4DR4Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4Q00
4P71A 3NBHB 2WB1E 3S1RH 4NXMQ 1TWHH 4BY1G 4B3RQ 3FKIH 2OTLA 4LF6L 4R4OA 4TQUS 3GTLH 4JYAQ 1MJEA 5M5YH 3CW2C 1HR0L 2R6GA 3HFZB 2D62A 4BBRG 3PO2H 1XPOA 1FJGL 2OTJA 2R93H 1GD7A 2VL6A 1J5EQ 1IBMQ 2VY3A 3KDFA 4KLKA 4EQ5A 3KJPA 3K7AH 5LMUQ 4A3IG 1N36L 4P72A 2JEBI 1K8GA 1HZBA 3TEHB 2UUCL 1VQEA 4DV5Q 2BH2A 2KENA 3EIVA 1TWFH 2UXCL 3MEFA 1LUZA 4LF8Q 4GKKQ 1BBWA 4L5SA 4X66L 1UE6A 4NB3A 1VQHA 2OQ0A 1EIFA 4LFAQ 4DV4L 1PA6A 3HOZG 4IPDA 5IYBG 3M4OH 2KCMA 5IWAL 1IBLQ 3S16H 1Q8KA 5FLXc 3I4MH 1JJGA 1Q1EA 4NXNQ 1I50H 1PYBA 1YVCA 4JOIC 3CCRA 4BXXH 1JT8A 1C7YA 3KF6A 2IT1A 2Z6KA 1PVOA 4DR3Q 3CCVA 1IZ6A 4OWTB 2BA1A 1KRTA 3GTMH 4A3CG 1EWIA 4DR1Q 1CKMA 4HIOA 5IY0A 1W3SA 2R7DA 4HIKA 4JI2Q 1JE5A 2Q2IA 5FJ8G 3S17H 2BA0A 4LF7Q 2KBNA 1SE8A 2B29A 1N33Q 2JA7H 1C9OA 1VQPA 1IBKL 3PUYA 4MTNA 1WYDA 1MKHA 4C3JH 4YWKA 1HNWL 1YJ9A 1KAWA 2DUDA 3CQZH 2JE6I 1OTCA 2H5XA 4HIDA 4JI7Q 2IHEA 3CPFA 4LF6Q 2Z0SA 3D31A 1PHJA 5C4JH 4QY7A 1HR0Q 1VCIA 1BBUA 3BU2A 1FJGQ 4IO9A 1YHQA 1N34L 1VQ8A 4JI1L 4APVA 3U58A 1XNRL 1Q1BA 1N36Q 2ZTCA 1L0WA 2UUCQ 4LF9Q 1L2FA 1SR3A 2Y0SE 4A3BH 2Q2HA 2F4VL 1E7ZA 3S2DH 2UXCQ 1G51A 1S72A 1FVIA 4JG2A 1N32Q 4JI0L 2MO0A 1YJWA 1WOCA 2VW9A 1VQCA 1BKBA 2LXKA 4A3KH 2MQHA 4J15A 2YV5A 1UEBA 2I5HA 3G4SA 3ULLA 3CAMA 1U0LA 1HH2P 1VQFA 1LYLA 4MNOA 5HGQA 4ALPA 2E5LL 5GAEC 3J81c 2EQSA 3TREA 1VS0A 3U4VA 3S1NH 4A3LG 3EN2A 4JYAL 4P73A 1T9HA 2KHIA 1EYGA 4LF5Q 2ASBA 1NTGA 2VZAA 2IX0A 2XGTA 3JC66 5M3MG 1S3OA 4JCVE 4DK6C 4LWCA 1RIPA 4JI6L 1Y1VH 3PUVA 5E7NA 4AIMA 1J5EL 2JA5G 4LUZA 1IBKQ 4DV5L 4JI4Q 2F3IA 3PV0A 3RLNA 1Y1WG 5FLMG 5BR8Q 4IPCA 3M85A 1HNWQ 2JA8G 1I94L 3K7UC 3UDXA 4LF8L 2HIVA 1S40A 1W2BA 2ZM6L 1BVSA 2RCNA 1CUKA 1CSQA 1L1OA 1CKNB 1Q46A 3AQQA 4YCUA 5IYCH 2ZJRA 3FKIG 2AKWB 1A0IA 2GN5A 1N34Q 1HNXQ 1OXSC 3S2HH 1YZ6A 4NXNL 5IP7H 3CC7A 2CQOA 4HJAA 2ATWA 2K14A 3RLOA 3PUXA 5EAYA 1IL2A 3PO2G 2Q2UA 2WAQG 2R93G 5C4XH 2CWPA 4Y52H 3UDIA 3GTGH 4HIMA 1PH4A 3CCLA 4JI0Q 3I2ZA 3ICEA 1EQRA 4A3EG 4WJ4A 1NY4A 2VS1A 3PF5A 3KLWA 4UY8C 3K80C 3M3YH 4PZ8A 2BH8A 4HJ7A 4B3TL 4GNXA 3GO5A 5JJLA 2D0PA 1K0RA 2E5LQ 1KD1C 4IPGA 1SFOH 3I4MG 1Z47A 1U5KA 5ELOA 1X65A 1JB7A 1JJCB 1XJVA 1I3QH 4AQYL 4JI7L 3KF8B 4BXXG 3OTOL 3G6EA 3W1GA 1VQGA 4DR6Q 1QVGA 3PUZA 4OONA 1X54A 3PIPA 1EIYB 1Q81C 2IY5B 2HHHQ 4JI6Q 3PGZA 2CKZB 1E1OA 3HOWH 4KHPQ 4GOPC 3DM3A 4A93H 4LF9L 3CP0A 3KDFB 3U50C 2K5VA 5C44H 1VQMA 2YTXA 1NMGA 4YWMA 2E8GA 2JEAI 1X56A 1SROA 2VQFQ 1I94Q 1EFWA 4GLXA 2JA7G 1KHIA 3PSIA 1YEZA 4O0AA 2ZM6Q 2PQAA 2AWOA 4L5TA 3I4NH 2PNHA 3CCMA 4DV2Q 3GTOH 3HOXH 4UP8A 2PQAB 4DAYB 4X62Q 3S15H 1HNZL 2N8NA 3M4PA 3KYHC 4HJ5A 2ZJPA 4A3JH 1QVFA 4R4TA 3GTKH 2C35B 1X6OA 2E2HH 3AEVA 4FDBA 4GN4B 1K73C 2OWOA 3CXCA 4JC0A 3KF6B 2ZTDA 3E0EA 1PH6A 3UDFA 2I5LX 1VQOA 1X9NA 4A3BG 4IJLA 4LF5L 3J80c 3UE0A 1E24A 5M3FH 4YCWA 4X65L 4DV3L 4JI3L 4UPAA 4B3TQ 3UE1A 1YITA 3M7NA 3WWVA 1E1TA 2A8VA 4A3KG 2IHFA 1UE5A 1WJJA 1V9PA 1YJNA 5H1SE 4JI4L 3S14H 1NJIC 3OW2A 2YU9H 3CCJA 2JA6H 5BR8L 4AQYQ 3L7ZC 4AH6A 3CPWA 3OTOQ 3T1HL 3JAMc 1PH3A 1PH5A 2NZOA 1X55A 2ALYB 3ULJA 3J81j 1UE1A 4UP9A 4A3FH 2K5HA 2B63H 2VNUD 5JJIA 4YWLA 2PI2A 2PI2E 5JEAG 1G6PA 2N3SA 4LW1A 3CC2A 4GS3A 4H02A 1HNXL 4YHHQ 1LTLA 3I7FA 4R4QA 4BBSH 4A75A 1GKHA 1PH1A 2VQEQ 2GVAA 3AFPA 3NEMA 3J80i 2UUBL 2YTVA 1OXVA 1MIUA 4JBKA 3BZKA 1I5FA 1Y1VG 4DPGA 2UUAL 3KFUA 2RF4A 4LFBQ 4JV5Q 1OXTA 4C3IH 3CMEA 1K9MC 4OXPA 2MFIA 1PV4A 4LUOA 2WAQE 2Z6KC 3PO3H 5JEAJ 3L2PA 4QJFA 3JAMi 3CCUA 1HJPA 1HNZQ 1Q86C 2CCZA 1TWCH 3HOUH 5IYCG 4JBMA 4X6AH 1VQIA 1PFSA 1X3EA 3S1MH 4UP7A 1FL0A 4OX9Q 2R7ZH 5IP7G 1C0AA 3CCSA 1PH2A 3E9HA 1PH8A 2AMCB 5IYDH 1VQ9A 3I4OA 3F2BA 5C4XG 4ME3A 4DK3C 4DR6L 5DLQE 4X65Q 4DV3Q 4PZ7A 4JI3Q 1TWGH 2VUMH 2HHHL 3K8AA 1VQLA 5K36G 3H3VH 4KHPL 2AHOB 1J6QA 4QL5A 1VQNA 4C2MH 4OWXB 1M1KC 4DR2L 4A3MH 4EX5A 5M5XH 3M4QA 1EOVA 3H0GH 4LFCL 3STBD 3T1HQ 1YIJA 1B70B 2VQFL 3TS0A 4KI0A 5C0XJ 2ZTEA 2Q2TA 3GTQH 4KHZA 4DUYL 3HOYH 3U4ZA 1MJCA 1YHBA 1QZHA 4DV1Q 4A76A 1L1OB 3ZJYC 3G71A 4X62L 3H3VI 2CFMA 2NVQH 1GO3E 1ASYA 2UUBQ 1E22A 1CKOA 1A63A 2UUAQ 2WFWA 2WP8J 2R92H 3HOWG 2JJQA 4A93G 5JJKA 1EQQA 4DKAC 1WI5A 5C44G 3HOVH 4IOCA 5IE8A 2QEXA 4DV6L 2YYZA 3IRBA 1QZGA 4IOAA 5C0XI 1TWAH 1HR0W 2K4KA 3KJOA 3I4NG 4OO1G 4YY3Q 2UXBQ 1G291 3F1ZA 1B8AA 3HOXG 3FP9A 3PIOA 4GNXB 3BJUA 1QVCA 4DNIA 3T1YL 4A3JG 4BA1I 2RHSB 1B7YB 1KL9A 4LNQA 4DR4L 5AJ3Q 2NN6G 3TRZA 2MO1A 4DR7Q 3M9BA 4JOIA 2OQKA 1QUQA 5GAGC 2KCTA 4YHHL 4DR5Q 1VQJA 2XTIA 1YI2A 1K8AC 2ES2A 3W5OA 1RL2A 2HT1A 4QQBX 5M3FG 1N32L 1QUQB 4DV7Q 2NZHA 2VQEL 5J3BA 1NBWA 1YNXA 4DR2Q 1L1OC 4HJ8A 1UWVA 3CF5A 4JI8L 3GTJH 2E2IH 4LFCQ 1VQ7A 4LFBL 4R4IA 3J7ZC 4L5RC 1XMOQ 4LUVA 4JV5L 1FGUA 4DUYQ 2N78A 2ZJQA 2EIFA 4A3GH 3I55A 2JA6G 4A3DH 1KIXA 2LSSA 3GDEA 1HZ9A 1SMXA 5LMNW 1VQ6A 3GD7A 4A3FG 1IYJB 1AE3A 1Q12A 2B63G 1WCMH 2HIXA 5C3EH 1SLJA 1H95A 5ELNA 3UDGA 4OX9L 1A8VA 4JI5L 4BBSG 1KQSA 1VQKA 3S24A 3CMAA 3J7A5 4AYBG 4IFDG 4GNXC 2I0QA 1VQ5A 3RN2A 4A3EH 1XMQQ 1SRUA 3FHWA 4DV6Q 5GADC 3RN5A 1JJ2A 3S1QH 3SGIA 4BY7H 3B6YA 3EBEA 3NENA 2UU9L 4POFA 3KOJA 3K0XA 3DLLA 4XIGS 5IP9H 4LF4Q 3PO3G 1YBYA 1XTDA 4DUZQ 3CC4A 4DV2L 2NN6I 3PCOB 2F52A 4YCVA 4BY1H 3T1YQ 4RG1A 1PYSB 1D8LA 4DV0L 3HOUG 3HKZG 2D0OA 1HZCA 2R7ZG 4DR4Q 2K75A 4IFDJ 2EXDA 2JQOA 3G48A 4BBRH 5IT9c 3HKSA 2UXDQ 1CSPA 1TXYA 3A0JA 5IYDG 4DV1L 5LMNL 1N9WA 4B3SQ 3RZOH 2KHJA 2WB1G 3PUWA 4A3IH 2NVXH 4X64L 1NMFA 3OYYA 1XNQQ 1ASZA 4WJ3M 4RMFA 2VUMG 1VQBA 4GLAC 4BA2I 4JI8Q 1KXLA 2RHQB 4A3MG 3HOZH 1X3FA 2AWNA 4GOPB 1PH7A 1HZAA 1Y14B 1E3PA 1Z9FA 4JBWA 3H0GG 5IYBH 4GKJL 1AH9A 1M90C 3HOYG 2UXBL 3H15A 1SN8A 4YY3L 3CCEA 2A1AA 4IFDI 1EUJA 4GN3B 2QGQA 3RZDH 2B3GA 4JI5Q 3F2DA 4K0KL 4A3CH 5C0XG 4POGA 1NE3A 2ID0A 4GLVB 1Q7YC 3F8TA 3NELA 1GM5A 3ERSX 2FXQA 2R92G 1KC8C 2JA9A 1A62A 3ER0A 4PG3A 5GROA 5AJ3L 2K50A 4MZ9A 3CCQA 4DR7L 5FJ8H 1P8LA 4X66Q 4DR5L 1R9TH 4DV4Q 3HOVG 2UU9Q 4TVAB 5IWAQ 2MNAA 3L0OA 4DV7L 5HY6A 2N49A 3MXNB 2HQLA 1I6HH 1VQAA 1YHAA 1Q82C 2PMZE 3TQYA 1PH9A 3AFQA 4R1JA 5GAHC 1UE7A 4DV0Q 1XMOL 4B3ML 2JK8A 1X3GA 1JMCA 1IXRA 3BZCA 4NXML 1D7QA 3A5ZB 1K83H 2LXJA 4B3RL 3K81C 1V1QA 3W1BA 2NVTH 3A5UA 5LMNQ 2QA4A 2K52A 3E9IA 4X64Q 4GN5A 1GVPA 4JBJA 2IX1A 3AYHB 1IBML 1XPUA 2R7FA 1O7IA 3RR5A 3STBC 5LMUL 3RNUA 2L15A 3VDYA 1LM0A 2OCEA 1AE2A 4HJ9A 4P75A 4GKJQ 1XMQL 1P16A 4C3HH 2V1CC 3ULPA 4GOPA 1N8RC 1CKNA 2Y0SG 4GKKL 1OXXK 4LFAL 3CD6A 1XPRA 2DGYA 3J81i 4A3GG 1IBLL 4AYBE 2K5NA 4A3DG 1V43A 4OWWB 3LGJA 4LF4L 4P74A 4DUZL 4JI1Q 1OXUA 2NVYH 4QGUA 4XTCS 3RLFA 4IJHA 1XNRQ 4K0KQ 3F2CA 4OO1I 4A3LH 1WCMG 1K3RA 5GQOA 2CWAA 5C3EG 2E2JH 4O2DA 4R4CA 4DR3L 2F4VQ 1VQ4A 1KRSA 5M3MH 2UXDL 4DR1L 3D0FA 1VQDA 4B3SL 4A4IA 3A74A 4L5QA 1DGSA 2JA5H 4NPSA 1WFQA 3TS2A 2A19A 3HKZE 5M5WH 4Y7NH 1XNQL 2GVBA 4JI2L 2I5MX 4BY7G 2YTYA 4PZ6A 1Y1WH 4LF7L 5FLMH 3Q8DA 3GTPH 2JA8H 4QIWE 4IPHA 1N33L 4B3MQ 5IP9G 3PF4A 4DAMA 3I56A 4PMWA
chains in the Genus database with same CATH superfamily
1EYCA 4P71A 4DA2A 4NXMQ 3A8JE 4B3RQ 4J8QA 4R8IA 2OTLA 4TQUS 5EQ0A 3CW2C 1PRTB 2N88A 2HUGA 1L0YB 1PZKD 2QF7A 2WKDA 2R93H 1JORA 4EQ5A 4A3IG 1JE4A 5LMUQ 4P72A 1HZBA 1SMYC 3EQLC 3H0GB 2BH2A 1GUSA 3NWSA 1LUZA 1AZPA 1PA6A 1EIFA 2K05A 4LFAQ 4DAYA 1BCPD 1BOSA 2BDOA 5FLXc 1Q1EA 2PZWA 1YVCA 1K8MA 1SSOA 1C7YA 1SNQA 2RVLA 4DR3Q 4OWTB 2BA1A 1EWIA 1UNSA 5L37A 2J0TD 5C3XA 2RA4A 2F3WA 4HIOA 3I73A 3K0YA 1W3SA 2R7DA 4X3KA 5FJ8G 1XX8A 3S17H 3SK4A 3H6MA 4XQQA 4F87A 2JA7H 4DK1A 1JQYD 4N8FA 1MKHA 1EY4A 5CV9A 2PNRC 3MA2B 1YJ9A 1F2LA 4JI7Q 1ENFA 1OTCA 3J80L 1EY8A 2Z0SA 5EBCA 5C4JH 1HR0Q 1BBUA 2F0HA 4ZUJA 5DNFA 3OOCA 1N34L 1FJGQ 3HOWB 3OWEB 1ICFB 4APVA 4A93B 1KNAA 1L0WA 2UUCQ 3H94A 1L2FA 1SR3A 4BS9A 4A3BH 3J80E 1E7ZA 4ODGA 2AUKA 5I2XA 1S72A 4JI0L 2O2LD 4G7HC 1VQCA 3L9AX 1L0XB 1UEBA 2I5HA 3CAMA 3SK6A 1U0LA 1HH2P 2F0LA 1D5ZC 2K7VA 2B8GA 2O5JC 1ENCA 1EIHA 3WOEA 3U4VA 1VS0A 4LAAA 5I9OA 1EY9A 5I9PA 1T9HA 2KHIA 2K5WA 4LF5Q 1B1ZA 3OWFA 2IX0A 3FRPB 1RHPA 2ZT9C 1RIPA 2L9HA 1Y1VH 4AIMA 1J5EL 1WTQA 1IBKQ 4DV5L 4RA8A 4C1NK 3PV0A 1TS2A 5J22A 5FLMG 2Q8IB 4I65A 3K7UC 2HIVA 4CDFC 1CSQA 1CKNB 1SYGA 1JOKA 4BBSB 1OXSC 3S2HH 4AYBB 2A69C 5BN3A 2ATWA 1IKLA 5EAYA 4FO2A 5LL6X 1IL2A 3J7AF 4HTHA 2SNMA 5C4ZA 5C5MA 4HCSA 1PH4A 4UAIA 2F4IA 3RMHA 1ZKOA 1C4QA 1LT6D 4ZKCB 3M3YH 2BH8A 5JVH3 3HOUB 4RHRA 3KLRA 3RZDB 4P2CB 3OW7A 3BVGA 3QOLA 4IPGA 1SFOH 1VMCA 3PIP3 1U5KA 1JB7A 2EYJA 3OTOL 3RD4A 4DK0A 3LNNA 4FXGC 3PUZA 5EJWA 2IY5B 5HGTA 2HHHQ 4K6LA 4GOPC 1B4OA 2F0DA 3KDFB 1VF5C 1D1KA 1I6VC 3TSSA 4TRDA 2L1BA 1FNVA 2VQFQ 1I94Q 1YEZA 3IL8A 2ZM6Q 4L5TA 4C3JG 2PNHA 2EYMA 3GTOH 3HOXH 3BYYB 1D2BA 1CI3M 2N8NA 3M4PA 2B2UC 3GTKH 1BQQT 2R92B 2RDFA 3AEVA 4FDBA 2NTTA 4GN4B 3R93A 3CXCA 4JC0A 3HOVB 1PH6A 1V1PA 4K14A 3UDFA 5IGFA 1SYDA 4IJLA 2EZVA 3J80c 4ZRZA 3UE0A 5J39A 5M3FH 3MWYW 1TWAB 3X3NA 4B3TQ 3WWVA 2A8VA 4ZQ3A 2PZUA 2IHFA 3IKJA 3A54A 3H3VC 4XYOA 4JI4L 3NBIA 1PLFA 3T1HL 3L7ZC 4CKCA 3Q22A 2QCPX 3SHLA 3ULJA 4UP9A 2K5HA 4H7BA 5JJIA 1G6PA 2HDMA 2PI2E 1LTLA 3I7FA 1PH1A 1UUPA 1PTOH 2K33A 1U4MA 2RF4A 5D14A 3VR3A 1NAPA 1OXTA 1TWHB 3MZ5A 1K9MC 1B50A 1RD9D 2KJXA 4IUUA 4L63B 2WAQE 2XSCA 3JAMi 4X6AH 5IYCG 4JBMA 3S1MH 1FL0A 4OX9Q 1C0AA 3CCSA 2F0FA 1PH8A 2JP1A 1VQ9A 3F2BA 4ME3A 4PMBA 4X65Q 4DV3Q 3M4OB 3S16B 1VQLA 4KHPL 3TP8A 1M1KC 3VYSA 1A2TA 