5DAUA

Crystal structure of staphylococcal nuclease variant delta+phs v39e/v104e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLEDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNNWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39E/V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dauA00
1EY5A 3TP8A 3T16A 2F0JA 1ENCA 5IGCA 4EQOA 4DU9A 1KDCA 5EGTA 1KDAA 1STAA 3MXPA 5C3WA 5KGUA 1A2TA 5IGFA 2F3VA 4EVOA 1EY7A 1SNOA 5CV8A 3D6CA 5JOBA 2PYKA 4ZUIA 1F2ZA 4G57A 1AEXA 4NP5A 3BDLA 5EKLA 3EVQA 4DFAA 3SK4A 1SNQA 2PZWA 4YIJA 2EY1A 2HQEA 2ENBA 4K5WA 2F0WA 4TRDA 1STNA 1SYGA 4ID6A 1STYA 1TT2A 3ERQA 3MEHA 4PNYA 5C5LA 4N9PA 1NSNS 1EYDA 2F0DA 3OWFA 5CV6A 3C1EA 5KEEA 1EY0A 4K8IA 5JAVA 4KD4A 5CV7A 5K5PA 5IODA 5IIFA 1SYDA 3NK9A 1EYAA 1II3A 2RBMA 4K2LA 4K2KA 4DGZA 3P75A 5KRUA 1JOQA 4EQPA 5HURA 3NUCA 5M9OA 3OSOA 2O4XA 3SXHA 5NUCA 3MVVA 3LX0A 4KY7A 1NUCA 3QOLA 4F8MA 3H6MA 1EYCA 4KV6A 4K6DA 4J1MA 3NXWA 1ENAA 3P1HA 4K5VA 1EZ8A 5I6YA 3HZXA 1TR5A 4LAAA 2F0VA 2QDBA 4NMZA 1KDBA 5C4HA 2EY6A 3MZ5A 2EY2A 4K8JA 4NKLA 4WRDA 3TMEA 3TP5A 5J22A 2F0LA 5DAUA 1STHA 4NDXA 2F0TA 2EYFA 5E3FA 1SNCA 4PMBA 3NHHA 4ZUJA 5C5MA 4WORA 2F0SA 5IGDA 1KABA 1EZ6A 2WACA 4H7BA 4QMGA 3PMFA 4RKLA 1TQOA 2EYLA 4MIUA 2SOBA 5C6AA 4I65A 2LKVA 4KY5A 1SYEA 1SYBA 4QB4A 5J1ZA 2F0HA 2RKSA 1SYFA 2F0QA 4B9WA 3DMUA 4B9XA 5C3XA 4PMCA 4KHVA 5KYLA 2EXZA 1SNPA 3SR1A 5C4ZA 5IGGA 3T13A 1EQVA 2EY5A 1F2YA 1RKNA 4S3SA 5HGTA 3D4DA 5J39A 2M00A 3OMCA 4IALA 2SNSA 5EKKA 3OMGA 4RKBA 3SK8A 2PW7A 4KTAA 3E5SA 4ZQ3A 4R8NA 5ISRA 1EY6A 3D8GA 2NUCA 4N9TA 4ME5A 5CC4A 2EYMA 1IHZA 1F2MA 1KAAA 2PQEA 2F0MA 2F0PA 3ITPA 2PZTA 1A2UA 1STBA 2EYJA 2PZUA 5F2DA 5IGBA 5CV5A 5DEHA 3U9OA 2EYOA 1EY9A 2F3WA 1U9RA 4K14A 5I9OA 5IGEA 3NQTA 5KYIA 2KHSA 1JOOA 3EROA 4IUNA 4HMIA 4J6HA 3SHLA 4KJOA 5CV4A 3DHQA 2PW5A 3R3OA 3SK6A 1A3VA 3D4WA 4HMJA 2F0OA 3HEJA 5E1FA 4E6IA 5IOCA 3C1FA 5CR3A 3TP7A 2SNMA 3V2TA 4KJNA 5CGKA 2F0KA 4ODGA 2F0UA 4IZ8A 2OEOA 2F0FA 3QB3A 5I6WA 1SYCA 2F0NA 3S9WA 2F0EA 4KY6A 1JORA 3TP6A 5CV9A 2OF1A 1A3TA 4DF7A 4K5XA 1EY4A 1A3UA 3VA5A 2OXPA 1SNDA 5I9PA 3BDCA 2EYHA 3MHBA 1EY8A 1JOKA 4KD3A 4QF4A 2RDFA 3SK5A 5KIXA 3NP8A 1STGA 2F0GA 3QOJA 3EJIA 4EQNA 2EYPA 4F7XA 2KQ3A 4HTHA 4OL7A 3RUZA 1SNMA 2F0IA
chains in the Genus database with same CATH superfamily
1JWUD 2A69D 1KRSA 4DK0A 3IFTA 1XPOA 4DR2Q 5C3WA 3G4SA 1STAA 2IX0A 5C3EB 1DD2A 2UUCL 1HTLD 1F9PA 2EQSA 4ZUIA 2B2WC 3GDEA 4JI0L 4DFAA 2QEXA 2EY1A 3A74A 4CBVA 1SYGA 1BVSA 4ID6A 4YHHL 4JI6Q 5C0XJ 1FGBD 1Q8KA 3OWFA 5FJ8G 2ZTDA 1CA5A 4LNQA 2E75C 3KFUA 1SE8A 1XX8A 3NTKA 1JOQA 1VF7A 4U68A 2L4NA 4BY7B 1SE4A 4A75A 2B3GA 1DCZA 3HOZG 1KXLA 1LTGD 1LT4D 1EYCA 4X64L 4P75A 3X3MA 3P1HA 4B3RQ 3KF6B 5I2XA 3FVQA 2KCMA 3HZXA 1N33L 1RTNA 2Q8TA 1EQRA 4CJ1B 1LACA 1EFWA 3AU7A 2JEAI 1QUQA 4GN5A 3HOZB 3LWUA 5DM63 5M5WB 4JYAQ 4O0AA 1OXSC 4RKLA 4MIUA 3I4MH 4BBRH 3KBXA 3J80i 2LKVA 1QZGA 1SYFA 3T1HQ 3GTMB 5KNBA 2UUCQ 4R4CA 3M4OH 1RKNA 1G6PA 1H95A 4A3KH 2N88A 3OMCA 4CDFC 5JEAJ 1X56A 2PO4A 4HIOA 2HIVA 4QGUA 3OTOQ 4DV4Q 4DR5L 4DPGA 2DNCA 1X3GA 4FO2A 2M9VA 1I4PA 5C4JH 2PZUA 3TZUA 4JBWA 4ZRZA 1EFID 2BA0A 4ZKCB 5M5YB 3ULPA 3U9OA 3G6JB 3CHBD 3A8JE 5J3BA 3CC4A 1TWCH 5CV4A 1Q1EA 4DV5L 2PMZB 4JI2Q 2JA6G 1ML0D 1HNWL 4DR4Q 2XGTA 3S17B 3ULJA 2Z8LA 4QUCA 3CQZB 3S9WA 2R7DA 3UI2A 3I8ZA 1Y8OB 4OWXB 3HFZB 4KKUA 2JA6B 4A93H 3CCQA 3S2DB 1GD7A 4IUUA 2K14A 3N6RA 1EIHA 3T1YL 1SNMA 4JI4L 2KENA 1GXDC 1B44D 1V8QA 2TMPA 4X3UA 1EIFA 1ASZA 4DR1L 1QVGA 3C46A 1H9SB 3STBD 4G57A 5IWAQ 2ES2A 1QWYA 3GO5A 2X69A 4DV7Q 1AP0A 1Y14B 3EN2A 1O7ZA 2O5JC 1M4VA 5JJIA 3C1EA 4K8IA 2A1AA 2K33A 1SYDA 3VYRA 1B3AA 1BF4A 2E2IB 1KRTA 4K6DA 2OQ0A 1TR5A 3K0YA 3CCSA 4RCOA 3TP5A 4F87A 4NDXA 2RDGA 5E3FA 2IX1A 1R4QB 4CJ0B 2N55A 1S5CD 4A3JH 3ER0A 2JQOA 4QMGA 3Q6SA 3K59A 2MPMA 2EE1A 1C4QA 1FD7D 5ELCA 5D14A 1BCPB 1PTOF 5J1ZA 2UU9L 2WFWA 1SXTA 2ZTCA 1YVCA 3TZDA 1A62A 2NWGA 1PRTF 1CZWA 4S3SA 4QCLA 2CWPA 3NWTA 3UE0A 3PCOB 3GV3A 2ZM6Q 4KK7A 4N9TA 2Z9HA 3VA5A 5F2DA 5IYDG 2UUBQ 2DJFC 2K5NA 3M4YA 2B2VC 4M8AA 2ICEC 4QIWB 2GVAA 1VQEA 1D2BA 5GAHC 4X65Q 2VUMH 1WFQA 5G3LD 1CQFA 3BYTB 1VQFA 1XJVA 4HEDA 1CKOA 3H09A 2RSNA 2D5DA 4FF4A 3MTSA 3PUYA 4HSPA 2OXPA 1V9PA 5EBCA 1Y69U 2R92B 1VCIA 3AFPA 2JE6I 2YTVA 3MHBA 1R4PB 1STGA 3I91A 4DV0L 1Y8NB 4QJFA 1MKHA 3EBEA 2JXMB 2LSSA 1G8ZD 5FLXL 2K5DA 4IPDA 1VQ6A 3SGIA 4ZKBB 2K03A 1DXMA 3OIPA 2D0OA 3CCEA 2IWHA 3MFGA 2NVQB 1I6HH 3S1QH 1U4RA 3VR5A 2ZXPA 4TRDA 1CKMA 4Q0FA 2NVXB 1PMRA 1ZKOA 4NXML 4AYBE 3RMHA 3RN2A 2KCTA 5CV6A 3S14B 4ZLTF 1EY0A 1GO3E 2MUYA 4R4IA 1A6XA 5BN4A 1D5MC 1G51A 3KF8A 1KIXA 3HOWG 4I7ZC 3JAMc 4P73A 2KCNA 4A3EG 4YCWA 1FYCA 2XWBB 3W3AA 4ULLA 3TQYA 2B63B 1VDZA 2LS01 4ME3A 1B53A 3HOXH 4CHTB 5M3FH 4V190 3BZDB 4R1JA 1CKNA 1V1OA 1GVPA 1Z47A 2LFNA 3HOWB 1HR0W 4A3EB 2E2HH 1KABA 1AH9A 3RD4A 4Y7NB 4TKOB 2DJGC 5LHY1 2XWJB 1SYEA 4UP7A 5CORA 3M4QA 2HT1A 1SMYD 5LL6S 1M90C 2HHHQ 1LTBD 1SNPA 5IGGA 1SROA 1KC8C 3D4RA 4IALA 2OTLA 2VS1A 2BH8A 2PW7A 4OX9L 4HJ5A 3E9HA 4DNTB 3VDYA 2F0PA 2WIIB 3PO2H 1I4GA 3KUPA 3KF6A 2HDLA 3NPPA 2J0TD 2NB0A 1CHQD 2EDGA 4MHEA 1TKWB 2NZ1D 1GUWA 4LFBL 1VQ7A 1TWHB 1BBUA 1HNZL 4JI3Q 1XMQL 2MO0A 2M2LA 3HEJA 5FO7B 1VQMA 1F2LA 1WOCA 2PI2A 1JWSD 2FFKB 3MXNB 1PTOC 1W6KA 5LMNW 4C3JH 1B9NA 3I4MG 4BBRG 1DOLA 2AQ3B 4JOIA 1PRTC 5I9PA 2RHSB 2EYHA 1WTXA 2JK8A 1VQDA 2A6HC 2F0GA 4APVA 2AQ2B 2VW9A 4A3BG 4B3MQ 5M5XH 2BCOA 4A3KG 3NBHB 1A8VA 1IYUA 1L1OC 4BBRB 1VQKA 3I7FA 2B2TA 2Q2HA 1O78A 5JOBA 2IY5B 1QZHA 5GROA 5D65A 1WCMH 4L5QA 4NW2A 1BNZA 3M4OB 3L0OA 4A3KB 4DN4M 1N8RC 5LL6X 1WJJA 3J7AF 4IFDI 5LMNL 2K5WA 4KN7C 1YHBA 4JPBW 2L12A 1UEAB 3I4NH 1II3A 1NAPA 1T5EA 2OCEA 2WAQE 4RGMA 5C4JB 3GTOB 1GOZA 4EQPA 5JJLA 1QUQB 1XNQQ 1C8CA 1NUCA 1PYSB 4RGNA 4LF6L 3PIPA 1TWCB 1YNJC 4EX5A 4NMZA 2K52A 3BU2A 4A93G 3GTJB 3TN2A 5J22A 2A19A 2LXKA 5IE8A 1J5EQ 3EIVA 1G6ZA 5FO9B 2LY7A 1PFMA 2R6GA 2NVTH 3CCVA 4R4OA 2L15A 3EA6A 2O2LD 4ABNA 1IW7C 1K8AC 4A93B 1E22A 4OGQC 4KY5A 1GJXA 4FVMA 2F0HA 1BXTA 1SAPA 2RKSA 5D3IB 4PMCA 2EPBA 2Q2IA 1JQYD 2XN9C 4KHVA 5BR8Q 2E5LQ 2EXZA 1R9TH 1QNUA 3HOUB 5J39A 5HGTA 1ONLA 4KN4C 2K04A 5GAGC 2Z4HA 3U4ZA 3D8GA 2FMMA 1VQPA 4H02A 4LFCQ 2PZTA 4IJHA 3J81c 1KNEA 1YNJD 1KL9A 3HKZE 1BBWA 1GKHA 4LF6Q 1I6VC 3CRKC 1EQQA 3PUWA 4BY1G 2SNMA 1OXTA 2NN6I 3J7ZC 4IZ8A 1HA6A 1HXYD 1X3PA 2OEOA 3DEOA 3C2PA 2F0NA 1K73C 4A3JG 3K6OA 3GD7A 1IW7D 3ICEA 5LMUQ 1PH4A 1PTOH 3BVMA 2OWOA 4OHJA 3A0JA 4X3KA 3S2HH 2YTYA 1PH9A 1K8GA 4IUPA 3SK5A 3QOJA 2MFIA 1M1KC 4LF4Q 3G7LA 4A3JB 4RG1A 1S5ED 2VQFL 1OXVA 4X3SA 4DU9A 1VQIA 3OW2A 1IBKQ 1Z9FA 2AWNA 1HUNA 1RDPD 4UP9A 1U0LA 4GN4B 4OELB 1SNQA 4DNIA 4CKBA 3BS1A 1B70B 1CT1D 2CQOA 3HKSA 4UPAA 4JBKA 1NSNS 1CZGA 5KEEA 1Q86C 4WFN3 4L63B 4KHPL 3IAYA 2VUMG 5IODA 5K5PA 1EYAA 1N34Q 3K5NA 4IOCA 1RHPA 1KTKA 2CQAA 4LFAQ 1FNVA 1EZ8A 3TREA 2IJ0A 4AQYL 1BDOA 1H9RA 2F0VA 2VUMB 1KDBA 4NKLA 2K05A 2F0TA 1XXGA 4ZUJA 4C2MB 2A6EC 3FDTA 5JPNC 3TDQA 1TXYA 2SDFA 1B3QA 3J80E 1ICFB 1RODA 1KNAA 3CPWA 1LT3D 4DNRB 2ID0A 1PZJD 4A4IA 5C4ZA 3HOVH 3WWVA 5BN5A 4MTNA 3A5ZB 4JI7L 1ZXTA 1SSOA 1I94Q 2WB1B 3E3XA 4HJ8A 2JA7H 1Y1WH 2C9OA 1I6HB 4OO1I 3S1QB 3V05A 3E0JA 2A68C 3RZOB 1V1PA 1C7YA 4C1NI 2BE5C 1B1ZA 5DEHA 3IKJA 2AUJD 2KHJA 5KYIA 3NQTA 1OTCA 3HOXG 4AIMA 1EYGA 4BBSG 1IBLL 1A3VA 2L0CA 3TRZA 1TWGH 1X32A 4AYBG 3I73A 3C1FA 5CGKA 4POFA 4DR2L 5CBAE 2F0KA 4XT1B 3FKIH 1VMCA 1K28A 4DV2Q 2OF1A 1EEFD 2JJQA 1BR9A 2MP1A 2CH4A 5M3FB 3S1RH 5JJKA 3NE5B 2ZJQA 4JBMA 3D3RA 4GLXA 3I55A 2Z4IA 3FP9A 3NP8A 2E2HB 3SVMA 4DK3C 2Q2UA 5A2QE 3DM3A 3KLWA 2PPBC 3TP8A 1LTAD 1NJIC 2K4KA 3KLRA 2Y0SE 1I3QH 3DXJC 5EGTA 1W3SA 1EY7A 1EWHA 2A68D 3D6CA 3G71A 4B3RL 3PIOA 4J8QA 3PO2G 5ELEA 3KF8B 2K1BA 5C4XH 2ZXRA 1PH5A 4MTKA 1GM5A 4DR7Q 1QNKA 4LF9L 1DZ1A 5CV7A 4RHSA 2GVBA 4JYAL 3WOFA 3PO2B 4ZYSA 3ERSX 3MXNA 3NUCA 1CKNB 1IBLQ 3SXHA 2RCFA 1CA6A 4C3JG 1K9MC 3BJUA 2B8GA 3NXWA 3T1HL 3M7NA 3QJYA 1GUOA 4A3IB 4DV3Q 3PUVA 3CXCA 3PF5A 1SE2A 3NBHA 4CDDC 3OTOL 4C3JB 4DV4L 5IP9H 4LWCA 2F0SA 5IGDA 4V0BA 1UAPA 2RSOA 4Z9CB 3K81C 3PMFA 2GN5A 5C6AA 1G91A 4CDEC 4R9WA 2WKDA 5JVG3 1WCMG 2F0QA 4IFDG 3AB9A 4JI2L 3DWAA 4L5RC 4UY8C 4DR4L 1VQOA 3T13A 3GQBA 3D4DA 3DUZA 1U4LA 5IYBG 3I4NG 4X66Q 3OIQA 1WCMB 2YYZA 4ME5A 4LF9Q 3TEHB 1STBA 1TU2B 1J6QA 4LUOA 1DOKA 4CGYB 3IFDA 1IBMQ 2BOSA 1T5XD 2NYZD 2KEDA 2KHSA 1JOOA 2PW5A 4DUZQ 2R7ZG 3TP7A 4JI5Q 4ODGA 2A8VA 1UEBA 1WTHA 2F0FA 1PH2A 1EQTA 4A3BH 3GP7A 2WAQG 5IWAL 1SRUA 1ICWA 2VB2X 4OONA 4DV7L 3A55A 2HD3A 5AJ3L 4XYOA 3CKIB 1PLFA 2NVTB 4EQNA 5I2YA 3BVZA 3HGBA 