1II3A

Structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ii3A00
5JOBA 1RKNA 2EY2A 3SHLA 5IGGA 5J22A 2F0DA 4ZQ3A 4S3SA 5JAVA 4N9PA 2F0EA 3NK9A 2EY5A 5C5LA 2PZWA 3NHHA 4DGZA 3OMGA 2PW7A 1KDCA 1SNPA 2RBMA 5CV7A 4R8NA 1IHZA 4TRDA 1A3UA 3C1EA 3NP8A 4K5XA 3TMEA 3NUCA 2F0NA 2F0JA 1KABA 1TQOA 1EZ6A 1SNQA 1STBA 2EYJA 3SK4A 3SK8A 4HMJA 3U9OA 5EKKA 4G57A 3C1FA 2F0MA 2F0WA 4EQNA 5CV8A 1SYEA 4H7BA 4ZUIA 3D4DA 5J1ZA 2SNSA 3MXPA 4IZ8A 4KY7A 5I6WA 3QOJA 4K2KA 4QMGA 1A3TA 4PMCA 1F2MA 5CV5A 5EGTA 4EQOA 4K5VA 3OMCA 1II3A 2ENBA 1EY0A 4E6IA 1EY5A 4NKLA 2EYOA 5E1FA 1A2UA 1JOKA 3ERQA 3SK6A 3OSOA 5KRUA 4NP5A 1SYGA 1AEXA 4PMBA 3HEJA 4IALA 2KQ3A 1TT2A 3TP8A 1EZ8A 1TR5A 1A2TA 5KYIA 1ENAA 2RDFA 4IUNA 1SNOA 1U9RA 2F0LA 3E5SA 1EY4A 1SNCA 2F0GA 1SYFA 3D8GA 3P1HA 4LAAA 5CV6A 5C4ZA 1F2YA 4PNYA 5KIXA 4K8IA 3DMUA 1SYBA 3MZ5A 5HURA 4ODGA 2PZTA 1STAA 2EY1A 2O4XA 4N9TA 4OL7A 2OXPA 5C6AA 4ID6A 4K6DA 2F0OA 3SR1A 3TP7A 5HGTA 4RKLA 5IODA 4NDXA 3TP5A 4K5WA 3LX0A 3SXHA 3D4WA 2KHSA 4QB4A 2F0FA 4YIJA 2NUCA 2QDBA 5CGKA 2M00A 1KDAA 1SNDA 2EYHA 4I65A 4KD3A 5K5PA 5I9OA 5DAUA 4KY6A 4HMIA 2PQEA 3MVVA 5I6YA 3RUZA 1NSNS 1NUCA 3BDCA 1JOOA 2SNMA 3NQTA 5CR3A 1EQVA 4F8MA 5NUCA 5IGCA 2EYLA 5IGFA 4J6HA 3SK5A 3OWFA 4K2LA 2SOBA 3H6MA 4KJNA 4WORA 3TP6A 5C5MA 4B9XA 4DFAA 4KTAA 5I9PA 5J39A 1STGA 5IGDA 5M9OA 4EVOA 2F0UA 4RKBA 5IGEA 1STNA 1ENCA 2EY6A 2HQEA 4KV6A 2F0QA 2RKSA 3MHBA 5IOCA 4ME5A 3DHQA 2F3VA 3T13A 3PMFA 2PZUA 5E3FA 5EKLA 4EQPA 2F3WA 3EROA 5KYLA 5ISRA 1JORA 4K8JA 1KDBA 5CC4A 1EY6A 3P75A 3R3OA 5IIFA 4WRDA 1STHA 3BDLA 5DEHA 1EYAA 4DF7A 3S9WA 2WACA 1F2ZA 4KY5A 4KD4A 3VA5A 4K14A 1EYDA 4B9WA 3MEHA 1EY9A 3HZXA 1SYDA 2F0HA 5IGBA 5KEEA 1SYCA 2EXZA 1EYCA 5KGUA 4QF4A 4MIUA 1STYA 3ITPA 2F0TA 2PYKA 2OEOA 3T16A 1SNMA 4KJOA 1JOQA 5C3XA 3NXWA 3QOLA 3QB3A 4NMZA 4F7XA 2OF1A 3EVQA 4DU9A 1EY8A 3V2TA 2F0PA 4HTHA 4KHVA 2EYFA 3D6CA 3EJIA 2EYPA 2F0VA 4J1MA 2F0SA 2PW5A 5CV9A 2F0KA 2EYMA 2F0IA 5CV4A 2LKVA 4ZUJA 5F2DA 5C4HA 1EY7A 1A3VA 5C3WA 1KAAA
chains in the Genus database with same CATH superfamily
1IYJB 2ICIA 5M3MG 1J6QA 1I4QA 1N36Q 3NK9A 2KEEA 2PPBC 1B9MA 1S3OA 4X62Q 3PIO3 3AMUA 4RCOA 3M3YH 1I6HB 4RMFA 4DNTB 4L5QA 1EZ6A 3K5LA 3UDFA 3I4NG 2F0WA 2ZTCA 3A8IE 4GOPA 1PH8A 1LLRD 2QKIC 2B8GA 1PYWD 3ONAB 1LTRD 2EDGA 2KOLA 4K0KL 1IL8A 1OXUA 1A0IA 2WIIB 3PSIA 3GD7A 3NTKA 3NTHA 4A3MH 4PG3A 1LT4D 2B63G 4AIMA 2AUKA 4C3HB 4ZRZA 2WV6D 4A3KH 1YZ6A 5IE8A 1XMOQ 4LF4Q 1G2TA 2B2VC 1BDOA 3BZCA 4L5RC 1SYFA 4DV2L 4A3CH 3HOVG 4JI1L 2K5QA 2FJ2A 5C0XG 4G7HC 2EY1A 3FVQA 2UUAQ 2NN6G 4P74A 3KK7A 3TP5A 2N55A 3D4WA 3A5UA 1WYDA 3RR5A 2QDBA 4OGQC 4GN5A 3PIPA 2OCEA 4C3JG 1NSNS 3K7AH 1EQVA 2E5LQ 2UUCL 1UEAB 2E2JH 3PO3H 2VL6A 5C4XH 2B2VA 1WTQA 3X3MA 3BJUA 4IFDG 2EY6A 1SROA 4K8JA 4WRDA 1STHA 3BDLA 3GTMH 4CJ1B 2LY7A 3TBIB 2EJFC 1HNXL 4B9WA 1ZXTA 2VZAA 1JB3A 4IPDA 2NWGA 3K58A 2MO0A 3MA2B 1U0LA 3MWYW 3QB3A 2V4DA 2OF1A 3CP0A 2R92G 1N8RC 1K0SA 5ELCA 4A3GH 3KLRA 1MHWC 1VQMA 1Y1WB 1EY7A 3J80L 1XNRL 1GUNA 1N32Q 4ZQ3A 1G6ZA 4BXXH 3MXUA 4Q5VA 1U4MA 5EBDA 2HT1A 2LFNA 1HZBA 1KLGD 1SNPA 3GTLB 3PUVA 5M3FG 1STBA 4KKUA 1MI2A 4G57A 3NEMA 4YCWA 1H95A 1PH3A 2N88A 2BDNA 2ICEC 1MIUA 1B4OA 1F2MA 2F4IA 2JQOA 2TMPA 5IYBH 1CKMA 3FMCA 1SMYD 2Y0SE 2YV5A 4YY3Q 4POGA 2IWHA 4A3JG 3H91A 2XRSD 1EY4A 1NCVA 2ZJPA 5EJWA 2E2HH 5DM63 4YWKA 4V0BA 2OTJA 1ML0D 3A54A 3A55A 4K5WA 1LTBD 1TWFB 2J7ZA 2F0FA 5D65A 5JVH3 5CGKA 1X3PA 3S1NB 2IW3A 1Z47A 1VQPA 1BKBA 2Q8RE 5FLXE 2VUMB 2ZTDA 3S1RB 3RZOB 4AQYQ 1KNEA 3K6OA 2MO1A 1EWIA 3G4SA 3A0JA 4JC0A 3JAMi 4ZLTF 1EEID 3SK5A 1AE3A 1J5EL 4BBRH 5J39A 2NVYB 4J8QA 4FF3A 1PA6A 1STNA 2WKCA 2NVQB 1SN8A 1KIXA 3DHQA 3PV0A 4JBWA 3MTSA 4BWGB 1K3BC 3VDYA 1XPRA 3J81L 1ONLA 2I0QA 1VQ6A 3U9SA 2WACA 4K6LA 5M5WB 3LWUA 4KD4A 3HKSA 1EY9A 4LF5L 3CQZH 5DNFA 2EXZA 3NWSA 3GTJH 4C3HG 1B2TA 5EPKA 1NJIC 2FHTA 2EYFA 1HCZA 2Q2TA 1QVCA 4XIGS 4BY7B 1S5FD 4H13C 4MN3A 1LT3D 1I6VC 1JC7A 5CV4A 2R7FA 2FFKB 1DZ1A 1AP0A 2K05A 1WTOA 4IOCA 2J4XA 4IOAA 2Q2IA 5JVG3 3OMGA 3BYYB 3C2PA 1KDCA 3MEFA 2VB3X 4BA2I 2EIFA 1V9PA 3E3XA 1F9SA 2VB2X 1DXMA 4U68A 3QOJA 2ZM6L 2B39A 5CV5A 1JMCA 5IP9G 2NVTB 3KYHC 1PYBA 4JI0L 4DUZQ 1I3QB 3SK6A 1F9PA 2EJMA 3HEJA 1TT2A 2A5HA 5IWAL 1PRTC 2I46A 1QZGA 1O80A 3R8BA 2A69C 5ELDA 3QJYA 1PH7A 4DV0L 2G5DA 4LW1A 3ULPA 3GQBA 3D3RA 3OWEB 4WJ4A 3WOEA 2K7VA 3GTPH 1EUJA 1CHQD 4KKSA 1SNDA 3CCEA 1GHKA 1HQRD 4B3SL 3PO2G 2NBFA 4FP5D 2LSSA 4OO1G 1RIPA 1Y1WG 3FKIB 4F8MA 1X3GA 4JW0A 2O5IC 3HGBA 4WJ3M 3TP6A 4JBJA 3UE0A 1PFNA 1GM5A 3GTOB 1GUOA 1S72A 4RKBA 3MC0B 1LTAD 2F3WA 2F4VQ 3Q22A 1JORA 3SVMA 4LMQD 4B08A 5DEHA 4LF6Q 4DV6L 3D31A 3J80c 2ATWA 4N8FA 4LFCL 3HOUH 1K0RA 4QF4A 4DR1Q 1CUKA 3NTIA 3T16A 4C2MH 3JAME 2Z8LA 1Y1VH 2EJGC 1PH5A 3EVQA 3TN2A 5FK9C 1IZ6A 1E22A 1HNZQ 3FPUB 2D2CC 5C3EH 4KN7C 1PTOD 2FMMA 2LKVA 2Z6KC 3T1YL 1JT8A 4IUUA 1WFQA 4A3BG 1XMQL 4DV1L 1T9HA 1GD7A 5DLQE 2VUMG 3I4MH 5GAEC 4R8NA 1FGBD 1KTKA 3NP8A 2F0NA 2QEJC 3QR8A 4PQXA 1RDPD 5KYLA 3HOYB 1N34L 1EIGA 2RVLA 5IYDH 3T1HL 2E2IB 3KBGA 1NNXA 4H7BA 1WTHA 4BBSH 1QNUA 1L0WA 4JI5L 1BQQT 5J3BA 2BE5D 4DUYL 1U4PA 4A93B 3S15B 2WB1B 1I4XA 3A74A 3E5SA 1W2BA 3H3VH 3M4PA 3S2DB 2DGYA 1GXDC 3K5MA 2MP1A 1TY2A 1SYBA 3MZ5A 2PZTA 4DK0A 2JA8B 2O4XA 3K57A 2BDOA 5KNDA 2ALYB 2F0OA 5FLXL 2VQEL 2PI2A 4JI2Q 2L9HA 4DR6Q 2CH4W 1E2ZA 4JOIC 3J81c 2XGTA 5BR8L 1SJED 1R9TB 4G4KA 3A8KE 4BY7G 5JJKA 1PTOF 4IPGA 3I7FA 4DR2L 1C7YA 3H0GB 4RA8A 1O7IA 1OXXK 4CGYB 1IBLQ 4DV3L 5C5MA 1O7ZA 3KDFB 2A6EC 1STGA 2B2YC 1JJGA 1B9NA 2B2WC 2WAQB 2RHQB 1XNQQ 3CHBD 1X3EA 4UY8C 5HGQA 4XTCS 1B70B 1S5CD 1TIID 4PZ6A 1Q1EA 2JK8A 3KOJA 4P72A 4XYOA 2VQFL 1VF5C 3KJOA 1Q81C 1E3PA 3PQIA 5ELEA 1SFOH 4NXNL 1EIYB 2K04A 4DK6C 1PV4A 1CZGA 5I2YA 4BY1H 4DR4L 2ZJRA 1Y14B 3I4NB 5BN5A 4B3ML 3KDFA 3PGZA 5IYCG 4L6TB 3NXWA 2ES2A 2E76C 5IY0A 1IBKL 2PCFB 4DXFA 4R8IA 2OQKA 1UE7A 4WFN3 4Y52H 4DA2A 3NBHB 2EOTA 1G8ZD 1Q8IA 1M90C 3TEHB 1A3VA 5LMUL 1ZYRC 1Z7TA 4JI6Q 3HOWH 1A62A 2OQ0A 5GROA 3SHLA 3HOXH 2RSOA 3T56B 3CCLA 1G291 1YHBA 4EGVA 1VQ5A 1I4RA 1IBMQ 1LTLA 3A56A 4TRDA 1VDZA 4N8X1 3TMEA 3S1QH 3FKIG 1NR4A 1SDFA 4FYDA 3M3YB 3OOCA 4FNFA 2JA7H 2UXBL 1D1KA 4MTNA 3I72A 1RD9D 3I3CA 4ZUIA 3W2DA 3RNUA 3HOZH 4QGUA 5IP7G 1Q90A 3NBHA 4C3JB 3G71A 4UHVA 3M9BA 4K5VA 3GTKH 1II3A 4E6IA 3S2HB 1I5FA 3RN2A 1XX8A 1JQYD 4KMUC 2AQ3B 4CKBA 2I5MX 1N36L 4JYAQ 5T1GA 1KAWA 1YNNC 4X62L 3VR2A 2IPKD 5C4ZA 4UDUC 1F2YA 4LWCA 3H15A 5HURA 2KVMA 2GA4B 3UDGA 4RKLA 5EQ0A 4LFBQ 4NDXA 3D0FA 1SBBB 2QGQA 5IT9E 3NWTA 1PTOB 4C3IB 3CMAA 1TWAB 2D0PA 2I5LX 4QY7A 1EU4A 1YNJD 2HIXA 2LXKA 4DR3Q 1OO9B 5NUCA 3STBC 3M4OH 1WTVA 2B2UC 1XMOL 4LF4L 4NPSA 2V1CC 1IL2A 1H9KA 1HUMA 3MAQA 5M9OA 2R92B 3SE0A 4B3RQ 2DNEA 2JA6H 4RGOS 3PO3B 5C4XB 1X56A 5IOCA 2UUAL 4EQPA 5I2XA 4A3LH 1KD1C 3HOYG 3W1BA 1E1OA 3NSWA 3LGJA 4LNQA 4YCVA 3RZDH 2LXJA 4K14A 3GTQH 3PUZA 2Q8TA 4WJWA 3V05A 3JAML 3GTMB 4PZ8A 4M8AA 5M3FB 4R4CA 2E5LL 1EYCA 2H5XA 2RF4A 2SEBD 2JEBI 2B2UA 1DM0B 4LK1C 4CHTB 2CVRA 1NE3A 2R93H 2JA8G 1N33Q 1FJGQ 4KLKA 4A3GB 2EY2A 1ZEQX 4S3SA 3VR4A 4A3DH 2ZT9C 2Q2UA 3TS2A 2D62A 1J9OA 4IUTA 3IAYA 4K5XA 2YTYA 1HTPA 2F0JA 4BS9A 4CDDC 1TXYA 3E9IA 3K81C 1GUTA 1SYEA 5FLXc 1HQMC 3ER0A 3KLWA 1L1OB 2WAQG 4IJLA 2HHHQ 3J81j 3F2CA 4PMCA 5EGTA 1DYQA 5K36H 2N3SA 1YNXA 4GN4B 2MHVA 4F87A 1N32L 2X69A 1EOTA 4PMBA 3TP8A 4HIDA 4IN3A 4CJ2C 4ZK9B 1PH6A 3F2BA 3K5NA 2R3ZA 3RLNA 4TVAB 1U9RA 4DV4Q 3X3NA 4LFAQ 1DOMA 3DMUA 3OIQA 1PDQA 2E2HB 1SLJA 2L15A 1L1OA 3EN2A 1LTGD 1ASYA 4IO9A 1ESFA 2JSOA 4HJ7A 4CBVA 3IL8A 5I9OA 1UWVA 4RG1A 4YY3L 3CCSA 4B9XA 3G48A 1HFNA 4P75A 2KCNA 1MGSA 1EYGA 5IGDA 5D14A 1M4VA 4BBRB 4A75A 3I8ZA 3L0OA 4X3SA 4JI3Q 2WKDA 3F1ZA 2XTIA 3EIVA 4TQUS 1NMFA 4AQYL 1JICA 3SEBA 1SYDA 2QA4A 1DONA 4IUVA 1TWCH 3J7A5 2B2TC 4A3MG 2MGSA 3GDEA 2KEDA 1L2FA 4F88A 1SNMA 3ERSX 3T51B 1XTDA 3QOLA 3S14H 1UE5A 4UPAA 3S17H 4J1MA 5T1IA 2NVXH 2JEAI 1Z9FA 1NBWA 3CD6A 3SGIA 3M7GA 4A3CG 1SE3A 1VQGA 2YYZA 4N9PA 4C3IG 1B3AA 3NHHA 2XNAC 4QCLA 2R6GA 2IHEA 1C0AA 5C44H 3Q24A 1IHZA 1A8VA 2G9DA 1CFMA 5A2QE 3D4RA 4A4IA 1SNQA 2Z4HA 5EKKA 5DM73 2A69D 1E0BA 1Q8KA 2A1AA 5COYA 1RCVD 2GN5A 4KY7A 5I6WA 3IFDA 4AYBG 3PO2B 3M4YA 1VQOA 1A3TA 3PO3G 2HDLA 5C4XG 1RHPA 2JXMB 4HIMA 1EFID 1JWMD 1QJOA 4NKLA 1A2UA 2ASBA 1SYGA 1I50H 4IALA 1ZKOA 1TR5A 3FP9A 3GO5A 3MXGA 1XTCD 2UXDQ 2PQAB 5HGTA 3SR1A 2XWBB 1Q82C 3I91A 2QF7A 1K83H 1QWYA 1D5XC 1PFMA 4X65Q 1KDAA 1AE2A 1FR3A 3PUXA 4KHPQ 1GKHA 3R2IA 1VQJA 2PMZB 3JAMc 4DUZL 2SNMA 2WINB 3TZUA 4A3GG 1MJEA 2QDLA 3BG3A 4DFAA 3MFGA 3HP3A 