5DAUA

Crystal structure of staphylococcal nuclease variant delta+phs v39e/v104e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLEDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNNWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39E/V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dauA00
2EYJA 4K5VA 4NDXA 2OF1A 3C1EA 3MVVA 1TT2A 2SOBA 1EYDA 5C5LA 4DU9A 5KRUA 4LAAA 1SYFA 1SYEA 2EYLA 4TRDA 1TQOA 2PQEA 4J1MA 5IIFA 4N9TA 5IODA 5KYLA 1EY6A 4DF7A 1JOQA 3MZ5A 5J1ZA 1SYGA 1II3A 5DEHA 5NUCA 3SHLA 5IGGA 4KY5A 3NK9A 2PYKA 2EYPA 3R3OA 4IALA 2KHSA 5J39A 1EZ8A 2F0IA 2RKSA 3PMFA 3D4DA 3RUZA 5M9OA 5CGKA 2EYMA 3NP8A 4R8NA 4I65A 3SK4A 1KAAA 2F0LA 2QDBA 5CV7A 5DAUA 1JOKA 5F2DA 4PMBA 3TP8A 5IGEA 1EY5A 4HMIA 4K8JA 2F0HA 4KD4A 4PNYA 2F3VA 4ID6A 3SK6A 2PW5A 3HZXA 4QB4A 2F0FA 2HQEA 1F2YA 4KJOA 4IUNA 3QOLA 5KGUA 3P75A 4N9PA 2F3WA 4K5WA 1F2ZA 4E6IA 5C6AA 4F8MA 3ITPA 1EQVA 4PMCA 4KY7A 3SK8A 3TP6A 1JORA 2EY1A 4IZ8A 4WRDA 1SNPA 4KV6A 4NP5A 1EY4A 1KDCA 1SNMA 2F0NA 2OXPA 4G57A 2RDFA 4K8IA 4RKBA 1EY9A 1A3VA 2EY6A 2EY2A 4ODGA 4EQOA 2F0DA 3MXPA 3SK5A 2WACA 4WORA 4HTHA 2M00A 1KDBA 1EYCA 1KDAA 4KD3A 5K5PA 2F0EA 2PZTA 1SNQA 1SYDA 3EROA 3H6MA 1STYA 1SNDA 3QOJA 4KHVA 4B9WA 5I6YA 2F0UA 5IGFA 3OSOA 1EY7A 3S9WA 2EXZA 1EY0A 1SYCA 1EYAA 1ENCA 5KIXA 1A3UA 2PZWA 3C1FA 4K2LA 2EYHA 3T16A 1KABA 5CV8A 4KY6A 4B9XA 1SNOA 1U9RA 5C3XA 5KEEA 4KTAA 2LKVA 4MIUA 1STGA 4DFAA 3MEHA 5IGBA 4NMZA 4ZQ3A 4EVOA 5IGCA 4QF4A 5C4HA 5I9OA 1RKNA 1SNCA 4YIJA 4ZUIA 1NSNS 4ZUJA 4KJNA 2F0JA 3U9OA 5CV5A 1NUCA 5J22A 1STNA 4S3SA 3D6CA 2OEOA 5E3FA 5EKKA 4K5XA 3T13A 2EYOA 5IOCA 2F0KA 4QMGA 3V2TA 5I9PA 2PW7A 3HEJA 5C5MA 2F0OA 2NUCA 5C3WA 3NHHA 2F0MA 5JOBA 1SYBA 2KQ3A 4K6DA 5EKLA 1AEXA 4NKLA 3LX0A 2O4XA 1TR5A 4RKLA 2F0WA 3TP5A 5CC4A 4ME5A 5HGTA 1A2TA 4EQPA 5KYIA 3DHQA 3SR1A 5EGTA 5ISRA 2F0QA 1F2MA 5CV6A 1EY8A 3OWFA 1STHA 3P1HA 3QB3A 1A2UA 1STBA 3EJIA 1IHZA 3E5SA 2ENBA 2PZUA 3D8GA 3EVQA 4J6HA 3DMUA 2EYFA 3NXWA 3NQTA 4K2KA 2F0SA 3ERQA 5HURA 2F0PA 4K14A 2SNSA 4HMJA 3TP7A 4F7XA 3VA5A 1EZ6A 4EQNA 2RBMA 1A3TA 5CV4A 3OMCA 2SNMA 3TMEA 1JOOA 2F0VA 5I6WA 3NUCA 3BDLA 5JAVA 3OMGA 4DGZA 5CV9A 4H7BA 2F0GA 4OL7A 2F0TA 3D4WA 3BDCA 3MHBA 2EY5A 3SXHA 5IGDA 1ENAA 1STAA 5C4ZA 5CR3A 5E1FA
chains in the Genus database with same CATH superfamily
3C1EA 1OXUA 2D62A 2KEDA 5C5LA 5HY6A 1PTOB 2EE1A 1W2BA 1XMQL 1JE5A 5J1ZA 3H3VC 5D3DA 2XGTA 2EYPA 1MIUA 4IFDH 3RUZA 1Q46A 1D5MC 2R6GA 3GV3A 3K5MA 3KF8A 5LMUQ 5KNDA 3HOXB 4AQYL 1NTGA 1DM0B 1XPUA 3RR5A 1E22A 5C3EG 1UAPA 1QUQA 4HMIA 1Q86C 3K7UC 1RODA 5JEAH 2EJGC 4V190 3P75A 4EQ5A 1IYJB 3S1NH 3QO2A 1KQSA 2BDNA 3J81j 5M3FH 4O2DA 4P74A 3DWQA 2O2LD 1SNPA 2F4VL 4RKBA 4B3TQ 3B6YA 2B8GA 4JI6L 1ASZA 3FVQA 4OIKA 3H15A 2UXDQ 1K83H 1HUMA 4C3JB 1NMFA 1EU4A 1X65A 2I46A 1YJNA 5FLXc 5GAHC 2PI2E 3KBGA 2G5DA 3J80i 1YVCA 3T16A 4OIJA 4JI4Q 3P20A 1E1OA 3I4OA 5JPMC 5C0XH 1OXTA 2K01A 5C4JB 4RGNA 3FPPA 1B2TA 2JSOA 3AU7A 2F03A 4IUVA 3BZDB 4JYAQ 3M3YB 2R61A 1AZPA 4A3CH 3UE0A 5IOCA 3NWSA 1RDPD 1I6HB 3HOYB 5CMDA 3HEJA 3DEPA 1Q1EA 2D2CC 1XMQQ 2UXBL 1OXVA 3K6OA 1TR5A 3VA7A 4A3LG 4ZYSA 4DV5L 3J81i 3EJIA 2K6AA 3D8GA 3HKZB 4AQYQ 2E2HH 5C4XB 4BY1G 2Z4HA 3G6JB 1LV9A 4ZKBB 1SRUA 2E75C 2GA4B 1HNWL 1EQRA 4IFDI 1SE4A 2FJ2A 3CMAA 1TY0A 2K04A 2ZXRA 2ZJRA 1G51A 1K28A 3CCEA 1TT2A 1M90C 1SEBD 2F4VQ 3HFZB 1SYEA 3R2IA 1QNKA 5KYLA 4N9TA 4EGVA 2XN9C 3MZ5A 4JI6Q 3RN2A 3ICEA 1OTCA 4RGOS 2K4KA 2KCNA 5IT9c 2F52A 1CUKA 3PUXA 3F8TA 4RGMA 1MHWC 1SSOA 1KAAA 3MFGA 3S1MB 1UUPA 4OHJA 1K0SA 3FKIG 4KKTA 3GTJH 4G7OC 2E2IB 2VB2X 1AN8A 3OPOA 3GTGH 5JJKA 4F8MA 4OELB 4P75A 1L1OA 3H0GH 3T1YL 1EY4A 5K36G 4C2MB 4UP7A 3PIOA 1EIYB 2DY7A 1EY9A 1ESRA 2UXBQ 1WCMG 2X6LA 1WTWA 3TBIB 1KRTA 1YZ6A 1C9OA 1O80A 5I2YA 3X3NA 1VQ6A 2HDMA 5IGFA 3S9WA 3S24A 4DV5Q 4XXEA 2JQOA 4A4IA 1MJEA 5KIXA 4K2LA 1CA6A 5FKAC 3UDGA 5HGQA 1HNWQ 1CQVA 1ET6A 3GTLB 1JJGA 4ZUIA 5IYBG 4AH6A 3J80c 1XPOA 4C3IH 1J9OA 1E2ZA 1VQGA 3LWUA 1PTOF 4FF1A 1X3PA 1PFMA 2O5JC 4PQXA 4FDBA 1XX8A 2JA6H 1JC7A 1A2UA 3P7JA 3NQTA 1AZQA 1YJWA 5JJZA 1Q8IA 4JCVE 3A8KE 1Y14B 2R3ZA 5G3LD 3J81c 4A3DB 3S2HH 4H7BA 1A15A 2JEAI 2HIVA 2VXWA 2N88A 5CR3A 3PCOB 4YWLA 2QEXA 2XSCA 2EYJA 3KOJA 3UDFA 1EYDA 3I4LA 1OXXK 3JAME 3T1YQ 2VUMH 4AYBB 4LMQD 4U673 3FRPB 3W1BA 4B08A 1B50A 3DEOA 4HSVA 1AP0A 1JOQA 5LL6X 4OWWB 4C1NI 1X3QA 2CW0C 2Z8LA 1D1IA 3NP8A 1N33L 1TS2A 4MTNA 2WB1E 3I4MH 4GOPB 3VYSA 2AQ3B 3QWNA 1C4QA 2MQHA 2MO0A 1HJPA 5CBAE 4DAVA 1IBKL 1QCBD 1YNNC 3PO3G 1U4LA 1H9RA 3G4SA 5D3IB 4A3EH 1VQNA 2NVYB 1L0XB 3A5ZB 1HTLD 4KV6A 1S5DD 4A3MH 4G57A 5AJ3L 1LLRD 3MEFA 2K03A 1XPRA 1FGUA 2V1CC 4CJ1B 1Q12A 4P73A 1PA6A 4IOAA 5M3MH 1EYCA 4TVAB 2HHHL 3SEBA 2A68C 3WOFA 1JE4A 4RMFA 2Q8RE 2D0PA 3EA6A 1TY2A 1D8LA 3QIAA 1SMXA 3PO2H 2B2UA 2EYHA 3J7A5 1G2TA 4KY6A 4R4QA 3D6WA 3TS0A 1Y1VB 4GS3A 2RF4A 3FHWA 4KJNA 5CV5A 4DV4L 1NAPA 2QCPX 1HZCA 5T1IA 5C5MA 2CH4W 5ELNA 4K6DA 3S1NB 1GUWA 3H09A 4TKOB 5BN4A 3DHQA 4OXPA 3PIPA 4OX9L 4A3JH 3CU7A 2KOLA 4FXGC 2KCMA 4Y7NH 1JCKB 4LFAL 1N33Q 4A93G 1FNWA 3ND8A 1WTRA 1CK1A 4HIKA 3TP7A 4F7XA 1IBLL 1RHPA 1PRTB 1DJRD 1LTBD 2RBMA 3K8AA 1PV4A 2K7VA 2KEEA 1K83B 4JI7L 4JW0A 1CM9A 3NUCA 3J80E 1IBKQ 3AEVA 1O7ZA 1WJJA 2NN6G 3T53B 2L11A 3SGIA 4DK1A 4X3SA 1S5FD 2OF1A 1QNUA 1AE2A 4LAAA 4BWGB 5AJ3Q 1VF7A 2ZTCA 1JICA 3TREA 2Q2TA 2HHHQ 1Q7YC 4A3BG 1FR3A 1U4RA 3HP3A 1TS5A 1Z6HA 2DNEA 1EQQA 2ID0A 4PMWA 3A7AB 2N3SA 1EY5A 4PNYA 4OO1G 4LF5L 2L9HA 1UNSA 2I0QA 4DR6L 4FF3A 4N9PA 2E2HB 4BS9A 4APVA 1ILPA 5JVG3 4LUOA 4BA2I 4DV4Q 2KJXA 1VQPA 2OTJA 4IUQA 4NP5A 4DN4M 1PDQA 3E9HA 2UUBL 3HGBA 2LFNA 1L0WA 1FD7D 1I94L 1E7ZA 1ML0D 4N8FA 1JR0D 1HZ9A 2H1EA 4OX9Q 1WTHA 3M7GA 5M3FG 2IT1A 2PZTA 3EROA 1SNQA 5I6YA 1STYA 1A0IA 4LFAQ 2XTIA 3RLOA 5EBDA 1IYVA 3F2BA 1D5XC 3CAMA 1YEZA 5LL6S 1VMCA 3AYHB 4NXNL 1IBLQ 3S15H 2A6HC 5GROA 4HJ5A 2AKWB 2K5VA 2IX3A 3MXNB 4UDUC 3K81C 3CF5A 2J0TD 3W3AA 4JI7Q 2A69D 5EBCA 5C4HA 1BCPC 3H3VH 1QVCA 3W2DA 3GTJB 1NUCA 1N9WA 2F0KA 1YHBA 5IP9G 1S40A 5IE8A 3K0YA 2F0OA 2Z9HA 3GTGB 4GN4B 1AEXA 3FEWX 1RD9D 3H0GB 3HOZH 2BE5D 1PTOD 4QB4A 3PV0A 4K6LA 4KK7A 3NENA 1VQFA 4K2KA 4A76A 3KF6B 2J7ZA 5I6WA 1B9NA 5C44G 4UPAA 2JA5G 4LF5Q 1B7YB 3ULPA 4DGZA 4DR6Q 3NTKA 3CRKC 2F0GA 1ILQA 3CKIB 4LK1C 1NJIC 2R7ZH 1IYUA 3GTMH 5A2QL 3KJOA 2RVLA 3C3LA 3Q23A 1NNXA 4QCLA 1SYFA 4JG2A 2PQEA 2UUBQ 2GVBA 4QL5A 5DM73 5FJ8G 3BVZA 1I94Q 1UEAB 5DEHA 5ELEA 4C3IB 3KF8B 3R3OA 3NWTA 2B2VC 1QILA 1Y1WH 1Z47A 4DUZL 1QUQB 5JPNC 5CV7A 4RWSC 4NXNQ 5EQ0A 3BVMA 2JA6B 4GLXA 1OO9B 1Z7TA 2PW5A 3SK6A 1C48A 2B2TC 4L8JA 1ENFA 2NVQH 2F3WA 1TS3A 1Y8OB 4KHPL 4QQBX 3X3MA 1D6EC 2GVAA 3S2HB 5GAEC 3KUPA 2WB1B 4G7HC 2EY2A 2NZ1D 1B1ZA 2B39A 2OCEA 2IHFA 5FOBB 1GVPA 4HJ9A 3H3VI 2AUKA 4N8X1 2KVMA 1LTAD 5IYCH 2VUMB 2NBFA 2DNCA 3H0GG 2ICEC 2MHVA 4BBSG 2Z6BA 3V05A 2XRQD 5KEEA 1YBYA 5FO9B 1PRTF 1MBYA 4DAMA 3I4MB 4YIJA 3I4NH 3OIPA 3I70A 2DN8A 5E3FA 3KYHC 4IPCA 4A3EB 2ZXOA 1A2TA 4ZKCB 5LHY1 2FHTA 2F4IA 1Z9FA 4A3MB 4UHVA 1SMYC 2RSOA 2RA4A 3EQLC 5IYDG 4DUZQ 2WKDA 1GUOA 5M3MB 1KLUD 1WTXA 2VZAA 2XVSA 2SNMA 4GN3B 2HT1A 3BDLA 5JAVA 4FP5D 2JA6G 1YHAA 1T9HA 2MUYA 2EY5A 3PO2B 5IGDA 2X69A 2K52A 3STBC 3GTPH 4KHPQ 1Q90A 4LFCL 4GNXB 2VL6A 4L6TB 1Q82C 1EY6A 1II3A 5NUCA 1HA6A 4DV0L 2PYKA 3MXGA 2ZJQA 1F9RA 1FNUA 3MXUA 1V1PB 4R4IA 4O1NA 1YIJA 1UE1A 3MWYW 5DAUA 3CQZH 5LMNW 4A3JB 1CKOA 1CFMA 1I4XA 4A3IG 1EFID 4QIWE 2JA8H 1U5KA 4Y7NB 4B3ML 4HJ7A 1EUJA 2K33A 1L1OB 2L5TA 1X3GA 1EQVA 1X32A 4DKAC 3WDNA 4F87A 3SK8A 2K50A 1L0YB 3DWAA 4PG3A 3HOUG 3T1HL 2R93H 3JC66 4JPBW 3I91A 3RLFA 3OIQA 4IPDA 2JE6I 1KAWA 4ME3A 3IKJA 1Y1VH 2IHEA 4O0AA 5BN5A 4KHVA 4HR7B 4J8QA 3ZJYC 2CQOA 1HHVA 4R8IA 1RL2A 2ZTDA 2ASBA 3S1QH 5CV8A 4KN7C 3W5OA 1DONA 1HFGA 5IGBA 3MEHA 3VYTA 3NE5B 4ZQ3A 2ZM6L 5I2XA 3RN5A 2Y0SE 4TQUS 1I5FA 3PO2G 3T13A 3PGZA 4LFCQ 2XIWA 1NR2A 1Q81C 1SE8A 3NHHA 5JOBA 2P5ZX 3DWPA 4RKLA 3R93A 1CKNA 1UEBA 4DAYA 2CQAA 4DV0Q 5EGTA 2R92G 4XQQA 3HOVG 2G9DA 4DNIA 4X64L 2QA4A 3CRLC 3FPUB 1T5XD 2JYOA 5GAGC 4HMJA 3VA5A 4JYAL 3DM1A 4B3MQ 4A3JG 1AW7A 1VDZA 1P16A 1GHJA 4RGTA 3AQQA 4JI2L 3S15B 1QZHA 3PIO3 1E2WA 2C5CA 3K58A 5E4WC 3BZCA 1A6XA 2VQFL 2A73B 3T1HQ 2EYLA 2NYZD 5M5YH 1WFQA 1Y69U 2PMZE 3D0FA 2Z4IA 4QJFA 3W1GA 4DV3L 3HOXG 1VQ7A 3LWEA 1WTVA 4A3FH 2JXMB 2B63H 1TWCH 1Q1BA 3OW2A 3G7LA 1JB3A 1C7YA 2ZXPA 2CFMA 3S14H 4DV1L 4BXXH 3HOZB 1DCZA 2CHBD 3GO5A 4RG1A 3SDZA 4FVMA 3AFQA 2F0FA 2KHJA 5ELCA 2ZM6Q 1G6ZA 2B2TA 4LF4L 2EDGA 1VQ4A 2RDGA 1PH9A 4GNXA 2L12A 4DR2L 3CC2A 2WINB 2AHOB 4X66L 3H94A 2D5DA 3GTOH 1HZBA 4R4OA 4OO1I 