1TS3A 4EX5A 1ZEQX 1YIJA 1EOVA 1SEBD 4N9PA 4KI0A 4C1NI 3GTMB 3HOYH 1QZHA 3RZOB 4DV1Q 1L1OB 1BO0A 1FNUA 1Q8IA 3G71A 3H3VI 1ENAA 3ND8A 1PFMA 1GO3E 4H0LC 2BE5D 1CKOA 4B9XA 3MFGA 5I2YA 5IGBA 2A5HA 2WP8J 5DAUA 2JJQA 4C3JB 5JJKA 1WI5A 5C44G 2E74C 4IOCA 3I4LA 2YYZA 3I4NG 4QUCA 4N8X1 1G291 3F1ZA 1B8AA 4OELB 3FP9A 4HAEA 4GZYC 1XXGA 1QVCA 2HD3A 3T1YL 3X3MA 4Q5VA 2D9UA 1GJXA 1HQMC 3A55A 2MO1A 4JOIA 2OQKA 2ES2A 4QQBX 2VQEL 2JSOA 5CC4A 4ZLTF 3K5NA 3GTJH 3J7ZC 4JV5L 4LUVA 1SMYD 2EJMA 1KABA 3P75A 2ZJQA 2JA6G 2E2DC 2EY1A 1KIXA 3GDEA 1HZ9A 1F2ZA 4RWSC 2EJGC 1VQ6A 3GD7A 4A3FG 1AE3A 2KCNA 1WCMH 3D8GA 5C3EH 3UDGA 3T53B 1PZJD 1KQSA 1VQKA 2XWJB 1ET9A 5ELCA 4GNXC 2I0QA 1SRUA 4DV6Q 1STAA 4C3IG 4KK7A 1JOOA 3K0XA 3DLLA 5IP9H 4LF4Q 1B9MA 1U4RA 5E3FA 3NUCA 1D8LA 4DAVA 4DV0L 1F9PA 2NZ1D 4H44C 1HZCA 4WRDA 3D4DA 2K75A 2JQOA 3G48A 4BBRH 4K2KA 4PNYA 4UDUC 4KY7A 2JA5B 4B3SQ 3NQIA 2WB1G 1E2ZA 2O5IC 5FK9C 1G2TA 2MP1A 4EVOA 5CR3A 3S1RB 2RHQB 4A3MG 3HOZH 1X3FA 3FKIB 1SAPA 3S2DH 1Y14B 1E3PA 4RGMA 5M5YB 4ZK9B 1M90C 3PO2B 2OF1A 2WAQB 3K58A 4YY3L 3CCEA 4IFDI 3NTIA 4GN3B 4KKSA 3K7AB 5KYIA 4BWGB 3A8KE 2FXQA 2AQ1B 2JA9A 3ER0A 5JPMC 5ISRA 2B8FA 3UI2A 1HCZA 2UU9Q 4TVAB 2F0VA 3I4MB 1CHQD 1I50B 3MXNB 2HQLA 1NUCA 4PMWA 3EVQA 4R1JA 2JK8A 2PMZB 1X3GA 2LXJA 4L6TB 2K28A 3W1BA 5LMNQ 4DF7A 2QA4A 5COYA 1CT1D 1GVPA 2IX1A 2C9OA 4DNRB 2B2WA 2LS01 3AYHB 2A69D 3RR5A 1BBXC 1KDCA 2GA4B 4P75A 3KLSA 4I7AA 1CKNA 4QB4A 3GP7A 4GKKL 1LABA 1S5FD 1NSNS 4FXDA 1JB3A 3W2DA 3R3OA 4A3GG 4A3DG 5TSSA 1C48A 3KBXA 2WACA 4C56C 1IYUA 5C5LA 4R4CA 5M3MH 2F0NA 1VQDA 3A74A 2A19A 5M5WH 4Y7NH 2GVBA 3U9SA 4BY7G 4LF7L 4IUVA 1SNCA 3D4WA 2H1EA 3IFTA 1STYA 1SDFA 1MBYA 1WTPA 4BY1G 2KCCA 4LF6L 1J8IA 3GTLH 4R4OA 1EIGA 2OTJA 4PQXA 3OHXC 2EYFA 3SR1A 1J5EQ 5IGCA 3KDFA 3KJPA 2BOSA 4KLKA 2E2IH 4I7ZC 3TEHB 4DV5Q 3E0JA 3SVMA 2KENA 3TZUA 3EIVA 4XT3B 2UXCL 3VR4A 5DM73 1N32L 1UE6A 4NB3A 5FO7B 4IPDA 5IWAL 1WTXA 1F9SA 1YNJD 3TZDA 2HCIA 4NW2A 1STBA 1PRTD 1PYBA 5CMDA 5C4XB 4BXXH 3GTGB 1D1IA 2F0EA 3CCVA 1KRTA 1TS4A 3RUZA 4A3CG 1NR2A 3BG3A 5KGUA 4HIKA 1SNOA 1JE5A 3BS1A 3Q24A 5HURA 1WTRA 2BA0A 1WD0A 3NP8A 1C9OA 1VQPA 2NYZD 1I3QB 1KAWA 1STNA 2H5XA 3CPFA 5A2QL 4ZYSA 3I70A 3R2TA 3D6WA 4IO9A 1VQ8A 1XNRL 2NTSA 4RAUC 1LTSD 1N36Q 1DM0B 2ZTCA 4K8IA 2Y0SE 4QCLA 1RTOA 3JAML 5A2QE 2F4VL 4JG2A 1AFPA 4A3DB 5ELBA 1WTHA 4IZ8A 2MQHA 1QOHA 1HHVA 2EY5A 4A3JB 1FYCA 1IL8A 1LYLA 3JAME 2E5LL 3J81c 1EL0A 5KNDA 3TREA 1HUMA 3EN2A 2L0CA 5JEAH 4WFN3 1JOQA 1AZQA 1F9RA 4P73A 1NTGA 2LY7A 1VDZA 2XGTA 3JC66 1S3OA 2SOBA 4DK6C 4PMCA 3QG1A 5E7NA 1G91A 3S14B 3CU7A 2LMCB 4DXGA 5DM63 4JI4Q 3RLNA 1Y1WG 4FVMA 1WTWA 1WTOA 2JA8G 3UDXA 1S40A 1TQOA 5D3IB 1L1OA 3AQQA 4GOPB 4YCUA 2AKWB 1A0IA 2GN5A 3T13A 3VA7A 4NXNL 3R2IA 3CC7A 4HJAA 2K14A 2B2VA 4O42A 5NUCA 2BCOA 2Q2UA 2R93G 1STEA 1WD1A 3CCLA 3I2ZA 3QO2A 1A3VA 4A3EG 1NY4A 2VS1A 3K80C 3CKIB 1TWCB 1ILQA 5JJLA 2DN8A 2R7ZB 4X3TA 1GXDC 2XVSA 3V2TA 4AQYL 3G6EA 1QNUA 1A2UA 1QVGA 4OONA 2VUMB 1F9QA 2RBMA 1MI2A 4JI6Q 3PGZA 3KLSX 3HOWH 2PZTA 4KHPQ 5CBEE 4A93H 1I6HB 2K5VA 2YTXA 4RFBA 3KUPA 4YWMA 1FR3A 1EEID 4FXKC 1SROA 4K8JA 1EFWA 4GLXA 2JA7G 3PSIA 5EPLA 2PQAA 3CCMA 4DV2Q 1F77A 3QR8A 5CV8A 2A6HC 4UP8A 4ABNA 2NVQB 1IW7D 1H9SB 5JPNC 3WDNA 3KYHC 3HZXA 2A6EC 2C35B 3E3XA 1X6OA 2E2HH 3E0EA 2I5LX 4A3BG 2RDHA 1EZ8A 4YCWA 4JI3L 3UE1A 3M7NA 4KTAA 5T1GA 1UE5A 4CDCC 2KQ3A 4KD4A 4V190 1QJOA 4LMQD 2AQ2B 1HNWL 1PH3A 2F0JA 3NK9A 3JAMc 2NZOA 3QJYA 2ALYB 2DY8A 2PW5A 3J81j 2KVMA 2B63H 2VNUD 2PI2A 1CZWA 1LV9A 4GS3A 2EYLA 1HNXL 4XDXA 4BBSH 4FNFA 1D5MC 4A75A 2VQEQ 3DEOA 4IFDH 2YTVA 2AUJD 4JBKA 1Y1VG 3CRKC 2UUAL 2Y0SB 3MAQA 4JV5Q 2HDLA 1DXMA 3CMEA 1PV4A 1K8OA 4LUOA 2Z6KC 4IUPA 4DGZA 1S5ED 1HNZQ 3GV3A 3HOUH 5JJZA 1LTRD 1PFSA 1Y8OB 1I4XA 4F8MA 2Q8RE 1PH2A 3MXPA 1J9OA 1SYCA 4A3EB 2VB2X 4HSVA 1UAPA 5IYDH 4OL7A 1HRJA 4DK3C 1A3UA 1EY5A 1DZ1A 3MXNA 4RGNA 1BDOA 4F7XA 3W3AA 4DR2L 4LFCL 3M4YA 1B70B 5C0XJ 2Q2TA 3GTQH 4DUYL 4JK1C 3FVQA 1EQVA 2R61A 3U4ZA 4A3IB 2I46A 4M1UB 5C0XH 2UUBQ 1A63A 2WFWA 2R92H 2KA7A 1A15A 1EQQA 1QG7A 1QWYA 3HOVH 4QF4A 5D3DA 2QEXA 2B2TC 2CHBD 2IL8A 1QZGA 1LTAD 1TWAH 2L12A 1HR0W 1LTTD 2EYPA 1SYEA 1CA6A 4YY3Q 3HOXG 4GNXB 3PIOA 5C3WA 2IWHA 2XIWA 4DNIA 4A3BB 4Q0FA 2RHSB 4MN3A 4LNQA 1TR5A 2NWGA 3TRZA 2EPBA 2XTIA 5I6WA 2HT1A 1RL2A 3DHQA 2SDFA 4S3SA 1QUQB 5M3FG 5J3BA 1YNXA 3CF5A 4JI8L 1VQ7A 4R4IA 4DNTB 3G7LA 5J1ZA 2F0TA 4M8AA 2EIFA 4B08A 2XNAC 2HIXA 1B44D 3D4RA 1A8VA 1K3BC 5IOCA 1MSHA 1VQ5A 5E1FA 4OHJA 3SGIA 1F2YA 3B6YA 3N6RA 1EYAA 3NENA 2IX3A 3KOJA 5EKIA 4XIGS 1YBYA 3CC4A 2F0GA 2NN6I 1JICA 3PCOB 2F52A 4FP5D 1EWHA 1PYSB 2IW3A 3HKZG 2D0OA 1HUNA 4DR4Q 1XYIA 2EXDA 2A68C 3URYA 4ZKBB 1CSPA 2FMMA 2AQ3B 2VB3X 2SNSA 2V4DA 3A0JA 3RZOH 2KHJA 2BDNA 3AU7A 3CHBD 3M3YB 4TKOB 4X64L 2NBFA 3OYYA 3R8BA 1VQBA 3GTPB 4BA2I 1ZYRC 1IYVA 2HCCA 2AWNA 1PH7A 5IYBH 1AH9A 2QDLA 2TMPA 1GOZA 1EY6A 1DJRD 3HOYG 2UXBL 2A1AA 2PPBC 2QGQA 4JI5Q 4G4KA 3ZYYX 2H4OA 4HR7B 1X32A 1IHZA 2ID0A 1GM5A 3NELA 1O7LA 1TWFB 1A62A 4PG3A 5GROA 3CCQA 1P8LA 1SNMA 1R9TH 4OIJA 4ZUIA 2N55A 5KIXA 5IWAQ 1PFNA 2MNAA 3DWPA 3OSOA 5HY6A 2N49A 1VQAA 4H13C 2PMZE 3TQYA 1XMOL 4NXML 4RKBA 1D7QA 4NDXA 4B3RL 1LT3D 5FO8B 1UEAB 3K81C 3A5UA 1DOKA 3E9IA 2WV6D 4GN5A 4CDEC 1O7IA 3STBC 5LMUL 1M8AA 3CQZB 4CKEA 2QW7A 3QWNA 4HJ9A 4GKJQ 4C3HH 1N8RC 4GOPA 2QDBA 4JW0A 5IIFA 4LFAL 3CD6A 3C1FA 2K5NA 3LGJA 4P74A 1XNRQ 2RSOA 4K0KQ 4IJHA 5EGTA 4OO1I 4A3LH 1WCMG 4XXEA 5C3EG 1JR0D 2RDGA 4DR3L 1HPCA 2F4VQ 1MHWC 1KRSA 4WORA 2UXDL 2B2UA 3K5LA 1DGSA 3SE0A 2JA5H 4NPSA 5A35A 1LTBD 4UHVA 1FD7D 3HKZB 3S1MB 1BR9A 3Q8DA 4IPHA 4B3MQ 5IP9G 3S1NB 1C8CA 3HP3A 2F0IA 3NBHB 2WB1E 3S1RH 1PTOF 3FKIH 2A73B 5BN4A 5M5YH 4HN7A 1HR0L 2R6GA 3PO2H 4BBRG 1XPOA 1FJGL 3EA6A 4B9WA 1GD7A 1IBMQ 3K7AH 1K8GA 4LJZC 2JEBI 2MJ8A 2UUCL 1EEFD 2JXMB 3MXGA 4XT1B 3MEFA 2L55A 4K6DA 1Y8PB 4L5SA 4X66L 4DV4L 3HOZG 3K57A 1H9SA 1IBLQ 3I4MH 1JJGA 4N9TA 4NXNQ 1LLRD 1I50H 3OMCA 1JT8A 5BN5A 2ZXRA 2IT1A 5E4XA 3MXUA 2EY6A 1BUVT 2MUYA 4DR1Q 4KV6A 3I8ZA 1BCPC 4JI2Q 2Q2IA 3FPUB 4K5WA 2EYHA 3T4AC 1N33Q 1IBKL 3PUYA 1QB5D 1WYDA 3L3OC 5CORA 4YWKA 4ZCKA 4HIDA 2IHEA 2B2YC 4KHVA 3D31A 4FYDA 4K5VA 1VCIA 2JN4A 1M4VA 1NNXA 4XQNA 1YHQA 2WINB 5M9OA 5JOBA 4U68A 5C44B 2XN9C 3VA5A 1B9NA 3GTJB 4TSSA 1G51A 3I4NB 1TIID 1WOCA 2VW9A 2LXKA 4A3KH 3DM1A 2YV5A 3G4SA 3S15B 4NMZA 4RGTA 4RGOS 1WCMB 3TBIB 1VQFA 2XRSD 5HGQA 5GAEC 2EQSA 1MD2D 1DOMA 3BDCA 4HMJA 4JYAL 1EYGA 5T1IA 3T51B 4NP5A 1ESRA 5M3MG 1QCBD 4JCVE 3C3LA 4LWCA 1TKWB 3NTHA 4MTKA 2DNEA 4LUZA 1I4RA 5C4HA 2YU9B 2JA6B 2F3IA 1ESFA 2WIIB 3M85A 1HNWQ 1R4QB 1I94L 1TVXA 2KHSA 5EBDA 2K5DA 4A3FB 4LF8L 2ZM6L 2RCNA 2PQEA 4BBRB 1CUKA 2ZJRA 2PO4A 3TMEA 3LWUA 3DWQA 1N34Q 1HNXQ 1YZ6A 5IP7H 2CQOA 1T5XD 1B53A 3RLOA 3PUXA 5C4XH 2CWPA 2E75C 4Y52H 3GTGH 3NWTA 4HIMA 4C3IB 2PYKA 3FEWX 1AN8A 4JI0Q 1KDBA 4ULLA 5K36H 3KLWA 4PV1C 5CV5A 4UY8C 4QMGA 3LWEA 1A6XA 4YIJA 4HJ7A 4B3TL 4GNXA 3GO5A 4RH6A 1S5DD 1Z47A 1X65A 1XJVA 1I3QH 4BXXG 2WB1B 3NHHA 3J7YW 1X3QA 2XRQD 4CJ2C 1Q3LA 1TWGB 5CBAE 3TN2A 1Q81C 5FO9B 2CKZB 4C2MB 4X3UA 3QIAA 4A3MB 4LF9L 5M5XB 1F2MA 3U50C 1O80A 1BNZA 2E8GA 3C2PA 1SJED 1PTOC 2K6AA 2KOLA 4O0AA 1B2TA 2AWOA 1CHPD 3E5SA 3K5OA 2O4XA 1EU3A 2JYOA 4HJ5A 2ZJPA 1TY0A 3ONAB 4A3JH 4R4TA 1QVFA 1TS5A 1G6ZA 3KF6B 4KD3A 2NN6H 3DWAA 2PW7A 3FPPA 1V1PB 4L8JA 1CK1A 4X65L 4DV3L 4UPAA 3KBGA 4OIKA 2MHVA 1RTNA 1V9PA 5CV6A 5H1SE 3S14H 1NCVA 4OEMB 5BR8L 5KEEA 3CPWA 3OTOQ 1PH5A 4KY6A 3ERQA 4FF2A 4YWLA 2NVTB 5JEAG 3CC2A 1S5BD 1RCVD 3T16A 5EPJA 2FINB 1W6KA 1PDQA 2GVAA 1OXVA 1MIUA 1I5FA 1G2SA 3KFUA 4A3GB 4U673 3D3RA 3PO3H 3P20A 1H9MA 5JEAJ 3L2PA 3CCUA 1HJPA 1Q86C 1TWCH 1KLUD 1EY7A 1KDAA 1X3EA 2FFKB 4KY5A 2R7ZH 1KTKA 1VMPA 4FF3A 3I4OA 3EJIA 4DR6L 5DLQE 3S1QB 5IGDA 4BY7B 5I6YA 3FMCA 4R8NA 2RQXA 2VUMH 3K8AA 5G3LF 3H3VH 2AHOB 4QL5A 1VQNA 4OWXB 1SBBB 4K2LA 4BY1B 1LT5D 3H0GH 3STBD 1STHA 3T1HQ 2M9VA 2CVRA 4KHZA 3I91A 1MJCA 2ICIA 3SK5A 3A56A 3V96A 2NVXB 4X62L 2CFMA 5CV7A 4KN7C 2NVQH 1ASYA 2FHTA 1Q90A 1E22A 3I72A 3MEHA 5IODA 1U4PA 3HOWG 4OO1H 4A93G 4DKAC 5FOBB 3PIO3 4KKTA 5IE8A 4DV6L 4IOAA 2K04A 2K4KA 3KJOA 2UXBQ 1AW7A 2BE5C 1FNWA 1MSGA 2F0SA 2A74C 4X3SA 1B7YB 1KL9A 4EQPA 3PQIA 2ENBA 2CW0C 3M9BA 1YI2A 4YHHL 1VQJA 3W5OA 3E6ZX 3HS0C 1S4ZA 4HJ8A 1ONLA 2RKSA 3I3CA 4LFBL 1PXUA 3NBHA 1XMOQ 1FGUA 1K83B 1RF2D 3I55A 3BYTB 3Q0AA 2Z8LA 2B63G 1Z7TA 1SLJA 1H95A 4HEDA 4ZAIA 2E76C 1DYQA 4BBSG 2Z1CA 3CMAA 4G7ZC 2Q8TA 4AYBG 3OPOA 3J7A5 4IFDG 4G57A 3RN2A 4A3EH 3RN5A 3PMFA 2G9DA 3VYUA 1KLGD 2UU9L 1DONA 2NVYB 1PRTF 1JWMD 2E2JB 3HOUG 3T1YQ 2DJFC 3DUZA 4CGYB 2X6LA 4IFDJ 1GUTA 2UXDQ 4MIUA 5IYDG 5LMNL 1N9WA 3PUWA 4A3IH 1BXTA 2KEEA 3EFXD 1KNEA 1Y1WB 1ASZA 2JA8B 1LT4D 4MHEA 4NKLA 5ELEA 1CQFA 3HEJA 1SE4A 3Q6SA 3IAYA 1HZAA 4JBWA 1JCKB 3TDQA 3H15A 2R93B 3RZDH 3F2DA 5C0XG 4QUFA 4RCNA 4GLVB 1SXTA 5IGEA 1W6JA 3ERSX 5EKKA 2R92G 1KC8C 1MGSA 5AJ3L 4DR7L 2K50A 1V1OA 4MZ9A 1PMRA 5FJ8H 4X66Q 2DNCA 4DR5L 3HOVG 4DV4Q 3K5MA 1ET6A 4ME5A 3L0OA 4DV7L 1O78A 3S9WA 1Q82C 2E2HB 4DV0Q 4V0BA 4DFAA 1JMCA 1IXRA 3DEPA 1YNNC 2K1BA 3GV6A 3S17B 4JBJA 2K03A 1GHKA 3TP7A 3SXHA 1JWUD 4RKLA 2J4XA 2JA7B 2L4NA 2IPKD 2C5CA 3J7AV 1LM0A 1AE2A 3NTKA 1EY0A 1P16A 3ITPA 1XMQL 5C4JB 2B63B 1GUOA 1XPRA 3J81i 4OWWB 4IUNA 4DUZL 4XTCS 5ELFA 3F2CA 2M2LA 2CWAA 3GQBA 1LACA 4O2DA 1CM9A 3SEBA 