5DAUA

Crystal structure of staphylococcal nuclease variant delta+phs v39e/v104e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLEDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNNWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39E/V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dauA00
1STNA 1EYCA 2F0LA 5CC4A 3ITPA 3MEHA 4ODGA 5CV6A 4DU9A 3OSOA 2F0UA 4KV6A 1F2YA 1RKNA 1F2ZA 1SYEA 2F3WA 4N9PA 3D4WA 1SNOA 5CV7A 4ZUIA 3T13A 3TMEA 2SNMA 4ID6A 3V2TA 5IGFA 1KDCA 5CV8A 1STGA 2PZTA 4K5XA 1SYGA 3HEJA 1ENAA 4HMJA 3QOLA 5C5MA 3C1EA 4B9XA 5CGKA 4NKLA 2F0SA 4K8JA 4K5WA 5IGGA 3LX0A 2F0NA 2KHSA 2RDFA 3E5SA 3NXWA 2EY1A 3OMGA 4ZQ3A 4K2LA 4QMGA 3T16A 1TT2A 2RBMA 3TP8A 5KGUA 1JOQA 2SNSA 4KTAA 5M9OA 2PQEA 2WACA 2OXPA 2F0OA 5I6YA 5EKLA 4HMIA 3DMUA 4LAAA 2F0HA 3SXHA 2F0MA 3OMCA 1SYBA 4H7BA 4B9WA 4EQOA 3P1HA 2PYKA 3SK4A 4G57A 2KQ3A 2LKVA 3H6MA 5E3FA 2PZWA 2F0GA 1ENCA 3PMFA 4KJOA 2PW5A 1II3A 4PMBA 4K14A 3MZ5A 5IOCA 4RKLA 2EYLA 3NQTA 5IODA 1IHZA 5F2DA 4PNYA 3VA5A 1A3UA 5J22A 1KDAA 4YIJA 1A2UA 1EYDA 5JAVA 3BDLA 5KIXA 4KHVA 5DEHA 4KD3A 2EYHA 5JOBA 2ENBA 4DGZA 4F7XA 1STBA 1SNPA 2F0KA 4N9TA 5KYLA 5ISRA 5C4ZA 4R8NA 1EY0A 1SNCA 3BDCA 3MVVA 3R3OA 1KABA 1NUCA 4QF4A 3TP5A 3SK5A 2EYPA 4K5VA 1SYDA 5IIFA 2EYJA 4EQPA 1EQVA 5CR3A 4J6HA 3TP6A 1EZ8A 5DAUA 3QOJA 1TQOA 3SK8A 2F0DA 5NUCA 1EZ6A 1SNDA 1U9RA 2OF1A 4NDXA 3C1FA 1A3VA 3ERQA 2QDBA 4I65A 5E1FA 2F0PA 5IGCA 4J1MA 5EKKA 4DF7A 1JOKA 4ME5A 3QB3A 5IGBA 4MIUA 1STYA 1SYCA 2RKSA 4K6DA 4IALA 5HGTA 2EY6A 1A2TA 3D6CA 5C6AA 5C4HA 3DHQA 1EY6A 1EYAA 3NHHA 3NP8A 5CV9A 4KY5A 2EYFA 4WORA 2EY5A 3OWFA 3TP7A 5C3XA 5KRUA 2EY2A 4K8IA 4TRDA 3EVQA 2O4XA 4PMCA 5EGTA 4NMZA 2M00A 5J1ZA 5C3WA 3P75A 3EJIA 1EY5A 2F3VA 3SR1A 2F0QA 2PW7A 4WRDA 1SNMA 4F8MA 1EY8A 1A3TA 1STHA 1SNQA 2F0FA 4E6IA 5I9PA 3NK9A 2EXZA 2EYOA 5K5PA 1JOOA 1EY9A 4HTHA 5KEEA 5C5LA 5CV5A 3S9WA 4KJNA 5I6WA 1JORA 4ZUJA 2SOBA 5CV4A 2HQEA 4KY7A 1TR5A 1EY4A 2F0EA 4K2KA 4NP5A 3D4DA 2F0JA 5KYIA 2F0VA 5I9OA 2F0WA 2F0IA 3SHLA 1STAA 3HZXA 2NUCA 1KAAA 4IUNA 5IGEA 4RKBA 4EQNA 3U9OA 4OL7A 2OEOA 3RUZA 2PZUA 2EYMA 3EROA 3NUCA 3SK6A 4QB4A 1F2MA 5J39A 5HURA 4DFAA 1AEXA 5IGDA 4IZ8A 4S3SA 1EY7A 4KD4A 4EVOA 4KY6A 3D8GA 3MXPA 3MHBA 1NSNS 1SYFA 2F0TA 1KDBA
chains in the Genus database with same CATH superfamily
5C0XG 3HOUG 3M4OB 4DV5L 3J80L 2YU9B 4L5TA 3KLSA 5CV7A 4HJ5A 4JCVE 1PH1A 3T13A 4L5RC 5IGFA 4A3FH 5COYA 2XTIA 3QO2A 4IUVA 3GTOH 1JJGA 1PH7A 1L0XB 4BBSH 1U4PA 2K1BA 1K83B 3WWVA 1U0LA 3MXNB 1L1OB 1KNAA 2JA5G 1PH6A 2EQSA 3KJPA 2KVMA 3QR8A 4X3UA 1KDAA 2NVYH 3S1RH 4OO1G 5KIXA 3ICEA 1AP0A 4NXNQ 2CW0C 2ENBA 3FDTA 4QUFA 2NYZD 1MBYA 2A69D 1E7ZA 5H1SE 1WOCA 2AMCB 4FF4A 2DUDA 1IW7D 3PUYA 1PZID 1LM0A 2QDBA 2ZXOA 1Q8KA 3W2DA 4FXDA 2K5VA 3GTMB 1BCPC 5C3EG 1H9JA 1STYA 2GA4B 1TWHB 5GROA 1BKBA 3D6CA 3DEOA 4KY5A 1A0IA 3OWFA 2JQOA 3NBHA 1Q46A 3G6JB 4B08A 1P8LA 2O5IC 4DV3L 1PRTC 2NVQH 1TS4A 4JBJA 4KHPL 1SLJA 1EY8A 3OIPA 5ELCA 3C3LA 5K5PA 2VW9A 1HNWL 3PUWA 4Q0FA 3H15A 5I6WA 1VQJA 1WTHA 5EJWA 1CI3M 4BA2I 3P7JA 2Y0SE 1O7LA 5L37A 4A3FB 4GLXA 4DV4Q 4GNXC 1KXLA 1HNXQ 3CQZH 3GTOB 2NZHA 5E4WC 1A8VA 1NSNS 3W1BA 3Q23A 1HZ9A 1ZKOA 4WJ3M 3CU7A 4A3DB 1CKOA 5FLXL 5CC4A 1FVIA 4DR6L 3AYHB 1VQLA 1SE4A 1Z6HA 1I4RA 2B2YC 3E3XA 3K0YA 3OTOL 1VQ6A 2Z8LA 3HOVB 5CV8A 4IJHA 3BYTB 2AKWB 2DNEA 1Q12A 1CZWA 4LF8L 2HDMA 1H95A 4C3IB 1FYCA 1SJED 2VQFQ 2DN8A 3GP7A 5GADC 3TZUA 2NVYB 3D0FA 5BN5A 2F0MA 1MJEA 4C1NK 2I07B 1I50H 4IUUA 2ZT9C 1QNUA 3CCLA 3BZDB 4XIGS 4Q5VA 3KBXA 4DA2A 1IYVA 1BNZA 1HPCA 5C0XJ 3TBIB 3K59A 1JE4A 3RLNA 4A3LG 1PH3A 2MHVA 2A6ED 5JJZA 4EGVA 5FOBB 2VUMG 2R92G 1FJGL 1PYWD 4YCUA 3R2IA 3S2HH 2TMPA 3GD7A 4R8NA 1YHQA 3BDCA 1V1PA 2KCNA 3FHWA 4HJAA 4JI7L 4BBRG 2PMZE 3AEVA 1RL2A 1UE6A 4MTKA 1I4QA 1TU2B 3NWTA 1BR9A 3QOJA 3M4YA 4KN4C 1EZ6A 2F0PA 2RCFA 4B3TQ 1I4HA 4DNTB 1HA5A 3PO3G 2RQXA 1LO5D 3NWSA 5FKAC 1RDPD 1VDZA 3J81L 4TQUS 1ASZA 4IFDI 5KNDA 4NMZA 1HZBA 1EU4A 1IL8A 1QB5D 3OIQA 2F0QA 1EOVA 1A3TA 1Y1VG 4K0KQ 1U4MA 1GD7A 1WTVA 5A35A 4YY3Q 1QG7A 3O13A 1J6QA 5A2QL 1ESRA 1DOMA 1ICWA 3JAML 2VS1A 1I4PA 2E2HH 1WTRA 2NBFA 4NXNL 1BBXC 2R7DA 2K50A 3I72A 2M2LA 2F0WA 1HUNA 3RD4A 1AFPA 5G3LD 3ZJYC 3VYUA 4YWLA 1EOTA 4RG1A 2ZXPA 3HOZH 3T56B 4C3JB 5IP7H 5M3FH 3A7AB 1GHKA 1SMXA 1IKMA 2BA0A 1TS5A 2L12A 3UI2A 4HAEA 4EX5A 5M3MB 1FNVA 3S1NH 1J8IA 1UE1A 3RMHA 1SMYC 2AQ1B 3RR5A 5EPLA 2HD3A 1K28A 2E2JB 1DZ1A 1S3OA 4KN7C 3M4PA 4H7BA 3KFUA 2I46A 5D14A 5TSSA 1LT3D 3PMFA 1VQPA 2X6LA 2K5DA 4DPGA 4RKLA 3E6ZX 3S16B 2E5LQ 1GVPA 1XXGA 3C2PA 2Q2UA 2J0TD 1JWSD 2L9HA 4HCSA 4DV4L 2R93G 2EYJA 1IBMQ 1EQVA 1HNXL 4C56C 4QIWB 5C44G 3J81i 2BH8A 1VQCA 4IUPA 2IX0A 1G2TA 2E8GA 1NNXA 1Y1WG 2B63B 3SK8A 1EIFA 4LUZA 3ERQA 1HZCA 1PFNA 1G51A 2B2VC 4J1MA 4CKEA 1PH5A 1CKNA 1SE2A 3G48A 1BBWA 2WB1G 1YIJA 2ASBA 4DK0A 3PO2G 2LXJA 1EY6A 3KLRA 2VQFL 4A3EH 2IHFA 1C8CA 3JAMi 4KMUC 2E2HB 5C3WA 2C35B 1H9KA 4DAMA 1EY9A 1S72A 5CV5A 1QUQB 1LTBD 4Y52H 4ZUJA 4JG2A 2DNCA 4CGYB 5E7NA 3HOWH 2B2WA 4JI8Q 3K58A 4BXXH 3RUZA 2PZUA 4P75A 1VQ4A 2F03A 1ZYRC 3S1NB 1TWGH 3FRPB 3HRZC 5IGDA 4F87A 1N8RC 1LT5D 1TS2A 3PV0A 5J3BA 2KUMA 3RN2A 1TY2A 3G4SA 4B3TL 3OSOA 3NEMA 4H0LC 5JAVA 2HIXA 3TMEA 2L11A 1STGA 2NZOA 2PZTA 3V96A 1JQYD 4A93G 1GKHA 3QOLA 1PH9A 1SJHD 3AMUA 2IJ0A 1T5EA 1YHBA 3E5SA 1TIID 3T16A 1YJNA 2B2TA 3G7LA 3D4RA 4XDXA 3K80C 2K4KA 3BYYB 2F0OA 4K0KL 1CQFA 2ZM6Q 5BN3A 3U50C 1B7YB 1E22A 4YY3L 4FXGC 5IYCH 4HSVA 5GAHC 1EEID 2PW5A 4YWMA 3M3YH 2QDLA 3T4AC 3MXNA 1L1OA 4BY1H 3Q22A 1E1OA 5J22A 4IFDH 4LF7Q 2JA7G 2SEBD 1P16A 3L3OC 5DEHA 2B29A 4DGZA 4F7XA 1PYBA 1PYSB 1SNPA 1PV4A 5K36G 3HFZB 1PVOA 1V9PA 4YCWA 4K5VA 4GLAC 5I2XA 1FGBD 1D8LA 2UXDQ 3MA2B 4GOPB 3FKIB 1KAWA 3TP6A 2ZXRA 1O80A 3CMAA 3S14H 4IQZA 3ONAB 1SFOH 4NDXA 3LWUA 2FINB 3C1FA 4ZCKA 3UDFA 4DR7Q 1VQNA 3HOXH 1RTOA 4DV2Q 2K7VA 4BA1I 4K6DA 1MKHA 3TQYA 1S5BD 1XTCD 4LUVA 4TSSA 2QEXA 1TWAH 3M85A 1F9SA 4A3JG 1E2ZA 5JEAH 1UNSA 1I4XA 5M5WB 4O42A 2VZAA 1PRTF 2F4VQ 3HOWB 1JE5A 1HTLD 5FLMH 1IBKL 1LABA 3J81E 1RHPA 3OW7A 3CC4A 4O2DA 1JC7A 2AQ3B 2YYZA 1TWGB 1V1OA 1Y8OB 1KRTA 1K8AC 2E5LL 1VQFA 1PTOF 4AYBB 1TWCB 1U4LA 1WI5A 2F0IA 1Z9FA 3HZXA 4JI1Q 2NUCA 3LWEA 1IBML 2JA6H 5A2QE 2ALYB 3RZOB 3JAME 1V8QA 4QB4A 1V1QA 1MI2A 3T1HQ 4LW1A 1DOLA 2NN6G 1PH8A 2NB0A 3MXPA 2EOTA 1JMCA 3GQBA 2ICIA 2F0TA 2R7ZB 2F0UA 1QNKA 3T51B 1L0YB 3E0EA 4N9PA 1MIUA 4C1NI 3K5MA 4B3SQ 4JBMA 2CFMA 4A3GH 3CCRA 2N55A 2KEDA 5CGKA 3FEWX 2F0NA 4R4TA 1FR3A 3M7GA 1LT4D 2PI2A 2EPBA 4RHRA 2JA9A 2TSSA 3GTGH 1EFWA 4GN3B 3RNUA 5E3FA 1VQBA 1TXYA 3PUXA 5CBAE 3NQTA 1B8AA 4P2CB 2WIIB 4HIMA 4A3BH 4NW2A 4HEDA 2MPMA 4BY7G 4JI8L 1IYJB 5JOBA 2IX3A 3HOXB 5IT9c 2WB1E 4IURA 2UUAQ 1NY4A 3A5UA 5DM73 2A6HD 4OGQC 4DR5Q 1XX8A 3U4VA 3TEHB 1ZEQX 5E4XA 3NSWA 2YU9H 2KBNA 1TWAB 4KK7A 4RWSC 5BN4A 4LF6Q 3OWEB 3UDGA 1S40A 2B2UC 4GS3A 4DF7A 1T5XD 4APVA 1GXDC 4R8IA 3H0GH 2MFIA 5CORA 1PXUA 4R4CA 4C3HB 5IYDG 3UE0A 1WFQA 5C3XA 4CJ0B 1K83H 2AQ2B 4UP7A 4A3MB 4CBVA 2IY5B 4ABNA 4DK1A 2ZTEA 2ZM6L 4PZ8A 5JJIA 2JA6B 1O7ZA 2A6EC 1ICFB 1CUKA 2OTLA 1IYUA 2YV5A 4LF7L 2D9UA 4KY7A 5CMDA 1WTOA 1A63A 3K7AH 5M5YB 5I9OA 2D62A 4WJ4A 4RA8A 2D0PA 1A62A 4LUOA 2F3IA 2AWOA 3F1ZA 4A3GB 2EYMA 3EROA 4HR7B 1ZXTA 3I55A 2UXDL 2A19A 2VL6A 1D5XC 3PF5A 2MO0A 1SYFA 3HEJA 5ELEA 1NTGA 3FPUB 4DR7L 2Z4HA 3TRZA 2A74C 3CPFA 4DV2L 1BVSA 4GN5A 3VDYA 4A3KG 2JEBI 4ID6A 2Q2TA 2MNAA 3S17H 1ENAA 2FJ2A 5IE8A 3C46A 2RDFA 4OIJA 3J7AV 3IFDA 5KGUA 4JBKA 4A3BB 3I8ZA 3PF4A 2F4VL 2WAQG 2ID0A 1B2TA 1GM5A 3CMEA 4ME3A 2ZTDA 3MWYW 3MXUA 4R4OA 3BVZA 5EKIA 4JI5L 1NR2A 4IN3A 1F9PA 3KLSX 2B8FA 4YWKA 4L6TB 4JI1L 1YBYA 1VF7A 2EYHA 4PZ6A 4JPBW 3H0GB 2QGQA 4TKOB 3T1HL 4A3DH 5DNFA 2F52A 3LNNA 2L1BA 3F2CA 1DD2A 2JA8B 2XRQD 3W1GA 1YHAA 1PTOH 3HOVH 2F0DA 2OF1A 1WCMG 1HUMA 4XXEA 1VS0A 4B3SL 4C3IH 4CDDC 4QUCA 3KDFB 2EY6A 4DR1Q 4CJ2C 3E0JA 1YNJC 3D31A 1G2SA 1A15A 3DEPA 3K7AB 2PMZB 2EZVA 3P75A 4BBSG 3ULPA 3TDQA 1STHA 2F0FA 3RZDB 3HOYH 1F77A 1C4QA 5C4JH 1DXMA 1QUQA 2F0EA 2IL8A 2JSOA 4FYDA 3QG1A 1YNNC 1J5EQ 2UUAL 3STBD 4DR5L 3FMCA 1K8GA 1TVXA 2I0QA 3S17B 2KEEA 2E74C 4S3SA 3MHBA 4DUYQ 4LF6L 3CC2A 2KHJA 1OXUA 1STNA 4J8QA 1LV9A 1X3EA 1BCPB 2VB2X 1S5DD 2SNMA 1SR3A 2K28A 5IGGA 1EWCA 3OMGA 1JR0D 1UEAB 5I4DA 4B9WA 3PUVA 3CCUA 4RH6A 1D1IA 1PRTB 4CKCA 1ESFA 3P1HA 4X3SA 3DLLA 2LKVA 3FVQA 3VR5A 1WTXA 2JA5B 4LF4Q 1A2UA 3S15B 2ZJRA 1PTOB 4KI0A 4QJFA 3SVMA 1PFSA 5IYBH 4C3JH 1G6PA 3HKZG 3GTKB 2C9OA 3IKJA 3I2ZA 1NUCA 3UDIA 4GNXB 3ULLA 1XMQQ 3OW2A 2Z0SA 4KHZA 3KBGA 4NB3A 2D0OA 5M3MH 2PQAB 4GOPA 