2FXQA

Single-stranded dna-binding protein from thermus aquaticus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
227
structure length
197
Chain Sequence
RGLNQVFLIGTLTARPDMRYTPGGLAILDLNLAGQDAFTDESGQEREVPWYHRVRLLGRQAEMWGDLLEKGQLIFVEGRLEYRSEVQVRAEFIDPLEGRRRALNQVILMGNLTRDPDLRYTPQGTAVVRLGLAVNERRTHFLEVQAWRELAEWASELRKGDGLLVIGRLVNDSWTSSSGERRFQTRVEALRLERPTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
publication title Structure of the single-stranded DNA-binding protein SSB from Thermus aquaticus.
pubmed doi rcsb
source organism Thermus aquaticus
total genus 37
structure length 197
sequence length 227
ec nomenclature
pdb deposition date 2006-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2fxqA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2fxqA02
4AH6A 1SROA 2FXQA 4UY8C 2I5MX 1OXTA 4BBRG 2VQFL 5JJLA 4XTCS 4PG3A 1ASYA 3FKIH 5FLMH 1SLJA 3JC66 2Y0SE 3J81j 3AYHB 4GNXB 2WP8J 5C0XG 4DUYL 2JA7H 3SGIA 5HGQA 4L5SA 5K36G 2AWOA 1VQIA 4R1JA 2Q2TA 2BA0A 5M5YH 4A3MG 3FHWA 2EIFA 3EN2A 3S24A 2UU9Q 4DR6Q 1LTLA 3ULLA 2N49A 4X65Q 3I7FA 1YHQA 4BY1H 2IT1A 2ZM6Q 1H95A 1AE2A 3EIVA 4JV5L 3CQZH 2HHHL 1K0RA 3K81C 1YHAA 2Y0SG 4ME3A 1HNXQ 4JI7L 2UXBL 1N9WA 1XMOQ 2CFMA 4A3JG 4HJ8A 2IY5B 1HH2P 4L5QA 4QY7A 3T1HQ 4LF9Q 4C3HH 1E1TA 3FP9A 4UPAA 4JI3L 2VL6A 2GVAA 5EAYA 5M3MH 4DV0L 3CC2A 3KYHC 4LNQA 1W3SA 3BU2A 3CXCA 1XPUA 3KDFB 4LFBQ 2R7DA 1AE3A 1RL2A 4YWMA 2N3SA 4DUZL 4O2DA 3HOUG 4LUOA 3KF8B 1UE6A 2YTVA 2CKZB 5IP7H 4LF4L 1MJEA 1X54A 1VQ5A 5C3EG 1SMXA 3OW2A 1Y1WH 4A4IA 1Q8KA 3CCUA 1XPRA 3KLWA 3RN2A 4BXXH 4KHPL 4GLAC 3I4MH 4UP7A 4X62L 1K83H 5C44G 1UE7A 1W2BA 4POFA 3HFZB 2UUBQ 3H0GG 3W1BA 1Z47A 3G71A 1VQFA 5IY0A 4A3BH 4A3DG 4MZ9A 1U0LA 4DV7Q 3PUXA 3RNUA 2F3IA 4PZ8A 4YCWA 1PH6A 4IOCA 1PH8A 3GTLH 1UE5A 4DV4Q 1YJ9A 4IJLA 2NVQH 1HR0L 2AMCB 4JCVE 4R4IA 1HR0W 2YU9H 1RIPA 2OWOA 1VQGA 3I4NH 1I3QH 2OTLA 5JJKA 1Z9FA 1QUQA 1FVIA 4L5TA 1X9NA 4NXML 3GTKH 1YHBA 3TS2A 1S40A 5LMUQ 4B3SL 3U4VA 1MKHA 1VS0A 2K50A 3GDEA 3F2CA 1I94Q 4IFDI 2I5HA 1IBLL 2UXDL 1C0AA 1KAWA 5FJ8G 1EWIA 1HNWL 1N8RC 2ALYB 3M3YH 4P75A 1V1QA 5DLQE 2IHFA 4OWTB 1TWAH 1HZAA 1EIFA 1VQBA 2IX0A 4KLKA 4JI1L 3G4SA 2VQEL 2VQFQ 3PO2H 4EX5A 5IT9c 3HOZH 4DUYQ 3K7UC 5HY6A 2OQ0A 3CCVA 2ASBA 4HIOA 4OO1I 2WB1E 3A5ZB 2KENA 4DV2L 2ZTEA 3PF4A 3BZKA 3BZCA 2E8GA 3TEHB 4LF6L 3NENA 4DV1L 3CCQA 1HJPA 2HT1A 2ZJQA 4GLVB 1KD1C 1YIJA 2H5XA 3S2HH 3HOVG 4JV5Q 4PMWA 3AEVA 3PO3G 4P71A 2HHHQ 4XIGS 3EBEA 4JG2A 2R92G 2B63G 1Y1VH 1VQ4A 1K8AC 5IWAL 2UXBQ 2B29A 3HOXG 4OONA 4QQBX 2WB1G 4R4CA 3F2BA 2UUAL 3M7NA 1M90C 1EUJA 2JA5H 4DV5L 1GD7A 4AQYL 4LF8Q 3E9HA 3PIOA 3OTOL 4JI3Q 3PGZA 4DR3L 4GOPA 1B8AA 3TREA 1P16A 4DPGA 4OX9L 2NN6G 4A3KH 1O7IA 4YHHL 2MO1A 1JJ2A 4B3TL 4DUZQ 2R92H 1QVCA 3A0JA 3RLFA 1WI5A 5JJIA 1ASZA 2DUDA 4P72A 1PA6A 1VQ7A 2ZTCA 1YEZA 2Q2HA 3GTOH 4LF4Q 4QGUA 2B3GA 4GN5A 2RF4A 4LF7L 1N32L 3RLNA 1J5EL 4UP8A 4JI4L 4KHPQ 4A3LG 1VQAA 1G6PA 1KRSA 2Z6KA 1YI2A 3ULJA 1XPOA 1EYGA 1SN8A 4X6AH 1VQCA 1DGSA 2CCZA 1IYJB 2XGTA 2OQKA 4A3EG 1YJNA 4C2MH 1HR0Q 1VQEA 2RHQB 2NVYH 4A3MH 5IYDG 4LFAL 3D0FA 2UXCL 2C35B 4LUZA 5GAEC 2PI2E 3JAMi 3CPFA 4HJAA 3E0EA 1KHIA 4NXMQ 2F4VL 3F8TA 2KHIA 4IFDJ 2Q2IA 5IYCG 4JOIA 1EQRA 4GNXA 5BR8L 1PH7A 1JB7A 4JI2L 4GKKL 2UXDQ 1XNQL 1N36L 1HNWQ 1MJCA 1PVOA 4BA2I 3J81c 4RG1A 2VUMH 2VQEQ 3KF6B 2UUCL 4A3JH 1N33L 2PQAB 3IRBA 1K9MC 1Q46A 3I56A 3H15A 3M85A 1KXLA 1IL2A 2JA8H 4DV2Q 3CCJA 4DR2L 3TS0A 3CP0A 3CF5A 4LF6Q 1MIUA 1N34L 1G291 2E5LL 1XJVA 1X3GA 4X66L 4DV1Q 1C7YA 4NB3A 3S1MH 3FKIG 4A93H 4WJ3M 3T1YL 3HOUH 3ZJYC 3HOWG 4A3GG 1NMGA 2JJQA 1X56A 5C3EH 3UDIA 3KFUA 1VCIA 2RHSB 2K5NA 1L1OC 3GTMH 5IWAQ 1EQQA 1LUZA 1PYBA 2XTIA 4AIMA 2UUAQ 1X55A 4A3IG 3KDFA 3DLLA 4DV5Q 1Q1BA 4GS3A 4DK3C 3A74A 4AQYQ 1OXUA 3RZDH 4DR7L 3OTOQ 5AJ3L 4DR3Q 4K0KL 1E22A 2KHJA 1WCMH 4R4OA 3W5OA 4L5RC 4JI8L 4JI5L 4YHHQ 1UWVA 2ZJRA 4B3TQ 1JE5A 2I0QA 3PIPA 1A8VA 1SE8A 5C0XI 2IHEA 4BY7G 2K14A 1KRTA 1C9OA 4DR1L 4DK6C 5IP9H 1QVFA 1KQSA 1PH3A 1N32Q 4JBWA 3ERSX 3GO5A 5GROA 4JI4Q 1SR3A 3UE1A 5FJ8H 2A19A 2HIXA 3S1QH 1JJCB 1EFWA 2NVXH 5JEAJ 3HOYG 5FLXc 4JBMA 4DR4L 1XNRL 5IP7G 2HQLA 4P73A 3CC7A 4YWKA 3STBC 2R7ZH 4BXXG 1VQHA 2YV5A 1B70B 2QA4A 4HJ7A 4LF5L 1PH5A 4LFAQ 3I4MG 1Q86C 2UXCQ 3S17H 1EIYB 4A3CH 1L1OB 2R6GA 1CKNB 3HKZE 1BBUA 5H1SE 2A8VA 3J80i 1E1OA 2F4VQ 3PV0A 4DV3L 4H02A 4APVA 1XMQL 2CQOA 3CAMA 2CWPA 4DV6L 1UE1A 1KIXA 4YY3L 2K5VA 3PO3H 4MTNA 3U4ZA 1N36Q 1L0WA 1XNQQ 4BBSH 3I4NG 4MNOA 4PZ6A 4QIWE 1GVPA 1WOCA 2YTYA 1QVGA 4DR6L 4X65L 3LGJA 3RLOA 2UUCQ 4DR5L 1VQ9A 3MEFA 5JEAG 1NTGA 1N33Q 4GN3B 3Q8DA 4B3ML 2N8NA 1D8LA 3PSIA 4JI7Q 2F52A 4HJ9A 3PUVA 1BBWA 3HKZG 3KJPA 2R93H 5C4XG 1YBYA 3K0XA 4DKAC 2K4KA 2JEBI 4DR2Q 1YJWA 1VQDA 1HZCA 1N34Q 2K75A 4X66Q 3HOZG 1VQJA 3M4PA 4DV0Q 3PO2G 3T1YQ 2KCTA 4J15A 3CCLA 3TRZA 3S1NH 2ATWA 1GO3E 1B7YB 3CW2C 3RZOH 2A1AA 1BKBA 4GLXA 1GM5A 3ER0A 1Q1EA 3RN5A 3I55A 2I5LX 2D0OA 3UDGA 4LFBL 2YTXA 4JOIC 1Q7YC 1KL9A 1NJIC 1IBKL 1NMFA 4EQ5A 1NE3A 3AQQA 3S15H 4Y7NH 4A3FG 2E2HH 4LWCA 4R4QA 3S14H 5M3FH 4DR7Q 5AJ3Q 4POGA 3CCSA 4X62Q 4A3EH 2R7FA 5M5XH 1VQ8A 1CKOA 1Y1VG 4JI8Q 4AYBE 4BBRH 4HIDA 4JI5Q 1CKMA 3G6EA 3GTPH 4WJ4A 2CWAA 1HZBA 1IBML 1JMCA 1I5FA 2JA5G 1S72A 1V43A 4DR1Q 4LW1A 2BA1A 4C3IH 3CC4A 1XTDA 2GVBA 1IXRA 2WFWA 4UP9A 1PYSB 3UDXA 4YWLA 2VZAA 4B3SQ 4NXNL 4RMFA 4LFCL 2AKWB 4TVAB 1PV4A 2IX1A 4DR4Q 1IBLQ 4X64L 3K7AH 1XNRQ 2JQOA 4O0AA 4AYBG 1PHJA 1A62A 3S2DH 3GTGH 2MO0A 3K80C 5IYBG 1X3EA 2JA6G 1JT8A 1K73C 4JI1Q 1CSPA 1LM0A 4GN4B 4LF5Q 1HZ9A 4IPHA 5IE8A 3AFQA 2ES2A 3W1GA 4JI0L 3M4OH 4A75A 4GKJL 4P74A 1PFSA 2DGYA 1EOVA 1FL0A 1QZHA 4DV3Q 2NVTH 3HOWH 3KF6A 1XMQQ 4A3GH 4DV6Q 2NN6I 2PQAA 4YY3Q 1TWGH 1K3RA 4YCUA 5FLMG 3CMEA 1X3FA 2JA7G 4FDBA 3I2ZA 2GN5A 1FJGL 2QEXA 1AH9A 3AFPA 4ALPA 1OXVA 3KJOA 4DR5Q 4IFDG 1Q12A 4A3IH 1GKHA 2D0PA 1L2FA 3F2DA 4HIKA 4B3MQ 3KOJA 1OXSC 1TWFH 3S16H 2VNUD 2KCMA 4IPDA 1SRUA 5C44H 3D31A 3J7ZC 3G48A 4BY1G 3CCMA 3H0GH 4GKKQ 4JI6L 1TWHH 2N78A 2VUMG 4A3DH 5LMNL 3GD7A 5LMNW 4BY7H 2LXKA 4OO1G 3CMAA 4OX9Q 4LF8L 3DM3A 4IPGA 2JA8G 2LSSA 4B3RL 1YNXA 2EXDA 3I4OA 4DAMA 3E9IA 1YVCA 2QGQA 3JAMc 3UE0A 1HNZL 2E2IH 2JK8A 4A93G 2V1CC 5M3MG 3HOYH 5J3BA 1IBKQ 2AWNA 4LF7Q 1PH2A 4QJFA 1CUKA 1WFQA 1J5EQ 2VW9A 4HJ5A 3NBHB 3PUZA 4C3JH 2Q2UA 4A3FH 3B6YA 3UDFA 3WWVA 3ICEA 3OYYA 1YITA 2E2JH 4JYAL 3CCRA 1X6OA 1E3PA 2VY3A 1IBMQ 1T9HA 1Y1WG 4JC0A 2PI2A 3HKSA 1E24A 1QUQB 3K8AA 4R4TA 3PCOB 1A0IA 1WCMG 4IJHA 5GAGC 3PF5A 5E7NA 4GOPC 3NEMA 3J7A5 4IOAA 1V9PA 1J6QA 4A3BG 3M4QA 3H3VH 1JJGA 2AHOB 4OXPA 4NXNQ 4LFCQ 1PH9A 1YZ6A 1VQLA 2JEAI 4JI2Q 3TQYA 5BR8Q 3HOVH 4X64Q 1K8GA 5IP9G 3ULPA 1L1OA 5GAHC 1CKNA 2MNAA 1UEBA 2B63H 1VQOA 4JBKA 4A76A 4DNIA 2UU9L 5C4XH 3S1RH 1D7QA 1TWCH 3HOXH 5ELNA 5GADC 3PUWA 2ZM6L 2MQHA 1I6HH 2L15A 4JI0Q 4YCVA 4GKJQ 2Z6KC 1PH4A 1Q82C 3BJUA 2ID0A 3M9BA 2ZJPA 3L2PA 1G51A 1VQMA 2NZOA 3VDYA 1HNXL 1VQ6A 2R7ZG 2E5LQ 1TXYA 3L7ZC 3U50C 4HIMA 1NY4A 1XMOL 3U58A 3NELA 5C4JH 4LUVA 2BH8A 3T1HL 1VQPA 1FJGQ 4A3CG 4LF9L 1S3OA 3A5UA 1E7ZA 2WAQE 2ZTDA 1BVSA 1FGUA 2R93G 2RCNA 4A3LH 2BH2A 4BBSG 3J81i 1OTCA 4KI0A 3GTJH 4GNXC 4NPSA 4GOPB 1IZ6A 2PNHA 4QL5A 4JI6Q 3MXNB 4JBJA 2KBNA 5LMNQ 1VQKA 2PMZE 1SFOH 4K0KQ 3PUYA 1QZGA 3STBD 1Y14B 3GTQH 1VQNA 2JA9A 5M5WH 2OCEA 5IYDH 1WJJA 4KHZA 3RR5A 2UUBL 2WAQG 4B3RQ 5C0XJ 2OTJA 1M1KC 2JE6I 1HNZQ 3CCEA 4DV7L 4PZ7A 3J80c 5GQOA 4OWWB 2K5HA 3CPWA 4DV4L 5IYCH 1Q81C 4Y52H 1PH1A 4IPCA 1R9TH 1LYLA 2K52A 2MFIA 4A3KG 1KC8C 4OWXB 4DAYB 5IYBH 4IO9A 2D62A 2NZHA 1CSQA 1WYDA 2HIVA 2Z0SA 3L0OA 4TQUS 2JA6H 3H3VI 1P8LA 4BA1I 4JYAQ 5LMUL 1U5KA 2YYZA 3CD6A 1I50H 1I94L 3F1ZA 2VS1A 1A63A 2EQSA 1OXXK 1NBWA 2LXJA 5M3FG 5ELOA 1X65A
chains in the Genus database with same CATH superfamily
2FXQA 1LT4D 1EL0A 4UY8C 4MIUA 5D3IB 4BBRG 2VQFL 4PG3A 3FKIH 4DU9A 2HUGA 3J81j 1PRTC 3OMCA 4KV6A 5K36G 2AWOA 2TSSA 4HN7A 3AB9A 5TSSA 1K0SA 4C3IG 3BYYB 3FHWA 4ABNA 3S24A 1YHQA 3T56B 4Q5VA 2EJMA 2EY2A 1CI3M 4LJZC 1H95A 1AE2A 3MA2B 1EY0A 5EGTA 3CQZH 2HHHL 4ME3A 2ICEC 2KUMA 2RSNA 2F0QA 3C46A 2R92B 3SK6A 4C3HH 5K5PA 5EAYA 2GVAA 3CXCA 3KDFB 2R7DA 1RL2A 4YWMA 2N3SA 1V1OA 4LUOA 4R9WA 2YTVA 5M5XB 4K14A 5IP7H 4BBRB 2EPBA 1SMXA 3OW2A 3GTPB 3BVZA 1Q8KA 3NXWA 3CCUA 4BXXH 4KHPL 4G7HC 1RODA 2IX3A 3I4MH 1W2BA 1UE7A 4C3IB 1LT5D 1SJED 2PZWA 5I4DA 5JPMC 3PUXA 1JC7A 5E1FA 1UE5A 1QNUA 1HR0L 1HR0W 2WV6D 1GUNA 2BE5C 2YU9H 3I4NH 3R8BA 3HRZC 1FVIA 1CK1A 1MKHA 4HTHA 1I94Q 1IBLL 1C0AA 5IGDA 1KAWA 2XNAC 1EWIA 1I6VC 1H9RA 2D9UA 2Z8LA 1EIFA 1HZAA 1VQBA 2IX0A 3BDLA 2A69D 3PO2H 4DUYQ 4G7ZC 3CCVA 2WB1E 3BZKA 4LF6L 4EVOA 3NENA 1HJPA 3VYTA 2ZJQA 2DJGC 2OF1A 3H3VC 3S2HH 1F77A 3AEVA 3NTIA 1PTOF 4XIGS 4CDFC 1LTGD 3HEJA 1FYCA 1BBXC 1EZ8A 1EY6A 2RQXA 4R4CA 3M7NA 1M90C 2B2YC 1H9SB 1GHJA 2HDMA 4LF8Q 3OTOL 4JI3Q 4GOPA 1A6XA 1MSHA 1B8AA 1P16A 4DPGA 4A3KH 1STAA 1JJ2A 4B3TL 4DUZQ 5JJIA 2J7ZA 1PA6A 1YEZA 3GTOH 1TS5A 4QGUA 4LF7L 1K3BC 4UP8A 2R7ZB 2CW0C 4A3LG 3J80L 1PFMA 2DY8A 4RCOA 1KLUD 3PIP3 5G3LD 1EYGA 5LL6X 3NWSA 1F9SA 1IYJB 1LT3D 4A3MH 5IYDG 4LUZA 1HA6A 2PI2E 5D3DA 3TP5A 2B2WC 3F8TA 4FF3A 5IGBA 4GNXA 1JB7A 2UXDQ 1TY2A 1XNQL 1HNWQ 2QCPX 3J81c 2WAQB 3H94A 5D65A 2VQEQ 2UUCL 1Q46A 3M85A 5CORA 3CCJA 4DR2L 2F0EA 1DOLA 1G291 2PMZB 1RDPD 4NB3A 3A8IE 3DWQA 2JJQA 5J22A 3C2PA 4DK0A 3KFUA 2ZXOA 1PMRA 1KDBA 4ZQ3A 5FO8B 3VR4A 3A74A 3SEBA 1HTLD 4DR3Q 1E22A 1ZYRD 3W5OA 4L5RC 5COYA 4JI8L 3K59A 3KUPA 4RCNA 