1VQ8A 1WTPA 2YU9H 2EPBA 1TWHH 3N52A 2PQAA 3UE1A 3PMFA 5EKLA 1PRTF 4XQJA 2RCNA 3OYYA 3P75A 4ABNA 1LUZA 4A3BB 2PI2E 1EQTA 1EQRA 5FOBB 1RF2D 1D5MC 2EQSA 1I6HH 3UDIA 4GLAC 1SMXA 1UEBA 3I90A 1CA6A 2XIWA 3HOUB 2N49A 1JOQA 2WB1E 2O5JC 4C56C 2OTLA 4DU9A 1EY8A 5JEAJ 4HJAA 4X66Q 1YJ9A 2F4VL 4X64Q 3OW2A 4LUOA 5C3EB 4C3HH 2MQHA 3TSSA 1OXTA 4LF6L 4DAVA 1ILPA 1C48A 1QE6A 4JI4Q 4YWLA 3ICEA 4XDXA 4GNXC 2R7ZH 4DR1L 1O7LA 1IYUA 3I4MB 4OX9Q 3L2PA 2L11A 1VMCA 4LUVA 2RDHA 1HNZL 2JA5B 4EX5A 4Y7NB 3QWNA 5E4XA 4QMGA 4BBRG 3AB9A 4APVA 2A68D 3HFZB 1PH2A 3BZDB 1FL0A 4IPCA 3AU7A 4XQQA 2UU9Q 3H3VI 2JP1A 3Q8DA 3S1MH 4DK3C 1K8OA 5H1SE 3NQIA 1SNOA 3J7ZC 1SNCA 2F0GA 3H3VC 2E8GA 5IP9H 4K8IA 1S40A 2A6ED 1I94L 4K6DA 1YEZA 1AFPA 3NENA 1CZWA 1F9RA 3VYTA 5BN3A 5CMDA 2QW7A 4LF8Q 4I65A 3GP7A 1TS2A 4XXEA 1B7YB 4HMIA 3PIOA 3KF8B 4FXDA 4RHRA 1HZCA 5GADC 1A6XA 1Y8NB 1IW7C 5JJIA 2L0CA 1PRTB 3OIPA 1CKNB 3DUZA 2HQEA 3EBEA 2E2DC 3FRPB 4JI2L 1EY6A 4CDFC 1EQQA 4DR6L 4DF7A 1D8LA 1KL9A 1SAPA 3UI2A 3K8AA 1PXUA 4DV7Q 1ICFB 3KF8A 1ZYRD 3HZXA 1DGSA 3BVGA 3GTLH 5IGBA 2F3IA 2L5TA 1SFOB 5LMNQ 3Q0AA 1IBLL 4Z9CB 1RJTA 1MJCA 1SE8A 4G7ZC 1CKNA 2VY3A 1XNQL 2A74C 1F2LA 2F0PA 2DJFC 4HTHA 2NB0A 5CV9A 4DNIA 3EFXD 1K3RA 3KLSA 3I4OA 4FO2A 1C4QA 1VF7A 5E4WC 4ZKBB 3T53B 3S24A 2CWAA 1IYVA 1VMPA 1L0YB 2JN4A 1KABA 2A19A 4UP8A 2WP8J 4KKTA 5JPNC 1XWEA 1TWFH 1C8CA 2BCOA 4RFBA 1HTLD 2JA7B 2VUMH 1RTNA 1ASZA 1FYCA 1T5XD 3DEPA 3RZOH 3NPPA 2XWJB 2D9UA 4XT1B 3GTGB 3MXNB 4BA1I 3FDTA 2PO4A 3M85A 4NP5A 2NVYH 1LO5D 5C4JB 5GAHC 5KYIA 2RDFA 2AUJD 1IBML 2F0LA 3STBD 2NVQH 2RA4A 5M5XB 4LAAA 2UXCQ 1E1TA 1PFSA 1NR2A 4HSPA 4GKKQ 4N9TA 2HDMA 1S5DD 4CDEC 3HOUG 1GHJA 1UNSA 2NTTA 5M5WH 3SDZA 4QB4A 3ULLA 2NUCA 2N78A 5M5YB 1Y1VG 1BCPC 2EYHA 4KD3A 1UE6A 2OT2A 4DV5Q 3J80i 2Z6KA 1SJHD 5I6YA 5C3EG 1TS5A 2KCTA 1GO3E 2M9VA 3IKJA 4JYAL 3ULJA 4X3TA 4WORA 4JI8Q 2PNHA 2ZTEA 2AWOA 4O42A 3M4OB 2RDGA 1EL0A 1JJCB 1CHPD 3K5OA 1WCMB 2RKSA 5EKIA 2F3VA 3I2ZA 3AFPA 1V8QA 4OEMB 1HA6A 3EROA 4DAPA 3I4MG 4LFBL 1HNWQ 1W6KA 2FXQA 1I4PA 1KRTA 1EYAA 5IYDG 4UP9A 1VQ4A 2JA5G 1QILA 3ZJYC 1DJRD 5L37A 4DR3L 1MBYA 3I56A 2CQOA 2IX3A 1D6EC 2AHOB 3I70A 1QVFA 4B3TQ 4OWTB 1CSQA 4F7XA 4DR7L 3RLOA 1PZKD 2CW0C 5TSSA 2KJXA 2Z6BA 1K9MC 2NVTH 3RN5A 2XN9C 2K52A 1DOKA 2RCFA 1V1QA 1I3QH 3A5ZB 2M2LA 4JOIA 5J22A 5JEAG 4POFA 5G3LF 2BOSA 1QVGA 3S16B 3E6ZX 3PIP3 4HIKA 2A6HC 3CMEA 1TQOA 1WI5A 1CQFA 2B2YA 1BR9A 2B2WA 4A3IB 2KCCA 3MXPA 4IZ8A 4A3FB 4K2KA 5GQOA 2AQ2B 3CRKC 4NW2A 1N33L 1B53A 2ENBA 1EY0A 2C35B 1FJGL 3DWPA 1WVLA 2UUBQ 1JOKA 3D6WA 3W5OA 1YHQA 3M7NA 3QIAA 1EZ8A 1FVIA 3GTOH 3OW7A 4IUNA 4A3EH 5IGFA 3K59A 5ELFA 4ODGA 3LNNA 1ESRA 1STAA 5ELBA 4OL7A 4ID6A 4G7OC 4BY1G 4NXMQ 3SXHA 5I4DA 4LUZA 5C0XI 1KHIA 2HHHL 2K1BA 2M00A 3ND9A 1B3QA 2NN6I 1HHVA 1JJ2A 1PLFA 4GKJQ 3RUZA 1X3QA 4A3MB 1HR0W 4JBMA 4FXKC 1W6JA 4JV5Q 4KJNA 1YHAA 2K5NA 5I9PA 4R1JA 2ID0A 4I7AA 4A3KB 2EZVA 4DV4L 3HOWG 3C3LA 4LFAL 3DWAA 1JCKB 3KLSX 2F0QA 1VCIA 3H94A 2ZXRA 4O1NA 1H9MA 3E9HA 1VQKA 4IFDI 3NELA 2LS01 1DCZA 1SXTA 1UE1A 2JA7G 2HQLA 1LT5D 2EVBA 4LJZC 4JI7Q 4DK1A 1ET6A 3CCUA 3HOZG 4PMWA 3J80E 1Q86C 1D1IA 3RLFA 1QZHA 3K7AB 2GVBA 4DXGA 2OEOA 5HY6A 3I55A 2X6GA 2R7DA 5CBAE 2F52A 1MSGA 3BVMA 2E2JB 4AYBB 4RGNA 1AH9A 3TS0A 4HCSA 5FLMH 3S14B 2KA7A 4JI3L 3KUPA 4PZ7A 2IT1A 1SE4A 3S17B 1STEA 5C4HA 3PF4A 4A93H 4JPBW 2E2IH 3O13A 2Y0SG 5AFWA 4IJHA 3DLLA 3S2DH 3LWEA 5ELNA 2PW7A 5CV7A 2PMZE 5FKAC 4CKEA 3U4ZA 2JA8H 2NZHA 3NUCA 3OTOQ 5C44B 2D5DA 4QJFA 2K5DA 5CV8A 4JK1C 4MZ9A 2LMCB 4HCEA 5FJ8H 1WCMG 3H0GH 4YHHQ 1PH9A 2JA6G 1FNVA 4ZCKA 3CRLC 3U4VA 5KRUA 5CYUA 1VQNA 1I50B 1OXVA 2K4KA 4PNYA 1PH4A 1NY4A 4GZYC 1GUSA 4XYQA 1A63A 2RQXA 3OPOA 2OXPA 5M3MH 4PV1C 5CORA 2A73B 1K8MA 3CXCA 3OHXC 2KHSA 1V1PB 1VQEA 4HR7B 4YIJA 2H4OA 4QL5A 1XJVA 1VQLA 2PQEA 3MVVA 1JE5A 2O2LD 1GUWA 3CCVA 3I4NH 4XQNA 3NQTA 2XVSA 1HXYD 5FO7B 1NMGA 4K2LA 3S9WA 4GOPC 1X65A 4A3DG 2B63H 1ENCA 1RTOA 2KECA 4HAEA 2UXDL 2YU9B 4QIWB 3F2DA 3CCRA 1K73C 1AW7A 3R3OA 3J7AF 3WWVA 1F2ZA 1GVPA 4X65L 4A3IG 2CFMA 5D3IB 2K5HA 3VA5A 1HR0Q 4A3FG 3HOVH 5C0XH 1G2SA 3PF5A 4KHPL 4P2CB 3E0EA 4UP7A 3V96A 1B44D 2NN6H 4FF4A 5KGUA 5K36G 4HSVA 4KJOA 2ZXOA 3CAMA 1Q7YC 1TS4A 2E75C 1PYSB 4KHVA 4C3JH 1VQFA 2J0TD 3EJIA 3HKZB 1GUGA 3VYRA 5GAGC 2YTVA 2F0KA 3CW2C 3S2HH 5EPJA 1JE4A 1TU2B 5JOBA 1MKHA 5IGGA 2EXDA 3FHWA 4IFDH 2EY5A 2RSNA 2Z4IA 4X3KA 5KNCA 1QCBD 1A15A 3CCJA 1UUPA 1YIJA 3CQZB 3VR3A 1DOLA 1JWSD 2EYJA 5LHY1 2R7ZB 2CQAA 4DN4M 3GTJB 1BXTA 2K5WA 1PTOH 4EQNA 4C3IH 2QILA 3K7UC 1TWAH 3BU2A 4A3KG 2K75A 4TSSA 3R93A 1IXRA 2K14A 4LF7Q 4OWWB 1EIHA 2IL8A 4X66L 1TKWB 2NZOA 4X64L 3CKIB 3FEWX 2HCCA 1SE2A 3OMCA 1EY5A 1PH1A 1U5KA 4QQBX 3Q6SA 3OSOA 1VQBA 2R92H 4JI4L 1ENAA 1Q46A 3S1MB 1XPUA 1IW7D 1PRTD 2B2TA 4ULLA 4OX9L 1LYLA 4RHSA 1CTMA 3VR6A 1VQHA 1Q3LA 3CC4A 1F77A 1S5BD 1YNJC 4LF9Q 4RWSC 3IRBA 2KCMA 2RHSB 5M3FH 1ET9A 4OHJA 3RMHA 2F1MA 1IKMA 4DR5Q 4O0AA 4R4TA 2UU9L 3BDCA 1WOCA 5IGCA 2SOBA 5AJ3Q 4OO1I 4L5SA 2IX0A 3VR5A 5IT9L 3CC7A 4I7ZC 4Q0FA 3CPWA 3W3AA 1N9WA 3G6EA 5C44G 1H9JA 1KDBA 4MTKA 1XPOA 1V43A 5ELOA 4A3JH 2CCZA 1D7QA 1X6OA 3FPPA 2D0OA 3PCOB 4LF8L 3GTPB 1EYDA 1HJPA 1K28A 5KEEA 1VQCA 1STYA 1QB5D 2PYKA 3HS0C 3ND8A 1QOHA 1TWGH 5LMNW 4NMZA 1VQ7A 4BXXG 3R2TA 3AYHB 2MFIA 3D6CA 1AZQA 1G6PA 2PW5A 2IJ0A 4K0KQ 1IKLA 1E2VA 5F2DA 2HUGA 2L55A 4KHZA 1K8GA 1PHJA 1JR0D 4JCVE 1Y8OB 2F0DA 5JAVA 4DV7L 3J7AV 4L8JA 4L5TA 2Q2HA 1PZJD 4CJ0B 2SDFA 2QEXA 5LMNL 3U50C 4DV2Q 4JI1Q 3SK8A 1NTGA 3U9OA 1Y8PB 5IYBG 1YITA 1SR3A 2VW9A 4ZKCB 1S4ZA 4C2MB 1LABA 1Y1VB 5J1ZA 2SNSA 3N6RA 2IY5B 1BF4A 4H0LC 1NAPA 1CT1D 3BVZA 1BCPD 4L63B 3ERQA 2AWNA 5LL6X 2UUCQ 3P7JA 2K32A 3ZYYX 1LTID 1LTSD 1EIFA 2JJQA 3DXJC 4J15A 1A2TA 1WTXA 1BVSA 4OXPA 5CV6A 4HJ8A 3TQYA 1RODA 1BUVT 5EPLA 4GNXB 3KF6B 3TP7A 4FF2A 4RCNA 4H02A 2QCPX 1V1OA 2WAQE 3URYA 3G6JB 1B50A 1WTRA 4U673 4BBSB 1HH2P 1CK1A 1HNXQ 3HKZG 3TDQA 2BH8A 1HA5A 4DAYB 2K03A 3A8JE 1NUCA 1JOOA 2EYLA 3TRZA 4FVMA 3UDXA 4EVOA 2UXCL 2F0UA 1CI3M 4GLVB 4R4QA 3HG9A 3NBIA 1X55A 4AH6A 3KF6A 4GNXA 4GKKL 5E7NA 1X32A 2B8FA 4ALPA 2CW0D 4GN3B 2R7ZG 5IIFA 3J7YW 1RL2A 1XNRQ 2FINB 4DV5L 1DD2A 1PMRA 2VS1A 4OIJA 4DAYA 2XSCA 4YCUA 3F8TA 1VQ9A 1M8AA 1SEBD 1KC8C 3ITPA 1BCPF 1L0XB 2ZXPA 4DAMA 1W3SA 4JI8L 2BA1A 4JBKA 2Z0SA 2N8NA 2KENA 3PO2H 2A6HD 2DN8A 2F0VA 2P5ZX 4OO1H 1Y1WH 3VYUA 1SSOA 1HNWL 5EAYA 1PVOA 2A8VA 3EQLC 4FXGC 1FNWA 3P20A 4O2DA 4XT3B 2F0EA 5C5LA 2PZWA 2X6LA 5KNBA 4A76A 1OXSC 2KBNA 3C1EA 1P8LA 4BY1B 2IHFA 3DWQA 2B3GA 1WD0A 4B3TL 4MNOA 2TSSA 1GJXA 1B1ZA 1VQAA 4ZYSA 1J8IA 2DY8A 2R61A 1VQIA 4EQOA 3DEOA 4HEDA 2NZ1D 1U4RA 1KLUD 3DM3A 4EQ5A 5E1FA 5A2QL 3HOWB 2KQ3A 3HOXB 1LV9A 1J5EQ 1FD7D 4OIKA 3P1HA 1HRJA 3E0JA 1YNND 3HRZC 5IT9c 1QG7A 3CF5A 3KJPA 4A3EB 3AEVA 3S1QB 3TZDA 4A3BH 3A7AB 4AYBE 3LX0A 3S1NH 1YJWA 3S1RH 2NYZD 1LACA 5JJZA 1SMYC 4V190 4DNRB 5K5PA 4GLXA 4MHEA 4IURA 5DAUA 3HOZB 3KFUA 4LF5Q 1XYIA 2UUBL 4JI6L 3BYTB 3GTKB 3AQQA 4J6HA 1M1KC 3OWFA 1I4HA 2WFWA 1CSPA 1FGUA 1O7YA 2BA0A 4X3UA 3QG1A 2BH2A 1KNAA 2K01A 3T13A 4NXML 5ISRA 3VYSA 1CKOA 5CC4A 3CC2A 4KK7A 4H44C 2Y0SB 1EOVA 5G3LD 1EFWA 3PUYA 3L9AX 3MXNA 3MEHA 4GKJL 1BCPB 2JYOA 2IX1A 4IQZA 2F0HA 3K0YA 2MNAA 4MIUA 2C9OA 5FO9B 4JV5L 4P73A 2KHIA 3KBXA 1I94Q 2JA5H 4BY7H 4RH6A 4Y7NH 1WD1A 3V2TA 4P71A 1TVXA 2DY7A 2K28A 2ZM6Q 5FO8B 2JA6B 3BZKA 1X54A 1WJJA 2F0IA 1QNKA 3CCQA 1KRSA 2HIVA 4ZUJA 2I5HA 5JJLA 2GVAA 4ILWA 5C3WA 4JI0Q 1RKNA 1H9RA 1S5ED 4RGMA 1E2WA 4JI7L 4HJ9A 3RZDB 4BBSG 4DGZA 5IWAQ 2MUYA 3L3OC 3GTQB 2K6AA 1TS3A 1AZPA 3CPFA 1EEFD 4DV0Q 4IUPA 4ME3A 3SK4A 3U58A 1GOZA 3M4QA 3C1FA 5JEAH 2F0MA 4B3RL 2A68C 3RD4A 2L1BA 4HJ5A 3NE5B 2AKWB 3GV3A 4QIWE 2R93B 3CCMA 4B3SQ 2I07B 5A35A 4OELB 5IYCH 2MJ8A 1G51A 1HFGA 3JC66 2G9HD 5C0XJ 3Q23A 1AEXA 3MFYA 1WTWA 2HCIA 4A3DB 5KIXA 1H9SB 1MSHA 3OTOL 1P16A 1I4GA 1BO0A 5JPMC 1EWCA 1R4PB 2L4NA 5IODA 1SRUA 3G7LA 1EU3A 3L7ZC 5M3MB 1JWUD 2CH4A 1ICWA 1F9QA 3J81i 2CKZB 4DV6Q 3K0XA 3HKZE 2PNRC 4YHHL 3FKIH 4IFDJ 1Q1BA 5CR3A 4LFCQ 3BDOA 2XRQD 2F03A 4NB3A 2VNUD 2AQ1B 4QUCA 5IP7H 3W1GA 4M1UB 1H9SA 2DNCA 1X3FA 3I73A 4IUQA 3MHBA 1QUQB 3K80C 2PZUA 2B63B 4R9WA 3EA6A 4JG2A 4RGTA 2K33A 1VS0A 3T1YQ 1TY0A 3AFQA 4IPHA 4KY5A 1C9OA 1CM9A 2YTXA 4DV1Q 3GV6A 1XMQQ 4OWXB 1PFBA 3HOVB 1Z6HA 1SYCA 2JA9A 1O78A 1YVCA 4KN4C 2F0TA 4HIOA 1N34Q 1BOSA 1HUNA 3HOXG 3T1HQ 2Z1CA 4CDCC 1QUQA 1UAPA 2EYPA 2HD3A 2F0SA 3GTGH 2AMCB 2EYMA 3TREA 4A3EG 1ENFA 4KI0A 1E7ZA 4JI5Q 2NTSA 4R4OA 5C4JH 1CQVA 4QUFA 1HR0L 4X6AH 4DUYQ 5M5XH 1E24A 1Y69U 1PZID 3HOYH 2CHBD 2RBMA 1HZAA 4FF1A 2JE6I 1G91A 1KXLA 1A3UA 1Q12A 3VA7A 2DJGC 2DUDA 1TWCB 1MD2D 2MPMA 5EBCA 1AN8A 4HMJA 4ZAIA 1D5ZC 1PTOC 2VQEQ 4FDBA 4HN7A 3B6YA 3D4DA 5M5YH 1T5EA 2C5CA 3CU7A 1VQDA 1BBXC 5BR8Q 1BNZA 1LM0A 2NVXB 1BBWA 1YJNA 2EYOA 4DR2Q 3S15H 1OTCA 3T4AC 1D2BA 3BS1A 2FMCA 4DV3Q 1JB7A 2E74C 3D8GA 1LT6D 1WCMH 3C46A 4DR7Q 1KQSA 3PUWA 1HPCA 4DPGA 5C6AA 1LTTD 1EWHA 3A7LA 2B29A 4LF7L 1R9TH 4CKCA 4OONA 2VQFQ 5D3DA 1U4LA 3DM1A 1R4QB 2BE5C 2KUMA 4KY6A 4NXNQ 5FLMG 2Q8IB 1BBUA 4DR4Q 4R4IA 4A3LG 3WDNA 3H6MA 4B3MQ 1XXGA 4KTAA 4C1NI 3IFTA 2K5VA 4RAUC 1K8AC 4A93G 2WB1G 4DKAC 5IGEA 1IBKQ 4KV6A 3F2UA 4ME5A 5E3FA 2KHJA 4JVZA 3WOFA 1HZ9A 4LF9L 5BN4A 5LMUQ 2H1EA 1B8AA 1K83B 4A3JB 4UAIA 2K50A 3H09A 2ZJQA 2OWOA 3S16H 3J81E 1CA5A 4DR5L 2R93G 4GS3A 1ILQA 4C1NK 5FJ8G 2CWPA 1YI2A 3H0GG 5AJ3L 5LL6S 5C3XA 4A3IH 2EE1A 2Z9HA 1L1OC 5CBEE 4A3FH 2UXBQ 4TKOB 1X9NA 3QO2A 1TWGB 4YWMA 4GOPB 1YBYA 1TWHB 2L12A 2VXWA 1FNUA 1V1PA 3I4LA 1KAAA
