4OL7A

Crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 39
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ol7A00
1EY5A 3LX0A 3EROA 3MVVA 4RKBA 4IZ8A 3SXHA 3VA5A 2EY1A 5C5MA 4EQOA 4MIUA 1JOQA 4KTAA 3D8GA 3P75A 3HZXA 2O4XA 2SNMA 3D4DA 5K5PA 2EYOA 2EYFA 3ITPA 5KEEA 2F3WA 4KHVA 4EQNA 2F3VA 2OF1A 5DEHA 3PMFA 5F2DA 5I9OA 5J39A 4K8IA 5EKKA 2F0KA 4LAAA 3DHQA 3C1EA 5J1ZA 4F7XA 2F0IA 5CV5A 2F0TA 2OXPA 3MZ5A 5IGDA 4ZUIA 4B9XA 1F2ZA 3QB3A 4WORA 1SNMA 1STBA 3NHHA 2EYMA 3OMCA 2EXZA 5E1FA 4DF7A 4S3SA 5C3XA 2EYHA 3NK9A 3SHLA 5I6WA 3EVQA 2F0PA 2F0GA 4KD4A 2PYKA 5IOCA 2EY5A 2PZUA 5CV9A 2QDBA 3OMGA 5IGFA 5IGEA 5CR3A 2NUCA 4NP5A 4PMCA 1JOOA 1TQOA 2PW5A 1EZ8A 2PZWA 2F0LA 3H6MA 3R3OA 4J6HA 5CC4A 1SYDA 1EQVA 5CV8A 1A2TA 2KHSA 4HMIA 4OL7A 1NUCA 3TP6A 3SK4A 1SYGA 1TR5A 3D6CA 4HTHA 1SNQA 2F0JA 5C4HA 2F0QA 1SNOA 1A3TA 2F0WA 1F2MA 1KABA 4PMBA 3NP8A 3OSOA 4KY7A 5IODA 4K6DA 1SYFA 2OEOA 3SK6A 4DU9A 4G57A 4IUNA 3QOLA 4N9PA 1KDAA 2F0DA 2M00A 1STGA 1EYCA 4I65A 5EGTA 3S9WA 1TT2A 1AEXA 5CV6A 1EYAA 5IGGA 5IGBA 5KIXA 4K5XA 1SYEA 5HGTA 3BDLA 5IIFA 1A3VA 2RDFA 1A2UA 3T13A 1EYDA 1NSNS 2KQ3A 5IGCA 4WRDA 2EYPA 2F0VA 5HURA 1ENCA 4K5WA 2PZTA 2F0OA 1EY8A 4B9WA 3SR1A 1EY4A 1A3UA 4NMZA 4J1MA 4ZUJA 3T16A 4K5VA 4K8JA 4ZQ3A 4ID6A 5I9PA 4H7BA 5C6AA 3C1FA 3MHBA 1ENAA 5JAVA 4ODGA 1EY9A 2RBMA 1JOKA 3EJIA 5C4ZA 2F0UA 3HEJA 2PQEA 3TP7A 4DGZA 5I6YA 2EYLA 4TRDA 5M9OA 5EKLA 3MEHA 3U9OA 1EY7A 4KJNA 2EY6A 2LKVA 3NQTA 5KRUA 2WACA 5KYIA 1F2YA 3P1HA 1KAAA 1II3A 5JOBA 2PW7A 2F0HA 4PNYA 1STYA 2F0EA 3DMUA 4QF4A 2EY2A 1STNA 5C5LA 1SYBA 3NXWA 5ISRA 3BDCA 3TMEA 4YIJA 2SNSA 5E3FA 5NUCA 3QOJA 1EY0A 1EY6A 1EZ6A 1IHZA 4HMJA 4IALA 3SK8A 4EQPA 4NKLA 3E5SA 3NUCA 2RKSA 5CV4A 4DFAA 4F8MA 1RKNA 2EYJA 3ERQA 2ENBA 4K2KA 5C3WA 2HQEA 3SK5A 1JORA 4RKLA 1SNPA 1U9RA 2F0NA 4K2LA 2F0SA 5CV7A 5KGUA 1STHA 4NDXA 3D4WA 4KY5A 1SYCA 4KV6A 4N9TA 3TP5A 4EVOA 4KY6A 1KDBA 4R8NA 4KJOA 5CGKA 4KD3A 3MXPA 2F0FA 4K14A 1SNCA 3OWFA 4QMGA 1STAA 4ME5A 5DAUA 3TP8A 3V2TA 4QB4A 4E6IA 5KYLA 1KDCA 2SOBA 5J22A 2F0MA 1SNDA 3RUZA
chains in the Genus database with same CATH superfamily
2V1CC 3UI2A 2I46A 4LUZA 1LTID 4AYBE 1VQJA 1B3AA 1HRJA 1YHQA 1KL9A 4OIKA 3HP3A 3HZXA 5K5PA 1CHQD 5KEEA 3K57A 4YCUA 4BBRG 4JV5Q 2WV6D 5LMNQ 1VQNA 4POGA 2EJGC 3BU2A 3S1NB 2CW0C 4PZ6A 4MN3A 5GADC 1ESFA 5EKIA 3GTOB 4C2MH 4B3MQ 1IYUA 1YIJA 4GN5A 2PZUA 3HOVH 4IFDG 1PFSA 1H95A 4LF8Q 2JP1A 4JOIC 1LTRD 2E5LL 2Z4HA 2E2IB 3H6MA 2Z6BA 1HUNA 3RNUA 3I91A 2MHVA 3MXNB 3PF5A 4A3IH 2UXBL 3TRZA 3T1YQ 2R3ZA 1S3OA 2RDHA 2B63B 2A6HC 2VUMG 3CC4A 4JI7Q 3OWEB 1QZGA 3JAME 2VQEQ 3HOUG 1SYEA 4JI4Q 1E1TA 4JBJA 2FHTA 5JEAJ 4DV5L 4AYBB 4A3GB 2Q2UA 2CWAA 4QGUA 3DUZA 1P16A 3CCQA 1I3QH 5COYA 2I0QA 3CW2C 5C4XG 1OXSC 2F0UA 4RA8A 5I6YA 2UUBQ 3K7AH 4GNXA 1TY0A 2DNCA 5DM63 4LF4Q 5JEAH 1PV4A 1J5EL 3E9IA 1YITA 3E3XA 1ZXTA 1KRSA 4PNYA 4Z9CB 5ISRA 1GUNA 1AZQA 3OPOA 3H94A 1HNZQ 2N8NA 4QUFA 1TKWB 3ERSX 4IALA 5T1GA 4DUZQ 3G48A 1VQGA 3ERQA 2KBNA 4RKLA 4ME3A 4TSSA 2F0SA 3BG3A 4HSVA 3JC66 3FP9A 4GOPA 4EVOA 3DLLA 3A7LA 4K14A 1M4VA 5E7NA 4BBSG 2VS1A 2VY3A 1B2TA 3I4LA 4UP7A 3NSWA 1MGSA 2BDOA 2R7ZH 2A8VA 3S17B 2Z0SA 2A69C 3KBXA 4XQQA 2QCPX 1JCKB 1JOQA 1MD2D 2SDFA 4LF9L 4WJWA 1AZPA 1PH2A 3CP0A 1Q1EA 3PMFA 5J39A 2MFIA 3CMAA 5LL6X 4X64Q 4X66L 2ALYB 1C7YA 2GVBA 3RZOB 1ILPA 1IKLA 2EPBA 3K59A 2K5DA 1AE2A 2YU9B 4F88A 1PH1A 1DOLA 4YHHL 1JT8A 1A63A 1LABA 1BR9A 3MEFA 3HOYB 1JOOA 2PW5A 3NQIA 5CYUA 2NVXB 4J6HA 4CDEC 1PYBA 2AWNA 3RN2A 3ICEA 4G7ZC 4RHRA 2F0QA 3VR3A 1PH3A 1L1OA 2A1AA 4LUVA 1I4QA 1PXUA 3HOZB 2WFWA 3J81i 2A19A 1TS2A 2QF7A 1EYAA 4DUYL 4RGTA 4X62Q 4U68A 3KLWA 1EYDA 4HIDA 3S15B 1Y1WH 1B70B 3FEWX 1XMOQ 2BH2A 2BE5D 1HQRD 1ZEQX 2DY7A 4J1MA 5EPKA 4K5VA 1VQLA 4A3MB 5C6AA 2OT2A 1YNJD 4DK3C 5JAVA 1S72A 4DK1A 4A3KH 3HOXH 1K83B 2WP8J 1VQMA 3DEOA 2ZJRA 4FDBA 1PHJA 2DN8A 3BVGA 1Q8KA 3U4VA 3R93A 1OXTA 1V1QA 2IT1A 3J7A5 1SDFA 4A76A 2D5DA 4AQYQ 4LWCA 2RKSA 5LL6S 2EYJA 3PIOA 3KF8A 4DV6L 5KGUA 3M4OH 1ASZA 1PZKD 5E4WC 4KD3A 3M9BA 4TKOB 2CKZB 1E2VA 2PI2A 5A2QE 3HFZB 4HR7B 5M3FB 1O7YA 2RDFA 3RUZA 2HCCA 2NVYB 4AIMA 2M2LA 4BY7H 4UP8A 1RTNA 4L5SA 1PRTF 2HDMA 1GUOA 1QUQB 2QA4A 4DR2L 4KHVA 1D8LA 5ELOA 4DNTB 1IW7C 1X3PA 3HOWH 2CHBD 1D5ZC 4GN3B 3PIPA 1FYCA 2K28A 4OWWB 5BN5A 4C1NK 1L0XB 4KKTA 2IX3A 4JVZA 3S1QB 3MA2B 4FF1A 3C2PA 3A8IE 5C4XH 3BS1A 4BXXG 4ULLA 4KD4A 1Y1VH 1X3EA 3K7UC 4X3KA 2QDBA 2K75A 3KFUA 1N34L 1E22A 3KLSA 4GLVB 4DV7L 1TQOA 1L1OC 4YWMA 3PO3G 1X55A 2ICIA 4BXXH 4X65Q 1NUCA 1DGSA 2J0TD 1TR5A 2IWHA 4CDDC 4ZCKA 5GAHC 1CSPA 2NVQH 1GKHA 1EQQA 4ILWA 1KD1C 1RTOA 4A93B 1PZJD 4UY8C 3LNNA 4P75A 5IGBA 1AE3A 1IBLQ 1WD1A 5I4DA 2XN9C 4HAEA 1BKBA 1IL8A 3ER0A 3IFDA 3G6JB 2XVSA 4YHHQ 4QCLA 1WCMG 1PYSB 1NBWA 1QG7A 2NN6G 1PH9A 1CZGA 2R92B 4ZUJA 1HXYD 1MI2A 3IRBA 3M7GA 2EJMA 4DAYB 3C46A 4FVMA 2YTXA 3QJYA 1TS4A 1HR0Q 1F9RA 2KUMA 2RSOA 3MC0B 3CCEA 5JOBA 2JA8B 5DM73 2J7ZA 4LMQD 4QF4A 3NXWA 1EEFD 3F2BA 2F4VQ 5M3MH 2KOLA 2UUAL 1NMGA 4UPAA 4YWLA 1JICA 5M5WH 1JORA 5C3WA 4DV1L 1JJGA 3PSIA 3HOZG 1SE3A 4JI5L 1K8GA 2GA4B 1SNCA 2AHOB 2EE1A 3S1RH 1YI2A 1E24A 3KJPA 5FO9B 3I4OA 1CQVA 1CKOA 3I7FA 2KJXA 1HFNA 5IT9E 1EWIA 3M85A 3VYUA 1C8CA 4Q5VA 3PF4A 1VF7A 4A3MG 1Q7YC 2JEAI 3EQLC 2JSOA 2IHEA 1VQHA 2C9OA 2F0TA 4A3FB 4DV4Q 1EU3A 3L9AX 1FJGL 2HDLA 1EL0A 3QB3A 4GKKQ 3AMUA 4Y52H 4S3SA 4QUCA 4XQJA 2UXDL 2PYKA 3OYYA 4F87A 3HOXG 3E0JA 5GROA 1XTCD 4NP5A 4PMCA 3PGZA 2FINB 3I70A 4JI2L 1SMYD 2K7VA 4JI7L 4PMWA 5IT9c 2F0JA 3T1YL 1SR3A 4C3IH 4K6DA 2UXBQ 5AFWA 4K6LA 4RWSC 4JOIA 3H15A 5ELEA 4DR5L 2Y0SG 1AEXA 3KJOA 4HCEA 1Y8PB 1WCMB 5ELFA 4LUOA 3I2ZA 2B29A 4A75A 3K80C 4QY7A 3T51B 3TEHB 1ONLA 3SR1A 1U4RA 2ES2A 3T16A 1HZCA 2K05A 2RBMA 3DWQA 2E75C 3N52A 1YEZA 1HR0L 1GXDC 3U50C 3H3VI 3MEHA 4RCOA 4FXKC 4XT3B 3R8BA 3Q0AA 1EIGA 1V8QA 1TVXA 1VQBA 3K8AA 4A3EG 1VF5C 3FDTA 5HY6A 4DN4M 1QNUA 1EZ6A 2XRQD 4LFBL 1YNJC 3GTMB 4IFDI 4X3TA 4GZYC 1PFMA 2H5XA 5JVH3 2XWJB 1PLFA 4C3HH 5CORA 2JA5H 5CGKA 2N3SA 1F2LA 2R7ZB 2HQLA 2QGQA 3UDGA 5C5MA 1PH4A 4P2CB 3T4AC 3P75A 1U4LA 2O4XA 2Q2HA 1EFWA 1JC7A 2EYOA 1HR0W 1N34Q 1VQDA 1PTOC 5IP9H 1JJ2A 4LAAA 5J1ZA 3EBEA 1EIFA 1MSHA 1PTOD 1IBKQ 3DWPA 4ZUIA 4WORA 1I94L 1SRUA 1TWCB 3NTIA 3PQIA 1ET9A 2NUCA 2C5CA 4BY7B 1I50B 2DGYA 1PVOA 2A6ED 4ZYSA 2RHSB 1KTKA 5FLMG 3JAMi 2E2JB 1L0YB 5IE8A 3MXGA 2DJFC 3H0GB 5IYDH 4IUNA 2TSSA 2YTYA 1WVLA 2E2HB 2N49A 5C0XG 4H0LC 1PYWD 3D3RA 4IOCA 1HA5A 4RG1A 5KIXA 2VNUD 1EWHA 4DV4L 4A3GG 1SROA 2QKIC 1FNWA 3TREA 5M5XH 2EYPA 4FXGC 3QIAA 3K58A 1IBKL 4JI3Q 4IPCA 2JA7G 5JJZA 3S14B 1EY4A 3PO2G 3GP7A 1K83H 1B53A 1DYQA 2OQ0A 2EVBA 5JJLA 3HOVG 2YV5A 5C44G 1LV9A 1PFNA 4IUQA 2B2VC 2WKDA 2SEBD 4CBVA 2FMCA 2F0HA 1Q82C 1STNA 3GDEA 1NMFA 3K5OA 4HMJA 3RZDB 2NYZD 4DFAA 2HQEA 1SMXA 2GVAA 1D5MC 1SNPA 2X6GA 2F0NA 1QZHA 4PQXA 1MKHA 1GVPA 1XMQL 1G6PA 4E6IA 1RDPD 1NAPA 1TWHB 2EDGA 3I90A 3TZDA 1Y8OB 1D1KA 3MVVA 1RCVD 3FRPB 3X3MA 3PIO3 2NWGA 2RA4A 3T53B 2XNAC 4C3HG 3ULPA 3CCMA 5DEHA 4K8IA 2F0KA 4HN7A 1I4RA 3SVMA 3S16H 5G3LF 3TBIB 2EJFC 1E3PA 2RF4A 4MHEA 4IOAA 1PRTC 1VQ8A 1O7ZA 3VA7A 3OIPA 3IFTA 5C3EB 1WTHA 3Q6SA 5E1FA 2IW3A 4A3EB 2RQXA 3EVQA 4QJFA 1OXVA 3Q22A 2BA0A 1WFQA 2PZWA 1C48A 4GNXB 4LF9Q 1O7IA 1UAPA 4OL7A 4DNRB 3TP6A 1VQEA 1M1KC 1SE4A 4TQUS 4XYQA 4DAYA 2R7ZG 3NP8A 3F2DA 5JPMC 1LTSD 1BVSA 1LLRD 4N9PA 4OHJA 5FLXE 4KK7A 2R93B 2UXDQ 4K5XA 4A3KB 1PA6A 5HGTA 3STBC 2Z6KC 2R92H 1NE3A 4GLAC 3GTLH 1WTVA 3VYRA 3K5MA 1VDZA 5EQ0A 1HNZL 1AFPA 5D3IB 4DR2Q 3M3YB 3HKSA 2HHHL 4LNQA 5A2QL 3EA6A 4JYAL 1EY9A 1HZBA 1UUPA 4X6AH 1CA5A 5ELBA 5KRUA 1CSQA 4HEDA 1TWAH 4QL5A 1N36Q 2R7FA 2A6EC 4OO1G 4IUTA 4YIJA 5H1SE 4NXMQ 2XTIA 4JI6Q 1Q90A 2EIFA 1S5BD 4DV3Q 2B2WC 3NPPA 1I6HH 1IZ6A 4TVAB 2MNAA 2VQEL 1BO0A 3TP5A 4N8FA 1S5CD 3NENA 3JAMc 2ZT9C 2F4VL 1SAPA 5KYLA 4BBSB 3RZOH 1XPUA 1EY5A 4R4OA 2HT1A 5C0XH 4A3BB 1QUQA 3M4QA 1HFGA 4A93G 4IJHA 2B39A 2F3VA 4BY1B 5F2DA 1Z6HA 2D0OA 1SFOB 5K36G 1FNVA 2ZTDA 3J81L 4X62L 2NN6I 4B3ML 3NWTA 2A68D 2K32A 1RHPA 4AH6A 5D14A 5K36H 5FKAC 1K8MA 1JWMD 2JA5B 4DR6L 4G7OC 5IOCA 3CKIB 1SYDA 1E1OA 2JA8G 4PV1C 4X65L 1Y1WG 1SXTA 2B2TC 3UE1A 1KABA 5LMNW 2F4IA 3EFXD 4G57A 2BH8A 3S1MH 1HZAA 1KLUD 3BYTB 4I65A 2RCNA 2E2DC 3KF8B 3FPUB 5IGGA 4A3KG 1VQ9A 4CHTB 3S24A 3B6YA 3BZKA 1XNQL 5IIFA 4A3LH 2JEBI 3T13A 1KC8C 4A3JB 5IGCA 4WRDA 4A3DB 2OCEA 1MSGA 3KLRA 4NMZA 1S5ED 2PMZB 1UNSA 2WKCA 3GV3A 4V190 5BR8L 5IP7H 3HEJA 4DGZA 2E2JH 4DNIA 1FD7D 2F03A 2K5NA 2XGTA 3P1HA 5E4XA 2VQFL 1J6QA 3DMUA 1SYBA 3HKZG 3L7ZC 4RHSA 1B1ZA 3FVQA 