1II3A

Structure of s. nuclease quintuple mutant v23i/v66l/i72l/i92l/v99l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKLEVEFDKGQRTDKYGRGLAYLYADGKMLNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proteins with simplified hydrophobic cores compared to other packing mutants.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ii3A00
5IGDA 3TMEA 1SYCA 4KY6A 3TP5A 3H6MA 1U9RA 4B9XA 1SYBA 3ERQA 1SNCA 3NQTA 4NMZA 2EYMA 3NXWA 2F0VA 4EVOA 4ME5A 5C4ZA 1SNOA 2F0TA 4IALA 5C5MA 1SYGA 2KQ3A 2SNMA 4NKLA 2F3VA 5KIXA 3OMGA 2F0FA 2F0KA 1EQVA 4S3SA 5I9OA 1II3A 2OXPA 1ENAA 1SNPA 2LKVA 3MXPA 4KHVA 3C1FA 2EYPA 2EY5A 1KDCA 2SOBA 5C3WA 5CV6A 5CV4A 4R8NA 2EYFA 3P1HA 4WRDA 2F3WA 4ID6A 4NDXA 5C5LA 5C3XA 3LX0A 5KYLA 3QB3A 4K5XA 5K5PA 3S9WA 4PMCA 2PW7A 3P75A 1EYCA 1KDAA 4LAAA 3TP6A 2O4XA 1EYAA 3RUZA 5IGEA 1ENCA 5IODA 3DHQA 4PMBA 4EQPA 5M9OA 2EYLA 3D8GA 4EQNA 1SYFA 4RKLA 4IZ8A 2NUCA 1IHZA 3C1EA 4DGZA 5IIFA 4DF7A 1SNMA 5HURA 4N9PA 4DU9A 4OL7A 4ZUIA 5IGBA 4K8IA 4WORA 3NP8A 2EY1A 4EQOA 1TT2A 3BDCA 4ZQ3A 4HMIA 2EXZA 3QOLA 4K6DA 2WACA 2F0NA 3V2TA 5EKKA 1EYDA 4K2LA 5HGTA 4G57A 1A2UA 5IGGA 4RKBA 4KJNA 2RDFA 1AEXA 1EY0A 4YIJA 1EY9A 1JOKA 3HEJA 1EY6A 3MVVA 5CC4A 2F0PA 1EZ8A 1JOOA 3OSOA 4K2KA 2F0GA 5CV7A 4KJOA 3NK9A 3EROA 5I9PA 5C6AA 1EY4A 5J39A 4J6HA 3D4WA 4KY7A 1SNDA 1F2MA 2EYHA 2PYKA 2PZWA 3D6CA 3QOJA 4J1MA 3EVQA 3MEHA 5IGCA 3VA5A 4F7XA 2QDBA 2F0OA 5J22A 5J1ZA 1STHA 3E5SA 3TP7A 3DMUA 3SXHA 1A3TA 1EY5A 1EZ6A 5I6WA 4HMJA 2F0EA 1STBA 4I65A 4KD3A 3SK4A 5CGKA 2OF1A 4K14A 5JOBA 3BDLA 3ITPA 2PZUA 3T13A 1A2TA 1KAAA 1TR5A 2EY6A 2KHSA 5DAUA 5IOCA 1KABA 1A3UA 3SK8A 4TRDA 2F0JA 3R3OA 3OMCA 5CV5A 3SK6A 4DFAA 1STGA 5F2DA 3NHHA 3T16A 2F0SA 4KV6A 1EY7A 2F0WA 1RKNA 2RBMA 3OWFA 4H7BA 4KY5A 4QF4A 5CV9A 5NUCA 3NUCA 1STAA 3TP8A 5ISRA 1JOQA 2HQEA 2M00A 4QMGA 4KTAA 2F0UA 2F0LA 3U9OA 5I6YA 5E3FA 4E6IA 4F8MA 5KEEA 1NSNS 4KD4A 2ENBA 1TQOA 2F0HA 3EJIA 3PMFA 4MIUA 2F0QA 4NP5A 2EYJA 2RKSA 5KGUA 3MHBA 5EKLA 5IGFA 1EY8A 2OEOA 5E1FA 1KDBA 3MZ5A 4ODGA 3SHLA 4K8JA 5KRUA 2PQEA 4PNYA 4ZUJA 5JAVA 2F0MA 3HZXA 5EGTA 5C4HA 5CV8A 2F0IA 4QB4A 1SNQA 2SNSA 1NUCA 3SK5A 1F2YA 4N9TA 2PW5A 2F0DA 1STYA 5KYIA 1STNA 1SYEA 4HTHA 4B9WA 4K5VA 4K5WA 5CR3A 2PZTA 3D4DA 5DEHA 3SR1A 2EY2A 1JORA 4IUNA 1SYDA 2EYOA 1A3VA 1F2ZA
chains in the Genus database with same CATH superfamily
1IBML 1KC8C 3CU7A 1VMCA 2EYMA 3VA7A 2F0VA 1QG7A 1LTAD 5JPMC 1GUOA 4C3JB 4BY7B 3ULLA 2B2UC 3I7FA 4QIWB 2DY8A 1EQVA 1W3SA 5C44H 1WD1A 2OXPA 2VQFL 2B2WA 3CPFA 5GQOA 1FNVA 1VDZA 4JI8L 2C5CA 1ZXTA 3CMEA 2B39A 2MGSA 1V1PA 3P1HA 2RA4A 4JK1C 2J7ZA 2NN6I 2TMPA 1MJCA 4DUZQ 1O7IA 5AJ3L 2RCNA 1TWHH 2H1EA 4C3HH 1YITA 1K28A 3J81j 3EFXD 1QCBD 1R9TB 5IGBA 1CHQD 2UXBL 2EY1A 2UUAQ 5FLMG 4IPCA 3VYSA 5IY0A 4IUQA 3MWYW 3HOYH 1H9RA 1WTQA 1FJGL 3MA2B 1CK1A 2KBNA 3S24A 1EY4A 3GTGB 3K5OA 3LWEA 3HKZG 3U9SA 1T5XD 4ZK9B 3V96A 5CBEE 1XMOQ 2ASBA 2PO4A 3SK4A 1HZBA 1I4XA 1DXMA 2R93G 1BF4A 4C1NI 4UAIA 1A3UA 2JJQA 1S5ED 3S2DH 4BS9A 4APVA 3S14B 3NHHA 1BCPB 2EJFC 2A19A 5CV9A 3CCLA 1JT8A 4DAYA 4RH6A 3EN2A 3PF4A 1STEA 1LLRD 1UEAB 2B2VA 5M3MG 1DGSA 1JQYD 2IT1A 3R2TA 1YNNC 3X3NA 2KA7A 3M85A 5FLXE 1BCPF 1K83B 4G4KA 1UEBA 3KF6B 4OO1G 2NTSA 5LMNQ 3P20A 1XPUA 1QJOA 3TQYA 2ES2A 3IRBA 2F0IA 1GUNA 4IPDA 1WD0A 3D4DA 2HT1A 4IUNA 1PDQA 2AQ2B 3AB9A 1TS2A 5IGDA 5C0XI 1SNCA 3NXWA 4JV5Q 3BYTB 4R4IA 3PO2H 5C5MA 3HOVH 1RHPA 1G8ZD 3HOZH 4FYDA 2Q8IB 3L2PA 4ZCKA 3CCEA 3HOZB 3RZDH 3SGIA 2K52A 4FF2A 3S1QB 3C1FA 5C0XH 4A3KB 3G71A 1I50H 3I4MG 1HZCA 1EQQA 4OWTB 4ID6A 4B3RL 3S9WA 4CKEA 3K57A 2JA8H 4L5TA 3A74A 3JAME 4EGVA 5EPKA 5IODA 2E75C 3D8GA 2O2LD 1D7QA 1OXTA 3C1EA 4RMFA 3STBC 4LF9Q 5M5XH 2VUMH 3HG9A 4DAPA 3C46A 4LF5Q 3FPUB 1EYDA 1DCZA 1XNQQ 2L5TA 2JA7H 1D1KA 3UDXA 4K2KA 4JYAQ 1TS4A 2VXWA 1F2MA 2EYHA 2B63B 5JEAH 3EVQA 4X3UA 2QDBA 4JI6L 4FNFA 1EZ6A 3IFTA 2A68C 1TKWB 1FR3A 4A93B 4MHEA 2Q2UA 1YHBA 2BH2A 4MNOA 4DV0L 5F2DA 1YHAA 2EDGA 3NEMA 1TWAB 4PZ6A 2UXCQ 1RKNA 1LT5D 2BCOA 2CVRA 2Z6BA 1B9NA 1SBBB 1JOQA 1TY2A 2Z6KC 1TXYA 4KTAA 3I4NG 3GO5A 2QW7A 4LF8L 2ZTDA 2UUAL 4A3MH 4LF6Q 3CMAA 3EJIA 4PMWA 1MD2D 4X65L 5EKLA 1IBKQ 1FGUA 3FKIB 1IL2A 1X3FA 5JAVA 1KHIA 4X65Q 4X62L 1BVSA 4JG2A 1EIYB 1K9MC 2OTJA 1I3QH 3VR6A 3SR1A 4X3KA 5KNBA 1XTCD 1LTID 4Y7NB 3EQLC 5GAGC 4B9XA 2OWOA 5K36H 3JAML 1HNWL 3O13A 4HSPA 3A5ZB 4POGA 1IYUA 2KQ3A 3TREA 5LMUQ 3WDNA 5I2XA 3J7A5 1II3A 2A8VA 3P7JA 3HOUG 3FP9A 4F88A 2NVTH 3NTHA 1Y14B 1ICWA 2F52A 2VQFQ 2X6LA 5AFWA 4DV6L 2OTLA 1NCVA 2R92B 2ZJRA 4YWKA 2YV5A 2A6EC 2O5JC 1ENCA 2RCFA 3A54A 3ND8A 3R2IA 1CI3M 5JEAJ 4JI7L 2NZ1D 2E2HH 3K5LA 2E5LL 1R4PB 2IWHA 4L5RC 3NBIA 1XMQQ 2GVBA 1BXTA 1UE6A 4LUZA 1N32L 1X65A 2G9DA 1VQFA 3TDQA 5CV7A 5FKAC 4CJ0B 1SN8A 2XRQD 2KCNA 1Y1WG 3PIP3 2JA9A 4GS3A 1ZKOA 2KCCA 3TZUA 4OIKA 4A3KG 1LABA 4KD3A 5LL6X 3GQBA 4U68A 1LUZA 4DNTB 4GKKL 3E9HA 1PRTF 5BR8Q 1UE7A 1LM0A 1JB3A 2AMCB 4BBSB 4A76A 2JA6H 3GV6A 5ISRA 1BKBA 4DK3C 3TSSA 2KVMA 2FXQA 2QF7A 4FXGC 5DLQE 4KD4A 2ENBA 2F0HA 3MHBA 2L12A 1CQFA 1ET6A 3QG1A 3UDIA 2ZM6L 2F0MA 1NY4A 1KXLA 5I2YA 2JA8G 2HDLA 1Y1WB 3K7UC 4A3IB 1KD1C 3F2DA 4B9WA 3I4LA 4B3ML 4RWSC 4TKOB 2KCTA 5DNFA 3HFZB 1GOZA 4I7AA 4AQYL 4IFDG 3RZOB 2KUMA 4X64L 2JQOA 3B6YA 2JSOA 1TY0A 4N8X1 1SYGA 1PMRA 1LV9A 1VQ7A 4AQYQ 1H95A 3VR5A 2KJXA 4DUYQ 4CDDC 2HIXA 1YNJD 2FINB 2AHOB 1VQBA 2SDFA 4HJAA 1MSHA 1KQSA 4X3SA 4CDCC 1H9SA 1SE4A 5K5PA 4GOPC 1EYCA 1KDAA 5IGEA 3OIPA 1L0WA 2K5VA 2KOLA 1K8AC 2UUBL 4OO1H 3H0GG 1W6KA 4JVZA 1SNMA 4WJWA 4X62Q 1H9JA 4AH6A 3H3VC 4EQOA 3J80L 1RIPA 1NBWA 1GHJA 3KLRA 1YI2A 1I6VC 1WTRA 3OOCA 4CGYB 3JAMi 3GTJH 3MVVA 2Y0SG 4M1UB 3ER0A 5KNDA 5G3LF 4OIJA 1X56A 3UE0A 3HKZB 4KY7A 1U4RA 3HRZC 3PUWA 3K58A 2JP1A 3QJYA 1PA6A 1JR0D 1HUMA 4DNRB 1STHA 3E5SA 4DR7L 1LO5D 1PFNA 1OTCA 4GZYC 1YZ6A 3WOFA 4TRDA 2QEXA 3BS1A 3BZDB 1D6EC 1YJWA 4LFBL 4DR1L 1HR0W 1L0XB 3CC7A 1PXUA 3UDGA 1I6HH 3H0GB 3L0OA 1OXXK 4XQJA 2OQKA 2B2TC 3KDFB 3H91A 5TSSA 5CBAE 3S16B 1BBWA 3K81C 3RZOH 3J7YW 1HA5A 3DWAA 2HIVA 2TSSA 2RKSA 1PZKD 3VDYA 3K7AB 1DYQA 5CYUA 1PH9A 3K6OA 4C3HG 4PNYA 4UDUC 4OO1I 3S1NB 1C7YA 4LUOA 3NTIA 1VQ4A 2WINB 1XMQL 2PW5A 3UE1A 1E1TA 2MO0A 3MEFA 2RHSB 3BVMA 4BA1I 3J81c 1SYCA 4RGMA 3TP5A 1SYBA 4JI3L 2EIFA 3CQZH 1SNOA 2E2JH 3GV3A 4BBSG 4A3CG 4A3GG 1HNWQ 1XJVA 5FO7B 2F0FA 2I0QA 4PZ8A 1YNND 4K0KL 2GN5A 4IFDH 5C5LA 1I4RA 4C3IH 4A3FG 1EYAA 1VQLA 4DR2Q 4EQPA 3JAMc 1TWHB 4PG3A 4RKLA 1VQMA 2HUGA 5E4WC 4OX9L 3U50C 3AQQA 2NZOA 2WACA 1WOCA 4XYOA 4G57A 1V1PB 4KJNA 4UPAA 3HKZE 3RLOA 1JWMD 5M5WB 1EZ8A 1SE3A 3VR4A 2Z6KA 1TWCB 2MP1A 5EPJA 2GA4B 2K14A 4BBRB 4J6HA 1B2TA 2B63H 3NE5B 4DV4L 4FF3A 2BDNA 3UI2A 3AU7A 4FDBA 3ZJYC 1D2BA 4A3EH 4JI2Q 1PYSB 4DUYL 3DMUA 2D62A 2AQ1B 4P73A 3M9BA 3T1HQ 2JK8A 2AUJD 1J9OA 1W6JA 2KHSA 3H3VH 1KABA 2PMZE 1B8AA 2DGYA 3CCVA 1Q82C 5C4XB 2O5IC 2NVTB 4K6LA 4A3KH 1YNJC 1LACA 4HN7A 3M7NA 1PRTC 2N88A 2VB3X 3STBD 4DV5L 4A3EG 1EY7A 2F0WA 2JA5B 3I4NB 1VQ5A 1B70B 2M00A 1BCPC 3U9OA 2F0LA 1HNXL 3TEHB 4A3DG 1IXRA 1YIJA 5E3FA 2K50A 2OT2A 5KEEA 1TQOA 1QOHA 2V4DA 2IPKD 4NXMQ 1DOMA 1L1OB 1PH8A 1NNXA 2PQEA 1RODA 2UUBQ 5C4JB 2E2IH 4R1JA 2Q8TA 4B3TQ 4YWLA 3MFGA 4DV2L 3KFUA 4FF4A 3HOXG 1GHKA 3IKJA 3I4MH 5CR3A 2K75A 2VY3A 1BCPD 4P2CB 4TSSA 5C0XG 5JJLA 1TS3A 5ELDA 5LL6S 1A3VA 2X69A 2E8GA 1VQJA 1HXYD 2G5DA 3G6JB 4A3MB 1B50A 3OPOA 3J81i 2JEBI 2MFIA 1E0BA 4BXXG 2IX0A 3F2CA 1QNUA 1J5EQ 4A3GH 5M5YB 5GAEC 3KF8A 3S2DB 5CV4A 4ZKCB 3GTLB 5IYCG 1QVFA 2QA4A 1F9RA 5A35A 1TU2B 4O1NA 1SRUA 1XNRQ 4UP7A 1BQQT 1C8CA 5M3FB 2VB2X 2EXZA 3U4VA 1J8IA 1EQRA 4RKBA 2CH4A 1E2WA 1EWCA 1JOKA 4AYBG 4DUZL 2F0PA 5FOBB 4A3MG 4O42A 2MQHA 4JI3Q 2CW0D 1PYWD 1Y8PB 3BJUA 4XT3B 1C0AA 2PZWA 3NWTA 3PF5A 1MGSA 1H9KA 4KHPL 1MKHA 1Z6HA 3TZDA 1GM5A 1X3GA 2LY7A 2PZUA 2KHIA 1A2TA 3FVQA 3MXUA 5HGQA 4UY8C 2DJGC 4KHPQ 1F9PA 2L0CA 4QJFA 1J5EL 1IBMQ 1O7YA 2JA7B 1SLJA 2QEJC 4X66L 2R7FA 3S17H 1ILQA 1WTHA 5JEAG 4DAYB 4NB3A 5IYBG 5DM73 4XTCS 4FF1A 5M3FG 3J7AF 1HUNA 1WYDA 4V0BA 1TWGB 1C4QA 2D5DA 1CQVA 4LK1C 1V9PA 3HP3A 4IFDJ 1PHJA 2BA0A 1QVGA 3DUZA 4FP5D 4IUPA 3A5UA 4ZUJA 4DV1L 2NBFA 1SAPA 5C4HA 5CV8A 1VQKA 1IKMA 2VUMG 1LTLA 5LMNL 2SNSA 3QIAA 1CA6A 4DV7Q 4GOPA 2B2WC 2PZTA 3GTPB 3OW2A 1JWSD 4OONA 2RF4A 4GLVB 3RN5A 1G91A 2PNRC 1LTGD 2WB1B 5FK9C 1HJPA 3NQTA 4DAVA 3DEPA 3W1GA 2F0TA 4FXKC 1G51A 1HTPA 4QY7A 1VMPA 3M3YH 1HNZQ 4L5QA 2WIIB 3HOZG 1FJGQ 3HOVG 4DR3L 4RG1A 4X3TA 4A3LH 2EYFA 4GN5A 3TS0A 1XMOL 4TVAB 4K5XA 3GTPH 1N34L 3AYHB 3P75A 1PH4A 2ZXRA 1EIHA 3I3CA 2YU9H 2EJMA 3I4OA 3I72A 4PQXA 4N9PA 2NVQB 1HQMC 4WORA 2D0OA 