1IKLA

Nmr study of monomeric human interleukin-8 (minimized average structure)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
68
Chain Sequence
ELRCQCIKTYSKPFHPKFIKERVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine (chemotactic)
molecule keywords HUMAN INTERLEUKIN-8 (MONOMERIC)
publication title 1H NMR solution structure of an active monomeric interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 10
structure length 68
sequence length 69
ec nomenclature
pdb deposition date 1995-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iklA00
2JP1A 1G2SA 1X32A 4CJ1B 5JJZA 3D6WA 3R93A 1WTVA 1HUNA 1B50A 4HAEA 3Q6SA 4IUVA 1KNEA 4IUTA 4IUUA 2RSNA 2L1BA 2SDFA 3DM1A 3I8ZA 5DNFA 5EPJA 1RJTA 2K05A 2K03A 1SDFA 2B2VC 1EQTA 3ONAB 1F9QA 1HHVA 2DY8A 5D65A 1ESRA 2B2TC 4MHEA 2RSOA 2FHTA 2NYZD 2Q8RE 1M8AA 4O42A 1EOTA 1VMPA 3LWEA 1TVXA 2FFKB 2N88A 2KECA 1U4MA 2L4NA 1WD1A 4HCSA 4RWSC 1BBXC 1O7YA 3KUPA 1VMCA 1XX8A 1X3QA 1A15A 1XYIA 1B4OA 5CBAE 4U68A 1AZQA 4ZKCB 4OIJA 1U4LA 1GUWA 1BO0A 2K1BA 5E4WC 1F9SA 3SVMA 1J8IA 5EPKA 2B2YA 2B2VA 4XT3B 1WD0A 4X3TA 1JICA 1PFMA 2NWGA 5EKIA 4OIKA 2B2TA 1ILQA 1G91A 1E0BA 5EQ0A 1F2LA 2B2UA 2FJ2A 1WTRA 1MI2A 2JYOA 4ZLTF 2HDLA 2K28A 3GV3A 1HA6A 3H91A 3DEPA 2L11A 5T1IA 4R8IA 2CVRA 1PDQA 2VXWA 1MSGA 5D14A 1BNZA 3TZDA 1U4PA 2RA4A 3KBXA 5CORA 1O80A 2HUGA 2J7ZA 4RAUC 1IL8A 1EL0A 2FMMA 3FDTA 1WTWA 1PLFA 2XIWA 3F2UA 1B3AA 1CM9A 1F9PA 1QNKA 1SSOA 1JE4A 3G7LA 3I90A 2Q8TA 1QG7A 4HSVA 2N55A 1HFGA 2K01A 2X6LA 4X3SA 2MPMA 5CBEE 1C8CA 1RODA 2L12A 2X6GA 1WVLA 2B2WC 3HP3A 1PFBA 1WTQA 2FINB 4LMQD 1BF4A 1J9OA 1PFNA 2EPBA 2EOTA 2L9HA 1EIHA 1RTOA 4X3KA 3IFDA 1MSHA 3IL8A 4RA8A 4R9WA 2KEEA 5E4XA 3MTSA 2M2LA 2KUMA 2RVLA 1IKLA 1DOKA 4NW2A 4DN4M 4IUPA 3GV6A 3MWYW 3QO2A 3UI2A 1RHPA 1Q3LA 2KVMA 4CJ2C 5COYA 1G2TA 1NCVA 1O7ZA 1U4RA 1IKMA 1HUMA 1WTXA 1KNAA 1S4ZA 5AFWA 1WTPA 2B2WA 2HCCA 1NR4A 2HCIA 3I91A 2MP1A 4MN3A 4IUQA 4XT1B 1ZXTA 1HFNA 1RTNA 4CJ0B 2KOLA 5CMDA 4ZAIA 1WTOA 3P7JA 1NAPA 4QUFA 2NZ1D 1F9RA 1AZPA 1B2TA 2B2YC 5T1GA 4HEDA 1DONA 4XDXA 1DZ1A 1X3PA 2MJ8A 1ICWA 2IL8A 1HRJA 2KEDA 4X3UA 2HDMA 4ZKBB 2B2UC 3I3CA 1LV9A 2K04A 2DY7A 1CA5A 1QE6A 2H1EA 4IURA 3DEOA 2R3ZA 1ML0D 1SAPA 4UAIA 3TN2A 1EIGA 1DOMA 1MGSA 4QUCA 4ZK9B 1CA6A 1G6ZA 3FPUB 5EPLA 1ILPA 1DOLA 2X69A 1AP0A 2BDNA 5EJWA 2MGSA 1NR2A 2EE1A 1B53A 2D9UA 3N52A
chains in the Genus database with same CATH superfamily
2JP1A 1X32A 1AH9A 1N34Q 4AYBG 4HMJA 1LTBD 4PNYA 5JJIA 5IWAL 5EPJA 4L5RC 1EY6A 4DR6Q 3CP0A 1PRTB 1JJ2A 2K7VA 2Q8RE 1EEFD 4O42A 4DXFA 1JB3A 2B63H 1SNPA 3JAMc 5C4JH 3K58A 3H0GG 1XYIA 2ZXPA 4A3CG 1EFID 3HKZE 3DLLA 1WD0A 4X3TA 3J80i 3GD7A 1E1TA 4A3IH 1PZKD 5IP9H 4OGQC 2NN6G 1VQGA 4F87A 1VDZA 3H91A 1EY8A 2ZM6L 4MTKA 5DEHA 3GTGH 1O7LA 1GUNA 1F2MA 4YWKA 1F9PA 1SSOA 4L8JA 1QG7A 2ENBA 3A8JE 2DN8A 4TSSA 1E22A 3J7A5 4MIUA 1EIHA 1I4GA 3KF8A 4BBSG 4CDFC 2NB0A 3ITPA 1XMQL 3S15B 1EYCA 5IYCG 3K7UC 3NK9A 2VQEL 4DN4M 2UXCQ 2E5LL 3TS2A 1RHPA 3T53B 2R7ZH 4A3FG 2PQEA 3TP6A 4NMZA 2HCCA 4NXNL 2F3VA 1KAAA 1PH8A 2WP8J 2K5HA 4JI3Q 3P75A 2R92G 2NZ1D 1DONA 1TR5A 1R9TB 1FGUA 4OX9Q 3OMCA 3UDGA 1J5EL 3HS0C 3K7AH 4QUCA 1DOMA 5FLXL 2NVXH 1ILPA 2PZWA 2NVQH 3NE5B 1GHKA 3LWUA 5M5XB 3ULJA 4K2KA 2Z6KA 1B50A 3K5NA 4ZUJA 5A35A 3J81i 1L1OC 4QCLA 3GTOB 4JYAL 1HHVA 3S24A 1OXSC 2FHTA 4A4IA 3HOZB 1VMPA 1AFPA 3T56B 3DUZA 4R4IA 1Y14B 4A3DH 1PYSB 3ND9A 4DV7Q 1EQRA 2I0QA 1Y8PB 1B4OA 1EYGA 2KCCA 4PZ7A 4YIJA 4R4TA 3N6RA 3K0XA 4NXMQ 2B2VA 1IYVA 2G9DA 4GN3B 4C3HH 1ILQA 1JOKA 5IYDG 3OTOL 1BQQT 3M3YB 5EBDA 3TZUA 1JWMD 4EX5A 1DGSA 2IT1A 2HIXA 2MHVA 5EKLA 5D14A 5K36H 1NY4A 1KHIA 1C4QA 2P5ZX 3BZCA 4DR4Q 1QILA 1UE7A 3NBIA 4IZ8A 1QVFA 1UEAB 2VQFQ 5IGDA 1WTWA 2F52A 1QNKA 4KV6A 3FVQA 2Q8TA 1L2FA 3W3AA 3W1BA 1AE3A 1EQQA 3BDCA 1VQMA 3HP3A 1CUKA 1PFBA 1PFNA 2EOTA 4HJ5A 1Y1VB 3OW2A 1SLJA 4DF7A 3G48A 2OWOA 1VQBA 3H94A 1F77A 5IT9c 3CQZH 3AU7A 1PH1A 2WACA 1EFWA 1E24A 1LTAD 1TQOA 3KYHC 3GTOH 4L5QA 2L0CA 2WB1G 1GKHA 3GTMH 1WTPA 1VS0A 4FF2A 2L15A 3A5ZB 5EKKA 2DNEA 5F2DA 4BY1G 4JI7L 1LUZA 1NAPA 2ES2A 1LT3D 2F0QA 2HQEA 3H15A 1ICWA 2HDMA 4IUNA 4KHPQ 1HQMC 1K28A 4JI1Q 2F0LA 1DJRD 3GTJH 4PV1C 4A76A 1GJXA 4O1NA 4B3RL 3ULPA 5CV5A 3TRZA 3T13A 3WOEA 1BCPC 1B53A 3GP7A 1HZCA 1IBML 2IY5B 2EXZA 4IALA 3S14B 3RZOH 2A69D 3GTQH 4YY3Q 3FKIG 1KNEA 1WYDA 1ET9A 3K59A 5DNFA 2A6HD 2F0HA 3EQLC 4GLVB 1SNMA 2RBMA 2YU9B 2F0NA 1YHAA 4GOPA 2K52A 1UEBA 4DK0A 4HTHA 4DR6L 1M8AA 4DNIA 2RDGA 4DFAA 3CXCA 3SE0A 4TQUS 3AYHB 2E76C 2JN4A 3A74A 3BDLA 1NTGA 3M7GA 1N36Q 2PI2E 2BA0A 4DR1L 3NSWA 4A3MH 5C0XG 4DAPA 3IAYA 1TWAH 5CR3A 1T9HA 4LFBL 2B2TA 2CCZA 1F2LA 4H02A 4TKOB 3EBEA 3GV3A 1BCPD 2PPBC 3PIPA 1ET6A 3UE0A 3K5OA 3LX0A 5IYBG 3KDFB 1UWVA 2RHQB 5CORA 4LFCL 2HUGA 2K14A 2YTVA 4A3KG 5IGBA 4B3TQ 4A93H 4HIKA 3AEVA 1SN8A 5M5YH 1GHJA 4GNXA 3OYYA 1S5ED 3G7LA 4ZQ3A 4CKEA 1IL2A 2L12A 1UE1A 3HOXB 3HOUB 1GUSA 3WOFA 1BF4A 3HOWH 5JOBA 1YNNC 2WV6D 1EYDA 1PMRA 1V1PA 2RVLA 1PYBA 3AFQA 2SNSA 4DV4Q 2B63G 2QILA 3G71A 3KLSA 3S1NH 1DXMA 2UXCL 1I50B 3I72A 2YU9H 1FNWA 4EQ5A 1FYCA 4JC0A 3EJIA 2PYKA 2QGQA 3I91A 3F2CA 3HFZB 3RLOA 4QMGA 2GVAA 4QUFA 5JVH3 4A3IG 3KF6B 4JI3L 5IP9G 5KRUA 2EJGC 5EGTA 1LV9A 3CCEA 1SE8A 1HTPA 2NVYH 4OX9L 3U4ZA 2JA7H 1K8OA 3S1MH 3R2TA 2QDBA 1CI3M 4MNOA 1YNND 2WAQB 1E2WA 2ZXOA 1B7YB 2F0MA 1LO5D 2RHSB 2JJQA 2RSNA 2L1BA 3CPFA 1EY5A 4LF6Q 1PZJD 4J1MA 1BVSA 5LMUQ 3STBD 1ESRA 3JAML 3NBHA 1HR0W 4X62Q 4UDUC 4FXKC 1GVPA 3LWEA 1YNJD 2R7ZG 2L4NA 2CW0C 2JE6I 4FXGC 1A0IA 4EQPA 4ZKCB 4I7AA 2XWJB 4DV7L 4HJ9A 1K73C 4C1NK 2HQLA 4LF8L 4RGOS 4DAVA 3C2PA 2ICEC 1VQ4A 1OTCA 4NXML 1CKOA 3DWAA 1G91A 3QOLA 2Z4HA 3PCOB 3G6JB 2K5QA 1ASZA 4L63B 2B8GA 4ZUIA 1YJ9A 3DEPA 1KIXA 2ASBA 1GXDC 3KBXA 3NQTA 3MFGA 4DXGA 1NUCA 1V9PA 4FP5D 3RZDB 1TIID 2PO4A 4DR4L 1A3VA 1D5ZC 1CM9A 3SK6A 2SOBA 1BDOA 2N55A 4IJHA 1RODA 4IFDJ 1IYUA 3A56A 1TS4A 3MXNA 1SMYC 5IP7G 4RA8A 1G51A 4M1UB 1OXTA 3B6YA 2JA5H 3MTSA 1JR0D 2AWOA 1IXRA 3CU7A 1I3QB 5L37A 1H95A 4A3JH 3T16A 2MNAA 4A3DG 3MXGA 2KVMA 4RGTA 4O2DA 4YCWA 5M3MB 3M4OB 1IKMA 1K83B 4KLKA 3QG1A 1SYFA 4ABNA 5IIFA 1TY2A 2PNRC 4ZAIA 5ELNA 3RD4A 1SR3A 4K8IA 4RGNA 1JWSD 2QEXA 2B2UC 2K32A 3URYA 2DY7A 4Z9CB 3K5MA 4CKCA 1JE5A 3C1EA 1Q86C 3DEOA 5K36G 1V43A 3BDOA 1EIGA 2GVBA 1Q81C 1CA6A 4KHVA 1XNQQ 4JI1L 1A6XA 2WINB 4HMIA 4K6LA 2D0OA 4JCVE 4V190 1SMYD 5JJKA 1QZHA 1HUNA 3E5SA 3KLRA 4KI0A 5LL6X 5J1ZA 2ZJRA 1V1PB 5HURA 3RZDH 3TMEA 3M7NA 3T51B 1MJEA 2DY8A 5IYDH 3BVZA 4OWXB 1B44D 2Q2UA 2RSOA 3E6ZX 4C56C 4KY6A 1D5MC 1EOTA 2F0PA 3K6OA 5FLMH 2UU9Q 1V1OA 2DUDA 2F0VA 1YIJA 2C5CA 1PRTC 4DV2Q 3HKSA 1N36L 2NVTB 1VF7A 1D6EC 1FJGL 4OWTB 5LMNQ 2RF4A 4EQOA 2HDLA 2L11A 3EVQA 1FNVA 2E2JB 2YV5A 3MVVA 4ZRZA 3I4MH 1WCMH 1I6HB 1A8VA 4UP8A 3A8KE 3BYYB 1JWUD 5EBCA 4G7ZC 4B3TL 1WTHA 3EFXD 1SYCA 5DM73 2Y0SG 4ILWA 3NBHB 4WRDA 2X6GA 3OSOA 4DAMA 1HCZA 3J80E 5JJLA 3J81j 5LMNW 1UUPA 3GQBA 2VB2X 4QL5A 4IPHA 1HNXQ 2KHSA 3PV0A 1KRTA 5A2QE 5IT9L 3PUXA 2E2IH 2OF1A 5C4XB 4JOIA 3A5UA 5G3LF 4DV4L 1F2ZA 1Y1WB 2F0SA 5I2YA 2EXDA 2ZTEA 4C3IB 3DMUA 4KJOA 1KNAA 4A3EH 2HHHQ 1Q46A 4DV5Q 1Z9FA 2GN5A 4A3MG 1CQFA 1RTNA 4JV5Q 5HY6A 3C3LA 4V0BA 3CF5A 1JMCA 4WFN3 1VQCA 5JEAH 3RLFA 1WI5A 4TRDA 4N9PA 2KEDA 1VQKA 5FKAC 3S1QH 1C48A 1STHA 1IHZA 2OTJA 5C6AA 3HG9A 1JT8A 1HR0L 5C3EH 1DOLA 3CCQA 1JJCB 4A93G 5NUCA 3GTKB 2VB3X 3A7AB 3TREA 4LFAQ 3PUYA 4GN4B 3OIPA 4ME5A 5AJ3Q 5ELFA 2LSSA 3SXHA 2LS01 2K05A 3HOWG 1VQDA 4KMUC 2WFWA 1G6PA 1DM0B 2VUMH 4LF6L 4DK1A 2SNMA 2OXPA 4IPGA 3S1RH 1HTLD 3NEMA 3HOVB 1HJPA 2NYZD 3SK8A 2UUAQ 2QKIC 3FP9A 2WKCA 4KJNA 4LJZC 5J22A 2EJMA 1ASYA 1SYBA 2EY5A 3F2DA 1BBXC 1T5EA 3S2HH 3S2DH 3S16B 4A3BB 3GTLB 1EQVA 3QR8A 1SRUA 2LKVA 2F0KA 1F9SA 4UP7A 5C4XH 4XT3B 3J81E 4JI4L 1XNRQ 2G5DA 4R4OA 1VQ8A 1PV4A 1TWCB 4OIKA 1L0WA 4RKBA 2EYOA 1WTRA 2EYPA 3J7ZC 1BCPF 1V1QA 4R8IA 1TWGB 2CVRA 3U9SA 1DCZA 2JA7G 3PO2H 3TDQA 3RNUA 2PNHA 2PZTA 4IFDI 4Q5VA 2Q2HA 1RD9D 2FMMA 4G7OC 4B08A 5DAUA 5BN4A 3I90A 2F0FA 3L0OA 4H44C 2IHEA 1EY7A 1VQ7A 4NPSA 2F0EA 1S5DD 2QW7A 2RDFA 4POGA 2L9HA 1SMXA 4IOAA 2LY7A 1RTOA 5BR8Q 5DM63 3IFDA 5M3FH 2O5JC 4G4KA 1NNXA 1IKLA 4DUYQ 2MO1A 4ZYSA 4YCVA 1STGA 3AFPA 4X65L 3GTPB 4UP9A 4QIWB 1XPRA 5COYA 1U4RA 4JI5Q 4PG3A 1I5FA 4DV6L 2BH8A 5C4ZA 4IUQA 4CJ0B 4GZYC 3QJYA 2B8FA 2CHBD 1PA6A 4YWMA 1XPUA 3KLSX 2E75C 4P73A 2EY1A 3GTLH 3KFUA 5K5PA 1SFOB 2EVBA 1PH4A 1NSNS 3CD6A 2JK8A 4IURA 1VQ6A 4C2MB 1M4VA 3PIOA 1SAPA 1K0SA 1EUJA 5C3WA 2X69A 3FMCA 5CV6A 1RIPA 5EJWA 5BN3A 5I2XA 2EE1A 5FO9B 2EZVA 1XNQL 2F0TA 