3KF6B 5IY0A 1K8AC 4C2MB 4HIOA 4RCNA 2A68C 1G91A 3GTPB 1W6JA 4A93H 3NELA 1H9MA 1PMRA 4R8NA 3V05A 4R4IA 3S2HB 3L2PA 1BOSA 2HD3A 2R93G 3TP8A 4ZRZA 1ESRA 1JE4A 1VQ4A 2K5HA 2QDLA 5D3DA 3J81j 3LX0A 4IZ8A 1XPRA 4JK1C 1ET6A 1GHJA 2N78A 1UE6A 1Y1VB 3D4DA 1I4PA 1G51A 3K0YA 1DZ1A 4RAUC 4B08A 3DHQA 1LT5D 1BCPC 4JI4L 1EQRA 3GO5A 4FF3A 3MZ5A 4H02A 4M8AA 1CQFA 3NWSA 2MUYA 2TMPA 4GN4B 1FL0A 3K0XA 3R2TA 2JA5G 2L12A 3SHLA 4ABNA 1Q81C 1HZ9A 1UE5A 4WJ3M 3A54A 2NZOA 2FXQA 2ZM6Q 3OOCA 3G71A 2LXKA 4A3DH 1A2TA 1QCBD 4HMIA 4JI0Q 1SEBD 3D6CA 4OO1H 4DR6Q 4PZ8A 2AUKA 2F0WA 2XWBB 4PMBA 1LUZA 4JI1Q 1V43A 4UAIA 1X32A 3MXNA 3S16B 3J81E 3LWUA 4H44C 1STGA 1EYCA 1KAWA 1E2WA 1YBYA 3GTGH 1S40A 1G2SA 5I2YA 4JI1L 3GTKB 4JI8Q 2Q8TA 1JE5A 3RLFA 2IY5B 1NSNS 2K14A 4A3JG 4JC0A 2F0VA 1N9WA 5AJ3L 3CMEA 3CQZH 4K5WA 4IPGA 4P71A 3TN2A 2ZXOA 1V1PA 1HTLD 4B9WA 1A3UA 1NY4A 1HPCA 3U4ZA 4B3RL 4ZQ3A 1AH9A 4BBSH 3D4RA 3KYHC 5EBDA 1GUWA 1WTOA 3EJIA 2EQSA 1X3FA 2DY8A 2IX0A 3NQTA 2E8GA 5KYIA 2KECA 1T5XD 2L15A 2EY2A 2PI2E 5EPLA 5C5LA 4GKJL 4HIKA 3BZDB 5NUCA 1GHKA 2WAQG 3PV0A 1EY0A 1B44D 1Y1WB 4C3IB 2FFKB 3AFPA 4IFDH 4LK1C 3WOEA 2RVLA 4GS3A 1IKMA 3M7NA 1AP0A 2Q2IA 3OWFA 4KHPL 3L3OC 1D6EC 1F9QA 1I5FA 3LGJA 3EROA 3VR5A 1SJHD 2LY7A 4HJAA 1YJ9A 2R6GA 3FPPA 2CVRA 2K03A 3S2DH 1W2BA 3MFGA 2VB2X 3ITPA 3Q24A 5M5YB 2F3WA 2CWPA 3HOUH 3V96A 1JWUD 1WTPA 4A3FG 5FJ8G 2VL6A 5IGDA 1L0WA 3HOWG 1QJOA 1K28A 2IJ0A 2NVXH 5IP9G 1B9MA 3RR5A 2FJ2A 2WINB 2F0GA 3I4MB 1I4GA 3HOXB 3CCUA 3J80L 3ZJYC 5C44B 2KCNA 1I4XA 5LHY1 4CJ2C 3BVZA 4O42A 3NBIA 4MTKA 2AKWB 3W2DA 2O5IC 1SNOA 2JA6B 1JWSD 2YYZA 3K81C 4KY7A 5FOBB 1CFMA 3JAML 5EAYA 4IN3A 1RD9D 4P74A 1VQKA 4LF8L 5LMUQ 2KEEA 3A55A 4JCVE 1SE2A 2F0DA 2M00A 4LF7L 3VYTA 5EGTA 4RH6A 1Q3LA 5EPJA 3SEBA 4ZKBB 1L1OB 2AQ1B 3K5LA 3I55A 5IYDG 1YNNC 3E9HA 3R2IA 4IO9A 1BXTA 2DNEA 3AYHB 4IUVA 5JJIA 1X56A 4EGVA 1A6XA 2NVYH 1C4QA 3I4NG 4ID6A 1M8AA 1S4ZA 2ATWA 2X6LA 4GOPC 2BOSA 3GTJH 2PQEA 3NTKA 2NVTB 5EKLA 4YCWA 3A5UA 1IBML 3I4NH 4Y7NB 4JW0A 1KQSA 4IUUA 4BA1I 3AQQA 4DR1Q 4HJ5A 2PQAB 2UUCQ 1RJTA 3TMEA 5E3FA 1TU2B 1XNRQ 4MNOA 1NNXA 4DR7Q 1HHVA 3GV6A 3E5SA 3NUCA 4NKLA 4A3IB 2UXCQ 3HOYH 2CW0D 3I72A 3D31A 4FP5D 1U9RA 4K2LA 2BCOA 1SLJA 1Y14B 2L55A 1SYCA 5KNBA 1GUSA 3MXPA 3G4SA 1O7LA 3I3CA 3MFYA 2SOBA 3GD7A 4JPBW 3SE0A 3VR4A 2B63G 4KN7C 1CUKA 5CBEE 3PO3H 4DAVA 4XTCS 5LMUL 3I4MH 4JI3L 4DV3L 1PH5A 4Q0FA 1FNUA 2A69D 5M3MB 5C44H 4XQNA 3CCSA 3I73A 1ASYA 5M5WB 2K5WA 3GTPH 4CGYB 3VDYA 3WWVA 3J7AF 2CQAA 1A0IA 2EXZA 3CQZB 4DF7A 3S1NH 2EYHA 2L0CA 4DK6C 4JI2Q 2E2HH 4IFDJ 1HNWQ 4HJ7A 1NJIC 3M4YA 2PCFB 3LWEA 3ONAB 3AB9A 1YJWA 2JXMB 4C3IG 1JB7A 4OGQC 3OTOL 2OWOA 3SK4A 1H9RA 3T1HQ 4L6TB 2KA7A 4JG2A 2PNRC 1F2MA 1YJNA 4KKSA 1M90C 3PO2H 2JJQA 4DK0A 3M4OB 2I5LX 3S9WA 3KLSX 1R9TB 3N6RA 1EUJA 4OONA 5JVG3 1NCVA 5FLMH 1KRTA 1LT4D 2Y0SB 3KF6A 1UE1A 5IWAL 3CRLC 3OW2A 4FXDA 1TY2A 3UDXA 1GO3E 4CJ1B 4C1NI 4LJZC 4L5RC 3MHBA 4DR3L 1VQ5A 4FF4A 4FNFA 4HJ8A 2F3IA 2EYLA 5BN3A 4IPDA 3U9OA 4DXGA 1X9NA 3ZYYX 4BY1G 3PUZA 3I4MG 1U4MA 1IL2A 3I8ZA 1E0BA 2F0EA 3NE5B 2OTLA 3G6EA 4EX5A 3S1QH 1DONA 3UE0A 1P8LA 1VQOA 3Q23A 2UU9L 4EQPA 3SK8A 3CC2A 4DPGA 3C3LA 2ZXRA 3CD6A 2ENBA 1F77A 3MXUA 4IPHA 4J15A 1XJVA 2AQ2B 1F9PA 4KY5A 1VCIA 2B3GA 4O1NA 5AJ3Q 2WAQE 2F0FA 5DAUA 2QEXA 3STBD 4JI8L 4A3BG 1MBYA 5C4JB 3DWAA 3CF5A 1GM5A 1BUVT 2AQ3B 4EQNA 1TWHH 2NZ1D 2WB1B 4LF5L 1CI3M 1K3BC 3WOFA 1QNKA 5EKKA 1LTBD 4F7XA 1VS0A 1WTRA 1OTCA 4JI0L 3HRZC 1WOCA 1WCMH 1TWFH 2P5ZX 2B63H 2OXPA 3RLOA 3TSSA 2ZM6L 4G7HC 1QB5D 3H09A 3NHHA 1EYGA 1BBXC 4XT1B 3PUYA 3P20A 1WTWA 3OMGA 3GTQH 2QEJC 1BCPF 4RFBA 2KCCA 3CCVA 5CV8A 2EZVA 2NVTH 3L0OA 3TDQA 1YVCA 3F8TA 5GQOA 5KNDA 2VUMB 1SN8A 2G5DA 4DU9A 4HJ9A 1U5KA 1WTQA 3GTKH 3ULLA 2NB0A 1FJGQ 2G9HD 1TT2A 5FK9C 3OTOQ 4IUPA 2VW9A 1K0RA 1Z7TA 3FKIB 2K5QA 2KQ3A 4CDCC 1ILQA 3AU7A 2ZJQA 3A56A 2VUMH 1QILA 2LSSA 3QO2A 1LT6D 5DLQE 2RHQB 4YY3Q 4OXPA 4BS9A 5I9PA 3PUXA 1LYLA 1EWCA 1R4QB 1CK1A 1Q46A 4YCVA 1VQ6A 4A3CH 2EOTA 4KN4C 1Y1VG 5FLXL 4A3MH 2O2LD 3OHXC 4J8QA 4JI5Q 4JBMA 1KAAA 2Z4IA 3KDFA 2QILA 1HA6A 1IW7D 4DV1Q 1XYIA 3PIP3 1STEA 3BYYB 3H0GG 1GUGA 1EEID 1IHZA 3GTOH 2UUAQ 1CTMA 2D9UA 1UE7A 2PPBC 4CDFC 1F9SA 1PH8A 4B3TL 1LACA 1O80A 2AMCB 3TZUA 4APVA 1HTPA 4BWGB 3D6WA 3S15H 2N55A 4N8X1 2RSNA 1XNQQ 2SNSA 2UXCL 4OEMB 4ZK9B 2MP1A 1JR0D 1SJED 4EQOA 4KTAA 1GJXA 2O5JC 4NXNL 3GTQB 2WB1G 3M4PA 4LFBQ 4DR1L 2OF1A 3BZCA 3UDIA 1Q8IA 2KCMA 1IBMQ 4DR4Q 2VB3X 1IBLL 2Y0SE 4HIMA 2R92G 3KBGA 1I4HA 2D2CC 4A3BH 5ELNA 4B9XA 1PRTB 4L5TA 4A3GH 1FGBD 1I50H 1LTTD 3OMCA 1IXRA 1WTXA 3NK9A 2OTJA 1I3QB 4RGNA 1D7QA 3K5NA 2NBFA 5TSSA 2B2YA 3UDFA 5C3EG 3R3OA 5JJKA 1SBBB 1PTOB 3OIQA 3H3VH 4NW2A 1SNQA 1SSOA 4HCSA 5GAGC 4A4IA 2IHFA 2MPMA 3OSOA 4X66Q 2PMZE 5D65A 4CKCA 4X64L 1H9JA 4ZAIA 4PG3A 4DR5Q 4R9WA 1MJEA 4C3JG 4L63B 2E76C 2Q2TA 1B8AA 3CHBD 3AEVA 3QR8A 1A3VA 4H13C 3I56A 1DJRD 1Q12A 4B3SQ 1EOVA 2KHJA 3DM1A 2PZTA 1TIID 1BQQT 1NR4A 4DXFA 1BCPD 1CHPD 1PFBA 3HGBA 2C35B 2A74C 2G9DA 3A8JE 2JE6I 4YWKA 5C4XB 4JI6L 5C4ZA 4NXML 2HCIA 2A73B 2MO1A 1HNXL 4M1UB 1II3A 2WAQB 4BA2I 4DUZL 2K6AA 1L2FA 2R7DA 3IKJA 3SDZA 4YY3L 1V9PA 2XSCA 3BDCA 3ND8A 1C9OA 2K52A 5C0XJ 1K9MC 3T56B 1EY6A 2NTTA 4V0BA 1EU4A 3VYSA 5IP7G 3GTLB 4A3CG 4LF4L 1DM0B 3IL8A 4QQBX 2UUBL 3M3YH 1STHA 4NDXA 4KJOA 2BDNA 1RL2A 4X3UA 1HNXQ 1U0LA 4G4KA 5J22A 2F0MA 2IL8A 3VA5A 1QE6A 1OXUA 3SXHA 2Z8LA 1FR3A 3CXCA 3S1RB 2D62A 4R8IA 4GKJQ 1HH2P 2JA7B 1XMOL 3PCOB 2F52A 1HQMC 2I5MX 5C3EH 3IAYA 1GOZA 3C1EA 1ZYRC 5CV5A 4DUYQ 1NR2A 1SMYC 3EN2A 5CMDA 4A3EH 1F2ZA 5FLXc 1LO5D 1SNMA 4B3RQ 2JK8A 1EFID 1XTDA 5L37A 5I6WA 2F0PA 1VQCA 4DAPA 2VXWA 4P72A 4GOPB 1BNZA 3GQBA 5IYCH 5IGEA 4RMFA 5CR3A 4LF5Q 2LFNA 1Q86C 1QVFA 1J9OA 1TWAB 3S2HH 2KHSA 1X54A 2ZTEA 4HTHA 1Y8NB 2K33A 3RZDH 1QVGA 1BBWA 1RF2D 4JBWA 3SK6A 2ICEC 1KXLA 1C0AA 3A74A 3BJUA 4JV5L 4BBRB 5A35A 3AFQA 2XIWA 2K5VA 5BN4A 2D0PA 2BE5C 1XMQQ 4DR4L 4Y7NH 5HURA 4GNXC 1WYDA 2UU9Q 5FJ8H 4QIWB 1X3QA 1KLGD 4NXNQ 4XIGS 1QVCA 2Q8RE 5JEAG 4UP9A 3C1FA 4IJLA 2K01A 1A8VA 2K04A 2BA1A 4AYBG 2L11A 5IGFA 3TP7A 1Z9FA 2RCFA 1QOHA 4KJNA 5M3MG 2WACA 1F2YA 5T1IA 1E7ZA 4C56C 4P73A 3W1GA 4QIWE 4B3TQ 2B2YC 4WJ4A 4ZKCB 1H9SB 3QOJA 1H9SA 2B8GA 2L9HA 2CQOA 5CV4A 3FMCA 3SK5A 3HOUB 2JQOA 1B3QA 3KDFB 1TS5A 3A0JA 3D4WA 2DJGC 4KV6A 1SE8A 1U4PA 5I2XA 2F1MA 1UWVA 2K4KA 3GTMH 1STAA 3V2TA 2J4XA 4QB4A 1KDCA 4K0KL 1B9NA 3BVMA 4RKBA 1T9HA 3CRKC 1CKNB 4DV0L 4DV6Q 4DV2L 2R93H 1CKNA 4BY1H 2B8FA 1XWEA 1VQ7A 4DV5Q 5KNCA 2PQAA 2IX1A 1DXMA 3CC7A 3CCLA 4AQYL 1G6ZA 1Z47A 2F0IA 5CBAE 1B7YB 1HNWL 1PH6A 1JMCA 1ML0D 4O2DA 3EIVA 4B3SL 2AWOA 1TWGB 3SGIA 5C3XA 3HS0C 4I7ZC 4XDXA 4XYOA 1I94Q 2WB1E 2NVQB 3KK7A 1EZ8A 4X3SA 1LTGD 1WD0A 2E5LQ 3E6ZX 3S1MB 1FGUA 1IYVA 4FF2A 1TWGH 2JN4A 3E0EA 1A3TA 2NZHA 5ELCA 2JA6G 2K50A 1W6KA 4A3JH 1MIUA 2N88A 3FKIH 2A5HA 3ULJA 3BDOA 5CV6A 5JPNC 4NB3A 4L5QA 2JA6H 2ASBA 4O0AA 2CFMA 2QW7A 2HIXA 3F2CA 4ALPA 2CH4W 2F0OA 2XRSD 1EY8A 3HG9A 2ZJPA 1K8OA 4C3HB 3TS0A 4XXEA 1J8IA 1TS3A 1JOKA 1E2ZA 3HOYG 2WIIB 4TRDA 3U9SA 5M9OA 1EIYB 4DAMA 2EY6A 1UEAB 1YNXA 3ND9A 2PW7A 4A3FH 3P7JA 1N33Q 3J7YW 3KUPA 3GTGB 3D0FA 3U58A 2OQKA 1D2BA 1JB3A 3J80c 2LS01 2Z9HA 2E74C 2Q8IB 1N32Q 4F8MA 1YHBA 4LFCQ 1PRTD 3CCRA 1KNAA 1G291 1CA6A 1AW7A 4LFAL 4KY6A 2EXDA 1R9TH 2X69A 4BY7G 4QMGA 2AUJD 1K0SA 3J7ZC 5IYBH 2JA8H 2JYOA 2KHIA 1TWCH 4CKEA 1DCZA 3RMHA 4JBKA 4DR3Q 4A3DG 3RN5A 3D8GA 2ZTCA 3QWNA 1BF4A 2EYFA 3S17H 1Y69U 4KKUA 1I6VC 2L1BA 1N36L 1XXGA 5I9OA 3G7LA 1PZID 1VQIA 3FKIG 1O78A 3QG1A 4RGOS 3J80E 3DEPA 4L8JA 4JYAQ 2MQHA 4KMUC 2MO0A 1STBA 1J5EQ 2GN5A 1UEBA 3RLNA 4EQ5A 1VQFA 2H4OA 2HHHQ 4CKBA 1VQAA 4PZ7A 2FMMA 4OWXB 1CM9A 5M5XB 3HOWB 1OXXK 5CV9A 3MAQA 4GKKL 3T1HL 5CC4A 2F0LA 3J7AV 1NTGA 1DOKA 5M3FG 1PDQA 2LMCB 3F2UA 2B2UC 3O13A 5C4HA 5C0XI 3PO3B 3WDNA 1HUMA 1SYFA 2OEOA 3W1BA 1LM0A 1CT1D 2DUDA 2CH4A 2I5HA 3K6OA 4OX9Q 4KHPQ 1A15A 2PO4A 2KVMA 2H1EA 1XPOA 2V4DA 1PTOF 1MHWC 2NN6H 3HOZH 3BDLA 3PO2B 1CKMA 1TXYA 1OO9B 1ICFB 2MGSA 1ENCA 4WFN3 1WI5A 3W3AA 4OIJA 5ELDA 3HOVB 1K3RA 4LW1A 4K8JA 2E2IH 5IYBG 1EOTA 1H9KA 4ODGA 4LFAQ 1V1PB 3CCJA 1FVIA 1VQPA 3H3VC 2NTSA 2LKVA 4MTNA 4LFCL 4I7AA 2L5TA 5DNFA 1YHAA 1V1OA 1N8RC 1VMCA 4R1JA 1ZKOA 5LMNL 2Z1CA 1G2TA 4DKAC 3A7AB 1BDOA 1N33L 3A5ZB 2B2TA 3A8KE 1RKNA 2M9VA 1LT3D 2B2UA 5G3LD 5CV7A 4N9TA 3S2DB 2IPKD 2YU9H 3VR2A 4ZLTF 1SNDA 3TQYA 3I4NB 2JA7H 1B50A 2EY1A 3K7AB 4IQZA 5M3FH 2B2VA 1X6OA 4MIUA 2HUGA 1RIPA 2R61A 2SNMA 1S5FD 4KI0A 4HSPA 1ZYRD 4OWTB 4KHZA 2B2WA 3HKZE 3DXJC 1HJPA 4CJ0B 5EJWA 5FO7B 4FYDA 2LXJA 1SFOH 5IWAQ 1PTOH 2K1BA 4DV7Q 5HGQA 4OX9L 4LF6Q 4LF7Q 4A3IG 2EYMA 1CZWA 4U673 4POFA 4MZ9A 3CPWA 1TWFB 1I6HB 4UDUC 1KIXA 3NBHA 2EY5A 4FO2A 3GTJB 3NBHB 1PH7A 3X3NA 3HKZB 1S5DD 4OELB 5GAEC 5FO8B 1RODA 1EQVA 3FHWA 3OW7A 1SYGA 1Q1BA 1K73C 3CAMA 4C3JB 2YTVA 2ID0A 5C4JH 2Z6KA 2ZXPA 4BBRH 4DA2A 5IODA 4R4QA 3KOJA 3W5OA 1T5EA 1KNEA 3PUWA 1DD2A 3QOLA 1KDAA 1QWYA 1GUTA 4KLKA 4NPSA 3S14H 1G8ZD 4R4TA 3MWYW 3URYA 1A2UA 1LTAD 4DV2Q 4DV0Q 2CCZA 1BBUA 4C3JH 2KEDA 4RGMA 5J3BA 2L4NA 5EBCA 3TS2A 1JJCB 1HCZA 1WJJA 5IYCG 4K0KQ 1EIHA 1VMPA 3J80i 5M5YH 4H7BA 1EQTA 2A6HD 1ENAA 3MTSA 3J81c 1A62A 1ENFA 2VQFQ 2MJ8A 3NTHA 3RD4A 1BCPB 1B4OA 2KENA 3F1ZA 1D5XC 1EY7A 3VR6A 4LF6L 1IYJB 1YNND 4OO1I 3CU7A 4R4CA 5BR8Q 4IURA 1ICWA 1STYA 3PUVA 1X65A 2RDGA 2KCTA 2VZAA 3CPFA 4GLXA 1N32L 1LTLA 4A3LG 4UHVA 2I07B 1W3SA 1AN8A 1XX8A 4K2KA 3NEMA 3DM3A 5IT9L 1KHIA 1GD7A 2HIVA 2JA9A 1YZ6A 1X3GA 3H91A 4DR7L 1MJCA 1KDBA 1JQYD 1XNRL 1DOMA 3Q8DA 4ME5A 2UUCL 2PNHA 1D1IA 1R4PB 3H0GH
