4DR4Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4Q00
5IP7H 3HOWG 4JI3Q 3VDYA 2VL6A 1PH6A 1XNQL 1HNZL 4DV3L 4A3BH 3GD7A 4MZ9A 1Q81C 4DR3Q 4BA1I 2WAQG 4A76A 4LF8L 2VZAA 4P75A 3S1NH 4JI3L 3J81c 3CCQA 1EFWA 2YTXA 4NB3A 2JQOA 3GTMH 3HOVH 4DV6Q 4JBMA 2H5XA 4DR3L 3CP0A 2UUAQ 2E2HH 1VQMA 3EBEA 5IP9G 1C9OA 2WFWA 1NY4A 1Q12A 1X3EA 4DV6L 3ULJA 2ALYB 4LF5Q 2UUAL 5M3MG 5GAHC 4A3DG 1XNRQ 2R92G 2JA6H 5IWAQ 3EIVA 3STBC 4DV1Q 4BBSG 1IXRA 2WP8J 4A3IG 4LF5L 3S1RH 2HHHL 2DGYA 5IT9c 1XNRL 2VNUD 3H15A 2E2JH 1VQ6A 1N32Q 2WB1E 5IWAL 4YHHQ 2UXDQ 1XPUA 5JJLA 4DR5Q 3EN2A 3CCVA 1PH4A 4JI6Q 1AH9A 1V1QA 4RG1A 4IOAA 1N32L 4YHHL 2XTIA 3S17H 1YHQA 1MIUA 1S72A 2AWNA 3AFPA 5C4JH 4PG3A 1PA6A 4JI6L 1AE3A 1TWGH 1WI5A 3KDFA 4GNXC 4R4CA 4IFDG 3PUZA 4A3JG 1R9TH 1KXLA 5IP9H 2IX0A 1O7IA 2HIVA 4IJLA 4P72A 1CKNB 3PF5A 4LF6Q 1B8AA 1VCIA 2CWPA 4H02A 4NPSA 3TEHB 3MXNB 3L2PA 1VQ4A 1XMQQ 5FLXc 5IYCG 5GROA 1IZ6A 2GVAA 4GLAC 3S15H 3KF6B 2PNHA 4LF6L 1OXXK 3G71A 3CCJA 3E0EA 1NE3A 2CWAA 1Y1VG 4DV4Q 2K5NA 1VQHA 1JT8A 1XMQL 5H1SE 1I5FA 4TVAB 4DK6C 4IPGA 1I50H 3Q8DA 3GO5A 4B3MQ 4DK3C 5HGQA 4BBSH 1HZBA 1YNXA 4DV4L 3HOXG 1VQNA 4UP9A 4IFDI 3I4NG 4KHZA 1QVGA 4JG2A 1E24A 1RIPA 1NMFA 2D62A 2R6GA 3B6YA 1GO3E 3W1BA 3AQQA 5FLMG 4DR1L 4MTNA 4POFA 2JA7G 3L0OA 4BY7G 2RHSB 4JV5Q 4YY3Q 2IHFA 3F2CA 3OTOQ 1VQ8A 2PMZE 4JI5Q 2ATWA 3D0FA 1WOCA 4JOIA 3GTPH 1UE1A 3CCUA 1KAWA 1I6HH 3BJUA 4DR2Q 4ALPA 2MQHA 3CW2C 1YZ6A 2LXKA 4YCVA 4JV5L 4YY3L 1EUJA 3OTOL 4JI5L 1NJIC 1KHIA 4AYBE 5IE8A 3CQZH 3PV0A 2NZOA 5GQOA 2JA5G 1D8LA 4LWCA 1TWCH 2RHQB 2LSSA 1E1TA 1QUQB 3G6EA 2YYZA 1I94Q 3LGJA 1WCMH 3J80c 1Y1VH 4R1JA 1XPRA 4LFCL 4O0AA 4WJ4A 4QQBX 4LUVA 4JI0Q 1SE8A 2E8GA 1I94L 3E9HA 2QEXA 1Q82C 3HOYG 3RZOH 1PYBA 4A3LG 4A93G 3HOUG 2R7ZG 2E2IH 4QIWE 4A3MH 4L5SA 1DGSA 3JAMc 3I4NH 1LM0A 2GVBA 5C44G 2IY5B 1V9PA 1G51A 4JI0L 2ES2A 2R7FA 4DAMA 2Y0SE 5C0XJ 1BBWA 4DAYB 3UDGA 2A19A 4UPAA 1Q8KA 1W2BA 1JE5A 3PO2H 2AKWB 3T1YQ 4UY8C 1K9MC 1X65A 2IHEA 1YHBA 1KRSA 1ASZA 1Q1EA 2K75A 4YWKA 3PUXA 1KRTA 2R93H 5IYDG 2I5MX 1M1KC 3G4SA 4DPGA 3T1YL 2JA5H 4L5RC 1CKNA 2WAQE 4LFAQ 1BVSA 1VQGA 4B3ML 2B63H 2VQFQ 3H0GG 1T9HA 2AMCB 3GTJH 4UP7A 3KJOA 3T1HQ 2N3SA 4XIGS 1KC8C 1BBUA 4KLKA 4HIOA 2XGTA 4DUYQ 1Q46A 5IY0A 2VS1A 3KF6A 4LFAL 4YWMA 3S16H 3RLNA 5J3BA 2VQFL 2L15A 4A93H 3T1HL 1Z9FA 2FXQA 3HOUH 5E7NA 3KJPA 3HOZH 4IPHA 4GKKQ 3CCEA 2K14A 2K50A 1VQAA 2KCTA 4DV0Q 1NTGA 2PI2E 1YJNA 1NBWA 4LUOA 1G6PA 4C3JH 4A3CG 4GKKL 3RZDH 4GOPC 4KHPQ 4A75A 1UEBA 4POGA 3K7UC 4DV0L 4JI4Q 4X65Q 5DLQE 1E22A 3TRZA 3RNUA 2QGQA 2ASBA 3GTOH 1U5KA 3UE0A 2OCEA 1YI2A 4APVA 1PH8A 2Q2UA 3M3YH 4HJ9A 4BBRH 3S2HH 4LUZA 4DUZQ 4KHPL 4DV1L 3S24A 4JI4L 4YWLA 4X65L 1G291 2JA9A 4GNXB 3HOWH 3U50C 3KFUA 2BH2A 4LW1A 4R4QA 1VQIA 2UXDL 4BY1G 3J81i 4DUZL 2OTJA 2JK8A 3M9BA 1CSQA 4DR5L 1J5EQ 2F4VQ 3CCSA 1JJGA 1QUQA 4BA2I 2KHIA 3JC66 1GKHA 1OXUA 4PZ7A 3M4OH 3ZJYC 3H3VI 1YIJA 3CCRA 3BZCA 1MKHA 3NELA 4JI2Q 1J5EL 3CXCA 3WWVA 2F4VL 4P73A 5ELNA 4GN4B 2OTLA 3FKIG 3PUVA 1IBLQ 5IYBG 4A3DH 3K7AH 5M3MH 1B70B 4GLVB 2B29A 3HKZG 1PH2A 1K8GA 5K36G 4GS3A 1EQQA 4NXNQ 3I56A 2R92H 3W5OA 3PF4A 4A3CH 1P8LA 1VS0A 2CKZB 2KCMA 2Z6KC 3J81j 3I55A 1UWVA 3KF8B 4B3SQ 1X6OA 4A3IH 1IBLL 2VUMG 3CC7A 2KENA 1CUKA 4OWTB 1PH1A 1IL2A 5FJ8G 4NXNL 2EIFA 1N34Q 2A1AA 4B3RQ 1C7YA 1XTDA 4KI0A 4C3IH 2ZTDA 1GVPA 4B3SL 4P74A 3GTKH 2KHJA 2PI2A 1IBKQ 1N34L 3PUWA 4B3RL 2RCNA 1PV4A 1SROA 1FVIA 5ELOA 1SN8A 5M5XH 4DV2Q 4BY1H 4QL5A 1IBKL 3CC4A 3PUYA 1E7ZA 3ERSX 1X54A 3AYHB 2B3GA 4PZ6A 4YCUA 1J6QA 1TWHH 2CCZA 4A3JH 1VQBA 2DUDA 1XPOA 2E5LQ 2NVTH 1EYGA 3AFQA 4DV2L 2Z0SA 2ZJQA 3BU2A 3FHWA 2UUBQ 2K5HA 2EXDA 2NZHA 4HIMA 1VQKA 1D7QA 1LTLA 1SMXA 4O2DA 4HIKA 4DR2L 1XJVA 5IYCH 1I3QH 5M5WH 2UUBL 3I4MG 3W1GA 1QZGA 4X66Q 4K0KQ 2YV5A 5JEAJ 3AEVA 3PSIA 5BR8Q 4DR7Q 2N49A 2Q2HA 5FJ8H 3CCLA 1N33Q 4EX5A 3GTGH 3TS2A 2LXJA 4HJ8A 4UP8A 1HZ9A 4K0KL 3KYHC 2HT1A 2HIXA 1IBMQ 5BR8L 3I7FA 4DR7L 3MEFA 3RLOA 3HOXH 4A3KG 1FL0A 2K52A 3TREA 1N33L 1YJ9A 3J7A5 4GKJQ 3RLFA 3DM3A 1EIFA 5FLMH 4GNXA 3A5UA 3F2DA 5IP7G 3BZKA 2AWOA 4GN3B 3KOJA 2JA7H 3CPFA 1IBML 4BY7H 1YBYA 3PIOA 3RR5A 3CAMA 1OXTA 1OXVA 4MNOA 2MO0A 4A3EG 4GKJL 1UE5A 3IRBA 1QVCA 3UDXA 4Y7NH 1HNXQ 4JI7Q 1Z47A 2VY3A 4DV7Q 4HIDA 4OWWB 4EQ5A 1A62A 1HJPA 1SRUA 4DKAC 1PH3A 3S14H 4X62Q 4OO1G 1PYSB 3M85A 2D0OA 1HNXL 4JI7L 3PIPA 4DV7L 1KD1C 2K5VA 3J80i 2K4KA 1IYJB 4QJFA 2I5LX 1YHAA 2PQAB 1X55A 1XMOQ 4X62L 1JB7A 1N8RC 4B3TQ 2JA6G 4IJHA 1UE6A 3HOYH 4A3LH 2JJQA 2UXCQ 1X9NA 4HJ7A 1LUZA 2NN6G 1LYLA 2R7ZH 4Y52H 4DUYL 4GOPB 4C2MH 4OX9Q 1XMOL 1EOVA 4DV3Q 4GN5A 4L5TA 1PH7A 5C44H 4B3TL 2JA8G 2JEAI 2I5HA 4YCWA 1VQEA 3L7ZC 3S2DH 2GN5A 2UXCL 3OW2A 3F1ZA 3PGZA 2ZM6Q 2OQKA 3CF5A 4LF4Q 1A0IA 4OX9L 2R7DA 3HKSA 3RN2A 4A3EH 1E1OA 3U4ZA 1N9WA 1C0AA 1VQ5A 4OO1I 1TWFH 5AJ3Q 2VW9A 1PFSA 3NENA 2ZM6L 4OXPA 4GLXA 4LF4L 1JMCA 1H95A 3ER0A 3PO3G 3E9IA 5GAEC 4QGUA 2UU9Q 5IYDH 1N36Q 4LF7Q 4X64Q 1SR3A 4JOIC 5AJ3L 5HY6A 5GADC 2NVYH 1MJCA 3KLWA 4OONA 1K73C 4DNIA 5LMNW 3RN5A 1SFOH 1RL2A 3GTLH 1BKBA 4WJ3M 3H0GH 1WYDA 2UU9L 1K3RA 1HZAA 2NN6I 2HHHQ 3A5ZB 4OWXB 3U58A 4X64L 4PMWA 4DV5Q 1N36L 4LF7L 2JE6I 4C3HH 5GAGC 1VQPA 2MO1A 1TXYA 1PH5A 1X3FA 1VQFA 1VQJA 1L1OB 5LMNQ 4R4TA 1S40A 1HNWQ 3CPWA 1M90C 2IX1A 4P71A 4A4IA 5LMUQ 1L2FA 3FP9A 2BA1A 3UE1A 4DV5L 4HJ5A 1S3OA 4XTCS 2JA8H 3HKZE 3CMEA 1Q1BA 1YITA 3K8AA 1VQDA 3K80C 2WB1G 5LMNL 3S1MH 1HNWL 4AQYQ 1HH2P 4AH6A 2ZJRA 3GTQH 3D31A 1L1OC 4JI2L 5LMUL 3H3VH 3I4OA 1JJCB 1WJJA 3ULLA 5EAYA 4DR6Q 3CCMA 1Y1WG 1KQSA 1GM5A 1A63A 1SLJA 2ZTCA 2ZJPA 1CKMA 4AQYL 3STBD 1EWIA 4QY7A 4DR6L 3PO3H 1VQLA 2UXBQ 4AIMA 3DLLA 4ME3A 3K81C 5M3FG 3A0JA 2RF4A 4JBJA 1PVOA 3SGIA 3ULPA 3CC2A 3G48A 1FJGQ 1QZHA 4LFBQ 2UXBL 5JJKA 1YVCA 4IOCA 4R4OA 3M7NA 4JCVE 4RMFA 1X3GA 5JEAG 4A3GG 1VQ9A 1GD7A 1YEZA 2UUCQ 1CSPA 5M5YH 1W3SA 1WCMG 1QVFA 3UDFA 2PQAA 1FJGL 4LFBL 1VQCA 4IFDJ 1V43A 1FGUA 1NMGA 3F8TA 2N78A 4PZ8A 4DR4Q 4BXXG 5C4XG 1X56A 2AHOB 4JBWA 2CQOA 4IPCA 3F2BA 4FDBA 4DR1Q 1VQ7A 2UUCL 3FKIH 5IYBH 2E5LL 1TWAH 4GOPA 4JYAQ 4A3MG 2NVXH 2A8VA 5C0XG 1HZCA 2C35B 1OTCA 4JBKA 4DR4L 3PCOB 1Y1WH 2VUMH 3OYYA 3TQYA 2HQLA 2JEBI 4JI1Q 2YTYA 2YTVA 2ID0A 4J15A 1Q7YC 4JYAL 1WFQA 3HFZB 1OXSC 3PO2G 1KL9A 2BH8A 4X66L 3NEMA 3S1QH 4A3FG 3J7ZC 4LF9Q 5C3EG 1P16A 4JI1L 3TS0A 5M3FH 2ZTEA 2R93G 2F3IA 3CD6A 2KBNA 1UE7A 3U4VA 1K8AC 2D0PA 4LF9L 4R4IA 3K0XA 4LFCQ 4AYBG 4A3BG 4A3GH 2MNAA 2B63G 3KDFB 3UDIA 3M4QA 1B7YB 1PHJA 2OWOA 3A74A 4JI8Q 4L5QA 1CKOA 1U0LA 5C0XI 1MJEA 4BXXH 5C4XH 1E3PA 4IPDA 2Q2IA 1YJWA 3HOVG 1L1OA 1HR0W 3CMAA 2IT1A 2Z6KA 1PH9A 2EQSA 4JI8L 2N8NA 3HOZG 3ICEA 2YU9H 2VQEQ 3I4MH 4NXMQ 1L0WA 3GDEA 1Q86C 1ASYA 2F52A 2NVQH 3NBHB 1VQOA 3M4PA 1K83H 1K0RA 3I2ZA 1HR0Q 2VQEL 1EIYB 2Y0SG 4LNQA 4HJAA 1A8VA 2QA4A 1KIXA 1JJ2A 4NXML 4IO9A 4X6AH 2OQ0A 1AE2A 2Q2TA 4A3FH 5JJIA 5C3EH 2BA0A 3JAMi 2V1CC 2MFIA 1XNQQ 1HNZQ 4JC0A 1EQRA 4A3KH 1HR0L 2I0QA 2CFMA 4LF8Q 4TQUS 4BBRG 1Y14B
chains in the Genus database with same CATH superfamily
3HOWG 2F3VA 4A3BH 4DR3Q 1EU3A 2WAQG 4LF8L 2EJGC 2WB1B 1KDCA 3S1NH 1EFWA 3CCQA 4ULLA 2JQOA 3GTMH 1LTRD 4M8AA 1JWMD 1IW7C 5FKAC 3RUZA 3J80E 2G9DA 4DV6L 5I6WA 4LF5Q 5GAHC 1A2UA 1XYIA 3STBC 1DOKA 4DXFA 4DV1Q 2F0UA 1H9MA 2DGYA 2NN6H 1TWCB 2VNUD 2K01A 4CKCA 2E2JH 4A3GB 2WB1E 5IWAL 2UXDQ 1XPUA 5JJLA 4DR5Q 4OEMB 2IX3A 3CCVA 1NCVA 4JI6Q 1KAAA 3MXGA 1AH9A 4YHHL 2J4XA 3AFPA 4QUFA 5IGEA 5C4JH 3C46A 1AE3A 1ICFB 2QDBA 3KDFA 4DAPA 4GNXC 1LO5D 1CZWA 2QDLA 4HEDA 1HQMC 1KXLA 2F0NA 2B2YA 3NQTA 1O78A 1VCIA 1F2LA 4A3FB 2FJ2A 3MXNB 1VQ4A 2AQ3B 4KY5A 4GLAC 4OIJA 1WTVA 2PNHA 4LF6L 3E0EA 4TVAB 2B63B 2H4OA 2ICIA 5FOBB 1GUNA 1EY4A 4DK3C 5HGQA 1YNXA 1A3UA 3DUZA 4DR1L 4B3ML 1LT3D 4JV5Q 4YY3Q 2IHFA 5J22A 2KUMA 3NK9A 1PFBA 3CCUA 1KAWA 1PRTB 1TY2A 2Q8TA 4ALPA 1YZ6A 4C3JB 3OTOL 4JI5L 3D3RA 2F3WA 3PV0A 3S1RB 2JA5G 1D8LA 1ENAA 1TWCH 4LWCA 3NE5B 1DONA 2YYZA 3QR8A 3M3YB 4BBRB 4TKOB 1STHA 2B8FA 1K8OA 4ILWA 1XPRA 4WJ4A 1LT6D 1LLRD 2C5CA 2E8GA 1I94L 1Q82C 1DXMA 3VR2A 4EGVA 1DGSA 3JAMc 2IY5B 1CT1D 5C0XJ 1BBWA 2R3ZA 3SVMA 1Q8KA 1BDOA 3R2IA 5JPNC 1JE5A 2AKWB 1K9MC 1PXUA 1IKMA 1KRSA 3ONAB 4RH6A 2R92B 3G6JB 2FINB 2HQEA 4RGOS 1KRTA 2RCFA 1SEBD 5IYDG 2N55A 1SYFA 4FP5D 2JA5H 2A68D 1CKNA 4LFAQ 1B4OA 4WORA 2B63H 3T1HQ 1BBUA 2M00A 4HIOA 4DUYQ 4J8QA 5IY0A 1QNKA 3KF6A 3D4WA 2LMCB 1Z9FA 2MUYA 3MZ5A 4NP5A 1HA5A 4OHJA 2K14A 2O5JC 3CHBD 1MGSA 1NTGA 4G7ZC 4C3JH 4KY7A 1FD7D 1CQFA 3CQZB 4DV0L 1GUWA 3RNUA 3R8BA 2ASBA 2Q2UA 3M3YH 4BBRH 1STEA 4DV1L 3S24A 3GTGB 4R4QA 3K0YA 2UXDL 3TZUA 2E75C 1JOQA 2JK8A 4DR5L 1JJGA 1NR4A 1H9SA 1AP0A 1U4LA 1E2ZA 4PZ7A 3E0JA 5CC4A 4H44C 2EXZA 2XRQD 1MKHA 5CV9A 2F4VL 3HS0C 1EIGA 1TS5A 1SMYD 2F0TA 4IUVA 5IGGA 1PH2A 4K5WA 4NXNQ 2R92H 3W5OA 1NUCA 3NP8A 3J81j 1M4VA 1UWVA 1X6OA 2VUMG 2KENA 5EKKA 1IL2A 1C7YA 3GTJB 4B3SL 3DEPA 4LAAA 2PI2A 1IBKQ 1JCKB 1N34L 2RCNA 3HOYB 4A93B 1SN8A 2HDMA 4DK0A 4B9WA 2QCPX 1B3QA 3K5MA 3HOUB 1D2BA 3ERSX 3BVGA 1J6QA 3S2DB 4DV2L 1VMPA 2K5HA 1DCZA 2EXDA 4HIMA 1VQKA 1A6XA 1TWFB 1ZKOA 1GHJA 2JXMB 4HIKA 2MHVA 3GTOB 5IYCH 1F9SA 1I3QH 4YIJA 4WFN3 3P75A 4X66Q 2YV5A 5JEAJ 2F0EA 3AEVA 1QNUA 1ZYRD 2N49A 3M7GA 3SE0A 3GTLB 3CCLA 3GTGH 4IQZA 1IYVA 1RHPA 5L37A 5BR8L 3RLOA 3NSWA 3NQIA 1N33L 2VB3X 1QILA 3T56B 3DM3A 4GNXA 3F2DA 4GN3B 4NW2A 4A3EG 4MNOA 4GKJL 3K7AB 2RVLA 4H0LC 4UAIA 1CK1A 