4DR4Q

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, cognate transfer rna anticodon stem-loop and multiple copies of paromomycin molecules bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
100
structure length
100
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 19
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr4Q00
1X54A 5C4JH 4KHZA 5BR8Q 2UXBQ 2VL6A 5FLMH 4A3MH 1XMOL 3TEHB 1N32L 1PYBA 1X55A 4DV5L 2NN6G 2DUDA 2ZTCA 4X65L 3JC66 3CD6A 1HH2P 4JV5L 1EIFA 3GO5A 3E0EA 4JBWA 5LMNL 1IBMQ 4AYBG 2IY5B 5HY6A 3RR5A 3RNUA 3I4MG 2NVYH 1A62A 2VW9A 4K0KQ 1YJ9A 2YU9H 1IXRA 1Q1EA 3S1RH 1VQBA 1YIJA 4IPHA 3GTPH 1W2BA 4JBKA 2D0PA 4DKAC 1KC8C 4WJ3M 1E7ZA 3J7ZC 4GN5A 3I4OA 2E8GA 1YZ6A 4GLAC 3B6YA 4DNIA 2Y0SG 3ERSX 4Y7NH 1HR0W 3J81j 4GKJL 4DK6C 3CCVA 1I3QH 2HHHQ 2ZJQA 4YWLA 4JI8L 5C0XJ 4DV7Q 3T1HQ 4BY7H 3D31A 2HQLA 3F2CA 3J80i 3EIVA 1UWVA 2MO1A 4P72A 1IBLL 4OX9L 2WAQG 2WFWA 4JI4L 4HJ7A 5M5WH 4A93G 4RMFA 5C3EG 2EIFA 3L2PA 4C3JH 3CCQA 4LNQA 5FJ8H 4JI2Q 3G48A 4GNXC 3AQQA 4DV3Q 3I2ZA 3HOXH 1E24A 1YBYA 4HJ9A 4HJ8A 1Q7YC 1XMQQ 5C0XI 2B63H 3PIPA 3S14H 1IBML 2CWAA 4AH6A 1Q1BA 1NTGA 3WWVA 2D0OA 3PF5A 2A19A 2F52A 1QZGA 1LM0A 1I94Q 4GKKL 1E22A 4BBSH 3KYHC 1Y14B 1L2FA 3HOWG 4K0KL 2H5XA 2VY3A 1SRUA 3GTOH 1KAWA 1NY4A 1UE6A 4A76A 5IYBG 3T1YQ 4H02A 2BH2A 3H0GH 1VQPA 2NZOA 2VS1A 3KFUA 4LF9Q 4P71A 4JI5Q 2LXKA 3H3VH 3W5OA 2Q2IA 1WFQA 2XGTA 5GAEC 4DV7L 3ULPA 1XPRA 3UDFA 2YTYA 4HIKA 2K5HA 2R92H 3ZJYC 4MNOA 1X3GA 1NJIC 1C7YA 4LFCQ 5AJ3Q 1N34Q 2EXDA 1C0AA 3GTGH 3W1GA 5HGQA 1L1OC 4JI2L 4R4OA 4JI0Q 4LF7Q 5C4XG 1NE3A 2VQEQ 1YHQA 3EN2A 4A75A 3GTQH 3RLFA 2E5LL 1XMQL 5GQOA 3NENA 4PZ6A 5GAGC 3D0FA 4R4IA 4B3ML 2ZM6L 4DV1Q 5H1SE 2MQHA 4LF8L 4DR6Q 4YCWA 4DR2L 4A4IA 1Q46A 2JA6G 4IOCA 1D7QA 1XNQQ 4LF4Q 3H15A 5M3FG 1PH8A 2A8VA 1T9HA 1IBKL 3OW2A 1Q8KA 1Y1VG 1KL9A 3A0JA 1HNXQ 3CCJA 2GN5A 1BKBA 3UDGA 4LF9L 4OWTB 4GOPC 1M1KC 1XPOA 4IJHA 1S3OA 2QGQA 3AFQA 4A3FH 1S40A 4JI7L 4A3LG 1PVOA 4QGUA 1HJPA 2ZTDA 3K0XA 1JJGA 1VQCA 3E9IA 4GNXB 2R7DA 4HJ5A 2I5MX 1W3SA 1XMOQ 4OO1I 4ME3A 5ELNA 3VDYA 4NB3A 3PV0A 2IHEA 4LFCL 2JA7H 4DV5Q 5IYDH 2BA0A 2Z6KC 4GN4B 4R1JA 3PIOA 3K8AA 2PQAB 4X65Q 3CPWA 3CC2A 4JV5Q 1K8GA 3E9HA 4GN3B 2CCZA 4JI0L 4A3CH 4P75A 2VQEL 3DM3A 5GROA 3G71A 1PH7A 2AMCB 1KXLA 1JE5A 1HR0L 4DV1L 1KQSA 1EYGA 2E2JH 1D8LA 2JA8G 3HOUG 5M3MG 1G291 1B8AA 3K7UC 1SROA 4UPAA 3OTOL 3PO2H 2JJQA 1N8RC 4GKJQ 1G6PA 2RHQB 1WCMG 2EQSA 2ZTEA 3FP9A 5IYCG 2F3IA 3TQYA 3HKZE 1YEZA 4O2DA 4DV6Q 3FKIH 1Y1WH 3K80C 1IYJB 3M4PA 1OTCA 2OQKA 4JI4Q 4KI0A 3HOZG 2R93H 1L1OB 3KOJA 2WP8J 3SGIA 3J80c 1GM5A 3S24A 3GDEA 4JI1L 3CC7A 2ATWA 2R6GA 4BXXH 1VQ4A 1GD7A 4LUOA 1KHIA 5C0XG 4A3IG 3OYYA 3RZDH 1VQ7A 4BBRG 2IT1A 1J5EL 3CXCA 4C2MH 4GKKQ 3GD7A 4A3KG 2JK8A 4JBJA 1Q12A 3U4VA 3PUWA 4OXPA 4A3DG 3RLOA 1L1OA 2ZJPA 1GKHA 4QIWE 4YY3Q 1OXUA 3RZOH 4PG3A 3KF6B 3BZCA 1Q82C 1CUKA 1E1OA 2UUAL 4GLVB 2PNHA 4LFAL 1EQQA 3DLLA 2E2HH 4JI6L 2HT1A 4DPGA 2VZAA 1VQLA 4C3IH 3ULLA 2BH8A 4A3GH 5C4XH 4DV6L 3KJPA 4PZ8A 1QVGA 3S17H 2R7ZG 3I7FA 1CSQA 1J6QA 1AE2A 3PGZA 2N8NA 2DGYA 1VQAA 2KHJA 1TWGH 3CPFA 4O0AA 4GOPA 2JA6H 4A3BG 3J7A5 2UXCL 2OTJA 4BA2I 2OWOA 3KDFB 1X6OA 4JYAL 2UXBL 2LXJA 2K14A 3M9BA 3PUVA 5IP9H 4DUZL 1R9TH 2E5LQ 2D62A 4R4CA 3L7ZC 4DAYB 3F2BA 1Q86C 1EIYB 2ZM6Q 1VQKA 4B3MQ 1X3FA 4LF8Q 4IOAA 1OXXK 4DR2Q 4POFA 3HOYH 4R4TA 2Z6KA 4NXML 2ASBA 1GVPA 4AQYL 3KLWA 2E2IH 3I56A 1PYSB 1K0RA 4YY3L 1IBKQ 1SN8A 4B3TL 3HKZG 3AEVA 1KIXA 1IZ6A 3ER0A 3PUXA 1L0WA 1SLJA 1QUQB 1YJNA 4LF5L 2VUMG 3S1NH 4L5RC 4DV4Q 4C3HH 3EBEA 4JG2A 4BY1G 4JI7Q 1MJCA 1VQOA 3CP0A 5IT9c 1SMXA 1OXTA 5GADC 1N36L 4OO1G 1K3RA 2Q2UA 1B70B 1V9PA 1YHAA 1V1QA 1KD1C 3M7NA 4YWKA 5FLMG 1A0IA 2PI2E 4A3MG 2N78A 1VQ8A 4UP8A 2RHSB 4PMWA 2B29A 3TS0A 2A1AA 4NXNL 5C44G 5M3MH 2OCEA 4TQUS 5LMNW 3GTJH 1K73C 1PH5A 2AHOB 1WJJA 1A8VA 3CC4A 4UY8C 5JEAJ 1BBUA 1HZAA 3J81i 1MJEA 1TWHH 1WCMH 1HR0Q 1MIUA 4DR5L 1AE3A 3TRZA 2JEAI 4B3SL 4NPSA 2LSSA 3I4NG 2BA1A 1UE7A 4UP9A 2KCMA 4JC0A 3A74A 4DV2L 4DV0L 4LFBL 4DR7Q 1X3EA 2JEBI 5IP7H 1TXYA 3HFZB 2UU9Q 3HOZH 3OTOQ 4L5SA 1SFOH 3PO3G 3U58A 4JBMA 1WOCA 1YHBA 2JA9A 2K4KA 4JI3L 1O7IA 3CCLA 4POGA 2F4VL 4DV4L 4GS3A 2YTXA 4IFDJ 2HIVA 3F1ZA 1UE1A 5JJIA 4DUYQ 5JJLA 4LF6L 4EX5A 1VCIA 2WB1E 3CQZH 1C9OA 3M3YH 1VQMA 4QY7A 1PH2A 4JI1Q 2N49A 3I4MH 2IHFA 4A3DH 1PH1A 1PH4A 3U50C 1A63A 5ELOA 3CAMA 2R7FA 5FJ8G 1RL2A 4MTNA 1XJVA 1PA6A 1JT8A 3UE1A 4A3JG 3PCOB 1J5EQ 3CF5A 3HOVG 2GVAA 4LUVA 2ZJRA 1IL2A 4DR3L 2B63G 1BVSA 5IWAL 2XTIA 5FLXc 3S1QH 2YYZA 3UE0A 4IFDI 1EWIA 4GNXA 1XTDA 5K36G 1WYDA 5IE8A 1VQ5A 1HNWL 2UUAQ 4DR7L 5LMUQ 2UU9L 4HJAA 2R7ZH 4LFAQ 3MEFA 3H0GG 2IX0A 2FXQA 1CKNB 4JI6Q 1NBWA 4A93H 2PQAA 5C3EH 2NVTH 1ASZA 5M5XH 4HIOA 3RN5A 3K81C 4YHHL 4A3EG 4A3BH 4X66L 1UE5A 3NBHB 4DUYL 2NVXH 1U0LA 3LGJA 1QZHA 5M5YH 1OXVA 3CCMA 5JJKA 2N3SA 4LW1A 4EQ5A 3STBC 3CMAA 3PUZA 1VQIA 1PFSA 3HOWH 3S2HH 1K9MC 2UXCQ 2I5LX 1MKHA 1N33Q 4OWWB 4JYAQ 4RG1A 1B7YB 2OQ0A 5IYBH 3KF8B 1HZBA 4BA1I 1Z47A 4DUZQ 4GOPB 2NZHA 1I6HH 2VUMH 3S15H 2AWOA 2VQFQ 2MFIA 2UUCL 2OTLA 4NXMQ 4AQYQ 4BY1H 3NEMA 1PH6A 1VQDA 4B3TQ 2K50A 1YI2A 4JOIC 3GTLH 4LWCA 5LMUL 4LF5Q 1E1TA 4XIGS 2V1CC 3GTKH 3A5ZB 1FJGL 2WB1G 4KLKA 2CKZB 3AYHB 5IY0A 3CCUA 4X6AH 4KHPQ 3PUYA 5C44H 1KRTA 1N36Q 4A3FG 1CKOA 3MXNB 4QJFA 1VQNA 4X62L 3STBD 1S72A 1VQFA 3KJOA 3H3VI 4YCUA 4AIMA 1FL0A 2KHIA 3CMEA 2YV5A 4MZ9A 4QQBX 1TWCH 3KF6A 3RLNA 3I4NH 2KCTA 3ULJA 3W1BA 5IYDG 4NXNQ 2JA7G 5M3FH 2KENA 1N33L 1PH9A 1NMGA 4L5QA 3JAMi 4QL5A 3F2DA 4A3CG 1P16A 1VQGA 5DLQE 4DAMA 4X64L 1JJ2A 3PO3H 1Y1VH 1EFWA 4B3RL 4DR5Q 4IPCA 2VQFL 4B3SQ 4HIMA 3U4ZA 3J81c 4DV2Q 1XNRL 3PF4A 4DV0Q 4LFBQ 4A3LH 4JCVE 1HZCA 2JA5G 3ICEA 1YNXA 3PO2G 4IJLA 3G4SA 5BR8L 4JI3Q 1I5FA 2F4VQ 2JQOA 3KDFA 1X9NA 1K8AC 1EUJA 3F8TA 4LF6Q 4KHPL 3FKIG 1SR3A 2L15A 4YWMA 5JEAG 3G6EA 1P8LA 4A3JH 1Y1WG 2UUBQ 3S16H 3TS2A 2QEXA 2NN6I 3HOVH 2R93G 2HIXA 2ES2A 2AWNA 2MNAA 1QVCA 5J3BA 4BXXG 2JA8H 1QUQA 1VQEA 3HOUH 1HNZQ 1EQRA 2ID0A 2I5HA 2MO0A 3A5UA 4DR3Q 1PV4A 3CW2C 4IFDG 5IYCH 5IWAQ 2HHHL 3IRBA 2RCNA 4A3EH 1Q81C 3T1HL 1HZ9A 4UP7A 1HNWQ 4APVA 1JMCA 4WJ4A 4R4QA 3Q8DA 4OWXB 2PI2A 1ASYA 2AKWB 4TVAB 2CWPA 1FVIA 4IO9A 2B3GA 1JJCB 1E3PA 4L5TA 1OXSC 3K7AH 4YHHQ 4DR4Q 4X66Q 4BY7G 1X56A 4DR1Q 3NELA 4A3IH 3GTMH 4A3GG 3S1MH 1LTLA 3TREA 4JOIA 4DV3L 1VQHA 4BBRH 3BJUA 1LYLA 3RN2A 2PMZE 2UUBL 1QVFA 2RF4A 1Z9FA 3M4OH 4A3KH 1WI5A 2CFMA 2C35B 3UDXA 4HIDA 1I94L 1LUZA 1CSPA 4AYBE 4IPGA 3S2DH 1EOVA 3HKSA 1PHJA 1HNZL 4ALPA 3HOXG 1CKMA 3T1YL 1PH3A 1KRSA 5IP9G 2IX1A 1M90C 2UXDQ 1SE8A 1U5KA 2JE6I 2Q2HA 2UUCQ 1BBWA 5EAYA 4BBSG 2CQOA 3HOYG 4JI5L 4DK3C 4OONA 2Y0SE 1G51A 3I55A 2Q2TA 3UDIA 5E7NA 4XTCS 1RIPA 1N9WA 2Z0SA 1VQ9A 1NMFA 1VQJA 4P73A 3L0OA 2ALYB 1FJGQ 1N32Q 4LUZA 4FDBA 3AFPA 1JB7A 5AJ3L 3CCRA 4PZ7A 2YTVA 3BU2A 2WAQE 3PSIA 1VS0A 2K5VA 3BZKA 1N34L 4DR4L 4DR1L 1YJWA 4X62Q 2QA4A 4LF7L 2VNUD 3M85A 5LMNQ 2I0QA 1I50H 2R92G 2K5NA 1AH9A 1UEBA 4GLXA 2NVQH 4DR6L 4P74A 1GO3E 1CKNA 3CCEA 3CCSA 4IPDA 4LF4L 3FHWA 1TWAH 1V43A 2JA5H 1XNQL 4B3RQ 1DGSA 4X64Q 1TWFH 1X65A 3M4QA 5GAHC 3JAMc 2GVBA 4YCVA 4JI8Q 2UXDL 4Y52H 2K75A 1K83H 2K52A 1HNXL 1XNRQ 2KBNA 1VQ6A 4J15A 1FGUA 1XPUA 1YITA 1IBLQ 4OX9Q 5IP7G 1H95A 1YVCA
chains in the Genus database with same CATH superfamily
4R9WA 1DYQA 1EYAA 3OW7A 1N32L 1QG7A 3U9OA 3KF8A 1ET6A 4JW0A 1SE4A 1TS2A 4FF1A 1BF4A 4IFDH 4KJOA 3RNUA 4PQXA 1A62A 2VW9A 1IXRA 3S1RH 3S17B 1YIJA 4IPHA 3GTPH 3J7AF 3AU7A 3TMEA 4GLAC 2Y0SG 3R2TA 2JA6B 1IYVA 1S5BD 2X6GA 4DV7Q 3T1HQ 4BY7H 3GV6A 2RDFA 3F2CA 2QF7A 3NBIA 1Y1VB 1UWVA 5EBCA 2MO1A 1IBLL 5DEHA 4CBVA 2WFWA 4UDUC 4J8QA 3T4AC 2ZXOA 4RMFA 2A74C 3L2PA 3CCQA 5FJ8H 1YNJC 3AQQA 1YBYA 4HJ8A 2B63H 3PF5A 1QZGA 1D5ZC 2L1BA 1SJED 2KOLA 3S16B 1B4OA 2H5XA 1EZ6A 2B8FA 5FOBB 3G6JB 1A6XA 4XXEA 2JA8B 1ZXTA 2F3WA 4DV7L 2Q2IA 1WFQA 2X69A 1WCMB 2K6AA 1EEFD 1DJRD 3EVQA 1F2MA 2RDHA 1LTGD 2EDGA 2Z8LA 1C7YA 5AJ3Q 1N34Q 1L1OC 5CBAE 5C4XG 3L3OC 1NE3A 3EN2A 4DN4M 4A75A 1DM0B 3R3OA 2F0IA 1HQRD 1TY0A 4PZ6A 5GAGC 3GTMB 4R4IA 2ZM6L 4DR6Q 5H1SE 3QOJA 4HCEA 4DR2L 3HRZC 1Q46A 1K8OA 3EA6A 1XNQQ 3TN2A 5M3FG 3A7AB 1T9HA 3OW2A 4A3DB 4B9XA 1BR9A 4P2CB 5C5MA 1SNPA 3A0JA 3CCJA 2KEEA 2F0VA 1M1KC 4IJHA 1S3OA 1C8CA 3NTKA 1PVOA 3MHBA 1HJPA 3X3NA 3DUZA 4OO1I 2RBMA 2IHEA 1DCZA 4I65A 4GN4B 4R1JA 3K8AA 3FVQA 3ND9A 4JV5Q 2EYHA 5GROA 5KRUA 1PH7A 2WV6D 1KXLA 3EQLC 1HR0L 1KQSA 3BZDB 3HOUG 1PLFA 3A54A 1KABA 1SROA 1G6PA 2ZTEA 3FP9A 1KDBA 1DZ1A 3TQYA 3T13A 2OQKA 4DNRB 3J80c 1EY6A 4BY1B 4JPBW 1EWCA 3SE0A 3S24A 4LK1C 5E4WC 3GTLB 1D2BA 2SNMA 1HFNA 3OYYA 4A3MB 1VQ7A 5EQ0A 3OIPA 2IT1A 4BBRG 4V190 4A3KG 2JK8A 5C44B 3LX0A 3PUWA 4EQNA 4IN3A 3RLOA 1GKHA 4Z9CB 1OXUA 4PG3A 3KF6B 2PW5A 4YIJA 1EZ8A 1CA5A 1ENCA 3TZUA 1EQQA 2YU9B 2HT1A 1MSHA 4A3GH 2BH8A 5C4XH 1HCZA 4MTKA 1I3QB 2KCCA 4PZ8A 1QVGA 5JOBA 4DA2A 1J6QA 2FFKB 3PGZA 2N8NA 1VQAA 3R2IA 2HDLA 3A8KE 1TWGH 2UXCL 2OTJA 4BA2I 2OWOA 3F2UA 4JYAL 2H4OA 1EY4A 2IL8A 3M9BA 4DUZL 3F2BA 4R4CA 3L7ZC 5I9PA 1LT5D 4C3JB 1EIYB 2UXBQ 4POFA 2Z6KA 4DU9A 2E2IH 1WTRA 5CV8A 4B3TL 1IBKQ 1HRJA 1SN8A 3HKZG 5I6YA 2VUMG 1SYDA 1STNA 1KNEA 3MAQA 4L5RC 1H9KA 4DV4Q 5CV5A 4C3HH 3EBEA 4WORA 4JI7Q 1VQOA 1OXTA 3VYSA 2Z1CA 1B70B 2KEDA 4K8IA 4RH6A 4A3EB 1AP0A 1CQVA 3BVZA 2C9OA 3J81L 2E76C 1A0IA 2PI2E 1VQ8A 2B2WA 4K6DA 2A1AA 4NXNL 4RKLA 1J9OA 1WJJA 3CC4A 3A8JE 