chains in the Genus database with same CATH topology
3UI2A 2I46A 1LTID 1B3AA 1HRJA 4OIKA 3HP3A 3HZXA 5K5PA 1CHQD 5KEEA 3K57A 2WV6D 2EJGC 3S1NB 2CW0C 4MN3A 1ESFA 5EKIA 3GTOB 1IYUA 2PZUA 4IFDG 2JP1A 1LTRD 2E2IB 2Z4HA 3H6MA 1HUNA 3I91A 2MHVA 2R3ZA 2RDHA 2B63B 2A6HC 3OWEB 3JAME 1SYEA 2FHTA 5JEAJ 4AYBB 4A3GB 3DUZA 5COYA 1OXSC 2F0UA 4RA8A 5I6YA 1TY0A 2DNCA 5DM63 5JEAH 1ZXTA 4PNYA 4Z9CB 5ISRA 1GUNA 1AZQA 3OPOA 3H94A 4QUFA 1TKWB 4IALA 5T1GA 3ERQA 4RKLA 4TSSA 2F0SA 3BG3A 4HSVA 4EVOA 3A7LA 4K14A 1M4VA 1B2TA 3I4LA 3NSWA 1MGSA 2BDOA 3S17B 2A69C 3KBXA 4XQQA 2QCPX 1JCKB 1JOQA 1MD2D 2SDFA 4WJWA 1AZPA 1Q1EA 3PMFA 5J39A 5LL6X 3RZOB 1ILPA 1IKLA 2EPBA 3K59A 2K5DA 2YU9B 4F88A 1DOLA 1LABA 1BR9A 3HOYB 1JOOA 2PW5A 3NQIA 5CYUA 2NVXB 4J6HA 2AWNA 4G7ZC 4RHRA 2F0QA 3VR3A 1I4QA 1PXUA 3HOZB 1TS2A 2QF7A 1EYAA 4RGTA 4U68A 1EYDA 3S15B 3FEWX 2BE5D 1HQRD 1ZEQX 2DY7A 4J1MA 5EPKA 4K5VA 4A3MB 5C6AA 2OT2A 1YNJD 5JAVA 4DK1A 1K83B 2WP8J 3DEOA 2DN8A 3BVGA 3R93A 1OXTA 2IT1A 1SDFA 2D5DA 2RKSA 5LL6S 2EYJA 3KF8A 5KGUA 1PZKD 5E4WC 4KD3A 4TKOB 1E2VA 5A2QE 4HR7B 5M3FB 1O7YA 2RDFA 3RUZA 2HCCA 2NVYB 2M2LA 1RTNA 1PRTF 2HDMA 1GUOA 4KHVA 4DNTB 1IW7C 1X3PA 2CHBD 1D5ZC 1FYCA 2K28A 5BN5A 4C1NK 1L0XB 4KKTA 2IX3A 3S1QB 3MA2B 4FF1A 3C2PA 3A8IE 3BS1A 4ULLA 4KD4A 4X3KA 2QDBA 3KLSA 1TQOA 2ICIA 1NUCA 2J0TD 1TR5A 2IWHA 4ILWA 1RTOA 4A93B 1PZJD 3LNNA 5IGBA 1WD1A 5I4DA 2XN9C 4HAEA 1IL8A 3IFDA 3G6JB 2XVSA 4QCLA 1QG7A 2NN6G 1CZGA 2R92B 4ZUJA 1HXYD 1MI2A 3M7GA 2EJMA 3C46A 4FVMA 3QJYA 1TS4A 1F9RA 2KUMA 2RSOA 3MC0B 5JOBA 2JA8B 5DM73 2J7ZA 4LMQD 4QF4A 3NXWA 1EEFD 2KOLA 1JICA 1JORA 5C3WA 1SE3A 2GA4B 1SNCA 2EE1A 5FO9B 1CQVA 2KJXA 1HFNA 5IT9E 3M85A 3VYUA 1C8CA 4Q5VA 1VF7A 2JEAI 3EQLC 2JSOA 2C9OA 4A3FB 2F0TA 1EU3A 3L9AX 2HDLA 1EL0A 3QB3A 3AMUA 4S3SA 4QUCA 4XQJA 2PYKA 4F87A 3E0JA 1XTCD 4NP5A 4PMCA 2FINB 3I70A 1SMYD 2K7VA 4PMWA 2F0JA 4K6DA 5AFWA 4K6LA 4RWSC 5ELEA 1AEXA 4HCEA 1Y8PB 1WCMB 5ELFA 3T51B 1ONLA 3SR1A 1U4RA 3T16A 2K05A 2RBMA 3DWQA 2E75C 3N52A 1GXDC 3MEHA 4RCOA 4FXKC 3Q0AA 4XT3B 3R8BA 1EIGA 1V8QA 1TVXA 1VF5C 3FDTA 4DN4M 1QNUA 1EZ6A 2XRQD 1YNJC 3GTMB 4IFDI 4X3TA 4GZYC 1PFMA 5JVH3 2XWJB 1PLFA 5CORA 5CGKA 1F2LA 2R7ZB 5C5MA 4P2CB 3T4AC 3P75A 1U4LA 2O4XA 1JC7A 2EYOA 1PTOC 4LAAA 5J1ZA 1MSHA 1PTOD 3DWPA 4ZUIA 4WORA 1TWCB 3NTIA 1ET9A 2NUCA 2C5CA 4BY7B 1I50B 2A6ED 4ZYSA 2E2JB 1KTKA 1L0YB 3MXGA 3H0GB 4IUNA 2TSSA 1WVLA 2E2HB 5C0XG 4H0LC 1PYWD 3D3RA 1HA5A 5KIXA 2VNUD 1EWHA 2QKIC 1FNWA 2EYPA 4FXGC 3QIAA 3K58A 5JJZA 3S14B 1EY4A 3GP7A 1B53A 1DYQA 2EVBA 1LV9A 1PFNA 4IUQA 2B2VC 2WKDA 2SEBD 4CBVA 2FMCA 2F0HA 1STNA 3K5OA 4HMJA 3RZDB 2NYZD 4DFAA 2HQEA 1D5MC 1SNPA 2X6GA 2F0NA 4PQXA 4E6IA 1RDPD 1NAPA 1TWHB 2EDGA 3I90A 3TZDA 1Y8OB 1D1KA 3MVVA 1RCVD 3FRPB 3X3MA 3PIO3 2NWGA 2RA4A 3T53B 2XNAC 4C3HG 5DEHA 4K8IA 2F0KA 4HN7A 1I4RA 3SVMA 5G3LF 3TBIB 2EJFC 4MHEA 1PRTC 1O7ZA 3VA7A 3OIPA 3IFTA 5C3EB 3Q6SA 5E1FA 2IW3A 4A3EB 2RQXA 3EVQA 1OXVA 3Q22A 2BA0A 2PZWA 1C48A 1UAPA 4OL7A 4DNRB 3TP6A 1SE4A 4TQUS 4XYQA 4DAYA 3NP8A 5JPMC 1LTSD 1LLRD 4N9PA 4OHJA 5FLXE 4KK7A 2R93B 4K5XA 4A3KB 5HGTA 1WTVA 3VYRA 3K5MA 1VDZA 5EQ0A 1AFPA 5D3IB 3M3YB 5A2QL 3EA6A 1EY9A 1UUPA 1CA5A 5ELBA 5KRUA 4HEDA 2A6EC 4OO1G 4IUTA 4YIJA 1Q90A 1S5BD 2B2WC 3NPPA 1BO0A 3TP5A 1S5CD 2ZT9C 1SAPA 5KYLA 4BBSB 1EY5A 5C0XH 4A3BB 1HFGA 2B39A 2F3VA 4BY1B 5F2DA 1Z6HA 1SFOB 5K36G 1FNVA 3J81L 2NN6I 3NWTA 2A68D 2K32A 1RHPA 5D14A 5K36H 5FKAC 1K8MA 1JWMD 2JA5B 4G7OC 5IOCA 3CKIB 1SYDA 4PV1C 1SXTA 2B2TC 1KABA 2F4IA 3EFXD 4G57A 1KLUD 3BYTB 4I65A 2E2DC 5IGGA 3FPUB 4CHTB 5IIFA 2JEBI 3T13A 4A3JB 5IGCA 4WRDA 4A3DB 1MSGA 3KLRA 4NMZA 1S5ED 2PMZB 1UNSA 2WKCA 3GV3A 4V190 3HEJA 4DGZA 1FD7D 2F03A 3P1HA 5E4XA 3DMUA 1SYBA 3L7ZC 4RHSA 1B1ZA 3FVQA 4C2MB 4RCNA 2A68C 1G91A 3GTPB 1W6JA 1H9MA 1PMRA 4R8NA 3V05A 3S2HB 1BOSA 3TP8A 4ZRZA 1ESRA 1JE4A 5D3DA 3LX0A 4IZ8A 4JK1C 1ET6A 1GHJA 1Y1VB 3D4DA 1I4PA 3K0YA 1DZ1A 4RAUC 4B08A 3DHQA 1LT5D 1BCPC 3GO5A 4FF3A 3MZ5A 4M8AA 1CQFA 3NWSA 2MUYA 2TMPA 3R2TA 2L12A 3SHLA 4ABNA 3A54A 3OOCA 1A2TA 1QCBD 4HMIA 1SEBD 3D6CA 4OO1H 2AUKA 2F0WA 2XWBB 4PMBA 1V43A 4UAIA 1X32A 3MXNA 3S16B 3J81E 3LWUA 4H44C 1STGA 1EYCA 1E2WA 1G2SA 5I2YA 3GTKB 2Q8TA 3RLFA 1NSNS 2F0VA 4K5WA 3TN2A 2ZXOA 1V1PA 1HTLD 4B9WA 1A3UA 1HPCA 4ZQ3A 3D4RA 5EBDA 1GUWA 1WTOA 3EJIA 2IX0A 2DY8A 3NQTA 5KYIA 2KECA 1T5XD 2EY2A 5C5LA 5EPLA 3BZDB 5NUCA 1GHKA 3PV0A 1EY0A 1B44D 1Y1WB 4C3IB 2FFKB 4IFDH 4LK1C 3WOEA 2RVLA 1IKMA 3M7NA 1AP0A 3OWFA 3L3OC 1D6EC 1F9QA 3EROA 3VR5A 1SJHD 2LY7A 2R6GA 3FPPA 2CVRA 2K03A 3MFGA 2VB2X 3ITPA 3Q24A 5M5YB 2F3WA 3V96A 1JWUD 1WTPA 5IGDA 1QJOA 2IJ0A 1B9MA 2FJ2A 2WINB 2F0GA 3I4MB 1I4GA 3HOXB 3J80L 5C44B 2KCNA 1I4XA 5LHY1 4CJ2C 3BVZA 4O42A 3NBIA 3W2DA 2O5IC 1SNOA 2JA6B 1JWSD 2YYZA 4KY7A 5FOBB 1CFMA 3JAML 4IN3A 1RD9D 2KEEA 3A55A 1SE2A 2F0DA 2M00A 3VYTA 5EGTA 4RH6A 1Q3LA 5EPJA 3SEBA 4ZKBB 2AQ1B 3K5LA 1YNNC 3R2IA 1BXTA 2DNEA 4IUVA 4EGVA 1A6XA 1C4QA 4ID6A 1M8AA 1S4ZA 2X6LA 2BOSA 2PQEA 3NTKA 2NVTB 5EKLA 4Y7NB 4IUUA 4BA1I 1RJTA 3TMEA 5E3FA 1TU2B 1HHVA 3GV6A 3E5SA 3NUCA 4NKLA 4A3IB 2CW0D 3I72A 3D31A 4FP5D 1U9RA 4K2LA 2BCOA 2L55A 1SYCA 5KNBA 1GUSA 3MXPA 1O7LA 3I3CA 3MFYA 2SOBA 3GD7A 3SE0A 3VR4A 4KN7C 5CBEE 4DAVA 4XTCS 4Q0FA 1FNUA 2A69D 5M3MB 4XQNA 3I73A 5M5WB 2K5WA 4CGYB 3J7AF 2CQAA 2EXZA 3CQZB 4DF7A 2EYHA 2L0CA 4IFDJ 3M4YA 2PCFB 3LWEA 3ONAB 3AB9A 2JXMB 4C3IG 4OGQC 3SK4A 1H9RA 4L6TB 2KA7A 2PNRC 1F2MA 4KKSA 4DK0A 3M4OB 3S9WA 3KLSX 1R9TB 3N6RA 5JVG3 1NCVA 1LT4D 2Y0SB 3CRLC 4FXDA 1TY2A 4CJ1B 4C1NI 4LJZC 3MHBA 4FF4A 4FNFA 2EYLA 5BN3A 3U9OA 4DXGA 3ZYYX 3PUZA 1U4MA 3I8ZA 1E0BA 2F0EA 3NE5B 1DONA 3Q23A 4EQPA 3SK8A 3C3LA 2ZXRA 2ENBA 1F77A 3MXUA 2AQ2B 1F9PA 4KY5A 1VCIA 4O1NA 2F0FA 5DAUA 1MBYA 5C4JB 3DWAA 1BUVT 2AQ3B 4EQNA 2NZ1D 2WB1B 1CI3M 3WOFA 1QNKA 5EKKA 1LTBD 4F7XA 1WTRA 3HRZC 2OXPA 3TSSA 4G7HC 1QB5D 3H09A 3NHHA 1BBXC 4XT1B 3PUYA 3P20A 1WTWA 3OMGA 2QEJC 1BCPF 4RFBA 2KCCA 5CV8A 2EZVA 3TDQA 2VUMB 5KNDA 4DU9A 1WTQA 2NB0A 2G9HD 1TT2A 5FK9C 4IUPA 1Z7TA 3FKIB 2K5QA 2KQ3A 1ILQA 3AU7A 3A56A 1QILA 3QO2A 1LT6D 4BS9A 5I9PA 3PUXA 1EWCA 1R4QB 1CK1A 2EOTA 4KN4C 5FLXL 2O2LD 3OHXC 4J8QA 1KAAA 2Z4IA 2QILA 1HA6A 1IW7D 1XYIA 3PIP3 1STEA 3BYYB 1GUGA 1EEID 1IHZA 1CTMA 2D9UA 2PPBC 1F9SA 1LACA 1O80A 3TZUA 1HTPA 4BWGB 3D6WA 2N55A 2RSNA 2SNSA 4ZK9B 2MP1A 1JR0D 1SJED 4EQOA 4KTAA 1GJXA 2O5JC 3GTQB 2OF1A 1Q8IA 2VB3X 3KBGA 1I4HA 2D2CC 4B9XA 1PRTB 1FGBD 1LTTD 3OMCA 1WTXA 3NK9A 1I3QB 4RGNA 3K5NA 2NBFA 5TSSA 2B2YA 3R3OA 1SBBB 1PTOB 3OIQA 4NW2A 1SNQA 1SSOA 4HCSA 2MPMA 3OSOA 5D65A 4CKCA 4ZAIA 1H9JA 4R9WA 4C3JG 4L63B 2E76C 3CHBD 1A3VA 4H13C 1DJRD 1Q12A 3DM1A 2PZTA 1TIID 1BQQT 1NR4A 4DXFA 1BCPD 1CHPD 1PFBA 3HGBA 2A74C 2G9DA 3A8JE 2JE6I 5C4XB 5C4ZA 2HCIA 2A73B 4M1UB 1II3A 2WAQB 4BA2I 2K6AA 3SDZA 3IKJA 2XSCA 3BDCA 3ND8A 5C0XJ 3T56B 1EY6A 2NTTA 4V0BA 1EU4A 3VYSA 3GTLB 1DM0B 3IL8A 1STHA 4NDXA 4KJOA 2BDNA 4X3UA 4G4KA 5J22A 2F0MA 2IL8A 3VA5A 1QE6A 1OXUA 3SXHA 2Z8LA 1FR3A 3S1RB 2D62A 4R8IA 2JA7B 1HQMC 3IAYA 1GOZA 3C1EA 1ZYRC 5CV5A 1NR2A 1SMYC 5CMDA 1F2ZA 1LO5D 1SNMA 1EFID 5I6WA 2F0PA 4DAPA 2VXWA 1BNZA 3GQBA 5IGEA 5CR3A 2LFNA 1J9OA 1TWAB 2KHSA 4HTHA 1Y8NB 2K33A 1RF2D 4JBWA 3SK6A 2ICEC 5A35A 4BBRB 2XIWA 5BN4A 2BE5C 5HURA 4QIWB 1X3QA 1KLGD 4XIGS 2Q8RE 5JEAG 3C1FA 2K01A 2K04A 2BA1A 5IGFA 2L11A 3TP7A 1QOHA 4KJNA 2WACA 1F2YA 5T1IA 4C56C 2B2YC 4ZKCB 1H9SB 3QOJA 1H9SA 2B8GA 2L9HA 5CV4A 3FMCA 3SK5A 3HOUB 1TS5A 3D4WA 4KV6A 1U4PA 5I2XA 2F1MA 1STAA 3V2TA 2J4XA 4QB4A 1KDCA 