3PIPA 5C0XI 3EROA 1XWEA 2IHEA 5FKAC 3S9WA 2BOSA 4R8NA 5CMDA 3OIPA 1QVFA 3K7AB 4RKBA 1J8IA 4JBWA 4JI4Q 3KLSX 1VF5C 3EFXD 1JJCB 1GOZA 3VR2A 2NVXH 5A2QL 1U9RA 4JVZA 1ENAA 2F0HA 4DR4L 5IGGA 4DFAA 3CC7A 2NYZD 1QOHA 1SAPA 2NVTB 1VQHA 3OW7A 2YV5A 3R3OA 4LF5L 1PH5A 2K01A 1EIYB 2KEDA 1L1OB 4A3CH 1BBUA 1I4XA 2M00A 1HUMA 1PXUA 4H02A 2CQOA 5HGTA 4CDEC 3PO3H 3UI2A 1N36Q 1L0WA 2O5JC 5IT9L 2MP1A 1M4VA 2A6ED 2YTYA 3AU7A 1EY9A 4C1NI 2WINB 1I4HA 3ND9A 3FDTA 2N8NA 4EQNA 3MFGA 4JI7Q 5ISRA 3HKZG 1BCPF 2K4KA 1YJWA 2DJFC 4B08A 1JWUD 5NUCA 3HOZG 1VQJA 4DV0Q 1SE2A 5LHY1 1SYCA 2KCTA 4K2KA 3CCLA 3SDZA 1DD2A 1GO3E 3CW2C 3D8GA 4K6LA 4GLXA 1GM5A 2D0OA 3D4RA 3UDGA 5DM63 2YTXA 3S15H 1KL9A 5I6YA 1Y8PB 3QWNA 3AQQA 3NPPA 1AEXA 1W6KA 2XIWA 4DR7Q 4BWGB 5M5XH 5E3FA 1VQ8A 4BBRH 4OIKA 4HIDA 1AZPA 3GTPH 4HAEA 1KTKA 1TT2A 1I5FA 2JA5G 3K0YA 4DR1Q 1B2TA 4C3IH 3CC4A 3MWYW 1ILPA 2B63B 4S3SA 2IWHA 4UP9A 3HKZB 4YWLA 3HOXB 3R2IA 4B3SQ 4LFCL 2AKWB 1I6HB 1H9JA 2JQOA 4O0AA 2FJ2A 3GTGH 5IYBG 1X3EA 1JT8A 1K73C 1LM0A 2B2YA 1J9OA 4GN4B 1HZ9A 1CZGA 4NDXA 2ES2A 1A3UA 2QEJC 4PV1C 2JSOA 1QZHA 3KF6A 1XMQQ 1DXMA 3H09A 4YY3Q 4DA2A 3TP7A 1STYA 4ILWA 2QEXA 4DR5Q 5EQ0A 1Q12A 1GKHA 4B3MQ 1IYVA 1TWFH 5T1IA 3S16H 2KCMA 1LLRD 4IPDA 1SRUA 3CCMA 2EY5A 1EZ6A 1HUNA 2N78A 2A69C 5KEEA 5LMNL 4PMBA 1IW7D 5LMNW 5CBEE 2HQEA 5LL6S 4LF8L 4XXEA 3DM3A 1EYAA 4B3RL 5EPKA 2B2WA 1E2ZA 3I4OA 2Q8TA 3E9IA 3CKIB 4DAVA 2QGQA 3UE0A 5C5MA 4FF1A 4A93G 1IBKQ 3I3CA 1CUKA 1EY7A 4LAAA 3SVMA 3DMUA 3WWVA 3ICEA 3OYYA 1B50A 3CCRA 1X6OA 1ZKOA 1DJRD 1IBMQ 1L0YB 4R4TA 4TRDA 2M2LA 3PCOB 5GAGC 1ZEQX 5E7NA 2KEEA 1JJGA 4NXNQ 2A68D 1YZ6A 1K8GA 3CQZB 1CKNA 4ZYSA 5GAHC 4JBKA 1G8ZD 1TWCH 1E2VA 1QCBD 1TVXA 2RKSA 2ZM6L 2MQHA 3SK4A 3NQIA 2B8FA 2L9HA 1LTAD 2Z6KC 2AQ2B 1PH4A 3BJUA 2DNCA 1HNXL 1SXTA 1VQ6A 1HRJA 3U50C 2WKCA 2O5IC 3AMUA 1XMOL 1DZ1A 4MN3A 1A2TA 4IUVA 4LF9L 1G2SA 1PTOH 1F9QA 1E7ZA 2WAQE 2ZTDA 4U673 2L11A 2R93G 2RCNA 4A3LH 4QCLA 4G4KA 1OTCA 4KI0A 3GTJH 4NPSA 3P7JA 4GOPB 2PNHA 1MD2D 5ELBA 1VQKA 1ICWA 2PMZE 1HQRD 1K8OA 4K0KQ 1W6JA 3STBD 1R4QB 1Y14B 3N52A 2JA9A 1WTVA 5KYIA 1CA6A 5IYDH 1B3AA 2LS01 3I4NB 5C0XJ 2OTJA 1M1KC 3KLSA 3URYA 2JE6I 3QIAA 3CCEA 2PPBC 3J80c 1CFMA 4OEMB 4RAUC 3ERQA 1Q81C 1BF4A 4IPCA 4A3KG 2MFIA 1FGBD 1CSQA 2Z0SA 2PO4A 4JYAQ 5M3FG 1JCKB 2LXJA 2EXZA 1SROA 1ZYRC 2E74C 2F0JA 1ASYA 3JC66 4B9XA 4GNXB 2JA7H 1C4QA 1X32A 5C0XG 4RGNA 3SGIA 4R1JA 5M5YH 4A3MG 2EIFA 2DY7A 4WFN3 2UU9Q 4DR6Q 3BDCA 3I7FA 1LTRD 2ZXPA 4BY1H 2IT1A 1K0RA 3K81C 4KY5A 1U4MA 2Y0SG 2ZXRA 4JI7L 1PZJD 4A3KB 1N9WA 2CFMA 4HJ8A 2IY5B 3T1HQ 1QJOA 2L12A 4XDXA 4DV0L 3GTOB 5BN5A 3HG9A 3KYHC 4M1UB 4LNQA 3BU2A 1H9KA 5KGUA 5M3FB 5IGCA 1T5XD 4O2DA 2EZVA 1F2MA 2A6EC 1UE6A 5KRUA 3WOEA 2K28A 4LF4L 3TN2A 1X54A 1MJEA 3M7GA 5L37A 3PIO3 3KLWA 1SBBB 3I8ZA 5C4HA 4UP7A 1LTSD 4A3MB 4POFA 3H0GG 3T16A 3G6JB 1Z47A 3ZYYX 1STEA 3G71A 3GQBA 2EYOA 1PH6A 4PZ8A 4DV4Q 3CU7A 1SEBD 4KJOA 3A8KE 3E3XA 2Y0SB 4L5TA 1QUQA 2SNSA 2O2LD 2MJ8A 4B3SL 2K50A 5CV7A 4FXKC 5JPNC 1TQOA 1AW7A 2VXWA 2RDGA 1JORA 4C3JG 2ALYB 2RSOA 2NTTA 5DLQE 4OWTB 2NUCA 1EQTA 2F0NA 3HOZH 5IT9c 1TWGB 3K7UC 2OQ0A 2Z4IA 3K58A 3A5ZB 4CJ0B 3NE5B 4DV2L 2ZTEA 2E8GA 3TEHB 3VYSA 1EOTA 3CCQA 2PZTA 4OIJA 4QMGA 4DNRB 3H0GB 1YIJA 3C3LA 3I72A 4KK7A 3HOVG 4JV5Q 4PMWA 3Q24A 3PO3G 3LWEA 4XYQA 2I46A 2UXBQ 1K8AC 5IWAL 2B29A 3SR1A 4OONA 4QQBX 1GUOA 1GJXA 2UUAL 3IFDA 1EUJA 5KIXA 2JA5H 3EQLC 1GD7A 4UAIA 3PIOA 1IKLA 3MTSA 3IL8A 4YHHL 2F03A 1QVCA 3A0JA 4RWSC 2TMPA 1ASZA 2C9OA 2NVXB 1VQ7A 3TP8A 2Q2HA 4FYDA 2B3GA 2ZT9C 4GN5A 2RF4A 1N32L 3RLNA 5CR3A 1KRSA 2Z6KA 2F3WA 1UUPA 2F0WA 3ULJA 1XPOA 4DAYA 1SN8A 1IW7C 1RCVD 1DGSA 2CCZA 3OIQA 2XGTA 2OQKA 3H91A 4C2MH 1PYWD 1VQEA 5C3XA 2NVYH 3HOVB 3D0FA 2B2TC 3PO3B 2UXCL 5GAEC 2F0OA 3E0EA 1K28A 1KHIA 4NXMQ 1D5MC 3SK8A 4IFDJ 1EYCA 4XQNA 4JOIA 3E6ZX 3P75A 5KYLA 1PH7A 4GKKL 4FXDA 4J1MA 1SSOA 1MJCA 4BA2I 1CT1D 4RG1A 3KF6B 2CH4A 2E2JB 3PQIA 4QB4A 1M8AA 1KABA 2K5WA 1IL2A 3TZDA 3L3OC 4K8JA 2PQEA 1MIUA 3CF5A 4CKCA 3JAME 4DV1Q 4WJ3M 1PDQA 4A93H 2A68C 3S15B 4RKLA 1JQYD 2G5DA 2Z6BA 3DWAA 4ZKCB 3TSSA 5C3EH 3GTMH 2EJFC 1D5ZC 1PYBA 2XTIA 4K5WA 4DV5Q 1Q1BA 4AQYQ 2Q8IB 4IALA 1S5ED 4X3TA 4K0KL 2KHJA 3BVMA 2ZJRA 1JR0D 2QILA 2PZUA 3OOCA 2KCNA 1LV9A 4N9TA 3GTGB 3ERSX 1SR3A 5FJ8H 2HIXA 3S1QH 2WIIB 5D14A 5E4WC 2HQLA 2SOBA 3STBC 4DGZA 4HJ7A 2BDOA 4LFAQ 2OT2A 1Q86C 5FLXL 2R6GA 1CKNB 2A8VA 4RFBA 1E1OA 3I91A 4H0LC 2F4VQ 4KMUC 5CV5A 1RJTA 3CAMA 4DV6L 2R93H 1UE1A 1TWFB 3S16B 4MNOA 3MXGA 1WOCA 1QVGA 4DR6L 1GUGA 2JXMB 3MEFA 2L5TA 1VQ9A 3QG1A 2L1BA 1N33Q 1EEID 3PUVA 1BBWA 3VR6A 3T53B 1JB3A 3BS1A 5IGEA 1HZCA 1N34Q 4QF4A 3O13A 4X66Q 2EYPA 4N8X1 1TU2B 3T1YQ 4J15A 2VB2X 1BO0A 1DOKA 4IN3A 5ELFA 2D5DA 4ULLA 1B7YB 3RZOH 2A1AA 1BKBA 4XQJA 3ER0A 3HP3A 2J4XA 1Z7TA 2I5LX 3D4DA 3FPPA 2A5HA 3V05A 4OL7A 5M3FH 2CH4W 2SNMA 5AJ3Q 3A54A 4A3EH 2R7FA 4JI5Q 1O7LA 2F0GA 3G6EA 2XWJB 5C0XH 5EBDA 4B9WA 1JMCA 3E5SA 2X6GA 3GTKB 1XTDA 5CV8A 2GVBA 3C1FA 4JK1C 1V8QA 2WFWA 1TWCB 4QUFA 3CHBD 4RMFA 1PLFA 4TVAB 1HHVA 4X64L 1XNRQ 4AYBG 3DHQA 3MXPA 1XYIA 1TS2A 1T5EA 1CSPA 1ML0D 4QIWB 4JI1Q 1IYUA 4YIJA 4IPHA 4Z9CB 5IE8A 4GKJL 4A75A 1PTOB 4V0BA 1FL0A 4DV3Q 2F0VA 3HOWH 2PQAA 1E2WA 1TWGH 4H44C 1X3FA 2JA7G 3GTJB 3CRKC 1WTRA 4ALPA 1LACA 1D1KA 4HIKA 3EVQA 3KOJA 3K5NA 4BS9A 1WTXA 2LFNA 3D31A 4BY1G 3H0GH 1B9NA 1RTNA 1QG7A 4JI6L 3Q22A 2VUMG 1B4OA 2IPKD 2LXKA 2B2TA 4OX9Q 3MAQA 1JE4A 1JOQA 2LSSA 4AYBB 1YNXA 1H9MA 2EXDA 4EQOA 2V4DA 1GHKA 4FXGC 2V1CC 1U4PA 3DEPA 1F2ZA 3E0JA 1PH2A 1J5EQ 2L0CA 3A7LA 5ELEA 4C3JH 2K5QA 3NP8A 5JVG3 2EJGC 4K2LA 3UDFA 4HMIA 2E2DC 1E3PA 2X6LA 1T9HA 2JA7B 1NR4A 2PI2A 4G7OC 5G3LF 1E24A 1EIHA 1QUQB 3K8AA 4ZCKA 1A0IA 4K6DA 5M5YB 1V9PA 4XT3B 3H3VH 2AHOB 1DCZA 2F0FA 4BY1B 4JI2Q 3TQYA 3HOVH 5IP9G 2MNAA 1SE4A 5EKIA 5FO7B 3S1RH 4JPBW 1TS4A 5ELNA 3I4LA 4JW0A 4JI0Q 2F0IA 1UNSA 2XSCA 5EJWA 1WTPA 1O78A 2ID0A 3I73A 3NTHA 3L2PA 3EJIA 3P1HA 4O1NA 3L7ZC 4HIMA 1ZXTA 3NELA 3VR5A 5C4JH 1FR3A 1FJGQ 3MHBA 2A73B 1JICA 4K5XA 3OPOA 4OELB 3P20A 2RDFA 1KNEA 4TSSA 2KBNA 3PUYA 1VQNA 5CGKA 3VYRA 5M5WH 2OCEA 1QILA 1WJJA 4KHZA 2NZ1D 3RR5A 1HNZQ 2K05A 2K5HA 4Y52H 1HA5A 3TBIB 1R9TH 1LYLA 4DAYB 3J81E 2NZHA 4ME5A 1WYDA 2HIVA 3H3VI 1U5KA 4P2CB 3CD6A 1ENCA 1I50H 3HOZB 1I94L 3F1ZA 1SDFA 2VS1A 1CA5A 1STGA 1NBWA 3T13A 4NP5A 3VR3A 1TY0A 4AH6A 5BN4A 2I5MX 1OXTA 2N88A 5IODA 3DWPA 3QO2A 2WP8J 4DUYL 3L9AX 1BDOA 1BCPB 5ELCA 5F2DA 4IFDH 3BDOA 3X3NA 3T51B 3BVGA 2EE1A 1LTLA 2G9DA 3ULLA 2N49A 4IUPA 4HSVA 1WTOA 5DNFA 2JA5B 4KKSA 4LMQD 1ET9A 4OO1H 1ICFB 4L5QA 4QY7A 5FOBB 4Q0FA 1STBA 3U9SA 4O42A 3FMCA 4JI3L 4NKLA 3CC2A 1SNOA 1W3SA 2EYLA 4LFBQ 4DUZL 1FNUA 1DONA 2CKZB 3QOLA 1VQ5A 5C3EG 1SYEA 4A4IA 1XPRA 2B2UC 3IAYA 1NCVA 4C2MB 1SMYD 2KVMA 3GV6A 2UUBQ 1L0XB 5C44G 2NVYB 3LX0A 1QE6A 4F88A 5I9PA 2CQAA 5DAUA 3NBHA 4A3DG 4MZ9A 4DV7Q 2F0LA 4IJLA 2NVQH 4JCVE 4R4IA 4CJ1B 2OWOA 1VQGA 4FVMA 1I3QH 2H4OA 4KKUA 5EKKA 3GTKH 3TS2A 1S40A 5LMUQ 1HXYD 2K5DA 3GDEA 3U4VA 4IFDI 2I5HA 2UXDL 3M4OB 5FJ8G 1HNWL 1SYFA 1N8RC 4P75A 1KDAA 1V1QA 4KN7C 4JI1L 3G4SA 2VQFQ 2AQ3B 4KLKA 2VQEL 4A3FG 5I2YA 4EX5A 3Q6SA 4A93B 2ENBA 4OO1I 3TDQA 1EIGA 5C3EB 1WTQA 1A15A 2F0SA 1Q90A 3GTMB 4GLVB 5C44B 1KD1C 1WD0A 2H5XA 2HHHQ 3EBEA 2F4IA 2QKIC 1S5BD 2WB1G 1XTCD 1O7ZA 3E9HA 1V1PA 2QDBA 4DR3L 3MXNA 3BG3A 4OX9L 1O7IA 2MO1A 3I70A 1H9SA 1WI5A 4PMCA 1PRTF 3S1QB 3NTKA 2DUDA 2SDFA 4P72A 1ILQA 4A3FB 1F2YA 1NNXA 1PFBA 1J5EL 1AP0A 4JI4L 4KHPQ 1UAPA 1G6PA 5JAVA 3DXJC 2B39A 2K6AA 3J7AV 1LTTD 4I7ZC 3RD4A 4V190 4A3EG 1MHWC 1HR0Q 3H6MA 2RHQB 2R93B 2C35B 3JAMi 3NQTA 3CPFA 4HJAA 1Y8OB 2P5ZX 5IYCG 3T4AC 1EQRA 4JI2L 2I07B 1N36L 1PVOA 2F0MA 1EQVA 2KQ3A 2VUMH 4A3JH 2PQAB 3IRBA 4FF4A 3TS0A 1D5XC 3RZOB 4LF6Q 2KOLA 3D6WA 1C7YA 4CDDC 1JWMD 3S1MH 1S5CD 2BDNA 3HOUH 4KTAA 1ESFA 3HOWG 1IHZA 1X56A 4RHSA 5BN3A 2RHSB 4A3EB 2K5NA 2M9VA 1PRTB 4AIMA 1X55A 1PZKD 1I4RA 3RZDH 4DK3C 1OXUA 4DR7L 1VMPA 3OTOQ 3KF8A 4R4OA 2RCFA 3HS0C 1CZWA 1UWVA 1SYBA 2RA4A 4B3TQ 3DM1A 2I0QA 4L6TB 1SE8A 3BZDB 2KJXA 1KRTA 1C9OA 4DR1L 2K03A 5IP9H 1KQSA 1A3VA 1PH3A 3GO5A 1ONLA 5GROA 1STNA 1EYDA 2A19A 3QOJA 4KHVA 5JEAJ 4NMZA 2N55A 4JBMA 1MSGA 4YWKA 1Q3LA 3HOWB 1FNWA 1B70B 1G2TA 3S17H 1WVLA 3HKZE 4K8IA 1HPCA 3OWFA 4APVA 4KD4A 1XMQL 1WTHA 2CWPA 1S5FD 1KIXA 4YY3L 2K5VA 1XNQQ 2K33A 4PZ6A 1GVPA 4J8QA 3LGJA 1MI2A 3RLOA 3SE0A 3FRPB 4DR5L 2UUCQ 2XN9C 1NTGA 2NTSA 5JEAG 3J7AF 3Q8DA 2EYHA 4B3ML 2EVBA 3PSIA 2F52A 4DR2Q 2JEBI 1VQDA 4OHJA 4ODGA 3M4PA 3J80E 4XQQA 3K5LA 3TRZA 1R4PB 2WACA 2ATWA 4G57A 4KKTA 1Y69U 2FMCA 3MFYA 4C3JB 3I55A 2J0TD 4LFBL 1EU3A 1IBKL 4EQ5A 2IL8A 2GA4B 4Y7NH 2E2HH 3S14H 4R4QA 3FPUB 4KN4C 4HSPA 4POGA 4KY7A 3CCSA 5J39A 4X62Q 3GTLB 1CKOA 1Y1VG 4JI8Q 1CKMA 2B8GA 1IBML 1HZBA 2PNRC 1CHQD 1S72A 1V43A 4LW1A 1CQFA 4CBVA 3CRLC 1F2LA 1IXRA 5CV4A 1PYSB 2FINB 2LMCB 3UDXA 3S1RB 2VZAA 2LY7A 4NXNL 4DNTB 2IX1A 4DR4Q 2E75C 5EPLA 3S2DH 2MO0A 1SMYC 4LF5Q 2HDLA 1DM0B 5C4JB 1FD7D 3M4OH 4P74A 2DGYA 3FEWX 2EY1A 4A3GH 1CHPD 2RDHA 2NN6I 1K3RA 4YCUA 3CMEA 3J7YW 1HTPA 4FDBA 1AH9A 1S5DD 4KY6A 1Y1VB 1OXVA 4IUTA 4IFDG 4PQXA 4A3IH 1PTOD 1AN8A 1L2FA 4HMJA 5DEHA 2VNUD 5C44H 3J7ZC 5M5WB 3GP7A 5EPJA 4E6IA 1A2UA 5AFWA 4A3DH 1NAPA 5A2QE 4BY7H 4OO1G 5CC4A 2QDLA 1R9TB 2JA8G 4HCSA 1EY5A 4F8MA 2LKVA 4DAMA 1YVCA 4ID6A 2E2IH 2JK8A 4WORA 3EA6A 5J3BA 3HOYH 4N9PA 1I50B 1WFQA 2F1MA 1Y8NB 4R8IA 4HJ5A 3NBHB 2Q2UA 4A3FH 2MUYA 3B6YA 2MHVA 2E2JH 4JYAL 