2SOBA 1AE3A 3VYUA 3I4NG 4BBRB 2QDBA 2JEBI 2SDFA 3TSSA 1SFOH 3U58A 1RKNA 4JBMA 2K4KA 1O7IA 1V1PB 5FK9C 4DV4L 2YTXA 3CRKC 1BUVT 1BCPF 1VCIA 4H0LC 5L37A 3LWEA 4KD4A 5T1GA 2PO4A 1JCKB 3I4MH 2IHFA 1H9RA 4DK1A 1PH4A 3NXWA 1XJVA 1RL2A 1X3QA 4A3JG 4QUCA 3D8GA 5G3LD 3HOVG 4LUVA 3SVMA 4DR3L 1O7LA 3UE0A 4IFDI 4ILWA 1XTDA 5IE8A 3ERQA 5LMUQ 3R93A 2FXQA 1HA5A 4LMQD 2PQAA 4O42A 3DWAA 3TBIB 5C3EH 1ASZA 4LJZC 4HIOA 3RN5A 3PIP3 5IOCA 1BO0A 3PO2B 1UE5A 1TWFB 1GJXA 3IFDA 3H09A 1OXVA 1M4VA 3CCMA 5JJKA 2N3SA 2F0OA 1K28A 5ELCA 3NPPA 3STBC 3PUZA 1Y1WB 3HOWH 3PMFA 1DXMA 1QNUA 1TT2A 2R93B 1MKHA 4V0BA 3U9SA 5IYBH 2OQ0A 1HZBA 3K5LA 1Z47A 2NZHA 2XSCA 5C3XA 2VUMH 2AWOA 4ABNA 1PTOB 2UUCL 4FP5D 3NEMA 2Z9HA 3UI2A 4C2MB 1Z6HA 1YI2A 5LMUL 5KEEA 4OGQC 2O2LD 4XIGS 2V1CC 1ONLA 3OPOA 3RZOB 2CKZB 3CCUA 3I90A 4HMJA 3AB9A 3MXNB 2OF1A 5E3FA 1VQFA 3KJOA 4YCUA 2LFNA 4C3IB 2A5HA 2ZXPA 3QIAA 4R8NA 3I4NH 2RSNA 2JA7G 3W1BA 5CGKA 2KENA 1NMGA 1B3AA 1QCBD 3JAMi 4A3CG 3Q24A 1P16A 4DAMA 1JJ2A 4DR5Q 4IPCA 3M7GA 2OXPA 1PRTC 3KLRA 1LLRD 3PIO3 4BBSB 4JI3Q 2B2VC 2F4VQ 3VYTA 1CQFA 1K8AC 3JAME 2WIIB 2TMPA 1EUJA 4YWMA 3G6EA 4A3JH 3LWUA 3TS2A 5ELEA 3HOVH 3D4DA 3DWQA 4KD3A 1WTOA 4K2LA 3I3CA 3K58A 4CJ0B 4MIUA 2IWHA 3A8IE 3KBGA 1HTLD 4J1MA 4K8JA 1PZJD 1SNDA 4H13C 3IRBA 3BYTB 2EJGC 4APVA 4R4QA 3Q8DA 4EVOA 2K28A 1FNWA 1CHQD 1D1KA 1JJCB 2XVSA 4YHHQ 4X66Q 1AN8A 4A3IH 3NELA 1AFPA 1LTLA 1O7ZA 1I4GA 4K14A 1Y8PB 1QVFA 2F0QA 4X3UA 3M4OH 1WI5A 4K2KA 3UDXA 1LUZA 5CV6A 2SNSA 1EOVA 1PHJA 5IODA 1I4XA 1KRSA 2A6HC 2JA7B 1EU4A 2ICIA 1U5KA 1DD2A 1D6EC 3HOYG 1PFBA 2F0LA 1T5EA 4K5XA 2XIWA 5IGBA 1Y8OB 4KK7A 2Z0SA 1IHZA 2E2JB 1L0XB 2F0SA 2EYFA 1UUPA 1D5XC 4LUZA 1I4QA 4EQOA 5FKAC 1PMRA 1EIGA 3CCRA 2WAQB 2DJFC 2WAQE 1YJWA 4X62Q 2QA4A 4LF7L 4ZAIA 1SNQA 3M85A 5LMNQ 1I50H 2R92G 2FJ2A 3NWTA 2PQEA 2PZUA 1AH9A 2Q8IB 4GLXA 2KA7A 2NVXB 4K6LA 1NR4A 3QWNA 5KYLA 1CKNA 1SNMA 3CCEA 4LF4L 1DGSA 1EQTA 3NBHA 5J22A 4YCVA 4Y52H 5EBDA 3BDLA 1K83H 1KLUD 2KBNA 1FGUA 4OO1H 4FXGC 1B53A 1YITA 1H95A 5JAVA 5C4JH 5BR8Q 4QB4A 2VL6A 1XMOL 2EYOA 5C4ZA 1WTPA 5I2YA 4DV5L 2AQ3B 2DUDA 1IL8A 2G9HD 3JC66 1HH2P 3SK4A 3URYA 3GO5A 4B08A 5LMNL 1IBMQ 4AYBG 5HY6A 3TP6A 2NVYH 4K0KQ 1YJ9A 3Q0AA 1Q1EA 1D1IA 4JBKA 4DKAC 4WJ3M 3EFXD 1DOLA 4GN5A 3KUPA 1YZ6A 5I2XA 4Y7NH 4GOPB 3J81j 1WD1A 4DK6C 3CCVA 3VR2A 2ZJQA 4N8X1 2RSOA 2EYLA 1R9TB 1QE6A 3EIVA 1V8QA 4MHEA 4P72A 1SYEA 4JI4L 4HJ7A 5LL6X 4A93G 3W3AA 1TU2B 3G48A 2HQEA 2HDMA 4HJ9A 1WTQA 3QB3A 4F8MA 3S14H 4KN7C 1IBML 1NTGA 3H91A 1I94Q 3NTIA 2F0NA 3HZXA 1E22A 4K0KL 1L2FA 4ZYSA 1E2ZA 1SRUA 3GTOH 1KAWA 4A76A 4B9WA 3DHQA 2BH2A 3H0GH 1VQPA 1JB3A 4CJ2C 3K57A 4LF9Q 5M3MB 4JI5Q 2LXKA 3GTJB 3H3VH 3W5OA 5D65A 2XGTA 3ULPA 1EYCA 1ILQA 3N52A 4HIKA 2R92H 3QOLA 4FF4A 1KDCA 1VF7A 2N88A 1U4PA 1EQVA 3AMUA 3NUCA 2EXDA 3GTGH 5HGQA 3P20A 4R4OA 2VQEQ 3GTQH 2E5LL 3NENA 4B3ML 3D0FA 3S1MB 2MQHA 2L5TA 4Q0FA 3CQZB 4A4IA 2JA6G 2RCFA 2A8VA 1SNCA 1PH8A 2DY7A 2A68D 1F9SA 4DXFA 3DMUA 1Y1VG 4FXDA 2VB2X 4XYQA 1KL9A 3TP5A 1HNXQ 4LF9L 4A3FH 3AFQA 1S40A 4A3LG 1AZPA 2NTSA 1JJGA 2R7DA 2B2UA 2KQ3A 4HJ5A 1W3SA 4ME3A 1XXGA 3C1EA 1BCPB 2Z6KC 2R7ZB 3CPWA 5CBEE 3C2PA 1K8GA 1TKWB 4GN3B 2NVTB 5IT9E 2VQEL 1I6VC 4U68A 5CC4A 3I72A 4A3BB 3MTSA 1JOQA 1STEA 1JE5A 1GHKA 1D8LA 2A6HD 2JA8G 1G291 3K7UC 4UPAA 3OTOL 2JJQA 3S2HB 1WCMG 1EY9A 1H9SB 4PMBA 2D2CC 1YEZA 2B2WC 3FKIH 1KLGD 3CHBD 2M9VA 2IX3A 2FMCA 1BDOA 3KOJA 4ID6A 3SXHA 3SGIA 3K0YA 1HUNA 1A2UA 4JI1L 2R6GA 4BXXH 1TQOA 4M1UB 2AQ2B 3V05A 3LNNA 1RDPD 4N9TA 3RZDH 3GTKB 4DAVA 1CZGA 2QW7A 3GD7A 1CTMA 1SEBD 5KNCA 3U4VA 4OXPA 4A3DG 2EYJA 4NMZA 4QIWB 4QIWE 1DONA 1IKMA 2EY2A 1QOHA 4OHJA 4LFAL 3DLLA 3S1RB 4DPGA 1RODA 3FMCA 3ULLA 3PO3B 4HEDA 3KJPA 4KY7A 3S17H 3PQIA 2F03A 3I7FA 1JICA 4QUFA 1CSQA 1SAPA 1AE2A 3BVGA 2DGYA 2KHJA 3FRPB 3ZYYX 2J4XA 3CPFA 2LS01 5IGEA 2JA6H 3KDFB 1ML0D 1JWSD 5IP9H 2MGSA 2K05A 1Q86C 4IOAA 1STBA 2ZM6Q 3OWFA 4DR2Q 1HQMC 2ASBA 1GVPA 4AQYL 2B63B 3I56A 1PYSB 3ER0A 1YJNA 1L0WA 1SLJA 1QUQB 1LTID 5I9OA 3KBXA 2FMMA 4JG2A 4OIJA 4BY1G 1U9RA 4C1NK 3BG3A 2CQAA 1KD1C 5FLMG 5IGCA 4WFN3 4A3MG 1LT6D 3T53B 2K5DA 2N78A 5C44G 3WOEA 2OCEA 5LMNW 2IPKD 1PH5A 4KMUC 1A8VA 3K7AB 5DNFA 4F7XA 1LT4D 1BBUA 3J81i 1MJEA 1WCMH 1HR0Q 2AUKA 1HUMA 5IT9L 1EIHA 4B3SL 2Z4IA 4NPSA 1UE7A 3SDZA 1ENFA 4DV2L 4DV0L 4LFBL 4DR7Q 2UU9Q 3HFZB 3QR8A 2F0GA 1NCVA 2NB0A 3S2DB 3OOCA 1X3PA 2HIVA 2BE5D 5JVH3 1Z7TA 4G57A 4C56C 4DUYQ 3J81E 4EX5A 5FO9B 5CV9A 4A3DH 1FGBD 3D6WA 3CAMA 4C3JG 3C46A 2KHSA 4MN3A 2GVAA 2ZJRA 3D3RA 1BVSA 2EE1A 2XTIA 5FLXc 3S1QH 4RGTA 1EWIA 5K36G 1HNWL 5IGGA 1EYDA 1G2TA 4DR7L 4IUUA 2UU9L 3RMHA 1F9PA 3MEFA 2NVQB 2L11A 2IX0A 3GV3A 1LT3D 3N6RA 1A3TA 4A3EG 2DJGC 3NK9A 4DUYL 1U0LA 3LGJA 1STHA 2ICEC 5D3IB 4RHRA 5BN4A 1EU3A 4I7AA 2UXCQ 3OSOA 4KKTA 1BBXC 1KTKA 1N33Q 4JYAQ 4BA1I 4DUZQ 2XWJB 4HR7B 1JQYD 2NBFA 3ONAB 2EJMA 4BY1H 1D5MC 1PH6A 1VQDA 4B3TQ 2K50A 3GTLH 4J6HA 1E1TA 1FJGL 4KLKA 3SK6A 4X6AH 4E6IA 5C44H 1F2YA 3H3VI 1MSGA 3L9AX 4AIMA 3CMEA 2YV5A 4A3GB 1TWCH 3KF6A 3ULJA 5IYDG 4NXNQ 5M3FH 3DEOA 1N33L 5M5WB 3F2DA 4CGYB 2SEBD 2F0JA 4X64L 1EFWA 3E6ZX 5F2DA 5KYIA 1XX8A 3HOXB 3I8ZA 1XNRL 4HTHA 1B44D 5DM63 3RUZA 4JCVE 1HZCA 1SMYC 2PZWA 5JJZA 3ICEA 3PO2G 3J7YW 4IJLA 5C3WA 4IQZA 1SYBA 2ZXRA 1X9NA 2XNAC 1F77A 1Y1WG 3VR5A 4XT3B 2R93G 4BWGB 4CKBA 4ZUJA 3I4LA 2ES2A 1QVCA 1CA6A 4DK0A 4CDCC 1VQEA 5EKKA 3HOUH 1EQRA 2ID0A 2I5HA 4DR3Q 2HHHL 3FPPA 4A3EH 4KTAA 2XN9C 5EKLA 1JMCA 4ZRZA 2PI2A 1ASYA 2IW3A 1VDZA 2AKWB 2CWPA 1CK1A 3T16A 4L5TA 4U673 1OXSC 2PPBC 4UHVA 4DR4Q 3TP8A 4KN4C 4C3IG 1F9RA 4N9PA 1PYWD 3TREA 4DV3L 4BBRH 4A3KH 1PRTF 3KLSA 1EY8A 1NSNS 5ISRA 4EGVA 5CMDA 5CR3A 4ALPA 1V1PA 3T1YL 2F0DA 1M90C 5KNBA 2JE6I 2Q2HA 2UUCQ 2UXDQ 2Z6BA 2K5WA 4BBSG 1PTOD 4OONA 4DK3C 3D6CA 2I07B 3I55A 3K5MA 4XTCS 3HEJA 1VQ9A 2A73B 4P73A 4F87A 3L0OA 2B39A 1JB7A 4PZ7A 4DR4L 2K5VA 1B2TA 5C3EB 4R8IA 4FF2A 2K5NA 3DWPA 5KNDA 4P74A 3H3VC 2QKIC 3CCSA 4IPDA 3FHWA 1T5XD 2DNEA 2OEOA 1QJOA 2DN8A 1TWFH 3HOWB 3M4QA 2UXDL 1JR0D 1SXTA 2K75A 1CHPD 1TY2A 1I4PA 4IZ8A 4ZKBB 5IP7G 3IFTA 2EPBA 4KHZA 3TEHB 1GUGA 2XWBB 3D4WA 1PYBA 4X65L 1PTOH 3CD6A 1FR3A 2N55A 2E2HB 1EIFA 3E0EA 4JBWA 2QDLA 4L8JA 3J7AV 2EYPA 1GUNA 1VQBA 4IUVA 2D0PA 1E7ZA 3J7ZC 5C0XJ 4DNIA 2D5DA 3B6YA 4GKJL 1HR0W 2B2UC 2F0KA 4ZCKA 3T56B 3MXNA 3DM1A 4YWLA 1ZEQX 3VR6A 2NTTA 5E4XA 2HQLA 1ILPA 3QO2A 3J80i 2AQ1B 5M9OA 2WAQG 4S3SA 2MUYA 4NW2A 1A2TA 2EIFA 2R61A 3K6OA 4DF7A 5A2QE 4LNQA 1QNKA 3S1NB 3I2ZA 1EEID 1E24A 1Q7YC 1XMQQ 2A69D 3PIPA 4QQBX 2NWGA 1BCPC 3WWVA 2A19A 4GKKL 1LM0A 3J80E 2VB3X 4BBSH 1R4PB 3KYHC 1Y14B 4ZLTF 3HGBA 1IYUA 3O13A 1B9NA 1UE6A 4KY5A 4H02A 2NZOA 2VS1A 1C48A 4I7ZC 3KFUA 2A68C 1SMYD 3CU7A 5GAEC 4TKOB 3UDFA 2YTYA 2K5HA 4MNOA 1X3GA 2KECA 3SK8A 4LFCQ 3HOZB 3W1GA 2WKCA 3K5NA 4LF7Q 1PFMA 2JP1A 1XMQL 5GQOA 3A7LA 1IKLA 4A3IB 4DV1Q 4LF8L 3NQIA 3K59A 4RFBA 1D7QA 4LF4Q 1XWEA 3H15A 5BN3A 1Q8KA 3OIQA 1EOTA 2GN5A 1BKBA 2L4NA 4RKBA 2E75C 1WVLA 3MC0B 1XPOA 2QGQA 4RCOA 2ZTDA 2RVLA 1VQCA 1ESRA 3E9IA 4O1NA 4GNXB 1Y69U 1XMOQ 2P5ZX 4NB3A 1Y8NB 2QCPX 4LFCL 2JA7H 4DV5Q 2BA0A 3CC2A 2JSOA 3I70A 3PIOA 5ELBA 4A3CH 2CCZA 1LO5D 4P75A 3DM3A 5M5XB 4FXKC 3C3LA 3IAYA 5A35A 3DEPA 4DV1L 5M5YB 1EYGA 2E2JH 4IALA 5M3MG 3VR3A 1B50A 1N8RC 1MHWC 5IYCG 4K5WA 2F3IA 2RDGA 1I6HB 4DV6Q 3K80C 3M4PA 1OTCA 2K32A 4JI4Q 2F0HA 2WP8J 5FLXL 5EJWA 3GDEA 2ATWA 4RCNA 1S4ZA 3NHHA 1GD7A 1VQ4A 5C0XG 3MA2B 5A2QL 1M8AA 4G4KA 3CKIB 5NUCA 1J5EL 5IIFA 1MBYA 5CV4A 1MGSA 3WOFA 4YY3Q 4JVZA 1GXDC 1JWMD 3BZCA 3J80L 1CUKA 1IW7D 2UUAL 3OMCA 2PNHA 3IKJA 5LHY1 4JI6L 1S5FD 2BDOA 3MXGA 1VQLA 2WACA 2EOTA 4Y7NB 4DV6L 3G7LA 2G9DA 3D4RA 2R7ZG 2RQXA 3OHXC 1NR2A 3ITPA 1R4QB 4O0AA 3NWSA 4L6TB 4GOPA 4A3BG 4KKUA 1X6OA 2E5LQ 3PUVA 1R9TH 1VQKA 4DAYB 4B3MQ 4RGMA 1X3FA 1OXXK 3HOYH 3BDCA 3SHLA 4NXML 3S14B 3FPUB 2X6LA 1K0RA 5DAUA 4YY3L 4FO2A 1IZ6A 3VR4A 4LF5L 3WDNA 2B2YC 1ICFB 1CI3M 2QEJC 5I4DA 3H0GB 1N36L 1WD0A 1K3RA 4TSSA 2BE5C 3MXPA 1V9PA 3T51B 1QILA 1LTBD 1YHAA 1SDFA 3M7NA 4HAEA 1LACA 1JWUD 2WKDA 2RHSB 2B29A 5M3MH 1BCPD 3E5SA 4FVMA 4TQUS 3GTJH 1SE3A 1CT1D 4UY8C 5JEAJ 1HZAA 4KKSA 1TWHH 1MIUA 1ZYRD 3Q22A 3TRZA 5ELFA 2K04A 4UP9A 2KCMA 1XTCD 3A56A 1X3EA 1TXYA 2L9HA 3OTOQ 4L5SA 3PO3G 1WOCA 2JA9A 4GS3A 4CDEC 2NZ1D 5JJIA 5EKIA 4LF6L 2WINB 2WB1B 2WB1E 3CQZH 3M3YH 1VQMA 4QY7A 5KGUA 4JI1Q 1JOKA 2N49A 4A3FB 5C4HA 1PH1A 1VF5C 5CV7A 5ELOA 2F0EA 2K7VA 5FJ8G 1PA6A 4KV6A 1JT8A 4HSVA 1PRTB 1IL2A 2B63G 2KCNA 5COYA 5IGFA 5IWAL 3SR1A 4NDXA 1WYDA 2B2TA 5ELDA 1STAA 2R7ZH 4LFAQ 3MVVA 4A93H 1NBWA 2KUMA 5HURA 2MP1A 2NVTH 3R8BA 4XQQA 1TWAB 4A3BH 2JA5B 2MJ8A 3HG9A 1QZHA 2I46A 4WJWA 2D9UA 5G3LF 5CORA 1RTOA 4LW1A 4EQ5A 2RA4A 4CJ1B 1VQIA 1PFSA 4FF3A 3S2HH 1CFMA 2I5LX 3BVMA 2K1BA 4OWWB 1H9SA 3KF8B 1JC7A 1Q3LA 1YNNC 2BOSA 2O4XA 3S15H 5BN5A 2ENBA 4QMGA 1G2SA 2G5DA 2OTLA 3RZDB 3NSWA 4AQYQ 2GA4B 1ICWA 1G6ZA 1SNOA 1EFID 2F0MA 1PDQA 2PW7A 1WTXA 2HUGA 3GTKH 3GTPB 3TDQA 1HPCA 1KRTA 1CKOA 4QJFA 1S72A 4DXGA 3IL8A 1U4MA 1TVXA 4TRDA 1FL0A 4BY7B 2JYOA 2CW0C 4MZ9A 3RLNA 2L12A 5I6WA 2K5QA 4B3RL 3PO3H 3Q6SA 1UNSA 1Y1VH 1LTAD 4B3SQ 1UAPA 4RA8A 4DV2Q 3PF4A 4DV0Q 4LFBQ 4DFAA 4A3LH 2CH4W 4XDXA 3EJIA 3S9WA 3G4SA 4BS9A 1I5FA 3KDFA 2F0UA 3GP7A 3I91A 3F8TA 2KJXA 1SR3A 2L15A 5JEAG 1P8LA 3S16H 2UUBQ 2QEXA 5E1FA 1G91A 1OO9B 2MNAA 5J3BA 2Q8TA 5TSSA 2JA8H 1QUQA 2F3VA 5FO8B 2L0CA 5K5PA 2MO0A 1PV4A 