4OL7A

Crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 39
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ol7A00
2EY6A 3ERQA 3MZ5A 4HMJA 2EYJA 3HEJA 2F0SA 3MHBA 4NKLA 3TP6A 5EKLA 3D4DA 4PMBA 1SYDA 3DHQA 3TP8A 3EROA 5CV6A 3T16A 4N9TA 3V2TA 4F7XA 2F0PA 5CR3A 2F0LA 1JOOA 2OEOA 1KDBA 4QB4A 1STAA 3P1HA 5CV7A 5J1ZA 3PMFA 1A3VA 3BDLA 4H7BA 4NMZA 5I6YA 5IIFA 3D8GA 2EYHA 5IGBA 2WACA 1NUCA 2O4XA 2SOBA 2ENBA 4PNYA 2F0OA 3LX0A 1EZ8A 1AEXA 2F0UA 2RBMA 3C1EA 4G57A 4K8JA 4KD4A 2PZWA 4KTAA 2F0IA 5F2DA 5EKKA 1EY8A 2F0QA 5M9OA 1A2UA 4ZQ3A 3NQTA 4NP5A 1STHA 1SYEA 3QOJA 2M00A 2RDFA 3P75A 4K2KA 5IGGA 4KY7A 4QF4A 1KDAA 2PW5A 1JORA 1EQVA 5CV8A 3MVVA 5EGTA 4S3SA 5C3WA 3EJIA 1SNPA 2F0EA 1JOQA 5DEHA 2PW7A 3NUCA 1F2MA 4KHVA 3SK4A 4IZ8A 3SK8A 1JOKA 2PYKA 1NSNS 4J1MA 5CV9A 3RUZA 5HURA 1EY5A 4LAAA 5E3FA 4ODGA 2PZTA 1EY6A 2QDBA 1STGA 1ENCA 2F0TA 1TQOA 3DMUA 4F8MA 1F2YA 1SNDA 3MEHA 2F3VA 3E5SA 5E1FA 3SR1A 5KIXA 1SNCA 5NUCA 1EYCA 1SYBA 3OSOA 3HZXA 4KJNA 4KV6A 4K6DA 4PMCA 4B9WA 4RKBA 2F3WA 4NDXA 2EYMA 2KHSA 3OWFA 2EYFA 1IHZA 2EY1A 2EXZA 2NUCA 3D6CA 4I65A 4IALA 3SK6A 5CGKA 5KYIA 3S9WA 4HMIA 5IGFA 5IOCA 2OF1A 1F2ZA 2EYOA 4N9PA 1STYA 5IODA 3OMGA 4IUNA 4EQNA 2F0NA 1II3A 5KRUA 5C5MA 5KEEA 2F0DA 2RKSA 3T13A 3NK9A 5C4ZA 3SK5A 5J22A 5J39A 4K2LA 4B9XA 1SYGA 2F0MA 3QOLA 5C3XA 3R3OA 4DF7A 3SXHA 5C4HA 5HGTA 3TP7A 4DFAA 2F0GA 4KY6A 5CV4A 2HQEA 5K5PA 3NXWA 4EQPA 4ZUJA 5KGUA 4E6IA 1RKNA 5IGDA 4K8IA 5I9PA 1SNQA 5C6AA 3ITPA 2EY2A 4KY5A 4QMGA 4RKLA 1EY0A 1SNMA 1TR5A 4OL7A 1A2TA 2F0KA 2F0VA 1KABA 2F0FA 4YIJA 5JOBA 3TP5A 4DGZA 5JAVA 2LKVA 3NP8A 4KD3A 4WORA 2EYLA 2SNMA 1KAAA 3U9OA 1U9RA 3D4WA 1EY9A 1A3UA 2F0WA 5IGEA 5KYLA 2KQ3A 4WRDA 4R8NA 5I9OA 1EYDA 3C1FA 4EVOA 3MXPA 3TMEA 1STNA 4EQOA 4K5WA 4J6HA 3EVQA 3H6MA 3QB3A 1EY4A 1A3TA 1EY7A 1KDCA 4K5XA 5ISRA 5C5LA 1ENAA 2EYPA 2OXPA 5DAUA 1EYAA 4ZUIA 3VA5A 1EZ6A 1SYFA 5CC4A 4K5VA 4DU9A 3BDCA 2F0HA 3OMCA 2PQEA 1SYCA 4HTHA 2SNSA 4ME5A 1TT2A 4MIUA 1SNOA 3SHLA 5IGCA 1STBA 2F0JA 4TRDA 2PZUA 4K14A 4KJOA 5CV5A 5I6WA 3NHHA 4ID6A 2EY5A