5IT9E 1LTBD 2VY3A 3RUZA 4JC0A 3HKSA 4MHEA 1WCMG 5CV6A 1DOMA 3NEMA 3J7A5 4IOAA 1J6QA 1SNPA 1LTID 2PYKA 3OHXC 4OXPA 4LFCQ 1PH9A 1VQLA 2JEAI 1EFID 5BR8Q 1F9PA 1TS3A 3K6OA 3ULPA 2F0UA 3A8JE 4A76A 2UU9L 5C4XH 5C6AA 4N8FA 2JA8B 4NW2A 5GADC 1I4GA 3I4MB 2L15A 1KAAA 4YCVA 4L63B 1Q82C 1CM9A 1G51A 2NZOA 4X3KA 3VDYA 2R7ZG 5ELDA 1LT6D 2E5LQ 1NY4A 3U58A 1RKNA 4LUVA 2BH8A 1SNDA 3T1HL 1VQPA 1B9MA 1BVSA 3FVQA 4BBSG 3J81i 4RGOS 1V1PB 2Q8RE 5IGFA 1WCMB 1GUSA 4QL5A 3MXNB 5LMNQ 1SFOH 2O4XA 1NR2A 2L4NA 2NVQB 1RTOA 4B3RQ 3BYTB 2WAQG 1I3QB 1GUTA 4OWWB 3CPWA 1VF7A 4DV4L 2C5CA 5IYCH 1TR5A 1PH1A 2K52A 5I9OA 1KDCA 1KC8C 4OWXB 4IO9A 4TQUS 2JA6H 4IUNA 3NSWA 1P8LA 4BA1I 2YYZA 1U4LA 2XRSD 1O7YA 2EYFA 2EQSA 1UEAB 3MZ5A 3TP6A 1G6ZA 2DN8A 5JJLA 1Z6HA 4XTCS 5FLMH 1SLJA 3PMFA 2Y0SE 4BBSB 3AYHB 3KBXA 5HGQA 4L5SA 1VQIA 2JYOA 3C1EA 2Q2TA 2BA0A 5FO9B 3EN2A 5CV9A 2B2VC 4X65Q 1F9RA 5M9OA 2JP1A 2ZM6Q 3EIVA 4JV5L 1K8MA 3K5OA 1BCPD 1QNKA 4CKEA 1XXGA 1PZID 1YHAA 1HNXQ 5A35A 4ZUJA 2UXBL 4U68A 3S1NB 2ICIA 3Q0AA 3QB3A 1XMOQ 1Q8IA 4A3JG 1I4PA 1HH2P 2A74C 2PW7A 3TZUA 4LF9Q 1E1TA 3FP9A 4UPAA 2VL6A 5M3MH 1XPUA 1AE3A 1RD9D 3HOUG 2AUJD 2EYMA 3KF8B 1WTWA 1B44D 4MTKA 1Y1WH 3NUCA 3RN2A 4ZLTF 3ONAB 1MGSA 4GLAC 4RH6A 3JAML 3NHHA 4X62L 1K83H 1HFNA 3HFZB 3W1BA 3KBGA 1VQFA 5IY0A 2EOTA 1EWHA 4A3BH 1U0LA 1I4QA 3RNUA 2F3IA 4YCWA 1PH8A 4IOCA 3GTLH 1WD1A 2AMCB 2KCCA 4ZUIA 1RIPA 3SHLA 4RA8A 2OTLA 5JJKA 1Z9FA 1X9NA 2VB3X 4NXML 1X3PA 1YHBA 2KA7A 4EQPA 1HFGA 1PFNA 2A6HD 2EYJA 4UDUC 5JEAH 2VUMB 4A3JB 1VS0A 3F2CA 4UHVA 1YNJD 1EWCA 2RVLA 3M3YH 3Q23A 3CMAA 1OO9B 2IHFA 1YJ9A 1TWAH 3MXUA 3S1MB 2Z9HA 3NWTA 5HY6A 3HOUB 2ASBA 1SNQA 4HIOA 5T1GA 2KENA 3PF4A 4LK1C 1A3TA 4DAPA 4ZK9B 3BZCA 5JOBA 5C3WA 5CYUA 4DV1L 3R2TA 3W3AA 1U4RA 2HT1A 1EEFD 3WDNA 1TWHB 5JVH3 3RZDB 4P71A 4GZYC 4JG2A 2B63G 2HCIA 4C1NK 1Y1VH 1VQ4A 3HOXG 3G7LA 3F2BA 4DV5L 4AQYL 3PGZA 3IKJA 2F0KA 3TREA 3HGBA 2NN6G 2R92H 3RLFA 4I7AA 2ZTCA 4LF4Q 3QJYA 1PTOC 4M8AA 3N6RA 1E0BA 1STHA 2OEOA 1VQAA 1JOOA 4XYOA 3S17B 1YI2A 4X3SA 2FHTA 3GV3A 4X6AH 1VQCA 1YJNA 5K36H 2F0DA 2L55A 4LFAL 4F7XA 3LWUA 4RGTA 2F4VL 2KHIA 1GXDC 1BUVT 1EY4A 2Q2IA 3D3RA 4FF2A 5BR8L 1AFPA 4DXGA 5HURA 1YNND 4H13C 1N33L 1K9MC 3I56A 2Z4HA 3H15A 1KXLA 2OXPA 5C5LA 2JA8H 4DV2Q 2X69A 3R93A 3CP0A 2AUKA 1N34L 2E5LL 1XJVA 1X3GA 4X66L 1ET6A 2JN4A 3DEOA 3FKIG 4QUCA 4WJWA 3T1YL 3ZJYC 2XRQD 4A3GG 1NMGA 4Y7NB 3S14B 2E2HB 3UDIA 1D2BA 1VCIA 1L1OC 3GTQB 5IWAQ 2WKDA 1EQQA 1LUZA 1EY8A 2UUAQ 4A3IG 3KDFA 2NWGA 3DLLA 2DNEA 4GS3A 4C56C 5AJ3L 1WCMH 3KLRA 4JI5L 4YHHQ 4RGMA 1MBYA 1ESRA 1JE5A 1HCZA 4ZAIA 1PRTD 1A8VA 3NK9A 4CHTB 3MC0B 4BY7G 4C3HG 2K14A 5I6WA 4DK6C 4J6HA 2B2VA 2EY6A 1RF2D 3S2DB 1N32Q 4KJNA 1S4ZA 2XWBB 3UE1A 1EFWA 5KNBA 3HOYG 5FLXc 4HEDA 2MPMA 4DXFA 1XNRL 5IP7G 3MVVA 3D4WA 4P73A 3FKIB 2IJ0A 3MEHA 2R7ZH 4BXXG 2CVRA 4A3GB 3KK7A 2D2CC 4IZ8A 2QA4A 3I4MG 2E76C 2UXCQ 4DF7A 4PNYA 5H1SE 3J80i 4DN4M 3PV0A 4DV3L 4A3IB 3VYUA 4GKKQ 4BBSH 4IQZA 4MTNA 3U4ZA 4IUUA 3I4NG 2NBFA 4QIWE 1X3QA 1SNMA 4X65L 1C48A 4A3DB 3A56A 4HCEA 1TKWB 4OGQC 4GN3B 1D8LA 4BY7B 4HJ9A 4XT1B 4C3HB 3KJPA 5C4XG 1YBYA 3K0XA 4DKAC 3VA7A 4FP5D 2K75A 3PO2G 2E2IB 3S1NH 3HOYB 4HR7B 5E4XA 2BE5D 2MGSA 2F3VA 1SJHD 1BQQT 1Q1EA 3W2DA 3ND8A 3RN5A 5JJZA 1B1ZA 1FNVA 4FNFA 4JOIC 3X3MA 3K5MA 1Q7YC 1JOKA 1NMFA 1NE3A 1NJIC 4LWCA 1BCPC 1VMCA 1KLGD 4AYBE 2K32A 1B3QA 3WOFA 2YU9B 2IW3A 4WJ4A 2CWAA 1B53A 1IKMA 2CHBD 3K57A 4RHRA 5DM73 2BA1A 2R61A 4FO2A 4DK1A 1C8CA 1KNAA 1CTMA 5C4XB 3RMHA 2WB1B 3D6CA 1PV4A 2FMMA 5I2XA 1IBLQ 3K7AH 1QB5D 1PHJA 2FFKB 1A62A 3PO2B 3NBIA 3K80C 2JA6G 5EBCA 3OMGA 1SYDA 4IUQA 3AFQA 3W1GA 4JI0L 4CKBA 1BXTA 1PFSA 1SNCA 1EOVA 2PW5A 2NVTH 3J81L 4CDCC 1BNZA 4CJ2C 4DV6Q 1CQVA 3S2HB 3I90A 5CBAE 5IOCA 5FLMG 3I2ZA 2GN5A 1FJGL 1LABA 4CGYB 3AFPA 1ENFA 2A6HC 3KJOA 2XVSA 2D0PA 1SFOB 3F2DA 1II3A 1OXSC 3ITPA 4F87A 2CW0D 1YNJC 5FK9C 3G48A 3M4YA 1TWHH 5EKLA 3TMEA 3GD7A 2BCOA 3IFTA 1IL8A 3OWEB 1SE3A 1NUCA 4IPGA 3V96A 5J1ZA 2R3ZA 2PCFB 1DYQA 5KNDA 5C4ZA 2JA6B 1HNZL 3JAMc 5M3MG 2HD3A 4K5VA 4LF7Q 2AWNA 5FLXE 4QJFA 2VW9A 3PUZA 2RBMA 1YITA 2AQ1B 4WRDA 2F0PA 4EGVA 1XX8A 1Y1WG 5KNCA 1VDZA 2K04A 4IJHA 3PF5A 3LNNA 4GOPC 5IIFA 4A3BG 4I65A 3M4QA 2KECA 3DUZA 4X64Q 2QW7A 1L1OA 2G9HD 1UEBA 1D1IA 2B63H 1VQOA 4DNIA 1D7QA 3HOXH 2QF7A 1SYGA 3A7AB 2B2UA 3A55A 3PUWA 1I6HH 2HCCA 4GKJQ 1HQMC 4ZRZA 3M9BA 2KHSA 2ZJPA 5M3MB 1VQMA 2NN6H 1TXYA 2NB0A 1BR9A 3SXHA 4ZKBB 2Z1CA 2EDGA 4KD3A 4A3CG 1S3OA 3A5UA 1D6EC 4H7BA 1BOSA 1FGUA 2H1EA 1Y1WB 3F2UA 2BH2A 3QR8A 4L8JA 4GNXC 1NSNS 2K1BA 1YNNC 1K83B 1IZ6A 4JI6Q 4JBJA 1O80A 4A3BB 1QZGA 3GTQH 4X3UA 4TKOB 3U9OA 2UUBL 1GUWA 4IURA 4DV7L 4PZ7A 5GQOA 1AZQA 3VA5A 1TIID 2SEBD 1JWSD 1QWYA 2F0TA 3OSOA 2K7VA 2R92G 5IYBH 2D62A 3L0OA 1G91A 3HZXA 3M3YB 1TWAB 5LMUL 3SK5A 1RHPA 1EU4A 3V2TA 1A63A 1LO5D 1OXXK 5ELOA 1X65A
chains in the Genus database with same CATH topology
4AH6A 1SROA 2FXQA 4UY8C 2I5MX 1OXTA 4BBRG 2VQFL 5JJLA 4XTCS 4PG3A 1ASYA 3FKIH 5FLMH 1SLJA 3JC66 2Y0SE 3J81j 3AYHB 4GNXB 2WP8J 5C0XG 4DUYL 2JA7H 3SGIA 5HGQA 4L5SA 5K36G 2AWOA 1VQIA 4R1JA 2Q2TA 2BA0A 5M5YH 4A3MG 3FHWA 2EIFA 3EN2A 3S24A 2UU9Q 4DR6Q 1LTLA 3ULLA 2N49A 4X65Q 3I7FA 1YHQA 4BY1H 2IT1A 2ZM6Q 1H95A 1AE2A 3EIVA 4JV5L 3CQZH 2HHHL 1K0RA 3K81C 1YHAA 2Y0SG 4ME3A 1HNXQ 4JI7L 2UXBL 1N9WA 1XMOQ 2CFMA 4A3JG 4HJ8A 2IY5B 1HH2P 4L5QA 4QY7A 3T1HQ 4LF9Q 4C3HH 1E1TA 3FP9A 4UPAA 4JI3L 2VL6A 2GVAA 5EAYA 5M3MH 4DV0L 3CC2A 3KYHC 4LNQA 1W3SA 3BU2A 3CXCA 1XPUA 3KDFB 4LFBQ 2R7DA 1AE3A 1RL2A 4YWMA 2N3SA 4DUZL 4O2DA 3HOUG 4LUOA 3KF8B 1UE6A 2YTVA 2CKZB 5IP7H 4LF4L 1MJEA 1X54A 1VQ5A 5C3EG 1SMXA 3OW2A 1Y1WH 4A4IA 1Q8KA 3CCUA 1XPRA 3KLWA 3RN2A 4BXXH 4KHPL 4GLAC 3I4MH 4UP7A 4X62L 1K83H 5C44G 1UE7A 1W2BA 4POFA 3HFZB 2UUBQ 3H0GG 3W1BA 1Z47A 3G71A 1VQFA 5IY0A 4A3BH 4A3DG 4MZ9A 1U0LA 4DV7Q 3PUXA 3RNUA 2F3IA 4PZ8A 4YCWA 1PH6A 4IOCA 1PH8A 3GTLH 1UE5A 4DV4Q 1YJ9A 4IJLA 2NVQH 1HR0L 2AMCB 4JCVE 4R4IA 1HR0W 2YU9H 1RIPA 2OWOA 1VQGA 3I4NH 1I3QH 2OTLA 5JJKA 1Z9FA 1QUQA 1FVIA 4L5TA 1X9NA 4NXML 3GTKH 1YHBA 3TS2A 1S40A 5LMUQ 4B3SL 3U4VA 1MKHA 1VS0A 2K50A 3GDEA 3F2CA 1I94Q 4IFDI 2I5HA 1IBLL 2UXDL 1C0AA 1KAWA 5FJ8G 1EWIA 1HNWL 1N8RC 2ALYB 3M3YH 4P75A 1V1QA 5DLQE 2IHFA 4OWTB 1TWAH 1HZAA 1EIFA 1VQBA 2IX0A 4KLKA 4JI1L 3G4SA 2VQEL 2VQFQ 3PO2H 4EX5A 5IT9c 3HOZH 4DUYQ 3K7UC 5HY6A 2OQ0A 3CCVA 2ASBA 4HIOA 4OO1I 2WB1E 3A5ZB 2KENA 4DV2L 2ZTEA 3PF4A 3BZKA 3BZCA 2E8GA 3TEHB 4LF6L 3NENA 4DV1L 3CCQA 1HJPA 2HT1A 2ZJQA 4GLVB 1KD1C 1YIJA 2H5XA 3S2HH 3HOVG 4JV5Q 4PMWA 3AEVA 3PO3G 4P71A 2HHHQ 4XIGS 3EBEA 4JG2A 2R92G 2B63G 1Y1VH 1VQ4A 1K8AC 5IWAL 2UXBQ 2B29A 3HOXG 4OONA 4QQBX 2WB1G 4R4CA 3F2BA 2UUAL 3M7NA 1M90C 1EUJA 2JA5H 4DV5L 1GD7A 4AQYL 4LF8Q 3E9HA 3PIOA 3OTOL 4JI3Q 3PGZA 4DR3L 4GOPA 1B8AA 3TREA 1P16A 4DPGA 4OX9L 2NN6G 4A3KH 1O7IA 4YHHL 2MO1A 1JJ2A 4B3TL 4DUZQ 2R92H 1QVCA 3A0JA 3RLFA 1WI5A 5JJIA 1ASZA 2DUDA 4P72A 1PA6A 1VQ7A 2ZTCA 1YEZA 2Q2HA 3GTOH 4LF4Q 4QGUA 2B3GA 4GN5A 2RF4A 4LF7L 1N32L 3RLNA 1J5EL 4UP8A 4JI4L 4KHPQ 4A3LG 1VQAA 1G6PA 1KRSA 2Z6KA 1YI2A 3ULJA 1XPOA 1EYGA 1SN8A 4X6AH 1VQCA 1DGSA 2CCZA 1IYJB 2XGTA 2OQKA 4A3EG 1YJNA 4C2MH 1HR0Q 1VQEA 2RHQB 2NVYH 4A3MH 5IYDG 4LFAL 3D0FA 2UXCL 2C35B 4LUZA 5GAEC 2PI2E 3JAMi 3CPFA 4HJAA 3E0EA 1KHIA 4NXMQ 2F4VL 3F8TA 2KHIA 4IFDJ 2Q2IA 5IYCG 4JOIA 1EQRA 4GNXA 5BR8L 1PH7A 1JB7A 4JI2L 4GKKL 2UXDQ 1XNQL 1N36L 1HNWQ 1MJCA 1PVOA 4BA2I 3J81c 4RG1A 2VUMH 2VQEQ 3KF6B 2UUCL 4A3JH 1N33L 2PQAB 3IRBA 1K9MC 1Q46A 3I56A 3H15A 3M85A 1KXLA 1IL2A 2JA8H 4DV2Q 3CCJA 4DR2L 3TS0A 3CP0A 3CF5A 4LF6Q 1MIUA 1N34L 1G291 2E5LL 1XJVA 1X3GA 4X66L 4DV1Q 1C7YA 4NB3A 3S1MH 3FKIG 4A93H 4WJ3M 3T1YL 3HOUH 3ZJYC 3HOWG 4A3GG 1NMGA 2JJQA 1X56A 5C3EH 3UDIA 3KFUA 1VCIA 2RHSB 2K5NA 1L1OC 3GTMH 5IWAQ 1EQQA 1LUZA 1PYBA 2XTIA 4AIMA 2UUAQ 1X55A 4A3IG 3KDFA 3DLLA 4DV5Q 1Q1BA 4GS3A 4DK3C 3A74A 4AQYQ 1OXUA 3RZDH 4DR7L 3OTOQ 5AJ3L 4DR3Q 4K0KL 1E22A 2KHJA 1WCMH 4R4OA 3W5OA 4L5RC 4JI8L 4JI5L 4YHHQ 1UWVA 2ZJRA 4B3TQ 1JE5A 2I0QA 3PIPA 1A8VA 1SE8A 5C0XI 2IHEA 4BY7G 2K14A 1KRTA 1C9OA 4DR1L 4DK6C 5IP9H 1QVFA 1KQSA 1PH3A 1N32Q 4JBWA 3ERSX 3GO5A 5GROA 4JI4Q 1SR3A 3UE1A 5FJ8H 2A19A 2HIXA 3S1QH 1JJCB 1EFWA 2NVXH 5JEAJ 3HOYG 5FLXc 4JBMA 4DR4L 1XNRL 5IP7G 2HQLA 4P73A 3CC7A 4YWKA 3STBC 2R7ZH 4BXXG 1VQHA 2YV5A 1B70B 2QA4A 4HJ7A 4LF5L 1PH5A 4LFAQ 3I4MG 1Q86C 2UXCQ 3S17H 1EIYB 4A3CH 1L1OB 2R6GA 1CKNB 3HKZE 1BBUA 5H1SE 2A8VA 3J80i 1E1OA 2F4VQ 3PV0A 4DV3L 4H02A 4APVA 1XMQL 2CQOA 3CAMA 2CWPA 4DV6L 1UE1A 1KIXA 4YY3L 2K5VA 3PO3H 4MTNA 3U4ZA 1N36Q 1L0WA 1XNQQ 4BBSH 3I4NG 4MNOA 4PZ6A 4QIWE 1GVPA 1WOCA 2YTYA 1QVGA 4DR6L 4X65L 3LGJA 3RLOA 2UUCQ 4DR5L 1VQ9A 3MEFA 5JEAG 1NTGA 1N33Q 4GN3B 3Q8DA 4B3ML 2N8NA 1D8LA 3PSIA 4JI7Q 2F52A 4HJ9A 3PUVA 1BBWA 3HKZG 3KJPA 2R93H 5C4XG 1YBYA 3K0XA 4DKAC 2K4KA 2JEBI 4DR2Q 1YJWA 1VQDA 1HZCA 1N34Q 2K75A 4X66Q 3HOZG 1VQJA 3M4PA 4DV0Q 3PO2G 3T1YQ 2KCTA 4J15A 3CCLA 3TRZA 3S1NH 2ATWA 1GO3E 1B7YB 3CW2C 3RZOH 2A1AA 1BKBA 4GLXA 1GM5A 3ER0A 1Q1EA 3RN5A 3I55A 2I5LX 2D0OA 3UDGA 4LFBL 2YTXA 4JOIC 1Q7YC 1KL9A 1NJIC 1IBKL 1NMFA 4EQ5A 1NE3A 3AQQA 3S15H 4Y7NH 4A3FG 2E2HH 4LWCA 4R4QA 3S14H 5M3FH 4DR7Q 5AJ3Q 4POGA 3CCSA 4X62Q 4A3EH 2R7FA 5M5XH 1VQ8A 1CKOA 1Y1VG 4JI8Q 4AYBE 4BBRH 4HIDA 4JI5Q 1CKMA 3G6EA 3GTPH 4WJ4A 2CWAA 1HZBA 1IBML 1JMCA 1I5FA 2JA5G 1S72A 1V43A 4DR1Q 4LW1A 2BA1A 4C3IH 3CC4A 1XTDA 2GVBA 1IXRA 2WFWA 4UP9A 1PYSB 3UDXA 4YWLA 2VZAA 