2FXQA

Single-stranded dna-binding protein from thermus aquaticus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
227
structure length
197
Chain Sequence
RGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRSEVQVRAEFIDPLEGRRRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNERRTHFLEVQAWRELAEWASELRKGDGLLVIGRLVNDSWTSSSGERRFQTRVEALRLERPTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Structure of the single-stranded DNA-binding protein SSB from Thermus aquaticus.
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Dna binding protein
total genus 37
structure length 197
sequence length 227
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2fxqA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2fxqA02
1D8LA 4AQYL 3PSIA 4A3IG 1XJVA 4A3LH 1PH1A 4HIMA 3HOXG 5M3MG 4DR3L 2E8GA 3GTKH 1C7YA 5LMNQ 1JJCB 3GTJH 1SN8A 2UUCL 4JI1L 1MJCA 1VQJA 1Z47A 1QVFA 3HOZH 4GS3A 4JC0A 4EX5A 2MO0A 5BR8L 2VQFL 4B3SL 1P16A 1VCIA 1CKNA 2YYZA 1YJWA 4OWWB 2KCMA 4GKJL 2OTJA 1P8LA 2BH8A 1W2BA 3PO3H 2F4VQ 1HR0W 2H5XA 3U4ZA 1GVPA 3ER0A 3CCJA 2LXKA 3CCLA 3TEHB 2HHHL 5FJ8H 1KD1C 1Q46A 3BJUA 4LF7L 5IP7G 5AJ3L 5IY0A 1XMQL 3M4PA 4LF9L 1I50H 2WB1E 3E9IA 4QIWE 3CMAA 1EUJA 5ELNA 4DKAC 4DNIA 2R7DA 1K0RA 3RNUA 1PHJA 4JYAQ 4HJAA 2UUBL 1AH9A 1VQNA 1FJGL 3UE1A 1KL9A 4A3MH 5C0XI 2QA4A 4DR4L 3DLLA 3CCRA 4A3FG 4JI6Q 4AH6A 2B3GA 1N33Q 4DUYQ 3DM3A 3HOVG 1NY4A 4GNXC 4AYBE 3TS0A 4JI0Q 3J7ZC 4LF8Q 3KDFB 3RR5A 1OXUA 2D0OA 3UDIA 4LF6L 4DR1Q 2OQ0A 3AQQA 4GLXA 2K75A 1HR0Q 4O0AA 5IWAQ 4DR2L 3ICEA 1NTGA 1K9MC 1HNZL 2ZM6L 4JI8L 5GADC 2R93G 4L5RC 4YWKA 3M4QA 4B3TL 2FXQA 1T9HA 3STBC 1X3FA 2I5HA 5IYCG 1H95A 3SGIA 2NZOA 2C35B 4P74A 1Y1WH 4DV0L 2JA5G 2LXJA 1XNQL 4KHPQ 1KRSA 3T1YQ 2EQSA 1TXYA 3RN2A 3WWVA 1EFWA 5C4XH 2UXCL 4GN5A 1BKBA 2MQHA 2WAQE 1HZ9A 1PFSA 3L2PA 3FKIH 3M4OH 1K73C 2K5HA 1KAWA 2KHJA 3G71A 1PH3A 2JA8G 4BXXH 3CQZH 2R7ZG 1VQGA 1PYBA 3TQYA 2JEBI 3UDFA 3F2DA 4QY7A 4A3GH 3CCSA 1KIXA 4QL5A 5LMNL 3HKSA 1VQFA 2VL6A 1C9OA 4IPGA 4A3KH 1YJ9A 1KC8C 2QGQA 4LW1A 4R4CA 2RCNA 3KFUA 4GN4B 4XTCS 1A8VA 4YHHQ 4R4TA 3H15A 4DV7Q 1XPRA 3PCOB 2NVYH 1EQRA 1QUQB 4UP7A 2F4VL 1Q1EA 1N36Q 1VQ7A 4POGA 1VQ6A 3S1RH 3S17H 1YEZA 3KF8B 4ALPA 2Z0SA 1VQ9A 3KJOA 1YHBA 2NN6G 3E9HA 2E5LL 2QEXA 4MTNA 4R4OA 4LUZA 3K8AA 3A0JA 1FVIA 1TWHH 2VQEQ 4JYAL 1Q7YC 3HOYH 1X3EA 1YNXA 4BA1I 5H1SE 4DV2Q 2DUDA 1A63A 3CMEA 4DV3L 2HIVA 4JI6L 4POFA 1UEBA 1N33L 4PZ6A 2PQAA 3ERSX 1HZCA 4FDBA 4R1JA 4X64Q 4B3RQ 1JJ2A 4JBJA 4DR5Q 4LF8L 2GVAA 3LGJA 2UXBL 3CC4A 4DR1L 4DPGA 2I5LX 1HR0L 4B3MQ 1CUKA 5M5XH 4DR7Q 4KI0A 3L0OA 4OONA 4KLKA 1TWGH 3K7UC 1M90C 4LF5Q 1SLJA 1VQLA 3S2DH 1YBYA 1SRUA 2Z6KC 3CXCA 1KQSA 3CAMA 2ASBA 1SR3A 1I6HH 4X66L 3W1BA 2E2IH 1HNXQ 4JI7Q 3HOUH 1Y14B 2OTLA 3KOJA 2D62A 3CCVA 5FLMG 3F2BA 1VQ5A 4KHPL 3I7FA 2PMZE 4NB3A 3PIOA 3CPWA 2ATWA 3CW2C 1OXSC 2D0PA 4J15A 4PZ7A 1RL2A 4JI2Q 4AIMA 2JJQA 3CCUA 1Y1VG 1N34L 4A93H 1YZ6A 3RLOA 3HOZG 3UDGA 1VQEA 4H02A 3KF6B 4P71A 3GTPH 4DV5Q 3CCMA 3JAMc 3I2ZA 2N3SA 2NVTH 1KRTA 1I94L 5K36G 4HJ8A 1L1OA 2ES2A 2CWPA 3PO2H 1MJEA 4GLVB 1J6QA 3J81j 5C0XJ 1VQ4A 4AYBG 3J80i 3J81c 2WP8J 2OCEA 1YI2A 4DV1Q 1FGUA 4DV7L 5IYDH 1XTDA 5IP9H 2MFIA 4DUZQ 1QVGA 3S1NH 1N9WA 2UXDL 4JOIC 1TWFH 2KCTA 4JI5Q 1YJNA 1N36L 3OYYA 2JA6G 5C44H 1CKOA 1WI5A 4A3MG 1FL0A 5IYBG 3HOWG 1IYJB 1Q12A 3H0GG 4X65Q 1S3OA 2MO1A 4YY3L 1NMFA 4DV6Q 4DR6L 4JCVE 4BBRG 4TVAB 4BBSH 4OXPA 1QVCA 5ELOA 5C3EH 3BU2A 2VQEL 2JQOA 4MNOA 4YWLA 3T1HQ 4A3EH 2JA7G 2WAQG 4Y52H 2R92H 1VQMA 1HNWQ 1NE3A 2VW9A 3GDEA 1TWAH 1NBWA 2CWAA 4A3IH 1IBKL 3HOXH 4LFBQ 2JE6I 5M3MH 4B3RL 1B8AA 2UUAQ 1YHQA 2NN6I 2AHOB 2EIFA 5DLQE 1CKNB 4JI3Q 3PUWA 1Y1WG 2I0QA 2K5NA 5IT9c 5LMUQ 2OWOA 1JE5A 4GKKQ 2KBNA 3G4SA 1J5EL 3PUXA 5M3FG 4DR7L 2BH2A 4XIGS 1V1QA 3KJPA 1IBMQ 4LF5L 5JJKA 3FKIG 4LNQA 2ZJPA 1R9TH 3K0XA 2AMCB 2MNAA 5M5YH 3JAMi 4L5SA 3TRZA 1K83H 2CFMA 1X9NA 3BZCA 2K5VA 1PV4A 1HNXL 3PUZA 4JBMA 4JI7L 3I4MG 4X6AH 1WCMH 3ZJYC 1G6PA 1GD7A 2I5MX 3NBHB 4ME3A 4JI4L 5IP7H 4NXNQ 3J81i 3CC2A 4EQ5A 3F1ZA 2B63G 4LUOA 4A4IA 4TQUS 4X62Q 2ZJRA 2JA9A 2KENA 3HKZE 4QJFA 4R4IA 1UE1A 3NEMA 3NENA 1ASZA 4A3DH 1MIUA 4DV4Q 2OQKA 1CKMA 1RIPA 1X55A 5FLXc 4L5QA 4A3FH 3U50C 3HOVH 4LFAQ 2ZTDA 2KHIA 1SE8A 5JJLA 3AFPA 3PUYA 4JBWA 3S16H 3H3VI 2A1AA 1K8AC 4IFDI 4QQBX 1UWVA 3TREA 4DAMA 4UP8A 3CC7A 4IOAA 4GOPA 3HFZB 4DV1L 1Q8KA 4DUZL 1PH8A 4BY1G 2R93H 2RHSB 3PIPA 3GTQH 4JI5L 1YITA 3MEFA 1VQ8A 1PH5A 4P73A 4A3BG 3EN2A 5IYCH 4OX9Q 3G48A 3A5UA 1PYSB 1OXVA 3J80c 4DR3Q 2N78A 4NPSA 4LFCQ 1VS0A 2PI2E 3TS2A 2HT1A 4IPDA 1K8GA 2UUCQ 4JI1Q 4A3JH 1N8RC 1EIYB 3GO5A 3T1HL 1Z9FA 2PNHA 4LWCA 1LYLA 4UPAA 2R7ZH 4APVA 1E7ZA 3KYHC 5BR8Q 2VQFQ 4B3SQ 4LF4Q 3S1QH 2ZTCA 1JJGA 2K52A 3CCEA 2YTXA 3GTMH 1GO3E 4DUYL 1JB7A 2YU9H 4LFBL 4JI0L 1W3SA 2RF4A 5C0XG 2F3IA 2UUAL 3I4NH 2VUMG 3GD7A 3FP9A 3HOUG 2HQLA 3K81C 4K0KL 1L2FA 3PF4A 2CQOA 2K50A 3S24A 4IJLA 2CKZB 5IWAL 2ID0A 3UE0A 4GKKL 4OO1G 1E24A 1XMQQ 4LF9Q 4A93G 4A3CH 1VQPA 2XTIA 1E3PA 3L7ZC 1L0WA 2Z6KA 1IBLQ 3FHWA 3RLFA 4A3LG 3RN5A 4BY7H 3T1YL 1B70B 5E7NA 5JEAJ 5EAYA 3PGZA 3ULLA 5IE8A 4Y7NH 4WJ3M 2LSSA 2CCZA 4KHZA 4X62L 4LF6Q 2GN5A 4YCUA 2PQAB 3W1GA 1I3QH 4GLAC 1LUZA 2AWNA 3CPFA 1UE6A 2Q2HA 4PG3A 4A76A 4DV4L 4DR2Q 2PI2A 1HNZQ 3PO3G 2ZM6Q 4JI8Q 1PVOA 3CD6A 2IX0A 2ALYB 4C3IH 4HIDA 2A19A 1EQQA 4LFAL 4YWMA 4P75A 1QZHA 5FJ8G 2Y0SE 3KLWA 1EOVA 4DK6C 1BVSA 2L15A 3RZOH 4BBSG 4YHHL 1ASYA 2UXCQ 3EBEA 3STBD 2JK8A 3G6EA 2NZHA 5C3EG 3UDXA 1AE2A 3GTOH 2WFWA 2B29A 2AWOA 4JOIA 4NXMQ 2IX1A 3OTOQ 3S14H 4OX9L 3GTLH 1Q82C 3M7NA 2RHQB 2VS1A 2Q2IA 3I4OA 5HGQA 1L1OC 2DGYA 1G291 5FLMH 4IFDJ 4IPHA 4PMWA 2GVBA 4IJHA 4LFCL 1LTLA 4A75A 1XPOA 1JT8A 1IL2A 3H3VH 1XNRQ 1Y1VH 1VQIA 1X3GA 1N32Q 1L1OB 2K4KA 3PV0A 1BBUA 4DV2L 1K3RA 1NMGA 2VY3A 4DAYB 2YTYA 1GKHA 3HKZG 1VQOA 2IT1A 3KDFA 3E0EA 1S40A 4LF4L 1V43A 5GAGC 2ZTEA 1OXXK 4X64L 2HIXA 1HJPA 4DR5L 4GNXA 3MXNB 1XMOQ 2K14A 2E2HH 4C3HH 1JMCA 1WCMG 1E1TA 1YIJA 4B3ML 1M1KC 4UY8C 5GAEC 1G51A 2E5LQ 3A74A 4RG1A 1NJIC 5C4XG 1UE7A 2Q2TA 1KXLA 3B6YA 4BXXG 1SMXA 1Q1BA 1IBLL 1E22A 4DK3C 4R4QA 2JA6H 4A3DG 3I56A 1SFOH 4A3GG 4DV3Q 5IYBH 2VZAA 1PH4A 3HOWH 3H0GH 2YTVA 2IY5B 1VQHA 3M9BA 4JI2L 1C0AA 4BBRH 5M5WH 4OO1I 4A3KG 1SROA 5GQOA 2UXBQ 3PUVA 1UE5A 4GN3B 2JA7H 3NELA 4DV5L 4GNXB 3IRBA 1PH2A 2IHEA 1Q86C 1U5KA 3F2CA 4UP9A 2A8VA 4X66Q 4JV5Q 4JG2A 2EXDA 5J3BA 2NVXH 3CP0A 1VQKA 4JBKA 1QUQA 2ZJQA 1X56A 2BA1A 1YHAA 3U58A 1X6OA 3U4VA 2Q2UA 1I5FA 5M3FH 3BZKA 1WFQA 1N34Q 2UU9Q 4K0KQ 3W5OA 3JC66 4HJ7A 4A3JG 1IXRA 3HOYG 4NXML 4HJ5A 1HZAA 3OTOL 1A62A 3I4MH 4AQYQ 3RLNA 1WJJA 4C3JH 5JEAG 4X65L 2JA5H 1VQAA 5HY6A 4DV6L 1I94Q 2R7FA 3M3YH 3S1MH 4HIOA 4L5TA 3VDYA 3I4NG 4BA2I 1PA6A 1XNRL 2B63H 1Q81C 2JA8H 1LM0A 1N32L 5C4JH 4QGUA 2NVQH 4GOPC 1HNWL 2AKWB 4GKJQ 3EIVA 1B7YB 3D31A 4A3CG 4YCWA 2VNUD 1U0LA 1EWIA 4MZ9A 1PH6A 1OTCA 2UXDQ 4GOPB 4JI3L 1XMOL 1VQDA 1X54A 4P72A 3PF5A 4BY7G 5LMUL 1MKHA 2HHHQ 1DGSA 1EYGA 3F8TA 4LF7Q 4YY3Q 5AJ3Q 2Y0SG 4RMFA 3OW2A 3K7AH 1IBML 4HJ9A 4DR6Q 1PH9A 2R6GA 4BY1H 5JJIA 2V1CC 4PZ8A 4IO9A 2UUBQ 1D7QA 1HZBA 1VQCA 1FJGQ 2YV5A 3RZDH 4A3BH 4DR4Q 3K80C 3S15H 1BBWA 4IFDG 1O7IA 1YVCA 4IPCA 1IBKQ 3KF6A 1PH7A 3PO2G 3S2HH 4NXNL 2N49A 1X65A 3A5ZB 3Q8DA 1TWCH 4WJ4A 2BA0A 1AE3A 3J7A5 1EIFA 3AFQA 3CF5A 1QZGA 2JEAI 1WYDA 3CCQA 3D0FA 4OWTB 2F52A 5LMNW 2IHFA 1J5EQ 3AEVA 1V9PA 2N8NA 5IYDG 4LUVA 1A0IA 1KHIA 4O2DA 1IZ6A 1OXTA 5IP9G 4IOCA 3GTGH 1HH2P 4B3TQ 4OWXB 2XGTA 5C44G 1E1OA 4JV5L 3ULPA 1GM5A 1XPUA 3M85A 2VUMH 3I55A 4HIKA 4DV0Q 1XNQQ 5GAHC 1CSPA 5GROA 3ULJA 4JI4Q 2UU9L 4YCVA 1VQBA 4A3EG 2E2JH 1CSQA 1S72A 2R92G 3AYHB 2WB1G 1WOCA 4C2MH
chains in the Genus database with same CATH superfamily
4AQYL 4ZRZA 1PH1A 3EFXD 2L1BA 5FLXE 3SK8A 2KUMA 1JJCB 1SN8A 3S16B 2UUCL 3VR3A 1VQJA 1Z47A 1JR0D 4OIKA 4CKBA 1WTWA 1B2TA 3DXJC 4CBVA 4GKJL 1CKNA 4LK1C 2BH8A 2F4VQ 2AUJD 1DJRD 3FPUB 1PZJD 2F0EA 1KD1C 4LF7L 5AJ3L 1XMQL 1A3UA 1G2SA 1I50H 3E9IA 5BN5A 1JC7A 1K0RA 3NTIA 2UUBL 1DD2A 5C0XI 4DR4L 2XIWA 1N33Q 5CC4A 3DM3A 3SR1A 4JI0Q 4AYBE 1EIHA 3KDFB 2D0OA 4LF6L 1NCVA 4O0AA 2WKCA 3A7LA 1LO5D 3K6OA 1HNZL 3U9SA 1LT4D 4B3TL 2CH4W 2FXQA 3KUPA 5IYCG 3SGIA 1MHWC 1WTQA 1EYDA 2M9VA 2EQSA 2PCFB 1EFWA 3OIQA 3SVMA 4GN5A 2DY7A 2MQHA 2WAQE 5FKAC 3FKIH 1UEAB 3GTPB 1EL0A 4U68A 3UDFA 4Q5VA 4A3GH 4C3IB 3PO2B 1CTMA 1PFBA 1LT3D 5LMNL 2M00A 1C9OA 3OMGA 4IQZA 5FLXL 1FNWA 4JPBW 4XTCS 1A8VA 1WTHA 3BVGA 5KEEA 1TIID 4DV7Q 1XPRA 1QOHA 3PCOB 3FDTA 1Q1EA 4ZK9B 1N36Q 4IN3A 4J6HA 4XT1B 3KF8B 2ZXPA 2F3VA 3HZXA 1LABA 2QEXA 1ZEQX 4A3EB 3A0JA 1Y8OB 3P75A 1HCZA 2RQXA 2K32A 5KGUA 4FF3A 2DUDA 4DV3L 1UEBA 2C5CA 4PZ6A 1HZCA 3NP8A 1MSHA 2RVLA 4KD3A 1CT1D 1JJ2A 1AP0A 1HR0L 2CH4A 1K8MA 2IWHA 4CGYB 1M90C 3GV6A 3K7UC 1VQLA 1K83B 2A6HC 1F2ZA 1U9RA 5KNBA 5L37A 2ASBA 1SR3A 2E2IH 3ITPA 4N8FA 2OTLA 3KOJA 2D62A 3VYSA 3I7FA 4NB3A 3CPWA 4JI2Q 2F0KA 4O42A 4A93H 1HQMC 5T1IA 3HOZG 1GHJA 1X3QA 2DJGC 4H02A 3UDGA 2I46A 5IGEA 3GTPH 1FYCA 2L0CA 2EYPA 5IOCA 1XX8A 2N3SA 3C3LA 1SBBB 4OGQC 3N6RA 1I94L 4HJ8A 3T51B 2ES2A 1DYQA 2NVXB 3PO2H 3PIP3 1J6QA 3J81j 5C0XJ 1SNMA 3Q24A 1W6JA 4HSVA 5LL6S 2WP8J 3OW7A 2CW0D 3P20A 4JOIC 1YJNA 3WOFA 3OYYA 1FL0A 5ISRA 1IYJB 3NBIA 3P1HA 1NMFA 4BBSH 1QVCA 5ELOA 2HUGA 5I4DA 4MNOA 2VQEL 4A3EH 1G2TA 1WD0A 1HNWQ 3GDEA 2YU9B 1B8AA 1YHQA 2NN6I 2AHOB 2EIFA 2KQ3A 2DJFC 3VA7A 4CJ2C 2K5NA 5LMUQ 1BR9A 3I3CA 2OWOA 1JE5A 1GUSA 1ICFB 4K2KA 