1VQ4A 2F0WA 1CA5A 4L5QA 1XWEA 2SEBD 3HKZE 4RHSA 4DU9A 1LO5D 1XNQL 2I5MX 4KJOA 4K5XA 2RCFA 2YTYA 4PZ6A 1H9KA 5FLMH 3GTPH 1SYBA 4QIWE 3D6CA 4DAMA 3I56A 1T5EA 1BCPB 1TWHH 2ZXOA 2EVBA 1PTOD 3K6OA 4JYAQ 1MJEA 1QE6A 3V05A 3HFZB 2D62A 1Y1VB 1GUWA 2VL6A 2VY3A 2DJGC 1A3TA 1N36L 1EU4A 5JVG3 1VQEA 1EZ6A 4FF4A 3GTQB 4WJWA 1TWFH 4ILWA 1BF4A 3QOJA 4LF8Q 3T56B 1BBWA 3AB9A 1HXYD 4GKKQ 1VQHA 2OQ0A 1BCPF 3VR2A 5IYBG 2KCMA 3M4OH 3S16H 3S2HB 1Q8KA 5EPKA 4JOIC 3CCRA 5KNBA 3KF6A 1PVOA 2Z6KA 1HFNA 1IZ6A 3CRLC 4E6IA 3GTMH 3Q23A 1PZID 3N52A 1CKMA 1ZXTA 3EROA 5IY0A 4J1MA 1YNJC 4DN4M 3P7JA 3WOFA 1PRTC 4LF7Q 2KBNA 1SFOB 1SE8A 2B29A 4MTNA 4C3JH 2DUDA 3TP6A 4EQNA 3CQZH 2JE6I 4LF6Q 2Z6BA 1PHJA 4QY7A 4CJ1B 3BU2A 1K0SA 1E2VA 2X69A 4JI1L 3U58A 1Q1BA 2PCFB 4LF9Q 4KKUA 4IURA 2Q2HA 1D6EC 4LK1C 2UXCQ 1FVIA 1HTPA 1N32Q 1PYWD 2MO0A 1YJWA 1I4HA 3GTOB 3HOXB 3BDLA 1BKBA 4J15A 4C3HG 3ULLA 5K5PA 3FDTA 3GTKB 1LTID 4MNOA 4ALPA 2B2TA 1JWSD 2QEJC 3S1NH 4A3LG 1PFBA 1S5CD 5I4DA 5CV4A 5M3FB 2ASBA 1TY2A 2OT2A 2VZAA 4JI6L 3PUVA 2FJ2A 5EKLA 2JA5G 1CTMA 1GUNA 2NUCA 4XQJA 1B3AA 3BVZA 2KEDA 5BR8Q 4IPCA 3A7LA 2F0UA 1W2BA 1BVSA 4Z9CB 3H09A 1Q46A 4DV2L 4IALA 5IYCH 3FKIG 1AEXA 4G7OC 5LL6S 1PTOB 3PO2G 2WAQG 5D65A 1EYDA 3UDIA 5AFWA 4CDDC 1H9JA 3ICEA 3IFDA 1EQRA 4WJ4A 3PF5A 2CW0D 2OEOA 2ZXPA 4O1NA 4PZ8A 1E2WA 3LX0A 1I4PA 1EWCA 2D0PA 1K0RA 2E5LQ 1KD1C 4IQZA 3I4MG 4QIWB 5ELOA 1JJCB 4EQOA 2B2WC 3KF8B 4JI7L 2K5QA 3W1GA 1VQGA 4DR6Q 3HRZC 2Z9HA 1RODA 2FMCA 1X54A 1R9TB 3PIPA 2A6HD 1EIYB 4KMUC 5F2DA 1E1OA 3I90A 1FGBD 4DXFA 3DM3A 3CP0A 2A6ED 4HMIA 1VQMA 5C44H 1NMGA 3OIQA 2NB0A 2JEAI 1X56A 3H91A 3HOYB 1KHIA 3I4NH 4CKBA 1CZGA 2PQAB 1SYFA 3F2UA 4DAYB 4X62Q 3S15H 1HNZL 2X6GA 2L11A 1K73C 2OWOA 5ELDA 2ZTDA 2OXPA 1VQOA 1X9NA 4EGVA 4C3HB 4LF5L 1X3PA 3MHBA 1E24A 3OMGA 3DXJC 2DY7A 1IW7C 4F88A 1YITA 1E1TA 1U9RA 3MFYA 4A3KG 2F0QA 3NSWA 3BDOA 1WJJA 4OGQC 1YJNA 1NJIC 3OW2A 2YU9H 3CCJA 1WVLA 2HQEA 2JA6H 4AQYQ 4AH6A 1X55A 2IJ0A 1UE1A 4A3FH 5JAVA 2F0OA 1O7YA 2N3SA 4LW1A 4H02A 2D2CC 3NXWA 4YHHQ 4R4QA 3NPPA 1GKHA 3AFPA 3NEMA 3OIPA 3J80i 2UUBL 1D5XC 3BZKA 2K01A 4DPGA 4LFBQ 3VR6A 4C3IH 5IT9L 1HFGA 4OXPA 2MFIA 1HA6A 1SE2A 4QJFA 2CCZA 5C3EB 2CQAA 1VQIA 1Y8NB 4UP7A 1R4PB 5IP7G 5IT9E 3E9HA 3VR5A 3A8IE 2AMCB 2EE1A 2EYOA 1I4QA 5C4XG 1B3QA 1YNND 4PZ7A 2WKCA 4JI3Q 4R9WA 1TWGH 5KYLA 2HHHL 1DOLA 5K36G 5G3LD 1J6QA 3HGBA 4C2MH 1E0BA 1IKMA 4HSPA 4A3MH 1XTCD 5M5XH 3M4QA 2VQFL 3TS0A 2ZTEA 3KK7A 2TSSA 1STGA 3MTSA 1OO9B 1YHBA 5C6AA 4A76A 3ZJYC 5FKAC 3AMUA 2QKIC 1EQTA 2UUAQ 4IN3A 3J81L 1DCZA 1G8ZD 3S2DB 3HOZB 1V8QA 2J7ZA 3A7AB 2CH4W 1SNDA 4CBVA 3IRBA 2F03A 3NQTA 5C0XI 3C1EA 4JVZA 3G6JB 4IUQA 2VXWA 3J81E 3SK8A 3BJUA 4A3JG 4BA1I 1II3A 4DR4L 2F1MA 3MC0B 2NN6G 5AJ3Q 4DR7Q 4DR5Q 5GAGC 2NVTH 1QUQA 4A3KB 2KCTA 1K8AC 1CQVA 4DV7Q 2NZHA 1LTGD 2G5DA 1NBWA 4DR2Q 2M00A 1L1OC 1UWVA 4LFCQ 4L5RC 1EOTA 4DUYQ 5CYUA 2B2VC 2N78A 1U4LA 4A3GH 4A3DH 1ML0D 4IUTA 2LSSA 1SMXA 5LMNW 2Z4HA 1TT2A 1Z6HA 3MVVA 1IYJB 1Q12A 1ILPA 1SE3A 5ELNA 4OX9L 2B2YA 4JI5L 3O13A 3S24A 4RCOA 2CH4A 1HQRD 1XMQQ 3FHWA 5GADC 3VYTA 2MPMA 2A68D 1JJ2A 3S1QH 4BY7H 3QB3A 3EBEA 2F0PA 1AP0A 1NR4A 2EY2A 3M7GA 3PO3G 4DUZQ 1XTDA 4ID6A 4YCVA 1ZYRD 4BY1H 4RG1A 3U9OA 1SJHD 2R7ZG 2K32A 5M3MB 5IT9c 3HKSA 2EJFC 1ICWA 5E4WC 1O7ZA 3BVMA 1TXYA 4CHTB 5IGGA 4DV1L 1RKNA 2ICEC 5FLXL 4Y7NB 5M5WB 2NVXH 1NMFA 1XNQQ 2KUMA 4WJ3M 4RMFA 2VUMG 4GLAC 2XWBB 2EOTA 2P5ZX 3BZDB 4JI8Q 3DMUA 3HG9A 1RDPD 5KRUA 4XYQA 3P1HA 1KXLA 1I4GA 3TP5A 3GTLB 1Z9FA 4GKJL 3H0GG 5FLXE 2Z4IA 1RJTA 1SN8A 1GHJA 1EUJA 2E2IB 2B3GA 4KN4C 2B39A 4K0KL 4A3CH 2G9HD 2QILA 4POGA 1NE3A 1WTVA 1Q7YC 2LKVA 3F8TA 1HA5A 2LFNA 2RSNA 1DD2A 3NE5B 4KJNA 4OO1G 1SNPA 1Y69U 5LHY1 3C46A 1JC7A 1VF7A 1YHAA 1I6HH 2D5DA 1HTLD 1PH9A 3AFQA 5GAHC 1UE7A 4B3ML 5KNCA 2I07B 3BZCA 3A5ZB 1K83H 1EFID 1V1QA 4JPBW 4FF1A 2F0MA 5DEHA 2K52A 4DAPA 4X64Q 2EDGA 2EXZA 1IBML 2L5TA 2R7FA 3SDZA 1XPUA 1GUGA 3RNUA 2MGSA 2L15A 3VDYA 1H9RA 2OCEA 1QNKA 2V1CC 3ULPA 2Y0SG 1OXXK 2F0KA 2DGYA 1IBLL 1TU2B 4AYBE 3VYRA 1V43A 4LF4L 4JI1Q 1OXUA 2NVYH 4QGUA 3RLFA 1K3RA 5GQOA 1K28A 2E2JH 1QILA 2R3ZA 1CFMA 3K59A 4DR1L 3D0FA 4CJ0B 4B3SL 4A4IA 3PO3B 4J6HA 2F3VA 1WFQA 3TS2A 4JI2L 3ND9A 1KAAA 1Y1WH 5CGKA 4HCEA 2JA8H 3PF4A 1N33L 2KECA 4POFA 3KF8A
chains in the Genus database with same CATH topology
4P71A 3NBHB 2WB1E 3S1RH 4NXMQ 1TWHH 4BY1G 4B3RQ 3FKIH 2OTLA 4LF6L 4R4OA 4TQUS 3GTLH 4JYAQ 1MJEA 5M5YH 3CW2C 1HR0L 2R6GA 3HFZB 2D62A 4BBRG 3PO2H 1XPOA 1FJGL 2OTJA 2R93H 1GD7A 2VL6A 1J5EQ 1IBMQ 2VY3A 3KDFA 4KLKA 4EQ5A 3KJPA 3K7AH 5LMUQ 4A3IG 1N36L 4P72A 2JEBI 1K8GA 1HZBA 3TEHB 2UUCL 1VQEA 4DV5Q 2BH2A 2KENA 3EIVA 1TWFH 2UXCL 3MEFA 1LUZA 4LF8Q 4GKKQ 1BBWA 4L5SA 4X66L 1UE6A 4NB3A 1VQHA 2OQ0A 1EIFA 4LFAQ 4DV4L 1PA6A 3HOZG 4IPDA 5IYBG 3M4OH 2KCMA 5IWAL 1IBLQ 3S16H 1Q8KA 5FLXc 3I4MH 1JJGA 1Q1EA 4NXNQ 1I50H 1PYBA 1YVCA 4JOIC 3CCRA 4BXXH 1JT8A 1C7YA 3KF6A 2IT1A 2Z6KA 1PVOA 4DR3Q 3CCVA 1IZ6A 4OWTB 2BA1A 1KRTA 3GTMH 4A3CG 1EWIA 4DR1Q 1CKMA 4HIOA 5IY0A 1W3SA 2R7DA 4HIKA 4JI2Q 1JE5A 2Q2IA 5FJ8G 3S17H 2BA0A 4LF7Q 2KBNA 1SE8A 2B29A 1N33Q 2JA7H 1C9OA 1VQPA 1IBKL 3PUYA 4MTNA 1WYDA 1MKHA 4C3JH 4YWKA 1HNWL 1YJ9A 1KAWA 2DUDA 3CQZH 2JE6I 1OTCA 2H5XA 4HIDA 4JI7Q 2IHEA 3CPFA 4LF6Q 2Z0SA 3D31A 1PHJA 5C4JH 4QY7A 1HR0Q 1VCIA 1BBUA 3BU2A 1FJGQ 4IO9A 1YHQA 1N34L 1VQ8A 4JI1L 4APVA 3U58A 1XNRL 1Q1BA 1N36Q 2ZTCA 1L0WA 2UUCQ 4LF9Q 1L2FA 1SR3A 2Y0SE 4A3BH 2Q2HA 2F4VL 1E7ZA 3S2DH 2UXCQ 1G51A 1S72A 1FVIA 4JG2A 1N32Q 4JI0L 2MO0A 1YJWA 1WOCA 2VW9A 1VQCA 1BKBA 2LXKA 4A3KH 2MQHA 4J15A 2YV5A 1UEBA 2I5HA 3G4SA 3ULLA 3CAMA 1U0LA 1HH2P 1VQFA 1LYLA 4MNOA 5HGQA 4ALPA 2E5LL 5GAEC 3J81c 2EQSA 3TREA 1VS0A 3U4VA 3S1NH 4A3LG 3EN2A 4JYAL 4P73A 1T9HA 2KHIA 1EYGA 4LF5Q 2ASBA 1NTGA 2VZAA 2IX0A 2XGTA 3JC66 5M3MG 1S3OA 4JCVE 4DK6C 4LWCA 1RIPA 4JI6L 1Y1VH 3PUVA 5E7NA 4AIMA 1J5EL 2JA5G 4LUZA 1IBKQ 4DV5L 4JI4Q 2F3IA 3PV0A 3RLNA 1Y1WG 5FLMG 5BR8Q 4IPCA 3M85A 1HNWQ 2JA8G 1I94L 3K7UC 3UDXA 4LF8L 2HIVA 1S40A 1W2BA 2ZM6L 1BVSA 2RCNA 1CUKA 1CSQA 1L1OA 1CKNB 1Q46A 3AQQA 4YCUA 5IYCH 2ZJRA 3FKIG 2AKWB 1A0IA 2GN5A 1N34Q 1HNXQ 1OXSC 3S2HH 1YZ6A 4NXNL 5IP7H 3CC7A 2CQOA 4HJAA 2ATWA 2K14A 3RLOA 3PUXA 5EAYA 1IL2A 3PO2G 2Q2UA 2WAQG 2R93G 5C4XH 2CWPA 4Y52H 3UDIA 3GTGH 4HIMA 1PH4A 3CCLA 4JI0Q 3I2ZA 3ICEA 1EQRA 4A3EG 4WJ4A 1NY4A 2VS1A 3PF5A 3KLWA 4UY8C 3K80C 3M3YH 4PZ8A 2BH8A 4HJ7A 4B3TL 4GNXA 3GO5A 5JJLA 2D0PA 1K0RA 2E5LQ 1KD1C 4IPGA 1SFOH 3I4MG 1Z47A 1U5KA 5ELOA 1X65A 1JB7A 1JJCB 1XJVA 1I3QH 4AQYL 4JI7L 3KF8B 4BXXG 3OTOL 3G6EA 3W1GA 1VQGA 4DR6Q 1QVGA 3PUZA 4OONA 1X54A 3PIPA 1EIYB 1Q81C 2IY5B 2HHHQ 4JI6Q 3PGZA 2CKZB 1E1OA 3HOWH 4KHPQ 4GOPC 3DM3A 4A93H 4LF9L 3CP0A 3KDFB 3U50C 2K5VA 5C44H 1VQMA 2YTXA 1NMGA 4YWMA 2E8GA 2JEAI 1X56A 1SROA 2VQFQ 1I94Q 1EFWA 4GLXA 2JA7G 1KHIA 3PSIA 1YEZA 4O0AA 2ZM6Q 2PQAA 2AWOA 4L5TA 3I4NH 2PNHA 3CCMA 4DV2Q 3GTOH 3HOXH 4UP8A 2PQAB 4DAYB 4X62Q 3S15H 1HNZL 2N8NA 3M4PA 3KYHC 4HJ5A 2ZJPA 4A3JH 1QVFA 4R4TA 3GTKH 2C35B 1X6OA 2E2HH 3AEVA 4FDBA 4GN4B 1K73C 2OWOA 3CXCA 4JC0A 3KF6B 2ZTDA 3E0EA 1PH6A 3UDFA 2I5LX 1VQOA 1X9NA 4A3BG 4IJLA 4LF5L 3J80c 3UE0A 1E24A 5M3FH 4YCWA 4X65L 4DV3L 4JI3L 4UPAA 4B3TQ 3UE1A 1YITA 3M7NA 3WWVA 1E1TA 2A8VA 4A3KG 2IHFA 1UE5A 1WJJA 1V9PA 1YJNA 5H1SE 4JI4L 3S14H 1NJIC 3OW2A 2YU9H 3CCJA 2JA6H 5BR8L 4AQYQ 3L7ZC 4AH6A 3CPWA 3OTOQ 3T1HL 3JAMc 1PH3A 1PH5A 2NZOA 1X55A 2ALYB 3ULJA 3J81j 1UE1A 4UP9A 4A3FH 2K5HA 2B63H 2VNUD 5JJIA 4YWLA 2PI2A 2PI2E 5JEAG 1G6PA 2N3SA 4LW1A 3CC2A 4GS3A 4H02A 1HNXL 4YHHQ 1LTLA 3I7FA 4R4QA 4BBSH 4A75A 1GKHA 1PH1A 2VQEQ 2GVAA 3AFPA 3NEMA 3J80i 2UUBL 2YTVA 1OXVA 1MIUA 4JBKA 3BZKA 1I5FA 1Y1VG 4DPGA 2UUAL 3KFUA 2RF4A 4LFBQ 4JV5Q 1OXTA 4C3IH 3CMEA 1K9MC 4OXPA 2MFIA 1PV4A 4LUOA 2WAQE 2Z6KC 3PO3H 5JEAJ 3L2PA 4QJFA 3JAMi 3CCUA 1HJPA 1HNZQ 1Q86C 2CCZA 1TWCH 3HOUH 5IYCG 4JBMA 4X6AH 1VQIA 1PFSA 1X3EA 3S1MH 4UP7A 1FL0A 4OX9Q 2R7ZH 5IP7G 1C0AA 3CCSA 1PH2A 3E9HA 1PH8A 2AMCB 5IYDH 1VQ9A 3I4OA 3F2BA 5C4XG 4ME3A 4DK3C 4DR6L 5DLQE 4X65Q 4DV3Q 4PZ7A 4JI3Q 1TWGH 2VUMH 2HHHL 3K8AA 1VQLA 5K36G 3H3VH 4KHPL 2AHOB 1J6QA 4QL5A 1VQNA 4C2MH 4OWXB 1M1KC 4DR2L 4A3MH 4EX5A 5M5XH 3M4QA 1EOVA 3H0GH 4LFCL 3STBD 3T1HQ 1YIJA 1B70B 2VQFL 3TS0A 4KI0A 5C0XJ 2ZTEA 2Q2TA 3GTQH 4KHZA 4DUYL 3HOYH 3U4ZA 1MJCA 1YHBA 1QZHA 4DV1Q 4A76A 1L1OB 3ZJYC 3G71A 4X62L 3H3VI 2CFMA 2NVQH 1GO3E 1ASYA 2UUBQ 1E22A 1CKOA 1A63A 2UUAQ 2WFWA 2WP8J 2R92H 3HOWG 2JJQA 4A93G 5JJKA 1EQQA 4DKAC 1WI5A 5C44G 3HOVH 4IOCA 5IE8A 2QEXA 4DV6L 2YYZA 3IRBA 1QZGA 4IOAA 5C0XI 1TWAH 1HR0W 2K4KA 3KJOA 3I4NG 4OO1G 4YY3Q 2UXBQ 1G291 3F1ZA 1B8AA 3HOXG 3FP9A 3PIOA 4GNXB 3BJUA 1QVCA 4DNIA 3T1YL 4A3JG 4BA1I 2RHSB 1B7YB 1KL9A 4LNQA 4DR4L 5AJ3Q 2NN6G 3TRZA 2MO1A 4DR7Q 3M9BA 4JOIA 2OQKA 1QUQA 5GAGC 2KCTA 4YHHL 4DR5Q 1VQJA 2XTIA 1YI2A 1K8AC 2ES2A 3W5OA 1RL2A 2HT1A 4QQBX 5M3FG 1N32L 1QUQB 4DV7Q 2NZHA 2VQEL 5J3BA 1NBWA 1YNXA 4DR2Q 1L1OC 4HJ8A 1UWVA 3CF5A 4JI8L 3GTJH 2E2IH 4LFCQ 1VQ7A 4LFBL 4R4IA 3J7ZC 4L5RC 1XMOQ 4LUVA 4JV5L 1FGUA 4DUYQ 2N78A 2ZJQA 2EIFA 4A3GH 3I55A 2JA6G 4A3DH 1KIXA 2LSSA 3GDEA 1HZ9A 1SMXA 5LMNW 1VQ6A 3GD7A 4A3FG 1IYJB 1AE3A 1Q12A 2B63G 1WCMH 2HIXA 5C3EH 1SLJA 1H95A 5ELNA 3UDGA 4OX9L 1A8VA 4JI5L 4BBSG 1KQSA 1VQKA 3S24A 3CMAA 3J7A5 4AYBG 4IFDG 4GNXC 2I0QA 1VQ5A 3RN2A 4A3EH 1XMQQ 1SRUA 3FHWA 4DV6Q 