1V1PA 3OWEB 4HIDA 4OWWB 4ZQ3A 1A62A 4DKAC 4RCNA 1RCVD 1WTHA 4X62Q 1UAPA 2B2WC 4JI7L 4DV7L 4K5XA 1KD1C 2K5VA 3J80i 5LHY1 4FNFA 3FRPB 1PRTD 1GUOA 2I5LX 3SDZA 5DM63 1XMOQ 1N8RC 4B3TQ 3V2TA 4OIKA 3HOYH 4A3LH 1DOLA 1PDQA 2JJQA 4BY1B 2UXCQ 1LYLA 4RGTA 4DUYL 2J7ZA 4GN5A 4ODGA 1HFNA 2JA8G 2I5HA 1JOKA 1JQYD 4PMBA 3S2DH 1EY0A 5IOCA 2ZM6Q 2OQKA 2EYLA 2EY1A 5KYLA 4A3EH 1E1OA 1N9WA 1C0AA 1TWFH 1HUNA 3Q22A 3VYSA 3HEJA 1JMCA 1KDBA 1G8ZD 4JOIC 5AJ3L 3KLWA 3GTLH 2I07B 3H09A 3NBIA 4WRDA 3IL8A 2FFKB 1K3RA 2HHHQ 3A5ZB 1N36L 4LF7L 2BE5C 3DM1A 1VQPA 2CW0D 5I6YA 3MFGA 1VQFA 4JPBW 1HNWQ 5LMNQ 1M90C 4P71A 3FP9A 4HJ5A 4XTCS 2JA8H 1B9MA 1Q1BA 1VQDA 4Y7NB 3S1MH 4AQYQ 2IWHA 2ZJRA 4XT1B 1I4RA 3J7YW 4C56C 3CCMA 4ZYSA 3U9SA 1SBBB 2ZJPA 1CKMA 1EWIA 3VR6A 1VQLA 4NDXA 3WDNA 3DLLA 4ME3A 3S15H 1SNOA 5M3FG 3A0JA 2RF4A 4FF1A 1FNWA 2O2LD 3J81E 5JJKA 2K03A 1YVCA 2QEJC 1VQ9A 1GD7A 1WCMG 2PQAA 1FGUA 2Z4HA 4UDUC 3L9AX 5D65A 1S5DD 4JBWA 3F2BA 4IPCA 2UUCL 5IYBH 5G3LD 1TWAH 4G7OC 3T51B 5C0XG 2C35B 4DR4L 3C2PA 2KA7A 1WD1A 1Y69U 3DXJC 2JEBI 4JI1Q 2ID0A 1WFQA 1OXSC 1LTBD 4X66L 3MXUA 3J7ZC 4LF9Q 4XQQA 2JA6B 3TS0A 1QCBD 5M3FH 2ZTEA 2KBNA 5C3WA 2TSSA 3TP7A 5I4DA 4LFCQ 3A55A 3E5SA 3KDFB 3UDIA 5E4XA 1B3AA 1PHJA 3AB9A 2BOSA 1STAA 3FVQA 5C0XI 1MJEA 3H94A 2B2TA 1JORA 2Q2IA 4KKUA 1BCPB 1SE4A 1SYCA 2EQSA 1HXYD 5C0XH 2NVQH 3M4PA 2DJGC 1HR0Q 1EIYB 1B9NA 4BS9A 1A8VA 2KCNA 2L11A 2DJFC 4DGZA 4HJAA 4IO9A 4X6AH 2Q2TA 4XT3B 4JC0A 1EQRA 1YNJC 3W2DA 2FHTA 4XQJA 5D14A 4LF8Q 3V05A 1F2MA 1VMCA 5IP7H 3VDYA 4E6IA 1Q81C 4BA1I 4A76A 5TSSA 3I72A 3T4AC 2XSCA 3V96A 3KLSX 3NXWA 4DV6Q 2EY6A 1Y1WB 2XIWA 1VQMA 4OO1H 4HN7A 1E2VA 1GUTA 2WFWA 4XDXA 1X3EA 3S1QB 5DNFA 3BVMA 2JA6H 2PYKA 5IWAQ 3EIVA 4BBSG 2HHHL 3SK8A 5CV8A 4YHHQ 3OW7A 2I46A 1SYGA 2V4DA 2EJFC 2K04A 1PH4A 1ONLA 2D9UA 5C4XB 1PMRA 4RG1A 1N32L 3RZOB 1YHQA 3P7JA 1S72A 3I70A 1LTID 4R4CA 2Z1CA 5A2QE 2E76C 5DM73 1CKNB 4LF6Q 1I4PA 2HCIA 4H02A 2B8GA 1TT2A 3L2PA 2BDNA 5GROA 1IZ6A 4FXKC 3KF6B 3DWAA 3O13A 3G71A 3TDQA 2LFNA 1NE3A 1T5EA 1JT8A 4AYBB 5H1SE 3PIO3 2EPBA 4A3BB 2F0SA 4B3MQ 3A56A 4R8NA 1SNCA 2M2LA 3ZYYX 3R2TA 3HOXG 1VQNA 3S16B 1QVGA 4JG2A 2D62A 3B6YA 3QG1A 5HGTA 3PMFA 3QOLA 4MTNA 2RQXA 3HOZB 2JA7G 3L0OA 1VQ8A 3VR3A 3OTOQ 4JI5Q 1O7ZA 1WOCA 3D0FA 4JOIA 4LK1C 3K59A 3EROA 4PV1C 1ILPA 5ELFA 3W3AA 5LL6X 2A69C 1JWUD 3TBIB 5K5PA 5T1GA 1KHIA 4AYBE 5IE8A 4J1MA 4FO2A 3F2UA 1FNVA 2NZOA 5GQOA 4KKTA 5CGKA 3Q23A 5JEAH 1D5MC 2E2JB 1H9SB 5KYIA 1I94Q 4X3TA 3LGJA 4O1NA 3HOWB 2F0DA 4LFCL 1GXDC 3RZOH 3E9HA 2WAQB 1PYBA 3A54A 1S5ED 3K58A 5C4JB 5BN3A 4L5SA 1U4RA 1CHQD 5C44G 3ERQA 2N88A 4JI0L 4DAMA 2F0VA 3WOFA 4TRDA 3QJYA 4UY8C 1PZJD 5EPLA 1X65A 2L5TA 1YHBA 3DHQA 4CBVA 1PZKD 3PUXA 4DNRB 1M1KC 2I5MX 4G57A 3G4SA 5T1IA 1JICA 4L5RC 2WAQE 1BVSA 1VQGA 4L8JA 5EKIA 4IUPA 3H3VC 3H0GG 1T9HA 4UP7A 3GTKB 2N3SA 4XIGS 1KC8C 4KLKA 4N8X1 2XGTA 2R61A 4P2CB 2VS1A 4U68A 1SNDA 4C3HG 3S16H 3RLNA 5J3BA 2VQFL 2FXQA 3HOZH 2F03A 1MSHA 1TWHB 2K50A 2NTSA 4DV0Q 2KCTA 4ABNA 2NVTB 2PI2E 3URYA 5CBEE 2PZUA 2XWBB 3TZDA 1G6PA 4FF4A 5KEEA 1LTTD 4GOPC 1UEBA 4POGA 1BCPD 5DLQE 1E22A 4KD3A 3TRZA 4RWSC 5M5WB 3UE0A 1L0XB 2F0LA 2OCEA 3J7AV 1PYWD 4C3IG 1PH8A 1BXTA 1KNAA 4LUZA 1BO0A 4YWLA 4X65L 5BN4A 4GNXB 3HOWH 3KFUA 4LW1A 1VQIA 1GUGA 4KKSA 1K28A 3J81i 4DUZL 2OTJA 5EJWA 1CI3M 1CSQA 5JPMC 2BCOA 2F4VQ 1QUQA 3TN2A 1V1PB 2QF7A 4HTHA 4FVMA 3M4OH 5M9OA 3ITPA 4FF2A 1B53A 1UUPA 1I4QA 4I7ZC 4N9PA 3CCRA 3H3VI 4P73A 4GN4B 1SNPA 2OTLA 3GP7A 4NKLA 2KEEA 3D4DA 1B70B 1SAPA 4GS3A 3I56A 1MHWC 1P8LA 2KCMA 4B3SQ 4DAYA 1IBLL 3A8KE 1CUKA 1NAPA 2JA5B 2NZ1D 4IZ8A 1N34Q 2A1AA 4C3IH 5CORA 2NUCA 3GTKH 3K5OA 1WTWA 5CV5A 4HSPA 3OSOA 3NTIA 1ESFA 3PUWA 1S4ZA 4B3RL 1SROA 3I91A 4H7BA 5DAUA 5M5XH 4DV2Q 1BUVT 1X54A 1TWHH 2NVTH 1VQBA 2E5LQ 1EYGA 3AFQA 1XTCD 2Z0SA 3NHHA 3BU2A 4X3KA 3FHWA 5KNCA 3QO2A 2SOBA 5ELDA 2Q8IB 4F88A 1D7QA 3CKIB 1F2YA 3MFYA 5M5WH 3NWSA 1QZGA 3U9OA 5JOBA 4TSSA 3PSIA 5BR8Q 1HTLD 2Q2HA 1N33Q 4KV6A 4HJ8A 4UP8A 3KYHC 2PCFB 2HIXA 4DR7L 1OO9B 3I7FA 1PTOF 1O80A 3FEWX 4GKJQ 3RLFA 5I9PA 3A5UA 1ICWA 2PZTA 2RSOA 3CPFA 5NUCA 1VF5C 4JK1C 3CAMA 2G9HD 2MO0A 3C1FA 4ZLTF 1EQVA 1QVCA 3UDXA 1TIID 3GTQB 4JI7Q 2VY3A 4DV7Q 1D1IA 4EQ5A 1FYCA 3GV6A 3M85A 2K4KA 1IYJB 2PQAB 2ZXPA 1X55A 2F0MA 2IL8A 4IJHA 2XVSA 2HDLA 1I4HA 2KEDA 2EE1A 1X9NA 4HJ7A 4Y52H 2X6LA 1CZGA 3IFDA 4L5TA 1AZQA 4HMIA 2JEAI 1A3VA 1DOMA 1I4XA 3F1ZA 3PGZA 2F0WA 5IGCA 1A0IA 4OX9L 1LTAD 3HKSA 1BNZA 4FF3A 1EOTA 1S5CD 2B2VC 4IN3A 3JAML 5AJ3Q 4C1NK 4GLXA 2NVXB 1I3QB 3ER0A 4B08A 3N6RA 1EEID 4QGUA 5IYDH 1WTPA 1EY5A 1A3TA 1N36Q 4LF7Q 2VUMB 1FR3A 1SR3A 4X3SA 1MJCA 2DY8A 1BKBA 4WJ3M 2UU9L 1F9QA 1CA6A 3U58A 2JE6I 5GAGC 5I2XA 1TXYA 1ZXTA 1KLGD 3NPPA 2WKCA 4KTAA 4DV5L 2KCCA 1L2FA 3UE1A 1IW7D 3CMEA 1DYQA 1YITA 2RSNA 2K28A 3K80C 4IUTA 2B2TC 2JP1A 4AH6A 3GTQH 1AN8A 5LMUL 3MC0B 1WJJA 4LMQD 1KQSA 1GM5A 1KLUD 3SR1A 2K05A 1PTOC 2SDFA 1Y8OB 2ZTCA 3STBD 4QY7A 4DR6L 5JVG3 2K5QA 2HD3A 3ULPA 3G48A 2UXBL 1RTNA 1U9RA 4I7AA 4QCLA 3ND8A 4JCVE 3LWUA 4PNYA 4K2KA 2UUCQ 2L55A 1W3SA 1D1KA 3OHXC 1BOSA 4LFBL 5ELCA 2N78A 4DR4Q 3C3LA 4A3EB 4JVZA 1ENCA 2CQOA 3CRLC 2E5LL 4GOPA 5C5LA 2ZXOA 1SJED 4A3MG 2NVXH 2A8VA 2FMMA 2E2HB 2VUMH 3OYYA 2HQLA 2YTYA 5FO9B 1Q7YC 4JYAL 3P1HA 3PO2G 2BH8A 1Q3LA 4KMUC 3SK4A 5C3EG 2OEOA 1C8CA 2R93G 2EYJA 4HCSA 5J1ZA 4R8IA 3T16A 1RDPD 1KNEA 4R4IA 3K0XA 1PTOH 1KDAA 2JA8B 4K8IA 3M4QA 1B7YB 2WINB 3S1MB 1B50A 1E3PA 3HOVG 3S17B 1L1OA 3CMAA 2H1EA 1B44D 2Z4IA 1L0WA 1VDZA 2F52A 1R9TB 1VQOA 1X32A 1LTGD 4K2LA 3I2ZA 1K0RA 4J6HA 1IL8A 2Y0SG 2QA4A 5IODA 4NXML 2OQ0A 4MHEA 5C3EH 2I0QA 4TQUS 1Y14B 4I65A 1PH6A 1XNQL 2PZWA 5EQ0A 4MZ9A 5KNBA 2XN9C 2WV6D 3DWPA 2A6HD 1TWAB 2VZAA 4JI3L 2YTXA 4NB3A 3HOVH 2H5XA 2G5DA 2X69A 2CQAA 3CP0A 2E2HH 5JVH3 2QILA 4ZKBB 3EBEA 5IP9G 1BF4A 1S5BD 5KIXA 1B2TA 1C9OA 2K5WA 2RA4A 1NY4A 1Q12A 1I6HB 3ULJA 4A3DG 2UUAL 1SNMA 5M3MG 3GQBA 1JR0D 4H13C 2K1BA 5M3FB 5A35A 2WP8J 4A3IG 3JAME 2Q8RE 5IT9c 1R4PB 1XNRL 2TMPA 3KUPA 1N32Q 1WCMB 3A8IE 3AU7A 3VA7A 1V1QA 2KOLA 3S17H 2AWNA 4QMGA 1WI5A 2FMCA 4IFDG 3C1EA 3PUZA 2NVQB 3OIQA 4A3JG 1QG7A 1R9TH 3HZXA 2IX0A 4K6DA 1O7IA 5IP9H 4IJLA 4P72A 3KK7A 1B8AA 2PW7A 1I6VC 2CWPA 5COYA 2PMZB 3IKJA 4NPSA 3OMGA 5FLXc 2GVAA 1XWEA 1XXGA 3NTKA 3NBHA 1CHPD 1ML0D 4HSVA 2HUGA 2J0TD 3CCJA 4RHSA 2NYZD 2CWAA 1Y1VG 3NTHA 1XMQL 3CRKC 3Q8DA 1JB3A 3GO5A 1Y8NB 2X6GA 1LT4D 2A6EC 2B2VA 4DV4L 4IFDI 3I4NG 4KHZA 2R6GA 3W1BA 1GO3E 3I8ZA 3AQQA 5D3IB 5FLMG 4POFA 4BY7G 2RHSB 3F2CA 2PMZE 1K3BC 3PIP3 3MVVA 3GTPH 5C3XA 1I6HH 4ZKCB 4LJZC 1U4MA 4HR7B 1EUJA 1GHKA 4NMZA 3SHLA 2F4IA 3RD4A 4Q5VA 1E1TA 1QUQB 4N9TA 3NWTA 1WCMH 4QUCA 3J80c 1Y1VH 4PQXA 4QQBX 1HUMA 4JI0Q 5FLXL 5JJIA 2QEXA 4PMCA 3VR4A 2R7ZG 2L4NA 3EQLC 3I4NH 1V9PA 1RKNA 2LKVA 1G51A 2ES2A 2R7FA 4DAYB 4BWGB 4KJOA 1W2BA 4GZYC 3VA5A 2CH4W 5EBCA 1TU2B 1EY9A 1QB5D 2K75A 3MAQA 5CMDA 3HRZC 4BBSB 3T1YL 1Q90A 3I4LA 1NSNS 1ESRA 2PQEA 2VQFQ 4IURA 1Q46A 4F8MA 2EVBA 2L15A 2EYHA 2C9OA 4OELB 1SJHD 3J80L 4L6TB 1YJNA 1VF7A 1NBWA 1TS3A 2L12A 1LV9A 1DZ1A 1FNUA 4LUOA 4KD4A 5CBAE 2RDFA 4GKKL 5D3DA 2MGSA 4A75A 1ZEQX 4X65Q 3QWNA 2QGQA 1U5KA 1E2WA 4OL7A 4DU9A 4APVA 1PLFA 3S2HH 4KHPL 4DUZQ 4RFBA 1IHZA 4JI4L 1G291 2JA9A 3R93A 1FGBD 4KJNA 3HOXB 2KHIA 4BA2I 1GKHA 3T53B 1OXUA 5I2YA 1DD2A 4DK1A 4F87A 3ZJYC 2JA7B 1YIJA 4JI2Q 3NELA 1J5EL 3M4YA 2K32A 1SYDA 1YNND 3FKIG 1IBLQ 5K36G 1AW7A 1K8GA 3HKZG 5CV6A 1EQQA 2SNSA 2CKZB 2Z6KC 1F2ZA 1BBXC 1EWCA 4BBSH 2L1BA 2BE5D 1MSGA 1PH1A 1LTSD 5FJ8G 1HQRD 4B3RQ 4K8JA 1I4GA 2ZTDA 2O4XA 2NTTA 2KQ3A 5CV4A 4V190 5E1FA 1AEXA 3QOJA 2F0OA 1EU4A 1PV4A 3NUCA 4C2MB 1E7ZA 5C44B 1QJOA 4O42A 4RKBA 4PZ6A 4B9XA 2CCZA 1XPOA 2DUDA 2EY2A 2OF1A 1DM0B 5CYUA 1AZPA 1X3QA 3K5LA 3S9WA 4KN4C 3Q24A 1HTPA 1LTLA 5EPJA 1LACA 2UUBL 3I4MG 2F1MA 4DAVA 3W1GA 2EY5A 2DN8A 5EBDA 4DR7Q 5FJ8H 3TS2A 3TSSA 4RKLA 3VR5A 3H0GB 1HZ9A 4K0KL 1MBYA 1F9PA 3TP5A 5JAVA 3LWEA 3MEFA 3HOXH 4C3HB 2AQ1B 3TREA 4CDCC 4A3KG 1YJ9A 2A68C 3TMEA 3J7A5 3UI2A 3M4OB 1EIFA 1Y8PB 1D6EC 3BZKA 4C1NI 2JA7H 1IBML 3PIOA 2WIIB 3RR5A 3I73A 1NNXA 2RBMA 1Z47A 1SRUA 4IALA 2D0OA 1HNXL 4C3IB 2LY7A 1O7LA 1SYEA 1STNA 2MJ8A 2ZT9C 4QJFA 4CHTB 3P20A 2EZVA 1S5FD 3AMUA 3KF8A 3MTSA 5M5XB 1LUZA 2NN6G 4GOPB 2F0QA 3MA2B 4C2MH 1G2SA 4OX9Q 4DV3Q 5C44H 5M5YB 2A74C 3BYTB 2GN5A 5I9OA 5E4WC 1F9RA 3CF5A 4QF4A 3MXPA 2R7DA 1VQ5A 3A8JE 3K57A 4LF4L 3PO3G 3E9IA 1PRTF 5GAEC 2M9VA 2UU9Q 1YNJD 1SMYC 5HY6A 4OONA 2L0CA 5LMNW 1J9OA 3H0GH 1BQQT 1HZAA 2NN6I 4OWXB 4X64L 1NR2A 1W6JA 4DV5Q 2A5HA 4C3HH 3D6WA 2MO1A 1SDFA 1X3FA 1L1OB 1W6KA 3L3OC 4A4IA 5LMUQ 2LS01 1AFPA 3K8AA 2PNRC 2WB1G 1J8IA 1HH2P 3H3VH 3D31A 1L1OC 4JI2L 1II3A 4DR6Q 1JJCB 3DMUA 2WKDA 1A63A 1Z6HA 2YU9B 3SXHA 3PO3H 1TS4A 2NB0A 2UXBQ 4AIMA 2NWGA 2XRSD 4JBJA 1C48A 1PVOA 3SGIA 4Q0FA 4LFBQ 1QZHA 5AFWA 3M7NA 3EA6A 4RMFA 4A3GG 1ZYRC 5M5YH 1QVFA 1T5XD 2CH4A 4M1UB 1FJGL 4IFDJ 1V43A 1NMGA 2CVRA 2KJXA 2IJ0A 1VQ7A 4FDBA 2F0JA 2E74C 5DEHA 4JYAQ 4JBKA 3PCOB 2EYMA 2PW5A 3SK6A 3D4RA 5KGUA 2MP1A 3OPOA 3X3NA 1M8AA 3NEMA 4X3UA 2K5DA 4A3FG 4IUNA 5EPKA 4DF7A 3CD6A 1UE7A 1WTQA 1K8AC 1PRTC 1X3PA 2K33A 4A3GH 2B63G 4CKEA 5G3LF 2OWOA 4OGQC 5C4HA 1YJWA 1HR0W 2IT1A 5CR3A 2Z6KA 1PH9A 3ICEA 2A69D 4JI8L 2YU9H 1TWGB 4CJ2C 1Q8IA 4NXMQ 3GDEA 5EKLA 3NBHB 5EGTA 2XWJB 2A6HC 4LNQA 4C3JG 2VQEL 5J39A 1KIXA 4A3FH 4DNTB 