3E0EA 2HT1A 1CHQD 5JJZA 5JAVA 1TWGH 4HAEA 1H9MA 3Q6SA 2F0WA 4JK1C 2SDFA 4HIDA 3OW7A 4NP5A 4KN7C 1XTDA 5D65A 3HGBA 2JA5G 2R61A 1VF5C 2UUCQ 1TT2A 3NWTA 3J7AV 4A3JG 2OT2A 2F0JA 4JW0A 2FFKB 1HZ9A 3TEHB 4A3GB 1U4MA 2CFMA 3L9AX 2UU9L 1SNQA 5CV8A 2K5DA 1K8AC 5GADC 4JI2Q 4U68A 4ME3A 4OIJA 1KABA 1L1OA 2I07B 5EPKA 4DV2L 1OO9B 1JICA 5GAGC 3GTPH 2PI2A 5EKIA 5TSSA 4RH6A 3CC7A 5IP7H 5LMNL 4JI6Q 3CMEA 3VDYA 2XN9C 5JPNC 1YI2A 4KKSA 3RN5A 1SFOH 4EVOA 3S15H 1JE4A 2CQOA 5H1SE 3P1HA 4C2MH 1XWEA 1C8CA 3UE1A 2Z6KC 1B9MA 3ULLA 4OHJA 2B2WC 3PUVA 4DR5Q 3KJOA 4DR2Q 3D3RA 4FF3A 3A8IE 3EIVA 2JA8B 4XYOA 2TMPA 4GKJQ 5FLMG 3S17B 2Y0SE 1LTGD 4HJAA 4DAYA 3PIP3 1W3SA 2MFIA 1R9TH 4POFA 1Q8IA 1ENCA 1IZ6A 1UE5A 2K33A 3VA7A 4LK1C 3NELA 1NE3A 1PZID 1Q8KA 3NQIA 4DV5L 2HHHL 4RKLA 4AQYL 4X66Q 2IL8A 4X64Q 5M5XH 2EY2A 2K04A 3BZKA 3I4MG 2RCFA 1WCMG 3I4LA 2LXKA 4CDEC 4IPDA 4L5SA 4BS9A 3RUZA 2BDNA 1PTOC 3NXWA 3MZ5A 2R7DA 1BKBA 3NTIA 4C3JB 1XMOQ 4IUUA 3HOZH 4LFAL 2Z9HA 5AJ3L 4GKKQ 1EQTA 1EZ8A 1NBWA 2PZUA 1D2BA 2NZOA 1QVCA 1W6JA 3BVMA 2BCOA 1QZGA 4N8X1 1IBLQ 1P8LA 4QB4A 2UUAL 2N88A 1M1KC 3HOYB 3PMFA 2PCFB 3LNNA 3BS1A 3V05A 4BY7B 4A3EG 3M3YH 4PMCA 4BXXH 2XTIA 3OMGA 1BO0A 2D2CC 3KF8B 3M4PA 1N9WA 1JQYD 2B2YA 1PFMA 4P71A 5JEAG 1N34L 2F3WA 3J7AF 2TSSA 4LF5Q 1TWFB 1H9KA 1NMFA 4K0KQ 4RMFA 1QWYA 1K8MA 3TZDA 4DPGA 1E2VA 1O80A 1N33Q 4TVAB 3WWVA 5C3EG 3T1YQ 3ICEA 1S72A 1JOQA 4JI8Q 1MJCA 1Y1VH 5I6YA 2CWPA 3SDZA 1HZAA 1WOCA 4DR7Q 4DNRB 1LT6D 4KY7A 2X6LA 4A75A 1VQHA 5GAEC 2L55A 2Q8IB 2H4OA 4X3KA 2VUMG 1HA5A 3PGZA 3QIAA 4AYBB 3PF5A 1C0AA 4GOPC 1VQAA 3M85A 3GV6A 4XQQA 4DUYL 2KCNA 4IN3A 1VQLA 4JBMA 1V8QA 1HNZQ 1A3UA 2ZTCA 1HUMA 5KIXA 5C4XG 3J80L 1WTOA 1Q1BA 5M9OA 3P7JA 4BBRB 5IGGA 2N78A 3H0GB 3TBIB 3S14H 4F8MA 2SEBD 1EIYB 3PO2G 4IJLA 1D7QA 3I55A 3A0JA 2Z6BA 2J0TD 1STBA 4R1JA 1BOSA 4LUZA 1XJVA 1SBBB 3DM1A 2E2HB 3M4QA 1KDAA 2IX0A 5ELDA 1HZBA 4LF4Q 4X6AH 5M3FG 1Q90A 2KJXA 1PTOB 4FF1A 4DV3Q 4DAYB 4RHRA 3VYTA 2UUCL 4PMBA 3NHHA 3SHLA 2KHJA 4BBSB 1O7YA 3KUPA 4FVMA 3G6EA 2IW3A 3L3OC 1GUOA 2ALYB 4DR3Q 2WAQE 4JI2L 4K5XA 1E1OA 4A3FB 4LWCA 3K80C 1EZ6A 4K6DA 1X56A 3EN2A 3LGJA 2DGYA 1TY0A 3PF4A 4DUZQ 3T1HQ 3A7LA 5T1IA 2NTSA 3UDFA 3CCVA 1PDQA 4YHHQ 1MHWC 3OPOA 1BNZA 4JI6L 5D3IB 1CKNA 4ZCKA 2EYFA 2R92B 2G9HD 3OIQA 4DU9A 5FLXE 4B3SQ 4LUOA 3HOXH 1VQNA 3HOUH 2E8GA 1PXUA 4CDDC 1II3A 1YBYA 3ER0A 3FRPB 2KHIA 2A68C 1DD2A 1CSPA 4P75A 3MA2B 4P74A 2BE5C 1I50H 4DR5L 3BYTB 1X9NA 1QJOA 1SROA 3OOCA 4QGUA 4GKJL 1HNWQ 2ICIA 2EQSA 1O7ZA 1PTOH 4JBJA 2VQFL 2C35B 2MP1A 1STNA 3NTHA 5FOBB 4OWWB 2WKDA 4GOPB 3ERSX 2AMCB 1KAWA 1JB7A 1B2TA 5T1GA 1SJHD 2CW0D 3P20A 2RDHA 2R7FA 5IE8A 2I5LX 4X64L 2H1EA 4HIMA 1JOOA 4DGZA 2A1AA 4UAIA 2A68D 1CSQA 4KY5A 5M5WB 1B70B 3UDXA 2BE5D 3VR5A 2XRQD 4ALPA 3O13A 1L0YB 1Z6HA 5GROA 3R93A 1MIUA 4IPCA 3Q23A 3Q8DA 1KDBA 3BG3A 2F0UA 4YCUA 1RJTA 1XMOL 1UAPA 4QY7A 1KLGD 2OQ0A 4GKKL 2K75A 2IX3A 1SE3A 3IKJA 1B1ZA 2GA4B 4XQNA 4KHPL 4GNXB 1KRSA 2KECA 1IBLL 3PUWA 5CV4A 4FDBA 1VMCA 3VR3A 2R93B 2Z0SA 5CBAE 1U9RA 4CHTB 1E3PA 1FL0A 3HRZC 3K81C 1J8IA 1Y8NB 2J4XA 5HGTA 3W2DA 4YY3L 2OTLA 1E0BA 1OXXK 2WB1B 1HA6A 2E5LQ 1PH2A 4BY1B 1MSGA 4K0KL 1JC7A 1U4PA 4OL7A 1SYEA 5FK9C 2UXDQ 1HQRD 2J7ZA 3NTKA 4CGYB 1EL0A 3NPPA 3D8GA 3T1YL 4JI8L 1G8ZD 4PMWA 3HOZG 4HIOA 4DR7L 1I3QH 2OEOA 1YVCA 3DWQA 2D0PA 2BDOA 3H09A 1IBKQ 4OO1I 4R9WA 5M3MH 3M4OH 2I46A 1D1KA 2VL6A 1KDCA 1K83H 2KUMA 1I4RA 1DOKA 3KK7A 3FKIB 2K50A 1I4PA 1QCBD 3MWYW 3QO2A 2F0IA 4A3LH 1Q3LA 3U50C 3VR6A 4J6HA 4DK3C 4RCNA 4CDCC 1SE4A 3HZXA 4BXXG 1S4ZA 1HNZL 1JJGA 4UPAA 3C1FA 3CMAA 2VZAA 5CMDA 2YYZA 1GM5A 4LF9Q 1DZ1A 4XDXA 2IJ0A 1CKNB 4B9XA 5HGQA 4H13C 2R93H 1EU4A 1PRTD 4KKUA 3CCMA 3MHBA 2PMZB 2O4XA 4ID6A 1I94Q 1QOHA 1EEID 4BWGB 5EPLA 1RF2D 3E9IA 1Y1VG 3TSSA 2ZJQA 1KC8C 1G2SA 2ATWA 2XWBB 1WJJA 3H3VI 3MFYA 1TU2B 3OTOQ 1H9SA 3M9BA 5IY0A 4A3KB 3I8ZA 1K3RA 1LTTD 2PQAA 4LF4L 4MZ9A 3J80c 2YTYA 3A55A 3H6MA 4IO9A 4DV3L 2NVTH 1TVXA 3IRBA 3X3MA 4KTAA 4JOIC 3X3NA 3I4NB 2K4KA 4LF7Q 1MKHA 4I7ZC 2JA6B 1A15A 3PIO3 3H3VC 3MXNB 4DV1Q 2K1BA 5E4WC 3CKIB 2E2JH 1AN8A 2B63B 1W2BA 2C9OA 5C4JB 4DR3L 3PO3B 2QA4A 4I65A 2CWAA 3SK4A 1LTID 3NWSA 1I6HH 2JA9A 5LMUL 3ND8A 3SR1A 4DUZL 3T1HL 3V2TA 1VQFA 4YHHL 1LTLA 1SNDA 4X62L 1I4HA 2LMCB 4B3SL 1A2TA 4JI7Q 1N32Q 4HSVA 5KNBA 3AMUA 1E2ZA 4K5VA 2VW9A 1Y1WH 3CC2A 4C3IH 3JAME 3OWFA 5C44B 4HCEA 1OXVA 2KCMA 3UI2A 2QCPX 3M4YA 2A74C 3CHBD 1BBWA 2E2DC 2ZTDA 1HNWL 3MXUA 4C1NI 4B3MQ 3NUCA 1HH2P 3MEFA 2R7ZB 3G4SA 1STEA 5D3DA 3SK5A 3I4NH 2MJ8A 2JA6H 3J81c 1Q7YC 3R3OA 4X3UA 4LNQA 2BH2A 3SGIA 1VQPA 3GTKH 5I4DA 1Y69U 2IX1A 1CA5A 3QOJA 2AKWB 2IHFA 1B8AA 2ZXRA 4QQBX 3PO3H 3HOXG 4BBRG 3HOUG 4RGMA 5FJ8H 1PFSA 2ID0A 2K5VA 4QIWE 2MGSA 1P16A 2VS1A 4DR1Q 2HCIA 1EYAA 5CC4A 1A3TA 3K7AB 3HKZB 4LFBQ 1MBYA 3HOVH 2K6AA 2NVXB 2NVQB 1SDFA 3U9OA 3U58A 4A3BH 3S16H 4LFCQ 3C46A 2K5WA 1GOZA 1EU3A 2LXJA 1ENFA 1TWCH 2Q2IA 3AB9A 1BR9A 5C44H 1CHPD 1K3BC 2EIFA 3CW2C 1SXTA 4A3DB 1W6KA 1Q12A 1U5KA 3T4AC 5ELEA 2KENA 2WAQG 3F8TA 4C3HB 1C7YA 1TWHB 1H9SB 5C5MA 1IL8A 4F7XA 3FDTA 2UXDL 5JPMC 3F2UA 1CFMA 3TP7A 4WJ3M 1XPOA 2PQAB 2MPMA 3D6CA 2V4DA 5JVG3 1SNOA 1X55A 1WTQA 2EPBA 4WJ4A 4FO2A 4CBVA 4Y52H 2ZT9C 1MD2D 3NP8A 4OO1H 4LAAA 4BA1I 4NB3A 1IBKL 3JAMi 5I6WA 5JEAJ 3D4RA 1EWHA 1PH7A 3KDFA 4XYQA 3I2ZA 2JEBI 2F0DA 4J15A 2B2WA 3A54A 3CCLA 1NR4A 4MN3A 1HFNA 2B29A 1ZXTA 3CQZB 1ESFA 1OXUA 4LW1A 3QB3A 4LF9L 2NN6I 2F0OA 3GTMB 2KQ3A 1KXLA 3I3CA 1HNXL 3FHWA 5C0XJ 3TN2A 5BN5A 3S9WA 5C4HA 3RLNA 3FPUB 4AH6A 1I94L 1A63A 5E3FA 4LF8Q 4FXDA 3N52A 3AQQA 4HR7B 2V1CC 3H3VH 1RDPD 3CCSA 3GTJB 2KBNA 1KTKA 2WIIB 4GLAC 4APVA 1TWHH 4A3GH 2VNUD 1LYLA 2B2VC 3ONAB 4EGVA 4KHZA 4JV5L 1F9QA 5J39A 5M3MG 3RZOB 5IT9E 3GTQB 3IFTA 1SE2A 2AHOB 4PZ6A 1X6OA 4DNTB 4JBKA 2Y0SB 3KF6A 1XTCD 4H7BA 2UUBQ 4A3LG 5ELBA 1WD1A 3KOJA 1T5XD 5ISRA 1SYDA 3R2IA 1Y8OB 4LF7L 4K5WA 2AQ3B 2A5HA 2F4IA 4JI0Q 2H5XA 4DV1L 1QVGA 4PZ8A 1QB5D 4AIMA 4DV0Q 4B9WA 2XRSD 1ZEQX 3D4DA 2A69C 1TKWB 2R93G 4M8AA 5IOCA 2M9VA 1KLUD 4ODGA 2AWNA 1UNSA 4A3MB 2A6HC 3NENA 3BJUA 3VYUA 3I70A 2EYMA 2Z1CA 4NDXA 1TWAB 5G3LD 4S3SA 2F4VQ 4RAUC 1QUQA 2BA1A 2QF7A 1GO3E 2XIWA 1C9OA 4JG2A 3TP8A 1Q82C 4RG1A 2JA8H 3CCUA 2UXBQ 5KYIA 2MO0A 2K01A 1N32L 2HIVA 4X3SA 3ZJYC 5CBEE 1YHBA 3S17H 4A93B 1J9OA 1XNRL 5M5YB 1NJIC 1RKNA 2CH4A 1PTOD 2MUYA 1STYA 5E1FA 2I5MX 2DJGC 4IUPA 3RN2A 3FPPA 1VQOA 1PH3A 1BXTA 5CYUA 4FF4A 3HOWB 5CV9A 2IWHA 4IFDH 1HPCA 1NCVA 1VQEA 2Z4IA 5KNDA 4K14A 3OHXC 4XT1B 2NZHA 3S1NB 2VY3A 2KOLA 4DA2A 1ZYRC 1K8GA 1EWCA 1RCVD 2AUKA 2B2YC 4B3ML 4Q0FA 4KK7A 1D1IA 1TS5A 1FNUA 1LLRD 4AYBE 5CGKA 1PRTF 3VR2A 5BR8L 1QE6A 1ML0D 2Z8LA 2A19A 4C3JH 1L1OB 3GDEA 3MEHA 4FYDA 1NR2A 4G7HC 1R4PB 4ZKBB 2XNAC 3DXJC 1FJGQ 2F3IA 3D6WA 1YJWA 1E7ZA 3PSIA 1G291 2NVYB 3PUZA 4JI5L 1I4XA 4IUVA 2RCNA 4IUTA 2JA7B 2CQAA 3WDNA 3S1MB 1HXYD 3HOYH 5KYLA 3W1GA 4KKTA 1CK1A 5FO8B 5A2QL 4YWLA 2Q2TA 1Y1WG 3I56A 2B2TC 4C3IG 4BY7H 1WFQA 4N9TA 1VQIA 3MAQA 1SNCA 1EIFA 1CT1D 1ZYRD 4UHVA 4G57A 1O7IA 1QNUA 4OELB 2NBFA 1X3QA 1TWFH 3E9HA 1AZQA 2JEAI 1YZ6A 1BBUA 1F2YA 1EWIA 3SVMA 4GNXC 2AQ1B 3CAMA 1STAA 3KJPA 4R4CA 3I4NG 2LFNA 1UE6A 5EQ0A 2JA6G 1XXGA 2NUCA 1ENAA 4OEMB 4ZLTF 2K28A 5CV7A 2A8VA 2KCTA 4KD3A 1D8LA 2AUJD 1X65A 2RA4A 2D62A 2A73B 3PO3G 2RQXA 3STBC 5FJ8G 3PQIA 4WORA 3TP5A 4EQNA 4UY8C 5IODA 1YNJC 2PW5A 1FR3A 2YTXA 1N8RC 1HFGA 3HOVG 1U0LA 1ICFB 2R6GA 1L0XB 2O2LD 3R8BA 1S40A 3KBGA 4A3BG 1MSHA 3IL8A 2KEEA 1J6QA 4WJWA 3KLWA 3D0FA 1HR0Q 4QJFA 4R8NA 2AQ2B 1YHQA 3D4WA 3F2BA 5E7NA 1VQ9A 4CJ2C 1S5CD 3CRLC 4BBRH 2JA5B 3H0GH 1WTXA 1KD1C 1X3EA 4A3CH 3E3XA 5AFWA 5C44G 5KEEA 4A3JB 2ZJPA 3J81L 5C0XI 1F9RA 4MTNA 3EROA 2XVSA 3CCJA 2NN6H 1BCPB 1QUQB 4DR2L 1VQJA 3K0YA 1AEXA 2R3ZA 5EAYA 1MGSA 4XXEA 1K0RA 2E2HH 4OXPA 1IYJB 1LM0A 4JI4Q 5FLXc 2DNCA 3EA6A 1WTVA 5IWAQ 1I6VC 3DHQA 2XGTA 1PHJA 4GN5A 2M00A 5LHY1 3BVGA 1CQVA 4BBSH 4OO1G 4MHEA 5IYCH 2I5HA 1LACA 4X66L 1FVIA 4JVZA 3HKZG 5ELCA 2F0GA 4A3FH 2UUBL 3UDIA 2N8NA 2BOSA 1R4QB 3K57A 3CCRA 2HD3A 3SEBA 2EDGA 4R4QA 4F88A 4JI0L 2R92H 1FD7D 4DK6C 3JC66 4DV0L 5GQOA 1B9NA 2FJ2A 2B2UA 2RKSA 3U4VA 5I9PA 1PH5A 2JYOA 2ZM6Q 4KN4C 4Y7NB 3BU2A 4X65Q 2VXWA 1JCKB 1H9RA 4U673 2EYJA 3Q24A 1PH9A 3Q22A 4DV6Q 2F4VL 5C3XA 1Q1EA 5KGUA 3TQYA 1B3AA 4ULLA 3QWNA 1FGBD 4OONA 3I4MB 2B3GA 1CTMA 1WCMB 3RMHA 1TS2A 2JQOA 4C3HG 2UXBL 3BZDB 3DWPA 2FINB 3FEWX 4LMQD 1XMQQ 4A3GG 2VQEQ 4J8QA 2WB1E 1JORA 1X3FA 2M2LA 4LF5L 1RL2A 4RCOA 2OCEA 4CKBA 2MQHA 5J3BA 5IGFA 3I73A 5KNCA 2NTTA 2OQKA 3I7FA 3L7ZC 1N33L 1PVOA 1YEZA 3MXPA 