4B3SQ 4NXNL 4RMFA 4LFCL 2AKWB 4TVAB 1PV4A 2IX1A 4DR4Q 1IBLQ 4X64L 3K7AH 1XNRQ 2JQOA 4O0AA 4AYBG 1PHJA 1A62A 3S2DH 3GTGH 2MO0A 3K80C 5IYBG 1X3EA 2JA6G 1JT8A 1K73C 4JI1Q 1CSPA 1LM0A 4GN4B 4LF5Q 1HZ9A 4IPHA 5IE8A 3AFQA 2ES2A 3W1GA 4JI0L 3M4OH 4A75A 4GKJL 4P74A 1PFSA 2DGYA 1EOVA 1FL0A 1QZHA 4DV3Q 2NVTH 3HOWH 3KF6A 1XMQQ 4A3GH 4DV6Q 2NN6I 2PQAA 4YY3Q 1TWGH 1K3RA 4YCUA 5FLMG 3CMEA 1X3FA 2JA7G 4FDBA 3I2ZA 2GN5A 1FJGL 2QEXA 1AH9A 3AFPA 4ALPA 1OXVA 3KJOA 4DR5Q 4IFDG 1Q12A 4A3IH 1GKHA 2D0PA 1L2FA 3F2DA 4HIKA 4B3MQ 3KOJA 1OXSC 1TWFH 3S16H 2VNUD 2KCMA 4IPDA 1SRUA 5C44H 3D31A 3J7ZC 3G48A 4BY1G 3CCMA 3H0GH 4GKKQ 4JI6L 1TWHH 2N78A 2VUMG 4A3DH 5LMNL 3GD7A 5LMNW 4BY7H 2LXKA 4OO1G 3CMAA 4OX9Q 4LF8L 3DM3A 4IPGA 2JA8G 2LSSA 4B3RL 1YNXA 2EXDA 3I4OA 4DAMA 3E9IA 1YVCA 2QGQA 3JAMc 3UE0A 1HNZL 2E2IH 2JK8A 4A93G 2V1CC 5M3MG 3HOYH 5J3BA 1IBKQ 2AWNA 4LF7Q 1PH2A 4QJFA 1CUKA 1WFQA 1J5EQ 2VW9A 4HJ5A 3NBHB 3PUZA 4C3JH 2Q2UA 4A3FH 3B6YA 3UDFA 3WWVA 3ICEA 3OYYA 1YITA 2E2JH 4JYAL 3CCRA 1X6OA 1E3PA 2VY3A 1IBMQ 1T9HA 1Y1WG 4JC0A 2PI2A 3HKSA 1E24A 1QUQB 3K8AA 4R4TA 3PCOB 1A0IA 1WCMG 4IJHA 5GAGC 3PF5A 5E7NA 4GOPC 3NEMA 3J7A5 4IOAA 1V9PA 1J6QA 4A3BG 3M4QA 3H3VH 1JJGA 2AHOB 4OXPA 4NXNQ 4LFCQ 1PH9A 1YZ6A 1VQLA 2JEAI 4JI2Q 3TQYA 5BR8Q 3HOVH 4X64Q 1K8GA 5IP9G 3ULPA 1L1OA 5GAHC 1CKNA 2MNAA 1UEBA 2B63H 1VQOA 4JBKA 4A76A 4DNIA 2UU9L 5C4XH 3S1RH 1D7QA 1TWCH 3HOXH 5ELNA 5GADC 3PUWA 2ZM6L 2MQHA 1I6HH 2L15A 4JI0Q 4YCVA 4GKJQ 2Z6KC 1PH4A 1Q82C 3BJUA 2ID0A 3M9BA 2ZJPA 3L2PA 1G51A 1VQMA 2NZOA 3VDYA 1HNXL 1VQ6A 2R7ZG 2E5LQ 1TXYA 3L7ZC 3U50C 4HIMA 1NY4A 1XMOL 3U58A 3NELA 5C4JH 4LUVA 2BH8A 3T1HL 1VQPA 1FJGQ 4A3CG 4LF9L 1S3OA 3A5UA 1E7ZA 2WAQE 2ZTDA 1BVSA 1FGUA 2R93G 2RCNA 4A3LH 2BH2A 4BBSG 3J81i 1OTCA 4KI0A 3GTJH 4GNXC 4NPSA 4GOPB 1IZ6A 2PNHA 4QL5A 4JI6Q 3MXNB 4JBJA 2KBNA 5LMNQ 1VQKA 2PMZE 1SFOH 4K0KQ 3PUYA 1QZGA 3STBD 1Y14B 3GTQH 1VQNA 2JA9A 5M5WH 2OCEA 5IYDH 1WJJA 4KHZA 3RR5A 2UUBL 2WAQG 4B3RQ 5C0XJ 2OTJA 1M1KC 2JE6I 1HNZQ 3CCEA 4DV7L 4PZ7A 3J80c 5GQOA 4OWWB 2K5HA 3CPWA 4DV4L 5IYCH 1Q81C 4Y52H 1PH1A 4IPCA 1R9TH 1LYLA 2K52A 2MFIA 4A3KG 1KC8C 4OWXB 4DAYB 5IYBH 4IO9A 2D62A 2NZHA 1CSQA 1WYDA 2HIVA 2Z0SA 3L0OA 4TQUS 2JA6H 3H3VI 1P8LA 4BA1I 4JYAQ 5LMUL 1U5KA 2YYZA 3CD6A 1I50H 1I94L 3F1ZA 2VS1A 1A63A 2EQSA 1OXXK 1NBWA 2LXJA 5M3FG 5ELOA 1X65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AH6 A;  1SRO A;  2FXQ A;  4UY8 C;  2I5M X;  1OXT A;  4BBR G;  2VQF L;  5JJL A;  4XTC S;  4PG3 A;  1ASY A;  3FKI H;  5FLM H;  1SLJ A;  3JC6 6;  2Y0S E;  3J81 j;  3AYH B;  4GNX B;  2WP8 J;  5C0X G;  4DUY L;  2JA7 H;  3SGI A;  5HGQ A;  4L5S A;  5K36 G;  2AWO A;  1VQI A;  4R1J A;  2Q2T A;  2BA0 A;  5M5Y H;  4A3M G;  3FHW A;  2EIF A;  3EN2 A;  3S24 A;  2UU9 Q;  4DR6 Q;  1LTL A;  3ULL A;  2N49 A;  4X65 Q;  3I7F A;  1YHQ A;  4BY1 H;  2IT1 A;  2ZM6 Q;  1H95 A;  1AE2 A;  3EIV A;  4JV5 L;  3CQZ H;  2HHH L;  1K0R A;  3K81 C;  1YHA A;  2Y0S G;  4ME3 A;  1HNX Q;  4JI7 L;  2UXB L;  1N9W A;  1XMO Q;  2CFM A;  4A3J G;  4HJ8 A;  2IY5 B;  1HH2 P;  4L5Q A;  4QY7 A;  3T1H Q;  4LF9 Q;  4C3H H;  1E1T A;  3FP9 A;  4UPA A;  4JI3 L;  2VL6 A;  2GVA A;  5EAY A;  5M3M H;  4DV0 L;  3CC2 A;  3KYH C;  4LNQ A;  1W3S A;  3BU2 A;  3CXC A;  1XPU A;  3KDF B;  4LFB Q;  2R7D A;  1AE3 A;  1RL2 A;  4YWM A;  2N3S A;  4DUZ L;  4O2D A;  3HOU G;  4LUO A;  3KF8 B;  1UE6 A;  2YTV A;  2CKZ B;  5IP7 H;  4LF4 L;  1MJE A;  1X54 A;  1VQ5 A;  5C3E G;  1SMX A;  3OW2 A;  1Y1W H;  4A4I A;  1Q8K A;  3CCU A;  1XPR A;  3KLW A;  3RN2 A;  4BXX H;  4KHP L;  4GLA C;  3I4M H;  4UP7 A;  4X62 L;  1K83 H;  5C44 G;  1UE7 A;  1W2B A;  4POF A;  3HFZ B;  2UUB Q;  3H0G G;  3W1B A;  1Z47 A;  3G71 A;  1VQF A;  5IY0 A;  4A3B H;  4A3D G;  4MZ9 A;  1U0L A;  4DV7 Q;  3PUX A;  3RNU A;  2F3I A;  4PZ8 A;  4YCW A;  1PH6 A;  4IOC A;  1PH8 A;  3GTL H;  1UE5 A;  4DV4 Q;  1YJ9 A;  4IJL A;  2NVQ H;  1HR0 L;  2AMC B;  4JCV E;  4R4I A;  1HR0 W;  2YU9 H;  1RIP A;  2OWO A;  1VQG A;  3I4N H;  1I3Q H;  2OTL A;  5JJK A;  1Z9F A;  1QUQ A;  1FVI A;  4L5T A;  1X9N A;  4NXM L;  3GTK H;  1YHB A;  3TS2 A;  1S40 A;  5LMU Q;  4B3S L;  3U4V A;  1MKH A;  1VS0 A;  2K50 A;  3GDE A;  3F2C A;  1I94 Q;  4IFD I;  2I5H A;  1IBL L;  2UXD L;  1C0A A;  1KAW A;  5FJ8 G;  1EWI A;  1HNW L;  1N8R C;  2ALY B;  3M3Y H;  4P75 A;  1V1Q A;  5DLQ E;  2IHF A;  4OWT B;  1TWA H;  1HZA A;  1EIF A;  1VQB A;  2IX0 A;  4KLK A;  4JI1 L;  3G4S A;  2VQE L;  2VQF Q;  3PO2 H;  4EX5 A;  5IT9 c;  3HOZ H;  4DUY Q;  3K7U C;  5HY6 A;  2OQ0 A;  3CCV A;  2ASB A;  4HIO A;  4OO1 I;  2WB1 E;  3A5Z B;  2KEN A;  4DV2 L;  2ZTE A;  3PF4 A;  3BZK A;  3BZC A;  2E8G A;  3TEH B;  4LF6 L;  3NEN A;  4DV1 L;  3CCQ A;  1HJP A;  2HT1 A;  2ZJQ A;  4GLV B;  1KD1 C;  1YIJ A;  2H5X A;  3S2H H;  3HOV G;  4JV5 Q;  4PMW A;  3AEV A;  3PO3 G;  4P71 A;  2HHH Q;  4XIG S;  3EBE A;  4JG2 A;  2R92 G;  2B63 G;  1Y1V H;  1VQ4 A;  1K8A C;  5IWA L;  2UXB Q;  2B29 A;  3HOX G;  4OON A;  4QQB X;  2WB1 G;  4R4C A;  3F2B A;  2UUA L;  3M7N A;  1M90 C;  1EUJ A;  2JA5 H;  4DV5 L;  1GD7 A;  4AQY L;  4LF8 Q;  3E9H A;  3PIO A;  3OTO L;  4JI3 Q;  3PGZ A;  4DR3 L;  4GOP A;  1B8A A;  3TRE A;  1P16 A;  4DPG A;  4OX9 L;  2NN6 G;  4A3K H;  1O7I A;  4YHH L;  2MO1 A;  1JJ2 A;  4B3T L;  4DUZ Q;  2R92 H;  1QVC A;  3A0J A;  3RLF A;  1WI5 A;  5JJI A;  1ASZ A;  2DUD A;  4P72 A;  1PA6 A;  1VQ7 A;  2ZTC A;  1YEZ A;  2Q2H A;  3GTO H;  4LF4 Q;  4QGU A;  2B3G A;  4GN5 A;  2RF4 A;  4LF7 L;  1N32 L;  3RLN A;  1J5E L;  4UP8 A;  4JI4 L;  4KHP Q;  4A3L G;  1VQA A;  1G6P A;  1KRS A;  2Z6K A;  1YI2 A;  3ULJ A;  1XPO A;  1EYG A;  1SN8 A;  4X6A H;  1VQC A;  1DGS A;  2CCZ A;  1IYJ B;  2XGT A;  2OQK A;  4A3E G;  1YJN A;  4C2M H;  1HR0 Q;  1VQE A;  2RHQ B;  2NVY H;  4A3M H;  5IYD G;  4LFA L;  3D0F A;  2UXC L;  2C35 B;  4LUZ A;  5GAE C;  2PI2 E;  3JAM i;  3CPF A;  4HJA A;  3E0E A;  1KHI A;  4NXM Q;  2F4V L;  3F8T A;  2KHI A;  4IFD J;  2Q2I A;  5IYC G;  4JOI A;  1EQR A;  4GNX A;  5BR8 L;  1PH7 A;  1JB7 A;  4JI2 L;  4GKK L;  2UXD Q;  1XNQ L;  1N36 L;  1HNW Q;  1MJC A;  1PVO A;  4BA2 I;  3J81 c;  4RG1 A;  2VUM H;  2VQE Q;  3KF6 B;  2UUC L;  4A3J H;  1N33 L;  2PQA B;  3IRB A;  1K9M C;  1Q46 A;  3I56 A;  3H15 A;  3M85 A;  1KXL A;  1IL2 A;  2JA8 H;  4DV2 Q;  3CCJ A;  4DR2 L;  3TS0 A;  3CP0 A;  3CF5 A;  4LF6 Q;  1MIU A;  1N34 L;  1G29 1;  2E5L L;  1XJV A;  1X3G A;  4X66 L;  4DV1 Q;  1C7Y A;  4NB3 A;  3S1M H;  3FKI G;  4A93 H;  4WJ3 M;  3T1Y L;  3HOU H;  3ZJY C;  3HOW G;  4A3G G;  1NMG A;  2JJQ A;  1X56 A;  5C3E H;  3UDI A;  3KFU A;  1VCI A;  2RHS B;  2K5N A;  1L1O C;  3GTM H;  5IWA Q;  1EQQ A;  1LUZ A;  1PYB A;  2XTI A;  4AIM A;  2UUA Q;  1X55 A;  4A3I G;  3KDF A;  3DLL A;  4DV5 Q;  1Q1B A;  4GS3 A;  4DK3 C;  3A74 A;  4AQY Q;  1OXU A;  3RZD H;  4DR7 L;  3OTO Q;  5AJ3 L;  4DR3 Q;  4K0K L;  1E22 A;  2KHJ A;  1WCM H;  4R4O A;  3W5O A;  4L5R C;  4JI8 L;  4JI5 L;  4YHH Q;  1UWV A;  2ZJR A;  4B3T Q;  1JE5 A;  2I0Q A;  3PIP A;  1A8V A;  1SE8 A;  5C0X I;  2IHE A;  4BY7 G;  2K14 A;  1KRT A;  1C9O A;  4DR1 L;  4DK6 C;  5IP9 H;  1QVF A;  1KQS A;  1PH3 A;  1N32 Q;  4JBW A;  3ERS X;  3GO5 A;  5GRO A;  4JI4 Q;  1SR3 A;  3UE1 A;  5FJ8 H;  2A19 A;  2HIX A;  3S1Q H;  1JJC B;  1EFW A;  2NVX H;  5JEA J;  3HOY G;  5FLX c;  4JBM A;  4DR4 L;  1XNR L;  5IP7 G;  2HQL A;  4P73 A;  3CC7 A;  4YWK A;  3STB C;  2R7Z H;  4BXX G;  1VQH A;  2YV5 A;  1B70 B;  2QA4 A;  4HJ7 A;  4LF5 L;  1PH5 A;  4LFA Q;  3I4M G;  1Q86 C;  2UXC Q;  3S17 H;  1EIY B;  4A3C H;  1L1O B;  2R6G A;  1CKN B;  3HKZ E;  1BBU A;  5H1S E;  2A8V A;  3J80 i;  1E1O A;  2F4V Q;  3PV0 A;  4DV3 L;  4H02 A;  4APV A;  1XMQ L;  2CQO A;  3CAM A;  2CWP A;  4DV6 L;  1UE1 A;  1KIX A;  4YY3 L;  2K5V A;  3PO3 H;  4MTN A;  3U4Z A;  1N36 Q;  1L0W A;  1XNQ Q;  4BBS H;  3I4N G;  4MNO A;  4PZ6 A;  4QIW E;  1GVP A;  1WOC A;  2YTY A;  1QVG A;  4DR6 L;  4X65 L;  3LGJ A;  3RLO A;  2UUC Q;  4DR5 L;  1VQ9 A;  3MEF A;  5JEA G;  1NTG A;  1N33 Q;  4GN3 B;  3Q8D A;  4B3M L;  2N8N A;  1D8L A;  3PSI A;  4JI7 Q;  2F52 A;  4HJ9 A;  3PUV A;  1BBW A;  3HKZ G;  3KJP A;  2R93 H;  5C4X G;  1YBY A;  3K0X A;  4DKA C;  2K4K A;  2JEB I;  4DR2 Q;  1YJW A;  1VQD A;  1HZC A;  1N34 Q;  2K75 A;  4X66 Q;  3HOZ G;  1VQJ A;  3M4P A;  4DV0 Q;  3PO2 G;  3T1Y Q;  2KCT A;  4J15 A;  3CCL A;  3TRZ A;  3S1N H;  2ATW A;  1GO3 E;  1B7Y B;  3CW2 C;  3RZO H;  2A1A A;  1BKB A;  4GLX A;  1GM5 A;  3ER0 A;  1Q1E A;  3RN5 A;  3I55 A;  2I5L X;  2D0O A;  3UDG A;  4LFB L;  2YTX A;  4JOI C;  1Q7Y C;  1KL9 A;  1NJI C;  1IBK L;  1NMF A;  4EQ5 A;  1NE3 A;  3AQQ A;  3S15 H;  4Y7N H;  4A3F G;  2E2H H;  4LWC A;  4R4Q A;  3S14 H;  5M3F H;  4DR7 Q;  5AJ3 Q;  4POG A;  3CCS A;  4X62 Q;  4A3E H;  2R7F A;  5M5X H;  1VQ8 A;  1CKO A;  1Y1V G;  4JI8 Q;  4AYB E;  4BBR H;  4HID A;  4JI5 Q;  1CKM A;  3G6E A;  3GTP H;  4WJ4 A;  2CWA A;  1HZB A;  1IBM L;  1JMC A;  1I5F A;  2JA5 G;  1S72 A;  1V43 A;  4DR1 Q;  4LW1 A;  2BA1 A;  4C3I H;  3CC4 A;  1XTD A;  2GVB A;  1IXR A;  2WFW A;  4UP9 A;  1PYS B;  3UDX A;  4YWL A;  2VZA A;  4B3S Q;  4NXN L;  4RMF A;  4LFC L;  2AKW B;  4TVA B;  1PV4 A;  2IX1 A;  4DR4 Q;  1IBL Q;  4X64 L;  3K7A H;  1XNR Q;  2JQO A;  4O0A A;  4AYB G;  1PHJ A;  1A62 A;  3S2D H;  3GTG H;  2MO0 A;  3K80 C;  5IYB G;  1X3E A;  2JA6 G;  