4DR4Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4Q00
1FL0A 2JEBI 2ZTCA 3U4VA 4X62L 4LF5Q 3KF6A 1XPOA 3KFUA 2I5HA 4JI0Q 4JV5L 1HNZQ 1YEZA 3I55A 1S40A 1V1QA 2I0QA 2AWNA 2UUCL 5AJ3Q 2WB1G 3D0FA 1YI2A 1YZ6A 3OTOL 2PQAB 5LMNL 1VQPA 4DUZL 3HOUH 4PZ7A 4X62Q 3H0GH 3CW2C 1Q8KA 5E7NA 1QUQA 2K75A 4A3FH 3J81j 1HNXL 5M5YH 3M3YH 1J5EQ 1GD7A 2RHQB 3MEFA 4P75A 1OXSC 4FDBA 3OW2A 4A3CH 3E9IA 4NXMQ 2EQSA 2HIVA 1SFOH 1KL9A 3CCLA 1CSQA 1N32L 4LUOA 1HNXQ 4MNOA 1J5EL 2CFMA 1BVSA 1IBMQ 4DR7L 4DV7Q 1S72A 1VQGA 1QVFA 4P71A 2JA9A 4RMFA 1N36Q 4A76A 3FHWA 4POFA 1PH9A 5BR8Q 1N33L 2DUDA 2NVQH 4A93G 4LUVA 1IYJB 4YWKA 1GO3E 3ZJYC 3OTOQ 1JT8A 2D0OA 2MFIA 2Z0SA 4JI1L 4BBRH 4R4QA 3CC7A 1KRTA 4DUZQ 4A3KG 1OTCA 3G71A 4LF6L 4A3CG 2HT1A 4JI7Q 4KHZA 5IT9c 3TEHB 3J81c 4BY7G 1GKHA 4ME3A 1V43A 3TREA 4PZ6A 1Q86C 1ASZA 2WB1E 2VZAA 1XNQL 4X64Q 3JC66 4DV2L 2VW9A 1T9HA 1WI5A 1PH7A 2NN6I 1RIPA 2MQHA 1OXXK 3GO5A 3HOUG 3J7A5 4XTCS 5JJIA 5C3EH 4GN4B 3EIVA 5GROA 4X65Q 4JYAL 4TVAB 4IJLA 1EOVA 1VQNA 1VQCA 3I2ZA 3Q8DA 2BH8A 4DV1Q 3GD7A 3GTKH 1RL2A 1VS0A 1ASYA 1VQ4A 4DK3C 2R93H 2CWAA 2E2JH 4GNXC 4R4CA 1SMXA 2OQ0A 3K0XA 4X65L 1NJIC 2HHHL 1FJGQ 4JYAQ 4LF6Q 4OONA 5FJ8G 1PH1A 4X66Q 1L1OA 3B6YA 2JA5G 3STBD 2JK8A 3A74A 5ELOA 4DV4Q 4YWLA 5GAHC 2MNAA 3HOVG 2Q2TA 3HOXG 1MJCA 3GDEA 5J3BA 4DK6C 2EIFA 1BBUA 1B8AA 4DV0Q 2UXDL 5IYDG 3S15H 4JBKA 3I4MG 1U0LA 1VQ8A 4LF8Q 1KHIA 3PV0A 2PI2A 3HOZH 4A3GH 2HIXA 1W2BA 3F2BA 3AFPA 2JE6I 5ELNA 4GKKL 4PG3A 3UDXA 4DAMA 3GTOH 2ASBA 1QVCA 1XPUA 4IFDJ 3RLFA 3M7NA 2ZJQA 1GVPA 1PV4A 5LMUL 1EUJA 4DV6Q 2A8VA 2AKWB 3JAMi 4LF8L 2JEAI 2VQEQ 4IOAA 1JJCB 2JA6H 1EYGA 4A4IA 3PUYA 5IY0A 3KYHC 4GNXA 1FJGL 2JA7G 3GTLH 5IYDH 2VUMH 4GLVB 2E2HH 4JI3L 5JJLA 1D8LA 4JI6Q 4LF7L 4HIOA 3T1HL 2VQEL 1K8GA 3S14H 2UXCQ 3M4QA 3NEMA 4O2DA 3CCQA 2ID0A 1B7YB 4DV0L 1X3EA 2K50A 1XMQL 2IX0A 4B3TL 1JJGA 1Q46A 2ZM6Q 5C4JH 1PA6A 1S3OA 3KF8B 4A3LG 4K0KL 2GVBA 3S16H 3DLLA 1P8LA 4B3TQ 4DV5L 3UE0A 4ALPA 1P16A 4KLKA 1UWVA 1PYBA 1Q1BA 4P73A 4LW1A 2ZM6L 4A75A 4A3JG 4A3MG 1W3SA 5HGQA 2Y0SG 4A3LH 2KCTA 1XJVA 3J80i 1OXTA 3PSIA 2PQAA 1E1OA 1YJ9A 3PO2H 1XNRL 1CUKA 1IBLQ 1KXLA 1JB7A 4DUYQ 4LWCA 1A0IA 3PF5A 4IO9A 5C4XG 1M90C 3BZKA 2PI2E 3M85A 1C7YA 2RHSB 3CCSA 4DR2L 4AYBG 1UE1A 4GNXB 4LUZA 4BBRG 4YY3Q 4YCVA 1LYLA 2AWOA 2C35B 4UP8A 2ATWA 3I4NH 1IXRA 1HNWL 5JEAG 1X9NA 1AH9A 2E2IH 3NELA 4DR4L 4DV3L 4HIKA 3ULLA 2K14A 4R4TA 4GOPB 2KBNA 1WJJA 4IPDA 2LXKA 3H3VH 2E5LL 1K83H 5IE8A 4YY3L 3RN2A 4LFBL 1UE6A 1I3QH 3UDGA 2E8GA 4DV5Q 3PIPA 3W1GA 2YTVA 3PO3G 1SN8A 4WJ4A 5IYBH 5GQOA 4DKAC 3GTGH 2E5LQ 3U58A 4LFBQ 4A3FG 2N8NA 4JOIA 2KHJA 4JV5Q 2UUAL 3LGJA 2YU9H 1EQRA 3HKSA 4IPCA 3RLOA 5C4XH 4DR3L 4A3EH 1Y1WH 3H0GG 2YV5A 1E1TA 3FP9A 4PZ8A 4R4IA 4MZ9A 4POGA 1MIUA 1Y1WG 3I4OA 1NY4A 4HJ8A 1IZ6A 1M1KC 1C9OA 4B3SQ 3CCRA 4YHHL 2K52A 1UE5A 2K5NA 4J15A 4C3JH 3K7AH 5LMNW 4QY7A 4OWWB 4DAYB 3CC2A 5H1SE 3TRZA 1PVOA 3NBHB 1VQHA 1CKMA 1LUZA 3STBC 3RNUA 4C3IH 1GM5A 1V9PA 1H95A 3G48A 4A3KH 5FLMG 4KHPQ 3HKZG 2A19A 1L1OC 1L2FA 2A1AA 3K80C 5C3EG 1Z47A 4LF4Q 4JCVE 2VQFQ 3S2HH 2Z6KA 2VY3A 3PO2G 5C0XG 2ZJRA 2VUMG 5M3FG 5IYCH 3ICEA 5M3MG 2EXDA 1A62A 5IP9H 4L5TA 3D31A 1HZ9A 3CD6A 1YVCA 1VQOA 4A3IH 4IFDI 5FLMH 3AFQA 4DR6L 4NPSA 2UU9L 1G291 2K5VA 2WFWA 3A5ZB 3KJPA 1PH4A 3S1QH 2JA5H 2D0PA 4LF5L 2HQLA 1E24A 5FJ8H 2DGYA 4AH6A 1WCMH 3KJOA 1TWFH 3KLWA 4NB3A 1QZHA 4APVA 2L15A 2VL6A 1Y14B 1X54A 1Q7YC 4X6AH 1YIJA 2UU9Q 4DV7L 1E7ZA 1VQIA 3U4ZA 3CXCA 2R6GA 4NXNQ 3HOWG 1N36L 1MJEA 3HOXH 4BY1G 1AE3A 3EN2A 4A3MH 4TQUS 1K73C 3ER0A 3HFZB 3UE1A 4GS3A 1OXVA 3RR5A 3TS0A 4BXXG 2LXJA 4RG1A 2VNUD 2WAQE 3KDFB 3CCVA 4P74A 2JA8H 2R92H 1A63A 3M9BA 1VQAA 1A8VA 4A3EG 1VQKA 1E3PA 1NMFA 1VQ5A 4JI0L 3S2DH 4QJFA 2B63G 2NVTH 1K0RA 2OCEA 4OO1I 2K4KA 5AJ3L 4X64L 4C3HH 1L1OB 4DR7Q 4JI5L 4AYBE 1IL2A 1KRSA 2B3GA 1EIYB 2B29A 1L0WA 3CCUA 4Y52H 2AMCB 4DPGA 1PH2A 3PCOB 4XIGS 4UY8C 1TWAH 4BXXH 4JBJA 1HR0Q 3CP0A 1CSPA 3GTMH 2OQKA 1SR3A 2V1CC 3H15A 1CKNA 4OWXB 5M5XH 4JC0A 1VQLA 4DV1L 4LFCQ 3W5OA 5GAGC 1N32Q 3HKZE 4DNIA 2R7ZH 2CKZB 3BZCA 1WYDA 3KOJA 1XNQQ 2ALYB 2ZTDA 3GTJH 1HJPA 2JJQA 2Q2HA 1X3GA 3TQYA 1G51A 2OTLA 3H3VI 2WAQG 1CKNB 4LFCL 3CCJA 2D62A 3HOVH 2PNHA 2RCNA 1X55A 1WOCA 5BR8L 1EWIA 1N33Q 2RF4A 3VDYA 3HOZG 4A93H 3T1YQ 3S1NH 1PHJA 3FKIG 3SGIA 1JMCA 4A3BG 5IYCG 1TWCH 1I6HH 3KF6B 2OWOA 3BU2A 1TWHH 2AHOB 4HJ5A 4HIDA 2UUBL 1XMOL 3CCMA 5C44G 4KI0A 3T1YL 2Q2IA 4GKKQ 1TWGH 4JBWA 3J81i 1IBML 3HOYH 1SROA 1VCIA 1YBYA 3WWVA 3CAMA 3BJUA 3PUXA 3CMAA 3CPWA 1HZAA 4BA1I 2LSSA 3CF5A 5LMUQ 3KDFA 2GVAA 1XMOQ 2B63H 4DR5Q 1B70B 1KC8C 3E9HA 4OWTB 2F52A 4JI1Q 3UDIA 2UXDQ 1JE5A 3IRBA 1KQSA 1VQ6A 1C0AA 4JI7L 1TXYA 4QGUA 5K36G 3ULJA 1VQDA 1EQQA 1G6PA 4UP7A 3K7UC 3CMEA 4HJAA 4DR5L 4JBMA 1DGSA 1E22A 4DV2Q 1X3FA 3JAMc 4A3BH 1Y1VH 4AIMA 1R9TH 3CPFA 3I7FA 4BA2I 2NZOA 5GADC 3K81C 3G6EA 1XMQQ 1KD1C 1K3RA 2ZTEA 4LFAQ 1VQ7A 2UUBQ 2F4VL 2FXQA 4BY7H 4L5RC 1VQJA 1BKBA 4K0KQ 1AE2A 4O0AA 4YWMA 1X6OA 3OYYA 2R7ZG 4IOCA 1UE7A 1K8AC 3U50C 3UDFA 3CCEA 2MO0A 3ULPA 1I50H 3PUWA 2HHHQ 4QIWE 1I5FA 5DLQE 3GTQH 1N34Q 3RZOH 3F2DA 1Y1VG 2KCMA 4GN5A 1QZGA 4X66L 1IBKL 1FGUA 1IBLL 4DV6L 4LF9Q 4YCUA 2H5XA 2CQOA 3J80c 4LNQA 2QEXA 4DV4L 2KENA 1QUQB 1PFSA 3PUZA 2WP8J 2IHFA 1VQFA 1U5KA 2N3SA 4AQYQ 1Q82C 4JI4Q 1PH5A 3HOWH 4QL5A 3M4PA 1I94Q 1VQEA 2XTIA 4IPGA 3T1HQ 5HY6A 4LFAL 5C0XI 2F4VQ 4MTNA 5GAEC 2Q2UA 4OXPA 5IP7H 2UXCL 1SE8A 2CWPA 3ERSX 4AQYL 3M4OH 3PO3H 4JI4L 4Y7NH 3S1MH 4IFDG 3F2CA 3AQQA 1XNRQ 1I94L 2YTYA 4DUYL 1CKOA 1BBWA 5C44H 4A3IG 1XTDA 3S1RH 1HH2P 1NTGA 3HOYG 3PF4A 3NENA 5IP7G 1PH6A 2CCZA 2N49A 1N34L 1EFWA 2VS1A 5M3FH 3DM3A 4JI3Q 2JA7H 2NN6G 1IBKQ 2KHIA 4LF9L 4JI6L 4LF7Q 1HNWQ 3K8AA 2IX1A 4JG2A 5M5WH 5IYBG 1N8RC 1WCMG 4GOPA 3E0EA 2YYZA 2Y0SE 4DV3Q 4BBSH 4IPHA 3A5UA 4R4OA 2OTJA 1X56A 2IT1A 3A0JA 3MXNB 4C2MH 3PIOA 3AYHB 1HR0W 1YNXA 3RZDH 2R7DA 4R1JA 4L5QA 1MKHA 4UP9A 4B3SL 4OO1G 3L2PA 4YHHQ 4JI2Q 4HJ7A 4DR2Q 3F8TA 1NMGA 2I5MX 1YHQA 4B3MQ 2I5LX 4JOIC 2JQOA 1KIXA 1SRUA 1YHBA 3RLNA 2IHEA 1O7IA 4BBSG 1KAWA 2NZHA 2Z6KC 4DR3Q 1UEBA 2UXBL 2R93G 1JJ2A 4A3GG 4B3ML 3L7ZC 4DR1L 2XGTA 3CC4A 1J6QA 2VQFL 1QVGA 1Z9FA 1OXUA 3PGZA 3TS2A 4B3RL 3CQZH 1D7QA 4GOPC 3PUVA 5IWAL 4P72A 3S24A 2UXBQ 2JA8G 4PMWA 2R92G 1Q12A 2PMZE 2QGQA 1EIFA 2ES2A 1LM0A 2N78A 2IY5B 1Q1EA 3EBEA 1XPRA 1NBWA 4WJ3M 4GKJL 4BY1H 2GN5A 3G4SA 3GTPH 2R7FA 5JEAJ 5FLXc 2QA4A 3RN5A 2UUAQ 4B3RQ 4UPAA 4DR4Q 4JI2L 4L5SA 4HJ9A 3FKIH 2NVXH 4H02A 3I4NG 1LTLA 4NXML 1PH8A 3S17H 2BA0A 5JJKA 4YCWA 4A3DH 2BA1A 1YITA 3J7ZC 1HZBA 4GLXA 1PH3A 4DR6Q 1VQBA 4EX5A 2ZJPA 4DR1Q 4HIMA 1YHAA 4IJHA 3AEVA 1HZCA 4JI8Q 5IP9G 1FVIA 2NVYH 3W1BA 1VQ9A 5IWAQ 5M3MH 4OX9Q 2F3IA 4EQ5A 4A3JH 1PYSB 2JA6G 1K9MC 4KHPL 1YJNA 4LF4L 1Q81C 4JI5Q 1WFQA 3F1ZA 4OX9L 4NXNL 4JI8L 1YJWA 1VQMA 4A3DG 4GKJQ 4GN3B 1HNZL 2K5HA 3I56A 5C0XJ 2MO1A 4GLAC 1X65A 2YTXA 3L0OA 1SLJA 1HR0L 2UUCQ 1NE3A 4QQBX 3I4MH 5LMNQ 1N9WA 2BH2A 5EAYA
chains in the Genus database with same CATH superfamily
1LTBD 3TP7A 1XPOA 1HNZQ 1S40A 1FNUA 4QCLA 5AJ3Q 3D0FA 3S1QB 5DM63 4XT3B 2NVQB 5E7NA 3J81j 5FKAC 3V2TA 3BYYB 4P75A 2H4OA 4A3CH 3E9IA 4BS9A 1PDQA 1CSQA 4KMUC 3EJIA 4U68A 1EQVA 4WORA 2CFMA 2K01A 5EPKA 3GTJB 4DR7L 1VQGA 1TS2A 1LT6D 4P71A 4K8IA 2F0SA 1N36Q 4OO1H 3FHWA 1PH9A 2DUDA 4A93G 4LUVA 1STAA 1SAPA 2NTTA 4QB4A 1LV9A 1OTCA 2R7ZB 3SK8A 2HT1A 3TREA 1ASZA 2XIWA 2NN6H 5IOCA 1CK1A 4FYDA 5FO8B 3J7A5 4XTCS 5JJIA 1RODA 5GROA 5HURA 1UEAB 2FMMA 3I90A 4CJ1B 3SXHA 5BN4A 2LY7A 2M9VA 3GD7A 2I46A 2EYMA 1CI3M 2MPMA 4DK3C 2CWAA 2E2JH 1FJGQ 3HOVG 1SMXA 2L9HA 4OONA 5FJ8G 1LTTD 4X66Q 1CFMA 1RCVD 1T5EA 3A74A 4DV4Q 2AQ2B 3D6WA 4KHVA 3HOXG 5G3LD 1BCPC 2EIFA 1B8AA 4IUNA 3NTKA 3PV0A 2PI2A 4FF2A 4QF4A 3UDXA 3GTOH 3RLFA 3M4YA 5I9PA 5IGFA 2A8VA 1PTOD 2VQEQ 3D4WA 1B9NA 4OHJA 1STGA 3S2HB 2NUCA 1HUNA 2VUMH 4JI3L 4K5WA 1TKWB 1KABA 1O7YA 3L9AX 1S5BD 4DFAA 2WIIB 3NQIA 2VQEL 1K8GA 4IALA 5K36H 5DAUA 3NK9A 3JAML 4CGYB 4O2DA 4DV0L 2IX0A 4H7BA 1Q46A 3SK4A 3KBGA 1DXMA 3BYTB 3UE0A 2WKCA 3HOZB 4A3JG 4A3LH 4IZ8A 2PQAA 2A68D 1YJ9A 3PO2H 2L5TA 2NWGA 1CUKA 4P2CB 1AP0A 4DUYQ 3U9OA 3GTOB 2JA8B 2R92B 3M85A 2VXWA 4K6LA 3HZXA 5HGTA 2F0EA 3A8KE 4YY3Q 1WVLA 1HNWL 2ATWA 5T1GA 1LTAD 1U9RA 4GOPB 2KBNA 2KCNA 5FO9B 3H3VH 2B8FA 2E5LL 4YY3L 3RN2A 1JICA 1SYEA 1UE6A 1HPCA 1DONA 3PIPA 3W1GA 5IYBH 5GQOA 4C1NK 2E5LQ 1C48A 1UNSA 4M1UB 4JOIA 2UUAL 2PZUA 4MHEA 5I9OA 1BUVT 4ZAIA 4H13C 2YU9H 4IPCA 3NBIA 4OX9L 4DR3L 3PQIA 1S4ZA 1QNKA 1MIUA 4OELB 1FGBD 2CW0C 1NY4A 2D2CC 3A8IE 1M1KC 2EY5A 4B3SQ 2K52A 1BO0A 1G91A 3RZDB 1GUSA 4CDEC 1JORA 1EL0A 1PVOA 1EIHA 2M2LA 1QCBD 3RNUA 5I6WA 3G48A 4A3KH 4KHPQ 2P5ZX 2A19A 1L2FA 1SNQA 2B2VA 4DU9A 1Z47A 1TT2A 4LF4Q 3U9SA 2VY3A 5EQ0A 2ZJRA 2VUMG 3H3VC 3I70A 1A15A 4IFDI 3MTSA 2B2WA 3TZUA 3S1QH 2D0PA 4LF5L 1E24A 5FJ8H 2DGYA 4HSVA 4APVA 1O7ZA 1F2ZA 5EKLA 4BWGB 4X6AH 1KLUD 3K57A 1E7ZA 1VQIA 3U4ZA 2R6GA 2F3WA 1MJEA 1O80A 3HOXH 5FK9C 1AE3A 3QOLA 3JAME 1K73C 3HFZB 3UE1A 3RR5A 2RDFA 3KDFB 4PMCA 4P74A 4F7XA 2VB3X 2XRSD 3M9BA 1A8VA 2NVTH 1K0RA 1SE3A 2G9HD 4JI5L 5J1ZA 4IUTA 4UY8C 1TWAH 4BXXH 4JBJA 1ONLA 3OWFA 3T51B 1PFNA 3CP0A 3NSWA 1KNEA 3S14B 2V1CC 1CKNA 4MIUA 4JC0A 3GQBA 5G3LF 3W5OA 1N32Q 1D5ZC 1AFPA 2CKZB 1XNQQ 3P1HA 2EJMA 2KUMA 4KY6A 2QDBA 1X3GA 3H3VI 4X3SA 2OTLA 1CKNB 3CCJA 3O13A 3HOVH 1CT1D 1EWIA 2RF4A 