5DAUA

Crystal structure of staphylococcal nuclease variant delta+phs v39e/v104e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLEDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALERQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNNWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V39E/V104E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2015-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5dauA00
3D6CA 4N9TA 1JOKA 2EYHA 4S3SA 4E6IA 1STAA 4KJOA 1SYEA 4J1MA 5CGKA 1A3VA 5KEEA 4ZUJA 5EKKA 4IUNA 4NMZA 1SNDA 5EGTA 2F0TA 3D4WA 5CV7A 1IHZA 3EROA 4HMJA 4J6HA 4YIJA 1KDBA 4RKBA 1JOOA 5NUCA 3SK8A 4B9XA 5C4HA 1II3A 1EY6A 5IODA 4K5XA 5CC4A 2EYMA 1A3TA 1TQOA 5E3FA 2EY6A 4HMIA 3VA5A 5HGTA 4G57A 2F0HA 4KY6A 3E5SA 1KABA 1SNPA 1SYGA 4H7BA 2F0LA 2LKVA 2ENBA 4NDXA 3P1HA 5DAUA 3PMFA 1A3UA 1SYBA 4KV6A 1RKNA 4I65A 2F0FA 3RUZA 3MHBA 4PNYA 2EY5A 2PZTA 2RBMA 4EQOA 2EXZA 2EYLA 3TP5A 2F0GA 3TP7A 5IGEA 5CV4A 5HURA 5J22A 1JOQA 2F0DA 3SR1A 5C5LA 1SYCA 4EQPA 1ENAA 2F0EA 4KHVA 4ODGA 3TP6A 3MEHA 5F2DA 1JORA 2NUCA 3LX0A 2O4XA 4K2KA 1EY0A 2F0VA 3T16A 4MIUA 5C3XA 3OMCA 3R3OA 3SK6A 2F3VA 4KD4A 5I9OA 1SYFA 4PMBA 3C1FA 2KHSA 3MZ5A 4WRDA 2PW7A 4DF7A 4K6DA 4DGZA 5JOBA 2HQEA 2SNSA 1A2TA 5I9PA 4K5WA 2F0WA 4ZUIA 4B9WA 5KIXA 1STBA 2EYPA 1SNOA 2F0IA 2PW5A 3DHQA 3EJIA 4NKLA 4LAAA 3ITPA 2F0MA 2F0KA 2F0OA 3SHLA 5ISRA 1A2UA 3NP8A 1EY5A 2M00A 1EY4A 1STYA 1EYCA 1EYDA 1F2ZA 1SYDA 2RKSA 1U9RA 2WACA 2F0UA 2PZWA 1EY7A 3NHHA 3QOJA 4PMCA 1STGA 4QF4A 3BDLA 4TRDA 2F3WA 3OWFA 1NUCA 3NK9A 4WORA 5J39A 4KY7A 3D8GA 3QOLA 2KQ3A 4ZQ3A 1KDCA 4ME5A 5I6WA 3NQTA 3C1EA 4ID6A 4F7XA 5IGCA 3HZXA 5IIFA 5C5MA 4N9PA 5CV8A 3TP8A 1SNQA 5C3WA 1KDAA 4KJNA 5M9OA 5IGFA 2PQEA 2F0JA 3H6MA 5IGBA 5CV6A 2QDBA 3ERQA 1EZ8A 1EZ6A 3BDCA 4DFAA 4KY5A 5IGGA 2RDFA 1EQVA 3MXPA 2EYJA 4QB4A 3S9WA 2F0SA 3NUCA 4K14A 1ENCA 2EYFA 4KTAA 3SK4A 3T13A 5KYLA 2F0NA 5CR3A 1TT2A 3MVVA 2PZUA 1SNMA 3V2TA 4K8JA 5I6YA 4IZ8A 3EVQA 5JAVA 3TMEA 1SNCA 3D4DA 5KRUA 4KD3A 2OEOA 2PYKA 4EVOA 4K5VA 4K8IA 3OSOA 5C4ZA 2F0QA 4OL7A 2EYOA 2F0PA 5CV5A 3U9OA 5IOCA 5J1ZA 1EYAA 1EY8A 1STNA 1F2MA 1STHA 4R8NA 4K2LA 2EY2A 5KYIA 2SOBA 2SNMA 3P75A 5KGUA 5CV9A 4QMGA 5IGDA 3DMUA 4RKLA 2OXPA 1F2YA 1TR5A 3NXWA 3SXHA 1KAAA 3HEJA 3OMGA 1AEXA 1NSNS 5DEHA 2OF1A 3QB3A 1EY9A 2EY1A 4IALA 4NP5A 4HTHA 4EQNA 4F8MA 5EKLA 5K5PA 5C6AA 5E1FA 3SK5A 4DU9A
chains in the Genus database with same CATH superfamily
1SJHD 2A69C 1QILA 5IY0A 4JI6L 3J80E 1TVXA 3BVZA 3D0FA 1LV9A 4JI3L 3BZKA 2L55A 1NTGA 5AJ3L 5JVG3 2RSNA 1YNJD 4BBRG 3CC2A 1PMRA 2LXKA 3GTPB 2Z6BA 4R8IA 4DNIA 1XMOQ 5M3MG 4LF4Q 5I4DA 4TQUS 5JJIA 1B4OA 1YHQA 2K03A 1U5KA 1CM9A 4IQZA 1OO9B 2F0VA 5FKAC 2KCNA 3JAML 1VDZA 4IOCA 1S72A 1EWIA 3S24A 2PQAB 4RMFA 1TS2A 2KHSA 3OOCA 1ASZA 3WOEA 4K6DA 4DGZA 4GZYC 4A3JH 3MXUA 1YJNA 4OIKA 1KHIA 2F0WA 4GN4B 1P16A 1GO3E 1B70B 4NKLA 4DK0A 2VB2X 5C44B 1N32L 1IL8A 1GUOA 1D5ZC 1EY5A 3QOJA 3HOYH 3A74A 2K1BA 3EA6A 3PO3B 4A3GB 2NB0A 4R9WA 4UP7A 1RIPA 3PGZA 2CH4A 4DXFA 1DGSA 4F7XA 4A3CH 1CKNB 4V0BA 1MI2A 5C5MA 4N9PA 4DKAC 1VS0A 4YCVA 1SNQA 4KJNA 4ZCKA 3TZUA 1WTRA 1TWGH 1X6OA 1HRJA 3GTOB 4DAYA 3OW2A 1ENCA 5CR3A 1FVIA 3QO2A 3S17H 3EVQA 2LS01 4KD3A 4R4IA 2KOLA 1GD7A 2Z1CA 3K8AA 2UXBQ 2F0QA 3D6WA 1QZGA 4DR4Q 2EYOA 4M8AA 3TDQA 4GOPA 2CWPA 1BBXC 1YHAA 4FF3A 2A6HC 4JI7Q 4FYDA 1PXUA 5D65A 3VR3A 1FNWA 1WTOA 1NSNS 3E6ZX 1EY9A 2EY1A 4B3MQ 2O2LD 1V9PA 1FR3A 2MO1A 1TS4A 4N9TA 1JOKA 2F52A 1STAA 1ONLA 3CAMA 4WJ3M 1VMCA 4LFAQ 3K80C 5C44G 3EROA 5C4HA 1ILQA 3RLOA 5NUCA 2Q2IA 4EX5A 3PO3G 4A3GG 1Q1EA 3N6RA 4Z9CB 2TMPA 1XMQQ 3S1NH 1M4VA 4GLVB 4A3KH 2JE6I 2NZHA 3VR2A 2F0DA 1F9PA 4JV5L 1PFBA 4K2KA 4A3MB 1BCPD 4DV3L 2ID0A 3WWVA 3BZCA 3D31A 3R3OA 1TS3A 2VNUD 1Q82C 1TWGB 2XN9C 1QVFA 4Q0FA 1J5EL 2Q8TA 1S3OA 2KCMA 2SNSA 1A2TA 1A15A 1D1KA 1TWAH 4L5QA 4B9WA 4DV1Q 4HIOA 3S17B 1SNOA 1QUQB 1Q3LA 2F0MA 2PCFB 4P74A 5ISRA 4ME5A 5C4XH 4GKKQ 5KYLA 3BVMA 3Q8DA 4FDBA 4ZK9B 1EU4A 3D8GA 2HIXA 3CCJA 4AQYQ 3IKJA 2YTYA 1PH4A 1KQSA 1VQHA 1S40A 4ZLTF 1VQDA 1UEAB 2UXDL 5IGGA 1WOCA 4LF9L 2KBNA 3FHWA 1B3AA 3A56A 2OWOA 3L7ZC 1PVOA 1J6QA 3H0GB 2Q8RE 1YITA 1CFMA 3KF8B 2AMCB 4OHJA 1G91A 2F0PA 3R8BA 4POGA 3KLSA 3PIO3 3GDEA 3J81c 4DV4Q 1Z6HA 4CKBA 4A3CG 2SNMA 5ELNA 4A3MG 1T5EA 4IN3A 4JBWA 2B2YC 1YNXA 4A3KB 1ILPA 4NP5A 1E0BA 4UY8C 5C6AA 2EDGA 2MQHA 4O0AA 1CA5A 4JYAQ 1CK1A 3M4OB 5IP7G 1PRTF 1BO0A 4IUNA 4NMZA 1YNND 3Q24A 1CKNA 2K01A 4HMJA 3STBC 1N34L 1XYIA 1TQOA 5LMNQ 5E3FA 4DV6L 1VQMA 1OXUA 3DWQA 3H94A 1GVPA 2B2TC 3H09A 3C2PA 2Y0SB 3M3YH 1I4XA 4I65A 3TS0A 3U58A 5JJKA 5IGEA 5J22A 4CBVA 2JEAI 2WV6D 4RA8A 5C5LA 4OGQC 4P73A 1SMYD 1Z9FA 1KD1C 3H0GG 1H9MA 1SYFA 1R9TH 3MWYW 1H9SB 2YV5A 1IYVA 4K6LA 1D6EC 1PRTB 5IYDH 3I73A 1HA5A 4X3SA 1EWHA 2R3ZA 2NTTA 3K5MA 1A2UA 4A3KG 1STYA 3NTHA 4CJ1B 1U9RA 2WACA 4ILWA 4BXXH 4OWTB 3ZJYC 1BCPF 1B9NA 1KDCA 2QILA 3J81E 2F4VL 1RCVD 1UE5A 3C1EA 4DV5Q 3J7YW 3G48A 2B2UA 3TP8A 1KDAA 2VQFL 4A3DB 2R93H 4O1NA 1EZ6A 2E74C 4JI6Q 1VQFA 2RDFA 1HZCA 2ZTEA 1DCZA 4NW2A 4TSSA 4NXNL 3S1MH 1O80A 3MVVA 4MHEA 4JI3Q 2Y0SG 3T4AC 1SNCA 5KRUA 5C0XJ 5AJ3Q 4HJ7A 1BBWA 1LYLA 4X62L 1SBBB 1STEA 1Y1WH 1EUJA 1BF4A 1PLFA 4IUPA 1I4RA 1LTAD 2K14A 3KBXA 1EOVA 2DN8A 2NVYH 5GAEC 3M3YB 5COYA 1QUQA 2RHQB 1AFPA 5CORA 3NWSA 3CQZB 1X3QA 1PH5A 3BYYB 1BR9A 1EQTA 3J7ZC 1C48A 1WYDA 1TWCH 4QL5A 5L37A 1MBYA 1LTBD 1K3RA 4KHZA 1II3A 4C2MH 4HCSA 1TWHH 1KXLA 1NNXA 5GAGC 4LUOA 1L1OB 1IBKQ 2IT1A 4A3FB 2F0HA 1O7YA 4A3BH 1N32Q 1HNXL 1RHPA 2AQ1B 4XXEA 3RD4A 1F77A 2IY5B 1O78A 4A3DG 2V1CC 1T5XD 3UDGA 2O5JC 4XYQA 1CSPA 5CV4A 3OWEB 3SR1A 3KF8A 3K5LA 3S16H 1C8CA 2K6AA 1ENAA 3X3MA 4XT1B 3K57A 3HOUH 4FVMA 1RTNA 1LLRD 4X3UA 2X6LA 1M8AA 2NWGA 4X3KA 3K7UC 1ICWA 1FD7D 1B8AA 2G9DA 2UXBL 3C1FA 3A0JA 3MZ5A 1MIUA 3VYSA 1EU3A 1SE8A 5IT9L 2DNCA 2PI2E 3MC0B 2QEJC 1U4PA 3DEOA 1PTOC 3RMHA 1XTDA 4DR2L 1SRUA 1QG7A 1DONA 1B44D 5EAYA 1EY7A 4KI0A 1DOMA 3U50C 3F2UA 3PUWA 3NENA 4OX9L 4PZ7A 3CC7A 3OIPA 1HR0Q 3UDIA 1U4LA 1D2BA 3GTMH 2PMZE 4LFAL 1X32A 2NVYB 3F1ZA 1Z47A 1HTLD 5C3WA 1VQ9A 3M4PA 4HSPA 4XQJA 1ZKOA 1C9OA 5IGBA 2XTIA 1IKMA 2B63H 4A3FG 5EPJA 3CMAA 1W6JA 4JI8Q 2CH4W 1S5CD 4DAPA 3PV0A 4DA2A 1I3QB 5M5YH 1Y8PB 2IJ0A 3CRKC 3D4DA 3S14B 4UAIA 2RDHA 4HJAA 4C2MB 1DZ1A 3FP9A 1F2MA 3DM3A 4J15A 1BQQT 4DAMA 1SAPA 5KNDA 3BDOA 1JB7A 3LNNA 2R93G 4IFDJ 3TRZA 4X3TA 2D5DA 3QB3A 4JV5Q 3MTSA 3HOXB 4HTHA 5E1FA 5IP9H 2K32A 4DV3Q 2CHBD 1A63A 1NCVA 2XNAC 2NVQH 3GP7A 2AWNA 2ASBA 2Z6KA 4RFBA 5EGTA 3VA7A 4XQQA 1HH2P 1Q1BA 4O2DA 4GKKL 3CCUA 1J5EQ 2SDFA 1BKBA 5JPNC 1RF2D 1PA6A 1EQQA 4OIJA 1A8VA 4AQYL 2A69D 1NAPA 3L3OC 1NMFA 2ZXPA 4EGVA 4A3EB 4QUCA 1S5DD 5FO9B 3MHBA 1EIYB 4ULLA 3K58A 5M5WH 3TP7A 3CCQA 4DNTB 4JBJA 4LUZA 4GOPC 2UUAL 1JORA 4IJHA 1G291 3K5NA 1TWFH 2UXDQ 5LL6X 3R2TA 1AN8A 2ZXRA 4LF9Q 5FO8B 1G6PA 2B63B 4JBKA 4JI0L 1DOLA 1X3PA 2F4IA 3PUYA 2F0IA 2JA6B 4I7AA 3L2PA 2OTJA 5K36H 3PUVA 1EY4A 2RSOA 4IURA 1N33Q 3HOXG 2PZWA 1HPCA 2E2DC 4OO1H 4K0KL 3MXNA 1SJED 2JYOA 2E76C 1NR4A 3AQQA 4ID6A 1L1OA 1N8RC 3HZXA 3LGJA 1SROA 3KFUA 4GOPB 1E1OA 1LABA 3NEMA 3J81L 3DWPA 2NN6I 3BDCA 3CCMA 1M1KC 1QCBD 4UP8A 4CGYB 2F0NA 4DK3C 2D2CC 1D1IA 2WAQE 2PZUA 2CFMA 4A3EG 1X65A 1N34Q 5JAVA 3PF5A 1VQ6A 3CCEA 1N9WA 4OL7A 4DV6Q 4A3IH 1K8GA 1STNA 1Q12A 5HGQA 1E3PA 3HOZH 1LTSD 5FLMG 2FFKB 3FVQA 1I4GA 2I46A 2JQOA 4PMWA 4B3TL 3CD6A 5DEHA 4PZ8A 5M5WB 1LTTD 1O7IA 4F8MA 2B63G 3GV6A 3I4LA 2RDGA 2K05A 4BY7H 4C1NK 1QWYA 1F9RA 4OO1I 1DJRD 2JA6G 1I94L 2A6HD 1IW7C 2PNHA 4YY3Q 2I5MX 2JA8H 3RZOB 1PH9A 2MO0A 3G6JB 1IBML 2UUCL 2VUMH 4RCNA 3KLSX 4M1UB 3Q6SA 1SNPA 4HR7B 5AFWA 2DY7A 4H7BA 2EVBA 3G4SA 5CYUA 1HA6A 2EY5A 2HD3A 2FJ2A 2XVSA 4QCLA 3IRBA 1HZ9A 2JN4A 2F4VQ 5GQOA 1SYCA 1L2FA 2F0EA 4HN7A 2A6EC 1Q81C 2C35B 1A62A 4UPAA 4L5RC 3HGBA 2VQFQ 1B7YB 3QWNA 2CCZA 3QJYA 4NXNQ 2B39A 4HCEA 5CMDA 1HJPA 1SE4A 1IL2A 2XSCA 4K5WA 2IPKD 2NVXH 1STBA 2PW5A 3CMEA 2NZOA 1TXYA 3U9SA 2E2JH 2GN5A 4X62Q 1F2ZA 3KBGA 2HDMA 1A6XA 1HTPA 3FPPA 4QF4A 5C3EH 4A3IB 1VQ7A 3UDFA 5LHY1 3HP3A 3I8ZA 2HQLA 2L9HA 1CA6A 4C3JH 3VYRA 1UE7A 5I2YA 1VQIA 3OYYA 4FP5D 2A1AA 3W1BA 1JE4A 5M9OA 4HIMA 4HJ5A 1ZYRC 3I3CA 1NJIC 3SK4A 3T13A 2EYFA 1IBKL 4RHSA 4KMUC 3CP0A 5K36G 4G7HC 1AE3A 3S1QH 2JA8B 3A7AB 2WB1B 1RJTA 4K8IA 4R4CA 1Q8IA 2I5HA 4H13C 2VUMB 4BBSB 1HNXQ 2F03A 2L4NA 2Z0SA 3GTGH 3QIAA 3F2BA 2SOBA 5JEAH 1U4MA 3M9BA 2MHVA 1E2WA 1AP0A 3OMGA 1OXXK 2VXWA 3BU2A 3GTKH 5K5PA 1LTLA 2B2WA 2XIWA 4HJ8A 1S4ZA 2HCIA 1CQFA 5JVH3 4RGMA 1I6VC 1X55A 1PH6A 2L11A 2NTSA 5IODA 2B2UC 3DEPA 1VQ8A 4A3IG 3I72A 2UU9L 