4OL7A

Crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 39
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ol7A00
2EYHA 2PQEA 2EY1A 5C4ZA 2EYOA 3MHBA 4KJNA 4J6HA 5C5MA 1II3A 1SNPA 3TP8A 4WORA 1EZ6A 5CV7A 5KRUA 1A2TA 2F0VA 2EY5A 2F0WA 3MZ5A 1KABA 4ID6A 4N9TA 1KDCA 3BDLA 5HGTA 1STNA 4K5WA 5NUCA 1TR5A 3EROA 4NDXA 5CV5A 2F0OA 4IZ8A 4EQPA 1EYCA 3NK9A 1A3VA 2PW5A 4QB4A 3NQTA 5IGBA 1EYDA 4ZUJA 2F0MA 3EVQA 3SR1A 1JOKA 3TP7A 2EYLA 3ERQA 1EY5A 3DHQA 5M9OA 3QOJA 5IGGA 2OXPA 2EYMA 4PMCA 1EY8A 1SNOA 4QMGA 4EVOA 4LAAA 4NKLA 5C3XA 2EY6A 4K8JA 4DU9A 2F0FA 2F0LA 2SOBA 3MXPA 1F2ZA 1EZ8A 1SYFA 3OWFA 3SHLA 3R3OA 3D6CA 3TP6A 4NMZA 4KJOA 2RKSA 5CV6A 3PMFA 3NXWA 1EY6A 4KTAA 1STHA 2WACA 3E5SA 2OEOA 1EQVA 4K5VA 1SNCA 2F0DA 5IODA 5KIXA 3S9WA 1SYCA 2EYJA 4K6DA 4KD4A 5CV9A 3T16A 3OSOA 5CGKA 5KYLA 2PYKA 4ME5A 5IOCA 5IIFA 3LX0A 1IHZA 3TMEA 3D4DA 4K8IA 5F2DA 5I6WA 3NP8A 4KY6A 4WRDA 2ENBA 2LKVA 2EYPA 2OF1A 4HMJA 5DEHA 3SXHA 5EGTA 2EXZA 2F0KA 3MVVA 4KY5A 3TP5A 4TRDA 2HQEA 5C3WA 5I9PA 2F0SA 3EJIA 4KD3A 1EYAA 3QB3A 4IUNA 1A3UA 4ZUIA 1RKNA 5EKLA 3V2TA 2PZWA 4YIJA 5ISRA 4K5XA 1F2YA 2RDFA 4QF4A 4DGZA 4DFAA 2F3WA 3H6MA 1F2MA 1A2UA 2PW7A 4B9WA 5I9OA 3MEHA 3NUCA 3P75A 4B9XA 1KAAA 1EY0A 2M00A 5IGFA 4OL7A 2KHSA 2F0IA 1STYA 3D4WA 2KQ3A 1SNQA 5CR3A 5KEEA 2SNMA 4MIUA 5E1FA 5IGCA 5C6AA 3U9OA 5E3FA 2F0JA 1KDBA 4ODGA 3RUZA 2F3VA 5K5PA 1SNMA 2F0HA 2PZTA 4J1MA 5JAVA 1NSNS 1KDAA 1EY7A 2QDBA 1TQOA 3OMGA 4KHVA 2SNSA 4R8NA 5CV4A 5C4HA 2F0PA 1EY9A 4NP5A 1JORA 1AEXA 2F0EA 4H7BA 4PNYA 4F7XA 5IGEA 2RBMA 2EYFA 2F0TA 3SK8A 1STGA 3ITPA 2O4XA 3D8GA 4KY7A 3C1EA 4K2LA 2F0QA 4K14A 3T13A 3HZXA 2F0GA 3DMUA 4PMBA 2PZUA 5DAUA 5C5LA 1STAA 1JOQA 5I6YA 4HMIA 4KV6A 5J39A 1NUCA 2NUCA 1SYEA 3NHHA 4HTHA 4RKBA 5J1ZA 4EQOA 5EKKA 4E6IA 1JOOA 4S3SA 5CV8A 3SK6A 5KGUA 5KYIA 3VA5A 1U9RA 1ENCA 1STBA 3HEJA 3P1HA 3QOLA 4G57A 1SNDA 1A3TA 3SK5A 5CC4A 4I65A 1TT2A 4F8MA 5J22A 3OMCA 1SYGA 1EY4A 3SK4A 4DF7A 4EQNA 1SYDA 2EY2A 5JOBA 1SYBA 3BDCA 5HURA 5IGDA 4RKLA 4K2KA 4N9PA 4ZQ3A 2F0NA 2F0UA 4IALA 1ENAA 3C1FA
chains in the Genus database with same CATH superfamily
4UPAA 3VR3A 2PQEA 1TWHB 1JQYD 3A8IE 1UEBA 3F1ZA 2AWOA 2JA7B 3BYTB 4HJ5A 1EZ6A 4F88A 2AUJD 3S1RB 2BDOA 3KYHC 3TREA 5C4XB 2HUGA 1Y1VH 1HA6A 5M9OA 2XRSD 5GADC 1WTVA 3RLFA 2Q8IB 2R7ZH 1CHQD 1VQMA 1UE1A 1VQFA 4LF7Q 4BY1H 3PO3G 4DU9A 4DV1L 4P74A 5A2QE 4AYBG 2R7ZB 1S3OA 3HKZB 3AEVA 1EYGA 4A3DG 1TIID 1M1KC 1S4ZA 1IHZA 4HMJA 2YU9B 1JICA 1ILQA 3FPPA 2AQ3B 1EYAA 5IYDH 3QB3A 5DLQE 5E4XA 3D6WA 1ASZA 1SFOH 2AMCB 2UU9Q 4UAIA 4L5RC 1KXLA 3HGBA 3U58A 3H6MA 4XQNA 4A75A 1BBWA 2JA5H 1UEAB 1SSOA 3D4WA 4DK1A 4MTKA 1BDOA 1YHBA 5E1FA 4LUOA 1XMQL 4XDXA 1QG7A 1WTQA 4A3FG 1ZKOA 1WFQA 2Z4IA 3H15A 1AEXA 3STBD 3FKIB 4YHHL 2MJ8A 3E0EA 2PMZE 4NXML 2ZXOA 1JOQA 4FP5D 1NUCA 1YHQA 3S1QH 4AYBE 4C2MH 2UUBQ 4A3GG 1X55A 1PH7A 4E6IA 2QEJC 2JEBI 4L8JA 2MQHA 3SK6A 2MNAA 2JJQA 2NVXB 3GO5A 3S1QB 1A3TA 1G6ZA 4C2MB 4XQQA 2HQLA 1YITA 3D31A 4DV2Q 1CSPA 1WD1A 1EEID 1XTDA 1PRTD 1WCMG 4EX5A 3CCVA 4DV3L 1HNXL 1TWCH 2IHFA 1RL2A 1G2TA 1VF5C 2B2WC 2UXBQ 1B8AA 3J80E 3GTJH 4IUQA 2CCZA 4P71A 3S1MB 3S2HB 5M5WB 2JP1A 2RDGA 4ZRZA 1IKLA 4QB4A 4PG3A 2ID0A 3QO2A 2F0MA 1T5XD 4JI7L 1EY5A 2MGSA 1VQAA 1OO9B 3SGIA 3U4VA 4ZKCB 3HOZH 1CKNB 1F2ZA 3TP6A 3SVMA 1IKMA 3D6CA 4UP7A 1KL9A 1RCVD 5FLXL 2I5HA 5KIXA 2MHVA 3KF6A 1HR0Q 2MO1A 3BZCA 2AWNA 4KD4A 3TDQA 1HTLD 5I6WA 4B3RL 4WRDA 1JCKB 4YWLA 1IL8A 3NWSA 1GXDC 2HQEA 5EQ0A 3V2TA 3K0XA 1QNUA 1LT4D 4K5XA 2ZM6Q 4GOPB 2HHHL 1DOMA 4JCVE 4O2DA 4NXNQ 1X3QA 1F2MA 3D3RA 4XQJA 1WJJA 4BXXG 1L0XB 3NQIA 4TQUS 5KEEA 1LYLA 3L2PA 3RZDB 3RMHA 2RQXA 4IJHA 5IYBH 1TQOA 2KCMA 2VW9A 1PZJD 3TZUA 2M2LA 3EN2A 3W3AA 1PH5A 4UP8A 4B3TL 3MEFA 4JI4Q 2EZVA 3OTOQ 1IBKQ 2ZXPA 5FJ8H 2OCEA 4YY3L 1IL2A 3H09A 2UUAQ 1X3GA 5E4WC 5KNBA 4DUZL 3Q0AA 1K8GA 3ICEA 1KNAA 2XTIA 3A55A 2A69D 1H95A 4JI6L 1D7QA 4F8MA 1I3QB 1UUPA 1R9TB 1V43A 3CQZB 2ZXRA 1JB3A 3I4LA 1O78A 4LFCL 4LFAL 4K6LA 2B2YA 2SDFA 5LMNW 4IOCA 1QVFA 1KD1C 4C3IH 2EYOA 4A3MG 2R92H 4LJZC 4R9WA 1E2WA 2OTJA 3K5OA 2KBNA 4PV1C 2I5MX 1YBYA 1DXMA 2B29A 3S24A 3TS2A 2R92B 1CZGA 5ELDA 2A6EC 2KEDA 2B2TC 4ZUJA 2R93G 1LV9A 1Q12A 4RCNA 4DR1Q 3L0OA 1BKBA 3J81L 2CWAA 4QMGA 3V05A 5IT9c 4A3IH 3BVGA 3DM1A 1Y69U 1N33Q 2HDLA 2SOBA 5I2XA 3AMUA 3NTIA 4IOAA 1YJWA 3BYYB 1Z7TA 2EYJA 4K6DA 1XTCD 3M4OB 1OXSC 1A63A 1E1OA 1LTSD 1W6JA 5F2DA 4OHJA 1BCPC 5DEHA 1I5FA 4IFDH 4DNRB 1H9RA 5C3WA 4BWGB 1X65A 5EKLA 4OO1I 1G6PA 3I70A 3ULJA 2E75C 2DJGC 2G9DA 5ISRA 2KOLA 3TZDA 3CCRA 4GNXB 1AZQA 1X3FA 1CQVA 2B2UC 2IHEA 1A2UA 3ULPA 1BBXC 4LF5Q 1SNQA 4XYOA 2SNMA 2XSCA 1KQSA 2R6GA 3GQBA 3CW2C 4BBRG 1KDBA 1J9OA 3RLOA 4KKSA 3K57A 3GTKB 4JI8Q 1RJTA 1KRSA 1KAWA 2YTVA 4R8NA 2XN9C 2ALYB 4BY7B 1KRTA 4A93B 3CPFA 1HPCA 1Q8KA 1OXXK 2ZT9C 2CHBD 3CF5A 2IW3A 4LF8L 3HOUG 1V1PB 1VS0A 2N55A 2UXDQ 2F4VL 2JA9A 1PRTB 4K0KL 3OOCA 2VZAA 5M3MB 1QNKA 3K7AH 1YNJC 1Y8PB 2KHJA 1O7ZA 4DR2Q 4KN7C 1HCZA 3A5ZB 2EY2A 4CDFC 2FMCA 4CHTB 3GTLH 2F0UA 4P73A 5KRUA 3C1FA 4A76A 4UY8C 1NTGA 3HFZB 4JYAQ 2BE5D 2ZTCA 1H9KA 4DXGA 1PFSA 4YCUA 3CCSA 4BY7G 2JA8H 1IBML 4A3CH 1VQ7A 1KDCA 3BDLA 1D5MC 2ZJPA 1Q81C 3M7NA 2JA6B 3NQTA 3I4NB 2KCTA 2CQAA 1EUJA 3HOXB 5LHY1 1YNNC 1D1IA 3KDFB 2EYMA 2MP1A 1H9SA 4PMCA 1GM5A 4DV5L 4DUYQ 4EVOA 5C0XH 1CA6A 4JI0L 1PH3A 1QE6A 5G3LF 1J8IA 3CC4A 2F0LA 4NMZA 2K28A 3PGZA 4ULLA 4DA2A 4JI3Q 3PIP3 4IJLA 1Q1EA 2F0DA 3M4QA 2L55A 5M3FH 1V1QA 1L2FA 3NP8A 4KY6A 3JAMi 3U9OA 1RF2D 2EYPA 2EJFC 2F0KA 2NN6I 3FVQA 2B63B 1VDZA 3DWAA 1FL0A 4QGUA 1DZ1A 3A0JA 2WB1E 4RHRA 4A3EH 4X65L 2JA6G 1EFWA 2N3SA 3GD7A 3PF4A 3HOVB 1L1OC 3NBHA 1DOLA 1HJPA 5HGQA 1QUQB 1C4QA 4XTCS 3PQIA 3VR6A 4GKJL 2F52A 5C6AA 2HIVA 1Q1BA 2A68C 2H5XA 2AQ2B 3WOFA 1PH8A 4J1MA 4DV0Q 4QIWE 2ZTDA 5CV4A 3I56A 1JWMD 2B2WA 4GN3B 1N34L 1PTOH 5LL6X 5BR8Q 1SJED 1LTGD 1WOCA 1T5EA 3PUWA 4ME3A 5J1ZA 1B1ZA 3MFYA 4I7ZC 3BU2A 4IURA 3NTHA 5KYIA 5JEAH 4JW0A 3P1HA 4DV7Q 3S15B 4OX9Q 4FXKC 3J7ZC 1B4OA 1SYGA 2XWJB 4DF7A 3OW7A 1S5ED 3I7FA 4H13C 4RKLA 4Z9CB 3K7UC 1CSQA 5ELFA 2B8GA 1YEZA 5M5YB 3M7GA 3AQQA 1X6OA 1ESFA 5CV7A 3SE0A 2E2JH 1GUGA 4X62Q 4C3HG 2A5HA 4CDEC 2PNHA 1ZYRC 4DV4Q 3PV0A 4N8X1 4J8QA 3K5MA 5LMUL 4EQPA 1EYCA 3SR1A 2VUMH 1JWUD 2JQOA 5ELNA 3PIOA 4A3BH 2YYZA 3HRZC 1K3RA 3MTSA 3H0GH 4N8FA 4RCOA 1N32L 1VQ8A 2VS1A 1F2LA 3HG9A 2B39A 4CBVA 4DV6Q 3R3OA 1WTRA 2Y0SG 4KJOA 1CKMA 3GTMB 4K5VA 2K32A 2OQ0A 3I2ZA 4PMWA 2D5DA 4ME5A 4A4IA 1XWEA 2VY3A 2IY5B 2L4NA 4NB3A 1E24A 5IT9E 2LXJA 5I9PA 2QA4A 1I4HA 2PPBC 1A3UA 4ZUIA 3UDIA 1LUZA 2DY7A 1JJCB 2A6HD 1FNUA 2AHOB 1MJCA 1E7ZA 2N49A 4GN4B 3I90A 4KKTA 1KIXA 4OL7A 3I4MH 5IYCH 1LABA 4GS3A 1VMCA 1HR0W 1O80A 4WJ3M 3F2DA 1DJRD 3HOWG 1N36L 2K7VA 3UDGA 3RD4A 2B2YC 1XX8A 1EQRA 2LS01 3I4MB 1SBBB 3ONAB 3J7YW 3OIPA 3DXJC 1CK1A 5IGEA 4U673 2I0QA 2Z0SA 1XXGA 1JC7A 3GV3A 1J6QA 5DM63 1GJXA 2PZUA 2E8GA 1EU4A 1A62A 4HCEA 2Y0SE 1K73C 4RGNA 4HTHA 2B2TA 1HZCA 2BA1A 1Q8IA 2E2HH 3HOYH 4JPBW 3J80i 3SDZA 1XNRQ 4OO1G 1LTID 1W2BA 1R4QB 5EPLA 1GVPA 1SNDA 4P72A 2CWPA 2EDGA 3GTQH 4CJ2C 2F1MA 1SXTA 1SYDA 4XT1B 5HURA 2UU9L 3TN2A 2DJFC 3G6JB 2EY5A 3K81C 1PMRA 4A3JB 1I94L 1EWCA 4WJ4A 3EIVA 3IFTA 3PO3H 1O7IA 3F8TA 2ZTEA 4HJ7A 4I7AA 2NTTA 2NVTB 2DGYA 4X3TA 1TWGB 1R4PB 2F0OA 2PMZB 1TWAH 3PO3B 2Q2IA 3RN5A 2B2UA 3K5NA 2FFKB 1EYDA 2PNRC 2TSSA 1XNQQ 1TWHH 1IYVA 4AYBB 1GD7A 1SNOA 4A3DB 2V1CC 1AN8A 3OWEB 3GP7A 3FPUB 2QGQA 3S1RH 5E7NA 4RAUC 3SHLA 1PYBA 3T51B 2UUBL 3FP9A 4PZ6A 5C4XH 3T1HQ 1EY6A 4KTAA 5IP7G 1STHA 4ALPA 1H9JA 3S16H 1SYCA 1F9RA 3KJOA 2PYKA 4A3JG 2F4IA 4DV2L 4OGQC 2CFMA 5G3LD 2K5VA 2VQFQ 1CHPD 1PTOC 1PZKD 3SEBA 3S16B 4RMFA 3CD6A 4DR6Q 5FLMH 2L5TA 4DGZA 2KECA 2D0PA 4A3FB 5I9OA 2E2IB 5KNCA 2CH4A 1I4XA 5CORA 2YU9H 1J5EQ 3W1GA 1C7YA 2OWOA 2LY7A 3ER0A 2IPKD 1EY9A 4A3GB 4H7BA 3PUYA 4O1NA 5C44G 4A3LH 2EYFA 4KY7A 2D2CC 1SE2A 2Q2HA 2F0QA 4BBSG 5C5LA 4KV6A 3I55A 3S1NB 2JXMB 2NN6G 1UE5A 2JE6I 4JBJA 2RHSB 1X3PA 2KVMA 3GTOB 1WCMB 3FKIH 3ZJYC 1QB5D 1Y1WG 2DNCA 5GQOA 1HQMC 3OMCA 3ULLA 3R8BA 1FNVA 1DGSA 2VXWA 1ENFA 1YHAA 2ZM6L 3BDCA 2Q8TA 2B3GA 1A15A 4IFDI 2RF4A 3RZOH 4HJAA 3FHWA 4RFBA 2NBFA 1CI3M 4ZYSA 2NVXH 1GKHA 1BQQT 3CRLC 1HUNA 2I5LX 2PQAA 2JYOA 1RTNA 3E9IA 3RZOB 1OXTA 3WWVA 4DKAC 2RCFA 1Y1VG 2QDLA 4AQYQ 5GROA 1FGBD 2PW5A 3E6ZX 3TP7A 2EYLA 3ERQA 1L1OA 4OWTB 4BY1G 1VQKA 3EQLC 4JI4L 2TMPA 3MXNB 3OTOL 4CJ1B 2EY6A 1IBKL 4K8JA 4GKKQ 3KLSA 1YIJA 3S1MH 3S2HH 1W6KA 5C4JB 2WKCA 2CQOA 2RKSA 5M5WH 3J81c 1HNWQ 4Y52H 4BXXH 1CZWA 1WTXA 1BUVT 2BH2A 2NVYB 5IOCA 4CJ0B 