3VDYA 4DAPA 3T1YQ 3S1NH 3SGIA 5CR3A 2MHVA 4NP5A 5KNCA 3KF6B 2OWOA 5EPJA 1XMOL 3CCMA 4V0BA 1EEID 4KI0A 3T1YL 2Q2IA 3VR2A 4JBWA 1GXDC 2PNRC 1EZ8A 1CM9A 3CAMA 3BJUA 1MGSA 3TP6A 1I6HB 5LMUQ 3KDFA 1XMOQ 2EYJA 4C3JG 1B70B 1KC8C 2F52A 1GUGA 1HQMC 4EQPA 4F87A 4JI1Q 1WTHA 2PW5A 1B44D 1VQ6A 4JI7L 1TXYA 5D3DA 4QGUA 4CDFC 1BXTA 1VQDA 1EQQA 4B9WA 5ELBA 4UP7A 4XYQA 3OMCA 1X3FA 1RD9D 4DA2A 3JAMc 4BA2I 2NZOA 1GUNA 3CRLC 3C46A 3G6EA 4HSPA 2UUBQ 1JR0D 2FXQA 4HN7A 2QW7A 4L5RC 1VQJA 1G2SA 3NTHA 4YWMA 1XTCD 2R7ZG 4IOCA 3GTQB 1K8AC 3CCEA 3QO2A 5DLQE 1I5FA 2HHHQ 2D5DA 3F2DA 1IBKL 4LF9Q 1IBLL 4A3DB 2F0NA 3DXJC 2IHFA 4AQYQ 1U5KA 4JI4Q 4QL5A 1WTVA 1S5DD 1I4QA 5KGUA 1EWHA 1S5CD 5C0XI 2QEJC 3QIAA 4MTNA 3GTMB 2CWPA 4AQYL 2JA6B 2SNMA 3PO3H 4JI4L 1SYGA 2YTYA 1SE4A 2K1BA 4KV6A 4X3UA 3UI2A 4A3GB 5IP7G 2CCZA 4ZUIA 1WTXA 3DM3A 1SNDA 2NN6G 4RAUC 4LF7Q 5M5WH 5IYBG 2B2TC 2K03A 4RKBA 3LX0A 2SOBA 1B4OA 2A6HD 2Y0SE 4CJ2C 4DV3Q 1ZYRC 3A5UA 2E74C 4C2MH 2JYOA 3AYHB 1E2ZA 2R7DA 1MI2A 2RBMA 4R1JA 4UP9A 4XDXA 4DR2Q 3F8TA 2I5LX 2L0CA 3S1RB 3GV6A 4A3GG 3L7ZC 4DR1L 2L55A 3CC4A 2EZVA 5M3MB 4WRDA 4F88A 1Z9FA 4HMIA 4FXDA 1IW7C 2RCFA 3CQZH 3S24A 5DEHA 5CV9A 4PMWA 1Q12A 2QGQA 1EIFA 2ES2A 5IGEA 1E2WA 5C4XB 1K83B 2F3VA 5JEAJ 3RN5A 4DR4Q 4JI2L 4A3JB 4OGQC 2AUJD 4Q5VA 2NVXH 2MP1A 4YCWA 4A3DH 2R61A 3R93A 1STHA 2F0WA 2LKVA 3K6OA 2R93B 3Q22A 2G5DA 4EX5A 5EPLA 2ZJPA 2RSNA 3T56B 5IP9G 2ZT9C 5M3MH 5IWAQ 4EQ5A 3SHLA 2F0FA 3DHQA 1F77A 1NCVA 1OO9B 4GKJQ 4A3DG 4GN3B 3MEHA 4A3MB 4DAVA 3S16B 5C0XJ 1HTLD 2UUCQ 2NVTB 2YTXA 3L0OA 5LMNQ 2K33A 1FL0A 2JEBI 3NXWA 2GA4B 1F9PA 1YEZA 3I55A 4YIJA 2UUCL 1QJOA 1YI2A 1YZ6A 1HUMA 5LMNL 4IFDH 3HOUH 4CDDC 2QKIC 1M8AA 3CW2C 5AFWA 1HNXL 4CKCA 2PW7A 4O1NA 3KF8A 1IL8A 2RDHA 1KL9A 4RA8A 4LUOA 1HNXQ 4MNOA 3A55A 2B2YC 4IUQA 4B08A 4QMGA 2NYZD 2JA9A 2PZWA 4RMFA 3BDLA 3DEOA 5BR8Q 1N33L 1TR5A 2NVQH 2MFIA 2Z4HA 4R4QA 4G7HC 1KRTA 5JPMC 3FEWX 5IT9c 1GKHA 2WB1E 4HTHA 1D5MC 1LTID 1T9HA 2CVRA 3FPUB 3J7YW 3HOUG 4B9XA 5C3EH 4IURA 4RKLA 4FF4A 4IJLA 1EOVA 1VQNA 3J81L 3I2ZA 4DV1Q 1AW7A 2NVXB 4J8QA 3GTKH 3J7AF 1H9MA 4WJWA 1ASYA 1EU3A 1Z7TA 1HA5A 1NJIC 2OQ0A 1STBA 4LF6Q 1I3QB 4KK7A 1G2TA 3B6YA 2Q8IB 2JK8A 4YWLA 2Q2TA 1DOMA 1MJCA 2UXDL 1BBUA 4DV0Q 1LTGD 1C8CA 1U0LA 4K2KA 1KHIA 1LT4D 4A3GH 3AFPA 2D9UA 5ELNA 4GKKL 5DNFA 2HQEA 2KEDA 4IFDJ 2ZJQA 1GVPA 3SDZA 2AKWB 2VUMB 5K5PA 1JJCB 3PUYA 3GTLH 1ILQA 5IYDH 1Z6HA 4OEMB 2K05A 1IKLA 5EKIA 3T1HL 1WTQA 2K5DA 3HGBA 2K32A 1QWYA 2E2HB 1UAPA 1JWUD 2K50A 1XMQL 3SE0A 1JJGA 3WDNA 4J6HA 4X3KA 1PA6A 3KF8B 5ISRA 1GHJA 4K0KL 1MBYA 1Y1WB 1P8LA 2EDGA 4ALPA 3FRPB 1JWMD 4KLKA 1UWVA 4P73A 2CW0D 1W3SA 1MD2D 2Y0SG 3NPPA 3J80i 3J80E 2E2DC 5BN3A 3PF5A 4TRDA 1C7YA 4AYBG 4GNXB 4LUZA 2K6AA 3VR5A 1LYLA 2AWOA 1F9RA 5JEAG 1H9SA 1X9NA 4H0LC 3NELA 4HIKA 3ULLA 5I2XA 1C4QA 1WJJA 2LXKA 3VYSA 4A3BB 4QIWB 2ENBA 4DV5Q 5FO7B 2E2JB 5E4XA 3PO3G 2EYPA 4A3FG 1EEFD 2KHJA 2WKDA 1RDPD 3ND8A 3BDCA 3LGJA 4A3EH 3HOYH 1Y1WH 1E1TA 4KKTA 2MUYA 4R4IA 3S17B 2PO4A 4HJ8A 2RDGA 3DM1A 1IZ6A 3CCRA 1BCPB 4YHHL 1UE5A 3D6CA 3CC2A 5H1SE 1CTMA 1QE6A 4C3IH 1V9PA 4X3TA 5CV6A 1Y69U 3AB9A 3HKZG 3OMGA 1L1OC 2A1AA 3CQZB 3GV3A 5C3EG 4JCVE 1AZPA 1K8OA 3ICEA 3CKIB 2F0MA 4L5TA 1HZ9A 4A3IH 1CZGA 2UU9L 3A5ZB 1PFMA 5M9OA 2HQLA 1JE4A 1A3UA 3KLWA 3QJYA 4NB3A 2L15A 3HOXB 1Y14B 1Q7YC 2UU9Q 3BVMA 3SK6A 4DV7L 4UAIA 4ZYSA 4NXNQ 3HOWG 2KECA 3N6RA 3NTIA 3EN2A 4KY7A 3ER0A 4ME5A 1OXVA 4BXXG 3TS0A 2JA8H 4I7AA 2R92H 5C4XG 1QNUA 1VQAA 1VQKA 1NMFA 1VQ5A 3A8JE 4QJFA 2B63G 4CHTB 2K4KA 2A74C 5AJ3L 4X64L 4C3HH 4FF1A 1IYUA 4AYBE 1KRSA 2B3GA 3KLSA 2B29A 5JVH3 5TSSA 3CCUA 2AMCB 4DPGA 1PH2A 3PCOB 4XIGS 3H94A 4EQNA 1ZYRD 5KNBA 1CSPA 3GTMH 4BBRB 1J8IA 5M5XH 2TMPA 4LFCQ 4DN4M 1WYDA 4K5XA 3F2UA 4TKOB 2ALYB 2ZTDA 1L0YB 1TWGB 3IFDA 4EVOA 2JJQA 3AMUA 3D8GA 1G51A 2C9OA 3BDOA 4OIJA 4LFCL 1TS5A 1D5XC 1Q3LA 1X55A 3V96A 3SEBA 1TWCB 2DN8A 3CHBD 2Y0SB 1PHJA 3FKIG 1D2BA 3GTPB 5IYCG 4HIDA 2UUBL 4ZCKA 5BN5A 1B1ZA 4BBSB 1GOZA 1TWGH 3VR3A 1PZID 3J81i 1SROA 1VCIA 4AYBB 1K0SA 5D14A 4BA1I 1STEA 5IT9L 5M5XB 4FVMA 3DWPA 1Y8OB 3VR4A 2Z8LA 5CV7A 4U673 4MN3A 1TS3A 1MSHA 1BCPF 1Y1VH 2DNCA 1LO5D 1BBXC 3NUCA 1KD1C 2ZTEA 2NVYB 2Z9HA 3OIPA 1I6VC 3VR6A 4IUUA 2PCFB 3U50C 5J22A 2HUGA 4QIWE 4ULLA 3RZOH 3QR8A 1SJED 1U4PA 1Y1VG 2KCMA 4GN5A 4X66L 3A7AB 5JVG3 1M4VA 2F0JA 2KEEA 4YCUA 3WOEA 3J80c 2QEXA 4DV4L 3PUZA 2B8GA 2O4XA 3K5MA 2N3SA 1Q82C 1SFOB 3M4PA 2XTIA 4IPGA 2WINB 2F4VQ 1MSGA 5GAEC 2Q2UA 4KKUA 5IP7H 1SE8A 1B3QA 3AQQA 1XNRQ 4CDCC 4C3IB 3FMCA 4A3IG 3S1RH 1HH2P 1NTGA 3NENA 1I50B 1F2LA 1ICWA 1EFWA 4JI3Q 5M3FH 3PIP3 2KHIA 4JG2A 3E0EA 3I72A 5IGGA 4C2MB 4IPHA 1LTSD 3X3NA 2OTJA 1X56A 2IT1A 2XNAC 2EYHA 2DY8A 1JOOA 2CH4A 4XQJA 2RA4A 1HR0W 1YNXA 1SYFA 4L5QA 4UDUC 1KNAA 1NR2A 3GTKB 4JI2Q 1FNWA 4KKSA 4JOIC 2JQOA 3WOFA 4PV1C 3RLNA 2IHEA 4C3IG 2EVBA 4A3IB 2HDMA 1UEBA 2BE5D 1H9RA 1VMCA 2XGTA 1J6QA 1SNOA 2VQFL 3E6ZX 1FNVA 4DNTB 1OXUA 1PYWD 3TS2A 3PUVA 5IWAL 4P72A 2JA8G 2HD3A 2L11A 2R92G 1SXTA 1LM0A 2QDLA 1NBWA 3R3OA 2FMCA 4GKJL 1JOQA 2DJGC 2R7FA 5FLXc 2UUAQ 3ONAB 2FHTA 1PRTD 1Y8NB 3FKIH 1WD0A 4H02A 3J81E 1PH8A 1NAPA 1T5XD 2F0IA 1ESFA 3HRZC 3S17H 3MXPA 1BR9A 1YITA 1HFGA 4GLXA 4DR6Q 2PZTA 2XN9C 3R2TA 1YHAA 4JI8Q 2G9DA 2NVYH 4OX9Q 2F3IA 1PYSB 3N52A 1K9MC 4KHPL 1YNJD 2H1EA 4LF4L 1Q81C 3TMEA 4JI8L 1VQMA 5ELDA 1EU4A 3E3XA 1AZQA 2BDNA 2MO1A 3ERQA 1X65A 1HR0L 4QQBX 1BOSA 1NE3A 3NHHA 3ZYYX 1N9WA 4NXMQ 2KCCA 4HEDA 2BH2A 2O5IC 2ZTCA 3KFUA 4LF5Q 2A73B 2I5HA 5IGBA 4JI0Q 4JV5L 4LJZC 2F0KA 1V1QA 3EFXD 2WB1G 2PQAB 1VQPA 2CQAA 4PZ7A 1EY4A 3H0GH 1Q8KA 3Q6SA 1QUQA 1PRTC 1JC7A 1STYA 5LHY1 5M5YH 1SYDA 3MEFA 3OW2A 3P7JA 5E4WC 3A54A 2JA7B 4KJOA 3CCLA 3H91A 5C44B 1LTRD 1GHKA 3Q0AA 3A7LA 4ODGA 1BVSA 1IBMQ 1QVFA 4A76A 1TY0A 3K5LA 1CHPD 4M8AA 1SYCA 4N8X1 2FINB 5FLXE 4YWKA 1GO3E 3OTOQ 3PMFA 3T13A 3CC7A 1TS4A 2Z0SA 5EBDA 3DMUA 4BBRH 4DUZQ 4LF6L 3T16A 3G71A 4PMBA 4KHZA 2IX3A 3J81c 1TWAB 4BY7G 1V43A 1Q86C 1KLGD 1XNQL 3KLSX 4DV2L 3DWAA 3GTGB 2VW9A 1PH7A 2SNSA 1PXUA 1OXXK 3GO5A 5IGCA 2IL8A 4JK1C 1CA5A 1KTKA 3EIVA 5C4ZA 3C1FA 4X65Q 4JYAL 2BE5C 4TVAB 4NDXA 2FJ2A 1VQCA 3ITPA 3Q8DA 2BH8A 3KBXA 5EBCA 4GNXC 4R4CA 4X65L 4JYAQ 3TP8A 1VDZA 4RGMA 1F9QA 2JA5G 4EGVA 1SJHD 2M00A 2NTSA 3I3CA 1VF7A 2MNAA 2F0QA 3GDEA 4DK6C 3TBIB 5IYDG 4DK1A 4JBKA 5C6AA 2A68C 3QWNA 1W2BA 1QILA 1FYCA 1TQOA 4N9TA 2JE6I 2ZXOA 1QVCA 3K5OA 1XPUA 3FPPA 3VYRA 5LMUL 4A3KB 4DV6Q 3JAMi 2JEAI 2JA6H 4A4IA 4DF7A 1E2VA 1Q8IA 5JJLA 3Q23A 4GLVB 1KDBA 4DK0A 1D8LA 3MHBA 4XXEA 4JI6Q 4HIOA 1I4RA 2PQEA 1SNPA 2B2WC 4JW0A 2UXCQ 1SSOA 3M4QA 1LT5D 4DXFA 4Y7NB 5FOBB 3S1MB 3NEMA 3CCQA 1WTWA 3S15B 2QCPX 5C4JH 4A3LG 1S3OA 1SBBB 5CGKA 2GVBA 3S16H 3DLLA 2CH4W 5C5MA 4DV5L 3PO3B 4A3MG 1Q1BA 2BDOA 5HGQA 2KCTA 1FD7D 1OXTA 4KY5A 3PSIA 1E1OA 1A6XA 1KXLA 1IBLQ 4ZUJA 3HOWB 4RHSA 3HOUB 3BZKA 2PI2E 5LL6X 2RHSB 3CCSA 3MZ5A 2AQ3B 3PIO3 4YCVA 1NSNS 4UP8A 3R8BA 4BY7B 2VB2X 4G4KA 1AH9A 2E2IH 3KUPA 4ZKBB 4DV3L 2IPKD 2K14A 4R4TA 1K83H 3IKJA 4LFBL 2NBFA 2LFNA 1SN8A 4WJ4A 2K04A 3GTGH 3FKIB 1EY0A 4LFBQ 1B53A 2B39A 3TP5A 2WV6D 4I65A 2R93H 1EQRA 3RLOA 2A6EC 3H6MA 1EY7A 4PZ8A 2EYOA 1D1KA 4HMJA 1Y1WG 4H44C 1WD1A 3I4OA 4QUCA 1C9OA 2HCIA 1R4PB 1J9OA 2K5NA 4J15A 1SNMA 4IN3A 4QY7A 4DAYB 1EZ6A 3TRZA 1ICFB 3NBHB 1A3TA 1EYDA 1CKMA 1LUZA 3STBC 1AEXA 3K5NA 2XRQD 1XX8A 1KAAA 3EVQA 3S2HH 1ZXTA 3PO2G 5C0XG 5M5YB 5IYCH 5M3MG 2EXDA 1CHQD 5IP9H 3D31A 5JJZA 1YVCA 5FLMH 1DOKA 4NPSA 1G291 3D4RA 1WTOA 1A2UA 3KLRA 4TSSA 2JA5H 1SDFA 2SDFA 3URYA 1WCMH 3M4OB 1RTNA 5FLXL 1X3QA 1W6KA 2VL6A 1X54A 3W2DA 1YIJA 2V4DA 1N36L 1DM0B 1VF5C 4TQUS 2LXJA 3LNNA 2WAQE 1E0BA 1TY2A 2FFKB 2WAQB 1A63A 5DM73 1JWSD 4PNYA 2OCEA 5C4JB 3NP8A 1H9JA 1L1OB 2IW3A 4DR7Q 2EE1A 5C3WA 5CMDA 1L0WA 5KEEA 2OEOA 1EFID 5EKKA 2F0PA 2RVLA 3RZOB 1PLFA 3OSOA 1SR3A 3H15A 5NUCA 5GAGC 1JCKB 4DNIA 2R7ZH 4FP5D 4RGOS 5KRUA 1TWFB 3GTJH 2Q2HA 1ZEQX 3TQYA 1QOHA 2J0TD 2D62A 5CV8A 2RCNA 5IODA 1SMYD 1WOCA 5BR8L 1N33Q 3HOZG 4A93H 4A3CG 4L63B 2O2LD 5I4DA 4RCOA 1TWCH 4FO2A 1I6HH 3D4DA 4HJ5A 3WWVA 3CPWA 4K5VA 4A3FB 2F0TA 4I7ZC 4EQOA 4DR5Q 2DJFC 4OWTB 1LT3D 5CC4A 3UDIA 2RSOA 3IRBA 1KQSA 1C0AA 1GUTA 3ULJA 1ZKOA 3K7UC 4HJAA 4DR5L 4JBMA 4AIMA 1L0XB 2WACA 3I7FA 4HR7B 3R2IA 3VA7A 3K81C 1VQ7A 2F4VL 4FF3A 1ENCA 2AQ1B 1BKBA 3M7GA 4R8IA 4O0AA 3EA6A 1K3BC 3OYYA 3ULPA 1I50H 1RF2D 1XXGA 2L1BA 2JXMB 3HS0C 2H5XA 2CQOA 4LNQA 1QUQB 1RHPA 1PFSA 5E3FA 1VQFA 2L12A 1I94Q 3PO2B 1CQFA 3T1HQ 3FDTA 4LFAL 1EIGA 2F0UA 4OXPA 1IKMA 1I4GA 4Y7NH 2B2VC 3S1MH 4IFDG 3HG9A 1I94L 4CJ0B 5KNDA 1CKOA 4DUYL 2ICIA 2Q8RE 2X69A 3PF4A 1PH6A 2N49A 1N34L 2JA7H 2VS1A 4ZKCB 3M3YB 1HNWQ 1DCZA 1HXYD 1N8RC 4G57A 1WCMG 3H0GB 3T53B 2WB1B 1S5ED 3A0JA 3MXNB 1SEBD 3PIOA 3RZDH 4B3SL 4OO1G 1YHQA 1NMGA 2I5MX 4B3MQ 3OHXC 1YNJC 1II3A 1KIXA 3IFTA 4LMQD 1O7IA 4BBSG 2Z6KC 4DR3Q 2UXBL 2R93G 1B50A 4C3HG 3BG3A 3I8ZA 4B3ML 2L4NA 3A56A 1JB3A 2XVSA 4NW2A 5A2QL 3CU7A 4B3RL 3MFGA 1X32A 2F0DA 2X6LA 2UXBQ 2PMZE 3QOJA 2PMZB 2EYLA 2IY5B 3EBEA 2XWJB 1XPRA 4WJ3M 4A3EB 5CBAE 4BY1H 3GTPH 3T4AC 2QA4A 4B3RQ 3OOCA 1DD2A 4MTKA 3KK7A 1PTOF 3X3MA 1FR3A 3TSSA 4NXML 1WTRA 3C2PA 4FXKC 4HCSA 1UUPA 3QG1A 4O42A 1PH3A 1V1PA 4LK1C 2YU9B 1VQBA 5A35A 1EWCA 4ZLTF 4V190 4OIKA 1HZCA 1FVIA 4KD3A 1VQ9A 1V8QA 4A3JH 4UHVA 2JA6G 3VYUA 1YJNA 5IIFA 4JI5Q 4RHRA 2K28A 3F1ZA 3D3RA 