2F52A 2R61A 4GS3A 4OWTB 1L2FA 2B2WA 3NSWA 1EU3A 4C3IG 2K5HA 1MHWC 3EVQA 1R9TB 4K5WA 4IJLA 3ERQA 3WDNA 3IRBA 4H13C 2MJ8A 1NMGA 2IHEA 3I70A 3AEVA 3GTQH 5FLMH 5IIFA 4K2LA 4DGZA 3P75A 3LWEA 2KVMA 1D1KA 4RHRA 5EJWA 3KK7A 4P71A 1FJGQ 4K0KL 1MIUA 2K75A 4DA2A 5L37A 2AHOB 4K8JA 1JE4A 2EY2A 3CAMA 2G5DA 3KBGA 4X62Q 1PV4A 3HKZG 2L1BA 4JC0A 1A0IA 4QL5A 3NHHA 2ZM6L 4KMUC 3PUXA 1IYVA 1PTOB 5AJ3Q 4IPHA 2K6AA 2UUBL 1B8AA 1F9QA 3S2HB 1PRTB 1EOTA 1PH7A 2B2UC 2K50A 3BVGA 1HPCA 1TS5A 5HGQA 1K0SA 3VR6A 1TWFH 5GQOA 1YI2A 4X65L 3R93A 2BH2A 1IYJB 4WJWA 5JPMC 3JAME 4ZAIA 4KTAA 4R8NA 1JT8A 2MQHA 1M8AA 4CKEA 4BY1H 3J81L 1ENFA 2FMCA 3SR1A 2PQEA 4CDCC 4EVOA 3ND9A 1HZ9A 2AWOA 3K58A 1X9NA 3S1MB 3CW2C 3AFQA 4K0KQ 1G291 3L2PA 4YCUA 4BA2I 2F0UA 2XVSA 1SYCA 4YCVA 1Q82C 4IOAA 3FPUB 1RTOA 1HH2P 3CCUA 1Q90A 3MEFA 1WYDA 4U673 3S15H 1F9RA 5M3MH 1WTRA 1IL2A 1HA5A 3I90A 3HOVG 2HIXA 2SEBD 2EYPA 3K80C 2KQ3A 1YIJA 3AMUA 2JN4A 3KYHC 1ENCA 2RCNA 5IGCA 4EQOA 2JA7G 1Y1WG 1MJEA 1CSPA 3MXGA 2RHQB 3VYSA 4DR6Q 1PDQA 1JCKB 4WJ3M 1C48A 4FDBA 4NP5A 4OIJA 3HOVB 2PZWA 5C44H 3HP3A 1MGSA 1KD1C 4PNYA 1FL0A 4N9PA 1Y1WB 3PSIA 4KI0A 1EU4A 1J8IA 2N8NA 2MNAA 3FKIG 2D62A 1W2BA 3LX0A 2HUGA 4KV6A 4GNXC 2JA8G 1K0RA 3J7AV 1QJOA 2HHHL 1BCPF 2Q2TA 4DK6C 1TWGB 4A3FG 2EY6A 2D0PA 5DAUA 4Y52H 4JVZA 3FKIB 1SFOH 4WORA 2FHTA 3M3YH 1HFGA 3S1RB 1PH6A 3M7GA 2Z6BA 1E7ZA 4P2CB 5C0XI 2NZHA 4P74A 4B9XA 1BUVT 2CCZA 1V1PB 5C4XG 4ZCKA 4JI3L 1HNXL 1HZBA 4XT3B 3A54A 1XPUA 2CHBD 5E7NA 2I46A 4BBSH 2EXDA 3E5SA 3GTLB 1PYBA 2Y0SG 1O80A 3K0XA 4A3MH 4DV6L 1QOHA 1EL0A 1VQ9A 1TWAB 2B2VA 1A2UA 1TY0A 1LT6D 2GA4B 3M4PA 2L11A 4LUZA 2QF7A 5IGEA 3MAQA 3OHXC 3K7AB 4KJOA 4B3ML 3R3OA 2HCCA 2Y0SB 1YJNA 5CR3A 1GUSA 3PO3H 5IP9G 2PNRC 3CPFA 4O42A 2ATWA 1SR3A 5CV9A 1SN8A 3TSSA 1EY4A 2HDMA 4FP5D 3JAMi 3M9BA 1XTDA 3QG1A 2ZTEA 2C35B 4R4TA 2JYOA 5D3DA 4F7XA 3S16H 1YHQA 2B2YC 3EROA 1EY5A 4GNXA 1PA6A 1XNQL 1K3RA 1YHAA 4A3DH 1HNXQ 2Z1CA 1P8LA 4EQ5A 1AEXA 1IKLA 2K28A 1STNA 1J5EL 4MZ9A 1DOMA 4GZYC 1HZCA 4DV6Q 2K01A 1ESFA 2A5HA 1LTTD 1ET9A 2VL6A 3I2ZA 1JICA 4GOPC 4KD4A 4KLKA 3PGZA 5KNDA 4GLAC 5M9OA 1FNUA 1UE1A 1VQCA 3NTHA 2IPKD 5NUCA 4L5SA 3F2CA 4POGA 3R8BA 3I4MB 1Z6HA 3VYTA 1K8OA 1ESRA 5DM73 5I6YA 5BR8L 1VQ4A 2E5LL 5C4HA 4DUYQ 3Q22A 1LTID 5KNCA 4A3BB 1O7LA 3ND8A 2X6GA 4IFDH 3E9IA 2RA4A 2UXBL 3NTIA 3UDFA 3D0FA 4LFCL 4BS9A 2K32A 4BY7H 3I4LA 1W6JA 2SOBA 1H9JA 2KUMA 5IYBH 2VQEQ 2E76C 1SYBA 1GUTA 4O1NA 4LF8Q 1PTOD 3DMUA 2ASBA 3J7YW 1BOSA 1VQAA 1WVLA 1PRTD 1D1IA 4KKSA 5FLMG 4IPCA 2A6HD 2F3IA 5FLXE 2R7ZH 2WP8J 3G6EA 2N49A 3F2DA 5LMUL 2QCPX 3PF4A 1TS4A 2F0MA 2XTIA 2EYJA 1HR0Q 2B2YA 1E1OA 4PZ6A 2PMZE 4IUNA 3GTQB 4LF4L 1V43A 3VR2A 3ULLA 1LM0A 1S5FD 4HJ7A 1FVIA 2CH4W 3A56A 1N36Q 4B3SL 1HJPA 1PYWD 5IT9E 2AMCB 3CCJA 2UXDQ 1IBKL 3BZCA 2BA1A 4HJ9A 4RGTA 3H3VI 4KY6A 3TP6A 3I56A 3GTKH 2FINB 3O13A 1WD1A 4HSVA 2UXBQ 2KEEA 4RGOS 1U4MA 2FJ2A 4HAEA 3EFXD 4C3IH 1NMFA 2PCFB 4HIKA 3QO2A 1L1OA 2F0IA 3S17H 2F0JA 3Q0AA 4L8JA 2G9DA 1N34L 4FYDA 2DY7A 2AQ1B 2NN6H 3ONAB 2V4DA 1OXUA 1TVXA 3T53B 4IUQA 1CK1A 3H0GH 3F8TA 4ZK9B 3K5MA 4LFAL 5I4DA 3MC0B 4A3GG 3HG9A 1LTLA 3SK4A 3FEWX 3S2DH 5DLQE 2F0WA 3HOYH 1STYA 1TT2A 3MEHA 2D2CC 2DGYA 3K57A 1P16A 2F0DA 3I72A 4FXKC 4BY1B 1E2ZA 2RBMA 2X6LA 1I5FA 1NCVA 1SEBD 1IXRA 2ZJPA 4KY7A 3QOLA 1MI2A 2NZOA 3CD6A 4B3SQ 1JJGA 3QIAA 5M3MG 2VXWA 2IW3A 3CCRA 3E0EA 3J81i 2QDBA 4LMQD 3KDFB 4XTCS 4X6AH 3RLOA 1I94L 1VQ5A 3S15B 2QILA 1Q12A 5M3MB 1ILPA 1EZ6A 1Z7TA 4H7BA 2E2IH 4JW0A 1TQOA 2EYLA 1DGSA 2CKZB 2A74C 5C44G 2EY5A 2R7FA 2QKIC 3MWYW 4BXXG 3LGJA 2SNSA 4L6TB 4DV2L 4ZQ3A 1CSQA 1X3FA 4EGVA 1VQLA 5C44B 2WKCA 3E6ZX 2DY8A 4R8IA 3F1ZA 3KLSX 1G2TA 1QVCA 4QIWE 1RJTA 3GV6A 3U50C 1KQSA 3WOEA 1N32Q 2F4IA 2P5ZX 3D4WA 2Z6KC 2UXCQ 2JP1A 2K5VA 1XNRQ 1XWEA 1PXUA 1JB3A 1HQRD 4HR7B 4XQJA 4DF7A 4DXFA 3H15A 4GKJL 4B3TQ 2VY3A 4LF5Q 1L0YB 1SFOB 1ASYA 1JOKA 5ELFA 3EQLC 4DR7L 3CCLA 1X54A 1CHPD 2YV5A 3M3YB 3VR4A 3K8AA 2B29A 2XSCA 4OIKA 2BDOA 3MXPA 4A3MG 2I0QA 2B39A 2L5TA 2A6ED 3BDLA 3AQQA 4HCSA 2R92H 4DV3L 3C3LA 1X3EA 1KLGD 1RCVD 4DAYA 2EIFA 5C5LA 3OW7A 3HOXB 2JA8H 5H1SE 4HJAA 4BBSB 4A3CH 4AYBB 4A3FH 2I5HA 1E24A 3L7ZC 4K2KA 5KRUA 3PO3G 2KHIA 4MN3A 1T9HA 3MVVA 1YITA 1WTQA 4J1MA 1ENAA 2OQKA 5JEAG 3OYYA 4G7ZC 3HS0C 5A35A 4LAAA 1FR3A 2A69C 4X3TA 2NVYH 2G9HD 2BDNA 1C0AA 1V1QA 2BE5D 3UDXA 3NELA 2CW0C 1IZ6A 3W1GA 4GKJQ 4X66L 1QE6A 1UE5A 4A3DG 3DWQA 1YJWA 2LXJA 1IBML 1PZID 4C3HH 4DK1A 2K5QA 4QB4A 1B9MA 1YEZA 3HRZC 4GKKQ 1X6OA 5C3XA 2F4VQ 2K7VA 4DUZL 1FGUA 4PG3A 4FXDA 4JI5L 4A3DB 2M00A 1XTCD 3CP0A 4QUFA 2PNHA 2QA4A 4NXNQ 1TS3A 5ISRA 2KECA 1S3OA 5IYCH 4Y7NH 5FOBB 5EPJA 1PHJA 2RDHA 1LT5D 5EQ0A 1RIPA 1LABA 4C56C 3BG3A 4K14A 5ELOA 5I9OA 1NE3A 4HMIA 4QY7A 1JJ2A 2CW0D 2ZJRA 5G3LF 5E1FA 5M5XB 1X65A 2YU9H 1STEA 5I6WA 3J80c 2F0EA 3OWEB 3KJOA 4BY7G 2I07B 4GNXB 4HIMA 2EJMA 1A3TA 5IP7H 4FF2A 4K5XA 4DR3Q 1TY2A 2QW7A 1HQMC 4DKAC 4DAMA 1WD0A 4QF4A 1TWHH 1LO5D 4PZ7A 3R2TA 3KJPA 5AFWA 2XRQD 1I4HA 3I4NB 4LUVA 5FO8B 2XIWA 1KDAA 1SBBB 5IGFA 1PFNA 2EZVA 1XMOQ 1FJGL 3K7UC 1F2ZA 3D6WA 3PUZA 5EKLA 2UUAQ 3RLNA 5K36H 1E2VA 4X62L 4LF7Q 5HY6A 4JCVE 2KCCA 4JI1L 3VR3A 1EYDA 4JG2A 4JI8Q 2R7ZB 1AE3A 3RZDH 1L0XB 2NTTA 3KOJA 3RLFA 2WAQB 2VZAA 1OO9B 2KA7A 1CQVA 4F8MA 3H6MA 1E2WA 4YY3L 4OXPA 2R93H 4UAIA 4L5TA 3T51B 4JI0Q 1Q1BA 4WRDA 4IUVA 4YHHQ 3TS0A 1VS0A 3TBIB 1HHVA 3STBC 3GTOH 3GTKB 2B8FA 3TS2A 2OT2A 4F88A 2NN6G 4B08A 3H0GG 1SJHD 4C3IB 5EBDA 2OTJA 3U9SA 4X64Q 2Z0SA 2Q8IB 3GTJH 3HOYG 1K83H 4HCEA 3W2DA 1ILQA 1JJCB 1EIYB 4IQZA 3NWSA 4YWKA 1N33Q 4XQQA 4ALPA 4A3LG 3OMGA 3H0GB 4RKBA 2JSOA 1BKBA 3GTGH 4CJ2C 5TSSA 4RAUC 2CVRA 4JI1Q 1NY4A 3LNNA 1YNNC 3HOYB 5CV5A 2E2JH 2CWAA 1I50H 2EYOA 4DAVA 1U9RA 3KDFA 3HKZB 5T1GA 2R3ZA 4KHZA 3SK6A 4YY3Q 4GOPB 3HOUH 1LV9A 1LUZA 1Y1VH 5IOCA 3V2TA 1SDFA 3RN5A 4IFDJ 1HFNA 1X3QA 4DR6L 1PFBA 3L9AX 1L1OB 1JE5A 3KLSA 3D31A 4DR5Q 4NPSA 5EAYA 2IT1A 1K8MA 4A3GH 1D5XC 4KD3A 1F77A 2IL8A 3RR5A 3RUZA 4DV5Q 4MNOA 3IL8A 1HNWQ 2RVLA 4G7HC 3P7JA 1CFMA 1JWMD 1YNND 2PYKA 1AFPA 4WJ4A 1UNSA 1Q46A 4YIJA 1LYLA 4XYQA 1SLJA 1XPRA 3SEBA 2KBNA 1WI5A 1RF2D 2Q8RE 3U4VA 3T1YQ 3BZKA 1AW7A 4C1NK 1E0BA 1MJCA 4JI4Q 5GADC 3J7A5 4UP8A 4OO1G 3OOCA 5ELNA 1IL8A 4DR1Q 3Q8DA 4AH6A 3BYYB 5FKAC 3TMEA 4TQUS 2J4XA 3AYHB 2ZXOA 2TSSA 4IUTA 2JA7B 4NB3A 1FNWA 4BXXH 1CTMA 2B2UA 4R4QA 1D7QA 2R92G 2EJFC 2E74C 2DNEA 1DM0B 4KKTA 4XIGS 3A5UA 2WB1E 1A63A 1EQVA 3NQIA 5EPLA 4A3CG 4DV1L 4C2MH 4JBJA 3UE1A 3CC7A 1BQQT 4IO9A 1G2SA 1EUJA 3ITPA 1NR4A 2DUDA 1ET6A 2JA8B 5GAEC 1PZKD 1EWIA 5C0XH 1PH1A 1LLRD 4A3FB 2UU9Q 3SHLA 4YWMA 1EIGA 3SE0A 2F0OA 3RNUA 4UHVA 1RL2A 4PMWA 1HRJA 1I3QB 4RH6A 3GTPH 1A15A 1SMYC 1LTSD 3RZOH 3PQIA 1JORA 1I4XA 2JA5H 2ICIA 2AUKA 2NVYB 3CMAA 4C3HG 2NTSA 2A73B 3J81j 2B63G 5IT9L 2QDLA 4JOIC 1U5KA 5FK9C 5C4XB 2RDFA 2NBFA 1KHIA 3EJIA 5CBEE 1YZ6A 1GUNA 3UDGA 5DNFA 3PIP3 1ZYRC 4XXEA 1EEID 4DAYB 1K3BC 4C3HB 1KDCA 1GUGA 1ZEQX 3H3VC 5KGUA 2H1EA 5IYCG 1SNOA 3PV0A 4DV1Q 5E4WC 2B2TC 4IURA 4Q5VA 2PQAA 4DUYL 2L9HA 1S5BD 2VB3X 3X3NA 4FNFA 1NNXA 3W5OA 1Q81C 5JEAH 2HQLA 5JAVA 1D5ZC 1D6EC 1KLUD 5IY0A 4XQNA 4TVAB 1QVFA 2YTXA 1HUMA 4DV0Q 5CMDA 3S1NH 4N8FA 1VQGA 3VA7A 1U4PA 3CU7A 3OSOA 3DM1A 2VQEL 4ILWA 5IP7G 3J81E 4LF8L 2CFMA 1Q3LA 5JVH3 4A76A 3A7AB 1GHJA 2YU9B 1STHA 3R2IA 3CRLC 1F9SA 1AZQA 4NXMQ 1VF5C 1ZYRD 3ZYYX 4UDUC 2WV6D 4RMFA 1HR0L 3T56B 5E4XA 4RFBA 3A8IE 5COYA 3FMCA 1YNXA 5C3EH 2MHVA 1Q8IA 4GN3B 4A3IH 5K36G 1N36L 4O2DA 1I4QA 1O7IA 1MSGA 2UXDL 5ELBA 3SK8A 2L55A 1EY6A 3DEPA 2NUCA 2PI2E 1IHZA 1F2MA 2EVBA 3U58A 1S5DD 2R93G 4YWLA 2EJGC 3RZDB 2F03A 3P20A 1VMPA 3DHQA 1D8LA 4PQXA 5FJ8H 1L0WA 1YJ9A 3K5OA 1VQBA 5EPKA 1UE6A 2I5MX 3SDZA 3F2UA 1JMCA 4FF3A 3J80L 2VNUD 1B2TA 2R93B 4OX9Q 3HOZH 4PZ8A 1AN8A 5M5WH 3URYA 3VYUA 1S72A 1NTGA 1YBYA 1A3UA 4N8X1 1SNDA 1O7YA 3K5LA 1BCPC 3H91A 3FRPB 5KIXA 1VQ8A 4LFBQ 1AZPA 3GTMH 1C9OA 1HNZQ 1XMQQ 1VQHA 2MGSA 2F3VA 1VQJA 1JR0D 3H3VH 1K83B 2HQEA 2ENBA 2JA9A 3OPOA 5CYUA 3L3OC 3NBIA 2V1CC 2D9UA 5JJZA 3T4AC 5M5YH 4GOPA 3GTGB 1E3PA 3HOUG 1QCBD 3QWNA 1Y1VG 1JB7A 1H9SA 2MO1A 2E2JB 4HN7A 5HURA 2O4XA 1QILA 1I50B 2XRSD 1AE2A 2H4OA 4H0LC 1B7YB 2N78A 5EKIA 2C5CA 3CQZH 2F1MA 4BWGB 2J7ZA 3JC66 1BCPD 1Y1VB 2LMCB 1TWFB 5A2QL 1EWCA 5T1IA 2EYFA 2JA6H 3I4OA 4LW1A 1UWVA 5LMNQ 3NENA 1MSHA 2E2DC 3H94A 1PFSA 1HCZA 2FXQA 4A3LH 4G7OC 4XDXA 1SE3A 1XYIA 4A3GB 1PVOA 3MXUA 1N32L 2UXCL 2XNAC 1F2YA 4IN3A 1XNRL 1Q7YC 5EKKA 2WINB 1BBXC 4LK1C 1GHKA 1VQNA 1PH8A 4JK1C 2EYMA 4DAPA 5CC4A 1NBWA 1QB5D 1NR2A 4B3TL 4LF5L 2N3SA 2JEBI 3DWPA 3A7LA 3N52A 4IPGA 4HMJA 1SJED 4LJZC 3CF5A 1H9KA 3PIO3 1H9MA 3S24A 4KJNA 3NEMA 1J9OA 5BN3A 4FXGC 1OXXK 1WTPA 3BDCA 1X55A 3S1MH 1UUPA 3Q23A 4K6LA 3M85A 1DONA 1TIID 3T16A 3A8KE 4PV1C 3MFYA 2QEJC 5FLXc 1PH3A 1JC7A 1A2TA 3MA2B 5CV8A 4JV5L 1RD9D 4GLVB 1Y8PB 3DLLA 3FHWA 1KAWA 4RA8A 1N9WA 2HCIA 5C0XG 4G4KA 4OO1H 4QQBX 3BDOA 1EOVA 2EOTA 1B50A 4OEMB 2WB1G 5IT9c 2KOLA 3NK9A 2VQFQ 4DXGA 3CMEA 5IYDH 2DN8A 2JA5G 4GKKL 2F4VL 4K5VA 1LTRD 4OWWB 1CM9A 5ELDA 1B4OA 2H5XA 1S4ZA 2F0LA 4M1UB 3CCMA 1TS2A 1SNCA 4PMBA 3GTPB 2IX3A 3FPPA 1HTPA 4NXNL 5C5MA 2JA5B 4KHPQ 1CI3M 1WTOA 2RF4A 2QGQA 4A3MB 2WACA 1S40A 4FF1A 1BO0A 3G48A 4I65A 3V96A 5M3FG 1DJRD 3W1BA 4B9WA 3Q24A 3CC2A 4AQYQ 3UDIA 5KYLA 2NVQH 4JV5Q 2ZT9C 1E1TA 3ZJYC 1WTVA 2ALYB 2NVXH 4TSSA 3PO3B 2RQXA 2I5LX 1CUKA 3S14H 4JI6L 3I3CA 4P72A 1KAAA 4DR3L 3MZ5A 5IGBA 4J15A 1DYQA 1EY9A 2E8GA 2F3WA 2IHFA 1SMXA 3B6YA 3F2BA 1WTWA 4J6HA 2Z6KA 4BA1I 3S1NB 2AKWB 2B63H 4HIDA 3S16B 4E6IA 4JI7Q 1MD2D 3GTLH 3QB3A 1XMOL 1HZAA 1IKMA 1MBYA 1UE7A 3HOWH 1TWAH 1QG7A 2KJXA 4A3EH 2UUAL 4I7AA 4CKCA 4LF7L 1I4RA 5C3EG 3K7AH 4A3IG 1EY8A 2O5IC 4JI8L 4H44C 2PQAB 4HTHA 4OL7A 3JAML 4RWSC 4RCNA 3QR8A