3AYHB 1HR0L 3HOZG 3DM1A 4L6TB 2NVXB 5JEAJ 1PYSB 2FMCA 4DR2Q 4KV6A 2P5ZX 2E2JB 3GTJH 2MJ8A 3AFQA 4R4OA 4OX9Q 2FHTA 2WP8J 2ZTDA 4U673 3STBD 2L5TA 4CJ0B 1LT4D 4IPHA 2D0PA 4QIWB 4KHVA 1ET6A 4C3JB 4JI8L 1BNZA 1OXSC 1WD1A 3T1YL 3A54A 2JA8G 2YU9H 2WB1G 2F3IA 2ICIA 5CBAE 4AYBB 1CQVA 2JA5H 1X54A 2VUMG 2DY8A 4A3JB 2BOSA 4DF7A 1HNZL 4BBSG 2R7DA 3NPPA 5IYBG 1N36L 3KJPA 2O5IC 4ZUIA 1ZEQX 4LAAA 1QNUA 4KK7A 5DM73 2AUJD 4GS3A 3HOYB 2RKSA 1SYDA 4KKSA 1GOZA 3TN2A 3K0XA 4QUFA 3IFTA 3N52A 2EJGC 4OXPA 4N8FA 2QDLA 3W3AA 1KLGD 3J81j 5I6WA 1RD9D 3KF6B 4OWWB 3GTKB 1YEZA 3DXJC 1CT1D 1F2LA 1M90C 2D9UA 2QGQA 4PQXA 3OIQA 4P71A 3S2HH 3CF5A 3PF4A 4Q5VA 4KLKA 4JOIA 4OONA 3EFXD 5J3BA 3BVGA 2VQEL 4R8NA 4C3JG 1KNAA 5KGUA 1V1QA 3AU7A 1OXTA 5EJWA 3NWTA 2KA7A 3IFDA 4RKLA 3CW2C 1UE6A 1Y8NB 4AYBG 3NELA 2DGYA 4A3JG 3O13A 2NYZD 4GKJQ 4DUYL 4B3SL 4L8JA 2UUAQ 3PO2H 1IBLL 1SYEA 3K6OA 3SE0A 3CCRA 1TIID 4ZUJA 2AHOB 4NXML 5DLQE 2YU9B 2VW9A 1VQAA 3HOYG 3VDYA 1WCMH 4JVZA 1N33L 5FO7B 2XRSD 4JI0Q 1KRTA 4KY6A 2HT1A 3HG9A 1X3FA 3S1NB 1TU2B 2F0LA 4DR5L 4U68A 4X6AH 3SEBA 1KRSA 1LTRD 4GNXB 2CKZB 2EYLA 4K0KQ 1DXMA 4IUVA 1JC7A 4Y52H 1UUPA 3EN2A 4RH6A 3HKZB 2O4XA 3J80L 1PRTC 2RQXA 5C3XA 3I91A 5I9OA 4IJLA 1X56A 2PW7A 1TWAB 3AFPA 4OWXB 1HUNA 1XNQQ 5C4XB 2F0KA 4DK6C 1XXGA 2K4KA 4TRDA 3ULJA 4LJZC 2AQ3B 3CCLA 3JC66 3CPWA 2L1BA 4L63B 4LK1C 2WFWA 4APVA 2K52A 2N3SA 4IO9A 1CTMA 3NE5B 4FXKC 4B3TQ 1K73C 4YY3L 2R61A 1EIGA 3F8TA 1PTOD 1VQGA 1B50A 2ES2A 2A5HA 1JWMD 3MXPA 2FINB 2F0SA 4KTAA 1I94Q 2Y0SE 3NBHB 5I6YA 4IZ8A 1JCKB 4JI1L 3I4OA 5C0XH 5BN5A 5LMUL 3G71A 1IBMQ 4K5VA 4X65L 2UUCQ 2B3GA 1SE3A 3J7AF 4ZKCB 2LXJA 3U9OA 1Q86C 4DNRB 4HIDA 1HZBA 3BG3A 1I50H 1K3BC 2EY2A 3M7GA 3HKZG 1GUTA 1JWUD 3DMUA 1TR5A 4X66L 2NBFA 2JA7H 4LMQD 2ATWA 3SVMA 3RZDH 4JI2L 3QR8A 2Q2HA 2KECA 4RGTA 4J1MA 4MTKA 5C4XG 2JA9A 1L1OC 5CV7A 1HUMA 1KDBA 1MGSA 2MPMA 3KF6A 4K5XA 2OQ0A 5EPKA 5CC4A 5DM63 3HOVH 2ZM6L 1A3TA 3ULPA 3VA5A 4G57A 3TS2A 3E5SA 4XYOA 1XPOA 3B6YA 2KCCA 3I4NH 3T1HQ 4MZ9A 5D3IB 3RUZA 1BCPB 2QW7A 1NE3A 1JQYD 5C0XI 3RN2A 4JK1C 3JAMi 5IYCH 3IL8A 2JSOA 3TBIB 1V43A 1YJ9A 2DNEA 3JAMc 3H3VC 3W5OA 4MIUA 1WD0A 3MXNB 1VQJA 1R9TB 2F3VA 2OT2A 2LSSA 2KHJA 4RHRA 1CHPD 1GHKA 5EBCA 2IHEA 3LWEA 5IE8A 4JW0A 1K8MA 5KIXA 3GTQH 3GO5A 5FJ8H 2MFIA 3S2DH 1U0LA 3F2CA 4KKUA 3A8JE 2A73B 4YWKA 3U4VA 1I4QA 4G7ZC 2X6GA 1IYUA 1STGA 1XWEA 4BA2I 2F3WA 1UNSA 2VY3A 3NQIA 4PZ6A 4QQBX 1PTOH 1BUVT 1Y69U 5M3FH 3OTOL 1VF7A 4RAUC 5IIFA 5EKIA 1F9QA 2R93B 1WTQA 2JA7B 5FOBB 1XPUA 2BDNA 1Z7TA 4FF1A 4GNXA 4QGUA 3ND8A 3S1MB 4MN3A 1LT5D 1JJ2A 1Q90A 3CXCA 3E3XA 3HFZB 1EIHA 5HY6A 2PYKA 3CKIB 1PH3A 1S5ED 4PG3A 2UU9Q 1Y1WB 1ET9A 4DK1A 2H5XA 1B53A 2IWHA 5KYIA 3I4NB 1PYBA 4LF8L 4ABNA 1NBWA 1PTOF 3RLNA 4RG1A 4IFDH 2OXPA 5GADC 3NTKA 1PHJA 2QCPX 1AEXA 4DXGA 2IX3A 2OF1A 1RDPD 2A74C 5IYDG 5ELDA 1XNRQ 2Q2UA 1CKMA 5DNFA 1YZ6A 4S3SA 1G2SA 1EFID 4KJOA 3T1YQ 1AE2A 3JAME 2IW3A 1TWCB 5C0XG 1QJOA 2D62A 4LFCL 3D4WA 4BXXG 1O7LA 1KTKA 1TWHB 4DPGA 1HNZQ 1XPRA 1EY6A 1GUSA 1N36Q 2K5WA 4RCOA 2JK8A 2EJFC 1JWSD 1K8OA 4C3HH 2EY6A 2EOTA 4A3BB 3TZDA 1X9NA 4LF5L 3CC4A 4NDXA 1F9SA 5DAUA 1QVCA 2JA7G 1H95A 1DOKA 2XWBB 3NBHA 1PH7A 4PNYA 1IW7D 3BJUA 1VCIA 3TP5A 3I7FA 2F0GA 3UE1A 3S16B 5HURA 4YCUA 1QE6A 1FGUA 1Y8OB 3HOUB 2KEDA 3TP6A 1IKLA 3M4YA 2R92H 1EY0A 1SEBD 4N8X1 3KJOA 2Z9HA 3OMCA 4JPBW 5D3DA 2BCOA 1HFNA 1LACA 1HXYD 4AH6A 2QKIC 3HKSA 1Y1WG 1SFOH 3HOVG 4A75A 4IFDI 3A5ZB 3ONAB 3E9IA 2AKWB 1ASYA 1TY0A 1ZXTA 2KVMA 3I4NG 3HOWH 4LF7Q 2NN6H 2ALYB 2B2WC 1K9MC 1G6ZA 3ITPA 2A6ED 1E2VA 3VYUA 3NP8A 3VR5A 1KNEA 5IYCG 2F0UA 3GQBA 3DLLA 2VQEQ 3A8KE 4GKJL 3FRPB 5A2QE 3S1RH 4ZQ3A 2KQ3A 3GTMB 3MA2B 4L5TA 4BBRH 3WOFA 1G51A 1HHVA 1WI5A 2GVBA 4FO2A 2D0OA 1B2TA 5IGFA 4DUYQ 4B3SQ 1HFGA 2MUYA 3S9WA 4A3BG 1IBLQ 4ALPA 3UE0A 3OW7A 4WJ4A 4TVAB 4NXMQ 5M5YB 1CZGA 2BA1A 4K8JA 1G2TA 4O42A 1DD2A 5G3LD 3TMEA 2OEOA 2BE5C 3MEFA 3OSOA 1U4RA 3RNUA 2HHHL 3FMCA 1ZYRD 3HOUG 4DR5Q 1CZWA 1KL9A 1GUGA 1YIJA 1YHBA 4YWMA 3GTLH 4QMGA 3PSIA 1PZID 1F2YA 2KUMA 3SXHA 4RGOS 2DJGC 2ZJQA 2IHFA 4JC0A 2FXQA 4IOAA 4NPSA 1VQLA 2VL6A 3D6CA 3CRLC 2NVQB 3DUZA 1C4QA 2E75C 4DAVA 3SGIA 5KEEA 2R92B 4KHPL 1XNQL 3K5OA 1E1TA 2WINB 2JXMB 4PV1C 4DN4M 2UXCL 4A93H 1NY4A 5D14A 1KABA 4ZRZA 2N55A 3HOWB 5ELEA 1BVSA 3CCVA 4IFDG 3PMFA 4FF2A 2PZTA 3ER0A 1RODA 2C5CA 4CDCC 5H1SE 1RTOA 2TSSA 4JOIC 4LF6L 3MEHA 1HZAA 1TWFB 4JI5L 1I4PA 1YVCA 1W6KA 3KUPA 4JI4L 3MFYA 2NZ1D 1PFNA 4WRDA 1LUZA 3E0JA 2Q8IB 4F87A 3H91A 5E4XA 4JI1Q 2GVAA 5LMUQ 5ELOA 4KN4C 2V4DA 4X65Q 1C7YA 4BY1H 2F1MA 1V8QA 1JJCB 2H4OA 1B9MA 2M00A 1EYCA 2YYZA 2ZTCA 5IP9G 3KK7A 3BDLA 1WTVA 3OWFA 2B2VA 3K81C 3L0OA 4A3GH 3QOLA 5BR8L 2R92G 4X66Q 4ZAIA 1SXTA 1JR0D 4GN5A 4JI2Q 4DR3L 2UUBL 5CV6A 3BS1A 1JE5A 1EYGA 5IWAL 3HOWG 1EQRA 2NN6G 1SE2A 2K33A 4POFA 2EE1A 3CPFA 2ZJRA 4P72A 5JJZA 3T1HL 2ZM6Q 2Z4HA 4A93B 5J1ZA 4LFBL 3HOZB 4K2LA 1UEBA 1EWCA 3Q23A 1VQ5A 1Q46A 1FNVA 2CQOA 1AH9A 4CDDC 4XIGS 1HNWQ 4BY7B 4DU9A 2VS1A 4E6IA 4DR1L 5G3LF 1VQKA 1K0RA 3J7AV 5CGKA 1PV4A 4DV2Q 4G4KA 4IPDA 4C1NI 1VQOA 2MGSA 4A3LH 2K75A 4OO1G 4B3RL 3I70A 5LL6S 3RLFA 1MSGA 1D8LA 1GM5A 3TQYA 5FLXc 3VYTA 3GD7A 2AUKA 3J7A5 2BH2A 2XRQD 3MFGA 4BY1B 3D4RA 1MJEA 2K7VA 4I7ZC 3ICEA 1JOQA 4LNQA 3BYTB 3OTOQ 4ODGA 3T56B 2WKCA 1CHQD 2E5LQ 2WB1E 3T16A 1E22A 2EPBA 1XJVA 4A3MH 5BN3A 2J0TD 1YI2A 2K5DA 5IT9c 4A93G 5GAHC 2N88A 1Q8KA 3GV3A 4DR7L 2M9VA 5T1GA 1H9KA 5IP7H 3SHLA 1BDOA 2K50A 1B1ZA 2EIFA 2N8NA 5C3EB 1PRTD 1V1OA 1FNUA 3FDTA 1GKHA 4CKCA 1XNRL 4BY7G 4JG2A 3K7AH 3Q22A 4KY7A 4LF8Q 3WDNA 5CV8A 5A2QL 3KDFB 1I5FA 3W2DA 2CW0C 4F88A 3H6MA 2F0JA 5JPMC 1DYQA 4LW1A 1HQMC 1LTGD 4KY5A 3NUCA 3RR5A 1RL2A 3T53B 3V96A 4LFCQ 4BWGB 3S1QB 4DR6L 1L0XB 4BY1G 1LT3D 4EQ5A 3UDXA 3H0GH 2VZAA 4DV0L 1PDQA 4QIWE 4R4QA 2WKDA 1EYAA 3GTGB 1XTCD 4LF5Q 3I56A 1H9JA 1SLJA 1ESRA 5FLXE 4AYBE 3NXWA 2Z4IA 3A5UA 1YNJC 3CU7A 1BXTA 1SSOA 5KNCA 3SK5A 3LWUA 3E0EA 3G6EA 3I55A 1UAPA 4IPGA 4P75A 3M4OH 4HEDA 4LF7L 5EKKA 1SNDA 2YTVA 2F0TA 3L9AX 1VQPA 5C3EG 1I6HH 5A35A 3IAYA 2DUDA 5IT9E 1K8AC 2CVRA 3I4MH 4GNXC 1S5FD 4YHHL 1A0IA 2LKVA 5ELCA 4HSVA 1JICA 3GTJB 1A3UA 2AWOA 1J8IA 4OEMB 1WVLA 4EQOA 2EXZA 3D3RA 3KLWA 2K5VA 3K7AB 1EEFD 4IUTA 5EBDA 1V1PB 3LX0A 5E4WC 2G5DA 4A3LG 1WTXA 5EQ0A 1EL0A 3PIPA 2JA5B 1IYJB 2AQ2B 1GXDC 4LUVA 3NBIA 1KLUD 1WTWA 4QY7A 1JT8A 5JEAG 5JOBA 2QA4A 3M4QA 5LMNW 1YJWA 4X64Q 1VQNA 1O7ZA 2M2LA 3PUZA 2E8GA 1D7QA 2B8GA 1JJGA 1AZQA 1WFQA 2IL8A 2HHHQ 2KEEA 4MNOA 4PMCA 2FMMA 3W1GA 3J81i 4KN7C 4IUUA 2PQAA 3K59A 1HQRD 2KJXA 5IGCA 3M85A 2R7ZH 2OTLA 4IUQA 3A7LA 3A8IE 3TSSA 4A3DH 1QOHA 4GLXA 2K5HA 2ZXOA 1TT2A 4KHPQ 4HIKA 4DV7L 3S2HB 2Z8LA 3P20A 4R1JA 1QB5D 1IXRA 2UXCQ 1I6HB 2Z6KC 3HRZC 2RVLA 2ZJPA 1I4HA 2PNRC 3R2IA 5IOCA 1ENFA 1UE1A 1FJGL 1D5XC 3I4MB 3HKZE 1K0SA 2BA0A 3P75A 5CV9A 5ELFA 2JA5G 1KAAA 3VR4A 3I90A 2K04A 4IALA 3KOJA 3PO2B 4BA1I 4UHVA 3CQZH 1G8ZD 2A68D 4LF6Q 3C3LA 1SR3A 2JEBI 2N49A 4JI5Q 1XX8A 4DUZL 2RHSB 1WCMB 4JI4Q 4J6HA 1OTCA 4B9XA 1MHWC 3KDFA 4UP9A 3CCSA 2EYMA 5BN4A 1B3QA 4HMIA 3EBEA 1BCPC 4A3FH 2ENBA 3S15H 4FXDA 4LWCA 1QNKA 5EPLA 1Y1VH 5BR8Q 1L0YB 5GROA 4CDFC 2GA4B 2EZVA 2R7ZB 2B8FA 2NUCA 1FL0A 3I2ZA 4DR3Q 4CJ2C 2UUBQ 3P7JA 2LFNA 1ML0D 4PMBA 4H0LC 1SMXA 3H3VH 5IWAQ 3I4MG 3A55A 1W2BA 5I9PA 4C3IH 2I5LX 2ICEC 2F0OA 1WJJA 4HAEA 1NR2A 1XMOL 1EFWA 1KAWA 4WORA 2CQAA 4LF4L 1EOTA 4LFBQ 3PO2G 2K28A 1K28A 5J39A 3UI2A 1EEID 1HNWL 1FYCA 2QEXA 1L0WA 1WCMG 3H15A 4DV2L 3M7NA 4GLAC 2XWJB 2X69A 3C46A 1GHJA 1J9OA 2QDBA 2OQKA 3ERSX 4DR1Q 3R93A 1GJXA 5KNBA 1E7ZA 3KLRA 4B3RQ 1V1PA 1I3QH 3ULLA 4Y7NH 2HCCA 1VF5C 4RWSC 1TS5A 3S14H 3MXGA 1EY8A 1I50B 3OPOA 1YNNC 2R7ZG 3H3VI 3S15B 1HR0W 1HCZA 4XDXA 5TSSA 2MP1A 5IGDA 3FEWX 5C4JH 2E5LL 1QVGA 2L15A 3HEJA 3RZDB 2OCEA 2RCFA 4AIMA 4J8QA 5FLXL 2PPBC 1MD2D 5I2XA 2RF4A 2BE5D 5EKLA 1FGBD 3HOXH 1Y1VB 1ESFA 2IX0A 1CUKA 2RA4A 2B2VC 4QJFA 1PH1A 1CKOA 4H02A 3X3NA 2SEBD 2DJFC 1UWVA 1PZJD 2PMZB 1IHZA 4KKTA 2A68C 3SK8A 4RKBA 3AMUA 1LM0A 3HOVB 1Q7YC 4DR7Q 1SMYC 4DR4L 1SYGA 4C3IB 1JMCA 1E24A 1YBYA 3P1HA 4BS9A 1SYBA 3EIVA 4JI7L 1RKNA 2G9HD 4YWLA 3RN5A 2PO4A 2YTXA 4A3EH 1E2ZA 3V05A 3FKIH 4L5SA 1R4PB 4CKEA 4B3ML 4EQPA 2BDOA 2J7ZA 3U4ZA 5F2DA 2XGTA 1GUWA 3TREA 4H44C 2I0QA 5FLMH 3SK6A 2B29A 1OXVA 1MJCA 1JB3A 2K5NA 4CDEC 1KIXA 3GTQB 1P8LA 4DR6Q 4R4TA 3S2DB 2B2YA 2EYPA 2QF7A 3DHQA 1XMQL 3KYHC 1CSQA 1K83H 2I07B 4YCWA 4DV0Q 2JA6H 4Y7NB 1VQ4A 1AZPA 1EYDA 3NHHA 3E9HA 1PTOB 1PZKD 1NUCA 1Y1VG 1D5MC 1TKWB 1Y14B 5M3FB 3SDZA 3PCOB 1H9SA 3NQTA 2R6GA 3F2DA 3PUXA 2HUGA 5C4JB 3AB9A 3NTIA 2ZT9C 3ND9A 4V190 2IX1A 2EQSA 3ERQA 1EZ8A 4DFAA 1PFMA 1EQVA 2KHIA 2EYJA 2N78A 2B2TA 4K14A 4C3IG 2BH8A 1LO5D 2EJMA 4WFN3 3V2TA 3PIOA 2CWAA 4P2CB 1T9HA 4DV1L 2NVTH 4A4IA 3BZDB 4A76A 4EVOA 4ZYSA 2C9OA 5C4ZA 2MNAA 4YHHQ 4FF4A 4B08A 2HIVA 1DM0B 1IZ6A 4XT3B 4NB3A 4C56C 5M3MH 1PFSA 1SDFA 1VQEA 1ICFB 1NMGA 3FKIB 4EQNA 4XTCS 1WTHA 2H1EA 2EYHA 5FJ8G 1PH8A 1PH2A 3OHXC 1LTID 1CI3M 5M5XH 1A3VA 3ZYYX 1MKHA 4X64L 4IPCA 4YIJA 1X3GA 1JOOA 3NSWA 3RZOH 3EQLC 1TY2A 4C3HB 2E2IH 4UDUC 1MSHA 5M3FG 5HGTA 1EIFA 4DV4L 1K83B 2WAQB 1AW7A 2E2HH 2F0FA 2Q2TA 1W3SA 5E7NA 4DAYB 2RBMA 4CHTB 4GN3B 4G7OC 4FXGC 4MTNA 3J80i 3TEHB 1GUNA 1VMPA 3J80c 5CBEE 1S5BD 2J4XA 2JP1A 1VQBA 4JYAL 2A8VA 4XQNA 3FPUB 4KD4A 2EXDA 1SFOB 4JCVE 2PI2A 4ZKBB 4FNFA 3AEVA 3Q0AA 2LMCB 4DV7Q 2HQEA 3DWAA 3PIP3 5LMNL 1VQCA 3GTPH 5FK9C 3EJIA 2WIIB 3MAQA 2NVTB 3FKIG 1FJGQ 1KC8C 2L12A 4RGNA 3S1RB 3NK9A 3CHBD 4BBRB 1BBUA 2K5QA 3URYA 1X3EA 1C0AA 2RCNA 4TKOB 5M3MB 5JJLA 4WJWA 1WTPA 1SN8A 2PQEA 4C3HG 3K0YA 2HDLA 3G7LA 4QB4A 2KCTA 1R4QB 4ME3A 4DUZQ 1SNMA 4HJ9A 5M5XB 2WAQG 3QG1A 5T1IA 1PYWD 5C44H 2KENA 4JBMA 2LY7A 1H9RA 2E2IB 2CW0D 2VB3X 5CV5A 3PO3H 1BOSA 1STHA 1LT6D 2JJQA 2A19A 3GTLB 4BBSH 5IYBH 3T51B 3HS0C 2R7FA 5ELBA 2E2HB 4DV5L 1QZHA 3VR6A 4OELB 3GTOH 2L0CA 3PQIA
