1II3A

Structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ii3A00
3T13A 2F0GA 2WACA 2F0LA 2PZUA 4WORA 1JOKA 1SNMA 1EY9A 1SNDA 2F0EA 4PMBA 5DAUA 5JAVA 4EVOA 5IGFA 4IALA 1NSNS 3NHHA 5I6WA 2OXPA 4F7XA 4H7BA 4R8NA 3SHLA 4KY5A 5EKLA 1SYCA 3DMUA 2PYKA 3U9OA 2EYMA 3PMFA 5KGUA 5DEHA 4IUNA 1F2MA 5J1ZA 1A3VA 1EY5A 4HTHA 4DF7A 4DGZA 4NDXA 4K14A 1SNQA 5IGBA 3S9WA 4S3SA 3D8GA 5F2DA 3D6CA 3SR1A 4E6IA 5CV7A 4KV6A 4K6DA 2M00A 1SYBA 1SYDA 2EY2A 4DU9A 4RKLA 1TT2A 4QB4A 3C1EA 2PQEA 2OF1A 3SXHA 1EY0A 4ODGA 1SYFA 1STYA 2O4XA 4K2LA 1STBA 3SK4A 3BDCA 4KHVA 4QF4A 4PNYA 1NUCA 1KDAA 4PMCA 5IODA 2KHSA 1RKNA 3OMCA 5CC4A 1II3A 3DHQA 5CV4A 5I9OA 5KYLA 2PW5A 5C6AA 3QB3A 1EY6A 3VA5A 4J6HA 5C4HA 5KEEA 1STNA 4K2KA 5IGCA 1F2YA 2EXZA 1SNOA 3E5SA 2EY6A 3D4DA 3NK9A 3TP6A 4KTAA 3EJIA 4J1MA 2F0OA 2EYFA 2F0VA 2HQEA 4K5VA 4KD3A 5KIXA 1JOQA 1EQVA 2KQ3A 4G57A 5CV9A 5CR3A 3ITPA 3T16A 5NUCA 3P1HA 3HEJA 1KDBA 5HGTA 4KJNA 1EY4A 3MHBA 4HMJA 1STHA 4QMGA 3C1FA 5C3XA 4LAAA 1EZ6A 3NQTA 1KABA 4YIJA 5C5LA 1F2ZA 4EQNA 5C4ZA 5IIFA 4NKLA 4N9PA 1EY7A 1TR5A 3EROA 1ENAA 5IGDA 4K8IA 1KDCA 4NP5A 5M9OA 2LKVA 2F0PA 3LX0A 4MIUA 4B9XA 4RKBA 5IGGA 1EZ8A 2F0IA 3NXWA 2F3VA 3H6MA 2EY1A 3SK5A 4ZQ3A 1A2UA 3SK6A 4IZ8A 5I9PA 3TP7A 2ENBA 4ZUIA 1STGA 3TP5A 5C3WA 1A2TA 2EYOA 2F0HA 5JOBA 5HURA 4TRDA 5J22A 1EYDA 1IHZA 4KY7A 5CV6A 2F0UA 2PZTA 4N9TA 3OMGA 5E1FA 1AEXA 1SNCA 4B9WA 5C5MA 2F0MA 1A3TA 3QOLA 4ZUJA 3BDLA 2F0KA 4NMZA 4I65A 3SK8A 5K5PA 3NP8A 2F3WA 3EVQA 1EYCA 3NUCA 5KYIA 1TQOA 4WRDA 2EYHA 2SNSA 3R3OA 4EQOA 2F0FA 5CGKA 3D4WA 5IGEA 1SYEA 2SNMA 2F0WA 3MVVA 2EYJA 3TMEA 2F0QA 4DFAA 2RKSA 4KJOA 3ERQA 2F0TA 3V2TA 1STAA 5J39A 5ISRA 2NUCA 2F0SA 5CV8A 5KRUA 1SNPA 2EYPA 2F0NA 2SOBA 4KD4A 5CV5A 4KY6A 1A3UA 1U9RA 2QDBA 3P75A 4HMIA 4ME5A 3HZXA 4OL7A 3RUZA 5IOCA 5E3FA 5EKKA 2OEOA 2PW7A 3MXPA 1EY8A 3QOJA 4EQPA 1JORA 4K8JA 2RDFA 4K5XA 3TP8A 2F0DA 5I6YA 2EYLA 2RBMA 3MZ5A 3OWFA 1ENCA 5EGTA 4F8MA 1JOOA 1EYAA 2F0JA 4ID6A 3MEHA 3OSOA 4K5WA 1KAAA 1SYGA 2PZWA 2EY5A
chains in the Genus database with same CATH superfamily
1FNVA 4TSSA 4GLXA 2KUMA 4IALA 3JAME 2H4OA 3KK7A 3TREA 2DNEA 2EJFC 4R8NA 4A3DH 4C3IH 3MXUA 1TS2A 5J1ZA 1UUPA 4CGYB 3ER0A 1LTID 4DGZA 4RGTA 1VQCA 4DAMA 5BR8L 3D3RA 4RKLA 3MTSA 3GTLH 1EY0A 3BZCA 4JI3Q 1GHKA 3CP0A 1GHJA 3J81L 1TWAH 2F4VQ 2B29A 5DM73 1Z6HA 4IPGA 2CH4W 4JVZA 1S5BD 4IOAA 3PO2B 3M7GA 3FPUB 4A3IB 3PO3H 1F77A 1LT4D 1Y1WB 1BBUA 2EY6A 3ND8A 2PI2E 1R9TH 3P20A 3AMUA 1EOVA 4KTAA 1ZXTA 4KD3A 2HQEA 1JMCA 1GUGA 1PV4A 4X65Q 3ZJYC 1Y69U 2H5XA 5NUCA 5FO7B 3T16A 1GUSA 2UUBL 2K6AA 3MHBA 3RD4A 1SMXA 1YHAA 2X6GA 5AJ3Q 5BN5A 1B44D 2M2LA 2AKWB 4P2CB 1GOZA 3I4NG 1SBBB 2JEBI 2N8NA 2L11A 4B3ML 1Q1BA 3AU7A 1LT5D 5M9OA 2RSOA 5I2XA 4OGQC 4LF7L 1ASZA 3TP7A 2EYOA 4N9TA 5EPLA 4POGA 5EKIA 3S1NH 1I4GA 4FF4A 1HXYD 2HQLA 1RTNA 2NN6H 3HKZE 5M3MG 2AWOA 1YZ6A 2NWGA 1SEBD 4HN7A 4TVAB 1Y8OB 4DFAA 4NXNQ 1PTOF 2A6HC 1STAA 4J8QA 2G9HD 3D6WA 1I50B 4V0BA 1K3BC 5E3FA 3HGBA 4EQPA 1GUWA 2TMPA 4A3GG 3MC0B 1LABA 3OTOL 1BO0A 5EGTA 2YTYA 3SVMA 1ZYRD 5D3IB 3F2CA 3RLNA 1JWSD 1WCMG 4DR6Q 1JWMD 1B9NA 1SNMA 3SEBA 4IFDG 3S17H 1K73C 3VYUA 3HRZC 2IL8A 3HOZB 3CCQA 4NB3A 1VF5C 1T9HA 3IRBA 2QCPX 5CBEE 3TQYA 4DKAC 2UXDL 4G7OC 4G7HC 3I4MB 1EIYB 1DXMA 3J80c 1JT8A 4NPSA 2KENA 3KOJA 4K2LA 2IX3A 4KHVA 3FVQA 1TY2A 1K3RA 2OWOA 2K52A 3QG1A 4LMQD 5FKAC 4GZYC 5FLXE 2PMZE 1ESFA 2DNCA 1X6OA 1V1OA 3S2HH 4FNFA 4K2KA 2OTLA 2OCEA 4JI1Q 4P73A 4BWGB 1HR0Q 2B2TC 2B2VC 2DJGC 4BY1B 2HCCA 1A63A 4JI2L 2A68D 1PXUA 5ELBA 1YNJC 4PZ6A 3MEFA 5FLMG 1FJGQ 1BXTA 3C1FA 4FXGC 1X65A 4OO1I 1LTBD 3NQTA 1HZAA 2CW0D 5AFWA 1VCIA 5C3EH 2XSCA 3NBHA 2XWBB 1X3QA 1HZ9A 1LTLA 1L2FA 2K5QA 5LMNW 3GDEA 3SK5A 2PPBC 3OW7A 3FPPA 4ZUIA 1N33L 1LTSD 2Z4IA 5KNDA 3CAMA 5IY0A 4KY7A 3E0EA 2KCMA 3FMCA 3VR6A 3HOYB 1ML0D 2VUMG 3NBHB 4I65A 4X66Q 2F3IA 3K5OA 3W5OA 1PVOA 3GTMB 1S5FD 3CQZB 1NTGA 2F0FA 1BVSA 3D4WA 2VQEL 4I7ZC 1GUTA 2VQFL 2EYJA 4DR4Q 5IT9c 1XNRL 1BBWA 1Y8PB 5FOBB 3HS0C 4LF8Q 2EYPA 2BH8A 1LUZA 4XQJA 1X9NA 5JEAJ 5LMNL 1MBYA 1B3AA 1TXYA 1J6QA 1N36L 3HOUB 3TBIB 2F0JA 3A55A 5K36G 1SYGA 3SE0A 3GTPB 3IKJA 3HOWH 1SNDA 4PMBA 4DK6C 3BS1A 1VQKA 4DUZQ 2QEJC 1X3FA 4A3EH 1X3EA 2A8VA 4RH6A 4C3JH 1TKWB 2XWJB 1EY5A 1YNJD 2TSSA 4MZ9A 3TS2A 3PCOB 5CV7A 4K6DA 4JI7Q 2R7ZG 1M4VA 2DY7A 1U4PA 2NVYH 3ONAB 2Q2HA 3S1QB 5C4XG 3BVGA 1Z7TA 5C4JB 5C0XJ 4DNTB 1VQ6A 1E7ZA 1YVCA 1A62A 1KAWA 4B3TL 3HKZB 3T56B 4FF1A 1STNA 4LF5L 4YCWA 3A8IE 3U9SA 1B53A 2YTVA 1TS3A 1PYBA 1YI2A 1PTOH 3RZDB 4PG3A 3NEMA 3H0GH 5HGTA 3HEJA 3BVMA 2K4KA 3U4VA 2O5JC 1C7YA 1S4ZA 2CQOA 4QIWB 3H3VC 4N9PA 3BZDB 2B63H 4BA1I 4JOIA 4Y7NB 3KLRA 2ASBA 3PIPA 4ZQ3A 4KMUC 1IYJB 1EIHA 3KDFA 1A2TA 1I3QH 1EYDA 5CV6A 4F8MA 3AB9A 1SLJA 4R8IA 4DR2Q 4R4QA 3V05A 1N34Q 3BDLA 4CJ2C 3TEHB 4X62Q 1UNSA 2B2WA 1VQDA 4GOPC 1SFOB 3KDFB 4ALPA 2F0WA 1Q82C 2JA5G 4YHHL 2JA8H 4EQ5A 1BDOA 2HDMA 3V2TA 3G71A 5ISRA 4DV4L 3GTJB 3HOVH 4A3BG 4KD4A 4A3JH 1JOQA 2E2IH 2NTSA 2WAQG 3P75A 2L1BA 3I4NH 1CSPA 2PMZB 3GV3A 5EKKA 2VB2X 3MXPA 2RDFA 2IPKD 3JAMc 1X54A 2Y0SG 1PH5A 3Q0AA 1L1OC 1TWHH 4PQXA 2ID0A 4L6TB 1KAAA 4RG1A 4HIOA 4C3IG 3WOEA 3S15H 1QOHA 4LFAQ 4DAYA 3M4YA 4DV2Q 1HNWQ 5IGFA 2E2JB 4PZ7A 4KHPQ 2AQ1B 1I94L 1S5DD 2N88A 4J15A 5DEHA 1A3VA 5EAYA 1XMOQ 2Z9HA 3FP9A 3F2BA 3SDZA 2QW7A 4IPCA 1PRTC 4DAYB 2F52A 2XNAC 1BR9A 1Y8NB 4ME3A 1S3OA 2NN6I 4QY7A 5KNBA 3GTKB 1PZKD 2OF1A 4DUYL 1K9MC 3VA7A 5M3FB 3G6JB 4ZKCB 3BDCA 2QDLA 3RMHA 5M5YB 2XVSA 4QF4A 3PO3G 1LTTD 3D4RA 4DV7L 1VQ9A 1VQNA 4A3GH 4JBMA 1BOSA 1YITA 3UE1A 5CV4A 5KYLA 4JBWA 2D0OA 1HA6A 1WCMH 4DK3C 1PLFA 4JYAQ 1U4RA 3EFXD 4IFDH 1HHVA 1O7IA 2JN4A 2A5HA 1G6PA 3M7NA 3DXJC 4U68A 5KNCA 4BBSG 3P1HA 4A3MB 1NY4A 1NAPA 4FXDA 3DWQA 2UUAQ 1UE5A 3DWPA 1HQMC 3PV0A 4GNXA 1TWGB 2K01A 2ZT9C 3OHXC 1GXDC 3BZKA 4JI3L 1AW7A 2LSSA 1K83H 4N8FA 2F4VL 2M9VA 4MHEA 3K58A 5FK9C 3C3LA 4U673 2VB3X 1CHQD 4GNXB 4AQYQ 4LUOA 4LFBQ 2NN6G 1GUNA 2B2UA 2F0KA 4WJ4A 5K5PA 4YCVA 1FD7D 4GLAC 1IBKL 3CCVA 2ZM6L 3K8AA 3H94A 4DPGA 4DV6Q 2JA6B 1C4QA 2QGQA 4R1JA 3K0XA 2GN5A 3UE0A 5CV8A 2WB1E 1PH8A 2F0NA 1BCPF 2JSOA 3HKSA 1G2SA 2UU9Q 3QR8A 1STEA 3M3YH 1B1ZA 2L9HA 5E4WC 4HAEA 5E4XA 3TN2A 2I46A 2V1CC 1B8AA 4Q5VA 2MQHA 4BXXH 1N32L 5I2YA 4V190 3PO2H 1NSNS 5I6WA 2VUMH 3U4ZA 1TWFH 1MD2D 2K5VA 4H7BA 3ND9A 1QZGA 4EX5A 4GS3A 1JJ2A 3M4QA 1TWCB 4BY7B 1L0YB 2K5DA 3GTQB 5CORA 3SR1A 3D6CA 1AFPA 5FLXc 2LFNA 5C44G 2KA7A 5T1IA 1D5ZC 4ODGA 1FYCA 1SYFA 4HIMA 1STBA 5D3DA 5CBAE 4EGVA 1NUCA 1MHWC 4M8AA 1HNZL 1V43A 1VQ7A 2J4XA 4X3UA 5K36H 3J7YW 3NTIA 1QJOA 3M4OH 2A19A 1IYVA 2B39A 3TZUA 1PYSB 2F0OA 1XNQL 3Q22A 4G57A 5CV9A 4QL5A 3MFYA 1V9PA 3T1YL 4KHZA 3JC66 3LWUA 5C3EG 3WWVA 2UUCL 5IWAQ 1E1OA 2JJQA 1OXTA 1WTHA 1UEAB 4LF9Q 1R4QB 3CD6A 1WJJA 2N55A 4FVMA 4G4KA 1QVFA 4JI8Q 4JOIC 3S14B 1FVIA 4L5QA 1AE3A 2K04A 2QILA 3VR4A 5HURA 1SE2A 1A0IA 2B2VA 1NBWA 2R6GA 1SJED 5M5XH 3W1GA 3J7A5 1XTDA 2CH4A 2WKDA 2DGYA 5JJLA 4M1UB 2B2WC 3PUXA 3O13A 3IFDA 4IUTA 5IYCG 4LNQA 1SYEA 3FRPB 3RLOA 1B3QA 3TSSA 4XYOA 3KF6B 3GTGB 5M3MB 1V1PA 2LS01 2DJFC 4H44C 5KRUA 2K5NA 1JWUD 5CV5A 4OL7A 1QNKA 1F9RA 5M5WH 2UXCL 1EY8A 3HOWG 1PZID 2RBMA 5T1GA 4HJAA 3MEHA 3I73A 4DR5Q 2IY5B 1DOKA 2PZWA 2BDNA 4A3EG 2NBFA 1ICWA 3S16H 1PDQA 2F0EA 4C3JG 4LF6Q 2GVAA 2SEBD 2QF7A 2A6ED 3PUZA 1I6HB 3I55A 4F7XA 3CCRA 2ZXRA 2NZHA 1G6ZA 3GTOH 3AFPA 1IKLA 3I4OA 4DR4L 4DF7A 1EOTA 3K7UC 1VQ4A 2R92B 2KHIA 1SYDA 2K50A 4IQZA 4QB4A 3C1EA 2FHTA 4B3SQ 4PMWA 4JI0Q 1EL0A 3L2PA 2RQXA 1PHJA 1QCBD 3RZOH 3K7AB 1Q7YC 3KF8A 5ELNA 4UY8C 2WAQE 1MIUA 1NR4A 4KN4C 2K14A 3H0GG 1LTRD 3TP6A 2R7FA 1KRSA 3URYA 2Y0SE 2F0VA 2NVXB 3TZDA 2WB1B 3KF8B 1Q12A 3GO5A 4GKJL 3G48A 3GTMH 5IP9G 2ZXPA 3MXNA 4HMJA 1STHA 3C46A 3KYHC 3GD7A 4GNXC 3I90A 4JI7L 2B63G 1OTCA 2K03A 3HP3A 4RWSC 4EQNA 1ZYRC 2KEDA 1CSQA 2ALYB 1TR5A 3KJOA 2E5LQ 1F9PA 2LKVA 4LWCA 5IGGA 3MXNB 1RHPA 1E22A 1HNXQ 2R93H 2RCFA 3OWEB 2YYZA 2QA4A 4P71A 4CDCC 2HCIA 2B2UC 3NTHA 1PZJD 4ZUJA 2JA8G 4H02A 4IJLA 1DM0B 1EWIA 2EYHA 4C2MH 1I6VC 5ELOA 1MKHA 3NBIA 3HOVG 1YEZA 1QILA 3ULJA 4A3JG 1IL2A 4IFDI 3IAYA 4BBSH 1UE6A 3A5ZB 1TS4A 1O7ZA 2Z0SA 2YU9B 3J81c 5LHY1 1YJNA 3FEWX 4JV5L 5EBCA 5ELCA 2XIWA 5C5LA 5L37A 3Q8DA 5GQOA 5EPJA 4OWWB 5DM63 1DD2A 2L5TA 3K5LA 4RGMA 2CVRA 2DY8A 1MGSA 1JOOA 4JPBW 1EYAA 2R3ZA 4HSPA 3STBD 1VQ5A 1HA5A 4P72A 2X6LA 1KTKA 3BDOA 4WORA 1U0LA 2A68C 2AMCB 3CMAA 4GOPA 4A93B 4A3KB 5HY6A 4DV1L 4RMFA 1HTPA 4P75A 5GROA 1PH7A 4IN3A 1C0AA 3WDNA 2A1AA 2CW0C 1J5EL 4OIKA 4GOPB 3HG9A 2FXQA 5LL6X 2Q8TA 1ICFB 4ABNA 1L1OA 