1ENCA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1encA00
1ENAA 5JOBA 5KRUA 4YIJA 1STYA 2EYMA 4ZQ3A 4H7BA 2EY2A 3C1EA 3MXPA 2F0TA 1KAAA 5HGTA 1A3UA 2EY1A 1ENCA 5I9PA 5J39A 4DFAA 4F7XA 4K8IA 1STBA 3HEJA 5EKKA 1EY4A 2EY5A 3MEHA 4HTHA 4KY7A 4PMCA 3HZXA 4K5XA 5M9OA 2HQEA 4IZ8A 1A3VA 1EY9A 2EY6A 2F0QA 4KD4A 5CV8A 4NMZA 1EQVA 1KDCA 2F0VA 1SNQA 3EVQA 4WORA 4KTAA 3SXHA 4B9XA 3NP8A 3QOLA 2KHSA 2F0MA 2F3VA 1F2YA 4KJNA 2EYOA 4WRDA 5IGEA 5KEEA 4KY6A 1F2MA 3TP7A 3E5SA 3U9OA 2F0KA 1A2TA 4IUNA 5EGTA 2RBMA 1EY8A 4OL7A 5CGKA 2O4XA 4KY5A 2F0WA 3OSOA 5C4ZA 1SNDA 5E1FA 4EQNA 3T13A 2SNMA 3SK6A 1EY5A 1TR5A 3D4WA 5CV5A 4PNYA 4K6DA 3SHLA 5C6AA 4DF7A 2PZWA 3NQTA 2PW7A 1STHA 5C3XA 5IGCA 5HURA 1SYDA 3LX0A 2EYPA 1SNMA 2EYHA 3NK9A 5I6YA 2F0OA 4G57A 2F0JA 3D8GA 4RKLA 4K5VA 3NUCA 5CR3A 3VA5A 5I9OA 5IGBA 1KDBA 4EQPA 1F2ZA 4KD3A 3TMEA 4EVOA 5J22A 3D6CA 4IALA 1IHZA 5EKLA 1SNPA 3RUZA 5IOCA 2SOBA 4K8JA 5KIXA 3OMCA 2EYLA 5DAUA 4HMJA 4ME5A 5CC4A 3R3OA 4N9TA 4ZUIA 3SK8A 3NHHA 1NUCA 4KV6A 2F0DA 5JAVA 2NUCA 4F8MA 3H6MA 4K14A 2EYFA 5C3WA 1EZ8A 3D4DA 5CV6A 2F0UA 3BDLA 2ENBA 3SK4A 5F2DA 4DGZA 5IGFA 5NUCA 5E3FA 3MZ5A 1TQOA 4LAAA 1II3A 1JOKA 5C5LA 3TP5A 5C4HA 3OWFA 2F0EA 2PQEA 4S3SA 5CV7A 5CV9A 1TT2A 2PW5A 4NP5A 3EJIA 1STGA 2F0SA 2OF1A 2OXPA 3DMUA 4ID6A 4ZUJA 4EQOA 3NXWA 2EYJA 5I6WA 4E6IA 2SNSA 4MIUA 2PZTA 4PMBA 4QMGA 1KDAA 2F0NA 2M00A 4J1MA 4R8NA 3T16A 1A3TA 3P1HA 4QB4A 5IGDA 1SYEA 3BDCA 3ERQA 1JORA 1A2UA 1EYAA 4K2KA 4TRDA 1SYCA 4HMIA 3PMFA 4RKBA 5DEHA 1AEXA 1RKNA 2QDBA 1SYGA 2RDFA 3SK5A 1U9RA 2F0PA 5KYIA 3MHBA 3TP6A 5KGUA 4NKLA 2F0GA 3DHQA 1SNOA 5J1ZA 2PYKA 4NDXA 4KJOA 5K5PA 2F3WA 4ODGA 3S9WA 3C1FA 5CV4A 2F0FA 3MVVA 2LKVA 1NSNS 4J6HA 1EY0A 5C5MA 5IODA 4K5WA 2RKSA 1EY6A 1JOOA 1STAA 2F0IA 4K2LA 4KHVA 4QF4A 2KQ3A 2OEOA 3OMGA 1EYDA 3V2TA 5KYLA 4B9WA 3SR1A 2PZUA 1STNA 3P75A 1KABA 1SNCA 2WACA 3TP8A 1EY7A 1SYBA 5IGGA 1JOQA 4DU9A 5ISRA 1SYFA 3QOJA 2F0LA 3QB3A 2F0HA 3ITPA 1EYCA 2EXZA 4N9PA 1EZ6A 5IIFA 3EROA 4I65A
chains in the Genus database with same CATH superfamily
4DNRB 5M3FB 1C0AA 1BBWA 3T4AC 4R4TA 3HOVG 1KLUD 1ENCA 1GXDC 4DR3L 2ASBA 3FKIG 1PRTB 3A8IE 5FK9C 5FLMG 1EL0A 5CV8A 2B2UC 3A54A 4NMZA 5LMNQ 4N8FA 4C3IH 1HUMA 4B9XA 3NP8A 4KJNA 5EKIA 4LF7L 3A7AB 1A2TA 1I3QH 4XYOA 4LF6L 4YCUA 2AQ2B 2Z8LA 1MKHA 1L0XB 1EEID 1YBYA 3N6RA 2IT1A 4U673 2ICIA 2LFNA 1N36L 2B8FA 4FF1A 3UI2A 5JJKA 1PRTD 1X3QA 2R92B 2CFMA 5IGBA 1LO5D 3RD4A 5EKLA 3IRBA 1XYIA 5KIXA 1SFOB 2WP8J 4DAVA 2LS01 4HIMA 5JAVA 4GLXA 2VXWA 4HJ9A 5ELFA 1HRJA 1HZAA 1CKOA 4ZRZA 1JWUD 2TSSA 5M3FH 1P16A 5NUCA 1HR0L 2M9VA 1RTNA 2L5TA 4JI2L 2K7VA 1NR2A 3J7A5 4AYBB 2NTSA 2OF1A 4HSVA 3QG1A 2EJGC 2B29A 1PZKD 5KRUA 2M00A 3KBXA 1L1OA 4QB4A 2IWHA 1KNAA 2WB1E 4DR7L 3Q23A 1M8AA 2NZ1D 1ASZA 1DD2A 3PMFA 2J4XA 1AEXA 1U9RA 2JXMB 3TP6A 5DM73 5KGUA 1XPUA 2F0GA 2OCEA 3A8KE 3C1FA 2B63G 1O7LA 4KK7A 1EY0A 1HFNA 1O80A 1U5KA 4AH6A 1JOOA 1HA5A 4IPCA 5EBDA 3TBIB 2XIWA 1EY7A 1K8MA 4IQZA 2B2TC 2F0HA 3MXNB 2R92H 4GZYC 1WJJA 1DM0B 1K3BC 1ENAA 2RCFA 3W1BA 1IKMA 4H7BA 5FO9B 2H4OA 3C1EA 4X65L 1KAAA 1SFOH 2KJXA 4C3JG 4F7XA 2NVXB 4BY7B 3G6EA 4PMCA 4DR3Q 4BXXH 4KKTA 1PH8A 4LF5L 1X3PA 2UU9L 4AYBG 4DV0L 2YTXA 3I4MG 3D31A 2Q2UA 3PO3G 5COYA 1XTDA 4RGNA 2A6EC 3E0JA 2EYOA 5FLXL 2X6LA 1GUWA 3QWNA 2JJQA 2F0KA 4C3HB 1PH3A 1PH4A 3J7AV 1A62A 4LF7Q 5IY0A 1UWVA 1UNSA 4DK6C 1B53A 1YJ9A 4EQNA 2PMZE 4KLKA 3WDNA 4OWXB 1UE6A 4LF6Q 1Q12A 3A74A 4JI0Q 3LNNA 2NWGA 2QEJC 1EWCA 1ZYRC 5C0XI 2EQSA 1ENFA 2K6AA 3K5MA 1JMCA 1OO9B 1PHJA 2Q8TA 1VCIA 1JC7A 2LXJA 2FHTA 4BBRB 2GA4B 4I7AA 4EVOA 3KDFA 1S5CD 4QL5A 4DPGA 1DGSA 3DEOA 5DAUA 1Y8PB 1B3AA 4B08A 1D2BA 4OO1G 4PZ6A 1C8CA 1K8AC 1FVIA 2HUGA 4BY7G 1E24A 4A3BG 1GJXA 1JOKA 2NVTB 5DEHA 2NVXH 3R93A 3JAML 4JI2Q 3UE1A 2BA1A 4BY7H 3QJYA 2SNSA 4A3BH 5IGDA 3E9HA 4M8AA 1WTVA 2ES2A 1VQ5A 1VQIA 2WAQB 1EYAA 4HMIA 1B2TA 3SGIA 4LUZA 1RKNA 2L4NA 3H3VI 3M9BA 2O5IC 3GTJB 1TWAB 4C3HH 5IYDG 3S9WA 1P8LA 5GAEC 2WFWA 2M2LA 2KENA 2RKSA 2F0IA 2MQHA 4A3KB 1WFQA 3NE5B 2R3ZA 2PI2E 1S40A 1C48A 1IW7D 1PZID 4KN7C 4OELB 1SYFA 5LMUQ 2CH4A 4BBRH 3W3AA 1BCPC 1EEFD 2EYMA 4YY3L 4NW2A 4L5SA 5DNFA 1IBMQ 3L9AX 3NELA 3I4LA 4O1NA 3MEHA 1NJIC 3Q22A 5EPLA 4ZKBB 2CHBD 4AQYQ 2HQEA 5I2YA 1JE5A 2JA5G 3GTMB 1WTXA 2VZAA 3PUYA 4HCEA 2NVTH 1YVCA 4UP8A 4WRDA 4X64Q 2WAQG 4DV0Q 3D4RA 2XRQD 4A3EB 3IKJA 4LF9L 5KNBA 4ZLTF 5C4ZA 1X32A 4R1JA 1F9QA 4GN4B 3MXNA 5E1FA 3ND9A 4UHVA 2X6GA 4BBSG 4PNYA 3S2DB 5CYUA 4R9WA 4DV4Q 4DV1L 5HURA 2KHIA 4N8X1 3GTJH 1TWAH 1IL8A 4RCOA 2Z6KA 3FVQA 2CQAA 2HIXA 5CR3A 3ND8A 3IFDA 3O13A 4JI7L 3CCVA 2VQFQ 4X3UA 1LT6D 1LTBD 4TVAB 4KV6A 2ZT9C 1RF2D 4B3TL 5FLXE 3DWQA 3K5LA 5T1IA 4EX5A 1M1KC 3PF5A 2XTIA 4FO2A 4PZ7A 2F0EA 3K5NA 2E5LQ 5CV9A 2F0SA 2SEBD 1CHPD 4QMGA 4J1MA 3T1HL 4GN3B 4DK1A 2K5DA 3NEMA 1PTOC 3GTMH 4TRDA 4DV2L 3HKZE 2Z1CA 1UUPA 3CKIB 2QDBA 2XNAC 1BQQT 3JC66 2MP1A 2J0TD 1VDZA 3G4SA 3K58A 4A3EH 4UY8C 1PA6A 4GLVB 4NDXA 2Q8RE 3VR6A 1QZGA 1GUTA 2LKVA 3WOEA 3P7JA 4KHVA 3S2DH 5BR8Q 3A7LA 3UDGA 3J7ZC 2VQEL 4DU9A 2OWOA 3A56A 5CBAE 5IYCG 5E4XA 4YIJA 5JEAH 1H9RA 4CHTB 3HOUB 3NWTA 3DM1A 3KF6B 4DFAA 3CP0A 4XXEA 1E1OA 1JE4A 2H1EA 5D3DA 2QCPX 4X3TA 2F1MA 5LL6S 3H15A 1YNND 4IZ8A 3I55A 3U50C 2UXCQ 3CMAA 4IPDA 3PF4A 4P72A 3A8JE 1CA5A 3PIO3 2F0MA 1QVFA 1Y1WG 1F2MA 2QEXA 2EOTA 4YHHL 2I5HA 2I0QA 3BJUA 2DGYA 3VR2A 2C5CA 2XGTA 4DAMA 1VQNA 4ME3A 2IW3A 1TR5A 4M1UB 4CKBA 2RQXA 1Z7TA 2HD3A 2UUBL 3BVZA 3NK9A 2F0OA 3I70A 3FPUB 4YCWA 4HJ5A 4JI6Q 5LMNW 4KD3A 3H0GB 1X55A 1EWHA 4IN3A 4JI7Q 5IWAL 1SDFA 1LACA 3NHHA 4GLAC 5ELDA 2FJ2A 3JAMi 3CAMA 3BYYB 4A3IB 3HOUG 4POGA 5C3WA 3T53B 1BO0A 4IUTA 3BDLA 1UAPA 5IGFA 1O7IA 1DYQA 1SE4A 1NMGA 5A2QL 3HOUH 2JA8G 5G3LF 5JPNC 2MUYA 1OXTA 3HRZC 2EYJA 1XMQL 2MNAA 3KBGA 3P1HA 2BH8A 3CQZB 1OXVA 1FJGQ 3HG9A 1STEA 3T1HQ 1VQHA 1B70B 1WTWA 4RKBA 1CQVA 1VQ4A 4DV2Q 4UP9A 4B3MQ 4NKLA 5E4WC 1I5FA 3J81E 1KL9A 2ZTEA 1M90C 1JR0D 3J80L 2HHHL 2RDGA 4L5RC 3W5OA 1XX8A 1BOSA 3OMGA 1B50A 3FEWX 4FF2A 2A69D 2IX1A 1QJOA 5JVH3 3ITPA 1EYCA 2D0PA 5IIFA 2WB1B 4I65A 2HT1A 1E2WA 4X66Q 2RVLA 3OTOQ 2HDMA 2ZTDA 4FNFA 1LTTD 3RLFA 2XN9C 4YWLA 3S16B 1XXGA 3TRZA 4A3DB 3MFYA 4DK0A 4A3IH 2VS1A 3HZXA 4IFDJ 1GUNA 2E76C 4IOCA 1EIYB 1WD0A 1X3FA 4H0LC 4GN5A 2UXDL 2NB0A 1E2ZA 4WORA 2WKCA 2DY7A 3CCQA 1ET9A 4NXMQ 4GKJQ 5C3EG 3PGZA 4OL7A 1S72A 3I2ZA 4YHHQ 3OSOA 3CQZH 1K73C 1CKMA 3J81i 4AIMA 3ONAB 3SHLA 5I2XA 1SAPA 1FNVA 3STBD 3KF6A 2E75C 2LSSA 4JG2A 2R93B 1B44D 3DEPA 2AWOA 3RUZA 1VQGA 4CGYB 4KHPQ 4HMJA 3AFPA 4O2DA 1C7YA 2IHEA 1U4PA 3PIPA 3RZOB 1CI3M 2Y0SE 1SJHD 5IWAQ 1B1ZA 1JICA 1J9OA 3BVMA 4JCVE 5DLQE 4ALPA 3TZUA 5C0XG 2PMZB 4IPHA 2A68D 1IYVA 4LJZC 2GVAA 2B2YA 3UDFA 3G71A 3TP5A 1CA6A 4NXNQ 1MD2D 2ZJPA 3S16H 1TT2A 2FFKB 3DMUA 1TKWB 4A3DH 1TS2A 1GOZA 1VQ6A 2PNHA 4RMFA 1LTAD 3PUVA 1XMQQ 1Q82C 1YEZA 4C56C 1HNXQ 3MFGA 2WKDA 3IFTA 4RAUC 3SVMA 1WCMG 1CKNB 4Z9CB 4CKCA 1KQSA 1G91A 1N33Q 3DHQA 1I94L 4L5TA 4JVZA 2P5ZX 1I6HB 3UE0A 1Y8OB 2JP1A 4GOPB 1NNXA 1HR0W 2HCCA 4BY1B 4ULLA 3SR1A 3P75A 1KABA 1IBKL 3S2HB 3KJPA 5ISRA 2LXKA 2R93H 2JA7G 2OTLA 4HSPA 2I5LX 1K9MC 1V1QA 3AQQA 1V8QA 3TREA 4A3JG 4R4CA 2EY1A 1T9HA 4A93B 2BE5C 1YNJD 3RZOH 1WOCA 5AJ3L 4DN4M 4KY7A 4DR4L 1LTID 5M9OA 2MFIA 4KD4A 2F0QA 4CKEA 2R7ZB 5K36H 1H9MA 2AWNA 4FXDA 1XPOA 3I4NB 2ZJRA 2R6GA 2IX0A 5KNCA 1O7YA 2UXDQ 4DUYL 2XWBB 1PH5A 2KA7A 5EGTA 3M4QA 2ZM6L 1AZQA 1OXSC 4IUQA 1SNDA 1MHWC 1TWFB 4V190 1HPCA 1VQKA 1GKHA 3C2PA 4C3IG 2PW7A 1Q1EA 2L1BA 1CSQA 4XQQA 5I6YA 3AFQA 1QUQB 1D8LA 4BY1G 5BN4A 2QW7A 3FHWA 3CCRA 4DR6L 4LFAQ 1I6HH 1VQEA 2SOBA 3ER0A 3FRPB 3J81c 3SK8A 3T1YL 4BY1H 3NBIA 2RSNA 3DWPA 5FOBB 3S2HH 1H9SB 2EYFA 2FINB 1HJPA 4JI4Q 4A3MB 1YHBA 1II3A 1V1PB 5D65A 2Z6KC 2ZXOA 4A93H 1FD7D 3EJIA 1STGA 2OXPA 1ILQA 4KHZA 1PH1A 3K57A 2HCIA 4R8NA 3N52A 1WYDA 2R7ZH 3EQLC 2OTJA 5M3FG 3I4NH 4DNIA 2RDFA 2Z4HA 1RCVD 1CT1D 3F8TA 1Y1VB 3OYYA 1EIGA 3RNUA 1TWFH 1I94Q 1LV9A 4K2LA 1KAWA 1RODA 3K0XA 1SMYD 3K81C 2PZUA 1RL2A 3TP8A 4POFA 1EU4A 3HKZB 4JV5Q 5EAYA 5M5WB 5J39A 1SR3A 4GKKQ 3VYSA 3S15B 4RGMA 3R2IA 1SE8A 1A3VA 2VUMB 2R92G 1HHVA 4DR4Q 4A3MH 2NTTA 4HAEA 1TVXA 4DR1L 1IW7C 1CUKA 1DXMA 2A1AA 1ZEQX 2K1BA 4DUYQ 1PMRA 2NBFA 4BXXG 1QWYA 2F3IA 3GTQB 5AFWA 4A4IA 3VA7A 5G3LD 4DV6L 1F9PA 2EYPA 1H9JA 3PUXA 1E1TA 2K5VA 1HZ9A 4HCSA 4XYQA 4ZK9B 1E7ZA 1Y1VH 1TXYA 3AU7A 1QNUA 3NENA 5ELEA 3S1MB 1HZBA 2EYLA 4LNQA 1VQBA 4LFCL 3R8BA 5CBEE 1VS0A 1KD1C 2QF7A 4F8MA 1AH9A 3K80C 4QGUA 1MJEA 2EE1A 4BWGB 1ML0D 3D4DA 2KCMA 5E3FA 4X3SA 2K5HA 1TQOA 4LAAA 