1WTHA 1UEAB 3T1HL 4UP7A 1HNWQ 1GHJA 4OWXB 1K0SA 4KJNA 1PTOC 1VMPA 4XT1B 2JN4A 4TVAB 2B3GA 4HCSA 3K7AH 1DOMA 3VYRA 4DR1Q 3GTMH 4A3GG 4JOIA 3QJYA 3BJUA 2PMZB 2PMZE 2UUBL 2RF4A 1Z9FA 2R3ZA 2F0PA 3VA7A 4HIDA 3E3XA 1CSPA 1PZID 3S2DH 2XRQD 3HKSA 1SYFA 4PMCA 1CKMA 3HOXG 4X3TA 1I4HA 4NP5A 2J0TD 2O5IC 3MFYA 4K5VA 2Y0SB 1VMCA 2Y0SE 1G51A 2Q2TA 3UDIA 2MHVA 1RIPA 1N9WA 3S1QB 1JOOA 1NMFA 1VQJA 5EPJA 1FJGQ 2ALYB 3C1FA 4FDBA 5AJ3L 4C3HG 1N34L 2YTVA 3PSIA 3BZKA 4DR1L 2VNUD 5HGTA 1U4RA 1DOKA 2B2YA 2CVRA 2NVQH 4DR6L 1GO3E 3NTHA 1EL0A 2EZVA 1XNQL 1V43A 4HSPA 1WTVA 4RHSA 4X64Q 1X65A 1MI2A 5GAHC 1LV9A 2K01A 3JAMc 4JI8Q 1XNRQ 5CYUA 4RGNA 4J15A 1XPUA 5JEAH 4OX9Q 2NYZD 5EPLA 1B9MA 3MWYW 1YVCA 1X54A 5FLMH 4CDFC 4A3MH 2DY8A 1X55A 2NN6G 2ZTCA 4QCLA 3Q23A 1TR5A 4JV5L 4IURA 1HHVA 2IY5B 3RR5A 4X3KA 3I4MG 3RD4A 5C4XB 2A69C 4H44C 2YU9H 1AEXA 4FNFA 1YNND 1W2BA 1KC8C 2H1EA 1NNXA 1TWCB 2E8GA 3I4OA 2LKVA 1TWGB 3ERSX 2HHHQ 1I3QH 5M3FB 4JI8L 3D31A 1G8ZD 4G7OC 1HTPA 4OX9L 2Z4HA 5M5WH 2E2IB 5C3EG 3KLSX 3NQTA 2EVBA 1ET9A 4C3JH 4JI2Q 4GNXC 4DV3Q 2CW0D 1RD9D 3HOXH 1NAPA 4M8AA 5C0XI 4C3HB 2CWAA 4AH6A 1Q1BA 1HA6A 2D0OA 2F1MA 2F52A 5T1IA 3HOWG 5D14A 5K36H 2NUCA 2VY3A 1NY4A 2EY5A 5IYBG 3T1YQ 1JORA 2VXWA 3HOUB 3OWEB 4P71A 4ZKCB 5C6AA 1C4QA 1XPRA 1CZWA 3ZJYC 1NJIC 2MPMA 2BCOA 5J39A 1YNJD 1FD7D 5JVG3 1C0AA 1SFOB 4JI2L 4JI0Q 2L55A 1RJTA 2M2LA 2OT2A 3FDTA 4CDDC 3KK7A 3RLFA 5JPNC 1YHQA 2UXBL 3CRLC 3BDOA 4YCWA 4IOCA 4A3KB 3I4MB 1IBKL 1RCVD 3H94A 4XYOA 3UDGA 4OWTB 2NN6H 4GOPC 4JI7L 4PNYA 4IUNA 4QGUA 2J7ZA 3SK5A 1L0YB 2ZT9C 3K0XA 2I5MX 1BXTA 3BYYB 5ELNA 3VDYA 3PV0A 2K33A 5IYDH 4HMIA 4X65Q 2PQAB 3E9HA 4JI0L 4DAPA 3MEHA 3G71A 1GUSA 2AMCB 4G7HC 5DM73 1W6KA 4XQJA 2A6EC 1FYCA 3K5OA 1U4LA 1B8AA 2KVMA 3PO2H 4GKJQ 1SE2A 2RHQB 2EQSA 4PV1C 1IW7C 1QWYA 3HKZB 3HKZE 5J1ZA 3P1HA 4O2DA 4DGZA 5KIXA 1Y1WH 2VUMB 1IYJB 1TIID 3HOZG 4KI0A 2R93H 1L1OB 1LTSD 2PNRC 5EGTA 1GM5A 1STGA 3CC7A 4LUOA 5C5LA 1KHIA 4IUPA 4A3IG 1A3UA 1LTRD 4CKEA 1V1OA 4WRDA 3CXCA 4C2MH 4GKKQ 4OIKA 4JBJA 1Q12A 1CM9A 2EYMA 4ZK9B 1L1OA 3DXJC 1II3A 2ZJPA 3GQBA 3FEWX 3RZOH 2LMCB 1PZKD 1E1OA 2BDNA 1Q82C 3BS1A 4GLVB 3I4NB 4OEMB 2E2HH 2VZAA 2V4DA 3EROA 4C3IH 5FLXE 1SBBB 3X3MA 4CHTB 1SYGA 4FYDA 1F2LA 3M4YA 2CH4A 4DNTB 3J7A5 2LXJA 2K14A 1GOZA 2B2TC 2D62A 4LF8Q 4R4TA 4A3JB 1A3VA 3KLWA 1ZYRC 3HOVB 4NKLA 1FNVA 3AEVA 1KIXA 1GUWA 3PUXA 3S1NH 1MJCA 1J8IA 3CP0A 2F0TA 1SMXA 5IT9c 5GADC 4X3SA 4OO1G 2Q2UA 1V1QA 3OMGA 4YWKA 2AUJD 1GUTA 1Q90A 4UP8A 1BNZA 4PMWA 3TS0A 3HS0C 1K73C 2AHOB 3QG1A 4DR5L 1RTNA 2JEAI 1Q8IA 2LSSA 1KNAA 2BA1A 4JC0A 3A74A 2O5JC 3M4OB 1S5CD 4ZUIA 5IP7H 3HOZH 3V2TA 1S5DD 1SJHD 1YHBA 3CCLA 4JI3L 4POGA 2F4VL 1PXUA 4IFDJ 4Q5VA 3F1ZA 1K3BC 1UE1A 1STYA 5D3DA 5JJLA 5EPKA 1H9MA 1C9OA 1PH2A 4F88A 1RHPA 3U50C 1A63A 4LAAA 2R7FA 4OELB 4C1NI 4MTNA 5IGDA 3MZ5A 3I73A 3UE1A 3PCOB 1J5EQ 4GZYC 3CF5A 3W2DA 2FINB 1RF2D 3MFGA 1EY7A 2YYZA 1TS4A 1I50B 1O7YA 2IJ0A 4GNXA 1VQ5A 2CHBD 2EY1A 3NE5B 2UUAQ 1O78A 4H7BA 4HJAA 1KDAA 3H0GG 1CKNB 4JI6Q 2HCCA 5M5XH 1KAAA 3K81C 2F0FA 4YHHL 4X66L 4IUQA 1X32A 3NBHB 5AFWA 2NVXH 4UAIA 5M5YH 1K83B 4G7ZC 1B3QA 3CMAA 1K9MC 3TZDA 5C4JB 4RG1A 1B7YB 3MXUA 1H9JA 2E2DC 1I6HH 2XRSD 2A6ED 3A55A 1NUCA 2VQFQ 2MFIA 1HFGA 4NXMQ 3P75A 1JE4A 3E0JA 1ESFA 1HXYD 4JOIC 4LWCA 2NVYB 2HCIA 4LF5Q 3A5ZB 1QB5D 2WB1G 5IY0A 3AYHB 1E2VA 1TS5A 3PUYA 4KHPQ 1N36Q 4A3FG 1VQNA 4X62L 3STBD 1ZKOA 3JAML 3TP7A 4RGOS 2KHIA 3HP3A 2KCTA 4ULLA 2DNCA 1PH9A 4L5QA 4QL5A 4KY6A 1VQGA 2PYKA 2QILA 5DLQE 4EQPA 1F9QA 3SEBA 1I4RA 1TS3A 2VQFL 4HIMA 2PCFB 3U4ZA 3J81c 3VA5A 2JXMB 2JA5G 1YNXA 2F4IA 3HOYB 3H6MA 5BR8L 4ZQ3A 2JQOA 4QF4A 3GTOB 4DAYA 4LF6Q 1AZQA 4KHPL 1BQQT 3FKIG 5LL6S 1FNUA 2NN6I 2HIXA 2AWNA 2FHTA 1EWHA 1E2WA 2EJFC 2LY7A 4BXXG 2R92B 5FO7B 1EY5A 1HNZQ 1EY0A 3P7JA 1K8MA 1AW7A 3A5UA 1B1ZA 1MD2D 2HD3A 3CW2C 4IFDG 5IYCH 3GTGB 5IWAQ 1PRTD 1S5ED 2RCNA 1Q81C 3GTQB 1HZ9A 1XYIA 1WTWA 4WJ4A 1TWHB 2B8GA 4RWSC 1FVIA 1ENAA 4IO9A 1E3PA 1PFNA 4BY7G 1X56A 5C0XH 3S1MH 4L63B 5JPMC 1VQHA 4IUTA 1LYLA 3RN2A 2F0WA 2RKSA 2CFMA 2C35B 1I94L 1A15A 4JK1C 3ND8A 4AYBB 4AYBE 4IPGA 3M3YB 4KHVA 1HNZL 4RAUC 2C5CA 1PH3A 1F2ZA 2E74C 5IP9G 2IX1A 1E0BA 1SE8A 1BBWA 5EAYA 2CQOA 4JI5L 4CKCA 2EXZA 2PZTA 5E7NA 2Q8RE 1W6JA 1SYCA 1N32Q 4XQNA 3AFPA 3BU2A 1VS0A 3V96A 4A93B 4ME5A 2I0QA 2B2VA 3FKIB 2K03A 1UEBA 1LABA 4HN7A 1PTOF 4OL7A 2EY6A 1TWAH 2JA5H 1SSOA 4B3RQ 2M00A 2GVBA 2TSSA 3NP8A 1BOSA 2K52A 1HNXL 1VQ6A 1GUOA 3S15B 1IBLQ 1LTTD 1O80A 4ODGA 4N8FA
chains in the Genus database with same CATH topology
1X54A 5C4JH 4KHZA 5BR8Q 2UXBQ 2VL6A 5FLMH 4A3MH 1XMOL 3TEHB 1N32L 1PYBA 1X55A 4DV5L 2NN6G 2DUDA 2ZTCA 4X65L 3JC66 3CD6A 1HH2P 4JV5L 1EIFA 3GO5A 3E0EA 4JBWA 5LMNL 1IBMQ 4AYBG 2IY5B 5HY6A 3RR5A 3RNUA 3I4MG 2NVYH 1A62A 2VW9A 4K0KQ 1YJ9A 2YU9H 1IXRA 1Q1EA 3S1RH 1VQBA 1YIJA 4IPHA 3GTPH 1W2BA 4JBKA 2D0PA 4DKAC 1KC8C 4WJ3M 1E7ZA 3J7ZC 4GN5A 3I4OA 2E8GA 1YZ6A 4GLAC 3B6YA 4DNIA 2Y0SG 3ERSX 4Y7NH 1HR0W 3J81j 4GKJL 4DK6C 3CCVA 1I3QH 2HHHQ 2ZJQA 4YWLA 4JI8L 5C0XJ 4DV7Q 3T1HQ 4BY7H 3D31A 2HQLA 3F2CA 3J80i 3EIVA 1UWVA 2MO1A 4P72A 1IBLL 4OX9L 2WAQG 2WFWA 4JI4L 4HJ7A 5M5WH 4A93G 4RMFA 5C3EG 2EIFA 3L2PA 4C3JH 3CCQA 4LNQA 5FJ8H 4JI2Q 3G48A 4GNXC 3AQQA 4DV3Q 3I2ZA 3HOXH 1E24A 1YBYA 4HJ9A 4HJ8A 1Q7YC 1XMQQ 5C0XI 2B63H 3PIPA 3S14H 1IBML 2CWAA 4AH6A 1Q1BA 1NTGA 3WWVA 2D0OA 3PF5A 2A19A 2F52A 1QZGA 1LM0A 1I94Q 4GKKL 1E22A 4BBSH 3KYHC 1Y14B 1L2FA 3HOWG 4K0KL 2H5XA 2VY3A 1SRUA 3GTOH 1KAWA 1NY4A 1UE6A 4A76A 5IYBG 3T1YQ 4H02A 2BH2A 3H0GH 1VQPA 2NZOA 2VS1A 3KFUA 4LF9Q 4P71A 4JI5Q 2LXKA 3H3VH 3W5OA 2Q2IA 1WFQA 2XGTA 5GAEC 4DV7L 3ULPA 1XPRA 3UDFA 2YTYA 4HIKA 2K5HA 2R92H 3ZJYC 4MNOA 1X3GA 1NJIC 1C7YA 4LFCQ 5AJ3Q 1N34Q 2EXDA 1C0AA 3GTGH 3W1GA 5HGQA 1L1OC 4JI2L 4R4OA 4JI0Q 4LF7Q 5C4XG 1NE3A 2VQEQ 1YHQA 3EN2A 4A75A 3GTQH 3RLFA 2E5LL 1XMQL 5GQOA 3NENA 4PZ6A 5GAGC 3D0FA 4R4IA 4B3ML 2ZM6L 4DV1Q 5H1SE 2MQHA 4LF8L 4DR6Q 4YCWA 4DR2L 4A4IA 1Q46A 2JA6G 4IOCA 1D7QA 1XNQQ 4LF4Q 3H15A 5M3FG 1PH8A 2A8VA 1T9HA 1IBKL 3OW2A 1Q8KA 1Y1VG 1KL9A 3A0JA 1HNXQ 3CCJA 2GN5A 1BKBA 3UDGA 4LF9L 4OWTB 4GOPC 1M1KC 1XPOA 4IJHA 1S3OA 2QGQA 3AFQA 4A3FH 1S40A 4JI7L 4A3LG 1PVOA 4QGUA 1HJPA 2ZTDA 3K0XA 1JJGA 1VQCA 3E9IA 4GNXB 2R7DA 4HJ5A 2I5MX 1W3SA 1XMOQ 4OO1I 4ME3A 5ELNA 3VDYA 4NB3A 3PV0A 2IHEA 4LFCL 2JA7H 4DV5Q 5IYDH 2BA0A 2Z6KC 4GN4B 4R1JA 3PIOA 3K8AA 2PQAB 4X65Q 3CPWA 3CC2A 4JV5Q 1K8GA 3E9HA 4GN3B 2CCZA 4JI0L 4A3CH 4P75A 2VQEL 3DM3A 5GROA 3G71A 1PH7A 2AMCB 1KXLA 1JE5A 1HR0L 4DV1L 1KQSA 1EYGA 2E2JH 1D8LA 2JA8G 3HOUG 5M3MG 1G291 1B8AA 3K7UC 1SROA 4UPAA 3OTOL 3PO2H 2JJQA 1N8RC 4GKJQ 1G6PA 2RHQB 1WCMG 2EQSA 2ZTEA 3FP9A 5IYCG 2F3IA 3TQYA 3HKZE 1YEZA 4O2DA 4DV6Q 3FKIH 1Y1WH 3K80C 1IYJB 3M4PA 1OTCA 2OQKA 4JI4Q 4KI0A 3HOZG 2R93H 1L1OB 3KOJA 2WP8J 3SGIA 3J80c 1GM5A 3S24A 3GDEA 4JI1L 3CC7A 2ATWA 2R6GA 4BXXH 1VQ4A 1GD7A 4LUOA 1KHIA 5C0XG 4A3IG 3OYYA 3RZDH 1VQ7A 4BBRG 2IT1A 1J5EL 3CXCA 4C2MH 4GKKQ 3GD7A 4A3KG 2JK8A 4JBJA 1Q12A 3U4VA 3PUWA 4OXPA 4A3DG 3RLOA 1L1OA 2ZJPA 1GKHA 4QIWE 4YY3Q 1OXUA 3RZOH 4PG3A 3KF6B 3BZCA 1Q82C 1CUKA 1E1OA 2UUAL 4GLVB 2PNHA 4LFAL 1EQQA 3DLLA 2E2HH 4JI6L 2HT1A 4DPGA 2VZAA 1VQLA 4C3IH 3ULLA 2BH8A 4A3GH 5C4XH 4DV6L 3KJPA 4PZ8A 1QVGA 3S17H 2R7ZG 3I7FA 1CSQA 1J6QA 1AE2A 3PGZA 2N8NA 2DGYA 1VQAA 2KHJA 1TWGH 3CPFA 4O0AA 4GOPA 2JA6H 4A3BG 3J7A5 2UXCL 2OTJA 4BA2I 2OWOA 3KDFB 1X6OA 4JYAL 2UXBL 2LXJA 2K14A 3M9BA 3PUVA 5IP9H 4DUZL 1R9TH 2E5LQ 2D62A 4R4CA 3L7ZC 4DAYB 3F2BA 1Q86C 1EIYB 2ZM6Q 1VQKA 4B3MQ 1X3FA 4LF8Q 4IOAA 1OXXK 4DR2Q 4POFA 3HOYH 4R4TA 2Z6KA 4NXML 2ASBA 1GVPA 4AQYL 3KLWA 2E2IH 3I56A 1PYSB 1K0RA 4YY3L 1IBKQ 1SN8A 4B3TL 3HKZG 3AEVA 1KIXA 1IZ6A 3ER0A 3PUXA 1L0WA 1SLJA 1QUQB 1YJNA 4LF5L 2VUMG 3S1NH 4L5RC 4DV4Q 4C3HH 3EBEA 4JG2A 4BY1G 4JI7Q 1MJCA 1VQOA 3CP0A 5IT9c 1SMXA 1OXTA 5GADC 1N36L 4OO1G 1K3RA 2Q2UA 1B70B 1V9PA 1YHAA 1V1QA 1KD1C 3M7NA 4YWKA 5FLMG 1A0IA 2PI2E 4A3MG 2N78A 1VQ8A 4UP8A 2RHSB 4PMWA 2B29A 3TS0A 2A1AA 4NXNL 5C44G 5M3MH 2OCEA 4TQUS 5LMNW 3GTJH 1K73C 1PH5A 2AHOB 1WJJA 1A8VA 3CC4A 4UY8C 5JEAJ 1BBUA 1HZAA 3J81i 1MJEA 1TWHH 1WCMH 1HR0Q 1MIUA 4DR5L 1AE3A 3TRZA 2JEAI 4B3SL 4NPSA 2LSSA 3I4NG 2BA1A 1UE7A 4UP9A 2KCMA 4JC0A 3A74A 4DV2L 4DV0L 4LFBL 4DR7Q 1X3EA 2JEBI 5IP7H 1TXYA 3HFZB 2UU9Q 3HOZH 3OTOQ 4L5SA 1SFOH 3PO3G 3U58A 4JBMA 1WOCA 1YHBA 2JA9A 2K4KA 4JI3L 1O7IA 3CCLA 4POGA 2F4VL 4DV4L 4GS3A 2YTXA 4IFDJ 2HIVA 3F1ZA 1UE1A 5JJIA 4DUYQ 5JJLA 4LF6L 4EX5A 1VCIA 2WB1E 3CQZH 1C9OA 3M3YH 1VQMA 4QY7A 1PH2A 4JI1Q 2N49A 3I4MH 2IHFA 4A3DH 1PH1A 1PH4A 3U50C 1A63A 5ELOA 3CAMA 2R7FA 5FJ8G 1RL2A 4MTNA 1XJVA 1PA6A 1JT8A 3UE1A 4A3JG 3PCOB 1J5EQ 3CF5A 3HOVG 2GVAA 4LUVA 2ZJRA 1IL2A 4DR3L 2B63G 1BVSA 5IWAL 2XTIA 5FLXc 3S1QH 2YYZA 3UE0A 4IFDI 1EWIA 4GNXA 1XTDA 5K36G 1WYDA 5IE8A 1VQ5A 1HNWL 2UUAQ 4DR7L 5LMUQ 2UU9L 4HJAA 2R7ZH 4LFAQ 3MEFA 3H0GG 2IX0A 2FXQA 1CKNB 4JI6Q 1NBWA 4A93H 2PQAA 5C3EH 2NVTH 1ASZA 5M5XH 4HIOA 3RN5A 3K81C 4YHHL 4A3EG 4A3BH 4X66L 1UE5A 3NBHB 4DUYL 2NVXH 1U0LA 3LGJA 1QZHA 5M5YH 1OXVA 3CCMA 5JJKA 2N3SA 4LW1A 4EQ5A 3STBC 3CMAA 3PUZA 1VQIA 1PFSA 3HOWH 3S2HH 1K9MC 2UXCQ 2I5LX 1MKHA 1N33Q 4OWWB 4JYAQ 4RG1A 1B7YB 2OQ0A 5IYBH 3KF8B 1HZBA 4BA1I 1Z47A 4DUZQ 4GOPB 2NZHA 1I6HH 2VUMH 3S15H 2AWOA 2VQFQ 2MFIA 2UUCL 2OTLA 4NXMQ 4AQYQ 4BY1H 3NEMA 1PH6A 1VQDA 4B3TQ 2K50A 1YI2A 4JOIC 3GTLH 4LWCA 5LMUL 