1ENCA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-02-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1encA00
5E3FA 5E1FA 3SXHA 2F0JA 3OWFA 5IOCA 1IHZA 1A3UA 5C5LA 4F7XA 4ID6A 4IUNA 4ODGA 3T16A 2PZWA 1KABA 3H6MA 4K8IA 2EYMA 4N9TA 1EZ8A 3V2TA 4QMGA 4K2LA 3TP7A 1STYA 5EKKA 2PZTA 2F3VA 2F0UA 5JOBA 1EY8A 2ENBA 3E5SA 1EY7A 4KTAA 4B9XA 5I6WA 5KIXA 4HTHA 4K6DA 2F0WA 1SNDA 4EQNA 1SYCA 2PW5A 4MIUA 4LAAA 4RKLA 4KD3A 1EY9A 1STNA 4KY5A 2F0IA 1A2UA 1SNOA 2EY1A 2HQEA 1KDAA 2NUCA 2QDBA 4HMIA 2F0EA 2M00A 5C3XA 3SK5A 2RKSA 2SNSA 3EROA 5C4ZA 1F2YA 4KV6A 3EJIA 4NKLA 4DU9A 3MEHA 4KY7A 4R8NA 3NQTA 2EY2A 1A3TA 4IZ8A 5CR3A 5KEEA 2SOBA 4NP5A 2OXPA 2EY6A 2F0KA 2WACA 2EXZA 4KJNA 5IGCA 1TR5A 4QB4A 5CV5A 3BDCA 1EYDA 4K5XA 1A3VA 2EY5A 5IGFA 2KHSA 5K5PA 2PYKA 1EY5A 5IODA 3EVQA 1SYBA 1KDBA 2F3WA 3NK9A 3TP5A 5I9OA 5IGBA 3U9OA 4KD4A 1STGA 4E6IA 4KHVA 5IGDA 1KDCA 2F0HA 4PMBA 1STBA 5ISRA 1SNQA 3D4WA 1EY6A 3MHBA 4PMCA 5DEHA 4F8MA 5DAUA 1JORA 4ZQ3A 5IGEA 4NDXA 1RKNA 2F0QA 2EYPA 2F0NA 3QOJA 3QOLA 3MVVA 3SHLA 1ENAA 1NSNS 3MZ5A 2F0VA 2SNMA 3MXPA 5CV4A 4ZUIA 5HURA 4EQOA 3QB3A 4K5VA 3TMEA 1EZ6A 1SYGA 5C4HA 4KY6A 3TP6A 2PZUA 4S3SA 4QF4A 4DFAA 5JAVA 3S9WA 5KYLA 5EGTA 2EYOA 2F0GA 5J22A 5HGTA 3HZXA 3P1HA 5CV8A 3SR1A 4RKBA 5C5MA 5IIFA 4J6HA 5CV6A 4HMJA 1AEXA 5M9OA 4TRDA 1EQVA 2RDFA 2F0FA 3D8GA 4ME5A 1EY0A 3OMCA 4DF7A 4YIJA 1JOQA 1F2MA 1NUCA 1SNCA 4J1MA 3DMUA 1II3A 1TQOA 3TP8A 5CC4A 5CGKA 2EYFA 3D6CA 5J1ZA 1STHA 3LX0A 1F2ZA 3OMGA 3ERQA 3C1EA 4NMZA 3SK8A 1SYFA 4N9PA 4B9WA 1TT2A 1JOKA 1STAA 3D4DA 4K2KA 5KGUA 4WORA 2OEOA 4K8JA 5KRUA 3HEJA 3P75A 2F0TA 3DHQA 2RBMA 4WRDA 3SK4A 4G57A 3T13A 2F0OA 2O4XA 5CV9A 4KJOA 5C3WA 5CV7A 5C6AA 2F0PA 2LKVA 2EYJA 5KYIA 1SNMA 3NP8A 1EYAA 3ITPA 4OL7A 4PNYA 3BDLA 3R3OA 3RUZA 5I6YA 2OF1A 3C1FA 5F2DA 1ENCA 3NUCA 4EVOA 5I9PA 4ZUJA 2KQ3A 1JOOA 4EQPA 3VA5A 4K14A 2EYLA 4IALA 5EKLA 2F0SA 2F0LA 5IGGA 4I65A 1KAAA 1SYDA 4K5WA 5NUCA 2F0MA 5J39A 2PQEA 1A2TA 3PMFA 2PW7A 1EYCA 1SNPA 3NHHA 3SK6A 4DGZA 1U9RA 2F0DA 1EY4A 4H7BA 1SYEA 3NXWA 2EYHA 3OSOA
chains in the Genus database with same CATH superfamily
4C3JH 2TSSA 1ZXTA 5E1FA 3ER0A 4DNTB 3RZOB 3H0GG 4K8IA 2R6GA 2XSCA 1PH5A 3V2TA 3E0JA 2E2HB 1K0SA 1VQ9A 4L5QA 4DA2A 1AW7A 4FXDA 3GTPB 4HTHA 4RCOA 2R93B 4GKJL 4DAYA 5IP9H 3D0FA 4MIUA 2DJGC 2H4OA 2YYZA 4XDXA 3OOCA 1X6OA 2I5LX 1F2YA 2YU9B 4PQXA 2BOSA 1A3TA 4DNRB 5JEAG 4DV1Q 2B8GA 3DWQA 4N8FA 4BA2I 5M5XB 2WACA 1EIGA 1N8RC 2FMCA 1EYDA 1ZEQX 2NZHA 3FPUB 1FD7D 4JI4L 3NK9A 1HQRD 2A73B 3KK7A 5T1GA 3CCUA 3S15H 3E9IA 4DV5Q 1VQHA 1SAPA 4P72A 4R1JA 3OHXC 2FINB 3BZDB 4PMCA 4C3HB 3T53B 1F9SA 3VR6A 4LF6L 5IGEA 4PMWA 3NWSA 2IY5B 1EEID 3QOLA 1YNJD 5A2QE 1PTOF 3K0XA 3MZ5A 3G71A 1H95A 2WAQG 5IP7G 4IO9A 2JA5B 2A69C 1D1IA 1B70B 1RHPA 4X62Q 1EU3A 4FNFA 3EBEA 1EOVA 3MC0B 4GNXB 5C4HA 2Z4HA 3BZCA 1QVCA 3P1HA 4H02A 1Q1EA 1YNJC 1M1KC 1GKHA 3PO2B 1XPUA 2ZXPA 1BXTA 1D8LA 4DV3Q 1TQOA 4DUYL 1YJWA 3LX0A 3A8KE 4F88A 3M4OH 3S17B 2R92B 3F2BA 4DUZL 5E4WC 3ND8A 4QL5A 2K5NA 1A15A 1AZPA 3T1HL 3R2IA 3W2DA 1LLRD 2AQ3B 5F2DA 1G6ZA 2E2JB 2QEXA 1CI3M 2OCEA 4KKTA 2VUMH 3M3YB 3NHHA 1HR0Q 1U9RA 3G4SA 1TS2A 3AU7A 2Q2TA 3D6WA 1JE4A 1CA6A 4CDDC 2P5ZX 4ID6A 4UAIA 3OYYA 3UDGA 4WJ4A 1Y1WG 3I55A 1SJED 3F1ZA 4IPCA 1S5DD 2UXDQ 5FLMG 3FDTA 1DZ1A 1LT4D 4QMGA 2PZTA 2CQOA 2F3VA 5HY6A 5I4DA 4KTAA 2KCCA 2B63G 1TS4A 1N32Q 2OT2A 4DR4Q 4LAAA 3AYHB 3JC66 2VNUD 1U4RA 2F3IA 1I4XA 2NUCA 1L0WA 1E3PA 4DV2L 3M85A 1M4VA 1K9MC 1RCVD 3CRLC 3OPOA 5C3EH 3CPWA 3I73A 2SOBA 4LW1A 2MGSA 2C9OA 3I4NG 2EPBA 5EKIA 4G4KA 1CKNA 1EY5A 1GJXA 3J7ZC 1MJCA 4PZ7A 4LWCA 4LF7Q 2CKZB 4AQYQ 2B2TA 1FJGL 2NZOA 4KD4A 4E6IA 2I5HA 3RN5A 1X9NA 1IBML 2XWJB 2Z0SA 2E74C 3I4MB 3S16B 3OTOL 2K75A 1UNSA 1K8GA 4NXML 1R9TH 3PO3G 2JP1A 4DUZQ 2UXCL 4L8JA 3BDOA 3NENA 3FEWX 5CV6A 3DLLA 4DV0Q 4HJ9A 3GTLH 1EQVA 4WJWA 4C3IH 2F0FA 2JE6I 3DMUA 3M9BA 4A3EG 5CC4A 1HJPA 1ASYA 5C3EG 1N33Q 2BE5D 2OTLA 2XRQD 4XQNA 1STAA 1B7YB 1TT2A 3CAMA 3HKZE 1E0BA 5C4XG 5AFWA 3OW2A 4LF4L 3AFPA 3IAYA 3STBD 1OXVA 2LKVA 4FF2A 3CPFA 4OL7A 5LL6S 3TZDA 2VZAA 1PV4A 3UDXA 4A3JB 2OQKA 4JI5L 3SGIA 4K14A 4KK7A 3HP3A 1O80A 2PCFB 1QOHA 3FKIG 5EPLA 3Q24A 3STBC 5J39A 1JT8A 1I3QH 4B08A 3S24A 2YTXA 2PO4A 1SYEA 2Z1CA 5LMUQ 4DV2Q 3GTKH 1ILQA 3PIP3 5E3FA 1O7ZA 4F7XA 1VF5C 2EJFC 2K33A 4GOPB 3T16A 1IYJB 4A3KB 1IBLL 3S15B 3D31A 1Y69U 3O13A 2HD3A 1N36Q 4XT3B 3CHBD 1GM5A 3E5SA 1S5BD 5GAGC 3ZYYX 4JI7Q 1FJGQ 1SNDA 1AN8A 1IBMQ 1EY9A 1STNA 1A2UA 5D3IB 4JYAL 1A8VA 1B3QA 2GA4B 1WTQA 4NKLA 4DR2Q 3MEHA 3MXNB 4IZ8A 1BBUA 3S2DH 2B8FA 5IYBG 1AE2A 3DEOA 4X3UA 1JJGA 1G291 1HQMC 1Y8OB 1TR5A 4R4IA 1PLFA 4NXMQ 4POGA 3PQIA 5K5PA 2XRSD 2O5JC 3U4VA 2E2IB 2E5LL 3GTOH 4UPAA 1TY0A 1B53A 5EBDA 2WFWA 1LTTD 2LMCB 3D3RA 2XGTA 3H91A 5DAUA 1R4PB 1ILPA 4DR7Q 1HA5A 3ERSX 2M9VA 1VQMA 2NVYH 1L0YB 5FOBB 3MXPA 3BYTB 5BN4A 4HIMA 2HIVA 4K5VA 2ATWA 3HOUH 2A68D 4LF4Q 2PZUA 1PMRA 4PG3A 4LJZC 1KC8C 3L7ZC 3BZKA 1ICFB 4K0KL 3HOYG 4NPSA 2A68C 1VQDA 2MO1A 4DR6L 4C2MB 4NXNL 2KJXA 5C0XH 2DUDA 1FYCA 1HNWL 3A5UA 4K8JA 1T5EA 5EJWA 1EOTA 4IJHA 1V1OA 2EQSA 4CDFC 1VQ8A 1XWEA 1V9PA 1WTPA 4DPGA 4ZUJA 1HTPA 1XNQQ 5M3MB 5IT9c 1BCPC 5E7NA 1K73C 1HA6A 1V1PA 2NB0A 3KF6A 1G2TA 2AQ1B 4KMUC 5FLXc 2J4XA 2NWGA 2SEBD 4S3SA 4HCEA 1VQPA 3NBIA 2UXBQ 2HQLA 4BWGB 3H15A 1ESFA 2NVTB 5CORA 5FLXL 4HR7B 1TXYA 3HOXG 1KXLA 1EY8A 3BVGA 2UUBQ 5M5YB 2ZTCA 4DK1A 1PHJA 1Q46A 1UWVA 4HMIA 1CTMA 2D62A 3PIO3 4A3GG 1IKMA 2B2VA 2EY2A 4A3DG 2L1BA 5ELEA 2DNCA 2O2LD 3M4YA 4GLAC 1V1QA 1HNXL 1L1OA 5IYCH 1VQ7A 2PYKA 4OONA 4HAEA 5C44H 3E3XA 3BVMA 5AJ3L 1OXSC 4OIJA 2F0HA 3P20A 4CJ2C 1AZQA 3W1GA 3SEBA 1VCIA 4G7ZC 2WB1E 4AYBG 3AEVA 1FVIA 1RKNA 4XQJA 4XTCS 5M3FB 1E1OA 4HJ5A 3NELA 4BY1H 2IJ0A 5D3DA 1SSOA 4AH6A 2E76C 3GTMH 2D5DA 2K5QA 2AQ2B 1WCMB 2K5DA 4JI3Q 4QF4A 2MPMA 1D5XC 1C7YA 2JA7H 3HG9A 4JI6L 1AEXA 3RZOH 1A62A 2A8VA 2E2HH 5K36H 3I56A 3HOWB 3FRPB 4P74A 3OMGA 3GTPH 4LF8Q 3J81j 2R93H 1KNAA 3D4DA 4X64L 4WORA 5JPNC 3F2DA 2IHEA 3PUWA 4DAPA 3K7UC 2KOLA 2I07B 3W1BA 2YTVA 1IW7D 1PRTF 1ZKOA 2D0PA 3S1RB 4UHVA 3M7GA 3KDFA 4OIKA 4PNYA 2L12A 1B4OA 5M5XH 3S14B 3GTQB 1CSPA 1E24A 2EJGC 1WD0A 3VA5A 1IYVA 3SDZA 1IW7C 2L11A 3LWEA 2IL8A 5ELDA 3H3VC 4TVAB 2QA4A 4HIKA 4CJ0B 4C3HH 1GUGA 5DM63 3JAMi 3OWFA 1YJ9A 5G3LD 1WTHA 1S5CD 3I70A 3C46A 1LV9A 2JXMB 3FPPA 3J81i 4LF9L 2JA5H 5GAHC 1YBYA 3CD6A 3PGZA 4OO1I 3NTIA 1OXUA 2IHFA 4K6DA 1Q8KA 4JOIC 1SYCA 4RG1A 4GN4B 4X3KA 3UDIA 2R93G 1HFNA 1SNOA 2RKSA 2NN6I 3CC2A 3PO2H 4KV6A 1B9NA 2EY6A 1IBKQ 4QB4A 4OGQC 3S17H 2R92H 1U0LA 4EGVA 4RAUC 4JBJA 1VQNA 1D5MC 3TBIB 5I9OA 2A6ED 4BY7G 4LF5L 3MEFA 1PH1A 4G7OC 1EFID 3Q23A 1LUZA 1VQIA 2E2JH 1Q12A 2FFKB 4NDXA 4Z9CB 1QJOA 3D4RA 1C8CA 4XIGS 3KUPA 3HOVG 3M3YH 2KEEA 2X69A 1U5KA 1U4PA 5HURA 1GUWA 2B2YC 1EZ6A 5J22A 5EQ0A 5IIFA 2VY3A 5M9OA 3I3CA 3RN2A 1K0RA 4IUPA 1NUCA 2IT1A 3EA6A 1H9SB 3TP8A 3L2PA 3M4PA 1L0XB 3RMHA 4HCSA 2HCIA 3M4QA 3Q0AA 3RLNA 3MXGA 4DV7Q 4RCNA 5KYIA 2N49A 1BQQT 2DGYA 3X3NA 3NUCA 3TQYA 4BA1I 4AIMA 1EFWA 3MAQA 3K80C 4DV5L 4RMFA 1HUMA 3PMFA 2WINB 3A0JA 3CCQA 1NCVA 1EY4A 1QVFA 5GAEC 3T56B 1DM0B 2FMMA 3FHWA 3I91A 2X6LA 1IHZA 5C5LA 4X62L 2OQ0A 3OW7A 4DV4L 3I2ZA 4ZKCB 3I4MH 3S16H 1R4QB 4EX5A 1NJIC 2PNRC 2R7ZH 4V0BA 3WOEA 4I7ZC 2PPBC 1IZ6A 4O0AA 2F0WA 3U9SA 2PW5A 4LF5Q 4DV3L 4A3IG 2K32A 1KDAA 4O2DA 2DJFC 3WOFA 3EROA 3DXJC 4R4CA 2NYZD 2HIXA 5C4JB 1LO5D 2JA7B 1JC7A 4RA8A 1BDOA 2D9UA 5IODA 2R61A 4GKKL 1A0IA 4RGOS 2BA1A 2Y0SG 1QVGA 1Q1BA 4A3CG 4FF4A 1EEFD 4JV5Q 5ISRA 3HKSA 3MHBA 4RH6A 4IUUA 1HR0L 1IKLA 4A3JH 1E2VA 4ZQ3A 2K5HA 1YJNA 1EWIA 1JQYD 5TSSA 3HOZB 1ET9A 2HCCA 1ENAA 4MN3A 1J6QA 1YEZA 3S1MB 2ZJRA 2UXDL 4KY6A 4A3BB 3S9WA 2A19A 2EXDA 1YNXA 2XVSA 4JG2A 1GHKA 3SR1A 3VR3A 5C5MA 2PQAA 1CKOA 1N32L 4A3KH 4DR4L 2K05A 1UE6A 2C35B 3OWEB 3VYTA 4OX9L 2A69D 4Q0FA 1DONA 4C3JG 2XTIA 1IL8A 4H0LC 1N9WA 4L63B 3E9HA 1I94Q 4R4TA 4LFAQ 1UE5A 3SK4A 1JE5A 1SE4A 1KD1C 2ID0A 4OWXB 1HR0W 1GO3E 5JVG3 2CCZA 1Y8NB 4DV4Q 4LF7L 3H3VH 4AQYL 2KQ3A 1GUNA 1JOOA 1O78A 4FO2A 5IP9G 4KKUA 4O1NA 5EKLA 1K28A 4K5WA 1NAPA 2PW7A 1SNPA 4A3FB 2E2IH 4LNQA 1GXDC 2PI2E 1F9QA 3H3VI 1EL0A 3KJPA 1TS5A 1GUOA 1H9MA 3PUYA 2AUKA 2PZWA 5H1SE 3I4LA 2UUCL 4GKKQ 4DV0L 4OHJA 4F87A 4A3LH 2B2TC 1M90C 1N33L 3A74A 4JVZA 4LFCQ 1BR9A 2E8GA 2M00A 2SNSA 5C4ZA 1NTGA 3HKZG 2ES2A 1PFMA 2OXPA 1HRJA 4Y7NH 1CZWA 4KJNA 4C2MH 5M5WH 2ZJPA 1JWMD 1XTCD 1PH8A 1PTOC 5GADC 1CQVA 2RSNA 4JI0Q 4JC0A 4KHVA 1EU4A 2G9DA 2VB3X 1X3EA 4OX9Q 4DK0A 3ICEA 5M3MH 1WTOA 1W3SA 5LMUL 2EYPA 3QO2A 