2FXQA

Single-stranded dna-binding protein from thermus aquaticus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
227
structure length
197
Chain Sequence
RGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRSEVQVRAEFIDPLEGRRRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNERRTHFLEVQAWRELAEWASELRKGDGLLVIGRLVNDSWTSSSGERRFQTRVEALRLERPTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Structure of the single-stranded DNA-binding protein SSB from Thermus aquaticus.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 37
structure length 197
sequence length 227
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2fxqA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2fxqA02
1C0AA 1LUZA 2Q2UA 1CKNB 3KOJA 3NENA 1VQMA 1VQKA 3ZJYC 4DUYL 2ZJQA 4ME3A 3L7ZC 1MJEA 2UUBL 4A3IG 2QA4A 2PI2A 3BZKA 4OO1G 4IO9A 4NXNQ 1Q8KA 1W3SA 2F3IA 2BA1A 3HOZG 3RLOA 3L0OA 1G6PA 1GO3E 4AIMA 2IHEA 1TWFH 1FJGQ 1OXSC 2XGTA 3J80i 4HJ8A 1L2FA 4X6AH 2RHQB 4KLKA 1EOVA 4OWWB 3HOUG 1XMOL 3J81i 1LYLA 3RN5A 1J5EL 2UUAQ 2ASBA 2IHFA 1HNWL 2UXCL 3PIPA 1BVSA 3B6YA 3CP0A 4MNOA 1Q1EA 4BA1I 1WI5A 3HOVG 3RLFA 3AFPA 5FJ8G 4A3GG 4JC0A 3HOWG 1JT8A 1D7QA 1XNQQ 3K8AA 1IXRA 4DR2Q 1A0IA 1YNXA 2DUDA 4GN5A 3RNUA 4A3EH 4YCWA 2E5LL 4LF9L 1X55A 2VS1A 4PZ6A 2K75A 4UP7A 4JI1Q 4EX5A 2A19A 3I2ZA 3F2CA 4JI6Q 1L0WA 1MJCA 1YJWA 2AWOA 1SMXA 4DK3C 4B3TL 4QQBX 4GOPB 1HJPA 2CQOA 3JC66 2JA5H 3OTOQ 5JEAG 4GNXA 1HR0Q 1SLJA 3NBHB 4JI4Q 4DR6L 2D0PA 4X64L 4LFCL 3PUWA 3ICEA 1Z9FA 2B63H 2K5NA 2HHHQ 4BY7G 2LSSA 3PUZA 1X65A 4X66Q 3JAMc 2WB1G 3CCEA 3CPWA 3RR5A 3BU2A 4LF5Q 1VQJA 1IYJB 1UWVA 4A3DH 4JYAL 3CPFA 2UXCQ 3U4ZA 2YTVA 2B29A 4YCUA 4DV7Q 3ULPA 1XPRA 5C0XG 3S2DH 1WCMH 1AE2A 4OX9L 4R4QA 1HR0W 4L5SA 1E7ZA 2QEXA 4A3JH 1K83H 2GVBA 1CUKA 3PSIA 4DUZQ 1VQCA 4YHHQ 1SE8A 3ERSX 1RIPA 4A3BH 2E2HH 2D62A 4PZ8A 1OXUA 2OQ0A 3TQYA 5J3BA 1ASZA 2R93G 1FGUA 4C3JH 2LXJA 1QVFA 4QGUA 2UUCQ 3UDFA 4X65Q 4GN4B 1B8AA 1MIUA 1K8AC 1AE3A 4HJ5A 3PIOA 5DLQE 4DR1Q 1YITA 3GTKH 1OTCA 2IT1A 2OTLA 1XMQQ 4P71A 1S3OA 3KLWA 5M3FH 4HIMA 3RZDH 1IBKL 4B3RL 1I6HH 1VQ5A 2DGYA 5LMUL 1B70B 4DV4L 3M7NA 1VQNA 4QL5A 2K5VA 4IJLA 1YBYA 3G6EA 4A3FH 2CCZA 1EUJA 3HKZE 3I55A 1PFSA 2JA8G 1OXVA 1A62A 4POFA 1CKNA 2ZJPA 1Y1WH 1YI2A 3RZOH 1PH3A 3S16H 4O0AA 2MFIA 3H0GH 4JI5Q 4C2MH 2HIVA 2RCNA 1FVIA 4GKKL 4KHZA 5EAYA 4LF8L 3STBC 1D8LA 2R7ZG 4BBSH 4DV2L 3TEHB 1IBLQ 3GTQH 2VQFQ 5H1SE 3GTMH 3CC4A 3PO2H 3S15H 3H15A 1S72A 4KHPL 4A3KH 1VQHA 3KF6B 1JB7A 1YVCA 4PG3A 1YZ6A 2R92G 5IP7H 4HJ9A 3J7A5 5JEAJ 2WP8J 4GKJL 5FLXc 4LW1A 3M85A 1Q82C 4JI3L 1N34L 1X56A 4IPCA 4QIWE 5IY0A 5LMNQ 4GOPC 5E7NA 5M3MH 5C4JH 3BZCA 4AQYL 2Z0SA 2ZTEA 1KD1C 2JEAI 3AEVA 2Q2TA 5LMUQ 4DK6C 4R4OA 1Q46A 1N33L 1ASYA 4DKAC 3CCMA 3CMAA 4JI0L 3TRZA 1SROA 1RL2A 4DV3L 4A3MH 1I94Q 1HZCA 3K0XA 4R4IA 4HIKA 3F1ZA 5C0XJ 1NMFA 4DV5L 1EWIA 4R4CA 5GADC 1LTLA 1EYGA 2JEBI 4GLAC 3HOXH 4GOPA 4A3LH 1KL9A 1A63A 2PI2E 1P8LA 1TWCH 1WYDA 2CWAA 3EIVA 4JI7L 4K0KL 2Y0SG 4YWLA 2OTJA 4EQ5A 2OQKA 1NTGA 1Q86C 4YY3Q 5LMNW 1HNXQ 1XPUA 3PO3H 1Z47A 4IPGA 3GD7A 4LFAL 2PMZE 3HOYG 2KBNA 4A3EG 4MTNA 1S40A 4A4IA 4IOAA 3U58A 1IBML 4NXMQ 4P75A 1SFOH 4MZ9A 4GKJQ 1VQFA 4R1JA 4A93H 2UXDQ 4DR7L 1N34Q 1PYBA 2F4VL 2IX1A 2JA5G 3U50C 3EBEA 4GN3B 1HNZQ 1PV4A 2ZTCA 1Q7YC 5AJ3Q 4BBRH 2NZOA 4Y7NH 4HJAA 1N33Q 3AFQA 2KENA 2QGQA 3ER0A 4OWTB 3G71A 4HIDA 1A8VA 2B63G 4DR4Q 1TWGH 2VW9A 4X62Q 2CKZB 4IPHA 1PH5A 4HJ7A 4A3DG 4IFDI 4H02A 1VQAA 2A8VA 4LF4Q 4BA2I 1LM0A 3UE0A 2ZM6Q 2NVXH 5IT9c 1WCMG 1HZ9A 2JE6I 3W1GA 4DUYQ 1QVGA 2UUBQ 4A3JG 3GTPH 4JG2A 3T1HL 1UE7A 1Q81C 3E9IA 3M9BA 3GO5A 3AYHB 4JV5L 1NMGA 4A3BG 5HGQA 4GS3A 1P16A 2PQAB 2UXBL 1YJ9A 1QZHA 3GTGH 3UE1A 3BJUA 1KHIA 5IE8A 3I4MH 3M4OH 4DR7Q 3HFZB 3PUVA 3U4VA 3J80c 4KI0A 2UU9L 4ALPA 4AH6A 2I5MX 3J81c 1XMOQ 1PH1A 4NPSA 1N32L 1UEBA 1J5EQ 5IWAL 1HNWQ 1UE1A 5IYBH 3CQZH 5M3FG 3FHWA 1JJGA 2NVYH 1IZ6A 3EN2A 1XPOA 4LWCA 3KF6A 4A3FG 1JMCA 5ELOA 1IL2A 2E2JH 2N3SA 3A74A 2WB1E 1TWAH 2KCMA 4DV1L 5BR8L 1Y1WG 1O7IA 2I5HA 1XNRL 2VQEL 4LUOA 3PUXA 2GN5A 3CCJA 5C4XH 2E5LQ 4LF9Q 4WJ3M 3K7AH 4QJFA 3H0GG 1KRTA 1GM5A 4B3SL 3GTOH 2JA7H 3H3VI 4LUZA 1JJ2A 1VQLA 3M4PA 1VS0A 4B3TQ 3STBD 4BBSG 4UP9A 3WWVA 5C3EH 4DR3L 1EFWA 2JK8A 1K9MC 4JV5Q 3PO2G 4OXPA 2VNUD 1BBWA 1NE3A 1NBWA 4DR6Q 1VQEA 2IX0A 1WFQA 4JI8L 4X64Q 4LFCQ 4A3KG 1GD7A 2AWNA 3GDEA 1SR3A 4AYBG 3CC7A 3CCQA 1VQ7A 4JBKA 3GTLH 2EQSA 3S1QH 5IP7G 1MKHA 4LFBL 1L1OB 3CAMA 1NY4A 1WJJA 4LF6L 5C44H 3H3VH 4DR5L 4JYAQ 1E22A 5IWAQ 1PA6A 1GKHA 1T9HA 4UP8A 5M3MG 1N8RC 5JJKA 1Q12A 3T1YL 2AHOB 4OX9Q 2WAQG 1X54A 3TS0A 2ALYB 4L5TA 4QY7A 4JCVE 4A3MG 1VQ6A 4B3ML 1PHJA 1M90C 1VQ8A 3TREA 4BY1H 3HOXG 4A3LG 1KAWA 4L5RC 4TQUS 2MO1A 2MQHA 4P74A 5IP9H 3K81C 3ULLA 4A76A 1C9OA 1G291 3A5ZB 4LF7L 1E24A 5JJLA 1R9TH 1K73C 3PO3G 4Y52H 2K4KA 3I7FA 5IYDH 1HZAA 4TVAB 3UDIA 2KCTA 3KYHC 3CD6A 4PMWA 2VY3A 2Z6KC 1Y14B 2JA6H 4B3RQ 1IBKQ 3PF4A 4DV6L 4PZ7A 2NN6I 4DV7L 4JI2L 4O2DA 4DV4Q 1TWHH 4A93G 1K3RA 1NJIC 2I0QA 3S1NH 3SGIA 2H5XA 1B7YB 3RN2A 2XTIA 3KDFB 3LGJA 2Z6KA 4LUVA 4XTCS 4A3CH 1J6QA 1E3PA 3MEFA 4NXNL 4BBRG 1YHAA 3J7ZC 3M4QA 3AQQA 1CSPA 4GKKQ 2VL6A 2K14A 1Y1VH 2BH8A 2PQAA 2V1CC 4LF8Q 3PV0A 1YEZA 4XIGS 3I4NH 4JOIC 4DV2Q 3K80C 1X3GA 2IY5B 4C3HH 2VZAA 4IPDA 1N36L 1YHBA 1WOCA 3CMEA 2UUAL 3KF8B 4KHPQ 2E8GA 4LF7Q 3S17H 5FLMH 3S1MH 2ID0A 4UY8C 2HQLA 3A0JA 4FDBA 2Y0SE 1PH4A 1EQQA 1EIFA 3CCVA 1PH2A 2BH2A 2JJQA 3G4SA 4JI3Q 4APVA 4JOIA 1VQIA 1I3QH 3MXNB 4UPAA 4DR2L 2MNAA 1PH7A 1XNQL 4C3IH 2JA9A 2YU9H 2HT1A 4AQYQ 3FKIH 3DM3A 3E9HA 1C7YA 4IFDG 2MO0A 4JBMA 1VQBA 3I4MG 1X3FA 4JI0Q 4JI1L 4JI6L 4DV3Q 4HIOA 1PVOA 3PGZA 4RG1A 3CCSA 3HKSA 1YJNA 2NVTH 5IYCH 5GAEC 1L1OC 4DV5Q 2F52A 3OTOL 3CF5A 1EIYB 3CCLA 1HR0L 3KFUA 5IYBG 4JI4L 2RF4A 4JI7Q 4K0KQ 2YV5A 4WJ4A 2FXQA 1UE6A 1VQ4A 3W5OA 5M5YH 2HHHL 5ELNA 1VQOA 1PYSB 2VUMH 4OO1I 4LFAQ 4X66L 3JAMi 4P73A 3CCRA 5GQOA 4LF5L 1KC8C 1CKOA 1L1OA 1N36Q 1VQ9A 2YTYA 2AMCB 4YWKA 1IBMQ 2JQOA 3S14H 5C4XG 4IJHA 4BXXH 2JA7G 1VQPA 1QUQB 1AH9A 3NELA 2R6GA 2F4VQ 4YWMA 3S24A 4A3IH 3HOYH 1X6OA 2K52A 3KJOA 3S1RH 1CKMA 5C3EG 4DUZL 4GNXC 2ES2A 4YHHL 1KIXA 1OXTA 1K0RA 2I5LX 3D0FA 3IRBA 4DPGA 1JE5A 3I56A 5GAGC 1PH8A 3M3YH 3HOZH 3FP9A 2UUCL 2A1AA 2E2IH 5HY6A 4X65L 1E1TA 5C44G 3I4OA 3ULJA 4DR1L 1G51A 1OXXK 4DNIA 3CCUA 3HOUH 2KHIA 1XMQL 2Q2HA 1SRUA 3Q8DA 3HOVH 1TXYA 5M5WH 3J81j 4DV0L 2EXDA 5FJ8H 1XJVA 4A3GH 1BBUA 3HOWH 3F2DA 2CWPA 3T1HQ 4YCVA 1X9NA 1Q1BA 2GVAA 4L5QA 1QZGA 4BY1G 2N49A 1VQDA 4P72A 2BA0A 3KDFA 2UXBQ 4JI5L 5IP9G 3PF5A 2ZTDA 1SN8A 2D0OA 1DGSA 2UU9Q 4DAYB 5C0XI 1HH2P 3G48A 5IYDG 4IFDJ 3K7UC 1N32Q 1IBLL 1HZBA 1X3EA 2LXKA 2VQFL 2KHJA 2L15A 3W1BA 2JA6G 1CSQA 2YTXA 3A5UA 1EQRA 1U0LA 2EIFA 2R7FA 4BY7H 4AYBE 2PNHA 3HKZG 1K8GA 2AKWB 1KRSA 3L2PA 1UE5A 1V9PA 4DV1Q 4NB3A 5BR8Q 1W2BA 4GLVB 1XNRQ 5LMNL 2VQEQ 4A3CG 1BKBA 4R4TA 3RLNA 4DAMA 4B3SQ 4DV0Q 2R7DA 2NZHA 4LNQA 5K36G 1N9WA 1PH9A 2WAQE 1JJCB 5M5XH 1FL0A 1Y1VG 3D31A 5GROA 4GNXB 4JBJA 1I94L 1V43A 2NVQH 1VCIA 2NN6G 3I4NG 4DR3Q 1XTDA 1VQGA 5JJIA 3UDGA 5GAHC 2R93H 4JI8Q 4IOCA 5FLMG 1I50H 1YIJA 2ZJRA 4LFBQ 4YY3L 1HNXL 4LF6Q 2RHSB 4POGA 3PUYA 4DR5Q 3CC2A 4JBWA 2CFMA 3GTJH 4NXML 3E0EA 3FKIG 3T1YQ 1YHQA 3TS2A 4OONA 3OW2A 4GLXA 2N8NA 3CW2C 3CXCA 2UXDL 2JA8H 3OYYA 3KJPA 1FJGL 1QUQA 3NEMA 1KXLA 2C35B 4B3MQ 5IYCG 1GVPA 4A75A 1HNZL 3F8TA 1V1QA 1QVCA 3DLLA 1M1KC 1I5FA 5AJ3L 4RMFA 2WFWA 1U5KA 2K50A 1H95A 2N78A 2ATWA 4DR4L 2OWOA 2YYZA 2VUMG 3VDYA 1PH6A 4X62L 3S2HH 2R7ZH 1E1OA 4OWXB 2K5HA 3UDXA 4J15A 2B3GA 2HIXA 4LF4L 2OCEA 3PCOB 2Q2IA 4DV6Q 2ZM6L 1KQSA 4JI2Q 4BXXG 3F2BA 2R92H
chains in the Genus database with same CATH superfamily
1C0AA 2Q2UA 1VDZA 3NENA 1SYGA 4A3IG 1TY2A 1G2TA 1IW7D 5JJZA 2DJGC 4NXNQ 3J80E 1Q8KA 4FVMA 2P5ZX 2BA1A 3HOZG 3RLOA 1G6PA 1SXTA 3J80i 2A6HC 5I2YA 4XT1B 3D4RA 3TBIB 2UUAQ 2IHFA 5KNBA 3PIPA 1H9SB 1LTSD 1Q1EA 5K5PA 3N6RA 3QG1A 3RLFA 1IYUA 4K5VA 1D7QA 1H95A 3K8AA 4DR2Q 1ZKOA 1A0IA 2VB3X 4GN5A 3RNUA 2VXWA 3MFGA 3HP3A 4F87A 3F2CA 4EQOA 1EIHA 3I2ZA 1YJWA 1KNEA 1SYDA 2KCCA 4B3TL 2JA5H 5FOBB 1FNWA 5E4XA 1HR0Q 3R93A 4DR6L 5CYUA 3ICEA 2B63H 2K5NA 2LSSA 3JAMc 1CFMA 3BU2A 5D3DA 4Z9CB 1IYJB 4LF5Q 4A3DH 1U4MA 2F1MA 3CPFA 3ULPA 3S2DH 1SE4A 3KBXA 3R8BA 4R4QA 4RHRA 1HR0W 1E7ZA 1SNPA 1K83H 1PZKD 1CUKA 3DEPA 1VQCA 4V190 4YHHQ 1SE8A 1RIPA 1MHWC 1H9KA 3T4AC 4FO2A 4C3JH 1SJED 5FO9B 4Q5VA 3UDFA 4X65Q 3AMUA 5A2QE 1F9QA 1YITA 3GTKH 2JP1A 1OTCA 2IT1A 2DNCA 2OT2A 2HQEA 4P71A 1IBKL 4HIMA 4RCNA 1C4QA 3R2TA 1LTID 2JA5B 1B70B 1TS2A 3M7NA 1HQRD 1FGBD 4RGMA 2JA8G 3HOUB 3HKZE 1Y1WH 1QG7A 5CV4A 2B2TA 1YI2A 2B63B 3H0GH 4JI5Q 2HIVA 3HOWB 4LK1C 4TKOB 3H6MA 3IL8A 4ID6A 5EAYA 3STBC 2K05A 1S4ZA 3CC4A 3KF6B 1S5CD 1YVCA 2R92G 1EZ8A 4X3KA 4HJ9A 1GUGA 3TZUA 4QIWE 5LMNQ 2B2WA 5CGKA 5M3MH 5C4JH 3BZCA 4C3JB 2B2UA 2Z0SA 4AQYL 3AEVA 1Q46A 3SK6A 2WB1B 1ASYA 4DKAC 3CCMA 3CMAA 3GTKB 1RL2A 1BCPB 4A3MH 1I94Q 4HIKA 2KECA 1FNVA 4DV5L 2A6HD 1EYGA 4A3LH 4GLAC 1QNUA 3EIVA 2Y0SG 2OTJA 4EQ5A 1Q86C 5C3XA 2Z4HA 2X6GA 1HNXQ 5LMNW 1Y1WB 4IPGA 2FINB 2EJFC 2ZT9C 3HOYG 4A3EG 2HUGA 4A4IA 1G2SA 2Z9HA 4QB4A 3U58A 1KDCA 1SFOH 1MI2A 2IPKD 4OHJA 2UXDQ 1N34Q 2F4VL 3TZDA 3U50C 1J9OA 1RTNA 1HNZQ 4AYBB 5KRUA 2A5HA 4Y7NH 4HJAA 1X32A 3Q24A 4DR4Q 3G71A 4Q0FA 4X62Q 5M3MB 1PH5A 4IFDI 4H02A 1W6JA 1ICFB 2QKIC 2ZM6Q 4IUNA 5IT9c 4A3MB 2MUYA 4OEMB 1S5BD 1QVGA 3L9AX 3GTPH 3VR2A 2EXZA 4DK1A 3T1HL 3E9IA 