5GADC 3RN5A 1JJ2A 3S1QH 3SGIA 4BY7H 3B6YA 3EBEA 3NENA 2UU9L 4POFA 3KOJA 3K0XA 3DLLA 4XIGS 5IP9H 4LF4Q 3PO3G 1YBYA 1XTDA 4DUZQ 3CC4A 4DV2L 2NN6I 3PCOB 2F52A 4YCVA 4BY1H 3T1YQ 4RG1A 1PYSB 1D8LA 4DV0L 3HOUG 3HKZG 2D0OA 1HZCA 2R7ZG 4DR4Q 2K75A 4IFDJ 2EXDA 2JQOA 3G48A 4BBRH 5IT9c 3HKSA 2UXDQ 1CSPA 1TXYA 3A0JA 5IYDG 4DV1L 5LMNL 1N9WA 4B3SQ 3RZOH 2KHJA 2WB1G 3PUWA 4A3IH 2NVXH 4X64L 1NMFA 3OYYA 1XNQQ 1ASZA 4WJ3M 4RMFA 2VUMG 1VQBA 4GLAC 4BA2I 4JI8Q 1KXLA 2RHQB 4A3MG 3HOZH 1X3FA 2AWNA 4GOPB 1PH7A 1HZAA 1Y14B 1E3PA 1Z9FA 4JBWA 3H0GG 5IYBH 4GKJL 1AH9A 1M90C 3HOYG 2UXBL 3H15A 1SN8A 4YY3L 3CCEA 2A1AA 4IFDI 1EUJA 4GN3B 2QGQA 3RZDH 2B3GA 4JI5Q 3F2DA 4K0KL 4A3CH 5C0XG 4POGA 1NE3A 2ID0A 4GLVB 1Q7YC 3F8TA 3NELA 1GM5A 3ERSX 2FXQA 2R92G 1KC8C 2JA9A 1A62A 3ER0A 4PG3A 5GROA 5AJ3L 2K50A 4MZ9A 3CCQA 4DR7L 5FJ8H 1P8LA 4X66Q 4DR5L 1R9TH 4DV4Q 3HOVG 2UU9Q 4TVAB 5IWAQ 2MNAA 3L0OA 4DV7L 5HY6A 2N49A 3MXNB 2HQLA 1I6HH 1VQAA 1YHAA 1Q82C 2PMZE 3TQYA 1PH9A 3AFQA 4R1JA 5GAHC 1UE7A 4DV0Q 1XMOL 4B3ML 2JK8A 1X3GA 1JMCA 1IXRA 3BZCA 4NXML 1D7QA 3A5ZB 1K83H 2LXJA 4B3RL 3K81C 1V1QA 3W1BA 2NVTH 3A5UA 5LMNQ 2QA4A 2K52A 3E9IA 4X64Q 4GN5A 1GVPA 4JBJA 2IX1A 3AYHB 1IBML 1XPUA 2R7FA 1O7IA 3RR5A 3STBC 5LMUL 3RNUA 2L15A 3VDYA 1LM0A 2OCEA 1AE2A 4HJ9A 4P75A 4GKJQ 1XMQL 1P16A 4C3HH 2V1CC 3ULPA 4GOPA 1N8RC 1CKNA 2Y0SG 4GKKL 1OXXK 4LFAL 3CD6A 1XPRA 2DGYA 3J81i 4A3GG 1IBLL 4AYBE 2K5NA 4A3DG 1V43A 4OWWB 3LGJA 4LF4L 4P74A 4DUZL 4JI1Q 1OXUA 2NVYH 4QGUA 4XTCS 3RLFA 4IJHA 1XNRQ 4K0KQ 3F2CA 4OO1I 4A3LH 1WCMG 1K3RA 5GQOA 2CWAA 5C3EG 2E2JH 4O2DA 4R4CA 4DR3L 2F4VQ 1VQ4A 1KRSA 5M3MH 2UXDL 4DR1L 3D0FA 1VQDA 4B3SL 4A4IA 3A74A 4L5QA 1DGSA 2JA5H 4NPSA 1WFQA 3TS2A 2A19A 3HKZE 5M5WH 4Y7NH 1XNQL 2GVBA 4JI2L 2I5MX 4BY7G 2YTYA 4PZ6A 1Y1WH 4LF7L 5FLMH 3Q8DA 3GTPH 2JA8H 4QIWE 4IPHA 1N33L 4B3MQ 5IP9G 3PF4A 4DAMA 3I56A 4PMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P71 A;  3NBH B;  2WB1 E;  3S1R H;  4NXM Q;  1TWH H;  4BY1 G;  4B3R Q;  3FKI H;  2OTL A;  4LF6 L;  4R4O A;  4TQU S;  3GTL H;  4JYA Q;  1MJE A;  5M5Y H;  3CW2 C;  1HR0 L;  2R6G A;  3HFZ B;  2D62 A;  4BBR G;  3PO2 H;  1XPO A;  1FJG L;  2OTJ A;  2R93 H;  1GD7 A;  2VL6 A;  1J5E Q;  1IBM Q;  2VY3 A;  3KDF A;  4KLK A;  4EQ5 A;  3KJP A;  3K7A H;  5LMU Q;  4A3I G;  1N36 L;  4P72 A;  2JEB I;  1K8G A;  1HZB A;  3TEH B;  2UUC L;  1VQE A;  4DV5 Q;  2BH2 A;  2KEN A;  3EIV A;  1TWF H;  2UXC L;  3MEF A;  1LUZ A;  4LF8 Q;  4GKK Q;  1BBW A;  4L5S A;  4X66 L;  1UE6 A;  4NB3 A;  1VQH A;  2OQ0 A;  1EIF A;  4LFA Q;  4DV4 L;  1PA6 A;  3HOZ G;  4IPD A;  5IYB G;  3M4O H;  2KCM A;  5IWA L;  1IBL Q;  3S16 H;  1Q8K A;  5FLX c;  3I4M H;  1JJG A;  1Q1E A;  4NXN Q;  1I50 H;  1PYB A;  1YVC A;  4JOI C;  3CCR A;  4BXX H;  1JT8 A;  1C7Y A;  3KF6 A;  2IT1 A;  2Z6K A;  1PVO A;  4DR3 Q;  3CCV A;  1IZ6 A;  4OWT B;  2BA1 A;  1KRT A;  3GTM H;  4A3C G;  1EWI A;  4DR1 Q;  1CKM A;  4HIO A;  5IY0 A;  1W3S A;  2R7D A;  4HIK A;  4JI2 Q;  1JE5 A;  2Q2I A;  5FJ8 G;  3S17 H;  2BA0 A;  4LF7 Q;  2KBN A;  1SE8 A;  2B29 A;  1N33 Q;  2JA7 H;  1C9O A;  1VQP A;  1IBK L;  3PUY A;  4MTN A;  1WYD A;  1MKH A;  4C3J H;  4YWK A;  1HNW L;  1YJ9 A;  1KAW A;  2DUD A;  3CQZ H;  2JE6 I;  1OTC A;  2H5X A;  4HID A;  4JI7 Q;  2IHE A;  3CPF A;  4LF6 Q;  2Z0S A;  3D31 A;  1PHJ A;  5C4J H;  4QY7 A;  1HR0 Q;  1VCI A;  1BBU A;  3BU2 A;  1FJG Q;  4IO9 A;  1YHQ A;  1N34 L;  1VQ8 A;  4JI1 L;  4APV A;  3U58 A;  1XNR L;  1Q1B A;  1N36 Q;  2ZTC A;  1L0W A;  2UUC Q;  4LF9 Q;  1L2F A;  1SR3 A;  2Y0S E;  4A3B H;  2Q2H A;  2F4V L;  1E7Z A;  3S2D H;  2UXC Q;  1G51 A;  1S72 A;  1FVI A;  4JG2 A;  1N32 Q;  4JI0 L;  2MO0 A;  1YJW A;  1WOC A;  2VW9 A;  1VQC A;  1BKB A;  2LXK A;  4A3K H;  2MQH A;  4J15 A;  2YV5 A;  1UEB A;  2I5H A;  3G4S A;  3ULL A;  3CAM A;  1U0L A;  1HH2 P;  1VQF A;  1LYL A;  4MNO A;  5HGQ A;  4ALP A;  2E5L L;  5GAE C;  3J81 c;  2EQS A;  3TRE A;  1VS0 A;  3U4V A;  3S1N H;  4A3L G;  3EN2 A;  4JYA L;  4P73 A;  1T9H A;  2KHI A;  1EYG A;  4LF5 Q;  2ASB A;  1NTG A;  2VZA A;  2IX0 A;  2XGT A;  3JC6 6;  5M3M G;  1S3O A;  4JCV E;  4DK6 C;  4LWC A;  1RIP A;  4JI6 L;  1Y1V H;  3PUV A;  5E7N A;  4AIM A;  1J5E L;  2JA5 G;  4LUZ A;  1IBK Q;  4DV5 L;  4JI4 Q;  2F3I A;  3PV0 A;  3RLN A;  1Y1W G;  5FLM G;  5BR8 Q;  4IPC A;  3M85 A;  1HNW Q;  2JA8 G;  1I94 L;  3K7U C;  3UDX A;  4LF8 L;  2HIV A;  1S40 A;  1W2B A;  2ZM6 L;  1BVS A;  2RCN A;  1CUK A;  1CSQ A;  1L1O A;  1CKN B;  1Q46 A;  3AQQ A;  4YCU A;  5IYC H;  2ZJR A;  3FKI G;  2AKW B;  1A0I A;  2GN5 A;  1N34 Q;  1HNX Q;  1OXS C;  3S2H H;  1YZ6 A;  4NXN L;  5IP7 H;  3CC7 A;  2CQO A;  4HJA A;  2ATW A;  2K14 A;  3RLO A;  3PUX A;  5EAY A;  1IL2 A;  3PO2 G;  2Q2U A;  2WAQ G;  2R93 G;  5C4X H;  2CWP A;  4Y52 H;  3UDI A;  3GTG H;  4HIM A;  1PH4 A;  3CCL A;  4JI0 Q;  3I2Z A;  3ICE A;  1EQR A;  4A3E G;  4WJ4 A;  1NY4 A;  2VS1 A;  3PF5 A;  3KLW A;  4UY8 C;  3K80 C;  3M3Y H;  4PZ8 A;  2BH8 A;  4HJ7 A;  4B3T L;  4GNX A;  3GO5 A;  5JJL A;  2D0P A;  1K0R A;  2E5L Q;  1KD1 C;  4IPG A;  1SFO H;  3I4M G;  1Z47 A;  1U5K A;  5ELO A;  1X65 A;  1JB7 A;  1JJC B;  1XJV A;  1I3Q H;  4AQY L;  4JI7 L;  3KF8 B;  4BXX G;  3OTO L;  3G6E A;  3W1G A;  1VQG A;  4DR6 Q;  1QVG A;  3PUZ A;  4OON A;  1X54 A;  3PIP A;  1EIY B;  1Q81 C;  2IY5 B;  2HHH Q;  4JI6 Q;  3PGZ A;  2CKZ B;  1E1O A;  3HOW H;  4KHP Q;  4GOP C;  3DM3 A;  4A93 H;  4LF9 L;  3CP0 A;  3KDF B;  3U50 C;  2K5V A;  5C44 H;  1VQM A;  2YTX A;  1NMG A;  4YWM A;  2E8G A;  2JEA I;  1X56 A;  1SRO A;  2VQF Q;  1I94 Q;  1EFW A;  4GLX A;  2JA7 G;  1KHI A;  3PSI A;  1YEZ A;  4O0A A;  2ZM6 Q;  2PQA A;  2AWO A;  4L5T A;  3I4N H;  2PNH A;  3CCM A;  4DV2 Q;  3GTO H;  3HOX H;  4UP8 A;  2PQA B;  4DAY B;  4X62 Q;  3S15 H;  1HNZ L;  2N8N A;  3M4P A;  3KYH C;  4HJ5 A;  2ZJP A;  4A3J H;  1QVF A;  4R4T A;  3GTK H;  2C35 B;  1X6O A;  2E2H H;  3AEV A;  4FDB A;  4GN4 B;  1K73 C;  2OWO A;  3CXC A;  4JC0 A;  3KF6 B;  2ZTD A;  3E0E A;  1PH6 A;  3UDF A;  2I5L X;  1VQO A;  1X9N A;  4A3B G;  4IJL A;  4LF5 L;  3J80 c;  3UE0 A;  1E24 A;  5M3F H;  4YCW A;  4X65 L;  4DV3 L;  4JI3 L;  4UPA A;  4B3T Q;  3UE1 A;  1YIT A;  3M7N A;  3WWV A;  1E1T A;  2A8V A;  4A3K G;  2IHF A;  1UE5 A;  1WJJ A;  1V9P A;  1YJN A;  5H1S E;  4JI4 L;  3S14 H;  1NJI C;  3OW2 A;  2YU9 H;  3CCJ A;  2JA6 H;  5BR8 L;  4AQY Q;  3L7Z C;  4AH6 A;  3CPW A;  3OTO Q;  3T1H L;  3JAM c;  1PH3 A;  1PH5 A;  2NZO A;  1X55 A;  2ALY B;  3ULJ A;  3J81 j;  1UE1 A;  4UP9 A;  4A3F H;  2K5H A;  2B63 H;  2VNU D;  5JJI A;  4YWL A;  2PI2 A;  2PI2 E;  5JEA G;  1G6P A;  2N3S A;  4LW1 A;  3CC2 A;  4GS3 A;  4H02 A;  1HNX L;  4YHH Q;  1LTL A;  3I7F A;  4R4Q A;  4BBS H;  4A75 A;  1GKH A;  1PH1 A;  2VQE Q;  2GVA A;  3AFP A;  3NEM A;  3J80 i;  2UUB L;  2YTV A;  1OXV A;  1MIU A;  4JBK A;  3BZK A;  1I5F A;  1Y1V G;  4DPG A;  2UUA L;  3KFU A;  2RF4 A;  4LFB Q;  4JV5 Q;  1OXT A;  4C3I H;  3CME A;  1K9M C;  4OXP A;  2MFI A;  1PV4 A;  4LUO A;  2WAQ E;  2Z6K C;  3PO3 H;  5JEA J;  3L2P A;  4QJF A;  3JAM i;  3CCU A;  1HJP A;  1HNZ Q;  1Q86 C;  2CCZ A;  1TWC H;  3HOU H;  5IYC G;  4JBM A;  4X6A H;  1VQI A;  1PFS A;  1X3E A;  3S1M H;  4UP7 A;  1FL0 A;  4OX9 Q;  2R7Z H;  5IP7 G;  1C0A A;  3CCS A;  1PH2 A;  3E9H A;  1PH8 A;  2AMC B;  5IYD H;  1VQ9 A;  3I4O A;  3F2B A;  5C4X G;  4ME3 A;  4DK3 C;  4DR6 L;  5DLQ E;  4X65 Q;  4DV3 Q;  4PZ7 A;  4JI3 Q;  1TWG H;  2VUM H;  2HHH L;  3K8A A;  1VQL A;  5K36 G;  3H3V H;  4KHP L;  2AHO B;  1J6Q A;  4QL5 A;  1VQN A;  4C2M H;  4OWX B;  1M1K C;  4DR2 L;  4A3M H;  4EX5 A;  5M5X H;  3M4Q A;  1EOV A;  3H0G H;  4LFC L;  3STB D;  3T1H Q;  1YIJ A;  1B70 B;  2VQF L;  3TS0 A;  4KI0 A;  5C0X J;  2ZTE A;  2Q2T A;  3GTQ H;  4KHZ A;  4DUY L;  3HOY H;  3U4Z A;  1MJC A;  1YHB A;  1QZH A;  4DV1 Q;  4A76 A;  1L1O B;  3ZJY C;  3G71 A;  4X62 L;  3H3V I;  2CFM A;  2NVQ H;  1GO3 E;  1ASY A;  2UUB Q;  1E22 A;  1CKO A;  1A63 A;  2UUA Q;  2WFW A;  2WP8 J;  2R92 H;  3HOW G;  2JJQ A;  4A93 G;  5JJK A;  1EQQ A;  4DKA C;  1WI5 A;  5C44 G;  3HOV H;  4IOC A;  5IE8 A;  2QEX A;  4DV6 L;  2YYZ A;  3IRB A;  1QZG A;  4IOA A;  5C0X I;  1TWA H;  1HR0 W;  2K4K A;  3KJO A;  3I4N G;  4OO1 G;  4YY3 Q;  2UXB Q;  1G29 1;  3F1Z A;  1B8A A;  3HOX G;  3FP9 A;  3PIO A;  4GNX B;  3BJU A;  1QVC A;  4DNI A;  3T1Y L;  4A3J G;  4BA1 I;  2RHS B;  1B7Y B;  1KL9 A;  4LNQ A;  4DR4 L;  5AJ3 Q;  2NN6 G;  3TRZ A;  2MO1 A;  4DR7 Q;  3M9B A;  4JOI A;  2OQK A;  1QUQ A;  5GAG C;  2KCT A;  4YHH L;  4DR5 Q;  1VQJ A;  2XTI A;  1YI2 A;  1K8A C;  2ES2 A;  3W5O A;  1RL2 A;  2HT1 A;  4QQB X;  5M3F G;  1N32 L;  1QUQ B;  4DV7 Q;  2NZH A;  2VQE L;  5J3B A;  1NBW A;  1YNX A;  4DR2 Q;  1L1O C;  4HJ8 A;  1UWV A;  3CF5 A;  4JI8 L;  3GTJ H;  2E2I H;  4LFC Q;  1VQ7 A;  4LFB L;  4R4I A;  3J7Z C;  4L5R C;  1XMO Q;  4LUV A;  4JV5 L;  1FGU A;  4DUY Q;  2N78 A;  2ZJQ A;  2EIF A;  4A3G H;  3I55 A;  2JA6 G;  4A3D H;  1KIX A;  2LSS A;  3GDE A;  1HZ9 A;  1SMX A;  5LMN W;  1VQ6 A;  3GD7 A;  4A3F G;  1IYJ B;  1AE3 A;  1Q12 A;  2B63 G;  1WCM H;  2HIX A;  5C3E H;  1SLJ A;  1H95 A;  5ELN A;  3UDG A;  4OX9 L;  1A8V A;  4JI5 L;  4BBS G;  1KQS A;  1VQK A;  3S24 A;  3CMA A;  3J7A 5;  4AYB G;  4IFD G;  