1II3A

Structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ii3A00
4RKLA 2OEOA 5JAVA 4PMBA 2ENBA 1AEXA 1EY0A 3BDCA 5C4ZA 5C5LA 3EJIA 4IZ8A 2QDBA 3NP8A 4ID6A 3EVQA 2EYPA 4HMIA 4S3SA 3SHLA 1STHA 3H6MA 1EY7A 3E5SA 3DHQA 5CV5A 1SYDA 2RBMA 2EYHA 1EYAA 4KTAA 2F0OA 3C1EA 5JOBA 5CGKA 4QF4A 1EYCA 1NUCA 2EYLA 5HURA 5ISRA 5EKKA 5J1ZA 5IGEA 4NDXA 1SYEA 2EXZA 2PZWA 1SYCA 4EQOA 4IUNA 3D4WA 2F0QA 3OWFA 2SNSA 5C4HA 4IALA 2F0EA 4ZUJA 3NXWA 4HMJA 3U9OA 5IGDA 4ZUIA 1F2ZA 2WACA 3QOLA 4R8NA 1SYGA 5CV6A 2F3WA 5C3XA 2RKSA 5F2DA 5HGTA 1JOOA 3DMUA 2NUCA 1ENCA 4KD3A 3TP8A 4B9XA 4K5XA 4E6IA 5CC4A 1KDAA 5KGUA 4LAAA 5M9OA 4EQPA 1JOKA 3MVVA 3T16A 1SNDA 1TT2A 3OSOA 4K8IA 4DFAA 5KYIA 3ITPA 3S9WA 2F0TA 1NSNS 3TP7A 2F0UA 3QOJA 1STAA 4G57A 4K6DA 1SNMA 5CV4A 5C3WA 1STNA 3SK8A 5IGGA 5J22A 5CV8A 5IGBA 3EROA 3T13A 3HZXA 2PW5A 4J1MA 5C5MA 4QMGA 1TQOA 3NQTA 4KV6A 2O4XA 5I9PA 1SNPA 2F0SA 5E3FA 1SYFA 3PMFA 3SK6A 3R3OA 4N9PA 4OL7A 5IIFA 2F0IA 3NK9A 4ME5A 4F7XA 2F0PA 3TP5A 2M00A 3MHBA 1A3VA 2KQ3A 5IODA 3LX0A 2EYMA 3SXHA 3ERQA 4K2KA 2SNMA 5K5PA 2EYOA 1F2YA 1EY9A 2F0VA 4J6HA 5EKLA 2EY5A 5CR3A 5DEHA 4MIUA 3SK5A 4NP5A 5I6WA 4K5WA 1SNOA 1A2TA 4PNYA 4DU9A 2F3VA 4KJOA 2F0WA 4EVOA 1EY5A 5CV7A 2KHSA 1STGA 2PZTA 2F0LA 5IGFA 2LKVA 4WRDA 4YIJA 5IGCA 1EZ8A 4N9TA 3TMEA 4K5VA 5KEEA 3OMCA 2F0KA 4KJNA 2F0JA 4F8MA 4KY5A 3C1FA 3SK4A 1EY8A 4DGZA 1ENAA 1A2UA 1KDBA 1SNCA 1SNQA 4KHVA 3SR1A 2F0GA 1II3A 3BDLA 1JORA 5I9OA 2EY1A 5CV9A 5DAUA 1EQVA 2EYFA 3D4DA 4H7BA 4I65A 2F0FA 1KDCA 3OMGA 2EY6A 2PW7A 4QB4A 5EGTA 2PYKA 1SYBA 1STBA 1EY6A 1EZ6A 1JOQA 2EY2A 3TP6A 2HQEA 2PZUA 4NMZA 5C6AA 1A3UA 1U9RA 4KY6A 4DF7A 3QB3A 2SOBA 3P75A 4K2LA 4TRDA 4PMCA 2OF1A 3HEJA 4ZQ3A 1A3TA 2F0MA 5KYLA 5E1FA 3D6CA 4K14A 4WORA 4ODGA 4K8JA 5KIXA 2RDFA 5IOCA 4KD4A 1EYDA 4EQNA 4RKBA 3NHHA 5I6YA 3D8GA 3RUZA 4HTHA 1EY4A 3P1HA 5NUCA 5J39A 4KY7A 1STYA 3VA5A 4B9WA 2PQEA 1IHZA 1TR5A 2OXPA 1F2MA 2EYJA 2F0NA 1RKNA 3MXPA 3V2TA 2F0HA 3MZ5A 5KRUA 2F0DA 3NUCA 1KABA 3MEHA 1KAAA 4NKLA
chains in the Genus database with same CATH superfamily
2ID0A 2KCMA 1HNXL 4DAPA 1AEXA 4BXXH 1K8GA 2I07B 5C4JH 1BCPF 4HEDA 4XTCS 3HOXG 1OXUA 1NUCA 4R9WA 4OGQC 1I4GA 4OX9Q 4DNRB 1U4RA 1WTPA 4A3MH 5C0XH 4ZUJA 3S17H 5M3MG 1IYJB 2CW0C 3F1ZA 3CD6A 1AZPA 3CU7A 3MWYW 3LWUA 5F2DA 4L63B 5IT9L 1JOOA 2UXDQ 5K36G 2K4KA 2M9VA 4OELB 3AEVA 2CCZA 1LTAD 3TRZA 3HOUB 4JBKA 3HOWG 1V1OA 2LMCB 1NSNS 4FXDA 2F0UA 2VQFL 4PG3A 5E4WC 5ELBA 1XYIA 4A3LG 2F52A 4HJ8A 1EIHA 2O4XA 1SNPA 1SYFA 1IBML 2F0IA 3A0JA 1YI2A 4LF4Q 2M00A 3KF8B 1A3VA 1LTLA 2ZT9C 1JWSD 2AWOA 5JEAH 4KHPQ 4J6HA 5JVG3 1A2TA 1P16A 3IKJA 1SBBB 1QB5D 4JK1C 1XMQL 5ELFA 4AYBB 2PZTA 4NXNQ 1G6ZA 4K5VA 2J4XA 2E2IH 3I4NH 3SK4A 4R4IA 3RLOA 2N3SA 1I94Q 1KL9A 2K52A 1Y1WG 4XIGS 2KEEA 1RF2D 1SYBA 2IPKD 3T53B 1VQ6A 2K7VA 1QJOA 2JYOA 4JI6Q 2ZJQA 3PO3G 3VR4A 4DXGA 4ZQ3A 1ZKOA 1L2FA 2I0QA 1TU2B 4J8QA 1OXXK 2I46A 1R9TB 1WCMH 3K6OA 3NSWA 1M4VA 5KIXA 3KLWA 3S15H 2IL8A 3GD7A 4BWGB 1IL2A 3G4SA 2E2HH 5J39A 4HTHA 5NUCA 4G7OC 1NAPA 3V96A 4ABNA 1EQRA 1MJCA 1PRTC 2A69D 4G7ZC 1CQVA 2XRQD 4DAVA 1RIPA 2PQEA 4DUYL 1OXTA 4XT3B 3AMUA 4P75A 1D5XC 3BZDB 2ENBA 1S40A 4DPGA 4A3DB 3TZUA 1D8LA 2D62A 2DNEA 3CHBD 1Y69U 1MHWC 3NEMA 1XNRQ 1VQEA 1PTOD 2R6GA 4P2CB 2K32A 4GN4B 2B2YA 2EXZA 1BOSA 1DXMA 1SMYD 1Y1VG 2K5VA 3KF8A 3PUVA 1ML0D 1OTCA 1I5FA 1NY4A 4RGMA 2OT2A 4A3GB 5IP9G 4R4TA 4QJFA 1YITA 4K5XA 4EQPA 4EGVA 4PZ7A 3CCMA 3MFGA 2UUAL 3UDIA 1PZKD 2CFMA 1ZEQX 3E6ZX 2JP1A 1SE3A 4CKEA 3U50C 4AYBG 2MQHA 4GZYC 3PGZA 1FVIA 2WAQE 2Q2IA 4JI2Q 3R93A 1JR0D 4RHSA 3TP5A 2B2UA 1EOVA 3BJUA 1WTQA 1B4OA 1T5EA 1FR3A 1PMRA 3ERQA 3HOYB 2EYOA 2MFIA 4OWTB 4RGNA 4IUTA 4Z9CB 4O0AA 3JAML 1HR0L 1STGA 3URYA 1VQCA 4KKUA 1KQSA 2RF4A 3ULJA 4KJNA 5KEEA 3C1FA 4YCVA 2DJGC 2E2DC 1PYSB 1SRUA 4JBJA 1JE5A 4HSVA 1CA6A 3PUYA 5D65A 3KLSA 3RLFA 1ICWA 4GN3B 3TS0A 3J80L 2RSOA 2UUBQ 4WORA 2JXMB 5EPKA 1Y8NB 1X56A 2JA8H 1JB7A 1EYDA 2AMCB 4DA2A 3P1HA 4KKSA 5HGQA 3FMCA 1BR9A 2B63B 2P5ZX 5M3MH 1PRTF 2G5DA 4FYDA 5K36H 1UEBA 3J81L 1BCPB 4BA1I 2WFWA 1CKNB 3HP3A 3A7LA 2FXQA 4X3TA 2E5LQ 3HOWH 4A3LH 4MTNA 2HIXA 5J3BA 5CGKA 2SDFA 4O2DA 1CTMA 4ME3A 4CGYB 2A69C 4NDXA 3MXUA 5G3LF 3PQIA 2N78A 4UDUC 4DUYQ 2A8VA 1ZXTA 1HRJA 2EXDA 2L5TA 1X9NA 3I2ZA 3OTOQ 3G6EA 5EQ0A 3HKSA 3DMUA 5M3FH 2NUCA 1ENCA 2IW3A 2PPBC 3BZKA 5JVH3 3RR5A 2NN6I 4XYQA 1G6PA 1I4HA 2C5CA 4UPAA 1PTOC 4B3RL 2YYZA 1ET9A 3I73A 4DV5L 3T13A 2HIVA 4JCVE 3NQTA 4L5RC 2K5DA 4IJHA 2CWPA 4B3MQ 3SK6A 1Y1WH 3HG9A 1VQOA 3LX0A 4C2MB 2DN8A 2H4OA 3PO3H 3M4OB 1F2YA 2RQXA 1PTOH 2KOLA 1JB3A 2QILA 2EDGA 1EY5A 2EJMA 2Y0SB 3MFYA 2UUAQ 1N36L 1GM5A 2MHVA 3PF4A 1WD1A 1X3PA 3K0XA 1B8AA 3G6JB 2K5QA 1WOCA 4X65L 1Q3LA 2L15A 3GTPB 1TWGB 2EYFA 3KLSX 4A75A 3OWEB 1GUNA 2EY6A 3CCQA 4K0KQ 5I4DA 1IXRA 1EZ6A 3LWEA 1HNZQ 4IOAA 1CKNA 2L4NA 4KY6A 1MKHA 4DK3C 3F2CA 1HR0Q 3LGJA 2N88A 1O7ZA 1Z9FA 1X3FA 2JEBI 3PCOB 1AZQA 2J7ZA 1V1QA 3J7ZC 4FP5D 4A3MB 2EE1A 2BH8A 3NWSA 4I7AA 5BN4A 2OTJA 3MZ5A 1X3GA 1FJGL 3GTLB 1FNUA 3A8KE 1KABA 1RODA 1GXDC 5IP9H 4DNTB 3DWQA 2TSSA 3CQZH 4DR4Q 3C2PA 3K81C 3CRKC 4IZ8A 1XMOL 3NTIA 1DOKA 5IT9E 4KN7C 2L1BA 4X3SA 3STBD 1K0SA 1E2ZA 1FGBD 2R92G 1STEA 1WTXA 2ES2A 1MSHA 1EYCA 3DM1A 3D4WA 1EU4A 1CM9A 3NXWA 4A3EG 3KLRA 3S1RH 2D0OA 2K14A 1NMFA 3NE5B 3T16A 2XWJB 1Q86C 3AB9A 2X6LA 1PTOF 2DUDA 1L1OA 3FVQA 4G4KA 2K1BA 4DV3Q 3UDXA 2JA6B 1I4QA 1WTHA 2B2VC 3PIP3 2BOSA 1B70B 1VQKA 1FGUA 2MP1A 5E4XA 3DXJC 3FPPA 1YNND 3CKIB 1EY9A 4U673 1LLRD 3SK5A 1GVPA 2VQEL 2KBNA 4LF9L 1PFMA 2NYZD 1JT8A 1WCMB 4K6LA 2YU9B 1QWYA 5IGFA 1VQ5A 4DV5Q 4C1NI 2F0JA 3UDFA 1BBXC 2HT1A 3PF5A 1LTRD 4G7HC 3M3YB 3ERSX 1WI5A 3MXGA 5DAUA 5M5YH 1EQVA 4ZCKA 1GUWA 2F0FA 1A62A 1GUGA 4DV1L 2A68D 2PYKA 2VY3A 4LWCA 2K03A 1JOQA 4RA8A 1O7LA 5C0XJ 5C44G 2D9UA 2F1MA 1JJCB 4RHRA 4LFCQ 2SOBA 4LF6Q 2EIFA 1N36Q 4C3HB 3KOJA 1SROA 3K7AH 3N52A 4K8JA 1W2BA 3BVMA 4Y52H 4X65Q 5I6YA 1HNWL 2KEDA 1ILQA 1P8LA 4HIMA 2Z9HA 3K57A 1JWUD 5EKLA 1TS3A 1V43A 4R1JA 1KC8C 4P74A 5CYUA 2H1EA 1LYLA 4YHHL 1M90C 5CV5A 1UE7A 1C0AA 1JC7A 1TIID 1HFNA 2EVBA 1SR3A 2CH4W 1CHPD 1B9NA 1TS2A 1YEZA 2JN4A 3CC4A 3C3LA 1FJGQ 3A54A 3H94A 1K0RA 1KAWA 5C0XI 1UE6A 2ZXPA 4EQ5A 1VQLA 1KLGD 4BY1G 5IP7G 1TS5A 4B9XA 1U4PA 1CFMA 3STBC 4YCWA 2B8FA 4ZAIA 3K5NA 1QE6A 1TT2A 1Q81C 2H5XA 4HIKA 3K59A 4DR3L 3HOZG 1R4QB 5CV4A 3JAME 3CCEA 3WOEA 1OXSC 1G2SA 5C5MA 4QGUA 5FO9B 4KV6A 1MSGA 5TSSA 1XNQQ 3W2DA 4JI8Q 3NK9A 1JJGA 4DK0A 1JWMD 5JJZA 5L37A 4JBMA 2E74C 2A73B 2J0TD 2PO4A 3U9SA 2BE5D 5LMUL 3IL8A 2MO1A 3HOXB 5JJLA 2Z1CA 4YWLA 3S2DH 5FLXL 5I2YA 3MAQA 3J80E 4GOPC 2XVSA 3HFZB 5EKIA 4C3HG 4Q5VA 5M3MB 3RZOH 1JORA 3SR1A 4CKCA 1NJIC 1YNNC 1KDCA 3S16B 4LF5L 4IFDJ 3CW2C 4ZKBB 4CJ0B 2VS1A 4JI0L 4ILWA 3HOWB 4LF9Q 4JI5L 2GA4B 3J81E 1DOLA 4PMCA 2QEXA 3S1QH 3E0JA 1IZ6A 1ET6A 1LTGD 2R92H 1XPOA 1Q12A 4ODGA 4DV0L 3TDQA 5T1GA 1KD1C 4L5SA 1FL0A 3BZCA 1UE1A 1UAPA 5T1IA 4GS3A 3RUZA 1EY4A 2QF7A 1EWCA 4QUFA 2A68C 4NXML 1TWAB 2NWGA 1VDZA 3MXPA 2XIWA 4A3EH 1N8RC 1S4ZA 2AKWB 3VYSA 3F8TA 1UWVA 3DWPA 2I5HA 2R93G 1E3PA 3PIO3 5JJKA 4S3SA 2K33A 4XQJA 2EYPA 3M4OH 4A3JG 1RHPA 3DM3A 1PYBA 2RBMA 1RL2A 1KRSA 3CC2A 2E8GA 2JA5B 1WVLA 1HNWQ 3T1HL 1Y1WB 1ILPA 1TXYA 4OXPA 1LABA 3F2UA 2ASBA 3D3RA 4IFDI 1Z6HA 2ICIA 3PO3B 3F2DA 3K5OA 4FO2A 1TWGH 3I70A 1PTOB 1YIJA 3ND9A 4B08A 1YVCA 4HSPA 2HHHL 1N34L 3QG1A 1FNVA 4L5TA 1VQAA 1X32A 4K8IA 3M7NA 1MGSA 2JA9A 2LFNA 1SNMA 1T5XD 4IJLA 4X3KA 1PFBA 2WV6D 3EROA 5IWAL 3HZXA 4IOCA 1BVSA 2ATWA 1B3QA 5GQOA 2KA7A 2Q8TA 4X66L 5C44H 1TWFB 2EYMA 2UXCL 4RCNA 2SNMA 1PH5A 3GTLH 1ASZA 5CR3A 4MIUA 4MTKA 4PNYA 2CH4A 2PNHA 4DV4L 2Q2UA 2JQOA 2F0WA 3PUXA 3BYYB 4KI0A 4RCOA 1SN8A 1VQMA 1TVXA 1G51A 2QGQA 1MBYA 1KRTA 3WWVA 4JC0A 4XDXA 3KF6B 1Y1VB 1GUSA 3TS2A 1EY8A 1QUQB 3C46A 1SNCA 3E9IA 1EWHA 1LACA 2EY1A 2ZXRA 1VMPA 4I65A 2BE5C 1IBLL 5EGTA 2MUYA 3CQZB 3E3XA 2B8GA 4DR2Q 2JA7G 3IFDA 4JV5L 4A4IA 1J8IA 5KYLA 1S5FD 2Q8IB 4B3TL 1EU3A 5FO8B 4IUQA 4LJZC 2AWNA 1KNEA 1TS4A 1PH9A 1B53A 1IHZA 2JA6H 2WB1G 3DWAA 3V2TA 3FRPB 2JA5G 4LF5Q 4JYAQ 4GKKL 2F0HA 3S1RB 2IT1A 2ZTDA 5CBAE 3K8AA 4NKLA 1C8CA 5IP7H 4BY1H 1PVOA 4FDBA 1H9JA 1DYQA 1VF5C 5ELEA 2BDOA 3H6MA 3HOZH 1EY7A 3ICEA 4DV0Q 1SXTA 3T4AC 5FJ8H 4QF4A 5HURA 2YU9H 2B29A 4O1NA 1SYEA 4NXMQ 3A74A 4BBSB 2EPBA 1AH9A 4IUNA 2EZVA 3GP7A 1DONA 2IHFA 5C4HA 1CZWA 3RLNA 3M3YH 3L7ZC 2MNAA 4ZUIA 3A5UA 4DV2L 1E22A 2WACA 4R4CA 1JE4A 4CKBA 1WTOA 3X3NA 1DGSA 1Q1BA 3MXNB 3CMEA 5M5XB 4APVA 4HJAA 3WDNA 2EOTA 1PHJA 3ITPA 4PZ6A 3TP7A 4G57A 1STAA 1HUNA 4C3JB 