1B50A 1Y8PB 4XT3B 1P16A 2PQAB 5IE8A 1O7YA 1U4RA 5I9PA 5KGUA 4DR7Q 2X69A 4KI0A 3I73A 1BCPF 5EGTA 1UEBA 1J5EQ 2EJGC 5IYBH 5EJWA 2NVYH 4KJNA 3CHBD 3FDTA 4CDEC 1XPOA 4LWCA 5ELOA 2N3SA 3A74A 2E76C 2H4OA 2KCMA 1BCPC 1O7IA 2I5HA 1WD0A 1XNRL 1DD2A 3LWUA 5EKIA 2ZXRA 4LF9Q 3PUXA 2GN5A 5C4XH 3K6OA 2Z6BA 2D5DA 1JJ2A 4DA2A 2F0NA 2F0KA 3NWSA 1LACA 1Q8IA 2F0PA 4UP9A 1R4QB 3STBD 5C3EH 1CK1A 4JV5Q 3PO2G 3D3RA 5IGBA 1NE3A 1NBWA 2IX0A 4K5WA 4A3KG 3CC7A 3CCQA 4JBKA 3GTPB 4B9XA 1MKHA 2L9HA 1NY4A 2FJ2A 2RKSA 1GKHA 2NTSA 3T1YL 3TMEA 2ALYB 1PRTB 3TS0A 1CA6A 3A8KE 1D1IA 1VQ6A 3TREA 3HOXG 1AFPA 1K28A 2E74C 4TQUS 4FXKC 4P74A 5IP9H 3Q0AA 1C9OA 3A5ZB 1O7LA 3PO3G 4Y52H 3I7FA 4NMZA 4A3BB 4BS9A 3UDIA 2J7ZA 1BO0A 2GA4B 1G91A 2Z6KC 2JA6H 3PF4A 4DV6L 1EU3A 3OIPA 1WTXA 5C3EB 1RHPA 5I4DA 2CH4A 1DOKA 1G8ZD 2MP1A 1A6XA 4XQQA 3KDFB 4LUVA 3TP5A 1HFNA 1E3PA 4NXNL 1YHAA 2EZVA 1T5XD 4UAIA 1O7ZA 2OEOA 1R4PB 2IY5B 5L37A 1YHBA 3A56A 2UUAL 1ESRA 2E8GA 3WOEA 4LF7Q 2F0EA 2NB0A 4UY8C 2HQLA 3HS0C 2Y0SE 3CCVA 1PH2A 1LV9A 4JI3Q 4F8MA 4DR2L 1BR9A 3FKIH 5JVH3 3E9HA 3KK7A 1B3QA 4IFDG 4O42A 3I4MG 1EQTA 1VQBA 1ICWA 4N8X1 1VMPA 3UI2A 1STEA 5JAVA 4HIOA 1RTOA 2JYOA 4RG1A 2F03A 1PFNA 1D2BA 1HR0L 5JPNC 3C1FA 2J0TD 5DNFA 2FXQA 1VQ4A 2LKVA 2BDOA 4OO1I 4LFAQ 3CCRA 4LF5L 1CKOA 1L1OA 5G3LF 4HN7A 2YTYA 4YWKA 1IBMQ 1BCPD 2JQOA 3S14H 1SNOA 3BDOA 4IJHA 4FYDA 2EYPA 1I4RA 1QUQB 2CH4W 4P2CB 3NELA 2R6GA 3S24A 4N9TA 1KLGD 4A3IH 4PMBA 1DJRD 1X6OA 2K52A 1CZGA 3IAYA 1CKMA 4YHHL 4R8IA 1K0RA 4DPGA 2O5IC 4A93B 3I56A 5GAGC 3HOZH 4KKTA 3FP9A 2ENBA 4X65L 1E1TA 3FPPA 3ULJA 2QF7A 4HMJA 2KHIA 1JQYD 5COYA 3Q8DA 2IX3A 2EXDA 1BBUA 4JVZA 4DU9A 1Q1BA 1BNZA 1RJTA 2N49A 1Q3LA 2XNAC 2UXBQ 1ILQA 4JI5L 3PF5A 2ZTDA 1GUNA 1KAAA 1QILA 2BDNA 2MGSA 1DGSA 2UU9Q 2K28A 5IYDG 3K7UC 4FF4A 1N32Q 1HZBA 1X3EA 2LXKA 5FLXE 1EQRA 4A3IB 2F0GA 4MHEA 5J39A 1KRSA 4N9PA 1UE5A 1X3PA 4GLVB 2OF1A 5LMNL 3HOZB 1LTTD 4EQPA 5IGGA 5T1IA 1SYFA 3IKJA 2NZHA 4LNQA 5K36G 2E2JB 1TWAB 4H44C 1I94L 2NVQH 1V1PA 1V43A 3I4NG 4OIKA 1XTDA 2F0JA 4C3HG 3K7AB 1EL0A 3UDGA 3RUZA 2FMCA 4ZQ3A 2ZJRA 1HNXL 4POGA 4JBWA 3E0JA 4C3IG 2EYFA 3CKIB 3E0EA 3TS2A 3LX0A 3S1QB 4KN7C 3T51B 3CW2C 2MPMA 2UXDL 2JA8H 5D65A 3TSSA 4B3MQ 5IYCG 1GVPA 2K32A 1HNZL 5A35A 1WTWA 2L11A 1M1KC 2WFWA 1LTBD 1I4XA 5C6AA 4DR4L 1PH6A 4X62L 2F0SA 2RCFA 3G6JB 1SNCA 3M7GA 3K58A 3R2IA 2ZM6L 4DV7Q 4EQNA 1SDFA 1Y8NB 2R92H 5IOCA 3KOJA 1VQKA 2ZJQA 2MJ8A 2PI2A 4OO1G 3VYTA 5G3LD 1DZ1A 1W3SA 2DJFC 1GO3E 5T1GA 4AIMA 3J81E 2IHEA 1B2TA 1FJGQ 1SJHD 2XGTA 3NE5B 4HJ8A 4KLKA 3J81i 4DAYA 3RN5A 1J5EL 2ASBA 4UDUC 3K5LA 1B9NA 3HOVG 5FJ8G 4A3GG 1JT8A 1EOTA 3A7LA 4L8JA 3HOYH 1IXRA 4ZCKA 4A3EH 2DUDA 3FRPB 4EGVA 4LF9L 4WFN3 1SAPA 2N55A 2LMCB 4RHSA 4C56C 1L0WA 1MJCA 3NWTA 5EPLA 3X3MA 3RD4A 1RODA 4GOPB 2YU9B 4RGNA 4GNXA 3NBHB 2R92B 3MZ5A 3JAML 1A2TA 1HCZA 5IGCA 2F0WA 4BY7G 2NVTB 4NW2A 4X66Q 5KYIA 3CPWA 1STYA 2UXCQ 3U4ZA 2YTVA 2B29A 4YCUA 4DNTB 1AE2A 1QCBD 2Z8LA 2J4XA 1EYCA 4MIUA 4L5SA 2QEXA 2GVBA 3PSIA 5IGDA 3ND8A 3ERSX 1D5ZC 2VB2X 2D62A 1J8IA 2RVLA 3TQYA 4QCLA 5J3BA 2R93G 1QVFA 3HOYB 4A3EB 1SYCA 4M1UB 1ENCA 4DR1Q 5CV8A 2OTLA 4ZUJA 1S3OA 3RZDH 5LMUL 3CRLC 2K5VA 3G6EA 2F0IA 2CCZA 1EUJA 1WTHA 4UHVA 3TDQA 3I55A 4K5XA 1B9MA 4X3SA 2MFIA 2IW3A 1TS5A 4C2MH 5C4ZA 3OSOA 1FVIA 2R7ZG 2BE5C 5DM73 3PO2H 3A8JE 4MN3A 5KEEA 3PIO3 1S72A 4FF3A 4A3KH 3QO2A 2NUCA 1MSHA 5F2DA 4OIJA 3J7A5 5JEAJ 4LW1A 3WDNA 4JI3L 4IPCA 5KIXA 1PYWD 4GOPC 4RA8A 1KD1C 1B53A 4O1NA 1N33L 3D4DA 3TRZA 1SROA 1EY8A 2KA7A 2HD3A 2PZWA 5C0XJ 2DN8A 4HR7B 3RZDB 1HHVA 1SE2A 2JEBI 3HOXH 1TWCH 1NCVA 2CWAA 3L3OC 4YWLA 1NTGA 3GV6A 1XPUA 3PO3H 4LFAL 3R3OA 1I50B 3VR3A 1IBML 4P75A 4MZ9A 4GKJQ 1VQFA 4R1JA 4WORA 3NTIA 5BN5A 4IUVA 3PO2B 1H9MA 3EBEA 4A3KB 3E3XA 3W2DA 2ZTCA 2NZOA 3GQBA 4HIDA 5CV9A 3H94A 2XRQD 1TWGH 1VQAA 2PZUA 2PO4A 1GXDC 1KNAA 4LF4Q 5IT9L 4BA2I 1SSOA 1CM9A 3A7AB 3S2HB 1HZ9A 2JE6I 3NQTA 4XYQA 4A3JG 3HOXB 1RDPD 4K6DA 1Q81C 4N8FA 1NMGA 2EOTA 2RBMA 4IFDH 2UXBL 3PO3B 3I4MH 1QZHA 2SDFA 1E2VA 2QCPX 3M4OH 3HFZB 3PUVA 3TP6A 3J80c 2UU9L 4AH6A 4PV1C 3FMCA 3ND9A 1PH1A 1N32L 3S9WA 4KK7A 5IWAL 1A3UA 1HNWQ 1BOSA 1UUPA 5M3FG 3OMCA 1FYCA 4KD4A 5E1FA 3KF6A 1F9RA 1FD7D 2B2YA 4RWSC 4LUOA 3CCJA 4WJ3M 4ZAIA 4QJFA 1KRTA 1GM5A 3GTOH 1MSGA 4LUZA 1K0SA 1JWMD 4BBSG 3NK9A 5CV7A 2PQEA 2BE5D 2VNUD 1BBWA 1VQEA 4X64Q 1WFQA 5BN4A 1WTQA 1VQ7A 1II3A 1UEAB 5IP7G 3CAMA 4IUTA 2A74C 4KV6A 4F88A 1E22A 1VF7A 4NKLA 4UP8A 1N8RC 2EVBA 3M4OB 5JJKA 3MXUA 4QY7A 4A3DB 1VMCA 1GHKA 2NTTA 3ONAB 1ENFA 1CHQD 4XDXA 4B3ML 4ODGA 5LHY1 3S2DB 2R61A 2MO1A 1TS4A 1K83B 1JB3A 4IZ8A 1C48A 4OELB 5IYDH 4KY5A 3KYHC 3GTOB 5CBEE 4B3RQ 4MTKA 4DV7L 4DV4Q 3AB9A 2I0QA 1PFBA 5EBCA 1K8OA 4ZKCB 1RF2D 2LY7A 3LGJA 2Z6KA 4XTCS 3PQIA 3VR5A 1J6QA 4KTAA 5K36H 2KEEA 3Q6SA 3LNNA 2VL6A 2BH8A 2PQAA 1ILPA 1YEZA 3I4NH 2BOSA 3K80C 4IALA 4C3HH 2VZAA 4IPDA 5EPJA 3H0GB 2XN9C 3KBGA 2K5WA 3SK5A 1M4VA 4KHPQ 1C8CA 3S1MH 1SNMA 4FDBA 4NDXA 1EQQA 4KKUA 3MAQA 1DM0B 3V2TA 2BH2A 3G4SA 2K33A 1E2WA 1WTRA 2MNAA 1HQMC 5DAUA 4C3IH 2JA9A 2HT1A 3T16A 2EY1A 2IJ0A 2MO0A 1X3FA 1KLUD 4DV3Q 3NSWA 3QOJA 1PVOA 3CCSA 5C4JB 5IYCH 1EIYB 3CCLA 3CF5A 2WAQB 5CORA 4K0KQ 4PQXA 1UE6A 2EJMA 5M5YH 1PYSB 5D14A 4X66L 1KABA 1K8MA 4P73A 5GQOA 1KC8C 1N36Q 4G7OC 4S3SA 1LABA 3X3NA 3FVQA 1GUOA 2JA7G 1TR5A 1VQPA 2O4XA 4C3HB 3KJOA 5ISRA 3S1RH 1SFOB 4OO1H 4DXGA 1IHZA 1LTRD 2A1AA 3J7AV 1AP0A 1H9JA 4C3IB 1FNUA 3I4OA 4DR1L 1OXXK 4DNIA 3CCUA 4Y7NB 3EVQA 1F9PA 4OGQC 3HOVH 4DV0L 1TS3A 5FJ8H 1XJVA 4A3GH 1U9RA 2CWPA 2SOBA 1X9NA 4BY1G 2F3VA 5M5YB 3KDFA 2E75C 2PYKA 1SN8A 4ZK9B 1WVLA 1K3BC 4ZUIA 1HFGA 2KHJA 2L15A 4KKSA 2YTXA 3A5UA 4BY7H 3S1RB 2A6EC 4XQJA 3L2PA 1PZJD 3MWYW 2B2TC 2NVYB 2VQEQ 4A3CG 1BKBA 4R4TA 3RLNA 4DAMA 4B3SQ 1STGA 1N9WA 2XWJB 1JJCB 5M5XH 2WINB 4JBJA 1VCIA 4DR3Q 5C4XB 1HA6A 3HOVB 5JJIA 2F0OA 2I46A 1CZWA 2R93H 4JI8Q 4A3GB 2H1EA 5FLMG 3C2PA 3URYA 4LFBQ 4LF6Q 2RHSB 4K6LA 1S5FD 4DR5Q 4DXFA 3GTJH 3SVMA 1QWYA 1YHQA 4KHVA 5EPKA 1MGSA 3BDLA 3KJPA 1QUQA 4I7AA 1KXLA 2C35B 2K03A 3QWNA 3F8TA 1U4LA 1V1QA 1QVCA 3DLLA 3SEBA 2PW5A 3BS1A 1I5FA 4BY7B 4RMFA 1WTVA 2L12A 2K50A 4U673 4G57A 2VUMG 3SE0A 2LS01 2R7ZH 3I8ZA 4YIJA 2B3GA 4LF4L 1GUTA 3PCOB 1EEFD 2Q2IA 5ELBA 1KTKA 5M5XB 3VYUA 4JI2Q 5I6WA 3EROA 4BXXG 1LUZA 1CKNB 1EU4A 4CGYB 1VQMA 3I4LA 4ME3A 3L7ZC 3AU7A 2JA6B 4DFAA 2QA4A 2R93B 2K5QA 3BZKA 1LLRD 3K5MA 3HKZB 3L0OA 1PFMA 1TWFH 1OXSC 1LT3D 3NPPA 4XXEA 2RHQB 4X6AH 3GTJB 1EOVA 3HOUG 1LYLA 1D6EC 1HNWL 3W3AA 5EBDA 3B6YA 3HOWG 3HG9A 4WJWA 2PZTA 1XNQQ 1TIID 3HRZC 3MC0B 5EKLA 2VS1A 4ME5A 2K75A 4FXGC 4EX5A 2A19A 2KEDA 2F0MA 4H0LC 4QIWB 4JI6Q 2R7ZB 3OWFA 4DK3C 4QQBX 1DCZA 2ZXOA 3NTKA 1AN8A 2HCIA 3FKIB 3QIAA 3QOLA 3OTOQ 2F0HA 1SLJA 4CHTB 2Z4IA 2D0PA 4X64L 3QR8A 5EKKA 3PUZA 2WB1G 2A6ED 1VQJA 1UWVA 3OW7A 4KMUC 5FK9C 1WTPA 1PXUA 2SNSA 1TWFB 1TKWB 1HTLD 1SE3A 3MVVA 2EY5A 1EY0A 4A3JH 4DUZQ 3S14B 2FMMA 2E2HH 2QW7A 1OXUA 3MHBA 2IWHA 3KLSX 4QGUA 2UUCQ 1PMRA 4GN4B 5JVG3 1MIUA 2M9VA 1K8AC 1AE3A 3PIOA 3I3CA 4RFBA 5CBAE 3KLWA 5M3FH 1GUSA 1ENAA 4LMQD 4B3RL 1I6HH 1VQ5A 1EWHA 1STAA 4DV4L 1VQNA 1F77A 3DUZA 4QL5A 1YBYA 3P1HA 4ILWA 1A62A 2R3ZA 3RZOH 1PH3A 4O0AA 4HSVA 5C5LA 4FP5D 2XWBB 3NTHA 1CI3M 1LO5D 4BBSH 2G5DA 3TEHB 1M8AA 3VR4A 3GTQH 2VQFQ 5H1SE 3S15H 3H15A 4KHPL 4TSSA 5E4WC 4A3JB 1YZ6A 5IP7H 2WP8J 5FLXc 1N34L 2E2HB 1GOZA 1I6VC 2F0TA 3I90A 4F7XA 1SNQA 2ZTEA 4DK6C 4R4OA 4CDFC 3OMGA 4DV3L 1HZCA 1JOKA 3A54A 2MHVA 1HPCA 3F1ZA 5M3FB 1I6HB 1EWIA 5KNDA 1LTLA 1G6ZA 4GOPA 3D4WA 1P8LA 5ELFA 4K0KL 3NBHA 2OQKA 3M4YA 2NVQB 1JCKB 1Z47A 1TVXA 1F9SA 2PMZE 4RGOS 2SNMA 3RZOB 2KBNA 1XWEA 1S40A 4IOAA 4NXMQ 4FXDA 5D3IB 4CKBA 1XX8A 4BBSB 4DR7L 3GTQB 2IX1A 1F2MA 2AQ2B 3OHXC 2O5JC 2L5TA 3QJYA 1Y8OB 4FNFA 1Q7YC 3FPUB 1L0YB 4QF4A 1Y69U 3AFQA 2JA8B 3I70A 2KENA 2EYLA 2QGQA 3ER0A 4OWTB 2CKZB 2HDMA 1ET9A 1YNNC 4IPHA 2RDGA 2DY7A 3UE0A 2NVXH 3HEJA 1WCMG 3SXHA 3W1GA 1VF5C 4DUYQ 2UUBQ 4JG2A 4RCOA 1LT4D 3M9BA 3MA2B 3GO5A 3AYHB 4JV5L 2D9UA 4A3BG 5HGQA 3U9OA 4FF2A 4HCSA 1OO9B 3U9SA 3GTGH 3MFYA 3UE1A 3J80L 3C1EA 4CJ1B 3U4VA 4ALPA 3J81c 1XMOQ 4NPSA 3VA7A 3BDCA 2Q8TA 1HTPA 1IZ6A 2F0QA 3EN2A 4A3FG 1JMCA 1EIGA 4HTHA 2WB1E 2N88A 2Y0SB 2VQEL 2E5LQ 2PPBC 5I6YA 3F2UA 4B3SL 2EY6A 3H3VI 2JA7H 4G7ZC 3M4PA 1VS0A 5J22A 5CMDA 1EFWA 4DR3L 2JK8A 4H7BA 2NVXB 3BZDB 2KOLA 4JI8L 2QDBA 4K8JA 4LFCQ 3GDEA 3GTLH 4LFBL 4LF6L 1WJJA 1CHPD 4DR5L 4JYAQ 1PA6A 3GTGB 1EEID 1T9HA 4OX9Q 1EQVA 4J6HA 4L5TA 4K8IA 1RKNA 2AQ1B 1PHJA 2K5DA 1M90C 1PDQA 4BY1H 3T53B 1NNXA 1KAWA 4FF1A 3NHHA 2MQHA 3RMHA 3NP8A 4LF7L 3ULLA 1G291 1PZID 4DF7A 2KCNA 5JJLA 1R9TH 1K73C 2AUJD 1QB5D 2K4KA 5A2QL 2KCTA 4PMWA 2VY3A 3IFTA 1Y14B 2NWGA 3VYSA 2JA7B 2F0UA 2NN6I 3K5NA 4JI2L 4O2DA 3VR6A 4A93G 1K3RA 1NJIC 3S1NH 2A69C 4R9WA 4A3CH 3MEFA 4BBRG 1EY4A 1GUWA 4GKKQ 1CSPA 1X3QA 4LF8Q 3PV0A 4XIGS 4JOIC 4DV2Q 1YNND 1WOCA 4C2MB 4RKBA 5JOBA 3CMEA 3KF8B 4M8AA 5FLMH 2HDLA 2ID0A 3A0JA 1EIFA 1IKLA 4KD3A 4BY1B 1DXMA 5EQ0A 1VQIA 2WIIB 1EY5A 1HA5A 3MXNB 4UPAA 1PH7A 1XNQL 3HGBA 4JBMA 3KLRA 5IODA 4JI0Q 4JI6L 1JORA 1KDBA 3HKSA 1IKMA 5GAEC 2F52A 3OTOL 4CDDC 4JI7Q 2RF4A 4V0BA 2YV5A 3GP7A 3JAME 3S1NB 4WJ4A 1A2UA 2AQ3B 4R8NA 2VUMH 1VQOA 2F0VA 1O78A 2FFKB 3JAMi 1B44D 2RA4A 1BBXC 4RH6A 4IUPA 1TWCB 1MD2D 4BXXH 2XVSA 5LL6X 2XRSD 5ELCA 4CKCA 4YWMA 5M9OA 2RQXA 1TT2A 4DUZL 1HXYD 4GNXC 1KIXA 1OXTA 1JE5A 4DAVA 2F0FA 2ICIA 2UUCL 2E2IH 5HY6A 3P7JA 5C44G 