4LF5Q 1E1TA 4XIGS 2V1CC 3GTKH 3A5ZB 1FJGL 2WB1G 4KLKA 2CKZB 3AYHB 5IY0A 3CCUA 4X6AH 4KHPQ 3PUYA 5C44H 1KRTA 1N36Q 4A3FG 1CKOA 3MXNB 4QJFA 1VQNA 4X62L 3STBD 1S72A 1VQFA 3KJOA 3H3VI 4YCUA 4AIMA 1FL0A 2KHIA 3CMEA 2YV5A 4MZ9A 4QQBX 1TWCH 3KF6A 3RLNA 3I4NH 2KCTA 3ULJA 3W1BA 5IYDG 4NXNQ 2JA7G 5M3FH 2KENA 1N33L 1PH9A 1NMGA 4L5QA 3JAMi 4QL5A 3F2DA 4A3CG 1P16A 1VQGA 5DLQE 4DAMA 4X64L 1JJ2A 3PO3H 1Y1VH 1EFWA 4B3RL 4DR5Q 4IPCA 2VQFL 4B3SQ 4HIMA 3U4ZA 3J81c 4DV2Q 1XNRL 3PF4A 4DV0Q 4LFBQ 4A3LH 4JCVE 1HZCA 2JA5G 3ICEA 1YNXA 3PO2G 4IJLA 3G4SA 5BR8L 4JI3Q 1I5FA 2F4VQ 2JQOA 3KDFA 1X9NA 1K8AC 1EUJA 3F8TA 4LF6Q 4KHPL 3FKIG 1SR3A 2L15A 4YWMA 5JEAG 3G6EA 1P8LA 4A3JH 1Y1WG 2UUBQ 3S16H 3TS2A 2QEXA 2NN6I 3HOVH 2R93G 2HIXA 2ES2A 2AWNA 2MNAA 1QVCA 5J3BA 4BXXG 2JA8H 1QUQA 1VQEA 3HOUH 1HNZQ 1EQRA 2ID0A 2I5HA 2MO0A 3A5UA 4DR3Q 1PV4A 3CW2C 4IFDG 5IYCH 5IWAQ 2HHHL 3IRBA 2RCNA 4A3EH 1Q81C 3T1HL 1HZ9A 4UP7A 1HNWQ 4APVA 1JMCA 4WJ4A 4R4QA 3Q8DA 4OWXB 2PI2A 1ASYA 2AKWB 4TVAB 2CWPA 1FVIA 4IO9A 2B3GA 1JJCB 1E3PA 4L5TA 1OXSC 3K7AH 4YHHQ 4DR4Q 4X66Q 4BY7G 1X56A 4DR1Q 3NELA 4A3IH 3GTMH 4A3GG 3S1MH 1LTLA 3TREA 4JOIA 4DV3L 1VQHA 4BBRH 3BJUA 1LYLA 3RN2A 2PMZE 2UUBL 1QVFA 2RF4A 1Z9FA 3M4OH 4A3KH 1WI5A 2CFMA 2C35B 3UDXA 4HIDA 1I94L 1LUZA 1CSPA 4AYBE 4IPGA 3S2DH 1EOVA 3HKSA 1PHJA 1HNZL 4ALPA 3HOXG 1CKMA 3T1YL 1PH3A 1KRSA 5IP9G 2IX1A 1M90C 2UXDQ 1SE8A 1U5KA 2JE6I 2Q2HA 2UUCQ 1BBWA 5EAYA 4BBSG 2CQOA 3HOYG 4JI5L 4DK3C 4OONA 2Y0SE 1G51A 3I55A 2Q2TA 3UDIA 5E7NA 4XTCS 1RIPA 1N9WA 2Z0SA 1VQ9A 1NMFA 1VQJA 4P73A 3L0OA 2ALYB 1FJGQ 1N32Q 4LUZA 4FDBA 3AFPA 1JB7A 5AJ3L 3CCRA 4PZ7A 2YTVA 3BU2A 2WAQE 3PSIA 1VS0A 2K5VA 3BZKA 1N34L 4DR4L 4DR1L 1YJWA 4X62Q 2QA4A 4LF7L 2VNUD 3M85A 5LMNQ 2I0QA 1I50H 2R92G 2K5NA 1AH9A 1UEBA 4GLXA 2NVQH 4DR6L 4P74A 1GO3E 1CKNA 3CCEA 3CCSA 4IPDA 4LF4L 3FHWA 1TWAH 1V43A 2JA5H 1XNQL 4B3RQ 1DGSA 4X64Q 1TWFH 1X65A 3M4QA 5GAHC 3JAMc 2GVBA 4YCVA 4JI8Q 2UXDL 4Y52H 2K75A 1K83H 2K52A 1HNXL 1XNRQ 2KBNA 1VQ6A 4J15A 1FGUA 1XPUA 1YITA 1IBLQ 4OX9Q 5IP7G 1H95A 1YVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X54 A;  5C4J H;  4KHZ A;  5BR8 Q;  2UXB Q;  2VL6 A;  5FLM H;  4A3M H;  1XMO L;  3TEH B;  1N32 L;  1PYB A;  1X55 A;  4DV5 L;  2NN6 G;  2DUD A;  2ZTC A;  4X65 L;  3JC6 6;  3CD6 A;  1HH2 P;  4JV5 L;  1EIF A;  3GO5 A;  3E0E A;  4JBW A;  5LMN L;  1IBM Q;  4AYB G;  2IY5 B;  5HY6 A;  3RR5 A;  3RNU A;  3I4M G;  2NVY H;  1A62 A;  2VW9 A;  4K0K Q;  1YJ9 A;  2YU9 H;  1IXR A;  1Q1E A;  3S1R H;  1VQB A;  1YIJ A;  4IPH A;  3GTP H;  1W2B A;  4JBK A;  2D0P A;  4DKA C;  1KC8 C;  4WJ3 M;  1E7Z A;  3J7Z C;  4GN5 A;  3I4O A;  2E8G A;  1YZ6 A;  4GLA C;  3B6Y A;  4DNI A;  2Y0S G;  3ERS X;  4Y7N H;  1HR0 W;  3J81 j;  4GKJ L;  4DK6 C;  3CCV A;  1I3Q H;  2HHH Q;  2ZJQ A;  4YWL A;  4JI8 L;  5C0X J;  4DV7 Q;  3T1H Q;  4BY7 H;  3D31 A;  2HQL A;  3F2C A;  3J80 i;  3EIV A;  1UWV A;  2MO1 A;  4P72 A;  1IBL L;  4OX9 L;  2WAQ G;  2WFW A;  4JI4 L;  4HJ7 A;  5M5W H;  4A93 G;  4RMF A;  5C3E G;  2EIF A;  3L2P A;  4C3J H;  3CCQ A;  4LNQ A;  5FJ8 H;  4JI2 Q;  3G48 A;  4GNX C;  3AQQ A;  4DV3 Q;  3I2Z A;  3HOX H;  1E24 A;  1YBY A;  4HJ9 A;  4HJ8 A;  1Q7Y C;  1XMQ Q;  5C0X I;  2B63 H;  3PIP A;  3S14 H;  1IBM L;  2CWA A;  4AH6 A;  1Q1B A;  1NTG A;  3WWV A;  2D0O A;  3PF5 A;  2A19 A;  2F52 A;  1QZG A;  1LM0 A;  1I94 Q;  4GKK L;  1E22 A;  4BBS H;  3KYH C;  1Y14 B;  1L2F A;  3HOW G;  4K0K L;  2H5X A;  2VY3 A;  1SRU A;  3GTO H;  1KAW A;  1NY4 A;  1UE6 A;  4A76 A;  5IYB G;  3T1Y Q;  4H02 A;  2BH2 A;  3H0G H;  1VQP A;  2NZO A;  2VS1 A;  3KFU A;  4LF9 Q;  4P71 A;  4JI5 Q;  2LXK A;  3H3V H;  3W5O A;  2Q2I A;  1WFQ A;  2XGT A;  5GAE C;  4DV7 L;  3ULP A;  1XPR A;  3UDF A;  2YTY A;  4HIK A;  2K5H A;  2R92 H;  3ZJY C;  4MNO A;  1X3G A;  1NJI C;  1C7Y A;  4LFC Q;  5AJ3 Q;  1N34 Q;  2EXD A;  1C0A A;  3GTG H;  3W1G A;  5HGQ A;  1L1O C;  4JI2 L;  4R4O A;  4JI0 Q;  4LF7 Q;  5C4X G;  1NE3 A;  2VQE Q;  1YHQ A;  3EN2 A;  4A75 A;  3GTQ H;  3RLF A;  2E5L L;  1XMQ L;  5GQO A;  3NEN A;  4PZ6 A;  5GAG C;  3D0F A;  4R4I A;  4B3M L;  2ZM6 L;  4DV1 Q;  5H1S E;  2MQH A;  4LF8 L;  4DR6 Q;  4YCW A;  4DR2 L;  4A4I A;  1Q46 A;  2JA6 G;  4IOC A;  1D7Q A;  1XNQ Q;  4LF4 Q;  3H15 A;  5M3F G;  1PH8 A;  2A8V A;  1T9H A;  1IBK L;  3OW2 A;  1Q8K A;  1Y1V G;  1KL9 A;  3A0J A;  1HNX Q;  3CCJ A;  2GN5 A;  1BKB A;  3UDG A;  4LF9 L;  4OWT B;  4GOP C;  1M1K C;  1XPO A;  4IJH A;  1S3O A;  2QGQ A;  3AFQ A;  4A3F H;  1S40 A;  4JI7 L;  4A3L G;  1PVO A;  4QGU A;  1HJP A;  2ZTD A;  3K0X A;  1JJG A;  1VQC A;  3E9I A;  4GNX B;  2R7D A;  4HJ5 A;  2I5M X;  1W3S A;  1XMO Q;  4OO1 I;  4ME3 A;  5ELN A;  3VDY A;  4NB3 A;  3PV0 A;  2IHE A;  4LFC L;  2JA7 H;  4DV5 Q;  5IYD H;  2BA0 A;  2Z6K C;  4GN4 B;  4R1J A;  3PIO A;  3K8A A;  2PQA B;  4X65 Q;  3CPW A;  3CC2 A;  4JV5 Q;  1K8G A;  3E9H A;  4GN3 B;  2CCZ A;  4JI0 L;  4A3C H;  4P75 A;  2VQE L;  3DM3 A;  5GRO A;  3G71 A;  1PH7 A;  2AMC B;  1KXL A;  1JE5 A;  1HR0 L;  4DV1 L;  1KQS A;  1EYG A;  2E2J H;  1D8L A;  2JA8 G;  3HOU G;  5M3M G;  1G29 1;  1B8A A;  3K7U C;  1SRO A;  4UPA A;  3OTO L;  3PO2 H;  2JJQ A;  1N8R C;  4GKJ Q;  1G6P A;  2RHQ B;  1WCM G;  2EQS A;  2ZTE A;  3FP9 A;  5IYC G;  2F3I A;  3TQY A;  3HKZ E;  1YEZ A;  4O2D A;  4DV6 Q;  3FKI H;  1Y1W H;  3K80 C;  1IYJ B;  3M4P A;  1OTC A;  2OQK A;  4JI4 Q;  4KI0 A;  3HOZ G;  2R93 H;  1L1O B;  3KOJ A;  2WP8 J;  3SGI A;  3J80 c;  1GM5 A;  3S24 A;  3GDE A;  4JI1 L;  3CC7 A;  2ATW A;  2R6G A;  4BXX H;  1VQ4 A;  1GD7 A;  4LUO A;  1KHI A;  5C0X G;  4A3I G;  3OYY A;  3RZD H;  1VQ7 A;  4BBR G;  2IT1 A;  1J5E L;  3CXC A;  4C2M H;  4GKK Q;  3GD7 A;  4A3K G;  2JK8 A;  4JBJ A;  1Q12 A;  3U4V A;  3PUW A;  4OXP A;  4A3D G;  3RLO A;  1L1O A;  2ZJP A;  1GKH A;  4QIW E;  4YY3 Q;  1OXU A;  3RZO H;  4PG3 A;  3KF6 B;  3BZC A;  1Q82 C;  1CUK A;  1E1O A;  2UUA L;  4GLV B;  2PNH A;  4LFA L;  1EQQ A;  3DLL A;  2E2H H;  4JI6 L;  2HT1 A;  4DPG A;  2VZA A;  1VQL A;  4C3I H;  3ULL A;  2BH8 A;  4A3G H;  5C4X H;  4DV6 L;  3KJP A;  4PZ8 A;  1QVG A;  3S17 H;  2R7Z G;  3I7F A;  1CSQ A;  1J6Q A;  1AE2 A;  3PGZ A;  2N8N A;  2DGY A;  1VQA A;  2KHJ A;  1TWG H;  3CPF A;  4O0A A;  4GOP A;  2JA6 H;  4A3B G;  3J7A 5;  2UXC L;  2OTJ A;  4BA2 I;  2OWO A;  3KDF B;  1X6O A;  4JYA L;  2UXB L;  2LXJ A;  2K14 A;  3M9B A;  3PUV A;  5IP9 H;  4DUZ L;  1R9T H;  2E5L Q;  2D62 A;  4R4C A;  3L7Z C;  4DAY B;  3F2B A;  1Q86 C;  1EIY B;  2ZM6 Q;  1VQK A;  4B3M Q;  1X3F A;  4LF8 Q;  4IOA A;  1OXX K;  4DR2 Q;  4POF A;  3HOY H;  4R4T A;  2Z6K A;  4NXM L;  2ASB A;  1GVP A;  4AQY L;  3KLW A;  2E2I H;  3I56 A;  1PYS B;  1K0R A;  4YY3 L;  1IBK Q;  1SN8 A;  4B3T L;  3HKZ G;  3AEV A;  1KIX A;  1IZ6 A;  3ER0 A;  3PUX A;  1L0W A;  1SLJ A;  1QUQ B;  1YJN A;  4LF5 L;  2VUM G;  3S1N H;  4L5R C;  4DV4 Q;  4C3H H;  3EBE A;  4JG2 A;  4BY1 G;  4JI7 Q;  1MJC A;  1VQO A;  3CP0 A;  5IT9 c;  1SMX A;  1OXT A;  5GAD C;  1N36 L;  4OO1 G;  1K3R A;  2Q2U A;  1B70 B;  1V9P A;  1YHA A;  1V1Q A;  1KD1 C;  3M7N A;  4YWK A;  5FLM G;  1A0I A;  2PI2 E;  4A3M G;  2N78 A;  1VQ8 A;  4UP8 A;  2RHS B;  4PMW A;  2B29 A;  3TS0 A;  2A1A A;  4NXN L;  5C44 G;  5M3M H;  2OCE A;  4TQU S;  5LMN W;  3GTJ H;  1K73 C;  1PH5 A;  2AHO B;  1WJJ A;  1A8V A;  3CC4 A;  4UY8 C;  5JEA J;  1BBU A;  1HZA A;  3J81 i;  1MJE A;  1TWH H;  1WCM H;  1HR0 Q;  1MIU A;  4DR5 L;  1AE3 A;  3TRZ A;  2JEA I;  4B3S L;  4NPS A;  2LSS A;  3I4N G;  2BA1 A;  1UE7 A;  4UP9 A;  2KCM A;  4JC0 A;  3A74 A;  4DV2 L;  4DV0 L;  4LFB L;  4DR7 Q;  1X3E A;  2JEB I;  5IP7 H;  1TXY A;  3HFZ B;  2UU9 Q;  3HOZ H;  3OTO Q;  4L5S A;  1SFO H;  3PO3 G;  3U58 A;  4JBM A;  1WOC A;  1YHB A;  2JA9 A;  2K4K A;  4JI3 L;  1O7I A;  3CCL A;  4POG A;  2F4V L;  4DV4 L;  4GS3 A;  2YTX A;  4IFD J;  2HIV A;  3F1Z A;  1UE1 A;  5JJI A;  4DUY Q;  5JJL A;  4LF6 L;  4EX5 A;  1VCI A;  2WB1 E;  3CQZ H;  1C9O A;  3M3Y H;  1VQM A;  4QY7 A;  1PH2 A;  4JI1 Q;  2N49 A;  3I4M H;  2IHF A;  4A3D H;  1PH1 A;  1PH4 A;  3U50 C;  1A63 A;  5ELO A;  3CAM A;  2R7F A;  5FJ8 G;  1RL2 A;  4MTN A;  1XJV A;  1PA6 A;  1JT8 A;  3UE1 A;  4A3J G;  3PCO B;  1J5E Q;  3CF5 A;  3HOV G;  2GVA A;  4LUV A;  2ZJR A;  1IL2 A;  4DR3 L;  2B63 G;  1BVS A;  5IWA L;  2XTI A;  5FLX c;  3S1Q H;  2YYZ A;  3UE0 A;  4IFD I;  1EWI A;  4GNX A;  1XTD A;  5K36 G;  1WYD A;  5IE8 A;  1VQ5 A;  1HNW L;  2UUA Q;  4DR7 L;  5LMU Q;  2UU9 L;  4HJA A;  2R7Z H;  4LFA Q;  3MEF A;  3H0G G;  2IX0 A;  2FXQ A;  1CKN B;  4JI6 Q;  1NBW A;  4A93 H;  2PQA A;  5C3E H;  2NVT H;  1ASZ A;  5M5X H;  4HIO A;  3RN5 A;  3K81 C;  4YHH L;  4A3E G;  4A3B H;  4X66 L;  1UE5 A;  3NBH B;  4DUY L;  2NVX H;  1U0L A;  3LGJ A;  1QZH A;  5M5Y H;  1OXV A;  3CCM A;  5JJK A;  2N3S A;  4LW1 A;  4EQ5 A;  3STB C;  3CMA A;  3PUZ A;  1VQI A;  1PFS A;  3HOW H;  3S2H H;  1K9M C;  2UXC Q;  2I5L X;  1MKH A;  1N33 Q;  4OWW B;  4JYA Q;  4RG1 A;  1B7Y B;  2OQ0 A;  5IYB H;  3KF8 B;  1HZB A;  4BA1 I;  1Z47 A;  4DUZ Q;  4GOP B;  2NZH A;  1I6H H;  2VUM H;  3S15 H;  2AWO A;  2VQF Q;  2MFI A;  2UUC L;  2OTL A;  4NXM Q;  4AQY Q;  4BY1 H;  3NEM A;  1PH6 A;  1VQD A;  4B3T Q;  2K50 A;  1YI2 A;  4JOI C;  3GTL H;  4LWC A;  5LMU L;  4LF5 Q;  1E1T A;  4XIG S;  2V1C C;  