5D65A 4FF4A 2XRQD 3UE1A 3A7LA 4IQZA 4L63B 5IYDG 1XPRA 1S5BD 3MVVA 1K8AC 1E2VA 1Y8OB 3ND9A 3E0JA 1P8LA 2JA5G 1LM0A 4DV1Q 1VQJA 2PW7A 1D2BA 2CVRA 2M00A 5JVG3 2KJXA 1V1OA 1IXRA 4JBWA 4P75A 5FO9B 1SE3A 5IP9H 1I6HB 2H1EA 2R7FA 2PZTA 3WOEA 2E74C 1TY0A 2F0PA 2QCPX 3H91A 4LW1A 3M4PA 1I6VC 4B3ML 2Z4HA 4U68A 1JJ2A 1DONA 3C1EA 1CFMA 5FKAC 2F0GA 1GHJA 2K5NA 2RVLA 3C2PA 3S2DB 5C0XI 3RZDH 2K14A 3HP3A 4JI1L 4DR5Q 5CV8A 2X6GA 2Z6KC 3HEJA 2FHTA 4DK6C 2UXCQ 1FR3A 1YJ9A 3H94A 4JV5L 4A3MB 4FF1A 3MA2B 4CKCA 5CYUA 3T1YQ 4YHHQ 4LUVA 3I8ZA 1D1KA 4R8IA 1UWVA 4NXMQ 1TWFB 4GLXA 4LF5L 2R93B 1SNPA 1S5FD 4HCSA 1HQRD 2ATWA 1MD2D 2HCIA 1EIYB 3C46A 1SMYC 1A2TA 4OIKA 1I3QH 3IRBA 2IJ0A 1R9TH 2HIXA 5CBAE 1STNA 3AFQA 2PO4A 3CQZH 4EQ5A 1B9NA 3NK9A 3MAQA 5IGBA 4HN7A 1WTWA 3DHQA 1WTHA 1Q3LA 5FO8B 4LF6Q 4JI5Q 1H9MA 2VB3X 3E3XA 1NNXA 1MJEA 2UXDL 3IKJA 3E5SA 3ZYYX 1HTPA 2A74C 3DWPA 3LX0A 1ICFB 3IL8A 2VL6A 3CU7A 4B3SQ 3CAMA 4KLKA 3KDFA 4JI7Q 1ML0D 1HFGA 4IO9A 1UE7A 2RDHA 4BBRB 3F2CA 4YCWA 3B6YA 4JYAL 3M4OH 1IBLQ 3P75A 1E0BA 1SDFA 1D5ZC 1KNEA 5FLXE 2E76C 1TS4A 1QCBD 3HOUH 1KLGD 1QJOA 3CRKC 3A74A 3QJYA 1EU3A 2LSSA 4A3KG 4LFBL 3A5UA 3DWQA 3KF8A 1MBYA 4NP5A 3HOUB 4Q5VA 4DUYL 2F0TA 4C3JG 1EOVA 1STGA 2A8VA 1FJGQ 4FXGC 3Q24A 3GV6A 1GUSA 4DNIA 4DAYA 4ZAIA 4JI3L 1QUQA 1XMOL 3GTKH 3KF6B 5KGUA 4BY7H 1U9RA 5K36H 4A93H 5H1SE 4G57A 5CC4A 2WB1B 4ILWA 1D6EC 3F2UA 5J22A 1PFNA 3SK4A 1PH6A 2MFIA 5JJIA 3OIQA 5FO7B 1SYBA 4C3IG 3E9HA 2A6HC 1AZPA 2F03A 3QWNA 1G2SA 1I4RA 4R4IA 2NVQB 3MC0B 3A7AB 3KOJA 1KC8C 1NMFA 3BVZA 4DR7Q 4QIWB 1G91A 4YY3Q 5M3MH 1D8LA 4ID6A 3A56A 4KK7A 4CKEA 4DR4Q 4DUZQ 2QF7A 2XIWA 1LACA 1MKHA 1E22A 1TS5A 4YWKA 1NR4A 4A3IG 4LUZA 5IY0A 5IE8A 3CHBD 4M1UB 1TU2B 4X6AH 4BS9A 5C3XA 1HH2P 3VYTA 1EZ8A 2WB1G 1MIUA 2CKZB 3S17H 1DM0B 3A8KE 2JA6H 2Z9HA 3P20A 2E5LL 1SROA 4JBMA 3I4NH 4GOPC 4IUTA 3HOXH 1F9QA 4DV7L 2D9UA 4IFDG 1QOHA 3D4DA 4OX9L 1ESRA 2NZHA 5IWAQ 3S17B 3PCOB 2VQEQ 2LKVA 2OF1A 1RD9D 1IZ6A 3G6EA 3PF5A 5ELEA 2F0SA 1I4GA 2WAQG 3PO2G 4IUNA 4KI0A 4YIJA 2L9HA 2RDFA 3J81E 5EJWA 5LMNL 4QL5A 2F3WA 3NBIA 4B9WA 1YNXA 1JJGA 4X62L 1EIHA 3CC2A 2LMCB 4DV4L 3M4YA 2B63H 4ODGA 2Q2TA 1PHJA 2F3VA 1KDAA 3AFPA 5C4HA 1PZID 3PUZA 4X66L 2WIIB 3UDXA 3HOVH 1BOSA 4LF4L 5FOBB 1PFBA 4DV6L 3K6OA 1XPUA 4DXFA 1WTOA 4FF3A 4DPGA 2UUCQ 4UP9A 1MGSA 4JBKA 1EQTA 3VYRA 1TKWB 3VA5A 1YI2A 1Z47A 5GAGC 4KHPQ 2WAQE 1CUKA 1SE4A 1I50H 1U4LA 2I07B 3TSSA 2LFNA 4C3HB 1B3QA 4IALA 1F9PA 2EY1A 3RR5A 3LWEA 2K05A 4QUFA 2JA8G 4A3CG 4LF9L 1VQ6A 1RDPD 4HJ8A 1I50B 1RHPA 3S15H 2X69A 2XVSA 4DAPA 4Q0FA 1Q7YC 4JG2A 3FMCA 4TSSA 5NUCA 1TS2A 1S5CD 2FMMA 4XIGS 1Y14B 5AJ3Q 4K0KQ 2Y0SB 1DOKA 4JVZA 5M5YH 5C0XG 1VQOA 5IGGA 2OXPA 2J0TD 2XWBB 4C1NI 1B44D 2R7DA 2OQKA 1S72A 1N8RC 5JJZA 3S14B 3PMFA 2K50A 1A6XA 1E3PA 3JAML 1XNRL 1SNCA 3OYYA 1SMXA 2I46A 4JOIC 3T16A 3OSOA 3R2IA 4X64Q 2A6ED 4DK3C 1VF7A 2EXZA 2K5DA 3TP5A 1MI2A 1L0YB 1LTAD 2K75A 3STBC 4A3EG 3HOWB 2JN4A 3GTMH 4XYQA 2Z6KA 2NB0A 3AYHB 2EOTA 2B8FA 3G48A 1ET9A 2QW7A 2GVAA 4CDDC 1E2ZA 2CW0D 1BCPD 2FJ2A 1GOZA 4POGA 2SNSA 2NZOA 1I4PA 3SK8A 5I4DA 3TQYA 5CBEE 4DN4M 1U5KA 1H9SB 3AB9A 1PRTC 4L5SA 1YVCA 1X3EA 2KEEA 4CKBA 4RG1A 1Z6HA 2NUCA 1SYEA 2RCNA 3Q6SA 3TRZA 5JEAG 3J7AV 2HCCA 2BDNA 1FNWA 3UDFA 1QZHA 2VQFL 2IL8A 1VQCA 4O0AA 4CDCC 1NJIC 3JC66 1ASYA 3K80C 3L3OC 1LT3D 1HFNA 3PUXA 4DR3Q 3WDNA 1N34Q 5IGDA 1B7YB 4LF7L 1EIFA 2EYHA 4DNTB 5A2QL 3N52A 1EWIA 3K59A 4G4KA 2EIFA 3NBHB 3URYA 1J5EL 2F0VA 2F0WA 1KABA 4HJ9A 5IP7H 3L7ZC 1TR5A 2KCCA 4G7OC 2VUMG 4A3BG 2K5WA 4PQXA 1XJVA 1S40A 1YNJD 4Y7NH 5C3EG 1S5DD 3CCEA 4A3JH 1JOKA 3H0GG 3Q8DA 3VA7A 4ZLTF 1ONLA 5EBCA 4IPDA 1K8OA 1SLJA 1PA6A 4GZYC 4Y7NB 2NVTH 1GHKA 1BR9A 1TWGH 4B08A 1BBUA 4HSVA 2YV5A 3NXWA 1B2TA 4HIKA 2KA7A 1JE5A 3IFDA 5CV9A 4R4QA 5CGKA 1SJHD 1GO3E 3DM3A 3M3YB 4OXPA 4A3DH 5LMUQ 4EGVA 3U9SA 3TS0A 1PH9A 1YNND 1HXYD 1K83B 1N9WA 1YJNA 2K33A 2B2VC 1PH4A 3R93A 2A73B 2IWHA 3VYUA 4DAMA 1Q46A 4YCVA 3VYSA 1EY0A 1GUOA 5T1GA 2KHSA 4RA8A 3MWYW 4ABNA 5C44B 4MIUA 2NN6H 5GAHC 1E1TA 2WFWA 1NY4A 1KTKA 1TS3A 4BBSB 5FLXc 1NSNS 4KHVA 2A69C 3DUZA 3GDEA 4A3FH 2G5DA 4F7XA 3A8JE 3GTGB 2MPMA 1QVCA 2E2IH 1VQIA 3RN2A 3D8GA 4V190 2V4DA 1AE2A 4PMBA 1PXUA 1CKNA 5DAUA 1DYQA 3OW2A 1Y1WB 5I6YA 1HNWL 5EAYA 1X54A 3J80L 3HOYG 1NBWA 2UXBL 1C48A 2VB2X 3LNNA 3NHHA 5TSSA 1HRJA 1NE3A 3W1BA 1F9SA 1RTOA 4JC0A 5D14A 4DAVA 4A3GH 2A68D 1N36Q 1STBA 3FRPB 1P16A 5DM73 2L12A 2CH4W 3NSWA 1LTBD 1IW7D 2HDMA 3IAYA 4FXDA 2K52A 1IYJB 1EQQA 4R4OA 3S1NH 4GOPA 5GAEC 1AP0A 2N8NA 1Y1VB 1CKOA 1M90C 1K28A 4NPSA 4FO2A 3GTOH 1SN8A 1WCMH 5C5MA 4DK0A 3PUVA 1CA5A 1HR0L 3CCQA 4BY1B 2KENA 5BN3A 1QILA 4QY7A 4X3UA 3EROA 1EL0A 3T53B 4X3KA 1HNZQ 3KBGA 2JA7G 4JI2Q 5ELBA 5M5XH 4NXNL 4KHZA 2RSNA 4NKLA 5C4XG 5JJLA 1K0SA 4G7ZC 4PZ7A 1GUNA 1K9MC 5EPKA 1I94Q 1ICWA 5CV6A 1SFOB 3M9BA 4DR5L 3NWTA 1VQNA 2OEOA 2IX3A 1B70B 1I4QA 1ZYRD 5M5XB 1LT6D 1O7YA 3L9AX 2L11A 2UXCL 2JA5B 4K8IA 4YWMA 2K6AA 2L0CA 5EGTA 5FLMG 4TRDA 3EJIA 1STEA 3T1YL 2R7ZG 3VDYA 3HKZG 5C4JH 4BA2I 1QWYA 2PZWA 4XT3B 1VQPA 2FINB 1LO5D 4P2CB 1PYSB 1PLFA 1ILPA 2NVYH 5ELCA 1BCPB 3G4SA 5IGFA 1VMPA 3AU7A 3NPPA 2F0IA 1STYA 2UUAL 3CXCA 5CR3A 2K5HA 4LK1C 3W2DA 4X3SA 2D0OA 5K5PA 4A3LG 1VQDA 2IT1A 3LGJA 3MXGA 1SEBD 1IYUA 4PNYA 2F0EA 3RLNA 4FYDA 2DUDA 1WTPA 4LF6L 4JI5L 3J7A5 1VQBA 2FXQA 1VQHA 4IUUA 1C9OA 4ZCKA 3VR5A 1I6HH 4HSPA 2L1BA 2BE5C 3FKIG 1TWCB 1XPOA 3LWUA 3J81j 1JR0D 1JMCA 3H3VH 4B3SL 2PCFB 3GTJB 4BA1I 4J15A 2NTSA 4DR1L 4H44C 4RHSA 1EY4A 3I72A 2EVBA 3HKZE 3KBXA 3S2DH 3UI2A 4GNXA 4N9PA 1VCIA 3GTPH 4JOIA 1N33L 1IBLL 2WV6D 3BZDB 3K8AA 4KKUA 2ES2A 3MHBA 2ICIA 5DNFA 2N78A 3GTPB 1OTCA 1O7LA 1UE6A 4A3MH 3HOZB 4N9TA 2YTXA 4K5WA 1PYWD 1WI5A 3BDOA 2O5JC 1XMQQ 2WKDA 4FDBA 3QR8A 1NR2A 1EIGA 4POFA 1TWFH 3QOJA 4KMUC 1FGUA 2EJMA 1FJGL 2R93H 2GVBA 1PH2A 3CKIB 3KUPA 4QQBX 1MHWC 3BZKA 4WJWA 3J81i 1X56A 2PI2A 4UDUC 1V1PA 4IUPA 1SR3A 1JWSD 1EQVA 2Z1CA 1B50A 4OIJA 1G51A 1BXTA 2NYZD 1BO0A 4QUCA 2KCNA 3TMEA 4JI8L 1VQGA 5EKIA 5KNDA 4A3KH 5JVH3 4JK1C 1SE8A 4RH6A 2HT1A 2X6LA 3HOZG 4M8AA 5COYA 4C3JH 3KLRA 4CGYB 1K0RA 4DV3Q 4A3KB 1QVGA 3DLLA 4DR7L 4IPCA 1PH1A 1HNXQ 3MEHA 1X9NA 5EPJA 3CC7A 5IP9G 4QJFA 1OXVA 1HA5A 4DR4L 2PQAB 3NTKA 4C3JB 3OHXC 5IGCA 1K8MA 1X32A 1SNMA 1BVSA 2MO0A 3MFGA 1PTOD 3OMGA 5HY6A 4BBRH 2EXDA 4DR2L 3BVMA 1U4PA 1L1OB 2OT2A 3ITPA 1BCPF 1M4VA 3T13A 1WD0A 2HD3A 1ZXTA 1CT1D 3KLSX 3CCMA 3G7LA 1LTLA 1SAPA 3RNUA 4GLVB 1SRUA 4IPHA 4S3SA 4C3IB 4ZK9B 5JPMC 5IWAL 5IYBG 2VQEL 4H0LC 1EEFD 4I65A 3P7JA 4HIDA 4HIOA 2ZJQA 4B3RQ 1CQFA 4FNFA 3C3LA 2DN8A 1VQ5A 4OWWB 2C9OA 4B3MQ 2Z8LA 4ZQ3A 3ERSX 1G291 1TY2A 1BF4A 3KLWA 5FJ8G 5JJKA 3VR4A 2HHHQ 4KJNA 3DEOA 5A35A 5BN4A 1II3A 4MZ9A 4RGTA 4A3IB 1GUTA 2JK8A 1MSHA 2CW0C 4JI1Q 5HGTA 1AH9A 2B2VA 3CCUA 5I2YA 5J3BA 2AUKA 1Q86C 4IFDJ 3EVQA 4JV5Q 1HUMA 2NVQH 2XNAC 3M85A 2DNEA 2NZ1D 4H02A 1RODA 3PO2H 2R92G 4B3TQ 2F0FA 3MXPA 3OWFA 1HHVA 2UUCL 1B3AA 3A54A 4HR7B 2WAQB 3PO2B 3MXUA 1G8ZD 3S9WA 1FVIA 1HZ9A 2EPBA 1WVLA 5KYLA 5BN5A 4O42A 3X3NA 3CPWA 3K0YA 4L5QA 3TP8A 4DV0L 3KFUA 4WFN3 4KHPL 3JAMc 1C0AA 4PZ8A 1AFPA 4JI6Q 4KD3A 3CCLA 1WYDA 4R1JA 1EFID 3W5OA 5BR8L 4G7HC 1HZAA 4RGOS 4LFCQ 4LFAQ 4C56C 4R4CA 5EBDA 2XGTA 3H3VC 3BG3A 5CMDA 1VQEA 3V96A 1PVOA 4OELB 5AJ3L 1KLUD 4IUVA 4UHVA 3I4OA 2DY8A 1EY7A 2YTYA 1ZEQX 1FD7D 1C8CA 2QKIC 3U50C 2WINB 1JT8A 3K7AB 2A1AA 1A8VA 1BNZA 5J39A 4AH6A 3GTLB 5K36G 4A93G 4R4TA 2KUMA 2O5IC 4X64L 1ENCA 1Y8NB 3I3CA 1MSGA 3QOLA 1D5XC 1TT2A 4LFBQ 1KHIA 1CM9A 2JA8B 2K03A 3NENA 2AKWB 2ICEC 3UE0A 3KJPA 4K2KA 2RA4A 5C0XJ 1ENAA 5D3DA 4KN4C 5C4ZA 2Q2UA 1Q82C 2J7ZA 5M3MG 4XXEA 3NE5B 1ET6A 1TXYA 2A19A 2MUYA 1XMOQ 3BS1A 1NCVA 1JB7A 4LNQA 3OPOA 5CV5A 4C3HH 4OWXB 1YZ6A 5IT9L 2C5CA 4MTNA 4FVMA 3KF8B 3BJUA 5M3FB 1W3SA 2G9HD 3CCJA 3PSIA 2ZJRA 2R3ZA 2OTLA 2N88A 4LAAA 1L0WA 1SYFA 3I4NG 1AW7A 4DAYB 1UAPA 3HOXG 1T9HA 1PDQA 1SMYD 4LF8Q 1UNSA 1TVXA 2BH8A 4RGMA 4A3EB 3PIO3 3EFXD 4OEMB 2F4VQ 2R61A 2K5QA 1EOTA 2SEBD 2ENBA 2PI2E 5LL6S 3EA6A 5FK9C 1IW7C 4DR3L 3PIPA 3ND8A 3HKSA 1U0LA 3DEPA 1RKNA 3S14H 2AQ1B 2VNUD 1F2YA 4QF4A 1U4MA 4FF2A 3VR2A 1B9MA 4DFAA 4NW2A 2KHIA 2BOSA 3NUCA 5JAVA 2B63G 1K3BC 1KAAA 5ELOA 2RSOA 4RWSC 3J7AF 1PTOB 5M3FG 2Q8RE 2E5LQ 2O2LD 4GNXC 1V8QA 1IBMQ 4HAEA 5JEAJ 3RUZA 2BCOA 3HOWH 3HOVG 5AFWA 1A0IA 4MNOA 4MHEA 1VQ9A 2O4XA 4LWCA 1VQ4A 4K2LA 3G71A 2F3IA 4K14A 3HZXA 5JPNC 4DV5Q 3CP0A 5LMNQ 2IX1A 4JI0Q 3TEHB 1FYCA 2JSOA 3F2BA 4GLAC 4IPGA 1PRTF 1RIPA 5EKKA 1PV4A 1JOOA 2J4XA 3EBEA 3D0FA 3J80c 1VQLA 3SK5A 2Z6BA 1XNQL 2E2JB 4OO1H 3I73A 3QIAA 5C3EH 4X66Q 2QEXA 3FDTA 1Q90A 2F0NA 4LF4Q 4EQNA 4HIMA 2RHQB 1AE3A 3HS0C 2VUMB 4A3BB 4J6HA 2L15A 4L6TB 5C3EB 4X65Q 2K4KA 3T1HL 3H0GB 3I91A 4WORA 3O13A 1HZBA 5L37A 3MZ5A 1PFMA 2GN5A 4TVAB 2EQSA 3CMEA 4GKJQ 4F87A 5T1IA 4NDXA 4OONA 4IZ8A 2ASBA 1A3VA 1M8AA 2QILA 1LTTD 2EJGC 4DR6L 3KK7A 1EY8A 3TBIB 3U4ZA 4LF9Q 1F77A 1NMGA 3R2TA 2WACA 4MN3A 5IODA 2LXKA 3Q22A 4AIMA 4QCLA 5IIFA 3NELA 4APVA 1OXUA 3SXHA 2K01A 3D4RA 4KY5A 1LLRD 1B53A 3T56B 4V0BA 3K58A 3H3VI 4LMQD 2H4OA 1V9PA 2K1BA 3K5LA 3Q23A 1LT5D 4B9XA 3NEMA 3M3YH 2E2DC 2GA4B 1JE4A 2KQ3A 2IX0A 1QZGA 2NWGA 3CMAA 2WP8J 4L5TA 3JAME 1DCZA 1K83H 5E3FA 2F0JA 3T4AC 3X3MA 4ZKBB 2F0HA 4HEDA 1LTRD 4C1NK 2EE1A 1HNZL 1NAPA 2QDBA 2E2HB 4GN5A 4JI2L 3HOYB 2D62A 1JORA 1Z9FA 2RBMA 1GUWA 1U4RA 3MXNA 4TKOB 5C44H 3GTQB 3DMUA 1PTOF 1STAA 2JEAI 1N32Q 3I4MG 1EWHA 4HMIA 5IYCG 2M9VA 1DD2A 3FEWX 4RKBA 4BBSH 4EQOA 5D3IB 1CTMA 4AQYL 3GTGH 3QG1A 2C35B 2BA0A 3N6RA 2P5ZX 1Y1WH 2JA7H 5JOBA 1TWAB 1XYIA 4GKKL 4IN3A 2K04A
