4OL7A

Crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ol7A00
3OMGA 3P1HA 3TP8A 4ZUIA 1RKNA 2F0WA 2F0IA 2F3VA 2O4XA 2PW7A 2PZUA 4K8JA 2KHSA 4K8IA 3DMUA 4NP5A 2EYJA 5IODA 3D6CA 3MEHA 4ZQ3A 2F3WA 2PW5A 4MIUA 3T16A 5KIXA 3SK4A 4EQOA 2PZWA 1STYA 3P75A 4K5VA 4PMCA 3T13A 4KY5A 5CV5A 2EYMA 1EZ6A 2F0EA 2QDBA 5CV9A 3OMCA 4ID6A 4F8MA 5EGTA 5J22A 4KTAA 5I6YA 4TRDA 1SNOA 2PYKA 1JOOA 3LX0A 1ENAA 1TQOA 2EYFA 3EJIA 1EY0A 1SNPA 4ZUJA 2F0OA 4ODGA 2F0MA 1SYCA 4QF4A 4DU9A 3NP8A 3SHLA 1JOQA 3S9WA 5NUCA 5KYLA 5CV6A 3MXPA 3V2TA 4KD3A 4B9WA 3D8GA 3SXHA 1A3TA 1SYFA 1A2TA 3NXWA 5J39A 5DEHA 5ISRA 4PMBA 5JOBA 2EYPA 3ITPA 3SK6A 2F0GA 1TR5A 2F0UA 4I65A 1KDBA 3HEJA 4R8NA 5CV8A 4KJOA 3MVVA 3SK5A 4EQPA 5I9OA 2F0VA 2RKSA 3BDLA 3EROA 1TT2A 3D4DA 4DFAA 5IIFA 5IGCA 1EYCA 3E5SA 3VA5A 4B9XA 4KD4A 4KY7A 5KRUA 5C3WA 5C5LA 5KEEA 3QB3A 5K5PA 1EY5A 5IOCA 1NSNS 3D4WA 1JOKA 1SYEA 2EY1A 4KV6A 5C6AA 2EYLA 5I9PA 4IALA 2EY2A 5IGEA 1A3VA 5HURA 4K2KA 4KHVA 1JORA 3C1EA 2SNSA 4LAAA 4WORA 2HQEA 5CR3A 2OXPA 3RUZA 1STAA 3SR1A 1KDCA 2F0JA 1KDAA 2EY6A 2EYHA 3QOLA 2OF1A 2M00A 2NUCA 2PQEA 3OWFA 4K2LA 4S3SA 3TMEA 4DGZA 5IGGA 2WACA 5HGTA 2F0KA 1KAAA 1SNMA 3PMFA 5CV4A 3H6MA 2F0LA 1STNA 4N9PA 5E1FA 2SOBA 1SYDA 4IZ8A 4PNYA 5CGKA 3HZXA 3OSOA 4DF7A 2F0DA 3ERQA 3DHQA 1KABA 4KY6A 4EVOA 5M9OA 1SYGA 3BDCA 5IGBA 2ENBA 2F0FA 2EY5A 3EVQA 4HMJA 4J1MA 4KJNA 4NMZA 3C1FA 5KYIA 4K14A 1SYBA 5C4HA 1F2MA 4H7BA 2PZTA 1EY8A 4F7XA 1EYAA 5KGUA 4IUNA 1A2UA 3U9OA 3MHBA 1SNQA 1EY6A 3TP5A 2F0SA 5C5MA 5C3XA 2RDFA 1EY9A 1U9RA 5C4ZA 4K5XA 4WRDA 4N9TA 4RKBA 4NKLA 1STGA 3TP6A 5IGDA 4OL7A 1EZ8A 1STBA 2LKVA 4HTHA 1SNDA 2F0TA 5CV7A 1F2YA 3TP7A 2OEOA 5IGFA 5EKLA 1II3A 2EXZA 1STHA 2F0QA 4ME5A 3NK9A 2SNMA 2KQ3A 5EKKA 2RBMA 5F2DA 2EYOA 4K5WA 5J1ZA 2F0PA 3R3OA 3QOJA 4G57A 5CC4A 3SK8A 4NDXA 1F2ZA 4HMIA 1AEXA 4J6HA 3NUCA 1A3UA 1ENCA 1EY7A 3NQTA 4QMGA 5I6WA 4EQNA 4QB4A 1EQVA 1EY4A 4YIJA 4E6IA 1EYDA 2F0NA 3MZ5A 3NHHA 4K6DA 5E3FA 1SNCA 5DAUA 4RKLA 2F0HA 1NUCA 1IHZA 5JAVA
chains in the Genus database with same CATH superfamily
2F4VQ 4IOAA 2ZXOA 1XJVA 2NVXB 1Y69U 3CQZB 3Q6SA 2E5LQ 5JJIA 4A4IA 1STYA 4JVZA 1X56A 2N55A 1BKBA 3JAME 2NZHA 4KKTA 3TEHB 1JWUD 1J9OA 3BYTB 3X3MA 2IHEA 2Q2HA 4ODGA 1HQMC 1WTWA 1WCMH 2V4DA 4DUYQ 2UXBQ 1A2TA 3F2CA 5M3MG 3CC4A 3ITPA 5DNFA 5JVG3 1X3QA 3GTJH 1RCVD 1XMQQ 3S2DH 5IT9c 1CA5A 1YITA 1CA6A 3E5SA 4OXPA 5E4WC 1BO0A 1NSNS 2LY7A 4JPBW 3VYSA 2R7DA 5C0XG 3GTJB 3S2DB 1VS0A 1C0AA 1A3VA 3PQIA 5LHY1 4KHVA 3HOVG 3C1EA 4KN7C 2A69D 2M00A 4DGZA 2F3IA 4U673 2HDMA 1Y8OB 4AYBB 4N9PA 4RMFA 2B3GA 4KY6A 3S1QB 4BS9A 2EOTA 4B3SQ 1UEAB 1OO9B 5C4XG 3QIAA 3MFYA 2RQXA 3K81C 1PH7A 4UHVA 1VQ7A 2JA8G 5C4ZA 4ZLTF 4RKBA 2BDOA 1HR0Q 4IFDI 1EEID 3D4RA 2IX1A 2L12A 1YI2A 4FXGC 4LF7L 2ALYB 2XVSA 1OXSC 3HFZB 2CQOA 4IQZA 4JV5L 3IFTA 4LK1C 1K3RA 3A8KE 2A68D 4OELB 1PA6A 4JYAL 1EY4A 2NZ1D 1BDOA 1J5EQ 4IUVA 3I2ZA 2A8VA 3OMGA 4P75A 2YYZA 1P16A 4LF5Q 3NTKA 1QZHA 1F2LA 3F2BA 4A3EG 3RLFA 2QEXA 3P75A 2KENA 4X64Q 2E74C 4OX9L 4OHJA 1QCBD 2QDBA 3TZDA 3AMUA 1E24A 2IL8A 4JC0A 1TKWB 3I7FA 1UE1A 1TWGH 3PV0A 1WTRA 4X65L 1QILA 3DWAA 2RA4A 3SHLA 2YTXA 4OO1I 1PFBA 1RDPD 3EA6A 2YU9B 3K0YA 2K5VA 2ZJQA 1NE3A 1KLGD 1TWGB 1TR5A 4BY1H 3GTKH 2RKSA 4DFAA 1SJED 4J15A 5CYUA 1KXLA 1EIGA 3QB3A 4A3BH 4LF4L 3PCOB 4IFDG 1JOKA 2EY1A 1GKHA 2FXQA 3QG1A 2EY2A 4BY1B 3J7YW 3GTKB 4K2KA 1SEBD 1ICWA 3GTQB 1JORA 1YNXA 4RCNA 4WORA 4A3BB 2UUAQ 2E75C 4ZRZA 4IPHA 2Z8LA 3SGIA 4CDDC 3PMFA 1WVLA 3URYA 3K7UC 2EVBA 1U5KA 4C3IB 4DAMA 2ID0A 4R4CA 3FKIH 4HMJA 1IBKQ 4IUTA 2C35B 1Q8IA 3I72A 4L63B 5EJWA 2D9UA 1FNVA 4BY7G 2L0CA 1V43A 4DR7L 1PZKD 4A3MG 4OL7A 1VMPA 4HCSA 1CSQA 2Z0SA 4CJ0B 4A3JB 1D1KA 3PUVA 3HP3A 4ME5A 3NK9A 1WTOA 4BXXG 5EKKA 2CVRA 1SE2A 2E76C 3J7ZC 5AJ3L 3PO2G 4Q0FA 3UI2A 2ZTEA 3NUCA 3KDFB 1X55A 5ELNA 1QUQB 4R4OA 1GVPA 3NWSA 5IWAQ 4DV5L 2RDGA 1SE8A 3ERSX 2F0HA 4DA2A 3CRKC 3TP8A 5K36G 1RKNA 1S5CD 2F0WA 3E3XA 4DKAC 2F3VA 2PZUA 4JK1C 3KFUA 3O13A 2EYJA 3TS2A 5GADC 2LFNA 4PMCA 4DV0L 2Z6BA 4DV1L 1SRUA 1A15A 1Q1BA 4CKBA 3SDZA 1TWCH 4DXFA 4PG3A 1D6EC 4P73A 1N9WA 1TQOA 4G7HC 1PFNA 3CPWA 3DWPA 2K50A 1SBBB 1VCIA 5J3BA 1E1OA 1G2TA 1KNEA 3ND9A 1PYWD 1TWCB 1ZEQX 3S17H 2ZXPA 5J39A 4TKOB 3G4SA 1L0XB 1KDBA 1E2VA 1Q90A 1BVSA 3VR2A 2F0VA 2B2WA 3IKJA 5K5PA 3JAMi 3VR3A 2JE6I 4DK6C 1NNXA 1L2FA 5E7NA 2JEAI 4O1NA 1L0WA 4L8JA 4OO1H 1EIFA 2HQEA 4A3DG 4NXNL 1WTHA 5DM73 2PQEA 2SEBD 4Z9CB 4A3GG 1YNJC 2HHHL 1B1ZA 5CGKA 1ZYRD 2D2CC 3TZUA 3H0GG 5JEAH 2ENBA 5EAYA 2EY5A 4J1MA 3RNUA 3HOXB 3E9HA 5IT9L 3TDQA 4H02A 4QUFA 1PV4A 1VQEA 1ONLA 2DY8A 5BN5A 3UDGA 3TP5A 3T1YL 1HNXL 3JAMc 1IZ6A 3UDIA 4N9TA 3ICEA 3RLOA 4NKLA 3H3VI 1XNQL 1B3QA 1IBMQ 1XXGA 3AFPA 3LWUA 4QJFA 5CORA 2EXZA 5H1SE 4J8QA 2JK8A 3S24A 1A62A 1EOTA 4AQYL 4X66Q 1MSHA 1AH9A 3I4NH 4DUZQ 4HMIA 1AP0A 3NQTA 5HGQA 4YIJA 4KMUC 4RA8A 3QO2A 2VUMG 1SFOH 1IHZA 2LXKA 4A3CG 2LS01 3HOUG 2F0IA 3I4NB 4FP5D 5FLMG 3RR5A 1IBLL 2R7ZG 2Y0SB 4JI7Q 3T16A 2R93H 4X62L 4L5QA 4EQOA 5C3EG 1JWSD 4DV2Q 2BE5D 1SFOB 2QILA 1JE4A 4POFA 2F4VL 1ESFA 2B2VA 3I4OA 4C1NI 3OW2A 2HCIA 4F8MA 4A93H 4JI4Q 2R93B 3K57A 4TRDA 2E5LL 3CD6A 1SNOA 1SJHD 1HPCA 1OTCA 4LFCQ 1G6ZA 2J0TD 2RF4A 1NMFA 3M7GA 2EJGC 1QZGA 5D3DA 4A93B 3FHWA 1HA6A 2VB3X 2VQFQ 2HCCA 5JOBA 2ASBA 3E9IA 1M4VA 1F77A 4IURA 4IPCA 1RTNA 4DUYL 2UXBL 5C5LA 4P71A 3MA2B 1KIXA 3PGZA 3GTLH 5C6AA 3Q8DA 4JI1Q 3RD4A 5FO7B 2N8NA 4IALA 3T51B 1XMQL 1HUNA 1EUJA 5HURA 1HFGA 4ILWA 4ZKBB 5IP7H 3NBIA 3S14H 2Z9HA 3GTLB 1HHVA 4DV6L 2A74C 4S3SA 1QVGA 2JA6G 3LGJA 5HGTA 1SNMA 4MNOA 3H6MA 2FFKB 3S14B 1SYDA 1N34Q 4FXKC 3ERQA 2H4OA 3NBHB 5ELEA 2BCOA 2ZJRA 2QF7A 4F7XA 4HR7B 2AHOB 2K05A 3JC66 1IXRA 1LTBD 4GNXB 5LMUQ 5M5XH 1XX8A 4B3SL 1VQNA 3NSWA 1PH9A 1STBA 1PFMA 4HIDA 1HCZA 4LMQD 5EKLA 5BR8Q 2JJQA 3OIPA 4ALPA 2EYOA 4Y7NH 5M5XB 2EDGA 1W2BA 4FO2A 1HR0L 1XTCD 3CCVA 1AEXA 4MZ9A 1ENCA 4QQBX 4QB4A 2KCNA 1EQVA 4E6IA 4F87A 5C44B 2A73B 1DOMA 1TWFH 1SMYC 1KAWA 3BDOA 1V1PB 4K8JA 1ESRA 4BBSG 3PUZA 1YHQA 1B50A 4HIMA 1G91A 1EL0A 4GLAC 1Y1VG 2VW9A 1J5EL 1VQ6A 3BYYB 3CC7A 4LF5L 5IYBH 3CHBD 1KNAA 4LFAQ 1E7ZA 1PRTB 4X64L 2CH4W 3VDYA 1TS2A 1N36L 5IYCH 5FJ8H 4DV0Q 3S9WA 2UU9Q 5NUCA 2JA7H 1PYBA 3D8GA 1LTLA 1CZWA 3RZOH 1Q46A 4JCVE 2JA5G 3SK6A 1K8AC 3HEJA 3EROA 1FVIA 2JA7B 4YWMA 2O2LD 4KI0A 3A74A 4R8IA 3J81E 3D4WA 4BWGB 4KV6A 5I9PA 2QA4A 1L1OC 2VY3A 2EIFA 2L11A 4YCVA 4L6TB 2MO1A 1RHPA 4HSVA 2B2YC 3GTOH 2KEEA 5CR3A 4JI8Q 2OXPA 3AFQA 1I94Q 3PSIA 2X6LA 1KDAA 1Z6HA 4RFBA 3AEVA 1OXXK 5T1GA 1SE4A 3W3AA 2F0KA 3GTOB 5CV4A 4BBRG 1T5EA 5M3FH 1OXVA 2A5HA 2UUAL 1KABA 1LO5D 3BZCA 1C8CA 4AYBE 3CCQA 1LACA 1X3PA 2RCFA 2M9VA 4A3IH 3MEFA 1EFID 3WWVA 3PO3H 3CP0A 1YJWA 4C3JH 4JOIC 1CHQD 1CTMA 3TP6A 3QJYA 4C3HH 3J80E 3E0JA 1SLJA 4A3IB 2F0QA 2RHQB 1R9TH 2SNMA 3NBHA 3PO3B 4C3JB 2KECA 4NDXA 4HSPA 2DNEA 4JBWA 4DR3Q 4KKUA 2JEBI 4WFN3 1XNQQ 1HZCA 2F0NA 1R9TB 2R92B 2IJ0A 2DN8A 2K5NA 1HZ9A 2X69A 4GNXA 3Q24A 1O78A 5ELBA 1V1QA 1N33Q 1LV9A 1A6XA 2NZOA 3H94A 2EQSA 3F8TA 2XRQD 4MIUA 4A3KH 5IYDH 3PIP3 5C0XI 3BG3A 1O80A 3K5NA 2KVMA 3T13A 3WDNA 2RDHA 1GUSA 4KHZA 1EZ6A 2R61A 3RMHA 1EQRA 3EIVA 3BS1A 3DM3A 2NB0A 3P20A 5EKIA 4LF9Q 4JBJA 4XIGS 4A3KB 1SAPA 3LX0A 4YCUA 1N32Q 4RAUC 1BF4A 1YHBA 4C2MH 4I7AA 4PV1C 2IPKD 1MJEA 3SXHA 3WOEA 1C4QA 2EYPA 4NXMQ 2VZAA 2F0UA 5EPJA 3MVVA 4C2MB 3F2UA 5IIFA 2PQAB 3CCLA 1TXYA 3BJUA 2BOSA 3CW2C 1TU2B 1SROA 1BCPC 2Z4IA 2MO0A 1CK1A 4EX5A 2K75A 3HOYG 2IT1A 1C48A 4EQNA 4XDXA 3OHXC 5DLQE 1DGSA 3OWFA 1HJPA 1HRJA 2JXMB 4IPGA 1BBWA 2F0LA 2SOBA 2V1CC 2IHFA 1WCMB 2A68C 2E2JH 5IGBA 4OWWB 5KNCA 3L9AX 1ET9A 3C1FA 2AWNA 4DV6Q 1EYAA 2R3ZA 1VQOA 3I70A 3TQYA 4B3TQ 2F4IA 4GN4B 5ELDA 4RHSA 1IW7C 2E2JB 1U9RA 3Q22A 3A5UA 1HUMA 2QKIC 1IL2A 1BCPB 3MXGA 4F88A 3CKIB 1P8LA 2IX0A 1CQVA 1FNWA 2WKCA 4U68A 2L9HA 3ZJYC 1IBML 4DR4Q 3H09A 4G7OC 1RL2A 2WIIB 2X6GA 3NHHA 3R2IA 1KHIA 4DK1A 4YHHQ 4HAEA 2K5HA 2VL6A 3T53B 4X66L 4DV3Q 2FJ2A 1L1OA 4DUZL 2N49A 1PMRA 4HCEA 2F3WA 2B2YA 3IRBA 4X3TA 4K5VA 1HNWQ 1YVCA 2B29A 1NR2A 1N8RC 5BN4A 2F1MA 1I6VC 2VB2X 4JI7L 1GJXA 5M3MH 1JOOA 2LMCB 4OONA 4DV2L 1HZAA 4BY1G 1L0YB 3OPOA 1Q82C 1TY0A 2VXWA 3MXPA 1PTOC 5CV6A 4JI4L 4A3BG 1FYCA 5M3MB 3RZDH 1VQHA 4X6AH 4LFCL 5EPLA 3SK5A 4RCOA 3HOVH 1N36Q 4C3IG 5KRUA 1GHJA 1CM9A 1Z47A 4NB3A 5EBCA 2ZXRA 1PLFA 3RZDB 3KYHC 1EY5A 4WJ3M 2VQFL 1G8ZD 3GTPH 5FO8B 4UAIA 1LT4D 3EBEA 3C46A 1LTAD 1JMCA 1PTOH 1D2BA 4MTKA 1VF5C 1SDFA 1LYLA 1I50H 4FF4A 3S15H 4JI1L 3NPPA 1X32A 5C4XH 2PQAA 3DEOA 4A3JG 3AU7A 4Y52H 3S16H 1PTOB 2BH2A 