2F0DA 3GTMB 2R7ZB 5D14A 2R7DA 1KDBA 3S1RH 5K5PA 1FJGL 1B53A 4C3JG 3CXCA 5CORA 3M4OH 1V1PA 4DV6L 4X64Q 1GUNA 4RHSA 1LTSD 1GUGA 3HS0C 3HRZC 1SNOA 1U9RA 1HPCA 2EOTA 4GKJL 3L3OC 3OYYA 2DJFC 4DFAA 1Y1WB 1EOVA 2N49A 3VR6A 1I3QH 4JI3L 1DD2A 1TIID 4ZUJA 4LF9L 4JI2Q 2B2YC 1KHIA 4LUZA 1QVGA 1FYCA 1PRTD 2GN5A 4UAIA 1E2VA 3RD4A 1Q3LA 3HOYG 2QF7A 1K3RA 2VQFQ 2IW3A 1VQBA 2NVQB 1UWVA 2C35B 2F0MA 5IY0A 1KXLA 3RZDH 3EN2A 3PUWA 4NKLA 2N78A 2F0WA 2IWHA 1O78A 3HKZG 4DV3Q 5C4XG 4XT3B 3QB3A 4DUYL 1JT8A 5TSSA 1VQCA 2IX0A 1IW7C 4DV1Q 1A3TA 4FNFA 1TU2B 2A68D 4H02A 2ZTEA 3EIVA 5CV9A 3KLSA 5ELOA 4LF4Q 4MNOA 2PNHA 3VYUA 4HIOA 5E1FA 2CCZA 1C0AA 1E24A 3CCRA 4DR2Q 5ELFA 3UDXA 5FLXE 4X66Q 3JAML 3HOWH 1TQOA 3Q22A 5FLMH 3I4NB 3OTOL 3KDFB 1G8ZD 1GUSA 5IGGA 1GXDC 3NBHA 1HQMC 2WIIB 3KLWA 2R7ZG 1FJGQ 1GOZA 2KHSA 1EZ8A 2RKSA 5T1GA 2XWJB 3U4VA 1N34L 1KLGD 4DV6Q 3PUZA 4K0KL 4ZCKA 2AQ1B 3BVGA 3NTIA 2QDLA 3KJPA 3QJYA 4QY7A 4GKJQ 2EIFA 4BY7H 4ID6A 2KECA 3HZXA 2HQEA 1XYIA 4JI3Q 1O7LA 4LF9Q 1YNJD 5IP7G 2EQSA 2HUGA 5JJLA 4MZ9A 4X65L 1XJVA 5FO8B 2VB3X 4WRDA 4BBRH 3I8ZA 3VR5A 4A3GH 3T56B 3PIP3 1EQTA 3SK5A 2K1BA 4WORA 3GTPB 1WYDA 1ET9A 1U4PA 4QIWB 1S4ZA 3H6MA 1EY7A 4DUYQ 2K5QA 3CCUA 4RAUC 4KHZA 3Q24A 1AE3A 3C1FA 2A8VA 3E0EA 4J15A 4DA2A 1H9JA 3GTKH 3I73A 4HJ8A 2B3GA 3CQZB 5IT9E 4FO2A 2K28A 1EEID 2OEOA 2JA8B 4LFBL 4QMGA 3ZYYX 4QGUA 3OTOQ 2RCNA 1PVOA 3GP7A 5HGTA 4EQPA 4L5QA 5AFWA 3SR1A 3TEHB 2X6GA 2R93B 1UE5A 5HURA 1N34Q 1STBA 5C3EH 3E0JA 2ENBA 4K0KQ 3Q0AA 4JOIC 2Y0SB 1I4HA 3CPWA 5GQOA 2FMMA 4A3DG 1EZ6A 4R1JA 1BR9A 1VQAA 1KIXA 1LUZA 3A54A 1N8RC 1HXYD 4ABNA 3J80L 4IURA 3BDCA 2YV5A 1DOMA 2EJFC 1ENAA 3KLSX 4JI8L 4X65Q 3S1QB 1FGBD 2KUMA 4AYBG 3MVVA 2Q2UA 4A3KH 5KRUA 2KBNA 5ELBA 2QW7A 1BCPD 3PF5A 5LMNL 1VF5C 1JJCB 2MJ8A 4JV5L 1MSGA 1DXMA 3F2UA 3PMFA 4JC0A 4O42A 4UP9A 1ZYRC 2TSSA 1ICWA 4CKEA 4LF8L 2CWPA 1VQEA 1CSQA 1NR4A 2I07B 4IFDJ 3SVMA 2PMZB 5CBEE 3F1ZA 1W6JA 4JBMA 5M5XH 4LFBQ 1H9SA 1O7IA 2N55A 2PQAA 1JWMD 3A8IE 1VQLA 3KDFA 3OHXC 5JEAJ 4A3LH 2OQ0A 4IPGA 2E74C 1D2BA 3CD6A 3J81E 1H9KA 1LACA 4BY1H 3ND9A 1W6KA 5M5YB 1HTPA 1D7QA 3AB9A 2H4OA 2IPKD 4FXKC 4X6AH 4IFDG 2QEJC 1RIPA 1WTQA 3I7FA 4IUPA 2ALYB 1Y1VG 3S2DH 2B63B 4A3FB 4DR4L 1TWCB 2VNUD 4PV1C 1F9PA 1Y8NB 3S14B 2N8NA 5JEAG 3I2ZA 4JI8Q 3M85A 2PCFB 1JMCA 1X54A 1PYSB 3D6CA 2BDOA 4K5XA 5C0XJ 4XYQA 1LTTD 4DV2L 4QUCA 4DK0A 1SYBA 3I3CA 5COYA 4L5SA 1KNAA 5LMNQ 1V9PA 4QUFA 1DOLA 4HAEA 4POFA 4UY8C 3PUVA 4JV5Q 3J7AF 4IUUA 2L55A 3FKIH 4XT1B 3TSSA 3P1HA 1BF4A 3GTOB 3ERQA 1YI2A 4DV7L 4LF8Q 3S1RB 4XYOA 3OMCA 2WFWA 4DR1L 4ZRZA 3M4OB 4OL7A 5C0XG 3TRZA 3SXHA 5K36H 1WCMH 3E9IA 1U4MA 2Q2HA 1I3QB 3K57A 4A3CG 2A6ED 1RJTA 4DF7A 2AMCB 2F3IA 4WFN3 5J39A 2VY3A 3A56A 4XDXA 1QB5D 3RZDB 3SK4A 4C56C 4FXDA 4H0LC 1KL9A 1E1TA 1SR3A 2YYZA 1BKBA 4FF4A 5IYBH 4DR4Q 4KJOA 1VQMA 4A3FG 4E6IA 1W3SA 2PPBC 4PMCA 3WOEA 4OWXB 3BZKA 4IZ8A 2C9OA 4DV2Q 3CPFA 1X6OA 2WV6D 3DM3A 4I7ZC 4ODGA 4P2CB 4AIMA 1CTMA 2YTXA 3LNNA 4IJLA 3I72A 1BBUA 3J7YW 3STBD 2F1MA 4BA1I 1RTNA 3HOWB 3OSOA 2HIXA 1EY0A 4KKSA 1TWHH 4DK6C 3BYYB 1BUVT 4P72A 4DV7Q 1A3UA 2ATWA 1SE3A 1BCPB 4DR1Q 1N36L 1STGA 2RHSB 3BU2A 1G2SA 4DK3C 3TDQA 3G71A 4G7ZC 4YHHL 5EPLA 2E2JH 1FVIA 1STNA 2L0CA 4BY7B 1LO5D 5EPJA 1CKNB 2RQXA 3K0XA 1PLFA 4RA8A 4DAYB 3NPPA 1XNQL 2K5DA 3KBXA 3RMHA 4ME5A 5KYIA 3V96A 1PHJA 3PSIA 4B3RL 4BBRB 3D31A 3RZOH 3S17H 1G91A 4A3GB 3E5SA 1VQHA 3URYA 1QVFA 1MGSA 2NZHA 3C46A 2F0PA 2KENA 3PO3H 2LY7A 1N32L 2BCOA 1SAPA 1IL8A 1BDOA 2AQ2B 3L0OA 1X9NA 3MAQA 1TWGH 3D3RA 3NELA 4C1NK 1YHQA 1LT3D 4DNTB 4DR7L 4OEMB 5JJIA 4TRDA 5J3BA 1LTID 3VYRA 3GTKB 1HR0L 1H95A 4C3IG 1AFPA 1PTOC 1A8VA 2MPMA 1TS4A 3VR2A 4KY5A 2VW9A 1M4VA 1TVXA 4WJWA 2EYMA 1WOCA 3A0JA 3A55A 2QGQA 2QDBA 3TP8A 1UE6A 2WAQE 4KD4A 4R4TA 4Q0FA 4H44C 4DPGA 1N36Q 1PFSA 3TZDA 5C3EB 1Y8PB 3GV6A 4YHHQ 4KI0A 1GUTA 1K73C 1JORA 1BVSA 2WB1G 1KDCA 1EWIA 1XNQQ 3JAMi 1A3VA 1VQ9A 3S16H 3AFPA 1CQFA 1HNXL 5M5WH 2NB0A 2VUMG 3FDTA 3WWVA 4A93H 2K32A 4A3KB 4B3RQ 2G9HD 1SYDA 4HEDA 1GHKA 4B9WA 2HDLA 2EVBA 2MNAA 2LMCB 2IL8A 3K59A 2JN4A 2NN6H 3NQIA 3KLRA 3I4MG 1N32Q 3TS2A 1QE6A 2OT2A 5I9OA 1IBML 1B44D 2K5WA 4LF6L 5J22A 1YNXA 1WTOA 4A3EG 4DR7Q 4FYDA 3ERSX 3M4PA 1XXGA 5C3WA 3CC4A 1HR0Q 4A3BH 1ONLA 2BH8A 1V1OA 4PZ7A 4A3MG 3UI2A 5M5XB 2H5XA 4MTKA 2OQKA 1EIFA 1F2MA 2AUJD 1EY8A 2E2DC 2JP1A 4J6HA 5M3MG 1CKMA 4DXFA 4OO1H 4B3SL 2L4NA 5DM63 4ZAIA 2SNSA 3NEMA 1JWUD 4OGQC 4BY1B 4NW2A 1A62A 2EZVA 1B3AA 1SJHD 2NWGA 2MO1A 3DUZA 2K05A 1UE7A 1XWEA 3R8BA 4WJ4A 3S2DB 4ALPA 5BR8L 1S5BD 2I5MX 2B2WC 4G4KA 2E8GA 1VQDA 3NBHB 5IODA 1EYGA 3RLNA 1DYQA 1SFOH 1QZGA 1HNXQ 1HCZA 4IN3A 3NK9A 4ZK9B 4IALA 1TXYA 2F0IA 1SJED 3D4DA 1RTOA 3F2DA 5CGKA 4A3KG 4R8NA 2A1AA 3A8JE 1VCIA 1U0LA 1IXRA 1JOKA 1HUNA 2D0OA 3L2PA 3BG3A 1I4QA 3FKIB 1E3PA 1V8QA 2SDFA 4IOCA 1BCPF 1TWAH 1MD2D 2B2UC 1K8AC 1IBMQ 4KN4C 5KGUA 3CMEA 4K5WA 1SE2A 1F2ZA 3FP9A 4CKCA 5IP9H 4LF6Q 1DOKA 1TWFB 1IW7D 1VQOA 3K7AB 2NN6I 2F0NA 1KD1C 1MSHA 1BXTA 4YCVA 2B2VA 4HTHA 5KNBA 1WCMB 2BOSA 3N52A 3ULJA 3N6RA 4HCEA 3UDIA 2F0UA 1XNRQ 1PH8A 3JAMc 4XIGS 2FXQA 4P71A 2D9UA 5C44H 2JA5H 4B3SQ 1PYBA 4L5TA 3CCMA 4V0BA 1VMPA 1IL2A 4YWMA 2LKVA 2IY5B 3CCLA 1BNZA 1SNCA 1NSNS 4NB3A 1ESFA 4XQJA 1PZJD 1MI2A 4S3SA 5EKKA 5FJ8H 3PQIA 1CI3M 4Z9CB 5BR8Q 4C3HH 1SDFA 3TN2A 4CDFC 4CJ0B 2NUCA 3M4YA 2Q8TA 4WJ3M 3TP5A 1F9SA 2O4XA 1SBBB 5ISRA 3CC7A 4IJHA 2PZUA 1LT5D 2CW0D 2I5HA 2PO4A 3DXJC 4L5RC 4K14A 1PH2A 1I4RA 1QOHA 2CWAA 4EQNA 5DNFA 3OMGA 3T51B 1TWHB 3U4ZA 2DGYA 1PZID 3TP6A 1YNND 2KCTA 2Q2IA 1NCVA 3A5UA 2BA0A 1IKMA 1I50H 4J1MA 5FLXL 4RH6A 1K9MC 2E2JB 1PZKD 3Q6SA 2VS1A 1VQ8A 1ICFB 1PFNA 4ZLTF 5C0XI 1G6PA 3ONAB 3CP0A 4BBSH 1GKHA 3BYTB 2CKZB 2JA7H 2Z0SA 2B29A 2RCFA 1K8OA 3HOZG 3CHBD 3M7NA 4GOPC 1LT4D 3RZOB 4K8JA 2F0HA 3S17B 3TZUA 1KC8C 3GQBA 1F2YA 4X3KA 2CVRA 4PZ6A 4RHRA 4Q5VA 1H9SB 3PO3B 2NZOA 2PQAB 3ITPA 1J8IA 1K8MA 3GTQH 4IQZA 1HZAA 2EY1A 3Q8DA 4K8IA 1JWSD 4ULLA 1JB7A 2YTYA 2DUDA 2EY6A 1TWGB 2ZJPA 1CT1D 2IJ0A 2WACA 4HN7A 3QR8A 2UUCL 3HG9A 1E0BA 4RFBA 1KDAA 1BBXC 1B4OA 5IYDH 2WAQB 2TMPA 1NE3A 1HR0W 1SNDA 1VQJA 2NVTH 4LWCA 1WD0A 1BBWA 1LTRD 2VQEL 4CKBA 1Y1WG 1HNZL 5C3XA 3BDOA 2EXDA 4EVOA 1LTGD 2AWNA 3K80C 2ZT9C 1T5EA 2F0JA 1X3FA 3CCSA 1ZYRD 5DLQE 5IT9L 2E5LL 4X3UA 4JK1C 3SE0A 1B9MA 1QJOA 2KQ3A 5CC4A 4PZ8A 1V43A 3D4RA 4ILWA 2LS01 2B8FA 2F0QA 2J4XA 4X62L 3S16B 4DXGA 4A3IH 2EYFA 2M9VA 5IYCG 5M5WB 4EX5A 2QILA 3GD7A 4A93B 3IL8A 2A74C 2F0VA 1WI5A 3PF4A 4JBJA 1PRTC 3MFYA 2NVXH 1PH1A 3R2TA 1FL0A 3HOUH 1H9MA 1STAA 5C4ZA 3IAYA 1R9TH 1R4QB 4NDXA 1KNEA 1VQIA 2SOBA 2XNAC 3I4NG 1JJ2A 4HCSA 2B2WA 3A74A 1SYGA 4CDEC 2UUCQ 1K0RA 4XTCS 2R7FA 1CHPD 4KMUC 1G291 1ASYA 1EU3A 1HA5A 2LXJA 2M2LA 4Y52H 2WAQG 2E76C 1FNVA 3NBIA 4A3BB 2VQEQ 2MGSA 1CA5A 1NBWA 1XTCD 5F2DA 5IGEA 1HNZQ 3AMUA 5A35A 1D1KA 3G6EA 2RHQB 4HIMA 1XTDA 1O7YA 1ZXTA 2A19A 2A6HD 4JBWA 5C6AA 2I5LX 5E7NA 4X3TA 1ZKOA 3U9SA 2XWBB 1WTPA 2FMCA 2E5LQ 3F2CA 2OXPA 5I4DA 4JVZA 2R92H 4M8AA 1IZ6A 4YCWA 3HOVH 1XMOL 2ICIA 1AH9A 4JI0L 1WD1A 4KD3A 1PH4A 3GDEA 3J81L 5CYUA 1SN8A 5BN3A 4X62Q 3DLLA 1B8AA 5M3FB 2OTLA 1SFOB 3K5NA 3HKSA 3UE1A 1ENCA 3RNUA 2JJQA 5ELDA 2PZWA 2YU9H 2RDHA 4DNRB 1GD7A 4KTAA 1M1KC 1YNJC 4MIUA 1GO3E 1LT6D 4NMZA 4QF4A 1PTOH 4HSPA 2QKIC 2BA1A 4LW1A 3U9OA 2JA8G 3I55A 2OWOA 4GZYC 1P8LA 4HIDA 4R9WA 4MHEA 2O5IC 3VDYA 1STEA 5I9PA 1TWAB 2PW7A 4LJZC 1ZEQX 4GLAC 1CZGA 3HOXH 3EFXD 5EPKA 4YY3L 2BH2A 2R93G 4DAPA 3E6ZX 1I4GA 5CV6A 2Y0SG 3OWFA 5EKIA 1F77A 1IHZA 4IUTA 4HJAA 3OWEB 5GADC 2Z6KC 2Q8IB 3TMEA 1JOOA 1YJ9A 2B2YA 2DJGC 3L9AX 4CDDC 4R4CA 2F0TA 2LXKA 5C44B 4FF2A 2JA5B 3DMUA 3K5OA 3FMCA 1EOTA 5E4XA 1PH7A 1F9QA 2SEBD 2MP1A 1YITA 3CCQA 1PH6A 4RCOA 4JI1L 1PXUA 4C3JH 4LNQA 3I56A 2A5HA 2RSNA 3BS1A 1XMOQ 4JI0Q 4U68A 3SHLA 3M4QA 1B3QA 1RCVD 4C3HB 5M9OA 4CDCC 1TWFH 2HCCA 5C4JH 4YWKA 4JI5L 1HFNA 1VS0A 2F0LA 3K7AH 1BQQT 4PMBA 3M3YH 2UU9L 4LF7L 4OONA 3VR4A 3M9BA 4GOPA 3ULLA 2EJMA 1MJCA 3U50C 1C8CA 1I6HH 1LM0A 3HOYH 3IFDA 1CZWA 1PFBA 1DGSA 1K3BC 4KKUA 2WP8J 4KY7A 1LTLA 1S72A 1EWCA 1M8AA 1OXSC 4L63B 1I4PA 1TKWB 2RDFA 1RF2D 2HCIA 5EAYA 2WKCA 1EFWA 3MXPA 2JA9A 4IO9A 5C4XH 2M00A 3T4AC 4YY3Q 1B70B 2F0EA 4H13C 4M1UB 3CW2C 3NSWA 3L7ZC 1I50B 4KLKA 2EXZA 1GM5A 4CHTB 1SMYD 4IPHA 2B63G 1KABA 3H91A 1S3OA 4BBSB 1X56A 2JA7B 4I7AA 2NTSA 3HKZE 4BXXG 1RKNA 4LUVA 1J5EL 2FFKB 1Q8KA 2UXCL 1JQYD 3MC0B 3NTHA 3C2PA 1S5CD 2EYOA 1KTKA 1HH2P 1HQRD 1F2LA 2JK8A 2KHIA 4JI1Q 3OW7A 3GTQB 3S1MH 5L37A 3IFTA 2LSSA 1V1QA 2PI2A 2E2IH 4GLVB 1STHA 4C3HG 2CH4A 4CBVA 4XQNA 4JI5Q 4TSSA 3NXWA 2F0SA 1BOSA 4YCUA 4RCNA 3K5LA 2UU9Q 4GN5A 4DR5L 4LF7Q 2MFIA 5IP7H 1X3EA 2NVTB 4UP8A 4NXML 1D5ZC 4C2MH 3OOCA 2AWOA 1EIHA 1S5ED 1J6QA 5A2QE 4K5VA 4DR3L 1SXTA 2K14A 4NPSA 1K8GA 4DU9A 2L1BA 5IWAL 4A75A 2ES2A 3G48A 4GNXC 5IIFA 2EPBA 1HRJA 4GKKL 2V4DA 3IRBA 1L2FA 4JOIA 4MN3A 2A69C 2YTVA 3A7LA 4I65A 4F88A 1WVLA 4OWTB 3E3XA 3GTLH 2L15A 1A63A 1PH5A 4CJ2C 2UUAL 3EBEA 3TQYA 1EL0A 2HQLA 2F3VA 1NY4A 1IKLA 3KK7A 4A3IB 4IUNA 1X55A 3I90A 3QOLA 3VR3A 1J5EQ 2JA7G 2UXCQ 1XNRL 1L1OC 1QWYA 2A6EC 5FO7B 2BE5C 3O13A 3J7ZC 1LYLA 1QG7A 1SNMA 2NVXB 3BJUA 3HOUB 4EQOA 1R9TB 1PMRA 1VQKA 3HOWG 1I6VC 5FLMG 2IX1A 1EIGA 3QOJA 2JEBI 2XRSD 1SROA 4A3DH 2PNRC 5LMUL 1SYCA 3J7AV 1EYAA 2DY8A 2NTTA 4B9XA 1VQ5A 2KA7A 4DR5Q 1PH3A 1LABA 5IGCA 4NXMQ 3MXNA 4BY7G 1CSPA 5D65A 1DZ1A 2HD3A 4DR3Q 3QG1A 3V2TA 1KRSA 5IWAQ 3CCVA 5EJWA 4B3TL 3MA2B 1PYWD 5EKLA 3LX0A 4BBRG 4GKKQ 4POGA 4A3GG 2K5HA 2KCCA 3PUYA 2UXDL 4AYBE 3ER0A 2FINB 1GJXA 3EVQA 3MTSA 5FK9C 5JVH3 3KFUA 3HOVB 1CHQD 2R92B 1BO0A 3LGJA 5G3LF 5H1SE 2NVYH 1SLJA 2Z6KA 4JI4L 2UUAQ 2Z1CA 5CV4A 1MKHA 3KF6A 1EWHA 3CCJA 3U58A 1NMGA 2K5NA 3D4WA 5KNCA 3MHBA 1EEFD 2K75A 2YU9B 4JBKA 1R4PB 4CGYB