2V1CC 3KF6A 4DR5L 1A63A 3T1HQ 3T1YL 4C3HH 3CCLA 5AJ3L 3NTKA 1QUQA 1AP0A 1TQOA 5M5YB 5HY6A 4WJ4A 2A6HD 4ME5A 4BY7G 1C4QA 3TREA 4JI7L 3SXHA 2D2CC 5BN5A 5LMNW 1V8QA 1HNXQ 1RCVD 1RD9D 1N34Q 4L6TB 1KXLA 2C35B 2MJ8A 4KJOA 3K7AB 1XWEA 1AN8A 4X62L 4KN4C 4YIJA 1QNKA 5IYCG 1EIYB 2O5JC 1QOHA 5JJIA 1CKMA 1DCZA 3GV6A 2CKZB 3CPFA 1ENAA 2Y0SE 1F9SA 3J7AV 3EN2A 2R3ZA 3D4DA 4X66Q 2RCFA 2NBFA 2R93H 1WD0A 1R4PB 1HZCA 4A3JH 4XYOA 2F4VL 2MGSA 1EFID 3D6CA 3E0EA 1Q8KA 3PIOA 5BR8L 2VQFQ 4LF8L 2CHBD 4WJ3M 1OO9B 3QJYA 4RKBA 4KMUC 2AQ1B 3FKIG 3SDZA 1LT3D 2K28A 1TR5A 4RFBA 2RHSB 1IBLQ 1IBMQ 5DM73 3I72A 1NR2A 5FKAC 2VNUD 1U4MA 4BBSG 2KENA 5JAVA 2VW9A 4JV5Q 2UXBL 2A6ED 5IYBG 1NMGA 2SEBD 2KUMA 3ZJYC 1AE3A 4ID6A 4V0BA 1XMQQ 1E0BA 2B2VA 3GTKB 3HOXH 1PYWD 2F0OA 5FOBB 3OOCA 4YWMA 1LTBD 4LNQA 4QCLA 4PMWA 2XWBB 5IT9c 4C3JG 2F0EA 2PMZB 1J5EL 4JI1L 1QNUA 3M4YA 4R8NA 3U58A 4TSSA 2NVTH 2ZXOA 5I2XA 3S16H 4IPGA 3OYYA 2K04A 5HGTA 3QIAA 4I7ZC 2NN6G 3S2DB 1TY2A 3D31A 3VR6A 3RN5A 2XRSD 3MVVA 4DR1L 2IWHA 3H3VC 4CDDC 1S5DD 1Q7YC 3FP9A 3SK8A 1EEFD 3RZOB 4UAIA 5FLXE 4FXKC 3VYTA 1EQTA 4OHJA 3S1MB 4HN7A 3R3OA 2RVLA 3FHWA 3MHBA 4NPSA 1TWAH 2JA7H 5IODA 1E24A 2NZOA 2Z0SA 3S1QB 1CSQA 2F0VA 1UUPA 2BDNA 1ICFB 3NTHA 2QDLA 4P72A 4R8IA 2R92B 4GOPB 3H3VH 1G291 1A0IA 4CDEC 4FF1A 2WIIB 3TMEA 3I4LA 3HKZE 3TSSA 4DN4M 2A6HC 1SMYC 2KCTA 2DY8A 2B3GA 1SNQA 5GADC 2JA5H 4A3EB 4QIWB 4HIDA 3SE0A 3S24A 2HDMA 2YV5A 1UE5A 4CBVA 4JG2A 1TWHH 2LXJA 2HQEA 2PZUA 4ZYSA 1A3UA 2ZM6L 4K2LA 3HEJA 4YWKA 4H44C 1CA5A 3LNNA 3H15A 3Q0AA 3D6WA 2HCIA 5EPJA 1YZ6A 3I4MB 2ALYB 4YCUA 4JOIA 1GHJA 1LTID 3RZDB 1BQQT 2RA4A 2EJGC 3FPUB 4PMBA 3KYHC 1VQFA 3MA2B 4GNXB 4FF2A 4IPDA 5C4ZA 1TWFH 2VXWA 5ELCA 5KNCA 1S3OA 4JI3L 3E5SA 2L0CA 3AFQA 2B2TA 2QA4A 5EBCA 1Q8IA 3B6YA 5IGEA 1D5MC 1YHBA 3VYRA 5C44B 1Y1VH 4BY7H 2LXKA 2NVXH 2A6EC 1BKBA 1HPCA 3EA6A 4JVZA 3EQLC 4N8X1 3G71A 3I3CA 3Q23A 4KD3A 3K5MA 4GOPA 2YTYA 1VQIA 3P7JA 3AU7A 4LAAA 5FLMG 1SAPA 3TN2A 5IYCH 4AQYL 3S9WA 1PZID 4F88A 4UY8C 1B7YB 5IGGA 1N33L 4GKJL 2NZHA 2UUCL 1VQDA 2LS01 1OXVA 5ELOA 3RMHA 4HJ7A 4A3IG 4DV7L 1CUKA 4N9PA 3TZDA 1JQYD 5LMNL 4MZ9A 1J5EQ 3IAYA 3ND8A 2HUGA 4LUZA 4FXGC 5GAGC 1ESRA 3JAMc 1QCBD 4A93G 4OIKA 4X3UA 3AFPA 1SE8A 1XXGA 4DU9A 1YJWA 1GOZA 1V1PB 1CI3M 2Q2HA 2NVQH 3OHXC 3G7LA 4WRDA 2CQOA 2PQAB 4C3IG 1Q82C 1Q90A 3FKIH 5A35A 2L11A 1I6HH 2FMCA 4H0LC 5CORA 5CV9A 3I4MG 2IJ0A 1B9MA 1BO0A 4QB4A 4BY1B 4BBSH 2PW7A 4A3CG 4QL5A 3CF5A 1EY6A 1PH8A 1B3AA 5IYBH 3J80c 1U5KA 4GNXA 3CAMA 3VDYA 2KHJA 1HXYD 3P75A 3HOZB 4KK7A 2OF1A 2DJFC 1CQFA 1E2VA 2F0MA 3W1GA 1IL8A 3Q8DA 4B3RQ 5KNDA 5EPLA 1IYUA 5M5XH 2N8NA 2RSNA 2CWAA 4OO1I 5E7NA 4C3JH 1JMCA 2WAQG 3H91A 4DR6L 5LL6S 1YNJD 3GO5A 4QUCA 3BYTB 5FO7B 1HJPA 3K0YA 1X54A 1DJRD 2NN6H 3J7AF 1QVGA 1B50A 5A2QL 3EJIA 1E1TA 2RDHA 3GTQH 3DHQA 1TY0A 2Z6BA 2NZ1D 1Y8PB 2E76C 4KTAA 4LFBL 3A8IE 4CJ1B 4HIOA 4H13C 2PZWA 4GLVB 1MIUA 1S5ED 3A8JE 4IALA 3U4VA 4HMJA 4A3BB 1G8ZD 5ELDA 5IGDA 1QG7A 3A56A 4RG1A 5C3XA 1KNAA 3M4PA 3TP8A 5CC4A 4OEMB 1L0YB 1V1PA 5JEAJ 2PQAA 3KJOA 3GTJB 1LT4D 1KHIA 1VQJA 1I6VC 4DK6C 4DAYB 5COYA 3A7AB 3V05A 2VL6A 2R93B 3W3AA 4JOIC 3CMAA 3HOVB 4A3JB 3A5ZB 3GTGH 1H9KA 2EY5A 2E75C 1VQHA 1H9RA 1XMOQ 2UU9L 5LL6X 4NB3A 1N33Q 5IGCA 3CP0A 3K5LA 5C4XB 2UUCQ 3OMCA 2R7ZG 2CVRA 3EIVA 3GTKH 3O13A 1HQMC 2G9DA 2X6GA 4KHVA 4DV7Q 2F0GA 3QO2A 2XN9C 4ZRZA 2B2TC 1I4PA 2Z4HA 3MC0B 3DLLA 1KLUD 1FD7D 2N49A 1EFWA 1CKOA 3KUPA 1X65A 2GN5A 1X6OA 1WJJA 1HUMA 4H02A 4JBWA 1Q46A 2NVYB 3J7A5 3R2TA 4KD4A 3D4RA 2I5LX 2RHQB 2QCPX 4AYBE 2ICEC 1S5BD 2R7DA 4NW2A 2JE6I 5KRUA 3SVMA 4LF4L 2NVTB 4R4OA 4ULLA 4O42A 3S1MH 3TBIB 1CZGA 1PV4A 5FLMH 1EY0A 2VQEQ 5C5LA 4GN5A 1SSOA 3NP8A 3SHLA 3CC7A 4A3BG 1JICA 1STHA 4XQNA 1G2TA 1SEBD 5JOBA 4LUVA 2C9OA 1LM0A 2HQLA 1YNJC 4HJ9A 4A3IH 4DAYA 2BA1A 2Q2TA 1SYCA 1NNXA 4DR6Q 3L3OC 4LF7L 1I94L 2JA7B 4BBRG 4IFDG 2MPMA 3S1NH 4DV1Q 4A93H 2VB2X 2L9HA 5CV6A 3NELA 2RKSA 1O7YA 1K8AC 3L0OA 4JI6L 2KVMA 5JPMC 3QWNA 4C3IH 2GVAA 1NCVA 1PZJD 4GLXA 3HOVG 2OCEA 1PFSA 1C48A 1RTOA 3GDEA 4LK1C 5C3WA 5J22A 4GNXC 1I50B 3KFUA 1HR0W 2WB1B 4AH6A 2D0PA 2DGYA 1YJ9A 1K83H 3I4MH 4A3CH 5C4XG 1TWHB 1SDFA 2R7FA 1MJEA 3RZDH 2M2LA 2NTSA 4DR7L 2E2JH 3PIPA 1GHKA 4L8JA 4IUPA 4KKTA 4TQUS 2FFKB 4B3SL 1D1KA 1PA6A 1SNOA 4OIJA 4Y7NH 1T9HA 3EFXD 1AW7A 4YHHQ 3F2BA 2F0LA 2LKVA 3PSIA 1BUVT 3WOFA 1DM0B 3ZYYX 1I4RA 2EQSA 3GTMH 1A2UA 1B44D 1II3A 5I9OA 5M5WH 1HTLD 3TP6A 5C6AA 1IW7D 1BBUA 3QB3A 1WYDA 2UU9Q 4TRDA 1SE4A 1A3TA 1YNXA 1VQ8A 5E1FA 4A3FG 4V190 3BS1A 4DR3Q 2BCOA 2ZJRA 1SLJA 2JA8G 3NENA 4BY7B 2IX3A 4KY7A 4LW1A 2NVXB 1F2LA 2IX0A 4PQXA 1F2MA 1BXTA 4JI2L 4NMZA 3TQYA 2CQAA 4RGOS 3Q22A 1X55A 1VF7A 1Z47A 3T56B 2Z8LA 1NR4A 5LMUQ 1QZHA 3BDCA 3SEBA 1KTKA 3GQBA 1DZ1A 1HZAA 2Z4IA 2FMMA 3X3MA 2EYLA 1VMCA 3UDGA 2YTXA 2XNAC 4EX5A 2F03A 1TWCH 1ZYRD 1AFPA 2F3IA 2ZTEA 1BBWA 4XXEA 1VS0A 1PH3A 4JI0Q 1M8AA 2B39A 3GTOH 1QVFA 4LMQD 4YY3L 4JI5Q 4A3KG 1CHQD 5KGUA 5M3FG 1QZGA 2NVQB 2PMZE 3L9AX 3MTSA 2UUBL 2F0TA 4F87A 3FKIB 5ELNA 4DXFA 2R7ZH 1H95A 1I6HB 3PO2B 3K80C 3OIPA 4LF7Q 3SGIA 1WTWA 1XTDA 3GV3A 4L5QA 4IQZA 3CCSA 1H9MA 4MNOA 2NB0A 1TKWB 2F0PA 2PI2A 1EYGA 5C3EB 2NTTA 1RJTA 4DKAC 3UI2A 3QR8A 5FLXc 5DEHA 1HH2P 3KBGA 2E5LL 4EVOA 3I56A 3NBHB 2PNRC 3H3VI 3K58A 4M8AA 4X64L 1WTRA 1QVCA 1GJXA 4QQBX 2ZTCA 1PH4A 2VUMB 4DR7Q 1LO5D 2RCNA 4PZ8A 3HS0C 5EAYA 1D2BA 3OTOL 4MHEA 4DF7A 4QIWE 4B3SQ 5H1SE 1UNSA 4A3BH 4ZLTF 2HHHQ 3GTQB 1UEAB 1L0WA 5A2QE 1SFOH 3FEWX 2XSCA 4LFAL 3N6RA 1XX8A 5IWAQ 4EQNA 3HOUG 3JC66 3NHHA 3D8GA 3GTJH 3VA5A 4B9WA 4BBRH 4IFDH 4B3ML 2OXPA 3IFTA 1IW7C 4FF3A 2K5NA 2R61A 1HA5A 2K5HA 2OTLA 2ZJPA 2UXCQ 4R4QA 3RNUA 2VB3X 3RD4A 3TEHB 4ZKCB 2DY7A 4HCEA 4CDCC 4DV4Q 3HOVH 4P71A 1O80A 4AIMA 1PH6A 3ULPA 2V4DA 4UHVA 3OIQA 2X69A 2A74C 2B2WC 1GD7A 3UE1A 1Z7TA 2AQ3B 5C4XH 2SNSA 4POFA 2KHIA 3H0GB 3PO2G 1V9PA 1Y8OB 4K0KL 3U9OA 3GTGB 1WTVA 1F2ZA 4M1UB 1HNZL 4GLAC 2F3WA 2MO0A 2Z6KC 3J7YW 3IRBA 2QKIC 1X3EA 1KDAA 1GO3E 4N8FA 3MXNA 3NBHA 5M9OA 3D0FA 5IYDG 4B3TQ 1SNDA 5C3EG 5KYIA 1PH7A 1KIXA 1IBKL 4Q0FA 1VQ7A 3CCJA 1VQ9A 1VCIA 2PCFB 1ZYRC 4J1MA 3VR2A 3OPOA 4QMGA 5I9PA 2NVYH 4ALPA 2F0SA 3I90A 5E3FA 1W6JA 2XTIA 1F9RA 4GKKQ 5KNBA 1G91A 2KECA 4DV6L 4YY3Q 1PLFA 1E7ZA 4DR4L 2VUMG 4A3FH 4POGA 2F3VA 1Y14B 1FYCA 4LUOA 4CJ2C 1E2WA 4A3DG 1J6QA 1VQ4A 1W3SA 3W5OA 1KDBA 3RN2A 2DNCA 3HGBA 2LSSA 3K7UC 3W1BA 4H7BA 1CK1A 4DV2Q 2EY2A 4IUUA 1LT6D 1F9QA 1PXUA 2HCCA 4JI4L 3BU2A 3S2HH 4K14A 4IO9A 4A3GG 4JW0A 5DLQE 3DEOA 1LV9A 2IHEA 4X64Q 2AQ2B 2IY5B 4HAEA 4A3IB 2JJQA 4DR5Q 5D3IB 1K9MC 4WJWA 3S14H 2RDFA 3T1YQ 1QILA 4P73A 4DV3L 5AJ3Q 2BH2A 2K05A 1I50H 3S1NB 4CDFC 4A93B 1GKHA 4KLKA 3NUCA 1LUZA 1KAAA 4JI7Q 1EEID 4A3KH 4C3IB 3H0GG 4RMFA 4X6AH 3HOYG 3U4ZA 4X62Q 1ESFA 1SYDA 4LFAQ 3T51B 1EYAA 1K83B 1I3QB 1HZBA 1ENFA 1LTSD 4EQOA 3KK7A 1HHVA 3M85A 4RH6A 3E9HA 2E2JB 1EQQA 1YHQA 1K8MA 5AFWA 1FNWA 2OQ0A 2F4IA 1C7YA 4Y7NB 4C1NK 4LFCL 4LF6L 1N32L 2YTVA 1J9OA 2F4VQ 1CT1D 4WFN3 4OWWB 4LF8Q 5BR8Q 1L1OB 3QOJA 4K6DA 3GTMB 2WAQB 3BDOA 1STNA 3MEFA 3Q6SA 1SMXA 1PDQA 1EIGA 5M5WB 2L55A 4IPCA 4FF4A 3BVZA 4UP9A 1C9OA 1PH2A 4IN3A 4F7XA 3FDTA 2KQ3A 2IX1A 2JEAI 3BVGA 2B2YC 2UXBQ 2B63G 1E1OA 1DD2A 4NP5A 5C4JB 2A19A 4IUVA 3DEPA 1F77A 2HDLA 4TKOB 1IBKQ 3I8ZA 1BNZA 4RWSC 3BG3A 3HOUH 1S72A 4KY5A 4DGZA 1O78A 3S17B 3UE0A 1JJ2A 3NPPA 3Q24A 4KHZA 4DV6Q 5IE8A 4JI1Q 2AUJD 1YBYA 3CCUA 1U9RA 1PH1A 1A15A 4MN3A 3OW2A 2B2UC 1PFNA 1K73C 4DR1Q 1A8VA 1RTNA 1SE2A 1K3RA 4QY7A 1XPUA 2K75A 3P20A 5IOCA 1BCPD 4OO1G 1TWCB 2K01A 1HCZA 3VR3A 1X3QA 3PO2H 1XNQL 2L12A 4JI8L 3GTOB 1HTPA 4DUZL 3MEHA 2XGTA 2OEOA 4RKLA 4BA2I 4RGTA 5IYDH 5C3EH 4JI4Q 2R7ZB 4JPBW 2K5WA 2E2IB 3I4NB 3OW7A 1EL0A 3H09A 5D14A 1EIFA 2HD3A 4PV1C 1R9TH 1IKLA 2Y0SG 1WFQA 5J1ZA 3I7FA 2TMPA 1I4XA 3J81c 3AQQA 3DUZA 1B1ZA 2I5MX 4DAMA 1SYGA 2VUMH 1SJHD 3HKZB 3I4OA 2ZM6Q 4E6IA 1NE3A 1D6EC 5CMDA 1JOKA 4BXXG 2WKDA 3OSOA 4DFAA 1EUJA 3S15B 5EJWA 2D5DA 2OWOA 4RAUC 4A3DH 2E2HB 2GVBA 5CV8A 4BS9A 5IGBA 2PW5A 5EBDA 1NTGA 1D7QA 3I91A 3CRLC 2VZAA 3KJPA 4OL7A 5IIFA 1HFGA 2WB1E 3VR5A 4A3MG 5C0XG 1F9PA 3NWTA 3AYHB 5K5PA 1L0XB 4TVAB 1B2TA 3L2PA 1N32Q 4K5WA 4DK1A 5IY0A 1SFOB 4A3GH 4JI3Q 2AUKA 5GAHC 2KHSA 3PUZA 2OQKA 1K28A 4CHTB 1PRTB 1EZ8A 2F0KA 4F8MA 4XQQA 4BBRB 2BA0A 1IKMA 2JK8A 1MD2D 1AE2A 1H9SB 2QW7A 5BN3A 3OMGA 2Q8RE 3H0GH 3ER0A 4XT1B 3HOYH 5JEAG 1VQPA 2PI2E 3KDFB 3PV0A 4AQYQ 1VQGA 4FNFA 4GKJQ 1U0LA 3HRZC 3ONAB 1XJVA 1D5ZC 1YHAA 2N55A 4OX9L 2WP8J 3I4NG 1O7IA 3EBEA 5LMNQ 2JSOA 2EYJA 3JAMi 2JA6G 2F0DA 3R8BA 2A1AA 1HZ9A 5LHY1 2UXDL 5GROA 2CW0D 2KCNA 2QDBA 3EVQA 4HMIA 1BCPC 1D1IA 2EYHA 2WKCA 3HKZG 4OONA 3C1EA 1WCMG 5FJ8G 2K6AA 5ISRA 5EKKA 2QEJC 4HJ5A 3R2IA 2F0QA 1EOTA 3ULLA 3OWFA 2KJXA 3VYUA 4DUZQ 3J80i 1K8OA 2FHTA 1IYVA 1W6KA 2B63H 4DR2L 3QOLA 1NBWA 4A3FB 2WINB 2O2LD 1EWIA 1DOMA 2O5IC 4KHPL 2A5HA 2JA8B 1BF4A 2FJ2A 4DNIA 1S5CD 4NXNL 3J81i 2G9HD 1N9WA 1LT5D 5DNFA 1GUOA 2RDGA 1H9SA 3PMFA 4JYAL 4J15A 4IPHA 3J81j 1RDPD 3PUWA 3KBXA 4UP8A 5DM63 1MI2A 4K2KA 1SJED 1Q1EA 3VA7A 5I6WA 3S2HB 1HQRD 3G48A 3KDFA 1VQNA 5CV7A 3S14B 1LTTD 4N9TA 1YJNA 4U68A 4LFBQ 4OO1H 5CBEE 3NBIA 3M9BA 1VQBA 1XTCD 3M4QA 2EJFC 5FK9C 1I3QH 3M7GA 3BDLA 4C56C 4HCSA 1L1OC 4A3KB 5D3DA 5M3FB 4A76A 1STBA 1U4LA 1JCKB 3NQIA 3CCRA 1PRTD 3CXCA 1M1KC 1K3BC 2LY7A 4C2MH 3CPWA 1GUTA 2B2WA 4OWXB 1XPRA 4FVMA 1CSPA 2AHOB 3CCVA 2KCCA 3A55A 1ASYA 1ONLA 4UP7A 4ZK9B 1XNRL 1STYA 2Z6KA 4HR7B 5JPNC 2K50A 1RKNA 5GAEC 1BDOA 3GTPH 1A6XA 3I55A 2FINB 1HA6A 5G3LD 2F0NA 4IURA
