4DR4Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4Q00
2C35B 4IJHA 1RL2A 4AQYL 1SLJA 1QVCA 4JI2L 1NTGA 1CSPA 1XMQL 3I4MG 4DR4L 4LF7L 2JE6I 3ULJA 5JEAG 2VW9A 1HR0Q 1YHQA 1JJCB 1V9PA 1FJGQ 4DV2Q 3CF5A 1FJGL 3K7AH 4A3LH 1N36L 3MEFA 1VQEA 3K7UC 4RMFA 4DV1L 4L5SA 3PF4A 1C9OA 4LF6Q 2ES2A 2WAQG 3I4NH 2ZTCA 3GTQH 4L5RC 1Q81C 4DV5L 3TRZA 4X64L 4JI1Q 2UUAQ 5EAYA 2V1CC 3JAMi 4KHPL 1PH6A 3HFZB 4GN4B 4DUYQ 1M90C 2BA1A 1P8LA 3S2HH 2CFMA 1O7IA 1B7YB 2HQLA 4HJ9A 1XNRL 4LUOA 1SR3A 1YNXA 2F4VQ 3TQYA 3AQQA 4DNIA 4BBSH 1L2FA 1PYSB 2R6GA 4DR1L 1GM5A 4AYBE 4DKAC 2E8GA 3CCEA 5IYCH 5FLMG 1MIUA 1S3OA 2MQHA 2RCNA 3J7A5 1Z9FA 4B3TQ 1HNWQ 5H1SE 3EN2A 3J7ZC 4ALPA 2B63G 2CCZA 3I4MH 1OXVA 3PUZA 2UU9Q 1EUJA 3TEHB 4WJ3M 1KRTA 1KC8C 2JEBI 1YBYA 3NEMA 4L5QA 3CMEA 1IBKQ 1C7YA 3DLLA 3EIVA 3KOJA 2JA6G 1Q82C 4MZ9A 4JI6L 5K36G 4A3DG 4JYAL 1UE7A 1K0RA 2E2IH 3HOWH 3GD7A 2HIXA 1HZ9A 1MJCA 2K52A 2ZJRA 1PH7A 2Q2HA 1N36Q 1KIXA 4NXML 2R7FA 4LFAL 4BXXH 1GKHA 2N49A 4PZ8A 3H0GG 3RNUA 2VNUD 4J15A 4LF6L 1I3QH 4XIGS 2D0PA 1PH2A 1PV4A 1N32L 1VQIA 2PQAB 1SE8A 2VZAA 2YTXA 3L0OA 1G291 1KHIA 3BZKA 3M4PA 4YWKA 4JBKA 3RN5A 1CKNB 2QEXA 1I50H 2K4KA 4QJFA 4DAYB 5C0XI 2RHSB 3S14H 1A8VA 4K0KQ 4L5TA 1KAWA 2OCEA 2VQFQ 1YHAA 3KYHC 4DV3L 2I5LX 3K81C 4OWTB 4HJ7A 3HOUH 2N8NA 2PNHA 5C44H 3CCQA 4JYAQ 5BR8Q 2K5HA 1K3RA 1B70B 2EIFA 3PUWA 3Q8DA 4O0AA 4X62Q 1VQNA 2K5VA 4JOIA 1IBKL 1QUQA 3I7FA 3PIOA 3G6EA 3CCJA 4JV5Q 2I5HA 2UUCQ 2UXCQ 3J81i 4X6AH 2E2JH 2NN6G 4AYBG 4NXNQ 1IBML 4R4OA 4GNXB 1BVSA 4A3FH 4DR2Q 1K8AC 1S40A 3S17H 2XGTA 3L7ZC 4DV4Q 4IOCA 4LFCQ 2NN6I 4GKKQ 2ZJQA 1SN8A 1TWAH 5M3FG 1IL2A 2UXBQ 2OQKA 2JA8H 4MNOA 1KQSA 4DV3Q 1VQGA 3M3YH 1U0LA 5FLXc 3CD6A 3S1QH 4WJ4A 4A75A 4BY1G 1MKHA 5IE8A 3UE0A 1Q7YC 2ATWA 1UE6A 2CKZB 4X65Q 2ZM6L 1YIJA 1I6HH 1X55A 1S72A 1EYGA 3W5OA 4TQUS 4JI2Q 4GOPA 1XNRQ 2AHOB 1D8LA 4JI8Q 2JA7H 1TWFH 1T9HA 4DV7Q 3T1YL 4YCUA 5LMNL 3STBC 2ID0A 2YTVA 4UPAA 3H3VI 1BBUA 3ULPA 2VUMG 1VQPA 2Y0SG 1E24A 2JA5H 3PUXA 4GLAC 4YCVA 4HIDA 4IJLA 5IYDH 4IFDI 3RR5A 4JI7L 4A76A 3E9HA 1WFQA 1HNXL 4P73A 5FJ8H 3A74A 3ERSX 3H0GH 4OWWB 1I5FA 4DK3C 1N33Q 3HOVH 1X3GA 1FGUA 3I56A 1LYLA 2HIVA 3F8TA 4B3TL 2JA8G 3NELA 4B3RQ 4B3ML 3L2PA 3K8AA 4DV7L 4LUVA 4B3MQ 4C3HH 1XMOQ 1HNZL 3GTKH 3U58A 3PUYA 1Q12A 1EIYB 1UE5A 2RF4A 5C4XH 2QA4A 1Y1WG 4OWXB 1YJNA 3J81c 2NZHA 4A3KH 5E7NA 4JI3Q 2JA6H 1XMQQ 4DR4Q 4HIKA 4QL5A 3SGIA 1EQQA 2BH2A 4Y52H 1HH2P 1N32Q 1QUQB 2R7ZH 2LXJA 4JI7Q 1TWHH 5C0XG 1VQ4A 2FXQA 2KENA 2WP8J 4FDBA 1E7ZA 4OX9L 1Y1WH 3TS0A 3ICEA 1VQ9A 5C4XG 1E3PA 2UUBQ 2WB1G 4JI1L 5IY0A 2UUAL 1K8GA 1TXYA 4DR5L 4IOAA 1Y14B 5M3FH 3HKSA 1AE3A 4DR5Q 3A5UA 3PO3H 3CW2C 1J5EQ 3OTOL 4C2MH 2RHQB 4QGUA 2BH8A 2K14A 5IYDG 2HT1A 1XMOL 1HNZQ 5JJKA 4LF5Q 3UE1A 1L1OA 1X3EA 1PH5A 4JI3L 5LMNW 1U5KA 3UDGA 1Q86C 4JBMA 4OONA 1E1OA 1I94L 3GTPH 4A3DH 2F52A 1VQ8A 3CPFA 2JA5G 4A3GG 3M85A 4DR2L 2VUMH 3PF5A 4UP8A 4JI4L 4BA1I 1E1TA 3CMAA 2K5NA 3T1HL 4YHHQ 2A8VA 4UP7A 4GLXA 2YU9H 3BZCA 3CQZH 3J80i 4PG3A 2JA7G 4LFBQ 3B6YA 4JC0A 1VQOA 2UU9L 1VQFA 3CP0A 3CCMA 1K83H 2LXKA 1TWGH 4KHZA 3PO2G 2ZTEA 3LGJA 4A3JG 4TVAB 3J81j 1I94Q 1NJIC 3ER0A 4DUZL 4DV2L 1CKMA 2E2HH 3HOVG 1GO3E 1X6OA 1Q46A 1UEBA 1PH4A 4LF5L 1BKBA 1VQJA 5IP7G 3VDYA 2KBNA 3JC66 2H5XA 4APVA 4R4TA 2R92G 1YVCA 3CCRA 3DM3A 1PH3A 4GNXC 3HOXH 3M4QA 4LUZA 3J80c 1OXUA 4GLVB 1L1OB 1HZBA 3JAMc 3RZOH 2ZJPA 1VQDA 1HNXQ 4POFA 1J5EL 4B3SL 2UXBL 2YTYA 3AFPA 4MTNA 4AH6A 3CC7A 2E5LQ 4R4CA 1KD1C 1VQHA 3BU2A 4KHPQ 3A0JA 3AFQA 4ME3A 3GTJH 2WAQE 5JJLA 5AJ3Q 1WCMH 3OYYA 1PYBA 4EQ5A 4BA2I 1CKOA 5GROA 2UUCL 5IP9G 1AH9A 3I55A 3K80C 5IYBH 1L1OC 1A0IA 3FKIH 5IP7H 4HJAA 3GO5A 2D0OA 4POGA 4A3BG 2CWAA 4JV5L 1JE5A 3PCOB 1HZAA 2UUBL 3F2BA 2B29A 1X56A 3E0EA 1KL9A 4DR1Q 2XTIA 3KFUA 4HJ8A 4P74A 5JEAJ 4B3SQ 3PO3G 4DV0L 2AWOA 4AIMA 5C0XJ 3U4ZA 3HOWG 1YZ6A 2PI2A 2CWPA 1LTLA 2DUDA 1CKNA 3G4SA 4R1JA 4GKJQ 2WB1E 5IWAL 4PMWA 2MNAA 4C3JH 4DUYL 4DR6Q 4B3RL 2IY5B 1E22A 3F2CA 4R4QA 4JI5L 3UDIA 1VQ7A 3PSIA 4A3EH 3PUVA 3HOUG 5GAEC 3OW2A 3UDXA 1IYJB 3I2ZA 4UP9A 5LMUQ 1X9NA 2ASBA 2YV5A 1XPOA 2VY3A 3S15H 2MO1A 1Y1VH 2VS1A 1N8RC 5C3EH 4OO1I 1SFOH 4P75A 5M5XH 1HNWL 5IYBG 4DR7L 3KDFA 5IWAQ 4DR6L 2D62A 2VQFL 1V43A 1X54A 4GN3B 4DR7Q 4X65L 3RLNA 4GOPB 2Q2TA 1QZGA 1HR0L 1KXLA 4YWLA 4JI0L 1Z47A 4DAMA 1XJVA 2PMZE 1PH1A 2ALYB 5DLQE 4AQYQ 3KF8B 4NB3A 1B8AA 2WFWA 3RLFA 4KI0A 3U4VA 1HR0W 1IBMQ 2B3GA 2F4VL 4NXMQ 2AWNA 2GVAA 4LF9L 2R92H 2B63H 3RLOA 5GAHC 4BY1H 3HOXG 4BBRH 1J6QA 3GTLH 4A3CG 2Z0SA 4GNXA 4GOPC 1NMFA 2OWOA 4HIOA 1DGSA 4YHHL 1AE2A 4H02A 1HZCA 4A3IH 2R93G 3PV0A 4DV6Q 1JB7A 1OXSC 3EBEA 1N9WA 3FP9A 4JI4Q 1WOCA 1VCIA 4A3FG 1ASZA 1Q1EA 4X64Q 1NE3A 4R4IA 5GQOA 3KJPA 1EIFA 3CCSA 4A3JH 1EOVA 4LWCA 5IT9c 4P72A 3CPWA 4A4IA 4LF8Q 3CXCA 4BY7H 4XTCS 1XPRA 1JJGA 1EQRA 1BBWA 2AKWB 4OXPA 4DR3Q 1L0WA 3CAMA 2VQEQ 2IT1A 4JOIC 1CUKA 1IXRA 1XNQL 1JMCA 3ZJYC 4DUZQ 2KHIA 2OTLA 3CCLA 1VQBA 1WCMG 4LF7Q 2BA0A 4A3GH 1H95A 2R7DA 4HIMA 4LFAQ 4GKKL 1YI2A 1R9TH 4DPGA 4IPCA 3S2DH 2JA9A 5JJIA 1WI5A 5M3MH 2IX1A 3D0FA 4LFCL 4JCVE 5ELNA 5M5YH 3W1GA 1W3SA 1CSQA 4GS3A 1VQCA 2GN5A 4IPGA 3S24A 2QGQA 3HKZE 4DV5Q 2Q2IA 3M9BA 4YY3L 1GVPA 1KRSA 1VQAA 3PIPA 1PVOA 1D7QA 1OTCA 1OXTA 2OQ0A 1X65A 2NZOA 4JBJA 3KJOA 5C3EG 4LF4Q 1UE1A 4BY7G 3M4OH 3KDFB 2IX0A 3KLWA 2K75A 4QIWE 4JI8L 1IBLL 1VQLA 1Q1BA 3HOYH 3M7NA 4UY8C 2KCTA 2Z6KA 2JJQA 5LMNQ 4DV1Q 2NVXH 1XNQQ 3TS2A 1SROA 3PO2H 3I4NG 2UXDQ 4X66L 1VQ5A 1OXXK 2I5MX 3AYHB 4A3EG 2IHFA 5M5WH 4OO1G 2JK8A 4A3IG 1K73C 2R93H 4X66Q 3BJUA 1EFWA 5C4JH 2ZTDA 2KCMA 2AMCB 4IPDA 3S1RH 1HJPA 4A3LG 5IYCG 4LF4L 2JQOA 3FHWA 2DGYA 1YITA 3H3VH 4DV6L 1YJWA 1N33L 4IFDJ 4JI6Q 5FLMH 3NENA 3U50C 4IO9A 4HJ5A 1V1QA 1WJJA 2JEAI 4A93H 5ELOA 4GN5A 4JI5Q 5BR8L 1YJ9A 4BBSG 2UXCL 1QZHA 4LW1A 2HHHQ 4LF9Q 4P71A 5HGQA 3T1YQ 4C3IH 2Y0SE 1JJ2A 1N34L 1IZ6A 2KHJA 2A1AA 1PFSA 3HOZG 1VS0A 3S16H 3FKIG 5FJ8G 4BXXG 1YEZA 2UXDL 2L15A 3CC4A 4DV0Q 4RG1A 2N78A 4KLKA 4Y7NH 3AEVA 3W1BA 4NPSA 1NBWA 4PZ7A 1FVIA 2A19A 3KF6B 3CCVA 3F1ZA 4A93G 4A3MG 1XPUA 2VQEL 1QVGA 4LNQA 1SRUA 4QY7A 2YYZA 2R7ZG 1NY4A 3K0XA 1SMXA 2F3IA 4YY3Q 3F2DA 1VQMA 2NVQH 1QVFA 3G48A 5J3BA 3STBD 1PA6A 1PH8A 1XTDA 1N34Q 5AJ3L 1M1KC 4JG2A 4NXNL 2PI2E 4IPHA 4A3MH 3GTGH 2Z6KC 1RIPA 5GAGC 3CCUA 3RN2A 3GTMH 4A3KG 3HOYG 1ASYA 3GTOH 4A3CH 4QQBX 1C0AA 1A63A 2PQAA 3GDEA 3H15A 4OX9Q 3T1HQ 2EXDA 4JBWA 3A5ZB 2I0QA 1WYDA 2E5LL 2CQOA 3S1MH 1TWCH 3I4OA 3D31A 3ULLA 5IP9H 4BBRG 2NVTH 4DR3L 1G51A 1YHBA 3WWVA 1Y1VG 3G71A 4PZ6A 3S1NH 4A3BH 3TREA 1W2BA 2ZM6Q 4LF8L 1FL0A 3NBHB 1Q8KA 4O2DA 3OTOQ 1PHJA 1IBLQ 2MFIA 2IHEA 1UWVA 5C44G 3KF6A 2N3SA 3CC2A 5M3MG 2LSSA 4YCWA 4YWMA 1PH9A 1MJEA 2HHHL 4DK6C 5GADC 1P16A 4DV4L 3UDFA 1G6PA 2K50A 1EWIA 1VQ6A 1GD7A 3MXNB 1LUZA 5LMUL 3HOZH 2MO0A 3RZDH 1A62A 3IRBA 3PGZA 1X3FA 4LFBL 5HY6A 2Q2UA 2OTJA 4IFDG 4GKJL 1JT8A 2VL6A 4K0KL 1VQKA 2EQSA 4X62L 4EX5A 1K9MC 1NMGA 2GVBA 3E9IA 4JI0Q 2NVYH 3HKZG 1LM0A
chains in the Genus database with same CATH superfamily
2KCNA 5T1IA 5EPLA 4JI2L 1NTGA 1CSPA 2JP1A 4DR4L 2JE6I 3ULJA 4K5WA 3CF5A 3Q23A 3VA5A 3K7AH 4A3LH 3HOXB 4QF4A 1VQEA 3QIAA 4RMFA 5CV6A 4DV1L 2EVBA 2ZTCA 4DAPA 3BDOA 1D6EC 1D2BA 3HFZB 2B2WA 1SNPA 2A6EC 5L37A 2CFMA 1O7LA 1AZPA 4RHSA 1V1PA 1EZ8A 1YNXA 4KKTA 2F4VQ 1JC7A 3DHQA 1BCPD 3TQYA 5NUCA 3AQQA 4BBSH 1L2FA 1RCVD 4DKAC 1KABA 2E8GA 1K8MA 2K05A 1HA6A 2B2VC 2MQHA 3I91A 2LY7A 1NSNS 4FVMA 4CDEC 1DCZA 5H1SE 2MGSA 4ALPA 2B63G 1KRTA 1I50B 2Z4IA 3LWEA 3WOEA 1C7YA 1HUNA 2NWGA 3KOJA 3J7AV 5K36G 4A3DG 2ZJRA 1KIXA 3M3YB 5FK9C 2N49A 3RNUA 4O1NA 1AFPA 4XIGS 2D0PA 1PV4A 1F9QA 3HP3A 3A8IE 1VQIA 2PQAB 2YTXA 2EY6A 4LAAA 4IUVA 1KHIA 3BZKA 3K58A 1UNSA 2D5DA 3NTHA 5C0XI 1JWMD 2NBFA 4L5TA 3D6CA 1YHAA 2I5LX 4GZYC 5BR8Q 1B70B 1VQNA 1GUOA 1YNJD 2R93B 3TBIB 2B63B 3CCJA 1AW7A 2HUGA 2NN6G 5E4XA 1IBML 1X3QA 4A3FH 1S40A 4DV4Q 2RKSA 5M3FG 1IL2A 3FEWX 1FD7D 3HZXA 2OQKA 3TP7A 2JA8H 3M3YH 5K36H 5FLXE 1VQGA 3CD6A 4DA2A 3S1QH 4WJ4A 4QUFA 3H3VC 3D4WA 1PTOB 1X55A 1S72A 2WB1B 1EYGA 4GOPA 4XT1B 2AHOB 1D8LA 2Z9HA 3TZDA 2OEOA 1HPCA 4JVZA 4KN4C 1CTMA 1T9HA 2F0NA 3HGBA 1TU2B 2ID0A 2AQ1B 1DONA 3ULPA 2VUMG 2YU9B 1TT2A 1PRTF 2BCOA 1QNUA 4HR7B 2O2LD 3PUXA 4YCVA 4HIDA 4IFDI 2NZ1D 3RR5A 2H1EA 4X3TA 1WFQA 5FJ8H 3A74A 3ERSX 1I5FA 5I4DA 1L0YB 3I56A 1A3TA 3F8TA 2JA8G 4B3RQ 2EYFA 4J8QA 4DV7L 1MSGA 3JAML 3U58A 2RF4A 2QA4A 1L0XB 4OWXB 3J81c 2EY2A 4N8X1 4Y52H 2FMCA 3IKJA 4JI7Q 2WV6D 2KENA 3S1NB 2JA7B 1SEBD 1Y1WH 5C4HA 2WB1G 1D5ZC 2F0FA 4JI1L 4IOAA 1Y14B 3PO3H 2VUMB 1XWEA 4QGUA 1EWCA 2K14A 5DAUA 2K7VA 2JA8B 3UE1A 1BUVT 3TZUA 3UDGA 1E1OA 4A3DH 4JK1C 2VUMH 1H9SA 4BA1I 3J7YW 4C56C 2B2UA 2YU9H 4GLXA 3BZCA 3M7GA 3J80i 2JA7G 4LFBQ 1LT6D 4JC0A 1RJTA 2UU9L 3V2TA 3CCMA 2LXKA 1I3QB 1PTOH 1PTOC 1TWGH 4KHZA 3VR6A 4WRDA 3VR4A 1SE4A 3ER0A 4LJZC 4DV2L 2E2HH 2L12A 3HOVG 1X6OA 3QG1A 1VQJA 3JC66 2H5XA 4APVA 4R4TA 1YVCA 3CCRA 3DM3A 1SBBB 3M4QA 4GLVB 1HZBA 2JN4A 4B3SL 3CC7A 2E5LQ 4R4CA 1QWYA 5EKLA 4BY1B 2B8GA 3EQLC 1CM9A 5DEHA 1LTBD 2WAQE 1LACA 1LABA 1WCMH 4KY6A 5FO9B 2K28A 1C48A 1L1OC 2D0OA 1JE5A 1WTXA 1CHPD 1HZAA 2UUBL 4K8JA 2F0KA 1AEXA 3U9SA 2DNCA 1NAPA 3CU7A 3WOFA 4B3SQ 3HOWG 1SE2A 1YZ6A 2LFNA 4KJNA 4CKCA 3HKZB 3PQIA 1ET6A 2WB1E 2B2VA 5IWAL 4DUYL 2IY5B 5C0XH 4RA8A 3RZOB 4JI5L 1TWCB 3PUVA 4BS9A 4HCEA 1B53A 2ASBA 2YV5A 1XPOA 2VY3A 2MO1A 