1YJWA 4JPBW 2K5HA 4S3SA 4GLAC 1LABA 2EJFC 5J39A 1R9TB 5M5WB 3TN2A 4X62L 3U4VA 5CV4A 3KF6A 1B3AA 5JPNC 3MVVA 2I0QA 2AWNA 3OTOL 4DUZL 2O5JC 1U4LA 4X62Q 1KDAA 2K7VA 4DNRB 2K75A 3MWYW 4A3FH 4XT1B 3M3YH 4IQZA 1J5EQ 1GD7A 2RHQB 1OXSC 3HEJA 4FDBA 1EY8A 1EYCA 2JA5B 3MC0B 5EGTA 2EQSA 2EY6A 2HIVA 1GJXA 3I73A 1Y8PB 1SFOH 1TWHB 3NE5B 3EQLC 1N32L 1J5EL 1PMRA 3VYTA 4DV7Q 1S72A 1BCPD 4POFA 5M3FB 2KOLA 4KTAA 1IYJB 3ZJYC 1JT8A 2D0OA 4JI1L 2F0GA 4A3KG 1KDCA 4JI7Q 1HQRD 3TEHB 1U4RA 4ME3A 4PZ6A 2E2IB 2VZAA 4X64Q 3JC66 5IT9E 1ESRA 1WI5A 5ELFA 2NN6I 1RIPA 2QILA 4E6IA 1QG7A 2MQHA 4FXGC 3P20A 3S2DB 4ABNA 4GN4B 5CV5A 1O7LA 4GZYC 3RUZA 3RMHA 2HCCA 2EY1A 3L3OC 1V1OA 1IW7D 1RL2A 1VS0A 1VQ4A 3SR1A 1EOTA 2HHHL 1Y1VB 3K0XA 4R8NA 1PH1A 1G6ZA 1DZ1A 1L1OA 3STBD 5ELOA 2OF1A 4G7OC 4ZRZA 5GAHC 3MXUA 1HHVA 5J3BA 3S15H 1EY5A 2PPBC 3I4MG 5EJWA 4WFN3 1VQ8A 4LF8Q 3HOZH 1CQVA 2HIXA 3DWQA 3F2BA 3E5SA 4PG3A 4DAMA 2ASBA 2B2UA 2K5QA 3M7NA 1HRJA 1PV4A 3E0JA 1H9SB 1EUJA 4LF8L 3C1EA 4IOAA 3NQTA 1EYGA 4G7ZC 5IY0A 1ILPA 3KYHC 4GNXA 1FJGL 2I07B 2JA7G 1PTOH 2E2HH 1HCZA 4LF7L 3G7LA 2PYKA 3S14H 2RKSA 3CRKC 1RJTA 4K2LA 1PRTB 1B7YB 2ID0A 1X3EA 4ILWA 2A5HA 3J80L 4B3TL 3I4MB 2ZM6Q 4R9WA 1ET6A 2EYFA 3HOVB 3LWUA 4B3TQ 2B2TA 5I6YA 1P16A 1PYBA 2ZM6L 3DEPA 4LW1A 4N8FA 4A75A 2SEBD 3OWEB 1XJVA 4L8JA 4CKBA 3NWTA 1XNRL 3RD4A 2NB0A 1JB7A 4LWCA 4ZQ3A 1A0IA 2X6GA 4IO9A 1M90C 1JQYD 1I4XA 2ZXRA 1STNA 5C3EB 4DR2L 1PZJD 1EQTA 1UE1A 4BBRG 3NWSA 2C35B 3I4NH 1IXRA 4RH6A 3ND9A 1I4PA 3QB3A 4DR4L 2Z1CA 5JEAH 4IPDA 5IE8A 5JOBA 1I3QH 3UDGA 2E8GA 2YTVA 2Q8TA 3HKZB 3MA2B 4KN4C 4DKAC 1V1PB 3U58A 4JVZA 5A2QE 1ENAA 2N8NA 5CBEE 4RWSC 4F8MA 2XSCA 3HKSA 5C4XH 4Z9CB 3H0GG 1DOLA 1ET9A 2YV5A 3FP9A 4K8JA 4MZ9A 4POGA 2TSSA 1D6EC 1G8ZD 3I91A 3K58A 1CA6A 1GUOA 3HOYB 5IGDA 4C3JH 3K7AH 4OL7A 3S9WA 1PTOB 5LMNW 4OWWB 1TU2B 1VQHA 4N9PA 4RFBA 1GM5A 1H95A 1BQQT 3LWEA 5FLMG 3VA5A 3K80C 5E1FA 2KHSA 2VQFQ 2Z6KA 5M3FG 4CBVA 1A62A 5COYA 1A3VA 3DUZA 3CD6A 1VQOA 4DR6L 3AFQA 4DXGA 2K5VA 2WFWA 3KJPA 1PH4A 2ZXPA 2K5WA 1D1IA 1PTOC 4AH6A 3KJOA 1TWFH 4CKEA 1QZHA 3MXNA 4C56C 1NNXA 4C3HB 4Q0FA 3CXCA 4BY1G 2E76C 4A3MH 2XWBB 4ID6A 4KN7C 2LS01 4GS3A 4KJNA 1PFBA 2EOTA 4RG1A 2VNUD 3CCVA 3MFYA 5LL6S 3BS1A 3W3AA 1PRTF 1XWEA 3AU7A 4A3EG 5ELEA 4JI0L 4HCEA 1E3PA 3S2DH 4JV5Q 4OO1I 4J1MA 1XYIA 1RKNA 2KA7A 1IL2A 2E75C 1EIYB 1K8MA 3HP3A 4Y52H 1WCMB 1HA6A 4RGTA 2CHBD 2A6HC 1X3PA 1HR0Q 5T1IA 5C3XA 2OQKA 4RGNA 4NKLA 2EXZA 1U4MA 4OWXB 3K7AB 1VQLA 4DV1L 1LACA 3HKZE 3GTLB 3BZCA 3KOJA 4IUVA 1HJPA 2DNEA 2QF7A 4XYOA 2WAQG 4IUPA 2PNHA 1F2YA 5JAVA 5KYIA 2B63B 3FVQA 1HTPA 1JMCA 4A3BG 1AN8A 5C5LA 2F0VA 1CZWA 3BU2A 1TWHH 2AHOB 4LAAA 1H9KA 5C44G 2F1MA 4GKKQ 5L37A 1IBML 1ENFA 1K28A 1YBYA 3PUXA 5KIXA 3CMAA 1WTPA 3SK5A 1EY9A 1HZAA 1SYBA 2LSSA 5ELCA 3CF5A 1RTOA 2GVAA 1IYVA 2HDLA 2B63H 1W6JA 3E9HA 2A6ED 4A93B 4C1NI 2UXDQ 1JE5A 2F4IA 1QB5D 4K6DA 5K36G 1G6PA 3CMEA 1DGSA 1E22A 4DV2Q 1TIID 5D65A 4A3BH 1R9TH 3CPFA 3J7AV 5GADC 3OPOA 1NUCA 1ML0D 1XMQQ 1K3RA 2BCOA 4LFAQ 4HAEA 1VMPA 5F2DA 4BY7H 3H09A 1EYAA 3SVMA 2KVMA 2R3ZA 5I2YA 3TDQA 4K0KQ 1AE2A 1IHZA 2OT2A 2A69C 1SMYC 1X6OA 2F03A 1UE7A 3UDFA 3EROA 3MXGA 2MO0A 4XQNA 3PUWA 2KQ3A 3OW7A 1YNNC 4DGZA 3GTQH 1N34Q 2IWHA 3I4NB 1QZGA 3BVZA 1DJRD 1FGUA 4DV6L 1F2MA 2KENA 2WP8J 3C3LA 1PZKD 2LMCB 1PH5A 3HOWH 1VQEA 2NZ1D 2MGSA 5HY6A 1DYQA 4BY1B 2UXCL 3ERSX 3BZDB 3M4OH 1O78A 3F2CA 1HFNA 5D3IB 1BBWA 2B2YA 5C44H 1XTDA 3K0YA 3HOYG 1R4QB 2BOSA 1IBKQ 3IL8A 4JI6L 4LF9L 3K8AA 2IX1A 3G6JB 1A2TA 4GOPA 1F9SA 1B9MA 1TVXA 2KJXA 1NR4A 2YYZA 4BBSH 2IJ0A 2Z4IA 2F0HA 4R4OA 3MAQA 5CYUA 4C3JB 1YNND 1MKHA 3L2PA 4YHHQ 2N55A 4HJ7A 3IAYA 2F0OA 4PQXA 1GUWA 1SRUA 1YHBA 1JOKA 1I4HA 1KAWA 2NZHA 3OIQA 2EY2A 2DY7A 1JJ2A 2ICEC 1EY6A 1QVGA 2B2UC 3PGZA 4RCNA 1D7QA 4GOPC 3NBHA 5C4HA 4DAYA 1SNCA 2N78A 5KYLA 1Q1EA 1LLRD 2N88A 2EJGC 4QUFA 3K59A 2OXPA 2GN5A 3G4SA 2JP1A 1BF4A 2AUKA 4UPAA 3S1NB 1SE2A 3TZDA 4L5SA 1BDOA 4HJ9A 3V05A 1LTLA 3I4NG 1BNZA 3GP7A 3I4LA 3BVGA 1MHWC 2BA0A 2RQXA 5JJKA 2Z6BA 1Q90A 2BA1A 2JSOA 3J7ZC 1HZBA 4DR1Q 5CORA 4FNFA 4HIMA 4IJHA 2C5CA 3AEVA 4L6TB 5C0XH 3W1BA 3P75A 4KD4A 1S5FD 4XQQA 4ZK9B 1WFQA 4K14A 2A69D 2MJ8A 4NXNL 3Q24A 1B2TA 1HNZL 3I56A 4NMZA 1SLJA 2JN4A 2J7ZA 2J4XA 2F0LA 3I4MH 2EPBA 5EAYA
chains in the Genus database with same CATH topology
1FL0A 2JEBI 2ZTCA 3U4VA 4X62L 4LF5Q 3KF6A 1XPOA 3KFUA 2I5HA 4JI0Q 4JV5L 1HNZQ 1YEZA 3I55A 1S40A 1V1QA 2I0QA 2AWNA 2UUCL 5AJ3Q 2WB1G 3D0FA 1YI2A 1YZ6A 3OTOL 2PQAB 5LMNL 1VQPA 4DUZL 3HOUH 4PZ7A 4X62Q 3H0GH 3CW2C 1Q8KA 5E7NA 1QUQA 2K75A 4A3FH 3J81j 1HNXL 5M5YH 3M3YH 1J5EQ 1GD7A 2RHQB 3MEFA 4P75A 1OXSC 4FDBA 3OW2A 4A3CH 3E9IA 4NXMQ 2EQSA 2HIVA 1SFOH 1KL9A 3CCLA 1CSQA 1N32L 4LUOA 1HNXQ 4MNOA 1J5EL 2CFMA 1BVSA 1IBMQ 4DR7L 4DV7Q 1S72A 1VQGA 1QVFA 4P71A 2JA9A 4RMFA 1N36Q 4A76A 3FHWA 4POFA 1PH9A 5BR8Q 1N33L 2DUDA 2NVQH 4A93G 4LUVA 1IYJB 4YWKA 1GO3E 3ZJYC 3OTOQ 1JT8A 2D0OA 2MFIA 2Z0SA 4JI1L 4BBRH 4R4QA 3CC7A 1KRTA 4DUZQ 4A3KG 1OTCA 3G71A 4LF6L 4A3CG 2HT1A 4JI7Q 4KHZA 5IT9c 3TEHB 3J81c 4BY7G 1GKHA 4ME3A 1V43A 3TREA 4PZ6A 1Q86C 1ASZA 2WB1E 2VZAA 1XNQL 4X64Q 3JC66 4DV2L 2VW9A 1T9HA 1WI5A 1PH7A 2NN6I 1RIPA 2MQHA 1OXXK 3GO5A 3HOUG 3J7A5 4XTCS 5JJIA 5C3EH 4GN4B 3EIVA 5GROA 4X65Q 4JYAL 4TVAB 4IJLA 1EOVA 1VQNA 1VQCA 3I2ZA 3Q8DA 2BH8A 4DV1Q 3GD7A 3GTKH 1RL2A 1VS0A 1ASYA 1VQ4A 4DK3C 2R93H 2CWAA 2E2JH 4GNXC 4R4CA 1SMXA 2OQ0A 3K0XA 4X65L 1NJIC 2HHHL 1FJGQ 4JYAQ 4LF6Q 4OONA 5FJ8G 1PH1A 4X66Q 1L1OA 3B6YA 2JA5G 3STBD 2JK8A 3A74A 5ELOA 4DV4Q 4YWLA 5GAHC 2MNAA 3HOVG 2Q2TA 3HOXG 1MJCA 3GDEA 5J3BA 4DK6C 2EIFA 1BBUA 1B8AA 4DV0Q 2UXDL 5IYDG 3S15H 4JBKA 3I4MG 1U0LA 1VQ8A 4LF8Q 1KHIA 3PV0A 2PI2A 3HOZH 4A3GH 2HIXA 1W2BA 3F2BA 3AFPA 2JE6I 5ELNA 4GKKL 4PG3A 3UDXA 4DAMA 3GTOH 2ASBA 1QVCA 1XPUA 4IFDJ 3RLFA 3M7NA 2ZJQA 1GVPA 1PV4A 5LMUL 1EUJA 4DV6Q 2A8VA 2AKWB 3JAMi 4LF8L 2JEAI 2VQEQ 4IOAA 1JJCB 2JA6H 1EYGA 4A4IA 3PUYA 5IY0A 3KYHC 4GNXA 1FJGL 2JA7G 3GTLH 5IYDH 2VUMH 4GLVB 2E2HH 4JI3L 5JJLA 1D8LA 4JI6Q 4LF7L 4HIOA 3T1HL 2VQEL 1K8GA 3S14H 2UXCQ 3M4QA 3NEMA 4O2DA 3CCQA 2ID0A 1B7YB 4DV0L 1X3EA 2K50A 1XMQL 2IX0A 4B3TL 1JJGA 1Q46A 2ZM6Q 5C4JH 1PA6A 1S3OA 3KF8B 4A3LG 4K0KL 2GVBA 3S16H 3DLLA 1P8LA 4B3TQ 4DV5L 3UE0A 4ALPA 1P16A 4KLKA 1UWVA 1PYBA 1Q1BA 4P73A 4LW1A 2ZM6L 4A75A 4A3JG 4A3MG 1W3SA 5HGQA 2Y0SG 4A3LH 2KCTA 1XJVA 3J80i 1OXTA 3PSIA 2PQAA 1E1OA 1YJ9A 3PO2H 1XNRL 1CUKA 1IBLQ 1KXLA 1JB7A 4DUYQ 4LWCA 1A0IA 3PF5A 4IO9A 5C4XG 1M90C 3BZKA 2PI2E 3M85A 1C7YA 2RHSB 3CCSA 4DR2L 4AYBG 1UE1A 4GNXB 4LUZA 4BBRG 4YY3Q 4YCVA 1LYLA 2AWOA 2C35B 4UP8A 2ATWA 3I4NH 1IXRA 1HNWL 5JEAG 1X9NA 1AH9A 2E2IH 3NELA 4DR4L 4DV3L 4HIKA 3ULLA 2K14A 4R4TA 4GOPB 2KBNA 1WJJA 4IPDA 2LXKA 3H3VH 2E5LL 1K83H 5IE8A 4YY3L 3RN2A 4LFBL 1UE6A 1I3QH 3UDGA 2E8GA 4DV5Q 3PIPA 3W1GA 2YTVA 3PO3G 1SN8A 4WJ4A 5IYBH 5GQOA 4DKAC 3GTGH 2E5LQ 3U58A 4LFBQ 4A3FG 2N8NA 4JOIA 2KHJA 4JV5Q 2UUAL 3LGJA 2YU9H 1EQRA 3HKSA 4IPCA 3RLOA 5C4XH 4DR3L 4A3EH 1Y1WH 3H0GG 2YV5A 1E1TA 3FP9A 4PZ8A 4R4IA 4MZ9A 4POGA 1MIUA 1Y1WG 3I4OA 1NY4A 4HJ8A 1IZ6A 1M1KC 1C9OA 4B3SQ 3CCRA 4YHHL 2K52A 1UE5A 2K5NA 4J15A 4C3JH 3K7AH 5LMNW 4QY7A 4OWWB 4DAYB 3CC2A 5H1SE 3TRZA 1PVOA 3NBHB 1VQHA 1CKMA 1LUZA 3STBC 3RNUA 4C3IH 1GM5A 1V9PA 1H95A 3G48A 4A3KH 5FLMG 4KHPQ 3HKZG 2A19A 1L1OC 1L2FA 2A1AA 3K80C 5C3EG 1Z47A 4LF4Q 4JCVE 2VQFQ 3S2HH 2Z6KA 2VY3A 3PO2G 5C0XG 2ZJRA 2VUMG 5M3FG 5IYCH 3ICEA 5M3MG 2EXDA 1A62A 5IP9H 4L5TA 3D31A 1HZ9A 3CD6A 1YVCA 1VQOA 4A3IH 4IFDI 5FLMH 3AFQA 4DR6L 4NPSA 2UU9L 1G291 2K5VA 2WFWA 3A5ZB 3KJPA 1PH4A 3S1QH 2JA5H 2D0PA 4LF5L 2HQLA 1E24A 5FJ8H 2DGYA 4AH6A 1WCMH 3KJOA 1TWFH 3KLWA 4NB3A 1QZHA 4APVA 2L15A 2VL6A 1Y14B 1X54A 1Q7YC 4X6AH 1YIJA 2UU9Q 4DV7L 1E7ZA 1VQIA 3U4ZA 3CXCA 2R6GA 4NXNQ 3HOWG 1N36L 1MJEA 3HOXH 4BY1G 1AE3A 3EN2A 4A3MH 4TQUS 1K73C 3ER0A 3HFZB 3UE1A 4GS3A 1OXVA 3RR5A 3TS0A 4BXXG 2LXJA 4RG1A 2VNUD 2WAQE 3KDFB 3CCVA 4P74A 2JA8H 2R92H 1A63A 3M9BA 1VQAA 1A8VA 4A3EG 1VQKA 1E3PA 1NMFA 1VQ5A 4JI0L 3S2DH 4QJFA 2B63G 2NVTH 1K0RA 2OCEA 4OO1I 2K4KA 5AJ3L 4X64L 4C3HH 1L1OB 4DR7Q 4JI5L 4AYBE 1IL2A 1KRSA 2B3GA 1EIYB 2B29A 1L0WA 3CCUA 4Y52H 2AMCB 4DPGA 1PH2A 3PCOB 4XIGS 4UY8C 1TWAH 4BXXH 4JBJA 1HR0Q 3CP0A 1CSPA 3GTMH 2OQKA 1SR3A 2V1CC 3H15A 1CKNA 4OWXB 5M5XH 4JC0A 1VQLA 4DV1L 4LFCQ 3W5OA 5GAGC 1N32Q 3HKZE 4DNIA 2R7ZH 2CKZB 3BZCA 1WYDA 3KOJA 1XNQQ 2ALYB 2ZTDA 3GTJH 1HJPA 2JJQA 2Q2HA 1X3GA 3TQYA 1G51A 2OTLA 3H3VI 2WAQG 1CKNB 4LFCL 3CCJA 2D62A 3HOVH 2PNHA 2RCNA 1X55A 1WOCA 5BR8L 1EWIA 1N33Q 2RF4A 3VDYA 3HOZG 4A93H 3T1YQ 3S1NH 1PHJA 3FKIG 3SGIA 1JMCA 4A3BG 5IYCG 1TWCH 1I6HH 3KF6B 2OWOA 3BU2A 1TWHH 2AHOB 4HJ5A 4HIDA 2UUBL 1XMOL 3CCMA 5C44G 4KI0A 3T1YL 2Q2IA 4GKKQ 1TWGH 4JBWA 3J81i 1IBML 3HOYH 1SROA 1VCIA 1YBYA 3WWVA 3CAMA 3BJUA 3PUXA 3CMAA 3CPWA 1HZAA 4BA1I 2LSSA 3CF5A 5LMUQ 3KDFA 2GVAA 1XMOQ 2B63H 4DR5Q 1B70B 1KC8C 3E9HA 4OWTB 2F52A 4JI1Q 3UDIA 2UXDQ 1JE5A 3IRBA 1KQSA 1VQ6A 1C0AA 4JI7L 1TXYA 4QGUA 5K36G 3ULJA 1VQDA 1EQQA 1G6PA 4UP7A 3K7UC 3CMEA 4HJAA 4DR5L 4JBMA 1DGSA 1E22A 4DV2Q 1X3FA 3JAMc 4A3BH 1Y1VH 4AIMA 1R9TH 3CPFA 3I7FA 4BA2I 2NZOA 5GADC 3K81C 3G6EA 1XMQQ 1KD1C 1K3RA 2ZTEA 4LFAQ 1VQ7A 2UUBQ 2F4VL 2FXQA 4BY7H 4L5RC 1VQJA 1BKBA 4K0KQ 1AE2A 4O0AA 4YWMA 1X6OA 3OYYA 2R7ZG 4IOCA 1UE7A 1K8AC 3U50C 3UDFA 3CCEA 2MO0A 3ULPA 1I50H 