4DR4Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4Q00
1HNZQ 1GO3E 4IJLA 5GQOA 3I4NH 3KJOA 3CCRA 3CC2A 3TS2A 4LWCA 3EBEA 1UE7A 3ER0A 4A3MG 2K5VA 2Q2HA 3GO5A 1FL0A 5HY6A 3I4OA 1VQ8A 2ZJQA 5M3MG 2OWOA 5LMNW 3HOWG 1X3EA 2JA6G 2NZHA 4R4CA 2Q2TA 2UXBL 2XTIA 2VL6A 4DV2L 3A5ZB 4DR3L 3B6YA 1W2BA 2VQFL 1Y1WG 5IP7G 2VQEQ 4B3SQ 4GKKL 4GLAC 4DR2Q 4LFCL 1K73C 1W3SA 2EIFA 3CMAA 4A3CH 3G6EA 1YI2A 2OCEA 2GN5A 3KDFB 5FJ8H 4JI4L 3KLWA 4TVAB 4LF6L 3K0XA 3H3VH 4BXXG 1SMXA 1VQ9A 1UE6A 5LMNQ 1VQ6A 3I4MG 3BZCA 4R4QA 4KHPL 4KHZA 4JI6L 3PUWA 4JI5L 2K5NA 1K3RA 3PO2H 4IPGA 4LFBQ 5HGQA 2F4VL 2R93G 1EIFA 2B63G 2GVBA 5FLMH 3HOVG 1X65A 4KLKA 3AFPA 4XTCS 2ZM6L 1OXXK 1XPOA 4P75A 4DR7L 5AJ3Q 1EOVA 2UU9Q 2Q2UA 4YWMA 3H0GG 1BVSA 4LF9Q 4X64Q 1SROA 1TXYA 1KXLA 1PH6A 3DLLA 3U4ZA 3PO3H 4ME3A 4HIMA 3HFZB 4DV1Q 4DV4Q 2UUAQ 4WJ4A 1AE2A 2UUCL 1C7YA 1JJCB 2K75A 5GAGC 5IY0A 4LF7Q 3S16H 4A3EG 1G51A 1PFSA 2ID0A 4BA1I 3PF5A 3BU2A 1K83H 1OXUA 4OWXB 1XPRA 2QEXA 3S1QH 2WFWA 1VCIA 1NBWA 3JAMi 4UP9A 3HOZG 4A3BH 4JI2Q 1PH4A 1IL2A 3HOYG 1N8RC 3PSIA 4FDBA 2BA0A 4X62L 4HJ5A 1PHJA 3PF4A 3STBD 2AHOB 4HJAA 1CSQA 4C2MH 4DV3L 3CAMA 3K81C 4L5RC 4LF5L 5IP9H 5C0XJ 4HJ7A 1VQ7A 3GDEA 5M3FG 2NVXH 1TWHH 4GKJQ 3GTLH 3NELA 2N3SA 3JAMc 3TREA 1N9WA 4P71A 5IWAQ 4Y52H 4LF4L 4LFAL 3IRBA 4A3LH 3U58A 1Z47A 4AQYQ 1EQQA 3A0JA 4MZ9A 2R92G 4AYBE 2JEAI 4DR4Q 4GNXC 3OYYA 1E1TA 1VQMA 4JBMA 2IHEA 3HKZG 4UP7A 4H02A 2DGYA 4OO1I 4DR5L 1N32Q 2ZTEA 3RLFA 2QA4A 5C0XG 1KQSA 1UE5A 3PCOB 1E1OA 1PH8A 1HR0W 1P16A 2Y0SE 3F8TA 2EQSA 1MJCA 1JT8A 5C44H 4BY7H 2HIXA 4A3GH 3STBC 3GTJH 1KRSA 1IBML 1J5EL 4YWLA 4EX5A 2N8NA 5C3EG 2JJQA 3I7FA 3HOXH 3F2CA 1WYDA 4X66Q 4Y7NH 4A76A 4GOPB 4A3IH 3CCLA 1XMOQ 2R7ZH 3J7ZC 4A3BG 1HR0L 2JA8G 1VQBA 4BBSH 1GM5A 3M4PA 3NBHB 4A4IA 4JI8Q 2JK8A 1MKHA 1Q12A 2Z6KA 3ERSX 3MEFA 4AIMA 4YY3Q 4QJFA 1UWVA 3D31A 4YCWA 1XPUA 4HIKA 3CCQA 1N36Q 1VQOA 1VQ4A 1MJEA 3AQQA 1Q1BA 4GN5A 1K8GA 1Y14B 3Q8DA 3BJUA 1KRTA 1P8LA 4BBRH 5GAHC 4DV0L 2E2HH 1N33L 2WB1G 3L0OA 5IYBH 4DUZQ 2JA5H 5LMUL 1AE3A 1S40A 2UUAL 4A3LG 1OTCA 4DKAC 3S17H 1HNZL 1WCMG 4DUYQ 4A3FG 2CCZA 3WWVA 1YVCA 4JC0A 2AMCB 2Q2IA 3PUYA 3GTQH 1M90C 2VY3A 3K7AH 4BY1G 1I94L 4JV5Q 1QUQB 3S24A 1CUKA 1YNXA 1YZ6A 2AWNA 4JI7Q 3S2HH 1J6QA 1NJIC 2CFMA 4X6AH 3I2ZA 3PV0A 1QVGA 3H3VI 1L1OB 1B70B 1TWAH 2GVAA 5E7NA 3OW2A 4A3JH 4C3IH 1LUZA 4B3MQ 3U4VA 1FGUA 1PV4A 2NZOA 1KD1C 4B3SL 1SN8A 4B3RQ 1VS0A 4GS3A 4DR2L 3RR5A 4R4IA 1HNXQ 2D0PA 4MNOA 1VQFA 1CKMA 1GD7A 2NVTH 2I5LX 4QL5A 2R7ZG 2A19A 4OO1G 3KJPA 1V1QA 4DK6C 3PGZA 5C0XI 3K8AA 3AEVA 5LMNL 3RN5A 2RF4A 4PZ7A 4IO9A 1FJGQ 3S15H 4UP8A 3HKZE 4DAMA 4K0KQ 2Z0SA 2KENA 1I6HH 2YTXA 1RL2A 2JA9A 1NMGA 2R6GA 3S14H 2MQHA 4JI3L 4LFBL 4OWTB 1SRUA 2PI2A 2HHHQ 4PG3A 3UDIA 2RHQB 3CCSA 5C4XG 2UXCL 3E9HA 5C4JH 2WP8J 1G6PA 3HOUH 4DV6L 3CCUA 4GOPA 1Z9FA 5AJ3L 3S1NH 2UU9L 4DR3Q 5IYBG 5ELOA 1Q7YC 2I5MX 4X64L 1PH1A 2JA5G 1U0LA 1XMQQ 2K50A 3CCJA 1HZ9A 2JA7G 2YYZA 4XIGS 2IHFA 1HNWL 1JJGA 2WAQG 1E24A 1YHBA 4DV1L 4DV4L 1RIPA 2E8GA 2LXKA 3CP0A 1EIYB 1EQRA 3I4NG 2D62A 1VQGA 4PMWA 4JI4Q 2OQKA 4DPGA 4QQBX 4R1JA 3TQYA 4A3KH 4LF6Q 3OTOQ 4ALPA 1KAWA 1G291 3PIOA 3T1YQ 1Q86C 1PH3A 1PYBA 2ALYB 3I56A 4JI6Q 2I0QA 3J7A5 3W1GA 2EXDA 4GOPC 5FLXc 2PMZE 1WOCA 3UE0A 2K52A 2AKWB 4GLVB 2VNUD 2UUBQ 2IX0A 1L2FA 1OXTA 4B3TQ 3G71A 2R7FA 2ZM6Q 4IJHA 4C3HH 2E2IH 3CXCA 4A3CG 2V1CC 1QUQA 1UE1A 2JQOA 5FJ8G 1EYGA 1TWGH 4MTNA 4C3JH 1WJJA 2ZTDA 3U50C 1L1OA 4IOCA 3K7UC 3UDXA 4JI0L 2UUCQ 1YHAA 5GADC 1IBKQ 3G48A 3J81j 3PO2G 1X9NA 5JJKA 3CW2C 5GAEC 1HH2P 1K0RA 2A1AA 2PQAB 3K80C 5FLMG 3M4OH 4YWKA 1D7QA 2CQOA 1H95A 3GTMH 2ES2A 1E7ZA 4P73A 3RN2A 2CWPA 4YHHQ 4UY8C 1VQAA 3S2DH 2LSSA 1Y1VH 3TEHB 4OXPA 2I5HA 5IT9c 4POGA 3F2BA 4X65Q 4KI0A 1BBUA 1VQDA 4DV3Q 2ASBA 1L1OC 4NPSA 2MO1A 1YITA 3PO3G 2NN6I 3UDFA 3H15A 1Q8KA 4JBWA 2E5LQ 4A93H 2VW9A 4A3KG 1XNQQ 4GN3B 4OX9Q 3GD7A 1XMOL 3I55A 3FHWA 5BR8Q 3PIPA 1IBLL 3CC7A 1QVFA 4LF4Q 3T1HQ 1X3GA 1VQCA 2A8VA 4JI8L 4LNQA 3KFUA 1A63A 4DR1L 3TRZA 4IPDA 5M5XH 1VQEA 1YJWA 4NB3A 3A74A 4LUOA 1N36L 4RG1A 1CKNA 1JB7A 2VUMH 5M3MH 1IZ6A 3HOWH 2JA6H 1VQLA 2WAQE 2BA1A 3E0EA 5IP9G 1O7IA 1TWCH 5IYCH 2E2JH 3CMEA 4P72A 4DUZL 1NTGA 3RLNA 5IYDH 1HZAA 4DAYB 1Y1WH 4AH6A 1M1KC 4DUYL 4PZ8A 1L0WA 5IP7H 4GN4B 4LW1A 4LF8L 2KCMA 4R4OA 3UDGA 4LF9L 1R9TH 4NXMQ 3CD6A 3ULJA 1PH7A 2UXDQ 2XGTA 1KL9A 4JBJA 4LUVA 4DV7Q 1VQKA 1NY4A 1A62A 4IOAA 4JYAQ 2Z6KC 3DM3A 4OONA 4JI7L 1HZCA 4RMFA 3I4MH 1PYSB 1Q1EA 2MO0A 3L7ZC 4NXNQ 5GROA 1OXSC 1QVCA 4DR6Q 1Y1VG 3D0FA 1JJ2A 1C9OA 4YCUA 3CPFA 2QGQA 3M9BA 4IPCA 2ZJPA 1Q82C 3JC66 4JOIA 4B3RL 3HOVH 4WJ3M 1SE8A 1HNXL 2ZJRA 5C44G 1KHIA 2VQEL 4A3GG 4BY7G 4R4TA 1I5FA 3HKSA 3W5OA 4DV5Q 1YJ9A 4A3JG 2PQAA 4JI1Q 3HOXG 4A3IG 3MXNB 1PH2A 1PH9A 3J80i 1N34Q 1FJGL 1Q46A 3PUVA 5LMUQ 2BH2A 2IX1A 4BA2I 1E3PA 4K0KL 4J15A 1JMCA 2RCNA 4BBSG 3E9IA 3RZDH 1XNRQ 1VQ5A 1I3QH 2VUMG 4A3EH 2HQLA 2HHHL 4QGUA 3M85A 3GTPH 3SGIA 1I94Q 2L15A 5ELNA 1AH9A 4JOIC 2NN6G 2DUDA 1X3FA 1LM0A 4AYBG 2PI2E 3AFQA 2KHJA 5IYCG 3HOZH 1FVIA 1A0IA 4UPAA 3A5UA 3L2PA 3UE1A 4BBRG 3F1ZA 3J80c 3HOYH 2UXBQ 2F52A 5JJIA 1XTDA 5IYDG 1LTLA 1XMQL 4DV2Q 3S1MH 4POFA 1Q81C 3M7NA 1HJPA 2LXJA 2VQFQ 2Y0SG 3PUZA 1VQJA 2AWOA 4IPHA 3J81i 3CPWA 3F2DA 1VQHA 3VDYA 1ASZA 4GKKQ 2KBNA 1CKNB 5M3FH 4LFCQ 4IFDJ 1U5KA 3CCVA 4LF7L 3OTOL 4JBKA 3T1YL 2K14A 4L5SA 2IY5B 2YV5A 4JI3Q 4KHPQ 2R92H 4JI2L 5JJLA 2YTYA 4HIDA 4JI5Q 2UUBL 4O0AA 3ULLA 3GTOH 2HT1A 1QZGA 3J81c 4B3TL 2F4VQ 1JE5A 3FKIH 2C35B 1EUJA 5J3BA 2UXCQ 2KHIA 2WB1E 1WFQA 4DV6Q 1X54A 1HZBA 2F3IA 1NMFA 1BKBA 3KF6A 1WI5A 2H5XA 4HIOA 3EIVA 4DR7Q 4GKJL 3GTKH 1HNWQ 1IYJB 1XJVA 2PNHA 1OXVA 1E22A 5IWAL 1SFOH 1S72A 1IBKL 4GLXA 1PA6A 4AQYL 4L5QA 5C3EH 5IE8A 3CQZH 1YJNA 1ASYA 4A3DH 2K5HA 3GTGH 4DR4L 2N78A 3PUXA 1SLJA 4JCVE 3ZJYC 1K8AC 2JA8H 1K9MC 4IFDG 1I50H 1N32L 1YBYA 2CKZB 2CWAA 4LUZA 3HOUG 2OTLA 3KOJA 1IXRA 4YHHL 4GNXA 4A75A 2NVYH 3CCMA 1YIJA 2BH8A 1KIXA 4X62Q 2B29A 4X65L 4YCVA 3KF8B 4P74A 2E5LL 2HIVA 1XNQL 4OX9L 1GKHA 4LF5Q 2JE6I 5BR8L 2MFIA 5K36G 4PZ6A 3BZKA 3T1HL 4X66L 1LYLA 2IT1A 1V43A 2D0OA 3KYHC 3RNUA 1QZHA 4JI0Q 1VQNA 1WCMH 4A3FH 4LFAQ 1MIUA 1YEZA 3LGJA 4EQ5A 3ULPA 4APVA 1CKOA 4DK3C 2OTJA 2ZTCA 3NENA 1A8VA 5M5WH 4OWWB 1BBWA 4YY3L 3FKIG 1S3OA 4BY1H 1VQIA 4A3MH 2YTVA 3KDFA 4JG2A 3M3YH 4DR5Q 1X6OA 2JEBI 1PVOA 1EWIA 3RZOH 5JEAJ 4HJ9A 1NE3A 4DNIA 1CSPA 3AYHB 4QY7A 1YHQA 1C0AA 2K4KA 5M5YH 4NXML 2OQ0A 1UEBA 2FXQA 2UXDL 5DLQE 3EN2A 3S1RH 4A3DG 2NVQH 4DV7L 1TWFH 1B7YB 4JYAL 1IBMQ 1J5EQ 1IBLQ 1B8AA 2N49A 4JV5L 1KC8C 3KF6B 3CF5A 1GVPA 1V9PA 3NEMA 4NXNL 3CC4A 1VQPA 4IFDI 3FP9A 4BXXH 4DR1Q 1X55A 5JEAG 1HR0Q 4DR6L 3RLOA 2YU9H 4HJ8A 2ATWA 4TQUS 3ICEA 2R7DA 4B3ML 4L5TA 3TS0A 2MNAA 2R93H 5C4XH 4QIWE 3M4QA 1DGSA 2B63H 1D8LA 4DV5L 4A93G 1X56A 3G4SA 2B3GA 4DV0Q 5H1SE 4JI1L 1EFWA 1N34L 1N33Q 1SR3A 3W1BA 2JA7H 2RHSB 4O2DA 1PH5A 3CCEA 5EAYA 3H0GH 2KCTA 2VZAA 4GNXB 4LF8Q 1XNRL 1T9HA 2VS1A
chains in the Genus database with same CATH superfamily
1WTWA 4Y7NB 1HNZQ 5GQOA 3CC2A 3TS2A 4LWCA 2R3ZA 3ER0A 2HQEA 1BDOA 2KA7A 5M3MG 5LMNW 1EY5A 2VL6A 2E2JB 2EYOA 3AU7A 3A7AB 2VQFL 2OXPA 4GKKL 4GLAC 1W3SA 3CMAA 1TS3A 2Y0SB 5A2QE 5JJZA 4IURA 3KLWA 3K0XA 4QMGA 1VQ6A 3BZCA 1EY9A 3P1HA 4XQJA 1WTQA 2K33A 1R4PB 2K5NA 2R93G 3T4AC 1F9QA 2CH4W 1HHVA 1RHPA 2ZM6L 4ZQ3A 1DCZA 4DR7L 1EOVA 4LF9Q 3FEWX 1SROA 1IKLA 5FLXE 3U4ZA 1B3QA 3NSWA 4IN3A 3U9OA 1PFSA 3RD4A 1OXUA 1T5XD 4A3EB 2XSCA 1XPRA 1NBWA 3JAMi 3TP7A 2AQ1B 4JI2Q 1IL2A 5EBCA 3HOYG 4FDBA 5ELCA 3STBD 2AHOB 3JAME 3HOUB 2OEOA 1X3QA 4ILWA 3S1NB 3K81C 5I9OA 1DZ1A 1I6HB 1RD9D 3GDEA 3TREA 1N9WA 1NSNS 4OIKA 1SYDA 3MVVA 1JWSD 4LMQD 3SK5A 2SEBD 1E1TA 1VQMA 3HKZG 3GTOB 4DR5L 1MGSA 1CI3M 3FKIB 1UE5A 4HMIA 3BS1A 2Z8LA 1XX8A 1MJCA 3I91A 2E2IB 3KK7A 3STBC 5AFWA 1Q3LA 5D65A 1ENAA 3HZXA 1ASZA 4NKLA 3HOXH 4A3IH 1WYDA 2K1BA 5ISRA 1VQBA 1GM5A 3M4PA 3NBHB 2JK8A 1MKHA 4YY3Q 3KBXA 1H9RA 3CCQA 3OHXC 3TZUA 1Q1BA 1K8GA 1J8IA 3A8KE 1Y14B 5HGTA 1KRTA 4U68A 1KAAA 1P8LA 5IGEA 3L0OA 3FPPA 4A93B 1HFNA 1AE3A 3A8IE 1VMPA 5E1FA 3EROA 1JWUD 1PTOH 1H9SA 3GTQH 3ERQA 2VY3A 1D1IA 2EY6A 4BY1G 4XQQA 1M90C 1I94L 4EVOA 3TP6A 3W3AA 5CV9A 2ZXOA 1LTAD 3I2ZA 1L1OB 1B70B 1EWHA 4CKBA 3OW2A 2O5IC 5M3MB 5KIXA 3U4VA 2KCNA 1KD1C 1TWCB 4DGZA 2E75C 4MNOA 1VQFA 1CKMA 1O7LA 4ULLA 2A19A 5J1ZA 3KJPA 4OO1G 5C4ZA 4UHVA 3OPOA 2KVMA 1TWFB 5HURA 3NTKA 1I4QA 5DEHA 5LMNL 4PZ7A 3S15H 1FJGQ 4UP8A 4K0KQ 5C5MA 1STNA 1HQMC 2JA9A 2EYFA 2A6HC 3S14H 3R8BA 3FRPB 2MQHA 2FJ2A 2F0GA 4IUUA 4OWTB 5EPKA 1SRUA 4N8X1 4TRDA 3ND8A 2RHQB 3CCSA 1EOTA 3E9HA 2K32A 4OL7A 2R93B 5C4XB 5FKAC 4GOPA 4XDXA 5AJ3L 4DR3Q 1M4VA 2F0QA 2ZXPA 3SXHA 1HZ9A 3A54A 4DV4L 1EY7A 1RJTA 1JR0D 3NTHA 3I4NG 1EYCA 1RF2D 2OQKA 3TQYA 3QOLA 2XRSD 3T1YQ 4FYDA 1Q86C 1PH3A 4JI6Q 2I0QA 3SK6A 1QOHA 4GOPC 5FLXc 3U9SA 3UE0A 4CBVA 2C5CA 3TBIB 2VNUD 3T53B 1BNZA 1GOZA 4RHRA 5KYLA 4QF4A 3MZ5A 5LHY1 3CXCA 2V1CC 4K5VA 2K28A 4IQZA 1QILA 2G5DA 1SEBD 1WJJA 4L63B 4IOCA 2DN8A 3UDXA 2UUCQ 2PQEA 3OMCA 3J81j 2FMCA 5I9PA 3NP8A 2A1AA 5FLMG 2QKIC 3E0JA 2M2LA 1EU4A 3HKZB 1TY2A 2L0CA 4DXGA 4POGA 2C9OA 4KI0A 4CJ0B 1GJXA 1J9OA 4NPSA 1YITA 5DNFA 1B44D 1SJHD 3PO3B 1XMOL 3FHWA 3PIPA 1QVFA 4QB4A 1EZ6A 2SDFA 4O42A 3GTGB 2F0KA 2NBFA 1KNEA 2RBMA 4X3UA 4NB3A 1EWCA 3A74A 4LUOA 2Z6BA 1N36L 2NVYB 3HOWH 2JA6H 2WAQE 3E0EA 