chains in the Genus database with same CATH topology
3C1EA 1OXUA 2D62A 2KEDA 5C5LA 1PTOB 2EE1A 5J1ZA 3H3VC 5D3DA 2EYPA 4IFDH 3RUZA 1D5MC 2R6GA 3GV3A 3K5MA 3KF8A 3HOXB 5KNDA 1DM0B 1UAPA 4HMIA 1RODA 5JEAH 2EJGC 4V190 3P75A 3QO2A 2BDNA 3DWQA 2O2LD 1SNPA 4RKBA 2B8GA 3FVQA 4OIKA 1HUMA 4C3JB 1EU4A 2I46A 3KBGA 3T16A 4OIJA 3P20A 5JPMC 5C0XH 1OXTA 2K01A 5C4JB 4RGNA 3FPPA 1B2TA 2JSOA 3AU7A 2F03A 4IUVA 3BZDB 3M3YB 2R61A 1AZPA 5IOCA 3NWSA 1RDPD 1I6HB 3HOYB 5CMDA 3HEJA 3DEPA 1Q1EA 2D2CC 1OXVA 3K6OA 1TR5A 3VA7A 4ZYSA 3EJIA 2K6AA 3D8GA 3HKZB 5C4XB 2Z4HA 3G6JB 1LV9A 4ZKBB 2E75C 2GA4B 4IFDI 1SE4A 2FJ2A 1TY0A 2K04A 2ZXRA 1TT2A 1SEBD 3R2IA 1SYEA 1QNKA 5KYLA 4N9TA 4EGVA 2XN9C 3MZ5A 4RGOS 2KCNA 3PUXA 4RGMA 1SSOA 1KAAA 3MFGA 3S1MB 1UUPA 4OHJA 4KKTA 4G7OC 2E2IB 2VB2X 1AN8A 3OPOA 4F8MA 1EY4A 5K36G 4C2MB 2DY7A 1EY9A 1ESRA 2X6LA 1WTWA 3TBIB 1O80A 5I2YA 3X3NA 2HDMA 5IGFA 3S9WA 4XXEA 5KIXA 4K2LA 1CA6A 5FKAC 1CQVA 1ET6A 3GTLB 4ZUIA 1J9OA 1E2ZA 3LWUA 1PTOF 4FF1A 1X3PA 1PFMA 2O5JC 4PQXA 1XX8A 1JC7A 1A2UA 3NQTA 3P7JA 1AZQA 5JJZA 1Q8IA 3A8KE 5G3LD 2R3ZA 4A3DB 4H7BA 1A15A 2JEAI 2VXWA 2N88A 5CR3A 2XSCA 2EYJA 1EYDA 3I4LA 1OXXK 3JAME 4AYBB 4LMQD 4U673 3FRPB 1B50A 4B08A 3DEOA 4HSVA 1AP0A 1JOQA 5LL6X 4C1NI 1X3QA 2CW0C 2Z8LA 1D1IA 3NP8A 1TS2A 3VYSA 2AQ3B 3QWNA 1C4QA 5CBAE 4DAVA 1QCBD 1YNNC 1U4LA 1H9RA 5D3IB 2NVYB 1L0XB 1HTLD 4KV6A 1S5DD 4G57A 1LLRD 2K03A 4CJ1B 1Q12A 1EYCA 3SEBA 2A68C 3WOFA 1JE4A 2Q8RE 3EA6A 1TY2A 3QIAA 2B2UA 2EYHA 1G2TA 4KY6A 3D6WA 1Y1VB 4KJNA 5CV5A 1NAPA 2QCPX 5T1IA 5C5MA 4K6DA 3S1NB 1GUWA 3H09A 4TKOB 5BN4A 3DHQA 3CU7A 2KOLA 4FXGC 1JCKB 1FNWA 3ND8A 1WTRA 1CK1A 3TP7A 4F7XA 1RHPA 1PRTB 1DJRD 1LTBD 2RBMA 2K7VA 2KEEA 1K83B 3J80E 1CM9A 3NUCA 1O7ZA 2NN6G 3T53B 2L11A 4DK1A 4X3SA 1S5FD 2OF1A 1QNUA 4LAAA 4BWGB 1VF7A 1JICA 1FR3A 1U4RA 3HP3A 1TS5A 1Z6HA 2DNEA 2ID0A 4PMWA 3A7AB 1EY5A 4PNYA 4OO1G 2L9HA 1UNSA 4FF3A 4N9PA 2E2HB 4BS9A 1ILPA 5JVG3 4BA2I 2KJXA 4IUQA 4NP5A 4DN4M 1PDQA 3HGBA 2LFNA 1FD7D 1ML0D 1JR0D 2H1EA 3M7GA 2IT1A 2PZTA 1SNQA 5I6YA 3EROA 1STYA 5EBDA 1IYVA 1D5XC 5LL6S 1VMCA 2A6HC 2IX3A 4UDUC 2J0TD 3W3AA 2A69D 5EBCA 5C4HA 1BCPC 3W2DA 3GTJB 1NUCA 2F0KA 3K0YA 2F0OA 3GTGB 1AEXA 3FEWX 1RD9D 3H0GB 2BE5D 1PTOD 4QB4A 3PV0A 4K6LA 4KK7A 4K2KA 2J7ZA 5I6WA 1B9NA 4DGZA 3NTKA 3CRKC 2F0GA 1ILQA 3CKIB 4LK1C 1IYUA 5A2QL 2RVLA 3C3LA 3Q23A 4QCLA 1SYFA 2PQEA 5DM73 3BVZA 1UEAB 5DEHA 5ELEA 4C3IB 3R3OA 3NWTA 2B2VC 1QILA 1Z47A 5JPNC 5CV7A 4RWSC 5EQ0A 3BVMA 2JA6B 1OO9B 1Z7TA 2PW5A 3SK6A 1C48A 2B2TC 4L8JA 1ENFA 2F3WA 1TS3A 1Y8OB 3X3MA 1D6EC 3S2HB 3KUPA 2WB1B 4G7HC 2EY2A 2NZ1D 1B1ZA 2B39A 5FOBB 2AUKA 2KVMA 1LTAD 2VUMB 2NBFA 2DNCA 2ICEC 2MHVA 3V05A 2XRQD 5KEEA 5FO9B 1PRTF 1MBYA 3I4MB 4YIJA 3OIPA 3I70A 2DN8A 5E3FA 4A3EB 2ZXOA 1A2TA 4ZKCB 5LHY1 2FHTA 2F4IA 4A3MB 1SMYC 2RSOA 2RA4A 3EQLC 2WKDA 1GUOA 5M3MB 1KLUD 1WTXA 2XVSA 2SNMA 3BDLA 5JAVA 4FP5D 2MUYA 2EY5A 3PO2B 5IGDA 2X69A 1Q90A 4L6TB 1EY6A 1II3A 5NUCA 1HA6A 2PYKA 3MXGA 1F9RA 1FNUA 3MXUA 1V1PB 4O1NA 3MWYW 5DAUA 4A3JB 1CFMA 1I4XA 1EFID 4Y7NB 2K33A 2L5TA 1EQVA 1X32A 3WDNA 4F87A 3SK8A 1L0YB 3DWAA 3I91A 3RLFA 3OIQA 2JE6I 3IKJA 5BN5A 4KHVA 4HR7B 4J8QA 1HHVA 4R8IA 5CV8A 4KN7C 1DONA 1HFGA 5IGBA 3MEHA 3VYTA 3NE5B 4ZQ3A 5I2XA 4TQUS 3T13A 2XIWA 1NR2A 3NHHA 5JOBA 3DWPA 4RKLA 3R93A 4DAYA 2CQAA 5EGTA 4XQQA 2G9DA 3CRLC 3FPUB 1T5XD 2JYOA 4HMJA 3VA5A 3DM1A 1AW7A 1VDZA 1GHJA 4RGTA 3S15B 3PIO3 1E2WA 2C5CA 3K58A 5E4WC 1A6XA 2A73B 2EYLA 2NYZD 1Y69U 2Z4IA 3LWEA 1WTVA 2JXMB 1Q1BA 3G7LA 1JB3A 2ZXPA 3HOZB 1DCZA 2CHBD 3GO5A 3SDZA 4FVMA 2F0FA 5ELCA 1G6ZA 2B2TA 2EDGA 2RDGA 2L12A 2WINB 3H94A 2D5DA 4OO1I 2F0DA 3GTMB 2R7ZB 5D14A 1KDBA 5K5PA 1B53A 4C3JG 5CORA 1V1PA 1GUNA 4RHSA 1LTSD 1GUGA 3HS0C 3HRZC 1SNOA 1U9RA 1HPCA 2EOTA 3L3OC 4DFAA 1Y1WB 3VR6A 1DD2A 1TIID 4ZUJA 2B2YC 1FYCA 1PRTD 4UAIA 1E2VA 3RD4A 1Q3LA 2QF7A 2IW3A 2NVQB 2F0MA 3PUWA 4NKLA 2F0WA 2IWHA 1O78A 4XT3B 3QB3A 5TSSA 2IX0A 1IW7C 1A3TA 4FNFA 1TU2B 2A68D 5CV9A 3KLSA 3VYUA 5E1FA 5ELFA 5FLXE 3JAML 1TQOA 3Q22A 3I4NB 1G8ZD 1GUSA 5IGGA 1GXDC 3NBHA 1HQMC 2WIIB 1GOZA 2KHSA 1EZ8A 2RKSA 5T1GA 2XWJB 1KLGD 3PUZA 2AQ1B 3BVGA 3NTIA 3QJYA 4ID6A 2KECA 3HZXA 2HQEA 1XYIA 1O7LA 1YNJD 2HUGA 5FO8B 2VB3X 4WRDA 3I8ZA 3VR5A 3T56B 3PIP3 1EQTA 3SK5A 2K1BA 4WORA 3GTPB 1ET9A 1U4PA 4QIWB 1S4ZA 3H6MA 1EY7A 2K5QA 4RAUC 4KHZA 3Q24A 3C1FA 4DA2A 1H9JA 3I73A 3CQZB 5IT9E 4FO2A 2K28A 1EEID 2OEOA 2JA8B 4QMGA 3ZYYX 3GP7A 5HGTA 4EQPA 5AFWA 3SR1A 2X6GA 2R93B 5HURA 1STBA 3E0JA 2ENBA 3Q0AA 2Y0SB 1I4HA 2FMMA 1EZ6A 1BR9A 3A54A 1HXYD 4ABNA 3J80L 4IURA 3BDCA 1DOMA 2EJFC 1ENAA 3KLSX 3S1QB 1FGBD 2KUMA 3MVVA 5KRUA 5ELBA 1BCPD 1VF5C 2MJ8A 1MSGA 1DXMA 3F2UA 3PMFA 4O42A 1ZYRC 2TSSA 1ICWA 4CKEA 1NR4A 2I07B 4IFDJ 3SVMA 2PMZB 5CBEE 1W6JA 1H9SA 2N55A 1JWMD 3A8IE 3OHXC 5JEAJ 2E74C 1D2BA 3J81E 1H9KA 1LACA 3ND9A 1W6KA 5M5YB 1HTPA 3AB9A 2H4OA 2IPKD 4FXKC 4IFDG 2QEJC 1WTQA 4IUPA 2B63B 4A3FB 1TWCB 2VNUD 4PV1C 1F9PA 1Y8NB 3S14B 5JEAG 3M85A 2PCFB 3D6CA 2BDOA 4K5XA 5C0XJ 4XYQA 1LTTD 4QUCA 4DK0A 1SYBA 3I3CA 5COYA 1KNAA 4QUFA 1DOLA 4HAEA 3PUVA 3J7AF 4IUUA 2L55A 4XT1B 3TSSA 3P1HA 1BF4A 3GTOB 3ERQA 3S1RB 4XYOA 3OMCA 4ZRZA 3M4OB 4OL7A 5C0XG 3SXHA 5K36H 1U4MA 1I3QB 3K57A 2A6ED 1RJTA 4DF7A 4WFN3 5J39A 3A56A 4XDXA 1QB5D 3RZDB 3SK4A 4C56C 4FXDA 4H0LC 2YYZA 4FF4A 4KJOA 4E6IA 2PPBC 4PMCA 3WOEA 4IZ8A 2C9OA 2WV6D 4I7ZC 4ODGA 4P2CB 1CTMA 3LNNA 3I72A 3J7YW 2F1MA 4BA1I 1RTNA 3HOWB 3OSOA 1EY0A 4KKSA 3BYYB 1BUVT 1A3UA 1SE3A 1BCPB 1STGA 1G2SA 3TDQA 4G7ZC 5EPLA 1STNA 2L0CA 4BY7B 1LO5D 5EPJA 2RQXA 1PLFA 4RA8A 3NPPA 2K5DA 3KBXA 3RMHA 4ME5A 5KYIA 3V96A 4BBRB 3D31A 1G91A 4A3GB 3E5SA 3URYA 1MGSA 3C46A 2F0PA 2LY7A 2BCOA 1SAPA 1IL8A 1BDOA 2AQ2B 3MAQA 3D3RA 4C1NK 1LT3D 4DNTB 4TRDA 3VYRA 1LTID 3GTKB 4C3IG 1AFPA 1PTOC 2MPMA 1TS4A 3VR2A 4KY5A 1M4VA 1TVXA 4WJWA 2EYMA 3A55A 2QDBA 3TP8A 4KD4A 4Q0FA 4H44C 3TZDA 5C3EB 1Y8PB 3GV6A 4KI0A 1GUTA 1JORA 1KDCA 1A3VA 1CQFA 2NB0A 3FDTA 2K32A 4A3KB 2G9HD 1SYDA 4HEDA 1GHKA 4B9WA 2HDLA 2EVBA 2LMCB 2IL8A 3K59A 2NN6H 3NQIA 3KLRA 1QE6A 2OT2A 5I9OA 1B44D 2K5WA 5J22A 1WTOA 4FYDA 1XXGA 5C3WA 1ONLA 1V1OA 3UI2A 5M5XB 1F2MA 2AUJD 1EY8A 2E2DC 2JP1A 4J6HA 4DXFA 4OO1H 2L4NA 5DM63 4ZAIA 2SNSA 4OGQC 1JWUD 4BY1B 4NW2A 2EZVA 1B3AA 1SJHD 2NWGA 3DUZA 2K05A 1XWEA 3R8BA 3S2DB 1S5BD 2B2WC 4G4KA 5IODA 1DYQA 1HCZA 4IN3A 3NK9A 4ZK9B 4IALA 2F0IA 1SJED 3D4DA 1RTOA 5CGKA 4R8NA 3A8JE 1VCIA 1JOKA 1HUNA 3BG3A 1I4QA 3FKIB 1V8QA 2SDFA 1BCPF 1MD2D 2B2UC 4KN4C 5KGUA 4K5WA 1SE2A 1F2ZA 4CKCA 1DOKA 1TWFB 1IW7D 3K7AB 2NN6I 2F0NA 1MSHA 1BXTA 2B2VA 4HTHA 5KNBA 1WCMB 2BOSA 3N52A 3N6RA 4HCEA 2F0UA 4XIGS 2D9UA 4V0BA 1VMPA 2LKVA 1BNZA 1SNCA 1NSNS 1ESFA 4XQJA 1PZJD 1MI2A 4S3SA 5EKKA 1CI3M 4Z9CB 1SDFA 3TN2A 4CJ0B 2NUCA 3M4YA 2Q8TA 3TP5A 1F9SA 2O4XA 1SBBB 5ISRA 2PZUA 1LT5D 2CW0D 2PO4A 3DXJC 4K14A 1I4RA 1QOHA 4EQNA 5DNFA 3OMGA 3T51B 1TWHB 1PZID 3TP6A 1YNND 1NCVA 2BA0A 1IKMA 4J1MA 5FLXL 4RH6A 2E2JB 1PZKD 3Q6SA 1PFNA 4ZLTF 5C0XI 3ONAB 3BYTB 1K8OA 3CHBD 3M7NA 1LT4D 3RZOB 4K8JA 2F0HA 3S17B 3TZUA 3GQBA 1F2YA 4X3KA 2CVRA 4RHRA 4Q5VA 1H9SB 3PO3B 3ITPA 1J8IA 1K8MA 4IQZA 2EY1A 4K8IA 1JWSD 4ULLA 2EY6A 1TWGB 1CT1D 2IJ0A 2WACA 4HN7A 3HG9A 1E0BA 4RFBA 1KDAA 1BBXC 1B4OA 2WAQB 2TMPA 1SNDA 1WD0A 1LTRD 4CKBA 5C3XA 3BDOA 4EVOA 1LTGD 2AWNA 2ZT9C 1T5EA 2F0JA 1ZYRD 5IT9L 4X3UA 4JK1C 3SE0A 1B9MA 1QJOA 2KQ3A 5CC4A 1V43A 3D4RA 