3GTK H;  3A5Z B;  1FJG L;  2WB1 G;  4KLK A;  2CKZ B;  3AYH B;  5IY0 A;  3CCU A;  4X6A H;  4KHP Q;  3PUY A;  5C44 H;  1KRT A;  1N36 Q;  4A3F G;  1CKO A;  3MXN B;  4QJF A;  1VQN A;  4X62 L;  3STB D;  1S72 A;  1VQF A;  3KJO A;  3H3V I;  4YCU A;  4AIM A;  1FL0 A;  2KHI A;  3CME A;  2YV5 A;  4MZ9 A;  4QQB X;  1TWC H;  3KF6 A;  3RLN A;  3I4N H;  2KCT A;  3ULJ A;  3W1B A;  5IYD G;  4NXN Q;  2JA7 G;  5M3F H;  2KEN A;  1N33 L;  1PH9 A;  1NMG A;  4L5Q A;  3JAM i;  4QL5 A;  3F2D A;  4A3C G;  1P16 A;  1VQG A;  5DLQ E;  4DAM A;  4X64 L;  1JJ2 A;  3PO3 H;  1Y1V H;  1EFW A;  4B3R L;  4DR5 Q;  4IPC A;  2VQF L;  4B3S Q;  4HIM A;  3U4Z A;  3J81 c;  4DV2 Q;  1XNR L;  3PF4 A;  4DV0 Q;  4LFB Q;  4A3L H;  4JCV E;  1HZC A;  2JA5 G;  3ICE A;  1YNX A;  3PO2 G;  4IJL A;  3G4S A;  5BR8 L;  4JI3 Q;  1I5F A;  2F4V Q;  2JQO A;  3KDF A;  1X9N A;  1K8A C;  1EUJ A;  3F8T A;  4LF6 Q;  4KHP L;  3FKI G;  1SR3 A;  2L15 A;  4YWM A;  5JEA G;  3G6E A;  1P8L A;  4A3J H;  1Y1W G;  2UUB Q;  3S16 H;  3TS2 A;  2QEX A;  2NN6 I;  3HOV H;  2R93 G;  2HIX A;  2ES2 A;  2AWN A;  2MNA A;  1QVC A;  5J3B A;  4BXX G;  2JA8 H;  1QUQ A;  1VQE A;  3HOU H;  1HNZ Q;  1EQR A;  2ID0 A;  2I5H A;  2MO0 A;  3A5U A;  4DR3 Q;  1PV4 A;  3CW2 C;  4IFD G;  5IYC H;  5IWA Q;  2HHH L;  3IRB A;  2RCN A;  4A3E H;  1Q81 C;  3T1H L;  1HZ9 A;  4UP7 A;  1HNW Q;  4APV A;  1JMC A;  4WJ4 A;  4R4Q A;  3Q8D A;  4OWX B;  2PI2 A;  1ASY A;  2AKW B;  4TVA B;  2CWP A;  1FVI A;  4IO9 A;  2B3G A;  1JJC B;  1E3P A;  4L5T A;  1OXS C;  3K7A H;  4YHH Q;  4DR4 Q;  4X66 Q;  4BY7 G;  1X56 A;  4DR1 Q;  3NEL A;  4A3I H;  3GTM H;  4A3G G;  3S1M H;  1LTL A;  3TRE A;  4JOI A;  4DV3 L;  1VQH A;  4BBR H;  3BJU A;  1LYL A;  3RN2 A;  2PMZ E;  2UUB L;  1QVF A;  2RF4 A;  1Z9F A;  3M4O H;  4A3K H;  1WI5 A;  2CFM A;  2C35 B;  3UDX A;  4HID A;  1I94 L;  1LUZ A;  1CSP A;  4AYB E;  4IPG A;  3S2D H;  1EOV A;  3HKS A;  1PHJ A;  1HNZ L;  4ALP A;  3HOX G;  1CKM A;  3T1Y L;  1PH3 A;  1KRS A;  5IP9 G;  2IX1 A;  1M90 C;  2UXD Q;  1SE8 A;  1U5K A;  2JE6 I;  2Q2H A;  2UUC Q;  1BBW A;  5EAY A;  4BBS G;  2CQO A;  3HOY G;  4JI5 L;  4DK3 C;  4OON A;  2Y0S E;  1G51 A;  3I55 A;  2Q2T A;  3UDI A;  5E7N A;  4XTC S;  1RIP A;  1N9W A;  2Z0S A;  1VQ9 A;  1NMF A;  1VQJ A;  4P73 A;  3L0O A;  2ALY B;  1FJG Q;  1N32 Q;  4LUZ A;  4FDB A;  3AFP A;  1JB7 A;  5AJ3 L;  3CCR A;  4PZ7 A;  2YTV A;  3BU2 A;  2WAQ E;  3PSI A;  1VS0 A;  2K5V A;  3BZK A;  1N34 L;  4DR4 L;  4DR1 L;  1YJW A;  4X62 Q;  2QA4 A;  4LF7 L;  2VNU D;  3M85 A;  5LMN Q;  2I0Q A;  1I50 H;  2R92 G;  2K5N A;  1AH9 A;  1UEB A;  4GLX A;  2NVQ H;  4DR6 L;  4P74 A;  1GO3 E;  1CKN A;  3CCE A;  3CCS A;  4IPD A;  4LF4 L;  3FHW A;  1TWA H;  1V43 A;  2JA5 H;  1XNQ L;  4B3R Q;  1DGS A;  4X64 Q;  1TWF H;  1X65 A;  3M4Q A;  5GAH C;  3JAM c;  2GVB A;  4YCV A;  4JI8 Q;  2UXD L;  4Y52 H;  2K75 A;  1K83 H;  2K52 A;  1HNX L;  1XNR Q;  2KBN A;  1VQ6 A;  4J15 A;  1FGU A;  1XPU A;  1YIT A;  1IBL Q;  4OX9 Q;  5IP7 G;  1H95 A;  1YVC A; 
#chains in the Genus database with same CATH topology
 4R9W A;  1DYQ A;  1EYA A;  3OW7 A;  1N32 L;  1QG7 A;  3U9O A;  3KF8 A;  1ET6 A;  4JW0 A;  1SE4 A;  1TS2 A;  4FF1 A;  1BF4 A;  4IFD H;  4KJO A;  3RNU A;  4PQX A;  1A62 A;  2VW9 A;  1IXR A;  3S1R H;  3S17 B;  1YIJ A;  4IPH A;  3GTP H;  3J7A F;  3AU7 A;  3TME A;  4GLA C;  2Y0S G;  3R2T A;  2JA6 B;  1IYV A;  1S5B D;  2X6G A;  4DV7 Q;  3T1H Q;  4BY7 H;  3GV6 A;  2RDF A;  3F2C A;  2QF7 A;  3NBI A;  1Y1V B;  1UWV A;  5EBC A;  2MO1 A;  1IBL L;  5DEH A;  4CBV A;  2WFW A;  4UDU C;  4J8Q A;  3T4A C;  2ZXO A;  4RMF A;  2A74 C;  3L2P A;  3CCQ A;  5FJ8 H;  1YNJ C;  3AQQ A;  1YBY A;  4HJ8 A;  2B63 H;  3PF5 A;  1QZG A;  1D5Z C;  2L1B A;  1SJE D;  2KOL A;  3S16 B;  1B4O A;  2H5X A;  1EZ6 A;  2B8F A;  5FOB B;  3G6J B;  1A6X A;  4XXE A;  2JA8 B;  1ZXT A;  2F3W A;  4DV7 L;  2Q2I A;  1WFQ A;  2X69 A;  1WCM B;  2K6A A;  1EEF D;  1DJR D;  3EVQ A;  1F2M A;  2RDH A;  1LTG D;  2EDG A;  2Z8L A;  1C7Y A;  5AJ3 Q;  1N34 Q;  1L1O C;  5CBA E;  5C4X G;  3L3O C;  1NE3 A;  3EN2 A;  4DN4 M;  4A75 A;  1DM0 B;  3R3O A;  2F0I A;  1HQR D;  1TY0 A;  4PZ6 A;  5GAG C;  3GTM B;  4R4I A;  2ZM6 L;  4DR6 Q;  5H1S E;  3QOJ A;  4HCE A;  4DR2 L;  3HRZ C;  1Q46 A;  1K8O A;  3EA6 A;  1XNQ Q;  3TN2 A;  5M3F G;  3A7A B;  1T9H A;  3OW2 A;  4A3D B;  4B9X A;  1BR9 A;  4P2C B;  5C5M A;  1SNP A;  3A0J A;  3CCJ A;  2KEE A;  2F0V A;  1M1K C;  4IJH A;  1S3O A;  1C8C A;  3NTK A;  1PVO A;  3MHB A;  1HJP A;  3X3N A;  3DUZ A;  4OO1 I;  2RBM A;  2IHE A;  1DCZ A;  4I65 A;  4GN4 B;  4R1J A;  3K8A A;  3FVQ A;  3ND9 A;  4JV5 Q;  2EYH A;  5GRO A;  5KRU A;  1PH7 A;  2WV6 D;  1KXL A;  3EQL C;  1HR0 L;  1KQS A;  3BZD B;  3HOU G;  1PLF A;  3A54 A;  1KAB A;  1SRO A;  1G6P A;  2ZTE A;  3FP9 A;  1KDB A;  1DZ1 A;  3TQY A;  3T13 A;  2OQK A;  4DNR B;  3J80 c;  1EY6 A;  4BY1 B;  4JPB W;  1EWC A;  3SE0 A;  3S24 A;  4LK1 C;  5E4W C;  3GTL B;  1D2B A;  2SNM A;  1HFN A;  3OYY A;  4A3M B;  1VQ7 A;  5EQ0 A;  3OIP A;  2IT1 A;  4BBR G;  4V19 0;  4A3K G;  2JK8 A;  5C44 B;  3LX0 A;  3PUW A;  4EQN A;  4IN3 A;  3RLO A;  1GKH A;  4Z9C B;  1OXU A;  4PG3 A;  3KF6 B;  2PW5 A;  4YIJ A;  1EZ8 A;  1CA5 A;  1ENC A;  3TZU A;  1EQQ A;  2YU9 B;  2HT1 A;  1MSH A;  4A3G H;  2BH8 A;  5C4X H;  1HCZ A;  4MTK A;  1I3Q B;  2KCC A;  4PZ8 A;  1QVG A;  5JOB A;  4DA2 A;  1J6Q A;  2FFK B;  3PGZ A;  2N8N A;  1VQA A;  3R2I A;  2HDL A;  3A8K E;  1TWG H;  2UXC L;  2OTJ A;  4BA2 I;  2OWO A;  3F2U A;  4JYA L;  2H4O A;  1EY4 A;  2IL8 A;  3M9B A;  4DUZ L;  3F2B A;  4R4C A;  3L7Z C;  5I9P A;  1LT5 D;  4C3J B;  1EIY B;  2UXB Q;  4POF A;  2Z6K A;  4DU9 A;  2E2I H;  1WTR A;  5CV8 A;  4B3T L;  1IBK Q;  1HRJ A;  1SN8 A;  3HKZ G;  5I6Y A;  2VUM G;  1SYD A;  1STN A;  1KNE A;  3MAQ A;  4L5R C;  1H9K A;  4DV4 Q;  5CV5 A;  4C3H H;  3EBE A;  4WOR A;  4JI7 Q;  1VQO A;  1OXT A;  3VYS A;  2Z1C A;  1B70 B;  2KED A;  4K8I A;  4RH6 A;  4A3E B;  1AP0 A;  1CQV A;  3BVZ A;  2C9O A;  3J81 L;  2E76 C;  1A0I A;  2PI2 E;  1VQ8 A;  2B2W A;  4K6D A;  2A1A A;  4NXN L;  4RKL A;  1J9O A;  1WJJ A;  3CC4 A;  3A8J E;  2SOB A;  1AE3 A;  3VYU A;  3I4N G;  4BBR B;  2QDB A;  2JEB I;  2SDF A;  3TSS A;  1SFO H;  3U58 A;  1RKN A;  4JBM A;  2K4K A;  1O7I A;  1V1P B;  5FK9 C;  4DV4 L;  2YTX A;  3CRK C;  1BUV T;  1BCP F;  1VCI A;  4H0L C;  5L37 A;  3LWE A;  4KD4 A;  5T1G A;  2PO4 A;  1JCK B;  3I4M H;  2IHF A;  1H9R A;  4DK1 A;  1PH4 A;  3NXW A;  1XJV A;  1RL2 A;  1X3Q A;  4A3J G;  4QUC A;  3D8G A;  5G3L D;  3HOV G;  4LUV A;  3SVM A;  4DR3 L;  1O7L A;  3UE0 A;  4IFD I;  4ILW A;  1XTD A;  5IE8 A;  3ERQ A;  5LMU Q;  3R93 A;  2FXQ A;  1HA5 A;  4LMQ D;  2PQA A;  4O42 A;  3DWA A;  3TBI B;  5C3E H;  1ASZ A;  4LJZ C;  4HIO A;  3RN5 A;  3PIP 3;  5IOC A;  1BO0 A;  3PO2 B;  1UE5 A;  1TWF B;  1GJX A;  3IFD A;  3H09 A;  1OXV A;  1M4V A;  3CCM A;  5JJK A;  2N3S A;  2F0O A;  1K28 A;  5ELC A;  3NPP A;  3STB C;  3PUZ A;  1Y1W B;  3HOW H;  3PMF A;  1DXM A;  1QNU A;  1TT2 A;  2R93 B;  1MKH A;  4V0B A;  3U9S A;  5IYB H;  2OQ0 A;  1HZB A;  3K5L A;  1Z47 A;  2NZH A;  2XSC A;  5C3X A;  2VUM H;  2AWO A;  4ABN A;  1PTO B;  2UUC L;  4FP5 D;  3NEM A;  2Z9H A;  3UI2 A;  4C2M B;  1Z6H A;  1YI2 A;  5LMU L;  5KEE A;  4OGQ C;  2O2L D;  4XIG S;  2V1C C;  1ONL A;  3OPO A;  3RZO B;  2CKZ B;  3CCU A;  3I90 A;  4HMJ A;  3AB9 A;  3MXN B;  2OF1 A;  5E3F A;  1VQF A;  3KJO A;  4YCU A;  2LFN A;  4C3I B;  2A5H A;  2ZXP A;  3QIA A;  4R8N A;  3I4N H;  2RSN A;  2JA7 G;  3W1B A;  5CGK A;  2KEN A;  1NMG A;  1B3A A;  1QCB D;  3JAM i;  4A3C G;  3Q24 A;  1P16 A;  4DAM A;  1JJ2 A;  4DR5 Q;  4IPC A;  3M7G A;  2OXP A;  1PRT C;  3KLR A;  1LLR D;  3PIO 3;  4BBS B;  4JI3 Q;  2B2V C;  2F4V Q;  3VYT A;  1CQF A;  1K8A C;  3JAM E;  2WII B;  2TMP A;  1EUJ A;  4YWM A;  3G6E A;  4A3J H;  3LWU A;  3TS2 A;  5ELE A;  3HOV H;  3D4D A;  3DWQ A;  4KD3 A;  1WTO A;  4K2L A;  3I3C A;  3K58 A;  4CJ0 B;  4MIU A;  2IWH A;  3A8I E;  3KBG A;  1HTL D;  4J1M A;  4K8J A;  1PZJ D;  1SND A;  4H13 C;  3IRB A;  3BYT B;  2EJG C;  4APV A;  4R4Q A;  3Q8D A;  4EVO A;  2K28 A;  1FNW A;  1CHQ D;  1D1K A;  1JJC B;  2XVS A;  4YHH Q;  4X66 Q;  1AN8 A;  4A3I H;  3NEL A;  1AFP A;  1LTL A;  1O7Z A;  1I4G A;  4K14 A;  1Y8P B;  1QVF A;  2F0Q A;  4X3U A;  3M4O H;  1WI5 A;  4K2K A;  3UDX A;  1LUZ A;  5CV6 A;  2SNS A;  1EOV A;  1PHJ A;  5IOD A;  1I4X A;  1KRS A;  2A6H C;  2JA7 B;  1EU4 A;  2ICI A;  1U5K A;  1DD2 A;  1D6E C;  3HOY G;  1PFB A;  2F0L A;  1T5E A;  4K5X A;  2XIW A;  5IGB A;  1Y8O B;  4KK7 A;  2Z0S A;  1IHZ A;  2E2J B;  1L0X B;  2F0S A;  2EYF A;  1UUP A;  1D5X C;  4LUZ A;  1I4Q A;  4EQO A;  5FKA C;  1PMR A;  1EIG A;  3CCR A;  2WAQ B;  2DJF C;  2WAQ E;  1YJW A;  4X62 Q;  2QA4 A;  4LF7 L;  4ZAI A;  1SNQ A;  3M85 A;  5LMN Q;  1I50 H;  2R92 G;  2FJ2 A;  3NWT A;  2PQE A;  2PZU A;  1AH9 A;  2Q8I B;  4GLX A;  2KA7 A;  2NVX B;  4K6L A;  1NR4 A;  3QWN A;  5KYL A;  1CKN A;  1SNM A;  3CCE A;  4LF4 L;  1DGS A;  1EQT A;  3NBH A;  5J22 A;  4YCV A;  4Y52 H;  5EBD A;  3BDL A;  1K83 H;  1KLU D;  2KBN A;  1FGU A;  4OO1 H;  4FXG C;  1B53 A;  1YIT A;  1H95 A;  5JAV A;  5C4J H;  5BR8 Q;  4QB4 A;  2VL6 A;  1XMO L;  2EYO A;  5C4Z A;  1WTP