chains in the Genus database with same CATH topology
2ID0A 4DAPA 1AEXA 2I07B 1BCPF 4HEDA 4XTCS 1OXUA 1NUCA 4R9WA 4OGQC 1I4GA 4DNRB 1U4RA 1WTPA 5C0XH 4ZUJA 2CW0C 1AZPA 3CU7A 3MWYW 3LWUA 5F2DA 4L63B 5IT9L 1JOOA 5K36G 2M9VA 1LTAD 3HOUB 1V1OA 2LMCB 1NSNS 4FXDA 2F0UA 5E4WC 5ELBA 1XYIA 1EIHA 2O4XA 1SNPA 1SYFA 2F0IA 2M00A 1A3VA 2ZT9C 1JWSD 2AWOA 5JEAH 4J6HA 5JVG3 1A2TA 3IKJA 1SBBB 1QB5D 4JK1C 5ELFA 4AYBB 2PZTA 1G6ZA 4K5VA 2J4XA 3SK4A 4XIGS 2KEEA 1RF2D 1SYBA 2IPKD 3T53B 2K7VA 1QJOA 2JYOA 3VR4A 4DXGA 4ZQ3A 1ZKOA 4J8QA 1TU2B 1OXXK 2I46A 1R9TB 3K6OA 3NSWA 1M4VA 5KIXA 2IL8A 3GD7A 4BWGB 5J39A 4HTHA 5NUCA 4G7OC 1NAPA 3V96A 4ABNA 1PRTC 2A69D 4G7ZC 1CQVA 2XRQD 4DAVA 2PQEA 1OXTA 4XT3B 3AMUA 1D5XC 3BZDB 2ENBA 4A3DB 3TZUA 2D62A 2DNEA 3CHBD 1Y69U 1PTOD 2R6GA 4P2CB 2K32A 2B2YA 2EXZA 1BOSA 1DXMA 1SMYD 3KF8A 3PUVA 1ML0D 4RGMA 2OT2A 4A3GB 4K5XA 4EQPA 4EGVA 3MFGA 1PZKD 1ZEQX 3E6ZX 2JP1A 1SE3A 4CKEA 4GZYC 3R93A 1JR0D 4RHSA 3TP5A 2B2UA 1WTQA 1B4OA 1T5EA 1FR3A 1PMRA 3ERQA 3HOYB 2EYOA 4RGNA 4IUTA 4Z9CB 3JAML 1STGA 3URYA 4KKUA 5KEEA 4KJNA 3C1FA 2E2DC 4HSVA 1CA6A 3PUYA 5D65A 3KLSA 3RLFA 1ICWA 3J80L 2RSOA 4WORA 2JXMB 5EPKA 1Y8NB 1EYDA 4DA2A 3P1HA 4KKSA 3FMCA 1BR9A 2B63B 1PRTF 4FYDA 5K36H 3J81L 1BCPB 4BA1I 3HP3A 3A7LA 4X3TA 5CGKA 2SDFA 1CTMA 4CGYB 2A69C 4NDXA 3MXUA 5G3LF 4UDUC 1ZXTA 1HRJA 2L5TA 5EQ0A 3DMUA 2NUCA 1ENCA 2IW3A 2PPBC 5JVH3 2NN6I 4XYQA 1I4HA 2C5CA 1PTOC 2YYZA 1ET9A 3I73A 3T13A 3NQTA 2K5DA 3SK6A 3HG9A 3LX0A 4C2MB 2DN8A 2H4OA 3M4OB 1F2YA 2RQXA 1PTOH 2KOLA 1JB3A 2QILA 2EDGA 1EY5A 2EJMA 2Y0SB 3MFYA 2MHVA 1WD1A 1X3PA 3G6JB 2K5QA 1Q3LA 3GTPB 1TWGB 2EYFA 3KLSX 3OWEB 1GUNA 2EY6A 5I4DA 1EZ6A 3LWEA 2L4NA 4KY6A 2N88A 1O7ZA 2JEBI 1AZQA 2J7ZA 4FP5D 4A3MB 2EE1A 3NWSA 5BN4A 3MZ5A 3GTLB 1FNUA 3A8KE 1KABA 1RODA 1GXDC 4DNTB 3DWQA 2TSSA 3C2PA 3CRKC 4IZ8A 3NTIA 1DOKA 5IT9E 4KN7C 2L1BA 4X3SA 1E2ZA 1FGBD 1STEA 1WTXA 1MSHA 1EYCA 3DM1A 3D4WA 1EU4A 1CM9A 3NXWA 3KLRA 3NE5B 3T16A 2XWJB 3AB9A 2X6LA 1PTOF 4G4KA 3FVQA 2K1BA 2JA6B 1I4QA 2B2VC 3PIP3 2BOSA 2MP1A 5E4XA 3DXJC 3FPPA 1YNND 3CKIB 1EY9A 4U673 1LLRD 3SK5A 1PFMA 2NYZD 1WCMB 4K6LA 2YU9B 1QWYA 5IGFA 4C1NI 2F0JA 1BBXC 1LTRD 4G7HC 3M3YB 5DAUA 3MXGA 1EQVA 1GUWA 2F0FA 1GUGA 2A68D 2PYKA 1JOQA 2K03A 4RA8A 1O7LA 5C0XJ 2D9UA 2F1MA 4RHRA 2SOBA 4C3HB 3N52A 4K8JA 3BVMA 5I6YA 2KEDA 1ILQA 3K57A 1JWUD 5EKLA 1TS3A 1V43A 5CYUA 2H1EA 5CV5A 1JC7A 1TIID 1HFNA 2EVBA 1CHPD 1B9NA 1TS2A 3C3LA 3A54A 3H94A 5C0XI 2ZXPA 1KLGD 1TS5A 4B9XA 1U4PA 1CFMA 2B8FA 4ZAIA 3K5NA 1QE6A 1TT2A 3K59A 1R4QB 5CV4A 3JAME 3WOEA 1OXSC 1G2SA 5C5MA 5FO9B 4KV6A 1MSGA 5TSSA 3W2DA 3NK9A 4DK0A 1JWMD 5JJZA 2E74C 2A73B 2J0TD 2PO4A 3U9SA 2BE5D 3IL8A 3HOXB 2Z1CA 5FLXL 5I2YA 3MAQA 3J80E 2XVSA 5EKIA 4C3HG 4Q5VA 5M3MB 1JORA 3SR1A 4CKCA 1YNNC 1KDCA 3S16B 4IFDJ 4ZKBB 4CJ0B 4ILWA 3HOWB 2GA4B 3J81E 1DOLA 4PMCA 3E0JA 1ET6A 1LTGD 1Q12A 4ODGA 3TDQA 5T1GA 1UAPA 5T1IA 3RUZA 1EY4A 2QF7A 1EWCA 4QUFA 2A68C 1TWAB 2NWGA 1VDZA 3MXPA 2XIWA 1S4ZA 3VYSA 3DWPA 3PIO3 4S3SA 2K33A 4XQJA 2EYPA 1RHPA 2RBMA 2JA5B 1WVLA 1Y1WB 1ILPA 1LABA 3F2UA 3D3RA 4IFDI 1Z6HA 2ICIA 3PO3B 3K5OA 4FO2A 3I70A 1PTOB 3ND9A 4B08A 4HSPA 3QG1A 1FNVA 1X32A 4K8IA 3M7NA 1MGSA 2LFNA 1SNMA 1T5XD 4X3KA 1PFBA 2WV6D 3EROA 3HZXA 2KA7A 2Q8TA 1TWFB 2EYMA 4RCNA 2SNMA 5CR3A 4MIUA 4PNYA 2F0WA 3PUXA 3BYYB 4KI0A 4RCOA 1TVXA 1MBYA 4XDXA 1Y1VB 1GUSA 1EY8A 3C46A 1SNCA 1EWHA 1LACA 2EY1A 2ZXRA 1VMPA 4I65A 2BE5C 5EGTA 2MUYA 3CQZB 2B8GA 3IFDA 1J8IA 5KYLA 1S5FD 2Q8IB 1EU3A 5FO8B 4IUQA 4LJZC 2AWNA 1KNEA 1TS4A 1B53A 1IHZA 3DWAA 3V2TA 3FRPB 2F0HA 3S1RB 2IT1A 5CBAE 4NKLA 1C8CA 1H9JA 1DYQA 1VF5C 5ELEA 2BDOA 3H6MA 1EY7A 1SXTA 3T4AC 4QF4A 5HURA 4O1NA 1SYEA 4BBSB 2EPBA 4IUNA 2EZVA 3GP7A 1DONA 5C4HA 1CZWA 3L7ZC 4ZUIA 2WACA 1JE4A 4CKBA 1WTOA 3X3NA 1Q1BA 5M5XB 3WDNA 2EOTA 3ITPA 3TP7A 4G57A 1STAA 1HUNA 4C3JB 3NTKA 1AP0A 1TQOA 5M5YB 2A6HD 4ME5A 1C4QA 3SXHA 2D2CC 5BN5A 1V8QA 1RCVD 1RD9D 4L6TB 2MJ8A 4KJOA 3K7AB 1XWEA 1AN8A 4KN4C 4YIJA 1QNKA 2O5JC 1QOHA 3GV6A 1DCZA 1ENAA 1F9SA 3J7AV 2R3ZA 3D4DA 2NBFA 1WD0A 1R4PB 4XYOA 2MGSA 1EFID 3D6CA 2CHBD 1OO9B 3QJYA 4RKBA 4KMUC 2AQ1B 3SDZA 1LT3D 2K28A 1TR5A 4RFBA 5DM73 3I72A 1NR2A 5FKAC 2VNUD 1U4MA 5JAVA 2A6ED 2SEBD 2KUMA 4ID6A 4V0BA 1E0BA 2B2VA 3GTKB 1PYWD 2F0OA 5FOBB 3OOCA 1LTBD 4QCLA 4PMWA 2XWBB 4C3JG 2F0EA 2PMZB 1QNUA 3M4YA 4R8NA 4TSSA 2ZXOA 5I2XA 5HGTA 2K04A 3QIAA 4I7ZC 2NN6G 3S2DB 1TY2A 3D31A 3VR6A 2XRSD 3MVVA 2IWHA 3H3VC 1S5DD 3SK8A 1EEFD 3RZOB 4UAIA 5FLXE 4FXKC 3VYTA 1EQTA 4OHJA 3S1MB 4HN7A 3R3OA 2RVLA 3MHBA 5IODA 3S1QB 2F0VA 1UUPA 2BDNA 3NTHA 4R8IA 2R92B 1G291 4FF1A 2WIIB 3TMEA 3I4LA 3TSSA 4DN4M 2A6HC 1SMYC 2DY8A 1SNQA 4A3EB 4QIWB 3SE0A 2HDMA 4CBVA 2HQEA 2PZUA 4ZYSA 1A3UA 4K2LA 3HEJA 1CA5A 4H44C 3LNNA 3Q0AA 3D6WA 2HCIA 5EPJA 3I4MB 1GHJA 1LTID 3RZDB 1BQQT 2RA4A 2EJGC 3FPUB 4PMBA 3MA2B 4FF2A 5C4ZA 2VXWA 5ELCA 5KNCA 3E5SA 2L0CA 2B2TA 5EBCA 1Q8IA 5IGEA 1D5MC 3VYRA 5C44B 2A6EC 1HPCA 3EA6A 3EQLC 3I3CA 3Q23A 4KD3A 3K5MA 3P7JA 3AU7A 4LAAA 1SAPA 3TN2A 3S9WA 1PZID 4F88A 5IGGA 2LS01 1OXVA 3RMHA 3TZDA 4N9PA 1JQYD 3IAYA 3ND8A 2HUGA 4FXGC 1ESRA 1QCBD 4OIKA 4X3UA 1XXGA 4DU9A 1GOZA 1V1PB 1CI3M 3OHXC 3G7LA 4WRDA 4C3IG 1Q90A 5A35A 2L11A 2FMCA 4H0LC 5CORA 5CV9A 2IJ0A 1B9MA 1BO0A 4QB4A 4BY1B 2PW7A 1EY6A 1B3AA 1HXYD 3P75A 3HOZB 4KK7A 2OF1A 1CQFA 1E2VA 2F0MA 1IL8A 5KNDA 5EPLA 1IYUA 2RSNA 4OO1I 3H91A 5LL6S 1YNJD 3GO5A 4QUCA 3BYTB 5FO7B 3K0YA 1DJRD 2NN6H 3J7AF 1B50A 5A2QL 3EJIA 2RDHA 1TY0A 3DHQA 2NZ1D 1Y8PB 2E76C 4KTAA 3A8IE 4CJ1B 4H13C 2PZWA 1S5ED 3A8JE 4IALA 4HMJA 4A3BB 1G8ZD 5ELDA 5IGDA 1QG7A 3A56A 5C3XA 1KNAA 5CC4A 3TP8A 1L0YB 1V1PA 5JEAJ 3GTJB 1LT4D 1I6VC 5COYA 3A7AB 3V05A 2R93B 3W3AA 3HOVB 4A3JB 1H9KA 2EY5A 2E75C 1H9RA 5LL6X 5IGCA 3K5LA 5C4XB 3OMCA 2CVRA 3O13A 1HQMC 2G9DA 2X6GA 4KHVA 2F0GA 3QO2A 2XN9C 4ZRZA 2B2TC 1I4PA 2Z4HA 3MC0B 1KLUD 1FD7D 3KUPA 1HUMA 4JBWA 2NVYB 3R2TA 4KD4A 3D4RA 2QCPX 2ICEC 1S5BD 4NW2A 2JE6I 5KRUA 3SVMA 2NVTB 4ULLA 4O42A 3TBIB 1CZGA 1EY0A 5C5LA 1SSOA 3NP8A 3SHLA 1JICA 1STHA 4XQNA 1G2TA 1SEBD 5JOBA 2C9OA 1YNJC 4DAYA 2BA1A 1SYCA 3L3OC 2JA7B 4IFDG 2MPMA 2VB2X 2L9HA 5CV6A 2RKSA 1O7YA 2KVMA 5JPMC 3QWNA 1NCVA 1PZJD 1C48A 1RTOA 5C3WA 4LK1C 5J22A 1I50B 2WB1B 1TWHB 1SDFA 2M2LA 2NTSA 1GHKA 4L8JA 4IUPA 4KKTA 4TQUS 2FFKB 1D1KA 1SNOA 4OIJA 3EFXD 1AW7A 2F0LA 2LKVA 1BUVT 3WOFA 1DM0B 3ZYYX 1I4RA 1A2UA 1B44D 1II3A 5I9OA 1HTLD 3TP6A 5C6AA 1IW7D 3QB3A 4TRDA 1SE4A 1A3TA 5E1FA 4V190 3BS1A 2BCOA 4BY7B 2IX3A 4KY7A 2NVXB 1F2LA 2IX0A 4PQXA 1F2MA 1BXTA 4NMZA 2CQAA 4RGOS 3Q22A 1Z47A 1VF7A 3T56B 2Z8LA 1NR4A 3BDCA 3SEBA 1KTKA 3GQBA 1DZ1A 2Z4IA 2FMMA 3X3MA 2EYLA 1VMCA 2XNAC 2F03A 1ZYRD 1AFPA 4XXEA 1M8AA 2B39A 4LMQD 1CHQD 5KGUA 2NVQB 3L9AX 3MTSA 4F87A 2F0TA 3FKIB 4DXFA 1I6HB 3PO2B 3OIPA 1WTWA 3GV3A 4IQZA 1H9MA 2NB0A 1TKWB 2F0PA 5C3EB 2NTTA 1RJTA 3UI2A 5DEHA 3KBGA 4EVOA 2PNRC 3K58A 4M8AA 1WTRA 1GJXA 2VUMB 1LO5D 3HS0C 1D2BA 4MHEA 4DF7A 1UNSA 4ZLTF 3GTQB 1UEAB 5A2QE 3FEWX 2XSCA 3N6RA 1XX8A 4EQNA 3NHHA 3D8GA 3VA5A 4B9WA 4IFDH 2OXPA 3IFTA 1IW7C 4FF3A 2R61A 1HA5A 2VB3X 3RD4A 4ZKCB 2DY7A 4HCEA 1O80A 2V4DA 3OIQA 2X69A 2A74C 2B2WC 1Z7TA 2AQ3B 2SNSA 3H0GB 1Y8OB 3U9OA 3GTGB 1WTVA 1F2ZA 4M1UB 2F3WA 3J7YW 2QKIC 1KDAA 3MXNA 3NBHA 5M9OA 1SNDA 5KYIA 4Q0FA 1VCIA 2PCFB 1ZYRC 4J1MA 3VR2A 3OPOA 4QMGA 5I9PA 2F0SA 3I90A 5E3FA 1W6JA 1F9RA 5KNBA 1G91A 2KECA 1PLFA 2F3VA 1FYCA 4CJ2C 1E2WA 1KDBA 2DNCA 3HGBA 4H7BA 1CK1A 2EY2A 4IUUA 1LT6D 1F9QA 1PXUA 2HCCA 4K14A 3DEOA 1LV9A 2AQ2B 4HAEA 4A3IB 5D3IB 4WJWA 2RDFA 1QILA 