4ILWA 2LS01 2B8FA 2F0QA 2J4XA 3S16B 4DXGA 2EYFA 2M9VA 5M5WB 2QILA 3GD7A 4A93B 3IL8A 2A74C 2F0VA 1PRTC 3MFYA 3R2TA 1H9MA 1STAA 5C4ZA 3IAYA 1R4QB 4NDXA 1KNEA 2SOBA 2XNAC 4HCSA 2B2WA 1SYGA 4XTCS 1CHPD 4KMUC 1G291 1EU3A 1HA5A 2M2LA 2E76C 1FNVA 3NBIA 4A3BB 2MGSA 1CA5A 1XTCD 5F2DA 5IGEA 3AMUA 5A35A 1D1KA 1O7YA 1ZXTA 2A6HD 4JBWA 5C6AA 4X3TA 1ZKOA 3U9SA 2XWBB 1WTPA 2FMCA 2OXPA 5I4DA 4M8AA 2ICIA 1WD1A 4KD3A 3J81L 5CYUA 5BN3A 5M3FB 1SFOB 3K5NA 1ENCA 5ELDA 2PZWA 2RDHA 4DNRB 4KTAA 1YNJC 4MIUA 1LT6D 4NMZA 4QF4A 1PTOH 4HSPA 2QKIC 2BA1A 3U9OA 4GZYC 4R9WA 4MHEA 2O5IC 1STEA 5I9PA 1TWAB 2PW7A 4LJZC 1ZEQX 1CZGA 3EFXD 5EPKA 4DAPA 3E6ZX 1I4GA 5CV6A 3OWFA 5EKIA 1F77A 1IHZA 4IUTA 3OWEB 2Q8IB 3TMEA 1JOOA 2B2YA 3L9AX 2F0TA 5C44B 4FF2A 2JA5B 3DMUA 3K5OA 3FMCA 1EOTA 5E4XA 1F9QA 2SEBD 2MP1A 4RCOA 1PXUA 2A5HA 2RSNA 3BS1A 4U68A 3SHLA 1RCVD 4C3HB 5M9OA 2HCCA 1HFNA 2F0LA 1BQQT 4PMBA 3VR4A 2EJMA 1C8CA 1CZWA 3IFDA 1PFBA 4KKUA 2WP8J 4KY7A 1EWCA 1M8AA 1OXSC 4L63B 1I4PA 1TKWB 2RDFA 1RF2D 2HCIA 2WKCA 3MXPA 2M00A 3T4AC 2F0EA 4H13C 4M1UB 3NSWA 3L7ZC 1I50B 2EXZA 4CHTB 1SMYD 1KABA 3H91A 4BBSB 2JA7B 2NTSA 1RKNA 2FFKB 1JQYD 3MC0B 3NTHA 3C2PA 1S5CD 2EYOA 1KTKA 1HQRD 1F2LA 3OW7A 3GTQB 3IFTA 1STHA 4C3HG 4CBVA 4XQNA 4TSSA 3NXWA 2F0SA 1BOSA 3K5LA 4RCNA 2NVTB 1D5ZC 3OOCA 2AWOA 1EIHA 1S5ED 5A2QE 4K5VA 1SXTA 4DU9A 2L1BA 5IIFA 2EPBA 1HRJA 2V4DA 4MN3A 2A69C 3A7LA 4I65A 4F88A 1WVLA 4CJ2C 1EL0A 2F3VA 1IKLA 3KK7A 4A3IB 4IUNA 3I90A 3QOLA 3VR3A 1QWYA 2A6EC 5FO7B 2BE5C 3O13A 1QG7A 1SNMA 2NVXB 3HOUB 4EQOA 1R9TB 1PMRA 1I6VC 2IX1A 1EIGA 3QOJA 2JEBI 2XRSD 2PNRC 1SYCA 3J7AV 1EYAA 2DY8A 2NTTA 4B9XA 2KA7A 1LABA 5IGCA 3MXNA 5D65A 1DZ1A 3QG1A 3V2TA 5EJWA 3MA2B 1PYWD 5EKLA 3LX0A 3PUYA 2KCCA 2FINB 1GJXA 3EVQA 3MTSA 5FK9C 5JVH3 3HOVB 2R92B 1CHQD 1BO0A 5G3LF 2Z1CA 5CV4A 1EWHA 3D4WA 5KNCA 3MHBA 1EEFD 2YU9B 1R4PB 4CGYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYJ A;  4K5V A;  4NDX A;  2OF1 A;  3C1E A;  3MVV A;  1TT2 A;  2SOB A;  1EYD A;  5C5L A;  4DU9 A;  5KRU A;  4LAA A;  1SYF A;  1SYE A;  2EYL A;  4TRD A;  1TQO A;  2PQE A;  4J1M A;  5IIF A;  4N9T A;  5IOD A;  5KYL A;  1EY6 A;  4DF7 A;  1JOQ A;  3MZ5 A;  5J1Z A;  1SYG A;  1II3 A;  5DEH A;  5NUC A;  3SHL A;  5IGG A;  4KY5 A;  3NK9 A;  2PYK A;  2EYP A;  3R3O A;  4IAL A;  2KHS A;  5J39 A;  1EZ8 A;  2F0I A;  2RKS A;  3PMF A;  3D4D A;  3RUZ A;  5M9O A;  5CGK A;  2EYM A;  3NP8 A;  4R8N A;  4I65 A;  3SK4 A;  1KAA A;  2F0L A;  2QDB A;  5CV7 A;  5DAU A;  1JOK A;  5F2D A;  4PMB A;  3TP8 A;  5IGE A;  1EY5 A;  4HMI A;  4K8J A;  2F0H A;  4KD4 A;  4PNY A;  2F3V A;  4ID6 A;  3SK6 A;  2PW5 A;  3HZX A;  4QB4 A;  2F0F A;  2HQE A;  1F2Y A;  4KJO A;  4IUN A;  3QOL A;  5KGU A;  3P75 A;  4N9P A;  2F3W A;  4K5W A;  1F2Z A;  4E6I A;  5C6A A;  4F8M A;  3ITP A;  1EQV A;  4PMC A;  4KY7 A;  3SK8 A;  3TP6 A;  1JOR A;  2EY1 A;  4IZ8 A;  4WRD A;  1SNP A;  4KV6 A;  4NP5 A;  1EY4 A;  1KDC A;  1SNM A;  2F0N A;  2OXP A;  4G57 A;  2RDF A;  4K8I A;  4RKB A;  1EY9 A;  1A3V A;  2EY6 A;  2EY2 A;  4ODG A;  4EQO A;  2F0D A;  3MXP A;  3SK5 A;  2WAC A;  4WOR A;  4HTH A;  2M00 A;  1KDB A;  1EYC A;  1KDA A;  4KD3 A;  5K5P A;  2F0E A;  2PZT A;  1SNQ A;  1SYD A;  3ERO A;  3H6M A;  1STY A;  1SND A;  3QOJ A;  4KHV A;  4B9W A;  5I6Y A;  2F0U A;  5IGF A;  3OSO A;  1EY7 A;  3S9W A;  2EXZ A;  1EY0 A;  1SYC A;  1EYA A;  1ENC A;  5KIX A;  1A3U A;  2PZW A;  3C1F A;  4K2L A;  2EYH A;  3T16 A;  1KAB A;  5CV8 A;  4KY6 A;  4B9X A;  1SNO A;  1U9R A;  5C3X A;  5KEE A;  4KTA A;  2LKV A;  4MIU A;  1STG A;  4DFA A;  3MEH A;  5IGB A;  4NMZ A;  4ZQ3 A;  4EVO A;  5IGC A;  4QF4 A;  5C4H A;  5I9O A;  1RKN A;  1SNC A;  4YIJ A;  4ZUI A;  1NSN S;  4ZUJ A;  4KJN A;  2F0J A;  3U9O A;  5CV5 A;  1NUC A;  5J22 A;  1STN A;  4S3S A;  3D6C A;  2OEO A;  5E3F A;  5EKK A;  4K5X A;  3T13 A;  2EYO A;  5IOC A;  2F0K A;  4QMG A;  3V2T A;  5I9P A;  2PW7 A;  3HEJ A;  5C5M A;  2F0O A;  2NUC A;  5C3W A;  3NHH A;  2F0M A;  5JOB A;  1SYB A;  2KQ3 A;  4K6D A;  5EKL A;  1AEX A;  4NKL A;  3LX0 A;  2O4X A;  1TR5 A;  4RKL A;  2F0W A;  3TP5 A;  5CC4 A;  4ME5 A;  5HGT A;  1A2T A;  4EQP A;  5KYI A;  3DHQ A;  3SR1 A;  5EGT A;  5ISR A;  2F0Q A;  1F2M A;  5CV6 A;  1EY8 A;  3OWF A;  1STH A;  3P1H A;  3QB3 A;  1A2U A;  1STB A;  3EJI A;  1IHZ A;  3E5S A;  2ENB A;  2PZU A;  3D8G A;  3EVQ A;  4J6H A;  3DMU A;  2EYF A;  3NXW A;  3NQT A;  4K2K A;  2F0S A;  3ERQ A;  5HUR A;  2F0P A;  4K14 A;  2SNS A;  4HMJ A;  3TP7 A;  4F7X A;  3VA5 A;  1EZ6 A;  4EQN A;  2RBM A;  1A3T A;  5CV4 A;  3OMC A;  2SNM A;  3TME A;  1JOO A;  2F0V A;  5I6W A;  3NUC A;  3BDL A;  5JAV A;  3OMG A;  4DGZ A;  5CV9 A;  4H7B A;  2F0G A;  4OL7 A;  2F0T A;  3D4W A;  3BDC A;  3MHB A;  2EY5 A;  3SXH A;  5IGD A;  1ENA A;  1STA A;  5C4Z A;  5CR3 A;  5E1F A; 
#chains in the Genus database with same CATH topology
 3C1E A;  1OXU A;  2D62 A;  2KED A;  5C5L A;  5HY6 A;  1PTO B;  2EE1 A;  1W2B A;  1XMQ L;  1JE5 A;  5J1Z A;  3H3V C;  5D3D A;  2XGT A;  2EYP A;  1MIU A;  4IFD H;  3RUZ A;  1Q46 A;  1D5M C;  2R6G A;  3GV3 A;  3K5M A;  3KF8 A;  5LMU Q;  5KND A;  3HOX B;  4AQY L;  1NTG A;  1DM0 B;  1XPU A;  3RR5 A;  1E22 A;  5C3E G;  1UAP A;  1QUQ A;  4HMI A;  1Q86 C;  3K7U C;  1ROD A;  5JEA H;  2EJG C;  4V19 0;  3P75 A;  4EQ5 A;  1IYJ B;  3S1N H;  3QO2 A;  1KQS A;  2BDN A;  3J81 j;  5M3F H;  4O2D A;  4P74 A;  3DWQ A;  2O2L D;  1SNP A;  2F4V L;  4RKB A;  4B3T Q;  3B6Y A;  2B8G A;  4JI6 L;  1ASZ A;  3FVQ A;  4OIK A;  3H15 A;  2UXD Q;  1K83 H;  1HUM A;  4C3J B;  1NMF A;  1EU4 A;  1X65 A;  2I46 A;  1YJN A;  5FLX c;  5GAH C;  2PI2 E;  3KBG A;  2G5D A;  3J80 i;  1YVC A;  3T16 A;  4OIJ A;  4JI4 Q;  3P20 A;  1E1O A;  3I4O A;  5JPM C;  5C0X H;  1OXT A;  2K01 A;  5C4J B;  4RGN A;  3FPP A;  1B2T A;  2JSO A;  3AU7 A;  2F03 A;  4IUV A;  3BZD B;  4JYA Q;  3M3Y B;  2R61 A;  1AZP A;  4A3C H;  3UE0 A;  5IOC A;  3NWS A;  1RDP D;  1I6H B;  3HOY B;  5CMD A;  3HEJ A;  3DEP A;  1Q1E A;  2D2C C;  1XMQ Q;  2UXB L;  1OXV A;  3K6O A;  1TR5 A;  3VA7 A;  4A3L G;  4ZYS A;  4DV5 L;  3J81 i;  3EJI A;  2K6A A;  3D8G A;  3HKZ B;  4AQY Q;  2E2H H;  5C4X B;  4BY1 G;  2Z4H A;  3G6J B;  1LV9 A;  4ZKB B;  1SRU A;  2E75 C;  2GA4 B;  1HNW L;  1EQR A;  4IFD I;  1SE4 A;  2FJ2 A;  3CMA A;  1TY0 A;  2K04 A;  2ZXR A;  2ZJR A;  1G51 A;  1K28 A;  3CCE A;  1TT2 A;  1M90 C;  1SEB D;  2F4V Q;  3HFZ B;  1SYE A;  3R2I A;  1QNK A;  5KYL A;  4N9T A;  4EGV A;  2XN9 C;  3MZ5 A;  4JI6 Q;  3RN2 A;  3ICE A;  1OTC A;  4RGO S;  2K4K A;  2KCN A;  5IT9 c;  2F52 A;  1CUK A;  3PUX A;  3F8T A;  4RGM A;  1MHW C;  1SSO A;  1KAA A;  3MFG A;  3S1M B;  1UUP A;  4OHJ A;  1K0S A;  3FKI G;  4KKT A;  3GTJ H;  4G7O C;  2E2I B;  2VB2 X;  1AN8 A;  3OPO A;  3GTG H;  5JJK A;  4F8M A;  4OEL B;  4P75 A;  1L1O A;  3H0G H;  3T1Y L;  1EY4 A;  5K36 G;  4C2M B;  4UP7 A;  3PIO A;  1EIY B;  2DY7 A;  1EY9 A;  1ESR A;  2UXB Q;  1WCM G;  2X6L A;  1WTW A;  3TBI B;  1KRT A;  1YZ6 A;  1C9O A;  1O80 A;  5I2Y A;  3X3N A;  1VQ6 A;  2HDM A;  5IGF A;  3S9W A;  3S24 A;  4DV5 Q;  4XXE A;  2JQO A;  4A4I A;  1MJE A;  5KIX A;  4K2L A;  1CA6 A;  5FKA C;  3UDG A;  5HGQ A;  1HNW Q;  1CQV A;  1ET6 A;  3GTL B;  1JJG A;  4ZUI A;  5IYB G;  4AH6 A;  3J80 c;  1XPO A;  4C3I H;  1J9O A;  1E2Z A;  1VQG A;  3LWU A;  1PTO F;  4FF1 A;  1X3P A;  1PFM A;  2O5J C;  4PQX A;  4FDB A;  1XX8 A;  2JA6 H;  1JC7 A;  1A2U A;  3P7J A;  3NQT A;  1AZQ A;  1YJW A;  5JJZ A;  1Q8I A;  4JCV E;  3A8K E;  1Y14 B;  2R3Z A;  5G3L D;  3J81 c;  4A3D B;  3S2H H;  4H7B A;  1A15 A;  2JEA I;  2HIV A;  2VXW A;  2N88 A;  5CR3 A;  3PCO B;  4YWL A;  2QEX A;  2XSC A;  2EYJ A;  3KOJ A;  3UDF A;  1EYD A;  3I4L A;  1OXX K;  3JAM E;  3T1Y Q;  2VUM H;  4AYB B;  4LMQ D;  4U67 3;  3FRP B;  3W1B A;  4B08 A;  1B50 A;  3DEO A;  4HSV A;  1AP0 A;  1JOQ A;  5LL6 X;  4OWW B;  4C1N I;  1X3Q A;  2CW0 C;  2Z8L A;  1D1I A;  3NP8 A;  1N33 L;  1TS2 A;  4MTN A;  2WB1 E;  3I4M H;  4GOP B;  3VYS A;  2AQ3 B;  3QWN A;  1C4Q A;  2MQH A;  2MO0 A;  1HJP A;  5CBA E;  4DAV A;  1IBK L;  1QCB D;  1YNN C;  3PO3 G;  1U4L A;  1H9R A;  3G4S A;  5D3I B;  4A3E H;  1VQN A;  2NVY B;  1L0X B;  3A5Z B;  1HTL D;  4KV6 A;  1S5D D;  4A3M H;  4G57 A;  5AJ3 L;  1LLR D;  3MEF A;  2K03 A;  1XPR A;  1FGU A;  2V1C C;  4CJ1 B;  1Q12 A;  4P73 A;  1PA6 A;  4IOA A;  5M3M H;  1EYC A;  4TVA B;  2HHH L;  3SEB A;  2A68 C;  3WOF A;  1JE4 A;  4RMF A;  2Q8R E;  2D0P A;  3EA6 A;  1TY2 