chains in the Genus database with same CATH topology
3VR3A 2PQEA 1TWHB 1JQYD 3A8IE 2AWOA 2JA7B 3BYTB 1EZ6A 4F88A 2AUJD 3S1RB 2BDOA 5C4XB 2HUGA 1HA6A 5M9OA 2XRSD 1WTVA 3RLFA 2Q8IB 1CHQD 4DU9A 5A2QE 2R7ZB 3HKZB 1TIID 1S4ZA 1IHZA 4HMJA 2YU9B 1JICA 1ILQA 3FPPA 2AQ3B 1EYAA 3QB3A 5E4XA 3D6WA 4UAIA 3HGBA 3H6MA 4XQNA 1UEAB 1SSOA 3D4WA 4DK1A 1BDOA 5E1FA 4XDXA 1QG7A 1WTQA 1ZKOA 2Z4IA 1AEXA 3FKIB 2MJ8A 2ZXOA 1JOQA 4FP5D 1NUCA 4E6IA 2QEJC 2JEBI 4L8JA 3SK6A 2NVXB 3GO5A 3S1QB 1A3TA 1G6ZA 4C2MB 4XQQA 3D31A 1WD1A 1EEID 1PRTD 1G2TA 1VF5C 2B2WC 3J80E 4IUQA 3S1MB 3S2HB 5M5WB 2JP1A 2RDGA 4ZRZA 1IKLA 4QB4A 2ID0A 3QO2A 2F0MA 1T5XD 1EY5A 2MGSA 1OO9B 4ZKCB 1F2ZA 3TP6A 3SVMA 1IKMA 3D6CA 1RCVD 5FLXL 5KIXA 2MHVA 2AWNA 4KD4A 3TDQA 1HTLD 5I6WA 4WRDA 1JCKB 1IL8A 3NWSA 1GXDC 2HQEA 5EQ0A 3V2TA 1QNUA 1LT4D 4K5XA 1DOMA 1X3QA 1F2MA 3D3RA 4XQJA 1L0XB 3NQIA 4TQUS 5KEEA 3RZDB 3RMHA 2RQXA 1TQOA 1PZJD 3TZUA 2M2LA 3W3AA 2EZVA 2ZXPA 3H09A 5E4WC 5KNBA 3Q0AA 1KNAA 3A55A 2A69D 4F8MA 1I3QB 1UUPA 1R9TB 1V43A 3CQZB 2ZXRA 1JB3A 3I4LA 1O78A 4K6LA 2B2YA 2SDFA 2EYOA 4LJZC 4R9WA 1E2WA 3K5OA 4PV1C 1DXMA 2R92B 1CZGA 5ELDA 2A6EC 2KEDA 2B2TC 4ZUJA 1LV9A 1Q12A 4RCNA 3J81L 4QMGA 3V05A 3BVGA 3DM1A 1Y69U 2HDLA 2SOBA 5I2XA 3AMUA 3NTIA 3BYYB 1Z7TA 2EYJA 4K6DA 1XTCD 3M4OB 1OXSC 1LTSD 1W6JA 5F2DA 4OHJA 1BCPC 5DEHA 4IFDH 4DNRB 1H9RA 5C3WA 4BWGB 5EKLA 4OO1I 3I70A 2E75C 5ISRA 2G9DA 1AZQA 2KOLA 3TZDA 1CQVA 2B2UC 1A2UA 1BBXC 1SNQA 4XYOA 2SNMA 2XSCA 2R6GA 3GQBA 1KDBA 1J9OA 4KKSA 3K57A 3GTKB 1RJTA 4R8NA 2XN9C 4BY7B 4A93B 1HPCA 1OXXK 2ZT9C 2CHBD 2IW3A 1V1PB 2N55A 1PRTB 3OOCA 5M3MB 1QNKA 1YNJC 1Y8PB 1O7ZA 4KN7C 1HCZA 2EY2A 2FMCA 4CHTB 2F0UA 5KRUA 3C1FA 2BE5D 1H9KA 4DXGA 1KDCA 3BDLA 1D5MC 3M7NA 2JA6B 3NQTA 3I4NB 2CQAA 3HOXB 5LHY1 1YNNC 1D1IA 2EYMA 2MP1A 1H9SA 4PMCA 4EVOA 5C0XH 1CA6A 1J8IA 1QE6A 5G3LF 2F0LA 4NMZA 2K28A 4ULLA 4DA2A 3PIP3 1Q1EA 2F0DA 2L55A 3NP8A 4KY6A 3U9OA 1RF2D 2EYPA 2EJFC 2F0KA 2NN6I 3FVQA 2B63B 1VDZA 3DWAA 1DZ1A 4RHRA 3GD7A 3HOVB 3NBHA 1DOLA 1C4QA 4XTCS 3VR6A 5C6AA 1Q1BA 2A68C 2AQ2B 3WOFA 4J1MA 5CV4A 1JWMD 2B2WA 1PTOH 5LL6X 1SJED 1LTGD 1T5EA 3PUWA 5J1ZA 1B1ZA 3MFYA 4I7ZC 4IURA 3NTHA 5KYIA 5JEAH 3P1HA 3S15B 4FXKC 1B4OA 1SYGA 2XWJB 4DF7A 3OW7A 1S5ED 4H13C 4RKLA 4Z9CB 5ELFA 2B8GA 5M5YB 3M7GA 1ESFA 5CV7A 3SE0A 1GUGA 4C3HG 2A5HA 1ZYRC 3PV0A 3K5MA 4J8QA 4EQPA 1EYCA 3SR1A 1JWUD 2YYZA 3HRZC 3MTSA 4RCOA 1F2LA 3HG9A 2B39A 4CBVA 1WTRA 3R3OA 4KJOA 3GTMB 4K5VA 2K32A 4PMWA 2D5DA 4ME5A 1XWEA 2L4NA 5IT9E 5I9PA 1I4HA 2PPBC 1A3UA 4ZUIA 2DY7A 2A6HD 1FNUA 3I90A 4KKTA 4OL7A 1LABA 1VMCA 1O80A 1DJRD 2K7VA 3RD4A 2B2YC 1XX8A 2LS01 3I4MB 1SBBB 3ONAB 3J7YW 3OIPA 3DXJC 1CK1A 5IGEA 4U673 1XXGA 1JC7A 3GV3A 5DM63 1GJXA 2PZUA 1EU4A 4HCEA 4RGNA 4HTHA 2B2TA 2BA1A 1Q8IA 3SDZA 4OO1G 1LTID 1R4QB 5EPLA 1SNDA 2EDGA 4CJ2C 2F1MA 1SXTA 1SYDA 4XT1B 5HURA 3TN2A 3G6JB 2EY5A 1PMRA 4A3JB 1EWCA 3IFTA 2NTTA 2NVTB 4X3TA 1TWGB 1R4PB 2F0OA 2PMZB 3PO3B 2B2UA 3K5NA 2FFKB 1EYDA 2PNRC 2TSSA 1IYVA 4AYBB 1SNOA 4A3DB 1AN8A 3OWEB 3GP7A 3FPUB 4RAUC 3SHLA 3T51B 1EY6A 4KTAA 1STHA 1H9JA 1SYCA 1F9RA 2PYKA 2F4IA 4OGQC 5G3LD 1PTOC 1CHPD 1PZKD 3SEBA 3S16B 2L5TA 4DGZA 2KECA 4A3FB 5I9OA 2E2IB 5KNCA 1I4XA 5CORA 2LY7A 2IPKD 1EY9A 4A3GB 4H7BA 3PUYA 4O1NA 2EYFA 4KY7A 2D2CC 1SE2A 2F0QA 5C5LA 4KV6A 3S1NB 2JXMB 2NN6G 2JE6I 1X3PA 2KVMA 3GTOB 1WCMB 1QB5D 2DNCA 1HQMC 3OMCA 3R8BA 1FNVA 2VXWA 1ENFA 3BDCA 2Q8TA 1A15A 4IFDI 4RFBA 2NBFA 1CI3M 4ZYSA 1BQQT 3CRLC 1HUNA 2JYOA 1RTNA 3RZOB 1OXTA 1FGBD 2PW5A 3E6ZX 3TP7A 2EYLA 3ERQA 3EQLC 2TMPA 4CJ1B 2EY6A 4K8JA 3KLSA 1W6KA 5C4JB 2WKCA 2RKSA 1CZWA 1WTXA 1BUVT 2NVYB 5IOCA 4CJ0B 5D65A 4FF4A 2XRQD 3A7LA 4IQZA 4L63B 1S5BD 3MVVA 1E2VA 1Y8OB 3ND9A 3E0JA 2PW7A 1D2BA 2CVRA 2M00A 5JVG3 2KJXA 1V1OA 4JBWA 5FO9B 1SE3A 1I6HB 2H1EA 2PZTA 3WOEA 2E74C 1TY0A 2F0PA 2QCPX 3H91A 1I6VC 2Z4HA 4U68A 1DONA 3C1EA 1CFMA 5FKAC 2F0GA 1GHJA 2RVLA 3C2PA 3S2DB 5C0XI 3HP3A 5CV8A 2X6GA 3HEJA 2FHTA 1FR3A 3H94A 4A3MB 4FF1A 3MA2B 4CKCA 5CYUA 3I8ZA 1D1KA 4R8IA 1TWFB 2R93B 1SNPA 1S5FD 4HCSA 1HQRD 1MD2D 2HCIA 3C46A 1SMYC 1A2TA 4OIKA 2IJ0A 5CBAE 1STNA 2PO4A 1B9NA 3NK9A 3MAQA 5IGBA 4HN7A 1WTWA 3DHQA 1Q3LA 5FO8B 1H9MA 2VB3X 3IKJA 3E5SA 3ZYYX 1HTPA 2A74C 3DWPA 3LX0A 3IL8A 3CU7A 1ML0D 1HFGA 2RDHA 4BBRB 3P75A 1E0BA 1SDFA 1D5ZC 1KNEA 5FLXE 2E76C 1TS4A 1QCBD 1KLGD 1QJOA 3CRKC 3QJYA 1EU3A 3DWQA 3KF8A 1MBYA 4NP5A 3HOUB 4Q5VA 2F0TA 4C3JG 1STGA 4FXGC 3Q24A 3GV6A 1GUSA 4DAYA 4ZAIA 5KGUA 1U9RA 5K36H 4G57A 5CC4A 2WB1B 4ILWA 1D6EC 3F2UA 5J22A 1PFNA 3SK4A 3OIQA 5FO7B 1SYBA 4C3IG 2A6HC 1AZPA 2F03A 3QWNA 1G2SA 1I4RA 2NVQB 3MC0B 3A7AB 3BVZA 4QIWB 1G91A 4ID6A 3A56A 4KK7A 4CKEA 2QF7A 2XIWA 1LACA 1TS5A 1NR4A 3CHBD 4M1UB 1TU2B 4BS9A 5C3XA 3VYTA 1EZ8A 1DM0B 3A8KE 3P20A 4IUTA 1F9QA 2D9UA 4IFDG 1QOHA 3D4DA 1ESRA 3S17B 2LKVA 2OF1A 1RD9D 5ELEA 2F0SA 1I4GA 4IUNA 4KI0A 4YIJA 2L9HA 2RDFA 3J81E 5EJWA 2F3WA 3NBIA 4B9WA 1EIHA 2LMCB 3M4YA 4ODGA 2F3VA 1KDAA 5C4HA 1PZID 3PUZA 2WIIB 1BOSA 5FOBB 1PFBA 3K6OA 4DXFA 1WTOA 4FF3A 1MGSA 1EQTA 3VYRA 1TKWB 3VA5A 1Z47A 1SE4A 4C3HB 1U4LA 2I07B 3TSSA 2LFNA 4IALA 1F9PA 2EY1A 3LWEA 2K05A 4QUFA 1RDPD 1I50B 1RHPA 2X69A 2XVSA 4DAPA 4Q0FA 3FMCA 4TSSA 5NUCA 1TS2A 1S5CD 2FMMA 4XIGS 2Y0SB 1DOKA 5C0XG 5IGGA 2OXPA 2J0TD 2XWBB 4C1NI 1B44D 5JJZA 3S14B 3PMFA 1A6XA 3JAML 1SNCA 2I46A 3T16A 3OSOA 3R2IA 2A6ED 1VF7A 2EXZA 2K5DA 3TP5A 1MI2A 1L0YB 1LTAD 3HOWB 4XYQA 2NB0A 2EOTA 2B8FA 1ET9A 1E2ZA 2CW0D 1BCPD 2FJ2A 1GOZA 2SNSA 1I4PA 3SK8A 5I4DA 5CBEE 4DN4M 1H9SB 3AB9A 1PRTC 2KEEA 4CKBA 1Z6HA 2NUCA 1SYEA 3Q6SA 5JEAG 3J7AV 2HCCA 2BDNA 1FNWA 2IL8A 3L3OC 1LT3D 1HFNA 3PUXA 3WDNA 5IGDA 2EYHA 4DNTB 5A2QL 3N52A 3K59A 4G4KA 3URYA 2F0VA 2F0WA 1KABA 3L7ZC 1TR5A 2KCCA 4G7OC 2K5WA 4PQXA 1YNJD 1S5DD 1JOKA 3VA7A 4ZLTF 1ONLA 5EBCA 1K8OA 4GZYC 4Y7NB 1GHKA 1BR9A 4B08A 4HSVA 3NXWA 1B2TA 2KA7A 3IFDA 5CV9A 5CGKA 1SJHD 3M3YB 4EGVA 3U9SA 1YNND 1HXYD 1K83B 2K33A 2B2VC 3R93A 2A73B 2IWHA 3VYUA 3VYSA 1EY0A 1GUOA 5T1GA 2KHSA 4RA8A 3MWYW 4ABNA 5C44B 4MIUA 2NN6H 1KTKA 1TS3A 4BBSB 1NSNS 4KHVA 2A69C 3DUZA 3GTGB 4F7XA 3A8JE 2MPMA 4V190 3D8GA 2V4DA 4PMBA 1PXUA 5DAUA 1DYQA 1Y1WB 5I6YA 3J80L 1C48A 2VB2X 3LNNA 3NHHA 5TSSA 1HRJA 1F9SA 1RTOA 5D14A 4DAVA 2A68D 1STBA 3FRPB 5DM73 2L12A 3NSWA 1LTBD 1IW7D 2HDMA 3IAYA 4FXDA 1AP0A 1Y1VB 4FO2A 5C5MA 4DK0A 3PUVA 1CA5A 4BY1B 5BN3A 1QILA 4X3UA 1EL0A 3EROA 3T53B 4X3KA 3KBGA 5ELBA 4KHZA 2RSNA 4NKLA 4G7ZC 1GUNA 5EPKA 1ICWA 5CV6A 1SFOB 3NWTA 2OEOA 2IX3A 1ZYRD 1I4QA 5M5XB 1LT6D 1O7YA 3L9AX 2L11A 2JA5B 4K8IA 2K6AA 2L0CA 5EGTA 4TRDA 3EJIA 1STEA 4BA2I 1QWYA 2PZWA 4XT3B 2FINB 1LO5D 4P2CB 1PLFA 1ILPA 5ELCA 1BCPB 5IGFA 1VMPA 3AU7A 3NPPA 2F0IA 1STYA 5CR3A 4LK1C 3W2DA 4X3SA 5K5PA 2IT1A 3MXGA 1SEBD 1IYUA 4PNYA 2F0EA 4FYDA 1WTPA 4IUUA 3VR5A 4HSPA 2L1BA 2BE5C 1TWCB 3LWUA 1JR0D 3GTJB 2PCFB 4BA1I 2NTSA 4H44C 4RHSA 1EY4A 3I72A 2EVBA 3KBXA 3UI2A 4N9PA 1VCIA 2WV6D 3BZDB 4KKUA 3MHBA 2ICIA 5DNFA 3GTPB 1O7LA 3HOZB 4N9TA 4K5WA 1PYWD 3BDOA 2O5JC 2WKDA 1NR2A 1EIGA 3QOJA 4KMUC 2EJMA 3CKIB 3KUPA 4WJWA 4UDUC 1V1PA 4IUPA 1JWSD 1EQVA 2Z1CA 1B50A 4OIJA 1BXTA 2NYZD 1BO0A 4QUCA 2KCNA 3TMEA 5EKIA 5KNDA 5JVH3 4JK1C 4RH6A 2X6LA 4M8AA 5COYA 3KLRA 4CGYB 4A3KB 3MEHA 5EPJA 1OXVA 1HA5A 3NTKA 4C3JB 3OHXC 5IGCA 1K8MA 1X32A 1SNMA 3MFGA 1PTOD 3OMGA 3BVMA 1U4PA 2OT2A 3ITPA 1BCPF 1M4VA 3T13A 1WD0A 1ZXTA 1CT1D 3KLSX 3G7LA 1SAPA 4ZK9B 4S3SA 4C3IB 5JPMC 4H0LC 1EEFD 4I65A 3P7JA 1CQFA 4FNFA 3C3LA 2DN8A 2C9OA 2Z8LA 4ZQ3A 1G291 1TY2A 1BF4A 3VR4A 