4A3CH 2CKZB 4A3LH 3MFGA 1X3QA 1YITA 5FO9B 1CSQA 3I56A 2BE5D 4RCOA 2H5XA 3I4NG 2E2JH 1L0WA 3MFYA 2K5QA 2HCCA 2AWNA 5I2YA 3HOYB 5C4HA 1KQSA 5C4JB 3L9AX 2N3SA 2EYFA 4H44C 1N33Q 3W3AA 3MAQA 5EGTA 4ZK9B 2LSSA 4XQQA 1EY5A 3L7ZC 3SR1A 2H1EA 3S16H 4G7HC 2A68D 1K0RA 1X65A 3PO3H 1GUWA 3SGIA 2HQEA 1M90C 3CXCA 5KYIA 3T1YQ 3CD6A 2K5WA 1QCBD 3CCJA 3GDEA 1RF2D 4OL7A 3PIO3 2B63H 1HQMC 2K04A 3CHBD 2R7FA 1R4PB 1D5MC 5C4XH 1QVGA 2JN4A 1E2WA 4PZ7A 4LF5Q 4ZRZA 4JI6Q 2WAQE 3WDNA 2F0LA 3TSSA 5IWAL 2VQEQ 4DR2Q 4KV6A 2GN5A 3KUPA 1EU3A 4DR1L 1I5FA 1AE2A 4HJ7A 4HMJA 3CW2C 1CZGA 3PIPA 1PLFA 4BWGB 5JJKA 2KHSA 4QMGA 4XT1B 1JOQA 3BVGA 1FNUA 2P5ZX 1EEFD 4KTAA 1FL0A 4I7ZC 4JOIC 2Z6KA 2N88A 3CRKC 1O78A 1X3GA 5FO7B 1K9MC 1HR0W 2K32A 2AUKA 2WINB 4KJOA 3GTLB 4NPSA 3H3VI 3URYA 4DAPA 1KLUD 2HHHQ 1S5CD 2NZ1D 1J5EL 4PV1C 1Y8NB 1I6HB 5IT9L 1C48A 3AB9A 1JWMD 2VUMB 1E0BA 2R92B 3MC0B 3TP5A 3IFTA 3HOZG 1PZJD 3GV6A 1LTID 1UE5A 1X3FA 4KKTA 4DUYL 5IP7G 1KNEA 2WKCA 4JK1C 3CCQA 5M3FG 1E3PA 1D1KA 1W6KA 4BBRB 1OXVA 2K52A 3VYTA 1IBKQ 1A6XA 2RA4A 1MHWC 2FHTA 1OTCA 2LFNA 4I7AA 4M1UB 3F2BA 1RJTA 3VA7A 1JB7A 2KCTA 1B4OA 2BDNA 3BG3A 2N8NA 2R61A 3DUZA 1XPOA 3J7ZC 2CW0D 3PO3B 5FJ8H 1MSGA 4IOAA 2Z4IA 3GV3A 4LFAQ 4IUQA 3EBEA 3EN2A 3TZDA 1Y1WH 3CCSA 4E6IA 4MHEA 4OELB 2A1AA 4GKKL 1EQQA 3PCOB 3L0OA 1WTPA 1CA6A 4RFBA 5C4XB 1VCIA 4LF4L 2FXQA 1HH2P 3V05A 1BCPD 1TKWB 4DNRB 2HT1A 4DK3C 4QGUA 1VQHA 1EQRA 1VQIA 2ZTCA 3X3NA 1K8MA 2X6GA 2IPKD 3FKIH 3U9OA 1PH4A 1B3AA 1XMQL 5LMNQ 4HIOA 3A54A 1Q1EA 5HURA 1AEXA 1CK1A 4IZ8A 1XPRA 2L55A 1PRTD 4XYOA 2DGYA 1AZQA 1JJ2A 1H9RA 4MN3A 5CV6A 4P72A 4ZUIA 2RF4A 1KRSA 1TY0A 1N33L 2F0SA 5M5WH 1PTOD 3TP8A 4DR4Q 4A3EG 4K2LA 4FXKC 1VQ8A 4ZYSA 1YNXA 1HTPA 1X9NA 3CC7A 4B3RQ 3HKZE 1HHVA 2K75A 1WJJA 3I4MH 3U9SA 4FF1A 2F0GA 1TWCH 1II3A 1DOKA 2KA7A 5DM63 4FO2A 1IHZA 2XRSD 4U68A 1ET9A 1VQ9A 2IHEA 3T1YL 2KOLA 4HJ9A 4KHVA 3RZOH 1O7YA 4KD3A 1GHJA 3HOWG 1MGSA 3R3OA 4L5QA 4BXXG 3SK5A 2G9DA 2XWJB 1C9OA 3BS1A 4J6HA 1BBUA 2R7ZH 4R9WA 5T1IA 2DJFC 2B8GA 2R93B 4LF5L 4O0AA 4JI6L 2VQEL 4DR2L 4Y7NH 1Y1WB 1EIGA 1OO9B 2BDOA 1VF5C 2JA7H 3HG9A 2E2IH 4XTCS 5KNCA 4IPGA 4POGA 2CQAA 2Q8TA 3K5OA 5C6AA 5K36H 2WB1B 3KDFA 3TP7A 5KRUA 1NJIC 2EY2A 3PO2B 3M4QA 1NMFA 1YZ6A 1CM9A 2SDFA 3NELA 1X32A 5IP9H 1SNMA 1HNZQ 1V43A 1OXXK 1PDQA 2H4OA 2VY3A 1E24A 5IYCG 2IX1A 1X6OA 1BCPF 2HHHL 2B39A 1Q82C 1D2BA 1XJVA 4BY1G 1B9MA 1Z7TA 4FVMA 5C0XI 3D4DA 4ZKCB 4DV7Q 4R4IA 4IFDG 1DONA 2MGSA 3A74A 1EWHA 2KHIA 3OOCA 2GVAA 1XPUA 1GUGA 1IZ6A 3H3VH 4DV0Q 1EY7A 1Z47A 5JVG3 4HN7A 1H9SA 2L15A 1CT1D 1W2BA 1KC8C 4C3HH 2HQLA 1NAPA 3MEHA 4G4KA 4NXMQ 3SK6A 3ERSX 4JI5Q 4UHVA 1STEA 3I4MB 2FMMA 4O1NA 1LTTD 3NTIA 4B9XA 4A3MH 4QY7A 4A4IA 4K8JA 4K5WA 1SROA 2A69C 4OO1I 1RTNA 4A93B 4LFAL 5JEAG 5EQ0A 1IW7C 1XNQQ 1ASYA 1AE3A 3J7YW 3F8TA 1LUZA 4IPHA 2CH4A 3VYSA 4JI3Q 5M5YH 4DV1Q 5D3DA 1CHPD 2ES2A 2EYLA 1R9TB 1J9OA 2D2CC 3VYRA 4RGOS 1LLRD 3J7AF 4Y7NB 4Z9CB 4POFA 2K5HA 1SMYD 2MO1A 3WOFA 2JA7B 5LMNL 2LMCB 2E2IB 4A3IG 2BA1A 4LWCA 3P20A 1I3QH 3MEFA 2YTXA 1DYQA 2RVLA 4GNXA 4X3KA 2Q8RE 1XTDA 1JCKB 3I70A 5IT9E 1IKLA 5IGCA 3VR4A 2PQAA 2VB3X 2RHQB 2PPBC 2RKSA 4ULLA 1SEBD 1VMPA 1A2TA 2B2YA 4A3GG 2Q8IB 4DR4L 3NHHA 5CV9A 5HGQA 2UU9Q 1N32Q 1CHQD 4YHHQ 3AU7A 4B3RL 4CDEC 2I5LX 3KF6B 1HRJA 5GAGC 5JPNC 1SNQA 5T1GA 4N8FA 3M9BA 1WD1A 3S9WA 3KJOA 4JW0A 2Y0SG 4A3BG 1EY4A 2UUBQ 1B1ZA 4JBWA 3K5NA 1X56A 3SHLA 4EQNA 1SE3A 2JA8H 5ELFA 2MP1A 3S2DB 3TN2A 1PZKD 2CWAA 4FNFA 5EPKA 2CQOA 5J39A 2ICEC 1MSHA 4A75A 4CJ1B 3PIOA 4H02A 3CCMA 2KQ3A 4U673 1EYCA 2BE5C 2DJGC 3V2TA 1KDCA 5GAEC 2Z6BA 4IFDJ 4H13C 2OWOA 2A73B 2Q2IA 3SEBA 2EY1A 4IPCA 1C7YA 1RD9D 2AHOB 4BS9A 2K01A 3DM3A 2UXBQ 3RZDH 1UUPA 2PQEA 5I6YA 1SRUA 3DWAA 1HR0Q 4HMIA 1ZYRD 1SYBA 1HNZL 3SDZA 2X69A 2QILA 4L8JA 3I3CA 5HY6A 4JI2Q 2K6AA 1I3QB 4K14A 5IOCA 3R93A 5M5XB 2K05A 1WD0A 4DV7L 2B2WC 2XVSA 2DY7A 5KYLA 4N9TA 5ISRA 1XMOQ 3I4OA 2F4IA 4BY7B 5JEAJ 1GUSA 1AH9A 1NBWA 4DV0L 4JVZA 3PQIA 1QE6A 3GTPB 4NXML 1SSOA 5C0XH 3HOUH 4I65A 1SBBB 3BZCA 5E1FA 2CCZA 3RLOA 5EKKA 4ME5A 2J7ZA 4X3TA 1B44D 2AUJD 2HDLA 3BZKA 5HGTA 2B2TC 1UAPA 1YI2A 1LTGD 4EQ5A 3IAYA 3VR2A 4TRDA 2O4XA 1DGSA 3TS2A 1EIYB 1XNQL 3K6OA 2A8VA 1QOHA 3KK7A 2PW7A 2C5CA 2JK8A 2XN9C 4JI3L 2JA5H 4OWXB 2EYOA 4DV1L 3S15H 4P73A 1L1OC 1B9NA 3K0XA 1CTMA 3GTKH 5IWAQ 3EQLC 4OO1H 4NP5A 5AJ3Q 3I73A 3MXGA 2N78A 3D6WA 3AFPA 4A3FG 1NE3A 2PNHA 4N8X1 3Q24A 4OIKA 4UP9A 1BF4A 3K7UC 5ELNA 4A3DG 3DM1A 1VQMA 5FK9C 1KHIA 3D8GA 1D5ZC 1B3QA 1QILA 4PMWA 1KDBA 2LXKA 4OXPA 3HOVG 1JWUD 1TS3A 1HJPA 1LTAD 5C3EH 1CSPA 2E75C 5JPMC 3GTJB 1KIXA 1RKNA 1F2ZA 2F3WA 5JJLA 3D4WA 4JC0A 4C3IG 2B2VA 2FMCA 1RCVD 5C5MA 1N36Q 4AIMA 4A3KB 2UU9L 1N32L 3LX0A 1GO3E 4ZQ3A 3NTHA 4YHHL 1U4RA 2RBMA 1XYIA 1M4VA 2ZJPA 3S1MH 5KNBA 4X66Q 1GUNA 1PH2A 4P74A 2OXPA 4LAAA 2L0CA 2DY8A 2JYOA 1H9SB 1HA6A 2JP1A 4DAVA 1K8OA 2WAQB 2XIWA 3H6MA 1Q1BA 3NBIA 3HOYG 1UEBA 1DCZA 4PNYA 2UUBL 1HXYD 4YIJA 2VNUD 1E2VA 3BDLA 4XYQA 4AH6A 1W3SA 2IWHA 3HOUB 2BH2A 3U58A 4JYAQ 4OWTB 1SNCA 3J81j 5IIFA 2CH4W 3I7FA 2QW7A 4FP5D 3G6EA 3CF5A 1KD1C 1YEZA 1TQOA 2XGTA 1SNDA 1U9RA 3KF8B 3KYHC 2JXMB 3CCVA 4GKKQ 1JOKA 1BQQT 1Y8PB 5IGBA 3WOEA 1JJCB 1I6VC 1WCMB 1PTOC 2K03A 5LL6X 5D65A 1Y14B 1YJ9A 1F2LA 2RSOA 4G7OC 3J80i 2V1CC 4DAYB 2L4NA 2UXBL 4X62Q 4PMCA 1HR0L 4R1JA 1T9HA 3HGBA 3GTLH 3A5ZB 4OX9Q 2F3VA 5ELDA 4F8MA 4J15A 2MQHA 4YCVA 4JI2L 1SXTA 2ZJQA 1JOOA 4BBSB 1NMGA 5IY0A 1I6HH 1K3RA 3I4NH 4K6LA 4B3MQ 3BU2A 2VUMH 4QQBX 2R92H 1BO0A 1XMOL 5C3EB 5IYBG 2BOSA 4C3JG 3S1RB 1HCZA 2OQ0A 4BBRH 1F2MA 1VQEA 2N49A 1KLGD 2PO4A 4DFAA 1QVFA 2UXCQ 4LF9Q 3S1MB 4LNQA 5M3MG 2OCEA 4XQJA 5D3IB 2CVRA 1EFID 1QVCA 2NWGA 4A3CG 3K8AA 1LYLA 4DR3Q 5BR8L 2K5NA 4V0BA 4K5XA 1AN8A 1EYGA 4NKLA 1HFGA 2WV6D 2WKDA 1CKMA 3SE0A 2HCIA 3A55A 4DKAC 1EIHA 2R3ZA 3R2TA 2KECA 1MJCA 2M9VA 3OMCA 1VQ5A 3X3MA 1Y1VH 4EQOA 1KTKA 3CCEA 1ML0D 1SN8A 2UUCQ 4LK1C 1X3PA 2A5HA 2YTVA 2XWBB 3A7LA 2NVQB 1D6EC 1BDOA 3EA6A 1A3UA 1RODA 5AJ3L 2XNAC 1STBA 2F0KA 1R4QB 1ENFA 2B63G 5AFWA 3HKZB 4GKJQ 5CR3A 3RN5A 3K81C 3F2DA 5C4XG 3A8KE 3T53B 4L63B 3N52A 1JT8A 1BOSA 3CQZB 2K33A 3TREA 4ZLTF 4L5SA 1SYCA 1K0SA 1N36L 1IBLQ 3Q6SA 2O2LD 1OXSC 4PG3A 4DUZQ 1PHJA 4IOCA 4GLVB 3I4NB 4X66L 3CKIB 2ATWA 1GJXA 1EQTA 2M00A 2IW3A 4HSPA 3EJIA 4RGMA 5I9PA 2I5MX 3KF6A 3U4ZA 3PGZA 1G8ZD 1MD2D 4HTHA 2LY7A 2NN6I 1I50B 2K14A 2NTSA 1G6ZA 1TR5A 5EBDA 3M7NA 1VQ7A 1H9MA 4DNIA 4JYAL 3G71A 5CYUA 2PI2E 1Q81C 4RKBA 3J80E 2R93H 4OEMB 1YNJD 5C44H 3S2HB 3A8IE 1CFMA 1KL9A 3FP9A 1EWIA 2Z9HA 1FGUA 4KKUA 4ODGA 1ILPA 1GUTA 3J80c 1F2YA 1SYEA 1Y1VB 2B2UA 1PA6A 4F88A 3PO2H 1WTQA 2QEJC 3CPWA 1SYGA 2J4XA 1WTWA 3E9IA 4OWWB 1PFMA 3GO5A 4P71A 1YNND 4X62L 4JV5Q 2A6HC 2SNSA 5FJ8G 4UDUC 5M9OA 2OTJA 2HUGA 2MUYA 4OX9L 3DMUA 3SXHA 5LL6S 4OONA 4ZKBB 3HS0C 4RGNA 3K57A 4HCEA 4UP8A 1ET6A 4X6AH 1CA5A 1K73C 2JJQA 3MZ5A 1VQGA 4B3ML 5IODA 1QZHA 2HIVA 3R8BA 3L2PA 4ALPA 1EYDA 2CHBD 4KKSA 3B6YA 2QF7A 1GOZA 1IL2A 2PNRC 5ELOA 1S4ZA 2EJMA 3GTQH 1N9WA 4JI4Q 5C4ZA 1XNRQ 1EY0A 2RCNA 3FKIG 3MVVA 4HIKA 1QZGA 4C2MH 1HFNA 2Q2HA 3A8JE 1RIPA 1E1TA 2UXCL 4LF9L 2G9HD 4MTNA 1LTRD 2LS01 1WYDA 3HOZB 5GQOA 5ELBA 1SAPA 3W5OA 4DR3L 5M3FB 2V4DA 3CP0A 3MTSA 1Q90A 1LT6D 4A93H 3CRLC 1YVCA 5G3LF 2JEAI 3NBHB 1GUOA 4MZ9A 1EYAA 1UWVA 3NP8A 4TVAB 4WORA 4HIDA 1SDFA 4XT3B 3EVQA 2NVXH 4LFCQ 3ULJA 4IPDA 2EIFA 3DXJC 5J1ZA 1NCVA 4KLKA 1TWFH 1R9TH 4ZAIA 2UUCL 2QCPX 3NK9A 3I4MG 3NTKA 5KEEA 5C44B 4DXGA 4AYBG 2E76C 2XSCA 4LMQD 4QCLA 2SOBA 5CV4A 2YTYA 1ILQA 2FFKB 4K2KA 2F0VA 1B53A 2D5DA 1JB3A 3Q8DA 4XQNA 1STAA 5FLXE 1ONLA 4AQYQ 4IUNA 3E9HA 4RGTA 3ND9A 4X64Q 4GKJL 3ND8A 2E2DC 4GOPC 3UDXA 2R7ZG 1B70B 1B50A 3A56A 4QL5A 3VR6A 5FLXc 5LMUQ 4CKBA 4CDFC 3BJUA 1SNOA 3NPPA 1VQDA 1IBLL 1Q7YC 2EVBA 4DV6Q 1YJWA 3C1EA 4DUZL 4A3JH 3NXWA 2O5JC 2L5TA 1BXTA 2GVBA 2EDGA 4X65Q 5EKLA 1FD7D 4A3EB 4JI0Q 2F0HA 4QIWE 1I94Q 3PUZA 3N6RA 3GTQB 5IP9G 3SK4A 4G57A 2NVTH 1Q8IA 4C2MB 2PZWA 2OT2A 3H09A 1ENCA 4PMBA 3F2UA 3UE1A 3S24A 1HZAA 3VA5A 3HOXG 1L2FA 3S2DH 5EPJA 2EJFC 1V1PB 3QJYA 1HQRD 3DWQA 1X54A 4EQPA 1FNWA 1SYDA 1XWEA 2RSNA 3PSIA 4OHJA 2NN6H 2RDGA 4G7ZC 1N34Q 4M8AA 5DAUA 4LFBQ 5JVH3 3S1QH 2NVXB 3TS0A 5FLMG 5NUCA 1A3VA 4IJLA 3BVMA 1S5ED 4C3HG 3QB3A 4DV5Q 4MIUA 3KF8A 1TWFB 1DJRD 2WP8J 1M1KC 1G91A 1Q86C 3DWPA 2KENA 3A0JA 2EJGC 4A3MG 3DHQA 5DLQE 2VXWA 1SE8A 3STBC 3J81c 4JV5L 4RCNA 4A3IH 3NENA 1U5KA 3IL8A 4DAYA 2EE1A 3HKSA 2OQKA 2JA6G 1BUVT 2Z6KC 4WRDA 1QJOA 4CHTB 5M5XH 2EXZA 2QKIC 1Q3LA 5C5LA 3KOJA 1LTLA 1C0AA 3PIP3 4KJNA 2I5HA 3OYYA 3JAMc 4BY7H 4LJZC 1VQKA 2F0JA 3M3YB 4JI4L 4IO9A 5LHY1 1XNRL 4BY1B 5IGEA 4FDBA 2EXDA 1AZPA 2G5DA 2OEOA 3JC66 4WJWA 3GTPH 1S5FD 2IT1A 1QWYA 4A3JB 4KD4A 2PCFB 3AQQA 1LTSD 1DM0B 4RMFA 1PMRA 4GZYC 3ITPA 4DU9A 3H3VC 1F9RA 4R4QA 3S14B 2MJ8A 3HP3A 2B3GA 2NVTB 1SFOB 5IYDH 1EL0A 1K3BC 1I4GA 4LFCL 4DK6C 1TT2A 1D7QA 3ZYYX 2NTTA 3K5LA 5CBEE 1EUJA 4ILWA 2WACA 3M4OH 1UE7A 4RHSA 1LACA 2PYKA 3VR3A 4DV3Q 1NR4A 4KHPQ 2KCCA 3RLFA 3H91A 1VQAA 4DXFA 3AFQA 3D3RA 5EAYA 1Y69U 4DN4M 1HNWQ 5F2DA 2CWPA 3BDOA 2BCOA 3S1QB 1O7IA 2Z1CA 3H0GG 2RDHA 3FPPA 3KLWA 4AQYL 3EIVA 3IRBA 3Q0AA 1VQOA 4X64L 2F1MA 4QF4A 2KJXA 1KABA 3I90A 3J7A5 2EYPA 2JA8G 4V190 5EBCA 4HJ8A 5FO8B 3GTJH 4A3IB 1WVLA 1EZ8A 3NE5B 4CDCC 2A68C 5LMUL 4WFN3 3LGJA 1AW7A 1CKNB 1CQVA 3QWNA 3I4LA 4A3KH 1VMCA 3NQIA 4DR6Q 2WFWA 4A76A 1F9QA 4DV6L 4IALA 3OTOQ 4AYBE 1PFBA 4LF8Q 2EY5A 4K8IA 4FF3A 3OHXC 4JI0L 4X65L 1I94L 3GTMH 4FF2A 5LMNW 4UAIA 1TWHH 4IUTA 4JOIA 4MNOA 3GTGB 2JE6I 1W6JA 1JORA 3H94A 3OPOA 3EFXD 4UPAA 5BR8Q 3CAMA 2Y0SB 2QA4A 2RHSB 1G291 4UY8C 1OXTA 1FJGQ 1KAAA 4RAUC 3I91A 1M8AA 2KCMA 3NUCA 1IXRA 4JI7Q 3ER0A 1N34L 4LFBL 4EVOA 3QIAA 4KY6A 4PQXA 1JICA 1X55A 1WCMH 4GN4B 2R6GA