5M5WH 1BBUA 4R8IA 1QVCA 1X56A 2JEAI 1PLFA 2V4DA 4TQUS 4H02A 2A73B 1N36Q 3GD7A 3S15H 5H1SE 3S1NB 4JBMA 2KUMA 3NTIA 1X54A 4RHRA 2E2DC 2IX3A 1AW7A 1R9TB 2KEDA 5JPMC 2X69A 1GUOA 5C4JB 2KCNA 3KLSX 5CV4A 4L63B 3GTGB 3GTQH 4JI8L 1HR0Q 1BR9A 1V1PA 1C9OA 2MO0A 5I4DA 3D3RA 4C3HG 3F2CA 5CMDA 1SXTA 3CRKC 2EY2A 4GNXB 1KC8C 2F0TA 4CDCC 2SDFA 3E6ZX 5HGTA 2QA4A 1QZHA 4DR7Q 1Q8IA 5GAGC 5T1GA 4Q0FA 2F52A 2A6HC 3S17B 1DOKA 2K5WA 4CJ2C 4A3CG 2K05A 1SNQA 1ESRA 4BBRG 1XMOL 1VQCA 1PDQA 3MA2B 3RLNA 2B2VA 5IGEA 5KEEA 2A5HA 2I07B 3A5UA 3ICEA 3L3OC 1IYJB 2DY8A 3BZKA 4A3CH 1OXUA 4DR1Q 3L2PA 3S1NH 1R9TH 1Q81C 5JJLA 2AMCB 4UPAA 3D4WA 1HA6A 1ESFA 5C6AA 2DNEA 1XNQL 2PZWA 4X65Q 3ULJA 3OPOA 4I7ZC 3LX0A 2K01A 4G57A 4P74A 5C4JH 4RKLA 1E2VA 1SLJA 2L9HA 4LF5Q 2L11A 5J22A 2UU9Q 3F1ZA 5IOCA 2Z9HA 4DA2A 1TWGB 3GTGH 2OT2A 3HS0C 1YHQA 2K75A 2E2IB 4LK1C 3H09A 4LFCQ 3WWVA 5KNDA 2Z0SA 1IKLA 4TSSA 2EZVA 2D62A 2K4KA 4OGQC 3M7NA 1CZGA 4EGVA 1N34L 1J5EL 1F9SA 1SRUA 4A3KG 3HP3A 2A6ED 5GROA 1AE2A 1L2FA 4MTNA 2QKIC 3S17H 2ZXPA 1SYEA 3BDCA 4A3KH 4JI1L 1NE3A 3I90A 4ZAIA 1HH2P 2Y0SB 2E2HB 2A8VA 3UDXA 1ZYRD 2L12A 2B2YC 4ODGA 1EWIA 4YWMA 4RCNA 4P73A 3NTKA 4ZYSA 3CCJA 2JN4A 5IT9L 4O0AA 2OEOA 5ELCA 4RA8A 1EYDA 4DUZL 1IBLL 1D1IA 1SYBA 1J6QA 1ONLA 3S14B 2EXZA 4NPSA 4A3EG 5GQOA 3PQIA 3C46A 1UEAB 1EIHA 1TWGH 2B8GA 1I4RA 4JI5L 2EVBA 1XJVA 2QGQA 3AYHB 3HKSA 2E2IH 1Q86C 4IFDH 1VQLA 2K32A 2PQAB 4A3LG 2RDHA 1BVSA 1HXYD 4IO9A 1EQVA 4JOIA 2DNCA 4HJ7A 1BCPB 2F3VA 1F2YA 5JEAG 4A3LH 4DV5L 3P20A 2A69C 2YTYA 3U4VA 4OXPA 1EY8A 1XWEA 3CCLA 3JAME 1BUVT 4G4KA 2L15A 3I4OA 1D5XC 1G6ZA 3NBHB 1LYLA 4YY3Q 4JYAL 4IJHA 4K6DA 3M3YB 3KF8B 1VQ7A 1QE6A 5IGCA 2E2HH 4DK3C 4GNXA 1F2LA 4PMWA 4LMQD 1Y69U 2F0JA 3NUCA 1ICFB 2Z4IA 4MTKA 3I73A 2CW0D 4QY7A 2UUCL 1BCPD 1YZ6A 4DAYB 2TMPA 2F4VL 4EQ5A 1Q7YC 3RZDB 3S14H 1PYSB 2KEEA 4LF9Q 2GVBA 1EQTA 1I4GA 1K8OA 3K7UC 3NPPA 4X3KA 2ATWA 1SROA 3HOZB 2PQEA 1PVOA 1AZPA 1FR3A 1HFGA 2WIIB 3IL8A 1V1OA 5C44B 4DV1Q 2K14A 1N34Q 1A6XA 5M5XB 3BVGA 2N3SA 1BNZA 3DLLA 4FVMA 2AQ3B 4HN7A 4K0KL 3F2BA 3AMUA 4K2KA 4Q5VA 1SYCA 3E3XA 4JI1Q 1WTOA 2VY3A 2F0PA 1S4ZA 1LTSD 1SNOA 5K5PA 2F3WA 3GQBA 3A5ZB 2A68C 1PH6A 4B3TQ 1EIFA 4CDEC 3MC0B 1EY6A 4XT1B 1IL2A 1WD1A 4QF4A 3M3YH 2KOLA 3MXGA 4B9WA 1MGSA 1TY2A 2VB3X 3HOYB 1JOQA 1K28A 1NTGA 4DUZQ 1IBLQ 1QG7A 1FGUA 3TP7A 1HQRD 1CM9A 1HNZL 1MIUA 1RD9D 1Q3LA 3F2UA 3OIPA 1XNRL 1JB3A 3H3VC 3GO5A 3UDIA 3GDEA 3HEJA 2V1CC 4A3GB 1X3EA 4G7OC 2JQOA 3RZDH 2XRSD 1KLGD 4WJWA 1PFBA 4FDBA 1MSGA 2ZTCA 1NCVA 4QJFA 3WOFA 3QOLA 3H0GG 2KHSA 1L1OC 4JI3L 3HOZH 2NZOA 4L8JA 4UP7A 3G7LA 5C44H 1B7YB 3U9OA 5M5XH 1PXUA 2VQEQ 5IT9E 1JJ2A 2YU9B 2RBMA 1W3SA 2G9HD 5ELBA 4A3IG 3H0GH 4KY5A 3U9SA 2JK8A 1QB5D 4XTCS 4JYAQ 3QR8A 2NN6I 3MEFA 1FYCA 2RHQB 3CW2C 2RHSB 3GTKB 4IALA 4NB3A 4X6AH 5FLXc 4ME5A 5CC4A 4N9TA 2NZHA 4R4OA 3HOYH 2KCTA 3IAYA 2NUCA 1B9MA 3H6MA 2D2CC 4IOAA 4OHJA 4XQJA 4UDUC 2F4VQ 1V43A 2UUAL 3FP9A 3KLRA 3K5OA 4OIKA 1I50B 1FNWA 3NBHA 4S3SA 2AUKA 2KCCA 5HGQA 4HJ8A 2JYOA 2UUBQ 4A3GH 3KF8A 2D9UA 1ZXTA 1VF5C 3ERSX 1EU3A 2PPBC 4ZCKA 1T5XD 2EPBA 1HZCA 2FMCA 2WB1G 4GS3A 4LUVA 4DV3L 4LFBL 2MGSA 3KFUA 1DOMA 5IP9H 1D5ZC 3HOWB 4L5QA 4DAYA 2YU9H 3OW2A 4A3DG 3K8AA 2G9DA 1GHJA 3TZDA 4LW1A 4J6HA 5DM63 1UE5A 5EPJA 4A3FB 3V96A 1PRTC 1QNKA 3JAMc 1C4QA 4MHEA 1V9PA 1EZ6A 5J3BA 1Y8NB 3PO2B 1CFMA 1EYGA 5M3MB 4ZQ3A 3GTKH 1JT8A 1K0SA 1HNZQ 3HOXB 4IFDI 3EA6A 1XNRQ 2VNUD 1HQMC 3FDTA 5EPKA 3TEHB 1PH2A 2K28A 4P71A 1Z47A 3LWEA 4LUOA 1X9NA 3BDOA 2CVRA 2R93G 1LTGD 2Q2IA 1KDCA 3EVQA 2HHHQ 1I50H 1MBYA 4KY6A 2PO4A 4C1NI 4DXFA 1FNUA 5A2QE 3URYA 4H13C 2MO1A 4HR7B 3W1GA 1KNEA 1I6VC 2VL6A 2E8GA 5BN3A 3HOVB 5FJ8G 3M7GA 1U0LA 2EJFC 1YITA 4KI0A 1U4RA 2SNMA 3OW7A 3SK6A 5K36G 1SEBD 3FKIB 4CJ1B 3LGJA 1CZWA 3HOWH 4MN3A 3R2TA 4F87A 5FJ8H 3KJOA 3CXCA 5I9OA 3VA5A 3M85A 2B2VC 1RTOA 1LT4D 1E0BA 3J80E 3MTSA 3OMCA 2BDOA 3PO2G 3R3OA 4B3RL 4A3FH 1BKBA 3HOXG 1F77A 3E9IA 3OOCA 5EJWA 4C1NK 3PO2H 2HDLA 3CPWA 2I46A 1WTRA 2NYZD 2QDLA 1WTPA 1BF4A 3FPPA 5C5LA 4IJLA 1QILA 5BN5A 3HOXH 5CV7A 1OTCA 2NVQB 2O5JC 1SJED 3PIP3 5I6WA 4E6IA 2YTVA 2PZTA 1T5EA 2DN8A 3CU7A 3D6WA 1GUSA 1UE1A 1UE7A 1SE3A 4HIOA 4DV3Q 4LFBQ 4A93G 1G2SA 1YI2A 1JWMD 3BZDB 1AP0A 3KDFB 1BDOA 2YV5A 1CTMA 3DWAA 1W6JA 3HOVH 4K5WA 5A35A 1STAA 2R7ZG 1NR4A 5IT9c 4KKSA 1ILPA 1Y14B 3FKIH 5KYLA 5IYBG 1STNA 3I4NG 1N32L 3I56A 5FLMH 3QB3A 4JW0A 3J80i 3KLWA 3EROA 1WTHA 1S3OA 1BCPF 5IYBH 3EN2A 4FF3A 4JI0L 4CJ0B 5JVG3 3BZCA 2OQ0A 4RGOS 4JC0A 2IJ0A 2B63B 5EKKA 2EY5A 3S24A 3GTPB 2CH4W 3G6JB 2EY6A 4RHSA 3DM3A 3VYRA 5M5YB 3Q0AA 3CC2A 1K3RA 2BCOA 3TS2A 4KMUC 1G51A 2D0OA 2NVQH 1A8VA 3AEVA 2QILA 1IBKQ 1Z9FA 3X3NA 1K83B 1EQRA 4LWCA 1J8IA 4U68A 1U4LA 2RF4A 3RN2A 5ELNA 3T13A 4C3JB 4Y7NB 1VMCA 3NQTA 2ZXRA 4A3MG 3H94A 1SYDA 1SNMA 4MZ9A 4A76A 3SEBA 1CKNA 5AJ3Q 5C0XJ 4QCLA 4JOIC 4R4IA 3I4MB 3PO3B 4QUCA 1SNPA 3U58A 4K8JA 2Q8IB 2BOSA 5ELOA 2K33A 4GOPA 1K0RA 1EOTA 4YWKA 2BE5D 2R7FA 3M4PA 3M4OB 4B3RQ 1VQDA 1EZ8A 1VQOA 3K6OA 2ZM6Q 2CQOA 2N49A 3SK4A 1LT3D 1B3QA 1Y1VG 4GNXC 3DUZA 3LWUA 5C4HA 1WI5A 2CCZA 4EQOA 4ID6A 2A74C 3PUWA 5FO8B 5LMUL 3C3LA 2B63H 1VQJA 2G5DA 4MIUA 1KXLA 4PMBA 3GTPH 4TKOB 2B2WA 2C9OA 1PTOF 5M5YH 4OWWB 3TSSA 3GTLB 4DR6Q 1IBML 3GV3A 2K04A 3HKZG 3VDYA 2PI2A 4YCVA 2BDNA 4HIDA 1I4XA 3DXJC 4RWSC 3T1YQ 4AQYL 3D0FA 1K83H 2PYKA 1Q46A 1Q90A 1SMXA 5J1ZA 2PCFB 1PYBA 4A3BB 1LUZA 1A15A 1EUJA 3CCEA 4C2MB 3J7YW 2VUMG 5CORA 4C3JH 3L0OA 4QIWE 4X64L 4Y7NH 4DR5L 2FXQA 4KKUA 1N9WA 2WACA 4OEMB 4OX9L 1GHKA 3QOJA 1UEBA 2KECA 2VUMH 5D3IB 1N32Q 2MJ8A 1QUQA 5JOBA 1DJRD 3I4MH 1STYA 5GADC 3PO3H 4DV4L 3U4ZA 2K50A 2LMCB 1EQQA 4OIJA 1EFWA 2I5MX 1O7ZA 1VMPA 3M4OH 1B4OA 4K5XA 1H9SA 1S5DD 3J80c 1SE2A 2PNRC 3PUZA 3CCUA 2VQFL 2K52A 3OWEB 5FKAC 2DJGC 2RCNA 2AUJD 5IP7G 2CWPA 3TQYA 1MSHA 3NWSA 3T56B 2J7ZA 4J15A 4HIKA 1PFSA 3RR5A 5IP7H 3S1MH 2Z6BA 2HQLA 1DCZA 2JA9A 2EIFA 3GTLH 3RN5A 4O42A 2E5LL 2Q2TA 1PH7A 1G6PA 3I91A 2XSCA 4OO1H 2K5NA 3NQIA 1B9NA 3D8GA 2MPMA 1KRSA 4K5VA 2JA5B 1TS5A 1KDBA 3CHBD 4C2MH 3TS0A 2RSOA 3NTHA 2N78A 4ZUIA 1I4HA 1Q1BA 3VR4A 4WJ4A 1JWSD 1GO3E 1EFID 4IURA 1HTLD 1M4VA 5CV6A 1EOVA 1IYUA 4BBSB 2NN6G 2AKWB 2DJFC 5F2DA 2XWJB 4CDFC 5BR8L 5D14A 1ZKOA 4JBKA 5IYDH 1YNNC 4DV6Q 1U4MA 2NN6H 4L6TB 1TWCB 3QO2A 1VQ8A 2F0NA 2ZJQA 3EBEA 3Q6SA 1WVLA 2A19A 3MWYW 2CW0C 3RLOA 1HNWL 2JE6I 4LF8L 2JSOA 4ILWA 3MHBA 1D6EC 3GTOB 2UXCL 1X6OA 2K5QA 2R7DA 3VYUA 1KHIA 5C5MA 1PZJD 1SSOA 3CD6A 1MI2A 4F88A 1TY0A 2B2UA 2OQKA 4DV7L 1SNCA 4OWTB 2H5XA 4DR5Q 2F0LA 2JA5H 3A55A 4OX9Q 1YNXA 3PIOA 4UAIA 2JEBI 1LTLA 3KK7A 3I8ZA 3AB9A 1XTCD 1I4QA 1STBA 3G48A 1CSPA 3CRLC 4CDDC 4JI6L 3BU2A 4DAPA 2DUDA 4PZ8A 4BBSH 2EJMA 4HJAA 4MNOA 2K03A 4X62L 3CCMA 3SXHA 1IZ6A 1YIJA 4A75A 1NY4A 3J81L 4JI8Q 5E7NA 1G291 3NSWA 4JK1C 3E5SA 1A0IA 1LLRD 4ABNA 4PQXA 1TWCH 1L0WA 5CGKA 1ICWA 4IFDG 1R4QB 2Q2HA 4JPBW 5JJZA 1N8RC 4HEDA 1BXTA 1DOLA 1EY5A 5GAHC 1ASYA 5L37A 1PFNA 1Q8KA 5C3XA 1GUGA 1QCBD 1W6KA 1PYWD 2AQ1B 1OXXK 3GTOH 4LF4L 4AYBE 2L0CA 4K6LA 5LL6X 1FJGL 3TMEA 1CQFA 1A63A 1KIXA 1IHZA 4P75A 1Y1WB 1XMOQ 2F4IA 1TS4A 4B3ML 3TDQA 2EXDA 2Y0SG 1FGBD 4K14A 1S5ED 2L55A 1GVPA 2AHOB 2A6HD 2ICEC 4Y52H 3OWFA 1JCKB 1O78A 3PCOB 1XNQQ 4H44C 1PRTF 5HY6A 2MHVA 1JJCB 3OTOL 4X66L 1H95A 1Z6HA 5EQ0A 1JORA 2B2TA 4B3SL 3VR5A 3L7ZC 1X3GA 1HNWQ 4LF8Q 1SYGA 3SK5A 3KOJA 2N8NA 5IYCH 1QVGA 1WTQA 3VYTA 1H9KA 4FXGC 1LABA 5IODA 2JA8B 2KHJA 2KQ3A 3A0JA 4NXML 4GKJL 1J5EQ 5IGGA 3STBC 2BA0A 3TN2A 4N9PA 2E2JB 4DV7Q 3I3CA 3ZYYX 3ZJYC 1Y1WH 5I9PA 3VR3A 1A3UA 5JJIA 3GV6A 1D1KA 1TS3A 3HGBA 2C35B 1TWHB 2UXBL 4KHPL 1PTOB 3S1RB 4KTAA 1YJWA 1LM0A 2IL8A 3K0YA 4WJ3M 4X62Q 1NAPA 4IUNA 1SBBB 4PV1C 1W2BA 4CBVA 1QOHA 2O4XA 3FMCA 1YJNA 2JA6B 4NXNL 4FP5D 3EFXD 4OONA 1VQPA 4OO1I 1STHA 4JI5Q 3CCSA 2EYHA 5TSSA 3HOZG 1DZ1A 4JBWA 5C44G 3T51B 4IUPA 1D7QA 3CPFA 4EQPA 4DR2L 4G7ZC 2D5DA 4PG3A 3D6CA 3PSIA 4LF4Q 1PTOD 2JA8H 1HNXL 2WAQE 5LHY1 5C3EB 3CC7A 1YHAA 1VQ9A 1N33L 4G7HC 2KBNA 1NUCA 2F0DA 2B39A 4DV5Q 1XPRA 2IY5B 4QUFA 2E2JH 2F0UA 2ENBA 2HIVA 4J8QA 1GD7A 4XIGS 1YNJC 2GN5A 4ZKCB 1RJTA 1JJGA 4NP5A 4ZUJA 3OHXC 3NXWA 1RDPD 1G8ZD 3QIAA 5IE8A 3HOYG 1KDAA 3S1QB 2IPKD 1A3TA 1X65A 2PQAA 4BA2I 1LTRD 1TWHH 1R4PB 4GOPC 1PTOH 1PH9A 3S1RH 2UUCQ 4RFBA 3EIVA 2JA6G 2ID0A 5KYIA 2CKZB 4B3SQ 3X3MA 3SE0A 4XDXA 4A3GG 1AN8A 1JQYD 4WFN3 3KLSA 2JA6H 1PFMA 4FXKC 3J7AF 3KYHC 1RIPA 1GM5A 2B2WC 4JBJA 5IP9G 4KN4C 3Q8DA 1F9RA 1I4PA 2B3GA 1PV4A 1CHQD 1G2TA 3HFZB 4K0KQ 4APVA 5C4XB 3MXPA 3V05A 1WCMB 1KRTA 5JEAJ 3CF5A 4FF4A 5C3EH 2E74C 2YYZA 4BS9A 1NBWA 4K8IA 3I72A 1EY4A 1AE3A 4HTHA 5LMNL 2BH2A 3BG3A 1EY9A 4LFAL 2CWAA 1KTKA 2O2LD 4V0BA 4DXGA 3K7AB 4QIWB 2VW9A 2F0VA 3ULPA 1SN8A 2R61A 3ULLA 2UXBQ 2NVYB 4BA1I 4R4QA 1S5BD 2FMMA 4IUUA 4QQBX 2JA7B 2EDGA 1AFPA 4JI4L 1LT5D 5EBCA 3S1QH 1TU2B 2F0WA 4RGTA 4A3JB 2RA4A 3BYTB 5CV5A 4DF7A 3KUPA 1ET6A 1MJCA 3BS1A 3CMEA 1L1OB 1K8GA 5C0XH 1HCZA 1F2ZA 2WINB 1VQMA 4IPGA 1E22A 2ALYB 1SMYC 3PV0A 3W2DA 1L0YB 4DR2Q 4P2CB 2XVSA 1D5MC 3I7FA 3SDZA 3J81j 4JI3Q 2F03A 5C4XG 3MXUA 3B6YA 4XT3B 3HOWG 1VF7A 4DGZA 1VQFA 4C3IB 3Q24A 3MZ5A 2KVMA 5C4XH 2WV6D 1WCMH 3GP7A 1FL0A 3RMHA 1TIID 3MAQA 2PW5A 1JB7A 1B8AA 1HUNA 4A3FG 1I3QB 1VQAA 2N88A 4RH6A 3T16A 1S5FD 4JV5L 4DNTB 3ERQA 1CK1A 1A2UA 3H91A 3K7AH 3F2DA 5M3MG 3CC4A 1RHPA 2NVYH 4GKKL 3H3VH 3M4YA 2JA7H 1IXRA 1NMFA 4KJOA 2N55A 1DONA 2F0FA 3MVVA 5M3MH 1NSNS 4RG1A 3OIQA 2VB2X 4A3JH 2IHFA 4IUVA 2UUAQ 2LY7A 5FO7B 4FYDA 3E0EA 3V2TA 3K59A 1BBXC 1E3PA 4DKAC 4XQNA 1HTPA