A;  1D8L A;  3QIA A;  1SMX A;  3PO2 H;  2B2U A;  2EYH A;  3J7A 5;  1G2T A;  4KY6 A;  4R4Q A;  3D6W A;  3TS0 A;  1Y1V B;  4GS3 A;  2RF4 A;  3FHW A;  4KJN A;  5CV5 A;  4DV4 L;  1NAP A;  2QCP X;  1HZC A;  5T1I A;  5C5M A;  2CH4 W;  5ELN A;  4K6D A;  3S1N B;  1GUW A;  3H09 A;  4TKO B;  5BN4 A;  3DHQ A;  4OXP A;  3PIP A;  4OX9 L;  4A3J H;  3CU7 A;  2KOL A;  4FXG C;  2KCM A;  4Y7N H;  1JCK B;  4LFA L;  1N33 Q;  4A93 G;  1FNW A;  3ND8 A;  1WTR A;  1CK1 A;  4HIK A;  3TP7 A;  4F7X A;  1IBL L;  1RHP A;  1PRT B;  1DJR D;  1LTB D;  2RBM A;  3K8A A;  1PV4 A;  2K7V A;  2KEE A;  1K83 B;  4JI7 L;  4JW0 A;  1CM9 A;  3NUC A;  3J80 E;  1IBK Q;  3AEV A;  1O7Z A;  1WJJ A;  2NN6 G;  3T53 B;  2L11 A;  3SGI A;  4DK1 A;  4X3S A;  1S5F D;  2OF1 A;  1QNU A;  1AE2 A;  4LAA A;  4BWG B;  5AJ3 Q;  1VF7 A;  2ZTC A;  1JIC A;  3TRE A;  2Q2T A;  2HHH Q;  1Q7Y C;  4A3B G;  1FR3 A;  1U4R A;  3HP3 A;  1TS5 A;  1Z6H A;  2DNE A;  1EQQ A;  2ID0 A;  4PMW A;  3A7A B;  2N3S A;  1EY5 A;  4PNY A;  4OO1 G;  4LF5 L;  2L9H A;  1UNS A;  2I0Q A;  4DR6 L;  4FF3 A;  4N9P A;  2E2H B;  4BS9 A;  4APV A;  1ILP A;  5JVG 3;  4LUO A;  4BA2 I;  4DV4 Q;  2KJX A;  1VQP A;  2OTJ A;  4IUQ A;  4NP5 A;  4DN4 M;  1PDQ A;  3E9H A;  2UUB L;  3HGB A;  2LFN A;  1L0W A;  1FD7 D;  1I94 L;  1E7Z A;  1ML0 D;  4N8F A;  1JR0 D;  1HZ9 A;  2H1E A;  4OX9 Q;  1WTH A;  3M7G A;  5M3F G;  2IT1 A;  2PZT A;  3ERO A;  1SNQ A;  5I6Y A;  1STY A;  1A0I A;  4LFA Q;  2XTI A;  3RLO A;  5EBD A;  1IYV A;  3F2B A;  1D5X C;  3CAM A;  1YEZ A;  5LL6 S;  1VMC A;  3AYH B;  4NXN L;  1IBL Q;  3S15 H;  2A6H C;  5GRO A;  4HJ5 A;  2AKW B;  2K5V A;  2IX3 A;  3MXN B;  4UDU C;  3K81 C;  3CF5 A;  2J0T D;  3W3A A;  4JI7 Q;  2A69 D;  5EBC A;  5C4H A;  1BCP C;  3H3V H;  1QVC A;  3W2D A;  3GTJ B;  1NUC A;  1N9W A;  2F0K A;  1YHB A;  5IP9 G;  1S40 A;  5IE8 A;  3K0Y A;  2F0O A;  2Z9H A;  3GTG B;  4GN4 B;  1AEX A;  3FEW X;  1RD9 D;  3H0G B;  3HOZ H;  2BE5 D;  1PTO D;  4QB4 A;  3PV0 A;  4K6L A;  4KK7 A;  3NEN A;  1VQF A;  4K2K A;  4A76 A;  3KF6 B;  2J7Z A;  5I6W A;  1B9N A;  5C44 G;  4UPA A;  2JA5 G;  4LF5 Q;  1B7Y B;  3ULP A;  4DGZ A;  4DR6 Q;  3NTK A;  3CRK C;  2F0G A;  1ILQ A;  3CKI B;  4LK1 C;  1NJI C;  2R7Z H;  1IYU A;  3GTM H;  5A2Q L;  3KJO A;  2RVL A;  3C3L A;  3Q23 A;  1NNX A;  4QCL A;  1SYF A;  4JG2 A;  2PQE A;  2UUB Q;  2GVB A;  4QL5 A;  5DM7 3;  5FJ8 G;  3BVZ A;  1I94 Q;  1UEA B;  5DEH A;  5ELE A;  4C3I B;  3KF8 B;  3R3O A;  3NWT A;  2B2V C;  1QIL A;  1Y1W H;  1Z47 A;  4DUZ L;  1QUQ B;  5JPN C;  5CV7 A;  4RWS C;  4NXN Q;  5EQ0 A;  3BVM A;  2JA6 B;  4GLX A;  1OO9 B;  1Z7T A;  2PW5 A;  3SK6 A;  1C48 A;  2B2T C;  4L8J A;  1ENF A;  2NVQ H;  2F3W A;  1TS3 A;  1Y8O B;  4KHP L;  4QQB X;  3X3M A;  1D6E C;  2GVA A;  3S2H B;  5GAE C;  3KUP A;  2WB1 B;  4G7H C;  2EY2 A;  2NZ1 D;  1B1Z A;  2B39 A;  2OCE A;  2IHF A;  5FOB B;  1GVP A;  4HJ9 A;  3H3V I;  2AUK A;  4N8X 1;  2KVM A;  1LTA D;  5IYC H;  2VUM B;  2NBF A;  2DNC A;  3H0G G;  2ICE C;  2MHV A;  4BBS G;  2Z6B A;  3V05 A;  2XRQ D;  5KEE A;  1YBY A;  5FO9 B;  1PRT F;  1MBY A;  4DAM A;  3I4M B;  4YIJ A;  3I4N H;  3OIP A;  3I70 A;  2DN8 A;  5E3F A;  3KYH C;  4IPC A;  4A3E B;  2ZXO A;  1A2T A;  4ZKC B;  5LHY 1;  2FHT A;  2F4I A;  1Z9F A;  4A3M B;  4UHV A;  1SMY C;  2RSO A;  2RA4 A;  3EQL C;  5IYD G;  4DUZ Q;  2WKD A;  1GUO A;  5M3M B;  1KLU D;  1WTX A;  2VZA A;  2XVS A;  2SNM A;  4GN3 B;  2HT1 A;  3BDL A;  5JAV A;  4FP5 D;  2JA6 G;  1YHA A;  1T9H A;  2MUY A;  2EY5 A;  3PO2 B;  5IGD A;  2X69 A;  2K52 A;  3STB C;  3GTP H;  4KHP Q;  1Q90 A;  4LFC L;  4GNX B;  2VL6 A;  4L6T B;  1Q82 C;  1EY6 A;  1II3 A;  5NUC A;  1HA6 A;  4DV0 L;  2PYK A;  3MXG A;  2ZJQ A;  1F9R A;  1FNU A;  3MXU A;  1V1P B;  4R4I A;  4O1N A;  1YIJ A;  1UE1 A;  3MWY W;  5DAU A;  3CQZ H;  5LMN W;  4A3J B;  1CKO A;  1CFM A;  1I4X A;  4A3I G;  1EFI D;  4QIW E;  2JA8 H;  1U5K A;  4Y7N B;  4B3M L;  4HJ7 A;  1EUJ A;  2K33 A;  1L1O B;  2L5T A;  1X3G A;  1EQV A;  1X32 A;  4DKA C;  3WDN A;  4F87 A;  3SK8 A;  2K50 A;  1L0Y B;  3DWA A;  4PG3 A;  3HOU G;  3T1H L;  2R93 H;  3JC6 6;  4JPB W;  3I91 A;  3RLF A;  3OIQ A;  4IPD A;  2JE6 I;  1KAW A;  4ME3 A;  3IKJ A;  1Y1V H;  2IHE A;  4O0A A;  5BN5 A;  4KHV A;  4HR7 B;  4J8Q A;  3ZJY C;  2CQO A;  1HHV A;  4R8I A;  1RL2 A;  2ZTD A;  2ASB A;  3S1Q H;  5CV8 A;  4KN7 C;  3W5O A;  1DON A;  1HFG A;  5IGB A;  3MEH A;  3VYT A;  3NE5 B;  4ZQ3 A;  2ZM6 L;  5I2X A;  3RN5 A;  2Y0S E;  4TQU S;  1I5F A;  3PO2 G;  3T13 A;  3PGZ A;  4LFC Q;  2XIW A;  1NR2 A;  1Q81 C;  1SE8 A;  3NHH A;  5JOB A;  2P5Z X;  3DWP A;  4RKL A;  3R93 A;  1CKN A;  1UEB A;  4DAY A;  2CQA A;  4DV0 Q;  5EGT A;  2R92 G;  4XQQ A;  3HOV G;  2G9D A;  4DNI A;  4X64 L;  2QA4 A;  3CRL C;  3FPU B;  1T5X D;  2JYO A;  5GAG C;  4HMJ A;  3VA5 A;  4JYA L;  3DM1 A;  4B3M Q;  4A3J G;  1AW7 A;  1VDZ A;  1P16 A;  1GHJ A;  4RGT A;  3AQQ A;  4JI2 L;  3S15 B;  1QZH A;  3PIO 3;  1E2W A;  2C5C A;  3K58 A;  5E4W C;  3BZC A;  1A6X A;  2VQF L;  2A73 B;  3T1H Q;  2EYL A;  2NYZ D;  5M5Y H;  1WFQ A;  1Y69 U;  2PMZ E;  3D0F A;  2Z4I A;  4QJF A;  3W1G A;  4DV3 L;  3HOX G;  1VQ7 A;  3LWE A;  1WTV A;  4A3F H;  2JXM B;  2B63 H;  1TWC H;  1Q1B A;  3OW2 A;  3G7L A;  1JB3 A;  1C7Y A;  2ZXP A;  2CFM A;  3S14 H;  4DV1 L;  4BXX H;  3HOZ B;  1DCZ A;  2CHB D;  3GO5 A;  4RG1 A;  3SDZ A;  4FVM A;  3AFQ A;  2F0F A;  2KHJ A;  5ELC A;  2ZM6 Q;  1G6Z A;  2B2T A;  4LF4 L;  2EDG A;  1VQ4 A;  2RDG A;  1PH9 A;  4GNX A;  2L12 A;  4DR2 L;  3CC2 A;  2WIN B;  2AHO B;  4X66 L;  3H94 A;  2D5D A;  3GTO H;  1HZB A;  4R4O A;  4OO1 I;  2F0D A;  3GTM B;  2R7Z B;  5D14 A;  2R7D A;  1KDB A;  3S1R H;  5K5P A;  1FJG L;  1B53 A;  4C3J G;  3CXC A;  5COR A;  3M4O H;  1V1P A;  4DV6 L;  4X64 Q;  1GUN A;  4RHS A;  1LTS D;  1GUG A;  3HS0 C;  3HRZ C;  1SNO A;  1U9R A;  1HPC A;  2EOT A;  4GKJ L;  3L3O C;  3OYY A;  2DJF C;  4DFA A;  1Y1W B;  1EOV A;  2N49 A;  3VR6 A;  1I3Q H;  4JI3 L;  1DD2 A;  1TII D;  4ZUJ A;  4LF9 L;  4JI2 Q;  2B2Y C;  1KHI A;  4LUZ A;  1QVG A;  1FYC A;  1PRT D;  2GN5 A;  4UAI A;  1E2V A;  3RD4 A;  1Q3L A;  3HOY G;  2QF7 A;  1K3R A;  2VQF Q;  2IW3 A;  1VQB A;  2NVQ B;  1UWV A;  2C35 B;  2F0M A;  5IY0 A;  1KXL A;  3RZD H;  3EN2 A;  3PUW A;  4NKL A;  2N78 A;  2F0W A;  2IWH A;  1O78 A;  3HKZ G;  4DV3 Q;  5C4X G;  4XT3 B;  3QB3 A;  4DUY L;  1JT8 A;  5TSS A;  1VQC A;  2IX0 A;  1IW7 C;  4DV1 Q;  1A3T A;  4FNF A;  1TU2 B;  2A68 D;  4H02 A;  2ZTE A;  3EIV A;  5CV9 A;  3KLS A;  5ELO A;  4LF4 Q;  4MNO A;  2PNH A;  3VYU A;  4HIO A;  5E1F A;  2CCZ A;  1C0A A;  1E24 A;  3CCR A;  4DR2 Q;  5ELF A;  3UDX A;  5FLX E;  4X66 Q;  3JAM L;  3HOW H;  1TQO A;  3Q22 A;  5FLM H;  3I4N B;  3OTO L;  3KDF B;  1G8Z D;  1GUS A;  5IGG A;  1GXD C;  3NBH A;  1HQM C;  2WII B;  3KLW A;  2R7Z G;  1FJG Q;  1GOZ A;  2KHS A;  1EZ8 A;  2RKS A;  5T1G A;  2XWJ B;  3U4V A;  1N34 L;  1KLG D;  4DV6 Q;  3PUZ A;  4K0K L;  4ZCK A;  2AQ1 B;  3BVG A;  3NTI A;  2QDL A;  3KJP A;  3QJY A;  4QY7 A;  4GKJ Q;  2EIF A;  4BY7 H;  4ID6 A;  2KEC A;  3HZX A;  2HQE A;  1XYI A;  4JI3 Q;  1O7L A;  4LF9 Q;  1YNJ D;  5IP7 G;  2EQS A;  2HUG A;  5JJL A;  4MZ9 A;  4X65 L;  1XJV A;  5FO8 B;  2VB3 X;  4WRD A;  4BBR H;  3I8Z A;  3VR5 A;  4A3G H;  3T56 B;  3PIP 3;  1EQT A;  3SK5 A;  2K1B A;  4WOR A;  3GTP B;  1WYD A;  1ET9 A;  1U4P A;  4QIW B;  1S4Z A;  3H6M A;  1EY7 A;  4DUY Q;  2K5Q A;  3CCU A;  4RAU C;  4KHZ A;  3Q24 A;  1AE3 A;  3C1F A;  2A8V A;  3E0E A;  4J15 A;  4DA2 A;  1H9J A;  3GTK H;  3I73 A;  4HJ8 A;  2B3G A;  3CQZ B;  5IT9 E;  4FO2 A;  2K28 A;  1EEI D;  2OEO A;  2JA8 B;  4LFB L;  4QMG A;  3ZYY X;  4QGU A;  3OTO Q;  2RCN A;  1PVO A;  3GP7 A;  5HGT A;  4EQP A;  4L5Q A;  5AFW A;  3SR1 A;  3TEH B;  2X6G A;  2R93 B;  1UE5 A;  5HUR A;  1N34 Q;  1STB A;  5C3E H;  3E0J A;  2ENB A;  4K0K Q;  3Q0A A;  4JOI C;  2Y0S B;  1I4H A;  3CPW A;  5GQO A;  2FMM A;  4A3D G;  1EZ6 A;  4R1J A;  1BR9 A;  1VQA A;  1KIX A;  1LUZ A;  3A54 A;  1N8R C;  1HXY D;  4ABN A;  3J80 L;  4IUR A;  3BDC A;  2YV5 A;  1DOM A;  2EJF C;  1ENA A;  3KLS X;  4JI8 L;  4X65 Q;  3S1Q B;  1FGB D;  2KUM A;  4AYB G;  3MVV A;  2Q2U A;  4A3K H;  5KRU A;  2KBN A;  5ELB A;  2QW7 A;  1BCP D;  3PF5 A;  5LMN L;  1VF5 C;  1JJC B;  2MJ8 A;  4JV5 L;  1MSG A;  1DXM A;  3F2U A;  3PMF A;  4JC0 A;  4O42 A;  4UP9 A;  1ZYR C;  2TSS A;  1ICW A;  4CKE A;  4LF8 L;  2CWP A;  1VQE A;  1CSQ A;  1NR4 A;  2I07 