1II3A

Structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ii3A00
1F2ZA 1SYEA 4G57A 4N9PA 4HMJA 5C5MA 4IALA 5I9PA 2WACA 5CV6A 5I6YA 5ISRA 3D4DA 2NUCA 2EYJA 3MXPA 5C5LA 3TP6A 4ODGA 1EYCA 4E6IA 3SR1A 4MIUA 3C1EA 2EY1A 3QOLA 2F0HA 4QB4A 5JOBA 2F3VA 3TP8A 1EY6A 1STHA 2F0JA 3ITPA 2F0QA 3S9WA 2F3WA 3NHHA 3VA5A 1ENAA 2PYKA 2RBMA 4DFAA 2OF1A 1EY9A 4IUNA 2F0VA 4B9XA 2F0EA 1EY7A 3D6CA 4KD4A 4KJOA 3EVQA 5F2DA 1AEXA 1EQVA 1SYGA 1EYAA 2F0DA 4N9TA 2QDBA 2EYLA 5CV5A 4EQOA 3BDCA 2EYHA 3ERQA 4KTAA 2EYOA 2EYFA 4DU9A 4K6DA 2F0FA 3OMCA 1STAA 4OL7A 5CV8A 5IGDA 2PQEA 3HEJA 3P1HA 3QOJA 5IIFA 3NQTA 1EY5A 3MZ5A 4NDXA 3T13A 4IZ8A 5IGGA 4ID6A 1A3UA 4WRDA 1TR5A 1EY8A 3QB3A 3NK9A 2ENBA 5I6WA 3H6MA 4K5VA 4DGZA 5J39A 5KYLA 1U9RA 2HQEA 3P75A 2EYMA 3BDLA 4KD3A 2RDFA 3DMUA 3EROA 5M9OA 4NMZA 2PZTA 3MVVA 2PW5A 4H7BA 4ME5A 1SNCA 4S3SA 3DHQA 4PMCA 5E1FA 5I9OA 5KYIA 3LX0A 4KV6A 5EKLA 1SYDA 1STNA 4TRDA 5HGTA 4F8MA 1EY4A 3NUCA 3SK4A 1A3VA 1EYDA 1EZ6A 2OEOA 5CR3A 2F0PA 2PW7A 1RKNA 2EYPA 2F0IA 3SK6A 4F7XA 5CC4A 1KDCA 5IGBA 1SNOA 1SNMA 2F0WA 4QF4A 3D4WA 2O4XA 5HURA 5KIXA 5K5PA 2OXPA 4RKLA 4QMGA 1JOKA 1STBA 2LKVA 4LAAA 5NUCA 4HMIA 4J1MA 2F0NA 2EY5A 5C3WA 3SK8A 1NUCA 3E5SA 4K5WA 5J1ZA 5JAVA 2F0OA 1A2UA 4PNYA 3OSOA 4B9WA 4KHVA 4EQNA 4I65A 4KJNA 5IGEA 4K2KA 5IGCA 1F2YA 2SNSA 1JOOA 1SYCA 4K2LA 4WORA 4ZUIA 3RUZA 5EGTA 3SHLA 3HZXA 5KGUA 1SYFA 3R3OA 3TMEA 1SNPA 3MEHA 5EKKA 2SNMA 3NP8A 3OMGA 5KEEA 4RKBA 2F0LA 1KDBA 2KHSA 5E3FA 1F2MA 1SNQA 2F0KA 2F0TA 4DF7A 2RKSA 3PMFA 2F0MA 5CGKA 5IGFA 4KY6A 4NKLA 3NXWA 4NP5A 5C4HA 5IOCA 1TT2A 1JOQA 2EXZA 2F0GA 1ENCA 4K5XA 4KY5A 4EVOA 3D8GA 4K8IA 3TP7A 5KRUA 5IODA 4R8NA 1EZ8A 1STGA 1TQOA 4K8JA 1KAAA 2PZUA 4ZUJA 3SXHA 3EJIA 3TP5A 5CV7A 1JORA 4K14A 3T16A 3V2TA 5J22A 5DEHA 1II3A 1EY0A 2KQ3A 5CV9A 1A2TA 4KY7A 2EY6A 3MHBA 1KABA 1A3TA 4HTHA 5C6AA 4EQPA 1KDAA 1NSNS 5C3XA 5DAUA 3C1FA 2M00A 2EY2A 3U9OA 2PZWA 4J6HA 5CV4A 2SOBA 2F0SA 4ZQ3A 2F0UA 3OWFA 3SK5A 4PMBA 4YIJA 1SNDA 1IHZA 1SYBA 5C4ZA 1STYA
chains in the Genus database with same CATH superfamily
4LF8L 3ZJYC 1DCZA 1ONLA 1HFGA 4HJ7A 3X3NA 1LT4D 4HR7B 3IL8A 3H94A 1O7ZA 3HOZH 3S2HH 1LTLA 3FMCA 1DONA 2IWHA 1EIFA 2L12A 4X66Q 3HOWG 3KBGA 2RBMA 4DKAC 2UXBL 1WCMB 1OXVA 4P72A 1V1QA 5F2DA 3M4YA 4C3IG 1HPCA 1NNXA 1SYGA 3TN2A 1SFOB 2EYLA 3NSWA 2RSOA 3V96A 4Y52H 5CV8A 1CHQD 3G7LA 2L11A 1IXRA 1U4LA 1NJIC 4A75A 4X3SA 5I6WA 4QGUA 5K36H 3GTGH 2HQEA 4DUYQ 5IT9L 3HOXB 1UEAB 3BDOA 1SNCA 3OTOL 1D2BA 3G6JB 4TRDA 5HGTA 4LFAL 4A3CG 3PO2H 3VR3A 1HNXL 4Z9CB 3M4QA 4DNIA 2EYPA 2XNAC 5EBCA 4IUPA 3UDXA 1SSOA 2JSOA 3AEVA 5GROA 5I2YA 1OXTA 3CW2C 1NY4A 2X69A 2B2WC 1CK1A 4QUFA 2B2VC 3GV6A 4JI5Q 2J0TD 3D31A 1ASZA 3AU7A 2Z8LA 4K2KA 3PUZA 3G4SA 4R9WA 3KBXA 2ZT9C 1N36L 3I4LA 1CKNA 4ZUIA 5FO7B 1T5EA 2AKWB 1BCPF 3CMAA 1LM0A 1LUZA 4R8IA 2VQEQ 4RKBA 5T1IA 3JAME 2ZM6L 2JA7H 1SBBB 3GO5A 1TS4A 1VQHA 4NKLA 1LTTD 1HZAA 1G91A 1O7LA 4RGOS 2YTVA 5JEAG 1STGA 3EJIA 1YI2A 1PH8A 3PUXA 4K14A 3V2TA 4HIMA 2D9UA 1GUNA 1YJNA 1CZGA 1EY0A 4DR7Q 2VUMH 2F4IA 3K6OA 2IY5B 4HTHA 3A5UA 2UUCQ 4YWKA 3C1FA 4PQXA 1PZID 4FYDA 1SNDA 1NTGA 1I6HH 2QW7A 2HCCA 2J4XA 2NZHA 1YNXA 5C5LA 2WB1B 1A6XA 1J6QA 2ZXRA 4BXXH 2F3WA 1JB7A 5M5XH 4KJOA 1JWSD 2K7VA 2VQEL 1GUGA 3RD4A 4JI8Q 2EYFA 4A4IA 2YV5A 1XYIA 2N49A 2G5DA 5M5YB 3HEJA 4IZ8A 2BCOA 1YHAA 5M3FH 1R9TB 3G48A 2JK8A 3MXNA 3J81E 2NB0A 1A8VA 5FLMG 1Q8IA 3DEOA 2FFKB 4DXGA 2B3GA 4JI2Q 3TS2A 1TS5A 3OTOQ 4J15A 2UU9Q 4BBSG 1TWFB 1ENFA 2R93G 2FXQA 3IAYA 4NXMQ 2KEDA 1CI3M 1ET6A 3J7AF 4UP8A 4XDXA 4OO1H 3Q6SA 3STBD 2E2HB 5J1ZA 2B2YA 3FRPB 1RF2D 4AH6A 3HOVH 4DR4L 1YJWA 1PTOH 2VUMB 1F2YA 1JOOA 4K0KQ 1DM0B 2WAQE 3CCUA 1IYJB 1HTPA 4LFAQ 5K36G 2RHQB 3S1QB 2CW0D 4H0LC 1F2MA 5CORA 1G2TA 2EQSA 2RKSA 2XTIA 2ZXPA 1W6KA 1NMGA 5ELCA 3HOVB 1K3BC 1SROA 4GLAC 1HR0W 1YHBA 3VYUA 5KNBA 4K8IA 1DJRD 4CKCA 1HH2P 1TQOA 2N8NA 4A3EH 1UE6A 3GTPH 4OIKA 2PZUA 1JE4A 1JORA 1BBWA 3GTGB 3J7AV 4KY7A 3ERSX 4IJLA 5G3LD 1CSPA 1L1OA 3J7A5 2FMCA 1WTQA 3NWTA 2PW7A 4UHVA 4X65Q 4YCWA 4BY1G 4BY1H 4JI4Q 1VQCA 4XQJA 2V4DA 4RHRA 2B63B 1S5CD 4CKBA 1O7IA 3MXPA 3TP6A 2E5LL 2PMZB 2YU9H 1MHWC 1X3FA 2N78A 3ICEA 1F2LA 1H9JA 5JOBA 1GUWA 1E2ZA 2UXBQ 1K0SA 1LTID 3S15H 1YEZA 4KD4A 2WB1E 1X3PA 2JA5G 4CJ2C 1QUQB 1TWCH 2NVQB 1I3QH 2EYHA 3AFQA 4LF4L 5C44B 3BZDB 4HJAA 4MNOA 2K75A 1JB3A 4A3JH 4DV1L 2Q2TA 1SDFA 2A69D 3NTHA 3I4MH 3O13A 1K8MA 5C4JB 5CMDA 1A3UA 2PQAA 4RA8A 1DXMA 4K5VA 2CW0C 4JI0Q 5J39A 3P75A 1WTWA 3BDLA 3UDFA 3PO3G 2HCIA 1TWCB 1B70B 1T9HA 2FMMA 3TBIB 2WINB 5I9OA 2MO0A 3SVMA 3I4NG 3CCJA 2YTXA 4OO1I 1UEBA 3RZOH 3RLNA 2B2VA 4UAIA 3AQQA 4A3IH 1LO5D 1IL8A 3FKIB 2HHHQ 3K57A 2Z0SA 5JJIA 1LT6D 1SNMA 2CWAA 4JI7L 1IBLL 2BH2A 4P75A 3H0GH 4QMGA 4JI6L 1GVPA 1W3SA 3PUVA 3DM1A 2IL8A 2VQFL 1NCVA 2H4OA 3IKJA 3VR4A 3KUPA 2LY7A 1ICWA 3NBIA 2M9VA 3D3RA 1B3QA 1C7YA 3OYYA 2KHSA 1YHQA 2CH4A 1VQ8A 1VQJA 2DJGC 1Y1WG 3PCOB 1ZYRD 4DAYA 1EQRA 2HDMA 3LWEA 4O1NA 1EFID 2LS01 2EXZA 4KY5A 3EIVA 3TP7A 3HOUH 3A56A 4L5TA 2K4KA 3TZDA 1N33L 3DM3A 1VQ7A 3IFDA 3VR5A 2L0CA 4CDCC 3HKZE 3S17H 1TXYA 3EA6A 4RWSC 1LLRD 1A3TA 1KNAA 4LF5Q 1DYQA 1B44D 1WCMH 5C4XH 4BBSB 4J6HA 1NR2A 2LSSA 1CKNB 3PUWA 4DUZL 2F1MA 4IPGA 3SEBA 5LMUQ 1Q7YC 4RHSA 5FO8B 1FGBD 4DR3Q 3GTPB 3J80i 4QL5A 4R4CA 2NTSA 1QCBD 1JCKB 2AQ2B 4LF6L 2L5TA 1JQYD 2F0VA 1FJGL 1LTRD 2A1AA 3NBHA 2NVYH 1QNUA 1EYAA 2F0DA 1EU4A 2ZTDA 4DV5Q 3ERQA 1YVCA 4WFN3 3NENA 1DGSA 1PH6A 1X3QA 4BA1I 2K50A 1EIHA 3NQTA 1EY5A 3S16H 3TS0A 4K0KL 4OIJA 4RGTA 2ENBA 3RLFA 3J81c 4IPHA 2GVBA 4FDBA 2RDFA 3R93A 4H7BA 4ME5A 1OXUA 5EKIA 1JJGA 4OWWB 5EKLA 3KFUA 4BY7B 2IPKD 3WOEA 1QG7A 5JEAJ 1HUNA 2MP1A 3CKIB 3EQLC 3EN2A 1EYDA 3K5LA 1Y1WH 1G291 1I4XA 2MQHA 1BBUA 1P8LA 2F0WA 3UE0A 2N88A 2LKVA 4YWLA 1N34L 4GS3A 1UAPA 5JAVA 4M8AA 3CCLA 4B08A 3NE5B 2VS1A 1TU2B 3R2TA 3EBEA 1EEFD 3I4OA 2N3SA 2UUAQ 2SNMA 5DM73 3K5MA 2PQAB 4AQYQ 1L1OB 3DWQA 2IX3A 4X62L 4ZCKA 4A3IG 3S1NH 2E2IB 5ELFA 4K5XA 4NXML 4DAPA 2JA6G 2XIWA 2C35B 1QWYA 5IODA 3JC66 2BDNA 3GD7A 1SE2A 1PH4A 4G7OC 2EXDA 3T16A 2JQOA 3RLOA 4XYQA 4KKSA 2MGSA 4DNTB 4ABNA 1VQMA 2YU9B 3NTKA 4JI6Q 2OCEA 4EQPA 5IP9H 3GTLH 2CQAA 1PZKD 5H1SE 1N8RC 3SK5A 2UXCQ 1ML0D 3UI2A 3KF6A 3HKSA 4JI1L 2NN6I 4DK1A 1CUKA 5I6YA 2WAQB 5C0XH 1EYCA 1Y1VH 5M5XB 5IE8A 3U58A 2ATWA 4K6LA 1EY6A 2Z6KC 3I91A 1BDOA 3VA5A 1XNQQ 4DFAA 3M9BA 2CFMA 3S1RB 3UE1A 3I8ZA 3GTOH 2PI2E 1M90C 1IW7D 1CKOA 3S2DH 2ZM6Q 1MKHA 3HOUG 3OMCA 3JAMc 2PQEA 5AJ3L 1WTPA 4FXDA 2UXDL 4APVA 1I5FA 2KCCA 3NEMA 1TR5A 2JP1A 4JOIA 4GNXB 2BA0A 4R4QA 1XPUA 4XTCS 1MGSA 4X6AH 3K7AH 4LF7L 2EZVA 2KA7A 2I5LX 2FHTA 2IJ0A 3W1GA 4FP5D 2D0OA 1ILQA 4XYOA 4DV7L 1F9PA 1S5ED 2B63G 2N55A 5BR8L 5FKAC 1QVGA 3PO2B 3E9HA 5A2QE 2RCFA 3E3XA 4KI0A 1Q3LA 3DEPA 1HNXQ 1XXGA 1XX8A 3K7AB 1KRSA 3BVZA 3I3CA 3T4AC 4C1NI 3KYHC 1PA6A 1VS0A 4DR2L 5C3WA 1IBKL 4FF4A 1UE7A 1VQ5A 4KHVA 4CBVA 4HN7A 3L2PA 2E2HH 1PH9A 4IUTA 2NVQH 4LWCA 1AW7A 3BYTB 3PO3H 3TDQA 5LL6X 3H3VC 1K8AC 5IYBG 2F0MA 2JA8H 1XTCD 2WIIB 3I2ZA 2CHBD 5C3EH 4NP5A 5LMNW 1PH7A 1PFMA 4GOPB 3I55A 2H1EA 3CHBD 4G7HC 1L2FA 4ZUJA 3OW2A 4L63B 3TREA 4JPBW 3PO3B 5CYUA 4HJ5A 4RFBA 4XT1B 1VQFA 1X6OA 3S1MB 1LT3D 3U9OA 4GOPA 3OWFA 2K6AA 3M3YB 3NBHB 1F2ZA 4OWXB 2WACA 4PG3A 2E75C 5D65A 3T1YL 3I4MB 3V05A 2XN9C 5D3IB 1STHA 1JE5A 2F0QA 4MTNA 1I3QB 1V1PB 3E0EA 3A8JE 4IUNA 3J80E 2RCNA 2EE1A 2MO1A 1DZ1A 2YYZA 1GHJA 4K6DA 1ZYRC 2IHFA 1L1OC 3P20A 4A76A 3HG9A 4GLVB 3FVQA 5JJKA 4OELB 3DLLA 2A74C 1LT5D 5LMUL 5J3BA 3MWYW 5IP7G 4JV5L 4NB3A 1F9RA 2G9HD 3WWVA 2M2LA 4F87A 3DHQA 1STNA 4U68A 4CDDC 2KENA 2VUMG 4F8MA 1LACA 1CFMA 3K5NA 3HOVG 2NTTA 3M4OB 2EDGA 1HCZA 3M7NA 1Y1WB 4DV6L 5CC4A 1K3RA 2G9DA 1NE3A 2RQXA 2LXJA 1D5MC 1U4RA 1EIGA 1NMFA 1XNRL 1YNJC 2EY5A 5CBAE 5JVH3 1H9MA 2I46A 3SK8A 3HOUB 2CWPA 4RGNA 1WTHA 1GXDC 2IHEA 1V9PA 4I7ZC 4GLXA 2UUCL 2UXDQ 2KBNA 2SNSA 4K2LA 5ELEA 2EJGC 3TMEA 1KDBA 4H02A 5A2QL 1Q1EA 1SNQA 2FJ2A 4LF4Q 1N32L 2K05A 3I90A 3PO2G 5COYA 1U4MA 3BG3A 5LMNL 4F88A 1VQKA 5GADC 3MXNB 3BU2A 1TY0A 1EZ8A 4JW0A 4NXNL 2MFIA 3MC0B 2K01A 2QKIC 4LUVA 1MJEA 2OTJA 1XMOQ 1BVSA 1D7QA 1E1OA 3I70A 2GVAA 1FD7D 3FPPA 1E24A 1TWAB 2ICEC 1RTNA 2K5VA 2F0SA 1C0AA 5C4ZA 1QE6A 1VMCA 3E0JA 4JI0L 5C3EB 1WD1A 2K28A 1DOMA 1TVXA 1X65A 1UE5A 2EYJA 2UUBQ 1IZ6A 1VQBA 1E3PA 4MIUA 2HD3A 4GOPC 1G6PA 1I50B 3A0JA 1Y8OB 4X62Q 1GUSA 1S72A 5FOBB 1V8QA 2QEXA 4GKKQ 1PZJD 4IFDI 1HQMC 5JEAH 4QIWB 2HT1A 4EQOA 5IT9c 1VQ9A 1PHJA 1FL0A 1Y8NB 1PVOA 4L6TB 3BVMA 1IKMA 1YZ6A 5IIFA 5IGGA 4IUQA 4R4OA 1EY8A 1PYWD 3H6MA 3CCVA 