chains in the Genus database with same CATH topology
1SJHD 2A69C 1QILA 3J80E 1TVXA 3BVZA 1LV9A 2L55A 5JVG3 2RSNA 1YNJD 1PMRA 3GTPB 4R8IA 5I4DA 4TQUS 1B4OA 2K03A 1CM9A 4IQZA 1OO9B 2F0VA 5FKAC 2KCNA 3JAML 1VDZA 1TS2A 2KHSA 3OOCA 3WOEA 4K6DA 4DGZA 4GZYC 3MXUA 4OIKA 2F0WA 4NKLA 4DK0A 2VB2X 5C44B 1IL8A 1GUOA 1D5ZC 1EY5A 3QOJA 2K1BA 3EA6A 3PO3B 4A3GB 2NB0A 4R9WA 4DXFA 4F7XA 4V0BA 1MI2A 5C5MA 4N9PA 1SNQA 4KJNA 3TZUA 1WTRA 1HRJA 3GTOB 4DAYA 1ENCA 5CR3A 3QO2A 3EVQA 2LS01 4KD3A 2KOLA 2Z1CA 2F0QA 3D6WA 2EYOA 4M8AA 3TDQA 1BBXC 4FF3A 2A6HC 4FYDA 1PXUA 5D65A 3VR3A 1FNWA 1WTOA 1NSNS 3E6ZX 1EY9A 2EY1A 2O2LD 1FR3A 1TS4A 4N9TA 1JOKA 1STAA 1ONLA 1VMCA 3EROA 5C4HA 1ILQA 5NUCA 1Q1EA 3N6RA 4Z9CB 2TMPA 1M4VA 2JE6I 3VR2A 2F0DA 1F9PA 1PFBA 4K2KA 4A3MB 1BCPD 2ID0A 3D31A 3R3OA 1TS3A 2VNUD 1TWGB 2XN9C 4Q0FA 2Q8TA 2SNSA 1A2TA 1A15A 1D1KA 4B9WA 3S17B 1SNOA 1Q3LA 2F0MA 2PCFB 5ISRA 4ME5A 5KYLA 3BVMA 4ZK9B 1EU4A 3D8GA 3IKJA 4ZLTF 1UEAB 5IGGA 1B3AA 3A56A 3L7ZC 3H0GB 2Q8RE 1CFMA 4OHJA 1G91A 2F0PA 3R8BA 3KLSA 3PIO3 1Z6HA 4CKBA 2SNMA 1T5EA 4IN3A 4JBWA 2B2YC 4A3KB 1ILPA 4NP5A 1E0BA 5C6AA 2EDGA 1CA5A 1CK1A 3M4OB 1PRTF 1BO0A 4IUNA 4NMZA 1YNND 3Q24A 2K01A 4HMJA 1XYIA 1TQOA 5E3FA 1OXUA 3DWQA 3H94A 2B2TC 3H09A 3C2PA 2Y0SB 1I4XA 4I65A 5IGEA 5J22A 4CBVA 2JEAI 2WV6D 4RA8A 5C5LA 4OGQC 1SMYD 1H9MA 1SYFA 3MWYW 1H9SB 1IYVA 4K6LA 1D6EC 1PRTB 3I73A 1HA5A 4X3SA 1EWHA 2R3ZA 2NTTA 3K5MA 1A2UA 1STYA 3NTHA 4CJ1B 1U9RA 2WACA 4ILWA 1BCPF 1B9NA 1KDCA 2QILA 3J81E 1RCVD 3C1EA 3J7YW 2B2UA 3TP8A 1KDAA 4A3DB 4O1NA 1EZ6A 2E74C 2RDFA 4NW2A 4TSSA 1DCZA 1O80A 3MVVA 4MHEA 3T4AC 1SNCA 5KRUA 5C0XJ 1SBBB 1STEA 1BF4A 1PLFA 4IUPA 1I4RA 1LTAD 3KBXA 2DN8A 3M3YB 5COYA 1AFPA 5CORA 3NWSA 3CQZB 1X3QA 3BYYB 1BR9A 1EQTA 1C48A 1MBYA 1LTBD 4KHZA 1II3A 4HCSA 2IT1A 4A3FB 2F0HA 1O7YA 1RHPA 2AQ1B 4XXEA 3RD4A 1F77A 1O78A 1T5XD 2O5JC 4XYQA 5CV4A 3OWEB 3SR1A 3KF8A 3K5LA 1C8CA 2K6AA 1ENAA 3X3MA 4XT1B 3K57A 4FVMA 1RTNA 1LLRD 4X3UA 2X6LA 1M8AA 2NWGA 4X3KA 1ICWA 1FD7D 2G9DA 3C1FA 3MZ5A 3VYSA 1EU3A 5IT9L 2DNCA 3MC0B 2QEJC 1U4PA 3DEOA 1PTOC 3RMHA 1DONA 1QG7A 1B44D 1EY7A 4KI0A 1DOMA 3F2UA 3PUWA 3OIPA 1U4LA 1D2BA 1X32A 2NVYB 1Z47A 1HTLD 5C3WA 4HSPA 4XQJA 1ZKOA 5IGBA 1IKMA 5EPJA 1W6JA 1S5CD 4DAPA 3PV0A 4DA2A 1I3QB 1Y8PB 2IJ0A 3CRKC 3D4DA 3S14B 4UAIA 2RDHA 4C2MB 1DZ1A 1F2MA 1BQQT 1SAPA 5KNDA 3BDOA 3LNNA 4IFDJ 4X3TA 2D5DA 3QB3A 3MTSA 3HOXB 4HTHA 5E1FA 2K32A 2CHBD 1NCVA 2XNAC 3GP7A 2AWNA 5EGTA 4RFBA 3VA7A 4XQQA 1Q1BA 2SDFA 5JPNC 1RF2D 4OIJA 2A69D 1NAPA 3L3OC 2ZXPA 4EGVA 4A3EB 4QUCA 1S5DD 5FO9B 3MHBA 4ULLA 3K58A 3TP7A 4DNTB 1JORA 1G291 3K5NA 5LL6X 3R2TA 1AN8A 2ZXRA 5FO8B 2B63B 1DOLA 1X3PA 2F4IA 3PUYA 2F0IA 2JA6B 5K36H 3PUVA 1EY4A 2RSOA 4IURA 2PZWA 1HPCA 2E2DC 4OO1H 3MXNA 1SJED 2JYOA 2E76C 1NR4A 4ID6A 3HZXA 1LABA 3J81L 3DWPA 2NN6I 3BDCA 1QCBD 4CGYB 2F0NA 2D2CC 1D1IA 2PZUA 5JAVA 4OL7A 1STNA 1Q12A 1LTSD 2FFKB 3FVQA 1I4GA 2I46A 4PMWA 5DEHA 5M5WB 1LTTD 4F8MA 3GV6A 3I4LA 2RDGA 2K05A 4C1NK 1QWYA 1F9RA 4OO1I 1DJRD 2A6HD 1IW7C 3RZOB 3G6JB 4RCNA 3KLSX 4M1UB 3Q6SA 1SNPA 4HR7B 5AFWA 2DY7A 4H7BA 2EVBA 5CYUA 1HA6A 2EY5A 2FJ2A 2XVSA 4QCLA 1SYCA 2F0EA 4HN7A 2A6EC 3HGBA 3QWNA 3QJYA 2B39A 4HCEA 5CMDA 1SE4A 2XSCA 4K5WA 2IPKD 1STBA 2PW5A 3U9SA 1F2ZA 3KBGA 2HDMA 1A6XA 1HTPA 3FPPA 4QF4A 4A3IB 5LHY1 3HP3A 3I8ZA 2L9HA 1CA6A 3VYRA 5I2YA 4FP5D 1JE4A 5M9OA 1ZYRC 3I3CA 3SK4A 3T13A 2EYFA 4RHSA 4KMUC 5K36G 4G7HC 2JA8B 3A7AB 2WB1B 1RJTA 4K8IA 1Q8IA 4H13C 2VUMB 4BBSB 2F03A 2L4NA 3QIAA 2SOBA 5JEAH 1U4MA 2MHVA 1E2WA 1AP0A 3OMGA 1OXXK 2VXWA 5K5PA 2B2WA 2XIWA 1S4ZA 2HCIA 1CQFA 5JVH3 4RGMA 1I6VC 2L11A 2NTSA 5IODA 2B2UC 3DEPA 3I72A 3DM1A 4L6TB 2NVXB 5JEAJ 2FMCA 4KV6A 2E2JB 2MJ8A 2FHTA 2WP8J 4U673 2L5TA 4CJ0B 1LT4D 4QIWB 4KHVA 1ET6A 4C3JB 1BNZA 1OXSC 1WD1A 3A54A 2ICIA 5CBAE 4AYBB 1CQVA 2DY8A 4A3JB 2BOSA 4DF7A 3NPPA 2O5IC 4ZUIA 1ZEQX 4LAAA 1QNUA 4KK7A 5DM73 2AUJD 3HOYB 2RKSA 1SYDA 4KKSA 1GOZA 3TN2A 4QUFA 3IFTA 3N52A 2EJGC 3W3AA 1KLGD 5I6WA 1RD9D 3GTKB 3DXJC 1CT1D 1F2LA 2D9UA 4PQXA 3OIQA 4Q5VA 3EFXD 3BVGA 4R8NA 4C3JG 1KNAA 5KGUA 3AU7A 1OXTA 5EJWA 3NWTA 2KA7A 3IFDA 4RKLA 1Y8NB 3O13A 2NYZD 4L8JA 1SYEA 3K6OA 3SE0A 1TIID 4ZUJA 2YU9B 5FO7B 2XRSD 4KY6A 3HG9A 3S1NB 1TU2B 2F0LA 4U68A 3SEBA 1LTRD 2EYLA 1DXMA 4IUVA 1JC7A 1UUPA 4RH6A 3HKZB 2O4XA 3J80L 1PRTC 2RQXA 5C3XA 3I91A 5I9OA 2PW7A 1TWAB 1HUNA 5C4XB 2F0KA 1XXGA 4TRDA 4LJZC 2AQ3B 2L1BA 4L63B 4LK1C 1CTMA 3NE5B 4FXKC 2R61A 1EIGA 1PTOD 1B50A 2A5HA 1JWMD 3MXPA 2FINB 2F0SA 4KTAA 5I6YA 4IZ8A 1JCKB 5C0XH 5BN5A 4K5VA 1SE3A 3J7AF 4ZKCB 3U9OA 4DNRB 3BG3A 2EY2A 3M7GA 1GUTA 1JWUD 3DMUA 1TR5A 2NBFA 4LMQD 3SVMA 2KECA 4RGTA 4J1MA 5CV7A 1HUMA 1KDBA 1MGSA 2MPMA 5DM63 4K5XA 5EPKA 5CC4A 1A3TA 3VA5A 4G57A 3E5SA 4XYOA 2KCCA 5D3IB 3RUZA 1BCPB 1JQYD 5C0XI 4JK1C 3IL8A 2JSOA 3TBIB 1V43A 2DNEA 3H3VC 4MIUA 1WD0A 1R9TB 2F3VA 2OT2A 4RHRA 1CHPD 1GHKA 5EBCA 3LWEA 1K8MA 5KIXA 3GO5A 4KKUA 3A8JE 2A73B 1I4QA 4G7ZC 2X6GA 1IYUA 1STGA 1XWEA 4BA2I 2F3WA 1UNSA 3NQIA 1PTOH 1BUVT 1Y69U 1VF7A 4RAUC 5IIFA 5EKIA 1F9QA 2R93B 1WTQA 2JA7B 5FOBB 2BDNA 1Z7TA 4FF1A 3ND8A 3S1MB 4MN3A 1LT5D 1Q90A 1EIHA 2PYKA 3CKIB 1S5ED 1Y1WB 1ET9A 4DK1A 1B53A 2IWHA 5KYIA 3I4NB 4ABNA 1PTOF 4IFDH 2OXPA 3NTKA 2QCPX 1AEXA 4DXGA 2IX3A 2OF1A 1RDPD 2A74C 5ELDA 5DNFA 4S3SA 1G2SA 1EFID 4KJOA 3JAME 2IW3A 1TWCB 5C0XG 1QJOA 2D62A 3D4WA 1O7LA 1KTKA 1TWHB 1EY6A 1GUSA 2K5WA 4RCOA 2EJFC 1JWSD 1K8OA 2EY6A 2EOTA 4A3BB 3TZDA 4NDXA 1F9SA 5DAUA 1DOKA 2XWBB 3NBHA 4PNYA 1IW7D 1VCIA 3TP5A 2F0GA 3S16B 5HURA 1QE6A 1Y8OB 3HOUB 2KEDA 3TP6A 1IKLA 3M4YA 1EY0A 1SEBD 3OMCA 5D3DA 1HFNA 2BCOA 1LACA 1HXYD 2QKIC 4IFDI 3ONAB 1TY0A 1ZXTA 2KVMA 2NN6H 2B2WC 1G6ZA 3ITPA 2A6ED 1E2VA 3VYUA 3NP8A 3VR5A 1KNEA 2F0UA 3GQBA 3A8KE 3FRPB 5A2QE 4ZQ3A 2KQ3A 3GTMB 3MA2B 3WOFA 1HHVA 4FO2A 1B2TA 5IGFA 1HFGA 2MUYA 3S9WA 3OW7A 5M5YB 1CZGA 2BA1A 4K8JA 1G2TA 4O42A 1DD2A 5G3LD 3TMEA 2OEOA 2BE5C 3OSOA 1U4RA 3FMCA 1ZYRD 1CZWA 1GUGA 4QMGA 1PZID 1F2YA 2KUMA 3SXHA 4RGOS 3D6CA 3CRLC 2NVQB 3DUZA 1C4QA 2E75C 4DAVA 5KEEA 2R92B 3K5OA 2WINB 2JXMB 4PV1C 4DN4M 5D14A 1KABA 4ZRZA 2N55A 3HOWB 5ELEA 4IFDG 3PMFA 4FF2A 2PZTA 1RODA 2C5CA 1RTOA 2TSSA 3MEHA 1TWFB 1I4PA 1W6KA 3KUPA 3MFYA 2NZ1D 1PFNA 4WRDA 3E0JA 2Q8IB 4F87A 3H91A 5E4XA 4KN4C 2V4DA 2F1MA 1V8QA 2H4OA 1B9MA 2M00A 1EYCA 2YYZA 3KK7A 3BDLA 1WTVA 3OWFA 2B2VA 3QOLA 4ZAIA 1SXTA 1JR0D 5CV6A 3BS1A 2NN6G 1SE2A 2K33A 2EE1A 5JJZA 2Z4HA 4A93B 5J1ZA 3HOZB 4K2LA 1EWCA 3Q23A 1FNVA 4XIGS 4BY7B 4DU9A 4E6IA 5G3LF 3J7AV 5CGKA 4G4KA 4C1NI 2MGSA 4OO1G 3I70A 5LL6S 3RLFA 1MSGA 3VYTA 3GD7A 2AUKA 2XRQD 3MFGA 4BY1B 3D4RA 2K7VA 4I7ZC 1JOQA 3BYTB 4ODGA 3T56B 2WKCA 1CHQD 3T16A 2EPBA 5BN3A 2J0TD 2K5DA 2N88A 3GV3A 2M9VA 5T1GA 1H9KA 3SHLA 1BDOA 1B1ZA 5C3EB 1PRTD 1V1OA 4CKCA 1FNUA 3FDTA 3Q22A 4KY7A 3WDNA 5CV8A 5A2QL 3W2DA 2CW0C 4F88A 3H6MA 2F0JA 5JPMC 1DYQA 1HQMC 1LTGD 4KY5A 3NUCA 3T53B 3V96A 4BWGB 3S1QB 1L0XB 1LT3D 1PDQA 2WKDA 1EYAA 3GTGB 1XTCD 1H9JA 1ESRA 5FLXE 3NXWA 2Z4IA 1YNJC 3CU7A 1BXTA 1SSOA 5KNCA 3SK5A 3LWUA 1UAPA 4HEDA 5EKKA 1SNDA 2F0TA 3L9AX 5A35A 3IAYA 5IT9E 2CVRA 1S5FD 5ELCA 2LKVA 4HSVA 1JICA 3GTJB 1A3UA 2AWOA 1J8IA 1WVLA 4EQOA 2EXZA 3D3RA 3K7AB 1EEFD 4IUTA 5EBDA 1V1PB 3LX0A 5E4WC 1WTXA 5EQ0A 1EL0A 2JA5B 2AQ2B 1GXDC 3NBIA 1KLUD 1WTWA 5JEAG 5JOBA 1O7ZA 