2K05A 3S1NB 4A93B 3NUCA 1KAAA 1EEID 4C3IB 1ESFA 1SYDA 3T51B 1EYAA 1K83B 1I3QB 1ENFA 1LTSD 4EQOA 3KK7A 1HHVA 3M85A 4RH6A 2E2JB 1K8MA 5AFWA 1FNWA 2F4IA 4Y7NB 4C1NK 1J9OA 1CT1D 4WFN3 3QOJA 4K6DA 3GTMB 2WAQB 3BDOA 1STNA 3Q6SA 1PDQA 1EIGA 5M5WB 2L55A 4FF4A 3BVZA 4IN3A 4F7XA 3FDTA 2KQ3A 2IX1A 2JEAI 3BVGA 2B2YC 1DD2A 4NP5A 5C4JB 4IUVA 3DEPA 1F77A 2HDLA 4TKOB 3I8ZA 1BNZA 4RWSC 3BG3A 4KY5A 4DGZA 1O78A 3S17B 3NPPA 3Q24A 4KHZA 2AUJD 1U9RA 1A15A 4MN3A 2B2UC 1PFNA 1RTNA 1SE2A 3P20A 5IOCA 1BCPD 4OO1G 1TWCB 2K01A 1HCZA 3VR3A 1X3QA 2L12A 3GTOB 1HTPA 3MEHA 4RKLA 2OEOA 4BA2I 4RGTA 2R7ZB 2K5WA 2E2IB 3I4NB 3OW7A 1EL0A 3H09A 5D14A 4PV1C 1IKLA 5J1ZA 2TMPA 1I4XA 3DUZA 1B1ZA 1SYGA 1SJHD 3HKZB 4E6IA 1D6EC 5CMDA 1JOKA 2WKDA 4DFAA 3OSOA 3S15B 5EJWA 2D5DA 4RAUC 2E2HB 5CV8A 4BS9A 5IGBA 2PW5A 5EBDA 3I91A 3CRLC 4OL7A 5IIFA 1HFGA 3VR5A 5C0XG 1F9PA 3NWTA 5K5PA 1L0XB 1B2TA 4K5WA 4DK1A 1SFOB 2AUKA 2KHSA 3PUZA 4CHTB 1PRTB 1EZ8A 2F0KA 4F8MA 4XQQA 4BBRB 2BA0A 1IKMA 1MD2D 1H9SB 5BN3A 3OMGA 2Q8RE 4XT1B 5JEAG 3PV0A 4FNFA 3HRZC 3ONAB 1D5ZC 2N55A 2WP8J 2JSOA 2EYJA 2F0DA 3R8BA 5LHY1 2CW0D 2KCNA 2QDBA 3EVQA 4HMIA 1BCPC 1D1IA 2EYHA 2WKCA 3C1EA 2K6AA 5ISRA 5EKKA 2QEJC 3R2IA 2F0QA 1EOTA 3OWFA 2KJXA 3VYUA 1K8OA 2FHTA 1IYVA 1W6KA 3QOLA 4A3FB 2WINB 2O2LD 1DOMA 2O5IC 2A5HA 2JA8B 1BF4A 2FJ2A 1S5CD 2G9HD 1LT5D 5DNFA 1GUOA 2RDGA 1H9SA 3PMFA 1RDPD 3PUWA 3KBXA 5DM63 1MI2A 4K2KA 1SJED 1Q1EA 3VA7A 5I6WA 3S2HB 1HQRD 5CV7A 3S14B 1LTTD 4N9TA 4OO1H 4U68A 5CBEE 3NBIA 1XTCD 2EJFC 5FK9C 3M7GA 4C56C 3BDLA 4HCSA 4A3KB 5D3DA 5M3FB 1STBA 1U4LA 1JCKB 3NQIA 1PRTD 2LY7A 1GUTA 2B2WA 4FVMA 2KCCA 3A55A 1ONLA 4ZK9B 1STYA 4HR7B 5JPNC 1RKNA 1BDOA 1A6XA 2FINB 1HA6A 5G3LD 2F0NA 4IURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RKL A;  2OEO A;  5JAV A;  4PMB A;  2ENB A;  1AEX A;  1EY0 A;  3BDC A;  5C4Z A;  5C5L A;  3EJI A;  4IZ8 A;  2QDB A;  3NP8 A;  4ID6 A;  3EVQ A;  2EYP A;  4HMI A;  4S3S A;  3SHL A;  1STH A;  3H6M A;  1EY7 A;  3E5S A;  3DHQ A;  5CV5 A;  1SYD A;  2RBM A;  2EYH A;  1EYA A;  4KTA A;  2F0O A;  3C1E A;  5JOB A;  5CGK A;  4QF4 A;  1EYC A;  1NUC A;  2EYL A;  5HUR A;  5ISR A;  5EKK A;  5J1Z A;  5IGE A;  4NDX A;  1SYE A;  2EXZ A;  2PZW A;  1SYC A;  4EQO A;  4IUN A;  3D4W A;  2F0Q A;  3OWF A;  2SNS A;  5C4H A;  4IAL A;  2F0E A;  4ZUJ A;  3NXW A;  4HMJ A;  3U9O A;  5IGD A;  4ZUI A;  1F2Z A;  2WAC A;  3QOL A;  4R8N A;  1SYG A;  5CV6 A;  2F3W A;  5C3X A;  2RKS A;  5F2D A;  5HGT A;  1JOO A;  3DMU A;  2NUC A;  1ENC A;  4KD3 A;  3TP8 A;  4B9X A;  4K5X A;  4E6I A;  5CC4 A;  1KDA A;  5KGU A;  4LAA A;  5M9O A;  4EQP A;  1JOK A;  3MVV A;  3T16 A;  1SND A;  1TT2 A;  3OSO A;  4K8I A;  4DFA A;  5KYI A;  3ITP A;  3S9W A;  2F0T A;  1NSN S;  3TP7 A;  2F0U A;  3QOJ A;  1STA A;  4G57 A;  4K6D A;  1SNM A;  5CV4 A;  5C3W A;  1STN A;  3SK8 A;  5IGG A;  5J22 A;  5CV8 A;  5IGB A;  3ERO A;  3T13 A;  3HZX A;  2PW5 A;  4J1M A;  5C5M A;  4QMG A;  1TQO A;  3NQT A;  4KV6 A;  2O4X A;  5I9P A;  1SNP A;  2F0S A;  5E3F A;  1SYF A;  3PMF A;  3SK6 A;  3R3O A;  4N9P A;  4OL7 A;  5IIF A;  2F0I A;  3NK9 A;  4ME5 A;  4F7X A;  2F0P A;  3TP5 A;  2M00 A;  3MHB A;  1A3V A;  2KQ3 A;  5IOD A;  3LX0 A;  2EYM A;  3SXH A;  3ERQ A;  4K2K A;  2SNM A;  5K5P A;  2EYO A;  1F2Y A;  1EY9 A;  2F0V A;  4J6H A;  5EKL A;  2EY5 A;  5CR3 A;  5DEH A;  4MIU A;  3SK5 A;  4NP5 A;  5I6W A;  4K5W A;  1SNO A;  1A2T A;  4PNY A;  4DU9 A;  2F3V A;  4KJO A;  2F0W A;  4EVO A;  1EY5 A;  5CV7 A;  2KHS A;  1STG A;  2PZT A;  2F0L A;  5IGF A;  2LKV A;  4WRD A;  4YIJ A;  5IGC A;  1EZ8 A;  4N9T A;  3TME A;  4K5V A;  5KEE A;  3OMC A;  2F0K A;  4KJN A;  2F0J A;  4F8M A;  4KY5 A;  3C1F A;  3SK4 A;  1EY8 A;  4DGZ A;  1ENA A;  1A2U A;  1KDB A;  1SNC A;  1SNQ A;  4KHV A;  3SR1 A;  2F0G A;  1II3 A;  3BDL A;  1JOR A;  5I9O A;  2EY1 A;  5CV9 A;  5DAU A;  1EQV A;  2EYF A;  3D4D A;  4H7B A;  4I65 A;  2F0F A;  1KDC A;  3OMG A;  2EY6 A;  2PW7 A;  4QB4 A;  5EGT A;  2PYK A;  1SYB A;  1STB A;  1EY6 A;  1EZ6 A;  1JOQ A;  2EY2 A;  3TP6 A;  2HQE A;  2PZU A;  4NMZ A;  5C6A A;  1A3U A;  1U9R A;  4KY6 A;  4DF7 A;  3QB3 A;  2SOB A;  3P75 A;  4K2L A;  4TRD A;  4PMC A;  2OF1 A;  3HEJ A;  4ZQ3 A;  1A3T A;  2F0M A;  5KYL A;  5E1F A;  3D6C A;  4K14 A;  4WOR A;  4ODG A;  4K8J A;  5KIX A;  2RDF A;  5IOC A;  4KD4 A;  1EYD A;  4EQN A;  4RKB A;  3NHH A;  5I6Y A;  3D8G A;  3RUZ A;  4HTH A;  1EY4 A;  3P1H A;  5NUC A;  5J39 A;  4KY7 A;  1STY A;  3VA5 A;  4B9W A;  2PQE A;  1IHZ A;  1TR5 A;  2OXP A;  1F2M A;  2EYJ A;  2F0N A;  1RKN A;  3MXP A;  3V2T A;  2F0H A;  3MZ5 A;  5KRU A;  2F0D A;  3NUC A;  1KAB A;  3MEH A;  1KAA A;  4NKL A; 
#chains in the Genus database with same CATH topology
 2ID0 A;  2KCM A;  1HNX L;  4DAP A;  1AEX A;  4BXX H;  1K8G A;  2I07 B;  5C4J H;  1BCP F;  4HED A;  4XTC S;  3HOX G;  1OXU A;  1NUC A;  4R9W A;  4OGQ C;  1I4G A;  4OX9 Q;  4DNR B;  1U4R A;  1WTP A;  4A3M H;  5C0X H;  4ZUJ A;  3S17 H;  5M3M G;  1IYJ B;  2CW0 C;  3F1Z A;  3CD6 A;  1AZP A;  3CU7 A;  3MWY W;  3LWU A;  5F2D A;  4L63 B;  5IT9 L;  1JOO A;  2UXD Q;  5K36 G;  2K4K A;  2M9V A;  4OEL B;  3AEV A;  2CCZ A;  1LTA D;  3TRZ A;  3HOU B;  4JBK A;  3HOW G;  1V1O A;  2LMC B;  1NSN S;  4FXD A;  2F0U A;  2VQF L;  4PG3 A;  5E4W C;  5ELB A;  1XYI A;  4A3L G;  2F52 A;  4HJ8 A;  1EIH A;  2O4X A;  1SNP A;  1SYF A;  1IBM L;  2F0I A;  3A0J A;  1YI2 A;  4LF4 Q;  2M00 A;  3KF8 B;  1A3V A;  1LTL A;  2ZT9 C;  1JWS D;  2AWO A;  5JEA H;  4KHP Q;  4J6H A;  5JVG 3;  1A2T A;  1P16 A;  3IKJ A;  1SBB B;  1QB5 D;  4JK1 C;  1XMQ L;  5ELF A;  4AYB B;  2PZT A;  4NXN Q;  1G6Z A;  4K5V A;  2J4X A;  2E2I H;  3I4N H;  3SK4 A;  4R4I A;  3RLO A;  2N3S A;  1I94 Q;  1KL9 A;  2K52 A;  1Y1W G;  4XIG S;  2KEE A;  1RF2 D;  1SYB A;  2IPK D;  3T53 B;  1VQ6 A;  2K7V A;  1QJO A;  2JYO A;  4JI6 Q;  2ZJQ A;  3PO3 G;  3VR4 A;  4DXG A;  4ZQ3 A;  1ZKO A;  1L2F A;  2I0Q A;  1TU2 B;  4J8Q A;  1OXX K;  2I46 A;  1R9T B;  1WCM H;  3K6O A;  3NSW A;  1M4V A;  5KIX A;  3KLW A;  3S15 H;  2IL8 A;  3GD7 A;  4BWG B;  1IL2 A;  3G4S A;  2E2H H;  5J39 A;  4HTH A;  5NUC A;  4G7O C;  1NAP A;  3V96 A;  4ABN A;  1EQR A;  1MJC A;  1PRT C;  2A69 D;  4G7Z C;  1CQV A;  2XRQ D;  4DAV A;  1RIP A;  2PQE A;  4DUY L;  1OXT A;  4XT3 B;  3AMU A;  4P75 A;  1D5X C;  3BZD B;  2ENB A;  1S40 A;  4DPG A;  4A3D B;  3TZU A;  1D8L A;  2D62 A;  2DNE A;  3CHB D;  1Y69 U;  1MHW C;  3NEM A;  1XNR Q;  1VQE A;  1PTO D;  2R6G A;  4P2C B;  2K32 A;  4GN4 B;  2B2Y A;  2EXZ A;  1BOS A;  1DXM A;  1SMY D;  1Y1V G;  2K5V A;  3KF8 A;  3PUV A;  1ML0 D;  1OTC A;  1I5F A;  1NY4 A;  4RGM A;  2OT2 A;  4A3G B;  5IP9 G;  4R4T A;  4QJF A;  1YIT A;  4K5X A;  4EQP A;  4EGV A;  4PZ7 A;  3CCM A;  3MFG A;  2UUA L;  3UDI A;  1PZK D;  2CFM A;  1ZEQ X;  3E6Z X;  2JP1 A;  1SE3 A;  4CKE A;  3U50 C;  4AYB G;  2MQH A;  4GZY C;  3PGZ A;  1FVI A;  2WAQ E;  2Q2I A;  4JI2 Q;  3R93 A;  1JR0 D;  4RHS A;  3TP5 A;  2B2U A;  1EOV A;  3BJU A;  1WTQ A;  1B4O A;  1T5E A;  1FR3 A;  1PMR A;  3ERQ A;  3HOY B;  2EYO A;  2MFI A;  4OWT B;  4RGN A;  4IUT A;  4Z9C B;  4O0A A;  3JAM L;  1HR0 L;  1STG A;  3URY A;  1VQC A;  4KKU A;  1KQS A;  2RF4 A;  3ULJ A;  4KJN A;  5KEE A;  3C1F A;  4YCV A;  2DJG C;  2E2D C;  1PYS B;  1SRU A;  4JBJ A;  1JE5 A;  4HSV A;  1CA6 A;  3PUY A;  5D65 A;  3KLS A;  3RLF A;  1ICW A;  4GN3 B;  3TS0 A;  3J80 L;  2RSO A;  2UUB Q;  4WOR A;  2JXM B;  5EPK A;  1Y8N B;  1X56 A;  2JA8 H;  1JB7 A;  1EYD A;  2AMC B;  4DA2 A;  3P1H A;  4KKS A;  5HGQ A;  3FMC A;  1BR9 A;  2B63 B;  2P5Z X;  5M3M H;  1PRT F;  2G5D A;  4FYD A;  5K36 H;  1UEB A;  3J81 L;  1BCP B;  4BA1 I;  2WFW A;  1CKN B;  3HP3 A;  3A7L A;  2FXQ A;  4X3T A;  2E5L Q;  3HOW H;  4A3L H;  4MTN A;  2HIX A;  5J3B A;  5CGK A;  2SDF A;  4O2D A;  1CTM A;  4ME3 A;  4CGY B;  2A69 C;  4NDX A;  3MXU A;  5G3L F;  3PQI A;  2N78 A;  4UDU C;  4DUY Q;  2A8V A;  1ZXT A;  1HRJ A;  2EXD A;  2L5T A;  1X9N A;  3I2Z A;  3OTO Q;  3G6E A;  5EQ0 A;  3HKS A;  3DMU A;  5M3F H;  2NUC A;  1ENC A;  2IW3 A;  2PPB C;  3BZK A;  5JVH 3;  3RR5 A;  2NN6 I;  4XYQ A;  1G6P A;  1I4H A;  2C5C A;  4UPA A;  1PTO C;  4B3R L;  2YYZ A;  1ET9 A;  3I73 A;  4DV5 L;  3T13 A;  2HIV A;  4JCV E;  3NQT A;  4L5R C;  2K5D A;  4IJH A;  2CWP A;  4B3M Q;  3SK6 A;  1Y1W H;  3HG9 A;  1VQO A;  3LX0 A;  4C2M B;  2DN8 A;  2H4O A;  3PO3 H;  3M4O B;  1F2Y A;  2RQX A;  1PTO H;  2KOL A;  1JB3 A;  2QIL