5IYDH 4HAEA 1TT2A 3BDCA 2E2JB 5M3FH 4A3BB 2BOSA 3K59A 1LTTD 1VQ9A 2PCFB 1YVCA 2Y0SE 4JI1L 3NELA 2XNAC 2Y0SB 3PUVA 1JOOA 1VQDA 2K04A 3PUXA 1UNSA 5H1SE 2F0GA 1CA5A 4XXEA 5M5WH 5BN3A 1Q1EA 1VQNA 2EZVA 1SR3A 4R4TA 1HA6A 1M90C 5IGCA 5J22A 4B3MQ 3M4OB 2A73B 3CC2A 4ME3A 3C2PA 3HOWH 1K73C 1RTNA 4YY3Q 4JI6Q 3NPPA 3OYYA 3PUZA 1KIXA 2DNEA 1L1OA 1XTDA 4X64Q 4MZ9A 3SK8A 3RLNA 1HNZL 4XIGS 4JYAL 5IE8A 2VNUD 2CKZB 1E22A 4YHHL 4BY7G 4OWWB 4RAUC 4CJ1B 1Y1WH 3NUCA 1N36L 1Q12A 3BDOA 4DV3Q 2Z1CA 5GROA 1Y1VB 1WJJA 3R8BA 1EWIA 4LF4Q 3CCSA 4LF8Q 5FJ8G 1HCZA 4LF6L 1KTKA 4ODGA 1VQ8A 1NMFA 3HGBA 1TWFH 4NXML 1AE3A 4LF4L 3NBHA 1QE6A 1DOLA 3DLLA 4QB4A 4JBJA 4N9TA 4RHSA 5KYIA 4HTHA 1HZ9A 1ZYRC 1Q81C 2A5HA 4HJ7A 1XPRA 4IFDI 3HKSA 3J80i 1S3OA 4DA2A 2F1MA 2C35B 3H94A 3V05A 1X9NA 3J81E 2F4IA 1PV4A 2F3IA 1DOKA 3BG3A 3OIQA 4IALA 4GLXA 1GUSA 3KJOA 1FNWA 1WCMB 2F3VA 5FO8B 2IY5B 4NPSA 5C4JH 2K03A 1IYJB 3J80E 2UUCL 2EYPA 2K32A 1KDCA 2SOBA 1I3QB 2B2TA 3GTJB 3A56A 4PMCA 1SSOA 2I07B 4BWGB 4DK6C 3DHQA 1U4PA 2EYLA 2NUCA 1EQTA 1Q7YC 2LXJA 4HJ8A 3NP8A 4J8QA 1XX8A 1A0IA 4Q0FA 1IZ6A 4LFBQ 1ASYA 1L0YB 5HGTA 2PI2E 1VQIA 3ULPA 2R3ZA 2WB1E 5AJ3Q 3E0JA 2PNHA 4PV1C 3X3MA 3I4NH 2CWPA 3QO2A 3QOJA 3DM1A 5C3EH 1HQRD 1HZAA 1SMYC 1EOVA 2IHFA 4DXGA 2FJ2A 4YCWA 2VW9A 1GUTA 5ELCA 1NR4A 3W3AA 1G2SA 4HSVA 3T13A 3MXNA 3RN2A 2KCMA 4UP8A 5CV5A 3R3OA 2MHVA 2I5MX 2V1CC 2JA5G 1ZEQX 4DR4L 4HCSA 3A55A 1NR2A 4H7BA 4A3IG 1STAA 3KBGA 2A6ED 1RF2D 2RDGA 3VYUA 5LMUL 4IOAA 4NXNQ 2LS01 3CW2C 3FKIH 1VQAA 4DPGA 1EY8A 2OEOA 3NQIA 3MXNB 1SFOH 2AQ3B 1IYVA 2BE5C 2Z0SA 4IUVA 2IW3A 3ULJA 3HZXA 1CSQA 4AYBE 2Q8RE 4H0LC 2MNAA 1G6PA 4PZ7A 3FEWX 1EWHA 2I5LX 4JI7Q 4C3IB 1WVLA 2D9UA 1U9RA 2HQLA 3I2ZA 1WI5A 1BBUA 4ME5A 1HPCA 5T1GA 2OQ0A 1PRTD 1JJCB 5L37A 1CSPA 2SNMA 4NKLA 3PO2B 1PH2A 4YHHQ 4S3SA 2F0KA 1WTWA 1VS0A 2R6GA 3D31A 1SMYD 3LNNA 2ZXOA 3I91A 2K5DA 1C48A 2Z8LA 4WRDA 1P8LA 3K80C 4KMUC 1ESFA 1K0RA 1MBYA 3I56A 2IX1A 2PI2A 1NE3A 2XSCA 4OELB 4DF7A 1HNXQ 3KLSA 1HFGA 4NXNL 1SJED 4U673 4ZQ3A 1XXGA 3FRPB 3T53B 5IGGA 1PLFA 4BY1G 4QIWE 1EY9A 1EY6A 4L63B 3H15A 1Q3LA 1U4MA 2H4OA 1EIFA 5M3MH 2IHEA 1JWUD 3GTKB 2ZM6Q 5J1ZA 3TP7A 1GJXA 2A1AA 5T1IA 2KEEA 4GLAC 3MTSA 1XWEA 3T56B 3A8IE 2OF1A 3ITPA 1PH3A 4DR7Q 5HY6A 1LT6D 1K3RA 4YY3L 5ELOA 1LT3D 1F9SA 4OEMB 1WTXA 1SEBD 2ZTCA 4DFAA 1RCVD 1B9MA 2F4VQ 2EE1A 3Q22A 3ICEA 5ELNA 3Q8DA 4LWCA 3HOUB 2EQSA 3KLSX 1RTOA 2B2UA 1VQPA 4F8MA 3Q0AA 2JXMB 2R92G 1UAPA 4MN3A 2PMZB 1DZ1A 1I4GA 4R8IA 2MO1A 4K8JA 3E6ZX 2WKDA 4LNQA 5EGTA 5IYCH 4OGQC 5KNCA 1KLUD 1V1OA 2F0DA 3ZYYX 3I73A 2A6HC 2K5NA 4H02A 3BVGA 1F2ZA 3M4YA 4EQNA 4B3SQ 2R93B 3K8AA 2ALYB 5C0XJ 2HHHQ 4DXFA 1PH7A 4JI0Q 4IUTA 2P5ZX 3DWQA 1IKLA 1S4ZA 2AWNA 2R61A 5M5YH 4A3GB 2LKVA 1JICA 5JPNC 4WJ4A 5CV6A 3S15H 2WKCA 3D3RA 2A69D 4DN4M 1E3PA 3JC66 5IP7H 2PW7A 4JV5L 2F4VL 2KENA 3NWSA 5BN5A 3HOWB 1S5BD 2FFKB 3A8JE 2R7ZB 2DUDA 4GN4B 4F87A 3M4OH 3VYTA 3J7AV 3M4PA 2UXDQ 2CHBD 2YTVA 4ZUIA 3RZDB 1ILPA 3CF5A 2YTYA 4QL5A 4HMIA 4OX9Q 4QUFA 1JJ2A 4A3DH 4HIMA 2AWOA 3E3XA 4HCEA 4QCLA 3FKIG 5CC4A 1JB7A 1KRSA 1Q1BA 5IP9G 2A74C 1B44D 4IN3A 3W1BA 1Q86C 3ERSX 3HS0C 3EROA 4EQ5A 2JA6B 2JA8B 4P72A 1AZQA 1UE5A 4P74A 5ELEA 2E5LQ 4RFBA 4BBRG 3GD7A 3L3OC 4F7XA 5IWAQ 1CFMA 2LFNA 3H3VI 5I6WA 1MI2A 2ZT9C 4DAMA 2LMCB 2KECA 5DAUA 1S5CD 1P16A 3I55A 5C4XG 3TP8A 1VF5C 4GN3B 1N32Q 1LTRD 2CQAA 5JVG3 2N3SA 5I6YA 3F1ZA 1KLGD 3SDZA 1D8LA 4JCVE 1LYLA 1FD7D 1Y1VH 1SJHD 3MXGA 4DV0Q 3PIO3 1K0SA 4KKTA 1I94Q 4J15A 2BH8A 4XT1B 1Y69U 1PFSA 1A8VA 3IL8A 4KKUA 3GTOH 1SYEA 3HOXB 2NN6H 5EKIA 2K1BA 1CT1D 3S2HH 1SYDA 2EYOA 4RHRA 4RGOS 4JW0A 3H6MA 1CZGA 4B3RQ 1BR9A 4MTKA 3ERQA 4DV1Q 1XNQL 3PO3G 1J6QA 3OMGA 2EPBA 1HR0L 1VCIA 1QUQB 3KDFA 4KHVA 2CQOA 2NN6G 2CFMA 3S1MB 2J4XA 1QILA 2ZTEA 2B2VC 3FDTA 2UUCQ 3EIVA 3RLFA 3G4SA 1OXUA 1IHZA 4HIDA 4IQZA 2M2LA 1O78A 1UUPA 1CHPD 4LJZC 1ICFB 3KJPA 4ALPA 1EFID 1K3BC 1SFOB 1XYIA 4DV5Q 3K5MA 3CPWA 2F0NA 3CKIB 2J0TD 1FGBD 4CHTB 1B1ZA 1PTOB 2EXDA 2JEAI 1AEXA 1C9OA 3AFQA 4RA8A 3S1RH 1N9WA 3KUPA 1V43A 2HHHL 4L6TB 3D4WA 1SNDA 4ILWA 1OXSC 1I5FA 2F0OA 4BY7H 1E2ZA 1EY5A 2QCPX 4RGNA 1GUGA 1ZYRD 1KAAA 3VR2A 5JJIA 3CCJA 1HR0Q 3HOWG 2VQEQ 4JBKA 2F0SA 1WFQA 3D6WA 3OWFA 2N8NA 2JA7G 4C2MH 1Z9FA 1VQ6A 4B08A 2A68D 2K5WA 2MPMA 3H09A 1DD2A 2F0UA 1HHVA 3SVMA 1R4QB 2KEDA 2NYZD 3L9AX 5EBDA 1EIGA 1D1IA 2YU9B 3RNUA 4MTNA 1PTOD 4C3JH 3DWPA 2FMCA 3J81L 3AFPA 5BR8L 4DV6Q 3BZCA 3CRKC 2YYZA 2WAQB 4KN4C 3S17B 2XN9C 2VL6A 1X55A 1SE8A 2EY2A 3F2UA 4AIMA 1JMCA 4KY6A 1RD9D 3OHXC 4JBWA 1B7YB 4EVOA 3W5OA 3GP7A 1RJTA 2I5HA 3PO2G 2L55A 1IL8A 5KIXA 2NTTA 5LMNW 1M4VA 3T4AC 4JI4Q 4G7OC 1M8AA 4RCNA 4A3CH 3C3LA 1EFWA 2K5HA 2EOTA 5EJWA 3RR5A 1V1QA 3A0JA 5IT9L 3URYA 2Q2HA 3LWUA 4JOIC 1F77A 1UE1A 1GKHA 1PTOF 4NW2A 1E24A 3VR3A 4DR6L 5M9OA 4LUVA 2Z4HA 1SE2A 1LTBD 3K5NA 1ASZA 1MJEA 4C3JG 4A3EB 2E76C 2CCZA 3T1YQ 1TWGH 4DR6Q 2K6AA 5JJZA 2RVLA 4V190 1TWFB 5GAHC 3TS2A 4A3DB 3U4ZA 1KRTA 1D5ZC 2ICIA 4ZKBB 4DR4Q 5EKKA 1A2UA 3S1RB 4P71A 2D2CC 3L7ZC 4KI0A 1EY0A 4YIJA 2OCEA 3OTOQ 1EOTA 4O2DA 3ND9A 3OSOA 2FMMA 3QWNA 3RD4A 4QQBX 4KJOA 3NK9A 3PGZA 1NAPA 2ICEC 5IYBH 4K0KQ 1IBLL 2PYKA 1GO3E 1FYCA 1QWYA 3VA5A 2R93H 3NENA 1SXTA 4GOPB 2E2DC 4HJ5A 3G7LA 4DR2L 1CKNA 5JOBA 4IPHA 1DM0B 4GKJQ 1PTOH 1YNXA 4GNXA 1FL0A 2F0JA 1KNAA 1EL0A 3J80c 2PQAB 2DNCA 1I4PA 3S2HB 2L9HA 3S16H 3I90A 5FLMH 4M8AA 3PMFA 2F0QA 3CRLC 1TVXA 2K05A 3DXJC 1W2BA 2NVXB 4YCUA 2IJ0A 2XVSA 1WCMG 1A62A 4CKBA 5C44B 3NBHB 1HRJA 1B4OA 1N34Q 1KNEA 1O7LA 1NTGA 1SNQA 3S1NH 3H0GH 1F2YA 3DEOA 4N8FA 5M3MB 1HTLD 3CCMA 1D5XC 4DV3L 3N6RA 3HOUH 3BYYB 4H44C 5A2QE 4P75A 2BDOA 4DR5L 4LF7L 4H13C 4LFCL 4DK0A 4NMZA 2JN4A 5GADC 1CKMA 1VQGA 2EJGC 1X6OA 5K36G 4DR5Q 2PQAA 1EU4A 3E9IA 4FVMA 2B2YA 1VQHA 3GTQB 1Q90A 1CZWA 1IBKL 4BXXH 1PH6A 1AH9A 4LF5L 3NSWA 2EY5A 2NVYH 2R7DA 3CCUA 2F3WA 4LW1A 3QB3A 3QR8A 2DN8A 4ZYSA 5FO9B 3OWEB 4A75A 4PMBA 1U5KA 1E1OA 2NB0A 1SYFA 2B2YC 2UU9L 4C56C 2CWAA 3PIOA 5HURA 2B29A 2XTIA 4DNIA 3GTMH 1QNKA 5EPLA 1L2FA 3F8TA 1AE2A 1NJIC 2L11A 4Y52H 1S5FD 2NZHA 4O0AA 4A3IH 4HJ9A 2QILA 5C4XH 4R9WA 3CP0A 5I9PA 3A7LA 5J39A 3A8KE 4J1MA 3KK7A 4A3JG 4JOIA 2L4NA 4JI4L 4HMJA 4LF7Q 3BDLA 4R4OA 1BNZA 5I4DA 1TR5A 5IOCA 1XNRL 2HD3A 4QUCA 4A3JH 2RBMA 4KN7C 4DV4Q 1X54A 2VQEL 2B63G 1D5MC 1ET9A 5C3EB 1K8MA 4E6IA 4EX5A 3PUYA 4TQUS 1N33L 4YCVA 3KLWA 4GNXB 5KGUA 4A93G 3SEBA 5E1FA 2NVQH 1O7ZA 4G7HC 4GNXC 4A4IA 1K8GA 4X66Q 2ID0A 1M1KC 2PPBC 1DONA 1VQEA 1CTMA 2N55A 1KL9A 1JC7A 1NUCA 3SK5A 5EAYA 4K5WA 1JORA 4R4CA 4A3FH 4IURA 5FLXL 4AYBB 2XWJB 3MC0B 4FO2A 4C3IG 3EBEA 4L8JA 3M7GA 1B3QA 3A7AB 3D4RA 3CQZB 5ELFA 2RSNA 5C4ZA 3Q24A 1VQOA 3M3YB 3Q23A 4BA2I 4IPGA 4R4QA 4FXDA 1EEFD 3DM3A 1B3AA 1SDFA 4JPBW 3I8ZA 1F2LA 2WP8J 3MXPA 2QGQA 4BBSH 2YTXA 4WJ3M 2M9VA 2XRSD 4GKJL 4BY1B 2L1BA 1OXVA 4NDXA 4WFN3 2AKWB 3BU2A 5C3XA 3LX0A 4ZLTF 2FHTA 1VQCA 3KYHC 1XPOA 1NMGA 4LFAL 3MAQA 1WTPA 4DKAC 1LTSD 5IIFA 4QGUA 5FJ8H 4OL7A 2NVXH 4K8IA 3PIPA 4LFAQ 1WCMH 1EUJA 1N33Q 3QOLA 1QZHA 1CKNB 2DJFC 3W2DA 1Y1VG 1Y8OB 1X3PA 1QVCA 1K8OA 2RDFA 2VS1A 1EU3A 3EA6A 2NVYB 2K4KA 4XDXA 2A6HD 2ZJQA 2WV6D 3AMUA 4DR3Q 2ZJPA 1E7ZA 1X3QA 1WTVA 3MEHA 4Y7NH 2XWBB 3SXHA 1IBLQ 1A3TA 1G6ZA 4I65A 2F0EA 1BBXC 4ABNA 1DJRD 2BA1A 2WB1G 3AEVA 3BVZA 2NWGA 3WWVA 2QDLA 5JJKA 4G7ZC 1PZJD 3CAMA 5G3LD 3R93A 1PH5A 4BBRH 2ATWA 4B3TL 3M4QA 4JI1Q 4BY1H 3K0XA 5EBCA 2L15A 4QMGA 4XQNA 2HDMA 4LF9L 1PFBA 3N52A 5IYDG 4MIUA 5D3IB 1Q8KA 5IGFA 1WTOA 2R7ZH 1B53A 3KBXA 1KDBA 3SE0A 1S72A 1PRTB 2K28A 2B8GA 1S40A 3S14H 3S15B 1PFMA 4JC0A 4A3JB 2RQXA 3GTLH 4K5VA 1BO0A 4LMQD 3TRZA 5CMDA 3TBIB 2UXCL 3GDEA 3KF6A 1U4LA 2I46A 2MUYA 2QKIC 4OWXB 3GTGH 3OW7A 1AP0A 2IX3A 1ESRA 5CORA 1PTOC 3CD6A 4LFCQ 1F9QA 1GVPA 1JCKB 5I9OA 1ENAA 4IJLA 2ZXPA 1QB5D 3IFDA 2E74C 5JVH3 2Z4IA 3I4MB 1EEID 1O80A 1LT4D 2CW0C 3TP6A 1KAWA 2O4XA 3MFYA 2D0PA 2X6GA 1Z47A 1SMXA 3K0YA 1OO9B 1MSGA 2R7ZG 3PV0A 4DU9A 1JJGA 2VUMB 1V8QA 1Z7TA 4RGTA 2A69C 4A3BH 1T5EA 1AW7A 3T1YL 3S1QH 4K2LA 3UDFA 1HH2P 3U58A 3CCQA 2K5QA 4HIKA 2R92H 3PCOB 4JI5L 2JA5H 3LGJA 1CM9A 1X3EA 2Q2IA 4UP9A 1A6XA 1ONLA 3E0EA 2JA6G 5M5XB 1JE4A 1H9MA 1K83H 1Q8IA 1AN8A 1ML0D 1FVIA 1TIID 4KKSA 3HOVB 4OXPA 3GTKH 4CKCA 5CGKA 3IAYA 5IWAL 4IUUA 4JI8Q 4IO9A 4CDEC 2E2HB 3GTMB 2IL8A 3CCRA 2N78A 3OMCA 1A15A 1SROA 4B3SL 3NTKA 4KV6A 1TWCH 4KY5A 4QF4A 5NUCA 3FHWA 2HCCA 1G2TA 1IW7C 2HQEA 2BE5D 1PVOA 4X6AH 4KK7A 1PH1A 1N8RC 5IT9c 4RCOA 3HOYG 2EYJA 3WOEA 4JBMA 1H9SB 1BOSA 2RDHA 4JI2L 1T9HA 2LSSA 3BZKA 4ZAIA 2WAQE 4HR7B 2LXKA 1I94L 4C2MB 2K01A 5E4XA 1N36Q 1GD7A 4KHZA 2CH4W 1STNA 1MIUA 1IW7D 1I4HA 2VZAA 4DK1A 4JI5Q 5BN4A 5IT9E 2UXDL 3D0FA 3TMEA 3RMHA 3I70A 2B3GA 3TN2A 1R9TH 4GKKQ 4C3HB 3J7ZC 4HEDA 5D3DA 3G48A 3PSIA 4CJ2C 1VF7A 2JYOA 5C44G 3PO3B 2B8FA 1SNPA 3PO3H 3OTOL 3G6EA 1RDPD 4HIOA 5D65A 3FPPA 5C3WA 5ELBA 4R8NA 2K7VA 3HOXH 2Q2TA 3HOYB 4A3FB 1YBYA 3GTOB 5KYLA 1TWAH 1HFNA 4ULLA 2DY7A 4LAAA 3RUZA 1U0LA 4DV7L 3PQIA 1G291 1L1OC 2SEBD 3T51B 1X32A 4IZ8A 4DGZA 2GVAA 1I4QA 5LHY1 5COYA 1AZPA 4A93H 4OHJA 3K7AH 1BDOA 1MHWC 4K6DA 2K33A 2EVBA 2C9OA 3V2TA 3T1HL 4IJHA 2F03A 4XQQA 4I7ZC 3ONAB 5EQ0A 1GUWA 1RL2A 3HEJA 1UWVA 1I6HB 1CKOA 1BUVT 1I50B 3CHBD 3S1MH 2HCIA 4Z9CB 2N49A 5E7NA 3D6CA 1QZGA 3VYRA 5FLXc 2WFWA 4IOCA 3KF8B 3FMCA 1STBA 5D14A 1Y8NB 4K14A 3GTQH 3F2BA 4C1NK 3Q6SA 2EY6A 2H5XA 4ZRZA 3KOJA 3SK6A 1STGA 2XIWA 1PYBA 4POFA 3T16A 2KHJA 1YJ9A 5C3EG 5J3BA 4JI0L 2Z9HA 1S5DD 2MJ8A 4L5SA 4A3BG 1E2VA 1PZID 1NSNS 2UXBQ 5IP9H 4NP5A 5DM63 1Q46A 5A2QL 4Q5VA 2AUKA 1YJNA 2RSOA 1ENFA 1AFPA 2UU9Q 3MZ5A 3SHLA 1EYGA 5KRUA 4DV2Q 2E2IB 1GXDC 1FNUA 4CBVA 1YHQA 1TS5A 4YWMA 1CUKA 1QUQA 2JE6I 3CXCA 4UHVA 1A63A 4KLKA 1JE5A 2RHQB 2G9HD 4XYQA 4A3LG 2WAQG 1STYA 2XGTA 5DEHA 4CDFC 1YEZA 4DR1Q 5IP7G 5C6AA 3CC4A