1PLFA 1I4HA 1SBBB 3HOUH 2DY8A 2A73B 2B2VC 3C3LA 1TWGB 3J81j 3BVMA 3N52A 3MXPA 3HOWH 3F2DA 2GVAA 1SYBA 1QZGA 3NUCA 1VQDA 4KY7A 2VUMB 2PMZB 1O80A 3CRKC 3A8IE 1B1ZA 3H91A 1HH2P 3G48A 5C0XI 4IFDJ 3SK4A 2VQFL 3W1BA 3I4MB 1CSQA 1V1OA 2EIFA 2O2LD 2PNHA 3WOFA 1EYDA 4QUFA 2E2DC 2V4DA 4DV1Q 5BR8Q 2A69D 1CQFA 2L4NA 2E2IB 2R7DA 2F0LA 4DNRB 1PH9A 3KUPA 4B08A 1Y1VG 2K1BA 4OL7A 2NN6G 4ZLTF 3OOCA 2PNRC 5GAHC 1WD1A 4IOCA 3DM1A 3SK8A 1YIJA 2A68C 3PUYA 1ZXTA 4TRDA 4J8QA 5NUCA 2CFMA 3EFXD 4NXML 3CU7A 1EYAA 3BYTB 1QJOA 4GLXA 1STHA 3K57A 1A3VA 1S5DD 3OYYA 2EYHA 2ICEC 1FJGL 5HURA 2WKDA 3NEMA 3K59A 2L0CA 1F2ZA 1JWUD 2C9OA 3NXWA 2M2LA 1U5KA 3DWAA 3OWEB 1QOHA 2N78A 4ZRZA 1TQOA 3VDYA 1NAPA 3SR1A 1DOLA 3UDXA 5IT9E 2HIXA 2OCEA 5KYLA 2KJXA 1KQSA 2PCFB 1D5XC 1STBA 3TN2A 3ZJYC 4DUYL 2UUBL 1MJEA 2HCCA 1BUVT 1ONLA 1T5EA 4CDCC 2SEBD 4IO9A 1UAPA 1BF4A 5TSSA 2F3IA 3H09A 5C5MA 1L2FA 5IIFA 2F3WA 4OWWB 5HGTA 1XMOL 2K7VA 2QEJC 1SEBD 2UXCL 2PW7A 1BVSA 5KNCA 3CP0A 4MNOA 4BA1I 1WI5A 3DXJC 1CT1D 4ULLA 4G7HC 3J7AF 3AFPA 3I4NB 4JC0A 3T13A 3KLSA 2KHSA 1NSNS 1GHJA 1YNXA 4E6IA 3D6CA 4YCWA 3S1MB 2E5LL 4QUCA 2K01A 3DWPA 1X55A 3GV3A 2WV6D 4PZ6A 4B9WA 4UP7A 4JI1Q 2AWOA 1SMXA 4ZKBB 1F2LA 1ML0D 1HJPA 2CQOA 3JC66 1AZQA 5JEAG 4CBVA 4JI4Q 3V05A 4LFCL 4G4KA 3PUWA 3PIP3 1Z9FA 2HHHQ 3CCEA 1X65A 1GJXA 2CVRA 4K14A 3RR5A 1BQQT 4JYAL 2B2YC 1I4PA 1D1KA 1XPRA 2B39A 5C0XG 1WCMH 4GZYC 4OX9L 1FR3A 1EWCA 5I9OA 1B3AA 2ZXPA 3E5SA 4X3UA 2CHBD 4I7ZC 4A3BH 4PZ8A 2OQ0A 1ASZA 1AEXA 1JICA 1DOMA 1FGUA 2LXJA 4IQZA 2QDLA 3OPOA 1B8AA 1SMYC 4HJ5A 5DLQE 2NZ1D 2A68D 1XMQQ 5J1ZA 1YNJC 2F0DA 3K0YA 2DGYA 1IL8A 1NUCA 2NBFA 4IJLA 4A3FH 3QB3A 4RAUC 1BDOA 1PFSA 1OXVA 4POFA 1CKNA 2ZJPA 3BG3A 1PTOH 1AW7A 2JN4A 3S16H 1Q90A 1XTCD 5C3WA 1LTGD 1JOQA 2RCNA 3ITPA 3VA5A 4DGZA 4KHZA 1LTAD 4GKKL 4LF8L 1JE4A 3I72A 1D8LA 2RSOA 5CV6A 4DV2L 1IBLQ 1JWSD 1WCMB 2F4IA 3GTMH 2B2WC 1QE6A 4DN4M 2B2UC 1VQHA 1JB7A 4PG3A 5FLXL 4GKJL 2B8FA 1LT6D 1L0XB 1TU2B 3DHQA 1X56A 4C1NK 3M85A 1Q82C 5IY0A 5E7NA 2JEAI 4J1MA 4EVOA 5LMUQ 2Q2TA 4JI0L 2NYZD 2L1BA 3K0XA 2KUMA 4R4IA 1NMFA 1D5MC 4R4CA 3EA6A 5GADC 2G9HD 1KL9A 1A63A 2PI2E 4JI7L 1WYDA 5AFWA 4A3FB 3ERQA 4YY3Q 1PTOB 3GD7A 3HZXA 3S16B 4MTNA 3V96A 5JPMC 1ZEQX 4A93H 1XXGA 1PYBA 3GTMB 2JA5G 4NP5A 4GN3B 4BWGB 1PV4A 4KN4C 5AJ3Q 2FHTA 4BBRH 1N33Q 4L63B 1KDAA 2EE1A 2EYJA 2G9DA 1EY6A 1A8VA 2B63G 2EPBA 1PRTF 4DK0A 2VW9A 3SDZA 5I2XA 4HJ7A 4A3DG 2A8VA 1LM0A 1B4OA 2DNEA 3ZYYX 4RGTA 1CQVA 1ZYRC 4LJZC 4ZYSA 2CW0C 1PRTC 3A55A 1UE7A 1SYEA 4GS3A 4CJ2C 1YJ9A 3BJUA 1KHIA 4C3JG 3J81L 2I5MX 3TP8A 1DYQA 1SMYD 1UE1A 3CQZH 1ET6A 3FHWA 1JJGA 2RDHA 5E3FA 1YNJD 4HCEA 1IL2A 2E2JH 1UNSA 1Z6HA 1JC7A 1PTOF 1TWAH 4DV1L 4BBRB 5BR8L 1Y1WG 2B8GA 2CQAA 3K7AH 3H0GG 4U68A 1VQLA 1ESFA 4B3TQ 3TP7A 4C1NI 3P20A 3WWVA 1PTOC 3NQIA 1K9MC 4OXPA 4XQNA 4DR6Q 1WTOA 2I07B 1GD7A 2AWNA 1SR3A 4AYBG 1RD9D 2EQSA 2L55A 3IFDA 3S1QH 1Z7TA 1L1OB 3SHLA 5C44H 3H3VH 2BCOA 5BN3A 5IWAQ 2AUKA 2KVMA 5M3MG 2XIWA 1Q12A 2EYOA 2AHOB 4H13C 4CKEA 1HUMA 1A3TA 1X54A 2WAQG 2Q8IB 1IYVA 4X3TA 2K04A 1NR2A 5C4HA 3MEHA 2TSSA 4JCVE 4A3MG 5ELDA 3OIQA 3CQZB 1VQ8A 3DWQA 4K2LA 4A3LG 4CJ0B 2QILA 4L5RC 3K81C 1QNKA 4A76A 5IGEA 1E24A 4IN3A 3FEWX 3T56B 5FO8B 3BVGA 3EQLC 5IGFA 1TY0A 1HZAA 4TVAB 3G7LA 3CD6A 1IBKQ 3D6WA 3NBIA 4PZ7A 3DEOA 2JSOA 1TWHH 3SGIA 2H5XA 3P75A 1B7YB 3RN2A 2XTIA 2EYMA 4DAPA 3J7ZC 3M4QA 5C44B 3AQQA 2K14A 1Y1VH 2V1CC 2NN6H 1X3GA 4JW0A 1N36L 2EDGA 2TMPA 5CC4A 1XYIA 3O13A 1A15A 2RSNA 3S17H 1PH4A 1ZYRD 3Q22A 4PMCA 2JJQA 1S5ED 1EFID 4JOIA 4APVA 3S15B 1I3QH 1PRTD 2CW0D 3LWEA 3MXGA 2YU9H 4AQYQ 3C46A 3DM3A 5FO7B 1C7YA 1F2YA 1V1PB 4KJOA 4JI1L 1SNDA 3PGZA 1YJNA 2NVTH 4DV5Q 1L1OC 3KFUA 5IYBG 3BVZA 1TWHB 4JI4L 3W5OA 2JXMB 5ELNA 2HHHL 4IUQA 1VQ9A 4IUUA 2AMCB 1AZPA 1STNA 5C4XG 1Y1VB 4K2KA 1AH9A 4I65A 4IURA 2F4VQ 4QMGA 4XYOA 1RCVD 2ES2A 5C3EG 4WRDA 3S17B 1IW7C 1PTOD 1HRJA 2I5LX 3D0FA 3IRBA 5FKAC 3Q23A 3E6ZX 1PH8A 3M3YH 1W6KA 1I3QB 2LFNA 2WACA 1HUNA 1G51A 2C5CA 4L6TB 1CA5A 1E2ZA 1XMQL 3D8GA 2Q2HA 4ABNA 1SRUA 1TXYA 5M5WH 2D2CC 4LAAA 3H3VC 3T1HQ 4YCVA 5CV5A 4L5QA 5DEHA 4KY6A 4HSPA 4JK1C 4P72A 2BA0A 4JPBW 2B2VA 5IP9G 3J7YW 2D0OA 2Z1CA 4DAYB 2Q8RE 5DM63 5JEAH 1IBLL 1CTMA 2JA6G 2M00A 4RKLA 4PNYA 1U0LA 2R7FA 3KF8A 3PMFA 4AYBE 1K8GA 3HKZG 5ELEA 2OXPA 2AKWB 2WKCA 4HEDA 1V9PA 4NB3A 1W2BA 1MBYA 1XNRQ 3M3YB 1E0BA 1I4GA 3MXNA 5C0XH 4DV0Q 2WAQE 3VYRA 1FL0A 3K5OA 2XSCA 3D31A 5GROA 4GNXB 1EY9A 1LT5D 3MTSA 3DMUA 1VQGA 2EY2A 2KQ3A 5M5WB 5LL6S 1I50H 1NR4A 4YY3L 1EY7A 2RDFA 2K6AA 1DONA 3CC2A 2X6LA 3T1YQ 1JR0D 3FKIG 1BXTA 3GTLB 4OONA 3OW2A 3EJIA 2N8NA 3I91A 3CXCA 1H9SA 1JOOA 1I4QA 1EZ6A 4A75A 5AJ3L 1V8QA 4HMIA 2ATWA 2OWOA 2YYZA 4HAEA 2IL8A 3S2HH 1E1OA 4OWXB 2K5HA 4J15A 5CR3A 3BYYB 4DV6Q 1U4PA 1R9TB 1H9RA 3F2BA
chains in the Genus database with same CATH topology
1C0AA 1LUZA 2Q2UA 1CKNB 3KOJA 3NENA 1VQMA 1VQKA 3ZJYC 4DUYL 2ZJQA 4ME3A 3L7ZC 1MJEA 2UUBL 4A3IG 2QA4A 2PI2A 3BZKA 4OO1G 4IO9A 4NXNQ 1Q8KA 1W3SA 2F3IA 2BA1A 3HOZG 3RLOA 3L0OA 1G6PA 1GO3E 4AIMA 2IHEA 1TWFH 1FJGQ 1OXSC 2XGTA 3J80i 4HJ8A 1L2FA 4X6AH 2RHQB 4KLKA 1EOVA 4OWWB 3HOUG 1XMOL 3J81i 1LYLA 3RN5A 1J5EL 2UUAQ 2ASBA 2IHFA 1HNWL 2UXCL 3PIPA 1BVSA 3B6YA 3CP0A 4MNOA 1Q1EA 4BA1I 1WI5A 3HOVG 3RLFA 3AFPA 5FJ8G 4A3GG 4JC0A 3HOWG 1JT8A 1D7QA 1XNQQ 3K8AA 1IXRA 4DR2Q 1A0IA 1YNXA 2DUDA 4GN5A 3RNUA 4A3EH 4YCWA 2E5LL 4LF9L 1X55A 2VS1A 4PZ6A 2K75A 4UP7A 4JI1Q 4EX5A 2A19A 3I2ZA 3F2CA 4JI6Q 1L0WA 1MJCA 1YJWA 2AWOA 1SMXA 4DK3C 4B3TL 4QQBX 4GOPB 1HJPA 2CQOA 3JC66 2JA5H 3OTOQ 5JEAG 4GNXA 1HR0Q 1SLJA 3NBHB 4JI4Q 4DR6L 2D0PA 4X64L 4LFCL 3PUWA 3ICEA 1Z9FA 2B63H 2K5NA 2HHHQ 4BY7G 2LSSA 3PUZA 1X65A 4X66Q 3JAMc 2WB1G 3CCEA 3CPWA 3RR5A 3BU2A 4LF5Q 1VQJA 1IYJB 1UWVA 4A3DH 4JYAL 3CPFA 2UXCQ 3U4ZA 2YTVA 2B29A 4YCUA 4DV7Q 3ULPA 1XPRA 5C0XG 3S2DH 1WCMH 1AE2A 4OX9L 4R4QA 1HR0W 4L5SA 1E7ZA 2QEXA 4A3JH 1K83H 2GVBA 1CUKA 3PSIA 4DUZQ 1VQCA 4YHHQ 1SE8A 3ERSX 1RIPA 4A3BH 2E2HH 2D62A 4PZ8A 1OXUA 2OQ0A 3TQYA 5J3BA 1ASZA 2R93G 1FGUA 4C3JH 2LXJA 1QVFA 4QGUA 2UUCQ 3UDFA 4X65Q 4GN4B 1B8AA 1MIUA 1K8AC 1AE3A 4HJ5A 3PIOA 5DLQE 4DR1Q 1YITA 3GTKH 1OTCA 2IT1A 2OTLA 1XMQQ 4P71A 1S3OA 3KLWA 5M3FH 4HIMA 3RZDH 1IBKL 4B3RL 1I6HH 1VQ5A 2DGYA 5LMUL 1B70B 4DV4L 3M7NA 1VQNA 4QL5A 2K5VA 4IJLA 1YBYA 3G6EA 4A3FH 2CCZA 1EUJA 3HKZE 3I55A 1PFSA 2JA8G 1OXVA 1A62A 4POFA 1CKNA 2ZJPA 1Y1WH 1YI2A 3RZOH 1PH3A 3S16H 4O0AA 2MFIA 3H0GH 4JI5Q 4C2MH 2HIVA 2RCNA 1FVIA 4GKKL 4KHZA 5EAYA 4LF8L 3STBC 1D8LA 2R7ZG 4BBSH 4DV2L 3TEHB 1IBLQ 3GTQH 2VQFQ 5H1SE 3GTMH 3CC4A 3PO2H 3S15H 3H15A 1S72A 4KHPL 4A3KH 1VQHA 3KF6B 1JB7A 1YVCA 4PG3A 1YZ6A 2R92G 5IP7H 4HJ9A 3J7A5 5JEAJ 2WP8J 4GKJL 5FLXc 4LW1A 3M85A 1Q82C 4JI3L 1N34L 1X56A 4IPCA 4QIWE 5IY0A 5LMNQ 4GOPC 5E7NA 5M3MH 5C4JH 3BZCA 4AQYL 2Z0SA 2ZTEA 1KD1C 2JEAI 3AEVA 2Q2TA 5LMUQ 4DK6C 4R4OA 1Q46A 1N33L 1ASYA 4DKAC 3CCMA 3CMAA 4JI0L 3TRZA 1SROA 1RL2A 4DV3L 4A3MH 1I94Q 1HZCA 3K0XA 4R4IA 4HIKA 3F1ZA 5C0XJ 1NMFA 4DV5L 1EWIA 4R4CA 5GADC 1LTLA 1EYGA 2JEBI 4GLAC 3HOXH 4GOPA 4A3LH 1KL9A 1A63A 2PI2E 1P8LA 1TWCH 1WYDA 2CWAA 3EIVA 4JI7L 4K0KL 2Y0SG 4YWLA 2OTJA 4EQ5A 2OQKA 1NTGA 1Q86C 4YY3Q 5LMNW 1HNXQ 1XPUA 3PO3H 1Z47A 4IPGA 3GD7A 4LFAL 2PMZE 3HOYG 2KBNA 4A3EG 4MTNA 1S40A 4A4IA 4IOAA 3U58A 1IBML 4NXMQ 4P75A 1SFOH 4MZ9A 4GKJQ 1VQFA 4R1JA 4A93H 2UXDQ 4DR7L 1N34Q 1PYBA 2F4VL 2IX1A 2JA5G 3U50C 3EBEA 4GN3B 1HNZQ 1PV4A 2ZTCA 1Q7YC 5AJ3Q 4BBRH 2NZOA 4Y7NH 4HJAA 1N33Q 3AFQA 2KENA 2QGQA 3ER0A 4OWTB 3G71A 4HIDA 1A8VA 2B63G 4DR4Q 1TWGH 2VW9A 4X62Q 2CKZB 4IPHA 1PH5A 4HJ7A 4A3DG 4IFDI 4H02A 1VQAA 2A8VA 4LF4Q 4BA2I 1LM0A 3UE0A 2ZM6Q 2NVXH 5IT9c 1WCMG 1HZ9A 2JE6I 3W1GA 4DUYQ 1QVGA 2UUBQ 4A3JG 3GTPH 4JG2A 3T1HL 1UE7A 1Q81C 3E9IA 3M9BA 3GO5A 3AYHB 4JV5L 1NMGA 4A3BG 5HGQA 4GS3A 1P16A 2PQAB 2UXBL 1YJ9A 1QZHA 3GTGH 3UE1A 3BJUA 1KHIA 5IE8A 3I4MH 3M4OH 4DR7Q 3HFZB 3PUVA 3U4VA 3J80c 4KI0A 2UU9L 4ALPA 4AH6A 2I5MX 3J81c 1XMOQ 1PH1A 4NPSA 1N32L 1UEBA 1J5EQ 5IWAL 1HNWQ 1UE1A 5IYBH 3CQZH 5M3FG 3FHWA 1JJGA 2NVYH 1IZ6A 3EN2A 1XPOA 4LWCA 3KF6A 4A3FG 1JMCA 5ELOA 1IL2A 2E2JH 2N3SA 3A74A 2WB1E 1TWAH 2KCMA 4DV1L 5BR8L 1Y1WG 1O7IA 2I5HA 1XNRL 2VQEL 4LUOA 3PUXA 2GN5A 3CCJA 5C4XH 2E5LQ 4LF9Q 4WJ3M 3K7AH 4QJFA 3H0GG 1KRTA 1GM5A 4B3SL 3GTOH 2JA7H 3H3VI 4LUZA 1JJ2A 1VQLA 3M4PA 1VS0A 4B3TQ 3STBD 4BBSG 4UP9A 3WWVA 5C3EH 4DR3L 1EFWA 2JK8A 1K9MC 4JV5Q 3PO2G 4OXPA 2VNUD 1BBWA 1NE3A 1NBWA 4DR6Q 1VQEA 2IX0A 1WFQA 4JI8L 4X64Q 4LFCQ 4A3KG 1GD7A 2AWNA 3GDEA 1SR3A 4AYBG 3CC7A 3CCQA 1VQ7A 4JBKA 3GTLH 2EQSA 3S1QH 5IP7G 1MKHA 4LFBL 1L1OB 3CAMA 1NY4A 1WJJA 4LF6L 5C44H 3H3VH 4DR5L 4JYAQ 1E22A 5IWAQ 1PA6A 1GKHA 1T9HA 4UP8A 5M3MG 1N8RC 5JJKA 1Q12A 3T1YL 2AHOB 4OX9Q 2WAQG 1X54A 3TS0A 2ALYB 4L5TA 4QY7A 4JCVE 4A3MG 1VQ6A 4B3ML 1PHJA 1M90C 1VQ8A 3TREA 4BY1H 3HOXG 4A3LG 1KAWA 4L5RC 4TQUS 2MO1A 2MQHA 4P74A 5IP9H 3K81C 3ULLA 4A76A 1C9OA 1G291 3A5ZB 4LF7L 1E24A 5JJLA 1R9TH 1K73C 3PO3G 4Y52H 2K4KA 3I7FA 5IYDH 1HZAA 4TVAB 3UDIA 2KCTA 3KYHC 3CD6A 4PMWA 2VY3A 2Z6KC 1Y14B 2JA6H 4B3RQ 1IBKQ 3PF4A 4DV6L 4PZ7A 2NN6I 4DV7L 4JI2L 4O2DA 4DV4Q 1TWHH 4A93G 1K3RA 1NJIC 2I0QA 3S1NH 3SGIA 2H5XA 1B7YB 3RN2A 2XTIA 3KDFB 3LGJA 2Z6KA 4LUVA 4XTCS 4A3CH 1J6QA 1E3PA 3MEFA 4NXNL 4BBRG 1YHAA 3J7ZC 3M4QA 3AQQA 1CSPA 4GKKQ 2VL6A 2K14A 1Y1VH 2BH8A 2PQAA 2V1CC 4LF8Q 3PV0A 1YEZA 4XIGS 3I4NH 4JOIC 4DV2Q 3K80C 1X3GA 2IY5B 4C3HH 2VZAA 4IPDA 1N36L 1YHBA 1WOCA 3CMEA 