A;  2EDG A;  1EY5 A;  2EJM A;  2Y0S B;  3MFY A;  2UUA Q;  1N36 L;  1GM5 A;  2MHV A;  3PF4 A;  1WD1 A;  1X3P A;  3K0X A;  1B8A A;  3G6J B;  2K5Q A;  1WOC A;  4X65 L;  1Q3L A;  2L15 A;  3GTP B;  1TWG B;  2EYF A;  3KLS X;  4A75 A;  3OWE B;  1GUN A;  2EY6 A;  3CCQ A;  4K0K Q;  5I4D A;  1IXR A;  1EZ6 A;  3LWE A;  1HNZ Q;  4IOA A;  1CKN A;  2L4N A;  4KY6 A;  1MKH A;  4DK3 C;  3F2C A;  1HR0 Q;  3LGJ A;  2N88 A;  1O7Z A;  1Z9F A;  1X3F A;  2JEB I;  3PCO B;  1AZQ A;  2J7Z A;  1V1Q A;  3J7Z C;  4FP5 D;  4A3M B;  2EE1 A;  2BH8 A;  3NWS A;  4I7A A;  5BN4 A;  2OTJ A;  3MZ5 A;  1X3G A;  1FJG L;  3GTL B;  1FNU A;  3A8K E;  1KAB A;  1ROD A;  1GXD C;  5IP9 H;  4DNT B;  3DWQ A;  2TSS A;  3CQZ H;  4DR4 Q;  3C2P A;  3K81 C;  3CRK C;  4IZ8 A;  1XMO L;  3NTI A;  1DOK A;  5IT9 E;  4KN7 C;  2L1B A;  4X3S A;  3STB D;  1K0S A;  1E2Z A;  1FGB D;  2R92 G;  1STE A;  1WTX A;  2ES2 A;  1MSH A;  1EYC A;  3DM1 A;  3D4W A;  1EU4 A;  1CM9 A;  3NXW A;  4A3E G;  3KLR A;  3S1R H;  2D0O A;  2K14 A;  1NMF A;  3NE5 B;  3T16 A;  2XWJ B;  1Q86 C;  3AB9 A;  2X6L A;  1PTO F;  2DUD A;  1L1O A;  3FVQ A;  4G4K A;  2K1B A;  4DV3 Q;  3UDX A;  2JA6 B;  1I4Q A;  1WTH A;  2B2V C;  3PIP 3;  2BOS A;  1B70 B;  1VQK A;  1FGU A;  2MP1 A;  5E4X A;  3DXJ C;  3FPP A;  1YNN D;  3CKI B;  1EY9 A;  4U67 3;  1LLR D;  3SK5 A;  1GVP A;  2VQE L;  2KBN A;  4LF9 L;  1PFM A;  2NYZ D;  1JT8 A;  1WCM B;  4K6L A;  2YU9 B;  1QWY A;  5IGF A;  1VQ5 A;  4DV5 Q;  4C1N I;  2F0J A;  3UDF A;  1BBX C;  2HT1 A;  3PF5 A;  1LTR D;  4G7H C;  3M3Y B;  3ERS X;  1WI5 A;  3MXG A;  5DAU A;  5M5Y H;  1EQV A;  4ZCK A;  1GUW A;  2F0F A;  1A62 A;  1GUG A;  4DV1 L;  2A68 D;  2PYK A;  2VY3 A;  4LWC A;  2K03 A;  1JOQ A;  4RA8 A;  1O7L A;  5C0X J;  5C44 G;  2D9U A;  2F1M A;  1JJC B;  4RHR A;  4LFC Q;  2SOB A;  4LF6 Q;  2EIF A;  1N36 Q;  4C3H B;  3KOJ A;  1SRO A;  3K7A H;  3N52 A;  4K8J A;  1W2B A;  3BVM A;  4Y52 H;  4X65 Q;  5I6Y A;  1HNW L;  2KED A;  1ILQ A;  1P8L A;  4HIM A;  2Z9H A;  3K57 A;  1JWU D;  5EKL A;  1TS3 A;  1V43 A;  4R1J A;  1KC8 C;  4P74 A;  5CYU A;  2H1E A;  1LYL A;  4YHH L;  1M90 C;  5CV5 A;  1UE7 A;  1C0A A;  1JC7 A;  1TII D;  1HFN A;  2EVB A;  1SR3 A;  2CH4 W;  1CHP D;  1B9N A;  1TS2 A;  1YEZ A;  2JN4 A;  3CC4 A;  3C3L A;  1FJG Q;  3A54 A;  3H94 A;  1K0R A;  1KAW A;  5C0X I;  1UE6 A;  2ZXP A;  4EQ5 A;  1VQL A;  1KLG D;  4BY1 G;  5IP7 G;  1TS5 A;  4B9X A;  1U4P A;  1CFM A;  3STB C;  4YCW A;  2B8F A;  4ZAI A;  3K5N A;  1QE6 A;  1TT2 A;  1Q81 C;  2H5X A;  4HIK A;  3K59 A;  4DR3 L;  3HOZ G;  1R4Q B;  5CV4 A;  3JAM E;  3CCE A;  3WOE A;  1OXS C;  1G2S A;  5C5M A;  4QGU A;  5FO9 B;  4KV6 A;  1MSG A;  5TSS A;  1XNQ Q;  3W2D A;  4JI8 Q;  3NK9 A;  1JJG A;  4DK0 A;  1JWM D;  5JJZ A;  5L37 A;  4JBM A;  2E74 C;  2A73 B;  2J0T D;  2PO4 A;  3U9S A;  2BE5 D;  5LMU L;  3IL8 A;  2MO1 A;  3HOX B;  5JJL A;  2Z1C A;  4YWL A;  3S2D H;  5FLX L;  5I2Y A;  3MAQ A;  3J80 E;  4GOP C;  2XVS A;  3HFZ B;  5EKI A;  4C3H G;  4Q5V A;  5M3M B;  3RZO H;  1JOR A;  3SR1 A;  4CKC A;  1NJI C;  1YNN C;  1KDC A;  3S16 B;  4LF5 L;  4IFD J;  3CW2 C;  4ZKB B;  4CJ0 B;  2VS1 A;  4JI0 L;  4ILW A;  3HOW B;  4LF9 Q;  4JI5 L;  2GA4 B;  3J81 E;  1DOL A;  4PMC A;  2QEX A;  3S1Q H;  3E0J A;  1IZ6 A;  1ET6 A;  1LTG D;  2R92 H;  1XPO A;  1Q12 A;  4ODG A;  4DV0 L;  3TDQ A;  5T1G A;  1KD1 C;  4L5S A;  1FL0 A;  3BZC A;  1UE1 A;  1UAP A;  5T1I A;  4GS3 A;  3RUZ A;  1EY4 A;  2QF7 A;  1EWC A;  4QUF A;  2A68 C;  4NXM L;  1TWA B;  2NWG A;  1VDZ A;  3MXP A;  2XIW A;  4A3E H;  1N8R C;  1S4Z A;  2AKW B;  3VYS A;  3F8T A;  1UWV A;  3DWP A;  2I5H A;  2R93 G;  1E3P A;  3PIO 3;  5JJK A;  4S3S A;  2K33 A;  4XQJ A;  2EYP A;  3M4O H;  4A3J G;  1RHP A;  3DM3 A;  1PYB A;  2RBM A;  1RL2 A;  1KRS A;  3CC2 A;  2E8G A;  2JA5 B;  1WVL A;  1HNW Q;  3T1H L;  1Y1W B;  1ILP A;  1TXY A;  4OXP A;  1LAB A;  3F2U A;  2ASB A;  3D3R A;  4IFD I;  1Z6H A;  2ICI A;  3PO3 B;  3F2D A;  3K5O A;  4FO2 A;  1TWG H;  3I70 A;  1PTO B;  1YIJ A;  3ND9 A;  4B08 A;  1YVC A;  4HSP A;  2HHH L;  1N34 L;  3QG1 A;  1FNV A;  4L5T A;  1VQA A;  1X32 A;  4K8I A;  3M7N A;  1MGS A;  2JA9 A;  2LFN A;  1SNM A;  1T5X D;  4IJL A;  4X3K A;  1PFB A;  2WV6 D;  3ERO A;  5IWA L;  3HZX A;  4IOC A;  1BVS A;  2ATW A;  1B3Q A;  5GQO A;  2KA7 A;  2Q8T A;  4X66 L;  5C44 H;  1TWF B;  2EYM A;  2UXC L;  4RCN A;  2SNM A;  1PH5 A;  3GTL H;  1ASZ A;  5CR3 A;  4MIU A;  4MTK A;  4PNY A;  2CH4 A;  2PNH A;  4DV4 L;  2Q2U A;  2JQO A;  2F0W A;  3PUX A;  3BYY B;  4KI0 A;  4RCO A;  1SN8 A;  1VQM A;  1TVX A;  1G51 A;  2QGQ A;  1MBY A;  1KRT A;  3WWV A;  4JC0 A;  4XDX A;  3KF6 B;  1Y1V B;  1GUS A;  3TS2 A;  1EY8 A;  1QUQ B;  3C46 A;  1SNC A;  3E9I A;  1EWH A;  1LAC A;  2EY1 A;  2ZXR A;  1VMP A;  4I65 A;  2BE5 C;  1IBL L;  5EGT A;  2MUY A;  3CQZ B;  3E3X A;  2B8G A;  4DR2 Q;  2JA7 G;  3IFD A;  4JV5 L;  4A4I A;  1J8I A;  5KYL A;  1S5F D;  2Q8I B;  4B3T L;  1EU3 A;  5FO8 B;  4IUQ A;  4LJZ C;  2AWN A;  1KNE A;  1TS4 A;  1PH9 A;  1B53 A;  1IHZ A;  2JA6 H;  2WB1 G;  3DWA A;  3V2T A;  3FRP B;  2JA5 G;  4LF5 Q;  4JYA Q;  4GKK L;  2F0H A;  3S1R B;  2IT1 A;  2ZTD A;  5CBA E;  3K8A A;  4NKL A;  1C8C A;  5IP7 H;  4BY1 H;  1PVO A;  4FDB A;  1H9J A;  1DYQ A;  1VF5 C;  5ELE A;  2BDO A;  3H6M A;  3HOZ H;  1EY7 A;  3ICE A;  4DV0 Q;  1SXT A;  3T4A C;  5FJ8 H;  4QF4 A;  5HUR A;  2YU9 H;  2B29 A;  4O1N A;  1SYE A;  4NXM Q;  3A74 A;  4BBS B;  2EPB A;  1AH9 A;  4IUN A;  2EZV A;  3GP7 A;  1DON A;  2IHF A;  5C4H A;  1CZW A;  3RLN A;  3M3Y H;  3L7Z C;  2MNA A;  4ZUI A;  3A5U A;  4DV2 L;  1E22 A;  2WAC A;  4R4C A;  1JE4 A;  4CKB A;  1WTO A;  3X3N A;  1DGS A;  1Q1B A;  3MXN B;  3CME A;  5M5X B;  4APV A;  4HJA A;  3WDN A;  2EOT A;  1PHJ A;  3ITP A;  4PZ6 A;  3TP7 A;  4G57 A;  1STA A;  1HUN A;  4C3J B;  2V1C C;  3KF6 A;  4DR5 L;  1A63 A;  3T1H Q;  3T1Y L;  4C3H H;  3CCL A;  5AJ3 L;  3NTK A;  1QUQ A;  1AP0 A;  1TQO A;  5M5Y B;  5HY6 A;  4WJ4 A;  2A6H D;  4ME5 A;  4BY7 G;  1C4Q A;  3TRE A;  4JI7 L;  3SXH A;  2D2C C;  5BN5 A;  5LMN W;  1V8Q A;  1HNX Q;  1RCV D;  1RD9 D;  1N34 Q;  4L6T B;  1KXL A;  2C35 B;  2MJ8 A;  4KJO A;  3K7A B;  1XWE A;  1AN8 A;  4X62 L;  4KN4 C;  4YIJ A;  1QNK A;  5IYC G;  1EIY B;  2O5J C;  1QOH A;  5JJI A;  1CKM A;  1DCZ A;  3GV6 A;  2CKZ B;  3CPF A;  1ENA A;  2Y0S E;  1F9S A;  3J7A V;  3EN2 A;  2R3Z A;  3D4D A;  4X66 Q;  2RCF A;  2NBF A;  2R93 H;  1WD0 A;  1R4P B;  1HZC A;  4A3J H;  4XYO A;  2F4V L;  2MGS A;  1EFI D;  3D6C A;  3E0E A;  1Q8K A;  3PIO A;  5BR8 L;  2VQF Q;  4LF8 L;  2CHB D;  4WJ3 M;  1OO9 B;  3QJY A;  4RKB A;  4KMU C;  2AQ1 B;  3FKI G;  3SDZ A;  1LT3 D;  2K28 A;  1TR5 A;  4RFB A;  2RHS B;  1IBL Q;  1IBM Q;  5DM7 3;  3I72 A;  1NR2 A;  5FKA C;  2VNU D;  1U4M A;  4BBS G;  2KEN A;  5JAV A;  2VW9 A;  4JV5 Q;  2UXB L;  2A6E D;  5IYB G;  1NMG A;  2SEB D;  2KUM A;  3ZJY C;  1AE3 A;  4ID6 A;  4V0B A;  1XMQ Q;  1E0B A;  2B2V A;  3GTK B;  3HOX H;  1PYW D;  2F0O A;  5FOB B;  3OOC A;  4YWM A;  1LTB D;  4LNQ A;  4QCL A;  4PMW A;  2XWB B;  5IT9 c;  4C3J G;  2F0E A;  2PMZ B;  1J5E L;  4JI1 L;  1QNU A;  3M4Y A;  4R8N A;  3U58 A;  4TSS A;  2NVT H;  2ZXO A;  5I2X A;  3S16 H;  4IPG A;  3OYY A;  2K04 A;  5HGT A;  3QIA A;  4I7Z C;  2NN6 G;  3S2D B;  1TY2 A;  3D31 A;  3VR6 A;  3RN5 A;  2XRS D;  3MVV A;  4DR1 L;  2IWH A;  3H3V C;  4CDD C;  1S5D D;  1Q7Y C;  3FP9 A;  3SK8 A;  1EEF D;  3RZO B;  4UAI A;  5FLX E;  4FXK C;  3VYT A;  1EQT A;  4OHJ A;  3S1M B;  4HN7 A;  3R3O A;  2RVL A;  3FHW A;  3MHB A;  4NPS A;  1TWA H;  2JA7 H;  5IOD A;  1E24 A;  2NZO A;  2Z0S A;  3S1Q B;  1CSQ A;  2F0V A;  1UUP A;  2BDN A;  1ICF B;  3NTH A;  2QDL A;  4P72 A;  4R8I A;  2R92 B;  4GOP B;  3H3V H;  1G29 1;  1A0I A;  4CDE C;  4FF1 A;  2WII B;  3TME A;  3I4L A;  3HKZ E;  3TSS A;  4DN4 M;  2A6H C;  1SMY C;  2KCT A;  2DY8 A;  2B3G A;  1SNQ A;  5GAD C;  2JA5 H;  4A3E B;  4QIW B;  4HID A;  3SE0 A;  3S24 A;  2HDM A;  2YV5 A;  1UE5 A;  4CBV A;  4JG2 A;  1TWH H;  2LXJ A;  2HQE A;  2PZU A;  4ZYS A;  1A3U A;  2ZM6 L;  4K2L A;  3HEJ A;  4YWK A;  4H44 C;  1CA5 A;  3LNN A;  3H15 A;  3Q0A A;  3D6W A;  2HCI A;  5EPJ A;  1YZ6 A;  3I4M B;  2ALY B;  4YCU A;  4JOI A;  1GHJ A;  1LTI D;  3RZD B;  1BQQ T;  2RA4 A;  2EJG C;  3FPU B;  4PMB A;  3KYH C;  1VQF A;  3MA2 B;  4GNX B;  4FF2 A;  4IPD A;  5C4Z A;  1TWF H;  2VXW A;  5ELC A;  5KNC A;  1S3O A;  4JI3 L;  