chains in the Genus database with same CATH topology
3CU7A 1VMCA 2EYMA 3VA7A 2F0VA 1QG7A 1LTAD 5JPMC 1GUOA 4C3JB 4BY7B 2B2UC 4QIWB 2DY8A 1EQVA 1WD1A 2OXPA 2B2WA 1FNVA 1VDZA 2C5CA 1ZXTA 2B39A 2MGSA 1V1PA 3P1HA 2RA4A 4JK1C 2J7ZA 2NN6I 2TMPA 2H1EA 3EFXD 1QCBD 1R9TB 5IGBA 1CHQD 2EY1A 3VYSA 4IUQA 3MWYW 1H9RA 1WTQA 3MA2B 1CK1A 1EY4A 3GTGB 3K5OA 3LWEA 3U9SA 1T5XD 4ZK9B 3V96A 5CBEE 2PO4A 3SK4A 1I4XA 1DXMA 1BF4A 4C1NI 4UAIA 1A3UA 1S5ED 4BS9A 3S14B 3NHHA 1BCPB 2EJFC 5CV9A 4DAYA 4RH6A 1STEA 1LLRD 1UEAB 2B2VA 1JQYD 2IT1A 3R2TA 1YNNC 3X3NA 2KA7A 3M85A 5FLXE 1BCPF 1K83B 4G4KA 4OO1G 2NTSA 3P20A 1QJOA 2F0IA 1GUNA 1WD0A 3D4DA 4IUNA 1PDQA 2AQ2B 3AB9A 1TS2A 5IGDA 5C0XI 1SNCA 3NXWA 3BYTB 5C5MA 1RHPA 1G8ZD 4FYDA 2Q8IB 3HOZB 4FF2A 3S1QB 3C1FA 5C0XH 4A3KB 4ID6A 3S9WA 4CKEA 3K57A 3JAME 4EGVA 5EPKA 5IODA 2E75C 3D8GA 2O2LD 1OXTA 3C1EA 3HG9A 4DAPA 3C46A 3FPUB 1EYDA 1DCZA 2L5TA 1D1KA 4K2KA 1TS4A 2VXWA 1F2MA 2EYHA 2B63B 5JEAH 3EVQA 4X3UA 2QDBA 4FNFA 1EZ6A 3IFTA 2A68C 1TKWB 1FR3A 4A93B 4MHEA 5F2DA 2EDGA 1TWAB 1RKNA 1LT5D 2BCOA 2CVRA 1B9NA 1SBBB 1JOQA 1TY2A 4KTAA 3GO5A 3EJIA 4PMWA 1MD2D 5EKLA 3FKIB 5JAVA 3VR6A 3SR1A 4X3KA 5KNBA 1XTCD 1LTID 4Y7NB 3EQLC 4B9XA 5K36H 3JAML 3O13A 4HSPA 1IYUA 2KQ3A 3WDNA 5I2XA 1II3A 3P7JA 4F88A 3NTHA 1ICWA 2X6LA 5AFWA 1NCVA 2R92B 2A6EC 2O5JC 1ENCA 3A54A 3ND8A 3R2IA 1CI3M 5JEAJ 2NZ1D 3K5LA 1R4PB 2IWHA 3NBIA 1BXTA 2G9DA 3TDQA 5CV7A 5FKAC 4CJ0B 2XRQD 2KCNA 3PIP3 1ZKOA 2KCCA 3TZUA 4OIKA 1LABA 4KD3A 5LL6X 3GQBA 4U68A 4DNTB 1PRTF 1JB3A 4BBSB 3GV6A 5ISRA 3TSSA 2KVMA 2QF7A 4FXGC 4KD4A 2ENBA 2F0HA 3MHBA 2L12A 1CQFA 1ET6A 3QG1A 2F0MA 5I2YA 2HDLA 1Y1WB 4A3IB 4B9WA 3I4LA 4RWSC 4TKOB 5DNFA 1GOZA 4IFDG 3RZOB 2KUMA 2JSOA 1TY0A 1SYGA 1PMRA 1LV9A 3VR5A 2KJXA 1YNJD 2FINB 2SDFA 1MSHA 4X3SA 1H9SA 1SE4A 5K5PA 1EYCA 1KDAA 5IGEA 3OIPA 2KOLA 4OO1H 1W6KA 1SNMA 4WJWA 1H9JA 3H3VC 4EQOA 3J80L 1GHJA 3KLRA 1I6VC 1WTRA 3OOCA 4CGYB 3MVVA 4M1UB 5KNDA 5G3LF 4OIJA 3HKZB 4KY7A 1U4RA 3HRZC 3PUWA 3K58A 2JP1A 3QJYA 1JR0D 1HUMA 4DNRB 1STHA 3E5SA 1LO5D 1PFNA 4GZYC 3WOFA 4TRDA 3BS1A 3BZDB 1D6EC 1L0XB 1PXUA 3H0GB 1OXXK 4XQJA 2B2TC 3H91A 5TSSA 5CBAE 3S16B 3J7YW 1HA5A 3DWAA 2TSSA 2RKSA 1PZKD 3K7AB 1DYQA 5CYUA 3K6OA 4C3HG 4PNYA 4UDUC 4OO1I 3S1NB 3NTIA 2WINB 2PW5A 4BA1I 3BVMA 1SYCA 4RGMA 3TP5A 1SYBA 1SNOA 3GV3A 5FO7B 2F0FA 1YNND 4IFDH 5C5LA 1I4RA 1EYAA 4EQPA 1TWHB 4RKLA 2HUGA 5E4WC 2WACA 4XYOA 4G57A 1V1PB 4KJNA 1JWMD 5M5WB 1EZ8A 1SE3A 3VR4A 1TWCB 2MP1A 5EPJA 2GA4B 4BBRB 4J6HA 1B2TA 3NE5B 4FF3A 2BDNA 3UI2A 3AU7A 1D2BA 3DMUA 2D62A 2AQ1B 2AUJD 1J9OA 1W6JA 2KHSA 1KABA 5C4XB 2O5IC 2NVTB 4K6LA 1YNJC 1LACA 4HN7A 3M7NA 1PRTC 2N88A 2VB3X 1EY7A 2F0WA 2JA5B 3I4NB 2M00A 1BCPC 3U9OA 2F0LA 5E3FA 2OT2A 5KEEA 1TQOA 1QOHA 2V4DA 2IPKD 1DOMA 2PQEA 1RODA 5C4JB 2Q8TA 3MFGA 4FF4A 1GHKA 3IKJA 5CR3A 4P2CB 1BCPD 4TSSA 5C0XG 1TS3A 5ELDA 5LL6S 1A3VA 2X69A 1HXYD 3G6JB 4A3MB 1B50A 3OPOA 2JEBI 1E0BA 2IX0A 1QNUA 5M5YB 3KF8A 3S2DB 5CV4A 4ZKCB 3GTLB 1F9RA 5A35A 1TU2B 4O1NA 1BQQT 1C8CA 5M3FB 2VB2X 2EXZA 1J8IA 4RKBA 1E2WA 1EWCA 1JOKA 2F0PA 5FOBB 4O42A 2CW0D 1PYWD 1Y8PB 4XT3B 2PZWA 3NWTA 1MGSA 1H9KA 1Z6HA 3TZDA 2LY7A 2PZUA 1A2TA 3FVQA 3MXUA 1F9PA 2L0CA 2JA7B 1O7YA 2QEJC 1ILQA 5JEAG 5DM73 4XTCS 4FF1A 3J7AF 1HUNA 4V0BA 1TWGB 1C4QA 2D5DA 1CQVA 4LK1C 3HP3A 4IFDJ 2BA0A 3DUZA 4FP5D 4IUPA 4ZUJA 2NBFA 1SAPA 5C4HA 5CV8A 1IKMA 2SNSA 3QIAA 1CA6A 2B2WC 3GTPB 2PZTA 1JWSD 1G91A 2PNRC 1LTGD 2WB1B 5FK9C 3NQTA 4DAVA 3DEPA 2F0TA 4FXKC 1HTPA 1VMPA 2WIIB 4X3TA 2EYFA 4K5XA 3P75A 2ZXRA 1EIHA 3I3CA 2EJMA 3I72A 4PQXA 4N9PA 2NVQB 1HQMC 4WORA 4HAEA 1TT2A 3BDCA 2E2JB 4A3BB 2BOSA 3K59A 1LTTD 2PCFB 2XNAC 2Y0SB 3PUVA 1JOOA 3PUXA 2K04A 1CA5A 1UNSA 2F0GA 4XXEA 5BN3A 1Q1EA 2EZVA 1HA6A 5IGCA 5J22A 3M4OB 2A73B 3C2PA 1RTNA 3NPPA 3PUZA 2DNEA 3SK8A 4XIGS 2VNUD 4RAUC 4CJ1B 3NUCA 1Q12A 3BDOA 2Z1CA 1Y1VB 3R8BA 1HCZA 1KTKA 4ODGA 3HGBA 3NBHA 1QE6A 1DOLA 4QB4A 4N9TA 4RHSA 5KYIA 4HTHA 1ZYRC 2A5HA 4IFDI 4DA2A 2F1MA 3H94A 3V05A 3J81E 2F4IA 1DOKA 3BG3A 3OIQA 4IALA 1GUSA 1FNWA 1WCMB 2F3VA 5FO8B 2K03A 3J80E 2EYPA 2K32A 1KDCA 2SOBA 1I3QB 2B2TA 3GTJB 3A56A 4PMCA 1SSOA 2I07B 4BWGB 3DHQA 1U4PA 2EYLA 2NUCA 1EQTA 3NP8A 4J8QA 1XX8A 4Q0FA 1L0YB 5HGTA 2R3ZA 3E0JA 4PV1C 3X3MA 3QO2A 3QOJA 3DM1A 1HQRD 1SMYC 4DXGA 2FJ2A 1GUTA 5ELCA 1NR4A 3W3AA 1G2SA 4HSVA 3T13A 3MXNA 5CV5A 3R3OA 2MHVA 1ZEQX 4HCSA 3A55A 1NR2A 4H7BA 1STAA 3KBGA 2A6ED 1RF2D 2RDGA 3VYUA 2LS01 1EY8A 2OEOA 3NQIA 2AQ3B 1IYVA 2BE5C 4IUVA 2IW3A 3HZXA 2Q8RE 4H0LC 3FEWX 1EWHA 4C3IB 1WVLA 2D9UA 1U9RA 4ME5A 1HPCA 5T1GA 1PRTD 2SNMA 4NKLA 3PO2B 4S3SA 2F0KA 1WTWA 2R6GA 3D31A 1SMYD 3LNNA 2ZXOA 3I91A 2K5DA 1C48A 2Z8LA 4WRDA 4KMUC 1ESFA 1MBYA 2IX1A 2XSCA 4DF7A 3KLSA 1HFGA 4U673 1SJED 4ZQ3A 1XXGA 3FRPB 3T53B 5IGGA 1PLFA 1EY9A 1EY6A 4L63B 1Q3LA 1U4MA 2H4OA 1JWUD 3GTKB 5J1ZA 3TP7A 1GJXA 5T1IA 2KEEA 3MTSA 1XWEA 3T56B 3A8IE 2OF1A 3ITPA 1LT6D 1LT3D 1F9SA 1WTXA 1SEBD 4DFAA 1RCVD 1B9MA 2EE1A 3Q22A 3HOUB 3KLSX 1RTOA 2B2UA 4F8MA 3Q0AA 2JXMB 1UAPA 4MN3A 2PMZB 1DZ1A 1I4GA 4R8IA 4K8JA 3E6ZX 2WKDA 5EGTA 4OGQC 5KNCA 1KLUD 1V1OA 2F0DA 3ZYYX 3I73A 2A6HC 3BVGA 1F2ZA 3M4YA 4EQNA 2R93B 5C0XJ 4DXFA 4IUTA 3DWQA 1IKLA 1S4ZA 2AWNA 2R61A 4A3GB 2LKVA 1JICA 5JPNC 5CV6A 2WKCA 3D3RA 2A69D 4DN4M 2PW7A 3NWSA 5BN5A 3HOWB 1S5BD 2FFKB 3A8JE 2R7ZB 4F87A 3VYTA 3J7AV 2CHBD 4ZUIA 3RZDB 1ILPA 4HMIA 4QUFA 2AWOA 4HCEA 4QCLA 5CC4A 1Q1BA 2A74C 1B44D 4IN3A 3HS0C 3EROA 2JA6B 2JA8B 1AZQA 5ELEA 4RFBA 3GD7A 3L3OC 4F7XA 1CFMA 2LFNA 5I6WA 1MI2A 2ZT9C 2LMCB 2KECA 5DAUA 1S5CD 3TP8A 1VF5C 1LTRD 2CQAA 5JVG3 5I6YA 1KLGD 3SDZA 1FD7D 1SJHD 3MXGA 3PIO3 4KKTA 4XT1B 1Y69U 3IL8A 4KKUA 1SYEA 3HOXB 2NN6H 5EKIA 2K1BA 1CT1D 1SYDA 2EYOA 4RHRA 4RGOS 3H6MA 1CZGA 1BR9A 3ERQA 3OMGA 2EPBA 1VCIA 4KHVA 2NN6G 3S1MB 2J4XA 1QILA 2B2VC 3FDTA 3RLFA 1OXUA 1IHZA 4IQZA 2M2LA 1O78A 1UUPA 1CHPD 4LJZC 1EFID 1SFOB 1XYIA 3K5MA 2F0NA 3CKIB 2J0TD 1FGBD 4CHTB 1B1ZA 1PTOB 2JEAI 1AEXA 4RA8A 3KUPA 1V43A 4L6TB 3D4WA 1SNDA 4ILWA 1OXSC 2F0OA 1E2ZA 1EY5A 2QCPX 4RGNA 1GUGA 1ZYRD 1KAAA 3VR2A 2F0SA 3D6WA 3OWFA 4B08A 2A68D 2K5WA 2MPMA 3H09A 1DD2A 2F0UA 1HHVA 3SVMA 1R4QB 2KEDA 2NYZD 3L9AX 5EBDA 1EIGA 1D1IA 2YU9B 1PTOD 3DWPA 2FMCA 3J81L 3CRKC 2YYZA 2WAQB 4KN4C 3S17B 2XN9C 2EY2A 3F2UA 4KY6A 1RD9D 3OHXC 4JBWA 4EVOA 3GP7A 1RJTA 2L55A 1IL8A 5KIXA 2NTTA 1M4VA 3T4AC 4G7OC 1M8AA 4RCNA 3C3LA 5EJWA 2EOTA 5IT9L 3URYA 3LWUA 1F77A 1PTOF 4NW2A 3VR3A 5M9OA 2Z4HA 1SE2A 3K5NA 1LTBD 4C3JG 4A3EB 2E76C 2K6AA 5JJZA 2RVLA 4V190 1TWFB 4A3DB 1D5ZC 2ICIA 4ZKBB 5EKKA 1A2UA 3S1RB 2D2CC 3L7ZC 4KI0A 1EY0A 4YIJA 1EOTA 3ND9A 3OSOA 2FMMA 3QWNA 3RD4A 4KJOA 3NK9A 1NAPA 2ICEC 2PYKA 1FYCA 1QWYA 3VA5A 1SXTA 2E2DC 3G7LA 5JOBA 1DM0B 1PTOH 2F0JA 1KNAA 1EL0A 2DNCA 1I4PA 3S2HB 2L9HA 3I90A 4M8AA 3PMFA 2F0QA 3CRLC 1TVXA 2K05A 3DXJC 2NVXB 2IJ0A 2XVSA 5C44B 4CKBA 1HRJA 1B4OA 1KNEA 1O7LA 1SNQA 1F2YA 3DEOA 5M3MB 1HTLD 1D5XC 3N6RA 3BYYB 5A2QE 4H44C 2BDOA 4H13C 4DK0A 4NMZA 2EJGC 5K36G 1EU4A 4FVMA 2B2YA 3GTQB 1Q90A 1CZWA 3NSWA 2EY5A 2F3WA 3QB3A 2DN8A 4ZYSA 5FO9B 3OWEB 4PMBA 2NB0A 1SYFA 2B2YC 4C56C 5HURA 1QNKA 5EPLA 2L11A 1S5FD 2QILA 4R9WA 5I9PA 3A7LA 5J39A 3A8KE 4J1MA 3KK7A 2L4NA 4HMJA 3BDLA 1BNZA 5I4DA 1TR5A 5IOCA 4QUCA 2RBMA 4KN7C 1D5MC 1ET9A 5C3EB 1K8MA 4E6IA 3PUYA 4TQUS 5KGUA 3SEBA 5E1FA 1O7ZA 4G7HC 2ID0A 2PPBC 1DONA 1CTMA 2N55A 1JC7A 1NUCA 