chains in the Genus database with same CATH topology
5C0XG 3M4OB 3J80L 2YU9B 3KLSA 5CV7A 3T13A 5IGFA 5COYA 3QO2A 4IUVA 1L0XB 1U4PA 2K1BA 1K83B 1KNAA 2KVMA 4X3UA 1KDAA 4OO1G 5KIXA 1AP0A 2CW0C 2ENBA 3FDTA 4QUFA 2NYZD 1MBYA 2A69D 4FF4A 1IW7D 3PUYA 1PZID 2QDBA 2ZXOA 3W2DA 4FXDA 3GTMB 1BCPC 1H9JA 1STYA 2GA4B 1TWHB 3D6CA 3DEOA 4KY5A 3OWFA 3NBHA 3G6JB 4B08A 2O5IC 1PRTC 1TS4A 1EY8A 3OIPA 5ELCA 3C3LA 5K5PA 3PUWA 4Q0FA 5I6WA 5EJWA 1CI3M 4BA2I 3P7JA 1O7LA 4A3FB 3GTOB 5E4WC 1NSNS 3Q23A 1ZKOA 3CU7A 4A3DB 5FLXL 5CC4A 1SE4A 1Z6HA 1I4RA 2B2YC 3K0YA 2Z8LA 3HOVB 5CV8A 3BYTB 2DNEA 1Q12A 1CZWA 2HDMA 4C3IB 1FYCA 1SJED 2DN8A 3GP7A 3TZUA 2NVYB 5BN5A 2F0MA 4C1NK 2I07B 4IUUA 2ZT9C 1QNUA 3BZDB 4XIGS 4Q5VA 3KBXA 4DA2A 1IYVA 1BNZA 1HPCA 5C0XJ 3TBIB 3K59A 1JE4A 2MHVA 2A6ED 5JJZA 4EGVA 5FOBB 1PYWD 3R2IA 2TMPA 3GD7A 4R8NA 3BDCA 1V1PA 2KCNA 1I4QA 1TU2B 3NWTA 1BR9A 3QOJA 3M4YA 4KN4C 1EZ6A 2F0PA 1I4HA 4DNTB 1HA5A 2RQXA 1LO5D 3NWSA 5FKAC 1RDPD 1VDZA 3J81L 4TQUS 4IFDI 5KNDA 4NMZA 1EU4A 1IL8A 1QB5D 3OIQA 2F0QA 1A3TA 1U4MA 1WTVA 5A35A 1QG7A 3O13A 5A2QL 1ESRA 1DOMA 1ICWA 3JAML 1I4PA 1WTRA 2NBFA 1BBXC 3I72A 2M2LA 2F0WA 1HUNA 3RD4A 1AFPA 5G3LD 3VYUA 1EOTA 2ZXPA 3T56B 4C3JB 3A7AB 1GHKA 1IKMA 2BA0A 1TS5A 2L12A 3UI2A 4HAEA 5M3MB 1FNVA 1J8IA 3RMHA 1SMYC 2AQ1B 5EPLA 2E2JB 1DZ1A 4KN7C 4H7BA 2I46A 5D14A 5TSSA 1LT3D 3PMFA 2X6LA 2K5DA 4RKLA 3E6ZX 3S16B 1XXGA 3C2PA 2J0TD 1JWSD 2L9HA 4HCSA 2EYJA 1EQVA 4C56C 4QIWB 4IUPA 2IX0A 1G2TA 2B63B 3SK8A 3ERQA 1PFNA 2B2VC 4J1MA 4CKEA 1SE2A 4DK0A 1EY6A 3KLRA 1C8CA 4KMUC 2E2HB 5C3WA 1H9KA 1EY9A 5CV5A 1LTBD 4ZUJA 2DNCA 4CGYB 2B2WA 3K58A 3RUZA 2PZUA 2F03A 3S1NB 1ZYRC 3FRPB 3HRZC 5IGDA 4F87A 1LT5D 1TS2A 3PV0A 2KUMA 1TY2A 3OSOA 4H0LC 5JAVA 3TMEA 2L11A 1STGA 2PZTA 3V96A 1JQYD 3QOLA 1SJHD 3AMUA 2IJ0A 1T5EA 3E5SA 1TIID 3T16A 2B2TA 3G7LA 3D4RA 4XDXA 3BYYB 2F0OA 1CQFA 5BN3A 4FXGC 4HSVA 1EEID 2PW5A 3T4AC 3MXNA 3Q22A 5J22A 4IFDH 2SEBD 3L3OC 5DEHA 4DGZA 4F7XA 1SNPA 5K36G 4K5VA 5I2XA 1FGBD 3MA2B 3FKIB 3TP6A 2ZXRA 1O80A 4IQZA 3ONAB 4NDXA 2FINB 3C1FA 3LWUA 1RTOA 2K7VA 4BA1I 4K6DA 1S5BD 1XTCD 4TSSA 3M85A 1F9SA 1E2ZA 5JEAH 1UNSA 1I4XA 5M5WB 4O42A 1PRTF 3HOWB 1HTLD 1LABA 3J81E 1RHPA 3OW7A 1JC7A 2AQ3B 2YYZA 1TWGB 1V1OA 1Y8OB 1PTOF 4AYBB 1TWCB 1U4LA 2F0IA 3HZXA 2NUCA 3LWEA 5A2QE 3RZOB 3JAME 1V8QA 4QB4A 1MI2A 1DOLA 2NN6G 2NB0A 3MXPA 2EOTA 3GQBA 2ICIA 2F0TA 2R7ZB 2F0UA 1QNKA 3T51B 1L0YB 4N9PA 4C1NI 3K5MA 2N55A 2KEDA 5CGKA 3FEWX 2F0NA 1FR3A 3M7GA 1LT4D 2EPBA 4RHRA 2TSSA 5E3FA 3PUXA 5CBAE 3NQTA 4P2CB 2WIIB 4NW2A 4HEDA 2MPMA 5JOBA 2IX3A 3HOXB 4IURA 5DM73 2A6HD 4OGQC 1XX8A 1ZEQX 5E4XA 3NSWA 1TWAB 4KK7A 4RWSC 5BN4A 3OWEB 2B2UC 4DF7A 1T5XD 1GXDC 4R8IA 5CORA 1PXUA 4C3HB 5C3XA 4CJ0B 2AQ2B 4A3MB 4CBVA 4ABNA 4DK1A 2JA6B 1O7ZA 2A6EC 1IYUA 2D9UA 4KY7A 5CMDA 1WTOA 5M5YB 5I9OA 2D62A 4RA8A 2AWOA 4A3GB 2EYMA 3EROA 4HR7B 1ZXTA 1D5XC 1SYFA 3HEJA 5ELEA 3FPUB 2Z4HA 2A74C 2JEBI 4ID6A 1ENAA 2FJ2A 3C46A 2RDFA 4OIJA 3J7AV 3IFDA 5KGUA 4A3BB 3I8ZA 2ID0A 1B2TA 3MWYW 3MXUA 3BVZA 5EKIA 1NR2A 4IN3A 1F9PA 3KLSX 2B8FA 4L6TB 1VF7A 2EYHA 3H0GB 4TKOB 5DNFA 3LNNA 2L1BA 1DD2A 2JA8B 2XRQD 1PTOH 2F0DA 2OF1A 1HUMA 4XXEA 4QUCA 2EY6A 4CJ2C 3E0JA 1YNJC 3D31A 1G2SA 1A15A 3DEPA 3K7AB 2PMZB 2EZVA 3P75A 3TDQA 1STHA 2F0FA 3RZDB 1F77A 1C4QA 1DXMA 2F0EA 2IL8A 2JSOA 4FYDA 3QG1A 1YNNC 3FMCA 1TVXA 3S17B 2KEEA 2E74C 4S3SA 3MHBA 1OXUA 1STNA 4J8QA 1LV9A 1BCPB 2VB2X 1S5DD 2SNMA 2K28A 5IGGA 1EWCA 3OMGA 1JR0D 1UEAB 5I4DA 4B9WA 3PUVA 4RH6A 4CKCA 1D1IA 1PRTB 1ESFA 3P1HA 4X3SA 2LKVA 3FVQA 3VR5A 1WTXA 2JA5B 1A2UA 3S15B 1PTOB 4KI0A 3SVMA 3GTKB 2C9OA 3IKJA 1NUCA 4KHZA 3KBGA 3MFGA 1X3QA 5FO9B 2BE5D 4RCOA 3HOYB 2K5QA 2HCCA 2AWNA 3MFYA 5I2YA 5C4HA 5C4JB 3L9AX 2EYFA 4H44C 3W3AA 3MAQA 5EGTA 4ZK9B 4XQQA 1EY5A 3L7ZC 3SR1A 2H1EA 4G7HC 2A68D 1GUWA 2HQEA 5KYIA 2K5WA 1QCBD 1RF2D 4OL7A 3PIO3 1HQMC 2K04A 3CHBD 1R4PB 1D5MC 1E2WA 4ZRZA 3WDNA 2F0LA 3TSSA 4KV6A 3KUPA 1EU3A 4HMJA 1CZGA 1PLFA 4BWGB 2KHSA 4QMGA 4XT1B 1JOQA 3BVGA 1FNUA 1EEFD 4KTAA 4I7ZC 2N88A 5FO7B 3CRKC 1O78A 2K32A 2AUKA 2WINB 4KJOA 3GTLB 3URYA 4DAPA 1KLUD 1S5CD 2NZ1D 4PV1C 1Y8NB 1I6HB 5IT9L 1C48A 3AB9A 1JWMD 2VUMB 1E0BA 2R92B 3MC0B 3TP5A 3IFTA 1PZJD 3GV6A 1LTID 4KKTA 1KNEA 2WKCA 4JK1C 1D1KA 1W6KA 4BBRB 1OXVA 1A6XA 3VYTA 2RA4A 2FHTA 2LFNA 4M1UB 1RJTA 3VA7A 1B4OA 2BDNA 3BG3A 2R61A 3DUZA 2CW0D 3PO3B 1MSGA 2Z4IA 3GV3A 4IUQA 3TZDA 4E6IA 4MHEA 1WTPA 1CA6A 4RFBA 5C4XB 1VCIA 3V05A 1BCPD 1TKWB 4DNRB 3X3NA 1K8MA 2X6GA 2IPKD 3U9OA 1B3AA 3A54A 1Q1EA 5HURA 1AEXA 1CK1A 4IZ8A 2L55A 1PRTD 4XYOA 1AZQA 1H9RA 4MN3A 5CV6A 4ZUIA 1TY0A 2F0SA 1PTOD 3TP8A 4K2LA 4FXKC 4ZYSA 1HTPA 1HHVA 3U9SA 4FF1A 2F0GA 1II3A 1DOKA 2KA7A 5DM63 4FO2A 1IHZA 2XRSD 4U68A 1ET9A 2KOLA 4KHVA 1O7YA 4KD3A 1GHJA 1MGSA 3R3OA 3SK5A 2G9DA 2XWJB 3BS1A 4J6HA 4R9WA 5T1IA 2B8GA 2R93B 1Y1WB 1EIGA 1OO9B 2BDOA 1VF5C 3HG9A 4XTCS 5KNCA 2CQAA 2Q8TA 3K5OA 5C6AA 5K36H 2WB1B 5KRUA 3TP7A 2EY2A 3PO2B 1CM9A 2SDFA 1X32A 1SNMA 1V43A 1OXXK 1PDQA 2H4OA 2IX1A 1BCPF 2B39A 1D2BA 1B9MA 1Z7TA 4FVMA 5C0XI 3D4DA 4ZKCB 4IFDG 1DONA 2MGSA 3OOCA 1EWHA 1GUGA 1EY7A 1Z47A 5JVG3 4HN7A 1H9SA 1CT1D 1NAPA 3MEHA 4G4KA 3SK6A 1STEA 3I4MB 2FMMA 4O1NA 1LTTD 3NTIA 4B9XA 4K8JA 4K5WA 2A69C 4OO1I 1RTNA 4A93B 5JEAG 5EQ0A 1IW7C 3J7YW 3VYSA 5D3DA 1CHPD 2EYLA 1R9TB 1J9OA 2D2CC 3VYRA 4RGOS 1LLRD 3J7AF 4Y7NB 4Z9CB 1SMYD 3WOFA 2JA7B 2E2IB 2LMCB 2BA1A 3P20A 1DYQA 2RVLA 4X3KA 2Q8RE 1JCKB 3I70A 5IT9E 1IKLA 5IGCA 3VR4A 2VB3X 2PPBC 2RKSA 4ULLA 1SEBD 1VMPA 1A2TA 2B2YA 2Q8IB 3NHHA 5CV9A 1CHQD 3AU7A 1HRJA 5JPNC 1SNQA 5T1GA 1WD1A 3S9WA 1EY4A 1B1ZA 4JBWA 3K5NA 3SHLA 4EQNA 1SE3A 5ELFA 2MP1A 3S2DB 3TN2A 1PZKD 4FNFA 5EPKA 5J39A 2ICEC 1MSHA 4CJ1B 2KQ3A 4U673 1EYCA 2BE5C 3V2TA 1KDCA 4IFDJ 4H13C 2A73B 3SEBA 2EY1A 1RD9D 4BS9A 2K01A 1UUPA 2PQEA 5I6YA 3DWAA 4HMIA 1ZYRD 1SYBA 3SDZA 2X69A 2QILA 4L8JA 3I3CA 2K6AA 1I3QB 4K14A 5IOCA 3R93A 5M5XB 2K05A 1WD0A 2B2WC 2XVSA 2DY7A 5KYLA 4N9TA 5ISRA 2F4IA 4BY7B 5JEAJ 1GUSA 1QE6A 3GTPB 1SSOA 5C0XH 4I65A 1SBBB 5E1FA 5EKKA 4ME5A 2J7ZA 4X3TA 1B44D 2AUJD 2HDLA 5HGTA 2B2TC 1UAPA 1LTGD 3IAYA 3VR2A 4TRDA 2O4XA 3K6OA 1QOHA 3KK7A 2PW7A 2C5CA 2XN9C 2EYOA 1B9NA 1CTMA 3EQLC 4OO1H 4NP5A 3I73A 3MXGA 3D6WA 3Q24A 4OIKA 1BF4A 3DM1A 5FK9C 3D8GA 1D5ZC 1QILA 4PMWA 1KDBA 1JWUD 1TS3A 1LTAD 2E75C 5JPMC 3GTJB 1RKNA 1F2ZA 2F3WA 3D4WA 4C3IG 2B2VA 2FMCA 1RCVD 5C5MA 4A3KB 3LX0A 4ZQ3A 3NTHA 1U4RA 2RBMA 1XYIA 1M4VA 5KNBA 1GUNA 2OXPA 4LAAA 2L0CA 2DY8A 2JYOA 1H9SB 1HA6A 2JP1A 4DAVA 1K8OA 2WAQB 2XIWA 3H6MA 1Q1BA 3NBIA 1DCZA 4PNYA 1HXYD 4YIJA 2VNUD 1E2VA 3BDLA 4XYQA 2IWHA 3HOUB 1SNCA 5IIFA 4FP5D 1TQOA 1SNDA 1U9RA 2JXMB 1JOKA 1BQQT 1Y8PB 5IGBA 3WOEA 1I6VC 1WCMB 1PTOC 2K03A 5LL6X 5D65A 1F2LA 2RSOA 4G7OC 2L4NA 4PMCA 3HGBA 2F3VA 5ELDA 4F8MA 1SXTA 1JOOA 4BBSB 4K6LA 1BO0A 5C3EB 2BOSA 4C3JG 3S1RB 1HCZA 1F2MA 2PO4A 1KLGD 4DFAA 3S1MB 4XQJA 5D3IB 2CVRA 1EFID 2NWGA 4V0BA 4K5XA 1AN8A 4NKLA 1HFGA 2WV6D 2WKDA 3SE0A 2HCIA 3A55A 1EIHA 2R3ZA 3R2TA 2KECA 2M9VA 3OMCA 3X3MA 4EQOA 1KTKA 1ML0D 4LK1C 1X3PA 2A5HA 2XWBB 3A7LA 2NVQB 1D6EC 1BDOA 3EA6A 1A3UA 1RODA 2XNAC 1STBA 2F0KA 1R4QB 1ENFA 5AFWA 3HKZB 5CR3A 3A8KE 3T53B 4L63B 3N52A 1BOSA 3CQZB 2K33A 4ZLTF 1SYCA 3Q6SA 2O2LD 1OXSC 3I4NB 3CKIB 1GJXA 1EQTA 2M00A 2IW3A 4HSPA 3EJIA 4RGMA 5I9PA 1G8ZD 1MD2D 4HTHA 2LY7A 2NN6I 1I50B 2NTSA 1G6ZA 1TR5A 5EBDA 3M7NA 1H9MA 5CYUA 4RKBA 