2UUAL 3KF8B 4KHPQ 2E8GA 4LF7Q 3S17H 5FLMH 3S1MH 2ID0A 4UY8C 2HQLA 3A0JA 4FDBA 2Y0SE 1PH4A 1EQQA 1EIFA 3CCVA 1PH2A 2BH2A 2JJQA 3G4SA 4JI3Q 4APVA 4JOIA 1VQIA 1I3QH 3MXNB 4UPAA 4DR2L 2MNAA 1PH7A 1XNQL 4C3IH 2JA9A 2YU9H 2HT1A 4AQYQ 3FKIH 3DM3A 3E9HA 1C7YA 4IFDG 2MO0A 4JBMA 1VQBA 3I4MG 1X3FA 4JI0Q 4JI1L 4JI6L 4DV3Q 4HIOA 1PVOA 3PGZA 4RG1A 3CCSA 3HKSA 1YJNA 2NVTH 5IYCH 5GAEC 1L1OC 4DV5Q 2F52A 3OTOL 3CF5A 1EIYB 3CCLA 1HR0L 3KFUA 5IYBG 4JI4L 2RF4A 4JI7Q 4K0KQ 2YV5A 4WJ4A 2FXQA 1UE6A 1VQ4A 3W5OA 5M5YH 2HHHL 5ELNA 1VQOA 1PYSB 2VUMH 4OO1I 4LFAQ 4X66L 3JAMi 4P73A 3CCRA 5GQOA 4LF5L 1KC8C 1CKOA 1L1OA 1N36Q 1VQ9A 2YTYA 2AMCB 4YWKA 1IBMQ 2JQOA 3S14H 5C4XG 4IJHA 4BXXH 2JA7G 1VQPA 1QUQB 1AH9A 3NELA 2R6GA 2F4VQ 4YWMA 3S24A 4A3IH 3HOYH 1X6OA 2K52A 3KJOA 3S1RH 1CKMA 5C3EG 4DUZL 4GNXC 2ES2A 4YHHL 1KIXA 1OXTA 1K0RA 2I5LX 3D0FA 3IRBA 4DPGA 1JE5A 3I56A 5GAGC 1PH8A 3M3YH 3HOZH 3FP9A 2UUCL 2A1AA 2E2IH 5HY6A 4X65L 1E1TA 5C44G 3I4OA 3ULJA 4DR1L 1G51A 1OXXK 4DNIA 3CCUA 3HOUH 2KHIA 1XMQL 2Q2HA 1SRUA 3Q8DA 3HOVH 1TXYA 5M5WH 3J81j 4DV0L 2EXDA 5FJ8H 1XJVA 4A3GH 1BBUA 3HOWH 3F2DA 2CWPA 3T1HQ 4YCVA 1X9NA 1Q1BA 2GVAA 4L5QA 1QZGA 4BY1G 2N49A 1VQDA 4P72A 2BA0A 3KDFA 2UXBQ 4JI5L 5IP9G 3PF5A 2ZTDA 1SN8A 2D0OA 1DGSA 2UU9Q 4DAYB 5C0XI 1HH2P 3G48A 5IYDG 4IFDJ 3K7UC 1N32Q 1IBLL 1HZBA 1X3EA 2LXKA 2VQFL 2KHJA 2L15A 3W1BA 2JA6G 1CSQA 2YTXA 3A5UA 1EQRA 1U0LA 2EIFA 2R7FA 4BY7H 4AYBE 2PNHA 3HKZG 1K8GA 2AKWB 1KRSA 3L2PA 1UE5A 1V9PA 4DV1Q 4NB3A 5BR8Q 1W2BA 4GLVB 1XNRQ 5LMNL 2VQEQ 4A3CG 1BKBA 4R4TA 3RLNA 4DAMA 4B3SQ 4DV0Q 2R7DA 2NZHA 4LNQA 5K36G 1N9WA 1PH9A 2WAQE 1JJCB 5M5XH 1FL0A 1Y1VG 3D31A 5GROA 4GNXB 4JBJA 1I94L 1V43A 2NVQH 1VCIA 2NN6G 3I4NG 4DR3Q 1XTDA 1VQGA 5JJIA 3UDGA 5GAHC 2R93H 4JI8Q 4IOCA 5FLMG 1I50H 1YIJA 2ZJRA 4LFBQ 4YY3L 1HNXL 4LF6Q 2RHSB 4POGA 3PUYA 4DR5Q 3CC2A 4JBWA 2CFMA 3GTJH 4NXML 3E0EA 3FKIG 3T1YQ 1YHQA 3TS2A 4OONA 3OW2A 4GLXA 2N8NA 3CW2C 3CXCA 2UXDL 2JA8H 3OYYA 3KJPA 1FJGL 1QUQA 3NEMA 1KXLA 2C35B 4B3MQ 5IYCG 1GVPA 4A75A 1HNZL 3F8TA 1V1QA 1QVCA 3DLLA 1M1KC 1I5FA 5AJ3L 4RMFA 2WFWA 1U5KA 2K50A 1H95A 2N78A 2ATWA 4DR4L 2OWOA 2YYZA 2VUMG 3VDYA 1PH6A 4X62L 3S2HH 2R7ZH 1E1OA 4OWXB 2K5HA 3UDXA 4J15A 2B3GA 2HIXA 4LF4L 2OCEA 3PCOB 2Q2IA 4DV6Q 2ZM6L 1KQSA 4JI2Q 4BXXG 3F2BA 2R92H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C0A A;  1LUZ A;  2Q2U A;  1CKN B;  3KOJ A;  3NEN A;  1VQM A;  1VQK A;  3ZJY C;  4DUY L;  2ZJQ A;  4ME3 A;  3L7Z C;  1MJE A;  2UUB L;  4A3I G;  2QA4 A;  2PI2 A;  3BZK A;  4OO1 G;  4IO9 A;  4NXN Q;  1Q8K A;  1W3S A;  2F3I A;  2BA1 A;  3HOZ G;  3RLO A;  3L0O A;  1G6P A;  1GO3 E;  4AIM A;  2IHE A;  1TWF H;  1FJG Q;  1OXS C;  2XGT A;  3J80 i;  4HJ8 A;  1L2F A;  4X6A H;  2RHQ B;  4KLK A;  1EOV A;  4OWW B;  3HOU G;  1XMO L;  3J81 i;  1LYL A;  3RN5 A;  1J5E L;  2UUA Q;  2ASB A;  2IHF A;  1HNW L;  2UXC L;  3PIP A;  1BVS A;  3B6Y A;  3CP0 A;  4MNO A;  1Q1E A;  4BA1 I;  1WI5 A;  3HOV G;  3RLF A;  3AFP A;  5FJ8 G;  4A3G G;  4JC0 A;  3HOW G;  1JT8 A;  1D7Q A;  1XNQ Q;  3K8A A;  1IXR A;  4DR2 Q;  1A0I A;  1YNX A;  2DUD A;  4GN5 A;  3RNU A;  4A3E H;  4YCW A;  2E5L L;  4LF9 L;  1X55 A;  2VS1 A;  4PZ6 A;  2K75 A;  4UP7 A;  4JI1 Q;  4EX5 A;  2A19 A;  3I2Z A;  3F2C A;  4JI6 Q;  1L0W A;  1MJC A;  1YJW A;  2AWO A;  1SMX A;  4DK3 C;  4B3T L;  4QQB X;  4GOP B;  1HJP A;  2CQO A;  3JC6 6;  2JA5 H;  3OTO Q;  5JEA G;  4GNX A;  1HR0 Q;  1SLJ A;  3NBH B;  4JI4 Q;  4DR6 L;  2D0P A;  4X64 L;  4LFC L;  3PUW A;  3ICE A;  1Z9F A;  2B63 H;  2K5N A;  2HHH Q;  4BY7 G;  2LSS A;  3PUZ A;  1X65 A;  4X66 Q;  3JAM c;  2WB1 G;  3CCE A;  3CPW A;  3RR5 A;  3BU2 A;  4LF5 Q;  1VQJ A;  1IYJ B;  1UWV A;  4A3D H;  4JYA L;  3CPF A;  2UXC Q;  3U4Z A;  2YTV A;  2B29 A;  4YCU A;  4DV7 Q;  3ULP A;  1XPR A;  5C0X G;  3S2D H;  1WCM H;  1AE2 A;  4OX9 L;  4R4Q A;  1HR0 W;  4L5S A;  1E7Z A;  2QEX A;  4A3J H;  1K83 H;  2GVB A;  1CUK A;  3PSI A;  4DUZ Q;  1VQC A;  4YHH Q;  1SE8 A;  3ERS X;  1RIP A;  4A3B H;  2E2H H;  2D62 A;  4PZ8 A;  1OXU A;  2OQ0 A;  3TQY A;  5J3B A;  1ASZ A;  2R93 G;  1FGU A;  4C3J H;  2LXJ A;  1QVF A;  4QGU A;  2UUC Q;  3UDF A;  4X65 Q;  4GN4 B;  1B8A A;  1MIU A;  1K8A C;  1AE3 A;  4HJ5 A;  3PIO A;  5DLQ E;  4DR1 Q;  1YIT A;  3GTK H;  1OTC A;  2IT1 A;  2OTL A;  1XMQ Q;  4P71 A;  1S3O A;  3KLW A;  5M3F H;  4HIM A;  3RZD H;  1IBK L;  4B3R L;  1I6H H;  1VQ5 A;  2DGY A;  5LMU L;  1B70 B;  4DV4 L;  3M7N A;  1VQN A;  4QL5 A;  2K5V A;  4IJL A;  1YBY A;  3G6E A;  4A3F H;  2CCZ A;  1EUJ A;  3HKZ E;  3I55 A;  1PFS A;  2JA8 G;  1OXV A;  1A62 A;  4POF A;  1CKN A;  2ZJP A;  1Y1W H;  1YI2 A;  3RZO H;  1PH3 A;  3S16 H;  4O0A A;  2MFI A;  3H0G H;  4JI5 Q;  4C2M H;  2HIV A;  2RCN A;  1FVI A;  4GKK L;  4KHZ A;  5EAY A;  4LF8 L;  3STB C;  1D8L A;  2R7Z G;  4BBS H;  4DV2 L;  3TEH B;  1IBL Q;  3GTQ H;  2VQF Q;  5H1S E;  3GTM H;  3CC4 A;  3PO2 H;  3S15 H;  3H15 A;  1S72 A;  4KHP L;  4A3K H;  1VQH A;  3KF6 B;  1JB7 A;  1YVC A;  4PG3 A;  1YZ6 A;  2R92 G;  5IP7 H;  4HJ9 A;  3J7A 5;  5JEA J;  2WP8 J;  4GKJ L;  5FLX c;  4LW1 A;  3M85 A;  1Q82 C;  4JI3 L;  1N34 L;  1X56 A;  4IPC A;  4QIW E;  5IY0 A;  5LMN Q;  4GOP C;  5E7N A;  5M3M H;  5C4J H;  3BZC A;  4AQY L;  2Z0S A;  2ZTE A;  1KD1 C;  2JEA I;  3AEV A;  2Q2T A;  5LMU Q;  4DK6 C;  4R4O A;  1Q46 A;  1N33 L;  1ASY A;  4DKA C;  3CCM A;  3CMA A;  4JI0 L;  3TRZ A;  1SRO A;  1RL2 A;  4DV3 L;  4A3M H;  1I94 Q;  1HZC A;  3K0X A;  4R4I A;  4HIK A;  3F1Z A;  5C0X J;  1NMF A;  4DV5 L;  1EWI A;  4R4C A;  5GAD C;  1LTL A;  1EYG A;  2JEB I;  4GLA C;  3HOX H;  4GOP A;  4A3L H;  1KL9 A;  1A63 A;  2PI2 E;  1P8L A;  1TWC H;  1WYD A;  2CWA A;  3EIV A;  4JI7 L;  4K0K L;  2Y0S G;  4YWL A;  2OTJ A;  4EQ5 A;  2OQK A;  1NTG A;  1Q86 C;  4YY3 Q;  5LMN W;  1HNX Q;  1XPU A;  3PO3 H;  1Z47 A;  4IPG A;  3GD7 A;  4LFA L;  2PMZ E;  3HOY G;  2KBN A;  4A3E G;  4MTN A;  1S40 A;  4A4I A;  4IOA A;  3U58 A;  1IBM L;  4NXM Q;  4P75 A;  1SFO H;  4MZ9 A;  4GKJ Q;  1VQF A;  4R1J A;  4A93 H;  2UXD Q;  4DR7 L;  1N34 Q;  1PYB A;  2F4V L;  2IX1 A;  2JA5 G;  3U50 C;  3EBE A;  4GN3 B;  1HNZ Q;  1PV4 A;  2ZTC A;  1Q7Y C;  5AJ3 Q;  4BBR H;  2NZO A;  4Y7N H;  4HJA A;  1N33 Q;  3AFQ A;  2KEN A;  2QGQ A;  3ER0 A;  4OWT B;  3G71 A;  4HID A;  1A8V A;  2B63 G;  4DR4 Q;  1TWG H;  2VW9 A;  4X62 Q;  2CKZ B;  4IPH A;  1PH5 A;  4HJ7 A;  4A3D G;  4IFD I;  4H02 A;  1VQA A;  2A8V A;  4LF4 Q;  4BA2 I;  1LM0 A;  3UE0 A;  2ZM6 Q;  2NVX H;  5IT9 c;  1WCM G;  1HZ9 A;  2JE6 I;  3W1G A;  4DUY Q;  1QVG A;  2UUB Q;  4A3J G;  3GTP H;  4JG2 A;  3T1H L;  1UE7 A;  1Q81 C;  3E9I A;  3M9B A;  3GO5 A;  3AYH B;  4JV5 L;  1NMG A;  4A3B G;  5HGQ A;  4GS3 A;  1P16 A;  2PQA B;  2UXB L;  1YJ9 A;  1QZH A;  3GTG H;  3UE1 A;  3BJU A;  1KHI A;  5IE8 A;  3I4M H;  3M4O H;  4DR7 Q;  3HFZ B;  3PUV A;  3U4V A;  3J80 c;  4KI0 A;  2UU9 L;  4ALP A;  4AH6 A;  2I5M X;  3J81 c;  1XMO Q;  1PH1 A;  4NPS A;  1N32 L;  1UEB A;  1J5E Q;  5IWA L;  1HNW Q;  1UE1 A;  5IYB H;  3CQZ H;  5M3F G;  3FHW A;  1JJG A;  2NVY H;  1IZ6 A;  3EN2 A;  1XPO A;  4LWC A;  3KF6 A;  4A3F G;  1JMC A;  5ELO A;  1IL2 A;  2E2J H;  2N3S A;  3A74 A;  2WB1 E;  1TWA H;  2KCM A;  4DV1 L;  5BR8 L;  1Y1W G;  1O7I A;  2I5H A;  1XNR L;  2VQE L;  4LUO A;  3PUX A;  2GN5 A;  3CCJ A;  5C4X H;  2E5L Q;  4LF9 Q;  4WJ3 M;  3K7A H;  4QJF A;  3H0G G;  1KRT A;  1GM5 A;  4B3S L;  3GTO H;  2JA7 H;  3H3V I;  4LUZ A;  1JJ2 A;  1VQL A;  3M4P A;  1VS0 A;  4B3T Q;  3STB D;  4BBS G;  4UP9 A;  3WWV A;  5C3E H;  4DR3 L;  1EFW A;  2JK8 A;  1K9M C;  4JV5 Q;  3PO2 G;  4OXP A;  2VNU D;  1BBW A;  1NE3 A;  1NBW A;  4DR6 Q;  1VQE A;  2IX0 A;  1WFQ A;  4JI8 L;  4X64 Q;  4LFC Q;  4A3K G;  1GD7 A;  2AWN A;  3GDE A;  1SR3 A;  4AYB G;  3CC7 A;  3CCQ A;  1VQ7 A;  4JBK A;  3GTL H;  2EQS A;  3S1Q H;  5IP7 G;  1MKH A;  4LFB L;  1L1O B;  3CAM A;  1NY4 A;  1WJJ A;  4LF6 L;  5C44 H;  3H3V H;  4DR5 L;  4JYA Q;  1E22 A;  5IWA Q;  1PA6 A;  1GKH A;  1T9H A;  4UP8 A;  5M3M G;  1N8R C;  5JJK A;  1Q12 A;  3T1Y L;  2AHO B;  4OX9 Q;  2WAQ G;  1X54 A;  3TS0 A;  2ALY B;  4L5T A;  4QY7 A;  4JCV E;  4A3M G;  1VQ6 A;  4B3M L;  1PHJ A;  1M90 C;  1VQ8 A;  3TRE A;  4BY1 H;  3HOX G;  4A3L G;  1KAW A;  4L5R C;  4TQU S;  2MO1 A;  2MQH A;  4P74 A;  5IP9 H;  3K81 C;  3ULL A;  4A76 A;  1C9O A;  1G29 1;  3A5Z B;  4LF7 L;  1E24 A;  5JJL A;  1R9T H;  1K73 C;  3PO3 G;  4Y52 H;  2K4K A;  3I7F A;  5IYD H;  1HZA A;  4TVA B;  3UDI A;  2KCT A;  3KYH C;  3CD6 A;  4PMW A;  2VY3 A;  2Z6K C;  1Y14 B;  2JA6 H;  4B3R Q;  1IBK Q;  3PF4 A;  4DV6 L;  4PZ7 A;  2NN6 I;  4DV7 L;  4JI2 L;  4O2D A;  4DV4 Q;  1TWH H;  4A93 G;  1K3R A;  1NJI C;  2I0Q A;  3S1N H;  3SGI A;  2H5X A;  1B7Y B;  3RN2 A;  2XTI A;  3KDF B;  3LGJ A;  2Z6K A;  4LUV A;  4XTC S;  4A3C H;  1J6Q A;  1E3P A;  3MEF A;  4NXN L;  4BBR G;  1YHA A;  3J7Z C;  3M4Q A;  3AQQ A;  1CSP A;  4GKK Q;  2VL6 A;  2K14 A;  1Y1V H;  2BH8 A;  2PQA A;  2V1C C;  4LF8 Q;  3PV0 A;  1YEZ A;  4XIG S;  3I4N H;  4JOI C;  4DV2 Q;  3K80 C;  1X3G A;  2IY5 B;  4C3H H;  2VZA A;  4IPD A;  1N36 L;  1YHB A;  1WOC A;  3CME A;  2UUA L;  3KF8 B;  4KHP Q;  2E8G A;  4LF7 Q;  3S17 H;  5FLM H;  3S1M H;  2ID0 A;  4UY8 C;  2HQL A;  3A0J A;  4FDB A;  2Y0S E;  1PH4 A;  1EQQ A;  1EIF A;  3CCV A;  1PH2 A;  2BH2 A;  2JJQ A;  3G4S