3PUWA 2HHHQ 4QIWE 1I5FA 5DLQE 3GTQH 1N34Q 3RZOH 3F2DA 1Y1VG 2KCMA 4GN5A 1QZGA 4X66L 1IBKL 1FGUA 1IBLL 4DV6L 4LF9Q 4YCUA 2H5XA 2CQOA 3J80c 4LNQA 2QEXA 4DV4L 2KENA 1QUQB 1PFSA 3PUZA 2WP8J 2IHFA 1VQFA 1U5KA 2N3SA 4AQYQ 1Q82C 4JI4Q 1PH5A 3HOWH 4QL5A 3M4PA 1I94Q 1VQEA 2XTIA 4IPGA 3T1HQ 5HY6A 4LFAL 5C0XI 2F4VQ 4MTNA 5GAEC 2Q2UA 4OXPA 5IP7H 2UXCL 1SE8A 2CWPA 3ERSX 4AQYL 3M4OH 3PO3H 4JI4L 4Y7NH 3S1MH 4IFDG 3F2CA 3AQQA 1XNRQ 1I94L 2YTYA 4DUYL 1CKOA 1BBWA 5C44H 4A3IG 1XTDA 3S1RH 1HH2P 1NTGA 3HOYG 3PF4A 3NENA 5IP7G 1PH6A 2CCZA 2N49A 1N34L 1EFWA 2VS1A 5M3FH 3DM3A 4JI3Q 2JA7H 2NN6G 1IBKQ 2KHIA 4LF9L 4JI6L 4LF7Q 1HNWQ 3K8AA 2IX1A 4JG2A 5M5WH 5IYBG 1N8RC 1WCMG 4GOPA 3E0EA 2YYZA 2Y0SE 4DV3Q 4BBSH 4IPHA 3A5UA 4R4OA 2OTJA 1X56A 2IT1A 3A0JA 3MXNB 4C2MH 3PIOA 3AYHB 1HR0W 1YNXA 3RZDH 2R7DA 4R1JA 4L5QA 1MKHA 4UP9A 4B3SL 4OO1G 3L2PA 4YHHQ 4JI2Q 4HJ7A 4DR2Q 3F8TA 1NMGA 2I5MX 1YHQA 4B3MQ 2I5LX 4JOIC 2JQOA 1KIXA 1SRUA 1YHBA 3RLNA 2IHEA 1O7IA 4BBSG 1KAWA 2NZHA 2Z6KC 4DR3Q 1UEBA 2UXBL 2R93G 1JJ2A 4A3GG 4B3ML 3L7ZC 4DR1L 2XGTA 3CC4A 1J6QA 2VQFL 1QVGA 1Z9FA 1OXUA 3PGZA 3TS2A 4B3RL 3CQZH 1D7QA 4GOPC 3PUVA 5IWAL 4P72A 3S24A 2UXBQ 2JA8G 4PMWA 2R92G 1Q12A 2PMZE 2QGQA 1EIFA 2ES2A 1LM0A 2N78A 2IY5B 1Q1EA 3EBEA 1XPRA 1NBWA 4WJ3M 4GKJL 4BY1H 2GN5A 3G4SA 3GTPH 2R7FA 5JEAJ 5FLXc 2QA4A 3RN5A 2UUAQ 4B3RQ 4UPAA 4DR4Q 4JI2L 4L5SA 4HJ9A 3FKIH 2NVXH 4H02A 3I4NG 1LTLA 4NXML 1PH8A 3S17H 2BA0A 5JJKA 4YCWA 4A3DH 2BA1A 1YITA 3J7ZC 1HZBA 4GLXA 1PH3A 4DR6Q 1VQBA 4EX5A 2ZJPA 4DR1Q 4HIMA 1YHAA 4IJHA 3AEVA 1HZCA 4JI8Q 5IP9G 1FVIA 2NVYH 3W1BA 1VQ9A 5IWAQ 5M3MH 4OX9Q 2F3IA 4EQ5A 4A3JH 1PYSB 2JA6G 1K9MC 4KHPL 1YJNA 4LF4L 1Q81C 4JI5Q 1WFQA 3F1ZA 4OX9L 4NXNL 4JI8L 1YJWA 1VQMA 4A3DG 4GKJQ 4GN3B 1HNZL 2K5HA 3I56A 5C0XJ 2MO1A 4GLAC 1X65A 2YTXA 3L0OA 1SLJA 1HR0L 2UUCQ 1NE3A 4QQBX 3I4MH 5LMNQ 1N9WA 2BH2A 5EAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FL0 A;  2JEB I;  2ZTC A;  3U4V A;  4X62 L;  4LF5 Q;  3KF6 A;  1XPO A;  3KFU A;  2I5H A;  4JI0 Q;  4JV5 L;  1HNZ Q;  1YEZ A;  3I55 A;  1S40 A;  1V1Q A;  2I0Q A;  2AWN A;  2UUC L;  5AJ3 Q;  2WB1 G;  3D0F A;  1YI2 A;  1YZ6 A;  3OTO L;  2PQA B;  5LMN L;  1VQP A;  4DUZ L;  3HOU H;  4PZ7 A;  4X62 Q;  3H0G H;  3CW2 C;  1Q8K A;  5E7N A;  1QUQ A;  2K75 A;  4A3F H;  3J81 j;  1HNX L;  5M5Y H;  3M3Y H;  1J5E Q;  1GD7 A;  2RHQ B;  3MEF A;  4P75 A;  1OXS C;  4FDB A;  3OW2 A;  4A3C H;  3E9I A;  4NXM Q;  2EQS A;  2HIV A;  1SFO H;  1KL9 A;  3CCL A;  1CSQ A;  1N32 L;  4LUO A;  1HNX Q;  4MNO A;  1J5E L;  2CFM A;  1BVS A;  1IBM Q;  4DR7 L;  4DV7 Q;  1S72 A;  1VQG A;  1QVF A;  4P71 A;  2JA9 A;  4RMF A;  1N36 Q;  4A76 A;  3FHW A;  4POF A;  1PH9 A;  5BR8 Q;  1N33 L;  2DUD A;  2NVQ H;  4A93 G;  4LUV A;  1IYJ B;  4YWK A;  1GO3 E;  3ZJY C;  3OTO Q;  1JT8 A;  2D0O A;  2MFI A;  2Z0S A;  4JI1 L;  4BBR H;  4R4Q A;  3CC7 A;  1KRT A;  4DUZ Q;  4A3K G;  1OTC A;  3G71 A;  4LF6 L;  4A3C G;  2HT1 A;  4JI7 Q;  4KHZ A;  5IT9 c;  3TEH B;  3J81 c;  4BY7 G;  1GKH A;  4ME3 A;  1V43 A;  3TRE A;  4PZ6 A;  1Q86 C;  1ASZ A;  2WB1 E;  2VZA A;  1XNQ L;  4X64 Q;  3JC6 6;  4DV2 L;  2VW9 A;  1T9H A;  1WI5 A;  1PH7 A;  2NN6 I;  1RIP A;  2MQH A;  1OXX K;  3GO5 A;  3HOU G;  3J7A 5;  4XTC S;  5JJI A;  5C3E H;  4GN4 B;  3EIV A;  5GRO A;  4X65 Q;  4JYA L;  4TVA B;  4IJL A;  1EOV A;  1VQN A;  1VQC A;  3I2Z A;  3Q8D A;  2BH8 A;  4DV1 Q;  3GD7 A;  3GTK H;  1RL2 A;  1VS0 A;  1ASY A;  1VQ4 A;  4DK3 C;  2R93 H;  2CWA A;  2E2J H;  4GNX C;  4R4C A;  1SMX A;  2OQ0 A;  3K0X A;  4X65 L;  1NJI C;  2HHH L;  1FJG Q;  4JYA Q;  4LF6 Q;  4OON A;  5FJ8 G;  1PH1 A;  4X66 Q;  1L1O A;  3B6Y A;  2JA5 G;  3STB D;  2JK8 A;  3A74 A;  5ELO A;  4DV4 Q;  4YWL A;  5GAH C;  2MNA A;  3HOV G;  2Q2T A;  3HOX G;  1MJC A;  3GDE A;  5J3B A;  4DK6 C;  2EIF A;  1BBU A;  1B8A A;  4DV0 Q;  2UXD L;  5IYD G;  3S15 H;  4JBK A;  3I4M G;  1U0L A;  1VQ8 A;  4LF8 Q;  1KHI A;  3PV0 A;  2PI2 A;  3HOZ H;  4A3G H;  2HIX A;  1W2B A;  3F2B A;  3AFP A;  2JE6 I;  5ELN A;  4GKK L;  4PG3 A;  3UDX A;  4DAM A;  3GTO H;  2ASB A;  1QVC A;  1XPU A;  4IFD J;  3RLF A;  3M7N A;  2ZJQ A;  1GVP A;  1PV4 A;  5LMU L;  1EUJ A;  4DV6 Q;  2A8V A;  2AKW B;  3JAM i;  4LF8 L;  2JEA I;  2VQE Q;  4IOA A;  1JJC B;  2JA6 H;  1EYG A;  4A4I A;  3PUY A;  5IY0 A;  3KYH C;  4GNX A;  1FJG L;  2JA7 G;  3GTL H;  5IYD H;  2VUM H;  4GLV B;  2E2H H;  4JI3 L;  5JJL A;  1D8L A;  4JI6 Q;  4LF7 L;  4HIO A;  3T1H L;  2VQE L;  1K8G A;  3S14 H;  2UXC Q;  3M4Q A;  3NEM A;  4O2D A;  3CCQ A;  2ID0 A;  1B7Y B;  4DV0 L;  1X3E A;  2K50 A;  1XMQ L;  2IX0 A;  4B3T L;  1JJG A;  1Q46 A;  2ZM6 Q;  5C4J H;  1PA6 A;  1S3O A;  3KF8 B;  4A3L G;  4K0K L;  2GVB A;  3S16 H;  3DLL A;  1P8L A;  4B3T Q;  4DV5 L;  3UE0 A;  4ALP A;  1P16 A;  4KLK A;  1UWV A;  1PYB A;  1Q1B A;  4P73 A;  4LW1 A;  2ZM6 L;  4A75 A;  4A3J G;  4A3M G;  1W3S A;  5HGQ A;  2Y0S G;  4A3L H;  2KCT A;  1XJV A;  3J80 i;  1OXT A;  3PSI A;  2PQA A;  1E1O A;  1YJ9 A;  3PO2 H;  1XNR L;  1CUK A;  1IBL Q;  1KXL A;  1JB7 A;  4DUY Q;  4LWC A;  1A0I A;  3PF5 A;  4IO9 A;  5C4X G;  1M90 C;  3BZK A;  2PI2 E;  3M85 A;  1C7Y A;  2RHS B;  3CCS A;  4DR2 L;  4AYB G;  1UE1 A;  4GNX B;  4LUZ A;  4BBR G;  4YY3 Q;  4YCV A;  1LYL A;  2AWO A;  2C35 B;  4UP8 A;  2ATW A;  3I4N H;  1IXR A;  1HNW L;  5JEA G;  1X9N A;  1AH9 A;  2E2I H;  3NEL A;  4DR4 L;  4DV3 L;  4HIK A;  3ULL A;  2K14 A;  4R4T A;  4GOP B;  2KBN A;  1WJJ A;  4IPD A;  2LXK A;  3H3V H;  2E5L L;  1K83 H;  5IE8 A;  4YY3 L;  3RN2 A;  4LFB L;  1UE6 A;  1I3Q H;  3UDG A;  2E8G A;  4DV5 Q;  3PIP A;  3W1G A;  2YTV A;  3PO3 G;  1SN8 A;  4WJ4 A;  5IYB H;  5GQO A;  4DKA C;  3GTG H;  2E5L Q;  3U58 A;  4LFB Q;  4A3F G;  2N8N A;  4JOI A;  2KHJ A;  4JV5 Q;  2UUA L;  3LGJ A;  2YU9 H;  1EQR A;  3HKS A;  4IPC A;  3RLO A;  5C4X H;  4DR3 L;  4A3E H;  1Y1W H;  3H0G G;  2YV5 A;  1E1T A;  3FP9 A;  4PZ8 A;  4R4I A;  4MZ9 A;  4POG A;  1MIU A;  1Y1W G;  3I4O A;  1NY4 A;  4HJ8 A;  1IZ6 A;  1M1K C;  1C9O A;  4B3S Q;  3CCR A;  4YHH L;  2K52 A;  1UE5 A;  2K5N A;  4J15 A;  4C3J H;  3K7A H;  5LMN W;  4QY7 A;  4OWW B;  4DAY B;  3CC2 A;  5H1S E;  3TRZ A;  1PVO A;  3NBH B;  1VQH A;  1CKM A;  1LUZ A;  3STB C;  3RNU A;  4C3I H;  1GM5 A;  1V9P A;  1H95 A;  3G48 A;  4A3K H;  5FLM G;  4KHP Q;  3HKZ G;  2A19 A;  1L1O C;  1L2F A;  2A1A A;  3K80 C;  5C3E G;  1Z47 A;  4LF4 Q;  4JCV E;  2VQF Q;  3S2H H;  2Z6K A;  2VY3 A;  3PO2 G;  5C0X G;  2ZJR A;  2VUM G;  5M3F G;  5IYC H;  3ICE A;  5M3M G;  2EXD A;  1A62 A;  5IP9 H;  4L5T A;  3D31 A;  1HZ9 A;  3CD6 A;  1YVC A;  1VQO A;  4A3I H;  4IFD I;  5FLM H;  3AFQ A;  4DR6 L;  4NPS A;  2UU9 L;  1G29 1;  2K5V A;  2WFW A;  3A5Z B;  3KJP A;  1PH4 A;  3S1Q H;  2JA5 H;  2D0P A;  4LF5 L;  2HQL A;  1E24 A;  5FJ8 H;  2DGY A;  4AH6 A;  1WCM H;  3KJO A;  1TWF H;  3KLW A;  4NB3 A;  1QZH A;  4APV A;  2L15 A;  2VL6 A;  1Y14 B;  1X54 A;  1Q7Y C;  4X6A H;  1YIJ A;  2UU9 Q;  4DV7 L;  1E7Z A;  1VQI A;  3U4Z A;  3CXC A;  2R6G A;  4NXN Q;  3HOW G;  1N36 L;  1MJE A;  3HOX H;  4BY1 G;  1AE3 A;  3EN2 A;  4A3M H;  4TQU S;  1K73 C;  3ER0 A;  3HFZ B;  3UE1 A;  4GS3 A;  1OXV A;  3RR5 A;  3TS0 A;  4BXX G;  2LXJ A;  4RG1 A;  2VNU D;  2WAQ E;  3KDF B;  3CCV A;  4P74 A;  2JA8 H;  2R92 H;  1A63 A;  3M9B A;  1VQA A;  1A8V A;  4A3E G;  1VQK A;  1E3P A;  1NMF A;  1VQ5 A;  4JI0 L;  3S2D H;  4QJF A;  2B63 G;  2NVT H;  1K0R A;  2OCE A;  4OO1 I;  2K4K A;  5AJ3 L;  4X64 L;  4C3H H;  1L1O B;  4DR7 Q;  4JI5 L;  4AYB E;  1IL2 A;  1KRS A;  2B3G A;  1EIY B;  2B29 A;  1L0W A;  3CCU A;  4Y52 H;  2AMC B;  4DPG A;  1PH2 A;  3PCO B;  4XIG S;  4UY8 C;  1TWA H;  4BXX H;  4JBJ A;  1HR0 Q;  3CP0 A;  1CSP A;  3GTM H;  2OQK A;  1SR3 A;  2V1C C;  3H15 A;  1CKN A;  4OWX B;  5M5X H;  4JC0 A;  1VQL A;  4DV1 L;  4LFC Q;  3W5O A;  5GAG C;  1N32 Q;  3HKZ E;  4DNI A;  2R7Z H;  2CKZ B;  3BZC A;  1WYD A;  3KOJ A;  1XNQ Q;  2ALY B;  2ZTD A;  3GTJ H;  1HJP A;  2JJQ A;  2Q2H A;  1X3G A;  3TQY A;  1G51 A;  2OTL A;  3H3V I;  2WAQ G;  1CKN B;  4LFC L;  3CCJ A;  2D62 A;  3HOV H;  2PNH A;  2RCN A;  1X55 A;  1WOC A;  5BR8 L;  1EWI A;  1N33 Q;  2RF4 A;  3VDY A;  3HOZ G;  4A93 H;  3T1Y Q;  3S1N H;  1PHJ A;  3FKI G;  3SGI A;  1JMC A;  4A3B G;  5IYC G;  1TWC H;  1I6H H;  3KF6 B;  2OWO A;  3BU2 A;  1TWH H;  2AHO B;  4HJ5 A;  4HID A;  2UUB L;  1XMO L;  3CCM A;  5C44 G;  4KI0 A;  3T1Y L;  2Q2I A;  4GKK Q;  1TWG H;  4JBW A;  3J81 i;  1IBM L;  3HOY H;  1SRO A;  1VCI A;  1YBY A;  3WWV A;  3CAM A;  3BJU A;  3PUX A;  3CMA A;  3CPW A;  1HZA A;  4BA1 I;  2LSS A;  3CF5 A;  5LMU Q;  3KDF A;  2GVA A;  1XMO Q;  2B63 H;  4DR5 Q;  1B70 B;  1KC8 C;  3E9H A;  4OWT B;  2F52 A;  4JI1 Q;  3UDI A;  2UXD Q;  1JE5 A;  3IRB A;  1KQS A;  1VQ6 A;  1C0A A;  4JI7 L;  1TXY A;  4QGU A;  5K36 G;  3ULJ A;  1VQD A;  1EQQ A;  1G6P A;  4UP7 A;  3K7U C;  3CME A;  4HJA A;  4DR5 L;  4JBM A;  1DGS A;  1E22 A;  4DV2 Q;  1X3F A;  3JAM c;  4A3B H;  1Y1V H;  4AIM A;  1R9T H;  3CPF A;  3I7F A;  4BA2 I;  2NZO A;  5GAD C;  3K81 C;  3G6E A;  1XMQ Q;  1KD1 C;  1K3R A;  2ZTE A;  4LFA Q;  1VQ7 A;  2UUB Q;  2F4V L;  2FXQ A;  4BY7 H;  4L5R C;  1VQJ A;  1BKB A;  4K0K Q;  1AE2 A;  4O0A A;  4YWM A;  1X6O A;  3OYY A;  2R7Z G;  