3SK5A 4K5WA 1JORA 4IURA 5FLXL 4AYBB 2XWJB 3MC0B 4FO2A 4C3IG 4L8JA 3M7GA 3A7AB 3Q24A 3D4RA 3CQZB 2RSNA 5ELFA 5C4ZA 3M3YB 3Q23A 4BA2I 4FXDA 1EEFD 1B3AA 1SDFA 3I8ZA 1F2LA 2WP8J 3MXPA 2M9VA 2XRSD 4BY1B 2L1BA 1OXVA 4NDXA 4WFN3 5C3XA 3LX0A 4ZLTF 2FHTA 3MAQA 1WTPA 1LTSD 5IIFA 4OL7A 4K8IA 3QOLA 3W2DA 1Y8OB 1X3PA 1K8OA 2RDFA 1EU3A 3EA6A 2NVYB 4XDXA 2A6HD 2WV6D 3AMUA 1X3QA 1WTVA 3MEHA 2XWBB 3SXHA 1A3TA 1G6ZA 4I65A 2F0EA 1BBXC 4ABNA 1DJRD 2BA1A 3BVZA 2NWGA 4G7ZC 1PZJD 3R93A 5G3LD 5EBCA 4QMGA 4XQNA 2HDMA 1PFBA 3N52A 4MIUA 5D3IB 5IGFA 1WTOA 1B53A 3KBXA 1KDBA 3SE0A 1PRTB 2K28A 2B8GA 3S15B 1PFMA 4A3JB 2RQXA 4K5VA 1BO0A 4LMQD 5CMDA 3TBIB 1U4LA 2I46A 2MUYA 2QKIC 1AP0A 3OW7A 2IX3A 1ESRA 5CORA 1PTOC 1F9QA 1JCKB 5I9OA 1ENAA 2ZXPA 1QB5D 3IFDA 2E74C 5JVH3 2Z4IA 3I4MB 1EEID 1O80A 1LT4D 2CW0C 3TP6A 2O4XA 3MFYA 2X6GA 1Z47A 3K0YA 1OO9B 1MSGA 3PV0A 4DU9A 2VUMB 1V8QA 1Z7TA 4RGTA 2A69C 1T5EA 1AW7A 4K2LA 2K5QA 1CM9A 1A6XA 1ONLA 5M5XB 1JE4A 1H9MA 1Q8IA 1AN8A 1ML0D 1TIID 4KKSA 3HOVB 4CKCA 5CGKA 3IAYA 4IUUA 2E2HB 3GTMB 2IL8A 3OMCA 1A15A 3NTKA 4KV6A 4KY5A 4QF4A 5NUCA 2HCCA 1G2TA 1IW7C 2HQEA 2BE5D 4KK7A 4RCOA 3WOEA 2EYJA 1H9SB 1BOSA 2RDHA 4ZAIA 4HR7B 4C2MB 2K01A 5E4XA 4KHZA 1STNA 1IW7D 1I4HA 4DK1A 5BN4A 5IT9E 3TMEA 3RMHA 3I70A 3TN2A 4C3HB 4HEDA 5D3DA 4CJ2C 1VF7A 2JYOA 3PO3B 2B8FA 1SNPA 1RDPD 5D65A 3FPPA 5C3WA 5ELBA 4R8NA 2K7VA 3HOYB 4A3FB 3GTOB 1HFNA 5KYLA 4ULLA 2DY7A 4LAAA 3RUZA 1G291 2SEBD 3T51B 1X32A 4IZ8A 4DGZA 1I4QA 5LHY1 5COYA 1AZPA 4OHJA 1BDOA 4K6DA 2K33A 2EVBA 2C9OA 3V2TA 2F03A 4XQQA 4I7ZC 3ONAB 5EQ0A 1GUWA 3HEJA 1I6HB 1BUVT 1I50B 3CHBD 2HCIA 4Z9CB 3D6CA 3VYRA 3FMCA 1STBA 5D14A 1Y8NB 4K14A 4C1NK 3Q6SA 2EY6A 4ZRZA 3SK6A 1STGA 2XIWA 3T16A 1S5DD 2MJ8A 1E2VA 1PZID 1NSNS 4NP5A 5DM63 5A2QL 4Q5VA 2AUKA 2RSOA 1ENFA 1AFPA 3MZ5A 3SHLA 5KRUA 2E2IB 1GXDC 1FNUA 4CBVA 1TS5A 2JE6I 4XYQA 2G9HD 1STYA 5DEHA 5C6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGD A;  3TME A;  1SYC A;  4KY6 A;  3TP5 A;  3H6M A;  1U9R A;  4B9X A;  1SYB A;  3ERQ A;  1SNC A;  3NQT A;  4NMZ A;  2EYM A;  3NXW A;  2F0V A;  4EVO A;  4ME5 A;  5C4Z A;  1SNO A;  2F0T A;  4IAL A;  5C5M A;  1SYG A;  2KQ3 A;  2SNM A;  4NKL A;  2F3V A;  5KIX A;  3OMG A;  2F0F A;  2F0K A;  1EQV A;  4S3S A;  5I9O A;  1II3 A;  2OXP A;  1ENA A;  1SNP A;  2LKV A;  3MXP A;  4KHV A;  3C1F A;  2EYP A;  2EY5 A;  1KDC A;  2SOB A;  5C3W A;  5CV6 A;  5CV4 A;  4R8N A;  2EYF A;  3P1H A;  4WRD A;  2F3W A;  4ID6 A;  4NDX A;  5C5L A;  5C3X A;  3LX0 A;  5KYL A;  3QB3 A;  4K5X A;  5K5P A;  3S9W A;  4PMC A;  2PW7 A;  3P75 A;  1EYC A;  1KDA A;  4LAA A;  3TP6 A;  2O4X A;  1EYA A;  3RUZ A;  5IGE A;  1ENC A;  5IOD A;  3DHQ A;  4PMB A;  4EQP A;  5M9O A;  2EYL A;  3D8G A;  4EQN A;  1SYF A;  4RKL A;  4IZ8 A;  2NUC A;  1IHZ A;  3C1E A;  4DGZ A;  5IIF A;  4DF7 A;  1SNM A;  5HUR A;  4N9P A;  4DU9 A;  4OL7 A;  4ZUI A;  5IGB A;  4K8I A;  4WOR A;  3NP8 A;  2EY1 A;  4EQO A;  1TT2 A;  3BDC A;  4ZQ3 A;  4HMI A;  2EXZ A;  3QOL A;  4K6D A;  2WAC A;  2F0N A;  3V2T A;  5EKK A;  1EYD A;  4K2L A;  5HGT A;  4G57 A;  1A2U A;  5IGG A;  4RKB A;  4KJN A;  2RDF A;  1AEX A;  1EY0 A;  4YIJ A;  1EY9 A;  1JOK A;  3HEJ A;  1EY6 A;  3MVV A;  5CC4 A;  2F0P A;  1EZ8 A;  1JOO A;  3OSO A;  4K2K A;  2F0G A;  5CV7 A;  4KJO A;  3NK9 A;  3ERO A;  5I9P A;  5C6A A;  1EY4 A;  5J39 A;  4J6H A;  3D4W A;  4KY7 A;  1SND A;  1F2M A;  2EYH A;  2PYK A;  2PZW A;  3D6C A;  3QOJ A;  4J1M A;  3EVQ A;  3MEH A;  5IGC A;  3VA5 A;  4F7X A;  2QDB A;  2F0O A;  5J22 A;  5J1Z A;  1STH A;  3E5S A;  3TP7 A;  3DMU A;  3SXH A;  1A3T A;  1EY5 A;  1EZ6 A;  5I6W A;  4HMJ A;  2F0E A;  1STB A;  4I65 A;  4KD3 A;  3SK4 A;  5CGK A;  2OF1 A;  4K14 A;  5JOB A;  3BDL A;  3ITP A;  2PZU A;  3T13 A;  1A2T A;  1KAA A;  1TR5 A;  2EY6 A;  2KHS A;  5DAU A;  5IOC A;  1KAB A;  1A3U A;  3SK8 A;  4TRD A;  2F0J A;  3R3O A;  3OMC A;  5CV5 A;  3SK6 A;  4DFA A;  1STG A;  5F2D A;  3NHH A;  3T16 A;  2F0S A;  4KV6 A;  1EY7 A;  2F0W A;  1RKN A;  2RBM A;  3OWF A;  4H7B A;  4KY5 A;  4QF4 A;  5CV9 A;  5NUC A;  3NUC A;  1STA A;  3TP8 A;  5ISR A;  1JOQ A;  2HQE A;  2M00 A;  4QMG A;  4KTA A;  2F0U A;  2F0L A;  3U9O A;  5I6Y A;  5E3F A;  4E6I A;  4F8M A;  5KEE A;  1NSN S;  4KD4 A;  2ENB A;  1TQO A;  2F0H A;  3EJI A;  3PMF A;  4MIU A;  2F0Q A;  4NP5 A;  2EYJ A;  2RKS A;  5KGU A;  3MHB A;  5EKL A;  5IGF A;  1EY8 A;  2OEO A;  5E1F A;  1KDB A;  3MZ5 A;  4ODG A;  3SHL A;  4K8J A;  5KRU A;  2PQE A;  4PNY A;  4ZUJ A;  5JAV A;  2F0M A;  3HZX A;  5EGT A;  5C4H A;  5CV8 A;  2F0I A;  4QB4 A;  1SNQ A;  2SNS A;  1NUC A;  3SK5 A;  1F2Y A;  4N9T A;  2PW5 A;  2F0D A;  1STY A;  5KYI A;  1STN A;  1SYE A;  4HTH A;  4B9W A;  4K5V A;  4K5W A;  5CR3 A;  2PZT A;  3D4D A;  5DEH A;  3SR1 A;  2EY2 A;  1JOR A;  4IUN A;  1SYD A;  2EYO A;  1A3V A;  1F2Z A; 
#chains in the Genus database with same CATH topology
 1IBM L;  1KC8 C;  3CU7 A;  1VMC A;  2EYM A;  3VA7 A;  2F0V A;  1QG7 A;  1LTA D;  5JPM C;  1GUO A;  4C3J B;  4BY7 B;  3ULL A;  2B2U C;  3I7F A;  4QIW B;  2DY8 A;  1EQV A;  1W3S A;  5C44 H;  1WD1 A;  2OXP A;  2VQF L;  2B2W A;  3CPF A;  5GQO A;  1FNV A;  1VDZ A;  4JI8 L;  2C5C A;  1ZXT A;  3CME A;  2B39 A;  2MGS A;  1V1P A;  3P1H A;  2RA4 A;  4JK1 C;  2J7Z A;  2NN6 I;  2TMP A;  1MJC A;  4DUZ Q;  1O7I A;  5AJ3 L;  2RCN A;  1TWH H;  2H1E A;  4C3H H;  1YIT A;  1K28 A;  3J81 j;  3EFX D;  1QCB D;  1R9T B;  5IGB A;  1CHQ D;  2UXB L;  2EY1 A;  2UUA Q;  5FLM G;  4IPC A;  3VYS A;  5IY0 A;  4IUQ A;  3MWY W;  3HOY H;  1H9R A;  1WTQ A;  1FJG L;  3MA2 B;  1CK1 A;  2KBN A;  3S24 A;  1EY4 A;  3GTG B;  3K5O A;  3LWE A;  3HKZ G;  3U9S A;  1T5X D;  4ZK9 B;  3V96 A;  5CBE E;  1XMO Q;  2ASB A;  2PO4 A;  3SK4 A;  1HZB A;  1I4X A;  1DXM A;  2R93 G;  1BF4 A;  4C1N I;  4UAI A;  1A3U A;  2JJQ A;  1S5E D;  3S2D H;  4BS9 A;  4APV A;  3S14 B;  3NHH A;  1BCP B;  2EJF C;  2A19 A;  5CV9 A;  3CCL A;  1JT8 A;  4DAY A;  4RH6 A;  3EN2 A;  3PF4 A;  1STE A;  1LLR D;  1UEA B;  2B2V A;  5M3M G;  1DGS A;  1JQY D;  2IT1 A;  3R2T A;  1YNN C;  3X3N A;  2KA7 A;  3M85 A;  5FLX E;  1BCP F;  1K83 B;  4G4K A;  1UEB A;  3KF6 B;  4OO1 G;  2NTS A;  5LMN Q;  3P20 A;  1XPU A;  1QJO A;  3TQY A;  2ES2 A;  3IRB A;  2F0I A;  1GUN A;  4IPD A;  1WD0 A;  3D4D A;  2HT1 A;  4IUN A;  1PDQ A;  2AQ2 B;  3AB9 A;  1TS2 A;  5IGD A;  5C0X I;  1SNC A;  3NXW A;  4JV5 Q;  3BYT B;  4R4I A;  3PO2 H;  5C5M A;  3HOV H;  1RHP A;  1G8Z D;  3HOZ H;  4FYD A;  2Q8I B;  3L2P A;  4ZCK A;  3CCE A;  3HOZ B;  3RZD H;  3SGI A;  2K52 A;  4FF2 A;  3S1Q B;  3C1F A;  5C0X H;  4A3K B;  3G71 A;  1I50 H;  3I4M G;  1HZC A;  1EQQ A;  4OWT B;  4ID6 A;  4B3R L;  3S9W A;  4CKE A;  3K57 A;  2JA8 H;  4L5T A;  3A74 A;  3JAM E;  4EGV A;  5EPK A;  5IOD A;  2E75 C;  3D8G A;  2O2L D;  1D7Q A;  1OXT A;  3C1E A;  4RMF A;  3STB C;  4LF9 Q;  5M5X H;  2VUM H;  3HG9 A;  4DAP A;  3C46 A;  4LF5 Q;  3FPU B;  1EYD A;  1DCZ A;  1XNQ Q;  2L5T A;  2JA7 H;  1D1K A;  3UDX A;  4K2K A;  4JYA Q;  1TS4 A;  2VXW A;  1F2M A;  2EYH A;  2B63 B;  5JEA H;  3EVQ A;  4X3U A;  2QDB A;  4JI6 L;  4FNF A;  1EZ6 A;  3IFT A;  2A68 C;  1TKW B;  1FR3 A;  4A93 B;  4MHE A;  2Q2U A;  1YHB A;  2BH2 A;  4MNO A;  4DV0 L;  5F2D A;  1YHA A;  2EDG A;  3NEM A;  1TWA B;  4PZ6 A;  2UXC Q;  1RKN A;  1LT5 D;  2BCO A;  2CVR A;  2Z6B A;  1B9N A;  1SBB B;  1JOQ A;  1TY2 A;  2Z6K C;  1TXY A;  4KTA A;  3I4N G;  3GO5 A;  2QW7 A;  4LF8 L;  2ZTD A;  2UUA L;  4A3M H;  4LF6 Q;  3CMA A;  3EJI A;  4PMW A;  1MD2 D;  4X65 L;  5EKL A;  1IBK Q;  1FGU A;  3FKI B;  1IL2 A;  1X3F A;  5JAV A;  1KHI A;  4X65 Q;  4X62 L;  1BVS A;  4JG2 A;  1EIY B;  1K9M C;  2OTJ A;  1I3Q H;  3VR6 A;  3SR1 A;  4X3K A;  5KNB A;  1XTC D;  1LTI D;  4Y7N B;  3EQL C;  5GAG C;  4B9X A;  2OWO A;  5K36 H;  3JAM L;  1HNW L;  3O13 A;  4HSP A;  3A5Z B;  4POG A;  1IYU A;  2KQ3 A;  3TRE A;  5LMU Q;  3WDN A;  5I2X A;  3J7A 5;  1II3 A;  2A8V A;  3P7J A;  3HOU G;  3FP9 A;  4F88 A;  2NVT H;  3NTH A;  1Y14 B;  1ICW A;  2F52 A;  2VQF Q;  2X6L A;  5AFW A;  4DV6 L;  2OTL A;  1NCV A;  2R92 B;  2ZJR A;  4YWK A;  2YV5 A;  2A6E C;  2O5J C;  1ENC A;  2RCF A;  3A54 A;  3ND8 A;  3R2I A;  1CI3 M;  5JEA J;  4JI7 L;  2NZ1 D;  2E2H H;  3K5L A;  2E5L L;  1R4P B;  2IWH A;  4L5R C;  3NBI A;  1XMQ Q;  2GVB A;  1BXT A;  1UE6 A;  4LUZ A;  1N32 L;  1X65 A;  2G9D A;  1VQF A;  3TDQ A;  5CV7 A;  5FKA C;  4CJ0 B;  1SN8 A;  2XRQ D;  2KCN A;  1Y1W G;  3PIP 3;  2JA9 A;  4GS3 