3EFXD 4K6DA 1ZEQX 4FNFA 4ULLA 2KHSA 4OO1I 5M5XH 2KVMA 4HCSA 3MZ5A 3KDFA 1EQVA 3PIP3 1QJOA 4I7ZC 4DR7Q 4IALA 1HR0L 4JI0L 2Z1CA 1JE4A 5COYA 3DEOA 4NB3A 5DLQE 4AQYQ 1SNQA 2WFWA 4KI0A 5M5YB 1IBMQ 1Y1VB 4WORA 2A69C 5GAHC 4BY1H 2Z4HA 3H94A 1J6QA 5I9PA 4GNXA 1NMFA 2OWOA 4HIOA 1ML0D 4G7OC 4A3IH 1JICA 3NTKA 1JB7A 1OXSC 1WOCA 1E0BA 1VCIA 4R4IA 4A3CG 3CCSA 1EIFA 4LF8Q 3P20A 4CJ0B 5DM63 4JOIC 2EZVA 3VA7A 1JMCA 2OTLA 4IURA 5M3FB 1QG7A 3NUCA 4DPGA 1GUGA 5JJIA 2JSOA 2IX1A 4LFCL 1YNNC 4DFAA 4EGVA 3NP8A 1VQCA 4DGZA 2AQ3B 1F9SA 1XX8A 3NQIA 1S5DD 3M9BA 2L1BA 1C8CA 4YY3L 1PVOA 1OTCA 1OXTA 2OQ0A 1EYDA 1M8AA 3KDFB 2IX0A 3KLWA 5KGUA 5AFWA 1VQLA 1VMCA 3HOYH 3I90A 1SFOB 2SNMA 2Z6KA 3O13A 4UY8C 3TS2A 3I4NG 2CVRA 4X66L 1OXXK 2IHFA 5M5WH 4ILWA 2R93H 3GV3A 5JPNC 1FYCA 4E6IA 4KTAA 2AMCB 2VB2X 4G57A 4KKUA 3R93A 2DGYA 1TWFB 1QNKA 4DV6L 4JI6Q 5FLMH 3NENA 3U50C 4Q5VA 1W6JA 4HJ5A 4IUUA 2MPMA 2L9HA 5ELOA 4GN5A 4JI5Q 2F1MA 2Y0SB 4LF9Q 3W2DA 4C3IH 2Y0SE 4U68A 1IZ6A 2QW7A 3HOWB 4H0LC 3HOZG 2EJMA 2CH4W 5T1GA 1TY2A 5FJ8G 4BXXG 3ND8A 2TMPA 1ZKOA 1A2TA 4L63B 2UXDL 1DOMA 2EE1A 4RG1A 1LTSD 2N78A 4RCOA 4Y7NH 4K5XA 4CJ2C 3TP5A 1EU3A 2VXWA 4PZ7A 3W1BA 3ERQA 1FVIA 3KF6B 4A93G 5C4XB 2VQEL 5BN3A 1I4QA 2YYZA 2F3IA 3I4NB 2XWJB 3CQZB 5J3BA 1PA6A 2M00A 4RAUC 2PYKA 1N34Q 2DJGC 1M1KC 4A3MH 4IPHA 1WTWA 4A3CH 3HEJA 4RGNA 2PQAA 3D4RA 3H15A 4JBWA 1BNZA 2I0QA 1WYDA 3MWYW 3BDCA 2MP1A 3D31A 3FKIB 4G7ZC 1NR4A 3CHBD 2NVTH 1G51A 3U9OA 3WWVA 1Y1VG 3S1NH 4A3BH 4DU9A 1Q8KA 2MFIA 1BO0A 3GP7A 1MJEA 3HS0C 2DNEA 1WCMB 1VQ6A 1PFBA 3MXNB 4A3JB 2KEDA 4ZKCB 3PGZA 4CJ1B 5KIXA 1XXGA 3GTGB 3FMCA 2OTJA 4IFDG 3TP6A 2VL6A 2EQSA 4X62L 4EX5A 5LHY1 1K9MC 2GVBA 1S5BD 4O42A 1LM0A 1ET9A 2C35B 4IJHA 2XVSA 1SLJA 3DXJC 4AQYL 3OWEB 3D8GA 1HR0Q 3QOLA 1V9PA 2SNSA 1I4XA 5EGTA 4C3HB 1H9SB 3K7UC 1DOKA 1SNMA 1BCPC 1STAA 4L5SA 1C9OA 1ZYRD 2WAQG 1Q81C 3BDLA 4ZQ3A 1TWHB 2R3ZA 2CW0D 4JI1Q 4X64L 1QOHA 2V1CC 3T53B 1SNCA 1M90C 3S2HH 1O7IA 1B7YB 5IT9E 3K5LA 1Z7TA 1SXTA 3Q6SA 1XNRL 4LUOA 2O4XA 1SR3A 2EYJA 1SNOA 3Q24A 1PYSB 2R6GA 1RHPA 4DXFA 2NVYB 3Q0AA 4EVOA 3CCEA 4FF1A 2WKDA 1MIUA 3J7A5 2R92B 2KEEA 4B3TQ 1PZJD 1HTPA 3J7ZC 1WTVA 1IYUA 3L3OC 3NPPA 2JEBI 1GXDC 1YBYA 2RSOA 5I2XA 2JA6G 1EIGA 1T5EA 4JI6L 3VR3A 1UE7A 3E3XA 5CC4A 4NXML 3NK9A 1PH7A 2Q2HA 1N36Q 2R7FA 5CV7A 3N6RA 1I3QH 4MHEA 3L9AX 1N32L 3L0OA 1SE8A 3T56B 3RN5A 2QEXA 5IGDA 4DAYB 1SYGA 2M9VA 2EJGC 4ID6A 1A8VA 2OCEA 2VQFQ 4IUTA 2PNHA 1CI3M 1ICWA 3CCQA 4JYAQ 1XYIA 3PUWA 2EIFA 4X62Q 3C1FA 4XQJA 1IBKL 1QUQA 3NXWA 2N88A 3SDZA 2HCCA 4X6AH 1EY8A 2B8FA 4FF2A 4DR2Q 2XGTA 3L7ZC 4IOCA 1TS5A 4K6LA 1EU4A 2ZJQA 1TWAH 1X32A 4V0BA 1LT4D 1MSHA 5A35A 4DV3Q 1KQSA 2RBMA 1IW7D 4A75A 4BY1G 1MKHA 2CKZB 3W5OA 1SJED 3N52A 1Y1WB 1TWFH 4DV7Q 1R4QB 5LMNL 3MXGA 3STBC 3CRLC 1GUWA 3H3VI 1BBUA 3HRZC 4HN7A 1VQPA 1E24A 5F2DA 4PV1C 3K5NA 4IJLA 4C2MB 4NKLA 2BDNA 2K32A 2G5DA 4A76A 4P73A 3BVGA 1PZKD 4DK3C 1X3GA 1DOLA 3BG3A 4B3ML 4A3FB 4QUCA 4B9WA 2X69A 4B08A 4B3MQ 1I6VC 1XMOQ 3HOZB 1YJNA 4JI3Q 1XMQQ 4QL5A 3VR2A 1CK1A 1QUQB 1JOOA 1TWHH 2FXQA 4FDBA 3Q22A 5C4XG 1E3PA 1S5ED 2V4DA 3MTSA 1SYDA 5M3FH 3A5UA 1TY0A 2O5JC 3CW2C 1F2MA 1FNWA 3OTOL 3KLSA 2RHQB 2BH8A 1B3QA 1HNZQ 5JJKA 3KF8A 3VYUA 1L1OA 4JI3L 5LMNW 4JBMA 4OONA 1I94L 1ILPA 2WAQB 2ICEC 3G6JB 2FINB 4RGOS 1II3A 3M85A 2Z6BA 4UP8A 2A74C 1JCKB 1E1TA 2K5NA 4WJWA 4YHHQ 2NVXB 3CQZH 4JW0A 2EPBA 2D2CC 1GHJA 3URYA 4ABNA 5ELCA 2ZTEA 4RKBA 4DUZL 1R4PB 2WINB 1UEBA 4LF5L 1KDAA 1BKBA 3VDYA 4HSPA 1YNND 3J81L 5CV4A 1PH3A 3HOUB 2JA5B 2BOSA 2F4IA 3A7LA 1JQYD 1OXUA 3RZOH 1HNXQ 4POFA 1J5EL 4A3EB 2GA4B 2EYLA 3NBIA 4MTNA 1KD1C 4H7BA 3BU2A 1I4RA 3P75A 3GTJH 1RDPD 1TS4A 3OYYA 1CKOA 3NWSA 4LK1C 5IP9G 3I55A 4OELB 5IYBH 1A0IA 5IP7H 2PCFB 4POGA 2CWAA 5C4ZA 1U4LA 3F2BA 1CT1D 2B29A 1X56A 1KL9A 4PMCA 4DNTB 2ICIA 3KFUA 4P74A 2VB3X 2AWOA 4AIMA 1LT5D 3U4ZA 1LTLA 3C2PA 4OL7A 3TMEA 2H4OA 3GTOB 1PTOD 1GUSA 4C3JH 3OW7A 2J4XA 1TKWB 2I46A 3S14B 3HOUG 3PSIA 3OW2A 2EY5A 3I2ZA 4UP9A 4L6TB 5LMUQ 1JORA 2ENBA 1HHVA 1E2WA 3VR5A 1M4VA 1SFOH 2XNAC 1TQOA 1BQQT 5IYBG 5IWAQ 2D62A 2VQFL 1K3BC 1X54A 3RLNA 2Q2TA 1KXLA 1IKMA 4U673 1PRTD 1J8IA 5CBEE 1PH1A 5HGTA 1B8AA 4MTKA 5K5PA 2B3GA 2F4VL 4R9WA 3EVQA 1HCZA 4HMJA 4FYDA 2R92H 4LF9L 4Y7NB 2B63H 3QR8A 4C1NI 3HOXG 4X3SA 5CYUA 3HG9A 4HMIA 3GTLH 3RMHA 2Z0SA 3GTJB 4YHHL 1AE2A 4H02A 4DV6Q 4UHVA 1ASZA 5EBCA 4X64Q 2JEAI 5GQOA 3KJPA 1LTTD 3CPWA 1JJGA 1XPRA 1EQRA 2AKWB 1NR2A 4RHRA 2IT1A 3H09A 2B2TA 1JB3A 5JPMC 3H0GB 4DUZQ 2KHIA 2NUCA 4RWSC 2PZTA 1WCMG 2R7DA 1ENAA 4HIMA 2F0DA 3A55A 4A3IB 3AU7A 1O80A 1BF4A 2LMCB 4MN3A 4JCVE 5M5YH 3W1GA 1W3SA 4F87A 2L11A 4OIKA 4DV5Q 1VQAA 2HDLA 1D7QA 3KJOA 5J1ZA 3I72A 2K75A 1IBLL 1Q1BA 1J9OA 4ZYSA 3M7NA 3MFYA 2JJQA 4C3JB 1V1PB 2UXDQ 1VQ5A 2ZT9C 2BE5C 3SR1A 2A69D 5CV5A 5KEEA 1K73C 1JWSD 3KK7A 5C4JH 2ZTDA 1GJXA 1Y8OB 2JQOA 3E0JA 3FHWA 5ELBA 4V190 3I3CA 1YJWA 1EFID 1H9RA 1R9TB 3T16A 3FVQA 1WTPA 1STNA 2L5TA 2PMZB 4I65A 3PIO3 5BR8L 3C3LA 4BBSG 1V8QA 2UXCL 1NNXA 2HCIA 1BCPF 1JOKA 2WIIB 5HGQA 4EQOA 5KNDA 1N34L 2B2YA 2JYOA 1PFSA 1VS0A 2X6LA 3AB9A 5JAVA 4RCNA 5C44B 3R2TA 2L15A 5BN5A 3CC4A 4F8MA 4KLKA 2WKCA 4HTHA 1HXYD 3K7AB 4QMGA 3CCVA 2DN8A 1XPUA 1QVGA 4LNQA 2JA6B 2AUJD 2OT2A 1SMXA 4YY3Q 2F0GA 3BVZA 1VQMA 1QVFA 3G48A 3STBD 2OXPA 1XTDA 5AJ3L 2PI2E 2PZUA 1F9PA 2Z6KC 1CHQD 5GAGC 3SXHA 3HOYG 3BVMA 3GTKB 3GDEA 3J7AF 2SOBA 1Q8IA 3T4AC 2E2HB 2F0OA 3A5ZB 5D14A 2CQOA 3RD4A 3I4OA 4K5VA 1ESFA 4BBSB 3X3MA 4LMQD 4ZK9B 3R2IA 4PZ6A 4LF8L 1IBLQ 4O2DA 2IHEA 1A2UA 1SMYD 3KF6A 4XT3B 2LSSA 3NQTA 4YWMA 2HHHL 4DK6C 5GADC 2ZXOA 1P16A 4DV4L 1STEA 2K50A 3EROA 3VYSA 2MUYA 1LUZA 5KYLA 3HOZH 4NMZA 3UI2A 2MO0A 1A62A 3IRBA 5C3WA 5CGKA 1SJHD 2HD3A 5HY6A 5C5MA 1JT8A 1NMGA 3E9IA 4BBRB 2NVYH 1LTRD 3TDQA 5IGBA 1RL2A 1IKLA 1QVCA 4K2LA 1XMQL 2VW9A 5KNBA 4DV2Q 1ZXTA 4DK0A 3K57A 1FJGL 2XN9C 4CKBA 2F3VA 1KLUD 4DXGA 1N36L 5EPKA 4ZRZA 3PF4A 1A3UA 3K5MA 2ES2A 3I4NH 1GUNA 3TRZA 4N9TA 3JAMi 5LL6X 4DUYQ 2BA1A 4OIJA 3S2DB 2A73B 2HQLA 2K04A 1MD2D 3S1QB 1EY9A 1B44D 3S1RB 3PMFA 4FO2A 2E74C 5EBDA 2EYPA 1EYCA 1BBXC 2KECA 1Z9FA 1SSOA 2BDOA 2F0IA 3EN2A 3I4MH 2K5DA 3RUZA 3PUZA 3QOJA 2A68C 4RH6A 5IT9L 2UU9Q 1KC8C 1ICFB 3NEMA 4L5QA 3CMEA 4DN4M 3DLLA 3EIVA 4QCLA 1RTNA 2E2IH 3HOWH 1HZ9A 1MJCA 2K52A 4HSVA 4KK7A 1YNJC 4LFAL 4BXXH 4PZ8A 2VNUD 1PTOF 3S2HB 2K01A 4R8NA 2VZAA 3E6ZX 3BS1A 1GM5A 1FGBD 1G291 3M4PA 2IJ0A 1CKNB 2K4KA 3OMCA 4XQQA 1ZYRC 5CBAE 1WTOA 3S14H 2RVLA 4QB4A 3KYHC 4DV3L 4HJ7A 3K81C 4R8IA 3HOUH 1GUTA 2N8NA 3T13A 2EYHA 1LTGD 2N55A 4OHJA 2K5HA 1K3RA 2B2TC 4YIJA 1HRJA 3I7FA 3PIOA 3G6EA 2I5HA 2UUCQ 2PW5A 2ZXRA 5DNFA 2E2JH 1MBYA 3NHHA 4AYBG 4NXNQ 1U4RA 5KYIA 4R4OA 4GNXB 1TVXA 4KY7A 4GKKQ 4XXEA 1KAAA 4A3BB 4MNOA 3A56A 5IIFA 4ME5A 5IE8A 2ATWA 2O5IC 2ZM6L 1I6HH 1Y69U 4JI2Q 2JXMB 2JA7H 4B9XA 1DM0B 1WTHA 2EDGA 4YCUA 1BCPB 2B2UC 2F0MA 2Y0SG 2JA5H 4GLAC 1Q90A 2KCCA 1NCVA 2K33A 5IYDH 3D6WA 3FDTA 4JI7L 4XYOA 1HNXL 3H0GH 4OWWB 1N33Q 3M4YA 1FGUA 1LYLA 4B3TL 2EY1A 3G7LA 3MHBA 4J1MA 3K8AA 1ILQA 4C3HH 1HNZL 4K2KA 3J80L 1Q12A 4DF7A 1Y1WG 1DD2A 1B3AA 2NZHA 5E7NA 4C3JG 4A3KH 2JA6H 4HIKA 3A7AB 2BH2A 4KN7C 1EQQA 3V96A 1AZQA 1WD0A 2R7ZH 4IUNA 3ICEA 4OX9L 1E7ZA 1QILA 2EYOA 3TS0A 1VQ9A 4RGMA 1GOZA 2UUAL 1K8GA 3SE0A 2L0CA 1B9NA 3HKSA 1EEFD 4NDXA 3J80E 4DR5Q 5IGCA 3SK8A 1LV9A 2B2YC 1B4OA 5IOCA 1DJRD 1HQRD 5IYDG 1XMOL 4QIWB 2F0SA 3K5OA 1U5KA 4IUQA 2F52A 1GHKA 3CPFA 2JA5G 2QDLA 2EOTA 3EA6A 4DR2L 4G4KA 3PF5A 3K6OA 4M8AA 4UP7A 4PG3A 1RTOA 3DEPA 5M3MB 5A2QL 1VQOA 2G9HD 5KNCA 1K83H 3I4MB 2F3WA 4TVAB 1NJIC 3SVMA 1GO3E 1PH4A 1JWUD 5EKKA 2KBNA 2NN6H 1U4MA 4GNXC 4LUZA 1L1OB 3JAMc 1VQDA 2UXBL 2YTYA 2QKIC 3AFPA 4DK1A 3AFQA 4AYBB 4ME3A 4EQ5A 1PYBA 5IGGA 5GROA 3S1MB 1AH9A 4HJAA 4A3BG 4IQZA 4IUPA 5EPJA 3RZDB 3QJYA 3E0EA 5ELDA 2XTIA 1S5FD 3QB3A 5JEAJ 3VYRA 4HJ8A 3S16B 4DV0L 2PI2A 2ZXPA 2CWPA 4H44C 5D65A 4ZKBB 3OMGA 3M4OB 3G4SA 4DAVA 4GKJQ 4B3RL 4DR6Q 4PMWA 2MNAA 1PRTC 1MHWC 1E22A 3F2CA 4R4QA 4A3EH 5GAEC 5C4JB 4X3UA 5FO7B 2IPKD 2MJ8A 3OPOA 5FKAC 3E5SA 3H91A 3TN2A 2Q8TA 2LS01 3FPPA 1Y8PB 2VS1A 1N8RC 3GTPB 2L4NA 1RD9D 3OWFA 3KLRA 1D5XC 2KA7A 1V43A 4GN3B 4ZCKA 2B2WC 4KMUC 4YWLA 1Z47A 4FXGC 1G8ZD 2NTTA 1F9RA 3KF8B 3RLFA 1A6XA 1HR0W 3U4VA 2AWNA 3FPUB 5C3EB 4BBRH 4KD4A 1EL0A 4RGTA 4A3GB 1H9JA 1HZCA 2R93G 3PV0A 5ELEA 2Q8IB 1QB5D 3EBEA 1K8AC 2E2DC 1EQTA 2E76C 4LWCA 4BY7H 4P72A 5G3LF 3CXCA 1A15A 1MGSA 4DR3Q 4ZUJA 1L0WA 3CAMA 1CUKA 1EY5A 2K6AA 1SAPA 4C1NK 1XNQL 4F7XA 3ZJYC 1VQBA 4LF7Q 1EEID 2G9DA 1H95A 3WDNA 4LFAQ 1YI2A 4CBVA 5C5LA 4IPCA 3S2DH 1TR5A 5EQ0A 1IL8A 1TS2A 5C6AA 5M3MH 3D0FA 5ELNA 5JJZA 4GS3A 4IPGA 3HKZE 3NSWA 1GVPA 1KRSA 5C3EG 3BZDB 4BY7G 4JI8L 3NWTA 4QIWE 4RKLA 2QILA 2C9OA 2KCTA 4DV1Q 2NVXH 2PZWA 1XNQQ 1SROA 1IHZA 3C1EA 3PO2H 4Q0FA 2I5MX 3MC0B 3SK5A 5IGEA 4A3IG 1X3PA 2RDGA 1EFWA 2M2LA 4XQNA 5LL6S 2KCMA 2RSNA 4A3LG 1HJPA 5IYCG 4LF4L 1ESRA 1YITA 3H3VH 1N33L 4DNRB 4IO9A 1V1QA 3MVVA 5CR3A 3LWUA 5E1FA 1PZID 2NB0A 3VYTA 1I4HA 3TP8A 2SEBD 2PNRC 2HHHQ 1PFMA 4LW1A 1JJ2A 1F2YA 3DM1A 4K14A 2A1AA 1HFGA 1RF2D 4BY7B 3FKIG 4IZ8A 2FJ2A 2EJFC 1YEZA 2A6HD 4DV0Q 1JR0D 1BDOA 2XWBB 2SDFA 1NBWA 4NPSA 3F1ZA 3OIQA 4A3MG 5IGFA 1PRTB 5M5WB 1NY4A 3K0XA 3F2DA 2R61A 2J0TD 1PH8A 4JG2A 4NXNL 3GTGH 1RIPA 4OO1H 3CCUA 3GTMH 2IW3A 5I6WA 1ASYA 1I6HB 1A63A 5IODA 1PMRA 2XSCA 