1II3A

Structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ii3A00
1EYCA 2HQEA 1II3A 3HZXA 4IALA 5HGTA 2EY5A 2PZTA 4EQPA 2EYLA 3BDLA 4NDXA 1EY7A 1TT2A 2EY2A 1EY6A 3SK5A 5I9PA 3MXPA 1F2MA 4R8NA 5CR3A 5K5PA 5C4ZA 4G57A 1TR5A 4N9TA 1IHZA 1SNCA 2WACA 4KTAA 3V2TA 2SNMA 5C6AA 5IGGA 1SNDA 1ENCA 1NUCA 3TP7A 1AEXA 4K6DA 1EZ6A 4QB4A 5CC4A 1JORA 3HEJA 3D6CA 1EQVA 3NUCA 5CV8A 3SK8A 2F0PA 2PZUA 4KHVA 4KY7A 4EVOA 5IGBA 4KY5A 5J39A 1EZ8A 4KJOA 3D4DA 3TMEA 4ZUJA 4NP5A 4QF4A 2RKSA 2F0VA 3ERQA 2F0LA 3MEHA 5IODA 1SYEA 4K8JA 4K5XA 1EY8A 5C5MA 5EGTA 2EYMA 4S3SA 4N9PA 3P75A 4K8IA 3MHBA 2F0OA 3MZ5A 1SYGA 5DAUA 2F0HA 4QMGA 3NHHA 4KD4A 1TQOA 1JOKA 2SOBA 4K5VA 2F0WA 3QOJA 1SNPA 2F0TA 4LAAA 5KEEA 4F8MA 5IGFA 3U9OA 1JOQA 2F0DA 3VA5A 1F2YA 4ZQ3A 3DMUA 4WORA 4ID6A 2EXZA 3OMCA 4DF7A 4HMIA 5J22A 3EROA 5E3FA 2F0IA 3C1FA 4MIUA 3T13A 4DGZA 3OSOA 5ISRA 2SNSA 4TRDA 3PMFA 4YIJA 2EYHA 2F0NA 2EY1A 4NKLA 5DEHA 5JOBA 4DU9A 4EQOA 1STBA 3C1EA 2EY6A 2F3WA 5CV4A 5E1FA 2PZWA 3NQTA 5I6YA 1KAAA 3BDCA 4OL7A 1EYAA 5KIXA 4K2KA 1A3TA 2PW5A 3MVVA 1RKNA 5CV6A 1SYFA 2O4XA 4K5WA 3QB3A 4RKLA 2PW7A 4IUNA 4KY6A 4ME5A 5C3WA 5HURA 5I9OA 5KGUA 4PMBA 3T16A 3OWFA 3SR1A 2EYFA 4B9WA 1KDBA 2QDBA 2PQEA 4WRDA 5EKLA 1A3UA 3S9WA 5CV5A 4PNYA 1A3VA 5EKKA 2RBMA 5CGKA 2OF1A 2OXPA 3NK9A 4K2LA 2ENBA 3TP8A 2LKVA 2M00A 3SHLA 3SK4A 3NP8A 1ENAA 3R3OA 4E6IA 1JOOA 3ITPA 5IOCA 2NUCA 3E5SA 3D8GA 4PMCA 4RKBA 4F7XA 5KYLA 5IGDA 1EYDA 3EJIA 2OEOA 5C4HA 4KV6A 5KRUA 5IGCA 5JAVA 2F0EA 3SXHA 1NSNS 1U9RA 4DFAA 4I65A 2F0GA 3TP6A 4HTHA 4K14A 3SK6A 2KQ3A 2F0JA 2RDFA 5CV9A 4J1MA 5M9OA 3D4WA 4KJNA 4J6HA 1SNOA 4HMJA 3RUZA 1STNA 4H7BA 5C3XA 4ODGA 1A2UA 1F2ZA 5KYIA 1EY0A 1EY9A 2EYPA 1KDAA 2F0KA 3DHQA 1STYA 2F0SA 5J1ZA 5IIFA 2EYJA 2PYKA 3NXWA 3OMGA 5I6WA 2F3VA 1SYCA 4EQNA 4KD3A 1EY5A 4IZ8A 1EY4A 3TP5A 3EVQA 3QOLA 1STHA 4NMZA 4ZUIA 1STGA 1A2TA 5C5LA 2F0UA 2EYOA 1SNQA 5IGEA 1KABA 2F0FA 1SYBA 4B9XA 1STAA 2KHSA 1KDCA 2F0MA 1SNMA 2F0QA 3H6MA 3P1HA 5NUCA 3LX0A 5CV7A 1SYDA 5F2DA
chains in the Genus database with same CATH superfamily
1DYQA 2KUMA 3NBHA 5IP7H 3HOZG 2R7ZB 1WJJA 2YYZA 1SFOH 1EY6A 2A6ED 5IT9L 3J7AV 1F9QA 1VQIA 1A0IA 1Q1EA 4YCUA 3GTMB 3FRPB 5C6AA 3PF4A 2UUCL 5EAYA 2P5ZX 1W2BA 1JORA 1PH3A 1KD1C 1RF2D 2FXQA 2JA5H 2F0PA 2PZUA 1GO3E 1PZJD 2K75A 3OWEB 1GHJA 1N33L 1E1TA 3DXJC 1WTQA 2F0VA 2HDLA 5DM73 3F8TA 2RDGA 1WD1A 2ATWA 1EY8A 5JJZA 3TS2A 2K5VA 2HIXA 1PTOC 1ZEQX 1E0BA 3MZ5A 2QILA 1KIXA 1NE3A 2F0HA 4Y52H 2D0PA 3NPPA 1TVXA 1O7YA 4V0BA 4ABNA 3KF8B 3EQLC 3RNUA 3FPPA 3M4OB 2PMZB 1ZKOA 1N36Q 1B70B 5J22A 4RWSC 1D7QA 2WP8J 3T1YL 5FKAC 3MXNA 3AQQA 4QIWE 4AH6A 3TZDA 3ZYYX 1VQJA 3URYA 4A93H 3N52A 1SYFA 3RZOH 4C56C 2CFMA 4IN3A 2DUDA 1WTXA 4B9WA 2KENA 5CMDA 1A63A 5GAEC 3J81c 1IBKL 5K36H 2JA9A 4YWMA 1VQMA 4IPDA 4DR6Q 2VW9A 4UAIA 4CDCC 4B3ML 4H0LC 3P20A 4LMQD 2OEOA 1YNNC 1EIHA 1D6EC 5ELFA 1TS4A 2KCNA 3H3VH 2XTIA 1SMXA 4A3EB 1PRTB 3HS0C 1O7IA 3DLLA 1OO9B 2UXCL 4H7BA 1PH8A 4FO2A 1A2UA 1F2ZA 5COYA 1QJOA 2E2JH 1SN8A 2RQXA 4JBKA 1O7LA 3OHXC 2A19A 1Q3LA 1QUQA 3VR3A 3MA2B 3SVMA 2XGTA 4G4KA 3W1GA 1PYWD 3KLSA 4C3IH 3GV6A 3L7ZC 1ICFB 3OTOQ 4C3JG 1F2LA 1PH7A 3MXPA 3K59A 4LUZA 4X65Q 1WTPA 4DK1A 3V2TA 1IHZA 2SNMA 1S72A 3S1MH 1SNDA 4K6DA 1I4HA 4QB4A 2VUMH 4B3SQ 2CQOA 1EQVA 4IFDJ 3D4RA 5IT9E 3H09A 2NZOA 1F9RA 4KY5A 2IW3A 1I94L 4KHZA 1DOKA 4YCVA 1WTWA 3CC2A 3L2PA 1LT3D 1FNUA 2K6AA 1XYIA 5C5MA 4IUUA 4K8IA 1VQ5A 4O2DA 2N3SA 4JI3Q 1PV4A 1XMQQ 1QWYA 4YY3Q 4A3IB 4DK0A 1WCMH 4RGTA 3DMUA 1PHJA 1Y8OB 3A5ZB 4YWLA 2EVBA 4X3KA 3J80c 3HKSA 4F7XA 3I4MG 4A3LH 4O0AA 2JA6B 3K7UC 2F4VL 5M5YH 3GTQB 1L1OC 1K0RA 1VQHA 1H9SA 5IP9G 4HSPA 4A75A 4A3FH 3AFPA 4R8IA 2CH4A 3H3VC 2E2DC 2KA7A 4AYBE 1HNXL 1L0YB 1UWVA 3J80i 1PH4A 4DK3C 3NQIA 2R6GA 1A3VA 5EKKA 1HZAA 3U4ZA 1SFOB 3NE5B 5C3EH 3NK9A 4CGYB 3KJPA 4DV2Q 4GNXB 1LTSD 1G6PA 4DAYA 4OWWB 2KOLA 5IOCA 3FP9A 1Q81C 1FGUA 4H13C 2L9HA 2VB2X 3NWSA 1DZ1A 3MWYW 4DR1L 1V1QA 1GM5A 1H9JA 4JYAL 1CFMA 2JA5B 2R92H 2R7ZG 5LMNQ 2BE5C 1EU3A 4HTHA 2B2VC 2KJXA 1N32Q 2V4DA 2JA8H 1SNOA 4JOIC 4HR7B 2Q8IB 3HOUG 3DHQA 3GQBA 2SEBD 2XSCA 3DWPA 5I6WA 1VQGA 1ESFA 3D3RA 4XQNA 4UP8A 3BJUA 2N88A 2EYOA 1G8ZD 2VB3X 1V1PB 5IGEA 3HKZE 3TEHB 2F0QA 5DLQE 3GTJH 1SYDA 5AJ3L 1S40A 3GTPH 1IKLA 1F2MA 1NR4A 4DN4M 4A93B 4HEDA 3T1HL 1FNVA 1NUCA 1VQPA 3BU2A 4KHPL 3RZOB 5CC4A 4PQXA 3ONAB 5E4WC 2MO0A 1IL8A 4APVA 1DOMA 2QF7A 4TSSA 1PFBA 1CTMA 1NR2A 1HUMA 1HZBA 1HNWL 1SYEA 4WJ4A 1VCIA 4DUZL 1KRTA 3EN2A 4L6TB 5FJ8H 4M8AA 1J6QA 1L1OB 1JR0D 3CMAA 2BDNA 1JOKA 2F0WA 3GO5A 2H5XA 4X62Q 1GUWA 1JT8A 1PRTD 4DR5L 1YVCA 4X3SA 3GV3A 2AKWB 1LACA 1LTBD 1MKHA 3OMCA 3T13A 2SNSA 4DV7L 2E2JB 5JOBA 4EQOA 1HTLD 4C1NI 3AU7A 1B9NA 2C5CA 3SE0A 5KIXA 2VXWA 1WD0A 3MVVA 4A3EG 1CZGA 1JJ2A 1O78A 2O4XA 3W5OA 4DV1L 4C3IB 5KNDA 2Y0SB 3BS1A 3T16A 4WJ3M 1MBYA 4QY7A 4HJ9A 3E9HA 4NPSA 1CT1D 5CBAE 2NN6G 5G3LF 4K2LA 1N34L 4FDBA 4OO1H 4JI0Q 5JEAJ 1PTOD 3Q8DA 1HZCA 3U58A 2NUCA 4MN3A 4QL5A 2VUMB 3VR4A 4DPGA 3BZCA 3QWNA 2CQAA 2MGSA 2F0EA 2L0CA 2JEBI 3AEVA 1BBXC 5JJIA 3PO3G 5H1SE 4Q5VA 1TWHH 2F0JA 5C4JH 4PG3A 4R4IA 1YHQA 2UUBL 1IBML 1P16A 1XNQQ 2F03A 3VYRA 4HJAA 3SEBA 4DNTB 5LMUQ 3FHWA 4KLKA 1CKNA 3QOLA 2A68C 2RSOA 1VMCA 2IX0A 1WCMB 2QW7A 4O42A 3N6RA 1O7ZA 2F0FA 4C3JH 4LF6Q 5LL6X 1X56A 3BVMA 4EQPA 4ZRZA 1F9SA 4DR7L 5M5YB 3I72A 4A3FB 1IYJB 1SNCA 1T9HA 1HNZQ 1GUGA 1ENCA 4GN5A 2NVXH 3HEJA 4LFBL 2V1CC 3C2PA 5C3EB 4CKBA 4TKOB 5BN3A 3PF5A 1Z6HA 3ERQA 3HOVG 3DM3A 1NMGA 3PUVA 2LSSA 1QZHA 4OX9L 3P7JA 1AW7A 3J7ZC 3CCQA 1DOLA 4C2MH 4DV3L 4OELB 1TS3A 2R92B 5IP7G 2L12A 1K3RA 1H9KA 4JI8Q 2JA8B 4H44C 4XQJA 2FINB 1E2ZA 3I2ZA 3G48A 4MTNA 3STBC 2ZJRA 4A3KG 1XMOQ 5M5XH 5ISRA 3K57A 2A6HD 1CA6A 3PMFA 4NKLA 1X3FA 3C3LA 2MJ8A 5E1FA 1VQ6A 3NQTA 1D8LA 1C8CA 1EOTA 4JI7L 4JK1C 3EA6A 1BKBA 3QB3A 1B2TA 5C3WA 3VYTA 1M8AA 4PMBA 1E7ZA 1HA5A 1TIID 3GTJB 1A3UA 1DJRD 5CV5A 1SSOA 2NZ1D 5BR8L 4DUYL 3L3OC 2Z9HA 3GTPB 4X64Q 1LYLA 1S5BD 1ENFA 3SHLA 1Y1VG 2O2LD 3D8GA 4A76A 1XPUA 2B2YA 3X3MA 5M3FH 1CQVA 2RCNA 4MHEA 1C48A 2K5WA 4CDFC 5C4HA 1BXTA 2ZT9C 3UE0A 1JWMD 3K5LA 2Z4IA 4RCOA 5CV9A 1S3OA 5C4XH 3QO2A 3HOUH 2Z8LA 3ULPA 2R7FA 1EQRA 4LWCA 1VQ9A 5GQOA 4A93G 3OPOA 4LJZC 1ZYRD 1KXLA 4XYQA 2C9OA 4BY1G 3CF5A 2K05A 1VF5C 1YJ9A 2L11A 2K52A 3UDIA 1CI3M 1GKHA 4CJ2C 1IBLQ 1QE6A 2IHEA 5EKIA 1D5XC 3MXNB 1D5MC 2HUGA 1MSGA 5F2DA 4CJ0B 3A7LA 2EY5A 3E0JA 2K32A 4LFCL 1J9OA 1Q1BA 3PIP3 4HSVA 4C1NK 1GHKA 4JI1Q 4IPGA 1V8QA 2QA4A 3WOEA 2QEJC 4WJWA 4U68A 1RJTA 3D6CA 4OXPA 3NUCA 4EGVA 2LS01 5E7NA 1EZ8A 3CCVA 1I4GA 1PH5A 1P8LA 2EYMA 4S3SA 3KLSX 1SYGA 2BCOA 1JB3A 5IYBH 4QMGA 1EOVA 3X3NA 4JG2A 2ZM6Q 1EIFA 1UE1A 2F0TA 4LAAA 3CU7A 1XTCD 1TWHB 1VDZA 4X66L 5C4JB 2UUAQ 2E2HH 1NBWA 1VS0A 4DNRB 3Q23A 4P71A 4L5SA 1QCBD 1R4QB 1SEBD 2NVYH 4QGUA 5HGQA 1YBYA 1STBA 3KYHC 4FP5D 1JQYD 4LW1A 1XTDA 5FLXL 3KUPA 4JBMA 2CW0C 2K7VA 3DUZA 1CZWA 2HCCA 4C3JB 1S5FD 1MD2D 2B8FA 5I9OA 2NN6H 3FEWX 3OIPA 2L4NA 4DR3Q 3ER0A 3RMHA 3PSIA 1MJCA 1RCVD 1D5ZC 2UU9L 3IFTA 1QILA 1X55A 4PMCA 3CQZH 4KN4C 3PO3H 2NVXB 3R8BA 4IUPA 1B3AA 4A3LG 3EBEA 4MNOA 2VQFL 1PVOA 1OXUA 3HFZB 3SGIA 2X69A 1CQFA 1STNA 1X65A 4UDUC 3K81C 1G291 2B63G 4OONA 2NBFA 4LUOA 1QG7A 3A8KE 3TZUA 1J5EQ 2ZTEA 3K5OA 4C2MB 4G7OC 4KD3A 3FMCA 4BBRH 3M3YH 4TQUS 1YHAA 2PQAB 3GTLH 4IO9A 3KDFA 1CK1A 3CMEA 2KHSA 2CH4W 3BZKA 1TKWB 1EU4A 1N9WA 3LX0A 1E3PA 4LNQA 3S1NH 1H9SB 5M5XB 2EJGC 4RGMA 5IGCA 4HIMA 1A15A 4LF5L 4DV5Q 5I4DA 2ICIA 4GOPA 1AEXA 2GVBA 4CBVA 3L0OA 4X3TA 1FD7D 4RH6A 4PZ8A 3GTOH 2B29A 4K0KQ 2AMCB 2EJMA 3HOVH 4IUVA 3KBXA 2VQEL 1W6KA 3CKIB 1YHBA 2CWPA 1CKOA 3HGBA 5DAUA 1KNAA 4A3MG 4LF4Q 4A4IA 1UAPA 1KAWA 2CCZA 4A3KH 1I4XA 1SMYD 5C4XB 1F2YA 1TWFH 2NTTA 3PV0A 4B3TL 1RHPA 4DF7A 3HOUB 4IFDH 2Z6KA 4YIJA 4DU9A 2EZVA 3Q0AA 3KFUA 1CHPD 4HJ7A 4LF7Q 3F2UA 3W3AA 1SE3A 2EIFA 5ELDA 1HR0W 2ASBA 1X3QA 2JJQA 4DV0Q 4IUNA 1B50A 2N55A 1IW7C 2LY7A 5FJ8G 1UE5A 5BN4A 2A69D 1Y1VH 4O1NA 1MHWC 1YJWA 5FLXE 3A0JA 4F87A 2PPBC 1B1ZA 4GKKQ 4LF9Q 3PIOA 2VS1A 4DV4Q 1Z7TA 4LF8L 1Q90A 3FKIG 2B8GA 1SE2A 2PO4A 2N8NA 4PMWA 1HFNA 3ND9A 2YTXA 3F1ZA 2A8VA 3S1RB 1EQQA 3T53B 4B3RL 2KQ3A 4L5RC 1FYCA 3G7LA 1Y1WG 4BY1H 2DNEA 4ODGA 4XQQA 1HTPA 1GUNA 1EWCA 1CSPA 1E2VA 2JN4A 5IIFA 3CCMA 4AQYL 1BCPC 1Z9FA 2PCFB 4HAEA 1MSHA 2Z0SA 1ZXTA 2EJFC 4JI5L 2J0TD 3H0GH 4DR4L 1J8IA 3KBGA 3LNNA 2BDOA 2E2HB 4OO1G 1STAA 1F77A 1R9TH 1HFGA 4CDEC 4P2CB 3HOXG 3VR6A 2NVYB 1II3A 1ESRA 3PCOB 3T4AC 2PZTA 1A8VA 2WIIB 3MTSA 5CR3A 5C44H 5ELEA 4GNXC 2ALYB 4OIKA 1U4PA 2NWGA 1X3EA 4GLXA 