2MJ8A 2JA8H 2WB1E 3DHQA 4RGTA 5T1IA 3J81i 1AZPA 1ICFB 4KK7A 2EJFC 1JB7A 2BDNA 1VQ5A 4P2CB 3HGBA 1N34L 3S16B 1EWHA 3D6WA 2JA8B 3N6RA 1KL9A 3NQIA 1WTXA 1W6JA 1I4XA 1BNZA 1CZGA 3KLWA 1GD7A 3OYYA 1KQSA 3FVQA 3HOWG 2G9HD 5LMUL 1UAPA 2F0PA 1O7ZA 4OIKA 5M5YH 4HJAA 4JI0L 3KLSA 1F2ZA 1HH2P 1HZBA 1A3UA 4A3EH 2EZVA 1CKNA 1X9NA 2NYZD 5BR8L 1K73C 3DXJC 1YNND 4IO9A 5DAUA 1B4OA 1JT8A 3NTHA 5M5YB 2IW3A 1U4RA 3OIQA 5D3IB 1AN8A 3VYUA 3J81c 3FKIB 1PDQA 5JEAJ 1B44D 1JCKB 1T9HA 3MEHA 4A3EB 1VQIA 1I4RA 3J80i 2O5IC 3HOZH 3MWYW 1RJTA 5LMNW 4BA1I 2Y0SE 2LSSA 4LF6Q 1Y8NB 3MAQA 3UE1A 1ZXTA 1F9QA 1U4MA 1FL0A 1B7YB 2EYFA 2SDFA 5IP9H 3HOZB 3DUZA 2F0OA 2F0MA 1I4PA 4DU9A 4A76A 4LUVA 2OTJA 1EYGA 4KD3A 4LFAL 1A3TA 3TRZA 4IFDH 1STEA 1Q7YC 5JVH3 1DOKA 4YY3Q 2EE1A 3DM1A 1AE2A 4BA2I 2UU9L 1Y1WH 3VA5A 4B9XA 2Q8TA 4GKJQ 1WFQA 5KEEA 1S40A 3UE0A 4YCWA 5LMNQ 1I5FA 2B63H 2F52A 1BQQT 1SYEA 2D0PA 3I4LA 3G71A 3HOXG 1XPRA 3J80c 1B9NA 1OXUA 4JW0A 2UUCQ 1Y1WB 3NTIA 5GAHC 1WD1A 3EQLC 2XWJB 4DNIA 3RUZA 3D3RA 2B63B 2A19A 4OEMB 2EY6A 2E2IH 4FVMA 2E2HH 2EPBA 1GUGA 1KAAA 1FD7D 4UP9A 4JI8L 4PNYA 1I94L 3S17B 4TVAB 1ILPA 5EPKA 2E2IB 4H7BA 2E2HB 3PF4A 4BXXH 1EY6A 4PMWA 4CDEC 1GUWA 1GUTA 3D31A 3U4VA 1YIJA 1UUPA 2A6EC 2PI2A 3I3CA 3J7AV 3I4NG 3PO2H 2QEJC 5I4DA 2Y0SG 1PRTF 1F2YA 4DNRB 2WB1B 3DLLA 1PH8A 3X3NA 2RBMA 2WV6D 3TN2A 3HRZC 2O5JC 4V0BA 5AFWA 2R93G 2XRSD 3QWNA 5I6WA 5LL6S 4G7ZC 2LXJA 1LTRD 5C4JH 2UUBL 4QL5A 5CBAE 5KGUA 4FDBA 4C56C 1FJGQ 5JJKA 4MN3A 5KNDA 4DR3L 3DMUA 3F2DA 5IODA 4B08A 1XWEA 3K5OA 4DAYB 5C4JB 3HKZB 1SE3A 1QB5D 4KY5A 2I46A 4N8X1 2J4XA 1ET6A 2F0EA 1N33L 1RD9D 4ZK9B 4IJLA 4PZ8A 1G6PA 4JI3Q 2DUDA 2B8GA 3EN2A 1D5ZC 2OQKA 2K32A 3M4OH 2D62A 3NP8A 4EGVA 4A3FH 5KYLA 1V9PA 4LF9L 2D0OA 1UE6A 3KJPA 1N32L 2F0GA 1QNUA 4LFBQ 5CV8A 4QY7A 2VQEQ 3KF6B 3M4OB 2YV5A 5I9OA 3S1MH 2UXCL 2WP8J 2FMCA 1C9OA 3D4DA 4CHTB 5IP7G 4A3FB 2H5XA 1Q3LA 3R93A 4NXML 4TQUS 5EQ0A 1EFWA 1MBYA 4IUPA 1NR4A 2MNAA 1XMOQ 3S1MB 3CF5A 4LAAA 3H0GH 1ZKOA 2JYOA 1VQKA 2M2LA 2NUCA 4DR1Q 3GD7A 4NPSA 1A8VA 3ULLA 3PIPA 5GQOA 1UNSA 5GROA 1YNJD 3CCEA 3S1NH 2B2TC 4H44C 1VQ9A 4KJNA 4FYDA 1M8AA 1ML0D 4NW2A 4CDCC 3KBGA 5C44G 3C2PA 3GP7A 5C5MA 3KOJA 3S1NB 2JN4A 3W2DA 1Q1EA 3R2TA 1TY2A 4CJ2C 2F0TA 4HEDA 1II3A 4B3TL 2KCMA 3ZYYX 4KKSA 4A3LG 3CCRA 1GM5A 3K5MA 2R7ZH 5C3EH 3K7AH 2L5TA 1EEFD 1SNCA 3I4MH 1ASZA 3CAMA 1LT6D 2ICIA 2IY5B 3H3VC 4JI0Q 3D6CA 4DR4L 5C3EB 4MHEA 3SK4A 3K5LA 4YHHL 5IYCG 3HKSA 2ATWA 5FJ8G 1ENFA 2EYMA 2KA7A 3I4MB 1SSOA 4DV3L 2QW7A 5LL6X 4ID6A 1H9SA 3W1GA 1KD1C 2XSCA 1EY0A 1W3SA 3A56A 1BXTA 1E2WA 1H9RA 4IUQA 1CHPD 1HNWL 1T5XD 4M1UB 5GAEC 4Y7NB 3CMAA 1WTQA 1MD2D 3H3VH 1VQAA 3G48A 4H0LC 3FRPB 4R1JA 4DAYA 5DEHA 1YHAA 5ISRA 4XQJA 2A6HD 4CJ1B 1SR3A 4TSSA 4B3RQ 4KJOA 1VQDA 5FK9C 4YWKA 3VR4A 1TWFB 4X3KA 3RN2A 1LABA 2Z6KC 4JI2Q 2AMCB 4KD4A 4KY7A 1WD0A 5IY0A 4KHPL 1VQ8A 4LW1A 2E2DC 1RODA 1PXUA 3S1RH 2JA6H 4DV4L 2PMZE 5ELOA 1EU4A 1J8IA 4O0AA 2KHIA 1JWMD 2SNSA 3G6JB 3SR1A 3M85A 1VQMA 2JA9A 2H1EA 4WJ4A 3QOLA 3A7AB 3FP9A 3VR5A 2OF1A 1MIUA 3KF6A 2JA6B 2WACA 4LNQA 1LTSD 4A3IG 5A2QE 3PO3G 3M7NA 4DF7A 1XNRQ 5M9OA 2K5DA 4C3JG 3BDCA 3RZOB 3NELA 2K03A 1SYBA 4HJ7A 1I3QH 1VQBA 2NN6G 5A35A 4GLVB 1A2UA 2R92G 1K8MA 3ONAB 3W5OA 1SNQA 2Q8IB 2WAQE 5C3XA 2MP1A 1EWIA 5FOBB 3S2HH 2XGTA 4X3SA 2LKVA 1I3QB 1SNDA 3TP7A 3J80L 2IWHA 3TREA 1Z7TA 3LNNA 4H13C 2GA4B 4K6LA 1PRTD 1VQFA 5J1ZA 4DR6Q 3S2HB 3L7ZC 4LJZC 1NMGA 4BBSH 4HN7A 1VDZA 3T4AC 2NVYH 5IYDG 1F9SA 5FLXE 2HQLA 1NUCA 2DJFC 5M3FB 2I5MX 4ZUIA 3GTGH 4BBSB 2O4XA 1F9PA 3OOCA 3GDEA 1L1OB 2K28A 2BH8A 3EFXD 4R4IA 2UUBQ 2CW0D 3G7LA 5D14A 2WINB 1S4ZA 4OWTB 1U4LA 2G5DA 2L55A 1TS5A 1BUVT 2PYKA 1VQJA 4C3HB 1Y14B 3OTOQ 2B2TA 1DM0B 4QF4A 3PUXA 2MQHA 2AQ3B 5COYA 3V2TA 1YJ9A 3M4PA 4LF6L 1LTTD 3NXWA 1K0SA 5D65A 3FPUB 1HNZQ 3K8AA 2PNHA 2Q2TA 1TT2A 4DAPA 3JAML 1EYCA 2I5HA 1WCMG 2WKDA 3CRLC 1AW7A 3MTSA 3T56B 1X54A 1AFPA 1Y8PB 4CKEA 3A8JE 4YY3L 4GLXA 1QVCA 5CBEE 3M3YH 4BBRH 4GS3A 5E4XA 2KHJA 1R4PB 3J7A5 4GKJL 2UXCQ 2A69C 5LMNL 2CWPA 4Q5VA 3CC2A 3TMEA 2ZTCA 4O2DA 5IGGA 3M3YB 3M4QA 4BBRB 2UUCL 3E6ZX 4APVA 4AYBG 3FDTA 3L0OA 2PI2E 3L3OC 3HZXA 3HS0C 4RHRA 2PMZB 3PUWA 1K9MC 3EVQA 1DJRD 3A7LA 1F2MA 1DCZA 2PZTA 3I90A 1PZJD 2OCEA 2OT2A 4DNTB 4LWCA 2NTSA 2K33A 2RDFA 1EY9A 1YZ6A 4QCLA 1EOVA 1EZ8A 1LM0A 4HTHA 3VYTA 3STBD 5IGFA 2QCPX 1VF7A 2QGQA 3T1HQ 1JICA 1LTGD 1SMXA 3MXUA 1BOSA 1NJIC 4G57A 3L2PA 4J6HA 3N52A 2HD3A 2WAQB 2GVAA 1HFNA 2Z6KA 2NVQH 3V96A 1FR3A 2CKZB 1EYDA 3MZ5A 5E3FA 1VQLA 1CKNB 4GOPC 2K01A 4PZ7A 4XXEA 4DR5Q 1PH6A 2EXDA 1S5BD 2NVQB 3MC0B 2Q8RE 2RHSB 3PIO3 2XIWA 2JSOA 4M8AA 4HJ5A 2K6AA 2C5CA 1FJGL 3CCUA 3HG9A 3DEPA 2NWGA 5I6YA 3UDXA 4XT3B 1YJNA 1B70B 4ZUJA 1JJGA 4B3ML 2KCCA 1HR0W 2MPMA 1TS3A 1NAPA 5JPNC 1KRTA 2E8GA 1X6OA 3S1QH 4JI3L 4DR2Q 1TVXA 2ZM6Q 2YTVA 1VQPA 1ASYA 2IX3A 4GOPB 1MI2A 2AQ2B 1PH5A 3HOYH 1PVOA 4KN4C 4L5SA 2XNAC 4C1NK 2KOLA 2K5QA 4GZYC 4LFBL 2VQEL 1CKMA 4XQQA 1NTGA 1XPUA 5FO9B 1BCPD 1LT5D 3BVGA 3HOYB 4RGNA 1R4QB 2B2WC 1K8OA 2F0JA 4KHPQ 2K7VA 3VR6A 5C0XH 1WTPA 2N78A 1XMOL 1Q12A 3OWEB 4DV4Q 1B53A 4P72A 4JOIA 1O7LA 2B2UC 1SYGA 3BVZA 2L15A 1YNNC 4DR1L 1E1TA 4IFDJ 2K5WA 1CFMA 3WOFA 3D0FA 1VQ4A 3G6EA 1Z9FA 2L1BA 4OGQC 3HOVB 2QDLA 4DK3C 2HDLA 1G51A 2JQOA 4POGA 1QNKA 4QIWB 1TS4A 3FKIG 1CI3M 1IW7D 3CCMA 3GTPB 2DY7A 1EIHA 3BVMA 1KC8C 2XN9C 1FGBD 2WFWA 1PZID 3KJOA 4K5WA 1WOCA 3KF8A 2YU9H 1I50B 1JC7A 1V8QA 3S15B 5KNBA 1SXTA 1H9MA 1S5ED 5C4XB 4RGOS 4DAVA 1XTDA 3TBIB 3HOZG 1IKMA 4K6DA 2BA1A 4RKLA 3MXNB 4XYOA 3KBXA 3AYHB 2MFIA 5ELCA 3GQBA 2KHSA 4K8IA 1A63A 1QWYA 2PW5A 5IP9G 3I56A 1KLUD 1K0RA 4UP8A 3TS0A 4G4KA 1TWHH 4RWSC 1D8LA 1X65A 3GTQH 2UXDQ 3TSSA 4JBKA 4CGYB 1RTOA 1IKLA 2L4NA 3K80C 3RN5A 2AUKA 5J22A 3HKZE 3GTMH 1D5XC 2PPBC 1JR0D 2KUMA 1FNUA 1MHWC 1HQRD 1SNPA 1TWHB 1C7YA 1MGSA 1I4HA 2DGYA 2CWAA 3K59A 1Y1WG 1JOQA 4C3IH 1JJ2A 3CPFA 4UP7A 1MSGA 4QGUA 3GTMB 3J81j 2B63G 2B2VC 1AE3A 1PTOD 4JI6Q 4JI5Q 1Q86C 4R8NA 2NVTH 3BDLA 4K0KQ 1E3PA 3Q0AA 5M5WH 2CQAA 2FINB 4ABNA 2EYLA 2HUGA 4B3RL 2R6GA 4KLKA 4AH6A 2NVTB 4DPGA 4A3JH 5EBDA 3DWQA 2KCTA 4ULLA 3RLNA 4JI2L 1RIPA 5M5WB 3U9SA 4GKKQ 2B39A 1V1OA 1KDCA 2EYHA 1QVFA 5FLXc 4LF8Q 1E0BA 2WB1G 3NENA 4GOPA 1MJCA 3UDFA 1ZYRC 4ZKCB 1STNA 1B8AA 3SE0A 4OO1G 4IZ8A 1JJCB 2TMPA 2Z1CA 4N8FA 1PH2A 1EU3A 4NMZA 5KYIA 4K14A 4DN4M 2K14A 4FF1A 4IUNA 1K28A 4ZCKA 4FNFA 1G2SA 3HOWH 4XTCS 2F0SA 1XNRL 4EQ5A 2OTLA 1I4QA 5JEAG 5G3LF 5IGDA 4HIOA 3ER0A 3K58A 3C3LA 3K0XA 3HKZG 3HOWB 5I2YA 1STHA 1DXMA 4UY8C 2RCNA 1S72A 4BY7H 4A3MH 5HY6A 1WTVA 2I07B 4R9WA 1X3FA 4XQNA 1GUNA 5JAVA 3IAYA 3P1HA 4DR6L 1CSPA 1VQCA 2K52A 4BY7B 2PW7A 4A3MB 4NP5A 4AIMA 2BE5C 2ES2A 3I91A 1FGUA 1W6KA 4PQXA 5CV5A 4HJ8A 3CXCA 2J7ZA 4OWXB 4A3FG 4V190 3PO2B 5K36H 1D7QA 3GV3A 4A75A 2ICEC 2P5ZX 5EGTA 2RSOA 4KTAA 4CKCA 2C9OA 5DM63 1ENAA 1H9SB 3MXNA 3ULJA 1VMCA 2B2UA 1SN8A 4MTNA 4HJ9A 4I7ZC 4A93G 3CCJA 4PMBA 1BBUA 2FHTA 3SVMA 3HOXH 2RSNA 3OTOL 3H15A 1CKOA 1UWVA 3A5ZB 3W1BA 4WJWA 4B3MQ 1I6HH 1ILQA 3R8BA 1D5MC 5C3WA 4RGMA 1VQGA 3KLRA 3U4ZA 3M4YA 1HNZL 3AB9A 1I6HB 2G9DA 4FXDA 3I55A 1LLRD 5CMDA 1JE5A 1HTPA 1STAA 4CBVA 1Q81C 2NTTA 4P74A 2NBFA 1IYUA 1YBYA 2D5DA 1EQQA 1M90C 1U0LA 3OSOA 2Q2UA 4A3DH 4DV7L 2RVLA 2F0FA 2PCFB 3K6OA 1LUZA 1PH4A 1EY8A 2HIVA 3U9OA 5IT9E 4A3GH 1E22A 1GUOA 1GXDC 2F03A 1S5DD 4LF7Q 4A3DB 1D1IA 2N88A 4JV5Q 3B6YA 2A6ED 3P7JA 2AQ1B 2OEOA 4JYAQ 4L5RC 4A3GB 4DK0A 3I4MG 2I5LX 3KDFA 4IN3A 1JB3A 3H0GB 5CC4A 3SK8A 1QUQA 3A8IE 2CCZA 2JP1A 1DOLA 1X3GA 3T1HL 2OQ0A 5JJZA 2AUJD 4OX9Q 2A6HC 1UE5A 2PNRC 4IUUA 5KIXA 4ZQ3A 1K3BC 3BZKA 2I0QA 4LUOA 5GAGC 1G291 4LUZA 2VUMH 4X65Q 4A3CH 4DR5L 5CV9A 3OMCA 4GNXC 3NE5B 3HOUH 5FLMH 4XYQA 1H9JA 1O7YA 1O7IA 3EJIA 2FMMA 2VUMB 3A0JA 1BBXC 1SYCA 3BZDB 1K8GA 3HOUB 5IYBG 4B9WA 1OXTA 3M9BA 4LF4Q 2R7ZB 4CDFC 3E0EA 2HIXA 4OIJA 3KK7A 3K7AB 4I65A 1DZ1A 2NN6I 4EQPA 5IGCA 3U50C 1B3AA 3VYRA 3LWEA 2JA7G 3BU2A 3VA7A 4DR2L 1S5FD 4IJHA 2ZM6L 5IOCA 2BA0A 3H91A 5IGEA 1RF2D 4YWLA 2K4KA 3KLSX 2GVBA 3I73A 3ULPA 1GOZA 1GHKA 1EQTA 3GO5A 5TSSA 1F9RA 3J7AF 4ZAIA 3QR8A 1A0IA 1PRTC 3CMEA 1Q8KA 2ZJPA 2OWOA 1TIID 4R4TA 4PZ6A 5C44H 5A2QL 1PYSB 1LTID 3I8ZA 3PIOA 4ME3A 1PFSA 3CCSA 5IE8A 4EVOA 3J81L 2Z4HA 1DD2A 4DR7Q 4GN3B 5C4HA 1NCVA 1BCPF 3FPPA 3MHBA 4FF2A 4A3LH 5M3FG 2N3SA 1JQYD 4WRDA 2TSSA 5AJ3Q 1B9MA 1STGA 1CT1D 5CV7A 3S1RB 2CW0C 1H9KA 5G3LD 4DV5Q 2ZTDA 2KQ3A 5JPMC 3PF5A 5F2DA 2K1BA 3R3OA 3QOJA 2KBNA 1QE6A 2VS1A 5FLXL 1K83H 3NWTA 4QMGA 3CU7A 1PH1A 4ZYSA 1EIYB 4C3HG 2B8FA 4FF3A 2XWBB 1E2ZA 3GV6A 3IL8A 4DV1Q 4HIKA 3FMCA 4R4QA 1WJJA 1K83B 4RH6A 3PUYA 1IYJB 2DJGC 2R7FA 2PZWA 2PO4A 1DYQA 5I2XA 5BN3A 1M1KC 4L5TA 4UPAA 4X3UA 1GO3E 1XPOA 1WYDA 2VNUD 4IPDA 4A3KG 1IL8A 3A55A 1Y1VH 1J6QA 2UXDL 4QUCA 2DNCA 1SYFA 1SMYD 2NVYB 2KEDA 1YEZA 1PH3A 1Y1VB 1H95A 1WI5A 2XTIA 4GN5A 2YTYA 1MKHA 1AZQA 1NY4A 3GTGB 1BR9A 4JBMA 1UEBA 4JI6L 1QG7A 1CUKA 3V05A 4JI5L 4NXNQ 4JG2A 2JA5H 3SEBA 1QJOA 4K0KL 1S3OA 2GN5A 3NEMA 1TWAH 3A54A 1HXYD 2HHHQ 1PTOF 1IBKL 3STBC 3FEWX 2K04A 1HA5A 3ND8A 2ZT9C 2JA5B 4K2LA 2NN6H 1EWCA 2CFMA 1KRSA 2R92H 1U4PA 1UE7A 2MUYA 1TWAB 5E1FA 4RG1A 4GKKL 2F0DA 3T1YQ 1HNXQ 4UDUC 2CHBD 1CQFA 5ELFA 2WAQG 4LF8L 2Q2IA 2KJXA 3F1ZA 1IYVA 1DONA 2MHVA 1NBWA 2HT1A 2MGSA 5L37A 4IOCA 4O42A 2CH4A 3OW7A 4K5XA 2EJMA 4AQYQ 3Q23A 5JJLA 4DV7Q 3MFGA 5IWAL 3AQQA 1HTLD 4DXGA 2A1AA 3U58A 2AKWB 4QIWE 1QOHA 1XYIA 1LT3D 5FKAC 3KUPA 2NVXH 1EY7A 2AWOA 1IBLQ 3CQZH 1KTKA 3KF8B 4X62Q 1I4GA 4XT1B 5C0XJ 1V1PA 3IFDA 1X3EA 1B2TA 1PHJA