5M3FG 2X6GA 4MHEA 4N9TA 1QILA 1R9TH 3QJYA 2B2VC 1K83H 4HR7B 1X9NA 3BZCA 2EYJA 4JI7L 2KEDA 3ZJYC 5M9OA 4ABNA 4Y7NB 4H0LC 1ZKOA 2PMZB 4NXNQ 4EQ5A 3F1ZA 3MFGA 3MFYA 4LUOA 2RCFA 2DNCA 2XRQD 4F88A 3DEPA 4DV4Q 2OQKA 1X55A 3U50C 1ESRA 4KY7A 4LFAQ 4ZCKA 1Y69U 5HGTA 4JBWA 1UWVA 4DAMA 3BDOA 1Q8KA 1PH5A 4A3BG 5IYCH 1PZKD 2O5JC 3GTKB 3WDNA 3GTJB 1JQYD 4DR3Q 1VS0A 3HOZB 4IPDA 4QIWB 1N8RC 3GO5A 1I4HA 1V1OA 1JOOA 4UPAA 2QF7A 1E7ZA 3MWYW 5BR8Q 2K52A 1LTGD 2A68C 4DUYL 2YU9H 3KLSA 1ONLA 4OL7A 2F3IA 3I4NH 3E5SA 1I4GA 1L2FA 5ELDA 4M8AA 3OMCA 4OO1G 4QB4A 2ID0A 3TP8A 2EOTA 1WTVA 1GOZA 4KKTA 1HXYD 1QG7A 4RCOA 3HG9A 1ILQA 1AN8A 2A6ED 2L12A 5LL6X 4N8X1 5M5WB 1B70B 4DNRB 3AMUA 4CKEA 3K59A 5EAYA 3TP7A 4DXFA 3ULLA 4Y7NH 4WJ3M 2LSSA 1STGA 4CJ0B 2PQAB 3NE5B 1LUZA 2ZXOA 1UE6A 2Q2HA 4DR2Q 5KNDA 4JI8Q 1V8QA 2DY8A 3CD6A 1LTBD 2IX0A 1HFGA 1EQTA 2EY5A 1JICA 1PTOC 5M3FB 2B39A 4K14A 2L4NA 1FNUA 2NZHA 5C3EG 1AE2A 4NMZA 4JOIA 2M2LA 4EQOA 1Q82C 3MXUA 2RHQB 2AQ3B 4DNTB 4KN7C 2A74C 5DM63 5FK9C 4RWSC 4DK0A 5C4JB 1U4LA 3H3VH 1SXTA 1DOLA 1N32Q 2K4KA 2NZ1D 4HAEA 3MTSA 4K8JA 2F0HA 3G6JB 1K3RA 2VY3A 3EROA 4DAYB 4LF4L 1VQOA 4FF4A 3NHHA 4HCSA 1WCMG 2BOSA 4B3ML 3K7AB 1KTKA 2I07B 4KK7A 1BNZA 4FNFA 5C4HA 3BS1A 4Z9CB 1XWEA 4R8IA 2BDNA 4A3BB 4R4QA 4A3DG 2B2VA 1SFOH 2VZAA 1EU4A 1VQHA 4J8QA 4WORA 5M5WH 1SROA 1IHZA 4FXDA 1IYUA 3GTGB 3NELA 2EY6A 2BCOA 1U5KA 3F2CA 3KBGA 2EXDA 1RTOA 2BA1A 1YHAA 2Q2UA 5M3FH 3BZKA 4C2MB 2XVSA 2QCPX 3MXGA 1HZAA 3JAME 1VQAA 1O7ZA 2R7FA 4DAPA 1K28A 3VDYA 2A69C 3VA5A 5C4JH 2B2TA 1PRTC 2H4OA 4RAUC 2PYKA 4UAIA 1EWIA 4GOPB 1LTSD 1YNJD 1VQDA 4BY7G 3A8KE 1F9RA 1CZGA 1XYIA 1EYGA 3F8TA 2R3ZA 2Y0SG 5C3EB 3K7AH 1IBML 3TSSA 1LT6D 2R6GA 5J39A 1KLGD 3AB9A 3R8BA 1R4PB 4EGVA 5JJIA 4PZ8A 1MD2D 3HOXB 4A3BH 1JB3A 4IALA 5TSSA 4IFDG 1O7IA 1IBKQ 1R4QB 3KF6A 1PH7A 2N49A 1X65A 3Q8DA 4H13C 1BQQT 3AFQA 4QF4A 1QZGA 1TS4A 1BOSA 2NBFA 2PNRC 4WJWA 5LMNW 3K5NA 1A0IA 5IP9G 1IZ6A 3GTGH 3MXPA 2XGTA 1WCMB 4JV5L 2O2LD 4HN7A 1XPUA 4DV0Q 1XNQQ 1U4RA 1CSPA 4OO1H 1WTRA 3ULJA 4JI4Q 4OHJA 4YCVA 5C4ZA 2R92G 4A3DB 3AYHB 4C2MH 4A3IG 3SK6A 4IUQA 4HIMA 4QCLA 5CV5A 4C3HG 2Z1CA 1MJCA 3JAML 5IODA 4B3SL 1I4PA 2KCMA 1EY0A 1W2BA 1HR0W 2H5XA 1VMCA 3SDZA 3BVMA 1CHQD 4KMUC 4KKUA 3NTHA 4LF9L 2WB1E 1EUJA 2WINB 4DKAC 2R7DA 3LX0A 3RNUA 4JYAQ 4HJAA 1AH9A 3NBHA 4RGOS 1CK1A 1QJOA 4ZUIA 3UE1A 4X3UA 2LFNA 2A5HA 4A3FG 1K0SA 4GNXC 3K0YA 2KHSA 2ICEC 3J7ZC 1OXUA 4DR1Q 3AQQA 4GLXA 3HS0C 2A68D 5IGFA 5IWAQ 4DXGA 5GADC 2R93G 3M4QA 4BY7B 1T9HA 1X3FA 1SNOA 2I5HA 3VR6A 1Y1WH 3AU7A 2Y0SB 1KRSA 1O7YA 3WWVA 4M1UB 5A35A 1U4PA 2MHVA 1KDAA 1RF2D 2KCCA 3M4OH 1NAPA 1KAWA 4XQJA 5EKIA 4QY7A 1I4RA 3TZUA 2EDGA 1II3A 2MGSA 3X3MA 2VL6A 2MJ8A 4IPGA 2K01A 2QGQA 2RCNA 4QUCA 3KFUA 1WTXA 1EY7A 5E3FA 2B2UA 4YHHQ 1O80A 1TWFB 3C46A 3KLRA 1EQRA 1QUQB 4UP7A 2F4VL 4DN4M 3L3OC 3S14B 5IGDA 1VQ7A 4POGA 1SNDA 1VQ6A 1GUOA 3CKIB 5DM73 2NN6G 2K05A 2E5LL 1ML0D 3K8AA 2R92B 1FVIA 2NB0A 3H91A 2KA7A 1X3EA 2QEJC 4A3IB 2EYHA 4DV2Q 3CMEA 2HIVA 4POFA 1N33L 1LTTD 4FDBA 4C3HB 1K8OA 2IL8A 4DR5Q 2GVAA 2MP1A 3IFTA 4DPGA 1BCPB 3V05A 2I5LX 3GP7A 1CUKA 3SEBA 2EZVA 4DR7Q 4OONA 2J0TD 2ICIA 3S2DH 1SLJA 1DM0B 2OEOA 5C0XH 1O7LA 4IUTA 5C5MA 1Y14B 2NTTA 5FO8B 3CCVA 5FLMG 4G7ZC 4P2CB 3PIOA 3K58A 1H9JA 3CW2C 2ATWA 2D0PA 3CCUA 4FXGC 1N34L 2JJQA 4C1NI 1YZ6A 1VQEA 4PQXA 5A2QL 3I4LA 4A3FB 4DV5Q 3I2ZA 3A7AB 1KRTA 3MHBA 5K36G 1L1OA 3TN2A 2CWPA 1RD9D 4GLVB 1GXDC 1VQ4A 3J81c 4NW2A 1JWMD 1ZYRC 2R93B 4DV1Q 1FGUA 4DV7L 1QB5D 5IP9H 1QWYA 3FMCA 4DUZQ 1QVGA 5LHY1 3EJIA 2UXDL 5JJZA 5K5PA 1TWFH 2KCTA 2NYZD 1N36L 2JA6G 2VB2X 4A3MG 1AW7A 3ONAB 3U9OA 5IYBG 3I70A 2MO1A 4ID6A 4DR6L 4BBRG 3ERQA 4OXPA 1SE4A 2SNSA 2RA4A 2JQOA 4YWLA 1ZXTA 4TKOB 1E2ZA 5CGKA 2R92H 3GTMB 1TWAH 4A3IH 3EA6A 5CV9A 4LFBQ 2JE6I 2UUAQ 1SNPA 1CKNB 1PRTD 3PUWA 5IT9c 1BCPD 1J5EL 1J8IA 3PUXA 1V1QA 5FOBB 3K0XA 3IAYA 2MNAA 3LWEA 5M5YH 3JAMi 3RZDB 4IFDI 3I4MG 3PUZA 4X6AH 3DWPA 3S2HB 3N52A 2I5MX 5D14A 1I3QB 4A4IA 4TQUS 4X62Q 4JVZA 2KENA 3HKZE 2EYLA 4R4IA 4R8NA 2EY2A 1RIPA 4A3FH 1UUPA 5JJLA 1HUNA 3J7AV 3PUYA 3S16H 3CU7A 3HFZB 3C1FA 4K6LA 4F8MA 1PH8A 1SYDA 2R93H 3PIPA 3H3VC 2X69A 1SDFA 1YITA 3MEFA 1HA6A 4P73A 2FFKB 4OX9Q 1TU2B 3G48A 3A5UA 3J80c 2N78A 2LKVA 1D5XC 1K8GA 2UUCQ 1AFPA 2N55A 2RBMA 4APVA 2KCNA 1B9MA 3KYHC 3SHLA 1STEA 2ZTCA 3Q0AA 3CCEA 3GTMH 1WTOA 4ZKCB 1AEXA 4FF1A 1EZ8A 4CKCA 3H6MA 3OHXC 1RJTA 3GD7A 3HOUG 2HQLA 3K81C 1TT2A 1Z6HA 2F0WA 1XMQQ 4MTKA 4A3CH 2JA6B 3T53B 1LTRD 1EZ6A 4A3MB 1LT5D 3FHWA 2O4XA 3RLFA 4X3TA 3NTKA 4A3LG 2F3WA 4XT3B 4BBRB 1CFMA 3T1YL 1C4QA 2NN6H 5E7NA 3J7YW 2RSOA 4KHZA 5IT9E 4LF6Q 1IW7C 4YCUA 1I3QH 2MUYA 2F0JA 4RHRA 4DV4L 1HNZQ 1A2TA 1EWCA 5CR3A 4C3IH 2ZXRA 4HIDA 2A19A 4LFAL 5F2DA 3KLWA 5C4XB 1BVSA 4PNYA 2L15A 1GUTA 2XSCA 1CI3M 1Q90A 3I4MB 2AWOA 2EJFC 3DEOA 3OTOQ 1PMRA 3M7NA 1EOTA 2DNEA 2Q2IA 3I4OA 1HQRD 2DGYA 1G291 3QO2A 5FLMH 4IFDJ 5IGBA 4A3KB 2GVBA 2NVQB 2Z9HA 1XNRQ 1VQIA 5I6WA 3PV0A 1BBUA 2NVYB 1NMGA 3TP5A 3OWFA 4CHTB 2IT1A 3E0EA 4X64L 1DONA 1D6EC 1HJPA 1XMOQ 2K14A 4KV6A 4R9WA 1Y8NB 1F77A 4UY8C 1G51A 3A74A 1NJIC 1UE7A 1F9QA 3B6YA 3D6CA 3EVQA 1SMXA 2BE5D 2H1EA 1D1IA 2JA6H 4IZ8A 4DV3Q 5IYBH 5JPNC 1NUCA 1TWCB 2YTVA 1A2UA 1C0AA 4BBRH 5GQOA 3L9AX 4H44C 5M5XB 2K5DA 4DGZA 2L55A 1MI2A 1LV9A 1PZID 2EYOA 3ZYYX 5CBAE 1ICWA 2KVMA 3HOUB 2NUCA 2NVXH 2J4XA 5BN4A 2B2YC 5JVG3 2E2JB 1I5FA 3TBIB 4KJOA 4A3JG 3JC66 1KLUD 4GZYC 3HOYG 4ILWA 3I4MH 3OOCA 3RLNA 1MGSA 3BYTB 5JEAG 4X65L 3D6WA 5HY6A 4DV6L 1I94Q 4C56C 4HIOA 3VYTA 5D3DA 1Q81C 2PZTA 1N32L 1RHPA 2NVQH 4GOPC 2AQ2B 2F0GA 4NP5A 2AKWB 3EIVA 3R2TA 4YCWA 2VNUD 5C44B 4MZ9A 2JYOA 2QDLA 1SJED 4JI3L 1X54A 3DWQA 4P72A 4X3KA 1MKHA 2FINB 2HHHQ 2XWBB 1B3AA 4HJ9A 2E2DC 1PH9A 1UNSA 1O78A 2V1CC 1HHVA 1DOMA 1FJGQ 2WACA 2YV5A 2PQEA 1BBWA 1YVCA 4IPCA 1A3VA 1TWCH 2BA0A 1W6KA 3HRZC 3J7A5 2IJ0A 2ZT9C 3CCQA 3D0FA 4OWTB 2IHFA 3AEVA 1M4VA 4IOCA 4ZYSA 4OEMB 4KHVA 1EY8A 1S5DD 1X3PA 3M85A 5JOBA 2ENBA 3CQZB 2E2JH 2EE1A 1CSQA 5C3WA 2WB1G 1D8LA 4FO2A 4G7OC 1XJVA 4A3LH 2HQEA 3HOXG 5M3MG 5JPMC 3GTKH 1C7YA 3GTJH 3D4WA 4LJZC 4RHSA 3K57A 4JI1L 1CA5A 3HOZH 4RGMA 4JC0A 4EX5A 4NDXA 2VQFL 5JAVA 1P16A 1MBYA 1VCIA 2YYZA 1YJWA 3GTQB 2OTJA 3S1RB 3U4ZA 2G9HD 3ER0A 2LXKA 3CCLA 1F9PA 3TEHB 3Q22A 3VR4A 1S5FD 2SOBA 3BJUA 3RUZA 4CDEC 5EPJA 5HURA 1GHKA 2F0PA 1TWHB 3M4PA 4A3JB 3HOYB 4QIWE 1YNNC 5ELNA 1KDBA 4DNIA 4K2LA 3K5MA 2E76C 3S1QB 1STHA 2QA4A 3DLLA 3CCRA 4JI6Q 2B3GA 3Q23A 4DUYQ 3CHBD 1NY4A 3TS0A 4LF8Q 4KJNA 1D1KA 1TS2A 1KDCA 3T13A 4K6DA 2ZM6L 1I6HB 4YWKA 1B50A 2IW3A 2D5DA 2NZOA 2C35B 3DWAA 4V190 4DV0L 4C3JG 1CHPD 2LXJA 2PW5A 3E0JA 2JA5G 1XNQL 4KHPQ 2A6HD 1HRJA 5I2YA 3I8ZA 5E1FA 2UXCL 4IURA 2B2YA 1BKBA 1HZ9A 1PFSA 2K1BA 4IUPA 3RD4A 3L2PA 1K73C 2K5HA 3RMHA 1PH3A 2JA8G 3CQZH 2R7ZG 1PYBA 2O5IC 2JEBI 4XQNA 3F2DA 4XDXA 1E2WA 1KIXA 4QL5A 1EYAA 1VQFA 2TSSA 1KC8C 3RZOB 4R4CA 4EQNA 5DEHA 2SDFA 2CHBD 3S1NB 3GTOB 4R4TA 3H15A 2HD3A 1HTLD 5EQ0A 3S1RH 1YEZA 1TY2A 4F7XA 4ALPA 1DZ1A 4JW0A 4MTNA 4R4OA 5KRUA 4CDFC 5EBDA 1EY9A 2WB1B 1TWHH 5FO9B 4JYAL 1Q7YC 3HOYH 1YNXA 5I9OA 4CJ1B 5H1SE 3PQIA 5KYIA 5M3MB 1A63A 5J1ZA 2JSOA 3ERSX 4B3RQ 2E2HB 2NWGA 1SNCA 4R1JA 4JBJA 1XTCD 1F9SA 2UXBL 3CC4A 4DR1L 3NXWA 3FVQA 4B3MQ 3P7JA 3L0OA 4KLKA 4LF5Q 2Z6KC 1LLRD 1KQSA 1A6XA 1I6HH 5KNCA 4X66L 3HOWB 1HNXQ 3I91A 4KY5A 4KKSA 2F0LA 4J15A 4K0KL 4O1NA 2EJMA 5IGCA 1Y1VG 2JA7B 1IKLA 1SMYC 3RLOA 2XNAC 1F2LA 2F0TA 3KF6B 4P71A 1G6ZA 3CCMA 4DU9A 2G9DA 1MJEA 1PFMA 1T5EA 4AYBG 3J80i 2K7VA 3T16A 1YI2A 3MXNA 1XTDA 1ENFA 2MFIA 4K5VA 1N9WA 4PV1C 3S1NH 2F0NA 4JI5Q 4C3JB 2JA5B 1Q12A 3M3YB 3H0GG 3BYYB 1NNXA 2A73B 4YY3L 1BDOA 4TVAB 3I90A 2JA8B 5C3EH 2R7ZB 1KXLA 4Y52H 3T1HQ 2WAQG 1PYWD 1VQMA 1QE6A 4B9XA 2CWAA 3QIAA 3HOXH 5M3MH 5DLQE 4Q0FA 1PRTF 1TKWB 4GKKQ 1BCPF 2KBNA 3G4SA 4DR7L 2DN8A 4XIGS 2BH2A 5JJKA 1IBMQ 2FMMA 3FKIG 4LNQA 2AMCB 2V4DA 1FD7D 2P5ZX 1PV4A 4JBMA 4B08A 3TZDA 1WCMH 2F03A 2WIIB 3MC0B 3NBHB 4ME3A 3CC2A 2B63G 3M7GA 1HFNA 1FR3A 4QJFA 4DF7A 4K5XA 1UE1A 3NENA 4LAAA 1ASZA 5IGGA 4A3DH 2QILA 1SNQA 1STNA 2LMCB 1CKMA 5FLXc 4L5QA 2CW0C 2ZTDA 2KHIA 3AFPA 3BVZA 3GV3A 1EEID 3CRLC 3KBXA 2A1AA 1K8AC 1B44D 3TREA 2EPBA 4UP8A 4IOAA 4DV1L 4DUZL 1PTOD 2RHSB 1PXUA 1GJXA 2K04A 3W3AA 1OXVA 3V96A 1Y1VB 2E75C 4LFCQ 2PI2E 3TS2A 3T4AC 4CDCC 4UHVA 1EIYB 1Z9FA 1ENCA 4LWCA 1LYLA 2R7ZH 4B3SQ 1F2YA 1JJGA 5COYA 2YTXA 1GO3E 1JB7A 4LFBL 4JI0L 1PDQA 2UUAL 1PRTB 4AYBB 2VUMG 1B1ZA 4TRDA 1V1PA 3PF4A 2CQOA 2K50A 3S24A 2CKZB 3UE0A 3BG3A 1E24A 4LF9Q 4A93G 1VQPA 2XTIA 3C1EA 1E3PA 3L7ZC 3NWSA 2Z6KA 1IBLQ 3Q6SA 2HCCA 3H0GB 4BY7H 3RN5A 5JEAJ 3TDQA 4XYOA 3PGZA 5IE8A 2SEBD 2MPMA 2WAQB 2CCZA 4X62L 2GN5A 3W1GA 1SEBD 2PZUA 2AWNA 2F0IA 1PLFA 4PG3A 1ET9A 3PO3G 1PVOA 3HEJA 4IFDH 2ALYB 1IL8A 1EQQA 4YWMA 2K6AA 4P75A 1QZHA 5FJ8G 5G3LD 4RGNA 2Y0SE 1EOVA 2K33A 4XXEA 4DK6C 2SNMA 3FKIB 4BBSG 3EBEA 2JK8A 2KEEA 4NXMQ 3K5OA 3S14H 4OX9L 1F2MA 5HGQA 3SK5A 1CQFA 3VYUA 3OPOA 2B63B 5CV4A 4IPHA 4A75A 4IJHA 1LTLA 3D4DA 2D9UA 1Y1VH 1SJHD 1HTPA 1X3GA 1L1OB 3SK4A 1ILPA 1BBXC 1B4OA 5D65A 2CQAA 2YTYA 1GKHA 3KDFA 5GAGC 2HCIA 2ZTEA 1OXXK 2Z8LA 1C48A 2A69D 2HIXA 1X32A 4GNXA 2F0QA 3I73A 4C3HH 5CMDA 1JMCA 1E1TA 1GUGA 1YIJA 1M1KC 2A6EC 2E5LQ 5C4XG 1QNKA 5CV8A 2Q2TA 1STYA 4BXXG 4QMGA 1Q1BA 1E22A 1SAPA 1RCVD 1I6VC 1PH4A 3H0GH 2IY5B 2F0FA 2K5QA 2Q8TA 4JI2L 4A3KG 2BDOA 3D3RA 2KJXA 4GN3B 1EIGA 2QW7A 4GNXB 4KTAA 3IRBA 3PIO3 1PFNA 