chains in the Genus database with same CATH topology
1JWUD 2A69D 4DK0A 3IFTA 5C3WA 1STAA 2IX0A 5C3EB 1DD2A 1HTLD 1F9PA 4ZUIA 2B2WC 4DFAA 2EY1A 4CBVA 1SYGA 4ID6A 5C0XJ 1FGBD 3OWFA 1CA5A 2E75C 1XX8A 3NTKA 1JOQA 1VF7A 4U68A 2L4NA 4BY7B 1SE4A 1DCZA 1LTGD 1LT4D 1EYCA 3X3MA 3P1HA 5I2XA 3FVQA 3HZXA 1RTNA 2Q8TA 4CJ1B 1LACA 3AU7A 2JEAI 3HOZB 3LWUA 5DM63 5M5WB 1OXSC 4RKLA 4MIUA 3KBXA 2LKVA 1SYFA 3GTMB 5KNBA 1RKNA 2N88A 3OMCA 5JEAJ 2PO4A 2DNCA 4FO2A 2M9VA 1I4PA 2PZUA 3TZUA 4JBWA 4ZRZA 1EFID 2BA0A 4ZKCB 5M5YB 3U9OA 3G6JB 3CHBD 3A8JE 5CV4A 1Q1EA 2PMZB 1ML0D 3S17B 2Z8LA 4QUCA 3CQZB 3S9WA 3UI2A 3I8ZA 1Y8OB 4KKUA 2JA6B 3S2DB 4IUUA 3N6RA 1EIHA 1SNMA 1GXDC 1B44D 1V8QA 2TMPA 4X3UA 3C46A 1H9SB 4G57A 1QWYA 3GO5A 2X69A 1AP0A 1O7ZA 2O5JC 1M4VA 3C1EA 4K8IA 2K33A 1SYDA 3VYRA 1B3AA 1BF4A 2E2IB 4K6DA 1TR5A 3K0YA 4RCOA 3TP5A 4F87A 4NDXA 2RDGA 5E3FA 2IX1A 1R4QB 4CJ0B 2N55A 1S5CD 4QMGA 3Q6SA 3K59A 2MPMA 2EE1A 1C4QA 1FD7D 5ELCA 5D14A 1BCPB 1PTOF 5J1ZA 1SXTA 3TZDA 2NWGA 1PRTF 1CZWA 4S3SA 4QCLA 3NWTA 3GV3A 4KK7A 4N9TA 3VA5A 5F2DA 3M4YA 2B2VC 4M8AA 2ICEC 4QIWB 1D2BA 5G3LD 1CQFA 3BYTB 4HEDA 3H09A 2RSNA 2D5DA 4FF4A 3MTSA 3PUYA 4HSPA 2OXPA 5EBCA 1Y69U 2R92B 1VCIA 2JE6I 3MHBA 1R4PB 1STGA 3I91A 1Y8NB 2JXMB 1G8ZD 5FLXL 2K5DA 4ZKBB 2K03A 1DXMA 3OIPA 2IWHA 3MFGA 2NVQB 1U4RA 3VR5A 2ZXPA 4TRDA 4Q0FA 2NVXB 1PMRA 1ZKOA 3RMHA 5CV6A 3S14B 4ZLTF 1EY0A 2MUYA 5BN4A 1D5MC 3KF8A 4I7ZC 2KCNA 1FYCA 2XWBB 3W3AA 4ULLA 2B63B 1VDZA 2LS01 1B53A 4CHTB 4V190 3BZDB 1V1OA 2LFNA 1Z47A 3HOWB 4A3EB 1KABA 3RD4A 4Y7NB 4TKOB 5LHY1 2XWJB 1SYEA 5CORA 1SMYD 5LL6S 1LTBD 1SNPA 5IGGA 3D4RA 4IALA 2PW7A 4DNTB 2F0PA 2WIIB 1I4GA 3KUPA 2HDLA 2J0TD 2NB0A 3NPPA 1CHQD 2EDGA 4MHEA 1TKWB 2NZ1D 1GUWA 1TWHB 2M2LA 3HEJA 5FO7B 1F2LA 1JWSD 2FFKB 1PTOC 1W6KA 1B9NA 1DOLA 2AQ3B 1PRTC 5I9PA 2EYHA 1WTXA 2A6HC 2F0GA 2AQ2B 2BCOA 1IYUA 4BBRB 2B2TA 1O78A 5JOBA 5D65A 4NW2A 1BNZA 3M4OB 4A3KB 4DN4M 5LL6X 3J7AF 4IFDI 2K5WA 4KN7C 2L12A 1UEAB 1II3A 1NAPA 1T5EA 4RGMA 5C4JB 3GTOB 1A6XA 1GOZA 4EQPA 1C8CA 1NUCA 4RGNA 1TWCB 1YNJC 4NMZA 3GTJB 3TN2A 5J22A 1G6ZA 5FO9B 2LY7A 1PFMA 2R6GA 3EA6A 2O2LD 4ABNA 1IW7C 4A93B 4OGQC 4KY5A 1GJXA 4FVMA 2F0HA 1BXTA 1SAPA 2RKSA 5D3IB 4PMCA 2EPBA 4KHVA 1JQYD 2XN9C 2EXZA 1QNUA 3HOUB 5J39A 5HGTA 1ONLA 4KN4C 2K04A 2Z4HA 3D8GA 2FMMA 2PZTA 1KNEA 1YNJD 1I6VC 3CRKC 3PUWA 2SNMA 1OXTA 2NN6I 4IZ8A 1HA6A 1HXYD 1X3PA 2OEOA 3DEOA 3C2PA 2F0NA 3GD7A 3K6OA 1IW7D 1PTOH 3BVMA 4OHJA 4X3KA 4IUPA 3SK5A 3QOJA 3G7LA 4A3JB 1S5ED 1OXVA 4X3SA 4DU9A 2AWNA 1HUNA 1RDPD 1SNQA 4CKBA 3BS1A 1CT1D 1NSNS 1CZGA 5KEEA 4WFN3 4L63B 3IAYA 5IODA 5K5PA 1EYAA 3K5NA 1RHPA 1KTKA 2CQAA 1FNVA 1EZ8A 2IJ0A 1BDOA 1H9RA 2F0VA 2VUMB 1KDBA 4NKLA 2K05A 2F0TA 1XXGA 4ZUJA 4C2MB 2A6EC 3FDTA 5JPNC 3TDQA 2SDFA 3J80E 1RODA 1KNAA 1LT3D 4DNRB 2ID0A 1PZJD 5C4ZA 5BN5A 1ZXTA 1SSOA 2WB1B 2C9OA 1I6HB 4OO1I 3S1QB 3V05A 3E0JA 2A68C 3RZOB 1V1PA 4C1NI 2BE5C 1B1ZA 5DEHA 3IKJA 2AUJD 5KYIA 3NQTA 1A3VA 2L0CA 1X32A 3I73A 3C1FA 5CGKA 5CBAE 2F0KA 4XT1B 1VMCA 2OF1A 1EEFD 1BR9A 2MP1A 5M3FB 3NE5B 3D3RA 2Z4IA 3NP8A 2E2HB 3SVMA 5A2QE 2PPBC 3TP8A 1LTAD 3KLRA 3DXJC 5EGTA 1EY7A 1EWHA 2A68D 3D6CA 4J8QA 5ELEA 2K1BA 2ZXRA 1QNKA 1DZ1A 5CV7A 4RHSA 3WOFA 3PO2B 4ZYSA 3MXNA 3NUCA 3SXHA 1CA6A 4C3JG 2B8GA 3NXWA 3M7NA 3QJYA 1GUOA 4A3IB 3PUVA 1SE2A 3NBHA 4C3JB 2F0SA 5IGDA 4V0BA 1UAPA 4Z9CB 2RSOA 3PMFA 5C6AA 1G91A 4R9WA 2WKDA 5JVG3 2F0QA 4IFDG 3AB9A 3DWAA 3T13A 3GQBA 3D4DA 3DUZA 1U4LA 3OIQA 1WCMB 2YYZA 4ME5A 1STBA 1TU2B 4CGYB 1DOKA 3IFDA 2BOSA 1T5XD 2NYZD 2KEDA 2KHSA 1JOOA 2PW5A 3TP7A 4ODGA 2F0FA 1EQTA 3GP7A 1ICWA 2VB2X 3A55A 4XYOA 3CKIB 1PLFA 2NVTB 4EQNA 5I2YA 3BVZA 3HGBA 2R61A 2B2WA 3NSWA 1EU3A 4C3IG 3EVQA 1R9TB 4K5WA 3ERQA 3WDNA 4H13C 2MJ8A 3I70A 5IIFA 4K2LA 4DGZA 3P75A 3LWEA 2KVMA 1D1KA 4RHRA 5EJWA 3KK7A 4DA2A 4K8JA 1JE4A 2EY2A 3KBGA 2L1BA 3NHHA 4KMUC 3PUXA 1IYVA 1PTOB 2K6AA 1F9QA 3S2HB 1PRTB 1EOTA 2B2UC 3BVGA 1HPCA 1TS5A 3VR6A 3R93A 4WJWA 5JPMC 3JAME 4ZAIA 4KTAA 4R8NA 4CKEA 1M8AA 3J81L 1ENFA 2FMCA 3SR1A 2PQEA 4EVOA 3ND9A 2AWOA 3K58A 3S1MB 1G291 4BA2I 2F0UA 2XVSA 1SYCA 3FPUB 1RTOA 1Q90A 4U673 1F9RA 1WTRA 1HA5A 3I90A 2SEBD 2EYPA 2KQ3A 3AMUA 1ENCA 5IGCA 4EQOA 3MXGA 3VYSA 1PDQA 1JCKB 1C48A 4NP5A 4OIJA 3HOVB 2PZWA 3HP3A 1MGSA 4PNYA 4N9PA 1Y1WB 4KI0A 1EU4A 1J8IA 2D62A 3LX0A 2HUGA 4KV6A 3J7AV 1QJOA 1BCPF 1TWGB 2EY6A 5DAUA 3FKIB 4WORA 2FHTA 1HFGA 3S1RB 3M7GA 4P2CB 5C0XI 4B9XA 1BUVT 1V1PB 4XT3B 3A54A 2CHBD 2I46A 3GTLB 3E5SA 1O80A 1QOHA 1EL0A 1TWAB 2B2VA 1A2UA 1TY0A 1LT6D 2GA4B 2L11A 2QF7A 5IGEA 3MAQA 3OHXC 3K7AB 4KJOA 3R3OA 2HCCA 2Y0SB 5CR3A 1GUSA 2PNRC 4O42A 5CV9A 3TSSA 1EY4A 2HDMA 4FP5D 3QG1A 2JYOA 5D3DA 4F7XA 2B2YC 3EROA 1EY5A 2Z1CA 1AEXA 1IKLA 2K28A 1STNA 4GZYC 1DOMA 2K01A 1ESFA 2A5HA 1LTTD 1ET9A 1JICA 4KD4A 5KNDA 5M9OA 1FNUA 3NTHA 2IPKD 5NUCA 3R8BA 3I4MB 1Z6HA 3VYTA 1K8OA 1ESRA 5DM73 5I6YA 5C4HA 3Q22A 1LTID 5KNCA 4A3BB 1O7LA 3ND8A 2X6GA 4IFDH 2RA4A 3NTIA 4BS9A 2K32A 3I4LA 1W6JA 2SOBA 1H9JA 2KUMA 2E76C 1SYBA 1GUTA 4O1NA 1PTOD 3DMUA 3J7YW 1BOSA 1WVLA 1PRTD 1D1IA 4KKSA 2A6HD 5FLXE 2WP8J 2QCPX 1TS4A 2F0MA 2EYJA 2B2YA 4IUNA 3GTQB 1V43A 3VR2A 1S5FD 3A56A 1PYWD 5IT9E 2BA1A 4RGTA 4KY6A 3TP6A 2FINB 3O13A 1WD1A 4HSVA 2KEEA 4RGOS 1U4MA 2FJ2A 4HAEA 3EFXD 2PCFB 3QO2A 2F0IA 2F0JA 3Q0AA 4L8JA 2G9DA 4FYDA 2DY7A 2AQ1B 2NN6H 2V4DA 3ONAB 1OXUA 1TVXA 3T53B 4IUQA 1CK1A 4ZK9B 3K5MA 5I4DA 3MC0B 3HG9A 3SK4A 3FEWX 2F0WA 1STYA 1TT2A 3MEHA 2D2CC 3K57A 2F0DA 3I72A 4FXKC 4BY1B 1E2ZA 2RBMA 2X6LA 1NCVA 1SEBD 4KY7A 3QOLA 1MI2A 3QIAA 2VXWA 2IW3A 2QDBA 4LMQD 4XTCS 3S15B 2QILA 1Q12A 5M3MB 1ILPA 1EZ6A 1Z7TA 4H7BA 1TQOA 2EYLA 2A74C 2EY5A 2QKIC 3MWYW 2SNSA 4L6TB 4ZQ3A 4EGVA 5C44B 2WKCA 3E6ZX 2DY8A 4R8IA 3KLSX 1G2TA 1RJTA 3GV6A 3WOEA 2F4IA 3D4WA 2JP1A 1XWEA 1PXUA 1JB3A 1HQRD 4HR7B 4XQJA 4DF7A 4DXFA 1L0YB 1SFOB 1JOKA 5ELFA 3EQLC 1CHPD 3M3YB 3VR4A 2XSCA 4OIKA 2BDOA 3MXPA 2B39A 2L5TA 2A6ED 3BDLA 4HCSA 3C3LA 1KLGD 1RCVD 4DAYA 5C5LA 3OW7A 3HOXB 4BBSB 4AYBB 3L7ZC 4K2KA 5KRUA 4MN3A 3MVVA 1WTQA 4J1MA 1ENAA 5JEAG 4G7ZC 3HS0C 5A35A 4LAAA 1FR3A 4X3TA 2A69C 2G9HD 2BDNA 2BE5D 2CW0C 1QE6A 3DWQA 1PZID 4DK1A 2K5QA 4QB4A 1B9MA 3HRZC 5C3XA 2K7VA 4FXDA 4A3DB 2M00A 1XTCD 4QUFA 1TS3A 5ISRA 2KECA 5FOBB 5EPJA 2RDHA 1LT5D 5EQ0A 1LABA 4C56C 3BG3A 4K14A 5I9OA 4HMIA 2CW0D 5G3LF 5E1FA 5M5XB 1STEA 5I6WA 2F0EA 3OWEB 2I07B 2EJMA 1A3TA 4FF2A 4K5XA 1TY2A 1HQMC 1WD0A 4QF4A 1LO5D 3R2TA 5AFWA 2XRQD 1I4HA 3I4NB 5FO8B 2XIWA 1KDAA 1SBBB 5IGFA 1PFNA 2EZVA 1F2ZA 3D6WA 3PUZA 5EKLA 5K36H 1E2VA 2KCCA 3VR3A 1EYDA 2R7ZB 1L0XB 2NTTA 3RLFA 2WAQB 1OO9B 2KA7A 1CQVA 4F8MA 3H6MA 1E2WA 4UAIA 3T51B 1Q1BA 4WRDA 4IUVA 3TBIB 1HHVA 3GTKB 2B8FA 2OT2A 4F88A 2NN6G 4B08A 1SJHD 4C3IB 5EBDA 3U9SA 2Q8IB 4HCEA 3W2DA 1ILQA 4IQZA 3NWSA 4XQQA 3OMGA 3H0GB 4RKBA 2JSOA 4CJ2C 5TSSA 4RAUC 2CVRA 3LNNA 1YNNC 3HOYB 5CV5A 2EYOA 4DAVA 1U9RA 3HKZB 5T1GA 2R3ZA 4KHZA 3SK6A 1LV9A 5IOCA 3V2TA 1SDFA 1HFNA 4IFDJ 1X3QA 1PFBA 3L9AX 3KLSA 3D31A 2IT1A 1K8MA 1D5XC 4KD3A 1F77A 2IL8A 3RUZA 3IL8A 2RVLA 4G7HC 3P7JA 1CFMA 1JWMD 1YNND 2PYKA 1AFPA 1UNSA 4YIJA 4XYQA 3SEBA 1RF2D 2Q8RE 4C1NK 1AW7A 1E0BA 4OO1G 3OOCA 1IL8A 3BYYB 5FKAC 3TMEA 4TQUS 2J4XA 2ZXOA 2TSSA 4IUTA 2JA7B 1FNWA 1CTMA 2B2UA 2EJFC 2E74C 2DNEA 1DM0B 4KKTA 4XIGS 1EQVA 3NQIA 5EPLA 1BQQT 1G2SA 3ITPA 1NR4A 1ET6A 2JA8B 1PZKD 5C0XH 1LLRD 4A3FB 3SHLA 1EIGA 3SE0A 2F0OA 4PMWA 