4IOC A;  1UE7 A;  1K8A C;  3U50 C;  3UDF A;  3CCE A;  2MO0 A;  3ULP A;  1I50 H;  3PUW A;  2HHH Q;  4QIW E;  1I5F A;  5DLQ E;  3GTQ H;  1N34 Q;  3RZO H;  3F2D A;  1Y1V G;  2KCM A;  4GN5 A;  1QZG A;  4X66 L;  1IBK L;  1FGU A;  1IBL L;  4DV6 L;  4LF9 Q;  4YCU A;  2H5X A;  2CQO A;  3J80 c;  4LNQ A;  2QEX A;  4DV4 L;  2KEN A;  1QUQ B;  1PFS A;  3PUZ A;  2WP8 J;  2IHF A;  1VQF A;  1U5K A;  2N3S A;  4AQY Q;  1Q82 C;  4JI4 Q;  1PH5 A;  3HOW H;  4QL5 A;  3M4P A;  1I94 Q;  1VQE A;  2XTI A;  4IPG A;  3T1H Q;  5HY6 A;  4LFA L;  5C0X I;  2F4V Q;  4MTN A;  5GAE C;  2Q2U A;  4OXP A;  5IP7 H;  2UXC L;  1SE8 A;  2CWP A;  3ERS X;  4AQY L;  3M4O H;  3PO3 H;  4JI4 L;  4Y7N H;  3S1M H;  4IFD G;  3F2C A;  3AQQ A;  1XNR Q;  1I94 L;  2YTY A;  4DUY L;  1CKO A;  1BBW A;  5C44 H;  4A3I G;  1XTD A;  3S1R H;  1HH2 P;  1NTG A;  3HOY G;  3PF4 A;  3NEN A;  5IP7 G;  1PH6 A;  2CCZ A;  2N49 A;  1N34 L;  1EFW A;  2VS1 A;  5M3F H;  3DM3 A;  4JI3 Q;  2JA7 H;  2NN6 G;  1IBK Q;  2KHI A;  4LF9 L;  4JI6 L;  4LF7 Q;  1HNW Q;  3K8A A;  2IX1 A;  4JG2 A;  5M5W H;  5IYB G;  1N8R C;  1WCM G;  4GOP A;  3E0E A;  2YYZ A;  2Y0S E;  4DV3 Q;  4BBS H;  4IPH A;  3A5U A;  4R4O A;  2OTJ A;  1X56 A;  2IT1 A;  3A0J A;  3MXN B;  4C2M H;  3PIO A;  3AYH B;  1HR0 W;  1YNX A;  3RZD H;  2R7D A;  4R1J A;  4L5Q A;  1MKH A;  4UP9 A;  4B3S L;  4OO1 G;  3L2P A;  4YHH Q;  4JI2 Q;  4HJ7 A;  4DR2 Q;  3F8T A;  1NMG A;  2I5M X;  1YHQ A;  4B3M Q;  2I5L X;  4JOI C;  2JQO A;  1KIX A;  1SRU A;  1YHB A;  3RLN A;  2IHE A;  1O7I A;  4BBS G;  1KAW A;  2NZH A;  2Z6K C;  4DR3 Q;  1UEB A;  2UXB L;  2R93 G;  1JJ2 A;  4A3G G;  4B3M L;  3L7Z C;  4DR1 L;  2XGT A;  3CC4 A;  1J6Q A;  2VQF L;  1QVG A;  1Z9F A;  1OXU A;  3PGZ A;  3TS2 A;  4B3R L;  3CQZ H;  1D7Q A;  4GOP C;  3PUV A;  5IWA L;  4P72 A;  3S24 A;  2UXB Q;  2JA8 G;  4PMW A;  2R92 G;  1Q12 A;  2PMZ E;  2QGQ A;  1EIF A;  2ES2 A;  1LM0 A;  2N78 A;  2IY5 B;  1Q1E A;  3EBE A;  1XPR A;  1NBW A;  4WJ3 M;  4GKJ L;  4BY1 H;  2GN5 A;  3G4S A;  3GTP H;  2R7F A;  5JEA J;  5FLX c;  2QA4 A;  3RN5 A;  2UUA Q;  4B3R Q;  4UPA A;  4DR4 Q;  4JI2 L;  4L5S A;  4HJ9 A;  3FKI H;  2NVX H;  4H02 A;  3I4N G;  1LTL A;  4NXM L;  1PH8 A;  3S17 H;  2BA0 A;  5JJK A;  4YCW A;  4A3D H;  2BA1 A;  1YIT A;  3J7Z C;  1HZB A;  4GLX A;  1PH3 A;  4DR6 Q;  1VQB A;  4EX5 A;  2ZJP A;  4DR1 Q;  4HIM A;  1YHA A;  4IJH A;  3AEV A;  1HZC A;  4JI8 Q;  5IP9 G;  1FVI A;  2NVY H;  3W1B A;  1VQ9 A;  5IWA Q;  5M3M H;  4OX9 Q;  2F3I A;  4EQ5 A;  4A3J H;  1PYS B;  2JA6 G;  1K9M C;  4KHP L;  1YJN A;  4LF4 L;  1Q81 C;  4JI5 Q;  1WFQ A;  3F1Z A;  4OX9 L;  4NXN L;  4JI8 L;  1YJW A;  1VQM A;  4A3D G;  4GKJ Q;  4GN3 B;  1HNZ L;  2K5H A;  3I56 A;  5C0X J;  2MO1 A;  4GLA C;  1X65 A;  2YTX A;  3L0O A;  1SLJ A;  1HR0 L;  2UUC Q;  1NE3 A;  4QQB X;  3I4M H;  5LMN Q;  1N9W A;  2BH2 A;  5EAY A; 
#chains in the Genus database with same CATH topology
 1LTB D;  3TP7 A;  1XPO A;  1HNZ Q;  1S40 A;  1FNU A;  4QCL A;  5AJ3 Q;  3D0F A;  3S1Q B;  5DM6 3;  4XT3 B;  2NVQ B;  5E7N A;  3J81 j;  5FKA C;  3V2T A;  3BYY B;  4P75 A;  2H4O A;  4A3C H;  3E9I A;  4BS9 A;  1PDQ A;  1CSQ A;  4KMU C;  3EJI A;  4U68 A;  1EQV A;  4WOR A;  2CFM A;  2K01 A;  5EPK A;  3GTJ B;  4DR7 L;  1VQG A;  1TS2 A;  1LT6 D;  4P71 A;  4K8I A;  2F0S A;  1N36 Q;  4OO1 H;  3FHW A;  1PH9 A;  2DUD A;  4A93 G;  4LUV A;  1STA A;  1SAP A;  2NTT A;  4QB4 A;  1LV9 A;  1OTC A;  2R7Z B;  3SK8 A;  2HT1 A;  3TRE A;  1ASZ A;  2XIW A;  2NN6 H;  5IOC A;  1CK1 A;  4FYD A;  5FO8 B;  3J7A 5;  4XTC S;  5JJI A;  1ROD A;  5GRO A;  5HUR A;  1UEA B;  2FMM A;  3I90 A;  4CJ1 B;  3SXH A;  5BN4 A;  2LY7 A;  2M9V A;  3GD7 A;  2I46 A;  2EYM A;  1CI3 M;  2MPM A;  4DK3 C;  2CWA A;  2E2J H;  1FJG Q;  3HOV G;  1SMX A;  2L9H A;  4OON A;  5FJ8 G;  1LTT D;  4X66 Q;  1CFM A;  1RCV D;  1T5E A;  3A74 A;  4DV4 Q;  2AQ2 B;  3D6W A;  4KHV A;  3HOX G;  5G3L D;  1BCP C;  2EIF A;  1B8A A;  4IUN A;  3NTK A;  3PV0 A;  2PI2 A;  4FF2 A;  4QF4 A;  3UDX A;  3GTO H;  3RLF A;  3M4Y A;  5I9P A;  5IGF A;  2A8V A;  1PTO D;  2VQE Q;  3D4W A;  1B9N A;  4OHJ A;  1STG A;  3S2H B;  2NUC A;  1HUN A;  2VUM H;  4JI3 L;  4K5W A;  1TKW B;  1KAB A;  1O7Y A;  3L9A X;  1S5B D;  4DFA A;  2WII B;  3NQI A;  2VQE L;  1K8G A;  4IAL A;  5K36 H;  5DAU A;  3NK9 A;  3JAM L;  4CGY B;  4O2D A;  4DV0 L;  2IX0 A;  4H7B A;  1Q46 A;  3SK4 A;  3KBG A;  1DXM A;  3BYT B;  3UE0 A;  2WKC A;  3HOZ B;  4A3J G;  4A3L H;  4IZ8 A;  2PQA A;  2A68 D;  1YJ9 A;  3PO2 H;  2L5T A;  2NWG A;  1CUK A;  4P2C B;  1AP0 A;  4DUY Q;  3U9O A;  3GTO B;  2JA8 B;  2R92 B;  3M85 A;  2VXW A;  4K6L A;  3HZX A;  5HGT A;  2F0E A;  3A8K E;  4YY3 Q;  1WVL A;  1HNW L;  2ATW A;  5T1G A;  1LTA D;  1U9R A;  4GOP B;  2KBN A;  2KCN A;  5FO9 B;  3H3V H;  2B8F A;  2E5L L;  4YY3 L;  3RN2 A;  1JIC A;  1SYE A;  1UE6 A;  1HPC A;  1DON A;  3PIP A;  3W1G A;  5IYB H;  5GQO A;  4C1N K;  2E5L Q;  1C48 A;  1UNS A;  4M1U B;  4JOI A;  2UUA L;  2PZU A;  4MHE A;  5I9O A;  1BUV T;  4ZAI A;  4H13 C;  2YU9 H;  4IPC A;  3NBI A;  4OX9 L;  4DR3 L;  3PQI A;  1S4Z A;  1QNK A;  1MIU A;  4OEL B;  1FGB D;  2CW0 C;  1NY4 A;  2D2C C;  3A8I E;  1M1K C;  2EY5 A;  4B3S Q;  2K52 A;  1BO0 A;  1G91 A;  3RZD B;  1GUS A;  4CDE C;  1JOR A;  1EL0 A;  1PVO A;  1EIH A;  2M2L A;  1QCB D;  3RNU A;  5I6W A;  3G48 A;  4A3K H;  4KHP Q;  2P5Z X;  2A19 A;  1L2F A;  1SNQ A;  2B2V A;  4DU9 A;  1Z47 A;  1TT2 A;  4LF4 Q;  3U9S A;  2VY3 A;  5EQ0 A;  2ZJR A;  2VUM G;  3H3V C;  3I70 A;  1A15 A;  4IFD I;  3MTS A;  2B2W A;  3TZU A;  3S1Q H;  2D0P A;  4LF5 L;  1E24 A;  5FJ8 H;  2DGY A;  4HSV A;  4APV A;  1O7Z A;  1F2Z A;  5EKL A;  4BWG B;  4X6A H;  1KLU D;  3K57 A;  1E7Z A;  1VQI A;  3U4Z A;  2R6G A;  2F3W A;  1MJE A;  1O80 A;  3HOX H;  5FK9 C;  1AE3 A;  3QOL A;  3JAM E;  1K73 C;  3HFZ B;  3UE1 A;  3RR5 A;  2RDF A;  3KDF B;  4PMC A;  4P74 A;  4F7X A;  2VB3 X;  2XRS D;  3M9B A;  1A8V A;  2NVT H;  1K0R A;  1SE3 A;  2G9H D;  4JI5 L;  5J1Z A;  4IUT A;  4UY8 C;  1TWA H;  4BXX H;  4JBJ A;  1ONL A;  3OWF A;  3T51 B;  1PFN A;  3CP0 A;  3NSW A;  1KNE A;  3S14 B;  2V1C C;  1CKN A;  4MIU A;  4JC0 A;  3GQB A;  5G3L F;  3W5O A;  1N32 Q;  1D5Z C;  1AFP A;  2CKZ B;  1XNQ Q;  3P1H A;  2EJM A;  2KUM A;  4KY6 A;  2QDB A;  1X3G A;  3H3V I;  4X3S A;  2OTL A;  1CKN B;  3CCJ A;  3O13 A;  3HOV H;  1CT1 D;  1EWI A;  2RF4 A;  3VDY A;  4DAP A;  3T1Y Q;  3S1N H;  3SGI A;  5CR3 A;  2MHV A;  4NP5 A;  5KNC A;  3KF6 B;  2OWO A;  5EPJ A;  1XMO L;  3CCM A;  4V0B A;  1EEI D;  4KI0 A;  3T1Y L;  2Q2I A;  3VR2 A;  4JBW A;  1GXD C;  2PNR C;  1EZ8 A;  1CM9 A;  3CAM A;  3BJU A;  1MGS A;  3TP6 A;  1I6H B;  5LMU Q;  3KDF A;  1XMO Q;  2EYJ A;  4C3J G;  1B70 B;  1KC8 C;  2F52 A;  1GUG A;  1HQM C;  4EQP A;  4F87 A;  4JI1 Q;  1WTH A;  2PW5 A;  1B44 D;  1VQ6 A;  4JI7 L;  1TXY A;  5D3D A;  4QGU A;  4CDF C;  1BXT A;  1VQD A;  1EQQ A;  4B9W A;  5ELB A;  4UP7 A;  4XYQ A;  3OMC A;  1X3F A;  1RD9 D;  4DA2 A;  3JAM c;  4BA2 I;  2NZO A;  1GUN A;  3CRL C;  3C46 A;  3G6E A;  4HSP A;  2UUB Q;  1JR0 D;  2FXQ A;  4HN7 A;  2QW7 A;  4L5R C;  1VQJ A;  1G2S A;  3NTH A;  4YWM A;  1XTC D;  2R7Z G;  4IOC A;  3GTQ B;  1K8A C;  3CCE A;  3QO2 A;  5DLQ E;  1I5F A;  2HHH Q;  2D5D A;  3F2D A;  1IBK L;  4LF9 Q;  1IBL L;  4A3D B;  2F0N A;  3DXJ C;  2IHF A;  4AQY Q;  1U5K A;  4JI4 Q;  4QL5 A;  1WTV A;  1S5D D;  1I4Q A;  5KGU A;  1EWH A;  1S5C D;  5C0X I;  2QEJ C;  3QIA A;  4MTN A;  3GTM B;  2CWP A;  4AQY L;  2JA6 B;  2SNM A;  3PO3 H;  4JI4 L;  1SYG A;  2YTY A;  1SE4 A;  2K1B A;  4KV6 A;  4X3U A;  3UI2 A;  4A3G B;  5IP7 G;  2CCZ A;  4ZUI A;  1WTX A;  3DM3 A;  1SND A;  2NN6 G;  4RAU C;  4LF7 Q;  5M5W H;  5IYB G;  2B2T C;  2K03 A;  4RKB A;  3LX0 A;  2SOB A;  1B4O A;  2A6H D;  2Y0S E;  4CJ2 C;  4DV3 Q;  1ZYR C;  3A5U A;  2E74 C;  4C2M H;  2JYO A;  3AYH B;  1E2Z A;  2R7D A;  1MI2 A;  2RBM A;  4R1J A;  4UP9 A;  4XDX A;  4DR2 Q;  3F8T A;  2I5L X;  2L0C A;  3S1R B;  3GV6 A;  4A3G G;  3L7Z C;  4DR1 L;  2L55 A;  3CC4 A;  2EZV A;  5M3M B;  4WRD A;  4F88 A;  1Z9F A;  4HMI A;  4FXD A;  1IW7 C;  2RCF A;  3CQZ H;  3S24 A;  5DEH A;  5CV9 A;  4PMW A;  1Q12 A;  2QGQ A;  1EIF A;  2ES2 A;  5IGE A;  1E2W A;  5C4X B;  1K83 B;  2F3V A;  5JEA J;  3RN5 A;  4DR4 Q;  4JI2 L;  4A3J B;  4OGQ C;  2AUJ D;  4Q5V A;  2NVX H;  2MP1 A;  4YCW A;  4A3D H;  2R61 A;  3R93 A;  1STH A;  2F0W A;  2LKV A;  3K6O A;  2R93 B;  3Q22 A;  2G5D A;  4EX5 A;  5EPL A;  2ZJP A;  2RSN A;  3T56 B;  5IP9 G;  2ZT9 C;  5M3M H;  5IWA Q;  4EQ5 A;  3SHL A;  2F0F A;  3DHQ A;  1F77 A;  1NCV A;  1OO9 B;  4GKJ Q;  4A3D G;  4GN3 B;  3MEH A;  4A3M B;  4DAV A;  3S16 B;  5C0X J;  1HTL D;  2UUC Q;  2NVT B;  2YTX A;  3L0O A;  5LMN Q;  2K33 A;  1FL0 A;  2JEB I;  3NXW A;  2GA4 B;  1F9P A;  1YEZ A;  3I55 A;  4YIJ A;  2UUC L;  1QJO A;  1YI2 A;  1YZ6 A;  1HUM A;  5LMN L;  4IFD H;  3HOU H;  4CDD C;  2QKI C;  1M8A A;  3CW2 C;  5AFW A;  1HNX L;  4CKC A;  2PW7 A;  4O1N A;  3KF8 A;  1IL8 A;  2RDH A;  1KL9 A;  4RA8 A;  4LUO A;  1HNX Q;  4MNO A;  3A55 A;  2B2Y C;  4IUQ A;  4B08 A;  4QMG A;  2NYZ D;  2JA9 A;  2PZW A;  4RMF A;  3BDL A;  3DEO A;  5BR8 Q;  1N33 L;  1TR5 A;  2NVQ H;  2MFI A;  