2IHEA 2E2IB 1STAA 3R93A 2VUMB 4UP9A 2B2WC 4JG2A 3GQBA 1VQKA 4JBKA 3K5LA 1X56A 4A93B 4C1NK 4B9WA 1DOKA 4YIJA 1N34Q 2UU9Q 3KF8A 1S4ZA 1IXRA 1SYFA 4G57A 3OTOL 4AQYQ 1SMYD 4L5TA 3I4NG 4BA2I 1PA6A 1XNRL 2B63H 3SXHA 1GUWA 1H9MA 3J81E 1LM0A 1L0XB 1HNWL 1H9KA 3PO3B 4GKJQ 2RDGA 1B7YB 3D31A 4S3SA 1EYCA 1U0LA 4U673 1SYGA 1PH6A 2F1MA 3X3NA 1OTCA 2UXDQ 1ENAA 1LACA 1XMOL 4RFBA 3QG1A 2OF1A 5LMUL 2XRSD 3S9WA 4BBSB 4LF7Q 2LS01 5AJ3Q 4DR6Q 1RTNA 1AZPA 2L11A 1JE4A 3LNNA 4IO9A 2UUBQ 3IKJA 3RZDH 4DR4Q 2X6LA 3S2HH 4L8JA 4NXNL 3FPPA 4WJ4A 1AZQA 1AE3A 1EIFA 1KAAA 2JEAI 1WD1A 2F52A 1J5EQ 5IYDG 2KECA 1R9TB 3HP3A 1KHIA 4O2DA 1OXTA 1HH2P 4B3TQ 5C44G 5E4WC 1E1OA 3ULPA 1XXGA 3VYRA 1GM5A 2VUMH 4HMIA 4HIKA 3HGBA 1CZWA 4E6IA 5GROA 1VQBA 1OO9B 3OWEB 3J7AF 3PSIA 3E3XA 3MA2B 4DR3L 2E8GA 5LMNQ 3TP6A 4V0BA 1QVFA 2C9OA 1D2BA 4GS3A 4TSSA 1RDPD 1YNJC 3KLSX 2MO0A 3G7LA 4I7AA 5BR8L 1G91A 3E6ZX 4OWWB 3O13A 1P8LA 3PO3H 5K36H 1I4QA 2PW7A 3J81L 1NSNS 3S17B 1GVPA 3CCJA 2KOLA 1CQVA 3NWTA 1TS3A 2HHHL 5FJ8H 1UAPA 1Q46A 3J80E 5IP7G 4IUUA 5IY0A 1JCKB 3M4YA 3CMAA 1JOKA 1PHJA 1VQNA 1FJGL 1KL9A 1DCZA 4A3MH 2EYMA 1HPCA 4AH6A 4HSPA 2G5DA 3HOVG 3I4NB 3QB3A 4EVOA 2B8FA 3RR5A 3UDIA 2F0SA 4RH6A 2OQ0A 2K75A 1BXTA 2Q8IB 1HR0Q 1TWGB 5DAUA 1NR2A 4DR2L 3ICEA 1NTGA 1K9MC 4JI8L 4L5RC 5IT9L 4N9PA 1D5MC 2EVBA 3STBC 1VDZA 4FYDA 1H95A 3BDLA 2B2WA 4L6TB 3MAQA 4P74A 4ODGA 3H09A 1TVXA 3T1YQ 3SE0A 1TXYA 3RN2A 5C4XH 3QOLA 5I6YA 1RODA 2KHJA 2K03A 3G71A 4BXXH 1KNAA 2NVTB 1S5CD 1VQGA 3FEWX 3TQYA 1CA6A 1JORA 1KNEA 3CCSA 4BS9A 4WRDA 3HKSA 1TQOA 4XQQA 2JN4A 4A3KH 1YJ9A 1B9NA 2WV6D 4LW1A 4MIUA 3R3OA 4GN4B 1TY0A 3F2UA 2NTSA 1MSGA 2NVYH 1JWSD 1SYCA 1ZYRD 4NKLA 3A8JE 1BO0A 4K8IA 3S17H 2Z0SA 1VQ9A 2EXZA 1YHBA 3KJOA 3E9HA 4LUZA 2GA4B 2JP1A 2VQEQ 2B2TC 4BA1I 3J80L 3EQLC 4JI6L 2PPBC 4G7HC 2R61A 2PQAA 4X64Q 2OXPA 4LF8L 3LGJA 3ND8A 3D8GA 1NR4A 5C5LA 5M5XH 5JVH3 2EY1A 2HDLA 4KI0A 5T1GA 1TWGH 1LTID 1YBYA 1SRUA 3CXCA 3OIPA 1SFOB 2PO4A 3CAMA 3W1BA 2Z4HA 4JI7Q 4L63B 3HOUH 1WVLA 1DXMA 4KHPL 3F2BA 1VQ5A 2PMZE 1OXSC 4PZ7A 4AIMA 1RL2A 4KN4C 1EEFD 4BWGB 3NQIA 4MN3A 3JAMc 2NVTH 3HOVB 1B53A 2RDFA 2F0OA 4DAYA 4RGTA 5EPLA 1GUNA 2OCEA 3I72A 5IYDH 1SE3A 5BN3A 5AFWA 5C44H 1CKOA 1WI5A 3BZDB 5CBEE 3HOWG 2XWJB 4X65Q 1S3OA 3A54A 4DV6Q 2QKIC 3LWUA 4JCVE 4JK1C 2JXMB 3DUZA 1EY4A 1TR5A 4LMQD 3BU2A 4OIJA 1QCBD 3MEHA 2JA7G 5NUCA 1NE3A 1VF5C 2VW9A 1NBWA 1IBKL 1S5BD 4B3RL 4FF2A 3DHQA 4PMBA 1SYEA 4JI3Q 4ZKBB 5C6AA 4ULLA 1Y1WG 2I0QA 2J7ZA 5FO7B 1VF7A 2AQ1B 3KJPA 4LF5L 2OT2A 2ZJPA 2RDHA 4L5SA 3TRZA 2CFMA 5EPKA 2K5VA 5ELFA 1HNXL 4QUFA 1SYBA 4ZAIA 1G6PA 1GD7A 3BDCA 1BF4A 4JI4L 5IP7H 3J81i 4UDUC 2L5TA 1SSOA 1IKMA 5CORA 2ZJRA 2JA9A 3NUCA 3NEMA 1MIUA 1IW7D 5EBCA 3HOVH 3DMUA 1I4XA 1SE8A 3H3VI 4QQBX 3CC7A 4GOPA 5I2XA 3VR2A 5E4XA 4BY1G 5C3XA 3GTLB 5EKKA 3GTQH 1PTOF 4JI5L 1VQ8A 1SE2A 3EN2A 1PYSB 1HA5A 4NPSA 5KIXA 2HT1A 3NSWA 5IIFA 2Q8RE 4JI1Q 4A3JH 3T1HL 2PNHA 5ELBA 2B2UC 1LTAD 4K5WA 2VQFQ 1EY6A 4LF4Q 3S1QH 1BCPC 5JEAH 3URYA 3R2IA 1H9RA 1VMPA 1W3SA 2RF4A 5C0XG 5J22A 3QR8A 5D3IB 4F87A 2Z4IA 3FP9A 4WFN3 1STBA 4GKKL 4IJLA 5ELEA 5IWAL 4I65A 2K28A 1E0BA 1L0WA 4HCEA 3A56A 3H94A 1HUMA 4X3SA 4FVMA 4I7ZC 4KD4A 4GLAC 3CPFA 4HEDA 4A76A 1WTPA 2PI2A 2ZM6Q 3CRKC 3MVVA 1Y1WB 2K5WA 2RSNA 5G3LF 3RZOH 3M4OB 4YHHL 1ASYA 2UXCQ 3G6EA 3STBD 2VB3X 1PTOB 2F4IA 3UDXA 1CM9A 1EQVA 1K3BC 2WFWA 4DFAA 3GTOH 2B29A 3C2PA 2HDMA 2IX1A 5CYUA 3GTLH 3S1MB 2VS1A 1U4MA 1L1OC 1B3QA 4J1MA 1L0YB 5EGTA 4PMWA 1XPOA 1JT8A 4LFCL 2VXWA 1H9SA 2IX3A 1IL2A 1TS5A 2E74C 3NPPA 4RCNA 4DK1A 1BUVT 4DV2L 1EFID 1S40A 1EY5A 3HKZG 2TMPA 4XYQA 1V43A 1A15A 2WKDA 4DR5L 3MXNB 2E2HH 3NQTA 1EU3A 1IYVA 1Q3LA 3PMFA 5GAEC 4RG1A 1JWUD 4BY1B 2FJ2A 1JOQA 1FNVA 4FP5D 1IBLL 3D4RA 4DK3C 2F0VA 5CV6A 1H9SB 3S15B 3I56A 4A3GG 2RKSA 3KK7A 3HOWH 1QNUA 1RKNA 3M9BA 2PZWA 3IL8A 4OO1I 1Z7TA 5ELCA 3PUVA 4ME5A 3QWNA 2UXBQ 1UE5A 2JA7H 3S2DB 2FMCA 4DV5L 3VR5A 3QOJA 1PH2A 1G8ZD 2F0UA 2F0MA 1Q86C 3FRPB 2AUKA 3T56B 2A8VA 4X66Q 3IFDA 4JV5Q 5J3BA 3CP0A 5EJWA 1QUQA 2ZJQA 2B8GA 1X6OA 2CVRA 3DM1A 4HTHA 3V2TA 3U4VA 5A2QE 3U58A 1WFQA 4K0KQ 1KABA 3W5OA 4HJ7A 2XN9C 1E2VA 1PTOH 4HJ5A 4FXKC 4NXML 1A62A 1A3TA 1S5ED 1WJJA 4H7BA 3NK9A 3WOEA 4C3JH 2JA5H 2EJGC 3S1MH 3M3YH 3OSOA 4ZQ3A 3MZ5A 2JA8H 4RKLA 4QGUA 3UI2A 2LY7A 4CDDC 4A3CG 3TMEA 2D2CC 4IUVA 1Y8PB 3A55A 4IUNA 3PF5A 2BE5C 1DGSA 1I50B 4YY3Q 1FGBD 4RMFA 2EYFA 4DAVA 3OW2A 3A8IE 5EKLA 2IPKD 4G4KA 4BY1H 1TWAB 1D7QA 1ET6A 1HZBA 1VQCA 4OELB 1EWHA 2FHTA 3K80C 2F0DA 1YNND 5I9PA 2QDBA 3S15H 4C3IG 4EQPA 3PO2G 3A5ZB 4HMJA 2Z6BA 3CF5A 1WYDA 1Q8IA 1ESFA 3HKZB 1T5XD 1V9PA 2N8NA 4PMCA 4LUVA 1D5ZC 1V1PB 5M5YB 4ZUJA 1J9OA 1C8CA 4OWXB 4RKBA 5DNFA 3W2DA 3I55A 4KY6A 4RA8A 5GAHC 2L9HA 2N88A 5CV7A 3ND9A 4DA2A 2UU9L 4A3EG 4ZLTF 1S72A 5KYLA 4A3GB 1WOCA 1M8AA
chains in the Genus database with same CATH topology
1D8LA 4AQYL 3PSIA 4A3IG 1XJVA 4A3LH 1PH1A 4HIMA 3HOXG 5M3MG 4DR3L 2E8GA 3GTKH 1C7YA 5LMNQ 1JJCB 3GTJH 1SN8A 2UUCL 4JI1L 1MJCA 1VQJA 1Z47A 1QVFA 3HOZH 4GS3A 4JC0A 4EX5A 2MO0A 5BR8L 2VQFL 4B3SL 1P16A 1VCIA 1CKNA 2YYZA 1YJWA 4OWWB 2KCMA 4GKJL 2OTJA 1P8LA 2BH8A 1W2BA 3PO3H 2F4VQ 1HR0W 2H5XA 3U4ZA 1GVPA 3ER0A 3CCJA 2LXKA 3CCLA 3TEHB 2HHHL 5FJ8H 1KD1C 1Q46A 3BJUA 4LF7L 5IP7G 5AJ3L 5IY0A 1XMQL 3M4PA 4LF9L 1I50H 2WB1E 3E9IA 4QIWE 3CMAA 1EUJA 5ELNA 4DKAC 4DNIA 2R7DA 1K0RA 3RNUA 1PHJA 4JYAQ 4HJAA 2UUBL 1AH9A 1VQNA 1FJGL 3UE1A 1KL9A 4A3MH 5C0XI 2QA4A 4DR4L 3DLLA 3CCRA 4A3FG 4JI6Q 4AH6A 2B3GA 1N33Q 4DUYQ 3DM3A 3HOVG 1NY4A 4GNXC 4AYBE 3TS0A 4JI0Q 3J7ZC 4LF8Q 3KDFB 3RR5A 1OXUA 2D0OA 3UDIA 4LF6L 4DR1Q 2OQ0A 3AQQA 4GLXA 2K75A 1HR0Q 4O0AA 5IWAQ 4DR2L 3ICEA 1NTGA 1K9MC 1HNZL 2ZM6L 4JI8L 5GADC 2R93G 4L5RC 4YWKA 3M4QA 4B3TL 2FXQA 1T9HA 3STBC 1X3FA 2I5HA 5IYCG 1H95A 3SGIA 2NZOA 2C35B 4P74A 1Y1WH 4DV0L 2JA5G 2LXJA 1XNQL 4KHPQ 1KRSA 3T1YQ 2EQSA 1TXYA 3RN2A 3WWVA 1EFWA 5C4XH 2UXCL 4GN5A 1BKBA 2MQHA 2WAQE 1HZ9A 1PFSA 3L2PA 3FKIH 3M4OH 1K73C 2K5HA 1KAWA 2KHJA 3G71A 1PH3A 2JA8G 4BXXH 3CQZH 2R7ZG 1VQGA 1PYBA 3TQYA 2JEBI 3UDFA 3F2DA 4QY7A 4A3GH 3CCSA 1KIXA 4QL5A 5LMNL 3HKSA 1VQFA 2VL6A 1C9OA 4IPGA 4A3KH 1YJ9A 1KC8C 2QGQA 4LW1A 4R4CA 2RCNA 3KFUA 4GN4B 4XTCS 1A8VA 4YHHQ 4R4TA 3H15A 4DV7Q 1XPRA 3PCOB 2NVYH 1EQRA 1QUQB 4UP7A 2F4VL 1Q1EA 1N36Q 1VQ7A 4POGA 1VQ6A 3S1RH 3S17H 1YEZA 3KF8B 4ALPA 2Z0SA 1VQ9A 3KJOA 1YHBA 2NN6G 3E9HA 2E5LL 2QEXA 4MTNA 4R4OA 4LUZA 3K8AA 3A0JA 1FVIA 1TWHH 2VQEQ 4JYAL 1Q7YC 3HOYH 1X3EA 1YNXA 4BA1I 5H1SE 4DV2Q 2DUDA 1A63A 3CMEA 4DV3L 2HIVA 4JI6L 4POFA 1UEBA 1N33L 4PZ6A 2PQAA 3ERSX 1HZCA 4FDBA 4R1JA 4X64Q 4B3RQ 1JJ2A 4JBJA 4DR5Q 4LF8L 2GVAA 3LGJA 2UXBL 3CC4A 4DR1L 4DPGA 2I5LX 1HR0L 4B3MQ 1CUKA 5M5XH 4DR7Q 4KI0A 3L0OA 4OONA 4KLKA 1TWGH 3K7UC 1M90C 4LF5Q 1SLJA 1VQLA 3S2DH 1YBYA 1SRUA 2Z6KC 3CXCA 1KQSA 3CAMA 2ASBA 1SR3A 1I6HH 4X66L 3W1BA 2E2IH 1HNXQ 4JI7Q 3HOUH 1Y14B 2OTLA 3KOJA 2D62A 3CCVA 5FLMG 3F2BA 1VQ5A 4KHPL 3I7FA 2PMZE 4NB3A 3PIOA 3CPWA 2ATWA 3CW2C 1OXSC 2D0PA 4J15A 4PZ7A 1RL2A 4JI2Q 4AIMA 2JJQA 3CCUA 1Y1VG 1N34L 4A93H 1YZ6A 3RLOA 3HOZG 3UDGA 1VQEA 4H02A 3KF6B 4P71A 3GTPH 4DV5Q 3CCMA 3JAMc 3I2ZA 2N3SA 2NVTH 1KRTA 1I94L 5K36G 4HJ8A 1L1OA 2ES2A 2CWPA 3PO2H 1MJEA 4GLVB 1J6QA 3J81j 5C0XJ 1VQ4A 4AYBG 3J80i 3J81c 2WP8J 2OCEA 1YI2A 4DV1Q 1FGUA 4DV7L 5IYDH 1XTDA 5IP9H 2MFIA 4DUZQ 1QVGA 3S1NH 1N9WA 2UXDL 4JOIC 1TWFH 2KCTA 4JI5Q 1YJNA 1N36L 3OYYA 2JA6G 5C44H 1CKOA 1WI5A 4A3MG 1FL0A 5IYBG 3HOWG 1IYJB 1Q12A 3H0GG 4X65Q 1S3OA 2MO1A 4YY3L 1NMFA 4DV6Q 4DR6L 4JCVE 4BBRG 4TVAB 4BBSH 4OXPA 1QVCA 5ELOA 5C3EH 3BU2A 2VQEL 2JQOA 4MNOA 4YWLA 3T1HQ 4A3EH 2JA7G 2WAQG 4Y52H 2R92H 1VQMA 1HNWQ 1NE3A 2VW9A 3GDEA 1TWAH 1NBWA 2CWAA 4A3IH 1IBKL 3HOXH 4LFBQ 2JE6I 5M3MH 4B3RL 1B8AA 2UUAQ 1YHQA 2NN6I 2AHOB 2EIFA 5DLQE 1CKNB 4JI3Q 3PUWA 1Y1WG 2I0QA 2K5NA 5IT9c 5LMUQ 2OWOA 1JE5A 4GKKQ 2KBNA 3G4SA 1J5EL 3PUXA 5M3FG 4DR7L 2BH2A 4XIGS 1V1QA 3KJPA 1IBMQ 4LF5L 5JJKA 3FKIG 4LNQA 2ZJPA 1R9TH 3K0XA 2AMCB 2MNAA 5M5YH 3JAMi 4L5SA 3TRZA 1K83H 2CFMA 1X9NA 3BZCA 2K5VA 1PV4A 1HNXL 3PUZA 4JBMA 4JI7L 3I4MG 4X6AH 1WCMH 3ZJYC 1G6PA 1GD7A 2I5MX 3NBHB 4ME3A 4JI4L 5IP7H 4NXNQ 3J81i 3CC2A 4EQ5A 3F1ZA 2B63G 4LUOA 4A4IA 4TQUS 4X62Q 2ZJRA 2JA9A 2KENA 3HKZE 4QJFA 4R4IA 1UE1A 3NEMA 3NENA 1ASZA 4A3DH 1MIUA 4DV4Q 2OQKA 1CKMA 1RIPA 1X55A 5FLXc 4L5QA 4A3FH 3U50C 3HOVH 4LFAQ 2ZTDA 2KHIA 1SE8A 5JJLA 3AFPA 3PUYA 4JBWA 3S16H 3H3VI 2A1AA 1K8AC 4IFDI 4QQBX 1UWVA 3TREA 4DAMA 4UP8A 3CC7A 4IOAA 4GOPA 3HFZB 4DV1L 1Q8KA 4DUZL 1PH8A 4BY1G 2R93H 2RHSB 3PIPA 3GTQH 4JI5L 1YITA 3MEFA 1VQ8A 1PH5A 4P73A 4A3BG 3EN2A 5IYCH 4OX9Q 3G48A 3A5UA 1PYSB 1OXVA 3J80c 4DR3Q 2N78A 4NPSA 4LFCQ 1VS0A 2PI2E 3TS2A 2HT1A 4IPDA 1K8GA 2UUCQ 4JI1Q 4A3JH 1N8RC 1EIYB 3GO5A 3T1HL 1Z9FA 2PNHA 4LWCA 1LYLA 4UPAA 2R7ZH 4APVA 1E7ZA 3KYHC 5BR8Q 2VQFQ 4B3SQ 4LF4Q 3S1QH 2ZTCA 1JJGA 2K52A 3CCEA 2YTXA 3GTMH 1GO3E 4DUYL 1JB7A 2YU9H 4LFBL 4JI0L 1W3SA 2RF4A 5C0XG 2F3IA 2UUAL 3I4NH 2VUMG 3GD7A 3FP9A 3HOUG 2HQLA 3K81C 4K0KL 1L2FA 3PF4A 2CQOA 2K50A 3S24A 4IJLA 2CKZB 5IWAL 2ID0A 3UE0A 4GKKL 4OO1G 1E24A 1XMQQ 4LF9Q 4A93G 4A3CH 1VQPA 2XTIA 1E3PA 3L7ZC 1L0WA 2Z6KA 1IBLQ 3FHWA 3RLFA 4A3LG 3RN5A 4BY7H 3T1YL 1B70B 5E7NA 5JEAJ 5EAYA 3PGZA 3ULLA 5IE8A 4Y7NH 4WJ3M 2LSSA 2CCZA 4KHZA 4X62L 4LF6Q 2GN5A 4YCUA 2PQAB 3W1GA 1I3QH 4GLAC 1LUZA 2AWNA 3CPFA 1UE6A 2Q2HA 4PG3A 4A76A 4DV4L 4DR2Q 2PI2A 1HNZQ 3PO3G 2ZM6Q 4JI8Q 1PVOA 3CD6A 2IX0A 2ALYB 4C3IH 