1W6JA 1S5CD 3CMEA 4N9TA 4DUZL 2EXZA 1GUOA 4KKTA 1Y1WH 4AH6A 4RGOS 4LF9L 1PH7A 1ZKOA 5JVG3 4B08A 2RCFA 2Z6KC 4OONA 5EQ0A 5A35A 1Q90A 1HZCA 3I4MH 3OWFA 1OXSC 1QVCA 4BY1B 1Y1VG 2SOBA 2EYHA 3CPFA 5JOBA 4IPCA 3M3YB 1Q82C 4B3RL 1CK1A 4OIJA 1HNXL 2ZJRA 5C44G 4A3GG 1E2VA 1RDPD 1I5FA 2PQAA 4JI1Q 4KK7A 1LT6D 3O13A 4A3JB 4C1NI 1JMCA 2H4OA 1SYEA 2XWJB 3MEHA 2HHHL 2L11A 1LTTD 1QNKA 3SGIA 1AH9A 2DUDA 4RCOA 1KDAA 4AYBG 1LM0A 3WOEA 2PI2E 2KHJA 3HOZH 1ENCA 1FVIA 4UPAA 3L2PA 3UE1A 1HTLD 3J80c 1SNPA 1DOMA 5IYDG 1XMQL 4POFA 3BDCA 2VQFQ 3PUZA 1VQJA 3VDYA 4GKKQ 2J0TD 5M3FH 2F0LA 1TU2B 2CW0C 1X3PA 4JBKA 3I4NB 3BYTB 3KLRA 2R92H 4JI2L 5KNBA 2UUBL 4B3TL 2RDHA 5J3BA 2KHIA 1JOKA 1X54A 1F9SA 1HZBA 2F3IA 2KOLA 2O5JC 1MHWC 3EIVA 3SVMA 4WRDA 4DR7Q 2A69D 3C1FA 1AFPA 1IYJB 1ESFA 2CHBD 3NWSA 4QIWB 3T56B 1S72A 1XYIA 4GLXA 1MBYA 1PZKD 1VMCA 2L9HA 2EDGA 5C3EH 1I4GA 1YJNA 4A3DH 2K5HA 1PRTF 3PUXA 1SLJA 1I50H 4LUZA 3MXPA 4YHHL 4ME5A 2EPBA 2PZTA 1WTVA 2B29A 3VR4A 3VR6A 3S9WA 2BDNA 2MPMA 2PCFB 1GKHA 4OX9L 4DNRB 5K36G 2HCIA 4PZ6A 1B9NA 3BZDB 2EYJA 3K5MA 3RNUA 1VQNA 1JORA 1WCMH 2A69C 1MIUA 1TKWB 3HP3A 4APVA 1A8VA 1BBWA 4YY3L 1KLUD 1H9KA 1KABA 1GUTA 3K0YA 4F8MA 3HRZC 4JG2A 4EQNA 4DR5Q 2JEBI 4C3HG 5FO8B 3RZOH 5JEAJ 1Z6HA 1NE3A 4K8JA 2RKSA 3V2TA 3MTSA 2NVXB 2K4KA 5M5YH 1GHKA 1CT1D 2FXQA 4C3JB 2UXDL 4JYAL 1PRTC 1B8AA 3D4DA 1K0SA 4DFAA 4IFDI 1GVPA 1V9PA 3A8JE 3CC4A 4FF2A 3M4OB 2ATWA 3GTMB 2MNAA 1Y1VB 3Q6SA 3M4QA 4KY5A 3R3OA 1SJED 1X56A 3G4SA 2B3GA 3I4LA 5C44B 4A3GB 1EIHA 2RHSB 3H0GH 4GNXB 1XNRL 1DD2A 2F0VA 3KJOA 3CCRA 3FVQA 3K5OA 1VQ8A 5M5XB 1FL0A 3IL8A 3I4OA 5DM63 2DJGC 2XWBB 5EPLA 1X3EA 3D4RA 2EYLA 1ESRA 1LTID 4AYBB 4DR3L 3B6YA 3I8ZA 2X6GA 1ILQA 1ZEQX 2E2HB 1QNUA 5IP7G 2VQEQ 1JICA 2PZWA 4LFCL 2WKDA 4A3CH 1IYVA 1V1PB 1YI2A 5I2XA 3OOCA 4R8NA 5FJ8H 5TSSA 4RH6A 4X3SA 5LMNQ 1QG7A 2B2YA 4KHZA 4JI6L 3K7AB 1RCVD 3PO2H 3E3XA 4HSVA 1X32A 3DWQA 3OWEB 3DWAA 1TWAB 1F9RA 3HOVG 2M00A 1IW7C 3AFPA 1OXXK 5G3LD 4P75A 5AJ3Q 1TS4A 2KJXA 2Q2UA 3NBHA 4YWMA 1BVSA 3QIAA 3SK4A 4WFN3 2PO4A 2B39A 4Q0FA 2HD3A 3R2IA 2B2YC 4HIMA 3HFZB 4DV4Q 4RWSC 1AE2A 1F9PA 3MFYA 2K75A 5GAGC 2UUCL 3S16H 3RZDB 4A3EG 1G51A 4BA1I 3PF5A 1K83H 4OWXB 1ILPA 2HDMA 1K28A 1WTXA 1PH4A 2B2WA 1LV9A 1M8AA 4X62L 2WACA 3R2TA 1PTOF 1K8OA 1CSQA 1CFMA 4C2MH 2RDGA 4L5RC 1UUPA 2L1BA 3K6OA 1TWHH 1ZYRD 3GTLH 4J8QA 4P71A 1GHJA 1CHPD 1SYCA 3NQTA 3IRBA 4A3LH 1TT2A 2LKVA 5IODA 1EQQA 2B2WC 2JEAI 4DR4Q 2R61A 1B4OA 4UP7A 2DGYA 1N32Q 2F4IA 5L37A 3PCOB 4MTKA 1XXGA 2XN9C 2EQSA 4C3HB 1QCBD 2L12A 2HIXA 4BS9A 3N52A 1HA6A 2N8NA 4A76A 4X66Q 4Y7NH 2R7ZH 3CCLA 1XMOQ 3CQZB 1ET6A 3J7ZC 4HSPA 1HR0L 2JA8G 1CA6A 1Q12A 4QJFA 4IUPA 2NN6H 2Q8TA 1VQ4A 1N36Q 3T51B 4DK0A 1FNVA 3S2DB 4DNTB 3BJUA 1SAPA 5GAHC 1G91A 1N33L 3RUZA 4F88A 4DUZQ 2JA5H 1S40A 5IT9L 4DKAC 1OTCA 5IOCA 4A3FG 3QJYA 3VA5A 3K5LA 2QDLA 3WWVA 1YVCA 4RA8A 4JC0A 4JV5Q 1QUQB 3BG3A 3S24A 1AN8A 1J6QA 4KD3A 1SNQA 4X6AH 1QVGA 4KKSA 4EGVA 1PV4A 4B3SL 5CR3A 4B3RQ 5D14A 1HNXQ 1EY0A 2NVTH 4QL5A 4DK6C 3PGZA 4R9WA 3HKZE 4FXKC 2BE5D 1FD7D 1VDZA 1NMGA 3M4YA 3FDTA 2HHHQ 2YU9B 5C4XG 2NTSA 3TDQA 3KUPA 3HOUH 4RCNA 1G6PA 3S1NH 4M1UB 5ELOA 3HOVB 2I5MX 4X64L 1XMQQ 2K50A 2EVBA 2N55A 1RIPA 3CP0A 1EQRA 2F0DA 2QCPX 1CM9A 4DPGA 2F03A 2D5DA 4PQXA 1KAWA 2MP1A 3J7A5 3GTPB 3KLSX 3AMUA 2LS01 2BE5C 3VYTA 2IX0A 2UUBQ 2DY8A 4B3TQ 4QUCA 2KHSA 3G71A 1G6ZA 4IJHA 3S1MB 2E2IH 3OIQA 4KKUA 2JQOA 3GQBA 3U50C 2RSNA 4WORA 1YHAA 5E4XA 1X9NA 5JPNC 1B9MA 1TS2A 2VXWA 1K8MA 4CDDC 3I72A 2ES2A 3RN2A 2CWPA 4YHHQ 1VQAA 2LSSA 3LWUA 1SSOA 3D6WA 3DHQA 2AQ2B 4CJ2C 4DV3Q 3PO3G 1DOKA 3SDZA 4A93H 2VB3X 4GN3B 4OX9Q 1LTRD 3GD7A 1SFOB 1VF7A 5CV6A 2K03A 4LF4Q 4K2LA 2A8VA 3N6RA 4JI8L 3KFUA 3EFXD 4ZKCB 3TRZA 5T1IA 4IPDA 1VQEA 2JA8B 1YJWA 2L4NA 2A68D 3DM1A 4RG1A 2VUMH 4FF3A 5M3MH 4J6HA 1S5ED 1VQLA 5IP9G 4NDXA 1TWCH 4CJ1B 5IYCH 4P72A 5CV7A 2FINB 2PMZB 4H44C 4JK1C 1EY4A 4LW1A 4R4OA 2A73B 4B9WA 1R9TH 3ULJA 2UXDQ 4ZUIA 4LUVA 3HGBA 4A3FB 4IOAA 4JYAQ 3DM3A 4JI7L 2F0IA 5M5WB 1I4RA 5GROA 1JWMD 2F0FA 1SYFA 1EU3A 3H6MA 4G7OC 4WJ3M 3A56A 4BY7G 1KTKA 2A68C 2QILA 2VQEL 1EL0A 2K5WA 3EJIA 1WD0A 1AP0A 3NHHA 4A3JG 1PH9A 3J80i 1Q46A 1V1OA 1LT3D 5LMUQ 5T1GA 3HOXB 4NMZA 4BA2I 1B53A 1D5ZC 4BBSG 1XNRQ 3Q23A 3J80E 2AUJD 4GZYC 3M85A 1HRJA 1WTOA 3H3VC 5BN3A 4BBRG 3F1ZA 3HOYH 5JJIA 1SNCA 2FHTA 3M7NA 3PMFA 3F2DA 1V8QA 1JQYD 2DNCA 3CPWA 2KBNA 1CKNB 3TMEA 4LFCQ 4DU9A 3MHBA 5BN5A 1U5KA 3CCVA 3OTOL 4WJWA 2K14A 1PTOB 5KNDA 5C6AA 4L5SA 4M8AA 1T5EA 3E5SA 3TP5A 4HIDA 4L8JA 4C3IG 1WD1A 4O0AA 1GUGA 4K5WA 3J81c 1QZGA 1GUWA 1EUJA 3CHBD 2WB1E 4DV6Q 3ONAB 1YNJD 1D6EC 2H5XA 1DM0B 1C4QA 2WIIB 4FF4A 4F7XA 4FXGC 3D4WA 4MHEA 3J7YW 4XYQA 1HNWQ 1XJVA 3J7AV 2PNHA 4JPBW 3TSSA 2F0NA 3S15B 3LNNA 4JW0A 1HUNA 1PA6A 5IE8A 4O1NA 2MGSA 3GTGH 4N9PA 4DR4L 2MUYA 2N78A 4K6DA 2WKCA 4JCVE 1K8AC 1N32L 2CWAA 3KOJA 4GNXA 2NVYH 3CCMA 1ENFA 4X62Q 4I65A 4X65L 3C2PA 3IAYA 4MN3A 1PYWD 5ELDA 2HIVA 1XNQL 2HCCA 5BR8L 2MFIA 1TY0A 4CGYB 5M9OA 3DMUA 1FNUA 4X66L 3IFTA 1JB3A 3NPPA 1PXUA 5F2DA 4IZ8A 4EQ5A 2SNMA 2OTJA 5JPMC 3NENA 3S1QB 2F0SA 4ODGA 4BY1H 1V1PA 1VQIA 1LO5D 2N88A 4A3MH 3C1EA 4K5XA 2WV6D 3H09A 2I46A 3M3YH 1X6OA 4HJ9A 1PMRA 1YHQA 1PDQA 4C3JG 4NXML 2J4XA 3SHLA 3S1RH 4A3DG 2K5DA 4OO1H 1B7YB 1IBLQ 2JSOA 4DAPA 4JV5L 3KF6B 3NEMA 3FP9A 4BXXH 4DR1Q 1X55A 5JEAG 1HR0Q 4DR6L 3RLOA 4TQUS 1EEID 2DNEA 1UEAB 4E6IA 4EQPA 1DGSA 2B63H 1STYA 3KLSA 1MSGA 1LTGD 1O7YA 1N34L 1N33Q 4BY7B 1Q8IA 1E2ZA 2ICEC 3CCEA 3OMGA 2VS1A 1VQGA 4ZK9B 1GO3E 4IJLA 3I4NH 2B2TA 1EQTA 4BBSB 3KF8A 2K5VA 2Q2HA 3GO5A 4DXFA 1NR4A 3I3CA 2F0WA 2OWOA 2NZHA 2Q2TA 2XTIA 2JA6B 3CRLC 4N8FA 4RGMA 2K01A 4DF7A 2Z1CA 3L9AX 4BBRB 4B3SQ 1BCPD 4KY7A 5CGKA 5K5PA 2B2TC 3I90A 2GN5A 3KDFB 1ICWA 4ZYSA 4TVAB 1SNOA 3H3VH 1VQ9A 2A5HA 1STBA 4R4QA 4KHPL 1PLFA 2EJMA 5E4WC 2HUGA 2JYOA 2X6LA 3S2HB 1EIFA 2GVBA 3D8GA 5FLMH 4KD4A 4C3IB 1WTRA 1EYAA 4XTCS 3X3NA 2EOTA 4KY6A 5C0XH 5DM73 5CBEE 4IFDG 3H0GG 4X64Q 4EQOA 1TXYA 3DLLA 5KYIA 4WJ4A 1JJCB 1HUMA 5IY0A 4L6TB 4LF7Q 1BCPC 4ZAIA 2ID0A 2QEXA 2ZT9C 2WFWA 1VCIA 4A3BH 1UNSA 3KBGA 4HAEA 4BWGB 5I6YA 3LWEA 1N8RC 5DAUA 1C48A 2BA0A 2EY5A 1LT4D 5CYUA 2DY7A 1BXTA 3DUZA 2KECA 4DV3L 3CAMA 2SNSA 4LF5L 5C0XJ 2NVXH 5A2QL 1VQ7A 4V190 4LJZC 5I2YA 3NELA 3DWPA 4LF4L 4Y52H 4LFAL 2F1MA 1Y8NB 4CDCC 3U58A 1Z47A 2O2LD 2R92B 4XT1B 4JBMA 2Q8RE 4H02A 2ZTEA 4FXDA 1HCZA 1KQSA 5LL6X 1SXTA 2D9UA 1PH8A 1HR0W 1P16A 2Y0SE 1PFNA 5FLXL 1ET9A 1LLRD 2MHVA 5EKIA 5EJWA 4ZUJA 5C44H 4A3GH 3GTJH 1KRSA 1TWGB 2QDBA 1IKMA 1J5EL 3ZYYX 2H1EA 4EX5A 3I7FA 1LT5D 4GOPB 5C3EB 4A3DB 3P7JA 4JI8Q 1I50B 3MEFA 3JAML 4AIMA 4ID6A 3D31A 2B8GA 3Q22A 1VQOA 5FO7B 3X3MA 4XXEA 1U4PA 2M9VA 2BOSA 2E2HH 3D6CA 3MC0B 5IYBH 4DK1A 5I4DA 4FP5D 5LMUL 4A3LG 3S17H 2JP1A 3RMHA 3LX0A 2CCZA 1WCMB 1JCKB 2AMCB 1LTBD 1Y8PB 3PUYA 2CH4A 3K7AH 1CUKA 1YZ6A 2AWNA 4HTHA 4TSSA 4JI7Q 3NK9A 1UAPA 1MD2D 3PV0A 1TWAH 5E7NA 1LUZA 3RZOB 2PW7A 4B3MQ 1PZID 1TVXA 1W6KA 3PIO3 1VS0A 2P5ZX 2A6ED 4DR2L 3RR5A 3V96A 2D0PA 1GD7A 2XIWA 3C3LA 2R7ZG 1V1QA 2I07B 2K05A 3K8AA 3AEVA 2RF4A 4DAMA 2Z0SA 4FNFA 2KENA 5G3LF 1RL2A 2YTXA 3FMCA 2BDOA 4HN7A 2EZVA 4LFBL 5KRUA 2IWHA 3SE0A 1CQVA 1RTOA 4PG3A 3UDIA 1D5XC 1CA5A 2EE1A 2XNAC 5C4JH 3VR2A 5CC4A 4DV6L 3M7GA 1B2TA 1Z9FA 2K5QA 2UU9L 3DXJC 1SMYD 1PH1A 2JA5G 1U0LA 2JA7G 2YYZA 4XIGS 1HNWL 1JJGA 4UDUC 1YHBA 4OHJA 4RKBA 4DV1L 2LXKA 3H0GB 2WAQB 2HDLA 4XQNA 4JI4Q 4IUTA 5K36H 4A3KH 2B2UA 4LF6Q 3OTOQ 1I3QB 1G291 3PIOA 5EKLA 2JXMB 3OSOA 3I56A 2PNRC 3W1GA 2EXDA 1BBXC 2PMZE 1ML0D 1WOCA 1F2LA 4IALA 2K52A 1SNDA 2DJFC 2R7FA 4C3HH 1OO9B 2NUCA 1KLGD 2IW3A 5EBDA 3NE5B 3J80L 1EYGA 4MTNA 1O80A 3P20A 1L1OA 1SMYC 3K7UC 4C56C 5GADC 1STGA 5BN4A 5JJKA 3VYSA 1JC7A 5GAEC 1HH2P 2EYPA 1NCVA 2PQAB 1SE4A 3K80C 4YWKA 1D7QA 1FYCA 2F0HA 3BDLA 1E7ZA 4P73A 1BQQT 1EFID 3S2DH 4OXPA 3F2BA 5COYA 3SR1A 4X65Q 1BBUA 1VQDA 2ASBA 4QCLA 1I4HA 1L1OC 1EY8A 2MO1A 2TMPA 2NN6I 3H15A 3GTKB 4JBWA 1U9RA 2FFKB 1G2SA 2VW9A 1XNQQ 2RA4A 5BR8Q 3EA6A 1IBLL 3S16B 4IUQA 5EGTA 2X69A 4JVZA 1K83B 3F2UA 1TIID 4G4KA 4DR1L 1CQFA 4RGTA 1ZYRC 5CORA 1JB7A 1A15A 1CKNA 2K7VA 5FK9C 1IZ6A 2BA1A 4H7BA 2E2JH 1NTGA 4P2CB 3RLNA 3GP7A 1YNND 4DAYB 4OEMB 4DUYL 3E6ZX 5C3WA 5IGBA 5IP7H 1I6VC 3CKIB 4NXMQ 2KCMA 2F0EA 1IYUA 1NY4A 1A62A 1S5DD 4Q5VA 4CDFC 1G8ZD 1SDFA 2IPKD 1Q1EA 4ZLTF 4HCEA 4DR6Q 1JJ2A 3D0FA 1C9OA 2QGQA 1HPCA 2ZJPA 3JC66 3HOVH 3VA7A 4H13C 3W5OA 3HKSA 5I6WA 1YJ9A 3HOXG 4A3IG 3MXNB 1N34Q 1D1KA 3PUVA 1A3UA 2NVQB 2R7ZB 2RCNA 3E9IA 2PYKA 1F2ZA 1YNNC 3DEPA 2VUMG 2GA4B 4A3EH 2HQLA 3GTPH 2L15A 5ELNA 5FO9B 1BUVT 4CHTB 3AFQA 5IYCG 1WVLA 2IX3A 2F0UA 2F52A 1XTDA 4V0BA 1Z7TA 2B8FA 3S1MH 3VR3A 1Q81C 1HJPA 1PRTB 2LXJA 1I6HH 1SE2A 3J81i 2JA5B 1VQHA 1RTNA 1A2TA 2JA7B 3NWTA 1G2TA 1LACA 4LF7L 3G6JB 3J81E 1U4RA 2IY5B 4JI3Q 4KHPQ 5JJLA 2YTYA 3NXWA 3ULLA 3GTOH 2HT1A 3FKIH 2UXCQ 2C35B 1WFQA 1U4LA 2LMCB 3DEOA 1NMFA 4HEDA 3KF6A 2XVSA 1WI5A 4RGNA 3MA2B 2NVTB 2Q8IB 1B3AA 4PMBA 5E3FA 1SFOH 1IBKL 1AZPA 3R93A 4L5QA 1ASYA 5IGCA 1SE3A 3ZJYC 5KGUA 1K9MC 2JA8H 1YBYA 3WOFA 4Z9CB 4A75A 1IXRA 2BH8A 1KIXA 1B1ZA 3I73A 1LABA 1HXYD 4YCVA 4B9XA 4OELB 1TS5A 3HEJA 2AQ3B 2E5LL 1AEXA 3VYRA 4LF5Q 2KCCA 2V4DA 3T1HL 1H9MA 2IT1A 1DOLA 1KNAA 1V43A 2D0OA 3KYHC 1QZHA 4JI0Q 1O7ZA 4HR7B 3W2DA 4A3FH 2Z9HA 4LFAQ 1STAA 3ULPA 4DK3C 2ZTCA 5M5WH 4OWWB 2NYZD 