4DAMA 1BCPB 2F0NA 3J80c 2EZVA 4IFDJ 1NSNS 3IFTA 3K6OA 3CXCA 3BVZA 3UE1A 2BA0A 2E75C 4HEDA 3TZUA 3TMEA 1SYGA 3TP6A 5JAVA 3C3LA 2HHHQ 5ELNA 1O7IA 2R7FA 1N36L 2IWHA 5HGTA 3RZDB 1LTAD 3K5OA 5L37A 4IURA 4TRDA 2NVTH 4J8QA 3ULJA 2JYOA 1BF4A 2JEBI 4ME5A 4JI7L 2VUMG 1EY0A 3EN2A 2LY7A 1YNND 1SNCA 3J7AF 4CBVA 1I4RA 4DR2L 1B1ZA 5M5YH 1JOKA 1Y8PB 1EYGA 1LACA 2ZM6L 4L5SA 1I4GA 2WAQE 3H0GB 3RD4A 1YNNC 3CMAA 1Z6HA 2R7ZB 1K8OA 1B9MA 3NP8A 1LYLA 1LTSD 2JK8A 2MNAA 3VDYA 1B50A 3KOJA 4B3TQ 4EQPA 2UUCQ 1B3AA 4BBSH 3WWVA 3ZJYC 1SN8A 3IFDA 1TWCH 3K59A 2RSOA 4DR7L 1F9PA 4H7BA 2FXQA 2ASBA 3GDEA 3IKJA 1IXRA 1GUTA 2B2UA 5M3FH 1N34Q 2VXWA 4FVMA 4NB3A 4OEMB 1WCMH 4B9XA 2RDHA 3JAMc 1SLJA 1I6HB 4RGMA 4QJFA 4DV6L 1Q86C 2F0EA 2WAQB 1BOSA 3J81c 5EAYA 1VQLA 4X66Q 2HUGA 2ALYB 2F0KA 5LHY1 2JA6H 5BR8L 3HOWH 3JAML 1EIHA 3NBHB 4GLXA 4JCVE 4UP7A 4LUVA 2RCNA 3GTGH 3J81L 3PF5A 4C3IG 1XNQL 3S1RH 4C1NI 1VF7A 1STBA 2NVQH 4HJ7A 4F8MA 2JN4A 3S14H 3GTQH 3PUZA 1PXUA 2KECA 1KIXA 4JK1C 3Q22A 2UXBL 1RDPD 3GD7A 2ZM6Q 5LMNL 2ZJQA 4EQOA 3QB3A 1CK1A 5GQOA 3AFQA 2K5VA 3BG3A 4A93B 1C9OA 2I0QA 4J15A 5CV8A 4HN7A 4RKBA 1VDZA 4J6HA 1X32A 4HMJA 1XMOQ 3PSIA 2UUBL 4DK6C 4QQBX 3OMCA 4YCWA 1Q90A 4X3TA 4ZK9B 2JQOA 1F2MA 3NE5B 3N52A 2HDLA 1Q8IA 5FO8B 3HOWG 3KYHC 2KVMA 1MSGA 3HGBA 1QUQB 1Y1WB 1IYUA 2K4KA 2GVAA 1W6KA 4HIOA 1VQ4A 1BCPF 1QNUA 3A5ZB 4PV1C 2N3SA 5I6YA 3UE0A 1XXGA 2LSSA 1JMCA 2B39A 2OWOA 5IT9E 2B63B 1A6XA 2ZTEA 2A74C 4FYDA 3UI2A 4IUQA 2WB1G 2R7DA 2Z4IA 4JW0A 5FLXE 3BS1A 5CYUA 4Y7NB 5M5WB 1H9KA 4DV6Q 1E22A 5HGQA 2HQEA 1JICA 3OSOA 3I4NB 3RNUA 5ELFA 4BXXH 2JJQA 1PFBA 1BCPD 2CH4W 3MFGA 4JI3L 2WV6D 1NMGA 5BR8Q 3S1QB 1CHPD 3RLFA 3G7LA 1TWFB 4ZLTF 1A63A 3K0YA 1IL2A 3ND9A 3QWNA 5IE8A 4GNXA 4KY5A 2F0IA 1VQGA 1S3OA 3E6ZX 4I7AA 4LF8L 1NR2A 3AQQA 1KLUD 5CR3A 5IT9L 3PO3B 1PH7A 2QILA 4JBKA 1OXXK 2H1EA 3MA2B 3HOUG 5LMNQ 3BDCA 1X3GA 2F4VQ 4IUVA 5IYDH 3PV0A 4A3EB 2I5MX 1OTCA 1J8IA 5C0XG 3A54A 3A8IE 5C4XB 3I72A 5JEAJ 1D7QA 4XXEA 2F0VA 2RF4A 4ZUIA 4MHEA 3T51B 2RCFA 4L5TA 4IFDH 4O42A 3Q8DA 2AMCB 4DFAA 1K8MA 4BBSB 3PIPA 1Q7YC 3J80i 2MHVA 3FKIB 4KLKA 1TWCB 3TS0A 2K50A 1H9JA 4DR1Q 4C56C 4IFDI 2Q8IB 4UP9A 5JJLA 3SK8A 4QUFA 4MTKA 4N9PA 1G8ZD 1MI2A 4UDUC 2PI2A 1IBKL 2CW0C 2F0TA 3NTHA 3KFUA 1SFOB 2BH8A 4B3RQ 4CDCC 2F0OA 2O4XA 4DR3L 4KN7C 4QIWB 2F0PA 4OWTB 2MP1A 2X6GA 2Q8TA 5JJZA 4RGTA 5C4JH 1SMYC 1Q3LA 1QZGA 3UDFA 4M1UB 2O5IC 4GN5A 4DGZA 1EQRA 2JA6B 3W3AA 1CUKA 1MHWC 2Q8RE 3EQLC 2EOTA 1E7ZA 2LXJA 4C1NK 1JB3A 4IUNA 3RLOA 5IYCG 1I6VC 3HOZH 5G3LF 3CC4A 5C44G 1PDQA 2NVQB 2L9HA 4APVA 4A3MH 3KJOA 3S1MH 4ZKBB 2ENBA 1EY7A 3E0EA 4A3BH 2LXKA 1Y1VH 1I50H 3CQZH 1FR3A 2Q2HA 1Q81C 2Z6KC 2L5TA 1NY4A 2Z9HA 3CCSA 3EFXD 4BY1G 3HS0C 1SE8A 1HTLD 2JA8B 4R8NA 3NQTA 4DV7L 4OO1H 4NP5A 3HFZB 2EXZA 1V8QA 3K5LA 2G9HD 1A3VA 1LT6D 2A5HA 2JA7G 2KHSA 2RHQB 2NN6H 1HH2P 2QCPX 3HOYB 4BBRH 5K36G 5IGDA 3VR2A 3K8AA 1EY6A 5DEHA 1QG7A 5FJ8H 1PZKD 2AUJD 1QZHA 1Q82C 3FMCA 4L6TB 3MTSA 4LK1C 1O7YA 4A3FH 4JBMA 2XIWA 3F8TA 1GD7A 4GLVB 4IPHA 2EVBA 4YCVA 1TIID 2K03A 2VQFL 4DR3Q 2C5CA 4POFA 2GVBA 2EDGA 1JCKB 1ML0D 2EYOA 2F0GA 1I4PA 2L0CA 3L0OA 5KNDA 1UUPA 1SR3A 4GOPA 3T1YQ 3D6CA 3IL8A 2QEJC 1CKNB 3S1NB 1CZGA 3OIPA 4C3HG 1PYSB 3VYRA 4K2KA 2BH2A 1LM0A 3TSSA 1YHAA 3L3OC 2KCNA 1XX8A 2NN6G 3PIOA 2EE1A 1DCZA 3HOXB 2JA5G 1SNMA 1EYAA 3KLWA 4DR5Q 1DGSA 3F2CA 1Y14B 3MXNA 4XQQA 4KKSA 2KUMA 4NW2A 4IOAA 2CWAA 4JV5L 4I65A 1PTOB 5NUCA 2PQEA 4A3GB 1CT1D 3PO2G 2OTJA 3SK6A 2XNAC 4A3DB 1CHQD 3VR4A 2V4DA 5CV5A 4B3MQ 4MNOA 1UE1A 2R92G 5IOCA 3A7AB 1STEA 2B2WA 4ODGA 3H6MA 1CQFA 1KABA 4U673 5JPMC 4CDEC 4K2LA 4JOIA 1QUQA 1U4LA 3TP7A 3MFYA 3CMEA 1PYBA 4HSPA 4AYBB 4EQNA 2Q2UA 2IPKD 3DWPA 3RZDH 1T5XD 1WOCA 1HNZL 5C3XA 3SK5A 2WIIB 2ZXOA 1E1TA 3I8ZA 3KLSX 1I94L 4LFAL 3H94A 5IY0A 5IGCA 2NZ1D 1K83H 3DUZA 4LFBQ 1LTLA 5DM73 1NMFA 2VQFQ 4DAVA 3GV6A 3J7AV 3H0GH 1ASZA 1KDBA 3GO5A 4DXFA 2RHSB 4DK3C 4OXPA 1S4ZA 2CFMA 1KDCA 1O7LA 1B8AA 3K57A 2F0QA 3S2HB 3OIQA 2DNEA 1LTID 4ABNA 4RHRA 4CJ1B 1XJVA 4OWWB 5JEAH 1PA6A 1VS0A 4P73A 1FNVA 1VQFA 3DWAA 1TVXA 3W5OA 1X3PA 3TREA 3KF8B 2RDFA 3D8GA 4B3SQ 2PMZE 5JJIA 5BN5A 1QWYA 2Z8LA 4LFCL 4X65Q 5D14A 1F2ZA 1YIJA 2V1CC 1QCBD 3A55A 1I6HH 1PVOA 3LNNA 4CHTB 3I4MG 1JJCB 4FP5D 4A3MB 5C3WA 1XNRQ 5CV9A 5IP7H 3R8BA 3WDNA 4QY7A 2R7ZG 2OF1A 4M8AA 1Y1VB 1VQCA 4JI2Q 1I50B 4EVOA 3CQZB 4JI0L 1S40A 3G6EA 1H9RA 1KTKA 1A2TA 1HNZQ 5A35A 2L4NA 2MUYA 2RQXA 2AWOA 1TY2A 4QUCA 3CCEA 2A1AA 1QB5D 4KHZA 4TQUS 1F9RA 3I4OA 2KHIA 1KNEA 4HSVA 3VYUA 1EIYB 3IRBA 4BBRB 2HHHL 4OELB 2K1BA 4BY7B 2PMZB 1DOLA 3DM1A 1I4HA 3G48A 4A3JG 4A93H 1TWAB 1GOZA 4KD3A 2K52A 2QDBA 1VQAA 4A76A 3HOVB 3L9AX 3EJIA 2G5DA 4YHHQ 1V1PB 1ET6A 1X3QA 1NNXA 3KF6B 1KAWA 2DY7A 1UEAB 4IUTA 1Y1WH 3B6YA 1SYBA 4A3KG 1F2LA 4B3TL 2F3WA 3TP5A 5FLMH 1RODA 5IGBA 1EWHA 2K04A 3LGJA 4DKAC 2ICEC 1XMQQ 3ULLA 3V96A 5C0XJ 4KHPL 3D4WA 1YHQA 3LWUA 3SE0A 2B63H 1JORA 1M8AA 1TWGH 4UP8A 1LTRD 3NTKA 3J80E 4UY8C 4JI1Q 1PTOD 5FK9C 3TRZA 3MVVA 3SHLA 3VYSA 1I4QA 4MTNA 1CSQA 3PF4A 2R3ZA 5CBAE 1N34L 3I4NH 1C48A 2MO0A 1HPCA 3HZXA 4A93G 3KLSA 1HXYD 3HRZC 3S1QH 3TDQA 2Y0SE 5A2QL 4IJLA 3U58A 1TWFH 4GKJQ 2IX0A 4IOCA 4J1MA 1MJEA 1L1OB 1JR0D 1U4MA 4ALPA 2CQAA 1RL2A 4X66L 4H13C 3GQBA 1W6JA 3BU2A 3DHQA 2BCOA 5EPJA 4KJOA 1WTXA 2MJ8A 1MD2D 3ITPA 3R3OA 2B2UC 3PO3H 4Y52H 4RGNA 3J80L 4JI4Q 1G91A 4A3LG 1EQTA 4A3IB 1JJ2A 2F0SA 4JBWA 2F0LA 1ESRA 2KCMA 1HHVA 1KRSA 3K81C 4LF6Q 2AHOB 1C0AA 2F0DA 1VQ5A 1K83B 4A3EH 1VQKA 1BBWA 1BO0A 5DLQE 1KRTA 1HZBA 3X3MA 3CCVA 4CKCA 3SXHA 4YWMA 5LL6X 3GV3A 1HCZA 4GS3A 1X65A 1TWHB 4R4QA 5C4XH 2B3GA 1QILA 3K7AH 4CKEA 3GTJB 1HZ9A 1WJJA 2Y0SB 1HUNA 1CA5A 1NBWA 1VMPA 5CMDA 3MXUA 1MIUA 4YWLA 5JOBA 1XMOL 1DOMA 5KIXA 3JAME 2DY8A 1PZID 5M3MG 1J9OA 2MQHA 1YZ6A 4KHPQ 2FJ2A 3FKIH 1E2ZA 3KDFB 3J81E 2D0OA 4DUYQ 1VQ6A 4DU9A 2NVXB 4KI0A 1RF2D 4MZ9A 2PNHA 1T9HA 1H9SA 3ULPA 4G7HC 4P75A 3T1HQ 1SFOH 1AP0A 1SJHD 3U9OA 1KL9A 4CGYB 4LMQD 2QGQA 4PMBA 1KQSA 2GN5A 1WI5A 4C3JB 1SNQA 1BNZA 2HDMA 2VW9A 5J3BA 2D2CC 1LTGD 1DD2A 2VS1A 2HT1A 1DYQA 5IYBH 1XPOA 2BE5C 4R4OA 2UUAL 5I2XA 3KLRA 2RDGA 5KYLA 4BBSG 4RFBA 3BYYB 1OO9B 1JWSD 4P71A 1GVPA 2IX1A 3CCMA 1AFPA 5ELOA 4ME3A 4ZYSA 3F2UA 4NMZA 3ERQA 2KCTA 2Z6BA 1SBBB 1WTRA 2K14A 3P7JA 3A56A 5DNFA 5M3FG 4LUZA 3NWTA 1EUJA 2XWBB 3NEMA 2MFIA 2JA8H 1Z9FA 2EIFA 4XYOA 2L15A 2F4VL 3RUZA 1WCMG 3TEHB 3AB9A 4YY3L 4EQ5A 1G2SA 2EYLA 2J0TD 2N8NA 3K5NA 3HKZB 4HJ8A 3HOYH 3PUVA 4GNXC 2QF7A 3KF8A 1SEBD 1TU2B 2VB2X 2JA6G 3OTOQ 2F0JA 1A3UA 1YVCA 4ZAIA 2K7VA 1CM9A 3RR5A 1EZ8A 2UXCQ 2K5WA 1J5EL 2NTSA 2LFNA 4N8X1 1TWGB 5I6WA 3QR8A 3M4OB 1NR4A 5D65A 1UE7A 2DN8A 2CHBD 4DR1L 4R9WA 5LMNW 5COYA 1BVSA 2EJMA 1CFMA 1PRTB 3CKIB 2M2LA 1EIFA 1PH2A 1AH9A 1SRUA 4RHSA 2ZT9C 1GHJA 3H09A 3NSWA 2JA8G 4B3RL 2H5XA 3S1NH 2B2VC 4WFN3 4K5XA 2UUAQ 4JPBW 2VUMB 3EVQA 1AE3A 1RIPA 1L1OC 1SDFA 1SMXA 4JI5Q 3HOXH 1FNUA 4TSSA 4FXKC 3FP9A 2BDOA 4FXGC 4FF1A 1PFNA 2F03A 3QIAA 1NE3A 3KBGA 1PTOH 4A3GH 2WKCA 1PZJD 3Q6SA 5CV4A 2K28A 4R8IA 2JA9A 3CRKC 4A3DH 3DEPA 5EPKA 1WD1A 5CBEE 1IBLQ 1K3BC 5C0XI 2Q2IA 3A8JE 3CU7A 1D2BA 4QIWE 5GROA 4U68A 2WKDA 1VQEA 4YY3Q 3VR5A 1L2FA 2IX3A 4GZYC 5C3EB 1JOQA 4ZRZA 1II3A 4JYAQ 5J1ZA 1XYIA 4BXXG 1SYFA 2JEAI 3K7AB 4RWSC 5KRUA 1F77A 3HEJA 2N78A 3PCOB 2A6HD 2RBMA 4FF3A 3VA7A 2K01A 2UU9L 4HJAA 4DAYB 5C6AA 1X54A 5KNCA 2EYJA 4L5RC 5T1IA 3M7NA 1C4QA 1DJRD 5E4XA 1JB7A 1J5EQ 1WTVA 2QKIC 4PZ6A 2E5LQ 2A6HC 3A7LA 3AMUA 3CC7A 1RTOA 2CW0D 1KAAA 3BJUA 4JI8L 1R9TB 4FDBA 2PQAB 4LUOA 1SMYD 5IWAL 4X6AH 3CF5A 3S2HH 4A75A 1XPRA 3GTLB 1I5FA 3GP7A 4QCLA 4C3IB 2EYMA 5IYDG 4N9TA 2RA4A 3J7YW 3CP0A 2F0UA 1FGUA 1WFQA 1X55A 3C2PA 4K0KQ 2E2DC 5FKAC 3T1YL 1W2BA 4DR6Q 4DN4M 4NXNQ 3R93A 4KY7A 2VL6A 1HNWQ 5KEEA 4V190 4IFDG 2KENA 1VMCA 1S5FD 4KN4C 4QGUA 5IGFA 1B2TA 4DR5L 1WYDA 1I3QB 5FO7B 1UEBA 5JVH3 3URYA 1ONLA 1SE2A 1SROA 3GTKB 3N6RA 1GUSA 1V43A 4GOPC 1VQOA 3QOJA 2B29A 4B3ML 2VQEL 1EQQA 4DNIA 3NPPA 4DXGA 1VQJA 2YU9H 1D5ZC 2UU9Q 2NTTA 1LTBD 1YI2A 1RD9D 5I2YA 1JWUD 3I90A 1D1KA 3DM3A 1B44D 2WP8J 2WB1B 4DF7A 2SDFA 4YIJA 4BY7H 2N55A 3S2DB 3V05A 2KHJA 5CGKA 4HIDA 2CVRA 3U4ZA 1PH4A 1BKBA 1STHA 3PUXA 3QG1A 4X3SA 3K58A 3C1EA 1X56A 2CWPA 4JI8Q 4B9WA 1DOKA 1TWAH 4K6LA 2OEOA 1YHBA 1PRTD 1LABA 3P75A 1RJTA 4WRDA 2FHTA 3HOZG 4G57A 2YTYA 5IWAQ 3HOVH 4LFBL 5CV7A 3GTOB 1PH3A 3CCLA 1G51A 4A3MG 1HZAA 1HNXQ 2B2WC 3BDLA 1PH9A 2AKWB 1E2WA 1ENCA 1EWCA 5I9PA 4A3BG 1WVLA 3CCJA 1PRTC 1Y1VG 1KHIA 5AJ3Q 1FNWA 4IALA 3NBHA 3G6JB 1K3RA 2F1MA 1ZYRD 3EIVA 2F0MA 2NVYB 1K8AC 3J7A5 1G6PA 4WJ3M 2TMPA 4YWKA 4AYBE 4OO1G 3NXWA 5IGGA 3HOUB 1X3FA 1MKHA 5KNBA 1QNKA 1LT3D 4IQZA 1MBYA 3KBXA 2K6AA 1ZYRC 2YV5A 2NBFA 4XYQA 2L55A 4BBRG 1STYA 2ICIA 5EKKA 4H44C 1QE6A 2Z6KA 3CCRA 4JI6Q 3NQIA 4B3SL 5FJ8G 2LS01 4PZ8A 4RKLA 1FGBD 4X65L 1SE3A 2EY1A 1Z47A 4BS9A 2QDLA 1P8LA 4A3FG 3TS2A 2A6EC 4X64Q 5FO9B 2VQEQ 1XNRL 4IPGA 2XN9C 1FL0A 1XTDA 1UAPA 2EY5A 2CH4A 4JI2L 5BN3A 3T4AC 4CKBA 1STGA 2QW7A 1BBXC 5ELCA 1PYWD 2F52A 1PFSA 1HZCA 4A4IA 4YCUA 1HFGA 3K5MA 4GN3B 4ZCKA 4Q5VA 3U50C 2F4IA 2RVLA 4A3IH 1MSHA 4DV1L 1KLGD 2IW3A 1DXMA 2SNMA 2ZXRA 3QJYA 2BDNA 4ILWA 1ICWA 4IPDA 5ELBA 4XT1B 3CW2C 1ENFA 1LT5D 5EGTA 2JSOA 4LF9Q 1S5ED 1TWHH 2KBNA 3ONAB 3MWYW 3GTJH 3FVQA 1TS3A 4A3CH 1D6EC 2N88A 5EBCA 4P2CB 1TKWB 2J7ZA 2EYFA 2I46A 3R2TA 4YHHL 4ULLA 5KGUA 1RTNA 4IN3A 1SXTA 2KA7A 2B2YA 1CKMA 1P16A 3T13A 5C44B 1VQBA 1MGSA 2NVXH 3GTGB 3C1FA 1S72A 3TN2A 1BUVT 1PH6A 1Z7TA 2ZTDA 3I7FA 1XMQL 2KEDA 1WTWA 4BY1B 1SYDA 4TKOB 3SVMA 1YITA 2AWNA 3GTMB 5JJKA 1EYCA 4JI1L 1OXTA 2EYHA