chains in the Genus database with same CATH topology
4DNRB 5M3FB 3T4AC 1KLUD 1ENCA 1GXDC 1PRTB 3A8IE 5FK9C 1EL0A 5CV8A 2B2UC 3A54A 4NMZA 1HUMA 4B9XA 3NP8A 4KJNA 5EKIA 3A7AB 1A2TA 4XYOA 2AQ2B 2Z8LA 1L0XB 1EEID 3N6RA 2IT1A 4U673 2ICIA 2LFNA 2B8FA 4FF1A 3UI2A 1PRTD 1X3QA 2R92B 5IGBA 1LO5D 3RD4A 5EKLA 1XYIA 5KIXA 1SFOB 2WP8J 4DAVA 2LS01 5JAVA 2VXWA 5ELFA 1HRJA 4ZRZA 1JWUD 2TSSA 5NUCA 2M9VA 1RTNA 2L5TA 2K7VA 1NR2A 4AYBB 2NTSA 2OF1A 4HSVA 3QG1A 2EJGC 1PZKD 5KRUA 2M00A 3KBXA 4QB4A 2IWHA 1KNAA 3Q23A 1M8AA 2NZ1D 1DD2A 3PMFA 2J4XA 1AEXA 1U9RA 2JXMB 3TP6A 5DM73 5KGUA 2F0GA 3A8KE 3C1FA 1O7LA 4KK7A 1EY0A 1HFNA 1O80A 1JOOA 1HA5A 5EBDA 3TBIB 2XIWA 1EY7A 1K8MA 4IQZA 2B2TC 2F0HA 4GZYC 1DM0B 1ENAA 1IKMA 4H7BA 5FO9B 2H4OA 3C1EA 1KAAA 2KJXA 4C3JG 4F7XA 2NVXB 4BY7B 4PMCA 4KKTA 1X3PA 3D31A 5COYA 4RGNA 2A6EC 3E0JA 2EYOA 5FLXL 2X6LA 1GUWA 3QWNA 4C3HB 2F0KA 3J7AV 1UNSA 1B53A 4EQNA 3WDNA 1Q12A 2NWGA 3LNNA 2QEJC 1EWCA 1ZYRC 5C0XI 1ENFA 2K6AA 3K5MA 1OO9B 2Q8TA 1VCIA 1JC7A 2FHTA 4BBRB 2GA4B 4EVOA 1S5CD 3DEOA 5DAUA 1Y8PB 1B3AA 4B08A 1D2BA 4OO1G 1C8CA 2HUGA 1GJXA 1JOKA 2NVTB 5DEHA 3R93A 3JAML 2BA1A 3QJYA 2SNSA 5IGDA 4M8AA 1WTVA 2WAQB 1EYAA 4HMIA 1B2TA 1RKNA 2L4NA 2O5IC 3GTJB 1TWAB 3S9WA 2M2LA 2RKSA 2F0IA 4A3KB 3NE5B 2R3ZA 1C48A 1IW7D 1PZID 4KN7C 1SYFA 3W3AA 1BCPC 1EEFD 2EYMA 4NW2A 5DNFA 3L9AX 3I4LA 4O1NA 3MEHA 3Q22A 5EPLA 4ZKBB 2CHBD 2HQEA 5I2YA 3GTMB 1WTXA 3PUYA 4HCEA 4WRDA 3D4RA 2XRQD 4A3EB 3IKJA 5KNBA 4ZLTF 5C4ZA 1X32A 1F9QA 3MXNA 5E1FA 3ND9A 2X6GA 4PNYA 3S2DB 5CYUA 4R9WA 5HURA 1IL8A 4RCOA 3FVQA 2CQAA 5CR3A 3ND8A 3IFDA 3O13A 4X3UA 1LT6D 1LTBD 4KV6A 2ZT9C 1RF2D 5FLXE 3DWQA 3K5LA 5T1IA 4FO2A 2F0EA 3K5NA 5CV9A 2F0SA 2SEBD 1CHPD 4QMGA 4J1MA 4DK1A 2K5DA 1PTOC 4TRDA 2Z1CA 1UUPA 3CKIB 2QDBA 2XNAC 1BQQT 2MP1A 2J0TD 1VDZA 3K58A 4NDXA 2Q8RE 3VR6A 1GUTA 2LKVA 3WOEA 3P7JA 4KHVA 3A7LA 4DU9A 3A56A 5CBAE 5E4XA 4YIJA 5JEAH 1H9RA 4CHTB 3HOUB 3NWTA 3DM1A 4DFAA 4XXEA 1JE4A 2H1EA 5D3DA 2QCPX 4X3TA 2F1MA 5LL6S 1YNND 4IZ8A 3A8JE 1CA5A 3PIO3 2F0MA 1F2MA 2EOTA 3VR2A 2C5CA 2IW3A 1TR5A 4M1UB 4CKBA 2RQXA 1Z7TA 3BVZA 3NK9A 2F0OA 3I70A 3FPUB 4KD3A 3H0GB 1EWHA 4IN3A 1SDFA 1LACA 3NHHA 5ELDA 2FJ2A 3BYYB 4A3IB 5C3WA 3T53B 1BO0A 4IUTA 3BDLA 1UAPA 5IGFA 1DYQA 1SE4A 5A2QL 5G3LF 5JPNC 2MUYA 1OXTA 3HRZC 2EYJA 3KBGA 3P1HA 3CQZB 1OXVA 3HG9A 1STEA 1WTWA 4RKBA 1CQVA 4NKLA 5E4WC 3J81E 1JR0D 3J80L 2RDGA 1XX8A 1BOSA 3OMGA 1B50A 3FEWX 4FF2A 2A69D 2IX1A 1QJOA 5JVH3 3ITPA 1EYCA 5IIFA 2WB1B 4I65A 1E2WA 2RVLA 2HDMA 4FNFA 1LTTD 3RLFA 2XN9C 3S16B 1XXGA 4A3DB 3MFYA 4DK0A 3HZXA 4IFDJ 1GUNA 2E76C 1WD0A 4H0LC 2NB0A 1E2ZA 4WORA 2WKCA 2DY7A 1ET9A 4OL7A 3OSOA 3ONAB 3SHLA 5I2XA 1SAPA 1FNVA 2E75C 2R93B 1B44D 3DEPA 2AWOA 3RUZA 4CGYB 4HMJA 1U4PA 3RZOB 1CI3M 1SJHD 1B1ZA 1JICA 1J9OA 3BVMA 3TZUA 5C0XG 2PMZB 2A68D 1IYVA 4LJZC 2B2YA 3TP5A 1CA6A 1MD2D 1TT2A 2FFKB 3DMUA 1TKWB 1TS2A 1GOZA 1LTAD 3PUVA 4C56C 3MFGA 2WKDA 3IFTA 4RAUC 3SVMA 4Z9CB 4CKCA 1G91A 3DHQA 1I6HB 1Y8OB 2JP1A 2HCCA 4BY1B 4ULLA 3SR1A 3P75A 1KABA 3S2HB 5ISRA 4HSPA 1V8QA 2EY1A 4A93B 2BE5C 1YNJD 4DN4M 4KY7A 1LTID 5M9OA 4KD4A 2F0QA 4CKEA 2R7ZB 5K36H 1H9MA 2AWNA 4FXDA 3I4NB 2R6GA 2IX0A 5KNCA 1O7YA 2XWBB 2KA7A 5EGTA 1AZQA 1OXSC 4IUQA 1SNDA 1TWFB 4V190 1HPCA 3C2PA 4C3IG 2PW7A 1Q1EA 2L1BA 4XQQA 5I6YA 5BN4A 2SOBA 3FRPB 3SK8A 3NBIA 2RSNA 3DWPA 5FOBB 1H9SB 2EYFA 2FINB 4A3MB 1II3A 1V1PB 5D65A 2ZXOA 1FD7D 3EJIA 1STGA 2OXPA 1ILQA 4KHZA 3K57A 2HCIA 4R8NA 3N52A 3EQLC 2RDFA 2Z4HA 1RCVD 1CT1D 1Y1VB 1EIGA 1LV9A 4K2LA 1RODA 1SMYD 2PZUA 3TP8A 1EU4A 3HKZB 5M5WB 5J39A 3VYSA 3S15B 4RGMA 3R2IA 1A3VA 2VUMB 1HHVA 2NTTA 4HAEA 1TVXA 1IW7C 1DXMA 1ZEQX 2K1BA 1PMRA 2NBFA 1QWYA 3GTQB 5AFWA 3VA7A 5G3LD 1F9PA 2EYPA 1H9JA 3PUXA 4HCSA 4XYQA 4ZK9B 3AU7A 1QNUA 5ELEA 3S1MB 2EYLA 3R8BA 5CBEE 2QF7A 4F8MA 2EE1A 4BWGB 1ML0D 3D4DA 5E3FA 4X3SA 1TQOA 4LAAA 4R8IA 2JEAI 1PLFA 4TQUS 2V4DA 2A73B 3GD7A 3S1NB 2KUMA 3NTIA 4RHRA 2E2DC 2IX3A 1AW7A 1R9TB 2KEDA 5JPMC 2X69A 1GUOA 5C4JB 2KCNA 3KLSX 5CV4A 4L63B 3GTGB 1BR9A 1V1PA 5I4DA 3D3RA 4C3HG 5CMDA 1SXTA 3CRKC 2EY2A 2F0TA 2SDFA 3E6ZX 5HGTA 1Q8IA 5T1GA 4Q0FA 2A6HC 3S17B 1DOKA 2K5WA 4CJ2C 2K05A 1SNQA 1ESRA 1PDQA 3MA2B 2B2VA 5IGEA 5KEEA 2A5HA 2I07B 3L3OC 2DY8A 1OXUA 3D4WA 1HA6A 1ESFA 5C6AA 2DNEA 2PZWA 3OPOA 4I7ZC 3LX0A 2K01A 4G57A 4RKLA 1E2VA 2L9HA 2L11A 5J22A 5IOCA 4DA2A 1TWGB 2OT2A 3HS0C 2E2IB 4LK1C 3H09A 5KNDA 1IKLA 4TSSA 2EZVA 2D62A 4OGQC 3M7NA 1CZGA 4EGVA 1F9SA 3HP3A 2A6ED 2QKIC 2ZXPA 1SYEA 3BDCA 3I90A 4ZAIA 2Y0SB 2E2HB 1ZYRD 2L12A 2B2YC 4ODGA 4RCNA 4ZYSA 3NTKA 5IT9L 2OEOA 5ELCA 4RA8A 1EYDA 1D1IA 1SYBA 1ONLA 3S14B 2EXZA 3C46A 1UEAB 1EIHA 2B8GA 1I4RA 2EVBA 4IFDH 2K32A 2RDHA 1HXYD 1EQVA 2DNCA 1BCPB 2F3VA 1F2YA 5JEAG 3P20A 2A69C 1EY8A 1XWEA 3JAME 1BUVT 4G4KA 1G6ZA 1D5XC 3M3YB 4K6DA 1QE6A 5IGCA 1F2LA 4PMWA 4LMQD 1Y69U 2F0JA 3NUCA 2Z4IA 3I73A 2CW0D 1BCPD 2TMPA 3RZDB 2KEEA 1EQTA 1I4GA 1K8OA 3NPPA 4X3KA 3HOZB 2PQEA 1AZPA 1FR3A 1HFGA 2WIIB 3IL8A 1V1OA 5C44B 1A6XA 5M5XB 3BVGA 1BNZA 4FVMA 2AQ3B 4HN7A 3AMUA 4K2KA 4Q5VA 1SYCA 1WTOA 2F0PA 1S4ZA 1LTSD 1SNOA 5K5PA 2F3WA 3GQBA 2A68C 3MC0B 1EY6A 4XT1B 1WD1A 4QF4A 2KOLA 3MXGA 4B9WA 1MGSA 1TY2A 2VB3X 3HOYB 1JOQA 1QG7A 3TP7A 1HQRD 1CM9A 1RD9D 1Q3LA 3F2UA 3OIPA 1JB3A 3H3VC 3GO5A 3HEJA 4A3GB 4G7OC 2XRSD 1KLGD 4WJWA 1PFBA 1MSGA 1NCVA 3WOFA 3QOLA 2KHSA 4L8JA 3G7LA 3U9OA 1PXUA 5IT9E 2YU9B 2RBMA 2G9HD 5ELBA 4KY5A 3U9SA 1QB5D 4XTCS 2NN6I 1FYCA 3GTKB 4IALA 4ME5A 5CC4A 4N9TA 3IAYA 2NUCA 1B9MA 3H6MA 2D2CC 4OHJA 4XQJA 4UDUC 1V43A 3KLRA 3K5OA 4OIKA 1I50B 1FNWA 3NBHA 4S3SA 2AUKA 2KCCA 2JYOA 3KF8A 2D9UA 1ZXTA 1VF5C 1EU3A 2PPBC 1T5XD 2EPBA 2FMCA 2MGSA 1DOMA 1D5ZC 3HOWB 4DAYA 2G9DA 1GHJA 3TZDA 4J6HA 5DM63 5EPJA 4A3FB 3V96A 1PRTC 1QNKA 1C4QA 4MHEA 1EZ6A 1Y8NB 3PO2B 1CFMA 5M3MB 4ZQ3A 3HOXB 4IFDI 3EA6A 2VNUD 1HQMC 3FDTA 5EPKA 2K28A 1Z47A 3LWEA 3BDOA 2CVRA 1LTGD 1KDCA 3EVQA 1MBYA 4KY6A 2PO4A 4C1NI 4DXFA 1FNUA 5A2QE 3URYA 4H13C 4HR7B 1KNEA 1I6VC 5BN3A 3HOVB 3M7GA 2EJFC 4KI0A 1U4RA 2SNMA 3OW7A 3SK6A 5K36G 1SEBD 3FKIB 4CJ1B 1CZWA 4MN3A 3R2TA 4F87A 5I9OA 3VA5A 3M85A 2B2VC 1RTOA 1LT4D 1E0BA 3J80E 3MTSA 3OMCA 2BDOA 3R3OA 1F77A 3OOCA 5EJWA 4C1NK 2HDLA 2I46A 1WTRA 2NYZD 1WTPA 1BF4A 3FPPA 5C5LA 5BN5A 1QILA 5CV7A 2NVQB 2O5JC 1SJED 3PIP3 5I6WA 4E6IA 2PZTA 1T5EA 2DN8A 3CU7A 3D6WA 1GUSA 1SE3A 1G2SA 1JWMD 3BZDB 1AP0A 1BDOA 3DWAA 1CTMA 1W6JA 4K5WA 5A35A 1STAA 1NR4A 4KKSA 1ILPA 5KYLA 1STNA 3QB3A 3EROA 1BCPF 4FF3A 4CJ0B 5JVG3 4RGOS 2IJ0A 2B63B 5EKKA 2EY5A 3GTPB 3G6JB 2EY6A 4RHSA 3VYRA 5M5YB 3Q0AA 2BCOA 4KMUC 2QILA 3X3NA 1K83B 1J8IA 4U68A 1U4LA 3T13A 4C3JB 4Y7NB 1VMCA 3NQTA 2ZXRA 3H94A 1SYDA 1SNMA 3SEBA 5C0XJ 4QCLA 3I4MB 3PO3B 4QUCA 1SNPA 4K8JA 2Q8IB 2BOSA 2K33A 1EOTA 2BE5D 3M4OB 1EZ8A 3K6OA 3SK4A 1LT3D 3DUZA 3LWUA 5C4HA 4EQOA 4ID6A 2A74C 3PUWA 5FO8B 3C3LA 4MIUA 4PMBA 4TKOB 2B2WA 2C9OA 1PTOF 3TSSA 3GTLB 3GV3A 2K04A 2BDNA 1I4XA 3DXJC 4RWSC 5J1ZA 2PYKA 1Q90A 2PCFB 4A3BB 1A15A 4C2MB 3J7YW 5CORA 4KKUA 2WACA 1GHKA 3QOJA 2KECA 5D3IB 2MJ8A 5JOBA 1DJRD 1STYA 2LMCB 4OIJA 1O7ZA 1VMPA 1B4OA 4K5XA 1H9SA 1S5DD 1SE2A 2PNRC 3PUZA 3OWEB 5FKAC 2AUJD 1MSHA 3NWSA 3T56B 2J7ZA 1DCZA 4O42A 3I91A 2XSCA 4OO1H 3NQIA 1B9NA 3D8GA 2MPMA 4K5VA 2JA5B 1TS5A 1KDBA 3CHBD 2RSOA 3NTHA 4ZUIA 1I4HA 1Q1BA 3VR4A 1JWSD 1EFID 4IURA 1HTLD 1M4VA 5CV6A 1IYUA 4BBSB 2NN6G 5F2DA 2XWJB 5D14A 1ZKOA 1YNNC 1U4MA 2NN6H 4L6TB 1TWCB 3QO2A 2F0NA 3Q6SA 1WVLA 3MWYW 2CW0C 2JE6I 2JSOA 4ILWA 3MHBA 1D6EC 3GTOB 2K5QA 3VYUA 5C5MA 1PZJD 1SSOA 1MI2A 4F88A 1TY0A 2B2UA 1SNCA 