4HIDA 2A19A 1EQQA 4LFAL 4YWMA 4P75A 1QZHA 5FJ8G 2Y0SE 3KLWA 1EOVA 4DK6C 1BVSA 2L15A 3RZOH 4BBSG 4YHHL 1ASYA 2UXCQ 3EBEA 3STBD 2JK8A 3G6EA 2NZHA 5C3EG 3UDXA 1AE2A 3GTOH 2WFWA 2B29A 2AWOA 4JOIA 4NXMQ 2IX1A 3OTOQ 3S14H 4OX9L 3GTLH 1Q82C 3M7NA 2RHQB 2VS1A 2Q2IA 3I4OA 5HGQA 1L1OC 2DGYA 1G291 5FLMH 4IFDJ 4IPHA 4PMWA 2GVBA 4IJHA 4LFCL 1LTLA 4A75A 1XPOA 1JT8A 1IL2A 3H3VH 1XNRQ 1Y1VH 1VQIA 1X3GA 1N32Q 1L1OB 2K4KA 3PV0A 1BBUA 4DV2L 1K3RA 1NMGA 2VY3A 4DAYB 2YTYA 1GKHA 3HKZG 1VQOA 2IT1A 3KDFA 3E0EA 1S40A 4LF4L 1V43A 5GAGC 2ZTEA 1OXXK 4X64L 2HIXA 1HJPA 4DR5L 4GNXA 3MXNB 1XMOQ 2K14A 2E2HH 4C3HH 1JMCA 1WCMG 1E1TA 1YIJA 4B3ML 1M1KC 4UY8C 5GAEC 1G51A 2E5LQ 3A74A 4RG1A 1NJIC 5C4XG 1UE7A 2Q2TA 1KXLA 3B6YA 4BXXG 1SMXA 1Q1BA 1IBLL 1E22A 4DK3C 4R4QA 2JA6H 4A3DG 3I56A 1SFOH 4A3GG 4DV3Q 5IYBH 2VZAA 1PH4A 3HOWH 3H0GH 2YTVA 2IY5B 1VQHA 3M9BA 4JI2L 1C0AA 4BBRH 5M5WH 4OO1I 4A3KG 1SROA 5GQOA 2UXBQ 3PUVA 1UE5A 4GN3B 2JA7H 3NELA 4DV5L 4GNXB 3IRBA 1PH2A 2IHEA 1Q86C 1U5KA 3F2CA 4UP9A 2A8VA 4X66Q 4JV5Q 4JG2A 2EXDA 5J3BA 2NVXH 3CP0A 1VQKA 4JBKA 1QUQA 2ZJQA 1X56A 2BA1A 1YHAA 3U58A 1X6OA 3U4VA 2Q2UA 1I5FA 5M3FH 3BZKA 1WFQA 1N34Q 2UU9Q 4K0KQ 3W5OA 3JC66 4HJ7A 4A3JG 1IXRA 3HOYG 4NXML 4HJ5A 1HZAA 3OTOL 1A62A 3I4MH 4AQYQ 3RLNA 1WJJA 4C3JH 5JEAG 4X65L 2JA5H 1VQAA 5HY6A 4DV6L 1I94Q 2R7FA 3M3YH 3S1MH 4HIOA 4L5TA 3VDYA 3I4NG 4BA2I 1PA6A 1XNRL 2B63H 1Q81C 2JA8H 1LM0A 1N32L 5C4JH 4QGUA 2NVQH 4GOPC 1HNWL 2AKWB 4GKJQ 3EIVA 1B7YB 3D31A 4A3CG 4YCWA 2VNUD 1U0LA 1EWIA 4MZ9A 1PH6A 1OTCA 2UXDQ 4GOPB 4JI3L 1XMOL 1VQDA 1X54A 4P72A 3PF5A 4BY7G 5LMUL 1MKHA 2HHHQ 1DGSA 1EYGA 3F8TA 4LF7Q 4YY3Q 5AJ3Q 2Y0SG 4RMFA 3OW2A 3K7AH 1IBML 4HJ9A 4DR6Q 1PH9A 2R6GA 4BY1H 5JJIA 2V1CC 4PZ8A 4IO9A 2UUBQ 1D7QA 1HZBA 1VQCA 1FJGQ 2YV5A 3RZDH 4A3BH 4DR4Q 3K80C 3S15H 1BBWA 4IFDG 1O7IA 1YVCA 4IPCA 1IBKQ 3KF6A 1PH7A 3PO2G 3S2HH 4NXNL 2N49A 1X65A 3A5ZB 3Q8DA 1TWCH 4WJ4A 2BA0A 1AE3A 3J7A5 1EIFA 3AFQA 3CF5A 1QZGA 2JEAI 1WYDA 3CCQA 3D0FA 4OWTB 2F52A 5LMNW 2IHFA 1J5EQ 3AEVA 1V9PA 2N8NA 5IYDG 4LUVA 1A0IA 1KHIA 4O2DA 1IZ6A 1OXTA 5IP9G 4IOCA 3GTGH 1HH2P 4B3TQ 4OWXB 2XGTA 5C44G 1E1OA 4JV5L 3ULPA 1GM5A 1XPUA 3M85A 2VUMH 3I55A 4HIKA 4DV0Q 1XNQQ 5GAHC 1CSPA 5GROA 3ULJA 4JI4Q 2UU9L 4YCVA 1VQBA 4A3EG 2E2JH 1CSQA 1S72A 2R92G 3AYHB 2WB1G 1WOCA 4C2MH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D8L A;  4AQY L;  3PSI A;  4A3I G;  1XJV A;  4A3L H;  1PH1 A;  4HIM A;  3HOX G;  5M3M G;  4DR3 L;  2E8G A;  3GTK H;  1C7Y A;  5LMN Q;  1JJC B;  3GTJ H;  1SN8 A;  2UUC L;  4JI1 L;  1MJC A;  1VQJ A;  1Z47 A;  1QVF A;  3HOZ H;  4GS3 A;  4JC0 A;  4EX5 A;  2MO0 A;  5BR8 L;  2VQF L;  4B3S L;  1P16 A;  1VCI A;  1CKN A;  2YYZ A;  1YJW A;  4OWW B;  2KCM A;  4GKJ L;  2OTJ A;  1P8L A;  2BH8 A;  1W2B A;  3PO3 H;  2F4V Q;  1HR0 W;  2H5X A;  3U4Z A;  1GVP A;  3ER0 A;  3CCJ A;  2LXK A;  3CCL A;  3TEH B;  2HHH L;  5FJ8 H;  1KD1 C;  1Q46 A;  3BJU A;  4LF7 L;  5IP7 G;  5AJ3 L;  5IY0 A;  1XMQ L;  3M4P A;  4LF9 L;  1I50 H;  2WB1 E;  3E9I A;  4QIW E;  3CMA A;  1EUJ A;  5ELN A;  4DKA C;  4DNI A;  2R7D A;  1K0R A;  3RNU A;  1PHJ A;  4JYA Q;  4HJA A;  2UUB L;  1AH9 A;  1VQN A;  1FJG L;  3UE1 A;  1KL9 A;  4A3M H;  5C0X I;  2QA4 A;  4DR4 L;  3DLL A;  3CCR A;  4A3F G;  4JI6 Q;  4AH6 A;  2B3G A;  1N33 Q;  4DUY Q;  3DM3 A;  3HOV G;  1NY4 A;  4GNX C;  4AYB E;  3TS0 A;  4JI0 Q;  3J7Z C;  4LF8 Q;  3KDF B;  3RR5 A;  1OXU A;  2D0O A;  3UDI A;  4LF6 L;  4DR1 Q;  2OQ0 A;  3AQQ A;  4GLX A;  2K75 A;  1HR0 Q;  4O0A A;  5IWA Q;  4DR2 L;  3ICE A;  1NTG A;  1K9M C;  1HNZ L;  2ZM6 L;  4JI8 L;  5GAD C;  2R93 G;  4L5R C;  4YWK A;  3M4Q A;  4B3T L;  2FXQ A;  1T9H A;  3STB C;  1X3F A;  2I5H A;  5IYC G;  1H95 A;  3SGI A;  2NZO A;  2C35 B;  4P74 A;  1Y1W H;  4DV0 L;  2JA5 G;  2LXJ A;  1XNQ L;  4KHP Q;  1KRS A;  3T1Y Q;  2EQS A;  1TXY A;  3RN2 A;  3WWV A;  1EFW A;  5C4X H;  2UXC L;  4GN5 A;  1BKB A;  2MQH A;  2WAQ E;  1HZ9 A;  1PFS A;  3L2P A;  3FKI H;  3M4O H;  1K73 C;  2K5H A;  1KAW A;  2KHJ A;  3G71 A;  1PH3 A;  2JA8 G;  4BXX H;  3CQZ H;  2R7Z G;  1VQG A;  1PYB A;  3TQY A;  2JEB I;  3UDF A;  3F2D A;  4QY7 A;  4A3G H;  3CCS A;  1KIX A;  4QL5 A;  5LMN L;  3HKS A;  1VQF A;  2VL6 A;  1C9O A;  4IPG A;  4A3K H;  1YJ9 A;  1KC8 C;  2QGQ A;  4LW1 A;  4R4C A;  2RCN A;  3KFU A;  4GN4 B;  4XTC S;  1A8V A;  4YHH Q;  4R4T A;  3H15 A;  4DV7 Q;  1XPR A;  3PCO B;  2NVY H;  1EQR A;  1QUQ B;  4UP7 A;  2F4V L;  1Q1E A;  1N36 Q;  1VQ7 A;  4POG A;  1VQ6 A;  3S1R H;  3S17 H;  1YEZ A;  3KF8 B;  4ALP A;  2Z0S A;  1VQ9 A;  3KJO A;  1YHB A;  2NN6 G;  3E9H A;  2E5L L;  2QEX A;  4MTN A;  4R4O A;  4LUZ A;  3K8A A;  3A0J A;  1FVI A;  1TWH H;  2VQE Q;  4JYA L;  1Q7Y C;  3HOY H;  1X3E A;  1YNX A;  4BA1 I;  5H1S E;  4DV2 Q;  2DUD A;  1A63 A;  3CME A;  4DV3 L;  2HIV A;  4JI6 L;  4POF A;  1UEB A;  1N33 L;  4PZ6 A;  2PQA A;  3ERS X;  1HZC A;  4FDB A;  4R1J A;  4X64 Q;  4B3R Q;  1JJ2 A;  4JBJ A;  4DR5 Q;  4LF8 L;  2GVA A;  3LGJ A;  2UXB L;  3CC4 A;  4DR1 L;  4DPG A;  2I5L X;  1HR0 L;  4B3M Q;  1CUK A;  5M5X H;  4DR7 Q;  4KI0 A;  3L0O A;  4OON A;  4KLK A;  1TWG H;  3K7U C;  1M90 C;  4LF5 Q;  1SLJ A;  1VQL A;  3S2D H;  1YBY A;  1SRU A;  2Z6K C;  3CXC A;  1KQS A;  3CAM A;  2ASB A;  1SR3 A;  1I6H H;  4X66 L;  3W1B A;  2E2I H;  1HNX Q;  4JI7 Q;  3HOU H;  1Y14 B;  2OTL A;  3KOJ A;  2D62 A;  3CCV A;  5FLM G;  3F2B A;  1VQ5 A;  4KHP L;  3I7F A;  2PMZ E;  4NB3 A;  3PIO A;  3CPW A;  2ATW A;  3CW2 C;  1OXS C;  2D0P A;  4J15 A;  4PZ7 A;  1RL2 A;  4JI2 Q;  4AIM A;  2JJQ A;  3CCU A;  1Y1V G;  1N34 L;  4A93 H;  1YZ6 A;  3RLO A;  3HOZ G;  3UDG A;  1VQE A;  4H02 A;  3KF6 B;  4P71 A;  3GTP H;  4DV5 Q;  3CCM A;  3JAM c;  3I2Z A;  2N3S A;  2NVT H;  1KRT A;  1I94 L;  5K36 G;  4HJ8 A;  1L1O A;  2ES2 A;  2CWP A;  3PO2 H;  1MJE A;  4GLV B;  1J6Q A;  3J81 j;  5C0X J;  1VQ4 A;  4AYB G;  3J80 i;  3J81 c;  2WP8 J;  2OCE A;  1YI2 A;  4DV1 Q;  1FGU A;  4DV7 L;  5IYD H;  1XTD A;  5IP9 H;  2MFI A;  4DUZ Q;  1QVG A;  3S1N H;  1N9W A;  2UXD L;  4JOI C;  1TWF H;  2KCT A;  4JI5 Q;  1YJN A;  1N36 L;  3OYY A;  2JA6 G;  5C44 H;  1CKO A;  1WI5 A;  4A3M G;  1FL0 A;  5IYB G;  3HOW G;  1IYJ B;  1Q12 A;  3H0G G;  4X65 Q;  1S3O A;  2MO1 A;  4YY3 L;  1NMF A;  4DV6 Q;  4DR6 L;  4JCV E;  4BBR G;  4TVA B;  4BBS H;  4OXP A;  1QVC A;  5ELO A;  5C3E H;  3BU2 A;  2VQE L;  2JQO A;  4MNO A;  4YWL A;  3T1H Q;  4A3E H;  2JA7 G;  2WAQ G;  4Y52 H;  2R92 H;  1VQM A;  1HNW Q;  1NE3 A;  2VW9 A;  3GDE A;  1TWA H;  1NBW A;  2CWA A;  4A3I H;  1IBK L;  3HOX H;  4LFB Q;  2JE6 I;  5M3M H;  4B3R L;  1B8A A;  2UUA Q;  1YHQ A;  2NN6 I;  2AHO B;  2EIF A;  5DLQ E;  1CKN B;  4JI3 Q;  3PUW A;  1Y1W G;  2I0Q A;  2K5N A;  5IT9 c;  5LMU Q;  2OWO A;  1JE5 A;  4GKK Q;  2KBN A;  3G4S A;  1J5E L;  3PUX A;  5M3F G;  4DR7 L;  2BH2 A;  4XIG S;  1V1Q A;  3KJP A;  1IBM Q;  4LF5 L;  5JJK A;  3FKI G;  4LNQ A;  2ZJP A;  1R9T H;  3K0X A;  2AMC B;  2MNA A;  5M5Y H;  3JAM i;  4L5S A;  3TRZ A;  1K83 H;  2CFM A;  1X9N A;  3BZC A;  2K5V A;  1PV4 A;  1HNX L;  3PUZ A;  4JBM A;  4JI7 L;  3I4M G;  4X6A H;  1WCM H;  3ZJY C;  1G6P A;  1GD7 A;  2I5M X;  3NBH B;  4ME3 A;  4JI4 L;  5IP7 H;  4NXN Q;  3J81 i;  3CC2 A;  4EQ5 A;  3F1Z A;  2B63 G;  4LUO A;  4A4I A;  4TQU S;  4X62 Q;  2ZJR A;  2JA9 A;  2KEN A;  3HKZ E;  4QJF A;  4R4I A;  1UE1 A;  3NEM A;  3NEN A;  1ASZ A;  4A3D H;  1MIU A;  4DV4 Q;  2OQK A;  1CKM A;  1RIP A;  1X55 A;  5FLX c;  4L5Q A;  4A3F H;  3U50 C;  3HOV H;  4LFA Q;  2ZTD A;  2KHI A;  1SE8 A;  5JJL A;  3AFP A;  3PUY A;  4JBW A;  3S16 H;  3H3V I;  2A1A A;  1K8A C;  4IFD I;  4QQB X;  1UWV A;  3TRE A;  4DAM A;  4UP8 A;  3CC7 A;  4IOA A;  4GOP A;  3HFZ B;  4DV1 L;  1Q8K A;  4DUZ L;  1PH8 A;  4BY1 G;  2R93 H;  2RHS B;  3PIP A;  3GTQ H;  4JI5 L;  1YIT A;  3MEF A;  1VQ8 A;  1PH5 A;  4P73 A;  4A3B G;  3EN2 A;  5IYC H;  4OX9 Q;  3G48 A;  3A5U A;  1PYS B;  1OXV A;  3J80 c;  4DR3 Q;  2N78 A;  4NPS A;  4LFC Q;  1VS0 A;  2PI2 E;  3TS2 A;  2HT1 A;  4IPD A;  1K8G A;  2UUC Q;  4JI1 Q;  4A3J H;  1N8R C;  1EIY B;  3GO5 A;  3T1H L;  1Z9F A;  2PNH A;  4LWC A;  1LYL A;  4UPA A;  2R7Z H;  4APV A;  1E7Z A;  3KYH C;  5BR8 Q;  2VQF Q;  4B3S Q;  4LF4 Q;  3S1Q H;  2ZTC A;  1JJG A;  2K52 A;  3CCE A;  2YTX A;  3GTM H;  1GO3 E;  4DUY L;  1JB7 A;  2YU9 H;  4LFB L;  4JI0 L;  1W3S A;  2RF4 A;  5C0X G;  2F3I A;  2UUA L;  3I4N H;  2VUM G;  3GD7 A;  3FP9 A;  3HOU G;  2HQL A;  3K81 C;  4K0K L;  1L2F A;  3PF4 A;  2CQO A;  2K50 A;  3S24 A;  4IJL A;  2CKZ B;  5IWA L;  2ID0 A;  3UE0 A;  4GKK L;  4OO1 G;  1E24 A;  1XMQ Q;  4LF9 Q;  4A93 G;  4A3C H;  1VQP A;  2XTI A;  1E3P A;  3L7Z C;  1L0W A;  2Z6K A;  1IBL Q;  3FHW A;  3RLF A;  4A3L G;  3RN5 A;  4BY7 H;  3T1Y L;  1B70 B;  5E7N A;  5JEA J;  5EAY A;  3PGZ A;  3ULL A;  5IE8 A;  4Y7N H;  4WJ3 M;  2LSS A;  2CCZ A;  4KHZ A;  4X62 L;  4LF6 Q;  2GN5 A;  4YCU A;  2PQA B;  3W1G A;  1I3Q H;  4GLA C;  1LUZ A;  2AWN A;  3CPF A;  1UE6 A;  2Q2H A;  4PG3 A;  4A76 A;  4DV4 L;  4DR2 Q;  2PI2 A;  1HNZ Q;  3PO3 G;  2ZM6 Q;  4JI8 Q;  1PVO A;  3CD6 A;  2IX0 A;  2ALY B;  4C3I H;  4HID A;  2A19 A;  1EQQ A;  4LFA L;  4YWM A;  4P75 A;  1QZH A;  5FJ8 G;  2Y0S E;  3KLW A;  1EOV A;  4DK6 C;  1BVS A;  2L15 A;  3RZO H;  4BBS G;  4YHH L;  1ASY A;  2UXC Q;  3EBE A;  3STB D;  2JK8 A;  3G6E