4YIJA 1S3OA 1DJRD 3QO2A 5ELFA 5KNCA 2QW7A 3KDFA 1PVOA 1EWIA 1C0AA 3BVMA 2OQ0A 3IFDA 3I70A 5DLQE 3EN2A 4DV7L 1TWFH 1J5EQ 2N49A 3QR8A 1EYDA 3CF5A 4NXNL 3H94A 5KEEA 4HJ8A 5IGDA 3MXGA 4OGQC 3ICEA 2R7DA 4B3ML 4L5TA 3TS0A 4NW2A 2R93H 5C4XH 4QIWE 2F0TA 2BCOA 4DV5L 1II3A 4J1MA 5H1SE 2A6HD 1EFWA 1SYGA 1SR3A 3SK8A 3TZDA 2VZAA 1KDCA 4LF8Q 1T9HA 1X65A 1QB5D 1L2FA 5C4HA 4A3IB 2XRQD 3NUCA 3QB3A 4FVMA 3A7LA 3EBEA 4QUFA 1UE7A 3MAQA 4A3MG 5HY6A 2NZ1D 3MFGA 2F3WA 4K6LA 5ELEA 4C1NK 2ZJQA 3H91A 2VUMB 2IL8A 3HOWG 2JA6G 4R4CA 2UXBL 1SYBA 1F77A 2LY7A 4DV2L 3A5ZB 1NNXA 1W2BA 4TKOB 1GXDC 1Y1WG 1NUCA 3J7AF 4DR2Q 1K73C 2EIFA 2LFNA 3G6EA 1AW7A 2OCEA 1R9TB 4JI4L 4LF6L 4BXXG 1SMXA 1UE6A 3I4MG 4IUNA 3GTQB 1XWEA 3PUWA 1I4PA 4JI5L 4XYOA 1K3RA 4IPGA 4LFBQ 5HGQA 2F4VL 2D2CC 1DYQA 2B63G 3WDNA 2MJ8A 4KLKA 3UI2A 4K14A 2NTTA 1XPOA 2UU9Q 1Y69U 1S5BD 1EQVA 3PQIA 4H0LC 4KJNA 1KXLA 1SNMA 1PH6A 3PO3H 2J7ZA 4ME3A 4DV1Q 1C7YA 4RKLA 4KMUC 1HA5A 3BU2A 3ND9A 4CDEC 3S14B 1RKNA 3S1QH 4KN7C 4FO2A 4UP9A 5CV8A 3HOZG 1HQRD 3PSIA 4DN4M 3PIP3 4HJ5A 1PHJA 3CRKC 3PF4A 5JAVA 3HOYB 4RFBA 4HJAA 4HCSA 3OW7A 4CKCA 5IP9H 4HJ7A 5IGFA 5M3FG 2E76C 4GKJQ 2N3SA 3JAMc 1L0XB 1E2WA 1YNJC 4XT3B 3TP8A 5IWAQ 3HS0C 4AQYQ 1S4ZA 3A0JA 3L3OC 4MZ9A 4AYBE 5IT9E 1HFGA 2R92G 5CMDA 4GNXC 3OYYA 3URYA 3G7LA 2IHEA 4OO1I 1WTPA 2WINB 2QA4A 3RLFA 5C0XG 1E1OA 3F8TA 1CZWA 5FOBB 4BY7H 3NQIA 1KDBA 1IBML 4YWLA 5C3EG 2JJQA 4A3JH 3F2CA 3VR5A 4K8IA 4A3BG 4RAUC 2QF7A 4BBSH 3Q0AA 1BF4A 4R8IA 4A4IA 3TN2A 2Z6KA 2K04A 3ERSX 3Q24A 2F0PA 1UWVA 4YCWA 3K57A 1XPUA 5C5LA 1ZXTA 4HIKA 1MJEA 3AQQA 4GN5A 2OT2A 4G7HC 1NAPA 3Q8DA 4DV0L 4BBRH 2E2DC 2WB1G 1D5MC 2IJ0A 3NTIA 2G9HD 2UUAL 1HNZL 1WCMG 5D3IB 4DUYQ 3GV6A 1FR3A 1A3VA 5C3XA 2Q2IA 1BCPF 1XTCD 1YNXA 2ZXRA 3S2HH 1NJIC 2EYMA 2CFMA 4A3MB 5IIFA 3H3VI 2GVAA 4C3IH 1FGBD 3HOWB 1FGUA 2EJGC 2NZOA 2ICIA 2AUKA 2CW0D 1SN8A 1HTPA 4GS3A 4R4IA 2EY2A 2I5LX 1Y1WB 3S1RB 5C0XI 1O78A 3RN5A 4IO9A 1Y8OB 2R6GA 5LL6S 4JI3L 5EKKA 4DA2A 2PI2A 3I4MB 3QWNA 1B50A 1GUSA 3BVZA 2UXCL 2WP8J 3CCUA 2B63B 5IYBG 1Q7YC 2Z4HA 1RODA 3CCJA 2IHFA 2WAQG 1E24A 2E8GA 1EIYB 2RVLA 4I7AA 1BOSA 2D62A 4PMWA 4PMCA 4QQBX 1LTSD 4R1JA 3GV3A 4ALPA 3IKJA 1PYBA 2ALYB 4DAYA 1IHZA 2F0JA 4PNYA 2RSOA 4HMJA 2AKWB 4GLVB 4I7ZC 3HOZB 1OXTA 2FMMA 2ZM6Q 1H9SB 4A3CG 1QUQA 5D3DA 1UE1A 1IL8A 2E74C 5FJ8G 1TWGH 4C3JH 5M3FB 2B2VA 2ZTDA 2PW5A 1F2MA 4JI0L 1IBKQ 3G48A 2VB2X 3OIPA 3PO2G 3CW2C 5J39A 1K0RA 3M4OH 1AZQA 1FNWA 3MXNA 5JEAH 2CQOA 1C8CA 1H95A 3GTMH 4ABNA 4UY8C 1Y1VH 1D2BA 3TEHB 2I5HA 5IT9c 1STHA 1PRTD 3K59A 2B2VC 2KUMA 4F87A 3J81L 3UDFA 2E5LQ 1Q8KA 4A3KG 1A2UA 3I55A 3CC7A 1U4MA 1X3GA 3T1HQ 3NBIA 1VQCA 1TQOA 4LNQA 1A63A 1ICFB 4NP5A 5M5XH 4A3BB 2Z4IA 3EQLC 4IUVA 2CVRA 1L0YB 5J22A 3BYYB 1O7IA 1QWYA 5IYDH 5NUCA 1HZAA 2EJFC 1M1KC 4PZ8A 1L0WA 4GN4B 4KN4C 4LF8L 2WB1B 3UDGA 1H9JA 4G57A 3CD6A 2XGTA 1KL9A 1DONA 1VF5C 2A74C 4JBJA 4DV7Q 1VQKA 4KJOA 4X3KA 5CBAE 4RMFA 1PYSB 5IGGA 4NXNQ 2MO0A 3L7ZC 1E0BA 4YCUA 4ZKBB 5CV5A 2KEDA 3M9BA 4JOIA 2F3VA 4K2KA 1A6XA 4KV6A 1SE8A 1KHIA 3SEBA 4R4TA 2G9DA 4DV5Q 4IFDH 3GTJB 5M5YB 1F2YA 1PH2A 2F0OA 2IX1A 1FJGL 4G7ZC 2BH2A 4K0KL 1JOQA 1E3PA 4CKEA 4J15A 2PPBC 3RZDH 1WTHA 4LAAA 4U673 1IW7D 1I3QH 1VQ5A 2L5TA 4QGUA 1I94Q 4JOIC 2NN6G 1X3FA 1CHQD 3HG9A 1JOOA 1A0IA 2EY1A 3A5UA 2UXBQ 1LTLA 3VYUA 3A55A 4DV2Q 1I4XA 3T13A 1EEFD 1EIGA 4FF1A 5CV4A 2Y0SG 2AWOA 4IPHA 1JE4A 3S17B 4IFDJ 2RQXA 3FPUB 1QE6A 3T1YL 2A6EC 1K3BC 3V05A 2YV5A 2KQ3A 4JI5Q 1SBBB 5ELBA 2F4VQ 1JE5A 3BVGA 4ZCKA 2OF1A 1S5FD 4ZRZA 1BKBA 1MI2A 4HIOA 2NWGA 3K5NA 3BDOA 4LK1C 4GKJL 3GTKH 1OXVA 1E22A 2B2UC 5IWAL 1NR2A 2L55A 2NB0A 1R4QB 1EZ8A 4AQYL 3CQZH 1EY6A 2O4XA 3QG1A 2TSSA 2CKZB 3PO2B 3HOUG 2OTLA 5C4JB 3K58A 1YIJA 2ENBA 3C46A 4PV1C 1BO0A 3KF8B 4P74A 3T16A 2K6AA 4DAVA 1DXMA 2JE6I 1BR9A 3BZKA 4KTAA 1LYLA 4A3KB 1PTOD 1YEZA 3LGJA 5JVH3 1CKOA 4RHSA 1GUNA 3FKIG 5EPJA 1ONLA 2YTVA 4MIUA 4UAIA 4C2MB 1PFMA 1TR5A 3AB9A 3D3RA 4DNIA 1CSPA 3AYHB 4QY7A 1CZGA 1BCPB 1UEBA 1TWHB 2RDFA 3GTLB 3QOJA 3MWYW 2KEEA 2NVQH 1A3TA 1IBMQ 2PZUA 1KC8C 1QJOA 2QEJC 1JT8A 1VQPA 4KHVA 2YU9H 1PTOC 1STEA 1PFBA 3ITPA 3P75A 4X3TA 3EVQA 1PZJD 1D8LA 3CU7A 1MSHA 2JN4A 4A93G 4DV0Q 4JI1L 4S3SA 3W1BA 1CTMA 4O2DA 1PH5A 2JA7H 5EAYA 2CQAA 2KCTA 2F0MA 3MXUA 2UUAQ
chains in the Genus database with same CATH topology
1HNZQ 1GO3E 4IJLA 5GQOA 3I4NH 3KJOA 3CCRA 3CC2A 3TS2A 4LWCA 3EBEA 1UE7A 3ER0A 4A3MG 2K5VA 2Q2HA 3GO5A 1FL0A 5HY6A 3I4OA 1VQ8A 2ZJQA 5M3MG 2OWOA 5LMNW 3HOWG 1X3EA 2JA6G 2NZHA 4R4CA 2Q2TA 2UXBL 2XTIA 2VL6A 4DV2L 3A5ZB 4DR3L 3B6YA 1W2BA 2VQFL 1Y1WG 5IP7G 2VQEQ 4B3SQ 4GKKL 4GLAC 4DR2Q 4LFCL 1K73C 1W3SA 2EIFA 3CMAA 4A3CH 3G6EA 1YI2A 2OCEA 2GN5A 3KDFB 5FJ8H 4JI4L 3KLWA 4TVAB 4LF6L 3K0XA 3H3VH 4BXXG 1SMXA 1VQ9A 1UE6A 5LMNQ 1VQ6A 3I4MG 3BZCA 4R4QA 4KHPL 4KHZA 4JI6L 3PUWA 4JI5L 2K5NA 1K3RA 3PO2H 4IPGA 4LFBQ 5HGQA 2F4VL 2R93G 1EIFA 2B63G 2GVBA 5FLMH 3HOVG 1X65A 4KLKA 3AFPA 4XTCS 2ZM6L 1OXXK 1XPOA 4P75A 4DR7L 5AJ3Q 1EOVA 2UU9Q 2Q2UA 4YWMA 3H0GG 1BVSA 4LF9Q 4X64Q 1SROA 1TXYA 1KXLA 1PH6A 3DLLA 3U4ZA 3PO3H 4ME3A 4HIMA 3HFZB 4DV1Q 4DV4Q 2UUAQ 4WJ4A 1AE2A 2UUCL 1C7YA 1JJCB 2K75A 5GAGC 5IY0A 4LF7Q 3S16H 4A3EG 1G51A 1PFSA 2ID0A 4BA1I 3PF5A 3BU2A 1K83H 1OXUA 4OWXB 1XPRA 2QEXA 3S1QH 2WFWA 1VCIA 1NBWA 3JAMi 4UP9A 3HOZG 4A3BH 4JI2Q 1PH4A 1IL2A 3HOYG 1N8RC 3PSIA 4FDBA 2BA0A 4X62L 4HJ5A 1PHJA 3PF4A 3STBD 2AHOB 4HJAA 1CSQA 4C2MH 4DV3L 3CAMA 3K81C 4L5RC 4LF5L 5IP9H 5C0XJ 4HJ7A 1VQ7A 3GDEA 5M3FG 2NVXH 1TWHH 4GKJQ 3GTLH 3NELA 2N3SA 3JAMc 3TREA 1N9WA 4P71A 5IWAQ 4Y52H 4LF4L 4LFAL 3IRBA 4A3LH 3U58A 1Z47A 4AQYQ 1EQQA 3A0JA 4MZ9A 2R92G 4AYBE 2JEAI 4DR4Q 4GNXC 3OYYA 1E1TA 1VQMA 4JBMA 2IHEA 3HKZG 4UP7A 4H02A 2DGYA 4OO1I 4DR5L 1N32Q 2ZTEA 3RLFA 2QA4A 5C0XG 1KQSA 1UE5A 3PCOB 1E1OA 1PH8A 1HR0W 1P16A 2Y0SE 3F8TA 2EQSA 1MJCA 1JT8A 5C44H 4BY7H 2HIXA 4A3GH 3STBC 3GTJH 1KRSA 1IBML 1J5EL 4YWLA 4EX5A 2N8NA 5C3EG 2JJQA 3I7FA 3HOXH 3F2CA 1WYDA 4X66Q 4Y7NH 4A76A 4GOPB 4A3IH 3CCLA 1XMOQ 2R7ZH 3J7ZC 4A3BG 1HR0L 2JA8G 1VQBA 4BBSH 1GM5A 3M4PA 3NBHB 4A4IA 4JI8Q 2JK8A 1MKHA 1Q12A 2Z6KA 3ERSX 3MEFA 4AIMA 4YY3Q 4QJFA 1UWVA 3D31A 4YCWA 1XPUA 4HIKA 3CCQA 1N36Q 1VQOA 1VQ4A 1MJEA 3AQQA 1Q1BA 4GN5A 1K8GA 1Y14B 3Q8DA 3BJUA 1KRTA 1P8LA 4BBRH 5GAHC 4DV0L 2E2HH 1N33L 2WB1G 3L0OA 5IYBH 4DUZQ 2JA5H 5LMUL 1AE3A 1S40A 2UUAL 4A3LG 1OTCA 4DKAC 3S17H 1HNZL 1WCMG 4DUYQ 4A3FG 2CCZA 3WWVA 1YVCA 4JC0A 2AMCB 2Q2IA 3PUYA 3GTQH 1M90C 2VY3A 3K7AH 4BY1G 1I94L 4JV5Q 1QUQB 3S24A 1CUKA 1YNXA 1YZ6A 2AWNA 4JI7Q 3S2HH 1J6QA 1NJIC 2CFMA 4X6AH 3I2ZA 3PV0A 1QVGA 3H3VI 1L1OB 1B70B 1TWAH 2GVAA 5E7NA 3OW2A 4A3JH 4C3IH 1LUZA 4B3MQ 3U4VA 1FGUA 1PV4A 2NZOA 1KD1C 4B3SL 1SN8A 4B3RQ 1VS0A 4GS3A 4DR2L 3RR5A 4R4IA 1HNXQ 2D0PA 4MNOA 1VQFA 1CKMA 1GD7A 2NVTH 2I5LX 4QL5A 2R7ZG 2A19A 4OO1G 3KJPA 1V1QA 4DK6C 3PGZA 5C0XI 3K8AA 3AEVA 5LMNL 3RN5A 2RF4A 4PZ7A 4IO9A 1FJGQ 3S15H 4UP8A 3HKZE 4DAMA 4K0KQ 2Z0SA 2KENA 1I6HH 2YTXA 1RL2A 2JA9A 1NMGA 2R6GA 3S14H 2MQHA 4JI3L 4LFBL 4OWTB 1SRUA 2PI2A 2HHHQ 4PG3A 3UDIA 2RHQB 3CCSA 5C4XG 2UXCL 3E9HA 5C4JH 2WP8J 1G6PA 3HOUH 4DV6L 3CCUA 4GOPA 1Z9FA 5AJ3L 3S1NH 2UU9L 4DR3Q 5IYBG 5ELOA 1Q7YC 2I5MX 4X64L 1PH1A 2JA5G 1U0LA 1XMQQ 2K50A 3CCJA 1HZ9A 2JA7G 2YYZA 4XIGS 2IHFA 1HNWL 1JJGA 2WAQG 1E24A 1YHBA 4DV1L 4DV4L 1RIPA 2E8GA 2LXKA 3CP0A 1EIYB 1EQRA 3I4NG 2D62A 1VQGA 4PMWA 4JI4Q 2OQKA 4DPGA 4QQBX 4R1JA 3TQYA 4A3KH 4LF6Q 3OTOQ 4ALPA 1KAWA 1G291 3PIOA 3T1YQ 1Q86C 1PH3A 1PYBA 2ALYB 3I56A 4JI6Q 2I0QA 3J7A5 3W1GA 2EXDA 4GOPC 5FLXc 2PMZE 1WOCA 3UE0A 2K52A 2AKWB 4GLVB 2VNUD 2UUBQ 2IX0A 1L2FA 1OXTA 4B3TQ 3G71A 2R7FA 2ZM6Q 4IJHA 4C3HH 2E2IH 3CXCA 4A3CG 2V1CC 1QUQA 1UE1A 2JQOA 5FJ8G 1EYGA 1TWGH 4MTNA 4C3JH 1WJJA 2ZTDA 3U50C 1L1OA 4IOCA 3K7UC 3UDXA 4JI0L 2UUCQ 1YHAA 5GADC 1IBKQ 3G48A 3J81j 3PO2G 1X9NA 5JJKA 3CW2C 5GAEC 1HH2P 1K0RA 2A1AA 2PQAB 3K80C 5FLMG 3M4OH 4YWKA 1D7QA 2CQOA 1H95A 3GTMH 2ES2A 1E7ZA 4P73A 3RN2A 2CWPA 4YHHQ 4UY8C 1VQAA 3S2DH 2LSSA 1Y1VH 3TEHB 4OXPA 2I5HA 5IT9c 4POGA 3F2BA 4X65Q 4KI0A 1BBUA 1VQDA 4DV3Q 2ASBA 1L1OC 4NPSA 2MO1A 1YITA 3PO3G 2NN6I 3UDFA 3H15A 1Q8KA 4JBWA 2E5LQ 4A93H 2VW9A 4A3KG 1XNQQ 4GN3B 4OX9Q 3GD7A 1XMOL 3I55A 3FHWA 5BR8Q 3PIPA 1IBLL 3CC7A 1QVFA 4LF4Q 3T1HQ 1X3GA 1VQCA 2A8VA 4JI8L 4LNQA 3KFUA 1A63A 4DR1L 3TRZA 4IPDA 5M5XH 1VQEA 1YJWA 4NB3A 3A74A 4LUOA 1N36L 4RG1A 1CKNA 1JB7A 2VUMH 5M3MH 1IZ6A 3HOWH 2JA6H 1VQLA 2WAQE 2BA1A 3E0EA 5IP9G 1O7IA 1TWCH 5IYCH 2E2JH 3CMEA 4P72A 4DUZL 1NTGA 3RLNA 5IYDH 1HZAA 4DAYB 1Y1WH 4AH6A 1M1KC 4DUYL 4PZ8A 1L0WA 5IP7H 4GN4B 4LW1A 4LF8L 2KCMA 4R4OA 3UDGA 4LF9L 1R9TH 4NXMQ 3CD6A 3ULJA 1PH7A 2UXDQ 2XGTA 1KL9A 4JBJA 4LUVA 4DV7Q 1VQKA 1NY4A 1A62A 4IOAA 4JYAQ 2Z6KC 3DM3A 4OONA 4JI7L 1HZCA 4RMFA 3I4MH 1PYSB 1Q1EA 2MO0A 3L7ZC 4NXNQ 5GROA 1OXSC 1QVCA 4DR6Q 1Y1VG 3D0FA 1JJ2A 1C9OA 4YCUA 3CPFA 2QGQA 3M9BA 4IPCA 2ZJPA 1Q82C 3JC66 4JOIA 4B3RL 3HOVH 4WJ3M 1SE8A 1HNXL 2ZJRA 5C44G 1KHIA 2VQEL 4A3GG 4BY7G 4R4TA 1I5FA 3HKSA 3W5OA 4DV5Q 1YJ9A 4A3JG 2PQAA 4JI1Q 3HOXG 4A3IG 3MXNB 1PH2A 1PH9A 3J80i 1N34Q 1FJGL 1Q46A 3PUVA 5LMUQ 2BH2A 2IX1A 4BA2I 1E3PA 4K0KL 4J15A 1JMCA 2RCNA 4BBSG 3E9IA 3RZDH 1XNRQ 1VQ5A 1I3QH 2VUMG 4A3EH 2HQLA 2HHHL 4QGUA 3M85A 3GTPH 3SGIA 1I94Q 2L15A 5ELNA 1AH9A 4JOIC 2NN6G 2DUDA 1X3FA 1LM0A 4AYBG 2PI2E 3AFQA 2KHJA 5IYCG 3HOZH 1FVIA 1A0IA 