3G6EA 5G3LF 1IBLQ 4PMCA 5IODA 4JBKA 4BBRH 2BA0A 3DHQA 1Y1VH 1UEBA 3MWYW 1HPCA 5C4XB 4DV3Q 1EY6A 1E2WA 2CKZB 4DAVA 4LFAL 4DV2L 4L5RC 1L1OB 3QO2A 2HHHQ 4JI5Q 5D14A 4K5VA 5KIXA 1V1QA 4HSVA 1CQVA 1XMOL 3V96A 1QNUA 3R2IA 2PQAA 1U4LA 3IFTA 1SFOH 3PF4A 3L7ZC 5C44H 3H15A 1ZKOA 3S2DB 1PRTB 4NKLA 1E24A 2Z8LA 1ASYA 1ENAA 4IURA 3GP7A 1VQGA 2F3VA 3R8BA 2PQAB 4IZ8A 3SK6A 2ENBA 4UP8A 1IHZA 4JYAL 1PH9A 4C3HB 1PTOD 2ZTCA 4DR3L 1CM9A 1LT3D 3LWEA 4NMZA 1KNAA 1W6KA 3R3OA 1L0WA 3MVVA 4A3CH 1QZHA 1TU2B 3ERQA 1YJWA 1TIID 3H09A 5JEAH 2JA5B 4B08A 5DAUA 1XTCD 3KLSA 3PF5A 2JA9A 5H1SE 4BXXG 3KJPA 3K80C 2YTXA 1O78A 2WAQB 4XIGS 4DR1Q 2CQAA 5HGQA 3J7ZC 3FKIH 3PO2G 1VS0A 5M5YH 4XT3B 1A15A 1I5FA 2Y0SB 1JOKA 3I56A 1S5ED 1Y1WG 5LMUQ 1CKMA 4A3DB 4LUVA 3SHLA 3DLLA 3VR5A 3PMFA 5KGUA 1MJEA 5IYCH 2PI2A 1IYUA 3CRLC 4DV6L 1Y14B 2UXBQ 2C35B 4NDXA 3J7AV 3T53B 1KRTA 5IP7H 1QVGA 3KUPA 3GTLB 4A3MH 2E2HH 2UU9L 4L63B 1STYA 2JA7B 1VQLA 4GN3B 4KK7A 2ZJQA 1TWAB 2MUYA 1XMQQ 2AQ3B 3OMCA 1EUJA 2B2YC 4L5SA 1EEID 2MO1A 3ZYYX 5I9OA 3DEOA 1SN8A 4UPAA 2EOTA 2BH2A 5KEEA 1GM5A 4YWLA 1R9TB 1XPRA 2PCFB 4XQNA 2O5IC 2EYFA 4C1NI 1EQQA 1XXGA 2H1EA 2JQOA 5CR3A 1Z9FA 1TS5A 1EU4A 1EQRA 4IPDA 1EZ6A 3CRKC 4QUCA 3U50C 4NW2A 2CWAA 1F2ZA 5DNFA 1E2VA 1M1KC 1EY7A 2EXDA 1CKOA 5IGDA 5BR8Q 4RKBA 1H9JA 3MAQA 1TY0A 1EIGA 4UAIA 1PFNA 3F8TA 3J80i 1GO3E 1PFMA 4QUFA 1VQPA 3TP5A 1WTXA 4DV0L 1STGA 1NNXA 3M85A 5IE8A 4B9WA 2I0QA 1SNCA 2ATWA 3S1NB 3FDTA 4LUZA 1CQFA 1ESRA 1H9RA 1WOCA 3I72A 2NTTA 3T1HL 1K28A 1P16A 5EBDA 5IP9H 1WD1A 3I4MG 2NUCA 3Q24A 3BYTB 4ME5A 1K8MA 3LNNA 3DUZA 1SXTA 3RUZA 2UUBQ 4A3FB 3CCJA 2XN9C 2BE5D 4YY3L 1N9WA 3K57A 1EFWA 4RGOS 4DNIA 2IHEA 2EVBA 2PO4A 1H9SA 1YHQA 4LW1A 4DNRB 3CF5A 4K5WA 4B3MQ 3S1MH 1J9OA 4GKKL 1IZ6A 4RA8A 1T5XD 4CDDC 2D5DA 4O2DA 5JAVA 2F1MA 1F9QA 4LF7Q 3S17B 5A35A 2KCTA 2EQSA 3HOXH 1ENFA 1H9SB 1U4MA 1AP0A 1GJXA 3A74A 4HTHA 3CPWA 1WTQA 1D7QA 4C1NK 5IYBH 1HRJA 4JI4L 4UP9A 1YJ9A 1SYBA 5JJIA 3I8ZA 3J81E 3NWSA 4WJWA 3I70A 2LY7A 5FJ8H 3W2DA 4PNYA 3OPOA 3S2HB 2MFIA 4OIJA 3VA5A 1KC8C 3HOYG 3OTOQ 4CDEC 3D4DA 1X3GA 1EU3A 1K8GA 2O2LD 4OX9L 1S5CD 4IJHA 2R61A 1XX8A 3NTKA 2K28A 1KDBA 2B8FA 1EY4A 2E75C 2ZTEA 2C9OA 3A7AB 1ILQA 2R93G 1FR3A 1OXUA 4B3SL 5IIFA 2UXDQ 5C3EB 3G7LA 4B3RQ 2FFKB 2I5LX 3G4SA 1Q8IA 2D62A 1RCVD 2NVQB 3NXWA 5J3BA 3KBXA 4FP5D 4FXKC 1KQSA 2D2CC 3S1RH 2Z4HA 5J22A 1EFID 1PRTF 4CKEA 4ZLTF 2MP1A 2HDLA 3SK8A 4JW0A 1MI2A 4FO2A 4IUUA 2K7VA 1X32A 2SNMA 4TQUS 5COYA 2EPBA 3TMEA 3X3MA 1DJRD 1WD0A 3TDQA 2RSNA 3CC7A 2RDHA 2D9UA 3SGIA 4CJ0B 1PH4A 2HIXA 4FF2A 4HMIA 1PYWD 3QOJA 1WYDA 2Q2IA 2F0DA 1PH2A 4JK1C 5ELFA 1HUMA 4ID6A 5A2QL 2EY5A 3HOWB 3HKZG 1EY9A 1XPUA 4KLKA 4X65L 1JE5A 4AH6A 3A56A 3CXCA 1VQMA 4O0AA 1I4HA 1MSGA 5AJ3L 4UHVA 4C3JB 3K0YA 2VXWA 1QE6A 1K8OA 1XYIA 1PMRA 4K14A 4IFDJ 2B8GA 4S3SA 3T51B 5IYDG 1RF2D 4ZRZA 2VQEQ 3W1BA 2VQFQ 4PV1C 4DR7Q 4BBRG 1XNRQ 2NVYB 1Y1VG 2CHBD 4IUQA 3K81C 1IBMQ 4JG2A 2CWPA 2XTIA 1KDAA 1VQOA 3DM3A 1II3A 1D5MC 3D0FA 5LMNQ 4RCNA 5C4HA 2NVTB 4A3IH 3JAMi 1D1KA 1F9SA 3PQIA 2EXZA 4X3KA 1Y1WH 4NXNL 3CU7A 4XDXA 1RODA 4OEMB 3ITPA 4YWMA 2K75A 4MTKA 1OXVA 2K32A 2Q8IB 4BS9A 5C3XA 3F2UA 3L0OA 1SE4A 2Z6KC 4OWTB 5JVH3 1VQIA 4RHRA 1JB3A 1IBLL 1KDCA 4DR6L 1R4PB 3R2TA 5JJKA 1JE4A 4XXEA 1EZ8A 2FMMA 2I5MX 1A2UA 2A6EC 1C9OA 1I3QB 4DV3L 2JK8A 2RHQB 1PFSA 2F0UA 3RLFA 2N78A 3WOFA 2F0MA 2HHHL 3H3VH 1HR0W 1HFGA 4A3CG 1BQQT 1EYCA 1BCPD 2A69D 4ULLA 5IGEA 5JEAG 2JA8B 4A93H 2MO0A 3QIAA 2AHOB 3PUWA 1W2BA 4CHTB 4CBVA 5J39A 3ERSX 4BA2I 2CCZA 3HOVB 4A3JB 1A3UA 1I50H 1U9RA 1O80A 3I4NB 3FKIG 3OOCA 5M3FG 3PIO3 3TP8A 4KKUA 3MZ5A 3A0JA 4IUVA 3E9IA 3KF6A 1TWHB 4OHJA 1VQFA 4K6LA 4LJZC 1SMYD 4JI1L 1HR0L 4HIKA 2WACA 3S15B 5GAGC 3BVZA 2JP1A 5CYUA 3HOZH 2VL6A 4KY5A 4C56C 1FJGL 1SE3A 2PYKA 5IP7G 2G9DA 1RDPD 2RDGA 1F2MA 4RGNA 5JPNC 4HJ7A 3BYYB 4A3MG 4NXMQ 5C0XG 5ELDA 3S9WA 3D8GA 4ZK9B 1PFBA 1AE2A 3T4AC 3I4MH 5JPMC 2EY2A 4YHHQ 4IPHA 2E8GA 1IW7D 1CK1A 3AYHB 4DV4Q 1Q90A 1CTMA 4A3GB 1RKNA 1C48A 4UP7A 3X3NA 2L0CA 4X66L 4IOCA 2KCNA 1WCMB 1H9KA 4CKBA 3MA2B 1RTOA 3PSIA 1DONA 3ICEA 4DAPA 3UDGA 2N3SA 1SE8A 1E3PA 1I4XA 4BY1H 4LF8L 1OXXK 4C3HH 1SAPA 4YCUA 2JA6G 1I94Q 1JCKB 5LL6S 1KD1C 4LAAA 3DM1A 2HIVA 1G51A 4H0LC 3NQIA 3CMEA 2RHSB 3Q6SA 3STBC 3EROA 1ILPA 1K0SA 2B2YA 2F0PA 4B9XA 1CFMA 4DK1A 4ILWA 2QEXA 1ONLA 4DUZL 5C3WA 2F0HA 1FGUA 4KN7C 3HOYH 5C5MA 5BN4A 1JC7A 1UWVA 3NPPA 1XJVA 3CQZH 2SNSA 4WJ3M 2KECA 3NELA 4EQOA 4BY7G 3M4PA 3A5UA 4X64Q 1OO9B 4OONA 1VQJA 3VYRA 2FJ2A 4KKSA 1S40A 4XTCS 2AUKA 1SNPA 1A6XA 4WFN3 4LFCQ 4XYQA 4L8JA 3OIPA 1EYGA 2OEOA 2WKCA 4K0KL 4K8JA 4K5XA 3M3YB 4F87A 3CC4A 4KI0A 4HJ5A 3HOUH 1B2TA 1EQTA 3QJYA 1M90C 1AN8A 1X3PA 2JA7H 3S24A 3KBGA 3GTPH 2WP8J 2F0LA 5EQ0A 3HOXG 3MFGA 1K0RA 4Q0FA 2VUMB 5CMDA 3NHHA 1TWFB 3RN5A 2OXPA 4DXGA 5IYBG 1UE7A 1JR0D 4KKTA 3VR2A 2EE1A 3DMUA 3VR3A 2WFWA 4OWXB 3PGZA 4MNOA 3PIP3 4HEDA 1JJCB 1IBKQ 5FJ8G 3CCUA 2ZM6Q 3EN2A 4A3LG 1NE3A 4AYBG 4IUPA 1CUKA 3S1QH 2R7DA 3KLSX 5C4JH 2KHSA 2LMCB 4DR2L 1N34L 3TS0A 1PTOC 2IJ0A 4A75A 4L5TA 4X62L 3M4OB 1KLUD 2NYZD 5IGCA 1SNOA 4R4OA 2PNHA 3NK9A 2OQ0A 3Q23A 1N32Q 1ET6A 1ET9A 4R9WA 3RZDH 1LTGD 5BN3A 4LK1C 4KJNA 2Z6BA 4A76A 2NZOA 2P5ZX 2RCNA 5IYDH 2Q8RE 3AQQA 2R7ZB 4X3SA 4P74A 2NB0A 1LACA 1CA6A 1NCVA 5C4ZA 4QQBX 1VQEA 3W3AA 3K5MA 3U58A 3A8KE 4NP5A 1MSHA 2L12A 3ULPA 4APVA 4X6AH 4Y7NH 1QG7A 1HTLD 2EY1A 1HNWL 4A3FH 4LF4Q 3J80L 4KHPL 3D31A 1W3SA 2PZTA 5A2QE 5M5XB 4QIWE 3QOLA 1HNZQ 5KYIA 3PUVA 3R93A 1BUVT 2E76C 1HCZA 1YNXA 4Z9CB 3FHWA 1AZPA 2ZJPA 1OXSC 4TKOB 1AZQA 1XNQQ 1BBXC 4QCLA 1IXRA 2R92G 1KXLA 3GTJH 2F0SA 1SSOA 5F2DA 1LV9A 2SOBA 3L9AX 2QDBA 2JYOA 5M5WB 3T1YQ 3EA6A 4B3RL 2NZ1D 2UUCQ 4HIDA 3J7AF 2XRQD 3OSOA 4JI6Q 5C6AA 2ICIA 3S16B 4RFBA 1U5KA 2PZUA 3CCMA 4YWKA 1BF4A 1SROA 3K59A 2E2JH 3E3XA 1Q8KA 1LLRD 1YNNC 4HCEA 3NWTA 1BNZA 5EKLA 2UUAL 3TRZA 3GTOB 2WB1G 5G3LD 3H3VI 2VY3A 1NR2A 3PIOA 1H9MA 4A3BB 4DU9A 3GTKH 5IT9L 2A6HD 3J81i 5JJZA 2BDOA 5M3FH 4AQYL 1M8AA 4LFBL 4A3IG 1WTWA 1YHBA 4R4TA 2AUJD 3RN2A 5EPKA 3RZOB 2UXCQ 1PH3A 3I7FA 3QB3A 1WTOA 2RF4A 4C3IB 4RCOA 2C5CA 2NVQH 4GN4B 2K5HA 1I4QA 3UDXA 3B6YA 1VF7A 3EJIA 1Q1EA 4DV5Q 1JB7A 2KQ3A 3CHBD 1GUOA 3AEVA 1XPOA 2KOLA 1BCPB 2ZTDA 5C0XH 3QWNA 1D1IA 3CCLA 1I4RA 2BE5C 1KABA 4DR7L 1TWGH 3BU2A 2QKIC 1IBML 3A54A 3LX0A 3PO3B 2R93B 1W6JA 2IW3A 2EJGC 5I9PA 4RAUC 1YBYA 5JOBA 1VMCA 1YIJA 3KFUA 2RA4A 2MPMA 3OMGA 3M9BA 4A93G 4A3KG 1RL2A 3NUCA 1Q46A 1YNND 4C2MB 5I4DA 4OO1G 3EQLC 1O7LA 1G291 1KNEA 3CW2C 4BBSB 1DYQA 2Z6KA 2JA6H 3VYSA 3F1ZA 1CZWA 1V8QA 4GKJQ 2ES2A 1FNWA 3L3OC 4O42A 5IOCA 1JQYD 2G5DA 1NMGA 4OXPA 1SDFA 2EYLA 2LXJA 4H13C 3CCSA 4JCVE 1EEFD 1EWHA 1HJPA 3OWFA 1ENCA 3P7JA 3CPFA 2KEEA 2ZXOA 1HFNA 4A4IA 1DZ1A 1EWCA 3HOZG 3E6ZX 3E9HA 1SR3A 3UDIA 1CHPD 3KLWA 2OQKA 2K5WA 2NVTH 1SYCA 1O7YA 3OIQA 1TWCH 1I4PA 5IWAL 5DLQE 4BY7H 4IUNA 1G91A 4LF9L 2EZVA 1SNQA 5IGBA 3GTQH 4KV6A 4DA2A 4ZCKA 4JI8L 2M00A 5FO8B 1LTAD 2CFMA 1E1TA 3SXHA 2ZJRA 2SDFA 4JV5Q 2A74C 2AWNA 4DK0A 3E0JA 4RHSA 3AFQA 1C8CA 5E7NA 4BBRB 1Y1VB 1CI3M 4O1NA 2WINB 2PW5A 2F4IA 4BY1G 3F2DA 1RD9D 4C3HG 2PNRC 3JAML 2E74C 1F2YA 2J0TD 3OW2A 1P8LA 2KHJA 5TSSA 1B4OA 4ZKBB 3H91A 4ZYSA 4J1MA 1XWEA 4G7ZC 1EQVA 1QVCA 4GN5A 2IX0A 4NXML 1WTRA 3GV6A 1Z47A 4DV1Q 2JXMB 2IHFA 3GQBA 4A3LH 4YIJA 4R4IA 4Y52H 1RIPA 5C44B 3K5NA 1LO5D 4DR5L 1J5EQ 4K8IA 2L55A 3I91A 1VMPA 4HJ9A 3S14H 2MNAA 4LF6L 5D65A 1IL8A 4AYBE 4HJ8A 4FF3A 2A73B 3EVQA 3NP8A 4A3DG 1TQOA 1E2ZA 4HCSA 5CGKA 3LGJA 1KL9A 2HUGA 2I5HA 3BJUA 1LYLA 4AIMA 1VQBA 2HT1A 4KJOA 4IO9A 3GTGH 5M3MH 1JJGA 2RVLA 4JI0L 4KY6A 3RR5A 3HOUG 3HZXA 2JA7G 2E2DC 1QWYA 2XRSD 1D8LA 3FKIB 1X56A 1G8ZD 1PH6A 2F0GA 2VW9A 4OELB 2K05A 3DEPA 3CKIB 2GA4B 4EVOA 5GAHC 3PUYA 1I6HH 2EIFA 2IX1A 2J7ZA 4DR3Q 4JI2Q 4X64L 1HUNA 1GKHA 1WVLA 4E6IA 2E5LL 1JICA 2R92H 1L0XB 2FMCA 2XGTA 4GLVB 4LFCL 1TT2A 2E2HB 1HNXL 1DCZA 2MJ8A 3MXGA 2O4XA 1H95A 3HFZB 1GD7A 1N8RC 3VYTA 2IWHA 3K7AH 1N33Q 3EBEA 1BCPC 3J80E 2KCCA 1DOLA 4J6HA 4A3EB 2A69C 1KIXA 1E0BA 4FYDA 2EDGA 4JBJA 2DUDA 5FO9B 1PA6A 1QUQA 1LT6D 2VS1A 2NVXH 2VZAA 1G2TA 2HD3A 4XQQA 2Z1CA 4QMGA 4ZAIA 5GAEC 2OTJA 1D6EC 1K8AC 1VQ8A 1QUQB 2BCOA 2V4DA 1PRTD 4A3FG 5FLMH 1SMYC 4CDFC 4MIUA 1J8IA 5FLXL 2F0IA 2DN8A 3N6RA 3H6MA 1N36Q 2L15A 1LM0A 2K33A 4TRDA 4I7AA 1AEXA 4QJFA 1PTOB 1CZGA 2KJXA 4CJ1B 3H0GB 1FL0A 3ULLA 3I2ZA 1B9MA 4WRDA 1MJCA 1CT1D 1VQHA 3NENA 1NJIC 3DWAA 1VDZA 3CCEA 2RKSA 1A8VA 2YU9H 1IW7C 1HZBA 4XT1B 1HQRD 2B63B 2GVBA 1CKNA 3K6OA 1GVPA 4DN4M 3NSWA 2PW7A 4MN3A 1JORA 5C0XI 3RNUA 4DXFA 5IT9E 1B7YB 1IKMA 2F03A 3C2PA 4LF4L 1CA5A 4JI5L 1UAPA 3S1MB 5I6YA 1DGSA 3T13A 1CKNB 5JVG3 1WTVA 4B3TQ 4LF5Q 1VQAA 4K0KQ 4DV0Q 4A3KH 1UE1A 4OO1H 3HOXB 3U9OA 2EYMA 5ELEA 3N52A 2IT1A 4X3TA 2E2IB 2N49A 2EJMA 2BA1A 3EIVA 1FNUA 1S72A 4JC0A 1D5XC 4R4CA 3A8JE 3T1HQ 2PQEA 5EJWA 3SK4A 1EIFA 4AYBB 3VDYA 2R7ZH 1KLGD 5CC4A 1HH2P 4JI6L 2K1BA 2WV6D 5C4XH 4UDUC 3UI2A 1KHIA 4YY3Q 2KBNA 5GADC 1WFQA 1T5EA 3E5SA 2D0PA 4GKKQ 1WI5A 2Q2UA 2B2TA 1QB5D 3A7LA 3NE5B 1Q81C 1FGBD 1SJHD 2WIIB 3I4LA 2LXKA 1ZEQX 2MHVA 1B50A 4DR1L 1HZCA 3BG3A 3S2DH 1B70B 4MTNA 4JI4Q 3IL8A 3CC2A 4POFA 2FINB 2JE6I 3S1RB 2BOSA 2MGSA 1NMFA 5LMUL 2Q2TA 5E1FA 2B3GA 1D2BA 1RJTA 3UDFA 1A3TA 1V1PB 1SRUA 2UXBL 2F3WA 4DV5L 1DOMA 3I3CA 1TVXA 2L4NA 2F0QA 2X69A 2JEAI 1F2LA 2I07B 4OX9Q 2F0TA 2AQ2B 2ICEC 1K83B 1BKBA 1AH9A 2YV5A 2JA5H 1XMQL 3OYYA 4N8X1 4QGUA 2OT2A 4DUYQ 1Q86C 4FDBA 2KVMA 1WTPA 1PH1A 4A3BH 3J81j 4DV7Q 2VNUD 1Q3LA 4F88A 4CKCA 1X55A 4PZ8A 4HR7B