3E5S A;  2L0C A;  3AFQ A;  2B2T A;  2QA4 A;  5EBC A;  1Q8I A;  3B6Y A;  5IGE A;  1D5M C;  1YHB A;  3VYR A;  5C44 B;  1Y1V H;  4BY7 H;  2LXK A;  2NVX H;  2A6E C;  1BKB A;  1HPC A;  3EA6 A;  4JVZ A;  3EQL C;  4N8X 1;  3G71 A;  3I3C A;  3Q23 A;  4KD3 A;  3K5M A;  4GOP A;  2YTY A;  1VQI A;  3P7J A;  3AU7 A;  4LAA A;  5FLM G;  1SAP A;  3TN2 A;  5IYC H;  4AQY L;  3S9W A;  1PZI D;  4F88 A;  4UY8 C;  1B7Y B;  5IGG A;  1N33 L;  4GKJ L;  2NZH A;  2UUC L;  1VQD A;  2LS0 1;  1OXV A;  5ELO A;  3RMH A;  4HJ7 A;  4A3I G;  4DV7 L;  1CUK A;  4N9P A;  3TZD A;  1JQY D;  5LMN L;  4MZ9 A;  1J5E Q;  3IAY A;  3ND8 A;  2HUG A;  4LUZ A;  4FXG C;  5GAG C;  1ESR A;  3JAM c;  1QCB D;  4A93 G;  4OIK A;  4X3U A;  3AFP A;  1SE8 A;  1XXG A;  4DU9 A;  1YJW A;  1GOZ A;  1V1P B;  1CI3 M;  2Q2H A;  2NVQ H;  3OHX C;  3G7L A;  4WRD A;  2CQO A;  2PQA B;  4C3I G;  1Q82 C;  1Q90 A;  3FKI H;  5A35 A;  2L11 A;  1I6H H;  2FMC A;  4H0L C;  5COR A;  5CV9 A;  3I4M G;  2IJ0 A;  1B9M A;  1BO0 A;  4QB4 A;  4BY1 B;  4BBS H;  2PW7 A;  4A3C G;  4QL5 A;  3CF5 A;  1EY6 A;  1PH8 A;  1B3A A;  5IYB H;  3J80 c;  1U5K A;  4GNX A;  3CAM A;  3VDY A;  2KHJ A;  1HXY D;  3P75 A;  3HOZ B;  4KK7 A;  2OF1 A;  2DJF C;  1CQF A;  1E2V A;  2F0M A;  3W1G A;  1IL8 A;  3Q8D A;  4B3R Q;  5KND A;  5EPL A;  1IYU A;  5M5X H;  2N8N A;  2RSN A;  2CWA A;  4OO1 I;  5E7N A;  4C3J H;  1JMC A;  2WAQ G;  3H91 A;  4DR6 L;  5LL6 S;  1YNJ D;  3GO5 A;  4QUC A;  3BYT B;  5FO7 B;  1HJP A;  3K0Y A;  1X54 A;  1DJR D;  2NN6 H;  3J7A F;  1QVG A;  1B50 A;  5A2Q L;  3EJI A;  1E1T A;  2RDH A;  3GTQ H;  3DHQ A;  1TY0 A;  2Z6B A;  2NZ1 D;  1Y8P B;  2E76 C;  4KTA A;  4LFB L;  3A8I E;  4CJ1 B;  4HIO A;  4H13 C;  2PZW A;  4GLV B;  1MIU A;  1S5E D;  3A8J E;  4IAL A;  3U4V A;  4HMJ A;  4A3B B;  1G8Z D;  5ELD A;  5IGD A;  1QG7 A;  3A56 A;  4RG1 A;  5C3X A;  1KNA A;  3M4P A;  3TP8 A;  5CC4 A;  4OEM B;  1L0Y B;  1V1P A;  5JEA J;  2PQA A;  3KJO A;  3GTJ B;  1LT4 D;  1KHI A;  1VQJ A;  1I6V C;  4DK6 C;  4DAY B;  5COY A;  3A7A B;  3V05 A;  2VL6 A;  2R93 B;  3W3A A;  4JOI C;  3CMA A;  3HOV B;  4A3J B;  3A5Z B;  3GTG H;  1H9K A;  2EY5 A;  2E75 C;  1VQH A;  1H9R A;  1XMO Q;  2UU9 L;  5LL6 X;  4NB3 A;  1N33 Q;  5IGC A;  3CP0 A;  3K5L A;  5C4X B;  2UUC Q;  3OMC A;  2R7Z G;  2CVR A;  3EIV A;  3GTK H;  3O13 A;  1HQM C;  2G9D A;  2X6G A;  4KHV A;  4DV7 Q;  2F0G A;  3QO2 A;  2XN9 C;  4ZRZ A;  2B2T C;  1I4P A;  2Z4H A;  3MC0 B;  3DLL A;  1KLU D;  1FD7 D;  2N49 A;  1EFW A;  1CKO A;  3KUP A;  1X65 A;  2GN5 A;  1X6O A;  1WJJ A;  1HUM A;  4H02 A;  4JBW A;  1Q46 A;  2NVY B;  3J7A 5;  3R2T A;  4KD4 A;  3D4R A;  2I5L X;  2RHQ B;  2QCP X;  4AYB E;  2ICE C;  1S5B D;  2R7D A;  4NW2 A;  2JE6 I;  5KRU A;  3SVM A;  4LF4 L;  2NVT B;  4R4O A;  4ULL A;  4O42 A;  3S1M H;  3TBI B;  1CZG A;  1PV4 A;  5FLM H;  1EY0 A;  2VQE Q;  5C5L A;  4GN5 A;  1SSO A;  3NP8 A;  3SHL A;  3CC7 A;  4A3B G;  1JIC A;  1STH A;  4XQN A;  1G2T A;  1SEB D;  5JOB A;  4LUV A;  2C9O A;  1LM0 A;  2HQL A;  1YNJ C;  4HJ9 A;  4A3I H;  4DAY A;  2BA1 A;  2Q2T A;  1SYC A;  1NNX A;  4DR6 Q;  3L3O C;  4LF7 L;  1I94 L;  2JA7 B;  4BBR G;  4IFD G;  2MPM A;  3S1N H;  4DV1 Q;  4A93 H;  2VB2 X;  2L9H A;  5CV6 A;  3NEL A;  2RKS A;  1O7Y A;  1K8A C;  3L0O A;  4JI6 L;  2KVM A;  5JPM C;  3QWN A;  4C3I H;  2GVA A;  1NCV A;  1PZJ D;  4GLX A;  3HOV G;  2OCE A;  1PFS A;  1C48 A;  1RTO A;  3GDE A;  4LK1 C;  5C3W A;  5J22 A;  4GNX C;  1I50 B;  3KFU A;  1HR0 W;  2WB1 B;  4AH6 A;  2D0P A;  2DGY A;  1YJ9 A;  1K83 H;  3I4M H;  4A3C H;  5C4X G;  1TWH B;  1SDF A;  2R7F A;  1MJE A;  3RZD H;  2M2L A;  2NTS A;  4DR7 L;  2E2J H;  3PIP A;  1GHK A;  4L8J A;  4IUP A;  4KKT A;  4TQU S;  2FFK B;  4B3S L;  1D1K A;  1PA6 A;  1SNO A;  4OIJ A;  4Y7N H;  1T9H A;  3EFX D;  1AW7 A;  4YHH Q;  3F2B A;  2F0L A;  2LKV A;  3PSI A;  1BUV T;  3WOF A;  1DM0 B;  3ZYY X;  1I4R A;  2EQS A;  3GTM H;  1A2U A;  1B44 D;  1II3 A;  5I9O A;  5M5W H;  1HTL D;  3TP6 A;  5C6A A;  1IW7 D;  1BBU A;  3QB3 A;  1WYD A;  2UU9 Q;  4TRD A;  1SE4 A;  1A3T A;  1YNX A;  1VQ8 A;  5E1F A;  4A3F G;  4V19 0;  3BS1 A;  4DR3 Q;  2BCO A;  2ZJR A;  1SLJ A;  2JA8 G;  3NEN A;  4BY7 B;  2IX3 A;  4KY7 A;  4LW1 A;  2NVX B;  1F2L A;  2IX0 A;  4PQX A;  1F2M A;  1BXT A;  4JI2 L;  4NMZ A;  3TQY A;  2CQA A;  4RGO S;  3Q22 A;  1X55 A;  1VF7 A;  1Z47 A;  3T56 B;  2Z8L A;  1NR4 A;  5LMU Q;  1QZH A;  3BDC A;  3SEB A;  1KTK A;  3GQB A;  1DZ1 A;  1HZA A;  2Z4I A;  2FMM A;  3X3M A;  2EYL A;  1VMC A;  3UDG A;  2YTX A;  2XNA C;  4EX5 A;  2F03 A;  1TWC H;  1ZYR D;  1AFP A;  2F3I A;  2ZTE A;  1BBW A;  4XXE A;  1VS0 A;  1PH3 A;  4JI0 Q;  1M8A A;  2B39 A;  3GTO H;  1QVF A;  4LMQ D;  4YY3 L;  4JI5 Q;  4A3K G;  1CHQ D;  5KGU A;  5M3F G;  1QZG A;  2NVQ B;  2PMZ E;  3L9A X;  3MTS A;  2UUB L;  2F0T A;  4F87 A;  3FKI B;  5ELN A;  4DXF A;  2R7Z H;  1H95 A;  1I6H B;  3PO2 B;  3K80 C;  3OIP A;  4LF7 Q;  3SGI A;  1WTW A;  1XTD A;  3GV3 A;  4L5Q A;  4IQZ A;  3CCS A;  1H9M A;  4MNO A;  2NB0 A;  1TKW B;  2F0P A;  2PI2 A;  1EYG A;  5C3E B;  2NTT A;  1RJT A;  4DKA C;  3UI2 A;  3QR8 A;  5FLX c;  5DEH A;  1HH2 P;  3KBG A;  2E5L L;  4EVO A;  3I56 A;  3NBH B;  2PNR C;  3H3V I;  3K58 A;  4M8A A;  4X64 L;  1WTR A;  1QVC A;  1GJX A;  4QQB X;  2ZTC A;  1PH4 A;  2VUM B;  4DR7 Q;  1LO5 D;  2RCN A;  4PZ8 A;  3HS0 C;  5EAY A;  1D2B A;  3OTO L;  4MHE A;  4DF7 A;  4QIW E;  4B3S Q;  5H1S E;  1UNS A;  4A3B H;  4ZLT F;  2HHH Q;  3GTQ B;  1UEA B;  1L0W A;  5A2Q E;  1SFO H;  3FEW X;  2XSC A;  4LFA L;  3N6R A;  1XX8 A;  5IWA Q;  4EQN A;  3HOU G;  3JC6 6;  3NHH A;  3D8G A;  3GTJ H;  3VA5 A;  4B9W A;  4BBR H;  4IFD H;  4B3M L;  2OXP A;  3IFT A;  1IW7 C;  4FF3 A;  2K5N A;  2R61 A;  1HA5 A;  2K5H A;  2OTL A;  2ZJP A;  2UXC Q;  4R4Q A;  3RNU A;  2VB3 X;  3RD4 A;  3TEH B;  4ZKC B;  2DY7 A;  4HCE A;  4CDC C;  4DV4 Q;  3HOV H;  4P71 A;  1O80 A;  4AIM A;  1PH6 A;  3ULP A;  2V4D A;  4UHV A;  3OIQ A;  2X69 A;  2A74 C;  2B2W C;  1GD7 A;  3UE1 A;  1Z7T A;  2AQ3 B;  5C4X H;  2SNS A;  4POF A;  2KHI A;  3H0G B;  3PO2 G;  1V9P A;  1Y8O B;  4K0K L;  3U9O A;  3GTG B;  1WTV A;  1F2Z A;  4M1U B;  1HNZ L;  4GLA C;  2F3W A;  2MO0 A;  2Z6K C;  3J7Y W;  3IRB A;  2QKI C;  1X3E A;  1KDA A;  1GO3 E;  4N8F A;  3MXN A;  3NBH A;  5M9O A;  3D0F A;  5IYD G;  4B3T Q;  1SND A;  5C3E G;  5KYI A;  1PH7 A;  1KIX A;  1IBK L;  4Q0F A;  1VQ7 A;  3CCJ A;  1VQ9 A;  1VCI A;  2PCF B;  1ZYR C;  4J1M A;  3VR2 A;  3OPO A;  4QMG A;  5I9P A;  2NVY H;  4ALP A;  2F0S A;  3I90 A;  5E3F A;  1W6J A;  2XTI A;  1F9R A;  4GKK Q;  5KNB A;  1G91 A;  2KEC A;  4DV6 L;  4YY3 Q;  1PLF A;  1E7Z A;  4DR4 L;  2VUM G;  4A3F H;  4POG A;  2F3V A;  1Y14 B;  1FYC A;  4LUO A;  4CJ2 C;  1E2W A;  4A3D G;  1J6Q A;  1VQ4 A;  1W3S A;  3W5O A;  1KDB A;  3RN2 A;  2DNC A;  3HGB A;  2LSS A;  3K7U C;  3W1B A;  4H7B A;  1CK1 A;  4DV2 Q;  2EY2 A;  4IUU A;  1LT6 D;  1F9Q A;  1PXU A;  2HCC A;  4JI4 L;  3BU2 A;  3S2H H;  4K14 A;  4IO9 A;  4A3G G;  4JW0 A;  5DLQ E;  3DEO A;  1LV9 A;  2IHE A;  4X64 Q;  2AQ2 B;  2IY5 B;  4HAE A;  4A3I B;  2JJQ A;  4DR5 Q;  5D3I B;  1K9M C;  4WJW A;  3S14 H;  2RDF A;  3T1Y Q;  1QIL A;  4P73 A;  4DV3 L;  5AJ3 Q;  2BH2 A;  2K05 A;  1I50 H;  3S1N B;  4CDF C;  4A93 B;  1GKH A;  4KLK A;  3NUC A;  1LUZ A;  1KAA A;  4JI7 Q;  1EEI D;  4A3K H;  4C3I B;  3H0G G;  4RMF A;  4X6A H;  3HOY G;  3U4Z A;  4X62 Q;  1ESF A;  1SYD A;  4LFA Q;  3T51 B;  1EYA A;  1K83 B;  1I3Q B;  1HZB A;  1ENF A;  1LTS D;  4EQO A;  3KK7 A;  1HHV A;  3M85 A;  4RH6 A;  3E9H A;  2E2J B;  1EQQ A;  1YHQ A;  1K8M A;  5AFW A;  1FNW A;  2OQ0 A;  2F4I A;  1C7Y A;  4Y7N B;  4C1N K;  4LFC L;  4LF6 L;  1N32 L;  2YTV A;  1J9O A;  2F4V Q;  1CT1 D;  4WFN 3;  4OWW B;  4LF8 Q;  5BR8 Q;  1L1O B;  3QOJ A;  4K6D A;  3GTM B;  2WAQ B;  3BDO A;  1STN A;  3MEF A;  3Q6S A;  1SMX A;  1PDQ A;  1EIG A;  5M5W B;  2L55 A;  4IPC A;  4FF4 A;  3BVZ A;  4UP9 A;  1C9O A;  1PH2 A;  4IN3 A;  4F7X A;  3FDT A;  2KQ3 A;  2IX1 A;  2JEA I;  3BVG A;  2B2Y C;  2UXB Q;  2B63 G;  1E1O A;  1DD2 A;  4NP5 A;  5C4J B;  2A19 A;  4IUV A;  3DEP A;  1F77 A;  2HDL A;  4TKO B;  1IBK Q;  3I8Z A;  1BNZ A;  4RWS C;  3BG3 A;  3HOU H;  1S72 A;  4KY5 A;  4DGZ A;  1O78 A;  3S17 B;  3UE0 A;  1JJ2 A;  3NPP A;  3Q24 A;  4KHZ A;  4DV6 Q;  5IE8 A;  4JI1 Q;  2AUJ D;  1YBY A;  3CCU A;  1U9R A;  1PH1 A;  1A15 A;  4MN3 A;  3OW2 A;  2B2U C;  1PFN