1JT8 A;  1K73 C;  4JI1 Q;  1CSP A;  1LM0 A;  4GN4 B;  4LF5 Q;  1HZ9 A;  4IPH A;  5IE8 A;  3AFQ A;  2ES2 A;  3W1G A;  4JI0 L;  3M4O H;  4A75 A;  4GKJ L;  4P74 A;  1PFS A;  2DGY A;  1EOV A;  1FL0 A;  1QZH A;  4DV3 Q;  2NVT H;  3HOW H;  3KF6 A;  1XMQ Q;  4A3G H;  4DV6 Q;  2NN6 I;  2PQA A;  4YY3 Q;  1TWG H;  1K3R A;  4YCU A;  5FLM G;  3CME A;  1X3F A;  2JA7 G;  4FDB A;  3I2Z A;  2GN5 A;  1FJG L;  2QEX A;  1AH9 A;  3AFP A;  4ALP A;  1OXV A;  3KJO A;  4DR5 Q;  4IFD G;  1Q12 A;  4A3I H;  1GKH A;  2D0P A;  1L2F A;  3F2D A;  4HIK A;  4B3M Q;  3KOJ A;  1OXS C;  1TWF H;  3S16 H;  2VNU D;  2KCM A;  4IPD A;  1SRU A;  5C44 H;  3D31 A;  3J7Z C;  3G48 A;  4BY1 G;  3CCM A;  3H0G H;  4GKK Q;  4JI6 L;  1TWH H;  2N78 A;  2VUM G;  4A3D H;  5LMN L;  3GD7 A;  5LMN W;  4BY7 H;  2LXK A;  4OO1 G;  3CMA A;  4OX9 Q;  4LF8 L;  3DM3 A;  4IPG A;  2JA8 G;  2LSS A;  4B3R L;  1YNX A;  2EXD A;  3I4O A;  4DAM A;  3E9I A;  1YVC A;  2QGQ A;  3JAM c;  3UE0 A;  1HNZ L;  2E2I H;  2JK8 A;  4A93 G;  2V1C C;  5M3M G;  3HOY H;  5J3B A;  1IBK Q;  2AWN A;  4LF7 Q;  1PH2 A;  4QJF A;  1CUK A;  1WFQ A;  1J5E Q;  2VW9 A;  4HJ5 A;  3NBH B;  3PUZ A;  4C3J H;  2Q2U A;  4A3F H;  3B6Y A;  3UDF A;  3WWV A;  3ICE A;  3OYY A;  1YIT A;  2E2J H;  4JYA L;  3CCR A;  1X6O A;  1E3P A;  2VY3 A;  1IBM Q;  1T9H A;  1Y1W G;  4JC0 A;  2PI2 A;  3HKS A;  1E24 A;  1QUQ B;  3K8A A;  4R4T A;  3PCO B;  1A0I A;  1WCM G;  4IJH A;  5GAG C;  3PF5 A;  5E7N A;  4GOP C;  3NEM A;  3J7A 5;  4IOA A;  1V9P A;  1J6Q A;  4A3B G;  3M4Q A;  3H3V H;  1JJG A;  2AHO B;  4OXP A;  4NXN Q;  4LFC Q;  1PH9 A;  1YZ6 A;  1VQL A;  2JEA I;  4JI2 Q;  3TQY A;  5BR8 Q;  3HOV H;  4X64 Q;  1K8G A;  5IP9 G;  3ULP A;  1L1O A;  5GAH C;  1CKN A;  2MNA A;  1UEB A;  2B63 H;  1VQO A;  4JBK A;  4A76 A;  4DNI A;  2UU9 L;  5C4X H;  3S1R H;  1D7Q A;  1TWC H;  3HOX H;  5ELN A;  5GAD C;  3PUW A;  2ZM6 L;  2MQH A;  1I6H H;  2L15 A;  4JI0 Q;  4YCV A;  4GKJ Q;  2Z6K C;  1PH4 A;  1Q82 C;  3BJU A;  2ID0 A;  3M9B A;  2ZJP A;  3L2P A;  1G51 A;  1VQM A;  2NZO A;  3VDY A;  1HNX L;  1VQ6 A;  2R7Z G;  2E5L Q;  1TXY A;  3L7Z C;  3U50 C;  4HIM A;  1NY4 A;  1XMO L;  3U58 A;  3NEL A;  5C4J H;  4LUV A;  2BH8 A;  3T1H L;  1VQP A;  1FJG Q;  4A3C G;  4LF9 L;  1S3O A;  3A5U A;  1E7Z A;  2WAQ E;  2ZTD A;  1BVS A;  1FGU A;  2R93 G;  2RCN A;  4A3L H;  2BH2 A;  4BBS G;  3J81 i;  1OTC A;  4KI0 A;  3GTJ H;  4GNX C;  4NPS A;  4GOP B;  1IZ6 A;  2PNH A;  4QL5 A;  4JI6 Q;  3MXN B;  4JBJ A;  2KBN A;  5LMN Q;  1VQK A;  2PMZ E;  1SFO H;  4K0K Q;  3PUY A;  1QZG A;  3STB D;  1Y14 B;  3GTQ H;  1VQN A;  2JA9 A;  5M5W H;  2OCE A;  5IYD H;  1WJJ A;  4KHZ A;  3RR5 A;  2UUB L;  2WAQ G;  4B3R Q;  5C0X J;  2OTJ A;  1M1K C;  2JE6 I;  1HNZ Q;  3CCE A;  4DV7 L;  4PZ7 A;  3J80 c;  5GQO A;  4OWW B;  2K5H A;  3CPW A;  4DV4 L;  5IYC H;  1Q81 C;  4Y52 H;  1PH1 A;  4IPC A;  1R9T H;  1LYL A;  2K52 A;  2MFI A;  4A3K G;  1KC8 C;  4OWX B;  4DAY B;  5IYB H;  4IO9 A;  2D62 A;  2NZH A;  1CSQ A;  1WYD A;  2HIV A;  2Z0S A;  3L0O A;  4TQU S;  2JA6 H;  3H3V I;  1P8L A;  4BA1 I;  4JYA Q;  5LMU L;  1U5K A;  2YYZ A;  3CD6 A;  1I50 H;  1I94 L;  3F1Z A;  2VS1 A;  1A63 A;  2EQS A;  1OXX K;  1NBW A;  2LXJ A;  5M3F G;  5ELO A;  1X65 A; 
#chains in the Genus database with same CATH topology
 2FXQ A;  1LT4 D;  1EL0 A;  4UY8 C;  4MIU A;  5D3I B;  4BBR G;  2VQF L;  4PG3 A;  3FKI H;  4DU9 A;  2HUG A;  3J81 j;  1PRT C;  3OMC A;  4KV6 A;  5K36 G;  2AWO A;  2TSS A;  4HN7 A;  3AB9 A;  5TSS A;  1K0S A;  4C3I G;  3BYY B;  3FHW A;  4ABN A;  3S24 A;  1YHQ A;  3T56 B;  4Q5V A;  2EJM A;  2EY2 A;  1CI3 M;  4LJZ C;  1H95 A;  1AE2 A;  3MA2 B;  1EY0 A;  5EGT A;  3CQZ H;  2HHH L;  4ME3 A;  2ICE C;  2KUM A;  2RSN A;  2F0Q A;  3C46 A;  2R92 B;  3SK6 A;  4C3H H;  5K5P A;  5EAY A;  2GVA A;  3CXC A;  3KDF B;  2R7D A;  1RL2 A;  4YWM A;  2N3S A;  1V1O A;  4LUO A;  4R9W A;  2YTV A;  5M5X B;  4K14 A;  5IP7 H;  4BBR B;  2EPB A;  1SMX A;  3OW2 A;  3GTP B;  3BVZ A;  1Q8K A;  3NXW A;  3CCU A;  4BXX H;  4KHP L;  4G7H C;  1ROD A;  2IX3 A;  3I4M H;  1W2B A;  1UE7 A;  4C3I B;  1LT5 D;  1SJE D;  2PZW A;  5I4D A;  5JPM C;  3PUX A;  1JC7 A;  5E1F A;  1UE5 A;  1QNU A;  1HR0 L;  1HR0 W;  2WV6 D;  1GUN A;  2BE5 C;  2YU9 H;  3I4N H;  3R8B A;  3HRZ C;  1FVI A;  1CK1 A;  1MKH A;  4HTH A;  1I94 Q;  1IBL L;  1C0A A;  5IGD A;  1KAW A;  2XNA C;  1EWI A;  1I6V C;  1H9R A;  2D9U A;  2Z8L A;  1EIF A;  1HZA A;  1VQB A;  2IX0 A;  3BDL A;  2A69 D;  3PO2 H;  4DUY Q;  4G7Z C;  3CCV A;  2WB1 E;  3BZK A;  4LF6 L;  4EVO A;  3NEN A;  1HJP A;  3VYT A;  2ZJQ A;  2DJG C;  2OF1 A;  3H3V C;  3S2H H;  1F77 A;  3AEV A;  3NTI A;  1PTO F;  4XIG S;  4CDF C;  1LTG D;  3HEJ A;  1FYC A;  1BBX C;  1EZ8 A;  1EY6 A;  2RQX A;  4R4C A;  3M7N A;  1M90 C;  2B2Y C;  1H9S B;  1GHJ A;  2HDM A;  4LF8 Q;  3OTO L;  4JI3 Q;  4GOP A;  1A6X A;  1MSH A;  1B8A A;  1P16 A;  4DPG A;  4A3K H;  1STA A;  1JJ2 A;  4B3T L;  4DUZ Q;  5JJI A;  2J7Z A;  1PA6 A;  1YEZ A;  3GTO H;  1TS5 A;  4QGU A;  4LF7 L;  1K3B C;  4UP8 A;  2R7Z B;  2CW0 C;  4A3L G;  3J80 L;  1PFM A;  2DY8 A;  4RCO A;  1KLU D;  3PIP 3;  5G3L D;  1EYG A;  5LL6 X;  3NWS A;  1F9S A;  1IYJ B;  1LT3 D;  4A3M H;  5IYD G;  4LUZ A;  1HA6 A;  2PI2 E;  5D3D A;  3TP5 A;  2B2W C;  3F8T A;  4FF3 A;  5IGB A;  4GNX A;  1JB7 A;  2UXD Q;  1TY2 A;  1XNQ L;  1HNW Q;  2QCP X;  3J81 c;  2WAQ B;  3H94 A;  5D65 A;  2VQE Q;  2UUC L;  1Q46 A;  3M85 A;  5COR A;  3CCJ A;  4DR2 L;  2F0E A;  1DOL A;  1G29 1;  2PMZ B;  1RDP D;  4NB3 A;  3A8I E;  3DWQ A;  2JJQ A;  5J22 A;  3C2P A;  4DK0 A;  3KFU A;  2ZXO A;  1PMR A;  1KDB A;  4ZQ3 A;  5FO8 B;  3VR4 A;  3A74 A;  3SEB A;  1HTL D;  4DR3 Q;  1E22 A;  1ZYR D;  3W5O A;  4L5R C;  5COY A;  4JI8 L;  3K59 A;  3KUP A;  4RCN A;  3PIP A;  5C0X I;  3ERO A;  1XWE A;  2IHE A;  5FKA C;  3S9W A;  2BOS A;  4R8N A;  5CMD A;  3OIP A;  1QVF A;  3K7A B;  4RKB A;  1J8I A;  4JBW A;  4JI4 Q;  3KLS X;  1VF5 C;  3EFX D;  1JJC B;  1GOZ A;  3VR2 A;  2NVX H;  5A2Q L;  1U9R A;  4JVZ A;  1ENA A;  2F0H A;  4DR4 L;  5IGG A;  4DFA A;  3CC7 A;  2NYZ D;  1QOH A;  1SAP A;  2NVT B;  1VQH A;  3OW7 A;  2YV5 A;  3R3O A;  4LF5 L;  1PH5 A;  2K01 A;  1EIY B;  2KED A;  1L1O B;  4A3C H;  1BBU A;  1I4X A;  2M00 A;  1HUM A;  1PXU A;  4H02 A;  2CQO A;  5HGT A;  4CDE C;  3PO3 H;  3UI2 A;  1N36 Q;  1L0W A;  2O5J C;  5IT9 L;  2MP1 A;  1M4V A;  2A6E D;  2YTY A;  3AU7 A;  1EY9 A;  4C1N I;  2WIN B;  1I4H A;  3ND9 A;  3FDT A;  2N8N A;  4EQN A;  3MFG A;  4JI7 Q;  5ISR A;  3HKZ G;  1BCP F;  2K4K A;  1YJW A;  2DJF C;  4B08 A;  1JWU D;  5NUC A;  3HOZ G;  1VQJ A;  4DV0 Q;  1SE2 A;  5LHY 1;  1SYC A;  2KCT A;  4K2K A;  3CCL A;  3SDZ A;  1DD2 A;  1GO3 E;  3CW2 C;  3D8G A;  4K6L A;  4GLX A;  1GM5 A;  2D0O A;  3D4R A;  3UDG A;  5DM6 3;  2YTX A;  3S15 H;  1KL9 A;  5I6Y A;  1Y8P B;  3QWN A;  3AQQ A;  3NPP A;  1AEX A;  1W6K A;  2XIW A;  4DR7 Q;  4BWG B;  5M5X H;  5E3F A;  1VQ8 A;  4BBR H;  4OIK A;  4HID A;  1AZP A;  3GTP H;  4HAE A;  1KTK A;  1TT2 A;  1I5F A;  2JA5 G;  3K0Y A;  4DR1 Q;  1B2T A;  4C3I H;  3CC4 A;  3MWY W;  1ILP A;  2B63 B;  4S3S A;  2IWH A;  4UP9 A;  3HKZ B;  4YWL A;  3HOX B;  3R2I A;  4B3S Q;  4LFC L;  2AKW B;  1I6H B;  1H9J A;  2JQO A;  4O0A A;  2FJ2 A;  3GTG H;  5IYB G;  1X3E A;  1JT8 A;  1K73 C;  1LM0 A;  2B2Y A;  1J9O A;  4GN4 B;  1HZ9 A;  1CZG A;  4NDX A;  2ES2 A;  1A3U A;  2QEJ C;  4PV1 C;  2JSO A;  1QZH A;  3KF6 A;  1XMQ Q;  1DXM A;  3H09 A;  4YY3 Q;  4DA2 A;  3TP7 A;  1STY A;  4ILW A;  2QEX A;  4DR5 Q;  5EQ0 A;  1Q12 A;  1GKH A;  4B3M Q;  1IYV A;  1TWF H;  5T1I A;  3S16 H;  2KCM A;  1LLR D;  4IPD A;  1SRU A;  3CCM A;  2EY5 A;  1EZ6 A;  1HUN A;  2N78 A;  2A69 C;  5KEE A;  5LMN L;  4PMB A;  1IW7 D;  5LMN W;  5CBE E;  2HQE A;  5LL6 S;  4LF8 L;  4XXE A;  3DM3 A;  1EYA A;  4B3R L;  5EPK A;  2B2W A;  1E2Z A;  3I4O A;  2Q8T A;  3E9I A;  3CKI B;  4DAV A;  2QGQ A;  3UE0 A;  5C5M A;  4FF1 A;  4A93 G;  1IBK Q;  3I3C A;  1CUK A;  1EY7 A;  4LAA A;  3SVM A;  3DMU A;  3WWV A;  3ICE A;  3OYY A;  1B50 A;  3CCR A;  1X6O A;  1ZKO A;  1DJR D;  1IBM Q;  1L0Y B;  4R4T A;  4TRD A;  2M2L A;  3PCO B;  5GAG C;  1ZEQ X;  5E7N A;  2KEE A;  1JJG A;  4NXN Q;  2A68 D;  1YZ6 A;  1K8G A;  3CQZ B;  1CKN A;  4ZYS A;  5GAH C;  4JBK A;  1G8Z D;  1TWC H;  1E2V A;  1QCB D;  1TVX A;  2RKS A;  2ZM6 L;  2MQH A;  3SK4 A;  3NQI A;  2B8F A;  2L9H A;  1LTA D;  2Z6K C;  2AQ2 B;  1PH4 A;  3BJU A;  2DNC A;  1HNX L;  1SXT A;  1VQ6 A;  1HRJ A;  3U50 C;  2WKC A;  2O5I C;  3AMU A;  1XMO L;  1DZ1 A;  4MN3 A;  1A2T A;  4IUV A;  4LF9 L;  1G2S A;  1PTO H;  1F9Q A;  1E7Z A;  2WAQ E;  2ZTD A;  4U67 3;  2L11 A;  2R93 G;  2RCN A;  4A3L H;  4QCL A;  4G4K A;  1OTC A;  4KI0 A;  3GTJ H;  4NPS A;  3P7J A;  4GOP B;  2PNH A;  1MD2 D;  5ELB A;  1VQK A;  1ICW A;  2PMZ E;  1HQR D;  1K8O A;  4K0K Q;  1W6J A;  3STB D;  1R4Q B;  1Y14 B;  3N52 A;  2JA9 A;  1WTV A;  5KYI A;  1CA6 A;  5IYD H;  1B3A A;  2LS0 1;  3I4N B;  5C0X J;  2OTJ A;  1M1K C;  3KLS A;  3URY A;  2JE6 I;  3QIA A;  3CCE A;  2PPB C;  3J80 c;  1CFM A;  4OEM B;  4RAU C;  3ERQ A;  1Q81 C;  1BF4 A;  4IPC A;  4A3K G;  2MFI A;  1FGB D;  1CSQ A;  2Z0S A;  2PO4 A;  4JYA Q;  5M3F G;  1JCK B;  2LXJ A;  2EXZ A;  1SRO A;  1ZYR C;  2E74 C;  2F0J A;  1ASY A;  3JC6 6;  4B9X