4DKAC 4NXNQ 1YITA 1LT5D 1SEBD 2E2IB 4GS3A 4NKLA 3L2PA 1LTRD 2QEJC 2O5IC 1M90C 4BA2I 3ZYYX 2B39A 5IGCA 5M5WH 1CZGA 1YJNA 1EY4A 1J5EQ 4A3EB 1HRJA 3CRKC 3VR4A 1GD7A 1EY9A 4XQJA 4H0LC 3K5LA 1X54A 4KD4A 1S3OA 1IW7C 2D9UA 3S1QB 4E6IA 4CJ1B 4Y7NH 2JA8G 2EJFC 4O0AA 2K5NA 3I4OA 1VCIA 5LL6S 5C3EB 3VA5A 3V96A 4JYAQ 1H9JA 1LT4D 3F1ZA 2K03A 4XIGS 1SYGA 4PQXA 4L6TB 1S5FD 4HSPA 4IOCA 1EOVA 1BUVT 1S5BD 1TS3A 2PMZE 4JBWA 1D5XC 4HCSA 4RWSC 4IFDG 4P2CB 2VUMB 4LUVA 5FO7B 1XX8A 3S1RB 1A2UA 3J7YW 3E0JA 2A6EC 4HN7A 1ZKOA 2CH4W 1U4LA 2CKZB 1GUWA 2JXMB 1PH6A 2IPKD 4BY1H 1EY0A 5ELOA 3S2HB 2N49A 5IGEA 2NWGA 3S2DB 2EYHA 2QDLA 2F03A 2EY6A 1LABA 1MI2A 1NMGA 1O78A 2L5TA 3D31A 4RHSA 1IW7D 3W5OA 3CPWA 1DYQA 4JPBW 5GAHC 1ONLA 4FNFA 1AW7A 4C3JG 2D5DA 3K8AA 3OWEB 1X3GA 1AE2A 1PLFA 1GUGA 1Z47A 4N8FA 1CZWA 4P72A 4AQYQ 1SJED 3PO2B 3FKIH 4HJ7A 1WVLA 4XTCS 1B3QA 3DM3A 3HOYG 1Z7TA 1LTSD 1PTOF 3MC0B 1KQSA 5E4XA 4K8JA 4BY7G 1KL9A 1A62A 2A6ED 3ERQA 4HJ8A 4NW2A 3VYSA 2EYLA 3TS0A 3GO5A 3Q0AA 1I4QA 5DLQE 4A3IB 5M3FB 1GUTA 1G2TA 3RR5A 1TXYA 3CC4A 1CKMA 1K9MC 3HEJA 4K2LA 4RFBA 4IQZA 3VYRA 5C0XH 3GTGB 1AZPA 1PYWD 2DJFC 2E74C 4HEDA 4QF4A 4L5TA 1X3PA 2FMCA 2XSCA 5I9OA 1YNXA 2N3SA 2KA7A 5C5LA 5IYBH 2JSOA 2PW7A 2FXQA 4ZK9B 4B3RQ 1G6ZA 2F1MA 1IBMQ 4A3KH 1AP0A 1VQ5A 4GLXA
chains in the Genus database with same CATH topology
2JP1A 1X32A 4HMJA 1LTBD 4PNYA 5EPJA 1EY6A 1PRTB 2K7VA 2Q8RE 1EEFD 4O42A 4DXFA 1JB3A 1SNPA 3K58A 1XYIA 2ZXPA 1EFID 1WD0A 4X3TA 3GD7A 1PZKD 4OGQC 2NN6G 4F87A 1VDZA 3H91A 1EY8A 5DEHA 1O7LA 1GUNA 1F2MA 1F9PA 1SSOA 4L8JA 1QG7A 2ENBA 3A8JE 2DN8A 4TSSA 4MIUA 1EIHA 1I4GA 3KF8A 2NB0A 3ITPA 3S15B 1EYCA 3NK9A 4DN4M 1RHPA 3T53B 2PQEA 3TP6A 4NMZA 2HCCA 2F3VA 1KAAA 2WP8J 3P75A 2NZ1D 1DONA 1TR5A 1R9TB 3OMCA 3HS0C 4QUCA 1DOMA 5FLXL 1ILPA 2PZWA 3NE5B 1GHKA 3LWUA 5M5XB 4K2KA 1B50A 3K5NA 4ZUJA 5A35A 4QCLA 3GTOB 1HHVA 1OXSC 2FHTA 3HOZB 1VMPA 1AFPA 3T56B 3DUZA 3ND9A 1Y8PB 1B4OA 2KCCA 4YIJA 3N6RA 2B2VA 1IYVA 2G9DA 1ILQA 1JOKA 1BQQT 3M3YB 5EBDA 3TZUA 1JWMD 2IT1A 2MHVA 5EKLA 5D14A 5K36H 1C4QA 1QILA 3NBIA 4IZ8A 1UEAB 5IGDA 1WTWA 1QNKA 4KV6A 3FVQA 2Q8TA 3W3AA 3BDCA 3HP3A 1PFBA 1PFNA 2EOTA 1Y1VB 4DF7A 3H94A 1F77A 3AU7A 2WACA 1LTAD 1TQOA 2L0CA 1WTPA 4FF2A 5EKKA 2DNEA 5F2DA 1NAPA 1LT3D 2F0QA 2HQEA 1ICWA 2HDMA 4IUNA 1HQMC 2F0LA 1DJRD 4PV1C 1GJXA 4O1NA 5CV5A 3T13A 3WOEA 1BCPC 1B53A 3GP7A 2EXZA 4IALA 3S14B 2A69D 1KNEA 3K59A 1ET9A 5DNFA 2A6HD 2F0HA 3EQLC 1SNMA 2RBMA 2YU9B 2F0NA 4DK0A 4HTHA 1M8AA 2RDGA 4DFAA 3SE0A 4TQUS 2E76C 3M7GA 3BDLA 2BA0A 3NSWA 5C0XG 4DAPA 3IAYA 5CR3A 2B2TA 1F2LA 4TKOB 3GV3A 1BCPD 2PPBC 1ET6A 3K5OA 3LX0A 5CORA 2HUGA 5IGBA 1GHJA 1S5ED 3G7LA 4ZQ3A 4CKEA 2L12A 3HOXB 3HOUB 1GUSA 3WOFA 1BF4A 5JOBA 1YNNC 2WV6D 1EYDA 1PMRA 1V1PA 2RVLA 2SNSA 2QILA 3KLSA 1DXMA 1I50B 3I72A 1FNWA 1FYCA 3EJIA 2PYKA 3I91A 4QMGA 4QUFA 5JVH3 5KRUA 2EJGC 5EGTA 1LV9A 1HTPA 1K8OA 3R2TA 2QDBA 1CI3M 1YNND 2WAQB 1E2WA 2ZXOA 2F0MA 1LO5D 2RSNA 2L1BA 1EY5A 1PZJD 4J1MA 1ESRA 3JAML 3NBHA 4UDUC 4FXKC 3LWEA 1YNJD 2L4NA 2CW0C 2JE6I 4FXGC 4EQPA 4ZKCB 2XWJB 4C1NK 4RGOS 4DAVA 3C2PA 2ICEC 3DWAA 1G91A 3QOLA 2Z4HA 3G6JB 2K5QA 4L63B 2B8GA 4ZUIA 3DEPA 1GXDC 3KBXA 3NQTA 3MFGA 4DXGA 1NUCA 4FP5D 3RZDB 1TIID 2PO4A 1A3VA 1D5ZC 1CM9A 3SK6A 2SOBA 1BDOA 2N55A 1RODA 4IFDJ 1IYUA 3A56A 1TS4A 3MXNA 1SMYC 4RA8A 4M1UB 1OXTA 3MTSA 1JR0D 2AWOA 3CU7A 1I3QB 3T16A 3MXGA 2KVMA 4RGTA 5M3MB 3M4OB 1IKMA 1K83B 3QG1A 1SYFA 4ABNA 5IIFA 1TY2A 2PNRC 4ZAIA 3RD4A 4K8IA 4RGNA 1JWSD 2B2UC 2K32A 3URYA 2DY7A 4Z9CB 3K5MA 4CKCA 3C1EA 5K36G 3DEOA 1V43A 3BDOA 1EIGA 1CA6A 4KHVA 1A6XA 2WINB 4HMIA 4K6LA 4V190 1SMYD 1HUNA 3E5SA 3KLRA 4KI0A 5LL6X 5J1ZA 1V1PB 5HURA 3TMEA 3M7NA 3T51B 2DY8A 3BVZA 1B44D 2RSOA 3E6ZX 4C56C 4KY6A 1D5MC 1EOTA 2F0PA 3K6OA 1V1OA 2F0VA 2C5CA 1PRTC 2NVTB 1VF7A 1D6EC 4EQOA 2HDLA 2L11A 3EVQA 1FNVA 2E2JB 3MVVA 4ZRZA 1I6HB 3A8KE 3BYYB 1JWUD 5EBCA 4G7ZC 3EFXD 1SYCA 5DM73 4ILWA 4WRDA 2X6GA 3OSOA 1HCZA 3J80E 1UUPA 3GQBA 2VB2X 2KHSA 3PV0A 5A2QE 5IT9L 3PUXA 2OF1A 5C4XB 5G3LF 1F2ZA 1Y1WB 2F0SA 5I2YA 4C3IB 3DMUA 4KJOA 1KNAA 1CQFA 1RTNA 3C3LA 4V0BA 4WFN3 5JEAH 3RLFA 4TRDA 4N9PA 2KEDA 5FKAC 1C48A 1STHA 1IHZA 5C6AA 3HG9A 1DOLA 5NUCA 3GTKB 2VB3X 3A7AB 3PUYA 4ME5A 3OIPA 5ELFA 3SXHA 2LS01 2K05A 4KMUC 1DM0B 4DK1A 2SNMA 2OXPA 1HTLD 3HOVB 2NYZD 3SK8A 2QKIC 2WKCA 4KJNA 4LJZC 5J22A 2EJMA 1SYBA 2EY5A 1BBXC 1T5EA 4A3BB 3S16B 3GTLB 1EQVA 2LKVA 2F0KA 1F9SA 4XT3B 3J81E 1TWCB 4OIKA 4RKBA 2EYOA 1WTRA 2EYPA 1BCPF 4R8IA 1TWGB 2CVRA 3U9SA 1DCZA 3TDQA 4IFDI 2PZTA 4Q5VA 1RD9D 2FMMA 4G7OC 4B08A 5DAUA 5BN4A 3I90A 2F0FA 4H44C 1EY7A 2F0EA 1S5DD 2RDFA 2L9HA 2LY7A 1RTOA 5DM63 3IFDA 2O5JC 4G4KA 1IKLA 4ZYSA 1STGA 3GTPB 4QIWB 5COYA 1U4RA 5C4ZA 4IUQA 4CJ0B 4GZYC 3QJYA 2B8FA 2CHBD 3KLSX 2E75C 2EY1A 5K5PA 1SFOB 2EVBA 1NSNS 4IURA 4C2MB 1M4VA 1SAPA 5C3WA 2X69A 3FMCA 5CV6A 5EJWA 5BN3A 5I2XA 2EE1A 5FO9B 2EZVA 2F0TA 1CHQD 5JJZA 5JAVA 4HAEA 1H9MA 3Q6SA 2F0WA 4JK1C 2SDFA 3OW7A 4NP5A 4KN7C 5D65A 3HGBA 2R61A 1VF5C 1TT2A 3NWTA 3J7AV 2OT2A 2F0JA 2FFKB 4A3GB 1U4MA 3L9AX 1SNQA 5CV8A 2K5DA 4U68A 4OIJA 1KABA 2I07B 5EPKA 1OO9B 1JICA 5EKIA 5TSSA 4RH6A 2XN9C 5JPNC 4KKSA 4EVOA 1JE4A 3P1HA 1XWEA 1C8CA 1B9MA 4OHJA 2B2WC 3PUVA 3D3RA 4FF3A 3A8IE 2JA8B 4XYOA 2TMPA 3S17B 1LTGD 4DAYA 3PIP3 1Q8IA 1ENCA 2K33A 3VA7A 4LK1C 1PZID 3NQIA 4RKLA 2IL8A 2EY2A 2K04A 3I4LA 4BS9A 3RUZA 2BDNA 1PTOC 3NXWA 3MZ5A 3NTIA 4C3JB 4IUUA 1EQTA 1EZ8A 2PZUA 1D2BA 1W6JA 3BVMA 2BCOA 4QB4A 2N88A 3HOYB 3PMFA 2PCFB 3LNNA 3BS1A 3V05A 4BY7B 4PMCA 3OMGA 1BO0A 2D2CC 1JQYD 2B2YA 1PFMA 5JEAG 2F3WA 3J7AF 2TSSA 1TWFB 1H9KA 1QWYA 1K8MA 3TZDA 1E2VA 1O80A 1JOQA 5I6YA 3SDZA 4DNRB 1LT6D 4KY7A 2X6LA 2L55A 2Q8IB 4X3KA 2H4OA 1HA5A 3QIAA 4AYBB 3M85A 3GV6A 4XQQA 2KCNA 4IN3A 1V8QA 1A3UA 1HUMA 5KIXA 3J80L 1WTOA 1Q1BA 5M9OA 3P7JA 4BBRB 5IGGA 3H0GB 3TBIB 4F8MA 2SEBD 2J0TD 1STBA 1BOSA 1SBBB 3DM1A 2E2HB 1KDAA 2IX0A 5ELDA 1Q90A 2KJXA 1PTOB 4FF1A 4RHRA 3VYTA 4PMBA 3NHHA 3SHLA 4BBSB 1O7YA 3KUPA 4FVMA 2IW3A 3L3OC 1GUOA 4K5XA 4A3FB 4K6DA 1EZ6A 1TY0A 3A7LA 5T1IA 2NTSA 1PDQA 3OPOA 1BNZA 5D3IB 2R92B 2EYFA 2G9HD 3OIQA 4DU9A 5FLXE 1PXUA 1II3A 3FRPB 2A68C 1DD2A 3MA2B 2BE5C 3BYTB 1QJOA 3OOCA 2ICIA 1O7ZA 1PTOH 2MP1A 1STNA 3NTHA 5FOBB 2WKDA 1B2TA 5T1GA 1SJHD 2CW0D 3P20A 2RDHA 2H1EA 1JOOA 4DGZA 4UAIA 2A68D 4KY5A 5M5WB 2BE5D 3VR5A 2XRQD 3O13A 1L0YB 1Z6HA 3R93A 3Q23A 1KDBA 3BG3A 2F0UA 1RJTA 1UAPA 1KLGD 2IX3A 1SE3A 3IKJA 1B1ZA 2GA4B 4XQNA 2KECA 3PUWA 5CV4A 1VMCA 3VR3A 2R93B 5CBAE 1U9RA 4CHTB 3HRZC 1J8IA 1Y8NB 2J4XA 5HGTA 3W2DA 1E0BA 1OXXK 2WB1B 1HA6A 4BY1B 1MSGA 1JC7A 1U4PA 4OL7A 1SYEA 5FK9C 1HQRD 2J7ZA 3NTKA 4CGYB 1EL0A 3NPPA 3D8GA 1G8ZD 4PMWA 2OEOA 3DWQA 2BDOA 3H09A 4OO1I 4R9WA 2I46A 1D1KA 1KDCA 2KUMA 1I4RA 1DOKA 3KK7A 3FKIB 1I4PA 1QCBD 3MWYW 3QO2A 2F0IA 1Q3LA 3VR6A 4J6HA 4RCNA 1SE4A 3HZXA 1S4ZA 3C1FA 5CMDA 2YYZA 1DZ1A 4XDXA 2IJ0A 4B9XA 4H13C 1EU4A 1PRTD 4KKUA 3MHBA 2PMZB 2O4XA 4ID6A 1QOHA 1EEID 4BWGB 5EPLA 1RF2D 3TSSA 1G2SA 2XWBB 3MFYA 1TU2B 1H9SA 4A3KB 3I8ZA 1LTTD 3A55A 3H6MA 1TVXA 3X3MA 4KTAA 3X3NA 3I4NB 4I7ZC 2JA6B 1A15A 3PIO3 3H3VC 2K1BA 5E4WC 3CKIB 1AN8A 2B63B 2C9OA 5C4JB 3PO3B 4I65A 3SK4A 1LTID 3NWSA 3ND8A 3SR1A 3V2TA 1SNDA 1I4HA 2LMCB 1A2TA 4HSVA 5KNBA 3AMUA 1E2ZA 4K5VA 3JAME 3OWFA 5C44B 4HCEA 1OXVA 3UI2A 2QCPX 3M4YA 2A74C 3CHBD 2E2DC 3MXUA 4C1NI 3NUCA 2R7ZB 1STEA 5D3DA 3SK5A 2MJ8A 3R3OA 4X3UA 5I4DA 1Y69U 2IX1A 1CA5A 3QOJA 2ZXRA 4RGMA 2ID0A 2MGSA 2HCIA 1EYAA 5CC4A 1A3TA 3K7AB 3HKZB 1MBYA 2K6AA 2NVXB 2NVQB 1SDFA 3U9OA 3C46A 2K5WA 1GOZA 1EU3A 1ENFA 3AB9A 1BR9A 1CHPD 1SXTA 4A3DB 1W6KA 1Q12A 3T4AC 5ELEA 4C3HB 1TWHB 1H9SB 5C5MA 1IL8A 4F7XA 3FDTA 5JPMC 3F2UA 1CFMA 3TP7A 2MPMA 3D6CA 2V4DA 5JVG3 1SNOA 1WTQA 2EPBA 4FO2A 4CBVA 2ZT9C 1MD2D 3NP8A 4OO1H 4LAAA 4BA1I 5I6WA 5JEAJ 3D4RA 1EWHA 4XYQA 2JEBI 2F0DA 2B2WA 3A54A 1NR4A 4MN3A 1HFNA 1ZXTA 3CQZB 1ESFA 1OXUA 3QB3A 2NN6I 2F0OA 3GTMB 2KQ3A 3I3CA 5C0XJ 3TN2A 5BN5A 3S9WA 5C4HA 3FPUB 5E3FA 4FXDA 3N52A 4HR7B 1RDPD 3GTJB 1KTKA 2WIIB 2VNUD 2B2VC 3ONAB 4EGVA 4KHZA 1F9QA 5J39A 3RZOB 5IT9E 3GTQB 3IFTA 1SE2A 4DNTB 2Y0SB 1XTCD 4H7BA 5ELBA 1WD1A 1T5XD 5ISRA 1SYDA 3R2IA 1Y8OB 4K5WA 2AQ3B 2A5HA 2F4IA 1QB5D 4B9WA 2XRSD 1ZEQX 3D4DA 2A69C 1TKWB 4M8AA 5IOCA 2M9VA 1KLUD 4ODGA 2AWNA 1UNSA 4A3MB 2A6HC 3VYUA 3I70A 2EYMA 2Z1CA 4NDXA 1TWAB 5G3LD 4S3SA 4RAUC 2BA1A 2QF7A 2XIWA 3TP8A 5KYIA 2K01A 4X3SA 5CBEE 4A93B 1J9OA 5M5YB 1RKNA 1PTOD 2MUYA 1STYA 5E1FA 4IUPA 3FPPA 4FF4A 1BXTA 5CYUA 3HOWB 5CV9A 2IWHA 4IFDH 1HPCA 1NCVA 2Z4IA 5KNDA 