3J80E 1YNJD 3S2HB 3A8IE 1CFMA 4KKUA 4ODGA 1ILPA 1GUTA 1F2YA 1SYEA 1Y1VB 2B2UA 4F88A 1WTQA 2QEJC 1SYGA 2J4XA 1WTWA 1PFMA 3GO5A 1YNND 2A6HC 2SNSA 4UDUC 5M9OA 2HUGA 2MUYA 3DMUA 3SXHA 5LL6S 4ZKBB 3HS0C 4RGNA 3K57A 4HCEA 1ET6A 1CA5A 3MZ5A 5IODA 3R8BA 1EYDA 2CHBD 4KKSA 2QF7A 1GOZA 2PNRC 1S4ZA 2EJMA 5C4ZA 1EY0A 3MVVA 1HFNA 3A8JE 2G9HD 1LTRD 2LS01 3HOZB 5ELBA 1SAPA 5M3FB 2V4DA 3MTSA 1Q90A 1LT6D 3CRLC 5G3LF 2JEAI 1GUOA 1EYAA 3NP8A 4WORA 1SDFA 4XT3B 3EVQA 3DXJC 5J1ZA 1NCVA 4ZAIA 2QCPX 3NK9A 3NTKA 5KEEA 5C44B 4DXGA 2E76C 2XSCA 4LMQD 4QCLA 2SOBA 5CV4A 1ILQA 2FFKB 4K2KA 2F0VA 1B53A 2D5DA 1JB3A 4XQNA 1STAA 5FLXE 1ONLA 4IUNA 4RGTA 3ND9A 3ND8A 2E2DC 1B50A 3A56A 3VR6A 4CKBA 1SNOA 3NPPA 2EVBA 3C1EA 3NXWA 2O5JC 2L5TA 1BXTA 2EDGA 5EKLA 1FD7D 4A3EB 2F0HA 3PUZA 3N6RA 3GTQB 3SK4A 4G57A 1Q8IA 4C2MB 2PZWA 2OT2A 3H09A 1ENCA 4PMBA 3F2UA 3VA5A 5EPJA 2EJFC 1V1PB 3QJYA 1HQRD 3DWQA 4EQPA 1FNWA 1SYDA 1XWEA 2RSNA 4OHJA 2NN6H 2RDGA 4G7ZC 4M8AA 5DAUA 5JVH3 2NVXB 5NUCA 1A3VA 3BVMA 1S5ED 4C3HG 3QB3A 4MIUA 3KF8A 1TWFB 1DJRD 2WP8J 1G91A 3DWPA 2EJGC 3DHQA 2VXWA 4RCNA 3IL8A 4DAYA 2EE1A 1BUVT 4WRDA 1QJOA 4CHTB 2EXZA 2QKIC 1Q3LA 5C5LA 3PIP3 4KJNA 4LJZC 2F0JA 3M3YB 5LHY1 4BY1B 5IGEA 1AZPA 2OEOA 4WJWA 1S5FD 2IT1A 1QWYA 4A3JB 4KD4A 2PCFB 1LTSD 1DM0B 1PMRA 4GZYC 3ITPA 4DU9A 3H3VC 1F9RA 3S14B 2MJ8A 3HP3A 2NVTB 1SFOB 1EL0A 1I4GA 1TT2A 3ZYYX 2NTTA 3K5LA 5CBEE 4ILWA 2WACA 4RHSA 1LACA 2PYKA 3VR3A 1NR4A 3RLFA 2KCCA 3H91A 4DXFA 3D3RA 1Y69U 4DN4M 5F2DA 3BDOA 2BCOA 3S1QB 2Z1CA 2RDHA 3FPPA 3Q0AA 2F1MA 4QF4A 2KJXA 1KABA 3I90A 2EYPA 4V190 5EBCA 5FO8B 1WVLA 4A3IB 1EZ8A 3NE5B 2A68C 4WFN3 1AW7A 1CQVA 3QWNA 3I4LA 1VMCA 3NQIA 1F9QA 4IALA 1PFBA 2EY5A 4K8IA 4FF3A 3OHXC 4FF2A 4UAIA 4IUTA 3GTGB 2JE6I 1W6JA 1JORA 3H94A 3OPOA 3EFXD 2Y0SB 1G291 1OXTA 1KAAA 4RAUC 3I91A 1M8AA 3NUCA 4EVOA 3QIAA 4KY6A 4PQXA 1JICA 2R6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STN A;  1EYC A;  2F0L A;  5CC4 A;  3ITP A;  3MEH A;  4ODG A;  5CV6 A;  4DU9 A;  3OSO A;  2F0U A;  4KV6 A;  1F2Y A;  1RKN A;  1F2Z A;  1SYE A;  2F3W A;  4N9P A;  3D4W A;  1SNO A;  5CV7 A;  4ZUI A;  3T13 A;  3TME A;  2SNM A;  4ID6 A;  3V2T A;  5IGF A;  1KDC A;  5CV8 A;  1STG A;  2PZT A;  4K5X A;  1SYG A;  3HEJ A;  1ENA A;  4HMJ A;  3QOL A;  5C5M A;  3C1E A;  4B9X A;  5CGK A;  4NKL A;  2F0S A;  4K8J A;  4K5W A;  5IGG A;  3LX0 A;  2F0N A;  2KHS A;  2RDF A;  3E5S A;  3NXW A;  2EY1 A;  3OMG A;  4ZQ3 A;  4K2L A;  4QMG A;  3T16 A;  1TT2 A;  2RBM A;  3TP8 A;  5KGU A;  1JOQ A;  2SNS A;  4KTA A;  5M9O A;  2PQE A;  2WAC A;  2OXP A;  2F0O A;  5I6Y A;  5EKL A;  4HMI A;  3DMU A;  4LAA A;  2F0H A;  3SXH A;  2F0M A;  3OMC A;  1SYB A;  4H7B A;  4B9W A;  4EQO A;  3P1H A;  2PYK A;  3SK4 A;  4G57 A;  2KQ3 A;  2LKV A;  3H6M A;  5E3F A;  2PZW A;  2F0G A;  1ENC A;  3PMF A;  4KJO A;  2PW5 A;  1II3 A;  4PMB A;  4K14 A;  3MZ5 A;  5IOC A;  4RKL A;  2EYL A;  3NQT A;  5IOD A;  1IHZ A;  5F2D A;  4PNY A;  3VA5 A;  1A3U A;  5J22 A;  1KDA A;  4YIJ A;  1A2U A;  1EYD A;  5JAV A;  3BDL A;  5KIX A;  4KHV A;  5DEH A;  4KD3 A;  2EYH A;  5JOB A;  2ENB A;  4DGZ A;  4F7X A;  1STB A;  1SNP A;  2F0K A;  4N9T A;  5KYL A;  5ISR A;  5C4Z A;  4R8N A;  1EY0 A;  1SNC A;  3BDC A;  3MVV A;  3R3O A;  1KAB A;  1NUC A;  4QF4 A;  3TP5 A;  3SK5 A;  2EYP A;  4K5V A;  1SYD A;  5IIF A;  2EYJ A;  4EQP A;  1EQV A;  5CR3 A;  4J6H A;  3TP6 A;  1EZ8 A;  5DAU A;  3QOJ A;  1TQO A;  3SK8 A;  2F0D A;  5NUC A;  1EZ6 A;  1SND A;  1U9R A;  2OF1 A;  4NDX A;  3C1F A;  1A3V A;  3ERQ A;  2QDB A;  4I65 A;  5E1F A;  2F0P A;  5IGC A;  4J1M A;  5EKK A;  4DF7 A;  1JOK A;  4ME5 A;  3QB3 A;  5IGB A;  4MIU A;  1STY A;  1SYC A;  2RKS A;  4K6D A;  4IAL A;  5HGT A;  2EY6 A;  1A2T A;  3D6C A;  5C6A A;  5C4H A;  3DHQ A;  1EY6 A;  1EYA A;  3NHH A;  3NP8 A;  5CV9 A;  4KY5 A;  2EYF A;  4WOR A;  2EY5 A;  3OWF A;  3TP7 A;  5C3X A;  5KRU A;  2EY2 A;  4K8I A;  4TRD A;  3EVQ A;  2O4X A;  4PMC A;  5EGT A;  4NMZ A;  2M00 A;  5J1Z A;  5C3W A;  3P75 A;  3EJI A;  1EY5 A;  2F3V A;  3SR1 A;  2F0Q A;  2PW7 A;  4WRD A;  1SNM A;  4F8M A;  1EY8 A;  1A3T A;  1STH A;  1SNQ A;  2F0F A;  4E6I A;  5I9P A;  3NK9 A;  2EXZ A;  2EYO A;  5K5P A;  1JOO A;  1EY9 A;  4HTH A;  5KEE A;  5C5L A;  5CV5 A;  3S9W A;  4KJN A;  5I6W A;  1JOR A;  4ZUJ A;  2SOB A;  5CV4 A;  2HQE A;  4KY7 A;  1TR5 A;  1EY4 A;  2F0E A;  4K2K A;  4NP5 A;  3D4D A;  2F0J A;  5KYI A;  2F0V A;  5I9O A;  2F0W A;  2F0I A;  3SHL A;  1STA A;  3HZX A;  2NUC A;  1KAA A;  4IUN A;  5IGE A;  4RKB A;  4EQN A;  3U9O A;  4OL7 A;  2OEO A;  3RUZ A;  2PZU A;  2EYM A;  3ERO A;  3NUC A;  3SK6 A;  4QB4 A;  1F2M A;  5J39 A;  5HUR A;  4DFA A;  1AEX A;  5IGD A;  4IZ8 A;  4S3S A;  1EY7 A;  4KD4 A;  4EVO A;  4KY6 A;  3D8G A;  3MXP A;  3MHB A;  1NSN S;  1SYF A;  2F0T A;  1KDB A; 
#chains in the Genus database with same CATH topology
 5C0X G;  3HOU G;  3M4O B;  4DV5 L;  3J80 L;  2YU9 B;  4L5T A;  3KLS A;  5CV7 A;  4HJ5 A;  4JCV E;  1PH1 A;  3T13 A;  4L5R C;  5IGF A;  4A3F H;  5COY A;  2XTI A;  3QO2 A;  4IUV A;  3GTO H;  1JJG A;  1PH7 A;  1L0X B;  4BBS H;  1U4P A;  2K1B A;  1K83 B;  3WWV A;  1U0L A;  3MXN B;  1L1O B;  1KNA A;  2JA5 G;  1PH6 A;  2EQS A;  3KJP A;  2KVM A;  3QR8 A;  4X3U A;  1KDA A;  2NVY H;  3S1R H;  4OO1 G;  5KIX A;  3ICE A;  1AP0 A;  4NXN Q;  2CW0 C;  2ENB A;  3FDT A;  4QUF A;  2NYZ D;  1MBY A;  2A69 D;  1E7Z A;  5H1S E;  1WOC A;  2AMC B;  4FF4 A;  2DUD A;  1IW7 D;  3PUY A;  1PZI D;  1LM0 A;  2QDB A;  2ZXO A;  1Q8K A;  3W2D A;  4FXD A;  2K5V A;  3GTM B;  1BCP C;  5C3E G;  1H9J A;  1STY A;  2GA4 B;  1TWH B;  5GRO A;  1BKB A;  3D6C A;  3DEO A;  4KY5 A;  1A0I A;  3OWF A;  2JQO A;  3NBH A;  1Q46 A;  3G6J B;  4B08 A;  1P8L A;  2O5I C;  4DV3 L;  1PRT C;  2NVQ H;  1TS4 A;  4JBJ A;  4KHP L;  1SLJ A;  1EY8 A;  3OIP A;  5ELC A;  3C3L A;  5K5P A;  2VW9 A;  1HNW L;  3PUW A;  4Q0F A;  3H15 A;  5I6W A;  1VQJ A;  1WTH A;  5EJW A;  1CI3 M;  4BA2 I;  3P7J A;  2Y0S E;  1O7L A;  5L37 A;  4A3F B;  4GLX A;  4DV4 Q;  4GNX C;  1KXL A;  1HNX Q;  3CQZ H;  3GTO B;  2NZH A;  5E4W C;  1A8V A;  1NSN S;  3W1B A;  3Q23 A;  1HZ9 A;  1ZKO A;  4WJ3 M;  3CU7 A;  4A3D B;  1CKO A;  5FLX L;  5CC4 A;  1FVI A;  4DR6 L;  3AYH B;  1VQL A;  1SE4 A;  1Z6H A;  1I4R A;  2B2Y C;  3E3X A;  3K0Y A;  3OTO L;  1VQ6 A;  2Z8L A;  3HOV B;  5CV8 A;  4IJH A;  3BYT B;  2AKW B;  2DNE A;  1Q12 A;  1CZW A;  4LF8 L;  2HDM A;  1H95 A;  4C3I B;  1FYC A;  1SJE D;  2VQF Q;  2DN8 A;  3GP7 A;  5GAD C;  3TZU A;  2NVY B;  3D0F A;  5BN5 A;  2F0M A;  1MJE A;  4C1N K;  2I07 B;  1I50 H;  4IUU A;  2ZT9 C;  1QNU A;  3CCL A;  3BZD B;  4XIG S;  4Q5V A;  3KBX A;  4DA2 A;  1IYV A;  1BNZ A;  1HPC A;  5C0X J;  3TBI B;  3K59 A;  1JE4 A;  3RLN A;  4A3L G;  1PH3 A;  2MHV A;  2A6E D;  5JJZ A;  4EGV A;  5FOB B;  2VUM G;  2R92 G;  1FJG L;  1PYW D;  4YCU A;  3R2I A;  3S2H H;  2TMP A;  3GD7 A;  4R8N A;  1YHQ A;  3BDC A;  1V1P A;  2KCN A;  3FHW A;  4HJA A;  4JI7 L;  4BBR G;  2PMZ E;  3AEV A;  1RL2 A;  1UE6 A;  4MTK A;  1I4Q A;  1TU2 B;  3NWT A;  1BR9 A;  3QOJ A;  3M4Y A;  4KN4 C;  1EZ6 A;  2F0P A;  2RCF A;  4B3T Q;  1I4H A;  4DNT B;  1HA5 A;  3PO3 G;  2RQX A;  1LO5 D;  3NWS A;  5FKA C;  1RDP D;  1VDZ A;  3J81 L;  4TQU S;  1ASZ A;  4IFD I;  5KND A;  4NMZ A;  1HZB A;  1EU4 A;  1IL8 A;  1QB5 D;  3OIQ A;  2F0Q A;  1EOV A;  1A3T A;  1Y1V G;  4K0K Q;  1U4M A;  1GD7 A;  1WTV A;  5A35 A;  4YY3 Q;  1QG7 A;  3O13 A;  1J6Q A;  5A2Q L;  1ESR A;  1DOM A;  1ICW A;  3JAM L;  2VS1 A;  1I4P A;  2E2H H;  1WTR A;  2NBF A;  4NXN L;  1BBX C;  2R7D A;  2K50 A;  3I72 A;  2M2L A;  2F0W A;  1HUN A;  3RD4 A;  1AFP A;  5G3L D;  3ZJY C;  3VYU A;  4YWL A;  1EOT A;  4RG1 A;  2ZXP A;  3HOZ H;  3T56 B;  4C3J B;  5IP7 H;  5M3F H;  3A7A B;  1GHK A;  1SMX A;  1IKM A;  2BA0 A;  1TS5 A;  2L12 A;  3UI2 A;  4HAE A;  4EX5 A;  5M3M B;  1FNV A;  3S1N H;  1J8I A;  1UE1 A;  3RMH A;  1SMY C;  2AQ1 B;  3RR5 A;  5EPL A;  2HD3 A;  1K28 A;  2E2J B;  1DZ1 A;  1S3O A;  4KN7 C;  3M4P A;  4H7B A;  3KFU A;  2I46 A;  5D14 A;  5TSS A;  1LT3 D;  3PMF A;  1VQP A;  2X6L A;  2K5D A;  4DPG A;  4RKL A;  3E6Z X;  3S16 B;  2E5L Q;  1GVP A;  1XXG A;  3C2P A;  2Q2U A;  2J0T D;  1JWS D;  2L9H A;  4HCS A;  4DV4 L;  2R93 G;  2EYJ A;  1IBM Q;  1EQV A;  1HNX L;  4C56 C;  4QIW B;  5C44 G;  3J81 i;  2BH8 A;  1VQC A;  4IUP A;  2IX0 A;  1G2T A;  2E8G A;  1NNX A;  1Y1W G;  2B63 B;  3SK8 A;  1EIF A;  4LUZ A;  3ERQ A;  1HZC A;  1PFN