A;  4GNX B;  2JA7 H;  1C4Q A;  1X32 A;  5C0X G;  4RGN A;  3SGI A;  4R1J A;  5M5Y H;  4A3M G;  2EIF A;  2DY7 A;  4WFN 3;  2UU9 Q;  4DR6 Q;  3BDC A;  3I7F A;  1LTR D;  2ZXP A;  4BY1 H;  2IT1 A;  1K0R A;  3K81 C;  4KY5 A;  1U4M A;  2Y0S G;  2ZXR A;  4JI7 L;  1PZJ D;  4A3K B;  1N9W A;  2CFM A;  4HJ8 A;  2IY5 B;  3T1H Q;  1QJO A;  2L12 A;  4XDX A;  4DV0 L;  3GTO B;  5BN5 A;  3HG9 A;  3KYH C;  4M1U B;  4LNQ A;  3BU2 A;  1H9K A;  5KGU A;  5M3F B;  5IGC A;  1T5X D;  4O2D A;  2EZV A;  1F2M A;  2A6E C;  1UE6 A;  5KRU A;  3WOE A;  2K28 A;  4LF4 L;  3TN2 A;  1X54 A;  1MJE A;  3M7G A;  5L37 A;  3PIO 3;  3KLW A;  1SBB B;  3I8Z A;  5C4H A;  4UP7 A;  1LTS D;  4A3M B;  4POF A;  3H0G G;  3T16 A;  3G6J B;  1Z47 A;  3ZYY X;  1STE A;  3G71 A;  3GQB A;  2EYO A;  1PH6 A;  4PZ8 A;  4DV4 Q;  3CU7 A;  1SEB D;  4KJO A;  3A8K E;  3E3X A;  2Y0S B;  4L5T A;  1QUQ A;  2SNS A;  2O2L D;  2MJ8 A;  4B3S L;  2K50 A;  5CV7 A;  4FXK C;  5JPN C;  1TQO A;  1AW7 A;  2VXW A;  2RDG A;  1JOR A;  4C3J G;  2ALY B;  2RSO A;  2NTT A;  5DLQ E;  4OWT B;  2NUC A;  1EQT A;  2F0N A;  3HOZ H;  5IT9 c;  1TWG B;  3K7U C;  2OQ0 A;  2Z4I A;  3K58 A;  3A5Z B;  4CJ0 B;  3NE5 B;  4DV2 L;  2ZTE A;  2E8G A;  3TEH B;  3VYS A;  1EOT A;  3CCQ A;  2PZT A;  4OIJ A;  4QMG A;  4DNR B;  3H0G B;  1YIJ A;  3C3L A;  3I72 A;  4KK7 A;  3HOV G;  4JV5 Q;  4PMW A;  3Q24 A;  3PO3 G;  3LWE A;  4XYQ A;  2I46 A;  2UXB Q;  1K8A C;  5IWA L;  2B29 A;  3SR1 A;  4OON A;  4QQB X;  1GUO A;  1GJX A;  2UUA L;  3IFD A;  1EUJ A;  5KIX A;  2JA5 H;  3EQL C;  1GD7 A;  4UAI A;  3PIO A;  1IKL A;  3MTS A;  3IL8 A;  4YHH L;  2F03 A;  1QVC A;  3A0J A;  4RWS C;  2TMP A;  1ASZ A;  2C9O A;  2NVX B;  1VQ7 A;  3TP8 A;  2Q2H A;  4FYD A;  2B3G A;  2ZT9 C;  4GN5 A;  2RF4 A;  1N32 L;  3RLN A;  5CR3 A;  1KRS A;  2Z6K A;  2F3W A;  1UUP A;  2F0W A;  3ULJ A;  1XPO A;  4DAY A;  1SN8 A;  1IW7 C;  1RCV D;  1DGS A;  2CCZ A;  3OIQ A;  2XGT A;  2OQK A;  3H91 A;  4C2M H;  1PYW D;  1VQE A;  5C3X A;  2NVY H;  3HOV B;  3D0F A;  2B2T C;  3PO3 B;  2UXC L;  5GAE C;  2F0O A;  3E0E A;  1K28 A;  1KHI A;  4NXM Q;  1D5M C;  3SK8 A;  4IFD J;  1EYC A;  4XQN A;  4JOI A;  3E6Z X;  3P75 A;  5KYL A;  1PH7 A;  4GKK L;  4FXD A;  4J1M A;  1SSO A;  1MJC A;  4BA2 I;  1CT1 D;  4RG1 A;  3KF6 B;  2CH4 A;  2E2J B;  3PQI A;  4QB4 A;  1M8A A;  1KAB A;  2K5W A;  1IL2 A;  3TZD A;  3L3O C;  4K8J A;  2PQE A;  1MIU A;  3CF5 A;  4CKC A;  3JAM E;  4DV1 Q;  4WJ3 M;  1PDQ A;  4A93 H;  2A68 C;  3S15 B;  4RKL A;  1JQY D;  2G5D A;  2Z6B A;  3DWA A;  4ZKC B;  3TSS A;  5C3E H;  3GTM H;  2EJF C;  1D5Z C;  1PYB A;  2XTI A;  4K5W A;  4DV5 Q;  1Q1B A;  4AQY Q;  2Q8I B;  4IAL A;  1S5E D;  4X3T A;  4K0K L;  2KHJ A;  3BVM A;  2ZJR A;  1JR0 D;  2QIL A;  2PZU A;  3OOC A;  2KCN A;  1LV9 A;  4N9T A;  3GTG B;  3ERS X;  1SR3 A;  5FJ8 H;  2HIX A;  3S1Q H;  2WII B;  5D14 A;  5E4W C;  2HQL A;  2SOB A;  3STB C;  4DGZ A;  4HJ7 A;  2BDO A;  4LFA Q;  2OT2 A;  1Q86 C;  5FLX L;  2R6G A;  1CKN B;  2A8V A;  4RFB A;  1E1O A;  3I91 A;  4H0L C;  2F4V Q;  4KMU C;  5CV5 A;  1RJT A;  3CAM A;  4DV6 L;  2R93 H;  1UE1 A;  1TWF B;  3S16 B;  4MNO A;  3MXG A;  1WOC A;  1QVG A;  4DR6 L;  1GUG A;  2JXM B;  3MEF A;  2L5T A;  1VQ9 A;  3QG1 A;  2L1B A;  1N33 Q;  1EEI D;  3PUV A;  1BBW A;  3VR6 A;  3T53 B;  1JB3 A;  3BS1 A;  5IGE A;  1HZC A;  1N34 Q;  4QF4 A;  3O13 A;  4X66 Q;  2EYP A;  4N8X 1;  1TU2 B;  3T1Y Q;  4J15 A;  2VB2 X;  1BO0 A;  1DOK A;  4IN3 A;  5ELF A;  2D5D A;  4ULL A;  1B7Y B;  3RZO H;  2A1A A;  1BKB A;  4XQJ A;  3ER0 A;  3HP3 A;  2J4X A;  1Z7T A;  2I5L X;  3D4D A;  3FPP A;  2A5H A;  3V05 A;  4OL7 A;  5M3F H;  2CH4 W;  2SNM A;  5AJ3 Q;  3A54 A;  4A3E H;  2R7F A;  4JI5 Q;  1O7L A;  2F0G A;  3G6E A;  2XWJ B;  5C0X H;  5EBD A;  4B9W A;  1JMC A;  3E5S A;  2X6G A;  3GTK B;  1XTD A;  5CV8 A;  2GVB A;  3C1F A;  4JK1 C;  1V8Q A;  2WFW A;  1TWC B;  4QUF A;  3CHB D;  4RMF A;  1PLF A;  4TVA B;  1HHV A;  4X64 L;  1XNR Q;  4AYB G;  3DHQ A;  3MXP A;  1XYI A;  1TS2 A;  1T5E A;  1CSP A;  1ML0 D;  4QIW B;  4JI1 Q;  1IYU A;  4YIJ A;  4IPH A;  4Z9C B;  5IE8 A;  4GKJ L;  4A75 A;  1PTO B;  4V0B A;  1FL0 A;  4DV3 Q;  2F0V A;  3HOW H;  2PQA A;  1E2W A;  1TWG H;  4H44 C;  1X3F A;  2JA7 G;  3GTJ B;  3CRK C;  1WTR A;  4ALP A;  1LAC A;  1D1K A;  4HIK A;  3EVQ A;  3KOJ A;  3K5N A;  4BS9 A;  1WTX A;  2LFN A;  3D31 A;  4BY1 G;  3H0G H;  1B9N A;  1RTN A;  1QG7 A;  4JI6 L;  3Q22 A;  2VUM G;  1B4O A;  2IPK D;  2LXK A;  2B2T A;  4OX9 Q;  3MAQ A;  1JE4 A;  1JOQ A;  2LSS A;  4AYB B;  1YNX A;  1H9M A;  2EXD A;  4EQO A;  2V4D A;  1GHK A;  4FXG C;  2V1C C;  1U4P A;  3DEP A;  1F2Z A;  3E0J A;  1PH2 A;  1J5E Q;  2L0C A;  3A7L A;  5ELE A;  4C3J H;  2K5Q A;  3NP8 A;  5JVG 3;  2EJG C;  4K2L A;  3UDF A;  4HMI A;  2E2D C;  1E3P A;  2X6L A;  1T9H A;  2JA7 B;  1NR4 A;  2PI2 A;  4G7O C;  5G3L F;  1E24 A;  1EIH A;  1QUQ B;  3K8A A;  4ZCK A;  1A0I A;  4K6D A;  5M5Y B;  1V9P A;  4XT3 B;  3H3V H;  2AHO B;  1DCZ A;  2F0F A;  4BY1 B;  4JI2 Q;  3TQY A;  3HOV H;  5IP9 G;  2MNA A;  1SE4 A;  5EKI A;  5FO7 B;  3S1R H;  4JPB W;  1TS4 A;  5ELN A;  3I4L A;  4JW0 A;  4JI0 Q;  2F0I A;  1UNS A;  2XSC A;  5EJW A;  1WTP A;  1O78 A;  2ID0 A;  3I73 A;  3NTH A;  3L2P A;  3EJI A;  3P1H A;  4O1N A;  3L7Z C;  4HIM A;  1ZXT A;  3NEL A;  3VR5 A;  5C4J H;  1FR3 A;  1FJG Q;  3MHB A;  2A73 B;  1JIC A;  4K5X A;  3OPO A;  4OEL B;  3P20 A;  2RDF A;  1KNE A;  4TSS A;  2KBN A;  3PUY A;  1VQN A;  5CGK A;  3VYR A;  5M5W H;  2OCE A;  1QIL A;  1WJJ A;  4KHZ A;  2NZ1 D;  3RR5 A;  1HNZ Q;  2K05 A;  2K5H A;  4Y52 H;  1HA5 A;  3TBI B;  1R9T H;  1LYL A;  4DAY B;  3J81 E;  2NZH A;  4ME5 A;  1WYD A;  2HIV A;  3H3V I;  1U5K A;  4P2C B;  3CD6 A;  1ENC A;  1I50 H;  3HOZ B;  1I94 L;  3F1Z A;  1SDF A;  2VS1 A;  1CA5 A;  1STG A;  1NBW A;  3T13 A;  4NP5 A;  3VR3 A;  1TY0 A;  4AH6 A;  5BN4 A;  2I5M X;  1OXT A;  2N88 A;  5IOD A;  3DWP A;  3QO2 A;  2WP8 J;  4DUY L;  3L9A X;  1BDO A;  1BCP B;  5ELC A;  5F2D A;  4IFD H;  3BDO A;  3X3N A;  3T51 B;  3BVG A;  2EE1 A;  1LTL A;  2G9D A;  3ULL A;  2N49 A;  4IUP A;  4HSV A;  1WTO A;  5DNF A;  2JA5 B;  4KKS A;  4LMQ D;  1ET9 A;  4OO1 H;  1ICF B;  4L5Q A;  4QY7 A;  5FOB B;  4Q0F A;  1STB A;  3U9S A;  4O42 A;  3FMC A;  4JI3 L;  4NKL A;  3CC2 A;  1SNO A;  1W3S A;  2EYL A;  4LFB Q;  4DUZ L;  1FNU A;  1DON A;  2CKZ B;  3QOL A;  1VQ5 A;  5C3E G;  1SYE A;  4A4I A;  1XPR A;  2B2U C;  3IAY A;  1NCV A;  4C2M B;  1SMY D;  2KVM A;  3GV6 A;  2UUB Q;  1L0X B;  5C44 G;  2NVY B;  3LX0 A;  1QE6 A;  4F88 A;  5I9P A;  2CQA A;  5DAU A;  3NBH A;  4A3D G;  4MZ9 A;  4DV7 Q;  2F0L A;  4IJL A;  2NVQ H;  4JCV E;  4R4I A;  4CJ1 B;  2OWO A;  1VQG A;  4FVM A;  1I3Q H;  2H4O A;  4KKU A;  5EKK A;  3GTK H;  3TS2 A;  1S40 A;  5LMU Q;  1HXY D;  2K5D A;  3GDE A;  3U4V A;  4IFD I;  2I5H A;  2UXD L;  3M4O B;  5FJ8 G;  1HNW L;  1SYF A;  1N8R C;  4P75 A;  1KDA A;  1V1Q A;  4KN7 C;  4JI1 L;  3G4S A;  2VQF Q;  2AQ3 B;  4KLK A;  2VQE L;  4A3F G;  5I2Y A;  4EX5 A;  3Q6S A;  4A93 B;  2ENB A;  4OO1 I;  3TDQ A;  1EIG A;  5C3E B;  1WTQ A;  1A15 A;  2F0S A;  1Q90 A;  3GTM B;  4GLV B;  5C44 B;  1KD1 C;  1WD0 A;  2H5X A;  2HHH Q;  3EBE A;  2F4I A;  2QKI C;  1S5B D;  2WB1 G;  1XTC D;  1O7Z A;  3E9H A;  1V1P A;  2QDB A;  4DR3 L;  3MXN A;  3BG3 A;  4OX9 L;  1O7I A;  2MO1 A;  3I70 A;  1H9S A;  1WI5 A;  4PMC A;  1PRT F;  3S1Q B;  3NTK A;  2DUD A;  2SDF A;  4P72 A;  1ILQ A;  4A3F B;  1F2Y A;  1NNX A;  1PFB A;  1J5E L;  1AP0 A;  4JI4 L;  4KHP Q;  1UAP A;  1G6P A;  5JAV A;  3DXJ C;  2B39 A;  2K6A A;  3J7A V;  1LTT D;  4I7Z C;  3RD4 A;  4V19 0;  4A3E G;  1MHW C;  1HR0 Q;  3H6M A;  2RHQ B;  2R93 B;  2C35 B;  3JAM i;  3NQT A;  3CPF A;  4HJA A;  1Y8O B;  2P5Z X;  5IYC G;  3T4A C;  1EQR A;  4JI2 L;  2I07 B;  1N36 L;  1PVO A;  2F0M A;  1EQV A;  2KQ3 A;  2VUM H;  4A3J H;  2PQA B;  3IRB A;  4FF4 A;  3TS0 A;  1D5X C;  3RZO B;  4LF6 Q;  2KOL A;  3D6W A;  1C7Y A;  4CDD C;  1JWM D;  3S1M H;  1S5C D;  2BDN A;  3HOU H;  4KTA A;  1ESF A;  3HOW G;  1IHZ A;  1X56 A;  4RHS A;  5BN3 A;  2RHS B;  4A3E B;  2K5N A;  2M9V A;  1PRT B;  4AIM A;  1X55 A;  1PZK D;  1I4R A;  3RZD H;  4DK3 C;  1OXU A;  4DR7 L;  1VMP A;  3OTO Q;  3KF8 A;  4R4O A;  2RCF A;  3HS0 C;  1CZW A;  1UWV A;  1SYB A;  2RA4 A;  4B3T Q;  3DM1 A;  2I0Q A;  4L6T B;  1SE8 A;  3BZD B;  2KJX A;  1KRT A;  1C9O A;  4DR1 L;  2K03 A;  5IP9 H;  1KQS A;  1A3V A;  1PH3 A;  3GO5 A;  1ONL A;  5GRO A;  1STN A;  1EYD A;  2A19 A;  3QOJ A;  4KHV A;  5JEA J;  4NMZ A;  2N55 A;  4JBM A;  1MSG A;  4YWK A;  1Q3L A;  3HOW B;  1FNW A;  1B70 B;  1G2T A;  3S17 H;  1WVL A;  3HKZ E;  4K8I A;  1HPC A;  3OWF A;  4APV A;  4KD4 A;  1XMQ L;  1WTH A;  2CWP A;  1S5F D;  1KIX A;  4YY3 L;  2K5V A;  1XNQ Q;  2K33 A;  4PZ6 A;  1GVP A;  4J8Q A;  3LGJ A;  1MI2 A;  3RLO A;  3SE0 A;  3FRP B;  4DR5 L;  2UUC Q;  2XN9 C;  1NTG A;  2NTS A;  5JEA G;  3J7A F;  3Q8D A;  2EYH A;  4B3M L;  2EVB A;  3PSI A;  2F52 A;  4DR2 Q;  2JEB I;  1VQD A;  4OHJ A;  4ODG A;  3M4P A;  3J80 E;  4XQQ A;  3K5L A;  3TRZ A;  1R4P B;  2WAC A;  2ATW A;  4G57 A;  4KKT A;  1Y69 U;  2FMC A;  3MFY A;  4C3J B;  3I55 A;  2J0T D;  4LFB L;  1EU3 A;  1IBK L;  4EQ5 A;  2IL8 A;  2GA4 B;  4Y7N H;  2E2H H;  3S14 H;  4R4Q A;  3FPU B;  4KN4 C;  4HSP A;  