2AQ3B 4WJ3M 2OT2A 1X3EA 2QCPX 4TSSA 3OW7A 4DV0L 3KF8A 3QJYA 4PMCA 1SE8A 1DOKA 3HOYG 3L9AX 4PZ8A 3CU7A 5M5WH 4DV4Q 3LNNA 1CA6A 2QF7A 3EFXD 2MPMA 3M7GA 3KDFB 1NR4A 1RDPD 5K5PA 4DV4L 1STBA 4HMIA 2A68C 5GAEC 3OOCA 1O78A 1HR0L 1XWEA 3E5SA 1XMQL 5FLXL 3PV0A 4A3CH 3T51B 1CT1D 1PFBA 2K5DA 4TQUS 5ELDA 3H91A 1TIID 4MZ9A 1VF5C 4KHZA 4ME3A 5C0XI 4A3GB 4DF7A 4DV7Q 4IO9A 4O2DA 2NN6H 3K80C 1Y8PB 4LMQD 4DA2A 2EOTA 1MSHA 4RGMA 1WTRA 2F0GA 1PFSA 1SJED 4R8NA 3S2HB 4BBRG 3GTLB 1TS2A 3PIP3 4DK0A 2CH4W 5J22A 1VQOA 4FVMA 4EGVA 4CDEC 4A3MH 4CJ0B 3U50C 1QNKA 3M85A 1WTOA 1WI5A 2M00A 4OGQC 4BA2I 4CDFC 1ENAA 1STYA 3MFYA 1SRUA 1VQ4A 4LF9Q 4HCSA 4A3JB 3T56B 2IT1A 2Z9HA 5CV6A 5ISRA 2NUCA 3QWNA 2JA5B 1E1TA 4CHTB 4BWGB 2ZJRA 3K81C 4A3JG 3JAMi 3CD6A 2QILA 4TVAB 4KN4C 1TY2A 2XVSA 4O42A 2AWOA 2SEBD 2RHSB 4IURA 3TZUA 1Y1VG 2PMZE 4X64L 1B9NA 2WB1G 2MJ8A 4MTKA 3RZDB 2IX1A 4DR1Q 1NAPA 4C1NK 3KOJA 1L0YB 2I0QA 2JA6B 3HP3A 1SN8A 2K5QA 4C3HH 1NBWA 1U9RA 1GD7A 4MN3A 2PZTA 3PIOA 2HHHL 1HA5A 2LMCB 3S1MH 4FF1A 3K59A 3CCRA 2F0PA 4F7XA 2C5CA 4QCLA 1VQIA 4PV1C 3J7YW 4QF4A 5EQ0A 1ASYA 1EFWA 1X32A 1VDZA 2XRSD 4ZK9B 2QA4A 2B8FA 2HUGA 4JI3Q 3M3YH 1H9RA 4NPSA 3OSOA 3J81L 3S17B 3MEFA 4JI1Q 4X64Q 2JA7B 1B2TA 1PRTC 1YNNC 2UXCL 1J5EQ 1B53A 4Y7NH 1H9SA 3KLWA 2NZOA 3KDFA 3CP0A 1UWVA 4KY6A 3MAQA 2F4VQ 3SE0A 3DUZA 3I4MG 4N8FA 4A3FB 3K8AA 5IYDH 1PLFA 1MD2D 1F9SA 4XIGS 4DR5L 1FYCA 1B50A 3K5OA 5DAUA 1AE3A 2PNRC 3F2CA 4DV5L 4X65L 2SOBA 3HKZG 5ELBA 3BVGA 1CQFA 4XXEA 4JV5Q 2FINB 2RF4A 2OTLA 2ICIA 4OHJA 2VXWA 4LF6Q 2YTYA 5EBDA 2E8GA 2K5WA 2RA4A 4G4KA 4DUZQ 3J7ZC 4A3MG 4IOAA 1EQTA 1D1KA 4TKOB 4B3TQ 2F3VA 3S2DB 5EPKA 2P5ZX 3CMEA 3NHHA 3W1BA 4JBJA 2JA8B 4BBRH 3F1ZA 1QILA 1SMYC 1FVIA 3W5OA 1SFOH 4JOIC 2B2WA 3CAMA 5FK9C 3E6ZX 5M3FB 5HGQA 1R9TH 3MXGA 5I2XA 1GUOA 3QOJA 3I56A 1QJOA 5LL6S 1AP0A 4A3KH 3R2IA 4JI8L 4DR3L 1BQQT 4DV0Q 5HY6A 3RR5A 2BDOA 1Q8KA 5AJ3Q 1DOLA 4Q5VA 4AYBB 1T5XD 2A19A 1N32Q 2R3ZA 4KN7C 3A5ZB 4CGYB 1IBML 2V1CC 2QGQA 4B3SL 2KJXA 3Q22A 2OEOA 1LYLA 1RKNA 1X55A 2R7ZB 5T1GA 2OXPA 1KIXA 1EWIA 4XT3B 2B2TC 1HR0Q 4J1MA 3VYRA 1E7ZA 2VL6A 3HOYH 1A62A 1IYUA 1WYDA 2I5MX 1CZWA 4I65A 2D0PA 2HDLA 4PMWA 2QEJC 1JR0D 1PTOD 3F2UA 1EL0A 3H09A 3RMHA 1S5BD 4FF3A 5EKKA 2PCFB 3OMGA 4GKJL 2L9HA 1S5DD 2F0KA 1RD9D 2VQFQ 3PMFA 4C2MH 5IGFA 1LTGD 2L4NA 3SDZA 2HIXA 4JYAQ 4ZRZA 5C4XB 5EJWA 1HZ9A 4JYAL 2CKZB 3Q0AA 2NVXH 2K14A 5KRUA 3KJPA 1BF4A 4LUZA 1WTVA 1XNQL 3SXHA 3PF4A 4JC0A 4DR1L 2D2CC 4FO2A 3MFGA 2B2TA 3MHBA 2DNCA 1SLJA 4AIMA 1MIUA 1KRTA 2R93B 4IOCA 4ZAIA 3AFPA 4LJZC 1SYBA 4CKEA 2AQ1B 5I9PA 4KK7A 1JICA 4BS9A 4LFBL 2JA5H 5BN4A 4ODGA 2EIFA 3R8BA 1RTOA 1MJCA 1TKWB 2R6GA 1V1PA 3T1YQ 5KNDA 1V43A 1E2VA 4C3IH 1EY9A 4JBWA 3CCQA 3CXCA 5C0XJ 4POGA 3EVQA 1K9MC 1F9QA 3J81j 1EQVA 1TWHB 4RCNA 2QDBA 4KTAA 4GZYC 4RH6A 3C3LA 3K58A 1XPRA 1XNRQ 3GTQH 1ZEQX 3CQZB 1CA5A 1PTOC 4ID6A 2IX0A 4WRDA 2OWOA 3QB3A 3NK9A 3M4PA 5KYLA 2EYMA 4A93G 4RMFA 1B1ZA 1SYDA 3I72A 1BKBA 3OHXC 1IYVA 1ZKOA 1Q46A 1EY4A 1KNEA 3SGIA 3SK4A 1SXTA 1B7YB 5C3EG 1HA6A 2VNUD 2EJFC 1F77A 2F0IA 4B3MQ 1RL2A 1HNZQ 1K8GA 4UPAA 5IWAQ 3U9SA 4C3JH 5NUCA 2R92B 3GDEA 2A8VA 1GKHA 3NELA 1K28A 1EIYB 4KKTA 4LFCQ 4LF9L 4BY7G 1SYCA 2ZTCA 4FXKC 5EGTA 3A55A 1ILPA 4JG2A 1JJ2A 2E5LQ 4G7ZC 3QR8A 2BA1A 5TSSA 1ICFB 4LFCL 2AWNA 1D1IA 4WJWA 1TS3A 1Q12A 2RDGA 1K83B 1HTLD 1FGUA 2Q2IA 1K73C 2L15A 3D8GA 4NW2A 2XGTA 2KVMA 1A15A 1K8OA 1KAAA 2XSCA 4N8X1 2JEAI 1XTDA 4DUYL 5CV9A 1SMXA 4H44C 1Y1VB 3A7LA 2KECA 4DR6L 1JWUD 1KABA 4WJ4A 2I07B 1KDAA 1SR3A 2A6HD 1K83H 1LTBD 5C3XA 1AH9A 4GN3B 4ZQ3A 2VB3X 4A3LG 4B3ML 1C9OA 4L5QA 2O5JC 4LF5L 1K0RA 2IW3A 3HGBA 4H13C 1JWMD 5DLQE 4ULLA 1PH1A 4C56C 1I4QA 3A8IE 3HOWB 3S9WA 3KK7A 3K0YA 1I4HA 2AUJD 3L7ZC 1CM9A 1VQEA 2OF1A 1KL9A 1Q82C 2L1BA 5BN5A 1TWGB 1JC7A 5E4WC 3STBC 3E9IA 3S24A 1D6EC 1PMRA 1KQSA 4DV3Q 4JI3L 4C3HB 3A8KE 5IYDG 5IGDA 4HAEA 1O80A 5M5WB 4ZLTF 2A6ED 5IP9G 2A68D 1QZHA 3DMUA 1OXSC 3T1HL 4DN4M 4OO1G 5BR8Q 3LX0A 2TMPA 4A3FH 2K52A 1KTKA 1X54A 3ULPA 3MXUA 1H9KA 2DY7A 1A3VA 1YBYA 1BBXC 1RJTA 1EZ6A 1R4PB 2R93H 4PZ7A 3N52A 5GAHC 3CF5A 2B2YC 1SE3A 1N33Q 1CQVA 3S16B 1AE2A 1HUMA 1IBKQ 3VR6A 4IJHA 3OWEB 2PI2A 2MNAA 3AMUA 2KCTA 4RAUC 3NQIA 4R4TA 4BBRB 3J81i 4M1UB 4WORA 3RUZA 5KGUA 1SMYD 2Q8TA 1SYFA 4UP7A 4IFDG 5A35A 4DV3L 2Q2UA 4L8JA 5DNFA 2F0LA 4IUVA 4A3EB 1L0WA 2Z4IA 5BN3A 2Z6KA 4DR7L 4OX9Q 2R92H 3UDGA 2DUDA 1U5KA 1QZGA 2GN5A 1BR9A 3WDNA 3AB9A 1PYSB 2C9OA 2NBFA 3PIPA 3K0XA 1H9SB 5C4JH 4GNXA 2A69C 2R7DA 4LNQA 1W2BA 3DXJC 4YIJA 1KHIA 2VB2X 3C2PA 3ONAB 2K03A 1GO3E 4IALA 4AQYL 1WVLA 1B8AA 1U0LA 4R4IA 4E6IA 2B8GA 2Y0SG 4A3IB 4EX5A 4A3KB 2E2JB 4QB4A 3TP8A 2BE5C 4POFA 2F0EA 3D6CA 1QOHA 1STEA 1PRTD 1YNND 3RNUA 4XQNA 1Q86C 3PQIA 1OXXK 4UP9A 2Z6BA 2KEEA 3BDCA 3UDIA 2E2DC 1X3GA 4B3RL 4A3BG 2F0FA 1JMCA 1STAA 2JA6H 4V190 3PSIA 2BH8A 3T13A 5C4XG 4IPDA 1WCMG 4LK1C 3H0GB 2B29A 2OQKA 2TSSA 1QVCA 1XPOA 3HOZB 1Y14B 4DGZA 4L5RC 4IQZA 3KJOA 1GHKA 4NMZA 2UU9L 2KCMA 2XWJB 1BNZA 2UUAL 2JXMB 1SE4A 2ASBA 3F8TA 1HNZL 5CR3A 2KHIA 3IFTA 5IGBA 3D4WA 2A5HA 1KLGD 2R7FA 5HURA 2EJMA 1E22A 1FNWA 3FHWA 3CCEA 4V0BA 5C44H 5IGEA 4LF7Q 2HQLA 2DY8A 3U4ZA 3I73A 1M8AA 3BZKA 3R3OA 4YHHQ 3KLSX 1Y69U 4Y7NB 4IFDJ 3VDYA 1N9WA 3CRKC 1ESRA 1O7YA 4DV2Q 1R4QB 3KF8B 2L55A 4QY7A 5LMNQ 5C4HA 1C4QA 5IWAL 1XJVA 1HRJA 3K7UC 3D4RA 3RZOB 3W3AA 3ULLA 4K8JA 2CCZA 1BXTA 4BY1B 5D14A 5CV7A 2F4VL 1PYBA 1I94Q 5G3LF 2ZTEA 1M4VA 3Q24A 5IOCA 2F03A 3I7FA 1AN8A 1I6VC 1D8LA 1N36Q 1X9NA 1PV4A 3MA2B 4HEDA 4A3DB 2PO4A 5EAYA 3U4VA 4HCEA 4AYBG 5I4DA 2EY1A 1JT8A 1C8CA 1M1KC 1RCVD 2F0JA 1CHPD 2PYKA 3RN5A 1HNWQ 4QUCA 2F52A 1FR3A 1U4PA 3HS0C 4UY8C 1PTOF 3Q23A 1PXUA 5CV5A 3GV3A 3C46A 3H3VI 1I6HB 1ESFA 5CBEE 4DR6Q 4DK6C 3P1HA 2R92G 1WTXA 3MZ5A 4DV1Q 2K33A 4C3JB 5LHY1 4NXNQ 5IY0A 2R7ZG 4OWTB 1UNSA 1MBYA 2XWBB 4IFDH 1GM5A 1I4RA 4S3SA 3CC2A 2Y0SB 5KYIA 5EPJA 2NVTB 1I94L 1BCPB 3Q8DA 3GTMB 1KXLA 1EOTA 2GA4B 4IN3A 2NN6G 4X3KA 4B3SQ 3SK6A 1Q1BA 1BOSA 1SNOA 3A74A 3DWAA 3TEHB 3ULJA 3G6EA 2O4XA 5FJ8G 1W6JA 5KIXA 3H0GG 4DR4Q 1JOKA 1KC8C 4LAAA 5IT9E 1XMQQ 4GN5A 2F0NA 4YY3Q 1B4OA 1VQPA 5IYBH 3KLSA 2QDLA 2D5DA 4K5WA 3BS1A 4PNYA 5JVG3 1IBLQ 3IRBA 4X3UA 5IGCA 1IKLA 3QIAA 4A3FG 3F2DA 4ALPA 4BY7H 1SNPA 4OEMB 1H95A 1Z9FA 4JI2L 3OIPA 5E3FA 5ELNA 5IP7H 2VY3A 4DK3C 2F0TA 3LWUA 5CGKA 4DV6Q 2K1BA 3NXWA 4DR5Q 3NTIA 1QVFA 1LV9A 5FJ8H 3QO2A 1PH3A 1ENCA 2KCNA 4BBSH 3A7AB 4UDUC 1LTAD 2AUKA 1ET9A 1WOCA 5E4XA 2B2UA 2KQ3A 1A2TA 3HFZB 1L0XB 5IYCG 3CC7A 3GTKH 4A93H 3MTSA 3W2DA 5KEEA 4YCVA 4YCUA 1WJJA 2WKDA 1IHZA 3TP5A 5M3FG 1I50H 4G57A 4N9PA 2R7ZH 3FDTA 4IPCA 1E2WA 4DXFA 3D0FA 3OIQA 3A54A 2JYOA 3H3VH 3C1EA 4XQQA 1HFNA 4A3LH 1DD2A 3G71A 3VYTA 3B6YA 4QIWE 2F3IA 3GTMH 5EPLA 4RCOA 4PZ6A 1TWHH 1OO9B 4BXXG 4DAMA 4P74A 4HSPA 1E0BA 2Q8RE 1CSQA 2ID0A 1FJGQ 1TWGH 5C0XG 3GP7A 4QQBX 4NDXA 3HRZC 1G6ZA 5KNCA 2K5NA 3OPOA 4DR2Q 3ZYYX 3L0OA 1SJHD 2JA8G 4KHPQ 2I5HA 3EROA 3CCMA 1BCPD 4FF2A 5E1FA 2MUYA 4KV6A 1SEBD 4CJ1B 2O5IC 1QUQA 3NPPA 4GKJQ 4KMUC 3NUCA 1S3OA 3JAML 1KDCA 5JJLA 3ND8A 1XMOL 1V1OA 1PRTF 1PH2A 4C3JG 1VQGA 3PUYA 1QB5D 4A3DH 2DJFC 1VQAA 4HJ9A 2D62A 4MHEA 2JA7G 1VMPA 2KOLA 2EVBA 3GQBA 1A2UA 1G8ZD 5FLMH 5D3DA 4HIKA 5GAGC 3CPWA 4OXPA 1S5FD 2K5HA 4KLKA 2K32A 3P7JA 1EWCA 3N6RA 4YY3L 3DWPA 1MSGA 2MHVA 2HIVA 2UUBL 1OTCA 3NP8A 1AFPA 2J7ZA 1GOZA 2R61A 2JE6I 1TT2A 1JOQA 4EVOA 3HOYB 4R1JA 3NWSA 1VCIA 2K04A 4U673 1WD0A 4JI7Q 1FNUA 1II3A 3HKZB 4C3IB 3HOXH 3F2BA 2Z4HA 4J8QA 5C6AA 2PPBC 1GJXA 3KLRA 3M4OH 4EQ5A 2EY2A 5CV4A 1EUJA 1G2SA 4JI4L 2KHJA 4JBKA 4A3BB 4DAYB 4A3MB 1D5ZC 4HMJA 4ZYSA 5GQOA 4OONA 1LTSD 2KUMA 3D4DA 3T1HQ 2PNHA 4GNXC 3CQZH 1J8IA 4B3TL 2O2LD 3HOXG 1HZCA 2F0HA 1I4GA 3ITPA 1HNWL 5FO9B 2ES2A 4LFBQ 4FXGC 2E74C 2BOSA 2LFNA 1KAWA 3GTKB 4DNRB 2E2JH 1AEXA 4Q0FA 4N9TA 4DV2L 3TQYA 5ELOA 2EYOA 2AHOB 4OL7A 4P73A 3S15B 1N34Q 5DM63 1Q90A 5IYCH 3TSSA 3WOFA 3QG1A 1S4ZA 3S1QH 4KD3A 3AYHB 2PW5A 2DN8A 3MVVA 4AYBE 4ZKCB 1VQLA 1IBMQ 1TWAH 4KHPL 4A3DG 1B9MA 2DNEA 1WFQA 1KD1C 4A93B 1HZBA 5JJZA 1IW7C 1RIPA 4X3TA 2B39A 1YJ9A 1PDQA 4RKLA 1I4PA 1EOVA 2RDHA 1HJPA 4C2MB 4P71A 3FEWX 3PGZA 3VR2A 1EYGA 4KJNA 4JK1C 2WFWA 2Q8IB 2NVXB 2AMCB 1LABA 3HZXA 4JCVE 4JVZA 3MEHA 3S14B 2NVYB 3L3OC 2CQOA 3T53B 5FLXc 1D5XC 4DAVA 1EQQA 3VA7A 4YWMA 4A3KG 2XRQD 1A63A 1J9OA 3FPUB 4ZKBB 3S14H 3GTJH 4GKKL 1B3AA 3BJUA 1G51A 4JBMA 3HOWH 1KLUD 2WV6D 5DEHA 2RVLA 4OX9L 1TWFH 3HOZG 2EY6A 4B3RQ 3ER0A 3S1RH 3GTOB 3H15A 1NSNS 1AZPA 3PIO3 2CVRA 2PZWA 4LW1A 1FNVA 2F0UA 1MI2A 4P2CB 4C3HG 5JPMC 4ILWA 1SYEA 1JJCB 3GTJB 3D6WA 5C5MA 2NVTH 3TRZA 1Q81C 1A0IA 4X66L 1S40A 1J5EL 3LGJA 3SR1A 4HJ8A 1CTMA 4KKUA 4HIDA 3QOLA 3FKIH 4RG1A 4A3GG 2NYZD 4QJFA 5JPNC 1Z47A 3GTQB 5M5YH 4B9XA 2Z1CA 1EY7A 1HXYD 1VQNA 3X3MA 2WAQG 2VZAA 3FP9A 3KF6B 4GN4B 3RZDH 4L5SA 3J80L 1GUTA 4A3GH 2B2UC 1BO0A 2EPBA 1Z7TA 4FNFA 4DU9A 1VQ6A 2ALYB 1BUVT 2A6EC 2ZXOA 3PF5A 2X6GA 1UE1A 2NWGA 3S1NB 2Q2HA 2DGYA 1RHPA 4I7AA 3RN2A 1SAPA 2LXKA 4HIOA 3CPFA 2JA9A 3CC4A 5M9OA 2Y0SE 5M3MG 2BE5D 1HHVA 2SDFA 4DPGA 5M3MB 1PH5A 1YNJD 1AZQA 2X6LA 3VYSA 4JI5L 4A3EG 3URYA 3J80c 1UUPA 4IUUA 1ZXTA 2B63H 3CRLC 2VW9A 1PRTB 5M3MH 1NUCA 2F0OA 3ND9A 2H5XA 5C44G 4B9WA 4EQNA 2RSNA 1PTOB 2WP8J 2A6HC 3I4NH 3SHLA 1EU3A 2OQ0A 1CKMA 1YIJA 1VQDA 1X56A 1PFNA 2ZJQA 5E7NA 1C48A 4HSVA 1YITA 3CCSA 1EEID 4YHHL 2JEBI 1HQRD 2E76C 3I4NB 1Z6HA 1EWHA 2WKCA 2NZ1D 1RODA 4O0AA 1VF7A 2A73B 5FLXE 1BCPC 3BYYB 5AFWA 2JJQA 4LUOA 1P16A 2ZJPA 2E2IH 1IL2A 5L37A 2JN4A 4PMBA 4LF8Q 3FKIG 4A3BH 3BZCA