A;  1G51 A;  2B2V C;  4J1M A;  4CKE A;  1PH5 A;  1CKN A;  1SE2 A;  3G48 A;  1BBW A;  2WB1 G;  1YIJ A;  2ASB A;  4DK0 A;  3PO2 G;  2LXJ A;  1EY6 A;  3KLR A;  2VQF L;  4A3E H;  2IHF A;  1C8C A;  3JAM i;  4KMU C;  2E2H B;  5C3W A;  2C35 B;  1H9K A;  4DAM A;  1EY9 A;  1S72 A;  5CV5 A;  1QUQ B;  1LTB D;  4Y52 H;  4ZUJ A;  4JG2 A;  2DNC A;  4CGY B;  5E7N A;  3HOW H;  2B2W A;  4JI8 Q;  3K58 A;  4BXX H;  3RUZ A;  2PZU A;  4P75 A;  1VQ4 A;  2F03 A;  1ZYR C;  3S1N B;  1TWG H;  3FRP B;  3HRZ C;  5IGD A;  4F87 A;  1N8R C;  1LT5 D;  1TS2 A;  3PV0 A;  5J3B A;  2KUM A;  3RN2 A;  1TY2 A;  3G4S A;  4B3T L;  3OSO A;  3NEM A;  4H0L C;  5JAV A;  2HIX A;  3TME A;  2L11 A;  1STG A;  2NZO A;  2PZT A;  3V96 A;  1JQY D;  4A93 G;  1GKH A;  3QOL A;  1PH9 A;  1SJH D;  3AMU A;  2IJ0 A;  1T5E A;  1YHB A;  3E5S A;  1TII D;  3T16 A;  1YJN A;  2B2T A;  3G7L A;  3D4R A;  4XDX A;  3K80 C;  2K4K A;  3BYY B;  2F0O A;  4K0K L;  1CQF A;  2ZM6 Q;  5BN3 A;  3U50 C;  1B7Y B;  1E22 A;  4YY3 L;  4FXG C;  5IYC H;  4HSV A;  5GAH C;  1EEI D;  2PW5 A;  4YWM A;  3M3Y H;  2QDL A;  3T4A C;  3MXN A;  1L1O A;  4BY1 H;  3Q22 A;  1E1O A;  5J22 A;  4IFD H;  4LF7 Q;  2JA7 G;  2SEB D;  1P16 A;  3L3O C;  5DEH A;  2B29 A;  4DGZ A;  4F7X A;  1PYB A;  1PYS B;  1SNP A;  1PV4 A;  5K36 G;  3HFZ B;  1PVO A;  1V9P A;  4YCW A;  4K5V A;  4GLA C;  5I2X A;  1FGB D;  1D8L A;  2UXD Q;  3MA2 B;  4GOP B;  3FKI B;  1KAW A;  3TP6 A;  2ZXR A;  1O80 A;  3CMA A;  3S14 H;  4IQZ A;  3ONA B;  1SFO H;  4NDX A;  3LWU A;  2FIN B;  3C1F A;  4ZCK A;  3UDF A;  4DR7 Q;  1VQN A;  3HOX H;  1RTO A;  4DV2 Q;  2K7V A;  4BA1 I;  4K6D A;  1MKH A;  3TQY A;  1S5B D;  1XTC D;  4LUV A;  4TSS A;  2QEX A;  1TWA H;  3M85 A;  1F9S A;  4A3J G;  1E2Z A;  5JEA H;  1UNS A;  1I4X A;  5M5W B;  4O42 A;  2VZA A;  1PRT F;  2F4V Q;  3HOW B;  1JE5 A;  1HTL D;  5FLM H;  1IBK L;  1LAB A;  3J81 E;  1RHP A;  3OW7 A;  3CC4 A;  4O2D A;  1JC7 A;  2AQ3 B;  2YYZ A;  1TWG B;  1V1O A;  1Y8O B;  1KRT A;  1K8A C;  2E5L L;  1VQF A;  1PTO F;  4AYB B;  1TWC B;  1U4L A;  1WI5 A;  2F0I A;  1Z9F A;  3HZX A;  4JI1 Q;  2NUC A;  3LWE A;  1IBM L;  2JA6 H;  5A2Q E;  2ALY B;  3RZO B;  3JAM E;  1V8Q A;  4QB4 A;  1V1Q A;  1MI2 A;  3T1H Q;  4LW1 A;  1DOL A;  2NN6 G;  1PH8 A;  2NB0 A;  3MXP A;  2EOT A;  1JMC A;  3GQB A;  2ICI A;  2F0T A;  2R7Z B;  2F0U A;  1QNK A;  3T51 B;  1L0Y B;  3E0E A;  4N9P A;  1MIU A;  4C1N I;  3K5M A;  4B3S Q;  4JBM A;  2CFM A;  4A3G H;  3CCR A;  2N55 A;  2KED A;  5CGK A;  3FEW X;  2F0N A;  4R4T A;  1FR3 A;  3M7G A;  1LT4 D;  2PI2 A;  2EPB A;  4RHR A;  2JA9 A;  2TSS A;  3GTG H;  1EFW A;  4GN3 B;  3RNU A;  5E3F A;  1VQB A;  1TXY A;  3PUX A;  5CBA E;  3NQT A;  1B8A A;  4P2C B;  2WII B;  4HIM A;  4A3B H;  4NW2 A;  4HED A;  2MPM A;  4BY7 G;  4JI8 L;  1IYJ B;  5JOB A;  2IX3 A;  3HOX B;  5IT9 c;  2WB1 E;  4IUR A;  2UUA Q;  1NY4 A;  3A5U A;  5DM7 3;  2A6H D;  4OGQ C;  4DR5 Q;  1XX8 A;  3U4V A;  3TEH B;  1ZEQ X;  5E4X A;  3NSW A;  2YU9 H;  2KBN A;  1TWA B;  4KK7 A;  4RWS C;  5BN4 A;  4LF6 Q;  3OWE B;  3UDG A;  1S40 A;  2B2U C;  4GS3 A;  4DF7 A;  1T5X D;  4APV A;  1GXD C;  4R8I A;  3H0G H;  2MFI A;  5COR A;  1PXU A;  4R4C A;  4C3H B;  5IYD G;  3UE0 A;  1WFQ A;  5C3X A;  4CJ0 B;  1K83 H;  2AQ2 B;  4UP7 A;  4A3M B;  4CBV A;  2IY5 B;  4ABN A;  4DK1 A;  2ZTE A;  2ZM6 L;  4PZ8 A;  5JJI A;  2JA6 B;  1O7Z A;  2A6E C;  1ICF B;  1CUK A;  2OTL A;  1IYU A;  2YV5 A;  4LF7 L;  2D9U A;  4KY7 A;  5CMD A;  1WTO A;  1A63 A;  3K7A H;  5M5Y B;  5I9O A;  2D62 A;  4WJ4 A;  4RA8 A;  2D0P A;  1A62 A;  4LUO A;  2F3I A;  2AWO A;  3F1Z A;  4A3G B;  2EYM A;  3ERO A;  4HR7 B;  1ZXT A;  3I55 A;  2UXD L;  2A19 A;  2VL6 A;  1D5X C;  3PF5 A;  2MO0 A;  1SYF A;  3HEJ A;  5ELE A;  1NTG A;  3FPU B;  4DR7 L;  2Z4H A;  3TRZ A;  2A74 C;  3CPF A;  4DV2 L;  1BVS A;  4GN5 A;  3VDY A;  4A3K G;  2JEB I;  4ID6 A;  2Q2T A;  2MNA A;  3S17 H;  1ENA A;  2FJ2 A;  5IE8 A;  3C46 A;  2RDF A;  4OIJ A;  3J7A V;  3IFD A;  5KGU A;  4JBK A;  4A3B B;  3I8Z A;  3PF4 A;  2F4V L;  2WAQ G;  2ID0 A;  1B2T A;  1GM5 A;  3CME A;  4ME3 A;  2ZTD A;  3MWY W;  3MXU A;  4R4O A;  3BVZ A;  5EKI A;  4JI5 L;  1NR2 A;  4IN3 A;  1F9P A;  3KLS X;  2B8F A;  4YWK A;  4L6T B;  4JI1 L;  1YBY A;  1VF7 A;  2EYH A;  4PZ6 A;  4JPB W;  3H0G B;  2QGQ A;  4TKO B;  3T1H L;  4A3D H;  5DNF A;  2F52 A;  3LNN A;  2L1B A;  3F2C A;  1DD2 A;  2JA8 B;  2XRQ D;  3W1G A;  1YHA A;  1PTO H;  3HOV H;  2F0D A;  2OF1 A;  1WCM G;  1HUM A;  4XXE A;  1VS0 A;  4B3S L;  4C3I H;  4CDD C;  4QUC A;  3KDF B;  2EY6 A;  4DR1 Q;  4CJ2 C;  3E0J A;  1YNJ C;  3D31 A;  1G2S A;  1A15 A;  3DEP A;  3K7A B;  2PMZ B;  2EZV A;  3P75 A;  4BBS G;  3ULP A;  3TDQ A;  1STH A;  2F0F A;  3RZD B;  3HOY H;  1F77 A;  1C4Q A;  5C4J H;  1DXM A;  1QUQ A;  2F0E A;  2IL8 A;  2JSO A;  4FYD A;  3QG1 A;  1YNN C;  1J5E Q;  2UUA L;  3STB D;  4DR5 L;  3FMC A;  1K8G A;  1TVX A;  2I0Q A;  3S17 B;  2KEE A;  2E74 C;  4S3S A;  3MHB A;  4DUY Q;  4LF6 L;  3CC2 A;  2KHJ A;  1OXU A;  1STN A;  4J8Q A;  1LV9 A;  1X3E A;  1BCP B;  2VB2 X;  1S5D D;  2SNM A;  1SR3 A;  2K28 A;  5IGG A;  1EWC A;  3OMG A;  1JR0 D;  1UEA B;  5I4D A;  4B9W A;  3PUV A;  3CCU A;  4RH6 A;  1D1I A;  1PRT B;  4CKC A;  1ESF A;  3P1H A;  4X3S A;  3DLL A;  2LKV A;  3FVQ A;  3VR5 A;  1WTX A;  2JA5 B;  4LF4 Q;  1A2U A;  3S15 B;  2ZJR A;  1PTO B;  4KI0 A;  4QJF A;  3SVM A;  1PFS A;  5IYB H;  4C3J H;  1G6P A;  3HKZ G;  3GTK B;  2C9O A;  3IKJ A;  3I2Z A;  1NUC A;  3UDI A;  4GNX B;  3ULL A;  1XMQ Q;  3OW2 A;  2Z0S A;  4KHZ A;  3KBG A;  4NB3 A;  2D0O A;  5M3M H;  2PQA B;  4GOP A;  4A3C H;  2CKZ B;  4A3L H;  3MFG A;  1X3Q A;  1YIT A;  5FO9 B;  1CSQ A;  3I56 A;  2BE5 D;  4RCO A;  2H5X A;  3I4N G;  2E2J H;  1L0W A;  3MFY A;  2K5Q A;  2HCC A;  2AWN A;  5I2Y A;  3HOY B;  5C4H A;  1KQS A;  5C4J B;  3L9A X;  2N3S A;  2EYF A;  4H44 C;  1N33 Q;  3W3A A;  3MAQ A;  5EGT A;  4ZK9 B;  2LSS A;  4XQQ A;  1EY5 A;  3L7Z C;  3SR1 A;  2H1E A;  3S16 H;  4G7H C;  2A68 D;  1K0R A;  1X65 A;  3PO3 H;  1GUW A;  3SGI A;  2HQE A;  1M90 C;  3CXC A;  5KYI A;  3T1Y Q;  3CD6 A;  2K5W A;  1QCB D;  3CCJ A;  3GDE A;  1RF2 D;  4OL7 A;  3PIO 3;  2B63 H;  1HQM C;  2K04 A;  3CHB D;  2R7F A;  1R4P B;  1D5M C;  5C4X H;  1QVG A;  2JN4 A;  1E2W A;  4PZ7 A;  4LF5 Q;  4ZRZ A;  4JI6 Q;  2WAQ E;  3WDN A;  2F0L A;  3TSS A;  5IWA L;  2VQE Q;  4DR2 Q;  4KV6 A;  2GN5 A;  3KUP A;  1EU3 A;  4DR1 L;  1I5F A;  1AE2 A;  4HJ7 A;  4HMJ A;  3CW2 C;  1CZG A;  3PIP A;  1PLF A;  4BWG B;  5JJK A;  2KHS A;  4QMG A;  4XT1 B;  1JOQ A;  3BVG A;  1FNU A;  2P5Z X;  1EEF D;  4KTA A;  1FL0 A;  4I7Z C;  4JOI C;  2Z6K A;  2N88 A;  3CRK C;  1O78 A;  1X3G A;  5FO7 B;  1K9M C;  1HR0 W;  2K32 A;  2AUK A;  2WIN B;  4KJO A;  3GTL B;  4NPS A;  3H3V I;  3URY A;  4DAP A;  1KLU D;  2HHH Q;  1S5C D;  2NZ1 D;  1J5E L;  4PV1 C;  1Y8N B;  1I6H B;  5IT9 L;  1C48 A;  3AB9 A;  1JWM D;  2VUM B;  1E0B A;  2R92 B;  3MC0 B;  3TP5 A;  3IFT A;  3HOZ G;  1PZJ D;  3GV6 A;  1LTI D;  1UE5 A;  1X3F A;  4KKT A;  4DUY L;  5IP7 G;  1KNE A;  2WKC A;  4JK1 C;  3CCQ A;  5M3F G;  1E3P A;  1D1K A;  1W6K A;  4BBR B;  1OXV A;  2K52 A;  3VYT A;  1IBK Q;  1A6X A;  2RA4 A;  1MHW C;  2FHT A;  1OTC A;  2LFN A;  4I7A A;  4M1U B;  3F2B A;  1RJT A;  3VA7 A;  1JB7 A;  2KCT A;  1B4O A;  2BDN A;  3BG3 A;  2N8N A;  2R61 A;  3DUZ A;  1XPO A;  3J7Z C;  2CW0 D;  3PO3 B;  5FJ8 H;  1MSG A;  4IOA A;  2Z4I A;  3GV3 A;  4LFA Q;  4IUQ A;  3EBE A;  3EN2 A;  3TZD A;  1Y1W H;  3CCS A;  4E6I A;  4MHE A;  4OEL B;  2A1A A;  4GKK L;  1EQQ A;  3PCO B;  3L0O A;  1WTP A;  1CA6 A;  4RFB A;  5C4X B;  1VCI A;  4LF4 L;  2FXQ A;  1HH2 P;  3V05 A;  1BCP D;  1TKW B;  4DNR B;  2HT1 A;  4DK3 C;  4QGU A;  1VQH A;  1EQR A;  1VQI A;  2ZTC A;  3X3N A;  1K8M A;  2X6G A;  2IPK D;  3FKI H;  3U9O A;  1PH4 A;  1B3A A;  1XMQ L;  5LMN Q;  4HIO A;  3A54 A;  1Q1E A;  5HUR A;  1AEX A;  1CK1 A;  4IZ8 A;  1XPR A;  2L55 A;  1PRT D;  4XYO A;  2DGY A;  1AZQ A;  1JJ2 A;  1H9R A;  4MN3 A;  5CV6 A;  4P72 A;  4ZUI A;  2RF4 A;  1KRS A;  1TY0 A;  1N33 L;  2F0S A;  5M5W H;  1PTO D;  3TP8 A;  4DR4 Q;  4A3E G;  4K2L A;  4FXK C;  1VQ8 A;  4ZYS A;  1YNX A;  1HTP A;  1X9N A;  3CC7 A;  4B3R Q;  3HKZ E;  1HHV A;  2K75 A;  1WJJ A;  3I4M H;  3U9S A;  4FF1 A;  2F0G A;  1TWC H;  1II3 A;  1DOK A;  2KA7 A;  5DM6 3;  4FO2 A;  1IHZ A;  2XRS D;  4U68 A;  1ET9 A;  1VQ9 A;  2IHE A;  3T1Y L;  2KOL A;  4HJ9 A;  4KHV