chains in the Genus database with same CATH topology
2ZXOA 2NVXB 1Y69U 3CQZB 3Q6SA 1STYA 2N55A 3JAME 4KKTA 1JWUD 1J9OA 3BYTB 3X3MA 4ODGA 1HQMC 1WTWA 2V4DA 1A2TA 3ITPA 5DNFA 5JVG3 1X3QA 1RCVD 1CA5A 1CA6A 3E5SA 5E4WC 1BO0A 1NSNS 2LY7A 3VYSA 5C0XG 3GTJB 3S2DB 1A3VA 5LHY1 4KHVA 3C1EA 4KN7C 2A69D 2M00A 4DGZA 4U673 2HDMA 1Y8OB 4AYBB 4N9PA 4KY6A 3S1QB 4BS9A 2EOTA 1UEAB 1OO9B 3QIAA 3MFYA 2RQXA 5C4ZA 4ZLTF 4RKBA 2BDOA 4IFDI 1EEID 3D4RA 2IX1A 2L12A 4FXGC 2XVSA 1OXSC 4IQZA 3IFTA 4LK1C 3A8KE 2A68D 1EY4A 2NZ1D 1BDOA 4IUVA 3OMGA 2YYZA 3NTKA 1F2LA 3RLFA 3P75A 2E74C 4OHJA 1QCBD 2QDBA 3TZDA 3AMUA 2IL8A 1TKWB 3PV0A 1WTRA 1QILA 3DWAA 2RA4A 3SHLA 4OO1I 1PFBA 1RDPD 3EA6A 2YU9B 3K0YA 1KLGD 1TWGB 1TR5A 2RKSA 4DFAA 1SJED 5CYUA 1EIGA 3QB3A 4IFDG 1JOKA 2EY1A 3QG1A 2EY2A 4BY1B 3J7YW 3GTKB 4K2KA 1SEBD 1ICWA 3GTQB 1JORA 4RCNA 4WORA 4A3BB 2E75C 4ZRZA 2Z8LA 3PMFA 1WVLA 3URYA 2EVBA 4C3IB 2ID0A 4HMJA 4IUTA 1Q8IA 3I72A 4L63B 5EJWA 2D9UA 1FNVA 2L0CA 1V43A 1PZKD 4OL7A 1VMPA 4HCSA 4CJ0B 4A3JB 1D1KA 3PUVA 3HP3A 4ME5A 3NK9A 1WTOA 5EKKA 2CVRA 1SE2A 2E76C 4Q0FA 3UI2A 3NUCA 3NWSA 2RDGA 2F0HA 4DA2A 3CRKC 3TP8A 5K36G 1RKNA 1S5CD 2F0WA 2F3VA 2PZUA 4JK1C 3O13A 2EYJA 2LFNA 4PMCA 1A15A 1Q1BA 4CKBA 3SDZA 4DXFA 1D6EC 1TQOA 4G7HC 1PFNA 3DWPA 1SBBB 1VCIA 1G2TA 1KNEA 3ND9A 1PYWD 1TWCB 1ZEQX 2ZXPA 5J39A 4TKOB 1L0XB 1KDBA 1E2VA 1Q90A 3VR2A 2F0VA 2B2WA 3IKJA 5K5PA 3VR3A 2JE6I 2JEAI 4O1NA 4L8JA 4OO1H 2HQEA 5DM73 2PQEA 2SEBD 4Z9CB 1YNJC 1B1ZA 5CGKA 1ZYRD 2D2CC 3TZUA 5JEAH 2ENBA 2EY5A 4J1MA 3HOXB 5IT9L 3TDQA 4QUFA 2DY8A 1ONLA 5BN5A 3TP5A 4N9TA 4NKLA 1XXGA 3LWUA 5CORA 2EXZA 4J8QA 1EOTA 1MSHA 1AP0A 4HMIA 3NQTA 4YIJA 4KMUC 4RA8A 3QO2A 1IHZA 2LS01 2F0IA 3I4NB 4FP5D 2Y0SB 3T16A 4EQOA 1JWSD 2BE5D 1SFOB 2QILA 1JE4A 1ESFA 2B2VA 4C1NI 2HCIA 4F8MA 2R93B 3K57A 4TRDA 1SNOA 1SJHD 1HPCA 1G6ZA 2J0TD 3M7GA 2EJGC 5D3DA 4A93B 1HA6A 2VB3X 2HCCA 5JOBA 1M4VA 1F77A 4IURA 1RTNA 5C5LA 3MA2B 5C6AA 3RD4A 5FO7B 4IALA 3T51B 1HUNA 5HURA 1HFGA 4ILWA 4ZKBB 3NBIA 3GTLB 1HHVA 2A74C 4S3SA 5HGTA 1SNMA 3H6MA 2FFKB 3S14B 1SYDA 4FXKC 3ERQA 2H4OA 5ELEA 2BCOA 2QF7A 4F7XA 4HR7B 2K05A 1LTBD 1XX8A 3NSWA 1STBA 1PFMA 1HCZA 4LMQD 5EKLA 3OIPA 2EYOA 5M5XB 2EDGA 4FO2A 1XTCD 1AEXA 1ENCA 4QB4A 2KCNA 1EQVA 4E6IA 4F87A 5C44B 2A73B 1DOMA 1SMYC 3BDOA 1V1PB 4K8JA 1ESRA 3PUZA 1B50A 1G91A 1EL0A 3BYYB 3CHBD 1KNAA 1PRTB 1TS2A 3S9WA 5NUCA 3D8GA 1CZWA 3SK6A 3HEJA 3EROA 2JA7B 2O2LD 4KI0A 4R8IA 3J81E 3D4WA 4BWGB 4KV6A 5I9PA 2L11A 4L6TB 1RHPA 4HSVA 2B2YC 2KEEA 5CR3A 2OXPA 2X6LA 1KDAA 1Z6HA 4RFBA 1OXXK 5T1GA 1SE4A 3W3AA 2F0KA 3GTOB 5CV4A 1T5EA 1OXVA 2A5HA 1KABA 1LO5D 1C8CA 1LACA 1X3PA 2M9VA 1EFID 1CHQD 1CTMA 3TP6A 3QJYA 3J80E 3E0JA 4A3IB 2F0QA 2SNMA 3NBHA 3PO3B 4C3JB 2KECA 4NDXA 4HSPA 2DNEA 4JBWA 4KKUA 2JEBI 4WFN3 2R92B 2F0NA 1R9TB 2IJ0A 2DN8A 2X69A 3Q24A 1O78A 5ELBA 1LV9A 1A6XA 3H94A 2XRQD 4MIUA 3PIP3 5C0XI 3BG3A 1O80A 3K5NA 2KVMA 3T13A 3WDNA 2RDHA 1GUSA 4KHZA 1EZ6A 2R61A 3RMHA 3BS1A 3P20A 2NB0A 5EKIA 4XIGS 4A3KB 1SAPA 3LX0A 4RAUC 1BF4A 4PV1C 2IPKD 3SXHA 3WOEA 1C4QA 2EYPA 2F0UA 5EPJA 3MVVA 4C2MB 3F2UA 5IIFA 2BOSA 1TU2B 1BCPC 2Z4IA 1CK1A 2IT1A 1C48A 4EQNA 4XDXA 3OHXC 3OWFA 1HRJA 2JXMB 2F0LA 2SOBA 1WCMB 2A68C 5IGBA 5KNCA 3L9AX 1ET9A 3C1FA 2AWNA 1EYAA 2R3ZA 3I70A 2F4IA 5ELDA 4RHSA 1IW7C 2E2JB 1U9RA 3Q22A 1HUMA 2QKIC 1BCPB 3MXGA 4F88A 3CKIB 2IX0A 1CQVA 1FNWA 2WKCA 4U68A 2L9HA 3H09A 4G7OC 2WIIB 2X6GA 3NHHA 3R2IA 4DK1A 4HAEA 3T53B 2FJ2A 1PMRA 4HCEA 2F3WA 2B2YA 4X3TA 4K5VA 1NR2A 5BN4A 2F1MA 1I6VC 2VB2X 1GJXA 1JOOA 2LMCB 1L0YB 3OPOA 1TY0A 2VXWA 3MXPA 1PTOC 5CV6A 1FYCA 5M3MB 5EPLA 3SK5A 4RCOA 4C3IG 5KRUA 1GHJA 1CM9A 1Z47A 5EBCA 2ZXRA 1PLFA 3RZDB 1EY5A 1G8ZD 5FO8B 4UAIA 1LT4D 3C46A 1LTAD 1PTOH 1D2BA 1VF5C 1SDFA 4FF4A 3NPPA 1X32A 3DEOA 3AU7A 1PTOB 2MJ8A 3DHQA 4RGTA 1AZPA 5T1IA 4KK7A 2EJFC 2BDNA 4P2CB 3HGBA 3S16B 1EWHA 3D6WA 2JA8B 3N6RA 3NQIA 1WTXA 1W6JA 1I4XA 1BNZA 1CZGA 3FVQA 2G9HD 1UAPA 2F0PA 1O7ZA 4OIKA 3KLSA 1F2ZA 1A3UA 2EZVA 2NYZD 3DXJC 1YNND 5DAUA 1B4OA 3NTHA 5M5YB 2IW3A 1U4RA 3OIQA 5D3IB 1AN8A 3VYUA 3FKIB 1PDQA 5JEAJ 1B44D 1JCKB 4A3EB 3MEHA 1I4RA 2O5IC 3MWYW 1RJTA 4BA1I 1Y8NB 3MAQA 1ZXTA 1F9QA 1U4MA 2SDFA 2EYFA 3HOZB 3DUZA 2F0OA 2F0MA 1I4PA 4DU9A 4KD3A 1A3TA 4IFDH 1STEA 5JVH3 1DOKA 2EE1A 3DM1A 4BA2I 3VA5A 4B9XA 2Q8TA 5KEEA 1BQQT 1SYEA 3I4LA 1B9NA 1OXUA 1Y1WB 3NTIA 1WD1A 3EQLC 2XWJB 3RUZA 3D3RA 2B63B 2EY6A 4FVMA 2EPBA 1GUGA 1KAAA 1FD7D 4PNYA 3S17B 1ILPA 5EPKA 2E2IB 4H7BA 2E2HB 1EY6A 4PMWA 1GUWA 1GUTA 3D31A 1UUPA 2A6EC 3I3CA 3J7AV 2QEJC 5I4DA 1PRTF 1F2YA 4DNRB 2WB1B 3X3NA 2RBMA 2WV6D 3TN2A 3HRZC 2O5JC 4V0BA 5AFWA 2XRSD 3QWNA 5I6WA 5LL6S 4G7ZC 1LTRD 5CBAE 5KGUA 4C56C 4MN3A 5KNDA 3DMUA 5IODA 4B08A 1XWEA 3K5OA 5C4JB 3HKZB 1SE3A 1QB5D 4KY5A 2I46A 2J4XA 1ET6A 2F0EA 1RD9D 4ZK9B 2B8GA 1D5ZC 2K32A 2D62A 3NP8A 4EGVA 5KYLA 2F0GA 1QNUA 5CV8A 3M4OB 5I9OA 2WP8J 2FMCA 3D4DA 4A3FB 4CHTB 1Q3LA 3R93A 4TQUS 5EQ0A 1MBYA 4IUPA 1NR4A 3S1MB 4LAAA 1ZKOA 2JYOA 2M2LA 2NUCA 3GD7A 1UNSA 1YNJD 2B2TC 4H44C 4KJNA 4FYDA 1M8AA 1ML0D 4NW2A 3KBGA 3C2PA 3GP7A 5C5MA 3S1NB 3W2DA 1Q1EA 3R2TA 1TY2A 4CJ2C 2F0TA 4HEDA 1II3A 3ZYYX 4KKSA 3K5MA 2L5TA 1EEFD 1SNCA 1LT6D 2ICIA 3H3VC 3D6CA 5C3EB 4MHEA 3SK4A 3K5LA 3I4MB 1ENFA 2EYMA 2KA7A 1SSOA 5LL6X 4ID6A 1H9SA 2XSCA 1EY0A 3A56A 1BXTA 1E2WA 1H9RA 4IUQA 1CHPD 1T5XD 4M1UB 4Y7NB 1WTQA 1MD2D 4DAYA 4H0LC 3FRPB 5DEHA 5ISRA 4XQJA 2A6HD 4CJ1B 4TSSA 4KJOA 5FK9C 3VR4A 1TWFB 4X3KA 1LABA 4KD4A 4KY7A 1WD0A 2E2DC 1RODA 1PXUA 1EU4A 1J8IA 1JWMD 2SNSA 3G6JB 3SR1A 3M85A 2H1EA 3QOLA 3A7AB 3VR5A 2JA6B 2OF1A 2WACA 1LTSD 5A2QE 3M7NA 4DF7A 5M9OA 2K5DA 4C3JG 3BDCA 3RZOB 2K03A 1SYBA 2NN6G 5A35A 1A2UA 1K8MA 3ONAB 1SNQA 2Q8IB 5C3XA 2MP1A 5FOBB 4X3SA 2LKVA 1I3QB 1SNDA 3TP7A 3J80L 2IWHA 1Z7TA 3LNNA 4H13C 2GA4B 4K6LA 1PRTD 5J1ZA 3S2HB 3L7ZC 4LJZC 4HN7A 1VDZA 3T4AC 1F9SA 5FLXE 1NUCA 5M3FB 4ZUIA 4BBSB 2O4XA 1F9PA 3OOCA 2K28A 3EFXD 2CW0D 3G7LA 5D14A 2WINB 1S4ZA 1U4LA 2L55A 1TS5A 1BUVT 2PYKA 4C3HB 2B2TA 1DM0B 4QF4A 3PUXA 2AQ3B 5COYA 3V2TA 1LTTD 3NXWA 5D65A 3FPUB 1TT2A 4DAPA 3JAML 1EYCA 2WKDA 3CRLC 1AW7A 3MTSA 3T56B 1AFPA 1Y8PB 4CKEA 3A8JE 5CBEE 5E4XA 1R4PB 2A69C 4Q5VA 3TMEA 5IGGA 3M3YB 4BBRB 3E6ZX 3FDTA 3L3OC 3HZXA 3HS0C 4RHRA 2PMZB 3PUWA 3EVQA 1DJRD 3A7LA 1F2MA 1DCZA 2PZTA 3I90A 1PZJD 2OT2A 4DNTB 2NTSA 2K33A 2RDFA 1EY9A 4QCLA 1EZ8A 4HTHA 3VYTA 5IGFA 2QCPX 1VF7A 1JICA 1LTGD 3MXUA 1BOSA 4G57A 4J6HA 3N52A 2WAQB 1HFNA 3V96A 1FR3A 5E3FA 1EYDA 3MZ5A 2K01A 4XXEA 1S5BD 2NVQB 3MC0B 2Q8RE 3PIO3 2XIWA 2JSOA 4M8AA 2K6AA 2C5CA 3HG9A 3DEPA 2NWGA 5I6YA 4XT3B 4ZUJA 2KCCA 2MPMA 1TS3A 1NAPA 5JPNC 1TVXA 2IX3A 1MI2A 2AQ2B 4KN4C 2XNAC 4C1NK 2KOLA 2K5QA 4GZYC 4XQQA 5FO9B 1BCPD 1LT5D 3BVGA 3HOYB 4RGNA 1R4QB 2B2WC 1K8OA 2F0JA 2K7VA 3VR6A 5C0XH 1WTPA 1Q12A 3OWEB 1B53A 1O7LA 2B2UC 1SYGA 3BVZA 1YNNC 4IFDJ 2K5WA 1CFMA 3WOFA 2L1BA 4OGQC 3HOVB 2HDLA 1QNKA 4QIWB 1TS4A 1CI3M 1IW7D 3GTPB 2DY7A 1EIHA 3BVMA 2XN9C 1FGBD 1PZID 4K5WA 3KF8A 1I50B 1JC7A 1V8QA 3S15B 5KNBA 1SXTA 1H9MA 1S5ED 5C4XB 4RGOS 4DAVA 3TBIB 1IKMA 4K6DA 2BA1A 4RKLA 4XYOA 3KBXA 5ELCA 3GQBA 2KHSA 4K8IA 1QWYA 2PW5A 1KLUD 4G4KA 4RWSC 3TSSA 4CGYB 1RTOA 1IKLA 2L4NA 2AUKA 5J22A 1D5XC 2PPBC 1JR0D 2KUMA 1FNUA 1HQRD 1SNPA 1TWHB 1MGSA 1I4HA 3K59A 1JOQA 1MSGA 3GTMB 2B2VC 1PTOD 4R8NA 3BDLA 3Q0AA 2CQAA 2FINB 4ABNA 2EYLA 2HUGA 2NVTB 2R6GA 5EBDA 3DWQA 4ULLA 5M5WB 3U9SA 2B39A 1V1OA 1KDCA 2EYHA 1E0BA 1ZYRC 4ZKCB 1STNA 3SE0A 4OO1G 4IZ8A 2TMPA 2Z1CA 1EU3A 4NMZA 5KYIA 4K14A 4DN4M 4FF1A 4IUNA 4FNFA 1G2SA 4XTCS 2F0SA 