chains in the Genus database with same CATH topology
1FNVA 4TSSA 2KUMA 4IALA 3JAME 2H4OA 3KK7A 2DNEA 2EJFC 4R8NA 3MXUA 1TS2A 5J1ZA 1UUPA 4CGYB 1LTID 4DGZA 4RGTA 3D3RA 4RKLA 3MTSA 1EY0A 1GHKA 1GHJA 3J81L 5DM73 1Z6HA 1S5BD 3PO2B 3M7GA 3FPUB 4A3IB 1F77A 1LT4D 1Y1WB 2EY6A 3ND8A 3P20A 3AMUA 4KTAA 1ZXTA 4KD3A 2HQEA 1GUGA 1Y69U 3T16A 5NUCA 5FO7B 1GUSA 2K6AA 3MHBA 3RD4A 2X6GA 5BN5A 1B44D 2M2LA 4P2CB 1GOZA 1SBBB 2JEBI 2L11A 1Q1BA 3AU7A 1LT5D 5M9OA 2RSOA 5I2XA 4OGQC 3TP7A 2EYOA 4N9TA 5EPLA 5EKIA 1I4GA 4FF4A 1HXYD 1RTNA 2NN6H 2AWOA 2NWGA 1SEBD 4HN7A 1Y8OB 4DFAA 1PTOF 2A6HC 1STAA 4J8QA 2G9HD 3D6WA 1I50B 4V0BA 5E3FA 3HGBA 4EQPA 1GUWA 2TMPA 3MC0B 1LABA 1BO0A 5EGTA 3SVMA 1ZYRD 5D3IB 1JWSD 1JWMD 1B9NA 1SNMA 3SEBA 4IFDG 3VYUA 3HRZC 2IL8A 3HOZB 1VF5C 2QCPX 5CBEE 4G7OC 4G7HC 3I4MB 1DXMA 4K2LA 2IX3A 4KHVA 3FVQA 1TY2A 4GZYC 3QG1A 4LMQD 5FKAC 5FLXE 1ESFA 2DNCA 1V1OA 4FNFA 4K2KA 4BWGB 2B2TC 2B2VC 4BY1B 2HCCA 2A68D 1PXUA 5ELBA 1YNJC 1BXTA 3C1FA 4FXGC 4OO1I 1LTBD 3NQTA 2CW0D 5AFWA 1VCIA 2XSCA 3NBHA 2XWBB 1X3QA 2K5QA 3SK5A 2PPBC 3OW7A 3FPPA 4ZUIA 1LTSD 2Z4IA 5KNDA 4KY7A 3FMCA 3VR6A 3HOYB 1ML0D 4I65A 3K5OA 3GTMB 1S5FD 3CQZB 2F0FA 3D4WA 4I7ZC 1GUTA 2EYJA 1Y8PB 5FOBB 3HS0C 2EYPA 4XQJA 5JEAJ 1MBYA 1B3AA 3HOUB 3TBIB 2F0JA 3A55A 5K36G 1SYGA 3SE0A 3GTPB 3IKJA 1SNDA 4PMBA 3BS1A 2QEJC 4RH6A 1TKWB 2XWJB 1EY5A 1YNJD 2TSSA 5CV7A 4K6DA 1M4VA 2DY7A 1U4PA 3ONAB 3S1QB 3BVGA 1Z7TA 5C4JB 5C0XJ 4DNTB 3HKZB 3T56B 4FF1A 1STNA 3A8IE 3U9SA 1B53A 1TS3A 1PTOH 3RZDB 5HGTA 3HEJA 3BVMA 2O5JC 1S4ZA 4QIWB 3H3VC 4N9PA 3BZDB 4BA1I 4Y7NB 3KLRA 4ZQ3A 4KMUC 1EIHA 1A2TA 1EYDA 5CV6A 4F8MA 3AB9A 4R8IA 3V05A 3BDLA 4CJ2C 1UNSA 2B2WA 1SFOB 2F0WA 1BDOA 2HDMA 3V2TA 5ISRA 3GTJB 4KD4A 1JOQA 2NTSA 3P75A 2L1BA 3GV3A 2PMZB 5EKKA 2VB2X 3MXPA 2RDFA 2IPKD 3Q0AA 4PQXA 2ID0A 4L6TB 1KAAA 4C3IG 3WOEA 1QOHA 4DAYA 3M4YA 5IGFA 2E2JB 2AQ1B 1S5DD 2N88A 5DEHA 1A3VA 3SDZA 1PRTC 2XNAC 1BR9A 1Y8NB 2NN6I 5KNBA 3GTKB 1PZKD 2OF1A 3VA7A 5M3FB 3G6JB 4ZKCB 3BDCA 3RMHA 5M5YB 2XVSA 4QF4A 1LTTD 3D4RA 1BOSA 5CV4A 5KYLA 4JBWA 1HA6A 1PLFA 1U4RA 3EFXD 4IFDH 1HHVA 2A5HA 3M7NA 3DXJC 4U68A 5KNCA 3P1HA 4A3MB 1NAPA 4FXDA 3DWQA 3DWPA 1HQMC 3PV0A 1TWGB 2K01A 2ZT9C 3OHXC 1GXDC 1AW7A 2M9VA 4MHEA 3K58A 5FK9C 3C3LA 4U673 2VB3X 1CHQD 2NN6G 1GUNA 2B2UA 2F0KA 5K5PA 1FD7D 3H94A 2JA6B 1C4QA 5CV8A 2F0NA 1BCPF 2JSOA 1G2SA 1STEA 1B1ZA 2L9HA 5E4WC 4HAEA 5E4XA 3TN2A 2I46A 4Q5VA 5I2YA 4V190 1NSNS 5I6WA 1MD2D 4H7BA 3ND9A 1TWCB 4BY7B 1L0YB 2K5DA 3GTQB 5CORA 3SR1A 3D6CA 1AFPA 2LFNA 2KA7A 5T1IA 1D5ZC 4ODGA 1FYCA 1SYFA 1STBA 5D3DA 5CBAE 4EGVA 1NUCA 4M8AA 1V43A 2J4XA 4X3UA 5K36H 3J7YW 3NTIA 1QJOA 1IYVA 2B39A 3TZUA 2F0OA 3Q22A 4G57A 5CV9A 3MFYA 4KHZA 3LWUA 1OXTA 1UEAB 1R4QB 2N55A 4FVMA 4G4KA 3S14B 2K04A 2QILA 3VR4A 5HURA 1SE2A 2B2VA 2R6GA 1SJED 2WKDA 4M1UB 2B2WC 3PUXA 3O13A 3IFDA 4IUTA 1SYEA 3FRPB 3TSSA 4XYOA 3GTGB 5M3MB 1V1PA 2LS01 4H44C 5KRUA 1JWUD 5CV5A 4OL7A 1QNKA 1F9RA 1EY8A 1PZID 2RBMA 5T1GA 3MEHA 3I73A 1DOKA 2PZWA 2BDNA 2NBFA 1ICWA 1PDQA 2F0EA 4C3JG 2SEBD 2QF7A 2A6ED 3PUZA 1I6HB 4F7XA 2ZXRA 1G6ZA 1IKLA 4DF7A 1EOTA 2R92B 1SYDA 4IQZA 4QB4A 3C1EA 2FHTA 4PMWA 1EL0A 2RQXA 1QCBD 3K7AB 3KF8A 1NR4A 4KN4C 1LTRD 3TP6A 3URYA 2F0VA 2NVXB 3TZDA 2WB1B 1Q12A 3GO5A 2ZXPA 3MXNA 4HMJA 1STHA 3C46A 3GD7A 3I90A 2K03A 3HP3A 4RWSC 4EQNA 1ZYRC 2KEDA 1TR5A 1F9PA 2LKVA 5IGGA 1RHPA 3OWEB 2YYZA 2HCIA 2B2UC 3NTHA 1PZJD 4ZUJA 1DM0B 2EYHA 1I6VC 3NBIA 1QILA 4IFDI 3IAYA 1TS4A 1O7ZA 2YU9B 5LHY1 3FEWX 5EBCA 5ELCA 2XIWA 5C5LA 5EPJA 5DM63 1DD2A 2L5TA 3K5LA 4RGMA 2CVRA 2DY8A 1MGSA 1JOOA 1EYAA 2R3ZA 4HSPA 1HA5A 2X6LA 1KTKA 3BDOA 4WORA 2A68C 4A93B 4A3KB 1HTPA 4IN3A 3WDNA 2CW0C 4OIKA 3HG9A 5LL6X 2Q8TA 4ABNA 5G3LF 4PMCA 5IODA 2BA0A 3DHQA 3MWYW 1HPCA 5C4XB 1EY6A 1E2WA 4DAVA 3QO2A 5D14A 4K5VA 5KIXA 4HSVA 1CQVA 3V96A 1QNUA 3R2IA 1U4LA 3IFTA 3L7ZC 3S2DB 1ZKOA 1PRTB 4NKLA 2Z8LA 1ENAA 4IURA 3GP7A 2F3VA 3R8BA 3SK6A 4IZ8A 2ENBA 1IHZA 4C3HB 1PTOD 1CM9A 1LT3D 3LWEA 4NMZA 1KNAA 1W6KA 3R3OA 3MVVA 1TU2B 3ERQA 1TIID 3H09A 5JEAH 2JA5B 4B08A 5DAUA 1XTCD 3KLSA 1O78A 2WAQB 4XIGS 2CQAA 4XT3B 1A15A 2Y0SB 1JOKA 1S5ED 4A3DB 3SHLA 3VR5A 3PMFA 5KGUA 1IYUA 3CRLC 4NDXA 3J7AV 3T53B 3KUPA 3GTLB 4L63B 1STYA 2JA7B 4KK7A 1TWAB 2MUYA 2AQ3B 3OMCA 2B2YC 1EEID 3ZYYX 5I9OA 3DEOA 2EOTA 5KEEA 1R9TB 2PCFB 4XQNA 2O5IC 2EYFA 4C1NI 1XXGA 2H1EA 5CR3A 1TS5A 1EU4A 1EZ6A 3CRKC 4QUCA 4NW2A 1F2ZA 5DNFA 1E2VA 1EY7A 5IGDA 4RKBA 1H9JA 3MAQA 1TY0A 1EIGA 4UAIA 1PFNA 1PFMA 4QUFA 3TP5A 1WTXA 1STGA 3M85A 4B9WA 1SNCA 3S1NB 3FDTA 1CQFA 1ESRA 1H9RA 3I72A 2NTTA 5EBDA 1WD1A 2NUCA 3Q24A 3BYTB 4ME5A 1K8MA 3LNNA 3DUZA 1SXTA 3RUZA 4A3FB 2XN9C 2BE5D 3K57A 4RGOS 2EVBA 2PO4A 1H9SA 4DNRB 4K5WA 1J9OA 4RA8A 1T5XD 2D5DA 5JAVA 2F1MA 1F9QA 3S17B 5A35A 1ENFA 1H9SB 1U4MA 1AP0A 1GJXA 4HTHA 1WTQA 4C1NK 1HRJA 1SYBA 3I8ZA 3J81E 3NWSA 4WJWA 3I70A 2LY7A 3W2DA 4PNYA 3OPOA 3S2HB 4OIJA 3VA5A 3D4DA 1EU3A 2O2LD 1S5CD 2R61A 1XX8A 3NTKA 2K28A 1KDBA 2B8FA 1EY4A 2E75C 2C9OA 3A7AB 1ILQA 1FR3A 1OXUA 5IIFA 5C3EB 3G7LA 2FFKB 1Q8IA 2D62A 1RCVD 2NVQB 3NXWA 3KBXA 4FP5D 4FXKC 2D2CC 2Z4HA 5J22A 1EFID 1PRTF 4CKEA 4ZLTF 2MP1A 2HDLA 3SK8A 1MI2A 4FO2A 4IUUA 2K7VA 1X32A 2SNMA 4TQUS 5COYA 2EPBA 3TMEA 3X3MA 1DJRD 1WD0A 3TDQA 2RSNA 2RDHA 2D9UA 4CJ0B 4FF2A 4HMIA 1PYWD 3QOJA 2F0DA 4JK1C 5ELFA 1HUMA 4ID6A 5A2QL 2EY5A 3HOWB 1EY9A 3A56A 1I4HA 1MSGA 4C3JB 3K0YA 2VXWA 1QE6A 1K8OA 1XYIA 1PMRA 4K14A 4IFDJ 2B8GA 4S3SA 3T51B 1RF2D 4ZRZA 4PV1C 2NVYB 2CHBD 4IUQA 1KDAA 1II3A 1D5MC 4RCNA 5C4HA 2NVTB 1D1KA 1F9SA 2EXZA 4X3KA 3CU7A 4XDXA 1RODA 3ITPA 1OXVA 2K32A 2Q8IB 5C3XA 4BS9A 3F2UA 1SE4A 5JVH3 4RHRA 1JB3A 1KDCA 1R4PB 3R2TA 1JE4A 4XXEA 1EZ8A 2FMMA 1A2UA 2A6EC 1I3QB 3RLFA 2F0UA 3WOFA 2F0MA 1HFGA 1BQQT 1EYCA 1BCPD 2A69D 4ULLA 5IGEA 5JEAG 2JA8B 3QIAA 3PUWA 4CHTB 4CBVA 5J39A 4BA2I 3HOVB 4A3JB 1A3UA 1U9RA 1O80A 3I4NB 3OOCA 3PIO3 3TP8A 4KKUA 3MZ5A 4IUVA 1TWHB 4OHJA 4K6LA 4LJZC 1SMYD 2WACA 3S15B 3BVZA 2JP1A 5CYUA 4KY5A 4C56C 1SE3A 2PYKA 2G9DA 1RDPD 2RDGA 1F2MA 4RGNA 5JPNC 3BYYB 5C0XG 5ELDA 3S9WA 3D8GA 4ZK9B 1PFBA 3T4AC 5JPMC 2EY2A 1IW7D 1CK1A 1Q90A 1CTMA 4A3GB 1RKNA 1C48A 3X3NA 2L0CA 2KCNA 1WCMB 1H9KA 4CKBA 3MA2B 1RTOA 1DONA 4DAPA 1I4XA 1OXXK 1SAPA 1JCKB 5LL6S 4LAAA 3DM1A 4H0LC 3NQIA 3Q6SA 3EROA 1ILPA 2B2YA 2F0PA 4B9XA 1CFMA 4DK1A 4ILWA 1ONLA 5C3WA 2F0HA 4KN7C 5C5MA 5BN4A 1JC7A 3NPPA 2SNSA 2KECA 4EQOA 1OO9B 3VYRA 2FJ2A 4KKSA 4XTCS 2AUKA 1SNPA 1A6XA 4WFN3 4XYQA 4L8JA 3OIPA 2OEOA 2WKCA 4K8JA 4K5XA 3M3YB 4F87A 4KI0A 1B2TA 1EQTA 3QJYA 1AN8A 1X3PA 3KBGA 2WP8J 2F0LA 5EQ0A 3MFGA 4Q0FA 2VUMB 5CMDA 3NHHA 1TWFB 2OXPA 4DXGA 3VR2A 1JR0D 4KKTA 3VR3A 2EE1A 3DMUA 3PIP3 4HEDA 4IUPA 3KLSX 2KHSA 2LMCB 1PTOC 2IJ0A 3M4OB 1KLUD 2NYZD 5IGCA 1SNOA 3NK9A 3Q23A 1ET6A 1ET9A 4R9WA 1LTGD 5BN3A 4LK1C 4KJNA 2Q8RE 2R7ZB 4X3SA 2NB0A 1LACA 1CA6A 1NCVA 5C4ZA 3W3AA 3K5MA 3A8KE 4NP5A 1MSHA 2L12A 1QG7A 1HTLD 2EY1A 3J80L 3D31A 2PZTA 5A2QE 5M5XB 3QOLA 5KYIA 3PUVA 3R93A 1BUVT 2E76C 1HCZA 4Z9CB 1AZPA 1OXSC 4TKOB 1AZQA 4QCLA 1BBXC 2F0SA 5F2DA 1SSOA 1LV9A 2SOBA 3L9AX 2QDBA 2JYOA 5M5WB 3EA6A 2NZ1D 3J7AF 2XRQD 3OSOA 5C6AA 2ICIA 3S16B 4RFBA 2PZUA 1BF4A 3K59A 1LLRD 1YNNC 4HCEA 3NWTA 1BNZA 5EKLA 3GTOB 5G3LD 1NR2A 1H9MA 4A3BB 4DU9A 5IT9L 2A6HD 5JJZA 2BDOA 1M8AA 1WTWA 2AUJD 5EPKA 3RZOB 3QB3A 1WTOA 4C3IB 4RCOA 2C5CA 1I4QA 1VF7A 3EJIA 1Q1EA 2KQ3A 3CHBD 1GUOA 2KOLA 1BCPB 5C0XH 3QWNA 1D1IA 1I4RA 2BE5C 1KABA 2QKIC 3A54A 3LX0A 3PO3B 2R93B 1W6JA 2IW3A 2EJGC 5I9PA 4RAUC 5JOBA 1VMCA 2RA4A 2MPMA 3OMGA 3NUCA 1YNND 