2F0LA 3A55A 4UAIA 2JEBI 3KK7A 3I8ZA 3AB9A 1XTCD 1I4QA 1STBA 3CRLC 4DAPA 2EJMA 2K03A 3SXHA 3J81L 1G291 3NSWA 4JK1C 3E5SA 1LLRD 4ABNA 4PQXA 5CGKA 1ICWA 4IFDG 1R4QB 5JJZA 4HEDA 1BXTA 1DOLA 1EY5A 1PFNA 5C3XA 1GUGA 1QCBD 1W6KA 1PYWD 2AQ1B 1OXXK 2L0CA 4K6LA 5LL6X 3TMEA 1CQFA 1IHZA 1Y1WB 2F4IA 1TS4A 3TDQA 1FGBD 4K14A 1S5ED 2L55A 2A6HD 2ICEC 3OWFA 1JCKB 1O78A 4H44C 1PRTF 2MHVA 1Z6HA 5EQ0A 1JORA 2B2TA 3VR5A 3L7ZC 1SYGA 3SK5A 1WTQA 3VYTA 1H9KA 4FXGC 1LABA 5IODA 2JA8B 2KQ3A 5IGGA 2BA0A 3TN2A 4N9PA 2E2JB 3I3CA 3ZYYX 5I9PA 3VR3A 1A3UA 3GV6A 1D1KA 1TS3A 3HGBA 1TWHB 1PTOB 3S1RB 4KTAA 2IL8A 3K0YA 1NAPA 4IUNA 1SBBB 4PV1C 4CBVA 1QOHA 2O4XA 3FMCA 2JA6B 4FP5D 3EFXD 4OO1I 1STHA 2EYHA 5TSSA 1DZ1A 4JBWA 3T51B 4IUPA 4EQPA 4G7ZC 2D5DA 3D6CA 1PTOD 5LHY1 5C3EB 4G7HC 1NUCA 2F0DA 2B39A 4QUFA 2F0UA 2ENBA 4J8QA 4XIGS 1YNJC 4ZKCB 1RJTA 4NP5A 4ZUJA 3OHXC 3NXWA 1RDPD 1G8ZD 3QIAA 1KDAA 3S1QB 2IPKD 1A3TA 4BA2I 1LTRD 1R4PB 1PTOH 4RFBA 2ID0A 5KYIA 3X3MA 3SE0A 4XDXA 1AN8A 1JQYD 4WFN3 3KLSA 1PFMA 4FXKC 3J7AF 2B2WC 4KN4C 1F9RA 1I4PA 1CHQD 1G2TA 5C4XB 3MXPA 3V05A 1WCMB 5JEAJ 4FF4A 2E74C 2YYZA 4BS9A 4K8IA 3I72A 1EY4A 4HTHA 3BG3A 1EY9A 1KTKA 2O2LD 4V0BA 4DXGA 3K7AB 4QIWB 2F0VA 2R61A 2NVYB 4BA1I 1S5BD 2FMMA 4IUUA 2JA7B 2EDGA 1AFPA 1LT5D 5EBCA 1TU2B 2F0WA 4RGTA 4A3JB 2RA4A 3BYTB 5CV5A 4DF7A 3KUPA 1ET6A 3BS1A 5C0XH 1HCZA 1F2ZA 2WINB 1SMYC 3PV0A 3W2DA 1L0YB 4P2CB 2XVSA 1D5MC 3SDZA 2F03A 3MXUA 4XT3B 1VF7A 4DGZA 4C3IB 3Q24A 3MZ5A 2KVMA 2WV6D 3GP7A 3RMHA 1TIID 3MAQA 2PW5A 1HUNA 1I3QB 2N88A 4RH6A 3T16A 1S5FD 4DNTB 3ERQA 1CK1A 1A2UA 3H91A 1RHPA 3M4YA 4KJOA 2N55A 1DONA 2F0FA 3MVVA 1NSNS 3OIQA 2VB2X 4IUVA 2LY7A 5FO7B 4FYDA 3V2TA 3K59A 1BBXC 4XQNA 1HTPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENA A;  5JOB A;  5KRU A;  4YIJ A;  1STY A;  2EYM A;  4ZQ3 A;  4H7B A;  2EY2 A;  3C1E A;  3MXP A;  2F0T A;  1KAA A;  5HGT A;  1A3U A;  2EY1 A;  1ENC A;  5I9P A;  5J39 A;  4DFA A;  4F7X A;  4K8I A;  1STB A;  3HEJ A;  5EKK A;  1EY4 A;  2EY5 A;  3MEH A;  4HTH A;  4KY7 A;  4PMC A;  3HZX A;  4K5X A;  5M9O A;  2HQE A;  4IZ8 A;  1A3V A;  1EY9 A;  2EY6 A;  2F0Q A;  4KD4 A;  5CV8 A;  4NMZ A;  1EQV A;  1KDC A;  2F0V A;  1SNQ A;  3EVQ A;  4WOR A;  4KTA A;  3SXH A;  4B9X A;  3NP8 A;  3QOL A;  2KHS A;  2F0M A;  2F3V A;  1F2Y A;  4KJN A;  2EYO A;  4WRD A;  5IGE A;  5KEE A;  4KY6 A;  1F2M A;  3TP7 A;  3E5S A;  3U9O A;  2F0K A;  1A2T A;  4IUN A;  5EGT A;  2RBM A;  1EY8 A;  4OL7 A;  5CGK A;  2O4X A;  4KY5 A;  2F0W A;  3OSO A;  5C4Z A;  1SND A;  5E1F A;  4EQN A;  3T13 A;  2SNM A;  3SK6 A;  1EY5 A;  1TR5 A;  3D4W A;  5CV5 A;  4PNY A;  4K6D A;  3SHL A;  5C6A A;  4DF7 A;  2PZW A;  3NQT A;  2PW7 A;  1STH A;  5C3X A;  5IGC A;  5HUR A;  1SYD A;  3LX0 A;  2EYP A;  1SNM A;  2EYH A;  3NK9 A;  5I6Y A;  2F0O A;  4G57 A;  2F0J A;  3D8G A;  4RKL A;  4K5V A;  3NUC A;  5CR3 A;  3VA5 A;  5I9O A;  5IGB A;  1KDB A;  4EQP A;  1F2Z A;  4KD3 A;  3TME A;  4EVO A;  5J22 A;  3D6C A;  4IAL A;  1IHZ A;  5EKL A;  1SNP A;  3RUZ A;  5IOC A;  2SOB A;  4K8J A;  5KIX A;  3OMC A;  2EYL A;  5DAU A;  4HMJ A;  4ME5 A;  5CC4 A;  3R3O A;  4N9T A;  4ZUI A;  3SK8 A;  3NHH A;  1NUC A;  4KV6 A;  2F0D A;  5JAV A;  2NUC A;  4F8M A;  3H6M A;  4K14 A;  2EYF A;  5C3W A;  1EZ8 A;  3D4D A;  5CV6 A;  2F0U A;  3BDL A;  2ENB A;  3SK4 A;  5F2D A;  4DGZ A;  5IGF A;  5NUC A;  5E3F A;  3MZ5 A;  1TQO A;  4LAA A;  1II3 A;  1JOK A;  5C5L A;  3TP5 A;  5C4H A;  3OWF A;  2F0E A;  2PQE A;  4S3S A;  5CV7 A;  5CV9 A;  1TT2 A;  2PW5 A;  4NP5 A;  3EJI A;  1STG A;  2F0S A;  2OF1 A;  2OXP A;  3DMU A;  4ID6 A;  4ZUJ A;  4EQO A;  3NXW A;  2EYJ A;  5I6W A;  4E6I A;  2SNS A;  4MIU A;  2PZT A;  4PMB A;  4QMG A;  1KDA A;  2F0N A;  2M00 A;  4J1M A;  4R8N A;  3T16 A;  1A3T A;  3P1H A;  4QB4 A;  5IGD A;  1SYE A;  3BDC A;  3ERQ A;  1JOR A;  1A2U A;  1EYA A;  4K2K A;  4TRD A;  1SYC A;  4HMI A;  3PMF A;  4RKB A;  5DEH A;  1AEX A;  1RKN A;  2QDB A;  1SYG A;  2RDF A;  3SK5 A;  1U9R A;  2F0P A;  5KYI A;  3MHB A;  3TP6 A;  5KGU A;  4NKL A;  2F0G A;  3DHQ A;  1SNO A;  5J1Z A;  2PYK A;  4NDX A;  4KJO A;  5K5P A;  2F3W A;  4ODG A;  3S9W A;  3C1F A;  5CV4 A;  2F0F A;  3MVV A;  2LKV A;  1NSN S;  4J6H A;  1EY0 A;  5C5M A;  5IOD A;  4K5W A;  2RKS A;  1EY6 A;  1JOO A;  1STA A;  2F0I A;  4K2L A;  4KHV A;  4QF4 A;  2KQ3 A;  2OEO A;  3OMG A;  1EYD A;  3V2T A;  5KYL A;  4B9W A;  3SR1 A;  2PZU A;  1STN A;  3P75 A;  1KAB A;  1SNC A;  2WAC A;  3TP8 A;  1EY7 A;  1SYB A;  5IGG A;  1JOQ A;  4DU9 A;  5ISR A;  1SYF A;  3QOJ A;  2F0L A;  3QB3 A;  2F0H A;  3ITP A;  1EYC A;  2EXZ A;  4N9P A;  1EZ6 A;  5IIF A;  3ERO A;  4I65 A; 
#chains in the Genus database with same CATH topology
 4DNR B;  5M3F B;  1C0A A;  1BBW A;  3T4A C;  4R4T A;  3HOV G;  1KLU D;  1ENC A;  1GXD C;  4DR3 L;  2ASB A;  3FKI G;  1PRT B;  3A8I E;  5FK9 C;  5FLM G;  1EL0 A;  5CV8 A;  2B2U C;  3A54 A;  4NMZ A;  5LMN Q;  4N8F A;  4C3I H;  1HUM A;  4B9X A;  3NP8 A;  4KJN A;  5EKI A;  4LF7 L;  3A7A B;  1A2T A;  1I3Q H;  4XYO A;  4LF6 L;  4YCU A;  2AQ2 B;  2Z8L A;  1MKH A;  1L0X B;  1EEI D;  1YBY A;  3N6R A;  2IT1 A;  4U67 3;  2ICI A;  2LFN A;  1N36 L;  2B8F A;  4FF1 A;  3UI2 A;  5JJK A;  1PRT D;  1X3Q A;  2R92 B;  2CFM A;  5IGB A;  1LO5 D;  3RD4 A;  5EKL A;  3IRB A;  1XYI A;  5KIX A;  1SFO B;  2WP8 J;  4DAV A;  2LS0 1;  4HIM A;  5JAV A;  4GLX A;  2VXW A;  4HJ9 A;  5ELF A;  1HRJ A;  1HZA A;  1CKO A;  4ZRZ A;  1JWU D;  2TSS A;  5M3F H;  1P16 A;  5NUC A;  1HR0 L;  2M9V A;  1RTN A;  2L5T A;  4JI2 L;  2K7V A;  1NR2 A;  3J7A 5;  4AYB B;  2NTS A;  2OF1 A;  4HSV A;  3QG1 A;  2EJG C;  2B29 A;  1PZK D;  5KRU A;  2M00 A;  3KBX A;  1L1O A;  4QB4 A;  2IWH A;  1KNA A;  2WB1 E;  4DR7 L;  3Q23 A;  1M8A A;  2NZ1 D;  1ASZ A;  1DD2 A;  3PMF A;  2J4X A;  1AEX A;  1U9R A;  2JXM B;  3TP6 A;  5DM7 3;  5KGU A;  1XPU A;  2F0G A;  2OCE A;  3A8K E;  3C1F A;  2B63 G;  1O7L A;  4KK7 A;  1EY0 A;  1HFN A;  1O80 A;  1U5K A;  4AH6 A;  1JOO A;  1HA5 A;  4IPC A;  5EBD A;  3TBI B;  2XIW A;  1EY7 A;  1K8M A;  4IQZ A;  2B2T C;  2F0H A;  3MXN B;  2R92 H;  4GZY C;  1WJJ A;  1DM0 B;  1K3B C;  1ENA A;  2RCF A;  3W1B A;  1IKM A;  4H7B A;  5FO9 B;  2H4O A;  3C1E A;  4X65 L;  1KAA A;  1SFO H;  2KJX A;  4C3J G;  4F7X A;  2NVX B;  4BY7 B;  3G6E A;  4PMC A;  4DR3 Q;  4BXX H;  4KKT A;  1PH8 A;  4LF5 L;  1X3P A;  2UU9 L;  4AYB G;  4DV0 L;  2YTX A;  3I4M G;  3D31 A;  2Q2U A;  3PO3 G;  5COY A;  1XTD A;  4RGN A;  2A6E C;  3E0J A;  2EYO A;  5FLX L;  2X6L A;  1GUW A;  3QWN A;  2JJQ A;  2F0K A;  4C3H B;  1PH3 A;  1PH4 A;  3J7A V;  1A62 A;  4LF7 Q;  5IY0 A;  1UWV A;  1UNS A;  4DK6 C;  1B53 A;  1YJ9 A;  4EQN A;  2PMZ E;  4KLK A;  3WDN A;  4OWX B;  1UE6 A;  4LF6 Q;  1Q12 A;  3A74 A;  4JI0 Q;  3LNN A;  2NWG A;  2QEJ C;  1EWC A;  1ZYR C;  5C0X I;  2EQS A;  1ENF A;  2K6A A;  3K5M A;  1JMC A;  1OO9 B;  1PHJ A;  2Q8T A;  1VCI A;  1JC7 A;  2LXJ A;  2FHT A;  4BBR B;  2GA4 B;  4I7A A;  4EVO A;  3KDF A;  1S5C D;  4QL5 A;  4DPG A;  1DGS A;  3DEO A;  5DAU A;  1Y8P B;  1B3A A;  4B08 A;  1D2B A;  4OO1 G;  4PZ6 A;  1C8C A;  1K8A C;  1FVI A;  2HUG A;  4BY7 G;  1E24 A;  4A3B G;  1GJX A;  1JOK A;  2NVT B;  5DEH A;  2NVX H;  3R93 A;  3JAM L;  4JI2 Q;  3UE1 A;  2BA1 A;  4BY7 H;  3QJY A;  2SNS A;  4A3B H;  5IGD A;  3E9H A;  4M8A A;  1WTV A;  2ES2 A;  1VQ5 A;  1VQI A;  2WAQ B;  1EYA A;  4HMI A;  1B2T A;  3SGI A;  4LUZ A;  1RKN A;  2L4N A;  3H3V I;  3M9B A;  2O5I C;  3GTJ B;  1TWA B;  4C3H H;  5IYD G;  3S9W A;  1P8L A;  5GAE C;  2WFW A;  2M2L A;  2KEN A;  2RKS A;  2F0I A;  2MQH A;  4A3K B;  1WFQ A;  3NE5 B;  2R3Z A;  2PI2 E;  1S40 A;  1C48 A;  1IW7 D;  1PZI D;  4KN7 C;  4OEL B;  1SYF A;  5LMU Q;  2CH4 A;  4BBR H;  3W3A A;  1BCP C;  1EEF D;  2EYM A;  4YY3 L;  4NW2 A;  4L5S A;  5DNF A;  1IBM Q;  3L9A X;  3NEL A;  3I4L A;  4O1N A;  3MEH A;  1NJI C;  3Q22 A;  5EPL A;  4ZKB B;  2CHB D;  4AQY Q;  2HQE A;  5I2Y A;  1JE5 A;  2JA5 G;  3GTM B;  1WTX A;  2VZA A;  3PUY A;  4HCE A;  2NVT H;  1YVC A;  4UP8 A;  4WRD A;  4X64 Q;  2WAQ G;  4DV0 Q;  3D4R A;  2XRQ D;  4A3E B;  3IKJ A;  4LF9 L;  5KNB A;  4ZLT F;  5C4Z A;  1X32 A;  4R1J A;  1F9Q A;  4GN4 B;  3MXN A;  5E1F A;  3ND9 A;  4UHV A;  2X6G A;  4BBS G;  4PNY A;  3S2D B;  5CYU A;  4R9W A;  4DV4 Q;  4DV1 L;  5HUR A;  2KHI A;  4N8X 1;  3GTJ H;  1TWA H;  1IL8 A;  4RCO A;  2Z6K A;  3FVQ A;  2CQA A;  2HIX A;  5CR3 A;  3ND8 A;  3IFD A;  