4K14A 3OHXC 4XT1B 3S1NB 2KOLA 4DA2A 1ZYRC 1EWCA 1RCVD 2AUKA 2B2YC 4Q0FA 4KK7A 1D1IA 1TS5A 1FNUA 1LLRD 5CGKA 1PRTF 3VR2A 1QE6A 1ML0D 2Z8LA 3MEHA 4FYDA 1NR2A 4G7HC 1R4PB 4ZKBB 2XNAC 3DXJC 3D6WA 1G291 2NVYB 3PUZA 1I4XA 4IUVA 4IUTA 2JA7B 2CQAA 3WDNA 3S1MB 1HXYD 5KYLA 4KKTA 1CK1A 5FO8B 5A2QL 2B2TC 4C3IG 4N9TA 3MAQA 1SNCA 1CT1D 1ZYRD 4G57A 1QNUA 2NBFA 1X3QA 1AZQA 2JEAI 1F2YA 3SVMA 2AQ1B 1STAA 2LFNA 5EQ0A 1XXGA 2NUCA 1ENAA 4ZLTF 2K28A 5CV7A 4KD3A 2AUJD 2RA4A 2D62A 2A73B 2RQXA 4WORA 3TP5A 4EQNA 5IODA 1YNJC 2PW5A 1FR3A 1HFGA 2R6GA 1L0XB 2O2LD 3R8BA 3KBGA 1MSHA 3IL8A 2KEEA 4WJWA 4R8NA 2AQ2B 3D4WA 4CJ2C 1S5CD 3CRLC 2JA5B 1WTXA 5AFWA 5KEEA 4A3JB 3J81L 5C0XI 1F9RA 3EROA 2XVSA 2NN6H 1BCPB 3K0YA 1AEXA 2R3ZA 1MGSA 4XXEA 2DNCA 3EA6A 1WTVA 1I6VC 3DHQA 2M00A 5LHY1 3BVGA 1CQVA 4OO1G 4MHEA 1LACA 5ELCA 2F0GA 2BOSA 1R4QB 3K57A 3SEBA 2EDGA 4F88A 1FD7D 1B9NA 2FJ2A 2B2UA 2RKSA 5I9PA 2JYOA 4KN4C 4Y7NB 2VXWA 1JCKB 1H9RA 4U673 2EYJA 3Q24A 3Q22A 5C3XA 1Q1EA 5KGUA 1B3AA 4ULLA 3QWNA 1FGBD 3I4MB 1CTMA 1WCMB 3RMHA 1TS2A 4C3HG 3BZDB 3DWPA 2FINB 3FEWX 4LMQD 4J8QA 1JORA 2M2LA 4RCOA 4CKBA 5IGFA 3I73A 5KNCA 2NTTA 3L7ZC 3MXPA 1LT5D 1SEBD 2E2IB 4NKLA 1LTRD 2QEJC 2O5IC 4BA2I 3ZYYX 2B39A 5IGCA 1CZGA 1EY4A 1HRJA 4A3EB 3CRKC 3VR4A 1EY9A 4XQJA 4H0LC 3K5LA 4KD4A 1IW7C 2D9UA 3S1QB 4E6IA 4CJ1B 2EJFC 1VCIA 5LL6S 5C3EB 3VA5A 3V96A 1H9JA 1LT4D 2K03A 4XIGS 1SYGA 4PQXA 4L6TB 1S5FD 4HSPA 1BUVT 1S5BD 1TS3A 4JBWA 1D5XC 4HCSA 4RWSC 4IFDG 4P2CB 2VUMB 5FO7B 1XX8A 3S1RB 1A2UA 3J7YW 3E0JA 2A6EC 4HN7A 1ZKOA 1U4LA 1GUWA 2JXMB 2IPKD 1EY0A 3S2HB 5IGEA 2NWGA 3S2DB 2EYHA 2F03A 2EY6A 1LABA 1MI2A 1O78A 2L5TA 3D31A 4RHSA 1IW7D 1DYQA 1ONLA 4FNFA 1AW7A 4C3JG 2D5DA 3OWEB 1PLFA 1GUGA 1Z47A 1CZWA 1SJED 3PO2B 1WVLA 4XTCS 1Z7TA 1LTSD 1PTOF 3MC0B 5E4XA 4K8JA 2A6ED 3ERQA 4NW2A 3VYSA 2EYLA 3GO5A 3Q0AA 1I4QA 4A3IB 5M3FB 1GUTA 1G2TA 3HEJA 4K2LA 4RFBA 4IQZA 3VYRA 5C0XH 3GTGB 1AZPA 1PYWD 2E74C 4HEDA 4QF4A 1X3PA 2FMCA 2XSCA 5I9OA 2KA7A 5C5LA 2JSOA 2PW7A 4ZK9B 1G6ZA 2F1MA 1AP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP1 A;  1G2S A;  1X32 A;  4CJ1 B;  5JJZ A;  3D6W A;  3R93 A;  1WTV A;  1HUN A;  1B50 A;  4HAE A;  3Q6S A;  4IUV A;  1KNE A;  4IUT A;  4IUU A;  2RSN A;  2L1B A;  2SDF A;  3DM1 A;  3I8Z A;  5DNF A;  5EPJ A;  1RJT A;  2K05 A;  2K03 A;  1SDF A;  2B2V C;  1EQT A;  3ONA B;  1F9Q A;  1HHV A;  2DY8 A;  5D65 A;  1ESR A;  2B2T C;  4MHE A;  2RSO A;  2FHT A;  2NYZ D;  2Q8R E;  1M8A A;  4O42 A;  1EOT A;  1VMP A;  3LWE A;  1TVX A;  2FFK B;  2N88 A;  2KEC A;  1U4M A;  2L4N A;  1WD1 A;  4HCS A;  4RWS C;  1BBX C;  1O7Y A;  3KUP A;  1VMC A;  1XX8 A;  1X3Q A;  1A15 A;  1XYI A;  1B4O A;  5CBA E;  4U68 A;  1AZQ A;  4ZKC B;  4OIJ A;  1U4L A;  1GUW A;  1BO0 A;  2K1B A;  5E4W C;  1F9S A;  3SVM A;  1J8I A;  5EPK A;  2B2Y A;  2B2V A;  4XT3 B;  1WD0 A;  4X3T A;  1JIC A;  1PFM A;  2NWG A;  5EKI A;  4OIK A;  2B2T A;  1ILQ A;  1G91 A;  1E0B A;  5EQ0 A;  1F2L A;  2B2U A;  2FJ2 A;  1WTR A;  1MI2 A;  2JYO A;  4ZLT F;  2HDL A;  2K28 A;  3GV3 A;  1HA6 A;  3H91 A;  3DEP A;  2L11 A;  5T1I A;  4R8I A;  2CVR A;  1PDQ A;  2VXW A;  1MSG A;  5D14 A;  1BNZ A;  3TZD A;  1U4P A;  2RA4 A;  3KBX A;  5COR A;  1O80 A;  2HUG A;  2J7Z A;  4RAU C;  1IL8 A;  1EL0 A;  2FMM A;  3FDT A;  1WTW A;  1PLF A;  2XIW A;  3F2U A;  1B3A A;  1CM9 A;  1F9P A;  1QNK A;  1SSO A;  1JE4 A;  3G7L A;  3I90 A;  2Q8T A;  1QG7 A;  4HSV A;  2N55 A;  1HFG A;  2K01 A;  2X6L A;  4X3S A;  2MPM A;  5CBE E;  1C8C A;  1ROD A;  2L12 A;  2X6G A;  1WVL A;  2B2W C;  3HP3 A;  1PFB A;  1WTQ A;  2FIN B;  4LMQ D;  1BF4 A;  1J9O A;  1PFN A;  2EPB A;  2EOT A;  2L9H A;  1EIH A;  1RTO A;  4X3K A;  3IFD A;  1MSH A;  3IL8 A;  4RA8 A;  4R9W A;  2KEE A;  5E4X A;  3MTS A;  2M2L A;  2KUM A;  2RVL A;  1IKL A;  1DOK A;  4NW2 A;  4DN4 M;  4IUP A;  3GV6 A;  3MWY W;  3QO2 A;  3UI2 A;  1RHP A;  1Q3L A;  2KVM A;  4CJ2 C;  5COY A;  1G2T A;  1NCV A;  1O7Z A;  1U4R A;  1IKM A;  1HUM A;  1WTX A;  1KNA A;  1S4Z A;  5AFW A;  1WTP A;  2B2W A;  2HCC A;  1NR4 A;  2HCI A;  3I91 A;  2MP1 A;  4MN3 A;  4IUQ A;  4XT1 B;  1ZXT A;  1HFN A;  1RTN A;  4CJ0 B;  2KOL A;  5CMD A;  4ZAI A;  1WTO A;  3P7J A;  1NAP A;  4QUF A;  2NZ1 D;  1F9R A;  1AZP A;  1B2T A;  2B2Y C;  5T1G A;  4HED A;  1DON A;  4XDX A;  1DZ1 A;  1X3P A;  2MJ8 A;  1ICW A;  2IL8 A;  1HRJ A;  2KED A;  4X3U A;  2HDM A;  4ZKB B;  2B2U C;  3I3C A;  1LV9 A;  2K04 A;  2DY7 A;  1CA5 A;  1QE6 A;  2H1E A;  4IUR A;  3DEO A;  2R3Z A;  1ML0 D;  1SAP A;  4UAI A;  3TN2 A;  1EIG A;  1DOM A;  1MGS A;  4QUC A;  4ZK9 B;  1CA6 A;  1G6Z A;  3FPU B;  5EPL A;  1ILP A;  1DOL A;  2X69 A;  1AP0 A;  2BDN A;  5EJW A;  2MGS A;  1NR2 A;  2EE1 A;  1B53 A;  2D9U A;  3N52 A; 
#chains in the Genus database with same CATH topology
 2JP1 A;  1X32 A;  1AH9 A;  1N34 Q;  4AYB G;  4HMJ A;  1LTB D;  4PNY A;  5JJI A;  5IWA L;  5EPJ A;  4L5R C;  1EY6 A;  4DR6 Q;  3CP0 A;  1PRT B;  1JJ2 A;  2K7V A;  2Q8R E;  1EEF D;  4O42 A;  4DXF A;  1JB3 A;  2B63 H;  1SNP A;  3JAM c;  5C4J H;  3K58 A;  3H0G G;  1XYI A;  2ZXP A;  4A3C G;  1EFI D;  3HKZ E;  3DLL A;  1WD0 A;  4X3T A;  3J80 i;  3GD7 A;  1E1T A;  4A3I H;  1PZK D;  5IP9 H;  4OGQ C;  2NN6 G;  1VQG A;  4F87 A;  1VDZ A;  3H91 A;  1EY8 A;  2ZM6 L;  4MTK A;  5DEH A;  3GTG H;  1O7L A;  1GUN A;  1F2M A;  4YWK A;  1F9P A;  1SSO A;  4L8J A;  1QG7 A;  2ENB A;  3A8J E;  2DN8 A;  4TSS A;  1E22 A;  3J7A 5;  4MIU A;  1EIH A;  1I4G A;  3KF8 A;  4BBS G;  4CDF C;  2NB0 A;  3ITP A;  1XMQ L;  3S15 B;  1EYC A;  5IYC G;  3K7U C;  3NK9 A;  2VQE L;  4DN4 M;  2UXC Q;  2E5L L;  3TS2 A;  1RHP A;  3T53 B;  2R7Z H;  4A3F G;  2PQE A;  3TP6 A;  4NMZ A;  2HCC A;  4NXN L;  2F3V A;  1KAA A;  1PH8 A;  2WP8 J;  2K5H A;  4JI3 Q;  3P75 A;  2R92 G;  2NZ1 D;  1DON A;  1TR5 A;  1R9T B;  1FGU A;  4OX9 Q;  3OMC A;  3UDG A;  1J5E L;  3HS0 C;  3K7A H;  4QUC A;  1DOM A;  5FLX L;  2NVX H;  1ILP A;  2PZW A;  2NVQ H;  3NE5 B;  1GHK A;  3LWU A;  5M5X B;  3ULJ A;  4K2K A;  2Z6K A;  1B50 A;  3K5N A;  4ZUJ A;  5A35 A;  3J81 i;  1L1O C;  4QCL A;  3GTO B;  4JYA L;  1HHV A;  3S24 A;  1OXS C;  2FHT A;  4A4I A;  3HOZ B;  1VMP A;  1AFP A;  3T56 B;  3DUZ A;  4R4I A;  1Y14 B;  4A3D H;  1PYS B;  3ND9 A;  4DV7 Q;  1EQR A;  2I0Q A;  1Y8P B;  1B4O A;  1EYG A;  2KCC A;  4PZ7 A;  4YIJ A;  4R4T A;  3N6R A;  3K0X A;  4NXM Q;  2B2V A;  1IYV A;  2G9D A;  4GN3 B;  4C3H H;  1ILQ A;  1JOK A;  5IYD G;  3OTO L;  1BQQ T;  3M3Y B;  5EBD A;  3TZU A;  1JWM D;  4EX5 A;  1DGS A;  2IT1 A;  2HIX A;  2MHV A;  5EKL A;  5D14 A;  5K36 H;  1NY4 A;  1KHI A;  1C4Q A;  2P5Z X;  3BZC A;  4DR4 Q;  1QIL A;  1UE7 A;  3NBI A;  4IZ8 A;  1QVF A;  1UEA B;  2VQF Q;  5IGD A;  1WTW A;  2F52 A;  1QNK A;  4KV6 A;  3FVQ A;  2Q8T A;  1L2F A;  3W3A A;  3W1B A;  1AE3 A;  1EQQ A;  3BDC A;  1VQM A;  3HP3 A;  1CUK A;  1PFB A;  1PFN A;  2EOT A;  4HJ5 A;  1Y1V B;  3OW2 A;  1SLJ A;  4DF7 A;  3G48 A;  2OWO A;  1VQB A;  3H94 A;  1F77 A;  5IT9 c;  3CQZ H;  3AU7 A;  1PH1 A;  2WAC A;  1EFW A;  1E24 A;  1LTA D;  1TQO A;  3KYH C;  3GTO H;  4L5Q A;  2L0C A;  2WB1 G;  1GKH A;  3GTM H;  1WTP A;  1VS0 A;  4FF2 A;  2L15 A;  3A5Z B;  5EKK A;  2DNE A;  5F2D A;  4BY1 G;  4JI7 L;  1LUZ A;  1NAP A;  2ES2 A;  1LT3 D;  2F0Q A;  2HQE A;  3H15 A;  1ICW A;  2HDM A;  4IUN A;  4KHP Q;  1HQM C;  1K28 A;  4JI1 Q;  2F0L A;  1DJR D;  3GTJ H;  4PV1 C;  4A76 A;  1GJX A;  4O1N A;  4B3R L;  3ULP A;  5CV5 A;  3TRZ A;  3T13 A;  3WOE A;  1BCP C;  1B53 A;  3GP7 A;  1HZC A;  1IBM L;  2IY5 B;  2EXZ A;  4IAL A;  3S14 B;  3RZO H;  2A69 D;  3GTQ H;  4YY3 Q;  3FKI G;  1KNE A;  1WYD A;  1ET9 A;  3K59 A;  5DNF A;  2A6H D;  2F0H A;  3EQL C;  4GLV B;  1SNM A;  2RBM A;  2YU9 B;  2F0N A;  1YHA A;  4GOP A;  2K52 A;  1UEB A;  4DK0 A;  4HTH A;  4DR6 L;  1M8A A;  4DNI A;  2RDG A;  4DFA A;  3CXC A;  3SE0 A;  4TQU S;  3AYH B;  2E76 C;  2JN4 A;  3A74 A;  3BDL A;  1NTG A;  3M7G A;  1N36 Q;  2PI2 E;  2BA0 A;  4DR1 L;  3NSW A;  4A3M H;  5C0X G;  4DAP A;  3IAY A;  1TWA H;  5CR3 A;  1T9H A;  4LFB L;  2B2T A;  2CCZ A;  1F2L A;  4H02 A;  4TKO B;  3EBE A;  3GV3 A;  1BCP D;  2PPB C;  3PIP A;  1ET6 A;  3UE0 A;  3K5O A;  3LX0 A;  5IYB G;  3KDF B;  1UWV A;  2RHQ B;  5COR A;  4LFC L;  2HUG A;  2K14 A;  2YTV A;  4A3K G;  5IGB A;  4B3T Q;  4A93 H;  4HIK A;  3AEV A;  1SN8 A;  5M5Y H;  1GHJ A;  4GNX A;  3OYY A;  1S5E D;  3G7L A;  4ZQ3 A;  4CKE A;  1IL2 A;  2L12 A;  1UE1 A;  3HOX B;  3HOU