3TP7A 1L2FA 1EZ6A 2R7DA 2OWOA 2WKCA 4KKTA 2YV5A 4ZYSA 4PV1C 2AQ2B 4C3HH 3OW7A 4EVOA 1ML0D 5IGBA 4RG1A 3CRKC 4KJOA 1AP0A 3S14H 2WKDA 5IODA 2EPBA 2JK8A 4JBJA 2F52A 1NNXA 3VDYA 4MTKA 2IL8A 1HUNA 4N9PA 3P75A 3CQZB 3PO3B 3S15H 5T1IA 1GOZA 1A6XA 1BNZA 2RHQB 1ONLA 4K5VA 5LL6S 5CORA 4BA1I 2F3IA 4OWXB 4DGZA 2BA0A 1XNRQ 5GROA 2E5LL 3OYYA 3J81L 1YNXA 2RVLA 4OO1I 3H94A 5I6YA 1KAAA 1UE6A 4BBRB 3M3YB 1NCVA 3GTLB 4XT1B 1I6VC 1G2SA 4RKLA 2PMZE 4EX5A 4NB3A 3S1NB 4JCVE 2PQEA 3OIQA 4DAPA 4R1JA 1XPRA 5CGKA 4IJHA 2AQ1B 1B4OA 3JC66 5IGDA 1BCPB 1VQCA 1PH6A 4OIJA 1G51A 1FJGQ 4DXGA 3GTOB 5JAVA 1JCKB 1U9RA 3QG1A 3HOVB 2B63H 2EXDA 1WTHA 2B2WC 3GP7A 2NVQH 1A62A 2QEXA 1EY0A 4Z9CB 1EY9A 1HQMC 2ZXPA 1IYVA 5KGUA 5FOBB 3CPWA 4HCEA 2CW0D 5JEAH 1VQEA 4A3KB 4B9XA 1TWFB 2LXKA 4GKJQ 1XPOA 1X6OA 4DR2L 1E2WA 2MPMA 5M3FG 2WB1B 5IWAL 1LABA 1ILPA 3I4NH 1UEBA 1XJVA 4R4OA 4JI6L 4IQZA 5C4XG 3G4SA 3MFGA 3W1BA 2IJ0A 4LF4L 2B2TA 4DKAC 5ELBA 3HG9A 1R4PB 1NMFA 1Y1VB 3TMEA 4ZUJA 2RKSA 2UXDQ 3IKJA 2CHBD 5D14A 2JE6I 3OW2A 4IOAA 4A3MH 1MJEA 2RHSB 2QCPX 2JXMB 3J80L 4YHHQ 2YU9H 3K80C 5JVG3 1KC8C 3BVGA 1KL9A 2B2UA 4WORA 4BY1B 1V43A 3I4LA 3W2DA 1HZ9A 2NB0A 3NSWA 1VQLA 1N36L 3BDCA 5G3LD 1PFSA 1JE5A 4FNFA 3H0GB 1K28A 3CCUA 2L5TA 3DWAA 1BVSA 1R9TB 3J81E 2PI2E 3TRZA 1CHQD 2G9HD 5IYBG 1CUKA 4P72A 2OXPA 4A3BG 2JA7H 1H9RA 2K4KA 2HHHQ 3FKIH 1VQNA 5T1GA 4CKCA 4ZK9B 1CM9A 2ZXRA 5JPMC 2I5MX 1PFNA 4C3HB 1I4RA 4DR6L 1K83H 3HOYH 1LTLA 1Y1WH 4DFAA 3TS0A 4G7HC 2TMPA 3C46A 2WAQB 3S14B 1HHVA 5M9OA 2AWOA 1LT5D 1X32A 3CC7A 3DM1A 4AYBG 4OEMB 3NEMA 1U4LA 3S15B 5J1ZA 4L8JA 1VQ8A 4FYDA 1DM0B 3TP5A 2E76C 3LGJA 4QUCA 4POFA 1RDPD 3HOXH 1I4PA 2CVRA 3S1MB 2F0UA 1E1OA 3A56A 2XVSA 1KDCA 3M4QA 1EWHA 4X3UA 2HQEA 3ND8A 3BDLA 3VR2A 4FF2A 2R61A 2DNCA 2JP1A 3OTOL 3QR8A 4JI4Q 1IL2A 4X65L 4KHVA 4NP5A 2EDGA 5GAGC 4BBRG 2F0LA 5D65A 5A2QL 4B3SL 5IYDH 3A55A 2ZJQA 1H95A 1LM0A 3S17H 1BUVT 1BBWA 2QDLA 4GLAC 4PZ6A 5FLMG 2B63B 1YNND 2NZHA 1OXSC 2NVQB 2JQOA 2IT1A 2NN6I 4XYOA 2L15A 4JI3L 1VQDA 1XMQL 3J80E 1CSQA 4YY3L 4NXNQ 2I07B 4BWGB 1I3QH 4JC0A 1U5KA 2WINB 4KKUA 2BA1A 3LWEA 1SLJA 3K8AA 2OQKA 1AE2A 3CCRA 4WRDA 1I50H 1FVIA 2KEDA 1JC7A 1EQTA 3E9IA 3I4NB 2K50A 1BCPF 3CW2C 1I6HH 4DV6Q 3MC0B 4L5QA 4KKSA 1YZ6A 3GTGH 2I0QA 3CCEA 1B9MA 2PNHA 3EJIA 4I7AA 4IFDG 2Y0SE 4DV2L 2ES2A 2LFNA 3BZDB 4DAVA 1NSNS 4I65A 2WB1G 1BQQT 4BBSH 5E4XA 1HR0Q 3NBHB 3F2DA 1WOCA 3I73A 1DCZA 4J6HA 1MIUA 3A7AB 1RIPA 4A3MB 2EYPA 5LMNL 1JWUD 1STYA 2F0SA 3OOCA 2EYJA 1N32L 1SYCA 2UXBQ 2Q2TA 1XWEA 4M1UB 2YU9B 4IZ8A 1EY4A 1KABA 3M7NA 1SYBA 3S9WA 1BBUA 2OT2A 4JPBW 2K33A 3S2HH 5CV7A 1EYGA 2AUKA 2I5HA 2UUCQ 1LTGD 4EQ5A 1V9PA 1JMCA 1EY7A 4ZAIA 5JJKA 4HN7A 5K5PA 5GADC 1OTCA 3QJYA 2YTYA 1N33Q 4RHSA 4KMUC 4ALPA 2JSOA 2I5LX 1KQSA 2Q2IA 4LFAQ 5LHY1 1V1PA 3RLOA 2JA7B 1BR9A 3FKIB 4IFDI 1LV9A 2D0OA 3NTHA 3H0GG 1Q8IA 1FNWA 3CXCA 4J15A 3MEFA 1QNKA 2OTJA 1K83B 3HOYB 3BYTB 1Y1WB 1PH1A 4F8MA 1IZ6A 4J8QA 4KK7A 5A2QE 3T1YQ 2XN9C 3UDGA 3AB9A 5C44G 4ZQ3A 2O5JC 2ZXOA 1WI5A 5M3MH 2BE5D 4IUQA 3A54A 4X62L 3RN5A 3C1EA 4C3HG 2EY6A 3T51B 2DJFC 1IBKQ 3HOXB 2AWNA 5FO8B 1L1OA 2WAQG 1LTID 4KY6A 4JI2Q 4A3BH 1KDBA 2QDBA 5EKLA 4B3MQ 1K8MA 2I46A 4WFN3 1M4VA 4ZLTF 3MXGA 3KJOA 2LKVA 1TY0A 3I7FA 1CKMA 5EPLA 1ENAA 1QUQB 4POGA 3ULLA 2UXCQ 4JI0L 3MXUA 3SXHA 3FDTA 2K03A 2K5DA 2F4IA 4R4TA 2WV6D 4FF1A 3S1QH 1T5XD 4HJ8A 2B2VA 1S5CD 4JOIA 3S17B 1C9OA 4HIOA 2BOSA 1C4QA 1EY5A 2Q2HA 3K7AH 1YIJA 3GDEA 2XWBB 4CKEA 3CHBD 1XNQL 3PQIA 1SE8A 5D3IB 5LMUL 5NUCA 2XRQD 1EYCA 1B7YB 3HZXA 4P75A 4HJ5A 2Q2UA 2KHJA 1I3QB 4LF6L 1SDFA 3H15A 3BYYB 3IL8A 4A3DG 4I7ZC 1JB7A 1I94Q 3LWUA 3I55A 5EQ0A 4OGQC 1TY2A 2VY3A 3WWVA 1AZPA 3H91A 4RFBA 5IT9c 3S24A 1I50B 1GVPA 2K14A 1HNZL 3TBIB 1TS2A 1QVCA 5C0XJ 5JEAG 3HOWG 1I6HB 3PO2G 2HDMA 2GA4B 4HIKA 1PTOH 4K5XA 2SDFA 2EQSA 3GTGB 4NXMQ 5FLMH 1O80A 3U9SA 3UE1A 3NTIA 3FVQA 3Q6SA 3Q24A 4KD4A 1TQOA 4QIWB 3VR5A 4CJ1B 2M2LA 1LO5D 2F4VQ 3O13A 4BBSB 1EEID 3I4NG 1AZQA 1UEAB 4HMIA 5I2XA 4DAYB 2EYHA 2EY1A 3KLRA 1HNXQ 4JI8L 3D0FA 2AQ3B 3AMUA 5ELOA 1NAPA 2FMMA 4K2KA 5D3DA 3S16H 1WTRA 1XMOL 1M1KC 1B3QA 1PXUA 3CCLA 5M3FB 3VYSA 2A68D 4P73A 2EYFA 3S2HB 1PDQA 4PNYA 4DR1Q 3V96A 1Q7YC 3TP8A 4JYAQ 3M4YA 2EE1A 4V190 3SK4A 3E5SA 2E2IH 1RD9D 2M9VA 3K0XA 4X64L 3B6YA 1TXYA 2MUYA 2J7ZA 4LUVA 4A3GH 2RDFA 4J1MA 3JAML 5I2YA 1ET6A 2NTSA 2D9UA 2EOTA 5KYIA 1K73C 1QOHA 2GVAA 3IRBA 3TREA 4UY8C 4ME3A 3NXWA 4LK1C 3F2CA 5AJ3Q 1DXMA 1SRUA 1Z47A 3PUYA 2JA7G 4TVAB 4LFAL 3S2DH 4HIDA 1X3PA 3H6MA 1S5DD 5M3MB 3UDXA 3T1HQ 1TWGH 4KHPQ 4P74A 4NDXA 1TT2A 2EY2A 1D1IA 5TSSA 3STBD 1S4ZA 3K0YA 1IBLL 3HOYG 1LUZA 3R2TA 1QVFA 2DGYA 3G6JB 5FK9C 1W3SA 3V05A 2LXJA 2KEEA 3ICEA 3PUZA 4DNIA 1HNWQ 4A3BB 1ASZA 4DUZQ 4R9WA 3SK8A 1VQ4A 2AHOB 1Q8KA 4JI1L 3T56B 2D5DA 5J39A 2C35B 4JBWA 4K8JA 4CHTB 4DR5Q 1B8AA 5EGTA 2KVMA 1JWSD 2A73B 3A74A 1SBBB 3F2BA 1LT6D 2SOBA 1PYBA 1XXGA 2RSNA 4DV7Q 4QJFA 4A3JH 4IURA 1X9NA 4PZ7A 2F0DA 5ELCA 4GZYC 4IPCA 1HXYD 4AYBB 4JI2L 4MZ9A 3S1QB 3CRLC 4RA8A 1K8GA 1SR3A 2F0IA 2ZM6L 1YJNA 1RODA 4BXXH 4DV1Q 2F0NA 2LMCB 4F88A 3J81i 4GN3B 3M85A 2KCCA 2UUAL 1YNJC 2MNAA 4JV5Q 1LTRD 1G91A 3PIO3 1K9MC 3K7AB 2DY7A 4IOCA 5EBCA 3UI2A 1N34Q 4ME5A 1YITA 1SJHD 5IYDG 2B3GA 1TWCH 4X6AH 2XNAC 1GUSA 3KF6A 1B44D 3DEOA 1D2BA 2Z1CA 2OF1A 1TU2B 3MAQA 2K5NA 1I5FA 1SAPA 1DGSA 2A5HA 2B2YC 5EJWA 3ITPA 5KNCA 1CKNB 5KYLA 4BY7H 2MHVA 3PUXA 4DR3L 1YEZA 2UUBQ 1K3BC 4RCNA 1IBMQ 1Y14B 2ZTCA 2F1MA 3BDOA 5DM63 3DWQA 3VYUA 2A6HC 3A8JE 3D4WA 3HKZB 4HMJA 1LTAD 2R93H 1AFPA 1QZGA 1PTOB 3GTKH 3D6WA 1NY4A 1ASYA 1PZKD 3G71A 3KK7A 1GJXA 3TDQA 3QIAA 5EPKA 1QNUA 2VZAA 4EQNA 1LTTD 5DNFA 4FVMA 1EL0A 2K5QA 3JAME 4DR7Q 4DAMA 1TWAH 4E6IA 4GN4B 2IY5B 4H02A 3VA7A 1J5EL 1BF4A 1V1OA 4A3DH 2MO1A 4LFBQ 5JPNC 4R8NA 2IPKD 2DY8A 1KHIA 3S16B 1ILQA 4BBSG 4NXML 1KNEA 2E75C 2PQAA 5AFWA 3A5UA 4DV5L 3HOWH 2G5DA 1AN8A 3PO2H 4OX9Q 1ZYRC 3J81j 1HQRD 4DV3Q 1EUJA 2YTVA 2HCIA 3EIVA 3KOJA 4K0KL 1JJGA 2E2IB 2HIVA 2IHFA 5L37A 5M5WH 4A3GB 1Y8PB 3U9OA 1ET9A 4ZKBB 5EBDA 3KLWA 1VMPA 3VA5A 2N49A 4ID6A 2K1BA 4UP9A 2FHTA 2IX3A 3EROA 1AH9A 1EIGA 4R4QA 3IFDA 1Q12A 4JI7Q 1UE7A 1HPCA 4XIGS 1IXRA 1H9MA 2F3WA 5CV4A 3CC4A 4BA2I 4OL7A 4IUTA 5BR8Q 3FPUB 3BVZA 4DUYQ 5C0XG 2H1EA 4K5WA 3S2DB 1E24A 2E8GA 3CAMA 4A3CH 2R3ZA 3UDFA 3K58A 3RZDH 2NVTH 4LF7L 2FFKB 1WFQA 1PFMA 3NENA 4OWTB 1TWGB 4ZKCB 1EWIA 3J7YW 2D62A 4FXKC 2B39A 1VQKA 1U4RA 4DV0L 3NP8A 4BS9A 4U673 3R3OA 2XRSD 3HOZH 1C0AA 3NELA 1EYDA 3E3XA 3I8ZA 2TSSA 4KV6A 5M3MG 4GKKL 4LF9L 4DV4L 1JE4A 5IYCG 3KF8A 4QUFA 4FXDA 1UNSA 1PYSB 2RDHA 1KDAA 1Q86C 3E0EA 3A8IE 3U50C 3OMGA 2F3VA 3RN2A 2D2CC 1CA5A 5C44B 1Q46A 3EVQA 1STHA 4NMZA 2JYOA 1STGA 4A3JB 2UXBL 5C5LA 4LFCQ 3GD7A 4ILWA 4K6LA 4R4CA 1GD7A 1MGSA 5HGTA 4FF3A 2PNRC 5I9PA 4FXGC 5C0XI 1HCZA 4GOPC 2HQLA 4G57A 2RCFA 4OHJA 5IGGA 3RD4A 1L0WA 1IYUA 3J7AF 3I70A 1WYDA 2CWAA 1TWCB 1K0SA 4UP7A 2AUJD 4NW2A 2WB1E 1IW7D 4QF4A 3CCSA 3R93A 4BY7B 4X66Q 2X6GA 1FR3A 4JV5L 4IPHA 2KBNA 3QOJA 1SNPA 3I56A 1QB5D 2MFIA 5IGFA 1RTNA 1JOQA 2Z6KC 1HRJA 4HCSA 2R93B 3PUWA 3GTKB 3NWTA 4TRDA 5DEHA 4G7ZC 1KTKA 3K5MA 2OTLA 1PRTF 4QCLA 3MFYA 1Y8NB 2PW5A 5CV6A 1BCPD 1XNRL 3RLNA 3HKZG 1IKMA 1TWAB 3G6EA 2UU9Q 1LLRD 1PA6A 5ELNA 1W6JA 4JW0A 4FF4A 1DD2A 3AYHB 3HP3A 5GAHC 4A3DB 2OQ0A 2ENBA 3IAYA 2HT1A 3ERSX 2A6EC 1BDOA 1JOOA 2VQFQ 3DEPA 4RKBA 2MQHA 3KDFB 1SMYC 3HOWB 1OXVA 3WOFA 3PO2B 1PTOF 1WTVA 1JICA 3CPFA 4KJNA 4L63B 1FJGL 2K04A 4A3IG 2WFWA 1YNJD 1HH2P 2F0KA 4UHVA 1SE4A 4GOPB 2JEAI 5M5WB 1U0LA 1KLUD 3RR5A 3M4PA 4IJLA 2GN5A 1XX8A 2PI2A 2JA6G 1GUOA 1EFWA 2WAQE 3M7GA 4LF5Q 2A69C 4DXFA 5BN5A 2FJ2A 1E22A 1VQAA 4IALA 5KEEA 2EYLA 2VL6A 2VNUD 1TR5A 2NYZD 2WACA 4N9TA 4A3GG 4GKJL 2O5IC 1X54A 5J3BA 2HD3A 3I4MH 3J7A5 2ID0A 4GNXA 1WTOA 3CP0A 2VQEQ 2NVTB 3RZDB 5IP9H 2L1BA 2DJGC 1KLGD 5CYUA 3D4DA 2JA5G 1L0XB 3PIPA 2Z6BA 3MEHA 1D1KA 4GLVB 3D31A 1U4MA 1UUPA 5FO9B 3HOZB 2ZTDA 4B3TQ 3NHHA 2CKZB 2H4OA 2UXDL 3NTKA 5FO7B 1WVLA 1HA6A 1LT4D 2EXZA 4RHRA 4YHHL 3L9AX 5E3FA 4Y7NH 4MIUA 1DONA 2K01A 1S5ED 2Z4HA 2R7ZH 3EFXD 1VQBA 5C0XH 5JJLA 1EYAA 3GTMH 5LMNW 1A3TA 3R2IA 4AIMA 1I4QA 2PW7A 5HURA 2MP1A 1M90C 4XTCS 1GUTA 3ZJYC 4LF8Q 3BG3A 1YI2A 4RGNA 1VQ7A 2RBMA 4QQBX 5FLXc 4N8X1 1HJPA 3U4VA 2BH2A 1ICWA 2J4XA 5K36G 1STEA 4A3JG 4B3RQ 1G6ZA 1PH9A 2XIWA 1VQFA 2Q8TA 5IYCH 2HHHL 4BXXG 5A35A 3CD6A 2F0GA 1BO0A 4AQYQ 4XT3B 1PH2A 3M4OH 4JVZA 4RMFA 1B53A 4JI5Q 4DR4Q 2B2WA 4L5TA 3PGZA 5HY6A 3TSSA 2KCMA 3K6OA 3TN2A 4KI0A 1OXTA 3S1RH 4DA2A 3I3CA 1A2TA 1SNQA 3TQYA 1PMRA 1C7YA 3Q22A 2F0MA 3P1HA 4RAUC 1FL0A 2FMCA 1G2TA 2X6LA 4C3IG 4BY7G 4UPAA 3I91A 3SK5A 2ZJPA 2Y0SG 1FGBD 1PLFA 5C4ZA 4KTAA 1RL2A 2G9DA 3HRZC 2B2TC 3KF6B 3M9BA 1TS5A 2KHIA 2R93G 1EEFD 2QGQA 4Q0FA 5CV8A 4KY7A 2VUMG 4A3EH 1VF7A 2K28A 2ICEC 4JI4L 4CDDC 1NJIC 2OCEA 1VQOA 1AE3A 1K8OA 1EFID 2F0OA 3MHBA 2RF4A 2N78A 3E6ZX 1T5EA 3H3VI 2B2UC 2E5LQ 4YWKA 4ZCKA 1QVGA 3WDNA 1X3GA 3C1FA 1SXTA 1WCMG 3OSOA 1EIYB 4ULLA 2IWHA 2A1AA 2PZWA 4KN7C 1OXXK 3AFQA 1NTGA 1KRSA 2L55A 3I90A 1RKNA 4NXNL 3RLFA 2Q8RE 4N8FA 3CCJA 4A3FG 5KNBA 3OWFA 3SR1A 2K5HA 3SDZA 1F9PA 2A74C 2M00A 5CBEE 2QKIC 5C3EG 4RGOS 1GXDC 2DN8A 1JJCB 3JAMc 3I4MB 1Y69U 4XXEA 1BOSA 5KRUA 2E74C 3K5NA 1SROA 4DV6L 4GS3A 4DK6C 5IY0A 4A3IH 3TP6A 2IX1A 2RA4A 4K14A 3SK6A 1RTOA 2BH8A 1N8RC 2R92G 3RUZA 3I4OA 2XWJB 3JAMi 5C3XA 4XDXA 2KECA 4B08A 1PZID 2JA8G 2JA6H 5EPJA 1HR0L 2PYKA 1Q82C 3GTQH 4A3CG 5IE8A 1SJED 4YCWA 1K8AC 4DR2Q 4ZUIA 3ULJA 5IWAQ 1MI2A 1PRTC 2KCTA 1SNMA 3NBIA 4Y7NB 5JVH3 4JI6Q
