4OL7A

Crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ol7A00
4EVOA 3NK9A 4QF4A 3R3OA 1JORA 3MEHA 4K2KA 2F0GA 1STAA 3NUCA 4DGZA 5IGDA 4TRDA 1EY5A 2OF1A 1STNA 2WACA 5CV5A 2F3WA 5EGTA 1SYFA 3DMUA 1EY9A 5I6YA 4ZUIA 5CV4A 5E3FA 1STYA 3PMFA 5KRUA 4NDXA 1EYAA 4NMZA 1A3TA 5C5LA 1A2TA 3S9WA 3OSOA 1SYCA 4IZ8A 4PNYA 5DEHA 3H6MA 5CV6A 3SK5A 4K5XA 4IUNA 4EQNA 5J22A 2PZUA 3D6CA 3V2TA 1NSNS 3TP7A 5KGUA 4NP5A 4K6DA 3BDCA 3OWFA 2F0OA 3SK4A 3OMGA 4K2LA 2F0KA 3QOLA 1SNCA 2F0TA 2SNMA 5C5MA 3P1HA 3TP5A 4OL7A 3LX0A 2NUCA 2EYHA 2OXPA 3EVQA 4WRDA 2KQ3A 2M00A 1ENCA 3EROA 2PQEA 3HZXA 3QOJA 5KEEA 4B9XA 5JOBA 5C3WA 2PZTA 3EJIA 5IGGA 2PW7A 2PW5A 3T13A 2F3VA 4HMJA 5IOCA 2F0EA 4KY7A 4QMGA 3SHLA 1JOQA 3T16A 3D8GA 1KDBA 1SNQA 3ITPA 3SR1A 5EKKA 1TT2A 5IGEA 2EY6A 1KDAA 2SOBA 1SNPA 1SYBA 3D4WA 4R8NA 1U9RA 4IALA 3NHHA 4K5WA 2F0WA 4WORA 4K8IA 4KY6A 4LAAA 3NQTA 2F0HA 2RDFA 4ME5A 4S3SA 2F0UA 5C4ZA 3E5SA 5CV9A 1EQVA 3TMEA 5I9PA 5IGCA 2F0IA 2KHSA 2EY2A 4ZQ3A 5CGKA 1IHZA 1EZ8A 2F0SA 4YIJA 2F0DA 5F2DA 1JOOA 1EY8A 3SK8A 4DFAA 2F0VA 4N9TA 5KYLA 3U9OA 5J39A 5IGBA 1EY4A 2EYFA 2F0NA 2O4XA 4KJNA 4NKLA 4PMCA 1EY0A 2LKVA 5IGFA 1EY6A 4KTAA 3SK6A 2QDBA 3VA5A 2RKSA 4B9WA 3TP8A 5ISRA 4EQPA 5KYIA 3RUZA 3MHBA 1TQOA 5E1FA 2PZWA 2EYPA 1STBA 2F0PA 4MIUA 5IIFA 4QB4A 1F2ZA 1STGA 2RBMA 3MZ5A 4ZUJA 1II3A 1KDCA 4I65A 2EY5A 3MXPA 5HGTA 1SNDA 2F0QA 1KABA 5NUCA 3NXWA 3P75A 2HQEA 1TR5A 1SNMA 1SYDA 4J6HA 4EQOA 2OEOA 1EYCA 2EYLA 4F8MA 5IODA 3C1EA 3TP6A 1EYDA 5CC4A 1SYEA 2EY1A 3QB3A 4DU9A 5C4HA 1AEXA 4KV6A 5I6WA 5J1ZA 1ENAA 4J1MA 4K5VA 4K8JA 2PYKA 4KD3A 1A3VA 5KIXA 1EY7A 3BDLA 5JAVA 1KAAA 1F2YA 1RKNA 2EYMA 5CR3A 3SXHA 4F7XA 3MVVA 2F0MA 2F0FA 2SNSA 3DHQA 3OMCA 5C6AA 4KY5A 4H7BA 4KJOA 1SYGA 5C3XA 2ENBA 1JOKA 2EYJA 3C1FA 4HMIA 5CV7A 1SNOA 1STHA 4HTHA 3D4DA 1NUCA 3NP8A 4RKLA 4RKBA 4E6IA 1F2MA 2F0LA 4KHVA 5DAUA 1EZ6A 2EYOA 4ODGA 3HEJA 5K5PA 2F0JA 2EXZA 4DF7A 5EKLA 3ERQA 5CV8A 4N9PA 4PMBA 5HURA 5I9OA 4K14A 1A2UA 4G57A 5M9OA 4ID6A 1A3UA 4KD4A
chains in the Genus database with same CATH superfamily
2UUAQ 4NXNQ 4A3GG 2E2HB 4B08A 4PG3A 2WV6D 2VY3A 2A5HA 3H3VI 1SFOH 1STNA 1HFGA 2F3WA 1SYFA 2Q8IB 1G6ZA 1I4HA 3V05A 5EJWA 3UE0A 2OWOA 2Z6BA 4LWCA 2BDOA 4CHTB 1E1TA 3WWVA 3QR8A 3V2TA 1K28A 3ND8A 4DR4L 2ICIA 1XPRA 3ONAB 3SK4A 1CKNB 5A35A 1LTRD 4FF1A 1EUJA 1NJIC 3FPPA 1I94L 2Q2HA 4RGTA 3AU7A 4DK6C 4HJAA 1ASYA 1WTOA 1FYCA 1Y14B 1YI2A 1KD1C 3FDTA 4A4IA 2R7DA 3K6OA 1KDAA 2E2IB 2MO0A 1WFQA 3HOUB 2ZTCA 2WB1G 3HOZG 1FR3A 4BBRB 3I90A 1V43A 5ELEA 5HY6A 5C0XH 4C3JH 4DFAA 3PF5A 1VQPA 2BH2A 4A75A 1G6PA 2EYFA 2JYOA 2VB2X 2A74C 2MP1A 4ULLA 4DR1L 4O2DA 4O1NA 3J80L 4BY1G 2VL6A 1U0LA 3E3XA 1GOZA 2QW7A 2BOSA 4NXML 4KN4C 1ET9A 3AQQA 3NBHB 2HQEA 1TR5A 1YEZA 2L55A 2D2CC 2EYLA 5IODA 4IOAA 5FLXL 1ICWA 2QKIC 1I4GA 1C4QA 1E24A 1QVGA 4QUFA 4C3HB 1KAAA 2WINB 3AEVA 1FJGL 3S1NB 1WTHA 2SNSA 3H91A 1XMOQ 4BS9A 5M3FB 2NVTB 1X3EA 5IYBG 2Z4HA 3J81j 4JI2L 1O7LA 3HOWB 2KHJA 2RHQB 4DUYQ 3PUWA 4N9PA 2MUYA 3KF6A 1A2UA 3DWAA 1PA6A 1Q86C 4GZYC 1YBYA 2B39A 3NK9A 4WJ3M 1STAA 4X3UA 4A3BH 2AQ3B 2F3IA 5CV5A 1J5EQ 4HSVA 1IYVA 3MXGA 4YY3Q 3PUZA 1TWCB 3PO2B 1STYA 1TWAB 3GTQH 4NDXA 4NMZA 1CZGA 4BXXG 1A2TA 4C1NK 4EQNA 2IPKD 3TSSA 2MNAA 3S17B 1VQBA 1CHQD 1I4XA 4A93H 1MJEA 4OELB 5IYCH 3F2CA 3HRZC 3DXJC 4HSPA 3X3NA 4KLKA 2KQ3A 3QOJA 5C4XG 3HZXA 2AWOA 2ZT9C 4YHHQ 2NZHA 4JYAL 3DEPA 2F3VA 3J7YW 3FKIB 3S2DB 2F0EA 3K7UC 3U4ZA 1JOQA 3GDEA 5M5XB 1PTOF 4R4CA 3MTSA 4XT3B 4WORA 3SE0A 3TBIB 5IYDH 1IL8A 5AFWA 5D3IB 4L5SA 3PF4A 3NWTA 3J7AV 1XPUA 1A15A 4DKAC 3E5SA 1PYWD 2K7VA 1X65A 1LTGD 4J15A 5IGCA 4DV3L 2KHSA 2F52A 1IHZA 3U9OA 2LKVA 1AZPA 4LF6L 3A5UA 1ZKOA 1I6HH 2PZWA 1JJGA 4DV0L 3HOUH 1N36L 1KDCA 4I65A 3I55A 4DR6Q 4IJHA 4BBRH 4DR3Q 1VQDA 4DK0A 2MFIA 1IKMA 1NR2A 1X55A 3M4PA 1C0AA 2FMCA 3OWEB 3TP6A 1EQQA 4DK3C 5C4HA 1M1KC 3M4QA 3KF6B 4APVA 4FF4A 4KD3A 4DNTB 3M7NA 5BR8Q 1CFMA 1LTBD 4V190 2VUMB 1O7ZA 4A3CH 1SMYC 3C2PA 1BO0A 5K5PA 4GN3B 2QDLA 2KENA 3J80E 2VQEL 2ZM6Q 5JEAH 4JW0A 4KKSA 3CC4A 2K01A 3X3MA 2V4DA 1VQ9A 4KD4A 4RGMA 2IX3A 5LMNW 1WVLA 4OWXB 4AYBB 3KLSA 4WJ4A 1JC7A 5C44G 3DM1A 2HT1A 2O2LD 5IY0A 5FLXE 5A2QL 3S1NH 3J7A5 1GUTA 4QCLA 5I6YA 1XNRL 1BOSA 2OQKA 4DV2L 4YWLA 1EEID 5C5LA 3CRKC 3WOEA 4R8IA 3HOWH 2UXDL 4HCSA 2HHHQ 2KCMA 4P2CB 4OIJA 3A54A 4IUUA 1E0BA 1QG7A 4LNQA 4JBKA 3BG3A 4MZ9A 3STBD 4A3DB 1HNWQ 2PW7A 3DUZA 3KBXA 3BU2A 3J81i 3QJYA 3SR1A 2O5JC 2SOBA 4OO1H 3OIPA 2NVYB 2GN5A 4K5WA 1BKBA 4BBSB 4KY6A 3FRPB 2RDFA 3I4NG 2PI2A 1GUOA 4YIJA 4EQ5A 4DV4Q 4BWGB 4HIKA 1QUQA 1AE2A 3H0GB 3VA5A 2R7ZG 1JWSD 4N8X1 2IX1A 4XDXA 1ZXTA 1VDZA 2EYPA 3W1GA 4BA1I 2ZXOA 1KABA 5E4XA 1PTOC 2OEOA 1EYCA 1HR0L 4WJWA 2VNUD 4KHPL 2EY1A 3JAML 3VR5A 4LF8Q 1MI2A 1QE6A 1HA6A 4KV6A 2R92B 1L2FA 1PFSA 4X66Q 4LUOA 3S24A 1Y1WB 4L6TB 1LLRD 4B3ML 5LHY1 2ZJRA 2CCZA 1LTTD 3K80C 3HOXB 1V1QA 2F0LA 2ATWA 2J4XA 1KIXA 1KQSA 2HCIA 1GHKA 1X3PA 4B3TQ 3QIAA 1B2TA 4Y7NB 3KYHC 5TSSA 2HUGA 5IT9c 4UHVA 1K8AC 5K36G 4JI1L 2ZTEA 1CK1A 2PCFB 2QEJC 1CHPD 1JORA 2NWGA 3CC7A 2F4VL 4DR2Q 1R9TB 2SDFA 1EY5A 1JB7A 2AQ2B 1WJJA 1IBKL 4I7ZC 5E3FA 2RVLA 5CV6A 4DUZQ 3SK5A 1SN8A 3T1HQ 1SE8A 4L63B 2X6GA 3MAQA 4NP5A 4K6DA 1Z7TA 2X6LA 2F0KA 1QVFA 1N9WA 1UWVA 4IUPA 2KCCA 2MJ8A 1A62A 1AW7A 4OL7A 3K0XA 3UI2A 3W2DA 1ENFA 5KEEA 1VQ4A 2ASBA 3J80i 2CW0D 4FYDA 1HHVA 1QUQB 2Q8RE 4LFAQ 3T13A 2HD3A 4F88A 5IOCA 3DWQA 1STEA 5G3LF 3S14B 1MSGA 5EBDA 3FPUB 1H9KA 4R8NA 3HP3A 1CT1D 2JA7G 2VS1A 1KLUD 2NN6G 5A2QE 1K3BC 1Q7YC 2K04A 3ND9A 4C3IG 4A3GB 3HKZE 5KYLA 1L0YB 4LF4L 4G7HC 2E2DC 4A3DH 2O4XA 4ZKCB 2B63H 1H9SA 3MHBA 1D6EC 2K28A 3BVZA 1JCKB 3KLWA 1WCMH 2NVQB 2NVYH 1I50B 1QNUA 4I7AA 2I46A 4PZ7A 1SYDA 4OWTB 3S16H 5ELFA 3RD4A 2LS01 3I70A 4K0KQ 5CC4A 5JVH3 4DU9A 5IP9H 1X9NA 4A3LH 4ZKBB 5J1ZA 3TREA 3P20A 2LMCB 4JI4Q 4C1NI 3GTOB 1B70B 1CM9A 2EYMA 1RKNA 2A1AA 5JVG3 2NZOA 3HOVG 5C6AA 2B2YC 4A3EG 1JOKA 2WB1B 3A55A 4RG1A 1HNZQ 3HOZB 4BA2I 3GTLB 1SNOA 1CUKA 1EZ6A 1VF7A 1GUSA 1JB3A 1TWGB 2VXWA 4DR7Q 1NAPA 5CV8A 3HGBA 1TIID 5HURA 4RMFA 1SSOA 3KDFA 1TS4A 1VQ6A 1K8MA 4QF4A 2R92H 4H44C 1MD2D 4A3MH 4A3FH 4BY1B 1LT6D 3KUPA 5FLMH 3BZKA 3JAME 3CCJA 1YJWA 2F03A 4XQNA 1EY9A 1RODA 4FXDA 2UUBL 4AQYQ 2NVXH 2JA5G 4CDDC 1C7YA 3EIVA 5DEHA 2K33A 2PZUA 2E5LL 1NSNS 4QUCA 2RA4A 2QA4A 3O13A 3QOLA 5M3MG 1HZAA 5KNDA 2OT2A 2KOLA 3I56A 2CQOA 2D5DA 1B7YB 5IGGA 1KC8C 2K5NA 1G291 5LMUQ 4IPHA 3VDYA 3ITPA 2GA4B 3VR4A 4X65Q 5GAHC 2A19A 4JI6L 1ILPA 1I3QH 2B2TC 3DWPA 2I07B 2NBFA 1H9SB 4DR5Q 4JI0L 1QZHA 1EWCA 3W1BA 4X62L 1KRTA 1VQJA 3D4RA 5CGKA 3IKJA 4LF7L 3N52A 4A3KH 1XTDA 3F2BA 2ZJPA 2RF4A 1AN8A 4NKLA 1I6VC 4JI3Q 1HCZA 1PTOB 3S1RH 3RUZA 4IFDH 1IBMQ 1TQOA 4HIMA 4DV7Q 3K5NA 1F2ZA 4B3SQ 3MZ5A 1X54A 1TWFH 1SE4A 1W6JA 1YNJC 5E7NA 1GKHA 1VMPA 5C4XB 3R2IA 1R4QB 1ICFB 3U4VA 4PMWA 3KDFB 4K8JA 4UDUC 1D5ZC 1G2SA 1Q12A 1EY7A 1G2TA 4R4QA 5CR3A 5M5WB 1TS3A 1MHWC 3ULPA 2GVBA 4H7BA 1PRTF 1VQLA 2NVQH 3A8IE 2CWPA 2NN6I 1EU4A 3UE1A 2B2YA 1GUNA 1JJCB 1H9RA 2SEBD 2MHVA 1E2ZA 3M7GA 3I4MG 3S1MB 1UEAB 2XRQD 4PMBA 1TXYA 2JXMB 4WFN3 4EVOA 3MEHA 4K2KA 4P74A 3Q0AA 3PQIA 1TWHB 1SMYD 1DZ1A 3J7ZC 3GV6A 3HOZH 1YNNC 4U68A 1S5ED 4H0LC 3DLLA 5IWAQ 2Q2UA 4X64Q 2NYZD 3HS0C 4HIOA 4QJFA 2K75A 3KJPA 1GUWA 4NB3A 1CA5A 4ZCKA 1WI5A 2JA6G 4FXKC 1PH7A 1H95A 2A8VA 5C3WA 2PZTA 1WTWA 3K5OA 1G91A 1QCBD 1RTNA 4DNIA 3CAMA 3D8GA 1LTAD 1PH2A 2A6HC 5IGEA 1GD7A 1QOHA 1HNXQ 2CW0C 2X69A 3N6RA 3SEBA 2AKWB 1D2BA 2F0WA 1YJNA 3H3VC 2K5DA 3I7FA 1NBWA 2F0HA 2DJGC 1WOCA 4ME5A 3K8AA 3JAMi 3QO2A 4A3JH 5FO9B 4PZ8A 1KHIA 2B2TA 2F0IA 1LT3D 4GKJQ 2R6GA 1A8VA 5C44B 1PZID 4FVMA 2KVMA 1EY4A 1C8CA 2Y0SE 3KK7A 1IYUA 3BZDB 3Q23A 2EQSA 3RZDB 4BY7H 1FGUA 1PZJD 3FVQA 1XJVA 3V96A 3CP0A 1RD9D 4IPDA 1DONA 5HGTA 4JV5L 2B8FA 3NTHA 1K9MC 3C46A 2DY8A 4F8MA 2EXDA 3P7JA 2BA0A 4OEMB 1S5BD 5I2YA 3GTMH 2I5MX 1M4VA 1Y1VH 5IT9L 2M9VA 1X56A 1D1KA 1PYBA 1RL2A 4JOIC 1FNWA 1V8QA 4CJ2C 5C3XA 4XQQA 1PTOD 4RKLA 1CQFA 1PFMA 2EE1A 3I4LA 3I4NB 1MJCA 3T1YQ 2PMZE 4YWKA 4DF7A 4JI8Q 5C4XH 3ZYYX 5CBEE 4LF5Q 4X6AH 3KJOA 2R7ZB 1Z9FA 2EZVA 1S5DD 2XN9C 1IBLQ 4TRDA 3M4YA 2UUAL 4NXNL 5EGTA 4GS3A 4IJLA 1ESRA 3AYHB 1EFWA 3H09A 4FXGC 3H6MA 3F2DA 3CCSA 1XMQQ 4PZ6A 1PRTC 4FNFA 4IO9A 3PO3H 3S1QB 4ZK9B 1LO5D 3S1MH 1IW7C 2F0OA 1CTMA 1ASZA 1S72A 3LX0A 3EVQA 2G9HD 1ENCA 4G4KA 2PQEA 2R7FA 4IUVA 1JJ2A 2JA8H 1BNZA 5T1IA 1Y8PB 4YWMA 4HMJA 5COYA 2NTSA 3M85A 1ESFA 3MC0B 3EBEA 2B3GA 2E2JH 1QVCA 1SNPA 1NMFA 2L5TA 2K6AA 2XIWA 2K14A 4LAAA 2ZXPA 3GP7A 1CZWA 4AH6A 2JEBI 2OTLA 1PFBA 