A;  3RZO H;  1O7Y A;  4KD3 A;  1GHJ A;  3HOW G;  1MGS A;  3R3O A;  4L5Q A;  4BXX G;  3SK5 A;  2G9D A;  2XWJ B;  1C9O A;  3BS1 A;  4J6H A;  1BBU A;  2R7Z H;  4R9W A;  5T1I A;  2DJF C;  2B8G A;  2R93 B;  4LF5 L;  4O0A A;  4JI6 L;  2VQE L;  4DR2 L;  4Y7N H;  1Y1W B;  1EIG A;  1OO9 B;  2BDO A;  1VF5 C;  2JA7 H;  3HG9 A;  2E2I H;  4XTC S;  5KNC A;  4IPG A;  4POG A;  2CQA A;  2Q8T A;  3K5O A;  5C6A A;  5K36 H;  2WB1 B;  3KDF A;  3TP7 A;  5KRU A;  1NJI C;  2EY2 A;  3PO2 B;  3M4Q A;  1NMF A;  1YZ6 A;  1CM9 A;  2SDF A;  3NEL A;  1X32 A;  5IP9 H;  1SNM A;  1HNZ Q;  1V43 A;  1OXX K;  1PDQ A;  2H4O A;  2VY3 A;  1E24 A;  5IYC G;  2IX1 A;  1X6O A;  1BCP F;  2HHH L;  2B39 A;  1Q82 C;  1D2B A;  1XJV A;  4BY1 G;  1B9M A;  1Z7T A;  4FVM A;  5C0X I;  3D4D A;  4ZKC B;  4DV7 Q;  4R4I A;  4IFD G;  1DON A;  2MGS A;  3A74 A;  1EWH A;  2KHI A;  3OOC A;  2GVA A;  1XPU A;  1GUG A;  1IZ6 A;  3H3V H;  4DV0 Q;  1EY7 A;  1Z47 A;  5JVG 3;  4HN7 A;  1H9S A;  2L15 A;  1CT1 D;  1W2B A;  1KC8 C;  4C3H H;  2HQL A;  1NAP A;  3MEH A;  4G4K A;  4NXM Q;  3SK6 A;  3ERS X;  4JI5 Q;  4UHV A;  1STE A;  3I4M B;  2FMM A;  4O1N A;  1LTT D;  3NTI A;  4B9X A;  4A3M H;  4QY7 A;  4A4I A;  4K8J A;  4K5W A;  1SRO A;  2A69 C;  4OO1 I;  1RTN A;  4A93 B;  4LFA L;  5JEA G;  5EQ0 A;  1IW7 C;  1XNQ Q;  1ASY A;  1AE3 A;  3J7Y W;  3F8T A;  1LUZ A;  4IPH A;  2CH4 A;  3VYS A;  4JI3 Q;  5M5Y H;  4DV1 Q;  5D3D A;  1CHP D;  2ES2 A;  2EYL A;  1R9T B;  1J9O A;  2D2C C;  3VYR A;  4RGO S;  1LLR D;  3J7A F;  4Y7N B;  4Z9C B;  4POF A;  2K5H A;  1SMY D;  2MO1 A;  3WOF A;  2JA7 B;  5LMN L;  2LMC B;  2E2I B;  4A3I G;  2BA1 A;  4LWC A;  3P20 A;  1I3Q H;  3MEF A;  2YTX A;  1DYQ A;  2RVL A;  4GNX A;  4X3K A;  2Q8R E;  1XTD A;  1JCK B;  3I70 A;  5IT9 E;  1IKL A;  5IGC A;  3VR4 A;  2PQA A;  2VB3 X;  2RHQ B;  2PPB C;  2RKS A;  4ULL A;  1SEB D;  1VMP A;  1A2T A;  2B2Y A;  4A3G G;  2Q8I B;  4DR4 L;  3NHH A;  5CV9 A;  5HGQ A;  2UU9 Q;  1N32 Q;  1CHQ D;  4YHH Q;  3AU7 A;  4B3R L;  4CDE C;  2I5L X;  3KF6 B;  1HRJ A;  5GAG C;  5JPN C;  1SNQ A;  5T1G A;  4N8F A;  3M9B A;  1WD1 A;  3S9W A;  3KJO A;  4JW0 A;  2Y0S G;  4A3B G;  1EY4 A;  2UUB Q;  1B1Z A;  4JBW A;  3K5N A;  1X56 A;  3SHL A;  4EQN A;  1SE3 A;  2JA8 H;  5ELF A;  2MP1 A;  3S2D B;  3TN2 A;  1PZK D;  2CWA A;  4FNF A;  5EPK A;  2CQO A;  5J39 A;  2ICE C;  1MSH A;  4A75 A;  4CJ1 B;  3PIO A;  4H02 A;  3CCM A;  2KQ3 A;  4U67 3;  1EYC A;  2BE5 C;  2DJG C;  3V2T A;  1KDC A;  5GAE C;  2Z6B A;  4IFD J;  4H13 C;  2OWO A;  2A73 B;  2Q2I A;  3SEB A;  2EY1 A;  4IPC A;  1C7Y A;  1RD9 D;  2AHO B;  4BS9 A;  2K01 A;  3DM3 A;  2UXB Q;  3RZD H;  1UUP A;  2PQE A;  5I6Y A;  1SRU A;  3DWA A;  1HR0 Q;  4HMI A;  1ZYR D;  1SYB A;  1HNZ L;  3SDZ A;  2X69 A;  2QIL A;  4L8J A;  3I3C A;  5HY6 A;  4JI2 Q;  2K6A A;  1I3Q B;  4K14 A;  5IOC A;  3R93 A;  5M5X B;  2K05 A;  1WD0 A;  4DV7 L;  2B2W C;  2XVS A;  2DY7 A;  5KYL A;  4N9T A;  5ISR A;  1XMO Q;  3I4O A;  2F4I A;  4BY7 B;  5JEA J;  1GUS A;  1AH9 A;  1NBW A;  4DV0 L;  4JVZ A;  3PQI A;  1QE6 A;  3GTP B;  4NXM L;  1SSO A;  5C0X H;  3HOU H;  4I65 A;  1SBB B;  3BZC A;  5E1F A;  2CCZ A;  3RLO A;  5EKK A;  4ME5 A;  2J7Z A;  4X3T A;  1B44 D;  2AUJ D;  2HDL A;  3BZK A;  5HGT A;  2B2T C;  1UAP A;  1YI2 A;  1LTG D;  4EQ5 A;  3IAY A;  3VR2 A;  4TRD A;  2O4X A;  1DGS A;  3TS2 A;  1EIY B;  1XNQ L;  3K6O A;  2A8V A;  1QOH A;  3KK7 A;  2PW7 A;  2C5C A;  2JK8 A;  2XN9 C;  4JI3 L;  2JA5 H;  4OWX B;  2EYO A;  4DV1 L;  3S15 H;  4P73 A;  1L1O C;  1B9N A;  3K0X A;  1CTM A;  3GTK H;  5IWA Q;  3EQL C;  4OO1 H;  4NP5 A;  5AJ3 Q;  3I73 A;  3MXG A;  2N78 A;  3D6W A;  3AFP A;  4A3F G;  1NE3 A;  2PNH A;  4N8X 1;  3Q24 A;  4OIK A;  4UP9 A;  1BF4 A;  3K7U C;  5ELN A;  4A3D G;  3DM1 A;  1VQM A;  5FK9 C;  1KHI A;  3D8G A;  1D5Z C;  1B3Q A;  1QIL A;  4PMW A;  1KDB A;  2LXK A;  4OXP A;  3HOV G;  1JWU D;  1TS3 A;  1HJP A;  1LTA D;  5C3E H;  1CSP A;  2E75 C;  5JPM C;  3GTJ B;  1KIX A;  1RKN A;  1F2Z A;  2F3W A;  5JJL A;  3D4W A;  4JC0 A;  4C3I G;  2B2V A;  2FMC A;  1RCV D;  5C5M A;  1N36 Q;  4AIM A;  4A3K B;  2UU9 L;  1N32 L;  3LX0 A;  1GO3 E;  4ZQ3 A;  3NTH A;  4YHH L;  1U4R A;  2RBM A;  1XYI A;  1M4V A;  2ZJP A;  3S1M H;  5KNB A;  4X66 Q;  1GUN A;  1PH2 A;  4P74 A;  2OXP A;  4LAA A;  2L0C A;  2DY8 A;  2JYO A;  1H9S B;  1HA6 A;  2JP1 A;  4DAV A;  1K8O A;  2WAQ B;  2XIW A;  3H6M A;  1Q1B A;  3NBI A;  3HOY G;  1UEB A;  1DCZ A;  4PNY A;  2UUB L;  1HXY D;  4YIJ A;  2VNU D;  1E2V A;  3BDL A;  4XYQ A;  4AH6 A;  1W3S A;  2IWH A;  3HOU B;  2BH2 A;  3U58 A;  4JYA Q;  4OWT B;  1SNC A;  3J81 j;  5IIF A;  2CH4 W;  3I7F A;  2QW7 A;  4FP5 D;  3G6E A;  3CF5 A;  1KD1 C;  1YEZ A;  1TQO A;  2XGT A;  1SND A;  1U9R A;  3KF8 B;  3KYH C;  2JXM B;  3CCV A;  4GKK Q;  1JOK A;  1BQQ T;  1Y8P B;  5IGB A;  3WOE A;  1JJC B;  1I6V C;  1WCM B;  1PTO C;  2K03 A;  5LL6 X;  5D65 A;  1Y14 B;  1YJ9 A;  1F2L A;  2RSO A;  4G7O C;  3J80 i;  2V1C C;  4DAY B;  2L4N A;  2UXB L;  4X62 Q;  4PMC A;  1HR0 L;  4R1J A;  1T9H A;  3HGB A;  3GTL H;  3A5Z B;  4OX9 Q;  2F3V A;  5ELD A;  4F8M A;  4J15 A;  2MQH A;  4YCV A;  4JI2 L;  1SXT A;  2ZJQ A;  1JOO A;  4BBS B;  1NMG A;  5IY0 A;  1I6H H;  1K3R A;  3I4N H;  4K6L A;  4B3M Q;  3BU2 A;  2VUM H;  4QQB X;  2R92 H;  1BO0 A;  1XMO L;  5C3E B;  5IYB G;  2BOS A;  4C3J G;  3S1R B;  1HCZ A;  2OQ0 A;  4BBR H;  1F2M A;  1VQE A;  2N49 A;  1KLG D;  2PO4 A;  4DFA A;  1QVF A;  2UXC Q;  4LF9 Q;  3S1M B;  4LNQ A;  5M3M G;  2OCE A;  4XQJ A;  5D3I B;  2CVR A;  1EFI D;  1QVC A;  2NWG A;  4A3C G;  3K8A A;  1LYL A;  4DR3 Q;  5BR8 L;  2K5N A;  4V0B A;  4K5X A;  1AN8 A;  1EYG A;  4NKL A;  1HFG A;  2WV6 D;  2WKD A;  1CKM A;  3SE0 A;  2HCI A;  3A55 A;  4DKA C;  1EIH A;  2R3Z A;  3R2T A;  2KEC A;  1MJC A;  2M9V A;  3OMC A;  1VQ5 A;  3X3M A;  1Y1V H;  4EQO A;  1KTK A;  3CCE A;  1ML0 D;  1SN8 A;  2UUC Q;  4LK1 C;  1X3P A;  2A5H A;  2YTV A;  2XWB B;  3A7L A;  2NVQ B;  1D6E C;  1BDO A;  3EA6 A;  1A3U A;  1ROD A;  5AJ3 L;  2XNA C;  1STB A;  2F0K A;  1R4Q B;  1ENF A;  2B63 G;  5AFW A;  3HKZ B;  4GKJ Q;  5CR3 A;  3RN5 A;  3K81 C;  3F2D A;  5C4X G;  3A8K E;  3T53 B;  4L63 B;  3N52 A;  1JT8 A;  1BOS A;  3CQZ B;  2K33 A;  3TRE A;  4ZLT F;  4L5S A;  1SYC A;  1K0S A;  1N36 L;  1IBL Q;  3Q6S A;  2O2L D;  1OXS C;  4PG3 A;  4DUZ Q;  1PHJ A;  4IOC A;  4GLV B;  3I4N B;  4X66 L;  3CKI B;  2ATW A;  1GJX A;  1EQT A;  2M00 A;  2IW3 A;  4HSP A;  3EJI A;  4RGM A;  5I9P A;  2I5M X;  3KF6 A;  3U4Z A;  3PGZ A;  1G8Z D;  1MD2 D;  4HTH A;  2LY7 A;  2NN6 I;  1I50 B;  2K14 A;  2NTS A;  1G6Z A;  1TR5 A;  5EBD A;  3M7N A;  1VQ7 A;  1H9M A;  4DNI A;  4JYA L;  3G71 A;  5CYU A;  2PI2 E;  1Q81 C;  4RKB A;  3J80 E;  2R93 H;  4OEM B;  1YNJ D;  5C44 H;  3S2H B;  3A8I E;  1CFM A;  1KL9 A;  3FP9 A;  1EWI A;  2Z9H A;  1FGU A;  4KKU A;  4ODG A;  1ILP A;  1GUT A;  3J80 c;  1F2Y A;  1SYE A;  1Y1V B;  2B2U A;  1PA6 A;  4F88 A;  3PO2 H;  1WTQ A;  2QEJ C;  3CPW A;  1SYG A;  2J4X A;  1WTW A;  3E9I A;  4OWW B;  1PFM A;  3GO5 A;  4P71 A;  1YNN D;  4X62 L;  4JV5 Q;  2A6H C;  2SNS A;  5FJ8 G;  4UDU C;  5M9O A;  2OTJ A;  2HUG A;  2MUY A;  4OX9 L;  3DMU A;  3SXH A;  5LL6 S;  4OON A;  4ZKB B;  3HS0 C;  4RGN A;  3K57 A;  4HCE A;  4UP8 A;  1ET6 A;  4X6A H;  1CA5 A;  1K73 C;  2JJQ A;  3MZ5 A;  1VQG A;  4B3M L;  5IOD A;  1QZH A;  2HIV A;  3R8B A;  3L2P A;  4ALP A;  1EYD A;  2CHB D;  4KKS A;  3B6Y A;  2QF7 A;  1GOZ A;  1IL2 A;  2PNR C;  5ELO A;  1S4Z A;  2EJM A;  3GTQ H;  1N9W A;  4JI4 Q;  5C4Z A;  1XNR Q;  1EY0 A;  2RCN A;  3FKI G;  3MVV A;  4HIK A;  1QZG A;  4C2M H;  1HFN A;  2Q2H A;  3A8J E;  1RIP A;  1E1T A;  2UXC L;  4LF9 L;  2G9H D;  4MTN A;  1LTR D;  2LS0 1;  1WYD A;  3HOZ B;  5GQO A;  5ELB A;  1SAP A;  3W5O A;  4DR3 L;  5M3F B;  2V4D A;  3CP0 A;  3MTS A;  1Q90 A;  1LT6 D;  4A93 H;  3CRL C;  1YVC A;  5G3L F;  2JEA I;  3NBH B;  1GUO A;  4MZ9 A;  1EYA A;  1UWV A;  3NP8 A;  4TVA B;  4WOR A;  4HID A;  1SDF A;  4XT3 B;  3EVQ A;  2NVX H;  4LFC Q;  3ULJ A;  4IPD A;  2EIF A;  3DXJ C;  5J1Z A;  1NCV A;  4KLK A;  1TWF H;  1R9T H;  4ZAI A;  2UUC L;  2QCP X;  3NK9 A;  3I4M G;  3NTK A;  5KEE A;  5C44 B;  4DXG A;  4AYB G;  2E76 C;  2XSC A;  4LMQ D;  4QCL A;  2SOB A;  5CV4 A;  2YTY A;  1ILQ A;  2FFK B;  4K2K A;  2F0V A;  1B53 A;  2D5D A;  1JB3 A;  3Q8D A;  4XQN A;  1STA A;  5FLX E;  1ONL A;  4AQY Q;  4IUN A;  3E9H A;  4RGT A;  3ND9 A;  