A;  2NZH A;  5C3E G;  3UDX A;  1AE2 A;  3GTO H;  2WFW A;  2B29 A;  2AWO A;  4JOI A;  4NXM Q;  2IX1 A;  3OTO Q;  3S14 H;  4OX9 L;  3GTL H;  1Q82 C;  3M7N A;  2RHQ B;  2VS1 A;  2Q2I A;  3I4O A;  5HGQ A;  1L1O C;  2DGY A;  1G29 1;  5FLM H;  4IFD J;  4IPH A;  4PMW A;  2GVB A;  4IJH A;  4LFC L;  1LTL A;  4A75 A;  1XPO A;  1JT8 A;  1IL2 A;  3H3V H;  1XNR Q;  1Y1V H;  1VQI A;  1X3G A;  1N32 Q;  1L1O B;  2K4K A;  3PV0 A;  1BBU A;  4DV2 L;  1K3R A;  1NMG A;  2VY3 A;  4DAY B;  2YTY A;  1GKH A;  3HKZ G;  1VQO A;  2IT1 A;  3KDF A;  3E0E A;  1S40 A;  4LF4 L;  1V43 A;  5GAG C;  2ZTE A;  1OXX K;  4X64 L;  2HIX A;  1HJP A;  4DR5 L;  4GNX A;  3MXN B;  1XMO Q;  2K14 A;  2E2H H;  4C3H H;  1JMC A;  1WCM G;  1E1T A;  1YIJ A;  4B3M L;  1M1K C;  4UY8 C;  5GAE C;  1G51 A;  2E5L Q;  3A74 A;  4RG1 A;  1NJI C;  5C4X G;  1UE7 A;  2Q2T A;  1KXL A;  3B6Y A;  4BXX G;  1SMX A;  1Q1B A;  1IBL L;  1E22 A;  4DK3 C;  4R4Q A;  2JA6 H;  4A3D G;  3I56 A;  1SFO H;  4A3G G;  4DV3 Q;  5IYB H;  2VZA A;  1PH4 A;  3HOW H;  3H0G H;  2YTV A;  2IY5 B;  1VQH A;  3M9B A;  4JI2 L;  1C0A A;  4BBR H;  5M5W H;  4OO1 I;  4A3K G;  1SRO A;  5GQO A;  2UXB Q;  3PUV A;  1UE5 A;  4GN3 B;  2JA7 H;  3NEL A;  4DV5 L;  4GNX B;  3IRB A;  1PH2 A;  2IHE A;  1Q86 C;  1U5K A;  3F2C A;  4UP9 A;  2A8V A;  4X66 Q;  4JV5 Q;  4JG2 A;  2EXD A;  5J3B A;  2NVX H;  3CP0 A;  1VQK A;  4JBK A;  1QUQ A;  2ZJQ A;  1X56 A;  2BA1 A;  1YHA A;  3U58 A;  1X6O A;  3U4V A;  2Q2U A;  1I5F A;  5M3F H;  3BZK A;  1WFQ A;  1N34 Q;  2UU9 Q;  4K0K Q;  3W5O A;  3JC6 6;  4HJ7 A;  4A3J G;  1IXR A;  3HOY G;  4NXM L;  4HJ5 A;  1HZA A;  3OTO L;  1A62 A;  3I4M H;  4AQY Q;  3RLN A;  1WJJ A;  4C3J H;  5JEA G;  4X65 L;  2JA5 H;  1VQA A;  5HY6 A;  4DV6 L;  1I94 Q;  2R7F A;  3M3Y H;  3S1M H;  4HIO A;  4L5T A;  3VDY A;  3I4N G;  4BA2 I;  1PA6 A;  1XNR L;  2B63 H;  1Q81 C;  2JA8 H;  1LM0 A;  1N32 L;  5C4J H;  4QGU A;  2NVQ H;  4GOP C;  1HNW L;  2AKW B;  4GKJ Q;  3EIV A;  1B7Y B;  3D31 A;  4A3C G;  4YCW A;  2VNU D;  1U0L A;  1EWI A;  4MZ9 A;  1PH6 A;  1OTC A;  2UXD Q;  4GOP B;  4JI3 L;  1XMO L;  1VQD A;  1X54 A;  4P72 A;  3PF5 A;  4BY7 G;  5LMU L;  1MKH A;  2HHH Q;  1DGS A;  1EYG A;  3F8T A;  4LF7 Q;  4YY3 Q;  5AJ3 Q;  2Y0S G;  4RMF A;  3OW2 A;  3K7A H;  1IBM L;  4HJ9 A;  4DR6 Q;  1PH9 A;  2R6G A;  4BY1 H;  5JJI A;  2V1C C;  4PZ8 A;  4IO9 A;  2UUB Q;  1D7Q A;  1HZB A;  1VQC A;  1FJG Q;  2YV5 A;  3RZD H;  4A3B H;  4DR4 Q;  3K80 C;  3S15 H;  1BBW A;  4IFD G;  1O7I A;  1YVC A;  4IPC A;  1IBK Q;  3KF6 A;  1PH7 A;  3PO2 G;  3S2H H;  4NXN L;  2N49 A;  1X65 A;  3A5Z B;  3Q8D A;  1TWC H;  4WJ4 A;  2BA0 A;  1AE3 A;  3J7A 5;  1EIF A;  3AFQ A;  3CF5 A;  1QZG A;  2JEA I;  1WYD A;  3CCQ A;  3D0F A;  4OWT B;  2F52 A;  5LMN W;  2IHF A;  1J5E Q;  3AEV A;  1V9P A;  2N8N A;  5IYD G;  4LUV A;  1A0I A;  1KHI A;  4O2D A;  1IZ6 A;  1OXT A;  5IP9 G;  4IOC A;  3GTG H;  1HH2 P;  4B3T Q;  4OWX B;  2XGT A;  5C44 G;  1E1O A;  4JV5 L;  3ULP A;  1GM5 A;  1XPU A;  3M85 A;  2VUM H;  3I55 A;  4HIK A;  4DV0 Q;  1XNQ Q;  5GAH C;  1CSP A;  5GRO A;  3ULJ A;  4JI4 Q;  2UU9 L;  4YCV A;  1VQB A;  4A3E G;  2E2J H;  1CSQ A;  1S72 A;  2R92 G;  3AYH B;  2WB1 G;  1WOC A;  4C2M H; 
#chains in the Genus database with same CATH topology
 4AQY L;  4ZRZ A;  1PH1 A;  3EFX D;  2L1B A;  5FLX E;  3SK8 A;  2KUM A;  1JJC B;  1SN8 A;  3S16 B;  2UUC L;  3VR3 A;  1VQJ A;  1Z47 A;  1JR0 D;  4OIK A;  4CKB A;  1WTW A;  1B2T A;  3DXJ C;  4CBV A;  4GKJ L;  1CKN A;  4LK1 C;  2BH8 A;  2F4V Q;  2AUJ D;  1DJR D;  3FPU B;  1PZJ D;  2F0E A;  1KD1 C;  4LF7 L;  5AJ3 L;  1XMQ L;  1A3U A;  1G2S A;  1I50 H;  3E9I A;  5BN5 A;  1JC7 A;  1K0R A;  3NTI A;  2UUB L;  1DD2 A;  5C0X I;  4DR4 L;  2XIW A;  1N33 Q;  5CC4 A;  3DM3 A;  3SR1 A;  4JI0 Q;  4AYB E;  1EIH A;  3KDF B;  2D0O A;  4LF6 L;  1NCV A;  4O0A A;  2WKC A;  3A7L A;  1LO5 D;  3K6O A;  1HNZ L;  3U9S A;  1LT4 D;  4B3T L;  2CH4 W;  2FXQ A;  3KUP A;  5IYC G;  3SGI A;  1MHW C;  1WTQ A;  1EYD A;  2M9V A;  2EQS A;  2PCF B;  1EFW A;  3OIQ A;  3SVM A;  4GN5 A;  2DY7 A;  2MQH A;  2WAQ E;  5FKA C;  3FKI H;  1UEA B;  3GTP B;  1EL0 A;  4U68 A;  3UDF A;  4Q5V A;  4A3G H;  4C3I B;  3PO2 B;  1CTM A;  1PFB A;  1LT3 D;  5LMN L;  2M00 A;  1C9O A;  3OMG A;  4IQZ A;  5FLX L;  1FNW A;  4JPB W;  4XTC S;  1A8V A;  1WTH A;  3BVG A;  5KEE A;  1TII D;  4DV7 Q;  1XPR A;  1QOH A;  3PCO B;  3FDT A;  1Q1E A;  4ZK9 B;  1N36 Q;  4IN3 A;  4J6H A;  4XT1 B;  3KF8 B;  2ZXP A;  2F3V A;  3HZX A;  1LAB A;  2QEX A;  1ZEQ X;  4A3E B;  3A0J A;  1Y8O B;  3P75 A;  1HCZ A;  2RQX A;  2K32 A;  5KGU A;  4FF3 A;  2DUD A;  4DV3 L;  1UEB A;  2C5C A;  4PZ6 A;  1HZC A;  3NP8 A;  1MSH A;  2RVL A;  4KD3 A;  1CT1 D;  1JJ2 A;  1AP0 A;  1HR0 L;  2CH4 A;  1K8M A;  2IWH A;  4CGY B;  1M90 C;  3GV6 A;  3K7U C;  1VQL A;  1K83 B;  2A6H C;  1F2Z A;  1U9R A;  5KNB A;  5L37 A;  2ASB A;  1SR3 A;  2E2I H;  3ITP A;  4N8F A;  2OTL A;  3KOJ A;  2D62 A;  3VYS A;  3I7F A;  4NB3 A;  3CPW A;  4JI2 Q;  2F0K A;  4O42 A;  4A93 H;  1HQM C;  5T1I A;  3HOZ G;  1GHJ A;  1X3Q A;  2DJG C;  4H02 A;  3UDG A;  2I46 A;  5IGE A;  3GTP H;  1FYC A;  2L0C A;  2EYP A;  5IOC A;  1XX8 A;  2N3S A;  3C3L A;  1SBB B;  4OGQ C;  3N6R A;  1I94 L;  4HJ8 A;  3T51 B;  2ES2 A;  1DYQ A;  2NVX B;  3PO2 H;  3PIP 3;  1J6Q A;  3J81 j;  5C0X J;  1SNM A;  3Q24 A;  1W6J A;  4HSV A;  5LL6 S;  2WP8 J;  3OW7 A;  2CW0 D;  3P20 A;  4JOI C;  1YJN A;  3WOF A;  3OYY A;  1FL0 A;  5ISR A;  1IYJ B;  3NBI A;  3P1H A;  1NMF A;  4BBS H;  1QVC A;  5ELO A;  2HUG A;  5I4D A;  4MNO A;  2VQE L;  4A3E H;  1G2T A;  1WD0 A;  1HNW Q;  3GDE A;  2YU9 B;  1B8A A;  1YHQ A;  2NN6 I;  2AHO B;  2EIF A;  2KQ3 A;  2DJF C;  3VA7 A;  4CJ2 C;  2K5N A;  5LMU Q;  1BR9 A;  3I3C A;  2OWO A;  1JE5 A;  1GUS A;  1ICF B;  4K2K A;  5M3F G;  2X6G A;  4MHE A;  4N9T A;  1QIL A;  1R9T H;  3QJY A;  2B2V C;  1K83 H;  4HR7 B;  1X9N A;  3BZC A;  2EYJ A;  4JI7 L;  2KED A;  3ZJY C;  5M9O A;  4ABN A;  4Y7N B;  4H0L C;  1ZKO A;  2PMZ B;  4NXN Q;  4EQ5 A;  3F1Z A;  3MFG A;  3MFY A;  4LUO A;  2RCF A;  2DNC A;  2XRQ D;  4F88 A;  3DEP A;  4DV4 Q;  2OQK A;  1X55 A;  3U50 C;  1ESR A;  4KY7 A;  4LFA Q;  4ZCK A;  1Y69 U;  5HGT A;  4JBW A;  1UWV A;  4DAM A;  3BDO A;  1Q8K A;  1PH5 A;  4A3B G;  5IYC H;  1PZK D;  2O5J C;  3GTK B;  3WDN A;  3GTJ B;  1JQY D;  4DR3 Q;  1VS0 A;  3HOZ B;  4IPD A;  4QIW B;  1N8R C;  3GO5 A;  1I4H A;  1V1O A;  1JOO A;  4UPA A;  2QF7 A;  1E7Z A;  3MWY W;  5BR8 Q;  2K52 A;  1LTG D;  2A68 C;  4DUY L;  2YU9 H;  3KLS A;  1ONL A;  4OL7 A;  2F3I A;  3I4N H;  3E5S A;  1I4G A;  1L2F A;  5ELD A;  4M8A A;  3OMC A;  4OO1 G;  4QB4 A;  2ID0 A;  3TP8 A;  2EOT A;  1WTV A;  1GOZ A;  4KKT A;  1HXY D;  1QG7 A;  4RCO A;  3HG9 A;  1ILQ A;  1AN8 A;  2A6E D;  2L12 A;  5LL6 X;  4N8X 1;  5M5W B;  1B70 B;  4DNR B;  3AMU A;  4CKE A;  3K59 A;  5EAY A;  3TP7 A;  4DXF A;  3ULL A;  4Y7N H;  4WJ3 M;  2LSS A;  1STG A;  4CJ0 B;  2PQA B;  3NE5 B;  1LUZ A;  2ZXO A;  1UE6 A;  2Q2H A;  4DR2 Q;  5KND A;  4JI8 Q;  1V8Q A;  2DY8 A;  3CD6 A;  1LTB D;  2IX0 A;  1HFG A;  1EQT A;  2EY5 A;  1JIC A;  1PTO C;  5M3F B;  2B39 A;  4K14 A;  2L4N A;  1FNU A;  2NZH A;  5C3E G;  1AE2 A;  4NMZ A;  4JOI A;  2M2L A;  4EQO A;  1Q82 C;  3MXU A;  2RHQ B;  2AQ3 B;  4DNT B;  4KN7 C;  2A74 C;  5DM6 3;  5FK9 C;  4RWS C;  4DK0 A;  5C4J B;  1U4L A;  3H3V H;  1SXT A;  1DOL A;  1N32 Q;  2K4K A;  2NZ1 D;  4HAE A;  3MTS A;  4K8J A;  2F0H A;  3G6J B;  1K3R A;  2VY3 A;  3ERO A;  4DAY B;  4LF4 L;  1VQO A;  4FF4 A;  3NHH A;  4HCS A;  1WCM G;  2BOS A;  4B3M L;  3K7A B;  1KTK A;  2I07 B;  4KK7 A;  1BNZ A;  4FNF A;  5C4H A;  3BS1 A;  4Z9C B;  1XWE A;  4R8I A;  2BDN A;  4A3B B;  4R4Q A;  4A3D G;  2B2V A;  1SFO H;  2VZA A;  1EU4 A;  1VQH A;  4J8Q A;  4WOR A;  5M5W H;  1SRO A;  1IHZ A;  4FXD A;  1IYU A;  3GTG B;  3NEL A;  2EY6 A;  2BCO A;  1U5K A;  3F2C A;  3KBG A;  2EXD A;  1RTO A;  2BA1 A;  1YHA A;  2Q2U A;  5M3F H;  3BZK A;  4C2M B;  2XVS A;  2QCP X;  3MXG A;  1HZA A;  3JAM E;  1VQA A;  1O7Z A;  2R7F A;  4DAP A;  1K28 A;  3VDY A;  2A69 C;  3VA5 A;  5C4J H;  2B2T A;  1PRT C;  2H4O A;  4RAU C;  2PYK A;  4UAI A;  1EWI A;  4GOP B;  1LTS D;  1YNJ D;  1VQD A;  4BY7 G;  3A8K E;  1F9R A;  1CZG A;  1XYI A;  1EYG A;  3F8T A;  2R3Z A;  2Y0S G;  5C3E B;  3K7A H;  1IBM L;  3TSS A;  1LT6 D;  2R6G A;  5J39 A;  1KLG D;  3AB9 A;  3R8B A;  1R4P B;  4EGV A;  5JJI A;  4PZ8 A;  1MD2 D;  3HOX B;  4A3B H;  1JB3 A;  4IAL A;  5TSS A;  4IFD G;  1O7I A;  1IBK Q;  1R4Q B;  3KF6 A;  1PH7 A;  2N49 A;  1X65 A;  3Q8D A;  4H13 C;  1BQQ T;  3AFQ A;  4QF4 A;  1QZG A;  1TS4 A;  1BOS A;  2NBF A;  2PNR C;  4WJW A;  5LMN W;  3K5N A;  1A0I A;  5IP9 G;  1IZ6 A;  3GTG H;  3MXP A;  2XGT A;  1WCM B;  4JV5 L;  2O2L D;  4HN7 A;  1XPU A;  4DV0 Q;  1XNQ Q;  1U4R A;  1CSP A;  4OO1 H;  1WTR A;  3ULJ A;  4JI4 Q;  4OHJ A;  4YCV A;  5C4Z A;  2R92 G;  4A3D B;  3AYH B;  4C2M H;  4A3I G;  3SK6 A;  4IUQ A;  4HIM A;  4QCL A;  5CV5 A;  4C3H G;  2Z1C A;  1MJC A;  3JAM L;  5IOD A;  4B3S L;  1I4P A;  2KCM A;  1EY0 A;  1W2B A;  1HR0 W;  2H5X A;  1VMC A;  3SDZ A;  3BVM A;  1CHQ D;  4KMU C;  4KKU A;  3NTH A;  4LF9 L;  2WB1 E;  1EUJ A;  2WIN B;  4DKA C;  2R7D A;  3LX0 A;  3RNU A;  4JYA Q;  4HJA A;  1AH9 A;  3NBH A;  4RGO