1LYLA 2R93G 5C0XG 3NBIA 4C3JG 2E2HH 1WD1A 1SJED 1HUMA 4OX9Q 1EY6A 4XIGS 1C48A 2BA1A 1PH1A 3K58A 4EQPA 5KYIA 1WYDA 2N8NA 3S2HB 2LFNA 5GQOA 3CKIB 1OO9B 3RZOB 1ONLA 1HZCA 2E76C 4KHZA 2UXBQ 1X3FA 2EVBA 1AEXA 3HOYG 1TKWB 3F8TA 1G8ZD 2BDNA 1S40A 4K5VA 4JBMA 1OTCA 2K1BA 2AWNA 1F9RA 5AJ3Q 3ERSX 3RZDH 1M8AA 2JA7B 5C4JB 2PPBC 1L1OB 1STHA 4HTHA 1HA5A 2E2IH 4QIWB 3MFGA 1O7IA 2K5QA 4C3IB 2LY7A 4JOIA 1B3QA 1XMOL 1KL9A 5IP7H 2IW3A 4GKKQ 2VQFQ 1EOTA 4UAIA 3GTJB 3U9SA 4DUYL 5CORA 1VQ5A 2WACA 4A3BG 5FO8B 1KTKA 3RR5A 5LMNQ 4QY7A 2XVSA 2D9UA 4CJ1B 5IT9E 2K50A 3OHXC 1OXXK 1J5EL 4MTNA 1SAPA 4YY3L 1YITA 1AH9A 3D6CA 1NE3A 2XTIA 1SE3A 4K2LA 4HIDA 2F1MA 4TVAB 5KNBA 2EYHA 2HDMA 2OXPA 1PHJA 4A93G 1VQCA 5IYCG 4ILWA 3HOVB 4HR7B 3EJIA 1CI3M 1MKHA 4RWSC 4C3HH 4A3EB 2UUCQ 3T56B 3FP9A 2L1BA 4OONA 4KY7A 3SHLA 1YHQA 2L4NA 4ABNA 5M3FH 2NVTH 4YHHL 4RCOA 3D4WA 2XSCA 4YCWA 1V1PA 5KNCA 2F0UA 3AFPA 5C4ZA 1OXUA 5CV9A 4IQZA 5IYDG 2ZXRA 1XNQQ 4ZQ3A 2EY2A 1Q90A 4OHJA 1HR0W 4IURA 4UY8C 1K83B 1CA6A 4OWWB 2HIXA 1DCZA 1PLFA 3J81c 1B9MA 3A5ZB 2JA5B 1KRSA 3GTKB 1TWCH 5IIFA 1EWIA 1TWAH 2ZJQA 3PO2H 1PXUA 4ZUJA 4R4IA 4LF9Q 2RHSB 3S17H 3E9HA 5M3MB 4HJ7A 4EQOA 1YHAA 1VMCA 3D3RA 4DV5Q 4NW2A 1EYDA 1SYEA 1AZQA 3GTPB 1SROA 4DR6L 4ZYSA 4DR3L 1B3AA 4A3IG 5D3DA 2JJQA 4LFBQ 3FKIH 3S2DH 2RSNA 5G3LD 3M4OB 1FD7D 1BDOA 1YNJD 5M5XH 5BR8L 3RLOA 1K0SA 2AMCB 2KJXA 2L15A 4LUVA 3CPWA 3G71A 1D5MC 3VR2A 5I9OA 3RZOH 3Q24A 3M9BA 1IXRA 3HFZB 1VQHA 2K05A 5C0XI 5JEAG 1HZBA 2ZM6L 5EPLA 1KXLA 3NUCA 1RTOA 2UU9Q 1PRTB 5IGDA 3TS2A 1PH8A 1PH9A 3W3AA 2JA7H 3CRLC 3HKSA 3RLFA 1YNXA 2L11A 2MPMA 3VA7A 1N32Q 5M5YB 2K5WA 4UP9A 3BVGA 2KHIA 5JJLA 1V1PB 1D8LA 2RDHA 4DNRB 1SNCA 4HJ9A 4IUTA 5D14A 3TP5A 1EL0A 2HHHL 3I8ZA 3EROA 1WTPA 3EA6A 3TRZA 1KNAA 2MGSA 3NWSA 1S5CD 1YNND 2C9OA 2PNHA 4JBWA 2KUMA 3FHWA 3I72A 1HNWL 4DV6Q 3A8KE 5GAGC 2VUMH 1Y8OB 3NHHA 3I4MB 4P73A 4OO1G 4GLVB 4B3RQ 3CQZB 2IL8A 4C2MB 5C0XJ 1K8GA 5F2DA 1CKMA 4XQJA 4N9TA 3H15A 3H3VH 4PV1C 4KJNA 4DV4L 2A6HD 2N3SA 3OTOQ 4A3EH 1HZ9A 3CU7A 5JJZA 3UDIA 3VR6A 2B2VC 3CF5A 4CDCC 3BS1A 2KCTA 1BCPB 1A0IA 1FNUA 2BH8A 4KKUA 4Q5VA 1VQAA 2F0QA 4DA2A 4DXFA 1OXSC 3L7ZC 4IOCA 1I5FA 1SRUA 2HCCA 1CQVA 3WDNA 2EJGC 2ES2A 4PQXA 3U50C 3GO5A 2H1EA 4DV1Q 4LF8L 2RCNA 1PFNA 2F0MA 4KY5A 1SYGA 2EYJA 4GLAC 4X66L 1BBWA 1MBYA 3K7AB 4E6IA 4BBSH 1SDFA 3BZCA 3CPFA 3LNNA 5M3MH 4YCVA 4LJZC 1J8IA 1HQMC 1ZYRC 5EKLA 3C3LA 1UE7A 3GTPH 2UXCQ 5LL6X 2I0QA 5FJ8H 4FP5D 4JC0A 2B2UA 4B3TL 1B1ZA 3J7AF 1J9OA 2L0CA 2CWAA 5DM63 3H0GH 5FKAC 1N33Q 3PUYA 3UDGA 3A0JA 5CV4A 4DR2L 2KBNA 2D0PA 3A56A 1BF4A 2PI2E 4IZ8A 1WTVA 4K6LA 3VR3A 5J22A 1D1IA 1L0XB 1DJRD 1ILQA 2GVAA 3OMGA 1VQNA 4DUZL 3T1HL 1Q3LA 3LWUA 1B4OA 2M00A 4ZRZA 3IL8A 4CKEA 4RH6A 3CC2A 1W6KA 3RN2A 1T9HA 1VQOA 2B29A 2K03A 1I4QA 1Y1WH 3KLRA 3T16A 1JWUD 1KDBA 1PRTD 5EKKA 2EY6A 1E2WA 1Q1BA 1IW7D 3A7LA 3KLSX 3T4AC 4LFAL 3HOXH 4FF3A 3E0EA 4HJ8A 1NR4A 3TDQA 2XRSD 1DYQA 4Y7NH 1QZGA 1KNEA 2F0DA 3EN2A 4IUQA 1U4LA 2CH4A 1HTLD 1E22A 1HTPA 4G7OC 1K8OA 1R9TH 5LL6S 1D5XC 1K3RA 1SFOB 4B9WA 5D65A 4A3DG 1IL2A 2TSSA 4JI5Q 1FGBD 1HXYD 2H4OA 5EPJA 2XNAC 4MIUA 4QB4A 2B63G 3G7LA 1TS5A 2A6EC 3KF8B 2DUDA 1SNDA 1WCMG 2B2VA 4C56C 3NXWA 2EDGA 3MXUA 1BBXC 3CQZH 4CKCA 3ULLA 1VF5C 1N34Q 3FMCA 4OGQC 3NENA 5IP9G 4K0KL 1KAWA 3BDLA 2WKCA 4Y52H 3DHQA 2J7ZA 1HRJA 3S14H 4KJOA 1VQIA 4JI4L 2RCFA 4RKBA 1F2MA 3PCOB 4POFA 4OO1I 3A8JE 4H13C 1AE3A 3ER0A 2G5DA 5JEAJ 2R93B 1E2VA 4A3GH 4C3JB 3KFUA 1U5KA 5EAYA 2K32A 4DR7L 1LT5D 3DEOA 1PH6A 2CFMA 3K81C 1PVOA 5L37A 3W5OA 4HN7A 4A3MG 4A3FG 4R4OA 3RLNA 1P8LA 2HDLA 4DR4Q 3CCMA 1I50H 2F4IA 4K5XA 4RCNA 3HKZG 3MFYA 4AQYL 1I94Q 2N49A 5FO7B 4RFBA 3HOYB 4GN5A 1GM5A 1IYJB 1RIPA 1JT8A 5C5MA 5ISRA 1L1OC 2NUCA 4GOPA 1B44D 3R93A 3BYYB 3GTOH 2PW5A 1ZEQX 3A74A 2LXJA 4MHEA 3G4SA 1W2BA 3IAYA 3J81L 2VB3X 1BXTA 1SYBA 3GTLH 1X3QA 3SDZA 2KEDA 3PIP3 5LMUL 3L0OA 2NB0A 4X65L 4RHSA 1A63A 1R4PB 1TWGH 3I4OA 2WAQE 4DR5L 1AFPA 2JE6I 5J39A 4RHRA 4DR1Q 4LMQD 4A3KG 1XTCD 4A3BB 3IFDA 3E9IA 1NNXA 3VYSA 4BY1H 2IT1A 4JK1C 3TP8A 4NXMQ 1RDPD 5T1GA 1Q81C 2F0PA 4RGNA 4JI3L 2B8GA 4HAEA 4IFDG 2RBMA 2VZAA 3KBGA 1II3A 1SJHD 5JPMC 5DM73 2NTTA 1IBML 1BCPF 2XWBB 3CCQA 2IHEA 4DV7L 4J6HA 4B3SL 4A93B 1L0WA 5IE8A 4DAYA 1BUVT 4LK1C 4RAUC 1FJGQ 3NELA 3L9AX 1PH3A 1PMRA 2PMZB 1F2YA 1JE4A 5IYBH 4JI2Q 1X32A 3C1FA 4KMUC 4L5RC 1RCVD 3D4DA 5C3EG 4KHVA 1F9SA 4X3SA 4ODGA 5ELDA 2LSSA 3HEJA 1MIUA 2BCOA 2O5IC 1D7QA 2KEEA 1C9OA 1V1OA 5FK9C 1VQFA 1TY2A 4GOPB 2AHOB 1PTOH 3DMUA 2KECA 4BXXH 1I6HB 5CYUA 1EYGA 3MA2B 1Z6HA 3PMFA 2Z9HA 4OXPA 1BR9A 3OSOA 1AP0A 4PNYA 2QGQA 4U673 2K4KA 4DN4M 1EIGA 2R93H 2L12A 5IWAL 1W3SA 4A3IB 1GJXA 2OTJA 4JYAQ 1WTXA 1EEFD 4X64L 3P1HA 4LFCL 1E3PA 1I4PA 1NY4A 4NPSA 4JI7L 1VQMA 5JOBA 3K57A 1QNKA 4Z9CB 1VS0A 2YV5A 5M5WH 1L1OA 4M1UB 1EU3A 4DAMA 1O80A 4MN3A 2AQ1B 4DV3Q 2DNCA 4X3TA 2EOTA 4K8IA 3H94A 3T53B 1PDQA 3PUXA 3K5LA 5GADC 1HNXL 1EQVA 2AUKA 3HOYH 1KLGD 1EZ8A 2F0SA 4A3JG 1O7YA 5JPNC 1RHPA 2PNRC 2XWJB 4LF6Q 4XXEA 4OIKA 4UPAA 1B53A 1E7ZA 4GKJL 4DAYB 3PIO3 5FOBB 1TWHH 4JPBW 4DV0Q 5BN3A 1N36Q 2ICEC 1QB5D 5ELNA 3CW2C 2YTYA 1CKOA 5DLQE 4BY7G 1STGA 3EFXD 2R61A 4QGUA 1U4RA 1HPCA 3NPPA 3P75A 2A69C 3RMHA 1JQYD 3J81E 3I73A 4Q0FA 1QJOA 5I6WA 1LV9A 1ENAA 3NQIA 2I5HA 1OXTA 5I2XA 1SBBB 1Y1VG 2K5HA 3E6ZX 1JICA 2LXKA 3NTIA 2ENBA 3BYTB 2VQEQ 2WAQG 1NUCA 3NP8A 3RN5A 3CMEA 4UP7A 4R1JA 2EJFC 1MGSA 1WTRA 4POGA 3MEFA 1BCPC 1F77A 2FHTA 3T1YL 5C44H 1HH2P 3R3OA 2JP1A 2F0GA 1QWYA 4JI8L 1XNRQ 4DV2Q 3M3YB 3BVMA 4LF5L 2E8GA 2UXDQ 3PV0A 3TN2A 1E1OA 5KRUA 1IBLL 4IFDI 1EYAA 2Z4IA 1A3TA 1ZYRD 2DNEA 1B9NA 1TU2B 1YVCA 4HJ5A 1X6OA 3AFQA 4LW1A 2WIIB 3L3OC 3OWFA 3GV3A 2Y0SG 3PO3G 1XMQL 2F0TA 4FO2A 1N8RC 4XT1B 1VQ8A 4CGYB 4B9XA 1HUNA 2D0OA 2JA8G 4GLXA 1VQGA 3QWNA 2BE5C 1J6QA 1LACA 1TT2A 1O78A 2E75C 3PSIA 4M8AA 1Q8KA 1BBUA 4N8FA 2K52A 1Q46A 3I4NH 3T51B 1F9PA 3Q6SA 1PH4A 3B6YA 2ALYB 1EFID 3TQYA 4A3IH 4CKBA 4X3KA 1GVPA 3SK8A 1YIJA 4IPCA 4CDEC 2R7ZH 1Q82C 4PMCA 2A68C 3QG1A 4IFDJ 2V1CC 5E1FA 2H5XA 4IPGA 3LGJA 4OX9L 2Z0SA 1V9PA 1HR0Q 1B50A 1UE5A 2EJMA 4KHPQ 4XTCS 3S1QH 3CCUA 1XWEA 3C1EA 3DM3A 1S5FD 4QIWE 1F2LA 4J1MA 5H1SE 3ULJA 1A3VA 4ME3A 4B3MQ 4JBJA 1EIFA 2UXBL 3D0FA 4TQUS 3G6EA 4F7XA 3OPOA 2A6ED 3OMCA 3HG9A 4ALPA 2AUJD 4HMIA 3GTGB 2C35B 5AJ3L 4AIMA 2YYZA 1U4MA 2EYOA 1Z47A 1EQTA 1VQEA 1PZKD 1LUZA 4JI1Q 4GNXC 3HOUG 5K36H 5IP7G 2F4VQ 4BBRG 2QILA 3FEWX 4ID6A 1A3UA 3D31A 4P71A 4GKKL 3D6WA 3MXNA 3L2PA 4J8QA 1IBKQ 3F2UA 2VQFL 2A73B 1JWMD 2C5CA 3NSWA 4JCVE 4L8JA 4P72A 1MSHA 2B63B 4ZUIA 2WP8J 1WCMB 3S2HH 3S9WA 3G48A 1M90C 4DAPA 4AYBE 1YZ6A 2EPBA 4A3CG 3S16B 5LMNL 3RNUA 3BDCA 2B2UC 4JG2A 3F1ZA 3LWEA 1LABA 4P75A 2J0TD 3I2ZA 4HEDA 3CCRA 3M3YH 1K0RA 2RSOA 4QMGA 4FDBA 1SEBD 4C3HG 2KA7A 1SNQA 5C4JH 2NN6H 5I4DA 2UUCL 1U9RA 4C3IH 2PQAA 5M3FG 2Q2TA 2WFWA 3TMEA 5I9PA 4LF4Q 3HOWG 3CCVA 1FVIA 2IHFA 3OYYA 1EIHA 4UP8A 3K0YA 4GN4B 1FNVA 1BQQT 3GTJH 1XNQL 4A3MB 3GQBA 1H9MA 4XYQA 4A3FB 3WOFA 2E74C 4H02A 2QDBA 1SR3A 2RKSA 2PO4A 1EOVA 2CHBD 1DM0B 1STBA 2NVXB 3AMUA 1T5XD 3HKZB 2EIFA 2G9DA 2OCEA 1DGSA 1JMCA 4O42A 3IFTA 3PO2G 3S15B 5NUCA 1LTLA 3OOCA 4QQBX 2CQAA 1QILA 4L5QA 2HQLA 3R2TA 4LF9L 3ICEA 1TS2A 4QL5A 1NCVA 3J80c 4DV5L 1ET6A 3PIPA 3HOVH 5KIXA 5JAVA 3MXNB 3SXHA 2F0FA 1FL0A 2OQ0A 1YHBA 4TKOB 1I3QB 3FKIG 5CV7A 1CSQA 5ELOA 1G51A 4LFBL 3URYA 4EX5A 2N88A 5FLXc 1TY0A 1PH5A 5EKIA 1GO3E 2JA6B 2Q8TA 4K14A 4A3KB 4G57A 2WKDA 1F9QA 1NTGA 4GNXA 1K83H 3VYRA 4DGZA 1A6XA 2UUBQ 2JA9A 3S1RB 2JA5H 4R9WA 2KCNA 3TZUA 1U4PA 2Z6KC 3OIQA 2UU9L 2QCPX 2FINB 4ZLTF 2E5LQ 3GTGH 3KF8A 4LUZA 3GTKH 1SYCA 1XYIA 1DOKA 1VQKA 1HQRD 1TWFB 4IUNA 3CD6A 5CBAE 1WTQA 2DGYA 1XX8A 1DXMA 5KGUA 2M2LA 1S3OA 2PQAB 1N32L 2SNMA 5JJIA 4WRDA 2QEXA 4JI6Q 1LTID 3I91A 2N55A 3BJUA 4JI0Q 4RA8A 5C3EB 3VYTA 2IY5B 2CH4W 3M4OH 4X62Q 5HGQA 1SMXA 2IX0A 1UNSA 4MTKA 3E0JA 4MNOA 3MWYW 2FJ2A 5DNFA 2YU9B 2DJFC 4LF7Q 1UE6A 2VUMG 3CHBD 4S3SA 2B2WC 1GUGA 1EQRA 2DN8A 2VW9A 4DV6L 3NE5B 4GOPC 1JR0D 3UDFA 3KOJA 1EY8A 1UE1A 2F0VA 4CDFC 1GHJA 5IGBA 4DXGA 4B3RL 1VQ7A 2F0NA 1EY0A 5IGFA 1XPOA 4KTAA 3SK6A 3IRBA 1XXGA 4AYBG 1VCIA 2HIVA 3I3CA 3OTOL 4ZAIA 1P16A 3Q8DA 2K5VA 5M5YH 3ZJYC 2EY5A 3MXPA 3EQLC 2IJ0A 1LM0A 4KK7A 2RQXA 1IZ6A 5JJKA 1UUPA 2JEAI 3G6JB 4L5TA 4O0AA 3SGIA 1HJPA 3UDXA 5EPKA 2JSOA 3Q22A 1OXVA 2FFKB 4CJ0B 4V0BA 4GNXB 4EGVA 2MO1A 4CBVA 3CMAA 1SE2A 2FXQA 4DV1L 2A69D 3JC66 2TMPA 1RJTA 4R4TA 3I4MH 5DAUA 2YTVA 3S15H 2P5ZX 4FF2A 1EIYB 3SVMA 4A3JB 2EXZA 3PIOA 4BBSG 3ERQA 1CSPA 5ELCA 5CMDA 4C2MH 3BDOA 5M9OA 2WB1E 3NTKA 1RF2D 1K73C 3NEMA 3PUVA 3TZDA 5GROA 4RGOS 2R3ZA 5FJ8G 2OF1A 2UXCL 1SLJA 4A3LG 4KN7C 5EBCA 4BY7B 1PYSB 2QF7A 3H0GG 3R8BA 3STBC 4XYOA 1NMGA 3CCLA 2Z1CA 5BN4A 1N33L 4TSSA 1BCPD 2DY7A 2Z6KA 3TP7A 1SXTA 2D62A 1UEBA 1HNZL 2JA6H 3K59A 5BN5A 4DAVA 3GTMB 5E4WC 1Y69U 1Y1VB 1JE5A 2YTXA 1Q1EA 2JN4A 1PV4A 5ELBA 2MQHA 4KI0A 1B8AA 3OW2A 2R92G 2WAQB 5J3BA 3OW7A 2ID0A 2I5LX 4A76A 1Y1WG 1DOMA 5FLMG 3PGZA 3K7AH 4IALA 1HFNA 2RDGA 3NQTA 1CKNA 3TS0A 3HOXG 3U58A 1Y8NB 1WD0A 1GXDC 1YJ9A 1JOOA 1UAPA 4JVZA 2B2WA 2L9HA 2XGTA 2BE5D 2ZTDA 4YCUA 3CCEA 1Q8IA 2Z8LA 5C3EH 4KKTA 1X3GA 2CKZB 1ML0D 4JV5Q 1I4RA 2JQOA 2IWHA 2NZ1D 3TEHB 2YU9H 1T5EA 2CVRA 4JI5L 2Y0SB 3PO3B 1SNMA 1S4ZA 3QB3A 2A68D 3GD7A 4HCEA 2JA8B 1DOLA 2N78A 2Q2IA 4DK1A 1EWHA 1TVXA 2PYKA 1IKLA 3A7AB 1DD2A 1N34L 2JK8A 2FMMA 4IN3A 3MVVA 5GAEC 2E2JB 1LTSD 5EQ0A 3NBHA 3GTQB 1LT4D 3AB9A 4F87A 3JAMc 4LFCQ 2F0JA 3CXCA 4G7ZC 1H9JA 4JI7Q 4DPGA 3VYUA 1BVSA 3K5MA