chains in the Genus database with same CATH topology
2TSSA 1ZXTA 5E1FA 4DNTB 3RZOB 4K8IA 2R6GA 2XSCA 3V2TA 3E0JA 2E2HB 4DA2A 1AW7A 4FXDA 3GTPB 4HTHA 4RCOA 2R93B 4DAYA 4MIUA 2H4OA 2YYZA 4XDXA 3OOCA 1F2YA 2YU9B 4PQXA 2BOSA 1A3TA 4DNRB 5JEAG 2B8GA 3DWQA 4BA2I 5M5XB 2WACA 1EIGA 2FMCA 1EYDA 1ZEQX 3FPUB 1FD7D 3NK9A 1HQRD 2A73B 3KK7A 5T1GA 1SAPA 3OHXC 2FINB 3BZDB 4PMCA 4C3HB 3T53B 1F9SA 3VR6A 5IGEA 4PMWA 3NWSA 1EEID 3QOLA 1YNJD 5A2QE 1PTOF 3MZ5A 2JA5B 2A69C 1D1IA 1RHPA 1EU3A 4FNFA 3MC0B 5C4HA 2Z4HA 3P1HA 1Q1EA 1YNJC 3PO2B 2ZXPA 1BXTA 1TQOA 3LX0A 3A8KE 4F88A 3S17B 2R92B 5E4WC 3ND8A 1A15A 1AZPA 3R2IA 3W2DA 1LLRD 2AQ3B 5F2DA 1G6ZA 2E2JB 1CI3M 4KKTA 3M3YB 3NHHA 1U9RA 1TS2A 3AU7A 3D6WA 1JE4A 1CA6A 4UAIA 4ID6A 1SJED 1S5DD 3FDTA 1DZ1A 1LT4D 4QMGA 2PZTA 2F3VA 5I4DA 4KTAA 2KCCA 1TS4A 2OT2A 4LAAA 2VNUD 1U4RA 2NUCA 1I4XA 3M85A 1M4VA 1RCVD 3CRLC 3OPOA 3I73A 2SOBA 2MGSA 2C9OA 2EPBA 5EKIA 4G4KA 1EY5A 1GJXA 2B2TA 4E6IA 4KD4A 2XWJB 2E74C 3I4MB 3S16B 1UNSA 2JP1A 4L8JA 3BDOA 5CV6A 3FEWX 1EQVA 4WJWA 2F0FA 2JE6I 3DMUA 5CC4A 2BE5D 2XRQD 4XQNA 1STAA 1TT2A 1E0BA 5AFWA 3IAYA 1OXVA 2LKVA 4FF2A 4OL7A 5LL6S 3TZDA 4A3JB 4K14A 4KK7A 3HP3A 1O80A 2PCFB 1QOHA 5EPLA 3Q24A 5J39A 4B08A 2PO4A 1SYEA 2Z1CA 1ILQA 3PIP3 5E3FA 1O7ZA 4F7XA 1VF5C 2EJFC 2K33A 3T16A 4A3KB 3S15B 3D31A 1Y69U 3O13A 4XT3B 3CHBD 3E5SA 1S5BD 3ZYYX 1SNDA 1AN8A 1EY9A 1STNA 1A2UA 5D3IB 2GA4B 1WTQA 4NKLA 3MEHA 4IZ8A 2B8FA 3DEOA 4X3UA 1G291 1HQMC 1Y8OB 1TR5A 1PLFA 5K5PA 2XRSD 2O5JC 2E2IB 1TY0A 1B53A 5EBDA 1LTTD 2LMCB 3D3RA 3H91A 5DAUA 1R4PB 1ILPA 1HA5A 2M9VA 1L0YB 5FOBB 3MXPA 3BYTB 5BN4A 4K5VA 2A68D 2PZUA 1PMRA 4LJZC 3L7ZC 2A68C 4C2MB 2KJXA 5C0XH 1FYCA 4K8JA 1T5EA 5EJWA 1EOTA 1V1OA 1XWEA 1WTPA 4ZUJA 1HTPA 5M3MB 1BCPC 1HA6A 1V1PA 2NB0A 1G2TA 2AQ1B 4KMUC 2J4XA 2NWGA 2SEBD 4S3SA 4HCEA 3NBIA 4BWGB 1ESFA 2NVTB 5CORA 5FLXL 4HR7B 1EY8A 3BVGA 5M5YB 4DK1A 4HMIA 1CTMA 2D62A 3PIO3 1IKMA 2B2VA 2EY2A 2L1BA 5ELEA 2DNCA 2O2LD 3M4YA 2PYKA 4HAEA 3BVMA 1OXSC 4OIJA 2F0HA 3P20A 4CJ2C 1AZQA 3SEBA 1VCIA 4G7ZC 1RKNA 4XQJA 4XTCS 5M3FB 2IJ0A 5D3DA 1SSOA 2E76C 2D5DA 2K5QA 2AQ2B 1WCMB 2K5DA 4QF4A 2MPMA 1D5XC 3HG9A 1AEXA 5K36H 3HOWB 3FRPB 3OMGA 1KNAA 3D4DA 3GTGB 4WORA 5JPNC 3PUWA 4DAPA 2KOLA 2I07B 1IW7D 1PRTF 1ZKOA 3S1RB 3M7GA 4OIKA 4PNYA 2L12A 1B4OA 3S14B 3GTQB 2EJGC 1WD0A 3VA5A 1IYVA 3SDZA 1IW7C 2L11A 3LWEA 2IL8A 5ELDA 3H3VC 4CJ0B 5DM63 1GUGA 3OWFA 5G3LD 1S5CD 3I70A 3C46A 1LV9A 2JXMB 3FPPA 4OO1I 3NTIA 1OXUA 4K6DA 1SYCA 4X3KA 1HFNA 1SNOA 2RKSA 2NN6I 4KV6A 1B9NA 2EY6A 4QB4A 4OGQC 4EGVA 4RAUC 1D5MC 3TBIB 5I9OA 2A6ED 4G7OC 1EFID 3Q23A 1Q12A 2FFKB 4NDXA 4Z9CB 1QJOA 3D4RA 1C8CA 4XIGS 3KUPA 2KEEA 2X69A 1U4PA 5HURA 1GUWA 2B2YC 1EZ6A 5J22A 5EQ0A 5IIFA 5M9OA 3I3CA 4IUPA 1NUCA 2IT1A 3EA6A 1H9SB 3TP8A 1L0XB 3RMHA 4HCSA 2HCIA 3Q0AA 3MXGA 4RCNA 5KYIA 1BQQT 3X3NA 3NUCA 4BA1I 3MAQA 1HUMA 3PMFA 2WINB 1NCVA 1EY4A 3T56B 1DM0B 2FMMA 3I91A 2X6LA 1IHZA 5C5LA 3OW7A 4ZKCB 1R4QB 2PNRC 4V0BA 3WOEA 4I7ZC 2PPBC 2F0WA 3U9SA 2PW5A 2K32A 1KDAA 3WOFA 3EROA 3DXJC 2NYZD 5C4JB 1LO5D 2JA7B 1JC7A 4RA8A 1BDOA 2D9UA 5IODA 2R61A 4RGOS 2BA1A 1Q1BA 4FF4A 1EEFD 5ISRA 4RH6A 3MHBA 4IUUA 1IKLA 1E2VA 4ZQ3A 1JQYD 5TSSA 3HOZB 1ET9A 2HCCA 1ENAA 4MN3A 3S1MB 4KY6A 4A3BB 3S9WA 2XVSA 1GHKA 3SR1A 3VR3A 5C5MA 2K05A 3OWEB 3VYTA 2A69D 4Q0FA 1DONA 4C3JG 1IL8A 4H0LC 4L63B 3SK4A 1SE4A 2ID0A 5JVG3 1Y8NB 2KQ3A 1GUNA 1JOOA 1O78A 4FO2A 4KKUA 4O1NA 5EKLA 4K5WA 1NAPA 2PW7A 1SNPA 4A3FB 1GXDC 1F9QA 1EL0A 1TS5A 1GUOA 1H9MA 3PUYA 2AUKA 2PZWA 3I4LA 4OHJA 4F87A 2B2TC 1BR9A 2M00A 2SNSA 5C4ZA 1PFMA 2OXPA 1HRJA 1CZWA 4KJNA 1JWMD 1XTCD 1PTOC 1CQVA 2RSNA 4KHVA 1EU4A 2G9DA 2VB3X 4DK0A 1WTOA 2EYPA 3QO2A 1BCPB 2F0NA 2EZVA 4IFDJ 1NSNS 3IFTA 3K6OA 3BVZA 2BA0A 2E75C 4HEDA 3TZUA 3TMEA 1SYGA 3TP6A 5JAVA 3C3LA 2IWHA 5HGTA 3RZDB 1LTAD 3K5OA 4IURA 4TRDA 4J8QA 2JYOA 1BF4A 2JEBI 4ME5A 1EY0A 2LY7A 1YNND 1SNCA 3J7AF 4CBVA 1I4RA 1B1ZA 1JOKA 1Y8PB 1LACA 1I4GA 3H0GB 3RD4A 1YNNC 1Z6HA 2R7ZB 1K8OA 1B9MA 3NP8A 1LTSD 1B50A 4EQPA 1B3AA 3IFDA 3K59A 2RSOA 1F9PA 4H7BA 3IKJA 1GUTA 2B2UA 2VXWA 4FVMA 4B9XA 2RDHA 1I6HB 4RGMA 2F0EA 2WAQB 1BOSA 2HUGA 2F0KA 5LHY1 1EIHA 3JAML 3J81L 4C3IG 4C1NI 1VF7A 1STBA 4F8MA 3PUZA 1PXUA 2KECA 4JK1C 3Q22A 1RDPD 3GD7A 4EQOA 3QB3A 1CK1A 3BG3A 4A93B 5CV8A 4HN7A 4RKBA 1VDZA 4J6HA 1X32A 4HMJA 3OMCA 1Q90A 4X3TA 4ZK9B 1F2MA 3NE5B 3N52A 2HDLA 1Q8IA 5FO8B 2KVMA 1MSGA 3HGBA 1Y1WB 1IYUA 1W6KA 1BCPF 1QNUA 4PV1C 5I6YA 1XXGA 2B39A 5IT9E 2B63B 1A6XA 2A74C 4FYDA 3UI2A 4IUQA 2Z4IA 5FLXE 3BS1A 5CYUA 4Y7NB 5M5WB 1H9KA 2HQEA 1JICA 3OSOA 3I4NB 5ELFA 1PFBA 1BCPD 3MFGA 2WV6D 3S1QB 1CHPD 3RLFA 3G7LA 1TWFB 4ZLTF 3K0YA 3ND9A 3QWNA 4KY5A 2F0IA 3E6ZX 1NR2A 1KLUD 5CR3A 5IT9L 3PO3B 2QILA 1OXXK 2H1EA 3MA2B 3BDCA 4IUVA 3PV0A 4A3EB 1J8IA 5C0XG 3A54A 3A8IE 5C4XB 3I72A 5JEAJ 4XXEA 2F0VA 4ZUIA 4MHEA 3T51B 4IFDH 4O42A 4DFAA 1K8MA 4BBSB 2MHVA 3FKIB 1TWCB 1H9JA 4C56C 4IFDI 2Q8IB 3SK8A 4QUFA 4N9PA 1G8ZD 1MI2A 4UDUC 2CW0C 2F0TA 3NTHA 1SFOB 2F0OA 2O4XA 4KN7C 4QIWB 2F0PA 2MP1A 2X6GA 2Q8TA 5JJZA 4RGTA 1SMYC 1Q3LA 4M1UB 2O5IC 4DGZA 2JA6B 3W3AA 2Q8RE 3EQLC 2EOTA 4C1NK 1JB3A 4IUNA 1I6VC 5G3LF 1PDQA 2NVQB 2L9HA 4ZKBB 2ENBA 1EY7A 1FR3A 2L5TA 3EFXD 3HS0C 1HTLD 2JA8B 4R8NA 3NQTA 4OO1H 4NP5A 2EXZA 1V8QA 3K5LA 2G9HD 1A3VA 1LT6D 2A5HA 2KHSA 2NN6H 2QCPX 3HOYB 5K36G 5IGDA 3VR2A 1EY6A 5DEHA 1QG7A 1PZKD 2AUJD 3FMCA 4L6TB 3MTSA 4LK1C 1O7YA 2XIWA 2EVBA 1TIID 2K03A 2C5CA 2EDGA 1JCKB 1ML0D 2EYOA 2F0GA 1I4PA 2L0CA 5KNDA 1UUPA 3D6CA 3IL8A 2QEJC 3S1NB 1CZGA 3OIPA 4C3HG 3VYRA 4K2KA 3TSSA 3L3OC 2KCNA 1XX8A 2NN6G 2EE1A 1DCZA 3HOXB 1SNMA 1EYAA 3MXNA 4XQQA 4KKSA 2KUMA 4NW2A 4I65A 1PTOB 5NUCA 2PQEA 4A3GB 1CT1D 3SK6A 2XNAC 4A3DB 1CHQD 3VR4A 2V4DA 5CV5A 5IOCA 3A7AB 1STEA 2B2WA 4ODGA 3H6MA 1CQFA 1KABA 4U673 5JPMC 4K2LA 3TP7A 1U4LA 3MFYA 4HSPA 4AYBB 4EQNA 2IPKD 3DWPA 1T5XD 5C3XA 3SK5A 2WIIB 2ZXOA 3I8ZA 3KLSX 3H94A 5IGCA 2NZ1D 3DUZA 5DM73 4DAVA 3GV6A 3J7AV 1KDBA 3GO5A 4DXFA 1S4ZA 1KDCA 1O7LA 3K57A 2F0QA 3S2HB 3OIQA 2DNEA 1LTID 4ABNA 4RHRA 4CJ1B 5JEAH 1FNVA 3DWAA 1TVXA 1X3PA 2RDFA 3D8GA 5BN5A 1QWYA 2Z8LA 5D14A 1F2ZA 1QCBD 3A55A 3LNNA 4CHTB 4FP5D 4A3MB 5C3WA 5CV9A 3R8BA 3WDNA 2OF1A 4M8AA 1Y1VB 4EVOA 1I50B 3CQZB 1H9RA 1KTKA 1A2TA 5A35A 2L4NA 2MUYA 2RQXA 2AWOA 1TY2A 4QUCA 1QB5D 4KHZA 4TQUS 1F9RA 4HSVA 3VYUA 1KNEA 4BBRB 2K1BA 4BY7B 2PMZB 1DOLA 3DM1A 1I4HA 1TWAB 1GOZA 4KD3A 2QDBA 3HOVB 3L9AX 3EJIA 1V1PB 1ET6A 1X3QA 2DY7A 1UEAB 4IUTA 1SYBA 1F2LA 2F3WA 3TP5A 1RODA 5IGBA 1EWHA 2K04A 2ICEC 3V96A 5C0XJ 3D4WA 3LWUA 3SE0A 1JORA 1M8AA 1LTRD 3NTKA 3J80E 1PTOD 5FK9C 3MVVA 3SHLA 3VYSA 1I4QA 2R3ZA 5CBAE 1C48A 1HPCA 3HZXA 3KLSA 1HXYD 3HRZC 3TDQA 5A2QL 2IX0A 4J1MA 1JR0D 1U4MA 2CQAA 4H13C 3GQBA 1W6JA 2BCOA 3DHQA 5EPJA 4KJOA 1WTXA 2MJ8A 1MD2D 3ITPA 3R3OA 2B2UC 4RGNA 3J80L 1G91A 1EQTA 4A3IB 2F0SA 4JBWA 2F0LA 1ESRA 1HHVA 2F0DA 1K83B 1BO0A 3X3MA 4CKCA 3SXHA 5LL6X 3GV3A 1HCZA 1TWHB 1QILA 4CKEA 3GTJB 2Y0SB 1HUNA 1CA5A 1VMPA 5CMDA 3MXUA 5JOBA 1DOMA 5KIXA 3JAME 2DY8A 1PZID 1J9OA 2FJ2A 1E2ZA 3J81E 4DU9A 2NVXB 4KI0A 1RF2D 1H9SA 4G7HC 1AP0A 1SJHD 3U9OA 4CGYB 4LMQD 4PMBA 4C3JB 1SNQA 1BNZA 2HDMA 2D2CC 1LTGD 1DD2A 1DYQA 2BE5C 5I2XA 3KLRA 2RDGA 5KYLA 4RFBA 3BYYB 1OO9B 1JWSD 2IX1A 1AFPA 4ZYSA 3F2UA 4NMZA 3ERQA 1SBBB 1WTRA 5DNFA 3P7JA 3A56A 3NWTA 2XWBB 4XYOA 3RUZA 3AB9A 1G2SA 2EYLA 2J0TD 3K5NA 3HKZB 3PUVA 2QF7A 3KF8A 1SEBD 1TU2B 2VB2X 2F0JA 1A3UA 4ZAIA 2K7VA 1CM9A 1EZ8A 2K5WA 2NTSA 2LFNA 1TWGB 5I6WA 3M4OB 1NR4A 5D65A 2DN8A 