4POG A;  4KY7 A;  3CCS A;  5J39 A;  4X62 Q;  3GTL B;  1CKO A;  1Y1V G;  4JI8 Q;  1CKM A;  2B8G A;  1IBM L;  1HZB A;  2PNR C;  1CHQ D;  1S72 A;  1V43 A;  4LW1 A;  1CQF A;  4CBV A;  3CRL C;  1F2L A;  1IXR A;  5CV4 A;  1PYS B;  2FIN B;  2LMC B;  3UDX A;  3S1R B;  2VZA A;  2LY7 A;  4NXN L;  4DNT B;  2IX1 A;  4DR4 Q;  2E75 C;  5EPL A;  3S2D H;  2MO0 A;  1SMY C;  4LF5 Q;  2HDL A;  1DM0 B;  5C4J B;  1FD7 D;  3M4O H;  4P74 A;  2DGY A;  3FEW X;  2EY1 A;  4A3G H;  1CHP D;  2RDH A;  2NN6 I;  1K3R A;  4YCU A;  3CME A;  3J7Y W;  1HTP A;  4FDB A;  1AH9 A;  1S5D D;  4KY6 A;  1Y1V B;  1OXV A;  4IUT A;  4IFD G;  4PQX A;  4A3I H;  1PTO D;  1AN8 A;  1L2F A;  4HMJ A;  5DEH A;  2VNU D;  5C44 H;  3J7Z C;  5M5W B;  3GP7 A;  5EPJ A;  4E6I A;  1A2U A;  5AFW A;  4A3D H;  1NAP A;  5A2Q E;  4BY7 H;  4OO1 G;  5CC4 A;  2QDL A;  1R9T B;  2JA8 G;  4HCS A;  1EY5 A;  4F8M A;  2LKV A;  4DAM A;  1YVC A;  4ID6 A;  2E2I H;  2JK8 A;  4WOR A;  3EA6 A;  5J3B A;  3HOY H;  4N9P A;  1I50 B;  1WFQ A;  2F1M A;  1Y8N B;  4R8I A;  4HJ5 A;  3NBH B;  2Q2U A;  4A3F H;  2MUY A;  3B6Y A;  2MHV A;  2E2J H;  4JYA L;  5IT9 E;  1LTB D;  2VY3 A;  3RUZ A;  4JC0 A;  3HKS A;  4MHE A;  1WCM G;  5CV6 A;  1DOM A;  3NEM A;  3J7A 5;  4IOA A;  1J6Q A;  1SNP A;  1LTI D;  2PYK A;  3OHX C;  4OXP A;  4LFC Q;  1PH9 A;  1VQL A;  2JEA I;  1EFI D;  5BR8 Q;  1F9P A;  1TS3 A;  3K6O A;  3ULP A;  2F0U A;  3A8J E;  4A76 A;  2UU9 L;  5C4X H;  5C6A A;  4N8F A;  2JA8 B;  4NW2 A;  5GAD C;  1I4G A;  3I4M B;  2L15 A;  1KAA A;  4YCV A;  4L63 B;  1Q82 C;  1CM9 A;  1G51 A;  2NZO A;  4X3K A;  3VDY A;  2R7Z G;  5ELD A;  1LT6 D;  2E5L Q;  1NY4 A;  3U58 A;  1RKN A;  4LUV A;  2BH8 A;  1SND A;  3T1H L;  1VQP A;  1B9M A;  1BVS A;  3FVQ A;  4BBS G;  3J81 i;  4RGO S;  1V1P B;  2Q8R E;  5IGF A;  1WCM B;  1GUS A;  4QL5 A;  3MXN B;  5LMN Q;  1SFO H;  2O4X A;  1NR2 A;  2L4N A;  2NVQ B;  1RTO A;  4B3R Q;  3BYT B;  2WAQ G;  1I3Q B;  1GUT A;  4OWW B;  3CPW A;  1VF7 A;  4DV4 L;  2C5C A;  5IYC H;  1TR5 A;  1PH1 A;  2K52 A;  5I9O A;  1KDC A;  1KC8 C;  4OWX B;  4IO9 A;  4TQU S;  2JA6 H;  4IUN A;  3NSW A;  1P8L A;  4BA1 I;  2YYZ A;  1U4L A;  2XRS D;  1O7Y A;  2EYF A;  2EQS A;  1UEA B;  3MZ5 A;  3TP6 A;  1G6Z A;  2DN8 A;  5JJL A;  1Z6H A;  4XTC S;  5FLM H;  1SLJ A;  3PMF A;  2Y0S E;  4BBS B;  3AYH B;  3KBX A;  5HGQ A;  4L5S A;  1VQI A;  2JYO A;  3C1E A;  2Q2T A;  2BA0 A;  5FO9 B;  3EN2 A;  5CV9 A;  2B2V C;  4X65 Q;  1F9R A;  5M9O A;  2JP1 A;  2ZM6 Q;  3EIV A;  4JV5 L;  1K8M A;  3K5O A;  1BCP D;  1QNK A;  4CKE A;  1XXG A;  1PZI D;  1YHA A;  1HNX Q;  5A35 A;  4ZUJ A;  2UXB L;  4U68 A;  3S1N B;  2ICI A;  3Q0A A;  3QB3 A;  1XMO Q;  1Q8I A;  4A3J G;  1I4P A;  1HH2 P;  2A74 C;  2PW7 A;  3TZU A;  4LF9 Q;  1E1T A;  3FP9 A;  4UPA A;  2VL6 A;  5M3M H;  1XPU A;  1AE3 A;  1RD9 D;  3HOU G;  2AUJ D;  2EYM A;  3KF8 B;  1WTW A;  1B44 D;  4MTK A;  1Y1W H;  3NUC A;  3RN2 A;  4ZLT F;  3ONA B;  1MGS A;  4GLA C;  4RH6 A;  3JAM L;  3NHH A;  4X62 L;  1K83 H;  1HFN A;  3HFZ B;  3W1B A;  3KBG A;  1VQF A;  5IY0 A;  2EOT A;  1EWH A;  4A3B H;  1U0L A;  1I4Q A;  3RNU A;  2F3I A;  4YCW A;  1PH8 A;  4IOC A;  3GTL H;  1WD1 A;  2AMC B;  2KCC A;  4ZUI A;  1RIP A;  3SHL A;  4RA8 A;  2OTL A;  5JJK A;  1Z9F A;  1X9N A;  2VB3 X;  4NXM L;  1X3P A;  1YHB A;  2KA7 A;  4EQP A;  1HFG A;  1PFN A;  2A6H D;  2EYJ A;  4UDU C;  5JEA H;  2VUM B;  4A3J B;  1VS0 A;  3F2C A;  4UHV A;  1YNJ D;  1EWC A;  2RVL A;  3M3Y H;  3Q23 A;  3CMA A;  1OO9 B;  2IHF A;  1YJ9 A;  1TWA H;  3MXU A;  3S1M B;  2Z9H A;  3NWT A;  5HY6 A;  3HOU B;  2ASB A;  1SNQ A;  4HIO A;  5T1G A;  2KEN A;  3PF4 A;  4LK1 C;  1A3T A;  4DAP A;  4ZK9 B;  3BZC A;  5JOB A;  5C3W A;  5CYU A;  4DV1 L;  3R2T A;  3W3A A;  1U4R A;  2HT1 A;  1EEF D;  3WDN A;  1TWH B;  5JVH 3;  3RZD B;  4P71 A;  4GZY C;  4JG2 A;  2B63 G;  2HCI A;  4C1N K;  1Y1V H;  1VQ4 A;  3HOX G;  3G7L A;  3F2B A;  4DV5 L;  4AQY L;  3PGZ A;  3IKJ A;  2F0K A;  3TRE A;  3HGB A;  2NN6 G;  2R92 H;  3RLF A;  4I7A A;  2ZTC A;  4LF4 Q;  3QJY A;  1PTO C;  4M8A A;  3N6R A;  1E0B A;  1STH A;  2OEO A;  1VQA A;  1JOO A;  4XYO A;  3S17 B;  1YI2 A;  4X3S A;  2FHT A;  3GV3 A;  4X6A H;  1VQC A;  1YJN A;  5K36 H;  2F0D A;  2L55 A;  4LFA L;  4F7X A;  3LWU A;  4RGT A;  2F4V L;  2KHI A;  1GXD C;  1BUV T;  1EY4 A;  2Q2I A;  3D3R A;  4FF2 A;  5BR8 L;  1AFP A;  4DXG A;  5HUR A;  1YNN D;  4H13 C;  1N33 L;  1K9M C;  3I56 A;  2Z4H A;  3H15 A;  1KXL A;  2OXP A;  5C5L A;  2JA8 H;  4DV2 Q;  2X69 A;  3R93 A;  3CP0 A;  2AUK A;  1N34 L;  2E5L L;  1XJV A;  1X3G A;  4X66 L;  1ET6 A;  2JN4 A;  3DEO A;  3FKI G;  4QUC A;  4WJW A;  3T1Y L;  3ZJY C;  2XRQ D;  4A3G G;  1NMG A;  4Y7N B;  3S14 B;  2E2H B;  3UDI A;  1D2B A;  1VCI A;  1L1O C;  3GTQ B;  5IWA Q;  2WKD A;  1EQQ A;  1LUZ A;  1EY8 A;  2UUA Q;  4A3I G;  3KDF A;  2NWG A;  3DLL A;  2DNE A;  4GS3 A;  4C56 C;  5AJ3 L;  1WCM H;  3KLR A;  4JI5 L;  4YHH Q;  4RGM A;  1MBY A;  1ESR A;  1JE5 A;  1HCZ A;  4ZAI A;  1PRT D;  1A8V A;  3NK9 A;  4CHT B;  3MC0 B;  4BY7 G;  4C3H G;  2K14 A;  5I6W A;  4DK6 C;  4J6H A;  2B2V A;  2EY6 A;  1RF2 D;  3S2D B;  1N32 Q;  4KJN A;  1S4Z A;  2XWB B;  3UE1 A;  1EFW A;  5KNB A;  3HOY G;  5FLX c;  4HED A;  2MPM A;  4DXF A;  1XNR L;  5IP7 G;  3MVV A;  3D4W A;  4P73 A;  3FKI B;  2IJ0 A;  3MEH A;  2R7Z H;  4BXX G;  2CVR A;  4A3G B;  3KK7 A;  2D2C C;  4IZ8 A;  2QA4 A;  3I4M G;  2E76 C;  2UXC Q;  4DF7 A;  4PNY A;  5H1S E;  3J80 i;  4DN4 M;  3PV0 A;  4DV3 L;  4A3I B;  3VYU A;  4GKK Q;  4BBS H;  4IQZ A;  4MTN A;  3U4Z A;  4IUU A;  3I4N G;  2NBF A;  4QIW E;  1X3Q A;  1SNM A;  4X65 L;  1C48 A;  4A3D B;  3A56 A;  4HCE A;  1TKW B;  4OGQ C;  4GN3 B;  1D8L A;  4BY7 B;  4HJ9 A;  4XT1 B;  4C3H B;  3KJP A;  5C4X G;  1YBY A;  3K0X A;  4DKA C;  3VA7 A;  4FP5 D;  2K75 A;  3PO2 G;  2E2I B;  3S1N H;  3HOY B;  4HR7 B;  5E4X A;  2BE5 D;  2MGS A;  2F3V A;  1SJH D;  1BQQ T;  1Q1E A;  3W2D A;  3ND8 A;  3RN5 A;  5JJZ A;  1B1Z A;  1FNV A;  4FNF A;  4JOI C;  3X3M A;  3K5M A;  1Q7Y C;  1JOK A;  1NMF A;  1NE3 A;  1NJI C;  4LWC A;  1BCP C;  1VMC A;  1KLG D;  4AYB E;  2K32 A;  1B3Q A;  3WOF A;  2YU9 B;  2IW3 A;  4WJ4 A;  2CWA A;  1B53 A;  1IKM A;  2CHB D;  3K57 A;  4RHR A;  5DM7 3;  2BA1 A;  2R61 A;  4FO2 A;  4DK1 A;  1C8C A;  1KNA A;  1CTM A;  5C4X B;  3RMH A;  2WB1 B;  3D6C A;  1PV4 A;  2FMM A;  5I2X A;  1IBL Q;  3K7A H;  1QB5 D;  1PHJ A;  2FFK B;  1A62 A;  3PO2 B;  3NBI A;  3K80 C;  2JA6 G;  5EBC A;  3OMG A;  1SYD A;  4IUQ A;  3AFQ A;  3W1G A;  4JI0 L;  4CKB A;  1BXT A;  1PFS A;  1SNC A;  1EOV A;  2PW5 A;  2NVT H;  3J81 L;  4CDC C;  1BNZ A;  4CJ2 C;  4DV6 Q;  1CQV A;  3S2H B;  3I90 A;  5CBA E;  5IOC A;  5FLM G;  3I2Z A;  2GN5 A;  1FJG L;  1LAB A;  4CGY B;  3AFP A;  1ENF A;  2A6H C;  3KJO A;  2XVS A;  2D0P A;  1SFO B;  3F2D A;  1II3 A;  1OXS C;  3ITP A;  4F87 A;  2CW0 D;  1YNJ C;  5FK9 C;  3G48 A;  3M4Y A;  1TWH H;  5EKL A;  3TME A;  3GD7 A;  2BCO A;  3IFT A;  1IL8 A;  3OWE B;  1SE3 A;  1NUC A;  4IPG A;  3V96 A;  5J1Z A;  2R3Z A;  2PCF B;  1DYQ A;  5KND A;  5C4Z A;  2JA6 B;  1HNZ L;  3JAM c;  5M3M G;  2HD3 A;  4K5V A;  4LF7 Q;  2AWN A;  5FLX E;  4QJF A;  2VW9 A;  3PUZ A;  2RBM A;  1YIT A;  2AQ1 B;  4WRD A;  2F0P A;  4EGV A;  1XX8 A;  1Y1W G;  5KNC A;  1VDZ A;  2K04 A;  4IJH A;  3PF5 A;  3LNN A;  4GOP C;  5IIF A;  4A3B G;  4I65 A;  3M4Q A;  2KEC A;  3DUZ A;  4X64 Q;  2QW7 A;  1L1O A;  2G9H D;  1UEB A;  1D1I A;  2B63 H;  1VQO A;  4DNI A;  1D7Q A;  3HOX H;  2QF7 A;  1SYG A;  3A7A B;  2B2U A;  3A55 A;  3PUW A;  1I6H H;  2HCC A;  4GKJ Q;  1HQM C;  4ZRZ A;  3M9B A;  2KHS A;  2ZJP A;  5M3M B;  1VQM A;  2NN6 H;  1TXY A;  2NB0 A;  1BR9 A;  3SXH A;  4ZKB B;  2Z1C A;  2EDG A;  4KD3 A;  4A3C G;  1S3O A;  3A5U A;  1D6E C;  4H7B A;  1BOS A;  1FGU A;  2H1E A;  1Y1W B;  3F2U A;  2BH2 A;  3QR8 A;  4L8J A;  4GNX C;  1NSN S;  2K1B A;  1YNN C;  1K83 B;  1IZ6 A;  4JI6 Q;  4JBJ A;  1O80 A;  4A3B B;  1QZG A;  3GTQ H;  4X3U A;  4TKO B;  3U9O A;  2UUB L;  1GUW A;  4IUR A;  4DV7 L;  4PZ7 A;  5GQO A;  1AZQ A;  3VA5 A;  1TII D;  2SEB D;  1JWS D;  1QWY A;  2F0T A;  3OSO A;  2K7V A;  2R92 G;  5IYB H;  2D62 A;  3L0O A;  1G91 A;  3HZX A;  3M3Y B;  1TWA B;  5LMU L;  3SK5 A;  1RHP A;  1EU4 A;  3V2T A;  1A63 A;  1LO5 D;  1OXX K;  5ELO A;  1X65 A; 
#chains in the Genus database with same CATH homology