chains in the Genus database with same CATH topology
2E2HB 4B08A 2WV6D 2A5HA 1STNA 1HFGA 2F3WA 1SYFA 2Q8IB 1G6ZA 1I4HA 3V05A 5EJWA 2BDOA 4CHTB 3V2TA 3ND8A 2ICIA 3ONAB 3SK4A 5A35A 1LTRD 4FF1A 3FPPA 4RGTA 3AU7A 1WTOA 1FYCA 3FDTA 3K6OA 1KDAA 2E2IB 3HOUB 1FR3A 4BBRB 3I90A 1V43A 5ELEA 5C0XH 4DFAA 2EYFA 2JYOA 2VB2X 2A74C 2MP1A 4ULLA 4O1NA 3J80L 1GOZA 2BOSA 4KN4C 1ET9A 2HQEA 1TR5A 2L55A 2D2CC 2EYLA 5IODA 5FLXL 1ICWA 2QKIC 1I4GA 1C4QA 4QUFA 4C3HB 1KAAA 2WINB 3S1NB 2SNSA 3H91A 4BS9A 5M3FB 2NVTB 2Z4HA 1O7LA 3HOWB 3PUWA 4N9PA 2MUYA 1A2UA 3DWAA 4GZYC 2B39A 3NK9A 1STAA 4X3UA 2AQ3B 5CV5A 4HSVA 1IYVA 3MXGA 3PUZA 1TWCB 3PO2B 1STYA 1TWAB 4NDXA 4NMZA 1CZGA 1A2TA 4C1NK 4EQNA 2IPKD 3TSSA 3S17B 1CHQD 1I4XA 3HRZC 3DXJC 4HSPA 3X3NA 2KQ3A 3QOJA 3HZXA 2AWOA 2ZT9C 3DEPA 2F3VA 3J7YW 3FKIB 3S2DB 2F0EA 1JOQA 5M5XB 1PTOF 3MTSA 4XT3B 4WORA 3SE0A 3TBIB 1IL8A 5AFWA 5D3IB 3NWTA 3J7AV 1A15A 3E5SA 1PYWD 2K7VA 1LTGD 5IGCA 2KHSA 1IHZA 3U9OA 2LKVA 1AZPA 1ZKOA 2PZWA 1KDCA 4I65A 4DK0A 1IKMA 1NR2A 2FMCA 3OWEB 3TP6A 5C4HA 4FF4A 4KD3A 4DNTB 3M7NA 1CFMA 1LTBD 4V190 2VUMB 1O7ZA 1SMYC 3C2PA 1BO0A 5K5PA 3J80E 5JEAH 4KKSA 2K01A 3X3MA 2V4DA 4KD4A 4RGMA 2IX3A 1WVLA 4AYBB 3KLSA 1JC7A 3DM1A 2O2LD 5FLXE 5A2QL 1GUTA 4QCLA 5I6YA 1BOSA 1EEID 5C5LA 3CRKC 3WOEA 4R8IA 4HCSA 4P2CB 4OIJA 3A54A 4IUUA 1E0BA 1QG7A 3BG3A 4A3DB 2PW7A 3DUZA 3KBXA 3QJYA 3SR1A 2O5JC 2SOBA 4OO1H 3OIPA 2NVYB 4K5WA 4BBSB 4KY6A 3FRPB 2RDFA 4YIJA 1GUOA 4BWGB 3H0GB 3VA5A 1JWSD 2IX1A 4XDXA 1ZXTA 1VDZA 2EYPA 4BA1I 2ZXOA 1KABA 5E4XA 1PTOC 2OEOA 1EYCA 4WJWA 2VNUD 2EY1A 3JAML 3VR5A 1MI2A 1QE6A 1HA6A 4KV6A 2R92B 1Y1WB 4L6TB 1LLRD 5LHY1 1LTTD 3HOXB 2F0LA 2J4XA 2HCIA 1GHKA 1X3PA 1B2TA 3QIAA 4Y7NB 5TSSA 2HUGA 5K36G 1CK1A 2PCFB 2QEJC 1CHPD 1JORA 2NWGA 1R9TB 2SDFA 1EY5A 2AQ2B 4I7ZC 5E3FA 2RVLA 5CV6A 3SK5A 4L63B 2X6GA 3MAQA 4NP5A 4K6DA 1Z7TA 2X6LA 2F0KA 4IUPA 2KCCA 2MJ8A 1AW7A 4OL7A 3UI2A 3W2DA 1ENFA 5KEEA 2CW0D 4FYDA 1HHVA 2Q8RE 3T13A 5IOCA 4F88A 3DWQA 1STEA 5G3LF 3S14B 1MSGA 5EBDA 3FPUB 4R8NA 1H9KA 3HP3A 1CT1D 1KLUD 2NN6G 5A2QE 2K04A 3ND9A 4C3IG 4A3GB 5KYLA 1L0YB 4G7HC 2E2DC 2O4XA 4ZKCB 1H9SA 3MHBA 1D6EC 2K28A 3BVZA 1JCKB 2NVQB 1I50B 1QNUA 2I46A 1SYDA 5ELFA 3RD4A 2LS01 3I70A 5CC4A 5JVH3 4DU9A 4ZKBB 5J1ZA 3P20A 2LMCB 4C1NI 3GTOB 1CM9A 2EYMA 1RKNA 5JVG3 5C6AA 2B2YC 1JOKA 2WB1B 3A55A 3HOZB 4BA2I 3GTLB 1SNOA 1EZ6A 1VF7A 1GUSA 1JB3A 1TWGB 2VXWA 1NAPA 5CV8A 3HGBA 1TIID 5HURA 1SSOA 1TS4A 1K8MA 4QF4A 4H44C 1MD2D 4BY1B 1LT6D 3KUPA 3JAME 2F03A 4XQNA 1EY9A 1RODA 4FXDA 5DEHA 2K33A 2PZUA 1NSNS 4QUCA 2RA4A 3O13A 3QOLA 5KNDA 2OT2A 2KOLA 2D5DA 5IGGA 1G291 3ITPA 2GA4B 3VR4A 1ILPA 2B2TC 3DWPA 2I07B 2NBFA 1H9SB 1EWCA 3D4RA 5CGKA 3IKJA 3N52A 1AN8A 4NKLA 1I6VC 1HCZA 1PTOB 3RUZA 4IFDH 1TQOA 3K5NA 1F2ZA 3MZ5A 1SE4A 1W6JA 1YNJC 1VMPA 5C4XB 3R2IA 1R4QB 4PMWA 4K8JA 4UDUC 1D5ZC 1G2SA 1Q12A 1EY7A 1G2TA 5CR3A 5M5WB 1TS3A 4H7BA 1PRTF 3A8IE 2NN6I 1EU4A 2B2YA 1GUNA 1H9RA 2SEBD 2MHVA 1E2ZA 3M7GA 3S1MB 1UEAB 2XRQD 4PMBA 2JXMB 4WFN3 4EVOA 3MEHA 4K2KA 3Q0AA 1TWHB 1SMYD 1DZ1A 3GV6A 1YNNC 4U68A 1S5ED 4H0LC 2NYZD 3HS0C 1GUWA 1CA5A 4FXKC 5C3WA 2PZTA 1WTWA 3K5OA 1G91A 1QCBD 1RTNA 3D8GA 1LTAD 2A6HC 5IGEA 1QOHA 2CW0C 2X69A 3N6RA 3SEBA 1D2BA 2F0WA 3H3VC 2K5DA 2F0HA 4ME5A 3QO2A 5FO9B 2B2TA 2F0IA 1LT3D 2R6GA 5C44B 1PZID 4FVMA 2KVMA 1EY4A 1C8CA 3KK7A 1IYUA 3BZDB 3Q23A 3RZDB 1PZJD 3FVQA 3V96A 1RD9D 1DONA 5HGTA 2B8FA 3NTHA 3C46A 2DY8A 4F8MA 3P7JA 2BA0A 1S5BD 5I2YA 1M4VA 5IT9L 2M9VA 1D1KA 1FNWA 1V8QA 4CJ2C 5C3XA 4XQQA 1PTOD 4RKLA 1CQFA 1PFMA 2EE1A 3I4LA 3I4NB 4DF7A 3ZYYX 5CBEE 2R7ZB 2EZVA 1S5DD 2XN9C 4TRDA 3M4YA 5EGTA 1ESRA 3H09A 4FXGC 3H6MA 1PRTC 4FNFA 3S1QB 4ZK9B 1LO5D 1IW7C 2F0OA 1CTMA 3LX0A 3EVQA 2G9HD 1ENCA 4G4KA 2PQEA 4IUVA 1BNZA 5T1IA 1Y8PB 4HMJA 5COYA 2NTSA 3M85A 1ESFA 3MC0B 1SNPA 2L5TA 2K6AA 2XIWA 4LAAA 2ZXPA 3GP7A 1CZWA 2JEBI 1PFBA 5C0XG 3NBIA 4C3JG 1WD1A 1SJED 1HUMA 1EY6A 4XIGS 1C48A 2BA1A 3K58A 4EQPA 5KYIA 3S2HB 2LFNA 3CKIB 1OO9B 3RZOB 1ONLA 4KHZA 2E76C 2EVBA 1AEXA 1TKWB 1G8ZD 2BDNA 4K5VA 2K1BA 2AWNA 1F9RA 1M8AA 2JA7B 5C4JB 2PPBC 1STHA 4HTHA 1HA5A 4QIWB 3MFGA 4C3IB 2K5QA 2LY7A 2IW3A 1EOTA 4UAIA 3GTJB 3U9SA 5CORA 2WACA 5FO8B 1KTKA 2XVSA 2D9UA 4CJ1B 5IT9E 3OHXC 1OXXK 1SAPA 3D6CA 1SE3A 4K2LA 2F1MA 5KNBA 2EYHA 2HDMA 2OXPA 4ILWA 3HOVB 4HR7B 3EJIA 1CI3M 4RWSC 4A3EB 3T56B 2L1BA 4KY7A 3SHLA 2L4NA 4ABNA 4RCOA 3D4WA 2XSCA 1V1PA 5KNCA 2F0UA 5C4ZA 1OXUA 5CV9A 4IQZA 2ZXRA 4ZQ3A 2EY2A 1Q90A 4OHJA 4IURA 1K83B 1CA6A 1DCZA 1PLFA 1B9MA 2JA5B 3GTKB 5IIFA 1PXUA 4ZUJA 5M3MB 4EQOA 1VMCA 3D3RA 4NW2A 1EYDA 1SYEA 1AZQA 3GTPB 4ZYSA 1B3AA 5D3DA 2RSNA 5G3LD 3M4OB 1FD7D 1BDOA 1YNJD 2KJXA 1D5MC 3VR2A 5I9OA 3Q24A 2K05A 5C0XI 5JEAG 5EPLA 3NUCA 1RTOA 1PRTB 5IGDA 3W3AA 3CRLC 3RLFA 2L11A 2MPMA 3VA7A 5M5YB 2K5WA 3BVGA 1V1PB 2RDHA 4DNRB 1SNCA 4IUTA 5D14A 3TP5A 1EL0A 3I8ZA 3EROA 1WTPA 3EA6A 1KNAA 2MGSA 3NWSA 1S5CD 1YNND 2C9OA 4JBWA 2KUMA 3I72A 3A8KE 1Y8OB 3NHHA 3I4MB 4OO1G 3CQZB 2IL8A 4C2MB 5C0XJ 5F2DA 4XQJA 4N9TA 4PV1C 4KJNA 2A6HD 3CU7A 5JJZA 3VR6A 2B2VC 3BS1A 1BCPB 1FNUA 4KKUA 4Q5VA 2F0QA 4DA2A 4DXFA 1OXSC 3L7ZC 2HCCA 1CQVA 3WDNA 2EJGC 4PQXA 3GO5A 2H1EA 1PFNA 2F0MA 4KY5A 1SYGA 2EYJA 1MBYA 3K7AB 4E6IA 1SDFA 3LNNA 4LJZC 1J8IA 1HQMC 1ZYRC 5EKLA 3C3LA 5LL6X 4FP5D 2B2UA 1B1ZA 3J7AF 1J9OA 2L0CA 5DM63 5FKAC 3PUYA 5CV4A 1BF4A 3A56A 4IZ8A 1WTVA 4K6LA 3VR3A 5J22A 1D1IA 1L0XB 1DJRD 1ILQA 3OMGA 1Q3LA 3LWUA 1B4OA 2M00A 4ZRZA 3IL8A 4CKEA 4RH6A 1W6KA 2K03A 1I4QA 3KLRA 3T16A 1JWUD 1KDBA 1PRTD 5EKKA 2EY6A 1E2WA 1Q1BA 1IW7D 3T4AC 3A7LA 3KLSX 4FF3A 1NR4A 3TDQA 2XRSD 1DYQA 1KNEA 2F0DA 4IUQA 1U4LA 1HTLD 1HTPA 4G7OC 1K8OA 5LL6S 1D5XC 1SFOB 4B9WA 5D65A 2TSSA 1FGBD 1HXYD 2H4OA 5EPJA 2XNAC 4MIUA 4QB4A 3G7LA 1TS5A 2A6EC 1SNDA 2B2VA 4C56C 3NXWA 2EDGA 3MXUA 1BBXC 4CKCA 1VF5C 3FMCA 4OGQC 3BDLA 2WKCA 3DHQA 2J7ZA 1HRJA 4KJOA 4RKBA 1F2MA 4OO1I 3A8JE 4H13C 5JEAJ 2R93B 1E2VA 4C3JB 2K32A 1LT5D 3DEOA 4HN7A 2HDLA 2F4IA 4K5XA 4RCNA 3MFYA 5FO7B 4RFBA 3HOYB 5C5MA 5ISRA 2NUCA 1B44D 3R93A 3BYYB 2PW5A 1ZEQX 4MHEA 3IAYA 3J81L 2VB3X 1BXTA 1SYBA 3SDZA 1X3QA 2KEDA 3PIP3 2NB0A 4RHSA 1R4PB 1AFPA 2JE6I 5J39A 4RHRA 4LMQD 1XTCD 4A3BB 3IFDA 3VYSA 2IT1A 4JK1C 3TP8A 1RDPD 5T1GA 2F0PA 4RGNA 2B8GA 4HAEA 4IFDG 2RBMA 3KBGA 1II3A 1SJHD 5JPMC 5DM73 2NTTA 1BCPF 2XWBB 4J6HA 4A93B 4DAYA 1BUVT 4LK1C 4RAUC 3L9AX 1PMRA 2PMZB 1F2YA 1JE4A 1X32A 3C1FA 4KMUC 1RCVD 3D4DA 4KHVA 1F9SA 4X3SA 4ODGA 5ELDA 3HEJA 2BCOA 2O5IC 2KEEA 1V1OA 5FK9C 1TY2A 1PTOH 3DMUA 2KECA 1I6HB 5CYUA 3MA2B 1Z6HA 3PMFA 1BR9A 3OSOA 1AP0A 4PNYA 4U673 4DN4M 1EIGA 2L12A 4A3IB 1GJXA 1WTXA 1EEFD 3P1HA 1I4PA 5JOBA 3K57A 1QNKA 4Z9CB 4M1UB 1EU3A 1O80A 4MN3A 2AQ1B 4X3TA 2DNCA 2EOTA 4K8IA 3H94A 3T53B 1PDQA 3PUXA 3K5LA 1EQVA 2AUKA 1KLGD 1EZ8A 2F0SA 1O7YA 5JPNC 1RHPA 2PNRC 2XWJB 4XXEA 4OIKA 1B53A 3PIO3 5FOBB 5BN3A 2ICEC 1QB5D 1STGA 3EFXD 2R61A 1U4RA 1HPCA 3NPPA 3P75A 2A69C 3RMHA 1JQYD 3J81E 3I73A 4Q0FA 1QJOA 5I6WA 1LV9A 1ENAA 3NQIA 1OXTA 5I2XA 1SBBB 3E6ZX 1JICA 2ENBA 3NTIA 3BYTB 3NP8A 1NUCA 2EJFC 1MGSA 1WTRA 1BCPC 1F77A 2FHTA 3R3OA 2JP1A 2F0GA 1QWYA 3M3YB 3BVMA 3PV0A 3TN2A 5KRUA 4IFDI 1EYAA 2Z4IA 1A3TA 1ZYRD 2DNEA 1B9NA 1TU2B 2WIIB 3L3OC 3OWFA 3GV3A 2F0TA 4FO2A 4XT1B 4CGYB 4B9XA 1HUNA 3QWNA 2BE5C 1LACA 1TT2A 1O78A 2E75C 4M8AA 3T51B 1F9PA 3Q6SA 1EFID 4CKBA 4X3KA 3SK8A 4PMCA 2A68C 3QG1A 4IFDJ 5E1FA 1B50A 2EJMA 4XTCS 1XWEA 3C1EA 1S5FD 1F2LA 4J1MA 1A3VA 4TQUS 4F7XA 3OPOA 2A6ED 3OMCA 3HG9A 2AUJD 4HMIA 3GTGB 2YYZA 1U4MA 2EYOA 1Z47A 1EQTA 1PZKD 5K36H 2QILA 3FEWX 