1I4QA 5JEAG 5G3LF 5IGDA 3K58A 3C3LA 3HOWB 5I2YA 1STHA 1DXMA 1WTVA 2I07B 4R9WA 4XQNA 1GUNA 5JAVA 3IAYA 3P1HA 4BY7B 2PW7A 4A3MB 4NP5A 2BE5C 3I91A 1W6KA 4PQXA 5CV5A 2J7ZA 4V190 3PO2B 5K36H 3GV3A 2ICEC 5EGTA 4CKCA 2RSOA 4KTAA 2C9OA 5DM63 1ENAA 1H9SB 3MXNA 1VMCA 2B2UA 4I7ZC 4PMBA 2FHTA 3SVMA 2RSNA 4WJWA 1ILQA 3R8BA 1D5MC 5C3WA 4RGMA 3KLRA 3M4YA 3AB9A 1I6HB 2G9DA 4FXDA 1LLRD 5CMDA 1HTPA 1STAA 4CBVA 2NTTA 2NBFA 1IYUA 2D5DA 3OSOA 2RVLA 2F0FA 2PCFB 3K6OA 1EY8A 3U9OA 5IT9E 1GUOA 1GXDC 2F03A 1S5DD 4A3DB 1D1IA 2N88A 2A6ED 3P7JA 2AQ1B 2OEOA 4A3GB 4DK0A 4IN3A 1JB3A 3H0GB 5CC4A 3SK8A 3A8IE 2JP1A 1DOLA 5JJZA 2AUJD 2A6HC 2PNRC 4IUUA 5KIXA 4ZQ3A 1G291 5CV9A 3OMCA 3NE5B 4XYQA 1H9JA 1O7YA 3EJIA 2FMMA 2VUMB 1BBXC 1SYCA 3BZDB 3HOUB 4B9WA 1OXTA 2R7ZB 4OIJA 3KK7A 3K7AB 4I65A 1DZ1A 2NN6I 4EQPA 5IGCA 1B3AA 3VYRA 3LWEA 3VA7A 1S5FD 5IOCA 2BA0A 3H91A 5IGEA 1RF2D 3KLSX 3I73A 1GOZA 1GHKA 1EQTA 3GO5A 5TSSA 1F9RA 3J7AF 4ZAIA 1PRTC 1TIID 5A2QL 1LTID 3I8ZA 4EVOA 3J81L 2Z4HA 1DD2A 5C4HA 1NCVA 1BCPF 3FPPA 3MHBA 4FF2A 1JQYD 4WRDA 2TSSA 1B9MA 1STGA 1CT1D 5CV7A 3S1RB 2CW0C 1H9KA 5G3LD 2KQ3A 5JPMC 5F2DA 2K1BA 3R3OA 3QOJA 1QE6A 5FLXL 3NWTA 4QMGA 3CU7A 4ZYSA 4C3HG 2B8FA 4FF3A 2XWBB 1E2ZA 3GV6A 3IL8A 3FMCA 1K83B 4RH6A 3PUYA 2PZWA 2PO4A 1DYQA 5I2XA 5BN3A 4X3UA 2VNUD 1IL8A 3A55A 4QUCA 2DNCA 1SYFA 1SMYD 2NVYB 2KEDA 1Y1VB 1AZQA 3GTGB 1BR9A 1QG7A 3V05A 3SEBA 1QJOA 3A54A 1HXYD 1PTOF 3FEWX 2K04A 1HA5A 3ND8A 2ZT9C 2JA5B 4K2LA 2NN6H 1EWCA 1U4PA 2MUYA 1TWAB 5E1FA 2F0DA 4UDUC 2CHBD 1CQFA 5ELFA 2KJXA 1IYVA 1DONA 2MHVA 2MGSA 4O42A 4K5XA 3OW7A 2EJMA 3Q23A 3MFGA 1HTLD 4DXGA 1QOHA 1XYIA 1LT3D 5FKAC 3KUPA 1EY7A 2AWOA 1KTKA 1I4GA 4XT1B 5C0XJ 1V1PA 3IFDA 1B2TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OMG A;  3P1H A;  3TP8 A;  4ZUI A;  1RKN A;  2F0W A;  2F0I A;  2F3V A;  2O4X A;  2PW7 A;  2PZU A;  4K8J A;  2KHS A;  4K8I A;  3DMU A;  4NP5 A;  2EYJ A;  5IOD A;  3D6C A;  3MEH A;  4ZQ3 A;  2F3W A;  2PW5 A;  4MIU A;  3T16 A;  5KIX A;  3SK4 A;  4EQO A;  2PZW A;  1STY A;  3P75 A;  4K5V A;  4PMC A;  3T13 A;  4KY5 A;  5CV5 A;  2EYM A;  1EZ6 A;  2F0E A;  2QDB A;  5CV9 A;  3OMC A;  4ID6 A;  4F8M A;  5EGT A;  5J22 A;  4KTA A;  5I6Y A;  4TRD A;  1SNO A;  2PYK A;  1JOO A;  3LX0 A;  1ENA A;  1TQO A;  2EYF A;  3EJI A;  1EY0 A;  1SNP A;  4ZUJ A;  2F0O A;  4ODG A;  2F0M A;  1SYC A;  4QF4 A;  4DU9 A;  3NP8 A;  3SHL A;  1JOQ A;  3S9W A;  5NUC A;  5KYL A;  5CV6 A;  3MXP A;  3V2T A;  4KD3 A;  4B9W A;  3D8G A;  3SXH A;  1A3T A;  1SYF A;  1A2T A;  3NXW A;  5J39 A;  5DEH A;  5ISR A;  4PMB A;  5JOB A;  2EYP A;  3ITP A;  3SK6 A;  2F0G A;  1TR5 A;  2F0U A;  4I65 A;  1KDB A;  3HEJ A;  4R8N A;  5CV8 A;  4KJO A;  3MVV A;  3SK5 A;  4EQP A;  5I9O A;  2F0V A;  2RKS A;  3BDL A;  3ERO A;  1TT2 A;  3D4D A;  4DFA A;  5IIF A;  5IGC A;  1EYC A;  3E5S A;  3VA5 A;  4B9X A;  4KD4 A;  4KY7 A;  5KRU A;  5C3W A;  5C5L A;  5KEE A;  3QB3 A;  5K5P A;  1EY5 A;  5IOC A;  1NSN S;  3D4W A;  1JOK A;  1SYE A;  2EY1 A;  4KV6 A;  5C6A A;  2EYL A;  5I9P A;  4IAL A;  2EY2 A;  5IGE A;  1A3V A;  5HUR A;  4K2K A;  4KHV A;  1JOR A;  3C1E A;  2SNS A;  4LAA A;  4WOR A;  2HQE A;  5CR3 A;  2OXP A;  3RUZ A;  1STA A;  3SR1 A;  1KDC A;  2F0J A;  1KDA A;  2EY6 A;  2EYH A;  3QOL A;  2OF1 A;  2M00 A;  2NUC A;  2PQE A;  3OWF A;  4K2L A;  4S3S A;  3TME A;  4DGZ A;  5IGG A;  2WAC A;  5HGT A;  2F0K A;  1KAA A;  1SNM A;  3PMF A;  5CV4 A;  3H6M A;  2F0L A;  1STN A;  4N9P A;  5E1F A;  2SOB A;  1SYD A;  4IZ8 A;  4PNY A;  5CGK A;  3HZX A;  3OSO A;  4DF7 A;  2F0D A;  3ERQ A;  3DHQ A;  1KAB A;  4KY6 A;  4EVO A;  5M9O A;  1SYG A;  3BDC A;  5IGB A;  2ENB A;  2F0F A;  2EY5 A;  3EVQ A;  4HMJ A;  4J1M A;  4KJN A;  4NMZ A;  3C1F A;  5KYI A;  4K14 A;  1SYB A;  5C4H A;  1F2M A;  4H7B A;  2PZT A;  1EY8 A;  4F7X A;  1EYA A;  5KGU A;  4IUN A;  1A2U A;  3U9O A;  3MHB A;  1SNQ A;  1EY6 A;  3TP5 A;  2F0S A;  5C5M A;  5C3X A;  2RDF A;  1EY9 A;  1U9R A;  5C4Z A;  4K5X A;  4WRD A;  4N9T A;  4RKB A;  4NKL A;  1STG A;  3TP6 A;  5IGD A;  4OL7 A;  1EZ8 A;  1STB A;  2LKV A;  4HTH A;  1SND A;  2F0T A;  5CV7 A;  1F2Y A;  3TP7 A;  2OEO A;  5IGF A;  5EKL A;  1II3 A;  2EXZ A;  1STH A;  2F0Q A;  4ME5 A;  3NK9 A;  2SNM A;  2KQ3 A;  5EKK A;  2RBM A;  5F2D A;  2EYO A;  4K5W A;  5J1Z A;  2F0P A;  3R3O A;  3QOJ A;  4G57 A;  5CC4 A;  3SK8 A;  4NDX A;  1F2Z A;  4HMI A;  1AEX A;  4J6H A;  3NUC A;  1A3U A;  1ENC A;  1EY7 A;  3NQT A;  4QMG A;  5I6W A;  4EQN A;  4QB4 A;  1EQV A;  1EY4 A;  4YIJ A;  4E6I A;  1EYD A;  2F0N A;  3MZ5 A;  3NHH A;  4K6D A;  5E3F A;  1SNC A;  5DAU A;  4RKL A;  2F0H A;  1NUC A;  1IHZ A;  5JAV A; 
#chains in the Genus database with same CATH topology
 2F4V Q;  4IOA A;  2ZXO A;  1XJV A;  2NVX B;  1Y69 U;  3CQZ B;  3Q6S A;  2E5L Q;  5JJI A;  4A4I A;  1STY A;  4JVZ A;  1X56 A;  2N55 A;  1BKB A;  3JAM E;  2NZH A;  4KKT A;  3TEH B;  1JWU D;  1J9O A;  3BYT B;  3X3M A;  2IHE A;  2Q2H A;  4ODG A;  1HQM C;  1WTW A;  1WCM H;  2V4D A;  4DUY Q;  2UXB Q;  1A2T A;  3F2C A;  5M3M G;  3CC4 A;  3ITP A;  5DNF A;  5JVG 3;  1X3Q A;  3GTJ H;  1RCV D;  1XMQ Q;  3S2D H;  5IT9 c;  1CA5 A;  1YIT A;  1CA6 A;  3E5S A;  4OXP A;  5E4W C;  1BO0 A;  1NSN S;  2LY7 A;  4JPB W;  3VYS A;  2R7D A;  5C0X G;  3GTJ B;  3S2D B;  1VS0 A;  1C0A A;  1A3V A;  3PQI A;  5LHY 1;  4KHV A;  3HOV G;  3C1E A;  4KN7 C;  2A69 D;  2M00 A;  4DGZ A;  2F3I A;  4U67 3;  2HDM A;  1Y8O B;  4AYB B;  4N9P A;  4RMF A;  2B3G A;  4KY6 A;  3S1Q B;  4BS9 A;  2EOT A;  4B3S Q;  1UEA B;  1OO9 B;  5C4X G;  3QIA A;  3MFY A;  2RQX A;  3K81 C;  1PH7 A;  4UHV A;  1VQ7 A;  2JA8 G;  5C4Z A;  4ZLT F;  4RKB A;  2BDO A;  1HR0 Q;  4IFD I;  1EEI D;  3D4R A;  2IX1 A;  2L12 A;  1YI2 A;  4FXG C;  4LF7 L;  2ALY B;  2XVS A;  1OXS C;  3HFZ B;  2CQO A;  4IQZ A;  4JV5 L;  3IFT A;  4LK1 C;  1K3R A;  3A8K E;  2A68 D;  4OEL B;  1PA6 A;  4JYA L;  1EY4 A;  2NZ1 D;  1BDO A;  1J5E Q;  4IUV A;  3I2Z A;  2A8V A;  3OMG A;  4P75 A;  2YYZ A;  1P16 A;  4LF5 Q;  3NTK A;  1QZH A;  1F2L A;  3F2B A;  4A3E G;  3RLF A;  2QEX A;  3P75 A;  2KEN A;  4X64 Q;  2E74 C;  4OX9 L;  4OHJ A;  1QCB D;  2QDB A;  3TZD A;  3AMU A;  1E24 A;  2IL8 A;  4JC0 A;  1TKW B;  3I7F A;  1UE1 A;  1TWG H;  3PV0 A;  1WTR A;  4X65 L;  1QIL A;  3DWA A;  2RA4 A;  3SHL A;  2YTX A;  4OO1 I;  1PFB A;  1RDP D;  3EA6 A;  2YU9 B;  3K0Y A;  2K5V A;  2ZJQ A;  1NE3 A;  1KLG D;  1TWG B;  1TR5 A;  4BY1 H;  3GTK H;  2RKS A;  4DFA A;  1SJE D;  4J15 A;  5CYU A;  1KXL A;  1EIG A;  3QB3 A;  4A3B H;  4LF4 L;  3PCO B;  4IFD G;  1JOK A;  2EY1 A;  1GKH A;  2FXQ A;  3QG1 A;  2EY2 A;  4BY1 B;  3J7Y W;  3GTK B;  4K2K A;  1SEB D;  1ICW A;  3GTQ B;  1JOR A;  1YNX A;  4RCN A;  4WOR A;  4A3B B;  2UUA Q;  2E75 C;  4ZRZ A;  4IPH A;  2Z8L A;  3SGI A;  4CDD C;  3PMF A;  1WVL A;  3URY A;  3K7U C;  2EVB A;  1U5K A;  4C3I B;  4DAM A;  2ID0 A;  4R4C A;  3FKI H;  4HMJ A;  1IBK Q;  4IUT A;  2C35 B;  1Q8I A;  3I72 A;  4L63 B;  5EJW A;  2D9U A;  1FNV A;  4BY7 G;  2L0C A;  1V43 A;  4DR7 L;  1PZK D;  4A3M G;  4OL7 A;  1VMP A;  4HCS A;  1CSQ A;  2Z0S A;  4CJ0 B;  4A3J B;  1D1K A;  3PUV A;  3HP3 A;  4ME5 A;  3NK9 A;  1WTO A;  4BXX G;  5EKK A;  2CVR A;  1SE2 A;  2E76 C;  3J7Z C;  5AJ3 L;  3PO2 G;  4Q0F A;  3UI2 A;  2ZTE A;  3NUC A;  3KDF B;  1X55 A;  5ELN A;  1QUQ B;  4R4O A;  1GVP A;  3NWS A;  5IWA Q;  4DV5 L;  2RDG A;  1SE8 A;  3ERS X;  2F0H A;  4DA2 A;  3CRK C;  3TP8 A;  5K36 G;  1RKN A;  1S5C D;  2F0W A;  3E3X A;  4DKA C;  2F3V A;  2PZU A;  4JK1 C;  3KFU A;  3O13 A;  2EYJ A;  3TS2 A;  5GAD C;  2LFN A;  4PMC A;  4DV0 L;  2Z6B A;  4DV1 L;  1SRU A;  1A15 A;  1Q1B A;  4CKB A;  3SDZ A;  1TWC H;  4DXF A;  4PG3 A;  1D6E C;  4P73 A;  1N9W A;  1TQO A;  4G7H C;  1PFN A;  3CPW A;  3DWP A;  2K50 A;  1SBB B;  1VCI A;  5J3B A;  1E1O A;  1G2T A;  1KNE A;  3ND9 A;  1PYW D;  1TWC B;  1ZEQ X;  3S17 H;  2ZXP A;  5J39 A;  4TKO B;  3G4S A;  1L0X B;  1KDB A;  1E2V A;  1Q90 A;  1BVS A;  3VR2 A;  2F0V A;  2B2W A;  3IKJ A;  5K5P A;  3JAM i;  3VR3 A;  2JE6 I;  4DK6 C;  1NNX A;  1L2F A;  5E7N A;  2JEA I;  4O1N A;  1L0W A;  4L8J A;  4OO1 H;  1EIF A;  2HQE A;  4A3D G;  4NXN L;  1WTH A;  5DM7 3;  2PQE A;  2SEB D;  4Z9C B;  4A3G G;  1YNJ C;  2HHH L;  1B1Z A;  5CGK A;  1ZYR D;  2D2C C;  3TZU A;  3H0G G;  5JEA H;  2ENB A;  5EAY A;  2EY5 A;  4J1M A;  3RNU A;  3HOX B;  3E9H A;  5IT9 L;  3TDQ A;  4H02 A;  4QUF A;  1PV4 A;  1VQE A;  