2M2LA 3PUZA 2B8GA 1AZQA 2IL8A 2KEEA 4PMCA 2FMMA 4KN7C 4IUUA 3K59A 1HQRD 2KJXA 5IGCA 3M85A 4IUQA 3A7LA 3A8IE 3TSSA 1QOHA 2ZXOA 1TT2A 3S2HB 2Z8LA 3P20A 1QB5D 1I6HB 3HRZC 2RVLA 1I4HA 2PNRC 3R2IA 5IOCA 1ENFA 1D5XC 3I4MB 2BA0A 3P75A 5CV9A 5ELFA 1KAAA 3VR4A 3I90A 2K04A 4IALA 3PO2B 4BA1I 1G8ZD 2A68D 3C3LA 2JEBI 1XX8A 1WCMB 4J6HA 4B9XA 2EYMA 5BN4A 4HMIA 1BCPC 2ENBA 4FXDA 1QNKA 5EPLA 1L0YB 2GA4B 2EZVA 2R7ZB 2B8FA 2NUCA 4CJ2C 3P7JA 2LFNA 1ML0D 4PMBA 4H0LC 3A55A 5I9PA 2ICEC 2F0OA 4HAEA 1NR2A 4WORA 2CQAA 1EOTA 2K28A 5J39A 3UI2A 1EEID 1FYCA 3M7NA 2XWJB 2X69A 3C46A 1GHJA 1J9OA 2QDBA 3R93A 1GJXA 5KNBA 3KLRA 1V1PA 2HCCA 1VF5C 4RWSC 1TS5A 3MXGA 1EY8A 1I50B 3OPOA 1YNNC 3S15B 1HCZA 4XDXA 5TSSA 2MP1A 5IGDA 3FEWX 3HEJA 3RZDB 4J8QA 5FLXL 2PPBC 1MD2D 5I2XA 2BE5D 5EKLA 1FGBD 1Y1VB 1ESFA 2IX0A 2RA4A 2B2VC 3X3NA 2SEBD 1PZJD 2PMZB 1IHZA 4KKTA 2A68C 3SK8A 4RKBA 3AMUA 3HOVB 1SMYC 1SYGA 4C3IB 3P1HA 4BS9A 1SYBA 1RKNA 2G9HD 2PO4A 1E2ZA 3V05A 1R4PB 4CKEA 4EQPA 2BDOA 2J7ZA 5F2DA 1GUWA 4H44C 3SK6A 1OXVA 1JB3A 3GTQB 3S2DB 2B2YA 2EYPA 2QF7A 3DHQA 2I07B 4Y7NB 1AZPA 1EYDA 3NHHA 1PTOB 1PZKD 1NUCA 1D5MC 1TKWB 5M3FB 3SDZA 1H9SA 3NQTA 2R6GA 3PUXA 2HUGA 5C4JB 3AB9A 3NTIA 2ZT9C 3ND9A 4V190 2IX1A 3ERQA 1EZ8A 4DFAA 1PFMA 1EQVA 2EYJA 2B2TA 4K14A 4C3IG 1LO5D 2EJMA 4WFN3 3V2TA 4P2CB 3BZDB 4EVOA 4ZYSA 2C9OA 5C4ZA 4FF4A 4B08A 1DM0B 4XT3B 4C56C 1SDFA 3FKIB 4EQNA 4XTCS 2H1EA 2EYHA 3OHXC 1LTID 1CI3M 1A3VA 3ZYYX 4YIJA 1JOOA 3NSWA 3EQLC 1TY2A 4C3HB 4UDUC 1MSHA 5HGTA 1K83B 2WAQB 1AW7A 2F0FA 2RBMA 4CHTB 4G7OC 4FXGC 1GUNA 1VMPA 5CBEE 1S5BD 2J4XA 2JP1A 4XQNA 3FPUB 4KD4A 1SFOB 4ZKBB 4FNFA 3Q0AA 2LMCB 2HQEA 3DWAA 3PIP3 5FK9C 3EJIA 2WIIB 3MAQA 2NVTB 2L12A 4RGNA 3S1RB 3NK9A 3CHBD 4BBRB 2K5QA 3URYA 4TKOB 5M3MB 4WJWA 1WTPA 2PQEA 4C3HG 3K0YA 2HDLA 3G7LA 4QB4A 1R4QB 1SNMA 5M5XB 3QG1A 5T1IA 1PYWD 2LY7A 1H9RA 2E2IB 2CW0D 2VB3X 5CV5A 1BOSA 1STHA 1LT6D 3GTLB 3T51B 3HS0C 5ELBA 2E2HB 3VR6A 2L0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D6C A;  4N9T A;  1JOK A;  2EYH A;  4S3S A;  4E6I A;  1STA A;  4KJO A;  1SYE A;  4J1M A;  5CGK A;  1A3V A;  5KEE A;  4ZUJ A;  5EKK A;  4IUN A;  4NMZ A;  1SND A;  5EGT A;  2F0T A;  3D4W A;  5CV7 A;  1IHZ A;  3ERO A;  4HMJ A;  4J6H A;  4YIJ A;  1KDB A;  4RKB A;  1JOO A;  5NUC A;  3SK8 A;  4B9X A;  5C4H A;  1II3 A;  1EY6 A;  5IOD A;  4K5X A;  5CC4 A;  2EYM A;  1A3T A;  1TQO A;  5E3F A;  2EY6 A;  4HMI A;  3VA5 A;  5HGT A;  4G57 A;  2F0H A;  4KY6 A;  3E5S A;  1KAB A;  1SNP A;  1SYG A;  4H7B A;  2F0L A;  2LKV A;  2ENB A;  4NDX A;  3P1H A;  5DAU A;  3PMF A;  1A3U A;  1SYB A;  4KV6 A;  1RKN A;  4I65 A;  2F0F A;  3RUZ A;  3MHB A;  4PNY A;  2EY5 A;  2PZT A;  2RBM A;  4EQO A;  2EXZ A;  2EYL A;  3TP5 A;  2F0G A;  3TP7 A;  5IGE A;  5CV4 A;  5HUR A;  5J22 A;  1JOQ A;  2F0D A;  3SR1 A;  5C5L A;  1SYC A;  4EQP A;  1ENA A;  2F0E A;  4KHV A;  4ODG A;  3TP6 A;  3MEH A;  5F2D A;  1JOR A;  2NUC A;  3LX0 A;  2O4X A;  4K2K A;  1EY0 A;  2F0V A;  3T16 A;  4MIU A;  5C3X A;  3OMC A;  3R3O A;  3SK6 A;  2F3V A;  4KD4 A;  5I9O A;  1SYF A;  4PMB A;  3C1F A;  2KHS A;  3MZ5 A;  4WRD A;  2PW7 A;  4DF7 A;  4K6D A;  4DGZ A;  5JOB A;  2HQE A;  2SNS A;  1A2T A;  5I9P A;  4K5W A;  2F0W A;  4ZUI A;  4B9W A;  5KIX A;  1STB A;  2EYP A;  1SNO A;  2F0I A;  2PW5 A;  3DHQ A;  3EJI A;  4NKL A;  4LAA A;  3ITP A;  2F0M A;  2F0K A;  2F0O A;  3SHL A;  5ISR A;  1A2U A;  3NP8 A;  1EY5 A;  2M00 A;  1EY4 A;  1STY A;  1EYC A;  1EYD A;  1F2Z A;  1SYD A;  2RKS A;  1U9R A;  2WAC A;  2F0U A;  2PZW A;  1EY7 A;  3NHH A;  3QOJ A;  4PMC A;  1STG A;  4QF4 A;  3BDL A;  4TRD A;  2F3W A;  3OWF A;  1NUC A;  3NK9 A;  4WOR A;  5J39 A;  4KY7 A;  3D8G A;  3QOL A;  2KQ3 A;  4ZQ3 A;  1KDC A;  4ME5 A;  5I6W A;  3NQT A;  3C1E A;  4ID6 A;  4F7X A;  5IGC A;  3HZX A;  5IIF A;  5C5M A;  4N9P A;  5CV8 A;  3TP8 A;  1SNQ A;  5C3W A;  1KDA A;  4KJN A;  5M9O A;  5IGF A;  2PQE A;  2F0J A;  3H6M A;  5IGB A;  5CV6 A;  2QDB A;  3ERQ A;  1EZ8 A;  1EZ6 A;  3BDC A;  4DFA A;  4KY5 A;  5IGG A;  2RDF A;  1EQV A;  3MXP A;  2EYJ A;  4QB4 A;  3S9W A;  2F0S A;  3NUC A;  4K14 A;  1ENC A;  2EYF A;  4KTA A;  3SK4 A;  3T13 A;  5KYL A;  2F0N A;  5CR3 A;  1TT2 A;  3MVV A;  2PZU A;  1SNM A;  3V2T A;  4K8J A;  5I6Y A;  4IZ8 A;  3EVQ A;  5JAV A;  3TME A;  1SNC A;  3D4D A;  5KRU A;  4KD3 A;  2OEO A;  2PYK A;  4EVO A;  4K5V A;  4K8I A;  3OSO A;  5C4Z A;  2F0Q A;  4OL7 A;  2EYO A;  2F0P A;  5CV5 A;  3U9O A;  5IOC A;  5J1Z A;  1EYA A;  1EY8 A;  1STN A;  1F2M A;  1STH A;  4R8N A;  4K2L A;  2EY2 A;  5KYI A;  2SOB A;  2SNM A;  3P75 A;  5KGU A;  5CV9 A;  4QMG A;  5IGD A;  3DMU A;  4RKL A;  2OXP A;  1F2Y A;  1TR5 A;  3NXW A;  3SXH A;  1KAA A;  3HEJ A;  3OMG A;  1AEX A;  1NSN S;  5DEH A;  2OF1 A;  3QB3 A;  1EY9 A;  2EY1 A;  4IAL A;  4NP5 A;  4HTH A;  4EQN A;  4F8M A;  5EKL A;  5K5P A;  5C6A A;  5E1F A;  3SK5 A;  4DU9 A; 
#chains in the Genus database with same CATH topology
 1SJH D;  2A69 C;  1QIL A;  5IY0 A;  4JI6 L;  3J80 E;  1TVX A;  3BVZ A;  3D0F A;  1LV9 A;  4JI3 L;  3BZK A;  2L55 A;  1NTG A;  5AJ3 L;  5JVG 3;  2RSN A;  1YNJ D;  4BBR G;  3CC2 A;  1PMR A;  2LXK A;  3GTP B;  2Z6B A;  4R8I A;  4DNI A;  1XMO Q;  5M3M G;  4LF4 Q;  5I4D A;  4TQU S;  5JJI A;  1B4O A;  1YHQ A;  2K03 A;  1U5K A;  1CM9 A;  4IQZ A;  1OO9 B;  2F0V A;  5FKA C;  2KCN A;  3JAM L;  1VDZ A;  4IOC A;  1S72 A;  1EWI A;  3S24 A;  2PQA B;  4RMF A;  1TS2 A;  2KHS A;  3OOC A;  1ASZ A;  3WOE A;  4K6D A;  4DGZ A;  4GZY C;  4A3J H;  3MXU A;  1YJN A;  4OIK A;  1KHI A;  2F0W A;  4GN4 B;  1P16 A;  1GO3 E;  1B70 B;  4NKL A;  4DK0 A;  2VB2 X;  5C44 B;  1N32 L;  1IL8 A;  1GUO A;  1D5Z C;  1EY5 A;  3QOJ A;  3HOY H;  3A74 A;  2K1B A;  3EA6 A;  3PO3 B;  4A3G B;  2NB0 A;  4R9W A;  4UP7 A;  1RIP A;  3PGZ A;  2CH4 A;  4DXF A;  1DGS A;  4F7X A;  4A3C H;  1CKN B;  4V0B A;  1MI2 A;  5C5M A;  4N9P A;  4DKA C;  1VS0 A;  4YCV A;  1SNQ A;  4KJN A;  4ZCK A;  3TZU A;  1WTR A;  1TWG H;  1X6O A;  1HRJ A;  3GTO B;  4DAY A;  3OW2 A;  1ENC A;  5CR3 A;  1FVI A;  3QO2 A;  3S17 H;  3EVQ A;  2LS0 1;  4KD3 A;  4R4I A;  2KOL A;  1GD7 A;  2Z1C A;  3K8A A;  2UXB Q;  2F0Q A;  3D6W A;  1QZG A;  4DR4 Q;  2EYO A;  4M8A A;  3TDQ A;  4GOP A;  2CWP A;  1BBX C;  1YHA A;  4FF3 A;  2A6H C;  4JI7 Q;  4FYD A;  1PXU A;  5D65 A;  3VR3 A;  1FNW A;  1WTO A;  1NSN S;  3E6Z X;  1EY9 A;  2EY1 A;  4B3M Q;  2O2L D;  1V9P A;  1FR3 A;  2MO1 A;  1TS4 A;  4N9T A;  1JOK A;  2F52 A;  1STA A;  1ONL A;  3CAM A;  4WJ3 M;  1VMC A;  4LFA Q;  3K80 C;  5C44 G;  3ERO A;  5C4H A;  1ILQ A;  3RLO A;  5NUC A;  2Q2I A;  4EX5 A;  3PO3 G;  4A3G G;  1Q1E A;  3N6R A;  4Z9C B;  2TMP A;  1XMQ Q;  3S1N H;  1M4V A;  4GLV B;  4A3K H;  2JE6 I;  2NZH A;  3VR2 A;  2F0D A;  1F9P A;  4JV5 L;  1PFB A;  4K2K A;  4A3M B;  1BCP D;  4DV3 L;  2ID0 A;  3WWV A;  3BZC A;  3D31 A;  3R3O A;  1TS3 A;  2VNU D;  1Q82 C;  1TWG B;  2XN9 C;  1QVF A;  4Q0F A;  1J5E L;  2Q8T A;  1S3O A;  2KCM A;  2SNS A;  1A2T A;  1A15 A;  1D1K A;  1TWA H;  4L5Q A;  4B9W A;  4DV1 Q;  4HIO A;  3S17 B;  1SNO A;  1QUQ B;  1Q3L A;  2F0M A;  2PCF B;  4P74 A;  5ISR A;  4ME5 A;  5C4X H;  4GKK Q;  5KYL A;  3BVM A;  3Q8D A;  4FDB A;  4ZK9 B;  1EU4 A;  3D8G A;  2HIX A;  3CCJ A;  4AQY Q;  3IKJ A;  2YTY A;  1PH4 A;  1KQS A;  1VQH A;  1S40 A;  4ZLT F;  1VQD A;  1UEA B;  2UXD L;  5IGG A;  1WOC A;  4LF9 L;  2KBN A;  3FHW A;  1B3A A;  3A56 A;  2OWO A;  3L7Z C;  1PVO A;  1J6Q A;  3H0G B;  2Q8R E;  1YIT A;  1CFM A;  3KF8 B;  2AMC B;  4OHJ A;  1G91 A;  2F0P A;  3R8B A;  4POG A;  3KLS A;  3PIO 3;  3GDE A;  3J81 c;  4DV4 Q;  1Z6H A;  4CKB A;  4A3C G;  2SNM A;  5ELN A;  4A3M G;  1T5E A;  4IN3 A;  4JBW A;  2B2Y C;  1YNX A;  4A3K B;  1ILP A;  4NP5 A;  1E0B A;  4UY8 C;  5C6A A;  2EDG A;  2MQH A;  4O0A A;  1CA5 A;  4JYA Q;  1CK1 A;  3M4O B;  5IP7 G;  1PRT F;  1BO0 A;  4IUN A;  4NMZ A;  1YNN D;  3Q24 A;  1CKN A;  2K01 A;  4HMJ A;  3STB C;  1N34 L;  1XYI A;  1TQO A;  5LMN Q;  5E3F A;  4DV6 L;  1VQM A;  1OXU A;  3DWQ A;  3H94 A;  1GVP A;  2B2T C;  3H09 A;  3C2P A;  2Y0S B;  3M3Y H;  1I4X A;  4I65 A;  3TS0 A;  3U58 A;  5JJK A;  5IGE A;  5J22 A;  4CBV A;  2JEA I;  2WV6 D;  4RA8 A;  5C5L A;  4OGQ C;  4P73 A;  1SMY D;  1Z9F A;  1KD1 C;  3H0G G;  1H9M A;  1SYF A;  1R9T H;  3MWY W;  1H9S B;  2YV5 A;  1IYV A;  4K6L A;  1D6E C;  1PRT B;  5IYD H;  3I73 A;  1HA5 A;  4X3S A;  1EWH A;  2R3Z A;  2NTT A;  3K5M A;  1A2U A;  4A3K G;  1STY A;  3NTH A;  4CJ1 B;  1U9R A;  