A;  4JI3 Q;  4APV A;  4JOI A;  1VQI A;  1I3Q H;  3MXN B;  4UPA A;  4DR2 L;  2MNA A;  1PH7 A;  1XNQ L;  4C3I H;  2JA9 A;  2YU9 H;  2HT1 A;  4AQY Q;  3FKI H;  3DM3 A;  3E9H A;  1C7Y A;  4IFD G;  2MO0 A;  4JBM A;  1VQB A;  3I4M G;  1X3F A;  4JI0 Q;  4JI1 L;  4JI6 L;  4DV3 Q;  4HIO A;  1PVO A;  3PGZ A;  4RG1 A;  3CCS A;  3HKS A;  1YJN A;  2NVT H;  5IYC H;  5GAE C;  1L1O C;  4DV5 Q;  2F52 A;  3OTO L;  3CF5 A;  1EIY B;  3CCL A;  1HR0 L;  3KFU A;  5IYB G;  4JI4 L;  2RF4 A;  4JI7 Q;  4K0K Q;  2YV5 A;  4WJ4 A;  2FXQ A;  1UE6 A;  1VQ4 A;  3W5O A;  5M5Y H;  2HHH L;  5ELN A;  1VQO A;  1PYS B;  2VUM H;  4OO1 I;  4LFA Q;  4X66 L;  3JAM i;  4P73 A;  3CCR A;  5GQO A;  4LF5 L;  1KC8 C;  1CKO A;  1L1O A;  1N36 Q;  1VQ9 A;  2YTY A;  2AMC B;  4YWK A;  1IBM Q;  2JQO A;  3S14 H;  5C4X G;  4IJH A;  4BXX H;  2JA7 G;  1VQP A;  1QUQ B;  1AH9 A;  3NEL A;  2R6G A;  2F4V Q;  4YWM A;  3S24 A;  4A3I H;  3HOY H;  1X6O A;  2K52 A;  3KJO A;  3S1R H;  1CKM A;  5C3E G;  4DUZ L;  4GNX C;  2ES2 A;  4YHH L;  1KIX A;  1OXT A;  1K0R A;  2I5L X;  3D0F A;  3IRB A;  4DPG A;  1JE5 A;  3I56 A;  5GAG C;  1PH8 A;  3M3Y H;  3HOZ H;  3FP9 A;  2UUC L;  2A1A A;  2E2I H;  5HY6 A;  4X65 L;  1E1T A;  5C44 G;  3I4O A;  3ULJ A;  4DR1 L;  1G51 A;  1OXX K;  4DNI A;  3CCU A;  3HOU H;  2KHI A;  1XMQ L;  2Q2H A;  1SRU A;  3Q8D A;  3HOV H;  1TXY A;  5M5W H;  3J81 j;  4DV0 L;  2EXD A;  5FJ8 H;  1XJV A;  4A3G H;  1BBU A;  3HOW H;  3F2D A;  2CWP A;  3T1H Q;  4YCV A;  1X9N A;  1Q1B A;  2GVA A;  4L5Q A;  1QZG A;  4BY1 G;  2N49 A;  1VQD A;  4P72 A;  2BA0 A;  3KDF A;  2UXB Q;  4JI5 L;  5IP9 G;  3PF5 A;  2ZTD A;  1SN8 A;  2D0O A;  1DGS A;  2UU9 Q;  4DAY B;  5C0X I;  1HH2 P;  3G48 A;  5IYD G;  4IFD J;  3K7U C;  1N32 Q;  1IBL L;  1HZB A;  1X3E A;  2LXK A;  2VQF L;  2KHJ A;  2L15 A;  3W1B A;  2JA6 G;  1CSQ A;  2YTX A;  3A5U A;  1EQR A;  1U0L A;  2EIF A;  2R7F A;  4BY7 H;  4AYB E;  2PNH A;  3HKZ G;  1K8G A;  2AKW B;  1KRS A;  3L2P A;  1UE5 A;  1V9P A;  4DV1 Q;  4NB3 A;  5BR8 Q;  1W2B A;  4GLV B;  1XNR Q;  5LMN L;  2VQE Q;  4A3C G;  1BKB A;  4R4T A;  3RLN A;  4DAM A;  4B3S Q;  4DV0 Q;  2R7D A;  2NZH A;  4LNQ A;  5K36 G;  1N9W A;  1PH9 A;  2WAQ E;  1JJC B;  5M5X H;  1FL0 A;  1Y1V G;  3D31 A;  5GRO A;  4GNX B;  4JBJ A;  1I94 L;  1V43 A;  2NVQ H;  1VCI A;  2NN6 G;  3I4N G;  4DR3 Q;  1XTD A;  1VQG A;  5JJI A;  3UDG A;  5GAH C;  2R93 H;  4JI8 Q;  4IOC A;  5FLM G;  1I50 H;  1YIJ A;  2ZJR A;  4LFB Q;  4YY3 L;  1HNX L;  4LF6 Q;  2RHS B;  4POG A;  3PUY A;  4DR5 Q;  3CC2 A;  4JBW A;  2CFM A;  3GTJ H;  4NXM L;  3E0E A;  3FKI G;  3T1Y Q;  1YHQ A;  3TS2 A;  4OON A;  3OW2 A;  4GLX A;  2N8N A;  3CW2 C;  3CXC A;  2UXD L;  2JA8 H;  3OYY A;  3KJP A;  1FJG L;  1QUQ A;  3NEM A;  1KXL A;  2C35 B;  4B3M Q;  5IYC G;  1GVP A;  4A75 A;  1HNZ L;  3F8T A;  1V1Q A;  1QVC A;  3DLL A;  1M1K C;  1I5F A;  5AJ3 L;  4RMF A;  2WFW A;  1U5K A;  2K50 A;  1H95 A;  2N78 A;  2ATW A;  4DR4 L;  2OWO A;  2YYZ A;  2VUM G;  3VDY A;  1PH6 A;  4X62 L;  3S2H H;  2R7Z H;  1E1O A;  4OWX B;  2K5H A;  3UDX A;  4J15 A;  2B3G A;  2HIX A;  4LF4 L;  2OCE A;  3PCO B;  2Q2I A;  4DV6 Q;  2ZM6 L;  1KQS A;  4JI2 Q;  4BXX G;  3F2B A;  2R92 H; 
#chains in the Genus database with same CATH topology
 1C0A A;  2Q2U A;  1VDZ A;  3NEN A;  1SYG A;  4A3I G;  1TY2 A;  1G2T A;  1IW7 D;  5JJZ A;  2DJG C;  4NXN Q;  3J80 E;  1Q8K A;  4FVM A;  2P5Z X;  2BA1 A;  3HOZ G;  3RLO A;  1G6P A;  1SXT A;  3J80 i;  2A6H C;  5I2Y A;  4XT1 B;  3D4R A;  3TBI B;  2UUA Q;  2IHF A;  5KNB A;  3PIP A;  1H9S B;  1LTS D;  1Q1E A;  5K5P A;  3N6R A;  3QG1 A;  3RLF A;  1IYU A;  4K5V A;  1D7Q A;  1H95 A;  3K8A A;  4DR2 Q;  1ZKO A;  1A0I A;  2VB3 X;  4GN5 A;  3RNU A;  2VXW A;  3MFG A;  3HP3 A;  4F87 A;  3F2C A;  4EQO A;  1EIH A;  3I2Z A;  1YJW A;  1KNE A;  1SYD A;  2KCC A;  4B3T L;  2JA5 H;  5FOB B;  1FNW A;  5E4X A;  1HR0 Q;  3R93 A;  4DR6 L;  5CYU A;  3ICE A;  2B63 H;  2K5N A;  2LSS A;  3JAM c;  1CFM A;  3BU2 A;  5D3D A;  4Z9C B;  1IYJ B;  4LF5 Q;  4A3D H;  1U4M A;  2F1M A;  3CPF A;  3ULP A;  3S2D H;  1SE4 A;  3KBX A;  3R8B A;  4R4Q A;  4RHR A;  1HR0 W;  1E7Z A;  1SNP A;  1K83 H;  1PZK D;  1CUK A;  3DEP A;  1VQC A;  4V19 0;  4YHH Q;  1SE8 A;  1RIP A;  1MHW C;  1H9K A;  3T4A C;  4FO2 A;  4C3J H;  1SJE D;  5FO9 B;  4Q5V A;  3UDF A;  4X65 Q;  3AMU A;  5A2Q E;  1F9Q A;  1YIT A;  3GTK H;  2JP1 A;  1OTC A;  2IT1 A;  2DNC A;  2OT2 A;  2HQE A;  4P71 A;  1IBK L;  4HIM A;  4RCN A;  1C4Q A;  3R2T A;  1LTI D;  2JA5 B;  1B70 B;  1TS2 A;  3M7N A;  1HQR D;  1FGB D;  4RGM A;  2JA8 G;  3HOU B;  3HKZ E;  1Y1W H;  1QG7 A;  5CV4 A;  2B2T A;  1YI2 A;  2B63 B;  3H0G H;  4JI5 Q;  2HIV A;  3HOW B;  4LK1 C;  4TKO B;  3H6M A;  3IL8 A;  4ID6 A;  5EAY A;  3STB C;  2K05 A;  1S4Z A;  3CC4 A;  3KF6 B;  1S5C D;  1YVC A;  2R92 G;  1EZ8 A;  4X3K A;  4HJ9 A;  1GUG A;  3TZU A;  4QIW E;  5LMN Q;  2B2W A;  5CGK A;  5M3M H;  5C4J H;  3BZC A;  4C3J B;  2B2U A;  2Z0S A;  4AQY L;  3AEV A;  1Q46 A;  3SK6 A;  2WB1 B;  1ASY A;  4DKA C;  3CCM A;  3CMA A;  3GTK B;  1RL2 A;  1BCP B;  4A3M H;  1I94 Q;  4HIK A;  2KEC A;  1FNV A;  4DV5 L;  2A6H D;  1EYG A;  4A3L H;  4GLA C;  1QNU A;  3EIV A;  2Y0S G;  2OTJ A;  4EQ5 A;  1Q86 C;  5C3X A;  2Z4H A;  2X6G A;  1HNX Q;  5LMN W;  1Y1W B;  4IPG A;  2FIN B;  2EJF C;  2ZT9 C;  3HOY G;  4A3E G;  2HUG A;  4A4I A;  1G2S A;  2Z9H A;  4QB4 A;  3U58 A;  1KDC A;  1SFO H;  1MI2 A;  2IPK D;  4OHJ A;  2UXD Q;  1N34 Q;  2F4V L;  3TZD A;  3U50 C;  1J9O A;  1RTN A;  1HNZ Q;  4AYB B;  5KRU A;  2A5H A;  4Y7N H;  4HJA A;  1X32 A;  3Q24 A;  4DR4 Q;  3G71 A;  4Q0F A;  4X62 Q;  5M3M B;  1PH5 A;  4IFD I;  4H02 A;  1W6J A;  1ICF B;  2QKI C;  2ZM6 Q;  4IUN A;  5IT9 c;  4A3M B;  2MUY A;  4OEM B;  1S5B D;  1QVG A;  3L9A X;  3GTP H;  3VR2 A;  2EXZ A;  4DK1 A;  3T1H L;  3E9I A;  1B50 A;  1Y8P B;  4XT3 B;  1P16 A;  2PQA B;  5IE8 A;  1O7Y A;  1U4R A;  5I9P A;  5KGU A;  4DR7 Q;  2X69 A;  4KI0 A;  3I73 A;  1BCP F;  5EGT A;  1UEB A;  1J5E Q;  2EJG C;  5IYB H;  5EJW A;  2NVY H;  4KJN A;  3CHB D;  3FDT A;  4CDE C;  1XPO A;  4LWC A;  5ELO A;  2N3S A;  3A74 A;  2E76 C;  2H4O A;  2KCM A;  1BCP C;  1O7I A;  2I5H A;  1WD0 A;  1XNR L;  1DD2 A;  3LWU A;  5EKI A;  2ZXR A;  4LF9 Q;  3PUX A;  2GN5 A;  5C4X H;  3K6O A;  2Z6B A;  2D5D A;  1JJ2 A;  4DA2 A;  2F0N A;  2F0K A;  3NWS A;  1LAC A;  1Q8I A;  2F0P A;  4UP9 A;  1R4Q B;  3STB D;  5C3E H;  1CK1 A;  4JV5 Q;  3PO2 G;  3D3R A;  5IGB A;  1NE3 A;  1NBW A;  2IX0 A;  4K5W A;  4A3K G;  3CC7 A;  3CCQ A;  4JBK A;  3GTP B;  4B9X A;  1MKH A;  2L9H A;  1NY4 A;  2FJ2 A;  2RKS A;  1GKH A;  2NTS A;  3T1Y L;  3TME A;  2ALY B;  1PRT B;  3TS0 A;  1CA6 A;  3A8K E;  1D1I A;  1VQ6 A;  3TRE A;  3HOX G;  1AFP A;  1K28 A;  2E74 C;  4TQU S;  4FXK C;  4P74 A;  5IP9 H;  3Q0A A;  1C9O A;  3A5Z B;  1O7L A;  3PO3 G;  4Y52 H;  3I7F A;  4NMZ A;  4A3B B;  4BS9 A;  3UDI A;  2J7Z A;  1BO0 A;  2GA4 B;  1G91 A;  2Z6K C;  2JA6 H;  3PF4 A;  4DV6 L;  1EU3 A;  3OIP A;  1WTX A;  5C3E B;  1RHP A;  5I4D A;  2CH4 A;  1DOK A;  1G8Z D;  2MP1 A;  1A6X A;  4XQQ A;  3KDF B;  4LUV A;  3TP5 A;  1HFN A;  1E3P A;  4NXN L;  1YHA A;  2EZV A;  1T5X D;  4UAI A;  1O7Z A;  2OEO A;  1R4P B;  2IY5 B;  5L37 A;  1YHB A;  3A56 A;  2UUA L;  1ESR A;  2E8G A;  3WOE A;  4LF7 Q;  2F0E A;  2NB0 A;  4UY8 C;  2HQL A;  3HS0 C;  2Y0S E;  3CCV A;  1PH2 A;  1LV9 A;  4JI3 Q;  4F8M A;  4DR2 L;  1BR9 A;  3FKI H;  5JVH 3;  3E9H A;  3KK7 A;  1B3Q A;  4IFD G;  4O42 A;  3I4M G;  1EQT A;  1VQB A;  1ICW A;  4N8X 1;  1VMP A;  3UI2 A;  1STE A;  5JAV A;  4HIO A;  1RTO A;  2JYO A;  4RG1 A;  2F03 A;  1PFN A;  1D2B A;  1HR0 L;  5JPN C;  3C1F A;  2J0T D;  5DNF A;  2FXQ A;  1VQ4 A;  2LKV A;  2BDO A;  4OO1 I;  4LFA Q;  3CCR A;  4LF5 L;  1CKO A;  1L1O A;  5G3L F;  4HN7 A;  2YTY A;  4YWK A;  1IBM Q;  1BCP D;  2JQO A;  3S14 H;  1SNO A;  3BDO A;  4IJH A;  4FYD A;  2EYP A;  1I4R A;  1QUQ B;  2CH4 W;  4P2C B;  3NEL A;  2R6G A;  3S24 A;  4N9T A;  1KLG D;  4A3I H;  4PMB A;  1DJR D;  1X6O A;  2K52 A;  1CZG A;  3IAY A;  1CKM A;  4YHH L;  4R8I A;  1K0R A;  4DPG A;  2O5I C;  4A93 B;  3I56 A;  5GAG C;  3HOZ H;  4KKT A;  3FP9 A;  2ENB A;  4X65 L;  1E1T A;  3FPP A;  3ULJ A;  2QF7 A;  4HMJ A;  2KHI A;  1JQY D;  5COY A;  3Q8D A;  2IX3 A;  2EXD A;  1BBU A;  4JVZ A;  4DU9 A;  1Q1B A;  1BNZ A;  1RJT A;  2N49 A;  1Q3L A;  2XNA C;  2UXB Q;  1ILQ A;  4JI5 L;  3PF5 A;  2ZTD A;  1GUN A;  1KAA A;  1QIL A;  2BDN A;  2MGS A;  1DGS A;  2UU9 Q;  2K28 A;  5IYD G;  3K7U C;  4FF4 A;  1N32 Q;  1HZB A;  1X3E A;  2LXK A;  5FLX E;  1EQR A;  4A3I B;  2F0G A;  4MHE A;  5J39 A;  1KRS A;  4N9P A;  1UE5 A;  1X3P A;  4GLV B;  2OF1 A;  5LMN L;  3HOZ B;  1LTT D;  4EQP A;  5IGG A;  5T1I A;  1SYF A;  3IKJ A;  2NZH A;  4LNQ A;  5K36 G;  2E2J B;  1TWA B;  4H44 C;  1I94 L;  2NVQ H;  1V1P A;  1V43 A;  3I4N G;  4OIK A;  1XTD A;  2F0J A;  4C3H G;  3K7A B;  1EL0 A;  3UDG A;  3RUZ A;  2FMC A;  4ZQ3 A;  2ZJR A;  1HNX L;  4POG A;  4JBW A;  3E0J A;  4C3I G;  2EYF A;  3CKI B;  3E0E A;  3TS2 A;  3LX0 A;  3S1Q B;  4KN7 C;  3T51 B;  3CW2 C;  2MPM A;  2UXD L;  2JA8 H;  5D65 A;  3TSS A;  4B3M Q;  5IYC G;  1GVP A;  2K32 A;  1HNZ L;  5A35 A;  1WTW A;  2L11 A;  1M1K C;  2WFW A;  1LTB D;  1I4X A;  5C6A A;  4DR4 L;  1PH6 