B;  4IFD J;  3SVM A;  2PMZ B;  5CBE E;  3F1Z A;  1W6J A;  4JBM A;  5M5X H;  4LFB Q;  1H9S A;  1O7I A;  2N55 A;  2PQA A;  1JWM D;  3A8I E;  1VQL A;  3KDF A;  3OHX C;  5JEA J;  4A3L H;  2OQ0 A;  4IPG A;  2E74 C;  1D2B A;  3CD6 A;  3J81 E;  1H9K A;  1LAC A;  4BY1 H;  3ND9 A;  1W6K A;  5M5Y B;  1HTP A;  1D7Q A;  3AB9 A;  2H4O A;  2IPK D;  4FXK C;  4X6A H;  4IFD G;  2QEJ C;  1RIP A;  1WTQ A;  3I7F A;  4IUP A;  2ALY B;  1Y1V G;  3S2D H;  2B63 B;  4A3F B;  4DR4 L;  1TWC B;  2VNU D;  4PV1 C;  1F9P A;  1Y8N B;  3S14 B;  2N8N A;  5JEA G;  3I2Z A;  4JI8 Q;  3M85 A;  2PCF B;  1JMC A;  1X54 A;  1PYS B;  3D6C A;  2BDO A;  4K5X A;  5C0X J;  4XYQ A;  1LTT D;  4DV2 L;  4QUC A;  4DK0 A;  1SYB A;  3I3C A;  5COY A;  4L5S A;  1KNA A;  5LMN Q;  1V9P A;  4QUF A;  1DOL A;  4HAE A;  4POF A;  4UY8 C;  3PUV A;  4JV5 Q;  3J7A F;  4IUU A;  2L55 A;  3FKI H;  4XT1 B;  3TSS A;  3P1H A;  1BF4 A;  3GTO B;  3ERQ A;  1YI2 A;  4DV7 L;  4LF8 Q;  3S1R B;  4XYO A;  3OMC A;  2WFW A;  4DR1 L;  4ZRZ A;  3M4O B;  4OL7 A;  5C0X G;  3TRZ A;  3SXH A;  5K36 H;  1WCM H;  3E9I A;  1U4M A;  2Q2H A;  1I3Q B;  3K57 A;  4A3C G;  2A6E D;  1RJT A;  4DF7 A;  2AMC B;  2F3I A;  4WFN 3;  5J39 A;  2VY3 A;  3A56 A;  4XDX A;  1QB5 D;  3RZD B;  3SK4 A;  4C56 C;  4FXD A;  4H0L C;  1KL9 A;  1E1T A;  1SR3 A;  2YYZ A;  1BKB A;  4FF4 A;  5IYB H;  4DR4 Q;  4KJO A;  1VQM A;  4A3F G;  4E6I A;  1W3S A;  2PPB C;  4PMC A;  3WOE A;  4OWX B;  3BZK A;  4IZ8 A;  2C9O A;  4DV2 Q;  3CPF A;  1X6O A;  2WV6 D;  3DM3 A;  4I7Z C;  4ODG A;  4P2C B;  4AIM A;  1CTM A;  2YTX A;  3LNN A;  4IJL A;  3I72 A;  1BBU A;  3J7Y W;  3STB D;  2F1M A;  4BA1 I;  1RTN A;  3HOW B;  3OSO A;  2HIX A;  1EY0 A;  4KKS A;  1TWH H;  4DK6 C;  3BYY B;  1BUV T;  4P72 A;  4DV7 Q;  1A3U A;  2ATW A;  1SE3 A;  1BCP B;  4DR1 Q;  1N36 L;  1STG A;  2RHS B;  3BU2 A;  1G2S A;  4DK3 C;  3TDQ A;  3G71 A;  4G7Z C;  4YHH L;  5EPL A;  2E2J H;  1FVI A;  1STN A;  2L0C A;  4BY7 B;  1LO5 D;  5EPJ A;  1CKN B;  2RQX A;  3K0X A;  1PLF A;  4RA8 A;  4DAY B;  3NPP A;  1XNQ L;  2K5D A;  3KBX A;  3RMH A;  4ME5 A;  5KYI A;  3V96 A;  1PHJ A;  3PSI A;  4B3R L;  4BBR B;  3D31 A;  3RZO H;  3S17 H;  1G91 A;  4A3G B;  3E5S A;  1VQH A;  3URY A;  1QVF A;  1MGS A;  2NZH A;  3C46 A;  2F0P A;  2KEN A;  3PO3 H;  2LY7 A;  1N32 L;  2BCO A;  1SAP A;  1IL8 A;  1BDO A;  2AQ2 B;  3L0O A;  1X9N A;  3MAQ A;  1TWG H;  3D3R A;  3NEL A;  4C1N K;  1YHQ A;  1LT3 D;  4DNT B;  4DR7 L;  4OEM B;  5JJI A;  4TRD A;  5J3B A;  1LTI D;  3VYR A;  3GTK B;  1HR0 L;  1H95 A;  4C3I G;  1AFP A;  1PTO C;  1A8V A;  2MPM A;  1TS4 A;  3VR2 A;  4KY5 A;  2VW9 A;  1M4V A;  1TVX A;  4WJW A;  2EYM A;  1WOC A;  3A0J A;  3A55 A;  2QGQ A;  2QDB A;  3TP8 A;  1UE6 A;  2WAQ E;  4KD4 A;  4R4T A;  4Q0F A;  4H44 C;  4DPG A;  1N36 Q;  1PFS A;  3TZD A;  5C3E B;  1Y8P B;  3GV6 A;  4YHH Q;  4KI0 A;  1GUT A;  1K73 C;  1JOR A;  1BVS A;  2WB1 G;  1KDC A;  1EWI A;  1XNQ Q;  3JAM i;  1A3V A;  1VQ9 A;  3S16 H;  3AFP A;  1CQF A;  1HNX L;  5M5W H;  2NB0 A;  2VUM G;  3FDT A;  3WWV A;  4A93 H;  2K32 A;  4A3K B;  4B3R Q;  2G9H D;  1SYD A;  4HED A;  1GHK A;  4B9W A;  2HDL A;  2EVB A;  2MNA A;  2LMC B;  2IL8 A;  3K59 A;  2JN4 A;  2NN6 H;  3NQI A;  3KLR A;  3I4M G;  1N32 Q;  3TS2 A;  1QE6 A;  2OT2 A;  5I9O A;  1IBM L;  1B44 D;  2K5W A;  4LF6 L;  5J22 A;  1YNX A;  1WTO A;  4A3E G;  4DR7 Q;  4FYD A;  3ERS X;  3M4P A;  1XXG A;  5C3W A;  3CC4 A;  1HR0 Q;  4A3B H;  1ONL A;  2BH8 A;  1V1O A;  4PZ7 A;  4A3M G;  3UI2 A;  5M5X B;  2H5X A;  4MTK A;  2OQK A;  1EIF A;  1F2M A;  2AUJ D;  1EY8 A;  2E2D C;  2JP1 A;  4J6H A;  5M3M G;  1CKM A;  4DXF A;  4OO1 H;  4B3S L;  2L4N A;  5DM6 3;  4ZAI A;  2SNS A;  3NEM A;  1JWU D;  4OGQ C;  4BY1 B;  4NW2 A;  1A62 A;  2EZV A;  1B3A A;  1SJH D;  2NWG A;  2MO1 A;  3DUZ A;  2K05 A;  1UE7 A;  1XWE A;  3R8B A;  4WJ4 A;  3S2D B;  4ALP A;  5BR8 L;  1S5B D;  2I5M X;  2B2W C;  4G4K A;  2E8G A;  1VQD A;  3NBH B;  5IOD A;  1EYG A;  3RLN A;  1DYQ A;  1SFO H;  1QZG A;  1HNX Q;  1HCZ A;  4IN3 A;  3NK9 A;  4ZK9 B;  4IAL A;  1TXY A;  2F0I A;  1SJE D;  3D4D A;  1RTO A;  3F2D A;  5CGK A;  4A3K G;  4R8N A;  2A1A A;  3A8J E;  1VCI A;  1U0L A;  1IXR A;  1JOK A;  1HUN A;  2D0O A;  3L2P A;  3BG3 A;  1I4Q A;  3FKI B;  1E3P A;  1V8Q A;  2SDF A;  4IOC A;  1BCP F;  1TWA H;  1MD2 D;  2B2U C;  1K8A C;  1IBM Q;  4KN4 C;  5KGU A;  3CME A;  4K5W A;  1SE2 A;  1F2Z A;  3FP9 A;  4CKC A;  5IP9 H;  4LF6 Q;  1DOK A;  1TWF B;  1IW7 D;  1VQO A;  3K7A B;  2NN6 I;  2F0N A;  1KD1 C;  1MSH A;  1BXT A;  4YCV A;  2B2V A;  4HTH A;  5KNB A;  1WCM B;  2BOS A;  3N52 A;  3ULJ A;  3N6R A;  4HCE A;  3UDI A;  2F0U A;  1XNR Q;  1PH8 A;  3JAM c;  4XIG S;  2FXQ A;  4P71 A;  2D9U A;  5C44 H;  2JA5 H;  4B3S Q;  1PYB A;  4L5T A;  3CCM A;  4V0B A;  1VMP A;  1IL2 A;  4YWM A;  2LKV A;  2IY5 B;  3CCL A;  1BNZ A;  1SNC A;  1NSN S;  4NB3 A;  1ESF A;  4XQJ A;  1PZJ D;  1MI2 A;  4S3S A;  5EKK A;  5FJ8 H;  3PQI A;  1CI3 M;  4Z9C B;  5BR8 Q;  4C3H H;  1SDF A;  3TN2 A;  4CDF C;  4CJ0 B;  2NUC A;  3M4Y A;  2Q8T A;  4WJ3 M;  3TP5 A;  1F9S A;  2O4X A;  1SBB B;  5ISR A;  3CC7 A;  4IJH A;  2PZU A;  1LT5 D;  2CW0 D;  2I5H A;  2PO4 A;  3DXJ C;  4L5R C;  4K14 A;  1PH2 A;  1I4R A;  1QOH A;  2CWA A;  4EQN A;  5DNF A;  3OMG A;  3T51 B;  1TWH B;  3U4Z A;  2DGY A;  1PZI D;  3TP6 A;  1YNN D;  2KCT A;  2Q2I A;  1NCV A;  3A5U A;  2BA0 A;  1IKM A;  1I50 H;  4J1M A;  5FLX L;  4RH6 A;  1K9M C;  2E2J B;  1PZK D;  3Q6S A;  2VS1 A;  1VQ8 A;  1ICF B;  1PFN A;  4ZLT F;  5C0X I;  1G6P A;  3ONA B;  3CP0 A;  4BBS H;  1GKH A;  3BYT B;  2CKZ B;  2JA7 H;  2Z0S A;  2B29 A;  2RCF A;  1K8O A;  3HOZ G;  3CHB D;  3M7N A;  4GOP C;  1LT4 D;  3RZO B;  4K8J A;  2F0H A;  3S17 B;  3TZU A;  1KC8 C;  3GQB A;  1F2Y A;  4X3K A;  2CVR A;  4PZ6 A;  4RHR A;  4Q5V A;  1H9S B;  3PO3 B;  2NZO A;  2PQA B;  3ITP A;  1J8I A;  1K8M A;  3GTQ H;  4IQZ A;  1HZA A;  2EY1 A;  3Q8D A;  4K8I A;  1JWS D;  4ULL A;  1JB7 A;  2YTY A;  2DUD A;  2EY6 A;  1TWG B;  2ZJP A;  1CT1 D;  2IJ0 A;  2WAC A;  4HN7 A;  3QR8 A;  2UUC L;  3HG9 A;  1E0B A;  4RFB A;  1KDA A;  1BBX C;  1B4O A;  5IYD H;  2WAQ B;  2TMP A;  1NE3 A;  1HR0 W;  1SND A;  1VQJ A;  2NVT H;  4LWC A;  1WD0 A;  1BBW A;  1LTR D;  2VQE L;  4CKB A;  1Y1W G;  1HNZ L;  5C3X A;  3BDO A;  2EXD A;  4EVO A;  1LTG D;  2AWN A;  3K80 C;  2ZT9 C;  1T5E A;  2F0J A;  1X3F A;  3CCS A;  1ZYR D;  5DLQ E;  5IT9 L;  2E5L L;  4X3U A;  4JK1 C;  3SE0 A;  1B9M A;  1QJO A;  2KQ3 A;  5CC4 A;  4PZ8 A;  1V43 A;  3D4R A;  4ILW A;  2LS0 1;  2B8F A;  2F0Q A;  2J4X A;  4X62 L;  3S16 B;  4DXG A;  4A3I H;  2EYF A;  2M9V A;  5IYC G;  5M5W B;  4EX5 A;  2QIL A;  3GD7 A;  4A93 B;  3IL8 A;  2A74 C;  2F0V A;  1WI5 A;  3PF4 A;  4JBJ A;  1PRT C;  3MFY A;  2NVX H;  1PH1 A;  3R2T A;  1FL0 A;  3HOU H;  1H9M A;  1STA A;  5C4Z A;  3IAY A;  1R9T H;  1R4Q B;  4NDX A;  1KNE A;  1VQI A;  2SOB A;  2XNA C;  3I4N G;  1JJ2 A;  4HCS A;  2B2W A;  3A74 A;  1SYG A;  4CDE C;  2UUC Q;  1K0R A;  4XTC S;  2R7F A;  1CHP D;  4KMU C;  1G29 1;  1ASY A;  1EU3 A;  1HA5 A;  2LXJ A;  2M2L A;  4Y52 H;  2WAQ G;  2E76 C;  1FNV A;  3NBI A;  4A3B B;  2VQE Q;  2MGS A;  1CA5 A;  1NBW A;  1XTC D;  5F2D A;  5IGE A;  1HNZ Q;  3AMU A;  5A35 A;  1D1K A;  3G6E A;  2RHQ B;  4HIM A;  1XTD A;  1O7Y A;  1ZXT A;  2A19 A;  2A6H D;  4JBW A;  5C6A A;  2I5L X;  5E7N A;  4X3T A;  1ZKO A;  3U9S A;  2XWB B;  1WTP A;  2FMC A;  2E5L Q;  3F2C A;  2OXP A;  5I4D A;  4JVZ A;  2R92 H;  4M8A A;  1IZ6 A;  4YCW A;  3HOV H;  1XMO L;  2ICI A;  1AH9 A;  4JI0 L;  1WD1 A;  4KD3 A;  1PH4 A;  3GDE A;  3J81 L;  5CYU A;  1SN8 A;  5BN3 A;  4X62 Q;  3DLL A;  1B8A A;  5M3F B;  2OTL A;  1SFO B;  3K5N A;  3HKS A;  3UE1 A;  1ENC A;  3RNU A;  2JJQ A;  5ELD A;  2PZW A;  2YU9 H;  2RDH A;  4DNR B;  1GD7 A;  4KTA A;  1M1K C;  1YNJ C;  4MIU A;  1GO3 E;  1LT6 D;  4NMZ A;  4QF4 A;  1PTO H;  4HSP A;  2QKI C;  2BA1 A;  4LW1 A;  3U9O A;  2JA8 G;  3I55 A;  2OWO A;  4GZY C;  1P8L A;  4HID A;  4R9W A;  4MHE A;  2O5I C;  3VDY A;  1STE A;  5I9P A;  1TWA B;  2PW7 A;  4LJZ C;  1ZEQ X;  4GLA C;  1CZG A;  3HOX H;  3EFX D;  5EPK A;  4YY3 L;  2BH2 A;  2R93 G;  4DAP A;  3E6Z X;  1I4G A;  5CV6 A;  2Y0S G;  3OWF A;  5EKI A;  1F77 A;  1IHZ A;  4IUT A;  4HJA A;  3OWE B;  5GAD C;  2Z6K C;  2Q8I B;  3TME A;  1JOO A;  1YJ9 A;  2B2Y A;  2DJG C;  3L9A X;  4CDD C;  4R4C A;  2F0T A;  2LXK A;  5C44 B;  4FF2 A;  2JA5 B;  