chains in the Genus database with same CATH topology
1DCZA 1ONLA 1HFGA 3X3NA 1LT4D 4HR7B 3IL8A 3H94A 1O7ZA 3FMCA 1DONA 2IWHA 2L12A 3KBGA 2RBMA 1WCMB 1OXVA 5F2DA 3M4YA 4C3IG 1HPCA 1SYGA 3TN2A 1SFOB 2EYLA 3NSWA 2RSOA 3V96A 5CV8A 1CHQD 3G7LA 2L11A 1U4LA 4X3SA 5I6WA 5K36H 2HQEA 5IT9L 3HOXB 1UEAB 3BDOA 1SNCA 1D2BA 3G6JB 5HGTA 3VR3A 4Z9CB 2EYPA 2XNAC 5EBCA 4IUPA 1SSOA 2JSOA 5I2YA 1OXTA 2X69A 2B2WC 1CK1A 4QUFA 2B2VC 3GV6A 2J0TD 3D31A 3AU7A 2Z8LA 4K2KA 3PUZA 4R9WA 3KBXA 2ZT9C 3I4LA 4ZUIA 5FO7B 1T5EA 1BCPF 4R8IA 4RKBA 5T1IA 3JAME 1SBBB 3GO5A 1TS4A 4NKLA 1LTTD 1G91A 1O7LA 4RGOS 5JEAG 1STGA 3EJIA 3PUXA 4K14A 3V2TA 2D9UA 1GUNA 1CZGA 1EY0A 2F4IA 3K6OA 4HTHA 3C1FA 4PQXA 1PZID 4FYDA 1SNDA 2HCCA 2J4XA 5C5LA 2WB1B 1A6XA 2ZXRA 2F3WA 4KJOA 1JWSD 2K7VA 1GUGA 3RD4A 2EYFA 1XYIA 5M5YB 3HEJA 4IZ8A 2BCOA 1R9TB 3MXNA 3J81E 2NB0A 1Q8IA 3DEOA 2FFKB 4DXGA 1TS5A 1TWFB 1ENFA 3IAYA 2KEDA 1CI3M 1ET6A 3J7AF 4XDXA 4OO1H 3Q6SA 2E2HB 5J1ZA 2B2YA 3FRPB 1RF2D 1PTOH 2VUMB 1F2YA 1JOOA 1DM0B 1HTPA 5K36G 3S1QB 2CW0D 4H0LC 1F2MA 5CORA 1G2TA 2RKSA 2ZXPA 1W6KA 5ELCA 3HOVB 3VYUA 5KNBA 4K8IA 1DJRD 4CKCA 1TQOA 2PZUA 4OIKA 1JE4A 1JORA 3GTGB 3J7AV 4KY7A 5G3LD 2FMCA 1WTQA 3NWTA 2PW7A 4XQJA 2V4DA 4RHRA 2B63B 1S5CD 4CKBA 3MXPA 3TP6A 2PMZB 1F2LA 1H9JA 5JOBA 1GUWA 1E2ZA 1LTID 4KD4A 1X3PA 4CJ2C 2NVQB 2EYHA 5C44B 3BZDB 1JB3A 1SDFA 2A69D 3NTHA 3O13A 1K8MA 5C4JB 5CMDA 1A3UA 4RA8A 1DXMA 4K5VA 2CW0C 5J39A 3P75A 1WTWA 3BDLA 2HCIA 1TWCB 2FMMA 3TBIB 2WINB 5I9OA 3SVMA 4OO1I 2B2VA 4UAIA 1LO5D 1IL8A 3FKIB 3K57A 1LT6D 1SNMA 4QMGA 3PUVA 3DM1A 2IL8A 1NCVA 2H4OA 3IKJA 3VR4A 3KUPA 2LY7A 1ICWA 3NBIA 2M9VA 3D3RA 2KHSA 1ZYRD 4DAYA 2HDMA 3LWEA 4O1NA 1EFID 2LS01 2EXZA 4KY5A 3TP7A 3A56A 3TZDA 3IFDA 3VR5A 2L0CA 3EA6A 4RWSC 1LLRD 1A3TA 1KNAA 1DYQA 1B44D 4BBSB 4J6HA 1NR2A 3PUWA 2F1MA 3SEBA 4RHSA 5FO8B 1FGBD 3GTPB 2NTSA 1QCBD 1JCKB 2AQ2B 2L5TA 1JQYD 2F0VA 1LTRD 3NBHA 1QNUA 1EYAA 2F0DA 1EU4A 3ERQA 4WFN3 1X3QA 4BA1I 1EIHA 3NQTA 1EY5A 4OIJA 4RGTA 2ENBA 3RLFA 2RDFA 3R93A 4H7BA 4ME5A 1OXUA 5EKIA 5EKLA 4BY7B 2IPKD 3WOEA 1QG7A 5JEAJ 1HUNA 2MP1A 3CKIB 3EQLC 1EYDA 3K5LA 1G291 1I4XA 2F0WA 2N88A 2LKVA 1UAPA 5JAVA 4M8AA 4B08A 3NE5B 1TU2B 3R2TA 1EEFD 2SNMA 5DM73 3K5MA 3DWQA 2IX3A 2E2IB 5ELFA 4K5XA 4DAPA 2XIWA 1QWYA 5IODA 2BDNA 3GD7A 1SE2A 4G7OC 3T16A 4XYQA 4KKSA 2MGSA 4DNTB 4ABNA 2YU9B 3NTKA 4EQPA 2CQAA 1PZKD 3SK5A 1ML0D 3UI2A 2NN6I 4DK1A 5I6YA 2WAQB 5C0XH 1EYCA 5M5XB 4K6LA 1EY6A 3I91A 1BDOA 3VA5A 4DFAA 3S1RB 3I8ZA 1IW7D 3OMCA 2PQEA 1WTPA 4FXDA 2KCCA 1TR5A 2JP1A 2BA0A 4XTCS 1MGSA 2EZVA 2KA7A 2FHTA 2IJ0A 4FP5D 1ILQA 4XYOA 1F9PA 1S5ED 2N55A 5FKAC 3PO2B 5A2QE 4KI0A 1Q3LA 3DEPA 1XXGA 1XX8A 3K7AB 3BVZA 3I3CA 3T4AC 4C1NI 5C3WA 4FF4A 4KHVA 4CBVA 4HN7A 4IUTA 1AW7A 3BYTB 3TDQA 5LL6X 3H3VC 2F0MA 1XTCD 2WIIB 2CHBD 4NP5A 1PFMA 2H1EA 3CHBD 4G7HC 4ZUJA 4L63B 3PO3B 5CYUA 4RFBA 4XT1B 3S1MB 1LT3D 3U9OA 3OWFA 2K6AA 3M3YB 1F2ZA 2WACA 2E75C 5D65A 3I4MB 3V05A 2XN9C 5D3IB 1STHA 2F0QA 1I3QB 1V1PB 3A8JE 4IUNA 3J80E 2EE1A 1DZ1A 2YYZA 1GHJA 4K6DA 1ZYRC 3P20A 3HG9A 3FVQA 2A74C 1LT5D 3MWYW 1F9RA 2G9HD 2M2LA 4F87A 3DHQA 1STNA 4U68A 4F8MA 1LACA 1CFMA 3K5NA 2NTTA 3M4OB 2EDGA 1HCZA 3M7NA 1Y1WB 5CC4A 2G9DA 2RQXA 1D5MC 1U4RA 1EIGA 1YNJC 2EY5A 5CBAE 5JVH3 1H9MA 2I46A 3HOUB 3SK8A 4RGNA 1GXDC 4I7ZC 2SNSA 4K2LA 5ELEA 2EJGC 3TMEA 1KDBA 5A2QL 1Q1EA 1SNQA 2FJ2A 2K05A 3I90A 5COYA 1U4MA 3BG3A 4F88A 1TY0A 1EZ8A 3MC0B 2K01A 2QKIC 3FPPA 3I70A 1FD7D 1TWAB 2ICEC 1RTNA 2F0SA 5C4ZA 1QE6A 1VMCA 3E0JA 5C3EB 1WD1A 2K28A 1DOMA 1TVXA 2EYJA 4MIUA 1I50B 1Y8OB 1GUSA 5FOBB 1V8QA 1PZJD 4IFDI 1HQMC 5JEAH 4QIWB 4EQOA 1Y8NB 4L6TB 3BVMA 1IKMA 5IIFA 5IGGA 4IUQA 1EY8A 1PYWD 3H6MA 2AQ3B 2OT2A 2QCPX 4TSSA 3OW7A 3KF8A 3QJYA 4PMCA 1DOKA 3L9AX 3CU7A 3LNNA 1CA6A 2QF7A 3EFXD 2MPMA 3M7GA 1NR4A 1RDPD 5K5PA 1STBA 4HMIA 2A68C 3OOCA 1O78A 1XWEA 3E5SA 5FLXL 3PV0A 3T51B 1CT1D 1PFBA 2K5DA 4TQUS 5ELDA 3H91A 1TIID 1VF5C 4KHZA 5C0XI 4A3GB 4DF7A 4LMQD 2NN6H 4DA2A 1Y8PB 2EOTA 1MSHA 4RGMA 1WTRA 2F0GA 1SJED 4R8NA 3S2HB 3GTLB 1TS2A 3PIP3 4DK0A 5J22A 4FVMA 4EGVA 4CJ0B 1QNKA 3M85A 1WTOA 2M00A 4OGQC 4BA2I 1ENAA 1STYA 3MFYA 4HCSA 4A3JB 3T56B 2IT1A 5CV6A 5ISRA 2NUCA 3QWNA 2JA5B 4CHTB 4BWGB 2QILA 4KN4C 1TY2A 2XVSA 4O42A 2AWOA 2SEBD 4IURA 3TZUA 1B9NA 2MJ8A 2IX1A 3RZDB 1NAPA 4C1NK 1L0YB 2JA6B 3HP3A 2K5QA 1U9RA 4MN3A 2PZTA 1HA5A 2LMCB 4FF1A 3K59A 2F0PA 4F7XA 2C5CA 4QCLA 4PV1C 3J7YW 4QF4A 5EQ0A 1X32A 1VDZA 2XRSD 4ZK9B 2B8FA 2HUGA 1H9RA 3OSOA 3J81L 3S17B 2JA7B 1B2TA 1PRTC 1YNNC 1B53A 1H9SA 4KY6A 3MAQA 3SE0A 3DUZA 4A3FB 1PLFA 1MD2D 1F9SA 4XIGS 1FYCA 1B50A 3K5OA 5DAUA 2PNRC 2SOBA 5ELBA 3BVGA 4XXEA 1CQFA 2FINB 2ICIA 4OHJA 2VXWA 5EBDA 2RA4A 2K5WA 4G4KA 1EQTA 1D1KA 4TKOB 2F3VA 3S2DB 5EPKA 3NHHA 2JA8B 1QILA 1SMYC 2B2WA 5FK9C 3E6ZX 5M3FB 3MXGA 5I2XA 1GUOA 3QOJA 1QJOA 5LL6S 1AP0A 3R2IA 1BQQT 2BDOA 4Q5VA 1DOLA 4AYBB 1T5XD 2R3ZA 4KN7C 4CGYB 2KJXA 3Q22A 2OEOA 1RKNA 2R7ZB 5T1GA 2OXPA 4XT3B 2B2TC 4J1MA 3VYRA 1IYUA 1CZWA 4I65A 2HDLA 4PMWA 2QEJC 1JR0D 1PTOD 3F2UA 1EL0A 3H09A 3RMHA 1S5BD 4FF3A 5EKKA 2PCFB 3OMGA 2L9HA 1S5DD 2F0KA 1RD9D 3PMFA 5IGFA 1LTGD 2L4NA 3SDZA 4ZRZA 5C4XB 5EJWA 3Q0AA 5KRUA 1BF4A 1WTVA 3SXHA 2D2CC 4FO2A 3MFGA 2B2TA 3MHBA 2DNCA 2R93B 4ZAIA 4LJZC 1SYBA 4CKEA 2AQ1B 5I9PA 4KK7A 1JICA 4BS9A 5BN4A 4ODGA 3R8BA 1RTOA 1TKWB 2R6GA 1V1PA 5KNDA 1V43A 1E2VA 1EY9A 4JBWA 5C0XJ 3EVQA 1F9QA 1EQVA 1TWHB 4RCNA 2QDBA 4KTAA 4GZYC 4RH6A 3C3LA 3K58A 1ZEQX 3CQZB 1CA5A 1PTOC 4ID6A 2IX0A 4WRDA 3QB3A 3NK9A 5KYLA 2EYMA 1B1ZA 1SYDA 3I72A 3OHXC 1IYVA 1ZKOA 1EY4A 1KNEA 3SK4A 1SXTA 1HA6A 2VNUD 2EJFC 1F77A 2F0IA 3U9SA 5NUCA 2R92B 4KKTA 1SYCA 4FXKC 5EGTA 3A55A 1ILPA 4G7ZC 2BA1A 5TSSA 2AWNA 1D1IA 4WJWA 1TS3A 1Q12A 2RDGA 1K83B 1HTLD 4NW2A 3D8GA 2KVMA 1A15A 1K8OA 1KAAA 2XSCA 2JEAI 5CV9A 4H44C 1Y1VB 3A7LA 2KECA 1JWUD 1KABA 2I07B 1KDAA 2A6HD 1LTBD 5C3XA 4ZQ3A 2VB3X 2O5JC 2IW3A 3HGBA 4H13C 1JWMD 4ULLA 4C56C 1I4QA 3A8IE 3HOWB 3S9WA 3KK7A 3K0YA 1I4HA 2AUJD 3L7ZC 1CM9A 2OF1A 2L1BA 5BN5A 1TWGB 1JC7A 5E4WC 1D6EC 1PMRA 4C3HB 3A8KE 5IGDA 4HAEA 5M5WB 1O80A 4ZLTF 2A6ED 2A68D 3DMUA 1OXSC 4DN4M 4OO1G 3LX0A 2TMPA 1KTKA 3MXUA 1H9KA 2DY7A 1A3VA 1BBXC 1RJTA 1EZ6A 1R4PB 3N52A 2B2YC 1SE3A 1CQVA 3S16B 1HUMA 3VR6A 3OWEB 3AMUA 4RAUC 3NQIA 4BBRB 4M1UB 4WORA 3RUZA 5KGUA 1SMYD 2Q8TA 1SYFA 4IFDG 5A35A 4L8JA 5DNFA 2F0LA 4IUVA 4A3EB 2Z4IA 5BN3A 1BR9A 3WDNA 3AB9A 2C9OA 2NBFA 1H9SB 2A69C 3DXJC 4YIJA 3C2PA 2VB2X 3ONAB 2K03A 4IALA 1WVLA 4E6IA 2B8GA 4A3IB 4A3KB 2E2JB 4QB4A 3TP8A 2BE5C 2F0EA 3D6CA 1QOHA 1STEA 1PRTD 1YNND 4XQNA 1OXXK 3BDCA 2KEEA 2E2DC 2F0FA 1STAA 4V190 3T13A 4LK1C 3H0GB 2TSSA 3HOZB 4DGZA 4IQZA 1GHKA 4NMZA 2XWJB 1BNZA 2JXMB 1SE4A 5CR3A 3IFTA 5IGBA 3D4WA 2A5HA 1KLGD 5HURA 2EJMA 1FNWA 4V0BA 5IGEA 2DY8A 3I73A 1M8AA 3R3OA 3KLSX 1Y69U 4Y7NB 4IFDJ 3CRKC 1ESRA 1O7YA 1R4QB 2L55A 5C4HA 1C4QA 1HRJA 3D4RA 3RZOB 3W3AA 4K8JA 1BXTA 4BY1B 5D14A 5CV7A 5G3LF 1M4VA 3Q24A 5IOCA 2F03A 1AN8A 1I6VC 3MA2B 4HEDA 4A3DB 2PO4A 4HCEA 5I4DA 2EY1A 1C8CA 1RCVD 2F0JA 1CHPD 2PYKA 4QUCA 1FR3A 1U4PA 3HS0C 1PTOF 3Q23A 1PXUA 5CV5A 3GV3A 3C46A 1I6HB 1ESFA 5CBEE 3P1HA 1WTXA 3MZ5A 2K33A 4C3JB 5LHY1 1UNSA 1MBYA 2XWBB 4IFDH 1I4RA 4S3SA 2Y0SB 5KYIA 5EPJA 2NVTB 1BCPB 3GTMB 1EOTA 2GA4B 4IN3A 2NN6G 4X3KA 3SK6A 1Q1BA 1BOSA 1SNOA 3DWAA 2O4XA 1W6JA 5KIXA 1JOKA 4LAAA 5IT9E 2F0NA 1B4OA 3KLSA 2D5DA 4K5WA 3BS1A 4PNYA 5JVG3 4X3UA 5IGCA 1IKLA 3QIAA 1SNPA 3OIPA 5E3FA 2F0TA 3LWUA 5CGKA 2K1BA 3NXWA 3NTIA 1LV9A 3QO2A 1ENCA 2KCNA 3A7AB 4UDUC 1LTAD 2AUKA 1ET9A 5E4XA 