1ONL A;  2DY8 A;  5BN5 A;  3UDG A;  3TP5 A;  3T1Y L;  1HNX L;  3JAM c;  1IZ6 A;  3UDI A;  4N9T A;  3ICE A;  3RLO A;  4NKL A;  3H3V I;  1XNQ L;  1B3Q A;  1IBM Q;  1XXG A;  3AFP A;  3LWU A;  4QJF A;  5COR A;  2EXZ A;  5H1S E;  4J8Q A;  2JK8 A;  3S24 A;  1A62 A;  1EOT A;  4AQY L;  4X66 Q;  1MSH A;  1AH9 A;  3I4N H;  4DUZ Q;  4HMI A;  1AP0 A;  3NQT A;  5HGQ A;  4YIJ A;  4KMU C;  4RA8 A;  3QO2 A;  2VUM G;  1SFO H;  1IHZ A;  2LXK A;  4A3C G;  2LS0 1;  3HOU G;  2F0I A;  3I4N B;  4FP5 D;  5FLM G;  3RR5 A;  1IBL L;  2R7Z G;  2Y0S B;  4JI7 Q;  3T16 A;  2R93 H;  4X62 L;  4L5Q A;  4EQO A;  5C3E G;  1JWS D;  4DV2 Q;  2BE5 D;  1SFO B;  2QIL A;  1JE4 A;  4POF A;  2F4V L;  1ESF A;  2B2V A;  3I4O A;  4C1N I;  3OW2 A;  2HCI A;  4F8M A;  4A93 H;  4JI4 Q;  2R93 B;  3K57 A;  4TRD A;  2E5L L;  3CD6 A;  1SNO A;  1SJH D;  1HPC A;  1OTC A;  4LFC Q;  1G6Z A;  2J0T D;  2RF4 A;  1NMF A;  3M7G A;  2EJG C;  1QZG A;  5D3D A;  4A93 B;  3FHW A;  1HA6 A;  2VB3 X;  2VQF Q;  2HCC A;  5JOB A;  2ASB A;  3E9I A;  1M4V A;  1F77 A;  4IUR A;  4IPC A;  1RTN A;  4DUY L;  2UXB L;  5C5L A;  4P71 A;  3MA2 B;  1KIX A;  3PGZ A;  3GTL H;  5C6A A;  3Q8D A;  4JI1 Q;  3RD4 A;  5FO7 B;  2N8N A;  4IAL A;  3T51 B;  1XMQ L;  1HUN A;  1EUJ A;  5HUR A;  1HFG A;  4ILW A;  4ZKB B;  5IP7 H;  3NBI A;  3S14 H;  2Z9H A;  3GTL B;  1HHV A;  4DV6 L;  2A74 C;  4S3S A;  1QVG A;  2JA6 G;  3LGJ A;  5HGT A;  1SNM A;  4MNO A;  3H6M A;  2FFK B;  3S14 B;  1SYD A;  1N34 Q;  4FXK C;  3ERQ A;  2H4O A;  3NBH B;  5ELE A;  2BCO A;  2ZJR A;  2QF7 A;  4F7X A;  4HR7 B;  2AHO B;  2K05 A;  3JC6 6;  1IXR A;  1LTB D;  4GNX B;  5LMU Q;  5M5X H;  1XX8 A;  4B3S L;  1VQN A;  3NSW A;  1PH9 A;  1STB A;  1PFM A;  4HID A;  1HCZ A;  4LMQ D;  5EKL A;  5BR8 Q;  2JJQ A;  3OIP A;  4ALP A;  2EYO A;  4Y7N H;  5M5X B;  2EDG A;  1W2B A;  4FO2 A;  1HR0 L;  1XTC D;  3CCV A;  1AEX A;  4MZ9 A;  1ENC A;  4QQB X;  4QB4 A;  2KCN A;  1EQV A;  4E6I A;  4F87 A;  5C44 B;  2A73 B;  1DOM A;  1TWF H;  1SMY C;  1KAW A;  3BDO A;  1V1P B;  4K8J A;  1ESR A;  4BBS G;  3PUZ A;  1YHQ A;  1B50 A;  4HIM A;  1G91 A;  1EL0 A;  4GLA C;  1Y1V G;  2VW9 A;  1J5E L;  1VQ6 A;  3BYY B;  3CC7 A;  4LF5 L;  5IYB H;  3CHB D;  1KNA A;  4LFA Q;  1E7Z A;  1PRT B;  4X64 L;  2CH4 W;  3VDY A;  1TS2 A;  1N36 L;  5IYC H;  5FJ8 H;  4DV0 Q;  3S9W A;  2UU9 Q;  5NUC A;  2JA7 H;  1PYB A;  3D8G A;  1LTL A;  1CZW A;  3RZO H;  1Q46 A;  4JCV E;  2JA5 G;  3SK6 A;  1K8A C;  3HEJ A;  3ERO A;  1FVI A;  2JA7 B;  4YWM A;  2O2L D;  4KI0 A;  3A74 A;  4R8I A;  3J81 E;  3D4W A;  4BWG B;  4KV6 A;  5I9P A;  2QA4 A;  1L1O C;  2VY3 A;  2EIF A;  2L11 A;  4YCV A;  4L6T B;  2MO1 A;  1RHP A;  4HSV A;  2B2Y C;  3GTO H;  2KEE A;  5CR3 A;  4JI8 Q;  2OXP A;  3AFQ A;  1I94 Q;  3PSI A;  2X6L A;  1KDA A;  1Z6H A;  4RFB A;  3AEV A;  1OXX K;  5T1G A;  1SE4 A;  3W3A A;  2F0K A;  3GTO B;  5CV4 A;  4BBR G;  1T5E A;  5M3F H;  1OXV A;  2A5H A;  2UUA L;  1KAB A;  1LO5 D;  3BZC A;  1C8C A;  4AYB E;  3CCQ A;  1LAC A;  1X3P A;  2RCF A;  2M9V A;  4A3I H;  3MEF A;  1EFI D;  3WWV A;  3PO3 H;  3CP0 A;  1YJW A;  4C3J H;  4JOI C;  1CHQ D;  1CTM A;  3TP6 A;  3QJY A;  4C3H H;  3J80 E;  3E0J A;  1SLJ A;  4A3I B;  2F0Q A;  2RHQ B;  1R9T H;  2SNM A;  3NBH A;  3PO3 B;  4C3J B;  2KEC A;  4NDX A;  4HSP A;  2DNE A;  4JBW A;  4DR3 Q;  4KKU A;  2JEB I;  4WFN 3;  1XNQ Q;  1HZC A;  2F0N A;  1R9T B;  2R92 B;  2IJ0 A;  2DN8 A;  2K5N A;  1HZ9 A;  2X69 A;  4GNX A;  3Q24 A;  1O78 A;  5ELB A;  1V1Q A;  1N33 Q;  1LV9 A;  1A6X A;  2NZO A;  3H94 A;  2EQS A;  3F8T A;  2XRQ D;  4MIU A;  4A3K H;  5IYD H;  3PIP 3;  5C0X I;  3BG3 A;  1O80 A;  3K5N A;  2KVM A;  3T13 A;  3WDN A;  2RDH A;  1GUS A;  4KHZ A;  1EZ6 A;  2R61 A;  3RMH A;  1EQR A;  3EIV A;  3BS1 A;  3DM3 A;  2NB0 A;  3P20 A;  5EKI A;  4LF9 Q;  4JBJ A;  4XIG S;  4A3K B;  1SAP A;  3LX0 A;  4YCU A;  1N32 Q;  4RAU C;  1BF4 A;  1YHB A;  4C2M H;  4I7A A;  4PV1 C;  2IPK D;  1MJE A;  3SXH A;  3WOE A;  1C4Q A;  2EYP A;  4NXM Q;  2VZA A;  2F0U A;  5EPJ A;  3MVV A;  4C2M B;  3F2U A;  5IIF A;  2PQA B;  3CCL A;  1TXY A;  3BJU A;  2BOS A;  3CW2 C;  1TU2 B;  1SRO A;  1BCP C;  2Z4I A;  2MO0 A;  1CK1 A;  4EX5 A;  2K75 A;  3HOY G;  2IT1 A;  1C48 A;  4EQN A;  4XDX A;  3OHX C;  5DLQ E;  1DGS A;  3OWF A;  1HJP A;  1HRJ A;  2JXM B;  4IPG A;  1BBW A;  2F0L A;  2SOB A;  2V1C C;  2IHF A;  1WCM B;  2A68 C;  2E2J H;  5IGB A;  4OWW B;  5KNC A;  3L9A X;  1ET9 A;  3C1F A;  2AWN A;  4DV6 Q;  1EYA A;  2R3Z A;  1VQO A;  3I70 A;  3TQY A;  4B3T Q;  2F4I A;  4GN4 B;  5ELD A;  4RHS A;  1IW7 C;  2E2J B;  1U9R A;  3Q22 A;  3A5U A;  1HUM A;  2QKI C;  1IL2 A;  1BCP B;  3MXG A;  4F88 A;  3CKI B;  1P8L A;  2IX0 A;  1CQV A;  1FNW A;  2WKC A;  4U68 A;  2L9H A;  3ZJY C;  1IBM L;  4DR4 Q;  3H09 A;  4G7O C;  1RL2 A;  2WII B;  2X6G A;  3NHH A;  3R2I A;  1KHI A;  4DK1 A;  4YHH Q;  4HAE A;  2K5H A;  2VL6 A;  3T53 B;  4X66 L;  4DV3 Q;  2FJ2 A;  1L1O A;  4DUZ L;  2N49 A;  1PMR A;  4HCE A;  2F3W A;  2B2Y A;  3IRB A;  4X3T A;  4K5V A;  1HNW Q;  1YVC A;  2B29 A;  1NR2 A;  1N8R C;  5BN4 A;  2F1M A;  1I6V C;  2VB2 X;  4JI7 L;  1GJX A;  5M3M H;  1JOO A;  2LMC B;  4OON A;  4DV2 L;  1HZA A;  4BY1 G;  1L0Y B;  3OPO A;  1Q82 C;  1TY0 A;  2VXW A;  3MXP A;  1PTO C;  5CV6 A;  4JI4 L;  4A3B G;  1FYC A;  5M3M B;  3RZD H;  1VQH A;  4X6A H;  4LFC L;  5EPL A;  3SK5 A;  4RCO A;  3HOV H;  1N36 Q;  4C3I G;  5KRU A;  1GHJ A;  1CM9 A;  1Z47 A;  4NB3 A;  5EBC A;  2ZXR A;  1PLF A;  3RZD B;  3KYH C;  1EY5 A;  4WJ3 M;  2VQF L;  1G8Z D;  3GTP H;  5FO8 B;  4UAI A;  1LT4 D;  3EBE A;  3C46 A;  1LTA D;  1JMC A;  1PTO H;  1D2B A;  4MTK A;  1VF5 C;  1SDF A;  1LYL A;  1I50 H;  4FF4 A;  3S15 H;  4JI1 L;  3NPP A;  1X32 A;  5C4X H;  2PQA A;  3DEO A;  4A3J G;  3AU7 A;  4Y52 H;  3S16 H;  1PTO B;  2BH2 A;  2MJ8 A;  2JA8 H;  2WB1 E;  3DHQ A;  4RGT A;  5T1I A;  3J81 i;  1AZP A;  1ICF B;  4KK7 A;  2EJF C;  1JB7 A;  2BDN A;  1VQ5 A;  4P2C B;  3HGB A;  1N34 L;  3S16 B;  1EWH A;  3D6W A;  2JA8 B;  3N6R A;  1KL9 A;  3NQI A;  1WTX A;  1W6J A;  1I4X A;  1BNZ A;  1CZG A;  3KLW A;  1GD7 A;  3OYY A;  1KQS A;  3FVQ A;  3HOW G;  2G9H D;  5LMU L;  1UAP A;  2F0P A;  1O7Z A;  4OIK A;  5M5Y H;  4HJA A;  4JI0 L;  3KLS A;  1F2Z A;  1HH2 P;  1HZB A;  1A3U A;  4A3E H;  2EZV A;  1CKN A;  1X9N A;  2NYZ D;  5BR8 L;  1K73 C;  3DXJ C;  1YNN D;  4IO9 A;  5DAU A;  1B4O A;  1JT8 A;  3NTH A;  5M5Y B;  2IW3 A;  1U4R A;  3OIQ A;  5D3I B;  1AN8 A;  3VYU A;  3J81 c;  3FKI B;  1PDQ A;  5JEA J;  1B44 D;  1JCK B;  1T9H A;  3MEH A;  4A3E B;  1VQI A;  1I4R A;  3J80 i;  2O5I C;  3HOZ H;  3MWY W;  1RJT A;  5LMN W;  4BA1 I;  2Y0S E;  2LSS A;  4LF6 Q;  1Y8N B;  3MAQ A;  3UE1 A;  1ZXT A;  1F9Q A;  1U4M A;  1FL0 A;  1B7Y B;  2EYF A;  2SDF A;  5IP9 H;  3HOZ B;  3DUZ A;  2F0O A;  2F0M A;  1I4P A;  4DU9 A;  4A76 A;  4LUV A;  2OTJ A;  1EYG A;  4KD3 A;  4LFA L;  1A3T A;  3TRZ A;  4IFD H;  1STE A;  1Q7Y C;  5JVH 3;  1DOK A;  4YY3 Q;  2EE1 A;  3DM1 A;  1AE2 A;  4BA2 I;  2UU9 L;  1Y1W H;  3VA5 A;  4B9X A;  2Q8T A;  4GKJ Q;  1WFQ A;  5KEE A;  1S40 A;  3UE0 A;  4YCW A;  5LMN Q;  1I5F A;  2B63 H;  2F52 A;  1BQQ T;  1SYE A;  2D0P A;  3I4L A;  3G71 A;  3HOX G;  1XPR A;  3J80 c;  1B9N A;  1OXU A;  4JW0 A;  2UUC Q;  1Y1W B;  3NTI A;  5GAH C;  1WD1 A;  3EQL C;  2XWJ B;  4DNI A;  3RUZ A;  3D3R A;  2B63 B;  2A19 A;  4OEM B;  2EY6 A;  2E2I H;  4FVM A;  2E2H H;  2EPB A;  1GUG A;  1KAA A;  1FD7 D;  4UP9 A;  4JI8 L;  4PNY A;  1I94 L;  3S17 B;  4TVA B;  1ILP A;  5EPK A;  2E2I B;  4H7B A;  2E2H B;  3PF4 A;  4BXX H;  1EY6 A;  4PMW A;  4CDE C;  1GUW A;  1GUT A;  3D31 A;  3U4V A;  1YIJ A;  1UUP A;  2A6E C;  2PI2 A;  3I3C A;  3J7A V;  3I4N G;  3PO2 H;  2QEJ C;  5I4D A;  2Y0S G;  1PRT F;  1F2Y A;  4DNR B;  2WB1 B;  3DLL A;  1PH8 A;  3X3N A;  2RBM A;  2WV6 D;  3TN2 A;  3HRZ C;  2O5J C;  4V0B A;  5AFW A;  2R93 G;  2XRS D;  3QWN A;  5I6W A;  5LL6 S;  4G7Z C;  2LXJ A;  1LTR D;  5C4J H;  2UUB L;  4QL5 A;  5CBA E;  5KGU A;  4FDB A;  4C56 C;  1FJG Q;  5JJK A;  4MN3 A;  5KND A;  4DR3 L;  3DMU A;  3F2D A;  5IOD A;  4B08 A;  1XWE A;  3K5O A;  4DAY B;  5C4J B;  3HKZ B;  1SE3 A;  1QB5 D;  4KY5 A;  2I46 A;  4N8X 1;  2J4X A;  1ET6 A;  2F0E A;  1N33 L;  1RD9 D;  4ZK9 B;  4IJL A;  4PZ8 A;  1G6P A;  4JI3 Q;  2DUD A;  2B8G A;  3EN2 A;  1D5Z C;  2OQK A;  2K32 A;  3M4O H;  2D62 A;  3NP8 A;  4EGV A;  4A3F H;  5KYL A;  1V9P