2LKVA 2E5LL 1TWCH 1LTAD 4BBRG 1EYAA 3G71A 2K5QA 3KBXA 1W2BA 1FL0A 3NBHB 1PHJA 2B39A 3OTOQ 1H9MA 1HFNA 1EIHA 5G3LD 1UWVA 5D3IB 1DYQA 2N3SA 3CC2A 1JOQA 4YCWA 1PH9A 2TSSA 1O7ZA 2PPBC 1HQMC 2AQ2B 3UDFA 1G6PA 1V1OA 1GD7A 5LMUL 4WFN3 1DZ1A 4LFBL 3JAME 4K8IA 2Q2UA 5I6YA 1WD1A 2IL8A 4TSSA 4JI0Q 5E3FA 2C5CA 5I9OA 3I4MG 4NW2A 2Q8RE 4LF7L 5JEAG 1HTLD 1FJGQ 3AMUA 1YHQA 1JJCB 5KRUA 1CFMA 3MEFA 4LF6Q 1OO9B 3GTQH 4L5RC 4DV5L 1QE6A 2UUAQ 2KUMA 5J22A 5EAYA 1D1KA 4KHPL 1PH6A 4GN4B 2QF7A 5ISRA 1P8LA 4A3DB 1SMYC 1SYEA 5I2YA 4HJ9A 1F2LA 3F2UA 4DNIA 2NVQB 1G6ZA 2A68D 2A6ED 4L8JA 4DR1L 4AYBE 4H13C 4TRDA 1WTQA 5IYCH 5FLMG 1S3OA 2RCNA 1STBA 1SYCA 1B1ZA 1HNWQ 2DJFC 3I4LA 1PFNA 1PXUA 1UEAB 2CCZA 1OXVA 1EWHA 4WJ3M 1EUJA 3TEHB 4S3SA 1IBKQ 1Q82C 4MZ9A 1BOSA 4JYAL 5CV9A 1K0RA 3GD7A 2HIXA 1GKHA 3H0GG 4J15A 4LF6L 1PH2A 4A93B 2F0QA 4JBKA 4YWKA 1I50H 4QJFA 2RHSB 2XRQD 4K0KQ 1KAWA 2KOLA 3DWQA 4OWTB 4FF4A 5C44H 2KJXA 1IW7C 3OIPA 3Q8DA 1HA5A 4O0AA 2K5VA 4JOIA 1E2ZA 2F0VA 4JV5Q 2WACA 3HOVB 2UXCQ 3J81i 2F03A 1BVSA 1VDZA 1H9KA 3S17H 4EQNA 4LFCQ 1PDQA 2NN6I 1STGA 2RDFA 1SN8A 3IFTA 3QO2A 3SHLA 1CA6A 3QWNA 1ONLA 2UXBQ 1STHA 1U0LA 5FLXc 4C3IB 1Q7YC 2F0HA 3UE0A 1UE6A 2F0TA 1BR9A 2F0WA 4X65Q 1YIJA 2MHVA 1XNRQ 4TQUS 1S4ZA 4JI8Q 4UDUC 2FFKB 2QDBA 3T1YL 4UPAA 2YTVA 5M5XB 3BYYB 2CHBD 3E9HA 4MIUA 4X3KA 3HOVH 2HIVA 3OHXC 2FHTA 1ENCA 3NELA 2RCFA 3L2PA 5FOBB 1UAPA 4LUVA 3ZYYX 3GTKH 1SYBA 5CV8A 2AUKA 3GTLB 3PUYA 1EIYB 1UE5A 1STYA 5C4XH 1KNEA 2BE5D 4DR4Q 4N8FA 3SGIA 1HH2P 4F88A 2RA4A 3GTQB 1N32Q 2LXJA 1KNAA 3SK6A 5C0XG 1VQ4A 2WP8J 5HURA 1CA5A 3W3AA 1G2TA 1U9RA 3MXUA 4OGQC 3V05A 4BWGB 2UUBQ 5IY0A 2A6HC 1TXYA 4DR5L 1QCBD 4RFBA 1AE3A 3LNNA 1AP0A 3CRKC 1J5EQ 5EKIA 4C2MH 1G91A 2XRSD 5C3XA 3S17B 3D4DA 2HT1A 3IFDA 3OSOA 4LF5Q 2F0PA 1X3EA 1PH5A 1Q86C 3GTPH 1VQ8A 1EY7A 5DM73 3ONAB 1K0SA 1AN8A 2F0JA 5BN4A 4A3GG 2PW7A 3R8BA 4JI4L 1Z6HA 1BXTA 3CMAA 4OEMB 3T1HL 3HOYB 2A8VA 5E4WC 2QCPX 4KHVA 1TWAB 3OOCA 3B6YA 1C4QA 2Z8LA 1VQFA 3CP0A 2RDHA 3S15B 1LT3D 2D9UA 3PO2G 1SYFA 3LGJA 4A3JG 3J81j 1I94Q 3PO3B 1CKMA 3DWPA 1Q46A 3KLSX 5IP7G 5ELFA 2R92G 2RQXA 3H6MA 3HOXH 1RKNA 3J80c 2ZJPA 3I70A 4AH6A 3P1HA 5JVG3 1VQHA 4KHPQ 3A0JA 4XYQA 3FRPB 4EQPA 2J7ZA 5JJLA 5AJ3Q 4BA2I 2UUCL 4IN3A 3K80C 3FKIH 1LTID 3GO5A 3J81E 5JEAH 4JV5L 3MEHA 3PCOB 1EZ6A 3DUZA 4C3IG 4DR1Q 1VF7A 3PO3G 5C0XJ 1EY4A 1WTRA 4KY5A 1DXMA 1A3VA 1S5CD 2CH4A 2DUDA 4KD3A 1CKNA 3GQBA 4R1JA 4UAIA 4CGYB 2F0UA 3NBHA 5FLXL 3MAQA 5FO8B 4FXDA 4KKSA 4CDDC 5EJWA 2NYZD 4C3HG 3UDIA 1VQ7A 3T51B 3UDXA 1IYJB 1UUPA 1EY0A 1FNVA 3MXNA 1X9NA 1CQFA 3S15H 1Y1VH 5JVH3 4CDCC 4PNYA 5C3EH 4M1UB 2L55A 4P75A 3MXPA 5A2QE 3LX0A 1HNWL 4DR7L 4N9PA 3I8ZA 4DR6L 4G7HC 1TS3A 3TSSA 4PMBA 1T5XD 4X65L 4NP5A 4GOPB 1QZGA 1G2SA 4DAMA 1O7YA 1VF5C 1B9MA 1KLGD 2ALYB 2PMZE 1XJVA 3IAYA 3NTIA 4NXMQ 1FNUA 2GVAA 3RLOA 5CORA 1Q3LA 4GOPC 1DGSA 1W6KA 2K5WA 4JI4Q 1N9WA 3FP9A 4A3FG 2E2IB 1Q1EA 1B2TA 1NE3A 4LF4Q 4A3JH 4Z9CB 4ODGA 1D1IA 1EOVA 5IT9c 4A4IA 4XTCS 1PYWD 1BBWA 4OXPA 2VQEQ 1FR3A 1IXRA 4HEDA 3CCLA 4KJOA 2BA0A 2A5HA 1KDCA 1B50A 4A3GH 5J39A 4TKOB 4GKKL 1IYVA 1R9TH 2I07B 4ZLTF 2JA9A 1E2VA 2NVTB 1WI5A 2HDMA 4PQXA 3S24A 1CSQA 3EJIA 2GN5A 2QGQA 1K83B 2Q2IA 2EYMA 2XIWA 2HQEA 2K1BA 3K0YA 3PIPA 3I73A 1I4GA 1X65A 2NZOA 4JBJA 3CKIB 4ZUIA 1UE1A 2IX3A 1TIID 3D3RA 2OF1A 3ITPA 4ZAIA 3M4OH 1LO5D 1CQVA 4JPBW 5LMNQ 1SDFA 1CZGA 3A8JE 4CDFC 3SEBA 3AYHB 1D5MC 2E75C 4A3EG 2F0EA 1XTCD 2JK8A 4OO1G 4X66Q 3BJUA 2R7ZB 4IPDA 3S1RH 1HUMA 1KDBA 4FXKC 4A3MB 2E2JB 3S9WA 5M9OA 3C46A 4IFDJ 3A8KE 1O78A 2PO4A 1WJJA 2K03A 4A93H 3PO2B 1LLRD 5CMDA 1YJ9A 2DY7A 4IFDH 1QZHA 1K8OA 4P71A 5D3DA 3T1YQ 1RODA 2KHJA 2DY8A 1VMPA 2FMMA 3S16H 3R3OA 2NTSA 1SE3A 4P2CB 4XDXA 1PLFA 2P5ZX 2QEJC 3A54A 3ND9A 2EXZA 4CKEA 3MFGA 3SK4A 3AEVA 2A19A 4CHTB 1SRUA 2CW0C 4QY7A 2R7ZG 3KUPA 2NVQH 1I4PA 1EOTA 2F0LA 1NUCA 2PQEA 1EY6A 4I7AA 2IWHA 3RN2A 4A3KG 1SNDA 3GTOH 4QQBX 1C0AA 1Y8NB 3P7JA 4OX9Q 3T1HQ 2X6GA 2EXDA 3S1MH 1ENFA 3BYTB 3DWAA 3X3NA 3ULLA 1KTKA 5IP9H 1K28A 4DAYA 4DR3L 1YHBA 3KBGA 5JOBA 3TREA 4FP5D 2ZM6Q 3IL8A 3GTMB 2KQ3A 5C44G 1F2ZA 3DMUA 4J6HA 3NE5B 3MA2B 5M3MG 1F77A 1MI2A 4KV6A 4FF3A 2CQAA 1WVLA 1EWIA 4HAEA 1CZWA 3K59A 3RZDH 3GV6A 5TSSA 1X3FA 4A3KB 4GKJL 1U4PA 4K0KL 1VQKA 1TWGB 3HKZG
chains in the Genus database with same CATH topology
2C35B 4IJHA 1RL2A 4AQYL 1SLJA 1QVCA 4JI2L 1NTGA 1CSPA 1XMQL 3I4MG 4DR4L 4LF7L 2JE6I 3ULJA 5JEAG 2VW9A 1HR0Q 1YHQA 1JJCB 1V9PA 1FJGQ 4DV2Q 3CF5A 1FJGL 3K7AH 4A3LH 1N36L 3MEFA 1VQEA 3K7UC 4RMFA 4DV1L 4L5SA 3PF4A 1C9OA 4LF6Q 2ES2A 2WAQG 3I4NH 2ZTCA 3GTQH 4L5RC 1Q81C 4DV5L 3TRZA 4X64L 4JI1Q 2UUAQ 5EAYA 2V1CC 3JAMi 4KHPL 1PH6A 3HFZB 4GN4B 4DUYQ 1M90C 2BA1A 1P8LA 3S2HH 2CFMA 1O7IA 1B7YB 2HQLA 4HJ9A 1XNRL 4LUOA 1SR3A 1YNXA 2F4VQ 3TQYA 3AQQA 4DNIA 4BBSH 1L2FA 1PYSB 2R6GA 4DR1L 1GM5A 4AYBE 4DKAC 2E8GA 3CCEA 5IYCH 5FLMG 1MIUA 1S3OA 2MQHA 2RCNA 3J7A5 1Z9FA 4B3TQ 1HNWQ 5H1SE 3EN2A 3J7ZC 4ALPA 2B63G 2CCZA 3I4MH 1OXVA 3PUZA 2UU9Q 1EUJA 3TEHB 4WJ3M 1KRTA 1KC8C 2JEBI 1YBYA 3NEMA 4L5QA 3CMEA 1IBKQ 1C7YA 3DLLA 3EIVA 3KOJA 2JA6G 1Q82C 4MZ9A 4JI6L 5K36G 4A3DG 4JYAL 1UE7A 1K0RA 2E2IH 3HOWH 3GD7A 2HIXA 1HZ9A 1MJCA 2K52A 2ZJRA 1PH7A 2Q2HA 1N36Q 1KIXA 4NXML 2R7FA 4LFAL 4BXXH 1GKHA 2N49A 4PZ8A 3H0GG 3RNUA 2VNUD 4J15A 4LF6L 1I3QH 4XIGS 2D0PA 1PH2A 1PV4A 1N32L 1VQIA 2PQAB 1SE8A 2VZAA 2YTXA 3L0OA 1G291 1KHIA 3BZKA 3M4PA 4YWKA 4JBKA 3RN5A 1CKNB 2QEXA 1I50H 2K4KA 4QJFA 4DAYB 5C0XI 2RHSB 3S14H 1A8VA 4K0KQ 4L5TA 1KAWA 2OCEA 2VQFQ 1YHAA 3KYHC 4DV3L 2I5LX 3K81C 4OWTB 4HJ7A 3HOUH 2N8NA 2PNHA 5C44H 3CCQA 4JYAQ 5BR8Q 2K5HA 1K3RA 1B70B 2EIFA 3PUWA 3Q8DA 4O0AA 4X62Q 1VQNA 2K5VA 4JOIA 1IBKL 1QUQA 3I7FA 3PIOA 3G6EA 3CCJA 4JV5Q 2I5HA 2UUCQ 2UXCQ 3J81i 4X6AH 2E2JH 2NN6G 4AYBG 4NXNQ 1IBML 4R4OA 4GNXB 1BVSA 4A3FH 4DR2Q 1K8AC 1S40A 3S17H 2XGTA 3L7ZC 4DV4Q 4IOCA 4LFCQ 2NN6I 4GKKQ 2ZJQA 1SN8A 1TWAH 5M3FG 1IL2A 2UXBQ 2OQKA 2JA8H 4MNOA 1KQSA 4DV3Q 1VQGA 3M3YH 1U0LA 5FLXc 3CD6A 3S1QH 4WJ4A 4A75A 4BY1G 1MKHA 5IE8A 3UE0A 1Q7YC 2ATWA 1UE6A 2CKZB 4X65Q 2ZM6L 1YIJA 1I6HH 1X55A 1S72A 1EYGA 3W5OA 4TQUS 4JI2Q 4GOPA 1XNRQ 2AHOB 1D8LA 4JI8Q 2JA7H 1TWFH 1T9HA 4DV7Q 3T1YL 4YCUA 5LMNL 3STBC 2ID0A 2YTVA 4UPAA 3H3VI 1BBUA 3ULPA 2VUMG 1VQPA 2Y0SG 1E24A 2JA5H 3PUXA 4GLAC 4YCVA 4HIDA 4IJLA 5IYDH 4IFDI 3RR5A 4JI7L 4A76A 3E9HA 1WFQA 1HNXL 4P73A 5FJ8H 3A74A 3ERSX 3H0GH 4OWWB 1I5FA 4DK3C 1N33Q 3HOVH 1X3GA 1FGUA 3I56A 1LYLA 2HIVA 3F8TA 4B3TL 2JA8G 3NELA 4B3RQ 4B3ML 3L2PA 3K8AA 4DV7L 4LUVA 4B3MQ 4C3HH 1XMOQ 1HNZL 3GTKH 3U58A 3PUYA 1Q12A 1EIYB 1UE5A 2RF4A 5C4XH 2QA4A 1Y1WG 4OWXB 1YJNA 3J81c 2NZHA 4A3KH 5E7NA 4JI3Q 2JA6H 1XMQQ 4DR4Q 4HIKA 4QL5A 3SGIA 1EQQA 2BH2A 4Y52H 1HH2P 1N32Q 1QUQB 2R7ZH 2LXJA 4JI7Q 1TWHH 5C0XG 1VQ4A 2FXQA 2KENA 2WP8J 4FDBA 1E7ZA 4OX9L 1Y1WH 3TS0A 3ICEA 1VQ9A 5C4XG 1E3PA 2UUBQ 2WB1G 4JI1L 5IY0A 2UUAL 1K8GA 1TXYA 4DR5L 4IOAA 1Y14B 5M3FH 3HKSA 1AE3A 4DR5Q 3A5UA 3PO3H 3CW2C 1J5EQ 3OTOL 4C2MH 2RHQB 4QGUA 2BH8A 2K14A 5IYDG 2HT1A 1XMOL 1HNZQ 5JJKA 4LF5Q 3UE1A 1L1OA 1X3EA 1PH5A 4JI3L 5LMNW 1U5KA 3UDGA 1Q86C 4JBMA 4OONA 1E1OA 1I94L 3GTPH 4A3DH 2F52A 1VQ8A 3CPFA 2JA5G 4A3GG 3M85A 4DR2L 2VUMH 3PF5A 4UP8A 4JI4L 4BA1I 1E1TA 3CMAA 2K5NA 3T1HL 4YHHQ 2A8VA 4UP7A 4GLXA 2YU9H 3BZCA 3CQZH 3J80i 4PG3A 2JA7G 4LFBQ 3B6YA 4JC0A 1VQOA 2UU9L 1VQFA 3CP0A 3CCMA 1K83H 2LXKA 1TWGH 4KHZA 3PO2G 2ZTEA 3LGJA 4A3JG 4TVAB 3J81j 1I94Q 1NJIC 3ER0A 4DUZL 4DV2L 1CKMA 2E2HH 3HOVG 1GO3E 1X6OA 1Q46A 1UEBA 1PH4A 4LF5L 1BKBA 1VQJA 5IP7G 3VDYA 2KBNA 3JC66 2H5XA 4APVA 4R4TA 2R92G 1YVCA 3CCRA 3DM3A 1PH3A 4GNXC 3HOXH 3M4QA 4LUZA 3J80c 1OXUA 4GLVB 1L1OB 1HZBA 3JAMc 3RZOH 2ZJPA 1VQDA 1HNXQ 4POFA 1J5EL 4B3SL 2UXBL 2YTYA 3AFPA 4MTNA 4AH6A 3CC7A 2E5LQ 4R4CA 1KD1C 1VQHA 3BU2A 4KHPQ 3A0JA 3AFQA 4ME3A 3GTJH 2WAQE 5JJLA 5AJ3Q 1WCMH 3OYYA 1PYBA 4EQ5A 4BA2I 1CKOA 5GROA 2UUCL 5IP9G 1AH9A 3I55A 3K80C 5IYBH 1L1OC 1A0IA 3FKIH 5IP7H 4HJAA 3GO5A 2D0OA 4POGA 4A3BG 2CWAA 4JV5L 1JE5A 3PCOB 1HZAA 2UUBL 3F2BA 2B29A 1X56A 3E0EA 1KL9A 4DR1Q 2XTIA 3KFUA 4HJ8A 4P74A 5JEAJ 4B3SQ 3PO3G 4DV0L 2AWOA 4AIMA 5C0XJ 3U4ZA 3HOWG 1YZ6A 2PI2A 2CWPA 1LTLA 2DUDA 1CKNA 3G4SA 4R1JA 4GKJQ 2WB1E 5IWAL 4PMWA 2MNAA 4C3JH 4DUYL 4DR6Q 4B3RL 2IY5B 1E22A 3F2CA 4R4QA 4JI5L 3UDIA 1VQ7A 3PSIA 4A3EH 3PUVA 3HOUG 5GAEC 3OW2A 3UDXA 1IYJB 3I2ZA 4UP9A 5LMUQ 1X9NA 2ASBA 2YV5A 1XPOA 2VY3A 3S15H 2MO1A 1Y1VH 2VS1A 1N8RC 5C3EH 4OO1I 1SFOH 4P75A 5M5XH 1HNWL 5IYBG 4DR7L 3KDFA 5IWAQ 4DR6L 2D62A 2VQFL 1V43A 1X54A 4GN3B 4DR7Q 4X65L 3RLNA 4GOPB 2Q2TA 1QZGA 1HR0L 1KXLA 4YWLA 4JI0L 1Z47A 4DAMA 1XJVA 2PMZE 1PH1A 2ALYB 5DLQE 4AQYQ 3KF8B 4NB3A 1B8AA 2WFWA 3RLFA 4KI0A 3U4VA 1HR0W 1IBMQ 2B3GA 2F4VL 4NXMQ 2AWNA 2GVAA 4LF9L 2R92H 2B63H 3RLOA 5GAHC 4BY1H 3HOXG 4BBRH 1J6QA 3GTLH 4A3CG 2Z0SA 4GNXA 4GOPC 1NMFA 2OWOA 4HIOA 1DGSA 4YHHL 1AE2A 4H02A 1HZCA 4A3IH 2R93G 3PV0A 4DV6Q 1JB7A 1OXSC 3EBEA 1N9WA 3FP9A 4JI4Q 1WOCA 1VCIA 4A3FG 1ASZA 1Q1EA 4X64Q 1NE3A 4R4IA 5GQOA 3KJPA 1EIFA 3CCSA 4A3JH 1EOVA 4LWCA 5IT9c 4P72A 3CPWA 4A4IA 4LF8Q 3CXCA 4BY7H 4XTCS 1XPRA 1JJGA 1EQRA 1BBWA 2AKWB 4OXPA 4DR3Q 1L0WA 3CAMA 2VQEQ 2IT1A 4JOIC 1CUKA 1IXRA 1XNQL 1JMCA 3ZJYC 4DUZQ 2KHIA 2OTLA 3CCLA 1VQBA 1WCMG 4LF7Q 2BA0A 4A3GH 1H95A 2R7DA 4HIMA 4LFAQ 4GKKL 1YI2A 1R9TH 4DPGA 4IPCA 3S2DH 2JA9A 5JJIA 1WI5A 5M3MH 2IX1A 