1HRJA 1I3QB 4RH6A 1A15A 1SMYC 1LTSD 1JORA 1I4XA 2ICIA 2AUKA 2NVYB 4C3HG 2NTSA 2A73B 5IT9L 5FK9C 5C4XB 2RDFA 2NBFA 3EJIA 5CBEE 1GUNA 5DNFA 3PIP3 1ZYRC 4XXEA 1EEID 4C3HB 1KDCA 1GUGA 1ZEQX 3H3VC 5KGUA 2H1EA 1SNOA 3PV0A 5E4WC 2B2TC 4IURA 4Q5VA 2L9HA 1S5BD 2VB3X 3X3NA 4FNFA 5JEAH 5JAVA 1D5ZC 1D6EC 1KLUD 4XQNA 1HUMA 5CMDA 3VA7A 1U4PA 3CU7A 3OSOA 3DM1A 4ILWA 3J81E 1Q3LA 5JVH3 3A7AB 1GHJA 2YU9B 1STHA 3R2IA 3CRLC 1F9SA 1AZQA 1VF5C 1ZYRD 3ZYYX 4UDUC 2WV6D 3T56B 5E4XA 4RFBA 3A8IE 5COYA 3FMCA 2MHVA 1Q8IA 5K36G 1I4QA 1MSGA 5ELBA 3SK8A 2L55A 1EY6A 3DEPA 2NUCA 1IHZA 1F2MA 2EVBA 1S5DD 2EJGC 3RZDB 2F03A 3P20A 1VMPA 3DHQA 4PQXA 3K5OA 5EPKA 3SDZA 3F2UA 4FF3A 3J80L 2VNUD 1B2TA 2R93B 1AN8A 3URYA 3VYUA 1A3UA 1SNDA 1O7YA 3K5LA 1BCPC 3H91A 3FRPB 5KIXA 1AZPA 2MGSA 2F3VA 1JR0D 1K83B 2HQEA 2ENBA 3OPOA 5CYUA 3L3OC 3NBIA 2D9UA 5JJZA 3T4AC 3GTGB 1QCBD 3QWNA 1H9SA 2E2JB 4HN7A 5HURA 2O4XA 1QILA 1I50B 2XRSD 2H4OA 4H0LC 5EKIA 2C5CA 4BWGB 2F1MA 2J7ZA 1BCPD 1Y1VB 2LMCB 1TWFB 5A2QL 1EWCA 5T1IA 2EYFA 1MSHA 2E2DC 3H94A 1HCZA 4G7OC 4XDXA 1SE3A 1XYIA 4A3GB 3MXUA 2XNAC 1F2YA 4IN3A 5EKKA 2WINB 1BBXC 4LK1C 1GHKA 4JK1C 2EYMA 4DAPA 5CC4A 1QB5D 1NR2A 2JEBI 3DWPA 3A7LA 3N52A 4HMJA 1SJED 4LJZC 1H9KA 3PIO3 1H9MA 4KJNA 1J9OA 5BN3A 4FXGC 1OXXK 1WTPA 3BDCA 1UUPA 3Q23A 4K6LA 3M85A 1DONA 1TIID 3T16A 3A8KE 4PV1C 3MFYA 2QEJC 1JC7A 1A2TA 3MA2B 5CV8A 1RD9D 1Y8PB 4RA8A 2HCIA 5C0XG 4G4KA 4OO1H 3BDOA 2EOTA 1B50A 2KOLA 3NK9A 4DXGA 2DN8A 4K5VA 1LTRD 1CM9A 5ELDA 1B4OA 1S4ZA 2F0LA 4M1UB 1TS2A 1SNCA 4PMBA 3GTPB 2IX3A 3FPPA 1HTPA 5C5MA 2JA5B 1CI3M 1WTOA 4A3MB 2WACA 4FF1A 1BO0A 4I65A 3V96A 1DJRD 4B9WA 3Q24A 5KYLA 2ZT9C 1WTVA 4TSSA 3PO3B 2RQXA 3I3CA 1KAAA 3MZ5A 5IGBA 1DYQA 1EY9A 2F3WA 1WTWA 4J6HA 4BA1I 3S1NB 3S16B 4E6IA 1MD2D 3QB3A 1IKMA 1MBYA 1QG7A 2KJXA 4CKCA 1I4RA 1EY8A 2O5IC 4H44C 4HTHA 4OL7A 3JAML 4RWSC 4RCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY5 A;  3TP8 A;  3T16 A;  2F0J A;  1ENC A;  5IGC A;  4EQO A;  4DU9 A;  1KDC A;  5EGT A;  1KDA A;  1STA A;  3MXP A;  5C3W A;  5KGU A;  1A2T A;  5IGF A;  2F3V A;  4EVO A;  1EY7 A;  1SNO A;  5CV8 A;  3D6C A;  5JOB A;  2PYK A;  4ZUI A;  1F2Z A;  4G57 A;  1AEX A;  4NP5 A;  3BDL A;  5EKL A;  3EVQ A;  4DFA A;  3SK4 A;  1SNQ A;  2PZW A;  4YIJ A;  2EY1 A;  2HQE A;  2ENB A;  4K5W A;  2F0W A;  4TRD A;  1STN A;  1SYG A;  4ID6 A;  1STY A;  1TT2 A;  3ERQ A;  3MEH A;  4PNY A;  5C5L A;  4N9P A;  1NSN S;  1EYD A;  2F0D A;  3OWF A;  5CV6 A;  3C1E A;  5KEE A;  1EY0 A;  4K8I A;  5JAV A;  4KD4 A;  5CV7 A;  5K5P A;  5IOD A;  5IIF A;  1SYD A;  3NK9 A;  1EYA A;  1II3 A;  2RBM A;  4K2L A;  4K2K A;  4DGZ A;  3P75 A;  5KRU A;  1JOQ A;  4EQP A;  5HUR A;  3NUC A;  5M9O A;  3OSO A;  2O4X A;  3SXH A;  5NUC A;  3MVV A;  3LX0 A;  4KY7 A;  1NUC A;  3QOL A;  4F8M A;  3H6M A;  1EYC A;  4KV6 A;  4K6D A;  4J1M A;  3NXW A;  1ENA A;  3P1H A;  4K5V A;  1EZ8 A;  5I6Y A;  3HZX A;  1TR5 A;  4LAA A;  2F0V A;  2QDB A;  4NMZ A;  1KDB A;  5C4H A;  2EY6 A;  3MZ5 A;  2EY2 A;  4K8J A;  4NKL A;  4WRD A;  3TME A;  3TP5 A;  5J22 A;  2F0L A;  5DAU A;  1STH A;  4NDX A;  2F0T A;  2EYF A;  5E3F A;  1SNC A;  4PMB A;  3NHH A;  4ZUJ A;  5C5M A;  4WOR A;  2F0S A;  5IGD A;  1KAB A;  1EZ6 A;  2WAC A;  4H7B A;  4QMG A;  3PMF A;  4RKL A;  1TQO A;  2EYL A;  4MIU A;  2SOB A;  5C6A A;  4I65 A;  2LKV A;  4KY5 A;  1SYE A;  1SYB A;  4QB4 A;  5J1Z A;  2F0H A;  2RKS A;  1SYF A;  2F0Q A;  4B9W A;  3DMU A;  4B9X A;  5C3X A;  4PMC A;  4KHV A;  5KYL A;  2EXZ A;  1SNP A;  3SR1 A;  5C4Z A;  5IGG A;  3T13 A;  1EQV A;  2EY5 A;  1F2Y A;  1RKN A;  4S3S A;  5HGT A;  3D4D A;  5J39 A;  2M00 A;  3OMC A;  4IAL A;  2SNS A;  5EKK A;  3OMG A;  4RKB A;  3SK8 A;  2PW7 A;  4KTA A;  3E5S A;  4ZQ3 A;  4R8N A;  5ISR A;  1EY6 A;  3D8G A;  2NUC A;  4N9T A;  4ME5 A;  5CC4 A;  2EYM A;  1IHZ A;  1F2M A;  1KAA A;  2PQE A;  2F0M A;  2F0P A;  3ITP A;  2PZT A;  1A2U A;  1STB A;  2EYJ A;  2PZU A;  5F2D A;  5IGB A;  5CV5 A;  5DEH A;  3U9O A;  2EYO A;  1EY9 A;  2F3W A;  1U9R A;  4K14 A;  5I9O A;  5IGE A;  3NQT A;  5KYI A;  2KHS A;  1JOO A;  3ERO A;  4IUN A;  4HMI A;  4J6H A;  3SHL A;  4KJO A;  5CV4 A;  3DHQ A;  2PW5 A;  3R3O A;  3SK6 A;  1A3V A;  3D4W A;  4HMJ A;  2F0O A;  3HEJ A;  5E1F A;  4E6I A;  5IOC A;  3C1F A;  5CR3 A;  3TP7 A;  2SNM A;  3V2T A;  4KJN A;  5CGK A;  2F0K A;  4ODG A;  2F0U A;  4IZ8 A;  2OEO A;  2F0F A;  3QB3 A;  5I6W A;  1SYC A;  2F0N A;  3S9W A;  2F0E A;  4KY6 A;  1JOR A;  3TP6 A;  5CV9 A;  2OF1 A;  1A3T A;  4DF7 A;  4K5X A;  1EY4 A;  1A3U A;  3VA5 A;  2OXP A;  1SND A;  5I9P A;  3BDC A;  2EYH A;  3MHB A;  1EY8 A;  1JOK A;  4KD3 A;  4QF4 A;  2RDF A;  3SK5 A;  5KIX A;  3NP8 A;  1STG A;  2F0G A;  3QOJ A;  3EJI A;  4EQN A;  2EYP A;  4F7X A;  2KQ3 A;  4HTH A;  4OL7 A;  3RUZ A;  1SNM A;  2F0I A; 
#chains in the Genus database with same CATH topology
 1JWU D;  2A69 D;  1KRS A;  4DK0 A;  3IFT A;  1XPO A;  4DR2 Q;  5C3W A;  3G4S A;  1STA A;  2IX0 A;  5C3E B;  1DD2 A;  2UUC L;  1HTL D;  1F9P A;  2EQS A;  4ZUI A;  2B2W C;  3GDE A;  4JI0 L;  4DFA A;  2QEX A;  2EY1 A;  3A74 A;  4CBV A;  1SYG A;  1BVS A;  4ID6 A;  4YHH L;  4JI6 Q;  5C0X J;  1FGB D;  1Q8K A;  3OWF A;  5FJ8 G;  2ZTD A;  1CA5 A;  4LNQ A;  2E75 C;  3KFU A;  1SE8 A;  1XX8 A;  3NTK A;  1JOQ A;  1VF7 A;  4U68 A;  2L4N A;  4BY7 B;  1SE4 A;  4A75 A;  2B3G A;  1DCZ A;  3HOZ G;  1KXL A;  1LTG D;  1LT4 D;  1EYC A;  4X64 L;  4P75 A;  3X3M A;  3P1H A;  4B3R Q;  3KF6 B;  5I2X A;  3FVQ A;  2KCM A;  3HZX A;  1N33 L;  1RTN A;  2Q8T A;  1EQR A;  4CJ1 B;  1LAC A;  1EFW A;  3AU7 A;  2JEA I;  1QUQ A;  4GN5 A;  3HOZ B;  3LWU A;  5DM6 3;  5M5W B;  4JYA Q;  4O0A A;  1OXS C;  4RKL A;  4MIU A;  3I4M H;  4BBR H;  3KBX A;  3J80 i;  2LKV A;  1QZG A;  1SYF A;  3T1H Q;  3GTM B;  5KNB A;  2UUC Q;  4R4C A;  3M4O H;  1RKN A;  1G6P A;  1H95 A;  4A3K H;  2N88 A;  3OMC A;  4CDF C;  5JEA J;  1X56 A;  2PO4 A;  4HIO A;  2HIV A;  4QGU A;  3OTO Q;  4DV4 Q;  4DR5 L;  4DPG A;  2DNC A;  1X3G A;  4FO2 A;  2M9V A;  1I4P A;  5C4J H;  2PZU A;  3TZU A;  4JBW A;  4ZRZ A;  1EFI D;  2BA0 A;  4ZKC B;  5M5Y B;  3ULP A;  3U9O A;  3G6J B;  3CHB D;  3A8J E;  5J3B A;  3CC4 A;  1TWC H;  5CV4 A;  1Q1E A;  4DV5 L;  2PMZ B;  4JI2 Q;  2JA6 G;  1ML0 D;  1HNW L;  4DR4 Q;  2XGT A;  3S17 B;  3ULJ A;  2Z8L A;  4QUC A;  3CQZ B;  3S9W A;  2R7D A;  3UI2 A;  3I8Z A;  1Y8O B;  4OWX B;  3HFZ B;  4KKU A;  2JA6 B;  4A93 H;  3CCQ A;  3S2D B;  1GD7 A;  4IUU A;  2K14 A;  3N6R A;  1EIH A;  3T1Y L;  1SNM A;  4JI4 L;  2KEN A;  1GXD C;  1B44 D;  1V8Q A;  2TMP A;  4X3U A;  1EIF A;  1ASZ A;  4DR1 L;  1QVG A;  3C46 A;  1H9S B;  3STB D;  4G57 A;  5IWA Q;  2ES2 A;  1QWY A;  3GO5 A;  2X69 A;  4DV7 Q;  1AP0 A;  1Y14 B;  3EN2 A;  1O7Z A;  2O5J C;  1M4V A;  5JJI A;  3C1E A;  4K8I A;  2A1A A;  2K33 A;  1SYD A;  3VYR A;  1B3A A;  1BF4 A;  2E2I B;  1KRT A;  4K6D A;  2OQ0 A;  1TR5 A;  3K0Y A;  3CCS A;  4RCO A;  3TP5 A;  4F87 A;  4NDX A;  2RDG A;  5E3F A;  2IX1 A;  1R4Q B;  4CJ0 B;  2N55 A;  1S5C D;  4A3J H;  3ER0 A;  2JQO A;  4QMG A;  3Q6S A;  3K59 A;  2MPM A;  2EE1 A;  1C4Q A;  1FD7 D;  5ELC A;  5D14 A;  1BCP B;  1PTO F;  5J1Z A;  2UU9 L;  2WFW A;  1SXT A;  2ZTC A;  1YVC A;  3TZD A;  1A62 A;  2NWG A;  1PRT F;  1CZW A;  4S3S A;  4QCL A;  2CWP A;  3NWT A;  3UE0 A;  3PCO B;  3GV3 A;  2ZM6 Q;  4KK7 A;  4N9T A;  2Z9H A;  3VA5 A;  5F2D A;  5IYD G;  2UUB Q;  2DJF C;  2K5N A;  3M4Y A;  2B2V C;  4M8A A;  2ICE C;  4QIW B;  2GVA A;  1VQE A;  1D2B A;  5GAH C;  4X65 Q;  2VUM H;  1WFQ A;  5G3L D;  1CQF A;  3BYT B;  1VQF A;  1XJV A;  4HED A;  1CKO A;  3H09 A;  2RSN A;  2D5D A;  4FF4 A;  3MTS A;  3PUY A;  4HSP A;  2OXP A;  1V9P A;  5EBC A;  1Y69 U;  2R92 B;  1VCI A;  3AFP A;  2JE6 I;  2YTV A;  3MHB A;  1R4P B;  1STG A;  3I91 A;  4DV0 L;  1Y8N B;  4QJF A;  1MKH A;  3EBE A;  2JXM B;  2LSS A;  1G8Z D;  5FLX L;  2K5D A;  4IPD A;  1VQ6 A;  3SGI A;  4ZKB B;  2K03 A;  1DXM A;  3OIP A;  2D0O A;  3CCE A;  2IWH A;  3MFG A;  2NVQ B;  1I6H H;  3S1Q H;  1U4R A;  3VR5 A;  2ZXP A;  4TRD A;  1CKM A;  4Q0F A;  2NVX B;  1PMR A;  1ZKO A;  4NXM L;  4AYB E;  3RMH A;  3RN2 A;  2KCT A;  5CV6 A;  3S14 B;  4ZLT F;  1EY0 A;  1GO3 E;  2MUY A;  4R4I A;  1A6X A;  5BN4 A;  1D5M C;  1G51 A;  3KF8 A;  1KIX A;  3HOW G;  4I7Z C;  3JAM c;  4P73 A;  2KCN A;  4A3E G;  4YCW A;  1FYC A;  2XWB B;  3W3A A;  4ULL A;  3TQY A;  2B63 B;  1VDZ A;  2LS0 1;  4ME3 A;  1B53 A;  3HOX H;  4CHT B;  5M3F