chains in the Genus database with same CATH topology
1DYQA 2KUMA 3NBHA 2R7ZB 2YYZA 1EY6A 2A6ED 5IT9L 3J7AV 1F9QA 1Q1EA 3GTMB 3FRPB 5C6AA 1JORA 1RF2D 2F0PA 2PZUA 1PZJD 3OWEB 1GHJA 3DXJC 1WTQA 2F0VA 2HDLA 5DM73 2RDGA 1WD1A 1EY8A 5JJZA 1PTOC 1ZEQX 1E0BA 3MZ5A 2QILA 2F0HA 3NPPA 1TVXA 1O7YA 4V0BA 4ABNA 3EQLC 3FPPA 3M4OB 2PMZB 1ZKOA 5J22A 4RWSC 2WP8J 5FKAC 3MXNA 3TZDA 3ZYYX 3URYA 3N52A 1SYFA 4C56C 4IN3A 1WTXA 4B9WA 5CMDA 5K36H 4UAIA 4H0LC 3P20A 4LMQD 2OEOA 1YNNC 1EIHA 1D6EC 5ELFA 1TS4A 2KCNA 4A3EB 1PRTB 3HS0C 1OO9B 4H7BA 4FO2A 1A2UA 1F2ZA 5COYA 1QJOA 2RQXA 1O7LA 3OHXC 1Q3LA 3VR3A 3MA2B 3SVMA 4G4KA 1PYWD 3KLSA 3GV6A 3L7ZC 4C3JG 1F2LA 3MXPA 3K59A 1WTPA 4DK1A 3V2TA 1IHZA 2SNMA 1SNDA 4K6DA 1I4HA 4QB4A 1EQVA 4IFDJ 3D4RA 5IT9E 3H09A 1F9RA 4KY5A 2IW3A 4KHZA 1DOKA 1WTWA 1LT3D 1FNUA 2K6AA 1XYIA 5C5MA 4IUUA 4K8IA 1QWYA 4A3IB 4DK0A 4RGTA 3DMUA 1Y8OB 2EVBA 4X3KA 4F7XA 2JA6B 3GTQB 1H9SA 4HSPA 4R8IA 3H3VC 2E2DC 2KA7A 1L0YB 3NQIA 2R6GA 1A3VA 5EKKA 1SFOB 3NE5B 3NK9A 4CGYB 1LTSD 4DAYA 2KOLA 5IOCA 4H13C 2L9HA 2VB2X 3NWSA 1DZ1A 3MWYW 1H9JA 1CFMA 2JA5B 2BE5C 1EU3A 4HTHA 2B2VC 2KJXA 2V4DA 1SNOA 4HR7B 2Q8IB 3DHQA 3GQBA 2SEBD 2XSCA 3DWPA 5I6WA 1ESFA 3D3RA 4XQNA 2N88A 2EYOA 1G8ZD 2VB3X 1V1PB 5IGEA 2F0QA 1SYDA 1IKLA 1F2MA 1NR4A 4DN4M 4A93B 4HEDA 1FNVA 1NUCA 3RZOB 5CC4A 4PQXA 3ONAB 5E4WC 1IL8A 1DOMA 2QF7A 4TSSA 1PFBA 1CTMA 1NR2A 1HUMA 1SYEA 1VCIA 4L6TB 4M8AA 1JR0D 2BDNA 1JOKA 2F0WA 3GO5A 1GUWA 1PRTD 4X3SA 3GV3A 1LACA 1LTBD 3OMCA 3T13A 2SNSA 2E2JB 5JOBA 4EQOA 1HTLD 4C1NI 3AU7A 1B9NA 2C5CA 3SE0A 5KIXA 2VXWA 1WD0A 3MVVA 1CZGA 1O78A 2O4XA 4C3IB 5KNDA 2Y0SB 3BS1A 3T16A 1MBYA 1CT1D 5CBAE 2NN6G 5G3LF 4K2LA 4OO1H 5JEAJ 1PTOD 2NUCA 4MN3A 2VUMB 3VR4A 3QWNA 2CQAA 2MGSA 2F0EA 2L0CA 2JEBI 1BBXC 4Q5VA 2F0JA 2F03A 3VYRA 3SEBA 4DNTB 3QOLA 2A68C 2RSOA 1VMCA 2IX0A 1WCMB 4O42A 3N6RA 1O7ZA 2F0FA 5LL6X 3BVMA 4EQPA 4ZRZA 1F9SA 5M5YB 3I72A 4A3FB 1SNCA 1GUGA 1ENCA 3HEJA 3C2PA 5C3EB 5BN3A 4CKBA 4TKOB 1Z6HA 3ERQA 3PUVA 3P7JA 1AW7A 1DOLA 1TS3A 2R92B 2L12A 1H9KA 2JA8B 4H44C 4XQJA 2FINB 1E2ZA 1CA6A 5ISRA 3K57A 2A6HD 3PMFA 4NKLA 3C3LA 2MJ8A 5E1FA 3NQTA 1C8CA 1EOTA 4JK1C 3EA6A 3QB3A 1B2TA 5C3WA 3VYTA 1M8AA 4PMBA 1HA5A 1TIID 3GTJB 1A3UA 1DJRD 5CV5A 1SSOA 2NZ1D 3L3OC 3GTPB 1S5BD 1ENFA 3SHLA 2O2LD 3D8GA 2B2YA 3X3MA 1CQVA 4MHEA 1C48A 2K5WA 5C4HA 1BXTA 2ZT9C 1JWMD 3K5LA 2Z4IA 4RCOA 5CV9A 3QO2A 2Z8LA 3OPOA 4LJZC 1ZYRD 4XYQA 2C9OA 2K05A 1VF5C 2L11A 1CI3M 4CJ2C 1QE6A 5EKIA 1D5XC 1D5MC 2HUGA 1MSGA 5F2DA 4CJ0B 3A7LA 2EY5A 3E0JA 2K32A 1J9OA 1Q1BA 3PIP3 4HSVA 4C1NK 1GHKA 1V8QA 3WOEA 2QEJC 4WJWA 4U68A 1RJTA 3D6CA 3NUCA 4EGVA 2LS01 1EZ8A 1I4GA 2EYMA 4S3SA 3KLSX 1SYGA 2BCOA 1JB3A 4QMGA 3X3NA 2F0TA 4LAAA 3CU7A 1XTCD 1TWHB 1VDZA 5C4JB 3Q23A 4DNRB 1QCBD 1R4QB 1SEBD 1STBA 4FP5D 1JQYD 5FLXL 3KUPA 2CW0C 2K7VA 3DUZA 1CZWA 2HCCA 4C3JB 1S5FD 1MD2D 2B8FA 5I9OA 2NN6H 3FEWX 3OIPA 2L4NA 3RMHA 1RCVD 1D5ZC 3IFTA 1QILA 4PMCA 4KN4C 2NVXB 3R8BA 4IUPA 1B3AA 1OXUA 2X69A 1CQFA 1STNA 4UDUC 1G291 2NBFA 1QG7A 3A8KE 3TZUA 3K5OA 4C2MB 4G7OC 4KD3A 3FMCA 4TQUS 1CK1A 2KHSA 1TKWB 1EU4A 3LX0A 1H9SB 5M5XB 2EJGC 4RGMA 5IGCA 1A15A 5I4DA 2ICIA 1AEXA 4CBVA 4X3TA 1FD7D 4RH6A 2EJMA 4IUVA 3KBXA 1W6KA 3CKIB 3HGBA 5DAUA 1KNAA 1UAPA 1I4XA 1SMYD 5C4XB 1F2YA 2NTTA 3PV0A 3HOUB 4IFDH 1RHPA 4DF7A 4YIJA 4DU9A 2EZVA 3Q0AA 1CHPD 3F2UA 3W3AA 1SE3A 5ELDA 1X3QA 1B50A 4IUNA 2N55A 1IW7C 2LY7A 5BN4A 2A69D 4O1NA 5FLXE 4F87A 2PPBC 1B1ZA 1Z7TA 1Q90A 2B8GA 1SE2A 2PO4A 1HFNA 4PMWA 3ND9A 3S1RB 3T53B 2KQ3A 1FYCA 3G7LA 2DNEA 4ODGA 4XQQA 1HTPA 1GUNA 1EWCA 1E2VA 5IIFA 1BCPC 2PCFB 4HAEA 1MSHA 1ZXTA 2EJFC 2J0TD 1J8IA 3KBGA 3LNNA 2BDOA 2E2HB 4OO1G 1STAA 1F77A 1HFGA 4P2CB 3VR6A 2NVYB 1II3A 1ESRA 3T4AC 2PZTA 2WIIB 3MTSA 5CR3A 5ELEA 4OIKA 1U4PA 2NWGA 3TP7A 1EZ6A 2WKCA 4KKTA 4ZYSA 4PV1C 2AQ2B 3OW7A 4EVOA 1ML0D 5IGBA 3CRKC 4KJOA 1AP0A 2WKDA 5IODA 2EPBA 2IL8A 1HUNA 4N9PA 3P75A 3CQZB 3PO3B 5T1IA 1GOZA 1A6XA 1BNZA 1ONLA 4K5VA 5LL6S 5CORA 4BA1I 4DGZA 2BA0A 3J81L 2RVLA 4OO1I 3H94A 5I6YA 1KAAA 4BBRB 3M3YB 1NCVA 3GTLB 4XT1B 1I6VC 1G2SA 4RKLA 3S1NB 2PQEA 3OIQA 4DAPA 5CGKA 2AQ1B 1B4OA 5IGDA 1BCPB 4OIJA 4DXGA 3GTOB 5JAVA 1JCKB 1U9RA 3QG1A 3HOVB 2B2WC 3GP7A 1EY0A 4Z9CB 1EY9A 1HQMC 2ZXPA 1IYVA 5KGUA 5FOBB 4HCEA 2CW0D 5JEAH 4A3KB 4B9XA 1TWFB 1E2WA 2MPMA 2WB1B 1LABA 1ILPA 4IQZA 3MFGA 2IJ0A 2B2TA 5ELBA 3HG9A 1R4PB 1Y1VB 3TMEA 4ZUJA 2RKSA 3IKJA 2CHBD 5D14A 2JE6I 2QCPX 2JXMB 3J80L 5JVG3 3BVGA 2B2UA 4WORA 4BY1B 1V43A 3I4LA 3W2DA 2NB0A 3NSWA 3BDCA 5G3LD 4FNFA 3H0GB 2L5TA 3DWAA 1R9TB 3J81E 1CHQD 2G9HD 2OXPA 1H9RA 5T1GA 4CKCA 4ZK9B 1CM9A 2ZXRA 5JPMC 1PFNA 4C3HB 1I4RA 4DFAA 4G7HC 2TMPA 3C46A 2WAQB 3S14B 1HHVA 5M9OA 2AWOA 1LT5D 1X32A 3DM1A 1U4LA 3S15B 5J1ZA 4L8JA 4FYDA 1DM0B 3TP5A 2E76C 4QUCA 1RDPD 1I4PA 2CVRA 3S1MB 2F0UA 3A56A 2XVSA 1KDCA 1EWHA 4X3UA 2HQEA 3ND8A 3BDLA 3VR2A 4FF2A 2R61A 2DNCA 2JP1A 4KHVA 4NP5A 2EDGA 2F0LA 5D65A 5A2QL 3A55A 1BUVT 2B63B 1YNND 1OXSC 2NVQB 2IT1A 2NN6I 4XYOA 3J80E 2I07B 4BWGB 2WINB 4KKUA 2BA1A 3LWEA 4WRDA 2KEDA 1JC7A 1EQTA 3I4NB 1BCPF 3MC0B 4KKSA 1B9MA 3EJIA 4IFDG 2LFNA 3BZDB 4DAVA 1NSNS 4I65A 1BQQT 5E4XA 3I73A 1DCZA 4J6HA 3A7AB 4A3MB 2EYPA 1JWUD 1STYA 2F0SA 3OOCA 2EYJA 1SYCA 1XWEA 4M1UB 2YU9B 4IZ8A 1EY4A 1KABA 3M7NA 1SYBA 3S9WA 2OT2A 2K33A 5CV7A 2AUKA 1LTGD 1EY7A 4ZAIA 4HN7A 5K5PA 3QJYA 4RHSA 4KMUC 2JSOA 5LHY1 1V1PA 2JA7B 1BR9A 3FKIB 4IFDI 1LV9A 3NTHA 1Q8IA 1FNWA 1QNKA 1K83B 3HOYB 3BYTB 1Y1WB 4F8MA 4KK7A 4J8QA 5A2QE 2XN9C 3AB9A 4ZQ3A 2O5JC 2ZXOA 2BE5D 4IUQA 3A54A 3C1EA 4C3HG 2EY6A 3T51B 3HOXB 2AWNA 5FO8B 1LTID 4KY6A 1KDBA 2QDBA 5EKLA 1K8MA 2I46A 4WFN3 1M4VA 4ZLTF 3MXGA 2LKVA 1TY0A 5EPLA 1ENAA 3MXUA 3SXHA 3FDTA 2K03A 2K5DA 2F4IA 2WV6D 4FF1A 1T5XD 2B2VA 1S5CD 3S17B 2BOSA 1C4QA 1EY5A 2XWBB 4CKEA 3CHBD 5D3IB 5NUCA 2XRQD 1EYCA 3HZXA 1I3QB 1SDFA 3BYYB 3IL8A 4I7ZC 3LWUA 5EQ0A 4OGQC 1TY2A 1AZPA 3H91A 4RFBA 1I50B 3TBIB 1TS2A 5C0XJ 5JEAG 1I6HB 2HDMA 2GA4B 1PTOH 4K5XA 2SDFA 3GTGB 1O80A 3U9SA 3NTIA 3FVQA 3Q6SA 3Q24A 4KD4A 1TQOA 4QIWB 3VR5A 4CJ1B 2M2LA 1LO5D 4BBSB 3O13A 1EEID 1AZQA 1UEAB 4HMIA 5I2XA 2EYHA 2EY1A 3KLRA 2AQ3B 3AMUA 1NAPA 2FMMA 4K2KA 5D3DA 1WTRA 1PXUA 5M3FB 3VYSA 2A68D 2EYFA 3S2HB 1PDQA 4PNYA 3V96A 3TP8A 3M4YA 2EE1A 4V190 3SK4A 3E5SA 1RD9D 2M9VA 2MUYA 2J7ZA 2RDFA 4J1MA 3JAML 5I2YA 1ET6A 2NTSA 2D9UA 2EOTA 5KYIA 1QOHA 3NXWA 4LK1C 1DXMA 1Z47A 3PUYA 1X3PA 3H6MA 1S5DD 5M3MB 4NDXA 1TT2A 2EY2A 1D1IA 5TSSA 1S4ZA 3K0YA 3R2TA 5FK9C 3G6JB 3V05A 2KEEA 3PUZA 4A3BB 4R9WA 3SK8A 3T56B 2D5DA 5J39A 4JBWA 4K8JA 4CHTB 5EGTA 2KVMA 1JWSD 2A73B 1SBBB 1LT6D 2SOBA 1XXGA 2RSNA 4IURA 2F0DA 5ELCA 4GZYC 1HXYD 4AYBB 3S1QB 3CRLC 4RA8A 2F0IA 1RODA 2F0NA 2LMCB 4F88A 3M85A 2KCCA 1YNJC 1G91A 1LTRD 3PIO3 3K7AB 2DY7A 5EBCA 3UI2A 4ME5A 1SJHD 2XNAC 1GUSA 1B44D 3DEOA 1D2BA 2Z1CA 2OF1A 1TU2B 3MAQA 1SAPA 2A5HA 2B2YC 5EJWA 3ITPA 5KNCA 5KYLA 2MHVA 3PUXA 4RCNA 2F1MA 3BDOA 5DM63 3DWQA 3VYUA 2A6HC 3A8JE 3D4WA 3HKZB 4HMJA 1LTAD 1AFPA 1PTOB 3D6WA 1PZKD 3KK7A 1GJXA 3TDQA 3QIAA 5EPKA 1QNUA 4EQNA 1LTTD 5DNFA 4FVMA 1EL0A 2K5QA 3JAME 4E6IA 3VA7A 1BF4A 1V1OA 5JPNC 4R8NA 2IPKD 2DY8A 3S16B 1ILQA 1KNEA 2E75C 5AFWA 1AN8A 1ZYRC 1HQRD 2HCIA 2E2IB 4A3GB 1Y8PB 3U9OA 1ET9A 4ZKBB 5EBDA 1VMPA 3VA5A 4ID6A 2K1BA 2IX3A 2FHTA 3EROA 1EIGA 3IFDA 1Q12A 1HPCA 4XIGS 1H9MA 2F3WA 5CV4A 4BA2I 4OL7A 4IUTA 3FPUB 3BVZA 5C0XG 2H1EA 4K5WA 3S2DB 2R3ZA 3K58A 2FFKB 1PFMA 4ZKCB 1TWGB 3J7YW 2D62A 4FXKC 2B39A 1U4RA 3NP8A 4BS9A 4U673 3R3OA 2XRSD 1EYDA 3I8ZA 2TSSA 4KV6A 1JE4A 3KF8A 4QUFA 4FXDA 