S;  1CK1 A;  1QJO A;  4ZUI A;  3UE1 A;  4X3U A;  2LFN A;  2A5H A;  4A3F G;  1K0S A;  4GNX C;  3K0Y A;  2KHS A;  2ICE C;  3J7Z C;  1OXU A;  4DR1 Q;  3AQQ A;  4GLX A;  3HS0 C;  2A68 D;  5IGF A;  5IWA Q;  4DXG A;  5GAD C;  2R93 G;  3M4Q A;  4BY7 B;  1T9H A;  1X3F A;  1SNO A;  2I5H A;  3VR6 A;  1Y1W H;  3AU7 A;  2Y0S B;  1KRS A;  1O7Y A;  3WWV A;  4M1U B;  5A35 A;  1U4P A;  2MHV A;  1KDA A;  1RF2 D;  2KCC A;  3M4O H;  1NAP A;  1KAW A;  4XQJ A;  5EKI A;  4QY7 A;  1I4R A;  3TZU A;  2EDG A;  1II3 A;  2MGS A;  3X3M A;  2VL6 A;  2MJ8 A;  4IPG A;  2K01 A;  2QGQ A;  2RCN A;  4QUC A;  3KFU A;  1WTX A;  1EY7 A;  5E3F A;  2B2U A;  4YHH Q;  1O80 A;  1TWF B;  3C46 A;  3KLR A;  1EQR A;  1QUQ B;  4UP7 A;  2F4V L;  4DN4 M;  3L3O C;  3S14 B;  5IGD A;  1VQ7 A;  4POG A;  1SND A;  1VQ6 A;  1GUO A;  3CKI B;  5DM7 3;  2NN6 G;  2K05 A;  2E5L L;  1ML0 D;  3K8A A;  2R92 B;  1FVI A;  2NB0 A;  3H91 A;  2KA7 A;  1X3E A;  2QEJ C;  4A3I B;  2EYH A;  4DV2 Q;  3CME A;  2HIV A;  4POF A;  1N33 L;  1LTT D;  4FDB A;  4C3H B;  1K8O A;  2IL8 A;  4DR5 Q;  2GVA A;  2MP1 A;  3IFT A;  4DPG A;  1BCP B;  3V05 A;  2I5L X;  3GP7 A;  1CUK A;  3SEB A;  2EZV A;  4DR7 Q;  4OON A;  2J0T D;  2ICI A;  3S2D H;  1SLJ A;  1DM0 B;  2OEO A;  5C0X H;  1O7L A;  4IUT A;  5C5M A;  1Y14 B;  2NTT A;  5FO8 B;  3CCV A;  5FLM G;  4G7Z C;  4P2C B;  3PIO A;  3K58 A;  1H9J A;  3CW2 C;  2ATW A;  2D0P A;  3CCU A;  4FXG C;  1N34 L;  2JJQ A;  4C1N I;  1YZ6 A;  1VQE A;  4PQX A;  5A2Q L;  3I4L A;  4A3F B;  4DV5 Q;  3I2Z A;  3A7A B;  1KRT A;  3MHB A;  5K36 G;  1L1O A;  3TN2 A;  2CWP A;  1RD9 D;  4GLV B;  1GXD C;  1VQ4 A;  3J81 c;  4NW2 A;  1JWM D;  1ZYR C;  2R93 B;  4DV1 Q;  1FGU A;  4DV7 L;  1QB5 D;  5IP9 H;  1QWY A;  3FMC A;  4DUZ Q;  1QVG A;  5LHY 1;  3EJI A;  2UXD L;  5JJZ A;  5K5P A;  1TWF H;  2KCT A;  2NYZ D;  1N36 L;  2JA6 G;  2VB2 X;  4A3M G;  1AW7 A;  3ONA B;  3U9O A;  5IYB G;  3I70 A;  2MO1 A;  4ID6 A;  4DR6 L;  4BBR G;  3ERQ A;  4OXP A;  1SE4 A;  2SNS A;  2RA4 A;  2JQO A;  4YWL A;  1ZXT A;  4TKO B;  1E2Z A;  5CGK A;  2R92 H;  3GTM B;  1TWA H;  4A3I H;  3EA6 A;  5CV9 A;  4LFB Q;  2JE6 I;  2UUA Q;  1SNP A;  1CKN B;  1PRT D;  3PUW A;  5IT9 c;  1BCP D;  1J5E L;  1J8I A;  3PUX A;  1V1Q A;  5FOB B;  3K0X A;  3IAY A;  2MNA A;  3LWE A;  5M5Y H;  3JAM i;  3RZD B;  4IFD I;  3I4M G;  3PUZ A;  4X6A H;  3DWP A;  3S2H B;  3N52 A;  2I5M X;  5D14 A;  1I3Q B;  4A4I A;  4TQU S;  4X62 Q;  4JVZ A;  2KEN A;  3HKZ E;  2EYL A;  4R4I A;  4R8N A;  2EY2 A;  1RIP A;  4A3F H;  1UUP A;  5JJL A;  1HUN A;  3J7A V;  3PUY A;  3S16 H;  3CU7 A;  3HFZ B;  3C1F A;  4K6L A;  4F8M A;  1PH8 A;  1SYD A;  2R93 H;  3PIP A;  3H3V C;  2X69 A;  1SDF A;  1YIT A;  3MEF A;  1HA6 A;  4P73 A;  2FFK B;  4OX9 Q;  1TU2 B;  3G48 A;  3A5U A;  3J80 c;  2N78 A;  2LKV A;  1D5X C;  1K8G A;  2UUC Q;  1AFP A;  2N55 A;  2RBM A;  4APV A;  2KCN A;  1B9M A;  3KYH C;  3SHL A;  1STE A;  2ZTC A;  3Q0A A;  3CCE A;  3GTM H;  1WTO A;  4ZKC B;  1AEX A;  4FF1 A;  1EZ8 A;  4CKC A;  3H6M A;  3OHX C;  1RJT A;  3GD7 A;  3HOU G;  2HQL A;  3K81 C;  1TT2 A;  1Z6H A;  2F0W A;  1XMQ Q;  4MTK A;  4A3C H;  2JA6 B;  3T53 B;  1LTR D;  1EZ6 A;  4A3M B;  1LT5 D;  3FHW A;  2O4X A;  3RLF A;  4X3T A;  3NTK A;  4A3L G;  2F3W A;  4XT3 B;  4BBR B;  1CFM A;  3T1Y L;  1C4Q A;  2NN6 H;  5E7N A;  3J7Y W;  2RSO A;  4KHZ A;  5IT9 E;  4LF6 Q;  1IW7 C;  4YCU A;  1I3Q H;  2MUY A;  2F0J A;  4RHR A;  4DV4 L;  1HNZ Q;  1A2T A;  1EWC A;  5CR3 A;  4C3I H;  2ZXR A;  4HID A;  2A19 A;  4LFA L;  5F2D A;  3KLW A;  5C4X B;  1BVS A;  4PNY A;  2L15 A;  1GUT A;  2XSC A;  1CI3 M;  1Q90 A;  3I4M B;  2AWO A;  2EJF C;  3DEO A;  3OTO Q;  1PMR A;  3M7N A;  1EOT A;  2DNE A;  2Q2I A;  3I4O A;  1HQR D;  2DGY A;  1G29 1;  3QO2 A;  5FLM H;  4IFD J;  5IGB A;  4A3K B;  2GVB A;  2NVQ B;  2Z9H A;  1XNR Q;  1VQI A;  5I6W A;  3PV0 A;  1BBU A;  2NVY B;  1NMG A;  3TP5 A;  3OWF A;  4CHT B;  2IT1 A;  3E0E A;  4X64 L;  1DON A;  1D6E C;  1HJP A;  1XMO Q;  2K14 A;  4KV6 A;  4R9W A;  1Y8N B;  1F77 A;  4UY8 C;  1G51 A;  3A74 A;  1NJI C;  1UE7 A;  1F9Q A;  3B6Y A;  3D6C A;  3EVQ A;  1SMX A;  2BE5 D;  2H1E A;  1D1I A;  2JA6 H;  4IZ8 A;  4DV3 Q;  5IYB H;  5JPN C;  1NUC A;  1TWC B;  2YTV A;  1A2U A;  1C0A A;  4BBR H;  5GQO A;  3L9A X;  4H44 C;  5M5X B;  2K5D A;  4DGZ A;  2L55 A;  1MI2 A;  1LV9 A;  1PZI D;  2EYO A;  3ZYY X;  5CBA E;  1ICW A;  2KVM A;  3HOU B;  2NUC A;  2NVX H;  2J4X A;  5BN4 A;  2B2Y C;  5JVG 3;  2E2J B;  1I5F A;  3TBI B;  4KJO A;  4A3J G;  3JC6 6;  1KLU D;  4GZY C;  3HOY G;  4ILW A;  3I4M H;  3OOC A;  3RLN A;  1MGS A;  3BYT B;  5JEA G;  4X65 L;  3D6W A;  5HY6 A;  4DV6 L;  1I94 Q;  4C56 C;  4HIO A;  3VYT A;  5D3D A;  1Q81 C;  2PZT A;  1N32 L;  1RHP A;  2NVQ H;  4GOP C;  2AQ2 B;  2F0G A;  4NP5 A;  2AKW B;  3EIV A;  3R2T A;  4YCW A;  2VNU D;  5C44 B;  4MZ9 A;  2JYO A;  2QDL A;  1SJE D;  4JI3 L;  1X54 A;  3DWQ A;  4P72 A;  4X3K A;  1MKH A;  2FIN B;  2HHH Q;  2XWB B;  1B3A A;  4HJ9 A;  2E2D C;  1PH9 A;  1UNS A;  1O78 A;  2V1C C;  1HHV A;  1DOM A;  1FJG Q;  2WAC A;  2YV5 A;  2PQE A;  1BBW A;  1YVC A;  4IPC A;  1A3V A;  1TWC H;  2BA0 A;  1W6K A;  3HRZ C;  3J7A 5;  2IJ0 A;  2ZT9 C;  3CCQ A;  3D0F A;  4OWT B;  2IHF A;  3AEV A;  1M4V A;  4IOC A;  4ZYS A;  4OEM B;  4KHV A;  1EY8 A;  1S5D D;  1X3P A;  3M85 A;  5JOB A;  2ENB A;  3CQZ B;  2E2J H;  2EE1 A;  1CSQ A;  5C3W A;  2WB1 G;  1D8L A;  4FO2 A;  4G7O C;  1XJV A;  4A3L H;  2HQE A;  3HOX G;  5M3M G;  5JPM C;  3GTK H;  1C7Y A;  3GTJ H;  3D4W A;  4LJZ C;  4RHS A;  3K57 A;  4JI1 L;  1CA5 A;  3HOZ H;  4RGM A;  4JC0 A;  4EX5 A;  4NDX A;  2VQF L;  5JAV A;  1P16 A;  1MBY A;  1VCI A;  2YYZ A;  1YJW A;  3GTQ B;  2OTJ A;  3S1R B;  3U4Z A;  2G9H D;  3ER0 A;  2LXK A;  3CCL A;  1F9P A;  3TEH B;  3Q22 A;  3VR4 A;  1S5F D;  2SOB A;  3BJU A;  3RUZ A;  4CDE C;  5EPJ A;  5HUR A;  1GHK A;  2F0P A;  1TWH B;  3M4P A;  4A3J B;  3HOY B;  4QIW E;  1YNN C;  5ELN A;  1KDB A;  4DNI A;  4K2L A;  3K5M A;  2E76 C;  3S1Q B;  1STH A;  2QA4 A;  3DLL A;  3CCR A;  4JI6 Q;  2B3G A;  3Q23 A;  4DUY Q;  3CHB D;  1NY4 A;  3TS0 A;  4LF8 Q;  4KJN A;  1D1K A;  1TS2 A;  1KDC A;  3T13 A;  4K6D A;  2ZM6 L;  1I6H B;  4YWK A;  1B50 A;  2IW3 A;  2D5D A;  2NZO A;  2C35 B;  3DWA A;  4V19 0;  4DV0 L;  4C3J G;  1CHP D;  2LXJ A;  2PW5 A;  3E0J A;  2JA5 G;  1XNQ L;  4KHP Q;  2A6H D;  1HRJ A;  5I2Y A;  3I8Z A;  5E1F A;  2UXC L;  4IUR A;  2B2Y A;  1BKB A;  1HZ9 A;  1PFS A;  2K1B A;  4IUP A;  3RD4 A;  3L2P A;  1K73 C;  2K5H A;  3RMH A;  1PH3 A;  2JA8 G;  3CQZ H;  2R7Z G;  1PYB A;  2O5I C;  2JEB I;  4XQN A;  3F2D A;  4XDX A;  1E2W A;  1KIX A;  4QL5 A;  1EYA A;  1VQF A;  2TSS A;  1KC8 C;  3RZO B;  4R4C A;  4EQN A;  5DEH A;  2SDF A;  2CHB D;  3S1N B;  3GTO B;  4R4T A;  3H15 A;  2HD3 A;  1HTL D;  5EQ0 A;  3S1R H;  1YEZ A;  1TY2 A;  4F7X A;  4ALP A;  1DZ1 A;  4JW0 A;  4MTN A;  4R4O A;  5KRU A;  4CDF C;  5EBD A;  1EY9 A;  2WB1 B;  1TWH H;  5FO9 B;  4JYA L;  1Q7Y C;  3HOY H;  1YNX A;  5I9O A;  4CJ1 B;  5H1S E;  3PQI A;  5KYI A;  5M3M B;  1A63 A;  5J1Z A;  2JSO A;  3ERS X;  4B3R Q;  2E2H B;  2NWG A;  1SNC A;  4R1J A;  4JBJ A;  1XTC D;  1F9S A;  2UXB L;  3CC4 A;  4DR1 L;  3NXW A;  3FVQ A;  4B3M Q;  3P7J A;  3L0O A;  4KLK A;  4LF5 Q;  2Z6K C;  1LLR D;  1KQS A;  1A6X A;  1I6H H;  5KNC A;  4X66 L;  3HOW B;  1HNX Q;  3I91 A;  4KY5 A;  4KKS A;  2F0L A;  4J15 A;  4K0K L;  4O1N A;  2EJM A;  5IGC A;  1Y1V G;  2JA7 B;  1IKL A;  1SMY C;  3RLO A;  2XNA C;  1F2L A;  2F0T A;  3KF6 B;  4P71 A;  1G6Z A;  3CCM A;  4DU9 A;  2G9D A;  1MJE A;  1PFM A;  1T5E A;  4AYB G;  3J80 i;  2K7V A;  3T16 A;  1YI2 A;  3MXN A;  1XTD A;  1ENF A;  2MFI A;  4K5V A;  1N9W A;  4PV1 C;  3S1N H;  2F0N A;  4JI5 Q;  4C3J B;  2JA5 B;  1Q12 A;  3M3Y B;  3H0G G;  3BYY B;  1NNX A;  2A73 B;  4YY3 L;  1BDO A;  4TVA B;  3I90 A;  2JA8 B;  5C3E H;  2R7Z B;  1KXL A;  4Y52 H;  3T1H Q;  2WAQ G;  1PYW D;  1VQM A;  1QE6 A;  4B9X A;  2CWA A;  3QIA A;  3HOX H;  5M3M H;  5DLQ E;  4Q0F A;  1PRT F;  1TKW B;  4GKK Q;  1BCP F;  2KBN A;  3G4S A;  4DR7 L;  2DN8 A;  4XIG S;  2BH2 A;  5JJK A;  1IBM Q;  2FMM A;  3FKI G;  4LNQ A;  2AMC B;  2V4D A;  1FD7 D;  2P5Z X;  1PV4 A;  4JBM A;  4B08 A;  3TZD A;  1WCM H;  2F03 A;  2WII B;  3MC0 B;  3NBH B;  4ME3 A;  3CC2 A;  2B63 G;  3M7G A;  1HFN A;  1FR3 A;  4QJF A;  4DF7 A;  4K5X A;  1UE1 A;  3NEN A;  4LAA A;  1ASZ A;  5IGG A;  4A3D H;  2QIL A;  1SNQ A;  1STN A;  2LMC B;  1CKM A;  5FLX c;  4L5Q A;  2CW0 C;  2ZTD A;  2KHI A;  3AFP A;  3BVZ A;  3GV3 A;  1EEI D;  3CRL C;  3KBX A;  2A1A A;  1K8A C;  1B44 D;  3TRE A;  2EPB A;  4UP8 A;  4IOA A;  4DV1 L;  4DUZ L;  1PTO D;  2RHS B;  1PXU A;  1GJX A;  2K04 A;  3W3A A;  1OXV A;  3V96 A;  1Y1V B;  2E75 C;  4LFC Q;  2PI2 E;  3TS2 A;  3T4A C;  4CDC C;  4UHV A;  1EIY B;  1Z9F A;  1ENC A;  4LWC A;  1LYL A;  2R7Z H;  4B3S Q;  1F2Y A;  1JJG A;  5COY A;  2YTX A;  1GO3 E;  1JB7 A;  4LFB L;  4JI0 L;  1PDQ A;  2UUA L;  1PRT B;  4AYB B;  2VUM G;  1B1Z A;  4TRD A;  1V1P A;  3PF4 A;  2CQO A;  2K50 A;  3S24 A;  2CKZ B;  3UE0 A;  3BG3 A;  1E24 A;  4LF9 Q;  4A93 G;  1VQP A;  2XTI A;  3C1E A;  1E3P A;  3L7Z C;  3NWS A;  2Z6K A;  1IBL Q;  3Q6S A;  2HCC A;  3H0G B;  4BY7 H;  3RN5 A;  5JEA J;  3TDQ A;  4XYO A;  3PGZ A;  5IE8 