3D0FA 4LFCL 4JCVE 5ELNA 5M5YH 3W1GA 1W3SA 1CSQA 4GS3A 1VQCA 2GN5A 4IPGA 3S24A 2QGQA 3HKZE 4DV5Q 2Q2IA 3M9BA 4YY3L 1GVPA 1KRSA 1VQAA 3PIPA 1PVOA 1D7QA 1OTCA 1OXTA 2OQ0A 1X65A 2NZOA 4JBJA 3KJOA 5C3EG 4LF4Q 1UE1A 4BY7G 3M4OH 3KDFB 2IX0A 3KLWA 2K75A 4QIWE 4JI8L 1IBLL 1VQLA 1Q1BA 3HOYH 3M7NA 4UY8C 2KCTA 2Z6KA 2JJQA 5LMNQ 4DV1Q 2NVXH 1XNQQ 3TS2A 1SROA 3PO2H 3I4NG 2UXDQ 4X66L 1VQ5A 1OXXK 2I5MX 3AYHB 4A3EG 2IHFA 5M5WH 4OO1G 2JK8A 4A3IG 1K73C 2R93H 4X66Q 3BJUA 1EFWA 5C4JH 2ZTDA 2KCMA 2AMCB 4IPDA 3S1RH 1HJPA 4A3LG 5IYCG 4LF4L 2JQOA 3FHWA 2DGYA 1YITA 3H3VH 4DV6L 1YJWA 1N33L 4IFDJ 4JI6Q 5FLMH 3NENA 3U50C 4IO9A 4HJ5A 1V1QA 1WJJA 2JEAI 4A93H 5ELOA 4GN5A 4JI5Q 5BR8L 1YJ9A 4BBSG 2UXCL 1QZHA 4LW1A 2HHHQ 4LF9Q 4P71A 5HGQA 3T1YQ 4C3IH 2Y0SE 1JJ2A 1N34L 1IZ6A 2KHJA 2A1AA 1PFSA 3HOZG 1VS0A 3S16H 3FKIG 5FJ8G 4BXXG 1YEZA 2UXDL 2L15A 3CC4A 4DV0Q 4RG1A 2N78A 4KLKA 4Y7NH 3AEVA 3W1BA 4NPSA 1NBWA 4PZ7A 1FVIA 2A19A 3KF6B 3CCVA 3F1ZA 4A93G 4A3MG 1XPUA 2VQEL 1QVGA 4LNQA 1SRUA 4QY7A 2YYZA 2R7ZG 1NY4A 3K0XA 1SMXA 2F3IA 4YY3Q 3F2DA 1VQMA 2NVQH 1QVFA 3G48A 5J3BA 3STBD 1PA6A 1PH8A 1XTDA 1N34Q 5AJ3L 1M1KC 4JG2A 4NXNL 2PI2E 4IPHA 4A3MH 3GTGH 2Z6KC 1RIPA 5GAGC 3CCUA 3RN2A 3GTMH 4A3KG 3HOYG 1ASYA 3GTOH 4A3CH 4QQBX 1C0AA 1A63A 2PQAA 3GDEA 3H15A 4OX9Q 3T1HQ 2EXDA 4JBWA 3A5ZB 2I0QA 1WYDA 2E5LL 2CQOA 3S1MH 1TWCH 3I4OA 3D31A 3ULLA 5IP9H 4BBRG 2NVTH 4DR3L 1G51A 1YHBA 3WWVA 1Y1VG 3G71A 4PZ6A 3S1NH 4A3BH 3TREA 1W2BA 2ZM6Q 4LF8L 1FL0A 3NBHB 1Q8KA 4O2DA 3OTOQ 1PHJA 1IBLQ 2MFIA 2IHEA 1UWVA 5C44G 3KF6A 2N3SA 3CC2A 5M3MG 2LSSA 4YCWA 4YWMA 1PH9A 1MJEA 2HHHL 4DK6C 5GADC 1P16A 4DV4L 3UDFA 1G6PA 2K50A 1EWIA 1VQ6A 1GD7A 3MXNB 1LUZA 5LMUL 3HOZH 2MO0A 3RZDH 1A62A 3IRBA 3PGZA 1X3FA 4LFBL 5HY6A 2Q2UA 2OTJA 4IFDG 4GKJL 1JT8A 2VL6A 4K0KL 1VQKA 2EQSA 4X62L 4EX5A 1K9MC 1NMGA 2GVBA 3E9IA 4JI0Q 2NVYH 3HKZG 1LM0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C35 B;  4IJH A;  1RL2 A;  4AQY L;  1SLJ A;  1QVC A;  4JI2 L;  1NTG A;  1CSP A;  1XMQ L;  3I4M G;  4DR4 L;  4LF7 L;  2JE6 I;  3ULJ A;  5JEA G;  2VW9 A;  1HR0 Q;  1YHQ A;  1JJC B;  1V9P A;  1FJG Q;  4DV2 Q;  3CF5 A;  1FJG L;  3K7A H;  4A3L H;  1N36 L;  3MEF A;  1VQE A;  3K7U C;  4RMF A;  4DV1 L;  4L5S A;  3PF4 A;  1C9O A;  4LF6 Q;  2ES2 A;  2WAQ G;  3I4N H;  2ZTC A;  3GTQ H;  4L5R C;  1Q81 C;  4DV5 L;  3TRZ A;  4X64 L;  4JI1 Q;  2UUA Q;  5EAY A;  2V1C C;  3JAM i;  4KHP L;  1PH6 A;  3HFZ B;  4GN4 B;  4DUY Q;  1M90 C;  2BA1 A;  1P8L A;  3S2H H;  2CFM A;  1O7I A;  1B7Y B;  2HQL A;  4HJ9 A;  1XNR L;  4LUO A;  1SR3 A;  1YNX A;  2F4V Q;  3TQY A;  3AQQ A;  4DNI A;  4BBS H;  1L2F A;  1PYS B;  2R6G A;  4DR1 L;  1GM5 A;  4AYB E;  4DKA C;  2E8G A;  3CCE A;  5IYC H;  5FLM G;  1MIU A;  1S3O A;  2MQH A;  2RCN A;  3J7A 5;  1Z9F A;  4B3T Q;  1HNW Q;  5H1S E;  3EN2 A;  3J7Z C;  4ALP A;  2B63 G;  2CCZ A;  3I4M H;  1OXV A;  3PUZ A;  2UU9 Q;  1EUJ A;  3TEH B;  4WJ3 M;  1KRT A;  1KC8 C;  2JEB I;  1YBY A;  3NEM A;  4L5Q A;  3CME A;  1IBK Q;  1C7Y A;  3DLL A;  3EIV A;  3KOJ A;  2JA6 G;  1Q82 C;  4MZ9 A;  4JI6 L;  5K36 G;  4A3D G;  4JYA L;  1UE7 A;  1K0R A;  2E2I H;  3HOW H;  3GD7 A;  2HIX A;  1HZ9 A;  1MJC A;  2K52 A;  2ZJR A;  1PH7 A;  2Q2H A;  1N36 Q;  1KIX A;  4NXM L;  2R7F A;  4LFA L;  4BXX H;  1GKH A;  2N49 A;  4PZ8 A;  3H0G G;  3RNU A;  2VNU D;  4J15 A;  4LF6 L;  1I3Q H;  4XIG S;  2D0P A;  1PH2 A;  1PV4 A;  1N32 L;  1VQI A;  2PQA B;  1SE8 A;  2VZA A;  2YTX A;  3L0O A;  1G29 1;  1KHI A;  3BZK A;  3M4P A;  4YWK A;  4JBK A;  3RN5 A;  1CKN B;  2QEX A;  1I50 H;  2K4K A;  4QJF A;  4DAY B;  5C0X I;  2RHS B;  3S14 H;  1A8V A;  4K0K Q;  4L5T A;  1KAW A;  2OCE A;  2VQF Q;  1YHA A;  3KYH C;  4DV3 L;  2I5L X;  3K81 C;  4OWT B;  4HJ7 A;  3HOU H;  2N8N A;  2PNH A;  5C44 H;  3CCQ A;  4JYA Q;  5BR8 Q;  2K5H A;  1K3R A;  1B70 B;  2EIF A;  3PUW A;  3Q8D A;  4O0A A;  4X62 Q;  1VQN A;  2K5V A;  4JOI A;  1IBK L;  1QUQ A;  3I7F A;  3PIO A;  3G6E A;  3CCJ A;  4JV5 Q;  2I5H A;  2UUC Q;  2UXC Q;  3J81 i;  4X6A H;  2E2J H;  2NN6 G;  4AYB G;  4NXN Q;  1IBM L;  4R4O A;  4GNX B;  1BVS A;  4A3F H;  4DR2 Q;  1K8A C;  1S40 A;  3S17 H;  2XGT A;  3L7Z C;  4DV4 Q;  4IOC A;  4LFC Q;  2NN6 I;  4GKK Q;  2ZJQ A;  1SN8 A;  1TWA H;  5M3F G;  1IL2 A;  2UXB Q;  2OQK A;  2JA8 H;  4MNO A;  1KQS A;  4DV3 Q;  1VQG A;  3M3Y H;  1U0L A;  5FLX c;  3CD6 A;  3S1Q H;  4WJ4 A;  4A75 A;  4BY1 G;  1MKH A;  5IE8 A;  3UE0 A;  1Q7Y C;  2ATW A;  1UE6 A;  2CKZ B;  4X65 Q;  2ZM6 L;  1YIJ A;  1I6H H;  1X55 A;  1S72 A;  1EYG A;  3W5O A;  4TQU S;  4JI2 Q;  4GOP A;  1XNR Q;  2AHO B;  1D8L A;  4JI8 Q;  2JA7 H;  1TWF H;  1T9H A;  4DV7 Q;  3T1Y L;  4YCU A;  5LMN L;  3STB C;  2ID0 A;  2YTV A;  4UPA A;  3H3V I;  1BBU A;  3ULP A;  2VUM G;  1VQP A;  2Y0S G;  1E24 A;  2JA5 H;  3PUX A;  4GLA C;  4YCV A;  4HID A;  4IJL A;  5IYD H;  4IFD I;  3RR5 A;  4JI7 L;  4A76 A;  3E9H A;  1WFQ A;  1HNX L;  4P73 A;  5FJ8 H;  3A74 A;  3ERS X;  3H0G H;  4OWW B;  1I5F A;  4DK3 C;  1N33 Q;  3HOV H;  1X3G A;  1FGU A;  3I56 A;  1LYL A;  2HIV A;  3F8T A;  4B3T L;  2JA8 G;  3NEL A;  4B3R Q;  4B3M L;  3L2P A;  3K8A A;  4DV7 L;  4LUV A;  4B3M Q;  4C3H H;  1XMO Q;  1HNZ L;  3GTK H;  3U58 A;  3PUY A;  1Q12 A;  1EIY B;  1UE5 A;  2RF4 A;  5C4X H;  2QA4 A;  1Y1W G;  4OWX B;  1YJN A;  3J81 c;  2NZH A;  4A3K H;  5E7N A;  4JI3 Q;  2JA6 H;  1XMQ Q;  4DR4 Q;  4HIK A;  4QL5 A;  3SGI A;  1EQQ A;  2BH2 A;  4Y52 H;  1HH2 P;  1N32 Q;  1QUQ B;  2R7Z H;  2LXJ A;  4JI7 Q;  1TWH H;  5C0X G;  1VQ4 A;  2FXQ A;  2KEN A;  2WP8 J;  4FDB A;  1E7Z A;  4OX9 L;  1Y1W H;  3TS0 A;  3ICE A;  1VQ9 A;  5C4X G;  1E3P A;  2UUB Q;  2WB1 G;  4JI1 L;  5IY0 A;  2UUA L;  1K8G A;  1TXY A;  4DR5 L;  4IOA A;  1Y14 B;  5M3F H;  3HKS A;  1AE3 A;  4DR5 Q;  3A5U A;  3PO3 H;  3CW2 C;  1J5E Q;  3OTO L;  4C2M H;  2RHQ B;  4QGU A;  2BH8 A;  2K14 A;  5IYD G;  2HT1 A;  1XMO L;  1HNZ Q;  5JJK A;  4LF5 Q;  3UE1 A;  1L1O A;  1X3E A;  1PH5 A;  4JI3 L;  5LMN W;  1U5K A;  3UDG A;  1Q86 C;  4JBM A;  4OON A;  1E1O A;  1I94 L;  3GTP H;  4A3D H;  2F52 A;  1VQ8 A;  3CPF A;  2JA5 G;  4A3G G;  3M85 A;  4DR2 L;  2VUM H;  3PF5 A;  4UP8 A;  4JI4 L;  4BA1 I;  1E1T A;  3CMA A;  2K5N A;  3T1H L;  4YHH Q;  2A8V A;  4UP7 A;  4GLX A;  2YU9 H;  3BZC A;  3CQZ H;  3J80 i;  4PG3 A;  2JA7 G;  4LFB Q;  3B6Y A;  4JC0 A;  1VQO A;  2UU9 L;  1VQF A;  3CP0 A;  3CCM A;  1K83 H;  2LXK A;  1TWG H;  4KHZ A;  3PO2 G;  2ZTE A;  3LGJ A;  4A3J G;  4TVA B;  3J81 j;  1I94 Q;  1NJI C;  3ER0 A;  4DUZ L;  4DV2 L;  1CKM A;  2E2H H;  3HOV G;  1GO3 E;  1X6O A;  1Q46 A;  1UEB A;  1PH4 A;  4LF5 L;  1BKB A;  1VQJ A;  5IP7 G;  3VDY A;  2KBN A;  3JC6 6;  2H5X A;  4APV A;  4R4T A;  2R92 G;  1YVC A;  3CCR A;  3DM3 A;  1PH3 A;  4GNX C;  3HOX H;  3M4Q A;  4LUZ A;  3J80 c;  1OXU A;  4GLV B;  1L1O B;  1HZB A;  3JAM c;  3RZO H;  2ZJP A;  1VQD A;  1HNX Q;  4POF A;  1J5E L;  4B3S L;  2UXB L;  2YTY A;  3AFP A;  4MTN A;  4AH6 A;  3CC7 A;  2E5L Q;  4R4C A;  1KD1 C;  1VQH A;  3BU2 A;  4KHP Q;  3A0J A;  3AFQ A;  4ME3 A;  3GTJ H;  2WAQ E;  5JJL A;  5AJ3 Q;  1WCM H;  3OYY A;  1PYB A;  4EQ5 A;  4BA2 I;  1CKO A;  5GRO A;  2UUC L;  5IP9 G;  1AH9 A;  3I55 A;  3K80 C;  5IYB H;  1L1O C;  1A0I A;  3FKI H;  5IP7 H;  4HJA A;  3GO5 A;  2D0O A;  4POG A;  4A3B G;  2CWA A;  4JV5 L;  1JE5 A;  3PCO B;  1HZA A;  2UUB L;  3F2B A;  2B29 A;  1X56 A;  3E0E A;  1KL9 A;  4DR1 Q;  2XTI A;  3KFU A;  4HJ8 A;  4P74 A;  5JEA J;  4B3S Q;  3PO3 G;  4DV0 L;  2AWO A;  4AIM A;  5C0X J;  3U4Z A;  3HOW G;  1YZ6 A;  2PI2 A;  2CWP A;  1LTL A;  2DUD A;  1CKN A;  3G4S A;  4R1J A;  4GKJ Q;  2WB1 E;  5IWA L;  4PMW A;  2MNA A;  4C3J H;  4DUY L;  4DR6 Q;  4B3R L;  2IY5 B;  1E22 A;  3F2C A;  4R4Q A;  4JI5 L;  3UDI A;  1VQ7 A;  3PSI A;  4A3E H;  3PUV A;  3HOU G;  5GAE C;  3OW2 A;  3UDX A;  1IYJ B;  3I2Z A;  4UP9 A;  5LMU Q;  1X9N A;  2ASB A;  2YV5 A;  1XPO A;  2VY3 A;  3S15 H;  2MO1 A;  1Y1V H;  2VS1 A;  1N8R C;  5C3E H;  4OO1 I;  1SFO H;  4P75 A;  5M5X H;  1HNW L;  5IYB G;  4DR7 L;  3KDF A;  5IWA Q;  4DR6 L;  2D62 A;  2VQF L;  1V43 A;  1X54 A;  4GN3 B;  4DR7 Q;  4X65 L;  3RLN A;  4GOP B;  2Q2T A;  1QZG A;  1HR0 L;  1KXL A;  4YWL A;  4JI0 L;  1Z47 A;  4DAM A;  1XJV A;  2PMZ E;  1PH1 A;  2ALY B;  5DLQ E;  4AQY Q;  3KF8 B;  4NB3 A;  1B8A A;  2WFW A;  3RLF A;  4KI0 A;  3U4V A;  1HR0 W;  1IBM Q;  2B3G A;  2F4V L;  4NXM Q;  2AWN A;  2GVA A;  4LF9 L;  2R92 H;  2B63 H;  3RLO A;  5GAH C;  4BY1 H;  3HOX G;  4BBR H;  1J6Q A;  3GTL H;  4A3C G;  2Z0S A;  4GNX A;  4GOP C;  1NMF A;  2OWO A;  4HIO A;  1DGS A;  4YHH L;  1AE2 A;  4H02 A;  1HZC A;  4A3I H;  2R93 G;  3PV0 A;  4DV6 Q;  1JB7 A;  1OXS C;  3EBE A;  1N9W A;  3FP9 A;  4JI4 Q;  1WOC A;  1VCI A;  4A3F G;  1ASZ A;  1Q1E A;  4X64 Q;  1NE3 A;  4R4I A;  5GQO A;  3KJP A;  1EIF A;  3CCS A;  4A3J H;  1EOV A;  4LWC A;  5IT9 c;  4P72 A;  3CPW A;  4A4I A;  4LF8 Q;  3CXC A;  4BY7 H;  4XTC S;  1XPR A;  1JJG A;  1EQR A;  1BBW A;  2AKW B;  4OXP A;  4DR3 Q;  1L0W A;  3CAM A;  2VQE Q;  2IT1 A;  4JOI C;  1CUK A;  1IXR A;  1XNQ L;  1JMC A;  3ZJY C;  4DUZ Q;  2KHI A;  2OTL A;  3CCL A;  1VQB A;  1WCM G;  4LF7 Q;  2BA0 A;  4A3G H;  1H95 A;  2R7D A;  4HIM A;  4LFA Q;  4GKK L;  1YI2 A;  