H;  4V19 0;  3BZD B;  4R1J A;  1CKN A;  1V1O A;  1GVP A;  1Z47 A;  2LFN A;  3HOW B;  1HR0 W;  4A3E B;  2E2H H;  1KAB A;  1AH9 A;  3RD4 A;  4Y7N B;  4TKO B;  2DJG C;  5LHY 1;  2XWJ B;  1SYE A;  4UP7 A;  5COR A;  3M4Q A;  2HT1 A;  1SMY D;  5LL6 S;  1M90 C;  2HHH Q;  1LTB D;  1SNP A;  5IGG A;  1SRO A;  1KC8 C;  3D4R A;  4IAL A;  2OTL A;  2VS1 A;  2BH8 A;  2PW7 A;  4OX9 L;  4HJ5 A;  3E9H A;  4DNT B;  3VDY A;  2F0P A;  2WII B;  3PO2 H;  1I4G A;  3KUP A;  3KF6 A;  2HDL A;  3NPP A;  2J0T D;  2NB0 A;  1CHQ D;  2EDG A;  4MHE A;  1TKW B;  2NZ1 D;  1GUW A;  4LFB L;  1VQ7 A;  1TWH B;  1BBU A;  1HNZ L;  4JI3 Q;  1XMQ L;  2MO0 A;  2M2L A;  3HEJ A;  5FO7 B;  1VQM A;  1F2L A;  1WOC A;  2PI2 A;  1JWS D;  2FFK B;  3MXN B;  1PTO C;  1W6K A;  5LMN W;  4C3J H;  1B9N A;  3I4M G;  4BBR G;  1DOL A;  2AQ3 B;  4JOI A;  1PRT C;  5I9P A;  2RHS B;  2EYH A;  1WTX A;  2JK8 A;  1VQD A;  2A6H C;  2F0G A;  4APV A;  2AQ2 B;  2VW9 A;  4A3B G;  4B3M Q;  5M5X H;  2BCO A;  4A3K G;  3NBH B;  1A8V A;  1IYU A;  1L1O C;  4BBR B;  1VQK A;  3I7F A;  2B2T A;  2Q2H A;  1O78 A;  5JOB A;  2IY5 B;  1QZH A;  5GRO A;  5D65 A;  1WCM H;  4L5Q A;  4NW2 A;  1BNZ A;  3M4O B;  3L0O A;  4A3K B;  4DN4 M;  1N8R C;  5LL6 X;  1WJJ A;  3J7A F;  4IFD I;  5LMN L;  2K5W A;  4KN7 C;  1YHB A;  4JPB W;  2L12 A;  1UEA B;  3I4N H;  1II3 A;  1NAP A;  1T5E A;  2OCE A;  2WAQ E;  4RGM A;  5C4J B;  3GTO B;  1GOZ A;  4EQP A;  5JJL A;  1QUQ B;  1XNQ Q;  1C8C A;  1NUC A;  1PYS B;  4RGN A;  4LF6 L;  3PIP A;  1TWC B;  1YNJ C;  4EX5 A;  4NMZ A;  2K52 A;  3BU2 A;  4A93 G;  3GTJ B;  3TN2 A;  5J22 A;  2A19 A;  2LXK A;  5IE8 A;  1J5E Q;  3EIV A;  1G6Z A;  5FO9 B;  2LY7 A;  1PFM A;  2R6G A;  2NVT H;  3CCV A;  4R4O A;  2L15 A;  3EA6 A;  2O2L D;  4ABN A;  1IW7 C;  1K8A C;  4A93 B;  1E22 A;  4OGQ C;  4KY5 A;  1GJX A;  4FVM A;  2F0H A;  1BXT A;  1SAP A;  2RKS A;  5D3I B;  4PMC A;  2EPB A;  2Q2I A;  1JQY D;  2XN9 C;  4KHV A;  5BR8 Q;  2E5L Q;  2EXZ A;  1R9T H;  1QNU A;  3HOU B;  5J39 A;  5HGT A;  1ONL A;  4KN4 C;  2K04 A;  5GAG C;  2Z4H A;  3U4Z A;  3D8G A;  2FMM A;  1VQP A;  4H02 A;  4LFC Q;  2PZT A;  4IJH A;  3J81 c;  1KNE A;  1YNJ D;  1KL9 A;  3HKZ E;  1BBW A;  1GKH A;  4LF6 Q;  1I6V C;  3CRK C;  1EQQ A;  3PUW A;  4BY1 G;  2SNM A;  1OXT A;  2NN6 I;  3J7Z C;  4IZ8 A;  1HA6 A;  1HXY D;  1X3P A;  2OEO A;  3DEO A;  3C2P A;  2F0N A;  1K73 C;  4A3J G;  3K6O A;  3GD7 A;  1IW7 D;  3ICE A;  5LMU Q;  1PH4 A;  1PTO H;  3BVM A;  2OWO A;  4OHJ A;  3A0J A;  4X3K A;  3S2H H;  2YTY A;  1PH9 A;  1K8G A;  4IUP A;  3SK5 A;  3QOJ A;  2MFI A;  1M1K C;  4LF4 Q;  3G7L A;  4A3J B;  4RG1 A;  1S5E D;  2VQF L;  1OXV A;  4X3S A;  4DU9 A;  1VQI A;  3OW2 A;  1IBK Q;  1Z9F A;  2AWN A;  1HUN A;  1RDP D;  4UP9 A;  1U0L A;  4GN4 B;  4OEL B;  1SNQ A;  4DNI A;  4CKB A;  3BS1 A;  1B70 B;  1CT1 D;  2CQO A;  3HKS A;  4UPA A;  4JBK A;  1NSN S;  1CZG A;  5KEE A;  1Q86 C;  4WFN 3;  4L63 B;  4KHP L;  3IAY A;  2VUM G;  5IOD A;  5K5P A;  1EYA A;  1N34 Q;  3K5N A;  4IOC A;  1RHP A;  1KTK A;  2CQA A;  4LFA Q;  1FNV A;  1EZ8 A;  3TRE A;  2IJ0 A;  4AQY L;  1BDO A;  1H9R A;  2F0V A;  2VUM B;  1KDB A;  4NKL A;  2K05 A;  2F0T A;  1XXG A;  4ZUJ A;  4C2M B;  2A6E C;  3FDT A;  5JPN C;  3TDQ A;  1TXY A;  2SDF A;  1B3Q A;  3J80 E;  1ICF B;  1ROD A;  1KNA A;  3CPW A;  1LT3 D;  4DNR B;  2ID0 A;  1PZJ D;  4A4I A;  5C4Z A;  3HOV H;  3WWV A;  5BN5 A;  4MTN A;  3A5Z B;  4JI7 L;  1ZXT A;  1SSO A;  1I94 Q;  2WB1 B;  3E3X A;  4HJ8 A;  2JA7 H;  1Y1W H;  2C9O A;  1I6H B;  4OO1 I;  3S1Q B;  3V05 A;  3E0J A;  2A68 C;  3RZO B;  1V1P A;  1C7Y A;  4C1N I;  2BE5 C;  1B1Z A;  5DEH A;  3IKJ A;  2AUJ D;  2KHJ A;  5KYI A;  3NQT A;  1OTC A;  3HOX G;  4AIM A;  1EYG A;  4BBS G;  1IBL L;  1A3V A;  2L0C A;  3TRZ A;  1TWG H;  1X32 A;  4AYB G;  3I73 A;  3C1F A;  5CGK A;  4POF A;  4DR2 L;  5CBA E;  2F0K A;  4XT1 B;  3FKI H;  1VMC A;  1K28 A;  4DV2 Q;  2OF1 A;  1EEF D;  2JJQ A;  1BR9 A;  2MP1 A;  2CH4 A;  5M3F B;  3S1R H;  5JJK A;  3NE5 B;  2ZJQ A;  4JBM A;  3D3R A;  4GLX A;  3I55 A;  2Z4I A;  3FP9 A;  3NP8 A;  2E2H B;  3SVM A;  4DK3 C;  2Q2U A;  5A2Q E;  3DM3 A;  3KLW A;  2PPB C;  3TP8 A;  1LTA D;  1NJI C;  2K4K A;  3KLR A;  2Y0S E;  1I3Q H;  3DXJ C;  5EGT A;  1W3S A;  1EY7 A;  1EWH A;  2A68 D;  3D6C A;  3G71 A;  4B3R L;  3PIO A;  4J8Q A;  3PO2 G;  5ELE A;  3KF8 B;  2K1B A;  5C4X H;  2ZXR A;  1PH5 A;  4MTK A;  1GM5 A;  4DR7 Q;  1QNK A;  4LF9 L;  1DZ1 A;  5CV7 A;  4RHS A;  2GVB A;  4JYA L;  3WOF A;  3PO2 B;  4ZYS A;  3ERS X;  3MXN A;  3NUC A;  1CKN B;  1IBL Q;  3SXH A;  2RCF A;  1CA6 A;  4C3J G;  1K9M C;  3BJU A;  2B8G A;  3NXW A;  3T1H L;  3M7N A;  3QJY A;  1GUO A;  4A3I B;  4DV3 Q;  3PUV A;  3CXC A;  3PF5 A;  1SE2 A;  3NBH A;  4CDD C;  3OTO L;  4C3J B;  4DV4 L;  5IP9 H;  4LWC A;  2F0S A;  5IGD A;  4V0B A;  1UAP A;  2RSO A;  4Z9C B;  3K81 C;  3PMF A;  2GN5 A;  5C6A A;  1G91 A;  4CDE C;  4R9W A;  2WKD A;  5JVG 3;  1WCM G;  2F0Q A;  4IFD G;  3AB9 A;  4JI2 L;  3DWA A;  4L5R C;  4UY8 C;  4DR4 L;  1VQO A;  3T13 A;  3GQB A;  3D4D A;  3DUZ A;  1U4L A;  5IYB G;  3I4N G;  4X66 Q;  3OIQ A;  1WCM B;  2YYZ A;  4ME5 A;  4LF9 Q;  3TEH B;  1STB A;  1TU2 B;  1J6Q A;  4LUO A;  1DOK A;  4CGY B;  3IFD A;  1IBM Q;  2BOS A;  1T5X D;  2NYZ D;  2KED A;  2KHS A;  1JOO A;  2PW5 A;  4DUZ Q;  2R7Z G;  3TP7 A;  4JI5 Q;  4ODG A;  2A8V A;  1UEB A;  1WTH A;  2F0F A;  1PH2 A;  1EQT A;  4A3B H;  3GP7 A;  2WAQ G;  5IWA L;  1SRU A;  1ICW A;  2VB2 X;  4OON A;  4DV7 L;  3A55 A;  2HD3 A;  5AJ3 L;  4XYO A;  3CKI B;  1PLF A;  2NVT B;  4EQN A;  5I2Y A;  3BVZ A;  3HGB A;  2F52 A;  2R61 A;  4GS3 A;  4OWT B;  1L2F A;  2B2W A;  3NSW A;  1EU3 A;  4C3I G;  2K5H A;  1MHW C;  3EVQ A;  1R9T B;  4K5W A;  4IJL A;  3ERQ A;  3WDN A;  3IRB A;  4H13 C;  2MJ8 A;  1NMG A;  2IHE A;  3I70 A;  3AEV A;  3GTQ H;  5FLM H;  5IIF A;  4K2L A;  4DGZ A;  3P75 A;  3LWE A;  2KVM A;  1D1K A;  4RHR A;  5EJW A;  3KK7 A;  4P71 A;  1FJG Q;  4K0K L;  1MIU A;  2K75 A;  4DA2 A;  5L37 A;  2AHO B;  4K8J A;  1JE4 A;  2EY2 A;  3CAM A;  2G5D A;  3KBG A;  4X62 Q;  1PV4 A;  3HKZ G;  2L1B A;  4JC0 A;  1A0I A;  4QL5 A;  3NHH A;  2ZM6 L;  4KMU C;  3PUX A;  1IYV A;  1PTO B;  5AJ3 Q;  4IPH A;  2K6A A;  2UUB L;  1B8A A;  1F9Q A;  3S2H B;  1PRT B;  1EOT A;  1PH7 A;  2B2U C;  2K50 A;  3BVG A;  1HPC A;  1TS5 A;  5HGQ A;  1K0S A;  3VR6 A;  1TWF H;  5GQO A;  1YI2 A;  4X65 L;  3R93 A;  2BH2 A;  1IYJ B;  4WJW A;  5JPM C;  3JAM E;  4ZAI A;  4KTA A;  4R8N A;  1JT8 A;  2MQH A;  1M8A A;  4CKE A;  4BY1 H;  3J81 L;  1ENF A;  2FMC A;  3SR1 A;  2PQE A;  4CDC C;  4EVO A;  3ND9 A;  1HZ9 A;  2AWO A;  3K58 A;  1X9N A;  3S1M B;  3CW2 C;  3AFQ A;  4K0K Q;  1G29 1;  3L2P A;  4YCU A;  4BA2 I;  2F0U A;  2XVS A;  1SYC A;  4YCV A;  1Q82 C;  4IOA A;  3FPU B;  1RTO A;  1HH2 P;  3CCU A;  1Q90 A;  3MEF A;  1WYD A;  4U67 3;  3S15 H;  1F9R A;  5M3M H;  1WTR A;  1IL2 A;  1HA5 A;  3I90 A;  3HOV G;  2HIX A;  2SEB D;  2EYP A;  3K80 C;  2KQ3 A;  1YIJ A;  3AMU A;  2JN4 A;  3KYH C;  1ENC A;  2RCN A;  5IGC A;  4EQO A;  2JA7 G;  1Y1W G;  1MJE A;  1CSP A;  3MXG A;  2RHQ B;  3VYS A;  4DR6 Q;  1PDQ A;  1JCK B;  4WJ3 M;  1C48 A;  4FDB A;  4NP5 A;  4OIJ A;  3HOV B;  2PZW A;  5C44 H;  3HP3 A;  1MGS A;  1KD1 C;  4PNY A;  1FL0 A;  4N9P A;  1Y1W B;  3PSI A;  4KI0 A;  1EU4 A;  1J8I A;  2N8N A;  2MNA A;  3FKI G;  2D62 A;  1W2B A;  3LX0 A;  2HUG A;  4KV6 A;  4GNX C;  2JA8 G;  1K0R A;  3J7A V;  1QJO A;  2HHH L;  1BCP F;  2Q2T A;  4DK6 C;  1TWG B;  4A3F G;  2EY6 A;  2D0P A;  5DAU A;  4Y52 H;  4JVZ A;  3FKI B;  1SFO H;  4WOR A;  2FHT A;  3M3Y H;  1HFG A;  3S1R B;  1PH6 A;  3M7G A;  2Z6B A;  1E7Z A;  4P2C B;  5C0X I;  2NZH A;  4P74 A;  4B9X A;  1BUV T;  2CCZ A;  1V1P B;  5C4X G;  4ZCK A;  4JI3 L;  1HNX L;  1HZB A;  4XT3 B;  3A54 A;  1XPU A;  2CHB D;  5E7N A;  2I46 A;  4BBS H;  2EXD A;  3E5S A;  3GTL B;  1PYB A;  2Y0S G;  1O80 A;  3K0X A;  4A3M H;  4DV6 L;  1QOH A;  1EL0 A;  1VQ9 A;  1TWA B;  2B2V A;  1A2U A;  1TY0 A;  1LT6 D;  2GA4 B;  3M4P A;  2L11 A;  4LUZ A;  2QF7 A;  5IGE A;  3MAQ A;  3OHX C;  3K7A B;  4KJO A;  4B3M L;  3R3O A;  2HCC A;  2Y0S B;  1YJN A;  5CR3 A;  1GUS A;  3PO3 H;  5IP9 G;  2PNR C;  3CPF A;  4O42 A;  2ATW A;  1SR3 A;  5CV9 A;  1SN8 A;  3TSS A;  1EY4 A;  2HDM A;  4FP5 D;  3JAM i;  3M9B A;  1XTD A;  3QG1 A;  2ZTE A;  2C35 B;  4R4T A;  2JYO A;  5D3D A;  4F7X A;  3S16 H;  1YHQ A;  2B2Y C;  3ERO A;  1EY5 