chains in the Genus database with same CATH topology
2ICIA 1I4QA 3NK9A 2KEEA 2PPBC 1B9MA 3PIO3 3AMUA 4RCOA 1I6HB 4DNTB 1EZ6A 3K5LA 2F0WA 3A8IE 1LLRD 2QKIC 2B8GA 1PYWD 3ONAB 1LTRD 2EDGA 2KOLA 1IL8A 1OXUA 2WIIB 3NTHA 3GD7A 3NTKA 1LT4D 2AUKA 4C3HB 4ZRZA 2WV6D 1G2TA 2B2VC 1BDOA 1SYFA 2K5QA 2FJ2A 5C0XG 4G7HC 2EY1A 3FVQA 2NN6G 3KK7A 3TP5A 2N55A 3D4WA 2QDBA 4OGQC 4C3JG 1NSNS 1EQVA 1UEAB 2B2VA 1WTQA 3X3MA 4IFDG 2EY6A 4K8JA 4WRDA 1STHA 3BDLA 4CJ1B 2LY7A 3TBIB 2EJFC 4B9WA 1ZXTA 1JB3A 2NWGA 3K58A 3MA2B 3MWYW 3QB3A 2V4DA 2OF1A 5ELCA 3KLRA 1Y1WB 1EY7A 3J80L 1GUNA 4ZQ3A 1G6ZA 3MXUA 4Q5VA 1U4MA 5EBDA 2LFNA 1KLGD 1SNPA 3GTLB 3PUVA 1STBA 4KKUA 1MI2A 4G57A 2N88A 2BDNA 2ICEC 1B4OA 1F2MA 2F4IA 2TMPA 3FMCA 1SMYD 2IWHA 3H91A 2XRSD 1EY4A 1NCVA 5EJWA 5DM63 4V0BA 1ML0D 3A54A 3A55A 4K5WA 1LTBD 1TWFB 2J7ZA 2F0FA 5D65A 5JVH3 5CGKA 1X3PA 3S1NB 2IW3A 1Z47A 2Q8RE 5FLXE 2VUMB 3S1RB 3RZOB 1KNEA 3K6OA 4ZLTF 1EEID 3SK5A 5J39A 2NVYB 4J8QA 4FF3A 1STNA 2WKCA 2NVQB 3DHQA 3PV0A 4JBWA 3MTSA 4BWGB 3J81L 1ONLA 3U9SA 2WACA 4K6LA 5M5WB 3LWUA 4KD4A 1EY9A 5DNFA 2EXZA 3NWSA 4C3HG 1B2TA 5EPKA 2FHTA 2EYFA 1HCZA 4BY7B 4XIGS 1S5FD 4H13C 4MN3A 1LT3D 1I6VC 1JC7A 5CV4A 2FFKB 1DZ1A 1AP0A 2K05A 1WTOA 2J4XA 5JVG3 3OMGA 3BYYB 3C2PA 1KDCA 2VB3X 4BA2I 1F9SA 2VB2X 1DXMA 4U68A 3QOJA 2B39A 5CV5A 2NVTB 1I3QB 3SK6A 1F9PA 2EJMA 3HEJA 1TT2A 2A5HA 1PRTC 2I46A 1O80A 3R8BA 2A69C 5ELDA 3QJYA 3GQBA 3D3RA 3OWEB 3WOEA 2K7VA 1CHQD 4KKSA 1SNDA 1GHKA 1HQRD 2NBFA 4FP5D 4OO1G 3FKIB 4F8MA 2O5IC 3HGBA 3TP6A 1PFNA 3GTOB 1GUOA 4RKBA 3MC0B 1LTAD 2F3WA 1JORA 3Q22A 3SVMA 4LMQD 4B08A 5DEHA 3D31A 4QF4A 3NTIA 3T16A 3JAME 2Z8LA 2EJGC 3EVQA 3TN2A 5FK9C 3FPUB 2D2CC 4KN7C 1PTOD 2FMMA 2LKVA 4IUUA 4R8NA 1FGBD 1KTKA 3NP8A 2F0NA 2QEJC 4PQXA 1RDPD 5KYLA 3HOYB 1EIGA 2RVLA 2E2IB 3KBGA 4H7BA 1QNUA 1BQQT 2BE5D 1U4PA 4A93B 3S15B 2WB1B 1I4XA 3E5SA 3S2DB 1GXDC 3K5MA 2MP1A 1TY2A 1SYBA 3MZ5A 2PZTA 4DK0A 2JA8B 2O4XA 3K57A 2BDOA 5KNDA 2F0OA 5FLXL 2L9HA 1E2ZA 1SJED 1R9TB 4G4KA 3A8KE 1PTOF 3H0GB 4RA8A 1OXXK 4CGYB 5C5MA 1O7ZA 2A6EC 1STGA 2B2YC 1B9NA 2B2WC 2WAQB 3CHBD 4XTCS 1S5CD 1TIID 1Q1EA 4XYOA 1VF5C 5ELEA 2K04A 1CZGA 5I2YA 3I4NB 5BN5A 4L6TB 3NXWA 2E76C 2PCFB 4DXFA 4R8IA 4WFN3 4DA2A 2EOTA 1G8ZD 1Q8IA 1A3VA 1ZYRC 1Z7TA 3SHLA 2RSOA 3T56B 1G291 4EGVA 1I4RA 3A56A 4TRDA 1VDZA 3TMEA 1NR4A 1SDFA 4FYDA 3M3YB 3OOCA 4FNFA 1D1KA 3I72A 1RD9D 3I3CA 3W2DA 4ZUIA 1Q90A 3NBHA 4C3JB 4K5VA 1II3A 4E6IA 3S2HB 1XX8A 1JQYD 4KMUC 2AQ3B 4CKBA 5T1GA 1YNNC 3VR2A 2IPKD 5C4ZA 4UDUC 1F2YA 5HURA 2KVMA 2GA4B 4RKLA 5EQ0A 4NDXA 1SBBB 5IT9E 3NWTA 1PTOB 4C3IB 1TWAB 1EU4A 1YNJD 1OO9B 5NUCA 1WTVA 2B2UC 1H9KA 1HUMA 3MAQA 5M9OA 2R92B 3SE0A 2DNEA 4RGOS 3PO3B 5C4XB 5IOCA 4EQPA 5I2XA 3NSWA 4K14A 3PUZA 2Q8TA 4WJWA 3V05A 3JAML 3GTMB 4M8AA 5M3FB 1EYCA 2SEBD 2JEBI 2B2UA 1DM0B 4LK1C 4CHTB 2CVRA 4A3GB 2EY2A 1ZEQX 4S3SA 3VR4A 2ZT9C 2D62A 1J9OA 4IUTA 3IAYA 4K5XA 1HTPA 2F0JA 4BS9A 1GUTA 1SYEA 1HQMC 4PMCA 5EGTA 1DYQA 5K36H 2MHVA 4F87A 2X69A 1EOTA 4PMBA 3TP8A 4IN3A 4CJ2C 4ZK9B 3K5NA 2R3ZA 1U9RA 3X3NA 1DOMA 3DMUA 3OIQA 1PDQA 2E2HB 1LTGD 1ESFA 2JSOA 4CBVA 3IL8A 5I9OA 4B9XA 1HFNA 2KCNA 1MGSA 5IGDA 5D14A 1M4VA 4BBRB 3I8ZA 4X3SA 2WKDA 4TQUS 1JICA 3SEBA 1SYDA 1DONA 4IUVA 2B2TC 2MGSA 2KEDA 4F88A 1SNMA 3T51B 3QOLA 4J1MA 5T1IA 2JEAI 3M7GA 1SE3A 2YYZA 4N9PA 4C3IG 1B3AA 3NHHA 2XNAC 4QCLA 2R6GA 3Q24A 1IHZA 2G9DA 1CFMA 5A2QE 3D4RA 1SNQA 2Z4HA 5EKKA 5DM73 2A69D 1E0BA 5COYA 1RCVD 4KY7A 5I6WA 3IFDA 3PO2B 3M4YA 1A3TA 2HDLA 1RHPA 2JXMB 1EFID 1JWMD 1QJOA 4NKLA 1A2UA 1SYGA 4IALA 1ZKOA 1TR5A 3GO5A 3MXGA 1XTCD 5HGTA 3SR1A 2XWBB 3I91A 2QF7A 1QWYA 1D5XC 1PFMA 1KDAA 1FR3A 3PUXA 3R2IA 2PMZB 2SNMA 2WINB 3TZUA 3BG3A 4DFAA 3MFGA 3HP3A 1WTPA 2EPBA 3N52A 3PMFA 5EKLA 1PRTF 4XQJA 3P75A 4ABNA 4A3BB 1EQTA 5FOBB 1RF2D 1D5MC 3I90A 1CA6A 2XIWA 3HOUB 1JOQA 2O5JC 4C56C 4DU9A 1EY8A 5JEAJ 5C3EB 3TSSA 1OXTA 4DAVA 1ILPA 1C48A 1QE6A 4XDXA 1O7LA 1IYUA 3I4MB 2L11A 1VMCA 2RDHA 2JA5B 4Y7NB 3QWNA 5E4XA 4QMGA 3AB9A 2A68D 3BZDB 3AU7A 4XQQA 2JP1A 1K8OA 3NQIA 1SNOA 1SNCA 2F0GA 3H3VC 4K8IA 2A6ED 4K6DA 1AFPA 1CZWA 1F9RA 3VYTA 5BN3A 5CMDA 4I65A 3GP7A 1TS2A 4XXEA 4HMIA 4FXDA 4RHRA 1A6XA 1Y8NB 1IW7C 2L0CA 1PRTB 3OIPA 3DUZA 2HQEA 2E2DC 3FRPB 1EY6A 4DF7A 1SAPA 3UI2A 1PXUA 3KF8A 1ZYRD 3HZXA 3BVGA 5IGBA 1SFOB 2L5TA 3Q0AA 4Z9CB 1RJTA 4G7ZC 2A74C 1F2LA 2F0PA 4HTHA 2NB0A 5CV9A 3EFXD 3KLSA 4FO2A 1C4QA 1VF7A 5E4WC 4ZKBB 3T53B 1IYVA 1VMPA 1L0YB 1KABA 2WP8J 4KKTA 5JPNC 1XWEA 1C8CA 2BCOA 4RFBA 1HTLD 2JA7B 1RTNA 1FYCA 1T5XD 3DEPA 3NPPA 2XWJB 2D9UA 4XT1B 3GTGB 4BA1I 3FDTA 2PO4A 3M85A 4NP5A 1LO5D 5C4JB 5KYIA 2RDFA 2AUJD 2F0LA 2RA4A 5M5XB 4LAAA 1NR2A 4HSPA 4N9TA 2HDMA 1S5DD 1GHJA 1UNSA 2NTTA 3SDZA 4QB4A 2NUCA 5M5YB 1BCPC 2EYHA 4KD3A 2OT2A 1SJHD 5I6YA 1TS5A 3IKJA 2M9VA 4X3TA 4WORA 2AWOA 4O42A 3M4OB 2RDGA 1EL0A 1CHPD 3K5OA 1WCMB 2RKSA 5EKIA 2F3VA 1V8QA 1HA6A 3EROA 4DAPA 1W6KA 1I4PA 1EYAA 1QILA 1DJRD 1MBYA 2IX3A 1D6EC 3I70A 4F7XA 1PZKD 2CW0C 5TSSA 2KJXA 2XN9C 1DOKA 2M2LA 5J22A 5JEAG 5G3LF 2BOSA 3S16B 3E6ZX 3PIP3 2A6HC 1TQOA 1CQFA 2B2YA 1BR9A 2B2WA 4A3IB 2KCCA 3MXPA 4IZ8A 4A3FB 4K2KA 2AQ2B 3CRKC 4NW2A 1B53A 2ENBA 1EY0A 3DWPA 1WVLA 1JOKA 3D6WA 3M7NA 3QIAA 1EZ8A 3OW7A 4IUNA 5IGFA 3K59A 5ELFA 4ODGA 3LNNA 1ESRA 1STAA 5ELBA 4OL7A 4ID6A 4G7OC 3SXHA 5I4DA 5C0XI 2K1BA 2M00A 3ND9A 2NN6I 1HHVA 1PLFA 3RUZA 1X3QA 4A3MB 4FXKC 1W6JA 4KJNA 5I9PA 2ID0A 4A3KB 2EZVA 3C3LA 3DWAA 1JCKB 3KLSX 2F0QA 1VCIA 3H94A 2ZXRA 4O1NA 1H9MA 4IFDI 2LS01 1DCZA 1SXTA 1LT5D 2EVBA 4LJZC 4DK1A 1ET6A 4PMWA 3J80E 1D1IA 3RLFA 3K7AB 4DXGA 2OEOA 2X6GA 5CBAE 1MSGA 3BVMA 2E2JB 4AYBB 4RGNA 4HCSA 3S14B 2KA7A 3KUPA 2IT1A 1SE4A 3S17B 1STEA 5C4HA 3O13A 5AFWA 3LWEA 2PW7A 5CV7A 5FKAC 4CKEA 3NUCA 5C44B 2D5DA 2K5DA 5CV8A 4JK1C 2LMCB 4HCEA 1FNVA 3CRLC 5KRUA 5CYUA 1I50B 1OXVA 4PNYA 4GZYC 1GUSA 4XYQA 2RQXA 3OPOA 2OXPA 4PV1C 5CORA 2A73B 1K8MA 3OHXC 2KHSA 1V1PB 4HR7B 4YIJA 2H4OA 2PQEA 3MVVA 2O2LD 1GUWA 4XQNA 3NQTA 2XVSA 1HXYD 5FO7B 4K2LA 3S9WA 1ENCA 1RTOA 2KECA 4HAEA 2YU9B 4QIWB 1AW7A 3R3OA 3J7AF 1F2ZA 5D3IB 3VA5A 5C0XH 1G2SA 4P2CB 3V96A 1B44D 2NN6H 4FF4A 5KGUA 5K36G 4HSVA 4KJOA 2ZXOA 1TS4A 2E75C 4KHVA 2J0TD 3EJIA 3HKZB 1GUGA 3VYRA 2F0KA 5EPJA 1JE4A 1TU2B 5JOBA 5IGGA 4IFDH 2EY5A 2RSNA 2Z4IA 4X3KA 5KNCA 1QCBD 1A15A 1UUPA 3VR3A 3CQZB 1DOLA 1JWSD 2EYJA 5LHY1 2R7ZB 2CQAA 4DN4M 3GTJB 1BXTA 2K5WA 1PTOH 4EQNA 2QILA 4TSSA 3R93A 1EIHA 2IL8A 1TKWB 3CKIB 3FEWX 2HCCA 1SE2A 3OMCA 1EY5A 3Q6SA 3OSOA 1ENAA 3S1MB 1IW7D 1PRTD 2B2TA 4ULLA 4RHSA 1CTMA 3VR6A 1Q3LA 1S5BD 1F77A 1YNJC 4RWSC 1ET9A 4OHJA 3RMHA 2F1MA 1IKMA 3BDCA 5IGCA 2SOBA 4OO1I 2IX0A 3VR5A 5IT9L 4I7ZC 4Q0FA 3W3AA 1H9JA 1KDBA 1V43A 3FPPA 3GTPB 1EYDA 5KEEA 1STYA 1QB5D 2PYKA 3HS0C 3ND8A 1QOHA 4NMZA 3R2TA 3D6CA 1AZQA 2PW5A 2IJ0A 1IKLA 1E2VA 5F2DA 2HUGA 4KHZA 2L55A 1JR0D 1Y8OB 2F0DA 5JAVA 3J7AV 4L8JA 1PZJD 4CJ0B 2SDFA 3SK8A 3U9OA 1Y8PB 4ZKCB 1S4ZA 4C2MB 1LABA 1Y1VB 5J1ZA 2SNSA 3N6RA 1BF4A 4H0LC 1NAPA 1CT1D 3BVZA 1BCPD 4L63B 3ERQA 2AWNA 5LL6X 3P7JA 2K32A 3ZYYX 1LTID 1LTSD 3DXJC 1A2TA 1WTXA 5CV6A 1RODA 1BUVT 5EPLA 3TP7A 4FF2A 4RCNA 2QCPX 1V1OA 3URYA 3G6JB 1B50A 1WTRA 4U673 4BBSB 1CK1A 3TDQA 1HA5A 2K03A 3A8JE 1NUCA 1JOOA 2EYLA 4FVMA 4EVOA 2F0UA 1CI3M 3HG9A 3NBIA 1X32A 2B8FA 2CW0D 5IIFA 3J7YW 2FINB 1DD2A 1PMRA 4OIJA 4DAYA 2XSCA 1M8AA 1SEBD 3ITPA 1BCPF 1L0XB 2ZXPA 2BA1A 2A6HD 2DN8A 2F0VA 4OO1H 3VYUA 1SSOA 3EQLC 4FXGC 1FNWA 3P20A 4XT3B 2F0EA 5C5LA 2PZWA 2X6LA 5KNBA 1OXSC 3C1EA 4BY1B 3DWQA 1WD0A 2TSSA 1GJXA 1B1ZA 4ZYSA 1J8IA 2DY8A 