1R9T H;  4DPG A;  4IPC A;  3S2D H;  2JA9 A;  5JJI A;  1WI5 A;  5M3M H;  2IX1 A;  3D0F A;  4LFC L;  4JCV E;  5ELN A;  5M5Y H;  3W1G A;  1W3S A;  1CSQ A;  4GS3 A;  1VQC A;  2GN5 A;  4IPG A;  3S24 A;  2QGQ A;  3HKZ E;  4DV5 Q;  2Q2I A;  3M9B A;  4YY3 L;  1GVP A;  1KRS A;  1VQA A;  3PIP A;  1PVO A;  1D7Q A;  1OTC A;  1OXT A;  2OQ0 A;  1X65 A;  2NZO A;  4JBJ A;  3KJO A;  5C3E G;  4LF4 Q;  1UE1 A;  4BY7 G;  3M4O H;  3KDF B;  2IX0 A;  3KLW A;  2K75 A;  4QIW E;  4JI8 L;  1IBL L;  1VQL A;  1Q1B A;  3HOY H;  3M7N A;  4UY8 C;  2KCT A;  2Z6K A;  2JJQ A;  5LMN Q;  4DV1 Q;  2NVX H;  1XNQ Q;  3TS2 A;  1SRO A;  3PO2 H;  3I4N G;  2UXD Q;  4X66 L;  1VQ5 A;  1OXX K;  2I5M X;  3AYH B;  4A3E G;  2IHF A;  5M5W H;  4OO1 G;  2JK8 A;  4A3I G;  1K73 C;  2R93 H;  4X66 Q;  3BJU A;  1EFW A;  5C4J H;  2ZTD A;  2KCM A;  2AMC B;  4IPD A;  3S1R H;  1HJP A;  4A3L G;  5IYC G;  4LF4 L;  2JQO A;  3FHW A;  2DGY A;  1YIT A;  3H3V H;  4DV6 L;  1YJW A;  1N33 L;  4IFD J;  4JI6 Q;  5FLM H;  3NEN A;  3U50 C;  4IO9 A;  4HJ5 A;  1V1Q A;  1WJJ A;  2JEA I;  4A93 H;  5ELO A;  4GN5 A;  4JI5 Q;  5BR8 L;  1YJ9 A;  4BBS G;  2UXC L;  1QZH A;  4LW1 A;  2HHH Q;  4LF9 Q;  4P71 A;  5HGQ A;  3T1Y Q;  4C3I H;  2Y0S E;  1JJ2 A;  1N34 L;  1IZ6 A;  2KHJ A;  2A1A A;  1PFS A;  3HOZ G;  1VS0 A;  3S16 H;  3FKI G;  5FJ8 G;  4BXX G;  1YEZ A;  2UXD L;  2L15 A;  3CC4 A;  4DV0 Q;  4RG1 A;  2N78 A;  4KLK A;  4Y7N H;  3AEV A;  3W1B A;  4NPS A;  1NBW A;  4PZ7 A;  1FVI A;  2A19 A;  3KF6 B;  3CCV A;  3F1Z A;  4A93 G;  4A3M G;  1XPU A;  2VQE L;  1QVG A;  4LNQ A;  1SRU A;  4QY7 A;  2YYZ A;  2R7Z G;  1NY4 A;  3K0X A;  1SMX A;  2F3I A;  4YY3 Q;  3F2D A;  1VQM A;  2NVQ H;  1QVF A;  3G48 A;  5J3B A;  3STB D;  1PA6 A;  1PH8 A;  1XTD A;  1N34 Q;  5AJ3 L;  1M1K C;  4JG2 A;  4NXN L;  2PI2 E;  4IPH A;  4A3M H;  3GTG H;  2Z6K C;  1RIP A;  5GAG C;  3CCU A;  3RN2 A;  3GTM H;  4A3K G;  3HOY G;  1ASY A;  3GTO H;  4A3C H;  4QQB X;  1C0A A;  1A63 A;  2PQA A;  3GDE A;  3H15 A;  4OX9 Q;  3T1H Q;  2EXD A;  4JBW A;  3A5Z B;  2I0Q A;  1WYD A;  2E5L L;  2CQO A;  3S1M H;  1TWC H;  3I4O A;  3D31 A;  3ULL A;  5IP9 H;  4BBR G;  2NVT H;  4DR3 L;  1G51 A;  1YHB A;  3WWV A;  1Y1V G;  3G71 A;  4PZ6 A;  3S1N H;  4A3B H;  3TRE A;  1W2B A;  2ZM6 Q;  4LF8 L;  1FL0 A;  3NBH B;  1Q8K A;  4O2D A;  3OTO Q;  1PHJ A;  1IBL Q;  2MFI A;  2IHE A;  1UWV A;  5C44 G;  3KF6 A;  2N3S A;  3CC2 A;  5M3M G;  2LSS A;  4YCW A;  4YWM A;  1PH9 A;  1MJE A;  2HHH L;  4DK6 C;  5GAD C;  1P16 A;  4DV4 L;  3UDF A;  1G6P A;  2K50 A;  1EWI A;  1VQ6 A;  1GD7 A;  3MXN B;  1LUZ A;  5LMU L;  3HOZ H;  2MO0 A;  3RZD H;  1A62 A;  3IRB A;  3PGZ A;  1X3F A;  4LFB L;  5HY6 A;  2Q2U A;  2OTJ A;  4IFD G;  4GKJ L;  1JT8 A;  2VL6 A;  4K0K L;  1VQK A;  2EQS A;  4X62 L;  4EX5 A;  1K9M C;  1NMG A;  2GVB A;  3E9I A;  4JI0 Q;  2NVY H;  3HKZ G;  1LM0 A; 
#chains in the Genus database with same CATH topology
 2KCN A;  5T1I A;  5EPL A;  4JI2 L;  1NTG A;  1CSP A;  2JP1 A;  4DR4 L;  2JE6 I;  3ULJ A;  4K5W A;  3CF5 A;  3Q23 A;  3VA5 A;  3K7A H;  4A3L H;  3HOX B;  4QF4 A;  1VQE A;  3QIA A;  4RMF A;  5CV6 A;  4DV1 L;  2EVB A;  2ZTC A;  4DAP A;  3BDO A;  1D6E C;  1D2B A;  3HFZ B;  2B2W A;  1SNP A;  2A6E C;  5L37 A;  2CFM A;  1O7L A;  1AZP A;  4RHS A;  1V1P A;  1EZ8 A;  1YNX A;  4KKT A;  2F4V Q;  1JC7 A;  3DHQ A;  1BCP D;  3TQY A;  5NUC A;  3AQQ A;  4BBS H;  1L2F A;  1RCV D;  4DKA C;  1KAB A;  2E8G A;  1K8M A;  2K05 A;  1HA6 A;  2B2V C;  2MQH A;  3I91 A;  2LY7 A;  1NSN S;  4FVM A;  4CDE C;  1DCZ A;  5H1S E;  2MGS A;  4ALP A;  2B63 G;  1KRT A;  1I50 B;  2Z4I A;  3LWE A;  3WOE A;  1C7Y A;  1HUN A;  2NWG A;  3KOJ A;  3J7A V;  5K36 G;  4A3D G;  2ZJR A;  1KIX A;  3M3Y B;  5FK9 C;  2N49 A;  3RNU A;  4O1N A;  1AFP A;  4XIG S;  2D0P A;  1PV4 A;  1F9Q A;  3HP3 A;  3A8I E;  1VQI A;  2PQA B;  2YTX A;  2EY6 A;  4LAA A;  4IUV A;  1KHI A;  3BZK A;  3K58 A;  1UNS A;  2D5D A;  3NTH A;  5C0X I;  1JWM D;  2NBF A;  4L5T A;  3D6C A;  1YHA A;  2I5L X;  4GZY C;  5BR8 Q;  1B70 B;  1VQN A;  1GUO A;  1YNJ D;  2R93 B;  3TBI B;  2B63 B;  3CCJ A;  1AW7 A;  2HUG A;  2NN6 G;  5E4X A;  1IBM L;  1X3Q A;  4A3F H;  1S40 A;  4DV4 Q;  2RKS A;  5M3F G;  1IL2 A;  3FEW X;  1FD7 D;  3HZX A;  2OQK A;  3TP7 A;  2JA8 H;  3M3Y H;  5K36 H;  5FLX E;  1VQG A;  3CD6 A;  4DA2 A;  3S1Q H;  4WJ4 A;  4QUF A;  3H3V C;  3D4W A;  1PTO B;  1X55 A;  1S72 A;  2WB1 B;  1EYG A;  4GOP A;  4XT1 B;  2AHO B;  1D8L A;  2Z9H A;  3TZD A;  2OEO A;  1HPC A;  4JVZ A;  4KN4 C;  1CTM A;  1T9H A;  2F0N A;  3HGB A;  1TU2 B;  2ID0 A;  2AQ1 B;  1DON A;  3ULP A;  2VUM G;  2YU9 B;  1TT2 A;  1PRT F;  2BCO A;  1QNU A;  4HR7 B;  2O2L D;  3PUX A;  4YCV A;  4HID A;  4IFD I;  2NZ1 D;  3RR5 A;  2H1E A;  4X3T A;  1WFQ A;  5FJ8 H;  3A74 A;  3ERS X;  1I5F A;  5I4D A;  1L0Y B;  3I56 A;  1A3T A;  3F8T A;  2JA8 G;  4B3R Q;  2EYF A;  4J8Q A;  4DV7 L;  1MSG A;  3JAM L;  3U58 A;  2RF4 A;  2QA4 A;  1L0X B;  4OWX B;  3J81 c;  2EY2 A;  4N8X 1;  4Y52 H;  2FMC A;  3IKJ A;  4JI7 Q;  2WV6 D;  2KEN A;  3S1N B;  2JA7 B;  1SEB D;  1Y1W H;  5C4H A;  2WB1 G;  1D5Z C;  2F0F A;  4JI1 L;  4IOA A;  1Y14 B;  3PO3 H;  2VUM B;  1XWE A;  4QGU A;  1EWC A;  2K14 A;  5DAU A;  2K7V A;  2JA8 B;  3UE1 A;  1BUV T;  3TZU A;  3UDG A;  1E1O A;  4A3D H;  4JK1 C;  2VUM H;  1H9S A;  4BA1 I;  3J7Y W;  4C56 C;  2B2U A;  2YU9 H;  4GLX A;  3BZC A;  3M7G A;  3J80 i;  2JA7 G;  4LFB Q;  1LT6 D;  4JC0 A;  1RJT A;  2UU9 L;  3V2T A;  3CCM A;  2LXK A;  1I3Q B;  1PTO H;  1PTO C;  1TWG H;  4KHZ A;  3VR6 A;  4WRD A;  3VR4 A;  1SE4 A;  3ER0 A;  4LJZ C;  4DV2 L;  2E2H H;  2L12 A;  3HOV G;  1X6O A;  3QG1 A;  1VQJ A;  3JC6 6;  2H5X A;  4APV A;  4R4T A;  1YVC A;  3CCR A;  3DM3 A;  1SBB B;  3M4Q A;  4GLV B;  1HZB A;  2JN4 A;  4B3S L;  3CC7 A;  2E5L Q;  4R4C A;  1QWY A;  5EKL A;  4BY1 B;  2B8G A;  3EQL C;  1CM9 A;  5DEH A;  1LTB D;  2WAQ E;  1LAC A;  1LAB A;  1WCM H;  4KY6 A;  5FO9 B;  2K28 A;  1C48 A;  1L1O C;  2D0O A;  1JE5 A;  1WTX A;  1CHP D;  1HZA A;  2UUB L;  4K8J A;  2F0K A;  1AEX A;  3U9S A;  2DNC A;  1NAP A;  3CU7 A;  3WOF A;  4B3S Q;  3HOW G;  1SE2 A;  1YZ6 A;  2LFN A;  4KJN A;  4CKC A;  3HKZ B;  3PQI A;  1ET6 A;  2WB1 E;  2B2V A;  5IWA L;  4DUY L;  2IY5 B;  5C0X H;  4RA8 A;  3RZO B;  4JI5 L;  1TWC B;  3PUV A;  4BS9 A;  4HCE A;  1B53 A;  2ASB A;  2YV5 A;  1XPO A;  2VY3 A;  2MO1 A;  3EFX D;  4K6D A;  1ZEQ X;  4FNF A;  4ULL A;  2KHS A;  4OO1 I;  5M5X H;  2KVM A;  4HCS A;  3MZ5 A;  3KDF A;  1EQV A;  3PIP 3;  1QJO A;  4I7Z C;  4DR7 Q;  4IAL A;  1HR0 L;  4JI0 L;  2Z1C A;  1JE4 A;  5COY A;  3DEO A;  4NB3 A;  5DLQ E;  4AQY Q;  1SNQ A;  2WFW A;  4KI0 A;  5M5Y B;  1IBM Q;  1Y1V B;  4WOR A;  2A69 C;  5GAH C;  4BY1 H;  2Z4H A;  3H94 A;  1J6Q A;  5I9P A;  4GNX A;  1NMF A;  2OWO A;  4HIO A;  1ML0 D;  4G7O C;  4A3I H;  1JIC A;  3NTK A;  1JB7 A;  1OXS C;  1WOC A;  1E0B A;  1VCI A;  4R4I A;  4A3C G;  3CCS A;  1EIF A;  4LF8 Q;  3P20 A;  4CJ0 B;  5DM6 3;  4JOI C;  2EZV A;  3VA7 A;  1JMC A;  2OTL A;  4IUR A;  5M3F B;  1QG7 A;  3NUC A;  4DPG A;  1GUG A;  5JJI A;  2JSO A;  2IX1 A;  4LFC L;  1YNN C;  4DFA A;  4EGV A;  3NP8 A;  1VQC A;  4DGZ A;  2AQ3 B;  1F9S A;  1XX8 A;  3NQI A;  1S5D D;  3M9B A;  2L1B A;  1C8C A;  4YY3 L;  1PVO A;  1OTC A;  1OXT A;  2OQ0 A;  1EYD A;  1M8A A;  3KDF B;  2IX0 A;  3KLW A;  5KGU A;  5AFW A;  1VQL A;  1VMC A;  3HOY H;  3I90 A;  1SFO B;  2SNM A;  2Z6K A;  3O13 A;  4UY8 C;  3TS2 A;  3I4N G;  2CVR A;  4X66 L;  1OXX K;  2IHF A;  5M5W H;  4ILW A;  2R93 H;  3GV3 A;  5JPN C;  1FYC A;  4E6I A;  4KTA A;  2AMC B;  2VB2 X;  4G57 A;  4KKU A;  3R93 A;  2DGY A;  1TWF B;  1QNK A;  4DV6 L;  4JI6 Q;  5FLM H;  3NEN A;  3U50 C;  4Q5V A;  1W6J A;  4HJ5 A;  4IUU A;  2MPM A;  2L9H A;  5ELO A;  4GN5 A;  4JI5 Q;  2F1M A;  2Y0S B;  4LF9 Q;  3W2D A;  4C3I H;  2Y0S E;  4U68 A;  1IZ6 A;  2QW7 A;  3HOW B;  4H0L C;  3HOZ G;  2EJM A;  2CH4 W;  5T1G A;  1TY2 A;  5FJ8 G;  4BXX G;  3ND8 A;  2TMP A;  1ZKO A;  1A2T A;  4L63 B;  2UXD L;  1DOM A;  2EE1 A;  4RG1 A;  1LTS D;  2N78 A;  4RCO A;  4Y7N H;  4K5X A;  4CJ2 C;  3TP5 A;  1EU3 A;  2VXW A;  4PZ7 A;  3W1B A;  3ERQ A;  1FVI A;  3KF6 B;  4A93 G;  5C4X B;  2VQE L;  5BN3 A;  1I4Q A;  2YYZ A;  2F3I A;  3I4N B;  2XWJ B;  3CQZ B;  5J3B A;  1PA6 A;  2M00 A;  4RAU C;  2PYK A;  1N34 Q;  2DJG C;  1M1K C;  4A3M H;  4IPH A;  1WTW A;  4A3C H;  3HEJ A;  4RGN A;  2PQA A;  3D4R A;  3H15 A;  4JBW A;  1BNZ A;  2I0Q A;  1WYD A;  3MWY W;  3BDC A;  2MP1 A;  3D31 A;  3FKI B;  4G7Z C;  1NR4 A;  3CHB D;  2NVT H;  1G51 A;  3U9O A;  3WWV A;  1Y1V G;  3S1N H;  4A3B H;  4DU9 A;  1Q8K A;  2MFI A;  1BO0 A;  3GP7 A;  1MJE A;  3HS0 C;  2DNE A;  1WCM B;  1VQ6 A;  1PFB A;  3MXN B;  4A3J B;  2KED A;  4ZKC B;  3PGZ A;  4CJ1 B;  5KIX A;  1XXG A;  3GTG B;  3FMC A;  2OTJ A;  4IFD G;  3TP6 A;  2VL6 A;  2EQS A;  4X62 L;  4EX5 A;  5LHY 1;  1K9M C;  2GVB A;  1S5B D;  4O42 A;  1LM0 A;  1ET9 A;  2C35 B;  4IJH A;  2XVS A;  1SLJ A;  3DXJ C;  4AQY L;  3OWE B;  3D8G A;  1HR0 Q;  3QOL A;  1V9P A;  2SNS A;  1I4X A;  5EGT A;  4C3H B;  1H9S B;  3K7U C;  1DOK A;  1SNM A;  1BCP C;  1STA A;  4L5S A;  1C9O A;  1ZYR D;  2WAQ G;  1Q81 C;  3BDL A;  