4ID6A 1A3UA 3D31A 3D6WA 3MXNA 4J8QA 3F2UA 2A73B 1JWMD 2C5CA 3NSWA 4L8JA 1MSHA 2B63B 4ZUIA 2WP8J 1WCMB 3S9WA 4DAPA 2EPBA 3S16B 3BDCA 2B2UC 3LWEA 1LABA 2J0TD 4HEDA 2RSOA 4QMGA 1SEBD 4C3HG 2KA7A 1SNQA 2NN6H 5I4DA 1U9RA 3TMEA 5I9PA 1EIHA 3K0YA 1FNVA 1BQQT 4A3MB 3GQBA 1H9MA 4XYQA 4A3FB 3WOFA 2E74C 2QDBA 2RKSA 2PO4A 2CHBD 1DM0B 1STBA 2NVXB 3AMUA 1T5XD 3HKZB 2G9DA 4O42A 3IFTA 3S15B 5NUCA 3OOCA 2CQAA 1QILA 3R2TA 1TS2A 1NCVA 1ET6A 5KIXA 5JAVA 3SXHA 2F0FA 4TKOB 5CV7A 1I3QB 3URYA 2N88A 1TY0A 5EKIA 2JA6B 2Q8TA 4K14A 4A3KB 4G57A 2WKDA 1F9QA 3VYRA 4DGZA 1A6XA 3S1RB 4R9WA 2KCNA 3TZUA 1U4PA 3OIQA 2QCPX 2FINB 4ZLTF 3KF8A 1SYCA 1XYIA 1DOKA 1HQRD 1TWFB 4IUNA 5CBAE 1WTQA 5KGUA 1XX8A 1DXMA 2M2LA 2SNMA 4WRDA 1LTID 3I91A 2N55A 4RA8A 5C3EB 3VYTA 2IX0A 1UNSA 3E0JA 5DNFA 2FJ2A 3MWYW 2YU9B 3CHBD 4S3SA 2B2WC 1GUGA 2DN8A 3NE5B 1JR0D 1EY8A 2F0VA 1GHJA 5IGBA 4DXGA 2F0NA 1EY0A 5IGFA 4KTAA 3SK6A 1XXGA 1VCIA 3I3CA 4ZAIA 2EY5A 3MXPA 3EQLC 2IJ0A 4KK7A 2RQXA 1UUPA 2JEAI 3G6JB 5EPKA 2JSOA 3Q22A 1OXVA 2FFKB 4CJ0B 4V0BA 4EGVA 4CBVA 1SE2A 2A69D 2TMPA 1RJTA 5DAUA 4FF2A 3SVMA 4A3JB 2EXZA 3ERQA 5ELCA 5CMDA 3BDOA 5M9OA 3NTKA 1RF2D 3PUVA 3TZDA 4RGOS 2R3ZA 2OF1A 4KN7C 5EBCA 4BY7B 2QF7A 3R8BA 4XYOA 2Z1CA 5BN4A 4TSSA 1BCPD 2DY7A 3TP7A 1SXTA 2D62A 3K59A 5BN5A 4DAVA 3GTMB 5E4WC 1Y69U 1Y1VB 1Q1EA 5ELBA 4KI0A 2WAQB 3OW7A 2ID0A 1DOMA 4IALA 1HFNA 2RDGA 3NQTA 1Y8NB 1WD0A 1GXDC 1JOOA 1UAPA 2B2WA 2L9HA 2BE5D 1Q8IA 2Z8LA 4KKTA 1ML0D 1I4RA 2IWHA 2NZ1D 1T5EA 2CVRA 2Y0SB 3PO3B 1SNMA 1S4ZA 3QB3A 2A68D 3GD7A 4HCEA 2JA8B 1DOLA 4DK1A 1EWHA 1TVXA 2PYKA 1IKLA 3A7AB 1DD2A 2FMMA 4IN3A 3MVVA 2E2JB 1LTSD 5EQ0A 3NBHA 3GTQB 1LT4D 3AB9A 4F87A 2F0JA 4G7ZC 1H9JA 3VYUA 3K5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EVO A;  3NK9 A;  4QF4 A;  3R3O A;  1JOR A;  3MEH A;  4K2K A;  2F0G A;  1STA A;  3NUC A;  4DGZ A;  5IGD A;  4TRD A;  1EY5 A;  2OF1 A;  1STN A;  2WAC A;  5CV5 A;  2F3W A;  5EGT A;  1SYF A;  3DMU A;  1EY9 A;  5I6Y A;  4ZUI A;  5CV4 A;  5E3F A;  1STY A;  3PMF A;  5KRU A;  4NDX A;  1EYA A;  4NMZ A;  1A3T A;  5C5L A;  1A2T A;  3S9W A;  3OSO A;  1SYC A;  4IZ8 A;  4PNY A;  5DEH A;  3H6M A;  5CV6 A;  3SK5 A;  4K5X A;  4IUN A;  4EQN A;  5J22 A;  2PZU A;  3D6C A;  3V2T A;  1NSN S;  3TP7 A;  5KGU A;  4NP5 A;  4K6D A;  3BDC A;  3OWF A;  2F0O A;  3SK4 A;  3OMG A;  4K2L A;  2F0K A;  3QOL A;  1SNC A;  2F0T A;  2SNM A;  5C5M A;  3P1H A;  3TP5 A;  4OL7 A;  3LX0 A;  2NUC A;  2EYH A;  2OXP A;  3EVQ A;  4WRD A;  2KQ3 A;  2M00 A;  1ENC A;  3ERO A;  2PQE A;  3HZX A;  3QOJ A;  5KEE A;  4B9X A;  5JOB A;  5C3W A;  2PZT A;  3EJI A;  5IGG A;  2PW7 A;  2PW5 A;  3T13 A;  2F3V A;  4HMJ A;  5IOC A;  2F0E A;  4KY7 A;  4QMG A;  3SHL A;  1JOQ A;  3T16 A;  3D8G A;  1KDB A;  1SNQ A;  3ITP A;  3SR1 A;  5EKK A;  1TT2 A;  5IGE A;  2EY6 A;  1KDA A;  2SOB A;  1SNP A;  1SYB A;  3D4W A;  4R8N A;  1U9R A;  4IAL A;  3NHH A;  4K5W A;  2F0W A;  4WOR A;  4K8I A;  4KY6 A;  4LAA A;  3NQT A;  2F0H A;  2RDF A;  4ME5 A;  4S3S A;  2F0U A;  5C4Z A;  3E5S A;  5CV9 A;  1EQV A;  3TME A;  5I9P A;  5IGC A;  2F0I A;  2KHS A;  2EY2 A;  4ZQ3 A;  5CGK A;  1IHZ A;  1EZ8 A;  2F0S A;  4YIJ A;  2F0D A;  5F2D A;  1JOO A;  1EY8 A;  3SK8 A;  4DFA A;  2F0V A;  4N9T A;  5KYL A;  3U9O A;  5J39 A;  5IGB A;  1EY4 A;  2EYF A;  2F0N A;  2O4X A;  4KJN A;  4NKL A;  4PMC A;  1EY0 A;  2LKV A;  5IGF A;  1EY6 A;  4KTA A;  3SK6 A;  2QDB A;  3VA5 A;  2RKS A;  4B9W A;  3TP8 A;  5ISR A;  4EQP A;  5KYI A;  3RUZ A;  3MHB A;  1TQO A;  5E1F A;  2PZW A;  2EYP A;  1STB A;  2F0P A;  4MIU A;  5IIF A;  4QB4 A;  1F2Z A;  1STG A;  2RBM A;  3MZ5 A;  4ZUJ A;  1II3 A;  1KDC A;  4I65 A;  2EY5 A;  3MXP A;  5HGT A;  1SND A;  2F0Q A;  1KAB A;  5NUC A;  3NXW A;  3P75 A;  2HQE A;  1TR5 A;  1SNM A;  1SYD A;  4J6H A;  4EQO A;  2OEO A;  1EYC A;  2EYL A;  4F8M A;  5IOD A;  3C1E A;  3TP6 A;  1EYD A;  5CC4 A;  1SYE A;  2EY1 A;  3QB3 A;  4DU9 A;  5C4H A;  1AEX A;  4KV6 A;  5I6W A;  5J1Z A;  1ENA A;  4J1M A;  4K5V A;  4K8J A;  2PYK A;  4KD3 A;  1A3V A;  5KIX A;  1EY7 A;  3BDL A;  5JAV A;  1KAA A;  1F2Y A;  1RKN A;  2EYM A;  5CR3 A;  3SXH A;  4F7X A;  3MVV A;  2F0M A;  2F0F A;  2SNS A;  3DHQ A;  3OMC A;  5C6A A;  4KY5 A;  4H7B A;  4KJO A;  1SYG A;  5C3X A;  2ENB A;  1JOK A;  2EYJ A;  3C1F A;  4HMI A;  5CV7 A;  1SNO A;  1STH A;  4HTH A;  3D4D A;  1NUC A;  3NP8 A;  4RKL A;  4RKB A;  4E6I A;  1F2M A;  2F0L A;  4KHV A;  5DAU A;  1EZ6 A;  2EYO A;  4ODG A;  3HEJ A;  5K5P A;  2F0J A;  2EXZ A;  4DF7 A;  5EKL A;  3ERQ A;  5CV8 A;  4N9P A;  4PMB A;  5HUR A;  5I9O A;  4K14 A;  1A2U A;  4G57 A;  5M9O A;  4ID6 A;  1A3U A;  4KD4 A; 
#chains in the Genus database with same CATH topology
 2UUA Q;  4NXN Q;  4A3G G;  2E2H B;  4B08 A;  4PG3 A;  2WV6 D;  2VY3 A;  2A5H A;  3H3V I;  1SFO H;  1STN A;  1HFG A;  2F3W A;  1SYF A;  2Q8I B;  1G6Z A;  1I4H A;  3V05 A;  5EJW A;  3UE0 A;  2OWO A;  2Z6B A;  4LWC A;  2BDO A;  4CHT B;  1E1T A;  3WWV A;  3QR8 A;  3V2T A;  1K28 A;  3ND8 A;  4DR4 L;  2ICI A;  1XPR A;  3ONA B;  3SK4 A;  1CKN B;  5A35 A;  1LTR D;  4FF1 A;  1EUJ A;  1NJI C;  3FPP A;  1I94 L;  2Q2H A;  4RGT A;  3AU7 A;  4DK6 C;  4HJA A;  1ASY A;  1WTO A;  1FYC A;  1Y14 B;  1YI2 A;  1KD1 C;  3FDT A;  4A4I A;  2R7D A;  3K6O A;  1KDA A;  2E2I B;  2MO0 A;  1WFQ A;  3HOU B;  2ZTC A;  2WB1 G;  3HOZ G;  1FR3 A;  4BBR B;  3I90 A;  1V43 A;  5ELE A;  5HY6 A;  5C0X H;  4C3J H;  4DFA A;  3PF5 A;  1VQP A;  2BH2 A;  4A75 A;  1G6P A;  2EYF A;  2JYO A;  2VB2 X;  2A74 C;  2MP1 A;  4ULL A;  4DR1 L;  4O2D A;  4O1N A;  3J80 L;  4BY1 G;  2VL6 A;  1U0L A;  3E3X A;  1GOZ A;  2QW7 A;  2BOS A;  4NXM L;  4KN4 C;  1ET9 A;  3AQQ A;  3NBH B;  2HQE A;  1TR5 A;  1YEZ A;  2L55 A;  2D2C C;  2EYL A;  5IOD A;  4IOA A;  5FLX L;  1ICW A;  2QKI C;  1I4G A;  1C4Q A;  1E24 A;  1QVG A;  4QUF A;  4C3H B;  1KAA A;  2WIN B;  3AEV A;  1FJG L;  3S1N B;  1WTH A;  2SNS A;  3H91 A;  1XMO Q;  4BS9 A;  5M3F B;  2NVT B;  1X3E A;  5IYB G;  2Z4H A;  3J81 j;  4JI2 L;  1O7L A;  3HOW B;  2KHJ A;  2RHQ B;  4DUY Q;  3PUW A;  4N9P A;  2MUY A;  3KF6 A;  1A2U A;  3DWA A;  1PA6 A;  1Q86 C;  4GZY C;  1YBY A;  2B39 A;  3NK9 A;  4WJ3 M;  1STA A;  4X3U A;  4A3B H;  2AQ3 B;  2F3I A;  5CV5 A;  1J5E Q;  4HSV A;  1IYV A;  3MXG A;  4YY3 Q;  3PUZ A;  1TWC B;  3PO2 B;  1STY A;  1TWA B;  3GTQ H;  4NDX A;  4NMZ A;  1CZG A;  4BXX G;  1A2T A;  4C1N K;  4EQN A;  2IPK D;  3TSS A;  2MNA A;  3S17 B;  1VQB A;  1CHQ D;  1I4X A;  4A93 H;  1MJE A;  4OEL B;  5IYC H;  3F2C A;  3HRZ C;  3DXJ C;  4HSP A;  3X3N A;  4KLK A;  2KQ3 A;  3QOJ A;  5C4X G;  3HZX A;  2AWO A;  2ZT9 C;  4YHH Q;  2NZH A;  4JYA L;  3DEP A;  2F3V A;  3J7Y W;  3FKI B;  3S2D B;  2F0E A;  3K7U C;  3U4Z A;  1JOQ A;  3GDE A;  5M5X B;  1PTO F;  4R4C A;  3MTS A;  4XT3 B;  4WOR A;  3SE0 A;  3TBI B;  5IYD H;  1IL8 A;  5AFW A;  5D3I B;  4L5S A;  3PF4 A;  3NWT A;  3J7A V;  1XPU A;  1A15 A;  4DKA C;  3E5S A;  1PYW D;  2K7V A;  1X65 A;  1LTG D;  4J15 A;  5IGC A;  4DV3 L;  2KHS A;  2F52 A;  1IHZ A;  3U9O A;  2LKV A;  1AZP A;  4LF6 L;  3A5U A;  1ZKO A;  1I6H H;  2PZW A;  1JJG A;  4DV0 L;  3HOU H;  1N36 L;  1KDC A;  4I65 A;  3I55 A;  4DR6 Q;  4IJH A;  4BBR H;  4DR3 Q;  1VQD A;  4DK0 A;  2MFI A;  1IKM A;  1NR2 A;  1X55 A;  3M4P A;  1C0A A;  2FMC A;  3OWE B;  3TP6 A;  1EQQ A;  4DK3 C;  5C4H A;  1M1K C;  3M4Q A;  3KF6 B;  4APV A;  4FF4 A;  4KD3 A;  4DNT B;  3M7N A;  5BR8 Q;  1CFM A;  1LTB D;  4V19 0;  2VUM B;  1O7Z A;  4A3C H;  1SMY C;  3C2P A;  1BO0 A;  5K5P A;  4GN3 B;  2QDL A;  2KEN A;  3J80 E;  2VQE L;  2ZM6 Q;  5JEA H;  4JW0 A;  4KKS A;  3CC4 A;  2K01 A;  3X3M A;  2V4D A;  1VQ9 A;  4KD4 A;  4RGM A;  2IX3 A;  5LMN W;  1WVL A;  4OWX B;  4AYB B;  3KLS A;  4WJ4 A;  1JC7 A;  5C44 G;  3DM1 A;  2HT1 A;  2O2L D;  5IY0 A;  5FLX E;  5A2Q L;  3S1N H;  3J7A 5;  1GUT A;  4QCL A;  5I6Y A;  1XNR L;  1BOS A;  2OQK A;  4DV2 L;  4YWL A;  1EEI D;  5C5L A;  3CRK C;  3WOE A;  4R8I A;  3HOW H;  2UXD L;  4HCS A;  2HHH Q;  2KCM A;  4P2C B;  4OIJ A;  3A54 A;  4IUU A;  1E0B A;  1QG7 A;  4LNQ A;  4JBK A;  3BG3 A;  4MZ9 A;  3STB D;  4A3D B;  1HNW Q;  2PW7 A;  3DUZ A;  3KBX A;  3BU2 A;  3J81 i;  3QJY A;  3SR1 A;  2O5J C;  2SOB A;  4OO1 H;  3OIP A;  2NVY B;  2GN5 A;  4K5W A;  1BKB A;  4BBS B;  4KY6 A;  3FRP B;  2RDF A;  3I4N G;  2PI2 A;  1GUO A;  4YIJ A;  4EQ5 A;  4DV4 Q;  4BWG B;  4HIK A;  1QUQ A;  1AE2 A;  3H0G B;  3VA5 A;  