A;  5I2Y A;  4DV5 L;  2AQ3 B;  2DUD A;  1IL8 A;  2G9H D;  3JC6 6;  1HH2 P;  3SK4 A;  3URY A;  3GO5 A;  4B08 A;  5LMN L;  1IBM Q;  4AYB G;  5HY6 A;  3TP6 A;  2NVY H;  4K0K Q;  1YJ9 A;  3Q0A A;  1Q1E A;  1D1I A;  4JBK A;  4DKA C;  4WJ3 M;  3EFX D;  1DOL A;  4GN5 A;  3KUP A;  1YZ6 A;  5I2X A;  4Y7N H;  4GOP B;  3J81 j;  1WD1 A;  4DK6 C;  3CCV A;  3VR2 A;  2ZJQ A;  4N8X 1;  2RSO A;  2EYL A;  1R9T B;  1QE6 A;  3EIV A;  1V8Q A;  4MHE A;  4P72 A;  1SYE A;  4JI4 L;  4HJ7 A;  5LL6 X;  4A93 G;  3W3A A;  1TU2 B;  3G48 A;  2HQE A;  2HDM A;  4HJ9 A;  1WTQ A;  3QB3 A;  4F8M A;  3S14 H;  4KN7 C;  1IBM L;  1NTG A;  3H91 A;  1I94 Q;  3NTI A;  2F0N A;  3HZX A;  1E22 A;  4K0K L;  1L2F A;  4ZYS A;  1E2Z A;  1SRU A;  3GTO H;  1KAW A;  4A76 A;  4B9W A;  3DHQ A;  2BH2 A;  3H0G H;  1VQP A;  1JB3 A;  4CJ2 C;  3K57 A;  4LF9 Q;  5M3M B;  4JI5 Q;  2LXK A;  3GTJ B;  3H3V H;  3W5O A;  5D65 A;  2XGT A;  3ULP A;  1EYC A;  1ILQ A;  3N52 A;  4HIK A;  2R92 H;  3QOL A;  4FF4 A;  1KDC A;  1VF7 A;  2N88 A;  1U4P A;  1EQV A;  3AMU A;  3NUC A;  2EXD A;  3GTG H;  5HGQ A;  3P20 A;  4R4O A;  2VQE Q;  3GTQ H;  2E5L L;  3NEN A;  4B3M L;  3D0F A;  3S1M B;  2MQH A;  2L5T A;  4Q0F A;  3CQZ B;  4A4I A;  2JA6 G;  2RCF A;  2A8V A;  1SNC A;  1PH8 A;  2DY7 A;  2A68 D;  1F9S A;  4DXF A;  3DMU A;  1Y1V G;  4FXD A;  2VB2 X;  4XYQ A;  1KL9 A;  3TP5 A;  1HNX Q;  4LF9 L;  4A3F H;  3AFQ A;  1S40 A;  4A3L G;  1AZP A;  2NTS A;  1JJG A;  2R7D A;  2B2U A;  2KQ3 A;  4HJ5 A;  1W3S A;  4ME3 A;  1XXG A;  3C1E A;  1BCP B;  2Z6K C;  2R7Z B;  3CPW A;  5CBE E;  3C2P A;  1K8G A;  1TKW B;  4GN3 B;  2NVT B;  5IT9 E;  2VQE L;  1I6V C;  4U68 A;  5CC4 A;  3I72 A;  4A3B B;  3MTS A;  1JOQ A;  1STE A;  1JE5 A;  1GHK A;  1D8L A;  2A6H D;  2JA8 G;  1G29 1;  3K7U C;  4UPA A;  3OTO L;  2JJQ A;  3S2H B;  1WCM G;  1EY9 A;  1H9S B;  4PMB A;  2D2C C;  1YEZ A;  2B2W C;  3FKI H;  1KLG D;  3CHB D;  2M9V A;  2IX3 A;  2FMC A;  1BDO A;  3KOJ A;  4ID6 A;  3SXH A;  3SGI A;  3K0Y A;  1HUN A;  1A2U A;  4JI1 L;  2R6G A;  4BXX H;  1TQO A;  4M1U B;  2AQ2 B;  3V05 A;  3LNN A;  1RDP D;  4N9T A;  3RZD H;  3GTK B;  4DAV A;  1CZG A;  2QW7 A;  3GD7 A;  1CTM A;  1SEB D;  5KNC A;  3U4V A;  4OXP A;  4A3D G;  2EYJ A;  4NMZ A;  4QIW B;  4QIW E;  1DON A;  1IKM A;  2EY2 A;  1QOH A;  4OHJ A;  4LFA L;  3DLL A;  3S1R B;  4DPG A;  1ROD A;  3FMC A;  3ULL A;  3PO3 B;  4HED A;  3KJP A;  4KY7 A;  3S17 H;  3PQI A;  2F03 A;  3I7F A;  1JIC A;  4QUF A;  1CSQ A;  1SAP A;  1AE2 A;  3BVG A;  2DGY A;  2KHJ A;  3FRP B;  3ZYY X;  2J4X A;  3CPF A;  2LS0 1;  5IGE A;  2JA6 H;  3KDF B;  1ML0 D;  1JWS D;  5IP9 H;  2MGS A;  2K05 A;  1Q86 C;  4IOA A;  1STB A;  2ZM6 Q;  3OWF A;  4DR2 Q;  1HQM C;  2ASB A;  1GVP A;  4AQY L;  2B63 B;  3I56 A;  1PYS B;  3ER0 A;  1YJN A;  1L0W A;  1SLJ A;  1QUQ B;  1LTI D;  5I9O A;  3KBX A;  2FMM A;  4JG2 A;  4OIJ A;  4BY1 G;  1U9R A;  4C1N K;  3BG3 A;  2CQA A;  1KD1 C;  5FLM G;  5IGC A;  4WFN 3;  4A3M G;  1LT6 D;  3T53 B;  2K5D A;  2N78 A;  5C44 G;  3WOE A;  2OCE A;  5LMN W;  2IPK D;  1PH5 A;  4KMU C;  1A8V A;  3K7A B;  5DNF A;  4F7X A;  1LT4 D;  1BBU A;  3J81 i;  1MJE A;  1WCM H;  1HR0 Q;  2AUK A;  1HUM A;  5IT9 L;  1EIH A;  4B3S L;  2Z4I A;  4NPS A;  1UE7 A;  3SDZ A;  1ENF A;  4DV2 L;  4DV0 L;  4LFB L;  4DR7 Q;  2UU9 Q;  3HFZ B;  3QR8 A;  2F0G A;  1NCV A;  2NB0 A;  3S2D B;  3OOC A;  1X3P A;  2HIV A;  2BE5 D;  5JVH 3;  1Z7T A;  4G57 A;  4C56 C;  4DUY Q;  3J81 E;  4EX5 A;  5FO9 B;  5CV9 A;  4A3D H;  1FGB D;  3D6W A;  3CAM A;  4C3J G;  3C46 A;  2KHS A;  4MN3 A;  2GVA A;  2ZJR A;  3D3R A;  1BVS A;  2EE1 A;  2XTI A;  5FLX c;  3S1Q H;  4RGT A;  1EWI A;  5K36 G;  1HNW L;  5IGG A;  1EYD A;  1G2T A;  4DR7 L;  4IUU A;  2UU9 L;  3RMH A;  1F9P A;  3MEF A;  2NVQ B;  2L11 A;  2IX0 A;  3GV3 A;  1LT3 D;  3N6R A;  1A3T A;  4A3E G;  2DJG C;  3NK9 A;  4DUY L;  1U0L A;  3LGJ A;  1STH A;  2ICE C;  5D3I B;  4RHR A;  5BN4 A;  1EU3 A;  4I7A A;  2UXC Q;  3OSO A;  4KKT A;  1BBX C;  1KTK A;  1N33 Q;  4JYA Q;  4BA1 I;  4DUZ Q;  2XWJ B;  4HR7 B;  1JQY D;  2NBF A;  3ONA B;  2EJM A;  4BY1 H;  1D5M C;  1PH6 A;  1VQD A;  4B3T Q;  2K50 A;  3GTL H;  4J6H A;  1E1T A;  1FJG L;  4KLK A;  3SK6 A;  4X6A H;  4E6I A;  5C44 H;  1F2Y A;  3H3V I;  1MSG A;  3L9A X;  4AIM A;  3CME A;  2YV5 A;  4A3G B;  1TWC H;  3KF6 A;  3ULJ A;  5IYD G;  4NXN Q;  5M3F H;  3DEO A;  1N33 L;  5M5W B;  3F2D A;  4CGY B;  2SEB D;  2F0J A;  4X64 L;  1EFW A;  3E6Z X;  5F2D A;  5KYI A;  1XX8 A;  3HOX B;  3I8Z A;  1XNR L;  4HTH A;  1B44 D;  5DM6 3;  3RUZ A;  4JCV E;  1HZC A;  1SMY C;  2PZW A;  5JJZ A;  3ICE A;  3PO2 G;  3J7Y W;  4IJL A;  5C3W A;  4IQZ A;  1SYB A;  2ZXR A;  1X9N A;  2XNA C;  1F77 A;  1Y1W G;  3VR5 A;  4XT3 B;  2R93 G;  4BWG B;  4CKB A;  4ZUJ A;  3I4L A;  2ES2 A;  1QVC A;  1CA6 A;  4DK0 A;  4CDC C;  1VQE A;  5EKK A;  3HOU H;  1EQR A;  2ID0 A;  2I5H A;  4DR3 Q;  2HHH L;  3FPP A;  4A3E H;  4KTA A;  2XN9 C;  5EKL A;  1JMC A;  4ZRZ A;  2PI2 A;  1ASY A;  2IW3 A;  1VDZ A;  2AKW B;  2CWP A;  1CK1 A;  3T16 A;  4L5T A;  4U67 3;  1OXS C;  2PPB C;  4UHV A;  4DR4 Q;  3TP8 A;  4KN4 C;  4C3I G;  1F9R A;  4N9P A;  1PYW D;  3TRE A;  4DV3 L;  4BBR H;  4A3K H;  1PRT F;  3KLS A;  1EY8 A;  1NSN S;  5ISR A;  4EGV A;  5CMD A;  5CR3 A;  4ALP A;  1V1P A;  3T1Y L;  2F0D A;  1M90 C;  5KNB A;  2JE6 I;  2Q2H A;  2UUC Q;  2UXD Q;  2Z6B A;  2K5W A;  4BBS G;  1PTO D;  4OON A;  4DK3 C;  3D6C A;  2I07 B;  3I55 A;  3K5M A;  4XTC S;  3HEJ A;  1VQ9 A;  2A73 B;  4P73 A;  4F87 A;  3L0O A;  2B39 A;  1JB7 A;  4PZ7 A;  4DR4 L;  2K5V A;  1B2T A;  5C3E B;  4R8I A;  4FF2 A;  2K5N A;  3DWP A;  5KND A;  4P74 A;  3H3V C;  2QKI C;  3CCS A;  4IPD A;  3FHW A;  1T5X D;  2DNE A;  2OEO A;  1QJO A;  2DN8 A;  1TWF H;  3HOW B;  3M4Q A;  2UXD L;  1JR0 D;  1SXT A;  2K75 A;  1CHP D;  1TY2 A;  1I4P A;  4IZ8 A;  4ZKB B;  5IP7 G;  3IFT A;  2EPB A;  4KHZ A;  3TEH B;  1GUG A;  2XWB B;  3D4W A;  1PYB A;  4X65 L;  1PTO H;  3CD6 A;  1FR3 A;  2N55 A;  2E2H B;  1EIF A;  3E0E A;  4JBW A;  2QDL A;  4L8J A;  3J7A V;  2EYP A;  1GUN A;  1VQB A;  4IUV A;  2D0P A;  1E7Z A;  3J7Z C;  5C0X J;  4DNI A;  2D5D A;  3B6Y A;  4GKJ L;  1HR0 W;  2B2U C;  2F0K A;  4ZCK A;  3T56 B;  3MXN A;  3DM1 A;  4YWL A;  1ZEQ X;  3VR6 A;  2NTT A;  5E4X A;  2HQL A;  1ILP A;  3QO2 A;  3J80 i;  2AQ1 B;  5M9O A;  2WAQ G;  4S3S A;  2MUY A;  4NW2 A;  1A2T A;  2EIF A;  2R61 A;  3K6O A;  4DF7 A;  5A2Q E;  4LNQ A;  1QNK A;  3S1N B;  3I2Z A;  1EEI D;  1E24 A;  1Q7Y C;  1XMQ Q;  2A69 D;  3PIP A;  4QQB X;  2NWG A;  1BCP C;  3WWV A;  2A19 A;  4GKK L;  1LM0 A;  3J80 E;  2VB3 X;  4BBS H;  1R4P B;  3KYH C;  1Y14 B;  4ZLT F;  3HGB A;  1IYU A;  3O13 A;  1B9N A;  1UE6 A;  4KY5 A;  4H02 A;  2NZO A;  2VS1 A;  1C48 A;  4I7Z C;  3KFU A;  2A68 C;  1SMY D;  3CU7 A;  5GAE C;  4TKO B;  3UDF A;  2YTY A;  2K5H A;  4MNO A;  1X3G A;  2KEC A;  3SK8 A;  4LFC Q;  3HOZ B;  3W1G A;  2WKC A;  3K5N A;  4LF7 Q;  1PFM A;  2JP1 A;  1XMQ L;  5GQO A;  3A7L A;  1IKL A;  4A3I B;  4DV1 Q;  4LF8 L;  3NQI A;  3K59 A;  4RFB A;  1D7Q A;  4LF4 Q;  1XWE A;  3H15 A;  5BN3 A;  1Q8K A;  3OIQ A;  1EOT A;  2GN5 A;  1BKB A;  2L4N A;  4RKB A;  2E75 C;  1WVL A;  3MC0 B;  1XPO A;  2QGQ A;  4RCO A;  2ZTD A;  2RVL A;  1VQC A;  1ESR A;  3E9I A;  4O1N A;  4GNX B;  1Y69 U;  1XMO Q;  2P5Z X;  4NB3 A;  1Y8N B;  2QCP X;  4LFC L;  2JA7 H;  4DV5 Q;  2BA0 A;  3CC2 A;  2JSO A;  3I70 A;  3PIO A;  5ELB A;  4A3C H;  2CCZ A;  1LO5 D;  4P75 A;  3DM3 A;  5M5X B;  4FXK C;  3C3L A;  3IAY A;  5A35 A;  3DEP A;  4DV1 L;  5M5Y B;  1EYG A;  2E2J H;  4IAL A;  5M3M G;  3VR3 A;  1B50 A;  1N8R C;  1MHW C;  5IYC G;  4K5W A;  2F3I A;  2RDG A;  1I6H B;  4DV6 Q;  3K80 C;  3M4P A;  1OTC A;  2K32 A;  4JI4 Q;  2F0H A;  2WP8 J;  5FLX L;  5EJW A;  3GDE A;  2ATW A;  4RCN A;  1S4Z A;  3NHH A;  1GD7 A;  1VQ4 A;  5C0X G;  3MA2 B;  5A2Q L;  1M8A A;  4G4K A;  3CKI B;  5NUC A;  1J5E L;  5IIF A;  1MBY A;  5CV4 A;  1MGS A;  3WOF A;  4YY3 Q;  4JVZ A;  1GXD C;  1JWM D;  3BZC A;  3J80 L;  1CUK A;  1IW7 D;  2UUA L;  3OMC A;  2PNH A;  3IKJ A;  5LHY 1;  4JI6 L;  1S5F D;  2BDO A;  3MXG A;  1VQL A;  2WAC A;  2EOT A;  4Y7N B;  4DV6 L;  3G7L A;  2G9D A;  3D4R A;  2R7Z G;  2RQX A;  3OHX C;  1NR2 A;  3ITP A;  1R4Q B;  4O0A A;  3NWS A;  4L6T B;  4GOP A;  4A3B G;  4KKU A;  1X6O A;  2E5L Q;  3PUV A;  1R9T H;  1VQK A;  4DAY B;  4B3M Q;  4RGM A;  1X3F A;  1OXX K;  3HOY H;  3BDC A;  3SHL A;  4NXM L;  3S14 B;  3FPU B;  2X6L A;  1K0R A;  5DAU A;  4YY3 L;  4FO2 A;  1IZ6 A;  3VR4 A;  4LF5 L;  3WDN A;  2B2Y C;  1ICF B;  1CI3 M;  2QEJ C;  5I4D A;  3H0G B;  1N36 L;  1WD0 A;  1K3R A;  4TSS A;  2BE5 C;  3MXP A;  1V9P A;  3T51 B;  1QIL A;  1LTB D;  1YHA A;  1SDF A;  3M7N A;  4HAE A;  1LAC A;  1JWU D;  2WKD A;  2RHS B;  2B29 A;  5M3M H;  1BCP D;  3E5S A;  4FVM A;  4TQU S;  3GTJ H;  1SE3 A;  1CT1 D;  4UY8 C;  5JEA J;  1HZA A;  4KKS A;  1TWH H;  1MIU A;  1ZYR D;  3Q22 A;  3TRZ A;  5ELF A;  2K04 A;  4UP9 A;  2KCM A;  1XTC D;  3A56 A;  1X3E A;  1TXY A;  2L9H A;  3OTO Q;  4L5S A;  3PO3 G;  1WOC A;  2JA9 A;  4GS3 A;  4CDE C;  2NZ1 D;  5JJI A;  5EKI A;  4LF6 L;  2WIN B;  2WB1 B;  2WB1 E;  3CQZ H;  3M3Y H;  1VQM A;  4QY7 A;  5KGU A;  4JI1 Q;  1JOK A;  