1UNSA 2RDHA 1KDAA 3A8IE 3OMGA 2F3VA 1CA5A 2D2CC 5C44B 3EVQA 1STHA 4NMZA 2JYOA 1STGA 4A3JB 5C5LA 3GD7A 4ILWA 4K6LA 1MGSA 5HGTA 4FF3A 2PNRC 5I9PA 4FXGC 5C0XI 1HCZA 4G57A 4OHJA 5IGGA 3RD4A 1IYUA 3J7AF 3I70A 1TWCB 2AUJD 4NW2A 1IW7D 4QF4A 3R93A 4BY7B 2X6GA 1FR3A 3QOJA 1SNPA 1QB5D 5IGFA 1RTNA 1JOQA 1HRJA 4HCSA 2R93B 3PUWA 3GTKB 3NWTA 4TRDA 5DEHA 4G7ZC 1KTKA 3K5MA 1PRTF 4QCLA 3MFYA 1Y8NB 2PW5A 5CV6A 1BCPD 1IKMA 1TWAB 1LLRD 1W6JA 4FF4A 1DD2A 4A3DB 3HP3A 2ENBA 3IAYA 2A6EC 1BDOA 1JOOA 3DEPA 4RKBA 1SMYC 3HOWB 1OXVA 3WOFA 3PO2B 1PTOF 1WTVA 1JICA 4KJNA 4L63B 2K04A 1YNJD 2F0KA 1SE4A 2JEAI 5M5WB 1KLUD 1XX8A 1GUOA 3M7GA 2A69C 4DXFA 5BN5A 2FJ2A 4IALA 5KEEA 2EYLA 2VNUD 1TR5A 2NYZD 2WACA 4N9TA 2O5IC 2ID0A 1WTOA 2NVTB 3RZDB 2L1BA 1KLGD 5CYUA 3D4DA 1L0XB 3MEHA 1D1KA 3D31A 1U4MA 1UUPA 5FO9B 3HOZB 3NHHA 2H4OA 3NTKA 5FO7B 1WVLA 1HA6A 1LT4D 2EXZA 4RHRA 3L9AX 5E3FA 4MIUA 1DONA 2K01A 1S5ED 2Z4HA 3EFXD 5C0XH 1EYAA 1A3TA 3R2IA 1I4QA 2PW7A 5HURA 2MP1A 4XTCS 1GUTA 3BG3A 4RGNA 2RBMA 1ICWA 2J4XA 5K36G 1STEA 1G6ZA 2XIWA 2Q8TA 5A35A 2F0GA 1BO0A 4XT3B 1B53A 2B2WA 3TSSA 3K6OA 3TN2A 4KI0A 1OXTA 4DA2A 3I3CA 1A2TA 1SNQA 1PMRA 3Q22A 2F0MA 3P1HA 4RAUC 2FMCA 1G2TA 2X6LA 4C3IG 3I91A 3SK5A 1FGBD 1PLFA 5C4ZA 4KTAA 2G9DA 3HRZC 2B2TC 1TS5A 1EEFD 4Q0FA 5CV8A 4KY7A 1VF7A 2K28A 2ICEC 1K8OA 1EFID 2F0OA 3MHBA 3E6ZX 1T5EA 2B2UC 3WDNA 3C1FA 1SXTA 3OSOA 4ULLA 2IWHA 2PZWA 4KN7C 1OXXK 2L55A 3I90A 1RKNA 3RLFA 2Q8RE 5KNBA 3OWFA 3SR1A 3SDZA 1F9PA 2A74C 2M00A 5CBEE 2QKIC 4RGOS 1GXDC 2DN8A 3I4MB 1Y69U 4XXEA 1BOSA 5KRUA 2E74C 3K5NA 3TP6A 2IX1A 2RA4A 4K14A 3SK6A 1RTOA 3RUZA 2XWJB 5C3XA 4XDXA 2KECA 4B08A 1PZID 5EPJA 2PYKA 1SJED 4ZUIA 1MI2A 1PRTC 1SNMA 3NBIA 4Y7NB 5JVH3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYC A;  2HQE A;  1II3 A;  3HZX A;  4IAL A;  5HGT A;  2EY5 A;  2PZT A;  4EQP A;  2EYL A;  3BDL A;  4NDX A;  1EY7 A;  1TT2 A;  2EY2 A;  1EY6 A;  3SK5 A;  5I9P A;  3MXP A;  1F2M A;  4R8N A;  5CR3 A;  5K5P A;  5C4Z A;  4G57 A;  1TR5 A;  4N9T A;  1IHZ A;  1SNC A;  2WAC A;  4KTA A;  3V2T A;  2SNM A;  5C6A A;  5IGG A;  1SND A;  1ENC A;  1NUC A;  3TP7 A;  1AEX A;  4K6D A;  1EZ6 A;  4QB4 A;  5CC4 A;  1JOR A;  3HEJ A;  3D6C A;  1EQV A;  3NUC A;  5CV8 A;  3SK8 A;  2F0P A;  2PZU A;  4KHV A;  4KY7 A;  4EVO A;  5IGB A;  4KY5 A;  5J39 A;  1EZ8 A;  4KJO A;  3D4D A;  3TME A;  4ZUJ A;  4NP5 A;  4QF4 A;  2RKS A;  2F0V A;  3ERQ A;  2F0L A;  3MEH A;  5IOD A;  1SYE A;  4K8J A;  4K5X A;  1EY8 A;  5C5M A;  5EGT A;  2EYM A;  4S3S A;  4N9P A;  3P75 A;  4K8I A;  3MHB A;  2F0O A;  3MZ5 A;  1SYG A;  5DAU A;  2F0H A;  4QMG A;  3NHH A;  4KD4 A;  1TQO A;  1JOK A;  2SOB A;  4K5V A;  2F0W A;  3QOJ A;  1SNP A;  2F0T A;  4LAA A;  5KEE A;  4F8M A;  5IGF A;  3U9O A;  1JOQ A;  2F0D A;  3VA5 A;  1F2Y A;  4ZQ3 A;  3DMU A;  4WOR A;  4ID6 A;  2EXZ A;  3OMC A;  4DF7 A;  4HMI A;  5J22 A;  3ERO A;  5E3F A;  2F0I A;  3C1F A;  4MIU A;  3T13 A;  4DGZ A;  3OSO A;  5ISR A;  2SNS A;  4TRD A;  3PMF A;  4YIJ A;  2EYH A;  2F0N A;  2EY1 A;  4NKL A;  5DEH A;  5JOB A;  4DU9 A;  4EQO A;  1STB A;  3C1E A;  2EY6 A;  2F3W A;  5CV4 A;  5E1F A;  2PZW A;  3NQT A;  5I6Y A;  1KAA A;  3BDC A;  4OL7 A;  1EYA A;  5KIX A;  4K2K A;  1A3T A;  2PW5 A;  3MVV A;  1RKN A;  5CV6 A;  1SYF A;  2O4X A;  4K5W A;  3QB3 A;  4RKL A;  2PW7 A;  4IUN A;  4KY6 A;  4ME5 A;  5C3W A;  5HUR A;  5I9O A;  5KGU A;  4PMB A;  3T16 A;  3OWF A;  3SR1 A;  2EYF A;  4B9W A;  1KDB A;  2QDB A;  2PQE A;  4WRD A;  5EKL A;  1A3U A;  3S9W A;  5CV5 A;  4PNY A;  1A3V A;  5EKK A;  2RBM A;  5CGK A;  2OF1 A;  2OXP A;  3NK9 A;  4K2L A;  2ENB A;  3TP8 A;  2LKV A;  2M00 A;  3SHL A;  3SK4 A;  3NP8 A;  1ENA A;  3R3O A;  4E6I A;  1JOO A;  3ITP A;  5IOC A;  2NUC A;  3E5S A;  3D8G A;  4PMC A;  4RKB A;  4F7X A;  5KYL A;  5IGD A;  1EYD A;  3EJI A;  2OEO A;  5C4H A;  4KV6 A;  5KRU A;  5IGC A;  5JAV A;  2F0E A;  3SXH A;  1NSN S;  1U9R A;  4DFA A;  4I65 A;  2F0G A;  3TP6 A;  4HTH A;  4K14 A;  3SK6 A;  2KQ3 A;  2F0J A;  2RDF A;  5CV9 A;  4J1M A;  5M9O A;  3D4W A;  4KJN A;  4J6H A;  1SNO A;  4HMJ A;  3RUZ A;  1STN A;  4H7B A;  5C3X A;  4ODG A;  1A2U A;  1F2Z A;  5KYI A;  1EY0 A;  1EY9 A;  2EYP A;  1KDA A;  2F0K A;  3DHQ A;  1STY A;  2F0S A;  5J1Z A;  5IIF A;  2EYJ A;  2PYK A;  3NXW A;  3OMG A;  5I6W A;  2F3V A;  1SYC A;  4EQN A;  4KD3 A;  1EY5 A;  4IZ8 A;  1EY4 A;  3TP5 A;  3EVQ A;  3QOL A;  1STH A;  4NMZ A;  4ZUI A;  1STG A;  1A2T A;  5C5L A;  2F0U A;  2EYO A;  1SNQ A;  5IGE A;  1KAB A;  2F0F A;  1SYB A;  4B9X A;  1STA A;  2KHS A;  1KDC A;  2F0M A;  1SNM A;  2F0Q A;  3H6M A;  3P1H A;  5NUC A;  3LX0 A;  5CV7 A;  1SYD A;  5F2D A; 
#chains in the Genus database with same CATH topology
 1DYQ A;  2KUM A;  3NBH A;  5IP7 H;  3HOZ G;  2R7Z B;  1WJJ A;  2YYZ A;  1SFO H;  1EY6 A;  2A6E D;  5IT9 L;  3J7A V;  1F9Q A;  1VQI A;  1A0I A;  1Q1E A;  4YCU A;  3GTM B;  3FRP B;  5C6A A;  3PF4 A;  2UUC L;  5EAY A;  2P5Z X;  1W2B A;  1JOR A;  1PH3 A;  1KD1 C;  1RF2 D;  2FXQ A;  2JA5 H;  2F0P A;  2PZU A;  1GO3 E;  1PZJ D;  2K75 A;  3OWE B;  1GHJ A;  1N33 L;  1E1T A;  3DXJ C;  1WTQ A;  2F0V A;  2HDL A;  5DM7 3;  3F8T A;  2RDG A;  1WD1 A;  2ATW A;  1EY8 A;  5JJZ A;  3TS2 A;  2K5V A;  2HIX A;  1PTO C;  1ZEQ X;  1E0B A;  3MZ5 A;  2QIL A;  1KIX A;  1NE3 A;  2F0H A;  4Y52 H;  2D0P A;  3NPP A;  1TVX A;  1O7Y A;  4V0B A;  4ABN A;  3KF8 B;  3EQL C;  3RNU A;  3FPP A;  3M4O B;  2PMZ B;  1ZKO A;  1N36 Q;  1B70 B;  5J22 A;  4RWS C;  1D7Q A;  2WP8 J;  3T1Y L;  5FKA C;  3MXN A;  3AQQ A;  4QIW E;  4AH6 A;  3TZD A;  3ZYY X;  1VQJ A;  3URY A;  4A93 H;  3N52 A;  1SYF A;  3RZO H;  4C56 C;  2CFM A;  4IN3 A;  2DUD A;  1WTX A;  4B9W A;  2KEN A;  5CMD A;  1A63 A;  5GAE C;  3J81 c;  1IBK L;  5K36 H;  2JA9 A;  4YWM A;  1VQM A;  4IPD A;  4DR6 Q;  2VW9 A;  4UAI A;  4CDC C;  4B3M L;  4H0L C;  3P20 A;  4LMQ D;  2OEO A;  1YNN C;  1EIH A;  1D6E C;  5ELF A;  1TS4 A;  2KCN A;  3H3V H;  2XTI A;  1SMX A;  4A3E B;  1PRT B;  3HS0 C;  1O7I A;  3DLL A;  1OO9 B;  2UXC L;  4H7B A;  1PH8 A;  4FO2 A;  1A2U A;  1F2Z A;  5COY A;  1QJO A;  2E2J H;  1SN8 A;  2RQX A;  4JBK A;  1O7L A;  3OHX C;  2A19 A;  1Q3L A;  1QUQ A;  3VR3 A;  3MA2 B;  3SVM A;  2XGT A;  4G4K A;  3W1G A;  1PYW D;  3KLS A;  4C3I H;  3GV6 A;  3L7Z C;  1ICF B;  3OTO Q;  4C3J G;  1F2L A;  1PH7 A;  3MXP A;  3K59 A;  4LUZ A;  4X65 Q;  1WTP A;  4DK1 A;  3V2T A;  1IHZ A;  2SNM A;  1S72 A;  3S1M H;  1SND A;  4K6D A;  1I4H A;  4QB4 A;  2VUM H;  4B3S Q;  2CQO A;  1EQV A;  4IFD J;  3D4R A;  5IT9 E;  3H09 A;  2NZO A;  1F9R A;  4KY5 A;  2IW3 A;  1I94 L;  4KHZ A;  1DOK A;  4YCV A;  1WTW A;  3CC2 A;  3L2P A;  1LT3 D;  1FNU A;  2K6A A;  1XYI A;  5C5M A;  4IUU A;  4K8I A;  1VQ5 A;  4O2D A;  2N3S A;  4JI3 Q;  1PV4 A;  1XMQ Q;  1QWY A;  4YY3 Q;  4A3I B;  4DK0 A;  1WCM H;  4RGT A;  3DMU A;  1PHJ A;  1Y8O B;  3A5Z B;  4YWL A;  2EVB A;  4X3K A;  3J80 c;  3HKS A;  4F7X A;  3I4M G;  4A3L H;  4O0A A;  2JA6 B;  3K7U C;  2F4V L;  5M5Y H;  3GTQ B;  1L1O C;  1K0R A;  1VQH A;  1H9S A;  5IP9 G;  4HSP A;  4A75 A;  4A3F H;  3AFP A;  4R8I A;  2CH4 A;  3H3V C;  2E2D C;  2KA7 A;  4AYB E;  1HNX L;  1L0Y B;  1UWV A;  3J80 i;  1PH4 A;  4DK3 C;  3NQI A;  2R6G A;  1A3V A;  5EKK A;  1HZA A;  3U4Z A;  1SFO B;  3NE5 B;  5C3E H;  3NK9 A;  4CGY B;  3KJP A;  4DV2 Q;  4GNX B;  1LTS D;  1G6P A;  4DAY A;  4OWW B;  2KOL A;  5IOC A;  3FP9 A;  1Q81 C;  1FGU A;  4H13 C;  2L9H A;  2VB2 X;  3NWS A;  1DZ1 A;  3MWY W;  4DR1 L;  1V1Q A;  1GM5 A;  1H9J A;  4JYA L;  1CFM A;  2JA5 B;  2R92 H;  2R7Z G;  5LMN Q;  2BE5 C;  1EU3 A;  4HTH A;  2B2V C;  2KJX A;  1N32 Q;  2V4D A;  2JA8 H;  1SNO A;  4JOI C;  4HR7 B;  2Q8I B;  3HOU G;  3DHQ A;  3GQB A;  2SEB D;  2XSC A;  3DWP A;  5I6W A;  1VQG A;  1ESF A;  3D3R A;  4XQN A;  4UP8 A;  3BJU A;  2N88 A;  2EYO A;  1G8Z D;  2VB3 X;  1V1P B;  5IGE A;  3HKZ E;  3TEH B;  2F0Q A;  5DLQ E;  3GTJ H;  1SYD A;  5AJ3 L;  1S40 A;  3GTP H;  1IKL A;  1F2M A;  1NR4 A;  4DN4 M;  4A93 B;  4HED A;  3T1H L;  1FNV A;  1NUC A;  1VQP A;  3BU2 A;  4KHP L;  3RZO B;  5CC4 A;  4PQX A;  3ONA B;  5E4W C;  2MO0 A;  1IL8 A;  4APV A;  1DOM A;  2QF7 A;  4TSS A;  1PFB A;  1CTM A;  1NR2 A;  1HUM A;  1HZB A;  1HNW L;  1SYE A;  4WJ4 A;  1VCI A;  4DUZ L;  1KRT A;  3EN2 A;  4L6T B;  5FJ8 H;  4M8A A;  1J6Q A;  1L1O B;  1JR0 D;  3CMA A;  2BDN A;  1JOK A;  2F0W A;  3GO5 A;  2H5X A;  4X62 Q;  1GUW A;  1JT8 A;  1PRT D;  