2R7Z G;  1JWS D;  4N8X 1;  2IX1 A;  4XDX A;  1ZXT A;  1VDZ A;  2EYP A;  3W1G A;  4BA1 I;  2ZXO A;  1KAB A;  5E4X A;  1PTO C;  2OEO A;  1EYC A;  1HR0 L;  4WJW A;  2VNU D;  4KHP L;  2EY1 A;  3JAM L;  3VR5 A;  4LF8 Q;  1MI2 A;  1QE6 A;  1HA6 A;  4KV6 A;  2R92 B;  1L2F A;  1PFS A;  4X66 Q;  4LUO A;  3S24 A;  1Y1W B;  4L6T B;  1LLR D;  4B3M L;  5LHY 1;  2ZJR A;  2CCZ A;  1LTT D;  3K80 C;  3HOX B;  1V1Q A;  2F0L A;  2ATW A;  2J4X A;  1KIX A;  1KQS A;  2HCI A;  1GHK A;  1X3P A;  4B3T Q;  3QIA A;  1B2T A;  4Y7N B;  3KYH C;  5TSS A;  2HUG A;  5IT9 c;  4UHV A;  1K8A C;  5K36 G;  4JI1 L;  2ZTE A;  1CK1 A;  2PCF B;  2QEJ C;  1CHP D;  1JOR A;  2NWG A;  3CC7 A;  2F4V L;  4DR2 Q;  1R9T B;  2SDF A;  1EY5 A;  1JB7 A;  2AQ2 B;  1WJJ A;  1IBK L;  4I7Z C;  5E3F A;  2RVL A;  5CV6 A;  4DUZ Q;  3SK5 A;  1SN8 A;  3T1H Q;  1SE8 A;  4L63 B;  2X6G A;  3MAQ A;  4NP5 A;  4K6D A;  1Z7T A;  2X6L A;  2F0K A;  1QVF A;  1N9W A;  1UWV A;  4IUP A;  2KCC A;  2MJ8 A;  1A62 A;  1AW7 A;  4OL7 A;  3K0X A;  3UI2 A;  3W2D A;  1ENF A;  5KEE A;  1VQ4 A;  2ASB A;  3J80 i;  2CW0 D;  4FYD A;  1HHV A;  1QUQ B;  2Q8R E;  4LFA Q;  3T13 A;  2HD3 A;  4F88 A;  5IOC A;  3DWQ A;  1STE A;  5G3L F;  3S14 B;  1MSG A;  5EBD A;  3FPU B;  1H9K A;  4R8N A;  3HP3 A;  1CT1 D;  2JA7 G;  2VS1 A;  1KLU D;  2NN6 G;  5A2Q E;  1K3B C;  1Q7Y C;  2K04 A;  3ND9 A;  4C3I G;  4A3G B;  3HKZ E;  5KYL A;  1L0Y B;  4LF4 L;  4G7H C;  2E2D C;  4A3D H;  2O4X A;  4ZKC B;  2B63 H;  1H9S A;  3MHB A;  1D6E C;  2K28 A;  3BVZ A;  1JCK B;  3KLW A;  1WCM H;  2NVQ B;  2NVY H;  1I50 B;  1QNU A;  4I7A A;  2I46 A;  4PZ7 A;  1SYD A;  4OWT B;  3S16 H;  5ELF A;  3RD4 A;  2LS0 1;  3I70 A;  4K0K Q;  5CC4 A;  5JVH 3;  4DU9 A;  5IP9 H;  1X9N A;  4A3L H;  4ZKB B;  5J1Z A;  3TRE A;  3P20 A;  2LMC B;  4JI4 Q;  4C1N I;  3GTO B;  1B70 B;  1CM9 A;  2EYM A;  1RKN A;  2A1A A;  5JVG 3;  2NZO A;  3HOV G;  5C6A A;  2B2Y C;  4A3E G;  1JOK A;  2WB1 B;  3A55 A;  4RG1 A;  1HNZ Q;  3HOZ B;  4BA2 I;  3GTL B;  1SNO A;  1CUK A;  1EZ6 A;  1VF7 A;  1GUS A;  1JB3 A;  1TWG B;  2VXW A;  4DR7 Q;  1NAP A;  5CV8 A;  3HGB A;  1TII D;  5HUR A;  4RMF A;  1SSO A;  3KDF A;  1TS4 A;  1VQ6 A;  1K8M A;  4QF4 A;  2R92 H;  4H44 C;  1MD2 D;  4A3M H;  4A3F H;  4BY1 B;  1LT6 D;  3KUP A;  5FLM H;  3BZK A;  3JAM E;  3CCJ A;  1YJW A;  2F03 A;  4XQN A;  1EY9 A;  1ROD A;  4FXD A;  2UUB L;  4AQY Q;  2NVX H;  2JA5 G;  4CDD C;  1C7Y A;  3EIV A;  5DEH A;  2K33 A;  2PZU A;  2E5L L;  1NSN S;  4QUC A;  2RA4 A;  2QA4 A;  3O13 A;  3QOL A;  5M3M G;  1HZA A;  5KND A;  2OT2 A;  2KOL A;  3I56 A;  2CQO A;  2D5D A;  1B7Y B;  5IGG A;  1KC8 C;  2K5N A;  1G29 1;  5LMU Q;  4IPH A;  3VDY A;  3ITP A;  2GA4 B;  3VR4 A;  4X65 Q;  5GAH C;  2A19 A;  4JI6 L;  1ILP A;  1I3Q H;  2B2T C;  3DWP A;  2I07 B;  2NBF A;  1H9S B;  4DR5 Q;  4JI0 L;  1QZH A;  1EWC A;  3W1B A;  4X62 L;  1KRT A;  1VQJ A;  3D4R A;  5CGK A;  3IKJ A;  4LF7 L;  3N52 A;  4A3K H;  1XTD A;  3F2B A;  2ZJP A;  2RF4 A;  1AN8 A;  4NKL A;  1I6V C;  4JI3 Q;  1HCZ A;  1PTO B;  3S1R H;  3RUZ A;  4IFD H;  1IBM Q;  1TQO A;  4HIM A;  4DV7 Q;  3K5N A;  1F2Z A;  4B3S Q;  3MZ5 A;  1X54 A;  1TWF H;  1SE4 A;  1W6J A;  1YNJ C;  5E7N A;  1GKH A;  1VMP A;  5C4X B;  3R2I A;  1R4Q B;  1ICF B;  3U4V A;  4PMW A;  3KDF B;  4K8J A;  4UDU C;  1D5Z C;  1G2S A;  1Q12 A;  1EY7 A;  1G2T A;  4R4Q A;  5CR3 A;  5M5W B;  1TS3 A;  1MHW C;  3ULP A;  2GVB A;  4H7B A;  1PRT F;  1VQL A;  2NVQ H;  3A8I E;  2CWP A;  2NN6 I;  1EU4 A;  3UE1 A;  2B2Y A;  1GUN A;  1JJC B;  1H9R A;  2SEB D;  2MHV A;  1E2Z A;  3M7G A;  3I4M G;  3S1M B;  1UEA B;  2XRQ D;  4PMB A;  1TXY A;  2JXM B;  4WFN 3;  4EVO A;  3MEH A;  4K2K A;  4P74 A;  3Q0A A;  3PQI A;  1TWH B;  1SMY D;  1DZ1 A;  3J7Z C;  3GV6 A;  3HOZ H;  1YNN C;  4U68 A;  1S5E D;  4H0L C;  3DLL A;  5IWA Q;  2Q2U A;  4X64 Q;  2NYZ D;  3HS0 C;  4HIO A;  4QJF A;  2K75 A;  3KJP A;  1GUW A;  4NB3 A;  1CA5 A;  4ZCK A;  1WI5 A;  2JA6 G;  4FXK C;  1PH7 A;  1H95 A;  2A8V A;  5C3W A;  2PZT A;  1WTW A;  3K5O A;  1G91 A;  1QCB D;  1RTN A;  4DNI A;  3CAM A;  3D8G A;  1LTA D;  1PH2 A;  2A6H C;  5IGE A;  1GD7 A;  1QOH A;  1HNX Q;  2CW0 C;  2X69 A;  3N6R A;  3SEB A;  2AKW B;  1D2B A;  2F0W A;  1YJN A;  3H3V C;  2K5D A;  3I7F A;  1NBW A;  2F0H A;  2DJG C;  1WOC A;  4ME5 A;  3K8A A;  3JAM i;  3QO2 A;  4A3J H;  5FO9 B;  4PZ8 A;  1KHI A;  2B2T A;  2F0I A;  1LT3 D;  4GKJ Q;  2R6G A;  1A8V A;  5C44 B;  1PZI D;  4FVM A;  2KVM A;  1EY4 A;  1C8C A;  2Y0S E;  3KK7 A;  1IYU A;  3BZD B;  3Q23 A;  2EQS A;  3RZD B;  4BY7 H;  1FGU A;  1PZJ D;  3FVQ A;  1XJV A;  3V96 A;  3CP0 A;  1RD9 D;  4IPD A;  1DON A;  5HGT A;  4JV5 L;  2B8F A;  3NTH A;  1K9M C;  3C46 A;  2DY8 A;  4F8M A;  2EXD A;  3P7J A;  2BA0 A;  4OEM B;  1S5B D;  5I2Y A;  3GTM H;  2I5M X;  1M4V A;  1Y1V H;  5IT9 L;  2M9V A;  1X56 A;  1D1K A;  1PYB A;  1RL2 A;  4JOI C;  1FNW A;  1V8Q A;  4CJ2 C;  5C3X A;  4XQQ A;  1PTO D;  4RKL A;  1CQF A;  1PFM A;  2EE1 A;  3I4L A;  3I4N B;  1MJC A;  3T1Y Q;  2PMZ E;  4YWK A;  4DF7 A;  4JI8 Q;  5C4X H;  3ZYY X;  5CBE E;  4LF5 Q;  4X6A H;  3KJO A;  2R7Z B;  1Z9F A;  2EZV A;  1S5D D;  2XN9 C;  1IBL Q;  4TRD A;  3M4Y A;  2UUA L;  4NXN L;  5EGT A;  4GS3 A;  4IJL A;  1ESR A;  3AYH B;  1EFW A;  3H09 A;  4FXG C;  3H6M A;  3F2D A;  3CCS A;  1XMQ Q;  4PZ6 A;  1PRT C;  4FNF A;  4IO9 A;  3PO3 H;  3S1Q B;  4ZK9 B;  1LO5 D;  3S1M H;  1IW7 C;  2F0O A;  1CTM A;  1ASZ A;  1S72 A;  3LX0 A;  3EVQ A;  2G9H D;  1ENC A;  4G4K A;  2PQE A;  2R7F A;  4IUV A;  1JJ2 A;  2JA8 H;  1BNZ A;  5T1I A;  1Y8P B;  4YWM A;  4HMJ A;  5COY A;  2NTS A;  3M85 A;  1ESF A;  3MC0 B;  3EBE A;  2B3G A;  2E2J H;  1QVC A;  1SNP A;  1NMF A;  2L5T A;  2K6A A;  2XIW A;  2K14 A;  4LAA A;  2ZXP A;  3GP7 A;  1CZW A;  4AH6 A;  2JEB I;  2OTL A;  1PFB A;  1LYL A;  2R93 G;  5C0X G;  3NBI A;  4C3J G;  2E2H H;  1WD1 A;  1SJE D;  1HUM A;  4OX9 Q;  1EY6 A;  4XIG S;  1C48 A;  2BA1 A;  1PH1 A;  3K58 A;  4EQP A;  5KYI A;  1WYD A;  2N8N A;  3S2H B;  2LFN A;  5GQO A;  3CKI B;  1OO9 B;  3RZO B;  1ONL A;  1HZC A;  2E76 C;  4KHZ A;  2UXB Q;  1X3F A;  2EVB A;  1AEX A;  3HOY G;  1TKW B;  3F8T A;  1G8Z D;  2BDN A;  1S40 A;  4K5V A;  4JBM A;  1OTC A;  2K1B A;  2AWN A;  1F9R A;  5AJ3 Q;  3ERS X;  3RZD H;  1M8A A;  2JA7 B;  5C4J B;  2PPB C;  1L1O B;  1STH A;  4HTH A;  1HA5 A;  2E2I H;  4QIW B;  3MFG A;  1O7I A;  2K5Q A;  4C3I B;  2LY7 A;  4JOI A;  1B3Q A;  1XMO L;  1KL9 A;  5IP7 H;  2IW3 A;  4GKK Q;  2VQF Q;  1EOT A;  4UAI A;  3GTJ B;  3U9S A;  4DUY L;  5COR A;  1VQ5 A;  2WAC A;  4A3B G;  5FO8 B;  1KTK A;  3RR5 A;  5LMN Q;  4QY7 A;  2XVS A;  2D9U A;  4CJ1 B;  5IT9 E;  2K50 A;  3OHX C;  1OXX K;  1J5E L;  4MTN A;  1SAP A;  4YY3 L;  1YIT A;  1AH9 A;  3D6C A;  1NE3 A;  2XTI A;  1SE3 A;  4K2L A;  4HID A;  2F1M A;  4TVA B;  5KNB A;  2EYH A;  2HDM A;  2OXP A;  1PHJ A;  4A93 G;  1VQC A;  5IYC G;  4ILW A;  3HOV B;  4HR7 B;  3EJI A;  1CI3 M;  1MKH A;  4RWS C;  4C3H H;  4A3E B;  2UUC Q;  3T56 B;  3FP9 A;  2L1B A;  4OON A;  4KY7 A;  3SHL A;  1YHQ A;  2L4N A;  4ABN A;  5M3F H;  2NVT H;  4YHH L;  4RCO A;  3D4W A;  2XSC A;  4YCW A;  1V1P A;  5KNC A;  2F0U A;  3AFP A;  5C4Z A;  1OXU A;  5CV9 A;  4IQZ A;  5IYD G;  2ZXR A;  1XNQ Q;  4ZQ3 A;  2EY2 A;  1Q90 A;  4OHJ A;  1HR0 W;  4IUR A;  4UY8 C;  1K83 B;  1CA6 A;  4OWW B;  2HIX A;  1DCZ A;  1PLF A;  3J81 c;  1B9M A;  3A5Z B;  2JA5 B;  1KRS A;  3GTK B;  1TWC H;  5IIF A;  1EWI A;  1TWA H;  2ZJQ A;  3PO2 H;  1PXU A;  4ZUJ A;  4R4I A;  4LF9 Q;  2RHS B;  3S17 H;  3E9H A;  5M3M B;  4HJ7 A;  4EQO A;  1YHA A;  1VMC A;  3D3R A;  4DV5 Q;  4NW2 A;  1EYD A;  1SYE A;  1AZQ A;  3GTP B;  1SRO A;  4DR6 L;  4ZYS A;  4DR3 L;  1B3A A;  4A3I G;  5D3D A;  2JJQ A;  4LFB Q;  3FKI H;  3S2D H;  2RSN A;  5G3L D;  3M4O B;  1FD7 D;  1BDO A;  1YNJ D;  5M5X H;  5BR8 L;  3RLO A;  1K0S A;  2AMC B;  2KJX A;  2L15 A;  4LUV A;  3CPW A;  3G71 A;  1D5M C;  3VR2 A;  5I9O A;  3RZO H;  3Q24 A;  3M9B A;  1IXR A;  3HFZ B;  1VQH A;  2K05 A;  5C0X I;  5JEA G;  1HZB A;  2ZM6 L;  5EPL A;  1KXL A;  3NUC A;  1RTO A;  2UU9 Q;  1PRT B;  5IGD A;  3TS2 A;  1PH8 A;  1PH9 A;  3W3A A;  2JA7 H;  3CRL C;  3HKS A;  3RLF A;  1YNX A;  2L11 A;  2MPM A;  3VA7 A;  1N32 Q;  5M5Y B;  2K5W A;  4UP9 A;  3BVG A;  2KHI A;  5JJL A;  1V1P B;  1D8L A;  2RDH A;  4DNR B;  1SNC A;  4HJ9 A;  4IUT A;  5D14 A;  3TP5 A;  1EL0 A;  2HHH L;  3I8Z