2Z4H A;  4R4Q A;  4G7H C;  1KRT A;  5JPM C;  3FEW X;  5IT9 c;  1GKH A;  2WB1 E;  4HTH A;  1D5M C;  1LTI D;  1T9H A;  2CVR A;  3FPU B;  3J7Y W;  3HOU G;  4B9X A;  5C3E H;  4IUR A;  4RKL A;  4FF4 A;  4IJL A;  1EOV A;  1VQN A;  3J81 L;  3I2Z A;  4DV1 Q;  1AW7 A;  2NVX B;  4J8Q A;  3GTK H;  3J7A F;  1H9M A;  4WJW A;  1ASY A;  1EU3 A;  1Z7T A;  1HA5 A;  1NJI C;  2OQ0 A;  1STB A;  4LF6 Q;  1I3Q B;  4KK7 A;  1G2T A;  3B6Y A;  2Q8I B;  2JK8 A;  4YWL A;  2Q2T A;  1DOM A;  1MJC A;  2UXD L;  1BBU A;  4DV0 Q;  1LTG D;  1C8C A;  1U0L A;  4K2K A;  1KHI A;  1LT4 D;  4A3G H;  3AFP A;  2D9U A;  5ELN A;  4GKK L;  5DNF A;  2HQE A;  2KED A;  4IFD J;  2ZJQ A;  1GVP A;  3SDZ A;  2AKW B;  2VUM B;  5K5P A;  1JJC B;  3PUY A;  3GTL H;  1ILQ A;  5IYD H;  1Z6H A;  4OEM B;  2K05 A;  1IKL A;  5EKI A;  3T1H L;  1WTQ A;  2K5D A;  3HGB A;  2K32 A;  1QWY A;  2E2H B;  1UAP A;  1JWU D;  2K50 A;  1XMQ L;  3SE0 A;  1JJG A;  3WDN A;  4J6H A;  4X3K A;  1PA6 A;  3KF8 B;  5ISR A;  1GHJ A;  4K0K L;  1MBY A;  1Y1W B;  1P8L A;  2EDG A;  4ALP A;  3FRP B;  1JWM D;  4KLK A;  1UWV A;  4P73 A;  2CW0 D;  1W3S A;  1MD2 D;  2Y0S G;  3NPP A;  3J80 i;  3J80 E;  2E2D C;  5BN3 A;  3PF5 A;  4TRD A;  1C7Y A;  4AYB G;  4GNX B;  4LUZ A;  2K6A A;  3VR5 A;  1LYL A;  2AWO A;  1F9R A;  5JEA G;  1H9S A;  1X9N A;  4H0L C;  3NEL A;  4HIK A;  3ULL A;  5I2X A;  1C4Q A;  1WJJ A;  2LXK A;  3VYS A;  4A3B B;  4QIW B;  2ENB A;  4DV5 Q;  5FO7 B;  2E2J B;  5E4X A;  3PO3 G;  2EYP A;  4A3F G;  1EEF D;  2KHJ A;  2WKD A;  1RDP D;  3ND8 A;  3BDC A;  3LGJ A;  4A3E H;  3HOY H;  1Y1W H;  1E1T A;  4KKT A;  2MUY A;  4R4I A;  3S17 B;  2PO4 A;  4HJ8 A;  2RDG A;  3DM1 A;  1IZ6 A;  3CCR A;  1BCP B;  4YHH L;  1UE5 A;  3D6C A;  3CC2 A;  5H1S E;  1CTM A;  1QE6 A;  4C3I H;  1V9P A;  4X3T A;  5CV6 A;  1Y69 U;  3AB9 A;  3HKZ G;  3OMG A;  1L1O C;  2A1A A;  3CQZ B;  3GV3 A;  5C3E G;  4JCV E;  1AZP A;  1K8O A;  3ICE A;  3CKI B;  2F0M A;  4L5T A;  1HZ9 A;  4A3I H;  1CZG A;  2UU9 L;  3A5Z B;  1PFM A;  5M9O A;  2HQL A;  1JE4 A;  1A3U A;  3KLW A;  3QJY A;  4NB3 A;  2L15 A;  3HOX B;  1Y14 B;  1Q7Y C;  2UU9 Q;  3BVM A;  3SK6 A;  4DV7 L;  4UAI A;  4ZYS A;  4NXN Q;  3HOW G;  2KEC A;  3N6R A;  3NTI A;  3EN2 A;  4KY7 A;  3ER0 A;  4ME5 A;  1OXV A;  4BXX G;  3TS0 A;  2JA8 H;  4I7A A;  2R92 H;  5C4X G;  1QNU A;  1VQA A;  1VQK A;  1NMF A;  1VQ5 A;  3A8J E;  4QJF A;  2B63 G;  4CHT B;  2K4K A;  2A74 C;  5AJ3 L;  4X64 L;  4C3H H;  4FF1 A;  1IYU A;  4AYB E;  1KRS A;  2B3G A;  3KLS A;  2B29 A;  5JVH 3;  5TSS A;  3CCU A;  2AMC B;  4DPG A;  1PH2 A;  3PCO B;  4XIG S;  3H94 A;  4EQN A;  1ZYR D;  5KNB A;  1CSP A;  3GTM H;  4BBR B;  1J8I A;  5M5X H;  2TMP A;  4LFC Q;  4DN4 M;  1WYD A;  4K5X A;  3F2U A;  4TKO B;  2ALY B;  2ZTD A;  1L0Y B;  1TWG B;  3IFD A;  4EVO A;  2JJQ A;  3AMU A;  3D8G A;  1G51 A;  2C9O A;  3BDO A;  4OIJ A;  4LFC L;  1TS5 A;  1D5X C;  1Q3L A;  1X55 A;  3V96 A;  3SEB A;  1TWC B;  2DN8 A;  3CHB D;  2Y0S B;  1PHJ A;  3FKI G;  1D2B A;  3GTP B;  5IYC G;  4HID A;  2UUB L;  4ZCK A;  5BN5 A;  1B1Z A;  4BBS B;  1GOZ A;  1TWG H;  3VR3 A;  1PZI D;  3J81 i;  1SRO A;  1VCI A;  4AYB B;  1K0S A;  5D14 A;  4BA1 I;  1STE A;  5IT9 L;  5M5X B;  4FVM A;  3DWP A;  1Y8O B;  3VR4 A;  2Z8L A;  5CV7 A;  4U67 3;  4MN3 A;  1TS3 A;  1MSH A;  1BCP F;  1Y1V H;  2DNC A;  1LO5 D;  1BBX C;  3NUC A;  1KD1 C;  2ZTE A;  2NVY B;  2Z9H A;  3OIP A;  1I6V C;  3VR6 A;  4IUU A;  2PCF B;  3U50 C;  5J22 A;  2HUG A;  4QIW E;  4ULL A;  3RZO H;  3QR8 A;  1SJE D;  1U4P A;  1Y1V G;  2KCM A;  4GN5 A;  4X66 L;  3A7A B;  5JVG 3;  1M4V A;  2F0J A;  2KEE A;  4YCU A;  3WOE A;  3J80 c;  2QEX A;  4DV4 L;  3PUZ A;  2B8G A;  2O4X A;  3K5M A;  2N3S A;  1Q82 C;  1SFO B;  3M4P A;  2XTI A;  4IPG A;  2WIN B;  2F4V Q;  1MSG A;  5GAE C;  2Q2U A;  4KKU A;  5IP7 H;  1SE8 A;  1B3Q A;  3AQQ A;  1XNR Q;  4CDC C;  4C3I B;  3FMC A;  4A3I G;  3S1R H;  1HH2 P;  1NTG A;  3NEN A;  1I50 B;  1F2L A;  1ICW A;  1EFW A;  4JI3 Q;  5M3F H;  3PIP 3;  2KHI A;  4JG2 A;  3E0E A;  3I72 A;  5IGG A;  4C2M B;  4IPH A;  1LTS D;  3X3N A;  2OTJ A;  1X56 A;  2IT1 A;  2XNA C;  2EYH A;  2DY8 A;  1JOO A;  2CH4 A;  4XQJ A;  2RA4 A;  1HR0 W;  1YNX A;  1SYF A;  4L5Q A;  4UDU C;  1KNA A;  1NR2 A;  3GTK B;  4JI2 Q;  1FNW A;  4KKS A;  4JOI C;  2JQO A;  3WOF A;  4PV1 C;  3RLN A;  2IHE A;  4C3I G;  2EVB A;  4A3I B;  2HDM A;  1UEB A;  2BE5 D;  1H9R A;  1VMC A;  2XGT A;  1J6Q A;  1SNO A;  2VQF L;  3E6Z X;  1FNV A;  4DNT B;  1OXU A;  1PYW D;  3TS2 A;  3PUV A;  5IWA L;  4P72 A;  2JA8 G;  2HD3 A;  2L11 A;  2R92 G;  1SXT A;  1LM0 A;  2QDL A;  1NBW A;  3R3O A;  2FMC A;  4GKJ L;  1JOQ A;  2DJG C;  2R7F A;  5FLX c;  2UUA Q;  3ONA B;  2FHT A;  1PRT D;  1Y8N B;  3FKI H;  1WD0 A;  4H02 A;  3J81 E;  1PH8 A;  1NAP A;  1T5X D;  2F0I A;  1ESF A;  3HRZ C;  3S17 H;  3MXP A;  1BR9 A;  1YIT A;  1HFG A;  4GLX A;  4DR6 Q;  2PZT A;  2XN9 C;  3R2T A;  1YHA A;  4JI8 Q;  2G9D A;  2NVY H;  4OX9 Q;  2F3I A;  1PYS B;  3N52 A;  1K9M C;  4KHP L;  1YNJ D;  2H1E A;  4LF4 L;  1Q81 C;  3TME A;  4JI8 L;  1VQM A;  5ELD A;  1EU4 A;  3E3X A;  1AZQ A;  2BDN A;  2MO1 A;  3ERQ A;  1X65 A;  1HR0 L;  4QQB X;  1BOS A;  1NE3 A;  3NHH A;  3ZYY X;  1N9W A;  4NXM Q;  2KCC A;  4HED A;  2BH2 A;  2O5I C;  2ZTC A;  3KFU A;  4LF5 Q;  2A73 B;  2I5H A;  5IGB A;  4JI0 Q;  4JV5 L;  4LJZ C;  2F0K A;  1V1Q A;  3EFX D;  2WB1 G;  2PQA B;  1VQP A;  2CQA A;  4PZ7 A;  1EY4 A;  3H0G H;  1Q8K A;  3Q6S A;  1QUQ A;  1PRT C;  1JC7 A;  1STY A;  5LHY 1;  5M5Y H;  1SYD A;  3MEF A;  3OW2 A;  3P7J A;  5E4W C;  3A54 A;  2JA7 B;  4KJO A;  3CCL A;  3H91 A;  5C44 B;  1LTR D;  1GHK A;  3Q0A A;  3A7L A;  4ODG A;  1BVS A;  1IBM Q;  1QVF A;  4A76 A;  1TY0 A;  3K5L A;  1CHP D;  4M8A A;  1SYC A;  4N8X 1;  2FIN B;  5FLX E;  4YWK A;  1GO3 E;  3OTO Q;  3PMF A;  3T13 A;  3CC7 A;  1TS4 A;  2Z0S A;  5EBD A;  3DMU A;  4BBR H;  4DUZ Q;  4LF6 L;  3T16 A;  3G71 A;  4PMB A;  4KHZ A;  2IX3 A;  3J81 c;  1TWA B;  4BY7 G;  1V43 A;  1Q86 C;  1KLG D;  1XNQ L;  3KLS X;  4DV2 L;  3DWA A;  3GTG B;  2VW9 A;  1PH7 A;  2SNS A;  1PXU A;  1OXX K;  3GO5 A;  5IGC A;  2IL8 A;  4JK1 C;  1CA5 A;  1KTK A;  3EIV A;  5C4Z A;  3C1F A;  4X65 Q;  4JYA L;  2BE5 C;  4TVA B;  4NDX A;  2FJ2 A;  1VQC A;  3ITP A;  3Q8D A;  2BH8 A;  3KBX A;  5EBC A;  4GNX C;  4R4C A;  4X65 L;  4JYA Q;  3TP8 A;  1VDZ A;  4RGM A;  1F9Q A;  2JA5 G;  4EGV A;  1SJH D;  2M00 A;  2NTS A;  3I3C A;  1VF7 A;  2MNA A;  2F0Q A;  3GDE A;  4DK6 C;  3TBI B;  5IYD G;  4DK1 A;  4JBK A;  5C6A A;  2A68 C;  3QWN A;  1W2B A;  1QIL A;  1FYC A;  1TQO A;  4N9T A;  2JE6 I;  2ZXO A;  1QVC A;  3K5O A;  1XPU A;  3FPP A;  3VYR A;  5LMU L;  4A3K B;  4DV6 Q;  3JAM i;  2JEA I;  2JA6 H;  4A4I A;  4DF7 A;  1E2V A;  1Q8I A;  5JJL A;  3Q23 A;  4GLV B;  1KDB A;  4DK0 A;  1D8L A;  3MHB A;  4XXE A;  4JI6 Q;  4HIO A;  1I4R A;  2PQE A;  1SNP A;  2B2W C;  4JW0 A;  2UXC Q;  1SSO A;  3M4Q A;  1LT5 D;  4DXF A;  4Y7N B;  5FOB B;  3S1M B;  3NEM A;  3CCQ A;  1WTW A;  3S15 B;  2QCP X;  5C4J H;  4A3L G;  1S3O A;  1SBB B;  5CGK A;  2GVB A;  3S16 H;  3DLL A;  2CH4 W;  5C5M A;  4DV5 L;  3PO3 B;  4A3M G;  1Q1B A;  2BDO A;  5HGQ A;  2KCT A;  1FD7 D;  1OXT A;  4KY5 A;  3PSI A;  1E1O A;  1A6X A;  1KXL A;  1IBL Q;  4ZUJ A;  3HOW B;  4RHS A;  3HOU B;  3BZK A;  2PI2 E;  5LL6 X;  2RHS B;  3CCS A;  3MZ5 A;  2AQ3 B;  3PIO 3;  4YCV A;  1NSN S;  4UP8 A;  3R8B A;  4BY7 B;  2VB2 X;  4G4K A;  1AH9 A;  2E2I H;  3KUP A;  4ZKB B;  4DV3 L;  2IPK D;  2K14 A;  4R4T A;  1K83 H;  3IKJ A;  4LFB L;  2NBF A;  2LFN A;  1SN8 A;  4WJ4 A;  2K04 A;  3GTG H;  3FKI B;  1EY0 A;  4LFB Q;  1B53 A;  2B39 A;  3TP5 A;  2WV6 D;  4I65 A;  2R93 H;  1EQR A;  3RLO A;  2A6E C;  3H6M A;  1EY7 A;  4PZ8 A;  2EYO A;  1D1K A;  4HMJ A;  1Y1W G;  4H44 C;  1WD1 A;  3I4O A;  4QUC A;  1C9O A;  2HCI A;  1R4P B;  1J9O A;  2K5N A;  4J15 A;  1SNM A;  4IN3 A;  4QY7 A;  4DAY B;  1EZ6 A;  3TRZ A;  1ICF B;  3NBH B;  1A3T A;  1EYD A;  1CKM A;  1LUZ A;  3STB C;  1AEX A;  3K5N A;  2XRQ D;  1XX8 A;  1KAA A;  3EVQ A;  3S2H H;  1ZXT A;  3PO2 G;  5C0X G;  5M5Y B;  5IYC H;  5M3M G;  2EXD A;  1CHQ D;  5IP9 H;  3D31 A;  5JJZ A;  1YVC A;  5FLM H;  1DOK A;  4NPS A;  1G29 1;  3D4R A;  1WTO A;  1A2U A;  3KLR A;  4TSS A;  2JA5 H;  1SDF A;  2SDF A;  3URY A;  1WCM H;  3M4O B;  1RTN A;  5FLX L;  1X3Q A;  1W6K A;  2VL6 A;  1X54 A;  3W2D A;  1YIJ A;  2V4D A;  1N36 L;  1DM0 B;  1VF5 C;  4TQU S;  2LXJ A;  3LNN A;  2WAQ E;  1E0B A;  1TY2 A;  2FFK B;  2WAQ B;  1A63 A;  5DM7 3;  1JWS D;  4PNY A;  2OCE A;  5C4J B;  3NP8 A;  1H9J A;  1L1O B;  2IW3 A;  4DR7 Q;  2EE1 A;  5C3W A;  5CMD A;  1L0W A;  5KEE A;  2OEO A;  1EFI D;  5EKK A;  2F0P A;  2RVL A;  3RZO B;  1PLF A;  3OSO A;  1SR3 A;  3H15 A;  5NUC A;  5GAG C;  1JCK B;  4DNI A;  2R7Z H;  4FP5 D;  4RGO S;  5KRU A;  1TWF B;  3GTJ H;  2Q2H A;  1ZEQ X;  3TQY A;  1QOH A;  2J0T D;  2D62 A;  5CV8 A;  2RCN A;  5IOD A;  1SMY D;  1WOC A;  5BR8 L;  1N33 Q;  3HOZ G;  4A93 H;  4A3C G;  4L63 B;  2O2L D;  5I4D A;  4RCO A;  1TWC H;  4FO2 A;  1I6H H;  3D4D A;  4HJ5 A;  3WWV A;  3CPW A;  4K5V A;  4A3F B;  2F0T A;  4I7Z C;  4EQO A;  4DR5 Q;  2DJF C;  4OWT B;  1LT3 D;  5CC4 