A;  4LF9 L;  2D0O A;  1UE6 A;  3KJP A;  1N32 L;  2F0G A;  1QNU A;  4LFB Q;  5CV8 A;  4QY7 A;  2VQE Q;  3KF6 B;  3M4O B;  2YV5 A;  5I9O A;  3S1M H;  2UXC L;  2WP8 J;  2FMC A;  1C9O A;  3D4D A;  4CHT B;  5IP7 G;  4A3F B;  2H5X A;  1Q3L A;  3R93 A;  4NXM L;  4TQU S;  5EQ0 A;  1EFW A;  1MBY A;  4IUP A;  1NR4 A;  2MNA A;  1XMO Q;  3S1M B;  3CF5 A;  4LAA A;  3H0G H;  1ZKO A;  2JYO A;  1VQK A;  2M2L A;  2NUC A;  4DR1 Q;  3GD7 A;  4NPS A;  1A8V A;  3ULL A;  3PIP A;  5GQO A;  1UNS A;  5GRO A;  1YNJ D;  3CCE A;  3S1N H;  2B2T C;  4H44 C;  1VQ9 A;  4KJN A;  4FYD A;  1M8A A;  1ML0 D;  4NW2 A;  4CDC C;  3KBG A;  5C44 G;  3C2P A;  3GP7 A;  5C5M A;  3KOJ A;  3S1N B;  2JN4 A;  3W2D A;  1Q1E A;  3R2T A;  1TY2 A;  4CJ2 C;  2F0T A;  4HED A;  1II3 A;  4B3T L;  2KCM A;  3ZYY X;  4KKS A;  4A3L G;  3CCR A;  1GM5 A;  3K5M A;  2R7Z H;  5C3E H;  3K7A H;  2L5T A;  1EEF D;  1SNC A;  3I4M H;  1ASZ A;  3CAM A;  1LT6 D;  2ICI A;  2IY5 B;  3H3V C;  4JI0 Q;  3D6C A;  4DR4 L;  5C3E B;  4MHE A;  3SK4 A;  3K5L A;  4YHH L;  5IYC G;  3HKS A;  2ATW A;  5FJ8 G;  1ENF A;  2EYM A;  2KA7 A;  3I4M B;  1SSO A;  4DV3 L;  2QW7 A;  5LL6 X;  4ID6 A;  1H9S A;  3W1G A;  1KD1 C;  2XSC A;  1EY0 A;  1W3S A;  3A56 A;  1BXT A;  1E2W A;  1H9R A;  4IUQ A;  1CHP D;  1HNW L;  1T5X D;  4M1U B;  5GAE C;  4Y7N B;  3CMA A;  1WTQ A;  1MD2 D;  3H3V H;  1VQA A;  3G48 A;  4H0L C;  3FRP B;  4R1J A;  4DAY A;  5DEH A;  1YHA A;  5ISR A;  4XQJ A;  2A6H D;  4CJ1 B;  1SR3 A;  4TSS A;  4B3R Q;  4KJO A;  1VQD A;  5FK9 C;  4YWK A;  3VR4 A;  1TWF B;  4X3K A;  3RN2 A;  1LAB A;  2Z6K C;  4JI2 Q;  2AMC B;  4KD4 A;  4KY7 A;  1WD0 A;  5IY0 A;  4KHP L;  1VQ8 A;  4LW1 A;  2E2D C;  1ROD A;  1PXU A;  3S1R H;  2JA6 H;  4DV4 L;  2PMZ E;  5ELO A;  1EU4 A;  1J8I A;  4O0A A;  2KHI A;  1JWM D;  2SNS A;  3G6J B;  3SR1 A;  3M85 A;  1VQM A;  2JA9 A;  2H1E A;  4WJ4 A;  3QOL A;  3A7A B;  3FP9 A;  3VR5 A;  2OF1 A;  1MIU A;  3KF6 A;  2JA6 B;  2WAC A;  4LNQ A;  1LTS D;  4A3I G;  5A2Q E;  3PO3 G;  3M7N A;  4DF7 A;  1XNR Q;  5M9O A;  2K5D A;  4C3J G;  3BDC A;  3RZO B;  3NEL A;  2K03 A;  1SYB A;  4HJ7 A;  1I3Q H;  1VQB A;  2NN6 G;  5A35 A;  4GLV B;  1A2U A;  2R92 G;  1K8M A;  3ONA B;  3W5O A;  1SNQ A;  2Q8I B;  2WAQ E;  5C3X A;  2MP1 A;  1EWI A;  5FOB B;  3S2H H;  2XGT A;  4X3S A;  2LKV A;  1I3Q B;  1SND A;  3TP7 A;  3J80 L;  2IWH A;  3TRE A;  1Z7T A;  3LNN A;  4H13 C;  2GA4 B;  4K6L A;  1PRT D;  1VQF A;  5J1Z A;  4DR6 Q;  3S2H B;  3L7Z C;  4LJZ C;  1NMG A;  4BBS H;  4HN7 A;  1VDZ A;  3T4A C;  2NVY H;  5IYD G;  1F9S A;  5FLX E;  2HQL A;  1NUC A;  2DJF C;  5M3F B;  2I5M X;  4ZUI A;  3GTG H;  4BBS B;  2O4X A;  1F9P A;  3OOC A;  3GDE A;  1L1O B;  2K28 A;  2BH8 A;  3EFX D;  4R4I A;  2UUB Q;  2CW0 D;  3G7L A;  5D14 A;  2WIN B;  1S4Z A;  4OWT B;  1U4L A;  2G5D A;  2L55 A;  1TS5 A;  1BUV T;  2PYK A;  1VQJ A;  4C3H B;  1Y14 B;  3OTO Q;  2B2T A;  1DM0 B;  4QF4 A;  3PUX A;  2MQH A;  2AQ3 B;  5COY A;  3V2T A;  1YJ9 A;  3M4P A;  4LF6 L;  1LTT D;  3NXW A;  1K0S A;  5D65 A;  3FPU B;  1HNZ Q;  3K8A A;  2PNH A;  2Q2T A;  1TT2 A;  4DAP A;  3JAM L;  1EYC A;  2I5H A;  1WCM G;  2WKD A;  3CRL C;  1AW7 A;  3MTS A;  3T56 B;  1X54 A;  1AFP A;  1Y8P B;  4CKE A;  3A8J E;  4YY3 L;  4GLX A;  1QVC A;  5CBE E;  3M3Y H;  4BBR H;  4GS3 A;  5E4X A;  2KHJ A;  1R4P B;  3J7A 5;  4GKJ L;  2UXC Q;  2A69 C;  5LMN L;  2CWP A;  4Q5V A;  3CC2 A;  3TME A;  2ZTC A;  4O2D A;  5IGG A;  3M3Y B;  3M4Q A;  4BBR B;  2UUC L;  3E6Z X;  4APV A;  4AYB G;  3FDT A;  3L0O A;  2PI2 E;  3L3O C;  3HZX A;  3HS0 C;  4RHR A;  2PMZ B;  3PUW A;  1K9M C;  3EVQ A;  1DJR D;  3A7L A;  1F2M A;  1DCZ A;  2PZT A;  3I90 A;  1PZJ D;  2OCE A;  2OT2 A;  4DNT B;  4LWC A;  2NTS A;  2K33 A;  2RDF A;  1EY9 A;  1YZ6 A;  4QCL A;  1EOV A;  1EZ8 A;  1LM0 A;  4HTH A;  3VYT A;  3STB D;  5IGF A;  2QCP X;  1VF7 A;  2QGQ A;  3T1H Q;  1JIC A;  1LTG D;  1SMX A;  3MXU A;  1BOS A;  1NJI C;  4G57 A;  3L2P A;  4J6H A;  3N52 A;  2HD3 A;  2WAQ B;  2GVA A;  1HFN A;  2Z6K A;  2NVQ H;  3V96 A;  1FR3 A;  2CKZ B;  1EYD A;  3MZ5 A;  5E3F A;  1VQL A;  1CKN B;  4GOP C;  2K01 A;  4PZ7 A;  4XXE A;  4DR5 Q;  1PH6 A;  2EXD A;  1S5B D;  2NVQ B;  3MC0 B;  2Q8R E;  2RHS B;  3PIO 3;  2XIW A;  2JSO A;  4M8A A;  4HJ5 A;  2K6A A;  2C5C A;  1FJG L;  3CCU A;  3HG9 A;  3DEP A;  2NWG A;  5I6Y A;  3UDX A;  4XT3 B;  1YJN A;  1B70 B;  4ZUJ A;  1JJG A;  4B3M L;  2KCC A;  1HR0 W;  2MPM A;  1TS3 A;  1NAP A;  5JPN C;  1KRT A;  2E8G A;  1X6O A;  3S1Q H;  4JI3 L;  4DR2 Q;  1TVX A;  2ZM6 Q;  2YTV A;  1VQP A;  1ASY A;  2IX3 A;  4GOP B;  1MI2 A;  2AQ2 B;  1PH5 A;  3HOY H;  1PVO A;  4KN4 C;  4L5S A;  2XNA C;  4C1N K;  2KOL A;  2K5Q A;  4GZY C;  4LFB L;  2VQE L;  1CKM A;  4XQQ A;  1NTG A;  1XPU A;  5FO9 B;  1BCP D;  1LT5 D;  3BVG A;  3HOY B;  4RGN A;  1R4Q B;  2B2W C;  1K8O A;  2F0J A;  4KHP Q;  2K7V A;  3VR6 A;  5C0X H;  1WTP A;  2N78 A;  1XMO L;  1Q12 A;  3OWE B;  4DV4 Q;  1B53 A;  4P72 A;  4JOI A;  1O7L A;  2B2U C;  1SYG A;  3BVZ A;  2L15 A;  1YNN C;  4DR1 L;  1E1T A;  4IFD J;  2K5W A;  1CFM A;  3WOF A;  3D0F A;  1VQ4 A;  3G6E A;  1Z9F A;  2L1B A;  4OGQ C;  3HOV B;  2QDL A;  4DK3 C;  2HDL A;  1G51 A;  2JQO A;  4POG A;  1QNK A;  4QIW B;  1TS4 A;  3FKI G;  1CI3 M;  1IW7 D;  3CCM A;  3GTP B;  2DY7 A;  1EIH A;  3BVM A;  1KC8 C;  2XN9 C;  1FGB D;  2WFW A;  1PZI D;  3KJO A;  4K5W A;  1WOC A;  3KF8 A;  2YU9 H;  1I50 B;  1JC7 A;  1V8Q A;  3S15 B;  5KNB A;  1SXT A;  1H9M A;  1S5E D;  5C4X B;  4RGO S;  4DAV A;  1XTD A;  3TBI B;  3HOZ G;  1IKM A;  4K6D A;  2BA1 A;  4RKL A;  3MXN B;  4XYO A;  3KBX A;  3AYH B;  2MFI A;  5ELC A;  3GQB A;  2KHS A;  4K8I A;  1A63 A;  1QWY A;  2PW5 A;  5IP9 G;  3I56 A;  1KLU D;  1K0R A;  4UP8 A;  3TS0 A;  4G4K A;  1TWH H;  4RWS C;  1D8L A;  1X65 A;  3GTQ H;  2UXD Q;  3TSS A;  4JBK A;  4CGY B;  1RTO A;  1IKL A;  2L4N A;  3K80 C;  3RN5 A;  2AUK A;  5J22 A;  3HKZ E;  3GTM H;  1D5X C;  2PPB C;  1JR0 D;  2KUM A;  1FNU A;  1MHW C;  1HQR D;  1SNP A;  1TWH B;  1C7Y A;  1MGS A;  1I4H A;  2DGY A;  2CWA A;  3K59 A;  1Y1W G;  1JOQ A;  4C3I H;  1JJ2 A;  3CPF A;  4UP7 A;  1MSG A;  4QGU A;  3GTM B;  3J81 j;  2B63 G;  2B2V C;  1AE3 A;  1PTO D;  4JI6 Q;  4JI5 Q;  1Q86 C;  4R8N A;  2NVT H;  3BDL A;  4K0K Q;  1E3P A;  3Q0A A;  5M5W H;  2CQA A;  2FIN B;  4ABN A;  2EYL A;  2HUG A;  4B3R L;  2R6G A;  4KLK A;  4AH6 A;  2NVT B;  4DPG A;  4A3J H;  5EBD A;  3DWQ A;  2KCT A;  4ULL A;  3RLN A;  4JI2 L;  1RIP A;  5M5W B;  3U9S A;  4GKK Q;  2B39 A;  1V1O A;  1KDC A;  2EYH A;  1QVF A;  5FLX c;  4LF8 Q;  1E0B A;  2WB1 G;  3NEN A;  4GOP A;  1MJC A;  3UDF A;  1ZYR C;  4ZKC B;  1STN A;  1B8A A;  3SE0 A;  4OO1 G;  4IZ8 A;  1JJC B;  2TMP A;  2Z1C A;  4N8F A;  1PH2 A;  1EU3 A;  4NMZ A;  5KYI A;  4K14 A;  4DN4 M;  2K14 A;  4FF1 A;  4IUN A;  1K28 A;  4ZCK A;  4FNF A;  1G2S A;  3HOW H;  4XTC S;  2F0S A;  1XNR L;  4EQ5 A;  2OTL A;  1I4Q A;  5JEA G;  5G3L F;  5IGD A;  4HIO A;  3ER0 A;  3K58 A;  3C3L A;  3K0X A;  3HKZ G;  3HOW B;  5I2Y A;  1STH A;  1DXM A;  4UY8 C;  2RCN A;  1S72 A;  4BY7 H;  4A3M H;  5HY6 A;  1WTV A;  2I07 B;  4R9W A;  1X3F A;  4XQN A;  1GUN A;  5JAV A;  3IAY A;  3P1H A;  4DR6 L;  1CSP A;  1VQC A;  2K52 A;  4BY7 B;  2PW7 A;  4A3M B;  4NP5 A;  4AIM A;  2BE5 C;  2ES2 A;  3I91 A;  1FGU A;  1W6K A;  4PQX A;  5CV5 A;  4HJ8 A;  3CXC A;  2J7Z A;  4OWX B;  4A3F G;  4V19 0;  3PO2 B;  5K36 H;  1D7Q A;  3GV3 A;  4A75 A;  2ICE C;  2P5Z X;  5EGT A;  2RSO A;  4KTA A;  4CKC A;  2C9O A;  5DM6 3;  1ENA A;  1H9S B;  3MXN A;  3ULJ A;  1VMC A;  2B2U A;  1SN8 A;  4MTN A;  4HJ9 A;  4I7Z C;  4A93 G;  3CCJ A;  4PMB A;  1BBU A;  2FHT A;  3SVM A;  3HOX H;  2RSN A;  3OTO L;  3H15 A;  1CKO A;  1UWV A;  3A5Z B;  3W1B A;  4WJW A;  4B3M Q;  1I6H H;  1ILQ A;  3R8B A;  1D5M C;  5C3W A;  4RGM A;  1VQG A;  3KLR A;  3U4Z A;  3M4Y A;  1HNZ L;  3AB9 A;  1I6H B;  2G9D A;  4FXD A;  3I55 A;  1LLR D;  5CMD A;  1JE5 A;  1HTP A;  1STA A;  4CBV A;  1Q81 C;  2NTT A;  4P74 A;  2NBF A;  1IYU A;  1YBY A;  2D5D A;  1EQQ A;  1M90 C;  1U0L A;  3OSO A;  2Q2U A;  4A3D H;  4DV7 L;  2RVL A;  2F0F A;  2PCF B;  3K6O A;  1LUZ A;  1PH4 A;  1EY8 A;  2HIV A;  3U9O A;  5IT9 E;  4A3G H;  1E22 A;  1GUO A;  1GXD C;  2F03 A;  1S5D D;  4LF7 Q;  4A3D B;  1D1I A;  2N88 A;  4JV5 Q;  3B6Y A;  2A6E D;  3P7J A;  2AQ1 B;  2OEO A;  4JYA Q;  4L5R C;  4A3G B;  4DK0 A;  3I4M G;  2I5L X;  