4KJNA 3DEOA 5A35A 5BN4A 1II3A 4RGTA 4A3IB 1GUTA 1MSHA 2CW0C 5HGTA 2B2VA 5I2YA 2AUKA 4IFDJ 3EVQA 1HUMA 2XNAC 3M85A 2DNEA 2NZ1D 1RODA 2F0FA 3MXPA 3OWFA 1HHVA 1B3AA 3A54A 4HR7B 2WAQB 3PO2B 3MXUA 1G8ZD 3S9WA 2EPBA 1WVLA 5KYLA 5BN5A 4O42A 3X3NA 3K0YA 3TP8A 4WFN3 1AFPA 4KD3A 1EFID 4G7HC 4RGOS 4C56C 5EBDA 3H3VC 3BG3A 5CMDA 3V96A 1KLUD 4IUVA 2DY8A 1EY7A 1ZEQX 1FD7D 1C8CA 2QKIC 2WINB 3K7AB 1BNZA 5J39A 3GTLB 5K36G 2KUMA 2O5IC 1ENCA 1Y8NB 3I3CA 1MSGA 3QOLA 1D5XC 1TT2A 1CM9A 2JA8B 2K03A 2ICEC 4K2KA 2RA4A 5C0XJ 1ENAA 5D3DA 4KN4C 5C4ZA 2J7ZA 4XXEA 3NE5B 1ET6A 2MUYA 3BS1A 1NCVA 3OPOA 5CV5A 5IT9L 2C5CA 4FVMA 5M3FB 2G9HD 2R3ZA 2N88A 4LAAA 1SYFA 1AW7A 1UAPA 1PDQA 1SMYD 1UNSA 1TVXA 4RGMA 4A3EB 3PIO3 3EFXD 2R61A 2K5QA 1EOTA 2SEBD 2ENBA 5LL6S 3EA6A 5FK9C 1IW7C 3ND8A 3DEPA 1RKNA 2AQ1B 2VNUD 1F2YA 4QF4A 1U4MA 4FF2A 3VR2A 1B9MA 4DFAA 4NW2A 2BOSA 3NUCA 5JAVA 1KAAA 2RSOA 4RWSC 3J7AF 1PTOB 2Q8RE 2O2LD 1V8QA 4HAEA 5JEAJ 3RUZA 2BCOA 5AFWA 4MHEA 2O4XA 4K2LA 4K14A 3HZXA 5JPNC 2IX1A 1FYCA 2JSOA 1PRTF 5EKKA 1JOOA 2J4XA 3SK5A 2E2JB 4OO1H 3I73A 3QIAA 3FDTA 1Q90A 2F0NA 4EQNA 3HS0C 2VUMB 4A3BB 4J6HA 4L6TB 5C3EB 3H0GB 3I91A 4WORA 3O13A 3MZ5A 1PFMA 4F87A 5T1IA 4NDXA 4IZ8A 1A3VA 1M8AA 2QILA 1LTTD 2EJGC 3KK7A 1EY8A 3TBIB 1F77A 3R2TA 2WACA 4MN3A 5IODA 3Q22A 4QCLA 5IIFA 1OXUA 3SXHA 2K01A 3D4RA 4KY5A 1LLRD 1B53A 3T56B 4V0BA 3K58A 4LMQD 2H4OA 2K1BA 3K5LA 3Q23A 1LT5D 4B9XA 2E2DC 2GA4B 1JE4A 2KQ3A 2IX0A 2NWGA 2WP8J 3JAME 1DCZA 5E3FA 2F0JA 3T4AC 3X3MA 4ZKBB 2F0HA 4HEDA 1LTRD 4C1NK 2EE1A 1NAPA 2QDBA 2E2HB 3HOYB 2D62A 1JORA 2RBMA 1GUWA 1U4RA 3MXNA 4TKOB 3GTQB 3DMUA 1PTOF 1STAA 2JEAI 1EWHA 4HMIA 2M9VA 1DD2A 3FEWX 4RKBA 4EQOA 5D3IB 1CTMA 3QG1A 2BA0A 3N6RA 5JOBA 1TWAB 1XYIA 4IN3A 2K04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYH A;  2PQE A;  2EY1 A;  5C4Z A;  2EYO A;  3MHB A;  4KJN A;  4J6H A;  5C5M A;  1II3 A;  1SNP A;  3TP8 A;  4WOR A;  1EZ6 A;  5CV7 A;  5KRU A;  1A2T A;  2F0V A;  2EY5 A;  2F0W A;  3MZ5 A;  1KAB A;  4ID6 A;  4N9T A;  1KDC A;  3BDL A;  5HGT A;  1STN A;  4K5W A;  5NUC A;  1TR5 A;  3ERO A;  4NDX A;  5CV5 A;  2F0O A;  4IZ8 A;  4EQP A;  1EYC A;  3NK9 A;  1A3V A;  2PW5 A;  4QB4 A;  3NQT A;  5IGB A;  1EYD A;  4ZUJ A;  2F0M A;  3EVQ A;  3SR1 A;  1JOK A;  3TP7 A;  2EYL A;  3ERQ A;  1EY5 A;  3DHQ A;  5M9O A;  3QOJ A;  5IGG A;  2OXP A;  2EYM A;  4PMC A;  1EY8 A;  1SNO A;  4QMG A;  4EVO A;  4LAA A;  4NKL A;  5C3X A;  2EY6 A;  4K8J A;  4DU9 A;  2F0F A;  2F0L A;  2SOB A;  3MXP A;  1F2Z A;  1EZ8 A;  1SYF A;  3OWF A;  3SHL A;  3R3O A;  3D6C A;  3TP6 A;  4NMZ A;  4KJO A;  2RKS A;  5CV6 A;  3PMF A;  3NXW A;  1EY6 A;  4KTA A;  1STH A;  2WAC A;  3E5S A;  2OEO A;  1EQV A;  4K5V A;  1SNC A;  2F0D A;  5IOD A;  5KIX A;  3S9W A;  1SYC A;  2EYJ A;  4K6D A;  4KD4 A;  5CV9 A;  3T16 A;  3OSO A;  5CGK A;  5KYL A;  2PYK A;  4ME5 A;  5IOC A;  5IIF A;  3LX0 A;  1IHZ A;  3TME A;  3D4D A;  4K8I A;  5F2D A;  5I6W A;  3NP8 A;  4KY6 A;  4WRD A;  2ENB A;  2LKV A;  2EYP A;  2OF1 A;  4HMJ A;  5DEH A;  3SXH A;  5EGT A;  2EXZ A;  2F0K A;  3MVV A;  4KY5 A;  3TP5 A;  4TRD A;  2HQE A;  5C3W A;  5I9P A;  2F0S A;  3EJI A;  4KD3 A;  1EYA A;  3QB3 A;  4IUN A;  1A3U A;  4ZUI A;  1RKN A;  5EKL A;  3V2T A;  2PZW A;  4YIJ A;  5ISR A;  4K5X A;  1F2Y A;  2RDF A;  4QF4 A;  4DGZ A;  4DFA A;  2F3W A;  3H6M A;  1F2M A;  1A2U A;  2PW7 A;  4B9W A;  5I9O A;  3MEH A;  3NUC A;  3P75 A;  4B9X A;  1KAA A;  1EY0 A;  2M00 A;  5IGF A;  4OL7 A;  2KHS A;  2F0I A;  1STY A;  3D4W A;  2KQ3 A;  1SNQ A;  5CR3 A;  5KEE A;  2SNM A;  4MIU A;  5E1F A;  5IGC A;  5C6A A;  3U9O A;  5E3F A;  2F0J A;  1KDB A;  4ODG A;  3RUZ A;  2F3V A;  5K5P A;  1SNM A;  2F0H A;  2PZT A;  4J1M A;  5JAV A;  1NSN S;  1KDA A;  1EY7 A;  2QDB A;  1TQO A;  3OMG A;  4KHV A;  2SNS A;  4R8N A;  5CV4 A;  5C4H A;  2F0P A;  1EY9 A;  4NP5 A;  1JOR A;  1AEX A;  2F0E A;  4H7B A;  4PNY A;  4F7X A;  5IGE A;  2RBM A;  2EYF A;  2F0T A;  3SK8 A;  1STG A;  3ITP A;  2O4X A;  3D8G A;  4KY7 A;  3C1E A;  4K2L A;  2F0Q A;  4K14 A;  3T13 A;  3HZX A;  2F0G A;  3DMU A;  4PMB A;  2PZU A;  5DAU A;  5C5L A;  1STA A;  1JOQ A;  5I6Y A;  4HMI A;  4KV6 A;  5J39 A;  1NUC A;  2NUC A;  1SYE A;  3NHH A;  4HTH A;  4RKB A;  5J1Z A;  4EQO A;  5EKK A;  4E6I A;  1JOO A;  4S3S A;  5CV8 A;  3SK6 A;  5KGU A;  5KYI A;  3VA5 A;  1U9R A;  1ENC A;  1STB A;  3HEJ A;  3P1H A;  3QOL A;  4G57 A;  1SND A;  1A3T A;  3SK5 A;  5CC4 A;  4I65 A;  1TT2 A;  4F8M A;  5J22 A;  3OMC A;  1SYG A;  1EY4 A;  3SK4 A;  4DF7 A;  4EQN A;  1SYD A;  2EY2 A;  5JOB A;  1SYB A;  3BDC A;  5HUR A;  5IGD A;  4RKL A;  4K2K A;  4N9P A;  4ZQ3 A;  2F0N A;  2F0U A;  4IAL A;  1ENA A;  3C1F A; 
#chains in the Genus database with same CATH topology
 4UPA A;  3VR3 A;  2PQE A;  1TWH B;  1JQY D;  3A8I E;  1UEB A;  3F1Z A;  2AWO A;  2JA7 B;  3BYT B;  4HJ5 A;  1EZ6 A;  4F88 A;  2AUJ D;  3S1R B;  2BDO A;  3KYH C;  3TRE A;  5C4X B;  2HUG A;  1Y1V H;  1HA6 A;  5M9O A;  2XRS D;  5GAD C;  1WTV A;  3RLF A;  2Q8I B;  2R7Z H;  1CHQ D;  1VQM A;  1UE1 A;  1VQF A;  4LF7 Q;  4BY1 H;  3PO3 G;  4DU9 A;  4DV1 L;  4P74 A;  5A2Q E;  4AYB G;  2R7Z B;  1S3O A;  3HKZ B;  3AEV A;  1EYG A;  4A3D G;  1TII D;  1M1K C;  1S4Z A;  1IHZ A;  4HMJ A;  2YU9 B;  1JIC A;  1ILQ A;  3FPP A;  2AQ3 B;  1EYA A;  5IYD H;  3QB3 A;  5DLQ E;  5E4X A;  3D6W A;  1ASZ A;  1SFO H;  2AMC B;  2UU9 Q;  4UAI A;  4L5R C;  1KXL A;  3HGB A;  3U58 A;  3H6M A;  4XQN A;  4A75 A;  1BBW A;  2JA5 H;  1UEA B;  1SSO A;  3D4W A;  4DK1 A;  4MTK A;  1BDO A;  1YHB A;  5E1F A;  4LUO A;  1XMQ L;  4XDX A;  1QG7 A;  1WTQ A;  4A3F G;  1ZKO A;  1WFQ A;  2Z4I A;  3H15 A;  1AEX A;  3STB D;  3FKI B;  4YHH L;  2MJ8 A;  3E0E A;  2PMZ E;  4NXM L;  2ZXO A;  1JOQ A;  4FP5 D;  1NUC A;  1YHQ A;  3S1Q H;  4AYB E;  4C2M H;  2UUB Q;  4A3G G;  1X55 A;  1PH7 A;  4E6I A;  2QEJ C;  2JEB I;  4L8J A;  2MQH A;  3SK6 A;  2MNA A;  2JJQ A;  2NVX B;  3GO5 A;  3S1Q B;  1A3T A;  1G6Z A;  4C2M B;  4XQQ A;  2HQL A;  1YIT A;  3D31 A;  4DV2 Q;  1CSP A;  1WD1 A;  1EEI D;  1XTD A;  1PRT D;  1WCM G;  4EX5 A;  3CCV A;  4DV3 L;  1HNX L;  1TWC H;  2IHF A;  1RL2 A;  1G2T A;  1VF5 C;  2B2W C;  2UXB Q;  1B8A A;  3J80 E;  3GTJ H;  4IUQ A;  2CCZ A;  4P71 A;  3S1M B;  3S2H B;  5M5W B;  2JP1 A;  2RDG A;  4ZRZ A;  1IKL A;  4QB4 A;  4PG3 A;  2ID0 A;  3QO2 A;  2F0M A;  1T5X D;  4JI7 L;  1EY5 A;  2MGS A;  1VQA A;  1OO9 B;  3SGI A;  3U4V A;  4ZKC B;  3HOZ H;  1CKN B;  1F2Z A;  3TP6 A;  3SVM A;  1IKM A;  3D6C A;  4UP7 A;  1KL9 A;  1RCV D;  5FLX L;  2I5H A;  5KIX A;  2MHV A;  3KF6 A;  1HR0 Q;  2MO1 A;  3BZC A;  2AWN A;  4KD4 A;  3TDQ A;  1HTL D;  5I6W A;  4B3R L;  4WRD A;  1JCK B;  4YWL A;  1IL8 A;  3NWS A;  1GXD C;  2HQE A;  5EQ0 A;  3V2T A;  3K0X A;  1QNU A;  1LT4 D;  4K5X A;  2ZM6 Q;  4GOP B;  2HHH L;  1DOM A;  4JCV E;  4O2D A;  4NXN Q;  1X3Q A;  1F2M A;  3D3R A;  4XQJ A;  1WJJ A;  4BXX G;  1L0X B;  3NQI A;  4TQU S;  5KEE A;  1LYL A;  3L2P A;  3RZD B;  3RMH A;  2RQX A;  4IJH A;  5IYB H;  1TQO A;  2KCM A;  2VW9 A;  1PZJ D;  3TZU A;  2M2L A;  3EN2 A;  3W3A A;  1PH5 A;  4UP8 A;  4B3T L;  3MEF A;  4JI4 Q;  2EZV A;  3OTO Q;  1IBK Q;  2ZXP A;  5FJ8 H;  2OCE A;  4YY3 L;  1IL2 A;  3H09 A;  2UUA Q;  1X3G A;  5E4W C;  5KNB A;  4DUZ L;  3Q0A A;  1K8G A;  3ICE A;  1KNA A;  2XTI A;  3A55 A;  2A69 D;  1H95 A;  4JI6 L;  1D7Q A;  4F8M A;  1I3Q B;  1UUP A;  1R9T B;  1V43 A;  3CQZ B;  2ZXR A;  1JB3 A;  3I4L A;  1O78 A;  4LFC L;  4LFA L;  4K6L A;  2B2Y A;  2SDF A;  5LMN W;  4IOC A;  1QVF A;  1KD1 C;  4C3I H;  2EYO A;  4A3M G;  2R92 H;  4LJZ C;  4R9W A;  1E2W A;  2OTJ A;  3K5O A;  2KBN A;  4PV1 C;  2I5M X;  1YBY A;  1DXM A;  2B29 A;  3S24 A;  3TS2 A;  2R92 B;  1CZG A;  5ELD A;  2A6E C;  2KED A;  2B2T C;  4ZUJ A;  2R93 G;  1LV9 A;  1Q12 A;  4RCN A;  4DR1 Q;  3L0O A;  1BKB A;  3J81 L;  2CWA A;  4QMG A;  3V05 A;  5IT9 c;  4A3I H;  3BVG A;  3DM1 A;  1Y69 U;  1N33 Q;  2HDL A;  2SOB A;  5I2X A;  3AMU A;  3NTI A;  4IOA A;  1YJW A;  3BYY B;  1Z7T A;  2EYJ A;  4K6D A;  1XTC D;  3M4O B;  1OXS C;  1A63 A;  1E1O A;  1LTS D;  1W6J A;  5F2D A;  4OHJ A;  1BCP C;  5DEH A;  1I5F A;  4IFD H;  4DNR B;  1H9R A;  5C3W A;  4BWG B;  1X65 A;  5EKL A;  4OO1 I;  1G6P A;  3I70 A;  3ULJ A;  2E75 C;  2DJG C;  2G9D A;  5ISR A;  2KOL A;  3TZD A;  3CCR A;  4GNX B;  1AZQ A;  1X3F A;  1CQV A;  2B2U C;  2IHE A;  1A2U A;  3ULP A;  1BBX C;  4LF5 Q;  1SNQ A;  4XYO A;  