A;  3UDI A;  2RSO A;  3IRB A;  1KQS A;  1C0A A;  1GUT A;  3ULJ A;  1ZKO A;  3K7U C;  4HJA A;  4DR5 L;  4JBM A;  4AIM A;  1L0X B;  2WAC A;  3I7F A;  4HR7 B;  3R2I A;  3VA7 A;  3K81 C;  1VQ7 A;  2F4V L;  4FF3 A;  1ENC A;  2AQ1 B;  1BKB A;  3M7G A;  4R8I A;  4O0A A;  3EA6 A;  1K3B C;  3OYY A;  3ULP A;  1I50 H;  1RF2 D;  1XXG A;  2L1B A;  2JXM B;  3HS0 C;  2H5X A;  2CQO A;  4LNQ A;  1QUQ B;  1RHP A;  1PFS A;  5E3F A;  1VQF A;  2L12 A;  1I94 Q;  3PO2 B;  1CQF A;  3T1H Q;  3FDT A;  4LFA L;  1EIG A;  2F0U A;  4OXP A;  1IKM A;  1I4G A;  4Y7N H;  2B2V C;  3S1M H;  4IFD G;  3HG9 A;  1I94 L;  4CJ0 B;  5KND A;  1CKO A;  4DUY L;  2ICI A;  2Q8R E;  2X69 A;  3PF4 A;  1PH6 A;  2N49 A;  1N34 L;  2JA7 H;  2VS1 A;  4ZKC B;  3M3Y B;  1HNW Q;  1DCZ A;  1HXY D;  1N8R C;  4G57 A;  1WCM G;  3H0G B;  3T53 B;  2WB1 B;  1S5E D;  3A0J A;  3MXN B;  1SEB D;  3PIO A;  3RZD H;  4B3S L;  4OO1 G;  1YHQ A;  1NMG A;  2I5M X;  4B3M Q;  3OHX C;  1YNJ C;  1II3 A;  1KIX A;  3IFT A;  4LMQ D;  1O7I A;  4BBS G;  2Z6K C;  4DR3 Q;  2UXB L;  2R93 G;  1B50 A;  4C3H G;  3BG3 A;  3I8Z A;  4B3M L;  2L4N A;  3A56 A;  1JB3 A;  2XVS A;  4NW2 A;  5A2Q L;  3CU7 A;  4B3R L;  3MFG A;  1X32 A;  2F0D A;  2X6L A;  2UXB Q;  2PMZ E;  3QOJ A;  2PMZ B;  2EYL A;  2IY5 B;  3EBE A;  2XWJ B;  1XPR A;  4WJ3 M;  4A3E B;  5CBA E;  4BY1 H;  3GTP H;  3T4A C;  2QA4 A;  4B3R Q;  3OOC A;  1DD2 A;  4MTK A;  3KK7 A;  1PTO F;  3X3M A;  1FR3 A;  3TSS A;  4NXM L;  1WTR A;  3C2P A;  4FXK C;  4HCS A;  1UUP A;  3QG1 A;  4O42 A;  1PH3 A;  1V1P A;  4LK1 C;  2YU9 B;  1VQB A;  5A35 A;  1EWC A;  4ZLT F;  4V19 0;  4OIK A;  1HZC A;  1FVI A;  4KD3 A;  1VQ9 A;  1V8Q A;  4A3J H;  4UHV A;  2JA6 G;  3VYU A;  1YJN A;  5IIF A;  4JI5 Q;  4RHR A;  2K28 A;  3F1Z A;  3D3R A;  1YJW A;  4JPB W;  2K5H A;  4S3S A;  4GLA C;  1LAB A;  2EJF C;  5J39 A;  1R9T B;  5M5W B;  3TN2 A;  4X62 L;  3U4V A;  5CV4 A;  3KF6 A;  1B3A A;  5JPN C;  3MVV A;  2I0Q A;  2AWN A;  3OTO L;  4DUZ L;  2O5J C;  1U4L A;  4X62 Q;  1KDA A;  2K7V A;  4DNR B;  2K75 A;  3MWY W;  4A3F H;  4XT1 B;  3M3Y H;  4IQZ A;  1J5E Q;  1GD7 A;  2RHQ B;  1OXS C;  3HEJ A;  4FDB A;  1EY8 A;  1EYC A;  2JA5 B;  3MC0 B;  5EGT A;  2EQS A;  2EY6 A;  2HIV A;  1GJX A;  3I73 A;  1Y8P B;  1SFO H;  1TWH B;  3NE5 B;  3EQL C;  1N32 L;  1J5E L;  1PMR A;  3VYT A;  4DV7 Q;  1S72 A;  1BCP D;  4POF A;  5M3F B;  2KOL A;  4KTA A;  1IYJ B;  3ZJY C;  1JT8 A;  2D0O A;  4JI1 L;  2F0G A;  4A3K G;  1KDC A;  4JI7 Q;  1HQR D;  3TEH B;  1U4R A;  4ME3 A;  4PZ6 A;  2E2I B;  2VZA A;  4X64 Q;  3JC6 6;  5IT9 E;  1ESR A;  1WI5 A;  5ELF A;  2NN6 I;  1RIP A;  2QIL A;  4E6I A;  1QG7 A;  2MQH A;  4FXG C;  3P20 A;  3S2D B;  4ABN A;  4GN4 B;  5CV5 A;  1O7L A;  4GZY C;  3RUZ A;  3RMH A;  2HCC A;  2EY1 A;  3L3O C;  1V1O A;  1IW7 D;  1RL2 A;  1VS0 A;  1VQ4 A;  3SR1 A;  1EOT A;  2HHH L;  1Y1V B;  3K0X A;  4R8N A;  1PH1 A;  1G6Z A;  1DZ1 A;  1L1O A;  3STB D;  5ELO A;  2OF1 A;  4G7O C;  4ZRZ A;  5GAH C;  3MXU A;  1HHV A;  5J3B A;  3S15 H;  1EY5 A;  2PPB C;  3I4M G;  5EJW A;  4WFN 3;  1VQ8 A;  4LF8 Q;  3HOZ H;  1CQV A;  2HIX A;  3DWQ A;  3F2B A;  3E5S A;  4PG3 A;  4DAM A;  2ASB A;  2B2U A;  2K5Q A;  3M7N A;  1HRJ A;  1PV4 A;  3E0J A;  1H9S B;  1EUJ A;  4LF8 L;  3C1E A;  4IOA A;  3NQT A;  1EYG A;  4G7Z C;  5IY0 A;  1ILP A;  3KYH C;  4GNX A;  1FJG L;  2I07 B;  2JA7 G;  1PTO H;  2E2H H;  1HCZ A;  4LF7 L;  3G7L A;  2PYK A;  3S14 H;  2RKS A;  3CRK C;  1RJT A;  4K2L A;  1PRT B;  1B7Y B;  2ID0 A;  1X3E A;  4ILW A;  2A5H A;  3J80 L;  4B3T L;  3I4M B;  2ZM6 Q;  4R9W A;  1ET6 A;  2EYF A;  3HOV B;  3LWU A;  4B3T Q;  2B2T A;  5I6Y A;  1P16 A;  1PYB A;  2ZM6 L;  3DEP A;  4LW1 A;  4N8F A;  4A75 A;  2SEB D;  3OWE B;  1XJV A;  4L8J A;  4CKB A;  3NWT A;  1XNR L;  3RD4 A;  2NB0 A;  1JB7 A;  4LWC A;  4ZQ3 A;  1A0I A;  2X6G A;  4IO9 A;  1M90 C;  1JQY D;  1I4X A;  2ZXR A;  1STN A;  5C3E B;  4DR2 L;  1PZJ D;  1EQT A;  1UE1 A;  4BBR G;  3NWS A;  2C35 B;  3I4N H;  1IXR A;  4RH6 A;  3ND9 A;  1I4P A;  3QB3 A;  4DR4 L;  2Z1C A;  5JEA H;  4IPD A;  5IE8 A;  5JOB A;  1I3Q H;  3UDG A;  2E8G A;  2YTV A;  2Q8T A;  3HKZ B;  3MA2 B;  4KN4 C;  4DKA C;  1V1P B;  3U58 A;  4JVZ A;  5A2Q E;  1ENA A;  2N8N A;  5CBE E;  4RWS C;  4F8M A;  2XSC A;  3HKS A;  5C4X H;  4Z9C B;  3H0G G;  1DOL A;  1ET9 A;  2YV5 A;  3FP9 A;  4K8J A;  4MZ9 A;  4POG A;  2TSS A;  1D6E C;  1G8Z D;  3I91 A;  3K58 A;  1CA6 A;  1GUO A;  3HOY B;  5IGD A;  4C3J H;  3K7A H;  4OL7 A;  3S9W A;  1PTO B;  5LMN W;  4OWW B;  1TU2 B;  1VQH A;  4N9P A;  4RFB A;  1GM5 A;  1H95 A;  1BQQ T;  3LWE A;  5FLM G;  3VA5 A;  3K80 C;  5E1F A;  2KHS A;  2VQF Q;  2Z6K A;  5M3F G;  4CBV A;  1A62 A;  5COY A;  1A3V A;  3DUZ A;  3CD6 A;  1VQO A;  4DR6 L;  3AFQ A;  4DXG A;  2K5V A;  2WFW A;  3KJP A;  1PH4 A;  2ZXP A;  2K5W A;  1D1I A;  1PTO C;  4AH6 A;  3KJO A;  1TWF H;  4CKE A;  1QZH A;  3MXN A;  4C56 C;  1NNX A;  4C3H B;  4Q0F A;  3CXC A;  4BY1 G;  2E76 C;  4A3M H;  2XWB B;  4ID6 A;  4KN7 C;  2LS0 1;  4GS3 A;  4KJN A;  1PFB A;  2EOT A;  4RG1 A;  2VNU D;  3CCV A;  3MFY A;  5LL6 S;  3BS1 A;  3W3A A;  1PRT F;  1XWE A;  3AU7 A;  4A3E G;  5ELE A;  4JI0 L;  4HCE A;  1E3P A;  3S2D H;  4JV5 Q;  4OO1 I;  4J1M A;  1XYI A;  1RKN A;  2KA7 A;  1IL2 A;  2E75 C;  1EIY B;  1K8M A;  3HP3 A;  4Y52 H;  1WCM B;  1HA6 A;  4RGT A;  2CHB D;  2A6H C;  1X3P A;  1HR0 Q;  5T1I A;  5C3X A;  2OQK A;  4RGN A;  4NKL A;  2EXZ A;  1U4M A;  4OWX B;  3K7A B;  1VQL A;  4DV1 L;  1LAC A;  3HKZ E;  3GTL B;  3BZC A;  3KOJ A;  4IUV A;  1HJP A;  2DNE A;  2QF7 A;  4XYO A;  2WAQ G;  4IUP A;  2PNH A;  1F2Y A;  5JAV A;  5KYI A;  2B63 B;  3FVQ A;  1HTP A;  1JMC A;  4A3B G;  1AN8 A;  5C5L A;  2F0V A;  1CZW A;  3BU2 A;  1TWH H;  2AHO B;  4LAA A;  1H9K A;  5C44 G;  2F1M A;  4GKK Q;  5L37 A;  1IBM L;  1ENF A;  1K28 A;  1YBY A;  3PUX A;  5KIX A;  3CMA A;  1WTP A;  3SK5 A;  1EY9 A;  1HZA A;  1SYB A;  2LSS A;  5ELC A;  3CF5 A;  1RTO A;  2GVA A;  1IYV A;  2HDL A;  2B63 H;  1W6J A;  3E9H A;  2A6E D;  4A93 B;  4C1N I;  2UXD Q;  1JE5 A;  2F4I A;  1QB5 D;  4K6D A;  5K36 G;  1G6P A;  3CME A;  1DGS A;  1E22 A;  4DV2 Q;  1TII D;  5D65 A;  4A3B H;  1R9T H;  3CPF A;  3J7A V;  5GAD C;  3OPO A;  1NUC A;  1ML0 D;  1XMQ Q;  1K3R A;  2BCO A;  4LFA Q;  4HAE A;  1VMP A;  5F2D A;  4BY7 H;  3H09 A;  1EYA A;  3SVM A;  2KVM A;  2R3Z A;  5I2Y A;  3TDQ A;  4K0K Q;  1AE2 A;  1IHZ A;  2OT2 A;  2A69 C;  1SMY C;  1X6O A;  2F03 A;  1UE7 A;  3UDF A;  3ERO A;  3MXG A;  2MO0 A;  4XQN A;  3PUW A;  2KQ3 A;  3OW7 A;  1YNN C;  4DGZ A;  3GTQ H;  1N34 Q;  2IWH A;  3I4N B;  1QZG A;  3BVZ A;  1DJR D;  1FGU A;  4DV6 L;  1F2M A;  2KEN A;  2WP8 J;  3C3L A;  1PZK D;  2LMC B;  1PH5 A;  3HOW H;  1VQE A;  2NZ1 D;  2MGS A;  5HY6 A;  1DYQ A;  4BY1 B;  2UXC L;  3ERS X;  3BZD B;  3M4O H;  1O78 A;  3F2C A;  1HFN A;  5D3I B;  1BBW A;  2B2Y A;  5C44 H;  1XTD A;  3K0Y A;  3HOY G;  1R4Q B;  2BOS A;  1IBK Q;  3IL8 A;  4JI6 L;  4LF9 L;  3K8A A;  2IX1 A;  3G6J B;  1A2T A;  4GOP A;  1F9S A;  1B9M A;  1TVX A;  2KJX A;  1NR4 A;  2YYZ A;  4BBS H;  2IJ0 A;  2Z4I A;  2F0H A;  4R4O A;  3MAQ A;  5CYU A;  4C3J B;  1YNN D;  1MKH A;  3L2P A;  4YHH Q;  2N55 A;  4HJ7 A;  3IAY A;  2F0O A;  4PQX A;  1GUW A;  1SRU A;  1YHB A;  1JOK A;  1I4H A;  1KAW A;  2NZH A;  3OIQ A;  2EY2 A;  2DY7 A;  1JJ2 A;  2ICE C;  1EY6 A;  1QVG A;  2B2U C;  3PGZ A;  4RCN A;  1D7Q A;  4GOP C;  3NBH A;  5C4H A;  4DAY A;  1SNC A;  2N78 A;  5KYL A;  1Q1E A;  1LLR D;  2N88 A;  2EJG C;  4QUF A;  3K59 A;  2OXP A;  2GN5 A;  3G4S A;  2JP1 A;  1BF4 A;  2AUK A;  4UPA A;  3S1N B;  1SE2 A;  3TZD A;  4L5S A;  1BDO A;  4HJ9 A;  3V05 A;  1LTL A;  3I4N G;  1BNZ A;  3GP7 A;  3I4L A;  3BVG A;  1MHW C;  2BA0 A;  2RQX A;  5JJK A;  2Z6B A;  1Q90 A;  2BA1 A;  2JSO A;  3J7Z C;  1HZB A;  4DR1 Q;  5COR A;  4FNF A;  4HIM A;  4IJH A;  2C5C A;  3AEV A;  4L6T B;  5C0X H;  3W1B A;  3P75 A;  4KD4 A;  1S5F D;  4XQQ A;  4ZK9 B;  1WFQ A;  4K14 A;  2A69 D;  2MJ8 A;  4NXN L;  3Q24 A;  1B2T A;  1HNZ L;  3I56 A;  4NMZ A;  1SLJ A;  2JN4 A;  2J7Z A;  2J4X A;  2F0L A;  3I4M H;  2EPB A;  5EAY A; 
#chains in the Genus database with same CATH homology