2CHBD 4R9WA 5COYA 2EJMA 1CFMA 1PRTB 3CKIB 2M2LA 4RHSA 2ZT9C 1GHJA 3H09A 3NSWA 2B2VC 4WFN3 4K5XA 2VUMB 3EVQA 1SDFA 1FNUA 4TSSA 4FXKC 2BDOA 4FXGC 4FF1A 1PFNA 2F03A 3QIAA 3KBGA 1PTOH 2WKCA 1PZJD 3Q6SA 5CV4A 2K28A 4R8IA 3CRKC 3DEPA 5EPKA 1WD1A 5CBEE 5C0XI 3A8JE 1D2BA 3CU7A 4U68A 2WKDA 3VR5A 2IX3A 4GZYC 5C3EB 1JOQA 4ZRZA 1II3A 5J1ZA 1XYIA 1SYFA 2JEAI 3K7AB 4RWSC 5KRUA 1F77A 3HEJA 2A6HD 2RBMA 4FF3A 3VA7A 2K01A 5C6AA 5KNCA 2EYJA 5T1IA 3M7NA 1C4QA 1DJRD 5E4XA 1WTVA 2QKIC 2A6HC 3A7LA 3AMUA 1RTOA 2CW0D 1KAAA 1R9TB 1SMYD 3GTLB 4QCLA 3GP7A 4C3IB 2EYMA 4N9TA 2RA4A 3J7YW 2F0UA 3C2PA 2E2DC 5FKAC 4DN4M 3R93A 4KY7A 5KEEA 4V190 4IFDG 1VMCA 1S5FD 4KN4C 5IGFA 1B2TA 1I3QB 5FO7B 5JVH3 3URYA 1ONLA 1SE2A 3GTKB 3N6RA 1GUSA 1V43A 3QOJA 3NPPA 4DXGA 1D5ZC 2NTTA 1LTBD 1RD9D 5I2YA 1JWUD 3I90A 1D1KA 1B44D 2WP8J 2WB1B 4DF7A 2SDFA 4YIJA 2N55A 3S2DB 3V05A 5CGKA 2CVRA 4X3SA 1STHA 3PUXA 3QG1A 3K58A 3C1EA 4B9WA 1DOKA 4K6LA 2OEOA 1PRTD 1LABA 3P75A 1RJTA 4WRDA 2FHTA 4G57A 5CV7A 3GTOB 2B2WC 3BDLA 1E2WA 1ENCA 1EWCA 5I9PA 1WVLA 1PRTC 1FNWA 4IALA 3NBHA 3G6JB 2F1MA 1ZYRD 2F0MA 2NVYB 2TMPA 4OO1G 3NXWA 5IGGA 3HOUB 5KNBA 1QNKA 1LT3D 4IQZA 1MBYA 3KBXA 2K6AA 1ZYRC 2NBFA 4XYQA 2L55A 1STYA 2ICIA 5EKKA 4H44C 1QE6A 3NQIA 2LS01 4RKLA 1FGBD 1SE3A 2EY1A 1Z47A 4BS9A 2A6EC 5FO9B 2XN9C 1UAPA 2EY5A 5BN3A 3T4AC 4CKBA 1STGA 1BBXC 5ELCA 1PYWD 1HFGA 3K5MA 4Q5VA 2F4IA 2RVLA 1MSHA 1KLGD 2IW3A 1DXMA 2SNMA 2ZXRA 3QJYA 2BDNA 4ILWA 1ICWA 5ELBA 4XT1B 1ENFA 1LT5D 5EGTA 2JSOA 1S5ED 3ONAB 3MWYW 3FVQA 1TS3A 1D6EC 2N88A 5EBCA 4P2CB 1TKWB 2J7ZA 2EYFA 2I46A 3R2TA 4ULLA 5KGUA 1RTNA 4IN3A 1SXTA 2KA7A 2B2YA 3T13A 5C44B 1MGSA 3C1FA 3TN2A 1BUVT 1Z7TA 2KEDA 1WTWA 4BY1B 1SYDA 4TKOB 3SVMA 2AWNA 3GTMB 1EYCA 1OXTA 2EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E3F A;  5E1F A;  3SXH A;  2F0J A;  3OWF A;  5IOC A;  1IHZ A;  1A3U A;  5C5L A;  4F7X A;  4ID6 A;  4IUN A;  4ODG A;  3T16 A;  2PZW A;  1KAB A;  3H6M A;  4K8I A;  2EYM A;  4N9T A;  1EZ8 A;  3V2T A;  4QMG A;  4K2L A;  3TP7 A;  1STY A;  5EKK A;  2PZT A;  2F3V A;  2F0U A;  5JOB A;  1EY8 A;  2ENB A;  3E5S A;  1EY7 A;  4KTA A;  4B9X A;  5I6W A;  5KIX A;  4HTH A;  4K6D A;  2F0W A;  1SND A;  4EQN A;  1SYC A;  2PW5 A;  4MIU A;  4LAA A;  4RKL A;  4KD3 A;  1EY9 A;  1STN A;  4KY5 A;  2F0I A;  1A2U A;  1SNO A;  2EY1 A;  2HQE A;  1KDA A;  2NUC A;  2QDB A;  4HMI A;  2F0E A;  2M00 A;  5C3X A;  3SK5 A;  2RKS A;  2SNS A;  3ERO A;  5C4Z A;  1F2Y A;  4KV6 A;  3EJI A;  4NKL A;  4DU9 A;  3MEH A;  4KY7 A;  4R8N A;  3NQT A;  2EY2 A;  1A3T A;  4IZ8 A;  5CR3 A;  5KEE A;  2SOB A;  4NP5 A;  2OXP A;  2EY6 A;  2F0K A;  2WAC A;  2EXZ A;  4KJN A;  5IGC A;  1TR5 A;  4QB4 A;  5CV5 A;  3BDC A;  1EYD A;  4K5X A;  1A3V A;  2EY5 A;  5IGF A;  2KHS A;  5K5P A;  2PYK A;  1EY5 A;  5IOD A;  3EVQ A;  1SYB A;  1KDB A;  2F3W A;  3NK9 A;  3TP5 A;  5I9O A;  5IGB A;  3U9O A;  4KD4 A;  1STG A;  4E6I A;  4KHV A;  5IGD A;  1KDC A;  2F0H A;  4PMB A;  1STB A;  5ISR A;  1SNQ A;  3D4W A;  1EY6 A;  3MHB A;  4PMC A;  5DEH A;  4F8M A;  5DAU A;  1JOR A;  4ZQ3 A;  5IGE A;  4NDX A;  1RKN A;  2F0Q A;  2EYP A;  2F0N A;  3QOJ A;  3QOL A;  3MVV A;  3SHL A;  1ENA A;  1NSN S;  3MZ5 A;  2F0V A;  2SNM A;  3MXP A;  5CV4 A;  4ZUI A;  5HUR A;  4EQO A;  3QB3 A;  4K5V A;  3TME A;  1EZ6 A;  1SYG A;  5C4H A;  4KY6 A;  3TP6 A;  2PZU A;  4S3S A;  4QF4 A;  4DFA A;  5JAV A;  3S9W A;  5KYL A;  5EGT A;  2EYO A;  2F0G A;  5J22 A;  5HGT A;  3HZX A;  3P1H A;  5CV8 A;  3SR1 A;  4RKB A;  5C5M A;  5IIF A;  4J6H A;  5CV6 A;  4HMJ A;  1AEX A;  5M9O A;  4TRD A;  1EQV A;  2RDF A;  2F0F A;  3D8G A;  4ME5 A;  1EY0 A;  3OMC A;  4DF7 A;  4YIJ A;  1JOQ A;  1F2M A;  1NUC A;  1SNC A;  4J1M A;  3DMU A;  1II3 A;  1TQO A;  3TP8 A;  5CC4 A;  5CGK A;  2EYF A;  3D6C A;  5J1Z A;  1STH A;  3LX0 A;  1F2Z A;  3OMG A;  3ERQ A;  3C1E A;  4NMZ A;  3SK8 A;  1SYF A;  4N9P A;  4B9W A;  1TT2 A;  1JOK A;  1STA A;  3D4D A;  4K2K A;  5KGU A;  4WOR A;  2OEO A;  4K8J A;  5KRU A;  3HEJ A;  3P75 A;  2F0T A;  3DHQ A;  2RBM A;  4WRD A;  3SK4 A;  4G57 A;  3T13 A;  2F0O A;  2O4X A;  5CV9 A;  4KJO A;  5C3W A;  5CV7 A;  5C6A A;  2F0P A;  2LKV A;  2EYJ A;  5KYI A;  1SNM A;  3NP8 A;  1EYA A;  3ITP A;  4OL7 A;  4PNY A;  3BDL A;  3R3O A;  3RUZ A;  5I6Y A;  2OF1 A;  3C1F A;  5F2D A;  1ENC A;  3NUC A;  4EVO A;  5I9P A;  4ZUJ A;  2KQ3 A;  1JOO A;  4EQP A;  3VA5 A;  4K14 A;  2EYL A;  4IAL A;  5EKL A;  2F0S A;  2F0L A;  5IGG A;  4I65 A;  1KAA A;  1SYD A;  4K5W A;  5NUC A;  2F0M A;  5J39 A;  2PQE A;  1A2T A;  3PMF A;  2PW7 A;  1EYC A;  1SNP A;  3NHH A;  3SK6 A;  4DGZ A;  1U9R A;  2F0D A;  1EY4 A;  4H7B A;  1SYE A;  3NXW A;  2EYH A;  3OSO A; 
#chains in the Genus database with same CATH topology
 4C3J H;  2TSS A;  1ZXT A;  5E1F A;  3ER0 A;  4DNT B;  3RZO B;  3H0G G;  4K8I A;  2R6G A;  2XSC A;  1PH5 A;  3V2T A;  3E0J A;  2E2H B;  1K0S A;  1VQ9 A;  4L5Q A;  4DA2 A;  1AW7 A;  4FXD A;  3GTP B;  4HTH A;  4RCO A;  2R93 B;  4GKJ L;  4DAY A;  5IP9 H;  3D0F A;  4MIU A;  2DJG C;  2H4O A;  2YYZ A;  4XDX A;  3OOC A;  1X6O A;  2I5L X;  1F2Y A;  2YU9 B;  4PQX A;  2BOS A;  1A3T A;  4DNR B;  5JEA G;  4DV1 Q;  2B8G A;  3DWQ A;  4N8F A;  4BA2 I;  5M5X B;  2WAC A;  1EIG A;  1N8R C;  2FMC A;  1EYD A;  1ZEQ X;  2NZH A;  3FPU B;  1FD7 D;  4JI4 L;  3NK9 A;  1HQR D;  2A73 B;  3KK7 A;  5T1G A;  3CCU A;  3S15 H;  3E9I A;  4DV5 Q;  1VQH A;  1SAP A;  4P72 A;  4R1J A;  3OHX C;  2FIN B;  3BZD B;  4PMC A;  4C3H B;  3T53 B;  1F9S A;  3VR6 A;  4LF6 L;  5IGE A;  4PMW A;  3NWS A;  2IY5 B;  1EEI D;  3QOL A;  1YNJ D;  5A2Q E;  1PTO F;  3K0X A;  3MZ5 A;  3G71 A;  1H95 A;  2WAQ G;  5IP7 G;  4IO9 A;  2JA5 B;  2A69 C;  1D1I A;  1B70 B;  1RHP A;  4X62 Q;  1EU3 A;  4FNF A;  3EBE A;  1EOV A;  3MC0 B;  4GNX B;  5C4H A;  2Z4H A;  3BZC A;  1QVC A;  3P1H A;  4H02 A;  1Q1E A;  1YNJ C;  1M1K C;  1GKH A;  3PO2 B;  1XPU A;  2ZXP A;  1BXT A;  1D8L A;  4DV3 Q;  1TQO A;  4DUY L;  1YJW A;  3LX0 A;  3A8K E;  4F88 A;  3M4O H;  3S17 B;  2R92 B;  3F2B A;  4DUZ L;  5E4W C;  3ND8 A;  4QL5 A;  2K5N A;  1A15 A;  1AZP A;  3T1H L;  3R2I A;  3W2D A;  1LLR D;  2AQ3 B;  5F2D A;  1G6Z A;  2E2J B;  2QEX A;  1CI3 M;  2OCE A;  4KKT A;  2VUM H;  3M3Y B;  3NHH A;  1HR0 Q;  1U9R A;  3G4S A;  1TS2 A;  3AU7 A;  2Q2T A;  3D6W A;  1JE4 A;  1CA6 A;  4CDD C;  2P5Z X;  4ID6 A;  4UAI A;  3OYY A;  3UDG A;  4WJ4 A;  1Y1W G;  3I55 A;  1SJE D;  3F1Z A;  4IPC A;  1S5D D;  2UXD Q;  5FLM G;  3FDT A;  1DZ1 A;  1LT4 D;  4QMG A;  2PZT A;  2CQO A;  2F3V A;  5HY6 A;  5I4D A;  4KTA A;  2KCC A;  2B63 G;  1TS4 A;  1N32 Q;  2OT2 A;  4DR4 Q;  4LAA A;  3AYH B;  3JC6 6;  2VNU D;  1U4R A;  2F3I A;  1I4X A;  2NUC A;  1L0W A;  1E3P A;  4DV2 L;  3M85 A;  1M4V A;  1K9M C;  1RCV D;  3CRL C;  3OPO A;  5C3E H;  3CPW A;  3I73 A;  2SOB A;  4LW1 A;  2MGS A;  2C9O A;  3I4N G;  2EPB A;  5EKI A;  4G4K A;  1CKN A;  1EY5 A;  1GJX A;  3J7Z C;  1MJC A;  4PZ7 A;  4LWC A;  4LF7 Q;  2CKZ B;  4AQY Q;  2B2T A;  1FJG L;  2NZO A;  4KD4 A;  4E6I A;  2I5H A;  3RN5 A;  1X9N A;  1IBM L;  2XWJ B;  2Z0S A;  2E74 C;  3I4M B;  3S16 B;  3OTO L;  2K75 A;  1UNS A;  1K8G A;  4NXM L;  1R9T H;  3PO3 G;  2JP1 A;  4DUZ Q;  2UXC L;  4L8J A;  3BDO A;  3NEN A;  3FEW X;  5CV6 A;  3DLL A;  4DV0 Q;  4HJ9 A;  3GTL H;  1EQV A;  4WJW A;  4C3I H;  2F0F A;  2JE6 I;  3DMU A;  3M9B A;  4A3E G;  5CC4 A;  1HJP A;  1ASY A;  5C3E G;  1N33 Q;  2BE5 D;  2OTL A;  2XRQ D;  4XQN A;  1STA A;  1B7Y B;  1TT2 A;  3CAM A;  3HKZ E;  1E0B A;  5C4X G;  5AFW A;  3OW2 A;  4LF4 L;  3AFP A;  3IAY A;  3STB D;  1OXV A;  2LKV A;  4FF2 A;  3CPF A;  4OL7 A;  5LL6 S;  3TZD A;  2VZA A;  1PV4 A;  3UDX A;  4A3J B;  2OQK A;  4JI5 L;  3SGI A;  4K14 A;  4KK7 A;  3HP3 A;  1O80 A;  2PCF B;  1QOH A;  3FKI G;  5EPL A;  3Q24 A;  3STB C;  5J39 A;  1JT8 A;  1I3Q H;  4B08 A;  3S24 A;  2YTX A;  2PO4 A;  1SYE A;  2Z1C A;  5LMU Q;  4DV2 Q;  3GTK H;  1ILQ A;  3PIP 3;  5E3F A;  1O7Z A;  4F7X A;  1VF5 C;  2EJF C;  2K33 A;  4GOP B;  3T16 A;  1IYJ B;  4A3K B;  1IBL L;  3S15 B;  3D31 A;  1Y69 U;  3O13 A;  2HD3 A;  1N36 Q;  4XT3 B;  3CHB D;  1GM5 A;  3E5S A;  1S5B D;  5GAG C;  3ZYY X;  4JI7 Q;  1FJG Q;  1SND A;  1AN8 A;  1IBM Q;  1EY9 A;  1STN A;  1A2U A;  5D3I B;  4JYA L;  1A8V A;  1B3Q A;  2GA4 B;  1WTQ A;  4NKL A;  4DR2 Q;  3MEH A;  3MXN B;  4IZ8 A;  1BBU A;  3S2D H;  2B8F A;  5IYB G;  1AE2 A;  3DEO A;  4X3U A;  1JJG A;  1G29 1;  1HQM C;  