chains in the Genus database with same CATH superfamily
2R93B 2L1BA 2KENA 2G5DA 3MXNB 1U4MA 2ZTEA 1PTOD 1SJED 4CJ1B 1TWFB 2LMCB 3QG1A 1CKMA 4KI0A 2RDGA 4NMZA 2K6AA 5IGBA 1F77A 2ZM6L 1DOLA 4C3HB 4G7ZC 3QIAA 4RAUC 4JI7L 5GQOA 5M9OA 3HOWB 1G6ZA 1E3PA 4NP5A 1QILA 3A55A 2WV6D 2MFIA 1BCPF 3EFXD 2RDFA 4OELB 1QVFA 4BXXG 2K01A 1XPRA 1JOQA 2HDLA 1EEID 5BR8Q 3CCUA 3VYUA 3P7JA 2RHQB 3NWSA 4JW0A 3ULPA 3U4VA 2OQKA 1TIID 2KECA 4GLXA 2EDGA 1Y1WG 2NVYH 3HOXB 1EIHA 1UUPA 2NN6I 2JA7G 2Q2TA 2L15A 2K04A 4LFCL 5M5YH 4BWGB 5M3MH 4L5QA 4A3IG 3H09A 4A3CG 1U4PA 1F2LA 2A69D 3GV6A 5BR8L 2NUCA 3D6CA 4CDCC 4LUVA 4FDBA 1ASYA 1ICFB 4IUNA 1GHJA 1O7ZA 4XT1B 1HHVA 3NPPA 3VR5A 5J22A 3NTHA 1HZBA 1QZGA 1AFPA 3KYHC 1UAPA 4LFCQ 3BDOA 3HOXG 4A3DH 1BUVT 3S14H 2JK8A 4R4QA 5CV4A 2MHVA 4B3TL 2MGSA 1QZHA 1RTNA 1HCZA 1VQAA 1QUQB 2JA5B 2WFWA 1KTKA 1KABA 3HRZC 1UEAB 4IJHA 3CF5A 2PQAB 1A6XA 2CVRA 3CC2A 1EYDA 3NWTA 3MXPA 5T1GA 2R92H 4WJWA 2WKCA 1WD0A 2Z6KA 1S5FD 3K59A 2E2DC 2EYPA 5ELDA 3M9BA 2R7ZB 4DR7L 3CW2C 4B3RQ 3OPOA 5JEAG 2LS01 1TT2A 1SAPA 2PZUA 1HNWQ 2N55A 3K0XA 3MFYA 2QF7A 1LTTD 2QW7A 1N9WA 1K8GA 3KF6B 3OIPA 3QR8A 5A2QL 4NKLA 1S5ED 2A74C 2IPKD 2I5MX 4QB4A 2EPBA 4A3GG 1PFSA 3OWEB 4BS9A 4FF1A 1X6OA 1E2VA 2VQFQ 4DV6L 3L7ZC 3GTPB 4O1NA 1PFBA 4FF2A 3H0GG 1MSGA 4LUZA 1I6VC 4KTAA 4JBJA 4DV0L 3A7LA 1TWAH 2VB2X 4PV1C 2NZ1D 2G9HD 4JI3Q 3G6EA 2ICIA 3EJIA 4HJ8A 4ILWA 3HKZB 1IBML 4KKTA 4HR7B 2E2JH 3IFTA 2R93H 5C4JB 1EY5A 2R93G 1DD2A 2J0TD 2JA5H 2QDBA 5J3BA 1CKNB 4DK1A 2MP1A 1STGA 2Q8IB 3GTGB 4RGMA 4JI7Q 3W5OA 3BS1A 3S14B 3E0JA 2B2TC 2Z9HA 4JI3L 5CBAE 4DR1L 2F3WA 1Y14B 4P71A 3SK6A 4I65A 1D2BA 1G91A 1IBMQ 1G8ZD 3I4MB 2HHHQ 3HOWG 2F0DA 2F03A 1KAWA 4DK6C 4DNIA 3RLNA 1K8OA 5IT9E 1JE5A 3DEPA 1K3RA 4KHZA 3Q6SA 1HNXQ 1EFWA 1AP0A 4JC0A 3KUPA 2K5HA 1PRTD 2OQ0A 4RGNA 1VQLA 1AE3A 1XWEA 2UXDQ 3OW2A 2UXCQ 3K5LA 1K0SA 1PZKD 5JAVA 1FJGL 3NP8A 1BCPC 2EIFA 2E5LQ 2R6GA 1XPUA 1Z9FA 3NTKA 3TS0A 2QEJC 3I70A 4X64Q 5KYLA 3S1RB 4GKJL 1YNNC 2ZT9C 4MNOA 1SJHD 3NBHB 3CKIB 1WCMB 2UXDL 