3O13 A;  4JI7 L;  3CCV A;  2VQF Q;  4X3U A;  1LT6 D;  1LTB D;  4TVA B;  4KV6 A;  2ZT9 C;  1RF2 D;  4B3T L;  5FLX E;  3DWQ A;  3K5L A;  5T1I A;  4EX5 A;  1M1K C;  3PF5 A;  2XTI A;  4FO2 A;  4PZ7 A;  2F0E A;  3K5N A;  2E5L Q;  5CV9 A;  2F0S A;  2SEB D;  1CHP D;  4QMG A;  4J1M A;  3T1H L;  4GN3 B;  4DK1 A;  2K5D A;  3NEM A;  1PTO C;  3GTM H;  4TRD A;  4DV2 L;  3HKZ E;  2Z1C A;  1UUP A;  3CKI B;  2QDB A;  2XNA C;  1BQQ T;  3JC6 6;  2MP1 A;  2J0T D;  1VDZ A;  3G4S A;  3K58 A;  4A3E H;  4UY8 C;  1PA6 A;  4GLV B;  4NDX A;  2Q8R E;  3VR6 A;  1QZG A;  1GUT A;  2LKV A;  3WOE A;  3P7J A;  4KHV A;  3S2D H;  5BR8 Q;  3A7L A;  3UDG A;  3J7Z C;  2VQE L;  4DU9 A;  2OWO A;  3A56 A;  5CBA E;  5IYC G;  5E4X A;  4YIJ A;  5JEA H;  1H9R A;  4CHT B;  3HOU B;  3NWT A;  3DM1 A;  3KF6 B;  4DFA A;  3CP0 A;  4XXE A;  1E1O A;  1JE4 A;  2H1E A;  5D3D A;  2QCP X;  4X3T A;  2F1M A;  5LL6 S;  3H15 A;  1YNN D;  4IZ8 A;  3I55 A;  3U50 C;  2UXC Q;  3CMA A;  4IPD A;  3PF4 A;  4P72 A;  3A8J E;  1CA5 A;  3PIO 3;  2F0M A;  1QVF A;  1Y1W G;  1F2M A;  2QEX A;  2EOT A;  4YHH L;  2I5H A;  2I0Q A;  3BJU A;  2DGY A;  3VR2 A;  2C5C A;  2XGT A;  4DAM A;  1VQN A;  4ME3 A;  2IW3 A;  1TR5 A;  4M1U B;  4CKB A;  2RQX A;  1Z7T A;  2HD3 A;  2UUB L;  3BVZ A;  3NK9 A;  2F0O A;  3I70 A;  3FPU B;  4YCW A;  4HJ5 A;  4JI6 Q;  5LMN W;  4KD3 A;  3H0G B;  1X55 A;  1EWH A;  4IN3 A;  4JI7 Q;  5IWA L;  1SDF A;  1LAC A;  3NHH A;  4GLA C;  5ELD A;  2FJ2 A;  3JAM i;  3CAM A;  3BYY B;  4A3I B;  3HOU G;  4POG A;  5C3W A;  3T53 B;  1BO0 A;  4IUT A;  3BDL A;  1UAP A;  5IGF A;  1O7I A;  1DYQ A;  1SE4 A;  1NMG A;  5A2Q L;  3HOU H;  2JA8 G;  5G3L F;  5JPN C;  2MUY A;  1OXT A;  3HRZ C;  2EYJ A;  1XMQ L;  2MNA A;  3KBG A;  3P1H A;  2BH8 A;  3CQZ B;  1OXV A;  1FJG Q;  3HG9 A;  1STE A;  3T1H Q;  1VQH A;  1B70 B;  1WTW A;  4RKB A;  1CQV A;  1VQ4 A;  4DV2 Q;  4UP9 A;  4B3M Q;  4NKL A;  5E4W C;  1I5F A;  3J81 E;  1KL9 A;  2ZTE A;  1M90 C;  1JR0 D;  3J80 L;  2HHH L;  2RDG A;  4L5R C;  3W5O A;  1XX8 A;  1BOS A;  3OMG A;  1B50 A;  3FEW X;  4FF2 A;  2A69 D;  2IX1 A;  1QJO A;  5JVH 3;  3ITP A;  1EYC A;  2D0P A;  5IIF A;  2WB1 B;  4I65 A;  2HT1 A;  1E2W A;  4X66 Q;  2RVL A;  3OTO Q;  2HDM A;  2ZTD A;  4FNF A;  1LTT D;  3RLF A;  2XN9 C;  4YWL A;  3S16 B;  1XXG A;  3TRZ A;  4A3D B;  3MFY A;  4DK0 A;  4A3I H;  2VS1 A;  3HZX A;  4IFD J;  1GUN A;  2E76 C;  4IOC A;  1EIY B;  1WD0 A;  1X3F A;  4H0L C;  4GN5 A;  2UXD L;  2NB0 A;  1E2Z A;  4WOR A;  2WKC A;  2DY7 A;  3CCQ A;  1ET9 A;  4NXM Q;  4GKJ Q;  5C3E G;  3PGZ A;  4OL7 A;  1S72 A;  3I2Z A;  4YHH Q;  3OSO A;  3CQZ H;  1K73 C;  1CKM A;  3J81 i;  4AIM A;  3ONA B;  3SHL A;  5I2X A;  1SAP A;  1FNV A;  3STB D;  3KF6 A;  2E75 C;  2LSS A;  4JG2 A;  2R93 B;  1B44 D;  3DEP A;  2AWO A;  3RUZ A;  1VQG A;  4CGY B;  4KHP Q;  4HMJ A;  3AFP A;  4O2D A;  1C7Y A;  2IHE A;  1U4P A;  3PIP A;  3RZO B;  1CI3 M;  2Y0S E;  1SJH D;  5IWA Q;  1B1Z A;  1JIC A;  1J9O A;  3BVM A;  4JCV E;  5DLQ E;  4ALP A;  3TZU A;  5C0X G;  2PMZ B;  4IPH A;  2A68 D;  1IYV A;  4LJZ C;  2GVA A;  2B2Y A;  3UDF A;  3G71 A;  3TP5 A;  1CA6 A;  4NXN Q;  1MD2 D;  2ZJP A;  3S16 H;  1TT2 A;  2FFK B;  3DMU A;  1TKW B;  4A3D H;  1TS2 A;  1GOZ A;  1VQ6 A;  2PNH A;  4RMF A;  1LTA D;  3PUV A;  1XMQ Q;  1Q82 C;  1YEZ A;  4C56 C;  1HNX Q;  3MFG A;  2WKD A;  3IFT A;  4RAU C;  3SVM A;  1WCM G;  1CKN B;  4Z9C B;  4CKC A;  1KQS A;  1G91 A;  1N33 Q;  3DHQ A;  1I94 L;  4L5T A;  4JVZ A;  2P5Z X;  1I6H B;  3UE0 A;  1Y8O B;  2JP1 A;  4GOP B;  1NNX A;  1HR0 W;  2HCC A;  4BY1 B;  4ULL A;  3SR1 A;  3P75 A;  1KAB A;  1IBK L;  3S2H B;  3KJP A;  5ISR A;  2LXK A;  2R93 H;  2JA7 G;  2OTL A;  4HSP A;  2I5L X;  1K9M C;  1V1Q A;  3AQQ A;  1V8Q A;  3TRE A;  4A3J G;  4R4C A;  2EY1 A;  1T9H A;  4A93 B;  2BE5 C;  1YNJ D;  3RZO H;  1WOC A;  5AJ3 L;  4DN4 M;  4KY7 A;  4DR4 L;  1LTI D;  5M9O A;  2MFI A;  4KD4 A;  2F0Q A;  4CKE A;  2R7Z B;  5K36 H;  1H9M A;  2AWN A;  4FXD A;  1XPO A;  3I4N B;  2ZJR A;  2R6G A;  2IX0 A;  5KNC A;  1O7Y A;  2UXD Q;  4DUY L;  2XWB B;  1PH5 A;  2KA7 A;  5EGT A;  3M4Q A;  2ZM6 L;  1AZQ A;  1OXS C;  4IUQ A;  1SND A;  1MHW C;  1TWF B;  4V19 0;  1HPC A;  1VQK A;  1GKH A;  3C2P A;  4C3I G;  2PW7 A;  1Q1E A;  2L1B A;  1CSQ A;  4XQQ A;  5I6Y A;  3AFQ A;  1QUQ B;  1D8L A;  4BY1 G;  5BN4 A;  2QW7 A;  3FHW A;  3CCR A;  4DR6 L;  4LFA Q;  1I6H H;  1VQE A;  2SOB A;  3ER0 A;  3FRP B;  3J81 c;  3SK8 A;  3T1Y L;  4BY1 H;  3NBI A;  2RSN A;  3DWP A;  5FOB B;  3S2H H;  1H9S B;  2EYF A;  2FIN B;  1HJP A;  4JI4 Q;  4A3M B;  1YHB A;  1II3 A;  1V1P B;  5D65 A;  2Z6K C;  2ZXO A;  4A93 H;  1FD7 D;  3EJI A;  1STG A;  2OXP A;  1ILQ A;  4KHZ A;  1PH1 A;  3K57 A;  2HCI A;  4R8N A;  3N52 A;  1WYD A;  2R7Z H;  3EQL C;  2OTJ A;  5M3F G;  3I4N H;  4DNI A;  2RDF A;  2Z4H A;  1RCV D;  1CT1 D;  3F8T A;  1Y1V B;  3OYY A;  1EIG A;  3RNU A;  1TWF H;  1I94 Q;  1LV9 A;  4K2L A;  1KAW A;  1ROD A;  3K0X A;  1SMY D;  3K81 C;  2PZU A;  1RL2 A;  3TP8 A;  4POF A;  1EU4 A;  3HKZ B;  4JV5 Q;  5EAY A;  5M5W B;  5J39 A;  1SR3 A;  4GKK Q;  3VYS A;  3S15 B;  4RGM A;  3R2I A;  1SE8 A;  1A3V A;  2VUM B;  2R92 G;  1HHV A;  4DR4 Q;  4A3M H;  2NTT A;  4HAE A;  1TVX A;  4DR1 L;  1IW7 C;  1CUK A;  1DXM A;  2A1A A;  1ZEQ X;  2K1B A;  4DUY Q;  1PMR A;  2NBF A;  4BXX G;  1QWY A;  2F3I A;  3GTQ B;  5AFW A;  4A4I A;  3VA7 A;  5G3L D;  4DV6 L;  1F9P A;  2EYP A;  1H9J A;  3PUX A;  1E1T A;  2K5V A;  1HZ9 A;  4HCS A;  4XYQ A;  4ZK9 B;  1E7Z A;  1Y1V H;  1TXY A;  3AU7 A;  1QNU A;  3NEN A;  5ELE A;  3S1M B;  1HZB A;  2EYL A;  4LNQ A;  1VQB A;  4LFC L;  3R8B A;  5CBE E;  1VS0 A;  1KD1 C;  2QF7 A;  4F8M A;  1AH9 A;  3K80 C;  4QGU A;  1MJE A;  2EE1 A;  4BWG B;  1ML0 D;  3D4D A;  2KCM A;  5E3F A;  4X3S A;  2K5H A;  1TQO A;  4LAA A;  5M5W H;  1BBU A;  4R8I A;  1QVC A;  1X56 A;  2JEA I;  1PLF A;  2V4D A;  4TQU S;  4H02 A;  2A73 B;  1N36 Q;  3GD7 A;  3S15 H;  5H1S E;  3S1N B;  4JBM A;  2KUM A;  3NTI A;  1X54 A;  4RHR A;  2E2D C;  2IX3 A;  1AW7 A;  1R9T B;  2KED A;  5JPM C;  2X69 A;  1GUO A;  5C4J B;  2KCN A;  3KLS X;  5CV4 A;  4L63 B;  3GTG B;  3GTQ H;  4JI8 L;  1HR0 Q;  1BR9 A;  1V1P A;  1C9O A;  2MO0 A;  5I4D A;  3D3R A;  4C3H G;  3F2C A;  5CMD A;  1SXT A;  3CRK C;  2EY2 A;  4GNX B;  1KC8 C;  2F0T A;  4CDC C;  2SDF A;  3E6Z X;  5HGT A;  2QA4 A;  1QZH A;  4DR7 Q;  1Q8I A;  5GAG C;  5T1G A;  4Q0F A;  2F52 A;  2A6H C;  3S17 B;  1DOK A;  2K5W A;  4CJ2 C;  4A3C G;  2K05 A;  1SNQ A;  1ESR A;  4BBR G;  1XMO L;  1VQC A;  1PDQ A;  3MA2 B;  3RLN A;  2B2V A;  5IGE A;  5KEE A;  2A5H A;  2I07 B;  3A5U A;  3ICE A;  3L3O C;  1IYJ B;  2DY8 A;  3BZK A;  4A3C H;  1OXU A;  4DR1 Q;  3L2P A;  3S1N H;  1R9T H;  1Q81 C;  5JJL A;  2AMC B;  4UPA A;  3D4W A;  1HA6 A;  1ESF A;  5C6A A;  2DNE A;  1XNQ L;  2PZW A;  4X65 Q;  3ULJ A;  3OPO A;  4I7Z C;  3LX0 A;  2K01 A;  4G57 A;  4P74 A;  5C4J H;  4RKL A;  1E2V A;  1SLJ A;  2L9H A;  4LF5 Q;  2L11 A;  5J22 A;  2UU9 Q;  3F1Z A;  5IOC A;  2Z9H A;  4DA2 A;  1TWG B;  3GTG H;  2OT2 A;  3HS0 C;  1YHQ A;  2K75 A;  2E2I B;  4LK1 C;  3H09 A;  4LFC Q;  3WWV A;  5KND A;  2Z0S A;  1IKL A;  4TSS A;  2EZV A;  2D62 A;  2K4K A;  4OGQ C;  3M7N A;  1CZG A;  4EGV A;  1N34 L;  1J5E L;  1F9S A;  1SRU A;  4A3K G;  3HP3 A;  2A6E D;  5GRO A;  1AE2 A;  1L2F A;  4MTN A;  2QKI C;  3S17 H;  2ZXP A;  1SYE A;  3BDC A;  4A3K H;  4JI1 L;  1NE3 A;  3I90 A;  4ZAI A;  1HH2 P;  2Y0S B;  2E2H B;  2A8V A;  3UDX A;  1ZYR D;  2L12 A;  2B2Y C;  4ODG A;  1EWI A;  4YWM A;  4RCN A;  4P73 A;  3NTK A;  4ZYS A;  3CCJ A;  2JN4 A;  5IT9 L;  4O0A A;  2OEO A;  5ELC A;  4RA8 A;  1EYD A;  4DUZ L;  1IBL L;  1D1I A;  1SYB A;  1J6Q A;  1ONL A;  3S14 B;  2EXZ A;  4NPS A;  4A3E G;  5GQO A;  3PQI A;  3C46 A;  1UEA B;  1EIH A;  1TWG H;  2B8G A;  1I4R A;  4JI5 L;  2EVB A;  1XJV A;  2QGQ A;  3AYH B;  3HKS A;  2E2I H;  1Q86 C;  4IFD H;  1VQL A;  2K32 A;  2PQA B;  4A3L G;  2RDH A;  1BVS A;  1HXY D;  4IO9 A;  1EQV A;  4JOI A;  2DNC A;  4HJ7 A;  1BCP B;  2F3V A;  1F2Y A;  5JEA G;  4A3L H;  4DV5 L;  3P20 A;  2A69 C;  2YTY A;  3U4V A;  4OXP A;  1EY8 A;  1XWE A;  3CCL A;  3JAM E;  1BUV T;  4G4K A;  2L15 A;  3I4O A;  1D5X C;  1G6Z A;  3NBH B;  1LYL A;  4YY3 Q;  4JYA L;  4IJH A;  4K6D A;  3M3Y B;  3KF8 B;  1VQ7 A;  1QE6 A;  5IGC A;  2E2H H;  4DK3 C;  4GNX A;  1F2L A;  4PMW A;  4LMQ D;  1Y69 U;  2F0J