2B2UA 2KQ3A 1A2TA 1L0XB 3MTSA 3W2DA 5KEEA 2WKDA 1IHZA 3TP5A 4G57A 4N9PA 3FDTA 1E2WA 4DXFA 3OIQA 3A54A 2JYOA 3C1EA 4XQQA 1HFNA 1DD2A 3VYTA 5EPLA 4RCOA 1OO9B 4HSPA 1E0BA 2Q8RE 2ID0A 5C0XG 3GP7A 4NDXA 3HRZC 1G6ZA 5KNCA 3OPOA 3ZYYX 1SJHD 3EROA 1BCPD 4FF2A 5E1FA 2MUYA 4KV6A 1SEBD 4CJ1B 2O5IC 3NPPA 4KMUC 3NUCA 3JAML 1KDCA 3ND8A 1V1OA 1PRTF 4C3JG 3PUYA 1QB5D 2D62A 4MHEA 1VMPA 2KOLA 2EVBA 3GQBA 1A2UA 1G8ZD 5D3DA 1S5FD 2K32A 3P7JA 1EWCA 3N6RA 3DWPA 1MSGA 2MHVA 3NP8A 1AFPA 2J7ZA 1GOZA 2R61A 2JE6I 1TT2A 1JOQA 4EVOA 3HOYB 3NWSA 1VCIA 2K04A 4U673 1WD0A 1FNUA 1II3A 3HKZB 4C3IB 2Z4HA 4J8QA 5C6AA 2PPBC 1GJXA 3KLRA 2EY2A 5CV4A 1G2SA 4A3BB 4A3MB 1D5ZC 4HMJA 4ZYSA 1LTSD 2KUMA 3D4DA 1J8IA 2O2LD 2F0HA 1I4GA 3ITPA 5FO9B 2E74C 4FXGC 2BOSA 2LFNA 3GTKB 4DNRB 1AEXA 4Q0FA 4N9TA 2EYOA 4OL7A 3S15B 5DM63 1Q90A 3TSSA 3WOFA 3QG1A 1S4ZA 4KD3A 3MVVA 2PW5A 2DN8A 4ZKCB 1B9MA 2DNEA 4A93B 5JJZA 1IW7C 4X3TA 2B39A 1PDQA 4RKLA 1I4PA 2RDHA 4C2MB 3FEWX 3VR2A 4KJNA 4JK1C 2Q8IB 2NVXB 1LABA 3HZXA 3MEHA 3S14B 2NVYB 3L3OC 3T53B 1D5XC 4DAVA 3VA7A 2XRQD 1J9OA 3FPUB 4ZKBB 1B3AA 1KLUD 2WV6D 5DEHA 2RVLA 2EY6A 3GTOB 1NSNS 1AZPA 3PIO3 2CVRA 2PZWA 1FNVA 2F0UA 1MI2A 4P2CB 4C3HG 5JPMC 4ILWA 1SYEA 3GTJB 3D6WA 5C5MA 3SR1A 1CTMA 4KKUA 3QOLA 2NYZD 5JPNC 1Z47A 3GTQB 4B9XA 2Z1CA 1EY7A 1HXYD 3X3MA 3J80L 1GUTA 2B2UC 1BO0A 2EPBA 1Z7TA 4FNFA 4DU9A 1BUVT 2A6EC 2ZXOA 2X6GA 2NWGA 3S1NB 1RHPA 1SAPA 5M9OA 2BE5D 1HHVA 2SDFA 5M3MB 1AZQA 1YNJD 2X6LA 3VYSA 3URYA 1UUPA 4IUUA 1ZXTA 3CRLC 1PRTB 1NUCA 2F0OA 3ND9A 4B9WA 4EQNA 2RSNA 1PTOB 2WP8J 2A6HC 3SHLA 1EU3A 1PFNA 1C48A 4HSVA 1EEID 2JEBI 1HQRD 2E76C 3I4NB 1Z6HA 1EWHA 2WKCA 2NZ1D 1RODA 1VF7A 2A73B 5FLXE 1BCPC 3BYYB 5AFWA 4PMBA 4TRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Z A;  1SYE A;  4G57 A;  4N9P A;  4HMJ A;  5C5M A;  4IAL A;  5I9P A;  2WAC A;  5CV6 A;  5I6Y A;  5ISR A;  3D4D A;  2NUC A;  2EYJ A;  3MXP A;  5C5L A;  3TP6 A;  4ODG A;  1EYC A;  4E6I A;  3SR1 A;  4MIU A;  3C1E A;  2EY1 A;  3QOL A;  2F0H A;  4QB4 A;  5JOB A;  2F3V A;  3TP8 A;  1EY6 A;  1STH A;  2F0J A;  3ITP A;  2F0Q A;  3S9W A;  2F3W A;  3NHH A;  3VA5 A;  1ENA A;  2PYK A;  2RBM A;  4DFA A;  2OF1 A;  1EY9 A;  4IUN A;  2F0V A;  4B9X A;  2F0E A;  1EY7 A;  3D6C A;  4KD4 A;  4KJO A;  3EVQ A;  5F2D A;  1AEX A;  1EQV A;  1SYG A;  1EYA A;  2F0D A;  4N9T A;  2QDB A;  2EYL A;  5CV5 A;  4EQO A;  3BDC A;  2EYH A;  3ERQ A;  4KTA A;  2EYO A;  2EYF A;  4DU9 A;  4K6D A;  2F0F A;  3OMC A;  1STA A;  4OL7 A;  5CV8 A;  5IGD A;  2PQE A;  3HEJ A;  3P1H A;  3QOJ A;  5IIF A;  3NQT A;  1EY5 A;  3MZ5 A;  4NDX A;  3T13 A;  4IZ8 A;  5IGG A;  4ID6 A;  1A3U A;  4WRD A;  1TR5 A;  1EY8 A;  3QB3 A;  3NK9 A;  2ENB A;  5I6W A;  3H6M A;  4K5V A;  4DGZ A;  5J39 A;  5KYL A;  1U9R A;  2HQE A;  3P75 A;  2EYM A;  3BDL A;  4KD3 A;  2RDF A;  3DMU A;  3ERO A;  5M9O A;  4NMZ A;  2PZT A;  3MVV A;  2PW5 A;  4H7B A;  4ME5 A;  1SNC A;  4S3S A;  3DHQ A;  4PMC A;  5E1F A;  5I9O A;  5KYI A;  3LX0 A;  4KV6 A;  5EKL A;  1SYD A;  1STN A;  4TRD A;  5HGT A;  4F8M A;  1EY4 A;  3NUC A;  3SK4 A;  1A3V A;  1EYD A;  1EZ6 A;  2OEO A;  5CR3 A;  2F0P A;  2PW7 A;  1RKN A;  2EYP A;  2F0I A;  3SK6 A;  4F7X A;  5CC4 A;  1KDC A;  5IGB A;  1SNO A;  1SNM A;  2F0W A;  4QF4 A;  3D4W A;  2O4X A;  5HUR A;  5KIX A;  5K5P A;  2OXP A;  4RKL A;  4QMG A;  1JOK A;  1STB A;  2LKV A;  4LAA A;  5NUC A;  4HMI A;  4J1M A;  2F0N A;  2EY5 A;  5C3W A;  3SK8 A;  1NUC A;  3E5S A;  4K5W A;  5J1Z A;  5JAV A;  2F0O A;  1A2U A;  4PNY A;  3OSO A;  4B9W A;  4KHV A;  4EQN A;  4I65 A;  4KJN A;  5IGE A;  4K2K A;  5IGC A;  1F2Y A;  2SNS A;  1JOO A;  1SYC A;  4K2L A;  4WOR A;  4ZUI A;  3RUZ A;  5EGT A;  3SHL A;  3HZX A;  5KGU A;  1SYF A;  3R3O A;  3TME A;  1SNP A;  3MEH A;  5EKK A;  2SNM A;  3NP8 A;  3OMG A;  5KEE A;  4RKB A;  2F0L A;  1KDB A;  2KHS A;  5E3F A;  1F2M A;  1SNQ A;  2F0K A;  2F0T A;  4DF7 A;  2RKS A;  3PMF A;  2F0M A;  5CGK A;  5IGF A;  4KY6 A;  4NKL A;  3NXW A;  4NP5 A;  5C4H A;  5IOC A;  1TT2 A;  1JOQ A;  2EXZ A;  2F0G A;  1ENC A;  4K5X A;  4KY5 A;  4EVO A;  3D8G A;  4K8I A;  3TP7 A;  5KRU A;  5IOD A;  4R8N A;  1EZ8 A;  1STG A;  1TQO A;  4K8J A;  1KAA A;  2PZU A;  4ZUJ A;  3SXH A;  3EJI A;  3TP5 A;  5CV7 A;  1JOR A;  4K14 A;  3T16 A;  3V2T A;  5J22 A;  5DEH A;  1II3 A;  1EY0 A;  2KQ3 A;  5CV9 A;  1A2T A;  4KY7 A;  2EY6 A;  3MHB A;  1KAB A;  1A3T A;  4HTH A;  5C6A A;  4EQP A;  1KDA A;  1NSN S;  5C3X A;  5DAU A;  3C1F A;  2M00 A;  2EY2 A;  3U9O A;  2PZW A;  4J6H A;  5CV4 A;  2SOB A;  2F0S A;  4ZQ3 A;  2F0U A;  3OWF A;  3SK5 A;  4PMB A;  4YIJ A;  1SND A;  1IHZ A;  1SYB A;  5C4Z A;  1STY A; 
#chains in the Genus database with same CATH topology
 4LF8 L;  3ZJY C;  1DCZ A;  1ONL A;  1HFG A;  4HJ7 A;  3X3N A;  1LT4 D;  4HR7 B;  3IL8 A;  3H94 A;  1O7Z A;  3HOZ H;  3S2H H;  1LTL A;  3FMC A;  1DON A;  2IWH A;  1EIF A;  2L12 A;  4X66 Q;  3HOW G;  3KBG A;  2RBM A;  4DKA C;  2UXB L;  1WCM B;  1OXV A;  4P72 A;  1V1Q A;  5F2D A;  3M4Y A;  4C3I G;  1HPC A;  1NNX A;  1SYG A;  3TN2 A;  1SFO B;  2EYL A;  3NSW A;  2RSO A;  3V96 A;  4Y52 H;  5CV8 A;  1CHQ D;  3G7L A;  2L11 A;  1IXR A;  1U4L A;  1NJI C;  4A75 A;  4X3S A;  5I6W A;  4QGU A;  5K36 H;  3GTG H;  2HQE A;  4DUY Q;  5IT9 L;  3HOX B;  1UEA B;  3BDO A;  1SNC A;  3OTO L;  1D2B A;  3G6J B;  4TRD A;  5HGT A;  4LFA L;  4A3C G;  3PO2 H;  3VR3 A;  1HNX L;  4Z9C B;  3M4Q A;  4DNI A;  2EYP A;  2XNA C;  5EBC A;  4IUP A;  3UDX A;  1SSO A;  2JSO A;  3AEV A;  5GRO A;  5I2Y A;  1OXT A;  3CW2 C;  1NY4 A;  2X69 A;  2B2W C;  1CK1 A;  4QUF A;  2B2V C;  3GV6 A;  4JI5 Q;  2J0T D;  3D31 A;  1ASZ A;  3AU7 A;  2Z8L A;  4K2K A;  3PUZ A;  3G4S A;  4R9W A;  3KBX A;  2ZT9 C;  1N36 L;  3I4L A;  1CKN A;  4ZUI A;  5FO7 B;  1T5E A;  2AKW B;  1BCP F;  3CMA A;  1LM0 A;  1LUZ A;  4R8I A;  2VQE Q;  4RKB A;  5T1I A;  3JAM E;  2ZM6 L;  2JA7 H;  1SBB B;  3GO5 A;  1TS4 A;  1VQH A;  4NKL A;  1LTT D;  1HZA A;  1G91 A;  1O7L A;  4RGO S;  2YTV A;  5JEA G;  1STG A;  3EJI A;  1YI2 A;  1PH8 A;  3PUX A;  4K14 A;  3V2T A;  4HIM A;  2D9U A;  1GUN A;  1YJN A;  1CZG A;  1EY0 A;  4DR7 Q;  2VUM H;  2F4I A;  3K6O A;  2IY5 B;  4HTH A;  3A5U A;  2UUC Q;  4YWK A;  3C1F A;  4PQX A;  1PZI D;  4FYD A;  1SND A;  1NTG A;  1I6H H;  2QW7 A;  2HCC A;  2J4X A;  2NZH A;  1YNX A;  5C5L A;  2WB1 B;  1A6X A;  1J6Q A;  2ZXR A;  4BXX H;  2F3W A;  1JB7 A;  5M5X H;  4KJO A;  1JWS D;  2K7V A;  2VQE L;  1GUG A;  3RD4 A;  4JI8 Q;  2EYF A;  4A4I A;  2YV5 A;  1XYI A;  2N49 A;  2G5D A;  5M5Y B;  3HEJ A;  4IZ8 A;  2BCO A;  1YHA A;  5M3F H;  1R9T B;  3G48 A;  2JK8 A;  3MXN A;  3J81 E;  2NB0 A;  1A8V A;  5FLM G;  1Q8I A;  3DEO A;  2FFK B;  4DXG A;  2B3G A;  4JI2 Q;  3TS2 A;  1TS5 A;  3OTO Q;  4J15 A;  2UU9 Q;  4BBS G;  1TWF B;  1ENF A;  2R93 G;  2FXQ A;  3IAY A;  4NXM Q;  2KED A;  1CI3 M;  1ET6 A;  3J7A F;  4UP8 A;  4XDX A;  4OO1 H;  3Q6S A;  3STB D;  2E2H B;  5J1Z A;  2B2Y A;  3FRP B;  1RF2 D;  4AH6 A;  3HOV H;  4DR4 L;  1YJW A;  1PTO H;  2VUM B;  1F2Y A;  1JOO A;  4K0K Q;  1DM0 B;  2WAQ E;  3CCU A;  1IYJ B;  1HTP A;  4LFA Q;  5K36 G;  2RHQ B;  3S1Q B;  2CW0 D;  4H0L C;  1F2M A;  5COR A;  1G2T A;  2EQS A;  2RKS A;  2XTI A;  2ZXP A;  1W6K A;  1NMG A;  5ELC A;  3HOV B;  1K3B C;  1SRO A;  4GLA C;  1HR0 W;  1YHB A;  3VYU A;  5KNB A;  4K8I A;  1DJR D;  4CKC A;  1HH2 P;  1TQO A;  2N8N A;  4A3E H;  1UE6 A;  3GTP H;  4OIK A;  2PZU A;  1JE4 A;  1JOR A;  1BBW A;  3GTG B;  3J7A V;  4KY7 A;  3ERS X;  4IJL A;  5G3L D;  1CSP A;  1L1O A;  3J7A 5;  2FMC A;  1WTQ A;  3NWT A;  2PW7 A;  4UHV A;  4X65 Q;  4YCW A;  4BY1 G;  4BY1 H;  4JI4 Q;  1VQC A;  4XQJ A;  2V4D A;  4RHR A;  2B63 B;  1S5C D;  4CKB A;  1O7I A;  3MXP A;  3TP6 A;  2E5L L;  2PMZ B;  2YU9 H;  1MHW C;  1X3F A;  2N78 A;  3ICE A;  1F2L A;  1H9J A;  5JOB A;  1GUW A;  1E2Z A;  2UXB Q;  1K0S A;  1LTI D;  3S15 H;  1YEZ A;  4KD4 A;  2WB1 E;  1X3P A;  2JA5 G;  4CJ2 C;  1QUQ B;  1TWC H;  2NVQ B;  1I3Q H;  2EYH A;  3AFQ A;  4LF4 L;  5C44 B;  3BZD B;  4HJA A;  4MNO A;  2K75 A;  1JB3 A;  4A3J H;  4DV1 L;  2Q2T A;  1SDF A;  2A69 D;  3NTH A;  3I4M H;  3O13 A;  1K8M A;  5C4J B;  5CMD A;  1A3U A;  2PQA A;  4RA8 A;  1DXM A;  4K5V A;  2CW0 C;  4JI0 Q;  5J39 A;  3P75 A;  1WTW A;  3BDL A;  3UDF A;  3PO3 G;  2HCI A;  1TWC B;  1B70 B;  1T9H A;  2FMM A;  3TBI B;  2WIN B;  5I9O A;  2MO0 A;  3SVM A;  3I4N G;  3CCJ A;  2YTX A;  4OO1 I;  