2WAC A;  4ILW A;  4BXX H;  4OWT B;  3ZJY C;  1BCP F;  1B9N A;  1KDC A;  2QIL A;  3J81 E;  2F4V L;  1RCV D;  1UE5 A;  3C1E A;  4DV5 Q;  3J7Y W;  3G48 A;  2B2U A;  3TP8 A;  1KDA A;  2VQF L;  4A3D B;  2R93 H;  4O1N A;  1EZ6 A;  2E74 C;  4JI6 Q;  1VQF A;  2RDF A;  1HZC A;  2ZTE A;  1DCZ A;  4NW2 A;  4TSS A;  4NXN L;  3S1M H;  1O80 A;  3MVV A;  4MHE A;  4JI3 Q;  2Y0S G;  3T4A C;  1SNC A;  5KRU A;  5C0X J;  5AJ3 Q;  4HJ7 A;  1BBW A;  1LYL A;  4X62 L;  1SBB B;  1STE A;  1Y1W H;  1EUJ A;  1BF4 A;  1PLF A;  4IUP A;  1I4R A;  1LTA D;  2K14 A;  3KBX A;  1EOV A;  2DN8 A;  2NVY H;  5GAE C;  3M3Y B;  5COY A;  1QUQ A;  2RHQ B;  1AFP A;  5COR A;  3NWS A;  3CQZ B;  1X3Q A;  1PH5 A;  3BYY B;  1BR9 A;  1EQT A;  3J7Z C;  1C48 A;  1WYD A;  1TWC H;  4QL5 A;  5L37 A;  1MBY A;  1LTB D;  1K3R A;  4KHZ A;  1II3 A;  4C2M H;  4HCS A;  1TWH H;  1KXL A;  1NNX A;  5GAG C;  4LUO A;  1L1O B;  1IBK Q;  2IT1 A;  4A3F B;  2F0H A;  1O7Y A;  4A3B H;  1N32 Q;  1HNX L;  1RHP A;  2AQ1 B;  4XXE A;  3RD4 A;  1F77 A;  2IY5 B;  1O78 A;  4A3D G;  2V1C C;  1T5X D;  3UDG A;  2O5J C;  4XYQ A;  1CSP A;  5CV4 A;  3OWE B;  3SR1 A;  3KF8 A;  3K5L A;  3S16 H;  1C8C A;  2K6A A;  1ENA A;  3X3M A;  4XT1 B;  3K57 A;  3HOU H;  4FVM A;  1RTN A;  1LLR D;  4X3U A;  2X6L A;  1M8A A;  2NWG A;  4X3K A;  3K7U C;  1ICW A;  1FD7 D;  1B8A A;  2G9D A;  2UXB L;  3C1F A;  3A0J A;  3MZ5 A;  1MIU A;  3VYS A;  1EU3 A;  1SE8 A;  5IT9 L;  2DNC A;  2PI2 E;  3MC0 B;  2QEJ C;  1U4P A;  3DEO A;  1PTO C;  3RMH A;  1XTD A;  4DR2 L;  1SRU A;  1QG7 A;  1DON A;  1B44 D;  5EAY A;  1EY7 A;  4KI0 A;  1DOM A;  3U50 C;  3F2U A;  3PUW A;  3NEN A;  4OX9 L;  4PZ7 A;  3CC7 A;  3OIP A;  1HR0 Q;  3UDI A;  1U4L A;  1D2B A;  3GTM H;  2PMZ E;  4LFA L;  1X32 A;  2NVY B;  3F1Z A;  1Z47 A;  1HTL D;  5C3W A;  1VQ9 A;  3M4P A;  4HSP A;  4XQJ A;  1ZKO A;  1C9O A;  5IGB A;  2XTI A;  1IKM A;  2B63 H;  4A3F G;  5EPJ A;  3CMA A;  1W6J A;  4JI8 Q;  2CH4 W;  1S5C D;  4DAP A;  3PV0 A;  4DA2 A;  1I3Q B;  5M5Y H;  1Y8P B;  2IJ0 A;  3CRK C;  3D4D A;  3S14 B;  4UAI A;  2RDH A;  4HJA A;  4C2M B;  1DZ1 A;  3FP9 A;  1F2M A;  3DM3 A;  4J15 A;  1BQQ T;  4DAM A;  1SAP A;  5KND A;  3BDO A;  1JB7 A;  3LNN A;  2R93 G;  4IFD J;  3TRZ A;  4X3T A;  2D5D A;  3QB3 A;  4JV5 Q;  3MTS A;  3HOX B;  4HTH A;  5E1F A;  5IP9 H;  2K32 A;  4DV3 Q;  2CHB D;  1A63 A;  1NCV A;  2XNA C;  2NVQ H;  3GP7 A;  2AWN A;  2ASB A;  2Z6K A;  4RFB A;  5EGT A;  3VA7 A;  4XQQ A;  1HH2 P;  1Q1B A;  4O2D A;  4GKK L;  3CCU A;  1J5E Q;  2SDF A;  1BKB A;  5JPN C;  1RF2 D;  1PA6 A;  1EQQ A;  4OIJ A;  1A8V A;  4AQY L;  2A69 D;  1NAP A;  3L3O C;  1NMF A;  2ZXP A;  4EGV A;  4A3E B;  4QUC A;  1S5D D;  5FO9 B;  3MHB A;  1EIY B;  4ULL A;  3K58 A;  5M5W H;  3TP7 A;  3CCQ A;  4DNT B;  4JBJ A;  4LUZ A;  4GOP C;  2UUA L;  1JOR A;  4IJH A;  1G29 1;  3K5N A;  1TWF H;  2UXD Q;  5LL6 X;  3R2T A;  1AN8 A;  2ZXR A;  4LF9 Q;  5FO8 B;  1G6P A;  2B63 B;  4JBK A;  4JI0 L;  1DOL A;  1X3P A;  2F4I A;  3PUY A;  2F0I A;  2JA6 B;  4I7A A;  3L2P A;  2OTJ A;  5K36 H;  3PUV A;  1EY4 A;  2RSO A;  4IUR A;  1N33 Q;  3HOX G;  2PZW A;  1HPC A;  2E2D C;  4OO1 H;  4K0K L;  3MXN A;  1SJE D;  2JYO A;  2E76 C;  1NR4 A;  3AQQ A;  4ID6 A;  1L1O A;  1N8R C;  3HZX A;  3LGJ A;  1SRO A;  3KFU A;  4GOP B;  1E1O A;  1LAB A;  3NEM A;  3J81 L;  3DWP A;  2NN6 I;  3BDC A;  3CCM A;  1M1K C;  1QCB D;  4UP8 A;  4CGY B;  2F0N A;  4DK3 C;  2D2C C;  1D1I A;  2WAQ E;  2PZU A;  2CFM A;  4A3E G;  1X65 A;  1N34 Q;  5JAV A;  3PF5 A;  1VQ6 A;  3CCE A;  1N9W A;  4OL7 A;  4DV6 Q;  4A3I H;  1K8G A;  1STN A;  1Q12 A;  5HGQ A;  1E3P A;  3HOZ H;  1LTS D;  5FLM G;  2FFK B;  3FVQ A;  1I4G A;  2I46 A;  2JQO A;  4PMW A;  4B3T L;  3CD6 A;  5DEH A;  4PZ8 A;  5M5W B;  1LTT D;  1O7I A;  4F8M A;  2B63 G;  3GV6 A;  3I4L A;  2RDG A;  2K05 A;  4BY7 H;  4C1N K;  1QWY A;  1F9R A;  4OO1 I;  1DJR D;  2JA6 G;  1I94 L;  2A6H D;  1IW7 C;  2PNH A;  4YY3 Q;  2I5M X;  2JA8 H;  3RZO B;  1PH9 A;  2MO0 A;  3G6J B;  1IBM L;  2UUC L;  2VUM H;  4RCN A;  3KLS X;  4M1U B;  3Q6S A;  1SNP A;  4HR7 B;  5AFW A;  2DY7 A;  4H7B A;  2EVB A;  3G4S A;  5CYU A;  1HA6 A;  2EY5 A;  2HD3 A;  2FJ2 A;  2XVS A;  4QCL A;  3IRB A;  1HZ9 A;  2JN4 A;  2F4V Q;  5GQO A;  1SYC A;  1L2F A;  2F0E A;  4HN7 A;  2A6E C;  1Q81 C;  2C35 B;  1A62 A;  4UPA A;  4L5R C;  3HGB A;  2VQF Q;  1B7Y B;  3QWN A;  2CCZ A;  3QJY A;  4NXN Q;  2B39 A;  4HCE A;  5CMD A;  1HJP A;  1SE4 A;  1IL2 A;  2XSC A;  4K5W A;  2IPK D;  2NVX H;  1STB A;  2PW5 A;  3CME A;  2NZO A;  1TXY A;  3U9S A;  2E2J H;  2GN5 A;  4X62 Q;  1F2Z A;  3KBG A;  2HDM A;  1A6X A;  1HTP A;  3FPP A;  4QF4 A;  5C3E H;  4A3I B;  1VQ7 A;  3UDF A;  5LHY 1;  3HP3 A;  3I8Z A;  2HQL A;  2L9H A;  1CA6 A;  4C3J H;  3VYR A;  1UE7 A;  5I2Y A;  1VQI A;  3OYY A;  4FP5 D;  2A1A A;  3W1B A;  1JE4 A;  5M9O A;  4HIM A;  4HJ5 A;  1ZYR C;  3I3C A;  1NJI C;  3SK4 A;  3T13 A;  2EYF A;  1IBK L;  4RHS A;  4KMU C;  3CP0 A;  5K36 G;  4G7H C;  1AE3 A;  3S1Q H;  2JA8 B;  3A7A B;  2WB1 B;  1RJT A;  4K8I A;  4R4C A;  1Q8I A;  2I5H A;  4H13 C;  2VUM B;  4BBS B;  1HNX Q;  2F03 A;  2L4N A;  2Z0S A;  3GTG H;  3QIA A;  3F2B A;  2SOB A;  5JEA H;  1U4M A;  3M9B A;  2MHV A;  1E2W A;  1AP0 A;  3OMG A;  1OXX K;  2VXW A;  3BU2 A;  3GTK H;  5K5P A;  1LTL A;  2B2W A;  2XIW A;  4HJ8 A;  1S4Z A;  2HCI A;  1CQF A;  5JVH 3;  4RGM A;  1I6V C;  1X55 A;  1PH6 A;  2L11 A;  2NTS A;  5IOD A;  2B2U C;  3DEP A;  1VQ8 A;  4A3I G;  3I72 A;  2UU9 L;  3AYH B;  1HR0 L;  3HOZ G;  3DM1 A;  4L6T B;  2NVX B;  5JEA J;  1PYS B;  2FMC A;  4DR2 Q;  4KV6 A;  2P5Z X;  2E2J B;  3GTJ H;  2MJ8 A;  3AFQ A;  4R4O A;  4OX9 Q;  2FHT A;  2WP8 J;  2ZTD A;  4U67 3;  3STB D;  2L5T A;  4CJ0 B;  1LT4 D;  4IPH A;  2D0P A;  4QIW B;  4KHV A;  1ET6 A;  4C3J B;  4JI8 L;  1BNZ A;  1OXS C;  1WD1 A;  3T1Y L;  3A54 A;  2JA8 G;  2YU9 H;  2WB1 G;  2F3I A;  2ICI A;  5CBA E;  4AYB B;  1CQV A;  2JA5 H;  1X54 A;  2VUM G;  2DY8 A;  4A3J B;  2BOS A;  4DF7 A;  1HNZ L;  4BBS G;  2R7D A;  3NPP A;  5IYB G;  1N36 L;  3KJP A;  2O5I C;  4ZUI A;  1ZEQ X;  4LAA A;  1QNU A;  4KK7 A;  5DM7 3;  2AUJ D;  4GS3 A;  3HOY B;  2RKS A;  1SYD A;  4KKS A;  1GOZ A;  3TN2 A;  3K0X A;  4QUF A;  3IFT A;  3N52 A;  2EJG C;  4OXP A;  4N8F A;  2QDL A;  3W3A A;  1KLG D;  3J81 j;  5I6W A;  1RD9 D;  3KF6 B;  4OWW B;  3GTK B;  1YEZ A;  3DXJ C;  1CT1 D;  1F2L A;  1M90 C;  2D9U A;  2QGQ A;  4PQX A;  3OIQ A;  4P71 A;  3S2H H;  3CF5 A;  3PF4 A;  4Q5V A;  4KLK A;  4JOI A;  4OON A;  3EFX D;  5J3B A;  3BVG A;  2VQE L;  4R8N A;  4C3J G;  1KNA A;  5KGU A;  1V1Q A;  3AU7 A;  1OXT A;  5EJW A;  3NWT A;  2KA7 A;  3IFD A;  4RKL A;  3CW2 C;  1UE6 A;  1Y8N B;  4AYB G;  3NEL A;  2DGY A;  4A3J G;  3O13 A;  2NYZ D;  4GKJ Q;  4DUY L;  4B3S L;  4L8J A;  2UUA Q;  3PO2 H;  1IBL L;  1SYE A;  3K6O A;  3SE0 A;  3CCR A;  1TII D;  4ZUJ A;  2AHO B;  4NXM L;  5DLQ E;  2YU9 B;  2VW9 A;  1VQA A;  3HOY G;  3VDY A;  1WCM H;  4JVZ A;  1N33 L;  5FO7 B;  2XRS D;  4JI0 Q;  1KRT A;  4KY6 A;  2HT1 A;  3HG9 A;  1X3F A;  3S1N B;  1TU2 B;  2F0L A;  4DR5 L;  4U68 A;  4X6A H;  3SEB A;  1KRS A;  1LTR D;  4GNX B;  2CKZ B;  2EYL A;  4K0K Q;  1DXM A;  4IUV A;  1JC7 A;  4Y52 H;  1UUP A;  3EN2 A;  4RH6 A;  3HKZ B;  2O4X A;  3J80 L;  1PRT C;  2RQX A;  5C3X A;  3I91 A;  5I9O A;  4IJL A;  1X56 A;  2PW7 A;  1TWA B;  3AFP A;  4OWX B;  1HUN A;  1XNQ Q;  5C4X B;  2F0K A;  4DK6 C;  1XXG A;  2K4K A;  4TRD A;  3ULJ A;  4LJZ C;  2AQ3 B;  3CCL A;  3JC6 6;  3CPW A;  2L1B A;  4L63 B;  4LK1 C;  2WFW A;  4APV A;  2K52 A;  2N3S A;  4IO9 A;  1CTM A;  3NE5 B;  4FXK C;  4B3T Q;  1K73 C;  4YY3 L;  2R61 A;  1EIG A;  3F8T A;  1PTO D;  1VQG A;  1B50 A;  2ES2 A;  2A5H A;  1JWM D;  3MXP A;  2FIN B;  2F0S A;  4KTA A;  1I94 Q;  2Y0S E;  3NBH B;  5I6Y A;  4IZ8 A;  1JCK B;  4JI1 L;  3I4O A;  5C0X H;  5BN5 A;  5LMU L;  3G71 A;  1IBM Q;  4K5V A;  4X65 L;  2UUC Q;  2B3G A;  1SE3 A;  3J7A F;  4ZKC B;  2LXJ A;  3U9O A;  1Q86 C;  4DNR B;  4HID A;  1HZB A;  3BG3 A;  1I50 H;  1K3B C;  2EY2 A;  3M7G A;  3HKZ G;  1GUT A;  1JWU D;  3DMU A;  1TR5 A;  4X66 L;  2NBF A;  2JA7 H;  4LMQ D;  2ATW A;  3SVM A;  3RZD H;  4JI2 L;  3QR8 A;  2Q2H A;  2KEC A;  4RGT A;  4J1M A;  4MTK A;  5C4X G;  2JA9 A;  1L1O C;  5CV7 A;  1HUM A;  1KDB A;  1MGS A;  2MPM A;  3KF6 A;  4K5X A;  2OQ0 A;  5EPK A;  5CC4 A;  5DM6 3;  3HOV H;  2ZM6 L;  1A3T A;  3ULP A;  3VA5 A;  4G57 A;  3TS2 A;  3E5S A;  4XYO