B;  1GUS A;  3WOF A;  1BF4 A;  3HOW H;  5JOB A;  1YNN C;  2WV6 D;  1EYD A;  1PMR A;  1V1P A;  2RVL A;  1PYB A;  3AFQ A;  2SNS A;  4DV4 Q;  2B63 G;  2QIL A;  3G71 A;  3KLS A;  3S1N H;  1DXM A;  2UXC L;  1I50 B;  3I72 A;  2YU9 H;  1FNW A;  4EQ5 A;  1FYC A;  4JC0 A;  3EJI A;  2PYK A;  2QGQ A;  3I91 A;  3F2C A;  3HFZ B;  3RLO A;  4QMG A;  2GVA A;  4QUF A;  5JVH 3;  4A3I G;  3KF6 B;  4JI3 L;  5IP9 G;  5KRU A;  2EJG C;  5EGT A;  1LV9 A;  3CCE A;  1SE8 A;  1HTP A;  2NVY H;  4OX9 L;  3U4Z A;  2JA7 H;  1K8O A;  3S1M H;  3R2T A;  2QDB A;  1CI3 M;  4MNO A;  1YNN D;  2WAQ B;  1E2W A;  2ZXO A;  1B7Y B;  2F0M A;  1LO5 D;  2RHS B;  2JJQ A;  2RSN A;  2L1B A;  3CPF A;  1EY5 A;  4LF6 Q;  1PZJ D;  4J1M A;  1BVS A;  5LMU Q;  3STB D;  1ESR A;  3JAM L;  3NBH A;  1HR0 W;  4X62 Q;  4UDU C;  4FXK C;  1GVP A;  3LWE A;  1YNJ D;  2R7Z G;  2L4N A;  2CW0 C;  2JE6 I;  4FXG C;  1A0I A;  4EQP A;  4ZKC B;  4I7A A;  2XWJ B;  4DV7 L;  4HJ9 A;  1K73 C;  4C1N K;  2HQL A;  4LF8 L;  4RGO S;  4DAV A;  3C2P A;  2ICE C;  1VQ4 A;  1OTC A;  4NXM L;  1CKO A;  3DWA A;  1G91 A;  3QOL A;  2Z4H A;  3PCO B;  3G6J B;  2K5Q A;  1ASZ A;  4L63 B;  2B8G A;  4ZUI A;  1YJ9 A;  3DEP A;  1KIX A;  2ASB A;  1GXD C;  3KBX A;  3NQT A;  3MFG A;  4DXG A;  1NUC A;  1V9P A;  4FP5 D;  3RZD B;  1TII D;  2PO4 A;  4DR4 L;  1A3V A;  1D5Z C;  1CM9 A;  3SK6 A;  2SOB A;  1BDO A;  2N55 A;  4IJH A;  1ROD A;  4IFD J;  1IYU A;  3A56 A;  1TS4 A;  3MXN A;  1SMY C;  5IP7 G;  4RA8 A;  1G51 A;  4M1U B;  1OXT A;  3B6Y A;  2JA5 H;  3MTS A;  1JR0 D;  2AWO A;  1IXR A;  3CU7 A;  1I3Q B;  5L37 A;  1H95 A;  4A3J H;  3T16 A;  2MNA A;  4A3D G;  3MXG A;  2KVM A;  4RGT A;  4O2D A;  4YCW A;  5M3M B;  3M4O B;  1IKM A;  1K83 B;  4KLK A;  3QG1 A;  1SYF A;  4ABN A;  5IIF A;  1TY2 A;  2PNR C;  4ZAI A;  5ELN A;  3RD4 A;  1SR3 A;  4K8I A;  4RGN A;  1JWS D;  2QEX A;  2B2U C;  2K32 A;  3URY A;  2DY7 A;  4Z9C B;  3K5M A;  4CKC A;  1JE5 A;  3C1E A;  1Q86 C;  3DEO A;  5K36 G;  1V43 A;  3BDO A;  1EIG A;  2GVB A;  1Q81 C;  1CA6 A;  4KHV A;  1XNQ Q;  4JI1 L;  1A6X A;  2WIN B;  4HMI A;  4K6L A;  2D0O A;  4JCV E;  4V19 0;  1SMY D;  5JJK A;  1QZH A;  1HUN A;  3E5S A;  3KLR A;  4KI0 A;  5LL6 X;  5J1Z A;  2ZJR A;  1V1P B;  5HUR A;  3RZD H;  3TME A;  3M7N A;  3T51 B;  1MJE A;  2DY8 A;  5IYD H;  3BVZ A;  4OWX B;  1B44 D;  2Q2U A;  2RSO A;  3E6Z X;  4C56 C;  4KY6 A;  1D5M C;  1EOT A;  2F0P A;  3K6O A;  5FLM H;  2UU9 Q;  1V1O A;  2DUD A;  2F0V A;  1YIJ A;  2C5C A;  1PRT C;  4DV2 Q;  3HKS A;  1N36 L;  2NVT B;  1VF7 A;  1D6E C;  1FJG L;  4OWT B;  5LMN Q;  2RF4 A;  4EQO A;  2HDL A;  2L11 A;  3EVQ A;  1FNV A;  2E2J B;  2YV5 A;  3MVV A;  4ZRZ A;  3I4M H;  1WCM H;  1I6H B;  1A8V A;  4UP8 A;  3A8K E;  3BYY B;  1JWU D;  5EBC A;  4G7Z C;  4B3T L;  1WTH A;  3EFX D;  1SYC A;  5DM7 3;  2Y0S G;  4ILW A;  3NBH B;  4WRD A;  2X6G A;  3OSO A;  4DAM A;  1HCZ A;  3J80 E;  5JJL A;  3J81 j;  5LMN W;  1UUP A;  3GQB A;  2VB2 X;  4QL5 A;  4IPH A;  1HNX Q;  2KHS A;  3PV0 A;  1KRT A;  5A2Q E;  5IT9 L;  3PUX A;  2E2I H;  2OF1 A;  5C4X B;  4JOI A;  3A5U A;  5G3L F;  4DV4 L;  1F2Z A;  1Y1W B;  2F0S A;  5I2Y A;  2EXD A;  2ZTE A;  4C3I B;  3DMU A;  4KJO A;  1KNA A;  4A3E H;  2HHH Q;  1Q46 A;  4DV5 Q;  1Z9F A;  2GN5 A;  4A3M G;  1CQF A;  1RTN A;  4JV5 Q;  5HY6 A;  3C3L A;  4V0B A;  3CF5 A;  1JMC A;  4WFN 3;  1VQC A;  5JEA H;  3RLF A;  1WI5 A;  4TRD A;  4N9P A;  2KED A;  1VQK A;  5FKA C;  3S1Q H;  1C48 A;  1STH A;  1IHZ A;  2OTJ A;  5C6A A;  3HG9 A;  1JT8 A;  1HR0 L;  5C3E H;  1DOL A;  3CCQ A;  1JJC B;  4A93 G;  5NUC A;  3GTK B;  2VB3 X;  3A7A B;  3TRE A;  4LFA Q;  3PUY A;  4GN4 B;  3OIP A;  4ME5 A;  5AJ3 Q;  5ELF A;  2LSS A;  3SXH A;  2LS0 1;  2K05 A;  3HOW G;  1VQD A;  4KMU C;  2WFW A;  1G6P A;  1DM0 B;  2VUM H;  4LF6 L;  4DK1 A;  2SNM A;  2OXP A;  4IPG A;  3S1R H;  1HTL D;  3NEM A;  3HOV B;  1HJP A;  2NYZ D;  3SK8 A;  2UUA Q;  2QKI C;  3FP9 A;  2WKC A;  4KJN A;  4LJZ C;  5J22 A;  2EJM A;  1ASY A;  1SYB A;  2EY5 A;  3F2D A;  1BBX C;  1T5E A;  3S2H H;  3S2D H;  3S16 B;  4A3B B;  3GTL B;  1EQV A;  3QR8 A;  1SRU A;  2LKV A;  2F0K A;  1F9S A;  4UP7 A;  5C4X H;  4XT3 B;  3J81 E;  4JI4 L;  1XNR Q;  2G5D A;  4R4O A;  1VQ8 A;  1PV4 A;  1TWC B;  4OIK A;  1L0W A;  4RKB A;  2EYO A;  1WTR A;  2EYP A;  3J7Z C;  1BCP F;  1V1Q A;  4R8I A;  1TWG B;  2CVR A;  3U9S A;  1DCZ A;  2JA7 G;  3PO2 H;  3TDQ A;  3RNU A;  2PNH A;  2PZT A;  4IFD I;  4Q5V A;  2Q2H A;  1RD9 D;  2FMM A;  4G7O C;  4B08 A;  5DAU A;  5BN4 A;  3I90 A;  2F0F A;  3L0O A;  4H44 C;  2IHE A;  1EY7 A;  1VQ7 A;  4NPS A;  2F0E A;  1S5D D;  2QW7 A;  2RDF A;  4POG A;  2L9H A;  1SMX A;  4IOA A;  2LY7 A;  1RTO A;  5BR8 Q;  5DM6 3;  3IFD A;  5M3F H;  2O5J C;  4G4K A;  1NNX A;  1IKL A;  4DUY Q;  2MO1 A;  4ZYS A;  4YCV A;  1STG A;  3AFP A;  4X65 L;  3GTP B;  4UP9 A;  4QIW B;  1XPR A;  5COY A;  1U4R A;  4JI5 Q;  4PG3 A;  1I5F A;  4DV6 L;  2BH8 A;  5C4Z A;  4IUQ A;  4CJ0 B;  4GZY C;  3QJY A;  2B8F A;  2CHB D;  1PA6 A;  4YWM A;  1XPU A;  3KLS X;  2E75 C;  4P73 A;  2EY1 A;  3GTL H;  3KFU A;  5K5P A;  1SFO B;  2EVB A;  1PH4 A;  1NSN S;  3CD6 A;  2JK8 A;  4IUR A;  1VQ6 A;  4C2M B;  1M4V A;  3PIO A;  1SAP A;  1K0S A;  1EUJ A;  5C3W A;  2X69 A;  3FMC A;  5CV6 A;  1RIP A;  5EJW A;  5BN3 A;  5I2X A;  2EE1 A;  5FO9 B;  2EZV A;  1XNQ L;  2F0T A;  3E0E A;  2HT1 A;  1CHQ D;  5JJZ A;  5JAV A;  1TWG H;  4HAE A;  1H9M A;  3Q6S A;  2F0W A;  4JK1 C;  2SDF A;  4HID A;  3OW7 A;  4NP5 A;  4KN7 C;  1XTD A;  5D65 A;  3HGB A;  2JA5 G;  2R61 A;  1VF5 C;  2UUC Q;  1TT2 A;  3NWT A;  3J7A V;  4A3J G;  2OT2 A;  2F0J A;  4JW0 A;  2FFK B;  1HZ9 A;  3TEH B;  4A3G B;  1U4M A;  2CFM A;  3L9A X;  2UU9 L;  1SNQ A;  5CV8 A;  2K5D A;  1K8A C;  5GAD C;  4JI2 Q;  4U68 A;  4ME3 A;  4OIJ A;  1KAB A;  1L1O A;  2I07 B;  5EPK A;  4DV2 L;  1OO9 B;  1JIC A;  5GAG C;  3GTP H;  2PI2 A;  5EKI A;  5TSS A;  4RH6 A;  3CC7 A;  5IP7 H;  5LMN L;  4JI6 Q;  3CME A;  3VDY A;  2XN9 C;  5JPN C;  1YI2 A;  4KKS A;  3RN5 A;  1SFO H;  4EVO A;  3S15 H;  1JE4 A;  2CQO A;  5H1S E;  3P1H A;  4C2M H;  1XWE A;  1C8C A;  3UE1 A;  2Z6K C;  1B9M A;  3ULL A;  4OHJ A;  2B2W C;  3PUV A;  4DR5 Q;  3KJO A;  4DR2 Q;  3D3R A;  4FF3 A;  3A8I E;  3EIV A;  2JA8 B;  4XYO A;  2TMP A;  4GKJ Q;  5FLM G;  3S17 B;  2Y0S E;  1LTG D;  4HJA A;  4DAY A;  3PIP 3;  1W3S A;  2MFI A;  1R9T H;  4POF A;  1Q8I A;  1ENC A;  1IZ6 A;  1UE5 A;  2K33 A;  3VA7 A;  4LK1 C;  3NEL A;  1NE3 A;  1PZI D;  1Q8K A;  3NQI A;  4DV5 L;  2HHH L;  4RKL A;  4AQY L;  4X66 Q;  2IL8 A;  4X64 Q;  5M5X H;  2EY2 A;  2K04 A;  3BZK A;  3I4M G;  2RCF A;  1WCM G;  3I4L A;  2LXK A;  4CDE C;  4IPD A;  4L5S A;  4BS9 A;  3RUZ A;  2BDN A;  1PTO C;  3NXW A;  3MZ5 A;  2R7D A;  1BKB A;  3NTI A;  4C3J B;  1XMO Q;  4IUU A;  3HOZ H;  4LFA L;  2Z9H A;  5AJ3 L;  4GKK Q;  1EQT A;  1EZ8 A;  1NBW A;  2PZU A;  1D2B A;  2NZO A;  1QVC A;  1W6J A;  3BVM A;  2BCO A;  1QZG A;  4N8X 1;  1IBL Q;  1P8L A;  4QB4 A;  2UUA L;  2N88 A;  1M1K C;  3HOY B;  3PMF A;  2PCF B;  3LNN A;  3BS1 A;  3V05 A;  4BY7 B;  4A3E G;  3M3Y H;  4PMC A;  4BXX H;  2XTI A;  3OMG A;  1BO0 A;  2D2C C;  3KF8 B;  3M4P A;  1N9W A;  1JQY D;  2B2Y A;  1PFM A;  4P71 A;  5JEA G;  1N34 L;  2F3W A;  3J7A F;  2TSS A;  4LF5 Q;  1TWF B;  1H9K A;  1NMF A;  4K0K Q;  4RMF A;  1QWY A;  1K8M A;  3TZD A;  4DPG A;  1E2V A;  1O80 A;  1N33 Q;  4TVA B;  3WWV A;  5C3E G;  3T1Y Q;  3ICE A;  1S72 A;  1JOQ A;  4JI8 Q;  1MJC A;  1Y1V H;  5I6Y A;  2CWP A;  3SDZ A;  1HZA A;  1WOC A;  4DR7 Q;  4DNR B;  1LT6 D;  4KY7 A;  2X6L A;  4A75 A;  1VQH A;  5GAE C;  2L55 A;  2Q8I B;  2H4O A;  4X3K A;  2VUM G;  1HA5 A;  3PGZ A;  3QIA A;  4AYB B;  3PF5 A;  1C0A A;  4GOP C;  1VQA A;  3M85 A;  3GV6 A;  4XQQ A;  4DUY L;  2KCN A;  4IN3 A;  1VQL A;  4JBM A;  1V8Q A;  1HNZ Q;  1A3U A;  2ZTC A;  1HUM A;  5KIX A;  5C4X G;  3J80 L;  1WTO A;  1Q1B A;  5M9O A;  3P7J A;  4BBR B;  5IGG A;  2N78 A;  3H0G B;  3TBI B;  3S14 H;  4F8M A;  2SEB D;  1EIY B;  3PO2 G;  4IJL A;  1D7Q A;  3I55 A;  3A0J A;  2Z6B A;  2J0T D;  1STB A;  4R1J A;  1BOS A;  4LUZ A;  1XJV A;  1SBB B;  3DM1 A;  2E2H B;  3M4Q A;  1KDA A;  2IX0 A;  5ELD A;  1HZB A;  4LF4 Q;  4X6A H;  5M3F G;  1Q90 A;  2KJX A;  1PTO B;  4FF1 A;  4DV3 Q;  4DAY B;  4RHR A;  3VYT A;  2UUC L;  4PMB A;  3NHH A;  3SHL A;  2KHJ A;  4BBS B;  1O7Y A;  3KUP A;  4FVM A;  3G6E A;  2IW3 A;  3L3O C;  1GUO