A;  1ZKO A;  2KCC A;  3TZU A;  4OIK A;  4A3K G;  1LAB A;  4KD3 A;  5LL6 X;  3GQB A;  4U68 A;  1LUZ A;  4DNT B;  4GKK L;  3E9H A;  1PRT F;  5BR8 Q;  1UE7 A;  1LM0 A;  1JB3 A;  2AMC B;  4BBS B;  4A76 A;  2JA6 H;  3GV6 A;  5ISR A;  1BKB A;  4DK3 C;  3TSS A;  2KVM A;  2FXQ A;  2QF7 A;  4FXG C;  5DLQ E;  4KD4 A;  2ENB A;  2F0H A;  3MHB A;  2L12 A;  1CQF A;  1ET6 A;  3QG1 A;  3UDI A;  2ZM6 L;  2F0M A;  1NY4 A;  1KXL A;  5I2Y A;  2JA8 G;  2HDL A;  1Y1W B;  3K7U C;  4A3I B;  1KD1 C;  3F2D A;  4B9W A;  3I4L A;  4B3M L;  4RWS C;  4TKO B;  2KCT A;  5DNF A;  3HFZ B;  1GOZ A;  4I7A A;  4AQY L;  4IFD G;  3RZO B;  2KUM A;  4X64 L;  2JQO A;  3B6Y A;  2JSO A;  1TY0 A;  4N8X 1;  1SYG A;  1PMR A;  1LV9 A;  1VQ7 A;  4AQY Q;  1H95 A;  3VR5 A;  2KJX A;  4DUY Q;  4CDD C;  2HIX A;  1YNJ D;  2FIN B;  2AHO B;  1VQB A;  2SDF A;  4HJA A;  1MSH A;  1KQS A;  4X3S A;  4CDC C;  1H9S A;  1SE4 A;  5K5P A;  4GOP C;  1EYC A;  1KDA A;  5IGE A;  3OIP A;  1L0W A;  2K5V A;  2KOL A;  1K8A C;  2UUB L;  4OO1 H;  3H0G G;  1W6K A;  4JVZ A;  1SNM A;  4WJW A;  4X62 Q;  1H9J A;  4AH6 A;  3H3V C;  4EQO A;  3J80 L;  1RIP A;  1NBW A;  1GHJ A;  3KLR A;  1YI2 A;  1I6V C;  1WTR A;  3OOC A;  4CGY B;  3JAM i;  3GTJ H;  3MVV A;  2Y0S G;  4M1U B;  3ER0 A;  5KND A;  5G3L F;  4OIJ A;  1X56 A;  3UE0 A;  3HKZ B;  4KY7 A;  1U4R A;  3HRZ C;  3PUW A;  3K58 A;  2JP1 A;  3QJY A;  1PA6 A;  1JR0 D;  1HUM A;  4DNR B;  1STH A;  3E5S A;  4DR7 L;  1LO5 D;  1PFN A;  1OTC A;  4GZY C;  1YZ6 A;  3WOF A;  4TRD A;  2QEX A;  3BS1 A;  3BZD B;  1D6E C;  1YJW A;  4LFB L;  4DR1 L;  1HR0 W;  1L0X B;  3CC7 A;  1PXU A;  3UDG A;  1I6H H;  3H0G B;  3L0O A;  1OXX K;  4XQJ A;  2OQK A;  2B2T C;  3KDF B;  3H91 A;  5TSS A;  5CBA E;  3S16 B;  1BBW A;  3K81 C;  3RZO H;  3J7Y W;  1HA5 A;  3DWA A;  2HIV A;  2TSS A;  2RKS A;  1PZK D;  3VDY A;  3K7A B;  1DYQ A;  5CYU A;  1PH9 A;  3K6O A;  4C3H G;  4PNY A;  4UDU C;  4OO1 I;  3S1N B;  1C7Y A;  4LUO A;  3NTI A;  1VQ4 A;  2WIN B;  1XMQ L;  2PW5 A;  3UE1 A;  1E1T A;  2MO0 A;  3MEF A;  2RHS B;  3BVM A;  4BA1 I;  3J81 c;  1SYC A;  4RGM A;  3TP5 A;  1SYB A;  4JI3 L;  2EIF A;  3CQZ H;  1SNO A;  2E2J H;  3GV3 A;  4BBS G;  4A3C G;  4A3G G;  1HNW Q;  1XJV A;  5FO7 B;  2F0F A;  2I0Q A;  4PZ8 A;  1YNN D;  4K0K L;  2GN5 A;  4IFD H;  5C5L A;  1I4R A;  4C3I H;  4A3F G;  1EYA A;  1VQL A;  4DR2 Q;  4EQP A;  3JAM c;  1TWH B;  4PG3 A;  4RKL A;  1VQM A;  2HUG A;  5E4W C;  4OX9 L;  3U50 C;  3AQQ A;  2NZO A;  2WAC A;  1WOC A;  4XYO A;  4G57 A;  1V1P B;  4KJN A;  4UPA A;  3HKZ E;  3RLO A;  1JWM D;  5M5W B;  1EZ8 A;  1SE3 A;  3VR4 A;  2Z6K A;  1TWC B;  2MP1 A;  5EPJ A;  2GA4 B;  2K14 A;  4BBR B;  4J6H A;  1B2T A;  2B63 H;  3NE5 B;  4DV4 L;  4FF3 A;  2BDN A;  3UI2 A;  3AU7 A;  4FDB A;  3ZJY C;  1D2B A;  4A3E H;  4JI2 Q;  1PYS B;  4DUY L;  3DMU A;  2D62 A;  2AQ1 B;  4P73 A;  3M9B A;  3T1H Q;  2JK8 A;  2AUJ D;  1J9O A;  1W6J A;  2KHS A;  3H3V H;  1KAB A;  2PMZ E;  1B8A A;  2DGY A;  3CCV A;  1Q82 C;  5C4X B;  2O5I C;  2NVT B;  4K6L A;  4A3K H;  1YNJ C;  1LAC A;  4HN7 A;  3M7N A;  1PRT C;  2N88 A;  2VB3 X;  3STB D;  4DV5 L;  4A3E G;  1EY7 A;  2F0W A;  2JA5 B;  3I4N B;  1VQ5 A;  1B70 B;  2M00 A;  1BCP C;  3U9O A;  2F0L A;  1HNX L;  3TEH B;  4A3D G;  1IXR A;  1YIJ A;  5E3F A;  2K50 A;  2OT2 A;  5KEE A;  1TQO A;  1QOH A;  2V4D A;  2IPK D;  4NXM Q;  1DOM A;  1L1O B;  1PH8 A;  1NNX A;  2PQE A;  1ROD A;  2UUB Q;  5C4J B;  2E2I H;  4R1J A;  2Q8T A;  4B3T Q;  4YWL A;  3MFG A;  4DV2 L;  3KFU A;  4FF4 A;  3HOX G;  1GHK A;  3IKJ A;  3I4M H;  5CR3 A;  2K75 A;  2VY3 A;  1BCP D;  4P2C B;  4TSS A;  5C0X G;  5JJL A;  1TS3 A;  5ELD A;  5LL6 S;  1A3V A;  2X69 A;  2E8G A;  1VQJ A;  1HXY D;  2G5D A;  3G6J B;  4A3M B;  1B50 A;  3OPO A;  3J81 i;  2JEB I;  2MFI A;  1E0B A;  4BXX G;  2IX0 A;  3F2C A;  1QNU A;  1J5E Q;  4A3G H;  5M5Y B;  5GAE C;  3KF8 A;  3S2D B;  5CV4 A;  4ZKC B;  3GTL B;  5IYC G;  1QVF A;  2QA4 A;  1F9R A;  5A35 A;  1TU2 B;  4O1N A;  1SRU A;  1XNR Q;  4UP7 A;  1BQQ T;  1C8C A;  5M3F B;  2VB2 X;  2EXZ A;  3U4V A;  1J8I A;  1EQR A;  4RKB A;  2CH4 A;  1E2W A;  1EWC A;  1JOK A;  4AYB G;  4DUZ L;  2F0P A;  5FOB B;  4A3M G;  4O42 A;  2MQH A;  4JI3 Q;  2CW0 D;  1PYW D;  1Y8P B;  3BJU A;  4XT3 B;  1C0A A;  2PZW A;  3NWT A;  3PF5 A;  1MGS A;  1H9K A;  4KHP L;  1MKH A;  1Z6H A;  3TZD A;  1GM5 A;  1X3G A;  2LY7 A;  2PZU A;  2KHI A;  1A2T A;  3FVQ A;  3MXU A;  5HGQ A;  4UY8 C;  2DJG C;  4KHP Q;  1F9P A;  2L0C A;  4QJF A;  1J5E L;  1IBM Q;  1O7Y A;  2JA7 B;  1SLJ A;  2QEJ C;  4X66 L;  2R7F A;  3S17 H;  1ILQ A;  1WTH A;  5JEA G;  4DAY B;  4NB3 A;  5IYB G;  5DM7 3;  4XTC S;  4FF1 A;  5M3F G;  3J7A F;  1HUN A;  1WYD A;  4V0B A;  1TWG B;  1C4Q A;  2D5D A;  1CQV A;  4LK1 C;  1V9P A;  3HP3 A;  4IFD J;  1PHJ A;  2BA0 A;  1QVG A;  3DUZ A;  4FP5 D;  4IUP A;  3A5U A;  4ZUJ A;  4DV1 L;  2NBF A;  1SAP A;  5C4H A;  5CV8 A;  1VQK A;  1IKM A;  2VUM G;  1LTL A;  5LMN L;  2SNS A;  3QIA A;  1CA6 A;  4DV7 Q;  4GOP A;  2B2W C;  2PZT A;  3GTP B;  3OW2 A;  1JWS D;  4OON A;  2RF4 A;  4GLV B;  3RN5 A;  1G91 A;  2PNR C;  1LTG D;  2WB1 B;  5FK9 C;  1HJP A;  3NQT A;  4DAV A;  3DEP A;  3W1G A;  2F0T A;  4FXK C;  1G51 A;  1HTP A;  4QY7 A;  1VMP A;  3M3Y H;  1HNZ Q;  4L5Q A;  2WII B;  3HOZ G;  1FJG Q;  3HOV G;  4DR3 L;  4RG1 A;  4X3T A;  4A3L H;  2EYF A;  4GN5 A;  3TS0 A;  1XMO L;  4TVA B;  4K5X A;  3GTP H;  1N34 L;  3AYH B;  3P75 A;  1PH4 A;  2ZXR A;  1EIH A;  3I3C A;  2YU9 H;  2EJM A;  3I4O A;  3I72 A;  4PQX A;  4N9P A;  2NVQ B;  1HQM C;  4WOR A;  2D0O A;  5IYD H;  4HAE A;  1TT2 A;  3BDC A;  2E2J B;  5M3F H;  4A3B B;  2BOS A;  3K59 A;  1LTT D;  1VQ9 A;  2PCF B;  1YVC A;  2Y0S E;  4JI1 L;  3NEL A;  2XNA C;  2Y0S B;  3PUV A;  1JOO A;  1VQD A;  2K04 A;  3PUX A;  1UNS A;  5H1S E;  2F0G A;  1CA5 A;  4XXE A;  5M5W H;  5BN3 A;  1Q1E A;  1VQN A;  2EZV A;  1SR3 A;  4R4T A;  1HA6 A;  1M90 C;  5IGC A;  5J22 A;  4B3M Q;  3M4O B;  2A73 B;  3CC2 A;  4ME3 A;  3C2P A;  3HOW H;  1K73 C;  1RTN A;  4YY3 Q;  4JI6 Q;  3NPP A;  3OYY A;  3PUZ A;  1KIX A;  2DNE A;  1L1O A;  1XTD A;  4X64 Q;  4MZ9 A;  3SK8 A;  3RLN A;  1HNZ L;  4XIG S;  4JYA L;  5IE8 A;  2VNU D;  2CKZ B;  1E22 A;  4YHH L;  4BY7 G;  4OWW B;  4RAU C;  4CJ1 B;  1Y1W H;  3NUC A;  1N36 L;  1Q12 A;  3BDO A;  4DV3 Q;  2Z1C A;  5GRO A;  1Y1V B;  1WJJ A;  3R8B A;  1EWI A;  4LF4 Q;  3CCS A;  4LF8 Q;  5FJ8 G;  1HCZ A;  4LF6 L;  1KTK A;  4ODG A;  1VQ8 A;  1NMF A;  3HGB A;  1TWF H;  4NXM L;  1AE3 A;  4LF4 L;  3NBH A;  1QE6 A;  1DOL A;  3DLL A;  4QB4 A;  4JBJ A;  4N9T A;  4RHS A;  5KYI A;  4HTH A;  1HZ9 A;  1ZYR C;  1Q81 C;  2A5H A;  4HJ7 A;  1XPR A;  4IFD I;  3HKS A;  3J80 i;  1S3O A;  4DA2 A;  2F1M A;  2C35 B;  3H94 A;  3V05 A;  1X9N A;  3J81 E;  2F4I A;  1PV4 A;  2F3I A;  1DOK A;  3BG3 A;  3OIQ A;  4IAL A;  4GLX A;  1GUS A;  3KJO A;  1FNW A;  1WCM B;  2F3V A;  5FO8 B;  2IY5 B;  4NPS A;  5C4J H;  2K03 A;  1IYJ B;  3J80 E;  2UUC L;  2EYP A;  2K32 A;  1KDC A;  2SOB A;  1I3Q B;  2B2T A;  3GTJ B;  3A56 A;  4PMC A;  1SSO A;  2I07 B;  4BWG B;  4DK6 C;  3DHQ A;  1U4P A;  2EYL A;  2NUC A;  1EQT A;  1Q7Y C;  2LXJ A;  4HJ8 A;  3NP8 A;  4J8Q A;  1XX8 A;  1A0I A;  4Q0F A;  1IZ6 A;  4LFB Q;  1ASY A;  1L0Y B;  5HGT A;  2PI2 E;  1VQI A;  3ULP A;  2R3Z A;  2WB1 E;  5AJ3 Q;  3E0J A;  2PNH A;  4PV1 C;  3X3M A;  3I4N H;  2CWP A;  3QO2 A;  3QOJ A;  3DM1 A;  5C3E H;  1HQR D;  1HZA A;  1SMY C;  1EOV A;  2IHF A;  4DXG A;  2FJ2 A;  4YCW A;  2VW9 A;  1GUT A;  5ELC A;  1NR4 A;  3W3A A;  1G2S A;  4HSV A;  3T13 A;  3MXN A;  3RN2 A;  2KCM A;  4UP8 A;  5CV5 A;  3R3O A;  2MHV A;  2I5M X;  2V1C C;  2JA5 G;  1ZEQ X;  4DR4 L;  4HCS A;  3A55 A;  1NR2 A;  4H7B A;  4A3I G;  1STA A;  3KBG A;  2A6E D;  1RF2 D;  2RDG A;  3VYU A;  5LMU L;  4IOA A;  4NXN Q;  2LS0 1;  3CW2 C;  3FKI H;  1VQA A;  4DPG A;  1EY8 A;  2OEO A;  3NQI A;  3MXN B;  1SFO H;  2AQ3 B;  1IYV A;  2BE5 C;  2Z0S A;  4IUV A;  2IW3 A;  3ULJ A;  3HZX A;  1CSQ A;  4AYB E;  2Q8R E;  4H0L C;  2MNA A;  1G6P A;  4PZ7 A;  3FEW X;  1EWH A;  2I5L X;  4JI7 Q;  4C3I B;  1WVL A;  2D9U A;  1U9R A;  2HQL A;  3I2Z A;  1WI5 A;  1BBU A;  4ME5 A;  1HPC A;  5T1G A;  2OQ0 A;  1PRT D;  1JJC B;  5L37 A;  1CSP A;  2SNM A;  4NKL A;  3PO2 B;  1PH2 A;  4YHH Q;  4S3S A;  2F0K A;  1WTW A;  1VS0 A;  2R6G A;  3D31 A;  1SMY D;  3LNN A;  2ZXO A;  3I91 A;  2K5D A;  1C48 A;  2Z8L A;  4WRD A;  1P8L A;  3K80 C;  