4C2MB 5I4DA 4OO1G 3EQLC 1O7LA 1G291 1KNEA 4BBSB 1DYQA 3VYSA 1CZWA 1V8QA 1FNWA 3L3OC 4O42A 5IOCA 1JQYD 1SDFA 2EYLA 4H13C 1EEFD 1EWHA 3P7JA 3OWFA 1ENCA 2KEEA 2ZXOA 1HFNA 1DZ1A 1EWCA 3E6ZX 1CHPD 2K5WA 1SYCA 1O7YA 3OIQA 1I4PA 4IUNA 1G91A 2EZVA 1SNQA 5IGBA 4KV6A 4DA2A 5FO8B 2M00A 1LTAD 3SXHA 2SDFA 2A74C 2AWNA 4DK0A 3E0JA 4RHSA 1C8CA 4BBRB 1Y1VB 1CI3M 4O1NA 2WINB 2PW5A 2F4IA 1RD9D 4C3HG 2PNRC 3JAML 2E74C 1F2YA 2J0TD 5TSSA 1B4OA 4ZKBB 3H91A 4ZYSA 4J1MA 1XWEA 4G7ZC 1EQVA 2IX0A 1WTRA 3GV6A 1Z47A 2JXMB 3GQBA 4YIJA 5C44B 3K5NA 1LO5D 4K8IA 2L55A 3I91A 1VMPA 5D65A 1IL8A 4FF3A 2A73B 3EVQA 3NP8A 1TQOA 1E2ZA 4HCSA 5CGKA 2HUGA 4KJOA 2RVLA 4KY6A 3HZXA 2E2DC 1QWYA 2XRSD 3FKIB 1G8ZD 2F0GA 2K05A 3DEPA 3CKIB 2GA4B 4EVOA 3PUYA 2IX1A 2J7ZA 1HUNA 1WVLA 4E6IA 1JICA 1L0XB 2FMCA 1TT2A 2E2HB 1DCZA 2MJ8A 3MXGA 2O4XA 3VYTA 2IWHA 1BCPC 3J80E 2KCCA 1DOLA 4J6HA 4A3EB 2A69C 1E0BA 4FYDA 2EDGA 5FO9B 1LT6D 1G2TA 4XQQA 2Z1CA 4QMGA 4ZAIA 1D6EC 2BCOA 2V4DA 1PRTD 1SMYC 4MIUA 1J8IA 5FLXL 2F0IA 2DN8A 3N6RA 3H6MA 2K33A 4TRDA 1AEXA 1PTOB 1CZGA 2KJXA 4CJ1B 3H0GB 1B9MA 4WRDA 1CT1D 3DWAA 1VDZA 2RKSA 1IW7C 4XT1B 1HQRD 2B63B 3K6OA 4DN4M 3NSWA 2PW7A 4MN3A 1JORA 5C0XI 4DXFA 5IT9E 1IKMA 2F03A 3C2PA 1CA5A 3S1MB 1UAPA 5I6YA 3T13A 5JVG3 1WTVA 4OO1H 3HOXB 3U9OA 2EYMA 5ELEA 3N52A 2IT1A 4X3TA 2E2IB 2EJMA 2BA1A 1FNUA 1D5XC 3A8JE 2PQEA 5EJWA 3SK4A 4AYBB 1KLGD 5CC4A 2K1BA 2WV6D 4UDUC 3UI2A 1T5EA 3E5SA 2B2TA 1QB5D 3A7LA 3NE5B 1FGBD 1SJHD 2WIIB 3I4LA 1ZEQX 2MHVA 1B50A 3BG3A 3IL8A 2FINB 2JE6I 3S1RB 2BOSA 2MGSA 5E1FA 1D2BA 1RJTA 1A3TA 1V1PB 2F3WA 1DOMA 3I3CA 1TVXA 2L4NA 2F0QA 2X69A 2JEAI 1F2LA 2I07B 2F0TA 2AQ2B 2ICEC 1K83B 2OT2A 1WTPA 2KVMA 2VNUD 1Q3LA 4F88A 4CKCA 4HR7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T13 A;  2F0G A;  2WAC A;  2F0L A;  2PZU A;  4WOR A;  1JOK A;  1SNM A;  1EY9 A;  1SND A;  2F0E A;  4PMB A;  5DAU A;  5JAV A;  4EVO A;  5IGF A;  4IAL A;  1NSN S;  3NHH A;  5I6W A;  2OXP A;  4F7X A;  4H7B A;  4R8N A;  3SHL A;  4KY5 A;  5EKL A;  1SYC A;  3DMU A;  2PYK A;  3U9O A;  2EYM A;  3PMF A;  5KGU A;  5DEH A;  4IUN A;  1F2M A;  5J1Z A;  1A3V A;  1EY5 A;  4HTH A;  4DF7 A;  4DGZ A;  4NDX A;  4K14 A;  1SNQ A;  5IGB A;  3S9W A;  4S3S A;  3D8G A;  5F2D A;  3D6C A;  3SR1 A;  4E6I A;  5CV7 A;  4KV6 A;  4K6D A;  2M00 A;  1SYB A;  1SYD A;  2EY2 A;  4DU9 A;  4RKL A;  1TT2 A;  4QB4 A;  3C1E A;  2PQE A;  2OF1 A;  3SXH A;  1EY0 A;  4ODG A;  1SYF A;  1STY A;  2O4X A;  4K2L A;  1STB A;  3SK4 A;  3BDC A;  4KHV A;  4QF4 A;  4PNY A;  1NUC A;  1KDA A;  4PMC A;  5IOD A;  2KHS A;  1RKN A;  3OMC A;  5CC4 A;  1II3 A;  3DHQ A;  5CV4 A;  5I9O A;  5KYL A;  2PW5 A;  5C6A A;  3QB3 A;  1EY6 A;  3VA5 A;  4J6H A;  5C4H A;  5KEE A;  1STN A;  4K2K A;  5IGC A;  1F2Y A;  2EXZ A;  1SNO A;  3E5S A;  2EY6 A;  3D4D A;  3NK9 A;  3TP6 A;  4KTA A;  3EJI A;  4J1M A;  2F0O A;  2EYF A;  2F0V A;  2HQE A;  4K5V A;  4KD3 A;  5KIX A;  1JOQ A;  1EQV A;  2KQ3 A;  4G57 A;  5CV9 A;  5CR3 A;  3ITP A;  3T16 A;  5NUC A;  3P1H A;  3HEJ A;  1KDB A;  5HGT A;  4KJN A;  1EY4 A;  3MHB A;  4HMJ A;  1STH A;  4QMG A;  3C1F A;  5C3X A;  4LAA A;  1EZ6 A;  3NQT A;  1KAB A;  4YIJ A;  5C5L A;  1F2Z A;  4EQN A;  5C4Z A;  5IIF A;  4NKL A;  4N9P A;  1EY7 A;  1TR5 A;  3ERO A;  1ENA A;  5IGD A;  4K8I A;  1KDC A;  4NP5 A;  5M9O A;  2LKV A;  2F0P A;  3LX0 A;  4MIU A;  4B9X A;  4RKB A;  5IGG A;  1EZ8 A;  2F0I A;  3NXW A;  2F3V A;  3H6M A;  2EY1 A;  3SK5 A;  4ZQ3 A;  1A2U A;  3SK6 A;  4IZ8 A;  5I9P A;  3TP7 A;  2ENB A;  4ZUI A;  1STG A;  3TP5 A;  5C3W A;  1A2T A;  2EYO A;  2F0H A;  5JOB A;  5HUR A;  4TRD A;  5J22 A;  1EYD A;  1IHZ A;  4KY7 A;  5CV6 A;  2F0U A;  2PZT A;  4N9T A;  3OMG A;  5E1F A;  1AEX A;  1SNC A;  4B9W A;  5C5M A;  2F0M A;  1A3T A;  3QOL A;  4ZUJ A;  3BDL A;  2F0K A;  4NMZ A;  4I65 A;  3SK8 A;  5K5P A;  3NP8 A;  2F3W A;  3EVQ A;  1EYC A;  3NUC A;  5KYI A;  1TQO A;  4WRD A;  2EYH A;  2SNS A;  3R3O A;  4EQO A;  2F0F A;  5CGK A;  3D4W A;  5IGE A;  1SYE A;  2SNM A;  2F0W A;  3MVV A;  2EYJ A;  3TME A;  2F0Q A;  4DFA A;  2RKS A;  4KJO A;  3ERQ A;  2F0T A;  3V2T A;  1STA A;  5J39 A;  5ISR A;  2NUC A;  2F0S A;  5CV8 A;  5KRU A;  1SNP A;  2EYP A;  2F0N A;  2SOB A;  4KD4 A;  5CV5 A;  4KY6 A;  1A3U A;  1U9R A;  2QDB A;  3P75 A;  4HMI A;  4ME5 A;  3HZX A;  4OL7 A;  3RUZ A;  5IOC A;  5E3F A;  5EKK A;  2OEO A;  2PW7 A;  3MXP A;  1EY8 A;  3QOJ A;  4EQP A;  1JOR A;  4K8J A;  2RDF A;  4K5X A;  3TP8 A;  2F0D A;  5I6Y A;  2EYL A;  2RBM A;  3MZ5 A;  3OWF A;  1ENC A;  5EGT A;  4F8M A;  1JOO A;  1EYA A;  2F0J A;  4ID6 A;  3MEH A;  3OSO A;  4K5W A;  1KAA A;  1SYG A;  2PZW A;  2EY5 A; 
#chains in the Genus database with same CATH topology
 1FNV A;  4TSS A;  4GLX A;  2KUM A;  4IAL A;  3JAM E;  2H4O A;  3KK7 A;  3TRE A;  2DNE A;  2EJF C;  4R8N A;  4A3D H;  4C3I H;  3MXU A;  1TS2 A;  5J1Z A;  1UUP A;  4CGY B;  3ER0 A;  1LTI D;  4DGZ A;  4RGT A;  1VQC A;  4DAM A;  5BR8 L;  3D3R A;  4RKL A;  3MTS A;  3GTL H;  1EY0 A;  3BZC A;  4JI3 Q;  1GHK A;  3CP0 A;  1GHJ A;  3J81 L;  1TWA H;  2F4V Q;  2B29 A;  5DM7 3;  1Z6H A;  4IPG A;  2CH4 W;  4JVZ A;  1S5B D;  4IOA A;  3PO2 B;  3M7G A;  3FPU B;  4A3I B;  3PO3 H;  1F77 A;  1LT4 D;  1Y1W B;  1BBU A;  2EY6 A;  3ND8 A;  2PI2 E;  1R9T H;  3P20 A;  3AMU A;  1EOV A;  4KTA A;  1ZXT A;  4KD3 A;  2HQE A;  1JMC A;  1GUG A;  1PV4 A;  4X65 Q;  3ZJY C;  1Y69 U;  2H5X A;  5NUC A;  5FO7 B;  3T16 A;  1GUS A;  2UUB L;  2K6A A;  3MHB A;  3RD4 A;  1SMX A;  1YHA A;  2X6G A;  5AJ3 Q;  5BN5 A;  1B44 D;  2M2L A;  2AKW B;  4P2C B;  1GOZ A;  3I4N G;  1SBB B;  2JEB I;  2N8N A;  2L11 A;  4B3M L;  1Q1B A;  3AU7 A;  1LT5 D;  5M9O A;  2RSO A;  5I2X A;  4OGQ C;  4LF7 L;  1ASZ A;  3TP7 A;  2EYO A;  4N9T A;  5EPL A;  4POG A;  5EKI A;  3S1N H;  1I4G A;  4FF4 A;  1HXY D;  2HQL A;  1RTN A;  2NN6 H;  3HKZ E;  5M3M G;  2AWO A;  1YZ6 A;  2NWG A;  1SEB D;  4HN7 A;  4TVA B;  1Y8O B;  4DFA A;  4NXN Q;  1PTO F;  2A6H C;  1STA A;  4J8Q A;  2G9H D;  3D6W A;  1I50 B;  4V0B A;  1K3B C;  5E3F A;  3HGB A;  4EQP A;  1GUW A;  2TMP A;  4A3G G;  3MC0 B;  1LAB A;  3OTO L;  1BO0 A;  5EGT A;  2YTY A;  3SVM A;  1ZYR D;  5D3I B;  3F2C A;  3RLN A;  1JWS D;  1WCM G;  4DR6 Q;  1JWM D;  1B9N A;  1SNM A;  3SEB A;  4IFD G;  3S17 H;  1K73 C;  3VYU A;  3HRZ C;  2IL8 A;  3HOZ B;  3CCQ A;  4NB3 A;  1VF5 C;  1T9H A;  3IRB A;  2QCP X;  5CBE E;  3TQY A;  4DKA C;  2UXD L;  4G7O C;  4G7H C;  3I4M B;  1EIY B;  1DXM A;  3J80 c;  1JT8 A;  4NPS A;  2KEN A;  3KOJ A;  4K2L A;  2IX3 A;  4KHV A;  3FVQ A;  1TY2 A;  1K3R A;  2OWO A;  2K52 A;  3QG1 A;  4LMQ D;  5FKA C;  4GZY C;  5FLX E;  2PMZ E;  1ESF A;  2DNC A;  1X6O A;  1V1O A;  3S2H H;  4FNF A;  4K2K A;  2OTL A;  2OCE A;  4JI1 Q;  4P73 A;  4BWG B;  1HR0 Q;  2B2T C;  2B2V C;  2DJG C;  4BY1 B;  2HCC A;  1A63 A;  4JI2 L;  2A68 D;  1PXU A;  5ELB A;  1YNJ C;  4PZ6 A;  3MEF A;  5FLM G;  1FJG Q;  1BXT A;  3C1F A;  4FXG C;  1X65 A;  4OO1 I;  1LTB D;  3NQT A;  1HZA A;  2CW0 D;  5AFW A;  1VCI A;  5C3E H;  2XSC A;  3NBH A;  2XWB B;  1X3Q A;  1HZ9 A;  1LTL A;  1L2F A;  2K5Q A;  5LMN W;  3GDE A;  3SK5 A;  2PPB C;  3OW7 A;  3FPP A;  4ZUI A;  1N33 L;  1LTS D;  2Z4I A;  5KND A;  3CAM A;  5IY0 A;  4KY7 A;  3E0E A;  2KCM A;  3FMC A;  3VR6 A;  3HOY B;  1ML0 D;  2VUM G;  3NBH B;  4I65 A;  4X66 Q;  2F3I A;  3K5O A;  3W5O A;  1PVO A;  3GTM B;  1S5F D;  3CQZ B;  1NTG A;  2F0F A;  1BVS A;  3D4W A;  2VQE L;  4I7Z C;  1GUT A;  2VQF L;  2EYJ A;  4DR4 Q;  5IT9 c;  1XNR L;  1BBW A;  1Y8P B;  5FOB B;  3HS0 C;  4LF8 Q;  2EYP A;  2BH8 A;  1LUZ A;  4XQJ A;  1X9N A;  5JEA J;  5LMN L;  1MBY A;  1B3A A;  1TXY A;  1J6Q A;  1N36 L;  3HOU B;  3TBI B;  2F0J A;  3A55 A;  5K36 G;  1SYG A;  3SE0 A;  3GTP B;  3IKJ A;  3HOW H;  1SND A;  4PMB A;  4DK6 C;  3BS1 A;  1VQK A;  4DUZ Q;  2QEJ C;  1X3F A;  4A3E H;  1X3E A;  2A8V A;  4RH6 A;  4C3J H;  1TKW B;  2XWJ B;  1EY5 A;  1YNJ D;  2TSS A;  4MZ9 A;  3TS2 A;  3PCO B;  5CV7 A;  4K6D A;  4JI7 Q;  2R7Z G;  1M4V A;  2DY7 A;  1U4P A;  2NVY H;  3ONA B;  2Q2H A;  3S1Q B;  5C4X G;  3BVG A;  1Z7T A;  5C4J B;  5C0X J;  4DNT B;  1VQ6 A;  1E7Z A;  1YVC A;  1A62 A;  1KAW A;  4B3T L;  3HKZ B;  3T56 B;  4FF1 A;  1STN A;  4LF5 L;  4YCW A;  3A8I E;  3U9S A;  1B53 A;  2YTV A;  1TS3 A;  1PYB A;  1YI2 A;  1PTO H;  3RZD B;  4PG3 A;  3NEM A;  3H0G H;  5HGT A;  3HEJ A;  3BVM A;  2K4K A;  3U4V A;  2O5J C;  1C7Y A;  1S4Z