1V1PB 3ND9A 2BE5C 3OMCA 5LMNW 1SYCA 3OOCA 2JA6G 2JA9A 3NENA 1FJGQ 4KHPQ 3CPWA 4KJOA 1LV9A 4A3EB 2OWOA 1J5EL 1WTVA 4O42A 4ID6A 1D5XC 1NR4A 4HCSA 4X64L 2PPBC 1OXSC 3MTSA 2F0SA 4OIKA 4WFN3 2RA4A 3MWYW 1GUWA 3P1HA 1JC7A 2RSOA 3M4OB 2WACA 1LABA 2B8FA 3S1NB 1CHPD 3T1YQ 1FR3A 4L63B 1YNND 4ZQ3A 1C0AA 1JJ2A 3Q22A 2ASBA 1HNWL 1PRTC 4QF4A 3AYHB 5BN5A 2O5IC 2VNUD 4A3KB 1XNQQ 1X3GA 2F0EA 2R92B 1U4RA 1UE7A 1Y69U 1CTMA 3J81i 4HIKA 1Q12A 3KF6A 4F87A 3HOVG 2PCFB 2BDOA 3TREA 3T1YL 1OXVA 3KLWA 2E76C 2JA8G 1ESFA 1WTWA 4I7ZC 1SN8A 2F4IA 4DU9A 4YWLA 3KFUA 4FVMA 2NVQB 5FK9C 4DV0Q 4RKBA 4IALA 1IL8A 4DR4Q 5IOCA 3T4AC 1E22A 4HAEA 5LMUL 1HH2P 1B44D 2K33A 1D8LA 2B2VC 5M5XH 5FO9B 4IPDA 1STEA 1D1IA 4IFDJ 4DFAA 3HOVB 4HSVA 4DUYL 2LY7A 1H9MA 4J15A 1RKNA 1VQKA 4GN5A 1MSHA 1F9QA 5C4XH 3J7YW 2O2LD 1BBWA 4ZYSA 2XWJB 3EBEA 1EY9A 2YTXA 3K5OA 4OWTB 3HOZB 3VR6A 1KLUD 5FO7B 2Y0SG 4CKBA 4YY3Q 1EY4A 1IW7C 2DY8A 3J81c 1GD7A 2WB1E 4ZUIA 2LXJA 1LO5D 2VXWA 4HTHA 4IFDG 3M4QA 4CJ2C 2K1BA 1ZYRD 3R2TA 2CW0C 1B70B 2UUAL 1AH9A 1OTCA 1A8VA 4DV7L 1R9TB 4CKEA 3M85A 3TP8A 3S2HH 2IHEA 1KRSA 3EROA 3NBHA 4QIWE 1W3SA 1ZKOA 3GP7A 3SGIA 2EYHA 1B7YB 4QY7A 4GKJQ 1QNKA 1VQDA 2FXQA 4POGA 4C3JG 4RA8A 3CCVA 2KUMA 3C1EA 4K8JA 3U58A 2ES2A 1N8RC 1SYEA 2M00A 3VDYA 2ALYB 4OO1G 1TWCB 1JORA 1RJTA 1GKHA 4S3SA 4A3LG 2EOTA 3W1BA 3PSIA 4NPSA 5C4XG 3S15H 2K14A 1TWAB 3Q0AA 1N33L 1ICWA 3J7ZC 1VQJA 3GTOH 3DEOA 1XNRL 4J8QA 5EKIA 1E24A 1ILPA 4QIWB 2RVLA 4L5SA 1WTOA 1CSPA 1F2YA 2LFNA 1PH4A 1QVCA 2J4XA 5FLMH 1CKOA 3OSOA 4KV6A 3HZXA 4FF4A 1TWGB 3PO3G 3J80i 1CQFA 4DAVA 3AEVA 2CH4A 1D7QA 4HMIA 1D5MC 2EYOA 1Q1EA 2VQEL 4N9PA 1EIYB 3HOYG 3KF8A 5D65A 1ASZA 2B2YA 2Z4HA 1CK1A 4OONA 3ZJYC 2B2UA 3T13A 3K80C 1L1OB 2F0MA 1X9NA 4DF7A 2YU9B 3D31A 1MKHA 4FXGC 2A6HD 5K5PA 4N8FA 3TRZA 1BNZA 2SEBD 1BBXC 3RZDB 1SMYD 4DV5L 1P16A 1E1OA 1KAAA 4RCOA 5EJWA 5FLXc 4ZK9B 1RL2A 3TSSA 3PF4A 1UE5A 3GTGH 4JBWA 2XTIA 5EAYA 5DM73 4EVOA 3I90A 3QB3A 1EY7A 1CQVA 4LUOA 1WYDA 3VA5A 3RR5A 2DJGC 5ELFA 4JG2A 1I3QB 1Y8PB 1PTOF 2N88A 1DGSA 3ND8A 