A;  4GNX A;  1PA6 A;  1XNQ L;  1K3R A;  1YHA A;  4A3D H;  1HNX Q;  2Z1C A;  1P8L A;  4EQ5 A;  1AEX A;  1IKL A;  2K28 A;  1STN A;  1J5E L;  4MZ9 A;  1DOM A;  4GZY C;  1HZC A;  4DV6 Q;  2K01 A;  1ESF A;  2A5H A;  1LTT D;  1ET9 A;  2VL6 A;  3I2Z A;  1JIC A;  4GOP C;  4KD4 A;  4KLK A;  3PGZ A;  5KND A;  4GLA C;  5M9O A;  1FNU A;  1UE1 A;  1VQC A;  3NTH A;  2IPK D;  5NUC A;  4L5S A;  3F2C A;  4POG A;  3R8B A;  3I4M B;  1Z6H A;  3VYT A;  1K8O A;  1ESR A;  5DM7 3;  5I6Y A;  5BR8 L;  1VQ4 A;  2E5L L;  5C4H A;  4DUY Q;  3Q22 A;  1LTI D;  5KNC A;  4A3B B;  1O7L A;  3ND8 A;  2X6G A;  4IFD H;  3E9I A;  2RA4 A;  2UXB L;  3NTI A;  3UDF A;  3D0F A;  4LFC L;  4BS9 A;  2K32 A;  4BY7 H;  3I4L A;  1W6J A;  2SOB A;  1H9J A;  2KUM A;  5IYB H;  2VQE Q;  2E76 C;  1SYB A;  1GUT A;  4O1N A;  4LF8 Q;  1PTO D;  3DMU A;  2ASB A;  3J7Y W;  1BOS A;  1VQA A;  1WVL A;  1PRT D;  1D1I A;  4KKS A;  5FLM G;  4IPC A;  2A6H D;  2F3I A;  5FLX E;  2R7Z H;  2WP8 J;  3G6E A;  2N49 A;  3F2D A;  5LMU L;  2QCP X;  3PF4 A;  1TS4 A;  2F0M A;  2XTI A;  2EYJ A;  1HR0 Q;  2B2Y A;  1E1O A;  4PZ6 A;  2PMZ E;  4IUN A;  3GTQ B;  4LF4 L;  1V43 A;  3VR2 A;  3ULL A;  1LM0 A;  1S5F D;  4HJ7 A;  1FVI A;  2CH4 W;  3A56 A;  1N36 Q;  4B3S L;  1HJP A;  1PYW D;  5IT9 E;  2AMC B;  3CCJ A;  2UXD Q;  1IBK L;  3BZC A;  2BA1 A;  4HJ9 A;  4RGT A;  3H3V I;  4KY6 A;  3TP6 A;  3I56 A;  3GTK H;  2FIN B;  3O13 A;  1WD1 A;  4HSV A;  2UXB Q;  2KEE A;  4RGO S;  1U4M A;  2FJ2 A;  4HAE A;  3EFX D;  4C3I H;  1NMF A;  2PCF B;  4HIK A;  3QO2 A;  1L1O A;  2F0I A;  3S17 H;  2F0J A;  3Q0A A;  4L8J A;  2G9D A;  1N34 L;  4FYD A;  2DY7 A;  2AQ1 B;  2NN6 H;  3ONA B;  2V4D A;  1OXU A;  1TVX A;  3T53 B;  4IUQ A;  1CK1 A;  3H0G H;  3F8T A;  4ZK9 B;  3K5M A;  4LFA L;  5I4D A;  3MC0 B;  4A3G G;  3HG9 A;  1LTL A;  3SK4 A;  3FEW X;  3S2D H;  5DLQ E;  2F0W A;  3HOY H;  1STY A;  1TT2 A;  3MEH A;  2D2C C;  2DGY A;  3K57 A;  1P16 A;  2F0D A;  3I72 A;  4FXK C;  4BY1 B;  1E2Z A;  2RBM A;  2X6L A;  1I5F A;  1NCV A;  1SEB D;  1IXR A;  2ZJP A;  4KY7 A;  3QOL A;  1MI2 A;  2NZO A;  3CD6 A;  4B3S Q;  1JJG A;  3QIA A;  5M3M G;  2VXW A;  2IW3 A;  3CCR A;  3E0E A;  3J81 i;  2QDB A;  4LMQ D;  3KDF B;  4XTC S;  4X6A H;  3RLO A;  1I94 L;  1VQ5 A;  3S15 B;  2QIL A;  1Q12 A;  5M3M B;  1ILP A;  1EZ6 A;  1Z7T A;  4H7B A;  2E2I H;  4JW0 A;  1TQO A;  2EYL A;  1DGS A;  2CKZ B;  2A74 C;  5C44 G;  2EY5 A;  2R7F A;  2QKI C;  3MWY W;  4BXX G;  3LGJ A;  2SNS A;  4L6T B;  4DV2 L;  4ZQ3 A;  1CSQ A;  1X3F A;  4EGV A;  1VQL A;  5C44 B;  2WKC A;  3E6Z X;  2DY8 A;  4R8I A;  3F1Z A;  3KLS X;  1G2T A;  1QVC A;  4QIW E;  1RJT A;  3GV6 A;  3U50 C;  1KQS A;  3WOE A;  1N32 Q;  2F4I A;  2P5Z X;  3D4W A;  2Z6K C;  2UXC Q;  2JP1 A;  2K5V A;  1XNR Q;  1XWE A;  1PXU A;  1JB3 A;  1HQR D;  4HR7 B;  4XQJ A;  4DF7 A;  4DXF A;  3H15 A;  4GKJ L;  4B3T Q;  2VY3 A;  4LF5 Q;  1L0Y B;  1SFO B;  1ASY A;  1JOK A;  5ELF A;  3EQL C;  4DR7 L;  3CCL A;  1X54 A;  1CHP D;  2YV5 A;  3M3Y B;  3VR4 A;  3K8A A;  2B29 A;  2XSC A;  4OIK A;  2BDO A;  3MXP A;  4A3M G;  2I0Q A;  2B39 A;  2L5T A;  2A6E D;  3BDL A;  3AQQ A;  4HCS A;  2R92 H;  4DV3 L;  3C3L A;  1X3E A;  1KLG D;  1RCV D;  4DAY A;  2EIF A;  5C5L A;  3OW7 A;  3HOX B;  2JA8 H;  5H1S E;  4HJA A;  4BBS B;  4A3C H;  4AYB B;  4A3F H;  2I5H A;  1E24 A;  3L7Z C;  4K2K A;  5KRU A;  3PO3 G;  2KHI A;  4MN3 A;  1T9H A;  3MVV A;  1YIT A;  1WTQ A;  4J1M A;  1ENA A;  2OQK A;  5JEA G;  3OYY A;  4G7Z C;  3HS0 C;  5A35 A;  4LAA A;  1FR3 A;  2A69 C;  4X3T A;  2NVY H;  2G9H D;  2BDN A;  1C0A A;  1V1Q A;  2BE5 D;  3UDX A;  3NEL A;  2CW0 C;  1IZ6 A;  3W1G A;  4GKJ Q;  4X66 L;  1QE6 A;  1UE5 A;  4A3D G;  3DWQ A;  1YJW A;  2LXJ A;  1IBM L;  1PZI D;  4C3H H;  4DK1 A;  2K5Q A;  4QB4 A;  1B9M A;  1YEZ A;  3HRZ C;  4GKK Q;  1X6O A;  5C3X A;  2F4V Q;  2K7V A;  4DUZ L;  1FGU A;  4PG3 A;  4FXD A;  4JI5 L;  4A3D B;  2M00 A;  1XTC D;  3CP0 A;  4QUF A;  2PNH A;  2QA4 A;  4NXN Q;  1TS3 A;  5ISR A;  2KEC A;  1S3O A;  5IYC H;  4Y7N H;  5FOB B;  5EPJ A;  1PHJ A;  2RDH A;  1LT5 D;  5EQ0 A;  1RIP A;  1LAB A;  4C56 C;  3BG3 A;  4K14 A;  5ELO A;  5I9O A;  1NE3 A;  4HMI A;  4QY7 A;  1JJ2 A;  2CW0 D;  2ZJR A;  5G3L F;  5E1F A;  5M5X B;  1X65 A;  2YU9 H;  1STE A;  5I6W A;  3J80 c;  2F0E A;  3OWE B;  3KJO A;  4BY7 G;  2I07 B;  4GNX B;  4HIM A;  2EJM A;  1A3T A;  5IP7 H;  4FF2 A;  4K5X A;  4DR3 Q;  1TY2 A;  2QW7 A;  1HQM C;  4DKA C;  4DAM A;  1WD0 A;  4QF4 A;  1TWH H;  1LO5 D;  4PZ7 A;  3R2T A;  3KJP A;  5AFW A;  2XRQ D;  1I4H A;  3I4N B;  4LUV A;  5FO8 B;  2XIW A;  1KDA A;  1SBB B;  5IGF A;  1PFN A;  2EZV A;  1XMO Q;  1FJG L;  3K7U C;  1F2Z A;  3D6W A;  3PUZ A;  5EKL A;  2UUA Q;  3RLN A;  5K36 H;  1E2V A;  4X62 L;  4LF7 Q;  5HY6 A;  4JCV E;  2KCC A;  4JI1 L;  3VR3 A;  1EYD A;  4JG2 A;  4JI8 Q;  2R7Z B;  1AE3 A;  3RZD H;  1L0X B;  2NTT A;  3KOJ A;  3RLF A;  2WAQ B;  2VZA A;  1OO9 B;  2KA7 A;  1CQV A;  4F8M A;  3H6M A;  1E2W A;  4YY3 L;  4OXP A;  2R93 H;  4UAI A;  4L5T A;  3T51 B;  4JI0 Q;  1Q1B A;  4WRD A;  4IUV A;  4YHH Q;  3TS0 A;  1VS0 A;  3TBI B;  1HHV A;  3STB C;  3GTO H;  3GTK B;  2B8F A;  3TS2 A;  2OT2 A;  4F88 A;  2NN6 G;  4B08 A;  3H0G G;  1SJH D;  4C3I B;  5EBD A;  2OTJ A;  3U9S A;  4X64 Q;  2Z0S A;  2Q8I B;  3GTJ H;  3HOY G;  1K83 H;  4HCE A;  3W2D A;  1ILQ A;  1JJC B;  1EIY B;  4IQZ A;  3NWS A;  4YWK A;  1N33 Q;  4XQQ A;  4ALP A;  4A3L G;  3OMG A;  3H0G B;  4RKB A;  2JSO A;  1BKB A;  3GTG H;  4CJ2 C;  5TSS A;  4RAU C;  2CVR A;  4JI1 Q;  1NY4 A;  3LNN A;  1YNN C;  3HOY B;  5CV5 A;  2E2J H;  2CWA A;  1I50 H;  2EYO A;  4DAV A;  1U9R A;  3KDF A;  3HKZ B;  5T1G A;  2R3Z A;  4KHZ A;  3SK6 A;  4YY3 Q;  4GOP B;  3HOU H;  1LV9 A;  1LUZ A;  1Y1V H;  5IOC A;  3V2T A;  1SDF A;  3RN5 A;  4IFD J;  1HFN A;  1X3Q A;  4DR6 L;  1PFB A;  3L9A X;  1L1O B;  1JE5 A;  3KLS A;  3D31 A;  4DR5 Q;  4NPS A;  5EAY A;  2IT1 A;  1K8M A;  4A3G H;  1D5X C;  4KD3 A;  1F77 A;  2IL8 A;  3RR5 A;  3RUZ A;  4DV5 Q;  4MNO A;  3IL8 A;  1HNW Q;  2RVL A;  4G7H C;  3P7J A;  1CFM A;  1JWM D;  1YNN D;  2PYK A;  1AFP A;  4WJ4 A;  1UNS A;  1Q46 A;  4YIJ A;  1LYL A;  4XYQ A;  1SLJ A;  1XPR A;  3SEB A;  2KBN A;  1WI5 A;  1RF2 D;  2Q8R E;  3U4V A;  3T1Y Q;  3BZK A;  1AW7 A;  4C1N K;  1E0B A;  1MJC A;  4JI4 Q;  5GAD C;  3J7A 5;  4UP8 A;  4OO1 G;  3OOC A;  5ELN A;  1IL8 A;  4DR1 Q;  3Q8D A;  4AH6 A;  3BYY B;  5FKA C;  3TME A;  4TQU S;  2J4X A;  3AYH B;  2ZXO A;  2TSS A;  4IUT A;  2JA7 B;  4NB3 A;  1FNW A;  4BXX H;  1CTM A;  2B2U A;  4R4Q A;  1D7Q A;  2R92 G;  2EJF C;  2E74 C;  2DNE A;  1DM0 B;  4KKT A;  4XIG S;  3A5U A;  2WB1 E;  1A63 A;  1EQV A;  3NQI A;  5EPL A;  4A3C G;  4DV1 L;  4C2M H;  4JBJ A;  3UE1 A;  3CC7 A;  1BQQ T;  4IO9 A;  1G2S A;  1EUJ A;  3ITP A;  1NR4 A;  2DUD A;  1ET6 A;  2JA8 B;  5GAE C;  1PZK D;  1EWI A;  5C0X H;  1PH1 A;  1LLR D;  4A3F B;  2UU9 Q;  3SHL A;  4YWM A;  1EIG A;  3SE0 A;  2F0O A;  3RNU A;  4UHV A;  1RL2 A;  4PMW A;  1HRJ A;  1I3Q B;  4RH6 A;  3GTP H;  1A15 A;  1SMY C;  1LTS D;  3RZO H;  3PQI A;  1JOR A;  1I4X A;  2JA5 H;  2ICI A;  2AUK A;  2NVY B;  3CMA A;  4C3H G;  2NTS A;  2A73 B;  3J81 j;  2B63 G;  5IT9 L;  2QDL A;  4JOI C;  1U5K A;  5FK9 C;  5C4X B;  2RDF A;  2NBF A;  1KHI A;  3EJI A;  5CBE E;  1YZ6 A;  1GUN A;  3UDG A;  5DNF A;  3PIP 3;  1ZYR C;  4XXE A;  1EEI D;  4DAY B;  1K3B C;  4C3H B;  1KDC A;  1GUG A;  1ZEQ X;  3H3V C;  5KGU A;  2H1E A;  5IYC G;  1SNO A;  3PV0 A;  4DV1 Q;  5E4W C;  2B2T C;  4IUR A;  4Q5V A;  2PQA A;  4DUY L;  2L9H A;  1S5B D;  2VB3 X;  3X3N A;  4FNF A;  1NNX A;  3W5O A;  1Q81 C;  5JEA H;  2HQL A;  5JAV A;  1D5Z C;  1D6E C;  1KLU D;  5IY0 A;  4XQN A;  4TVA B;  1QVF A;  2YTX A;  1HUM A;  4DV0 Q;  5CMD A;  3S1N H;  4N8F A;  1VQG A;  3VA7 A;  1U4P A;  3CU7 A;  3OSO A;  3DM1 A;  2VQE L;  4ILW A;  5IP7 G;  3J81 E;  4LF8 L;  2CFM A;  1Q3L A;  5JVH 3;  4A76 A;  3A7A B;  1GHJ A;  2YU9 B;  1STH A;  3R2I A;  3CRL C;  1F9S A;  1AZQ A;  4NXM Q;  1VF5 C;  1ZYR D;  3ZYY X;  4UDU C;  2WV6 D;  4RMF A;  1HR0 L;  3T56 B;  5E4X A;  4RFB A;  3A8I E;  5COY A;  3FMC A;  1YNX A;  5C3E H;  2MHV A;  1Q8I A;  4GN3 B;  4A3I H;  5K36 G;  1N36 L;  4O2D A;  1I4Q A;  1O7I A;  1MSG A;  2UXD L;  5ELB A;  3SK8 A;  2L55 A;  1EY6 A;  3DEP A;  2NUC A;  2PI2 E;  1IHZ A;  1F2M A;  2EVB A;  3U58 A;  1S5D D;  2R93 G;  4YWL A;  2EJG C;  3RZD B;  2F03 A;  3P20 A;  1VMP A;  