A;  1XPO A;  3B6Y A;  2KCC A;  3I4N H;  3T1H Q;  4MZ9 A;  5D3I B;  3RUZ A;  1BCP B;  2QW7 A;  1NE3 A;  1JQY D;  5C0X I;  3RN2 A;  4JK1 C;  3JAM i;  5IYC H;  3IL8 A;  2JSO A;  3TBI B;  1V43 A;  1YJ9 A;  2DNE A;  3JAM c;  3H3V C;  3W5O A;  4MIU A;  1WD0 A;  3MXN B;  1VQJ A;  1R9T B;  2F3V A;  2OT2 A;  2LSS A;  2KHJ A;  4RHR A;  1CHP D;  1GHK A;  5EBC A;  2IHE A;  3LWE A;  5IE8 A;  4JW0 A;  1K8M A;  5KIX A;  3GTQ H;  3GO5 A;  5FJ8 H;  2MFI A;  3S2D H;  1U0L A;  3F2C A;  4KKU A;  3A8J E;  2A73 B;  4YWK A;  3U4V A;  1I4Q A;  4G7Z C;  2X6G A;  1IYU A;  1STG A;  1XWE A;  4BA2 I;  2F3W A;  1UNS A;  2VY3 A;  3NQI A;  4PZ6 A;  4QQB X;  1PTO H;  1BUV T;  1Y69 U;  5M3F H;  3OTO L;  1VF7 A;  4RAU C;  5IIF A;  5EKI A;  1F9Q A;  2R93 B;  1WTQ A;  2JA7 B;  5FOB B;  1XPU A;  2BDN A;  1Z7T A;  4FF1 A;  4GNX A;  4QGU A;  3ND8 A;  3S1M B;  4MN3 A;  1LT5 D;  1JJ2 A;  1Q90 A;  3CXC A;  3E3X A;  3HFZ B;  1EIH A;  5HY6 A;  2PYK A;  3CKI B;  1PH3 A;  1S5E D;  4PG3 A;  2UU9 Q;  1Y1W B;  1ET9 A;  4DK1 A;  2H5X A;  1B53 A;  2IWH A;  5KYI A;  3I4N B;  1PYB A;  4LF8 L;  4ABN A;  1NBW A;  1PTO F;  3RLN A;  4RG1 A;  4IFD H;  2OXP A;  5GAD C;  3NTK A;  1PHJ A;  2QCP X;  1AEX A;  4DXG A;  2IX3 A;  2OF1 A;  1RDP D;  2A74 C;  5IYD G;  5ELD A;  1XNR Q;  2Q2U A;  1CKM A;  5DNF A;  1YZ6 A;  4S3S A;  1G2S A;  1EFI D;  4KJO A;  3T1Y Q;  1AE2 A;  3JAM E;  2IW3 A;  1TWC B;  5C0X G;  1QJO A;  2D62 A;  4LFC L;  3D4W A;  4BXX G;  1O7L A;  1KTK A;  1TWH B;  4DPG A;  1HNZ Q;  1XPR A;  1EY6 A;  1GUS A;  1N36 Q;  2K5W A;  4RCO A;  2JK8 A;  2EJF C;  1JWS D;  1K8O A;  4C3H H;  2EY6 A;  2EOT A;  4A3B B;  3TZD A;  1X9N A;  4LF5 L;  3CC4 A;  4NDX A;  1F9S A;  5DAU A;  1QVC A;  2JA7 G;  1H95 A;  1DOK A;  2XWB B;  3NBH A;  1PH7 A;  4PNY A;  1IW7 D;  3BJU A;  1VCI A;  3TP5 A;  3I7F A;  2F0G A;  3UE1 A;  3S16 B;  5HUR A;  4YCU A;  1QE6 A;  1FGU A;  1Y8O B;  3HOU B;  2KED A;  3TP6 A;  1IKL A;  3M4Y A;  2R92 H;  1EY0 A;  1SEB D;  4N8X 1;  3KJO A;  2Z9H A;  3OMC A;  4JPB W;  5D3D A;  2BCO A;  1HFN A;  1LAC A;  1HXY D;  4AH6 A;  2QKI C;  3HKS A;  1Y1W G;  1SFO H;  3HOV G;  4A75 A;  4IFD I;  3A5Z B;  3ONA B;  3E9I A;  2AKW B;  1ASY A;  1TY0 A;  1ZXT A;  2KVM A;  3I4N G;  3HOW H;  4LF7 Q;  2NN6 H;  2ALY B;  2B2W C;  1K9M C;  1G6Z A;  3ITP A;  2A6E D;  1E2V A;  3VYU A;  3NP8 A;  3VR5 A;  1KNE A;  5IYC G;  2F0U A;  3GQB A;  3DLL A;  2VQE Q;  3A8K E;  4GKJ L;  3FRP B;  5A2Q E;  3S1R H;  4ZQ3 A;  2KQ3 A;  3GTM B;  3MA2 B;  4L5T A;  4BBR H;  3WOF A;  1G51 A;  1HHV A;  1WI5 A;  2GVB A;  4FO2 A;  2D0O A;  1B2T A;  5IGF A;  4DUY Q;  4B3S Q;  1HFG A;  2MUY A;  3S9W A;  4A3B G;  1IBL Q;  4ALP A;  3UE0 A;  3OW7 A;  4WJ4 A;  4TVA B;  4NXM Q;  5M5Y B;  1CZG A;  2BA1 A;  4K8J A;  1G2T A;  4O42 A;  1DD2 A;  5G3L D;  3TME A;  2OEO A;  2BE5 C;  3MEF A;  3OSO A;  1U4R A;  3RNU A;  2HHH L;  3FMC A;  1ZYR D;  3HOU G;  4DR5 Q;  1CZW A;  1KL9 A;  1GUG A;  1YIJ A;  1YHB A;  4YWM A;  3GTL H;  4QMG A;  3PSI A;  1PZI D;  1F2Y A;  2KUM A;  3SXH A;  4RGO S;  2DJG C;  2ZJQ A;  2IHF A;  4JC0 A;  2FXQ A;  4IOA A;  4NPS A;  1VQL A;  2VL6 A;  3D6C A;  3CRL C;  2NVQ B;  3DUZ A;  1C4Q A;  2E75 C;  4DAV A;  3SGI A;  5KEE A;  2R92 B;  4KHP L;  1XNQ L;  3K5O A;  1E1T A;  2WIN B;  2JXM B;  4PV1 C;  4DN4 M;  2UXC L;  4A93 H;  1NY4 A;  5D14 A;  1KAB A;  4ZRZ A;  2N55 A;  3HOW B;  5ELE A;  1BVS A;  3CCV A;  4IFD G;  3PMF A;  4FF2 A;  2PZT A;  3ER0 A;  1ROD A;  2C5C A;  4CDC C;  5H1S E;  1RTO A;  2TSS A;  4JOI C;  4LF6 L;  3MEH A;  1HZA A;  1TWF B;  4JI5 L;  1I4P A;  1YVC A;  1W6K A;  3KUP A;  4JI4 L;  3MFY A;  2NZ1 D;  1PFN A;  4WRD A;  1LUZ A;  3E0J A;  2Q8I B;  4F87 A;  3H91 A;  5E4X A;  4JI1 Q;  2GVA A;  5LMU Q;  5ELO A;  4KN4 C;  2V4D A;  4X65 Q;  1C7Y A;  4BY1 H;  2F1M A;  1V8Q A;  1JJC B;  2H4O A;  1B9M A;  2M00 A;  1EYC A;  2YYZ A;  2ZTC A;  5IP9 G;  3KK7 A;  3BDL A;  1WTV A;  3OWF A;  2B2V A;  3K81 C;  3L0O A;  4A3G H;  3QOL A;  5BR8 L;  2R92 G;  4X66 Q;  4ZAI A;  1SXT A;  1JR0 D;  4GN5 A;  4JI2 Q;  4DR3 L;  2UUB L;  5CV6 A;  3BS1 A;  1JE5 A;  1EYG A;  5IWA L;  3HOW G;  1EQR A;  2NN6 G;  1SE2 A;  2K33 A;  4POF A;  2EE1 A;  3CPF A;  2ZJR A;  4P72 A;  5JJZ A;  3T1H L;  2ZM6 Q;  2Z4H A;  4A93 B;  5J1Z A;  4LFB L;  3HOZ B;  4K2L A;  1UEB A;  1EWC A;  3Q23 A;  1VQ5 A;  1Q46 A;  1FNV A;  2CQO A;  1AH9 A;  4CDD C;  4XIG S;  1HNW Q;  4BY7 B;  4DU9 A;  2VS1 A;  4E6I A;  4DR1 L;  5G3L F;  1VQK A;  1K0R A;  3J7A V;  5CGK A;  1PV4 A;  4DV2 Q;  4G4K A;  4IPD A;  4C1N I;  1VQO A;  2MGS A;  4A3L H;  2K75 A;  4OO1 G;  4B3R L;  3I70 A;  5LL6 S;  3RLF A;  1MSG A;  1D8L A;  1GM5 A;  3TQY A;  5FLX c;  3VYT A;  3GD7 A;  2AUK A;  3J7A 5;  2BH2 A;  2XRQ D;  3MFG A;  4BY1 B;  3D4R A;  1MJE A;  2K7V A;  4I7Z C;  3ICE A;  1JOQ A;  4LNQ A;  3BYT B;  3OTO Q;  4ODG A;  3T56 B;  2WKC A;  1CHQ D;  2E5L Q;  2WB1 E;  3T16 A;  1E22 A;  2EPB A;  1XJV A;  4A3M H;  5BN3 A;  2J0T D;  1YI2 A;  2K5D A;  5IT9 c;  4A93 G;  5GAH C;  2N88 A;  1Q8K A;  3GV3 A;  4DR7 L;  2M9V A;  5T1G A;  1H9K A;  5IP7 H;  3SHL A;  1BDO A;  2K50 A;  1B1Z A;  2EIF A;  2N8N A;  5C3E B;  1PRT D;  1V1O A;  1FNU A;  3FDT A;  1GKH A;  4CKC A;  1XNR L;  4BY7 G;  4JG2 A;  3K7A H;  3Q22 A;  4KY7 A;  4LF8 Q;  3WDN A;  5CV8 A;  5A2Q L;  3KDF B;  1I5F A;  3W2D A;  2CW0 C;  4F88 A;  3H6M A;  2F0J A;  5JPM C;  1DYQ A;  4LW1 A;  1HQM C;  1LTG D;  4KY5 A;  3NUC A;  3RR5 A;  1RL2 A;  3T53 B;  3V96 A;  4LFC Q;  4BWG B;  3S1Q B;  4DR6 L;  1L0X B;  4BY1 G;  1LT3 D;  4EQ5 A;  3UDX A;  3H0G H;  2VZA A;  4DV0 L;  1PDQ A;  4QIW E;  4R4Q A;  2WKD A;  1EYA A;  3GTG B;  1XTC D;  4LF5 Q;  3I56 A;  1H9J A;  1SLJ A;  1ESR A;  5FLX E;  4AYB E;  3NXW A;  2Z4I A;  3A5U A;  1YNJ C;  3CU7 A;  1BXT A;  1SSO A;  5KNC A;  3SK5 A;  3LWU A;  3E0E A;  3G6E A;  3I55 A;  1UAP A;  4IPG A;  4P75 A;  3M4O H;  4HED A;  4LF7 L;  5EKK A;  1SND A;  2YTV A;  2F0T A;  3L9A X;  1VQP A;  5C3E G;  1I6H H;  5A35 A;  3IAY A;  2DUD A;  5IT9 E;  1K8A C;  2CVR A;  3I4M H;  4GNX C;  1S5F D;  4YHH L;  1A0I A;  2LKV A;  5ELC A;  4HSV A;  1JIC A;  3GTJ B;  1A3U A;  2AWO A;  1J8I A;  4OEM B;  1WVL A;  4EQO A;  2EXZ A;  3D3R A;  3KLW A;  2K5V A;  3K7A B;  1EEF D;  4IUT A;  5EBD A;  1V1P B;  3LX0 A;  5E4W C;  2G5D A;  4A3L G;  1WTX A;  5EQ0 A;  1EL0 A;  3PIP A;  2JA5 B;  1IYJ B;  2AQ2 B;  1GXD C;  4LUV A;  3NBI A;  1KLU D;  1WTW A;  4QY7 A;  1JT8 A;  5JEA G;  5JOB A;  2QA4 A;  3M4Q A;  5LMN W;  1YJW A;  4X64 Q;  1VQN A;  1O7Z A;  2M2L A;  3PUZ A;  2E8G A;  1D7Q A;  2B8G A;  1JJG A;  1AZQ A;  1WFQ A;  2IL8 A;  2HHH Q;  2KEE A;  4MNO A;  4PMC A;  2FMM A;  3W1G A;  3J81 i;  4KN7 C;  4IUU A;  2PQA A;  3K59 A;  1HQR D;  2KJX A;  5IGC A;  3M85 A;  2R7Z H;  2OTL A;  4IUQ A;  3A7L A;  3A8I E;  3TSS A;  4A3D H;  1QOH A;  4GLX A;  2K5H A;  2ZXO A;  1TT2 A;  4KHP Q;  4HIK A;  4DV7 L;  3S2H B;  2Z8L A;  3P20 A;  4R1J A;  1QB5 D;  1IXR A;  2UXC Q;  1I6H B;  2Z6K C;  3HRZ C;  2RVL A;  2ZJP A;  1I4H A;  2PNR C;  3R2I A;  5IOC A;  1ENF A;  1UE1 A;  1FJG L;  1D5X C;  3I4M B;  3HKZ E;  1K0S A;  2BA0 A;  3P75 A;  5CV9 A;  5ELF A;  2JA5 G;  1KAA A;  3VR4 A;  3I90 A;  2K04 A;  4IAL A;  3KOJ A;  3PO2 B;  4BA1 I;  4UHV A;  3CQZ H;  1G8Z D;  2A68 D;  4LF6 Q;  3C3L A;  1SR3 A;  2JEB I;  2N49 A;  4JI5 Q;  1XX8 A;  4DUZ L;  2RHS B;  1WCM B;  4JI4 Q;  4J6H A;  1OTC A;  4B9X A;  1MHW C;  3KDF A;  4UP9 A;  3CCS A;  2EYM A;  5BN4 A;  1B3Q A;  4HMI A;  3EBE A;  1BCP C;  4A3F H;  2ENB A;  3S15 H;  4FXD A;  4LWC A;  1QNK A;  5EPL A;  1Y1V H;  5BR8 Q;  1L0Y B;  5GRO A;  4CDF C;  2GA4 B;  2EZV A;  2R7Z B;  2B8F A;  2NUC A;  1FL0 A;  3I2Z A;  4DR3 Q;  4CJ2 C;  2UUB Q;  3P7J A;  2LFN A;  1ML0 D;  4PMB A;  4H0L C;  1SMX A;  3H3V H;  5IWA Q;  3I4M G;  3A55 A;  1W2B A;  5I9P A;  4C3I H;  2I5L X;  2ICE C;  2F0O A;  1WJJ A;  4HAE A;  1NR2 A;  1XMO L;  1EFW A;  1KAW A;  4WOR A;  2CQA A;  4LF4 L;  1EOT A;  4LFB Q;  3PO2 G;  2K28 A;  1K28 A;  5J39 A;  3UI2 A;  1EEI D;  1HNW L;  1FYC A;  2QEX A;  1L0W A;  1WCM G;  3H15 A;  4DV2 L;  3M7N A;  4GLA C;  2XWJ B;  2X69 A;  3C46 A;  1GHJ A;  1J9O A;  2QDB A;  2OQK A;  3ERS X;  4DR1 Q;  3R93 A;  1GJX A;  5KNB A;  1E7Z A;  3KLR A;  4B3R Q;  1V1P A;  1I3Q H;  3ULL A;  4Y7N H;  2HCC A;  1VF5 C;  4RWS C;  1TS5 A;  3S14 H;  3MXG A;  1EY8 A;  1I50 B;  3OPO A;  1YNN C;  2R7Z G;  3H3V I;  3S15 B;  1HR0 W;  1HCZ A;  4XDX A;  5TSS A;  2MP1 A;  5IGD