1Y8O B;  1TR5 A;  4R4I A;  1PLF A;  4NXM Q;  4POG A;  3PQI A;  5K5P A;  2XRS D;  2O5J C;  3U4V A;  2E2I B;  2E5L L;  3GTO H;  4UPA A;  1TY0 A;  1B53 A;  5EBD A;  2WFW A;  1LTT D;  2LMC B;  3D3R A;  2XGT A;  3H91 A;  5DAU A;  1R4P B;  1ILP A;  4DR7 Q;  1HA5 A;  3ERS X;  2M9V A;  1VQM A;  2NVY H;  1L0Y B;  5FOB B;  3MXP A;  3BYT B;  5BN4 A;  4HIM A;  2HIV A;  4K5V A;  2ATW A;  3HOU H;  2A68 D;  4LF4 Q;  2PZU A;  1PMR A;  4PG3 A;  4LJZ C;  1KC8 C;  3L7Z C;  3BZK A;  1ICF B;  4K0K L;  3HOY G;  4NPS A;  2A68 C;  1VQD A;  2MO1 A;  4DR6 L;  4C2M B;  4NXN L;  2KJX A;  5C0X H;  2DUD A;  1FYC A;  1HNW L;  3A5U A;  4K8J A;  1T5E A;  5EJW A;  1EOT A;  4IJH A;  1V1O A;  2EQS A;  4CDF C;  1VQ8 A;  1XWE A;  1V9P A;  1WTP A;  4DPG A;  4ZUJ A;  1HTP A;  1XNQ Q;  5M3M B;  5IT9 c;  1BCP C;  5E7N A;  1K73 C;  1HA6 A;  1V1P A;  2NB0 A;  3KF6 A;  1G2T A;  2AQ1 B;  4KMU C;  5FLX c;  2J4X A;  2NWG A;  2SEB D;  4S3S A;  4HCE A;  1VQP A;  3NBI A;  2UXB Q;  2HQL A;  4BWG B;  3H15 A;  1ESF A;  2NVT B;  5COR A;  5FLX L;  4HR7 B;  1TXY A;  3HOX G;  1KXL A;  1EY8 A;  3BVG A;  2UUB Q;  5M5Y B;  2ZTC A;  4DK1 A;  1PHJ A;  1Q46 A;  1UWV A;  4HMI A;  1CTM A;  2D62 A;  3PIO 3;  4A3G G;  1IKM A;  2B2V A;  2EY2 A;  4A3D G;  2L1B A;  5ELE A;  2DNC A;  2O2L D;  3M4Y A;  4GLA C;  1V1Q A;  1HNX L;  1L1O A;  5IYC H;  1VQ7 A;  2PYK A;  4OON A;  4HAE A;  5C44 H;  3E3X A;  3BVM A;  5AJ3 L;  1OXS C;  4OIJ A;  2F0H A;  3P20 A;  4CJ2 C;  1AZQ A;  3W1G A;  3SEB A;  1VCI A;  4G7Z C;  2WB1 E;  4AYB G;  3AEV A;  1FVI A;  1RKN A;  4XQJ A;  4XTC S;  5M3F B;  1E1O A;  4HJ5 A;  3NEL A;  4BY1 H;  2IJ0 A;  5D3D A;  1SSO A;  4AH6 A;  2E76 C;  3GTM H;  2D5D A;  2K5Q A;  2AQ2 B;  1WCM B;  2K5D A;  4JI3 Q;  4QF4 A;  2MPM A;  1D5X C;  1C7Y A;  2JA7 H;  3HG9 A;  4JI6 L;  1AEX A;  3RZO H;  1A62 A;  2A8V A;  2E2H H;  5K36 H;  3I56 A;  3HOW B;  3FRP B;  4P74 A;  3OMG A;  3GTP H;  4LF8 Q;  3J81 j;  2R93 H;  1KNA A;  3D4D A;  4X64 L;  4WOR A;  5JPN C;  3F2D A;  2IHE A;  3PUW A;  4DAP A;  3K7U C;  2KOL A;  2I07 B;  3W1B A;  2YTV A;  1IW7 D;  1PRT F;  1ZKO A;  2D0P A;  3S1R B;  4UHV A;  3M7G A;  3KDF A;  4OIK A;  4PNY A;  2L12 A;  1B4O A;  5M5X H;  3S14 B;  3GTQ B;  1CSP A;  1E24 A;  2EJG C;  1WD0 A;  3VA5 A;  1IYV A;  3SDZ A;  1IW7 C;  2L11 A;  3LWE A;  2IL8 A;  5ELD A;  3H3V C;  4TVA B;  2QA4 A;  4HIK A;  4CJ0 B;  4C3H H;  1GUG A;  5DM6 3;  3JAM i;  3OWF A;  1YJ9 A;  5G3L D;  1WTH A;  1S5C D;  3I70 A;  3C46 A;  1LV9 A;  2JXM B;  3FPP A;  3J81 i;  4LF9 L;  2JA5 H;  5GAH C;  1YBY A;  3CD6 A;  3PGZ A;  4OO1 I;  3NTI A;  1OXU A;  2IHF A;  4K6D A;  1Q8K A;  4JOI C;  1SYC A;  4RG1 A;  4GN4 B;  4X3K A;  3UDI A;  2R93 G;  1HFN A;  1SNO A;  2RKS A;  2NN6 I;  3CC2 A;  3PO2 H;  4KV6 A;  1B9N A;  2EY6 A;  1IBK Q;  4QB4 A;  4OGQ C;  3S17 H;  2R92 H;  1U0L A;  4EGV A;  4RAU C;  4JBJ A;  1VQN A;  1D5M C;  3TBI B;  5I9O A;  2A6E D;  4BY7 G;  4LF5 L;  3MEF A;  1PH1 A;  4G7O C;  1EFI D;  3Q23 A;  1LUZ A;  1VQI A;  2E2J H;  1Q12 A;  2FFK B;  4NDX A;  4Z9C B;  1QJO A;  3D4R A;  1C8C A;  4XIG S;  3KUP A;  3HOV G;  3M3Y H;  2KEE A;  2X69 A;  1U5K A;  1U4P A;  5HUR A;  1GUW A;  2B2Y C;  1EZ6 A;  5J22 A;  5EQ0 A;  5IIF A;  2VY3 A;  5M9O A;  3I3C A;  3RN2 A;  1K0R A;  4IUP A;  1NUC A;  2IT1 A;  3EA6 A;  1H9S B;  3TP8 A;  3L2P A;  3M4P A;  1L0X B;  3RMH A;  4HCS A;  2HCI A;  3M4Q A;  3Q0A A;  3RLN A;  3MXG A;  4DV7 Q;  4RCN A;  5KYI A;  2N49 A;  1BQQ T;  2DGY A;  3X3N A;  3NUC A;  3TQY A;  4BA1 I;  4AIM A;  1EFW A;  3MAQ A;  3K80 C;  4DV5 L;  4RMF A;  1HUM A;  3PMF A;  2WIN B;  3A0J A;  3CCQ A;  1NCV A;  1EY4 A;  1QVF A;  5GAE C;  3T56 B;  1DM0 B;  2FMM A;  3FHW A;  3I91 A;  2X6L A;  1IHZ A;  5C5L A;  4X62 L;  2OQ0 A;  3OW7 A;  4DV4 L;  3I2Z A;  4ZKC B;  3I4M H;  3S16 H;  1R4Q B;  4EX5 A;  1NJI C;  2PNR C;  2R7Z H;  4V0B A;  3WOE A;  4I7Z C;  2PPB C;  1IZ6 A;  4O0A A;  2F0W A;  3U9S A;  2PW5 A;  4LF5 Q;  4DV3 L;  4A3I G;  2K32 A;  1KDA A;  4O2D A;  2DJF C;  3WOF A;  3ERO A;  3DXJ C;  4R4C A;  2NYZ D;  2HIX A;  5C4J B;  1LO5 D;  2JA7 B;  1JC7 A;  4RA8 A;  1BDO A;  2D9U A;  5IOD A;  2R61 A;  4GKK L;  1A0I A;  4RGO S;  2BA1 A;  2Y0S G;  1QVG A;  1Q1B A;  4A3C G;  4FF4 A;  1EEF D;  4JV5 Q;  5ISR A;  3HKS A;  3MHB A;  4RH6 A;  4IUU A;  1HR0 L;  1IKL A;  4A3J H;  1E2V A;  4ZQ3 A;  2K5H A;  1YJN A;  1EWI A;  1JQY D;  5TSS A;  3HOZ B;  1ET9 A;  2HCC A;  1ENA A;  4MN3 A;  1J6Q A;  1YEZ A;  3S1M B;  2ZJR A;  2UXD L;  4KY6 A;  4A3B B;  3S9W A;  2A19 A;  2EXD A;  1YNX A;  2XVS A;  4JG2 A;  1GHK A;  3SR1 A;  3VR3 A;  5C5M A;  2PQA A;  1CKO A;  1N32 L;  4A3K H;  4DR4 L;  2K05 A;  1UE6 A;  2C35 B;  3OWE B;  3VYT A;  4OX9 L;  2A69 D;  4Q0F A;  1DON A;  4C3J G;  2XTI A;  1IL8 A;  4H0L C;  1N9W A;  4L63 B;  3E9H A;  1I94 Q;  4R4T A;  4LFA Q;  1UE5 A;  3SK4 A;  1JE5 A;  1SE4 A;  1KD1 C;  2ID0 A;  4OWX B;  1HR0 W;  1GO3 E;  5JVG 3;  2CCZ A;  1Y8N B;  4DV4 Q;  4LF7 L;  3H3V H;  4AQY L;  2KQ3 A;  1GUN A;  1JOO A;  1O78 A;  4FO2 A;  5IP9 G;  4KKU A;  4O1N A;  5EKL A;  1K28 A;  4K5W A;  1NAP A;  2PW7 A;  1SNP A;  4A3F B;  2E2I H;  4LNQ A;  1GXD C;  2PI2 E;  1F9Q A;  3H3V I;  1EL0 A;  3KJP A;  1TS5 A;  1GUO A;  1H9M A;  3PUY A;  2AUK A;  2PZW A;  5H1S E;  3I4L A;  2UUC L;  4GKK Q;  4DV0 L;  4OHJ A;  4F87 A;  4A3L H;  2B2T C;  1M90 C;  1N33 L;  3A74 A;  4JVZ A;  4LFC Q;  1BR9 A;  2E8G A;  2M00 A;  2SNS A;  5C4Z A;  1NTG A;  3HKZ G;  2ES2 A;  1PFM A;  2OXP A;  1HRJ A;  4Y7N H;  1CZW A;  4KJN A;  4C2M H;  5M5W H;  2ZJP A;  1JWM D;  1XTC D;  1PH8 A;  1PTO C;  5GAD C;  1CQV A;  2RSN A;  4JI0 Q;  4JC0 A;  4KHV A;  1EU4 A;  2G9D A;  2VB3 X;  1X3E A;  4OX9 Q;  4DK0 A;  3ICE A;  5M3M H;  1WTO A;  1W3S A;  5LMU L;  2EYP A;  3QO2 A;  4DAM A;  1BCP B;  2F0N A;  3J80 c;  2EZV A;  4IFD J;  1NSN S;  3IFT A;  3K6O A;  3CXC A;  3BVZ A;  3UE1 A;  2BA0 A;  2E75 C;  4HED A;  3TZU A;  3TME A;  1SYG A;  3TP6 A;  5JAV A;  3C3L A;  2HHH Q;  5ELN A;  1O7I A;  2R7F A;  1N36 L;  2IWH A;  5HGT A;  3RZD B;  1LTA D;  3K5O A;  5L37 A;  4IUR A;  4TRD A;  2NVT H;  4J8Q A;  3ULJ A;  2JYO A;  1BF4 A;  2JEB I;  4ME5 A;  4JI7 L;  2VUM G;  1EY0 A;  3EN2 A;  2LY7 A;  1YNN D;  1SNC A;  3J7A F;  4CBV A;  1I4R A;  4DR2 L;  1B1Z A;  5M5Y H;  1JOK A;  1Y8P B;  1EYG A;  1LAC A;  2ZM6 L;  4L5S A;  1I4G A;  2WAQ E;  3H0G B;  3RD4 A;  1YNN C;  3CMA A;  1Z6H A;  2R7Z B;  1K8O A;  1B9M A;  3NP8 A;  1LYL A;  1LTS D;  2JK8 A;  2MNA A;  3VDY A;  1B50 A;  3KOJ A;  4B3T Q;  4EQP A;  2UUC Q;  1B3A A;  4BBS H;  3WWV A;  3ZJY C;  1SN8 A;  3IFD A;  1TWC H;  3K59 A;  2RSO A;  4DR7 L;  1F9P A;  4H7B A;  2FXQ A;  2ASB A;  3GDE A;  3IKJ A;  1IXR A;  1GUT A;  2B2U A;  5M3F H;  1N34 Q;  2VXW A;  4FVM A;  4NB3 A;  4OEM B;  1WCM H;  4B9X A;  2RDH A;  3JAM c;  1SLJ A;  1I6H B;  4RGM A;  4QJF A;  4DV6 L;  1Q86 C;  2F0E A;  2WAQ B;  1BOS A;  3J81 c;  5EAY A;  1VQL A;  4X66 Q;  2HUG A;  2ALY B;  2F0K A;  5LHY 1;  2JA6 H;  5BR8 L;  3HOW H;  3JAM L;  1EIH A;  3NBH B;  4GLX A;  4JCV E;  4UP7 A;  4LUV A;  2RCN A;  3GTG H;  3J81 L;  3PF5 A;  4C3I G;  1XNQ L;  3S1R H;  4C1N I;  1VF7 A;  1STB A;  2NVQ H;  4HJ7 A;  4F8M A;  2JN4 A;  3S14 H;  3GTQ H;  3PUZ A;  1PXU A;  2KEC A;  1KIX A;  4JK1 C;  3Q22 A;  2UXB L;  1RDP D;  3GD7 A;  2ZM6 Q;  5LMN L;  2ZJQ A;  4EQO A;  3QB3 A;  1CK1 A;  5GQO A;  3AFQ A;  2K5V A;  3BG3 A;  4A93 B;  1C9O A;  2I0Q A;  4J15 A;  5CV8 A;  4HN7 A;  4RKB A;  1VDZ A;  4J6H A;  1X32 A;  4HMJ A;  1XMO Q;  3PSI A;  2UUB L;  4DK6 C;  4QQB X;  3OMC A;  4YCW A;  1Q90 A;  4X3T A;  4ZK9 B;  2JQO A;  1F2M A;  3NE5 B;  3N52 A;  2HDL A;  1Q8I A;  5FO8 B;  3HOW G;  3KYH C;  2KVM A;  1MSG A;  3HGB A;  1QUQ B;  1Y1W B;  1IYU A;  2K4K A;  2GVA A;  1W6K A;  4HIO A;  1VQ4 A;  1BCP F;  1QNU A;  3A5Z B;  4PV1 C;  2N3S A;  5I6Y A;  3UE0 A;  1XXG A;  2LSS A;  1JMC A;  2B39 A;  2OWO A;  5IT9 E;  2B63 B;  1A6X A;  2ZTE A;  2A74 C;  4FYD A;  3UI2 A;  4IUQ A;  2WB1 G;  2R7D A;  2Z4I A;  4JW0 A;  5FLX E;  3BS1 A;  5CYU A;  4Y7N B;  5M5W B;  1H9K A;  4DV6 Q;  1E22 A;  5HGQ A;  2HQE A;  1JIC A;  3OSO A;  3I4N B;  3RNU A;  5ELF A;  4BXX H;  2JJQ A;  1PFB A;  1BCP D;  2CH4 W;  3MFG A;  4JI3 L;  2WV6 D;  1NMG A;  5BR8 Q;  3S1Q B;  1CHP D;  3RLF A;  3G7L A;  1TWF B;  4ZLT F;  1A63 A;  3K0Y A;  1IL2 A;  3ND9 A;  3QWN A;  5IE8 A;  4GNX A;  4KY5 A;  2F0I A;  1VQG A;  1S3O A;  3E6Z X;  