1RJTA 5BN5A 1XNQQ 4DA2A 2CFMA 4BBRG 2ICEC 4DN4M 1G6ZA 2VB2X 4JI3Q 4ZUIA 2VL6A 4K14A 1HNZL 4DV3L 3GD7A 1I50B 4ME5A 5F2DA 2CW0C 2PPBC 4P75A 3G7LA 1EYDA 3J81c 2K6AA 5C4ZA 4JBMA 4DR3L 2UUAQ 5FK9C 1UNSA 3VYTA 3K5NA 3X3MA 2ALYB 4DFAA 1TS2A 1XNRQ 3EJIA 1TKWB 5HURA 2BDOA 4RHRA 5FO7B 2R92G 4EQPA 1EWHA 1IXRA 4LF5L 5IGDA 4R9WA 3S1RH 1PTOB 3H15A 1VQ6A 1EL0A 4EQOA 1EZ6A 4XQNA 4ZK9B 1O7YA 3EN2A 4XXEA 4F7XA 2HCCA 2ENBA 4IOAA 2XTIA 1MIUA 2DNCA 1SXTA 3EVQA 3IAYA 3BDOA 1WD0A 2E2IB 1PA6A 4A3MB 4PG3A 4JI6L 1TWGH 4EQNA 3A7AB 1L0YB 2Z8LA 3HP3A 2EOTA 3TP8A 1SE2A 2HIVA 1HA6A 3Q0AA 3PF5A 3OWFA 3J81L 3PO2B 1DJRD 1STGA 2D5DA 1K8MA 2P5ZX 2CHBD 3TEHB 5C3EB 1WVLA 1XMQQ 5IYCG 1ET6A 2R93B 2KHSA 1OXXK 4DV4Q 2K5NA 1VQHA 3SEBA 1I5FA 4DXGA 4U673 4DK6C 1ILQA 1I50H 4IPGA 5JJZA 1HZBA 4UP9A 4MN3A 3HOVB 1E24A 1RIPA 1NMFA 3T13A 2ATWA 1JWSD 1UE1A 4QIWB 3BJUA 2KECA 4MIUA 4DR2Q 2MQHA 3CW2C 4JV5L 2LXKA 4YCVA 4YY3L 2Y0SB 2RDHA 3RZDB 1BR9A 1D5XC 3CU7A 1NJIC 3CQZH 2RHQB 2LSSA 3G6EA 3FPUB 4MTKA 3E3XA 1WTOA 4R1JA 3IFTA 4O0AA 3KBGA 1HCZA 4LUVA 1SE8A 3HOYG 4A3LG 1TVXA 4A93G 3HOUG 1C4QA 2E2IH 4QIWE 4A3MH 1XX8A 5C6AA 1LM0A 2GVBA 1GOZA 2Y0SE 1JOOA 3UDGA 2A19A 4UPAA 1EY6A 3MHBA 3PO2H 2F0PA 3T1YQ 4A3DB 5M3MB 2IHEA 1ASZA 1Q1EA 2E2DC 4ZRZA 4YWKA 1GUSA 3S15B 1RODA 3BVZA 4RCOA 2R93H 4XYQA 3VYUA 3WOEA 4DPGA 4A3IB 1WTXA 4RAUC 4KK7A 4FXDA 3OOCA 2AMCB 3BYYB 1MD2D 4HAEA 3KJOA 3GTJH 3MXNA 4KY6A 4HMJA 2AUKA 2EYPA 4LFAL 4YWMA 1PZID 1JE4A 5KRUA 3T1HL 4A93H 1SE3A 3HOUH 5E7NA 3KJPA 2F0HA 1A2TA 4IPHA 4GKKQ 3CCEA 2EYOA 3GTPB 1SNQA 1VQAA 4ID6A 4A3JB 2JYOA 2B39A 5ELEA 1QWYA 4A3CG 1SYBA 5IGFA 3RZDH 4JW0A 4KHPQ 3K7UC 4UHVA 4JI4Q 1PFNA 3GTOH 4KN7C 1YI2A 1CTMA 4HJ9A 1YNNC 1Y1VB 3D6CA 2B2UC 3BG3A 3U50C 2BH2A 1STBA 1WTRA 4KHVA 4BY1G 3M9BA 1J5EQ 4N8FA 3CCSA 2QKIC 3I4NB 3JC66 5A2QL 2K7VA 4BY7B 3BZCA 3CXCA 3WWVA 2OXPA 5ELNA 1BCPF 2XNAC 3PUVA 1TQOA 2QW7A 2F0IA 2KVMA 3K7AH 5M3MH 4GLVB 5IYBG 2B29A 4A3DH 3PF4A 4A3CH 4FYDA 1VS0A 3BZDB 4IUUA 3QB3A 3I55A 3I90A 4G4KA 3KF8B 4A3IH 3CC7A 3S14B 1HPCA 4OWTB 4NXNL 2EIFA 4CJ0B 1RD9D 1XTDA 2IW3A 4KI0A 1GVPA 4P74A 2OT2A 2KHJA 4CKBA 5IT9L 2F0KA 3D8GA 5IGBA 1QOHA 1FVIA 5ELOA 4BY1H 4QL5A 4EVOA 3Q6SA 2R7ZB 4CDFC 1IBKL 3CC4A 3PUYA 1PFMA 1PTOD 3AYHB 4IFDH 2B3GA 2RKSA 4YCUA 4A3JH 3HGBA 4S3SA 3DWQA 1KTKA 2ZJQA 4Z9CB 4HCEA 3N52A 2UUBQ 1RTOA 1G2TA 3E6ZX 2NZHA 2MPMA 1EYAA 3MEHA 4WJWA 1EIHA 2ZXRA 1SMXA 4XYOA 4O2DA 1ENFA 4DR2L 1XJVA 4K0KQ 3S2HB 2NVYB 2F0FA 4EX5A 1SFOB 1G91A 2LXJA 4ZCKA 4K6LA 1R4QB 4CDEC 4CGYB 2HT1A 1CM9A 1Z7TA 3BDLA 1IBMQ 2PO4A 1FL0A 2K52A 3RMHA 5FLMH 2IPKD 5IP7G 2AWOA 4BY7H 3KOJA 1YBYA 1K0SA 1OXTA 1OXVA 1UE5A 1QE6A 3IRBA 4Y7NH 3FPPA 1IKLA 1HNXQ 2DY7A 3QIAA 5ISRA 1EZ8A 1HJPA 1PH3A 4RGMA 3KLRA 1H9KA 3S14H 2AQ2B 3EFXD 1PYSB 4OO1G 1HFGA 3PIPA 1HRJA 2B2YC 2DNEA 1YHAA 1BCPC 4X62L 1JB7A 2JA6G 1EQTA 1GJXA 1UE6A 1H9RA 5KNDA 2R7ZH 1XMOL 1EOVA 3VYRA 1PH7A 1KABA 4B3TL 4YCWA 4ZUJA 1VQEA 4V0BA 3L7ZC 2UXCL 3OW2A 1SSOA 2Z9HA 4LF4Q 3RN2A 1EY8A 3U4ZA 3FKIB 1UEAB 1V8QA 2SNMA 4OO1I 3HKZB 2VW9A 1PFSA 3NENA 2ZM6L 4OXPA 1STYA 1H95A 1RF2D 1H9JA 4X64Q 5C5MA 2NVYH 5GADC 1K73C 4DNIA 3RN5A 1SFOH 3A7LA 3KLSA 1WYDA 2RDGA 3PQIA 4PMWA 4RA8A 3MWYW 3HG9A 1F77A 1ET9A 1TY0A 2JN4A 1PH5A 1VQJA 4R4TA 1S40A 3CPWA 2IX1A 3BDCA 2BA1A 2JSOA 3OMCA 1S3OA 3HKZE 3GV3A 1HNWL 5LMNL 5IIFA 1LT5D 3I4OA 3ULLA 1U4PA 3H91A 5EAYA 1Y1WG 3FMCA 1SLJA 4AQYL 1MI2A 3R3OA 3I4MB 4K5VA 2B2WA 4L63B 1CFMA 2EYFA 1K83B 3K81C 3CC2A 1FJGQ 4CDDC 4IOCA 4R4OA 1E0BA 4A3KB 1X3GA 2A73B 5JEAG 3LX0A 1YEZA 4QB4A 1CSPA 1D5ZC 1B1ZA 3UDFA 1VQCA 5E3FA 2GA4B 3F8TA 3OIPA 4PZ8A 4BXXG 5C4XG 1X56A 2AHOB 4DR1Q 4CJ1B 3FKIH 5K36H 3I3CA 5FO8B 3S1NB 3ND9A 2EDGA 3GTMB 1HZCA 2AUJD 1OTCA 1Y1WH 2F0GA 1EY7A 5IT9E 3J7AF 2SEBD 3KBXA 3TQYA 1EFID 2YTVA 4J15A 3LNNA 2Z6BA 3HFZB 2VXWA 1TR5A 2B2UA 1KL9A 4FXGC 2EJMA 3S1QH 2O5IC 1P16A 4JI1L 1LABA 1IYUA 2A6ED 2F3IA 2NBFA 3TP6A 1EYCA 1A15A 3U4VA 1EEFD 5ELBA 2D0PA 4LF9L 4AYBG 3H6MA 2D2CC 4A3BG 2MNAA 4IUQA 1JC7A 3A74A 4JI8Q 4L5QA 5CV7A 1CKOA 3K6OA 1U0LA 3SK5A 1CQVA 4BXXH 5C4XH 4IPDA 2WACA 3FDTA 5FLXE 4RGNA 3HOZG 2N8NA 5LL6S 2VQEQ 3I4MH 3BS1A 1Q86C 1ASYA 3PO3B 3DEOA 1K83H 1CA5A 1V1OA 2L9HA 1JJ2A 4G7HC 1HHVA 1AE2A 2BA0A 3JAMi 2V1CC 4ZAIA 2MFIA 1HNZQ 4A3KH 1HR0L 1RL2A
chains in the Genus database with same CATH topology
5IP7H 3HOWG 4JI3Q 3VDYA 2VL6A 1PH6A 1XNQL 1HNZL 4DV3L 4A3BH 3GD7A 4MZ9A 1Q81C 4DR3Q 4BA1I 2WAQG 4A76A 4LF8L 2VZAA 4P75A 3S1NH 4JI3L 3J81c 3CCQA 1EFWA 2YTXA 4NB3A 2JQOA 3GTMH 3HOVH 4DV6Q 4JBMA 2H5XA 4DR3L 3CP0A 2UUAQ 2E2HH 1VQMA 3EBEA 5IP9G 1C9OA 2WFWA 1NY4A 1Q12A 1X3EA 4DV6L 3ULJA 2ALYB 4LF5Q 2UUAL 5M3MG 5GAHC 4A3DG 1XNRQ 2R92G 2JA6H 5IWAQ 3EIVA 3STBC 4DV1Q 4BBSG 1IXRA 2WP8J 4A3IG 4LF5L 3S1RH 2HHHL 2DGYA 5IT9c 1XNRL 2VNUD 3H15A 2E2JH 1VQ6A 1N32Q 2WB1E 5IWAL 4YHHQ 2UXDQ 1XPUA 5JJLA 4DR5Q 3EN2A 3CCVA 1PH4A 4JI6Q 1AH9A 1V1QA 4RG1A 4IOAA 1N32L 4YHHL 2XTIA 3S17H 1YHQA 1MIUA 1S72A 2AWNA 3AFPA 5C4JH 4PG3A 1PA6A 4JI6L 1AE3A 1TWGH 1WI5A 3KDFA 4GNXC 4R4CA 4IFDG 3PUZA 4A3JG 1R9TH 1KXLA 5IP9H 2IX0A 1O7IA 2HIVA 4IJLA 4P72A 1CKNB 3PF5A 4LF6Q 1B8AA 1VCIA 2CWPA 4H02A 4NPSA 3TEHB 3MXNB 3L2PA 1VQ4A 1XMQQ 5FLXc 5IYCG 5GROA 1IZ6A 2GVAA 4GLAC 3S15H 3KF6B 2PNHA 4LF6L 1OXXK 3G71A 3CCJA 3E0EA 1NE3A 2CWAA 1Y1VG 4DV4Q 2K5NA 1VQHA 1JT8A 1XMQL 5H1SE 1I5FA 4TVAB 4DK6C 4IPGA 1I50H 3Q8DA 3GO5A 4B3MQ 4DK3C 5HGQA 4BBSH 1HZBA 1YNXA 4DV4L 3HOXG 1VQNA 4UP9A 4IFDI 3I4NG 4KHZA 1QVGA 4JG2A 1E24A 1RIPA 1NMFA 2D62A 2R6GA 3B6YA 1GO3E 3W1BA 3AQQA 5FLMG 4DR1L 4MTNA 4POFA 2JA7G 3L0OA 4BY7G 2RHSB 4JV5Q 4YY3Q 2IHFA 3F2CA 3OTOQ 1VQ8A 2PMZE 4JI5Q 2ATWA 3D0FA 1WOCA 4JOIA 3GTPH 1UE1A 3CCUA 1KAWA 1I6HH 3BJUA 4DR2Q 4ALPA 2MQHA 3CW2C 1YZ6A 2LXKA 4YCVA 4JV5L 4YY3L 1EUJA 3OTOL 4JI5L 1NJIC 1KHIA 4AYBE 5IE8A 3CQZH 3PV0A 2NZOA 5GQOA 2JA5G 1D8LA 4LWCA 1TWCH 2RHQB 2LSSA 1E1TA 1QUQB 3G6EA 2YYZA 1I94Q 3LGJA 1WCMH 3J80c 1Y1VH 4R1JA 1XPRA 4LFCL 4O0AA 4WJ4A 4QQBX 4LUVA 4JI0Q 1SE8A 2E8GA 1I94L 3E9HA 2QEXA 1Q82C 3HOYG 3RZOH 1PYBA 4A3LG 4A93G 3HOUG 2R7ZG 2E2IH 4QIWE 4A3MH 4L5SA 1DGSA 3JAMc 3I4NH 1LM0A 2GVBA 5C44G 2IY5B 1V9PA 1G51A 4JI0L 2ES2A 2R7FA 4DAMA 2Y0SE 5C0XJ 1BBWA 4DAYB 3UDGA 2A19A 4UPAA 1Q8KA 1W2BA 1JE5A 3PO2H 2AKWB 3T1YQ 4UY8C 1K9MC 1X65A 2IHEA 1YHBA 1KRSA 1ASZA 1Q1EA 2K75A 4YWKA 3PUXA 1KRTA 2R93H 5IYDG 2I5MX 1M1KC 3G4SA 4DPGA 3T1YL 2JA5H 4L5RC 1CKNA 2WAQE 4LFAQ 1BVSA 1VQGA 4B3ML 2B63H 2VQFQ 3H0GG 1T9HA 2AMCB 3GTJH 4UP7A 3KJOA 3T1HQ 2N3SA 4XIGS 1KC8C 1BBUA 4KLKA 4HIOA 2XGTA 4DUYQ 1Q46A 5IY0A 2VS1A 3KF6A 4LFAL 4YWMA 3S16H 3RLNA 5J3BA 2VQFL 2L15A 4A93H 3T1HL 1Z9FA 2FXQA 3HOUH 5E7NA 3KJPA 3HOZH 4IPHA 4GKKQ 3CCEA 2K14A 2K50A 1VQAA 2KCTA 4DV0Q 1NTGA 2PI2E 1YJNA 1NBWA 4LUOA 1G6PA 4C3JH 4A3CG 4GKKL 3RZDH 4GOPC 4KHPQ 4A75A 1UEBA 4POGA 3K7UC 4DV0L 4JI4Q 4X65Q 5DLQE 1E22A 3TRZA 3RNUA 2QGQA 2ASBA 3GTOH 1U5KA 3UE0A 2OCEA 1YI2A 4APVA 1PH8A 2Q2UA 3M3YH 4HJ9A 4BBRH 3S2HH 4LUZA 4DUZQ 4KHPL 4DV1L 3S24A 4JI4L 4YWLA 4X65L 1G291 2JA9A 4GNXB 3HOWH 3U50C 3KFUA 2BH2A 4LW1A 4R4QA 1VQIA 2UXDL 4BY1G 3J81i 4DUZL 2OTJA 2JK8A 3M9BA 1CSQA 4DR5L 1J5EQ 2F4VQ 3CCSA 1JJGA 1QUQA 4BA2I 2KHIA 3JC66 1GKHA 1OXUA 4PZ7A 3M4OH 3ZJYC 3H3VI 1YIJA 3CCRA 3BZCA 1MKHA 3NELA 4JI2Q 1J5EL 3CXCA 3WWVA 2F4VL 4P73A 5ELNA 4GN4B 2OTLA 3FKIG 3PUVA 1IBLQ 5IYBG 4A3DH 3K7AH 5M3MH 1B70B 4GLVB 2B29A 3HKZG 1PH2A 1K8GA 5K36G 4GS3A 1EQQA 4NXNQ 3I56A 2R92H 3W5OA 3PF4A 4A3CH 1P8LA 1VS0A 2CKZB 2KCMA 2Z6KC 3J81j 3I55A 1UWVA 3KF8B 4B3SQ 1X6OA 4A3IH 1IBLL 2VUMG 3CC7A 2KENA 1CUKA 4OWTB 1PH1A 1IL2A 5FJ8G 4NXNL 2EIFA 1N34Q 2A1AA 4B3RQ 1C7YA 1XTDA 4KI0A 4C3IH 2ZTDA 1GVPA 4B3SL 4P74A 3GTKH 2KHJA 2PI2A 1IBKQ 1N34L 3PUWA 4B3RL 2RCNA 1PV4A 1SROA 1FVIA 5ELOA 1SN8A 5M5XH 4DV2Q 4BY1H 4QL5A 1IBKL 3CC4A 3PUYA 1E7ZA 3ERSX 1X54A 3AYHB 2B3GA 4PZ6A 4YCUA 1J6QA 1TWHH 2CCZA 4A3JH 1VQBA 2DUDA 1XPOA 2E5LQ 2NVTH 1EYGA 3AFQA 4DV2L 2Z0SA 2ZJQA 3BU2A 3FHWA 2UUBQ 2K5HA 2EXDA 2NZHA 4HIMA 1VQKA 1D7QA 1LTLA 1SMXA 4O2DA 4HIKA 4DR2L 1XJVA 5IYCH 1I3QH 5M5WH 2UUBL 3I4MG 3W1GA 1QZGA 4X66Q 4K0KQ 2YV5A 5JEAJ 3AEVA 3PSIA 5BR8Q 4DR7Q 2N49A 2Q2HA 5FJ8H 3CCLA 1N33Q 4EX5A 3GTGH 3TS2A 2LXJA 4HJ8A 4UP8A 1HZ9A 4K0KL 3KYHC 2HT1A 2HIXA 1IBMQ 5BR8L 3I7FA 4DR7L 3MEFA 3RLOA 3HOXH 4A3KG 1FL0A 2K52A 3TREA 1N33L 1YJ9A 3J7A5 4GKJQ 3RLFA 3DM3A 1EIFA 5FLMH 4GNXA 3A5UA 3F2DA 5IP7G 3BZKA 2AWOA 4GN3B 3KOJA 2JA7H 3CPFA 1IBML 4BY7H 1YBYA 3PIOA 3RR5A 3CAMA 1OXTA 1OXVA 4MNOA 2MO0A 4A3EG 4GKJL 1UE5A 3IRBA 1QVCA 3UDXA 4Y7NH 1HNXQ 4JI7Q 1Z47A 2VY3A 4DV7Q 4HIDA 4OWWB 4EQ5A 1A62A 1HJPA 1SRUA 4DKAC 1PH3A 3S14H 4X62Q 4OO1G 1PYSB 3M85A 2D0OA 1HNXL 4JI7L 3PIPA 4DV7L 1KD1C 2K5VA 3J80i 2K4KA 1IYJB 4QJFA 2I5LX 1YHAA 2PQAB 1X55A 1XMOQ 4X62L 1JB7A 1N8RC 4B3TQ 2JA6G 4IJHA 1UE6A 3HOYH 4A3LH 2JJQA 2UXCQ 1X9NA 4HJ7A 1LUZA 2NN6G 1LYLA 2R7ZH 4Y52H 4DUYL 4GOPB 4C2MH 4OX9Q 1XMOL 1EOVA 4DV3Q 4GN5A 4L5TA 1PH7A 5C44H 4B3TL 2JA8G 2JEAI 2I5HA 4YCWA 1VQEA 3L7ZC 3S2DH 2GN5A 2UXCL 3OW2A 3F1ZA 3PGZA 2ZM6Q 2OQKA 3CF5A 4LF4Q 1A0IA 4OX9L 2R7DA 3HKSA 3RN2A 4A3EH 1E1OA 3U4ZA 1N9WA 1C0AA 1VQ5A 4OO1I 1TWFH 5AJ3Q 2VW9A 1PFSA 3NENA 2ZM6L 4OXPA 4GLXA 4LF4L 1JMCA 1H95A 3ER0A 3PO3G 3E9IA 5GAEC 4QGUA 2UU9Q 5IYDH 1N36Q 4LF7Q 4X64Q 1SR3A 4JOIC 5AJ3L 5HY6A 5GADC 2NVYH 1MJCA 3KLWA 4OONA 1K73C 4DNIA 5LMNW 3RN5A 1SFOH 1RL2A 3GTLH 1BKBA 4WJ3M 