A;  2CQO A;  4QIW B;  3H3V C;  4N9P A;  3BZD B;  2B63 H;  4BA1 I;  4JOI A;  4Y7N B;  3KLR A;  2ASB A;  3PIP A;  4ZQ3 A;  4KMU C;  1IYJ B;  1EIH A;  3KDF A;  1A2T A;  1I3Q H;  1EYD A;  5CV6 A;  4F8M A;  3AB9 A;  1SLJ A;  4R8I A;  4DR2 Q;  4R4Q A;  3V05 A;  1N34 Q;  3BDL A;  4CJ2 C;  3TEH B;  4X62 Q;  1UNS A;  2B2W A;  1VQD A;  4GOP C;  1SFO B;  3KDF B;  4ALP A;  2F0W A;  1Q82 C;  2JA5 G;  4YHH L;  2JA8 H;  4EQ5 A;  1BDO A;  2HDM A;  3V2T A;  3G71 A;  5ISR A;  4DV4 L;  3GTJ B;  3HOV H;  4A3B G;  4KD4 A;  4A3J H;  1JOQ A;  2E2I H;  2NTS A;  2WAQ G;  3P75 A;  2L1B A;  3I4N H;  1CSP A;  2PMZ B;  3GV3 A;  5EKK A;  2VB2 X;  3MXP A;  2RDF A;  2IPK D;  3JAM c;  1X54 A;  2Y0S G;  1PH5 A;  3Q0A A;  1L1O C;  1TWH H;  4PQX A;  2ID0 A;  4L6T B;  1KAA A;  4RG1 A;  4HIO A;  4C3I G;  3WOE A;  3S15 H;  1QOH A;  4LFA Q;  4DAY A;  3M4Y A;  4DV2 Q;  1HNW Q;  5IGF A;  2E2J B;  4PZ7 A;  4KHP Q;  2AQ1 B;  1I94 L;  1S5D D;  2N88 A;  4J15 A;  5DEH A;  1A3V A;  5EAY A;  1XMO Q;  2Z9H A;  3FP9 A;  3F2B A;  3SDZ A;  2QW7 A;  4IPC A;  1PRT C;  4DAY B;  2F52 A;  2XNA C;  1BR9 A;  1Y8N B;  4ME3 A;  1S3O A;  2NN6 I;  4QY7 A;  5KNB A;  3GTK B;  1PZK D;  2OF1 A;  4DUY L;  1K9M C;  3VA7 A;  5M3F B;  3G6J B;  4ZKC B;  3BDC A;  2QDL A;  3RMH A;  5M5Y B;  2XVS A;  4QF4 A;  3PO3 G;  1LTT D;  3D4R A;  4DV7 L;  1VQ9 A;  1VQN A;  4A3G H;  4JBM A;  1BOS A;  1YIT A;  3UE1 A;  5CV4 A;  5KYL A;  4JBW A;  2D0O A;  1HA6 A;  1WCM H;  4DK3 C;  1PLF A;  4JYA Q;  1U4R A;  3EFX D;  4IFD H;  1HHV A;  1O7I A;  2JN4 A;  2A5H A;  1G6P A;  3M7N A;  3DXJ C;  4U68 A;  5KNC A;  4BBS G;  3P1H A;  4A3M B;  1NY4 A;  1NAP A;  4FXD A;  3DWQ A;  2UUA Q;  1UE5 A;  3DWP A;  1HQM C;  3PV0 A;  4GNX A;  1TWG B;  2K01 A;  2ZT9 C;  3OHX C;  1GXD C;  3BZK A;  4JI3 L;  1AW7 A;  2LSS A;  1K83 H;  4N8F A;  2F4V L;  2M9V A;  4MHE A;  3K58 A;  5FK9 C;  3C3L A;  4U67 3;  2VB3 X;  1CHQ D;  4GNX B;  4AQY Q;  4LUO A;  4LFB Q;  2NN6 G;  1GUN A;  2B2U A;  2F0K A;  4WJ4 A;  5K5P A;  4YCV A;  1FD7 D;  4GLA C;  1IBK L;  3CCV A;  2ZM6 L;  3K8A A;  3H94 A;  4DPG A;  4DV6 Q;  2JA6 B;  1C4Q A;  2QGQ A;  4R1J A;  3K0X A;  2GN5 A;  3UE0 A;  5CV8 A;  2WB1 E;  1PH8 A;  2F0N A;  1BCP F;  2JSO A;  3HKS A;  1G2S A;  2UU9 Q;  3QR8 A;  1STE A;  3M3Y H;  1B1Z A;  2L9H A;  5E4W C;  4HAE A;  5E4X A;  3TN2 A;  2I46 A;  2V1C C;  1B8A A;  4Q5V A;  2MQH A;  4BXX H;  1N32 L;  5I2Y A;  4V19 0;  3PO2 H;  1NSN S;  5I6W A;  2VUM H;  3U4Z A;  1TWF H;  1MD2 D;  2K5V A;  4H7B A;  3ND9 A;  1QZG A;  4EX5 A;  4GS3 A;  1JJ2 A;  3M4Q A;  1TWC B;  4BY7 B;  1L0Y B;  2K5D A;  3GTQ B;  5COR A;  3SR1 A;  3D6C A;  1AFP A;  5FLX c;  2LFN A;  5C44 G;  2KA7 A;  5T1I A;  1D5Z C;  4ODG A;  1FYC A;  1SYF A;  4HIM A;  1STB A;  5D3D A;  5CBA E;  4EGV A;  1NUC A;  1MHW C;  4M8A A;  1HNZ L;  1V43 A;  1VQ7 A;  2J4X A;  4X3U A;  5K36 H;  3J7Y W;  3NTI A;  1QJO A;  3M4O H;  2A19 A;  1IYV A;  2B39 A;  3TZU A;  1PYS B;  2F0O A;  1XNQ L;  3Q22 A;  4G57 A;  5CV9 A;  4QL5 A;  3MFY A;  1V9P A;  3T1Y L;  4KHZ A;  3JC6 6;  3LWU A;  5C3E G;  3WWV A;  2UUC L;  5IWA Q;  1E1O A;  2JJQ A;  1OXT A;  1WTH A;  1UEA B;  4LF9 Q;  1R4Q B;  3CD6 A;  1WJJ A;  2N55 A;  4FVM A;  4G4K A;  1QVF A;  4JI8 Q;  4JOI C;  3S14 B;  1FVI A;  4L5Q A;  1AE3 A;  2K04 A;  2QIL A;  3VR4 A;  5HUR A;  1SE2 A;  1A0I A;  2B2V A;  1NBW A;  2R6G A;  1SJE D;  5M5X H;  3W1G A;  3J7A 5;  1XTD A;  2CH4 A;  2WKD A;  2DGY A;  5JJL A;  4M1U B;  2B2W C;  3PUX A;  3O13 A;  3IFD A;  4IUT A;  5IYC G;  4LNQ A;  1SYE A;  3FRP B;  3RLO A;  1B3Q A;  3TSS A;  4XYO A;  3KF6 B;  3GTG B;  5M3M B;  1V1P A;  2LS0 1;  2DJF C;  4H44 C;  5KRU A;  2K5N A;  1JWU D;  5CV5 A;  4OL7 A;  1QNK A;  1F9R A;  5M5W H;  2UXC L;  1EY8 A;  3HOW G;  1PZI D;  2RBM A;  5T1G A;  4HJA A;  3MEH A;  3I73 A;  4DR5 Q;  2IY5 B;  1DOK A;  2PZW A;  2BDN A;  4A3E G;  2NBF A;  1ICW A;  3S16 H;  1PDQ A;  2F0E A;  4C3J G;  4LF6 Q;  2GVA A;  2SEB D;  2QF7 A;  2A6E D;  3PUZ A;  1I6H B;  3I55 A;  4F7X A;  3CCR A;  2ZXR A;  2NZH A;  1G6Z A;  3GTO H;  3AFP A;  1IKL A;  3I4O A;  4DR4 L;  4DF7 A;  1EOT A;  3K7U C;  1VQ4 A;  2R92 B;  2KHI A;  1SYD A;  2K50 A;  4IQZ A;  4QB4 A;  3C1E A;  2FHT A;  4B3S Q;  4PMW A;  4JI0 Q;  1EL0 A;  3L2P A;  2RQX A;  1PHJ A;  1QCB D;  3RZO H;  3K7A B;  1Q7Y C;  3KF8 A;  5ELN A;  4UY8 C;  2WAQ E;  1MIU A;  1NR4 A;  4KN4 C;  2K14 A;  3H0G G;  1LTR D;  3TP6 A;  2R7F A;  1KRS A;  3URY A;  2Y0S E;  2F0V A;  2NVX B;  3TZD A;  2WB1 B;  3KF8 B;  1Q12 A;  3GO5 A;  4GKJ L;  3G48 A;  3GTM H;  5IP9 G;  2ZXP A;  3MXN A;  4HMJ A;  1STH A;  3C46 A;  3KYH C;  3GD7 A;  4GNX C;  3I90 A;  4JI7 L;  2B63 G;  1OTC A;  2K03 A;  3HP3 A;  4RWS C;  4EQN A;  1ZYR C;  2KED A;  1CSQ A;  2ALY B;  1TR5 A;  3KJO A;  2E5L Q;  1F9P A;  2LKV A;  4LWC A;  5IGG A;  3MXN B;  1RHP A;  1E22 A;  1HNX Q;  2R93 H;  2RCF A;  3OWE B;  2YYZ A;  2QA4 A;  4P71 A;  4CDC C;  2HCI A;  2B2U C;  3NTH A;  1PZJ D;  4ZUJ A;  2JA8 G;  4H02 A;  4IJL A;  1DM0 B;  1EWI A;  2EYH A;  4C2M H;  1I6V C;  5ELO A;  1MKH A;  3NBI A;  3HOV G;  1YEZ A;  1QIL A;  3ULJ A;  4A3J G;  1IL2 A;  4IFD I;  3IAY A;  4BBS H;  1UE6 A;  3A5Z B;  1TS4 A;  1O7Z A;  2Z0S A;  2YU9 B;  3J81 c;  5LHY 1;  1YJN A;  3FEW X;  4JV5 L;  5EBC A;  5ELC A;  2XIW A;  5C5L A;  5L37 A;  3Q8D A;  5GQO A;  5EPJ A;  4OWW B;  5DM6 3;  1DD2 A;  2L5T A;  3K5L A;  4RGM A;  2CVR A;  2DY8 A;  1MGS A;  1JOO A;  4JPB W;  1EYA A;  2R3Z A;  4HSP A;  3STB D;  1VQ5 A;  1HA5 A;  4P72 A;  2X6L A;  1KTK A;  3BDO A;  4WOR A;  1U0L A;  2A68 C;  2AMC B;  3CMA A;  4GOP A;  4A93 B;  4A3K B;  5HY6 A;  4DV1 L;  4RMF A;  1HTP A;  4P75 A;  5GRO A;  1PH7 A;  4IN3 A;  1C0A A;  3WDN A;  2A1A A;  2CW0 C;  1J5E L;  4OIK A;  4GOP B;  3HG9 A;  2FXQ A;  5LL6 X;  2Q8T A;  1ICF B;  4ABN A;  1L1O A;  3G6E A;  5G3L F;  1IBL Q;  4PMC A;  5IOD A;  4JBK A;  4BBR H;  2BA0 A;  3DHQ A;  1Y1V H;  1UEB A;  3MWY W;  1HPC A;  5C4X B;  4DV3 Q;  1EY6 A;  1E2W A;  2CKZ B;  4DAV A;  4LFA L;  4DV2 L;  4L5R C;  1L1O B;  3QO2 A;  2HHH Q;  4JI5 Q;  5D14 A;  4K5V A;  5KIX A;  1V1Q A;  4HSV A;  1CQV A;  1XMO L;  3V96 A;  1QNU A;  3R2I A;  2PQA A;  1U4L A;  3IFT A;  1SFO H;  3PF4 A;  3L7Z C;  5C44 H;  3H15 A;  1ZKO A;  3S2D B;  1PRT B;  4NKL A;  1E24 A;  2Z8L A;  1ASY A;  1ENA A;  4IUR A;  3GP7 A;  1VQG A;  2F3V A;  3R8B A;  2PQA B;  4IZ8 A;  3SK6 A;  2ENB A;  4UP8 A;  1IHZ A;  4JYA L;  1PH9 A;  4C3H B;  1PTO D;  2ZTC A;  4DR3 L;  1CM9 A;  1LT3 D;  3LWE A;  4NMZ A;  1KNA A;  1W6K A;  3R3O A;  1L0W A;  3MVV A;  4A3C H;  1QZH A;  1TU2 B;  3ERQ A;  1YJW A;  1TII D;  3H09 A;  5JEA H;  2JA5 B;  4B08 A;  5DAU A;  1XTC D;  3KLS A;  3PF5 A;  2JA9 A;  5H1S E;  4BXX G;  3KJP A;  3K80 C;  2YTX A;  1O78 A;  2WAQ B;  4XIG S;  4DR1 Q;  2CQA A;  5HGQ A;  3J7Z C;  3FKI H;  3PO2 G;  1VS0 A;  5M5Y H;  4XT3 B;  1A15 A;  1I5F A;  2Y0S B;  1JOK A;  3I56 A;  1S5E D;  1Y1W G;  5LMU Q;  1CKM A;  4A3D B;  4LUV A;  3SHL A;  3DLL A;  3VR5 A;  3PMF A;  5KGU A;  1MJE A;  5IYC H;  2PI2 A;  1IYU A;  3CRL C;  4DV6 L;  1Y14 B;  2UXB Q;  2C35 B;  4NDX A;  3J7A V;  3T53 B;  1KRT A;  5IP7 H;  1QVG A;  3KUP A;  3GTL B;  4A3M H;  2E2H H;  2UU9 L;  4L63 B;  1STY A;  2JA7 B;  1VQL A;  4GN3 B;  4KK7 A;  2ZJQ A;  1TWA B;  2MUY A;  1XMQ Q;  2AQ3 B;  3OMC A;  1EUJ A;  2B2Y C;  4L5S A;  1EEI D;  2MO1 A;  3ZYY X;  5I9O A;  3DEO A;  1SN8 A;  4UPA A;  2EOT A;  2BH2 A;  5KEE A;  1GM5 A;  4YWL A;  1R9T B;  1XPR A;  2PCF B;  4XQN A;  2O5I C;  2EYF A;  4C1N I;  1EQQ A;  1XXG A;  2H1E A;  2JQO A;  5CR3 A;  1Z9F A;  1TS5 A;  1EU4 A;  1EQR A;  4IPD A;  1EZ6 A;  3CRK C;  4QUC A;  3U50 C;  4NW2 A;  2CWA A;  1F2Z A;  5DNF A;  1E2V A;  1M1K C;  1EY7 A;  2EXD A;  1CKO A;  5IGD A;  5BR8 Q;  4RKB A;  1H9J A;  3MAQ A;  1TY0 A;  1EIG A;  4UAI A;  1PFN A;  3F8T A;  3J80 i;  1GO3 E;  1PFM A;  4QUF A;  1VQP A;  3TP5 A;  1WTX A;  4DV0 L;  1STG A;  1NNX A;  3M85 A;  5IE8 A;  4B9W A;  2I0Q A;  1SNC A;  2ATW A;  3S1N B;  3FDT A;  4LUZ A;  1CQF A;  1ESR A;  1H9R A;  1WOC A;  3I72 A;  2NTT A;  3T1H L;  1K28 A;  1P16 A;  5EBD A;  5IP9 H;  1WD1 A;  3I4M G;  2NUC A;  3Q24 A;  3BYT B;  4ME5 A;  1K8M A;  3LNN A;  3DUZ A;  1SXT A;  3RUZ A;  2UUB Q;  4A3F B;  3CCJ A;  2XN9 C;  2BE5 D;  4YY3 L;  1N9W A;  3K57 A;  1EFW A;  4RGO S;  4DNI A;  2IHE A;  2EVB A;  2PO4 A;  1H9S A;  1YHQ A;  4LW1 A;  4DNR B;  3CF5 A;  4K5W A;  