4GNX C;  2I0Q A;  1VQ5 A;  3RN2 A;  4A3E H;  1XMQ Q;  1SRU A;  3FHW A;  4DV6 Q;  5GAD C;  3RN5 A;  1JJ2 A;  3S1Q H;  3SGI A;  4BY7 H;  3B6Y A;  3EBE A;  3NEN A;  2UU9 L;  4POF A;  3KOJ A;  3K0X A;  3DLL A;  4XIG S;  5IP9 H;  4LF4 Q;  3PO3 G;  1YBY A;  1XTD A;  4DUZ Q;  3CC4 A;  4DV2 L;  2NN6 I;  3PCO B;  2F52 A;  4YCV A;  4BY1 H;  3T1Y Q;  4RG1 A;  1PYS B;  1D8L A;  4DV0 L;  3HOU G;  3HKZ G;  2D0O A;  1HZC A;  2R7Z G;  4DR4 Q;  2K75 A;  4IFD J;  2EXD A;  2JQO A;  3G48 A;  4BBR H;  5IT9 c;  3HKS A;  2UXD Q;  1CSP A;  1TXY A;  3A0J A;  5IYD G;  4DV1 L;  5LMN L;  1N9W A;  4B3S Q;  3RZO H;  2KHJ A;  2WB1 G;  3PUW A;  4A3I H;  2NVX H;  4X64 L;  1NMF A;  3OYY A;  1XNQ Q;  1ASZ A;  4WJ3 M;  4RMF A;  2VUM G;  1VQB A;  4GLA C;  4BA2 I;  4JI8 Q;  1KXL A;  2RHQ B;  4A3M G;  3HOZ H;  1X3F A;  2AWN A;  4GOP B;  1PH7 A;  1HZA A;  1Y14 B;  1E3P A;  1Z9F A;  4JBW A;  3H0G G;  5IYB H;  4GKJ L;  1AH9 A;  1M90 C;  3HOY G;  2UXB L;  3H15 A;  1SN8 A;  4YY3 L;  3CCE A;  2A1A A;  4IFD I;  1EUJ A;  4GN3 B;  2QGQ A;  3RZD H;  2B3G A;  4JI5 Q;  3F2D A;  4K0K L;  4A3C H;  5C0X G;  4POG A;  1NE3 A;  2ID0 A;  4GLV B;  1Q7Y C;  3F8T A;  3NEL A;  1GM5 A;  3ERS X;  2FXQ A;  2R92 G;  1KC8 C;  2JA9 A;  1A62 A;  3ER0 A;  4PG3 A;  5GRO A;  5AJ3 L;  2K50 A;  4MZ9 A;  3CCQ A;  4DR7 L;  5FJ8 H;  1P8L A;  4X66 Q;  4DR5 L;  1R9T H;  4DV4 Q;  3HOV G;  2UU9 Q;  4TVA B;  5IWA Q;  2MNA A;  3L0O A;  4DV7 L;  5HY6 A;  2N49 A;  3MXN B;  2HQL A;  1I6H H;  1VQA A;  1YHA A;  1Q82 C;  2PMZ E;  3TQY A;  1PH9 A;  3AFQ A;  4R1J A;  5GAH C;  1UE7 A;  4DV0 Q;  1XMO L;  4B3M L;  2JK8 A;  1X3G A;  1JMC A;  1IXR A;  3BZC A;  4NXM L;  1D7Q A;  3A5Z B;  1K83 H;  2LXJ A;  4B3R L;  3K81 C;  1V1Q A;  3W1B A;  2NVT H;  3A5U A;  5LMN Q;  2QA4 A;  2K52 A;  3E9I A;  4X64 Q;  4GN5 A;  1GVP A;  4JBJ A;  2IX1 A;  3AYH B;  1IBM L;  1XPU A;  2R7F A;  1O7I A;  3RR5 A;  3STB C;  5LMU L;  3RNU A;  2L15 A;  3VDY A;  1LM0 A;  2OCE A;  1AE2 A;  4HJ9 A;  4P75 A;  4GKJ Q;  1XMQ L;  1P16 A;  4C3H H;  2V1C C;  3ULP A;  4GOP A;  1N8R C;  1CKN A;  2Y0S G;  4GKK L;  1OXX K;  4LFA L;  3CD6 A;  1XPR A;  2DGY A;  3J81 i;  4A3G G;  1IBL L;  4AYB E;  2K5N A;  4A3D G;  1V43 A;  4OWW B;  3LGJ A;  4LF4 L;  4P74 A;  4DUZ L;  4JI1 Q;  1OXU A;  2NVY H;  4QGU A;  4XTC S;  3RLF A;  4IJH A;  1XNR Q;  4K0K Q;  3F2C A;  4OO1 I;  4A3L H;  1WCM G;  1K3R A;  5GQO A;  2CWA A;  5C3E G;  2E2J H;  4O2D A;  4R4C A;  4DR3 L;  2F4V Q;  1VQ4 A;  1KRS A;  5M3M H;  2UXD L;  4DR1 L;  3D0F A;  1VQD A;  4B3S L;  4A4I A;  3A74 A;  4L5Q A;  1DGS A;  2JA5 H;  4NPS A;  1WFQ A;  3TS2 A;  2A19 A;  3HKZ E;  5M5W H;  4Y7N H;  1XNQ L;  2GVB A;  4JI2 L;  2I5M X;  4BY7 G;  2YTY A;  4PZ6 A;  1Y1W H;  4LF7 L;  5FLM H;  3Q8D A;  3GTP H;  2JA8 H;  4QIW E;  4IPH A;  1N33 L;  4B3M Q;  5IP9 G;  3PF4 A;  4DAM A;  3I56 A;  4PMW A; 
#chains in the Genus database with same CATH topology
 1EYC A;  4P71 A;  4DA2 A;  4NXM Q;  3A8J E;  4B3R Q;  4J8Q A;  4R8I A;  2OTL A;  4TQU S;  5EQ0 A;  3CW2 C;  1PRT B;  2N88 A;  2HUG A;  1L0Y B;  1PZK D;  2QF7 A;  2WKD A;  2R93 H;  1JOR A;  4EQ5 A;  4A3I G;  1JE4 A;  5LMU Q;  4P72 A;  1HZB A;  1SMY C;  3EQL C;  3H0G B;  2BH2 A;  1GUS A;  3NWS A;  1LUZ A;  1AZP A;  1PA6 A;  1EIF A;  2K05 A;  4LFA Q;  4DAY A;  1BCP D;  1BOS A;  2BDO A;  5FLX c;  1Q1E A;  2PZW A;  1YVC A;  1K8M A;  1SSO A;  1C7Y A;  1SNQ A;  2RVL A;  4DR3 Q;  4OWT B;  2BA1 A;  1EWI A;  1UNS A;  5L37 A;  2J0T D;  5C3X A;  2RA4 A;  2F3W A;  4HIO A;  3I73 A;  3K0Y A;  1W3S A;  2R7D A;  4X3K A;  5FJ8 G;  1XX8 A;  3S17 H;  3SK4 A;  3H6M A;  4XQQ A;  4F87 A;  2JA7 H;  4DK1 A;  1JQY D;  4N8F A;  1MKH A;  1EY4 A;  5CV9 A;  2PNR C;  3MA2 B;  1YJ9 A;  1F2L A;  4JI7 Q;  1ENF A;  1OTC A;  3J80 L;  1EY8 A;  2Z0S A;  5EBC A;  5C4J H;  1HR0 Q;  1BBU A;  2F0H A;  4ZUJ A;  5DNF A;  3OOC A;  1N34 L;  1FJG Q;  3HOW B;  3OWE B;  1ICF B;  4APV A;  4A93 B;  1KNA A;  1L0W A;  2UUC Q;  3H94 A;  1L2F A;  1SR3 A;  4BS9 A;  4A3B H;  3J80 E;  1E7Z A;  4ODG A;  2AUK A;  5I2X A;  1S72 A;  4JI0 L;  2O2L D;  4G7H C;  1VQC A;  3L9A X;  1L0X B;  1UEB A;  2I5H A;  3CAM A;  3SK6 A;  1U0L A;  1HH2 P;  2F0L A;  1D5Z C;  2K7V A;  2B8G A;  2O5J C;  1ENC A;  1EIH A;  3WOE A;  3U4V A;  1VS0 A;  4LAA A;  5I9O A;  1EY9 A;  5I9P A;  1T9H A;  2KHI A;  2K5W A;  4LF5 Q;  1B1Z A;  3OWF A;  2IX0 A;  3FRP B;  1RHP A;  2ZT9 C;  1RIP A;  2L9H A;  1Y1V H;  4AIM A;  1J5E L;  1WTQ A;  1IBK Q;  4DV5 L;  4RA8 A;  4C1N K;  3PV0 A;  1TS2 A;  5J22 A;  5FLM G;  2Q8I B;  4I65 A;  3K7U C;  2HIV A;  4CDF C;  1CSQ A;  1CKN B;  1SYG A;  1JOK A;  4BBS B;  1OXS C;  3S2H H;  4AYB B;  2A69 C;  5BN3 A;  2ATW A;  1IKL A;  5EAY A;  4FO2 A;  5LL6 X;  1IL2 A;  3J7A F;  4HTH A;  2SNM A;  5C4Z A;  5C5M A;  4HCS A;  1PH4 A;  4UAI A;  2F4I A;  3RMH A;  1ZKO A;  1C4Q A;  1LT6 D;  4ZKC B;  3M3Y H;  2BH8 A;  5JVH 3;  3HOU B;  4RHR A;  3KLR A;  3RZD B;  4P2C B;  3OW7 A;  3BVG A;  3QOL A;  4IPG A;  1SFO H;  1VMC A;  3PIP 3;  1U5K A;  1JB7 A;  2EYJ A;  3OTO L;  3RD4 A;  4DK0 A;  3LNN A;  4FXG C;  3PUZ A;  5EJW A;  2IY5 B;  5HGT A;  2HHH Q;  4K6L A;  4GOP C;  1B4O A;  2F0D A;  3KDF B;  1VF5 C;  1D1K A;  1I6V C;  3TSS A;  4TRD A;  2L1B A;  1FNV A;  2VQF Q;  1I94 Q;  1YEZ A;  3IL8 A;  2ZM6 Q;  4L5T A;  4C3J G;  2PNH A;  2EYM A;  3GTO H;  3HOX H;  3BYY B;  1D2B A;  1CI3 M;  2N8N A;  3M4P A;  2B2U C;  3GTK H;  1BQQ T;  2R92 B;  2RDF A;  3AEV A;  4FDB A;  2NTT A;  4GN4 B;  3R93 A;  3CXC A;  4JC0 A;  3HOV B;  1PH6 A;  1V1P A;  4K14 A;  3UDF A;  5IGF A;  1SYD A;  4IJL A;  2EZV A;  3J80 c;  4ZRZ A;  3UE0 A;  5J39 A;  5M3F H;  3MWY W;  1TWA B;  3X3N A;  4B3T Q;  3WWV A;  2A8V A;  4ZQ3 A;  2PZU A;  2IHF A;  3IKJ A;  3A54 A;  3H3V C;  4XYO A;  4JI4 L;  3NBI A;  1PLF A;  3T1H L;  3L7Z C;  4CKC A;  3Q22 A;  2QCP X;  3SHL A;  3ULJ A;  4UP9 A;  2K5H A;  4H7B A;  5JJI A;  1G6P A;  2HDM A;  2PI2 E;  1LTL A;  3I7F A;  1PH1 A;  1UUP A;  1PTO H;  2K33 A;  1U4M A;  2RF4 A;  5D14 A;  3VR3 A;  1NAP A;  1OXT A;  1TWH B;  3MZ5 A;  1K9M C;  1B50 A;  1RD9 D;  2KJX A;  4IUU A;  4L63 B;  2WAQ E;  2XSC A;  3JAM i;  4X6A H;  5IYC G;  4JBM A;  3S1M H;  1FL0 A;  4OX9 Q;  1C0A A;  3CCS A;  2F0F A;  1PH8 A;  2JP1 A;  1VQ9 A;  3F2B A;  4ME3 A;  4PMB A;  4X65 Q;  4DV3 Q;  3M4O B;  3S16 B;  1VQL A;  4KHP L;  3TP8 A;  1M1K C;  3VYS A;  1A2T A;  1TS3 A;  4EX5 A;  1ZEQ X;  1YIJ A;  1EOV A;  1SEB D;  4N9P A;  4KI0 A;  4C1N I;  3GTM B;  3HOY H;  1QZH A;  3RZO B;  4DV1 Q;  1L1O B;  1BO0 A;  1FNU A;  1Q8I A;  3G71 A;  3H3V I;  1ENA A;  3ND8 A;  1PFM A;  1GO3 E;  4H0L C;  2BE5 D;  1CKO A;  4B9X A;  3MFG A;  5I2Y A;  5IGB A;  2A5H A;  2WP8 J;  5DAU A;  2JJQ A;  4C3J B;  5JJK A;  1WI5 A;  5C44 G;  2E74 C;  4IOC A;  3I4L A;  2YYZ A;  3I4N G;  4QUC A;  4N8X 1;  1G29 1;  3F1Z A;  1B8A A;  4OEL B;  3FP9 A;  4HAE A;  4GZY C;  1XXG A;  1QVC A;  2HD3 A;  3T1Y L;  3X3M A;  4Q5V A;  2D9U A;  1GJX A;  1HQM C;  3A55 A;  2MO1 A;  4JOI A;  2OQK A;  2ES2 A;  4QQB X;  2VQE L;  2JSO A;  5CC4 A;  4ZLT F;  3K5N A;  3GTJ H;  3J7Z C;  4JV5 L;  4LUV A;  1SMY D;  2EJM A;  1KAB A;  3P75 A;  2ZJQ A;  2JA6 G;  2E2D C;  2EY1 A;  1KIX A;  3GDE A;  1HZ9 A;  1F2Z A;  4RWS C;  2EJG C;  1VQ6 A;  3GD7 A;  4A3F G;  1AE3 A;  2KCN A;  1WCM H;  3D8G A;  5C3E H;  3UDG A;  3T53 B;  1PZJ D;  1KQS A;  1VQK A;  2XWJ B;  1ET9 A;  5ELC A;  4GNX C;  2I0Q A;  1SRU A;  4DV6 Q;  1STA A;  4C3I G;  4KK7 A;  1JOO A;  3K0X A;  3DLL A;  5IP9 H;  4LF4 Q;  1B9M A;  1U4R A;  5E3F A;  3NUC A;  1D8L A;  4DAV A;  4DV0 L;  1F9P A;  2NZ1 D;  4H44 C;  1HZC A;  4WRD A;  3D4D A;  2K75 A;  2JQO A;  3G48 A;  4BBR H;  4K2K A;  4PNY A;  4UDU C;  4KY7 A;  2JA5 B;  4B3S Q;  3NQI A;  2WB1 G;  1E2Z A;  2O5I C;  5FK9 C;  1G2T A;  2MP1 A;  4EVO A;  5CR3 A;  3S1R B;  2RHQ B;  4A3M G;  3HOZ H;  1X3F A;  3FKI B;  1SAP A;  3S2D H;  1Y14 B;  1E3P A;  4RGM A;  5M5Y B;  4ZK9 B;  1M90 C;  3PO2 B;  2OF1 A;  2WAQ B;  3K58 A;  4YY3 L;  3CCE A;  4IFD I;  3NTI A;  4GN3 B;  4KKS A;  3K7A B;  5KYI A;  4BWG B;  3A8K E;  2FXQ A;  2AQ1 B;  2JA9 A;  3ER0 A;  5JPM C;  5ISR A;  2B8F A;  3UI2 A;  1HCZ A;  2UU9 Q;  4TVA B;  2F0V A;  3I4M B;  1CHQ D;  1I50 B;  3MXN B;  2HQL A;  1NUC A;  4PMW A;  3EVQ A;  4R1J A;  2JK8 A;  2PMZ B;  1X3G A;  2LXJ A;  4L6T B;  2K28 A;  3W1B A;  5LMN Q;  4DF7 A;  2QA4 A;  5COY A;  1CT1 D;  1GVP A;  2IX1 A;  2C9O A;  4DNR B;  2B2W A;  2LS0 1;  3AYH B;  2A69 D;  3RR5 A;  1BBX C;  1KDC A;  2GA4 B;  4P75 A;  3KLS A;  4I7A A;  1CKN A;  4QB4 A;  3GP7 A;  4GKK L;  1LAB A;  1S5F D;  1NSN S;  4FXD A;  1JB3 A;  3W2D A;  3R3O A;  4A3G G;  4A3D G;  5TSS A;  1C48 A;  3KBX A;  2WAC A;  4C56 C;  1IYU A;  5C5L A;  4R4C A;  5M3M H;  2F0N A;  1VQD A;  3A74 A;  2A19 A;  5M5W H;  4Y7N H;  2GVB A;  3U9S A;  4BY7 G;  4LF7 L;  4IUV A;  1SNC A;  3D4W A;  2H1E A;  3IFT A;  1STY A;  1SDF A;  1MBY A;  1WTP A;  4BY1 G;  2KCC A;  4LF6 L;  1J8I A;  3GTL H;  4R4O A;  1EIG A;  2OTJ A;  4PQX A;  3OHX C;  2EYF A;  3SR1 A;  1J5E Q;  5IGC A;  3KDF A;  3KJP A;  2BOS A;  4KLK A;  2E2I H;  4I7Z C;  3TEH B;  4DV5 Q;  3E0J A;  3SVM A;  2KEN A;  3TZU A;  3EIV A;  4XT3 B;  2UXC L;  3VR4 A;  