A;  2SEB D;  2MPM A;  2WAQ B;  2CCZ A;  4X62 L;  2GN5 A;  3W1G A;  1SEB D;  2PZU A;  2AWN A;  2F0I A;  1PLF A;  4PG3 A;  1ET9 A;  3PO3 G;  1PVO A;  3HEJ A;  4IFD H;  2ALY B;  1IL8 A;  1EQQ A;  4YWM A;  2K6A A;  4P75 A;  1QZH A;  5FJ8 G;  5G3L D;  4RGN A;  2Y0S E;  1EOV A;  2K33 A;  4XXE A;  4DK6 C;  2SNM A;  3FKI B;  4BBS G;  3EBE A;  2JK8 A;  2KEE A;  4NXM Q;  3K5O A;  3S14 H;  4OX9 L;  1F2M A;  5HGQ A;  3SK5 A;  1CQF A;  3VYU A;  3OPO A;  2B63 B;  5CV4 A;  4IPH A;  4A75 A;  4IJH A;  1LTL A;  3D4D A;  2D9U A;  1Y1V H;  1SJH D;  1HTP A;  1X3G A;  1L1O B;  3SK4 A;  1ILP A;  1BBX C;  1B4O A;  5D65 A;  2CQA A;  2YTY A;  1GKH A;  3KDF A;  5GAG C;  2HCI A;  2ZTE A;  1OXX K;  2Z8L A;  1C48 A;  2A69 D;  2HIX A;  1X32 A;  4GNX A;  2F0Q A;  3I73 A;  4C3H H;  5CMD A;  1JMC A;  1E1T A;  1GUG A;  1YIJ A;  1M1K C;  2A6E C;  2E5L Q;  5C4X G;  1QNK A;  5CV8 A;  2Q2T A;  1STY A;  4BXX G;  4QMG A;  1Q1B A;  1E22 A;  1SAP A;  1RCV D;  1I6V C;  1PH4 A;  3H0G H;  2IY5 B;  2F0F A;  2K5Q A;  2Q8T A;  4JI2 L;  4A3K G;  2BDO A;  3D3R A;  2KJX A;  4GN3 B;  1EIG A;  2QW7 A;  4GNX B;  4KTA A;  3IRB A;  3PIO 3;  1PFN A;  2IHE A;  2E2I B;  1STA A;  3R93 A;  2VUM B;  4UP9 A;  2B2W C;  4JG2 A;  3GQB A;  1VQK A;  4JBK A;  3K5L A;  1X56 A;  4A93 B;  4C1N K;  4B9W A;  1DOK A;  4YIJ A;  1N34 Q;  2UU9 Q;  3KF8 A;  1S4Z A;  1IXR A;  1SYF A;  4G57 A;  3OTO L;  4AQY Q;  1SMY D;  4L5T A;  3I4N G;  4BA2 I;  1PA6 A;  1XNR L;  2B63 H;  3SXH A;  1GUW A;  1H9M A;  3J81 E;  1LM0 A;  1L0X B;  1HNW L;  1H9K A;  3PO3 B;  4GKJ Q;  2RDG A;  1B7Y B;  3D31 A;  4S3S A;  1EYC A;  1U0L A;  4U67 3;  1SYG A;  1PH6 A;  2F1M A;  3X3N A;  1OTC A;  2UXD Q;  1ENA A;  1LAC A;  1XMO L;  4RFB A;  3QG1 A;  2OF1 A;  5LMU L;  2XRS D;  3S9W A;  4BBS B;  4LF7 Q;  2LS0 1;  5AJ3 Q;  4DR6 Q;  1RTN A;  1AZP A;  2L11 A;  1JE4 A;  3LNN A;  4IO9 A;  2UUB Q;  3IKJ A;  3RZD H;  4DR4 Q;  2X6L A;  3S2H H;  4L8J A;  4NXN L;  3FPP A;  4WJ4 A;  1AZQ A;  1AE3 A;  1EIF A;  1KAA A;  2JEA I;  1WD1 A;  2F52 A;  1J5E Q;  5IYD G;  2KEC A;  1R9T B;  3HP3 A;  1KHI A;  4O2D A;  1OXT A;  1HH2 P;  4B3T Q;  5C44 G;  5E4W C;  1E1O A;  3ULP A;  1XXG A;  3VYR A;  1GM5 A;  2VUM H;  4HMI A;  4HIK A;  3HGB A;  1CZW A;  4E6I A;  5GRO A;  1VQB A;  1OO9 B;  3OWE B;  3J7A F;  3PSI A;  3E3X A;  3MA2 B;  4DR3 L;  2E8G A;  5LMN Q;  3TP6 A;  4V0B A;  1QVF A;  2C9O A;  1D2B A;  4GS3 A;  4TSS A;  1RDP D;  1YNJ C;  3KLS X;  2MO0 A;  3G7L A;  4I7A A;  5BR8 L;  1G91 A;  3E6Z X;  4OWW B;  3O13 A;  1P8L A;  3PO3 H;  5K36 H;  1I4Q A;  2PW7 A;  3J81 L;  1NSN S;  3S17 B;  1GVP A;  3CCJ A;  2KOL A;  1CQV A;  3NWT A;  1TS3 A;  2HHH L;  5FJ8 H;  1UAP A;  1Q46 A;  3J80 E;  5IP7 G;  4IUU A;  5IY0 A;  1JCK B;  3M4Y A;  3CMA A;  1JOK A;  1PHJ A;  1VQN A;  1FJG L;  1KL9 A;  1DCZ A;  4A3M H;  2EYM A;  1HPC A;  4AH6 A;  4HSP A;  2G5D A;  3HOV G;  3I4N B;  3QB3 A;  4EVO A;  2B8F A;  3RR5 A;  3UDI A;  2F0S A;  4RH6 A;  2OQ0 A;  2K75 A;  1BXT A;  2Q8I B;  1HR0 Q;  1TWG B;  5DAU A;  1NR2 A;  4DR2 L;  3ICE A;  1NTG A;  1K9M C;  4JI8 L;  4L5R C;  5IT9 L;  4N9P A;  1D5M C;  2EVB A;  3STB C;  1VDZ A;  4FYD A;  1H95 A;  3BDL A;  2B2W A;  4L6T B;  3MAQ A;  4P74 A;  4ODG A;  3H09 A;  1TVX A;  3T1Y Q;  3SE0 A;  1TXY A;  3RN2 A;  5C4X H;  3QOL A;  5I6Y A;  1ROD A;  2KHJ A;  2K03 A;  3G71 A;  4BXX H;  1KNA A;  2NVT B;  1S5C D;  1VQG A;  3FEW X;  3TQY A;  1CA6 A;  1JOR A;  1KNE A;  3CCS A;  4BS9 A;  4WRD A;  3HKS A;  1TQO A;  4XQQ A;  2JN4 A;  4A3K H;  1YJ9 A;  1B9N A;  2WV6 D;  4LW1 A;  4MIU A;  3R3O A;  4GN4 B;  1TY0 A;  3F2U A;  2NTS A;  1MSG A;  2NVY H;  1JWS D;  1SYC A;  1ZYR D;  4NKL A;  3A8J E;  1BO0 A;  4K8I A;  3S17 H;  2Z0S A;  1VQ9 A;  2EXZ A;  1YHB A;  3KJO A;  3E9H A;  4LUZ A;  2GA4 B;  2JP1 A;  2VQE Q;  2B2T C;  4BA1 I;  3J80 L;  3EQL C;  4JI6 L;  2PPB C;  4G7H C;  2R61 A;  2PQA A;  4X64 Q;  2OXP A;  4LF8 L;  3LGJ A;  3ND8 A;  3D8G A;  1NR4 A;  5C5L A;  5M5X H;  5JVH 3;  2EY1 A;  2HDL A;  4KI0 A;  5T1G A;  1TWG H;  1LTI D;  1YBY A;  1SRU A;  3CXC A;  3OIP A;  1SFO B;  2PO4 A;  3CAM A;  3W1B A;  2Z4H A;  4JI7 Q;  4L63 B;  3HOU H;  1WVL A;  1DXM A;  4KHP L;  3F2B A;  1VQ5 A;  2PMZ E;  1OXS C;  4PZ7 A;  4AIM A;  1RL2 A;  4KN4 C;  1EEF D;  4BWG B;  3NQI A;  4MN3 A;  3JAM c;  2NVT H;  3HOV B;  1B53 A;  2RDF A;  2F0O A;  4DAY A;  4RGT A;  5EPL A;  1GUN A;  2OCE A;  3I72 A;  5IYD H;  1SE3 A;  5BN3 A;  5AFW A;  5C44 H;  1CKO A;  1WI5 A;  3BZD B;  5CBE E;  3HOW G;  2XWJ B;  4X65 Q;  1S3O A;  3A54 A;  4DV6 Q;  2QKI C;  3LWU A;  4JCV E;  4JK1 C;  2JXM B;  3DUZ A;  1EY4 A;  1TR5 A;  4LMQ D;  3BU2 A;  4OIJ A;  1QCB D;  3MEH A;  2JA7 G;  5NUC A;  1NE3 A;  1VF5 C;  2VW9 A;  1NBW A;  1IBK L;  1S5B D;  4B3R L;  4FF2 A;  3DHQ A;  4PMB A;  1SYE A;  4JI3 Q;  4ZKB B;  5C6A A;  4ULL A;  1Y1W G;  2I0Q A;  2J7Z A;  5FO7 B;  1VF7 A;  2AQ1 B;  3KJP A;  4LF5 L;  2OT2 A;  2ZJP A;  2RDH A;  4L5S A;  3TRZ A;  2CFM A;  5EPK A;  2K5V A;  5ELF A;  1HNX L;  4QUF A;  1SYB A;  4ZAI A;  1G6P A;  1GD7 A;  3BDC A;  1BF4 A;  4JI4 L;  5IP7 H;  3J81 i;  4UDU C;  2L5T A;  1SSO A;  1IKM A;  5COR A;  2ZJR A;  2JA9 A;  3NUC A;  3NEM A;  1MIU A;  1IW7 D;  5EBC A;  3HOV H;  3DMU A;  1I4X A;  1SE8 A;  3H3V I;  4QQB X;  3CC7 A;  4GOP A;  5I2X A;  3VR2 A;  5E4X A;  4BY1 G;  5C3X A;  3GTL B;  5EKK A;  3GTQ H;  1PTO F;  4JI5 L;  1VQ8 A;  1SE2 A;  3EN2 A;  1PYS B;  1HA5 A;  4NPS A;  5KIX A;  2HT1 A;  3NSW A;  5IIF A;  2Q8R E;  4JI1 Q;  4A3J H;  3T1H L;  2PNH A;  5ELB A;  2B2U C;  1LTA D;  4K5W A;  2VQF Q;  1EY6 A;  4LF4 Q;  3S1Q H;  1BCP C;  5JEA H;  3URY A;  3R2I A;  1H9R A;  1VMP A;  1W3S A;  2RF4 A;  5C0X G;  5J22 A;  3QR8 A;  5D3I B;  4F87 A;  2Z4I A;  3FP9 A;  4WFN 3;  1STB A;  4GKK L;  4IJL A;  5ELE A;  5IWA L;  4I65 A;  2K28 A;  1E0B A;  1L0W A;  4HCE A;  3A56 A;  3H94 A;  1HUM A;  4X3S A;  4FVM A;  4I7Z C;  4KD4 A;  4GLA C;  3CPF A;  4HED A;  4A76 A;  1WTP A;  2PI2 A;  2ZM6 Q;  3CRK C;  3MVV A;  1Y1W B;  2K5W A;  2RSN A;  5G3L F;  3RZO H;  3M4O B;  4YHH L;  1ASY A;  2UXC Q;  3G6E A;  3STB D;  2VB3 X;  1PTO B;  2F4I A;  3UDX A;  1CM9 A;  1EQV A;  1K3B C;  2WFW A;  4DFA A;  3GTO H;  2B29 A;  3C2P A;  2HDM A;  2IX1 A;  5CYU A;  3GTL H;  3S1M B;  2VS1 A;  1U4M A;  1L1O C;  1B3Q A;  4J1M A;  1L0Y B;  5EGT A;  4PMW A;  1XPO A;  1JT8 A;  4LFC L;  2VXW A;  1H9S A;  2IX3 A;  1IL2 A;  1TS5 A;  2E74 C;  3NPP A;  4RCN A;  4DK1 A;  1BUV T;  4DV2 L;  1EFI D;  1S40 A;  1EY5 A;  3HKZ G;  2TMP A;  4XYQ A;  1V43 A;  1A15 A;  2WKD A;  4DR5 L;  3MXN B;  2E2H H;  3NQT A;  1EU3 A;  1IYV A;  1Q3L A;  3PMF A;  5GAE C;  4RG1 A;  1JWU D;  4BY1 B;  2FJ2 A;  1JOQ A;  1FNV A;  4FP5 D;  1IBL L;  3D4R A;  4DK3 C;  2F0V A;  5CV6 A;  1H9S B;  3S15 B;  3I56 A;  4A3G G;  2RKS A;  3KK7 A;  3HOW H;  1QNU A;  1RKN A;  3M9B A;  2PZW A;  3IL8 A;  4OO1 I;  1Z7T A;  5ELC A;  3PUV A;  4ME5 A;  3QWN A;  2UXB Q;  1UE5 A;  2JA7 H;  3S2D B;  2FMC A;  4DV5 L;  3VR5 A;  3QOJ A;  1PH2 A;  1G8Z D;  2F0U A;  2F0M A;  1Q86 C;  3FRP B;  2AUK A;  3T56 B;  2A8V A;  4X66 Q;  3IFD A;  4JV5 Q;  5J3B A;  3CP0 A;  5EJW A;  1QUQ A;  2ZJQ A;  2B8G A;  1X6O A;  2CVR A;  3DM1 A;  4HTH A;  3V2T A;  3U4V A;  5A2Q E;  3U58 A;  1WFQ A;  4K0K Q;  1KAB A;  3W5O A;  4HJ7 A;  2XN9 C;  1E2V A;  1PTO H;  4HJ5 A;  4FXK C;  4NXM L;  1A62 A;  1A3T A;  1S5E D;  1WJJ A;  4H7B A;  3NK9 A;  3WOE A;  4C3J H;  2JA5 H;  2EJG C;  3S1M H;  3M3Y H;  3OSO A;  4ZQ3 A;  3MZ5 A;  2JA8 H;  4RKL A;  4QGU A;  3UI2 A;  2LY7 A;  4CDD C;  4A3C G;  3TME A;  2D2C C;  4IUV A;  1Y8P B;  3A55 A;  4IUN A;  3PF5 A;  2BE5 C;  1DGS A;  1I50 B;  4YY3 Q;  1FGB D;  4RMF A;  2EYF A;  4DAV A;  3OW2 A;  3A8I E;  5EKL A;  2IPK D;  4G4K A;  4BY1 H;  1TWA B;  1D7Q A;  1ET6 A;  1HZB A;  1VQC A;  4OEL B;  1EWH A;  2FHT A;  3K80 C;  2F0D A;  1YNN D;  5I9P A;  2QDB A;  3S15 H;  4C3I G;  4EQP A;  3PO2 G;  3A5Z B;  4HMJ A;  2Z6B A;  3CF5 A;  1WYD A;  1Q8I A;  1ESF A;  3HKZ B;  1T5X D;  1V9P A;  2N8N A;  4PMC A;  4LUV A;  1D5Z C;  1V1P B;  5M5Y B;  4ZUJ A;  1J9O A;  1C8C A;  4OWX B;  4RKB A;  5DNF A;  3W2D A;  3I55 A;  4KY6 A;  4RA8 A;  5GAH C;  2L9H A;  2N88 A;  5CV7 A;  3ND9 A;  4DA2 A;  2UU9 L;  4A3E G;  4ZLT F;  1S72 A;  5KYL A;  4A3G B;  1WOC A;  1M8A A; 
#chains in the Genus database with same CATH homology