2SNM A;  2XSC A;  1KQS A;  2R6G A;  3GQB A;  3CW2 C;  4BBR G;  1KDB A;  1J9O A;  3RLO A;  4KKS A;  3K57 A;  3GTK B;  4JI8 Q;  1RJT A;  1KRS A;  1KAW A;  2YTV A;  4R8N A;  2XN9 C;  2ALY B;  4BY7 B;  1KRT A;  4A93 B;  3CPF A;  1HPC A;  1Q8K A;  1OXX K;  2ZT9 C;  2CHB D;  3CF5 A;  2IW3 A;  4LF8 L;  3HOU G;  1V1P B;  1VS0 A;  2N55 A;  2UXD Q;  2F4V L;  2JA9 A;  1PRT B;  4K0K L;  3OOC A;  2VZA A;  5M3M B;  1QNK A;  3K7A H;  1YNJ C;  1Y8P B;  2KHJ A;  1O7Z A;  4DR2 Q;  4KN7 C;  1HCZ A;  3A5Z B;  2EY2 A;  4CDF C;  2FMC A;  4CHT B;  3GTL H;  2F0U A;  4P73 A;  5KRU A;  3C1F A;  4A76 A;  4UY8 C;  1NTG A;  3HFZ B;  4JYA Q;  2BE5 D;  2ZTC A;  1H9K A;  4DXG A;  1PFS A;  4YCU A;  3CCS A;  4BY7 G;  2JA8 H;  1IBM L;  4A3C H;  1VQ7 A;  1KDC A;  3BDL A;  1D5M C;  2ZJP A;  1Q81 C;  3M7N A;  2JA6 B;  3NQT A;  3I4N B;  2KCT A;  2CQA A;  1EUJ A;  3HOX B;  5LHY 1;  1YNN C;  1D1I A;  3KDF B;  2EYM A;  2MP1 A;  1H9S A;  4PMC A;  1GM5 A;  4DV5 L;  4DUY Q;  4EVO A;  5C0X H;  1CA6 A;  4JI0 L;  1PH3 A;  1QE6 A;  5G3L F;  1J8I A;  3CC4 A;  2F0L A;  4NMZ A;  2K28 A;  3PGZ A;  4ULL A;  4DA2 A;  4JI3 Q;  3PIP 3;  4IJL A;  1Q1E A;  2F0D A;  3M4Q A;  2L55 A;  5M3F H;  1V1Q A;  1L2F A;  3NP8 A;  4KY6 A;  3JAM i;  3U9O A;  1RF2 D;  2EYP A;  2EJF C;  2F0K A;  2NN6 I;  3FVQ A;  2B63 B;  1VDZ A;  3DWA A;  1FL0 A;  4QGU A;  1DZ1 A;  3A0J A;  2WB1 E;  4RHR A;  4A3E H;  4X65 L;  2JA6 G;  1EFW A;  2N3S A;  3GD7 A;  3PF4 A;  3HOV B;  1L1O C;  3NBH A;  1DOL A;  1HJP A;  5HGQ A;  1QUQ B;  1C4Q A;  4XTC S;  3PQI A;  3VR6 A;  4GKJ L;  2F52 A;  5C6A A;  2HIV A;  1Q1B A;  2A68 C;  2H5X A;  2AQ2 B;  3WOF A;  1PH8 A;  4J1M A;  4DV0 Q;  4QIW E;  2ZTD A;  5CV4 A;  3I56 A;  1JWM D;  2B2W A;  4GN3 B;  1N34 L;  1PTO H;  5LL6 X;  5BR8 Q;  1SJE D;  1LTG D;  1WOC A;  1T5E A;  3PUW A;  4ME3 A;  5J1Z A;  1B1Z A;  3MFY A;  4I7Z C;  3BU2 A;  4IUR A;  3NTH A;  5KYI A;  5JEA H;  4JW0 A;  3P1H A;  4DV7 Q;  3S15 B;  4OX9 Q;  4FXK C;  3J7Z C;  1B4O A;  1SYG A;  2XWJ B;  4DF7 A;  3OW7 A;  1S5E D;  3I7F A;  4H13 C;  4RKL A;  4Z9C B;  3K7U C;  1CSQ A;  5ELF A;  2B8G A;  1YEZ A;  5M5Y B;  3M7G A;  3AQQ A;  1X6O A;  1ESF A;  5CV7 A;  3SE0 A;  2E2J H;  1GUG A;  4X62 Q;  4C3H G;  2A5H A;  4CDE C;  2PNH A;  1ZYR C;  4DV4 Q;  3PV0 A;  4N8X 1;  4J8Q A;  3K5M A;  5LMU L;  4EQP A;  1EYC A;  3SR1 A;  2VUM H;  1JWU D;  2JQO A;  5ELN A;  3PIO A;  4A3B H;  2YYZ A;  3HRZ C;  1K3R A;  3MTS A;  3H0G H;  4N8F A;  4RCO A;  1N32 L;  1VQ8 A;  2VS1 A;  1F2L A;  3HG9 A;  2B39 A;  4CBV A;  4DV6 Q;  3R3O A;  1WTR A;  2Y0S G;  4KJO A;  1CKM A;  3GTM B;  4K5V A;  2K32 A;  2OQ0 A;  3I2Z A;  4PMW A;  2D5D A;  4ME5 A;  4A4I A;  1XWE A;  2VY3 A;  2IY5 B;  2L4N A;  4NB3 A;  1E24 A;  5IT9 E;  2LXJ A;  5I9P A;  2QA4 A;  1I4H A;  2PPB C;  1A3U A;  4ZUI A;  3UDI A;  1LUZ A;  2DY7 A;  1JJC B;  2A6H D;  1FNU A;  2AHO B;  1MJC A;  1E7Z A;  2N49 A;  4GN4 B;  3I90 A;  4KKT A;  1KIX A;  4OL7 A;  3I4M H;  5IYC H;  1LAB A;  4GS3 A;  1VMC A;  1HR0 W;  1O80 A;  4WJ3 M;  3F2D A;  1DJR D;  3HOW G;  1N36 L;  2K7V A;  3UDG A;  3RD4 A;  2B2Y C;  1XX8 A;  1EQR A;  2LS0 1;  3I4M B;  1SBB B;  3ONA B;  3J7Y W;  3OIP A;  3DXJ C;  1CK1 A;  5IGE A;  4U67 3;  2I0Q A;  2Z0S A;  1XXG A;  1JC7 A;  3GV3 A;  1J6Q A;  5DM6 3;  1GJX A;  2PZU A;  2E8G A;  1EU4 A;  1A62 A;  4HCE A;  2Y0S E;  1K73 C;  4RGN A;  4HTH A;  2B2T A;  1HZC A;  2BA1 A;  1Q8I A;  2E2H H;  3HOY H;  4JPB W;  3J80 i;  3SDZ A;  1XNR Q;  4OO1 G;  1LTI D;  1W2B A;  1R4Q B;  5EPL A;  1GVP A;  1SND A;  4P72 A;  2CWP A;  2EDG A;  3GTQ H;  4CJ2 C;  2F1M A;  1SXT A;  1SYD A;  4XT1 B;  5HUR A;  2UU9 L;  3TN2 A;  2DJF C;  3G6J B;  2EY5 A;  3K81 C;  1PMR A;  4A3J B;  1I94 L;  1EWC A;  4WJ4 A;  3EIV A;  3IFT A;  3PO3 H;  1O7I A;  3F8T A;  2ZTE A;  4HJ7 A;  4I7A A;  2NTT A;  2NVT B;  2DGY A;  4X3T A;  1TWG B;  1R4P B;  2F0O A;  2PMZ B;  1TWA H;  3PO3 B;  2Q2I A;  3RN5 A;  2B2U A;  3K5N A;  2FFK B;  1EYD A;  2PNR C;  2TSS A;  1XNQ Q;  1TWH H;  1IYV A;  4AYB B;  1GD7 A;  1SNO A;  4A3D B;  2V1C C;  1AN8 A;  3OWE B;  3GP7 A;  3FPU B;  2QGQ A;  3S1R H;  5E7N A;  4RAU C;  3SHL A;  1PYB A;  3T51 B;  2UUB L;  3FP9 A;  4PZ6 A;  5C4X H;  3T1H Q;  1EY6 A;  4KTA A;  5IP7 G;  1STH A;  4ALP A;  1H9J A;  3S16 H;  1SYC A;  1F9R A;  3KJO A;  2PYK A;  4A3J G;  2F4I A;  4DV2 L;  4OGQ C;  2CFM A;  5G3L D;  2K5V A;  2VQF Q;  1CHP D;  1PTO C;  1PZK D;  3SEB A;  3S16 B;  4RMF A;  3CD6 A;  4DR6 Q;  5FLM H;  2L5T A;  4DGZ A;  2KEC A;  2D0P A;  4A3F B;  5I9O A;  2E2I B;  5KNC A;  2CH4 A;  1I4X A;  5COR A;  2YU9 H;  1J5E Q;  3W1G A;  1C7Y A;  2OWO A;  2LY7 A;  3ER0 A;  2IPK D;  1EY9 A;  4A3G B;  4H7B A;  3PUY A;  4O1N A;  5C44 G;  4A3L H;  2EYF A;  4KY7 A;  2D2C C;  1SE2 A;  2Q2H A;  2F0Q A;  4BBS G;  5C5L A;  4KV6 A;  3I55 A;  3S1N B;  2JXM B;  2NN6 G;  1UE5 A;  2JE6 I;  4JBJ A;  2RHS B;  1X3P A;  2KVM A;  3GTO B;  1WCM B;  3FKI H;  3ZJY C;  1QB5 D;  1Y1W G;  2DNC A;  5GQO A;  1HQM C;  3OMC A;  3ULL A;  3R8B A;  1FNV A;  1DGS A;  2VXW A;  1ENF A;  1YHA A;  2ZM6 L;  3BDC A;  2Q8T A;  2B3G A;  1A15 A;  4IFD I;  2RF4 A;  3RZO H;  4HJA A;  3FHW A;  4RFB A;  2NBF A;  1CI3 M;  4ZYS A;  2NVX H;  1GKH A;  1BQQ T;  3CRL C;  1HUN A;  2I5L X;  2PQA A;  2JYO A;  1RTN A;  3E9I A;  3RZO B;  1OXT A;  3WWV A;  4DKA C;  2RCF A;  1Y1V G;  2QDL A;  4AQY Q;  5GRO A;  1FGB D;  2PW5 A;  3E6Z X;  3TP7 A;  2EYL A;  3ERQ A;  1L1O A;  4OWT B;  4BY1 G;  1VQK A;  3EQL C;  4JI4 L;  2TMP A;  3MXN B;  3OTO L;  4CJ1 B;  2EY6 A;  1IBK L;  4K8J A;  4GKK Q;  3KLS A;  1YIJ A;  3S1M H;  3S2H H;  1W6K A;  5C4J B;  2WKC A;  2CQO A;  2RKS A;  5M5W H;  3J81 c;  1HNW Q;  4Y52 H;  4BXX H;  1CZW A;  1WTX A;  1BUV T;  2BH2 A;  2NVY B;  5IOC A;  4CJ0 B;  5D65 A;  4FF4 A;  2XRQ D;  3UE1 A;  3A7L A;  4IQZ A;  4L63 B;  5IYD G;  1XPR A;  1S5B D;  3MVV A;  1K8A C;  1E2V A;  1Y8O B;  3ND9 A;  3E0J A;  1P8L A;  2JA5 G;  1LM0 A;  4DV1 Q;  1VQJ A;  2PW7 A;  1D2B A;  2CVR A;  2M00 A;  5JVG 3;  2KJX A;  1V1O A;  1IXR A;  4JBW A;  4P75 A;  5FO9 B;  1SE3 A;  5IP9 H;  1I6H B;  2H1E A;  2R7F A;  2PZT A;  3WOE A;  2E74 C;  1TY0 A;  2F0P A;  2QCP X;  3H91 A;  4LW1 A;  3M4P A;  1I6V C;  4B3M L;  2Z4H A;  4U68 A;  1JJ2 A;  1DON A;  3C1E A;  1CFM A;  5FKA C;  2F0G A;  1GHJ A;  2K5N A;  2RVL A;  3C2P A;  3S2D B;  5C0X I;  3RZD H;  2K14 A;  3HP3 A;  4JI1 L;  4DR5 Q;  5CV8 A;  2X6G A;  2Z6K C;  3HEJ A;  2FHT A;  4DK6 C;  2UXC Q;  1FR3 A;  1YJ9 A;  3H94 A;  4JV5 L;  4A3M B;  4FF1 A;  3MA2 B;  4CKC A;  5CYU A;  3T1Y Q;  4YHH Q;  4LUV A;  3I8Z A;  1D1K A;  4R8I A;  1UWV A;  4NXM Q;  1TWF B;  4GLX A;  4LF5 L;  2R93 B;  1SNP A;  1S5F D;  4HCS A;  1HQR D;  2ATW A;  1MD2 D;  2HCI A;  1EIY B;  3C46 A;  1SMY C;  1A2T A;  4OIK A;  1I3Q H;  3IRB A;  2IJ0 A;  1R9T H;  2HIX A;  5CBA E;  1STN A;  3AFQ A;  2PO4 A;  3CQZ H;  4EQ5 A;  1B9N A;  3NK9 A;  3MAQ A;  5IGB A;  4HN7 A;  1WTW A;  3DHQ A;  1WTH A;  1Q3L A;  5FO8 B;  4LF6 Q;  4JI5 Q;  1H9M A;  2VB3 X;  3E3X A;  1NNX A;  1MJE A;  2UXD L;  3IKJ A;  3E5S A;  3ZYY X;  1HTP A;  2A74 C;  3DWP A;  3LX0 A;  1ICF B;  3IL8 A;  2VL6 A;  3CU7 A;  4B3S Q;  3CAM A;  4KLK A;  3KDF A;  4JI7 Q;  1ML0 D;  1HFG A;  4IO9 A;  1UE7 A;  2RDH A;  4BBR B;  3F2C A;  4YCW A;  3B6Y A;  4JYA L;  3M4O H;  1IBL Q;  3P75 A;  1E0B A;  1SDF A;  1D5Z C;  1KNE A;  5FLX E;  2E76 C;  1TS4 A;  1QCB D;  3HOU H;  1KLG D;  1QJO A;  3CRK C;  3A74 A;  3QJY A;  1EU3 A;  2LSS A;  4A3K G;  4LFB L;  3A5U A;  3DWQ A;  3KF8 A;  1MBY A;  4NP5 A;  3HOU B;  4Q5V A;  4DUY L;  2F0T A;  4C3J G;  1EOV A;  1STG A;  2A8V A;  1FJG Q;  4FXG C;  3Q24 A;  3GV6 A;  1GUS A;  4DNI A;  4DAY A;  4ZAI A;  4JI3 L;  1QUQ A;  1XMO L;  3GTK H;  3KF6 B;  5KGU A;  4BY7 H;  1U9R A;  5K36 H;  4A93 H;  5H1S E;  4G57 A;  5CC4 A;  2WB1 B;  4ILW A;  1D6E C;  3F2U A;  5J22 A;  1PFN A;  3SK4 A;  1PH6 A;  2MFI A;  5JJI A;  3OIQ A;  5FO7 B;  1SYB A;  4C3I G;  3E9H A;  2A6H C;  1AZP A;  2F03 A;  3QWN A;  1G2S A;  1I4R A;  4R4I A;  2NVQ B;  3MC0 B;  3A7A B;  3KOJ A;  1KC8 C;  1NMF A;  3BVZ A;  4DR7 Q;  4QIW B;  1G91 A;  4YY3 Q;  5M3M H;  1D8L A;  4ID6 A;  3A56 A;  4KK7 A;  4CKE A;  4DR4 Q;  4DUZ Q;  2QF7 A;  2XIW A;  1LAC A;  1MKH A;  1E22 A;  1TS5 A;  4YWK A;  1NR4 A;  4A3I G;  4LUZ A;  5IY0 A;  5IE8 A;  3CHB D;  4M1U B;  1TU2 B;  4X6A H;  4BS9 A;  5C3X A;  1HH2 P;  3VYT A;  1EZ8 A;  2WB1 G;  