A;  1K73 C;  4DR1 Q;  1A8V A;  1RTN A;  1SE2 A;  1K3R A;  4QY7 A;  1XPU A;  2K75 A;  3P20 A;  5IOC A;  1BCP D;  4OO1 G;  1TWC B;  2K01 A;  1HCZ A;  3VR3 A;  1X3Q A;  3PO2 H;  1XNQ L;  2L12 A;  4JI8 L;  3GTO B;  1HTP A;  4DUZ L;  3MEH A;  2XGT A;  2OEO A;  4RKL A;  4BA2 I;  4RGT A;  5IYD H;  5C3E H;  4JI4 Q;  2R7Z B;  4JPB W;  2K5W A;  2E2I B;  3I4N B;  3OW7 A;  1EL0 A;  3H09 A;  5D14 A;  1EIF A;  2HD3 A;  4PV1 C;  1R9T H;  1IKL A;  2Y0S G;  1WFQ A;  5J1Z A;  3I7F A;  2TMP A;  1I4X A;  3J81 c;  3AQQ A;  3DUZ A;  1B1Z A;  2I5M X;  4DAM A;  1SYG A;  2VUM H;  1SJH D;  3HKZ B;  3I4O A;  2ZM6 Q;  4E6I A;  1NE3 A;  1D6E C;  5CMD A;  1JOK A;  4BXX G;  2WKD A;  3OSO A;  4DFA A;  1EUJ A;  3S15 B;  5EJW A;  2D5D A;  2OWO A;  4RAU C;  4A3D H;  2E2H B;  2GVB A;  5CV8 A;  4BS9 A;  5IGB A;  2PW5 A;  5EBD A;  1NTG A;  1D7Q A;  3I91 A;  3CRL C;  2VZA A;  3KJP A;  4OL7 A;  5IIF A;  1HFG A;  2WB1 E;  3VR5 A;  4A3M G;  5C0X G;  1F9P A;  3NWT A;  3AYH B;  5K5P A;  1L0X B;  4TVA B;  1B2T A;  3L2P A;  1N32 Q;  4K5W A;  4DK1 A;  5IY0 A;  1SFO B;  4A3G H;  4JI3 Q;  2AUK A;  5GAH C;  2KHS A;  3PUZ A;  2OQK A;  1K28 A;  4CHT B;  1PRT B;  1EZ8 A;  2F0K A;  4F8M A;  4XQQ A;  4BBR B;  2BA0 A;  1IKM A;  2JK8 A;  1MD2 D;  1AE2 A;  1H9S B;  2QW7 A;  5BN3 A;  3OMG A;  2Q8R E;  3H0G H;  3ER0 A;  4XT1 B;  3HOY H;  5JEA G;  1VQP A;  2PI2 E;  3KDF B;  3PV0 A;  4AQY Q;  1VQG A;  4FNF A;  4GKJ Q;  1U0L A;  3HRZ C;  3ONA B;  1XJV A;  1D5Z C;  1YHA A;  2N55 A;  4OX9 L;  2WP8 J;  3I4N G;  1O7I A;  3EBE A;  5LMN Q;  2JSO A;  2EYJ A;  3JAM i;  2JA6 G;  2F0D A;  3R8B A;  2A1A A;  1HZ9 A;  5LHY 1;  2UXD L;  5GRO A;  2CW0 D;  2KCN A;  2QDB A;  3EVQ A;  4HMI A;  1BCP C;  1D1I A;  2EYH A;  2WKC A;  3HKZ G;  4OON A;  3C1E A;  1WCM G;  5FJ8 G;  2K6A A;  5ISR A;  5EKK A;  2QEJ C;  4HJ5 A;  3R2I A;  2F0Q A;  1EOT A;  3ULL A;  3OWF A;  2KJX A;  3VYU A;  4DUZ Q;  3J80 i;  1K8O A;  2FHT A;  1IYV A;  1W6K A;  2B63 H;  4DR2 L;  3QOL A;  1NBW A;  4A3F B;  2WIN B;  2O2L D;  1EWI A;  1DOM A;  2O5I C;  4KHP L;  2A5H A;  2JA8 B;  1BF4 A;  2FJ2 A;  4DNI A;  1S5C D;  4NXN L;  3J81 i;  2G9H D;  1N9W A;  1LT5 D;  5DNF A;  1GUO A;  2RDG A;  1H9S A;  3PMF A;  4JYA L;  4J15 A;  4IPH A;  3J81 j;  1RDP D;  3PUW A;  3KBX A;  4UP8 A;  5DM6 3;  1MI2 A;  4K2K A;  1SJE D;  1Q1E A;  3VA7 A;  5I6W A;  3S2H B;  1HQR D;  3G48 A;  3KDF A;  1VQN A;  5CV7 A;  3S14 B;  1LTT D;  4N9T A;  1YJN A;  4U68 A;  4LFB Q;  4OO1 H;  5CBE E;  3NBI A;  3M9B A;  1VQB A;  1XTC D;  3M4Q A;  2EJF C;  5FK9 C;  1I3Q H;  3M7G A;  3BDL A;  4C56 C;  4HCS A;  1L1O C;  4A3K B;  5D3D A;  5M3F B;  4A76 A;  1STB A;  1U4L A;  1JCK B;  3NQI A;  3CCR A;  1PRT D;  3CXC A;  1M1K C;  1K3B C;  2LY7 A;  4C2M H;  3CPW A;  1GUT A;  2B2W A;  4OWX B;  1XPR A;  4FVM A;  1CSP A;  2AHO B;  3CCV A;  2KCC A;  3A55 A;  1ASY A;  1ONL A;  4UP7 A;  4ZK9 B;  1XNR L;  1STY A;  2Z6K A;  4HR7 B;  5JPN C;  2K50 A;  1RKN A;  5GAE C;  1BDO A;  3GTP H;  1A6X A;  3I55 A;  2FIN B;  1HA6 A;  5G3L D;  2F0N A;  4IUR A; 
#chains in the Genus database with same CATH homology
 2ID0 A;  4DAP A;  1AEX A;  2I07 B;  1BCP F;  4HED A;  4XTC S;  1OXU A;  1NUC A;  4R9W A;  4OGQ C;  1I4G A;  4DNR B;  1U4R A;  1WTP A;  5C0X H;  4ZUJ A;  2CW0 C;  1AZP A;  3CU7 A;  3MWY W;  3LWU A;  5F2D A;  4L63 B;  5IT9 L;  1JOO A;  5K36 G;  2M9V A;  1LTA D;  3HOU B;  1V1O A;  2LMC B;  1NSN S;  4FXD A;  2F0U A;  5E4W C;  5ELB A;  1XYI A;  1EIH A;  2O4X A;  1SNP A;  1SYF A;  2F0I A;  2M00 A;  1A3V A;  2ZT9 C;  1JWS D;  2AWO A;  5JEA H;  4J6H A;  5JVG 3;  1A2T A;  3IKJ A;  1SBB B;  1QB5 D;  4JK1 C;  5ELF A;  4AYB B;  2PZT A;  1G6Z A;  4K5V A;  2J4X A;  3SK4 A;  4XIG S;  2KEE A;  1RF2 D;  1SYB A;  2IPK D;  3T53 B;  2K7V A;  1QJO A;  2JYO A;  3VR4 A;  4DXG A;  4ZQ3 A;  1ZKO A;  4J8Q A;  1TU2 B;  1OXX K;  2I46 A;  1R9T B;  3K6O A;  3NSW A;  1M4V A;  5KIX A;  2IL8 A;  3GD7 A;  4BWG B;  5J39 A;  4HTH A;  5NUC A;  4G7O C;  1NAP A;  3V96 A;  4ABN A;  1PRT C;  2A69 D;  4G7Z C;  1CQV A;  2XRQ D;  4DAV A;  2PQE A;  1OXT A;  4XT3 B;  3AMU A;  1D5X C;  3BZD B;  2ENB A;  4A3D B;  3TZU A;  2D62 A;  2DNE A;  3CHB D;  1Y69 U;  1PTO D;  2R6G A;  4P2C B;  2K32 A;  2B2Y A;  2EXZ A;  1BOS A;  1DXM A;  1SMY D;  3KF8 A;  3PUV A;  1ML0 D;  4RGM A;  2OT2 A;  4A3G B;  4K5X A;  4EQP A;  4EGV A;  3MFG A;  1PZK D;  1ZEQ X;  3E6Z X;  2JP1 A;  1SE3 A;  4CKE A;  4GZY C;  3R93 A;  1JR0 D;  4RHS A;  3TP5 A;  2B2U A;  1WTQ A;  1B4O A;  1T5E A;  1FR3 A;  1PMR A;  3ERQ A;  3HOY B;  2EYO A;  4RGN A;  4IUT A;  4Z9C B;  3JAM L;  1STG A;  3URY A;  4KKU A;  5KEE A;  4KJN A;  3C1F A;  2E2D C;  4HSV A;  1CA6 A;  3PUY A;  5D65 A;  3KLS A;  3RLF A;  1ICW A;  3J80 L;  2RSO A;  4WOR A;  2JXM B;  5EPK A;  1Y8N B;  1EYD A;  4DA2 A;  3P1H A;  4KKS A;  3FMC A;  1BR9 A;  2B63 B;  1PRT F;  4FYD A;  5K36 H;  3J81 L;  1BCP B;  4BA1 I;  3HP3 A;  3A7L A;  4X3T A;  5CGK A;  2SDF A;  1CTM A;  4CGY B;  2A69 C;  4NDX A;  3MXU A;  5G3L F;  4UDU C;  1ZXT A;  1HRJ A;  2L5T A;  5EQ0 A;  3DMU A;  2NUC A;  1ENC A;  2IW3 A;  2PPB C;  5JVH 3;  2NN6 I;  4XYQ A;  1I4H A;  2C5C A;  1PTO C;  2YYZ A;  1ET9 A;  3I73 A;  3T13 A;  3NQT A;  2K5D A;  3SK6 A;  3HG9 A;  3LX0 A;  4C2M B;  2DN8 A;  2H4O A;  3M4O B;  1F2Y A;  2RQX A;  1PTO H;  2KOL A;  1JB3 A;  2QIL A;  2EDG A;  1EY5 A;  2EJM A;  2Y0S B;  3MFY A;  2MHV A;  1WD1 A;  1X3P A;  3G6J B;  2K5Q A;  1Q3L A;  3GTP B;  1TWG B;  2EYF A;  3KLS X;  3OWE B;  1GUN A;  2EY6 A;  5I4D A;  1EZ6 A;  3LWE A;  2L4N A;  4KY6 A;  2N88 A;  1O7Z A;  2JEB I;  1AZQ A;  2J7Z A;  4FP5 D;  4A3M B;  2EE1 A;  3NWS A;  5BN4 A;  3MZ5 A;  3GTL B;  1FNU A;  3A8K E;  1KAB A;  1ROD A;  1GXD C;  4DNT B;  3DWQ A;  2TSS A;  3C2P A;  3CRK C;  4IZ8 A;  3NTI A;  1DOK A;  5IT9 E;  4KN7 C;  2L1B A;  4X3S A;  1E2Z A;  1FGB D;  1STE A;  1WTX A;  1MSH A;  1EYC A;  3DM1 A;  3D4W A;  1EU4 A;  1CM9 A;  3NXW A;  3KLR A;  3NE5 B;  3T16 A;  2XWJ B;  3AB9 A;  2X6L A;  1PTO F;  4G4K A;  3FVQ A;  2K1B A;  2JA6 B;  1I4Q A;  2B2V C;  3PIP 3;  2BOS A;  2MP1 A;  5E4X A;  3DXJ C;  3FPP A;  1YNN D;  3CKI B;  1EY9 A;  4U67 3;  1LLR D;  3SK5 A;  1PFM A;  2NYZ D;  1WCM B;  4K6L A;  2YU9 B;  1QWY A;  5IGF A;  4C1N I;  2F0J A;  1BBX C;  1LTR D;  4G7H C;  3M3Y B;  5DAU A;  3MXG A;  1EQV A;  1GUW A;  2F0F A;  1GUG A;  2A68 D;  2PYK A;  1JOQ A;  2K03 A;  4RA8 A;  1O7L A;  5C0X J;  2D9U A;  2F1M A;  4RHR A;  2SOB A;  4C3H B;  3N52 A;  4K8J A;  3BVM A;  5I6Y A;  2KED A;  1ILQ A;  3K57 A;  1JWU D;  5EKL A;  1TS3 A;  1V43 A;  5CYU A;  2H1E A;  5CV5 A;  1JC7 A;  1TII D;  1HFN A;  2EVB A;  1CHP D;  1B9N A;  1TS2 A;  3C3L A;  3A54 A;  3H94 A;  5C0X I;  2ZXP A;  1KLG D;  1TS5 A;  4B9X A;  1U4P A;  1CFM A;  2B8F A;  4ZAI A;  3K5N A;  1QE6 A;  1TT2 A;  3K59 A;  1R4Q B;  5CV4 A;  3JAM E;  3WOE A;  1OXS C;  1G2S A;  5C5M A;  5FO9 B;  4KV6 A;  1MSG A;  5TSS A;  3W2D A;  3NK9 A;  4DK0 A;  1JWM D;  5JJZ A;  2E74 C;  2A73 B;  2J0T D;  2PO4 A;  3U9S A;  2BE5 D;  3IL8 A;  3HOX B;  2Z1C A;  5FLX L;  5I2Y A;  3MAQ A;  3J80 E;  2XVS A;  5EKI A;  4C3H G;  4Q5V A;  5M3M B;  1JOR A;  3SR1 A;  4CKC A;  1YNN C;  1KDC A;  3S16 B;  4IFD J;  4ZKB B;  4CJ0 B;  4ILW A;  3HOW B;  2GA4 B;  3J81 E;  1DOL A;  4PMC A;  3E0J A;  1ET6 A;  1LTG D;  1Q12 A;  4ODG A;  3TDQ A;  5T1G A;  1UAP A;  5T1I A;  3RUZ A;  1EY4 A;  2QF7 A;  1EWC A;  4QUF A;  2A68 C;  1TWA B;  2NWG A;  1VDZ A;  3MXP A;  2XIW A;  1S4Z A;  3VYS A;  3DWP A;  3PIO 3;  4S3S A;  2K33 A;  4XQJ A;  2EYP A;  1RHP A;  2RBM A;  2JA5 B;  1WVL A;  1Y1W B;  1ILP A;  1LAB A;  3F2U A;  3D3R A;  4IFD I;  1Z6H A;  2ICI A;  3PO3 B;  3K5O A;  4FO2 A;  3I70 A;  1PTO B;  3ND9 A;  4B08 A;  4HSP A;  3QG1 A;  1FNV A;  1X32 A;  4K8I A;  3M7N A;  1MGS A;  2LFN A;  1SNM A;  1T5X D;  4X3K A;  1PFB A;  2WV6 D;  3ERO A;  3HZX A;  2KA7 A;  2Q8T A;  1TWF B;  2EYM A;  4RCN A;  2SNM A;  5CR3 A;  4MIU A;  4PNY A;  2F0W A;  3PUX A;  3BYY B;  4KI0 A;  4RCO A;  1TVX A;  1MBY A;  4XDX A;  1Y1V B;  1GUS A;  1EY8 A;  3C46 A;  1SNC A;  1EWH A;  1LAC A;  2EY1 A;  2ZXR A;  1VMP A;  4I65 A;  2BE5 C;  5EGT A;  2MUY A;  3CQZ B;  2B8G A;  3IFD A;  1J8I A;  5KYL A;  1S5F D;  2Q8I B;  1EU3 A;  5FO8 B;  4IUQ A;  4LJZ C;  2AWN A;  1KNE A;  1TS4 A;  1B53 A;  1IHZ A;  3DWA A;  3V2T A;  3FRP B;  2F0H A;  3S1R B;  2IT1 A;  5CBA E;  4NKL A;  1C8C A;  1H9J A;  