 1D8L A;  4AQY L;  3PSI A;  4A3I G;  1XJV A;  4A3L H;  1PH1 A;  4HIM A;  3HOX G;  5M3M G;  4DR3 L;  2E8G A;  3GTK H;  1C7Y A;  5LMN Q;  1JJC B;  3GTJ H;  1SN8 A;  2UUC L;  4JI1 L;  1MJC A;  1VQJ A;  1Z47 A;  1QVF A;  3HOZ H;  4GS3 A;  4JC0 A;  4EX5 A;  2MO0 A;  5BR8 L;  2VQF L;  4B3S L;  1P16 A;  1VCI A;  1CKN A;  2YYZ A;  1YJW A;  4OWW B;  2KCM A;  4GKJ L;  2OTJ A;  1P8L A;  2BH8 A;  1W2B A;  3PO3 H;  2F4V Q;  1HR0 W;  2H5X A;  3U4Z A;  1GVP A;  3ER0 A;  3CCJ A;  2LXK A;  3CCL A;  3TEH B;  2HHH L;  5FJ8 H;  1KD1 C;  1Q46 A;  3BJU A;  4LF7 L;  5IP7 G;  5AJ3 L;  5IY0 A;  1XMQ L;  3M4P A;  4LF9 L;  1I50 H;  2WB1 E;  3E9I A;  4QIW E;  3CMA A;  1EUJ A;  5ELN A;  4DKA C;  4DNI A;  2R7D A;  1K0R A;  3RNU A;  1PHJ A;  4JYA Q;  4HJA A;  2UUB L;  1AH9 A;  1VQN A;  1FJG L;  3UE1 A;  1KL9 A;  4A3M H;  5C0X I;  2QA4 A;  4DR4 L;  3DLL A;  3CCR A;  4A3F G;  4JI6 Q;  4AH6 A;  2B3G A;  1N33 Q;  4DUY Q;  3DM3 A;  3HOV G;  1NY4 A;  4GNX C;  4AYB E;  3TS0 A;  4JI0 Q;  3J7Z C;  4LF8 Q;  3KDF B;  3RR5 A;  1OXU A;  2D0O A;  3UDI A;  4LF6 L;  4DR1 Q;  2OQ0 A;  3AQQ A;  4GLX A;  2K75 A;  1HR0 Q;  4O0A A;  5IWA Q;  4DR2 L;  3ICE A;  1NTG A;  1K9M C;  1HNZ L;  2ZM6 L;  4JI8 L;  5GAD C;  2R93 G;  4L5R C;  4YWK A;  3M4Q A;  4B3T L;  2FXQ A;  1T9H A;  3STB C;  1X3F A;  2I5H A;  5IYC G;  1H95 A;  3SGI A;  2NZO A;  2C35 B;  4P74 A;  1Y1W H;  4DV0 L;  2JA5 G;  2LXJ A;  1XNQ L;  4KHP Q;  1KRS A;  3T1Y Q;  2EQS A;  1TXY A;  3RN2 A;  3WWV A;  1EFW A;  5C4X H;  2UXC L;  4GN5 A;  1BKB A;  2MQH A;  2WAQ E;  1HZ9 A;  1PFS A;  3L2P A;  3FKI H;  3M4O H;  1K73 C;  2K5H A;  1KAW A;  2KHJ A;  3G71 A;  1PH3 A;  2JA8 G;  4BXX H;  3CQZ H;  2R7Z G;  1VQG A;  1PYB A;  3TQY A;  2JEB I;  3UDF A;  3F2D A;  4QY7 A;  4A3G H;  3CCS A;  1KIX A;  4QL5 A;  5LMN L;  3HKS A;  1VQF A;  2VL6 A;  1C9O A;  4IPG A;  4A3K H;  1YJ9 A;  1KC8 C;  2QGQ A;  4LW1 A;  4R4C A;  2RCN A;  3KFU A;  4GN4 B;  4XTC S;  1A8V A;  4YHH Q;  4R4T A;  3H15 A;  4DV7 Q;  1XPR A;  3PCO B;  2NVY H;  1EQR A;  1QUQ B;  4UP7 A;  2F4V L;  1Q1E A;  1N36 Q;  1VQ7 A;  4POG A;  1VQ6 A;  3S1R H;  3S17 H;  1YEZ A;  3KF8 B;  4ALP A;  2Z0S A;  1VQ9 A;  3KJO A;  1YHB A;  2NN6 G;  3E9H A;  2E5L L;  2QEX A;  4MTN A;  4R4O A;  4LUZ A;  3K8A A;  3A0J A;  1FVI A;  1TWH H;  2VQE Q;  4JYA L;  1Q7Y C;  3HOY H;  1X3E A;  1YNX A;  4BA1 I;  5H1S E;  4DV2 Q;  2DUD A;  1A63 A;  3CME A;  4DV3 L;  2HIV A;  4JI6 L;  4POF A;  1UEB A;  1N33 L;  4PZ6 A;  2PQA A;  3ERS X;  1HZC A;  4FDB A;  4R1J A;  4X64 Q;  4B3R Q;  1JJ2 A;  4JBJ A;  4DR5 Q;  4LF8 L;  2GVA A;  3LGJ A;  2UXB L;  3CC4 A;  4DR1 L;  4DPG A;  2I5L X;  1HR0 L;  4B3M Q;  1CUK A;  5M5X H;  4DR7 Q;  4KI0 A;  3L0O A;  4OON A;  4KLK A;  1TWG H;  3K7U C;  1M90 C;  4LF5 Q;  1SLJ A;  1VQL A;  3S2D H;  1YBY A;  1SRU A;  2Z6K C;  3CXC A;  1KQS A;  3CAM A;  2ASB A;  1SR3 A;  1I6H H;  4X66 L;  3W1B A;  2E2I H;  1HNX Q;  4JI7 Q;  3HOU H;  1Y14 B;  2OTL A;  3KOJ A;  2D62 A;  3CCV A;  5FLM G;  3F2B A;  1VQ5 A;  4KHP L;  3I7F A;  2PMZ E;  4NB3 A;  3PIO A;  3CPW A;  2ATW A;  3CW2 C;  1OXS C;  2D0P A;  4J15 A;  4PZ7 A;  1RL2 A;  4JI2 Q;  4AIM A;  2JJQ A;  3CCU A;  1Y1V G;  1N34 L;  4A93 H;  1YZ6 A;  3RLO A;  3HOZ G;  3UDG A;  1VQE A;  4H02 A;  3KF6 B;  4P71 A;  3GTP H;  4DV5 Q;  3CCM A;  3JAM c;  3I2Z A;  2N3S A;  2NVT H;  1KRT A;  1I94 L;  5K36 G;  4HJ8 A;  1L1O A;  2ES2 A;  2CWP A;  3PO2 H;  1MJE A;  4GLV B;  1J6Q A;  3J81 j;  5C0X J;  1VQ4 A;  4AYB G;  3J80 i;  3J81 c;  2WP8 J;  2OCE A;  1YI2 A;  4DV1 Q;  1FGU A;  4DV7 L;  5IYD H;  1XTD A;  5IP9 H;  2MFI A;  4DUZ Q;  1QVG A;  3S1N H;  1N9W A;  2UXD L;  4JOI C;  1TWF H;  2KCT A;  4JI5 Q;  1YJN A;  1N36 L;  3OYY A;  2JA6 G;  5C44 H;  1CKO A;  1WI5 A;  4A3M G;  1FL0 A;  5IYB G;  3HOW G;  1IYJ B;  1Q12 A;  3H0G G;  4X65 Q;  1S3O A;  2MO1 A;  4YY3 L;  1NMF A;  4DV6 Q;  4DR6 L;  4JCV E;  4BBR G;  4TVA B;  4BBS H;  4OXP A;  1QVC A;  5ELO A;  5C3E H;  3BU2 A;  2VQE L;  2JQO A;  4MNO A;  4YWL A;  3T1H Q;  4A3E H;  2JA7 G;  2WAQ G;  4Y52 H;  2R92 H;  1VQM A;  1HNW Q;  1NE3 A;  2VW9 A;  3GDE A;  1TWA H;  1NBW A;  2CWA A;  4A3I H;  1IBK L;  3HOX H;  4LFB Q;  2JE6 I;  5M3M H;  4B3R L;  1B8A A;  2UUA Q;  1YHQ A;  2NN6 I;  2AHO B;  2EIF A;  5DLQ E;  1CKN B;  4JI3 Q;  3PUW A;  1Y1W G;  2I0Q A;  2K5N A;  5IT9 c;  5LMU Q;  2OWO A;  1JE5 A;  4GKK Q;  2KBN A;  3G4S A;  1J5E L;  3PUX A;  5M3F G;  4DR7 L;  2BH2 A;  4XIG S;  1V1Q A;  3KJP A;  1IBM Q;  4LF5 L;  5JJK A;  3FKI G;  4LNQ A;  2ZJP A;  1R9T H;  3K0X A;  2AMC B;  2MNA A;  5M5Y H;  3JAM i;  4L5S A;  3TRZ A;  1K83 H;  2CFM A;  1X9N A;  3BZC A;  2K5V A;  1PV4 A;  1HNX L;  3PUZ A;  4JBM A;  4JI7 L;  3I4M G;  4X6A H;  1WCM H;  3ZJY C;  1G6P A;  1GD7 A;  2I5M X;  3NBH B;  4ME3 A;  4JI4 L;  5IP7 H;  4NXN Q;  3J81 i;  3CC2 A;  4EQ5 A;  3F1Z A;  2B63 G;  4LUO A;  4A4I A;  4TQU S;  4X62 Q;  2ZJR A;  2JA9 A;  2KEN A;  3HKZ E;  4QJF A;  4R4I A;  1UE1 A;  3NEM A;  3NEN A;  1ASZ A;  4A3D H;  1MIU A;  4DV4 Q;  2OQK A;  1CKM A;  1RIP A;  1X55 A;  5FLX c;  4L5Q A;  4A3F H;  3U50 C;  3HOV H;  4LFA Q;  2ZTD A;  2KHI A;  1SE8 A;  5JJL A;  3AFP A;  3PUY A;  4JBW A;  3S16 H;  3H3V I;  2A1A A;  1K8A C;  4IFD I;  4QQB X;  1UWV A;  3TRE A;  4DAM A;  4UP8 A;  3CC7 A;  4IOA A;  4GOP A;  3HFZ B;  4DV1 L;  1Q8K A;  4DUZ L;  1PH8 A;  4BY1 G;  2R93 H;  2RHS B;  3PIP A;  3GTQ H;  4JI5 L;  1YIT A;  3MEF A;  1VQ8 A;  1PH5 A;  4P73 A;  4A3B G;  3EN2 A;  5IYC H;  4OX9 Q;  3G48 A;  3A5U A;  1PYS B;  1OXV A;  3J80 c;  4DR3 Q;  2N78 A;  4NPS A;  4LFC Q;  1VS0 A;  2PI2 E;  3TS2 A;  2HT1 A;  4IPD A;  1K8G A;  2UUC Q;  4JI1 Q;  4A3J H;  1N8R C;  1EIY B;  3GO5 A;  3T1H L;  1Z9F A;  2PNH A;  4LWC A;  1LYL A;  4UPA A;  2R7Z H;  4APV A;  1E7Z A;  3KYH C;  5BR8 Q;  2VQF Q;  4B3S Q;  4LF4 Q;  3S1Q H;  2ZTC A;  1JJG A;  2K52 A;  3CCE A;  2YTX A;  3GTM H;  1GO3 E;  4DUY L;  1JB7 A;  2YU9 H;  4LFB L;  4JI0 L;  1W3S A;  2RF4 A;  5C0X G;  2F3I A;  2UUA L;  3I4N H;  2VUM G;  3GD7 A;  3FP9 A;  3HOU G;  2HQL A;  3K81 C;  4K0K L;  1L2F A;  3PF4 A;  2CQO A;  2K50 A;  3S24 A;  4IJL A;  2CKZ B;  5IWA L;  2ID0 A;  3UE0 A;  4GKK L;  4OO1 G;  1E24 A;  1XMQ Q;  4LF9 Q;  4A93 G;  4A3C H;  1VQP A;  2XTI A;  1E3P A;  3L7Z C;  1L0W A;  2Z6K A;  1IBL Q;  3FHW A;  3RLF A;  4A3L G;  3RN5 A;  4BY7 H;  3T1Y L;  1B70 B;  5E7N A;  5JEA J;  5EAY A;  3PGZ A;  3ULL A;  5IE8 A;  4Y7N H;  4WJ3 M;  2LSS A;  2CCZ A;  4KHZ A;  4X62 L;  4LF6 Q;  2GN5 A;  4YCU A;  2PQA B;  3W1G A;  1I3Q H;  4GLA C;  1LUZ A;  2AWN A;  3CPF A;  1UE6 A;  2Q2H A;  4PG3 A;  4A76 A;  4DV4 L;  4DR2 Q;  2PI2 A;  1HNZ Q;  3PO3 G;  2ZM6 Q;  4JI8 Q;  1PVO A;  3CD6 A;  2IX0 A;  2ALY B;  4C3I H;  4HID A;  2A19 A;  1EQQ A;  4LFA L;  4YWM A;  4P75 A;  1QZH A;  5FJ8 G;  2Y0S E;  3KLW A;  1EOV A;  4DK6 C;  1BVS A;  2L15 A;  3RZO H;  4BBS G;  4YHH L;  1ASY A;  2UXC Q;  3EBE A;  3STB D;  2JK8 A;  3G6E A;  2NZH A;  5C3E G;  3UDX A;  1AE2 A;  3GTO H;  2WFW A;  2B29 A;  2AWO A;  4JOI A;  4NXM Q;  2IX1 A;  3OTO Q;  3S14 H;  4OX9 L;  3GTL H;  1Q82 C;  3M7N A;  2RHQ B;  2VS1 A;  2Q2I A;  3I4O A;  5HGQ A;  1L1O C;  2DGY A;  1G29 1;  5FLM H;  4IFD J;  4IPH A;  4PMW A;  2GVB A;  4IJH A;  4LFC L;  1LTL A;  4A75 A;  1XPO A;  1JT8 A;  1IL2 A;  3H3V H;  1XNR Q;  1Y1V H;  1VQI A;  1X3G A;  1N32 Q;  1L1O B;  2K4K A;  3PV0 A;  1BBU A;  4DV2 L;  1K3R A;  1NMG A;  2VY3 A;  4DAY B;  2YTY A;  1GKH A;  3HKZ G;  1VQO A;  2IT1 A;  3KDF A;  3E0E A;  1S40 A;  4LF4 L;  1V43 A;  5GAG C;  2ZTE A;  1OXX K;  4X64 L;  2HIX A;  1HJP A;  4DR5 L;  4GNX A;  3MXN B;  1XMO Q;  2K14 A;  2E2H H;  4C3H H;  1JMC A;  1WCM G;  1E1T A;  1YIJ A;  4B3M L;  1M1K C;  4UY8 C;  5GAE C;  1G51 A;  2E5L Q;  3A74 A;  4RG1 A;  1NJI C;  5C4X G;  1UE7 A;  2Q2T A;  1KXL A;  3B6Y A;  4BXX G;  1SMX A;  1Q1B A;  1IBL L;  1E22 A;  4DK3 C;  4R4Q A;  2JA6 H;  4A3D G;  3I56 A;  1SFO H;  4A3G G;  4DV3 Q;  5IYB H;  2VZA A;  1PH4 A;  3HOW H;  3H0G H;  2YTV A;  2IY5 B;  1VQH A;  3M9B A;  4JI2 L;  1C0A A;  4BBR H;  5M5W H;  4OO1 I;  4A3K G;  1SRO A;  5GQO A;  2UXB Q;  3PUV A;  1UE5 A;  4GN3 B;  2JA7 H;  3NEL A;  4DV5 L;  4GNX B;  3IRB A;  1PH2 A;  2IHE A;  1Q86 C;  1U5K A;  3F2C A;  4UP9 A;  2A8V A;  4X66 Q;  4JV5 Q;  4JG2 A;  2EXD A;  5J3B A;  2NVX H;  3CP0 A;  1VQK A;  4JBK A;  1QUQ A;  2ZJQ A;  1X56 A;  2BA1 A;  1YHA A;  3U58 A;  1X6O A;  3U4V A;  2Q2U A;  1I5F A;  5M3F H;  3BZK A;  1WFQ A;  1N34 Q;  2UU9 Q;  4K0K Q;  3W5O A;  3JC6 6;  4HJ7 A;  4A3J G;  1IXR A;  3HOY G;  4NXM L;  4HJ5 A;  1HZA A;  3OTO L;  1A62 A;  3I4M H;  4AQY Q;  3RLN A;  1WJJ A;  4C3J H;  5JEA G;  4X65 L;  2JA5 H;  1VQA A;  5HY6 A;  4DV6 L;  1I94 Q;  2R7F A;  3M3Y H;  3S1M H;  4HIO A;  4L5T A;  3VDY A;  3I4N G;  4BA2 I;  1PA6 A;  1XNR L;  2B63 H;  1Q81 C;  2JA8 H;  1LM0 A;  1N32 L;  5C4J H;  4QGU A;  2NVQ H;  4GOP C;  1HNW L;  2AKW B;  4GKJ Q;  3EIV A;  1B7Y B;  3D31 A;  4A3C G;  4YCW A;  2VNU D;  1U0L A;  1EWI A;  4MZ9 A;  1PH6 A;  1OTC A;  2UXD Q;  4GOP B;  4JI3 L;  1XMO L;  1VQD A;  1X54 A;  4P72 A;  3PF5 A;  4BY7 G;  5LMU L;  1MKH A;  2HHH Q;  1DGS A;  1EYG A;  3F8T A;  4LF7 Q;  4YY3 Q;  5AJ3 Q;  2Y0S G;  4RMF A;  3OW2 A;  3K7A H;  1IBM L;  4HJ9 A;  4DR6 Q;  1PH9 A;  2R6G A;  4BY1 H;  5JJI A;  2V1C C;  4PZ8 A;  4IO9 A;  2UUB Q;  1D7Q A;  1HZB A;  1VQC A;  1FJG Q;  2YV5 A;  3RZD H;  4A3B H;  4DR4 Q;  3K80 C;  3S15 H;  1BBW A;  4IFD G;  1O7I A;  1YVC A;  4IPC A;  1IBK Q;  3KF6 A;  1PH7 A;  3PO2 G;  3S2H H;  4NXN L;  2N49 A;  1X65 A;  3A5Z B;  3Q8D A;  1TWC H;  4WJ4 A;  2BA0 A;  1AE3 A;  3J7A 5;  1EIF A;  3AFQ A;  3CF5 A;  1QZG A;  2JEA I;  1WYD A;  3CCQ A;  3D0F A;  4OWT B;  2F52 A;  5LMN W;  2IHF A;  1J5E Q;  3AEV A;  1V9P A;  2N8N A;  5IYD G;  4LUV A;  1A0I A;  1KHI A;  4O2D A;  1IZ6 A;  1OXT A;  5IP9 G;  4IOC A;  3GTG H;  1HH2 P;  4B3T Q;  4OWX B;  2XGT A;  5C44 G;  1E1O A;  4JV5 L;  3ULP A;  1GM5 A;  1XPU A;  3M85 A;  2VUM H;  3I55 A;  4HIK A;  4DV0 Q;  1XNQ Q;  5GAH C;  1CSP A;  5GRO A;  3ULJ A;  4JI4 Q;  2UU9 L;  4YCV A;  1VQB A;  4A3E G;  2E2J H;  1CSQ A;  1S72 A;  2R92 G;  3AYH B;  2WB1 G;  1WOC A;  4C2M H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...