2R61A 4EQOA 3DEOA 4HEDA 2NZ1D 1U4RA 1KLUD 5E1FA 5A2QL 3HOWB 2KQ3A 3HOXB 1LV9A 1FD7D 4OIKA 3P1HA 1HRJA 3E0JA 1YNND 3HRZC 1QG7A 4A3EB 3S1QB 3TZDA 3A7AB 3LX0A 2NYZD 1LACA 5JJZA 1SMYC 4V190 4DNRB 5K5PA 3HOZB 4MHEA 4IURA 5DAUA 1XYIA 3BYTB 3GTKB 4J6HA 3OWFA 1I4HA 1O7YA 2BA0A 4X3UA 3QG1A 1KNAA 2K01A 3T13A 5ISRA 3VYSA 5CC4A 4KK7A 4H44C 2Y0SB 5G3LD 3PUYA 3L9AX 3MXNA 3MEHA 1BCPB 2JYOA 2IX1A 4IQZA 2F0HA 3K0YA 4MIUA 2C9OA 5FO9B 3KBXA 4RH6A 1WD1A 3V2TA 1TVXA 2DY7A 2K28A 5FO8B 2JA6B 2F0IA 1QNKA 4ZUJA 4ILWA 5C3WA 1RKNA 1H9RA 1S5ED 4RGMA 1E2WA 3RZDB 4DGZA 2MUYA 3L3OC 3GTQB 2K6AA 1TS3A 1AZPA 1EEFD 4IUPA 3SK4A 1GOZA 3C1FA 5JEAH 2F0MA 2A68C 3RD4A 2L1BA 3NE5B 3GV3A 2R93B 2I07B 5A35A 2MJ8A 1HFGA 2G9HD 5C0XJ 3Q23A 1AEXA 3MFYA 1WTWA 2HCIA 4A3DB 5KIXA 1H9SB 1MSHA 1I4GA 1BO0A 5JPMC 1EWCA 1R4PB 2L4NA 5IODA 3G7LA 1EU3A 3L7ZC 5M3MB 1JWUD 1ICWA 1F9QA 2PNRC 4IFDJ 1Q1BA 5CR3A 3BDOA 2XRQD 2F03A 2VNUD 2AQ1B 4QUCA 4M1UB 1H9SA 2DNCA 3I73A 4IUQA 3MHBA 2PZUA 2B63B 4R9WA 3EA6A 4RGTA 2K33A 1TY0A 4KY5A 1CM9A 3GV6A 1PFBA 3HOVB 1Z6HA 1SYCA 1O78A 4KN4C 2F0TA 1BOSA 1HUNA 2Z1CA 1UAPA 2EYPA 2F0SA 2EYMA 1ENFA 4KI0A 2NTSA 1CQVA 4QUFA 1Y69U 1PZID 2CHBD 2RBMA 1G91A 4FF1A 2JE6I 1A3UA 1Q12A 3VA7A 1TWCB 1MD2D 2MPMA 5EBCA 1AN8A 4HMJA 4ZAIA 1D5ZC 1PTOC 4HN7A 3D4DA 1T5EA 2C5CA 3CU7A 1BBXC 1BNZA 2NVXB 2EYOA 3T4AC 1D2BA 3BS1A 2FMCA 2E74C 3D8GA 1LT6D 3C46A 3PUWA 1HPCA 5C6AA 1LTTD 1EWHA 3A7LA 4CKCA 5D3DA 1U4LA 3DM1A 1R4QB 2BE5C 2KUMA 4KY6A 2Q8IB 3WDNA 3H6MA 1XXGA 4KTAA 4C1NI 3IFTA 4RAUC 5IGEA 4KV6A 3F2UA 4ME5A 5E3FA 3WOFA 5BN4A 2H1EA 1K83B 4A3JB 4UAIA 3H09A 3J81E 1CA5A 1ILQA 4C1NK 5LL6S 5C3XA 2EE1A 5CBEE 4TKOB 3QO2A 1TWGB 1TWHB 2L12A 2VXWA 1FNUA 1V1PA 3I4LA 1KAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JOB A;  1RKN A;  2EY2 A;  3SHL A;  5IGG A;  5J22 A;  2F0D A;  4ZQ3 A;  4S3S A;  5JAV A;  4N9P A;  2F0E A;  3NK9 A;  2EY5 A;  5C5L A;  2PZW A;  3NHH A;  4DGZ A;  3OMG A;  2PW7 A;  1KDC A;  1SNP A;  2RBM A;  5CV7 A;  4R8N A;  1IHZ A;  4TRD A;  1A3U A;  3C1E A;  3NP8 A;  4K5X A;  3TME A;  3NUC A;  2F0N A;  2F0J A;  1KAB A;  1TQO A;  1EZ6 A;  1SNQ A;  1STB A;  2EYJ A;  3SK4 A;  3SK8 A;  4HMJ A;  3U9O A;  5EKK A;  4G57 A;  3C1F A;  2F0M A;  2F0W A;  4EQN A;  5CV8 A;  1SYE A;  4H7B A;  4ZUI A;  3D4D A;  5J1Z A;  2SNS A;  3MXP A;  4IZ8 A;  4KY7 A;  5I6W A;  3QOJ A;  4K2K A;  4QMG A;  1A3T A;  4PMC A;  1F2M A;  5CV5 A;  5EGT A;  4EQO A;  4K5V A;  3OMC A;  1II3 A;  2ENB A;  1EY0 A;  4E6I A;  1EY5 A;  4NKL A;  2EYO A;  5E1F A;  1A2U A;  1JOK A;  3ERQ A;  3SK6 A;  3OSO A;  5KRU A;  4NP5 A;  1SYG A;  1AEX A;  4PMB A;  3HEJ A;  4IAL A;  2KQ3 A;  1TT2 A;  3TP8 A;  1EZ8 A;  1TR5 A;  1A2T A;  5KYI A;  1ENA A;  2RDF A;  4IUN A;  1SNO A;  1U9R A;  2F0L A;  3E5S A;  1EY4 A;  1SNC A;  2F0G A;  1SYF A;  3D8G A;  3P1H A;  4LAA A;  5CV6 A;  5C4Z A;  1F2Y A;  4PNY A;  5KIX A;  4K8I A;  3DMU A;  1SYB A;  3MZ5 A;  5HUR A;  4ODG A;  2PZT A;  1STA A;  2EY1 A;  2O4X A;  4N9T A;  4OL7 A;  2OXP A;  5C6A A;  4ID6 A;  4K6D A;  2F0O A;  3SR1 A;  3TP7 A;  5HGT A;  4RKL A;  5IOD A;  4NDX A;  3TP5 A;  4K5W A;  3LX0 A;  3SXH A;  3D4W A;  2KHS A;  4QB4 A;  2F0F A;  4YIJ A;  2NUC A;  2QDB A;  5CGK A;  2M00 A;  1KDA A;  1SND A;  2EYH A;  4I65 A;  4KD3 A;  5K5P A;  5I9O A;  5DAU A;  4KY6 A;  4HMI A;  2PQE A;  3MVV A;  5I6Y A;  3RUZ A;  1NSN S;  1NUC A;  3BDC A;  1JOO A;  2SNM A;  3NQT A;  5CR3 A;  1EQV A;  4F8M A;  5NUC A;  5IGC A;  2EYL A;  5IGF A;  4J6H A;  3SK5 A;  3OWF A;  4K2L A;  2SOB A;  3H6M A;  4KJN A;  4WOR A;  3TP6 A;  5C5M A;  4B9X A;  4DFA A;  4KTA A;  5I9P A;  5J39 A;  1STG A;  5IGD A;  5M9O A;  4EVO A;  2F0U A;  4RKB A;  5IGE A;  1STN A;  1ENC A;  2EY6 A;  2HQE A;  4KV6 A;  2F0Q A;  2RKS A;  3MHB A;  5IOC A;  4ME5 A;  3DHQ A;  2F3V A;  3T13 A;  3PMF A;  2PZU A;  5E3F A;  5EKL A;  4EQP A;  2F3W A;  3ERO A;  5KYL A;  5ISR A;  1JOR A;  4K8J A;  1KDB A;  5CC4 A;  1EY6 A;  3P75 A;  3R3O A;  5IIF A;  4WRD A;  1STH A;  3BDL A;  5DEH A;  1EYA A;  4DF7 A;  3S9W A;  2WAC A;  1F2Z A;  4KY5 A;  4KD4 A;  3VA5 A;  4K14 A;  1EYD A;  4B9W A;  3MEH A;  1EY9 A;  3HZX A;  1SYD A;  2F0H A;  5IGB A;  5KEE A;  1SYC A;  2EXZ A;  1EYC A;  5KGU A;  4QF4 A;  4MIU A;  1STY A;  3ITP A;  2F0T A;  2PYK A;  2OEO A;  3T16 A;  1SNM A;  4KJO A;  1JOQ A;  5C3X A;  3NXW A;  3QOL A;  3QB3 A;  4NMZ A;  4F7X A;  2OF1 A;  3EVQ A;  4DU9 A;  1EY8 A;  3V2T A;  2F0P A;  4HTH A;  4KHV A;  2EYF A;  3D6C A;  3EJI A;  2EYP A;  2F0V A;  4J1M A;  2F0S A;  2PW5 A;  5CV9 A;  2F0K A;  2EYM A;  2F0I A;  5CV4 A;  2LKV A;  4ZUJ A;  5F2D A;  5C4H A;  1EY7 A;  1A3V A;  5C3W A;  1KAA A; 
#chains in the Genus database with same CATH topology
 1IYJ B;  2ICI A;  5M3M G;  1J6Q A;  1I4Q A;  1N36 Q;  3NK9 A;  2KEE A;  2PPB C;  1B9M A;  1S3O A;  4X62 Q;  3PIO 3;  3AMU A;  4RCO A;  3M3Y H;  1I6H B;  4RMF A;  4DNT B;  4L5Q A;  1EZ6 A;  3K5L A;  3UDF A;  3I4N G;  2F0W A;  2ZTC A;  3A8I E;  4GOP A;  1PH8 A;  1LLR D;  2QKI C;  2B8G A;  1PYW D;  3ONA B;  1LTR D;  2EDG A;  2KOL A;  4K0K L;  1IL8 A;  1OXU A;  1A0I A;  2WII B;  3PSI A;  3GD7 A;  3NTK A;  3NTH A;  4A3M H;  4PG3 A;  1LT4 D;  2B63 G;  4AIM A;  2AUK A;  4C3H B;  4ZRZ A;  2WV6 D;  4A3K H;  1YZ6 A;  5IE8 A;  1XMO Q;  4LF4 Q;  1G2T A;  2B2V C;  1BDO A;  3BZC A;  4L5R C;  1SYF A;  4DV2 L;  4A3C H;  3HOV G;  4JI1 L;  2K5Q A;  2FJ2 A;  5C0X G;  4G7H C;  2EY1 A;  3FVQ A;  2UUA Q;  2NN6 G;  4P74 A;  3KK7 A;  3TP5 A;  2N55 A;  3D4W A;  3A5U A;  1WYD A;  3RR5 A;  2QDB A;  4OGQ C;  4GN5 A;  3PIP A;  2OCE A;  4C3J G;  1NSN S;  3K7A H;  1EQV A;  2E5L Q;  2UUC L;  1UEA B;  2E2J H;  3PO3 H;  2VL6 A;  5C4X H;  2B2V A;  1WTQ A;  3X3M A;  3BJU A;  4IFD G;  2EY6 A;  1SRO A;  4K8J A;  4WRD A;  1STH A;  3BDL A;  3GTM H;  4CJ1 B;  2LY7 A;  3TBI B;  2EJF C;  1HNX L;  4B9W A;  1ZXT A;  2VZA A;  1JB3 A;  4IPD A;  2NWG A;  3K58 A;  2MO0 A;  3MA2 B;  1U0L A;  3MWY W;  3QB3 A;  2V4D A;  2OF1 A;  3CP0 A;  2R92 G;  1N8R C;  1K0S A;  5ELC A;  4A3G H;  3KLR A;  1MHW C;  1VQM A;  1Y1W B;  1EY7 A;  3J80 L;  1XNR L;  1GUN A;  1N32 Q;  4ZQ3 A;  1G6Z A;  4BXX H;  3MXU A;  4Q5V A;  1U4M A;  5EBD A;  2HT1 A;  2LFN A;  1HZB A;  1KLG D;  1SNP A;  3GTL B;  3PUV A;  5M3F G;  1STB A;  4KKU A;  1MI2 A;  4G57 A;  3NEM A;  4YCW A;  1H95 A;  1PH3 A;  2N88 A;  2BDN A;  2ICE C;  1MIU A;  1B4O A;  1F2M A;  2F4I A;  2JQO A;  2TMP A;  5IYB H;  1CKM A;  3FMC A;  1SMY D;  2Y0S E;  2YV5 A;  4YY3 Q;  4POG A;  2IWH A;  4A3J G;  3H91 A;  2XRS D;  1EY4 A;  1NCV A;  2ZJP A;  5EJW A;  2E2H H;  5DM6 3;  4YWK A;  4V0B A;  2OTJ A;  1ML0 D;  3A54 A;  3A55 A;  4K5W A;  1LTB D;  1TWF B;  2J7Z A;  2F0F A;  5D65 A;  5JVH 3;  5CGK A;  1X3P A;  3S1N B;  2IW3 A;  1Z47 A;  1VQP A;  1BKB A;  2Q8R E;  5FLX E;  2VUM B;  2ZTD A;  3S1R B;  3RZO B;  4AQY Q;  1KNE A;  3K6O A;  2MO1 A;  1EWI A;  3G4S A;  3A0J A;  4JC0 A;  3JAM i;  4ZLT F;  1EEI D;  3SK5 A;  1AE3 A;  1J5E L;  4BBR H;  5J39 A;  2NVY B;  4J8Q A;  4FF3 A;  1PA6 A;  1STN A;  2WKC A;  2NVQ B;  1SN8 A;  1KIX A;  3DHQ A;  3PV0 A;  4JBW A;  3MTS A;  4BWG B;  1K3B C;  3VDY A;  1XPR A;  3J81 L;  1ONL A;  2I0Q A;  1VQ6 A;  3U9S A;  2WAC A;  4K6L A;  5M5W B;  3LWU A;  4KD4 A;  3HKS A;  1EY9 A;  4LF5 L;  3CQZ H;  5DNF A;  2EXZ A;  3NWS A;  3GTJ H;  4C3H G;  1B2T A;  5EPK A;  1NJI C;  2FHT A;  2EYF A;  1HCZ A;  2Q2T A;  1QVC A;  4XIG S;  4BY7 B;  1S5F D;  4H13 C;  4MN3 A;  1LT3 D;  1I6V C;  1JC7 A;  5CV4 A;  2R7F A;  2FFK B;  1DZ1 A;  1AP0 A;  2K05 A;  1WTO A;  4IOC A;  2J4X A;  4IOA A;  2Q2I A;  5JVG 3;  3OMG A;  3BYY B;  3C2P A;  1KDC A;  3MEF A;  2VB3 X;  4BA2 I;  2EIF A;  1V9P A;  3E3X A;  1F9S A;  2VB2 X;  1DXM A;  4U68 A;  3QOJ A;  2ZM6 L;  2B39 A;  5CV5 A;  1JMC A;  5IP9 G;  2NVT B;  3KYH C;  1PYB A;  4JI0 L;  4DUZ Q;  1I3Q B;  3SK6 A;  1F9P A;  2EJM A;  3HEJ A;  1TT2 A;  2A5H A;  5IWA L;  1PRT C;  2I46 A;  1QZG A;  1O80 A;  3R8B A;  2A69 C;  5ELD A;  3QJY A;  1PH7 A;  4DV0 L;  2G5D A;  4LW1 A;  3ULP A;  3GQB A;  3D3R A;  3OWE B;  4WJ4 A;  3WOE A;  2K7V A;  3GTP H;  1EUJ A;  1CHQ D;  4KKS A;  1SND A;  3CCE A;  1GHK A;  1HQR D;  4B3S L;  3PO2 G;  2NBF A;  4FP5 D;  2LSS A;  4OO1 G;  1RIP A;  1Y1W G;  3FKI B;  4F8M A;  1X3G A;  4JW0 A;  2O5I C;  3HGB A;  4WJ3 M;  3TP6 A;  4JBJ A;  3UE0 A;  1PFN A;  1GM5 A;  3GTO B;  1GUO A;  1S72 A;  4RKB A;  3MC0 B;  1LTA D;  2F3W A;  2F4V Q;  3Q22 