A;  3ERO A;  1WTP A;  3EA6 A;  3TRZ A;  1KNA A;  2MGS A;  3NWS A;  1S5C D;  1YNN D;  2C9O A;  2PNH A;  4JBW A;  2KUM A;  3FHW A;  3I72 A;  1HNW L;  4DV6 Q;  3A8K E;  5GAG C;  2VUM H;  1Y8O B;  3NHH A;  3I4M B;  4P73 A;  4OO1 G;  4GLV B;  4B3R Q;  3CQZ B;  2IL8 A;  4C2M B;  5C0X J;  1K8G A;  5F2D A;  1CKM A;  4XQJ A;  4N9T A;  3H15 A;  3H3V H;  4PV1 C;  4KJN A;  4DV4 L;  2A6H D;  2N3S A;  3OTO Q;  4A3E H;  1HZ9 A;  3CU7 A;  5JJZ A;  3UDI A;  3VR6 A;  2B2V C;  3CF5 A;  4CDC C;  3BS1 A;  2KCT A;  1BCP B;  1A0I A;  1FNU A;  2BH8 A;  4KKU A;  4Q5V A;  1VQA A;  2F0Q A;  4DA2 A;  4DXF A;  1OXS C;  3L7Z C;  4IOC A;  1I5F A;  1SRU A;  2HCC A;  1CQV A;  3WDN A;  2EJG C;  2ES2 A;  4PQX A;  3U50 C;  3GO5 A;  2H1E A;  4DV1 Q;  4LF8 L;  2RCN A;  1PFN A;  2F0M A;  4KY5 A;  1SYG A;  2EYJ A;  4GLA C;  4X66 L;  1BBW A;  1MBY A;  3K7A B;  4E6I A;  4BBS H;  1SDF A;  3BZC A;  3CPF A;  3LNN A;  5M3M H;  4YCV A;  4LJZ C;  1J8I A;  1HQM C;  1ZYR C;  5EKL A;  3C3L A;  1UE7 A;  3GTP H;  2UXC Q;  5LL6 X;  2I0Q A;  5FJ8 H;  4FP5 D;  4JC0 A;  2B2U A;  4B3T L;  1B1Z A;  3J7A F;  1J9O A;  2L0C A;  2CWA A;  5DM6 3;  3H0G H;  5FKA C;  1N33 Q;  3PUY A;  3UDG A;  3A0J A;  5CV4 A;  4DR2 L;  2KBN A;  2D0P A;  3A56 A;  1BF4 A;  2PI2 E;  4IZ8 A;  1WTV A;  4K6L A;  3VR3 A;  5J22 A;  1D1I A;  1L0X B;  1DJR D;  1ILQ A;  2GVA A;  3OMG A;  1VQN A;  4DUZ L;  3T1H L;  1Q3L A;  3LWU A;  1B4O A;  2M00 A;  4ZRZ A;  3IL8 A;  4CKE A;  4RH6 A;  3CC2 A;  1W6K A;  3RN2 A;  1T9H A;  1VQO A;  2B29 A;  2K03 A;  1I4Q A;  1Y1W H;  3KLR A;  3T16 A;  1JWU D;  1KDB A;  1PRT D;  5EKK A;  2EY6 A;  1E2W A;  1Q1B A;  1IW7 D;  3A7L A;  3KLS X;  3T4A C;  4LFA L;  3HOX H;  4FF3 A;  3E0E A;  4HJ8 A;  1NR4 A;  3TDQ A;  2XRS D;  1DYQ A;  4Y7N H;  1QZG A;  1KNE A;  2F0D A;  3EN2 A;  4IUQ A;  1U4L A;  2CH4 A;  1HTL D;  1E22 A;  1HTP A;  4G7O C;  1K8O A;  1R9T H;  5LL6 S;  1D5X C;  1K3R A;  1SFO B;  4B9W A;  5D65 A;  4A3D G;  1IL2 A;  2TSS A;  4JI5 Q;  1FGB D;  1HXY D;  2H4O A;  5EPJ A;  2XNA C;  4MIU A;  4QB4 A;  2B63 G;  3G7L A;  1TS5 A;  2A6E C;  3KF8 B;  2DUD A;  1SND A;  1WCM G;  2B2V A;  4C56 C;  3NXW A;  2EDG A;  3MXU A;  1BBX C;  3CQZ H;  4CKC A;  3ULL A;  1VF5 C;  1N34 Q;  3FMC A;  4OGQ C;  3NEN A;  5IP9 G;  4K0K L;  1KAW A;  3BDL A;  2WKC A;  4Y52 H;  3DHQ A;  2J7Z A;  1HRJ A;  3S14 H;  4KJO A;  1VQI A;  4JI4 L;  2RCF A;  4RKB A;  1F2M A;  3PCO B;  4POF A;  4OO1 I;  3A8J E;  4H13 C;  1AE3 A;  3ER0 A;  2G5D A;  5JEA J;  2R93 B;  1E2V A;  4A3G H;  4C3J B;  3KFU A;  1U5K A;  5EAY A;  2K32 A;  4DR7 L;  1LT5 D;  3DEO A;  1PH6 A;  2CFM A;  3K81 C;  1PVO A;  5L37 A;  3W5O A;  4HN7 A;  4A3M G;  4A3F G;  4R4O A;  3RLN A;  1P8L A;  2HDL A;  4DR4 Q;  3CCM A;  1I50 H;  2F4I A;  4K5X A;  4RCN A;  3HKZ G;  3MFY A;  4AQY L;  1I94 Q;  2N49 A;  5FO7 B;  4RFB A;  3HOY B;  4GN5 A;  1GM5 A;  1IYJ B;  1RIP A;  1JT8 A;  5C5M A;  5ISR A;  1L1O C;  2NUC A;  4GOP A;  1B44 D;  3R93 A;  3BYY B;  3GTO H;  2PW5 A;  1ZEQ X;  3A74 A;  2LXJ A;  4MHE A;  3G4S A;  1W2B A;  3IAY A;  3J81 L;  2VB3 X;  1BXT A;  1SYB A;  3GTL H;  1X3Q A;  3SDZ A;  2KED A;  3PIP 3;  5LMU L;  3L0O A;  2NB0 A;  4X65 L;  4RHS A;  1A63 A;  1R4P B;  1TWG H;  3I4O A;  2WAQ E;  4DR5 L;  1AFP A;  2JE6 I;  5J39 A;  4RHR A;  4DR1 Q;  4LMQ D;  4A3K G;  1XTC D;  4A3B B;  3IFD A;  3E9I A;  1NNX A;  3VYS A;  4BY1 H;  2IT1 A;  4JK1 C;  3TP8 A;  4NXM Q;  1RDP D;  5T1G A;  1Q81 C;  2F0P A;  4RGN A;  4JI3 L;  2B8G A;  4HAE A;  4IFD G;  2RBM A;  2VZA A;  3KBG A;  1II3 A;  1SJH D;  5JPM C;  5DM7 3;  2NTT A;  1IBM L;  1BCP F;  2XWB B;  3CCQ A;  2IHE A;  4DV7 L;  4J6H A;  4B3S L;  4A93 B;  1L0W A;  5IE8 A;  4DAY A;  1BUV T;  4LK1 C;  4RAU C;  1FJG Q;  3NEL A;  3L9A X;  1PH3 A;  1PMR A;  2PMZ B;  1F2Y A;  1JE4 A;  5IYB H;  4JI2 Q;  1X32 A;  3C1F A;  4KMU C;  4L5R C;  1RCV D;  3D4D A;  5C3E G;  4KHV A;  1F9S A;  4X3S A;  4ODG A;  5ELD A;  2LSS A;  3HEJ A;  1MIU A;  2BCO A;  2O5I C;  1D7Q A;  2KEE A;  1C9O A;  1V1O A;  5FK9 C;  1VQF A;  1TY2 A;  4GOP B;  2AHO B;  1PTO H;  3DMU A;  2KEC A;  4BXX H;  1I6H B;  5CYU A;  1EYG A;  3MA2 B;  1Z6H A;  3PMF A;  2Z9H A;  4OXP A;  1BR9 A;  3OSO A;  1AP0 A;  4PNY A;  2QGQ A;  4U67 3;  2K4K A;  4DN4 M;  1EIG A;  2R93 H;  2L12 A;  5IWA L;  1W3S A;  4A3I B;  1GJX A;  2OTJ A;  4JYA Q;  1WTX A;  1EEF D;  4X64 L;  3P1H A;  4LFC L;  1E3P A;  1I4P A;  1NY4 A;  4NPS A;  4JI7 L;  1VQM A;  5JOB A;  3K57 A;  1QNK A;  4Z9C B;  1VS0 A;  2YV5 A;  5M5W H;  1L1O A;  4M1U B;  1EU3 A;  4DAM A;  1O80 A;  4MN3 A;  2AQ1 B;  4DV3 Q;  2DNC A;  4X3T A;  2EOT A;  4K8I A;  3H94 A;  3T53 B;  1PDQ A;  3PUX A;  3K5L A;  5GAD C;  1HNX L;  1EQV A;  2AUK A;  3HOY H;  1KLG D;  1EZ8 A;  2F0S A;  4A3J G;  1O7Y A;  5JPN C;  1RHP A;  2PNR C;  2XWJ B;  4LF6 Q;  4XXE A;  4OIK A;  4UPA A;  1B53 A;  1E7Z A;  4GKJ L;  4DAY B;  3PIO 3;  5FOB B;  1TWH H;  4JPB W;  4DV0 Q;  5BN3 A;  1N36 Q;  2ICE C;  1QB5 D;  5ELN A;  3CW2 C;  2YTY A;  1CKO A;  5DLQ E;  4BY7 G;  1STG A;  3EFX D;  2R61 A;  4QGU A;  1U4R A;  1HPC A;  3NPP A;  3P75 A;  2A69 C;  3RMH A;  1JQY D;  3J81 E;  3I73 A;  4Q0F A;  1QJO A;  5I6W A;  1LV9 A;  1ENA A;  3NQI A;  2I5H A;  1OXT A;  5I2X A;  1SBB B;  1Y1V G;  2K5H A;  3E6Z X;  1JIC A;  2LXK A;  3NTI A;  2ENB A;  3BYT B;  2VQE Q;  2WAQ G;  1NUC A;  3NP8 A;  3RN5 A;  3CME A;  4UP7 A;  4R1J A;  2EJF C;  1MGS A;  1WTR A;  4POG A;  3MEF A;  1BCP C;  1F77 A;  2FHT A;  3T1Y L;  5C44 H;  1HH2 P;  3R3O A;  2JP1 A;  2F0G A;  1QWY A;  4JI8 L;  1XNR Q;  4DV2 Q;  3M3Y B;  3BVM A;  4LF5 L;  2E8G A;  2UXD Q;  3PV0 A;  3TN2 A;  1E1O A;  5KRU A;  1IBL L;  4IFD I;  1EYA A;  2Z4I A;  1A3T A;  1ZYR D;  2DNE A;  1B9N A;  1TU2 B;  1YVC A;  4HJ5 A;  1X6O A;  3AFQ A;  4LW1 A;  2WII B;  3L3O C;  3OWF A;  3GV3 A;  2Y0S G;  3PO3 G;  1XMQ L;  2F0T A;  4FO2 A;  1N8R C;  4XT1 B;  1VQ8 A;  4CGY B;  4B9X A;  1HUN A;  2D0O A;  2JA8 G;  4GLX A;  1VQG A;  3QWN A;  2BE5 C;  1J6Q A;  1LAC A;  1TT2 A;  1O78 A;  2E75 C;  3PSI A;  4M8A A;  1Q8K A;  1BBU A;  4N8F A;  2K52 A;  1Q46 A;  3I4N H;  3T51 B;  1F9P A;  3Q6S A;  1PH4 A;  3B6Y A;  2ALY B;  1EFI D;  3TQY A;  4A3I H;  4CKB A;  4X3K A;  1GVP A;  3SK8 A;  1YIJ A;  4IPC A;  4CDE C;  2R7Z H;  1Q82 C;  4PMC A;  2A68 C;  3QG1 A;  4IFD J;  2V1C C;  5E1F A;  2H5X A;  4IPG A;  3LGJ A;  4OX9 L;  2Z0S A;  1V9P A;  1HR0 Q;  1B50 A;  1UE5 A;  2EJM A;  4KHP Q;  4XTC S;  3S1Q H;  3CCU A;  1XWE A;  3C1E A;  3DM3 A;  1S5F D;  4QIW E;  1F2L A;  4J1M A;  5H1S E;  3ULJ A;  1A3V A;  4ME3 A;  4B3M Q;  4JBJ A;  1EIF A;  2UXB L;  3D0F A;  4TQU S;  3G6E A;  4F7X A;  3OPO A;  2A6E D;  3OMC A;  3HG9 A;  4ALP A;  2AUJ D;  4HMI A;  3GTG B;  2C35 B;  5AJ3 L;  4AIM A;  2YYZ A;  1U4M A;  2EYO A;  1Z47 A;  1EQT A;  1VQE A;  1PZK D;  1LUZ A;  4JI1 Q;  4GNX C;  3HOU G;  5K36 H;  5IP7 G;  2F4V Q;  4BBR G;  2QIL A;  3FEW X;  4ID6 A;  1A3U A;  3D31 A;  4P71 A;  4GKK L;  3D6W A;  3MXN A;  3L2P A;  4J8Q A;  1IBK Q;  3F2U A;  2VQF L;  2A73 B;  1JWM D;  2C5C A;  3NSW A;  4JCV E;  4L8J A;  4P72 A;  1MSH A;  2B63 B;  4ZUI A;  2WP8 J;  1WCM B;  3S2H H;  3S9W A;  3G48 A;  1M90 C;  4DAP A;  4AYB E;  1YZ6 A;  2EPB A;  4A3C G;  3S16 B;  5LMN L;  3RNU A;  3BDC A;  2B2U C;  4JG2 A;  3F1Z A;  3LWE A;  1LAB A;  4P75 A;  2J0T D;  3I2Z A;  4HED A;  3CCR A;  3M3Y H;  1K0R A;  2RSO A;  4QMG A;  4FDB A;  1SEB D;  4C3H G;  2KA7 A;  1SNQ A;  5C4J H;  2NN6 H;  5I4D A;  2UUC L;  1U9R A;  4C3I H;  2PQA A;  5M3F G;  2Q2T A;  2WFW A;  3TME A;  5I9P A;  4LF4 Q;  3HOW G;  3CCV A;  1FVI A;  2IHF A;  3OYY A;  1EIH A;  4UP8 A;  3K0Y A;  4GN4 B;  1FNV A;  1BQQ T;  3GTJ H;  1XNQ L;  4A3M B;  3GQB A;  1H9M A;  4XYQ A;  4A3F B;  3WOF A;  2E74 C;  4H02 A;  2QDB A;  1SR3 A;  2RKS A;  2PO4 A;  1EOV A;  2CHB D;  1DM0 B;  1STB A;  2NVX B;  3AMU A;  1T5X D;  3HKZ B;  2EIF A;  2G9D A;  2OCE A;  1DGS A;  1JMC A;  4O42 A;  3IFT A;  3PO2 G;  3S15 B;  5NUC A;  1LTL A;  3OOC A;  4QQB X;  2CQA A;  1QIL A;  4L5Q A;  2HQL A;  3R2T A;  4LF9 L;  3ICE A;  1TS2 A;  4QL5 A;  1NCV A;  3J80 c;  4DV5 L;  1ET6 A;  3PIP A;  3HOV H;  5KIX A;  5JAV A;  3MXN B;  3SXH A;  2F0F A;  1FL0 A;  2OQ0 A;  1YHB A;  4TKO B;  1I3Q B;  3FKI G;  5CV7 A;  1CSQ A;  5ELO A;  1G51 A;  4LFB L;  3URY A;  4EX5 A;  2N88 A;  5FLX c;  1TY0 A;  1PH5 A;  5EKI A;  1GO3 E;  2JA6 B;  2Q8T A;  4K14 A;  4A3K B;  4G57 A;  