4B3M Q;  3S1M H;  1J9O A;  4GKK L;  1IZ6 A;  4RA8 A;  1T5X D;  4CDD C;  2D5D A;  4O2D A;  5JAV A;  2F1M A;  1F9Q A;  4LF7 Q;  3S17 B;  5A35 A;  2KCT A;  2EQS A;  3HOX H;  1ENF A;  1H9S B;  1U4M A;  1AP0 A;  1GJX A;  3A74 A;  4HTH A;  3CPW A;  1WTQ A;  1D7Q A;  4C1N K;  5IYB H;  1HRJ A;  4JI4 L;  4UP9 A;  1YJ9 A;  1SYB A;  5JJI A;  3I8Z A;  3J81 E;  3NWS A;  4WJW A;  3I70 A;  2LY7 A;  5FJ8 H;  3W2D A;  4PNY A;  3OPO A;  3S2H B;  2MFI A;  4OIJ A;  3VA5 A;  1KC8 C;  3HOY G;  3OTO Q;  4CDE C;  3D4D A;  1X3G A;  1EU3 A;  1K8G A;  2O2L D;  4OX9 L;  1S5C D;  4IJH A;  2R61 A;  1XX8 A;  3NTK A;  2K28 A;  1KDB A;  2B8F A;  1EY4 A;  2E75 C;  2ZTE A;  2C9O A;  3A7A B;  1ILQ A;  2R93 G;  1FR3 A;  1OXU A;  4B3S L;  5IIF A;  2UXD Q;  5C3E B;  3G7L A;  4B3R Q;  2FFK B;  2I5L X;  3G4S A;  1Q8I A;  2D62 A;  1RCV D;  2NVQ B;  3NXW A;  5J3B A;  3KBX A;  4FP5 D;  4FXK C;  1KQS A;  2D2C C;  3S1R H;  2Z4H A;  5J22 A;  1EFI D;  1PRT F;  4CKE A;  4ZLT F;  2MP1 A;  2HDL A;  3SK8 A;  4JW0 A;  1MI2 A;  4FO2 A;  4IUU A;  2K7V A;  1X32 A;  2SNM A;  4TQU S;  5COY A;  2EPB A;  3TME A;  3X3M A;  1DJR D;  1WD0 A;  3TDQ A;  2RSN A;  3CC7 A;  2RDH A;  2D9U A;  3SGI A;  4CJ0 B;  1PH4 A;  2HIX A;  4FF2 A;  4HMI A;  1PYW D;  3QOJ A;  1WYD A;  2Q2I A;  2F0D A;  1PH2 A;  4JK1 C;  5ELF A;  1HUM A;  4ID6 A;  5A2Q L;  2EY5 A;  3HOW B;  3HKZ G;  1EY9 A;  1XPU A;  4KLK A;  4X65 L;  1JE5 A;  4AH6 A;  3A56 A;  3CXC A;  1VQM A;  4O0A A;  1I4H A;  1MSG A;  5AJ3 L;  4UHV A;  4C3J B;  3K0Y A;  2VXW A;  1QE6 A;  1K8O A;  1XYI A;  1PMR A;  4K14 A;  4IFD J;  2B8G A;  4S3S A;  3T51 B;  5IYD G;  1RF2 D;  4ZRZ A;  2VQE Q;  3W1B A;  2VQF Q;  4PV1 C;  4DR7 Q;  4BBR G;  1XNR Q;  2NVY B;  1Y1V G;  2CHB D;  4IUQ A;  3K81 C;  1IBM Q;  4JG2 A;  2CWP A;  2XTI A;  1KDA A;  1VQO A;  3DM3 A;  1II3 A;  1D5M C;  3D0F A;  5LMN Q;  4RCN A;  5C4H A;  2NVT B;  4A3I H;  3JAM i;  1D1K A;  1F9S A;  3PQI A;  2EXZ A;  4X3K A;  1Y1W H;  4NXN L;  3CU7 A;  4XDX A;  1ROD A;  4OEM B;  3ITP A;  4YWM A;  2K75 A;  4MTK A;  1OXV A;  2K32 A;  2Q8I B;  4BS9 A;  5C3X A;  3F2U A;  3L0O A;  1SE4 A;  2Z6K C;  4OWT B;  5JVH 3;  1VQI A;  4RHR A;  1JB3 A;  1IBL L;  1KDC A;  4DR6 L;  1R4P B;  3R2T A;  5JJK A;  1JE4 A;  4XXE A;  1EZ8 A;  2FMM A;  2I5M X;  1A2U A;  2A6E C;  1C9O A;  1I3Q B;  4DV3 L;  2JK8 A;  2RHQ B;  1PFS A;  2F0U A;  3RLF A;  2N78 A;  3WOF A;  2F0M A;  2HHH L;  3H3V H;  1HR0 W;  1HFG A;  4A3C G;  1BQQ T;  1EYC A;  1BCP D;  2A69 D;  4ULL A;  5IGE A;  5JEA G;  2JA8 B;  4A93 H;  2MO0 A;  3QIA A;  2AHO B;  3PUW A;  1W2B A;  4CHT B;  4CBV A;  5J39 A;  3ERS X;  4BA2 I;  2CCZ A;  3HOV B;  4A3J B;  1A3U A;  1I50 H;  1U9R A;  1O80 A;  3I4N B;  3FKI G;  3OOC A;  5M3F G;  3PIO 3;  3TP8 A;  4KKU A;  3MZ5 A;  3A0J A;  4IUV A;  3E9I A;  3KF6 A;  1TWH B;  4OHJ A;  1VQF A;  4K6L A;  4LJZ C;  1SMY D;  4JI1 L;  1HR0 L;  4HIK A;  2WAC A;  3S15 B;  5GAG C;  3BVZ A;  2JP1 A;  5CYU A;  3HOZ H;  2VL6 A;  4KY5 A;  4C56 C;  1FJG L;  1SE3 A;  2PYK A;  5IP7 G;  2G9D A;  1RDP D;  2RDG A;  1F2M A;  4RGN A;  5JPN C;  4HJ7 A;  3BYY B;  4A3M G;  4NXM Q;  5C0X G;  5ELD A;  3S9W A;  3D8G A;  4ZK9 B;  1PFB A;  1AE2 A;  3T4A C;  3I4M H;  5JPM C;  2EY2 A;  4YHH Q;  4IPH A;  2E8G A;  1IW7 D;  1CK1 A;  3AYH B;  4DV4 Q;  1Q90 A;  1CTM A;  4A3G B;  1RKN A;  1C48 A;  4UP7 A;  3X3N A;  2L0C A;  4X66 L;  4IOC A;  2KCN A;  1WCM B;  1H9K A;  4CKB A;  3MA2 B;  1RTO A;  3PSI A;  1DON A;  3ICE A;  4DAP A;  3UDG A;  2N3S A;  1SE8 A;  1E3P A;  1I4X A;  4BY1 H;  4LF8 L;  1OXX K;  4C3H H;  1SAP A;  4YCU A;  2JA6 G;  1I94 Q;  1JCK B;  5LL6 S;  1KD1 C;  4LAA A;  3DM1 A;  2HIV A;  1G51 A;  4H0L C;  3NQI A;  3CME A;  2RHS B;  3Q6S A;  3STB C;  3ERO A;  1ILP A;  1K0S A;  2B2Y A;  2F0P A;  4B9X A;  1CFM A;  4DK1 A;  4ILW A;  2QEX A;  1ONL A;  4DUZ L;  5C3W A;  2F0H A;  1FGU A;  4KN7 C;  3HOY H;  5C5M A;  5BN4 A;  1JC7 A;  1UWV A;  3NPP A;  1XJV A;  3CQZ H;  2SNS A;  4WJ3 M;  2KEC A;  3NEL A;  4EQO A;  4BY7 G;  3M4P A;  3A5U A;  4X64 Q;  1OO9 B;  4OON A;  1VQJ A;  3VYR A;  2FJ2 A;  4KKS A;  1S40 A;  4XTC S;  2AUK A;  1SNP A;  1A6X A;  4WFN 3;  4LFC Q;  4XYQ A;  4L8J A;  3OIP A;  1EYG A;  2OEO A;  2WKC A;  4K0K L;  4K8J A;  4K5X A;  3M3Y B;  4F87 A;  3CC4 A;  4KI0 A;  4HJ5 A;  3HOU H;  1B2T A;  1EQT A;  3QJY A;  1M90 C;  1AN8 A;  1X3P A;  2JA7 H;  3S24 A;  3KBG A;  3GTP H;  2WP8 J;  2F0L A;  5EQ0 A;  3HOX G;  3MFG A;  1K0R A;  4Q0F A;  2VUM B;  5CMD A;  3NHH A;  1TWF B;  3RN5 A;  2OXP A;  4DXG A;  5IYB G;  1UE7 A;  1JR0 D;  4KKT A;  3VR2 A;  2EE1 A;  3DMU A;  3VR3 A;  2WFW A;  4OWX B;  3PGZ A;  4MNO A;  3PIP 3;  4HED A;  1JJC B;  1IBK Q;  5FJ8 G;  3CCU A;  2ZM6 Q;  3EN2 A;  4A3L G;  1NE3 A;  4AYB G;  4IUP A;  1CUK A;  3S1Q H;  2R7D A;  3KLS X;  5C4J H;  2KHS A;  2LMC B;  4DR2 L;  1N34 L;  3TS0 A;  1PTO C;  2IJ0 A;  4A75 A;  4L5T A;  4X62 L;  3M4O B;  1KLU D;  2NYZ D;  5IGC A;  1SNO A;  4R4O A;  2PNH A;  3NK9 A;  2OQ0 A;  3Q23 A;  1N32 Q;  1ET6 A;  1ET9 A;  4R9W A;  3RZD H;  1LTG D;  5BN3 A;  4LK1 C;  4KJN A;  2Z6B A;  4A76 A;  2NZO A;  2P5Z X;  2RCN A;  5IYD H;  2Q8R E;  3AQQ A;  2R7Z B;  4X3S A;  4P74 A;  2NB0 A;  1LAC A;  1CA6 A;  1NCV A;  5C4Z A;  4QQB X;  1VQE A;  3W3A A;  3K5M A;  3U58 A;  3A8K E;  4NP5 A;  1MSH A;  2L12 A;  3ULP A;  4APV A;  4X6A H;  4Y7N H;  1QG7 A;  1HTL D;  2EY1 A;  1HNW L;  4A3F H;  4LF4 Q;  3J80 L;  4KHP L;  3D31 A;  1W3S A;  2PZT A;  5A2Q E;  5M5X B;  4QIW E;  3QOL A;  1HNZ Q;  5KYI A;  3PUV A;  3R93 A;  1BUV T;  2E76 C;  1HCZ A;  1YNX A;  4Z9C B;  3FHW A;  1AZP A;  2ZJP A;  1OXS C;  4TKO B;  1AZQ A;  1XNQ Q;  1BBX C;  4QCL A;  1IXR A;  2R92 G;  1KXL A;  3GTJ H;  2F0S A;  1SSO A;  5F2D A;  1LV9 A;  2SOB A;  3L9A X;  2QDB A;  2JYO A;  5M5W B;  3T1Y Q;  3EA6 A;  4B3R L;  2NZ1 D;  2UUC Q;  4HID A;  3J7A F;  2XRQ D;  3OSO A;  4JI6 Q;  5C6A A;  2ICI A;  3S16 B;  4RFB A;  1U5K A;  2PZU A;  3CCM A;  4YWK A;  1BF4 A;  1SRO A;  3K59 A;  2E2J H;  3E3X A;  1Q8K A;  1LLR D;  1YNN C;  4HCE A;  3NWT A;  1BNZ A;  5EKL A;  2UUA L;  3TRZ A;  3GTO B;  2WB1 G;  5G3L D;  3H3V I;  2VY3 A;  1NR2 A;  3PIO A;  1H9M A;  4A3B B;  4DU9 A;  3GTK H;  5IT9 L;  2A6H D;  3J81 i;  5JJZ A;  2BDO A;  5M3F H;  4AQY L;  1M8A A;  4LFB L;  4A3I G;  1WTW A;  1YHB A;  4R4T A;  2AUJ D;  3RN2 A;  5EPK A;  3RZO B;  2UXC Q;  1PH3 A;  3I7F A;  3QB3 A;  1WTO A;  2RF4 A;  4C3I B;  4RCO A;  2C5C A;  2NVQ H;  4GN4 B;  2K5H A;  1I4Q A;  3UDX A;  3B6Y A;  1VF7 A;  3EJI A;  1Q1E A;  4DV5 Q;  1JB7 A;  2KQ3 A;  3CHB D;  1GUO A;  3AEV A;  1XPO A;  2KOL A;  1BCP B;  2ZTD A;  5C0X H;  3QWN A;  1D1I A;  3CCL A;  1I4R A;  2BE5 C;  1KAB A;  4DR7 L;  1TWG H;  3BU2 A;  2QKI C;  1IBM L;  3A54 A;  3LX0 A;  3PO3 B;  2R93 B;  1W6J A;  2IW3 A;  2EJG C;  5I9P A;  4RAU C;  1YBY A;  5JOB A;  1VMC A;  1YIJ A;  3KFU A;  2RA4 A;  2MPM A;  3OMG A;  3M9B A;  4A93 G;  4A3K G;  1RL2 A;  3NUC A;  1Q46 A;  1YNN D;  4C2M B;  5I4D A;  4OO1 G;  3EQL C;  1O7L A;  1G29 1;  1KNE A;  3CW2 C;  4BBS B;  1DYQ A;  2Z6K A;  2JA6 H;  3VYS A;  3F1Z A;  1CZW A;  1V8Q A;  4GKJ Q;  2ES2 A;  1FNW A;  3L3O C;  4O42 A;  5IOC A;  1JQY D;  2G5D A;  1NMG A;  4OXP A;  1SDF A;  2EYL A;  2LXJ A;  4H13 C;  3CCS A;  4JCV E;  1EEF D;  1EWH A;  1HJP A;  3OWF A;  1ENC A;  3P7J A;  3CPF A;  2KEE A;  2ZXO A;  1HFN A;  4A4I A;  1DZ1 A;  1EWC A;  3HOZ G;  3E6Z X;  3E9H A;  1SR3 A;  3UDI A;  1CHP D;  3KLW A;  2OQK A;  2K5W A;  2NVT H;  1SYC A;  1O7Y A;  3OIQ A;  1TWC H;  1I4P A;  5IWA L;  5DLQ E;  4BY7 H;  4IUN A;  1G91 A;  4LF9 L;  2EZV A;  1SNQ A;  5IGB A;  3GTQ H;  4KV6 A;  4DA2 A;  4ZCK A;  4JI8 L;  2M00 A;  5FO8 B;  1LTA D;  2CFM A;  1E1T A;  3SXH A;  2ZJR A;  2SDF A;  4JV5 Q;  2A74 C;  2AWN A;  4DK0 A;  3E0J A;  4RHS A;  3AFQ A;  1C8C A;  5E7N A;  4BBR B;  1Y1V B;  1CI3 M;  4O1N A;  2WIN B;  2PW5 A;  2F4I A;  4BY1 G;  3F2D A;  1RD9 D;  4C3H G;  2PNR C;  3JAM L;  2E74 C;  1F2Y A;  2J0T D;  3OW2 A;  1P8L A;  2KHJ A;  5TSS A;  1B4O A;  4ZKB B;  3H91 A;  4ZYS A;  4J1M A;  1XWE A;  4G7Z C;  1EQV A;  1QVC A;  4GN5 A;  2IX0 A;  4NXM L;  1WTR A;  3GV6 A;  1Z47 A;  4DV1 Q;  2JXM B;  2IHF A;  3GQB A;  4A3L H;  4YIJ A;  4R4I A;  4Y52 H;  1RIP A;  5C44 B;  3K5N A;  1LO5 D;  4DR5 L;  1J5E Q;  4K8I A;  2L55 A;  3I91 A;  1VMP A;  4HJ9 A;  3S14 H;  2MNA A;  4LF6 L;  5D65 A;  1IL8 A;  4AYB E;  4HJ8 A;  4FF3 