A;  1JOR A;  3SVM A;  4LMQ D;  4B08 A;  5DEH A;  4LF6 Q;  4DV6 L;  3D31 A;  3J80 c;  2ATW A;  4N8F A;  4LFC L;  3HOU H;  1K0R A;  4QF4 A;  4DR1 Q;  1CUK A;  3NTI A;  3T16 A;  4C2M H;  3JAM E;  2Z8L A;  1Y1V H;  2EJG C;  1PH5 A;  3EVQ A;  3TN2 A;  5FK9 C;  1IZ6 A;  1E22 A;  1HNZ Q;  3FPU B;  2D2C C;  5C3E H;  4KN7 C;  1PTO D;  2FMM A;  2LKV A;  2Z6K C;  3T1Y L;  1JT8 A;  4IUU A;  1WFQ A;  4A3B G;  1XMQ L;  4DV1 L;  1T9H A;  1GD7 A;  5DLQ E;  2VUM G;  3I4M H;  5GAE C;  4R8N A;  1FGB D;  1KTK A;  3NP8 A;  2F0N A;  2QEJ C;  3QR8 A;  4PQX A;  1RDP D;  5KYL A;  3HOY B;  1N34 L;  1EIG A;  2RVL A;  5IYD H;  3T1H L;  2E2I B;  3KBG A;  1NNX A;  4H7B A;  1WTH A;  4BBS H;  1QNU A;  1L0W A;  4JI5 L;  1BQQ T;  5J3B A;  2BE5 D;  4DUY L;  1U4P A;  4A93 B;  3S15 B;  2WB1 B;  1I4X A;  3A74 A;  3E5S A;  1W2B A;  3H3V H;  3M4P A;  3S2D B;  2DGY A;  1GXD C;  3K5M A;  2MP1 A;  1TY2 A;  1SYB A;  3MZ5 A;  2PZT A;  4DK0 A;  2JA8 B;  2O4X A;  3K57 A;  2BDO A;  5KND A;  2ALY B;  2F0O A;  5FLX L;  2VQE L;  2PI2 A;  4JI2 Q;  2L9H A;  4DR6 Q;  2CH4 W;  1E2Z A;  4JOI C;  3J81 c;  2XGT A;  5BR8 L;  1SJE D;  1R9T B;  4G4K A;  3A8K E;  4BY7 G;  5JJK A;  1PTO F;  4IPG A;  3I7F A;  4DR2 L;  1C7Y A;  3H0G B;  4RA8 A;  1O7I A;  1OXX K;  4CGY B;  1IBL Q;  4DV3 L;  5C5M A;  1O7Z A;  3KDF B;  2A6E C;  1STG A;  2B2Y C;  1JJG A;  1B9N A;  2B2W C;  2WAQ B;  2RHQ B;  1XNQ Q;  3CHB D;  1X3E A;  4UY8 C;  5HGQ A;  4XTC S;  1B70 B;  1S5C D;  1TII D;  4PZ6 A;  1Q1E A;  2JK8 A;  3KOJ A;  4P72 A;  4XYO A;  2VQF L;  1VF5 C;  3KJO A;  1Q81 C;  1E3P A;  3PQI A;  5ELE A;  1SFO H;  4NXN L;  1EIY B;  2K04 A;  4DK6 C;  1PV4 A;  1CZG A;  5I2Y A;  4BY1 H;  4DR4 L;  2ZJR A;  1Y14 B;  3I4N B;  5BN5 A;  4B3M L;  3KDF A;  3PGZ A;  5IYC G;  4L6T B;  3NXW A;  2ES2 A;  2E76 C;  5IY0 A;  1IBK L;  2PCF B;  4DXF A;  4R8I A;  2OQK A;  1UE7 A;  4WFN 3;  4Y52 H;  4DA2 A;  3NBH B;  2EOT A;  1G8Z D;  1Q8I A;  1M90 C;  3TEH B;  1A3V A;  5LMU L;  1ZYR C;  1Z7T A;  4JI6 Q;  3HOW H;  1A62 A;  2OQ0 A;  5GRO A;  3SHL A;  3HOX H;  2RSO A;  3T56 B;  3CCL A;  1G29 1;  1YHB A;  4EGV A;  1VQ5 A;  1I4R A;  1IBM Q;  1LTL A;  3A56 A;  4TRD A;  1VDZ A;  4N8X 1;  3TME A;  3S1Q H;  3FKI G;  1NR4 A;  1SDF A;  4FYD A;  3M3Y B;  3OOC A;  4FNF A;  2JA7 H;  2UXB L;  1D1K A;  4MTN A;  3I72 A;  1RD9 D;  3I3C A;  4ZUI A;  3W2D A;  3RNU A;  3HOZ H;  4QGU A;  5IP7 G;  1Q90 A;  3NBH A;  4C3J B;  3G71 A;  4UHV A;  3M9B A;  4K5V A;  3GTK H;  1II3 A;  4E6I A;  3S2H B;  1I5F A;  3RN2 A;  1XX8 A;  1JQY D;  4KMU C;  2AQ3 B;  4CKB A;  2I5M X;  1N36 L;  4JYA Q;  5T1G A;  1KAW A;  1YNN C;  4X62 L;  3VR2 A;  2IPK D;  5C4Z A;  4UDU C;  1F2Y A;  4LWC A;  3H15 A;  5HUR A;  2KVM A;  2GA4 B;  3UDG A;  4RKL A;  5EQ0 A;  4LFB Q;  4NDX A;  3D0F A;  1SBB B;  2QGQ A;  5IT9 E;  3NWT A;  1PTO B;  4C3I B;  3CMA A;  1TWA B;  2D0P A;  2I5L X;  4QY7 A;  1EU4 A;  1YNJ D;  2HIX A;  2LXK A;  4DR3 Q;  1OO9 B;  5NUC A;  3STB C;  3M4O H;  1WTV A;  2B2U C;  1XMO L;  4LF4 L;  4NPS A;  2V1C C;  1IL2 A;  1H9K A;  1HUM A;  3MAQ A;  5M9O A;  2R92 B;  3SE0 A;  4B3R Q;  2DNE A;  2JA6 H;  4RGO S;  3PO3 B;  5C4X B;  1X56 A;  5IOC A;  2UUA L;  4EQP A;  5I2X A;  4A3L H;  1KD1 C;  3HOY G;  3W1B A;  1E1O A;  3NSW A;  3LGJ A;  4LNQ A;  4YCV A;  3RZD H;  2LXJ A;  4K14 A;  3GTQ H;  3PUZ A;  2Q8T A;  4WJW A;  3V05 A;  3JAM L;  3GTM B;  4PZ8 A;  4M8A A;  5M3F B;  4R4C A;  2E5L L;  1EYC A;  2H5X A;  2RF4 A;  2SEB D;  2JEB I;  2B2U A;  1DM0 B;  4LK1 C;  4CHT B;  2CVR A;  1NE3 A;  2R93 H;  2JA8 G;  1N33 Q;  1FJG Q;  4KLK A;  4A3G B;  2EY2 A;  1ZEQ X;  4S3S A;  3VR4 A;  4A3D H;  2ZT9 C;  2Q2U A;  3TS2 A;  2D62 A;  1J9O A;  4IUT A;  3IAY A;  4K5X A;  2YTY A;  1HTP A;  2F0J A;  4BS9 A;  4CDD C;  1TXY A;  3E9I A;  3K81 C;  1GUT A;  1SYE A;  5FLX c;  1HQM C;  3ER0 A;  3KLW A;  1L1O B;  2WAQ G;  4IJL A;  2HHH Q;  3J81 j;  3F2C A;  4PMC A;  5EGT A;  1DYQ A;  5K36 H;  2N3S A;  1YNX A;  4GN4 B;  2MHV A;  4F87 A;  1N32 L;  2X69 A;  1EOT A;  4PMB A;  3TP8 A;  4HID A;  4IN3 A;  4CJ2 C;  4ZK9 B;  1PH6 A;  3F2B A;  3K5N A;  2R3Z A;  3RLN A;  4TVA B;  1U9R A;  4DV4 Q;  3X3N A;  4LFA Q;  1DOM A;  3DMU A;  3OIQ A;  1PDQ A;  2E2H B;  1SLJ A;  2L15 A;  1L1O A;  3EN2 A;  1LTG D;  1ASY A;  4IO9 A;  1ESF A;  2JSO A;  4HJ7 A;  4CBV A;  3IL8 A;  5I9O A;  1UWV A;  4RG1 A;  4YY3 L;  3CCS A;  4B9X A;  3G48 A;  1HFN A;  4P75 A;  2KCN A;  1MGS A;  1EYG A;  5IGD A;  5D14 A;  1M4V A;  4BBR B;  4A75 A;  3I8Z A;  3L0O A;  4X3S A;  4JI3 Q;  2WKD A;  3F1Z A;  2XTI A;  3EIV A;  4TQU S;  1NMF A;  4AQY L;  1JIC A;  3SEB A;  1SYD A;  2QA4 A;  1DON A;  4IUV A;  1TWC H;  3J7A 5;  2B2T C;  4A3M G;  2MGS A;  3GDE A;  2KED A;  1L2F A;  4F88 A;  1SNM A;  3ERS X;  3T51 B;  1XTD A;  3QOL A;  3S14 H;  1UE5 A;  4UPA A;  3S17 H;  4J1M A;  5T1I A;  2NVX H;  2JEA I;  1Z9F A;  1NBW A;  3CD6 A;  3SGI A;  3M7G A;  4A3C G;  1SE3 A;  1VQG A;  2YYZ A;  4N9P A;  4C3I G;  1B3A A;  3NHH A;  2XNA C;  4QCL A;  2R6G A;  2IHE A;  1C0A A;  5C44 H;  3Q24 A;  1IHZ A;  1A8V A;  2G9D A;  1CFM A;  5A2Q E;  3D4R A;  4A4I A;  1SNQ A;  2Z4H A;  5EKK A;  5DM7 3;  2A69 D;  1E0B A;  1Q8K A;  2A1A A;  5COY A;  1RCV D;  2GN5 A;  4KY7 A;  5I6W A;  3IFD A;  4AYB G;  3PO2 B;  3M4Y A;  1VQO A;  1A3T A;  3PO3 G;  2HDL A;  5C4X G;  1RHP A;  2JXM B;  4HIM A;  1EFI D;  1JWM D;  1QJO A;  4NKL A;  1A2U A;  2ASB A;  1SYG A;  1I50 H;  4IAL A;  1ZKO A;  1TR5 A;  3FP9 A;  3GO5 A;  3MXG A;  1XTC D;  2UXD Q;  2PQA B;  5HGT A;  3SR1 A;  2XWB B;  1Q82 C;  3I91 A;  2QF7 A;  1K83 H;  1QWY A;  1D5X C;  1PFM A;  4X65 Q;  1KDA A;  1AE2 A;  1FR3 A;  3PUX A;  4KHP Q;  1GKH A;  3R2I A;  1VQJ A;  2PMZ B;  3JAM c;  4DUZ L;  2SNM A;  2WIN B;  3TZU A;  4A3G G;  1MJE A;  2QDL A;  3BG3 A;  4DFA A;  3MFG A;  3HP3 A;  1VQ8 A;  1WTP A;  2YU9 H;  2EPB A;  1TWH H;  3N52 A;  2PQA A;  3UE1 A;  3PMF A;  5EKL A;  1PRT F;  4XQJ A;  2RCN A;  3OYY A;  3P75 A;  4ABN A;  1LUZ A;  4A3B B;  2PI2 E;  1EQT A;  1EQR A;  5FOB B;  1RF2 D;  1D5M C;  2EQS A;  1I6H H;  3UDI A;  4GLA C;  1SMX A;  1UEB A;  3I90 A;  1CA6 A;  2XIW A;  3HOU B;  2N49 A;  1JOQ A;  2WB1 E;  2O5J C;  4C56 C;  2OTL A;  4DU9 A;  1EY8 A;  5JEA J;  4HJA A;  4X66 Q;  1YJ9 A;  2F4V L;  4X64 Q;  3OW2 A;  4LUO A;  5C3E B;  4C3H H;  2MQH A;  3TSS A;  1OXT A;  4LF6 L;  4DAV A;  1ILP A;  1C48 A;  1QE6 A;  4JI4 Q;  4YWL A;  3ICE A;  4XDX A;  4GNX C;  2R7Z H;  4DR1 L;  1O7L A;  1IYU A;  3I4M B;  4OX9 Q;  3L2P A;  2L11 A;  1VMC A;  4LUV A;  2RDH A;  1HNZ L;  2JA5 B;  4EX5 A;  4Y7N B;  3QWN A;  5E4X A;  4QMG A;  4BBR G;  3AB9 A;  4APV A;  2A68 D;  3HFZ B;  1PH2 A;  3BZD B;  1FL0 A;  4IPC A;  3AU7 A;  4XQQ A;  2UU9 Q;  3H3V I;  2JP1 A;  3Q8D A;  3S1M H;  4DK3 C;  1K8O A;  5H1S E;  3NQI A;  1SNO A;  3J7Z C;  1SNC A;  2F0G A;  3H3V C;  2E8G A;  5IP9 H;  4K8I A;  1S40 A;  2A6E D;  1I94 L;  4K6D A;  1YEZ A;  1AFP A;  3NEN A;  1CZW A;  1F9R A;  3VYT A;  5BN3 A;  5CMD A;  2QW7 A;  4LF8 Q;  4I65 A;  3GP7 A;  1TS2 A;  4XXE A;  1B7Y B;  4HMI A;  3PIO A;  3KF8 B;  4FXD A;  4RHR A;  1HZC A;  5GAD C;  1A6X A;  1Y8N B;  1IW7 C;  5JJI A;  2L0C A;  1PRT B;  3OIP A;  1CKN B;  3DUZ A;  2HQE A;  3EBE A;  2E2D C;  3FRP B;  4JI2 L;  1EY6 A;  4CDF C;  1EQQ A;  4DR6 L;  4DF7 A;  1D8L A;  1KL9 A;  1SAP A;  3UI2 A;  3K8A A;  1PXU A;  4DV7 Q;  1ICF B;  3KF8 A;  1ZYR D;  3HZX A;  1DGS A;  3BVG A;  3GTL H;  5IGB A;  2F3I A;  2L5T A;  1SFO B;  5LMN Q;  3Q0A A;  1IBL L;  4Z9C B;  1RJT A;  1MJC A;  1SE8 A;  4G7Z C;  1CKN A;  2VY3 A;  1XNQ L;  2A74 C;  1F2L A;  2F0P A;  2DJF C;  4HTH A;  2NB0 A;  5CV9 A;  4DNI A;  3EFX D;  1K3R A;  3KLS A;  3I4O A;  4FO2 A;  1C4Q A;  1VF7 A;  5E4W C;  4ZKB B;  3T53 B;  3S24 A;  2CWA A;  1IYV A;  1VMP A;  1L0Y B;  2JN4 A;  1KAB A;  2A19 A;  4UP8 A;  2WP8 J;  4KKT A;  5JPN C;  1XWE A;  1TWF H;  1C8C A;  2BCO A;  4RFB A;  1HTL D;  2JA7 B;  2VUM H;  1RTN A;  1ASZ A;  1FYC A;  1T5X D;  3DEP A;  3RZO H;  3NPP A;  2XWJ B;  2D9U A;  4XT1 B;  3GTG B;  3MXN B;  4BA1 I;  3FDT A;  2PO4 A;  3M85 A;  4NP5 A;  2NVY H;  1LO5 D;  5C4J B;  5GAH C;  5KYI A;  2RDF A;  2AUJ D;  1IBM L;  2F0L A;  3STB D;  2NVQ H;  2RA4 A;  5M5X B;  4LAA A;  2UXC Q;  1E1T A;  1PFS A;  1NR2 A;  4HSP A;  4GKK Q;  4N9T A;  2HDM A;  1S5D D;  4CDE C;  3HOU G;  1GHJ A;  1UNS A;  2NTT A;  5M5W H;  3SDZ A;  4QB4 A;  3ULL A;  2NUC A;  2N78 A;  