4UPAA 3A5UA 3L2PA 3UE1A 4BBRG 3F1ZA 3J80c 3HOYH 2UXBQ 2F52A 5JJIA 1XTDA 5IYDG 1LTLA 1XMQL 4DV2Q 3S1MH 4POFA 1Q81C 3M7NA 1HJPA 2LXJA 2VQFQ 2Y0SG 3PUZA 1VQJA 2AWOA 4IPHA 3J81i 3CPWA 3F2DA 1VQHA 3VDYA 1ASZA 4GKKQ 2KBNA 1CKNB 5M3FH 4LFCQ 4IFDJ 1U5KA 3CCVA 4LF7L 3OTOL 4JBKA 3T1YL 2K14A 4L5SA 2IY5B 2YV5A 4JI3Q 4KHPQ 2R92H 4JI2L 5JJLA 2YTYA 4HIDA 4JI5Q 2UUBL 4O0AA 3ULLA 3GTOH 2HT1A 1QZGA 3J81c 4B3TL 2F4VQ 1JE5A 3FKIH 2C35B 1EUJA 5J3BA 2UXCQ 2KHIA 2WB1E 1WFQA 4DV6Q 1X54A 1HZBA 2F3IA 1NMFA 1BKBA 3KF6A 1WI5A 2H5XA 4HIOA 3EIVA 4DR7Q 4GKJL 3GTKH 1HNWQ 1IYJB 1XJVA 2PNHA 1OXVA 1E22A 5IWAL 1SFOH 1S72A 1IBKL 4GLXA 1PA6A 4AQYL 4L5QA 5C3EH 5IE8A 3CQZH 1YJNA 1ASYA 4A3DH 2K5HA 3GTGH 4DR4L 2N78A 3PUXA 1SLJA 4JCVE 3ZJYC 1K8AC 2JA8H 1K9MC 4IFDG 1I50H 1N32L 1YBYA 2CKZB 2CWAA 4LUZA 3HOUG 2OTLA 3KOJA 1IXRA 4YHHL 4GNXA 4A75A 2NVYH 3CCMA 1YIJA 2BH8A 1KIXA 4X62Q 2B29A 4X65L 4YCVA 3KF8B 4P74A 2E5LL 2HIVA 1XNQL 4OX9L 1GKHA 4LF5Q 2JE6I 5BR8L 2MFIA 5K36G 4PZ6A 3BZKA 3T1HL 4X66L 1LYLA 2IT1A 1V43A 2D0OA 3KYHC 3RNUA 1QZHA 4JI0Q 1VQNA 1WCMH 4A3FH 4LFAQ 1MIUA 1YEZA 3LGJA 4EQ5A 3ULPA 4APVA 1CKOA 4DK3C 2OTJA 2ZTCA 3NENA 1A8VA 5M5WH 4OWWB 1BBWA 4YY3L 3FKIG 1S3OA 4BY1H 1VQIA 4A3MH 2YTVA 3KDFA 4JG2A 3M3YH 4DR5Q 1X6OA 2JEBI 1PVOA 1EWIA 3RZOH 5JEAJ 4HJ9A 1NE3A 4DNIA 1CSPA 3AYHB 4QY7A 1YHQA 1C0AA 2K4KA 5M5YH 4NXML 2OQ0A 1UEBA 2FXQA 2UXDL 5DLQE 3EN2A 3S1RH 4A3DG 2NVQH 4DV7L 1TWFH 1B7YB 4JYAL 1IBMQ 1J5EQ 1IBLQ 1B8AA 2N49A 4JV5L 1KC8C 3KF6B 3CF5A 1GVPA 1V9PA 3NEMA 4NXNL 3CC4A 1VQPA 4IFDI 3FP9A 4BXXH 4DR1Q 1X55A 5JEAG 1HR0Q 4DR6L 3RLOA 2YU9H 4HJ8A 2ATWA 4TQUS 3ICEA 2R7DA 4B3ML 4L5TA 3TS0A 2MNAA 2R93H 5C4XH 4QIWE 3M4QA 1DGSA 2B63H 1D8LA 4DV5L 4A93G 1X56A 3G4SA 2B3GA 4DV0Q 5H1SE 4JI1L 1EFWA 1N34L 1N33Q 1SR3A 3W1BA 2JA7H 2RHSB 4O2DA 1PH5A 3CCEA 5EAYA 3H0GH 2KCTA 2VZAA 4GNXB 4LF8Q 1XNRL 1T9HA 2VS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ Q;  1GO3 E;  4IJL A;  5GQO A;  3I4N H;  3KJO A;  3CCR A;  3CC2 A;  3TS2 A;  4LWC A;  3EBE A;  1UE7 A;  3ER0 A;  4A3M G;  2K5V A;  2Q2H A;  3GO5 A;  1FL0 A;  5HY6 A;  3I4O A;  1VQ8 A;  2ZJQ A;  5M3M G;  2OWO A;  5LMN W;  3HOW G;  1X3E A;  2JA6 G;  2NZH A;  4R4C A;  2Q2T A;  2UXB L;  2XTI A;  2VL6 A;  4DV2 L;  3A5Z B;  4DR3 L;  3B6Y A;  1W2B A;  2VQF L;  1Y1W G;  5IP7 G;  2VQE Q;  4B3S Q;  4GKK L;  4GLA C;  4DR2 Q;  4LFC L;  1K73 C;  1W3S A;  2EIF A;  3CMA A;  4A3C H;  3G6E A;  1YI2 A;  2OCE A;  2GN5 A;  3KDF B;  5FJ8 H;  4JI4 L;  3KLW A;  4TVA B;  4LF6 L;  3K0X A;  3H3V H;  4BXX G;  1SMX A;  1VQ9 A;  1UE6 A;  5LMN Q;  1VQ6 A;  3I4M G;  3BZC A;  4R4Q A;  4KHP L;  4KHZ A;  4JI6 L;  3PUW A;  4JI5 L;  2K5N A;  1K3R A;  3PO2 H;  4IPG A;  4LFB Q;  5HGQ A;  2F4V L;  2R93 G;  1EIF A;  2B63 G;  2GVB A;  5FLM H;  3HOV G;  1X65 A;  4KLK A;  3AFP A;  4XTC S;  2ZM6 L;  1OXX K;  1XPO A;  4P75 A;  4DR7 L;  5AJ3 Q;  1EOV A;  2UU9 Q;  2Q2U A;  4YWM A;  3H0G G;  1BVS A;  4LF9 Q;  4X64 Q;  1SRO A;  1TXY A;  1KXL A;  1PH6 A;  3DLL A;  3U4Z A;  3PO3 H;  4ME3 A;  4HIM A;  3HFZ B;  4DV1 Q;  4DV4 Q;  2UUA Q;  4WJ4 A;  1AE2 A;  2UUC L;  1C7Y A;  1JJC B;  2K75 A;  5GAG C;  5IY0 A;  4LF7 Q;  3S16 H;  4A3E G;  1G51 A;  1PFS A;  2ID0 A;  4BA1 I;  3PF5 A;  3BU2 A;  1K83 H;  1OXU A;  4OWX B;  1XPR A;  2QEX A;  3S1Q H;  2WFW A;  1VCI A;  1NBW A;  3JAM i;  4UP9 A;  3HOZ G;  4A3B H;  4JI2 Q;  1PH4 A;  1IL2 A;  3HOY G;  1N8R C;  3PSI A;  4FDB A;  2BA0 A;  4X62 L;  4HJ5 A;  1PHJ A;  3PF4 A;  3STB D;  2AHO B;  4HJA A;  1CSQ A;  4C2M H;  4DV3 L;  3CAM A;  3K81 C;  4L5R C;  4LF5 L;  5IP9 H;  5C0X J;  4HJ7 A;  1VQ7 A;  3GDE A;  5M3F G;  2NVX H;  1TWH H;  4GKJ Q;  3GTL H;  3NEL A;  2N3S A;  3JAM c;  3TRE A;  1N9W A;  4P71 A;  5IWA Q;  4Y52 H;  4LF4 L;  4LFA L;  3IRB A;  4A3L H;  3U58 A;  1Z47 A;  4AQY Q;  1EQQ A;  3A0J A;  4MZ9 A;  2R92 G;  4AYB E;  2JEA I;  4DR4 Q;  4GNX C;  3OYY A;  1E1T A;  1VQM A;  4JBM A;  2IHE A;  3HKZ G;  4UP7 A;  4H02 A;  2DGY A;  4OO1 I;  4DR5 L;  1N32 Q;  2ZTE A;  3RLF A;  2QA4 A;  5C0X G;  1KQS A;  1UE5 A;  3PCO B;  1E1O A;  1PH8 A;  1HR0 W;  1P16 A;  2Y0S E;  3F8T A;  2EQS A;  1MJC A;  1JT8 A;  5C44 H;  4BY7 H;  2HIX A;  4A3G H;  3STB C;  3GTJ H;  1KRS A;  1IBM L;  1J5E L;  4YWL A;  4EX5 A;  2N8N A;  5C3E G;  2JJQ A;  3I7F A;  3HOX H;  3F2C A;  1WYD A;  4X66 Q;  4Y7N H;  4A76 A;  4GOP B;  4A3I H;  3CCL A;  1XMO Q;  2R7Z H;  3J7Z C;  4A3B G;  1HR0 L;  2JA8 G;  1VQB A;  4BBS H;  1GM5 A;  3M4P A;  3NBH B;  4A4I A;  4JI8 Q;  2JK8 A;  1MKH A;  1Q12 A;  2Z6K A;  3ERS X;  3MEF A;  4AIM A;  4YY3 Q;  4QJF A;  1UWV A;  3D31 A;  4YCW A;  1XPU A;  4HIK A;  3CCQ A;  1N36 Q;  1VQO A;  1VQ4 A;  1MJE A;  3AQQ A;  1Q1B A;  4GN5 A;  1K8G A;  1Y14 B;  3Q8D A;  3BJU A;  1KRT A;  1P8L A;  4BBR H;  5GAH C;  4DV0 L;  2E2H H;  1N33 L;  2WB1 G;  3L0O A;  5IYB H;  4DUZ Q;  2JA5 H;  5LMU L;  1AE3 A;  1S40 A;  2UUA L;  4A3L G;  1OTC A;  4DKA C;  3S17 H;  1HNZ L;  1WCM G;  4DUY Q;  4A3F G;  2CCZ A;  3WWV A;  1YVC A;  4JC0 A;  2AMC B;  2Q2I A;  3PUY A;  3GTQ H;  1M90 C;  2VY3 A;  3K7A H;  4BY1 G;  1I94 L;  4JV5 Q;  1QUQ B;  3S24 A;  1CUK A;  1YNX A;  1YZ6 A;  2AWN A;  4JI7 Q;  3S2H H;  1J6Q A;  1NJI C;  2CFM A;  4X6A H;  3I2Z A;  3PV0 A;  1QVG A;  3H3V I;  1L1O B;  1B70 B;  1TWA H;  2GVA A;  5E7N A;  3OW2 A;  4A3J H;  4C3I H;  1LUZ A;  4B3M Q;  3U4V A;  1FGU A;  1PV4 A;  2NZO A;  1KD1 C;  4B3S L;  1SN8 A;  4B3R Q;  1VS0 A;  4GS3 A;  4DR2 L;  3RR5 A;  4R4I A;  1HNX Q;  2D0P A;  4MNO A;  1VQF A;  1CKM A;  1GD7 A;  2NVT H;  2I5L X;  4QL5 A;  2R7Z G;  2A19 A;  4OO1 G;  3KJP A;  1V1Q A;  4DK6 C;  3PGZ A;  5C0X I;  3K8A A;  3AEV A;  5LMN L;  3RN5 A;  2RF4 A;  4PZ7 A;  4IO9 A;  1FJG Q;  3S15 H;  4UP8 A;  3HKZ E;  4DAM A;  4K0K Q;  2Z0S A;  2KEN A;  1I6H H;  2YTX A;  1RL2 A;  2JA9 A;  1NMG A;  2R6G A;  3S14 H;  2MQH A;  4JI3 L;  4LFB L;  4OWT B;  1SRU A;  2PI2 A;  2HHH Q;  4PG3 A;  3UDI A;  2RHQ B;  3CCS A;  5C4X G;  2UXC L;  3E9H A;  5C4J H;  2WP8 J;  1G6P A;  3HOU H;  4DV6 L;  3CCU A;  4GOP A;  1Z9F A;  5AJ3 L;  3S1N H;  2UU9 L;  4DR3 Q;  5IYB G;  5ELO A;  1Q7Y C;  2I5M X;  4X64 L;  1PH1 A;  2JA5 G;  1U0L A;  1XMQ Q;  2K50 A;  3CCJ A;  1HZ9 A;  2JA7 G;  2YYZ A;  4XIG S;  2IHF A;  1HNW L;  1JJG A;  2WAQ G;  1E24 A;  1YHB A;  4DV1 L;  4DV4 L;  1RIP A;  2E8G A;  2LXK A;  3CP0 A;  1EIY B;  1EQR A;  3I4N G;  2D62 A;  1VQG A;  4PMW A;  4JI4 Q;  2OQK A;  4DPG A;  4QQB X;  4R1J A;  3TQY A;  4A3K H;  4LF6 Q;  3OTO Q;  4ALP A;  1KAW A;  1G29 1;  3PIO A;  3T1Y Q;  1Q86 C;  1PH3 A;  1PYB A;  2ALY B;  3I56 A;  4JI6 Q;  2I0Q A;  3J7A 5;  3W1G A;  2EXD A;  4GOP C;  5FLX c;  2PMZ E;  1WOC A;  3UE0 A;  2K52 A;  2AKW B;  4GLV B;  2VNU D;  2UUB Q;  2IX0 A;  1L2F A;  1OXT A;  4B3T Q;  3G71 A;  2R7F A;  2ZM6 Q;  4IJH A;  4C3H H;  2E2I H;  3CXC A;  4A3C G;  2V1C C;  1QUQ A;  1UE1 A;  2JQO A;  5FJ8 G;  1EYG A;  1TWG H;  4MTN A;  4C3J H;  1WJJ A;  2ZTD A;  3U50 C;  1L1O A;  4IOC A;  3K7U C;  3UDX A;  4JI0 L;  2UUC Q;  1YHA A;  5GAD C;  1IBK Q;  3G48 A;  3J81 j;  3PO2 G;  1X9N A;  5JJK A;  3CW2 C;  5GAE C;  1HH2 P;  1K0R A;  2A1A A;  2PQA B;  3K80 C;  5FLM G;  3M4O H;  4YWK A;  1D7Q A;  2CQO A;  1H95 A;  3GTM H;  2ES2 A;  1E7Z A;  4P73 A;  3RN2 A;  2CWP A;  4YHH Q;  4UY8 C;  1VQA A;  3S2D H;  2LSS A;  1Y1V H;  3TEH B;  4OXP A;  2I5H A;  5IT9 c;  4POG A;  3F2B A;  4X65 Q;  4KI0 A;  1BBU A;  1VQD A;  4DV3 Q;  2ASB A;  1L1O C;  4NPS A;  2MO1 A;  1YIT A;  3PO3 G;  2NN6 I;  3UDF A;  3H15 A;  1Q8K A;  4JBW A;  2E5L Q;  4A93 H;  2VW9 A;  4A3K G;  1XNQ Q;  4GN3 B;  4OX9 Q;  3GD7 A;  1XMO L;  3I55 A;  3FHW A;  5BR8 Q;  3PIP A;  1IBL L;  3CC7 A;  1QVF A;  4LF4 Q;  3T1H Q;  1X3G A;  1VQC A;  2A8V A;  4JI8 L;  4LNQ A;  3KFU A;  1A63 A;  4DR1 L;  3TRZ A;  4IPD A;  5M5X H;  1VQE A;  1YJW A;  4NB3 A;  3A74 A;  4LUO A;  1N36 L;  4RG1 A;  1CKN A;  1JB7 A;  2VUM H;  5M3M H;  1IZ6 A;  3HOW H;  2JA6 H;  1VQL A;  2WAQ E;  2BA1 A;  3E0E A;  5IP9 G;  1O7I A;  1TWC H;  5IYC H;  2E2J H;  3CME A;  4P72 A;  4DUZ L;  1NTG A;  3RLN A;  5IYD H;  1HZA A;  4DAY B;  1Y1W H;  4AH6 A;  1M1K C;  4DUY L;  4PZ8 A;  1L0W A;  5IP7 H;  4GN4 B;  4LW1 A;  4LF8 L;  2KCM A;  4R4O A;  3UDG A;  4LF9 L;  1R9T H;  4NXM Q;  3CD6 A;  3ULJ A;  1PH7 A;  2UXD Q;  2XGT A;  1KL9 A;  4JBJ A;  4LUV A;  4DV7 Q;  1VQK A;  1NY4 A;  1A62 A;  4IOA A;  4JYA Q;  2Z6K C;  3DM3 A;  4OON A;  4JI7 L;  1HZC A;  4RMF A;  3I4M H;  1PYS B;  1Q1E A;  2MO0 A;  3L7Z C;  4NXN Q;  5GRO A;  1OXS C;  1QVC A;  4DR6 Q;  1Y1V G;  3D0F A;  1JJ2 A;  1C9O A;  4YCU A;  3CPF A;  2QGQ A;  3M9B A;  4IPC A;  2ZJP A;  1Q82 C;  3JC6 6;  4JOI A;  4B3R L;  3HOV H;  4WJ3 M;  1SE8 A;  1HNX L;  2ZJR A;  5C44 G;  1KHI A;  2VQE L;  4A3G G;  4BY7 G;  4R4T A;  1I5F A;  3HKS A;  3W5O A;  4DV5 Q;  1YJ9 A;  4A3J G;  2PQA A;  4JI1 Q;  3HOX G;  4A3I G;  3MXN B;  1PH2 A;  1PH9 A;  3J80 i;  1N34 Q;  1FJG L;  1Q46 A;  3PUV A;  5LMU Q;  2BH2 A;  2IX1 A;  4BA2 I;  1E3P A;  4K0K L;  4J15 A;  1JMC A;  2RCN A;  4BBS G;  3E9I A;  3RZD H;  1XNR Q;  1VQ5 A;  1I3Q H;  2VUM G;  4A3E H;  2HQL A;  2HHH L;  4QGU A;  3M85 A;  3GTP H;  3SGI A;  1I94 Q;  2L15 A;  5ELN A;  1AH9 A;  4JOI C;  2NN6 G;  2DUD A;  1X3F A;  