2N49 A;  4A3F B;  5C4H A;  1PH1 A;  1VF5 C;  5CV7 A;  5ELO A;  2F0E A;  2K7V A;  5FJ8 G;  1PA6 A;  4KV6 A;  1JT8 A;  4HSV A;  1PRT B;  1IL2 A;  2B63 G;  2KCN A;  5COY A;  5IGF A;  5IWA L;  3SR1 A;  4NDX A;  1WYD A;  2B2T A;  5ELD A;  1STA A;  2R7Z H;  4LFA Q;  3MVV A;  4A93 H;  1NBW A;  2KUM A;  5HUR A;  2MP1 A;  2NVT H;  3R8B A;  4XQQ A;  1TWA B;  4A3B H;  2JA5 B;  2MJ8 A;  3HG9 A;  1QZH A;  2I46 A;  4WJW A;  2D9U A;  5G3L F;  5COR A;  1RTO A;  4LW1 A;  4EQ5 A;  2RA4 A;  4CJ1 B;  1VQI A;  1PFS A;  4FF3 A;  3S2H H;  1CFM A;  2I5L X;  3BVM A;  2K1B A;  4OWW B;  1H9S A;  3KF8 B;  1JC7 A;  1Q3L A;  1YNN C;  2BOS A;  2O4X A;  3S15 H;  5BN5 A;  2ENB A;  4QMG A;  1G2S A;  2G5D A;  2OTL A;  3RZD B;  3NSW A;  4AQY Q;  2GA4 B;  1ICW A;  1G6Z A;  1SNO A;  1EFI D;  2F0M A;  1PDQ A;  2PW7 A;  1WTX A;  2HUG A;  3GTK H;  3GTP B;  3TDQ A;  1HPC A;  1KRT A;  1CKO A;  4QJF A;  1S72 A;  4DXG A;  3IL8 A;  1U4M A;  1TVX A;  4TRD A;  1FL0 A;  4BY7 B;  2JYO A;  2CW0 C;  4MZ9 A;  3RLN A;  2L12 A;  5I6W A;  2K5Q A;  4B3R L;  3PO3 H;  3Q6S A;  1UNS A;  1Y1V H;  1LTA D;  4B3S Q;  1UAP A;  4RA8 A;  4DV2 Q;  3PF4 A;  4DV0 Q;  4LFB Q;  4DFA A;  4A3L H;  2CH4 W;  4XDX A;  3EJI A;  3S9W A;  3G4S A;  4BS9 A;  1I5F A;  3KDF A;  2F0U A;  3GP7 A;  3I91 A;  3F8T A;  2KJX A;  1SR3 A;  2L15 A;  5JEA G;  1P8L A;  3S16 H;  2UUB Q;  2QEX A;  5E1F A;  1G91 A;  1OO9 B;  2MNA A;  5J3B A;  2Q8T A;  5TSS A;  2JA8 H;  1QUQ A;  2F3V A;  5FO8 B;  2L0C A;  5K5P A;  2MO0 A;  1PV4 A;  1WTH A;  1UEA B;  3T1H L;  4UP7 A;  1HNW Q;  1GHJ A;  4OWX B;  1K0S A;  4KJN A;  1PTO C;  1VMP A;  4XT1 B;  2JN4 A;  4TVA B;  2B3G A;  4HCS A;  3K7A H;  1DOM A;  3VYR A;  4DR1 Q;  3GTM H;  4A3G G;  4JOI A;  3QJY A;  3BJU A;  2PMZ B;  2PMZ E;  2UUB L;  2RF4 A;  1Z9F A;  2R3Z A;  2F0P A;  3VA7 A;  4HID A;  3E3X A;  1CSP A;  1PZI D;  3S2D H;  2XRQ D;  3HKS A;  1SYF A;  4PMC A;  1CKM A;  3HOX G;  4X3T A;  1I4H A;  4NP5 A;  2J0T D;  2O5I C;  3MFY A;  4K5V A;  2Y0S B;  1VMC A;  2Y0S E;  1G51 A;  2Q2T A;  3UDI A;  2MHV A;  1RIP A;  1N9W A;  3S1Q B;  1JOO A;  1NMF A;  1VQJ A;  5EPJ A;  1FJG Q;  2ALY B;  3C1F A;  4FDB A;  5AJ3 L;  4C3H G;  1N34 L;  2YTV A;  3PSI A;  3BZK A;  4DR1 L;  2VNU D;  5HGT A;  1U4R A;  1DOK A;  2B2Y A;  2CVR A;  2NVQ H;  4DR6 L;  1GO3 E;  3NTH A;  1EL0 A;  2EZV A;  1XNQ L;  1V43 A;  4HSP A;  1WTV A;  4RHS A;  4X64 Q;  1X65 A;  1MI2 A;  5GAH C;  1LV9 A;  2K01 A;  3JAM c;  4JI8 Q;  1XNR Q;  5CYU A;  4RGN A;  4J15 A;  1XPU A;  5JEA H;  4OX9 Q;  2NYZ D;  5EPL A;  1B9M A;  3MWY W;  1YVC A;  1X54 A;  5FLM H;  4CDF C;  4A3M H;  2DY8 A;  1X55 A;  2NN6 G;  2ZTC A;  4QCL A;  3Q23 A;  1TR5 A;  4JV5 L;  4IUR A;  1HHV A;  2IY5 B;  3RR5 A;  4X3K A;  3I4M G;  3RD4 A;  5C4X B;  2A69 C;  4H44 C;  2YU9 H;  1AEX A;  4FNF A;  1YNN D;  1W2B A;  1KC8 C;  2H1E A;  1NNX A;  1TWC B;  2E8G A;  3I4O A;  2LKV A;  1TWG B;  3ERS X;  2HHH Q;  1I3Q H;  5M3F B;  4JI8 L;  3D31 A;  1G8Z D;  4G7O C;  1HTP A;  4OX9 L;  2Z4H A;  5M5W H;  2E2I B;  5C3E G;  3KLS X;  3NQT A;  2EVB A;  1ET9 A;  4C3J H;  4JI2 Q;  4GNX C;  4DV3 Q;  2CW0 D;  1RD9 D;  3HOX H;  1NAP A;  4M8A A;  5C0X I;  4C3H B;  2CWA A;  4AH6 A;  1Q1B A;  1HA6 A;  2D0O A;  2F1M A;  2F52 A;  5T1I A;  3HOW G;  5D14 A;  5K36 H;  2NUC A;  2VY3 A;  1NY4 A;  2EY5 A;  5IYB G;  3T1Y Q;  1JOR A;  2VXW A;  3HOU B;  3OWE B;  4P71 A;  4ZKC B;  5C6A A;  1C4Q A;  1XPR A;  1CZW A;  3ZJY C;  1NJI C;  2MPM A;  2BCO A;  5J39 A;  1YNJ D;  1FD7 D;  5JVG 3;  1C0A A;  1SFO B;  4JI2 L;  4JI0 Q;  2L55 A;  1RJT A;  2M2L A;  2OT2 A;  3FDT A;  4CDD C;  3KK7 A;  3RLF A;  5JPN C;  1YHQ A;  2UXB L;  3CRL C;  3BDO A;  4YCW A;  4IOC A;  4A3K B;  3I4M B;  1IBK L;  1RCV D;  3H94 A;  4XYO A;  3UDG A;  4OWT B;  2NN6 H;  4GOP C;  4JI7 L;  4PNY A;  4IUN A;  4QGU A;  2J7Z A;  3SK5 A;  1L0Y B;  2ZT9 C;  3K0X A;  2I5M X;  1BXT A;  3BYY B;  5ELN A;  3VDY A;  3PV0 A;  2K33 A;  5IYD H;  4HMI A;  4X65 Q;  2PQA B;  3E9H A;  4JI0 L;  4DAP A;  3MEH A;  3G71 A;  1GUS A;  2AMC B;  4G7H C;  5DM7 3;  1W6K A;  4XQJ A;  2A6E C;  1FYC A;  3K5O A;  1U4L A;  1B8A A;  2KVM A;  3PO2 H;  4GKJ Q;  1SE2 A;  2RHQ B;  2EQS A;  4PV1 C;  1IW7 C;  1QWY A;  3HKZ B;  3HKZ E;  5J1Z A;  3P1H A;  4O2D A;  4DGZ A;  5KIX A;  1Y1W H;  2VUM B;  1IYJ B;  1TII D;  3HOZ G;  4KI0 A;  2R93 H;  1L1O B;  1LTS D;  2PNR C;  5EGT A;  1GM5 A;  1STG A;  3CC7 A;  4LUO A;  5C5L A;  1KHI A;  4IUP A;  4A3I G;  1A3U A;  1LTR D;  4CKE A;  1V1O A;  4WRD A;  3CXC A;  4C2M H;  4GKK Q;  4OIK A;  4JBJ A;  1Q12 A;  1CM9 A;  2EYM A;  4ZK9 B;  1L1O A;  3DXJ C;  1II3 A;  2ZJP A;  3GQB A;  3FEW X;  3RZO H;  2LMC B;  1PZK D;  1E1O A;  2BDN A;  1Q82 C;  3BS1 A;  4GLV B;  3I4N B;  4OEM B;  2E2H H;  2VZA A;  2V4D A;  3ERO A;  4C3I H;  5FLX E;  1SBB B;  3X3M A;  4CHT B;  1SYG A;  4FYD A;  1F2L A;  3M4Y A;  2CH4 A;  4DNT B;  3J7A 5;  2LXJ A;  2K14 A;  1GOZ A;  2B2T C;  2D62 A;  4LF8 Q;  4R4T A;  4A3J B;  1A3V A;  3KLW A;  1ZYR C;  3HOV B;  4NKL A;  1FNV A;  3AEV A;  1KIX A;  1GUW A;  3PUX A;  3S1N H;  1MJC A;  1J8I A;  3CP0 A;  2F0T A;  1SMX A;  5IT9 c;  5GAD C;  4X3S A;  4OO1 G;  2Q2U A;  1V1Q A;  3OMG A;  4YWK A;  2AUJ D;  1GUT A;  1Q90 A;  4UP8 A;  1BNZ A;  4PMW A;  3TS0 A;  3HS0 C;  1K73 C;  2AHO B;  3QG1 A;  4DR5 L;  1RTN A;  2JEA I;  1Q8I A;  2LSS A;  1KNA A;  2BA1 A;  4JC0 A;  3A74 A;  2O5J C;  3M4O B;  1S5C D;  4ZUI A;  5IP7 H;  3HOZ H;  3V2T A;  1S5D D;  1SJH D;  1YHB A;  3CCL A;  4JI3 L;  4POG A;  2F4V L;  1PXU A;  4IFD J;  4Q5V A;  3F1Z A;  1K3B C;  1UE1 A;  1STY A;  5D3D A;  5JJL A;  5EPK A;  1H9M A;  1C9O A;  1PH2 A;  4F88 A;  1RHP A;  3U50 C;  1A63 A;  4LAA A;  2R7F A;  4OEL B;  4C1N I;  4MTN A;  5IGD A;  3MZ5 A;  3I73 A;  3UE1 A;  3PCO B;  1J5E Q;  4GZY C;  3CF5 A;  3W2D A;  2FIN B;  1RF2 D;  3MFG A;  1EY7 A;  2YYZ A;  1TS4 A;  1I50 B;  1O7Y A;  2IJ0 A;  4GNX A;  1VQ5 A;  2CHB D;  2EY1 A;  3NE5 B;  2UUA Q;  1O78 A;  4H7B A;  4HJA A;  1KDA A;  3H0G G;  1CKN B;  4JI6 Q;  2HCC A;  5M5X H;  1KAA A;  3K81 C;  2F0F A;  4YHH L;  4X66 L;  4IUQ A;  1X32 A;  3NBH B;  5AFW A;  2NVX H;  4UAI A;  5M5Y H;  1K83 B;  4G7Z C;  1B3Q A;  3CMA A;  1K9M C;  3TZD A;  5C4J B;  4RG1 A;  1B7Y B;  3MXU A;  1H9J A;  2E2D C;  1I6H H;  2XRS D;  2A6E D;  3A55 A;  1NUC A;  2VQF Q;  2MFI A;  1HFG A;  4NXM Q;  3P75 A;  1JE4 A;  3E0J A;  1ESF A;  1HXY D;  4JOI C;  4LWC A;  2NVY B;  2HCI A;  4LF5 Q;  3A5Z B;  1QB5 D;  2WB1 G;  5IY0 A;  3AYH B;  1E2V A;  1TS5 A;  3PUY A;  4KHP Q;  1N36 Q;  4A3F G;  1VQN A;  4X62 L;  3STB D;  1ZKO A;  3JAM L;  3TP7 A;  4RGO S;  2KHI A;  3HP3 A;  2KCT A;  4ULL A;  2DNC A;  1PH9 A;  4L5Q A;  4QL5 A;  4KY6 A;  1VQG A;  2PYK A;  2QIL A;  5DLQ E;  4EQP A;  1F9Q A;  3SEB A;  1I4R A;  1TS3 A;  2VQF L;  4HIM A;  2PCF B;  3U4Z A;  3J81 c;  3VA5 A;  2JXM B;  2JA5 G;  1YNX A;  2F4I A;  3HOY B;  3H6M A;  5BR8 L;  4ZQ3 A;  2JQO A;  4QF4 A;  3GTO B;  4DAY A;  4LF6 Q;  1AZQ A;  4KHP L;  1BQQ T;  3FKI G;  5LL6 S;  1FNU A;  2NN6 I;  2HIX A;  2AWN A;  2FHT A;  1EWH A;  1E2W A;  2EJF C;  2LY7 A;  4BXX G;  2R92 B;  5FO7 B;  1EY5 A;  1HNZ Q;  1EY0 A;  3P7J A;  1K8M A;  1AW7 A;  3A5U A;  1B1Z A;  1MD2 D;  2HD3 A;  3CW2 C;  4IFD G;  5IYC H;  3GTG B;  5IWA Q;  1PRT D;  1S5E D;  2RCN A;  1Q81 C;  3GTQ B;  1HZ9 A;  1XYI A;  1WTW A;  4WJ4 A;  1TWH B;  2B8G A;  4RWS C;  1FVI A;  1ENA A;  4IO9 A;  1E3P A;  1PFN A;  4BY7 G;  1X56 A;  5C0X H;  3S1M H;  4L63 B;  5JPM C;  1VQH A;  4IUT A;  1LYL A;  3RN2 A;  2F0W A;  2RKS A;  2CFM A;  2C35 B;  1I94 L;  1A15 A;  4JK1 C;  3ND8 A;  4AYB B;  4AYB E;  4IPG A;  3M3Y B;  4KHV A;  1HNZ L;  4RAU C;  2C5C A;  1PH3 A;  1F2Z A;  2E74 C;  5IP9 G;  2IX1 A;  1E0B A;  1SE8 A;  1BBW A;  5EAY A;  2CQO A;  4JI5 L;  4CKC A;  2EXZ A;  2PZT A;  5E7N A;  2Q8R E;  1W6J A;  1SYC A;  1N32 Q;  4XQN A;  3AFP A;  3BU2 A;  1VS0 A;  3V96 A;  4A93 B;  4ME5 A;  2I0Q A;  2B2V A;  3FKI B;  2K03 A;  1UEB A;  1LAB A;  4HN7 A;  1PTO F;  4OL7 A;  2EY6 A;  1TWA H;  2JA5 H;  1SSO A;  4B3R Q;  2M00 A;  2GVB A;  2TSS A;  3NP8 A;  1BOS A;  2K52 A;  1HNX L;  1VQ6 A;  1GUO A;  3S15 B;  1IBL Q;  1LTT D;  1O80 A;  4ODG A;  4N8F A; 
#chains in the Genus database with same CATH homology