3DHQ A;  1D8L A;  4PQX A;  5FJ8 H;  1L0W A;  1YJ9 A;  3K5O A;  1VQB A;  5EPK A;  1UE6 A;  2I5M X;  3SDZ A;  3F2U A;  1JMC A;  4FF3 A;  3J80 L;  2VNU D;  1B2T A;  2R93 B;  4OX9 Q;  3HOZ H;  4PZ8 A;  1AN8 A;  5M5W H;  3URY A;  3VYU A;  1S72 A;  1NTG A;  1YBY A;  1A3U A;  4N8X 1;  1SND A;  1O7Y A;  3K5L A;  1BCP C;  3H91 A;  3FRP B;  5KIX A;  1VQ8 A;  4LFB Q;  1AZP A;  3GTM H;  1C9O A;  1HNZ Q;  1XMQ Q;  1VQH A;  2MGS A;  2F3V A;  1VQJ A;  1JR0 D;  3H3V H;  1K83 B;  2HQE A;  2ENB A;  2JA9 A;  3OPO A;  5CYU A;  3L3O C;  3NBI A;  2V1C C;  2D9U A;  5JJZ A;  3T4A C;  5M5Y H;  4GOP A;  3GTG B;  1E3P A;  3HOU G;  1QCB D;  3QWN A;  1Y1V G;  1JB7 A;  1H9S A;  2MO1 A;  2E2J B;  4HN7 A;  5HUR A;  2O4X A;  1QIL A;  1I50 B;  2XRS D;  1AE2 A;  2H4O A;  4H0L C;  1B7Y B;  2N78 A;  5EKI A;  2C5C A;  3CQZ H;  2F1M A;  4BWG B;  2J7Z A;  3JC6 6;  1BCP D;  1Y1V B;  2LMC B;  1TWF B;  5A2Q L;  1EWC A;  5T1I A;  2EYF A;  2JA6 H;  3I4O A;  4LW1 A;  1UWV A;  5LMN Q;  3NEN A;  1MSH A;  2E2D C;  3H94 A;  1PFS A;  1HCZ A;  2FXQ A;  4A3L H;  4G7O C;  4XDX A;  1SE3 A;  1XYI A;  4A3G B;  1PVO A;  3MXU A;  1N32 L;  2UXC L;  2XNA C;  1F2Y A;  4IN3 A;  1XNR L;  1Q7Y C;  5EKK A;  2WIN B;  1BBX C;  4LK1 C;  1GHK A;  1VQN A;  1PH8 A;  4JK1 C;  2EYM A;  4DAP A;  5CC4 A;  1NBW A;  1QB5 D;  1NR2 A;  4B3T L;  4LF5 L;  2N3S A;  2JEB I;  3DWP A;  3A7L A;  3N52 A;  4IPG A;  4HMJ A;  1SJE D;  4LJZ C;  3CF5 A;  1H9K A;  3PIO 3;  1H9M A;  3S24 A;  4KJN A;  3NEM A;  1J9O A;  5BN3 A;  4FXG C;  1OXX K;  1WTP A;  3BDC A;  1X55 A;  3S1M H;  1UUP A;  3Q23 A;  4K6L A;  3M85 A;  1DON A;  1TII D;  3T16 A;  3A8K E;  4PV1 C;  3MFY A;  2QEJ C;  5FLX c;  1PH3 A;  1JC7 A;  1A2T A;  3MA2 B;  5CV8 A;  4JV5 L;  1RD9 D;  4GLV B;  1Y8P B;  3DLL A;  3FHW A;  1KAW A;  4RA8 A;  1N9W A;  2HCI A;  5C0X G;  4G4K A;  4OO1 H;  4QQB X;  3BDO A;  1EOV A;  2EOT A;  1B50 A;  4OEM B;  2WB1 G;  5IT9 c;  2KOL A;  3NK9 A;  2VQF Q;  4DXG A;  3CME A;  5IYD H;  2DN8 A;  2JA5 G;  4GKK L;  2F4V L;  4K5V A;  1LTR D;  4OWW B;  1CM9 A;  5ELD A;  1B4O A;  2H5X A;  1S4Z A;  2F0L A;  4M1U B;  3CCM A;  1TS2 A;  1SNC A;  4PMB A;  3GTP B;  2IX3 A;  3FPP A;  1HTP A;  4NXN L;  5C5M A;  2JA5 B;  4KHP Q;  1CI3 M;  1WTO A;  2RF4 A;  2QGQ A;  4A3M B;  2WAC A;  1S40 A;  4FF1 A;  1BO0 A;  3G48 A;  4I65 A;  3V96 A;  5M3F G;  1DJR D;  3W1B A;  4B9W A;  3Q24 A;  3CC2 A;  4AQY Q;  3UDI A;  5KYL A;  2NVQ H;  4JV5 Q;  2ZT9 C;  1E1T A;  3ZJY C;  1WTV A;  2ALY B;  2NVX H;  4TSS A;  3PO3 B;  2RQX A;  2I5L X;  1CUK A;  3S14 H;  4JI6 L;  3I3C A;  4P72 A;  1KAA A;  4DR3 L;  3MZ5 A;  5IGB A;  4J15 A;  1DYQ A;  1EY9 A;  2E8G A;  2F3W A;  2IHF A;  1SMX A;  3B6Y A;  3F2B A;  1WTW A;  4J6H A;  2Z6K A;  4BA1 I;  3S1N B;  2AKW B;  2B63 H;  4HID A;  3S16 B;  4E6I A;  4JI7 Q;  1MD2 D;  3GTL H;  3QB3 A;  1XMO L;  1HZA A;  1IKM A;  1MBY A;  1UE7 A;  3HOW H;  1TWA H;  1QG7 A;  2KJX A;  4A3E H;  2UUA L;  4I7A A;  4CKC A;  4LF7 L;  1I4R A;  5C3E G;  3K7A H;  4A3I G;  1EY8 A;  2O5I C;  4JI8 L;  4H44 C;  2PQA B;  4HTH A;  4OL7 A;  3JAM L;  4RWS C;  4RCN A;  3QR8 A; 
#chains in the Genus database with same CATH homology
 1JWU D;  2A69 D;  4DK0 A;  3IFT A;  5C3W A;  1STA A;  2IX0 A;  5C3E B;  1DD2 A;  1HTL D;  1F9P A;  4ZUI A;  2B2W C;  4DFA A;  2EY1 A;  4CBV A;  1SYG A;  4ID6 A;  5C0X J;  1FGB D;  3OWF A;  1CA5 A;  2E75 C;  1XX8 A;  3NTK A;  1JOQ A;  1VF7 A;  4U68 A;  2L4N A;  4BY7 B;  1SE4 A;  1DCZ A;  1LTG D;  1LT4 D;  1EYC A;  3X3M A;  3P1H A;  5I2X A;  3FVQ A;  3HZX A;  1RTN A;  2Q8T A;  4CJ1 B;  1LAC A;  3AU7 A;  2JEA I;  3HOZ B;  3LWU A;  5DM6 3;  5M5W B;  1OXS C;  4RKL A;  4MIU A;  3KBX A;  2LKV A;  1SYF A;  3GTM B;  5KNB A;  1RKN A;  2N88 A;  3OMC A;  5JEA J;  2PO4 A;  2DNC A;  4FO2 A;  2M9V A;  1I4P A;  2PZU A;  3TZU A;  4JBW A;  4ZRZ A;  1EFI D;  2BA0 A;  4ZKC B;  5M5Y B;  3U9O A;  3G6J B;  3CHB D;  3A8J E;  5CV4 A;  1Q1E A;  2PMZ B;  1ML0 D;  3S17 B;  2Z8L A;  4QUC A;  3CQZ B;  3S9W A;  3UI2 A;  3I8Z A;  1Y8O B;  4KKU A;  2JA6 B;  3S2D B;  4IUU A;  3N6R A;  1EIH A;  1SNM A;  1GXD C;  1B44 D;  1V8Q A;  2TMP A;  4X3U A;  3C46 A;  1H9S B;  4G57 A;  1QWY A;  3GO5 A;  2X69 A;  1AP0 A;  1O7Z A;  2O5J C;  1M4V A;  3C1E A;  4K8I A;  2K33 A;  1SYD A;  3VYR A;  1B3A A;  1BF4 A;  2E2I B;  4K6D A;  1TR5 A;  3K0Y A;  4RCO A;  3TP5 A;  4F87 A;  4NDX A;  2RDG A;  5E3F A;  2IX1 A;  1R4Q B;  4CJ0 B;  2N55 A;  1S5C D;  4QMG A;  3Q6S A;  3K59 A;  2MPM A;  2EE1 A;  1C4Q A;  1FD7 D;  5ELC A;  5D14 A;  1BCP B;  1PTO F;  5J1Z A;  1SXT A;  3TZD A;  2NWG A;  1PRT F;  1CZW A;  4S3S A;  4QCL A;  3NWT A;  3GV3 A;  4KK7 A;  4N9T A;  3VA5 A;  5F2D A;  3M4Y A;  2B2V C;  4M8A A;  2ICE C;  4QIW B;  1D2B A;  5G3L D;  1CQF A;  3BYT B;  4HED A;  3H09 A;  2RSN A;  2D5D A;  4FF4 A;  3MTS A;  3PUY A;  4HSP A;  2OXP A;  5EBC A;  1Y69 U;  2R92 B;  1VCI A;  2JE6 I;  3MHB A;  1R4P B;  1STG A;  3I91 A;  1Y8N B;  2JXM B;  1G8Z D;  5FLX L;  2K5D A;  4ZKB B;  2K03 A;  1DXM A;  3OIP A;  2IWH A;  3MFG A;  2NVQ B;  1U4R A;  3VR5 A;  2ZXP A;  4TRD A;  4Q0F A;  2NVX B;  1PMR A;  1ZKO A;  3RMH A;  5CV6 A;  3S14 B;  4ZLT F;  1EY0 A;  2MUY A;  5BN4 A;  1D5M C;  3KF8 A;  4I7Z C;  2KCN A;  1FYC A;  2XWB B;  3W3A A;  4ULL A;  2B63 B;  1VDZ A;  2LS0 1;  1B53 A;  4CHT B;  4V19 0;  3BZD B;  1V1O A;  2LFN A;  1Z47 A;  3HOW B;  4A3E B;  1KAB A;  3RD4 A;  4Y7N B;  4TKO B;  5LHY 1;  2XWJ B;  1SYE A;  5COR A;  1SMY D;  5LL6 S;  1LTB D;  1SNP A;  5IGG A;  3D4R A;  4IAL A;  2PW7 A;  4DNT B;  2F0P A;  2WII B;  1I4G A;  3KUP A;  2HDL A;  2J0T D;  2NB0 A;  3NPP A;  1CHQ D;  2EDG A;  4MHE A;  1TKW B;  2NZ1 D;  1GUW A;  1TWH B;  2M2L A;  3HEJ A;  5FO7 B;  1F2L A;  1JWS D;  2FFK B;  1PTO C;  1W6K A;  1B9N A;  1DOL A;  2AQ3 B;  1PRT C;  5I9P A;  2EYH A;  1WTX A;  2A6H C;  2F0G A;  2AQ2 B;  2BCO A;  1IYU A;  4BBR B;  2B2T A;  1O78 A;  5JOB A;  5D65 A;  4NW2 A;  1BNZ A;  3M4O B;  4A3K B;  4DN4 M;  5LL6 X;  3J7A F;  4IFD I;  2K5W A;  4KN7 C;  2L12 A;  1UEA B;  1II3 A;  1NAP A;  1T5E A;  4RGM A;  5C4J B;  3GTO B;  1A6X A;  1GOZ A;  4EQP A;  1C8C A;  1NUC A;  4RGN A;  1TWC B;  1YNJ C;  4NMZ A;  3GTJ B;  3TN2 A;  5J22 A;  1G6Z A;  5FO9 B;  2LY7 A;  1PFM A;  2R6G A;  3EA6 A;  2O2L D;  4ABN A;  1IW7 C;  4A93 B;  4OGQ C;  4KY5 A;  1GJX A;  4FVM A;  2F0H A;  1BXT A;  1SAP A;  2RKS A;  5D3I B;  4PMC A;  2EPB A;  4KHV A;  1JQY D;  2XN9 C;  2EXZ A;  1QNU A;  3HOU B;  5J39 A;  5HGT A;  1ONL A;  4KN4 C;  2K04 A;  2Z4H A;  3D8G A;  2FMM A;  2PZT A;  1KNE A;  1YNJ D;  1I6V C;  3CRK C;  3PUW A;  2SNM A;  1OXT A;  2NN6 I;  4IZ8 A;  1HA6 A;  1HXY D;  1X3P A;  2OEO A;  3DEO A;  3C2P A;  2F0N A;  3GD7 A;  3K6O A;  1IW7 D;  1PTO H;  3BVM A;  4OHJ A;  4X3K A;  4IUP A;  3SK5 A;  3QOJ A;  3G7L A;  4A3J B;  1S5E D;  1OXV A;  4X3S A;  4DU9 A;  2AWN A;  1HUN A;  1RDP D;  1SNQ A;  4CKB A;  3BS1 A;  1CT1 D;  1NSN S;  1CZG A;  5KEE A;  4WFN 3;  4L63 B;  3IAY A;  5IOD A;  5K5P A;  1EYA A;  3K5N A;  1RHP A;  1KTK A;  2CQA A;  1FNV A;  1EZ8 A;  2IJ0 A;  1BDO A;  1H9R A;  2F0V A;  2VUM B;  1KDB A;  4NKL A;  2K05 A;  2F0T A;  1XXG A;  4ZUJ A;  4C2M B;  2A6E C;  3FDT A;  5JPN C;  3TDQ A;  2SDF A;  3J80 E;  1ROD A;  1KNA A;  1LT3 D;  4DNR B;  2ID0 A;  1PZJ D;  5C4Z A;  5BN5 A;  1ZXT A;  1SSO A;  2WB1 B;  2C9O A;  1I6H B;  4OO1 I;  3S1Q B;  3V05 A;  3E0J A;  2A68 C;  3RZO B;  1V1P A;  4C1N I;  2BE5 C;  1B1Z A;  5DEH A;  3IKJ A;  2AUJ D;  5KYI A;  3NQT A;  1A3V A;  2L0C A;  1X32 A;  3I73 A;  3C1F A;  5CGK A;  5CBA E;  2F0K A;  4XT1 B;  1VMC A;  2OF1 A;  1EEF D;  1BR9 A;  2MP1 A;  5M3F B;  3NE5 B;  3D3R A;  2Z4I A;  3NP8 A;  2E2H B;  3SVM A;  5A2Q E;  2PPB C;  3TP8 A;  1LTA D;  3KLR A;  3DXJ C;  5EGT A;  1EY7 A;  1EWH A;  2A68 D;  3D6C A;  4J8Q A;  5ELE A;  2K1B A;  2ZXR A;  1QNK A;  1DZ1 A;  5CV7 A;  4RHS A;  3WOF A;  3PO2 B;  4ZYS A;  3MXN A;  3NUC A;  3SXH A;  1CA6 A;  4C3J G;  2B8G A;  3NXW A;  3M7N A;  3QJY A;  1GUO A;  4A3I B;  3PUV A;  1SE2 A;  3NBH A;  4C3J B;  2F0S A;  5IGD A;  4V0B A;  1UAP A;  4Z9C B;  2RSO A;  3PMF A;  5C6A A;  1G91 A;  4R9W A;  2WKD A;  5JVG 3;  2F0Q A;  4IFD G;  3AB9 A;  3DWA A;  3T13 A;  3GQB A;  3D4D A;  3DUZ A;  1U4L A;  3OIQ A;  1WCM B;  2YYZ A;  4ME5 A;  1STB A;  1TU2 B;  4CGY B;  1DOK A;  3IFD A;  2BOS A;  1T5X D;  2NYZ D;  2KED A;  2KHS A;  1JOO A;  2PW5 A;  3TP7 A;  4ODG A;  2F0F A;  1EQT A;  3GP7 A;  