4KMU C;  1ESF A;  1K0R A;  1MBY A;  3I56 A;  2IX1 A;  2PI2 A;  1NE3 A;  2XSC A;  4OEL B;  4DF7 A;  1HNX Q;  3KLS A;  1HFG A;  4NXN L;  1SJE D;  4U67 3;  4ZQ3 A;  1XXG A;  3FRP B;  3T53 B;  5IGG A;  1PLF A;  4BY1 G;  4QIW E;  1EY9 A;  1EY6 A;  4L63 B;  3H15 A;  1Q3L A;  1U4M A;  2H4O A;  1EIF A;  5M3M H;  2IHE A;  1JWU D;  3GTK B;  2ZM6 Q;  5J1Z A;  3TP7 A;  1GJX A;  2A1A A;  5T1I A;  2KEE A;  4GLA C;  3MTS A;  1XWE A;  3T56 B;  3A8I E;  2OF1 A;  3ITP A;  1PH3 A;  4DR7 Q;  5HY6 A;  1LT6 D;  1K3R A;  4YY3 L;  5ELO A;  1LT3 D;  1F9S A;  4OEM B;  1WTX A;  1SEB D;  2ZTC A;  4DFA A;  1RCV D;  1B9M A;  2F4V Q;  2EE1 A;  3Q22 A;  3ICE A;  5ELN A;  3Q8D A;  4LWC A;  3HOU B;  2EQS A;  3KLS X;  1RTO A;  2B2U A;  1VQP A;  4F8M A;  3Q0A A;  2JXM B;  2R92 G;  1UAP A;  4MN3 A;  2PMZ B;  1DZ1 A;  1I4G A;  4R8I A;  2MO1 A;  4K8J A;  3E6Z X;  2WKD A;  4LNQ A;  5EGT A;  5IYC H;  4OGQ C;  5KNC A;  1KLU D;  1V1O A;  2F0D A;  3ZYY X;  3I73 A;  2A6H C;  2K5N A;  4H02 A;  3BVG A;  1F2Z A;  3M4Y A;  4EQN A;  4B3S Q;  2R93 B;  3K8A A;  2ALY B;  5C0X J;  2HHH Q;  4DXF A;  1PH7 A;  4JI0 Q;  4IUT A;  2P5Z X;  3DWQ A;  1IKL A;  1S4Z A;  2AWN A;  2R61 A;  5M5Y H;  4A3G B;  2LKV A;  1JIC A;  5JPN C;  4WJ4 A;  5CV6 A;  3S15 H;  2WKC A;  3D3R A;  2A69 D;  4DN4 M;  1E3P A;  3JC6 6;  5IP7 H;  2PW7 A;  4JV5 L;  2F4V L;  2KEN A;  3NWS A;  5BN5 A;  3HOW B;  1S5B D;  2FFK B;  3A8J E;  2R7Z B;  2DUD A;  4GN4 B;  4F87 A;  3M4O H;  3VYT A;  3J7A V;  3M4P A;  2UXD Q;  2CHB D;  2YTV A;  4ZUI A;  3RZD B;  1ILP A;  3CF5 A;  2YTY A;  4QL5 A;  4HMI A;  4OX9 Q;  4QUF A;  1JJ2 A;  4A3D H;  4HIM A;  2AWO A;  3E3X A;  4HCE A;  4QCL A;  3FKI G;  5CC4 A;  1JB7 A;  1KRS A;  1Q1B A;  5IP9 G;  2A74 C;  1B44 D;  4IN3 A;  3W1B A;  1Q86 C;  3ERS X;  3HS0 C;  3ERO A;  4EQ5 A;  2JA6 B;  2JA8 B;  4P72 A;  1AZQ A;  1UE5 A;  4P74 A;  5ELE A;  2E5L Q;  4RFB A;  4BBR G;  3GD7 A;  3L3O C;  4F7X A;  5IWA Q;  1CFM A;  2LFN A;  3H3V I;  5I6W A;  1MI2 A;  2ZT9 C;  4DAM A;  2LMC B;  2KEC A;  5DAU A;  1S5C D;  1P16 A;  3I55 A;  5C4X G;  3TP8 A;  1VF5 C;  4GN3 B;  1N32 Q;  1LTR D;  2CQA A;  5JVG 3;  2N3S A;  5I6Y A;  3F1Z A;  1KLG D;  3SDZ A;  1D8L A;  4JCV E;  1LYL A;  1FD7 D;  1Y1V H;  1SJH D;  3MXG A;  4DV0 Q;  3PIO 3;  1K0S A;  4KKT A;  1I94 Q;  4J15 A;  2BH8 A;  4XT1 B;  1Y69 U;  1PFS A;  1A8V A;  3IL8 A;  4KKU A;  3GTO H;  1SYE A;  3HOX B;  2NN6 H;  5EKI A;  2K1B A;  1CT1 D;  3S2H H;  1SYD A;  2EYO A;  4RHR A;  4RGO S;  4JW0 A;  3H6M A;  1CZG A;  4B3R Q;  1BR9 A;  4MTK A;  3ERQ A;  4DV1 Q;  1XNQ L;  3PO3 G;  1J6Q A;  3OMG A;  2EPB A;  1HR0 L;  1VCI A;  1QUQ B;  3KDF A;  4KHV A;  2CQO A;  2NN6 G;  2CFM A;  3S1M B;  2J4X A;  1QIL A;  2ZTE A;  2B2V C;  3FDT A;  2UUC Q;  3EIV A;  3RLF A;  3G4S A;  1OXU A;  1IHZ A;  4HID A;  4IQZ A;  2M2L A;  1O78 A;  1UUP A;  1CHP D;  4LJZ C;  1ICF B;  3KJP A;  4ALP A;  1EFI D;  1K3B C;  1SFO B;  1XYI A;  4DV5 Q;  3K5M A;  3CPW A;  2F0N A;  3CKI B;  2J0T D;  1FGB D;  4CHT B;  1B1Z A;  1PTO B;  2EXD A;  2JEA I;  1AEX A;  1C9O A;  3AFQ A;  4RA8 A;  3S1R H;  1N9W A;  3KUP A;  1V43 A;  2HHH L;  4L6T B;  3D4W A;  1SND A;  4ILW A;  1OXS C;  1I5F A;  2F0O A;  4BY7 H;  1E2Z A;  1EY5 A;  2QCP X;  4RGN A;  1GUG A;  1ZYR D;  1KAA A;  3VR2 A;  5JJI A;  3CCJ A;  1HR0 Q;  3HOW G;  2VQE Q;  4JBK A;  2F0S A;  1WFQ A;  3D6W A;  3OWF A;  2N8N A;  2JA7 G;  4C2M H;  1Z9F A;  1VQ6 A;  4B08 A;  2A68 D;  2K5W A;  2MPM A;  3H09 A;  1DD2 A;  2F0U A;  1HHV A;  3SVM A;  1R4Q B;  2KED A;  2NYZ D;  3L9A X;  5EBD A;  1EIG A;  1D1I A;  2YU9 B;  3RNU A;  4MTN A;  1PTO D;  4C3J H;  3DWP A;  2FMC A;  3J81 L;  3AFP A;  5BR8 L;  4DV6 Q;  3BZC A;  3CRK C;  2YYZ A;  2WAQ B;  4KN4 C;  3S17 B;  2XN9 C;  2VL6 A;  1X55 A;  1SE8 A;  2EY2 A;  3F2U A;  4AIM A;  1JMC A;  4KY6 A;  1RD9 D;  3OHX C;  4JBW A;  1B7Y B;  4EVO A;  3W5O A;  3GP7 A;  1RJT A;  2I5H A;  3PO2 G;  2L55 A;  1IL8 A;  5KIX A;  2NTT A;  5LMN W;  1M4V A;  3T4A C;  4JI4 Q;  4G7O C;  1M8A A;  4RCN A;  4A3C H;  3C3L A;  1EFW A;  2K5H A;  2EOT A;  5EJW A;  3RR5 A;  1V1Q A;  3A0J A;  5IT9 L;  3URY A;  2Q2H A;  3LWU A;  4JOI C;  1F77 A;  1UE1 A;  1GKH A;  1PTO F;  4NW2 A;  1E24 A;  3VR3 A;  4DR6 L;  5M9O A;  4LUV A;  2Z4H A;  1SE2 A;  1LTB D;  3K5N A;  1ASZ A;  1MJE A;  4C3J G;  4A3E B;  2E76 C;  2CCZ A;  3T1Y Q;  1TWG H;  4DR6 Q;  2K6A A;  5JJZ A;  2RVL A;  4V19 0;  1TWF B;  5GAH C;  3TS2 A;  4A3D B;  3U4Z A;  1KRT A;  1D5Z C;  2ICI A;  4ZKB B;  4DR4 Q;  5EKK A;  1A2U A;  3S1R B;  4P71 A;  2D2C C;  3L7Z C;  4KI0 A;  1EY0 A;  4YIJ A;  2OCE A;  3OTO Q;  1EOT A;  4O2D A;  3ND9 A;  3OSO A;  2FMM A;  3QWN A;  3RD4 A;  4QQB X;  4KJO A;  3NK9 A;  3PGZ A;  1NAP A;  2ICE C;  5IYB H;  4K0K Q;  1IBL L;  2PYK A;  1GO3 E;  1FYC A;  1QWY A;  3VA5 A;  2R93 H;  3NEN A;  1SXT A;  4GOP B;  2E2D C;  4HJ5 A;  3G7L A;  4DR2 L;  1CKN A;  5JOB A;  4IPH A;  1DM0 B;  4GKJ Q;  1PTO H;  1YNX A;  4GNX A;  1FL0 A;  2F0J A;  1KNA A;  1EL0 A;  3J80 c;  2PQA B;  2DNC A;  1I4P A;  3S2H B;  2L9H A;  3S16 H;  3I90 A;  5FLM H;  4M8A A;  3PMF A;  2F0Q A;  3CRL C;  1TVX A;  2K05 A;  3DXJ C;  1W2B A;  2NVX B;  4YCU A;  2IJ0 A;  2XVS A;  1WCM G;  1A62 A;  4CKB A;  5C44 B;  3NBH B;  1HRJ A;  1B4O A;  1N34 Q;  1KNE A;  1O7L A;  1NTG A;  1SNQ A;  3S1N H;  3H0G H;  1F2Y A;  3DEO A;  4N8F A;  5M3M B;  1HTL D;  3CCM A;  1D5X C;  4DV3 L;  3N6R A;  3HOU H;  3BYY B;  4H44 C;  5A2Q E;  4P75 A;  2BDO A;  4DR5 L;  4LF7 L;  4H13 C;  4LFC L;  4DK0 A;  4NMZ A;  2JN4 A;  5GAD C;  1CKM A;  1VQG A;  2EJG C;  1X6O A;  5K36 G;  4DR5 Q;  2PQA A;  1EU4 A;  3E9I A;  4FVM A;  2B2Y A;  1VQH A;  3GTQ B;  1Q90 A;  1CZW A;  1IBK L;  4BXX H;  1PH6 A;  1AH9 A;  4LF5 L;  3NSW A;  2EY5 A;  2NVY H;  2R7D A;  3CCU A;  2F3W A;  4LW1 A;  3QB3 A;  3QR8 A;  2DN8 A;  4ZYS A;  5FO9 B;  3OWE B;  4A75 A;  4PMB A;  1U5K A;  1E1O A;  2NB0 A;  1SYF A;  2B2Y C;  2UU9 L;  4C56 C;  2CWA A;  3PIO A;  5HUR A;  2B29 A;  2XTI A;  4DNI A;  3GTM H;  1QNK A;  5EPL A;  1L2F A;  3F8T A;  1AE2 A;  1NJI C;  2L11 A;  4Y52 H;  1S5F D;  2NZH A;  4O0A A;  4A3I H;  4HJ9 A;  2QIL A;  5C4X H;  4R9W A;  3CP0 A;  5I9P A;  3A7L A;  5J39 A;  3A8K E;  4J1M A;  3KK7 A;  4A3J G;  4JOI A;  2L4N A;  4JI4 L;  4HMJ A;  4LF7 Q;  3BDL A;  4R4O A;  1BNZ A;  5I4D A;  1TR5 A;  5IOC A;  1XNR L;  2HD3 A;  4QUC A;  4A3J H;  2RBM A;  4KN7 C;  4DV4 Q;  1X54 A;  2VQE L;  2B63 G;  1D5M C;  1ET9 A;  5C3E B;  1K8M A;  4E6I A;  4EX5 A;  3PUY A;  4TQU S;  1N33 L;  4YCV A;  3KLW A;  4GNX B;  5KGU A;  4A93 G;  3SEB A;  5E1F A;  2NVQ H;  1O7Z A;  4G7H C;  4GNX C;  4A4I A;  1K8G A;  4X66 Q;  2ID0 A;  1M1K C;  2PPB C;  1DON A;  1VQE A;  1CTM A;  2N55 A;  1KL9 A;  1JC7 A;  1NUC A;  3SK5 A;  5EAY A;  4K5W A;  1JOR A;  4R4C A;  4A3F H;  4IUR A;  5FLX L;  4AYB B;  2XWJ B;  3MC0 B;  4FO2 A;  4C3I G;  3EBE A;  4L8J A;  3M7G A;  1B3Q A;  3A7A B;  3D4R A;  3CQZ B;  5ELF A;  2RSN A;  5C4Z A;  3Q24 A;  1VQO A;  3M3Y B;  3Q23 A;  4BA2 I;  4IPG A;  4R4Q A;  4FXD A;  1EEF D;  3DM3 A;  1B3A A;  1SDF A;  4JPB W;  3I8Z A;  1F2L A;  2WP8 J;  3MXP A;  2QGQ A;  4BBS H;  2YTX A;  4WJ3 M;  2M9V A;  2XRS D;  4GKJ L;  4BY1 B;  2L1B A;  1OXV A;  4NDX A;  4WFN 3;  2AKW B;  3BU2 A;  5C3X A;  3LX0 A;  4ZLT F;  2FHT A;  1VQC A;  3KYH C;  1XPO A;  1NMG A;  4LFA L;  3MAQ A;  1WTP A;  4DKA C;  1LTS D;  5IIF A;  4QGU A;  5FJ8 H;  4OL7 A;  2NVX H;  4K8I A;  3PIP A;  4LFA Q;  1WCM H;  1EUJ A;  1N33 Q;  3QOL A;  1QZH A;  1CKN B;  2DJF C;  3W2D A;  1Y1V G;  1Y8O B;  1X3P A;  1QVC A;  1K8O A;  2RDF A;  2VS1 A;  1EU3 A;  3EA6 A;  2NVY B;  2K4K A;  4XDX A;  2A6H D;  2ZJQ A;  2WV6 D;  3AMU A;  4DR3 Q;  2ZJP A;  1E7Z A;  1X3Q A;  1WTV A;  3MEH A;  4Y7N H;  2XWB B;  3SXH A;  1IBL Q;  1A3T A;  1G6Z A;  4I65 A;  2F0E A;  1BBX C;  4ABN A;  1DJR D;  2BA1 A;  2WB1 G;  3AEV A;  3BVZ A;  2NWG A;  3WWV A;  2QDL A;  5JJK A;  4G7Z C;  1PZJ D;  3CAM A;  5G3L D;  3R93 A;  1PH5 A;  4BBR H;  2ATW A;  4B3T L;  3M4Q A;  4JI1 Q;  4BY1 H;  3K0X A;  5EBC A;  2L15 A;  4QMG A;  4XQN A;  2HDM A;  4LF9 L;  1PFB A;  3N52 A;  5IYD G;  4MIU A;  5D3I B;  1Q8K A;  5IGF A;  1WTO A;  2R7Z H;  1B53 A;  3KBX A;  1KDB A;  3SE0 A;  1S72 A;  1PRT B;  2K28 A;  2B8G A;  1S40 A;  3S14 H;  3S15 B;  1PFM A;  4JC0 A;  4A3J B;  2RQX A;  3GTL H;  4K5V A;  1BO0 A;  4LMQ D;  3TRZ A;  5CMD A;  3TBI B;  2UXC L;  3GDE A;  3KF6 A;  1U4L A;  2I46 A;  