A;  4X62 L;  2F0S A;  2RCF A;  3G6J B;  1SNC A;  3M7G A;  3K58 A;  3R2I A;  2ZM6 L;  4DV7 Q;  4EQN A;  1SDF A;  1Y8N B;  2R92 H;  5IOC A;  3KOJ A;  1VQK A;  2ZJQ A;  2MJ8 A;  2PI2 A;  4OO1 G;  3VYT A;  5G3L D;  1DZ1 A;  1W3S A;  2DJF C;  1GO3 E;  5T1G A;  4AIM A;  3J81 E;  2IHE A;  1B2T A;  1FJG Q;  1SJH D;  2XGT A;  3NE5 B;  4HJ8 A;  4KLK A;  3J81 i;  4DAY A;  3RN5 A;  1J5E L;  2ASB A;  4UDU C;  3K5L A;  1B9N A;  3HOV G;  5FJ8 G;  4A3G G;  1JT8 A;  1EOT A;  3A7L A;  4L8J A;  3HOY H;  1IXR A;  4ZCK A;  4A3E H;  2DUD A;  3FRP B;  4EGV A;  4LF9 L;  4WFN 3;  1SAP A;  2N55 A;  2LMC B;  4RHS A;  4C56 C;  1L0W A;  1MJC A;  3NWT A;  5EPL A;  3X3M A;  3RD4 A;  1ROD A;  4GOP B;  2YU9 B;  4RGN A;  4GNX A;  3NBH B;  2R92 B;  3MZ5 A;  3JAM L;  1A2T A;  1HCZ A;  5IGC A;  2F0W A;  4BY7 G;  2NVT B;  4NW2 A;  4X66 Q;  5KYI A;  3CPW A;  1STY A;  2UXC Q;  3U4Z A;  2YTV A;  2B29 A;  4YCU A;  4DNT B;  1AE2 A;  1QCB D;  2Z8L A;  2J4X A;  1EYC A;  4MIU A;  4L5S A;  2QEX A;  2GVB A;  3PSI A;  5IGD A;  3ND8 A;  3ERS X;  1D5Z C;  2VB2 X;  2D62 A;  1J8I A;  2RVL A;  3TQY A;  4QCL A;  5J3B A;  2R93 G;  1QVF A;  3HOY B;  4A3E B;  1SYC A;  4M1U B;  1ENC A;  4DR1 Q;  5CV8 A;  2OTL A;  4ZUJ A;  1S3O A;  3RZD H;  5LMU L;  3CRL C;  2K5V A;  3G6E A;  2F0I A;  2CCZ A;  1EUJ A;  1WTH A;  4UHV A;  3TDQ A;  3I55 A;  4K5X A;  1B9M A;  4X3S A;  2MFI A;  2IW3 A;  1TS5 A;  4C2M H;  5C4Z A;  3OSO A;  1FVI A;  2R7Z G;  2BE5 C;  5DM7 3;  3PO2 H;  3A8J E;  4MN3 A;  5KEE A;  3PIO 3;  1S72 A;  4FF3 A;  4A3K H;  3QO2 A;  2NUC A;  1MSH A;  5F2D A;  4OIJ A;  3J7A 5;  5JEA J;  4LW1 A;  3WDN A;  4JI3 L;  4IPC A;  5KIX A;  1PYW D;  4GOP C;  4RA8 A;  1KD1 C;  1B53 A;  4O1N A;  1N33 L;  3D4D A;  3TRZ A;  1SRO A;  1EY8 A;  2KA7 A;  2HD3 A;  2PZW A;  5C0X J;  2DN8 A;  4HR7 B;  3RZD B;  1HHV A;  1SE2 A;  2JEB I;  3HOX H;  1TWC H;  1NCV A;  2CWA A;  3L3O C;  4YWL A;  1NTG A;  3GV6 A;  1XPU A;  3PO3 H;  4LFA L;  3R3O A;  1I50 B;  3VR3 A;  1IBM L;  4P75 A;  4MZ9 A;  4GKJ Q;  1VQF A;  4R1J A;  4WOR A;  3NTI A;  5BN5 A;  4IUV A;  3PO2 B;  1H9M A;  3EBE A;  4A3K B;  3E3X A;  3W2D A;  2ZTC A;  2NZO A;  3GQB A;  4HID A;  5CV9 A;  3H94 A;  2XRQ D;  1TWG H;  1VQA A;  2PZU A;  2PO4 A;  1GXD C;  1KNA A;  4LF4 Q;  5IT9 L;  4BA2 I;  1SSO A;  1CM9 A;  3A7A B;  3S2H B;  1HZ9 A;  2JE6 I;  3NQT A;  4XYQ A;  4A3J G;  3HOX B;  1RDP D;  4K6D A;  1Q81 C;  4N8F A;  1NMG A;  2EOT A;  2RBM A;  4IFD H;  2UXB L;  3PO3 B;  3I4M H;  1QZH A;  2SDF A;  1E2V A;  2QCP X;  3M4O H;  3HFZ B;  3PUV A;  3TP6 A;  3J80 c;  2UU9 L;  4AH6 A;  4PV1 C;  3FMC A;  3ND9 A;  1PH1 A;  1N32 L;  3S9W A;  4KK7 A;  5IWA L;  1A3U A;  1HNW Q;  1BOS A;  1UUP A;  5M3F G;  3OMC A;  1FYC A;  4KD4 A;  5E1F A;  3KF6 A;  1F9R A;  1FD7 D;  2B2Y A;  4RWS C;  4LUO A;  3CCJ A;  4WJ3 M;  4ZAI A;  4QJF A;  1KRT A;  1GM5 A;  3GTO H;  1MSG A;  4LUZ A;  1K0S A;  1JWM D;  4BBS G;  3NK9 A;  5CV7 A;  2PQE A;  2BE5 D;  2VNU D;  1BBW A;  1VQE A;  4X64 Q;  1WFQ A;  5BN4 A;  1WTQ A;  1VQ7 A;  1II3 A;  1UEA B;  5IP7 G;  3CAM A;  4IUT A;  2A74 C;  4KV6 A;  4F88 A;  1E22 A;  1VF7 A;  4NKL A;  4UP8 A;  1N8R C;  2EVB A;  3M4O B;  5JJK A;  3MXU A;  4QY7 A;  4A3D B;  1VMC A;  1GHK A;  2NTT A;  3ONA B;  1ENF A;  1CHQ D;  4XDX A;  4B3M L;  4ODG A;  5LHY 1;  3S2D B;  2R61 A;  2MO1 A;  1TS4 A;  1K83 B;  1JB3 A;  4IZ8 A;  1C48 A;  4OEL B;  5IYD H;  4KY5 A;  3KYH C;  3GTO B;  5CBE E;  4B3R Q;  4MTK A;  4DV7 L;  4DV4 Q;  3AB9 A;  2I0Q A;  1PFB A;  5EBC A;  1K8O A;  4ZKC B;  1RF2 D;  2LY7 A;  3LGJ A;  2Z6K A;  4XTC S;  3PQI A;  3VR5 A;  1J6Q A;  4KTA A;  5K36 H;  2KEE A;  3Q6S A;  3LNN A;  2VL6 A;  2BH8 A;  2PQA A;  1ILP A;  1YEZ A;  3I4N H;  2BOS A;  3K80 C;  4IAL A;  4C3H H;  2VZA A;  4IPD A;  5EPJ A;  3H0G B;  2XN9 C;  3KBG A;  2K5W A;  3SK5 A;  1M4V A;  4KHP Q;  1C8C A;  3S1M H;  1SNM A;  4FDB A;  4NDX A;  1EQQ A;  4KKU A;  3MAQ A;  1DM0 B;  3V2T A;  2BH2 A;  3G4S A;  2K33 A;  1E2W A;  1WTR A;  2MNA A;  1HQM C;  5DAU A;  4C3I H;  2JA9 A;  2HT1 A;  3T16 A;  2EY1 A;  2IJ0 A;  2MO0 A;  1X3F A;  1KLU D;  4DV3 Q;  3NSW A;  3QOJ A;  1PVO A;  3CCS A;  5C4J B;  5IYC H;  1EIY B;  3CCL A;  3CF5 A;  2WAQ B;  5COR A;  4K0K Q;  4PQX A;  1UE6 A;  2EJM A;  5M5Y H;  1PYS B;  5D14 A;  4X66 L;  1KAB A;  1K8M A;  4P73 A;  5GQO A;  1KC8 C;  1N36 Q;  4G7O C;  4S3S A;  1LAB A;  3X3N A;  3FVQ A;  1GUO A;  2JA7 G;  1TR5 A;  1VQP A;  2O4X A;  4C3H B;  3KJO A;  5ISR A;  3S1R H;  1SFO B;  4OO1 H;  4DXG A;  1IHZ A;  1LTR D;  2A1A A;  3J7A V;  1AP0 A;  1H9J A;  4C3I B;  1FNU A;  3I4O A;  4DR1 L;  1OXX K;  4DNI A;  3CCU A;  4Y7N B;  3EVQ A;  1F9P A;  4OGQ C;  3HOV H;  4DV0 L;  1TS3 A;  5FJ8 H;  1XJV A;  4A3G H;  1U9R A;  2CWP A;  2SOB A;  1X9N A;  4BY1 G;  2F3V A;  5M5Y B;  3KDF A;  2E75 C;  2PYK A;  1SN8 A;  4ZK9 B;  1WVL A;  1K3B C;  4ZUI A;  1HFG A;  2KHJ A;  2L15 A;  4KKS A;  2YTX A;  3A5U A;  4BY7 H;  3S1R B;  2A6E C;  4XQJ A;  3L2P A;  1PZJ D;  3MWY W;  2B2T C;  2NVY B;  2VQE Q;  4A3C G;  1BKB A;  4R4T A;  3RLN A;  4DAM A;  4B3S Q;  1STG A;  1N9W A;  2XWJ B;  1JJC B;  5M5X H;  2WIN B;  4JBJ A;  1VCI A;  4DR3 Q;  5C4X B;  1HA6 A;  3HOV B;  5JJI A;  2F0O A;  2I46 A;  1CZW A;  2R93 H;  4JI8 Q;  4A3G B;  2H1E A;  5FLM G;  3C2P A;  3URY A;  4LFB Q;  4LF6 Q;  2RHS B;  4K6L A;  1S5F D;  4DR5 Q;  4DXF A;  3GTJ H;  3SVM A;  1QWY A;  1YHQ A;  4KHV A;  5EPK A;  1MGS A;  3BDL A;  3KJP A;  1QUQ A;  4I7A A;  1KXL A;  2C35 B;  2K03 A;  3QWN A;  3F8T A;  1U4L A;  1V1Q A;  1QVC A;  3DLL A;  3SEB A;  2PW5 A;  3BS1 A;  1I5F A;  4BY7 B;  4RMF A;  1WTV A;  2L12 A;  2K50 A;  4U67 3;  4G57 A;  2VUM G;  3SE0 A;  2LS0 1;  2R7Z H;  3I8Z A;  4YIJ A;  2B3G A;  4LF4 L;  1GUT A;  3PCO B;  1EEF D;  2Q2I A;  5ELB A;  1KTK A;  5M5X B;  3VYU A;  4JI2 Q;  5I6W A;  3ERO A;  4BXX G;  1LUZ A;  1CKN B;  1EU4 A;  4CGY B;  1VQM A;  3I4L A;  4ME3 A;  3L7Z C;  3AU7 A;  2JA6 B;  4DFA A;  2QA4 A;  2R93 B;  2K5Q A;  3BZK A;  1LLR D;  3K5M A;  3HKZ B;  3L0O A;  1PFM A;  1TWF H;  1OXS C;  1LT3 D;  3NPP A;  4XXE A;  2RHQ B;  4X6A H;  3GTJ B;  1EOV A;  3HOU G;  1LYL A;  1D6E C;  1HNW L;  3W3A A;  5EBD A;  3B6Y A;  3HOW G;  3HG9 A;  4WJW A;  2PZT A;  1XNQ Q;  1TII D;  3HRZ C;  3MC0 B;  5EKL A;  2VS1 A;  4ME5 A;  2K75 A;  4FXG C;  4EX5 A;  2A19 A;  2KED A;  2F0M A;  4H0L C;  4QIW B;  4JI6 Q;  2R7Z B;  3OWF A;  4DK3 C;  4QQB X;  1DCZ A;  2ZXO A;  3NTK A;  1AN8 A;  2HCI A;  3FKI B;  3QIA A;  3QOL A;  3OTO Q;  2F0H A;  1SLJ A;  4CHT B;  2Z4I A;  2D0P A;  4X64 L;  3QR8 A;  5EKK A;  3PUZ A;  2WB1 G;  2A6E D;  1VQJ A;  1UWV A;  3OW7 A;  4KMU C;  5FK9 C;  1WTP A;  1PXU A;  2SNS A;  1TWF B;  1TKW B;  1HTL D;  1SE3 A;  3MVV A;  2EY5 A;  1EY0 A;  4A3J H;  4DUZ Q;  3S14 B;  2FMM A;  2E2H H;  2QW7 A;  1OXU A;  3MHB A;  2IWH A;  3KLS X;  4QGU A;  2UUC Q;  1PMR A;  4GN4 B;  5JVG 3;  1MIU A;  2M9V A;  1K8A C;  1AE3 A;  3PIO A;  3I3C A;  4RFB A;  5CBA E;  3KLW A;  5M3F H;  1GUS A;  1ENA A;  4LMQ D;  4B3R L;  1I6H H;  1VQ5 A;  1EWH A;  1STA A;  4DV4 L;  1VQN A;  1F77 A;  3DUZ A;  4QL5 A;  1YBY A;  3P1H A;  4ILW A;  1A62 A;  2R3Z A;  3RZO H;  1PH3 A;  4O0A A;  4HSV A;  5C5L A;  4FP5 D;  2XWB B;  3NTH A;  1CI3 M;  1LO5 D;  4BBS H;  2G5D A;  3TEH B;  1M8A A;  3VR4 A;  3GTQ H;  2VQF Q;  5H1S E;  3S15 H;  3H15 A;  4KHP L;  4TSS A;  5E4W C;  4A3J B;  1YZ6 A;  5IP7 H;  2WP8 J;  5FLX c;  1N34 L;  2E2H B;  1GOZ A;  1I6V C;  2F0T A;  3I90 A;  4F7X A;  1SNQ A;  2ZTE A;  4DK6 C;  4R4O A;  4CDF C;  3OMG A;  4DV3 L;  1HZC A;  1JOK A;  3A54 A;  2MHV A;  1HPC A;  3F1Z A;  5M3F B;  1I6H B;  1EWI A;  5KND A;  1LTL A;  1G6Z A;  4GOP A;  3D4W A;  1P8L A;  5ELF A;  4K0K L;  3NBH A;  2OQK A;  3M4Y A;  2NVQ B;  1JCK B;  1Z47 A;  1TVX A;  1F9S A;  2PMZ E;  4RGO S;  2SNM A;  3RZO B;  2KBN A;  1XWE A;  1S40 A;  4IOA A;  4NXM Q;  4FXD A;  5D3I B;  4CKB A;  1XX8 A;  4BBS B;  4DR7 L;  3GTQ B;  2IX1 A;  1F2M A;  2AQ2 B;  3OHX C;  2O5J C;  2L5T A;  3QJY A;  1Y8O B;  4FNF A;  1Q7Y C;  3FPU B;  1L0Y B;  4QF4 A;  1Y69 U;  3AFQ A;  2JA8 B;  3I70 A;  2KEN A;  2EYL A;  2QGQ A;  3ER0 A;  4OWT B;  2CKZ B;  2HDM A;  1ET9 A;  1YNN C;  4IPH A;  2RDG A;  2DY7 A;  3UE0 A;  2NVX H;  3HEJ A;  1WCM G;  3SXH A;  3W1G A;  1VF5 C;  4DUY Q;  2UUB Q;  4JG2 A;  4RCO A;  1LT4 D;  3M9B A;  3MA2 B;  3GO5 A;  3AYH B;  4JV5 L;  2D9U A;  4A3B G;  5HGQ A;  3U9O A;  4FF2 A;  4HCS A;  1OO9 B;  3U9S A;  3GTG H;  3MFY A;  3UE1 A;  3J80 L;  3C1E A;  4CJ1 B;  3U4V A;  4ALP A;  3J81 c;  1XMO Q;  4NPS A;  3VA7 A;  3BDC A;  2Q8T A;  1HTP A;  1IZ6 A;  2F0Q A;  3EN2 A;  4A3F G;  1JMC A;  1EIG A;  4HTH A;  2WB1 E;  2N88 A;  2Y0S B;  2VQE L;  2E5L Q;  2PPB C;  5I6Y A;  3F2U A;  4B3S L;  2EY6 A;  3H3V I;  2JA7 H;  4G7Z C;  3M4P A;  1VS0 A;  5J22 A;  5CMD A;  1EFW A;  4DR3 L;  2JK8 A;  4H7B A;  2NVX B;  3BZD B;  2KOL A;  4JI8 L;  2QDB A;  4K8J A;  4LFC Q;  3GDE A;  3GTL H;  4LFB L;  4LF6 L;  1WJJ A;  1CHP D;  4DR5 L;  4JYA Q;  1PA6 A;  3GTG B;  1EEI D;  1T9H A;  4OX9 Q;  1EQV A;  4J6H A;  4L5T A;  4K8I A;  1RKN A;  2AQ1 B;  1PHJ A;  2K5D A;  1M90 C;  1PDQ A;  4BY1 H;  3T53 B;  1NNX A;  1KAW A;  4FF1 A;  3NHH A;  2MQH A;  3RMH A;  3NP8 A;  4LF7 L;  3ULL A;  1G29 1;  1PZI D;  4DF7 A;  2KCN A;  5JJL A;  