3H0GH 1WYDA 2UU9L 1K3RA 1HZAA 2NN6I 2HHHQ 3A5ZB 4OWXB 3U58A 4X64L 4PMWA 4DV5Q 1N36L 4LF7L 2JE6I 4C3HH 5GAGC 1VQPA 2MO1A 1TXYA 1PH5A 1X3FA 1VQFA 1VQJA 1L1OB 5LMNQ 4R4TA 1S40A 1HNWQ 3CPWA 1M90C 2IX1A 4P71A 4A4IA 5LMUQ 1L2FA 3FP9A 2BA1A 3UE1A 4DV5L 4HJ5A 1S3OA 4XTCS 2JA8H 3HKZE 3CMEA 1Q1BA 1YITA 3K8AA 1VQDA 3K80C 2WB1G 5LMNL 3S1MH 1HNWL 4AQYQ 1HH2P 4AH6A 2ZJRA 3GTQH 3D31A 1L1OC 4JI2L 5LMUL 3H3VH 3I4OA 1JJCB 1WJJA 3ULLA 5EAYA 4DR6Q 3CCMA 1Y1WG 1KQSA 1GM5A 1A63A 1SLJA 2ZTCA 2ZJPA 1CKMA 4AQYL 3STBD 1EWIA 4QY7A 4DR6L 3PO3H 1VQLA 2UXBQ 4AIMA 3DLLA 4ME3A 3K81C 5M3FG 3A0JA 2RF4A 4JBJA 1PVOA 3SGIA 3ULPA 3CC2A 3G48A 1FJGQ 1QZHA 4LFBQ 2UXBL 5JJKA 1YVCA 4IOCA 4R4OA 3M7NA 4JCVE 4RMFA 1X3GA 5JEAG 4A3GG 1VQ9A 1GD7A 1YEZA 2UUCQ 1CSPA 5M5YH 1W3SA 1WCMG 1QVFA 3UDFA 2PQAA 1FJGL 4LFBL 1VQCA 4IFDJ 1V43A 1FGUA 1NMGA 3F8TA 2N78A 4PZ8A 4DR4Q 4BXXG 5C4XG 1X56A 2AHOB 4JBWA 2CQOA 4IPCA 3F2BA 4FDBA 4DR1Q 1VQ7A 2UUCL 3FKIH 5IYBH 2E5LL 1TWAH 4GOPA 4JYAQ 4A3MG 2NVXH 2A8VA 5C0XG 1HZCA 2C35B 1OTCA 4JBKA 4DR4L 3PCOB 1Y1WH 2VUMH 3OYYA 3TQYA 2HQLA 2JEBI 4JI1Q 2YTYA 2YTVA 2ID0A 4J15A 1Q7YC 4JYAL 1WFQA 3HFZB 1OXSC 3PO2G 1KL9A 2BH8A 4X66L 3NEMA 3S1QH 4A3FG 3J7ZC 4LF9Q 5C3EG 1P16A 4JI1L 3TS0A 5M3FH 2ZTEA 2R93G 2F3IA 3CD6A 2KBNA 1UE7A 3U4VA 1K8AC 2D0PA 4LF9L 4R4IA 3K0XA 4LFCQ 4AYBG 4A3BG 4A3GH 2MNAA 2B63G 3KDFB 3UDIA 3M4QA 1B7YB 1PHJA 2OWOA 3A74A 4JI8Q 4L5QA 1CKOA 1U0LA 5C0XI 1MJEA 4BXXH 5C4XH 1E3PA 4IPDA 2Q2IA 1YJWA 3HOVG 1L1OA 1HR0W 3CMAA 2IT1A 2Z6KA 1PH9A 2EQSA 4JI8L 2N8NA 3HOZG 3ICEA 2YU9H 2VQEQ 3I4MH 4NXMQ 1L0WA 3GDEA 1Q86C 1ASYA 2F52A 2NVQH 3NBHB 1VQOA 3M4PA 1K83H 1K0RA 3I2ZA 1HR0Q 2VQEL 1EIYB 2Y0SG 4LNQA 4HJAA 1A8VA 2QA4A 1KIXA 1JJ2A 4NXML 4IO9A 4X6AH 2OQ0A 1AE2A 2Q2TA 4A3FH 5JJIA 5C3EH 2BA0A 3JAMi 2V1CC 2MFIA 1XNQQ 1HNZQ 4JC0A 1EQRA 4A3KH 1HR0L 2I0QA 2CFMA 4LF8Q 4TQUS 4BBRG 1Y14B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP7 H;  3HOW G;  4JI3 Q;  3VDY A;  2VL6 A;  1PH6 A;  1XNQ L;  1HNZ L;  4DV3 L;  4A3B H;  3GD7 A;  4MZ9 A;  1Q81 C;  4DR3 Q;  4BA1 I;  2WAQ G;  4A76 A;  4LF8 L;  2VZA A;  4P75 A;  3S1N H;  4JI3 L;  3J81 c;  3CCQ A;  1EFW A;  2YTX A;  4NB3 A;  2JQO A;  3GTM H;  3HOV H;  4DV6 Q;  4JBM A;  2H5X A;  4DR3 L;  3CP0 A;  2UUA Q;  2E2H H;  1VQM A;  3EBE A;  5IP9 G;  1C9O A;  2WFW A;  1NY4 A;  1Q12 A;  1X3E A;  4DV6 L;  3ULJ A;  2ALY B;  4LF5 Q;  2UUA L;  5M3M G;  5GAH C;  4A3D G;  1XNR Q;  2R92 G;  2JA6 H;  5IWA Q;  3EIV A;  3STB C;  4DV1 Q;  4BBS G;  1IXR A;  2WP8 J;  4A3I G;  4LF5 L;  3S1R H;  2HHH L;  2DGY A;  5IT9 c;  1XNR L;  2VNU D;  3H15 A;  2E2J H;  1VQ6 A;  1N32 Q;  2WB1 E;  5IWA L;  4YHH Q;  2UXD Q;  1XPU A;  5JJL A;  4DR5 Q;  3EN2 A;  3CCV A;  1PH4 A;  4JI6 Q;  1AH9 A;  1V1Q A;  4RG1 A;  4IOA A;  1N32 L;  4YHH L;  2XTI A;  3S17 H;  1YHQ A;  1MIU A;  1S72 A;  2AWN A;  3AFP A;  5C4J H;  4PG3 A;  1PA6 A;  4JI6 L;  1AE3 A;  1TWG H;  1WI5 A;  3KDF A;  4GNX C;  4R4C A;  4IFD G;  3PUZ A;  4A3J G;  1R9T H;  1KXL A;  5IP9 H;  2IX0 A;  1O7I A;  2HIV A;  4IJL A;  4P72 A;  1CKN B;  3PF5 A;  4LF6 Q;  1B8A A;  1VCI A;  2CWP A;  4H02 A;  4NPS A;  3TEH B;  3MXN B;  3L2P A;  1VQ4 A;  1XMQ Q;  5FLX c;  5IYC G;  5GRO A;  1IZ6 A;  2GVA A;  4GLA C;  3S15 H;  3KF6 B;  2PNH A;  4LF6 L;  1OXX K;  3G71 A;  3CCJ A;  3E0E A;  1NE3 A;  2CWA A;  1Y1V G;  4DV4 Q;  2K5N A;  1VQH A;  1JT8 A;  1XMQ L;  5H1S E;  1I5F A;  4TVA B;  4DK6 C;  4IPG A;  1I50 H;  3Q8D A;  3GO5 A;  4B3M Q;  4DK3 C;  5HGQ A;  4BBS H;  1HZB A;  1YNX A;  4DV4 L;  3HOX G;  1VQN A;  4UP9 A;  4IFD I;  3I4N G;  4KHZ A;  1QVG A;  4JG2 A;  1E24 A;  1RIP A;  1NMF A;  2D62 A;  2R6G A;  3B6Y A;  1GO3 E;  3W1B A;  3AQQ A;  5FLM G;  4DR1 L;  4MTN A;  4POF A;  2JA7 G;  3L0O A;  4BY7 G;  2RHS B;  4JV5 Q;  4YY3 Q;  2IHF A;  3F2C A;  3OTO Q;  1VQ8 A;  2PMZ E;  4JI5 Q;  2ATW A;  3D0F A;  1WOC A;  4JOI A;  3GTP H;  1UE1 A;  3CCU A;  1KAW A;  1I6H H;  3BJU A;  4DR2 Q;  4ALP A;  2MQH A;  3CW2 C;  1YZ6 A;  2LXK A;  4YCV A;  4JV5 L;  4YY3 L;  1EUJ A;  3OTO L;  4JI5 L;  1NJI C;  1KHI A;  4AYB E;  5IE8 A;  3CQZ H;  3PV0 A;  2NZO A;  5GQO A;  2JA5 G;  1D8L A;  4LWC A;  1TWC H;  2RHQ B;  2LSS A;  1E1T A;  1QUQ B;  3G6E A;  2YYZ A;  1I94 Q;  3LGJ A;  1WCM H;  3J80 c;  1Y1V H;  4R1J A;  1XPR A;  4LFC L;  4O0A A;  4WJ4 A;  4QQB X;  4LUV A;  4JI0 Q;  1SE8 A;  2E8G A;  1I94 L;  3E9H A;  2QEX A;  1Q82 C;  3HOY G;  3RZO H;  1PYB A;  4A3L G;  4A93 G;  3HOU G;  2R7Z G;  2E2I H;  4QIW E;  4A3M H;  4L5S A;  1DGS A;  3JAM c;  3I4N H;  1LM0 A;  2GVB A;  5C44 G;  2IY5 B;  1V9P A;  1G51 A;  4JI0 L;  2ES2 A;  2R7F A;  4DAM A;  2Y0S E;  5C0X J;  1BBW A;  4DAY B;  3UDG A;  2A19 A;  4UPA A;  1Q8K A;  1W2B A;  1JE5 A;  3PO2 H;  2AKW B;  3T1Y Q;  4UY8 C;  1K9M C;  1X65 A;  2IHE A;  1YHB A;  1KRS A;  1ASZ A;  1Q1E A;  2K75 A;  4YWK A;  3PUX A;  1KRT A;  2R93 H;  5IYD G;  2I5M X;  1M1K C;  3G4S A;  4DPG A;  3T1Y L;  2JA5 H;  4L5R C;  1CKN A;  2WAQ E;  4LFA Q;  1BVS A;  1VQG A;  4B3M L;  2B63 H;  2VQF Q;  3H0G G;  1T9H A;  2AMC B;  3GTJ H;  4UP7 A;  3KJO A;  3T1H Q;  2N3S A;  4XIG S;  1KC8 C;  1BBU A;  4KLK A;  4HIO A;  2XGT A;  4DUY Q;  1Q46 A;  5IY0 A;  2VS1 A;  3KF6 A;  4LFA L;  4YWM A;  3S16 H;  3RLN A;  5J3B A;  2VQF L;  2L15 A;  4A93 H;  3T1H L;  1Z9F A;  2FXQ A;  3HOU H;  5E7N A;  3KJP A;  3HOZ H;  4IPH A;  4GKK Q;  3CCE A;  2K14 A;  2K50 A;  1VQA A;  2KCT A;  4DV0 Q;  1NTG A;  2PI2 E;  1YJN A;  1NBW A;  4LUO A;  1G6P A;  4C3J H;  4A3C G;  4GKK L;  3RZD H;  4GOP C;  4KHP Q;  4A75 A;  1UEB A;  4POG A;  3K7U C;  4DV0 L;  4JI4 Q;  4X65 Q;  5DLQ E;  1E22 A;  3TRZ A;  3RNU A;  2QGQ A;  2ASB A;  3GTO H;  1U5K A;  3UE0 A;  2OCE A;  1YI2 A;  4APV A;  1PH8 A;  2Q2U A;  3M3Y H;  4HJ9 A;  4BBR H;  3S2H H;  4LUZ A;  4DUZ Q;  4KHP L;  4DV1 L;  3S24 A;  4JI4 L;  4YWL A;  4X65 L;  1G29 1;  2JA9 A;  4GNX B;  3HOW H;  3U50 C;  3KFU A;  2BH2 A;  4LW1 A;  4R4Q A;  1VQI A;  2UXD L;  4BY1 G;  3J81 i;  4DUZ L;  2OTJ A;  2JK8 A;  3M9B A;  1CSQ A;  4DR5 L;  1J5E Q;  2F4V Q;  3CCS A;  1JJG A;  1QUQ A;  4BA2 I;  2KHI A;  3JC6 6;  1GKH A;  1OXU A;  4PZ7 A;  3M4O H;  3ZJY C;  3H3V I;  1YIJ A;  3CCR A;  3BZC A;  1MKH A;  3NEL A;  4JI2 Q;  1J5E L;  3CXC A;  3WWV A;  2F4V L;  4P73 A;  5ELN A;  4GN4 B;  2OTL A;  3FKI G;  3PUV A;  1IBL Q;  5IYB G;  4A3D H;  3K7A H;  5M3M H;  1B70 B;  4GLV B;  2B29 A;  3HKZ G;  1PH2 A;  1K8G A;  5K36 G;  4GS3 A;  1EQQ A;  4NXN Q;  3I56 A;  2R92 H;  3W5O A;  3PF4 A;  4A3C H;  1P8L A;  1VS0 A;  2CKZ B;  2KCM A;  2Z6K C;  3J81 j;  3I55 A;  1UWV A;  3KF8 B;  4B3S Q;  1X6O A;  4A3I H;  1IBL L;  2VUM G;  3CC7 A;  2KEN A;  1CUK A;  4OWT B;  1PH1 A;  1IL2 A;  5FJ8 G;  4NXN L;  2EIF A;  1N34 Q;  2A1A A;  4B3R Q;  1C7Y A;  1XTD A;  4KI0 A;  4C3I H;  2ZTD A;  1GVP A;  4B3S L;  4P74 A;  3GTK H;  2KHJ A;  2PI2 A;  1IBK Q;  1N34 L;  3PUW A;  4B3R L;  2RCN A;  1PV4 A;  1SRO A;  1FVI A;  5ELO A;  1SN8 A;  5M5X H;  4DV2 Q;  4BY1 H;  4QL5 A;  1IBK L;  3CC4 A;  3PUY A;  1E7Z A;  3ERS X;  1X54 A;  3AYH B;  2B3G A;  4PZ6 A;  4YCU A;  1J6Q A;  1TWH H;  2CCZ A;  4A3J H;  1VQB A;  2DUD A;  1XPO A;  2E5L Q;  2NVT H;  1EYG A;  3AFQ A;  4DV2 L;  2Z0S A;  2ZJQ A;  3BU2 A;  3FHW A;  2UUB Q;  2K5H A;  2EXD A;  2NZH A;  4HIM A;  1VQK A;  1D7Q A;  1LTL A;  1SMX A;  4O2D A;  4HIK A;  4DR2 L;  1XJV A;  5IYC H;  1I3Q H;  5M5W H;  2UUB L;  3I4M G;  3W1G A;  1QZG A;  4X66 Q;  4K0K Q;  2YV5 A;  5JEA J;  3AEV A;  3PSI A;  5BR8 Q;  4DR7 Q;  2N49 A;  2Q2H A;  5FJ8 H;  3CCL A;  1N33 Q;  4EX5 A;  3GTG H;  3TS2 A;  2LXJ A;  4HJ8 A;  4UP8 A;  1HZ9 A;  4K0K L;  3KYH C;  2HT1 A;  2HIX A;  1IBM Q;  5BR8 L;  3I7F A;  4DR7 L;  3MEF A;  3RLO A;  3HOX H;  4A3K G;  1FL0 A;  2K52 A;  3TRE A;  1N33 L;  1YJ9 A;  3J7A 5;  4GKJ Q;  3RLF A;  3DM3 A;  1EIF A;  5FLM H;  4GNX A;  3A5U A;  3F2D A;  5IP7 G;  3BZK A;  2AWO A;  4GN3 B;  3KOJ A;  2JA7 H;  3CPF A;  1IBM L;  4BY7 H;  1YBY A;  3PIO A;  3RR5 A;  3CAM A;  1OXT A;  1OXV A;  4MNO A;  2MO0 A;  4A3E G;  4GKJ L;  1UE5 A;  3IRB A;  1QVC A;  3UDX A;  4Y7N H;  1HNX Q;  4JI7 Q;  1Z47 A;  2VY3 A;  4DV7 Q;  4HID A;  4OWW B;  4EQ5 A;  1A62 A;  1HJP A;  1SRU A;  4DKA C;  1PH3 A;  3S14 H;  4X62 Q;  4OO1 G;  1PYS B;  3M85 A;  2D0O A;  1HNX L;  4JI7 L;  3PIP A;  4DV7 L;  1KD1 C;  2K5V A;  3J80 i;  2K4K A;  1IYJ B;  4QJF A;  2I5L X;  1YHA A;  2PQA B;  1X55 A;  1XMO Q;  4X62 L;  1JB7 A;  1N8R C;  4B3T Q;  2JA6 G;  4IJH A;  1UE6 A;  3HOY H;  4A3L H;  2JJQ A;  2UXC Q;  1X9N A;  4HJ7 A;  1LUZ A;  2NN6 G;  1LYL A;  2R7Z H;  4Y52 H;  4DUY L;  4GOP B;  4C2M H;  4OX9 Q;  1XMO L;  1EOV A;  4DV3 Q;  4GN5 A;  4L5T A;  1PH7 A;  5C44 H;  4B3T L;  2JA8 G;  2JEA I;  2I5H A;  4YCW A;  1VQE A;  3L7Z C;  3S2D H;  2GN5 A;  2UXC L;  3OW2 A;  3F1Z A;  3PGZ A;  2ZM6 Q;  2OQK A;  3CF5 A;  4LF4 Q;  1A0I A;  4OX9 L;  2R7D A;  3HKS A;  3RN2 A;  4A3E H;  1E1O A;  3U4Z A;  1N9W A;  1C0A A;  1VQ5 A;  4OO1 I;  1TWF H;  5AJ3 Q;  2VW9 A;  1PFS A;  3NEN A;  2ZM6 L;  4OXP A;  4GLX A;  4LF4 L;  1JMC A;  1H95 A;  3ER0 A;  3PO3 G;  3E9I A;  5GAE C;  4QGU A;  2UU9 Q;  5IYD H;  1N36 Q;  4LF7 Q;  4X64 Q;  1SR3 A;  4JOI C;  5AJ3 L;  5HY6 A;  5GAD C;  2NVY H;  1MJC A;  3KLW A;  4OON A;  