 4AH6 A;  1SRO A;  2FXQ A;  4UY8 C;  2I5M X;  1OXT A;  4BBR G;  2VQF L;  5JJL A;  4XTC S;  4PG3 A;  1ASY A;  3FKI H;  5FLM H;  1SLJ A;  3JC6 6;  2Y0S E;  3J81 j;  3AYH B;  4GNX B;  2WP8 J;  5C0X G;  4DUY L;  2JA7 H;  3SGI A;  5HGQ A;  4L5S A;  5K36 G;  2AWO A;  1VQI A;  4R1J A;  2Q2T A;  2BA0 A;  5M5Y H;  4A3M G;  3FHW A;  2EIF A;  3EN2 A;  3S24 A;  2UU9 Q;  4DR6 Q;  1LTL A;  3ULL A;  2N49 A;  4X65 Q;  3I7F A;  1YHQ A;  4BY1 H;  2IT1 A;  2ZM6 Q;  1H95 A;  1AE2 A;  3EIV A;  4JV5 L;  3CQZ H;  2HHH L;  1K0R A;  3K81 C;  1YHA A;  2Y0S G;  4ME3 A;  1HNX Q;  4JI7 L;  2UXB L;  1N9W A;  1XMO Q;  2CFM A;  4A3J G;  4HJ8 A;  2IY5 B;  1HH2 P;  4L5Q A;  4QY7 A;  3T1H Q;  4LF9 Q;  4C3H H;  1E1T A;  3FP9 A;  4UPA A;  4JI3 L;  2VL6 A;  2GVA A;  5EAY A;  5M3M H;  4DV0 L;  3CC2 A;  3KYH C;  4LNQ A;  1W3S A;  3BU2 A;  3CXC A;  1XPU A;  3KDF B;  4LFB Q;  2R7D A;  1AE3 A;  1RL2 A;  4YWM A;  2N3S A;  4DUZ L;  4O2D A;  3HOU G;  4LUO A;  3KF8 B;  1UE6 A;  2YTV A;  2CKZ B;  5IP7 H;  4LF4 L;  1MJE A;  1X54 A;  1VQ5 A;  5C3E G;  1SMX A;  3OW2 A;  1Y1W H;  4A4I A;  1Q8K A;  3CCU A;  1XPR A;  3KLW A;  3RN2 A;  4BXX H;  4KHP L;  4GLA C;  3I4M H;  4UP7 A;  4X62 L;  1K83 H;  5C44 G;  1UE7 A;  1W2B A;  4POF A;  3HFZ B;  2UUB Q;  3H0G G;  3W1B A;  1Z47 A;  3G71 A;  1VQF A;  5IY0 A;  4A3B H;  4A3D G;  4MZ9 A;  1U0L A;  4DV7 Q;  3PUX A;  3RNU A;  2F3I A;  4PZ8 A;  4YCW A;  1PH6 A;  4IOC A;  1PH8 A;  3GTL H;  1UE5 A;  4DV4 Q;  1YJ9 A;  4IJL A;  2NVQ H;  1HR0 L;  2AMC B;  4JCV E;  4R4I A;  1HR0 W;  2YU9 H;  1RIP A;  2OWO A;  1VQG A;  3I4N H;  1I3Q H;  2OTL A;  5JJK A;  1Z9F A;  1QUQ A;  1FVI A;  4L5T A;  1X9N A;  4NXM L;  3GTK H;  1YHB A;  3TS2 A;  1S40 A;  5LMU Q;  4B3S L;  3U4V A;  1MKH A;  1VS0 A;  2K50 A;  3GDE A;  3F2C A;  1I94 Q;  4IFD I;  2I5H A;  1IBL L;  2UXD L;  1C0A A;  1KAW A;  5FJ8 G;  1EWI A;  1HNW L;  1N8R C;  2ALY B;  3M3Y H;  4P75 A;  1V1Q A;  5DLQ E;  2IHF A;  4OWT B;  1TWA H;  1HZA A;  1EIF A;  1VQB A;  2IX0 A;  4KLK A;  4JI1 L;  3G4S A;  2VQE L;  2VQF Q;  3PO2 H;  4EX5 A;  5IT9 c;  3HOZ H;  4DUY Q;  3K7U C;  5HY6 A;  2OQ0 A;  3CCV A;  2ASB A;  4HIO A;  4OO1 I;  2WB1 E;  3A5Z B;  2KEN A;  4DV2 L;  2ZTE A;  3PF4 A;  3BZK A;  3BZC A;  2E8G A;  3TEH B;  4LF6 L;  3NEN A;  4DV1 L;  3CCQ A;  1HJP A;  2HT1 A;  2ZJQ A;  4GLV B;  1KD1 C;  1YIJ A;  2H5X A;  3S2H H;  3HOV G;  4JV5 Q;  4PMW A;  3AEV A;  3PO3 G;  4P71 A;  2HHH Q;  4XIG S;  3EBE A;  4JG2 A;  2R92 G;  2B63 G;  1Y1V H;  1VQ4 A;  1K8A C;  5IWA L;  2UXB Q;  2B29 A;  3HOX G;  4OON A;  4QQB X;  2WB1 G;  4R4C A;  3F2B A;  2UUA L;  3M7N A;  1M90 C;  1EUJ A;  2JA5 H;  4DV5 L;  1GD7 A;  4AQY L;  4LF8 Q;  3E9H A;  3PIO A;  3OTO L;  4JI3 Q;  3PGZ A;  4DR3 L;  4GOP A;  1B8A A;  3TRE A;  1P16 A;  4DPG A;  4OX9 L;  2NN6 G;  4A3K H;  1O7I A;  4YHH L;  2MO1 A;  1JJ2 A;  4B3T L;  4DUZ Q;  2R92 H;  1QVC A;  3A0J A;  3RLF A;  1WI5 A;  5JJI A;  1ASZ A;  2DUD A;  4P72 A;  1PA6 A;  1VQ7 A;  2ZTC A;  1YEZ A;  2Q2H A;  3GTO H;  4LF4 Q;  4QGU A;  2B3G A;  4GN5 A;  2RF4 A;  4LF7 L;  1N32 L;  3RLN A;  1J5E L;  4UP8 A;  4JI4 L;  4KHP Q;  4A3L G;  1VQA A;  1G6P A;  1KRS A;  2Z6K A;  1YI2 A;  3ULJ A;  1XPO A;  1EYG A;  1SN8 A;  4X6A H;  1VQC A;  1DGS A;  2CCZ A;  1IYJ B;  2XGT A;  2OQK A;  4A3E G;  1YJN A;  4C2M H;  1HR0 Q;  1VQE A;  2RHQ B;  2NVY H;  4A3M H;  5IYD G;  4LFA L;  3D0F A;  2UXC L;  2C35 B;  4LUZ A;  5GAE C;  2PI2 E;  3JAM i;  3CPF A;  4HJA A;  3E0E A;  1KHI A;  4NXM Q;  2F4V L;  3F8T A;  2KHI A;  4IFD J;  2Q2I A;  5IYC G;  4JOI A;  1EQR A;  4GNX A;  5BR8 L;  1PH7 A;  1JB7 A;  4JI2 L;  4GKK L;  2UXD Q;  1XNQ L;  1N36 L;  1HNW Q;  1MJC A;  1PVO A;  4BA2 I;  3J81 c;  4RG1 A;  2VUM H;  2VQE Q;  3KF6 B;  2UUC L;  4A3J H;  1N33 L;  2PQA B;  3IRB A;  1K9M C;  1Q46 A;  3I56 A;  3H15 A;  3M85 A;  1KXL A;  1IL2 A;  2JA8 H;  4DV2 Q;  3CCJ A;  4DR2 L;  3TS0 A;  3CP0 A;  3CF5 A;  4LF6 Q;  1MIU A;  1N34 L;  1G29 1;  2E5L L;  1XJV A;  1X3G A;  4X66 L;  4DV1 Q;  1C7Y A;  4NB3 A;  3S1M H;  3FKI G;  4A93 H;  4WJ3 M;  3T1Y L;  3HOU H;  3ZJY C;  3HOW G;  4A3G G;  1NMG A;  2JJQ A;  1X56 A;  5C3E H;  3UDI A;  3KFU A;  1VCI A;  2RHS B;  2K5N A;  1L1O C;  3GTM H;  5IWA Q;  1EQQ A;  1LUZ A;  1PYB A;  2XTI A;  4AIM A;  2UUA Q;  1X55 A;  4A3I G;  3KDF A;  3DLL A;  4DV5 Q;  1Q1B A;  4GS3 A;  4DK3 C;  3A74 A;  4AQY Q;  1OXU A;  3RZD H;  4DR7 L;  3OTO Q;  5AJ3 L;  4DR3 Q;  4K0K L;  1E22 A;  2KHJ A;  1WCM H;  4R4O A;  3W5O A;  4L5R C;  4JI8 L;  4JI5 L;  4YHH Q;  1UWV A;  2ZJR A;  4B3T Q;  1JE5 A;  2I0Q A;  3PIP A;  1A8V A;  1SE8 A;  5C0X I;  2IHE A;  4BY7 G;  2K14 A;  1KRT A;  1C9O A;  4DR1 L;  4DK6 C;  5IP9 H;  1QVF A;  1KQS A;  1PH3 A;  1N32 Q;  4JBW A;  3ERS X;  3GO5 A;  5GRO A;  4JI4 Q;  1SR3 A;  3UE1 A;  5FJ8 H;  2A19 A;  2HIX A;  3S1Q H;  1JJC B;  1EFW A;  2NVX H;  5JEA J;  3HOY G;  5FLX c;  4JBM A;  4DR4 L;  1XNR L;  5IP7 G;  2HQL A;  4P73 A;  3CC7 A;  4YWK A;  3STB C;  2R7Z H;  4BXX G;  1VQH A;  2YV5 A;  1B70 B;  2QA4 A;  4HJ7 A;  4LF5 L;  1PH5 A;  4LFA Q;  3I4M G;  1Q86 C;  2UXC Q;  3S17 H;  1EIY B;  4A3C H;  1L1O B;  2R6G A;  1CKN B;  3HKZ E;  1BBU A;  5H1S E;  2A8V A;  3J80 i;  1E1O A;  2F4V Q;  3PV0 A;  4DV3 L;  4H02 A;  4APV A;  1XMQ L;  2CQO A;  3CAM A;  2CWP A;  4DV6 L;  1UE1 A;  1KIX A;  4YY3 L;  2K5V A;  3PO3 H;  4MTN A;  3U4Z A;  1N36 Q;  1L0W A;  1XNQ Q;  4BBS H;  3I4N G;  4MNO A;  4PZ6 A;  4QIW E;  1GVP A;  1WOC A;  2YTY A;  1QVG A;  4DR6 L;  4X65 L;  3LGJ A;  3RLO A;  2UUC Q;  4DR5 L;  1VQ9 A;  3MEF A;  5JEA G;  1NTG A;  1N33 Q;  4GN3 B;  3Q8D A;  4B3M L;  2N8N A;  1D8L A;  3PSI A;  4JI7 Q;  2F52 A;  4HJ9 A;  3PUV A;  1BBW A;  3HKZ G;  3KJP A;  2R93 H;  5C4X G;  1YBY A;  3K0X A;  4DKA C;  2K4K A;  2JEB I;  4DR2 Q;  1YJW A;  1VQD A;  1HZC A;  1N34 Q;  2K75 A;  4X66 Q;  3HOZ G;  1VQJ A;  3M4P A;  4DV0 Q;  3PO2 G;  3T1Y Q;  2KCT A;  4J15 A;  3CCL A;  3TRZ A;  3S1N H;  2ATW A;  1GO3 E;  1B7Y B;  3CW2 C;  3RZO H;  2A1A A;  1BKB A;  4GLX A;  1GM5 A;  3ER0 A;  1Q1E A;  3RN5 A;  3I55 A;  2I5L X;  2D0O A;  3UDG A;  4LFB L;  2YTX A;  4JOI C;  1Q7Y C;  1KL9 A;  1NJI C;  1IBK L;  1NMF A;  4EQ5 A;  1NE3 A;  3AQQ A;  3S15 H;  4Y7N H;  4A3F G;  2E2H H;  4LWC A;  4R4Q A;  3S14 H;  5M3F H;  4DR7 Q;  5AJ3 Q;  4POG A;  3CCS A;  4X62 Q;  4A3E H;  2R7F A;  5M5X H;  1VQ8 A;  1CKO A;  1Y1V G;  4JI8 Q;  4AYB E;  4BBR H;  4HID A;  4JI5 Q;  1CKM A;  3G6E A;  3GTP H;  4WJ4 A;  2CWA A;  1HZB A;  1IBM L;  1JMC A;  1I5F A;  2JA5 G;  1S72 A;  1V43 A;  4DR1 Q;  4LW1 A;  2BA1 A;  4C3I H;  3CC4 A;  1XTD A;  2GVB A;  1IXR A;  2WFW A;  4UP9 A;  1PYS B;  3UDX A;  4YWL A;  2VZA A;  4B3S Q;  4NXN L;  4RMF A;  4LFC L;  2AKW B;  4TVA B;  1PV4 A;  2IX1 A;  4DR4 Q;  1IBL Q;  4X64 L;  3K7A H;  1XNR Q;  2JQO A;  4O0A A;  4AYB G;  1PHJ A;  1A62 A;  3S2D H;  3GTG H;  2MO0 A;  3K80 C;  5IYB G;  1X3E A;  2JA6 G;  1JT8 A;  1K73 C;  4JI1 Q;  1CSP A;  1LM0 A;  4GN4 B;  4LF5 Q;  1HZ9 A;  4IPH A;  5IE8 A;  3AFQ A;  2ES2 A;  3W1G A;  4JI0 L;  3M4O H;  4A75 A;  4GKJ L;  4P74 A;  1PFS A;  2DGY A;  1EOV A;  1FL0 A;  1QZH A;  4DV3 Q;  2NVT H;  3HOW H;  3KF6 A;  1XMQ Q;  4A3G H;  4DV6 Q;  2NN6 I;  2PQA A;  4YY3 Q;  1TWG H;  1K3R A;  4YCU A;  5FLM G;  3CME A;  1X3F A;  2JA7 G;  4FDB A;  3I2Z A;  2GN5 A;  1FJG L;  2QEX A;  1AH9 A;  3AFP A;  4ALP A;  1OXV A;  3KJO A;  4DR5 Q;  4IFD G;  1Q12 A;  4A3I H;  1GKH A;  2D0P A;  1L2F A;  3F2D A;  4HIK A;  4B3M Q;  3KOJ A;  1OXS C;  1TWF H;  3S16 H;  2VNU D;  2KCM A;  4IPD A;  1SRU A;  5C44 H;  3D31 A;  3J7Z C;  3G48 A;  4BY1 G;  3CCM A;  3H0G H;  4GKK Q;  4JI6 L;  1TWH H;  2N78 A;  2VUM G;  4A3D H;  5LMN L;  3GD7 A;  5LMN W;  4BY7 H;  2LXK A;  4OO1 G;  3CMA A;  4OX9 Q;  4LF8 L;  3DM3 A;  4IPG A;  2JA8 G;  2LSS A;  4B3R L;  1YNX A;  2EXD A;  3I4O A;  4DAM A;  3E9I A;  1YVC A;  2QGQ A;  3JAM c;  3UE0 A;  1HNZ L;  2E2I H;  2JK8 A;  4A93 G;  2V1C C;  5M3M G;  3HOY H;  5J3B A;  1IBK Q;  2AWN A;  4LF7 Q;  1PH2 A;  4QJF A;  1CUK A;  1WFQ A;  1J5E Q;  2VW9 A;  4HJ5 A;  3NBH B;  3PUZ A;  4C3J H;  2Q2U A;  4A3F H;  3B6Y A;  3UDF A;  3WWV A;  3ICE A;  3OYY A;  1YIT A;  2E2J H;  4JYA L;  3CCR A;  1X6O A;  1E3P A;  2VY3 A;  1IBM Q;  1T9H A;  1Y1W G;  4JC0 A;  2PI2 A;  3HKS A;  1E24 A;  1QUQ B;  3K8A A;  4R4T A;  3PCO B;  1A0I A;  1WCM G;  4IJH A;  5GAG C;  3PF5 A;  5E7N A;  4GOP C;  3NEM A;  3J7A 5;  4IOA A;  1V9P A;  1J6Q A;  4A3B G;  3M4Q A;  3H3V H;  1JJG A;  2AHO B;  4OXP A;  4NXN Q;  4LFC Q;  1PH9 A;  1YZ6 A;  1VQL A;  2JEA I;  4JI2 Q;  3TQY A;  5BR8 Q;  3HOV H;  4X64 Q;  1K8G A;  5IP9 G;  3ULP A;  1L1O A;  5GAH C;  1CKN A;  2MNA A;  1UEB A;  2B63 H;  1VQO A;  4JBK A;  4A76 A;  4DNI A;  2UU9 L;  5C4X H;  3S1R H;  1D7Q A;  1TWC H;  3HOX H;  5ELN A;  5GAD C;  3PUW A;  2ZM6 L;  2MQH A;  1I6H H;  2L15 A;  4JI0 Q;  4YCV A;  4GKJ Q;  2Z6K C;  1PH4 A;  1Q82 C;  3BJU A;  2ID0 A;  3M9B A;  2ZJP A;  3L2P A;  1G51 A;  1VQM A;  2NZO A;  3VDY A;  1HNX L;  1VQ6 A;  2R7Z G;  2E5L Q;  1TXY A;  3L7Z C;  3U50 C;  4HIM A;  1NY4 A;  1XMO L;  3U58 A;  3NEL A;  5C4J H;  4LUV A;  2BH8 A;  3T1H L;  1VQP A;  1FJG Q;  4A3C G;  4LF9 L;  1S3O A;  3A5U A;  1E7Z A;  2WAQ E;  2ZTD A;  1BVS A;  1FGU A;  2R93 G;  2RCN A;  4A3L H;  2BH2 A;  4BBS G;  3J81 i;  1OTC A;  4KI0 A;  3GTJ H;  4GNX C;  4NPS A;  4GOP B;  1IZ6 A;  2PNH A;  4QL5 A;  4JI6 Q;  3MXN B;  4JBJ A;  2KBN A;  5LMN Q;  1VQK A;  2PMZ E;  1SFO H;  4K0K Q;  3PUY A;  1QZG A;  3STB D;  1Y14 B;  3GTQ H;  1VQN A;  2JA9 A;  5M5W H;  2OCE A;  5IYD H;  1WJJ A;  4KHZ A;  3RR5 A;  2UUB L;  2WAQ G;  4B3R Q;  5C0X J;  2OTJ A;  1M1K C;  2JE6 I;  1HNZ Q;  3CCE A;  4DV7 L;  4PZ7 A;  3J80 c;  5GQO A;  4OWW B;  2K5H A;  3CPW A;  4DV4 L;  5IYC H;  1Q81 C;  4Y52 H;  1PH1 A;  4IPC A;  1R9T H;  1LYL A;  2K52 A;  2MFI A;  4A3K G;  1KC8 C;  4OWX B;  4DAY B;  5IYB H;  4IO9 A;  2D62 A;  2NZH A;  1CSQ A;  1WYD A;  2HIV A;  2Z0S A;  3L0O A;  4TQU S;  2JA6 H;  3H3V I;  1P8L A;  4BA1 I;  4JYA Q;  5LMU L;  1U5K A;  2YYZ A;  3CD6 A;  1I50 H;  1I94 L;  3F1Z A;  2VS1 A;  1A63 A;  2EQS A;  1OXX K;  1NBW A;  2LXJ A;  5M3F G;  5ELO A;  1X65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...