4DR5 L;  1YVC A;  4X3S A;  3GV3 A;  2AKW B;  1LAC A;  1LTB D;  1MKH A;  3OMC A;  3T13 A;  2SNS A;  4DV7 L;  2E2J B;  5JOB A;  4EQO A;  1HTL D;  4C1N I;  3AU7 A;  1B9N A;  2C5C A;  3SE0 A;  5KIX A;  2VXW A;  1WD0 A;  3MVV A;  4A3E G;  1CZG A;  1JJ2 A;  1O78 A;  2O4X A;  3W5O A;  4DV1 L;  4C3I B;  5KND A;  2Y0S B;  3BS1 A;  3T16 A;  4WJ3 M;  1MBY A;  4QY7 A;  4HJ9 A;  3E9H A;  4NPS A;  1CT1 D;  5CBA E;  2NN6 G;  5G3L F;  4K2L A;  1N34 L;  4FDB A;  4OO1 H;  4JI0 Q;  5JEA J;  1PTO D;  3Q8D A;  1HZC A;  3U58 A;  2NUC A;  4MN3 A;  4QL5 A;  2VUM B;  3VR4 A;  4DPG A;  3BZC A;  3QWN A;  2CQA A;  2MGS A;  2F0E A;  2L0C A;  2JEB I;  3AEV A;  1BBX C;  5JJI A;  3PO3 G;  5H1S E;  4Q5V A;  1TWH H;  2F0J A;  5C4J H;  4PG3 A;  4R4I A;  1YHQ A;  2UUB L;  1IBM L;  1P16 A;  1XNQ Q;  2F03 A;  3VYR A;  4HJA A;  3SEB A;  4DNT B;  5LMU Q;  3FHW A;  4KLK A;  1CKN A;  3QOL A;  2A68 C;  2RSO A;  1VMC A;  2IX0 A;  1WCM B;  2QW7 A;  4O42 A;  3N6R A;  1O7Z A;  2F0F A;  4C3J H;  4LF6 Q;  5LL6 X;  1X56 A;  3BVM A;  4EQP A;  4ZRZ A;  1F9S A;  4DR7 L;  5M5Y B;  3I72 A;  4A3F B;  1IYJ B;  1SNC A;  1T9H A;  1HNZ Q;  1GUG A;  1ENC A;  4GN5 A;  2NVX H;  3HEJ A;  4LFB L;  2V1C C;  3C2P A;  5C3E B;  4CKB A;  4TKO B;  5BN3 A;  3PF5 A;  1Z6H A;  3ERQ A;  3HOV G;  3DM3 A;  1NMG A;  3PUV A;  2LSS A;  1QZH A;  4OX9 L;  3P7J A;  1AW7 A;  3J7Z C;  3CCQ A;  1DOL A;  4C2M H;  4DV3 L;  4OEL B;  1TS3 A;  2R92 B;  5IP7 G;  2L12 A;  1K3R A;  1H9K A;  4JI8 Q;  2JA8 B;  4H44 C;  4XQJ A;  2FIN B;  1E2Z A;  3I2Z A;  3G48 A;  4MTN A;  3STB C;  2ZJR A;  4A3K G;  1XMO Q;  5M5X H;  5ISR A;  3K57 A;  2A6H D;  1CA6 A;  3PMF A;  4NKL A;  1X3F A;  3C3L A;  2MJ8 A;  5E1F A;  1VQ6 A;  3NQT A;  1D8L A;  1C8C A;  1EOT A;  4JI7 L;  4JK1 C;  3EA6 A;  1BKB A;  3QB3 A;  1B2T A;  5C3W A;  3VYT A;  1M8A A;  4PMB A;  1E7Z A;  1HA5 A;  1TII D;  3GTJ B;  1A3U A;  1DJR D;  5CV5 A;  1SSO A;  2NZ1 D;  5BR8 L;  4DUY L;  3L3O C;  2Z9H A;  3GTP B;  4X64 Q;  1LYL A;  1S5B D;  1ENF A;  3SHL A;  1Y1V G;  2O2L D;  3D8G A;  4A76 A;  1XPU A;  2B2Y A;  3X3M A;  5M3F H;  1CQV A;  2RCN A;  4MHE A;  1C48 A;  2K5W A;  4CDF C;  5C4H A;  1BXT A;  2ZT9 C;  3UE0 A;  1JWM D;  3K5L A;  2Z4I A;  4RCO A;  5CV9 A;  1S3O A;  5C4X H;  3QO2 A;  3HOU H;  2Z8L A;  3ULP A;  2R7F A;  1EQR A;  4LWC A;  1VQ9 A;  5GQO A;  4A93 G;  3OPO A;  4LJZ C;  1ZYR D;  1KXL A;  4XYQ A;  2C9O A;  4BY1 G;  3CF5 A;  2K05 A;  1VF5 C;  1YJ9 A;  2L11 A;  2K52 A;  3UDI A;  1CI3 M;  1GKH A;  4CJ2 C;  1IBL Q;  1QE6 A;  2IHE A;  5EKI A;  1D5X C;  3MXN B;  1D5M C;  2HUG A;  1MSG A;  5F2D A;  4CJ0 B;  3A7L A;  2EY5 A;  3E0J A;  2K32 A;  4LFC L;  1J9O A;  1Q1B A;  3PIP 3;  4HSV A;  4C1N K;  1GHK A;  4JI1 Q;  4IPG A;  1V8Q A;  2QA4 A;  3WOE A;  2QEJ C;  4WJW A;  4U68 A;  1RJT A;  3D6C A;  4OXP A;  3NUC A;  4EGV A;  2LS0 1;  5E7N A;  1EZ8 A;  3CCV A;  1I4G A;  1PH5 A;  1P8L A;  2EYM A;  4S3S A;  3KLS X;  1SYG A;  2BCO A;  1JB3 A;  5IYB H;  4QMG A;  1EOV A;  3X3N A;  4JG2 A;  2ZM6 Q;  1EIF A;  1UE1 A;  2F0T A;  4LAA A;  3CU7 A;  1XTC D;  1TWH B;  1VDZ A;  4X66 L;  5C4J B;  2UUA Q;  2E2H H;  1NBW A;  1VS0 A;  4DNR B;  3Q23 A;  4P71 A;  4L5S A;  1QCB D;  1R4Q B;  1SEB D;  2NVY H;  4QGU A;  5HGQ A;  1YBY A;  1STB A;  3KYH C;  4FP5 D;  1JQY D;  4LW1 A;  1XTD A;  5FLX L;  3KUP A;  4JBM A;  2CW0 C;  2K7V A;  3DUZ A;  1CZW A;  2HCC A;  4C3J B;  1S5F D;  1MD2 D;  2B8F A;  5I9O A;  2NN6 H;  3FEW X;  3OIP A;  2L4N A;  4DR3 Q;  3ER0 A;  3RMH A;  3PSI A;  1MJC A;  1RCV D;  1D5Z C;  2UU9 L;  3IFT A;  1QIL A;  1X55 A;  4PMC A;  3CQZ H;  4KN4 C;  3PO3 H;  2NVX B;  3R8B A;  4IUP A;  1B3A A;  4A3L G;  3EBE A;  4MNO A;  2VQF L;  1PVO A;  1OXU A;  3HFZ B;  3SGI A;  2X69 A;  1CQF A;  1STN A;  1X65 A;  4UDU C;  3K81 C;  1G29 1;  2B63 G;  4OON A;  2NBF A;  4LUO A;  1QG7 A;  3A8K E;  3TZU A;  1J5E Q;  2ZTE A;  3K5O A;  4C2M B;  4G7O C;  4KD3 A;  3FMC A;  4BBR H;  3M3Y H;  4TQU S;  1YHA A;  2PQA B;  3GTL H;  4IO9 A;  3KDF A;  1CK1 A;  3CME A;  2KHS A;  2CH4 W;  3BZK A;  1TKW B;  1EU4 A;  1N9W A;  3LX0 A;  1E3P A;  4LNQ A;  3S1N H;  1H9S B;  5M5X B;  2EJG C;  4RGM A;  5IGC A;  4HIM A;  1A15 A;  4LF5 L;  4DV5 Q;  5I4D A;  2ICI A;  4GOP A;  1AEX A;  2GVB A;  4CBV A;  3L0O A;  4X3T A;  1FD7 D;  4RH6 A;  4PZ8 A;  3GTO H;  2B29 A;  4K0K Q;  2AMC B;  2EJM A;  3HOV H;  4IUV A;  3KBX A;  2VQE L;  1W6K A;  3CKI B;  1YHB A;  2CWP A;  1CKO A;  3HGB A;  5DAU A;  1KNA A;  4A3M G;  4LF4 Q;  4A4I A;  1UAP A;  1KAW A;  2CCZ A;  4A3K H;  1I4X A;  1SMY D;  5C4X B;  1F2Y A;  1TWF H;  2NTT A;  3PV0 A;  4B3T L;  1RHP A;  4DF7 A;  3HOU B;  4IFD H;  2Z6K A;  4YIJ A;  4DU9 A;  2EZV A;  3Q0A A;  3KFU A;  1CHP D;  4HJ7 A;  4LF7 Q;  3F2U A;  3W3A A;  1SE3 A;  2EIF A;  5ELD A;  1HR0 W;  2ASB A;  1X3Q A;  2JJQ A;  4DV0 Q;  4IUN A;  1B50 A;  2N55 A;  1IW7 C;  2LY7 A;  5FJ8 G;  1UE5 A;  5BN4 A;  2A69 D;  1Y1V H;  4O1N A;  1MHW C;  1YJW A;  5FLX E;  3A0J A;  4F87 A;  2PPB C;  1B1Z A;  4GKK Q;  4LF9 Q;  3PIO A;  2VS1 A;  4DV4 Q;  1Z7T A;  4LF8 L;  1Q90 A;  3FKI G;  2B8G A;  1SE2 A;  2PO4 A;  2N8N A;  4PMW A;  1HFN A;  3ND9 A;  2YTX A;  3F1Z A;  2A8V A;  3S1R B;  1EQQ A;  3T53 B;  4B3R L;  2KQ3 A;  4L5R C;  1FYC A;  3G7L A;  1Y1W G;  4BY1 H;  2DNE A;  4ODG A;  4XQQ A;  1HTP A;  1GUN A;  1EWC A;  1CSP A;  1E2V A;  2JN4 A;  5IIF A;  3CCM A;  4AQY L;  1BCP C;  1Z9F A;  2PCF B;  4HAE A;  1MSH A;  2Z0S A;  1ZXT A;  2EJF C;  4JI5 L;  2J0T D;  3H0G H;  4DR4 L;  1J8I A;  3KBG A;  3LNN A;  2BDO A;  2E2H B;  4OO1 G;  1STA A;  1F77 A;  1R9T H;  1HFG A;  4CDE C;  4P2C B;  3HOX G;  3VR6 A;  2NVY B;  1II3 A;  1ESR A;  3PCO B;  3T4A C;  2PZT A;  1A8V A;  2WII B;  3MTS A;  5CR3 A;  5C44 H;  5ELE A;  4GNX C;  2ALY B;  4OIK A;  1U4P A;  2NWG A;  1X3E A;  4GLX A;  3TP7 A;  1L2F A;  1EZ6 A;  2R7D A;  2OWO A;  2WKC A;  4KKT A;  2YV5 A;  4ZYS A;  4PV1 C;  2AQ2 B;  4C3H H;  3OW7 A;  4EVO A;  1ML0 D;  5IGB A;  4RG1 A;  3CRK C;  4KJO A;  1AP0 A;  3S14 H;  2WKD A;  5IOD A;  2EPB A;  2JK8 A;  4JBJ A;  2F52 A;  1NNX A;  3VDY A;  4MTK A;  2IL8 A;  1HUN A;  4N9P A;  3P75 A;  3CQZ B;  3PO3 B;  3S15 H;  5T1I A;  1GOZ A;  1A6X A;  1BNZ A;  2RHQ B;  1ONL A;  4K5V A;  5LL6 S;  5COR A;  4BA1 I;  2F3I A;  4OWX B;  4DGZ A;  2BA0 A;  1XNR Q;  5GRO A;  2E5L L;  3OYY A;  3J81 L;  1YNX A;  2RVL A;  4OO1 I;  3H94 A;  5I6Y A;  1KAA A;  1UE6 A;  4BBR B;  3M3Y B;  1NCV A;  3GTL B;  4XT1 B;  1I6V C;  1G2S A;  4RKL A;  2PMZ E;  4EX5 A;  4NB3 A;  3S1N B;  4JCV E;  2PQE A;  3OIQ A;  4DAP A;  4R1J A;  1XPR A;  5CGK A;  4IJH A;  2AQ1 B;  1B4O A;  3JC6 6;  5IGD A;  1BCP B;  1VQC A;  1PH6 A;  4OIJ A;  1G51 A;  1FJG Q;  4DXG A;  3GTO B;  5JAV A;  1JCK B;  1U9R A;  3QG1 A;  3HOV B;  2B63 H;  2EXD A;  1WTH A;  2B2W C;  3GP7 A;  2NVQ H;  1A62 A;  2QEX A;  1EY0 A;  4Z9C B;  1EY9 A;  1HQM C;  2ZXP A;  1IYV A;  5KGU A;  5FOB B;  3CPW A;  4HCE A;  2CW0 D;  5JEA H;  1VQE A;  4A3K B;  4B9X A;  1TWF B;  2LXK A;  4GKJ Q;  1XPO A;  1X6O A;  4DR2 L;  1E2W A;  2MPM A;  5M3F G;  2WB1 B;  5IWA L;  1LAB A;  1ILP A;  3I4N H;  1UEB A;  1XJV A;  4R4O A;  4JI6 L;  4IQZ A;  5C4X G;  3G4S A;  3MFG A;  3W1B A;  2IJ0 A;  4LF4 L;  2B2T A;  4DKA C;  5ELB A;  3HG9 A;  1R4P B;  1NMF A;  1Y1V B;  3TME A;  4ZUJ A;  2RKS A;  2UXD Q;  3IKJ A;  2CHB D;  5D14 A;  2JE6 I;  3OW2 A;  4IOA A;  4A3M H;  1MJE A;  2RHS B;  2QCP X;  2JXM B;  3J80 L;  4YHH Q;  2YU9 H;  3K80 C;  5JVG 3;  1KC8 C;  3BVG A;  1KL9 A;  2B2U A;  4WOR A;  4BY1 B;  1V43 A;  3I4L A;  3W2D A;  1HZ9 A;  2NB0 A;  3NSW A;  1VQL A;  1N36 L;  3BDC A;  5G3L D;  1PFS A;  1JE5 A;  4FNF A;  3H0G B;  1K28 A;  3CCU A;  2L5T A;  3DWA A;  1BVS A;  1R9T B;  3J81 E;  2PI2 E;  3TRZ A;  1CHQ D;  2G9H D;  5IYB G;  1CUK A;  4P72 A;  2OXP A;  4A3B G;  2JA7 H;  1H9R A;  2K4K A;  2HHH Q;  3FKI H;  1VQN A;  5T1G A;  4CKC A;  4ZK9 B;  1CM9 A;  2ZXR A;  5JPM C;  2I5M X;  1PFN A;  4C3H B;  1I4R A;  4DR6 L;  1K83 H;  3HOY H;  1LTL A;  1Y1W H;  4DFA A;  3TS0 A;  4G7H C;  2TMP A;  3C46 A;  2WAQ B;  3S14 B;  1HHV A;  5M9O A;  2AWO A;  1LT5 D;  1X32 A;  3CC7 A;  3DM1 A;  4AYB G;  4OEM B;  3NEM A;  1U4L A;  3S15 B;  5J1Z A;  4L8J A;  1VQ8 A;  4FYD A;  1DM0 B;  3TP5 A;  2E76 C;  3LGJ A;  4QUC A;  4POF A;  1RDP D;  3HOX H;  1I4P A;  2CVR A;  3S1M B;  2F0U A;  1E1O A;  3A56 A;  2XVS A;  1KDC A;  3M4Q A;  1EWH A;  4X3U A;  2HQE