1MIU A;  2CKZ B;  3S17 H;  1DM0 B;  3A8K E;  2JA6 H;  2Z9H A;  3P20 A;  2E5L L;  1SRO A;  4JBM A;  3I4N H;  4GOP C;  4IUT A;  3HOX H;  1F9Q A;  4DV7 L;  2D9U A;  4IFD G;  1QOH A;  3D4D A;  4OX9 L;  1ESR A;  2NZH A;  5IWA Q;  3S17 B;  3PCO B;  2VQE Q;  2LKV A;  2OF1 A;  1RD9 D;  1IZ6 A;  3G6E A;  3PF5 A;  5ELE A;  2F0S A;  1I4G A;  2WAQ G;  3PO2 G;  4IUN A;  4KI0 A;  4YIJ A;  2L9H A;  2RDF A;  3J81 E;  5EJW A;  5LMN L;  4QL5 A;  2F3W A;  3NBI A;  4B9W A;  1YNX A;  1JJG A;  4X62 L;  1EIH A;  3CC2 A;  2LMC B;  4DV4 L;  3M4Y A;  2B63 H;  4ODG A;  2Q2T A;  1PHJ A;  2F3V A;  1KDA A;  3AFP A;  5C4H A;  1PZI D;  3PUZ A;  4X66 L;  2WII B;  3UDX A;  3HOV H;  1BOS A;  4LF4 L;  5FOB B;  1PFB A;  4DV6 L;  3K6O A;  1XPU A;  4DXF A;  1WTO A;  4FF3 A;  4DPG A;  2UUC Q;  4UP9 A;  1MGS A;  4JBK A;  1EQT A;  3VYR A;  1TKW B;  3VA5 A;  1YI2 A;  1Z47 A;  5GAG C;  4KHP Q;  2WAQ E;  1CUK A;  1SE4 A;  1I50 H;  1U4L A;  2I07 B;  3TSS A;  2LFN A;  4C3H B;  1B3Q A;  4IAL A;  1F9P A;  2EY1 A;  3RR5 A;  3LWE A;  2K05 A;  4QUF A;  2JA8 G;  4A3C G;  4LF9 L;  1VQ6 A;  1RDP D;  4HJ8 A;  1I50 B;  1RHP A;  3S15 H;  2X69 A;  2XVS A;  4DAP A;  4Q0F A;  1Q7Y C;  4JG2 A;  3FMC A;  4TSS A;  5NUC A;  1TS2 A;  1S5C D;  2FMM A;  4XIG S;  1Y14 B;  5AJ3 Q;  4K0K Q;  2Y0S B;  1DOK A;  4JVZ A;  5M5Y H;  5C0X G;  1VQO A;  5IGG A;  2OXP A;  2J0T D;  2XWB B;  4C1N I;  1B44 D;  2R7D A;  2OQK A;  1S72 A;  1N8R C;  5JJZ A;  3S14 B;  3PMF A;  2K50 A;  1A6X A;  1E3P A;  3JAM L;  1XNR L;  1SNC A;  3OYY A;  1SMX A;  2I46 A;  4JOI C;  3T16 A;  3OSO A;  3R2I A;  4X64 Q;  2A6E D;  4DK3 C;  1VF7 A;  2EXZ A;  2K5D A;  3TP5 A;  1MI2 A;  1L0Y B;  1LTA D;  2K75 A;  3STB C;  4A3E G;  3HOW B;  2JN4 A;  3GTM H;  4XYQ A;  2Z6K A;  2NB0 A;  3AYH B;  2EOT A;  2B8F A;  3G48 A;  1ET9 A;  2QW7 A;  2GVA A;  4CDD C;  1E2Z A;  2CW0 D;  1BCP D;  2FJ2 A;  1GOZ A;  4POG A;  2SNS A;  2NZO A;  1I4P A;  3SK8 A;  5I4D A;  3TQY A;  5CBE E;  4DN4 M;  1U5K A;  1H9S B;  3AB9 A;  1PRT C;  4L5S A;  1YVC A;  1X3E A;  2KEE A;  4CKB A;  4RG1 A;  1Z6H A;  2NUC A;  1SYE A;  2RCN A;  3Q6S A;  3TRZ A;  5JEA G;  3J7A V;  2HCC A;  2BDN A;  1FNW A;  3UDF A;  1QZH A;  2VQF L;  2IL8 A;  1VQC A;  4O0A A;  4CDC C;  1NJI C;  3JC6 6;  1ASY A;  3K80 C;  3L3O C;  1LT3 D;  1HFN A;  3PUX A;  4DR3 Q;  3WDN A;  1N34 Q;  5IGD A;  1B7Y B;  4LF7 L;  1EIF A;  2EYH A;  4DNT B;  5A2Q L;  3N52 A;  1EWI A;  3K59 A;  4G4K A;  2EIF A;  3NBH B;  3URY A;  1J5E L;  2F0V A;  2F0W A;  1KAB A;  4HJ9 A;  5IP7 H;  3L7Z C;  1TR5 A;  2KCC A;  4G7O C;  2VUM G;  4A3B G;  2K5W A;  4PQX A;  1XJV A;  1S40 A;  1YNJ D;  4Y7N H;  5C3E G;  1S5D D;  3CCE A;  4A3J H;  1JOK A;  3H0G G;  3Q8D A;  3VA7 A;  4ZLT F;  1ONL A;  5EBC A;  4IPD A;  1K8O A;  1SLJ A;  1PA6 A;  4GZY C;  4Y7N B;  2NVT H;  1GHK A;  1BR9 A;  1TWG H;  4B08 A;  1BBU A;  4HSV A;  2YV5 A;  3NXW A;  1B2T A;  4HIK A;  2KA7 A;  1JE5 A;  3IFD A;  5CV9 A;  4R4Q A;  5CGK A;  1SJH D;  1GO3 E;  3DM3 A;  3M3Y B;  4OXP A;  4A3D H;  5LMU Q;  4EGV A;  3U9S A;  3TS0 A;  1PH9 A;  1YNN D;  1HXY D;  1K83 B;  1N9W A;  1YJN A;  2K33 A;  2B2V C;  1PH4 A;  3R93 A;  2A73 B;  2IWH A;  3VYU A;  4DAM A;  1Q46 A;  4YCV A;  3VYS A;  1EY0 A;  1GUO A;  5T1G A;  2KHS A;  4RA8 A;  3MWY W;  4ABN A;  5C44 B;  4MIU A;  2NN6 H;  5GAH C;  1E1T A;  2WFW A;  1NY4 A;  1KTK A;  1TS3 A;  4BBS B;  5FLX c;  1NSN S;  4KHV A;  2A69 C;  3DUZ A;  3GDE A;  4A3F H;  2G5D A;  4F7X A;  3A8J E;  3GTG B;  2MPM A;  1QVC A;  2E2I H;  1VQI A;  3RN2 A;  3D8G A;  4V19 0;  2V4D A;  1AE2 A;  4PMB A;  1PXU A;  1CKN A;  5DAU A;  1DYQ A;  3OW2 A;  1Y1W B;  5I6Y A;  1HNW L;  5EAY A;  1X54 A;  3J80 L;  3HOY G;  1NBW A;  2UXB L;  1C48 A;  2VB2 X;  3LNN A;  3NHH A;  5TSS A;  1HRJ A;  1NE3 A;  3W1B A;  1F9S A;  1RTO A;  4JC0 A;  5D14 A;  4DAV A;  4A3G H;  2A68 D;  1N36 Q;  1STB A;  3FRP B;  1P16 A;  5DM7 3;  2L12 A;  2CH4 W;  3NSW A;  1LTB D;  1IW7 D;  2HDM A;  3IAY A;  4FXD A;  2K52 A;  1IYJ B;  1EQQ A;  4R4O A;  3S1N H;  4GOP A;  5GAE C;  1AP0 A;  2N8N A;  1Y1V B;  1CKO A;  1M90 C;  1K28 A;  4NPS A;  4FO2 A;  3GTO H;  1SN8 A;  1WCM H;  5C5M A;  4DK0 A;  3PUV A;  1CA5 A;  1HR0 L;  3CCQ A;  4BY1 B;  2KEN A;  5BN3 A;  1QIL A;  4QY7 A;  4X3U A;  3ERO A;  1EL0 A;  3T53 B;  4X3K A;  1HNZ Q;  3KBG A;  2JA7 G;  4JI2 Q;  5ELB A;  5M5X H;  4NXN L;  4KHZ A;  2RSN A;  4NKL A;  5C4X G;  5JJL A;  1K0S A;  4G7Z C;  4PZ7 A;  1GUN A;  1K9M C;  5EPK A;  1I94 Q;  1ICW A;  5CV6 A;  1SFO B;  3M9B A;  4DR5 L;  3NWT A;  1VQN A;  2OEO A;  2IX3 A;  1B70 B;  1I4Q A;  1ZYR D;  5M5X B;  1LT6 D;  1O7Y A;  3L9A X;  2L11 A;  2UXC L;  2JA5 B;  4K8I A;  4YWM A;  2K6A A;  2L0C A;  5EGT A;  5FLM G;  4TRD A;  3EJI A;  1STE A;  3T1Y L;  2R7Z G;  3VDY A;  3HKZ G;  5C4J H;  4BA2 I;  1QWY A;  2PZW A;  4XT3 B;  1VQP A;  2FIN B;  1LO5 D;  4P2C B;  1PYS B;  1PLF A;  1ILP A;  2NVY H;  5ELC A;  1BCP B;  3G4S A;  5IGF A;  1VMP A;  3AU7 A;  3NPP A;  2F0I A;  1STY A;  2UUA L;  3CXC A;  5CR3 A;  2K5H A;  4LK1 C;  3W2D A;  4X3S A;  2D0O A;  5K5P A;  4A3L G;  1VQD A;  2IT1 A;  3LGJ A;  3MXG A;  1SEB D;  1IYU A;  4PNY A;  2F0E A;  3RLN A;  4FYD A;  2DUD A;  1WTP A;  4LF6 L;  4JI5 L;  3J7A 5;  1VQB A;  2FXQ A;  1VQH A;  4IUU A;  1C9O A;  4ZCK A;  3VR5 A;  1I6H H;  4HSP A;  2L1B A;  2BE5 C;  3FKI G;  1TWC B;  1XPO A;  3LWU A;  3J81 j;  1JR0 D;  1JMC A;  3H3V H;  4B3S L;  2PCF B;  3GTJ B;  4BA1 I;  4J15 A;  2NTS A;  4DR1 L;  4H44 C;  4RHS A;  1EY4 A;  3I72 A;  2EVB A;  3HKZ E;  3KBX A;  3S2D H;  3UI2 A;  4GNX A;  4N9P A;  1VCI A;  3GTP H;  4JOI A;  1N33 L;  1IBL L;  2WV6 D;  3BZD B;  3K8A A;  4KKU A;  2ES2 A;  3MHB A;  2ICI A;  5DNF A;  2N78 A;  3GTP B;  1OTC A;  1O7L A;  1UE6 A;  4A3M H;  3HOZ B;  4N9T A;  2YTX A;  4K5W A;  1PYW D;  1WI5 A;  3BDO A;  2O5J C;  1XMQ Q;  2WKD A;  4FDB A;  3QR8 A;  1NR2 A;  1EIG A;  4POF A;  1TWF H;  3QOJ A;  4KMU C;  1FGU A;  2EJM A;  1FJG L;  2R93 H;  2GVB A;  1PH2 A;  3CKI B;  3KUP A;  4QQB X;  1MHW C;  3BZK A;  4WJW A;  3J81 i;  1X56 A;  2PI2 A;  4UDU C;  1V1P A;  4IUP A;  1SR3 A;  1JWS D;  1EQV A;  2Z1C A;  1B50 A;  4OIJ A;  1G51 A;  1BXT A;  2NYZ D;  1BO0 A;  4QUC A;  2KCN A;  3TME A;  4JI8 L;  1VQG A;  5EKI A;  5KND A;  4A3K H;  5JVH 3;  4JK1 C;  1SE8 A;  4RH6 A;  2HT1 A;  2X6L A;  3HOZ G;  4M8A A;  5COY A;  4C3J H;  3KLR A;  4CGY B;  1K0R A;  4DV3 Q;  4A3K B;  1QVG A;  3DLL A;  4DR7 L;  4IPC A;  1PH1 A;  1HNX Q;  3MEH A;  1X9N A;  5EPJ A;  3CC7 A;  5IP9 G;  4QJF A;  1OXV A;  1HA5 A;  4DR4 L;  2PQA B;  3NTK A;  4C3J B;  3OHX C;  5IGC A;  1K8M A;  1X32 A;  1SNM A;  1BVS A;  2MO0 A;  3MFG A;  1PTO D;  3OMG A;  5HY6 A;  4BBR H;  2EXD A;  4DR2 L;  3BVM A;  1U4P A;  1L1O B;  2OT2 A;  3ITP A;  1BCP F;  1M4V A;  3T13 A;  1WD0 A;  2HD3 A;  1ZXT A;  1CT1 D;  3KLS X;  3CCM A;  3G7L A;  1LTL A;  1SAP A;  3RNU A;  4GLV B;  1SRU A;  4IPH A;  4S3S A;  4C3I B;  4ZK9 B;  5JPM C;  5IWA L;  5IYB G;  2VQE L;  4H0L C;  1EEF D;  4I65 A;  3P7J A;  4HID A;  4HIO A;  2ZJQ A;  4B3R Q;  1CQF A;  4FNF A;  3C3L A;  2DN8 A;  1VQ5 A;  4OWW B;  2C9O A;  4B3M Q;  2Z8L A;  4ZQ3 A;  3ERS X;  1G29 1;  1TY2 A;  1BF4 A;  3KLW A;  5FJ8 G;  5JJK A;  3VR4 A;  2HHH Q;  4KJN A;  3DEO A;  5A35 A;  5BN4 A;  1II3 A;  4MZ9 A;  4RGT A;  4A3I B;  1GUT A;  2JK8 A;  1MSH A;  2CW0 C;  4JI1 Q;  5HGT A;  1AH9 A;  2B2V A;  3CCU A;  5I2Y A;  5J3B A;  2AUK A;  1Q86 C;  4IFD J;  3EVQ A;  4JV5 Q;  1HUM A;  2NVQ H;  2XNA C;  3M85 A;  2DNE A;  2NZ1 D;  4H02 A;  1ROD A;  3PO2 H;  2R92 G;  4B3T Q;  2F0F A;  3MXP A;  3OWF A;  1HHV A;  2UUC L;  1B3A A;  3A54 A;  4HR7 B;  2WAQ B;  3PO2 B;  3MXU A;  1G8Z D;  3S9W A;  1FVI A;  1HZ9 A;  2EPB A;  1WVL A;  5KYL A;  5BN5 A;  4O42 A;  3X3N A;  3CPW A;  3K0Y A;  4L5Q A;  3TP8 A;  4DV0 L;  3KFU A;  4WFN 3;  4KHP L;  3JAM c;  1C0A A;  4PZ8 A;  1AFP A;  4JI6 Q;  4KD3 A;  3CCL A;  1WYD A;  4R1J A;  1EFI D;  3W5O A;  5BR8 L;  4G7H C;  1HZA A;  4RGO S;  4LFC Q;  4LFA Q;  4C56 C;  4R4C A;  5EBD A;  2XGT A;  3H3V C;  3BG3 A;  5CMD A;  1VQE A;  3V96 A;  1PVO A;  4OEL B;  5AJ3 L;  1KLU D;  4IUV A;  4UHV A;  3I4O A;  2DY8 A;  1EY7 A;  2YTY A;  1ZEQ X;  1FD7 D;  1C8C A;  2QKI C;  3U50 C;  2WIN B;  1JT8 A;  3K7A B;  2A1A A;  1A8V A;  1BNZ A;  5J39 A;  4AH6 A;  3GTL B;  5K36 G;  4A93 G;  4R4T A;  2KUM A;  2O5I C;  4X64 L;  1ENC A;  1Y8N B;  3I3C A;  1MSG A;  3QOL A;  1D5X