2WKD A;  1F9Q A;  1NTG A;  4GNX A;  1K83 H;  3VYR A;  4DGZ A;  1A6X A;  2UUB Q;  2JA9 A;  3S1R B;  2JA5 H;  4R9W A;  2KCN A;  3TZU A;  1U4P A;  2Z6K C;  3OIQ A;  2UU9 L;  2QCP X;  2FIN B;  4ZLT F;  2E5L Q;  3GTG H;  3KF8 A;  4LUZ A;  3GTK H;  1SYC A;  1XYI A;  1DOK A;  1VQK A;  1HQR D;  1TWF B;  4IUN A;  3CD6 A;  5CBA E;  1WTQ A;  2DGY A;  1XX8 A;  1DXM A;  5KGU A;  2M2L A;  1S3O A;  2PQA B;  1N32 L;  2SNM A;  5JJI A;  4WRD A;  2QEX A;  4JI6 Q;  1LTI D;  3I91 A;  2N55 A;  3BJU A;  4JI0 Q;  4RA8 A;  5C3E B;  3VYT A;  2IY5 B;  2CH4 W;  3M4O H;  4X62 Q;  5HGQ A;  1SMX A;  2IX0 A;  1UNS A;  4MTK A;  3E0J A;  4MNO A;  3MWY W;  2FJ2 A;  5DNF A;  2YU9 B;  2DJF C;  4LF7 Q;  1UE6 A;  2VUM G;  3CHB D;  4S3S A;  2B2W C;  1GUG A;  1EQR A;  2DN8 A;  2VW9 A;  4DV6 L;  3NE5 B;  4GOP C;  1JR0 D;  3UDF A;  3KOJ A;  1EY8 A;  1UE1 A;  2F0V A;  4CDF C;  1GHJ A;  5IGB A;  4DXG A;  4B3R L;  1VQ7 A;  2F0N A;  1EY0 A;  5IGF A;  1XPO A;  4KTA A;  3SK6 A;  3IRB A;  1XXG A;  4AYB G;  1VCI A;  2HIV A;  3I3C A;  3OTO L;  4ZAI A;  1P16 A;  3Q8D A;  2K5V A;  5M5Y H;  3ZJY C;  2EY5 A;  3MXP A;  3EQL C;  2IJ0 A;  1LM0 A;  4KK7 A;  2RQX A;  1IZ6 A;  5JJK A;  1UUP A;  2JEA I;  3G6J B;  4L5T A;  4O0A A;  3SGI A;  1HJP A;  3UDX A;  5EPK A;  2JSO A;  3Q22 A;  1OXV A;  2FFK B;  4CJ0 B;  4V0B A;  4GNX B;  4EGV A;  2MO1 A;  4CBV A;  3CMA A;  1SE2 A;  2FXQ A;  4DV1 L;  2A69 D;  3JC6 6;  2TMP A;  1RJT A;  4R4T A;  3I4M H;  5DAU A;  2YTV A;  3S15 H;  2P5Z X;  4FF2 A;  1EIY B;  3SVM A;  4A3J B;  2EXZ A;  3PIO A;  4BBS G;  3ERQ A;  1CSP A;  5ELC A;  5CMD A;  4C2M H;  3BDO A;  5M9O A;  2WB1 E;  3NTK A;  1RF2 D;  1K73 C;  3NEM A;  3PUV A;  3TZD A;  5GRO A;  4RGO S;  2R3Z A;  5FJ8 G;  2OF1 A;  2UXC L;  1SLJ A;  4A3L G;  4KN7 C;  5EBC A;  4BY7 B;  1PYS B;  2QF7 A;  3H0G G;  3R8B A;  3STB C;  4XYO A;  1NMG A;  3CCL A;  2Z1C A;  5BN4 A;  1N33 L;  4TSS A;  1BCP D;  2DY7 A;  2Z6K A;  3TP7 A;  1SXT A;  2D62 A;  1UEB A;  1HNZ L;  2JA6 H;  3K59 A;  5BN5 A;  4DAV A;  3GTM B;  5E4W C;  1Y69 U;  1Y1V B;  1JE5 A;  2YTX A;  1Q1E A;  2JN4 A;  1PV4 A;  5ELB A;  2MQH A;  4KI0 A;  1B8A A;  3OW2 A;  2R92 G;  2WAQ B;  5J3B A;  3OW7 A;  2ID0 A;  2I5L X;  4A76 A;  1Y1W G;  1DOM A;  5FLM G;  3PGZ A;  3K7A H;  4IAL A;  1HFN A;  2RDG A;  3NQT A;  1CKN A;  3TS0 A;  3HOX G;  3U58 A;  1Y8N B;  1WD0 A;  1GXD C;  1YJ9 A;  1JOO A;  1UAP A;  4JVZ A;  2B2W A;  2L9H A;  2XGT A;  2BE5 D;  2ZTD A;  4YCU A;  3CCE A;  1Q8I A;  2Z8L A;  5C3E H;  4KKT A;  1X3G A;  2CKZ B;  1ML0 D;  4JV5 Q;  1I4R A;  2JQO A;  2IWH A;  2NZ1 D;  3TEH B;  2YU9 H;  1T5E A;  2CVR A;  4JI5 L;  2Y0S B;  3PO3 B;  1SNM A;  1S4Z A;  3QB3 A;  2A68 D;  3GD7 A;  4HCE A;  2JA8 B;  1DOL A;  2N78 A;  2Q2I A;  4DK1 A;  1EWH A;  1TVX A;  2PYK A;  1IKL A;  3A7A B;  1DD2 A;  1N34 L;  2JK8 A;  2FMM A;  4IN3 A;  3MVV A;  5GAE C;  2E2J B;  1LTS D;  5EQ0 A;  3NBH A;  3GTQ B;  1LT4 D;  3AB9 A;  4F87 A;  3JAM c;  4LFC Q;  2F0J A;  3CXC A;  4G7Z C;  1H9J A;  4JI7 Q;  4DPG A;  3VYU A;  1BVS A;  3K5M A; 
#chains in the Genus database with same CATH homology
 2E2H B;  4B08 A;  2WV6 D;  2A5H A;  1STN A;  1HFG A;  2F3W A;  1SYF A;  2Q8I B;  1G6Z A;  1I4H A;  3V05 A;  5EJW A;  2BDO A;  4CHT B;  3V2T A;  3ND8 A;  2ICI A;  3ONA B;  3SK4 A;  5A35 A;  1LTR D;  4FF1 A;  3FPP A;  4RGT A;  3AU7 A;  1WTO A;  1FYC A;  3FDT A;  3K6O A;  1KDA A;  2E2I B;  3HOU B;  1FR3 A;  4BBR B;  3I90 A;  1V43 A;  5ELE A;  5C0X H;  4DFA A;  2EYF A;  2JYO A;  2VB2 X;  2A74 C;  2MP1 A;  4ULL A;  4O1N A;  3J80 L;  1GOZ A;  2BOS A;  4KN4 C;  1ET9 A;  2HQE A;  1TR5 A;  2L55 A;  2D2C C;  2EYL A;  5IOD A;  5FLX L;  1ICW A;  2QKI C;  1I4G A;  1C4Q A;  4QUF A;  4C3H B;  1KAA A;  2WIN B;  3S1N B;  2SNS A;  3H91 A;  4BS9 A;  5M3F B;  2NVT B;  2Z4H A;  1O7L A;  3HOW B;  3PUW A;  4N9P A;  2MUY A;  1A2U A;  3DWA A;  4GZY C;  2B39 A;  3NK9 A;  1STA A;  4X3U A;  2AQ3 B;  5CV5 A;  4HSV A;  1IYV A;  3MXG A;  3PUZ A;  1TWC B;  3PO2 B;  1STY A;  1TWA B;  4NDX A;  4NMZ A;  1CZG A;  1A2T A;  4C1N K;  4EQN A;  2IPK D;  3TSS A;  3S17 B;  1CHQ D;  1I4X A;  3HRZ C;  3DXJ C;  4HSP A;  3X3N A;  2KQ3 A;  3QOJ A;  3HZX A;  2AWO A;  2ZT9 C;  3DEP A;  2F3V A;  3J7Y W;  3FKI B;  3S2D B;  2F0E A;  1JOQ A;  5M5X B;  1PTO F;  3MTS A;  4XT3 B;  4WOR A;  3SE0 A;  3TBI B;  1IL8 A;  5AFW A;  5D3I B;  3NWT A;  3J7A V;  1A15 A;  3E5S A;  1PYW D;  2K7V A;  1LTG D;  5IGC A;  2KHS A;  1IHZ A;  3U9O A;  2LKV A;  1AZP A;  1ZKO A;  2PZW A;  1KDC A;  4I65 A;  4DK0 A;  1IKM A;  1NR2 A;  2FMC A;  3OWE B;  3TP6 A;  5C4H A;  4FF4 A;  4KD3 A;  4DNT B;  3M7N A;  1CFM A;  1LTB D;  4V19 0;  2VUM B;  1O7Z A;  1SMY C;  3C2P A;  1BO0 A;  5K5P A;  3J80 E;  5JEA H;  4KKS A;  2K01 A;  3X3M A;  2V4D A;  4KD4 A;  4RGM A;  2IX3 A;  1WVL A;  4AYB B;  3KLS A;  1JC7 A;  3DM1 A;  2O2L D;  5FLX E;  5A2Q L;  1GUT A;  4QCL A;  5I6Y A;  1BOS A;  1EEI D;  5C5L A;  3CRK C;  3WOE A;  4R8I A;  4HCS A;  4P2C B;  4OIJ A;  3A54 A;  4IUU A;  1E0B A;  1QG7 A;  3BG3 A;  4A3D B;  2PW7 A;  3DUZ A;  3KBX A;  3QJY A;  3SR1 A;  2O5J C;  2SOB A;  4OO1 H;  3OIP A;  2NVY B;  4K5W A;  4BBS B;  4KY6 A;  3FRP B;  2RDF A;  4YIJ A;  1GUO A;  4BWG B;  3H0G B;  3VA5 A;  1JWS D;  2IX1 A;  4XDX A;  1ZXT A;  1VDZ A;  2EYP A;  4BA1 I;  2ZXO A;  1KAB A;  5E4X A;  1PTO C;  2OEO A;  1EYC A;  4WJW A;  2VNU D;  2EY1 A;  3JAM L;  3VR5 A;  1MI2 A;  1QE6 A;  1HA6 A;  4KV6 A;  2R92 B;  1Y1W B;  4L6T B;  1LLR D;  5LHY 1;  1LTT D;  3HOX B;  2F0L A;  2J4X A;  2HCI A;  1GHK A;  1X3P A;  1B2T A;  3QIA A;  4Y7N B;  5TSS A;  2HUG A;  5K36 G;  1CK1 A;  2PCF B;  2QEJ C;  1CHP D;  1JOR A;  2NWG A;  1R9T B;  2SDF A;  1EY5 A;  2AQ2 B;  4I7Z C;  5E3F A;  2RVL A;  5CV6 A;  3SK5 A;  4L63 B;  2X6G A;  3MAQ A;  4NP5 A;  4K6D A;  1Z7T A;  2X6L A;  2F0K A;  4IUP A;  2KCC A;  2MJ8 A;  1AW7 A;  4OL7 A;  3UI2 A;  3W2D A;  1ENF A;  5KEE A;  2CW0 D;  4FYD A;  1HHV A;  2Q8R E;  3T13 A;  5IOC A;  4F88 A;  3DWQ A;  1STE A;  5G3L F;  3S14 B;  1MSG A;  5EBD A;  3FPU B;  4R8N A;  1H9K A;  3HP3 A;  1CT1 D;  1KLU D;  2NN6 G;  5A2Q E;  2K04 A;  3ND9 A;  4C3I G;  4A3G B;  5KYL A;  1L0Y B;  4G7H C;  2E2D C;  2O4X A;  4ZKC B;  1H9S A;  3MHB A;  1D6E C;  2K28 A;  3BVZ A;  1JCK B;  2NVQ B;  1I50 B;  1QNU A;  2I46 A;  1SYD A;  5ELF A;  3RD4 A;  2LS0 1;  3I70 A;  5CC4 A;  5JVH 3;  4DU9 A;  4ZKB B;  5J1Z A;  3P20 A;  2LMC B;  4C1N I;  3GTO B;  1CM9 A;  2EYM A;  1RKN A;  5JVG 3;  5C6A A;  2B2Y C;  1JOK A;  2WB1 B;  3A55 A;  3HOZ B;  4BA2 I;  3GTL B;  1SNO A;  1EZ6 A;  1VF7 A;  1GUS A;  1JB3 A;  1TWG B;  2VXW A;  1NAP A;  5CV8 A;  3HGB A;  1TII D;  5HUR A;  1SSO A;  1TS4 A;  1K8M A;  4QF4 A;  4H44 C;  1MD2 D;  4BY1 B;  1LT6 D;  3KUP A;  3JAM E;  2F03 A;  4XQN A;  1EY9 A;  1ROD A;  4FXD A;  5DEH A;  2K33 A;  2PZU A;  1NSN S;  4QUC A;  2RA4 A;  3O13 A;  3QOL A;  5KND A;  2OT2 A;  2KOL A;  2D5D A;  5IGG A;  1G29 1;  3ITP A;  2GA4 B;  3VR4 A;  1ILP A;  2B2T C;  3DWP A;  2I07 B;  2NBF A;  1H9S B;  1EWC A;  3D4R A;  5CGK A;  3IKJ A;  3N52 A;  1AN8 A;  4NKL A;  1I6V C;  1HCZ A;  1PTO B;  3RUZ A;  4IFD H;  1TQO A;  3K5N A;  1F2Z A;  3MZ5 A;  1SE4 A;  1W6J A;  1YNJ C;  1VMP A;  5C4X B;  3R2I A;  1R4Q B;  4PMW A;  4K8J A;  4UDU C;  1D5Z C;  1G2S A;  1Q12 A;  1EY7 A;  1G2T A;  5CR3 A;  5M5W B;  1TS3 A;  4H7B A;  1PRT F;  3A8I E;  2NN6 I;  1EU4 A;  2B2Y A;  1GUN A;  1H9R A;  2SEB D;  2MHV A;  1E2Z A;  3M7G A;  3S1M B;  1UEA B;  2XRQ D;  4PMB A;  2JXM B;  4WFN 3;  4EVO A;  3MEH A;  4K2K A;  3Q0A A;  1TWH B;  1SMY D;  1DZ1 A;  3GV6 A;  1YNN C;  4U68 A;  1S5E D;  4H0L C;  2NYZ D;  3HS0 C;  1GUW A;  1CA5 A;  4FXK C;  5C3W A;  2PZT A;  1WTW A;  3K5O A;  1G91 A;  1QCB D;  1RTN A;  3D8G A;  1LTA D;  2A6H C;  5IGE A;  1QOH A;  2CW0 C;  2X69 A;  3N6R A;  3SEB A;  1D2B A;  2F0W A;  3H3V C;  2K5D A;  2F0H A;  4ME5 A;  3QO2 A;  5FO9 B;  2B2T A;  2F0I A;  1LT3 D;  2R6G A;  5C44 B;  1PZI D;  4FVM A;  2KVM A;  1EY4 A;  1C8C A;  3KK7 A;  1IYU A;  3BZD B;  3Q23 A;  3RZD B;  1PZJ D;  3FVQ A;  3V96 A;  1RD9 D;  1DON A;  5HGT A;  2B8F A;  3NTH A;  3C46 A;  2DY8 A;  4F8M A;  3P7J A;  2BA0 A;  1S5B D;  5I2Y A;  1M4V A;  5IT9 L;  2M9V A;  1D1K A;  1FNW A;  1V8Q A;  4CJ2 C;  5C3X A;  4XQQ A;  1PTO D;  4RKL A;  1CQF A;  1PFM A;  2EE1 A;  3I4L A;  3I4N B;  4DF7 A;  3ZYY X;  5CBE E;  2R7Z B;  2EZV A;  1S5D D;  2XN9 C;  