5DM7 3;  1N32 L;  1UE6 A;  4NB3 A;  5FO7 B;  4IPD A;  5IWA L;  1WTX A;  1F9S A;  1YNJ D;  3TZD A;  2HCI A;  4NW2 A;  1STB A;  1PRT D;  1PYB A;  5CMD A;  5C4X B;  4BXX H;  3GTG B;  1D1I A;  2F0E A;  3CCV A;  1KRT A;  1TS4 A;  3RUZ A;  4A3C G;  1NR2 A;  3BG3 A;  5KGU A;  4HIK A;  1SNO A;  1JE5 A;  3BS1 A;  3Q24 A;  5HUR A;  1WTR A;  2BA0 A;  1WD0 A;  3NP8 A;  1C9O A;  1VQP A;  2NYZ D;  1I3Q B;  1KAW A;  1STN A;  2H5X A;  3CPF A;  5A2Q L;  4ZYS A;  3I70 A;  3R2T A;  3D6W A;  4IO9 A;  1VQ8 A;  1XNR L;  2NTS A;  4RAU C;  1LTS D;  1N36 Q;  1DM0 B;  2ZTC A;  4K8I A;  2Y0S E;  4QCL A;  1RTO A;  3JAM L;  5A2Q E;  2F4V L;  4JG2 A;  1AFP A;  4A3D B;  5ELB A;  1WTH A;  4IZ8 A;  2MQH A;  1QOH A;  1HHV A;  2EY5 A;  4A3J B;  1FYC A;  1IL8 A;  1LYL A;  3JAM E;  2E5L L;  3J81 c;  1EL0 A;  5KND A;  3TRE A;  1HUM A;  3EN2 A;  2L0C A;  5JEA H;  4WFN 3;  1JOQ A;  1AZQ A;  1F9R A;  4P73 A;  1NTG A;  2LY7 A;  1VDZ A;  2XGT A;  3JC6 6;  1S3O A;  2SOB A;  4DK6 C;  4PMC A;  3QG1 A;  5E7N A;  1G91 A;  3S14 B;  3CU7 A;  2LMC B;  4DXG A;  5DM6 3;  4JI4 Q;  3RLN A;  1Y1W G;  4FVM A;  1WTW A;  1WTO A;  2JA8 G;  3UDX A;  1S40 A;  1TQO A;  5D3I B;  1L1O A;  3AQQ A;  4GOP B;  4YCU A;  2AKW B;  1A0I A;  2GN5 A;  3T13 A;  3VA7 A;  4NXN L;  3R2I A;  3CC7 A;  4HJA A;  2K14 A;  2B2V A;  4O42 A;  5NUC A;  2BCO A;  2Q2U A;  2R93 G;  1STE A;  1WD1 A;  3CCL A;  3I2Z A;  3QO2 A;  1A3V A;  4A3E G;  1NY4 A;  2VS1 A;  3K80 C;  3CKI B;  1TWC B;  1ILQ A;  5JJL A;  2DN8 A;  2R7Z B;  4X3T A;  1GXD C;  2XVS A;  3V2T A;  4AQY L;  3G6E A;  1QNU A;  1A2U A;  1QVG A;  4OON A;  2VUM B;  1F9Q A;  2RBM A;  1MI2 A;  4JI6 Q;  3PGZ A;  3KLS X;  3HOW H;  2PZT A;  4KHP Q;  5CBE E;  4A93 H;  1I6H B;  2K5V A;  2YTX A;  4RFB A;  3KUP A;  4YWM A;  1FR3 A;  1EEI D;  4FXK C;  1SRO A;  4K8J A;  1EFW A;  4GLX A;  2JA7 G;  3PSI A;  5EPL A;  2PQA A;  3CCM A;  4DV2 Q;  1F77 A;  3QR8 A;  5CV8 A;  2A6H C;  4UP8 A;  4ABN A;  2NVQ B;  1IW7 D;  1H9S B;  5JPN C;  3WDN A;  3KYH C;  3HZX A;  2A6E C;  2C35 B;  3E3X A;  1X6O A;  2E2H H;  3E0E A;  2I5L X;  4A3B G;  2RDH A;  1EZ8 A;  4YCW A;  4JI3 L;  3UE1 A;  3M7N A;  4KTA A;  5T1G A;  1UE5 A;  4CDC C;  2KQ3 A;  4KD4 A;  4V19 0;  1QJO A;  4LMQ D;  2AQ2 B;  1HNW L;  1PH3 A;  2F0J A;  3NK9 A;  3JAM c;  2NZO A;  3QJY A;  2ALY B;  2DY8 A;  2PW5 A;  3J81 j;  2KVM A;  2B63 H;  2VNU D;  2PI2 A;  1CZW A;  1LV9 A;  4GS3 A;  2EYL A;  1HNX L;  4XDX A;  4BBS H;  4FNF A;  1D5M C;  4A75 A;  2VQE Q;  3DEO A;  4IFD H;  2YTV A;  2AUJ D;  4JBK A;  1Y1V G;  3CRK C;  2UUA L;  2Y0S B;  3MAQ A;  4JV5 Q;  2HDL A;  1DXM A;  3CME A;  1PV4 A;  1K8O A;  4LUO A;  2Z6K C;  4IUP A;  4DGZ A;  1S5E D;  1HNZ Q;  3GV3 A;  3HOU H;  5JJZ A;  1LTR D;  1PFS A;  1Y8O B;  1I4X A;  4F8M A;  2Q8R E;  1PH2 A;  3MXP A;  1J9O A;  1SYC A;  4A3E B;  2VB2 X;  4HSV A;  1UAP A;  5IYD H;  4OL7 A;  1HRJ A;  4DK3 C;  1A3U A;  1EY5 A;  1DZ1 A;  3MXN A;  4RGN A;  1BDO A;  4F7X A;  3W3A A;  4DR2 L;  4LFC L;  3M4Y A;  1B70 B;  5C0X J;  2Q2T A;  3GTQ H;  4DUY L;  4JK1 C;  3FVQ A;  1EQV A;  2R61 A;  3U4Z A;  4A3I B;  2I46 A;  4M1U B;  5C0X H;  2UUB Q;  1A63 A;  2WFW A;  2R92 H;  2KA7 A;  1A15 A;  1EQQ A;  1QG7 A;  1QWY A;  3HOV H;  4QF4 A;  5D3D A;  2QEX A;  2B2T C;  2CHB D;  2IL8 A;  1QZG A;  1LTA D;  1TWA H;  2L12 A;  1HR0 W;  1LTT D;  2EYP A;  1SYE A;  1CA6 A;  4YY3 Q;  3HOX G;  4GNX B;  3PIO A;  5C3W A;  2IWH A;  2XIW A;  4DNI A;  4A3B B;  4Q0F A;  2RHS B;  4MN3 A;  4LNQ A;  1TR5 A;  2NWG A;  3TRZ A;  2EPB A;  2XTI A;  5I6W A;  2HT1 A;  1RL2 A;  3DHQ A;  2SDF A;  4S3S A;  1QUQ B;  5M3F G;  5J3B A;  1YNX A;  3CF5 A;  4JI8 L;  1VQ7 A;  4R4I A;  4DNT B;  3G7L A;  5J1Z A;  2F0T A;  4M8A A;  2EIF A;  4B08 A;  2XNA C;  2HIX A;  1B44 D;  3D4R A;  1A8V A;  1K3B C;  5IOC A;  1MSH A;  1VQ5 A;  5E1F A;  4OHJ A;  3SGI A;  1F2Y A;  3B6Y A;  3N6R A;  1EYA A;  3NEN A;  2IX3 A;  3KOJ A;  5EKI A;  4XIG S;  1YBY A;  3CC4 A;  2F0G A;  2NN6 I;  1JIC A;  3PCO B;  2F52 A;  4FP5 D;  1EWH A;  1PYS B;  2IW3 A;  3HKZ G;  2D0O A;  1HUN A;  4DR4 Q;  1XYI A;  2EXD A;  2A68 C;  3URY A;  4ZKB B;  1CSP A;  2FMM A;  2AQ3 B;  2VB3 X;  2SNS A;  2V4D A;  3A0J A;  3RZO H;  2KHJ A;  2BDN A;  3AU7 A;  3CHB D;  3M3Y B;  4TKO B;  4X64 L;  2NBF A;  3OYY A;  3R8B A;  1VQB A;  3GTP B;  4BA2 I;  1ZYR C;  1IYV A;  2HCC A;  2AWN A;  1PH7 A;  5IYB H;  1AH9 A;  2QDL A;  2TMP A;  1GOZ A;  1EY6 A;  1DJR D;  3HOY G;  2UXB L;  2A1A A;  2PPB C;  2QGQ A;  4JI5 Q;  4G4K A;  3ZYY X;  2H4O A;  4HR7 B;  1X32 A;  1IHZ A;  2ID0 A;  1GM5 A;  3NEL A;  1O7L A;  1TWF B;  1A62 A;  4PG3 A;  5GRO A;  3CCQ A;  1P8L A;  1SNM A;  1R9T H;  4OIJ A;  4ZUI A;  2N55 A;  5KIX A;  5IWA Q;  1PFN A;  2MNA A;  3DWP A;  3OSO A;  5HY6 A;  2N49 A;  1VQA A;  4H13 C;  2PMZ E;  3TQY A;  1XMO L;  4NXM L;  4RKB A;  1D7Q A;  4NDX A;  4B3R L;  1LT3 D;  5FO8 B;  1UEA B;  3K81 C;  3A5U A;  1DOK A;  3E9I A;  2WV6 D;  4GN5 A;  4CDE C;  1O7I A;  3STB C;  5LMU L;  1M8A A;  3CQZ B;  4CKE A;  2QW7 A;  3QWN A;  4HJ9 A;  4GKJ Q;  4C3H H;  1N8R C;  4GOP A;  2QDB A;  4JW0 A;  5IIF A;  4LFA L;  3CD6 A;  3C1F A;  2K5N A;  3LGJ A;  4P74 A;  1XNR Q;  2RSO A;  4K0K Q;  4IJH A;  5EGT A;  4OO1 I;  4A3L H;  1WCM G;  4XXE A;  5C3E G;  1JR0 D;  2RDG A;  4DR3 L;  1HPC A;  2F4V Q;  1MHW C;  1KRS A;  4WOR A;  2UXD L;  2B2U A;  3K5L A;  1DGS A;  3SE0 A;  2JA5 H;  4NPS A;  5A35 A;  1LTB D;  4UHV A;  1FD7 D;  3HKZ B;  3S1M B;  1BR9 A;  3Q8D A;  4IPH A;  4B3M Q;  5IP9 G;  3S1N B;  1C8C A;  3HP3 A;  2F0I A;  3NBH B;  2WB1 E;  3S1R H;  1PTO F;  3FKI H;  2A73 B;  5BN4 A;  5M5Y H;  4HN7 A;  1HR0 L;  2R6G A;  3PO2 H;  4BBR G;  1XPO A;  1FJG L;  3EA6 A;  4B9W A;  1GD7 A;  1IBM Q;  3K7A H;  1K8G A;  4LJZ C;  2JEB I;  2MJ8 A;  2UUC L;  1EEF D;  2JXM B;  3MXG A;  4XT1 B;  3MEF A;  2L55 A;  4K6D A;  1Y8P B;  4L5S A;  4X66 L;  4DV4 L;  3HOZ G;  3K57 A;  1H9S A;  1IBL Q;  3I4M H;  1JJG A;  4N9T A;  4NXN Q;  1LLR D;  1I50 H;  3OMC A;  1JT8 A;  5BN5 A;  2ZXR A;  2IT1 A;  5E4X A;  3MXU A;  2EY6 A;  1BUV T;  2MUY A;  4DR1 Q;  4KV6 A;  3I8Z A;  1BCP C;  4JI2 Q;  2Q2I A;  3FPU B;  4K5W A;  2EYH A;  3T4A C;  1N33 Q;  1IBK L;  3PUY A;  1QB5 D;  1WYD A;  3L3O C;  5COR A;  4YWK A;  4ZCK A;  4HID A;  2IHE A;  2B2Y C;  4KHV A;  3D31 A;  4FYD A;  4K5V A;  1VCI A;  2JN4 A;  1M4V A;  1NNX A;  4XQN A;  1YHQ A;  2WIN B;  5M9O A;  5JOB A;  4U68 A;  5C44 B;  2XN9 C;  3VA5 A;  1B9N A;  3GTJ B;  4TSS A;  1G51 A;  3I4N B;  1TII D;  1WOC A;  2VW9 A;  2LXK A;  4A3K H;  3DM1 A;  2YV5 A;  3G4S A;  3S15 B;  4NMZ A;  4RGT A;  4RGO S;  1WCM B;  3TBI B;  1VQF A;  2XRS D;  5HGQ A;  5GAE C;  2EQS A;  1MD2 D;  1DOM A;  3BDC A;  4HMJ A;  4JYA L;  1EYG A;  5T1I A;  3T51 B;  4NP5 A;  1ESR A;  5M3M G;  1QCB D;  4JCV E;  3C3L A;  4LWC A;  1TKW B;  3NTH A;  4MTK A;  2DNE A;  4LUZ A;  1I4R A;  5C4H A;  2YU9 B;  2JA6 B;  2F3I A;  1ESF A;  2WII B;  3M85 A;  1HNW Q;  1R4Q B;  1I94 L;  1TVX A;  2KHS A;  5EBD A;  2K5D A;  4A3F B;  4LF8 L;  2ZM6 L;  2RCN A;  2PQE A;  4BBR B;  1CUK A;  2ZJR A;  2PO4 A;  3TME A;  3LWU A;  3DWQ A;  1N34 Q;  1HNX Q;  1YZ6 A;  5IP7 H;  2CQO A;  1T5X D;  1B53 A;  3RLO A;  3PUX A;  5C4X H;  2CWP A;  2E75 C;  4Y52 H;  3GTG H;  3NWT A;  4HIM A;  4C3I B;  2PYK A;  3FEW X;  1AN8 A;  4JI0 Q;  1KDB A;  4ULL A;  5K36 H;  3KLW A;  4PV1 C;  5CV5 A;  4UY8 C;  4QMG A;  3LWE A;  1A6X A;  4YIJ A;  4HJ7 A;  4B3T L;  4GNX A;  3GO5 A;  4RH6 A;  1S5D D;  1Z47 A;  1X65 A;  1XJV A;  1I3Q H;  4BXX G;  2WB1 B;  3NHH A;  3J7Y W;  1X3Q A;  2XRQ D;  4CJ2 C;  1Q3L A;  1TWG B;  5CBA E;  3TN2 A;  1Q81 C;  5FO9 B;  2CKZ B;  4C2M B;  4X3U A;  3QIA A;  4A3M B;  4LF9 L;  5M5X B;  1F2M A;  3U50 C;  1O80 A;  1BNZ A;  2E8G A;  3C2P A;  1SJE D;  1PTO C;  2K6A A;  2KOL A;  4O0A A;  1B2T A;  2AWO A;  1CHP D;  3E5S A;  3K5O A;  2O4X A;  1EU3 A;  2JYO A;  4HJ5 A;  2ZJP A;  1TY0 A;  3ONA B;  4A3J H;  4R4T A;  1QVF A;  1TS5 A;  1G6Z A;  3KF6 B;  4KD3 A;  2NN6 H;  3DWA A;  2PW7 A;  3FPP A;  1V1P B;  4L8J A;  1CK1 A;  4X65 L;  4DV3 L;  4UPA A;  3KBG A;  4OIK A;  2MHV A;  1RTN A;  1V9P A;  5CV6 A;  5H1S E;  3S14 H;  1NCV A;  4OEM B;  5BR8 L;  5KEE A;  3CPW A;  3OTO Q;  1PH5 A;  4KY6 A;  3ERQ A;  4FF2 A;  4YWL A;  2NVT B;  5JEA G;  3CC2 A;  1S5B D;  1RCV D;  3T16 A;  5EPJ A;  2FIN B;  1W6K A;  1PDQ A;  2GVA A;  1OXV A;  1MIU A;  1I5F A;  1G2S A;  3KFU A;  4A3G B;  4U67 3;  3D3R A;  3PO3 H;  3P20 A;  1H9M A;  5JEA J;  3L2P A;  3CCU A;  1HJP A;  1Q86 C;  1TWC H;  1KLU D;  1EY7 A;  1KDA A;  1X3E A;  2FFK B;  4KY5 A;  2R7Z H;  1KTK A;  1VMP A;  4FF3 A;  3I4O A;  3EJI A;  4DR6 L;  5DLQ E;  3S1Q B;  5IGD A;  4BY7 B;  5I6Y A;  3FMC A;  4R8N A;  2RQX A;  2VUM H;  3K8A A;  5G3L F;  3H3V H;  2AHO B;  4QL5 A;  1VQN A;  4OWX B;  1SBB B;  4K2L A;  4BY1 B;  1LT5 D;  3H0G H;  3STB D;  1STH A;  3T1H Q;  2M9V A;  2CVR A;  4KHZ A;  3I91 A;  1MJC A;  2ICI A;  3SK5 A;  3A56 A;  3V96 A;  2NVX B;  4X62 L;  2CFM A;  5CV7 A;  4KN7 C;  2NVQ H;  1ASY A;  2FHT A;  1Q90 A;  1E22 A;  3I72 A;  3MEH A;  5IOD A;  1U4P A;  3HOW G;  4OO1 H;  4A93 G;  4DKA C;  5FOB B;  3PIO 3;  4KKT A;  5IE8 A;  4DV6 L;  4IOA A;  2K04 A;  2K4K