1B9NA 3BVMA 4RKBA 3CRKC 2B8FA 1XWEA 2IX1A 5KNCA 1DXMA 1G6ZA 1Z47A 2F0IA 5CBAE 1ML0D 2AWOA 1TWGB 5C3XA 3HS0C 4I7ZC 4XDXA 4XYOA 2NVQB 3KK7A 1EZ8A 4X3SA 1LTGD 1WD0A 3E6ZX 3S1MB 1IYVA 4FF2A 1A3TA 5ELCA 1W6KA 2N88A 2A5HA 3BDOA 5CV6A 5JPNC 2F0OA 2XRSD 1EY8A 3HG9A 1K8OA 4C3HB 4XXEA 1J8IA 1TS3A 1JOKA 1E2ZA 2WIIB 4TRDA 3U9SA 5M9OA 2EY6A 1UEAB 3ND9A 2PW7A 3P7JA 3J7YW 3KUPA 3GTGB 1D2BA 1JB3A 2LS01 2E74C 2Q8IB 4F8MA 1PRTD 1KNAA 1G291 1CA6A 1AW7A 4KY6A 2X69A 4QMGA 2AUJD 2JYOA 4CKEA 1DCZA 3RMHA 3D8GA 3QWNA 1BF4A 2EYFA 1Y69U 4KKUA 1I6VC 2L1BA 1XXGA 5I9OA 3G7LA 1PZID 1O78A 3QG1A 4RGOS 3J80E 3DEPA 4L8JA 4KMUC 1STBA 2H4OA 4CKBA 2FMMA 1CM9A 5M5XB 3HOWB 1OXXK 5CV9A 3MAQA 5CC4A 2F0LA 3J7AV 1DOKA 1PDQA 2LMCB 3F2UA 2B2UC 3O13A 5C4HA 5C0XI 3PO3B 3WDNA 1HUMA 1SYFA 2OEOA 3K6OA 1CT1D 1A15A 2PO4A 2KVMA 2H1EA 2V4DA 1PTOF 2NN6H 3BDLA 3PO2B 1OO9B 2MGSA 1ENCA 4WFN3 3W3AA 4OIJA 5ELDA 3HOVB 4K8JA 1EOTA 1H9KA 4ODGA 1V1PB 3H3VC 2NTSA 2LKVA 2L5TA 5DNFA 1V1OA 1VMCA 1ZKOA 2Z1CA 1G2TA 3A7AB 1BDOA 3A8KE 2B2TA 1RKNA 2M9VA 1LT3D 2B2UA 5G3LD 5CV7A 4N9TA 3S2DB 2IPKD 3VR2A 4ZLTF 1SNDA 3I4NB 1B50A 2EY1A 3K7AB 4IQZA 2B2VA 4MIUA 2HUGA 2R61A 2SNMA 1S5FD 4KI0A 4HSPA 1ZYRD 4KHZA 2B2WA 3DXJC 4CJ0B 5EJWA 5FO7B 4FYDA 1PTOH 2K1BA 2EYMA 1CZWA 4U673 1TWFB 1I6HB 4UDUC 3NBHA 2EY5A 4FO2A 3GTJB 3X3NA 3HKZB 1S5DD 5FO8B 1RODA 1EQVA 3OW7A 1SYGA 1Q1BA 4C3JB 2ID0A 2ZXPA 4DA2A 5IODA 1T5EA 1KNEA 3PUWA 1DD2A 3QOLA 1KDAA 1QWYA 1GUTA 1G8ZD 3MWYW 3URYA 1A2UA 1LTAD 2KEDA 4RGMA 2L4NA 5EBCA 1HCZA 1EIHA 1VMPA 4H7BA 1EQTA 2A6HD 1ENAA 3MTSA 1ENFA 2MJ8A 3NTHA 3RD4A 1BCPB 1B4OA 1D5XC 1EY7A 3VR6A 4OO1I 1YNND 3CU7A 4IURA 1ICWA 1STYA 3PUVA 2RDGA 2I07B 1AN8A 1XX8A 4K2KA 5IT9L 3H91A 1KDBA 1JQYD 1DOMA 4ME5A 1D1IA 1R4PB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY5 A;  3LX0 A;  3ERO A;  3MVV A;  4RKB A;  4IZ8 A;  3SXH A;  3VA5 A;  2EY1 A;  5C5M A;  4EQO A;  4MIU A;  1JOQ A;  4KTA A;  3D8G A;  3P75 A;  3HZX A;  2O4X A;  2SNM A;  3D4D A;  5K5P A;  2EYO A;  2EYF A;  3ITP A;  5KEE A;  2F3W A;  4KHV A;  4EQN A;  2F3V A;  2OF1 A;  5DEH A;  3PMF A;  5F2D A;  5I9O A;  5J39 A;  4K8I A;  5EKK A;  2F0K A;  4LAA A;  3DHQ A;  3C1E A;  5J1Z A;  4F7X A;  2F0I A;  5CV5 A;  2F0T A;  2OXP A;  3MZ5 A;  5IGD A;  4ZUI A;  4B9X A;  1F2Z A;  3QB3 A;  4WOR A;  1SNM A;  1STB A;  3NHH A;  2EYM A;  3OMC A;  2EXZ A;  5E1F A;  4DF7 A;  4S3S A;  5C3X A;  2EYH A;  3NK9 A;  3SHL A;  5I6W A;  3EVQ A;  2F0P A;  2F0G A;  4KD4 A;  2PYK A;  5IOC A;  2EY5 A;  2PZU A;  5CV9 A;  2QDB A;  3OMG A;  5IGF A;  5IGE A;  5CR3 A;  2NUC A;  4NP5 A;  4PMC A;  1JOO A;  1TQO A;  2PW5 A;  1EZ8 A;  2PZW A;  2F0L A;  3H6M A;  3R3O A;  4J6H A;  5CC4 A;  1SYD A;  1EQV A;  5CV8 A;  1A2T A;  2KHS A;  4HMI A;  4OL7 A;  1NUC A;  3TP6 A;  3SK4 A;  1SYG A;  1TR5 A;  3D6C A;  4HTH A;  1SNQ A;  2F0J A;  5C4H A;  2F0Q A;  1SNO A;  1A3T A;  2F0W A;  1F2M A;  1KAB A;  4PMB A;  3NP8 A;  3OSO A;  4KY7 A;  5IOD A;  4K6D A;  1SYF A;  2OEO A;  3SK6 A;  4DU9 A;  4G57 A;  4IUN A;  3QOL A;  4N9P A;  1KDA A;  2F0D A;  2M00 A;  1STG A;  1EYC A;  4I65 A;  5EGT A;  3S9W A;  1TT2 A;  1AEX A;  5CV6 A;  1EYA A;  5IGG A;  5IGB A;  5KIX A;  4K5X A;  1SYE A;  5HGT A;  3BDL A;  5IIF A;  1A3V A;  2RDF A;  1A2U A;  3T13 A;  1EYD A;  1NSN S;  2KQ3 A;  5IGC A;  4WRD A;  2EYP A;  2F0V A;  5HUR A;  1ENC A;  4K5W A;  2PZT A;  2F0O A;  1EY8 A;  4B9W A;  3SR1 A;  1EY4 A;  1A3U A;  4NMZ A;  4J1M A;  4ZUJ A;  3T16 A;  4K5V A;  4K8J A;  4ZQ3 A;  4ID6 A;  5I9P A;  4H7B A;  5C6A A;  3C1F A;  3MHB A;  1ENA A;  5JAV A;  4ODG A;  1EY9 A;  2RBM A;  1JOK A;  3EJI A;  5C4Z A;  2F0U A;  3HEJ A;  2PQE A;  3TP7 A;  4DGZ A;  5I6Y A;  2EYL A;  4TRD A;  5M9O A;  5EKL A;  3MEH A;  3U9O A;  1EY7 A;  4KJN A;  2EY6 A;  2LKV A;  3NQT A;  5KRU A;  2WAC A;  5KYI A;  1F2Y A;  3P1H A;  1KAA A;  1II3 A;  5JOB A;  2PW7 A;  2F0H A;  4PNY A;  1STY A;  2F0E A;  3DMU A;  4QF4 A;  2EY2 A;  1STN A;  5C5L A;  1SYB A;  3NXW A;  5ISR A;  3BDC A;  3TME A;  4YIJ A;  2SNS A;  5E3F A;  5NUC A;  3QOJ A;  1EY0 A;  1EY6 A;  1EZ6 A;  1IHZ A;  4HMJ A;  4IAL A;  3SK8 A;  4EQP A;  4NKL A;  3E5S A;  3NUC A;  2RKS A;  5CV4 A;  4DFA A;  4F8M A;  1RKN A;  2EYJ A;  3ERQ A;  2ENB A;  4K2K A;  5C3W A;  2HQE A;  3SK5 A;  1JOR A;  4RKL A;  1SNP A;  1U9R A;  2F0N A;  4K2L A;  2F0S A;  5CV7 A;  5KGU A;  1STH A;  4NDX A;  3D4W A;  4KY5 A;  1SYC A;  4KV6 A;  4N9T A;  3TP5 A;  4EVO A;  4KY6 A;  1KDB A;  4R8N A;  4KJO A;  5CGK A;  4KD3 A;  3MXP A;  2F0F A;  4K14 A;  1SNC A;  3OWF A;  4QMG A;  1STA A;  4ME5 A;  5DAU A;  3TP8 A;  3V2T A;  4QB4 A;  4E6I A;  5KYL A;  1KDC A;  2SOB A;  5J22 A;  2F0M A;  1SND A;  3RUZ A; 
#chains in the Genus database with same CATH topology
 2V1C C;  3UI2 A;  2I46 A;  4LUZ A;  1LTI D;  4AYB E;  1VQJ A;  1B3A A;  1HRJ A;  1YHQ A;  1KL9 A;  4OIK A;  3HP3 A;  3HZX A;  5K5P A;  1CHQ D;  5KEE A;  3K57 A;  4YCU A;  4BBR G;  4JV5 Q;  2WV6 D;  5LMN Q;  1VQN A;  4POG A;  2EJG C;  3BU2 A;  3S1N B;  2CW0 C;  4PZ6 A;  4MN3 A;  5GAD C;  1ESF A;  5EKI A;  3GTO B;  4C2M H;  4B3M Q;  1IYU A;  1YIJ A;  4GN5 A;  2PZU A;  3HOV H;  4IFD G;  1PFS A;  1H95 A;  4LF8 Q;  2JP1 A;  4JOI C;  1LTR D;  2E5L L;  2Z4H A;  2E2I B;  3H6M A;  2Z6B A;  1HUN A;  3RNU A;  3I91 A;  2MHV A;  3MXN B;  3PF5 A;  4A3I H;  2UXB L;  3TRZ A;  3T1Y Q;  2R3Z A;  1S3O A;  2RDH A;  2B63 B;  2A6H C;  2VUM G;  3CC4 A;  4JI7 Q;  3OWE B;  1QZG A;  3JAM E;  2VQE Q;  3HOU G;  1SYE A;  4JI4 Q;  1E1T A;  4JBJ A;  2FHT A;  5JEA J;  4DV5 L;  4AYB B;  4A3G B;  2Q2U A;  2CWA A;  4QGU A;  3DUZ A;  1P16 A;  3CCQ A;  1I3Q H;  5COY A;  2I0Q A;  3CW2 C;  5C4X G;  1OXS C;  2F0U A;  4RA8 A;  5I6Y A;  2UUB Q;  3K7A H;  4GNX A;  1TY0 A;  2DNC A;  5DM6 3;  4LF4 Q;  5JEA H;  1PV4 A;  1J5E L;  3E9I A;  1YIT A;  3E3X A;  1ZXT A;  1KRS A;  4PNY A;  4Z9C B;  5ISR A;  1GUN A;  1AZQ A;  3OPO A;  3H94 A;  1HNZ Q;  2N8N A;  4QUF A;  1TKW B;  3ERS X;  4IAL A;  5T1G A;  4DUZ Q;  3G48 A;  1VQG A;  3ERQ A;  2KBN A;  4RKL A;  4ME3 A;  4TSS A;  2F0S A;  3BG3 A;  4HSV A;  3JC6 6;  3FP9 A;  4GOP A;  4EVO A;  3DLL A;  3A7L A;  4K14 A;  1M4V A;  5E7N A;  4BBS G;  2VS1 A;  2VY3 A;  1B2T A;  3I4L A;  4UP7 A;  3NSW A;  1MGS A;  2BDO A;  2R7Z H;  2A8V A;  3S17 B;  2Z0S A;  2A69 C;  3KBX A;  4XQQ A;  2QCP X;  1JCK B;  1JOQ A;  1MD2 D;  2SDF A;  4LF9 L;  4WJW A;  1AZP A;  1PH2 A;  3CP0 A;  1Q1E A;  3PMF A;  5J39 A;  2MFI A;  3CMA A;  5LL6 X;  4X64 Q;  4X66 L;  2ALY B;  1C7Y A;  2GVB A;  3RZO B;  1ILP A;  1IKL A;  2EPB A;  3K59 A;  2K5D A;  1AE2 A;  2YU9 B;  4F88 A;  1PH1 A;  1DOL A;  4YHH L;  1JT8 A;  1A63 A;  1LAB A;  1BR9 A;  3MEF A;  3HOY B;  1JOO A;  2PW5 A;  3NQI A;  5CYU A;  2NVX B;  4J6H A;  4CDE C;  1PYB A;  2AWN A;  3RN2 A;  3ICE A;  4G7Z C;  4RHR A;  2F0Q A;  3VR3 A;  1PH3 A;  1L1O A;  2A1A A;  4LUV A;  1I4Q A;  1PXU A;  3HOZ B;  2WFW A;  3J81 i;  2A19 A;  1TS2 A;  2QF7 A;  1EYA A;  4DUY L;  4RGT A;  4X62 Q;  4U68 A;  3KLW A;  1EYD A;  4HID A;  3S15 B;  1Y1W H;  1B70 B;  3FEW X;  1XMO Q;  2BH2 A;  2BE5 D;  1HQR D;  1ZEQ X;  2DY7 A;  4J1M A;  5EPK A;  4K5V A;  1VQL A;  4A3M B;  5C6A A;  2OT2 A;  1YNJ D;  4DK3 C;  5JAV A;  1S72 A;  4DK1 A;  4A3K H;  3HOX H;  1K83 B;  2WP8 J;  1VQM A;  3DEO A;  2ZJR A;  4FDB A;  1PHJ A;  2DN8 A;  3BVG A;  1Q8K A;  3U4V A;  3R93 A;  1OXT A;  1V1Q A;  2IT1 A;  3J7A 5;  1SDF A;  4A76 A;  2D5D A;  4AQY Q;  4LWC A;  2RKS A;  5LL6 S;  2EYJ A;  3PIO A;  3KF8 A;  4DV6 L;  5KGU A;  3M4O H;  1ASZ A;  1PZK D;  5E4W C;  4KD3 A;  3M9B A;  4TKO B;  2CKZ B;  1E2V A;  2PI2 A;  5A2Q E;  3HFZ B;  4HR7 B;  5M3F B;  1O7Y A;  2RDF A;  3RUZ A;  2HCC A;  2NVY B;  4AIM A;  2M2L A;  4BY7 H;  4UP8 A;  1RTN A;  4L5S A;  1PRT F;  2HDM A;  1GUO A;  1QUQ B;  2QA4 A;  4DR2 L;  4KHV A;  1D8L A;  5ELO A;  4DNT B;  1IW7 C;  1X3P A;  3HOW H;  2CHB D;  1D5Z C;  4GN3 B;  3PIP A;  1FYC A;  2K28 A;  4OWW B;  5BN5 A;  4C1N K;  1L0X B;  4KKT A;  2IX3 A;  4JVZ A;  3S1Q B;  3MA2 B;  4FF1 A;  3C2P A;  3A8I E;  5C4X H;  3BS1 A;  4BXX G;  4ULL A;  4KD4 A;  1Y1V H;  1X3E A;  3K7U C;  4X3K A;  2QDB A;  2K75 A;  3KFU A;  1N34 L;  1E22 A;  3KLS A;  4GLV B;  4DV7 L;  1TQO A;  1L1O C;  4YWM A;  3PO3 G;  1X55 A;  2ICI A;  4BXX H;  4X65 Q;  1NUC A;  1DGS A;  2J0T D;  1TR5 A;  2IWH A;  4CDD C;  4ZCK A;  5GAH C;  1CSP A;  2NVQ H;  1GKH A;  1EQQ A;  4ILW A;  1KD1 C;  1RTO A;  4A93 B;  1PZJ D;  