3KDF A;  4IN3 A;  1JB3 A;  3H0G B;  5CC4 A;  3SK8 A;  1QUQ A;  3A8I E;  2CCZ A;  2JP1 A;  1DOL A;  1X3G A;  3T1H L;  2OQ0 A;  5JJZ A;  2AUJ D;  4OX9 Q;  2A6H C;  1UE5 A;  2PNR C;  4IUU A;  5KIX A;  4ZQ3 A;  1K3B C;  3BZK A;  2I0Q A;  4LUO A;  5GAG C;  1G29 1;  4LUZ A;  2VUM H;  4X65 Q;  4A3C H;  4DR5 L;  5CV9 A;  3OMC A;  4GNX C;  3NE5 B;  3HOU H;  5FLM H;  4XYQ A;  1H9J A;  1O7Y A;  1O7I A;  3EJI A;  2FMM A;  2VUM B;  3A0J A;  1BBX C;  1SYC A;  3BZD B;  1K8G A;  3HOU B;  5IYB G;  4B9W A;  1OXT A;  3M9B A;  4LF4 Q;  2R7Z B;  4CDF C;  3E0E A;  2HIX A;  4OIJ A;  3KK7 A;  3K7A B;  4I65 A;  1DZ1 A;  2NN6 I;  4EQP A;  5IGC A;  3U50 C;  1B3A A;  3VYR A;  3LWE A;  2JA7 G;  3BU2 A;  3VA7 A;  4DR2 L;  1S5F D;  4IJH A;  2ZM6 L;  5IOC A;  2BA0 A;  3H91 A;  5IGE A;  1RF2 D;  4YWL A;  2K4K A;  3KLS X;  2GVB A;  3I73 A;  3ULP A;  1GOZ A;  1GHK A;  1EQT A;  3GO5 A;  5TSS A;  1F9R A;  3J7A F;  4ZAI A;  3QR8 A;  1A0I A;  1PRT C;  3CME A;  1Q8K A;  2ZJP A;  2OWO A;  1TII D;  4R4T A;  4PZ6 A;  5C44 H;  5A2Q L;  1PYS B;  1LTI D;  3I8Z A;  3PIO A;  4ME3 A;  1PFS A;  3CCS A;  5IE8 A;  4EVO A;  3J81 L;  2Z4H A;  1DD2 A;  4DR7 Q;  4GN3 B;  5C4H A;  1NCV A;  1BCP F;  3FPP A;  3MHB A;  4FF2 A;  4A3L H;  5M3F G;  2N3S A;  1JQY D;  4WRD A;  2TSS A;  5AJ3 Q;  1B9M A;  1STG A;  1CT1 D;  5CV7 A;  3S1R B;  2CW0 C;  1H9K A;  5G3L D;  4DV5 Q;  2ZTD A;  2KQ3 A;  5JPM C;  3PF5 A;  5F2D A;  2K1B A;  3R3O A;  3QOJ A;  2KBN A;  1QE6 A;  2VS1 A;  5FLX L;  1K83 H;  3NWT A;  4QMG A;  3CU7 A;  1PH1 A;  4ZYS A;  1EIY B;  4C3H G;  2B8F A;  4FF3 A;  2XWB B;  1E2Z A;  3GV6 A;  3IL8 A;  4DV1 Q;  4HIK A;  3FMC A;  4R4Q A;  1WJJ A;  1K83 B;  4RH6 A;  3PUY A;  1IYJ B;  2DJG C;  2R7F A;  2PZW A;  2PO4 A;  1DYQ A;  5I2X A;  5BN3 A;  1M1K C;  4L5T A;  4UPA A;  4X3U A;  1GO3 E;  1XPO A;  1WYD A;  2VNU D;  4IPD A;  4A3K G;  1IL8 A;  3A55 A;  1Y1V H;  1J6Q A;  2UXD L;  4QUC A;  2DNC A;  1SYF A;  1SMY D;  2NVY B;  2KED A;  1YEZ A;  1PH3 A;  1Y1V B;  1H95 A;  1WI5 A;  2XTI A;  4GN5 A;  2YTY A;  1MKH A;  1AZQ A;  1NY4 A;  3GTG B;  1BR9 A;  4JBM A;  1UEB A;  4JI6 L;  1QG7 A;  1CUK A;  3V05 A;  4JI5 L;  4NXN Q;  4JG2 A;  2JA5 H;  3SEB A;  1QJO A;  4K0K L;  1S3O A;  2GN5 A;  3NEM A;  1TWA H;  3A54 A;  1HXY D;  2HHH Q;  1PTO F;  1IBK L;  3STB C;  3FEW X;  2K04 A;  1HA5 A;  3ND8 A;  2ZT9 C;  2JA5 B;  4K2L A;  2NN6 H;  1EWC A;  2CFM A;  1KRS A;  2R92 H;  1U4P A;  1UE7 A;  2MUY A;  1TWA B;  5E1F A;  4RG1 A;  4GKK L;  2F0D A;  3T1Y Q;  1HNX Q;  4UDU C;  2CHB D;  1CQF A;  5ELF A;  2WAQ G;  4LF8 L;  2Q2I A;  2KJX A;  3F1Z A;  1IYV A;  1DON A;  2MHV A;  1NBW A;  2HT1 A;  2MGS A;  5L37 A;  4IOC A;  4O42 A;  2CH4 A;  3OW7 A;  4K5X A;  2EJM A;  4AQY Q;  3Q23 A;  5JJL A;  4DV7 Q;  3MFG A;  5IWA L;  3AQQ A;  1HTL D;  4DXG A;  2A1A A;  3U58 A;  2AKW B;  4QIW E;  1QOH A;  1XYI A;  1LT3 D;  5FKA C;  3KUP A;  2NVX H;  1EY7 A;  2AWO A;  1IBL Q;  3CQZ H;  1KTK A;  3KF8 B;  4X62 Q;  1I4G A;  4XT1 B;  5C0X J;  1V1P A;  3IFD A;  1X3E A;  1B2T A;  1PHJ A; 
#chains in the Genus database with same CATH homology
 2ZXO A;  2NVX B;  1Y69 U;  3CQZ B;  3Q6S A;  1STY A;  2N55 A;  3JAM E;  4KKT A;  1JWU D;  1J9O A;  3BYT B;  3X3M A;  4ODG A;  1HQM C;  1WTW A;  2V4D A;  1A2T A;  3ITP A;  5DNF A;  5JVG 3;  1X3Q A;  1RCV D;  1CA5 A;  1CA6 A;  3E5S A;  5E4W C;  1BO0 A;  1NSN S;  2LY7 A;  3VYS A;  5C0X G;  3GTJ B;  3S2D B;  1A3V A;  5LHY 1;  4KHV A;  3C1E A;  4KN7 C;  2A69 D;  2M00 A;  4DGZ A;  4U67 3;  2HDM A;  1Y8O B;  4AYB B;  4N9P A;  4KY6 A;  3S1Q B;  4BS9 A;  2EOT A;  1UEA B;  1OO9 B;  3QIA A;  3MFY A;  2RQX A;  5C4Z A;  4ZLT F;  4RKB A;  2BDO A;  4IFD I;  1EEI D;  3D4R A;  2IX1 A;  2L12 A;  4FXG C;  2XVS A;  1OXS C;  4IQZ A;  3IFT A;  4LK1 C;  3A8K E;  2A68 D;  1EY4 A;  2NZ1 D;  1BDO A;  4IUV A;  3OMG A;  2YYZ A;  3NTK A;  1F2L A;  3RLF A;  3P75 A;  2E74 C;  4OHJ A;  1QCB D;  2QDB A;  3TZD A;  3AMU A;  2IL8 A;  1TKW B;  3PV0 A;  1WTR A;  1QIL A;  3DWA A;  2RA4 A;  3SHL A;  4OO1 I;  1PFB A;  1RDP D;  3EA6 A;  2YU9 B;  3K0Y A;  1KLG D;  1TWG B;  1TR5 A;  2RKS A;  4DFA A;  1SJE D;  5CYU A;  1EIG A;  3QB3 A;  4IFD G;  1JOK A;  2EY1 A;  3QG1 A;  2EY2 A;  4BY1 B;  3J7Y W;  3GTK B;  4K2K A;  1SEB D;  1ICW A;  3GTQ B;  1JOR A;  4RCN A;  4WOR A;  4A3B B;  2E75 C;  4ZRZ A;  2Z8L A;  3PMF A;  1WVL A;  3URY A;  2EVB A;  4C3I B;  2ID0 A;  4HMJ A;  4IUT A;  1Q8I A;  3I72 A;  4L63 B;  5EJW A;  2D9U A;  1FNV A;  2L0C A;  1V43 A;  1PZK D;  4OL7 A;  1VMP A;  4HCS A;  4CJ0 B;  4A3J B;  1D1K A;  3PUV A;  3HP3 A;  4ME5 A;  3NK9 A;  1WTO A;  5EKK A;  2CVR A;  1SE2 A;  2E76 C;  4Q0F A;  3UI2 A;  3NUC A;  3NWS A;  2RDG A;  2F0H A;  4DA2 A;  3CRK C;  3TP8 A;  5K36 G;  1RKN A;  1S5C D;  2F0W A;  2F3V A;  2PZU A;  4JK1 C;  3O13 A;  2EYJ A;  2LFN A;  4PMC A;  1A15 A;  1Q1B A;  4CKB A;  3SDZ A;  4DXF A;  1D6E C;  1TQO A;  4G7H C;  1PFN A;  3DWP A;  1SBB B;  1VCI A;  1G2T A;  1KNE A;  3ND9 A;  1PYW D;  1TWC B;  1ZEQ X;  2ZXP A;  5J39 A;  4TKO B;  1L0X B;  1KDB A;  1E2V A;  1Q90 A;  3VR2 A;  2F0V A;  2B2W A;  3IKJ A;  5K5P A;  3VR3 A;  2JE6 I;  2JEA I;  4O1N A;  4L8J A;  4OO1 H;  2HQE A;  5DM7 3;  2PQE A;  2SEB D;  4Z9C B;  1YNJ C;  1B1Z A;  5CGK A;  1ZYR D;  2D2C C;  3TZU A;  5JEA H;  2ENB A;  2EY5 A;  4J1M A;  3HOX B;  5IT9 L;  3TDQ A;  4QUF A;  2DY8 A;  1ONL A;  5BN5 A;  3TP5 A;  4N9T A;  4NKL A;  1XXG A;  3LWU A;  5COR A;  2EXZ A;  4J8Q A;  1EOT A;  1MSH A;  1AP0 A;  4HMI A;  3NQT A;  4YIJ A;  4KMU C;  4RA8 A;  3QO2 A;  1IHZ A;  2LS0 1;  2F0I A;  3I4N B;  4FP5 D;  2Y0S B;  3T16 A;  4EQO A;  1JWS D;  2BE5 D;  1SFO B;  2QIL A;  1JE4 A;  1ESF A;  2B2V A;  4C1N I;  2HCI A;  4F8M A;  2R93 B;  3K57 A;  4TRD A;  1SNO A;  1SJH D;  1HPC A;  1G6Z A;  2J0T D;  3M7G A;  2EJG C;  5D3D A;  4A93 B;  1HA6 A;  2VB3 X;  2HCC A;  5JOB A;  1M4V A;  1F77 A;  4IUR A;  1RTN A;  5C5L A;  3MA2 B;  5C6A A;  3RD4 A;  5FO7 B;  4IAL A;  3T51 B;  1HUN A;  5HUR A;  1HFG A;  4ILW A;  4ZKB B;  3NBI A;  3GTL B;  1HHV A;  2A74 C;  4S3S A;  5HGT A;  1SNM A;  3H6M A;  2FFK B;  3S14 B;  1SYD A;  4FXK C;  3ERQ A;  2H4O A;  5ELE A;  2BCO A;  2QF7 A;  4F7X A;  4HR7 B;  2K05 A;  1LTB D;  1XX8 A;  3NSW A;  1STB A;  1PFM A;  1HCZ A;  4LMQ D;  5EKL A;  3OIP A;  2EYO A;  5M5X B;  2EDG A;  4FO2 A;  1XTC D;  1AEX A;  1ENC A;  4QB4 A;  2KCN A;  1EQV A;  4E6I A;  4F87 A;  5C44 B;  2A73 B;  1DOM A;  1SMY C;  3BDO A;  1V1P B;  4K8J A;  1ESR A;  3PUZ A;  1B50 A;  1G91 A;  1EL0 A;  3BYY B;  3CHB D;  1KNA A;  1PRT B;  1TS2 A;  3S9W A;  5NUC A;  3D8G A;  1CZW A;  3SK6 A;  3HEJ A;  3ERO A;  2JA7 B;  2O2L D;  4KI0 A;  4R8I A;  3J81 E;  3D4W A;  4BWG B;  4KV6 A;  5I9P A;  2L11 A;  4L6T B;  1RHP A;  4HSV A;  2B2Y C;  2KEE A;  5CR3 A;  2OXP A;  2X6L A;  1KDA A;  1Z6H A;  4RFB A;  1OXX K;  5T1G A;  1SE4 A;  3W3A A;  2F0K A;  3GTO B;  5CV4 A;  1T5E A;  1OXV A;  2A5H A;  1KAB A;  1LO5 D;  1C8C A;  1LAC A;  1X3P A;  2M9V A;  1EFI D;  1CHQ D;  1CTM A;  3TP6 A;  3QJY A;  3J80 E;  3E0J A;  4A3I B;  2F0Q A;  2SNM A;  3NBH A;  3PO3 B;  4C3J B;  2KEC A;  4NDX A;  4HSP A;  2DNE A;  4JBW A;  4KKU A;  2JEB I;  4WFN 3;  2R92 B;  2F0N A;  1R9T B;  2IJ0 A;  2DN8 A;  2X69 A;  3Q24 A;  1O78 A;  5ELB A;  1LV9 A;  1A6X A;  3H94 A;  2XRQ D;  4MIU A;  3PIP 3;  5C0X I;  3BG3 A;  1O80 A;  3K5N A;  2KVM A;  3T13 A;  3WDN A;  2RDH A;  1GUS A;  4KHZ A;  1EZ6 A;  2R61 A;  3RMH A;  3BS1 A;  3P20 A;  2NB0 A;  5EKI A;  4XIG S;  4A3K B;  1SAP A;  3LX0 A;  4RAU C;  1BF4 A;  4PV1 C;  2IPK D;  3SXH A;  3WOE A;  1C4Q A;  2EYP A;  2F0U A;  5EPJ A;  3MVV A;  4C2M B;  3F2U A;  5IIF A;  2BOS A;  1TU2 B;  1BCP C;  2Z4I A;  1CK1 A;  2IT1 A;  1C48 A;  4EQN A;  4XDX A;  3OHX C;  3OWF A;  1HRJ A;  2JXM B;  2F0L A;  2SOB A;  1WCM B;  2A68 C;  5IGB A;  5KNC A;  3L9A X;  1ET9 A;  3C1F A;  2AWN A;  1EYA A;  2R3Z A;  3I70 A;  2F4I A;  5ELD A;  4RHS A;  1IW7 C;  2E2J B;  1U9R A;  3Q22 A;  1HUM A;  2QKI C;  1BCP B;  3MXG A;  4F88 A;  3CKI B;  2IX0 A;  1CQV A;  1FNW A;  2WKC A;  4U68 A;  2L9H A;  3H09 A;  4G7O C;  2WII B;  2X6G A;  3NHH A;  3R2I A;  4DK1 A;  4HAE A;  3T53 B;  2FJ2 A;  1PMR A;  4HCE A;  2F3W A;  2B2Y A;  4X3T A;  4K5V A;  1NR2 A;  5BN4 A;  2F1M A;  1I6V C;  2VB2 X;  1GJX A;  1JOO A;  2LMC B;  1L0Y B;  3OPO A;  1TY0 A;  2VXW A;  3MXP A;  1PTO C;  5CV6 A;  1FYC A;  5M3M B;  5EPL A;  