4I7A A;  4LF8 L;  1NR2 A;  3AQQ A;  1KLU D;  5CR3 A;  5IT9 L;  3PO3 B;  1PH7 A;  2QIL A;  4JBK A;  1OXX K;  2H1E A;  3MA2 B;  3HOU G;  5LMN Q;  3BDC A;  1X3G A;  2F4V Q;  4IUV A;  5IYD H;  3PV0 A;  4A3E B;  2I5M X;  1OTC A;  1J8I A;  5C0X G;  3A54 A;  3A8I E;  5C4X B;  3I72 A;  5JEA J;  1D7Q A;  4XXE A;  2F0V A;  2RF4 A;  4ZUI A;  4MHE A;  3T51 B;  2RCF A;  4L5T A;  4IFD H;  4O42 A;  3Q8D A;  2AMC B;  4DFA A;  1K8M A;  4BBS B;  3PIP A;  1Q7Y C;  3J80 i;  2MHV A;  3FKI B;  4KLK A;  1TWC B;  3TS0 A;  2K50 A;  1H9J A;  4DR1 Q;  4C56 C;  4IFD I;  2Q8I B;  4UP9 A;  5JJL A;  3SK8 A;  4QUF A;  4MTK A;  4N9P A;  1G8Z D;  1MI2 A;  4UDU C;  2PI2 A;  1IBK L;  2CW0 C;  2F0T A;  3NTH A;  3KFU A;  1SFO B;  2BH8 A;  4B3R Q;  4CDC C;  2F0O A;  2O4X A;  4DR3 L;  4KN7 C;  4QIW B;  2F0P A;  4OWT B;  2MP1 A;  2X6G A;  2Q8T A;  5JJZ A;  4RGT A;  5C4J H;  1SMY C;  1Q3L A;  1QZG A;  3UDF A;  4M1U B;  2O5I C;  4GN5 A;  4DGZ A;  1EQR A;  2JA6 B;  3W3A A;  1CUK A;  1MHW C;  2Q8R E;  3EQL C;  2EOT A;  1E7Z A;  2LXJ A;  4C1N K;  1JB3 A;  4IUN A;  3RLO A;  5IYC G;  1I6V C;  3HOZ H;  5G3L F;  3CC4 A;  5C44 G;  1PDQ A;  2NVQ B;  2L9H A;  4APV A;  4A3M H;  3KJO A;  3S1M H;  4ZKB B;  2ENB A;  1EY7 A;  3E0E A;  4A3B H;  2LXK A;  1Y1V H;  1I50 H;  3CQZ H;  1FR3 A;  2Q2H A;  1Q81 C;  2Z6K C;  2L5T A;  1NY4 A;  2Z9H A;  3CCS A;  3EFX D;  4BY1 G;  3HS0 C;  1SE8 A;  1HTL D;  2JA8 B;  4R8N A;  3NQT A;  4DV7 L;  4OO1 H;  4NP5 A;  3HFZ B;  2EXZ A;  1V8Q A;  3K5L A;  2G9H D;  1A3V A;  1LT6 D;  2A5H A;  2JA7 G;  2KHS A;  2RHQ B;  2NN6 H;  1HH2 P;  2QCP X;  3HOY B;  4BBR H;  5K36 G;  5IGD A;  3VR2 A;  3K8A A;  1EY6 A;  5DEH A;  1QG7 A;  5FJ8 H;  1PZK D;  2AUJ D;  1QZH A;  1Q82 C;  3FMC A;  4L6T B;  3MTS A;  4LK1 C;  1O7Y A;  4A3F H;  4JBM A;  2XIW A;  3F8T A;  1GD7 A;  4GLV B;  4IPH A;  2EVB A;  4YCV A;  1TII D;  2K03 A;  2VQF L;  4DR3 Q;  2C5C A;  4POF A;  2GVB A;  2EDG A;  1JCK B;  1ML0 D;  2EYO A;  2F0G A;  1I4P A;  2L0C A;  3L0O A;  5KND A;  1UUP A;  1SR3 A;  4GOP A;  3T1Y Q;  3D6C A;  3IL8 A;  2QEJ C;  1CKN B;  3S1N B;  1CZG A;  3OIP A;  4C3H G;  1PYS B;  3VYR A;  4K2K A;  2BH2 A;  1LM0 A;  3TSS A;  1YHA A;  3L3O C;  2KCN A;  1XX8 A;  2NN6 G;  3PIO A;  2EE1 A;  1DCZ A;  3HOX B;  2JA5 G;  1SNM A;  1EYA A;  3KLW A;  4DR5 Q;  1DGS A;  3F2C A;  1Y14 B;  3MXN A;  4XQQ A;  4KKS A;  2KUM A;  4NW2 A;  4IOA A;  2CWA A;  4JV5 L;  4I65 A;  1PTO B;  5NUC A;  2PQE A;  4A3G B;  1CT1 D;  3PO2 G;  2OTJ A;  3SK6 A;  2XNA C;  4A3D B;  1CHQ D;  3VR4 A;  2V4D A;  5CV5 A;  4B3M Q;  4MNO A;  1UE1 A;  2R92 G;  5IOC A;  3A7A B;  1STE A;  2B2W A;  4ODG A;  3H6M A;  1CQF A;  1KAB A;  4U67 3;  5JPM C;  4CDE C;  4K2L A;  4JOI A;  1QUQ A;  1U4L A;  3TP7 A;  3MFY A;  3CME A;  1PYB A;  4HSP A;  4AYB B;  4EQN A;  2Q2U A;  2IPK D;  3DWP A;  3RZD H;  1T5X D;  1WOC A;  1HNZ L;  5C3X A;  3SK5 A;  2WII B;  2ZXO A;  1E1T A;  3I8Z A;  3KLS X;  1I94 L;  4LFA L;  3H94 A;  5IY0 A;  5IGC A;  2NZ1 D;  1K83 H;  3DUZ A;  4LFB Q;  1LTL A;  5DM7 3;  1NMF A;  2VQF Q;  4DAV A;  3GV6 A;  3J7A V;  3H0G H;  1ASZ A;  1KDB A;  3GO5 A;  4DXF A;  2RHS B;  4DK3 C;  4OXP A;  1S4Z A;  2CFM A;  1KDC A;  1O7L A;  1B8A A;  3K57 A;  2F0Q A;  3S2H B;  3OIQ A;  2DNE A;  1LTI D;  4ABN A;  4RHR A;  4CJ1 B;  1XJV A;  4OWW B;  5JEA H;  1PA6 A;  1VS0 A;  4P73 A;  1FNV A;  1VQF A;  3DWA A;  1TVX A;  3W5O A;  1X3P A;  3TRE A;  3KF8 B;  2RDF A;  3D8G A;  4B3S Q;  2PMZ E;  5JJI A;  5BN5 A;  1QWY A;  2Z8L A;  4LFC L;  4X65 Q;  5D14 A;  1F2Z A;  1YIJ A;  2V1C C;  1QCB D;  3A55 A;  1I6H H;  1PVO A;  3LNN A;  4CHT B;  3I4M G;  1JJC B;  4FP5 D;  4A3M B;  5C3W A;  1XNR Q;  5CV9 A;  5IP7 H;  3R8B A;  3WDN A;  4QY7 A;  2R7Z G;  2OF1 A;  4M8A A;  1Y1V B;  1VQC A;  4JI2 Q;  1I50 B;  4EVO A;  3CQZ B;  4JI0 L;  1S40 A;  3G6E A;  1H9R A;  1KTK A;  1A2T A;  1HNZ Q;  5A35 A;  2L4N A;  2MUY A;  2RQX A;  2AWO A;  1TY2 A;  4QUC A;  3CCE A;  2A1A A;  1QB5 D;  4KHZ A;  4TQU S;  1F9R A;  3I4O A;  2KHI A;  1KNE A;  4HSV A;  3VYU A;  1EIY B;  3IRB A;  4BBR B;  2HHH L;  4OEL B;  2K1B A;  4BY7 B;  2PMZ B;  1DOL A;  3DM1 A;  1I4H A;  3G48 A;  4A3J G;  4A93 H;  1TWA B;  1GOZ A;  4KD3 A;  2K52 A;  2QDB A;  1VQA A;  4A76 A;  3HOV B;  3L9A X;  3EJI A;  2G5D A;  4YHH Q;  1V1P B;  1ET6 A;  1X3Q A;  1NNX A;  3KF6 B;  1KAW A;  2DY7 A;  1UEA B;  4IUT A;  1Y1W H;  3B6Y A;  1SYB A;  4A3K G;  1F2L A;  4B3T L;  2F3W A;  3TP5 A;  5FLM H;  1ROD A;  5IGB A;  1EWH A;  2K04 A;  3LGJ A;  4DKA C;  2ICE C;  1XMQ Q;  3ULL A;  3V96 A;  5C0X J;  4KHP L;  3D4W A;  1YHQ A;  3LWU A;  3SE0 A;  2B63 H;  1JOR A;  1M8A A;  1TWG H;  4UP8 A;  1LTR D;  3NTK A;  3J80 E;  4UY8 C;  4JI1 Q;  1PTO D;  5FK9 C;  3TRZ A;  3MVV A;  3SHL A;  3VYS A;  1I4Q A;  4MTN A;  1CSQ A;  3PF4 A;  2R3Z A;  5CBA E;  1N34 L;  3I4N H;  1C48 A;  2MO0 A;  1HPC A;  3HZX A;  4A93 G;  3KLS A;  1HXY D;  3HRZ C;  3S1Q H;  3TDQ A;  2Y0S E;  5A2Q L;  4IJL A;  3U58 A;  1TWF H;  4GKJ Q;  2IX0 A;  4IOC A;  4J1M A;  1MJE A;  1L1O B;  1JR0 D;  1U4M A;  4ALP A;  2CQA A;  1RL2 A;  4X66 L;  4H13 C;  3GQB A;  1W6J A;  3BU2 A;  3DHQ A;  2BCO A;  5EPJ A;  4KJO A;  1WTX A;  2MJ8 A;  1MD2 D;  3ITP A;  3R3O A;  2B2U C;  3PO3 H;  4Y52 H;  4RGN A;  3J80 L;  4JI4 Q;  1G91 A;  4A3L G;  1EQT A;  4A3I B;  1JJ2 A;  2F0S A;  4JBW A;  2F0L A;  1ESR A;  2KCM A;  1HHV A;  1KRS A;  3K81 C;  4LF6 Q;  2AHO B;  1C0A A;  2F0D A;  1VQ5 A;  1K83 B;  4A3E H;  1VQK A;  1BBW A;  1BO0 A;  5DLQ E;  1KRT A;  1HZB A;  3X3M A;  3CCV A;  4CKC A;  3SXH A;  4YWM A;  5LL6 X;  3GV3 A;  1HCZ A;  4GS3 A;  1X65 A;  1TWH B;  4R4Q A;  5C4X H;  2B3G A;  1QIL A;  3K7A H;  4CKE A;  3GTJ B;  1HZ9 A;  1WJJ A;  2Y0S B;  1HUN A;  1CA5 A;  1NBW A;  1VMP A;  5CMD A;  3MXU A;  1MIU A;  4YWL A;  5JOB A;  1XMO L;  1DOM A;  5KIX A;  3JAM E;  2DY8 A;  1PZI D;  5M3M G;  1J9O A;  2MQH A;  1YZ6 A;  4KHP Q;  2FJ2 A;  3FKI H;  1E2Z A;  3KDF B;  3J81 E;  2D0O A;  4DUY Q;  1VQ6 A;  4DU9 A;  2NVX B;  4KI0 A;  1RF2 D;  4MZ9 A;  2PNH A;  1T9H A;  1H9S A;  3ULP A;  4G7H C;  4P75 A;  3T1H Q;  1SFO H;  1AP0 A;  1SJH D;  3U9O A;  1KL9 A;  4CGY B;  4LMQ D;  2QGQ A;  4PMB A;  1KQS A;  2GN5 A;  1WI5 A;  4C3J B;  1SNQ A;  1BNZ A;  2HDM A;  2VW9 A;  5J3B A;  2D2C C;  1LTG D;  1DD2 A;  2VS1 A;  2HT1 A;  1DYQ A;  5IYB H;  1XPO A;  2BE5 C;  4R4O A;  2UUA L;  5I2X A;  3KLR A;  2RDG A;  5KYL A;  4BBS G;  4RFB A;  3BYY B;  1OO9 B;  1JWS D;  4P71 A;  1GVP A;  2IX1 A;  3CCM A;  1AFP A;  5ELO A;  4ME3 A;  4ZYS A;  3F2U A;  4NMZ A;  3ERQ A;  2KCT A;  2Z6B A;  1SBB B;  1WTR A;  2K14 A;  3P7J A;  3A56 A;  5DNF A;  5M3F G;  4LUZ A;  3NWT A;  1EUJ A;  2XWB B;  3NEM A;  2MFI A;  2JA8 H;  1Z9F A;  2EIF A;  4XYO A;  2L15 A;  2F4V L;  3RUZ A;  1WCM G;  3TEH B;  3AB9 A;  4YY3 L;  4EQ5 A;  1G2S A;  2EYL A;  2J0T D;  2N8N A;  3K5N A;  3HKZ B;  4HJ8 A;  3HOY H;  3PUV A;  4GNX C;  2QF7 A;  3KF8 A;  1SEB D;  1TU2 B;  2VB2 X;  2JA6 G;  3OTO Q;  2F0J A;  1A3U A;  1YVC A;  4ZAI A;  2K7V A;  1CM9 A;  3RR5 A;  1EZ8 A;  2UXC Q;  2K5W A;  1J5E L;  2NTS A;  2LFN A;  4N8X 1;  1TWG B;  5I6W A;  3QR8 A;  3M4O B;  1NR4 A;  5D65 A;  1UE7 A;  2DN8 A;  2CHB D;  4DR1 L;  4R9W A;  5LMN W;  5COY A;  1BVS A;  2EJM A;  1CFM A;  1PRT B;  3CKI B;  2M2L A;  1EIF A;  1PH2 A;  1AH9 A;  1SRU A;  4RHS A;  2ZT9 C;  1GHJ A;  3H09 A;  3NSW A;  2JA8 G;  4B3R L;  2H5X A;  3S1N H;  2B2V C;  4WFN 3;  4K5X A;  2UUA Q;  4JPB W;  2VUM B;  3EVQ A;  1AE3 A;  1RIP A;  1L1O C;  1SDF A;  1SMX A;  4JI5 Q;  3HOX H;  1FNU A;  4TSS A;  4FXK C;  3FP9 A;  2BDO A;  4FXG C;  4FF1 A;  1PFN A;  2F03 A;  3QIA A;  1NE3 A;  3KBG A;  1PTO H;  4A3G H;  2WKC A;  1PZJ D;  3Q6S A;  5CV4 A;  2K28 A;  4R8I A;  2JA9 A;  3CRK C;  4A3D H;  3DEP A;  5EPK A;  1WD1 A;  5CBE E;  1IBL Q;  1K3B C;  5C0X I;  2Q2I A;  3A8J E;  3CU7 A;  1D2B A;  4QIW E;  5GRO A;  4U68 A;  2WKD A;  1VQE A;  4YY3 Q;  3VR5 A;  1L2F A;  2IX3 A;  4GZY C;  5C3E B;  1JOQ A;  4ZRZ A;  1II3 A;  4JYA Q;  5J1Z A;  1XYI A;  4BXX G;  1SYF A;  2JEA I;  3K7A B;  4RWS C;  5KRU A;  1F77 A;  3HEJ A;  2N78 A;  3PCO B;  2A6H D;  2RBM A;  4FF3 A;  3VA7 A;  2K01 A;  2UU9 L;  4HJA A;  4DAY B;  5C6A A;  1X54 A;  5KNC A;  2EYJ A;  4L5R C;  5T1I A;  3M7N A;  1C4Q A;  1DJR D;  5E4X A;  1JB7 A;  1J5E Q;  1WTV A;  2QKI C;  4PZ6 A;  2E5L Q;  2A6H C;  3A7L A;  3AMU A;  3CC7 A;  1RTO A;  2CW0 D;  1KAA A;  