C;  1TT2 A;  4LFB Q;  1KHI A;  1CM9 A;  2JA8 B;  2K03 A;  3NEN A;  2AKW B;  2ICE C;  3UE0 A;  3KJP A;  4K2K A;  2RA4 A;  5C0X J;  1ENA A;  5D3D A;  4KN4 C;  5C4Z A;  2Q2U A;  1Q82 C;  2J7Z A;  5M3M G;  4XXE A;  3NE5 B;  1ET6 A;  1TXY A;  2A19 A;  2MUY A;  1XMO Q;  3BS1 A;  1NCV A;  1JB7 A;  4LNQ A;  3OPO A;  5CV5 A;  4C3H H;  4OWX B;  1YZ6 A;  5IT9 L;  2C5C A;  4MTN A;  4FVM A;  3KF8 B;  3BJU A;  5M3F B;  1W3S A;  2G9H D;  3CCJ A;  3PSI A;  2ZJR A;  2R3Z A;  2OTL A;  2N88 A;  4LAA A;  1L0W A;  1SYF A;  3I4N G;  1AW7 A;  4DAY B;  1UAP A;  3HOX G;  1T9H A;  1PDQ A;  1SMY D;  4LF8 Q;  1UNS A;  1TVX A;  2BH8 A;  4RGM A;  4A3E B;  3PIO 3;  3EFX D;  4OEM B;  2F4V Q;  2R61 A;  2K5Q A;  1EOT A;  2SEB D;  2ENB A;  2PI2 E;  5LL6 S;  3EA6 A;  5FK9 C;  1IW7 C;  4DR3 L;  3PIP A;  3ND8 A;  3HKS A;  1U0L A;  3DEP A;  1RKN A;  3S14 H;  2AQ1 B;  2VNU D;  1F2Y A;  4QF4 A;  1U4M A;  4FF2 A;  3VR2 A;  1B9M A;  4DFA A;  4NW2 A;  2KHI A;  2BOS A;  3NUC A;  5JAV A;  2B63 G;  1K3B C;  1KAA A;  5ELO A;  2RSO A;  4RWS C;  3J7A F;  1PTO B;  5M3F G;  2Q8R E;  2E5L Q;  2O2L D;  4GNX C;  1V8Q A;  1IBM Q;  4HAE A;  5JEA J;  3RUZ A;  2BCO A;  3HOW H;  3HOV G;  5AFW A;  1A0I A;  4MNO A;  4MHE A;  1VQ9 A;  2O4X A;  4LWC A;  1VQ4 A;  4K2L A;  3G71 A;  2F3I A;  4K14 A;  3HZX A;  5JPN C;  4DV5 Q;  3CP0 A;  5LMN Q;  2IX1 A;  4JI0 Q;  3TEH B;  1FYC A;  2JSO A;  3F2B A;  4GLA C;  4IPG A;  1PRT F;  1RIP A;  5EKK A;  1PV4 A;  1JOO A;  2J4X A;  3EBE A;  3D0F A;  3J80 c;  1VQL A;  3SK5 A;  2Z6B A;  1XNQ L;  2E2J B;  4OO1 H;  3I73 A;  3QIA A;  5C3E H;  4X66 Q;  2QEX A;  3FDT A;  1Q90 A;  2F0N A;  4LF4 Q;  4EQN A;  4HIM A;  2RHQ B;  1AE3 A;  3HS0 C;  2VUM B;  4A3B B;  4J6H A;  2L15 A;  4L6T B;  5C3E B;  4X65 Q;  2K4K A;  3T1H L;  3H0G B;  3I91 A;  4WOR A;  3O13 A;  1HZB A;  5L37 A;  3MZ5 A;  1PFM A;  2GN5 A;  4TVA B;  2EQS A;  3CME A;  4GKJ Q;  4F87 A;  5T1I A;  4NDX A;  4OON A;  4IZ8 A;  2ASB A;  1A3V A;  1M8A A;  2QIL A;  1LTT D;  2EJG C;  4DR6 L;  3KK7 A;  1EY8 A;  3TBI B;  3U4Z A;  4LF9 Q;  1F77 A;  1NMG A;  3R2T A;  2WAC A;  4MN3 A;  5IOD A;  2LXK A;  3Q22 A;  4AIM A;  4QCL A;  5IIF A;  3NEL A;  4APV A;  1OXU A;  3SXH A;  2K01 A;  3D4R A;  4KY5 A;  1LLR D;  1B53 A;  3T56 B;  4V0B A;  3K58 A;  3H3V I;  4LMQ D;  2H4O A;  1V9P A;  2K1B A;  3K5L A;  3Q23 A;  1LT5 D;  4B9X A;  3NEM A;  3M3Y H;  2E2D C;  2GA4 B;  1JE4 A;  2KQ3 A;  2IX0 A;  1QZG A;  2NWG A;  3CMA A;  2WP8 J;  4L5T A;  3JAM E;  1DCZ A;  1K83 H;  5E3F A;  2F0J A;  3T4A C;  3X3M A;  4ZKB B;  2F0H A;  4HED A;  1LTR D;  4C1N K;  2EE1 A;  1HNZ L;  1NAP A;  2QDB A;  2E2H B;  4GN5 A;  4JI2 L;  3HOY B;  2D62 A;  1JOR A;  1Z9F A;  2RBM A;  1GUW A;  1U4R A;  3MXN A;  4TKO B;  5C44 H;  3GTQ B;  3DMU A;  1PTO F;  1STA A;  2JEA I;  1N32 Q;  3I4M G;  1EWH A;  4HMI A;  5IYC G;  2M9V A;  1DD2 A;  3FEW X;  4RKB A;  4BBS H;  4EQO A;  5D3I B;  1CTM A;  4AQY L;  3GTG H;  3QG1 A;  2C35 B;  2BA0 A;  3N6R A;  2P5Z X;  1Y1W H;  2JA7 H;  5JOB A;  1TWA B;  1XYI A;  4GKK L;  4IN3 A;  2K04 A; 
#chains in the Genus database with same CATH homology
 3VR3 A;  2PQE A;  1TWH B;  1JQY D;  3A8I E;  2AWO A;  2JA7 B;  3BYT B;  1EZ6 A;  4F88 A;  2AUJ D;  3S1R B;  2BDO A;  5C4X B;  2HUG A;  1HA6 A;  5M9O A;  2XRS D;  1WTV A;  3RLF A;  2Q8I B;  1CHQ D;  4DU9 A;  5A2Q E;  2R7Z B;  3HKZ B;  1TII D;  1S4Z A;  1IHZ A;  4HMJ A;  2YU9 B;  1JIC A;  1ILQ A;  3FPP A;  2AQ3 B;  1EYA A;  3QB3 A;  5E4X A;  3D6W A;  4UAI A;  3HGB A;  3H6M A;  4XQN A;  1UEA B;  1SSO A;  3D4W A;  4DK1 A;  1BDO A;  5E1F A;  4XDX A;  1QG7 A;  1WTQ A;  1ZKO A;  2Z4I A;  1AEX A;  3FKI B;  2MJ8 A;  2ZXO A;  1JOQ A;  4FP5 D;  1NUC A;  4E6I A;  2QEJ C;  2JEB I;  4L8J A;  3SK6 A;  2NVX B;  3GO5 A;  3S1Q B;  1A3T A;  1G6Z A;  4C2M B;  4XQQ A;  3D31 A;  1WD1 A;  1EEI D;  1PRT D;  1G2T A;  1VF5 C;  2B2W C;  3J80 E;  4IUQ A;  3S1M B;  3S2H B;  5M5W B;  2JP1 A;  2RDG A;  4ZRZ A;  1IKL A;  4QB4 A;  2ID0 A;  3QO2 A;  2F0M A;  1T5X D;  1EY5 A;  2MGS A;  1OO9 B;  4ZKC B;  1F2Z A;  3TP6 A;  3SVM A;  1IKM A;  3D6C A;  1RCV D;  5FLX L;  5KIX A;  2MHV A;  2AWN A;  4KD4 A;  3TDQ A;  1HTL D;  5I6W A;  4WRD A;  1JCK B;  1IL8 A;  3NWS A;  1GXD C;  2HQE A;  5EQ0 A;  3V2T A;  1QNU A;  1LT4 D;  4K5X A;  1DOM A;  1X3Q A;  1F2M A;  3D3R A;  4XQJ A;  1L0X B;  3NQI A;  4TQU S;  5KEE A;  3RZD B;  3RMH A;  2RQX A;  1TQO A;  1PZJ D;  3TZU A;  2M2L A;  3W3A A;  2EZV A;  2ZXP A;  3H09 A;  5E4W C;  5KNB A;  3Q0A A;  1KNA A;  3A55 A;  2A69 D;  4F8M A;  1I3Q B;  1UUP A;  1R9T B;  1V43 A;  3CQZ B;  2ZXR A;  1JB3 A;  3I4L A;  1O78 A;  4K6L A;  2B2Y A;  2SDF A;  2EYO A;  4LJZ C;  4R9W A;  1E2W A;  3K5O A;  4PV1 C;  1DXM A;  2R92 B;  1CZG A;  5ELD A;  2A6E C;  2KED A;  2B2T C;  4ZUJ A;  1LV9 A;  1Q12 A;  4RCN A;  3J81 L;  4QMG A;  3V05 A;  3BVG A;  3DM1 A;  1Y69 U;  2HDL A;  2SOB A;  5I2X A;  3AMU A;  3NTI A;  3BYY B;  1Z7T A;  2EYJ A;  4K6D A;  1XTC D;  3M4O B;  1OXS C;  1LTS D;  1W6J A;  5F2D A;  4OHJ A;  1BCP C;  5DEH A;  4IFD H;  4DNR B;  1H9R A;  5C3W A;  4BWG B;  5EKL A;  4OO1 I;  3I70 A;  2E75 C;  5ISR A;  2G9D A;  1AZQ A;  2KOL A;  3TZD A;  1CQV A;  2B2U C;  1A2U A;  1BBX C;  1SNQ A;  4XYO A;  2SNM A;  2XSC A;  2R6G A;  3GQB A;  1KDB A;  1J9O A;  4KKS A;  3K57 A;  3GTK B;  1RJT A;  4R8N A;  2XN9 C;  4BY7 B;  4A93 B;  1HPC A;  1OXX K;  2ZT9 C;  2CHB D;  2IW3 A;  1V1P B;  2N55 A;  1PRT B;  3OOC A;  5M3M B;  1QNK A;  1YNJ C;  1Y8P B;  1O7Z A;  4KN7 C;  1HCZ A;  2EY2 A;  2FMC A;  4CHT B;  2F0U A;  5KRU A;  3C1F A;  2BE5 D;  1H9K A;  4DXG A;  1KDC A;  3BDL A;  1D5M C;  3M7N A;  2JA6 B;  3NQT A;  3I4N B;  2CQA A;  3HOX B;  5LHY 1;  1YNN C;  1D1I A;  2EYM A;  2MP1 A;  1H9S A;  4PMC A;  4EVO A;  5C0X H;  1CA6 A;  1J8I A;  1QE6 A;  5G3L F;  2F0L A;  4NMZ A;  2K28 A;  4ULL A;  4DA2 A;  3PIP 3;  1Q1E A;  2F0D A;  2L55 A;  3NP8 A;  4KY6 A;  3U9O A;  1RF2 D;  2EYP A;  2EJF C;  2F0K A;  2NN6 I;  3FVQ A;  2B63 B;  1VDZ A;  3DWA A;  1DZ1 A;  4RHR A;  3GD7 A;  3HOV B;  3NBH A;  1DOL A;  1C4Q A;  4XTC S;  3VR6 A;  5C6A A;  1Q1B A;  2A68 C;  2AQ2 B;  3WOF A;  4J1M A;  5CV4 A;  1JWM D;  2B2W A;  1PTO H;  5LL6 X;  1SJE D;  1LTG D;  1T5E A;  3PUW A;  5J1Z A;  1B1Z A;  3MFY A;  4I7Z C;  4IUR A;  3NTH A;  5KYI A;  5JEA H;  3P1H A;  3S15 B;  4FXK C;  1B4O A;  1SYG A;  2XWJ B;  4DF7 A;  3OW7 A;  1S5E D;  4H13 C;  4RKL A;  4Z9C B;  5ELF A;  2B8G A;  5M5Y B;  3M7G A;  1ESF A;  5CV7 A;  3SE0 A;  1GUG A;  4C3H G;  2A5H A;  1ZYR C;  3PV0 A;  3K5M A;  4J8Q A;  4EQP A;  1EYC A;  3SR1 A;  1JWU D;  2YYZ A;  3HRZ C;  3MTS A;  4RCO A;  1F2L A;  3HG9 A;  2B39 A;  4CBV A;  1WTR A;  3R3O A;  4KJO A;  3GTM B;  4K5V A;  2K32 A;  4PMW A;  2D5D A;  4ME5 A;  1XWE A;  2L4N A;  5IT9 E;  5I9P A;  1I4H A;  2PPB C;  1A3U A;  4ZUI A;  2DY7 A;  2A6H D;  1FNU A;  3I90 A;  4KKT A;  4OL7 A;  1LAB A;  1VMC A;  1O80 A;  1DJR D;  2K7V A;  3RD4 A;  2B2Y C;  1XX8 A;  2LS0 1;  3I4M B;  1SBB B;  3ONA B;  3J7Y W;  3OIP A;  3DXJ C;  1CK1 A;  5IGE A;  4U67 3;  1XXG A;  1JC7 A;  3GV3 A;  5DM6 3;  1GJX A;  2PZU A;  1EU4 A;  4HCE A;  4RGN A;  4HTH A;  2B2T A;  2BA1 A;  1Q8I A;  3SDZ A;  4OO1 G;  1LTI D;  1R4Q B;  5EPL A;  1SND A;  2EDG A;  4CJ2 C;  2F1M A;  1SXT A;  1SYD A;  4XT1 B;  5HUR A;  3TN2 A;  3G6J B;  2EY5 A;  1PMR A;  4A3J B;  1EWC A;  3IFT A;  2NTT A;  2NVT B;  4X3T A;  1TWG B;  1R4P B;  2F0O A;  2PMZ B;  3PO3 B;  2B2U A;  3K5N A;  2FFK B;  1EYD A;  2PNR C;  2TSS A;  1IYV A;  4AYB B;  1SNO A;  4A3D B;  1AN8 A;  3OWE B;  3GP7 A;  3FPU B;  4RAU C;  3SHL A;  3T51 B;  1EY6 A;  4KTA A;  1STH A;  1H9J A;  1SYC A;  1F9R A;  2PYK A;  2F4I A;  4OGQ C;  5G3L D;  1PTO C;  1CHP D;  1PZK D;  3SEB A;  3S16 B;  2L5T A;  4DGZ A;  2KEC A;  4A3F B;  5I9O A;  2E2I B;  5KNC A;  1I4X A;  5COR A;  2LY7 A;  2IPK D;  1EY9 A;  4A3G B;  4H7B A;  3PUY A;  4O1N A;  2EYF A;  4KY7 A;  2D2C C;  1SE2 A;  2F0Q A;  5C5L A;  4KV6 A;  3S1N B;  2JXM B;  2NN6 G;  2JE6 I;  1X3P A;  2KVM A;  3GTO B;  1WCM B;  1QB5 D;  2DNC A;  1HQM C;  3OMC A;  3R8B A;  1FNV A;  2VXW A;  1ENF A;  3BDC A;  2Q8T A;  1A15 A;  4IFD I;  4RFB A;  2NBF A;  1CI3 M;  4ZYS A;  1BQQ T;  3CRL C;  1HUN A;  2JYO A;  1RTN A;  3RZO B;  1OXT A;  1FGB D;  2PW5 A;  3E6Z X;  3TP7 A;  2EYL A;  3ERQ A;  3EQL C;  2TMP A;  4CJ1 B;  2EY6 A;  4K8J A;  3KLS A;  1W6K A;  5C4J B;  2WKC A;  2RKS A;  1CZW