A;  3FEW X;  5C4J H;  2E5L L;  1QVG A;  2L15 A;  3HEJ A;  3RZD B;  2OCE A;  2RCF A;  4AIM A;  4J8Q A;  5FLX L;  2PPB C;  1MD2 D;  5I2X A;  2RF4 A;  2BE5 D;  5EKL A;  1FGB D;  3HOX H;  1Y1V B;  1ESF A;  2IX0 A;  1CUK A;  2RA4 A;  2B2V C;  4QJF A;  1PH1 A;  1CKO A;  4H02 A;  3X3N A;  2SEB D;  2DJF C;  1UWV A;  1PZJ D;  2PMZ B;  1IHZ A;  4KKT A;  2A68 C;  3SK8 A;  4RKB A;  3AMU A;  1LM0 A;  3HOV B;  1Q7Y C;  4DR7 Q;  1SMY C;  4DR4 L;  1SYG A;  4C3I B;  1JMC A;  1E24 A;  1YBY A;  3P1H A;  4BS9 A;  1SYB A;  3EIV A;  4JI7 L;  1RKN A;  2G9H D;  4YWL A;  3RN5 A;  2PO4 A;  2YTX A;  4A3E H;  1E2Z A;  3V05 A;  3FKI H;  4L5S A;  1R4P B;  4CKE A;  4B3M L;  4EQP A;  2BDO A;  2J7Z A;  3U4Z A;  5F2D A;  2XGT A;  1GUW A;  3TRE A;  4H44 C;  2I0Q A;  5FLM H;  3SK6 A;  2B29 A;  1OXV A;  1MJC A;  1JB3 A;  2K5N A;  4CDE C;  1KIX A;  3GTQ B;  1P8L A;  4DR6 Q;  4R4T A;  3S2D B;  2B2Y A;  2EYP A;  2QF7 A;  3DHQ A;  1XMQ L;  3KYH C;  1CSQ A;  1K83 H;  2I07 B;  4YCW A;  4DV0 Q;  2JA6 H;  4Y7N B;  1VQ4 A;  1AZP A;  1EYD A;  3NHH A;  3E9H A;  1PTO B;  1PZK D;  1NUC A;  1Y1V G;  1D5M C;  1TKW B;  1Y14 B;  5M3F B;  3SDZ A;  3PCO B;  1H9S A;  3NQT A;  2R6G A;  3F2D A;  3PUX A;  2HUG A;  5C4J B;  3AB9 A;  3NTI A;  2ZT9 C;  3ND9 A;  4V19 0;  2IX1 A;  2EQS A;  3ERQ A;  1EZ8 A;  4DFA A;  1PFM A;  1EQV A;  2KHI A;  2EYJ A;  2N78 A;  2B2T A;  4K14 A;  4C3I G;  2BH8 A;  1LO5 D;  2EJM A;  4WFN 3;  3V2T A;  3PIO A;  2CWA A;  4P2C B;  1T9H A;  4DV1 L;  2NVT H;  4A4I A;  3BZD B;  4A76 A;  4EVO A;  4ZYS A;  2C9O A;  5C4Z A;  2MNA A;  4YHH Q;  4FF4 A;  4B08 A;  2HIV A;  1DM0 B;  1IZ6 A;  4XT3 B;  4NB3 A;  4C56 C;  5M3M H;  1PFS A;  1SDF A;  1VQE A;  1ICF B;  1NMG A;  3FKI B;  4EQN A;  4XTC S;  1WTH A;  2H1E A;  2EYH A;  5FJ8 G;  1PH8 A;  1PH2 A;  3OHX C;  1LTI D;  1CI3 M;  5M5X H;  1A3V A;  3ZYY X;  1MKH A;  4X64 L;  4IPC A;  4YIJ A;  1X3G A;  1JOO A;  3NSW A;  3RZO H;  3EQL C;  1TY2 A;  4C3H B;  2E2I H;  4UDU C;  1MSH A;  5M3F G;  5HGT A;  1EIF A;  4DV4 L;  1K83 B;  2WAQ B;  1AW7 A;  2E2H H;  2F0F A;  2Q2T A;  1W3S A;  5E7N A;  4DAY B;  2RBM A;  4CHT B;  4GN3 B;  4G7O C;  4FXG C;  4MTN A;  3J80 i;  3TEH B;  1GUN A;  1VMP A;  3J80 c;  5CBE E;  1S5B D;  2J4X A;  2JP1 A;  1VQB A;  4JYA L;  2A8V A;  4XQN A;  3FPU B;  4KD4 A;  2EXD A;  1SFO B;  4JCV E;  2PI2 A;  4ZKB B;  4FNF A;  3AEV A;  3Q0A A;  2LMC B;  4DV7 Q;  2HQE A;  3DWA A;  3PIP 3;  5LMN L;  1VQC A;  3GTP H;  5FK9 C;  3EJI A;  2WII B;  3MAQ A;  2NVT B;  3FKI G;  1FJG Q;  1KC8 C;  2L12 A;  4RGN A;  3S1R B;  3NK9 A;  3CHB D;  4BBR B;  1BBU A;  2K5Q A;  3URY A;  1X3E A;  1C0A A;  2RCN A;  4TKO B;  5M3M B;  5JJL A;  4WJW A;  1WTP A;  1SN8 A;  2PQE A;  4C3H G;  3K0Y A;  2HDL A;  3G7L A;  4QB4 A;  2KCT A;  1R4Q B;  4ME3 A;  4DUZ Q;  1SNM A;  4HJ9 A;  5M5X B;  2WAQ G;  3QG1 A;  5T1I A;  1PYW D;  5C44 H;  2KEN A;  4JBM A;  2LY7 A;  1H9R A;  2E2I B;  2CW0 D;  2VB3 X;  5CV5 A;  3PO3 H;  1BOS A;  1STH A;  1LT6 D;  2JJQ A;  2A19 A;  3GTL B;  4BBS H;  5IYB H;  3T51 B;  3HS0 C;  2R7F A;  5ELB A;  2E2H B;  4DV5 L;  1QZH A;  3VR6 A;  4OEL B;  3GTO H;  2L0C A;  3PQI A; 
#chains in the Genus database with same CATH homology
 1SJH D;  2A69 C;  1QIL A;  3J80 E;  1TVX A;  3BVZ A;  1LV9 A;  2L55 A;  5JVG 3;  2RSN A;  1YNJ D;  1PMR A;  3GTP B;  4R8I A;  5I4D A;  4TQU S;  1B4O A;  2K03 A;  1CM9 A;  4IQZ A;  1OO9 B;  2F0V A;  5FKA C;  2KCN A;  3JAM L;  1VDZ A;  1TS2 A;  2KHS A;  3OOC A;  3WOE A;  4K6D A;  4DGZ A;  4GZY C;  3MXU A;  4OIK A;  2F0W A;  4NKL A;  4DK0 A;  2VB2 X;  5C44 B;  1IL8 A;  1GUO A;  1D5Z C;  1EY5 A;  3QOJ A;  2K1B A;  3EA6 A;  3PO3 B;  4A3G B;  2NB0 A;  4R9W A;  4DXF A;  4F7X A;  4V0B A;  1MI2 A;  5C5M A;  4N9P A;  1SNQ A;  4KJN A;  3TZU A;  1WTR A;  1HRJ A;  3GTO B;  4DAY A;  1ENC A;  5CR3 A;  3QO2 A;  3EVQ A;  2LS0 1;  4KD3 A;  2KOL A;  2Z1C A;  2F0Q A;  3D6W A;  2EYO A;  4M8A A;  3TDQ A;  1BBX C;  4FF3 A;  2A6H C;  4FYD A;  1PXU A;  5D65 A;  3VR3 A;  1FNW A;  1WTO A;  1NSN S;  3E6Z X;  1EY9 A;  2EY1 A;  2O2L D;  1FR3 A;  1TS4 A;  4N9T A;  1JOK A;  1STA A;  1ONL A;  1VMC A;  3ERO A;  5C4H A;  1ILQ A;  5NUC A;  1Q1E A;  3N6R A;  4Z9C B;  2TMP A;  1M4V A;  2JE6 I;  3VR2 A;  2F0D A;  1F9P A;  1PFB A;  4K2K A;  4A3M B;  1BCP D;  2ID0 A;  3D31 A;  3R3O A;  1TS3 A;  2VNU D;  1TWG B;  2XN9 C;  4Q0F A;  2Q8T A;  2SNS A;  1A2T A;  1A15 A;  1D1K A;  4B9W A;  3S17 B;  1SNO A;  1Q3L A;  2F0M A;  2PCF B;  5ISR A;  4ME5 A;  5KYL A;  3BVM A;  4ZK9 B;  1EU4 A;  3D8G A;  3IKJ A;  4ZLT F;  1UEA B;  5IGG A;  1B3A A;  3A56 A;  3L7Z C;  3H0G B;  2Q8R E;  1CFM A;  4OHJ A;  1G91 A;  2F0P A;  3R8B A;  3KLS A;  3PIO 3;  1Z6H A;  4CKB A;  2SNM A;  1T5E A;  4IN3 A;  4JBW A;  2B2Y C;  4A3K B;  1ILP A;  4NP5 A;  1E0B A;  5C6A A;  2EDG A;  1CA5 A;  1CK1 A;  3M4O B;  1PRT F;  1BO0 A;  4IUN A;  4NMZ A;  1YNN D;  3Q24 A;  2K01 A;  4HMJ A;  1XYI A;  1TQO A;  5E3F A;  1OXU A;  3DWQ A;  3H94 A;  2B2T C;  3H09 A;  3C2P A;  2Y0S B;  1I4X A;  4I65 A;  5IGE A;  5J22 A;  4CBV A;  2JEA I;  2WV6 D;  4RA8 A;  5C5L A;  4OGQ C;  1SMY D;  1H9M A;  1SYF A;  3MWY W;  1H9S B;  1IYV A;  4K6L A;  1D6E C;  1PRT B;  3I73 A;  1HA5 A;  4X3S A;  1EWH A;  2R3Z A;  2NTT A;  3K5M A;  1A2U A;  1STY A;  3NTH A;  4CJ1 B;  1U9R A;  2WAC A;  4ILW A;  1BCP F;  1B9N A;  1KDC A;  2QIL A;  3J81 E;  1RCV D;  3C1E A;  3J7Y W;  2B2U A;  3TP8 A;  1KDA A;  4A3D B;  4O1N A;  1EZ6 A;  2E74 C;  2RDF A;  4NW2 A;  4TSS A;  1DCZ A;  1O80 A;  3MVV A;  4MHE A;  3T4A C;  1SNC A;  5KRU A;  5C0X J;  1SBB B;  1STE A;  1BF4 A;  1PLF A;  4IUP A;  1I4R A;  1LTA D;  3KBX A;  2DN8 A;  3M3Y B;  5COY A;  1AFP A;  5COR A;  3NWS A;  3CQZ B;  1X3Q A;  3BYY B;  1BR9 A;  1EQT A;  1C48 A;  1MBY A;  1LTB D;  4KHZ A;  1II3 A;  4HCS A;  2IT1 A;  4A3F B;  2F0H A;  1O7Y A;  1RHP A;  2AQ1 B;  4XXE A;  3RD4 A;  1F77 A;  1O78 A;  1T5X D;  2O5J C;  4XYQ A;  5CV4 A;  3OWE B;  3SR1 A;  3KF8 A;  3K5L A;  1C8C A;  2K6A A;  1ENA A;  3X3M A;  4XT1 B;  3K57 A;  4FVM A;  1RTN A;  1LLR D;  4X3U A;  2X6L A;  1M8A A;  2NWG A;  4X3K A;  1ICW A;  1FD7 D;  2G9D A;  3C1F A;  3MZ5 A;  3VYS A;  1EU3 A;  5IT9 L;  2DNC A;  3MC0 B;  2QEJ C;  1U4P A;  3DEO A;  1PTO C;  3RMH A;  1DON A;  1QG7 A;  1B44 D;  1EY7 A;  4KI0 A;  1DOM A;  3F2U A;  3PUW A;  3OIP A;  1U4L A;  1D2B A;  1X32 A;  2NVY B;  1Z47 A;  1HTL D;  5C3W A;  4HSP A;  4XQJ A;  1ZKO A;  5IGB A;  1IKM A;  5EPJ A;  1W6J A;  1S5C D;  4DAP A;  3PV0 A;  4DA2 A;  1I3Q B;  1Y8P B;  2IJ0 A;  3CRK C;  3D4D A;  3S14 B;  4UAI A;  2RDH A;  4C2M B;  1DZ1 A;  1F2M A;  1BQQ T;  1SAP A;  5KND A;  3BDO A;  3LNN A;  4IFD J;  4X3T A;  2D5D A;  3QB3 A;  3MTS A;  3HOX B;  4HTH A;  5E1F A;  2K32 A;  2CHB D;  1NCV A;  2XNA C;  3GP7 A;  2AWN A;  5EGT A;  4RFB A;  3VA7 A;  4XQQ A;  1Q1B A;  2SDF A;  5JPN C;  1RF2 D;  4OIJ A;  2A69 D;  1NAP A;  3L3O C;  2ZXP A;  4EGV A;  4A3E B;  4QUC A;  1S5D D;  5FO9 B;  3MHB A;  4ULL A;  3K58 A;  3TP7 A;  4DNT B;  1JOR A;  1G29 1;  3K5N A;  5LL6 X;  3R2T A;  1AN8 A;  2ZXR A;  5FO8 B;  2B63 B;  1DOL A;  1X3P A;  2F4I A;  3PUY A;  2F0I A;  2JA6 B;  5K36 H;  3PUV A;  1EY4 A;  2RSO A;  4IUR A;  2PZW A;  1HPC A;  2E2D C;  4OO1 H;  3MXN A;  1SJE D;  2JYO A;  2E76 C;  1NR4 A;  4ID6 A;  3HZX A;  1LAB A;  3J81 L;  3DWP A;  2NN6 I;  3BDC A;  1QCB D;  4CGY B;  2F0N A;  2D2C C;  1D1I A;  2PZU A;  5JAV A;  4OL7 A;  1STN A;  1Q12 A;  1LTS D;  2FFK B;  3FVQ A;  1I4G A;  2I46 A;  4PMW A;  5DEH A;  5M5W B;  1LTT D;  4F8M A;  3GV6 A;  3I4L A;  2RDG A;  2K05 A;  4C1N K;  1QWY A;  1F9R A;  4OO1 I;  1DJR D;  2A6H D;  1IW7 C;  3RZO B;  3G6J B;  4RCN A;  3KLS X;  4M1U B;  3Q6S A;  1SNP A;  4HR7 B;  5AFW A;  2DY7 A;  4H7B A;  2EVB A;  5CYU A;  1HA6 A;  2EY5 A;  2FJ2 A;  2XVS A;  4QCL A;  1SYC A;  2F0E A;  4HN7 A;  2A6E C;  3HGB A;  3QWN A;  3QJY A;  2B39 A;  4HCE A;  5CMD A;  1SE4 A;  2XSC A;  4K5W A;  2IPK D;  1STB A;  2PW5 A;  3U9S A;  1F2Z A;  3KBG A;  2HDM A;  1A6X A;  1HTP A;  3FPP A;  4QF4 A;  4A3I B;  5LHY 1;  3HP3 A;  3I8Z A;  2L9H A;  1CA6 A;  3VYR A;  5I2Y A;  4FP5 D;  1JE4 A;  5M9O A;  1ZYR C;  3I3C A;  3SK4 A;  3T13 A;  2EYF A;  4RHS A;  4KMU C;  5K36 G;  4G7H C;  2JA8 B;  3A7A B;  2WB1 B;  1RJT A;  4K8I A;  1Q8I A;  4H13 C;  2VUM B;  4BBS B;  2F03 A;  2L4N A;  3QIA A;  2SOB A;  5JEA H;  1U4M A;  2MHV A;  1E2W A;  1AP0 A;  3OMG A;  1OXX K;  2VXW A;  5K5P A;  2B2W A;  2XIW A;  