3BJU A;  4JI8 L;  1R9T B;  4FDB A;  2PQA B;  4LUO A;  1SMY D;  5IWA L;  4X6A H;  3CF5 A;  3S2H H;  4A75 A;  1XPR A;  3GTL B;  1I5F A;  3GP7 A;  4QCL A;  4C3I B;  2EYM A;  5IYD G;  4N9T A;  2RA4 A;  3J7Y W;  3CP0 A;  2F0U A;  1FGU A;  1WFQ A;  1X55 A;  3C2P A;  4K0K Q;  2E2D C;  5FKA C;  3T1Y L;  1W2B A;  4DR6 Q;  4DN4 M;  4NXN Q;  3R93 A;  4KY7 A;  2VL6 A;  1HNW Q;  5KEE A;  4V19 0;  4IFD G;  2KEN A;  1VMC A;  1S5F D;  4KN4 C;  4QGU A;  5IGF A;  1B2T A;  4DR5 L;  1WYD A;  1I3Q B;  5FO7 B;  1UEB A;  5JVH 3;  3URY A;  1ONL A;  1SE2 A;  1SRO A;  3GTK B;  3N6R A;  1GUS A;  1V43 A;  4GOP C;  1VQO A;  3QOJ A;  2B29 A;  4B3M L;  2VQE L;  1EQQ A;  4DNI A;  3NPP A;  4DXG A;  1VQJ A;  2YU9 H;  1D5Z C;  2UU9 Q;  2NTT A;  1LTB D;  1YI2 A;  1RD9 D;  5I2Y A;  1JWU D;  3I90 A;  1D1K A;  3DM3 A;  1B44 D;  2WP8 J;  2WB1 B;  4DF7 A;  2SDF A;  4YIJ A;  4BY7 H;  2N55 A;  3S2D B;  3V05 A;  2KHJ A;  5CGK A;  4HID A;  2CVR A;  3U4Z A;  1PH4 A;  1BKB A;  1STH A;  3PUX A;  3QG1 A;  4X3S A;  3K58 A;  3C1E A;  1X56 A;  2CWP A;  4JI8 Q;  4B9W A;  1DOK A;  1TWA H;  4K6L A;  2OEO A;  1YHB A;  1PRT D;  1LAB A;  3P75 A;  1RJT A;  4WRD A;  2FHT A;  3HOZ G;  4G57 A;  2YTY A;  5IWA Q;  3HOV H;  4LFB L;  5CV7 A;  3GTO B;  1PH3 A;  3CCL A;  1G51 A;  4A3M G;  1HZA A;  1HNX Q;  2B2W C;  3BDL A;  1PH9 A;  2AKW B;  1E2W A;  1ENC A;  1EWC A;  5I9P A;  4A3B G;  1WVL A;  3CCJ A;  1PRT C;  1Y1V G;  1KHI A;  5AJ3 Q;  1FNW A;  4IAL A;  3NBH A;  3G6J B;  1K3R A;  2F1M A;  1ZYR D;  3EIV A;  2F0M A;  2NVY B;  1K8A C;  3J7A 5;  1G6P A;  4WJ3 M;  2TMP A;  4YWK A;  4AYB E;  4OO1 G;  3NXW A;  5IGG A;  3HOU B;  1X3F A;  1MKH A;  5KNB A;  1QNK A;  1LT3 D;  4IQZ A;  1MBY A;  3KBX A;  2K6A A;  1ZYR C;  2YV5 A;  2NBF A;  4XYQ A;  2L55 A;  4BBR G;  1STY A;  2ICI A;  5EKK A;  4H44 C;  1QE6 A;  2Z6K A;  3CCR A;  4JI6 Q;  3NQI A;  4B3S L;  5FJ8 G;  2LS0 1;  4PZ8 A;  4RKL A;  1FGB D;  4X65 L;  1SE3 A;  2EY1 A;  1Z47 A;  4BS9 A;  2QDL A;  1P8L A;  4A3F G;  3TS2 A;  2A6E C;  4X64 Q;  5FO9 B;  2VQE Q;  1XNR L;  4IPG A;  2XN9 C;  1FL0 A;  1XTD A;  1UAP A;  2EY5 A;  2CH4 A;  4JI2 L;  5BN3 A;  3T4A C;  4CKB A;  1STG A;  2QW7 A;  1BBX C;  5ELC A;  1PYW D;  2F52 A;  1PFS A;  1HZC A;  4A4I A;  4YCU A;  1HFG A;  3K5M A;  4GN3 B;  4ZCK A;  4Q5V A;  3U50 C;  2F4I A;  2RVL A;  4A3I H;  1MSH A;  4DV1 L;  1KLG D;  2IW3 A;  1DXM A;  2SNM A;  2ZXR A;  3QJY A;  2BDN A;  4ILW A;  1ICW A;  4IPD A;  5ELB A;  4XT1 B;  3CW2 C;  1ENF A;  1LT5 D;  5EGT A;  2JSO A;  4LF9 Q;  1S5E D;  1TWH H;  2KBN A;  3ONA B;  3MWY W;  3GTJ H;  3FVQ A;  1TS3 A;  4A3C H;  1D6E C;  2N88 A;  5EBC A;  4P2C B;  1TKW B;  2J7Z A;  2EYF A;  2I46 A;  3R2T A;  4YHH L;  4ULL A;  5KGU A;  1RTN A;  4IN3 A;  1SXT A;  2KA7 A;  2B2Y A;  1CKM A;  1P16 A;  3T13 A;  5C44 B;  1VQB A;  1MGS A;  2NVX H;  3GTG B;  3C1F A;  1S72 A;  3TN2 A;  1BUV T;  1PH6 A;  1Z7T A;  2ZTD A;  3I7F A;  1XMQ L;  2KED A;  1WTW A;  4BY1 B;  1SYD A;  4TKO B;  3SVM A;  1YIT A;  2AWN A;  3GTM B;  5JJK A;  1EYC A;  4JI1 L;  1OXT A;  2EYH A; 
#chains in the Genus database with same CATH homology
 2TSS A;  1ZXT A;  5E1F A;  4DNT B;  3RZO B;  4K8I A;  2R6G A;  2XSC A;  3V2T A;  3E0J A;  2E2H B;  4DA2 A;  1AW7 A;  4FXD A;  3GTP B;  4HTH A;  4RCO A;  2R93 B;  4DAY A;  4MIU A;  2H4O A;  2YYZ A;  4XDX A;  3OOC A;  1F2Y A;  2YU9 B;  4PQX A;  2BOS A;  1A3T A;  4DNR B;  5JEA G;  2B8G A;  3DWQ A;  4BA2 I;  5M5X B;  2WAC A;  1EIG A;  2FMC A;  1EYD A;  1ZEQ X;  3FPU B;  1FD7 D;  3NK9 A;  1HQR D;  2A73 B;  3KK7 A;  5T1G A;  1SAP A;  3OHX C;  2FIN B;  3BZD B;  4PMC A;  4C3H B;  3T53 B;  1F9S A;  3VR6 A;  5IGE A;  4PMW A;  3NWS A;  1EEI D;  3QOL A;  1YNJ D;  5A2Q E;  1PTO F;  3MZ5 A;  2JA5 B;  2A69 C;  1D1I A;  1RHP A;  1EU3 A;  4FNF A;  3MC0 B;  5C4H A;  2Z4H A;  3P1H A;  1Q1E A;  1YNJ C;  3PO2 B;  2ZXP A;  1BXT A;  1TQO A;  3LX0 A;  3A8K E;  4F88 A;  3S17 B;  2R92 B;  5E4W C;  3ND8 A;  1A15 A;  1AZP A;  3R2I A;  3W2D A;  1LLR D;  2AQ3 B;  5F2D A;  1G6Z A;  2E2J B;  1CI3 M;  4KKT A;  3M3Y B;  3NHH A;  1U9R A;  1TS2 A;  3AU7 A;  3D6W A;  1JE4 A;  1CA6 A;  4UAI A;  4ID6 A;  1SJE D;  1S5D D;  3FDT A;  1DZ1 A;  1LT4 D;  4QMG A;  2PZT A;  2F3V A;  5I4D A;  4KTA A;  2KCC A;  1TS4 A;  2OT2 A;  4LAA A;  2VNU D;  1U4R A;  2NUC A;  1I4X A;  3M85 A;  1M4V A;  1RCV D;  3CRL C;  3OPO A;  3I73 A;  2SOB A;  2MGS A;  2C9O A;  2EPB A;  5EKI A;  4G4K A;  1EY5 A;  1GJX A;  2B2T A;  4E6I A;  4KD4 A;  2XWJ B;  2E74 C;  3I4M B;  3S16 B;  1UNS A;  2JP1 A;  4L8J A;  3BDO A;  5CV6 A;  3FEW X;  1EQV A;  4WJW A;  2F0F A;  2JE6 I;  3DMU A;  5CC4 A;  2BE5 D;  2XRQ D;  4XQN A;  1STA A;  1TT2 A;  1E0B A;  5AFW A;  3IAY A;  1OXV A;  2LKV A;  4FF2 A;  4OL7 A;  5LL6 S;  3TZD A;  4A3J B;  4K14 A;  4KK7 A;  3HP3 A;  1O80 A;  2PCF B;  1QOH A;  5EPL A;  3Q24 A;  5J39 A;  4B08 A;  2PO4 A;  1SYE A;  2Z1C A;  1ILQ A;  3PIP 3;  5E3F A;  1O7Z A;  4F7X A;  1VF5 C;  2EJF C;  2K33 A;  3T16 A;  4A3K B;  3S15 B;  3D31 A;  1Y69 U;  3O13 A;  4XT3 B;  3CHB D;  3E5S A;  1S5B D;  3ZYY X;  1SND A;  1AN8 A;  1EY9 A;  1STN A;  1A2U A;  5D3I B;  2GA4 B;  1WTQ A;  4NKL A;  3MEH A;  4IZ8 A;  2B8F A;  3DEO A;  4X3U A;  1G29 1;  1HQM C;  1Y8O B;  1TR5 A;  1PLF A;  5K5P A;  2XRS D;  2O5J C;  2E2I B;  1TY0 A;  1B53 A;  5EBD A;  1LTT D;  2LMC B;  3D3R A;  3H91 A;  5DAU A;  1R4P B;  1ILP A;  1HA5 A;  2M9V A;  1L0Y B;  5FOB B;  3MXP A;  3BYT B;  5BN4 A;  4K5V A;  2A68 D;  2PZU A;  1PMR A;  4LJZ C;  3L7Z C;  2A68 C;  4C2M B;  2KJX A;  5C0X H;  1FYC A;  4K8J A;  1T5E A;  5EJW A;  1EOT A;  1V1O A;  1XWE A;  1WTP A;  4ZUJ A;  1HTP A;  5M3M B;  1BCP C;  1HA6 A;  1V1P A;  2NB0 A;  1G2T A;  2AQ1 B;  4KMU C;  2J4X A;  2NWG A;  2SEB D;  4S3S A;  4HCE A;  3NBI A;  4BWG B;  1ESF A;  2NVT B;  5COR A;  5FLX L;  4HR7 B;  1EY8 A;  3BVG A;  5M5Y B;  4DK1 A;  4HMI A;  1CTM A;  2D62 A;  3PIO 3;  1IKM A;  2B2V A;  2EY2 A;  2L1B A;  5ELE A;  2DNC A;  2O2L D;  3M4Y A;  2PYK A;  4HAE A;  3BVM A;  1OXS C;  4OIJ A;  2F0H A;  3P20 A;  4CJ2 C;  1AZQ A;  3SEB A;  1VCI A;  4G7Z C;  1RKN A;  4XQJ A;  4XTC S;  5M3F B;  2IJ0 A;  5D3D A;  1SSO A;  2E76 C;  2D5D A;  2K5Q A;  2AQ2 B;  1WCM B;  2K5D A;  4QF4 A;  2MPM A;  1D5X C;  3HG9 A;  1AEX A;  5K36 H;  3HOW B;  3FRP B;  3OMG A;  1KNA A;  3D4D A;  3GTG B;  4WOR A;  5JPN C;  3PUW A;  4DAP A;  2KOL A;  2I07 B;  1IW7 D;  1PRT F;  1ZKO A;  3S1R B;  3M7G A;  4OIK A;  4PNY A;  2L12 A;  1B4O A;  3S14 B;  3GTQ B;  2EJG C;  1WD0 A;  3VA5 A;  1IYV A;  3SDZ A;  1IW7 C;  2L11 A;  3LWE A;  2IL8 A;  5ELD A;  3H3V C;  4CJ0 B;  5DM6 3;  1GUG A;  3OWF A;  5G3L D;  1S5C D;  3I70 A;  3C46 A;  1LV9 A;  2JXM B;  3FPP A;  4OO1 I;  3NTI A;  1OXU A;  4K6D A;  1SYC A;  4X3K A;  1HFN A;  1SNO A;  2RKS A;  2NN6 I;  4KV6 A;  1B9N A;  2EY6 A;  4QB4 A;  4OGQ C;  4EGV A;  4RAU C;  1D5M C;  3TBI B;  5I9O A;  2A6E D;  4G7O C;  1EFI D;  3Q23 A;  1Q12 A;  2FFK B;  4NDX A;  4Z9C B;  1QJO A;  3D4R A;  1C8C A;  4XIG S;  3KUP A;  2KEE A;  2X69 A;  1U4P A;  5HUR A;  1GUW A;  2B2Y C;  1EZ6 A;  5J22 A;  5EQ0 A;  5IIF A;  5M9O A;  3I3C A;  4IUP A;  1NUC A;  2IT1 A;  3EA6 A;  1H9S B;  3TP8 A;  1L0X B;  3RMH A;  4HCS A;  2HCI A;  3Q0A A;  3MXG A;  4RCN A;  5KYI A;  1BQQ T;  3X3N A;  3NUC A;  4BA1 I;  3MAQ A;  1HUM A;  3PMF A;  2WIN B;  1NCV A;  1EY4 A;  3T56 B;  1DM0 B;  2FMM A;  3I91 A;  2X6L A;  1IHZ A;  5C5L A;  3OW7 A;  4ZKC B;  1R4Q B;  2PNR C;  4V0B A;  3WOE A;  4I7Z C;  2PPB C;  2F0W A;  3U9S A;  2PW5 A;  2K32 A;  1KDA A;  3WOF A;  3ERO A;  3DXJ C;  2NYZ D;  5C4J B;  1LO5 D;  2JA7 B;  1JC7 A;  4RA8 A;  1BDO A;  2D9U A;  5IOD A;  2R61 A;  4RGO S;  2BA1 A;  1Q1B A;  4FF4 A;  1EEF D;  5ISR A;  4RH6 A;  3MHB A;  4IUU A;  1IKL A;  1E2V A;  4ZQ3 A;  1JQY D;  5TSS A;  3HOZ B;  1ET9 A;  2HCC A;  1ENA A;  4MN3 A;  3S1M B;  4KY6 A;  4A3B B;  3S9W A;  2XVS A;  1GHK A;  3SR1 A;  3VR3 A;  5C5M A;  2K05 A;  3OWE B;  3VYT A;  2A69 D;  4Q0F A;  1DON A;  4C3J G;  1IL8 A;  4H0L C;  4L63 B;  3SK4 A;  1SE4 A;  2ID0 A;  5JVG 3;  1Y8N B;  2KQ3 A;  1GUN A;  1JOO A;  1O78 A;  4FO2 A;  4KKU A;  4O1N A;  5EKL A;  4K5W A;  1NAP A;  2PW7 A;  1SNP A;  4A3F B;  1GXD C;  1F9Q A;  1EL0 A;  1TS5 A;  1GUO A;  1H9M A;  3PUY A;  2AUK A;  2PZW A;  3I4L A;  4OHJ A;  4F87 A;  2B2T C;  1BR9 A;  2M00 A;  2SNS A;  5C4Z A;  1PFM A;  2OXP A;  1HRJ A;  1CZW A;  4KJN A;  1JWM