1R9T H;  1K73 C;  2AUJ D;  1QB5 D;  2K4K A;  5A2Q L;  2KCT A;  4PMW A;  2VY3 A;  3IFT A;  1Y14 B;  2NWG A;  3VYS A;  2JA7 B;  2F0U A;  2NN6 I;  3K5N A;  4JI2 L;  4O2D A;  3VR6 A;  4A93 G;  1K3R A;  1NJI C;  3S1N H;  2A69 C;  4R9W A;  4A3C H;  3MEF A;  4BBR G;  1EY4 A;  1GUW A;  4GKK Q;  1CSP A;  1X3Q A;  4LF8 Q;  3PV0 A;  4XIG S;  4JOI C;  4DV2 Q;  1YNN D;  1WOC A;  4C2M B;  4RKB A;  5JOB A;  3CME A;  3KF8 B;  4M8A A;  5FLM H;  2HDL A;  2ID0 A;  3A0J A;  1EIF A;  1IKL A;  4KD3 A;  4BY1 B;  1DXM A;  5EQ0 A;  1VQI A;  2WII B;  1EY5 A;  1HA5 A;  3MXN B;  4UPA A;  1PH7 A;  1XNQ L;  3HGB A;  4JBM A;  3KLR A;  5IOD A;  4JI0 Q;  4JI6 L;  1JOR A;  1KDB A;  3HKS A;  1IKM A;  5GAE C;  2F52 A;  3OTO L;  4CDD C;  4JI7 Q;  2RF4 A;  4V0B A;  2YV5 A;  3GP7 A;  3JAM E;  3S1N B;  4WJ4 A;  1A2U A;  2AQ3 B;  4R8N A;  2VUM H;  1VQO A;  2F0V A;  1O78 A;  2FFK B;  3JAM i;  1B44 D;  2RA4 A;  1BBX C;  4RH6 A;  4IUP A;  1TWC B;  1MD2 D;  4BXX H;  2XVS A;  5LL6 X;  2XRS D;  5ELC A;  4CKC A;  4YWM A;  5M9O A;  2RQX A;  1TT2 A;  4DUZ L;  1HXY D;  4GNX C;  1KIX A;  1OXT A;  1JE5 A;  4DAV A;  2F0F A;  2ICI A;  2UUC L;  2E2I H;  5HY6 A;  3P7J A;  5C44 G;  1PLF A;  1I4H A;  1SBB B;  3HOU H;  2DY8 A;  2A73 B;  2B2V C;  3C3L A;  1TWG B;  3J81 j;  3BVM A;  3N52 A;  3MXP A;  3HOW H;  3F2D A;  2GVA A;  1SYB A;  1QZG A;  3NUC A;  1VQD A;  4KY7 A;  2VUM B;  2PMZ B;  1O80 A;  3CRK C;  3A8I E;  1B1Z A;  3H91 A;  1HH2 P;  3G48 A;  5C0X I;  4IFD J;  3SK4 A;  2VQF L;  3W1B A;  3I4M B;  1CSQ A;  1V1O A;  2EIF A;  2O2L D;  2PNH A;  3WOF A;  1EYD A;  4QUF A;  2E2D C;  2V4D A;  4DV1 Q;  5BR8 Q;  2A69 D;  1CQF A;  2L4N A;  2E2I B;  2R7D A;  2F0L A;  4DNR B;  1PH9 A;  3KUP A;  4B08 A;  1Y1V G;  2K1B A;  4OL7 A;  2NN6 G;  4ZLT F;  3OOC A;  2PNR C;  5GAH C;  1WD1 A;  4IOC A;  3DM1 A;  3SK8 A;  1YIJ A;  2A68 C;  3PUY A;  1ZXT A;  4TRD A;  4J8Q A;  5NUC A;  2CFM A;  3EFX D;  4NXM L;  3CU7 A;  1EYA A;  3BYT B;  1QJO A;  4GLX A;  1STH A;  3K57 A;  1A3V A;  1S5D D;  3OYY A;  2EYH A;  2ICE C;  1FJG L;  5HUR A;  2WKD A;  3NEM A;  3K59 A;  2L0C A;  1F2Z A;  1JWU D;  2C9O A;  3NXW A;  2M2L A;  1U5K A;  3DWA A;  3OWE B;  1QOH A;  2N78 A;  4ZRZ A;  1TQO A;  3VDY A;  1NAP A;  3SR1 A;  1DOL A;  3UDX A;  5IT9 E;  2HIX A;  2OCE A;  5KYL A;  2KJX A;  1KQS A;  2PCF B;  1D5X C;  1STB A;  3TN2 A;  3ZJY C;  4DUY L;  2UUB L;  1MJE A;  2HCC A;  1BUV T;  1ONL A;  1T5E A;  4CDC C;  2SEB D;  4IO9 A;  1UAP A;  1BF4 A;  5TSS A;  2F3I A;  3H09 A;  5C5M A;  1L2F A;  5IIF A;  2F3W A;  4OWW B;  5HGT A;  1XMO L;  2K7V A;  2QEJ C;  1SEB D;  2UXC L;  2PW7 A;  1BVS A;  5KNC A;  3CP0 A;  4MNO A;  4BA1 I;  1WI5 A;  3DXJ C;  1CT1 D;  4ULL A;  4G7H C;  3J7A F;  3AFP A;  3I4N B;  4JC0 A;  3T13 A;  3KLS A;  2KHS A;  1NSN S;  1GHJ A;  1YNX A;  4E6I A;  3D6C A;  4YCW A;  3S1M B;  2E5L L;  4QUC A;  2K01 A;  3DWP A;  1X55 A;  3GV3 A;  2WV6 D;  4PZ6 A;  4B9W A;  4UP7 A;  4JI1 Q;  2AWO A;  1SMX A;  4ZKB B;  1F2L A;  1ML0 D;  1HJP A;  2CQO A;  3JC6 6;  1AZQ A;  5JEA G;  4CBV A;  4JI4 Q;  3V05 A;  4LFC L;  4G4K A;  3PUW A;  3PIP 3;  1Z9F A;  2HHH Q;  3CCE A;  1X65 A;  1GJX A;  2CVR A;  4K14 A;  3RR5 A;  1BQQ T;  4JYA L;  2B2Y C;  1I4P A;  1D1K A;  1XPR A;  2B39 A;  5C0X G;  1WCM H;  4GZY C;  4OX9 L;  1FR3 A;  1EWC A;  5I9O A;  1B3A A;  2ZXP A;  3E5S A;  4X3U A;  2CHB D;  4I7Z C;  4A3B H;  4PZ8 A;  2OQ0 A;  1ASZ A;  1AEX A;  1JIC A;  1DOM A;  1FGU A;  2LXJ A;  4IQZ A;  2QDL A;  3OPO A;  1B8A A;  1SMY C;  4HJ5 A;  5DLQ E;  2NZ1 D;  2A68 D;  1XMQ Q;  5J1Z A;  1YNJ C;  2F0D A;  3K0Y A;  2DGY A;  1IL8 A;  1NUC A;  2NBF A;  4IJL A;  4A3F H;  3QB3 A;  4RAU C;  1BDO A;  1PFS A;  1OXV A;  4POF A;  1CKN A;  2ZJP A;  3BG3 A;  1PTO H;  1AW7 A;  2JN4 A;  3S16 H;  1Q90 A;  1XTC D;  5C3W A;  1LTG D;  1JOQ A;  2RCN A;  3ITP A;  3VA5 A;  4DGZ A;  4KHZ A;  1LTA D;  4GKK L;  4LF8 L;  1JE4 A;  3I72 A;  1D8L A;  2RSO A;  5CV6 A;  4DV2 L;  1IBL Q;  1JWS D;  1WCM B;  2F4I A;  3GTM H;  2B2W C;  1QE6 A;  4DN4 M;  2B2U C;  1VQH A;  1JB7 A;  4PG3 A;  5FLX L;  4GKJ L;  2B8F A;  1LT6 D;  1L0X B;  1TU2 B;  3DHQ A;  1X56 A;  4C1N K;  3M85 A;  1Q82 C;  5IY0 A;  5E7N A;  2JEA I;  4J1M A;  4EVO A;  5LMU Q;  2Q2T A;  4JI0 L;  2NYZ D;  2L1B A;  3K0X A;  2KUM A;  4R4I A;  1NMF A;  1D5M C;  4R4C A;  3EA6 A;  5GAD C;  2G9H D;  1KL9 A;  1A63 A;  2PI2 E;  4JI7 L;  1WYD A;  5AFW A;  4A3F B;  3ERQ A;  4YY3 Q;  1PTO B;  3GD7 A;  3HZX A;  3S16 B;  4MTN A;  3V96 A;  5JPM C;  1ZEQ X;  4A93 H;  1XXG A;  1PYB A;  3GTM B;  2JA5 G;  4NP5 A;  4GN3 B;  4BWG B;  1PV4 A;  4KN4 C;  5AJ3 Q;  2FHT A;  4BBR H;  1N33 Q;  4L63 B;  1KDA A;  2EE1 A;  2EYJ A;  2G9D A;  1EY6 A;  1A8V A;  2B63 G;  2EPB A;  1PRT F;  4DK0 A;  2VW9 A;  3SDZ A;  5I2X A;  4HJ7 A;  4A3D G;  2A8V A;  1LM0 A;  1B4O A;  2DNE A;  3ZYY X;  4RGT A;  1CQV A;  1ZYR C;  4LJZ C;  4ZYS A;  2CW0 C;  1PRT C;  3A55 A;  1UE7 A;  1SYE A;  4GS3 A;  4CJ2 C;  1YJ9 A;  3BJU A;  1KHI A;  4C3J G;  3J81 L;  2I5M X;  3TP8 A;  1DYQ A;  1SMY D;  1UE1 A;  3CQZ H;  1ET6 A;  3FHW A;  1JJG A;  2RDH A;  5E3F A;  1YNJ D;  4HCE A;  1IL2 A;  2E2J H;  1UNS A;  1Z6H A;  1JC7 A;  1PTO F;  1TWA H;  4DV1 L;  4BBR B;  5BR8 L;  1Y1W G;  2B8G A;  2CQA A;  3K7A H;  3H0G G;  4U68 A;  1VQL A;  1ESF A;  4B3T Q;  3TP7 A;  4C1N I;  3P20 A;  3WWV A;  1PTO C;  3NQI A;  1K9M C;  4OXP A;  4XQN A;  4DR6 Q;  1WTO A;  2I07 B;  1GD7 A;  2AWN A;  1SR3 A;  4AYB G;  1RD9 D;  2EQS A;  2L55 A;  3IFD A;  3S1Q H;  1Z7T A;  1L1O B;  3SHL A;  5C44 H;  3H3V H;  2BCO A;  5BN3 A;  5IWA Q;  2AUK A;  2KVM A;  5M3M G;  2XIW A;  1Q12 A;  2EYO A;  2AHO B;  4H13 C;  4CKE A;  1HUM A;  1A3T A;  1X54 A;  2WAQ G;  2Q8I B;  1IYV A;  4X3T A;  2K04 A;  1NR2 A;  5C4H A;  3MEH A;  2TSS A;  4JCV E;  4A3M G;  5ELD A;  3OIQ A;  3CQZ B;  1VQ8 A;  3DWQ A;  4K2L A;  4A3L G;  4CJ0 B;  2QIL A;  4L5R C;  3K81 C;  1QNK A;  4A76 A;  5IGE A;  1E24 A;  4IN3 A;  3FEW X;  3T56 B;  5FO8 B;  3BVG A;  3EQL C;  5IGF A;  1TY0 A;  1HZA A;  4TVA B;  3G7L A;  3CD6 A;  1IBK Q;  3D6W A;  3NBI A;  4PZ7 A;  3DEO A;  2JSO A;  1TWH H;  3SGI A;  2H5X A;  3P75 A;  1B7Y B;  3RN2 A;  2XTI A;  2EYM A;  4DAP A;  3J7Z C;  3M4Q A;  5C44 B;  3AQQ A;  2K14 A;  1Y1V H;  2V1C C;  2NN6 H;  1X3G A;  4JW0 A;  1N36 L;  2EDG A;  2TMP A;  5CC4 A;  1XYI A;  3O13 A;  1A15 A;  2RSN A;  3S17 H;  1PH4 A;  1ZYR D;  3Q22 A;  4PMC A;  2JJQ A;  1S5E D;  1EFI D;  4JOI A;  4APV A;  3S15 B;  1I3Q H;  1PRT D;  2CW0 D;  3LWE A;  3MXG A;  2YU9 H;  4AQY Q;  3C46 A;  3DM3 A;  5FO7 B;  1C7Y A;  1F2Y A;  1V1P B;  4KJO A;  4JI1 L;  1SND A;  3PGZ A;  1YJN A;  2NVT H;  4DV5 Q;  1L1O C;  3KFU A;  5IYB G;  3BVZ A;  1TWH B;  4JI4 L;  3W5O A;  2JXM B;  5ELN A;  2HHH L;  4IUQ A;  1VQ9 A;  4IUU A;  2AMC B;  1AZP A;  1STN A;  5C4X G;  1Y1V B;  4K2K A;  1AH9 A;  4I65 A;  4IUR A;  2F4V Q;  4QMG A;  4XYO A;  1RCV D;  2ES2 A;  5C3E G;  4WRD A;  3S17 B;  1IW7 C;  1PTO D;  1HRJ A;  2I5L X;  3D0F A;  3IRB A;  5FKA C;  3Q23 A;  3E6Z X;  1PH8 A;  3M3Y H;  1W6K A;  1I3Q B;  2LFN A;  2WAC A;  1HUN A;  1G51 A;  2C5C A;  4L6T B;  1CA5 A;  1E2Z A;  1XMQ L;  3D8G A;  2Q2H A;  4ABN A;  1SRU A;  1TXY A;  5M5W H;  2D2C C;  4LAA A;  3H3V C;  3T1H Q;  4YCV A;  5CV5 A;  4L5Q A;  5DEH A;  4KY6 A;  4HSP A;  4JK1 C;  4P72 A;  2BA0 A;  4JPB W;  2B2V A;  5IP9 G;  3J7Y W;  2D0O A;  2Z1C A;  4DAY B;  2Q8R E;  5DM6 3;  5JEA H;  1IBL L;  1CTM A;  2JA6 G;  2M00 A;  4RKL A;  4PNY A;  1U0L A;  2R7F A;  3KF8 A;  3PMF A;  4AYB E;  1K8G A;  3HKZ G;  5ELE A;  2OXP A;  2AKW B;  2WKC A;  4HED A;  1V9P A;  4NB3 A;  1W2B A;  1MBY A;  1XNR Q;  3M3Y B;  1E0B A;  1I4G A;  3MXN A;  5C0X H;  4DV0 Q;  2WAQ E;  3VYR A;  1FL0 A;  3K5O A;  2XSC A;  3D31 A;  5GRO A;  4GNX B;  1EY9 A;  1LT5 D;  3MTS A;  3DMU A;  1VQG A;  2EY2 A;  2KQ3 A;  5M5W B;  5LL6 S;  1I50 H;  1NR4 A;  4YY3 L;  1EY7 A;  2RDF A;  2K6A A;  1DON A;  3CC2 A;  2X6L A;  3T1Y Q;  1JR0 D;  3FKI G;  1BXT A;  3GTL B;  4OON A;  3OW2 A;  3EJI A;  2N8N A;  3I91 A;  3CXC A;  1H9S A;  1JOO A;  1I4Q A;  1EZ6 A;  4A75 A;  5AJ3 L;  1V8Q A;  4HMI A;  2ATW A;  2OWO A;  2YYZ A;  4HAE A;  2IL8 A;  3S2H H;  1E1O A;  4OWX B;  2K5H A;  4J15 A;  5CR3 A;  3BYY B;  4DV6 Q;  1U4P A;  1R9T B;  1H9R A;  3F2B A; 
#chains in the Genus database with same CATH homology