A;  3NUC A;  1ICF B;  2Z4I A;  4MTK A;  3I73 A;  2CW0 D;  4QY7 A;  2UUC L;  1BCP D;  1YZ6 A;  4DAY B;  2TMP A;  2F4V L;  4EQ5 A;  1Q7Y C;  3RZD B;  3S14 H;  1PYS B;  2KEE A;  4LF9 Q;  2GVB A;  1EQT A;  1I4G A;  1K8O A;  3K7U C;  3NPP A;  4X3K A;  2ATW A;  1SRO A;  3HOZ B;  2PQE A;  1PVO A;  1AZP A;  1FR3 A;  1HFG A;  2WII B;  3IL8 A;  1V1O A;  5C44 B;  4DV1 Q;  2K14 A;  1N34 Q;  1A6X A;  5M5X B;  3BVG A;  2N3S A;  1BNZ A;  3DLL A;  4FVM A;  2AQ3 B;  4HN7 A;  4K0K L;  3F2B A;  3AMU A;  4K2K A;  4Q5V A;  1SYC A;  3E3X A;  4JI1 Q;  1WTO A;  2VY3 A;  2F0P A;  1S4Z A;  1LTS D;  1SNO A;  5K5P A;  2F3W A;  3GQB A;  3A5Z B;  2A68 C;  1PH6 A;  4B3T Q;  1EIF A;  4CDE C;  3MC0 B;  1EY6 A;  4XT1 B;  1IL2 A;  1WD1 A;  4QF4 A;  3M3Y H;  2KOL A;  3MXG A;  4B9W A;  1MGS A;  1TY2 A;  2VB3 X;  3HOY B;  1JOQ A;  1K28 A;  1NTG A;  4DUZ Q;  1IBL Q;  1QG7 A;  1FGU A;  3TP7 A;  1HQR D;  1CM9 A;  1HNZ L;  1MIU A;  1RD9 D;  1Q3L A;  3F2U A;  3OIP A;  1XNR L;  1JB3 A;  3H3V C;  3GO5 A;  3UDI A;  3GDE A;  3HEJ A;  2V1C C;  4A3G B;  1X3E A;  4G7O C;  2JQO A;  3RZD H;  2XRS D;  1KLG D;  4WJW A;  1PFB A;  4FDB A;  1MSG A;  2ZTC A;  1NCV A;  4QJF A;  3WOF A;  3QOL A;  3H0G G;  2KHS A;  1L1O C;  4JI3 L;  3HOZ H;  2NZO A;  4L8J A;  4UP7 A;  3G7L A;  5C44 H;  1B7Y B;  3U9O A;  5M5X H;  1PXU A;  2VQE Q;  5IT9 E;  1JJ2 A;  2YU9 B;  2RBM A;  1W3S A;  2G9H D;  5ELB A;  4A3I G;  3H0G H;  4KY5 A;  3U9S A;  2JK8 A;  1QB5 D;  4XTC S;  4JYA Q;  3QR8 A;  2NN6 I;  3MEF A;  1FYC A;  2RHQ B;  3CW2 C;  2RHS B;  3GTK B;  4IAL A;  4NB3 A;  4X6A H;  5FLX c;  4ME5 A;  5CC4 A;  4N9T A;  2NZH A;  4R4O A;  3HOY H;  2KCT A;  3IAY A;  2NUC A;  1B9M A;  3H6M A;  2D2C C;  4IOA A;  4OHJ A;  4XQJ A;  4UDU C;  2F4V Q;  1V43 A;  2UUA L;  3FP9 A;  3KLR A;  3K5O A;  4OIK A;  1I50 B;  1FNW A;  3NBH A;  4S3S A;  2AUK A;  2KCC A;  5HGQ A;  4HJ8 A;  2JYO A;  2UUB Q;  4A3G H;  3KF8 A;  2D9U A;  1ZXT A;  1VF5 C;  3ERS X;  1EU3 A;  2PPB C;  4ZCK A;  1T5X D;  2EPB A;  1HZC A;  2FMC A;  2WB1 G;  4GS3 A;  4LUV A;  4DV3 L;  4LFB L;  2MGS A;  3KFU A;  1DOM A;  5IP9 H;  1D5Z C;  3HOW B;  4L5Q A;  4DAY A;  2YU9 H;  3OW2 A;  4A3D G;  3K8A A;  2G9D A;  1GHJ A;  3TZD A;  4LW1 A;  4J6H A;  5DM6 3;  1UE5 A;  5EPJ A;  4A3F B;  3V96 A;  1PRT C;  1QNK A;  3JAM c;  1C4Q A;  4MHE A;  1V9P A;  1EZ6 A;  5J3B A;  1Y8N B;  3PO2 B;  1CFM A;  1EYG A;  5M3M B;  4ZQ3 A;  3GTK H;  1JT8 A;  1K0S A;  1HNZ Q;  3HOX B;  4IFD I;  3EA6 A;  1XNR Q;  2VNU D;  1HQM C;  3FDT A;  5EPK A;  3TEH B;  1PH2 A;  2K28 A;  4P71 A;  1Z47 A;  3LWE A;  4LUO A;  1X9N A;  3BDO A;  2CVR A;  2R93 G;  1LTG D;  2Q2I A;  1KDC A;  3EVQ A;  2HHH Q;  1I50 H;  1MBY A;  4KY6 A;  2PO4 A;  4C1N I;  4DXF A;  1FNU A;  5A2Q E;  3URY A;  4H13 C;  2MO1 A;  4HR7 B;  3W1G A;  1KNE A;  1I6V C;  2VL6 A;  2E8G A;  5BN3 A;  3HOV B;  5FJ8 G;  3M7G A;  1U0L A;  2EJF C;  1YIT A;  4KI0 A;  1U4R A;  2SNM A;  3OW7 A;  3SK6 A;  5K36 G;  1SEB D;  3FKI B;  4CJ1 B;  3LGJ A;  1CZW A;  3HOW H;  4MN3 A;  3R2T A;  4F87 A;  5FJ8 H;  3KJO A;  3CXC A;  5I9O A;  3VA5 A;  3M85 A;  2B2V C;  1RTO A;  1LT4 D;  1E0B A;  3J80 E;  3MTS A;  3OMC A;  2BDO A;  3PO2 G;  3R3O A;  4B3R L;  4A3F H;  1BKB A;  3HOX G;  1F77 A;  3E9I A;  3OOC A;  5EJW A;  4C1N K;  3PO2 H;  2HDL A;  3CPW A;  2I46 A;  1WTR A;  2NYZ D;  2QDL A;  1WTP A;  1BF4 A;  3FPP A;  5C5L A;  4IJL A;  1QIL A;  5BN5 A;  3HOX H;  5CV7 A;  1OTC A;  2NVQ B;  2O5J C;  1SJE D;  3PIP 3;  5I6W A;  4E6I A;  2YTV A;  2PZT A;  1T5E A;  2DN8 A;  3CU7 A;  3D6W A;  1GUS A;  1UE1 A;  1UE7 A;  1SE3 A;  4HIO A;  4DV3 Q;  4LFB Q;  4A93 G;  1G2S A;  1YI2 A;  1JWM D;  3BZD B;  1AP0 A;  3KDF B;  1BDO A;  2YV5 A;  1CTM A;  3DWA A;  1W6J A;  3HOV H;  4K5W A;  5A35 A;  1STA A;  2R7Z G;  1NR4 A;  5IT9 c;  4KKS A;  1ILP A;  1Y14 B;  3FKI H;  5KYL A;  5IYB G;  1STN A;  3I4N G;  1N32 L;  3I56 A;  5FLM H;  3QB3 A;  4JW0 A;  3J80 i;  3KLW A;  3ERO A;  1WTH A;  1S3O A;  1BCP F;  5IYB H;  3EN2 A;  4FF3 A;  4JI0 L;  4CJ0 B;  5JVG 3;  3BZC A;  2OQ0 A;  4RGO S;  4JC0 A;  2IJ0 A;  2B63 B;  5EKK A;  2EY5 A;  3S24 A;  3GTP B;  2CH4 W;  3G6J B;  2EY6 A;  4RHS A;  3DM3 A;  3VYR A;  5M5Y B;  3Q0A A;  3CC2 A;  1K3R A;  2BCO A;  3TS2 A;  4KMU C;  1G51 A;  2D0O A;  2NVQ H;  1A8V A;  3AEV A;  2QIL A;  1IBK Q;  1Z9F A;  3X3N A;  1K83 B;  1EQR A;  4LWC A;  1J8I A;  4U68 A;  1U4L A;  2RF4 A;  3RN2 A;  5ELN A;  3T13 A;  4C3J B;  4Y7N B;  1VMC A;  3NQT A;  2ZXR A;  4A3M G;  3H94 A;  1SYD A;  1SNM A;  4MZ9 A;  4A76 A;  3SEB A;  1CKN A;  5AJ3 Q;  5C0X J;  4QCL A;  4JOI C;  4R4I A;  3I4M B;  3PO3 B;  4QUC A;  1SNP A;  3U58 A;  4K8J A;  2Q8I B;  2BOS A;  5ELO A;  2K33 A;  4GOP A;  1K0R A;  1EOT A;  4YWK A;  2BE5 D;  2R7F A;  3M4P A;  3M4O B;  4B3R Q;  1VQD A;  1EZ8 A;  1VQO A;  3K6O A;  2ZM6 Q;  2CQO A;  2N49 A;  3SK4 A;  1LT3 D;  1B3Q A;  1Y1V G;  4GNX C;  3DUZ A;  3LWU A;  5C4H A;  1WI5 A;  2CCZ A;  4EQO A;  4ID6 A;  2A74 C;  3PUW A;  5FO8 B;  5LMU L;  3C3L A;  2B63 H;  1VQJ A;  2G5D A;  4MIU A;  1KXL A;  4PMB A;  3GTP H;  4TKO B;  2B2W A;  2C9O A;  1PTO F;  5M5Y H;  4OWW B;  3TSS A;  3GTL B;  4DR6 Q;  1IBM L;  3GV3 A;  2K04 A;  3HKZ G;  3VDY A;  2PI2 A;  4YCV A;  2BDN A;  4HID A;  1I4X A;  3DXJ C;  4RWS C;  3T1Y Q;  4AQY L;  3D0F A;  1K83 H;  2PYK A;  1Q46 A;  1Q90 A;  1SMX A;  5J1Z A;  2PCF B;  1PYB A;  4A3B B;  1LUZ A;  1A15 A;  1EUJ A;  3CCE A;  4C2M B;  3J7Y W;  2VUM G;  5COR A;  4C3J H;  3L0O A;  4QIW E;  4X64 L;  4Y7N H;  4DR5 L;  2FXQ A;  4KKU A;  1N9W A;  2WAC A;  4OEM B;  4OX9 L;  1GHK A;  3QOJ A;  1UEB A;  2KEC A;  2VUM H;  5D3I B;  1N32 Q;  2MJ8 A;  1QUQ A;  5JOB A;  1DJR D;  3I4M H;  1STY A;  5GAD C;  3PO3 H;  4DV4 L;  3U4Z A;  2K50 A;  2LMC B;  1EQQ A;  4OIJ A;  1EFW A;  2I5M X;  1O7Z A;  1VMP A;  3M4O H;  1B4O A;  4K5X A;  1H9S A;  1S5D D;  3J80 c;  1SE2 A;  2PNR C;  3PUZ A;  3CCU A;  2VQF L;  2K52 A;  3OWE B;  5FKA C;  2DJG C;  2RCN A;  2AUJ D;  5IP7 G;  2CWP A;  3TQY A;  1MSH A;  3NWS A;  3T56 B;  2J7Z A;  4J15 A;  4HIK A;  1PFS A;  3RR5 A;  5IP7 H;  3S1M H;  2Z6B A;  2HQL A;  1DCZ A;  2JA9 A;  2EIF A;  3GTL H;  3RN5 A;  4O42 A;  2E5L L;  2Q2T A;  1PH7 A;  1G6P A;  3I91 A;  2XSC A;  4OO1 H;  2K5N A;  3NQI A;  1B9N A;  3D8G A;  2MPM A;  1KRS A;  4K5V A;  2JA5 B;  1TS5 A;  1KDB A;  3CHB D;  4C2M H;  3TS0 A;  2RSO A;  3NTH A;  2N78 A;  4ZUI A;  1I4H A;  1Q1B A;  3VR4 A;  4WJ4 A;  1JWS D;  1GO3 E;  1EFI D;  4IUR A;  1HTL D;  1M4V A;  5CV6 A;  1EOV A;  1IYU A;  4BBS B;  2NN6 G;  2AKW B;  2DJF C;  5F2D A;  2XWJ B;  4CDF C;  5BR8 L;  5D14 A;  1ZKO A;  4JBK A;  5IYD H;  1YNN C;  4DV6 Q;  1U4M A;  2NN6 H;  4L6T B;  1TWC B;  3QO2 A;  1VQ8 A;  2F0N A;  2ZJQ A;  3EBE A;  3Q6S A;  1WVL A;  2A19 A;  3MWY W;  2CW0 C;  3RLO A;  1HNW L;  2JE6 I;  4LF8 L;  2JSO A;  4ILW A;  3MHB A;  1D6E C;  3GTO B;  2UXC L;  1X6O A;  2K5Q A;  2R7D A;  3VYU A;  1KHI A;  5C5M A;  1PZJ D;  1SSO A;  3CD6 A;  1MI2 A;  4F88 A;  1TY0 A;  2B2U A;  2OQK A;  4DV7 L;  1SNC A;  4OWT B;  2H5X A;  4DR5 Q;  2F0L A;  2JA5 H;  3A55 A;  4OX9 Q;  1YNX A;  3PIO A;  4UAI A;  2JEB I;  1LTL A;  3KK7 A;  3I8Z A;  3AB9 A;  1XTC D;  1I4Q A;  1STB A;  3G48 A;  1CSP A;  3CRL C;  4CDD C;  4JI6 L;  3BU2 A;  4DAP A;  2DUD A;  4PZ8 A;  4BBS H;  2EJM A;  4HJA A;  4MNO A;  2K03 A;  4X62 L;  3CCM A;  3SXH A;  1IZ6 A;  1YIJ A;  4A75 A;  1NY4 A;  3J81 L;  4JI8 Q;  5E7N A;  1G29 1;  3NSW A;  4JK1 C;  3E5S A;  1A0I A;  1LLR D;  4ABN A;  4PQX A;  1TWC H;  1L0W A;  5CGK A;  1ICW A;  4IFD G;  1R4Q B;  2Q2H A;  4JPB W;  5JJZ A;  1N8R C;  4HED A;  1BXT A;  1DOL A;  1EY5 A;  5GAH C;  1ASY A;  5L37 A;  1PFN A;  1Q8K A;  5C3X A;  1GUG A;  1QCB D;  1W6K A;  1PYW D;  2AQ1 B;  1OXX K;  3GTO H;  4LF4 L;  4AYB E;  2L0C A;  4K6L A;  5LL6 X;  1FJG L;  3TME A;  1CQF A;  1A63 A;  1KIX A;  1IHZ A;  4P75 A;  1Y1W B;  1XMO Q;  2F4I A;  1TS4 A;  4B3M L;  3TDQ A;  2EXD A;  2Y0S G;  1FGB D;  4K14 A;  1S5E D;  2L55 A;  1GVP A;  2AHO B;  2A6H D;  2ICE C;  4Y52 H;  3OWF A;  1JCK B;  1O78 A;  3PCO B;  1XNQ Q;  4H44 C;  1PRT F;  5HY6 A;  2MHV A;  1JJC B;  3OTO L;  4X66 L;  1H95 A;  1Z6H A;  5EQ0 A;  1JOR A;  2B2T A;  4B3S L;  3VR5 A;  3L7Z C;  1X3G A;  1HNW Q;  4LF8 Q;  1SYG A;  3SK5 A;  3KOJ A;  2N8N A;  5IYC H;  1QVG A;  1WTQ A;  3VYT A;  1H9K A;  4FXG C;  1LAB A;  5IOD A;  2JA8 B;  2KHJ A;  2KQ3 A;  3A0J A;  