3DMU A;  3K5O A;  3FMC A;  1EOT A;  5E4X A;  1PH7 A;  1F9Q A;  2SEB D;  2MP1 A;  1YIT A;  3CCQ A;  1PH6 A;  4RCO A;  4JI1 L;  1PXU A;  4C3J H;  4LNQ A;  3I56 A;  2A5H A;  2RSN A;  3BS1 A;  1XMO Q;  4JI0 Q;  4U68 A;  3SHL A;  3M4Q A;  1B3Q A;  1RCV D;  4C3H B;  5M9O A;  4CDC C;  1TWF H;  2HCC A;  5C4J H;  4YWK A;  4JI5 L;  1HFN A;  1VS0 A;  2F0L A;  3K7A H;  1BQQ T;  4PMB A;  3M3Y H;  2UU9 L;  4LF7 L;  4OON A;  3VR4 A;  3M9B A;  4GOP A;  3ULL A;  2EJM A;  1MJC A;  3U50 C;  1C8C A;  1I6H H;  1LM0 A;  3HOY H;  3IFD A;  1CZW A;  1PFB A;  1DGS A;  1K3B C;  4KKU A;  2WP8 J;  4KY7 A;  1LTL A;  1S72 A;  1EWC A;  1M8A A;  1OXS C;  4L63 B;  1I4P A;  1TKW B;  2RDF A;  1RF2 D;  2HCI A;  5EAY A;  2WKC A;  1EFW A;  3MXP A;  2JA9 A;  4IO9 A;  5C4X H;  2M00 A;  3T4A C;  4YY3 Q;  1B70 B;  2F0E A;  4H13 C;  4M1U B;  3CW2 C;  3NSW A;  3L7Z C;  1I50 B;  4KLK A;  2EXZ A;  1GM5 A;  4CHT B;  1SMY D;  4IPH A;  2B63 G;  1KAB A;  3H91 A;  1S3O A;  4BBS B;  1X56 A;  2JA7 B;  4I7A A;  2NTS A;  3HKZ E;  4BXX G;  1RKN A;  4LUV A;  1J5E L;  2FFK B;  1Q8K A;  2UXC L;  1JQY D;  3MC0 B;  3NTH A;  3C2P A;  1S5C D;  2EYO A;  1KTK A;  1HH2 P;  1HQR D;  1F2L A;  2JK8 A;  2KHI A;  4JI1 Q;  3OW7 A;  3GTQ B;  3S1M H;  5L37 A;  3IFT A;  2LSS A;  1V1Q A;  2PI2 A;  2E2I H;  4GLV B;  1STH A;  4C3H G;  2CH4 A;  4CBV A;  4XQN A;  4JI5 Q;  4TSS A;  3NXW A;  2F0S A;  1BOS A;  4YCU A;  4RCN A;  3K5L A;  2UU9 Q;  4GN5 A;  4DR5 L;  4LF7 Q;  2MFI A;  5IP7 H;  1X3E A;  2NVT B;  4UP8 A;  4NXM L;  1D5Z C;  4C2M H;  3OOC A;  2AWO A;  1EIH A;  1S5E D;  1J6Q A;  5A2Q E;  4K5V A;  4DR3 L;  1SXT A;  2K14 A;  4NPS A;  1K8G A;  4DU9 A;  2L1B A;  5IWA L;  4A75 A;  2ES2 A;  3G48 A;  4GNX C;  5IIF A;  2EPB A;  1HRJ A;  4GKK L;  2V4D A;  3IRB A;  1L2F A;  4JOI A;  4MN3 A;  2A69 C;  2YTV A;  3A7L A;  4I65 A;  4F88 A;  1WVL A;  4OWT B;  3E3X A;  3GTL H;  2L15 A;  1A63 A;  1PH5 A;  4CJ2 C;  2UUA L;  3EBE A;  3TQY A;  1EL0 A;  2HQL A;  2F3V A;  1NY4 A;  1IKL A;  3KK7 A;  4A3I B;  4IUN A;  1X55 A;  3I90 A;  3QOL A;  3VR3 A;  1J5E Q;  2JA7 G;  2UXC Q;  1XNR L;  1L1O C;  1QWY A;  2A6E C;  5FO7 B;  2BE5 C;  3O13 A;  3J7Z C;  1LYL A;  1QG7 A;  1SNM A;  2NVX B;  3BJU A;  3HOU B;  4EQO A;  1R9T B;  1PMR A;  1VQK A;  3HOW G;  1I6V C;  5FLM G;  2IX1 A;  1EIG A;  3QOJ A;  2JEB I;  2XRS D;  1SRO A;  4A3D H;  2PNR C;  5LMU L;  1SYC A;  3J7A V;  1EYA A;  2DY8 A;  2NTT A;  4B9X A;  1VQ5 A;  2KA7 A;  4DR5 Q;  1PH3 A;  1LAB A;  5IGC A;  4NXM Q;  3MXN A;  4BY7 G;  1CSP A;  5D65 A;  1DZ1 A;  2HD3 A;  4DR3 Q;  3QG1 A;  3V2T A;  1KRS A;  5IWA Q;  3CCV A;  5EJW A;  4B3T L;  3MA2 B;  1PYW D;  5EKL A;  3LX0 A;  4BBR G;  4GKK Q;  4POG A;  4A3G G;  2K5H A;  2KCC A;  3PUY A;  2UXD L;  4AYB E;  3ER0 A;  2FIN B;  1GJX A;  3EVQ A;  3MTS A;  5FK9 C;  5JVH 3;  3KFU A;  3HOV B;  1CHQ D;  2R92 B;  1BO0 A;  3LGJ A;  5G3L F;  5H1S E;  2NVY H;  1SLJ A;  2Z6K A;  4JI4 L;  2UUA Q;  2Z1C A;  5CV4 A;  1MKH A;  3KF6 A;  1EWH A;  3CCJ A;  3U58 A;  1NMG A;  2K5N A;  3D4W A;  5KNC A;  3MHB A;  1EEF D;  2K75 A;  2YU9 B;  4JBK A;  1R4P B;  4CGY B; 
#chains in the Genus database with same CATH homology
 3C1E A;  1OXU A;  2D62 A;  2KED A;  5C5L A;  1PTO B;  2EE1 A;  5J1Z A;  3H3V C;  5D3D A;  2EYP A;  4IFD H;  3RUZ A;  1D5M C;  2R6G A;  3GV3 A;  3K5M A;  3KF8 A;  3HOX B;  5KND A;  1DM0 B;  1UAP A;  4HMI A;  1ROD A;  5JEA H;  2EJG C;  4V19 0;  3P75 A;  3QO2 A;  2BDN A;  3DWQ A;  2O2L D;  1SNP A;  4RKB A;  2B8G A;  3FVQ A;  4OIK A;  1HUM A;  4C3J B;  1EU4 A;  2I46 A;  3KBG A;  3T16 A;  4OIJ A;  3P20 A;  5JPM C;  5C0X H;  1OXT A;  2K01 A;  5C4J B;  4RGN A;  3FPP A;  1B2T A;  2JSO A;  3AU7 A;  2F03 A;  4IUV A;  3BZD B;  3M3Y B;  2R61 A;  1AZP A;  5IOC A;  3NWS A;  1RDP D;  1I6H B;  3HOY B;  5CMD A;  3HEJ A;  3DEP A;  1Q1E A;  2D2C C;  1OXV A;  3K6O A;  1TR5 A;  3VA7 A;  4ZYS A;  3EJI A;  2K6A A;  3D8G A;  3HKZ B;  5C4X B;  2Z4H A;  3G6J B;  1LV9 A;  4ZKB B;  2E75 C;  2GA4 B;  4IFD I;  1SE4 A;  2FJ2 A;  1TY0 A;  2K04 A;  2ZXR A;  1TT2 A;  1SEB D;  3R2I A;  1SYE A;  1QNK A;  5KYL A;  4N9T A;  4EGV A;  2XN9 C;  3MZ5 A;  4RGO S;  2KCN A;  3PUX A;  4RGM A;  1SSO A;  1KAA A;  3MFG A;  3S1M B;  1UUP A;  4OHJ A;  4KKT A;  4G7O C;  2E2I B;  2VB2 X;  1AN8 A;  3OPO A;  4F8M A;  1EY4 A;  5K36 G;  4C2M B;  2DY7 A;  1EY9 A;  1ESR A;  2X6L A;  1WTW A;  3TBI B;  1O80 A;  5I2Y A;  3X3N A;  2HDM A;  5IGF A;  3S9W A;  4XXE A;  5KIX A;  4K2L A;  1CA6 A;  5FKA C;  1CQV A;  1ET6 A;  3GTL B;  4ZUI A;  1J9O A;  1E2Z A;  3LWU A;  1PTO F;  4FF1 A;  1X3P A;  1PFM A;  2O5J C;  4PQX A;  1XX8 A;  1JC7 A;  1A2U A;  3NQT A;  3P7J A;  1AZQ A;  5JJZ A;  1Q8I A;  3A8K E;  5G3L D;  2R3Z A;  4A3D B;  4H7B A;  1A15 A;  2JEA I;  2VXW A;  2N88 A;  5CR3 A;  2XSC A;  2EYJ A;  1EYD A;  3I4L A;  1OXX K;  3JAM E;  4AYB B;  4LMQ D;  4U67 3;  3FRP B;  1B50 A;  4B08 A;  3DEO A;  4HSV A;  1AP0 A;  1JOQ A;  5LL6 X;  4C1N I;  1X3Q A;  2CW0 C;  2Z8L A;  1D1I A;  3NP8 A;  1TS2 A;  3VYS A;  2AQ3 B;  3QWN A;  1C4Q A;  5CBA E;  4DAV A;  1QCB D;  1YNN C;  1U4L A;  1H9R A;  5D3I B;  2NVY B;  1L0X B;  1HTL D;  4KV6 A;  1S5D D;  4G57 A;  1LLR D;  2K03 A;  4CJ1 B;  1Q12 A;  1EYC A;  3SEB A;  2A68 C;  3WOF A;  1JE4 A;  2Q8R E;  3EA6 A;  1TY2 A;  3QIA A;  2B2U A;  2EYH A;  1G2T A;  4KY6 A;  3D6W A;  1Y1V B;  4KJN A;  5CV5 A;  1NAP A;  2QCP X;  5T1I A;  5C5M A;  4K6D A;  3S1N B;  1GUW A;  3H09 A;  4TKO B;  5BN4 A;  3DHQ A;  3CU7 A;  2KOL A;  4FXG C;  1JCK B;  1FNW A;  3ND8 A;  1WTR A;  1CK1 A;  3TP7 A;  4F7X A;  1RHP A;  1PRT B;  1DJR D;  1LTB D;  2RBM A;  2K7V A;  2KEE A;  1K83 B;  3J80 E;  1CM9 A;  3NUC A;  1O7Z A;  2NN6 G;  3T53 B;  2L11 A;  4DK1 A;  4X3S A;  1S5F D;  2OF1 A;  1QNU A;  4LAA A;  4BWG B;  1VF7 A;  1JIC A;  1FR3 A;  1U4R A;  3HP3 A;  1TS5 A;  1Z6H A;  2DNE A;  2ID0 A;  4PMW A;  3A7A B;  1EY5 A;  4PNY A;  4OO1 G;  2L9H A;  1UNS A;  4FF3 A;  4N9P A;  2E2H B;  4BS9 A;  1ILP A;  5JVG 3;  4BA2 I;  2KJX A;  4IUQ A;  4NP5 A;  4DN4 M;  1PDQ A;  3HGB A;  2LFN A;  1FD7 D;  1ML0 D;  1JR0 D;  2H1E A;  3M7G A;  2IT1 A;  2PZT A;  1SNQ A;  5I6Y A;  3ERO A;  1STY A;  5EBD A;  1IYV A;  1D5X C;  5LL6 S;  1VMC A;  2A6H C;  2IX3 A;  4UDU C;  2J0T D;  3W3A A;  2A69 D;  5EBC A;  5C4H A;  1BCP C;  3W2D A;  3GTJ B;  1NUC A;  2F0K A;  3K0Y A;  2F0O A;  3GTG B;  1AEX A;  3FEW X;  1RD9 D;  3H0G B;  2BE5 D;  1PTO D;  4QB4 A;  3PV0 A;  4K6L A;  4KK7 A;  4K2K A;  2J7Z A;  5I6W A;  1B9N A;  4DGZ A;  3NTK A;  3CRK C;  2F0G A;  1ILQ A;  3CKI B;  4LK1 C;  1IYU A;  5A2Q L;  2RVL A;  3C3L A;  3Q23 A;  4QCL A;  1SYF A;  2PQE A;  5DM7 3;  3BVZ A;  1UEA B;  5DEH A;  5ELE A;  4C3I B;  3R3O A;  3NWT A;  2B2V C;  1QIL A;  1Z47 A;  5JPN C;  5CV7 A;  4RWS C;  5EQ0 A;  3BVM A;  2JA6 B;  1OO9 B;  1Z7T A;  2PW5 A;  3SK6 A;  1C48 A;  2B2T C;  4L8J A;  1ENF A;  2F3W A;  1TS3 A;  1Y8O B;  3X3M A;  1D6E C;  3S2H B;  3KUP A;  2WB1 B;  4G7H C;  2EY2 A;  2NZ1 D;  1B1Z A;  2B39 A;  5FOB B;  2AUK A;  2KVM A;  1LTA D;  2VUM B;  2NBF A;  2DNC A;  2ICE C;  2MHV A;  3V05 A;  2XRQ D;  5KEE A;  5FO9 B;  1PRT F;  1MBY A;  3I4M B;  4YIJ A;  3OIP A;  3I70 A;  2DN8 A;  5E3F A;  4A3E B;  2ZXO A;  1A2T A;  4ZKC B;  5LHY 1;  2FHT A;  2F4I A;  4A3M B;  1SMY C;  2RSO A;  2RA4 A;  3EQL C;  2WKD A;  1GUO A;  5M3M B;  1KLU D;  1WTX A;  2XVS A;  2SNM A;  3BDL A;  5JAV A;  4FP5 D;  2MUY A;  2EY5 A;  3PO2 B;  5IGD A;  2X69 A;  1Q90 A;  4L6T B;  1EY6 A;  1II3 A;  5NUC A;  1HA6 A;  2PYK A;  3MXG A;  1F9R A;  1FNU A;  3MXU A;  1V1P B;  4O1N A;  3MWY W;  5DAU A;  4A3J B;  1CFM A;  1I4X A;  1EFI D;  4Y7N B;  2K33 A;  2L5T A;  1EQV A;  1X32 A;  3WDN A;  4F87 A;  3SK8 A;  1L0Y B;  3DWA A;  3I91 A;  3RLF A;  3OIQ A;  2JE6 I;  3IKJ A;  5BN5 A;  4KHV A;  4HR7 B;  4J8Q A;  1HHV A;  4R8I A;  5CV8 A;  4KN7 C;  1DON A;  1HFG A;  5IGB A;  3MEH A;  3VYT A;  3NE5 B;  4ZQ3 A;  5I2X A;  4TQU S;  3T13 A;  2XIW A;  1NR2 A;  3NHH A;  5JOB A;  3DWP A;  4RKL A;  3R93 A;  4DAY A;  2CQA A;  5EGT A;  4XQQ A;  2G9D A;  3CRL C;  3FPU B;  1T5X D;  2JYO A;  4HMJ A;  3VA5 A;  3DM1 A;  1AW7 A;  1VDZ A;  1GHJ A;  4RGT A;  3S15 B;  3PIO 3;  1E2W A;  2C5C A;  3K58 A;  5E4W C;  1A6X A;  2A73 B;  2EYL A;  2NYZ D;  1Y69 U;  2Z4I A;  3LWE A;  1WTV A;  2JXM B;  1Q1B A;  3G7L A;  1JB3 A;  2ZXP A;  3HOZ B;  1DCZ A;  2CHB D;  3GO5 A;  3SDZ A;  4FVM A;  2F0F A;  5ELC A;  1G6Z A;  2B2T A;  