A;  2A73 B;  3EVQ A;  3NP8 A;  4A3D G;  1TQO A;  1E2Z A;  4HCS A;  5CGK A;  3LGJ A;  1KL9 A;  2HUG A;  2I5H A;  3BJU A;  1LYL A;  4AIM A;  1VQB A;  2HT1 A;  4KJO A;  4IO9 A;  3GTG H;  5M3M H;  1JJG A;  2RVL A;  4JI0 L;  4KY6 A;  3RR5 A;  3HOU G;  3HZX A;  2JA7 G;  2E2D C;  1QWY A;  2XRS D;  1D8L A;  3FKI B;  1X56 A;  1G8Z D;  1PH6 A;  2F0G A;  2VW9 A;  4OEL B;  2K05 A;  3DEP A;  3CKI B;  2GA4 B;  4EVO A;  5GAH C;  3PUY A;  1I6H H;  2EIF A;  2IX1 A;  2J7Z A;  4DR3 Q;  4JI2 Q;  4X64 L;  1HUN A;  1GKH A;  1WVL A;  4E6I A;  2E5L L;  1JIC A;  2R92 H;  1L0X B;  2FMC A;  2XGT A;  4GLV B;  4LFC L;  1TT2 A;  2E2H B;  1HNX L;  1DCZ A;  2MJ8 A;  3MXG A;  2O4X A;  1H95 A;  3HFZ B;  1GD7 A;  1N8R C;  3VYT A;  2IWH A;  3K7A H;  1N33 Q;  3EBE A;  1BCP C;  3J80 E;  2KCC A;  1DOL A;  4J6H A;  4A3E B;  2A69 C;  1KIX A;  1E0B A;  4FYD A;  2EDG A;  4JBJ A;  2DUD A;  5FO9 B;  1PA6 A;  1QUQ A;  1LT6 D;  2VS1 A;  2NVX H;  2VZA A;  1G2T A;  2HD3 A;  4XQQ A;  2Z1C A;  4QMG A;  4ZAI A;  5GAE C;  2OTJ A;  1D6E C;  1K8A C;  1VQ8 A;  1QUQ B;  2BCO A;  2V4D A;  1PRT D;  4A3F G;  5FLM H;  1SMY C;  4CDF C;  4MIU A;  1J8I A;  5FLX L;  2F0I A;  2DN8 A;  3N6R A;  3H6M A;  1N36 Q;  2L15 A;  1LM0 A;  2K33 A;  4TRD A;  4I7A A;  1AEX A;  4QJF A;  1PTO B;  1CZG A;  2KJX A;  4CJ1 B;  3H0G B;  1FL0 A;  3ULL A;  3I2Z A;  1B9M A;  4WRD A;  1MJC A;  1CT1 D;  1VQH A;  3NEN A;  1NJI C;  3DWA A;  1VDZ A;  3CCE A;  2RKS A;  1A8V A;  2YU9 H;  1IW7 C;  1HZB A;  4XT1 B;  1HQR D;  2B63 B;  2GVB A;  1CKN A;  3K6O A;  1GVP A;  4DN4 M;  3NSW A;  2PW7 A;  4MN3 A;  1JOR A;  5C0X I;  3RNU A;  4DXF A;  5IT9 E;  1B7Y B;  1IKM A;  2F03 A;  3C2P A;  4LF4 L;  1CA5 A;  4JI5 L;  1UAP A;  3S1M B;  5I6Y A;  1DGS A;  3T13 A;  1CKN B;  5JVG 3;  1WTV A;  4B3T Q;  4LF5 Q;  1VQA A;  4K0K Q;  4DV0 Q;  4A3K H;  1UE1 A;  4OO1 H;  3HOX B;  3U9O A;  2EYM A;  5ELE A;  3N52 A;  2IT1 A;  4X3T A;  2E2I B;  2N49 A;  2EJM A;  2BA1 A;  3EIV A;  1FNU A;  1S72 A;  4JC0 A;  1D5X C;  4R4C A;  3A8J E;  3T1H Q;  2PQE A;  5EJW A;  3SK4 A;  1EIF A;  4AYB B;  3VDY A;  2R7Z H;  1KLG D;  5CC4 A;  1HH2 P;  4JI6 L;  2K1B A;  2WV6 D;  5C4X H;  4UDU C;  3UI2 A;  1KHI A;  4YY3 Q;  2KBN A;  5GAD C;  1WFQ A;  1T5E A;  3E5S A;  2D0P A;  4GKK Q;  1WI5 A;  2Q2U A;  2B2T A;  1QB5 D;  3A7L A;  3NE5 B;  1Q81 C;  1FGB D;  1SJH D;  2WII B;  3I4L A;  2LXK A;  1ZEQ X;  2MHV A;  1B50 A;  4DR1 L;  1HZC A;  3BG3 A;  3S2D H;  1B70 B;  4MTN A;  4JI4 Q;  3IL8 A;  3CC2 A;  4POF A;  2FIN B;  2JE6 I;  3S1R B;  2BOS A;  2MGS A;  1NMF A;  5LMU L;  2Q2T A;  5E1F A;  2B3G A;  1D2B A;  1RJT A;  3UDF A;  1A3T A;  1V1P B;  1SRU A;  2UXB L;  2F3W A;  4DV5 L;  1DOM A;  3I3C A;  1TVX A;  2L4N A;  2F0Q A;  2X69 A;  2JEA I;  1F2L A;  2I07 B;  4OX9 Q;  2F0T A;  2AQ2 B;  2ICE C;  1K83 B;  1BKB A;  1AH9 A;  2YV5 A;  2JA5 H;  1XMQ L;  3OYY A;  4N8X 1;  4QGU A;  2OT2 A;  4DUY Q;  1Q86 C;  4FDB A;  2KVM A;  1WTP A;  1PH1 A;  4A3B H;  3J81 j;  4DV7 Q;  2VNU D;  1Q3L A;  4F88 A;  4CKC A;  1X55 A;  4PZ8 A;  4HR7 B; 
#chains in the Genus database with same CATH homology
 1FNV A;  4TSS A;  2KUM A;  4IAL A;  3JAM E;  2H4O A;  3KK7 A;  2DNE A;  2EJF C;  4R8N A;  3MXU A;  1TS2 A;  5J1Z A;  1UUP A;  4CGY B;  1LTI D;  4DGZ A;  4RGT A;  3D3R A;  4RKL A;  3MTS A;  1EY0 A;  1GHK A;  1GHJ A;  3J81 L;  5DM7 3;  1Z6H A;  1S5B D;  3PO2 B;  3M7G A;  3FPU B;  4A3I B;  1F77 A;  1LT4 D;  1Y1W B;  2EY6 A;  3ND8 A;  3P20 A;  3AMU A;  4KTA A;  1ZXT A;  4KD3 A;  2HQE A;  1GUG A;  1Y69 U;  3T16 A;  5NUC A;  5FO7 B;  1GUS A;  2K6A A;  3MHB A;  3RD4 A;  2X6G A;  5BN5 A;  1B44 D;  2M2L A;  4P2C B;  1GOZ A;  1SBB B;  2JEB I;  2L11 A;  1Q1B A;  3AU7 A;  1LT5 D;  5M9O A;  2RSO A;  5I2X A;  4OGQ C;  3TP7 A;  2EYO A;  4N9T A;  5EPL A;  5EKI A;  1I4G A;  4FF4 A;  1HXY D;  1RTN A;  2NN6 H;  2AWO A;  2NWG A;  1SEB D;  4HN7 A;  1Y8O B;  4DFA A;  1PTO F;  2A6H C;  1STA A;  4J8Q A;  2G9H D;  3D6W A;  1I50 B;  4V0B A;  5E3F A;  3HGB A;  4EQP A;  1GUW A;  2TMP A;  3MC0 B;  1LAB A;  1BO0 A;  5EGT A;  3SVM A;  1ZYR D;  5D3I B;  1JWS D;  1JWM D;  1B9N A;  1SNM A;  3SEB A;  4IFD G;  3VYU A;  3HRZ C;  2IL8 A;  3HOZ B;  1VF5 C;  2QCP X;  5CBE E;  4G7O C;  4G7H C;  3I4M B;  1DXM A;  4K2L A;  2IX3 A;  4KHV A;  3FVQ A;  1TY2 A;  4GZY C;  3QG1 A;  4LMQ D;  5FKA C;  5FLX E;  1ESF A;  2DNC A;  1V1O A;  4FNF A;  4K2K A;  4BWG B;  2B2T C;  2B2V C;  4BY1 B;  2HCC A;  2A68 D;  1PXU A;  5ELB A;  1YNJ C;  1BXT A;  3C1F A;  4FXG C;  4OO1 I;  1LTB D;  3NQT A;  2CW0 D;  5AFW A;  1VCI A;  2XSC A;  3NBH A;  2XWB B;  1X3Q A;  2K5Q A;  3SK5 A;  2PPB C;  3OW7 A;  3FPP A;  4ZUI A;  1LTS D;  2Z4I A;  5KND A;  4KY7 A;  3FMC A;  3VR6 A;  3HOY B;  1ML0 D;  4I65 A;  3K5O A;  3GTM B;  1S5F D;  3CQZ B;  2F0F A;  3D4W A;  4I7Z C;  1GUT A;  2EYJ A;  1Y8P B;  5FOB B;  3HS0 C;  2EYP A;  4XQJ A;  5JEA J;  1MBY A;  1B3A A;  3HOU B;  3TBI B;  2F0J A;  3A55 A;  5K36 G;  1SYG A;  3SE0 A;  3GTP B;  3IKJ A;  1SND A;  4PMB A;  3BS1 A;  2QEJ C;  4RH6 A;  1TKW B;  2XWJ B;  1EY5 A;  1YNJ D;  2TSS A;  5CV7 A;  4K6D A;  1M4V A;  2DY7 A;  1U4P A;  3ONA B;  3S1Q B;  3BVG A;  1Z7T A;  5C4J B;  5C0X J;  4DNT B;  3HKZ B;  3T56 B;  4FF1 A;  1STN A;  3A8I E;  3U9S A;  1B53 A;  1TS3 A;  1PTO H;  3RZD B;  5HGT A;  3HEJ A;  3BVM A;  2O5J C;  1S4Z A;  4QIW B;  3H3V C;  4N9P A;  3BZD B;  4BA1 I;  4Y7N B;  3KLR A;  4ZQ3 A;  4KMU C;  1EIH A;  1A2T A;  1EYD A;  5CV6 A;  4F8M A;  3AB9 A;  4R8I A;  3V05 A;  3BDL A;  4CJ2 C;  1UNS A;  2B2W A;  1SFO B;  2F0W A;  1BDO A;  2HDM A;  3V2T A;  5ISR A;  3GTJ B;  4KD4 A;  1JOQ A;  2NTS A;  3P75 A;  2L1B A;  3GV3 A;  2PMZ B;  5EKK A;  2VB2 X;  3MXP A;  2RDF A;  2IPK D;  3Q0A A;  4PQX A;  2ID0 A;  4L6T B;  1KAA A;  4C3I G;  3WOE A;  1QOH A;  4DAY A;  3M4Y A;  5IGF A;  2E2J B;  2AQ1 B;  1S5D D;  2N88 A;  5DEH A;  1A3V A;  3SDZ A;  1PRT C;  2XNA C;  1BR9 A;  1Y8N B;  2NN6 I;  5KNB A;  3GTK B;  1PZK D;  2OF1 A;  3VA7 A;  5M3F B;  3G6J B;  4ZKC B;  3BDC A;  3RMH A;  5M5Y B;  2XVS A;  4QF4 A;  1LTT D;  3D4R A;  1BOS A;  5CV4 A;  5KYL A;  4JBW A;  1HA6 A;  1PLF A;  1U4R A;  3EFX D;  4IFD H;  1HHV A;  2A5H A;  3M7N A;  3DXJ C;  4U68 A;  5KNC A;  3P1H A;  4A3M B;  1NAP A;  4FXD A;  3DWQ A;  3DWP A;  1HQM C;  3PV0 A;  1TWG B;  2K01 A;  2ZT9 C;  3OHX C;  1GXD C;  1AW7 A;  2M9V A;  4MHE A;  3K58 A;  5FK9 C;  3C3L A;  4U67 3;  2VB3 X;  1CHQ D;  2NN6 G;  1GUN A;  2B2U A;  2F0K A;  5K5P A;  1FD7 D;  3H94 A;  2JA6 B;  1C4Q A;  5CV8 A;  2F0N A;  1BCP F;  2JSO A;  1G2S A;  1STE A;  1B1Z A;  2L9H A;  5E4W C;  4HAE A;  5E4X A;  3TN2 A;  2I46 A;  4Q5V A;  5I2Y A;  4V19 0;  1NSN S;  5I6W A;  1MD2 D;  4H7B A;  3ND9 A;  1TWC B;  4BY7 B;  1L0Y B;  2K5D A;  3GTQ B;  5COR A;  3SR1 A;  3D6C A;  1AFP A;  2LFN A;  2KA7 A;  5T1I A;  1D5Z C;  4ODG A;  1FYC A;  1SYF A;  1STB A;  5D3D A;  5CBA E;  4EGV A;  1NUC A;  4M8A A;  1V43 A;  2J4X A;  4X3U A;  5K36 H;  3J7Y W;  3NTI A;  1QJO A;  1IYV A;  2B39 A;  3TZU A;  2F0O A;  3Q22 A;  4G57 A;  5CV9 A;  3MFY A;  4KHZ A;  3LWU A;  1OXT A;  1UEA B;  1R4Q B;  2N55 A;  4FVM A;  4G4K A;  3S14 B;  2K04 A;  2QIL A;  3VR4 A;  5HUR A;  1SE2 A;  2B2V A;  2R6G A;  1SJE D;  2WKD A;  4M1U B;  2B2W C;  3PUX A;  3O13 A;  3IFD A;  4IUT A;  1SYE A;  3FRP B;  3TSS A;  4XYO A;  3GTG B;  5M3M B;  1V1P A;  2LS0 1;  4H44 C;  5KRU A;  1JWU D;  5CV5 A;  4OL7 A;  1QNK A;  1F9R A;  1EY8 A;  1PZI D;  2RBM A;  5T1G A;  3MEH A;  3I73 A;  1DOK A;  2PZW A;  2BDN A;  2NBF A;  1ICW A;  1PDQ A;  2F0E A;  4C3J G;  2SEB D;  2QF7 A;  2A6E D;  3PUZ A;  1I6H B;  4F7X A;  2ZXR A;  1G6Z A;  1IKL A;  4DF7 A;  1EOT A;  2R92 B;  1SYD A;  4IQZ A;  4QB4 A;  3C1E A;  2FHT A;  4PMW A;  1EL0 A;  2RQX A;  1QCB D;  3K7A B;  3KF8 A;  1NR4 A;  4KN4 C;  1LTR D;  3TP6 A;  3URY A;  2F0V A;  2NVX B;  3TZD A;  2WB1 B;  1Q12 A;  3GO5 A;  2ZXP A;  3MXN A;  4HMJ A;  1STH A;  3C46 A;  3GD7 A;  3I90 A;  2K03 A;  3HP3 A;  4RWS C;  4EQN A;  1ZYR C;  2KED A;  1TR5 A;  1F9P A;  2LKV A;  5IGG A;  1RHP A;  3OWE B;  2YYZ A;  2HCI A;  2B2U C;  3NTH A;  1PZJ D;  4ZUJ A;  1DM0 B;  2EYH A;  1I6V C;  3NBI A;  1QIL A;  4IFD I;  3IAY A;  1TS4 A;  1O7Z A;  2YU9 B;  5LHY 1;  3FEW X;  5EBC A;  5ELC A;  2XIW A;  5C5L A;  5EPJ A;  5DM6 3;  1DD2 A;  2L5T A;  3K5L A;  4RGM A;  2CVR A;  2DY8 A;  1MGS A;  1JOO A;  1EYA A;  2R3Z A;  4HSP A;  1HA5 A;  