4UY8 C;  3LNN A;  4P75 A;  5IGB A;  1AE3 A;  1IBL Q;  1WD1 A;  5I4D A;  2XN9 C;  4HAE A;  1BKB A;  1IL8 A;  3ER0 A;  3IFD A;  3G6J B;  2XVS A;  4YHH Q;  4QCL A;  1WCM G;  1PYS B;  1NBW A;  1QG7 A;  2NN6 G;  1PH9 A;  1CZG A;  2R92 B;  4ZUJ A;  1HXY D;  1MI2 A;  3IRB A;  3M7G A;  2EJM A;  4DAY B;  3C46 A;  4FVM A;  2YTX A;  3QJY A;  1TS4 A;  1HR0 Q;  1F9R A;  2KUM A;  2RSO A;  3MC0 B;  3CCE A;  5JOB A;  2JA8 B;  5DM7 3;  2J7Z A;  4LMQ D;  4QF4 A;  3NXW A;  1EEF D;  3F2B A;  2F4V Q;  5M3M H;  2KOL A;  2UUA L;  1NMG A;  4UPA A;  4YWL A;  1JIC A;  5M5W H;  1JOR A;  5C3W A;  4DV1 L;  1JJG A;  3PSI A;  3HOZ G;  1SE3 A;  4JI5 L;  1K8G A;  2GA4 B;  1SNC A;  2AHO B;  2EE1 A;  3S1R H;  1YI2 A;  1E24 A;  3KJP A;  5FO9 B;  3I4O A;  1CQV A;  1CKO A;  3I7F A;  2KJX A;  1HFN A;  5IT9 E;  1EWI A;  3M85 A;  3VYU A;  1C8C A;  4Q5V A;  3PF4 A;  1VF7 A;  4A3M G;  1Q7Y C;  2JEA I;  3EQL C;  2JSO A;  2IHE A;  1VQH A;  2C9O A;  2F0T A;  4A3F B;  4DV4 Q;  1EU3 A;  3L9A X;  1FJG L;  2HDL A;  1EL0 A;  3QB3 A;  4GKK Q;  3AMU A;  4Y52 H;  4S3S A;  4QUC A;  4XQJ A;  2UXD L;  2PYK A;  3OYY A;  4F87 A;  3HOX G;  3E0J A;  5GRO A;  1XTC D;  4NP5 A;  4PMC A;  3PGZ A;  2FIN B;  3I70 A;  4JI2 L;  1SMY D;  2K7V A;  4JI7 L;  4PMW A;  5IT9 c;  2F0J A;  3T1Y L;  1SR3 A;  4C3I H;  4K6D A;  2UXB Q;  5AFW A;  4K6L A;  4RWS C;  4JOI A;  3H15 A;  5ELE A;  4DR5 L;  2Y0S G;  1AEX A;  3KJO A;  4HCE A;  1Y8P B;  1WCM B;  5ELF A;  4LUO A;  3I2Z A;  2B29 A;  4A75 A;  3K80 C;  4QY7 A;  3T51 B;  3TEH B;  1ONL A;  3SR1 A;  1U4R A;  2ES2 A;  3T16 A;  1HZC A;  2K05 A;  2RBM A;  3DWQ A;  2E75 C;  3N52 A;  1YEZ A;  1HR0 L;  1GXD C;  3U50 C;  3H3V I;  3MEH A;  4RCO A;  4FXK C;  4XT3 B;  3R8B A;  3Q0A A;  1EIG A;  1V8Q A;  1TVX A;  1VQB A;  3K8A A;  4A3E G;  1VF5 C;  3FDT A;  5HY6 A;  4DN4 M;  1QNU A;  1EZ6 A;  2XRQ D;  4LFB L;  1YNJ C;  3GTM B;  4IFD I;  4X3T A;  4GZY C;  1PFM A;  2H5X A;  5JVH 3;  2XWJ B;  1PLF A;  4C3H H;  5COR A;  2JA5 H;  5CGK A;  2N3S A;  1F2L A;  2R7Z B;  2HQL A;  2QGQ A;  3UDG A;  5C5M A;  1PH4 A;  4P2C B;  3T4A C;  3P75 A;  1U4L A;  2O4X A;  2Q2H A;  1EFW A;  1JC7 A;  2EYO A;  1HR0 W;  1N34 Q;  1VQD A;  1PTO C;  5IP9 H;  1JJ2 A;  4LAA A;  5J1Z A;  3EBE A;  1EIF A;  1MSH A;  1PTO D;  1IBK Q;  3DWP A;  4ZUI A;  4WOR A;  1I94 L;  1SRU A;  1TWC B;  3NTI A;  3PQI A;  1ET9 A;  2NUC A;  2C5C A;  4BY7 B;  1I50 B;  2DGY A;  1PVO A;  2A6E D;  4ZYS A;  2RHS B;  1KTK A;  5FLM G;  3JAM i;  2E2J B;  1L0Y B;  5IE8 A;  3MXG A;  2DJF C;  3H0G B;  5IYD H;  4IUN A;  2TSS A;  2YTY A;  1WVL A;  2E2H B;  2N49 A;  5C0X G;  4H0L C;  1PYW D;  3D3R A;  4IOC A;  1HA5 A;  4RG1 A;  5KIX A;  2VNU D;  1EWH A;  4DV4 L;  4A3G G;  1SRO A;  2QKI C;  1FNW A;  3TRE A;  5M5X H;  2EYP A;  4FXG C;  3QIA A;  3K58 A;  1IBK L;  4JI3 Q;  4IPC A;  2JA7 G;  5JJZ A;  3S14 B;  1EY4 A;  3PO2 G;  3GP7 A;  1K83 H;  1B53 A;  1DYQ A;  2OQ0 A;  2EVB A;  5JJL A;  3HOV G;  2YV5 A;  5C44 G;  1LV9 A;  1PFN A;  4IUQ A;  2B2V C;  2WKD A;  2SEB D;  4CBV A;  2FMC A;  2F0H A;  1Q82 C;  1STN A;  3GDE A;  1NMF A;  3K5O A;  4HMJ A;  3RZD B;  2NYZ D;  4DFA A;  2HQE A;  1SMX A;  2GVA A;  1D5M C;  1SNP A;  2X6G A;  2F0N A;  1QZH A;  4PQX A;  1MKH A;  1GVP A;  1XMQ L;  1G6P A;  4E6I A;  1RDP D;  1NAP A;  1TWH B;  2EDG A;  3I90 A;  3TZD A;  1Y8O B;  1D1K A;  3MVV A;  1RCV D;  3FRP B;  3X3M A;  3PIO 3;  2NWG A;  2RA4 A;  3T53 B;  2XNA C;  4C3H G;  3ULP A;  3CCM A;  5DEH A;  4K8I A;  2F0K A;  4HN7 A;  1I4R A;  3SVM A;  3S16 H;  5G3L F;  3TBI B;  2EJF C;  1E3P A;  2RF4 A;  4MHE A;  4IOA A;  1PRT C;  1VQ8 A;  1O7Z A;  3VA7 A;  3OIP A;  3IFT A;  5C3E B;  1WTH A;  3Q6S A;  5E1F A;  2IW3 A;  4A3E B;  2RQX A;  3EVQ A;  4QJF A;  1OXV A;  3Q22 A;  2BA0 A;  1WFQ A;  2PZW A;  1C48 A;  4GNX B;  4LF9 Q;  1O7I A;  1UAP A;  4OL7 A;  4DNR B;  3TP6 A;  1VQE A;  1M1K C;  1SE4 A;  4TQU S;  4XYQ A;  4DAY A;  2R7Z G;  3NP8 A;  3F2D A;  5JPM C;  1LTS D;  1BVS A;  1LLR D;  4N9P A;  4OHJ A;  5FLX E;  4KK7 A;  2R93 B;  2UXD Q;  4K5X A;  4A3K B;  1PA6 A;  5HGT A;  3STB C;  2Z6K C;  2R92 H;  1NE3 A;  4GLA C;  3GTL H;  1WTV A;  3VYR A;  3K5M A;  1VDZ A;  5EQ0 A;  1HNZ L;  1AFP A;  5D3I B;  4DR2 Q;  3M3Y B;  3HKS A;  2HHH L;  4LNQ A;  5A2Q L;  3EA6 A;  4JYA L;  1EY9 A;  1HZB A;  1UUP A;  4X6A H;  1CA5 A;  5ELB A;  5KRU A;  1CSQ A;  4HED A;  1TWA H;  4QL5 A;  1N36 Q;  2R7F A;  2A6E C;  4OO1 G;  4IUT A;  4YIJ A;  5H1S E;  4NXM Q;  2XTI A;  4JI6 Q;  1Q90 A;  2EIF A;  1S5B D;  4DV3 Q;  2B2W C;  3NPP A;  1I6H H;  1IZ6 A;  4TVA B;  2MNA A;  2VQE L;  1BO0 A;  3TP5 A;  4N8F A;  1S5C D;  3NEN A;  3JAM c;  2ZT9 C;  2F4V L;  1SAP A;  5KYL A;  4BBS B;  3RZO H;  1XPU A;  1EY5 A;  4R4O A;  2HT1 A;  5C0X H;  4A3B B;  1QUQ A;  3M4Q A;  1HFG A;  4A93 G;  4IJH A;  2B39 A;  2F3V A;  4BY1 B;  5F2D A;  1Z6H A;  2D0O A;  1SFO B;  5K36 G;  1FNV A;  2ZTD A;  3J81 L;  4X62 L;  2NN6 I;  4B3M L;  3NWT A;  2A68 D;  2K32 A;  1RHP A;  4AH6 A;  5D14 A;  5K36 H;  5FKA C;  1K8M A;  1JWM D;  2JA5 B;  4DR6 L;  4G7O C;  5IOC A;  3CKI B;  1SYD A;  1E1O A;  2JA8 G;  4PV1 C;  4X65 L;  1Y1W G;  1SXT A;  2B2T C;  3UE1 A;  1KAB A;  5LMN W;  2F4I A;  3EFX D;  4G57 A;  2BH8 A;  3S1M H;  1HZA A;  1KLU D;  3BYT B;  4I65 A;  2RCN A;  2E2D C;  3KF8 B;  3FPU B;  5IGG A;  4A3K G;  1VQ9 A;  4CHT B;  3S24 A;  3B6Y A;  3BZK A;  1XNQ L;  5IIF A;  4A3L H;  2JEB I;  3T13 A;  1KC8 C;  4A3J B;  5IGC A;  4WRD A;  4A3D B;  2OCE A;  1MSG A;  3KLR A;  4NMZ A;  1S5E D;  2PMZ B;  1UNS A;  2WKC A;  3GV3 A;  4V19 0;  5BR8 L;  5IP7 H;  3HEJ A;  4DGZ A;  2E2J H;  4DNI A;  1FD7 D;  2F03 A;  2K5N A;  2XGT A;  3P1H A;  5E4X A;  2VQF L;  1J6Q A;  3DMU A;  1SYB A;  3HKZ G;  3L7Z C;  4RHS A;  1B1Z A;  3FVQ A;  3KF6 B;  5IY0 A;  1K8A C;  4C2M B;  4HIO A;  4RCN A;  2A68 C;  1G91 A;  3GTP B;  1W6J A;  4A93 H;  3NEL A;  1H9M A;  1PMR A;  4R8N A;  3V05 A;  4R4I A;  3S2H B;  3L2P A;  1BOS A;  2HD3 A;  2R93 G;  3TP8 A;  4ZRZ A;  1ESR A;  1JE4 A;  1VQ4 A;  2K5H A;  2QDL A;  5D3D A;  3J81 j;  3LX0 A;  4IZ8 A;  1XPR A;  4JK1 C;  1ET6 A;  1GHJ A;  2N78 A;  1UE6 A;  1Y1V B;  3D4D A;  1I4P A;  1G51 A;  3K0Y A;  1DZ1 A;  4RAU C;  4B08 A;  3DHQ A;  1LT5 D;  1BCP C;  4JI4 L;  1EQR A;  3GO5 A;  4FF3 A;  3MZ5 A;  4H02 A;  4M8A A;  1CQF A;  3NWS A;  2MUY A;  2TMP A;  4GN4 B;  1FL0 A;  3K0X A;  3R2T A;  2JA5 G;  2L12 A;  3SHL A;  4ABN A;  1Q81 C;  1HZ9 A;  1UE5 A;  4WJ3 M;  3A54 A;  2NZO A;  2FXQ A;  2ZM6 Q;  3OOC A;  3G71 A;  2LXK A;  4A3D H;  1A2T A;  1QCB D;  4HMI A;  4JI0 Q;  1SEB D;  3D6C A;  4OO1 H;  4DR6 Q;  4PZ8 A;  2AUK A;  2F0W A;  2XWB B;  4PMB A;  1LUZ A;  4JI1 Q;  1V43 A;  4UAI A;  1X32 A;  3MXN A;  3S16 B;  3J81 E;  3LWU A;  4H44 C;  1STG A;  1EYC A;  1KAW A;  1E2W A;  1YBY A;  3GTG H;  1S40 A;  1G2S A;  5I2Y A;  4JI1 L;  3GTK B;  4JI8 Q;  2Q8T A;  1JE5 A;  3RLF A;  2IY5 B;  1NSN S;  2K14 A;  4A3J G;  4JC0 A;  2F0V A;  1N9W A;  5AJ3 L;  3CME A;  3CQZ H;  4K5W A;  4IPG A;  4P71 A;  3TN2 A;  2ZXO A;  1V1P A;  1HTL D;  4B9W A;  1A3U A;  1NY4 A;  1HPC A;  3U4Z A;  4B3R L;  4ZQ3 A;  1AH9 A;  4BBS H;  3D4R A;  3KYH C;  5EBD A;  1GUW A;  1WTO A;  3EJI A;  2EQS A;  1X3F A;  2DY8 A;  2IX0 A;  3NQT A;  2E8G A;  5KYI A;  2KEC A;  1T5X D;  2L15 A;  2EY2 A;  2PI2 E;  5EPL A;  5C5L A;  4GKJ L;  4HIK A;  3BZD B;  5NUC A;  1GHK A;  2WAQ G;  3PV0 A;  1EY0 A;  1B44 D;  1Y1W B;  4C3I B;  2FFK B;  3AFP A;  4IFD H;  4LK1 C;  3WOE A;  2RVL A;  4GS3 A;  1IKM A;  3M7N A;  1AP0 A;  2Q2I A;  3OWF A;  4KHP L;  3L3O C;  1D6E C;  1F9Q A;  1I5F A;  3LGJ A;  3ERO A;  3VR5 A;  1SJH D;  2LY7 A;  4HJA A;  1YJ9 A;  2R6G A;  3FPP A;  2CVR A;  2K03 A;  3S2D H;  1W2B A;  3MFG A;  2VB2 X;  3ITP A;  3Q24 A;  5M5Y B;  2F3W A;  2CWP A;  3HOU H;  3V96 A;  1JWU D;  1WTP A;  4A3F G;  5FJ8 G;  2VL6 A;  5IGD A;  1L0W A;  3HOW G;  1QJO A;  1K28 A;  2IJ0 A;  2NVX H;  5IP9 G;  1B9M A;  3RR5 A;  2FJ2 A;  2WIN B;  2F0G A;  3I4M B;  1I4G A;  3HOX B;  3CCU A;  3J80 L;  3ZJY C;  5C44 B;  2KCN A;  1I4X A;  5LHY 1;  4CJ2 C;  3BVZ A;  4O42 A;  3NBI A;  4MTK A;  2AKW B;  3W2D A;  2O5I C;  1SNO A;  2JA6 B;  1JWS D;  2YYZ A;  3K81 C;  4KY7 A;  5FOB B;  1CFM A;  3JAM L;  5EAY A;  4IN3 A;  1RD9 D;  4P74 A;  1VQK A;  4LF8 L;  5LMU Q;  2KEE A;  3A55 A;  4JCV E;  1SE2 A;  2F0D A;  2M00 A;  4LF7 L;  3VYT A;  5EGT A;  4RH6 A;  1Q3L A;  5EPJ A;  3SEB A;  