A;  3KJO A;  2UXB Q;  1AW7 A;  2BE5 C;  1FNW A;  1MSG A;  2F0S A;  2A74 C;  4X3S A;  1B7Y B;  1KL9 A;  4EQP A;  3PQI A;  2ENB A;  2CW0 C;  3M9B A;  1YI2 A;  4YHH L;  1VQJ A;  3W5O A;  3E6Z X;  3HS0 C;  1S4Z A;  4HJ8 A;  1ONL A;  2RKS A;  3I3C A;  4LFB L;  1PXU A;  3NBH A;  1XMO Q;  1FGU A;  1K83 B;  1RF2 D;  3I55 A;  3BYT B;  3Q0A A;  2Z8L A;  2B63 G;  1Z7T A;  1SLJ A;  1H95 A;  4HED A;  4ZAI A;  2E76 C;  1DYQ A;  4BBS G;  2Z1C A;  3CMA A;  4G7Z C;  2Q8T A;  4AYB G;  3OPO A;  3J7A 5;  4IFD G;  4G57 A;  3RN2 A;  4A3E H;  3RN5 A;  3PMF A;  2G9D A;  3VYU A;  1KLG D;  2UU9 L;  1DON A;  2NVY B;  1PRT F;  1JWM D;  2E2J B;  3HOU G;  3T1Y Q;  2DJF C;  3DUZ A;  4CGY B;  2X6L A;  4IFD J;  1GUT A;  2UXD Q;  4MIU A;  5IYD G;  5LMN L;  1N9W A;  3PUW A;  4A3I H;  1BXT A;  2KEE A;  3EFX D;  1KNE A;  1Y1W B;  1ASZ A;  2JA8 B;  1LT4 D;  4MHE A;  4NKL A;  5ELE A;  1CQF A;  3HEJ A;  1SE4 A;  3Q6S A;  3IAY A;  1HZA A;  4JBW A;  1JCK B;  3TDQ A;  3H15 A;  2R93 B;  3RZD H;  3F2D A;  5C0X G;  4QUF A;  4RCN A;  4GLV B;  1SXT A;  5IGE A;  1W6J A;  3ERS X;  5EKK A;  2R92 G;  1KC8 C;  1MGS A;  5AJ3 L;  4DR7 L;  2K50 A;  1V1O A;  4MZ9 A;  1PMR A;  5FJ8 H;  4X66 Q;  2DNC A;  4DR5 L;  3HOV G;  4DV4 Q;  3K5M A;  1ET6 A;  4ME5 A;  3L0O A;  4DV7 L;  1O78 A;  3S9W A;  1Q82 C;  2E2H B;  4DV0 Q;  4V0B A;  4DFA A;  1JMC A;  1IXR A;  3DEP A;  1YNN C;  2K1B A;  3GV6 A;  3S17 B;  4JBJ A;  2K03 A;  1GHK A;  3TP7 A;  3SXH A;  1JWU D;  4RKL A;  2J4X A;  2JA7 B;  2L4N A;  2IPK D;  2C5C A;  3J7A V;  1LM0 A;  1AE2 A;  3NTK A;  1EY0 A;  1P16 A;  3ITP A;  1XMQ L;  5C4J B;  2B63 B;  1GUO A;  1XPR A;  3J81 i;  4OWW B;  4IUN A;  4DUZ L;  4XTC S;  5ELF A;  3F2C A;  2M2L A;  2CWA A;  3GQB A;  1LAC A;  4O2D A;  1CM9 A;  3SEB A;  1VQ4 A;  2F0W A;  1CA5 A;  4L5Q A;  1XWE A;  2SEB D;  3HKZ E;  4RHS A;  4DU9 A;  1LO5 D;  1XNQ L;  2I5M X;  4KJO A;  4K5X A;  2RCF A;  2YTY A;  4PZ6 A;  1H9K A;  5FLM H;  3GTP H;  1SYB A;  4QIW E;  3D6C A;  4DAM A;  3I56 A;  1T5E A;  1BCP B;  1TWH H;  2ZXO A;  2EVB A;  1PTO D;  3K6O A;  4JYA Q;  1MJE A;  1QE6 A;  3V05 A;  3HFZ B;  2D62 A;  1Y1V B;  1GUW A;  2VL6 A;  2VY3 A;  2DJG C;  1A3T A;  1N36 L;  1EU4 A;  5JVG 3;  1VQE A;  1EZ6 A;  4FF4 A;  3GTQ B;  4WJW A;  1TWF H;  4ILW A;  1BF4 A;  3QOJ A;  4LF8 Q;  3T56 B;  1BBW A;  3AB9 A;  1HXY D;  4GKK Q;  1VQH A;  2OQ0 A;  1BCP F;  3VR2 A;  5IYB G;  2KCM A;  3M4O H;  3S16 H;  3S2H B;  1Q8K A;  5EPK A;  4JOI C;  3CCR A;  5KNB A;  3KF6 A;  1PVO A;  2Z6K A;  1HFN A;  1IZ6 A;  3CRL C;  4E6I A;  3GTM H;  3Q23 A;  1PZI D;  3N52 A;  1CKM A;  1ZXT A;  3ERO A;  5IY0 A;  4J1M A;  1YNJ C;  4DN4 M;  3P7J A;  3WOF A;  1PRT C;  4LF7 Q;  2KBN A;  1SFO B;  1SE8 A;  2B29 A;  4MTN A;  4C3J H;  2DUD A;  3TP6 A;  4EQN A;  3CQZ H;  2JE6 I;  4LF6 Q;  2Z6B A;  1PHJ A;  4QY7 A;  4CJ1 B;  3BU2 A;  1K0S A;  1E2V A;  2X69 A;  4JI1 L;  3U58 A;  1Q1B A;  2PCF B;  4LF9 Q;  4KKU A;  4IUR A;  2Q2H A;  1D6E C;  4LK1 C;  2UXC Q;  1FVI A;  1HTP A;  1N32 Q;  1PYW D;  2MO0 A;  1YJW A;  1I4H A;  3GTO B;  3HOX B;  3BDL A;  1BKB A;  4J15 A;  4C3H G;  3ULL A;  5K5P A;  3FDT A;  3GTK B;  1LTI D;  4MNO A;  4ALP A;  2B2T A;  1JWS D;  2QEJ C;  3S1N H;  4A3L G;  1PFB A;  1S5C D;  5I4D A;  5CV4 A;  5M3F B;  2ASB A;  1TY2 A;  2OT2 A;  2VZA A;  4JI6 L;  3PUV A;  2FJ2 A;  5EKL A;  2JA5 G;  1CTM A;  1GUN A;  2NUC A;  4XQJ A;  1B3A A;  3BVZ A;  2KED A;  5BR8 Q;  4IPC A;  3A7L A;  2F0U A;  1W2B A;  1BVS A;  4Z9C B;  3H09 A;  1Q46 A;  4DV2 L;  4IAL A;  5IYC H;  3FKI G;  1AEX A;  4G7O C;  5LL6 S;  1PTO B;  3PO2 G;  2WAQ G;  5D65 A;  1EYD A;  3UDI A;  5AFW A;  4CDD C;  1H9J A;  3ICE A;  3IFD A;  1EQR A;  4WJ4 A;  3PF5 A;  2CW0 D;  2OEO A;  2ZXP A;  4O1N A;  4PZ8 A;  1E2W A;  3LX0 A;  1I4P A;  1EWC A;  2D0P A;  1K0R A;  2E5L Q;  1KD1 C;  4IQZ A;  3I4M G;  4QIW B;  5ELO A;  1JJC B;  4EQO A;  2B2W C;  3KF8 B;  4JI7 L;  2K5Q A;  3W1G A;  1VQG A;  4DR6 Q;  3HRZ C;  2Z9H A;  1ROD A;  2FMC A;  1X54 A;  1R9T B;  3PIP A;  2A6H D;  1EIY B;  4KMU C;  5F2D A;  1E1O A;  3I90 A;  1FGB D;  4DXF A;  3DM3 A;  3CP0 A;  2A6E D;  4HMI A;  1VQM A;  5C44 H;  1NMG A;  3OIQ A;  2NB0 A;  2JEA I;  1X56 A;  3H91 A;  3HOY B;  1KHI A;  3I4N H;  4CKB A;  1CZG A;  2PQA B;  1SYF A;  3F2U A;  4DAY B;  4X62 Q;  3S15 H;  1HNZ L;  2X6G A;  2L11 A;  1K73 C;  2OWO A;  5ELD A;  2ZTD A;  2OXP A;  1VQO A;  1X9N A;  4EGV A;  4C3H B;  4LF5 L;  1X3P A;  3MHB A;  1E24 A;  3OMG A;  3DXJ C;  2DY7 A;  1IW7 C;  4F88 A;  1YIT A;  1E1T A;  1U9R A;  3MFY A;  4A3K G;  2F0Q A;  3NSW A;  3BDO A;  1WJJ A;  4OGQ C;  1YJN A;  1NJI C;  3OW2 A;  2YU9 H;  3CCJ A;  1WVL A;  2HQE A;  2JA6 H;  4AQY Q;  4AH6 A;  1X55 A;  2IJ0 A;  1UE1 A;  4A3F H;  5JAV A;  2F0O A;  1O7Y A;  2N3S A;  4LW1 A;  4H02 A;  2D2C C;  3NXW A;  4YHH Q;  4R4Q A;  3NPP A;  1GKH A;  3AFP A;  3NEM A;  3OIP A;  3J80 i;  2UUB L;  1D5X C;  3BZK A;  2K01 A;  4DPG A;  4LFB Q;  3VR6 A;  4C3I H;  5IT9 L;  1HFG A;  4OXP A;  2MFI A;  1HA6 A;  1SE2 A;  4QJF A;  2CCZ A;  5C3E B;  2CQA A;  1VQI A;  1Y8N B;  4UP7 A;  1R4P B;  5IP7 G;  5IT9 E;  3E9H A;  3VR5 A;  3A8I E;  2AMC B;  2EE1 A;  2EYO A;  1I4Q A;  5C4X G;  1B3Q A;  1YNN D;  4PZ7 A;  2WKC A;  4JI3 Q;  4R9W A;  1TWG H;  5KYL A;  2HHH L;  1DOL A;  5K36 G;  5G3L D;  1J6Q A;  3HGB A;  4C2M H;  1E0B A;  1IKM A;  4HSP A;  4A3M H;  1XTC D;  5M5X H;  3M4Q A;  2VQF L;  3TS0 A;  2ZTE A;  3KK7 A;  2TSS A;  1STG A;  3MTS A;  1OO9 B;  1YHB A;  5C6A A;  4A76 A;  3ZJY C;  5FKA C;  3AMU A;  2QKI C;  1EQT A;  2UUA Q;  4IN3 A;  3J81 L;  1DCZ A;  1G8Z D;  3S2D B;  3HOZ B;  1V8Q A;  2J7Z A;  3A7A B;  2CH4 W;  1SND A;  4CBV A;  3IRB A;  2F03 A;  3NQT A;  5C0X I;  3C1E A;  4JVZ A;  3G6J B;  4IUQ A;  2VXW A;  3J81 E;  3SK8 A;  3BJU A;  4A3J G;  4BA1 I;  1II3 A;  4DR4 L;  2F1M A;  3MC0 B;  2NN6 G;  5AJ3 Q;  4DR7 Q;  4DR5 Q;  5GAG C;  2NVT H;  1QUQ A;  4A3K B;  2KCT A;  1K8A C;  1CQV A;  4DV7 Q;  2NZH A;  1LTG D;  2G5D A;  1NBW A;  4DR2 Q;  2M00 A;  1L1O C;  1UWV A;  4LFC Q;  4L5R C;  1EOT A;  4DUY Q;  5CYU A;  2B2V C;  2N78 A;  1U4L A;  4A3G H;  4A3D H;  1ML0 D;  4IUT A;  2LSS A;  1SMX A;  5LMN W;  2Z4H A;  1TT2 A;  1Z6H A;  3MVV A;  1IYJ B;  1Q12 A;  1ILP A;  1SE3 A;  5ELN A;  4OX9 L;  2B2Y A;  4JI5 L;  3O13 A;  3S24 A;  4RCO A;  2CH4 A;  1HQR D;  1XMQ Q;  3FHW A;  5GAD C;  3VYT A;  2MPM A;  2A68 D;  1JJ2 A;  3S1Q H;  4BY7 H;  3QB3 A;  3EBE A;  2F0P A;  1AP0 A;  1NR4 A;  2EY2 A;  3M7G A;  3PO3 G;  4DUZ Q;  1XTD A;  4ID6 A;  4YCV A;  1ZYR D;  4BY1 H;  4RG1 A;  3U9O A;  1SJH D;  2R7Z G;  2K32 A;  5M3M B;  5IT9 c;  3HKS A;  2EJF C;  1ICW A;  5E4W C;  1O7Z A;  3BVM A;  1TXY A;  4CHT B;  5IGG A;  4DV1 L;  1RKN A;  2ICE C;  5FLX L;  4Y7N B;  5M5W B;  2NVX H;  1NMF A;  1XNQ Q;  2KUM A;  4WJ3 M;  4RMF A;  2VUM G;  4GLA C;  2XWB B;  2EOT A;  2P5Z X;  3BZD B;  4JI8 Q;  3DMU A;  3HG9 A;  1RDP D;  5KRU A;  4XYQ A;  3P1H A;  1KXL A;  1I4G A;  3TP5 A;  3GTL B;  1Z9F A;  4GKJ L;  3H0G G;  5FLX E;  2Z4I A;  1RJT A;  1SN8 A;  1GHJ A;  1EUJ A;  2E2I B;  2B3G A;  4KN4 C;  2B39 A;  4K0K L;  4A3C H;  2G9H D;  2QIL A;  4POG A;  1NE3 A;  1WTV A;  1Q7Y C;  2LKV A;  3F8T A;  1HA5 A;  2LFN A;  2RSN A;  1DD2 A;  3NE5 B;  4KJN A;  4OO1 G;  1SNP A;  1Y69 U;  5LHY 1;  3C46 A;  1JC7 A;  1VF7 A;  1YHA A;  1I6H H;  2D5D A;  1HTL D;  1PH9 A;  3AFQ A;  5GAH C;  1UE7 A;  4B3M L;  5KNC A;  2I07 B;  3BZC A;  3A5Z B;  1K83 H;  1EFI D;  1V1Q A;  4JPB W;  4FF1 A;  2F0M A;  5DEH A;  2K52 A;  4DAP A;  4X64 Q;  2EDG A;  2EXZ A;  1IBM L;  2L5T A;  2R7F A;  3SDZ A;  1XPU A;  1GUG A;  3RNU A;  2MGS A;  2L15 A;  3VDY A;  1H9R A;  2OCE A;  1QNK A;  2V1C C;  3ULP A;  2Y0S G;  1OXX K;  2F0K A;  2DGY A;  1IBL L;  1TU2 B;  4AYB E;  3VYR A;  1V43 A;  4LF4 L;  4JI1 Q;  1OXU A;  2NVY H;  4QGU A;  3RLF A;  1K3R A;  5GQO A;  1K28 A;  2E2J H;  1QIL A;  2R3Z A;  1CFM A;  3K59 A;  4DR1 L;  3D0F A;  4CJ0 B;  4B3S L;  4A4I A;  3PO3 B;  4J6H A;  2F3V A;  1WFQ A;  3TS2 A;  4JI2 L;  3ND9 A;  1KAA A;  1Y1W H;  5CGK A;  4HCE A;  2JA8 H;  3PF4 A;  1N33 L;  2KEC A;  4POF A;  3KF8 A; 
#chains in the Genus database with same CATH homology