5M5Y B;  1Y1V G;  1BCP C;  2EYH A;  4KD3 A;  1UE6 A;  2OT2 A;  4DV5 Q;  3J80 i;  2Z6K A;  1SJH D;  5I6Y A;  5C3E G;  1TS5 A;  2KCT A;  1GO3 E;  2M9V A;  3IKJ A;  4JYA L;  3ULJ A;  4X3T A;  4WOR A;  4JI8 Q;  2PNH A;  2ZTE A;  2AWO A;  4O42 A;  3M4O B;  2RDG A;  1EL0 A;  1JJC B;  1CHP D;  3K5O A;  1WCM B;  2RKS A;  5EKI A;  2F3V A;  3I2Z A;  3AFP A;  1V8Q A;  4OEM B;  1HA6 A;  3ERO A;  4DAP A;  3I4M G;  4LFB L;  1HNW Q;  1W6K A;  2FXQ A;  1I4P A;  1KRT A;  1EYA A;  5IYD G;  4UP9 A;  1VQ4 A;  2JA5 G;  1QIL A;  3ZJY C;  1DJR D;  5L37 A;  4DR3 L;  1MBY A;  3I56 A;  2CQO A;  2IX3 A;  1D6E C;  2AHO B;  3I70 A;  1QVF A;  4B3T Q;  4OWT B;  1CSQ A;  4F7X A;  4DR7 L;  3RLO A;  1PZK D;  2CW0 C;  5TSS A;  2KJX A;  2Z6B A;  1K9M C;  2NVT H;  3RN5 A;  2XN9 C;  2K52 A;  1DOK A;  2RCF A;  1V1Q A;  1I3Q H;  3A5Z B;  2M2L A;  4JOI A;  5J22 A;  5JEA G;  4POF A;  5G3L F;  2BOS A;  1QVG A;  3S16 B;  3E6Z X;  3PIP 3;  4HIK A;  2A6H C;  3CME A;  1TQO A;  1WI5 A;  1CQF A;  2B2Y A;  1BR9 A;  2B2W A;  4A3I B;  2KCC A;  3MXP A;  4IZ8 A;  4A3F B;  4K2K A;  5GQO A;  2AQ2 B;  3CRK C;  4NW2 A;  1N33 L;  1B53 A;  2ENB A;  1EY0 A;  2C35 B;  1FJG L;  3DWP A;  1WVL A;  2UUB Q;  1JOK A;  3D6W A;  3W5O A;  1YHQ A;  3M7N A;  3QIA A;  1EZ8 A;  1FVI A;  3GTO H;  3OW7 A;  4IUN A;  4A3E H;  5IGF A;  3K59 A;  5ELF A;  4ODG A;  3LNN A;  1ESR A;  1STA A;  5ELB A;  4OL7 A;  4ID6 A;  4G7O C;  4BY1 G;  4NXM Q;  3SXH A;  5I4D A;  4LUZ A;  5C0X I;  1KHI A;  2HHH L;  2K1B A;  2M00 A;  3ND9 A;  1B3Q A;  2NN6 I;  1HHV A;  1JJ2 A;  1PLF A;  4GKJ Q;  3RUZ A;  1X3Q A;  4A3M B;  1HR0 W;  4JBM A;  4FXK C;  1W6J A;  4JV5 Q;  4KJN A;  1YHA A;  2K5N A;  5I9P A;  4R1J A;  2ID0 A;  4I7A A;  4A3K B;  2EZV A;  4DV4 L;  3HOW G;  3C3L A;  4LFA L;  3DWA A;  1JCK B;  3KLS X;  2F0Q A;  1VCI A;  3H94 A;  2ZXR A;  4O1N A;  1H9M A;  3E9H A;  1VQK A;  4IFD I;  3NEL A;  2LS0 1;  1DCZ A;  1SXT A;  1UE1 A;  2JA7 G;  2HQL A;  1LT5 D;  2EVB A;  4LJZ C;  4JI7 Q;  4DK1 A;  1ET6 A;  3CCU A;  3HOZ G;  4PMW A;  3J80 E;  1Q86 C;  1D1I A;  3RLF A;  1QZH A;  3K7A B;  2GVB A;  4DXG A;  2OEO A;  5HY6 A;  3I55 A;  2X6G A;  2R7D A;  5CBA E;  2F52 A;  1MSG A;  3BVM A;  2E2J B;  4AYB B;  4RGN A;  1AH9 A;  3TS0 A;  4HCS A;  5FLM H;  3S14 B;  2KA7 A;  4JI3 L;  3KUP A;  4PZ7 A;  2IT1 A;  1SE4 A;  3S17 B;  1STE A;  5C4H A;  3PF4 A;  4A93 H;  4JPB W;  2E2I H;  3O13 A;  2Y0S G;  5AFW A;  4IJH A;  3DLL A;  3S2D H;  3LWE A;  5ELN A;  2PW7 A;  5CV7 A;  2PMZ E;  5FKA C;  4CKE A;  3U4Z A;  2JA8 H;  2NZH A;  3NUC A;  3OTO Q;  5C44 B;  2D5D A;  4QJF A;  2K5D A;  5CV8 A;  4JK1 C;  4MZ9 A;  2LMC B;  4HCE A;  5FJ8 H;  1WCM G;  3H0G H;  4YHH Q;  1PH9 A;  2JA6 G;  1FNV A;  4ZCK A;  3CRL C;  3U4V A;  5KRU A;  5CYU A;  1VQN A;  1I50 B;  1OXV A;  2K4K A;  4PNY A;  1PH4 A;  1NY4 A;  4GZY C;  1GUS A;  4XYQ A;  1A63 A;  2RQX A;  3OPO A;  2OXP A;  5M3M H;  4PV1 C;  5COR A;  2A73 B;  1K8M A;  3CXC A;  3OHX C;  2KHS A;  1V1P B;  1VQE A;  4HR7 B;  4YIJ A;  2H4O A;  4QL5 A;  1XJV A;  1VQL A;  2PQE A;  3MVV A;  1JE5 A;  2O2L D;  1GUW A;  3CCV A;  3I4N H;  4XQN A;  3NQT A;  2XVS A;  1HXY D;  5FO7 B;  1NMG A;  4K2L A;  3S9W A;  4GOP C;  1X65 A;  4A3D G;  2B63 H;  1ENC A;  1RTO A;  2KEC A;  4HAE A;  2UXD L;  2YU9 B;  4QIW B;  3F2D A;  3CCR A;  1K73 C;  1AW7 A;  3R3O A;  3J7A F;  3WWV A;  1F2Z A;  1GVP A;  4X65 L;  4A3I G;  2CFM A;  5D3I B;  2K5H A;  3VA5 A;  1HR0 Q;  4A3F G;  3HOV H;  5C0X H;  1G2S A;  3PF5 A;  4KHP L;  4P2C B;  3E0E A;  4UP7 A;  3V96 A;  1B44 D;  2NN6 H;  4FF4 A;  5KGU A;  5K36 G;  4HSV A;  4KJO A;  2ZXO A;  3CAM A;  1Q7Y C;  1TS4 A;  2E75 C;  1PYS B;  4KHV A;  4C3J H;  1VQF A;  2J0T D;  3EJI A;  3HKZ B;  1GUG A;  3VYR A;  5GAG C;  2YTV A;  2F0K A;  3CW2 C;  3S2H H;  5EPJ A;  1JE4 A;  1TU2 B;  5JOB A;  1MKH A;  5IGG A;  2EXD A;  3FHW A;  4IFD H;  2EY5 A;  2RSN A;  2Z4I A;  4X3K A;  5KNC A;  1QCB D;  1A15 A;  3CCJ A;  1UUP A;  1YIJ A;  3CQZ B;  3VR3 A;  1DOL A;  1JWS D;  2EYJ A;  5LHY 1;  2R7Z B;  2CQA A;  4DN4 M;  3GTJ B;  1BXT A;  2K5W A;  1PTO H;  4EQN A;  4C3I H;  2QIL A;  3K7U C;  1TWA H;  3BU2 A;  4A3K G;  2K75 A;  4TSS A;  3R93 A;  1IXR A;  2K14 A;  4LF7 Q;  4OWW B;  1EIH A;  2IL8 A;  4X66 L;  1TKW B;  2NZO A;  4X64 L;  3CKI B;  3FEW X;  2HCC A;  1SE2 A;  3OMC A;  1EY5 A;  1PH1 A;  1U5K A;  4QQB X;  3Q6S A;  3OSO A;  1VQB A;  2R92 H;  4JI4 L;  1ENA A;  1Q46 A;  3S1M B;  1XPU A;  1IW7 D;  1PRT D;  2B2T A;  4ULL A;  4OX9 L;  1LYL A;  4RHS A;  1CTM A;  3VR6 A;  1VQH A;  1Q3L A;  3CC4 A;  1F77 A;  1S5B D;  1YNJ C;  4LF9 Q;  4RWS C;  3IRB A;  2KCM A;  2RHS B;  5M3F H;  1ET9 A;  4OHJ A;  3RMH A;  2F1M A;  1IKM A;  4DR5 Q;  4O0A A;  4R4T A;  2UU9 L;  3BDC A;  1WOC A;  5IGC A;  2SOB A;  5AJ3 Q;  4OO1 I;  4L5S A;  2IX0 A;  3VR5 A;  5IT9 L;  3CC7 A;  4I7Z C;  4Q0F A;  3CPW A;  3W3A A;  1N9W A;  3G6E A;  5C44 G;  1H9J A;  1KDB A;  4MTK A;  1XPO A;  1V43 A;  5ELO A;  4A3J H;  2CCZ A;  1D7Q A;  1X6O A;  3FPP A;  2D0O A;  3PCO B;  4LF8 L;  3GTP B;  1EYD A;  1HJP A;  1K28 A;  5KEE A;  1VQC A;  1STY A;  1QB5 D;  2PYK A;  3HS0 C;  3ND8 A;  1QOH A;  1TWG H;  5LMN W;  4NMZ A;  1VQ7 A;  4BXX G;  3R2T A;  3AYH B;  2MFI A;  3D6C A;  1AZQ A;  1G6P A;  2PW5 A;  2IJ0 A;  4K0K Q;  1IKL A;  1E2V A;  5F2D A;  2HUG A;  2L55 A;  4KHZ A;  1K8G A;  1PHJ A;  1JR0 D;  4JCV E;  1Y8O B;  2F0D A;  5JAV A;  4DV7 L;  3J7A V;  4L8J A;  4L5T A;  2Q2H A;  1PZJ D;  4CJ0 B;  2SDF A;  2QEX A;  5LMN L;  3U50 C;  4DV2 Q;  4JI1 Q;  3SK8 A;  1NTG A;  3U9O A;  1Y8P B;  5IYB G;  1YIT A;  1SR3 A;  2VW9 A;  4ZKC B;  1S4Z A;  4C2M B;  1LAB A;  1Y1V B;  5J1Z A;  2SNS A;  3N6R A;  2IY5 B;  1BF4 A;  4H0L C;  1NAP A;  1CT1 D;  3BVZ A;  1BCP D;  4L63 B;  3ERQ A;  2AWN A;  5LL6 X;  2UUC Q;  3P7J A;  2K32 A;  3ZYY X;  1LTI D;  1LTS D;  1EIF A;  2JJQ A;  3DXJ C;  4J15 A;  1A2T A;  1WTX A;  1BVS A;  4OXP A;  5CV6 A;  4HJ8 A;  3TQY A;  1ROD A;  1BUV T;  5EPL A;  4GNX B;  3KF6 B;  3TP7 A;  4FF2 A;  4RCN A;  4H02 A;  2QCP X;  1V1O A;  2WAQ E;  3URY A;  3G6J B;  1B50 A;  1WTR A;  4U67 3;  4BBS B;  1HH2 P;  1CK1 A;  1HNX Q;  3HKZ G;  3TDQ A;  2BH8 A;  1HA5 A;  4DAY B;  2K03 A;  3A8J E;  1NUC A;  1JOO A;  2EYL A;  3TRZ A;  4FVM A;  3UDX A;  4EVO A;  2UXC L;  2F0U A;  1CI3 M;  4GLV B;  4R4Q A;  3HG9 A;  3NBI A;  1X55 A;  4AH6 A;  3KF6 A;  4GNX A;  4GKK L;  5E7N A;  1X32 A;  2B8F A;  4ALP A;  2CW0 D;  4GN3 B;  2R7Z G;  5IIF A;  3J7Y W;  1RL2 A;  1XNR Q;  2FIN B;  4DV5 L;  1DD2 A;  1PMR A;  2VS1 A;  4OIJ A;  4DAY A;  2XSC A;  4YCU A;  3F8T A;  1VQ9 A;  1M8A A;  1SEB D;  1KC8 C;  3ITP A;  1BCP F;  1L0X B;  2ZXP A;  4DAM A;  1W3S A;  4JI8 L;  2BA1 A;  4JBK A;  2Z0S A;  2N8N A;  2KEN A;  3PO2 H;  2A6H D;  2DN8 A;  2F0V A;  2P5Z X;  4OO1 H;  1Y1W H;  3VYU A;  1SSO A;  1HNW L;  5EAY A;  1PVO A;  2A8V A;  3EQL C;  4FXG C;  1FNW A;  3P20 A;  4O2D A;  4XT3 B;  2F0E A;  5C5L A;  2PZW A;  2X6L A;  5KNB A;  4A76 A;  1OXS C;  2KBN A;  3C1E A;  1P8L A;  4BY1 B;  2IHF A;  3DWQ A;  2B3G A;  1WD0 A;  4B3T L;  4MNO A;  2TSS A;  1GJX A;  1B1Z A;  1VQA A;  4ZYS A;  1J8I A;  2DY8 A;  2R61 A;  1VQI A;  4EQO A;  3DEO A;  4HED A;  2NZ1 D;  1U4R A;  1KLU D;  3DM3 A;  4EQ5 A;  5E1F A;  5A2Q L;  3HOW B;  2KQ3 A;  3HOX B;  1LV9 A;  1J5E Q;  1FD7 D;  4OIK A;  3P1H A;  1HRJ A;  3E0J A;  1YNN D;  3HRZ C;  5IT9 c;  1QG7 A;  3CF5 A;  3KJP A;  4A3E B;  3AEV A;  3S1Q B;  3TZD A;  4A3B H;  3A7A B;  4AYB E;  3LX0 A;  3S1N H;  1YJW A;  3S1R H;  2NYZ D;  1LAC A;  5JJZ A;  1SMY C;  4V19 0;  4DNR B;  5K5P A;  4GLX A;  4MHE A;  4IUR A;  5DAU A;  3HOZ B;  3KFU A;  4LF5 Q;  1XYI A;  2UUB L;  4JI6 L;  3BYT B;  3GTK B;  3AQQ A;  4J6H A;  1M1K C;  3OWF A;  1I4H A;  2WFW A;  1CSP A;  1FGU A;  1O7Y A;  2BA0 A;  4X3U A;  3QG1 A;  2BH2 A;  1KNA A;  2K01 A;  3T13 A;  4NXM L;  5ISR A;  3VYS A;  1CKO A;  5CC4 A;  3CC2 A;  4KK7 A;  4H44 C;  2Y0S B;  1EOV A;  5G3L D;  1EFW A;  3PUY A;  3L9A X;  3MXN A;  3MEH A;  4GKJ L;  1BCP B;  2JYO A;  2IX1 A;  4IQZ A;  2F0H A;  3K0Y A;  2MNA A;  4MIU A;  2C9O A;  5FO9 B;  4JV5 L;  4P73 A;  2KHI A;  3KBX A;  1I94 Q;  2JA5 H;  4BY7 H;  4RH6 A;  4Y7N H;  1WD1 A;  3V2T A;  4P71 A;  1TVX A;  2DY7 A;  2K28 A;  2ZM6 Q;  5FO8 B;  2JA6 B;  3BZK A;  1X54 A;  1WJJ A;  2F0I A;  1QNK A;  3CCQ A;  1KRS A;  2HIV A;  4ZUJ A;  2I5H A;  5JJL A;  2GVA A;  4ILW A;  5C3W A;  4JI0 