4ZKB B;  1L1O B;  2AQ1 B;  3K5L A;  3I55 A;  5IYD G;  1YNN C;  3E9H A;  3R2I A;  4IO9 A;  1BXT A;  2DNE A;  3AYH B;  4IUV A;  5JJI A;  1X56 A;  4EGV A;  1A6X A;  2NVY H;  1C4Q A;  3I4N G;  4ID6 A;  1M8A A;  1S4Z A;  2ATW A;  2X6L A;  4GOP C;  2BOS A;  3GTJ H;  2PQE A;  3NTK A;  2NVT B;  5EKL A;  4YCW A;  3A5U A;  1IBM L;  3I4N H;  4Y7N B;  4JW0 A;  1KQS A;  4IUU A;  4BA1 I;  3AQQ A;  4DR1 Q;  4HJ5 A;  2PQA B;  2UUC Q;  1RJT A;  3TME A;  5E3F A;  1TU2 B;  1XNR Q;  4MNO A;  1NNX A;  4DR7 Q;  1HHV A;  3GV6 A;  3E5S A;  3NUC A;  4NKL A;  4A3I B;  2UXC Q;  3HOY H;  2CW0 D;  3I72 A;  3D31 A;  4FP5 D;  1U9R A;  4K2L A;  2BCO A;  1SLJ A;  1Y14 B;  2L55 A;  1SYC A;  5KNB A;  1GUS A;  3MXP A;  3G4S A;  1O7L A;  3I3C A;  3MFY A;  2SOB A;  3GD7 A;  4JPB W;  3SE0 A;  3VR4 A;  2B63 G;  4KN7 C;  1CUK A;  5CBE E;  3PO3 H;  4DAV A;  4XTC S;  5LMU L;  3I4M H;  4JI3 L;  4DV3 L;  1PH5 A;  4Q0F A;  1FNU A;  2A69 D;  5M3M B;  5C44 H;  4XQN A;  3CCS A;  3I73 A;  1ASY A;  5M5W B;  2K5W A;  3GTP H;  4CGY B;  3VDY A;  3WWV A;  3J7A F;  2CQA A;  1A0I A;  2EXZ A;  3CQZ B;  4DF7 A;  3S1N H;  2EYH A;  2L0C A;  4DK6 C;  4JI2 Q;  2E2H H;  4IFD J;  1HNW Q;  4HJ7 A;  1NJI C;  3M4Y A;  2PCF B;  3LWE A;  3ONA B;  3AB9 A;  1YJW A;  2JXM B;  4C3I G;  1JB7 A;  4OGQ C;  3OTO L;  2OWO A;  3SK4 A;  1H9R A;  3T1H Q;  4L6T B;  2KA7 A;  4JG2 A;  2PNR C;  1F2M A;  1YJN A;  4KKS A;  1M90 C;  3PO2 H;  2JJQ A;  4DK0 A;  3M4O B;  2I5L X;  3S9W A;  3KLS X;  1R9T B;  3N6R A;  1EUJ A;  4OON A;  5JVG 3;  1NCV A;  5FLM H;  1KRT A;  1LT4 D;  2Y0S B;  3KF6 A;  1UE1 A;  5IWA L;  3CRL C;  3OW2 A;  4FXD A;  1TY2 A;  3UDX A;  1GO3 E;  4CJ1 B;  4C1N I;  4LJZ C;  4L5R C;  3MHB A;  4DR3 L;  1VQ5 A;  4FF4 A;  4FNF A;  4HJ8 A;  2F3I A;  2EYL A;  5BN3 A;  4IPD A;  3U9O A;  4DXG A;  1X9N A;  3ZYY X;  4BY1 G;  3PUZ A;  3I4M G;  1U4M A;  1IL2 A;  3I8Z A;  1E0B A;  2F0E A;  3NE5 B;  2OTL A;  3G6E A;  4EX5 A;  3S1Q H;  1DON A;  3UE0 A;  1P8L A;  1VQO A;  3Q23 A;  2UU9 L;  4EQP A;  3SK8 A;  3CC2 A;  4DPG A;  3C3L A;  2ZXR A;  3CD6 A;  2ENB A;  1F77 A;  3MXU A;  4IPH A;  4J15 A;  1XJV A;  2AQ2 B;  1F9P A;  4KY5 A;  1VCI A;  2B3G A;  4O1N A;  5AJ3 Q;  2WAQ E;  2F0F A;  5DAU A;  2QEX A;  3STB D;  4JI8 L;  4A3B G;  1MBY A;  5C4J B;  3DWA A;  3CF5 A;  1GM5 A;  1BUV T;  2AQ3 B;  4EQN A;  1TWH H;  2NZ1 D;  2WB1 B;  4LF5 L;  1CI3 M;  1K3B C;  3WOF A;  1QNK A;  5EKK A;  1LTB D;  4F7X A;  1VS0 A;  1WTR A;  1OTC A;  4JI0 L;  3HRZ C;  1WOC A;  1WCM H;  1TWF H;  2P5Z X;  2B63 H;  2OXP A;  3RLO A;  3TSS A;  2ZM6 L;  4G7H C;  1QB5 D;  3H09 A;  3NHH A;  1EYG A;  1BBX C;  4XT1 B;  3PUY A;  3P20 A;  1WTW A;  3OMG A;  3GTQ H;  2QEJ C;  1BCP F;  4RFB A;  2KCC A;  3CCV A;  5CV8 A;  2EZV A;  2NVT H;  3L0O A;  3TDQ A;  1YVC A;  3F8T A;  5GQO A;  5KND A;  2VUM B;  1SN8 A;  2G5D A;  4DU9 A;  4HJ9 A;  1U5K A;  1WTQ A;  3GTK H;  3ULL A;  2NB0 A;  1FJG Q;  2G9H D;  1TT2 A;  5FK9 C;  3OTO Q;  4IUP A;  2VW9 A;  1K0R A;  1Z7T A;  3FKI B;  2K5Q A;  2KQ3 A;  4CDC C;  1ILQ A;  3AU7 A;  2ZJQ A;  3A56 A;  2VUM H;  1QIL A;  2LSS A;  3QO2 A;  1LT6 D;  5DLQ E;  2RHQ B;  4YY3 Q;  4OXP A;  4BS9 A;  5I9P A;  3PUX A;  1LYL A;  1EWC A;  1R4Q B;  1CK1 A;  1Q46 A;  4YCV A;  1VQ6 A;  4A3C H;  2EOT A;  4KN4 C;  1Y1V G;  5FLX L;  4A3M H;  2O2L D;  3OHX C;  4J8Q A;  4JI5 Q;  4JBM A;  1KAA A;  2Z4I A;  3KDF A;  2QIL A;  1HA6 A;  1IW7 D;  4DV1 Q;  1XYI A;  3PIP 3;  1STE A;  3BYY B;  3H0G G;  1GUG A;  1EEI D;  1IHZ A;  3GTO H;  2UUA Q;  1CTM A;  2D9U A;  1UE7 A;  2PPB C;  4CDF C;  1F9S A;  1PH8 A;  4B3T L;  1LAC A;  1O80 A;  2AMC B;  3TZU A;  4APV A;  1HTP A;  4BWG B;  3D6W A;  3S15 H;  2N55 A;  4N8X 1;  2RSN A;  1XNQ Q;  2SNS A;  2UXC L;  4OEM B;  4ZK9 B;  2MP1 A;  1JR0 D;  1SJE D;  4EQO A;  4KTA A;  1GJX A;  2O5J C;  4NXN L;  3GTQ B;  2WB1 G;  3M4P A;  4LFB Q;  4DR1 L;  2OF1 A;  3BZC A;  3UDI A;  1Q8I A;  2KCM A;  1IBM Q;  4DR4 Q;  2VB3 X;  1IBL L;  2Y0S E;  4HIM A;  2R92 G;  3KBG A;  1I4H A;  2D2C C;  4A3B H;  5ELN A;  4B9X A;  1PRT B;  4L5T A;  4A3G H;  1FGB D;  1I50 H;  1LTT D;  3OMC A;  1IXR A;  1WTX A;  3NK9 A;  2OTJ A;  1I3Q B;  4RGN A;  1D7Q A;  3K5N A;  2NBF A;  5TSS A;  2B2Y A;  3UDF A;  5C3E G;  3R3O A;  5JJK A;  1SBB B;  1PTO B;  3OIQ A;  3H3V H;  4NW2 A;  1SNQ A;  1SSO A;  4HCS A;  5GAG C;  4A4I A;  2IHF A;  2MPM A;  3OSO A;  4X66 Q;  2PMZ E;  5D65 A;  4CKC A;  4X64 L;  1H9J A;  4ZAI A;  4PG3 A;  4DR5 Q;  4R9W A;  1MJE A;  4C3J G;  4L63 B;  2E76 C;  2Q2T A;  1B8A A;  3CHB D;  3AEV A;  3QR8 A;  1A3V A;  4H13 C;  3I56 A;  1DJR D;  1Q12 A;  4B3S Q;  1EOV A;  2KHJ A;  3DM1 A;  2PZT A;  1TII D;  1BQQ T;  1NR4 A;  4DXF A;  1BCP D;  1CHP D;  1PFB A;  3HGB A;  2C35 B;  2A74 C;  2G9D A;  3A8J E;  2JE6 I;  4YWK A;  5C4X B;  4JI6 L;  5C4Z A;  4NXM L;  2HCI A;  2A73 B;  2MO1 A;  1HNX L;  4M1U B;  1II3 A;  2WAQ B;  4BA2 I;  4DUZ L;  2K6A A;  1L2F A;  2R7D A;  3IKJ A;  3SDZ A;  4YY3 L;  1V9P A;  2XSC A;  3BDC A;  3ND8 A;  1C9O A;  2K52 A;  5C0X J;  1K9M C;  3T56 B;  1EY6 A;  2NTT A;  4V0B A;  1EU4 A;  3VYS A;  5IP7 G;  3GTL B;  4A3C G;  4LF4 L;  1DM0 B;  3IL8 A;  4QQB X;  2UUB L;  3M3Y H;  1STH A;  4NDX A;  4KJO A;  2BDN A;  1RL2 A;  4X3U A;  1HNX Q;  1U0L A;  4G4K A;  5J22 A;  2F0M A;  2IL8 A;  3VA5 A;  1QE6 A;  1OXU A;  3SXH A;  2Z8L A;  1FR3 A;  3CXC A;  3S1R B;  2D62 A;  4R8I A;  4GKJ Q;  1HH2 P;  2JA7 B;  1XMO L;  3PCO B;  2F52 A;  1HQM C;  2I5M X;  5C3E H;  3IAY A;  1GOZ A;  3C1E A;  1ZYR C;  5CV5 A;  4DUY Q;  1NR2 A;  1SMY C;  3EN2 A;  5CMD A;  4A3E H;  1F2Z A;  5FLX c;  1LO5 D;  1SNM A;  4B3R Q;  2JK8 A;  1EFI D;  1XTD A;  5L37 A;  5I6W A;  2F0P A;  1VQC A;  4DAP A;  2VXW A;  4P72 A;  4GOP B;  1BNZ A;  3GQB A;  5IYC H;  5IGE A;  4RMF A;  5CR3 A;  4LF5 Q;  2LFN A;  1Q86 C;  1QVF A;  1J9O A;  1TWA B;  3S2H H;  2KHS A;  1X54 A;  2ZTE A;  4HTH A;  1Y8N B;  2K33 A;  3RZD H;  1QVG A;  1BBW A;  1RF2 D;  4JBW A;  3SK6 A;  2ICE C;  1KXL A;  1C0A A;  3A74 A;  3BJU A;  4JV5 L;  4BBR B;  5A35 A;  3AFQ A;  2XIW A;  2K5V A;  5BN4 A;  2D0P A;  2BE5 C;  1XMQ Q;  4DR4 L;  4Y7N H;  5HUR A;  4GNX C;  1WYD A;  2UU9 Q;  5FJ8 H;  4QIW B;  1X3Q A;  1KLG D;  4NXN Q;  4XIG S;  1QVC A;  2Q8R E;  5JEA G;  4UP9 A;  3C1F A;  4IJL A;  2K01 A;  1A8V A;  2K04 A;  2BA1 A;  4AYB G;  2L11 A;  5IGF A;  3TP7 A;  1Z9F A;  2RCF A;  1QOH A;  4KJN A;  5M3M G;  2WAC A;  1F2Y A;  5T1I A;  1E7Z A;  4C56 C;  4P73 A;  3W1G A;  4QIW E;  4B3T Q;  2B2Y C;  4WJ4 A;  4ZKC B;  1H9S B;  3QOJ A;  1H9S A;  2B8G A;  2L9H A;  2CQO A;  5CV4 A;  3FMC A;  3SK5 A;  3HOU B;  2JQO A;  1B3Q A;  3KDF B;  1TS5 A;  3A0J A;  3D4W A;  2DJG C;  4KV6 A;  1SE8 A;  1U4P A;  5I2X A;  2F1M A;  1UWV A;  2K4K A;  3GTM H;  1STA A;  3V2T A;  2J4X A;  4QB4 A;  1KDC A;  4K0K L;  1B9N A;  3BVM A;  4RKB A;  1T9H A;  3CRK C;  1CKN B;  4DV0 L;  4DV6 Q;  4DV2 L;  2R93 H;  1CKN A;  4BY1 H;  2B8F A;  1XWE A;  1VQ7 A;  4DV5 Q;  5KNC A;  2PQA A;  2IX1 A;  1DXM A;  3CC7 A;  3CCL A;  4AQY L;  1G6Z A;  1Z47 A;  2F0I A;  5CBA E;  1B7Y B;  1HNW L;  1PH6 A;  1JMC A;  1ML0 D;  4O2D A;  3EIV A;  4B3S L;  2AWO A;  1TWG B;  3SGI A;  5C3X A;  3HS0 C;  4I7Z C;  4XDX A;  4XYO A;  1I94 Q;  2WB1 E;  2NVQ B;  3KK7 A;  1EZ8 A;  4X3S A;  1LTG D;  1WD0 A;  2E5L Q;  3E6Z X;  3S1M B;  1FGU A;  1IYV A;  4FF2 A;  1TWG H;  2JN4 A;  3E0E A;  1A3T A;  2NZH A;  5ELC A;  2JA6 G;  2K50 A;  1W6K A;  4A3J H;  1MIU A;  2N88 A;  3FKI H;  2A5H A;  3ULJ A;  3BDO A;  5CV6 A;  5JPN C;  4NB3 A;  4L5Q A;  2JA6 H;  2ASB A;  4O0A A;  2CFM A;  2QW7 A;  2HIX A;  3F2C A;  4ALP A;  2CH4 W;  2F0O A;  2XRS D;  1EY8 A;  3HG9 A;  2ZJP A;  1K8O A;  4C3H B;  3TS0 A;  4XXE A;  1J8I A;  1TS3 A;  1JOK A;  1E2Z A;  3HOY G;  2WII B;  4TRD A;  3U9S A;  5M9O A;  1EIY B;  4DAM A;  2EY6 A;  1UEA B;  1YNX A;  3ND9 A;  2PW7 A;  4A3F H;  3P7J A;  1N33 Q;  3J7Y W;  3KUP A;  3GTG B;  3D0F A;  3U58 A;  2OQK A;  1D2B A;  1JB3 A;  3J80 c;  2LS0 1;  2Z9H A;  2E74 C;  2Q8I B;  1N32 Q;  4F8M A;  1YHB A;  4LFC Q;  1PRT D;  3CCR A;  1KNA A;  1G29 1;  1CA6 A;  1AW7 A;  4LFA L;  4KY6 A;  2EXD A;  1R9T H;  2X69 A;  4BY7 G;  4QMG A;  2AUJ D;  1K0S A;  3J7Z C;  5IYB H;  2JA8 H;  2JYO A;  2KHI A;  1TWC H;  4CKE A;  1DCZ A;  3RMH A;  4JBK A;  4DR3 Q;  4A3D G;  3RN5 A;  3D8G A;  2ZTC A;  3QWN A;  1BF4 A;  2EYF A;  3S17 H;  1Y69 U;  4KKU A;  1I6V C;  2L1B A;  1N36 