1ICW A;  2VB2 X;  3A55 A;  4XYO A;  3CKI B;  1PLF A;  2NVT B;  4EQN A;  5I2Y A;  3BVZ A;  3HGB A;  2R61 A;  2B2W A;  3NSW A;  1EU3 A;  4C3I G;  3EVQ A;  1R9T B;  4K5W A;  3ERQ A;  3WDN A;  4H13 C;  2MJ8 A;  3I70 A;  5IIF A;  4K2L A;  4DGZ A;  3P75 A;  3LWE A;  2KVM A;  1D1K A;  4RHR A;  5EJW A;  3KK7 A;  4DA2 A;  4K8J A;  1JE4 A;  2EY2 A;  3KBG A;  2L1B A;  3NHH A;  4KMU C;  3PUX A;  1IYV A;  1PTO B;  2K6A A;  1F9Q A;  3S2H B;  1PRT B;  1EOT A;  2B2U C;  3BVG A;  1HPC A;  1TS5 A;  3VR6 A;  3R93 A;  4WJW A;  5JPM C;  3JAM E;  4ZAI A;  4KTA A;  4R8N A;  4CKE A;  1M8A A;  3J81 L;  1ENF A;  2FMC A;  3SR1 A;  2PQE A;  4EVO A;  3ND9 A;  2AWO A;  3K58 A;  3S1M B;  1G29 1;  4BA2 I;  2F0U A;  2XVS A;  1SYC A;  3FPU B;  1RTO A;  1Q90 A;  4U67 3;  1F9R A;  1WTR A;  1HA5 A;  3I90 A;  2SEB D;  2EYP A;  2KQ3 A;  3AMU A;  1ENC A;  5IGC A;  4EQO A;  3MXG A;  3VYS A;  1PDQ A;  1JCK B;  1C48 A;  4NP5 A;  4OIJ A;  3HOV B;  2PZW A;  3HP3 A;  1MGS A;  4PNY A;  4N9P A;  1Y1W B;  4KI0 A;  1EU4 A;  1J8I A;  2D62 A;  3LX0 A;  2HUG A;  4KV6 A;  3J7A V;  1QJO A;  1BCP F;  1TWG B;  2EY6 A;  5DAU A;  3FKI B;  4WOR A;  2FHT A;  1HFG A;  3S1R B;  3M7G A;  4P2C B;  5C0X I;  4B9X A;  1BUV T;  1V1P B;  4XT3 B;  3A54 A;  2CHB D;  2I46 A;  3GTL B;  3E5S A;  1O80 A;  1QOH A;  1EL0 A;  1TWA B;  2B2V A;  1A2U A;  1TY0 A;  1LT6 D;  2GA4 B;  2L11 A;  2QF7 A;  5IGE A;  3MAQ A;  3OHX C;  3K7A B;  4KJO A;  3R3O A;  2HCC A;  2Y0S B;  5CR3 A;  1GUS A;  2PNR C;  4O42 A;  5CV9 A;  3TSS A;  1EY4 A;  2HDM A;  4FP5 D;  3QG1 A;  2JYO A;  5D3D A;  4F7X A;  2B2Y C;  3ERO A;  1EY5 A;  2Z1C A;  1AEX A;  1IKL A;  2K28 A;  1STN A;  4GZY C;  1DOM A;  2K01 A;  1ESF A;  2A5H A;  1LTT D;  1ET9 A;  1JIC A;  4KD4 A;  5KND A;  5M9O A;  1FNU A;  3NTH A;  2IPK D;  5NUC A;  3R8B A;  3I4M B;  1Z6H A;  3VYT A;  1K8O A;  1ESR A;  5DM7 3;  5I6Y A;  5C4H A;  3Q22 A;  1LTI D;  5KNC A;  4A3B B;  1O7L A;  3ND8 A;  2X6G A;  4IFD H;  2RA4 A;  3NTI A;  4BS9 A;  2K32 A;  3I4L A;  1W6J A;  2SOB A;  1H9J A;  2KUM A;  2E76 C;  1SYB A;  1GUT A;  4O1N A;  1PTO D;  3DMU A;  3J7Y W;  1BOS A;  1WVL A;  1PRT D;  1D1I A;  4KKS A;  2A6H D;  5FLX E;  2WP8 J;  2QCP X;  1TS4 A;  2F0M A;  2EYJ A;  2B2Y A;  4IUN A;  3GTQ B;  1V43 A;  3VR2 A;  1S5F D;  3A56 A;  1PYW D;  5IT9 E;  2BA1 A;  4RGT A;  4KY6 A;  3TP6 A;  2FIN B;  3O13 A;  1WD1 A;  4HSV A;  2KEE A;  4RGO S;  1U4M A;  2FJ2 A;  4HAE A;  3EFX D;  2PCF B;  3QO2 A;  2F0I A;  2F0J A;  3Q0A A;  4L8J A;  2G9D A;  4FYD A;  2DY7 A;  2AQ1 B;  2NN6 H;  2V4D A;  3ONA B;  1OXU A;  1TVX A;  3T53 B;  4IUQ A;  1CK1 A;  4ZK9 B;  3K5M A;  5I4D A;  3MC0 B;  3HG9 A;  3SK4 A;  3FEW X;  2F0W A;  1STY A;  1TT2 A;  3MEH A;  2D2C C;  3K57 A;  2F0D A;  3I72 A;  4FXK C;  4BY1 B;  1E2Z A;  2RBM A;  2X6L A;  1NCV A;  1SEB D;  4KY7 A;  3QOL A;  1MI2 A;  3QIA A;  2VXW A;  2IW3 A;  2QDB A;  4LMQ D;  4XTC S;  3S15 B;  2QIL A;  1Q12 A;  5M3M B;  1ILP A;  1EZ6 A;  1Z7T A;  4H7B A;  1TQO A;  2EYL A;  2A74 C;  2EY5 A;  2QKI C;  3MWY W;  2SNS A;  4L6T B;  4ZQ3 A;  4EGV A;  5C44 B;  2WKC A;  3E6Z X;  2DY8 A;  4R8I A;  3KLS X;  1G2T A;  1RJT A;  3GV6 A;  3WOE A;  2F4I A;  3D4W A;  2JP1 A;  1XWE A;  1PXU A;  1JB3 A;  1HQR D;  4HR7 B;  4XQJ A;  4DF7 A;  4DXF A;  1L0Y B;  1SFO B;  1JOK A;  5ELF A;  3EQL C;  1CHP D;  3M3Y B;  3VR4 A;  2XSC A;  4OIK A;  2BDO A;  3MXP A;  2B39 A;  2L5T A;  2A6E D;  3BDL A;  4HCS A;  3C3L A;  1KLG D;  1RCV D;  4DAY A;  5C5L A;  3OW7 A;  3HOX B;  4BBS B;  4AYB B;  3L7Z C;  4K2K A;  5KRU A;  4MN3 A;  3MVV A;  1WTQ A;  4J1M A;  1ENA A;  5JEA G;  4G7Z C;  3HS0 C;  5A35 A;  4LAA A;  1FR3 A;  4X3T A;  2A69 C;  2G9H D;  2BDN A;  2BE5 D;  2CW0 C;  1QE6 A;  3DWQ A;  1PZI D;  4DK1 A;  2K5Q A;  4QB4 A;  1B9M A;  3HRZ C;  5C3X A;  2K7V A;  4FXD A;  4A3D B;  2M00 A;  1XTC D;  4QUF A;  1TS3 A;  5ISR A;  2KEC A;  5FOB B;  5EPJ A;  2RDH A;  1LT5 D;  5EQ0 A;  1LAB A;  4C56 C;  3BG3 A;  4K14 A;  5I9O A;  4HMI A;  2CW0 D;  5G3L F;  5E1F A;  5M5X B;  1STE A;  5I6W A;  2F0E A;  3OWE B;  2I07 B;  2EJM A;  1A3T A;  4FF2 A;  4K5X A;  1TY2 A;  1HQM C;  1WD0 A;  4QF4 A;  1LO5 D;  3R2T A;  5AFW A;  2XRQ D;  1I4H A;  3I4N B;  5FO8 B;  2XIW A;  1KDA A;  1SBB B;  5IGF A;  1PFN A;  2EZV A;  1F2Z A;  3D6W A;  3PUZ A;  5EKL A;  5K36 H;  1E2V A;  2KCC A;  3VR3 A;  1EYD A;  2R7Z B;  1L0X B;  2NTT A;  3RLF A;  2WAQ B;  1OO9 B;  2KA7 A;  1CQV A;  4F8M A;  3H6M A;  1E2W A;  4UAI A;  3T51 B;  1Q1B A;  4WRD A;  4IUV A;  3TBI B;  1HHV A;  3GTK B;  2B8F A;  2OT2 A;  4F88 A;  2NN6 G;  4B08 A;  1SJH D;  4C3I B;  5EBD A;  3U9S A;  2Q8I B;  4HCE A;  3W2D A;  1ILQ A;  4IQZ A;  3NWS A;  4XQQ A;  3OMG A;  3H0G B;  4RKB A;  2JSO A;  4CJ2 C;  5TSS A;  4RAU C;  2CVR A;  3LNN A;  1YNN C;  3HOY B;  5CV5 A;  2EYO A;  4DAV A;  1U9R A;  3HKZ B;  5T1G A;  2R3Z A;  4KHZ A;  3SK6 A;  1LV9 A;  5IOC A;  3V2T A;  1SDF A;  1HFN A;  4IFD J;  1X3Q A;  1PFB A;  3L9A X;  3KLS A;  3D31 A;  2IT1 A;  1K8M A;  1D5X C;  4KD3 A;  1F77 A;  2IL8 A;  3RUZ A;  3IL8 A;  2RVL A;  4G7H C;  3P7J A;  1CFM A;  1JWM D;  1YNN D;  2PYK A;  1AFP A;  1UNS A;  4YIJ A;  4XYQ A;  3SEB A;  1RF2 D;  2Q8R E;  4C1N K;  1AW7 A;  1E0B A;  4OO1 G;  3OOC A;  1IL8 A;  3BYY B;  5FKA C;  3TME A;  4TQU S;  2J4X A;  2ZXO A;  2TSS A;  4IUT A;  2JA7 B;  1FNW A;  1CTM A;  2B2U A;  2EJF C;  2E74 C;  2DNE A;  1DM0 B;  4KKT A;  4XIG S;  1EQV A;  3NQI A;  5EPL A;  1BQQ T;  1G2S A;  3ITP A;  1NR4 A;  1ET6 A;  2JA8 B;  1PZK D;  5C0X H;  1LLR D;  4A3F B;  3SHL A;  1EIG A;  3SE0 A;  2F0O A;  4PMW A;  1HRJ A;  1I3Q B;  4RH6 A;  1A15 A;  1SMY C;  1LTS D;  1JOR A;  1I4X A;  2ICI A;  2AUK A;  2NVY B;  4C3H G;  2NTS A;  2A73 B;  5IT9 L;  5FK9 C;  5C4X B;  2RDF A;  2NBF A;  3EJI A;  5CBE E;  1GUN A;  5DNF A;  3PIP 3;  1ZYR C;  4XXE A;  1EEI D;  4C3H B;  1KDC A;  1GUG A;  1ZEQ X;  3H3V C;  5KGU A;  2H1E A;  1SNO A;  3PV0 A;  5E4W C;  2B2T C;  4IUR A;  4Q5V A;  2L9H A;  1S5B D;  2VB3 X;  3X3N A;  4FNF A;  5JEA H;  5JAV A;  1D5Z C;  1D6E C;  1KLU D;  4XQN A;  1HUM A;  5CMD A;  3VA7 A;  1U4P A;  3CU7 A;  3OSO A;  3DM1 A;  4ILW A;  3J81 E;  1Q3L A;  5JVH 3;  3A7A B;  1GHJ A;  2YU9 B;  1STH A;  3R2I A;  3CRL C;  1F9S A;  1AZQ A;  1VF5 C;  1ZYR D;  3ZYY X;  4UDU C;  2WV6 D;  3T56 B;  5E4X A;  4RFB A;  3A8I E;  5COY A;  3FMC A;  2MHV A;  1Q8I A;  5K36 G;  1I4Q A;  1MSG A;  5ELB A;  3SK8 A;  2L55 A;  1EY6 A;  3DEP A;  2NUC A;  1IHZ A;  1F2M A;  2EVB A;  1S5D D;  2EJG C;  3RZD B;  2F03 A;  3P20 A;  1VMP A;  3DHQ A;  4PQX A;  3K5O A;  5EPK A;  3SDZ A;  3F2U A;  4FF3 A;  3J80 L;  2VNU D;  1B2T A;  2R93 B;  1AN8 A;  3URY A;  3VYU A;  1A3U A;  1SND A;  1O7Y A;  3K5L A;  1BCP C;  3H91 A;  3FRP B;  5KIX A;  1AZP A;  2MGS A;  2F3V A;  1JR0 D;  1K83 B;  2HQE A;  2ENB A;  3OPO A;  5CYU A;  3L3O C;  3NBI A;  2D9U A;  5JJZ A;  3T4A C;  3GTG B;  1QCB D;  3QWN A;  1H9S A;  2E2J B;  4HN7 A;  5HUR A;  2O4X A;  1QIL A;  1I50 B;  2XRS D;  2H4O A;  4H0L C;  5EKI A;  2C5C A;  4BWG B;  2F1M A;  2J7Z A;  1BCP D;  1Y1V B;  2LMC B;  1TWF B;  5A2Q L;  1EWC A;  5T1I A;  2EYF A;  1MSH A;  2E2D C;  3H94 A;  1HCZ A;  4G7O C;  4XDX A;  1SE3 A;  1XYI A;  4A3G B;  3MXU A;  2XNA C;  1F2Y A;  4IN3 A;  5EKK A;  2WIN B;  1BBX C;  4LK1 C;  1GHK A;  4JK1 C;  2EYM A;  4DAP A;  5CC4 A;  1QB5 D;  1NR2 A;  2JEB I;  3DWP A;  3A7L A;  3N52 A;  4HMJ A;  1SJE D;  4LJZ C;  1H9K A;  3PIO 3;  1H9M A;  4KJN A;  1J9O A;  5BN3 A;  4FXG C;  1OXX K;  1WTP A;  3BDC A;  1UUP A;  3Q23 A;  4K6L A;  3M85 A;  1DON A;  1TII D;  3T16 A;  3A8K E;  4PV1 C;  3MFY A;  2QEJ C;  1JC7 A;  1A2T A;  3MA2 B;  5CV8 A;  1RD9 D;  1Y8P B;  4RA8 A;  2HCI A;  5C0X G;  4G4K A;  4OO1 H;  3BDO A;  2EOT A;  1B50 A;  2KOL A;  3NK9 A;  4DXG A;  2DN8 A;  4K5V A;  1LTR D;  1CM9 A;  5ELD A;  1B4O A;  1S4Z A;  2F0L A;  4M1U B;  1TS2 A;  1SNC A;  4PMB A;  3GTP B;  2IX3 A;  3FPP A;  1HTP A;  5C5M A;  2JA5 B;  1CI3 M;  1WTO A;  4A3M B;  2WAC A;  4FF1 A;  1BO0 A;  4I65 A;  3V96 A;  1DJR D;  4B9W A;  3Q24 A;  5KYL A;  2ZT9 C;  1WTV A;  4TSS A;  3PO3 B;  2RQX A;  3I3C A;  1KAA A;  3MZ5 A;  5IGB A;  1DYQ A;  1EY9 A;  2F3W A;  1WTW A;  4J6H A;  4BA1 I;  3S1N B;  3S16 B;  4E6I A;  1MD2 D;  3QB3 A;  1IKM A;  1MBY A;  1QG7 A;  2KJX A;  4CKC A;  1I4R A;  1EY8 A;  2O5I C;  4H44 C;  4HTH A;  4OL7 A;  3JAM L;  4RWS C;  4RCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...