1UEB A;  3RZO H;  3RLN A;  2B2V A;  4UAI A;  3AQQ A;  4A3I H;  1LO5 D;  1IL8 A;  3FKI B;  2HHH Q;  3K57 A;  2Z0S A;  5JJI A;  1LT6 D;  1SNM A;  2CWA A;  4JI7 L;  1IBL L;  2BH2 A;  4P75 A;  3H0G H;  4QMG A;  4JI6 L;  1GVP A;  1W3S A;  3PUV A;  3DM1 A;  2IL8 A;  2VQF L;  1NCV A;  2H4O A;  3IKJ A;  3VR4 A;  3KUP A;  2LY7 A;  1ICW A;  3NBI A;  2M9V A;  3D3R A;  1B3Q A;  1C7Y A;  3OYY A;  2KHS A;  1YHQ A;  2CH4 A;  1VQ8 A;  1VQJ A;  2DJG C;  1Y1W G;  3PCO B;  1ZYR D;  4DAY A;  1EQR A;  2HDM A;  3LWE A;  4O1N A;  1EFI D;  2LS0 1;  2EXZ A;  4KY5 A;  3EIV A;  3TP7 A;  3HOU H;  3A56 A;  4L5T A;  2K4K A;  3TZD A;  1N33 L;  3DM3 A;  1VQ7 A;  3IFD A;  3VR5 A;  2L0C A;  4CDC C;  3HKZ E;  3S17 H;  1TXY A;  3EA6 A;  4RWS C;  1LLR D;  1A3T A;  1KNA A;  4LF5 Q;  1DYQ A;  1B44 D;  1WCM H;  5C4X H;  4BBS B;  4J6H A;  1NR2 A;  2LSS A;  1CKN B;  3PUW A;  4DUZ L;  2F1M A;  4IPG A;  3SEB A;  5LMU Q;  1Q7Y C;  4RHS A;  5FO8 B;  1FGB D;  4DR3 Q;  3GTP B;  3J80 i;  4QL5 A;  4R4C A;  2NTS A;  1QCB D;  1JCK B;  2AQ2 B;  4LF6 L;  2L5T A;  1JQY D;  2F0V A;  1FJG L;  1LTR D;  2A1A A;  3NBH A;  2NVY H;  1QNU A;  1EYA A;  2F0D A;  1EU4 A;  2ZTD A;  4DV5 Q;  3ERQ A;  1YVC A;  4WFN 3;  3NEN A;  1DGS A;  1PH6 A;  1X3Q A;  4BA1 I;  2K50 A;  1EIH A;  3NQT A;  1EY5 A;  3S16 H;  3TS0 A;  4K0K L;  4OIJ A;  4RGT A;  2ENB A;  3RLF A;  3J81 c;  4IPH A;  2GVB A;  4FDB A;  2RDF A;  3R93 A;  4H7B A;  4ME5 A;  1OXU A;  5EKI A;  1JJG A;  4OWW B;  5EKL A;  3KFU A;  4BY7 B;  2IPK D;  3WOE A;  1QG7 A;  5JEA J;  1HUN A;  2MP1 A;  3CKI B;  3EQL C;  3EN2 A;  1EYD A;  3K5L A;  1Y1W H;  1G29 1;  1I4X A;  2MQH A;  1BBU A;  1P8L A;  2F0W A;  3UE0 A;  2N88 A;  2LKV A;  4YWL A;  1N34 L;  4GS3 A;  1UAP A;  5JAV A;  4M8A A;  3CCL A;  4B08 A;  3NE5 B;  2VS1 A;  1TU2 B;  3R2T A;  3EBE A;  1EEF D;  3I4O A;  2N3S A;  2UUA Q;  2SNM A;  5DM7 3;  3K5M A;  2PQA B;  4AQY Q;  1L1O B;  3DWQ A;  2IX3 A;  4X62 L;  4ZCK A;  4A3I G;  3S1N H;  2E2I B;  5ELF A;  4K5X A;  4NXM L;  4DAP A;  2JA6 G;  2XIW A;  2C35 B;  1QWY A;  5IOD A;  3JC6 6;  2BDN A;  3GD7 A;  1SE2 A;  1PH4 A;  4G7O C;  2EXD A;  3T16 A;  2JQO A;  3RLO A;  4XYQ A;  4KKS A;  2MGS A;  4DNT B;  4ABN A;  1VQM A;  2YU9 B;  3NTK A;  4JI6 Q;  2OCE A;  4EQP A;  5IP9 H;  3GTL H;  2CQA A;  1PZK D;  5H1S E;  1N8R C;  3SK5 A;  2UXC Q;  1ML0 D;  3UI2 A;  3KF6 A;  3HKS A;  4JI1 L;  2NN6 I;  4DK1 A;  1CUK A;  5I6Y A;  2WAQ B;  5C0X H;  1EYC A;  1Y1V H;  5M5X B;  5IE8 A;  3U58 A;  2ATW A;  4K6L A;  1EY6 A;  2Z6K C;  3I91 A;  1BDO A;  3VA5 A;  1XNQ Q;  4DFA A;  3M9B A;  2CFM A;  3S1R B;  3UE1 A;  3I8Z A;  3GTO H;  2PI2 E;  1M90 C;  1IW7 D;  1CKO A;  3S2D H;  2ZM6 Q;  1MKH A;  3HOU G;  3OMC A;  3JAM c;  2PQE A;  5AJ3 L;  1WTP A;  4FXD A;  2UXD L;  4APV A;  1I5F A;  2KCC A;  3NEM A;  1TR5 A;  2JP1 A;  4JOI A;  4GNX B;  2BA0 A;  4R4Q A;  1XPU A;  4XTC S;  1MGS A;  4X6A H;  3K7A H;  4LF7 L;  2EZV A;  2KA7 A;  2I5L X;  2FHT A;  2IJ0 A;  3W1G A;  4FP5 D;  2D0O A;  1ILQ A;  4XYO A;  4DV7 L;  1F9P A;  1S5E D;  2B63 G;  2N55 A;  5BR8 L;  5FKA C;  1QVG A;  3PO2 B;  3E9H A;  5A2Q E;  2RCF A;  3E3X A;  4KI0 A;  1Q3L A;  3DEP A;  1HNX Q;  1XXG A;  1XX8 A;  3K7A B;  1KRS A;  3BVZ A;  3I3C A;  3T4A C;  4C1N I;  3KYH C;  1PA6 A;  1VS0 A;  4DR2 L;  5C3W A;  1IBK L;  4FF4 A;  1UE7 A;  1VQ5 A;  4KHV A;  4CBV A;  4HN7 A;  3L2P A;  2E2H H;  1PH9 A;  4IUT A;  2NVQ H;  4LWC A;  1AW7 A;  3BYT B;  3PO3 H;  3TDQ A;  5LL6 X;  3H3V C;  1K8A C;  5IYB G;  2F0M A;  2JA8 H;  1XTC D;  2WII B;  3I2Z A;  2CHB D;  5C3E H;  4NP5 A;  5LMN W;  1PH7 A;  1PFM A;  4GOP B;  3I55 A;  2H1E A;  3CHB D;  4G7H C;  1L2F A;  4ZUJ A;  3OW2 A;  4L63 B;  3TRE A;  4JPB W;  3PO3 B;  5CYU A;  4HJ5 A;  4RFB A;  4XT1 B;  1VQF A;  1X6O A;  3S1M B;  1LT3 D;  3U9O A;  4GOP A;  3OWF A;  2K6A A;  3M3Y B;  3NBH B;  1F2Z A;  4OWX B;  2WAC A;  4PG3 A;  2E75 C;  5D65 A;  3T1Y L;  3I4M B;  3V05 A;  2XN9 C;  5D3I B;  1STH A;  1JE5 A;  2F0Q A;  4MTN A;  1I3Q B;  1V1P B;  3E0E A;  3A8J E;  4IUN A;  3J80 E;  2RCN A;  2EE1 A;  2MO1 A;  1DZ1 A;  2YYZ A;  1GHJ A;  4K6D A;  1ZYR C;  2IHF A;  1L1O C;  3P20 A;  4A76 A;  3HG9 A;  4GLV B;  3FVQ A;  5JJK A;  4OEL B;  3DLL A;  2A74 C;  1LT5 D;  5LMU L;  5J3B A;  3MWY W;  5IP7 G;  4JV5 L;  4NB3 A;  1F9R A;  2G9H D;  3WWV A;  2M2L A;  4F87 A;  3DHQ A;  1STN A;  4U68 A;  4CDD C;  2KEN A;  2VUM G;  4F8M A;  1LAC A;  1CFM A;  3K5N A;  3HOV G;  2NTT A;  3M4O B;  2EDG A;  1HCZ A;  3M7N A;  1Y1W B;  4DV6 L;  5CC4 A;  1K3R A;  2G9D A;  1NE3 A;  2RQX A;  2LXJ A;  1D5M C;  1U4R A;  1EIG A;  1NMF A;  1XNR L;  1YNJ C;  2EY5 A;  5CBA E;  5JVH 3;  1H9M A;  2I46 A;  3SK8 A;  3HOU B;  2CWP A;  4RGN A;  1WTH A;  1GXD C;  2IHE A;  1V9P A;  4I7Z C;  4GLX A;  2UUC L;  2UXD Q;  2KBN A;  2SNS A;  4K2L A;  5ELE A;  2EJG C;  3TME A;  1KDB A;  4H02 A;  5A2Q L;  1Q1E A;  1SNQ A;  2FJ2 A;  4LF4 Q;  1N32 L;  2K05 A;  3I90 A;  3PO2 G;  5COY A;  1U4M A;  3BG3 A;  5LMN L;  4F88 A;  1VQK A;  5GAD C;  3MXN B;  3BU2 A;  1TY0 A;  1EZ8 A;  4JW0 A;  4NXN L;  2MFI A;  3MC0 B;  2K01 A;  2QKI C;  4LUV A;  1MJE A;  2OTJ A;  1XMO Q;  1BVS A;  1D7Q A;  1E1O A;  3I70 A;  2GVA A;  1FD7 D;  3FPP A;  1E24 A;  1TWA B;  2ICE C;  1RTN A;  2K5V A;  2F0S A;  1C0A A;  5C4Z A;  1QE6 A;  1VMC A;  3E0J A;  4JI0 L;  5C3E B;  1WD1 A;  2K28 A;  1DOM A;  1TVX A;  1X65 A;  1UE5 A;  2EYJ A;  2UUB Q;  1IZ6 A;  1VQB A;  1E3P A;  4MIU A;  2HD3 A;  4GOP C;  1G6P A;  1I50 B;  3A0J A;  1Y8O B;  4X62 Q;  1GUS A;  1S72 A;  5FOB B;  1V8Q A;  2QEX A;  4GKK Q;  1PZJ D;  4IFD I;  1HQM C;  5JEA H;  4QIW B;  2HT1 A;  4EQO A;  5IT9 c;  1VQ9 A;  1PHJ A;  1FL0 A;  1Y8N B;  1PVO A;  4L6T B;  3BVM A;  1IKM A;  1YZ6 A;  5IIF A;  5IGG A;  4IUQ A;  4R4O A;  1EY8 A;  1PYW D;  3H6M A;  3CCV A;  2AQ3 B;  4WJ3 M;  2OT2 A;  1X3E A;  2QCP X;  4TSS A;  3OW7 A;  4DV0 L;  3KF8 A;  3QJY A;  4PMC A;  1SE8 A;  1DOK A;  3HOY G;  3L9A X;  4PZ8 A;  3CU7 A;  5M5W H;  4DV4 Q;  3LNN A;  1CA6 A;  2QF7 A;  3EFX D;  2MPM A;  3M7G A;  3KDF B;  1NR4 A;  1RDP D;  5K5P A;  4DV4 L;  1STB A;  4HMI A;  2A68 C;  5GAE C;  3OOC A;  1O78 A;  1HR0 L;  1XWE A;  3E5S A;  1XMQ L;  5FLX L;  3PV0 A;  4A3C H;  3T51 B;  1CT1 D;  1PFB A;  2K5D A;  4TQU S;  5ELD A;  3H91 A;  1TII D;  4MZ9 A;  1VF5 C;  4KHZ A;  4ME3 A;  5C0X I;  4A3G B;  4DF7 A;  4DV7 Q;  4IO9 A;  4O2D A;  2NN6 H;  3K80 C;  1Y8P B;  4LMQ D;  4DA2 A;  2EOT A;  1MSH A;  4RGM A;  1WTR A;  2F0G A;  1PFS A;  1SJE D;  4R8N A;  3S2H B;  4BBR G;  3GTL B;  1TS2 A;  3PIP 3;  4DK0 A;  2CH4 W;  5J22 A;  1VQO A;  4FVM A;  4EGV A;  4CDE C;  4A3M H;  4CJ0 B;  3U50 C;  1QNK A;  3M85 A;  1WTO A;  1WI5 A;  2M00 A;  4OGQ C;  4BA2 I;  4CDF C;  1ENA A;  1STY A;  3MFY A;  1SRU A;  1VQ4 A;  4LF9 Q;  4HCS A;  4A3J B;  3T56 B;  2IT1 A;  2Z9H A;  5CV6 A;  5ISR A;  2NUC A;  3QWN A;  2JA5 B;  1E1T A;  4CHT B;  4BWG B;  2ZJR A;  3K81 C;  4A3J G;  3JAM i;  3CD6 A;  2QIL A;  4TVA B;  4KN4 C;  1TY2 A;  2XVS A;  4O42 A;  2AWO A;  2SEB D;  2RHS B;  4IUR A;  3TZU A;  1Y1V G;  2PMZ E;  4X64 L;  1B9N A;  2WB1 G;  2MJ8 A;  4MTK A;  3RZD B;  2IX1 A;  4DR1 Q;  1NAP A;  4C1N K;  3KOJ A;  1L0Y B;  2I0Q A;  2JA6 B;  3HP3 A;  1SN8 A;  2K5Q A;  4C3H H;  1NBW A;  1U9R A;  1GD7 A;  4MN3 A;  2PZT A;  3PIO A;  2HHH L;  1HA5 A;  2LMC B;  3S1M H;  4FF1 A;  3K59 A;  3CCR A;  2F0P A;  4F7X A;  2C5C A;  4QCL A;  1VQI A;  4PV1 C;  3J7Y W;  4QF4 A;  5EQ0 A;  1ASY A;  1EFW A;  1X32 A;  1VDZ A;  2XRS D;  4ZK9 B;  2QA4 A;  2B8F A;  2HUG A;  4JI3 Q;  3M3Y H;  1H9R A;  4NPS A;  3OSO A;  3J81 L;  3S17 B;  3MEF A;  4JI1 Q;  4X64 Q;  2JA7 B;  1B2T A;  1PRT C;  1YNN C;  2UXC L;  1J5E Q;  1B53 A;  4Y7N H;  1H9S A;  3KLW A;  2NZO A;  3KDF A;  3CP0 A;  1UWV A;  4KY6 A;  3MAQ A;  2F4V Q;  3SE0 A;  3DUZ A;  3I4M G;  4N8F A;  4A3F B;  3K8A A;  5IYD H;  1PLF A;  1MD2 D;  1F9S A;  4XIG S;  4DR5 L;  1FYC A;  1B50 A;  3K5O A;  5DAU A;  1AE3 A;  2PNR C;  3F2C A;  4DV5 L;  4X65 L;  2SOB A;  3HKZ G;  5ELB A;  3BVG A;  1CQF A;  4XXE A;  4JV5 Q;  2FIN B;  2RF4 A;  2OTL A;  2ICI A;  4OHJ A;  2VXW A;  4LF6 Q;  2YTY A;  5EBD A;  2E8G A;  2K5W A;  2RA4 A;  4G4K A;  4DUZ Q;  3J7Z C;  4A3M G;  4IOA A;  1EQT A;  1D1K A;  4TKO B;  4B3T Q;  2F3V A;  3S2D B;  5EPK A;  2P5Z X;  3CME A;  3NHH A;  3W1B A;  4JBJ A;  2JA8 B;  4BBR H;  3F1Z A;  1QIL A;  1SMY C;  1FVI A;  3W5O A;  1SFO