2EDG A;  2RDG A;  2L12 A;  2WIN B;  3H94 A;  2D5D A;  4OO1 I;  2F0D A;  3GTM B;  2R7Z B;  5D14 A;  1KDB A;  5K5P A;  1B53 A;  4C3J G;  5COR A;  1V1P A;  1GUN A;  4RHS A;  1LTS D;  1GUG A;  3HS0 C;  3HRZ C;  1SNO A;  1U9R A;  1HPC A;  2EOT A;  3L3O C;  4DFA A;  1Y1W B;  3VR6 A;  1DD2 A;  1TII D;  4ZUJ A;  2B2Y C;  1FYC A;  1PRT D;  4UAI A;  1E2V A;  3RD4 A;  1Q3L A;  2QF7 A;  2IW3 A;  2NVQ B;  2F0M A;  3PUW A;  4NKL A;  2F0W A;  2IWH A;  1O78 A;  4XT3 B;  3QB3 A;  5TSS A;  2IX0 A;  1IW7 C;  1A3T A;  4FNF A;  1TU2 B;  2A68 D;  5CV9 A;  3KLS A;  3VYU A;  5E1F A;  5ELF A;  5FLX E;  3JAM L;  1TQO A;  3Q22 A;  3I4N B;  1G8Z D;  1GUS A;  5IGG A;  1GXD C;  3NBH A;  1HQM C;  2WII B;  1GOZ A;  2KHS A;  1EZ8 A;  2RKS A;  5T1G A;  2XWJ B;  1KLG D;  3PUZ A;  2AQ1 B;  3BVG A;  3NTI A;  3QJY A;  4ID6 A;  2KEC A;  3HZX A;  2HQE A;  1XYI A;  1O7L A;  1YNJ D;  2HUG A;  5FO8 B;  2VB3 X;  4WRD A;  3I8Z A;  3VR5 A;  3T56 B;  3PIP 3;  1EQT A;  3SK5 A;  2K1B A;  4WOR A;  3GTP B;  1ET9 A;  1U4P A;  4QIW B;  1S4Z A;  3H6M A;  1EY7 A;  2K5Q A;  4RAU C;  4KHZ A;  3Q24 A;  3C1F A;  4DA2 A;  1H9J A;  3I73 A;  3CQZ B;  5IT9 E;  4FO2 A;  2K28 A;  1EEI D;  2OEO A;  2JA8 B;  4QMG A;  3ZYY X;  3GP7 A;  5HGT A;  4EQP A;  5AFW A;  3SR1 A;  2X6G A;  2R93 B;  5HUR A;  1STB A;  3E0J A;  2ENB A;  3Q0A A;  2Y0S B;  1I4H A;  2FMM A;  1EZ6 A;  1BR9 A;  3A54 A;  1HXY D;  4ABN A;  3J80 L;  4IUR A;  3BDC A;  1DOM A;  2EJF C;  1ENA A;  3KLS X;  3S1Q B;  1FGB D;  2KUM A;  3MVV A;  5KRU A;  5ELB A;  1BCP D;  1VF5 C;  2MJ8 A;  1MSG A;  1DXM A;  3F2U A;  3PMF A;  4O42 A;  1ZYR C;  2TSS A;  1ICW A;  4CKE A;  1NR4 A;  2I07 B;  4IFD J;  3SVM A;  2PMZ B;  5CBE E;  1W6J A;  1H9S A;  2N55 A;  1JWM D;  3A8I E;  3OHX C;  5JEA J;  2E74 C;  1D2B A;  3J81 E;  1H9K A;  1LAC A;  3ND9 A;  1W6K A;  5M5Y B;  1HTP A;  3AB9 A;  2H4O A;  2IPK D;  4FXK C;  4IFD G;  2QEJ C;  1WTQ A;  4IUP A;  2B63 B;  4A3F B;  1TWC B;  2VNU D;  4PV1 C;  1F9P A;  1Y8N B;  3S14 B;  5JEA G;  3M85 A;  2PCF B;  3D6C A;  2BDO A;  4K5X A;  5C0X J;  4XYQ A;  1LTT D;  4QUC A;  4DK0 A;  1SYB A;  3I3C A;  5COY A;  1KNA A;  4QUF A;  1DOL A;  4HAE A;  3PUV A;  3J7A F;  4IUU A;  2L55 A;  4XT1 B;  3TSS A;  3P1H A;  1BF4 A;  3GTO B;  3ERQ A;  3S1R B;  4XYO A;  3OMC A;  4ZRZ A;  3M4O B;  4OL7 A;  5C0X G;  3SXH A;  5K36 H;  1U4M A;  1I3Q B;  3K57 A;  2A6E D;  1RJT A;  4DF7 A;  4WFN 3;  5J39 A;  3A56 A;  4XDX A;  1QB5 D;  3RZD B;  3SK4 A;  4C56 C;  4FXD A;  4H0L C;  2YYZ A;  4FF4 A;  4KJO A;  4E6I A;  2PPB C;  4PMC A;  3WOE A;  4IZ8 A;  2C9O A;  2WV6 D;  4I7Z C;  4ODG A;  4P2C B;  1CTM A;  3LNN A;  3I72 A;  3J7Y W;  2F1M A;  4BA1 I;  1RTN A;  3HOW B;  3OSO A;  1EY0 A;  4KKS A;  3BYY B;  1BUV T;  1A3U A;  1SE3 A;  1BCP B;  1STG A;  1G2S A;  3TDQ A;  4G7Z C;  5EPL A;  1STN A;  2L0C A;  4BY7 B;  1LO5 D;  5EPJ A;  2RQX A;  1PLF A;  4RA8 A;  3NPP A;  2K5D A;  3KBX A;  3RMH A;  4ME5 A;  5KYI A;  3V96 A;  4BBR B;  3D31 A;  1G91 A;  4A3G B;  3E5S A;  3URY A;  1MGS A;  3C46 A;  2F0P A;  2LY7 A;  2BCO A;  1SAP A;  1IL8 A;  1BDO A;  2AQ2 B;  3MAQ A;  3D3R A;  4C1N K;  1LT3 D;  4DNT B;  4TRD A;  3VYR A;  1LTI D;  3GTK B;  4C3I G;  1AFP A;  1PTO C;  2MPM A;  1TS4 A;  3VR2 A;  4KY5 A;  1M4V A;  1TVX A;  4WJW A;  2EYM A;  3A55 A;  2QDB A;  3TP8 A;  4KD4 A;  4Q0F A;  4H44 C;  3TZD A;  5C3E B;  1Y8P B;  3GV6 A;  4KI0 A;  1GUT A;  1JOR A;  1KDC A;  1A3V A;  1CQF A;  2NB0 A;  3FDT A;  2K32 A;  4A3K B;  2G9H D;  1SYD A;  4HED A;  1GHK A;  4B9W A;  2HDL A;  2EVB A;  2LMC B;  2IL8 A;  3K59 A;  2NN6 H;  3NQI A;  3KLR A;  1QE6 A;  2OT2 A;  5I9O A;  1B44 D;  2K5W A;  5J22 A;  1WTO A;  4FYD A;  1XXG A;  5C3W A;  1ONL A;  1V1O A;  3UI2 A;  5M5X B;  1F2M A;  2AUJ D;  1EY8 A;  2E2D C;  2JP1 A;  4J6H A;  4DXF A;  4OO1 H;  2L4N A;  5DM6 3;  4ZAI A;  2SNS A;  4OGQ C;  1JWU D;  4BY1 B;  4NW2 A;  2EZV A;  1B3A A;  1SJH D;  2NWG A;  3DUZ A;  2K05 A;  1XWE A;  3R8B A;  3S2D B;  1S5B D;  2B2W C;  4G4K A;  5IOD A;  1DYQ A;  1HCZ A;  4IN3 A;  3NK9 A;  4ZK9 B;  4IAL A;  2F0I A;  1SJE D;  3D4D A;  1RTO A;  5CGK A;  4R8N A;  3A8J E;  1VCI A;  1JOK A;  1HUN A;  3BG3 A;  1I4Q A;  3FKI B;  1V8Q A;  2SDF A;  1BCP F;  1MD2 D;  2B2U C;  4KN4 C;  5KGU A;  4K5W A;  1SE2 A;  1F2Z A;  4CKC A;  1DOK A;  1TWF B;  1IW7 D;  3K7A B;  2NN6 I;  2F0N A;  1MSH A;  1BXT A;  2B2V A;  4HTH A;  5KNB A;  1WCM B;  2BOS A;  3N52 A;  3N6R A;  4HCE A;  2F0U A;  4XIG S;  2D9U A;  4V0B A;  1VMP A;  2LKV A;  1BNZ A;  1SNC A;  1NSN S;  1ESF A;  4XQJ A;  1PZJ D;  1MI2 A;  4S3S A;  5EKK A;  1CI3 M;  4Z9C B;  1SDF A;  3TN2 A;  4CJ0 B;  2NUC A;  3M4Y A;  2Q8T A;  3TP5 A;  1F9S A;  2O4X A;  1SBB B;  5ISR A;  2PZU A;  1LT5 D;  2CW0 D;  2PO4 A;  3DXJ C;  4K14 A;  1I4R A;  1QOH A;  4EQN A;  5DNF A;  3OMG A;  3T51 B;  1TWH B;  1PZI D;  3TP6 A;  1YNN D;  1NCV A;  2BA0 A;  1IKM A;  4J1M A;  5FLX L;  4RH6 A;  2E2J B;  1PZK D;  3Q6S A;  1PFN A;  4ZLT F;  5C0X I;  3ONA B;  3BYT B;  1K8O A;  3CHB D;  3M7N A;  1LT4 D;  3RZO B;  4K8J A;  2F0H A;  3S17 B;  3TZU A;  3GQB A;  1F2Y A;  4X3K A;  2CVR A;  4RHR A;  4Q5V A;  1H9S B;  3PO3 B;  3ITP A;  1J8I A;  1K8M A;  4IQZ A;  2EY1 A;  4K8I A;  1JWS D;  4ULL A;  2EY6 A;  1TWG B;  1CT1 D;  2IJ0 A;  2WAC A;  4HN7 A;  3HG9 A;  1E0B A;  4RFB A;  1KDA A;  1BBX C;  1B4O A;  2WAQ B;  2TMP A;  1SND A;  1WD0 A;  1LTR D;  4CKB A;  5C3X A;  3BDO A;  4EVO A;  1LTG D;  2AWN A;  2ZT9 C;  1T5E A;  2F0J A;  1ZYR D;  5IT9 L;  4X3U A;  4JK1 C;  3SE0 A;  1B9M A;  1QJO A;  2KQ3 A;  5CC4 A;  1V43 A;  3D4R A;  4ILW A;  2LS0 1;  2B8F A;  2F0Q A;  2J4X A;  3S16 B;  4DXG A;  2EYF A;  2M9V A;  5M5W B;  2QIL A;  3GD7 A;  4A93 B;  3IL8 A;  2A74 C;  2F0V A;  1PRT C;  3MFY A;  3R2T A;  1H9M A;  1STA A;  5C4Z A;  3IAY A;  1R4Q B;  4NDX A;  1KNE A;  2SOB A;  2XNA C;  4HCS A;  2B2W A;  1SYG A;  4XTC S;  1CHP D;  4KMU C;  1G29 1;  1EU3 A;  1HA5 A;  2M2L A;  2E76 C;  1FNV A;  3NBI A;  4A3B B;  2MGS A;  1CA5 A;  1XTC D;  5F2D A;  5IGE A;  3AMU A;  5A35 A;  1D1K A;  1O7Y A;  1ZXT A;  2A6H D;  4JBW A;  5C6A A;  4X3T A;  1ZKO A;  3U9S A;  2XWB B;  1WTP A;  2FMC A;  2OXP A;  5I4D A;  4M8A A;  2ICI A;  1WD1 A;  4KD3 A;  3J81 L;  5CYU A;  5BN3 A;  5M3F B;  1SFO B;  3K5N A;  1ENC A;  5ELD A;  2PZW A;  2RDH A;  4DNR B;  4KTA A;  1YNJ C;  4MIU A;  1LT6 D;  4NMZ A;  4QF4 A;  1PTO H;  4HSP A;  2QKI C;  2BA1 A;  3U9O A;  4GZY C;  4R9W A;  4MHE A;  2O5I C;  1STE A;  5I9P A;  1TWA B;  2PW7 A;  4LJZ C;  1ZEQ X;  1CZG A;  3EFX D;  5EPK A;  4DAP A;  3E6Z X;  1I4G A;  5CV6 A;  3OWF A;  5EKI A;  1F77 A;  1IHZ A;  4IUT A;  3OWE B;  2Q8I B;  3TME A;  1JOO A;  2B2Y A;  3L9A X;  2F0T A;  5C44 B;  4FF2 A;  2JA5 B;  3DMU A;  3K5O A;  3FMC A;  1EOT A;  5E4X A;  1F9Q A;  2SEB D;  2MP1 A;  4RCO A;  1PXU A;  2A5H A;  2RSN A;  3BS1 A;  4U68 A;  3SHL A;  1RCV D;  4C3H B;  5M9O A;  2HCC A;  1HFN A;  2F0L A;  1BQQ T;  4PMB A;  3VR4 A;  2EJM A;  1C8C A;  1CZW A;  3IFD A;  1PFB A;  4KKU A;  2WP8 J;  4KY7 A;  1EWC A;  1M8A A;  1OXS C;  4L63 B;  1I4P A;  1TKW B;  2RDF A;  1RF2 D;  2HCI A;  2WKC A;  3MXP A;  2M00 A;  3T4A C;  2F0E A;  4H13 C;  4M1U B;  3NSW A;  3L7Z C;  1I50 B;  2EXZ A;  4CHT B;  1SMY D;  1KAB A;  3H91 A;  4BBS B;  2JA7 B;  2NTS A;  1RKN A;  2FFK B;  1JQY D;  3MC0 B;  3NTH A;  3C2P A;  1S5C D;  2EYO A;  1KTK A;  1HQR D;  1F2L A;  3OW7 A;  3GTQ B;  3IFT A;  1STH A;  4C3H G;  4CBV A;  4XQN A;  4TSS A;  3NXW A;  2F0S A;  1BOS A;  3K5L A;  4RCN A;  2NVT B;  1D5Z C;  3OOC A;  2AWO A;  1EIH A;  1S5E D;  5A2Q E;  4K5V A;  1SXT A;  4DU9 A;  2L1B A;  5IIF A;  2EPB A;  1HRJ A;  2V4D A;  4MN3 A;  2A69 C;  3A7L A;  4I65 A;  4F88 A;  1WVL A;  4CJ2 C;  1EL0 A;  2F3V A;  1IKL A;  3KK7 A;  4A3I B;  4IUN A;  3I90 A;  3QOL A;  3VR3 A;  1QWY A;  2A6E C;  5FO7 B;  2BE5 C;  3O13 A;  1QG7 A;  1SNM A;  2NVX B;  3HOU B;  4EQO A;  1R9T B;  1PMR A;  1I6V C;  2IX1 A;  1EIG A;  3QOJ A;  2JEB I;  2XRS D;  2PNR C;  1SYC A;  3J7A V;  1EYA A;  2DY8 A;  2NTT A;  4B9X A;  2KA7 A;  1LAB A;  5IGC A;  3MXN A;  5D65 A;  1DZ1 A;  3QG1 A;  3V2T A;  5EJW A;  3MA2 B;  1PYW D;  5EKL A;  3LX0 A;  3PUY A;  2KCC A;  2FIN B;  1GJX A;  3EVQ A;  3MTS A;  5FK9 C;  5JVH 3;  3HOV B;  2R92 B;  1CHQ D;  1BO0 A;  5G3L F;  2Z1C A;  5CV4 A;  1EWH A;  3D4W A;  5KNC A;  3MHB A;  1EEF D;  2YU9 B;  1R4P B;  4CGY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...