1DYQ A;  1VF5 C;  5ELE A;  2BDO A;  3H6M A;  1EY7 A;  1SXT A;  3T4A C;  4QF4 A;  5HUR A;  4O1N A;  1SYE A;  4BBS B;  2EPB A;  4IUN A;  2EZV A;  3GP7 A;  1DON A;  5C4H A;  1CZW A;  3L7Z C;  4ZUI A;  2WAC A;  1JE4 A;  4CKB A;  1WTO A;  3X3N A;  1Q1B A;  5M5X B;  3WDN A;  2EOT A;  3ITP A;  3TP7 A;  4G57 A;  1STA A;  1HUN A;  4C3J B;  3NTK A;  1AP0 A;  1TQO A;  5M5Y B;  2A6H D;  4ME5 A;  1C4Q A;  3SXH A;  2D2C C;  5BN5 A;  1V8Q A;  1RCV D;  1RD9 D;  4L6T B;  2MJ8 A;  4KJO A;  3K7A B;  1XWE A;  1AN8 A;  4KN4 C;  4YIJ A;  1QNK A;  2O5J C;  1QOH A;  3GV6 A;  1DCZ A;  1ENA A;  1F9S A;  3J7A V;  2R3Z A;  3D4D A;  2NBF A;  1WD0 A;  1R4P B;  4XYO A;  2MGS A;  1EFI D;  3D6C A;  2CHB D;  1OO9 B;  3QJY A;  4RKB A;  4KMU C;  2AQ1 B;  3SDZ A;  1LT3 D;  2K28 A;  1TR5 A;  4RFB A;  5DM7 3;  3I72 A;  1NR2 A;  5FKA C;  2VNU D;  1U4M A;  5JAV A;  2A6E D;  2SEB D;  2KUM A;  4ID6 A;  4V0B A;  1E0B A;  2B2V A;  3GTK B;  1PYW D;  2F0O A;  5FOB B;  3OOC A;  1LTB D;  4QCL A;  4PMW A;  2XWB B;  4C3J G;  2F0E A;  2PMZ B;  1QNU A;  3M4Y A;  4R8N A;  4TSS A;  2ZXO A;  5I2X A;  5HGT A;  2K04 A;  3QIA A;  4I7Z C;  2NN6 G;  3S2D B;  1TY2 A;  3D31 A;  3VR6 A;  2XRS D;  3MVV A;  2IWH A;  3H3V C;  1S5D D;  3SK8 A;  1EEF D;  3RZO B;  4UAI A;  5FLX E;  4FXK C;  3VYT A;  1EQT A;  4OHJ A;  3S1M B;  4HN7 A;  3R3O A;  2RVL A;  3MHB A;  5IOD A;  3S1Q B;  2F0V A;  1UUP A;  2BDN A;  3NTH A;  4R8I A;  2R92 B;  1G29 1;  4FF1 A;  2WII B;  3TME A;  3I4L A;  3TSS A;  4DN4 M;  2A6H C;  1SMY C;  2DY8 A;  1SNQ A;  4A3E B;  4QIW B;  3SE0 A;  2HDM A;  4CBV A;  2HQE A;  2PZU A;  4ZYS A;  1A3U A;  4K2L A;  3HEJ A;  1CA5 A;  4H44 C;  3LNN A;  3Q0A A;  3D6W A;  2HCI A;  5EPJ A;  3I4M B;  1GHJ A;  1LTI D;  3RZD B;  1BQQ T;  2RA4 A;  2EJG C;  3FPU B;  4PMB A;  3MA2 B;  4FF2 A;  5C4Z A;  2VXW A;  5ELC A;  5KNC A;  3E5S A;  2L0C A;  2B2T A;  5EBC A;  1Q8I A;  5IGE A;  1D5M C;  3VYR A;  5C44 B;  2A6E C;  1HPC A;  3EA6 A;  3EQL C;  3I3C A;  3Q23 A;  4KD3 A;  3K5M A;  3P7J A;  3AU7 A;  4LAA A;  1SAP A;  3TN2 A;  3S9W A;  1PZI D;  4F88 A;  5IGG A;  2LS0 1;  1OXV A;  3RMH A;  3TZD A;  4N9P A;  1JQY D;  3IAY A;  3ND8 A;  2HUG A;  4FXG C;  1ESR A;  1QCB D;  4OIK A;  4X3U A;  1XXG A;  4DU9 A;  1GOZ A;  1V1P B;  1CI3 M;  3OHX C;  3G7L A;  4WRD A;  4C3I G;  1Q90 A;  5A35 A;  2L11 A;  2FMC A;  4H0L C;  5COR A;  5CV9 A;  2IJ0 A;  1B9M A;  1BO0 A;  4QB4 A;  4BY1 B;  2PW7 A;  1EY6 A;  1B3A A;  1HXY D;  3P75 A;  3HOZ B;  4KK7 A;  2OF1 A;  1CQF A;  1E2V A;  2F0M A;  1IL8 A;  5KND A;  5EPL A;  1IYU A;  2RSN A;  4OO1 I;  3H91 A;  5LL6 S;  1YNJ D;  3GO5 A;  4QUC A;  3BYT B;  5FO7 B;  3K0Y A;  1DJR D;  2NN6 H;  3J7A F;  1B50 A;  5A2Q L;  3EJI A;  2RDH A;  1TY0 A;  3DHQ A;  2NZ1 D;  1Y8P B;  2E76 C;  4KTA A;  3A8I E;  4CJ1 B;  4H13 C;  2PZW A;  1S5E D;  3A8J E;  4IAL A;  4HMJ A;  4A3B B;  1G8Z D;  5ELD A;  5IGD A;  1QG7 A;  3A56 A;  5C3X A;  1KNA A;  5CC4 A;  3TP8 A;  1L0Y B;  1V1P A;  5JEA J;  3GTJ B;  1LT4 D;  1I6V C;  5COY A;  3A7A B;  3V05 A;  2R93 B;  3W3A A;  3HOV B;  4A3J B;  1H9K A;  2EY5 A;  2E75 C;  1H9R A;  5LL6 X;  5IGC A;  3K5L A;  5C4X B;  3OMC A;  2CVR A;  3O13 A;  1HQM C;  2G9D A;  2X6G A;  4KHV A;  2F0G A;  3QO2 A;  2XN9 C;  4ZRZ A;  2B2T C;  1I4P A;  2Z4H A;  3MC0 B;  1KLU D;  1FD7 D;  3KUP A;  1HUM A;  4JBW A;  2NVY B;  3R2T A;  4KD4 A;  3D4R A;  2QCP X;  2ICE C;  1S5B D;  4NW2 A;  2JE6 I;  5KRU A;  3SVM A;  2NVT B;  4ULL A;  4O42 A;  3TBI B;  1CZG A;  1EY0 A;  5C5L A;  1SSO A;  3NP8 A;  3SHL A;  1JIC A;  1STH A;  4XQN A;  1G2T A;  1SEB D;  5JOB A;  2C9O A;  1YNJ C;  4DAY A;  2BA1 A;  1SYC A;  3L3O C;  2JA7 B;  4IFD G;  2MPM A;  2VB2 X;  2L9H A;  5CV6 A;  2RKS A;  1O7Y A;  2KVM A;  5JPM C;  3QWN A;  1NCV A;  1PZJ D;  1C48 A;  1RTO A;  5C3W A;  4LK1 C;  5J22 A;  1I50 B;  2WB1 B;  1TWH B;  1SDF A;  2M2L A;  2NTS A;  1GHK A;  4L8J A;  4IUP A;  4KKT A;  4TQU S;  2FFK B;  1D1K A;  1SNO A;  4OIJ A;  3EFX D;  1AW7 A;  2F0L A;  2LKV A;  1BUV T;  3WOF A;  1DM0 B;  3ZYY X;  1I4R A;  1A2U A;  1B44 D;  1II3 A;  5I9O A;  1HTL D;  3TP6 A;  5C6A A;  1IW7 D;  3QB3 A;  4TRD A;  1SE4 A;  1A3T A;  5E1F A;  4V19 0;  3BS1 A;  2BCO A;  4BY7 B;  2IX3 A;  4KY7 A;  2NVX B;  1F2L A;  2IX0 A;  4PQX A;  1F2M A;  1BXT A;  4NMZ A;  2CQA A;  4RGO S;  3Q22 A;  1Z47 A;  1VF7 A;  3T56 B;  2Z8L A;  1NR4 A;  3BDC A;  3SEB A;  1KTK A;  3GQB A;  1DZ1 A;  2Z4I A;  2FMM A;  3X3M A;  2EYL A;  1VMC A;  2XNA C;  2F03 A;  1ZYR D;  1AFP A;  4XXE A;  1M8A A;  2B39 A;  4LMQ D;  1CHQ D;  5KGU A;  2NVQ B;  3L9A X;  3MTS A;  4F87 A;  2F0T A;  3FKI B;  4DXF A;  1I6H B;  3PO2 B;  3OIP A;  1WTW A;  3GV3 A;  4IQZ A;  1H9M A;  2NB0 A;  1TKW B;  2F0P A;  5C3E B;  2NTT A;  1RJT A;  3UI2 A;  5DEH A;  3KBG A;  4EVO A;  2PNR C;  3K58 A;  4M8A A;  1WTR A;  1GJX A;  2VUM B;  1LO5 D;  3HS0 C;  1D2B A;  4MHE A;  4DF7 A;  1UNS A;  4ZLT F;  3GTQ B;  1UEA B;  5A2Q E;  3FEW X;  2XSC A;  3N6R A;  1XX8 A;  4EQN A;  3NHH A;  3D8G A;  3VA5 A;  4B9W A;  4IFD H;  2OXP A;  3IFT A;  1IW7 C;  4FF3 A;  2R61 A;  1HA5 A;  2VB3 X;  3RD4 A;  4ZKC B;  2DY7 A;  4HCE A;  1O80 A;  2V4D A;  3OIQ A;  2X69 A;  2A74 C;  2B2W C;  1Z7T A;  2AQ3 B;  2SNS A;  3H0G B;  1Y8O B;  3U9O A;  3GTG B;  1WTV A;  1F2Z A;  4M1U B;  2F3W A;  3J7Y W;  2QKI C;  1KDA A;  3MXN A;  3NBH A;  5M9O A;  1SND A;  5KYI A;  4Q0F A;  1VCI A;  2PCF B;  1ZYR C;  4J1M A;  3VR2 A;  3OPO A;  4QMG A;  5I9P A;  2F0S A;  3I90 A;  5E3F A;  1W6J A;  1F9R A;  5KNB A;  1G91 A;  2KEC A;  1PLF A;  2F3V A;  1FYC A;  4CJ2 C;  1E2W A;  1KDB A;  2DNC A;  3HGB A;  4H7B A;  1CK1 A;  2EY2 A;  4IUU A;  1LT6 D;  1F9Q A;  1PXU A;  2HCC A;  4K14 A;  3DEO A;  1LV9 A;  2AQ2 B;  4HAE A;  4A3I B;  5D3I B;  4WJW A;  2RDF A;  1QIL A;  2K05 A;  3S1N B;  4A93 B;  3NUC A;  1KAA A;  1EEI D;  4C3I B;  1ESF A;  1SYD A;  3T51 B;  1EYA A;  1K83 B;  1I3Q B;  1ENF A;  1LTS D;  4EQO A;  3KK7 A;  1HHV A;  3M85 A;  4RH6 A;  2E2J B;  1K8M A;  5AFW A;  1FNW A;  2F4I A;  4Y7N B;  4C1N K;  1J9O A;  1CT1 D;  4WFN 3;  3QOJ A;  4K6D A;  3GTM B;  2WAQ B;  3BDO A;  1STN A;  3Q6S A;  1PDQ A;  1EIG A;  5M5W B;  2L55 A;  4FF4 A;  3BVZ A;  4IN3 A;  4F7X A;  3FDT A;  2KQ3 A;  2IX1 A;  2JEA I;  3BVG A;  2B2Y C;  1DD2 A;  4NP5 A;  5C4J B;  4IUV A;  3DEP A;  1F77 A;  2HDL A;  4TKO B;  3I8Z A;  1BNZ A;  4RWS C;  3BG3 A;  4KY5 A;  4DGZ A;  1O78 A;  3S17 B;  3NPP A;  3Q24 A;  4KHZ A;  2AUJ D;  1U9R A;  1A15 A;  4MN3 A;  2B2U C;  1PFN A;  1RTN A;  1SE2 A;  3P20 A;  5IOC A;  1BCP D;  4OO1 G;  1TWC B;  2K01 A;  1HCZ A;  3VR3 A;  1X3Q A;  2L12 A;  3GTO B;  1HTP A;  3MEH A;  4RKL A;  2OEO A;  4BA2 I;  4RGT A;  2R7Z B;  2K5W A;  2E2I B;  3I4N B;  3OW7 A;  1EL0 A;  3H09 A;  5D14 A;  4PV1 C;  1IKL A;  5J1Z A;  2TMP A;  1I4X A;  3DUZ A;  1B1Z A;  1SYG A;  1SJH D;  3HKZ B;  4E6I A;  1D6E C;  5CMD A;  1JOK A;  2WKD A;  4DFA A;  3OSO A;  3S15 B;  5EJW A;  2D5D A;  4RAU C;  2E2H B;  5CV8 A;  4BS9 A;  5IGB A;  2PW5 A;  5EBD A;  3I91 A;  3CRL C;  4OL7 A;  5IIF A;  1HFG A;  3VR5 A;  5C0X G;  1F9P A;  3NWT A;  5K5P A;  1L0X B;  1B2T A;  4K5W A;  4DK1 A;  1SFO B;  2AUK A;  2KHS A;  3PUZ A;  4CHT B;  1PRT B;  1EZ8 A;  2F0K A;  4F8M A;  4XQQ A;  4BBR B;  2BA0 A;  1IKM A;  1MD2 D;  1H9S B;  5BN3 A;  3OMG A;  2Q8R E;  4XT1 B;  5JEA G;  3PV0 A;  4FNF A;  3HRZ C;  3ONA B;  1D5Z C;  2N55 A;  2WP8 J;  2JSO A;  2EYJ A;  2F0D A;  3R8B A;  5LHY 1;  2CW0 D;  2KCN A;  2QDB A;  3EVQ A;  4HMI A;  1BCP C;  1D1I A;  2EYH A;  2WKC A;  3C1E A;  2K6A A;  5ISR A;  5EKK A;  2QEJ C;  3R2I A;  2F0Q A;  1EOT A;  3OWF A;  2KJX A;  3VYU A;  1K8O A;  2FHT A;  1IYV A;  1W6K A;  3QOL A;  4A3F B;  2WIN B;  2O2L D;  1DOM A;  2O5I C;  2A5H A;  2JA8 B;  1BF4 A;  2FJ2 A;  1S5C D;  2G9H D;  1LT5 D;  5DNF A;  1GUO A;  2RDG A;  1H9S A;  3PMF A;  1RDP D;  3PUW A;  3KBX A;  5DM6 3;  1MI2 A;  4K2K A;  1SJE D;  1Q1E A;  3VA7 A;  5I6W A;  3S2H B;  1HQR D;  5CV7 A;  3S14 B;  1LTT D;  4N9T A;  4OO1 H;  4U68 A;  5CBE E;  3NBI A;  1XTC D;  2EJF C;  5FK9 C;  3M7G A;  4C56 C;  3BDL A;  4HCS A;  4A3K B;  5D3D A;  5M3F B;  1STB A;  1U4L A;  1JCK B;  3NQI A;  1PRT D;  2LY7 A;  1GUT A;  2B2W A;  4FVM A;  2KCC A;  3A55 A;  1ONL A;  4ZK9 B;  1STY A;  4HR7 B;  5JPN C;  1RKN A;  1BDO A;  1A6X A;  2FIN B;  1HA6 A;  5G3L D;  2F0N A;  4IUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...