4NXM L;  4GKJ L;  1J5E Q;  5IGG A;  3STB C;  2BA0 A;  3TN2 A;  4N9P A;  2E2J B;  4DV7 Q;  3I3C A;  3ZYY X;  3ZJY C;  1Y1W H;  5I9P A;  3VR3 A;  1A3U A;  5JJI A;  3GV6 A;  1D1K A;  1TS3 A;  3HGB A;  2C35 B;  1TWH B;  2UXB L;  4KHP L;  1PTO B;  3S1R B;  4KTA A;  1YJW A;  1LM0 A;  2IL8 A;  3K0Y A;  4WJ3 M;  4X62 Q;  1NAP A;  4IUN A;  1SBB B;  4PV1 C;  1W2B A;  4CBV A;  1QOH A;  2O4X A;  3FMC A;  1YJN A;  2JA6 B;  4NXN L;  4FP5 D;  3EFX D;  4OON A;  1VQP A;  4OO1 I;  1STH A;  4JI5 Q;  3CCS A;  2EYH A;  5TSS A;  3HOZ G;  1DZ1 A;  4JBW A;  5C44 G;  3T51 B;  4IUP A;  1D7Q A;  3CPF A;  4EQP A;  4DR2 L;  4G7Z C;  2D5D A;  4PG3 A;  3D6C A;  3PSI A;  4LF4 Q;  1PTO D;  2JA8 H;  1HNX L;  2WAQ E;  5LHY 1;  5C3E B;  3CC7 A;  1YHA A;  1VQ9 A;  1N33 L;  4G7H C;  2KBN A;  1NUC A;  2F0D A;  2B39 A;  4DV5 Q;  1XPR A;  2IY5 B;  4QUF A;  2E2J H;  2F0U A;  2ENB A;  2HIV A;  4J8Q A;  1GD7 A;  4XIG S;  1YNJ C;  2GN5 A;  4ZKC B;  1RJT A;  1JJG A;  4NP5 A;  4ZUJ A;  3OHX C;  3NXW A;  1RDP D;  1G8Z D;  3QIA A;  5IE8 A;  3HOY G;  1KDA A;  3S1Q B;  2IPK D;  1A3T A;  1X65 A;  2PQA A;  4BA2 I;  1LTR D;  1TWH H;  1R4P B;  4GOP C;  1PTO H;  1PH9 A;  3S1R H;  2UUC Q;  4RFB A;  3EIV A;  2JA6 G;  2ID0 A;  5KYI A;  2CKZ B;  4B3S Q;  3X3M A;  3SE0 A;  4XDX A;  4A3G G;  1AN8 A;  1JQY D;  4WFN 3;  3KLS A;  2JA6 H;  1PFM A;  4FXK C;  3J7A F;  3KYH C;  1RIP A;  1GM5 A;  2B2W C;  4JBJ A;  5IP9 G;  4KN4 C;  3Q8D A;  1F9R A;  1I4P A;  2B3G A;  1PV4 A;  1CHQ D;  1G2T A;  3HFZ B;  4K0K Q;  4APV A;  5C4X B;  3MXP A;  3V05 A;  1WCM B;  1KRT A;  5JEA J;  3CF5 A;  4FF4 A;  5C3E H;  2E74 C;  2YYZ A;  4BS9 A;  1NBW A;  4K8I A;  3I72 A;  1EY4 A;  1AE3 A;  4HTH A;  5LMN L;  2BH2 A;  3BG3 A;  1EY9 A;  4LFA L;  2CWA A;  1KTK A;  2O2L D;  4V0B A;  4DXG A;  3K7A B;  4QIW B;  2VW9 A;  2F0V A;  3ULP A;  1SN8 A;  2R61 A;  3ULL A;  2UXB Q;  2NVY B;  4BA1 I;  4R4Q A;  1S5B D;  2FMM A;  4IUU A;  4QQB X;  2JA7 B;  2EDG A;  1AFP A;  4JI4 L;  1LT5 D;  5EBC A;  3S1Q H;  1TU2 B;  2F0W A;  4RGT A;  4A3J B;  2RA4 A;  3BYT B;  5CV5 A;  4DF7 A;  3KUP A;  1ET6 A;  1MJC A;  3BS1 A;  3CME A;  1L1O B;  1K8G A;  5C0X H;  1HCZ A;  1F2Z A;  2WIN B;  1VQM A;  4IPG A;  1E22 A;  2ALY B;  1SMY C;  3PV0 A;  3W2D A;  1L0Y B;  4DR2 Q;  4P2C B;  2XVS A;  1D5M C;  3I7F A;  3SDZ A;  3J81 j;  4JI3 Q;  2F03 A;  5C4X G;  3MXU A;  3B6Y A;  4XT3 B;  3HOW G;  1VF7 A;  4DGZ A;  1VQF A;  4C3I B;  3Q24 A;  3MZ5 A;  2KVM A;  5C4X H;  2WV6 D;  1WCM H;  3GP7 A;  1FL0 A;  3RMH A;  1TII D;  3MAQ A;  2PW5 A;  1JB7 A;  1B8A A;  1HUN A;  4A3F G;  1I3Q B;  1VQA A;  2N88 A;  4RH6 A;  3T16 A;  1S5F D;  4JV5 L;  4DNT B;  3ERQ A;  1CK1 A;  1A2U A;  3H91 A;  3K7A H;  3F2D A;  5M3M G;  3CC4 A;  1RHP A;  2NVY H;  4GKK L;  3H3V H;  3M4Y A;  2JA7 H;  1IXR A;  1NMF A;  4KJO A;  2N55 A;  1DON A;  2F0F A;  3MVV A;  5M3M H;  1NSN S;  4RG1 A;  3OIQ A;  2VB2 X;  4A3J H;  2IHF A;  4IUV A;  2UUA Q;  2LY7 A;  5FO7 B;  4FYD A;  3E0E A;  3V2T A;  3K59 A;  1BBX C;  1E3P A;  4DKA C;  4XQN A;  1HTP A; 
#chains in the Genus database with same CATH homology
 4DNR B;  5M3F B;  3T4A C;  1KLU D;  1ENC A;  1GXD C;  1PRT B;  3A8I E;  5FK9 C;  1EL0 A;  5CV8 A;  2B2U C;  3A54 A;  4NMZ A;  1HUM A;  4B9X A;  3NP8 A;  4KJN A;  5EKI A;  3A7A B;  1A2T A;  4XYO A;  2AQ2 B;  2Z8L A;  1L0X B;  1EEI D;  3N6R A;  2IT1 A;  4U67 3;  2ICI A;  2LFN A;  2B8F A;  4FF1 A;  3UI2 A;  1PRT D;  1X3Q A;  2R92 B;  5IGB A;  1LO5 D;  3RD4 A;  5EKL A;  1XYI A;  5KIX A;  1SFO B;  2WP8 J;  4DAV A;  2LS0 1;  5JAV A;  2VXW A;  5ELF A;  1HRJ A;  4ZRZ A;  1JWU D;  2TSS A;  5NUC A;  2M9V A;  1RTN A;  2L5T A;  2K7V A;  1NR2 A;  4AYB B;  2NTS A;  2OF1 A;  4HSV A;  3QG1 A;  2EJG C;  1PZK D;  5KRU A;  2M00 A;  3KBX A;  4QB4 A;  2IWH A;  1KNA A;  3Q23 A;  1M8A A;  2NZ1 D;  1DD2 A;  3PMF A;  2J4X A;  1AEX A;  1U9R A;  2JXM B;  3TP6 A;  5DM7 3;  5KGU A;  2F0G A;  3A8K E;  3C1F A;  1O7L A;  4KK7 A;  1EY0 A;  1HFN A;  1O80 A;  1JOO A;  1HA5 A;  5EBD A;  3TBI B;  2XIW A;  1EY7 A;  1K8M A;  4IQZ A;  2B2T C;  2F0H A;  4GZY C;  1DM0 B;  1ENA A;  1IKM A;  4H7B A;  5FO9 B;  2H4O A;  3C1E A;  1KAA A;  2KJX A;  4C3J G;  4F7X A;  2NVX B;  4BY7 B;  4PMC A;  4KKT A;  1X3P A;  3D31 A;  5COY A;  4RGN A;  2A6E C;  3E0J A;  2EYO A;  5FLX L;  2X6L A;  1GUW A;  3QWN A;  4C3H B;  2F0K A;  3J7A V;  1UNS A;  1B53 A;  4EQN A;  3WDN A;  1Q12 A;  2NWG A;  3LNN A;  2QEJ C;  1EWC A;  1ZYR C;  5C0X I;  1ENF A;  2K6A A;  3K5M A;  1OO9 B;  2Q8T A;  1VCI A;  1JC7 A;  2FHT A;  4BBR B;  2GA4 B;  4EVO A;  1S5C D;  3DEO A;  5DAU A;  1Y8P B;  1B3A A;  4B08 A;  1D2B A;  4OO1 G;  1C8C A;  2HUG A;  1GJX A;  1JOK A;  2NVT B;  5DEH A;  3R93 A;  3JAM L;  2BA1 A;  3QJY A;  2SNS A;  5IGD A;  4M8A A;  1WTV A;  2WAQ B;  1EYA A;  4HMI A;  1B2T A;  1RKN A;  2L4N A;  2O5I C;  3GTJ B;  1TWA B;  3S9W A;  2M2L A;  2RKS A;  2F0I A;  4A3K B;  3NE5 B;  2R3Z A;  1C48 A;  1IW7 D;  1PZI D;  4KN7 C;  1SYF A;  3W3A A;  1BCP C;  1EEF D;  2EYM A;  4NW2 A;  5DNF A;  3L9A X;  3I4L A;  4O1N A;  3MEH A;  3Q22 A;  5EPL A;  4ZKB B;  2CHB D;  2HQE A;  5I2Y A;  3GTM B;  1WTX A;  3PUY A;  4HCE A;  4WRD A;  3D4R A;  2XRQ D;  4A3E B;  3IKJ A;  5KNB A;  4ZLT F;  5C4Z A;  1X32 A;  1F9Q A;  3MXN A;  5E1F A;  3ND9 A;  2X6G A;  4PNY A;  3S2D B;  5CYU A;  4R9W A;  5HUR A;  1IL8 A;  4RCO A;  3FVQ A;  2CQA A;  5CR3 A;  3ND8 A;  3IFD A;  3O13 A;  4X3U A;  1LT6 D;  1LTB D;  4KV6 A;  2ZT9 C;  1RF2 D;  5FLX E;  3DWQ A;  3K5L A;  5T1I A;  4FO2 A;  2F0E A;  3K5N A;  5CV9 A;  2F0S A;  2SEB D;  1CHP D;  4QMG A;  4J1M A;  4DK1 A;  2K5D A;  1PTO C;  4TRD A;  2Z1C A;  1UUP A;  3CKI B;  2QDB A;  2XNA C;  1BQQ T;  2MP1 A;  2J0T D;  1VDZ A;  3K58 A;  4NDX A;  2Q8R E;  3VR6 A;  1GUT A;  2LKV A;  3WOE A;  3P7J A;  4KHV A;  3A7L A;  4DU9 A;  3A56 A;  5CBA E;  5E4X A;  4YIJ A;  5JEA H;  1H9R A;  4CHT B;  3HOU B;  3NWT A;  3DM1 A;  4DFA A;  4XXE A;  1JE4 A;  2H1E A;  5D3D A;  2QCP X;  4X3T A;  2F1M A;  5LL6 S;  1YNN D;  4IZ8 A;  3A8J E;  1CA5 A;  3PIO 3;  2F0M A;  1F2M A;  2EOT A;  3VR2 A;  2C5C A;  2IW3 A;  1TR5 A;  4M1U B;  4CKB A;  2RQX A;  1Z7T A;  3BVZ A;  3NK9 A;  2F0O A;  3I70 A;  3FPU B;  4KD3 A;  3H0G B;  1EWH A;  4IN3 A;  1SDF A;  1LAC A;  3NHH A;  5ELD A;  2FJ2 A;  3BYY B;  4A3I B;  5C3W A;  3T53 B;  1BO0 A;  4IUT A;  3BDL A;  1UAP A;  5IGF A;  1DYQ A;  1SE4 A;  5A2Q L;  5G3L F;  5JPN C;  2MUY A;  1OXT A;  3HRZ C;  2EYJ A;  3KBG A;  3P1H A;  3CQZ B;  1OXV A;  3HG9 A;  1STE A;  1WTW A;  4RKB A;  1CQV A;  4NKL A;  5E4W C;  3J81 E;  1JR0 D;  3J80 L;  2RDG A;  1XX8 A;  1BOS A;  3OMG A;  1B50 A;  3FEW X;  4FF2 A;  2A69 D;  2IX1 A;  1QJO A;  5JVH 3;  3ITP A;  1EYC A;  5IIF A;  2WB1 B;  4I65 A;  1E2W A;  2RVL A;  2HDM A;  4FNF A;  1LTT D;  3RLF A;  2XN9 C;  3S16 B;  1XXG A;  4A3D B;  3MFY A;  4DK0 A;  3HZX A;  4IFD J;  1GUN A;  2E76 C;  1WD0 A;  4H0L C;  2NB0 A;  1E2Z A;  4WOR A;  2WKC A;  2DY7 A;  1ET9 A;  4OL7 A;  3OSO A;  3ONA B;  3SHL A;  5I2X A;  1SAP A;  1FNV A;  2E75 C;  2R93 B;  1B44 D;  3DEP A;  2AWO A;  3RUZ A;  4CGY B;  4HMJ A;  1U4P A;  3RZO B;  1CI3 M;  1SJH D;  1B1Z A;  1JIC A;  1J9O A;  3BVM A;  3TZU A;  5C0X G;  2PMZ B;  2A68 D;  1IYV A;  4LJZ C;  2B2Y A;  3TP5 A;  1CA6 A;  1MD2 D;  1TT2 A;  2FFK B;  3DMU A;  1TKW B;  1TS2 A;  1GOZ A;  1LTA D;  3PUV A;  4C56 C;  3MFG A;  2WKD A;  3IFT A;  4RAU C;  3SVM A;  4Z9C B;  4CKC A;  1G91 A;  3DHQ A;  1I6H B;  1Y8O B;  2JP1 A;  2HCC A;  4BY1 B;  4ULL A;  3SR1 A;  3P75 A;  1KAB A;  3S2H B;  5ISR A;  4HSP A;  1V8Q A;  2EY1 A;  4A93 B;  2BE5 C;  1YNJ D;  4DN4 M;  4KY7 A;  1LTI D;  5M9O A;  4KD4 A;  2F0Q A;  4CKE A;  2R7Z B;  5K36 H;  1H9M A;  2AWN A;  4FXD A;  3I4N B;  2R6G A;  2IX0 A;  5KNC A;  1O7Y A;  2XWB B;  2KA7 A;  5EGT A;  1AZQ A;  1OXS C;  4IUQ A;  1SND A;  1TWF B;  4V19 0;  1HPC A;  3C2P A;  4C3I G;  2PW7 A;  1Q1E A;  2L1B A;  4XQQ A;  5I6Y A;  5BN4 A;  2SOB A;  3FRP B;  3SK8 A;  3NBI A;  2RSN A;  3DWP A;  5FOB B;  1H9S B;  2EYF A;  2FIN B;  4A3M B;  1II3 A;  1V1P B;  5D65 A;  2ZXO A;  1FD7 D;  3EJI A;  1STG A;  2OXP A;  1ILQ A;  4KHZ A;  3K57 A;  2HCI A;  4R8N A;  3N52 A;  3EQL C;  2RDF A;  2Z4H A;  1RCV D;  1CT1 D;  1Y1V B;  1EIG A;  1LV9 A;  4K2L A;  1ROD A;  1SMY D;  2PZU A;  3TP8 A;  1EU4 A;  3HKZ B;  5M5W B;  5J39 A;  3VYS A;  3S15 B;  4RGM A;  3R2I A;  1A3V A;  2VUM B;  