4ZQ3 A;  1TWH B;  2R3Z A;  2CW0 D;  4JI1 Q;  4X64 L;  1QOH A;  2V1C C;  3T53 B;  1SNC A;  1M90 C;  3S2H H;  1O7I A;  1B7Y B;  5IT9 E;  3K5L A;  1Z7T A;  1SXT A;  3Q6S A;  1XNR L;  4LUO A;  2O4X A;  1SR3 A;  2EYJ A;  1SNO A;  3Q24 A;  1PYS B;  2R6G A;  1RHP A;  4DXF A;  2NVY B;  3Q0A A;  4EVO A;  3CCE A;  4FF1 A;  2WKD A;  1MIU A;  3J7A 5;  2R92 B;  2KEE A;  4B3T Q;  1PZJ D;  1HTP A;  3J7Z C;  1WTV A;  1IYU A;  3L3O C;  3NPP A;  2JEB I;  1GXD C;  1YBY A;  2RSO A;  5I2X A;  2JA6 G;  1EIG A;  1T5E A;  4JI6 L;  3VR3 A;  1UE7 A;  3E3X A;  5CC4 A;  4NXM L;  3NK9 A;  1PH7 A;  2Q2H A;  1N36 Q;  2R7F A;  5CV7 A;  3N6R A;  1I3Q H;  4MHE A;  3L9A X;  1N32 L;  3L0O A;  1SE8 A;  3T56 B;  3RN5 A;  2QEX A;  5IGD A;  4DAY B;  1SYG A;  2M9V A;  2EJG C;  4ID6 A;  1A8V A;  2OCE A;  2VQF Q;  4IUT A;  2PNH A;  1CI3 M;  1ICW A;  3CCQ A;  4JYA Q;  1XYI A;  3PUW A;  2EIF A;  4X62 Q;  3C1F A;  4XQJ A;  1IBK L;  1QUQ A;  3NXW A;  2N88 A;  3SDZ A;  2HCC A;  4X6A H;  1EY8 A;  2B8F A;  4FF2 A;  4DR2 Q;  2XGT A;  3L7Z C;  4IOC A;  1TS5 A;  4K6L A;  1EU4 A;  2ZJQ A;  1TWA H;  1X32 A;  4V0B A;  1LT4 D;  1MSH A;  5A35 A;  4DV3 Q;  1KQS A;  2RBM A;  1IW7 D;  4A75 A;  4BY1 G;  1MKH A;  2CKZ B;  3W5O A;  1SJE D;  3N52 A;  1Y1W B;  1TWF H;  4DV7 Q;  1R4Q B;  5LMN L;  3MXG A;  3STB C;  3CRL C;  1GUW A;  3H3V I;  1BBU A;  3HRZ C;  4HN7 A;  1VQP A;  1E24 A;  5F2D A;  4PV1 C;  3K5N A;  4IJL A;  4C2M B;  4NKL A;  2BDN A;  2K32 A;  2G5D A;  4A76 A;  4P73 A;  3BVG A;  1PZK D;  4DK3 C;  1X3G A;  1DOL A;  3BG3 A;  4B3M L;  4A3F B;  4QUC A;  4B9W A;  2X69 A;  4B08 A;  4B3M Q;  1I6V C;  1XMO Q;  3HOZ B;  1YJN A;  4JI3 Q;  1XMQ Q;  4QL5 A;  3VR2 A;  1CK1 A;  1QUQ B;  1JOO A;  1TWH H;  2FXQ A;  4FDB A;  3Q22 A;  5C4X G;  1E3P A;  1S5E D;  2V4D A;  3MTS A;  1SYD A;  5M3F H;  3A5U A;  1TY0 A;  2O5J C;  3CW2 C;  1F2M A;  1FNW A;  3OTO L;  3KLS A;  2RHQ B;  2BH8 A;  1B3Q A;  1HNZ Q;  5JJK A;  3KF8 A;  3VYU A;  1L1O A;  4JI3 L;  5LMN W;  4JBM A;  4OON A;  1I94 L;  1ILP A;  2WAQ B;  2ICE C;  3G6J B;  2FIN B;  4RGO S;  1II3 A;  3M85 A;  2Z6B A;  4UP8 A;  2A74 C;  1JCK B;  1E1T A;  2K5N A;  4WJW A;  4YHH Q;  2NVX B;  3CQZ H;  4JW0 A;  2EPB A;  2D2C C;  1GHJ A;  3URY A;  4ABN A;  5ELC A;  2ZTE A;  4RKB A;  4DUZ L;  1R4P B;  2WIN B;  1UEB A;  4LF5 L;  1KDA A;  1BKB A;  3VDY A;  4HSP A;  1YNN D;  3J81 L;  5CV4 A;  1PH3 A;  3HOU B;  2JA5 B;  2BOS A;  2F4I A;  3A7L A;  1JQY D;  1OXU A;  3RZO H;  1HNX Q;  4POF A;  1J5E L;  4A3E B;  2GA4 B;  2EYL A;  3NBI A;  4MTN A;  1KD1 C;  4H7B A;  3BU2 A;  1I4R A;  3P75 A;  3GTJ H;  1RDP D;  1TS4 A;  3OYY A;  1CKO A;  3NWS A;  4LK1 C;  5IP9 G;  3I55 A;  4OEL B;  5IYB H;  1A0I A;  5IP7 H;  2PCF B;  4POG A;  2CWA A;  5C4Z A;  1U4L A;  3F2B A;  1CT1 D;  2B29 A;  1X56 A;  1KL9 A;  4PMC A;  4DNT B;  2ICI A;  3KFU A;  4P74 A;  2VB3 X;  2AWO A;  4AIM A;  1LT5 D;  3U4Z A;  1LTL A;  3C2P A;  4OL7 A;  3TME A;  2H4O A;  3GTO B;  1PTO D;  1GUS A;  4C3J H;  3OW7 A;  2J4X A;  1TKW B;  2I46 A;  3S14 B;  3HOU G;  3PSI A;  3OW2 A;  2EY5 A;  3I2Z A;  4UP9 A;  4L6T B;  5LMU Q;  1JOR A;  2ENB A;  1HHV A;  1E2W A;  3VR5 A;  1M4V A;  1SFO H;  2XNA C;  1TQO A;  1BQQ T;  5IYB G;  5IWA Q;  2D62 A;  2VQF L;  1K3B C;  1X54 A;  3RLN A;  2Q2T A;  1KXL A;  1IKM A;  4U67 3;  1PRT D;  1J8I A;  5CBE E;  1PH1 A;  5HGT A;  1B8A A;  4MTK A;  5K5P A;  2B3G A;  2F4V L;  4R9W A;  3EVQ A;  1HCZ A;  4HMJ A;  4FYD A;  2R92 H;  4LF9 L;  4Y7N B;  2B63 H;  3QR8 A;  4C1N I;  3HOX G;  4X3S A;  5CYU A;  3HG9 A;  4HMI A;  3GTL H;  3RMH A;  2Z0S A;  3GTJ B;  4YHH L;  1AE2 A;  4H02 A;  4DV6 Q;  4UHV A;  1ASZ A;  5EBC A;  4X64 Q;  2JEA I;  5GQO A;  3KJP A;  1LTT D;  3CPW A;  1JJG A;  1XPR A;  1EQR A;  2AKW B;  1NR2 A;  4RHR A;  2IT1 A;  3H09 A;  2B2T A;  1JB3 A;  5JPM C;  3H0G B;  4DUZ Q;  2KHI A;  2NUC A;  4RWS C;  2PZT A;  1WCM G;  2R7D A;  1ENA A;  4HIM A;  2F0D A;  3A55 A;  4A3I B;  3AU7 A;  1O80 A;  1BF4 A;  2LMC B;  4MN3 A;  4JCV E;  5M5Y H;  3W1G A;  1W3S A;  4F87 A;  2L11 A;  4OIK A;  4DV5 Q;  1VQA A;  2HDL A;  1D7Q A;  3KJO A;  5J1Z A;  3I72 A;  2K75 A;  1IBL L;  1Q1B A;  1J9O A;  4ZYS A;  3M7N A;  3MFY A;  2JJQ A;  4C3J B;  1V1P B;  2UXD Q;  1VQ5 A;  2ZT9 C;  2BE5 C;  3SR1 A;  2A69 D;  5CV5 A;  5KEE A;  1K73 C;  1JWS D;  3KK7 A;  5C4J H;  2ZTD A;  1GJX A;  1Y8O B;  2JQO A;  3E0J A;  3FHW A;  5ELB A;  4V19 0;  3I3C A;  1YJW A;  1EFI D;  1H9R A;  1R9T B;  3T16 A;  3FVQ A;  1WTP A;  1STN A;  2L5T A;  2PMZ B;  4I65 A;  3PIO 3;  5BR8 L;  3C3L A;  4BBS G;  1V8Q A;  2UXC L;  1NNX A;  2HCI A;  1BCP F;  1JOK A;  2WII B;  5HGQ A;  4EQO A;  5KND A;  1N34 L;  2B2Y A;  2JYO A;  1PFS A;  1VS0 A;  2X6L A;  3AB9 A;  5JAV A;  4RCN A;  5C44 B;  3R2T A;  2L15 A;  5BN5 A;  3CC4 A;  4F8M A;  4KLK A;  2WKC A;  4HTH A;  1HXY D;  3K7A B;  4QMG A;  3CCV A;  2DN8 A;  1XPU A;  1QVG A;  4LNQ A;  2JA6 B;  2AUJ D;  2OT2 A;  1SMX A;  4YY3 Q;  2F0G A;  3BVZ A;  1VQM A;  1QVF A;  3G48 A;  3STB D;  2OXP A;  1XTD A;  5AJ3 L;  2PI2 E;  2PZU A;  1F9P A;  2Z6K C;  1CHQ D;  5GAG C;  3SXH A;  3HOY G;  3BVM A;  3GTK B;  3GDE A;  3J7A F;  2SOB A;  1Q8I A;  3T4A C;  2E2H B;  2F0O A;  3A5Z B;  5D14 A;  2CQO A;  3RD4 A;  3I4O A;  4K5V A;  1ESF A;  4BBS B;  3X3M A;  4LMQ D;  4ZK9 B;  3R2I A;  4PZ6 A;  4LF8 L;  1IBL Q;  4O2D A;  2IHE A;  1A2U A;  1SMY D;  3KF6 A;  4XT3 B;  2LSS A;  3NQT A;  4YWM A;  2HHH L;  4DK6 C;  5GAD C;  2ZXO A;  1P16 A;  4DV4 L;  1STE A;  2K50 A;  3ERO A;  3VYS A;  2MUY A;  1LUZ A;  5KYL A;  3HOZ H;  4NMZ A;  3UI2 A;  2MO0 A;  1A62 A;  3IRB A;  5C3W A;  5CGK A;  1SJH D;  2HD3 A;  5HY6 A;  5C5M A;  1JT8 A;  1NMG A;  3E9I A;  4BBR B;  2NVY H;  1LTR D;  3TDQ A;  5IGB A;  1RL2 A;  1IKL A;  1QVC A;  4K2L A;  1XMQ L;  2VW9 A;  5KNB A;  4DV2 Q;  1ZXT A;  4DK0 A;  3K57 A;  1FJG L;  2XN9 C;  4CKB A;  2F3V A;  1KLU D;  4DXG A;  1N36 L;  5EPK A;  4ZRZ A;  3PF4 A;  1A3U A;  3K5M A;  2ES2 A;  3I4N H;  1GUN A;  3TRZ A;  4N9T A;  3JAM i;  5LL6 X;  4DUY Q;  2BA1 A;  4OIJ A;  3S2D B;  2A73 B;  2HQL A;  2K04 A;  1MD2 D;  3S1Q B;  1EY9 A;  1B44 D;  3S1R B;  3PMF A;  4FO2 A;  2E74 C;  5EBD A;  2EYP A;  1EYC A;  1BBX C;  2KEC A;  1Z9F A;  1SSO A;  2BDO A;  2F0I A;  3EN2 A;  3I4M H;  2K5D A;  3RUZ A;  3PUZ A;  3QOJ A;  2A68 C;  4RH6 A;  5IT9 L;  2UU9 Q;  1KC8 C;  1ICF B;  3NEM A;  4L5Q A;  3CME A;  4DN4 M;  3DLL A;  3EIV A;  4QCL A;  1RTN A;  2E2I H;  3HOW H;  1HZ9 A;  1MJC A;  2K52 A;  4HSV A;  4KK7 A;  1YNJ C;  4LFA L;  4BXX H;  4PZ8 A;  2VNU D;  1PTO F;  3S2H B;  2K01 A;  4R8N A;  2VZA A;  3E6Z X;  3BS1 A;  1GM5 A;  1FGB D;  1G29 1;  3M4P A;  2IJ0 A;  1CKN B;  2K4K A;  3OMC A;  4XQQ A;  1ZYR C;  5CBA E;  1WTO A;  3S14 H;  2RVL A;  4QB4 A;  3KYH C;  4DV3 L;  4HJ7 A;  3K81 C;  4R8I A;  3HOU H;  1GUT A;  2N8N A;  3T13 A;  2EYH A;  1LTG D;  2N55 A;  4OHJ A;  2K5H A;  1K3R A;  2B2T C;  4YIJ A;  1HRJ A;  3I7F A;  3PIO A;  3G6E A;  2I5H A;  2UUC Q;  2PW5 A;  2ZXR A;  5DNF A;  2E2J H;  1MBY A;  3NHH A;  4AYB G;  4NXN Q;  1U4R A;  5KYI A;  4R4O A;  4GNX B;  1TVX A;  4KY7 A;  4GKK Q;  4XXE A;  1KAA A;  4A3B B;  4MNO A;  3A56 A;  5IIF A;  4ME5 A;  5IE8 A;  2ATW A;  2O5I C;  2ZM6 L;  1I6H H;  1Y69 U;  4JI2 Q;  2JXM B;  2JA7 H;  4B9X A;  1DM0 B;  1WTH A;  2EDG A;  4YCU A;  1BCP B;  2B2U C;  2F0M A;  2Y0S G;  2JA5 H;  4GLA C;  1Q90 A;  2KCC A;  1NCV A;  2K33 A;  5IYD H;  3D6W A;  3FDT A;  4JI7 L;  4XYO A;  1HNX L;  3H0G H;  4OWW B;  1N33 Q;  3M4Y A;  1FGU A;  1LYL A;  4B3T L;  2EY1 A;  3G7L A;  3MHB A;  4J1M A;  3K8A A;  1ILQ A;  4C3H H;  1HNZ L;  4K2K A;  3J80 L;  1Q12 A;  4DF7 A;  1Y1W G;  1DD2 A;  1B3A A;  2NZH A;  5E7N A;  4C3J G;  4A3K H;  2JA6 H;  4HIK A;  3A7A B;  2BH2 A;  4KN7 C;  1EQQ A;  3V96 A;  1AZQ A;  1WD0 A;  2R7Z H;  4IUN A;  3ICE A;  4OX9 L;  1E7Z A;  1QIL A;  2EYO A;  3TS0 A;  1VQ9 A;  4RGM A;  1GOZ A;  2UUA L;  1K8G A;  3SE0 A;  2L0C A;  1B9N A;  3HKS A;  1EEF D;  4NDX A;  3J80 E;  4DR5 Q;  5IGC A;  3SK8 A;  1LV9 A;  2B2Y C;  1B4O A;  5IOC A;  1DJR D;  1HQR D;  5IYD G;  1XMO L;  4QIW B;  2F0S A;  3K5O A;  1U5K A;  4IUQ A;  2F52 A;  1GHK A;  3CPF A;  2JA5 G;  2QDL A;  2EOT A;  3EA6 A;  4DR2 L;  4G4K A;  3PF5 A;  3K6O A;  4M8A A;  4UP7 A;  4PG3 A;  1RTO A;  3DEP A;  5M3M B;  5A2Q L;  1VQO A;  2G9H D;  5KNC A;  1K83 H;  3I4M B;  2F3W A;  4TVA B;  1NJI C;  3SVM A;  1GO3 E;  1PH4 A;  1JWU D;  5EKK A;  2KBN A;  2NN6 H;  1U4M A;  4GNX C;  4LUZ A;  1L1O B;  3JAM c;  1VQD A;  2UXB L;  2YTY A;  2QKI C;  3AFP A;  4DK1 A;  3AFQ A;  4AYB B;  4ME3 A;  4EQ5 A;  1PYB A;  5IGG A;  5GRO A;  3S1M B;  1AH9 A;  4HJA A;  4A3B G;  4IQZ A;  4IUP A;  5EPJ A;  3RZD B;  3QJY A;  3E0E A;  5ELD A;  2XTI A;  1S5F D;  3QB3 A;  5JEA J;  3VYR A;  4HJ8 A;  3S16 B;  4DV0 L;  2PI2 A;  2ZXP A;  2CWP A;  4H44 C;  5D65 A;  4ZKB B;  3OMG A;  3M4O B;  3G4S A;  4DAV A;  4GKJ Q;  4B3R L;  4DR6 Q;  4PMW A;  2MNA A;  1PRT C;  1MHW C;  1E22 A;  3F2C A;  4R4Q A;  4A3E H;  5GAE C;  5C4J B;  4X3U A;  5FO7 B;  2IPK D;  2MJ8 A;  3OPO A;  5FKA C;  3E5S A;  3H91 A;  3TN2 A;  2Q8T A;  2LS0 1;  3FPP A;  1Y8P B;  2VS1 A;  1N8R C;  3GTP B;  2L4N A;  1RD9 D;  3OWF A;  3KLR