H;  4JOI C;  2B2W A;  3CAM A;  5FK9 C;  3E6Z X;  5M3F B;  5HGQ A;  1R9T H;  3MXG A;  5I2X A;  1GUO A;  3QOJ A;  3I56 A;  1QJO A;  5LL6 S;  1AP0 A;  4A3K H;  3R2I A;  4JI8 L;  4DR3 L;  1BQQ T;  4DV0 Q;  5HY6 A;  3RR5 A;  2BDO A;  1Q8K A;  5AJ3 Q;  1DOL A;  4Q5V A;  4AYB B;  1T5X D;  2A19 A;  1N32 Q;  2R3Z A;  4KN7 C;  3A5Z B;  4CGY B;  1IBM L;  2V1C C;  2QGQ A;  4B3S L;  2KJX A;  3Q22 A;  2OEO A;  1LYL A;  1RKN A;  1X55 A;  2R7Z B;  5T1G A;  2OXP A;  1KIX A;  1EWI A;  4XT3 B;  2B2T C;  1HR0 Q;  4J1M A;  3VYR A;  1E7Z A;  2VL6 A;  3HOY H;  1A62 A;  1IYU A;  1WYD A;  2I5M X;  1CZW A;  4I65 A;  2D0P A;  2HDL A;  4PMW A;  2QEJ C;  1JR0 D;  1PTO D;  3F2U A;  1EL0 A;  3H09 A;  3RMH A;  1S5B D;  4FF3 A;  5EKK A;  2PCF B;  3OMG A;  4GKJ L;  2L9H A;  1S5D D;  2F0K A;  1RD9 D;  2VQF Q;  3PMF A;  4C2M H;  5IGF A;  1LTG D;  2L4N A;  3SDZ A;  2HIX A;  4JYA Q;  4ZRZ A;  5C4X B;  5EJW A;  1HZ9 A;  4JYA L;  2CKZ B;  3Q0A A;  2NVX H;  2K14 A;  5KRU A;  3KJP A;  1BF4 A;  4LUZ A;  1WTV A;  1XNQ L;  3SXH A;  3PF4 A;  4JC0 A;  4DR1 L;  2D2C C;  4FO2 A;  3MFG A;  2B2T A;  3MHB A;  2DNC A;  1SLJ A;  4AIM A;  1MIU A;  1KRT A;  2R93 B;  4IOC A;  4ZAI A;  3AFP A;  4LJZ C;  1SYB A;  4CKE A;  2AQ1 B;  5I9P A;  4KK7 A;  1JIC A;  4BS9 A;  4LFB L;  2JA5 H;  5BN4 A;  4ODG A;  2EIF A;  3R8B A;  1RTO A;  1MJC A;  1TKW B;  2R6G A;  1V1P A;  3T1Y Q;  5KND A;  1V43 A;  1E2V A;  4C3I H;  1EY9 A;  4JBW A;  3CCQ A;  3CXC A;  5C0X J;  4POG A;  3EVQ A;  1K9M C;  1F9Q A;  3J81 j;  1EQV A;  1TWH B;  4RCN A;  2QDB A;  4KTA A;  4GZY C;  4RH6 A;  3C3L A;  3K58 A;  1XPR A;  1XNR Q;  3GTQ H;  1ZEQ X;  3CQZ B;  1CA5 A;  1PTO C;  4ID6 A;  2IX0 A;  4WRD A;  2OWO A;  3QB3 A;  3NK9 A;  3M4P A;  5KYL A;  2EYM A;  4A93 G;  4RMF A;  1B1Z A;  1SYD A;  3I72 A;  1BKB A;  3OHX C;  1IYV A;  1ZKO A;  1Q46 A;  1EY4 A;  1KNE A;  3SGI A;  3SK4 A;  1SXT A;  1B7Y B;  5C3E G;  1HA6 A;  2VNU D;  2EJF C;  1F77 A;  2F0I A;  4B3M Q;  1RL2 A;  1HNZ Q;  1K8G A;  4UPA A;  5IWA Q;  3U9S A;  4C3J H;  5NUC A;  2R92 B;  3GDE A;  2A8V A;  1GKH A;  3NEL A;  1K28 A;  1EIY B;  4KKT A;  4LFC Q;  4LF9 L;  4BY7 G;  1SYC A;  2ZTC A;  4FXK C;  5EGT A;  3A55 A;  1ILP A;  4JG2 A;  1JJ2 A;  2E5L Q;  4G7Z C;  3QR8 A;  2BA1 A;  5TSS A;  1ICF B;  4LFC L;  2AWN A;  1D1I A;  4WJW A;  1TS3 A;  1Q12 A;  2RDG A;  1K83 B;  1HTL D;  1FGU A;  2Q2I A;  1K73 C;  2L15 A;  3D8G A;  4NW2 A;  2XGT A;  2KVM A;  1A15 A;  1K8O A;  1KAA A;  2XSC A;  4N8X 1;  2JEA I;  1XTD A;  4DUY L;  5CV9 A;  1SMX A;  4H44 C;  1Y1V B;  3A7L A;  2KEC A;  4DR6 L;  1JWU D;  1KAB A;  4WJ4 A;  2I07 B;  1KDA A;  1SR3 A;  2A6H D;  1K83 H;  1LTB D;  5C3X A;  1AH9 A;  4GN3 B;  4ZQ3 A;  2VB3 X;  4A3L G;  4B3M L;  1C9O A;  4L5Q A;  2O5J C;  4LF5 L;  1K0R A;  2IW3 A;  3HGB A;  4H13 C;  1JWM D;  5DLQ E;  4ULL A;  1PH1 A;  4C56 C;  1I4Q A;  3A8I E;  3HOW B;  3S9W A;  3KK7 A;  3K0Y A;  1I4H A;  2AUJ D;  3L7Z C;  1CM9 A;  1VQE A;  2OF1 A;  1KL9 A;  1Q82 C;  2L1B A;  5BN5 A;  1TWG B;  1JC7 A;  5E4W C;  3STB C;  3E9I A;  3S24 A;  1D6E C;  1PMR A;  1KQS A;  4DV3 Q;  4JI3 L;  4C3H B;  3A8K E;  5IYD G;  5IGD A;  4HAE A;  1O80 A;  5M5W B;  4ZLT F;  2A6E D;  5IP9 G;  2A68 D;  1QZH A;  3DMU A;  1OXS C;  3T1H L;  4DN4 M;  4OO1 G;  5BR8 Q;  3LX0 A;  2TMP A;  4A3F H;  2K52 A;  1KTK A;  1X54 A;  3ULP A;  3MXU A;  1H9K A;  2DY7 A;  1A3V A;  1YBY A;  1BBX C;  1RJT A;  1EZ6 A;  1R4P B;  2R93 H;  4PZ7 A;  3N52 A;  5GAH C;  3CF5 A;  2B2Y C;  1SE3 A;  1N33 Q;  1CQV A;  3S16 B;  1AE2 A;  1HUM A;  1IBK Q;  3VR6 A;  4IJH A;  3OWE B;  2PI2 A;  2MNA A;  3AMU A;  2KCT A;  4RAU C;  3NQI A;  4R4T A;  4BBR B;  3J81 i;  4M1U B;  4WOR A;  3RUZ A;  5KGU A;  1SMY D;  2Q8T A;  1SYF A;  4UP7 A;  4IFD G;  5A35 A;  4DV3 L;  2Q2U A;  4L8J A;  5DNF A;  2F0L A;  4IUV A;  4A3E B;  1L0W A;  2Z4I A;  5BN3 A;  2Z6K A;  4DR7 L;  4OX9 Q;  2R92 H;  3UDG A;  2DUD A;  1U5K A;  1QZG A;  2GN5 A;  1BR9 A;  3WDN A;  3AB9 A;  1PYS B;  2C9O A;  2NBF A;  3PIP A;  3K0X A;  1H9S B;  5C4J H;  4GNX A;  2A69 C;  2R7D A;  4LNQ A;  1W2B A;  3DXJ C;  4YIJ A;  1KHI A;  2VB2 X;  3C2P A;  3ONA B;  2K03 A;  1GO3 E;  4IAL A;  4AQY L;  1WVL A;  1B8A A;  1U0L A;  4R4I A;  4E6I A;  2B8G A;  2Y0S G;  4A3I B;  4EX5 A;  4A3K B;  2E2J B;  4QB4 A;  3TP8 A;  2BE5 C;  4POF A;  2F0E A;  3D6C A;  1QOH A;  1STE A;  1PRT D;  1YNN D;  3RNU A;  4XQN A;  1Q86 C;  3PQI A;  1OXX K;  4UP9 A;  2Z6B A;  2KEE A;  3BDC A;  3UDI A;  2E2D C;  1X3G A;  4B3R L;  4A3B G;  2F0F A;  1JMC A;  1STA A;  2JA6 H;  4V19 0;  3PSI A;  2BH8 A;  3T13 A;  5C4X G;  4IPD A;  1WCM G;  4LK1 C;  3H0G B;  2B29 A;  2OQK A;  2TSS A;  1QVC A;  1XPO A;  3HOZ B;  1Y14 B;  4DGZ A;  4L5R C;  4IQZ A;  3KJO A;  1GHK A;  4NMZ A;  2UU9 L;  2KCM A;  2XWJ B;  1BNZ A;  2UUA L;  2JXM B;  1SE4 A;  2ASB A;  3F8T A;  1HNZ L;  5CR3 A;  2KHI A;  3IFT A;  5IGB A;  3D4W A;  2A5H A;  1KLG D;  2R7F A;  5HUR A;  2EJM A;  1E22 A;  1FNW A;  3FHW A;  3CCE A;  4V0B A;  5C44 H;  5IGE A;  4LF7 Q;  2HQL A;  2DY8 A;  3U4Z A;  3I73 A;  1M8A A;  3BZK A;  3R3O A;  4YHH Q;  3KLS X;  1Y69 U;  4Y7N B;  4IFD J;  3VDY A;  1N9W A;  3CRK C;  1ESR A;  1O7Y A;  4DV2 Q;  1R4Q B;  3KF8 B;  2L55 A;  4QY7 A;  5LMN Q;  5C4H A;  1C4Q A;  5IWA L;  1XJV A;  1HRJ A;  3K7U C;  3D4R A;  3RZO B;  3W3A A;  3ULL A;  4K8J A;  2CCZ A;  1BXT A;  4BY1 B;  5D14 A;  5CV7 A;  2F4V L;  1PYB A;  1I94 Q;  5G3L F;  2ZTE A;  1M4V A;  3Q24 A;  5IOC A;  2F03 A;  3I7F A;  1AN8 A;  1I6V C;  1D8L A;  1N36 Q;  1X9N A;  1PV4 A;  3MA2 B;  4HED A;  4A3D B;  2PO4 A;  5EAY A;  3U4V A;  4HCE A;  4AYB G;  5I4D A;  2EY1 A;  1JT8 A;  1C8C A;  1M1K C;  1RCV D;  2F0J A;  1CHP D;  2PYK A;  3RN5 A;  1HNW Q;  4QUC A;  2F52 A;  1FR3 A;  1U4P A;  3HS0 C;  4UY8 C;  1PTO F;  3Q23 A;  1PXU A;  5CV5 A;  3GV3 A;  3C46 A;  3H3V I;  1I6H B;  1ESF A;  5CBE E;  4DR6 Q;  4DK6 C;  3P1H A;  2R92 G;  1WTX A;  3MZ5 A;  4DV1 Q;  2K33 A;  4C3J B;  5LHY 1;  4NXN Q;  5IY0 A;  2R7Z G;  4OWT B;  1UNS A;  1MBY A;  2XWB B;  4IFD H;  1GM5 A;  1I4R A;  4S3S A;  3CC2 A;  2Y0S B;  5KYI A;  5EPJ A;  2NVT B;  1I94 L;  1BCP B;  3Q8D A;  3GTM B;  1KXL A;  1EOT A;  2GA4 B;  4IN3 A;  2NN6 G;  4X3K A;  4B3S Q;  3SK6 A;  1Q1B A;  1BOS A;  1SNO A;  3A74 A;  3DWA A;  3TEH B;  3ULJ A;  3G6E A;  2O4X A;  5FJ8 G;  1W6J A;  5KIX A;  3H0G G;  4DR4 Q;  1JOK A;  1KC8 C;  4LAA A;  5IT9 E;  1XMQ Q;  4GN5 A;  2F0N A;  4YY3 Q;  1B4O A;  1VQP A;  5IYB H;  3KLS A;  2QDL A;  2D5D A;  4K5W A;  3BS1 A;  4PNY A;  5JVG 3;  1IBL Q;  3IRB A;  4X3U A;  5IGC A;  1IKL A;  3QIA A;  4A3F G;  3F2D A;  4ALP A;  4BY7 H;  1SNP A;  4OEM B;  1H95 A;  1Z9F A;  4JI2 L;  3OIP A;  5E3F A;  5ELN A;  5IP7 H;  2VY3 A;  4DK3 C;  2F0T A;  3LWU A;  5CGK A;  4DV6 Q;  2K1B A;  3NXW A;  4DR5 Q;  3NTI A;  1QVF A;  1LV9 A;  5FJ8 H;  3QO2 A;  1PH3 A;  1ENC A;  2KCN A;  4BBS H;  3A7A B;  4UDU C;  1LTA D;  2AUK A;  1ET9 A;  1WOC A;  5E4X A;  2B2U A;  2KQ3 A;  1A2T A;  3HFZ B;  1L0X B;  5IYC G;  3CC7 A;  3GTK H;  4A93 H;  3MTS A;  3W2D A;  5KEE A;  4YCV A;  4YCU A;  1WJJ A;  2WKD A;  1IHZ A;  3TP5 A;  5M3F G;  1I50 H;  4G57 A;  4N9P A;  2R7Z H;  3FDT A;  4IPC A;  1E2W A;  4DXF A;  3D0F A;  3OIQ A;  3A54 A;  2JYO A;  3H3V H;  3C1E A;  4XQQ A;  1HFN A;  4A3L H;  1DD2 A;  3G71 A;  3VYT A;  3B6Y A;  4QIW E;  2F3I A;  3GTM H;  5EPL A;  4RCO A;  4PZ6 A;  1TWH H;  1OO9 B;  4BXX G;  4DAM A;  4P74 A;  4HSP A;  1E0B A;  2Q8R E;  1CSQ A;  2ID0 A;  1FJG Q;  1TWG H;  5C0X G;  3GP7 A;  4QQB X;  4NDX A;  3HRZ C;  1G6Z A;  5KNC A;  2K5N A;  3OPO A;  4DR2 Q;  3ZYY X;  3L0O A;  1SJH D;  2JA8 G;  4KHP Q;  2I5H A;  3ERO A;  3CCM A;  1BCP D;  4FF2 A;  5E1F A;  2MUY A;  4KV6 A;  1SEB D;  4CJ1 B;  2O5I C;  1QUQ A;  3NPP A;  4GKJ Q;  4KMU C;  3NUC A;  1S3O A;  3JAM L;  1KDC A;  5JJL A;  3ND8 A;  1XMO L;  1V1O A;  1PRT F;  1PH2 A;  4C3J G;  1VQG A;  3PUY A;  1QB5 D;  4A3D H;  2DJF C;  1VQA A;  4HJ9 A;  2D62 A;  4MHE A;  2JA7 G;  1VMP A;  2KOL A;  2EVB A;  3GQB A;  1A2U A;  1G8Z D;  5FLM H;  5D3D A;  4HIK A;  5GAG C;  3CPW A;  4OXP A;  1S5F D;  2K5H A;  4KLK A;  2K32 A;  3P7J A;  1EWC A;  3N6R A;  4YY3 L;  3DWP A;  1MSG A;  2MHV A;  2HIV A;  2UUB L;  1OTC A;  3NP8 A;  1AFP A;  2J7Z A;  1GOZ A;  2R61 A;  2JE6 I;  1TT2 A;  1JOQ A;  4EVO A;  3HOY B;  4R1J A;  3NWS A;  1VCI A;  2K04 A;  4U67 3;  1WD0 A;  4JI7 Q;  1FNU A;  1II3 