L;  1XXG A;  5I9O A;  3G7L A;  1PZI D;  1VQI A;  3FKI G;  1O78 A;  3QG1 A;  4RGO S;  3J80 E;  3DEP A;  4L8J A;  4JYA Q;  2MQH A;  4KMU C;  2MO0 A;  1STB A;  1J5E Q;  2GN5 A;  1UEB A;  3RLN A;  4EQ5 A;  1VQF A;  2H4O A;  2HHH Q;  4CKB A;  1VQA A;  4PZ7 A;  2FMM A;  4OWX B;  1CM9 A;  5M5X B;  3HOW B;  1OXX K;  5CV9 A;  3MAQ A;  4GKK L;  3T1H L;  5CC4 A;  2F0L A;  3J7A V;  1NTG A;  1DOK A;  5M3F G;  1PDQ A;  2LMC B;  3F2U A;  2B2U C;  3O13 A;  5C4H A;  5C0X I;  3PO3 B;  3WDN A;  1HUM A;  1SYF A;  2OEO A;  3W1B A;  1LM0 A;  1CT1 D;  2DUD A;  2CH4 A;  2I5H A;  3K6O A;  4OX9 Q;  4KHP Q;  1A15 A;  2PO4 A;  2KVM A;  2H1E A;  1XPO A;  2V4D A;  1PTO F;  1MHW C;  2NN6 H;  3HOZ H;  3BDL A;  3PO2 B;  1CKM A;  1TXY A;  1OO9 B;  1ICF B;  2MGS A;  1ENC A;  4WFN 3;  1WI5 A;  3W3A A;  4OIJ A;  5ELD A;  3HOV B;  1K3R A;  4LW1 A;  4K8J A;  2E2I H;  5IYB G;  1EOT A;  1H9K A;  4ODG A;  4LFA Q;  1V1P B;  3CCJ A;  1FVI A;  1VQP A;  3H3V C;  2NTS A;  2LKV A;  4MTN A;  4LFC L;  4I7A A;  2L5T A;  5DNF A;  1YHA A;  1V1O A;  1N8R C;  1VMC A;  4R1J A;  1ZKO A;  5LMN L;  2Z1C A;  1G2T A;  4DKA C;  3A7A B;  1BDO A;  1N33 L;  3A5Z B;  2B2T A;  3A8K E;  1RKN A;  2M9V A;  1LT3 D;  2B2U A;  5G3L D;  5CV7 A;  4N9T A;  3S2D B;  2IPK D;  2YU9 H;  3VR2 A;  4ZLT F;  1SND A;  3TQY A;  3I4N B;  2JA7 H;  1B50 A;  2EY1 A;  3K7A B;  4IQZ A;  5M3F H;  2B2V A;  1X6O A;  4MIU A;  2HUG A;  1RIP A;  2R61 A;  2SNM A;  1S5F D;  4KI0 A;  4HSP A;  1ZYR D;  4OWT B;  4KHZ A;  2B2W A;  3HKZ E;  3DXJ C;  1HJP A;  4CJ0 B;  5EJW A;  5FO7 B;  4FYD A;  2LXJ A;  1SFO H;  5IWA Q;  1PTO H;  2K1B A;  4DV7 Q;  5HGQ A;  4OX9 L;  4LF6 Q;  4LF7 Q;  4A3I G;  2EYM A;  1CZW A;  4U67 3;  4POF A;  4MZ9 A;  3CPW A;  1TWF B;  1I6H B;  4UDU C;  1KIX A;  3NBH A;  2EY5 A;  4FO2 A;  3GTJ B;  3NBH B;  1PH7 A;  3X3N A;  3HKZ B;  1S5D D;  4OEL B;  5GAE C;  5FO8 B;  1ROD A;  1EQV A;  3FHW A;  3OW7 A;  1SYG A;  1Q1B A;  1K73 C;  3CAM A;  4C3J B;  2YTV A;  2ID0 A;  5C4J H;  2Z6K A;  2ZXP A;  4BBR H;  4DA2 A;  5IOD A;  4R4Q A;  3KOJ A;  3W5O A;  1T5E A;  1KNE A;  3PUW A;  1DD2 A;  3QOL A;  1KDA A;  1QWY A;  1GUT A;  4KLK A;  4NPS A;  3S14 H;  1G8Z D;  4R4T A;  3MWY W;  3URY A;  1A2U A;  1LTA D;  4DV2 Q;  4DV0 Q;  2CCZ A;  1BBU A;  4C3J H;  2KED A;  4RGM A;  5J3B A;  2L4N A;  5EBC A;  3TS2 A;  1JJC B;  1HCZ A;  1WJJ A;  5IYC G;  4K0K Q;  1EIH A;  1VMP A;  3J80 i;  5M5Y H;  4H7B A;  1EQT A;  2A6H D;  1ENA A;  3MTS A;  3J81 c;  1A62 A;  1ENF A;  2VQF Q;  2MJ8 A;  3NTH A;  3RD4 A;  1BCP B;  1B4O A;  2KEN A;  3F1Z A;  1D5X C;  1EY7 A;  3VR6 A;  4LF6 L;  1IYJ B;  1YNN D;  4OO1 I;  3CU7 A;  4R4C A;  5BR8 Q;  4IUR A;  1ICW A;  1STY A;  3PUV A;  1X65 A;  2RDG A;  2KCT A;  2VZA A;  3CPF A;  4GLX A;  1N32 L;  1LTL A;  4A3L G;  4UHV A;  2I07 B;  1W3S A;  1AN8 A;  1XX8 A;  4K2K A;  3NEM A;  3DM3 A;  5IT9 L;  1KHI A;  1GD7 A;  2HIV A;  2JA9 A;  1YZ6 A;  1X3G A;  3H91 A;  4DR7 L;  1MJC A;  1KDB A;  1JQY D;  1XNR L;  1DOM A;  3Q8D A;  4ME5 A;  2UUC L;  2PNH A;  1D1I A;  1R4P B;  3H0G H; 
#chains in the Genus database with same CATH homology
 3UI2 A;  2I46 A;  1LTI D;  1B3A A;  1HRJ A;  4OIK A;  3HP3 A;  3HZX A;  5K5P A;  1CHQ D;  5KEE A;  3K57 A;  2WV6 D;  2EJG C;  3S1N B;  2CW0 C;  4MN3 A;  1ESF A;  5EKI A;  3GTO B;  1IYU A;  2PZU A;  4IFD G;  2JP1 A;  1LTR D;  2E2I B;  2Z4H A;  3H6M A;  1HUN A;  3I91 A;  2MHV A;  2R3Z A;  2RDH A;  2B63 B;  2A6H C;  3OWE B;  3JAM E;  1SYE A;  2FHT A;  5JEA J;  4AYB B;  4A3G B;  3DUZ A;  5COY A;  1OXS C;  2F0U A;  4RA8 A;  5I6Y A;  1TY0 A;  2DNC A;  5DM6 3;  5JEA H;  1ZXT A;  4PNY A;  4Z9C B;  5ISR A;  1GUN A;  1AZQ A;  3OPO A;  3H94 A;  4QUF A;  1TKW B;  4IAL A;  5T1G A;  3ERQ A;  4RKL A;  4TSS A;  2F0S A;  3BG3 A;  4HSV A;  4EVO A;  3A7L A;  4K14 A;  1M4V A;  1B2T A;  3I4L A;  3NSW A;  1MGS A;  2BDO A;  3S17 B;  2A69 C;  3KBX A;  4XQQ A;  2QCP X;  1JCK B;  1JOQ A;  1MD2 D;  2SDF A;  4WJW A;  1AZP A;  1Q1E A;  3PMF A;  5J39 A;  5LL6 X;  3RZO B;  1ILP A;  1IKL A;  2EPB A;  3K59 A;  2K5D A;  2YU9 B;  4F88 A;  1DOL A;  1LAB A;  1BR9 A;  3HOY B;  1JOO A;  2PW5 A;  3NQI A;  5CYU A;  2NVX B;  4J6H A;  2AWN A;  4G7Z C;  4RHR A;  2F0Q A;  3VR3 A;  1I4Q A;  1PXU A;  3HOZ B;  1TS2 A;  2QF7 A;  1EYA A;  4RGT A;  4U68 A;  1EYD A;  3S15 B;  3FEW X;  2BE5 D;  1HQR D;  1ZEQ X;  2DY7 A;  4J1M A;  5EPK A;  4K5V A;  4A3M B;  5C6A A;  2OT2 A;  1YNJ D;  5JAV A;  4DK1 A;  1K83 B;  2WP8 J;  3DEO A;  2DN8 A;  3BVG A;  3R93 A;  1OXT A;  2IT1 A;  1SDF A;  2D5D A;  2RKS A;  5LL6 S;  2EYJ A;  3KF8 A;  5KGU A;  1PZK D;  5E4W C;  4KD3 A;  4TKO B;  1E2V A;  5A2Q E;  4HR7 B;  5M3F B;  1O7Y A;  2RDF A;  3RUZ A;  2HCC A;  2NVY B;  2M2L A;  1RTN A;  1PRT F;  2HDM A;  1GUO A;  4KHV A;  4DNT B;  1IW7 C;  1X3P A;  2CHB D;  1D5Z C;  1FYC A;  2K28 A;  5BN5 A;  4C1N K;  1L0X B;  4KKT A;  2IX3 A;  3S1Q B;  3MA2 B;  4FF1 A;  3C2P A;  3A8I E;  3BS1 A;  4ULL A;  4KD4 A;  4X3K A;  2QDB A;  3KLS A;  1TQO A;  2ICI A;  1NUC A;  2J0T D;  1TR5 A;  2IWH A;  4ILW A;  1RTO A;  4A93 B;  1PZJ D;  3LNN A;  5IGB A;  1WD1 A;  5I4D A;  2XN9 C;  4HAE A;  1IL8 A;  3IFD A;  3G6J B;  2XVS A;  4QCL A;  1QG7 A;  2NN6 G;  1CZG A;  2R92 B;  4ZUJ A;  1HXY D;  1MI2 A;  3M7G A;  2EJM A;  3C46 A;  4FVM A;  3QJY A;  1TS4 A;  1F9R A;  2KUM A;  2RSO A;  3MC0 B;  5JOB A;  2JA8 B;  5DM7 3;  2J7Z A;  4LMQ D;  4QF4 A;  3NXW A;  1EEF D;  2KOL A;  1JIC A;  1JOR A;  5C3W A;  1SE3 A;  2GA4 B;  1SNC A;  2EE1 A;  5FO9 B;  1CQV A;  2KJX A;  1HFN A;  5IT9 E;  3M85 A;  3VYU A;  1C8C A;  4Q5V A;  1VF7 A;  2JEA I;  3EQL C;  2JSO A;  2C9O A;  4A3F B;  2F0T A;  1EU3 A;  3L9A X;  2HDL A;  1EL0 A;  3QB3 A;  3AMU A;  4S3S A;  4QUC A;  4XQJ A;  2PYK A;  4F87 A;  3E0J A;  1XTC D;  4NP5 A;  4PMC A;  2FIN B;  3I70 A;  1SMY D;  2K7V A;  4PMW A;  2F0J A;  4K6D A;  5AFW A;  4K6L A;  4RWS C;  5ELE A;  1AEX A;  4HCE A;  1Y8P B;  1WCM B;  5ELF A;  3T51 B;  1ONL A;  3SR1 A;  1U4R A;  3T16 A;  2K05 A;  2RBM A;  3DWQ A;  2E75 C;  3N52 A;  1GXD C;  3MEH A;  4RCO A;  4FXK C;  3Q0A A;  4XT3 B;  3R8B A;  1EIG A;  1V8Q A;  1TVX A;  1VF5 C;  3FDT A;  4DN4 M;  1QNU A;  1EZ6 A;  2XRQ D;  1YNJ C;  3GTM B;  4IFD I;  4X3T A;  4GZY C;  1PFM A;  5JVH 3;  2XWJ B;  1PLF A;  5COR A;  5CGK A;  1F2L A;  2R7Z B;  5C5M A;  4P2C B;  3T4A C;  3P75 A;  1U4L A;  2O4X A;  1JC7 A;  2EYO A;  1PTO C;  4LAA A;  5J1Z A;  1MSH A;  1PTO D;  3DWP A;  4ZUI A;  4WOR A;  1TWC B;  3NTI A;  1ET9 A;  2NUC A;  2C5C A;  4BY7 B;  1I50 B;  2A6E D;  4ZYS A;  2E2J B;  1KTK A;  1L0Y B;  3MXG A;  3H0G B;  4IUN A;  2TSS A;  1WVL A;  2E2H B;  5C0X G;  4H0L C;  1PYW D;  3D3R A;  1HA5 A;  5KIX A;  2VNU D;  1EWH A;  2QKI C;  1FNW A;  2EYP A;  4FXG C;  3QIA A;  3K58 A;  5JJZ A;  3S14 B;  1EY4 A;  3GP7 A;  1B53 A;  1DYQ A;  2EVB A;  1LV9 A;  1PFN A;  4IUQ A;  2B2V C;  2WKD A;  2SEB D;  4CBV A;  2FMC A;  2F0H A;  1STN A;  3K5O A;  4HMJ A;  3RZD B;  2NYZ D;  4DFA A;  2HQE A;  1D5M C;  1SNP A;  2X6G A;  2F0N A;  4PQX A;  4E6I A;  1RDP D;  1NAP A;  1TWH B;  2EDG A;  3I90 A;  3TZD A;  1Y8O B;  1D1K A;  3MVV A;  1RCV D;  3FRP B;  3X3M A;  3PIO 3;  2NWG A;  2RA4 A;  3T53 B;  2XNA C;  4C3H G;  5DEH A;  4K8I A;  2F0K A;  4HN7 A;  1I4R A;  3SVM A;  5G3L F;  3TBI B;  2EJF C;  4MHE A;  1PRT C;  1O7Z A;  3VA7 A;  3OIP A;  3IFT A;  5C3E B;  3Q6S A;  5E1F A;  2IW3 A;  4A3E B;  2RQX A;  3EVQ A;  1OXV A;  3Q22 A;  2BA0 A;  2PZW A;  1C48 A;  1UAP A;  4OL7 A;  4DNR B;  3TP6 A;  1SE4 A;  4TQU S;  4XYQ A;  4DAY A;  3NP8 A;  5JPM C;  1LTS D;  1LLR D;  4N9P A;  4OHJ A;  5FLX E;  4KK7 A;  2R93 B;  4K5X A;  4A3K B;  5HGT A;  1WTV A;  3VYR A;  3K5M A;  1VDZ A;  5EQ0 A;  1AFP A;  5D3I B;  3M3Y B;  5A2Q L;  3EA6 A;  1EY9 A;  1UUP A;  1CA5 A;  5ELB A;  5KRU A;  4HED A;  2A6E C;  4OO1 G;  4IUT A;  4YIJ A;  1Q90 A;  1S5B D;  2B2W C;  3NPP A;  1BO0 A;  3TP5 A;  1S5C D;  2ZT9 C;  1SAP A;  5KYL A;  4BBS B;  1EY5 A;  5C0X H;  4A3B B;  1HFG A;  2B39 A;  2F3V A;  4BY1 B;  5F2D A;  1Z6H A;  1SFO B;  5K36 G;  1FNV A;  3J81 L;  2NN6 I;  3NWT A;  2A68 D;  2K32 A;  1RHP A;  5D14 A;  5K36 H;  5FKA C;  1K8M A;  1JWM D;  2JA5 B;  4G7O C;  5IOC A;  3CKI B;  1SYD A;  4PV1 C;  1SXT A;  2B2T C;  1KAB A;  2F4I A;  3EFX D;  4G57 A;  1KLU D;  3BYT B;  4I65 A;  2E2D C;  5IGG A;  3FPU B;  4CHT B;  5IIF A;  2JEB I;  3T13 A;  4A3J B;  5IGC A;  4WRD A;  4A3D