A;  1D5X C;  2KA7 A;  1V43 A;  4GN3 B;  4ZCK A;  2B2W C;  4KMU C;  4YWL A;  1Z47 A;  4FXG C;  1G8Z D;  2NTT A;  1F9R A;  3KF8 B;  3RLF A;  1A6X A;  1HR0 W;  3U4V A;  2AWN A;  3FPU B;  5C3E B;  4BBR H;  4KD4 A;  1EL0 A;  4RGT A;  4A3G B;  1H9J A;  1HZC A;  2R93 G;  3PV0 A;  5ELE A;  2Q8I B;  1QB5 D;  3EBE A;  1K8A C;  2E2D C;  1EQT A;  2E76 C;  4LWC A;  4BY7 H;  4P72 A;  5G3L F;  3CXC A;  1A15 A;  1MGS A;  4DR3 Q;  4ZUJ A;  1L0W A;  3CAM A;  1CUK A;  1EY5 A;  2K6A A;  1SAP A;  4C1N K;  1XNQ L;  4F7X A;  3ZJY C;  1VQB A;  4LF7 Q;  1EEI D;  2G9D A;  1H95 A;  3WDN A;  4LFA Q;  1YI2 A;  4CBV A;  5C5L A;  4IPC A;  3S2D H;  1TR5 A;  5EQ0 A;  1IL8 A;  1TS2 A;  5C6A A;  5M3M H;  3D0F A;  5ELN A;  5JJZ A;  4GS3 A;  4IPG A;  3HKZ E;  3NSW A;  1GVP A;  1KRS A;  5C3E G;  3BZD B;  4BY7 G;  4JI8 L;  3NWT A;  4QIW E;  4RKL A;  2QIL A;  2C9O A;  2KCT A;  4DV1 Q;  2NVX H;  2PZW A;  1XNQ Q;  1SRO A;  1IHZ A;  3C1E A;  3PO2 H;  4Q0F A;  2I5M X;  3MC0 B;  3SK5 A;  5IGE A;  4A3I G;  1X3P A;  2RDG A;  1EFW A;  2M2L A;  4XQN A;  5LL6 S;  2KCM A;  2RSN A;  4A3L G;  1HJP A;  5IYC G;  4LF4 L;  1ESR A;  1YIT A;  3H3V H;  1N33 L;  4DNR B;  4IO9 A;  1V1Q A;  3MVV A;  5CR3 A;  3LWU A;  5E1F A;  1PZI D;  2NB0 A;  3VYT A;  1I4H A;  3TP8 A;  2SEB D;  2PNR C;  2HHH Q;  1PFM A;  4LW1 A;  1JJ2 A;  1F2Y A;  3DM1 A;  4K14 A;  2A1A A;  1HFG A;  1RF2 D;  4BY7 B;  3FKI G;  4IZ8 A;  2FJ2 A;  2EJF C;  1YEZ A;  2A6H D;  4DV0 Q;  1JR0 D;  1BDO A;  2XWB B;  2SDF A;  1NBW A;  4NPS A;  3F1Z A;  3OIQ A;  4A3M G;  5IGF A;  1PRT B;  5M5W B;  1NY4 A;  3K0X A;  3F2D A;  2R61 A;  2J0T D;  1PH8 A;  4JG2 A;  4NXN L;  3GTG H;  1RIP A;  4OO1 H;  3CCU A;  3GTM H;  2IW3 A;  5I6W A;  1ASY A;  1I6H B;  1A63 A;  5IOD A;  1PMR A;  2XSC A;  2LKV A;  2E5L L;  1TWC H;  1LTA D;  4BBR G;  1EYA A;  3G71 A;  2K5Q A;  3KBX A;  1W2B A;  1FL0 A;  3NBH B;  1PHJ A;  2B39 A;  3OTO Q;  1H9M A;  1HFN A;  1EIH A;  5G3L D;  1UWV A;  5D3I B;  1DYQ A;  2N3S A;  3CC2 A;  1JOQ A;  4YCW A;  1PH9 A;  2TSS A;  1O7Z A;  2PPB C;  1HQM C;  2AQ2 B;  3UDF A;  1G6P A;  1V1O A;  1GD7 A;  5LMU L;  4WFN 3;  1DZ1 A;  4LFB L;  3JAM E;  4K8I A;  2Q2U A;  5I6Y A;  1WD1 A;  2IL8 A;  4TSS A;  4JI0 Q;  5E3F A;  2C5C A;  5I9O A;  3I4M G;  4NW2 A;  2Q8R E;  4LF7 L;  5JEA G;  1HTL D;  1FJG Q;  3AMU A;  1YHQ A;  1JJC B;  5KRU A;  1CFM A;  3MEF A;  4LF6 Q;  1OO9 B;  3GTQ H;  4L5R C;  4DV5 L;  1QE6 A;  2UUA Q;  2KUM A;  5J22 A;  5EAY A;  1D1K A;  4KHP L;  1PH6 A;  4GN4 B;  2QF7 A;  5ISR A;  1P8L A;  4A3D B;  1SMY C;  1SYE A;  5I2Y A;  4HJ9 A;  1F2L A;  3F2U A;  4DNI A;  2NVQ B;  1G6Z A;  2A68 D;  2A6E D;  4L8J A;  4DR1 L;  4AYB E;  4H13 C;  4TRD A;  1WTQ A;  5IYC H;  5FLM G;  1S3O A;  2RCN A;  1STB A;  1SYC A;  1B1Z A;  1HNW Q;  2DJF C;  3I4L A;  1PFN A;  1PXU A;  1UEA B;  2CCZ A;  1OXV A;  1EWH A;  4WJ3 M;  1EUJ A;  3TEH B;  4S3S A;  1IBK Q;  1Q82 C;  4MZ9 A;  1BOS A;  4JYA L;  5CV9 A;  1K0R A;  3GD7 A;  2HIX A;  1GKH A;  3H0G G;  4J15 A;  4LF6 L;  1PH2 A;  4A93 B;  2F0Q A;  4JBK A;  4YWK A;  1I50 H;  4QJF A;  2RHS B;  2XRQ D;  4K0K Q;  1KAW A;  2KOL A;  3DWQ A;  4OWT B;  4FF4 A;  5C44 H;  2KJX A;  1IW7 C;  3OIP A;  3Q8D A;  1HA5 A;  4O0A A;  2K5V A;  4JOI A;  1E2Z A;  2F0V A;  4JV5 Q;  2WAC A;  3HOV B;  2UXC Q;  3J81 i;  2F03 A;  1BVS A;  1VDZ A;  1H9K A;  3S17 H;  4EQN A;  4LFC Q;  1PDQ A;  2NN6 I;  1STG A;  2RDF A;  1SN8 A;  3IFT A;  3QO2 A;  3SHL A;  1CA6 A;  3QWN A;  1ONL A;  2UXB Q;  1STH A;  1U0L A;  5FLX c;  4C3I B;  1Q7Y C;  2F0H A;  3UE0 A;  1UE6 A;  2F0T A;  1BR9 A;  2F0W A;  4X65 Q;  1YIJ A;  2MHV A;  1XNR Q;  4TQU S;  1S4Z A;  4JI8 Q;  4UDU C;  2FFK B;  2QDB A;  3T1Y L;  4UPA A;  2YTV A;  5M5X B;  3BYY B;  2CHB D;  3E9H A;  4MIU A;  4X3K A;  3HOV H;  2HIV A;  3OHX C;  2FHT A;  1ENC A;  3NEL A;  2RCF A;  3L2P A;  5FOB B;  1UAP A;  4LUV A;  3ZYY X;  3GTK H;  1SYB A;  5CV8 A;  2AUK A;  3GTL B;  3PUY A;  1EIY B;  1UE5 A;  1STY A;  5C4X H;  1KNE A;  2BE5 D;  4DR4 Q;  4N8F A;  3SGI A;  1HH2 P;  4F88 A;  2RA4 A;  3GTQ B;  1N32 Q;  2LXJ A;  1KNA A;  3SK6 A;  5C0X G;  1VQ4 A;  2WP8 J;  5HUR A;  1CA5 A;  3W3A A;  1G2T A;  1U9R A;  3MXU A;  4OGQ C;  3V05 A;  4BWG B;  2UUB Q;  5IY0 A;  2A6H C;  1TXY A;  4DR5 L;  1QCB D;  4RFB A;  1AE3 A;  3LNN A;  1AP0 A;  3CRK C;  1J5E Q;  5EKI A;  4C2M H;  1G91 A;  2XRS D;  5C3X A;  3S17 B;  3D4D A;  2HT1 A;  3IFD A;  3OSO A;  4LF5 Q;  2F0P A;  1X3E A;  1PH5 A;  1Q86 C;  3GTP H;  1VQ8 A;  1EY7 A;  5DM7 3;  3ONA B;  1K0S A;  1AN8 A;  2F0J A;  5BN4 A;  4A3G G;  2PW7 A;  3R8B A;  4JI4 L;  1Z6H A;  1BXT A;  3CMA A;  4OEM B;  3T1H L;  3HOY B;  2A8V A;  5E4W C;  2QCP X;  4KHV A;  1TWA B;  3OOC A;  3B6Y A;  1C4Q A;  2Z8L A;  1VQF A;  3CP0 A;  2RDH A;  3S15 B;  1LT3 D;  2D9U A;  3PO2 G;  1SYF A;  3LGJ A;  4A3J G;  3J81 j;  1I94 Q;  3PO3 B;  1CKM A;  3DWP A;  1Q46 A;  3KLS X;  5IP7 G;  5ELF A;  2R92 G;  2RQX A;  3H6M A;  3HOX H;  1RKN A;  3J80 c;  2ZJP A;  3I70 A;  4AH6 A;  3P1H A;  5JVG 3;  1VQH A;  4KHP Q;  3A0J A;  4XYQ A;  3FRP B;  4EQP A;  2J7Z A;  5JJL A;  5AJ3 Q;  4BA2 I;  2UUC L;  4IN3 A;  3K80 C;  3FKI H;  1LTI D;  3GO5 A;  3J81 E;  5JEA H;  4JV5 L;  3MEH A;  3PCO B;  1EZ6 A;  3DUZ A;  4C3I G;  4DR1 Q;  1VF7 A;  3PO3 G;  5C0X J;  1EY4 A;  1WTR A;  4KY5 A;  1DXM A;  1A3V A;  1S5C D;  2CH4 A;  2DUD A;  4KD3 A;  1CKN A;  3GQB A;  4R1J A;  4UAI A;  4CGY B;  2F0U A;  3NBH A;  5FLX L;  3MAQ A;  5FO8 B;  4FXD A;  4KKS A;  4CDD C;  5EJW A;  2NYZ D;  4C3H G;  3UDI A;  1VQ7 A;  3T51 B;  3UDX A;  1IYJ B;  1UUP A;  1EY0 A;  1FNV A;  3MXN A;  1X9N A;  1CQF A;  3S15 H;  1Y1V H;  5JVH 3;  4CDC C;  4PNY A;  5C3E H;  4M1U B;  2L55 A;  4P75 A;  3MXP A;  5A2Q E;  3LX0 A;  1HNW L;  4DR7 L;  4N9P A;  3I8Z A;  4DR6 L;  4G7H C;  1TS3 A;  3TSS A;  4PMB A;  1T5X D;  4X65 L;  4NP5 A;  4GOP B;  1QZG A;  1G2S A;  4DAM A;  1O7Y A;  1VF5 C;  1B9M A;  1KLG D;  2ALY B;  2PMZ E;  1XJV A;  3IAY A;  3NTI A;  4NXM Q;  1FNU A;  2GVA A;  3RLO A;  5COR A;  1Q3L A;  4GOP C;  1DGS A;  1W6K A;  2K5W A;  4JI4 Q;  1N9W A;  3FP9 A;  4A3F G;  2E2I B;  1Q1E A;  1B2T A;  1NE3 A;  4LF4 Q;  4A3J H;  4Z9C B;  4ODG A;  1D1I A;  1EOV A;  5IT9 c;  4A4I A;  4XTC S;  1PYW D;  1BBW A;  4OXP A;  2VQE Q;  1FR3 A;  1IXR A;  4HED A;  3CCL A;  4KJO A;  2BA0 A;  2A5H A;  1KDC A;  1B50 A;  4A3G H;  5J39 A;  4TKO B;  4GKK L;  1IYV A;  1R9T H;  2I07 B;  4ZLT F;  2JA9 A;  1E2V A;  2NVT B;  1WI5 A;  2HDM A;  4PQX A;  3S24 A;  1CSQ A;  3EJI A;  2GN5 A;  2QGQ A;  1K83 B;  2Q2I A;  2EYM A;  2XIW A;  2HQE A;  2K1B A;  3K0Y A;  3PIP A;  3I73 A;  1I4G A;  1X65 A;  2NZO A;  4JBJ A;  3CKI B;  4ZUI A;  1UE1 A;  2IX3 A;  1TII D;  3D3R A;  2OF1 A;  3ITP A;  4ZAI A;  3M4O H;  1LO5 D;  1CQV A;  4JPB W;  5LMN Q;  1SDF A;  1CZG A;  3A8J E;  4CDF C;  3SEB A;  3AYH B;  1D5M C;  2E75 C;  4A3E G;  2F0E A;  1XTC D;  2JK8 A;  4OO1 G;  4X66 Q;  3BJU A;  2R7Z B;  4IPD A;  3S1R H;  1HUM A;  1KDB A;  4FXK C;  4A3M B;  2E2J B;  3S9W A;  5M9O A;  3C46 A;  4IFD J;  3A8K E;  1O78 A;  2PO4 A;  1WJJ A;  2K03 A;  4A93 H;  3PO2 B;  1LLR D;  5CMD A;  1YJ9 A;  2DY7 A;  4IFD H;  1QZH A;  1K8O A;  4P71 A;  5D3D A;  3T1Y Q;  1ROD A;  2KHJ A;  2DY8 A;  1VMP A;  2FMM A;  3S16 H;  3R3O A;  2NTS A;  1SE3 A;  4P2C B;  4XDX A;  1PLF A;  2P5Z X;  2QEJ C;  3A54 A;  3ND9 A;  2EXZ A;  4CKE A;  3MFG A;  3SK4 A;  3AEV A;  2A19 A;  4CHT B;  1SRU A;  2CW0 C;  4QY7 A;  2R7Z G;  3KUP A;  2NVQ H;  1I4P A;  1EOT A;  2F0L A;  1NUC A;  2PQE A;  1EY6 A;  4I7A A;  2IWH A;  3RN2 A;  4A3K G;  1SND A;  3GTO H;  4QQB X;  1C0A A;  1Y8N B;  3P7J A;  4OX9 Q;  3T1H Q;  2X6G A;  2EXD A;  3S1M H;  1ENF A;  3BYT B;  3DWA A;  3X3N A;  3ULL A;  1KTK A;  5IP9 H;  1K28 A;  4DAY A;  4DR3 L;  1YHB A;  3KBG A;  5JOB A;  3TRE A;  4FP5 D;  2ZM6 Q;  3IL8 A;  3GTM B;  2KQ3 A;  5C44 G;  1F2Z A;  3DMU A;  4J6H A;  3NE5 B;  3MA2 B;  5M3M G;  1F77 A;  1MI2 A;  4KV6 A;  4FF3 A;  2CQA A;  1WVL A;  1EWI A;  4HAE A;  1CZW A;  3K59 A;  3RZD H;  3GV6 A;  5TSS A;  1X3F A;  4A3K B;  4GKJ L;  1U4P A;  4K0K L;  1VQK A;  1TWG B;  3HKZ G; 
#chains in the Genus database with same CATH homology