A;  2ALY B;  4DR3 Q;  2WAQ E;  4JI2 L;  4K5X A;  1E1O A;  4A3F B;  4LWC A;  3K80 C;  1EZ6 A;  4K6D A;  1X56 A;  3EN2 A;  3LGJ A;  2DGY A;  1TY0 A;  3PF4 A;  4DUZ Q;  3T1H Q;  3A7L A;  5T1I A;  2NTS A;  3UDF A;  3CCV A;  1PDQ A;  4YHH Q;  1MHW C;  3OPO A;  1BNZ A;  4JI6 L;  5D3I B;  1CKN A;  4ZCK A;  2EYF A;  2R92 B;  2G9H D;  3OIQ A;  4DU9 A;  5FLX E;  4B3S Q;  4LUO A;  3HOX H;  1VQN A;  3HOU H;  2E8G A;  1PXU A;  4CDD C;  1II3 A;  1YBY A;  3ER0 A;  3FRP B;  2KHI A;  2A68 C;  1DD2 A;  1CSP A;  4P75 A;  3MA2 B;  4P74 A;  2BE5 C;  1I50 H;  4DR5 L;  3BYT B;  1X9N A;  1QJO A;  1SRO A;  3OOC A;  4QGU A;  4GKJ L;  1HNW Q;  2ICI A;  2EQS A;  1O7Z A;  1PTO H;  4JBJ A;  2VQF L;  2C35 B;  2MP1 A;  1STN A;  3NTH A;  5FOB B;  4OWW B;  2WKD A;  4GOP B;  3ERS X;  2AMC B;  1KAW A;  1JB7 A;  1B2T A;  5T1G A;  1SJH D;  2CW0 D;  3P20 A;  2RDH A;  2R7F A;  5IE8 A;  2I5L X;  4X64 L;  2H1E A;  4HIM A;  1JOO A;  4DGZ A;  2A1A A;  4UAI A;  2A68 D;  1CSQ A;  4KY5 A;  5M5W B;  1B70 B;  3UDX A;  2BE5 D;  3VR5 A;  2XRQ D;  4ALP A;  3O13 A;  1L0Y B;  1Z6H A;  5GRO A;  3R93 A;  1MIU A;  4IPC A;  3Q23 A;  3Q8D A;  1KDB A;  3BG3 A;  2F0U A;  4YCU A;  1RJT A;  1XMO L;  1UAP A;  4QY7 A;  1KLG D;  2OQ0 A;  4GKK L;  2K75 A;  2IX3 A;  1SE3 A;  3IKJ A;  1B1Z A;  2GA4 B;  4XQN A;  4KHP L;  4GNX B;  1KRS A;  2KEC A;  1IBL L;  3PUW A;  5CV4 A;  4FDB A;  1VMC A;  3VR3 A;  2R93 B;  2Z0S A;  5CBA E;  1U9R A;  4CHT B;  1E3P A;  1FL0 A;  3HRZ C;  3K81 C;  1J8I A;  1Y8N B;  2J4X A;  5HGT A;  3W2D A;  4YY3 L;  2OTL A;  1E0B A;  1OXX K;  2WB1 B;  1HA6 A;  2E5L Q;  1PH2 A;  4BY1 B;  1MSG A;  4K0K L;  1JC7 A;  1U4P A;  4OL7 A;  1SYE A;  5FK9 C;  2UXD Q;  1HQR D;  2J7Z A;  3NTK A;  4CGY B;  1EL0 A;  3NPP A;  3D8G A;  3T1Y L;  4JI8 L;  1G8Z D;  4PMW A;  3HOZ G;  4HIO A;  4DR7 L;  1I3Q H;  2OEO A;  1YVC A;  3DWQ A;  2D0P A;  2BDO A;  3H09 A;  1IBK Q;  4OO1 I;  4R9W A;  5M3M H;  3M4O H;  2I46 A;  1D1K A;  2VL6 A;  1KDC A;  1K83 H;  2KUM A;  1I4R A;  1DOK A;  3KK7 A;  3FKI B;  2K50 A;  1I4P A;  1QCB D;  3MWY W;  3QO2 A;  2F0I A;  4A3L H;  1Q3L A;  3U50 C;  3VR6 A;  4J6H A;  4DK3 C;  4RCN A;  4CDC C;  1SE4 A;  3HZX A;  4BXX G;  1S4Z A;  1HNZ L;  1JJG A;  4UPA A;  3C1F A;  3CMA A;  2VZA A;  5CMD A;  2YYZ A;  1GM5 A;  4LF9 Q;  1DZ1 A;  4XDX A;  2IJ0 A;  1CKN B;  4B9X A;  5HGQ A;  4H13 C;  2R93 H;  1EU4 A;  1PRT D;  4KKU A;  3CCM A;  3MHB A;  2PMZ B;  2O4X A;  4ID6 A;  1I94 Q;  1QOH A;  1EEI D;  4BWG B;  5EPL A;  1RF2 D;  3E9I A;  1Y1V G;  3TSS A;  2ZJQ A;  1KC8 C;  1G2S A;  2ATW A;  2XWB B;  1WJJ A;  3H3V I;  3MFY A;  1TU2 B;  3OTO Q;  1H9S A;  3M9B A;  5IY0 A;  4A3K B;  3I8Z A;  1K3R A;  1LTT D;  2PQA A;  4LF4 L;  4MZ9 A;  3J80 c;  2YTY A;  3A55 A;  3H6M A;  4IO9 A;  4DV3 L;  2NVT H;  1TVX A;  3IRB A;  3X3M A;  4KTA A;  4JOI C;  3X3N A;  3I4N B;  2K4K A;  4LF7 Q;  1MKH A;  4I7Z C;  2JA6 B;  1A15 A;  3PIO 3;  3H3V C;  3MXN B;  4DV1 Q;  2K1B A;  5E4W C;  3CKI B;  2E2J H;  1AN8 A;  2B63 B;  1W2B A;  2C9O A;  5C4J B;  4DR3 L;  3PO3 B;  2QA4 A;  4I65 A;  2CWA A;  3SK4 A;  1LTI D;  3NWS A;  1I6H H;  2JA9 A;  5LMU L;  3ND8 A;  3SR1 A;  4DUZ L;  3T1H L;  3V2T A;  1VQF A;  4YHH L;  1LTL A;  1SND A;  4X62 L;  1I4H A;  2LMC B;  4B3S L;  1A2T A;  4JI7 Q;  1N32 Q;  4HSV A;  5KNB A;  3AMU A;  1E2Z A;  4K5V A;  2VW9 A;  1Y1W H;  3CC2 A;  4C3I H;  3JAM E;  3OWF A;  5C44 B;  4HCE A;  1OXV A;  2KCM A;  3UI2 A;  2QCP X;  3M4Y A;  2A74 C;  3CHB D;  1BBW A;  2E2D C;  2ZTD A;  1HNW L;  3MXU A;  4C1N I;  4B3M Q;  3NUC A;  1HH2 P;  3MEF A;  2R7Z B;  3G4S A;  1STE A;  5D3D A;  3SK5 A;  3I4N H;  2MJ8 A;  2JA6 H;  3J81 c;  1Q7Y C;  3R3O A;  4X3U A;  4LNQ A;  2BH2 A;  3SGI A;  1VQP A;  3GTK H;  5I4D A;  1Y69 U;  2IX1 A;  1CA5 A;  3QOJ A;  2AKW B;  2IHF A;  1B8A A;  2ZXR A;  4QQB X;  3PO3 H;  3HOX G;  4BBR G;  3HOU G;  4RGM A;  5FJ8 H;  1PFS A;  2ID0 A;  2K5V A;  4QIW E;  2MGS A;  1P16 A;  2VS1 A;  4DR1 Q;  2HCI A;  1EYA A;  5CC4 A;  1A3T A;  3K7A B;  3HKZ B;  4LFB Q;  1MBY A;  3HOV H;  2K6A A;  2NVX B;  2NVQ B;  1SDF A;  3U9O A;  3U58 A;  4A3B H;  3S16 H;  4LFC Q;  3C46 A;  2K5W A;  1GOZ A;  1EU3 A;  2LXJ A;  1ENF A;  1TWC H;  2Q2I A;  3AB9 A;  1BR9 A;  5C44 H;  1CHP D;  1K3B C;  2EIF A;  3CW2 C;  1SXT A;  4A3D B;  1W6K A;  1Q12 A;  1U5K A;  3T4A C;  5ELE A;  2KEN A;  2WAQ G;  3F8T A;  4C3H B;  1C7Y A;  1TWH B;  1H9S B;  5C5M A;  1IL8 A;  4F7X A;  3FDT A;  2UXD L;  5JPM C;  3F2U A;  1CFM A;  3TP7 A;  4WJ3 M;  1XPO A;  2PQA B;  2MPM A;  3D6C A;  2V4D A;  5JVG 3;  1SNO A;  1X55 A;  1WTQ A;  2EPB A;  4WJ4 A;  4FO2 A;  4CBV A;  4Y52 H;  2ZT9 C;  1MD2 D;  3NP8 A;  4OO1 H;  4LAA A;  4BA1 I;  4NB3 A;  1IBK L;  3JAM i;  5I6W A;  5JEA J;  3D4R A;  1EWH A;  1PH7 A;  3KDF A;  4XYQ A;  3I2Z A;  2JEB I;  2F0D A;  4J15 A;  2B2W A;  3A54 A;  3CCL A;  1NR4 A;  4MN3 A;  1HFN A;  2B29 A;  1ZXT A;  3CQZ B;  1ESF A;  1OXU A;  4LW1 A;  3QB3 A;  4LF9 L;  2NN6 I;  2F0O A;  3GTM B;  2KQ3 A;  1KXL A;  3I3C A;  1HNX L;  3FHW A;  5C0X J;  3TN2 A;  5BN5 A;  3S9W A;  5C4H A;  3RLN A;  3FPU B;  4AH6 A;  1I94 L;  1A63 A;  5E3F A;  4LF8 Q;  4FXD A;  3N52 A;  3AQQ A;  4HR7 B;  2V1C C;  3H3V H;  1RDP D;  3CCS A;  3GTJ B;  2KBN A;  1KTK A;  2WII B;  4GLA C;  4APV A;  1TWH H;  4A3G H;  2VNU D;  1LYL A;  2B2V C;  3ONA B;  4EGV A;  4KHZ A;  4JV5 L;  1F9Q A;  5J39 A;  5M3M G;  3RZO B;  5IT9 E;  3GTQ B;  3IFT A;  1SE2 A;  2AHO B;  4PZ6 A;  1X6O A;  4DNT B;  4JBK A;  2Y0S B;  3KF6 A;  1XTC D;  4H7B A;  2UUB Q;  4A3L G;  5ELB A;  1WD1 A;  3KOJ A;  1T5X D;  5ISR A;  1SYD A;  3R2I A;  1Y8O B;  4LF7 L;  4K5W A;  2AQ3 B;  2A5H A;  2F4I A;  4JI0 Q;  2H5X A;  4DV1 L;  1QVG A;  4PZ8 A;  1QB5 D;  4AIM A;  4DV0 Q;  4B9W A;  2XRS D;  1ZEQ X;  3D4D A;  2A69 C;  1TKW B;  2R93 G;  4M8A A;  5IOC A;  2M9V A;  1KLU D;  4ODG A;  2AWN A;  1UNS A;  4A3M B;  2A6H C;  3NEN A;  3BJU A;  3VYU A;  3I70 A;  2EYM A;  2Z1C A;  4NDX A;  1TWA B;  5G3L D;  4S3S A;  2F4V Q;  4RAU C;  1QUQ A;  2BA1 A;  2QF7 A;  1GO3 E;  2XIW A;  1C9O A;  4JG2 A;  3TP8 A;  1Q82 C;  4RG1 A;  2JA8 H;  3CCU A;  2UXB Q;  5KYI A;  2MO0 A;  2K01 A;  1N32 L;  2HIV A;  4X3S A;  3ZJY C;  5CBE E;  1YHB A;  3S17 H;  4A93 B;  1J9O A;  1XNR L;  5M5Y B;  1NJI C;  1RKN A;  2CH4 A;  1PTO D;  2MUY A;  1STY A;  5E1F A;  2I5M X;  2DJG C;  4IUP A;  3RN2 A;  3FPP A;  1VQO A;  1PH3 A;  1BXT A;  5CYU A;  4FF4 A;  3HOW B;  5CV9 A;  2IWH A;  4IFD H;  1HPC A;  1NCV A;  1VQE A;  2Z4I A;  5KND A;  4K14 A;  3OHX C;  4XT1 B;  2NZH A;  3S1N B;  2VY3 A;  2KOL A;  4DA2 A;  1ZYR C;  1K8G A;  1EWC A;  1RCV D;  2AUK A;  2B2Y C;  4B3M L;  4Q0F A;  4KK7 A;  1D1I A;  1TS5 A;  1FNU A;  1LLR D;  4AYB E;  5CGK A;  1PRT F;  3VR2 A;  5BR8 L;  1QE6 A;  1ML0 D;  2Z8L A;  2A19 A;  4C3J H;  1L1O B;  3GDE A;  3MEH A;  4FYD A;  1NR2 A;  4G7H C;  1R4P B;  4ZKB B;  2XNA C;  3DXJ C;  1FJG Q;  2F3I A;  3D6W A;  1YJW A;  1E7Z A;  3PSI A;  1G29 1;  2NVY B;  3PUZ A;  4JI5 L;  1I4X A;  4IUV A;  2RCN A;  4IUT A;  2JA7 B;  2CQA A;  3WDN A;  3S1M B;  1HXY D;  3HOY H;  5KYL A;  3W1G A;  4KKT A;  1CK1 A;  5FO8 B;  5A2Q L;  4YWL A;  2Q2T A;  1Y1W G;  3I56 A;  2B2T C;  4C3I G;  4BY7 H;  1WFQ A;  4N9T A;  1VQI A;  3MAQ A;  1SNC A;  1EIF A;  1CT1 D;  1ZYR D;  4UHV A;  4G57 A;  1O7I A;  1QNU A;  4OEL B;  2NBF A;  1X3Q A;  1TWF H;  3E9H A;  1AZQ A;  2JEA I;  1YZ6 A;  1BBU A;  1F2Y A;  1EWI A;  3SVM A;  4GNX C;  2AQ1 B;  3CAM A;  1STA A;  3KJP A;  4R4C A;  3I4N G;  2LFN A;  1UE6 A;  5EQ0 A;  2JA6 G;  1XXG A;  2NUC A;  1ENA A;  4OEM B;  4ZLT F;  2K28 A;  5CV7 A;  2A8V A;  2KCT A;  4KD3 A;  1D8L A;  2AUJ D;  1X65 A;  2RA4 A;  2D62 A;  2A73 B;  3PO3 G;  2RQX A;  3STB C;  5FJ8 G;  3PQI A;  4WOR A;  3TP5 A;  4EQN A;  4UY8 C;  5IOD A;  1YNJ C;  2PW5 A;  1FR3 A;  2YTX A;  1N8R C;  1HFG A;  3HOV G;  1U0L A;  1ICF B;  2R6G A;  1L0X B;  2O2L D;  3R8B A;  1S40 A;  3KBG A;  4A3B G;  1MSH A;  3IL8 A;  2KEE A;  1J6Q A;  4WJW A;  3KLW A;  3D0F A;  1HR0 Q;  4QJF A;  4R8N A;  2AQ2 B;  1YHQ A;  3D4W A;  3F2B A;  5E7N A;  1VQ9 A;  4CJ2 C;  1S5C D;  3CRL C;  4BBR H;  2JA5 B;  3H0G H;  1WTX A;  1KD1 C;  1X3E A;  4A3C H;  3E3X A;  5AFW A;  5C44 G;  5KEE A;  4A3J B;  2ZJP A;  3J81 L;  5C0X I;  1F9R A;  4MTN A;  3ERO A;  2XVS A;  3CCJ A;  2NN6 H;  1BCP B;  1QUQ B;  4DR2 L;  1VQJ A;  3K0Y A;  1AEX A;  2R3Z A;  5EAY A;  1MGS A;  4XXE A;  1K0R A;  2E2H