4X64 Q;  4GKJ L;  3ND8 A;  2E2D C;  4GOP C;  3UDX A;  2R7Z G;  1B70 B;  1B50 A;  3A56 A;  4QL5 A;  3VR6 A;  5FLX c;  5LMU Q;  4CKB A;  4CDF C;  3BJU A;  1SNO A;  3NPP A;  1VQD A;  1IBL L;  1Q7Y C;  2EVB A;  4DV6 Q;  1YJW A;  3C1E A;  4DUZ L;  4A3J H;  3NXW A;  2O5J C;  2L5T A;  1BXT A;  2GVB A;  2EDG A;  4X65 Q;  5EKL A;  1FD7 D;  4A3E B;  4JI0 Q;  2F0H A;  4QIW E;  1I94 Q;  3PUZ A;  3N6R A;  3GTQ B;  5IP9 G;  3SK4 A;  4G57 A;  2NVT H;  1Q8I A;  4C2M B;  2PZW A;  2OT2 A;  3H09 A;  1ENC A;  4PMB A;  3F2U A;  3UE1 A;  3S24 A;  1HZA A;  3VA5 A;  3HOX G;  1L2F A;  3S2D H;  5EPJ A;  2EJF C;  1V1P B;  3QJY A;  1HQR D;  3DWQ A;  1X54 A;  4EQP A;  1FNW A;  1SYD A;  1XWE A;  2RSN A;  3PSI A;  4OHJ A;  2NN6 H;  2RDG A;  4G7Z C;  1N34 Q;  4M8A A;  5DAU A;  4LFB Q;  5JVH 3;  3S1Q H;  2NVX B;  3TS0 A;  5FLM G;  5NUC A;  1A3V A;  4IJL A;  3BVM A;  1S5E D;  4C3H G;  3QB3 A;  4DV5 Q;  4MIU A;  3KF8 A;  1TWF B;  1DJR D;  2WP8 J;  1M1K C;  1G91 A;  1Q86 C;  3DWP A;  2KEN A;  3A0J A;  2EJG C;  4A3M G;  3DHQ A;  5DLQ E;  2VXW A;  1SE8 A;  3STB C;  3J81 c;  4JV5 L;  4RCN A;  4A3I H;  3NEN A;  1U5K A;  3IL8 A;  4DAY A;  2EE1 A;  3HKS A;  2OQK A;  2JA6 G;  1BUV T;  2Z6K C;  4WRD A;  1QJO A;  4CHT B;  5M5X H;  2EXZ A;  2QKI C;  1Q3L A;  5C5L A;  3KOJ A;  1LTL A;  1C0A A;  3PIP 3;  4KJN A;  2I5H A;  3OYY A;  3JAM c;  4BY7 H;  4LJZ C;  1VQK A;  2F0J A;  3M3Y B;  4JI4 L;  4IO9 A;  5LHY 1;  1XNR L;  4BY1 B;  5IGE A;  4FDB A;  2EXD A;  1AZP A;  2G5D A;  2OEO A;  3JC6 6;  4WJW A;  3GTP H;  1S5F D;  2IT1 A;  1QWY A;  4A3J B;  4KD4 A;  2PCF B;  3AQQ A;  1LTS D;  1DM0 B;  4RMF A;  1PMR A;  4GZY C;  3ITP A;  4DU9 A;  3H3V C;  1F9R A;  4R4Q A;  3S14 B;  2MJ8 A;  3HP3 A;  2B3G A;  2NVT B;  1SFO B;  5IYD H;  1EL0 A;  1K3B C;  1I4G A;  4LFC L;  4DK6 C;  1TT2 A;  1D7Q A;  3ZYY X;  2NTT A;  3K5L A;  5CBE E;  1EUJ A;  4ILW A;  2WAC A;  3M4O H;  1UE7 A;  4RHS A;  1LAC A;  2PYK A;  3VR3 A;  4DV3 Q;  1NR4 A;  4KHP Q;  2KCC A;  3RLF A;  3H91 A;  1VQA A;  4DXF A;  3AFQ A;  3D3R A;  5EAY A;  1Y69 U;  4DN4 M;  1HNW Q;  5F2D A;  2CWP A;  3BDO A;  2BCO A;  3S1Q B;  1O7I A;  2Z1C A;  3H0G G;  2RDH A;  3FPP A;  3KLW A;  4AQY L;  3EIV A;  3IRB A;  3Q0A A;  1VQO A;  4X64 L;  2F1M A;  4QF4 A;  2KJX A;  1KAB A;  3I90 A;  3J7A 5;  2EYP A;  2JA8 G;  4V19 0;  5EBC A;  4HJ8 A;  5FO8 B;  3GTJ H;  4A3I B;  1WVL A;  1EZ8 A;  3NE5 B;  4CDC C;  2A68 C;  5LMU L;  4WFN 3;  3LGJ A;  1AW7 A;  1CKN B;  1CQV A;  3QWN A;  3I4L A;  4A3K H;  1VMC A;  3NQI A;  4DR6 Q;  2WFW A;  4A76 A;  1F9Q A;  4DV6 L;  4IAL A;  3OTO Q;  4AYB E;  1PFB A;  4LF8 Q;  2EY5 A;  4K8I A;  4FF3 A;  3OHX C;  4JI0 L;  4X65 L;  1I94 L;  3GTM H;  4FF2 A;  5LMN W;  4UAI A;  1TWH H;  4IUT A;  4JOI A;  4MNO A;  3GTG B;  2JE6 I;  1W6J A;  1JOR A;  3H94 A;  3OPO A;  3EFX D;  4UPA A;  5BR8 Q;  3CAM A;  2Y0S B;  2QA4 A;  2RHS B;  1G29 1;  4UY8 C;  1OXT A;  1FJG Q;  1KAA A;  4RAU C;  3I91 A;  1M8A A;  2KCM A;  3NUC A;  1IXR A;  4JI7 Q;  3ER0 A;  1N34 L;  4LFB L;  4EVO A;  3QIA A;  4KY6 A;  4PQX A;  1JIC A;  1X55 A;  1WCM H;  4GN4 B;  2R6G A; 
#chains in the Genus database with same CATH homology
 5C0X G;  3M4O B;  3J80 L;  2YU9 B;  3KLS A;  5CV7 A;  3T13 A;  5IGF A;  5COY A;  3QO2 A;  4IUV A;  1L0X B;  1U4P A;  2K1B A;  1K83 B;  1KNA A;  2KVM A;  4X3U A;  1KDA A;  4OO1 G;  5KIX A;  1AP0 A;  2CW0 C;  2ENB A;  3FDT A;  4QUF A;  2NYZ D;  1MBY A;  2A69 D;  4FF4 A;  1IW7 D;  3PUY A;  1PZI D;  2QDB A;  2ZXO A;  3W2D A;  4FXD A;  3GTM B;  1BCP C;  1H9J A;  1STY A;  2GA4 B;  1TWH B;  3D6C A;  3DEO A;  4KY5 A;  3OWF A;  3NBH A;  3G6J B;  4B08 A;  2O5I C;  1PRT C;  1TS4 A;  1EY8 A;  3OIP A;  5ELC A;  3C3L A;  5K5P A;  3PUW A;  4Q0F A;  5I6W A;  5EJW A;  1CI3 M;  4BA2 I;  3P7J A;  1O7L A;  4A3F B;  3GTO B;  5E4W C;  1NSN S;  3Q23 A;  1ZKO A;  3CU7 A;  4A3D B;  5FLX L;  5CC4 A;  1SE4 A;  1Z6H A;  1I4R A;  2B2Y C;  3K0Y A;  2Z8L A;  3HOV B;  5CV8 A;  3BYT B;  2DNE A;  1Q12 A;  1CZW A;  2HDM A;  4C3I B;  1FYC A;  1SJE D;  2DN8 A;  3GP7 A;  3TZU A;  2NVY B;  5BN5 A;  2F0M A;  4C1N K;  2I07 B;  4IUU A;  2ZT9 C;  1QNU A;  3BZD B;  4XIG S;  4Q5V A;  3KBX A;  4DA2 A;  1IYV A;  1BNZ A;  1HPC A;  5C0X J;  3TBI B;  3K59 A;  1JE4 A;  2MHV A;  2A6E D;  5JJZ A;  4EGV A;  5FOB B;  1PYW D;  3R2I A;  2TMP A;  3GD7 A;  4R8N A;  3BDC A;  1V1P A;  2KCN A;  1I4Q A;  1TU2 B;  3NWT A;  1BR9 A;  3QOJ A;  3M4Y A;  4KN4 C;  1EZ6 A;  2F0P A;  1I4H A;  4DNT B;  1HA5 A;  2RQX A;  1LO5 D;  3NWS A;  5FKA C;  1RDP D;  1VDZ A;  3J81 L;  4TQU S;  4IFD I;  5KND A;  4NMZ A;  1EU4 A;  1IL8 A;  1QB5 D;  3OIQ A;  2F0Q A;  1A3T A;  1U4M A;  1WTV A;  5A35 A;  1QG7 A;  3O13 A;  5A2Q L;  1ESR A;  1DOM A;  1ICW A;  3JAM L;  1I4P A;  1WTR A;  2NBF A;  1BBX C;  3I72 A;  2M2L A;  2F0W A;  1HUN A;  3RD4 A;  1AFP A;  5G3L D;  3VYU A;  1EOT A;  2ZXP A;  3T56 B;  4C3J B;  3A7A B;  1GHK A;  1IKM A;  2BA0 A;  1TS5 A;  2L12 A;  3UI2 A;  4HAE A;  5M3M B;  1FNV A;  1J8I A;  3RMH A;  1SMY C;  2AQ1 B;  5EPL A;  2E2J B;  1DZ1 A;  4KN7 C;  4H7B A;  2I46 A;  5D14 A;  5TSS A;  1LT3 D;  3PMF A;  2X6L A;  2K5D A;  4RKL A;  3E6Z X;  3S16 B;  1XXG A;  3C2P A;  2J0T D;  1JWS D;  2L9H A;  4HCS A;  2EYJ A;  1EQV A;  4C56 C;  4QIW B;  4IUP A;  2IX0 A;  1G2T A;  2B63 B;  3SK8 A;  3ERQ A;  1PFN A;  2B2V C;  4J1M A;  4CKE A;  1SE2 A;  4DK0 A;  1EY6 A;  3KLR A;  1C8C A;  4KMU C;  2E2H B;  5C3W A;  1H9K A;  1EY9 A;  5CV5 A;  1LTB D;  4ZUJ A;  2DNC A;  4CGY B;  2B2W A;  3K58 A;  3RUZ A;  2PZU A;  2F03 A;  3S1N B;  1ZYR C;  3FRP B;  3HRZ C;  5IGD A;  4F87 A;  1LT5 D;  1TS2 A;  3PV0 A;  2KUM A;  1TY2 A;  3OSO A;  4H0L C;  5JAV A;  3TME A;  2L11 A;  1STG A;  2PZT A;  3V96 A;  1JQY D;  3QOL A;  1SJH D;  3AMU A;  2IJ0 A;  1T5E A;  3E5S A;  1TII D;  3T16 A;  2B2T A;  3G7L A;  3D4R A;  4XDX A;  3BYY B;  2F0O A;  1CQF A;  5BN3 A;  4FXG C;  4HSV A;  1EEI D;  2PW5 A;  3T4A C;  3MXN A;  3Q22 A;  5J22 A;  4IFD H;  2SEB D;  3L3O C;  5DEH A;  4DGZ A;  4F7X A;  1SNP A;  5K36 G;  4K5V A;  5I2X A;  1FGB D;  3MA2 B;  3FKI B;  3TP6 A;  2ZXR A;  1O80 A;  4IQZ A;  3ONA B;  4NDX A;  2FIN B;  3C1F A;  3LWU A;  1RTO A;  2K7V A;  4BA1 I;  4K6D A;  1S5B D;  1XTC D;  4TSS A;  3M85 A;  1F9S A;  1E2Z A;  5JEA H;  1UNS A;  1I4X A;  5M5W B;  4O42 A;  1PRT F;  3HOW B;  1HTL D;  1LAB A;  3J81 E;  1RHP A;  3OW7 A;  1JC7 A;  2AQ3 B;  2YYZ A;  1TWG B;  1V1O A;  1Y8O B;  1PTO F;  4AYB B;  1TWC B;  1U4L A;  2F0I A;  3HZX A;  2NUC A;  3LWE A;  5A2Q E;  3RZO B;  3JAM E;  1V8Q A;  4QB4 A;  1MI2 A;  1DOL A;  2NN6 G;  2NB0 A;  3MXP A;  2EOT A;  3GQB A;  2ICI A;  2F0T A;  2R7Z B;  2F0U A;  1QNK A;  3T51 B;  1L0Y B;  4N9P A;  4C1N I;  3K5M A;  2N55 A;  2KED A;  5CGK A;  3FEW X;  2F0N A;  1FR3 A;  3M7G A;  1LT4 D;  2EPB A;  4RHR A;  2TSS A;  5E3F A;  3PUX A;  5CBA E;  3NQT A;  4P2C B;  2WII B;  4NW2 A;  4HED A;  2MPM A;  5JOB A;  2IX3 A;  3HOX B;  4IUR A;  5DM7 3;  2A6H D;  4OGQ C;  1XX8 A;  1ZEQ X;  5E4X A;  3NSW A;  1TWA B;  4KK7 A;  4RWS C;  5BN4 A;  3OWE B;  2B2U C;  4DF7 A;  1T5X D;  1GXD C;  4R8I A;  5COR A;  1PXU A;  4C3H B;  5C3X A;  4CJ0 B;  2AQ2 B;  4A3M B;  4CBV A;  4ABN A;  4DK1 A;  2JA6 B;  1O7Z A;  2A6E C;  1IYU A;  2D9U A;  4KY7 A;  5CMD A;  1WTO A;  5M5Y B;  5I9O A;  2D62 A;  4RA8 A;  2AWO A;  4A3G B;  2EYM A;  3ERO A;  4HR7 B;  1ZXT A;  1D5X C;  1SYF A;  3HEJ A;  5ELE A;  3FPU B;  2Z4H A;  2A74 C;  2JEB I;  4ID6 A;  1ENA A;  2FJ2 A;  3C46 A;  2RDF A;  4OIJ A;  3J7A V;  3IFD A;  5KGU A;  4A3B B;  3I8Z A;  2ID0 A;  1B2T A;  3MWY W;  3MXU A;  3BVZ A;  5EKI A;  1NR2 A;  4IN3 A;  1F9P A;  3KLS X;  2B8F A;  4L6T B;  1VF7 A;  2EYH A;  3H0G B;  4TKO B;  5DNF A;  3LNN A;  2L1B A;  1DD2 A;  2JA8 B;  2XRQ D;  1PTO H;  2F0D A;  2OF1 A;  1HUM A;  4XXE A;  4QUC A;  2EY6 A;  4CJ2 C;  3E0J A;  1YNJ C;  3D31 A;  1G2S A;  1A15 A;  3DEP A;  3K7A B;  2PMZ B;  2EZV A;  3P75 A;  3TDQ A;  1STH A;  2F0F A;  3RZD B;  1F77 A;  1C4Q A;  1DXM A;  2F0E A;  2IL8 A;  2JSO A;  4FYD A;  3QG1 A;  1YNN C;  3FMC A;  1TVX A;  3S17 B;  2KEE A;  2E74 C;  4S3S A;  3MHB A;  1OXU A;  1STN A;  4J8Q A;  1LV9 A;  1BCP B;  2VB2 X;  1S5D D;  2SNM A;  2K28 A;  5IGG A;  1EWC A;  3OMG A;  1JR0 D;  1UEA B;  5I4D A;  4B9W A;  3PUV A;  4RH6 A;  4CKC A;  1D1I A;  1PRT B;  1ESF A;  3P1H A;  4X3S A;  2LKV A;  3FVQ A;  3VR5 A;  1WTX A;  2JA5 B;  1A2U A;  3S15 B;  1PTO B;  4KI0 A;  3SVM A;  3GTK B;  2C9O A;  3IKJ A;  1NUC A;  4KHZ A;  3KBG A;  3MFG A;  1X3Q A;  5FO9 B;  2BE5 D;  4RCO A;  3HOY B;  2K5Q A;  2HCC A;  2AWN A;  3MFY A;  5I2Y A;  5C4H A;  5C4J B;  3L9A X;  2EYF A;  4H44 C;  3W3A A;  3MAQ A;  5EGT A;  4ZK9 B;  4XQQ A;  1EY5 A;  3L7Z C;  3SR1 A;  2H1E A;  4G7H C;  2A68 D;  1GUW A;  2HQE A;  5KYI A;  2K5W A;  1QCB D;  1RF2 D;  4OL7 A;  3PIO 3;  1HQM C;  2K04 A;  3CHB D;  1R4P B;  1D5M C;  1E2W A;  4ZRZ A;  3WDN A;  2F0L A;  3TSS A;  4KV6 A;  3KUP A;  1EU3 A;  4HMJ A;  1CZG A;  1PLF A;  4BWG B;  2KHS A;  4QMG A;  4XT1 B;  1JOQ A;  3BVG A;  1FNU A;  1EEF D;  4KTA A;  4I7Z C;  2N88 A;  5FO7 B;  3CRK C;  1O78 A;  2K32 A;  2AUK A;  2WIN B;  4KJO A;  3GTL B;  3URY A;  4DAP A;  1KLU D;  1S5C D;  2NZ1 D;  4PV1 C;  1Y8N B;  1I6H B;  5IT9 L;  1C48 A;  3AB9 A;  1JWM D;  2VUM B;  1E0B A;  2R92 B;  3MC0 B;  3TP5 A;  3IFT A;  1PZJ D;  3GV6 A;  1LTI D;  4KKT A;  1KNE A;  2WKC A;  4JK1 C;  1D1K A;  1W6K A;  4BBR B;  1OXV A;  1A6X A;  3VYT A;  2RA4 A;  2FHT A;  2LFN A;  4M1U B;  1RJT A;  3VA7 A;  1B4O A;  2BDN A;  3BG3 A;  2R61 A;  3DUZ A;  2CW0 D;  3PO3 B;  1MSG A;  2Z4I A;  3GV3 A;  4IUQ A;  3TZD A;  4E6I A;  4MHE A;  1WTP A;  1CA6 A;  4RFB A;  5C4X B;  1VCI A;  3V05 A;  1BCP D;  1TKW B;  4DNR B;  3X3N A;  1K8M A;  2X6G A;  2IPK D;  3U9O A;  1B3A A;  3A54 A;  1Q1E A;  5HUR A;  1AEX A;  1CK1 A;  4IZ8 A;  2L55 A;  1PRT D;  4XYO A;  1AZQ A;  1H9R A;  4MN3 A;  5CV6 A;  4ZUI A;  1TY0 A;  2F0S A;  1PTO D;  3TP8 A;  4K2L A;  4FXK C;  4ZYS A;  1HTP A;  1HHV A;  3U9S A;  4FF1 A;  2F0G A;  1II3 A;  1DOK A;  2KA7 A;  5DM6 3;  4FO2 A;  1IHZ A;  2XRS D;  4U68 A;  1ET9 A;  2KOL A;  4KHV A;  1O7Y A;  4KD3 A;  1GHJ A;  1MGS A;  3R3O A;  3SK5 A;  2G9D A;  2XWJ B;  3BS1 A;  4J6H A;  4R9W A;  5T1I A;  2B8G A;  2R93 B;  1Y1W B;  1EIG A;  1OO9 B;  2BDO A;  1VF5 C;  3HG9 A;  4XTC S;  5KNC A;  2CQA A;  2Q8T A;  3K5O A;  5C6A A;  5K36 H;  2WB1 B;  5KRU A;  3TP7 A;  2EY2 A;  3PO2 B;  1CM9 A;  2SDF A;  1X32 A;  1SNM A;  1V43 A;  1OXX K;  1PDQ A;  2H4O A;  2IX1 A;  1BCP F;  2B39 A;  1D2B A;  1B9M A;  1Z7T A;  4FVM A;  5C0X I;  3D4D A;  4ZKC B;  4IFD G;  1DON A;  2MGS A;  3OOC A;  1EWH A;  1GUG A;  1EY7 A;  1Z47 A;  5JVG 3;  4HN7 A;  1H9S A;  1CT1 D;  1NAP A;  3MEH A;  4G4K A;  3SK6 A;  1STE A;  3I4M B;  2FMM A;  4O1N A;  1LTT D;  3NTI A;  4B9X A;  4K8J A;  4K5W A;  2A69 C;  4OO1 I;  1RTN A;  4A93 B;  5JEA G;  5EQ0 A;  1IW7 C;  3J7Y W;  3VYS A;  5D3D A;  1CHP D;  2EYL A;  1R9T B;  1J9O A;  2D2C C;  3VYR A;  4RGO S;  1LLR D;  3J7A F;  4Y7N B;  4Z9C B;  1SMY D;  3WOF A;  2JA7 B;  2E2I B;  2LMC B;  2BA1 A;  3P20 A;  1DYQ A;  2RVL A;  4X3K A;  2Q8R E;  1JCK B;  3I70 A;  5IT9 E;  1IKL A;  5IGC A;  3VR4 A;  2VB3 X;  2PPB C;  2RKS A;  4ULL A;  1SEB D;  1VMP A;  1A2T A;  2B2Y A;  2Q8I B;  3NHH A;  5CV9 A;  1CHQ D;  3AU7 A;  1HRJ A;  5JPN C;  1SNQ A;  5T1G A;  1WD1 A;  3S9W A;  1EY4 A;  1B1Z A;  4JBW A;  3K5N A;  3SHL A;  4EQN A;  1SE3 A;  5ELF A;  2MP1 A;  3S2D B;  3TN2 A;  1PZK D;  4FNF A;  5EPK A;  5J39 A;  2ICE C;  1MSH A;  4CJ1 B;  2KQ3 A;  4U67 3;  1EYC A;  2BE5 C;  3V2T A;  1KDC A;  4IFD J;  4H13 C;  2A73 B;  3SEB A;  2EY1 A;  1RD9 D;  4BS9 A;  2K01 A;  1UUP A;  2PQE A;  5I6Y A;  3DWA A;  4HMI A;  1ZYR D;  1SYB A;  3SDZ A;  2X69 A;  2QIL A;  4L8J A;  3I3C A;  2K6A A;  1I3Q B;  4K14 A;  5IOC A;  3R93 A;  5M5X B;  2K05 A;  1WD0 A;  2B2W C;  2XVS A;  2DY7 A;  5KYL A;  4N9T A;  5ISR A;  2F4I A;  4BY7 B;  5JEA J;  1GUS A;  1QE6 A;  3GTP B;  1SSO A;  5C0X H;  4I65 A;  1SBB B;  5E1F A;  5EKK A;  4ME5 A;  2J7Z A;  4X3T A;  1B44 D;  2AUJ D;  2HDL A;  5HGT A;  2B2T C;  1UAP A;  1LTG D;  3IAY A;  3VR2 A;  4TRD A;  2O4X A;  3K6O A;  1QOH A;  3KK7 A;  2PW7 A;  2C5C A;  2XN9 C;  2EYO A;  1B9N A;  1CTM A;  3EQL C;  4OO1 H;  4NP5 A;  3I73 A;  3MXG A;  3D6W A;  3Q24 A;  4OIK A;  1BF4 A;  3DM1 A;  5FK9 C;  3D8G A;  1D5Z C;  1QIL A;  4PMW A;  1KDB A;  1JWU D;  1TS3 A;  1LTA D;  2E75 C;  5JPM C;  3GTJ B;  1RKN A;  1F2Z A;  2F3W A;  3D4W A;  4C3I G;  2B2V A;  2FMC A;  1RCV D;  5C5M A;  4A3K B;  3LX0 A;  4ZQ3 A;  3NTH A;  1U4R A;  2RBM A;  1XYI A;  1M4V A;  5KNB A;  1GUN A;  2OXP A;  4LAA A;  2L0C A;  2DY8 A;  2JYO A;  1H9S B;  1HA6 A;  2JP1 A;  4DAV A;  1K8O A;  2WAQ B;  2XIW A;  3H6M A;  1Q1B A;  3NBI A;  1DCZ A;  4PNY A;  1HXY D;  4YIJ A;  2VNU D;  1E2V A;  3BDL A;  4XYQ A;  2IWH A;  3HOU B;  1SNC A;  5IIF A;  4FP5 D;  1TQO A;  1SND A;  1U9R A;  2JXM B;  1JOK A;  1BQQ T;  1Y8P B;  5IGB A;  3WOE A;  1I6V C;  1WCM B;  1PTO C;  2K03 A;  5LL6 X;  5D65 A;  1F2L A;  2RSO A;  4G7O C;  2L4N A;  4PMC A;  3HGB A;  2F3V A;  5ELD A;  4F8M A;  1SXT A;  1JOO A;  4BBS B;  4K6L A;  1BO0 A;  5C3E B;  2BOS A;  4C3J G;  3S1R B;  1HCZ A;  1F2M A;  2PO4 A;  1KLG D;  4DFA A;  3S1M B;  4XQJ A;  5D3I B;  2CVR A;  1EFI D;  2NWG A;  4V0B A;  4K5X A;  1AN8 A;  4NKL A;  1HFG A;  2WV6 D;  2WKD A;  3SE0 A;  2HCI A;  3A55 A;  1EIH A;  2R3Z A;  3R2T A;  2KEC A;  2M9V A;  3OMC A;  3X3M A;  4EQO A;  1KTK A;  1ML0 D;  4LK1 C;  1X3P A;  2A5H A;  2XWB B;  3A7L A;  2NVQ B;  1D6E C;  1BDO A;  3EA6 A;  1A3U A;  1ROD A;  2XNA C;  1STB A;  2F0K A;  1R4Q B;  1ENF A;  5AFW A;  3HKZ B;  5CR3 A;  3A8K E;  3T53 B;  4L63 B;  3N52 A;  1BOS A;  3CQZ B;  2K33 A;  4ZLT F;  1SYC A;  3Q6S A;  2O2L D;  1OXS C;  3I4N B;  3CKI B;  1GJX A;  1EQT A;  2M00 A;  2IW3 A;  4HSP A;  3EJI A;  4RGM A;  5I9P A;  1G8Z D;  1MD2 D;  4HTH A;  2LY7 A;  2NN6 I;  1I50 B;  2NTS A;  1G6Z A;  1TR5 A;  5EBD A;  3M7N A;  1H9M A;  5CYU A;  4RKB A;  3J80 E;  1YNJ D;  3S2H B;  3A8I E;  1CFM A;  4KKU A;  4ODG A;  1ILP A;  1GUT A;  1F2Y A;  1SYE A;  1Y1V B;  2B2U A;  4F88 A;  1WTQ A;  2QEJ C;  1SYG A;  2J4X A;  1WTW A;  1PFM A;  3GO5 A;  1YNN D;  2A6H C;  2SNS A;  4UDU C;  5M9O A;  2HUG A;  2MUY A;  3DMU A;  3SXH A;  5LL6 S;  4ZKB B;  3HS0 C;  4RGN A;  3K57 A;  4HCE A;  1ET6 A;  1CA5 A;  3MZ5 A;  5IOD A;  3R8B A;  1EYD A;  2CHB D;  4KKS A;  2QF7 A;  1GOZ A;  2PNR C;  1S4Z A;  2EJM A;  5C4Z A;  1EY0 A;  3MVV A;  1HFN A;  3A8J E;  2G9H D;  1LTR D;  2LS0 1;  3HOZ B;  5ELB A;  1SAP A;  5M3F B;  2V4D A;  3MTS A;  1Q90 A;  1LT6 D;  3CRL C;  5G3L F;  2JEA I;  1GUO A;  1EYA A;  3NP8 A;  4WOR A;  1SDF A;  4XT3 B;  3EVQ A;  3DXJ C;  5J1Z A;  1NCV A;  4ZAI A;  2QCP X;  3NK9 A;  3NTK A;  5KEE A;  5C44 B;  4DXG A;  2E76 C;  2XSC A;  4LMQ D;  4QCL A;  2SOB A;  5CV4 A;  1ILQ A;  2FFK B;  4K2K A;  2F0V A;  1B53 A;  2D5D A;  1JB3 A;  4XQN A;  1STA A;  5FLX E;  1ONL A;  4IUN A;  4RGT A;  3ND9 A;  3ND8 A;  2E2D C;  1B50 A;  3A56 A;  3VR6 A;  4CKB A;  1SNO A;  3NPP A;  2EVB A;  3C1E A;  3NXW A;  2O5J C;  2L5T A;  1BXT A;  2EDG A;  5EKL A;  1FD7 D;  4A3E B;  2F0H A;  3PUZ A;  3N6R A;  3GTQ B;  3SK4 A;  4G57 A;  1Q8I A;  4C2M B;  2PZW A;  2OT2 A;  3H09 A;  1ENC A;  4PMB A;  3F2U A;  3VA5 A;  5EPJ A;  2EJF C;  1V1P B;  3QJY A;  1HQR D;  3DWQ A;  4EQP A;  1FNW A;  1SYD A;  1XWE A;  2RSN A;  4OHJ A;  2NN6 H;  2RDG A;  4G7Z C;  4M8A A;  5DAU A;  5JVH 3;  2NVX B;  5NUC A;  1A3V A;  3BVM A;  1S5E D;  4C3H G;  3QB3 A;  4MIU A;  3KF8 A;  1TWF B;  1DJR D;  2WP8 J;  1G91 A;  3DWP A;  2EJG C;  3DHQ A;  2VXW A;  4RCN A;  3IL8 A;  4DAY A;  2EE1 A;  1BUV T;  4WRD A;  1QJO A;  4CHT B;  2EXZ A;  2QKI C;  1Q3L A;  5C5L A;  3PIP 3;  4KJN A;  4LJZ C;  2F0J A;  3M3Y B;  5LHY 1;  4BY1 B;  5IGE A;  1AZP A;  2OEO A;  4WJW A;  1S5F D;  2IT1 A;  1QWY A;  4A3J B;  4KD4 A;  2PCF B;  1LTS D;  1DM0 B;  1PMR A;  4GZY C;  3ITP A;  4DU9 A;  3H3V C;  1F9R A;  3S14 B;  2MJ8 A;  3HP3 A;  2NVT B;  1SFO B;  1EL0 A;  1I4G A;  1TT2 A;  3ZYY X;  2NTT A;  3K5L A;  5CBE E;  4ILW A;  2WAC A;  4RHS A;  1LAC A;  2PYK A;  3VR3 A;  1NR4 A;  3RLF A;  2KCC A;  3H91 A;  4DXF A;  3D3R A;  1Y69 U;  4DN4 M;  5F2D A;  3BDO A;  2BCO A;  3S1Q B;  2Z1C A;  2RDH A;  3FPP A;  3Q0A A;  2F1M A;  4QF4 A;  2KJX A;  1KAB A;  3I90 A;  2EYP A;  4V19 0;  5EBC A;  5FO8 B;  1WVL A;  4A3I B;  1EZ8 A;  3NE5 B;  2A68 C;  4WFN 3;  1AW7 A;  1CQV A;  3QWN A;  3I4L A;  1VMC A;  3NQI A;  1F9Q A;  4IAL A;  1PFB A;  2EY5 A;  4K8I A;  4FF3 A;  3OHX C;  4FF2 A;  4UAI A;  4IUT A;  3GTG B;  2JE6 I;  1W6J A;  1JOR A;  3H94 A;  3OPO A;  3EFX D;  2Y0S B;  1G29 1;  1OXT A;  1KAA A;  4RAU C;  3I91 A;  1M8A A;  3NUC A;  4EVO A;  3QIA A;  4KY6 A;  4PQX A;  1JIC A;  2R6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...