1S4Z A;  2HCI A;  1CQF A;  5JVH 3;  4RGM A;  1I6V C;  2L11 A;  2NTS A;  5IOD A;  2B2U C;  3DEP A;  3I72 A;  3DM1 A;  4L6T B;  2NVX B;  5JEA J;  2FMC A;  4KV6 A;  2E2J B;  2MJ8 A;  2FHT A;  2WP8 J;  4U67 3;  2L5T A;  4CJ0 B;  1LT4 D;  4QIW B;  4KHV A;  1ET6 A;  4C3J B;  1BNZ A;  1OXS C;  1WD1 A;  3A54 A;  2ICI A;  5CBA E;  4AYB B;  1CQV A;  2DY8 A;  4A3J B;  2BOS A;  4DF7 A;  3NPP A;  2O5I C;  4ZUI A;  1ZEQ X;  4LAA A;  1QNU A;  4KK7 A;  5DM7 3;  2AUJ D;  3HOY B;  2RKS A;  1SYD A;  4KKS A;  1GOZ A;  3TN2 A;  4QUF A;  3IFT A;  3N52 A;  2EJG C;  3W3A A;  1KLG D;  5I6W A;  1RD9 D;  3GTK B;  3DXJ C;  1CT1 D;  1F2L A;  2D9U A;  4PQX A;  3OIQ A;  4Q5V A;  3EFX D;  3BVG A;  4R8N A;  4C3J G;  1KNA A;  5KGU A;  3AU7 A;  1OXT A;  5EJW A;  3NWT A;  2KA7 A;  3IFD A;  4RKL A;  1Y8N B;  3O13 A;  2NYZ D;  4L8J A;  1SYE A;  3K6O A;  3SE0 A;  1TII D;  4ZUJ A;  2YU9 B;  5FO7 B;  2XRS D;  4KY6 A;  3HG9 A;  3S1N B;  1TU2 B;  2F0L A;  4U68 A;  3SEB A;  1LTR D;  2EYL A;  1DXM A;  4IUV A;  1JC7 A;  1UUP A;  4RH6 A;  3HKZ B;  2O4X A;  3J80 L;  1PRT C;  2RQX A;  5C3X A;  3I91 A;  5I9O A;  2PW7 A;  1TWA B;  1HUN A;  5C4X B;  2F0K A;  1XXG A;  4TRD A;  4LJZ C;  2AQ3 B;  2L1B A;  4L63 B;  4LK1 C;  1CTM A;  3NE5 B;  4FXK C;  2R61 A;  1EIG A;  1PTO D;  1B50 A;  2A5H A;  1JWM D;  3MXP A;  2FIN B;  2F0S A;  4KTA A;  5I6Y A;  4IZ8 A;  1JCK B;  5C0X H;  5BN5 A;  4K5V A;  1SE3 A;  3J7A F;  4ZKC B;  3U9O A;  4DNR B;  3BG3 A;  2EY2 A;  3M7G A;  1GUT A;  1JWU D;  3DMU A;  1TR5 A;  2NBF A;  4LMQ D;  3SVM A;  2KEC A;  4RGT A;  4J1M A;  5CV7 A;  1HUM A;  1KDB A;  1MGS A;  2MPM A;  5DM6 3;  4K5X A;  5EPK A;  5CC4 A;  1A3T A;  3VA5 A;  4G57 A;  3E5S A;  4XYO A;  2KCC A;  5D3I B;  3RUZ A;  1BCP B;  1JQY D;  5C0X I;  4JK1 C;  3IL8 A;  2JSO A;  3TBI B;  1V43 A;  2DNE A;  3H3V C;  4MIU A;  1WD0 A;  1R9T B;  2F3V A;  2OT2 A;  4RHR A;  1CHP D;  1GHK A;  5EBC A;  3LWE A;  1K8M A;  5KIX A;  3GO5 A;  4KKU A;  3A8J E;  2A73 B;  1I4Q A;  4G7Z C;  2X6G A;  1IYU A;  1STG A;  1XWE A;  4BA2 I;  2F3W A;  1UNS A;  3NQI A;  1PTO H;  1BUV T;  1Y69 U;  1VF7 A;  4RAU C;  5IIF A;  5EKI A;  1F9Q A;  2R93 B;  1WTQ A;  2JA7 B;  5FOB B;  2BDN A;  1Z7T A;  4FF1 A;  3ND8 A;  3S1M B;  4MN3 A;  1LT5 D;  1Q90 A;  1EIH A;  2PYK A;  3CKI B;  1S5E D;  1Y1W B;  1ET9 A;  4DK1 A;  1B53 A;  2IWH A;  5KYI A;  3I4N B;  4ABN A;  1PTO F;  4IFD H;  2OXP A;  3NTK A;  2QCP X;  1AEX A;  4DXG A;  2IX3 A;  2OF1 A;  1RDP D;  2A74 C;  5ELD A;  5DNF A;  4S3S A;  1G2S A;  1EFI D;  4KJO A;  3JAM E;  2IW3 A;  1TWC B;  5C0X G;  1QJO A;  2D62 A;  3D4W A;  1O7L A;  1KTK A;  1TWH B;  1EY6 A;  1GUS A;  2K5W A;  4RCO A;  2EJF C;  1JWS D;  1K8O A;  2EY6 A;  2EOT A;  4A3B B;  3TZD A;  4NDX A;  1F9S A;  5DAU A;  1DOK A;  2XWB B;  3NBH A;  4PNY A;  1IW7 D;  1VCI A;  3TP5 A;  2F0G A;  3S16 B;  5HUR A;  1QE6 A;  1Y8O B;  3HOU B;  2KED A;  3TP6 A;  1IKL A;  3M4Y A;  1EY0 A;  1SEB D;  3OMC A;  5D3D A;  1HFN A;  2BCO A;  1LAC A;  1HXY D;  2QKI C;  4IFD I;  3ONA B;  1TY0 A;  1ZXT A;  2KVM A;  2NN6 H;  2B2W C;  1G6Z A;  3ITP A;  2A6E D;  1E2V A;  3VYU A;  3NP8 A;  3VR5 A;  1KNE A;  2F0U A;  3GQB A;  3A8K E;  3FRP B;  5A2Q E;  4ZQ3 A;  2KQ3 A;  3GTM B;  3MA2 B;  3WOF A;  1HHV A;  4FO2 A;  1B2T A;  5IGF A;  1HFG A;  2MUY A;  3S9W A;  3OW7 A;  5M5Y B;  1CZG A;  2BA1 A;  4K8J A;  1G2T A;  4O42 A;  1DD2 A;  5G3L D;  3TME A;  2OEO A;  2BE5 C;  3OSO A;  1U4R A;  3FMC A;  1ZYR D;  1CZW A;  1GUG A;  4QMG A;  1PZI D;  1F2Y A;  2KUM A;  3SXH A;  4RGO S;  3D6C A;  3CRL C;  2NVQ B;  3DUZ A;  1C4Q A;  2E75 C;  4DAV A;  5KEE A;  2R92 B;  3K5O A;  2WIN B;  2JXM B;  4PV1 C;  4DN4 M;  5D14 A;  1KAB A;  4ZRZ A;  2N55 A;  3HOW B;  5ELE A;  4IFD G;  3PMF A;  4FF2 A;  2PZT A;  1ROD A;  2C5C A;  1RTO A;  2TSS A;  3MEH A;  1TWF B;  1I4P A;  1W6K A;  3KUP A;  3MFY A;  2NZ1 D;  1PFN A;  4WRD A;  3E0J A;  2Q8I B;  4F87 A;  3H91 A;  5E4X A;  4KN4 C;  2V4D A;  2F1M A;  1V8Q A;  2H4O A;  1B9M A;  2M00 A;  1EYC A;  2YYZ A;  3KK7 A;  3BDL A;  1WTV A;  3OWF A;  2B2V A;  3QOL A;  4ZAI A;  1SXT A;  1JR0 D;  5CV6 A;  3BS1 A;  2NN6 G;  1SE2 A;  2K33 A;  2EE1 A;  5JJZ A;  2Z4H A;  4A93 B;  5J1Z A;  3HOZ B;  4K2L A;  1EWC A;  3Q23 A;  1FNV A;  4XIG S;  4BY7 B;  4DU9 A;  4E6I A;  5G3L F;  3J7A V;  5CGK A;  4G4K A;  4C1N I;  2MGS A;  4OO1 G;  3I70 A;  5LL6 S;  3RLF A;  1MSG A;  3VYT A;  3GD7 A;  2AUK A;  2XRQ D;  3MFG A;  4BY1 B;  3D4R A;  2K7V A;  4I7Z C;  1JOQ A;  3BYT B;  4ODG A;  3T56 B;  2WKC A;  1CHQ D;  3T16 A;  2EPB A;  5BN3 A;  2J0T D;  2K5D A;  2N88 A;  3GV3 A;  2M9V A;  5T1G A;  1H9K A;  3SHL A;  1BDO A;  1B1Z A;  5C3E B;  1PRT D;  1V1O A;  4CKC A;  1FNU A;  3FDT A;  3Q22 A;  4KY7 A;  3WDN A;  5CV8 A;  5A2Q L;  3W2D A;  2CW0 C;  4F88 A;  3H6M A;  2F0J A;  5JPM C;  1DYQ A;  1HQM C;  1LTG D;  4KY5 A;  3NUC A;  3T53 B;  3V96 A;  4BWG B;  3S1Q B;  1L0X B;  1LT3 D;  1PDQ A;  2WKD A;  1EYA A;  3GTG B;  1XTC D;  1H9J A;  1ESR A;  5FLX E;  3NXW A;  2Z4I A;  1YNJ C;  3CU7 A;  1BXT A;  1SSO A;  5KNC A;  3SK5 A;  3LWU A;  1UAP A;  4HED A;  5EKK A;  1SND A;  2F0T A;  3L9A X;  5A35 A;  3IAY A;  5IT9 E;  2CVR A;  1S5F D;  5ELC A;  2LKV A;  4HSV A;  1JIC A;  3GTJ B;  1A3U A;  2AWO A;  1J8I A;  1WVL A;  4EQO A;  2EXZ A;  3D3R A;  3K7A B;  1EEF D;  4IUT A;  5EBD A;  1V1P B;  3LX0 A;  5E4W C;  1WTX A;  5EQ0 A;  1EL0 A;  2JA5 B;  2AQ2 B;  1GXD C;  3NBI A;  1KLU D;  1WTW A;  5JEA G;  5JOB A;  1O7Z A;  2M2L A;  3PUZ A;  2B8G A;  1AZQ A;  2IL8 A;  2KEE A;  4PMC A;  2FMM A;  4KN7 C;  4IUU A;  3K59 A;  1HQR D;  2KJX A;  5IGC A;  3M85 A;  4IUQ A;  3A7L A;  3A8I E;  3TSS A;  1QOH A;  2ZXO A;  1TT2 A;  3S2H B;  2Z8L A;  3P20 A;  1QB5 D;  1I6H B;  3HRZ C;  2RVL A;  1I4H A;  2PNR C;  3R2I A;  5IOC A;  1ENF A;  1D5X C;  3I4M B;  2BA0 A;  3P75 A;  5CV9 A;  5ELF A;  1KAA A;  3VR4 A;  3I90 A;  2K04 A;  4IAL A;  3PO2 B;  4BA1 I;  1G8Z D;  2A68 D;  3C3L A;  2JEB I;  1XX8 A;  1WCM B;  4J6H A;  4B9X A;  2EYM A;  5BN4 A;  4HMI A;  1BCP C;  2ENB A;  4FXD A;  1QNK A;  5EPL A;  1L0Y B;  2GA4 B;  2EZV A;  2R7Z B;  2B8F A;  2NUC A;  4CJ2 C;  3P7J A;  2LFN A;  1ML0 D;  4PMB A;  4H0L C;  3A55 A;  5I9P A;  2ICE C;  2F0O A;  4HAE A;  1NR2 A;  4WOR A;  2CQA A;  1EOT A;  2K28 A;  5J39 A;  3UI2 A;  1EEI D;  1FYC A;  3M7N A;  2XWJ B;  2X69 A;  3C46 A;  1GHJ A;  1J9O A;  2QDB A;  3R93 A;  1GJX A;  5KNB A;  3KLR A;  1V1P A;  2HCC A;  1VF5 C;  4RWS C;  1TS5 A;  3MXG A;  1EY8 A;  1I50 B;  3OPO A;  1YNN C;  3S15 B;  1HCZ A;  4XDX A;  5TSS A;  2MP1 A;  5IGD A;  3FEW X;  3HEJ A;  3RZD B;  4J8Q A;  5FLX L;  2PPB C;  1MD2 D;  5I2X A;  2BE5 D;  5EKL A;  1FGB D;  1Y1V B;  1ESF A;  2IX0 A;  2RA4 A;  2B2V C;  3X3N A;  2SEB D;  1PZJ D;  2PMZ B;  1IHZ A;  4KKT A;  2A68 C;  3SK8 A;  4RKB A;  3AMU A;  3HOV B;  1SMY C;  1SYG A;  4C3I B;  3P1H A;  4BS9 A;  1SYB A;  1RKN A;  2G9H D;  2PO4 A;  1E2Z A;  3V05 A;  1R4P B;  4CKE A;  4EQP A;  2BDO A;  2J7Z A;  5F2D A;  1GUW A;  4H44 C;  3SK6 A;  1OXV A;  1JB3 A;  3GTQ B;  3S2D B;  2B2Y A;  2EYP A;  2QF7 A;  3DHQ A;  2I07 B;  4Y7N B;  1AZP A;  1EYD A;  3NHH A;  1PTO B;  1PZK D;  1NUC A;  1D5M C;  1TKW B;  5M3F B;  3SDZ A;  1H9S A;  3NQT A;  2R6G A;  3PUX A;  2HUG A;  5C4J B;  3AB9 A;  3NTI A;  2ZT9 C;  3ND9 A;  4V19 0;  2IX1 A;  3ERQ A;  1EZ8 A;  4DFA A;  1PFM A;  1EQV A;  2EYJ A;  2B2T A;  4K14 A;  4C3I G;  1LO5 D;  2EJM A;  4WFN 3;  3V2T A;  4P2C B;  3BZD B;  4EVO A;  4ZYS A;  2C9O A;  5C4Z A;  4FF4 A;  4B08 A;  1DM0 B;  4XT3 B;  4C56 C;  1SDF A;  3FKI B;  4EQN A;  4XTC S;  2H1E A;  2EYH A;  3OHX C;  1LTI D;  1CI3 M;  1A3V A;  3ZYY X;  4YIJ A;  1JOO A;  3NSW A;  3EQL C;  1TY2 A;  4C3H B;  4UDU C;  1MSH A;  5HGT A;  1K83 B;  2WAQ B;  1AW7 A;  2F0F A;  2RBM A;  4CHT B;  4G7O C;  4FXG C;  1GUN A;  1VMP A;  5CBE E;  1S5B D;  2J4X A;  2JP1 A;  4XQN A;  3FPU B;  4KD4 A;  1SFO B;  4ZKB B;  4FNF A;  3Q0A A;  2LMC B;  2HQE A;  3DWA A;  3PIP 3;  5FK9 C;  3EJI A;  2WII B;  3MAQ A;  2NVT B;  2L12 A;  4RGN A;  3S1R B;  3NK9 A;  3CHB D;  4BBR B;  2K5Q A;  3URY A;  4TKO B;  5M3M B;  4WJW A;  1WTP A;  2PQE A;  4C3H G;  3K0Y A;  2HDL A;  3G7L A;  4QB4 A;  1R4Q B;  1SNM A;  5M5X B;  3QG1 A;  5T1I A;  1PYW D;  2LY7 A;  1H9R A;  2E2I B;  2CW0 D;  2VB3 X;  5CV5 A;  1BOS A;  1STH A;  1LT6 D;  3GTL B;  3T51 B;  3HS0 C;  5ELB A;  2E2H B;  3VR6 A;  2L0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...