Q;  1RKN A;  1H9R A;  1S5E D;  4RGM A;  1E2W A;  4JI7 L;  4HJ9 A;  3RZD B;  4BBS G;  4DGZ A;  5IWA Q;  2MUY A;  3L3O C;  3GTQ B;  2K6A A;  1TS3 A;  1AZP A;  3CPF A;  1EEF D;  4DV0 Q;  4IUP A;  4ME3 A;  3SK4 A;  3U58 A;  1GOZ A;  3M4Q A;  3C1F A;  5JEA H;  2F0M A;  4B3R L;  2A68 C;  3RD4 A;  2L1B A;  4HJ5 A;  3NE5 B;  2AKW B;  3GV3 A;  4QIW E;  2R93 B;  3CCM A;  4B3S Q;  2I07 B;  5A35 A;  4OEL B;  5IYC H;  2MJ8 A;  1G51 A;  1HFG A;  3JC6 6;  2G9H D;  5C0X J;  3Q23 A;  1AEX A;  3MFY A;  1WTW A;  2HCI A;  4A3D B;  5KIX A;  1H9S B;  1MSH A;  3OTO L;  1P16 A;  1I4G A;  1BO0 A;  5JPM C;  1EWC A;  1R4P B;  2L4N A;  5IOD A;  1SRU A;  3G7L A;  1EU3 A;  3L7Z C;  5M3M B;  1JWU D;  2CH4 A;  1ICW A;  1F9Q A;  3J81 i;  2CKZ B;  4DV6 Q;  3K0X A;  3HKZ E;  2PNR C;  4YHH L;  3FKI H;  4IFD J;  1Q1B A;  5CR3 A;  4LFC Q;  3BDO A;  2XRQ D;  2F03 A;  4NB3 A;  2VNU D;  2AQ1 B;  4QUC A;  5IP7 H;  3W1G A;  4M1U B;  1H9S A;  2DNC A;  1X3F A;  3I73 A;  4IUQ A;  3MHB A;  1QUQ B;  3K80 C;  2PZU A;  2B63 B;  4R9W A;  3EA6 A;  4JG2 A;  4RGT A;  2K33 A;  1VS0 A;  3T1Y Q;  1TY0 A;  3AFQ A;  4IPH A;  4KY5 A;  1C9O A;  1CM9 A;  2YTX A;  4DV1 Q;  3GV6 A;  1XMQ Q;  4OWX B;  1PFB A;  3HOV B;  1Z6H A;  1SYC A;  2JA9 A;  1O78 A;  1YVC A;  4KN4 C;  2F0T A;  4HIO A;  1N34 Q;  1BOS A;  1HUN A;  3HOX G;  3T1H Q;  2Z1C A;  4CDC C;  1QUQ A;  1UAP A;  2EYP A;  2HD3 A;  2F0S A;  3GTG H;  2AMC B;  2EYM A;  3TRE A;  4A3E G;  1ENF A;  4KI0 A;  1E7Z A;  4JI5 Q;  2NTS A;  4R4O A;  5C4J H;  1CQV A;  4QUF A;  1HR0 L;  4X6A H;  4DUY Q;  5M5X H;  1E24 A;  1Y69 U;  1PZI D;  3HOY H;  2CHB D;  2RBM A;  1HZA A;  4FF1 A;  2JE6 I;  1G91 A;  1KXL A;  1A3U A;  1Q12 A;  3VA7 A;  2DJG C;  2DUD A;  1TWC B;  1MD2 D;  2MPM A;  5EBC A;  1AN8 A;  4HMJ A;  4ZAI A;  1D5Z C;  1PTO C;  2VQE Q;  4FDB A;  4HN7 A;  3B6Y A;  3D4D A;  5M5Y H;  1T5E A;  2C5C A;  3CU7 A;  1VQD A;  1BBX C;  5BR8 Q;  1BNZ A;  1LM0 A;  2NVX B;  1BBW A;  1YJN A;  2EYO A;  4DR2 Q;  3S15 H;  1OTC A;  3T4A C;  1D2B A;  3BS1 A;  2FMC A;  4DV3 Q;  1JB7 A;  2E74 C;  3D8G A;  1LT6 D;  1WCM H;  3C46 A;  4DR7 Q;  1KQS A;  3PUW A;  1HPC A;  4DPG A;  5C6A A;  1LTT D;  1EWH A;  3A7L A;  2B29 A;  4LF7 L;  1R9T H;  4CKC A;  4OON A;  2VQF Q;  5D3D A;  1U4L A;  3DM1 A;  1R4Q B;  2BE5 C;  2KUM A;  4KY6 A;  4NXN Q;  5FLM G;  2Q8I B;  1BBU A;  4DR4 Q;  4R4I A;  4A3L G;  3WDN A;  3H6M A;  4B3M Q;  1XXG A;  4KTA A;  4C1N I;  3IFT A;  2K5V A;  4RAU C;  1K8A C;  4A93 G;  2WB1 G;  4DKA C;  5IGE A;  1IBK Q;  4KV6 A;  3F2U A;  4ME5 A;  5E3F A;  2KHJ A;  4JVZ A;  3WOF A;  1HZ9 A;  4LF9 L;  5BN4 A;  5LMU Q;  2H1E A;  1B8A A;  1K83 B;  4A3J B;  4UAI A;  2K50 A;  3H09 A;  2ZJQ A;  2OWO A;  3S16 H;  3J81 E;  1CA5 A;  4DR5 L;  2R93 G;  4GS3 A;  1ILQ A;  4C1N K;  5FJ8 G;  2CWP A;  1YI2 A;  3H0G G;  5AJ3 L;  5LL6 S;  5C3X A;  4A3I H;  2EE1 A;  2Z9H A;  1L1O C;  5CBE E;  4A3F H;  2UXB Q;  4TKO B;  1X9N A;  3QO2 A;  1TWG B;  4YWM A;  4GOP B;  1YBY A;  1TWH B;  2L12 A;  2VXW A;  1FNU A;  1V1P A;  3I4L A;  1KAA A; 
#chains in the Genus database with same CATH homology
 2ICI A;  1I4Q A;  3NK9 A;  2KEE A;  2PPB C;  1B9M A;  3PIO 3;  3AMU A;  4RCO A;  1I6H B;  4DNT B;  1EZ6 A;  3K5L A;  2F0W A;  3A8I E;  1LLR D;  2QKI C;  2B8G A;  1PYW D;  3ONA B;  1LTR D;  2EDG A;  2KOL A;  1IL8 A;  1OXU A;  2WII B;  3NTH A;  3GD7 A;  3NTK A;  1LT4 D;  2AUK A;  4C3H B;  4ZRZ A;  2WV6 D;  1G2T A;  2B2V C;  1BDO A;  1SYF A;  2K5Q A;  2FJ2 A;  5C0X G;  4G7H C;  2EY1 A;  3FVQ A;  2NN6 G;  3KK7 A;  3TP5 A;  2N55 A;  3D4W A;  2QDB A;  4OGQ C;  4C3J G;  1NSN S;  1EQV A;  1UEA B;  2B2V A;  1WTQ A;  3X3M A;  4IFD G;  2EY6 A;  4K8J A;  4WRD A;  1STH A;  3BDL A;  4CJ1 B;  2LY7 A;  3TBI B;  2EJF C;  4B9W A;  1ZXT A;  1JB3 A;  2NWG A;  3K58 A;  3MA2 B;  3MWY W;  3QB3 A;  2V4D A;  2OF1 A;  5ELC A;  3KLR A;  1Y1W B;  1EY7 A;  3J80 L;  1GUN A;  4ZQ3 A;  1G6Z A;  3MXU A;  4Q5V A;  1U4M A;  5EBD A;  2LFN A;  1KLG D;  1SNP A;  3GTL B;  3PUV A;  1STB A;  4KKU A;  1MI2 A;  4G57 A;  2N88 A;  2BDN A;  2ICE C;  1B4O A;  1F2M A;  2F4I A;  2TMP A;  3FMC A;  1SMY D;  2IWH A;  3H91 A;  2XRS D;  1EY4 A;  1NCV A;  5EJW A;  5DM6 3;  4V0B A;  1ML0 D;  3A54 A;  3A55 A;  4K5W A;  1LTB D;  1TWF B;  2J7Z A;  2F0F A;  5D65 A;  5JVH 3;  5CGK A;  1X3P A;  3S1N B;  2IW3 A;  1Z47 A;  2Q8R E;  5FLX E;  2VUM B;  3S1R B;  3RZO B;  1KNE A;  3K6O A;  4ZLT F;  1EEI D;  3SK5 A;  5J39 A;  2NVY B;  4J8Q A;  4FF3 A;  1STN A;  2WKC A;  2NVQ B;  3DHQ A;  3PV0 A;  4JBW A;  3MTS A;  4BWG B;  3J81 L;  1ONL A;  3U9S A;  2WAC A;  4K6L A;  5M5W B;  3LWU A;  4KD4 A;  1EY9 A;  5DNF A;  2EXZ A;  3NWS A;  4C3H G;  1B2T A;  5EPK A;  2FHT A;  2EYF A;  1HCZ A;  4BY7 B;  4XIG S;  1S5F D;  4H13 C;  4MN3 A;  1LT3 D;  1I6V C;  1JC7 A;  5CV4 A;  2FFK B;  1DZ1 A;  1AP0 A;  2K05 A;  1WTO A;  2J4X A;  5JVG 3;  3OMG A;  3BYY B;  3C2P A;  1KDC A;  2VB3 X;  4BA2 I;  1F9S A;  2VB2 X;  1DXM A;  4U68 A;  3QOJ A;  2B39 A;  5CV5 A;  2NVT B;  1I3Q B;  3SK6 A;  1F9P A;  2EJM A;  3HEJ A;  1TT2 A;  2A5H A;  1PRT C;  2I46 A;  1O80 A;  3R8B A;  2A69 C;  5ELD A;  3QJY A;  3GQB A;  3D3R A;  3OWE B;  3WOE A;  2K7V A;  1CHQ D;  4KKS A;  1SND A;  1GHK A;  1HQR D;  2NBF A;  4FP5 D;  4OO1 G;  3FKI B;  4F8M A;  2O5I C;  3HGB A;  3TP6 A;  1PFN A;  3GTO B;  1GUO A;  4RKB A;  3MC0 B;  1LTA D;  2F3W A;  1JOR A;  3Q22 A;  3SVM A;  4LMQ D;  4B08 A;  5DEH A;  3D31 A;  4QF4 A;  3NTI A;  3T16 A;  3JAM E;  2Z8L A;  2EJG C;  3EVQ A;  3TN2 A;  5FK9 C;  3FPU B;  2D2C C;  4KN7 C;  1PTO D;  2FMM A;  2LKV A;  4IUU A;  4R8N A;  1FGB D;  1KTK A;  3NP8 A;  2F0N A;  2QEJ C;  4PQX A;  1RDP D;  5KYL A;  3HOY B;  1EIG A;  2RVL A;  2E2I B;  3KBG A;  4H7B A;  1QNU A;  1BQQ T;  2BE5 D;  1U4P A;  4A93 B;  3S15 B;  2WB1 B;  1I4X A;  3E5S A;  3S2D B;  1GXD C;  3K5M A;  2MP1 A;  1TY2 A;  1SYB A;  3MZ5 A;  2PZT A;  4DK0 A;  2JA8 B;  2O4X A;  3K57 A;  2BDO A;  5KND A;  2F0O A;  5FLX L;  2L9H A;  1E2Z A;  1SJE D;  1R9T B;  4G4K A;  3A8K E;  1PTO F;  3H0G B;  4RA8 A;  1OXX K;  4CGY B;  5C5M A;  1O7Z A;  2A6E C;  1STG A;  2B2Y C;  1B9N A;  2B2W C;  2WAQ B;  3CHB D;  4XTC S;  1S5C D;  1TII D;  1Q1E A;  4XYO A;  1VF5 C;  5ELE A;  2K04 A;  1CZG A;  5I2Y A;  3I4N B;  5BN5 A;  4L6T B;  3NXW A;  2E76 C;  2PCF B;  4DXF A;  4R8I A;  4WFN 3;  4DA2 A;  2EOT A;  1G8Z D;  1Q8I A;  1A3V A;  1ZYR C;  1Z7T A;  3SHL A;  2RSO A;  3T56 B;  1G29 1;  4EGV A;  1I4R A;  3A56 A;  4TRD A;  1VDZ A;  3TME A;  1NR4 A;  1SDF A;  4FYD A;  3M3Y B;  3OOC A;  4FNF A;  1D1K A;  3I72 A;  1RD9 D;  3I3C A;  3W2D A;  4ZUI A;  1Q90 A;  3NBH A;  4C3J B;  4K5V A;  1II3 A;  4E6I A;  3S2H B;  1XX8 A;  1JQY D;  4KMU C;  2AQ3 B;  4CKB A;  5T1G A;  1YNN C;  3VR2 A;  2IPK D;  5C4Z A;  4UDU C;  1F2Y A;  5HUR A;  2KVM A;  2GA4 B;  4RKL A;  5EQ0 A;  4NDX A;  1SBB B;  5IT9 E;  3NWT A;  1PTO B;  4C3I B;  1TWA B;  1EU4 A;  1YNJ D;  1OO9 B;  5NUC A;  1WTV A;  2B2U C;  1H9K A;  1HUM A;  3MAQ A;  5M9O A;  2R92 B;  3SE0 A;  2DNE A;  4RGO S;  3PO3 B;  5C4X B;  5IOC A;  4EQP A;  5I2X A;  3NSW A;  4K14 A;  3PUZ A;  2Q8T A;  4WJW A;  3V05 A;  3JAM L;  3GTM B;  4M8A A;  5M3F B;  1EYC A;  2SEB D;  2JEB I;  2B2U A;  1DM0 B;  4LK1 C;  4CHT B;  2CVR A;  4A3G B;  2EY2 A;  1ZEQ X;  4S3S A;  3VR4 A;  2ZT9 C;  2D62 A;  1J9O A;  4IUT A;  3IAY A;  4K5X A;  1HTP A;  2F0J A;  4BS9 A;  1GUT A;  1SYE A;  1HQM C;  4PMC A;  5EGT A;  1DYQ A;  5K36 H;  2MHV A;  4F87 A;  2X69 A;  1EOT A;  4PMB A;  3TP8 A;  4IN3 A;  4CJ2 C;  4ZK9 B;  3K5N A;  2R3Z A;  1U9R A;  3X3N A;  1DOM A;  3DMU A;  3OIQ A;  1PDQ A;  2E2H B;  1LTG D;  1ESF A;  2JSO A;  4CBV A;  3IL8 A;  5I9O A;  4B9X A;  1HFN A;  2KCN A;  1MGS A;  5IGD A;  5D14 A;  1M4V A;  4BBR B;  3I8Z A;  4X3S A;  2WKD A;  4TQU S;  1JIC A;  3SEB A;  1SYD A;  1DON A;  4IUV A;  2B2T C;  2MGS A;  2KED A;  4F88 A;  1SNM A;  3T51 B;  3QOL A;  4J1M A;  5T1I A;  2JEA I;  3M7G A;  1SE3 A;  2YYZ A;  4N9P A;  4C3I G;  1B3A A;  3NHH A;  2XNA C;  4QCL A;  2R6G A;  3Q24 A;  1IHZ A;  2G9D A;  1CFM A;  5A2Q E;  3D4R A;  1SNQ A;  2Z4H A;  5EKK A;  5DM7 3;  2A69 D;  1E0B A;  5COY A;  1RCV D;  4KY7 A;  5I6W A;  3IFD A;  3PO2 B;  3M4Y A;  1A3T A;  2HDL A;  1RHP A;  2JXM B;  1EFI D;  1JWM D;  1QJO A;  4NKL A;  1A2U A;  1SYG A;  4IAL A;  1ZKO A;  1TR5 A;  3GO5 A;  3MXG A;  1XTC D;  5HGT A;  3SR1 A;  2XWB B;  3I91 A;  