A;  1WTX A;  1BUV T;  2NVY B;  5IOC A;  4CJ0 B;  5D65 A;  4FF4 A;  2XRQ D;  3A7L A;  4IQZ A;  4L63 B;  1S5B D;  3MVV A;  1E2V A;  1Y8O B;  3ND9 A;  3E0J A;  2PW7 A;  1D2B A;  2CVR A;  2M00 A;  5JVG 3;  2KJX A;  1V1O A;  4JBW A;  5FO9 B;  1SE3 A;  1I6H B;  2H1E A;  2PZT A;  3WOE A;  2E74 C;  1TY0 A;  2F0P A;  2QCP X;  3H91 A;  1I6V C;  2Z4H A;  4U68 A;  1DON A;  3C1E A;  1CFM A;  5FKA C;  2F0G A;  1GHJ A;  2RVL A;  3C2P A;  3S2D B;  5C0X I;  3HP3 A;  5CV8 A;  2X6G A;  3HEJ A;  2FHT A;  1FR3 A;  3H94 A;  4A3M B;  4FF1 A;  3MA2 B;  4CKC A;  5CYU A;  3I8Z A;  1D1K A;  4R8I A;  1TWF B;  2R93 B;  1SNP A;  1S5F D;  4HCS A;  1HQR D;  1MD2 D;  2HCI A;  3C46 A;  1SMY C;  1A2T A;  4OIK A;  2IJ0 A;  5CBA E;  1STN A;  2PO4 A;  1B9N A;  3NK9 A;  3MAQ A;  5IGB A;  4HN7 A;  1WTW A;  3DHQ A;  1Q3L A;  5FO8 B;  1H9M A;  2VB3 X;  3IKJ A;  3E5S A;  3ZYY X;  1HTP A;  2A74 C;  3DWP A;  3LX0 A;  3IL8 A;  3CU7 A;  1ML0 D;  1HFG A;  2RDH A;  4BBR B;  3P75 A;  1E0B A;  1SDF A;  1D5Z C;  1KNE A;  5FLX E;  2E76 C;  1TS4 A;  1QCB D;  1KLG D;  1QJO A;  3CRK C;  3QJY A;  1EU3 A;  3DWQ A;  3KF8 A;  1MBY A;  4NP5 A;  3HOU B;  4Q5V A;  2F0T A;  4C3J G;  1STG A;  4FXG C;  3Q24 A;  3GV6 A;  1GUS A;  4DAY A;  4ZAI A;  5KGU A;  1U9R A;  5K36 H;  4G57 A;  5CC4 A;  2WB1 B;  4ILW A;  1D6E C;  3F2U A;  5J22 A;  1PFN A;  3SK4 A;  3OIQ A;  5FO7 B;  1SYB A;  4C3I G;  2A6H C;  1AZP A;  2F03 A;  3QWN A;  1G2S A;  1I4R A;  2NVQ B;  3MC0 B;  3A7A B;  3BVZ A;  4QIW B;  1G91 A;  4ID6 A;  3A56 A;  4KK7 A;  4CKE A;  2QF7 A;  2XIW A;  1LAC A;  1TS5 A;  1NR4 A;  3CHB D;  4M1U B;  1TU2 B;  4BS9 A;  5C3X A;  3VYT A;  1EZ8 A;  1DM0 B;  3A8K E;  3P20 A;  4IUT A;  1F9Q A;  2D9U A;  4IFD G;  1QOH A;  3D4D A;  1ESR A;  3S17 B;  2LKV A;  2OF1 A;  1RD9 D;  5ELE A;  2F0S A;  1I4G A;  4IUN A;  4KI0 A;  4YIJ A;  2L9H A;  2RDF A;  3J81 E;  5EJW A;  2F3W A;  3NBI A;  4B9W A;  1EIH A;  2LMC B;  3M4Y A;  4ODG A;  2F3V A;  1KDA A;  5C4H A;  1PZI D;  3PUZ A;  2WII B;  1BOS A;  5FOB B;  1PFB A;  3K6O A;  4DXF A;  1WTO A;  4FF3 A;  1MGS A;  1EQT A;  3VYR A;  1TKW B;  3VA5 A;  1Z47 A;  1SE4 A;  4C3H B;  1U4L A;  2I07 B;  3TSS A;  2LFN A;  4IAL A;  1F9P A;  2EY1 A;  3LWE A;  2K05 A;  4QUF A;  1RDP D;  1I50 B;  1RHP A;  2X69 A;  2XVS A;  4DAP A;  4Q0F A;  3FMC A;  4TSS A;  5NUC A;  1TS2 A;  1S5C D;  2FMM A;  4XIG S;  2Y0S B;  1DOK A;  5C0X G;  5IGG A;  2OXP A;  2J0T D;  2XWB B;  4C1N I;  1B44 D;  5JJZ A;  3S14 B;  3PMF A;  1A6X A;  3JAM L;  1SNC A;  2I46 A;  3T16 A;  3OSO A;  3R2I A;  2A6E D;  1VF7 A;  2EXZ A;  2K5D A;  3TP5 A;  1MI2 A;  1L0Y B;  1LTA D;  3HOW B;  4XYQ A;  2NB0 A;  2EOT A;  2B8F A;  1ET9 A;  1E2Z A;  2CW0 D;  1BCP D;  2FJ2 A;  1GOZ A;  2SNS A;  1I4P A;  3SK8 A;  5I4D A;  5CBE E;  4DN4 M;  1H9S B;  3AB9 A;  1PRT C;  2KEE A;  4CKB A;  1Z6H A;  2NUC A;  1SYE A;  3Q6S A;  5JEA G;  3J7A V;  2HCC A;  2BDN A;  1FNW A;  2IL8 A;  3L3O C;  1LT3 D;  1HFN A;  3PUX A;  3WDN A;  5IGD A;  2EYH A;  4DNT B;  5A2Q L;  3N52 A;  3K59 A;  4G4K A;  3URY A;  2F0V A;  2F0W A;  1KAB A;  3L7Z C;  1TR5 A;  2KCC A;  4G7O C;  2K5W A;  4PQX A;  1YNJ D;  1S5D D;  1JOK A;  3VA7 A;  4ZLT F;  1ONL A;  5EBC A;  1K8O A;  4GZY C;  4Y7N B;  1GHK A;  1BR9 A;  4B08 A;  4HSV A;  3NXW A;  1B2T A;  2KA7 A;  3IFD A;  5CV9 A;  5CGK A;  1SJH D;  3M3Y B;  4EGV A;  3U9S A;  1YNN D;  1HXY D;  1K83 B;  2K33 A;  2B2V C;  3R93 A;  2A73 B;  2IWH A;  3VYU A;  3VYS A;  1EY0 A;  1GUO A;  5T1G A;  2KHS A;  4RA8 A;  3MWY W;  4ABN A;  5C44 B;  4MIU A;  2NN6 H;  1KTK A;  1TS3 A;  4BBS B;  1NSN S;  4KHV A;  2A69 C;  3DUZ A;  3GTG B;  4F7X A;  3A8J E;  2MPM A;  4V19 0;  3D8G A;  2V4D A;  4PMB A;  1PXU A;  5DAU A;  1DYQ A;  1Y1W B;  5I6Y A;  3J80 L;  1C48 A;  2VB2 X;  3LNN A;  3NHH A;  5TSS A;  1HRJ A;  1F9S A;  1RTO A;  5D14 A;  4DAV A;  2A68 D;  1STB A;  3FRP B;  5DM7 3;  2L12 A;  3NSW A;  1LTB D;  1IW7 D;  2HDM A;  3IAY A;  4FXD A;  1AP0 A;  1Y1V B;  4FO2 A;  5C5M A;  4DK0 A;  3PUV A;  1CA5 A;  4BY1 B;  5BN3 A;  1QIL A;  4X3U A;  1EL0 A;  3ERO A;  3T53 B;  4X3K A;  3KBG A;  5ELB A;  4KHZ A;  2RSN A;  4NKL A;  4G7Z C;  1GUN A;  5EPK A;  1ICW A;  5CV6 A;  1SFO B;  3NWT A;  2OEO A;  2IX3 A;  1ZYR D;  1I4Q A;  5M5X B;  1LT6 D;  1O7Y A;  3L9A X;  2L11 A;  2JA5 B;  4K8I A;  2K6A A;  2L0C A;  5EGT A;  4TRD A;  3EJI A;  1STE A;  4BA2 I;  1QWY A;  2PZW A;  4XT3 B;  2FIN B;  1LO5 D;  4P2C B;  1PLF A;  1ILP A;  5ELC A;  1BCP B;  5IGF A;  1VMP A;  3AU7 A;  3NPP A;  2F0I A;  1STY A;  5CR3 A;  4LK1 C;  3W2D A;  4X3S A;  5K5P A;  2IT1 A;  3MXG A;  1SEB D;  1IYU A;  4PNY A;  2F0E A;  4FYD A;  1WTP A;  4IUU A;  3VR5 A;  4HSP A;  2L1B A;  2BE5 C;  1TWC B;  3LWU A;  1JR0 D;  3GTJ B;  2PCF B;  4BA1 I;  2NTS A;  4H44 C;  4RHS A;  1EY4 A;  3I72 A;  2EVB A;  3KBX A;  3UI2 A;  4N9P A;  1VCI A;  2WV6 D;  3BZD B;  4KKU A;  3MHB A;  2ICI A;  5DNF A;  3GTP B;  1O7L A;  3HOZ B;  4N9T A;  4K5W A;  1PYW D;  3BDO A;  2O5J C;  2WKD A;  1NR2 A;  1EIG A;  3QOJ A;  4KMU C;  2EJM A;  3CKI B;  3KUP A;  4WJW A;  4UDU C;  1V1P A;  4IUP A;  1JWS D;  1EQV A;  2Z1C A;  1B50 A;  4OIJ A;  1BXT A;  2NYZ D;  1BO0 A;  4QUC A;  2KCN A;  3TME A;  5EKI A;  5KND A;  5JVH 3;  4JK1 C;  4RH6 A;  2X6L A;  4M8A A;  5COY A;  3KLR A;  4CGY B;  4A3K B;  3MEH A;  5EPJ A;  1OXV A;  1HA5 A;  3NTK A;  4C3J B;  3OHX C;  5IGC A;  1K8M A;  1X32 A;  1SNM A;  3MFG A;  1PTO D;  3OMG A;  3BVM A;  1U4P A;  2OT2 A;  3ITP A;  1BCP F;  1M4V A;  3T13 A;  1WD0 A;  1ZXT A;  1CT1 D;  3KLS X;  3G7L A;  1SAP A;  4ZK9 B;  4S3S A;  4C3I B;  5JPM C;  4H0L C;  1EEF D;  4I65 A;  3P7J A;  1CQF A;  4FNF A;  3C3L A;  2DN8 A;  2C9O A;  2Z8L A;  4ZQ3 A;  1G29 1;  1TY2 A;  1BF4 A;  3VR4 A;  4KJN A;  3DEO A;  5A35 A;  5BN4 A;  1II3 A;  4RGT A;  4A3I B;  1GUT A;  1MSH A;  2CW0 C;  5HGT A;  2B2V A;  5I2Y A;  2AUK A;  4IFD J;  3EVQ A;  1HUM A;  2XNA C;  3M85 A;  2DNE A;  2NZ1 D;  1ROD A;  2F0F A;  3MXP A;  3OWF A;  1HHV A;  1B3A A;  3A54 A;  4HR7 B;  2WAQ B;  3PO2 B;  3MXU A;  1G8Z D;  3S9W A;  2EPB A;  1WVL A;  5KYL A;  5BN5 A;  4O42 A;  3X3N A;  3K0Y A;  3TP8 A;  4WFN 3;  1AFP A;  4KD3 A;  1EFI D;  4G7H C;  4RGO S;  4C56 C;  5EBD A;  3H3V C;  3BG3 A;  5CMD A;  3V96 A;  1KLU D;  4IUV A;  2DY8 A;  1EY7 A;  1ZEQ X;  1FD7 D;  1C8C A;  2QKI C;  2WIN B;  3K7A B;  1BNZ A;  5J39 A;  3GTL B;  5K36 G;  2KUM A;  2O5I C;  1ENC A;  1Y8N B;  3I3C A;  1MSG A;  3QOL A;  1D5X C;  1TT2 A;  1CM9 A;  2JA8 B;  2K03 A;  2ICE C;  4K2K A;  2RA4 A;  5C0X J;  1ENA A;  5D3D A;  4KN4 C;  5C4Z A;  2J7Z A;  4XXE A;  3NE5 B;  1ET6 A;  2MUY A;  3BS1 A;  1NCV A;  3OPO A;  5CV5 A;  5IT9 L;  2C5C A;  4FVM A;  5M3F B;  2G9H D;  2R3Z A;  2N88 A;  4LAA A;  1SYF A;  1AW7 A;  1UAP A;  1PDQ A;  1SMY D;  1UNS A;  1TVX A;  4RGM A;  4A3E B;  3PIO 3;  3EFX D;  2R61 A;  2K5Q A;  1EOT A;  2SEB D;  2ENB A;  5LL6 S;  3EA6 A;  5FK9 C;  1IW7 C;  3ND8 A;  3DEP A;  1RKN A;  2AQ1 B;  2VNU D;  1F2Y A;  4QF4 A;  1U4M A;  4FF2 A;  3VR2 A;  1B9M A;  4DFA A;  4NW2 A;  2BOS A;  3NUC A;  5JAV A;  1KAA A;  2RSO A;  4RWS C;  3J7A F;  1PTO B;  2Q8R E;  2O2L D;  1V8Q A;  4HAE A;  5JEA J;  3RUZ A;  2BCO A;  5AFW A;  4MHE A;  2O4X A;  4K2L A;  4K14 A;  3HZX A;  5JPN C;  2IX1 A;  1FYC A;  2JSO A;  1PRT F;  5EKK A;  1JOO A;  2J4X A;  3SK5 A;  2E2J B;  4OO1 H;  3I73 A;  3QIA A;  3FDT A;  1Q90 A;  2F0N A;  4EQN A;  3HS0 C;  2VUM B;  4A3B B;  4J6H A;  4L6T B;  5C3E B;  3H0G B;  3I91 A;  4WOR A;  3O13 A;  3MZ5 A;  1PFM A;  4F87 A;  5T1I A;  4NDX A;  4IZ8 A;  1A3V A;  1M8A A;  2QIL A;  1LTT D;  2EJG C;  3KK7 A;  1EY8 A;  3TBI B;  1F77 A;  3R2T A;  2WAC A;  4MN3 A;  5IOD A;  3Q22 A;  4QCL A;  5IIF A;  1OXU A;  3SXH A;  2K01 A;  3D4R A;  4KY5 A;  1LLR D;  1B53 A;  3T56 B;  4V0B A;  3K58 A;  4LMQ D;  2H4O A;  2K1B A;  3K5L A;  3Q23 A;  1LT5 D;  4B9X A;  2E2D C;  2GA4 B;  1JE4 A;  2KQ3 A;  2IX0 A;  2NWG A;  2WP8 J;  3JAM E;  1DCZ A;  5E3F A;  2F0J A;  3T4A C;  3X3M A;  4ZKB B;  2F0H A;  4HED A;  1LTR D;  4C1N K;  2EE1 A;  1NAP A;  2QDB A;  2E2H B;  3HOY B;  2D62 A;  1JOR A;  2RBM A;  1GUW A;  1U4R A;  3MXN A;  4TKO B;  3GTQ B;  3DMU A;  1PTO F;  1STA A;  2JEA I;  1EWH A;  4HMI A;  2M9V A;  1DD2 A;  3FEW X;  4RKB A;  4EQO A;  5D3I B;  1CTM A;  3QG1 A;  2BA0 A;  3N6R A;  5JOB A;  1TWA B;  1XYI A;  4IN3 A;  2K04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...