H;  4OXP A;  1IYJ B;  1LM0 A;  4JI4 Q;  5FLX c;  2DNC A;  3EA6 A;  1WTV A;  5IWA Q;  1I6V C;  3DHQ A;  2XGT A;  1PHJ A;  4GN5 A;  2M00 A;  5LHY 1;  3BVG A;  1CQV A;  4BBS H;  4OO1 G;  4MHE A;  5IYC H;  2I5H A;  1LAC A;  4X66 L;  1FVI A;  4JVZ A;  3HKZ G;  5ELC A;  2F0G A;  4A3F H;  2UUB L;  3UDI A;  2N8N A;  2BOS A;  1R4Q B;  3K57 A;  3CCR A;  2HD3 A;  3SEB A;  2EDG A;  4R4Q A;  4F88 A;  4JI0 L;  2R92 H;  1FD7 D;  4DK6 C;  3JC6 6;  4DV0 L;  5GQO A;  1B9N A;  2FJ2 A;  2B2U A;  2RKS A;  3U4V A;  5I9P A;  1PH5 A;  2JYO A;  2ZM6 Q;  4KN4 C;  4Y7N B;  3BU2 A;  4X65 Q;  2VXW A;  1JCK B;  1H9R A;  4U67 3;  2EYJ A;  3Q24 A;  1PH9 A;  3Q22 A;  4DV6 Q;  2F4V L;  5C3X A;  1Q1E A;  5KGU A;  3TQY A;  1B3A A;  4ULL A;  3QWN A;  1FGB D;  4OON A;  3I4M B;  2B3G A;  1CTM A;  1WCM B;  3RMH A;  1TS2 A;  2JQO A;  4C3H G;  2UXB L;  3BZD B;  3DWP A;  2FIN B;  3FEW X;  4LMQ D;  1XMQ Q;  4A3G G;  2VQE Q;  4J8Q A;  2WB1 E;  1JOR A;  1X3F A;  2M2L A;  4LF5 L;  1RL2 A;  4RCO A;  2OCE A;  4CKB A;  2MQH A;  5J3B A;  5IGF A;  3I73 A;  5KNC A;  2NTT A;  2OQK A;  3I7F A;  3L7Z C;  1N33 L;  1PVO A;  1YEZ A;  3MXP A;  4DKA C;  4NXN Q;  1YIT A;  1LT5 D;  1SEB D;  2E2I B;  4GS3 A;  4NKL A;  3L2P A;  1LTR D;  2QEJ C;  2O5I C;  1M90 C;  4BA2 I;  3ZYY X;  2B39 A;  5IGC A;  5M5W H;  1CZG A;  1YJN A;  1EY4 A;  1J5E Q;  4A3E B;  1HRJ A;  3CRK C;  3VR4 A;  1GD7 A;  1EY9 A;  4XQJ A;  4H0L C;  3K5L A;  1X54 A;  4KD4 A;  1S3O A;  1IW7 C;  2D9U A;  3S1Q B;  4E6I A;  4CJ1 B;  4Y7N H;  2JA8 G;  2EJF C;  4O0A A;  2K5N A;  3I4O A;  1VCI A;  5LL6 S;  5C3E B;  3VA5 A;  3V96 A;  4JYA Q;  1H9J A;  1LT4 D;  3F1Z A;  2K03 A;  4XIG S;  1SYG A;  4PQX A;  4L6T B;  1S5F D;  4HSP A;  4IOC A;  1EOV A;  1BUV T;  1S5B D;  1TS3 A;  2PMZ E;  4JBW A;  1D5X C;  4HCS A;  4RWS C;  4IFD G;  4P2C B;  2VUM B;  4LUV A;  5FO7 B;  1XX8 A;  3S1R B;  1A2U A;  3J7Y W;  3E0J A;  2A6E C;  4HN7 A;  1ZKO A;  2CH4 W;  1U4L A;  2CKZ B;  1GUW A;  2JXM B;  1PH6 A;  2IPK D;  4BY1 H;  1EY0 A;  5ELO A;  3S2H B;  2N49 A;  5IGE A;  2NWG A;  3S2D B;  2EYH A;  2QDL A;  2F03 A;  2EY6 A;  1LAB A;  1MI2 A;  1NMG A;  1O78 A;  2L5T A;  3D31 A;  4RHS A;  1IW7 D;  3W5O A;  3CPW A;  1DYQ A;  4JPB W;  5GAH C;  1ONL A;  4FNF A;  1AW7 A;  4C3J G;  2D5D A;  3K8A A;  3OWE B;  1X3G A;  1AE2 A;  1PLF A;  1GUG A;  1Z47 A;  4N8F A;  1CZW A;  4P72 A;  4AQY Q;  1SJE D;  3PO2 B;  3FKI H;  4HJ7 A;  1WVL A;  4XTC S;  1B3Q A;  3DM3 A;  3HOY G;  1Z7T A;  1LTS D;  1PTO F;  3MC0 B;  1KQS A;  5E4X A;  4K8J A;  4BY7 G;  1KL9 A;  1A62 A;  2A6E D;  3ERQ A;  4HJ8 A;  4NW2 A;  3VYS A;  2EYL A;  3TS0 A;  3GO5 A;  3Q0A A;  1I4Q A;  5DLQ E;  4A3I B;  5M3F B;  1GUT A;  1G2T A;  3RR5 A;  1TXY A;  3CC4 A;  1CKM A;  1K9M C;  3HEJ A;  4K2L A;  4RFB A;  4IQZ A;  3VYR A;  5C0X H;  3GTG B;  1AZP A;  1PYW D;  2DJF C;  2E74 C;  4HED A;  4QF4 A;  4L5T A;  1X3P A;  2FMC A;  2XSC A;  5I9O A;  1YNX A;  2N3S A;  2KA7 A;  5C5L A;  5IYB H;  2JSO A;  2PW7 A;  2FXQ A;  4ZK9 B;  4B3R Q;  1G6Z A;  2F1M A;  1IBM Q;  4A3K H;  1AP0 A;  1VQ5 A;  4GLX A; 
#chains in the Genus database with same CATH homology
 2JP1 A;  1X32 A;  4HMJ A;  1LTB D;  4PNY A;  5EPJ A;  1EY6 A;  1PRT B;  2K7V A;  2Q8R E;  1EEF D;  4O42 A;  4DXF A;  1JB3 A;  1SNP A;  3K58 A;  1XYI A;  2ZXP A;  1EFI D;  1WD0 A;  4X3T A;  3GD7 A;  1PZK D;  4OGQ C;  2NN6 G;  4F87 A;  1VDZ A;  3H91 A;  1EY8 A;  5DEH A;  1O7L A;  1GUN A;  1F2M A;  1F9P A;  1SSO A;  4L8J A;  1QG7 A;  2ENB A;  3A8J E;  2DN8 A;  4TSS A;  4MIU A;  1EIH A;  1I4G A;  3KF8 A;  2NB0 A;  3ITP A;  3S15 B;  1EYC A;  3NK9 A;  4DN4 M;  1RHP A;  3T53 B;  2PQE A;  3TP6 A;  4NMZ A;  2HCC A;  2F3V A;  1KAA A;  2WP8 J;  3P75 A;  2NZ1 D;  1DON A;  1TR5 A;  1R9T B;  3OMC A;  3HS0 C;  4QUC A;  1DOM A;  5FLX L;  1ILP A;  2PZW A;  3NE5 B;  1GHK A;  3LWU A;  5M5X B;  4K2K A;  1B50 A;  3K5N A;  4ZUJ A;  5A35 A;  4QCL A;  3GTO B;  1HHV A;  1OXS C;  2FHT A;  3HOZ B;  1VMP A;  1AFP A;  3T56 B;  3DUZ A;  3ND9 A;  1Y8P B;  1B4O A;  2KCC A;  4YIJ A;  3N6R A;  2B2V A;  1IYV A;  2G9D A;  1ILQ A;  1JOK A;  1BQQ T;  3M3Y B;  5EBD A;  3TZU A;  1JWM D;  2IT1 A;  2MHV A;  5EKL A;  5D14 A;  5K36 H;  1C4Q A;  1QIL A;  3NBI A;  4IZ8 A;  1UEA B;  5IGD A;  1WTW A;  1QNK A;  4KV6 A;  3FVQ A;  2Q8T A;  3W3A A;  3BDC A;  3HP3 A;  1PFB A;  1PFN A;  2EOT A;  1Y1V B;  4DF7 A;  3H94 A;  1F77 A;  3AU7 A;  2WAC A;  1LTA D;  1TQO A;  2L0C A;  1WTP A;  4FF2 A;  5EKK A;  2DNE A;  5F2D A;  1NAP A;  1LT3 D;  2F0Q A;  2HQE A;  1ICW A;  2HDM A;  4IUN A;  1HQM C;  2F0L A;  1DJR D;  4PV1 C;  1GJX A;  4O1N A;  5CV5 A;  3T13 A;  3WOE A;  1BCP C;  1B53 A;  3GP7 A;  2EXZ A;  4IAL A;  3S14 B;  2A69 D;  1KNE A;  3K59 A;  1ET9 A;  5DNF A;  2A6H D;  2F0H A;  3EQL C;  1SNM A;  2RBM A;  2YU9 B;  2F0N A;  4DK0 A;  4HTH A;  1M8A A;  2RDG A;  4DFA A;  3SE0 A;  4TQU S;  2E76 C;  3M7G A;  3BDL A;  2BA0 A;  3NSW A;  5C0X G;  4DAP A;  3IAY A;  5CR3 A;  2B2T A;  1F2L A;  4TKO B;  3GV3 A;  1BCP D;  2PPB C;  1ET6 A;  3K5O A;  3LX0 A;  5COR A;  2HUG A;  5IGB A;  1GHJ A;  1S5E D;  3G7L A;  4ZQ3 A;  4CKE A;  2L12 A;  3HOX B;  3HOU B;  1GUS A;  3WOF A;  1BF4 A;  5JOB A;  1YNN C;  2WV6 D;  1EYD A;  1PMR A;  1V1P A;  2RVL A;  2SNS A;  2QIL A;  3KLS A;  1DXM A;  1I50 B;  3I72 A;  1FNW A;  1FYC A;  3EJI A;  2PYK A;  3I91 A;  4QMG A;  4QUF A;  5JVH 3;  5KRU A;  2EJG C;  5EGT A;  1LV9 A;  1HTP A;  1K8O A;  3R2T A;  2QDB A;  1CI3 M;  1YNN D;  2WAQ B;  1E2W A;  2ZXO A;  2F0M A;  1LO5 D;  2RSN A;  2L1B A;  1EY5 A;  1PZJ D;  4J1M A;  1ESR A;  3JAM L;  3NBH A;  4UDU C;  4FXK C;  3LWE A;  1YNJ D;  2L4N A;  2CW0 C;  2JE6 I;  4FXG C;  4EQP A;  4ZKC B;  2XWJ B;  4C1N K;  4RGO S;  4DAV A;  3C2P A;  2ICE C;  3DWA A;  1G91 A;  3QOL A;  2Z4H A;  3G6J B;  2K5Q A;  4L63 B;  2B8G A;  4ZUI A;  3DEP A;  1GXD C;  3KBX A;  3NQT A;  3MFG A;  4DXG A;  1NUC A;  4FP5 D;  3RZD B;  1TII D;  2PO4 A;  1A3V A;  1D5Z C;  1CM9 A;  3SK6 A;  2SOB A;  1BDO A;  2N55 A;  1ROD A;  4IFD J;  1IYU A;  3A56 A;  1TS4 A;  3MXN A;  1SMY C;  4RA8 A;  4M1U B;  1OXT A;  3MTS A;  1JR0 D;  2AWO A;  3CU7 A;  1I3Q B;  3T16 A;  3MXG A;  2KVM A;  4RGT A;  5M3M B;  3M4O B;  1IKM A;  1K83 B;  3QG1 A;  1SYF A;  4ABN A;  5IIF A;  1TY2 A;  2PNR C;  4ZAI A;  3RD4 A;  4K8I A;  4RGN A;  1JWS D;  2B2U C;  2K32 A;  3URY A;  2DY7 A;  4Z9C B;  3K5M A;  4CKC A;  3C1E A;  5K36 G;  3DEO A;  1V43 A;  3BDO A;  1EIG A;  1CA6 A;  4KHV A;  1A6X A;  2WIN B;  4HMI A;  4K6L A;  4V19 0;  1SMY D;  1HUN A;  3E5S A;  3KLR A;  4KI0 A;  5LL6 X;  5J1Z A;  1V1P B;  5HUR A;  3TME A;  3M7N A;  3T51 B;  2DY8 A;  3BVZ A;  1B44 D;  2RSO A;  3E6Z X;  4C56 C;  4KY6 A;  1D5M C;  1EOT A;  2F0P A;  3K6O A;  1V1O A;  2F0V A;  2C5C A;  1PRT C;  2NVT B;  1VF7 A;  1D6E C;  4EQO A;  2HDL A;  2L11 A;  3EVQ A;  1FNV A;  2E2J B;  3MVV A;  4ZRZ A;  1I6H B;  3A8K E;  3BYY B;  1JWU D;  5EBC A;  4G7Z C;  3EFX D;  1SYC A;  5DM7 3;  4ILW A;  4WRD A;  2X6G A;  3OSO A;  1HCZ A;  3J80 E;  1UUP A;  3GQB A;  2VB2 X;  2KHS A;  3PV0 A;  5A2Q E;  5IT9 L;  3PUX A;  2OF1 A;  5C4X B;  5G3L F;  1F2Z A;  1Y1W B;  2F0S A;  5I2Y A;  4C3I B;  3DMU A;  4KJO A;  1KNA A;  1CQF A;  1RTN A;  3C3L A;  4V0B A;  4WFN 3;  5JEA H;  3RLF A;  4TRD A;  4N9P A;  2KED A;  5FKA C;  1C48 A;  1STH A;  1IHZ A;  5C6A A;  3HG9 A;  1DOL A;  5NUC A;  3GTK B;  2VB3 X;  3A7A B;  3PUY A;  4ME5 A;  3OIP A;  5ELF A;  3SXH A;  2LS0 1;  2K05 A;  4KMU C;  1DM0 B;  4DK1 A;  2SNM A;  2OXP A;  1HTL D;  3HOV B;  2NYZ D;  3SK8 A;  2QKI C;  2WKC A;  4KJN A;  4LJZ C;  5J22 A;  2EJM A;  1SYB A;  2EY5 A;  1BBX C;  1T5E A;  4A3B B;  3S16 B;  3GTL B;  1EQV A;  2LKV A;  2F0K A;  1F9S A;  4XT3 B;  3J81 E;  1TWC B;  4OIK A;  4RKB A;  2EYO A;  1WTR A;  2EYP A;  1BCP F;  4R8I A;  1TWG B;  2CVR A;  3U9S A;  1DCZ A;  3TDQ A;  4IFD I;  2PZT A;  4Q5V A;  1RD9 D;  2FMM A;  4G7O C;  4B08 A;  5DAU A;  5BN4 A;  3I90 A;  2F0F A;  4H44 C;  1EY7 A;  2F0E A;  1S5D D;  2RDF A;  2L9H A;  2LY7 A;  1RTO A;  5DM6 3;  3IFD A;  2O5J C;  4G4K A;  1IKL A;  4ZYS A;  1STG A;  3GTP B;  4QIW B;  5COY A;  1U4R A;  5C4Z A;  4IUQ A;  4CJ0 B;  4GZY C;  3QJY A;  2B8F A;  2CHB D;  3KLS X;  2E75 C;  2EY1 A;  5K5P A;  1SFO B;  2EVB A;  1NSN S;  4IUR A;  4C2M B;  1M4V A;  1SAP A;  5C3W A;  2X69 A;  3FMC A;  5CV6 A;  5EJW A;  5BN3 A;  5I2X A;  2EE1 A;  5FO9 B;  2EZV A;  2F0T A;  1CHQ D;  5JJZ A;  5JAV A;  4HAE A;  1H9M A;  3Q6S A;  2F0W A;  4JK1 C;  2SDF A;  3OW7 A;  4NP5 A;  4KN7 C;  5D65 A;  3HGB A;  2R61 A;  1VF5 C;  1TT2 A;  3NWT A;  3J7A V;  2OT2 A;  2F0J A;  2FFK B;  4A3G B;  1U4M A;  3L9A X;  1SNQ A;  5CV8 A;  2K5D A;  4U68 A;  4OIJ A;  1KAB A;  2I07 B;  5EPK A;  1OO9 B;  1JIC A;  5EKI A;  5TSS A;  4RH6 A;  2XN9 C;  5JPN C;  4KKS A;  4EVO A;  1JE4 A;  3P1H A;  1XWE A;  1C8C A;  1B9M A;  4OHJ A;  2B2W C;  3PUV A;  3D3R A;  4FF3 A;  3A8I E;  2JA8 B;  4XYO A;  2TMP A;  3S17 B;  1LTG D;  4DAY A;  3PIP 3;  1Q8I A;  1ENC A;  2K33 A;  3VA7 A;  4LK1 C;  1PZI D;  3NQI A;  4RKL A;  2IL8 A;  2EY2 A;  2K04 A;  3I4L A;  4BS9 A;  3RUZ A;  2BDN A;  1PTO C;  3NXW A;  3MZ5 A;  3NTI A;  4C3J B;  4IUU A;  1EQT A;  1EZ8 A;  2PZU A;  1D2B A;  1W6J A;  3BVM A;  2BCO A;  4QB4 A;  2N88 A;  3HOY B;  3PMF A;  2PCF B;  3LNN A;  3BS1 A;  3V05 A;  4BY7 B;  4PMC A;  3OMG A;  1BO0 A;  2D2C C;  1JQY D;  2B2Y A;  1PFM A;  5JEA G;  2F3W A;  3J7A F;  2TSS A;  1TWF B;  1H9K A;  1QWY A;  1K8M A;  3TZD A;  1E2V A;  1O80 A;  1JOQ A;  5I6Y A;  3SDZ A;  4DNR B;  1LT6 D;  4KY7 A;  2X6L A;  2L55 A;  2Q8I B;  4X3K A;  2H4O A;  1HA5 A;  3QIA A;  4AYB B;  3M85 A;  3GV6 A;  4XQQ A;  2KCN A;  4IN3 A;  1V8Q A;  1A3U A;  1HUM A;  5KIX A;  3J80 L;  1WTO A;  1Q1B A;  5M9O A;  3P7J A;  4BBR B;  5IGG A;  3H0G B;  3TBI B;  4F8M A;  2SEB D;  2J0T D;  1STB A;  1BOS A;  1SBB B;  3DM1 A;  2E2H B;  1KDA A;  2IX0 A;  5ELD A;  1Q90 A;  2KJX A;  1PTO B;  4FF1 A;  4RHR A;  3VYT A;  4PMB A;  3NHH A;  3SHL A;  4BBS B;  1O7Y A;  3KUP A;  4FVM A;  2IW3 A;  3L3O C;  1GUO A;  4K5X A;  4A3F B;  4K6D A;  1EZ6 A;  1TY0 A;  3A7L A;  5T1I A;  2NTS A;  1PDQ A;  3OPO A;  1BNZ A;  5D3I B;  2R92 B;  2EYF A;  2G9H D;  3OIQ A;  4DU9 A;  5FLX E;  1PXU A;  1II3 A;  3FRP B;  2A68 C;  1DD2 A;  3MA2 B;  2BE5 C;  3BYT B;  1QJO A;  3OOC A;  2ICI A;  1O7Z A;  1PTO H;  2MP1 A;  1STN A;  3NTH A;  5FOB B;  2WKD A;  1B2T A;  5T1G A;  1SJH D;  2CW0 D;  3P20 A;  2RDH A;  2H1E A;  1JOO A;  4DGZ A;  4UAI A;  2A68 D;  4KY5 A;  5M5W B;  2BE5 D;  3VR5 A;  2XRQ D;  3O13 A;  1L0Y B;  1Z6H A;  3R93 A;  3Q23 A;  1KDB A;  3BG3 A;  2F0U A;  1RJT A;  1UAP A;  1KLG D;  2IX3 A;  1SE3 A;  3IKJ A;  1B1Z A;  2GA4 B;  4XQN A;  2KEC A;  3PUW A;  5CV4 A;  1VMC A;  3VR3 A;  2R93 B;  5CBA E;  1U9R A;  4CHT B;  3HRZ C;  1J8I A;  1Y8N B;  2J4X A;  5HGT A;  3W2D A;  1E0B A;  1OXX K;  2WB1 B;  1HA6 A;  4BY1 B;  1MSG A;  1JC7 A;  1U4P A;  4OL7 A;  1SYE A;  5FK9 C;  1HQR D;  2J7Z A;  3NTK A;  4CGY B;  1EL0 A;  3NPP A;  3D8G A;  1G8Z D;  4PMW A;  2OEO A;  3DWQ A;  2BDO A;  3H09 A;  4OO1 I;  4R9W A;  2I46 A;  1D1K A;  1KDC A;  2KUM A;  1I4R A;  1DOK A;  3KK7 A;  3FKI B;  1I4P A;  1QCB D;  3MWY W;  3QO2 A;  2F0I A;  1Q3L A;  3VR6 A;  4J6H A;  4RCN A;  1SE4 A;  3HZX A;  1S4Z A;  3C1F A;  5CMD A;  2YYZ A;  1DZ1 A;  4XDX A;  2IJ0 A;  4B9X A;  4H13 C;  1EU4 A;  1PRT D;  4KKU A;  3MHB A;  2PMZ B;  2O4X A;  4ID6 A;  1QOH A;  1EEI D;  4BWG B;  5EPL A;  1RF2 D;  3TSS A;  1G2S A;  2XWB B;  3MFY A;  1TU2 B;  1H9S A;  4A3K B;  3I8Z A;  1LTT D;  3A55 A;  3H6M A;  1TVX A;  3X3M A;  4KTA A;  3X3N A;  3I4N B;  4I7Z C;  2JA6 B;  1A15 A;  3PIO 3;  3H3V C;  2K1B A;  5E4W C;  3CKI B;  1AN8 A;  2B63 B;  2C9O A;  5C4J B;  3PO3 B;  4I65 A;  3SK4 A;  1LTI D;  3NWS A;  3ND8 A;  3SR1 A;  3V2T A;  1SND A;  1I4H A;  2LMC B;  1A2T A;  4HSV A;  5KNB A;  3AMU A;  1E2Z A;  4K5V A;  3JAM E;  3OWF A;  5C44 B;  4HCE A;  1OXV A;  3UI2 A;  2QCP X;  3M4Y A;  2A74 C;  3CHB D;  2E2D C;  3MXU A;  4C1N I;  3NUC A;  2R7Z B;  1STE A;  5D3D A;  3SK5 A;  2MJ8 A;  3R3O A;  4X3U A;  5I4D A;  1Y69 U;  2IX1 A;  1CA5 A;  3QOJ A;  2ZXR A;  4RGM A;  2ID0 A;  2MGS A;  2HCI A;  1EYA A;  5CC4 A;  1A3T A;  3K7A B;  3HKZ B;  1MBY A;  2K6A A;  2NVX B;  2NVQ B;  1SDF A;  3U9O A;  3C46 A;  2K5W A;  1GOZ A;  1EU3 A;  1ENF A;  3AB9 A;  1BR9 A;  1CHP D;  1SXT A;  4A3D B;  1W6K A;  1Q12 A;  3T4A C;  5ELE A;  4C3H B;  1TWH B;  1H9S B;  5C5M A;  1IL8 A;  4F7X A;  3FDT A;  5JPM C;  3F2U A;  1CFM A;  3TP7 A;  2MPM A;  3D6C A;  2V4D A;  5JVG 3;  1SNO A;  1WTQ A;  2EPB A;  4FO2 A;  4CBV A;  2ZT9 C;  1MD2 D;  3NP8 A;  4OO1 H;  4LAA A;  4BA1 I;  5I6W A;  5JEA J;  3D4R A;  1EWH A;  4XYQ A;  2JEB I;  2F0D A;  2B2W A;  3A54 A;  1NR4 A;  4MN3 A;  1HFN A;  1ZXT A;  3CQZ B;  1ESF A;  1OXU A;  3QB3 A;  2NN6 I;  2F0O A;  3GTM B;  2KQ3 A;  3I3C A;  5C0X J;  3TN2 A;  5BN5 A;  3S9W A;  5C4H A;  3FPU B;  5E3F A;  4FXD A;  3N52 A;  4HR7 B;  1RDP D;  3GTJ B;  1KTK A;  2WII B;  2VNU D;  2B2V C;  3ONA B;  4EGV A;  4KHZ A;  1F9Q A;  5J39 A;  3RZO B;  5IT9 E;  3GTQ B;  3IFT A;  1SE2 A;  4DNT B;  2Y0S B;  1XTC D;  4H7B A;  5ELB A;  1WD1 A;  1T5X D;  5ISR A;  1SYD A;  3R2I A;  1Y8O B;  4K5W A;  2AQ3 B;  2A5H A;  2F4I A;  1QB5 D;  4B9W A;  2XRS D;  1ZEQ X;  3D4D A;  2A69 C;  1TKW B;  4M8A A;  5IOC A;  2M9V A;  1KLU D;  4ODG A;  2AWN A;  1UNS A;  4A3M B;  2A6H C;  3VYU A;  3I70 A;  2EYM A;  2Z1C A;  4NDX A;  1TWA B;  5G3L D;  4S3S A;  4RAU C;  2BA1 A;  2QF7 A;  2XIW A;  3TP8 A;  5KYI A;  2K01 A;  4X3S A;  5CBE E;  4A93 B;  1J9O A;  5M5Y B;  1RKN A;  1PTO D;  2MUY A;  1STY A;  5E1F A;  4IUP A;  3FPP A;  4FF4 A;  1BXT A;  5CYU A;  3HOW B;  5CV9 A;  2IWH A;  4IFD H;  1HPC A;  1NCV A;  2Z4I A;  5KND A;  4K14 A;  3OHX C;  4XT1 B;  3S1N B;  2KOL A;  4DA2 A;  1ZYR C;  1EWC A;  1RCV D;  2AUK A;  2B2Y C;  4Q0F A;  4KK7 A;  1D1I A;  1TS5 A;  1FNU A;  1LLR D;  5CGK A;  1PRT F;  3VR2 A;  1QE6 A;  1ML0 D;  2Z8L A;  3MEH A;  4FYD A;  1NR2 A;  4G7H C;  1R4P B;  4ZKB B;  2XNA C;  3DXJ C;  3D6W A;  1G29 1;  2NVY B;  3PUZ A;  1I4X A;  4IUV A;  4IUT A;  2JA7 B;  2CQA A;  3WDN A;  3S1M B;  1HXY D;  5KYL A;  4KKT A;  1CK1 A;  5FO8 B;  5A2Q L;  2B2T C;  4C3I G;  4N9T A;  3MAQ A;  1SNC A;  1CT1 D;  1ZYR D;  4G57 A;  1QNU A;  2NBF A;  1X3Q A;  1AZQ A;  2JEA I;  1F2Y A;  3SVM A;  2AQ1 B;  1STA A;  2LFN A;  5EQ0 A;  1XXG A;  2NUC A;  1ENA A;  4ZLT F;  2K28 A;  5CV7 A;  4KD3 A;  2AUJ D;  2RA4 A;  2D62 A;  2A73 B;  2RQX A;  4WOR A;  3TP5 A;  4EQN A;  5IOD A;  1YNJ C;  2PW5 A;  1FR3 A;  1HFG A;  2R6G A;  1L0X B;  2O2L D;  3R8B A;  3KBG A;  1MSH A;  3IL8 A;  2KEE A;  4WJW A;  4R8N A;  2AQ2 B;  3D4W A;  4CJ2 C;  1S5C D;  3CRL C;  2JA5 B;  1WTX A;  5AFW A;  5KEE A;  4A3J B;  3J81 L;  5C0X I;  1F9R A;  3ERO A;  2XVS A;  2NN6 H;  1BCP B;  3K0Y A;  1AEX A;  2R3Z A;  1MGS A;  4XXE A;  2DNC A;  3EA6 A;  1WTV A;  1I6V C;  3DHQ A;  2M00 A;  5LHY 1;  3BVG A;  1CQV A;  4OO1 G;  4MHE A;  1LAC A;  5ELC A;  2F0G A;  2BOS A;  1R4Q B;  3K57 A;  3SEB A;  2EDG A;  4F88 A;  1FD7 D;  1B9N A;  2FJ2 A;  2B2U A;  2RKS A;  5I9P A;  2JYO A;  4KN4 C;  4Y7N B;  2VXW A;  1JCK B;  1H9R A;  4U67 3;  2EYJ A;  3Q24 A;  3Q22 A;  5C3X A;  1Q1E A;  5KGU A;  1B3A A;  4ULL A;  3QWN A;  1FGB D;  3I4M B;  1CTM A;  1WCM B;  3RMH A;  1TS2 A;  4C3H G;  3BZD B;  3DWP A;  2FIN B;  3FEW X;  4LMQ D;  4J8Q A;  1JOR A;  2M2L A;  4RCO A;  4CKB A;  5IGF A;  3I73 A;  5KNC A;  2NTT A;  3L7Z C;  3MXP A;  1LT5 D;  1SEB D;  2E2I B;  4NKL A;  1LTR D;  2QEJ C;  2O5I C;  4BA2 I;  3ZYY X;  2B39 A;  5IGC A;  1CZG A;  1EY4 A;  1HRJ A;  4A3E B;  3CRK C;  3VR4 A;  1EY9 A;  4XQJ A;  4H0L C;  3K5L A;  4KD4 A;  1IW7 C;  2D9U A;  3S1Q B;  4E6I A;  4CJ1 B;  2EJF C;  1VCI A;  5LL6 S;  5C3E B;  3VA5 A;  3V96 A;  1H9J A;  1LT4 D;  2K03 A;  4XIG S;  1SYG A;  4PQX A;  4L6T B;  1S5F D;  4HSP A;  1BUV T;  1S5B D;  1TS3 A;  4JBW A;  1D5X C;  4HCS A;  4RWS C;  4IFD G;  4P2C B;  2VUM B;  5FO7 B;  1XX8 A;  3S1R B;  1A2U A;  3J7Y W;  3E0J A;  2A6E C;  4HN7 A;  1ZKO A;  1U4L A;  1GUW A;  2JXM B;  2IPK D;  1EY0 A;  3S2H B;  5IGE A;  2NWG A;  3S2D B;  2EYH A;  2F03 A;  2EY6 A;  1LAB A;  1MI2 A;  1O78 A;  2L5T A;  3D31 A;  4RHS A;  1IW7 D;  1DYQ A;  1ONL A;  4FNF A;  1AW7 A;  4C3J G;  2D5D A;  3OWE B;  1PLF A;  1GUG A;  1Z47 A;  1CZW A;  1SJE D;  3PO2 B;  1WVL A;  4XTC S;  1Z7T A;  1LTS D;  1PTO F;  3MC0 B;  5E4X A;  4K8J A;  2A6E D;  3ERQ A;  4NW2 A;  3VYS A;  2EYL A;  3GO5 A;  3Q0A A;  1I4Q A;  4A3I B;  5M3F B;  1GUT A;  1G2T A;  3HEJ A;  4K2L A;  4RFB A;  4IQZ A;  3VYR A;  5C0X H;  3GTG B;  1AZP A;  1PYW D;  2E74 C;  4HED A;  4QF4 A;  1X3P A;  2FMC A;  2XSC A;  5I9O A;  2KA7 A;  5C5L A;  2JSO A;  2PW7 A;  4ZK9 B;  1G6Z A;  2F1M A;  1AP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...