2QF7 A;  1QWY A;  1D5X C;  1PFM A;  1KDA A;  1FR3 A;  3PUX A;  3R2I A;  2PMZ B;  2SNM A;  2WIN B;  3TZU A;  3BG3 A;  4DFA A;  3MFG A;  3HP3 A;  1WTP A;  2EPB A;  3N52 A;  3PMF A;  5EKL A;  1PRT F;  4XQJ A;  3P75 A;  4ABN A;  4A3B B;  1EQT A;  5FOB B;  1RF2 D;  1D5M C;  3I90 A;  1CA6 A;  2XIW A;  3HOU B;  1JOQ A;  2O5J C;  4C56 C;  4DU9 A;  1EY8 A;  5JEA J;  5C3E B;  3TSS A;  1OXT A;  4DAV A;  1ILP A;  1C48 A;  1QE6 A;  4XDX A;  1O7L A;  1IYU A;  3I4M B;  2L11 A;  1VMC A;  2RDH A;  2JA5 B;  4Y7N B;  3QWN A;  5E4X A;  4QMG A;  3AB9 A;  2A68 D;  3BZD B;  3AU7 A;  4XQQ A;  2JP1 A;  1K8O A;  3NQI A;  1SNO A;  1SNC A;  2F0G A;  3H3V C;  4K8I A;  2A6E D;  4K6D A;  1AFP A;  1CZW A;  1F9R A;  3VYT A;  5BN3 A;  5CMD A;  4I65 A;  3GP7 A;  1TS2 A;  4XXE A;  4HMI A;  4FXD A;  4RHR A;  1A6X A;  1Y8N B;  1IW7 C;  2L0C A;  1PRT B;  3OIP A;  3DUZ A;  2HQE A;  2E2D C;  3FRP B;  1EY6 A;  4DF7 A;  1SAP A;  3UI2 A;  1PXU A;  3KF8 A;  1ZYR D;  3HZX A;  3BVG A;  5IGB A;  1SFO B;  2L5T A;  3Q0A A;  4Z9C B;  1RJT A;  4G7Z C;  2A74 C;  1F2L A;  2F0P A;  4HTH A;  2NB0 A;  5CV9 A;  3EFX D;  3KLS A;  4FO2 A;  1C4Q A;  1VF7 A;  5E4W C;  4ZKB B;  3T53 B;  1IYV A;  1VMP A;  1L0Y B;  1KAB A;  2WP8 J;  4KKT A;  5JPN C;  1XWE A;  1C8C A;  2BCO A;  4RFB A;  1HTL D;  2JA7 B;  1RTN A;  1FYC A;  1T5X D;  3DEP A;  3NPP A;  2XWJ B;  2D9U A;  4XT1 B;  3GTG B;  4BA1 I;  3FDT A;  2PO4 A;  3M85 A;  4NP5 A;  1LO5 D;  5C4J B;  5KYI A;  2RDF A;  2AUJ D;  2F0L A;  2RA4 A;  5M5X B;  4LAA A;  1NR2 A;  4HSP A;  4N9T A;  2HDM A;  1S5D D;  1GHJ A;  1UNS A;  2NTT A;  3SDZ A;  4QB4 A;  2NUC A;  5M5Y B;  1BCP C;  2EYH A;  4KD3 A;  2OT2 A;  1SJH D;  5I6Y A;  1TS5 A;  3IKJ A;  2M9V A;  4X3T A;  4WOR A;  2AWO A;  4O42 A;  3M4O B;  2RDG A;  1EL0 A;  1CHP D;  3K5O A;  1WCM B;  2RKS A;  5EKI A;  2F3V A;  1V8Q A;  1HA6 A;  3ERO A;  4DAP A;  1W6K A;  1I4P A;  1EYA A;  1QIL A;  1DJR D;  1MBY A;  2IX3 A;  1D6E C;  3I70 A;  4F7X A;  1PZK D;  2CW0 C;  5TSS A;  2KJX A;  2XN9 C;  1DOK A;  2M2L A;  5J22 A;  5JEA G;  5G3L F;  2BOS A;  3S16 B;  3E6Z X;  3PIP 3;  2A6H C;  1TQO A;  1CQF A;  2B2Y A;  1BR9 A;  2B2W A;  4A3I B;  2KCC A;  3MXP A;  4IZ8 A;  4A3F B;  4K2K A;  2AQ2 B;  3CRK C;  4NW2 A;  1B53 A;  2ENB A;  1EY0 A;  3DWP A;  1WVL A;  1JOK A;  3D6W A;  3M7N A;  3QIA A;  1EZ8 A;  3OW7 A;  4IUN A;  5IGF A;  3K59 A;  5ELF A;  4ODG A;  3LNN A;  1ESR A;  1STA A;  5ELB A;  4OL7 A;  4ID6 A;  4G7O C;  3SXH A;  5I4D A;  5C0X I;  2K1B A;  2M00 A;  3ND9 A;  2NN6 I;  1HHV A;  1PLF A;  3RUZ A;  1X3Q A;  4A3M B;  4FXK C;  1W6J A;  4KJN A;  5I9P A;  2ID0 A;  4A3K B;  2EZV A;  3C3L A;  3DWA A;  1JCK B;  3KLS X;  2F0Q A;  1VCI A;  3H94 A;  2ZXR A;  4O1N A;  1H9M A;  4IFD I;  2LS0 1;  1DCZ A;  1SXT A;  1LT5 D;  2EVB A;  4LJZ C;  4DK1 A;  1ET6 A;  4PMW A;  3J80 E;  1D1I A;  3RLF A;  3K7A B;  4DXG A;  2OEO A;  2X6G A;  5CBA E;  1MSG A;  3BVM A;  2E2J B;  4AYB B;  4RGN A;  4HCS A;  3S14 B;  2KA7 A;  3KUP A;  2IT1 A;  1SE4 A;  3S17 B;  1STE A;  5C4H A;  3O13 A;  5AFW A;  3LWE A;  2PW7 A;  5CV7 A;  5FKA C;  4CKE A;  3NUC A;  5C44 B;  2D5D A;  2K5D A;  5CV8 A;  4JK1 C;  2LMC B;  4HCE A;  1FNV A;  3CRL C;  5KRU A;  5CYU A;  1I50 B;  1OXV A;  4PNY A;  4GZY C;  1GUS A;  4XYQ A;  2RQX A;  3OPO A;  2OXP A;  4PV1 C;  5COR A;  2A73 B;  1K8M A;  3OHX C;  2KHS A;  1V1P B;  4HR7 B;  4YIJ A;  2H4O A;  2PQE A;  3MVV A;  2O2L D;  1GUW A;  4XQN A;  3NQT A;  2XVS A;  1HXY D;  5FO7 B;  4K2L A;  3S9W A;  1ENC A;  1RTO A;  2KEC A;  4HAE A;  2YU9 B;  4QIW B;  1AW7 A;  3R3O A;  3J7A F;  1F2Z A;  5D3I B;  3VA5 A;  5C0X H;  1G2S A;  4P2C B;  3V96 A;  1B44 D;  2NN6 H;  4FF4 A;  5KGU A;  5K36 G;  4HSV A;  4KJO A;  2ZXO A;  1TS4 A;  2E75 C;  4KHV A;  2J0T D;  3EJI A;  3HKZ B;  1GUG A;  3VYR A;  2F0K A;  5EPJ A;  1JE4 A;  1TU2 B;  5JOB A;  5IGG A;  4IFD H;  2EY5 A;  2RSN A;  2Z4I A;  4X3K A;  5KNC A;  1QCB D;  1A15 A;  1UUP A;  3VR3 A;  3CQZ B;  1DOL A;  1JWS D;  2EYJ A;  5LHY 1;  2R7Z B;  2CQA A;  4DN4 M;  3GTJ B;  1BXT A;  2K5W A;  1PTO H;  4EQN A;  2QIL A;  4TSS A;  3R93 A;  1EIH A;  2IL8 A;  1TKW B;  3CKI B;  3FEW X;  2HCC A;  1SE2 A;  3OMC A;  1EY5 A;  3Q6S A;  3OSO A;  1ENA A;  3S1M B;  1IW7 D;  1PRT D;  2B2T A;  4ULL A;  4RHS A;  1CTM A;  3VR6 A;  1Q3L A;  1S5B D;  1F77 A;  1YNJ C;  4RWS C;  1ET9 A;  4OHJ A;  3RMH A;  2F1M A;  1IKM A;  3BDC A;  5IGC A;  2SOB A;  4OO1 I;  2IX0 A;  3VR5 A;  5IT9 L;  4I7Z C;  4Q0F A;  3W3A A;  1H9J A;  1KDB A;  1V43 A;  3FPP A;  3GTP B;  1EYD A;  5KEE A;  1STY A;  1QB5 D;  2PYK A;  3HS0 C;  3ND8 A;  1QOH A;  4NMZ A;  3R2T A;  3D6C A;  1AZQ A;  2PW5 A;  2IJ0 A;  1IKL A;  1E2V A;  5F2D A;  2HUG A;  4KHZ A;  2L55 A;  1JR0 D;  1Y8O B;  2F0D A;  5JAV A;  3J7A V;  4L8J A;  1PZJ D;  4CJ0 B;  2SDF A;  3SK8 A;  3U9O A;  1Y8P B;  4ZKC B;  1S4Z A;  4C2M B;  1LAB A;  1Y1V B;  5J1Z A;  2SNS A;  3N6R A;  1BF4 A;  4H0L C;  1NAP A;  1CT1 D;  3BVZ A;  1BCP D;  4L63 B;  3ERQ A;  2AWN A;  5LL6 X;  3P7J A;  2K32 A;  3ZYY X;  1LTI D;  1LTS D;  3DXJ C;  1A2T A;  1WTX A;  5CV6 A;  1ROD A;  1BUV T;  5EPL A;  3TP7 A;  4FF2 A;  4RCN A;  2QCP X;  1V1O A;  3URY A;  3G6J B;  1B50 A;  1WTR A;  4U67 3;  4BBS B;  1CK1 A;  3TDQ A;  1HA5 A;  2K03 A;  3A8J E;  1NUC A;  1JOO A;  2EYL A;  4FVM A;  4EVO A;  2F0U A;  1CI3 M;  3HG9 A;  3NBI A;  1X32 A;  2B8F A;  2CW0 D;  5IIF A;  3J7Y W;  2FIN B;  1DD2 A;  1PMR A;  4OIJ A;  4DAY A;  2XSC A;  1M8A A;  1SEB D;  3ITP A;  1BCP F;  1L0X B;  2ZXP A;  2BA1 A;  2A6H D;  2DN8 A;  2F0V A;  4OO1 H;  3VYU A;  1SSO A;  3EQL C;  4FXG C;  1FNW A;  3P20 A;  4XT3 B;  2F0E A;  5C5L A;  2PZW A;  2X6L A;  5KNB A;  1OXS C;  3C1E A;  4BY1 B;  3DWQ A;  1WD0 A;  2TSS A;  1GJX A;  1B1Z A;  4ZYS A;  1J8I A;  2DY8 A;  2R61 A;  4EQO A;  3DEO A;  4HED A;  2NZ1 D;  1U4R A;  1KLU D;  5E1F A;  5A2Q L;  3HOW B;  2KQ3 A;  3HOX B;  1LV9 A;  1FD7 D;  4OIK A;  3P1H A;  1HRJ A;  3E0J A;  1YNN D;  3HRZ C;  1QG7 A;  4A3E B;  3S1Q B;  3TZD A;  3A7A B;  3LX0 A;  2NYZ D;  1LAC A;  5JJZ A;  1SMY C;  4V19 0;  4DNR B;  5K5P A;  3HOZ B;  4MHE A;  4IUR A;  5DAU A;  1XYI A;  3BYT B;  3GTK B;  4J6H A;  3OWF A;  1I4H A;  1O7Y A;  2BA0 A;  4X3U A;  3QG1 A;  1KNA A;  2K01 A;  3T13 A;  5ISR A;  3VYS A;  5CC4 A;  4KK7 A;  4H44 C;  2Y0S B;  5G3L D;  3PUY A;  3L9A X;  3MXN A;  3MEH A;  1BCP B;  2JYO A;  2IX1 A;  4IQZ A;  2F0H A;  3K0Y A;  4MIU A;  2C9O A;  5FO9 B;  3KBX A;  4RH6 A;  1WD1 A;  3V2T A;  1TVX A;  2DY7 A;  2K28 A;  5FO8 B;  2JA6 B;  2F0I A;  1QNK A;  4ZUJ A;  4ILW A;  5C3W A;  1RKN A;  1H9R A;  1S5E D;  4RGM A;  1E2W A;  3RZD B;  4DGZ A;  2MUY A;  3L3O C;  3GTQ B;  2K6A A;  1TS3 A;  1AZP A;  1EEF D;  4IUP A;  3SK4 A;  1GOZ A;  3C1F A;  5JEA H;  2F0M A;  2A68 C;  3RD4 A;  2L1B A;  3NE5 B;  3GV3 A;  2R93 B;  2I07 B;  5A35 A;  2MJ8 A;  1HFG A;  2G9H D;  5C0X J;  3Q23 A;  1AEX A;  3MFY A;  1WTW A;  2HCI A;  4A3D B;  5KIX A;  1H9S B;  1MSH A;  1I4G A;  1BO0 A;  5JPM C;  1EWC A;  1R4P B;  2L4N A;  5IOD A;  3G7L A;  1EU3 A;  3L7Z C;  5M3M B;  1JWU D;  1ICW A;  1F9Q A;  2PNR C;  4IFD J;  1Q1B A;  5CR3 A;  3BDO A;  2XRQ D;  2F03 A;  2VNU D;  2AQ1 B;  4QUC A;  4M1U B;  1H9S A;  2DNC A;  3I73 A;  4IUQ A;  3MHB A;  2PZU A;  2B63 B;  4R9W A;  3EA6 A;  4RGT A;  2K33 A;  1TY0 A;  4KY5 A;  1CM9 A;  3GV6 A;  1PFB A;  3HOV B;  1Z6H A;  1SYC A;  1O78 A;  4KN4 C;  2F0T A;  1BOS A;  1HUN A;  2Z1C A;  1UAP A;  2EYP A;  2F0S A;  2EYM A;  1ENF A;  4KI0 A;  2NTS A;  1CQV A;  4QUF A;  1Y69 U;  1PZI D;  2CHB D;  2RBM A;  1G91 A;  4FF1 A;  2JE6 I;  1A3U A;  1Q12 A;  3VA7 A;  1TWC B;  1MD2 D;  2MPM A;  5EBC A;  1AN8 A;  4HMJ A;  4ZAI A;  1D5Z C;  1PTO C;  4HN7 A;  3D4D A;  1T5E A;  2C5C A;  3CU7 A;  1BBX C;  1BNZ A;  2NVX B;  2EYO A;  3T4A C;  1D2B A;  3BS1 A;  2FMC A;  2E74 C;  3D8G A;  1LT6 D;  3C46 A;  3PUW A;  1HPC A;  5C6A A;  1LTT D;  1EWH A;  3A7L A;  4CKC A;  5D3D A;  1U4L A;  3DM1 A;  1R4Q B;  2BE5 C;  2KUM A;  4KY6 A;  2Q8I B;  3WDN A;  3H6M A;  1XXG A;  4KTA A;  4C1N I;  3IFT A;  4RAU C;  5IGE A;  4KV6 A;  3F2U A;  4ME5 A;  5E3F A;  3WOF A;  5BN4 A;  2H1E A;  1K83 B;  4A3J B;  4UAI A;  3H09 A;  3J81 E;  1CA5 A;  1ILQ A;  4C1N K;  5LL6 S;  5C3X A;  2EE1 A;  5CBE E;  4TKO B;  3QO2 A;  1TWG B;  1TWH B;  2L12 A;  2VXW A;  1FNU A;  1V1P A;  3I4L A;  1KAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...