A;  3ND8 A;  3BDL A;  3VR2 A;  4FF2 A;  2R61 A;  2DNC A;  2JP1 A;  3OTO L;  3QR8 A;  4JI4 Q;  1IL2 A;  4X65 L;  4KHV A;  4NP5 A;  2EDG A;  5GAG C;  4BBR G;  2F0L A;  5D65 A;  5A2Q L;  4B3S L;  5IYD H;  3A55 A;  2ZJQ A;  1H95 A;  1LM0 A;  3S17 H;  1BUV T;  1BBW A;  2QDL A;  4GLA C;  4PZ6 A;  5FLM G;  2B63 B;  1YNN D;  2NZH A;  1OXS C;  2NVQ B;  2JQO A;  2IT1 A;  2NN6 I;  4XYO A;  2L15 A;  4JI3 L;  1VQD A;  1XMQ L;  3J80 E;  1CSQ A;  4YY3 L;  4NXN Q;  2I07 B;  4BWG B;  1I3Q H;  4JC0 A;  1U5K A;  2WIN B;  4KKU A;  2BA1 A;  3LWE A;  1SLJ A;  3K8A A;  2OQK A;  1AE2 A;  3CCR A;  4WRD A;  1I50 H;  1FVI A;  2KED A;  1JC7 A;  1EQT A;  3E9I A;  3I4N B;  2K50 A;  1BCP F;  3CW2 C;  1I6H H;  4DV6 Q;  3MC0 B;  4L5Q A;  4KKS A;  1YZ6 A;  3GTG H;  2I0Q A;  3CCE A;  1B9M A;  2PNH A;  3EJI A;  4I7A A;  4IFD G;  2Y0S E;  4DV2 L;  2ES2 A;  2LFN A;  3BZD B;  4DAV A;  1NSN S;  4I65 A;  2WB1 G;  1BQQ T;  4BBS H;  5E4X A;  1HR0 Q;  3NBH B;  3F2D A;  1WOC A;  3I73 A;  1DCZ A;  4J6H A;  1MIU A;  3A7A B;  1RIP A;  4A3M B;  2EYP A;  5LMN L;  1JWU D;  1STY A;  2F0S A;  3OOC A;  2EYJ A;  1N32 L;  1SYC A;  2UXB Q;  2Q2T A;  1XWE A;  4M1U B;  2YU9 B;  4IZ8 A;  1EY4 A;  1KAB A;  3M7N A;  1SYB A;  3S9W A;  1BBU A;  2OT2 A;  4JPB W;  2K33 A;  3S2H H;  5CV7 A;  1EYG A;  2AUK A;  2I5H A;  2UUC Q;  1LTG D;  4EQ5 A;  1V9P A;  1JMC A;  1EY7 A;  4ZAI A;  5JJK A;  4HN7 A;  5K5P A;  5GAD C;  1OTC A;  3QJY A;  2YTY A;  1N33 Q;  4RHS A;  4KMU C;  4ALP A;  2JSO A;  2I5L X;  1KQS A;  2Q2I A;  4LFA Q;  5LHY 1;  1V1P A;  3RLO A;  2JA7 B;  1BR9 A;  3FKI B;  4IFD I;  1LV9 A;  2D0O A;  3NTH A;  3H0G G;  1Q8I A;  1FNW A;  3CXC A;  4J15 A;  3MEF A;  1QNK A;  2OTJ A;  1K83 B;  3HOY B;  3BYT B;  1Y1W B;  1PH1 A;  4F8M A;  1IZ6 A;  4J8Q A;  4KK7 A;  5A2Q E;  3T1Y Q;  2XN9 C;  3UDG A;  3AB9 A;  5C44 G;  4ZQ3 A;  2O5J C;  2ZXO A;  1WI5 A;  5M3M H;  2BE5 D;  4IUQ A;  3A54 A;  4X62 L;  3RN5 A;  3C1E A;  4C3H G;  2EY6 A;  3T51 B;  2DJF C;  1IBK Q;  3HOX B;  2AWN A;  5FO8 B;  1L1O A;  2WAQ G;  1LTI D;  4KY6 A;  4JI2 Q;  4A3B H;  1KDB A;  2QDB A;  5EKL A;  4B3M Q;  1K8M A;  2I46 A;  4WFN 3;  1M4V A;  4ZLT F;  3MXG A;  3KJO A;  2LKV A;  1TY0 A;  3I7F A;  1CKM A;  5EPL A;  1ENA A;  1QUQ B;  4POG A;  3ULL A;  2UXC Q;  4JI0 L;  3MXU A;  3SXH A;  3FDT A;  2K03 A;  2K5D A;  2F4I A;  4R4T A;  2WV6 D;  4FF1 A;  3S1Q H;  1T5X D;  4HJ8 A;  2B2V A;  1S5C D;  4JOI A;  3S17 B;  1C9O A;  4HIO A;  2BOS A;  1C4Q A;  1EY5 A;  2Q2H A;  3K7A H;  1YIJ A;  3GDE A;  2XWB B;  4CKE A;  3CHB D;  1XNQ L;  3PQI A;  1SE8 A;  5D3I B;  5LMU L;  5NUC A;  2XRQ D;  1EYC A;  1B7Y B;  3HZX A;  4P75 A;  4HJ5 A;  2Q2U A;  2KHJ A;  1I3Q B;  4LF6 L;  1SDF A;  3H15 A;  3BYY B;  3IL8 A;  4A3D G;  4I7Z C;  1JB7 A;  1I94 Q;  3LWU A;  3I55 A;  5EQ0 A;  4OGQ C;  1TY2 A;  2VY3 A;  3WWV A;  1AZP A;  3H91 A;  4RFB A;  5IT9 c;  3S24 A;  1I50 B;  1GVP A;  2K14 A;  1HNZ L;  3TBI B;  1TS2 A;  1QVC A;  5C0X J;  5JEA G;  3HOW G;  1I6H B;  3PO2 G;  2HDM A;  2GA4 B;  4HIK A;  1PTO H;  4K5X A;  2SDF A;  2EQS A;  3GTG B;  4NXM Q;  5FLM H;  1O80 A;  3U9S A;  3UE1 A;  3NTI A;  3FVQ A;  3Q6S A;  3Q24 A;  4KD4 A;  1TQO A;  4QIW B;  3VR5 A;  4CJ1 B;  2M2L A;  1LO5 D;  2F4V Q;  3O13 A;  4BBS B;  1EEI D;  3I4N G;  1AZQ A;  1UEA B;  4HMI A;  5I2X A;  4DAY B;  2EYH A;  2EY1 A;  3KLR A;  1HNX Q;  4JI8 L;  3D0F A;  2AQ3 B;  3AMU A;  5ELO A;  1NAP A;  2FMM A;  4K2K A;  5D3D A;  3S16 H;  1WTR A;  1XMO L;  1M1K C;  1B3Q A;  1PXU A;  3CCL A;  5M3F B;  3VYS A;  2A68 D;  4P73 A;  2EYF A;  3S2H B;  1PDQ A;  4PNY A;  4DR1 Q;  3V96 A;  1Q7Y C;  3TP8 A;  4JYA Q;  3M4Y A;  2EE1 A;  4V19 0;  3SK4 A;  3E5S A;  2E2I H;  1RD9 D;  2M9V A;  3K0X A;  4X64 L;  3B6Y A;  1TXY A;  2MUY A;  2J7Z A;  4LUV A;  4A3G H;  2RDF A;  4J1M A;  3JAM L;  5I2Y A;  1ET6 A;  2NTS A;  2D9U A;  2EOT A;  5KYI A;  1K73 C;  1QOH A;  2GVA A;  3IRB A;  3TRE A;  4UY8 C;  4ME3 A;  3NXW A;  4LK1 C;  3F2C A;  5AJ3 Q;  1DXM A;  1SRU A;  1Z47 A;  3PUY A;  2JA7 G;  4TVA B;  4LFA L;  3S2D H;  4HID A;  1X3P A;  3H6M A;  1S5D D;  5M3M B;  3UDX A;  3T1H Q;  1TWG H;  4KHP Q;  4P74 A;  4NDX A;  1TT2 A;  2EY2 A;  1D1I A;  5TSS A;  3STB D;  1S4Z A;  3K0Y A;  1IBL L;  3HOY G;  1LUZ A;  3R2T A;  1QVF A;  2DGY A;  3G6J B;  5FK9 C;  1W3S A;  3V05 A;  2LXJ A;  2KEE A;  3ICE A;  3PUZ A;  4DNI A;  1HNW Q;  4A3B B;  1ASZ A;  4DUZ Q;  4R9W A;  3SK8 A;  1VQ4 A;  2AHO B;  1Q8K A;  4JI1 L;  3T56 B;  2D5D A;  5J39 A;  2C35 B;  4JBW A;  4K8J A;  4CHT B;  4DR5 Q;  1B8A A;  5EGT A;  2KVM A;  1JWS D;  2A73 B;  3A74 A;  1SBB B;  3F2B A;  1LT6 D;  2SOB A;  1PYB A;  1XXG A;  2RSN A;  4DV7 Q;  4QJF A;  4A3J H;  4IUR A;  1X9N A;  4PZ7 A;  2F0D A;  5ELC A;  4GZY C;  4IPC A;  1HXY D;  4AYB B;  4JI2 L;  4MZ9 A;  3S1Q B;  3CRL C;  4RA8 A;  1K8G A;  1SR3 A;  2F0I A;  2ZM6 L;  1YJN A;  1ROD A;  4BXX H;  4DV1 Q;  2F0N A;  2LMC B;  4F88 A;  3J81 i;  4GN3 B;  3M85 A;  2KCC A;  2UUA L;  1YNJ C;  2MNA A;  4JV5 Q;  1LTR D;  1G91 A;  3PIO 3;  1K9M C;  3K7A B;  2DY7 A;  4IOC A;  5EBC A;  3UI2 A;  1N34 Q;  4ME5 A;  1YIT A;  1SJH D;  5IYD G;  2B3G A;  1TWC H;  4X6A H;  2XNA C;  1GUS A;  3KF6 A;  1B44 D;  3DEO A;  1D2B A;  2Z1C A;  2OF1 A;  1TU2 B;  3MAQ A;  2K5N A;  1I5F A;  1SAP A;  1DGS A;  2A5H A;  2B2Y C;  5EJW A;  3ITP A;  5KNC A;  1CKN B;  5KYL A;  4BY7 H;  2MHV A;  3PUX A;  4DR3 L;  1YEZ A;  2UUB Q;  1K3B C;  4RCN A;  1IBM Q;  1Y14 B;  2ZTC A;  2F1M A;  3BDO A;  5DM6 3;  3DWQ A;  3VYU A;  2A6H C;  3A8J E;  3D4W A;  3HKZ B;  4HMJ A;  1LTA D;  2R93 H;  1AFP A;  1QZG A;  1PTO B;  3GTK H;  3D6W A;  1NY4 A;  1ASY A;  1PZK D;  3G71 A;  3KK7 A;  1GJX A;  3TDQ A;  3QIA A;  5EPK A;  1QNU A;  2VZA A;  4EQN A;  1LTT D;  5DNF A;  4FVM A;  1EL0 A;  2K5Q A;  3JAM E;  4DR7 Q;  4DAM A;  1TWA H;  4E6I A;  4GN4 B;  2IY5 B;  4H02 A;  3VA7 A;  1J5E L;  1BF4 A;  1V1O A;  4A3D H;  2MO1 A;  4LFB Q;  5JPN C;  4R8N A;  2IPK D;  2DY8 A;  1KHI A;  3S16 B;  1ILQ A;  4BBS G;  4NXM L;  1KNE A;  2E75 C;  2PQA A;  5AFW A;  3A5U A;  4DV5 L;  3HOW H;  2G5D A;  1AN8 A;  3PO2 H;  4OX9 Q;  1ZYR C;  3J81 j;  1HQR D;  4DV3 Q;  1EUJ A;  2YTV A;  2HCI A;  3EIV A;  3KOJ A;  4K0K L;  1JJG A;  2E2I B;  2HIV A;  2IHF A;  5L37 A;  5M5W H;  4A3G B;  1Y8P B;  3U9O A;  1ET9 A;  4ZKB B;  5EBD A;  3KLW A;  1VMP A;  3VA5 A;  2N49 A;  4ID6 A;  2K1B A;  4UP9 A;  2FHT A;  2IX3 A;  3ERO A;  1AH9 A;  1EIG A;  4R4Q A;  3IFD A;  1Q12 A;  4JI7 Q;  1UE7 A;  1HPC A;  4XIG S;  1IXR A;  1H9M A;  2F3W A;  5CV4 A;  3CC4 A;  4BA2 I;  4OL7 A;  4IUT A;  5BR8 Q;  3FPU B;  3BVZ A;  4DUY Q;  5C0X G;  2H1E A;  4K5W A;  3S2D B;  1E24 A;  2E8G A;  3CAM A;  4A3C H;  2R3Z A;  3UDF A;  3K58 A;  3RZD H;  2NVT H;  4LF7 L;  2FFK B;  1WFQ A;  1PFM A;  3NEN A;  4OWT B;  1TWG B;  4ZKC B;  1EWI A;  3J7Y W;  2D62 A;  4FXK C;  2B39 A;  1VQK A;  1U4R A;  4DV0 L;  3NP8 A;  4BS9 A;  4U67 3;  3R3O A;  2XRS D;  3HOZ H;  1C0A A;  3NEL A;  1EYD A;  3E3X A;  3I8Z A;  2TSS A;  4KV6 A;  5M3M G;  4GKK L;  4LF9 L;  4DV4 L;  1JE4 A;  5IYC G;  3KF8 A;  4QUF A;  4FXD A;  1UNS A;  1PYS B;  2RDH A;  1KDA A;  1Q86 C;  3E0E A;  3A8I E;  3U50 C;  3OMG A;  2F3V A;  3RN2 A;  2D2C C;  1CA5 A;  5C44 B;  1Q46 A;  3EVQ A;  1STH A;  4NMZ A;  2JYO A;  1STG A;  4A3J B;  2UXB L;  5C5L A;  4LFC Q;  3GD7 A;  4ILW A;  4K6L A;  4R4C A;  1GD7 A;  1MGS A;  5HGT A;  4FF3 A;  2PNR C;  5I9P A;  4FXG C;  5C0X I;  1HCZ A;  4GOP C;  2HQL A;  4G57 A;  2RCF A;  4OHJ A;  5IGG A;  3RD4 A;  1L0W A;  1IYU A;  3J7A F;  3I70 A;  1WYD A;  2CWA A;  1TWC B;  1K0S A;  4UP7 A;  2AUJ D;  4NW2 A;  2WB1 E;  1IW7 D;  4QF4 A;  3CCS A;  3R93 A;  4BY7 B;  4X66 Q;  2X6G A;  1FR3 A;  4JV5 L;  4IPH A;  2KBN A;  3QOJ A;  1SNP A;  3I56 A;  1QB5 D;  2MFI A;  5IGF A;  1RTN A;  1JOQ A;  2Z6K C;  1HRJ A;  4HCS A;  2R93 B;  3PUW A;  3GTK B;  3NWT A;  4TRD A;  5DEH A;  4G7Z C;  1KTK A;  3K5M A;  2OTL A;  1PRT F;  4QCL A;  3MFY A;  1Y8N B;  2PW5 A;  5CV6 A;  1BCP D;  1XNR L;  3RLN A;  3HKZ G;  1IKM A;  1TWA B;  3G6E A;  2UU9 Q;  1LLR D;  1PA6 A;  5ELN A;  1W6J A;  4JW0 A;  4FF4 A;  1DD2 A;  3AYH B;  3HP3 A;  5GAH C;  4A3D B;  2OQ0 A;  2ENB A;  3IAY A;  2HT1 A;  3ERS X;  2A6E C;  1BDO A;  1JOO A;  2VQF Q;  3DEP A;  4RKB A;  2MQH A;  3KDF B;  1SMY C;  3HOW B;  1OXV A;  3WOF A;  3PO2 B;  1PTO F;  1WTV A;  1JIC A;  3CPF A;  4KJN A;  4L63 B;  1FJG L;  