1K73 C;  4DNI A;  5LMN W;  3RN5 A;  1SFO H;  1RL2 A;  3GTL H;  1BKB A;  4WJ3 M;  3H0G H;  1WYD A;  2UU9 L;  1K3R A;  1HZA A;  2NN6 I;  2HHH Q;  3A5Z B;  4OWX B;  3U58 A;  4X64 L;  4PMW A;  4DV5 Q;  1N36 L;  4LF7 L;  2JE6 I;  4C3H H;  5GAG C;  1VQP A;  2MO1 A;  1TXY A;  1PH5 A;  1X3F A;  1VQF A;  1VQJ A;  1L1O B;  5LMN Q;  4R4T A;  1S40 A;  1HNW Q;  3CPW A;  1M90 C;  2IX1 A;  4P71 A;  4A4I A;  5LMU Q;  1L2F A;  3FP9 A;  2BA1 A;  3UE1 A;  4DV5 L;  4HJ5 A;  1S3O A;  4XTC S;  2JA8 H;  3HKZ E;  3CME A;  1Q1B A;  1YIT A;  3K8A A;  1VQD A;  3K80 C;  2WB1 G;  5LMN L;  3S1M H;  1HNW L;  4AQY Q;  1HH2 P;  4AH6 A;  2ZJR A;  3GTQ H;  3D31 A;  1L1O C;  4JI2 L;  5LMU L;  3H3V H;  3I4O A;  1JJC B;  1WJJ A;  3ULL A;  5EAY A;  4DR6 Q;  3CCM A;  1Y1W G;  1KQS A;  1GM5 A;  1A63 A;  1SLJ A;  2ZTC A;  2ZJP A;  1CKM A;  4AQY L;  3STB D;  1EWI A;  4QY7 A;  4DR6 L;  3PO3 H;  1VQL A;  2UXB Q;  4AIM A;  3DLL A;  4ME3 A;  3K81 C;  5M3F G;  3A0J A;  2RF4 A;  4JBJ A;  1PVO A;  3SGI A;  3ULP A;  3CC2 A;  3G48 A;  1FJG Q;  1QZH A;  4LFB Q;  2UXB L;  5JJK A;  1YVC A;  4IOC A;  4R4O A;  3M7N A;  4JCV E;  4RMF A;  1X3G A;  5JEA G;  4A3G G;  1VQ9 A;  1GD7 A;  1YEZ A;  2UUC Q;  1CSP A;  5M5Y H;  1W3S A;  1WCM G;  1QVF A;  3UDF A;  2PQA A;  1FJG L;  4LFB L;  1VQC A;  4IFD J;  1V43 A;  1FGU A;  1NMG A;  3F8T A;  2N78 A;  4PZ8 A;  4DR4 Q;  4BXX G;  5C4X G;  1X56 A;  2AHO B;  4JBW A;  2CQO A;  4IPC A;  3F2B A;  4FDB A;  4DR1 Q;  1VQ7 A;  2UUC L;  3FKI H;  5IYB H;  2E5L L;  1TWA H;  4GOP A;  4JYA Q;  4A3M G;  2NVX H;  2A8V A;  5C0X G;  1HZC A;  2C35 B;  1OTC A;  4JBK A;  4DR4 L;  3PCO B;  1Y1W H;  2VUM H;  3OYY A;  3TQY A;  2HQL A;  2JEB I;  4JI1 Q;  2YTY A;  2YTV A;  2ID0 A;  4J15 A;  1Q7Y C;  4JYA L;  1WFQ A;  3HFZ B;  1OXS C;  3PO2 G;  1KL9 A;  2BH8 A;  4X66 L;  3NEM A;  3S1Q H;  4A3F G;  3J7Z C;  4LF9 Q;  5C3E G;  1P16 A;  4JI1 L;  3TS0 A;  5M3F H;  2ZTE A;  2R93 G;  2F3I A;  3CD6 A;  2KBN A;  1UE7 A;  3U4V A;  1K8A C;  2D0P A;  4LF9 L;  4R4I A;  3K0X A;  4LFC Q;  4AYB G;  4A3B G;  4A3G H;  2MNA A;  2B63 G;  3KDF B;  3UDI A;  3M4Q A;  1B7Y B;  1PHJ A;  2OWO A;  3A74 A;  4JI8 Q;  4L5Q A;  1CKO A;  1U0L A;  5C0X I;  1MJE A;  4BXX H;  5C4X H;  1E3P A;  4IPD A;  2Q2I A;  1YJW A;  3HOV G;  1L1O A;  1HR0 W;  3CMA A;  2IT1 A;  2Z6K A;  1PH9 A;  2EQS A;  4JI8 L;  2N8N A;  3HOZ G;  3ICE A;  2YU9 H;  2VQE Q;  3I4M H;  4NXM Q;  1L0W A;  3GDE A;  1Q86 C;  1ASY A;  2F52 A;  2NVQ H;  3NBH B;  1VQO A;  3M4P A;  1K83 H;  1K0R A;  3I2Z A;  1HR0 Q;  2VQE L;  1EIY B;  2Y0S G;  4LNQ A;  4HJA A;  1A8V A;  2QA4 A;  1KIX A;  1JJ2 A;  4NXM L;  4IO9 A;  4X6A H;  2OQ0 A;  1AE2 A;  2Q2T A;  4A3F H;  5JJI A;  5C3E H;  2BA0 A;  3JAM i;  2V1C C;  2MFI A;  1XNQ Q;  1HNZ Q;  4JC0 A;  1EQR A;  4A3K H;  1HR0 L;  2I0Q A;  2CFM A;  4LF8 Q;  4TQU S;  4BBR G;  1Y14 B; 
#chains in the Genus database with same CATH topology
 3HOW G;  2F3V A;  4A3B H;  4DR3 Q;  1EU3 A;  2WAQ G;  4LF8 L;  2EJG C;  2WB1 B;  1KDC A;  3S1N H;  1EFW A;  3CCQ A;  4ULL A;  2JQO A;  3GTM H;  1LTR D;  4M8A A;  1JWM D;  1IW7 C;  5FKA C;  3RUZ A;  3J80 E;  2G9D A;  4DV6 L;  5I6W A;  4LF5 Q;  5GAH C;  1A2U A;  1XYI A;  3STB C;  1DOK A;  4DXF A;  4DV1 Q;  2F0U A;  1H9M A;  2DGY A;  2NN6 H;  1TWC B;  2VNU D;  2K01 A;  4CKC A;  2E2J H;  4A3G B;  2WB1 E;  5IWA L;  2UXD Q;  1XPU A;  5JJL A;  4DR5 Q;  4OEM B;  2IX3 A;  3CCV A;  1NCV A;  4JI6 Q;  1KAA A;  3MXG A;  1AH9 A;  4YHH L;  2J4X A;  3AFP A;  4QUF A;  5IGE A;  5C4J H;  3C46 A;  1AE3 A;  1ICF B;  2QDB A;  3KDF A;  4DAP A;  4GNX C;  1LO5 D;  1CZW A;  2QDL A;  4HED A;  1HQM C;  1KXL A;  2F0N A;  2B2Y A;  3NQT A;  1O78 A;  1VCI A;  1F2L A;  4A3F B;  2FJ2 A;  3MXN B;  1VQ4 A;  2AQ3 B;  4KY5 A;  4GLA C;  4OIJ A;  1WTV A;  2PNH A;  4LF6 L;  3E0E A;  4TVA B;  2B63 B;  2H4O A;  2ICI A;  5FOB B;  1GUN A;  1EY4 A;  4DK3 C;  5HGQ A;  1YNX A;  1A3U A;  3DUZ A;  4DR1 L;  4B3M L;  1LT3 D;  4JV5 Q;  4YY3 Q;  2IHF A;  5J22 A;  2KUM A;  3NK9 A;  1PFB A;  3CCU A;  1KAW A;  1PRT B;  1TY2 A;  2Q8T A;  4ALP A;  1YZ6 A;  4C3J B;  3OTO L;  4JI5 L;  3D3R A;  2F3W A;  3PV0 A;  3S1R B;  2JA5 G;  1D8L A;  1ENA A;  1TWC H;  4LWC A;  3NE5 B;  1DON A;  2YYZ A;  3QR8 A;  3M3Y B;  4BBR B;  4TKO B;  1STH A;  2B8F A;  1K8O A;  4ILW A;  1XPR A;  4WJ4 A;  1LT6 D;  1LLR D;  2C5C A;  2E8G A;  1I94 L;  1Q82 C;  1DXM A;  3VR2 A;  4EGV A;  1DGS A;  3JAM c;  2IY5 B;  1CT1 D;  5C0X J;  1BBW A;  2R3Z A;  3SVM A;  1Q8K A;  1BDO A;  3R2I A;  5JPN C;  1JE5 A;  2AKW B;  1K9M C;  1PXU A;  1IKM A;  1KRS A;  3ONA B;  4RH6 A;  2R92 B;  3G6J B;  2FIN B;  2HQE A;  4RGO S;  1KRT A;  2RCF A;  1SEB D;  5IYD G;  2N55 A;  1SYF A;  4FP5 D;  2JA5 H;  2A68 D;  1CKN A;  4LFA Q;  1B4O A;  4WOR A;  2B63 H;  3T1H Q;  1BBU A;  2M00 A;  4HIO A;  4DUY Q;  4J8Q A;  5IY0 A;  1QNK A;  3KF6 A;  3D4W A;  2LMC B;  1Z9F A;  2MUY A;  3MZ5 A;  4NP5 A;  1HA5 A;  4OHJ A;  2K14 A;  2O5J C;  3CHB D;  1MGS A;  1NTG A;  4G7Z C;  4C3J H;  4KY7 A;  1FD7 D;  1CQF A;  3CQZ B;  4DV0 L;  1GUW A;  3RNU A;  3R8B A;  2ASB A;  2Q2U A;  3M3Y H;  4BBR H;  1STE A;  4DV1 L;  3S24 A;  3GTG B;  4R4Q A;  3K0Y A;  2UXD L;  3TZU A;  2E75 C;  1JOQ A;  2JK8 A;  4DR5 L;  1JJG A;  1NR4 A;  1H9S A;  1AP0 A;  1U4L A;  1E2Z A;  4PZ7 A;  3E0J A;  5CC4 A;  4H44 C;  2EXZ A;  2XRQ D;  1MKH A;  5CV9 A;  2F4V L;  3HS0 C;  1EIG A;  1TS5 A;  1SMY D;  2F0T A;  4IUV A;  5IGG A;  1PH2 A;  4K5W A;  4NXN Q;  2R92 H;  3W5O A;  1NUC A;  3NP8 A;  3J81 j;  1M4V A;  1UWV A;  1X6O A;  2VUM G;  2KEN A;  5EKK A;  1IL2 A;  1C7Y A;  3GTJ B;  4B3S L;  3DEP A;  4LAA A;  2PI2 A;  1IBK Q;  1JCK B;  1N34 L;  2RCN A;  3HOY B;  4A93 B;  1SN8 A;  2HDM A;  4DK0 A;  4B9W A;  2QCP X;  1B3Q A;  3K5M A;  3HOU B;  1D2B A;  3ERS X;  3BVG A;  1J6Q A;  3S2D B;  4DV2 L;  1VMP A;  2K5H A;  1DCZ A;  2EXD A;  4HIM A;  1VQK A;  1A6X A;  1TWF B;  1ZKO A;  1GHJ A;  2JXM B;  4HIK A;  2MHV A;  3GTO B;  5IYC H;  1F9S A;  1I3Q H;  4YIJ A;  4WFN 3;  3P75 A;  4X66 Q;  2YV5 A;  5JEA J;  2F0E A;  3AEV A;  1QNU A;  1ZYR D;  2N49 A;  3M7G A;  3SE0 A;  3GTL B;  3CCL A;  3GTG H;  4IQZ A;  1IYV A;  1RHP A;  5L37 A;  5BR8 L;  3RLO A;  3NSW A;  3NQI A;  1N33 L;  2VB3 X;  1QIL A;  3T56 B;  3DM3 A;  4GNX A;  3F2D A;  4GN3 B;  4NW2 A;  4A3E G;  4MNO A;  4GKJ L;  3K7A B;  2RVL A;  4H0L C;  4UAI A;  1CK1 A;  1V1P A;  3OWE B;  4HID A;  4OWW B;  4ZQ3 A;  1A62 A;  4DKA C;  4RCN A;  1RCV D;  1WTH A;  4X62 Q;  1UAP A;  2B2W C;  4JI7 L;  4DV7 L;  4K5X A;  1KD1 C;  2K5V A;  3J80 i;  5LHY 1;  4FNF A;  3FRP B;  1PRT D;  1GUO A;  2I5L X;  3SDZ A;  5DM6 3;  1XMO Q;  1N8R C;  4B3T Q;  3V2T A;  4OIK A;  3HOY H;  4A3L H;  1DOL A;  1PDQ A;  2JJQ A;  4BY1 B;  2UXC Q;  1LYL A;  4RGT A;  4DUY L;  2J7Z A;  4GN5 A;  4ODG A;  1HFN A;  2JA8 G;  2I5H A;  1JOK A;  1JQY D;  4PMB A;  3S2D H;  1EY0 A;  5IOC A;  2ZM6 Q;  2OQK A;  2EYL A;  2EY1 A;  5KYL A;  4A3E H;  1E1O A;  1N9W A;  1C0A A;  1TWF H;  1HUN A;  3Q22 A;  3VYS A;  3HEJ A;  1JMC A;  1KDB A;  1G8Z D;  4JOI C;  5AJ3 L;  3KLW A;  3GTL H;  2I07 B;  3H09 A;  3NBI A;  4WRD A;  3IL8 A;  2FFK B;  1K3R A;  2HHH Q;  3A5Z B;  1N36 L;  4LF7 L;  2BE5 C;  3DM1 A;  1VQP A;  2CW0 D;  5I6Y A;  3MFG A;  1VQF A;  4JPB W;  1HNW Q;  5LMN Q;  1M90 C;  4P71 A;  3FP9 A;  4HJ5 A;  4XTC S;  2JA8 H;  1B9M A;  1Q1B A;  1VQD A;  4Y7N B;  3S1M H;  4AQY Q;  2IWH A;  2ZJR A;  4XT1 B;  1I4R A;  3J7Y W;  4C56 C;  3CCM A;  4ZYS A;  3U9S A;  1SBB B;  2ZJP A;  1CKM A;  1EWI A;  3VR6 A;  1VQL A;  4NDX A;  3WDN A;  3DLL A;  4ME3 A;  3S15 H;  1SNO A;  5M3F G;  3A0J A;  2RF4 A;  4FF1 A;  1FNW A;  2O2L D;  3J81 E;  5JJK A;  2K03 A;  1YVC A;  2QEJ C;  1VQ9 A;  1GD7 A;  1WCM G;  2PQA A;  1FGU A;  2Z4H A;  4UDU C;  3L9A X;  5D65 A;  1S5D D;  4JBW A;  3F2B A;  4IPC A;  2UUC L;  5IYB H;  5G3L D;  1TWA H;  4G7O C;  3T51 B;  5C0X G;  2C35 B;  4DR4 L;  3C2P A;  2KA7 A;  1WD1 A;  1Y69 U;  3DXJ C;  2JEB I;  4JI1 Q;  2ID0 A;  1WFQ A;  1OXS C;  1LTB D;  4X66 L;  3MXU A;  3J7Z C;  4LF9 Q;  4XQQ A;  2JA6 B;  3TS0 A;  1QCB D;  5M3F H;  2ZTE A;  2KBN A;  5C3W A;  2TSS A;  3TP7 A;  5I4D A;  4LFC Q;  3A55 A;  3E5S A;  3KDF B;  3UDI A;  5E4X A;  1B3A A;  1PHJ A;  3AB9 A;  2BOS A;  1STA A;  3FVQ A;  5C0X I;  1MJE A;  3H94 A;  2B2T A;  1JOR A;  2Q2I A;  4KKU A;  1BCP B;  1SE4 A;  1SYC A;  2EQS A;  1HXY D;  5C0X H;  2NVQ H;  3M4P A;  2DJG C;  1HR0 Q;  1EIY B;  1B9N A;  4BS9 A;  1A8V A;  2KCN A;  2L11 A;  2DJF C;  4DGZ A;  4HJA A;  4IO9 A;  4X6A H;  2Q2T A;  4XT3 B;  4JC0 A;  1EQR A;  1YNJ C;  3W2D A;  2FHT A;  4XQJ A;  5D14 A;  4LF8 Q;  3V05 A;  1F2M A;  1VMC A;  5IP7 H;  3VDY A;  4E6I A;  1Q81 C;  4BA1 I;  4A76 A;  5TSS A;  3I72 A;  3T4A C;  2XSC A;  3V96 A;  3KLS X;  3NXW A;  4DV6 Q;  2EY6 A;  1Y1W B;  2XIW A;  1VQM A;  4OO1 H;  4HN7 A;  1E2V A;  1GUT A;  2WFW A;  4XDX A;  1X3E A;  3S1Q B;  5DNF A;  3BVM A;  2JA6 H;  2PYK A;  5IWA Q;  3EIV A;  4BBS G;  2HHH L;  3SK8 A;  5CV8 A;  4YHH Q;  3OW7 A;  2I46 A;  1SYG A;  2V4D A;  2EJF C;  2K04 A;  1PH4 A;  1ONL A;  2D9U A;  5C4X B;  1PMR A;  4RG1 A;  1N32 L;  3RZO B;  1YHQ A;  3P7J A;  1S72 A;  3I70 A;  1LTI D;  4R4C A;  2Z1C