3SK5 A;  4RCO A;  4C3I G;  5KRU A;  1GHJ A;  1CM9 A;  1Z47 A;  5EBC A;  2ZXR A;  1PLF A;  3RZD B;  1EY5 A;  1G8Z D;  5FO8 B;  4UAI A;  1LT4 D;  3C46 A;  1LTA D;  1PTO H;  1D2B A;  1VF5 C;  1SDF A;  4FF4 A;  3NPP A;  1X32 A;  3DEO A;  3AU7 A;  1PTO B;  2MJ8 A;  3DHQ A;  4RGT A;  1AZP A;  5T1I A;  4KK7 A;  2EJF C;  2BDN A;  4P2C B;  3HGB A;  3S16 B;  1EWH A;  3D6W A;  2JA8 B;  3N6R A;  3NQI A;  1WTX A;  1W6J A;  1I4X A;  1BNZ A;  1CZG A;  3FVQ A;  2G9H D;  1UAP A;  2F0P A;  1O7Z A;  4OIK A;  3KLS A;  1F2Z A;  1A3U A;  2EZV A;  2NYZ D;  3DXJ C;  1YNN D;  5DAU A;  1B4O A;  3NTH A;  5M5Y B;  2IW3 A;  1U4R A;  3OIQ A;  5D3I B;  1AN8 A;  3VYU A;  3FKI B;  1PDQ A;  5JEA J;  1B44 D;  1JCK B;  4A3E B;  3MEH A;  1I4R A;  2O5I C;  3MWY W;  1RJT A;  4BA1 I;  1Y8N B;  3MAQ A;  1ZXT A;  1F9Q A;  1U4M A;  2SDF A;  2EYF A;  3HOZ B;  3DUZ A;  2F0O A;  2F0M A;  1I4P A;  4DU9 A;  4KD3 A;  1A3T A;  4IFD H;  1STE A;  5JVH 3;  1DOK A;  2EE1 A;  3DM1 A;  4BA2 I;  3VA5 A;  4B9X A;  2Q8T A;  5KEE A;  1BQQ T;  1SYE A;  3I4L A;  1B9N A;  1OXU A;  1Y1W B;  3NTI A;  1WD1 A;  3EQL C;  2XWJ B;  3RUZ A;  3D3R A;  2B63 B;  2EY6 A;  4FVM A;  2EPB A;  1GUG A;  1KAA A;  1FD7 D;  4PNY A;  3S17 B;  1ILP A;  5EPK A;  2E2I B;  4H7B A;  2E2H B;  1EY6 A;  4PMW A;  1GUW A;  1GUT A;  3D31 A;  1UUP A;  2A6E C;  3I3C A;  3J7A V;  2QEJ C;  5I4D A;  1PRT F;  1F2Y A;  4DNR B;  2WB1 B;  3X3N A;  2RBM A;  2WV6 D;  3TN2 A;  3HRZ C;  2O5J C;  4V0B A;  5AFW A;  2XRS D;  3QWN A;  5I6W A;  5LL6 S;  4G7Z C;  1LTR D;  5CBA E;  5KGU A;  4C56 C;  4MN3 A;  5KND A;  3DMU A;  5IOD A;  4B08 A;  1XWE A;  3K5O A;  5C4J B;  3HKZ B;  1SE3 A;  1QB5 D;  4KY5 A;  2I46 A;  2J4X A;  1ET6 A;  2F0E A;  1RD9 D;  4ZK9 B;  2B8G A;  1D5Z C;  2K32 A;  2D62 A;  3NP8 A;  4EGV A;  5KYL A;  2F0G A;  1QNU A;  5CV8 A;  3M4O B;  5I9O A;  2WP8 J;  2FMC A;  3D4D A;  4A3F B;  4CHT B;  1Q3L A;  3R93 A;  4TQU S;  5EQ0 A;  1MBY A;  4IUP A;  1NR4 A;  3S1M B;  4LAA A;  1ZKO A;  2JYO A;  2M2L A;  2NUC A;  3GD7 A;  1UNS A;  1YNJ D;  2B2T C;  4H44 C;  4KJN A;  4FYD A;  1M8A A;  1ML0 D;  4NW2 A;  3KBG A;  3C2P A;  3GP7 A;  5C5M A;  3S1N B;  3W2D A;  1Q1E A;  3R2T A;  1TY2 A;  4CJ2 C;  2F0T A;  4HED A;  1II3 A;  3ZYY X;  4KKS A;  3K5M A;  2L5T A;  1EEF D;  1SNC A;  1LT6 D;  2ICI A;  3H3V C;  3D6C A;  5C3E B;  4MHE A;  3SK4 A;  3K5L A;  3I4M B;  1ENF A;  2EYM A;  2KA7 A;  1SSO A;  5LL6 X;  4ID6 A;  1H9S A;  2XSC A;  1EY0 A;  3A56 A;  1BXT A;  1E2W A;  1H9R A;  4IUQ A;  1CHP D;  1T5X D;  4M1U B;  4Y7N B;  1WTQ A;  1MD2 D;  4DAY A;  4H0L C;  3FRP B;  5DEH A;  5ISR A;  4XQJ A;  2A6H D;  4CJ1 B;  4TSS A;  4KJO A;  5FK9 C;  3VR4 A;  1TWF B;  4X3K A;  1LAB A;  4KD4 A;  4KY7 A;  1WD0 A;  2E2D C;  1ROD A;  1PXU A;  1EU4 A;  1J8I A;  1JWM D;  2SNS A;  3G6J B;  3SR1 A;  3M85 A;  2H1E A;  3QOL A;  3A7A B;  3VR5 A;  2JA6 B;  2OF1 A;  2WAC A;  1LTS D;  5A2Q E;  3M7N A;  4DF7 A;  5M9O A;  2K5D A;  4C3J G;  3BDC A;  3RZO B;  2K03 A;  1SYB A;  2NN6 G;  5A35 A;  1A2U A;  1K8M A;  3ONA B;  1SNQ A;  2Q8I B;  5C3X A;  2MP1 A;  5FOB B;  4X3S A;  2LKV A;  1I3Q B;  1SND A;  3TP7 A;  3J80 L;  2IWH A;  1Z7T A;  3LNN A;  4H13 C;  2GA4 B;  4K6L A;  1PRT D;  5J1Z A;  3S2H B;  3L7Z C;  4LJZ C;  4HN7 A;  1VDZ A;  3T4A C;  1F9S A;  5FLX E;  1NUC A;  5M3F B;  4ZUI A;  4BBS B;  2O4X A;  1F9P A;  3OOC A;  2K28 A;  3EFX D;  2CW0 D;  3G7L A;  5D14 A;  2WIN B;  1S4Z A;  1U4L A;  2L55 A;  1TS5 A;  1BUV T;  2PYK A;  4C3H B;  2B2T A;  1DM0 B;  4QF4 A;  3PUX A;  2AQ3 B;  5COY A;  3V2T A;  1LTT D;  3NXW A;  5D65 A;  3FPU B;  1TT2 A;  4DAP A;  3JAM L;  1EYC A;  2WKD A;  3CRL C;  1AW7 A;  3MTS A;  3T56 B;  1AFP A;  1Y8P B;  4CKE A;  3A8J E;  5CBE E;  5E4X A;  1R4P B;  2A69 C;  4Q5V A;  3TME A;  5IGG A;  3M3Y B;  4BBR B;  3E6Z X;  3FDT A;  3L3O C;  3HZX A;  3HS0 C;  4RHR A;  2PMZ B;  3PUW A;  3EVQ A;  1DJR D;  3A7L A;  1F2M A;  1DCZ A;  2PZT A;  3I90 A;  1PZJ D;  2OT2 A;  4DNT B;  2NTS A;  2K33 A;  2RDF A;  1EY9 A;  4QCL A;  1EZ8 A;  4HTH A;  3VYT A;  5IGF A;  2QCP X;  1VF7 A;  1JIC A;  1LTG D;  3MXU A;  1BOS A;  4G57 A;  4J6H A;  3N52 A;  2WAQ B;  1HFN A;  3V96 A;  1FR3 A;  5E3F A;  1EYD A;  3MZ5 A;  2K01 A;  4XXE A;  1S5B D;  2NVQ B;  3MC0 B;  2Q8R E;  3PIO 3;  2XIW A;  2JSO A;  4M8A A;  2K6A A;  2C5C A;  3HG9 A;  3DEP A;  2NWG A;  5I6Y A;  4XT3 B;  4ZUJ A;  2KCC A;  2MPM A;  1TS3 A;  1NAP A;  5JPN C;  1TVX A;  2IX3 A;  1MI2 A;  2AQ2 B;  4KN4 C;  2XNA C;  4C1N K;  2KOL A;  2K5Q A;  4GZY C;  4XQQ A;  5FO9 B;  1BCP D;  1LT5 D;  3BVG A;  3HOY B;  4RGN A;  1R4Q B;  2B2W C;  1K8O A;  2F0J A;  2K7V A;  3VR6 A;  5C0X H;  1WTP A;  1Q12 A;  3OWE B;  1B53 A;  1O7L A;  2B2U C;  1SYG A;  3BVZ A;  1YNN C;  4IFD J;  2K5W A;  1CFM A;  3WOF A;  2L1B A;  4OGQ C;  3HOV B;  2HDL A;  1QNK A;  4QIW B;  1TS4 A;  1CI3 M;  1IW7 D;  3GTP B;  2DY7 A;  1EIH A;  3BVM A;  2XN9 C;  1FGB D;  1PZI D;  4K5W A;  3KF8 A;  1I50 B;  1JC7 A;  1V8Q A;  3S15 B;  5KNB A;  1SXT A;  1H9M A;  1S5E D;  5C4X B;  4RGO S;  4DAV A;  3TBI B;  1IKM A;  4K6D A;  2BA1 A;  4RKL A;  4XYO A;  3KBX A;  5ELC A;  3GQB A;  2KHS A;  4K8I A;  1QWY A;  2PW5 A;  1KLU D;  4G4K A;  4RWS C;  3TSS A;  4CGY B;  1RTO A;  1IKL A;  2L4N A;  2AUK A;  5J22 A;  1D5X C;  2PPB C;  1JR0 D;  2KUM A;  1FNU A;  1HQR D;  1SNP A;  1TWH B;  1MGS A;  1I4H A;  3K59 A;  1JOQ A;  1MSG A;  3GTM B;  2B2V C;  1PTO D;  4R8N A;  3BDL A;  3Q0A A;  2CQA A;  2FIN B;  4ABN A;  2EYL A;  2HUG A;  2NVT B;  2R6G A;  5EBD A;  3DWQ A;  4ULL A;  5M5W B;  3U9S A;  2B39 A;  1V1O A;  1KDC A;  2EYH A;  1E0B A;  1ZYR C;  4ZKC B;  1STN A;  3SE0 A;  4OO1 G;  4IZ8 A;  2TMP A;  2Z1C A;  1EU3 A;  4NMZ A;  5KYI A;  4K14 A;  4DN4 M;  4FF1 A;  4IUN A;  4FNF A;  1G2S A;  4XTC S;  2F0S A;  1I4Q A;  5JEA G;  5G3L F;  5IGD A;  3K58 A;  3C3L A;  3HOW B;  5I2Y A;  1STH A;  1DXM A;  1WTV A;  2I07 B;  4R9W A;  4XQN A;  1GUN A;  5JAV A;  3IAY A;  3P1H A;  4BY7 B;  2PW7 A;  4A3M B;  4NP5 A;  2BE5 C;  3I91 A;  1W6K A;  4PQX A;  5CV5 A;  2J7Z A;  4V19 0;  3PO2 B;  5K36 H;  3GV3 A;  2ICE C;  5EGT A;  4CKC A;  2RSO A;  4KTA A;  2C9O A;  5DM6 3;  1ENA A;  1H9S B;  3MXN A;  1VMC A;  2B2U A;  4I7Z C;  4PMB A;  2FHT A;  3SVM A;  2RSN A;  4WJW A;  1ILQ A;  3R8B A;  1D5M C;  5C3W A;  4RGM A;  3KLR A;  3M4Y A;  3AB9 A;  1I6H B;  2G9D A;  4FXD A;  1LLR D;  5CMD A;  1HTP A;  1STA A;  4CBV A;  2NTT A;  2NBF A;  1IYU A;  2D5D A;  3OSO A;  2RVL A;  2F0F A;  2PCF B;  3K6O A;  1EY8 A;  3U9O A;  5IT9 E;  1GUO A;  1GXD C;  2F03 A;  1S5D D;  4A3D B;  1D1I A;  2N88 A;  2A6E D;  3P7J A;  2AQ1 B;  2OEO A;  4A3G B;  4DK0 A;  4IN3 A;  1JB3 A;  3H0G B;  5CC4 A;  3SK8 A;  3A8I E;  2JP1 A;  1DOL A;  5JJZ A;  2AUJ D;  2A6H C;  2PNR C;  4IUU A;  5KIX A;  4ZQ3 A;  1G29 1;  5CV9 A;  3OMC A;  3NE5 B;  4XYQ A;  1H9J A;  1O7Y A;  3EJI A;  2FMM A;  2VUM B;  1BBX C;  1SYC A;  3BZD B;  3HOU B;  4B9W A;  1OXT A;  2R7Z B;  4OIJ A;  3KK7 A;  3K7A B;  4I65 A;  1DZ1 A;  2NN6 I;  4EQP A;  5IGC A;  1B3A A;  3VYR A;  3LWE A;  3VA7 A;  1S5F D;  5IOC A;  2BA0 A;  3H91 A;  5IGE A;  1RF2 D;  3KLS X;  3I73 A;  1GOZ A;  1GHK A;  1EQT A;  3GO5 A;  5TSS A;  1F9R A;  3J7A F;  4ZAI A;  1PRT C;  1TII D;  5A2Q L;  1LTI D;  3I8Z A;  4EVO A;  3J81 L;  2Z4H A;  1DD2 A;  5C4H A;  1NCV A;  1BCP F;  3FPP A;  3MHB A;  4FF2 A;  1JQY D;  4WRD A;  2TSS A;  1B9M A;  1STG A;  1CT1 D;  5CV7 A;  3S1R B;  2CW0 C;  1H9K A;  5G3L D;  2KQ3 A;  5JPM C;  5F2D A;  2K1B A;  3R3O A;  3QOJ A;  1QE6 A;  5FLX L;  3NWT A;  4QMG A;  3CU7 A;  4ZYS A;  4C3H G;  2B8F A;  4FF3 A;  2XWB B;  1E2Z A;  3GV6 A;  3IL8 A;  3FMC A;  1K83 B;  4RH6 A;  3PUY A;  2PZW A;  2PO4 A;  1DYQ A;  5I2X A;  5BN3 A;  4X3U A;  2VNU D;  1IL8 A;  3A55 A;  4QUC A;  2DNC A;  1SYF A;  1SMY D;  2NVY B;  2KED A;  1Y1V B;  1AZQ A;  3GTG B;  1BR9 A;  1QG7 A;  3V05 A;  3SEB A;  1QJO A;  3A54 A;  1HXY D;  1PTO F;  3FEW X;  2K04 A;  1HA5 A;  3ND8 A;  2ZT9 C;  2JA5 B;  4K2L A;  2NN6 H;  1EWC A;  1U4P A;  2MUY A;  1TWA B;  5E1F A;  2F0D A;  4UDU C;  2CHB D;  1CQF A;  5ELF A;  2KJX A;  1IYV A;  1DON A;  2MHV A;  2MGS A;  4O42 A;  4K5X A;  3OW7 A;  2EJM A;  3Q23 A;  3MFG A;  1HTL D;  4DXG A;  1QOH A;  1XYI A;  1LT3 D;  5FKA C;  3KUP A;  1EY7 A;  2AWO A;  1KTK A;  1I4G A;  4XT1 B;  5C0X J;  1V1P A;  3IFD A;  1B2T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...