A;  3HKZ B;  4C3I B;  3HOX H;  3F2B A;  2Z4H A;  4J8Q A;  5C6A A;  2PPB C;  1GJX A;  3KLR A;  3M4O H;  4EQ5 A;  2EY2 A;  5CV4 A;  1EUJ A;  1G2S A;  4JI4 L;  2KHJ A;  4JBK A;  4A3B B;  4DAY B;  4A3M B;  1D5Z C;  4HMJ A;  4ZYS A;  5GQO A;  4OON A;  1LTS D;  2KUM A;  3D4D A;  3T1H Q;  2PNH A;  4GNX C;  3CQZ H;  1J8I A;  4B3T L;  2O2L D;  3HOX G;  1HZC A;  2F0H A;  1I4G A;  3ITP A;  1HNW L;  5FO9 B;  2ES2 A;  4LFB Q;  4FXG C;  2E74 C;  2BOS A;  2LFN A;  1KAW A;  3GTK B;  4DNR B;  2E2J H;  1AEX A;  4Q0F A;  4N9T A;  4DV2 L;  3TQY A;  5ELO A;  2EYO A;  2AHO B;  4OL7 A;  4P73 A;  3S15 B;  1N34 Q;  5DM6 3;  1Q90 A;  5IYC H;  3TSS A;  3WOF A;  3QG1 A;  1S4Z A;  3S1Q H;  4KD3 A;  3AYH B;  2PW5 A;  2DN8 A;  3MVV A;  4AYB E;  4ZKC B;  1VQL A;  1IBM Q;  1TWA H;  4KHP L;  4A3D G;  1B9M A;  2DNE A;  1WFQ A;  1KD1 C;  4A93 B;  1HZB A;  5JJZ A;  1IW7 C;  1RIP A;  4X3T A;  2B39 A;  1YJ9 A;  1PDQ A;  4RKL A;  1I4P A;  1EOV A;  2RDH A;  1HJP A;  4C2M B;  4P71 A;  3FEW X;  3PGZ A;  3VR2 A;  1EYG A;  4KJN A;  4JK1 C;  2WFW A;  2Q8I B;  2NVX B;  2AMC B;  1LAB A;  3HZX A;  4JCV E;  4JVZ A;  3MEH A;  3S14 B;  2NVY B;  3L3O C;  2CQO A;  3T53 B;  5FLX c;  1D5X C;  4DAV A;  1EQQ A;  3VA7 A;  4YWM A;  4A3K G;  2XRQ D;  1A63 A;  1J9O A;  3FPU B;  4ZKB B;  3S14 H;  3GTJ H;  4GKK L;  1B3A A;  3BJU A;  1G51 A;  4JBM A;  3HOW H;  1KLU D;  2WV6 D;  5DEH A;  2RVL A;  4OX9 L;  1TWF H;  3HOZ G;  2EY6 A;  4B3R Q;  3ER0 A;  3S1R H;  3GTO B;  3H15 A;  1NSN S;  1AZP A;  3PIO 3;  2CVR A;  2PZW A;  4LW1 A;  1FNV A;  2F0U A;  1MI2 A;  4P2C B;  4C3H G;  5JPM C;  4ILW A;  1SYE A;  1JJC B;  3GTJ B;  3D6W A;  5C5M A;  2NVT H;  3TRZ A;  1Q81 C;  1A0I A;  4X66 L;  1S40 A;  1J5E L;  3LGJ A;  3SR1 A;  4HJ8 A;  1CTM A;  4KKU A;  4HID A;  3QOL A;  3FKI H;  4RG1 A;  4A3G G;  2NYZ D;  4QJF A;  5JPN C;  1Z47 A;  3GTQ B;  5M5Y H;  4B9X A;  2Z1C A;  1EY7 A;  1HXY D;  1VQN A;  3X3M A;  2WAQ G;  2VZA A;  3FP9 A;  3KF6 B;  4GN4 B;  3RZD H;  4L5S A;  3J80 L;  1GUT A;  4A3G H;  2B2U C;  1BO0 A;  2EPB A;  1Z7T A;  4FNF A;  4DU9 A;  1VQ6 A;  2ALY B;  1BUV T;  2A6E C;  2ZXO A;  3PF5 A;  2X6G A;  1UE1 A;  2NWG A;  3S1N B;  2Q2H A;  2DGY A;  1RHP A;  4I7A A;  3RN2 A;  1SAP A;  2LXK A;  4HIO A;  3CPF A;  2JA9 A;  3CC4 A;  5M9O A;  2Y0S E;  5M3M G;  2BE5 D;  1HHV A;  2SDF A;  4DPG A;  5M3M B;  1PH5 A;  1YNJ D;  1AZQ A;  2X6L A;  3VYS A;  4JI5 L;  4A3E G;  3URY A;  3J80 c;  1UUP A;  4IUU A;  1ZXT A;  2B63 H;  3CRL C;  2VW9 A;  1PRT B;  5M3M H;  1NUC A;  2F0O A;  3ND9 A;  2H5X A;  5C44 G;  4B9W A;  4EQN A;  2RSN A;  1PTO B;  2WP8 J;  2A6H C;  3I4N H;  3SHL A;  1EU3 A;  2OQ0 A;  1CKM A;  1YIJ A;  1VQD A;  1X56 A;  1PFN A;  2ZJQ A;  5E7N A;  1C48 A;  4HSV A;  1YIT A;  3CCS A;  1EEI D;  4YHH L;  2JEB I;  1HQR D;  2E76 C;  3I4N B;  1Z6H A;  1EWH A;  2WKC A;  2NZ1 D;  1ROD A;  4O0A A;  1VF7 A;  2A73 B;  5FLX E;  1BCP C;  3BYY B;  5AFW A;  2JJQ A;  4LUO A;  1P16 A;  2ZJP A;  2E2I H;  1IL2 A;  5L37 A;  2JN4 A;  4PMB A;  4LF8 Q;  3FKI G;  4A3B H;  3BZC A; 
#chains in the Genus database with same CATH homology
 1DCZ A;  1ONL A;  1HFG A;  3X3N A;  1LT4 D;  4HR7 B;  3IL8 A;  3H94 A;  1O7Z A;  3FMC A;  1DON A;  2IWH A;  2L12 A;  3KBG A;  2RBM A;  1WCM B;  1OXV A;  5F2D A;  3M4Y A;  4C3I G;  1HPC A;  1SYG A;  3TN2 A;  1SFO B;  2EYL A;  3NSW A;  2RSO A;  3V96 A;  5CV8 A;  1CHQ D;  3G7L A;  2L11 A;  1U4L A;  4X3S A;  5I6W A;  5K36 H;  2HQE A;  5IT9 L;  3HOX B;  1UEA B;  3BDO A;  1SNC A;  1D2B A;  3G6J B;  5HGT A;  3VR3 A;  4Z9C B;  2EYP A;  2XNA C;  5EBC A;  4IUP A;  1SSO A;  2JSO A;  5I2Y A;  1OXT A;  2X69 A;  2B2W C;  1CK1 A;  4QUF A;  2B2V C;  3GV6 A;  2J0T D;  3D31 A;  3AU7 A;  2Z8L A;  4K2K A;  3PUZ A;  4R9W A;  3KBX A;  2ZT9 C;  3I4L A;  4ZUI A;  5FO7 B;  1T5E A;  1BCP F;  4R8I A;  4RKB A;  5T1I A;  3JAM E;  1SBB B;  3GO5 A;  1TS4 A;  4NKL A;  1LTT D;  1G91 A;  1O7L A;  4RGO S;  5JEA G;  1STG A;  3EJI A;  3PUX A;  4K14 A;  3V2T A;  2D9U A;  1GUN A;  1CZG A;  1EY0 A;  2F4I A;  3K6O A;  4HTH A;  3C1F A;  4PQX A;  1PZI D;  4FYD A;  1SND A;  2HCC A;  2J4X A;  5C5L A;  2WB1 B;  1A6X A;  2ZXR A;  2F3W A;  4KJO A;  1JWS D;  2K7V A;  1GUG A;  3RD4 A;  2EYF A;  1XYI A;  5M5Y B;  3HEJ A;  4IZ8 A;  2BCO A;  1R9T B;  3MXN A;  3J81 E;  2NB0 A;  1Q8I A;  3DEO A;  2FFK B;  4DXG A;  1TS5 A;  1TWF B;  1ENF A;  3IAY A;  2KED A;  1CI3 M;  1ET6 A;  3J7A F;  4XDX A;  4OO1 H;  3Q6S A;  2E2H B;  5J1Z A;  2B2Y A;  3FRP B;  1RF2 D;  1PTO H;  2VUM B;  1F2Y A;  1JOO A;  1DM0 B;  1HTP A;  5K36 G;  3S1Q B;  2CW0 D;  4H0L C;  1F2M A;  5COR A;  1G2T A;  2RKS A;  2ZXP A;  1W6K A;  5ELC A;  3HOV B;  3VYU A;  5KNB A;  4K8I A;  1DJR D;  4CKC A;  1TQO A;  2PZU A;  4OIK A;  1JE4 A;  1JOR A;  3GTG B;  3J7A V;  4KY7 A;  5G3L D;  2FMC A;  1WTQ A;  3NWT A;  2PW7 A;  4XQJ A;  2V4D A;  4RHR A;  2B63 B;  1S5C D;  4CKB A;  3MXP A;  3TP6 A;  2PMZ B;  1F2L A;  1H9J A;  5JOB A;  1GUW A;  1E2Z A;  1LTI D;  4KD4 A;  1X3P A;  4CJ2 C;  2NVQ B;  2EYH A;  5C44 B;  3BZD B;  1JB3 A;  1SDF A;  2A69 D;  3NTH A;  3O13 A;  1K8M A;  5C4J B;  5CMD A;  1A3U A;  4RA8 A;  1DXM A;  4K5V A;  2CW0 C;  5J39 A;  3P75 A;  1WTW A;  3BDL A;  2HCI A;  1TWC B;  2FMM A;  3TBI B;  2WIN B;  5I9O A;  3SVM A;  4OO1 I;  2B2V A;  4UAI A;  1LO5 D;  1IL8 A;  3FKI B;  3K57 A;  1LT6 D;  1SNM A;  4QMG A;  3PUV A;  3DM1 A;  2IL8 A;  1NCV A;  2H4O A;  3IKJ A;  3VR4 A;  3KUP A;  2LY7 A;  1ICW A;  3NBI A;  2M9V A;  3D3R A;  2KHS A;  1ZYR D;  4DAY A;  2HDM A;  3LWE A;  4O1N A;  1EFI D;  2LS0 1;  2EXZ A;  4KY5 A;  3TP7 A;  3A56 A;  3TZD A;  3IFD A;  3VR5 A;  2L0C A;  3EA6 A;  4RWS C;  1LLR D;  1A3T A;  1KNA A;  1DYQ A;  1B44 D;  4BBS B;  4J6H A;  1NR2 A;  3PUW A;  2F1M A;  3SEB A;  4RHS A;  5FO8 B;  1FGB D;  3GTP B;  2NTS A;  1QCB D;  1JCK B;  2AQ2 B;  2L5T A;  1JQY D;  2F0V A;  1LTR D;  3NBH A;  1QNU A;  1EYA A;  2F0D A;  1EU4 A;  3ERQ A;  4WFN 3;  1X3Q A;  4BA1 I;  1EIH A;  3NQT A;  1EY5 A;  4OIJ A;  4RGT A;  2ENB A;  3RLF A;  2RDF A;  3R93 A;  4H7B A;  4ME5 A;  1OXU A;  5EKI A;  5EKL A;  4BY7 B;  2IPK D;  3WOE A;  1QG7 A;  5JEA J;  1HUN A;  2MP1 A;  3CKI B;  3EQL C;  1EYD A;  3K5L A;  1G29 1;  1I4X A;  2F0W A;  2N88 A;  2LKV A;  1UAP A;  5JAV A;  4M8A A;  4B08 A;  3NE5 B;  1TU2 B;  3R2T A;  1EEF D;  2SNM A;  5DM7 3;  3K5M A;  3DWQ A;  2IX3 A;  2E2I B;  5ELF A;  4K5X A;  4DAP A;  2XIW A;  1QWY A;  5IOD A;  2BDN A;  3GD7 A;  1SE2 A;  4G7O C;  3T16 A;  4XYQ A;  4KKS A;  2MGS A;  4DNT B;  4ABN A;  2YU9 B;  3NTK A;  4EQP A;  2CQA A;  1PZK D;  3SK5 A;  1ML0 D;  3UI2 A;  2NN6 I;  4DK1 A;  5I6Y A;  2WAQ B;  5C0X H;  1EYC A;  5M5X B;  4K6L A;  1EY6 A;  3I91 A;  1BDO A;  3VA5 A;  4DFA A;  3S1R B;  3I8Z A;  1IW7 D;  3OMC A;  2PQE A;  1WTP A;  4FXD A;  2KCC A;  1TR5 A;  2JP1 A;  2BA0 A;  4XTC S;  1MGS A;  2EZV A;  2KA7 A;  2FHT A;  2IJ0 A;  4FP5 D;  1ILQ A;  4XYO A;  1F9P A;  1S5E D;  2N55 A;  5FKA C;  3PO2 B;  5A2Q E;  4KI0 A;  1Q3L A;  3DEP A;  1XXG A;  1XX8 A;  3K7A B;  3BVZ A;  3I3C A;  3T4A C;  4C1N I;  5C3W A;  4FF4 A;  4KHV A;  4CBV A;  4HN7 A;  4IUT A;  1AW7 A;  3BYT B;  3TDQ A;  5LL6 X;  3H3V C;  2F0M A;  1XTC D;  2WII B;  2CHB D;  4NP5 A;  1PFM A;  2H1E A;  3CHB D;  4G7H C;  4ZUJ A;  4L63 B;  3PO3 B;  5CYU A;  4RFB A;  4XT1 B;  3S1M B;  1LT3 D;  3U9O A;  3OWF A;  2K6A A;  3M3Y B;  1F2Z A;  2WAC A;  2E75 C;  5D65 A;  3I4M B;  3V05 A;  2XN9 C;  5D3I B;  1STH A;  2F0Q A;  1I3Q B;  1V1P B;  3A8J E;  4IUN A;  3J80 E;  2EE1 A;  1DZ1 A;  2YYZ A;  1GHJ A;  4K6D A;  1ZYR C;  3P20 A;  3HG9 A;  3FVQ A;  2A74 C;  1LT5 D;  3MWY W;  1F9R A;  2G9H D;  2M2L A;  4F87 A;  3DHQ A;  1STN A;  4U68 A;  4F8M A;  1LAC A;  1CFM A;  3K5N A;  2NTT A;  3M4O B;  2EDG A;  1HCZ A;  3M7N A;  1Y1W B;  5CC4 A;  2G9D A;  2RQX A;  1D5M C;  1U4R A;  1EIG A;  1YNJ C;  2EY5 A;  5CBA E;  5JVH 3;  1H9M A;  2I46 A;  3HOU B;  3SK8 A;  4RGN A;  1GXD C;  4I7Z C;  2SNS A;  4K2L A;  5ELE A;  2EJG C;  3TME A;  1KDB A;  5A2Q L;  1Q1E A;  1SNQ A;  2FJ2 A;  2K05 A;  3I90 A;  5COY A;  1U4M A;  3BG3 A;  4F88 A;  1TY0 A;  1EZ8 A;  3MC0 B;  2K01 A;  2QKI C;  3FPP A;  3I70 A;  1FD7 D;  1TWA B;  2ICE C;  1RTN A;  2F0S A;  5C4Z A;  1QE6 A;  1VMC A;  3E0J A;  5C3E B;  1WD1 A;  2K28 A;  1DOM A;  1TVX A;  2EYJ A;  4MIU A;  1I50 B;  1Y8O B;  1GUS A;  5FOB B;  1V8Q A;  1PZJ D;  4IFD I;  1HQM C;  5JEA H;  