1LM0 A;  4AYB G;  2PI2 E;  3AFQ A;  2KHJ A;  5IYC G;  3HOZ H;  1FVI A;  1A0I A;  4UPA A;  3A5U A;  3L2P A;  3UE1 A;  4BBR G;  3F1Z A;  3J80 c;  3HOY H;  2UXB Q;  2F52 A;  5JJI A;  1XTD A;  5IYD G;  1LTL A;  1XMQ L;  4DV2 Q;  3S1M H;  4POF A;  1Q81 C;  3M7N A;  1HJP A;  2LXJ A;  2VQF Q;  2Y0S G;  3PUZ A;  1VQJ A;  2AWO A;  4IPH A;  3J81 i;  3CPW A;  3F2D A;  1VQH A;  3VDY A;  1ASZ A;  4GKK Q;  2KBN A;  1CKN B;  5M3F H;  4LFC Q;  4IFD J;  1U5K A;  3CCV A;  4LF7 L;  3OTO L;  4JBK A;  3T1Y L;  2K14 A;  4L5S A;  2IY5 B;  2YV5 A;  4JI3 Q;  4KHP Q;  2R92 H;  4JI2 L;  5JJL A;  2YTY A;  4HID A;  4JI5 Q;  2UUB L;  4O0A A;  3ULL A;  3GTO H;  2HT1 A;  1QZG A;  3J81 c;  4B3T L;  2F4V Q;  1JE5 A;  3FKI H;  2C35 B;  1EUJ A;  5J3B A;  2UXC Q;  2KHI A;  2WB1 E;  1WFQ A;  4DV6 Q;  1X54 A;  1HZB A;  2F3I A;  1NMF A;  1BKB A;  3KF6 A;  1WI5 A;  2H5X A;  4HIO A;  3EIV A;  4DR7 Q;  4GKJ L;  3GTK H;  1HNW Q;  1IYJ B;  1XJV A;  2PNH A;  1OXV A;  1E22 A;  5IWA L;  1SFO H;  1S72 A;  1IBK L;  4GLX A;  1PA6 A;  4AQY L;  4L5Q A;  5C3E H;  5IE8 A;  3CQZ H;  1YJN A;  1ASY A;  4A3D H;  2K5H A;  3GTG H;  4DR4 L;  2N78 A;  3PUX A;  1SLJ A;  4JCV E;  3ZJY C;  1K8A C;  2JA8 H;  1K9M C;  4IFD G;  1I50 H;  1N32 L;  1YBY A;  2CKZ B;  2CWA A;  4LUZ A;  3HOU G;  2OTL A;  3KOJ A;  1IXR A;  4YHH L;  4GNX A;  4A75 A;  2NVY H;  3CCM A;  1YIJ A;  2BH8 A;  1KIX A;  4X62 Q;  2B29 A;  4X65 L;  4YCV A;  3KF8 B;  4P74 A;  2E5L L;  2HIV A;  1XNQ L;  4OX9 L;  1GKH A;  4LF5 Q;  2JE6 I;  5BR8 L;  2MFI A;  5K36 G;  4PZ6 A;  3BZK A;  3T1H L;  4X66 L;  1LYL A;  2IT1 A;  1V43 A;  2D0O A;  3KYH C;  3RNU A;  1QZH A;  4JI0 Q;  1VQN A;  1WCM H;  4A3F H;  4LFA Q;  1MIU A;  1YEZ A;  3LGJ A;  4EQ5 A;  3ULP A;  4APV A;  1CKO A;  4DK3 C;  2OTJ A;  2ZTC A;  3NEN A;  1A8V A;  5M5W H;  4OWW B;  1BBW A;  4YY3 L;  3FKI G;  1S3O A;  4BY1 H;  1VQI A;  4A3M H;  2YTV A;  3KDF A;  4JG2 A;  3M3Y H;  4DR5 Q;  1X6O A;  2JEB I;  1PVO A;  1EWI A;  3RZO H;  5JEA J;  4HJ9 A;  1NE3 A;  4DNI A;  1CSP A;  3AYH B;  4QY7 A;  1YHQ A;  1C0A A;  2K4K A;  5M5Y H;  4NXM L;  2OQ0 A;  1UEB A;  2FXQ A;  2UXD L;  5DLQ E;  3EN2 A;  3S1R H;  4A3D G;  2NVQ H;  4DV7 L;  1TWF H;  1B7Y B;  4JYA L;  1IBM Q;  1J5E Q;  1IBL Q;  1B8A A;  2N49 A;  4JV5 L;  1KC8 C;  3KF6 B;  3CF5 A;  1GVP A;  1V9P A;  3NEM A;  4NXN L;  3CC4 A;  1VQP A;  4IFD I;  3FP9 A;  4BXX H;  4DR1 Q;  1X55 A;  5JEA G;  1HR0 Q;  4DR6 L;  3RLO A;  2YU9 H;  4HJ8 A;  2ATW A;  4TQU S;  3ICE A;  2R7D A;  4B3M L;  4L5T A;  3TS0 A;  2MNA A;  2R93 H;  5C4X H;  4QIW E;  3M4Q A;  1DGS A;  2B63 H;  1D8L A;  4DV5 L;  4A93 G;  1X56 A;  3G4S A;  2B3G A;  4DV0 Q;  5H1S E;  4JI1 L;  1EFW A;  1N34 L;  1N33 Q;  1SR3 A;  3W1B A;  2JA7 H;  2RHS B;  4O2D A;  1PH5 A;  3CCE A;  5EAY A;  3H0G H;  2KCT A;  2VZA A;  4GNX B;  4LF8 Q;  1XNR L;  1T9H A;  2VS1 A; 
#chains in the Genus database with same CATH topology
 1WTW A;  4Y7N B;  1HNZ Q;  5GQO A;  3CC2 A;  3TS2 A;  4LWC A;  2R3Z A;  3ER0 A;  2HQE A;  1BDO A;  2KA7 A;  5M3M G;  5LMN W;  1EY5 A;  2VL6 A;  2E2J B;  2EYO A;  3AU7 A;  3A7A B;  2VQF L;  2OXP A;  4GKK L;  4GLA C;  1W3S A;  3CMA A;  1TS3 A;  2Y0S B;  5A2Q E;  5JJZ A;  4IUR A;  3KLW A;  3K0X A;  4QMG A;  1VQ6 A;  3BZC A;  1EY9 A;  3P1H A;  4XQJ A;  1WTQ A;  2K33 A;  1R4P B;  2K5N A;  2R93 G;  3T4A C;  1F9Q A;  2CH4 W;  1HHV A;  1RHP A;  2ZM6 L;  4ZQ3 A;  1DCZ A;  4DR7 L;  1EOV A;  4LF9 Q;  3FEW X;  1SRO A;  1IKL A;  5FLX E;  3U4Z A;  1B3Q A;  3NSW A;  4IN3 A;  3U9O A;  1PFS A;  3RD4 A;  1OXU A;  1T5X D;  4A3E B;  2XSC A;  1XPR A;  1NBW A;  3JAM i;  3TP7 A;  2AQ1 B;  4JI2 Q;  1IL2 A;  5EBC A;  3HOY G;  4FDB A;  5ELC A;  3STB D;  2AHO B;  3JAM E;  3HOU B;  2OEO A;  1X3Q A;  4ILW A;  3S1N B;  3K81 C;  5I9O A;  1DZ1 A;  1I6H B;  1RD9 D;  3GDE A;  3TRE A;  1N9W A;  1NSN S;  4OIK A;  1SYD A;  3MVV A;  1JWS D;  4LMQ D;  3SK5 A;  2SEB D;  1E1T A;  1VQM A;  3HKZ G;  3GTO B;  4DR5 L;  1MGS A;  1CI3 M;  3FKI B;  1UE5 A;  4HMI A;  3BS1 A;  2Z8L A;  1XX8 A;  1MJC A;  3I91 A;  2E2I B;  3KK7 A;  3STB C;  5AFW A;  1Q3L A;  5D65 A;  1ENA A;  3HZX A;  1ASZ A;  4NKL A;  3HOX H;  4A3I H;  1WYD A;  2K1B A;  5ISR A;  1VQB A;  1GM5 A;  3M4P A;  3NBH B;  2JK8 A;  1MKH A;  4YY3 Q;  3KBX A;  1H9R A;  3CCQ A;  3OHX C;  3TZU A;  1Q1B A;  1K8G A;  1J8I A;  3A8K E;  1Y14 B;  5HGT A;  1KRT A;  4U68 A;  1KAA A;  1P8L A;  5IGE A;  3L0O A;  3FPP A;  4A93 B;  1HFN A;  1AE3 A;  3A8I E;  1VMP A;  5E1F A;  3ERO A;  1JWU D;  1PTO H;  1H9S A;  3GTQ H;  3ERQ A;  2VY3 A;  1D1I A;  2EY6 A;  4BY1 G;  4XQQ A;  1M90 C;  1I94 L;  4EVO A;  3TP6 A;  3W3A A;  5CV9 A;  2ZXO A;  1LTA D;  3I2Z A;  1L1O B;  1B70 B;  1EWH A;  4CKB A;  3OW2 A;  2O5I C;  5M3M B;  5KIX A;  3U4V A;  2KCN A;  1KD1 C;  1TWC B;  4DGZ A;  2E75 C;  4MNO A;  1VQF A;  1CKM A;  1O7L A;  4ULL A;  2A19 A;  5J1Z A;  3KJP A;  4OO1 G;  5C4Z A;  4UHV A;  3OPO A;  2KVM A;  1TWF B;  5HUR A;  3NTK A;  1I4Q A;  5DEH A;  5LMN L;  4PZ7 A;  3S15 H;  1FJG Q;  4UP8 A;  4K0K Q;  5C5M A;  1STN A;  1HQM C;  2JA9 A;  2EYF A;  2A6H C;  3S14 H;  3R8B A;  3FRP B;  2MQH A;  2FJ2 A;  2F0G A;  4IUU A;  4OWT B;  5EPK A;  1SRU A;  4N8X 1;  4TRD A;  3ND8 A;  2RHQ B;  3CCS A;  1EOT A;  3E9H A;  2K32 A;  4OL7 A;  2R93 B;  5C4X B;  5FKA C;  4GOP A;  4XDX A;  5AJ3 L;  4DR3 Q;  1M4V A;  2F0Q A;  2ZXP A;  3SXH A;  1HZ9 A;  3A54 A;  4DV4 L;  1EY7 A;  1RJT A;  1JR0 D;  3NTH A;  3I4N G;  1EYC A;  1RF2 D;  2OQK A;  3TQY A;  3QOL A;  2XRS D;  3T1Y Q;  4FYD A;  1Q86 C;  1PH3 A;  4JI6 Q;  2I0Q A;  3SK6 A;  1QOH A;  4GOP C;  5FLX c;  3U9S A;  3UE0 A;  4CBV A;  2C5C A;  3TBI B;  2VNU D;  3T53 B;  1BNZ A;  1GOZ A;  4RHR A;  5KYL A;  4QF4 A;  3MZ5 A;  5LHY 1;  3CXC A;  2V1C C;  4K5V A;  2K28 A;  4IQZ A;  1QIL A;  2G5D A;  1SEB D;  1WJJ A;  4L63 B;  4IOC A;  2DN8 A;  3UDX A;  2UUC Q;  2PQE A;  3OMC A;  3J81 j;  2FMC A;  5I9P A;  3NP8 A;  2A1A A;  5FLM G;  2QKI C;  3E0J A;  2M2L A;  1EU4 A;  3HKZ B;  1TY2 A;  2L0C A;  4DXG A;  4POG A;  2C9O A;  4KI0 A;  4CJ0 B;  1GJX A;  1J9O A;  4NPS A;  1YIT A;  5DNF A;  1B44 D;  1SJH D;  3PO3 B;  1XMO L;  3FHW A;  3PIP A;  1QVF A;  4QB4 A;  1EZ6 A;  2SDF A;  4O42 A;  3GTG B;  2F0K A;  2NBF A;  1KNE A;  2RBM A;  4X3U A;  4NB3 A;  1EWC A;  3A74 A;  4LUO A;  2Z6B A;  1N36 L;  2NVY B;  3HOW H;  2JA6 H;  2WAQ E;  3E0E A;  1W6J A;  1S5C D;  3CME A;  4N9T A;  4DUZ L;  2EXZ A;  1GUO A;  4KKT A;  1Y1W H;  4AH6 A;  4RGO S;  4LF9 L;  1PH7 A;  1ZKO A;  5JVG 3;  4B08 A;  2RCF A;  2Z6K C;  4OON A;  5EQ0 A;  5A35 A;  1Q90 A;  1HZC A;  3I4M H;  3OWF A;  1OXS C;  1QVC A;  4BY1 B;  1Y1V G;  2SOB A;  2EYH A;  3CPF A;  5JOB A;  4IPC A;  3M3Y B;  1Q82 C;  4B3R L;  1CK1 A;  4OIJ A;  1HNX L;  2ZJR A;  5C44 G;  4A3G G;  1E2V A;  1RDP D;  1I5F A;  2PQA A;  4JI1 Q;  4KK7 A;  1LT6 D;  3O13 A;  4A3J B;  4C1N I;  1JMC A;  2H4O A;  1SYE A;  2XWJ B;  3MEH A;  2HHH L;  2L11 A;  1LTT D;  1QNK A;  3SGI A;  1AH9 A;  2DUD A;  4RCO A;  1KDA A;  4AYB G;  1LM0 A;  3WOE A;  2PI2 E;  2KHJ A;  3HOZ H;  1ENC A;  1FVI A;  4UPA A;  3L2P A;  3UE1 A;  1HTL D;  3J80 c;  1SNP A;  1DOM A;  5IYD G;  1XMQ L;  4POF A;  3BDC A;  2VQF Q;  3PUZ A;  1VQJ A;  3VDY A;  4GKK Q;  2J0T D;  5M3F H;  2F0L A;  1TU2 B;  2CW0 C;  1X3P A;  4JBK A;  3I4N B;  3BYT B;  3KLR A;  2R92 H;  4JI2 L;  5KNB A;  2UUB L;  4B3T L;  2RDH A;  5J3B A;  2KHI A;  1JOK A;  1X54 A;  1F9S A;  1HZB A;  2F3I A;  2KOL A;  2O5J C;  1MHW C;  3EIV A;  3SVM A;  4WRD A;  4DR7 Q;  2A69 D;  3C1F A;  1AFP A;  1IYJ B;  1ESF A;  2CHB D;  3NWS A;  4QIW B;  3T56 B;  1S72 A;  1XYI A;  4GLX A;  1MBY A;  1PZK D;  1VMC A;  2L9H A;  2EDG A;  5C3E H;  1I4G A;  1YJN A;  4A3D H;  2K5H A;  1PRT F;  3PUX A;  1SLJ A;  1I50 H;  4LUZ A;  3MXP A;  4YHH L;  4ME5 A;  2EPB A;  2PZT A;  1WTV A;  2B29 A;  3VR4 A;  3VR6 A;  3S9W A;  2BDN A;  2MPM A;  2PCF B;  1GKH A;  4OX9 L;  4DNR B;  5K36 G;  2HCI A;  4PZ6 A;  1B9N A;  3BZD B;  2EYJ A;  3K5M A;  3RNU A;  1VQN A;  1JOR A;  1WCM H;  2A69 C;  1MIU A;  1TKW B;  3HP3 A;  4APV A;  1A8V A;  1BBW A;  4YY3 L;  1KLU D;  1H9K A;  1KAB A;  1GUT A;  3K0Y A;  4F8M A;  3HRZ C;  4JG2 A;  4EQN A;  4DR5 Q;  2JEB I;  4C3H G;  5FO8 B;  3RZO H;  5JEA J;  1Z6H A;  1NE3 A;  4K8J A;  2RKS A;  3V2T A;  3MTS A;  2NVX B;  2K4K A;  5M5Y H;  1GHK A;  1CT1 D;  2FXQ A;  4C3J B;  2UXD L;  4JYA L;  1PRT C;  1B8A A;  3D4D A;  1K0S A;  4DFA A;  4IFD I;  1GVP A;  1V9P A;  3A8J E;  3CC4 A;  4FF2 A;  3M4O B;  2ATW A;  3GTM B;  2MNA A;  1Y1V B;  3Q6S A;  3M4Q A;  4KY5 A;  3R3O A;  1SJE D;  1X56 A;  3G4S A;  2B3G A;  3I4L A;  5C44 B;  4A3G B;  1EIH A;  2RHS B;  3H0G H;  4GNX B;  1XNR L;  1DD2 A;  2F0V A;  3KJO A;  3CCR A;  3FVQ A;  3K5O A;  1VQ8 A;  5M5X B;  1FL0 A;  3IL8 A;  3I4O A;  5DM6 3;  2DJG C;  2XWB B;  5EPL A;  1X3E A;  3D4R A;  2EYL A;  1ESR A;  1LTI D;  4AYB B;  4DR3 L;  3B6Y A;  3I8Z A;  2X6G A;  1ILQ A;  1ZEQ X;  2E2H B;  1QNU A;  5IP7 G;  2VQE Q;  1JIC A;  2PZW A;  4LFC L;  2WKD A;  4A3C H;  1IYV A;  1V1P B;  1YI2 A;  5I2X A;  3OOC A;  4R8N A;  5FJ8 H;  5TSS A;  4RH6 A;  4X3S A;  5LMN Q;  1QG7 A;  2B2Y A;  4KHZ A;  4JI6 L;  3K7A B;  1RCV D;  3PO2 H;  3E3X