A;  5A2Q E;  2E76 C;  5DM7 3;  1CKN B;  4LF6 Q;  1I4P A;  2HCI A;  4H02 A;  2B8G A;  1TT2 A;  3L2P A;  2BDN A;  5GRO A;  1IZ6 A;  4FXK C;  3KF6 B;  3DWA A;  3O13 A;  3G71 A;  3TDQ A;  2LFN A;  1NE3 A;  1T5E A;  1JT8 A;  4AYB B;  5H1S E;  3PIO 3;  2EPB A;  4A3B B;  2F0S A;  4B3M Q;  3A56 A;  4R8N A;  1SNC A;  2M2L A;  3ZYY X;  3R2T A;  3HOX G;  1VQN A;  3S16 B;  1QVG A;  4JG2 A;  2D62 A;  3B6Y A;  3QG1 A;  5HGT A;  3PMF A;  3QOL A;  4MTN A;  2RQX A;  3HOZ B;  2JA7 G;  3L0O A;  1VQ8 A;  3VR3 A;  3OTO Q;  4JI5 Q;  1O7Z A;  1WOC A;  3D0F A;  4JOI A;  4LK1 C;  3K59 A;  3ERO A;  4PV1 C;  1ILP A;  5ELF A;  3W3A A;  5LL6 X;  2A69 C;  1JWU D;  3TBI B;  5K5P A;  5T1G A;  1KHI A;  4AYB E;  5IE8 A;  4J1M A;  4FO2 A;  3F2U A;  1FNV A;  2NZO A;  5GQO A;  4KKT A;  5CGK A;  3Q23 A;  5JEA H;  1D5M C;  2E2J B;  1H9S B;  5KYI A;  1I94 Q;  4X3T A;  3LGJ A;  4O1N A;  3HOW B;  2F0D A;  4LFC L;  1GXD C;  3RZO H;  3E9H A;  2WAQ B;  1PYB A;  3A54 A;  1S5E D;  3K58 A;  5C4J B;  5BN3 A;  4L5S A;  1U4R A;  1CHQ D;  5C44 G;  3ERQ A;  2N88 A;  4JI0 L;  4DAM A;  2F0V A;  3WOF A;  4TRD A;  3QJY A;  4UY8 C;  1PZJ D;  5EPL A;  1X65 A;  2L5T A;  1YHB A;  3DHQ A;  4CBV A;  1PZK D;  3PUX A;  4DNR B;  1M1K C;  2I5M X;  4G57 A;  3G4S A;  5T1I A;  1JIC A;  4L5R C;  2WAQ E;  1BVS A;  1VQG A;  4L8J A;  5EKI A;  4IUP A;  3H3V C;  3H0G G;  1T9H A;  4UP7 A;  3GTK B;  2N3S A;  4XIG S;  1KC8 C;  4KLK A;  4N8X 1;  2XGT A;  2R61 A;  4P2C B;  2VS1 A;  4U68 A;  1SND A;  4C3H G;  3S16 H;  3RLN A;  5J3B A;  2VQF L;  2FXQ A;  3HOZ H;  2F03 A;  1MSH A;  1TWH B;  2K50 A;  2NTS A;  4DV0 Q;  2KCT A;  4ABN A;  2NVT B;  2PI2 E;  3URY A;  5CBE E;  2PZU A;  2XWB B;  3TZD A;  1G6P A;  4FF4 A;  5KEE A;  1LTT D;  4GOP C;  1UEB A;  4POG A;  1BCP D;  5DLQ E;  1E22 A;  4KD3 A;  3TRZ A;  4RWS C;  5M5W B;  3UE0 A;  1L0X B;  2F0L A;  2OCE A;  3J7A V;  1PYW D;  4C3I G;  1PH8 A;  1BXT A;  1KNA A;  4LUZ A;  1BO0 A;  4YWL A;  4X65 L;  5BN4 A;  4GNX B;  3HOW H;  3KFU A;  4LW1 A;  1VQI A;  1GUG A;  4KKS A;  1K28 A;  3J81 i;  4DUZ L;  2OTJ A;  5EJW A;  1CI3 M;  1CSQ A;  5JPM C;  2BCO A;  2F4V Q;  1QUQ A;  3TN2 A;  1V1P B;  2QF7 A;  4HTH A;  4FVM A;  3M4O H;  5M9O A;  3ITP A;  4FF2 A;  1B53 A;  1UUP A;  1I4Q A;  4I7Z C;  4N9P A;  3CCR A;  3H3V I;  4P73 A;  4GN4 B;  1SNP A;  2OTL A;  3GP7 A;  4NKL A;  2KEE A;  3D4D A;  1B70 B;  1SAP A;  4GS3 A;  3I56 A;  1MHW C;  1P8L A;  2KCM A;  4B3S Q;  4DAY A;  1IBL L;  3A8K E;  1CUK A;  1NAP A;  2JA5 B;  2NZ1 D;  4IZ8 A;  1N34 Q;  2A1A A;  4C3I H;  5COR A;  2NUC A;  3GTK H;  3K5O A;  1WTW A;  5CV5 A;  4HSP A;  3OSO A;  3NTI A;  1ESF A;  3PUW A;  1S4Z A;  4B3R L;  1SRO A;  3I91 A;  4H7B A;  5DAU A;  5M5X H;  4DV2 Q;  1BUV T;  1X54 A;  1TWH H;  2NVT H;  1VQB A;  2E5L Q;  1EYG A;  3AFQ A;  1XTC D;  2Z0S A;  3NHH A;  3BU2 A;  4X3K A;  3FHW A;  5KNC A;  3QO2 A;  2SOB A;  5ELD A;  2Q8I B;  4F88 A;  1D7Q A;  3CKI B;  1F2Y A;  3MFY A;  5M5W H;  3NWS A;  1QZG A;  3U9O A;  5JOB A;  4TSS A;  3PSI A;  5BR8 Q;  1HTL D;  2Q2H A;  1N33 Q;  4KV6 A;  4HJ8 A;  4UP8 A;  3KYH C;  2PCF B;  2HIX A;  4DR7 L;  1OO9 B;  3I7F A;  1PTO F;  1O80 A;  3FEW X;  4GKJ Q;  3RLF A;  5I9P A;  3A5U A;  1ICW A;  2PZT A;  2RSO A;  3CPF A;  5NUC A;  1VF5 C;  4JK1 C;  3CAM A;  2G9H D;  2MO0 A;  3C1F A;  4ZLT F;  1EQV A;  1QVC A;  3UDX A;  1TII D;  3GTQ B;  4JI7 Q;  2VY3 A;  4DV7 Q;  1D1I A;  4EQ5 A;  1FYC A;  3GV6 A;  3M85 A;  2K4K A;  1IYJ B;  2PQA B;  2ZXP A;  1X55 A;  2F0M A;  2IL8 A;  4IJH A;  2XVS A;  2HDL A;  1I4H A;  2KED A;  2EE1 A;  1X9N A;  4HJ7 A;  4Y52 H;  2X6L A;  1CZG A;  3IFD A;  4L5T A;  1AZQ A;  4HMI A;  2JEA I;  1A3V A;  1DOM A;  1I4X A;  3F1Z A;  3PGZ A;  2F0W A;  5IGC A;  1A0I A;  4OX9 L;  1LTA D;  3HKS A;  1BNZ A;  4FF3 A;  1EOT A;  1S5C D;  2B2V C;  4IN3 A;  3JAM L;  5AJ3 Q;  4C1N K;  4GLX A;  2NVX B;  1I3Q B;  3ER0 A;  4B08 A;  3N6R A;  1EEI D;  4QGU A;  5IYD H;  1WTP A;  1EY5 A;  1A3T A;  1N36 Q;  4LF7 Q;  2VUM B;  1FR3 A;  1SR3 A;  4X3S A;  1MJC A;  2DY8 A;  1BKB A;  4WJ3 M;  2UU9 L;  1F9Q A;  1CA6 A;  3U58 A;  2JE6 I;  5GAG C;  5I2X A;  1TXY A;  1ZXT A;  1KLG D;  3NPP A;  2WKC A;  4KTA A;  4DV5 L;  2KCC A;  1L2F A;  3UE1 A;  1IW7 D;  3CME A;  1DYQ A;  1YIT A;  2RSN A;  2K28 A;  3K80 C;  4IUT A;  2B2T C;  2JP1 A;  4AH6 A;  3GTQ H;  1AN8 A;  5LMU L;  3MC0 B;  1WJJ A;  4LMQ D;  1KQS A;  1GM5 A;  1KLU D;  3SR1 A;  2K05 A;  1PTO C;  2SDF A;  1Y8O B;  2ZTC A;  3STB D;  4QY7 A;  4DR6 L;  5JVG 3;  2K5Q A;  2HD3 A;  3ULP A;  3G48 A;  2UXB L;  1RTN A;  1U9R A;  4I7A A;  4QCL A;  3ND8 A;  4JCV E;  3LWU A;  4PNY A;  4K2K A;  2UUC Q;  2L55 A;  1W3S A;  1D1K A;  3OHX C;  1BOS A;  4LFB L;  5ELC A;  2N78 A;  4DR4 Q;  3C3L A;  4A3E B;  4JVZ A;  1ENC A;  2CQO A;  3CRL C;  2E5L L;  4GOP A;  5C5L A;  2ZXO A;  1SJE D;  4A3M G;  2NVX H;  2A8V A;  2FMM A;  2E2H B;  2VUM H;  3OYY A;  2HQL A;  2YTY A;  5FO9 B;  1Q7Y C;  4JYA L;  3P1H A;  3PO2 G;  2BH8 A;  1Q3L A;  4KMU C;  3SK4 A;  5C3E G;  2OEO A;  1C8C A;  2R93 G;  2EYJ A;  4HCS A;  5J1Z A;  4R8I A;  3T16 A;  1RDP D;  1KNE A;  4R4I A;  3K0X A;  1PTO H;  1KDA A;  2JA8 B;  4K8I A;  3M4Q A;  1B7Y B;  2WIN B;  3S1M B;  1B50 A;  1E3P A;  3HOV G;  3S17 B;  1L1O A;  3CMA A;  2H1E A;  1B44 D;  2Z4I A;  1L0W A;  1VDZ A;  2F52 A;  1R9T B;  1VQO A;  1X32 A;  1LTG D;  4K2L A;  3I2Z A;  1K0R A;  4J6H A;  1IL8 A;  2Y0S G;  2QA4 A;  5IOD A;  4NXM L;  2OQ0 A;  4MHE A;  5C3E H;  2I0Q A;  4TQU S;  1Y14 B;  4I65 A;  1PH6 A;  1XNQ L;  2PZW A;  5EQ0 A;  4MZ9 A;  5KNB A;  2XN9 C;  2WV6 D;  3DWP A;  2A6H D;  1TWA B;  2VZA A;  4JI3 L;  2YTX A;  4NB3 A;  3HOV H;  2H5X A;  2G5D A;  2X69 A;  2CQA A;  3CP0 A;  2E2H H;  5JVH 3;  2QIL A;  4ZKB B;  3EBE A;  5IP9 G;  1BF4 A;  1S5B D;  5KIX A;  1B2T A;  1C9O A;  2K5W A;  2RA4 A;  1NY4 A;  1Q12 A;  1I6H B;  3ULJ A;  4A3D G;  2UUA L;  1SNM A;  5M3M G;  3GQB A;  1JR0 D;  4H13 C;  2K1B A;  5M3F B;  5A35 A;  2WP8 J;  4A3I G;  3JAM E;  2Q8R E;  5IT9 c;  1R4P B;  1XNR L;  2TMP A;  3KUP A;  1N32 Q;  1WCM B;  3A8I E;  3AU7 A;  3VA7 A;  1V1Q A;  2KOL A;  3S17 H;  2AWN A;  4QMG A;  1WI5 A;  2FMC A;  4IFD G;  3C1E A;  3PUZ A;  2NVQ B;  3OIQ A;  4A3J G;  1QG7 A;  1R9T H;  3HZX A;  2IX0 A;  4K6D A;  1O7I A;  5IP9 H;  4IJL A;  4P72 A;  3KK7 A;  1B8A A;  2PW7 A;  1I6V C;  2CWP A;  5COY A;  2PMZ B;  3IKJ A;  4NPS A;  3OMG A;  5FLX c;  2GVA A;  1XWE A;  1XXG A;  3NTK A;  3NBH A;  1CHP D;  1ML0 D;  4HSV A;  2HUG A;  2J0T D;  3CCJ A;  4RHS A;  2NYZ D;  2CWA A;  1Y1V G;  3NTH A;  1XMQ L;  3CRK C;  3Q8D A;  1JB3 A;  3GO5 A;  1Y8N B;  2X6G A;  1LT4 D;  2A6E C;  2B2V A;  4DV4 L;  4IFD I;  3I4N G;  4KHZ A;  2R6G A;  3W1B A;  1GO3 E;  3I8Z A;  3AQQ A;  5D3I B;  5FLM G;  4POF A;  4BY7 G;  2RHS B;  3F2C A;  2PMZ E;  1K3B C;  3PIP 3;  3MVV A;  3GTP H;  5C3X A;  1I6H H;  4ZKC B;  4LJZ C;  1U4M A;  4HR7 B;  1EUJ A;  1GHK A;  4NMZ A;  3SHL A;  2F4I A;  3RD4 A;  4Q5V A;  1E1T A;  1QUQ B;  4N9T A;  3NWT A;  1WCM H;  4QUC A;  3J80 c;  1Y1V H;  4PQX A;  4QQB X;  1HUM A;  4JI0 Q;  5FLX L;  5JJI A;  2QEX A;  4PMC A;  3VR4 A;  2R7Z G;  2L4N A;  3EQL C;  3I4N H;  1V9P A;  1RKN A;  2LKV A;  1G51 A;  2ES2 A;  2R7F A;  4DAY B;  4BWG B;  4KJO A;  1W2B A;  4GZY C;  3VA5 A;  2CH4 W;  5EBC A;  1TU2 B;  1EY9 A;  1QB5 D;  2K75 A;  3MAQ A;  5CMD A;  3HRZ C;  4BBS B;  3T1Y L;  1Q90 A;  3I4L A;  1NSN S;  1ESR A;  2PQE A;  2VQF Q;  4IUR A;  1Q46 A;  4F8M A;  2EVB A;  2L15 A;  2EYH A;  2C9O A;  4OEL B;  1SJH D;  3J80 L;  4L6T B;  1YJN A;  1VF7 A;  1NBW A;  1TS3 A;  2L12 A;  1LV9 A;  1DZ1 A;  1FNU A;  4LUO A;  4KD4 A;  5CBA E;  2RDF A;  4GKK L;  5D3D A;  2MGS A;  4A75 A;  1ZEQ X;  4X65 Q;  3QWN A;  2QGQ A;  1U5K A;  1E2W A;  4OL7 A;  4DU9 A;  4APV A;  1PLF A;  3S2H H;  4KHP L;  4DUZ Q;  4RFB A;  1IHZ A;  4JI4 L;  1G29 1;  2JA9 A;  3R93 A;  1FGB D;  4KJN A;  3HOX B;  2KHI A;  4BA2 I;  1GKH A;  3T53 B;  1OXU A;  5I2Y A;  1DD2 A;  4DK1 A;  4F87 A;  3ZJY C;  2JA7 B;  1YIJ A;  4JI2 Q;  3NEL A;  1J5E L;  3M4Y A;  2K32 A;  1SYD A;  1YNN D;  3FKI G;  1IBL Q;  5K36 G;  1AW7 A;  1K8G A;  3HKZ G;  5CV6 A;  1EQQ A;  2SNS A;  2CKZ B;  2Z6K C;  1F2Z A;  1BBX C;  1EWC A;  4BBS H;  2L1B A;  2BE5 D;  1MSG A;  1PH1 A;  1LTS D;  5FJ8 G;  1HQR D;  4B3R Q;  4K8J A;  1I4G A;  2ZTD A;  2O4X A;  2NTT A;  2KQ3 A;  5CV4 A;  4V19 0;  5E1F A;  1AEX A;  3QOJ A;  2F0O A;  1EU4 A;  1PV4 A;  3NUC A;  4C2M B;  1E7Z A;  5C44 B;  1QJO A;  4O42 A;  4RKB A;  4PZ6 A;  4B9X A;  2CCZ A;  1XPO A;  2DUD A;  2EY2 A;  2OF1 A;  1DM0 B;  5CYU A;  1AZP A;  1X3Q A;  3K5L A;  3S9W A;  4KN4 C;  3Q24 A;  1HTP A;  1LTL A;  5EPJ A;  1LAC A;  2UUB L;  3I4M G;  2F1M A;  4DAV A;  3W1G A;  2EY5 A;  2DN8 A;  5EBD A;  4DR7 Q;  5FJ8 H;  3TS2 A;  3TSS A;  4RKL A;  3VR5 A;  3H0G B;  1HZ9 A;  4K0K L;  1MBY A;  1F9P A;  3TP5 A;  5JAV A;  3LWE A;  3MEF A;  3HOX H;  4C3H B;  2AQ1 B;  3TRE A;  4CDC C;  4A3K G;  1YJ9 A;  2A68 C;  3TME A;  3J7A 5;  3UI2 A;  3M4O B;  1EIF A;  1Y8P B;  1D6E C;  3BZK A;  4C1N I;  2JA7 H;  1IBM L;  3PIO A;  2WII B;  3RR5 A;  3I73 A;  1NNX A;  2RBM A;  1Z47 A;  1SRU A;  4IAL A;  2D0O A;  1HNX L;  4C3I B;  2LY7 A;  