 1C0A A;  1LUZ A;  2Q2U A;  1CKN B;  3KOJ A;  3NEN A;  1VQM A;  1VQK A;  3ZJY C;  4DUY L;  2ZJQ A;  4ME3 A;  3L7Z C;  1MJE A;  2UUB L;  4A3I G;  2QA4 A;  2PI2 A;  3BZK A;  4OO1 G;  4IO9 A;  4NXN Q;  1Q8K A;  1W3S A;  2F3I A;  2BA1 A;  3HOZ G;  3RLO A;  3L0O A;  1G6P A;  1GO3 E;  4AIM A;  2IHE A;  1TWF H;  1FJG Q;  1OXS C;  2XGT A;  3J80 i;  4HJ8 A;  1L2F A;  4X6A H;  2RHQ B;  4KLK A;  1EOV A;  4OWW B;  3HOU G;  1XMO L;  3J81 i;  1LYL A;  3RN5 A;  1J5E L;  2UUA Q;  2ASB A;  2IHF A;  1HNW L;  2UXC L;  3PIP A;  1BVS A;  3B6Y A;  3CP0 A;  4MNO A;  1Q1E A;  4BA1 I;  1WI5 A;  3HOV G;  3RLF A;  3AFP A;  5FJ8 G;  4A3G G;  4JC0 A;  3HOW G;  1JT8 A;  1D7Q A;  1XNQ Q;  3K8A A;  1IXR A;  4DR2 Q;  1A0I A;  1YNX A;  2DUD A;  4GN5 A;  3RNU A;  4A3E H;  4YCW A;  2E5L L;  4LF9 L;  1X55 A;  2VS1 A;  4PZ6 A;  2K75 A;  4UP7 A;  4JI1 Q;  4EX5 A;  2A19 A;  3I2Z A;  3F2C A;  4JI6 Q;  1L0W A;  1MJC A;  1YJW A;  2AWO A;  1SMX A;  4DK3 C;  4B3T L;  4QQB X;  4GOP B;  1HJP A;  2CQO A;  3JC6 6;  2JA5 H;  3OTO Q;  5JEA G;  4GNX A;  1HR0 Q;  1SLJ A;  3NBH B;  4JI4 Q;  4DR6 L;  2D0P A;  4X64 L;  4LFC L;  3PUW A;  3ICE A;  1Z9F A;  2B63 H;  2K5N A;  2HHH Q;  4BY7 G;  2LSS A;  3PUZ A;  1X65 A;  4X66 Q;  3JAM c;  2WB1 G;  3CCE A;  3CPW A;  3RR5 A;  3BU2 A;  4LF5 Q;  1VQJ A;  1IYJ B;  1UWV A;  4A3D H;  4JYA L;  3CPF A;  2UXC Q;  3U4Z A;  2YTV A;  2B29 A;  4YCU A;  4DV7 Q;  3ULP A;  1XPR A;  5C0X G;  3S2D H;  1WCM H;  1AE2 A;  4OX9 L;  4R4Q A;  1HR0 W;  4L5S A;  1E7Z A;  2QEX A;  4A3J H;  1K83 H;  2GVB A;  1CUK A;  3PSI A;  4DUZ Q;  1VQC A;  4YHH Q;  1SE8 A;  3ERS X;  1RIP A;  4A3B H;  2E2H H;  2D62 A;  4PZ8 A;  1OXU A;  2OQ0 A;  3TQY A;  5J3B A;  1ASZ A;  2R93 G;  1FGU A;  4C3J H;  2LXJ A;  1QVF A;  4QGU A;  2UUC Q;  3UDF A;  4X65 Q;  4GN4 B;  1B8A A;  1MIU A;  1K8A C;  1AE3 A;  4HJ5 A;  3PIO A;  5DLQ E;  4DR1 Q;  1YIT A;  3GTK H;  1OTC A;  2IT1 A;  2OTL A;  1XMQ Q;  4P71 A;  1S3O A;  3KLW A;  5M3F H;  4HIM A;  3RZD H;  1IBK L;  4B3R L;  1I6H H;  1VQ5 A;  2DGY A;  5LMU L;  1B70 B;  4DV4 L;  3M7N A;  1VQN A;  4QL5 A;  2K5V A;  4IJL A;  1YBY A;  3G6E A;  4A3F H;  2CCZ A;  1EUJ A;  3HKZ E;  3I55 A;  1PFS A;  2JA8 G;  1OXV A;  1A62 A;  4POF A;  1CKN A;  2ZJP A;  1Y1W H;  1YI2 A;  3RZO H;  1PH3 A;  3S16 H;  4O0A A;  2MFI A;  3H0G H;  4JI5 Q;  4C2M H;  2HIV A;  2RCN A;  1FVI A;  4GKK L;  4KHZ A;  5EAY A;  4LF8 L;  3STB C;  1D8L A;  2R7Z G;  4BBS H;  4DV2 L;  3TEH B;  1IBL Q;  3GTQ H;  2VQF Q;  5H1S E;  3GTM H;  3CC4 A;  3PO2 H;  3S15 H;  3H15 A;  1S72 A;  4KHP L;  4A3K H;  1VQH A;  3KF6 B;  1JB7 A;  1YVC A;  4PG3 A;  1YZ6 A;  2R92 G;  5IP7 H;  4HJ9 A;  3J7A 5;  5JEA J;  2WP8 J;  4GKJ L;  5FLX c;  4LW1 A;  3M85 A;  1Q82 C;  4JI3 L;  1N34 L;  1X56 A;  4IPC A;  4QIW E;  5IY0 A;  5LMN Q;  4GOP C;  5E7N A;  5M3M H;  5C4J H;  3BZC A;  4AQY L;  2Z0S A;  2ZTE A;  1KD1 C;  2JEA I;  3AEV A;  2Q2T A;  5LMU Q;  4DK6 C;  4R4O A;  1Q46 A;  1N33 L;  1ASY A;  4DKA C;  3CCM A;  3CMA A;  4JI0 L;  3TRZ A;  1SRO A;  1RL2 A;  4DV3 L;  4A3M H;  1I94 Q;  1HZC A;  3K0X A;  4R4I A;  4HIK A;  3F1Z A;  5C0X J;  1NMF A;  4DV5 L;  1EWI A;  4R4C A;  5GAD C;  1LTL A;  1EYG A;  2JEB I;  4GLA C;  3HOX H;  4GOP A;  4A3L H;  1KL9 A;  1A63 A;  2PI2 E;  1P8L A;  1TWC H;  1WYD A;  2CWA A;  3EIV A;  4JI7 L;  4K0K L;  2Y0S G;  4YWL A;  2OTJ A;  4EQ5 A;  2OQK A;  1NTG A;  1Q86 C;  4YY3 Q;  5LMN W;  1HNX Q;  1XPU A;  3PO3 H;  1Z47 A;  4IPG A;  3GD7 A;  4LFA L;  2PMZ E;  3HOY G;  2KBN A;  4A3E G;  4MTN A;  1S40 A;  4A4I A;  4IOA A;  3U58 A;  1IBM L;  4NXM Q;  4P75 A;  1SFO H;  4MZ9 A;  4GKJ Q;  1VQF A;  4R1J A;  4A93 H;  2UXD Q;  4DR7 L;  1N34 Q;  1PYB A;  2F4V L;  2IX1 A;  2JA5 G;  3U50 C;  3EBE A;  4GN3 B;  1HNZ Q;  1PV4 A;  2ZTC A;  1Q7Y C;  5AJ3 Q;  4BBR H;  2NZO A;  4Y7N H;  4HJA A;  1N33 Q;  3AFQ A;  2KEN A;  2QGQ A;  3ER0 A;  4OWT B;  3G71 A;  4HID A;  1A8V A;  2B63 G;  4DR4 Q;  1TWG H;  2VW9 A;  4X62 Q;  2CKZ B;  4IPH A;  1PH5 A;  4HJ7 A;  4A3D G;  4IFD I;  4H02 A;  1VQA A;  2A8V A;  4LF4 Q;  4BA2 I;  1LM0 A;  3UE0 A;  2ZM6 Q;  2NVX H;  5IT9 c;  1WCM G;  1HZ9 A;  2JE6 I;  3W1G A;  4DUY Q;  1QVG A;  2UUB Q;  4A3J G;  3GTP H;  4JG2 A;  3T1H L;  1UE7 A;  1Q81 C;  3E9I A;  3M9B A;  3GO5 A;  3AYH B;  4JV5 L;  1NMG A;  4A3B G;  5HGQ A;  4GS3 A;  1P16 A;  2PQA B;  2UXB L;  1YJ9 A;  1QZH A;  3GTG H;  3UE1 A;  3BJU A;  1KHI A;  5IE8 A;  3I4M H;  3M4O H;  4DR7 Q;  3HFZ B;  3PUV A;  3U4V A;  3J80 c;  4KI0 A;  2UU9 L;  4ALP A;  4AH6 A;  2I5M X;  3J81 c;  1XMO Q;  1PH1 A;  4NPS A;  1N32 L;  1UEB A;  1J5E Q;  5IWA L;  1HNW Q;  1UE1 A;  5IYB H;  3CQZ H;  5M3F G;  3FHW A;  1JJG A;  2NVY H;  1IZ6 A;  3EN2 A;  1XPO A;  4LWC A;  3KF6 A;  4A3F G;  1JMC A;  5ELO A;  1IL2 A;  2E2J H;  2N3S A;  3A74 A;  2WB1 E;  1TWA H;  2KCM A;  4DV1 L;  5BR8 L;  1Y1W G;  1O7I A;  2I5H A;  1XNR L;  2VQE L;  4LUO A;  3PUX A;  2GN5 A;  3CCJ A;  5C4X H;  2E5L Q;  4LF9 Q;  4WJ3 M;  3K7A H;  4QJF A;  3H0G G;  1KRT A;  1GM5 A;  4B3S L;  3GTO H;  2JA7 H;  3H3V I;  4LUZ A;  1JJ2 A;  1VQL A;  3M4P A;  1VS0 A;  4B3T Q;  3STB D;  4BBS G;  4UP9 A;  3WWV A;  5C3E H;  4DR3 L;  1EFW A;  2JK8 A;  1K9M C;  4JV5 Q;  3PO2 G;  4OXP A;  2VNU D;  1BBW A;  1NE3 A;  1NBW A;  4DR6 Q;  1VQE A;  2IX0 A;  1WFQ A;  4JI8 L;  4X64 Q;  4LFC Q;  4A3K G;  1GD7 A;  2AWN A;  3GDE A;  1SR3 A;  4AYB G;  3CC7 A;  3CCQ A;  1VQ7 A;  4JBK A;  3GTL H;  2EQS A;  3S1Q H;  5IP7 G;  1MKH A;  4LFB L;  1L1O B;  3CAM A;  1NY4 A;  1WJJ A;  4LF6 L;  5C44 H;  3H3V H;  4DR5 L;  4JYA Q;  1E22 A;  5IWA Q;  1PA6 A;  1GKH A;  1T9H A;  4UP8 A;  5M3M G;  1N8R C;  5JJK A;  1Q12 A;  3T1Y L;  2AHO B;  4OX9 Q;  2WAQ G;  1X54 A;  3TS0 A;  2ALY B;  4L5T A;  4QY7 A;  4JCV E;  4A3M G;  1VQ6 A;  4B3M L;  1PHJ A;  1M90 C;  1VQ8 A;  3TRE A;  4BY1 H;  3HOX G;  4A3L G;  1KAW A;  4L5R C;  4TQU S;  2MO1 A;  2MQH A;  4P74 A;  5IP9 H;  3K81 C;  3ULL A;  4A76 A;  1C9O A;  1G29 1;  3A5Z B;  4LF7 L;  1E24 A;  5JJL A;  1R9T H;  1K73 C;  3PO3 G;  4Y52 H;  2K4K A;  3I7F A;  5IYD H;  1HZA A;  4TVA B;  3UDI A;  2KCT A;  3KYH C;  3CD6 A;  4PMW A;  2VY3 A;  2Z6K C;  1Y14 B;  2JA6 H;  4B3R Q;  1IBK Q;  3PF4 A;  4DV6 L;  4PZ7 A;  2NN6 I;  4DV7 L;  4JI2 L;  4O2D A;  4DV4 Q;  1TWH H;  4A93 G;  1K3R A;  1NJI C;  2I0Q A;  3S1N H;  3SGI A;  2H5X A;  1B7Y B;  3RN2 A;  2XTI A;  3KDF B;  3LGJ A;  2Z6K A;  4LUV A;  4XTC S;  4A3C H;  1J6Q A;  1E3P A;  3MEF A;  4NXN L;  4BBR G;  1YHA A;  3J7Z C;  3M4Q A;  3AQQ A;  1CSP A;  4GKK Q;  2VL6 A;  2K14 A;  1Y1V H;  2BH8 A;  2PQA A;  2V1C C;  4LF8 Q;  3PV0 A;  1YEZ A;  4XIG S;  3I4N H;  4JOI C;  4DV2 Q;  3K80 C;  1X3G A;  2IY5 B;  4C3H H;  2VZA A;  4IPD A;  1N36 L;  1YHB A;  1WOC A;  3CME A;  2UUA L;  3KF8 B;  4KHP Q;  2E8G A;  4LF7 Q;  3S17 H;  5FLM H;  3S1M H;  2ID0 A;  4UY8 C;  2HQL A;  3A0J A;  4FDB A;  2Y0S E;  1PH4 A;  1EQQ A;  1EIF A;  3CCV A;  1PH2 A;  2BH2 A;  2JJQ A;  3G4S A;  4JI3 Q;  4APV A;  4JOI A;  1VQI A;  1I3Q H;  3MXN B;  4UPA A;  4DR2 L;  2MNA A;  1PH7 A;  1XNQ L;  4C3I H;  2JA9 A;  2YU9 H;  2HT1 A;  4AQY Q;  3FKI H;  3DM3 A;  3E9H A;  1C7Y A;  4IFD G;  2MO0 A;  4JBM A;  1VQB A;  3I4M G;  1X3F A;  4JI0 Q;  4JI1 L;  4JI6 L;  4DV3 Q;  4HIO A;  1PVO A;  3PGZ A;  4RG1 A;  3CCS A;  3HKS A;  1YJN A;  2NVT H;  5IYC H;  5GAE C;  1L1O C;  4DV5 Q;  2F52 A;  3OTO L;  3CF5 A;  1EIY B;  3CCL A;  1HR0 L;  3KFU A;  5IYB G;  4JI4 L;  2RF4 A;  4JI7 Q;  4K0K Q;  2YV5 A;  4WJ4 A;  2FXQ A;  1UE6 A;  1VQ4 A;  3W5O A;  5M5Y H;  2HHH L;  5ELN A;  1VQO A;  1PYS B;  2VUM H;  4OO1 I;  4LFA Q;  4X66 L;  3JAM i;  4P73 A;  3CCR A;  5GQO A;  4LF5 L;  1KC8 C;  1CKO A;  1L1O A;  1N36 Q;  1VQ9 A;  2YTY A;  2AMC B;  4YWK A;  1IBM Q;  2JQO A;  3S14 H;  5C4X G;  4IJH A;  4BXX H;  2JA7 G;  1VQP A;  1QUQ B;  1AH9 A;  3NEL A;  2R6G A;  2F4V Q;  4YWM A;  3S24 A;  4A3I H;  3HOY H;  1X6O A;  2K52 A;  3KJO A;  3S1R H;  1CKM A;  5C3E G;  4DUZ L;  4GNX C;  2ES2 A;  4YHH L;  1KIX A;  1OXT A;  1K0R A;  2I5L X;  3D0F A;  3IRB A;  4DPG A;  1JE5 A;  3I56 A;  5GAG C;  1PH8 A;  3M3Y H;  3HOZ H;  3FP9 A;  2UUC L;  2A1A A;  2E2I H;  5HY6 A;  4X65 L;  1E1T A;  5C44 G;  3I4O A;  3ULJ A;  4DR1 L;  1G51 A;  1OXX K;  4DNI A;  3CCU A;  3HOU H;  2KHI A;  1XMQ L;  2Q2H A;  1SRU A;  3Q8D A;  3HOV H;  1TXY A;  5M5W H;  3J81 j;  4DV0 L;  2EXD A;  5FJ8 H;  1XJV A;  4A3G H;  1BBU A;  3HOW H;  3F2D A;  2CWP A;  3T1H Q;  4YCV A;  1X9N A;  1Q1B A;  2GVA A;  4L5Q A;  1QZG A;  4BY1 G;  2N49 A;  1VQD A;  4P72 A;  2BA0 A;  3KDF A;  2UXB Q;  4JI5 L;  5IP9 G;  3PF5 A;  2ZTD A;  1SN8 A;  2D0O A;  1DGS A;  2UU9 Q;  4DAY B;  5C0X I;  1HH2 P;  3G48 A;  5IYD G;  4IFD J;  3K7U C;  1N32 Q;  1IBL L;  1HZB A;  1X3E A;  2LXK A;  2VQF L;  2KHJ A;  2L15 A;  3W1B A;  2JA6 G;  1CSQ A;  2YTX A;  3A5U A;  1EQR A;  1U0L A;  2EIF A;  2R7F A;  4BY7 H;  4AYB E;  2PNH A;  3HKZ G;  1K8G A;  2AKW B;  1KRS A;  3L2P A;  1UE5 A;  1V9P A;  4DV1 Q;  4NB3 A;  5BR8 Q;  1W2B A;  4GLV B;  1XNR Q;  5LMN L;  2VQE Q;  4A3C G;  1BKB A;  4R4T A;  3RLN A;  4DAM A;  4B3S Q;  4DV0 Q;  2R7D A;  2NZH A;  4LNQ A;  5K36 G;  1N9W A;  1PH9 A;  2WAQ E;  1JJC B;  5M5X H;  1FL0 A;  1Y1V G;  3D31 A;  5GRO A;  4GNX B;  4JBJ A;  1I94 L;  1V43 A;  2NVQ H;  1VCI A;  2NN6 G;  3I4N G;  4DR3 Q;  1XTD A;  1VQG A;  5JJI A;  3UDG A;  5GAH C;  2R93 H;  4JI8 Q;  4IOC A;  5FLM G;  1I50 H;  1YIJ A;  2ZJR A;  4LFB Q;  4YY3 L;  1HNX L;  4LF6 Q;  2RHS B;  4POG A;  3PUY A;  4DR5 Q;  3CC2 A;  4JBW A;  2CFM A;  3GTJ H;  4NXM L;  3E0E A;  3FKI G;  3T1Y Q;  1YHQ A;  3TS2 A;  4OON A;  3OW2 A;  4GLX A;  2N8N A;  3CW2 C;  3CXC A;  2UXD L;  2JA8 H;  3OYY A;  3KJP A;  1FJG L;  1QUQ A;  3NEM A;  1KXL A;  2C35 B;  4B3M Q;  5IYC G;  1GVP A;  4A75 A;  1HNZ L;  3F8T A;  1V1Q A;  1QVC A;  3DLL A;  1M1K C;  1I5F A;  5AJ3 L;  4RMF A;  2WFW A;  1U5K A;  2K50 A;  1H95 A;  2N78 A;  2ATW A;  4DR4 L;  2OWO A;  2YYZ A;  2VUM G;  3VDY A;  1PH6 A;  4X62 L;  3S2H H;  2R7Z H;  1E1O A;  4OWX B;  2K5H A;  3UDX A;  4J15 A;  2B3G A;  2HIX A;  4LF4 L;  2OCE A;  3PCO B;  2Q2I A;  4DV6 Q;  2ZM6 L;  1KQS A;  4JI2 Q;  4BXX G;  3F2B A;  2R92 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...