A;  4HSV A;  1X32 A;  3DWQ A;  3OWE B;  3DWA A;  1TWA B;  1F9R A;  3HOV G;  2M00 A;  1IW7 C;  3AFP A;  1OXX K;  5G3L D;  4P75 A;  5AJ3 Q;  1TS4 A;  2KJX A;  2Q2U A;  3NBH A;  4YWM A;  1BVS A;  3QIA A;  3SK4 A;  4WFN 3;  2PO4 A;  2B39 A;  4Q0F A;  2HD3 A;  3R2I A;  2B2Y C;  4HIM A;  3HFZ B;  4DV4 Q;  4RWS C;  1AE2 A;  1F9P A;  3MFY A;  2K75 A;  5GAG C;  2UUC L;  3S16 H;  3RZD B;  4A3E G;  1G51 A;  4BA1 I;  3PF5 A;  1K83 H;  4OWX B;  1ILP A;  2HDM A;  1K28 A;  1WTX A;  1PH4 A;  2B2W A;  1LV9 A;  1M8A A;  4X62 L;  2WAC A;  3R2T A;  1PTO F;  1K8O A;  1CSQ A;  1CFM A;  4C2M H;  2RDG A;  4L5R C;  1UUP A;  2L1B A;  3K6O A;  1TWH H;  1ZYR D;  3GTL H;  4J8Q A;  4P71 A;  1GHJ A;  1CHP D;  1SYC A;  3NQT A;  3IRB A;  4A3L H;  1TT2 A;  2LKV A;  5IOD A;  1EQQ A;  2B2W C;  2JEA I;  4DR4 Q;  2R61 A;  1B4O A;  4UP7 A;  2DGY A;  1N32 Q;  2F4I A;  5L37 A;  3PCO B;  4MTK A;  1XXG A;  2XN9 C;  2EQS A;  4C3H B;  1QCB D;  2L12 A;  2HIX A;  4BS9 A;  3N52 A;  1HA6 A;  2N8N A;  4A76 A;  4X66 Q;  4Y7N H;  2R7Z H;  3CCL A;  1XMO Q;  3CQZ B;  1ET6 A;  3J7Z C;  4HSP A;  1HR0 L;  2JA8 G;  1CA6 A;  1Q12 A;  4QJF A;  4IUP A;  2NN6 H;  2Q8T A;  1VQ4 A;  1N36 Q;  3T51 B;  4DK0 A;  1FNV A;  3S2D B;  4DNT B;  3BJU A;  1SAP A;  5GAH C;  1G91 A;  1N33 L;  3RUZ A;  4F88 A;  4DUZ Q;  2JA5 H;  1S40 A;  5IT9 L;  4DKA C;  1OTC A;  5IOC A;  4A3F G;  3QJY A;  3VA5 A;  3K5L A;  2QDL A;  3WWV A;  1YVC A;  4RA8 A;  4JC0 A;  4JV5 Q;  1QUQ B;  3BG3 A;  3S24 A;  1AN8 A;  1J6Q A;  4KD3 A;  1SNQ A;  4X6A H;  1QVG A;  4KKS A;  4EGV A;  1PV4 A;  4B3S L;  5CR3 A;  4B3R Q;  5D14 A;  1HNX Q;  1EY0 A;  2NVT H;  4QL5 A;  4DK6 C;  3PGZ A;  4R9W A;  3HKZ E;  4FXK C;  2BE5 D;  1FD7 D;  1VDZ A;  1NMG A;  3M4Y A;  3FDT A;  2HHH Q;  2YU9 B;  5C4X G;  2NTS A;  3TDQ A;  3KUP A;  3HOU H;  4RCN A;  1G6P A;  3S1N H;  4M1U B;  5ELO A;  3HOV B;  2I5M X;  4X64 L;  1XMQ Q;  2K50 A;  2EVB A;  2N55 A;  1RIP A;  3CP0 A;  1EQR A;  2F0D A;  2QCP X;  1CM9 A;  4DPG A;  2F03 A;  2D5D A;  4PQX A;  1KAW A;  2MP1 A;  3J7A 5;  3GTP B;  3KLS X;  3AMU A;  2LS0 1;  2BE5 C;  3VYT A;  2IX0 A;  2UUB Q;  2DY8 A;  4B3T Q;  4QUC A;  2KHS A;  3G71 A;  1G6Z A;  4IJH A;  3S1M B;  2E2I H;  3OIQ A;  4KKU A;  2JQO A;  3GQB A;  3U50 C;  2RSN A;  4WOR A;  1YHA A;  5E4X A;  1X9N A;  5JPN C;  1B9M A;  1TS2 A;  2VXW A;  1K8M A;  4CDD C;  3I72 A;  2ES2 A;  3RN2 A;  2CWP A;  4YHH Q;  1VQA A;  2LSS A;  3LWU A;  1SSO A;  3D6W A;  3DHQ A;  2AQ2 B;  4CJ2 C;  4DV3 Q;  3PO3 G;  1DOK A;  3SDZ A;  4A93 H;  2VB3 X;  4GN3 B;  4OX9 Q;  1LTR D;  3GD7 A;  1SFO B;  1VF7 A;  5CV6 A;  2K03 A;  4LF4 Q;  4K2L A;  2A8V A;  3N6R A;  4JI8 L;  3KFU A;  3EFX D;  4ZKC B;  3TRZ A;  5T1I A;  4IPD A;  1VQE A;  2JA8 B;  1YJW A;  2L4N A;  2A68 D;  3DM1 A;  4RG1 A;  2VUM H;  4FF3 A;  5M3M H;  4J6H A;  1S5E D;  1VQL A;  5IP9 G;  4NDX A;  1TWC H;  4CJ1 B;  5IYC H;  4P72 A;  5CV7 A;  2FIN B;  2PMZ B;  4H44 C;  4JK1 C;  1EY4 A;  4LW1 A;  4R4O A;  2A73 B;  4B9W A;  1R9T H;  3ULJ A;  2UXD Q;  4ZUI A;  4LUV A;  3HGB A;  4A3F B;  4IOA A;  4JYA Q;  3DM3 A;  4JI7 L;  2F0I A;  5M5W B;  1I4R A;  5GRO A;  1JWM D;  2F0F A;  1SYF A;  1EU3 A;  3H6M A;  4G7O C;  4WJ3 M;  3A56 A;  4BY7 G;  1KTK A;  2A68 C;  2QIL A;  2VQE L;  1EL0 A;  2K5W A;  3EJI A;  1WD0 A;  1AP0 A;  3NHH A;  4A3J G;  1PH9 A;  3J80 i;  1Q46 A;  1V1O A;  1LT3 D;  5LMU Q;  5T1G A;  3HOX B;  4NMZ A;  4BA2 I;  1B53 A;  1D5Z C;  4BBS G;  1XNR Q;  3Q23 A;  3J80 E;  2AUJ D;  4GZY C;  3M85 A;  1HRJ A;  1WTO A;  3H3V C;  5BN3 A;  4BBR G;  3F1Z A;  3HOY H;  5JJI A;  1SNC A;  2FHT A;  3M7N A;  3PMF A;  3F2D A;  1V8Q A;  1JQY D;  2DNC A;  3CPW A;  2KBN A;  1CKN B;  3TME A;  4LFC Q;  4DU9 A;  3MHB A;  5BN5 A;  1U5K A;  3CCV A;  3OTO L;  4WJW A;  2K14 A;  1PTO B;  5KND A;  5C6A A;  4L5S A;  4M8A A;  1T5E A;  3E5S A;  3TP5 A;  4HID A;  4L8J A;  4C3I G;  1WD1 A;  4O0A A;  1GUG A;  4K5W A;  3J81 c;  1QZG A;  1GUW A;  1EUJ A;  3CHB D;  2WB1 E;  4DV6 Q;  3ONA B;  1YNJ D;  1D6E C;  2H5X A;  1DM0 B;  1C4Q A;  2WII B;  4FF4 A;  4F7X A;  4FXG C;  3D4W A;  4MHE A;  3J7Y W;  4XYQ A;  1HNW Q;  1XJV A;  3J7A V;  2PNH A;  4JPB W;  3TSS A;  2F0N A;  3S15 B;  3LNN A;  4JW0 A;  1HUN A;  1PA6 A;  5IE8 A;  4O1N A;  2MGS A;  3GTG H;  4N9P A;  4DR4 L;  2MUY A;  2N78 A;  4K6D A;  2WKC A;  4JCV E;  1K8A C;  1N32 L;  2CWA A;  3KOJ A;  4GNX A;  2NVY H;  3CCM A;  1ENF A;  4X62 Q;  4I65 A;  4X65 L;  3C2P A;  3IAY A;  4MN3 A;  1PYW D;  5ELD A;  2HIV A;  1XNQ L;  2HCC A;  5BR8 L;  2MFI A;  1TY0 A;  4CGY B;  5M9O A;  3DMU A;  1FNU A;  4X66 L;  3IFT A;  1JB3 A;  3NPP A;  1PXU A;  5F2D A;  4IZ8 A;  4EQ5 A;  2SNM A;  2OTJ A;  5JPM C;  3NEN A;  3S1Q B;  2F0S A;  4ODG A;  4BY1 H;  1V1P A;  1VQI A;  1LO5 D;  2N88 A;  4A3M H;  3C1E A;  4K5X A;  2WV6 D;  3H09 A;  2I46 A;  3M3Y H;  1X6O A;  4HJ9 A;  1PMR A;  1YHQ A;  1PDQ A;  4C3J G;  4NXM L;  2J4X A;  3SHL A;  3S1R H;  4A3D G;  2K5D A;  4OO1 H;  1B7Y B;  1IBL Q;  2JSO A;  4DAP A;  4JV5 L;  3KF6 B;  3NEM A;  3FP9 A;  4BXX H;  4DR1 Q;  1X55 A;  5JEA G;  1HR0 Q;  4DR6 L;  3RLO A;  4TQU S;  1EEI D;  2DNE A;  1UEA B;  4E6I A;  4EQP A;  1DGS A;  2B63 H;  1STY A;  3KLS A;  1MSG A;  1LTG D;  1O7Y A;  1N34 L;  1N33 Q;  4BY7 B;  1Q8I A;  1E2Z A;  2ICE C;  3CCE A;  3OMG A;  2VS1 A;  1VQG A;  4ZK9 B;  1GO3 E;  4IJL A;  3I4N H;  2B2T A;  1EQT A;  4BBS B;  3KF8 A;  2K5V A;  2Q2H A;  3GO5 A;  4DXF A;  1NR4 A;  3I3C A;  2F0W A;  2OWO A;  2NZH A;  2Q2T A;  2XTI A;  2JA6 B;  3CRL C;  4N8F A;  4RGM A;  2K01 A;  4DF7 A;  2Z1C A;  3L9A X;  4BBR B;  4B3S Q;  1BCP D;  4KY7 A;  5CGK A;  5K5P A;  2B2T C;  3I90 A;  2GN5 A;  3KDF B;  1ICW A;  4ZYS A;  4TVA B;  1SNO A;  3H3V H;  1VQ9 A;  2A5H A;  1STB A;  4R4Q A;  4KHP L;  1PLF A;  2EJM A;  5E4W C;  2HUG A;  2JYO A;  2X6L A;  3S2H B;  1EIF A;  2GVB A;  3D8G A;  5FLM H;  4KD4 A;  4C3I B;  1WTR A;  1EYA A;  4XTC S;  3X3N A;  2EOT A;  4KY6 A;  5C0X H;  5DM7 3;  5CBE E;  4IFD G;  3H0G G;  4X64 Q;  4EQO A;  1TXY A;  3DLL A;  5KYI A;  4WJ4 A;  1JJC B;  1HUM A;  5IY0 A;  4L6T B;  4LF7 Q;  1BCP C;  4ZAI A;  2ID0 A;  2QEX A;  2ZT9 C;  2WFW A;  1VCI A;  4A3B H;  1UNS A;  3KBG A;  4HAE A;  4BWG B;  5I6Y A;  3LWE A;  1N8R C;  5DAU A;  1C48 A;  2BA0 A;  2EY5 A;  1LT4 D;  5CYU A;  2DY7 A;  1BXT A;  3DUZ A;  2KEC A;  4DV3 L;  3CAM A;  2SNS A;  4LF5 L;  5C0X J;  2NVX H;  5A2Q L;  1VQ7 A;  4V19 0;  4LJZ C;  5I2Y A;  3NEL A;  3DWP A;  4LF4 L;  4Y52 H;  4LFA L;  2F1M A;  1Y8N B;  4CDC C;  3U58 A;  1Z47 A;  2O2L D;  2R92 B;  4XT1 B;  4JBM A;  2Q8R E;  4H02 A;  2ZTE A;  4FXD A;  1HCZ A;  1KQS A;  5LL6 X;  1SXT A;  2D9U A;  1PH8 A;  1HR0 W;  1P16 A;  2Y0S E;  1PFN A;  5FLX L;  1ET9 A;  1LLR D;  2MHV A;  5EKI A;  5EJW A;  4ZUJ A;  5C44 H;  4A3G H;  3GTJ H;  1KRS A;  1TWG B;  2QDB A;  1IKM A;  1J5E L;  3ZYY X;  2H1E A;  4EX5 A;  3I7F A;  1LT5 D;  4GOP B;  5C3E B;  4A3D B;  3P7J A;  4JI8 Q;  1I50 B;  3MEF A;  3JAM L;  4AIM A;  4ID6 A;  3D31 A;  2B8G A;  3Q22 A;  1VQO A;  5FO7 B;  3X3M A;  4XXE A;  1U4P A;  2M9V A;  2BOS A;  2E2H H;  3D6C A;  3MC0 B;  5IYB H;  4DK1 A;  5I4D A;  4FP5 D;  5LMU L;  4A3L G;  3S17 H;  2JP1 A;  3RMH A;  3LX0 A;  2CCZ A;  1WCM B;  1JCK B;  2AMC B;  1LTB D;  1Y8P B;  3PUY A;  2CH4 A;  3K7A H;  1CUK A;  1YZ6 A;  2AWN A;  4HTH A;  4TSS A;  4JI7 Q;  3NK9 A;  1UAP A;  1MD2 D;  3PV0 A;  1TWA H;  5E7N A;  1LUZ A;  3RZO B;  2PW7 A;  4B3M Q;  1PZI D;  1TVX A;  1W6K A;  3PIO 3;  1VS0 A;  2P5Z X;  2A6E D;  4DR2 L;  3RR5 A;  3V96 A;  2D0P A;  1GD7 A;  2XIW A;  3C3L A;  2R7Z G;  1V1Q A;  2I07 B;  2K05 A;  3K8A A;  3AEV A;  2RF4 A;  4DAM A;  2Z0S A;  4FNF A;  2KEN A;  5G3L F;  1RL2 A;  2YTX A;  3FMC A;  2BDO A;  4HN7 A;  2EZV A;  4LFB L;  5KRU A;  2IWH A;  3SE0 A;  1CQV A;  1RTO A;  4PG3 A;  3UDI A;  1D5X C;  1CA5 A;  2EE1 A;  2XNA C;  5C4J H;  3VR2 A;  5CC4 A;  4DV6 L;  3M7G A;  1B2T A;  1Z9F A;  2K5Q A;  2UU9 L;  3DXJ C;  1SMY D;  1PH1 A;  2JA5 G;  1U0L A;  2JA7 G;  2YYZ A;  4XIG S;  1HNW L;  1JJG A;  4UDU C;  1YHB A;  4OHJ A;  4RKB A;  4DV1 L;  2LXK A;  3H0G B;  2WAQ B;  2HDL A;  4XQN A;  4JI4 Q;  4IUT A;  5K36 H;  4A3K H;  2B2U A;  4LF6 Q;  3OTO Q;  1I3Q B;  1G29 1;  3PIO A;  5EKL A;  2JXM B;  3OSO A;  3I56 A;  2PNR C;  3W1G A;  2EXD A;  1BBX C;  2PMZ E;  1ML0 D;  1WOC A;  1F2L A;  4IAL A;  2K52 A;  1SND A;  2DJF C;  2R7F A;  4C3H H;  1OO9 B;  2NUC A;  1KLG D;  2IW3 A;  5EBD A;  3NE5 B;  3J80 L;  1EYG A;  4MTN A;  1O80 A;  3P20 A;  1L1O A;  1SMY C;  3K7U C;  4C56 C;  5GAD C;  1STG A;  5BN4 A;  5JJK A;  3VYS A;  1JC7 A;  5GAE C;  1HH2 P;  2EYP A;  1NCV A;  2PQA B;  1SE4 A;  3K80 C;  4YWK A;  1D7Q A;  1FYC A;  2F0H A;  3BDL A;  1E7Z A;  4P73 A;  1BQQ T;  1EFI D;  3S2D H;  4OXP A;  3F2B A;  5COY A;  3SR1 A;  4X65 Q;  1BBU A;  1VQD A;  2ASB A;  4QCL A;  1I4H A;  1L1O C;  1EY8 A;  2MO1 A;  2TMP A;  2NN6 I;  3H15 A;  3GTK B;  4JBW A;  1U9R A;  2FFK B;  1G2S A;  2VW9 A;  1XNQ Q;  2RA4 A;  5BR8 Q;  3EA6 A;  1IBL L;  3S16 B;  4IUQ A;  5EGT A;  2X69 A;  4JVZ A;  1K83 B;  3F2U A;  1TII D;  4G4K A;  4DR1 L;  1CQF A;  4RGT A;  1ZYR C;  5COR A;  1JB7 A;  1A15 A;  1CKN A;  2K7V A;  5FK9 C;  1IZ6 