 4P71 A;  3NBH B;  2WB1 E;  3S1R H;  4NXM Q;  1TWH H;  4BY1 G;  4B3R Q;  3FKI H;  2OTL A;  4LF6 L;  4R4O A;  4TQU S;  3GTL H;  4JYA Q;  1MJE A;  5M5Y H;  3CW2 C;  1HR0 L;  2R6G A;  3HFZ B;  2D62 A;  4BBR G;  3PO2 H;  1XPO A;  1FJG L;  2OTJ A;  2R93 H;  1GD7 A;  2VL6 A;  1J5E Q;  1IBM Q;  2VY3 A;  3KDF A;  4KLK A;  4EQ5 A;  3KJP A;  3K7A H;  5LMU Q;  4A3I G;  1N36 L;  4P72 A;  2JEB I;  1K8G A;  1HZB A;  3TEH B;  2UUC L;  1VQE A;  4DV5 Q;  2BH2 A;  2KEN A;  3EIV A;  1TWF H;  2UXC L;  3MEF A;  1LUZ A;  4LF8 Q;  4GKK Q;  1BBW A;  4L5S A;  4X66 L;  1UE6 A;  4NB3 A;  1VQH A;  2OQ0 A;  1EIF A;  4LFA Q;  4DV4 L;  1PA6 A;  3HOZ G;  4IPD A;  5IYB G;  3M4O H;  2KCM A;  5IWA L;  1IBL Q;  3S16 H;  1Q8K A;  5FLX c;  3I4M H;  1JJG A;  1Q1E A;  4NXN Q;  1I50 H;  1PYB A;  1YVC A;  4JOI C;  3CCR A;  4BXX H;  1JT8 A;  1C7Y A;  3KF6 A;  2IT1 A;  2Z6K A;  1PVO A;  4DR3 Q;  3CCV A;  1IZ6 A;  4OWT B;  2BA1 A;  1KRT A;  3GTM H;  4A3C G;  1EWI A;  4DR1 Q;  1CKM A;  4HIO A;  5IY0 A;  1W3S A;  2R7D A;  4HIK A;  4JI2 Q;  1JE5 A;  2Q2I A;  5FJ8 G;  3S17 H;  2BA0 A;  4LF7 Q;  2KBN A;  1SE8 A;  2B29 A;  1N33 Q;  2JA7 H;  1C9O A;  1VQP A;  1IBK L;  3PUY A;  4MTN A;  1WYD A;  1MKH A;  4C3J H;  4YWK A;  1HNW L;  1YJ9 A;  1KAW A;  2DUD A;  3CQZ H;  2JE6 I;  1OTC A;  2H5X A;  4HID A;  4JI7 Q;  2IHE A;  3CPF A;  4LF6 Q;  2Z0S A;  3D31 A;  1PHJ A;  5C4J H;  4QY7 A;  1HR0 Q;  1VCI A;  1BBU A;  3BU2 A;  1FJG Q;  4IO9 A;  1YHQ A;  1N34 L;  1VQ8 A;  4JI1 L;  4APV A;  3U58 A;  1XNR L;  1Q1B A;  1N36 Q;  2ZTC A;  1L0W A;  2UUC Q;  4LF9 Q;  1L2F A;  1SR3 A;  2Y0S E;  4A3B H;  2Q2H A;  2F4V L;  1E7Z A;  3S2D H;  2UXC Q;  1G51 A;  1S72 A;  1FVI A;  4JG2 A;  1N32 Q;  4JI0 L;  2MO0 A;  1YJW A;  1WOC A;  2VW9 A;  1VQC A;  1BKB A;  2LXK A;  4A3K H;  2MQH A;  4J15 A;  2YV5 A;  1UEB A;  2I5H A;  3G4S A;  3ULL A;  3CAM A;  1U0L A;  1HH2 P;  1VQF A;  1LYL A;  4MNO A;  5HGQ A;  4ALP A;  2E5L L;  5GAE C;  3J81 c;  2EQS A;  3TRE A;  1VS0 A;  3U4V A;  3S1N H;  4A3L G;  3EN2 A;  4JYA L;  4P73 A;  1T9H A;  2KHI A;  1EYG A;  4LF5 Q;  2ASB A;  1NTG A;  2VZA A;  2IX0 A;  2XGT A;  3JC6 6;  5M3M G;  1S3O A;  4JCV E;  4DK6 C;  4LWC A;  1RIP A;  4JI6 L;  1Y1V H;  3PUV A;  5E7N A;  4AIM A;  1J5E L;  2JA5 G;  4LUZ A;  1IBK Q;  4DV5 L;  4JI4 Q;  2F3I A;  3PV0 A;  3RLN A;  1Y1W G;  5FLM G;  5BR8 Q;  4IPC A;  3M85 A;  1HNW Q;  2JA8 G;  1I94 L;  3K7U C;  3UDX A;  4LF8 L;  2HIV A;  1S40 A;  1W2B A;  2ZM6 L;  1BVS A;  2RCN A;  1CUK A;  1CSQ A;  1L1O A;  1CKN B;  1Q46 A;  3AQQ A;  4YCU A;  5IYC H;  2ZJR A;  3FKI G;  2AKW B;  1A0I A;  2GN5 A;  1N34 Q;  1HNX Q;  1OXS C;  3S2H H;  1YZ6 A;  4NXN L;  5IP7 H;  3CC7 A;  2CQO A;  4HJA A;  2ATW A;  2K14 A;  3RLO A;  3PUX A;  5EAY A;  1IL2 A;  3PO2 G;  2Q2U A;  2WAQ G;  2R93 G;  5C4X H;  2CWP A;  4Y52 H;  3UDI A;  3GTG H;  4HIM A;  1PH4 A;  3CCL A;  4JI0 Q;  3I2Z A;  3ICE A;  1EQR A;  4A3E G;  4WJ4 A;  1NY4 A;  2VS1 A;  3PF5 A;  3KLW A;  4UY8 C;  3K80 C;  3M3Y H;  4PZ8 A;  2BH8 A;  4HJ7 A;  4B3T L;  4GNX A;  3GO5 A;  5JJL A;  2D0P A;  1K0R A;  2E5L Q;  1KD1 C;  4IPG A;  1SFO H;  3I4M G;  1Z47 A;  1U5K A;  5ELO A;  1X65 A;  1JB7 A;  1JJC B;  1XJV A;  1I3Q H;  4AQY L;  4JI7 L;  3KF8 B;  4BXX G;  3OTO L;  3G6E A;  3W1G A;  1VQG A;  4DR6 Q;  1QVG A;  3PUZ A;  4OON A;  1X54 A;  3PIP A;  1EIY B;  1Q81 C;  2IY5 B;  2HHH Q;  4JI6 Q;  3PGZ A;  2CKZ B;  1E1O A;  3HOW H;  4KHP Q;  4GOP C;  3DM3 A;  4A93 H;  4LF9 L;  3CP0 A;  3KDF B;  3U50 C;  2K5V A;  5C44 H;  1VQM A;  2YTX A;  1NMG A;  4YWM A;  2E8G A;  2JEA I;  1X56 A;  1SRO A;  2VQF Q;  1I94 Q;  1EFW A;  4GLX A;  2JA7 G;  1KHI A;  3PSI A;  1YEZ A;  4O0A A;  2ZM6 Q;  2PQA A;  2AWO A;  4L5T A;  3I4N H;  2PNH A;  3CCM A;  4DV2 Q;  3GTO H;  3HOX H;  4UP8 A;  2PQA B;  4DAY B;  4X62 Q;  3S15 H;  1HNZ L;  2N8N A;  3M4P A;  3KYH C;  4HJ5 A;  2ZJP A;  4A3J H;  1QVF A;  4R4T A;  3GTK H;  2C35 B;  1X6O A;  2E2H H;  3AEV A;  4FDB A;  4GN4 B;  1K73 C;  2OWO A;  3CXC A;  4JC0 A;  3KF6 B;  2ZTD A;  3E0E A;  1PH6 A;  3UDF A;  2I5L X;  1VQO A;  1X9N A;  4A3B G;  4IJL A;  4LF5 L;  3J80 c;  3UE0 A;  1E24 A;  5M3F H;  4YCW A;  4X65 L;  4DV3 L;  4JI3 L;  4UPA A;  4B3T Q;  3UE1 A;  1YIT A;  3M7N A;  3WWV A;  1E1T A;  2A8V A;  4A3K G;  2IHF A;  1UE5 A;  1WJJ A;  1V9P A;  1YJN A;  5H1S E;  4JI4 L;  3S14 H;  1NJI C;  3OW2 A;  2YU9 H;  3CCJ A;  2JA6 H;  5BR8 L;  4AQY Q;  3L7Z C;  4AH6 A;  3CPW A;  3OTO Q;  3T1H L;  3JAM c;  1PH3 A;  1PH5 A;  2NZO A;  1X55 A;  2ALY B;  3ULJ A;  3J81 j;  1UE1 A;  4UP9 A;  4A3F H;  2K5H A;  2B63 H;  2VNU D;  5JJI A;  4YWL A;  2PI2 A;  2PI2 E;  5JEA G;  1G6P A;  2N3S A;  4LW1 A;  3CC2 A;  4GS3 A;  4H02 A;  1HNX L;  4YHH Q;  1LTL A;  3I7F A;  4R4Q A;  4BBS H;  4A75 A;  1GKH A;  1PH1 A;  2VQE Q;  2GVA A;  3AFP A;  3NEM A;  3J80 i;  2UUB L;  2YTV A;  1OXV A;  1MIU A;  4JBK A;  3BZK A;  1I5F A;  1Y1V G;  4DPG A;  2UUA L;  3KFU A;  2RF4 A;  4LFB Q;  4JV5 Q;  1OXT A;  4C3I H;  3CME A;  1K9M C;  4OXP A;  2MFI A;  1PV4 A;  4LUO A;  2WAQ E;  2Z6K C;  3PO3 H;  5JEA J;  3L2P A;  4QJF A;  3JAM i;  3CCU A;  1HJP A;  1HNZ Q;  1Q86 C;  2CCZ A;  1TWC H;  3HOU H;  5IYC G;  4JBM A;  4X6A H;  1VQI A;  1PFS A;  1X3E A;  3S1M H;  4UP7 A;  1FL0 A;  4OX9 Q;  2R7Z H;  5IP7 G;  1C0A A;  3CCS A;  1PH2 A;  3E9H A;  1PH8 A;  2AMC B;  5IYD H;  1VQ9 A;  3I4O A;  3F2B A;  5C4X G;  4ME3 A;  4DK3 C;  4DR6 L;  5DLQ E;  4X65 Q;  4DV3 Q;  4PZ7 A;  4JI3 Q;  1TWG H;  2VUM H;  2HHH L;  3K8A A;  1VQL A;  5K36 G;  3H3V H;  4KHP L;  2AHO B;  1J6Q A;  4QL5 A;  1VQN A;  4C2M H;  4OWX B;  1M1K C;  4DR2 L;  4A3M H;  4EX5 A;  5M5X H;  3M4Q A;  1EOV A;  3H0G H;  4LFC L;  3STB D;  3T1H Q;  1YIJ A;  1B70 B;  2VQF L;  3TS0 A;  4KI0 A;  5C0X J;  2ZTE A;  2Q2T A;  3GTQ H;  4KHZ A;  4DUY L;  3HOY H;  3U4Z A;  1MJC A;  1YHB A;  1QZH A;  4DV1 Q;  4A76 A;  1L1O B;  3ZJY C;  3G71 A;  4X62 L;  3H3V I;  2CFM A;  2NVQ H;  1GO3 E;  1ASY A;  2UUB Q;  1E22 A;  1CKO A;  1A63 A;  2UUA Q;  2WFW A;  2WP8 J;  2R92 H;  3HOW G;  2JJQ A;  4A93 G;  5JJK A;  1EQQ A;  4DKA C;  1WI5 A;  5C44 G;  3HOV H;  4IOC A;  5IE8 A;  2QEX A;  4DV6 L;  2YYZ A;  3IRB A;  1QZG A;  4IOA A;  5C0X I;  1TWA H;  1HR0 W;  2K4K A;  3KJO A;  3I4N G;  4OO1 G;  4YY3 Q;  2UXB Q;  1G29 1;  3F1Z A;  1B8A A;  3HOX G;  3FP9 A;  3PIO A;  4GNX B;  3BJU A;  1QVC A;  4DNI A;  3T1Y L;  4A3J G;  4BA1 I;  2RHS B;  1B7Y B;  1KL9 A;  4LNQ A;  4DR4 L;  5AJ3 Q;  2NN6 G;  3TRZ A;  2MO1 A;  4DR7 Q;  3M9B A;  4JOI A;  2OQK A;  1QUQ A;  5GAG C;  2KCT A;  4YHH L;  4DR5 Q;  1VQJ A;  2XTI A;  1YI2 A;  1K8A C;  2ES2 A;  3W5O A;  1RL2 A;  2HT1 A;  4QQB X;  5M3F G;  1N32 L;  1QUQ B;  4DV7 Q;  2NZH A;  2VQE L;  5J3B A;  1NBW A;  1YNX A;  4DR2 Q;  1L1O C;  4HJ8 A;  1UWV A;  3CF5 A;  4JI8 L;  3GTJ H;  2E2I H;  4LFC Q;  1VQ7 A;  4LFB L;  4R4I A;  3J7Z C;  4L5R C;  1XMO Q;  4LUV A;  4JV5 L;  1FGU A;  4DUY Q;  2N78 A;  2ZJQ A;  2EIF A;  4A3G H;  3I55 A;  2JA6 G;  4A3D H;  1KIX A;  2LSS A;  3GDE A;  1HZ9 A;  1SMX A;  5LMN W;  1VQ6 A;  3GD7 A;  4A3F G;  1IYJ B;  1AE3 A;  1Q12 A;  2B63 G;  1WCM H;  2HIX A;  5C3E H;  1SLJ A;  1H95 A;  5ELN A;  3UDG A;  4OX9 L;  1A8V A;  4JI5 L;  4BBS G;  1KQS A;  1VQK A;  3S24 A;  3CMA A;  3J7A 5;  4AYB G;  4IFD G;  4GNX C;  2I0Q A;  1VQ5 A;  3RN2 A;  4A3E H;  1XMQ Q;  1SRU A;  3FHW A;  4DV6 Q;  5GAD C;  3RN5 A;  1JJ2 A;  3S1Q H;  3SGI A;  4BY7 H;  3B6Y A;  3EBE A;  3NEN A;  2UU9 L;  4POF A;  3KOJ A;  3K0X A;  3DLL A;  4XIG S;  5IP9 H;  4LF4 Q;  3PO3 G;  1YBY A;  1XTD A;  4DUZ Q;  3CC4 A;  4DV2 L;  2NN6 I;  3PCO B;  2F52 A;  4YCV A;  4BY1 H;  3T1Y Q;  4RG1 A;  1PYS B;  1D8L A;  4DV0 L;  3HOU G;  3HKZ G;  2D0O A;  1HZC A;  2R7Z G;  4DR4 Q;  2K75 A;  4IFD J;  2EXD A;  2JQO A;  3G48 A;  4BBR H;  5IT9 c;  3HKS A;  2UXD Q;  1CSP A;  1TXY A;  3A0J A;  5IYD G;  4DV1 L;  5LMN L;  1N9W A;  4B3S Q;  3RZO H;  2KHJ A;  2WB1 G;  3PUW A;  4A3I H;  2NVX H;  4X64 L;  1NMF A;  3OYY A;  1XNQ Q;  1ASZ A;  4WJ3 M;  4RMF A;  2VUM G;  1VQB A;  4GLA C;  4BA2 I;  4JI8 Q;  1KXL A;  2RHQ B;  4A3M G;  3HOZ H;  1X3F A;  2AWN A;  4GOP B;  1PH7 A;  1HZA A;  1Y14 B;  1E3P A;  1Z9F A;  4JBW A;  3H0G G;  5IYB H;  4GKJ L;  1AH9 A;  1M90 C;  3HOY G;  2UXB L;  3H15 A;  1SN8 A;  4YY3 L;  3CCE A;  2A1A A;  4IFD I;  1EUJ A;  4GN3 B;  2QGQ A;  3RZD H;  2B3G A;  4JI5 Q;  3F2D A;  4K0K L;  4A3C H;  5C0X G;  4POG A;  1NE3 A;  2ID0 A;  4GLV B;  1Q7Y C;  3F8T A;  3NEL A;  1GM5 A;  3ERS X;  2FXQ A;  2R92 G;  1KC8 C;  2JA9 A;  1A62 A;  3ER0 A;  4PG3 A;  5GRO A;  5AJ3 L;  2K50 A;  4MZ9 A;  3CCQ A;  4DR7 L;  5FJ8 H;  1P8L A;  4X66 Q;  4DR5 L;  1R9T H;  4DV4 Q;  3HOV G;  2UU9 Q;  4TVA B;  5IWA Q;  2MNA A;  3L0O A;  4DV7 L;  5HY6 A;  2N49 A;  3MXN B;  2HQL A;  1I6H H;  1VQA A;  1YHA A;  1Q82 C;  2PMZ E;  3TQY A;  1PH9 A;  3AFQ A;  4R1J A;  5GAH C;  1UE7 A;  4DV0 Q;  1XMO L;  4B3M L;  2JK8 A;  1X3G A;  1JMC A;  1IXR A;  3BZC A;  4NXM L;  1D7Q A;  3A5Z B;  1K83 H;  2LXJ A;  4B3R L;  3K81 C;  1V1Q A;  3W1B A;  2NVT H;  3A5U A;  5LMN Q;  2QA4 A;  2K52 A;  3E9I A;  4X64 Q;  4GN5 A;  1GVP A;  4JBJ A;  2IX1 A;  3AYH B;  1IBM L;  1XPU A;  2R7F A;  1O7I A;  3RR5 A;  3STB C;  5LMU L;  3RNU A;  2L15 A;  3VDY A;  1LM0 A;  2OCE A;  1AE2 A;  4HJ9 A;  4P75 A;  4GKJ Q;  1XMQ L;  1P16 A;  4C3H H;  2V1C C;  3ULP A;  4GOP A;  1N8R C;  1CKN A;  2Y0S G;  4GKK L;  1OXX K;  4LFA L;  3CD6 A;  1XPR A;  2DGY A;  3J81 i;  4A3G G;  1IBL L;  4AYB E;  2K5N A;  4A3D G;  1V43 A;  4OWW B;  3LGJ A;  4LF4 L;  4P74 A;  4DUZ L;  4JI1 Q;  1OXU A;  2NVY H;  4QGU A;  4XTC S;  3RLF A;  4IJH A;  1XNR Q;  4K0K Q;  3F2C A;  4OO1 I;  4A3L H;  1WCM G;  1K3R A;  5GQO A;  2CWA A;  5C3E G;  2E2J H;  4O2D A;  4R4C A;  4DR3 L;  2F4V Q;  1VQ4 A;  1KRS A;  5M3M H;  2UXD L;  4DR1 L;  3D0F A;  1VQD A;  4B3S L;  4A4I A;  3A74 A;  4L5Q A;  1DGS A;  2JA5 H;  4NPS A;  1WFQ A;  3TS2 A;  2A19 A;  3HKZ E;  5M5W H;  4Y7N H;  1XNQ L;  2GVB A;  4JI2 L;  2I5M X;  4BY7 G;  2YTY A;  4PZ6 A;  1Y1W H;  4LF7 L;  5FLM H;  3Q8D A;  3GTP H;  2JA8 H;  4QIW E;  4IPH A;  1N33 L;  4B3M Q;  5IP9 G;  3PF4 A;  4DAM A;  3I56 A;  4PMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...