2X6L A;  1KTK A;  3BDO A;  4WOR A;  2A68 C;  4A93 B;  4A3K B;  1HTP A;  4IN3 A;  3WDN A;  2CW0 C;  4OIK A;  3HG9 A;  5LL6 X;  2Q8T A;  4ABN A;  5G3L F;  4PMC A;  5IOD A;  2BA0 A;  3DHQ A;  3MWY W;  1HPC A;  5C4X B;  1EY6 A;  1E2W A;  4DAV A;  3QO2 A;  5D14 A;  4K5V A;  5KIX A;  4HSV A;  1CQV A;  3V96 A;  1QNU A;  3R2I A;  1U4L A;  3IFT A;  3L7Z C;  3S2D B;  1ZKO A;  1PRT B;  4NKL A;  2Z8L A;  1ENA A;  4IUR A;  3GP7 A;  2F3V A;  3R8B A;  3SK6 A;  4IZ8 A;  2ENB A;  1IHZ A;  4C3H B;  1PTO D;  1CM9 A;  1LT3 D;  3LWE A;  4NMZ A;  1KNA A;  1W6K A;  3R3O A;  3MVV A;  1TU2 B;  3ERQ A;  1TII D;  3H09 A;  5JEA H;  2JA5 B;  4B08 A;  5DAU A;  1XTC D;  3KLS A;  1O78 A;  2WAQ B;  4XIG S;  2CQA A;  4XT3 B;  1A15 A;  2Y0S B;  1JOK A;  1S5E D;  4A3D B;  3SHL A;  3VR5 A;  3PMF A;  5KGU A;  1IYU A;  3CRL C;  4NDX A;  3J7A V;  3T53 B;  3KUP A;  3GTL B;  4L63 B;  1STY A;  2JA7 B;  4KK7 A;  1TWA B;  2MUY A;  2AQ3 B;  3OMC A;  2B2Y C;  1EEI D;  3ZYY X;  5I9O A;  3DEO A;  2EOT A;  5KEE A;  1R9T B;  2PCF B;  4XQN A;  2O5I C;  2EYF A;  4C1N I;  1XXG A;  2H1E A;  5CR3 A;  1TS5 A;  1EU4 A;  1EZ6 A;  3CRK C;  4QUC A;  4NW2 A;  1F2Z A;  5DNF A;  1E2V A;  1EY7 A;  5IGD A;  4RKB A;  1H9J A;  3MAQ A;  1TY0 A;  1EIG A;  4UAI A;  1PFN A;  1PFM A;  4QUF A;  3TP5 A;  1WTX A;  1STG A;  3M85 A;  4B9W A;  1SNC A;  3S1N B;  3FDT A;  1CQF A;  1ESR A;  1H9R A;  3I72 A;  2NTT A;  5EBD A;  1WD1 A;  2NUC A;  3Q24 A;  3BYT B;  4ME5 A;  1K8M A;  3LNN A;  3DUZ A;  1SXT A;  3RUZ A;  4A3F B;  2XN9 C;  2BE5 D;  3K57 A;  4RGO S;  2EVB A;  2PO4 A;  1H9S A;  4DNR B;  4K5W A;  1J9O A;  4RA8 A;  1T5X D;  2D5D A;  5JAV A;  2F1M A;  1F9Q A;  3S17 B;  5A35 A;  1ENF A;  1H9S B;  1U4M A;  1AP0 A;  1GJX A;  4HTH A;  1WTQ A;  4C1N K;  1HRJ A;  1SYB A;  3I8Z A;  3J81 E;  3NWS A;  4WJW A;  3I70 A;  2LY7 A;  3W2D A;  4PNY A;  3OPO A;  3S2H B;  4OIJ A;  3VA5 A;  3D4D A;  1EU3 A;  2O2L D;  1S5C D;  2R61 A;  1XX8 A;  3NTK A;  2K28 A;  1KDB A;  2B8F A;  1EY4 A;  2E75 C;  2C9O A;  3A7A B;  1ILQ A;  1FR3 A;  1OXU A;  5IIF A;  5C3E B;  3G7L A;  2FFK B;  1Q8I A;  2D62 A;  1RCV D;  2NVQ B;  3NXW A;  3KBX A;  4FP5 D;  4FXK C;  2D2C C;  2Z4H A;  5J22 A;  1EFI D;  1PRT F;  4CKE A;  4ZLT F;  2MP1 A;  2HDL A;  3SK8 A;  1MI2 A;  4FO2 A;  4IUU A;  2K7V A;  1X32 A;  2SNM A;  4TQU S;  5COY A;  2EPB A;  3TME A;  3X3M A;  1DJR D;  1WD0 A;  3TDQ A;  2RSN A;  2RDH A;  2D9U A;  4CJ0 B;  4FF2 A;  4HMI A;  1PYW D;  3QOJ A;  2F0D A;  4JK1 C;  5ELF A;  1HUM A;  4ID6 A;  5A2Q L;  2EY5 A;  3HOW B;  1EY9 A;  3A56 A;  1I4H A;  1MSG A;  4C3J B;  3K0Y A;  2VXW A;  1QE6 A;  1K8O A;  1XYI A;  1PMR A;  4K14 A;  4IFD J;  2B8G A;  4S3S A;  3T51 B;  1RF2 D;  4ZRZ A;  4PV1 C;  2NVY B;  2CHB D;  4IUQ A;  1KDA A;  1II3 A;  1D5M C;  4RCN A;  5C4H A;  2NVT B;  1D1K A;  1F9S A;  2EXZ A;  4X3K A;  3CU7 A;  4XDX A;  1ROD A;  3ITP A;  1OXV A;  2K32 A;  2Q8I B;  5C3X A;  4BS9 A;  3F2U A;  1SE4 A;  5JVH 3;  4RHR A;  1JB3 A;  1KDC A;  1R4P B;  3R2T A;  1JE4 A;  4XXE A;  1EZ8 A;  2FMM A;  1A2U A;  2A6E C;  1I3Q B;  3RLF A;  2F0U A;  3WOF A;  2F0M A;  1HFG A;  1BQQ T;  1EYC A;  1BCP D;  2A69 D;  4ULL A;  5IGE A;  5JEA G;  2JA8 B;  3QIA A;  3PUW A;  4CHT B;  4CBV A;  5J39 A;  4BA2 I;  3HOV B;  4A3J B;  1A3U A;  1U9R A;  1O80 A;  3I4N B;  3OOC A;  3PIO 3;  3TP8 A;  4KKU A;  3MZ5 A;  4IUV A;  1TWH B;  4OHJ A;  4K6L A;  4LJZ C;  1SMY D;  2WAC A;  3S15 B;  3BVZ A;  2JP1 A;  5CYU A;  4KY5 A;  4C56 C;  1SE3 A;  2PYK A;  2G9D A;  1RDP D;  2RDG A;  1F2M A;  4RGN A;  5JPN C;  3BYY B;  5C0X G;  5ELD A;  3S9W A;  3D8G A;  4ZK9 B;  1PFB A;  3T4A C;  5JPM C;  2EY2 A;  1IW7 D;  1CK1 A;  1Q90 A;  1CTM A;  4A3G B;  1RKN A;  1C48 A;  3X3N A;  2L0C A;  2KCN A;  1WCM B;  1H9K A;  4CKB A;  3MA2 B;  1RTO A;  1DON A;  4DAP A;  1I4X A;  1OXX K;  1SAP A;  1JCK B;  5LL6 S;  4LAA A;  3DM1 A;  4H0L C;  3NQI A;  3Q6S A;  3ERO A;  1ILP A;  2B2Y A;  2F0P A;  4B9X A;  1CFM A;  4DK1 A;  4ILW A;  1ONL A;  5C3W A;  2F0H A;  4KN7 C;  5C5M A;  5BN4 A;  1JC7 A;  3NPP A;  2SNS A;  2KEC A;  4EQO A;  1OO9 B;  3VYR A;  2FJ2 A;  4KKS A;  4XTC S;  2AUK A;  1SNP A;  1A6X A;  4WFN 3;  4XYQ A;  4L8J A;  3OIP A;  2OEO A;  2WKC A;  4K8J A;  4K5X A;  3M3Y B;  4F87 A;  4KI0 A;  1B2T A;  1EQT A;  3QJY A;  1AN8 A;  1X3P A;  3KBG A;  2WP8 J;  2F0L A;  5EQ0 A;  3MFG A;  4Q0F A;  2VUM B;  5CMD A;  3NHH A;  1TWF B;  2OXP A;  4DXG A;  3VR2 A;  1JR0 D;  4KKT A;  3VR3 A;  2EE1 A;  3DMU A;  3PIP 3;  4HED A;  4IUP A;  3KLS X;  2KHS A;  2LMC B;  1PTO C;  2IJ0 A;  3M4O B;  1KLU D;  2NYZ D;  5IGC A;  1SNO A;  3NK9 A;  3Q23 A;  1ET6 A;  1ET9 A;  4R9W A;  1LTG D;  5BN3 A;  4LK1 C;  4KJN A;  2Q8R E;  2R7Z B;  4X3S A;  2NB0 A;  1LAC A;  1CA6 A;  1NCV A;  5C4Z A;  3W3A A;  3K5M A;  3A8K E;  4NP5 A;  1MSH A;  2L12 A;  1QG7 A;  1HTL D;  2EY1 A;  3J80 L;  3D31 A;  2PZT A;  5A2Q E;  5M5X B;  3QOL A;  5KYI A;  3PUV A;  3R93 A;  1BUV T;  2E76 C;  1HCZ A;  4Z9C B;  1AZP A;  1OXS C;  4TKO B;  1AZQ A;  4QCL A;  1BBX C;  2F0S A;  5F2D A;  1SSO A;  1LV9 A;  2SOB A;  3L9A X;  2QDB A;  2JYO A;  5M5W B;  3EA6 A;  2NZ1 D;  3J7A F;  2XRQ D;  3OSO A;  5C6A A;  2ICI A;  3S16 B;  4RFB A;  2PZU A;  1BF4 A;  3K59 A;  1LLR D;  1YNN C;  4HCE A;  3NWT A;  1BNZ A;  5EKL A;  3GTO B;  5G3L D;  1NR2 A;  1H9M A;  4A3B B;  4DU9 A;  5IT9 L;  2A6H D;  5JJZ A;  2BDO A;  1M8A A;  1WTW A;  2AUJ D;  5EPK A;  3RZO B;  3QB3 A;  1WTO A;  4C3I B;  4RCO A;  2C5C A;  1I4Q A;  1VF7 A;  3EJI A;  1Q1E A;  2KQ3 A;  3CHB D;  1GUO A;  2KOL A;  1BCP B;  5C0X H;  3QWN A;  1D1I A;  1I4R A;  2BE5 C;  1KAB A;  2QKI C;  3A54 A;  3LX0 A;  3PO3 B;  2R93 B;  1W6J A;  2IW3 A;  2EJG C;  5I9P A;  4RAU C;  5JOB A;  1VMC A;  2RA4 A;  2MPM A;  3OMG A;  3NUC A;  1YNN D;  4C2M B;  5I4D A;  4OO1 G;  3EQL C;  1O7L A;  1G29 1;  1KNE A;  4BBS B;  1DYQ A;  3VYS A;  1CZW A;  1V8Q A;  1FNW A;  3L3O C;  4O42 A;  5IOC A;  1JQY D;  1SDF A;  2EYL A;  4H13 C;  1EEF D;  1EWH A;  3P7J A;  3OWF A;  1ENC A;  2KEE A;  2ZXO A;  1HFN A;  1DZ1 A;  1EWC A;  3E6Z X;  1CHP D;  2K5W A;  1SYC A;  1O7Y A;  3OIQ A;  1I4P A;  4IUN A;  1G91 A;  2EZV A;  1SNQ A;  5IGB A;  4KV6 A;  4DA2 A;  5FO8 B;  2M00 A;  1LTA D;  3SXH A;  2SDF A;  2A74 C;  2AWN A;  4DK0 A;  3E0J A;  4RHS A;  1C8C A;  4BBR B;  1Y1V B;  1CI3 M;  4O1N A;  2WIN B;  2PW5 A;  2F4I A;  1RD9 D;  4C3H G;  2PNR C;  3JAM L;  2E74 C;  1F2Y A;  2J0T D;  5TSS A;  1B4O A;  4ZKB B;  3H91 A;  4ZYS A;  4J1M A;  1XWE A;  4G7Z C;  1EQV A;  2IX0 A;  1WTR A;  3GV6 A;  1Z47 A;  2JXM B;  3GQB A;  4YIJ A;  5C44 B;  3K5N A;  1LO5 D;  4K8I A;  2L55 A;  3I91 A;  1VMP A;  5D65 A;  1IL8 A;  4FF3 A;  2A73 B;  3EVQ A;  3NP8 A;  1TQO A;  1E2Z A;  4HCS A;  5CGK A;  2HUG A;  4KJO A;  2RVL A;  4KY6 A;  3HZX A;  2E2D C;  1QWY A;  2XRS D;  3FKI B;  1G8Z D;  2F0G A;  2K05 A;  3DEP A;  3CKI B;  2GA4 B;  4EVO A;  3PUY A;  2IX1 A;  2J7Z A;  1HUN A;  1WVL A;  4E6I A;  1JIC A;  1L0X B;  2FMC A;  1TT2 A;  2E2H B;  1DCZ A;  2MJ8 A;  3MXG A;  2O4X A;  3VYT A;  2IWH A;  1BCP C;  3J80 E;  2KCC A;  1DOL A;  4J6H A;  4A3E B;  2A69 C;  1E0B A;  4FYD A;  2EDG A;  5FO9 B;  1LT6 D;  1G2T A;  4XQQ A;  2Z1C A;  4QMG A;  4ZAI A;  1D6E C;  2BCO A;  2V4D A;  1PRT D;  1SMY C;  4MIU A;  1J8I A;  5FLX L;  2F0I A;  2DN8 A;  3N6R A;  3H6M A;  2K33 A;  4TRD A;  1AEX A;  1PTO B;  1CZG A;  2KJX A;  4CJ1 B;  3H0G B;  1B9M A;  4WRD A;  1CT1 D;  3DWA A;  1VDZ A;  2RKS A;  1IW7 C;  4XT1 B;  1HQR D;  2B63 B;  3K6O A;  4DN4 M;  3NSW A;  2PW7 A;  4MN3 A;  1JOR A;  5C0X I;  4DXF A;  5IT9 E;  1IKM A;  2F03 A;  3C2P A;  1CA5 A;  3S1M B;  1UAP A;  5I6Y A;  3T13 A;  5JVG 3;  1WTV A;  4OO1 H;  3HOX B;  3U9O A;  2EYM A;  5ELE A;  3N52 A;  2IT1 A;  4X3T A;  2E2I B;  2EJM A;  2BA1 A;  1FNU A;  1D5X C;  3A8J E;  2PQE A;  5EJW A;  3SK4 A;  4AYB B;  1KLG D;  5CC4 A;  2K1B A;  2WV6 D;  4UDU C;  3UI2 A;  1T5E A;  3E5S A;  2B2T A;  1QB5 D;  3A7L A;  3NE5 B;  1FGB D;  1SJH D;  2WII B;  3I4L A;  1ZEQ X;  2MHV A;  1B50 A;  3BG3 A;  3IL8 A;  2FIN B;  2JE6 I;  3S1R B;  2BOS A;  2MGS A;  5E1F A;  1D2B A;  1RJT A;  1A3T A;  1V1P B;  2F3W A;  1DOM A;  3I3C A;  1TVX A;  2L4N A;  2F0Q A;  2X69 A;  2JEA I;  1F2L A;  2I07 B;  2F0T A;  2AQ2 B;  2ICE C;  1K83 B;  2OT2 A;  1WTP A;  2KVM A;  2VNU D;  1Q3L A;  4F88 A;  4CKC A;  4HR7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...