2MUY A;  2QKI C;  4OWX B;  3GTG H;  3OW7 A;  1AP0 A;  2IX3 A;  1ESR A;  5COR A;  1PTO C;  3CD6 A;  4LFC Q;  1F9Q A;  1GVP A;  1JCK B;  5I9O A;  1ENA A;  4IJL A;  2ZXP A;  1QB5 D;  3IFD A;  2E74 C;  5JVH 3;  2Z4I A;  3I4M B;  1EEI D;  1O80 A;  1LT4 D;  2CW0 C;  3TP6 A;  1KAW A;  2O4X A;  3MFY A;  2D0P A;  2X6G A;  1Z47 A;  1SMX A;  3K0Y A;  1OO9 B;  1MSG A;  2R7Z G;  3PV0 A;  4DU9 A;  1JJG A;  2VUM B;  1V8Q A;  1Z7T A;  4RGT A;  2A69 C;  4A3B H;  1T5E A;  1AW7 A;  3T1Y L;  3S1Q H;  4K2L A;  3UDF A;  1HH2 P;  3U58 A;  3CCQ A;  2K5Q A;  4HIK A;  2R92 H;  3PCO B;  4JI5 L;  2JA5 H;  3LGJ A;  1CM9 A;  1X3E A;  2Q2I A;  4UP9 A;  1A6X A;  1ONL A;  3E0E A;  2JA6 G;  5M5X B;  1JE4 A;  1H9M A;  1K83 H;  1Q8I A;  1AN8 A;  1ML0 D;  1FVI A;  1TII D;  4KKS A;  3HOV B;  4OXP A;  3GTK H;  4CKC A;  5CGK A;  3IAY A;  5IWA L;  4IUU A;  4JI8 Q;  4IO9 A;  4CDE C;  2E2H B;  3GTM B;  2IL8 A;  3CCR A;  2N78 A;  3OMC A;  1A15 A;  1SRO A;  4B3S L;  3NTK A;  4KV6 A;  1TWC H;  4KY5 A;  4QF4 A;  5NUC A;  3FHW A;  2HCC A;  1G2T A;  1IW7 C;  2HQE A;  2BE5 D;  1PVO A;  4X6A H;  4KK7 A;  1PH1 A;  1N8R C;  5IT9 c;  4RCO A;  3HOY G;  2EYJ A;  3WOE A;  4JBM A;  1H9S B;  1BOS A;  2RDH A;  4JI2 L;  1T9H A;  2LSS A;  3BZK A;  4ZAI A;  2WAQ E;  4HR7 B;  2LXK A;  1I94 L;  4C2M B;  2K01 A;  5E4X A;  1N36 Q;  1GD7 A;  4KHZ A;  2CH4 W;  1STN A;  1MIU A;  1IW7 D;  1I4H A;  2VZA A;  4DK1 A;  4JI5 Q;  5BN4 A;  5IT9 E;  2UXD L;  3D0F A;  3TME A;  3RMH A;  3I70 A;  2B3G A;  3TN2 A;  1R9T H;  4GKK Q;  4C3H B;  3J7Z C;  4HED A;  5D3D A;  3G48 A;  3PSI A;  4CJ2 C;  1VF7 A;  2JYO A;  5C44 G;  3PO3 B;  2B8F A;  1SNP A;  3PO3 H;  3OTO L;  3G6E A;  1RDP D;  4HIO A;  5D65 A;  3FPP A;  5C3W A;  5ELB A;  4R8N A;  2K7V A;  3HOX H;  2Q2T A;  3HOY B;  4A3F B;  1YBY A;  3GTO B;  5KYL A;  1TWA H;  1HFN A;  4ULL A;  2DY7 A;  4LAA A;  3RUZ A;  1U0L A;  4DV7 L;  3PQI A;  1G29 1;  1L1O C;  2SEB D;  3T51 B;  1X32 A;  4IZ8 A;  4DGZ A;  2GVA A;  1I4Q A;  5LHY 1;  5COY A;  1AZP A;  4A93 H;  4OHJ A;  3K7A H;  1BDO A;  1MHW C;  4K6D A;  2K33 A;  2EVB A;  2C9O A;  3V2T A;  3T1H L;  4IJH A;  2F03 A;  4XQQ A;  4I7Z C;  3ONA B;  5EQ0 A;  1GUW A;  1RL2 A;  3HEJ A;  1UWV A;  1I6H B;  1CKO A;  1BUV T;  1I50 B;  3CHB D;  3S1M H;  2HCI A;  4Z9C B;  2N49 A;  5E7N A;  3D6C A;  1QZG A;  3VYR A;  5FLX c;  2WFW A;  4IOC A;  3KF8 B;  3FMC A;  1STB A;  5D14 A;  1Y8N B;  4K14 A;  3GTQ H;  3F2B A;  4C1N K;  3Q6S A;  2EY6 A;  2H5X A;  4ZRZ A;  3KOJ A;  3SK6 A;  1STG A;  2XIW A;  1PYB A;  4POF A;  3T16 A;  2KHJ A;  1YJ9 A;  5C3E G;  5J3B A;  4JI0 L;  2Z9H A;  1S5D D;  2MJ8 A;  4L5S A;  4A3B G;  1E2V A;  1PZI D;  1NSN S;  2UXB Q;  5IP9 H;  4NP5 A;  5DM6 3;  1Q46 A;  5A2Q L;  4Q5V A;  2AUK A;  1YJN A;  2RSO A;  1ENF A;  1AFP A;  2UU9 Q;  3MZ5 A;  3SHL A;  1EYG A;  5KRU A;  4DV2 Q;  2E2I B;  1GXD C;  1FNU A;  4CBV A;  1YHQ A;  1TS5 A;  4YWM A;  1CUK A;  1QUQ A;  2JE6 I;  3CXC A;  4UHV A;  1A63 A;  4KLK A;  1JE5 A;  2RHQ B;  2G9H D;  4XYQ A;  4A3L G;  2WAQ G;  1STY A;  2XGT A;  5DEH A;  4CDF C;  1YEZ A;  4DR1 Q;  5IP7 G;  5C6A A;  3CC4 A; 
#chains in the Genus database with same CATH homology
 3CU7 A;  1VMC A;  2EYM A;  3VA7 A;  2F0V A;  1QG7 A;  1LTA D;  5JPM C;  1GUO A;  4C3J B;  4BY7 B;  2B2U C;  4QIW B;  2DY8 A;  1EQV A;  1WD1 A;  2OXP A;  2B2W A;  1FNV A;  1VDZ A;  2C5C A;  1ZXT A;  2B39 A;  2MGS A;  1V1P A;  3P1H A;  2RA4 A;  4JK1 C;  2J7Z A;  2NN6 I;  2TMP A;  2H1E A;  3EFX D;  1QCB D;  1R9T B;  5IGB A;  1CHQ D;  2EY1 A;  3VYS A;  4IUQ A;  3MWY W;  1H9R A;  1WTQ A;  3MA2 B;  1CK1 A;  1EY4 A;  3GTG B;  3K5O A;  3LWE A;  3U9S A;  1T5X D;  4ZK9 B;  3V96 A;  5CBE E;  2PO4 A;  3SK4 A;  1I4X A;  1DXM A;  1BF4 A;  4C1N I;  4UAI A;  1A3U A;  1S5E D;  4BS9 A;  3S14 B;  3NHH A;  1BCP B;  2EJF C;  5CV9 A;  4DAY A;  4RH6 A;  1STE A;  1LLR D;  1UEA B;  2B2V A;  1JQY D;  2IT1 A;  3R2T A;  1YNN C;  3X3N A;  2KA7 A;  3M85 A;  5FLX E;  1BCP F;  1K83 B;  4G4K A;  4OO1 G;  2NTS A;  3P20 A;  1QJO A;  2F0I A;  1GUN A;  1WD0 A;  3D4D A;  4IUN A;  1PDQ A;  2AQ2 B;  3AB9 A;  1TS2 A;  5IGD A;  5C0X I;  1SNC A;  3NXW A;  3BYT B;  5C5M A;  1RHP A;  1G8Z D;  4FYD A;  2Q8I B;  3HOZ B;  4FF2 A;  3S1Q B;  3C1F A;  5C0X H;  4A3K B;  4ID6 A;  3S9W A;  4CKE A;  3K57 A;  3JAM E;  4EGV A;  5EPK A;  5IOD A;  2E75 C;  3D8G A;  2O2L D;  1OXT A;  3C1E A;  3HG9 A;  4DAP A;  3C46 A;  3FPU B;  1EYD A;  1DCZ A;  2L5T A;  1D1K A;  4K2K A;  1TS4 A;  2VXW A;  1F2M A;  2EYH A;  2B63 B;  5JEA H;  3EVQ A;  4X3U A;  2QDB A;  4FNF A;  1EZ6 A;  3IFT A;  2A68 C;  1TKW B;  1FR3 A;  4A93 B;  4MHE A;  5F2D A;  2EDG A;  1TWA B;  1RKN A;  1LT5 D;  2BCO A;  2CVR A;  1B9N A;  1SBB B;  1JOQ A;  1TY2 A;  4KTA A;  3GO5 A;  3EJI A;  4PMW A;  1MD2 D;  5EKL A;  3FKI B;  5JAV A;  3VR6 A;  3SR1 A;  4X3K A;  5KNB A;  1XTC D;  1LTI D;  4Y7N B;  3EQL C;  4B9X A;  5K36 H;  3JAM L;  3O13 A;  4HSP A;  1IYU A;  2KQ3 A;  3WDN A;  5I2X A;  1II3 A;  3P7J A;  4F88 A;  3NTH A;  1ICW A;  2X6L A;  5AFW A;  1NCV A;  2R92 B;  2A6E C;  2O5J C;  1ENC A;  3A54 A;  3ND8 A;  3R2I A;  1CI3 M;  5JEA J;  2NZ1 D;  3K5L A;  1R4P B;  2IWH A;  3NBI A;  1BXT A;  2G9D A;  3TDQ A;  5CV7 A;  5FKA C;  4CJ0 B;  2XRQ D;  2KCN A;  3PIP 3;  1ZKO A;  2KCC A;  3TZU A;  4OIK A;  1LAB A;  4KD3 A;  5LL6 X;  3GQB A;  4U68 A;  4DNT B;  1PRT F;  1JB3 A;  4BBS B;  3GV6 A;  5ISR A;  3TSS A;  2KVM A;  2QF7 A;  4FXG C;  4KD4 A;  2ENB A;  2F0H A;  3MHB A;  2L12 A;  1CQF A;  1ET6 A;  3QG1 A;  2F0M A;  5I2Y A;  2HDL A;  1Y1W B;  4A3I B;  4B9W A;  3I4L A;  4RWS C;  4TKO B;  5DNF A;  1GOZ A;  4IFD G;  3RZO B;  2KUM A;  2JSO A;  1TY0 A;  1SYG A;  1PMR A;  1LV9 A;  3VR5 A;  2KJX A;  1YNJ D;  2FIN B;  2SDF A;  1MSH A;  4X3S A;  1H9S A;  1SE4 A;  5K5P A;  1EYC A;  1KDA A;  5IGE A;  3OIP A;  2KOL A;  4OO1 H;  1W6K A;  1SNM A;  4WJW A;  1H9J A;  3H3V C;  4EQO A;  3J80 L;  1GHJ A;  3KLR A;  1I6V C;  1WTR A;  3OOC A;  4CGY B;  3MVV A;  4M1U B;  5KND A;  5G3L F;  4OIJ A;  3HKZ B;  4KY7 A;  1U4R A;  3HRZ C;  3PUW A;  3K58 A;  2JP1 A;  3QJY A;  1JR0 D;  1HUM A;  4DNR B;  1STH A;  3E5S A;  1LO5 D;  1PFN A;  4GZY C;  3WOF A;  4TRD A;  3BS1 A;  3BZD B;  1D6E C;  1L0X B;  1PXU A;  3H0G B;  1OXX K;  4XQJ A;  2B2T C;  3H91 A;  5TSS A;  5CBA E;  3S16 B;  3J7Y W;  1HA5 A;  3DWA A;  2TSS A;  2RKS A;  1PZK D;  3K7A B;  1DYQ A;  5CYU A;  3K6O A;  4C3H G;  4PNY A;  4UDU C;  4OO1 I;  3S1N B;  3NTI A;  2WIN B;  2PW5 A;  4BA1 I;  3BVM A;  1SYC A;  4RGM A;  3TP5 A;  1SYB A;  1SNO A;  3GV3 A;  5FO7 B;  2F0F A;  1YNN D;  4IFD H;  5C5L A;  1I4R A;  1EYA A;  4EQP A;  1TWH B;  4RKL A;  2HUG A;  5E4W C;  2WAC A;  4XYO A;  4G57 A;  1V1P B;  4KJN A;  1JWM D;  5M5W B;  1EZ8 A;  1SE3 A;  3VR4 A;  1TWC B;  2MP1 A;  5EPJ A;  2GA4 B;  4BBR B;  4J6H A;  1B2T A;  3NE5 B;  4FF3 A;  2BDN A;  3UI2 A;  3AU7 A;  1D2B A;  3DMU A;  2D62 A;  2AQ1 B;  2AUJ D;  1J9O A;  1W6J A;  2KHS A;  1KAB A;  5C4X B;  2O5I C;  2NVT B;  4K6L A;  1YNJ C;  1LAC A;  4HN7 A;  3M7N A;  1PRT C;  2N88 A;  2VB3 X;  1EY7 A;  2F0W A;  2JA5 B;  3I4N B;  2M00 A;  1BCP C;  3U9O A;  2F0L A;  5E3F A;  2OT2 A;  5KEE A;  1TQO A;  1QOH A;  2V4D A;  2IPK D;  1DOM A;  2PQE A;  1ROD A;  5C4J B;  2Q8T A;  3MFG A;  4FF4 A;  1GHK A;  3IKJ A;  5CR3 A;  4P2C B;  1BCP D;  4TSS A;  5C0X G;  1TS3 A;  5ELD A;  5LL6 S;  1A3V A;  2X69 A;  1HXY D;  3G6J B;  4A3M B;  1B50 A;  3OPO A;  2JEB I;  1E0B A;  2IX0 A;  1QNU A;  5M5Y B;  3KF8 A;  3S2D B;  5CV4 A;  4ZKC B;  3GTL B;  1F9R A;  5A35 A;  1TU2 B;  4O1N A;  1BQQ T;  1C8C A;  5M3F B;  2VB2 X;  2EXZ A;  1J8I A;  4RKB A;  1E2W A;  1EWC A;  1JOK A;  2F0P A;  5FOB B;  4O42 A;  2CW0 D;  1PYW D;  1Y8P B;  4XT3 B;  2PZW A;  3NWT A;  1MGS A;  1H9K A;  1Z6H A;  3TZD A;  2LY7 A;  2PZU A;  1A2T A;  3FVQ A;  3MXU A;  1F9P A;  2L0C A;  2JA7 B;  1O7Y A;  2QEJ C;  1ILQ A;  5JEA G;  5DM7 3;  4XTC S;  4FF1 A;  3J7A F;  1HUN A;  4V0B A;  1TWG B;  1C4Q A;  2D5D A;  1CQV A;  4LK1 C;  3HP3 A;  4IFD J;  2BA0 A;  3DUZ A;  4FP5 D;  4IUP A;  4ZUJ A;  2NBF A;  1SAP A;  5C4H A;  5CV8 A;  1IKM A;  2SNS A;  3QIA A;  1CA6 A;  2B2W C;  3GTP B;  2PZT A;  1JWS D;  1G91 A;  2PNR C;  1LTG D;  2WB1 B;  5FK9 C;  3NQT A;  4DAV A;  3DEP A;  2F0T A;  4FXK C;  1HTP A;  1VMP A;  2WII B;  4X3T A;  2EYF A;  4K5X A;  3P75 A;  2ZXR A;  1EIH A;  3I3C A;  2EJM A;  3I72 A;  4PQX A;  4N9P A;  2NVQ B;  1HQM C;  4WOR