1O7L A;  1SYE A;  1STN A;  2MJ8 A;  2ZT9 C;  4QJF A;  4CHT B;  3P20 A;  2EZV A;  1S5F D;  3AMU A;  3KF8 A;  3MTS A;  5M5X B;  1LUZ A;  2NN6 G;  4GOP B;  2F0Q A;  3MA2 B;  4C2M H;  1G2S A;  4OX9 Q;  4DV3 Q;  5C44 H;  5M5Y B;  2A74 C;  3BYT B;  2GN5 A;  5I9O A;  5E4W C;  1F9R A;  3CF5 A;  4QF4 A;  3MXP A;  2R7D A;  1VQ5 A;  3A8J E;  3K57 A;  4LF4 L;  3PO3 G;  3E9I A;  1PRT F;  5GAE C;  2M9V A;  2UU9 Q;  1YNJ D;  1SMY C;  5HY6 A;  4OON A;  2L0C A;  5LMN W;  1J9O A;  3H0G H;  1BQQ T;  1HZA A;  2NN6 I;  4OWX B;  4X64 L;  1NR2 A;  1W6J A;  4DV5 Q;  2A5H A;  4C3H H;  3D6W A;  2MO1 A;  1SDF A;  1X3F A;  1L1O B;  1W6K A;  3L3O C;  4A4I A;  5LMU Q;  2LS0 1;  1AFP A;  3K8A A;  2PNR C;  2WB1 G;  1J8I A;  1HH2 P;  3H3V H;  3D31 A;  1L1O C;  4JI2 L;  1II3 A;  4DR6 Q;  1JJC B;  3DMU A;  2WKD A;  1A63 A;  1Z6H A;  2YU9 B;  3SXH A;  3PO3 H;  1TS4 A;  2NB0 A;  2UXB Q;  4AIM A;  2NWG A;  2XRS D;  4JBJ A;  1C48 A;  1PVO A;  3SGI A;  4Q0F A;  4LFB Q;  1QZH A;  5AFW A;  3M7N A;  3EA6 A;  4RMF A;  4A3G G;  1ZYR C;  5M5Y H;  1QVF A;  1T5X D;  2CH4 A;  4M1U B;  1FJG L;  4IFD J;  1V43 A;  1NMG A;  2CVR A;  2KJX A;  2IJ0 A;  1VQ7 A;  4FDB A;  2F0J A;  2E74 C;  5DEH A;  4JYA Q;  4JBK A;  3PCO B;  2EYM A;  2PW5 A;  3SK6 A;  3D4R A;  5KGU A;  2MP1 A;  3OPO A;  3X3N A;  1M8A A;  3NEM A;  4X3U A;  2K5D A;  4A3F G;  4IUN A;  5EPK A;  4DF7 A;  3CD6 A;  1UE7 A;  1WTQ A;  1K8A C;  1PRT C;  1X3P A;  2K33 A;  4A3G H;  2B63 G;  4CKE A;  5G3L F;  2OWO A;  4OGQ C;  5C4H A;  1YJW A;  1HR0 W;  2IT1 A;  5CR3 A;  2Z6K A;  1PH9 A;  3ICE A;  2A69 D;  4JI8 L;  2YU9 H;  1TWG B;  4CJ2 C;  1Q8I A;  4NXM Q;  3GDE A;  5EKL A;  3NBH B;  5EGT A;  2XWJ B;  2A6H C;  4LNQ A;  4C3J G;  2VQE L;  5J39 A;  1KIX A;  4A3F H;  4DNT B;  1RJT A;  5BN5 A;  1XNQ Q;  4DA2 A;  2CFM A;  4BBR G;  2ICE C;  4DN4 M;  1G6Z A;  2VB2 X;  4JI3 Q;  4ZUI A;  2VL6 A;  4K14 A;  1HNZ L;  4DV3 L;  3GD7 A;  1I50 B;  4ME5 A;  5F2D A;  2CW0 C;  2PPB C;  4P75 A;  3G7L A;  1EYD A;  3J81 c;  2K6A A;  5C4Z A;  4JBM A;  4DR3 L;  2UUA Q;  5FK9 C;  1UNS A;  3VYT A;  3K5N A;  3X3M A;  2ALY B;  4DFA A;  1TS2 A;  1XNR Q;  3EJI A;  1TKW B;  5HUR A;  2BDO A;  4RHR A;  5FO7 B;  2R92 G;  4EQP A;  1EWH A;  1IXR A;  4LF5 L;  5IGD A;  4R9W A;  3S1R H;  1PTO B;  3H15 A;  1VQ6 A;  1EL0 A;  4EQO A;  1EZ6 A;  4XQN A;  4ZK9 B;  1O7Y A;  3EN2 A;  4XXE A;  4F7X A;  2HCC A;  2ENB A;  4IOA A;  2XTI A;  1MIU A;  2DNC A;  1SXT A;  3EVQ A;  3IAY A;  3BDO A;  1WD0 A;  2E2I B;  1PA6 A;  4A3M B;  4PG3 A;  4JI6 L;  1TWG H;  4EQN A;  3A7A B;  1L0Y B;  2Z8L A;  3HP3 A;  2EOT A;  3TP8 A;  1SE2 A;  2HIV A;  1HA6 A;  3Q0A A;  3PF5 A;  3OWF A;  3J81 L;  3PO2 B;  1DJR D;  1STG A;  2D5D A;  1K8M A;  2P5Z X;  2CHB D;  3TEH B;  5C3E B;  1WVL A;  1XMQ Q;  5IYC G;  1ET6 A;  2R93 B;  2KHS A;  1OXX K;  4DV4 Q;  2K5N A;  1VQH A;  3SEB A;  1I5F A;  4DXG A;  4U67 3;  4DK6 C;  1ILQ A;  1I50 H;  4IPG A;  5JJZ A;  1HZB A;  4UP9 A;  4MN3 A;  3HOV B;  1E24 A;  1RIP A;  1NMF A;  3T13 A;  2ATW A;  1JWS D;  1UE1 A;  4QIW B;  3BJU A;  2KEC A;  4MIU A;  4DR2 Q;  2MQH A;  3CW2 C;  4JV5 L;  2LXK A;  4YCV A;  4YY3 L;  2Y0S B;  2RDH A;  3RZD B;  1BR9 A;  1D5X C;  3CU7 A;  1NJI C;  3CQZ H;  2RHQ B;  2LSS A;  3G6E A;  3FPU B;  4MTK A;  3E3X A;  1WTO A;  4R1J A;  3IFT A;  4O0A A;  3KBG A;  1HCZ A;  4LUV A;  1SE8 A;  3HOY G;  4A3L G;  1TVX A;  4A93 G;  3HOU G;  1C4Q A;  2E2I H;  4QIW E;  4A3M H;  1XX8 A;  5C6A A;  1LM0 A;  2GVB A;  1GOZ A;  2Y0S E;  1JOO A;  3UDG A;  2A19 A;  4UPA A;  1EY6 A;  3MHB A;  3PO2 H;  2F0P A;  3T1Y Q;  4A3D B;  5M3M B;  2IHE A;  1ASZ A;  1Q1E A;  2E2D C;  4ZRZ A;  4YWK A;  1GUS A;  3S15 B;  1ROD A;  3BVZ A;  4RCO A;  2R93 H;  4XYQ A;  3VYU A;  3WOE A;  4DPG A;  4A3I B;  1WTX A;  4RAU C;  4KK7 A;  4FXD A;  3OOC A;  2AMC B;  3BYY B;  1MD2 D;  4HAE A;  3KJO A;  3GTJ H;  3MXN A;  4KY6 A;  4HMJ A;  2AUK A;  2EYP A;  4LFA L;  4YWM A;  1PZI D;  1JE4 A;  5KRU A;  3T1H L;  4A93 H;  1SE3 A;  3HOU H;  5E7N A;  3KJP A;  2F0H A;  1A2T A;  4IPH A;  4GKK Q;  3CCE A;  2EYO A;  3GTP B;  1SNQ A;  1VQA A;  4ID6 A;  4A3J B;  2JYO A;  2B39 A;  5ELE A;  1QWY A;  4A3C G;  1SYB A;  5IGF A;  3RZD H;  4JW0 A;  4KHP Q;  3K7U C;  4UHV A;  4JI4 Q;  1PFN A;  3GTO H;  4KN7 C;  1YI2 A;  1CTM A;  4HJ9 A;  1YNN C;  1Y1V B;  3D6C A;  2B2U C;  3BG3 A;  3U50 C;  2BH2 A;  1STB A;  1WTR A;  4KHV A;  4BY1 G;  3M9B A;  1J5E Q;  4N8F A;  3CCS A;  2QKI C;  3I4N B;  3JC6 6;  5A2Q L;  2K7V A;  4BY7 B;  3BZC A;  3CXC A;  3WWV A;  2OXP A;  5ELN A;  1BCP F;  2XNA C;  3PUV A;  1TQO A;  2QW7 A;  2F0I A;  2KVM A;  3K7A H;  5M3M H;  4GLV B;  5IYB G;  2B29 A;  4A3D H;  3PF4 A;  4A3C H;  4FYD A;  1VS0 A;  3BZD B;  4IUU A;  3QB3 A;  3I55 A;  3I90 A;  4G4K A;  3KF8 B;  4A3I H;  3CC7 A;  3S14 B;  1HPC A;  4OWT B;  4NXN L;  2EIF A;  4CJ0 B;  1RD9 D;  1XTD A;  2IW3 A;  4KI0 A;  1GVP A;  4P74 A;  2OT2 A;  2KHJ A;  4CKB A;  5IT9 L;  2F0K A;  3D8G A;  5IGB A;  1QOH A;  1FVI A;  5ELO A;  4BY1 H;  4QL5 A;  4EVO A;  3Q6S A;  2R7Z B;  4CDF C;  1IBK L;  3CC4 A;  3PUY A;  1PFM A;  1PTO D;  3AYH B;  4IFD H;  2B3G A;  2RKS A;  4YCU A;  4A3J H;  3HGB A;  4S3S A;  3DWQ A;  1KTK A;  2ZJQ A;  4Z9C B;  4HCE A;  3N52 A;  2UUB Q;  1RTO A;  1G2T A;  3E6Z X;  2NZH A;  2MPM A;  1EYA A;  3MEH A;  4WJW A;  1EIH A;  2ZXR A;  1SMX A;  4XYO A;  4O2D A;  1ENF A;  4DR2 L;  1XJV A;  4K0K Q;  3S2H B;  2NVY B;  2F0F A;  4EX5 A;  1SFO B;  1G91 A;  2LXJ A;  4ZCK A;  4K6L A;  1R4Q B;  4CDE C;  4CGY B;  2HT1 A;  1CM9 A;  1Z7T A;  3BDL A;  1IBM Q;  2PO4 A;  1FL0 A;  2K52 A;  3RMH A;  5FLM H;  2IPK D;  5IP7 G;  2AWO A;  4BY7 H;  3KOJ A;  1YBY A;  1K0S A;  1OXT A;  1OXV A;  1UE5 A;  1QE6 A;  3IRB A;  4Y7N H;  3FPP A;  1IKL A;  1HNX Q;  2DY7 A;  3QIA A;  5ISR A;  1EZ8 A;  1HJP A;  1PH3 A;  4RGM A;  3KLR A;  1H9K A;  3S14 H;  2AQ2 B;  3EFX D;  1PYS B;  4OO1 G;  1HFG A;  3PIP A;  1HRJ A;  2B2Y C;  2DNE A;  1YHA A;  1BCP C;  4X62 L;  1JB7 A;  2JA6 G;  1EQT A;  1GJX A;  1UE6 A;  1H9R A;  5KND A;  2R7Z H;  1XMO L;  1EOV A;  3VYR A;  1PH7 A;  1KAB A;  4B3T L;  4YCW A;  4ZUJ A;  1VQE A;  4V0B A;  3L7Z C;  2UXC L;  3OW2 A;  1SSO A;  2Z9H A;  4LF4 Q;  3RN2 A;  1EY8 A;  3U4Z A;  3FKI B;  1UEA B;  1V8Q A;  2SNM A;  4OO1 I;  3HKZ B;  2VW9 A;  1PFS A;  3NEN A;  2ZM6 L;  4OXP A;  1STY A;  1H95 A;  1RF2 D;  1H9J A;  4X64 Q;  5C5M A;  2NVY H;  5GAD C;  1K73 C;  4DNI A;  3RN5 A;  1SFO H;  3A7L A;  3KLS A;  1WYD A;  2RDG A;  3PQI A;  4PMW A;  4RA8 A;  3MWY W;  3HG9 A;  1F77 A;  1ET9 A;  1TY0 A;  2JN4 A;  1PH5 A;  1VQJ A;  4R4T A;  1S40 A;  3CPW A;  2IX1 A;  3BDC A;  2BA1 A;  2JSO A;  3OMC A;  1S3O A;  3HKZ E;  3GV3 A;  1HNW L;  5LMN L;  5IIF A;  1LT5 D;  3I4O A;  3ULL A;  1U4P A;  3H91 A;  5EAY A;  1Y1W G;  3FMC A;  1SLJ A;  4AQY L;  1MI2 A;  3R3O A;  3I4M B;  4K5V A;  2B2W A;  4L63 B;  1CFM A;  2EYF A;  1K83 B;  3K81 C;  3CC2 A;  1FJG Q;  4CDD C;  4IOC A;  4R4O A;  1E0B A;  4A3K B;  1X3G A;  2A73 B;  5JEA G;  3LX0 A;  1YEZ A;  4QB4 A;  1CSP A;  1D5Z C;  1B1Z A;  3UDF A;  1VQC A;  5E3F A;  2GA4 B;  3F8T A;  3OIP A;  4PZ8 A;  4BXX G;  5C4X G;  1X56 A;  2AHO B;  4DR1 Q;  4CJ1 B;  3FKI H;  5K36 H;  3I3C A;  5FO8 B;  3S1N B;  3ND9 A;  2EDG A;  3GTM B;  1HZC A;  2AUJ D;  1OTC A;  1Y1W H;  2F0G A;  1EY7 A;  5IT9 E;  3J7A F;  2SEB D;  3KBX A;  3TQY A;  1EFI D;  2YTV A;  4J15 A;  3LNN A;  2Z6B A;  3HFZ B;  2VXW A;  1TR5 A;  2B2U A;  1KL9 A;  4FXG C;  2EJM A;  3S1Q H;  2O5I C;  1P16 A;  4JI1 L;  1LAB A;  1IYU A;  2A6E D;  2F3I A;  2NBF A;  3TP6 A;  1EYC A;  1A15 A;  3U4V A;  1EEF D;  5ELB A;  2D0P A;  4LF9 L;  4AYB G;  3H6M A;  2D2C C;  4A3B G;  2MNA A;  4IUQ A;  1JC7 A;  3A74 A;  4JI8 Q;  4L5Q A;  5CV7 A;  1CKO A;  3K6O A;  1U0L A;  3SK5 A;  1CQV A;  4BXX H;  5C4X H;  4IPD A;  2WAC A;  3FDT A;  5FLX E;  4RGN A;  3HOZ G;  2N8N A;  5LL6 S;  2VQE Q;  3I4M H;  3BS1 A;  1Q86 C;  1ASY A;  3PO3 B;  3DEO A;  1K83 H;  1CA5 A;  1V1O A;  2L9H A;  1JJ2 A;  4G7H C;  1HHV A;  1AE2 A;  2BA0 A;  3JAM i;  2V1C C;  4ZAI A;  2MFI A;  1HNZ Q;  4A3K H;  1HR0 L;  1RL2 A; 
#chains in the Genus database with same CATH homology