4TRD A;  3M4Y A;  5EGT A;  1ESR A;  3H09 A;  4FXG C;  3H6M A;  1PRT C;  4FNF A;  3S1Q B;  4ZK9 B;  1LO5 D;  1IW7 C;  2F0O A;  1CTM A;  3LX0 A;  3EVQ A;  2G9H D;  1ENC A;  4G4K A;  2PQE A;  4IUV A;  1BNZ A;  5T1I A;  1Y8P B;  4HMJ A;  5COY A;  2NTS A;  3M85 A;  1ESF A;  3MC0 B;  1SNP A;  2L5T A;  2K6A A;  2XIW A;  4LAA A;  2ZXP A;  3GP7 A;  1CZW A;  2JEB I;  1PFB A;  5C0X G;  3NBI A;  4C3J G;  1WD1 A;  1SJE D;  1HUM A;  1EY6 A;  4XIG S;  1C48 A;  2BA1 A;  3K58 A;  4EQP A;  5KYI A;  3S2H B;  2LFN A;  3CKI B;  1OO9 B;  3RZO B;  1ONL A;  4KHZ A;  2E76 C;  2EVB A;  1AEX A;  1TKW B;  1G8Z D;  2BDN A;  4K5V A;  2K1B A;  2AWN A;  1F9R A;  1M8A A;  2JA7 B;  5C4J B;  2PPB C;  1STH A;  4HTH A;  1HA5 A;  4QIW B;  3MFG A;  4C3I B;  2K5Q A;  2LY7 A;  2IW3 A;  1EOT A;  4UAI A;  3GTJ B;  3U9S A;  5COR A;  2WAC A;  5FO8 B;  1KTK A;  2XVS A;  2D9U A;  4CJ1 B;  5IT9 E;  3OHX C;  1OXX K;  1SAP A;  3D6C A;  1SE3 A;  4K2L A;  2F1M A;  5KNB A;  2EYH A;  2HDM A;  2OXP A;  4ILW A;  3HOV B;  4HR7 B;  3EJI A;  1CI3 M;  4RWS C;  4A3E B;  3T56 B;  2L1B A;  4KY7 A;  3SHL A;  2L4N A;  4ABN A;  4RCO A;  3D4W A;  2XSC A;  1V1P A;  5KNC A;  2F0U A;  5C4Z A;  1OXU A;  5CV9 A;  4IQZ A;  2ZXR A;  4ZQ3 A;  2EY2 A;  1Q90 A;  4OHJ A;  4IUR A;  1K83 B;  1CA6 A;  1DCZ A;  1PLF A;  1B9M A;  2JA5 B;  3GTK B;  5IIF A;  1PXU A;  4ZUJ A;  5M3M B;  4EQO A;  1VMC A;  3D3R A;  4NW2 A;  1EYD A;  1SYE A;  1AZQ A;  3GTP B;  4ZYS A;  1B3A A;  5D3D A;  2RSN A;  5G3L D;  3M4O B;  1FD7 D;  1BDO A;  1YNJ D;  2KJX A;  1D5M C;  3VR2 A;  5I9O A;  3Q24 A;  2K05 A;  5C0X I;  5JEA G;  5EPL A;  3NUC A;  1RTO A;  1PRT B;  5IGD A;  3W3A A;  3CRL C;  3RLF A;  2L11 A;  2MPM A;  3VA7 A;  5M5Y B;  2K5W A;  3BVG A;  1V1P B;  2RDH A;  4DNR B;  1SNC A;  4IUT A;  5D14 A;  3TP5 A;  1EL0 A;  3I8Z A;  3ERO A;  1WTP A;  3EA6 A;  1KNA A;  2MGS A;  3NWS A;  1S5C D;  1YNN D;  2C9O A;  4JBW A;  2KUM A;  3I72 A;  3A8K E;  1Y8O B;  3NHH A;  3I4M B;  4OO1 G;  3CQZ B;  2IL8 A;  4C2M B;  5C0X J;  5F2D A;  4XQJ A;  4N9T A;  4PV1 C;  4KJN A;  2A6H D;  3CU7 A;  5JJZ A;  3VR6 A;  2B2V C;  3BS1 A;  1BCP B;  1FNU A;  4KKU A;  4Q5V A;  2F0Q A;  4DA2 A;  4DXF A;  1OXS C;  3L7Z C;  2HCC A;  1CQV A;  3WDN A;  2EJG C;  4PQX A;  3GO5 A;  2H1E A;  1PFN A;  2F0M A;  4KY5 A;  1SYG A;  2EYJ A;  1MBY A;  3K7A B;  4E6I A;  1SDF A;  3LNN A;  4LJZ C;  1J8I A;  1HQM C;  1ZYR C;  5EKL A;  3C3L A;  5LL6 X;  4FP5 D;  2B2U A;  1B1Z A;  3J7A F;  1J9O A;  2L0C A;  5DM6 3;  5FKA C;  3PUY A;  5CV4 A;  1BF4 A;  3A56 A;  4IZ8 A;  1WTV A;  4K6L A;  3VR3 A;  5J22 A;  1D1I A;  1L0X B;  1DJR D;  1ILQ A;  3OMG A;  1Q3L A;  3LWU A;  1B4O A;  2M00 A;  4ZRZ A;  3IL8 A;  4CKE A;  4RH6 A;  1W6K A;  2K03 A;  1I4Q A;  3KLR A;  3T16 A;  1JWU D;  1KDB A;  1PRT D;  5EKK A;  2EY6 A;  1E2W A;  1Q1B A;  1IW7 D;  3T4A C;  3A7L A;  3KLS X;  4FF3 A;  1NR4 A;  3TDQ A;  2XRS D;  1DYQ A;  1KNE A;  2F0D A;  4IUQ A;  1U4L A;  1HTL D;  1HTP A;  4G7O C;  1K8O A;  5LL6 S;  1D5X C;  1SFO B;  4B9W A;  5D65 A;  2TSS A;  1FGB D;  1HXY D;  2H4O A;  5EPJ A;  2XNA C;  4MIU A;  4QB4 A;  3G7L A;  1TS5 A;  2A6E C;  1SND A;  2B2V A;  4C56 C;  3NXW A;  2EDG A;  3MXU A;  1BBX C;  4CKC A;  1VF5 C;  3FMC A;  4OGQ C;  3BDL A;  2WKC A;  3DHQ A;  2J7Z A;  1HRJ A;  4KJO A;  4RKB A;  1F2M A;  4OO1 I;  3A8J E;  4H13 C;  5JEA J;  2R93 B;  1E2V A;  4C3J B;  2K32 A;  1LT5 D;  3DEO A;  4HN7 A;  2HDL A;  2F4I A;  4K5X A;  4RCN A;  3MFY A;  5FO7 B;  4RFB A;  3HOY B;  5C5M A;  5ISR A;  2NUC A;  1B44 D;  3R93 A;  3BYY B;  2PW5 A;  1ZEQ X;  4MHE A;  3IAY A;  3J81 L;  2VB3 X;  1BXT A;  1SYB A;  3SDZ A;  1X3Q A;  2KED A;  3PIP 3;  2NB0 A;  4RHS A;  1R4P B;  1AFP A;  2JE6 I;  5J39 A;  4RHR A;  4LMQ D;  1XTC D;  4A3B B;  3IFD A;  3VYS A;  2IT1 A;  4JK1 C;  3TP8 A;  1RDP D;  5T1G A;  2F0P A;  4RGN A;  2B8G A;  4HAE A;  4IFD G;  2RBM A;  3KBG A;  1II3 A;  1SJH D;  5JPM C;  5DM7 3;  2NTT A;  1BCP F;  2XWB B;  4J6H A;  4A93 B;  4DAY A;  1BUV T;  4LK1 C;  4RAU C;  3L9A X;  1PMR A;  2PMZ B;  1F2Y A;  1JE4 A;  1X32 A;  3C1F A;  4KMU C;  1RCV D;  3D4D A;  4KHV A;  1F9S A;  4X3S A;  4ODG A;  5ELD A;  3HEJ A;  2BCO A;  2O5I C;  2KEE A;  1V1O A;  5FK9 C;  1TY2 A;  1PTO H;  3DMU A;  2KEC A;  1I6H B;  5CYU A;  3MA2 B;  1Z6H A;  3PMF A;  1BR9 A;  3OSO A;  1AP0 A;  4PNY A;  4U67 3;  4DN4 M;  1EIG A;  2L12 A;  4A3I B;  1GJX A;  1WTX A;  1EEF D;  3P1H A;  1I4P A;  5JOB A;  3K57 A;  1QNK A;  4Z9C B;  4M1U B;  1EU3 A;  1O80 A;  4MN3 A;  2AQ1 B;  4X3T A;  2DNC A;  2EOT A;  4K8I A;  3H94 A;  3T53 B;  1PDQ A;  3PUX A;  3K5L A;  1EQV A;  2AUK A;  1KLG D;  1EZ8 A;  2F0S A;  1O7Y A;  5JPN C;  1RHP A;  2PNR C;  2XWJ B;  4XXE A;  4OIK A;  1B53 A;  3PIO 3;  5FOB B;  5BN3 A;  2ICE C;  1QB5 D;  1STG A;  3EFX D;  2R61 A;  1U4R A;  1HPC A;  3NPP A;  3P75 A;  2A69 C;  3RMH A;  1JQY D;  3J81 E;  3I73 A;  4Q0F A;  1QJO A;  5I6W A;  1LV9 A;  1ENA A;  3NQI A;  1OXT A;  5I2X A;  1SBB B;  3E6Z X;  1JIC A;  2ENB A;  3NTI A;  3BYT B;  3NP8 A;  1NUC A;  2EJF C;  1MGS A;  1WTR A;  1BCP C;  1F77 A;  2FHT A;  3R3O A;  2JP1 A;  2F0G A;  1QWY A;  3M3Y B;  3BVM A;  3PV0 A;  3TN2 A;  5KRU A;  4IFD I;  1EYA A;  2Z4I A;  1A3T A;  1ZYR D;  2DNE A;  1B9N A;  1TU2 B;  2WII B;  3L3O C;  3OWF A;  3GV3 A;  2F0T A;  4FO2 A;  4XT1 B;  4CGY B;  4B9X A;  1HUN A;  3QWN A;  2BE5 C;  1LAC A;  1TT2 A;  1O78 A;  2E75 C;  4M8A A;  3T51 B;  1F9P A;  3Q6S A;  1EFI D;  4CKB A;  4X3K A;  3SK8 A;  4PMC A;  2A68 C;  3QG1 A;  4IFD J;  5E1F A;  1B50 A;  2EJM A;  4XTC S;  1XWE A;  3C1E A;  1S5F D;  1F2L A;  4J1M A;  1A3V A;  4TQU S;  4F7X A;  3OPO A;  2A6E D;  3OMC A;  3HG9 A;  2AUJ D;  4HMI A;  3GTG B;  2YYZ A;  1U4M A;  2EYO A;  1Z47 A;  1EQT A;  1PZK D;  5K36 H;  2QIL A;  3FEW X;  4ID6 A;  1A3U A;  3D31 A;  3D6W A;  3MXN A;  4J8Q A;  3F2U A;  2A73 B;  1JWM D;  2C5C A;  3NSW A;  4L8J A;  1MSH A;  2B63 B;  4ZUI A;  2WP8 J;  1WCM B;  3S9W A;  4DAP A;  2EPB A;  3S16 B;  3BDC A;  2B2U C;  3LWE A;  1LAB A;  2J0T D;  4HED A;  2RSO A;  4QMG A;  1SEB D;  4C3H G;  2KA7 A;  1SNQ A;  2NN6 H;  5I4D A;  1U9R A;  3TME A;  5I9P A;  1EIH A;  3K0Y A;  1FNV A;  1BQQ T;  4A3M B;  3GQB A;  1H9M A;  4XYQ A;  4A3F B;  3WOF A;  2E74 C;  2QDB A;  2RKS A;  2PO4 A;  2CHB D;  1DM0 B;  1STB A;  2NVX B;  3AMU A;  1T5X D;  3HKZ B;  2G9D A;  4O42 A;  3IFT A;  3S15 B;  5NUC A;  3OOC A;  2CQA A;  1QIL A;  3R2T A;  1TS2 A;  1NCV A;  1ET6 A;  5KIX A;  5JAV A;  3SXH A;  2F0F A;  4TKO B;  5CV7 A;  1I3Q B;  3URY A;  2N88 A;  1TY0 A;  5EKI A;  2JA6 B;  2Q8T A;  4K14 A;  4A3K B;  4G57 A;  2WKD A;  1F9Q A;  3VYR A;  4DGZ A;  1A6X A;  3S1R B;  4R9W A;  2KCN A;  3TZU A;  1U4P A;  3OIQ A;  2QCP X;  2FIN B;  4ZLT F;  3KF8 A;  1SYC A;  1XYI A;  1DOK A;  1HQR D;  1TWF B;  4IUN A;  5CBA E;  1WTQ A;  5KGU A;  1XX8 A;  1DXM A;  2M2L A;  2SNM A;  4WRD A;  1LTI D;  3I91 A;  2N55 A;  4RA8 A;  5C3E B;  3VYT A;  2IX0 A;  1UNS A;  3E0J A;  5DNF A;  2FJ2 A;  3MWY W;  2YU9 B;  3CHB D;  4S3S A;  2B2W C;  1GUG A;  2DN8 A;  3NE5 B;  1JR0 D;  1EY8 A;  2F0V A;  1GHJ A;  5IGB A;  4DXG A;  2F0N A;  1EY0 A;  5IGF A;  4KTA A;  3SK6 A;  1XXG A;  1VCI A;  3I3C A;  4ZAI A;  2EY5 A;  3MXP A;  3EQL C;  2IJ0 A;  4KK7 A;  2RQX A;  1UUP A;  2JEA I;  3G6J B;  5EPK A;  2JSO A;  3Q22 A;  1OXV A;  2FFK B;  4CJ0 B;  4V0B A;  4EGV A;  4CBV A;  1SE2 A;  2A69 D;  2TMP A;  1RJT A;  5DAU A;  4FF2 A;  3SVM A;  4A3J B;  2EXZ A;  3ERQ A;  5ELC A;  5CMD A;  3BDO A;  5M9O A;  3NTK A;  1RF2 D;  3PUV A;  3TZD A;  4RGO S;  2R3Z A;  2OF1 A;  4KN7 C;  5EBC A;  4BY7 B;  2QF7 A;  3R8B A;  4XYO A;  2Z1C A;  5BN4 A;  4TSS A;  1BCP D;  2DY7 A;  3TP7 A;  1SXT A;  2D62 A;  3K59 A;  5BN5 A;  4DAV A;  3GTM B;  5E4W C;  1Y69 U;  1Y1V B;  1Q1E A;  5ELB A;  4KI0 A;  2WAQ B;  3OW7 A;  2ID0 A;  1DOM A;  4IAL A;  1HFN A;  2RDG A;  3NQT A;  1Y8N B;  1WD0 A;  1GXD C;  1JOO A;  1UAP A;  2B2W A;  2L9H A;  2BE5 D;  1Q8I A;  2Z8L A;  4KKT A;  1ML0 D;  1I4R A;  2IWH A;  2NZ1 D;  1T5E A;  2CVR A;  2Y0S B;  3PO3 B;  1SNM A;  1S4Z A;  3QB3 A;  2A68 D;  3GD7 A;  4HCE A;  2JA8 B;  1DOL A;  4DK1 A;  1EWH A;  1TVX A;  2PYK A;  1IKL A;  3A7A B;  1DD2 A;  2FMM A;  4IN3 A;  3MVV A;  2E2J B;  1LTS D;  5EQ0 A;  3NBH A;  3GTQ B;  1LT4 D;  3AB9 A;  4F87 A;  2F0J A;  4G7Z C;  1H9J A;  3VYU A;  3K5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...