A;  4HAE A;  1TT2 A;  3BDC A;  2E2J B;  4A3B B;  2BOS A;  3K59 A;  1LTT D;  2PCF B;  2XNA C;  2Y0S B;  3PUV A;  1JOO A;  3PUX A;  2K04 A;  1CA5 A;  1UNS A;  2F0G A;  4XXE A;  5BN3 A;  1Q1E A;  2EZV A;  1HA6 A;  5IGC A;  5J22 A;  3M4O B;  2A73 B;  3C2P A;  1RTN A;  3NPP A;  3PUZ A;  2DNE A;  3SK8 A;  4XIG S;  2VNU D;  4RAU C;  4CJ1 B;  3NUC A;  1Q12 A;  3BDO A;  2Z1C A;  1Y1V B;  3R8B A;  1HCZ A;  1KTK A;  4ODG A;  3HGB A;  3NBH A;  1QE6 A;  1DOL A;  4QB4 A;  4N9T A;  4RHS A;  5KYI A;  4HTH A;  1ZYR C;  2A5H A;  4IFD I;  4DA2 A;  2F1M A;  3H94 A;  3V05 A;  3J81 E;  2F4I A;  1DOK A;  3BG3 A;  3OIQ A;  4IAL A;  1GUS A;  1FNW A;  1WCM B;  2F3V A;  5FO8 B;  2K03 A;  3J80 E;  2EYP A;  2K32 A;  1KDC A;  2SOB A;  1I3Q B;  2B2T A;  3GTJ B;  3A56 A;  4PMC A;  1SSO A;  2I07 B;  4BWG B;  3DHQ A;  1U4P A;  2EYL A;  2NUC A;  1EQT A;  3NP8 A;  4J8Q A;  1XX8 A;  4Q0F A;  1L0Y B;  5HGT A;  2R3Z A;  3E0J A;  4PV1 C;  3X3M A;  3QO2 A;  3QOJ A;  3DM1 A;  1HQR D;  1SMY C;  4DXG A;  2FJ2 A;  1GUT A;  5ELC A;  1NR4 A;  3W3A A;  1G2S A;  4HSV A;  3T13 A;  3MXN A;  5CV5 A;  3R3O A;  2MHV A;  1ZEQ X;  4HCS A;  3A55 A;  1NR2 A;  4H7B A;  1STA A;  3KBG A;  2A6E D;  1RF2 D;  2RDG A;  3VYU A;  2LS0 1;  1EY8 A;  2OEO A;  3NQI A;  2AQ3 B;  1IYV A;  2BE5 C;  4IUV A;  2IW3 A;  3HZX A;  2Q8R E;  4H0L C;  3FEW X;  1EWH A;  4C3I B;  1WVL A;  2D9U A;  1U9R A;  4ME5 A;  1HPC A;  5T1G A;  1PRT D;  2SNM A;  4NKL A;  3PO2 B;  4S3S A;  2F0K A;  1WTW A;  2R6G A;  3D31 A;  1SMY D;  3LNN A;  2ZXO A;  3I91 A;  2K5D A;  1C48 A;  2Z8L A;  4WRD A;  4KMU C;  1ESF A;  1MBY A;  2IX1 A;  2XSC A;  4DF7 A;  3KLS A;  1HFG A;  4U67 3;  1SJE D;  4ZQ3 A;  1XXG A;  3FRP B;  3T53 B;  5IGG A;  1PLF A;  1EY9 A;  1EY6 A;  4L63 B;  1Q3L A;  1U4M A;  2H4O A;  1JWU D;  3GTK B;  5J1Z A;  3TP7 A;  1GJX A;  5T1I A;  2KEE A;  3MTS A;  1XWE A;  3T56 B;  3A8I E;  2OF1 A;  3ITP A;  1LT6 D;  1LT3 D;  1F9S A;  1WTX A;  1SEB D;  4DFA A;  1RCV D;  1B9M A;  2EE1 A;  3Q22 A;  3HOU B;  3KLS X;  1RTO A;  2B2U A;  4F8M A;  3Q0A A;  2JXM B;  1UAP A;  4MN3 A;  2PMZ B;  1DZ1 A;  1I4G A;  4R8I A;  4K8J A;  3E6Z X;  2WKD A;  5EGT A;  4OGQ C;  5KNC A;  1KLU D;  1V1O A;  2F0D A;  3ZYY X;  3I73 A;  2A6H C;  3BVG A;  1F2Z A;  3M4Y A;  4EQN A;  2R93 B;  5C0X J;  4DXF A;  4IUT A;  3DWQ A;  1IKL A;  1S4Z A;  2AWN A;  2R61 A;  4A3G B;  2LKV A;  1JIC A;  5JPN C;  5CV6 A;  2WKC A;  3D3R A;  2A69 D;  4DN4 M;  2PW7 A;  3NWS A;  5BN5 A;  3HOW B;  1S5B D;  2FFK B;  3A8J E;  2R7Z B;  4F87 A;  3VYT A;  3J7A V;  2CHB D;  4ZUI A;  3RZD B;  1ILP A;  4HMI A;  4QUF A;  2AWO A;  4HCE A;  4QCL A;  5CC4 A;  1Q1B A;  2A74 C;  1B44 D;  4IN3 A;  3HS0 C;  3ERO A;  2JA6 B;  2JA8 B;  1AZQ A;  5ELE A;  4RFB A;  3GD7 A;  3L3O C;  4F7X A;  1CFM A;  2LFN A;  5I6W A;  1MI2 A;  2ZT9 C;  2LMC B;  2KEC A;  5DAU A;  1S5C D;  3TP8 A;  1VF5 C;  1LTR D;  2CQA A;  5JVG 3;  5I6Y A;  1KLG D;  3SDZ A;  1FD7 D;  1SJH D;  3MXG A;  3PIO 3;  4KKT A;  4XT1 B;  1Y69 U;  3IL8 A;  4KKU A;  1SYE A;  3HOX B;  2NN6 H;  5EKI A;  2K1B A;  1CT1 D;  1SYD A;  2EYO A;  4RHR A;  4RGO S;  3H6M A;  1CZG A;  1BR9 A;  3ERQ A;  3OMG A;  2EPB A;  1VCI A;  4KHV A;  2NN6 G;  3S1M B;  2J4X A;  1QIL A;  2B2V C;  3FDT A;  3RLF A;  1OXU A;  1IHZ A;  4IQZ A;  2M2L A;  1O78 A;  1UUP A;  1CHP D;  4LJZ C;  1EFI D;  1SFO B;  1XYI A;  3K5M A;  2F0N A;  3CKI B;  2J0T D;  1FGB D;  4CHT B;  1B1Z A;  1PTO B;  2JEA I;  1AEX A;  4RA8 A;  3KUP A;  1V43 A;  4L6T B;  3D4W A;  1SND A;  4ILW A;  1OXS C;  2F0O A;  1E2Z A;  1EY5 A;  2QCP X;  4RGN A;  1GUG A;  1ZYR D;  1KAA A;  3VR2 A;  2F0S A;  3D6W A;  3OWF A;  4B08 A;  2A68 D;  2K5W A;  2MPM A;  3H09 A;  1DD2 A;  2F0U A;  1HHV A;  3SVM A;  1R4Q B;  2KED A;  2NYZ D;  3L9A X;  5EBD A;  1EIG A;  1D1I A;  2YU9 B;  1PTO D;  3DWP A;  2FMC A;  3J81 L;  3CRK C;  2YYZ A;  2WAQ B;  4KN4 C;  3S17 B;  2XN9 C;  2EY2 A;  3F2U A;  4KY6 A;  1RD9 D;  3OHX C;  4JBW A;  4EVO A;  3GP7 A;  1RJT A;  2L55 A;  1IL8 A;  5KIX A;  2NTT A;  1M4V A;  3T4A C;  4G7O C;  1M8A A;  4RCN A;  3C3L A;  5EJW A;  2EOT A;  5IT9 L;  3URY A;  3LWU A;  1F77 A;  1PTO F;  4NW2 A;  3VR3 A;  5M9O A;  2Z4H A;  1SE2 A;  3K5N A;  1LTB D;  4C3J G;  4A3E B;  2E76 C;  2K6A A;  5JJZ A;  2RVL A;  4V19 0;  1TWF B;  4A3D B;  1D5Z C;  2ICI A;  4ZKB B;  5EKK A;  1A2U A;  3S1R B;  2D2C C;  3L7Z C;  4KI0 A;  1EY0 A;  4YIJ A;  1EOT A;  3ND9 A;  3OSO A;  2FMM A;  3QWN A;  3RD4 A;  4KJO A;  3NK9 A;  1NAP A;  2ICE C;  2PYK A;  1FYC A;  1QWY A;  3VA5 A;  1SXT A;  2E2D C;  3G7L A;  5JOB A;  1DM0 B;  1PTO H;  2F0J A;  1KNA A;  1EL0 A;  2DNC A;  1I4P A;  3S2H B;  2L9H A;  3I90 A;  4M8A A;  3PMF A;  2F0Q A;  3CRL C;  1TVX A;  2K05 A;  3DXJ C;  2NVX B;  2IJ0 A;  2XVS A;  5C44 B;  4CKB A;  1HRJ A;  1B4O A;  1KNE A;  1O7L A;  1SNQ A;  1F2Y A;  3DEO A;  5M3M B;  1HTL D;  1D5X C;  3N6R A;  3BYY B;  5A2Q E;  4H44 C;  2BDO A;  4H13 C;  4DK0 A;  4NMZ A;  2EJG C;  5K36 G;  1EU4 A;  4FVM A;  2B2Y A;  3GTQ B;  1Q90 A;  1CZW A;  3NSW A;  2EY5 A;  2F3W A;  3QB3 A;  2DN8 A;  4ZYS A;  5FO9 B;  3OWE B;  4PMB A;  2NB0 A;  1SYF A;  2B2Y C;  4C56 C;  5HUR A;  1QNK A;  5EPL A;  2L11 A;  1S5F D;  2QIL A;  4R9W A;  5I9P A;  3A7L A;  5J39 A;  3A8K E;  4J1M A;  3KK7 A;  2L4N A;  4HMJ A;  3BDL A;  1BNZ A;  5I4D A;  1TR5 A;  5IOC A;  4QUC A;  2RBM A;  4KN7 C;  1D5M C;  1ET9 A;  5C3E B;  1K8M A;  4E6I A;  3PUY A;  4TQU S;  5KGU A;  3SEB A;  5E1F A;  1O7Z A;  4G7H C;  2ID0 A;  2PPB C;  1DON A;  1CTM A;  2N55 A;  1JC7 A;  1NUC A;  3SK5 A;  4K5W A;  1JOR A;  4IUR A;  5FLX L;  4AYB B;  2XWJ B;  3MC0 B;  4FO2 A;  4C3I G;  4L8J A;  3M7G A;  3A7A B;  3Q24 A;  3D4R A;  3CQZ B;  2RSN A;  5ELF A;  5C4Z A;  3M3Y B;  3Q23 A;  4BA2 I;  4FXD A;  1EEF D;  1B3A A;  1SDF A;  3I8Z A;  1F2L A;  2WP8 J;  3MXP A;  2M9V A;  2XRS D;  4BY1 B;  2L1B A;  1OXV A;  4NDX A;  4WFN 3;  5C3X A;  3LX0 A;  4ZLT F;  2FHT A;  3MAQ A;  1WTP A;  1LTS D;  5IIF A;  4OL7 A;  4K8I A;  3QOL A;  3W2D A;  1Y8O B;  1X3P A;  1K8O A;  2RDF A;  1EU3 A;  3EA6 A;  2NVY B;  4XDX A;  2A6H D;  2WV6 D;  3AMU A;  1X3Q A;  1WTV A;  3MEH A;  2XWB B;  3SXH A;  1A3T A;  1G6Z A;  4I65 A;  2F0E A;  1BBX C;  4ABN A;  1DJR D;  2BA1 A;  3BVZ A;  2NWG A;  4G7Z C;  1PZJ D;  3R93 A;  5G3L D;  5EBC A;  4QMG A;  4XQN A;  2HDM A;  1PFB A;  3N52 A;  4MIU A;  5D3I B;  5IGF A;  1WTO A;  1B53 A;  3KBX A;  1KDB A;  3SE0 A;  1PRT B;  2K28 A;  2B8G A;  3S15 B;  1PFM A;  4A3J B;  2RQX A;  4K5V A;  1BO0 A;  4LMQ D;  5CMD A;  3TBI B;  1U4L A;  2I46 A;  2MUY A;  2QKI C;  1AP0 A;  3OW7 A;  2IX3 A;  1ESR A;  5COR A;  1PTO C;  1F9Q A;  1JCK B;  5I9O A;  1ENA A;  2ZXP A;  1QB5 D;  3IFD A;  2E74 C;  5JVH 3;  2Z4I A;  3I4M B;  1EEI D;  1O80 A;  1LT4 D;  2CW0 C;  3TP6 A;  2O4X A;  3MFY A;  2X6G A;  1Z47 A;  3K0Y A;  1OO9 B;  1MSG A;  3PV0 A;  4DU9 A;  2VUM B;  1V8Q A;  1Z7T A;  4RGT A;  2A69 C;  1T5E A;  1AW7 A;  4K2L A;  2K5Q A;  1CM9 A;  1A6X A;  1ONL A;  5M5X B;  1JE4 A;  1H9M A;  1Q8I A;  1AN8 A;  1ML0 D;  1TII D;  4KKS A;  3HOV B;  4CKC A;  5CGK A;  3IAY A;  4IUU A;  2E2H B;  3GTM B;  2IL8 A;  3OMC A;  1A15 A;  3NTK A;  4KV6 A;  4KY5 A;  4QF4 A;  5NUC A;  2HCC A;  1G2T A;  1IW7 C;  2HQE A;  2BE5 D;  4KK7 A;  4RCO A;  3WOE A;  2EYJ A;  1H9S B;  1BOS A;  2RDH A;  4ZAI A;  4HR7 B;  4C2M B;  2K01 A;  5E4X A;  4KHZ A;  1STN A;  1IW7 D;  1I4H A;  4DK1 A;  5BN4 A;  5IT9 E;  3TME A;  3RMH A;  3I70 A;  3TN2 A;  4C3H B;  4HED A;  5D3D A;  4CJ2 C;  1VF7 A;  2JYO A;  3PO3 B;  2B8F A;  1SNP A;  1RDP D;  5D65 A;  3FPP A;  5C3W A;  5ELB A;  4R8N A;  2K7V A;  3HOY B;  4A3F B;  3GTO B;  1HFN A;  5KYL A;  4ULL A;  2DY7 A;  4LAA A;  3RUZ A;  1G29 1;  2SEB D;  3T51 B;  1X32 A;  4IZ8 A;  4DGZ A;  1I4Q A;  5LHY 1;  5COY A;  1AZP A;  4OHJ A;  1BDO A;  4K6D A;  2K33 A;  2EVB A;  2C9O A;  3V2T A;  2F03 A;  4XQQ A;  4I7Z C;  3ONA B;  5EQ0 A;  1GUW A;  3HEJ A;  1I6H B;  1BUV T;  1I50 B;  3CHB D;  2HCI A;  4Z9C B;  3D6C A;  3VYR A;  3FMC A;  1STB A;  5D14 A;  1Y8N B;  4K14 A;  4C1N K;  3Q6S A;  2EY6 A;  4ZRZ A;  3SK6 A;  1STG A;  2XIW A;  3T16 A;  1S5D D;  2MJ8 A;  1E2V A;  1PZI D;  1NSN S;  4NP5 A;  5DM6 3;  5A2Q L;  4Q5V A;  2AUK A;  2RSO A;  1ENF A;  1AFP A;  3MZ5 A;  3SHL A;  5KRU A;  2E2I B;  1GXD C;  1FNU A;  4CBV A;  1TS5 A;  2JE6 I;  4XYQ A;  2G9H D;  1STY A;  5DEH A;  5C6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...