D;  1XTC D;  1PTO C;  1CQV A;  2RSN A;  4KHV A;  1EU4 A;  2G9D A;  2VB3 X;  4DK0 A;  1WTO A;  2EYP A;  3QO2 A;  1BCP B;  2F0N A;  2EZV A;  4IFD J;  1NSN S;  3IFT A;  3K6O A;  3BVZ A;  2BA0 A;  2E75 C;  4HED A;  3TZU A;  3TME A;  1SYG A;  3TP6 A;  5JAV A;  3C3L A;  2IWH A;  5HGT A;  3RZD B;  1LTA D;  3K5O A;  4IUR A;  4TRD A;  4J8Q A;  2JYO A;  1BF4 A;  2JEB I;  4ME5 A;  1EY0 A;  2LY7 A;  1YNN D;  1SNC A;  3J7A F;  4CBV A;  1I4R A;  1B1Z A;  1JOK A;  1Y8P B;  1LAC A;  1I4G A;  3H0G B;  3RD4 A;  1YNN C;  1Z6H A;  2R7Z B;  1K8O A;  1B9M A;  3NP8 A;  1LTS D;  1B50 A;  4EQP A;  1B3A A;  3IFD A;  3K59 A;  2RSO A;  1F9P A;  4H7B A;  3IKJ A;  1GUT A;  2B2U A;  2VXW A;  4FVM A;  4B9X A;  2RDH A;  1I6H B;  4RGM A;  2F0E A;  2WAQ B;  1BOS A;  2HUG A;  2F0K A;  5LHY 1;  1EIH A;  3JAM L;  3J81 L;  4C3I G;  4C1N I;  1VF7 A;  1STB A;  4F8M A;  3PUZ A;  1PXU A;  2KEC A;  4JK1 C;  3Q22 A;  1RDP D;  3GD7 A;  4EQO A;  3QB3 A;  1CK1 A;  3BG3 A;  4A93 B;  5CV8 A;  4HN7 A;  4RKB A;  1VDZ A;  4J6H A;  1X32 A;  4HMJ A;  3OMC A;  1Q90 A;  4X3T A;  4ZK9 B;  1F2M A;  3NE5 B;  3N52 A;  2HDL A;  1Q8I A;  5FO8 B;  2KVM A;  1MSG A;  3HGB A;  1Y1W B;  1IYU A;  1W6K A;  1BCP F;  1QNU A;  4PV1 C;  5I6Y A;  1XXG A;  2B39 A;  5IT9 E;  2B63 B;  1A6X A;  2A74 C;  4FYD A;  3UI2 A;  4IUQ A;  2Z4I A;  5FLX E;  3BS1 A;  5CYU A;  4Y7N B;  5M5W B;  1H9K A;  2HQE A;  1JIC A;  3OSO A;  3I4N B;  5ELF A;  1PFB A;  1BCP D;  3MFG A;  2WV6 D;  3S1Q B;  1CHP D;  3RLF A;  3G7L A;  1TWF B;  4ZLT F;  3K0Y A;  3ND9 A;  3QWN A;  4KY5 A;  2F0I A;  3E6Z X;  1NR2 A;  1KLU D;  5CR3 A;  5IT9 L;  3PO3 B;  2QIL A;  1OXX K;  2H1E A;  3MA2 B;  3BDC A;  4IUV A;  3PV0 A;  4A3E B;  1J8I A;  5C0X G;  3A54 A;  3A8I E;  5C4X B;  3I72 A;  5JEA J;  4XXE A;  2F0V A;  4ZUI A;  4MHE A;  3T51 B;  4IFD H;  4O42 A;  4DFA A;  1K8M A;  4BBS B;  2MHV A;  3FKI B;  1TWC B;  1H9J A;  4C56 C;  4IFD I;  2Q8I B;  3SK8 A;  4QUF A;  4N9P A;  1G8Z D;  1MI2 A;  4UDU C;  2CW0 C;  2F0T A;  3NTH A;  1SFO B;  2F0O A;  2O4X A;  4KN7 C;  4QIW B;  2F0P A;  2MP1 A;  2X6G A;  2Q8T A;  5JJZ A;  4RGT A;  1SMY C;  1Q3L A;  4M1U B;  2O5I C;  4DGZ A;  2JA6 B;  3W3A A;  2Q8R E;  3EQL C;  2EOT A;  4C1N K;  1JB3 A;  4IUN A;  1I6V C;  5G3L F;  1PDQ A;  2NVQ B;  2L9H A;  4ZKB B;  2ENB A;  1EY7 A;  1FR3 A;  2L5T A;  3EFX D;  3HS0 C;  1HTL D;  2JA8 B;  4R8N A;  3NQT A;  4OO1 H;  4NP5 A;  2EXZ A;  1V8Q A;  3K5L A;  2G9H D;  1A3V A;  1LT6 D;  2A5H A;  2KHS A;  2NN6 H;  2QCP X;  3HOY B;  5K36 G;  5IGD A;  3VR2 A;  1EY6 A;  5DEH A;  1QG7 A;  1PZK D;  2AUJ D;  3FMC A;  4L6T B;  3MTS A;  4LK1 C;  1O7Y A;  2XIW A;  2EVB A;  1TII D;  2K03 A;  2C5C A;  2EDG A;  1JCK B;  1ML0 D;  2EYO A;  2F0G A;  1I4P A;  2L0C A;  5KND A;  1UUP A;  3D6C A;  3IL8 A;  2QEJ C;  3S1N B;  1CZG A;  3OIP A;  4C3H G;  3VYR A;  4K2K A;  3TSS A;  3L3O C;  2KCN A;  1XX8 A;  2NN6 G;  2EE1 A;  1DCZ A;  3HOX B;  1SNM A;  1EYA A;  3MXN A;  4XQQ A;  4KKS A;  2KUM A;  4NW2 A;  4I65 A;  1PTO B;  5NUC A;  2PQE A;  4A3G B;  1CT1 D;  3SK6 A;  2XNA C;  4A3D B;  1CHQ D;  3VR4 A;  2V4D A;  5CV5 A;  5IOC A;  3A7A B;  1STE A;  2B2W A;  4ODG A;  3H6M A;  1CQF A;  1KAB A;  4U67 3;  5JPM C;  4K2L A;  3TP7 A;  1U4L A;  3MFY A;  4HSP A;  4AYB B;  4EQN A;  2IPK D;  3DWP A;  1T5X D;  5C3X A;  3SK5 A;  2WII B;  2ZXO A;  3I8Z A;  3KLS X;  3H94 A;  5IGC A;  2NZ1 D;  3DUZ A;  5DM7 3;  4DAV A;  3GV6 A;  3J7A V;  1KDB A;  3GO5 A;  4DXF A;  1S4Z A;  1KDC A;  1O7L A;  3K57 A;  2F0Q A;  3S2H B;  3OIQ A;  2DNE A;  1LTI D;  4ABN A;  4RHR A;  4CJ1 B;  5JEA H;  1FNV A;  3DWA A;  1TVX A;  1X3P A;  2RDF A;  3D8G A;  5BN5 A;  1QWY A;  2Z8L A;  5D14 A;  1F2Z A;  1QCB D;  3A55 A;  3LNN A;  4CHT B;  4FP5 D;  4A3M B;  5C3W A;  5CV9 A;  3R8B A;  3WDN A;  2OF1 A;  4M8A A;  1Y1V B;  4EVO A;  1I50 B;  3CQZ B;  1H9R A;  1KTK A;  1A2T A;  5A35 A;  2L4N A;  2MUY A;  2RQX A;  2AWO A;  1TY2 A;  4QUC A;  1QB5 D;  4KHZ A;  4TQU S;  1F9R A;  4HSV A;  3VYU A;  1KNE A;  4BBR B;  2K1B A;  4BY7 B;  2PMZ B;  1DOL A;  3DM1 A;  1I4H A;  1TWA B;  1GOZ A;  4KD3 A;  2QDB A;  3HOV B;  3L9A X;  3EJI A;  1V1P B;  1ET6 A;  1X3Q A;  2DY7 A;  1UEA B;  4IUT A;  1SYB A;  1F2L A;  2F3W A;  3TP5 A;  1ROD A;  5IGB A;  1EWH A;  2K04 A;  2ICE C;  3V96 A;  5C0X J;  3D4W A;  3LWU A;  3SE0 A;  1JOR A;  1M8A A;  1LTR D;  3NTK A;  3J80 E;  1PTO D;  5FK9 C;  3MVV A;  3SHL A;  3VYS A;  1I4Q A;  2R3Z A;  5CBA E;  1C48 A;  1HPC A;  3HZX A;  3KLS A;  1HXY D;  3HRZ C;  3TDQ A;  5A2Q L;  2IX0 A;  4J1M A;  1JR0 D;  1U4M A;  2CQA A;  4H13 C;  3GQB A;  1W6J A;  2BCO A;  3DHQ A;  5EPJ A;  4KJO A;  1WTX A;  2MJ8 A;  1MD2 D;  3ITP A;  3R3O A;  2B2U C;  4RGN A;  3J80 L;  1G91 A;  1EQT A;  4A3I B;  2F0S A;  4JBW A;  2F0L A;  1ESR A;  1HHV A;  2F0D A;  1K83 B;  1BO0 A;  3X3M A;  4CKC A;  3SXH A;  5LL6 X;  3GV3 A;  1HCZ A;  1TWH B;  1QIL A;  4CKE A;  3GTJ B;  2Y0S B;  1HUN A;  1CA5 A;  1VMP A;  5CMD A;  3MXU A;  5JOB A;  1DOM A;  5KIX A;  3JAM E;  2DY8 A;  1PZI D;  1J9O A;  2FJ2 A;  1E2Z A;  3J81 E;  4DU9 A;  2NVX B;  4KI0 A;  1RF2 D;  1H9S A;  4G7H C;  1AP0 A;  1SJH D;  3U9O A;  4CGY B;  4LMQ D;  4PMB A;  4C3J B;  1SNQ A;  1BNZ A;  2HDM A;  2D2C C;  1LTG D;  1DD2 A;  1DYQ A;  2BE5 C;  5I2X A;  3KLR A;  2RDG A;  5KYL A;  4RFB A;  3BYY B;  1OO9 B;  1JWS D;  2IX1 A;  1AFP A;  4ZYS A;  3F2U A;  4NMZ A;  3ERQ A;  1SBB B;  1WTR A;  5DNF A;  3P7J A;  3A56 A;  3NWT A;  2XWB B;  4XYO A;  3RUZ A;  3AB9 A;  1G2S A;  2EYL A;  2J0T D;  3K5N A;  3HKZ B;  3PUV A;  2QF7 A;  3KF8 A;  1SEB D;  1TU2 B;  2VB2 X;  2F0J A;  1A3U A;  4ZAI A;  2K7V A;  1CM9 A;  1EZ8 A;  2K5W A;  2NTS A;  2LFN A;  1TWG B;  5I6W A;  3M4O B;  1NR4 A;  5D65 A;  2DN8 A;  2CHB D;  4R9W A;  5COY A;  2EJM A;  1CFM A;  1PRT B;  3CKI B;  2M2L A;  4RHS A;  2ZT9 C;  1GHJ A;  3H09 A;  3NSW A;  2B2V C;  4WFN 3;  4K5X A;  2VUM B;  3EVQ A;  1SDF A;  1FNU A;  4TSS A;  4FXK C;  2BDO A;  4FXG C;  4FF1 A;  1PFN A;  2F03 A;  3QIA A;  3KBG A;  1PTO H;  2WKC A;  1PZJ D;  3Q6S A;  5CV4 A;  2K28 A;  4R8I A;  3CRK C;  3DEP A;  5EPK A;  1WD1 A;  5CBE E;  5C0X I;  3A8J E;  1D2B A;  3CU7 A;  4U68 A;  2WKD A;  3VR5 A;  2IX3 A;  4GZY C;  5C3E B;  1JOQ A;  4ZRZ A;  1II3 A;  5J1Z A;  1XYI A;  1SYF A;  2JEA I;  3K7A B;  4RWS C;  5KRU A;  1F77 A;  3HEJ A;  2A6H D;  2RBM A;  4FF3 A;  3VA7 A;  2K01 A;  5C6A A;  5KNC A;  2EYJ A;  5T1I A;  3M7N A;  1C4Q A;  1DJR D;  5E4X A;  1WTV A;  2QKI C;  2A6H C;  3A7L A;  3AMU A;  1RTO A;  2CW0 D;  1KAA A;  1R9T B;  1SMY D;  3GTL B;  4QCL A;  3GP7 A;  4C3I B;  2EYM A;  4N9T A;  2RA4 A;  3J7Y W;  2F0U A;  3C2P A;  2E2D C;  5FKA C;  4DN4 M;  3R93 A;  4KY7 A;  5KEE A;  4V19 0;  4IFD G;  1VMC A;  1S5F D;  4KN4 C;  5IGF A;  1B2T A;  1I3Q B;  5FO7 B;  5JVH 3;  3URY A;  1ONL A;  1SE2 A;  3GTK B;  3N6R A;  1GUS A;  1V43 A;  3QOJ A;  3NPP A;  4DXG A;  1D5Z C;  2NTT A;  1LTB D;  1RD9 D;  5I2Y A;  1JWU D;  3I90 A;  1D1K A;  1B44 D;  2WP8 J;  2WB1 B;  4DF7 A;  2SDF A;  4YIJ A;  2N55 A;  3S2D B;  3V05 A;  5CGK A;  2CVR A;  4X3S A;  1STH A;  3PUX A;  3QG1 A;  3K58 A;  3C1E A;  4B9W A;  1DOK A;  4K6L A;  2OEO A;  1PRT D;  1LAB A;  3P75 A;  1RJT A;  4WRD A;  2FHT A;  4G57 A;  5CV7 A;  3GTO B;  2B2W C;  3BDL A;  1E2W A;  1ENC A;  1EWC A;  5I9P A;  1WVL A;  1PRT C;  1FNW A;  4IAL A;  3NBH A;  3G6J B;  2F1M A;  1ZYR D;  2F0M A;  2NVY B;  2TMP A;  4OO1 G;  3NXW A;  5IGG A;  3HOU B;  5KNB A;  1QNK A;  1LT3 D;  4IQZ A;  1MBY A;  3KBX A;  2K6A A;  1ZYR C;  2NBF A;  4XYQ A;  2L55 A;  1STY A;  2ICI A;  5EKK A;  4H44 C;  1QE6 A;  3NQI A;  2LS0 1;  4RKL A;  1FGB D;  1SE3 A;  2EY1 A;  1Z47 A;  4BS9 A;  2A6E C;  5FO9 B;  2XN9 C;  1UAP A;  2EY5 A;  5BN3 A;  3T4A C;  4CKB A;  1STG A;  1BBX C;  5ELC A;  1PYW D;  1HFG A;  3K5M A;  4Q5V A;  2F4I A;  2RVL A;  1MSH A;  1KLG D;  2IW3 A;  1DXM A;  2SNM A;  2ZXR A;  3QJY A;  2BDN A;  4ILW A;  1ICW A;  5ELB A;  4XT1 B;  1ENF A;  1LT5 D;  5EGT A;  2JSO A;  1S5E D;  3ONA B;  3MWY W;  3FVQ A;  1TS3 A;  1D6E C;  2N88 A;  5EBC A;  4P2C B;  1TKW B;  2J7Z A;  2EYF A;  2I46 A;  3R2T A;  4ULL A;  5KGU A;  1RTN A;  4IN3 A;  1SXT A;  2KA7 A;  2B2Y A;  3T13 A;  5C44 B;  1MGS A;  3C1F A;  3TN2 A;  1BUV T;  1Z7T A;  2KED A;  1WTW A;  4BY1 B;  1SYD A;  4TKO B;  3SVM A;  2AWN A;  3GTM B;  1EYC A;  1OXT A;  2EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...