 5IP7 H;  3HOW G;  4JI3 Q;  3VDY A;  2VL6 A;  1PH6 A;  1XNQ L;  1HNZ L;  4DV3 L;  4A3B H;  3GD7 A;  4MZ9 A;  1Q81 C;  4DR3 Q;  4BA1 I;  2WAQ G;  4A76 A;  4LF8 L;  2VZA A;  4P75 A;  3S1N H;  4JI3 L;  3J81 c;  3CCQ A;  1EFW A;  2YTX A;  4NB3 A;  2JQO A;  3GTM H;  3HOV H;  4DV6 Q;  4JBM A;  2H5X A;  4DR3 L;  3CP0 A;  2UUA Q;  2E2H H;  1VQM A;  3EBE A;  5IP9 G;  1C9O A;  2WFW A;  1NY4 A;  1Q12 A;  1X3E A;  4DV6 L;  3ULJ A;  2ALY B;  4LF5 Q;  2UUA L;  5M3M G;  5GAH C;  4A3D G;  1XNR Q;  2R92 G;  2JA6 H;  5IWA Q;  3EIV A;  3STB C;  4DV1 Q;  4BBS G;  1IXR A;  2WP8 J;  4A3I G;  4LF5 L;  3S1R H;  2HHH L;  2DGY A;  5IT9 c;  1XNR L;  2VNU D;  3H15 A;  2E2J H;  1VQ6 A;  1N32 Q;  2WB1 E;  5IWA L;  4YHH Q;  2UXD Q;  1XPU A;  5JJL A;  4DR5 Q;  3EN2 A;  3CCV A;  1PH4 A;  4JI6 Q;  1AH9 A;  1V1Q A;  4RG1 A;  4IOA A;  1N32 L;  4YHH L;  2XTI A;  3S17 H;  1YHQ A;  1MIU A;  1S72 A;  2AWN A;  3AFP A;  5C4J H;  4PG3 A;  1PA6 A;  4JI6 L;  1AE3 A;  1TWG H;  1WI5 A;  3KDF A;  4GNX C;  4R4C A;  4IFD G;  3PUZ A;  4A3J G;  1R9T H;  1KXL A;  5IP9 H;  2IX0 A;  1O7I A;  2HIV A;  4IJL A;  4P72 A;  1CKN B;  3PF5 A;  4LF6 Q;  1B8A A;  1VCI A;  2CWP A;  4H02 A;  4NPS A;  3TEH B;  3MXN B;  3L2P A;  1VQ4 A;  1XMQ Q;  5FLX c;  5IYC G;  5GRO A;  1IZ6 A;  2GVA A;  4GLA C;  3S15 H;  3KF6 B;  2PNH A;  4LF6 L;  1OXX K;  3G71 A;  3CCJ A;  3E0E A;  1NE3 A;  2CWA A;  1Y1V G;  4DV4 Q;  2K5N A;  1VQH A;  1JT8 A;  1XMQ L;  5H1S E;  1I5F A;  4TVA B;  4DK6 C;  4IPG A;  1I50 H;  3Q8D A;  3GO5 A;  4B3M Q;  4DK3 C;  5HGQ A;  4BBS H;  1HZB A;  1YNX A;  4DV4 L;  3HOX G;  1VQN A;  4UP9 A;  4IFD I;  3I4N G;  4KHZ A;  1QVG A;  4JG2 A;  1E24 A;  1RIP A;  1NMF A;  2D62 A;  2R6G A;  3B6Y A;  1GO3 E;  3W1B A;  3AQQ A;  5FLM G;  4DR1 L;  4MTN A;  4POF A;  2JA7 G;  3L0O A;  4BY7 G;  2RHS B;  4JV5 Q;  4YY3 Q;  2IHF A;  3F2C A;  3OTO Q;  1VQ8 A;  2PMZ E;  4JI5 Q;  2ATW A;  3D0F A;  1WOC A;  4JOI A;  3GTP H;  1UE1 A;  3CCU A;  1KAW A;  1I6H H;  3BJU A;  4DR2 Q;  4ALP A;  2MQH A;  3CW2 C;  1YZ6 A;  2LXK A;  4YCV A;  4JV5 L;  4YY3 L;  1EUJ A;  3OTO L;  4JI5 L;  1NJI C;  1KHI A;  4AYB E;  5IE8 A;  3CQZ H;  3PV0 A;  2NZO A;  5GQO A;  2JA5 G;  1D8L A;  4LWC A;  1TWC H;  2RHQ B;  2LSS A;  1E1T A;  1QUQ B;  3G6E A;  2YYZ A;  1I94 Q;  3LGJ A;  1WCM H;  3J80 c;  1Y1V H;  4R1J A;  1XPR A;  4LFC L;  4O0A A;  4WJ4 A;  4QQB X;  4LUV A;  4JI0 Q;  1SE8 A;  2E8G A;  1I94 L;  3E9H A;  2QEX A;  1Q82 C;  3HOY G;  3RZO H;  1PYB A;  4A3L G;  4A93 G;  3HOU G;  2R7Z G;  2E2I H;  4QIW E;  4A3M H;  4L5S A;  1DGS A;  3JAM c;  3I4N H;  1LM0 A;  2GVB A;  5C44 G;  2IY5 B;  1V9P A;  1G51 A;  4JI0 L;  2ES2 A;  2R7F A;  4DAM A;  2Y0S E;  5C0X J;  1BBW A;  4DAY B;  3UDG A;  2A19 A;  4UPA A;  1Q8K A;  1W2B A;  1JE5 A;  3PO2 H;  2AKW B;  3T1Y Q;  4UY8 C;  1K9M C;  1X65 A;  2IHE A;  1YHB A;  1KRS A;  1ASZ A;  1Q1E A;  2K75 A;  4YWK A;  3PUX A;  1KRT A;  2R93 H;  5IYD G;  2I5M X;  1M1K C;  3G4S A;  4DPG A;  3T1Y L;  2JA5 H;  4L5R C;  1CKN A;  2WAQ E;  4LFA Q;  1BVS A;  1VQG A;  4B3M L;  2B63 H;  2VQF Q;  3H0G G;  1T9H A;  2AMC B;  3GTJ H;  4UP7 A;  3KJO A;  3T1H Q;  2N3S A;  4XIG S;  1KC8 C;  1BBU A;  4KLK A;  4HIO A;  2XGT A;  4DUY Q;  1Q46 A;  5IY0 A;  2VS1 A;  3KF6 A;  4LFA L;  4YWM A;  3S16 H;  3RLN A;  5J3B A;  2VQF L;  2L15 A;  4A93 H;  3T1H L;  1Z9F A;  2FXQ A;  3HOU H;  5E7N A;  3KJP A;  3HOZ H;  4IPH A;  4GKK Q;  3CCE A;  2K14 A;  2K50 A;  1VQA A;  2KCT A;  4DV0 Q;  1NTG A;  2PI2 E;  1YJN A;  1NBW A;  4LUO A;  1G6P A;  4C3J H;  4A3C G;  4GKK L;  3RZD H;  4GOP C;  4KHP Q;  4A75 A;  1UEB A;  4POG A;  3K7U C;  4DV0 L;  4JI4 Q;  4X65 Q;  5DLQ E;  1E22 A;  3TRZ A;  3RNU A;  2QGQ A;  2ASB A;  3GTO H;  1U5K A;  3UE0 A;  2OCE A;  1YI2 A;  4APV A;  1PH8 A;  2Q2U A;  3M3Y H;  4HJ9 A;  4BBR H;  3S2H H;  4LUZ A;  4DUZ Q;  4KHP L;  4DV1 L;  3S24 A;  4JI4 L;  4YWL A;  4X65 L;  1G29 1;  2JA9 A;  4GNX B;  3HOW H;  3U50 C;  3KFU A;  2BH2 A;  4LW1 A;  4R4Q A;  1VQI A;  2UXD L;  4BY1 G;  3J81 i;  4DUZ L;  2OTJ A;  2JK8 A;  3M9B A;  1CSQ A;  4DR5 L;  1J5E Q;  2F4V Q;  3CCS A;  1JJG A;  1QUQ A;  4BA2 I;  2KHI A;  3JC6 6;  1GKH A;  1OXU A;  4PZ7 A;  3M4O H;  3ZJY C;  3H3V I;  1YIJ A;  3CCR A;  3BZC A;  1MKH A;  3NEL A;  4JI2 Q;  1J5E L;  3CXC A;  3WWV A;  2F4V L;  4P73 A;  5ELN A;  4GN4 B;  2OTL A;  3FKI G;  3PUV A;  1IBL Q;  5IYB G;  4A3D H;  3K7A H;  5M3M H;  1B70 B;  4GLV B;  2B29 A;  3HKZ G;  1PH2 A;  1K8G A;  5K36 G;  4GS3 A;  1EQQ A;  4NXN Q;  3I56 A;  2R92 H;  3W5O A;  3PF4 A;  4A3C H;  1P8L A;  1VS0 A;  2CKZ B;  2KCM A;  2Z6K C;  3J81 j;  3I55 A;  1UWV A;  3KF8 B;  4B3S Q;  1X6O A;  4A3I H;  1IBL L;  2VUM G;  3CC7 A;  2KEN A;  1CUK A;  4OWT B;  1PH1 A;  1IL2 A;  5FJ8 G;  4NXN L;  2EIF A;  1N34 Q;  2A1A A;  4B3R Q;  1C7Y A;  1XTD A;  4KI0 A;  4C3I H;  2ZTD A;  1GVP A;  4B3S L;  4P74 A;  3GTK H;  2KHJ A;  2PI2 A;  1IBK Q;  1N34 L;  3PUW A;  4B3R L;  2RCN A;  1PV4 A;  1SRO A;  1FVI A;  5ELO A;  1SN8 A;  5M5X H;  4DV2 Q;  4BY1 H;  4QL5 A;  1IBK L;  3CC4 A;  3PUY A;  1E7Z A;  3ERS X;  1X54 A;  3AYH B;  2B3G A;  4PZ6 A;  4YCU A;  1J6Q A;  1TWH H;  2CCZ A;  4A3J H;  1VQB A;  2DUD A;  1XPO A;  2E5L Q;  2NVT H;  1EYG A;  3AFQ A;  4DV2 L;  2Z0S A;  2ZJQ A;  3BU2 A;  3FHW A;  2UUB Q;  2K5H A;  2EXD A;  2NZH A;  4HIM A;  1VQK A;  1D7Q A;  1LTL A;  1SMX A;  4O2D A;  4HIK A;  4DR2 L;  1XJV A;  5IYC H;  1I3Q H;  5M5W H;  2UUB L;  3I4M G;  3W1G A;  1QZG A;  4X66 Q;  4K0K Q;  2YV5 A;  5JEA J;  3AEV A;  3PSI A;  5BR8 Q;  4DR7 Q;  2N49 A;  2Q2H A;  5FJ8 H;  3CCL A;  1N33 Q;  4EX5 A;  3GTG H;  3TS2 A;  2LXJ A;  4HJ8 A;  4UP8 A;  1HZ9 A;  4K0K L;  3KYH C;  2HT1 A;  2HIX A;  1IBM Q;  5BR8 L;  3I7F A;  4DR7 L;  3MEF A;  3RLO A;  3HOX H;  4A3K G;  1FL0 A;  2K52 A;  3TRE A;  1N33 L;  1YJ9 A;  3J7A 5;  4GKJ Q;  3RLF A;  3DM3 A;  1EIF A;  5FLM H;  4GNX A;  3A5U A;  3F2D A;  5IP7 G;  3BZK A;  2AWO A;  4GN3 B;  3KOJ A;  2JA7 H;  3CPF A;  1IBM L;  4BY7 H;  1YBY A;  3PIO A;  3RR5 A;  3CAM A;  1OXT A;  1OXV A;  4MNO A;  2MO0 A;  4A3E G;  4GKJ L;  1UE5 A;  3IRB A;  1QVC A;  3UDX A;  4Y7N H;  1HNX Q;  4JI7 Q;  1Z47 A;  2VY3 A;  4DV7 Q;  4HID A;  4OWW B;  4EQ5 A;  1A62 A;  1HJP A;  1SRU A;  4DKA C;  1PH3 A;  3S14 H;  4X62 Q;  4OO1 G;  1PYS B;  3M85 A;  2D0O A;  1HNX L;  4JI7 L;  3PIP A;  4DV7 L;  1KD1 C;  2K5V A;  3J80 i;  2K4K A;  1IYJ B;  4QJF A;  2I5L X;  1YHA A;  2PQA B;  1X55 A;  1XMO Q;  4X62 L;  1JB7 A;  1N8R C;  4B3T Q;  2JA6 G;  4IJH A;  1UE6 A;  3HOY H;  4A3L H;  2JJQ A;  2UXC Q;  1X9N A;  4HJ7 A;  1LUZ A;  2NN6 G;  1LYL A;  2R7Z H;  4Y52 H;  4DUY L;  4GOP B;  4C2M H;  4OX9 Q;  1XMO L;  1EOV A;  4DV3 Q;  4GN5 A;  4L5T A;  1PH7 A;  5C44 H;  4B3T L;  2JA8 G;  2JEA I;  2I5H A;  4YCW A;  1VQE A;  3L7Z C;  3S2D H;  2GN5 A;  2UXC L;  3OW2 A;  3F1Z A;  3PGZ A;  2ZM6 Q;  2OQK A;  3CF5 A;  4LF4 Q;  1A0I A;  4OX9 L;  2R7D A;  3HKS A;  3RN2 A;  4A3E H;  1E1O A;  3U4Z A;  1N9W A;  1C0A A;  1VQ5 A;  4OO1 I;  1TWF H;  5AJ3 Q;  2VW9 A;  1PFS A;  3NEN A;  2ZM6 L;  4OXP A;  4GLX A;  4LF4 L;  1JMC A;  1H95 A;  3ER0 A;  3PO3 G;  3E9I A;  5GAE C;  4QGU A;  2UU9 Q;  5IYD H;  1N36 Q;  4LF7 Q;  4X64 Q;  1SR3 A;  4JOI C;  5AJ3 L;  5HY6 A;  5GAD C;  2NVY H;  1MJC A;  3KLW A;  4OON A;  1K73 C;  4DNI A;  5LMN W;  3RN5 A;  1SFO H;  1RL2 A;  3GTL H;  1BKB A;  4WJ3 M;  3H0G H;  1WYD A;  2UU9 L;  1K3R A;  1HZA A;  2NN6 I;  2HHH Q;  3A5Z B;  4OWX B;  3U58 A;  4X64 L;  4PMW A;  4DV5 Q;  1N36 L;  4LF7 L;  2JE6 I;  4C3H H;  5GAG C;  1VQP A;  2MO1 A;  1TXY A;  1PH5 A;  1X3F A;  1VQF A;  1VQJ A;  1L1O B;  5LMN Q;  4R4T A;  1S40 A;  1HNW Q;  3CPW A;  1M90 C;  2IX1 A;  4P71 A;  4A4I A;  5LMU Q;  1L2F A;  3FP9 A;  2BA1 A;  3UE1 A;  4DV5 L;  4HJ5 A;  1S3O A;  4XTC S;  2JA8 H;  3HKZ E;  3CME A;  1Q1B A;  1YIT A;  3K8A A;  1VQD A;  3K80 C;  2WB1 G;  5LMN L;  3S1M H;  1HNW L;  4AQY Q;  1HH2 P;  4AH6 A;  2ZJR A;  3GTQ H;  3D31 A;  1L1O C;  4JI2 L;  5LMU L;  3H3V H;  3I4O A;  1JJC B;  1WJJ A;  3ULL A;  5EAY A;  4DR6 Q;  3CCM A;  1Y1W G;  1KQS A;  1GM5 A;  1A63 A;  1SLJ A;  2ZTC A;  2ZJP A;  1CKM A;  4AQY L;  3STB D;  1EWI A;  4QY7 A;  4DR6 L;  3PO3 H;  1VQL A;  2UXB Q;  4AIM A;  3DLL A;  4ME3 A;  3K81 C;  5M3F G;  3A0J A;  2RF4 A;  4JBJ A;  1PVO A;  3SGI A;  3ULP A;  3CC2 A;  3G48 A;  1FJG Q;  1QZH A;  4LFB Q;  2UXB L;  5JJK A;  1YVC A;  4IOC A;  4R4O A;  3M7N A;  4JCV E;  4RMF A;  1X3G A;  5JEA G;  4A3G G;  1VQ9 A;  1GD7 A;  1YEZ A;  2UUC Q;  1CSP A;  5M5Y H;  1W3S A;  1WCM G;  1QVF A;  3UDF A;  2PQA A;  1FJG L;  4LFB L;  1VQC A;  4IFD J;  1V43 A;  1FGU A;  1NMG A;  3F8T A;  2N78 A;  4PZ8 A;  4DR4 Q;  4BXX G;  5C4X G;  1X56 A;  2AHO B;  4JBW A;  2CQO A;  4IPC A;  3F2B A;  4FDB A;  4DR1 Q;  1VQ7 A;  2UUC L;  3FKI H;  5IYB H;  2E5L L;  1TWA H;  4GOP A;  4JYA Q;  4A3M G;  2NVX H;  2A8V A;  5C0X G;  1HZC A;  2C35 B;  1OTC A;  4JBK A;  4DR4 L;  3PCO B;  1Y1W H;  2VUM H;  3OYY A;  3TQY A;  2HQL A;  2JEB I;  4JI1 Q;  2YTY A;  2YTV A;  2ID0 A;  4J15 A;  1Q7Y C;  4JYA L;  1WFQ A;  3HFZ B;  1OXS C;  3PO2 G;  1KL9 A;  2BH8 A;  4X66 L;  3NEM A;  3S1Q H;  4A3F G;  3J7Z C;  4LF9 Q;  5C3E G;  1P16 A;  4JI1 L;  3TS0 A;  5M3F H;  2ZTE A;  2R93 G;  2F3I A;  3CD6 A;  2KBN A;  1UE7 A;  3U4V A;  1K8A C;  2D0P A;  4LF9 L;  4R4I A;  3K0X A;  4LFC Q;  4AYB G;  4A3B G;  4A3G H;  2MNA A;  2B63 G;  3KDF B;  3UDI A;  3M4Q A;  1B7Y B;  1PHJ A;  2OWO A;  3A74 A;  4JI8 Q;  4L5Q A;  1CKO A;  1U0L A;  5C0X I;  1MJE A;  4BXX H;  5C4X H;  1E3P A;  4IPD A;  2Q2I A;  1YJW A;  3HOV G;  1L1O A;  1HR0 W;  3CMA A;  2IT1 A;  2Z6K A;  1PH9 A;  2EQS A;  4JI8 L;  2N8N A;  3HOZ G;  3ICE A;  2YU9 H;  2VQE Q;  3I4M H;  4NXM Q;  1L0W A;  3GDE A;  1Q86 C;  1ASY A;  2F52 A;  2NVQ H;  3NBH B;  1VQO A;  3M4P A;  1K83 H;  1K0R A;  3I2Z A;  1HR0 Q;  2VQE L;  1EIY B;  2Y0S G;  4LNQ A;  4HJA A;  1A8V A;  2QA4 A;  1KIX A;  1JJ2 A;  4NXM L;  4IO9 A;  4X6A H;  2OQ0 A;  1AE2 A;  2Q2T A;  4A3F H;  5JJI A;  5C3E H;  2BA0 A;  3JAM i;  2V1C C;  2MFI A;  1XNQ Q;  1HNZ Q;  4JC0 A;  1EQR A;  4A3K H;  1HR0 L;  2I0Q A;  2CFM A;  4LF8 Q;  4TQU S;  4BBR G;  1Y14 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...