2K04 A;  4A3I G;  2WFW A;  1YNJ D;  1HH2 P;  2F0K A;  4UHV A;  1SE4 A;  4GOP B;  2JEA I;  5M5W B;  1U0L A;  1KLU D;  3RR5 A;  3M4P A;  4IJL A;  2GN5 A;  1XX8 A;  2PI2 A;  2JA6 G;  1GUO A;  1EFW A;  2WAQ E;  3M7G A;  4LF5 Q;  2A69 C;  4DXF A;  5BN5 A;  2FJ2 A;  1E22 A;  1VQA A;  4IAL A;  5KEE A;  2EYL A;  2VL6 A;  2VNU D;  1TR5 A;  2NYZ D;  2WAC A;  4N9T A;  4A3G G;  4GKJ L;  2O5I C;  1X54 A;  5J3B A;  2HD3 A;  3I4M H;  3J7A 5;  2ID0 A;  4GNX A;  1WTO A;  3CP0 A;  2VQE Q;  2NVT B;  3RZD B;  5IP9 H;  2L1B A;  2DJG C;  1KLG D;  5CYU A;  3D4D A;  2JA5 G;  1L0X B;  3PIP A;  2Z6B A;  3MEH A;  1D1K A;  4GLV B;  3D31 A;  1U4M A;  1UUP A;  5FO9 B;  3HOZ B;  2ZTD A;  4B3T Q;  3NHH A;  2CKZ B;  2H4O A;  2UXD L;  3NTK A;  5FO7 B;  1WVL A;  1HA6 A;  1LT4 D;  2EXZ A;  4RHR A;  4YHH L;  3L9A X;  5E3F A;  4Y7N H;  4MIU A;  1DON A;  2K01 A;  1S5E D;  2Z4H A;  2R7Z H;  3EFX D;  1VQB A;  5C0X H;  5JJL A;  1EYA A;  3GTM H;  5LMN W;  1A3T A;  3R2I A;  4AIM A;  1I4Q A;  2PW7 A;  5HUR A;  2MP1 A;  1M90 C;  4XTC S;  1GUT A;  3ZJY C;  4LF8 Q;  3BG3 A;  1YI2 A;  4RGN A;  1VQ7 A;  2RBM A;  4QQB X;  5FLX c;  4N8X 1;  1HJP A;  3U4V A;  2BH2 A;  1ICW A;  2J4X A;  5K36 G;  1STE A;  4A3J G;  4B3R Q;  1G6Z A;  1PH9 A;  2XIW A;  1VQF A;  2Q8T A;  5IYC H;  2HHH L;  4BXX G;  5A35 A;  3CD6 A;  2F0G A;  1BO0 A;  4AQY Q;  4XT3 B;  1PH2 A;  3M4O H;  4JVZ A;  4RMF A;  1B53 A;  4JI5 Q;  4DR4 Q;  2B2W A;  4L5T A;  3PGZ A;  5HY6 A;  3TSS A;  2KCM A;  3K6O A;  3TN2 A;  4KI0 A;  1OXT A;  3S1R H;  4DA2 A;  3I3C A;  1A2T A;  1SNQ A;  3TQY A;  1PMR A;  1C7Y A;  3Q22 A;  2F0M A;  3P1H A;  4RAU C;  1FL0 A;  2FMC A;  1G2T A;  2X6L A;  4C3I G;  4BY7 G;  4UPA A;  3I91 A;  3SK5 A;  2ZJP A;  2Y0S G;  1FGB D;  1PLF A;  5C4Z A;  4KTA A;  1RL2 A;  2G9D A;  3HRZ C;  2B2T C;  3KF6 B;  3M9B A;  1TS5 A;  2KHI A;  2R93 G;  1EEF D;  2QGQ A;  4Q0F A;  5CV8 A;  4KY7 A;  2VUM G;  4A3E H;  1VF7 A;  2K28 A;  2ICE C;  4JI4 L;  4CDD C;  1NJI C;  2OCE A;  1VQO A;  1AE3 A;  1K8O A;  1EFI D;  2F0O A;  3MHB A;  2RF4 A;  2N78 A;  3E6Z X;  1T5E A;  3H3V I;  2B2U C;  2E5L Q;  4YWK A;  4ZCK A;  1QVG A;  3WDN A;  1X3G A;  3C1F A;  1SXT A;  1WCM G;  3OSO A;  1EIY B;  4ULL A;  2IWH A;  2A1A A;  2PZW A;  4KN7 C;  1OXX K;  3AFQ A;  1NTG A;  1KRS A;  2L55 A;  3I90 A;  1RKN A;  4NXN L;  3RLF A;  2Q8R E;  4N8F A;  3CCJ A;  4A3F G;  5KNB A;  3OWF A;  3SR1 A;  2K5H A;  3SDZ A;  1F9P A;  2A74 C;  2M00 A;  5CBE E;  2QKI C;  5C3E G;  4RGO S;  1GXD C;  2DN8 A;  1JJC B;  3JAM c;  3I4M B;  1Y69 U;  4XXE A;  1BOS A;  5KRU A;  2E74 C;  3K5N A;  1SRO A;  4DV6 L;  4GS3 A;  4DK6 C;  5IY0 A;  4A3I H;  3TP6 A;  2IX1 A;  2RA4 A;  4K14 A;  3SK6 A;  1RTO A;  2BH8 A;  1N8R C;  2R92 G;  3RUZ A;  3I4O A;  2XWJ B;  3JAM i;  5C3X A;  4XDX A;  2KEC A;  4B08 A;  1PZI D;  2JA8 G;  2JA6 H;  5EPJ A;  1HR0 L;  2PYK A;  1Q82 C;  3GTQ H;  4A3C G;  5IE8 A;  1SJE D;  4YCW A;  1K8A C;  4DR2 Q;  4ZUI A;  3ULJ A;  5IWA Q;  1MI2 A;  1PRT C;  2KCT A;  1SNM A;  3NBI A;  4Y7N B;  5JVH 3;  4JI6 Q; 
#chains in the Genus database with same CATH homology
 1DYQ A;  2KUM A;  3NBH A;  2R7Z B;  2YYZ A;  1EY6 A;  2A6E D;  5IT9 L;  3J7A V;  1F9Q A;  1Q1E A;  3GTM B;  3FRP B;  5C6A A;  1JOR A;  1RF2 D;  2F0P A;  2PZU A;  1PZJ D;  3OWE B;  1GHJ A;  3DXJ C;  1WTQ A;  2F0V A;  2HDL A;  5DM7 3;  2RDG A;  1WD1 A;  1EY8 A;  5JJZ A;  1PTO C;  1ZEQ X;  1E0B A;  3MZ5 A;  2QIL A;  2F0H A;  3NPP A;  1TVX A;  1O7Y A;  4V0B A;  4ABN A;  3EQL C;  3FPP A;  3M4O B;  2PMZ B;  1ZKO A;  5J22 A;  4RWS C;  2WP8 J;  5FKA C;  3MXN A;  3TZD A;  3ZYY X;  3URY A;  3N52 A;  1SYF A;  4C56 C;  4IN3 A;  1WTX A;  4B9W A;  5CMD A;  5K36 H;  4UAI A;  4H0L C;  3P20 A;  4LMQ D;  2OEO A;  1YNN C;  1EIH A;  1D6E C;  5ELF A;  1TS4 A;  2KCN A;  4A3E B;  1PRT B;  3HS0 C;  1OO9 B;  4H7B A;  4FO2 A;  1A2U A;  1F2Z A;  5COY A;  1QJO A;  2RQX A;  1O7L A;  3OHX C;  1Q3L A;  3VR3 A;  3MA2 B;  3SVM A;  4G4K A;  1PYW D;  3KLS A;  3GV6 A;  3L7Z C;  4C3J G;  1F2L A;  3MXP A;  3K59 A;  1WTP A;  4DK1 A;  3V2T A;  1IHZ A;  2SNM A;  1SND A;  4K6D A;  1I4H A;  4QB4 A;  1EQV A;  4IFD J;  3D4R A;  5IT9 E;  3H09 A;  1F9R A;  4KY5 A;  2IW3 A;  4KHZ A;  1DOK A;  1WTW A;  1LT3 D;  1FNU A;  2K6A A;  1XYI A;  5C5M A;  4IUU A;  4K8I A;  1QWY A;  4A3I B;  4DK0 A;  4RGT A;  3DMU A;  1Y8O B;  2EVB A;  4X3K A;  4F7X A;  2JA6 B;  3GTQ B;  1H9S A;  4HSP A;  4R8I A;  3H3V C;  2E2D C;  2KA7 A;  1L0Y B;  3NQI A;  2R6G A;  1A3V A;  5EKK A;  1SFO B;  3NE5 B;  3NK9 A;  4CGY B;  1LTS D;  4DAY A;  2KOL A;  5IOC A;  4H13 C;  2L9H A;  2VB2 X;  3NWS A;  1DZ1 A;  3MWY W;  1H9J A;  1CFM A;  2JA5 B;  2BE5 C;  1EU3 A;  4HTH A;  2B2V C;  2KJX A;  2V4D A;  1SNO A;  4HR7 B;  2Q8I B;  3DHQ A;  3GQB A;  2SEB D;  2XSC A;  3DWP A;  5I6W A;  1ESF A;  3D3R A;  4XQN A;  2N88 A;  2EYO A;  1G8Z D;  2VB3 X;  1V1P B;  5IGE A;  2F0Q A;  1SYD A;  1IKL A;  1F2M A;  1NR4 A;  4DN4 M;  4A93 B;  4HED A;  1FNV A;  1NUC A;  3RZO B;  5CC4 A;  4PQX A;  3ONA B;  5E4W C;  1IL8 A;  1DOM A;  2QF7 A;  4TSS A;  1PFB A;  1CTM A;  1NR2 A;  1HUM A;  1SYE A;  1VCI A;  4L6T B;  4M8A A;  1JR0 D;  2BDN A;  1JOK A;  2F0W A;  3GO5 A;  1GUW A;  1PRT D;  4X3S A;  3GV3 A;  1LAC A;  1LTB D;  3OMC A;  3T13 A;  2SNS A;  2E2J B;  5JOB A;  4EQO A;  1HTL D;  4C1N I;  3AU7 A;  1B9N A;  2C5C A;  3SE0 A;  5KIX A;  2VXW A;  1WD0 A;  3MVV A;  1CZG A;  1O78 A;  2O4X A;  4C3I B;  5KND A;  2Y0S B;  3BS1 A;  3T16 A;  1MBY A;  1CT1 D;  5CBA E;  2NN6 G;  5G3L F;  4K2L A;  4OO1 H;  5JEA J;  1PTO D;  2NUC A;  4MN3 A;  2VUM B;  3VR4 A;  3QWN A;  2CQA A;  2MGS A;  2F0E A;  2L0C A;  2JEB I;  1BBX C;  4Q5V A;  2F0J A;  2F03 A;  3VYR A;  3SEB A;  4DNT B;  3QOL A;  2A68 C;  2RSO A;  1VMC A;  2IX0 A;  1WCM B;  4O42 A;  3N6R A;  1O7Z A;  2F0F A;  5LL6 X;  3BVM A;  4EQP A;  4ZRZ A;  1F9S A;  5M5Y B;  3I72 A;  4A3F B;  1SNC A;  1GUG A;  1ENC A;  3HEJ A;  3C2P A;  5C3E B;  5BN3 A;  4CKB A;  4TKO B;  1Z6H A;  3ERQ A;  3PUV A;  3P7J A;  1AW7 A;  1DOL A;  1TS3 A;  2R92 B;  2L12 A;  1H9K A;  2JA8 B;  4H44 C;  4XQJ A;  2FIN B;  1E2Z A;  1CA6 A;  5ISR A;  3K57 A;  2A6H D;  3PMF A;  4NKL A;  3C3L A;  2MJ8 A;  5E1F A;  3NQT A;  1C8C A;  1EOT A;  4JK1 C;  3EA6 A;  3QB3 A;  1B2T A;  5C3W A;  3VYT A;  1M8A A;  4PMB A;  1HA5 A;  1TII D;  3GTJ B;  1A3U A;  1DJR D;  5CV5 A;  1SSO A;  2NZ1 D;  3L3O C;  3GTP B;  1S5B D;  1ENF A;  3SHL A;  2O2L D;  3D8G A;  2B2Y A;  3X3M A;  1CQV A;  4MHE A;  1C48 A;  2K5W A;  5C4H A;  1BXT A;  2ZT9 C;  1JWM D;  3K5L A;  2Z4I A;  4RCO A;  5CV9 A;  3QO2 A;  2Z8L A;  3OPO A;  4LJZ C;  1ZYR D;  4XYQ A;  2C9O A;  2K05 A;  1VF5 C;  2L11 A;  1CI3 M;  4CJ2 C;  1QE6 A;  5EKI A;  1D5X C;  1D5M C;  2HUG A;  1MSG A;  5F2D A;  4CJ0 B;  3A7L A;  2EY5 A;  3E0J A;  2K32 A;  1J9O A;  1Q1B A;  3PIP 3;  4HSV A;  4C1N K;  1GHK A;  1V8Q A;  3WOE A;  2QEJ C;  4WJW A;  4U68 A;  1RJT A;  3D6C A;  3NUC A;  4EGV A;  2LS0 1;  1EZ8 A;  1I4G A;  2EYM A;  4S3S A;  3KLS X;  1SYG A;  2BCO A;  1JB3 A;  4QMG A;  3X3N A;  2F0T A;  4LAA A;  3CU7 A;  1XTC D;  1TWH B;  1VDZ A;  5C4J B;  3Q23 A;  4DNR B;  1QCB D;  1R4Q B;  1SEB D;  1STB A;  4FP5 D;  1JQY D;  5FLX L;  3KUP A;  2CW0 C;  2K7V A;  3DUZ A;  1CZW A;  2HCC A;  4C3J B;  1S5F D;  1MD2 D;  2B8F A;  5I9O A;  2NN6 H;  3FEW X;  3OIP A;  2L4N A;  3RMH A;  1RCV D;  1D5Z C;  3IFT A;  1QIL A;  4PMC A;  4KN4 C;  2NVX B;  3R8B A;  4IUP A;  1B3A A;  1OXU A;  2X69 A;  1CQF A;  1STN A;  4UDU C;  1G29 1;  2NBF A;  1QG7 A;  3A8K E;  3TZU A;  3K5O A;  4C2M B;  4G7O C;  4KD3 A;  3FMC A;  4TQU S;  1CK1 A;  2KHS A;  1TKW B;  1EU4 A;  3LX0 A;  1H9S B;  5M5X B;  2EJG C;  4RGM A;  5IGC A;  1A15 A;  5I4D A;  2ICI A;  1AEX A;  4CBV A;  4X3T A;  1FD7 D;  4RH6 A;  2EJM A;  4IUV A;  3KBX A;  1W6K A;  3CKI B;  3HGB A;  5DAU A;  1KNA A;  1UAP A;  1I4X A;  1SMY D;  5C4X B;  1F2Y A;  2NTT A;  3PV0 A;  3HOU B;  4IFD H;  1RHP A;  4DF7 A;  4YIJ A;  4DU9 A;  2EZV A;  3Q0A A;  1CHP D;  3F2U A;  3W3A A;  1SE3 A;  5ELD A;  1X3Q A;  1B50 A;  4IUN A;  2N55 A;  1IW7 C;  2LY7 A;  5BN4 A;  2A69 D;  4O1N A;  5FLX E;  4F87 A;  2PPB C;  1B1Z A;  1Z7T A;  1Q90 A;  2B8G A;  1SE2 A;  2PO4 A;  1HFN A;  4PMW A;  3ND9 A;  3S1R B;  3T53 B;  2KQ3 A;  1FYC A;  3G7L A;  2DNE A;  4ODG A;  4XQQ A;  1HTP A;  1GUN A;  1EWC A;  1E2V A;  5IIF A;  1BCP C;  2PCF B;  4HAE A;  1MSH A;  