 1FL0 A;  2JEB I;  2ZTC A;  3U4V A;  4X62 L;  4LF5 Q;  3KF6 A;  1XPO A;  3KFU A;  2I5H A;  4JI0 Q;  4JV5 L;  1HNZ Q;  1YEZ A;  3I55 A;  1S40 A;  1V1Q A;  2I0Q A;  2AWN A;  2UUC L;  5AJ3 Q;  2WB1 G;  3D0F A;  1YI2 A;  1YZ6 A;  3OTO L;  2PQA B;  5LMN L;  1VQP A;  4DUZ L;  3HOU H;  4PZ7 A;  4X62 Q;  3H0G H;  3CW2 C;  1Q8K A;  5E7N A;  1QUQ A;  2K75 A;  4A3F H;  3J81 j;  1HNX L;  5M5Y H;  3M3Y H;  1J5E Q;  1GD7 A;  2RHQ B;  3MEF A;  4P75 A;  1OXS C;  4FDB A;  3OW2 A;  4A3C H;  3E9I A;  4NXM Q;  2EQS A;  2HIV A;  1SFO H;  1KL9 A;  3CCL A;  1CSQ A;  1N32 L;  4LUO A;  1HNX Q;  4MNO A;  1J5E L;  2CFM A;  1BVS A;  1IBM Q;  4DR7 L;  4DV7 Q;  1S72 A;  1VQG A;  1QVF A;  4P71 A;  2JA9 A;  4RMF A;  1N36 Q;  4A76 A;  3FHW A;  4POF A;  1PH9 A;  5BR8 Q;  1N33 L;  2DUD A;  2NVQ H;  4A93 G;  4LUV A;  1IYJ B;  4YWK A;  1GO3 E;  3ZJY C;  3OTO Q;  1JT8 A;  2D0O A;  2MFI A;  2Z0S A;  4JI1 L;  4BBR H;  4R4Q A;  3CC7 A;  1KRT A;  4DUZ Q;  4A3K G;  1OTC A;  3G71 A;  4LF6 L;  4A3C G;  2HT1 A;  4JI7 Q;  4KHZ A;  5IT9 c;  3TEH B;  3J81 c;  4BY7 G;  1GKH A;  4ME3 A;  1V43 A;  3TRE A;  4PZ6 A;  1Q86 C;  1ASZ A;  2WB1 E;  2VZA A;  1XNQ L;  4X64 Q;  3JC6 6;  4DV2 L;  2VW9 A;  1T9H A;  1WI5 A;  1PH7 A;  2NN6 I;  1RIP A;  2MQH A;  1OXX K;  3GO5 A;  3HOU G;  3J7A 5;  4XTC S;  5JJI A;  5C3E H;  4GN4 B;  3EIV A;  5GRO A;  4X65 Q;  4JYA L;  4TVA B;  4IJL A;  1EOV A;  1VQN A;  1VQC A;  3I2Z A;  3Q8D A;  2BH8 A;  4DV1 Q;  3GD7 A;  3GTK H;  1RL2 A;  1VS0 A;  1ASY A;  1VQ4 A;  4DK3 C;  2R93 H;  2CWA A;  2E2J H;  4GNX C;  4R4C A;  1SMX A;  2OQ0 A;  3K0X A;  4X65 L;  1NJI C;  2HHH L;  1FJG Q;  4JYA Q;  4LF6 Q;  4OON A;  5FJ8 G;  1PH1 A;  4X66 Q;  1L1O A;  3B6Y A;  2JA5 G;  3STB D;  2JK8 A;  3A74 A;  5ELO A;  4DV4 Q;  4YWL A;  5GAH C;  2MNA A;  3HOV G;  2Q2T A;  3HOX G;  1MJC A;  3GDE A;  5J3B A;  4DK6 C;  2EIF A;  1BBU A;  1B8A A;  4DV0 Q;  2UXD L;  5IYD G;  3S15 H;  4JBK A;  3I4M G;  1U0L A;  1VQ8 A;  4LF8 Q;  1KHI A;  3PV0 A;  2PI2 A;  3HOZ H;  4A3G H;  2HIX A;  1W2B A;  3F2B A;  3AFP A;  2JE6 I;  5ELN A;  4GKK L;  4PG3 A;  3UDX A;  4DAM A;  3GTO H;  2ASB A;  1QVC A;  1XPU A;  4IFD J;  3RLF A;  3M7N A;  2ZJQ A;  1GVP A;  1PV4 A;  5LMU L;  1EUJ A;  4DV6 Q;  2A8V A;  2AKW B;  3JAM i;  4LF8 L;  2JEA I;  2VQE Q;  4IOA A;  1JJC B;  2JA6 H;  1EYG A;  4A4I A;  3PUY A;  5IY0 A;  3KYH C;  4GNX A;  1FJG L;  2JA7 G;  3GTL H;  5IYD H;  2VUM H;  4GLV B;  2E2H H;  4JI3 L;  5JJL A;  1D8L A;  4JI6 Q;  4LF7 L;  4HIO A;  3T1H L;  2VQE L;  1K8G A;  3S14 H;  2UXC Q;  3M4Q A;  3NEM A;  4O2D A;  3CCQ A;  2ID0 A;  1B7Y B;  4DV0 L;  1X3E A;  2K50 A;  1XMQ L;  2IX0 A;  4B3T L;  1JJG A;  1Q46 A;  2ZM6 Q;  5C4J H;  1PA6 A;  1S3O A;  3KF8 B;  4A3L G;  4K0K L;  2GVB A;  3S16 H;  3DLL A;  1P8L A;  4B3T Q;  4DV5 L;  3UE0 A;  4ALP A;  1P16 A;  4KLK A;  1UWV A;  1PYB A;  1Q1B A;  4P73 A;  4LW1 A;  2ZM6 L;  4A75 A;  4A3J G;  4A3M G;  1W3S A;  5HGQ A;  2Y0S G;  4A3L H;  2KCT A;  1XJV A;  3J80 i;  1OXT A;  3PSI A;  2PQA A;  1E1O A;  1YJ9 A;  3PO2 H;  1XNR L;  1CUK A;  1IBL Q;  1KXL A;  1JB7 A;  4DUY Q;  4LWC A;  1A0I A;  3PF5 A;  4IO9 A;  5C4X G;  1M90 C;  3BZK A;  2PI2 E;  3M85 A;  1C7Y A;  2RHS B;  3CCS A;  4DR2 L;  4AYB G;  1UE1 A;  4GNX B;  4LUZ A;  4BBR G;  4YY3 Q;  4YCV A;  1LYL A;  2AWO A;  2C35 B;  4UP8 A;  2ATW A;  3I4N H;  1IXR A;  1HNW L;  5JEA G;  1X9N A;  1AH9 A;  2E2I H;  3NEL A;  4DR4 L;  4DV3 L;  4HIK A;  3ULL A;  2K14 A;  4R4T A;  4GOP B;  2KBN A;  1WJJ A;  4IPD A;  2LXK A;  3H3V H;  2E5L L;  1K83 H;  5IE8 A;  4YY3 L;  3RN2 A;  4LFB L;  1UE6 A;  1I3Q H;  3UDG A;  2E8G A;  4DV5 Q;  3PIP A;  3W1G A;  2YTV A;  3PO3 G;  1SN8 A;  4WJ4 A;  5IYB H;  5GQO A;  4DKA C;  3GTG H;  2E5L Q;  3U58 A;  4LFB Q;  4A3F G;  2N8N A;  4JOI A;  2KHJ A;  4JV5 Q;  2UUA L;  3LGJ A;  2YU9 H;  1EQR A;  3HKS A;  4IPC A;  3RLO A;  5C4X H;  4DR3 L;  4A3E H;  1Y1W H;  3H0G G;  2YV5 A;  1E1T A;  3FP9 A;  4PZ8 A;  4R4I A;  4MZ9 A;  4POG A;  1MIU A;  1Y1W G;  3I4O A;  1NY4 A;  4HJ8 A;  1IZ6 A;  1M1K C;  1C9O A;  4B3S Q;  3CCR A;  4YHH L;  2K52 A;  1UE5 A;  2K5N A;  4J15 A;  4C3J H;  3K7A H;  5LMN W;  4QY7 A;  4OWW B;  4DAY B;  3CC2 A;  5H1S E;  3TRZ A;  1PVO A;  3NBH B;  1VQH A;  1CKM A;  1LUZ A;  3STB C;  3RNU A;  4C3I H;  1GM5 A;  1V9P A;  1H95 A;  3G48 A;  4A3K H;  5FLM G;  4KHP Q;  3HKZ G;  2A19 A;  1L1O C;  1L2F A;  2A1A A;  3K80 C;  5C3E G;  1Z47 A;  4LF4 Q;  4JCV E;  2VQF Q;  3S2H H;  2Z6K A;  2VY3 A;  3PO2 G;  5C0X G;  2ZJR A;  2VUM G;  5M3F G;  5IYC H;  3ICE A;  5M3M G;  2EXD A;  1A62 A;  5IP9 H;  4L5T A;  3D31 A;  1HZ9 A;  3CD6 A;  1YVC A;  1VQO A;  4A3I H;  4IFD I;  5FLM H;  3AFQ A;  4DR6 L;  4NPS A;  2UU9 L;  1G29 1;  2K5V A;  2WFW A;  3A5Z B;  3KJP A;  1PH4 A;  3S1Q H;  2JA5 H;  2D0P A;  4LF5 L;  2HQL A;  1E24 A;  5FJ8 H;  2DGY A;  4AH6 A;  1WCM H;  3KJO A;  1TWF H;  3KLW A;  4NB3 A;  1QZH A;  4APV A;  2L15 A;  2VL6 A;  1Y14 B;  1X54 A;  1Q7Y C;  4X6A H;  1YIJ A;  2UU9 Q;  4DV7 L;  1E7Z A;  1VQI A;  3U4Z A;  3CXC A;  2R6G A;  4NXN Q;  3HOW G;  1N36 L;  1MJE A;  3HOX H;  4BY1 G;  1AE3 A;  3EN2 A;  4A3M H;  4TQU S;  1K73 C;  3ER0 A;  3HFZ B;  3UE1 A;  4GS3 A;  1OXV A;  3RR5 A;  3TS0 A;  4BXX G;  2LXJ A;  4RG1 A;  2VNU D;  2WAQ E;  3KDF B;  3CCV A;  4P74 A;  2JA8 H;  2R92 H;  1A63 A;  3M9B A;  1VQA A;  1A8V A;  4A3E G;  1VQK A;  1E3P A;  1NMF A;  1VQ5 A;  4JI0 L;  3S2D H;  4QJF A;  2B63 G;  2NVT H;  1K0R A;  2OCE A;  4OO1 I;  2K4K A;  5AJ3 L;  4X64 L;  4C3H H;  1L1O B;  4DR7 Q;  4JI5 L;  4AYB E;  1IL2 A;  1KRS A;  2B3G A;  1EIY B;  2B29 A;  1L0W A;  3CCU A;  4Y52 H;  2AMC B;  4DPG A;  1PH2 A;  3PCO B;  4XIG S;  4UY8 C;  1TWA H;  4BXX H;  4JBJ A;  1HR0 Q;  3CP0 A;  1CSP A;  3GTM H;  2OQK A;  1SR3 A;  2V1C C;  3H15 A;  1CKN A;  4OWX B;  5M5X H;  4JC0 A;  1VQL A;  4DV1 L;  4LFC Q;  3W5O A;  5GAG C;  1N32 Q;  3HKZ E;  4DNI A;  2R7Z H;  2CKZ B;  3BZC A;  1WYD A;  3KOJ A;  1XNQ Q;  2ALY B;  2ZTD A;  3GTJ H;  1HJP A;  2JJQ A;  2Q2H A;  1X3G A;  3TQY A;  1G51 A;  2OTL A;  3H3V I;  2WAQ G;  1CKN B;  4LFC L;  3CCJ A;  2D62 A;  3HOV H;  2PNH A;  2RCN A;  1X55 A;  1WOC A;  5BR8 L;  1EWI A;  1N33 Q;  2RF4 A;  3VDY A;  3HOZ G;  4A93 H;  3T1Y Q;  3S1N H;  1PHJ A;  3FKI G;  3SGI A;  1JMC A;  4A3B G;  5IYC G;  1TWC H;  1I6H H;  3KF6 B;  2OWO A;  3BU2 A;  1TWH H;  2AHO B;  4HJ5 A;  4HID A;  2UUB L;  1XMO L;  3CCM A;  5C44 G;  4KI0 A;  3T1Y L;  2Q2I A;  4GKK Q;  1TWG H;  4JBW A;  3J81 i;  1IBM L;  3HOY H;  1SRO A;  1VCI A;  1YBY A;  3WWV A;  3CAM A;  3BJU A;  3PUX A;  3CMA A;  3CPW A;  1HZA A;  4BA1 I;  2LSS A;  3CF5 A;  5LMU Q;  3KDF A;  2GVA A;  1XMO Q;  2B63 H;  4DR5 Q;  1B70 B;  1KC8 C;  3E9H A;  4OWT B;  2F52 A;  4JI1 Q;  3UDI A;  2UXD Q;  1JE5 A;  3IRB A;  1KQS A;  1VQ6 A;  1C0A A;  4JI7 L;  1TXY A;  4QGU A;  5K36 G;  3ULJ A;  1VQD A;  1EQQ A;  1G6P A;  4UP7 A;  3K7U C;  3CME A;  4HJA A;  4DR5 L;  4JBM A;  1DGS A;  1E22 A;  4DV2 Q;  1X3F A;  3JAM c;  4A3B H;  1Y1V H;  4AIM A;  1R9T H;  3CPF A;  3I7F A;  4BA2 I;  2NZO A;  5GAD C;  3K81 C;  3G6E A;  1XMQ Q;  1KD1 C;  1K3R A;  2ZTE A;  4LFA Q;  1VQ7 A;  2UUB Q;  2F4V L;  2FXQ A;  4BY7 H;  4L5R C;  1VQJ A;  1BKB A;  4K0K Q;  1AE2 A;  4O0A A;  4YWM A;  1X6O A;  3OYY A;  2R7Z G;  4IOC A;  1UE7 A;  1K8A C;  3U50 C;  3UDF A;  3CCE A;  2MO0 A;  3ULP A;  1I50 H;  3PUW A;  2HHH Q;  4QIW E;  1I5F A;  5DLQ E;  3GTQ H;  1N34 Q;  3RZO H;  3F2D A;  1Y1V G;  2KCM A;  4GN5 A;  1QZG A;  4X66 L;  1IBK L;  1FGU A;  1IBL L;  4DV6 L;  4LF9 Q;  4YCU A;  2H5X A;  2CQO A;  3J80 c;  4LNQ A;  2QEX A;  4DV4 L;  2KEN A;  1QUQ B;  1PFS A;  3PUZ A;  2WP8 J;  2IHF A;  1VQF A;  1U5K A;  2N3S A;  4AQY Q;  1Q82 C;  4JI4 Q;  1PH5 A;  3HOW H;  4QL5 A;  3M4P A;  1I94 Q;  1VQE A;  2XTI A;  4IPG A;  3T1H Q;  5HY6 A;  4LFA L;  5C0X I;  2F4V Q;  4MTN A;  5GAE C;  2Q2U A;  4OXP A;  5IP7 H;  2UXC L;  1SE8 A;  2CWP A;  3ERS X;  4AQY L;  3M4O H;  3PO3 H;  4JI4 L;  4Y7N H;  3S1M H;  4IFD G;  3F2C A;  3AQQ A;  1XNR Q;  1I94 L;  2YTY A;  4DUY L;  1CKO A;  1BBW A;  5C44 H;  4A3I G;  1XTD A;  3S1R H;  1HH2 P;  1NTG A;  3HOY G;  3PF4 A;  3NEN A;  5IP7 G;  1PH6 A;  2CCZ A;  2N49 A;  1N34 L;  1EFW A;  2VS1 A;  5M3F H;  3DM3 A;  4JI3 Q;  2JA7 H;  2NN6 G;  1IBK Q;  2KHI A;  4LF9 L;  4JI6 L;  4LF7 Q;  1HNW Q;  3K8A A;  2IX1 A;  4JG2 A;  5M5W H;  5IYB G;  1N8R C;  1WCM G;  4GOP A;  3E0E A;  2YYZ A;  2Y0S E;  4DV3 Q;  4BBS H;  4IPH A;  3A5U A;  4R4O A;  2OTJ A;  1X56 A;  2IT1 A;  3A0J A;  3MXN B;  4C2M H;  3PIO A;  3AYH B;  1HR0 W;  1YNX A;  3RZD H;  2R7D A;  4R1J A;  4L5Q A;  1MKH A;  4UP9 A;  4B3S L;  4OO1 G;  3L2P A;  4YHH Q;  4JI2 Q;  4HJ7 A;  4DR2 Q;  3F8T A;  1NMG A;  2I5M X;  1YHQ A;  4B3M Q;  2I5L X;  4JOI C;  2JQO A;  1KIX A;  1SRU A;  1YHB A;  3RLN A;  2IHE A;  1O7I A;  4BBS G;  1KAW A;  2NZH A;  2Z6K C;  4DR3 Q;  1UEB A;  2UXB L;  2R93 G;  1JJ2 A;  4A3G G;  4B3M L;  3L7Z C;  4DR1 L;  2XGT A;  3CC4 A;  1J6Q A;  2VQF L;  1QVG A;  1Z9F A;  1OXU A;  3PGZ A;  3TS2 A;  4B3R L;  3CQZ H;  1D7Q A;  4GOP C;  3PUV A;  5IWA L;  4P72 A;  3S24 A;  2UXB Q;  2JA8 G;  4PMW A;  2R92 G;  1Q12 A;  2PMZ E;  2QGQ A;  1EIF A;  2ES2 A;  1LM0 A;  2N78 A;  2IY5 B;  1Q1E A;  3EBE A;  1XPR A;  1NBW A;  4WJ3 M;  4GKJ L;  4BY1 H;  2GN5 A;  3G4S A;  3GTP H;  2R7F A;  5JEA J;  5FLX c;  2QA4 A;  3RN5 A;  2UUA Q;  4B3R Q;  4UPA A;  4DR4 Q;  4JI2 L;  4L5S A;  4HJ9 A;  3FKI H;  2NVX H;  4H02 A;  3I4N G;  1LTL A;  4NXM L;  1PH8 A;  3S17 H;  2BA0 A;  5JJK A;  4YCW A;  4A3D H;  2BA1 A;  1YIT A;  3J7Z C;  1HZB A;  4GLX A;  1PH3 A;  4DR6 Q;  1VQB A;  4EX5 A;  2ZJP A;  4DR1 Q;  4HIM A;  1YHA A;  4IJH A;  3AEV A;  1HZC A;  4JI8 Q;  5IP9 G;  1FVI A;  2NVY H;  3W1B A;  1VQ9 A;  5IWA Q;  5M3M H;  4OX9 Q;  2F3I A;  4EQ5 A;  4A3J H;  1PYS B;  2JA6 G;  1K9M C;  4KHP L;  1YJN A;  4LF4 L;  1Q81 C;  4JI5 Q;  1WFQ A;  3F1Z A;  4OX9 L;  4NXN L;  4JI8 L;  1YJW A;  1VQM A;  4A3D G;  4GKJ Q;  4GN3 B;  1HNZ L;  2K5H A;  3I56 A;  5C0X J;  2MO1 A;  4GLA C;  1X65 A;  2YTX A;  3L0O A;  1SLJ A;  1HR0 L;  2UUC Q;  1NE3 A;  4QQB X;  3I4M H;  5LMN Q;  1N9W A;  2BH2 A;  5EAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...