A;  2BA1 A;  4H7B A;  2E2J H;  1NTG A;  4P2C B;  3RLN A;  3GP7 A;  1YNN D;  4DAY B;  4OEM B;  4DUY L;  3E6Z X;  5C3W A;  5IGB A;  5IP7 H;  1I6V C;  3CKI B;  4NXM Q;  2KCM A;  2F0E A;  1IYU A;  1NY4 A;  1A62 A;  1S5D D;  4Q5V A;  4CDF C;  1G8Z D;  1SDF A;  2IPK D;  1Q1E A;  4ZLT F;  4HCE A;  4DR6 Q;  1JJ2 A;  3D0F A;  1C9O A;  2QGQ A;  1HPC A;  2ZJP A;  3JC6 6;  3HOV H;  3VA7 A;  4H13 C;  3W5O A;  3HKS A;  5I6W A;  1YJ9 A;  3HOX G;  4A3I G;  3MXN B;  1N34 Q;  1D1K A;  3PUV A;  1A3U A;  2NVQ B;  2R7Z B;  2RCN A;  3E9I A;  2PYK A;  1F2Z A;  1YNN C;  3DEP A;  2VUM G;  2GA4 B;  4A3E H;  2HQL A;  3GTP H;  2L15 A;  5ELN A;  5FO9 B;  1BUV T;  4CHT B;  3AFQ A;  5IYC G;  1WVL A;  2IX3 A;  2F0U A;  2F52 A;  1XTD A;  4V0B A;  1Z7T A;  2B8F A;  3S1M H;  3VR3 A;  1Q81 C;  1HJP A;  1PRT B;  2LXJ A;  1I6H H;  1SE2 A;  3J81 i;  2JA5 B;  1VQH A;  1RTN A;  1A2T A;  2JA7 B;  3NWT A;  1G2T A;  1LAC A;  4LF7 L;  3G6J B;  3J81 E;  1U4R A;  2IY5 B;  4JI3 Q;  4KHP Q;  5JJL A;  2YTY A;  3NXW A;  3ULL A;  3GTO H;  2HT1 A;  3FKI H;  2UXC Q;  2C35 B;  1WFQ A;  1U4L A;  2LMC B;  3DEO A;  1NMF A;  4HED A;  3KF6 A;  2XVS A;  1WI5 A;  4RGN A;  3MA2 B;  2NVT B;  2Q8I B;  1B3A A;  4PMB A;  5E3F A;  1SFO H;  1IBK L;  1AZP A;  3R93 A;  4L5Q A;  1ASY A;  5IGC A;  1SE3 A;  3ZJY C;  5KGU A;  1K9M C;  2JA8 H;  1YBY A;  3WOF A;  4Z9C B;  4A75 A;  1IXR A;  2BH8 A;  1KIX A;  1B1Z A;  3I73 A;  1LAB A;  1HXY D;  4YCV A;  4B9X A;  4OEL B;  1TS5 A;  3HEJ A;  2AQ3 B;  2E5L L;  1AEX A;  3VYR A;  4LF5 Q;  2KCC A;  2V4D A;  3T1H L;  1H9M A;  2IT1 A;  1DOL A;  1KNA A;  1V43 A;  2D0O A;  3KYH C;  1QZH A;  4JI0 Q;  1O7Z A;  4HR7 B;  3W2D A;  4A3F H;  2Z9H A;  4LFA Q;  1STA A;  3ULP A;  4DK3 C;  2ZTC A;  5M5W H;  4OWW B;  2NYZ D;  4YIJ A;  1S3O A;  1DJR D;  3QO2 A;  5ELF A;  5KNC A;  2QW7 A;  3KDF A;  1PVO A;  1EWI A;  1C0A A;  3BVM A;  2OQ0 A;  3IFD A;  3I70 A;  5DLQ E;  3EN2 A;  4DV7 L;  1TWF H;  1J5E Q;  2N49 A;  3QR8 A;  1EYD A;  3CF5 A;  4NXN L;  3H94 A;  5KEE A;  4HJ8 A;  5IGD A;  3MXG A;  4OGQ C;  3ICE A;  2R7D A;  4B3M L;  4L5T A;  3TS0 A;  4NW2 A;  2R93 H;  5C4X H;  4QIW E;  2F0T A;  2BCO A;  4DV5 L;  1II3 A;  4J1M A;  5H1S E;  2A6H D;  1EFW A;  1SYG A;  1SR3 A;  3SK8 A;  3TZD A;  2VZA A;  1KDC A;  4LF8 Q;  1T9H A;  1X65 A;  1QB5 D;  1L2F A;  5C4H A;  4A3I B;  2XRQ D;  3NUC A;  3QB3 A;  4FVM A;  3A7L A;  3EBE A;  4QUF A;  1UE7 A;  3MAQ A;  4A3M G;  5HY6 A;  2NZ1 D;  3MFG A;  2F3W A;  4K6L A;  5ELE A;  4C1N K;  2ZJQ A;  3H91 A;  2VUM B;  2IL8 A;  3HOW G;  2JA6 G;  4R4C A;  2UXB L;  1SYB A;  1F77 A;  2LY7 A;  4DV2 L;  3A5Z B;  1NNX A;  1W2B A;  4TKO B;  1GXD C;  1Y1W G;  1NUC A;  3J7A F;  4DR2 Q;  1K73 C;  2EIF A;  2LFN A;  3G6E A;  1AW7 A;  2OCE A;  1R9T B;  4JI4 L;  4LF6 L;  4BXX G;  1SMX A;  1UE6 A;  3I4M G;  4IUN A;  3GTQ B;  1XWE A;  3PUW A;  1I4P A;  4JI5 L;  4XYO A;  1K3R A;  4IPG A;  4LFB Q;  5HGQ A;  2F4V L;  2D2C C;  1DYQ A;  2B63 G;  3WDN A;  2MJ8 A;  4KLK A;  3UI2 A;  4K14 A;  2NTT A;  1XPO A;  2UU9 Q;  1Y69 U;  1S5B D;  1EQV A;  3PQI A;  4H0L C;  4KJN A;  1KXL A;  1SNM A;  1PH6 A;  3PO3 H;  2J7Z A;  4ME3 A;  4DV1 Q;  1C7Y A;  4RKL A;  4KMU C;  1HA5 A;  3BU2 A;  3ND9 A;  4CDE C;  3S14 B;  1RKN A;  3S1Q H;  4KN7 C;  4FO2 A;  4UP9 A;  5CV8 A;  3HOZ G;  1HQR D;  3PSI A;  4DN4 M;  3PIP 3;  4HJ5 A;  1PHJ A;  3CRK C;  3PF4 A;  5JAV A;  3HOY B;  4RFB A;  4HJA A;  4HCS A;  3OW7 A;  4CKC A;  5IP9 H;  4HJ7 A;  5IGF A;  5M3F G;  2E76 C;  4GKJ Q;  2N3S A;  3JAM c;  1L0X B;  1E2W A;  1YNJ C;  4XT3 B;  3TP8 A;  5IWA Q;  3HS0 C;  4AQY Q;  1S4Z A;  3A0J A;  3L3O C;  4MZ9 A;  4AYB E;  5IT9 E;  1HFG A;  2R92 G;  5CMD A;  4GNX C;  3OYY A;  3URY A;  3G7L A;  2IHE A;  4OO1 I;  1WTP A;  2WIN B;  2QA4 A;  3RLF A;  5C0X G;  1E1O A;  3F8T A;  1CZW A;  5FOB B;  4BY7 H;  3NQI A;  1KDB A;  1IBM L;  4YWL A;  5C3E G;  2JJQ A;  4A3J H;  3F2C A;  3VR5 A;  4K8I A;  4A3B G;  4RAU C;  2QF7 A;  4BBS H;  3Q0A A;  1BF4 A;  4R8I A;  4A4I A;  3TN2 A;  2Z6K A;  2K04 A;  3ERS X;  3Q24 A;  2F0P A;  1UWV A;  4YCW A;  3K57 A;  1XPU A;  5C5L A;  1ZXT A;  4HIK A;  1MJE A;  3AQQ A;  4GN5 A;  2OT2 A;  4G7H C;  1NAP A;  3Q8D A;  4DV0 L;  4BBR H;  2E2D C;  2WB1 G;  1D5M C;  2IJ0 A;  3NTI A;  2G9H D;  2UUA L;  1HNZ L;  1WCM G;  5D3I B;  4DUY Q;  3GV6 A;  1FR3 A;  1A3V A;  5C3X A;  2Q2I A;  1BCP F;  1XTC D;  1YNX A;  2ZXR A;  3S2H H;  1NJI C;  2EYM A;  2CFM A;  4A3M B;  5IIF A;  3H3V I;  2GVA A;  4C3I H;  1FGB D;  3HOW B;  1FGU A;  2EJG C;  2NZO A;  2ICI A;  2AUK A;  2CW0 D;  1SN8 A;  1HTP A;  4GS3 A;  4R4I A;  2EY2 A;  2I5L X;  1Y1W B;  3S1R B;  5C0X I;  1O78 A;  3RN5 A;  4IO9 A;  1Y8O B;  2R6G A;  5LL6 S;  4JI3 L;  5EKK A;  4DA2 A;  2PI2 A;  3I4M B;  3QWN A;  1B50 A;  1GUS A;  3BVZ A;  2UXC L;  2WP8 J;  3CCU A;  2B63 B;  5IYB G;  1Q7Y C;  2Z4H A;  1ROD A;  3CCJ A;  2IHF A;  2WAQ G;  1E24 A;  2E8G A;  1EIY B;  2RVL A;  4I7A A;  1BOS A;  2D62 A;  4PMW A;  4PMC A;  4QQB X;  1LTS D;  4R1J A;  3GV3 A;  4ALP A;  3IKJ A;  1PYB A;  2ALY B;  4DAY A;  1IHZ A;  2F0J A;  4PNY A;  2RSO A;  4HMJ A;  2AKW B;  4GLV B;  4I7Z C;  3HOZ B;  1OXT A;  2FMM A;  2ZM6 Q;  1H9S B;  4A3C G;  1QUQ A;  5D3D A;  1UE1 A;  1IL8 A;  2E74 C;  5FJ8 G;  1TWG H;  4C3J H;  5M3F B;  2B2V A;  2ZTD A;  2PW5 A;  1F2M A;  4JI0 L;  1IBK Q;  3G48 A;  2VB2 X;  3OIP A;  3PO2 G;  3CW2 C;  5J39 A;  1K0R A;  3M4O H;  1AZQ A;  1FNW A;  3MXN A;  5JEA H;  2CQO A;  1C8C A;  1H95 A;  3GTM H;  4ABN A;  4UY8 C;  1Y1V H;  1D2B A;  3TEH B;  2I5H A;  5IT9 c;  1STH A;  1PRT D;  3K59 A;  2B2V C;  2KUM A;  4F87 A;  3J81 L;  3UDF A;  2E5L Q;  1Q8K A;  4A3K G;  1A2U A;  3I55 A;  3CC7 A;  1U4M A;  1X3G A;  3T1H Q;  3NBI A;  1VQC A;  1TQO A;  4LNQ A;  1A63 A;  1ICF B;  4NP5 A;  5M5X H;  4A3B B;  2Z4I A;  3EQL C;  4IUV A;  2CVR A;  1L0Y B;  5J22 A;  3BYY B;  1O7I A;  1QWY A;  5IYD H;  5NUC A;  1HZA A;  2EJF C;  1M1K C;  4PZ8 A;  1L0W A;  4GN4 B;  4KN4 C;  4LF8 L;  2WB1 B;  3UDG A;  1H9J A;  4G57 A;  3CD6 A;  2XGT A;  1KL9 A;  1DON A;  1VF5 C;  2A74 C;  4JBJ A;  4DV7 Q;  1VQK A;  4KJO A;  4X3K A;  5CBA E;  4RMF A;  1PYS B;  5IGG A;  4NXN Q;  2MO0 A;  3L7Z C;  1E0B A;  4YCU A;  4ZKB B;  5CV5 A;  2KED A;  3M9B A;  4JOI A;  2F3V A;  4K2K A;  1A6X A;  4KV6 A;  1SE8 A;  1KHI A;  3SEB A;  4R4T A;  2G9D A;  4DV5 Q;  4IFD H;  3GTJ B;  5M5Y B;  1F2Y A;  1PH2 A;  2F0O A;  2IX1 A;  1FJG L;  4G7Z C;  2BH2 A;  4K0K L;  1JOQ A;  1E3P A;  4CKE A;  4J15 A;  2PPB C;  3RZD H;  1WTH A;  4LAA A;  4U67 3;  1IW7 D;  1I3Q H;  1VQ5 A;  2L5T A;  4QGU A;  1I94 Q;  4JOI C;  2NN6 G;  1X3F A;  1CHQ D;  3HG9 A;  1JOO A;  1A0I A;  2EY1 A;  3A5U A;  2UXB Q;  1LTL A;  3VYU A;  3A55 A;  4DV2 Q;  1I4X A;  3T13 A;  1EEF D;  1EIG A;  4FF1 A;  5CV4 A;  2Y0S G;  2AWO A;  4IPH A;  1JE4 A;  3S17 B;  4IFD J;  2RQX A;  3FPU B;  1QE6 A;  3T1Y L;  2A6E C;  1K3B C;  3V05 A;  2YV5 A;  2KQ3 A;  4JI5 Q;  1SBB B;  5ELB A;  2F4V Q;  1JE5 A;  3BVG A;  4ZCK A;  2OF1 A;  1S5F D;  4ZRZ A;  1BKB A;  1MI2 A;  4HIO A;  2NWG A;  3K5N A;  3BDO A;  4LK1 C;  4GKJ L;  3GTK H;  1OXV A;  1E22 A;  2B2U C;  5IWA L;  1NR2 A;  2L55 A;  2NB0 A;  1R4Q B;  1EZ8 A;  4AQY L;  3CQZ H;  1EY6 A;  2O4X A;  3QG1 A;  2TSS A;  2CKZ B;  3PO2 B;  3HOU G;  2OTL A;  5C4J B;  3K58 A;  1YIJ A;  2ENB A;  3C46 A;  4PV1 C;  1BO0 A;  3KF8 B;  4P74 A;  3T16 A;  2K6A A;  4DAV A;  1DXM A;  2JE6 I;  1BR9 A;  3BZK A;  4KTA A;  1LYL A;  4A3K B;  1PTO D;  1YEZ A;  3LGJ A;  5JVH 3;  1CKO A;  4RHS A;  1GUN A;  3FKI G;  5EPJ A;  1ONL A;  2YTV A;  4MIU A;  4UAI A;  4C2M B;  1PFM A;  1TR5 A;  3AB9 A;  3D3R A;  4DNI A;  1CSP A;  3AYH B;  4QY7 A;  1CZG A;  1BCP B;  1UEB A;  1TWH B;  2RDF A;  3GTL B;  3QOJ A;  3MWY W;  2KEE A;  2NVQ H;  1A3T A;  1IBM Q;  2PZU A;  1KC8 C;  1QJO A;  2QEJ C;  1JT8 A;  1VQP A;  4KHV A;  2YU9 H;  1PTO C;  1STE A;  1PFB A;  3ITP A;  3P75 A;  4X3T A;  3EVQ A;  1PZJ D;  1D8L A;  3CU7 A;  1MSH A;  2JN4 A;  4A93 G;  4DV0 Q;  4JI1 L;  4S3S A;  3W1B A;  1CTM A;  4O2D A;  1PH5 A;  2JA7 H;  5EAY A;  2CQA A;  2KCT A;  2F0M A;  3MXU A;  2UUA Q; 
#chains in the Genus database with same CATH homology