1ZXT A;  2EJF C;  2J0T D;  1J8I A;  3KBG A;  3LNN A;  2BDO A;  2E2H B;  4OO1 G;  1STA A;  1F77 A;  1HFG A;  4P2C B;  3VR6 A;  2NVY B;  1II3 A;  1ESR A;  3T4A C;  2PZT A;  2WII B;  3MTS A;  5CR3 A;  5ELE A;  4OIK A;  1U4P A;  2NWG A;  3TP7 A;  1EZ6 A;  2WKC A;  4KKT A;  4ZYS A;  4PV1 C;  2AQ2 B;  3OW7 A;  4EVO A;  1ML0 D;  5IGB A;  3CRK C;  4KJO A;  1AP0 A;  2WKD A;  5IOD A;  2EPB A;  2IL8 A;  1HUN A;  4N9P A;  3P75 A;  3CQZ B;  3PO3 B;  5T1I A;  1GOZ A;  1A6X A;  1BNZ A;  1ONL A;  4K5V A;  5LL6 S;  5COR A;  4BA1 I;  4DGZ A;  2BA0 A;  3J81 L;  2RVL A;  4OO1 I;  3H94 A;  5I6Y A;  1KAA A;  4BBR B;  3M3Y B;  1NCV A;  3GTL B;  4XT1 B;  1I6V C;  1G2S A;  4RKL A;  3S1N B;  2PQE A;  3OIQ A;  4DAP A;  5CGK A;  2AQ1 B;  1B4O A;  5IGD A;  1BCP B;  4OIJ A;  4DXG A;  3GTO B;  5JAV A;  1JCK B;  1U9R A;  3QG1 A;  3HOV B;  2B2W C;  3GP7 A;  1EY0 A;  4Z9C B;  1EY9 A;  1HQM C;  2ZXP A;  1IYV A;  5KGU A;  5FOB B;  4HCE A;  2CW0 D;  5JEA H;  4A3K B;  4B9X A;  1TWF B;  1E2W A;  2MPM A;  2WB1 B;  1LAB A;  1ILP A;  4IQZ A;  3MFG A;  2IJ0 A;  2B2T A;  5ELB A;  3HG9 A;  1R4P B;  1Y1V B;  3TME A;  4ZUJ A;  2RKS A;  3IKJ A;  2CHB D;  5D14 A;  2JE6 I;  2QCP X;  2JXM B;  3J80 L;  5JVG 3;  3BVG A;  2B2U A;  4WOR A;  4BY1 B;  1V43 A;  3I4L A;  3W2D A;  2NB0 A;  3NSW A;  3BDC A;  5G3L D;  4FNF A;  3H0G B;  2L5T A;  3DWA A;  1R9T B;  3J81 E;  1CHQ D;  2G9H D;  2OXP A;  1H9R A;  5T1G A;  4CKC A;  4ZK9 B;  1CM9 A;  2ZXR A;  5JPM C;  1PFN A;  4C3H B;  1I4R A;  4DFA A;  4G7H C;  2TMP A;  3C46 A;  2WAQ B;  3S14 B;  1HHV A;  5M9O A;  2AWO A;  1LT5 D;  1X32 A;  3DM1 A;  1U4L A;  3S15 B;  5J1Z A;  4L8J A;  4FYD A;  1DM0 B;  3TP5 A;  2E76 C;  4QUC A;  1RDP D;  1I4P A;  2CVR A;  3S1M B;  2F0U A;  3A56 A;  2XVS A;  1KDC A;  1EWH A;  4X3U A;  2HQE A;  3ND8 A;  3BDL A;  3VR2 A;  4FF2 A;  2R61 A;  2DNC A;  2JP1 A;  4KHV A;  4NP5 A;  2EDG A;  2F0L A;  5D65 A;  5A2Q L;  3A55 A;  1BUV T;  2B63 B;  1YNN D;  1OXS C;  2NVQ B;  2IT1 A;  2NN6 I;  4XYO A;  3J80 E;  2I07 B;  4BWG B;  2WIN B;  4KKU A;  2BA1 A;  3LWE A;  4WRD A;  2KED A;  1JC7 A;  1EQT A;  3I4N B;  1BCP F;  3MC0 B;  4KKS A;  1B9M A;  3EJI A;  4IFD G;  2LFN A;  3BZD B;  4DAV A;  1NSN S;  4I65 A;  1BQQ T;  5E4X A;  3I73 A;  1DCZ A;  4J6H A;  3A7A B;  4A3M B;  2EYP A;  1JWU D;  1STY A;  2F0S A;  3OOC A;  2EYJ A;  1SYC A;  1XWE A;  4M1U B;  2YU9 B;  4IZ8 A;  1EY4 A;  1KAB A;  3M7N A;  1SYB A;  3S9W A;  2OT2 A;  2K33 A;  5CV7 A;  2AUK A;  1LTG D;  1EY7 A;  4ZAI A;  4HN7 A;  5K5P A;  3QJY A;  4RHS A;  4KMU C;  2JSO A;  5LHY 1;  1V1P A;  2JA7 B;  1BR9 A;  3FKI B;  4IFD I;  1LV9 A;  3NTH A;  1Q8I A;  1FNW A;  1QNK A;  1K83 B;  3HOY B;  3BYT B;  1Y1W B;  4F8M A;  4KK7 A;  4J8Q A;  5A2Q E;  2XN9 C;  3AB9 A;  4ZQ3 A;  2O5J C;  2ZXO A;  2BE5 D;  4IUQ A;  3A54 A;  3C1E A;  4C3H G;  2EY6 A;  3T51 B;  3HOX B;  2AWN A;  5FO8 B;  1LTI D;  4KY6 A;  1KDB A;  2QDB A;  5EKL A;  1K8M A;  2I46 A;  4WFN 3;  1M4V A;  4ZLT F;  3MXG A;  2LKV A;  1TY0 A;  5EPL A;  1ENA A;  3MXU A;  3SXH A;  3FDT A;  2K03 A;  2K5D A;  2F4I A;  2WV6 D;  4FF1 A;  1T5X D;  2B2V A;  1S5C D;  3S17 B;  2BOS A;  1C4Q A;  1EY5 A;  2XWB B;  4CKE A;  3CHB D;  5D3I B;  5NUC A;  2XRQ D;  1EYC A;  3HZX A;  1I3Q B;  1SDF A;  3BYY B;  3IL8 A;  4I7Z C;  3LWU A;  5EQ0 A;  4OGQ C;  1TY2 A;  1AZP A;  3H91 A;  4RFB A;  1I50 B;  3TBI B;  1TS2 A;  5C0X J;  5JEA G;  1I6H B;  2HDM A;  2GA4 B;  1PTO H;  4K5X A;  2SDF A;  3GTG B;  1O80 A;  3U9S A;  3NTI A;  3FVQ A;  3Q6S A;  3Q24 A;  4KD4 A;  1TQO A;  4QIW B;  3VR5 A;  4CJ1 B;  2M2L A;  1LO5 D;  4BBS B;  3O13 A;  1EEI D;  1AZQ A;  1UEA B;  4HMI A;  5I2X A;  2EYH A;  2EY1 A;  3KLR A;  2AQ3 B;  3AMU A;  1NAP A;  2FMM A;  4K2K A;  5D3D A;  1WTR A;  1PXU A;  5M3F B;  3VYS A;  2A68 D;  2EYF A;  3S2H B;  1PDQ A;  4PNY A;  3V96 A;  3TP8 A;  3M4Y A;  2EE1 A;  4V19 0;  3SK4 A;  3E5S A;  1RD9 D;  2M9V A;  2MUY A;  2J7Z A;  2RDF A;  4J1M A;  3JAM L;  5I2Y A;  1ET6 A;  2NTS A;  2D9U A;  2EOT A;  5KYI A;  1QOH A;  3NXW A;  4LK1 C;  1DXM A;  1Z47 A;  3PUY A;  1X3P A;  3H6M A;  1S5D D;  5M3M B;  4NDX A;  1TT2 A;  2EY2 A;  1D1I A;  5TSS A;  1S4Z A;  3K0Y A;  3R2T A;  5FK9 C;  3G6J B;  3V05 A;  2KEE A;  3PUZ A;  4A3B B;  4R9W A;  3SK8 A;  3T56 B;  2D5D A;  5J39 A;  4JBW A;  4K8J A;  4CHT B;  5EGT A;  2KVM A;  1JWS D;  2A73 B;  1SBB B;  1LT6 D;  2SOB A;  1XXG A;  2RSN A;  4IUR A;  2F0D A;  5ELC A;  4GZY C;  1HXY D;  4AYB B;  3S1Q B;  3CRL C;  4RA8 A;  2F0I A;  1ROD A;  2F0N A;  2LMC B;  4F88 A;  3M85 A;  2KCC A;  1YNJ C;  1G91 A;  1LTR D;  3PIO 3;  3K7A B;  2DY7 A;  5EBC A;  3UI2 A;  4ME5 A;  1SJH D;  2XNA C;  1GUS A;  1B44 D;  3DEO A;  1D2B A;  2Z1C A;  2OF1 A;  1TU2 B;  3MAQ A;  1SAP A;  2A5H A;  2B2Y C;  5EJW A;  3ITP A;  5KNC A;  5KYL A;  2MHV A;  3PUX A;  4RCN A;  2F1M A;  3BDO A;  5DM6 3;  3DWQ A;  3VYU A;  2A6H C;  3A8J E;  3D4W A;  3HKZ B;  4HMJ A;  1LTA D;  1AFP A;  1PTO B;  3D6W A;  1PZK D;  3KK7 A;  1GJX A;  3TDQ A;  3QIA A;  5EPK A;  1QNU A;  4EQN A;  1LTT D;  5DNF A;  4FVM A;  1EL0 A;  2K5Q A;  3JAM E;  4E6I A;  3VA7 A;  1BF4 A;  1V1O A;  5JPN C;  4R8N A;  2IPK D;  2DY8 A;  3S16 B;  1ILQ A;  1KNE A;  2E75 C;  5AFW A;  1AN8 A;  1ZYR C;  1HQR D;  2HCI A;  2E2I B;  4A3G B;  1Y8P B;  3U9O A;  1ET9 A;  4ZKB B;  5EBD A;  1VMP A;  3VA5 A;  4ID6 A;  2K1B A;  2IX3 A;  2FHT A;  3ERO A;  1EIG A;  3IFD A;  1Q12 A;  1HPC A;  4XIG S;  1H9M A;  2F3W A;  5CV4 A;  4BA2 I;  4OL7 A;  4IUT A;  3FPU B;  3BVZ A;  5C0X G;  2H1E A;  4K5W A;  3S2D B;  2R3Z A;  3K58 A;  2FFK B;  1PFM A;  4ZKC B;  1TWG B;  3J7Y W;  2D62 A;  4FXK C;  2B39 A;  1U4R A;  3NP8 A;  4BS9 A;  4U67 3;  3R3O A;  2XRS D;  1EYD A;  3I8Z A;  2TSS A;  4KV6 A;  1JE4 A;  3KF8 A;  4QUF A;  4FXD A;  1UNS A;  2RDH A;  1KDA A;  3A8I E;  3OMG A;  2F3V A;  1CA5 A;  2D2C C;  5C44 B;  3EVQ A;  1STH A;  4NMZ A;  2JYO A;  1STG A;  4A3J B;  5C5L A;  3GD7 A;  4ILW A;  4K6L A;  1MGS A;  5HGT A;  4FF3 A;  2PNR C;  5I9P A;  4FXG C;  5C0X I;  1HCZ A;  4G57 A;  4OHJ A;  5IGG A;  3RD4 A;  1IYU A;  3J7A F;  3I70 A;  1TWC B;  2AUJ D;  4NW2 A;  1IW7 D;  4QF4 A;  3R93 A;  4BY7 B;  2X6G A;  1FR3 A;  3QOJ A;  1SNP A;  1QB5 D;  5IGF A;  1RTN A;  1JOQ A;  1HRJ A;  4HCS A;  2R93 B;  3PUW A;  3GTK B;  3NWT A;  4TRD A;  5DEH A;  4G7Z C;  1KTK A;  3K5M A;  1PRT F;  4QCL A;  3MFY A;  1Y8N B;  2PW5 A;  5CV6 A;  1BCP D;  1IKM A;  1TWA B;  1LLR D;  1W6J A;  4FF4 A;  1DD2 A;  4A3D B;  3HP3 A;  2ENB A;  3IAY A;  2A6E C;  1BDO A;  1JOO A;  3DEP A;  4RKB A;  1SMY C;  3HOW B;  1OXV A;  3WOF A;  3PO2 B;  1PTO F;  1WTV A;  1JIC A;  4KJN A;  4L63 B;  2K04 A;  1YNJ D;  2F0K A;  1SE4 A;  2JEA I;  5M5W B;  1KLU D;  1XX8 A;  1GUO A;  3M7G A;  2A69 C;  4DXF A;  5BN5 A;  2FJ2 A;  4IAL A;  5KEE A;  2EYL A;  2VNU D;  1TR5 A;  2NYZ D;  2WAC A;  4N9T A;  2O5I C;  2ID0 A;  1WTO A;  2NVT B;  3RZD B;  2L1B A;  1KLG D;  5CYU A;  3D4D A;  1L0X B;  3MEH A;  1D1K A;  3D31 A;  1U4M A;  1UUP A;  5FO9 B;  3HOZ B;  3NHH A;  2H4O A;  3NTK A;  5FO7 B;  1WVL A;  1HA6 A;  1LT4 D;  2EXZ A;  4RHR A;  3L9A X;  5E3F A;  4MIU A;  1DON A;  2K01 A;  1S5E D;  2Z4H A;  3EFX D;  5C0X H;  1EYA A;  1A3T A;  3R2I A;  1I4Q A;  2PW7 A;  5HUR A;  2MP1 A;  4XTC S;  1GUT A;  3BG3 A;  4RGN A;  2RBM A;  1ICW A;  2J4X A;  5K36 G;  1STE A;  1G6Z A;  2XIW A;  2Q8T A;  5A35 A;  2F0G A;  1BO0 A;  4XT3 B;  1B53 A;  2B2W A;  3TSS A;  3K6O A;  3TN2 A;  4KI0 A;  1OXT A;  4DA2 A;  3I3C A;  1A2T A;  1SNQ A;  1PMR A;  3Q22 A;  2F0M A;  3P1H A;  4RAU C;  2FMC A;  1G2T A;  2X6L A;  4C3I G;  3I91 A;  3SK5 A;  1FGB D;  1PLF A;  5C4Z A;  4KTA A;  2G9D A;  3HRZ C;  2B2T C;  1TS5 A;  1EEF D;  4Q0F A;  5CV8 A;  4KY7 A;  1VF7 A;  2K28 A;  2ICE C;  1K8O A;  1EFI D;  2F0O A;  3MHB A;  3E6Z X;  1T5E A;  2B2U C;  3WDN A;  3C1F A;  1SXT A;  3OSO A;  4ULL A;  2IWH A;  2PZW A;  4KN7 C;  1OXX K;  2L55 A;  3I90 A;  1RKN A;  3RLF A;  2Q8R E;  5KNB A;  3OWF A;  3SR1 A;  3SDZ A;  1F9P A;  2A74 C;  2M00 A;  5CBE E;  2QKI C;  4RGO S;  1GXD C;  2DN8 A;  3I4M B;  1Y69 U;  4XXE A;  1BOS A;  5KRU A;  2E74 C;  3K5N A;  3TP6 A;  2IX1 A;  2RA4 A;  4K14 A;  3SK6 A;  1RTO A;  3RUZ A;  2XWJ B;  5C3X A;  4XDX A;  2KEC A;  4B08 A;  1PZI D;  5EPJ A;  2PYK A;  1SJE D;  4ZUI A;  1MI2 A;  1PRT C;  1SNM A;  3NBI A;  4Y7N B;  5JVH 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...