1HHV A;  2NTT A;  4HAE A;  1TVX A;  1IW7 C;  1DXM A;  1ZEQ X;  2K1B A;  1PMR A;  2NBF A;  1QWY A;  3GTQ B;  5AFW A;  3VA7 A;  5G3L D;  1F9P A;  2EYP A;  1H9J A;  3PUX A;  4HCS A;  4XYQ A;  4ZK9 B;  3AU7 A;  1QNU A;  5ELE A;  3S1M B;  2EYL A;  3R8B A;  5CBE E;  2QF7 A;  4F8M A;  2EE1 A;  4BWG B;  1ML0 D;  3D4D A;  5E3F A;  4X3S A;  1TQO A;  4LAA A;  4R8I A;  2JEA I;  1PLF A;  4TQU S;  2V4D A;  2A73 B;  3GD7 A;  3S1N B;  2KUM A;  3NTI A;  4RHR A;  2E2D C;  2IX3 A;  1AW7 A;  1R9T B;  2KED A;  5JPM C;  2X69 A;  1GUO A;  5C4J B;  2KCN A;  3KLS X;  5CV4 A;  4L63 B;  3GTG B;  1BR9 A;  1V1P A;  5I4D A;  3D3R A;  4C3H G;  5CMD A;  1SXT A;  3CRK C;  2EY2 A;  2F0T A;  2SDF A;  3E6Z X;  5HGT A;  1Q8I A;  5T1G A;  4Q0F A;  2A6H C;  3S17 B;  1DOK A;  2K5W A;  4CJ2 C;  2K05 A;  1SNQ A;  1ESR A;  1PDQ A;  3MA2 B;  2B2V A;  5IGE A;  5KEE A;  2A5H A;  2I07 B;  3L3O C;  2DY8 A;  1OXU A;  3D4W A;  1HA6 A;  1ESF A;  5C6A A;  2DNE A;  2PZW A;  3OPO A;  4I7Z C;  3LX0 A;  2K01 A;  4G57 A;  4RKL A;  1E2V A;  2L9H A;  2L11 A;  5J22 A;  5IOC A;  4DA2 A;  1TWG B;  2OT2 A;  3HS0 C;  2E2I B;  4LK1 C;  3H09 A;  5KND A;  1IKL A;  4TSS A;  2EZV A;  2D62 A;  4OGQ C;  3M7N A;  1CZG A;  4EGV A;  1F9S A;  3HP3 A;  2A6E D;  2QKI C;  2ZXP A;  1SYE A;  3BDC A;  3I90 A;  4ZAI A;  2Y0S B;  2E2H B;  1ZYR D;  2L12 A;  2B2Y C;  4ODG A;  4RCN A;  4ZYS A;  3NTK A;  5IT9 L;  2OEO A;  5ELC A;  4RA8 A;  1EYD A;  1D1I A;  1SYB A;  1ONL A;  3S14 B;  2EXZ A;  3C46 A;  1UEA B;  1EIH A;  2B8G A;  1I4R A;  2EVB A;  4IFD H;  2K32 A;  2RDH A;  1HXY D;  1EQV A;  2DNC A;  1BCP B;  2F3V A;  1F2Y A;  5JEA G;  3P20 A;  2A69 C;  1EY8 A;  1XWE A;  3JAM E;  1BUV T;  4G4K A;  1G6Z A;  1D5X C;  3M3Y B;  4K6D A;  1QE6 A;  5IGC A;  1F2L A;  4PMW A;  4LMQ D;  1Y69 U;  2F0J A;  3NUC A;  2Z4I A;  3I73 A;  2CW0 D;  1BCP D;  2TMP A;  3RZD B;  2KEE A;  1EQT A;  1I4G A;  1K8O A;  3NPP A;  4X3K A;  3HOZ B;  2PQE A;  1AZP A;  1FR3 A;  1HFG A;  2WII B;  3IL8 A;  1V1O A;  5C44 B;  1A6X A;  5M5X B;  3BVG A;  1BNZ A;  4FVM A;  2AQ3 B;  4HN7 A;  3AMU A;  4K2K A;  4Q5V A;  1SYC A;  1WTO A;  2F0P A;  1S4Z A;  1LTS D;  1SNO A;  5K5P A;  2F3W A;  3GQB A;  2A68 C;  3MC0 B;  1EY6 A;  4XT1 B;  1WD1 A;  4QF4 A;  2KOL A;  3MXG A;  4B9W A;  1MGS A;  1TY2 A;  2VB3 X;  3HOY B;  1JOQ A;  1QG7 A;  3TP7 A;  1HQR D;  1CM9 A;  1RD9 D;  1Q3L A;  3F2U A;  3OIP A;  1JB3 A;  3H3V C;  3GO5 A;  3HEJ A;  4A3G B;  4G7O C;  2XRS D;  1KLG D;  4WJW A;  1PFB A;  1MSG A;  1NCV A;  3WOF A;  3QOL A;  2KHS A;  4L8J A;  3G7L A;  3U9O A;  1PXU A;  5IT9 E;  2YU9 B;  2RBM A;  2G9H D;  5ELB A;  4KY5 A;  3U9S A;  1QB5 D;  4XTC S;  2NN6 I;  1FYC A;  3GTK B;  4IAL A;  4ME5 A;  5CC4 A;  4N9T A;  3IAY A;  2NUC A;  1B9M A;  3H6M A;  2D2C C;  4OHJ A;  4XQJ A;  4UDU C;  1V43 A;  3KLR A;  3K5O A;  4OIK A;  1I50 B;  1FNW A;  3NBH A;  4S3S A;  2AUK A;  2KCC A;  2JYO A;  3KF8 A;  2D9U A;  1ZXT A;  1VF5 C;  1EU3 A;  2PPB C;  1T5X D;  2EPB A;  2FMC A;  2MGS A;  1DOM A;  1D5Z C;  3HOW B;  4DAY A;  2G9D A;  1GHJ A;  3TZD A;  4J6H A;  5DM6 3;  5EPJ A;  4A3F B;  3V96 A;  1PRT C;  1QNK A;  1C4Q A;  4MHE A;  1EZ6 A;  1Y8N B;  3PO2 B;  1CFM A;  5M3M B;  4ZQ3 A;  3HOX B;  4IFD I;  3EA6 A;  2VNU D;  1HQM C;  3FDT A;  5EPK A;  2K28 A;  1Z47 A;  3LWE A;  3BDO A;  2CVR A;  1LTG D;  1KDC A;  3EVQ A;  1MBY A;  4KY6 A;  2PO4 A;  4C1N I;  4DXF A;  1FNU A;  5A2Q E;  3URY A;  4H13 C;  4HR7 B;  1KNE A;  1I6V C;  5BN3 A;  3HOV B;  3M7G A;  2EJF C;  4KI0 A;  1U4R A;  2SNM A;  3OW7 A;  3SK6 A;  5K36 G;  1SEB D;  3FKI B;  4CJ1 B;  1CZW A;  4MN3 A;  3R2T A;  4F87 A;  5I9O A;  3VA5 A;  3M85 A;  2B2V C;  1RTO A;  1LT4 D;  1E0B A;  3J80 E;  3MTS A;  3OMC A;  2BDO A;  3R3O A;  1F77 A;  3OOC A;  5EJW A;  4C1N K;  2HDL A;  2I46 A;  1WTR A;  2NYZ D;  1WTP A;  1BF4 A;  3FPP A;  5C5L A;  5BN5 A;  1QIL A;  5CV7 A;  2NVQ B;  2O5J C;  1SJE D;  3PIP 3;  5I6W A;  4E6I A;  2PZT A;  1T5E A;  2DN8 A;  3CU7 A;  3D6W A;  1GUS A;  1SE3 A;  1G2S A;  1JWM D;  3BZD B;  1AP0 A;  1BDO A;  3DWA A;  1CTM A;  1W6J A;  4K5W A;  5A35 A;  1STA A;  1NR4 A;  4KKS A;  1ILP A;  5KYL A;  1STN A;  3QB3 A;  3ERO A;  1BCP F;  4FF3 A;  4CJ0 B;  5JVG 3;  4RGO S;  2IJ0 A;  2B63 B;  5EKK A;  2EY5 A;  3GTP B;  3G6J B;  2EY6 A;  4RHS A;  3VYR A;  5M5Y B;  3Q0A A;  2BCO A;  4KMU C;  2QIL A;  3X3N A;  1K83 B;  1J8I A;  4U68 A;  1U4L A;  3T13 A;  4C3J B;  4Y7N B;  1VMC A;  3NQT A;  2ZXR A;  3H94 A;  1SYD A;  1SNM A;  3SEB A;  5C0X J;  4QCL A;  3I4M B;  3PO3 B;  4QUC A;  1SNP A;  4K8J A;  2Q8I B;  2BOS A;  2K33 A;  1EOT A;  2BE5 D;  3M4O B;  1EZ8 A;  3K6O A;  3SK4 A;  1LT3 D;  3DUZ A;  3LWU A;  5C4H A;  4EQO A;  4ID6 A;  2A74 C;  3PUW A;  5FO8 B;  3C3L A;  4MIU A;  4PMB A;  4TKO B;  2B2W A;  2C9O A;  1PTO F;  3TSS A;  3GTL B;  3GV3 A;  2K04 A;  2BDN A;  1I4X A;  3DXJ C;  4RWS C;  5J1Z A;  2PYK A;  1Q90 A;  2PCF B;  4A3B B;  1A15 A;  4C2M B;  3J7Y W;  5COR A;  4KKU A;  2WAC A;  1GHK A;  3QOJ A;  2KEC A;  5D3I B;  2MJ8 A;  5JOB A;  1DJR D;  1STY A;  2LMC B;  4OIJ A;  1O7Z A;  1VMP A;  1B4O A;  4K5X A;  1H9S A;  1S5D D;  1SE2 A;  2PNR C;  3PUZ A;  3OWE B;  5FKA C;  2AUJ D;  1MSH A;  3NWS A;  3T56 B;  2J7Z A;  1DCZ A;  4O42 A;  3I91 A;  2XSC A;  4OO1 H;  3NQI A;  1B9N A;  3D8G A;  2MPM A;  4K5V A;  2JA5 B;  1TS5 A;  1KDB A;  3CHB D;  2RSO A;  3NTH A;  4ZUI A;  1I4H A;  1Q1B A;  3VR4 A;  1JWS D;  1EFI D;  4IUR A;  1HTL D;  1M4V A;  5CV6 A;  1IYU A;  4BBS B;  2NN6 G;  5F2D A;  2XWJ B;  5D14 A;  1ZKO A;  1YNN C;  1U4M A;  2NN6 H;  4L6T B;  1TWC B;  3QO2 A;  2F0N A;  3Q6S A;  1WVL A;  3MWY W;  2CW0 C;  2JE6 I;  2JSO A;  4ILW A;  3MHB A;  1D6E C;  3GTO B;  2K5Q A;  3VYU A;  5C5M A;  1PZJ D;  1SSO A;  1MI2 A;  4F88 A;  1TY0 A;  2B2U A;  1SNC A;  2F0L A;  3A55 A;  4UAI A;  2JEB I;  3KK7 A;  3I8Z A;  3AB9 A;  1XTC D;  1I4Q A;  1STB A;  3CRL C;  4DAP A;  2EJM A;  2K03 A;  3SXH A;  3J81 L;  1G29 1;  3NSW A;  4JK1 C;  3E5S A;  1LLR D;  4ABN A;  4PQX A;  5CGK A;  1ICW A;  4IFD G;  1R4Q B;  5JJZ A;  4HED A;  1BXT A;  1DOL A;  1EY5 A;  1PFN A;  5C3X A;  1GUG A;  1QCB D;  1W6K A;  1PYW D;  2AQ1 B;  1OXX K;  2L0C A;  4K6L A;  5LL6 X;  3TME A;  1CQF A;  1IHZ A;  1Y1W B;  2F4I A;  1TS4 A;  3TDQ A;  1FGB D;  4K14 A;  1S5E D;  2L55 A;  2A6H D;  2ICE C;  3OWF A;  1JCK B;  1O78 A;  4H44 C;  1PRT F;  2MHV A;  1Z6H A;  5EQ0 A;  1JOR A;  2B2T A;  3VR5 A;  3L7Z C;  1SYG A;  3SK5 A;  1WTQ A;  3VYT A;  1H9K A;  4FXG C;  1LAB A;  5IOD A;  2JA8 B;  2KQ3 A;  5IGG A;  2BA0 A;  3TN2 A;  4N9P A;  2E2J B;  3I3C A;  3ZYY X;  5I9P A;  3VR3 A;  1A3U A;  3GV6 A;  1D1K A;  1TS3 A;  3HGB A;  1TWH B;  1PTO B;  3S1R B;  4KTA A;  2IL8 A;  3K0Y A;  1NAP A;  4IUN A;  1SBB B;  4PV1 C;  4CBV A;  1QOH A;  2O4X A;  3FMC A;  2JA6 B;  4FP5 D;  3EFX D;  4OO1 I;  1STH A;  2EYH A;  5TSS A;  1DZ1 A;  4JBW A;  3T51 B;  4IUP A;  4EQP A;  4G7Z C;  2D5D A;  3D6C A;  1PTO D;  5LHY 1;  5C3E B;  4G7H C;  1NUC A;  2F0D A;  2B39 A;  4QUF A;  2F0U A;  2ENB A;  4J8Q A;  4XIG S;  1YNJ C;  4ZKC B;  1RJT A;  4NP5 A;  4ZUJ A;  3OHX C;  3NXW A;  1RDP D;  1G8Z D;  3QIA A;  1KDA A;  3S1Q B;  2IPK D;  1A3T A;  4BA2 I;  1LTR D;  1R4P B;  1PTO H;  4RFB A;  2ID0 A;  5KYI A;  3X3M A;  3SE0 A;  4XDX A;  1AN8 A;  1JQY D;  4WFN 3;  3KLS A;  1PFM A;  4FXK C;  3J7A F;  2B2W C;  4KN4 C;  1F9R A;  1I4P A;  1CHQ D;  1G2T A;  5C4X B;  3MXP A;  3V05 A;  1WCM B;  5JEA J;  4FF4 A;  2E74 C;  2YYZ A;  4BS9 A;  4K8I A;  3I72 A;  1EY4 A;  4HTH A;  3BG3 A;  1EY9 A;  1KTK A;  2O2L D;  4V0B A;  4DXG A;  3K7A B;  4QIW B;  2F0V A;  2R61 A;  2NVY B;  4BA1 I;  1S5B D;  2FMM A;  4IUU A;  2JA7 B;  2EDG A;  1AFP A;  1LT5 D;  5EBC A;  1TU2 B;  2F0W A;  4RGT A;  4A3J B;  2RA4 A;  3BYT B;  5CV5 A;  4DF7 A;  3KUP A;  1ET6 A;  3BS1 A;  5C0X H;  1HCZ A;  1F2Z A;  2WIN B;  1SMY C;  3PV0 A;  3W2D A;  1L0Y B;  4P2C B;  2XVS A;  1D5M C;  3SDZ A;  2F03 A;  3MXU A;  4XT3 B;  1VF7 A;  4DGZ A;  4C3I B;  3Q24 A;  3MZ5 A;  2KVM A;  2WV6 D;  3GP7 A;  3RMH A;  1TII D;  3MAQ A;  2PW5 A;  1HUN A;  1I3Q B;  2N88 A;  4RH6 A;  3T16 A;  1S5F D;  4DNT B;  3ERQ A;  1CK1 A;  1A2U A;  3H91 A;  1RHP A;  3M4Y A;  4KJO A;  2N55 A;  1DON A;  2F0F A;  3MVV A;  1NSN S;  3OIQ A;  2VB2 X;  4IUV A;  2LY7 A;  5FO7 B;  4FYD A;  3V2T A;  3K59 A;  1BBX C;  4XQN A;  1HTP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...