 1HNZ Q;  1GO3 E;  4IJL A;  5GQO A;  3I4N H;  3KJO A;  3CCR A;  3CC2 A;  3TS2 A;  4LWC A;  3EBE A;  1UE7 A;  3ER0 A;  4A3M G;  2K5V A;  2Q2H A;  3GO5 A;  1FL0 A;  5HY6 A;  3I4O A;  1VQ8 A;  2ZJQ A;  5M3M G;  2OWO A;  5LMN W;  3HOW G;  1X3E A;  2JA6 G;  2NZH A;  4R4C A;  2Q2T A;  2UXB L;  2XTI A;  2VL6 A;  4DV2 L;  3A5Z B;  4DR3 L;  3B6Y A;  1W2B A;  2VQF L;  1Y1W G;  5IP7 G;  2VQE Q;  4B3S Q;  4GKK L;  4GLA C;  4DR2 Q;  4LFC L;  1K73 C;  1W3S A;  2EIF A;  3CMA A;  4A3C H;  3G6E A;  1YI2 A;  2OCE A;  2GN5 A;  3KDF B;  5FJ8 H;  4JI4 L;  3KLW A;  4TVA B;  4LF6 L;  3K0X A;  3H3V H;  4BXX G;  1SMX A;  1VQ9 A;  1UE6 A;  5LMN Q;  1VQ6 A;  3I4M G;  3BZC A;  4R4Q A;  4KHP L;  4KHZ A;  4JI6 L;  3PUW A;  4JI5 L;  2K5N A;  1K3R A;  3PO2 H;  4IPG A;  4LFB Q;  5HGQ A;  2F4V L;  2R93 G;  1EIF A;  2B63 G;  2GVB A;  5FLM H;  3HOV G;  1X65 A;  4KLK A;  3AFP A;  4XTC S;  2ZM6 L;  1OXX K;  1XPO A;  4P75 A;  4DR7 L;  5AJ3 Q;  1EOV A;  2UU9 Q;  2Q2U A;  4YWM A;  3H0G G;  1BVS A;  4LF9 Q;  4X64 Q;  1SRO A;  1TXY A;  1KXL A;  1PH6 A;  3DLL A;  3U4Z A;  3PO3 H;  4ME3 A;  4HIM A;  3HFZ B;  4DV1 Q;  4DV4 Q;  2UUA Q;  4WJ4 A;  1AE2 A;  2UUC L;  1C7Y A;  1JJC B;  2K75 A;  5GAG C;  5IY0 A;  4LF7 Q;  3S16 H;  4A3E G;  1G51 A;  1PFS A;  2ID0 A;  4BA1 I;  3PF5 A;  3BU2 A;  1K83 H;  1OXU A;  4OWX B;  1XPR A;  2QEX A;  3S1Q H;  2WFW A;  1VCI A;  1NBW A;  3JAM i;  4UP9 A;  3HOZ G;  4A3B H;  4JI2 Q;  1PH4 A;  1IL2 A;  3HOY G;  1N8R C;  3PSI A;  4FDB A;  2BA0 A;  4X62 L;  4HJ5 A;  1PHJ A;  3PF4 A;  3STB D;  2AHO B;  4HJA A;  1CSQ A;  4C2M H;  4DV3 L;  3CAM A;  3K81 C;  4L5R C;  4LF5 L;  5IP9 H;  5C0X J;  4HJ7 A;  1VQ7 A;  3GDE A;  5M3F G;  2NVX H;  1TWH H;  4GKJ Q;  3GTL H;  3NEL A;  2N3S A;  3JAM c;  3TRE A;  1N9W A;  4P71 A;  5IWA Q;  4Y52 H;  4LF4 L;  4LFA L;  3IRB A;  4A3L H;  3U58 A;  1Z47 A;  4AQY Q;  1EQQ A;  3A0J A;  4MZ9 A;  2R92 G;  4AYB E;  2JEA I;  4DR4 Q;  4GNX C;  3OYY A;  1E1T A;  1VQM A;  4JBM A;  2IHE A;  3HKZ G;  4UP7 A;  4H02 A;  2DGY A;  4OO1 I;  4DR5 L;  1N32 Q;  2ZTE A;  3RLF A;  2QA4 A;  5C0X G;  1KQS A;  1UE5 A;  3PCO B;  1E1O A;  1PH8 A;  1HR0 W;  1P16 A;  2Y0S E;  3F8T A;  2EQS A;  1MJC A;  1JT8 A;  5C44 H;  4BY7 H;  2HIX A;  4A3G H;  3STB C;  3GTJ H;  1KRS A;  1IBM L;  1J5E L;  4YWL A;  4EX5 A;  2N8N A;  5C3E G;  2JJQ A;  3I7F A;  3HOX H;  3F2C A;  1WYD A;  4X66 Q;  4Y7N H;  4A76 A;  4GOP B;  4A3I H;  3CCL A;  1XMO Q;  2R7Z H;  3J7Z C;  4A3B G;  1HR0 L;  2JA8 G;  1VQB A;  4BBS H;  1GM5 A;  3M4P A;  3NBH B;  4A4I A;  4JI8 Q;  2JK8 A;  1MKH A;  1Q12 A;  2Z6K A;  3ERS X;  3MEF A;  4AIM A;  4YY3 Q;  4QJF A;  1UWV A;  3D31 A;  4YCW A;  1XPU A;  4HIK A;  3CCQ A;  1N36 Q;  1VQO A;  1VQ4 A;  1MJE A;  3AQQ A;  1Q1B A;  4GN5 A;  1K8G A;  1Y14 B;  3Q8D A;  3BJU A;  1KRT A;  1P8L A;  4BBR H;  5GAH C;  4DV0 L;  2E2H H;  1N33 L;  2WB1 G;  3L0O A;  5IYB H;  4DUZ Q;  2JA5 H;  5LMU L;  1AE3 A;  1S40 A;  2UUA L;  4A3L G;  1OTC A;  4DKA C;  3S17 H;  1HNZ L;  1WCM G;  4DUY Q;  4A3F G;  2CCZ A;  3WWV A;  1YVC A;  4JC0 A;  2AMC B;  2Q2I A;  3PUY A;  3GTQ H;  1M90 C;  2VY3 A;  3K7A H;  4BY1 G;  1I94 L;  4JV5 Q;  1QUQ B;  3S24 A;  1CUK A;  1YNX A;  1YZ6 A;  2AWN A;  4JI7 Q;  3S2H H;  1J6Q A;  1NJI C;  2CFM A;  4X6A H;  3I2Z A;  3PV0 A;  1QVG A;  3H3V I;  1L1O B;  1B70 B;  1TWA H;  2GVA A;  5E7N A;  3OW2 A;  4A3J H;  4C3I H;  1LUZ A;  4B3M Q;  3U4V A;  1FGU A;  1PV4 A;  2NZO A;  1KD1 C;  4B3S L;  1SN8 A;  4B3R Q;  1VS0 A;  4GS3 A;  4DR2 L;  3RR5 A;  4R4I A;  1HNX Q;  2D0P A;  4MNO A;  1VQF A;  1CKM A;  1GD7 A;  2NVT H;  2I5L X;  4QL5 A;  2R7Z G;  2A19 A;  4OO1 G;  3KJP A;  1V1Q A;  4DK6 C;  3PGZ A;  5C0X I;  3K8A A;  3AEV A;  5LMN L;  3RN5 A;  2RF4 A;  4PZ7 A;  4IO9 A;  1FJG Q;  3S15 H;  4UP8 A;  3HKZ E;  4DAM A;  4K0K Q;  2Z0S A;  2KEN A;  1I6H H;  2YTX A;  1RL2 A;  2JA9 A;  1NMG A;  2R6G A;  3S14 H;  2MQH A;  4JI3 L;  4LFB L;  4OWT B;  1SRU A;  2PI2 A;  2HHH Q;  4PG3 A;  3UDI A;  2RHQ B;  3CCS A;  5C4X G;  2UXC L;  3E9H A;  5C4J H;  2WP8 J;  1G6P A;  3HOU H;  4DV6 L;  3CCU A;  4GOP A;  1Z9F A;  5AJ3 L;  3S1N H;  2UU9 L;  4DR3 Q;  5IYB G;  5ELO A;  1Q7Y C;  2I5M X;  4X64 L;  1PH1 A;  2JA5 G;  1U0L A;  1XMQ Q;  2K50 A;  3CCJ A;  1HZ9 A;  2JA7 G;  2YYZ A;  4XIG S;  2IHF A;  1HNW L;  1JJG A;  2WAQ G;  1E24 A;  1YHB A;  4DV1 L;  4DV4 L;  1RIP A;  2E8G A;  2LXK A;  3CP0 A;  1EIY B;  1EQR A;  3I4N G;  2D62 A;  1VQG A;  4PMW A;  4JI4 Q;  2OQK A;  4DPG A;  4QQB X;  4R1J A;  3TQY A;  4A3K H;  4LF6 Q;  3OTO Q;  4ALP A;  1KAW A;  1G29 1;  3PIO A;  3T1Y Q;  1Q86 C;  1PH3 A;  1PYB A;  2ALY B;  3I56 A;  4JI6 Q;  2I0Q A;  3J7A 5;  3W1G A;  2EXD A;  4GOP C;  5FLX c;  2PMZ E;  1WOC A;  3UE0 A;  2K52 A;  2AKW B;  4GLV B;  2VNU D;  2UUB Q;  2IX0 A;  1L2F A;  1OXT A;  4B3T Q;  3G71 A;  2R7F A;  2ZM6 Q;  4IJH A;  4C3H H;  2E2I H;  3CXC A;  4A3C G;  2V1C C;  1QUQ A;  1UE1 A;  2JQO A;  5FJ8 G;  1EYG A;  1TWG H;  4MTN A;  4C3J H;  1WJJ A;  2ZTD A;  3U50 C;  1L1O A;  4IOC A;  3K7U C;  3UDX A;  4JI0 L;  2UUC Q;  1YHA A;  5GAD C;  1IBK Q;  3G48 A;  3J81 j;  3PO2 G;  1X9N A;  5JJK A;  3CW2 C;  5GAE C;  1HH2 P;  1K0R A;  2A1A A;  2PQA B;  3K80 C;  5FLM G;  3M4O H;  4YWK A;  1D7Q A;  2CQO A;  1H95 A;  3GTM H;  2ES2 A;  1E7Z A;  4P73 A;  3RN2 A;  2CWP A;  4YHH Q;  4UY8 C;  1VQA A;  3S2D H;  2LSS A;  1Y1V H;  3TEH B;  4OXP A;  2I5H A;  5IT9 c;  4POG A;  3F2B A;  4X65 Q;  4KI0 A;  1BBU A;  1VQD A;  4DV3 Q;  2ASB A;  1L1O C;  4NPS A;  2MO1 A;  1YIT A;  3PO3 G;  2NN6 I;  3UDF A;  3H15 A;  1Q8K A;  4JBW A;  2E5L Q;  4A93 H;  2VW9 A;  4A3K G;  1XNQ Q;  4GN3 B;  4OX9 Q;  3GD7 A;  1XMO L;  3I55 A;  3FHW A;  5BR8 Q;  3PIP A;  1IBL L;  3CC7 A;  1QVF A;  4LF4 Q;  3T1H Q;  1X3G A;  1VQC A;  2A8V A;  4JI8 L;  4LNQ A;  3KFU A;  1A63 A;  4DR1 L;  3TRZ A;  4IPD A;  5M5X H;  1VQE A;  1YJW A;  4NB3 A;  3A74 A;  4LUO A;  1N36 L;  4RG1 A;  1CKN A;  1JB7 A;  2VUM H;  5M3M H;  1IZ6 A;  3HOW H;  2JA6 H;  1VQL A;  2WAQ E;  2BA1 A;  3E0E A;  5IP9 G;  1O7I A;  1TWC H;  5IYC H;  2E2J H;  3CME A;  4P72 A;  4DUZ L;  1NTG A;  3RLN A;  5IYD H;  1HZA A;  4DAY B;  1Y1W H;  4AH6 A;  1M1K C;  4DUY L;  4PZ8 A;  1L0W A;  5IP7 H;  4GN4 B;  4LW1 A;  4LF8 L;  2KCM A;  4R4O A;  3UDG A;  4LF9 L;  1R9T H;  4NXM Q;  3CD6 A;  3ULJ A;  1PH7 A;  2UXD Q;  2XGT A;  1KL9 A;  4JBJ A;  4LUV A;  4DV7 Q;  1VQK A;  1NY4 A;  1A62 A;  4IOA A;  4JYA Q;  2Z6K C;  3DM3 A;  4OON A;  4JI7 L;  1HZC A;  4RMF A;  3I4M H;  1PYS B;  1Q1E A;  2MO0 A;  3L7Z C;  4NXN Q;  5GRO A;  1OXS C;  1QVC A;  4DR6 Q;  1Y1V G;  3D0F A;  1JJ2 A;  1C9O A;  4YCU A;  3CPF A;  2QGQ A;  3M9B A;  4IPC A;  2ZJP A;  1Q82 C;  3JC6 6;  4JOI A;  4B3R L;  3HOV H;  4WJ3 M;  1SE8 A;  1HNX L;  2ZJR A;  5C44 G;  1KHI A;  2VQE L;  4A3G G;  4BY7 G;  4R4T A;  1I5F A;  3HKS A;  3W5O A;  4DV5 Q;  1YJ9 A;  4A3J G;  2PQA A;  4JI1 Q;  3HOX G;  4A3I G;  3MXN B;  1PH2 A;  1PH9 A;  3J80 i;  1N34 Q;  1FJG L;  1Q46 A;  3PUV A;  5LMU Q;  2BH2 A;  2IX1 A;  4BA2 I;  1E3P A;  4K0K L;  4J15 A;  1JMC A;  2RCN A;  4BBS G;  3E9I A;  3RZD H;  1XNR Q;  1VQ5 A;  1I3Q H;  2VUM G;  4A3E H;  2HQL A;  2HHH L;  4QGU A;  3M85 A;  3GTP H;  3SGI A;  1I94 Q;  2L15 A;  5ELN A;  1AH9 A;  4JOI C;  2NN6 G;  2DUD A;  1X3F A;  1LM0 A;  4AYB G;  2PI2 E;  3AFQ A;  2KHJ A;  5IYC G;  3HOZ H;  1FVI A;  1A0I A;  4UPA A;  3A5U A;  3L2P A;  3UE1 A;  4BBR G;  3F1Z A;  3J80 c;  3HOY H;  2UXB Q;  2F52 A;  5JJI A;  1XTD A;  5IYD G;  1LTL A;  1XMQ L;  4DV2 Q;  3S1M H;  4POF A;  1Q81 C;  3M7N A;  1HJP A;  2LXJ A;  2VQF Q;  2Y0S G;  3PUZ A;  1VQJ A;  2AWO A;  4IPH A;  3J81 i;  3CPW A;  3F2D A;  1VQH A;  3VDY A;  1ASZ A;  4GKK Q;  2KBN A;  1CKN B;  5M3F H;  4LFC Q;  4IFD J;  1U5K A;  3CCV A;  4LF7 L;  3OTO L;  4JBK A;  3T1Y L;  2K14 A;  4L5S A;  2IY5 B;  2YV5 A;  4JI3 Q;  4KHP Q;  2R92 H;  4JI2 L;  5JJL A;  2YTY A;  4HID A;  4JI5 Q;  2UUB L;  4O0A A;  3ULL A;  3GTO H;  2HT1 A;  1QZG A;  3J81 c;  4B3T L;  2F4V Q;  1JE5 A;  3FKI H;  2C35 B;  1EUJ A;  5J3B A;  2UXC Q;  2KHI A;  2WB1 E;  1WFQ A;  4DV6 Q;  1X54 A;  1HZB A;  2F3I A;  1NMF A;  1BKB A;  3KF6 A;  1WI5 A;  2H5X A;  4HIO A;  3EIV A;  4DR7 Q;  4GKJ L;  3GTK H;  1HNW Q;  1IYJ B;  1XJV A;  2PNH A;  1OXV A;  1E22 A;  5IWA L;  1SFO H;  1S72 A;  1IBK L;  4GLX A;  1PA6 A;  4AQY L;  4L5Q A;  5C3E H;  5IE8 A;  3CQZ H;  1YJN A;  1ASY A;  4A3D H;  2K5H A;  3GTG H;  4DR4 L;  2N78 A;  3PUX A;  1SLJ A;  4JCV E;  3ZJY C;  1K8A C;  2JA8 H;  1K9M C;  4IFD G;  1I50 H;  1N32 L;  1YBY A;  2CKZ B;  2CWA A;  4LUZ A;  3HOU G;  2OTL A;  3KOJ A;  1IXR A;  4YHH L;  4GNX A;  4A75 A;  2NVY H;  3CCM A;  1YIJ A;  2BH8 A;  1KIX A;  4X62 Q;  2B29 A;  4X65 L;  4YCV A;  3KF8 B;  4P74 A;  2E5L L;  2HIV A;  1XNQ L;  4OX9 L;  1GKH A;  4LF5 Q;  2JE6 I;  5BR8 L;  2MFI A;  5K36 G;  4PZ6 A;  3BZK A;  3T1H L;  4X66 L;  1LYL A;  2IT1 A;  1V43 A;  2D0O A;  3KYH C;  3RNU A;  1QZH A;  4JI0 Q;  1VQN A;  1WCM H;  4A3F H;  4LFA Q;  1MIU A;  1YEZ A;  3LGJ A;  4EQ5 A;  3ULP A;  4APV A;  1CKO A;  4DK3 C;  2OTJ A;  2ZTC A;  3NEN A;  1A8V A;  5M5W H;  4OWW B;  1BBW A;  4YY3 L;  3FKI G;  1S3O A;  4BY1 H;  1VQI A;  4A3M H;  2YTV A;  3KDF A;  4JG2 A;  3M3Y H;  4DR5 Q;  1X6O A;  2JEB I;  1PVO A;  1EWI A;  3RZO H;  5JEA J;  4HJ9 A;  1NE3 A;  4DNI A;  1CSP A;  3AYH B;  4QY7 A;  1YHQ A;  1C0A A;  2K4K A;  5M5Y H;  4NXM L;  2OQ0 A;  1UEB A;  2FXQ A;  2UXD L;  5DLQ E;  3EN2 A;  3S1R H;  4A3D G;  2NVQ H;  4DV7 L;  1TWF H;  1B7Y B;  4JYA L;  1IBM Q;  1J5E Q;  1IBL Q;  1B8A A;  2N49 A;  4JV5 L;  1KC8 C;  3KF6 B;  3CF5 A;  1GVP A;  1V9P A;  3NEM A;  4NXN L;  3CC4 A;  1VQP A;  4IFD I;  3FP9 A;  4BXX H;  4DR1 Q;  1X55 A;  5JEA G;  1HR0 Q;  4DR6 L;  3RLO A;  2YU9 H;  4HJ8 A;  2ATW A;  4TQU S;  3ICE A;  2R7D A;  4B3M L;  4L5T A;  3TS0 A;  2MNA A;  2R93 H;  5C4X H;  4QIW E;  3M4Q A;  1DGS A;  2B63 H;  1D8L A;  4DV5 L;  4A93 G;  1X56 A;  3G4S A;  2B3G A;  4DV0 Q;  5H1S E;  4JI1 L;  1EFW A;  1N34 L;  1N33 Q;  1SR3 A;  3W1B A;  2JA7 H;  2RHS B;  4O2D A;  1PH5 A;  3CCE A;  5EAY A;  3H0G H;  2KCT A;  2VZA A;  4GNX B;  4LF8 Q;  1XNR L;  1T9H A;  2VS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...