 2C35 B;  4IJH A;  1RL2 A;  4AQY L;  1SLJ A;  1QVC A;  4JI2 L;  1NTG A;  1CSP A;  1XMQ L;  3I4M G;  4DR4 L;  4LF7 L;  2JE6 I;  3ULJ A;  5JEA G;  2VW9 A;  1HR0 Q;  1YHQ A;  1JJC B;  1V9P A;  1FJG Q;  4DV2 Q;  3CF5 A;  1FJG L;  3K7A H;  4A3L H;  1N36 L;  3MEF A;  1VQE A;  3K7U C;  4RMF A;  4DV1 L;  4L5S A;  3PF4 A;  1C9O A;  4LF6 Q;  2ES2 A;  2WAQ G;  3I4N H;  2ZTC A;  3GTQ H;  4L5R C;  1Q81 C;  4DV5 L;  3TRZ A;  4X64 L;  4JI1 Q;  2UUA Q;  5EAY A;  2V1C C;  3JAM i;  4KHP L;  1PH6 A;  3HFZ B;  4GN4 B;  4DUY Q;  1M90 C;  2BA1 A;  1P8L A;  3S2H H;  2CFM A;  1O7I A;  1B7Y B;  2HQL A;  4HJ9 A;  1XNR L;  4LUO A;  1SR3 A;  1YNX A;  2F4V Q;  3TQY A;  3AQQ A;  4DNI A;  4BBS H;  1L2F A;  1PYS B;  2R6G A;  4DR1 L;  1GM5 A;  4AYB E;  4DKA C;  2E8G A;  3CCE A;  5IYC H;  5FLM G;  1MIU A;  1S3O A;  2MQH A;  2RCN A;  3J7A 5;  1Z9F A;  4B3T Q;  1HNW Q;  5H1S E;  3EN2 A;  3J7Z C;  4ALP A;  2B63 G;  2CCZ A;  3I4M H;  1OXV A;  3PUZ A;  2UU9 Q;  1EUJ A;  3TEH B;  4WJ3 M;  1KRT A;  1KC8 C;  2JEB I;  1YBY A;  3NEM A;  4L5Q A;  3CME A;  1IBK Q;  1C7Y A;  3DLL A;  3EIV A;  3KOJ A;  2JA6 G;  1Q82 C;  4MZ9 A;  4JI6 L;  5K36 G;  4A3D G;  4JYA L;  1UE7 A;  1K0R A;  2E2I H;  3HOW H;  3GD7 A;  2HIX A;  1HZ9 A;  1MJC A;  2K52 A;  2ZJR A;  1PH7 A;  2Q2H A;  1N36 Q;  1KIX A;  4NXM L;  2R7F A;  4LFA L;  4BXX H;  1GKH A;  2N49 A;  4PZ8 A;  3H0G G;  3RNU A;  2VNU D;  4J15 A;  4LF6 L;  1I3Q H;  4XIG S;  2D0P A;  1PH2 A;  1PV4 A;  1N32 L;  1VQI A;  2PQA B;  1SE8 A;  2VZA A;  2YTX A;  3L0O A;  1G29 1;  1KHI A;  3BZK A;  3M4P A;  4YWK A;  4JBK A;  3RN5 A;  1CKN B;  2QEX A;  1I50 H;  2K4K A;  4QJF A;  4DAY B;  5C0X I;  2RHS B;  3S14 H;  1A8V A;  4K0K Q;  4L5T A;  1KAW A;  2OCE A;  2VQF Q;  1YHA A;  3KYH C;  4DV3 L;  2I5L X;  3K81 C;  4OWT B;  4HJ7 A;  3HOU H;  2N8N A;  2PNH A;  5C44 H;  3CCQ A;  4JYA Q;  5BR8 Q;  2K5H A;  1K3R A;  1B70 B;  2EIF A;  3PUW A;  3Q8D A;  4O0A A;  4X62 Q;  1VQN A;  2K5V A;  4JOI A;  1IBK L;  1QUQ A;  3I7F A;  3PIO A;  3G6E A;  3CCJ A;  4JV5 Q;  2I5H A;  2UUC Q;  2UXC Q;  3J81 i;  4X6A H;  2E2J H;  2NN6 G;  4AYB G;  4NXN Q;  1IBM L;  4R4O A;  4GNX B;  1BVS A;  4A3F H;  4DR2 Q;  1K8A C;  1S40 A;  3S17 H;  2XGT A;  3L7Z C;  4DV4 Q;  4IOC A;  4LFC Q;  2NN6 I;  4GKK Q;  2ZJQ A;  1SN8 A;  1TWA H;  5M3F G;  1IL2 A;  2UXB Q;  2OQK A;  2JA8 H;  4MNO A;  1KQS A;  4DV3 Q;  1VQG A;  3M3Y H;  1U0L A;  5FLX c;  3CD6 A;  3S1Q H;  4WJ4 A;  4A75 A;  4BY1 G;  1MKH A;  5IE8 A;  3UE0 A;  1Q7Y C;  2ATW A;  1UE6 A;  2CKZ B;  4X65 Q;  2ZM6 L;  1YIJ A;  1I6H H;  1X55 A;  1S72 A;  1EYG A;  3W5O A;  4TQU S;  4JI2 Q;  4GOP A;  1XNR Q;  2AHO B;  1D8L A;  4JI8 Q;  2JA7 H;  1TWF H;  1T9H A;  4DV7 Q;  3T1Y L;  4YCU A;  5LMN L;  3STB C;  2ID0 A;  2YTV A;  4UPA A;  3H3V I;  1BBU A;  3ULP A;  2VUM G;  1VQP A;  2Y0S G;  1E24 A;  2JA5 H;  3PUX A;  4GLA C;  4YCV A;  4HID A;  4IJL A;  5IYD H;  4IFD I;  3RR5 A;  4JI7 L;  4A76 A;  3E9H A;  1WFQ A;  1HNX L;  4P73 A;  5FJ8 H;  3A74 A;  3ERS X;  3H0G H;  4OWW B;  1I5F A;  4DK3 C;  1N33 Q;  3HOV H;  1X3G A;  1FGU A;  3I56 A;  1LYL A;  2HIV A;  3F8T A;  4B3T L;  2JA8 G;  3NEL A;  4B3R Q;  4B3M L;  3L2P A;  3K8A A;  4DV7 L;  4LUV A;  4B3M Q;  4C3H H;  1XMO Q;  1HNZ L;  3GTK H;  3U58 A;  3PUY A;  1Q12 A;  1EIY B;  1UE5 A;  2RF4 A;  5C4X H;  2QA4 A;  1Y1W G;  4OWX B;  1YJN A;  3J81 c;  2NZH A;  4A3K H;  5E7N A;  4JI3 Q;  2JA6 H;  1XMQ Q;  4DR4 Q;  4HIK A;  4QL5 A;  3SGI A;  1EQQ A;  2BH2 A;  4Y52 H;  1HH2 P;  1N32 Q;  1QUQ B;  2R7Z H;  2LXJ A;  4JI7 Q;  1TWH H;  5C0X G;  1VQ4 A;  2FXQ A;  2KEN A;  2WP8 J;  4FDB A;  1E7Z A;  4OX9 L;  1Y1W H;  3TS0 A;  3ICE A;  1VQ9 A;  5C4X G;  1E3P A;  2UUB Q;  2WB1 G;  4JI1 L;  5IY0 A;  2UUA L;  1K8G A;  1TXY A;  4DR5 L;  4IOA A;  1Y14 B;  5M3F H;  3HKS A;  1AE3 A;  4DR5 Q;  3A5U A;  3PO3 H;  3CW2 C;  1J5E Q;  3OTO L;  4C2M H;  2RHQ B;  4QGU A;  2BH8 A;  2K14 A;  5IYD G;  2HT1 A;  1XMO L;  1HNZ Q;  5JJK A;  4LF5 Q;  3UE1 A;  1L1O A;  1X3E A;  1PH5 A;  4JI3 L;  5LMN W;  1U5K A;  3UDG A;  1Q86 C;  4JBM A;  4OON A;  1E1O A;  1I94 L;  3GTP H;  4A3D H;  2F52 A;  1VQ8 A;  3CPF A;  2JA5 G;  4A3G G;  3M85 A;  4DR2 L;  2VUM H;  3PF5 A;  4UP8 A;  4JI4 L;  4BA1 I;  1E1T A;  3CMA A;  2K5N A;  3T1H L;  4YHH Q;  2A8V A;  4UP7 A;  4GLX A;  2YU9 H;  3BZC A;  3CQZ H;  3J80 i;  4PG3 A;  2JA7 G;  4LFB Q;  3B6Y A;  4JC0 A;  1VQO A;  2UU9 L;  1VQF A;  3CP0 A;  3CCM A;  1K83 H;  2LXK A;  1TWG H;  4KHZ A;  3PO2 G;  2ZTE A;  3LGJ A;  4A3J G;  4TVA B;  3J81 j;  1I94 Q;  1NJI C;  3ER0 A;  4DUZ L;  4DV2 L;  1CKM A;  2E2H H;  3HOV G;  1GO3 E;  1X6O A;  1Q46 A;  1UEB A;  1PH4 A;  4LF5 L;  1BKB A;  1VQJ A;  5IP7 G;  3VDY A;  2KBN A;  3JC6 6;  2H5X A;  4APV A;  4R4T A;  2R92 G;  1YVC A;  3CCR A;  3DM3 A;  1PH3 A;  4GNX C;  3HOX H;  3M4Q A;  4LUZ A;  3J80 c;  1OXU A;  4GLV B;  1L1O B;  1HZB A;  3JAM c;  3RZO H;  2ZJP A;  1VQD A;  1HNX Q;  4POF A;  1J5E L;  4B3S L;  2UXB L;  2YTY A;  3AFP A;  4MTN A;  4AH6 A;  3CC7 A;  2E5L Q;  4R4C A;  1KD1 C;  1VQH A;  3BU2 A;  4KHP Q;  3A0J A;  3AFQ A;  4ME3 A;  3GTJ H;  2WAQ E;  5JJL A;  5AJ3 Q;  1WCM H;  3OYY A;  1PYB A;  4EQ5 A;  4BA2 I;  1CKO A;  5GRO A;  2UUC L;  5IP9 G;  1AH9 A;  3I55 A;  3K80 C;  5IYB H;  1L1O C;  1A0I A;  3FKI H;  5IP7 H;  4HJA A;  3GO5 A;  2D0O A;  4POG A;  4A3B G;  2CWA A;  4JV5 L;  1JE5 A;  3PCO B;  1HZA A;  2UUB L;  3F2B A;  2B29 A;  1X56 A;  3E0E A;  1KL9 A;  4DR1 Q;  2XTI A;  3KFU A;  4HJ8 A;  4P74 A;  5JEA J;  4B3S Q;  3PO3 G;  4DV0 L;  2AWO A;  4AIM A;  5C0X J;  3U4Z A;  3HOW G;  1YZ6 A;  2PI2 A;  2CWP A;  1LTL A;  2DUD A;  1CKN A;  3G4S A;  4R1J A;  4GKJ Q;  2WB1 E;  5IWA L;  4PMW A;  2MNA A;  4C3J H;  4DUY L;  4DR6 Q;  4B3R L;  2IY5 B;  1E22 A;  3F2C A;  4R4Q A;  4JI5 L;  3UDI A;  1VQ7 A;  3PSI A;  4A3E H;  3PUV A;  3HOU G;  5GAE C;  3OW2 A;  3UDX A;  1IYJ B;  3I2Z A;  4UP9 A;  5LMU Q;  1X9N A;  2ASB A;  2YV5 A;  1XPO A;  2VY3 A;  3S15 H;  2MO1 A;  1Y1V H;  2VS1 A;  1N8R C;  5C3E H;  4OO1 I;  1SFO H;  4P75 A;  5M5X H;  1HNW L;  5IYB G;  4DR7 L;  3KDF A;  5IWA Q;  4DR6 L;  2D62 A;  2VQF L;  1V43 A;  1X54 A;  4GN3 B;  4DR7 Q;  4X65 L;  3RLN A;  4GOP B;  2Q2T A;  1QZG A;  1HR0 L;  1KXL A;  4YWL A;  4JI0 L;  1Z47 A;  4DAM A;  1XJV A;  2PMZ E;  1PH1 A;  2ALY B;  5DLQ E;  4AQY Q;  3KF8 B;  4NB3 A;  1B8A A;  2WFW A;  3RLF A;  4KI0 A;  3U4V A;  1HR0 W;  1IBM Q;  2B3G A;  2F4V L;  4NXM Q;  2AWN A;  2GVA A;  4LF9 L;  2R92 H;  2B63 H;  3RLO A;  5GAH C;  4BY1 H;  3HOX G;  4BBR H;  1J6Q A;  3GTL H;  4A3C G;  2Z0S A;  4GNX A;  4GOP C;  1NMF A;  2OWO A;  4HIO A;  1DGS A;  4YHH L;  1AE2 A;  4H02 A;  1HZC A;  4A3I H;  2R93 G;  3PV0 A;  4DV6 Q;  1JB7 A;  1OXS C;  3EBE A;  1N9W A;  3FP9 A;  4JI4 Q;  1WOC A;  1VCI A;  4A3F G;  1ASZ A;  1Q1E A;  4X64 Q;  1NE3 A;  4R4I A;  5GQO A;  3KJP A;  1EIF A;  3CCS A;  4A3J H;  1EOV A;  4LWC A;  5IT9 c;  4P72 A;  3CPW A;  4A4I A;  4LF8 Q;  3CXC A;  4BY7 H;  4XTC S;  1XPR A;  1JJG A;  1EQR A;  1BBW A;  2AKW B;  4OXP A;  4DR3 Q;  1L0W A;  3CAM A;  2VQE Q;  2IT1 A;  4JOI C;  1CUK A;  1IXR A;  1XNQ L;  1JMC A;  3ZJY C;  4DUZ Q;  2KHI A;  2OTL A;  3CCL A;  1VQB A;  1WCM G;  4LF7 Q;  2BA0 A;  4A3G H;  1H95 A;  2R7D A;  4HIM A;  4LFA Q;  4GKK L;  1YI2 A;  1R9T H;  4DPG A;  4IPC A;  3S2D H;  2JA9 A;  5JJI A;  1WI5 A;  5M3M H;  2IX1 A;  3D0F A;  4LFC L;  4JCV E;  5ELN A;  5M5Y H;  3W1G A;  1W3S A;  1CSQ A;  4GS3 A;  1VQC A;  2GN5 A;  4IPG A;  3S24 A;  2QGQ A;  3HKZ E;  4DV5 Q;  2Q2I A;  3M9B A;  4YY3 L;  1GVP A;  1KRS A;  1VQA A;  3PIP A;  1PVO A;  1D7Q A;  1OTC A;  1OXT A;  2OQ0 A;  1X65 A;  2NZO A;  4JBJ A;  3KJO A;  5C3E G;  4LF4 Q;  1UE1 A;  4BY7 G;  3M4O H;  3KDF B;  2IX0 A;  3KLW A;  2K75 A;  4QIW E;  4JI8 L;  1IBL L;  1VQL A;  1Q1B A;  3HOY H;  3M7N A;  4UY8 C;  2KCT A;  2Z6K A;  2JJQ A;  5LMN Q;  4DV1 Q;  2NVX H;  1XNQ Q;  3TS2 A;  1SRO A;  3PO2 H;  3I4N G;  2UXD Q;  4X66 L;  1VQ5 A;  1OXX K;  2I5M X;  3AYH B;  4A3E G;  2IHF A;  5M5W H;  4OO1 G;  2JK8 A;  4A3I G;  1K73 C;  2R93 H;  4X66 Q;  3BJU A;  1EFW A;  5C4J H;  2ZTD A;  2KCM A;  2AMC B;  4IPD A;  3S1R H;  1HJP A;  4A3L G;  5IYC G;  4LF4 L;  2JQO A;  3FHW A;  2DGY A;  1YIT A;  3H3V H;  4DV6 L;  1YJW A;  1N33 L;  4IFD J;  4JI6 Q;  5FLM H;  3NEN A;  3U50 C;  4IO9 A;  4HJ5 A;  1V1Q A;  1WJJ A;  2JEA I;  4A93 H;  5ELO A;  4GN5 A;  4JI5 Q;  5BR8 L;  1YJ9 A;  4BBS G;  2UXC L;  1QZH A;  4LW1 A;  2HHH Q;  4LF9 Q;  4P71 A;  5HGQ A;  3T1Y Q;  4C3I H;  2Y0S E;  1JJ2 A;  1N34 L;  1IZ6 A;  2KHJ A;  2A1A A;  1PFS A;  3HOZ G;  1VS0 A;  3S16 H;  3FKI G;  5FJ8 G;  4BXX G;  1YEZ A;  2UXD L;  2L15 A;  3CC4 A;  4DV0 Q;  4RG1 A;  2N78 A;  4KLK A;  4Y7N H;  3AEV A;  3W1B A;  4NPS A;  1NBW A;  4PZ7 A;  1FVI A;  2A19 A;  3KF6 B;  3CCV A;  3F1Z A;  4A93 G;  4A3M G;  1XPU A;  2VQE L;  1QVG A;  4LNQ A;  1SRU A;  4QY7 A;  2YYZ A;  2R7Z G;  1NY4 A;  3K0X A;  1SMX A;  2F3I A;  4YY3 Q;  3F2D A;  1VQM A;  2NVQ H;  1QVF A;  3G48 A;  5J3B A;  3STB D;  1PA6 A;  1PH8 A;  1XTD A;  1N34 Q;  5AJ3 L;  1M1K C;  4JG2 A;  4NXN L;  2PI2 E;  4IPH A;  4A3M H;  3GTG H;  2Z6K C;  1RIP A;  5GAG C;  3CCU A;  3RN2 A;  3GTM H;  4A3K G;  3HOY G;  1ASY A;  3GTO H;  4A3C H;  4QQB X;  1C0A A;  1A63 A;  2PQA A;  3GDE A;  3H15 A;  4OX9 Q;  3T1H Q;  2EXD A;  4JBW A;  3A5Z B;  2I0Q A;  1WYD A;  2E5L L;  2CQO A;  3S1M H;  1TWC H;  3I4O A;  3D31 A;  3ULL A;  5IP9 H;  4BBR G;  2NVT H;  4DR3 L;  1G51 A;  1YHB A;  3WWV A;  1Y1V G;  3G71 A;  4PZ6 A;  3S1N H;  4A3B H;  3TRE A;  1W2B A;  2ZM6 Q;  4LF8 L;  1FL0 A;  3NBH B;  1Q8K A;  4O2D A;  3OTO Q;  1PHJ A;  1IBL Q;  2MFI A;  2IHE A;  1UWV A;  5C44 G;  3KF6 A;  2N3S A;  3CC2 A;  5M3M G;  2LSS A;  4YCW A;  4YWM A;  1PH9 A;  1MJE A;  2HHH L;  4DK6 C;  5GAD C;  1P16 A;  4DV4 L;  3UDF A;  1G6P A;  2K50 A;  1EWI A;  1VQ6 A;  1GD7 A;  3MXN B;  1LUZ A;  5LMU L;  3HOZ H;  2MO0 A;  3RZD H;  1A62 A;  3IRB A;  3PGZ A;  1X3F A;  4LFB L;  5HY6 A;  2Q2U A;  2OTJ A;  4IFD G;  4GKJ L;  1JT8 A;  2VL6 A;  4K0K L;  1VQK A;  2EQS A;  4X62 L;  4EX5 A;  1K9M C;  1NMG A;  2GVB A;  3E9I A;  4JI0 Q;  2NVY H;  3HKZ G;  1LM0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...