B;  1MSG A;  3KLR A;  4NMZ A;  1S5E D;  2PMZ B;  1UNS A;  2WKC A;  3GV3 A;  4V19 0;  3HEJ A;  4DGZ A;  1FD7 D;  2F03 A;  3P1H A;  5E4X A;  3DMU A;  1SYB A;  3L7Z C;  4RHS A;  1B1Z A;  3FVQ A;  4C2M B;  4RCN A;  2A68 C;  1G91 A;  3GTP B;  1W6J A;  1H9M A;  1PMR A;  4R8N A;  3V05 A;  3S2H B;  1BOS A;  3TP8 A;  4ZRZ A;  1ESR A;  1JE4 A;  5D3D A;  3LX0 A;  4IZ8 A;  4JK1 C;  1ET6 A;  1GHJ A;  1Y1V B;  3D4D A;  1I4P A;  3K0Y A;  1DZ1 A;  4RAU C;  4B08 A;  3DHQ A;  1LT5 D;  1BCP C;  3GO5 A;  4FF3 A;  3MZ5 A;  4M8A A;  1CQF A;  3NWS A;  2MUY A;  2TMP A;  3R2T A;  2L12 A;  3SHL A;  4ABN A;  3A54 A;  3OOC A;  1A2T A;  1QCB D;  4HMI A;  1SEB D;  3D6C A;  4OO1 H;  2AUK A;  2F0W A;  2XWB B;  4PMB A;  1V43 A;  4UAI A;  1X32 A;  3MXN A;  3S16 B;  3J81 E;  3LWU A;  4H44 C;  1STG A;  1EYC A;  1E2W A;  1G2S A;  5I2Y A;  3GTK B;  2Q8T A;  3RLF A;  1NSN S;  2F0V A;  4K5W A;  3TN2 A;  2ZXO A;  1V1P A;  1HTL D;  4B9W A;  1A3U A;  1HPC A;  4ZQ3 A;  3D4R A;  5EBD A;  1GUW A;  1WTO A;  3EJI A;  2IX0 A;  2DY8 A;  3NQT A;  5KYI A;  2KEC A;  1T5X D;  2EY2 A;  5C5L A;  5EPL A;  3BZD B;  5NUC A;  1GHK A;  3PV0 A;  1EY0 A;  1B44 D;  1Y1W B;  4C3I B;  2FFK B;  4IFD H;  4LK1 C;  3WOE A;  2RVL A;  1IKM A;  3M7N A;  1AP0 A;  3OWF A;  3L3O C;  1D6E C;  1F9Q A;  3ERO A;  3VR5 A;  1SJH D;  2LY7 A;  2R6G A;  3FPP A;  2CVR A;  2K03 A;  3MFG A;  2VB2 X;  3ITP A;  3Q24 A;  5M5Y B;  2F3W A;  3V96 A;  1JWU D;  1WTP A;  5IGD A;  1QJO A;  2IJ0 A;  1B9M A;  2FJ2 A;  2WIN B;  2F0G A;  3I4M B;  1I4G A;  3HOX B;  3J80 L;  5C44 B;  2KCN A;  1I4X A;  5LHY 1;  4CJ2 C;  3BVZ A;  4O42 A;  3NBI A;  3W2D A;  2O5I C;  1SNO A;  2JA6 B;  1JWS D;  2YYZ A;  4KY7 A;  5FOB B;  1CFM A;  3JAM L;  4IN3 A;  1RD9 D;  2KEE A;  3A55 A;  1SE2 A;  2F0D A;  2M00 A;  3VYT A;  5EGT A;  4RH6 A;  1Q3L A;  5EPJ A;  3SEB A;  4ZKB B;  2AQ1 B;  3K5L A;  1YNN C;  3R2I A;  1BXT A;  2DNE A;  4IUV A;  4EGV A;  1A6X A;  1C4Q A;  4ID6 A;  1M8A A;  1S4Z A;  2X6L A;  2BOS A;  2PQE A;  3NTK A;  2NVT B;  5EKL A;  4Y7N B;  4IUU A;  4BA1 I;  1RJT A;  3TME A;  5E3F A;  1TU2 B;  1HHV A;  3GV6 A;  3E5S A;  3NUC A;  4NKL A;  4A3I B;  2CW0 D;  3I72 A;  3D31 A;  4FP5 D;  1U9R A;  4K2L A;  2BCO A;  2L55 A;  1SYC A;  5KNB A;  1GUS A;  3MXP A;  1O7L A;  3I3C A;  3MFY A;  2SOB A;  3GD7 A;  3SE0 A;  3VR4 A;  4KN7 C;  5CBE E;  4DAV A;  4XTC S;  4Q0F A;  1FNU A;  2A69 D;  5M3M B;  4XQN A;  3I73 A;  5M5W B;  2K5W A;  4CGY B;  3J7A F;  2CQA A;  2EXZ A;  3CQZ B;  4DF7 A;  2EYH A;  2L0C A;  4IFD J;  3M4Y A;  2PCF B;  3LWE A;  3ONA B;  3AB9 A;  2JXM B;  4C3I G;  4OGQ C;  3SK4 A;  1H9R A;  4L6T B;  2KA7 A;  2PNR C;  1F2M A;  4KKS A;  4DK0 A;  3M4O B;  3S9W A;  3KLS X;  1R9T B;  3N6R A;  5JVG 3;  1NCV A;  1LT4 D;  2Y0S B;  3CRL C;  4FXD A;  1TY2 A;  4CJ1 B;  4C1N I;  4LJZ C;  3MHB A;  4FF4 A;  4FNF A;  2EYL A;  5BN3 A;  3U9O A;  4DXG A;  3ZYY X;  3PUZ A;  1U4M A;  3I8Z A;  1E0B A;  2F0E A;  3NE5 B;  1DON A;  3Q23 A;  4EQP A;  3SK8 A;  3C3L A;  2ZXR A;  2ENB A;  1F77 A;  3MXU A;  2AQ2 B;  1F9P A;  4KY5 A;  1VCI A;  4O1N A;  2F0F A;  5DAU A;  1MBY A;  5C4J B;  3DWA A;  1BUV T;  2AQ3 B;  4EQN A;  2NZ1 D;  2WB1 B;  1CI3 M;  3WOF A;  1QNK A;  5EKK A;  1LTB D;  4F7X A;  1WTR A;  3HRZ C;  2OXP A;  3TSS A;  4G7H C;  1QB5 D;  3H09 A;  3NHH A;  1BBX C;  4XT1 B;  3PUY A;  3P20 A;  1WTW A;  3OMG A;  2QEJ C;  1BCP F;  4RFB A;  2KCC A;  5CV8 A;  2EZV A;  3TDQ A;  2VUM B;  5KND A;  4DU9 A;  1WTQ A;  2NB0 A;  2G9H D;  1TT2 A;  5FK9 C;  4IUP A;  1Z7T A;  3FKI B;  2K5Q A;  2KQ3 A;  1ILQ A;  3AU7 A;  3A56 A;  1QIL A;  3QO2 A;  1LT6 D;  4BS9 A;  5I9P A;  3PUX A;  1EWC A;  1R4Q B;  1CK1 A;  2EOT A;  4KN4 C;  5FLX L;  2O2L D;  3OHX C;  4J8Q A;  1KAA A;  2Z4I A;  2QIL A;  1HA6 A;  1IW7 D;  1XYI A;  3PIP 3;  1STE A;  3BYY B;  1GUG A;  1EEI D;  1IHZ A;  1CTM A;  2D9U A;  2PPB C;  1F9S A;  1LAC A;  1O80 A;  3TZU A;  1HTP A;  4BWG B;  3D6W A;  2N55 A;  2RSN A;  2SNS A;  4ZK9 B;  2MP1 A;  1JR0 D;  1SJE D;  4EQO A;  4KTA A;  1GJX A;  2O5J C;  3GTQ B;  2OF1 A;  1Q8I A;  2VB3 X;  3KBG A;  1I4H A;  2D2C C;  4B9X A;  1PRT B;  1FGB D;  1LTT D;  3OMC A;  1WTX A;  3NK9 A;  1I3Q B;  4RGN A;  3K5N A;  2NBF A;  5TSS A;  2B2Y A;  3R3O A;  1SBB B;  1PTO B;  3OIQ A;  4NW2 A;  1SNQ A;  1SSO A;  4HCS A;  2MPM A;  3OSO A;  5D65 A;  4CKC A;  4ZAI A;  1H9J A;  4R9W A;  4C3J G;  4L63 B;  2E76 C;  3CHB D;  1A3V A;  4H13 C;  1DJR D;  1Q12 A;  3DM1 A;  2PZT A;  1TII D;  1BQQ T;  1NR4 A;  4DXF A;  1BCP D;  1CHP D;  1PFB A;  3HGB A;  2A74 C;  2G9D A;  3A8J E;  2JE6 I;  5C4X B;  5C4Z A;  2HCI A;  2A73 B;  4M1U B;  1II3 A;  2WAQ B;  4BA2 I;  2K6A A;  3SDZ A;  3IKJ A;  2XSC A;  3BDC A;  3ND8 A;  5C0X J;  3T56 B;  1EY6 A;  2NTT A;  4V0B A;  1EU4 A;  3VYS A;  3GTL B;  1DM0 B;  3IL8 A;  1STH A;  4NDX A;  4KJO A;  2BDN A;  4X3U A;  4G4K A;  5J22 A;  2F0M A;  2IL8 A;  3VA5 A;  1QE6 A;  1OXU A;  3SXH A;  2Z8L A;  1FR3 A;  3S1R B;  2D62 A;  4R8I A;  2JA7 B;  1HQM C;  3IAY A;  1GOZ A;  3C1E A;  1ZYR C;  5CV5 A;  1NR2 A;  1SMY C;  5CMD A;  1F2Z A;  1LO5 D;  1SNM A;  1EFI D;  5I6W A;  2F0P A;  4DAP A;  2VXW A;  1BNZ A;  3GQB A;  5IGE A;  5CR3 A;  2LFN A;  1J9O A;  1TWA B;  2KHS A;  4HTH A;  1Y8N B;  2K33 A;  1RF2 D;  4JBW A;  3SK6 A;  2ICE C;  5A35 A;  4BBR B;  2XIW A;  5BN4 A;  2BE5 C;  5HUR A;  4QIW B;  1X3Q A;  1KLG D;  4XIG S;  2Q8R E;  5JEA G;  3C1F A;  2K01 A;  2K04 A;  2BA1 A;  5IGF A;  2L11 A;  3TP7 A;  1QOH A;  4KJN A;  2WAC A;  1F2Y A;  5T1I A;  4C56 C;  2B2Y C;  4ZKC B;  1H9S B;  3QOJ A;  1H9S A;  2B8G A;  2L9H A;  5CV4 A;  3FMC A;  3SK5 A;  3HOU B;  1TS5 A;  3D4W A;  4KV6 A;  1U4P A;  5I2X A;  2F1M A;  1STA A;  3V2T A;  2J4X A;  4QB4 A;  1KDC A;  1B9N A;  3BVM A;  4RKB A;  3CRK C;  2B8F A;  1XWE A;  2IX1 A;  5KNC A;  1DXM A;  1G6Z A;  1Z47 A;  2F0I A;  5CBA E;  1ML0 D;  2AWO A;  1TWG B;  5C3X A;  3HS0 C;  4I7Z C;  4XDX A;  4XYO A;  2NVQ B;  3KK7 A;  1EZ8 A;  4X3S A;  1LTG D;  1WD0 A;  3E6Z X;  3S1M B;  1IYV A;  4FF2 A;  1A3T A;  5ELC A;  1W6K A;  2N88 A;  2A5H A;  3BDO A;  5CV6 A;  5JPN C;  2F0O A;  2XRS D;  1EY8 A;  3HG9 A;  1K8O A;  4C3H B;  4XXE A;  1J8I A;  1TS3 A;  1JOK A;  1E2Z A;  2WII B;  4TRD A;  3U9S A;  5M9O A;  2EY6 A;  1UEA B;  3ND9 A;  2PW7 A;  3P7J A;  3J7Y W;  3KUP A;  3GTG B;  1D2B A;  1JB3 A;  2LS0 1;  2E74 C;  2Q8I B;  4F8M A;  1PRT D;  1KNA A;  1G29 1;  1CA6 A;  1AW7 A;  4KY6 A;  2X69 A;  4QMG A;  2AUJ D;  2JYO A;  4CKE A;  1DCZ A;  3RMH A;  3D8G A;  3QWN A;  1BF4 A;  2EYF A;  1Y69 U;  4KKU A;  1I6V C;  2L1B A;  1XXG A;  5I9O A;  3G7L A;  1PZI D;  1O78 A;  3QG1 A;  4RGO S;  3J80 E;  3DEP A;  4L8J A;  4KMU C;  1STB A;  2H4O A;  4CKB A;  2FMM A;  1CM9 A;  5M5X B;  3HOW B;  1OXX K;  5CV9 A;  3MAQ A;  5CC4 A;  2F0L A;  3J7A V;  1DOK A;  1PDQ A;  2LMC B;  3F2U A;  2B2U C;  3O13 A;  5C4H A;  5C0X I;  3PO3 B;  3WDN A;  1HUM A;  1SYF A;  2OEO A;  3K6O A;  1CT1 D;  1A15 A;  2PO4 A;  2KVM A;  2H1E A;  2V4D A;  1PTO F;  2NN6 H;  3BDL A;  3PO2 B;  1OO9 B;  2MGS A;  1ENC A;  4WFN 3;  3W3A A;  4OIJ A;  5ELD A;  3HOV B;  4K8J A;  1EOT A;  1H9K A;  4ODG A;  1V1P B;  3H3V C;  2NTS A;  2LKV A;  2L5T A;  5DNF A;  1V1O A;  1VMC A;  1ZKO A;  2Z1C A;  1G2T A;  3A7A B;  1BDO A;  3A8K E;  2B2T A;  1RKN A;  2M9V A;  1LT3 D;  2B2U A;  5G3L D;  5CV7 A;  4N9T A;  3S2D B;  2IPK D;  3VR2 A;  4ZLT F;  1SND A;  3I4N B;  1B50 A;  2EY1 A;  3K7A B;  4IQZ A;  2B2V A;  4MIU A;  2HUG A;  2R61 A;  2SNM A;  1S5F D;  4KI0 A;  4HSP A;  1ZYR D;  4KHZ A;  2B2W A;  3DXJ C;  4CJ0 B;  5EJW A;  5FO7 B;  4FYD A;  1PTO H;  2K1B A;  2EYM A;  1CZW A;  4U67 3;  1TWF B;  1I6H B;  4UDU C;  3NBH A;  2EY5 A;  4FO2 A;  3GTJ B;  3X3N A;  3HKZ B;  1S5D D;  5FO8 B;  1ROD A;  1EQV A;  3OW7 A;  1SYG A;  1Q1B A;  4C3J B;  2ID0 A;  2ZXP A;  4DA2 A;  5IOD A;  1T5E A;  1KNE A;  3PUW A;  1DD2 A;  3QOL A;  1KDA A;  1QWY A;  1GUT A;  1G8Z D;  3MWY W;  3URY A;  1A2U A;  1LTA D;  2KED A;  4RGM A;  2L4N A;  5EBC A;  1HCZ A;  1EIH A;  1VMP A;  4H7B A;  1EQT A;  2A6H D;  1ENA A;  3MTS A;  1ENF A;  2MJ8 A;  3NTH A;  3RD4 A;  1BCP B;  1B4O A;  1D5X C;  1EY7 A;  3VR6 A;  4OO1 I;  1YNN D;  3CU7 A;  4IUR A;  1ICW A;  1STY A;  3PUV A;  2RDG A;  2I07 B;  1AN8 A;  1XX8 A;  4K2K A;  5IT9 L;  3H91 A;  1KDB A;  1JQY D;  1DOM A;  4ME5 A;  1D1I A;  1R4P B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...