 1X54 A;  5C4J H;  4KHZ A;  5BR8 Q;  2UXB Q;  2VL6 A;  5FLM H;  4A3M H;  1XMO L;  3TEH B;  1N32 L;  1PYB A;  1X55 A;  4DV5 L;  2NN6 G;  2DUD A;  2ZTC A;  4X65 L;  3JC6 6;  3CD6 A;  1HH2 P;  4JV5 L;  1EIF A;  3GO5 A;  3E0E A;  4JBW A;  5LMN L;  1IBM Q;  4AYB G;  2IY5 B;  5HY6 A;  3RR5 A;  3RNU A;  3I4M G;  2NVY H;  1A62 A;  2VW9 A;  4K0K Q;  1YJ9 A;  2YU9 H;  1IXR A;  1Q1E A;  3S1R H;  1VQB A;  1YIJ A;  4IPH A;  3GTP H;  1W2B A;  4JBK A;  2D0P A;  4DKA C;  1KC8 C;  4WJ3 M;  1E7Z A;  3J7Z C;  4GN5 A;  3I4O A;  2E8G A;  1YZ6 A;  4GLA C;  3B6Y A;  4DNI A;  2Y0S G;  3ERS X;  4Y7N H;  1HR0 W;  3J81 j;  4GKJ L;  4DK6 C;  3CCV A;  1I3Q H;  2HHH Q;  2ZJQ A;  4YWL A;  4JI8 L;  5C0X J;  4DV7 Q;  3T1H Q;  4BY7 H;  3D31 A;  2HQL A;  3F2C A;  3J80 i;  3EIV A;  1UWV A;  2MO1 A;  4P72 A;  1IBL L;  4OX9 L;  2WAQ G;  2WFW A;  4JI4 L;  4HJ7 A;  5M5W H;  4A93 G;  4RMF A;  5C3E G;  2EIF A;  3L2P A;  4C3J H;  3CCQ A;  4LNQ A;  5FJ8 H;  4JI2 Q;  3G48 A;  4GNX C;  3AQQ A;  4DV3 Q;  3I2Z A;  3HOX H;  1E24 A;  1YBY A;  4HJ9 A;  4HJ8 A;  1Q7Y C;  1XMQ Q;  5C0X I;  2B63 H;  3PIP A;  3S14 H;  1IBM L;  2CWA A;  4AH6 A;  1Q1B A;  1NTG A;  3WWV A;  2D0O A;  3PF5 A;  2A19 A;  2F52 A;  1QZG A;  1LM0 A;  1I94 Q;  4GKK L;  1E22 A;  4BBS H;  3KYH C;  1Y14 B;  1L2F A;  3HOW G;  4K0K L;  2H5X A;  2VY3 A;  1SRU A;  3GTO H;  1KAW A;  1NY4 A;  1UE6 A;  4A76 A;  5IYB G;  3T1Y Q;  4H02 A;  2BH2 A;  3H0G H;  1VQP A;  2NZO A;  2VS1 A;  3KFU A;  4LF9 Q;  4P71 A;  4JI5 Q;  2LXK A;  3H3V H;  3W5O A;  2Q2I A;  1WFQ A;  2XGT A;  5GAE C;  4DV7 L;  3ULP A;  1XPR A;  3UDF A;  2YTY A;  4HIK A;  2K5H A;  2R92 H;  3ZJY C;  4MNO A;  1X3G A;  1NJI C;  1C7Y A;  4LFC Q;  5AJ3 Q;  1N34 Q;  2EXD A;  1C0A A;  3GTG H;  3W1G A;  5HGQ A;  1L1O C;  4JI2 L;  4R4O A;  4JI0 Q;  4LF7 Q;  5C4X G;  1NE3 A;  2VQE Q;  1YHQ A;  3EN2 A;  4A75 A;  3GTQ H;  3RLF A;  2E5L L;  1XMQ L;  5GQO A;  3NEN A;  4PZ6 A;  5GAG C;  3D0F A;  4R4I A;  4B3M L;  2ZM6 L;  4DV1 Q;  5H1S E;  2MQH A;  4LF8 L;  4DR6 Q;  4YCW A;  4DR2 L;  4A4I A;  1Q46 A;  2JA6 G;  4IOC A;  1D7Q A;  1XNQ Q;  4LF4 Q;  3H15 A;  5M3F G;  1PH8 A;  2A8V A;  1T9H A;  1IBK L;  3OW2 A;  1Q8K A;  1Y1V G;  1KL9 A;  3A0J A;  1HNX Q;  3CCJ A;  2GN5 A;  1BKB A;  3UDG A;  4LF9 L;  4OWT B;  4GOP C;  1M1K C;  1XPO A;  4IJH A;  1S3O A;  2QGQ A;  3AFQ A;  4A3F H;  1S40 A;  4JI7 L;  4A3L G;  1PVO A;  4QGU A;  1HJP A;  2ZTD A;  3K0X A;  1JJG A;  1VQC A;  3E9I A;  4GNX B;  2R7D A;  4HJ5 A;  2I5M X;  1W3S A;  1XMO Q;  4OO1 I;  4ME3 A;  5ELN A;  3VDY A;  4NB3 A;  3PV0 A;  2IHE A;  4LFC L;  2JA7 H;  4DV5 Q;  5IYD H;  2BA0 A;  2Z6K C;  4GN4 B;  4R1J A;  3PIO A;  3K8A A;  2PQA B;  4X65 Q;  3CPW A;  3CC2 A;  4JV5 Q;  1K8G A;  3E9H A;  4GN3 B;  2CCZ A;  4JI0 L;  4A3C H;  4P75 A;  2VQE L;  3DM3 A;  5GRO A;  3G71 A;  1PH7 A;  2AMC B;  1KXL A;  1JE5 A;  1HR0 L;  4DV1 L;  1KQS A;  1EYG A;  2E2J H;  1D8L A;  2JA8 G;  3HOU G;  5M3M G;  1G29 1;  1B8A A;  3K7U C;  1SRO A;  4UPA A;  3OTO L;  3PO2 H;  2JJQ A;  1N8R C;  4GKJ Q;  1G6P A;  2RHQ B;  1WCM G;  2EQS A;  2ZTE A;  3FP9 A;  5IYC G;  2F3I A;  3TQY A;  3HKZ E;  1YEZ A;  4O2D A;  4DV6 Q;  3FKI H;  1Y1W H;  3K80 C;  1IYJ B;  3M4P A;  1OTC A;  2OQK A;  4JI4 Q;  4KI0 A;  3HOZ G;  2R93 H;  1L1O B;  3KOJ A;  2WP8 J;  3SGI A;  3J80 c;  1GM5 A;  3S24 A;  3GDE A;  4JI1 L;  3CC7 A;  2ATW A;  2R6G A;  4BXX H;  1VQ4 A;  1GD7 A;  4LUO A;  1KHI A;  5C0X G;  4A3I G;  3OYY A;  3RZD H;  1VQ7 A;  4BBR G;  2IT1 A;  1J5E L;  3CXC A;  4C2M H;  4GKK Q;  3GD7 A;  4A3K G;  2JK8 A;  4JBJ A;  1Q12 A;  3U4V A;  3PUW A;  4OXP A;  4A3D G;  3RLO A;  1L1O A;  2ZJP A;  1GKH A;  4QIW E;  4YY3 Q;  1OXU A;  3RZO H;  4PG3 A;  3KF6 B;  3BZC A;  1Q82 C;  1CUK A;  1E1O A;  2UUA L;  4GLV B;  2PNH A;  4LFA L;  1EQQ A;  3DLL A;  2E2H H;  4JI6 L;  2HT1 A;  4DPG A;  2VZA A;  1VQL A;  4C3I H;  3ULL A;  2BH8 A;  4A3G H;  5C4X H;  4DV6 L;  3KJP A;  4PZ8 A;  1QVG A;  3S17 H;  2R7Z G;  3I7F A;  1CSQ A;  1J6Q A;  1AE2 A;  3PGZ A;  2N8N A;  2DGY A;  1VQA A;  2KHJ A;  1TWG H;  3CPF A;  4O0A A;  4GOP A;  2JA6 H;  4A3B G;  3J7A 5;  2UXC L;  2OTJ A;  4BA2 I;  2OWO A;  3KDF B;  1X6O A;  4JYA L;  2UXB L;  2LXJ A;  2K14 A;  3M9B A;  3PUV A;  5IP9 H;  4DUZ L;  1R9T H;  2E5L Q;  2D62 A;  4R4C A;  3L7Z C;  4DAY B;  3F2B A;  1Q86 C;  1EIY B;  2ZM6 Q;  1VQK A;  4B3M Q;  1X3F A;  4LF8 Q;  4IOA A;  1OXX K;  4DR2 Q;  4POF A;  3HOY H;  4R4T A;  2Z6K A;  4NXM L;  2ASB A;  1GVP A;  4AQY L;  3KLW A;  2E2I H;  3I56 A;  1PYS B;  1K0R A;  4YY3 L;  1IBK Q;  1SN8 A;  4B3T L;  3HKZ G;  3AEV A;  1KIX A;  1IZ6 A;  3ER0 A;  3PUX A;  1L0W A;  1SLJ A;  1QUQ B;  1YJN A;  4LF5 L;  2VUM G;  3S1N H;  4L5R C;  4DV4 Q;  4C3H H;  3EBE A;  4JG2 A;  4BY1 G;  4JI7 Q;  1MJC A;  1VQO A;  3CP0 A;  5IT9 c;  1SMX A;  1OXT A;  5GAD C;  1N36 L;  4OO1 G;  1K3R A;  2Q2U A;  1B70 B;  1V9P A;  1YHA A;  1V1Q A;  1KD1 C;  3M7N A;  4YWK A;  5FLM G;  1A0I A;  2PI2 E;  4A3M G;  2N78 A;  1VQ8 A;  4UP8 A;  2RHS B;  4PMW A;  2B29 A;  3TS0 A;  2A1A A;  4NXN L;  5C44 G;  5M3M H;  2OCE A;  4TQU S;  5LMN W;  3GTJ H;  1K73 C;  1PH5 A;  2AHO B;  1WJJ A;  1A8V A;  3CC4 A;  4UY8 C;  5JEA J;  1BBU A;  1HZA A;  3J81 i;  1MJE A;  1TWH H;  1WCM H;  1HR0 Q;  1MIU A;  4DR5 L;  1AE3 A;  3TRZ A;  2JEA I;  4B3S L;  4NPS A;  2LSS A;  3I4N G;  2BA1 A;  1UE7 A;  4UP9 A;  2KCM A;  4JC0 A;  3A74 A;  4DV2 L;  4DV0 L;  4LFB L;  4DR7 Q;  1X3E A;  2JEB I;  5IP7 H;  1TXY A;  3HFZ B;  2UU9 Q;  3HOZ H;  3OTO Q;  4L5S A;  1SFO H;  3PO3 G;  3U58 A;  4JBM A;  1WOC A;  1YHB A;  2JA9 A;  2K4K A;  4JI3 L;  1O7I A;  3CCL A;  4POG A;  2F4V L;  4DV4 L;  4GS3 A;  2YTX A;  4IFD J;  2HIV A;  3F1Z A;  1UE1 A;  5JJI A;  4DUY Q;  5JJL A;  4LF6 L;  4EX5 A;  1VCI A;  2WB1 E;  3CQZ H;  1C9O A;  3M3Y H;  1VQM A;  4QY7 A;  1PH2 A;  4JI1 Q;  2N49 A;  3I4M H;  2IHF A;  4A3D H;  1PH1 A;  1PH4 A;  3U50 C;  1A63 A;  5ELO A;  3CAM A;  2R7F A;  5FJ8 G;  1RL2 A;  4MTN A;  1XJV A;  1PA6 A;  1JT8 A;  3UE1 A;  4A3J G;  3PCO B;  1J5E Q;  3CF5 A;  3HOV G;  2GVA A;  4LUV A;  2ZJR A;  1IL2 A;  4DR3 L;  2B63 G;  1BVS A;  5IWA L;  2XTI A;  5FLX c;  3S1Q H;  2YYZ A;  3UE0 A;  4IFD I;  1EWI A;  4GNX A;  1XTD A;  5K36 G;  1WYD A;  5IE8 A;  1VQ5 A;  1HNW L;  2UUA Q;  4DR7 L;  5LMU Q;  2UU9 L;  4HJA A;  2R7Z H;  4LFA Q;  3MEF A;  3H0G G;  2IX0 A;  2FXQ A;  1CKN B;  4JI6 Q;  1NBW A;  4A93 H;  2PQA A;  5C3E H;  2NVT H;  1ASZ A;  5M5X H;  4HIO A;  3RN5 A;  3K81 C;  4YHH L;  4A3E G;  4A3B H;  4X66 L;  1UE5 A;  3NBH B;  4DUY L;  2NVX H;  1U0L A;  3LGJ A;  1QZH A;  5M5Y H;  1OXV A;  3CCM A;  5JJK A;  2N3S A;  4LW1 A;  4EQ5 A;  3STB C;  3CMA A;  3PUZ A;  1VQI A;  1PFS A;  3HOW H;  3S2H H;  1K9M C;  2UXC Q;  2I5L X;  1MKH A;  1N33 Q;  4OWW B;  4JYA Q;  4RG1 A;  1B7Y B;  2OQ0 A;  5IYB H;  3KF8 B;  1HZB A;  4BA1 I;  1Z47 A;  4DUZ Q;  4GOP B;  2NZH A;  1I6H H;  2VUM H;  3S15 H;  2AWO A;  2VQF Q;  2MFI A;  2UUC L;  2OTL A;  4NXM Q;  4AQY Q;  4BY1 H;  3NEM A;  1PH6 A;  1VQD A;  4B3T Q;  2K50 A;  1YI2 A;  4JOI C;  3GTL H;  4LWC A;  5LMU L;  4LF5 Q;  1E1T A;  4XIG S;  2V1C C;  3GTK H;  3A5Z B;  1FJG L;  2WB1 G;  4KLK A;  2CKZ B;  3AYH B;  5IY0 A;  3CCU A;  4X6A H;  4KHP Q;  3PUY A;  5C44 H;  1KRT A;  1N36 Q;  4A3F G;  1CKO A;  3MXN B;  4QJF A;  1VQN A;  4X62 L;  3STB D;  1S72 A;  1VQF A;  3KJO A;  3H3V I;  4YCU A;  4AIM A;  1FL0 A;  2KHI A;  3CME A;  2YV5 A;  4MZ9 A;  4QQB X;  1TWC H;  3KF6 A;  3RLN A;  3I4N H;  2KCT A;  3ULJ A;  3W1B A;  5IYD G;  4NXN Q;  2JA7 G;  5M3F H;  2KEN A;  1N33 L;  1PH9 A;  1NMG A;  4L5Q A;  3JAM i;  4QL5 A;  3F2D A;  4A3C G;  1P16 A;  1VQG A;  5DLQ E;  4DAM A;  4X64 L;  1JJ2 A;  3PO3 H;  1Y1V H;  1EFW A;  4B3R L;  4DR5 Q;  4IPC A;  2VQF L;  4B3S Q;  4HIM A;  3U4Z A;  3J81 c;  4DV2 Q;  1XNR L;  3PF4 A;  4DV0 Q;  4LFB Q;  4A3L H;  4JCV E;  1HZC A;  2JA5 G;  3ICE A;  1YNX A;  3PO2 G;  4IJL A;  3G4S A;  5BR8 L;  4JI3 Q;  1I5F A;  2F4V Q;  2JQO A;  3KDF A;  1X9N A;  1K8A C;  1EUJ A;  3F8T A;  4LF6 Q;  4KHP L;  3FKI G;  1SR3 A;  2L15 A;  4YWM A;  5JEA G;  3G6E A;  1P8L A;  4A3J H;  1Y1W G;  2UUB Q;  3S16 H;  3TS2 A;  2QEX A;  2NN6 I;  3HOV H;  2R93 G;  2HIX A;  2ES2 A;  2AWN A;  2MNA A;  1QVC A;  5J3B A;  4BXX G;  2JA8 H;  1QUQ A;  1VQE A;  3HOU H;  1HNZ Q;  1EQR A;  2ID0 A;  2I5H A;  2MO0 A;  3A5U A;  4DR3 Q;  1PV4 A;  3CW2 C;  4IFD G;  5IYC H;  5IWA Q;  2HHH L;  3IRB A;  2RCN A;  4A3E H;  1Q81 C;  3T1H L;  1HZ9 A;  4UP7 A;  1HNW Q;  4APV A;  1JMC A;  4WJ4 A;  4R4Q A;  3Q8D A;  4OWX B;  2PI2 A;  1ASY A;  2AKW B;  4TVA B;  2CWP A;  1FVI A;  4IO9 A;  2B3G A;  1JJC B;  1E3P A;  4L5T A;  1OXS C;  3K7A H;  4YHH Q;  4DR4 Q;  4X66 Q;  4BY7 G;  1X56 A;  4DR1 Q;  3NEL A;  4A3I H;  3GTM H;  4A3G G;  3S1M H;  1LTL A;  3TRE A;  4JOI A;  4DV3 L;  1VQH A;  4BBR H;  3BJU A;  1LYL A;  3RN2 A;  2PMZ E;  2UUB L;  1QVF A;  2RF4 A;  1Z9F A;  3M4O H;  4A3K H;  1WI5 A;  2CFM A;  2C35 B;  3UDX A;  4HID A;  1I94 L;  1LUZ A;  1CSP A;  4AYB E;  4IPG A;  3S2D H;  1EOV A;  3HKS A;  1PHJ A;  1HNZ L;  4ALP A;  3HOX G;  1CKM A;  3T1Y L;  1PH3 A;  1KRS A;  5IP9 G;  2IX1 A;  1M90 C;  2UXD Q;  1SE8 A;  1U5K A;  2JE6 I;  2Q2H A;  2UUC Q;  1BBW A;  5EAY A;  4BBS G;  2CQO A;  3HOY G;  4JI5 L;  4DK3 C;  4OON A;  2Y0S E;  1G51 A;  3I55 A;  2Q2T A;  3UDI A;  5E7N A;  4XTC S;  1RIP A;  1N9W A;  2Z0S A;  1VQ9 A;  1NMF A;  1VQJ A;  4P73 A;  3L0O A;  2ALY B;  1FJG Q;  1N32 Q;  4LUZ A;  4FDB A;  3AFP A;  1JB7 A;  5AJ3 L;  3CCR A;  4PZ7 A;  2YTV A;  3BU2 A;  2WAQ E;  3PSI A;  1VS0 A;  2K5V A;  3BZK A;  1N34 L;  4DR4 L;  4DR1 L;  1YJW A;  4X62 Q;  2QA4 A;  4LF7 L;  2VNU D;  3M85 A;  5LMN Q;  2I0Q A;  1I50 H;  2R92 G;  2K5N A;  1AH9 A;  1UEB A;  4GLX A;  2NVQ H;  4DR6 L;  4P74 A;  1GO3 E;  1CKN A;  3CCE A;  3CCS A;  4IPD A;  4LF4 L;  3FHW A;  1TWA H;  1V43 A;  2JA5 H;  1XNQ L;  4B3R Q;  1DGS A;  4X64 Q;  1TWF H;  1X65 A;  3M4Q A;  5GAH C;  3JAM c;  2GVB A;  4YCV A;  4JI8 Q;  2UXD L;  4Y52 H;  2K75 A;  1K83 H;  2K52 A;  1HNX L;  1XNR Q;  2KBN A;  1VQ6 A;  4J15 A;  1FGU A;  1XPU A;  1YIT A;  1IBL Q;  4OX9 Q;  5IP7 G;  1H95 A;  1YVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...