4QIW B;  4EQO A;  1Y8N B;  4L6T B;  3BVM A;  1IKM A;  5IIF A;  5IGG A;  4IUQ A;  1EY8 A;  1PYW D;  3H6M A;  2AQ3 B;  2OT2 A;  2QCP X;  4TSS A;  3OW7 A;  3KF8 A;  3QJY A;  4PMC A;  1DOK A;  3L9A X;  3CU7 A;  3LNN A;  1CA6 A;  2QF7 A;  3EFX D;  2MPM A;  3M7G A;  1NR4 A;  1RDP D;  5K5P A;  1STB A;  4HMI A;  2A68 C;  3OOC A;  1O78 A;  1XWE A;  3E5S A;  5FLX L;  3PV0 A;  3T51 B;  1CT1 D;  1PFB A;  2K5D A;  4TQU S;  5ELD A;  3H91 A;  1TII D;  1VF5 C;  4KHZ A;  5C0X I;  4A3G B;  4DF7 A;  4LMQ D;  2NN6 H;  4DA2 A;  1Y8P B;  2EOT A;  1MSH A;  4RGM A;  1WTR A;  2F0G A;  1SJE D;  4R8N A;  3S2H B;  3GTL B;  1TS2 A;  3PIP 3;  4DK0 A;  5J22 A;  4FVM A;  4EGV A;  4CJ0 B;  1QNK A;  3M85 A;  1WTO A;  2M00 A;  4OGQ C;  4BA2 I;  1ENA A;  1STY A;  3MFY A;  4HCS A;  4A3J B;  3T56 B;  2IT1 A;  5CV6 A;  5ISR A;  2NUC A;  3QWN A;  2JA5 B;  4CHT B;  4BWG B;  2QIL A;  4KN4 C;  1TY2 A;  2XVS A;  4O42 A;  2AWO A;  2SEB D;  4IUR A;  3TZU A;  1B9N A;  2MJ8 A;  2IX1 A;  3RZD B;  1NAP A;  4C1N K;  1L0Y B;  2JA6 B;  3HP3 A;  2K5Q A;  1U9R A;  4MN3 A;  2PZT A;  1HA5 A;  2LMC B;  4FF1 A;  3K59 A;  2F0P A;  4F7X A;  2C5C A;  4QCL A;  4PV1 C;  3J7Y W;  4QF4 A;  5EQ0 A;  1X32 A;  1VDZ A;  2XRS D;  4ZK9 B;  2B8F A;  2HUG A;  1H9R A;  3OSO A;  3J81 L;  3S17 B;  2JA7 B;  1B2T A;  1PRT C;  1YNN C;  1B53 A;  1H9S A;  4KY6 A;  3MAQ A;  3SE0 A;  3DUZ A;  4A3F B;  1PLF A;  1MD2 D;  1F9S A;  4XIG S;  1FYC A;  1B50 A;  3K5O A;  5DAU A;  2PNR C;  2SOB A;  5ELB A;  3BVG A;  4XXE A;  1CQF A;  2FIN B;  2ICI A;  4OHJ A;  2VXW A;  5EBD A;  2RA4 A;  2K5W A;  4G4K A;  1EQT A;  1D1K A;  4TKO B;  2F3V A;  3S2D B;  5EPK A;  3NHH A;  2JA8 B;  1QIL A;  1SMY C;  2B2W A;  5FK9 C;  3E6Z X;  5M3F B;  3MXG A;  5I2X A;  1GUO A;  3QOJ A;  1QJO A;  5LL6 S;  1AP0 A;  3R2I A;  1BQQ T;  2BDO A;  4Q5V A;  1DOL A;  4AYB B;  1T5X D;  2R3Z A;  4KN7 C;  4CGY B;  2KJX A;  3Q22 A;  2OEO A;  1RKN A;  2R7Z B;  5T1G A;  2OXP A;  4XT3 B;  2B2T C;  4J1M A;  3VYR A;  1IYU A;  1CZW A;  4I65 A;  2HDL A;  4PMW A;  2QEJ C;  1JR0 D;  1PTO D;  3F2U A;  1EL0 A;  3H09 A;  3RMH A;  1S5B D;  4FF3 A;  5EKK A;  2PCF B;  3OMG A;  2L9H A;  1S5D D;  2F0K A;  1RD9 D;  3PMF A;  5IGF A;  1LTG D;  2L4N A;  3SDZ A;  4ZRZ A;  5C4X B;  5EJW A;  3Q0A A;  5KRU A;  1BF4 A;  1WTV A;  3SXH A;  2D2C C;  4FO2 A;  3MFG A;  2B2T A;  3MHB A;  2DNC A;  2R93 B;  4ZAI A;  4LJZ C;  1SYB A;  4CKE A;  2AQ1 B;  5I9P A;  4KK7 A;  1JIC A;  4BS9 A;  5BN4 A;  4ODG A;  3R8B A;  1RTO A;  1TKW B;  2R6G A;  1V1P A;  5KND A;  1V43 A;  1E2V A;  1EY9 A;  4JBW A;  5C0X J;  3EVQ A;  1F9Q A;  1EQV A;  1TWH B;  4RCN A;  2QDB A;  4KTA A;  4GZY C;  4RH6 A;  3C3L A;  3K58 A;  1ZEQ X;  3CQZ B;  1CA5 A;  1PTO C;  4ID6 A;  2IX0 A;  4WRD A;  3QB3 A;  3NK9 A;  5KYL A;  2EYM A;  1B1Z A;  1SYD A;  3I72 A;  3OHX C;  1IYV A;  1ZKO A;  1EY4 A;  1KNE A;  3SK4 A;  1SXT A;  1HA6 A;  2VNU D;  2EJF C;  1F77 A;  2F0I A;  3U9S A;  5NUC A;  2R92 B;  4KKT A;  1SYC A;  4FXK C;  5EGT A;  3A55 A;  1ILP A;  4G7Z C;  2BA1 A;  5TSS A;  2AWN A;  1D1I A;  4WJW A;  1TS3 A;  1Q12 A;  2RDG A;  1K83 B;  1HTL D;  4NW2 A;  3D8G A;  2KVM A;  1A15 A;  1K8O A;  1KAA A;  2XSC A;  2JEA I;  5CV9 A;  4H44 C;  1Y1V B;  3A7L A;  2KEC A;  1JWU D;  1KAB A;  2I07 B;  1KDA A;  2A6H D;  1LTB D;  5C3X A;  4ZQ3 A;  2VB3 X;  2O5J C;  2IW3 A;  3HGB A;  4H13 C;  1JWM D;  4ULL A;  4C56 C;  1I4Q A;  3A8I E;  3HOW B;  3S9W A;  3KK7 A;  3K0Y A;  1I4H A;  2AUJ D;  3L7Z C;  1CM9 A;  2OF1 A;  2L1B A;  5BN5 A;  1TWG B;  1JC7 A;  5E4W C;  1D6E C;  1PMR A;  4C3H B;  3A8K E;  5IGD A;  4HAE A;  5M5W B;  1O80 A;  4ZLT F;  2A6E D;  2A68 D;  3DMU A;  1OXS C;  4DN4 M;  4OO1 G;  3LX0 A;  2TMP A;  1KTK A;  3MXU A;  1H9K A;  2DY7 A;  1A3V A;  1BBX C;  1RJT A;  1EZ6 A;  1R4P B;  3N52 A;  2B2Y C;  1SE3 A;  1CQV A;  3S16 B;  1HUM A;  3VR6 A;  3OWE B;  3AMU A;  4RAU C;  3NQI A;  4BBR B;  4M1U B;  4WOR A;  3RUZ A;  5KGU A;  1SMY D;  2Q8T A;  1SYF A;  4IFD G;  5A35 A;  4L8J A;  5DNF A;  2F0L A;  4IUV A;  4A3E B;  2Z4I A;  5BN3 A;  1BR9 A;  3WDN A;  3AB9 A;  2C9O A;  2NBF A;  1H9S B;  2A69 C;  3DXJ C;  4YIJ A;  3C2P A;  2VB2 X;  3ONA B;  2K03 A;  4IAL A;  1WVL A;  4E6I A;  2B8G A;  4A3I B;  4A3K B;  2E2J B;  4QB4 A;  3TP8 A;  2BE5 C;  2F0E A;  3D6C A;  1QOH A;  1STE A;  1PRT D;  1YNN D;  4XQN A;  1OXX K;  3BDC A;  2KEE A;  2E2D C;  2F0F A;  1STA A;  4V19 0;  3T13 A;  4LK1 C;  3H0G B;  2TSS A;  3HOZ B;  4DGZ A;  4IQZ A;  1GHK A;  4NMZ A;  2XWJ B;  1BNZ A;  2JXM B;  1SE4 A;  5CR3 A;  3IFT A;  5IGB A;  3D4W A;  2A5H A;  1KLG D;  5HUR A;  2EJM A;  1FNW A;  4V0B A;  5IGE A;  2DY8 A;  3I73 A;  1M8A A;  3R3O A;  3KLS X;  1Y69 U;  4Y7N B;  4IFD J;  3CRK C;  1ESR A;  1O7Y A;  1R4Q B;  2L55 A;  5C4H A;  1C4Q A;  1HRJ A;  3D4R A;  3RZO B;  3W3A A;  4K8J A;  1BXT A;  4BY1 B;  5D14 A;  5CV7 A;  5G3L F;  1M4V A;  3Q24 A;  5IOC A;  2F03 A;  1AN8 A;  1I6V C;  3MA2 B;  4HED A;  4A3D B;  2PO4 A;  4HCE A;  5I4D A;  2EY1 A;  1C8C A;  1RCV D;  2F0J A;  1CHP D;  2PYK A;  4QUC A;  1FR3 A;  1U4P A;  3HS0 C;  1PTO F;  3Q23 A;  1PXU A;  5CV5 A;  3GV3 A;  3C46 A;  1I6H B;  1ESF A;  5CBE E;  3P1H A;  1WTX A;  3MZ5 A;  2K33 A;  4C3J B;  5LHY 1;  1UNS A;  1MBY A;  2XWB B;  4IFD H;  1I4R A;  4S3S A;  2Y0S B;  5KYI A;  5EPJ A;  2NVT B;  1BCP B;  3GTM B;  1EOT A;  2GA4 B;  4IN3 A;  2NN6 G;  4X3K A;  3SK6 A;  1Q1B A;  1BOS A;  1SNO A;  3DWA A;  2O4X A;  1W6J A;  5KIX A;  1JOK A;  4LAA A;  5IT9 E;  2F0N A;  1B4O A;  3KLS A;  2D5D A;  4K5W A;  3BS1 A;  4PNY A;  5JVG 3;  4X3U A;  5IGC A;  1IKL A;  3QIA A;  1SNP A;  3OIP A;  5E3F A;  2F0T A;  3LWU A;  5CGK A;  2K1B A;  3NXW A;  3NTI A;  1LV9 A;  3QO2 A;  1ENC A;  2KCN A;  3A7A B;  4UDU C;  1LTA D;  2AUK A;  1ET9 A;  5E4X A;  2B2U A;  2KQ3 A;  1A2T A;  1L0X B;  3MTS A;  3W2D A;  5KEE A;  2WKD A;  1IHZ A;  3TP5 A;  4G57 A;  4N9P A;  3FDT A;  1E2W A;  4DXF A;  3OIQ A;  3A54 A;  2JYO A;  3C1E A;  4XQQ A;  1HFN A;  1DD2 A;  3VYT A;  5EPL A;  4RCO A;  1OO9 B;  4HSP A;  1E0B A;  2Q8R E;  2ID0 A;  5C0X G;  3GP7 A;  4NDX A;  3HRZ C;  1G6Z A;  5KNC A;  3OPO A;  3ZYY X;  1SJH D;  3ERO A;  1BCP D;  4FF2 A;  5E1F A;  2MUY A;  4KV6 A;  1SEB D;  4CJ1 B;  2O5I C;  3NPP A;  4KMU C;  3NUC A;  3JAM L;  1KDC A;  3ND8 A;  1V1O A;  1PRT F;  4C3J G;  3PUY A;  1QB5 D;  2D62 A;  4MHE A;  1VMP A;  2KOL A;  2EVB A;  3GQB A;  1A2U A;  1G8Z D;  5D3D A;  1S5F D;  2K32 A;  3P7J A;  1EWC A;  3N6R A;  3DWP A;  1MSG A;  2MHV A;  3NP8 A;  1AFP A;  2J7Z A;  1GOZ A;  2R61 A;  2JE6 I;  1TT2 A;  1JOQ A;  4EVO A;  3HOY B;  3NWS A;  1VCI A;  2K04 A;  4U67 3;  1WD0 A;  1FNU A;  1II3 A;  3HKZ B;  4C3I B;  2Z4H A;  4J8Q A;  5C6A A;  2PPB C;  1GJX A;  3KLR A;  2EY2 A;  5CV4 A;  1G2S A;  4A3B B;  4A3M B;  1D5Z C;  4HMJ A;  4ZYS A;  1LTS D;  2KUM A;  3D4D A;  1J8I A;  2O2L D;  2F0H A;  1I4G A;  3ITP A;  5FO9 B;  2E74 C;  4FXG C;  2BOS A;  2LFN A;  3GTK B;  4DNR B;  1AEX A;  4Q0F A;  4N9T A;  2EYO A;  4OL7 A;  3S15 B;  5DM6 3;  1Q90 A;  3TSS A;  3WOF A;  3QG1 A;  1S4Z A;  4KD3 A;  3MVV A;  2PW5 A;  2DN8 A;  4ZKC B;  1B9M A;  2DNE A;  4A93 B;  5JJZ A;  1IW7 C;  4X3T A;  2B39 A;  1PDQ A;  4RKL A;  1I4P A;  2RDH A;  4C2M B;  3FEW X;  3VR2 A;  4KJN A;  4JK1 C;  2Q8I B;  2NVX B;  1LAB A;  3HZX A;  3MEH A;  3S14 B;  2NVY B;  3L3O C;  3T53 B;  1D5X C;  4DAV A;  3VA7 A;  2XRQ D;  1J9O A;  3FPU B;  4ZKB B;  1B3A A;  1KLU D;  2WV6 D;  5DEH A;  2RVL A;  2EY6 A;  3GTO B;  1NSN S;  1AZP A;  3PIO 3;  2CVR A;  2PZW A;  1FNV A;  2F0U A;  1MI2 A;  4P2C B;  4C3H G;  5JPM C;  4ILW A;  1SYE A;  3GTJ B;  3D6W A;  5C5M A;  3SR1 A;  1CTM A;  4KKU A;  3QOL A;  2NYZ D;  5JPN C;  1Z47 A;  3GTQ B;  4B9X A;  2Z1C A;  1EY7 A;  1HXY D;  3X3M A;  3J80 L;  1GUT A;  2B2U C;  1BO0 A;  2EPB A;  1Z7T A;  4FNF A;  4DU9 A;  1BUV T;  2A6E C;  2ZXO A;  2X6G A;  2NWG A;  3S1N B;  1RHP A;  1SAP A;  5M9O A;  2BE5 D;  1HHV A;  2SDF A;  5M3M B;  1AZQ A;  1YNJ D;  2X6L A;  3VYS A;  3URY A;  1UUP A;  4IUU A;  1ZXT A;  3CRL C;  1PRT B;  1NUC A;  2F0O A;  3ND9 A;  4B9W A;  4EQN A;  2RSN A;  1PTO B;  2WP8 J;  2A6H C;  3SHL A;  1EU3 A;  1PFN A;  1C48 A;  4HSV A;  1EEI D;  2JEB I;  1HQR D;  2E76 C;  3I4N B;  1Z6H A;  1EWH A;  2WKC A;  2NZ1 D;  1ROD A;  1VF7 A;  2A73 B;  5FLX E;  1BCP C;  3BYY B;  5AFW A;  4PMB A;  4TRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...