1GVPA 2EY5A 4DXGA 1TKWB 2BOSA 4UP9A 1NY4A 4PMBA 3V2TA 4K0KL 2XN9C 4C2MH 1ZXTA 3PMFA 3BYYB 4DUZL 2I0QA 4C3JH 3PUZA 3DUZA 3J81L 3PO2B 5H1SE 1S3OA 3TBIB 1SFOB 1IBLL 4G7HC 3GD7A 3UE1A 1O7YA 4G57A 2ZJQA 1RCVD 3TDQA 3A8KE 3PUWA 4MZ9A 1VQEA 3J80c 1PH9A 1Z7TA 4DV2L 1XYIA 3QJYA 4P75A 2NZHA 3KLRA 2N8NA 3GTQB 4R4CA 3SK4A 4JI8Q 1SMXA 1Y1WH 4ZKBB 1NSNS 4NB3A 4YCUA 4ZLTF 2WAQE 3A5ZB 1LT4D 3UI2A 5M5XB 3AU7A 3ER0A 1ENCA 1TQOA 3IKJA 3OTOQ 1L0WA 4JVZA 3L0OA 1QCBD 4A3CH 1H9SA 1VQ9A 4LF9L 1V8QA 1U5KA 2B2WA 3BVMA 2EYMA 2A6EC 3BJUA 3GQBA 5JPNC 3OIQA 4JI6Q 3PUVA 3JAMi 3K7AH 2Z8LA 2JEAI 4QUCA 2CCZA 4A93H 1SYGA 1N33Q 3OTOL 1S5DD 2HUGA 2FMCA 3HP3A 3D6WA 2E2HH 4JI2L 2Z0SA 3U4ZA 3NXWA 1A0IA 5E4WC 4H44C 3CQZB 1TWHH 4JI4Q 1KHIA 1WOCA 4GOPB 1IKLA 1UNSA 2K50A 5JOBA 1I4XA 3VR3A 2UXBL 4GN3B 4Y52H 2EQSA 3U9OA 1UE6A 4DV3L 1S5BD 5EBCA 1N36Q 3F2UA 1WD1A 4A3LH 2FMMA 4C3JB 1H9JA 2ZM6Q 4WRDA 4H02A 3I91A 3P20A 3EVQA 1AZPA 2JA8H 2Q8TA 3VR2A 4ZKCB 1ZEQX 1HJPA 3O13A 2E2JB 2VB3X 4XIGS 3SHLA 5IGCA 4P73A 3A54A 2D0PA 1EWIA 2WKDA 1PLFA 1PVOA 4DV3Q 1Y1WB 4DV5Q 3T56B 3F8TA 1KNAA 4AYBE 1Y8OB 4WJ4A 5I2XA 4UP7A 3A8IE 4ULLA 5LMNQ 4H7BA 3S1MB 1YNXA 1LTGD 1DXMA 4IQZA 4A3FG 2KCCA 2SOBA 1PH6A 1I4GA 1PYBA 2XGTA 1EYGA 4LF5L 1BDOA 2P5ZX 1IYUA 1OXXK 2L5TA 3RLFA 4X3KA 4YCWA 5C3WA 1SE8A 1I6HH 2K5DA 1G291 3Q8DA 1EIFA 3SK8A 1PTOH 1X3PA 3S1NH 5EQ0A 1NBWA 2NN6H 3EN2A 4JV5Q 5M3MG 3G48A 1HNZQ 2F0TA 1WTRA 3FPUB 3CP0A 3M7NA 2F3VA 4Z9CB 2VW9A 3R8BA 2AKWB 3FVQA 5NUCA 1EYCA 2L12A 4C56C 3E0EA 1P8LA 2KHSA 4RGTA 5CGKA 4KMUC 3HOWH 1EWHA 3GTOB 5C5MA 3CCJA 1FYCA 1YHBA 3BYTB 4A3IB 3A0JA 3SK5A 1M1KC 1YNJD 5DNFA 3T53B 3FHWA 2Q2UA 1VQFA 3L3OC 1D6EC 3M3YH 2EY2A 4FP5D 4ZRZA 4B3MQ 2A6HC 5FJ8G 2EYLA 4BXXH 2PO4A 4BY1H 1LTBD 1O78A 2EXDA 4R8NA 5DLQE 5IYCH 1FGBD 1A62A 2K5WA 3KLSX 4XQJA 1T9HA 5C3EH 1DYQA 4A3KH 2B8GA 2GA4B 1TVXA 2B29A 2JA6H 3J7AF 4HN7A 4ZCKA 1CZGA 1JMCA 3IL8A 1DCZA 4OWXB 5I6WA 3L9AX 3ERQA 1ET6A 1LTLA 4V190 4A3GH 4RHRA 3VYSA 2EYJA 1SR3A 3MHBA 2UXBQ 4RG1A 1K3BC 4PMWA 1VQMA 1VCIA 1GHKA 2AQ1B 2KBNA 2UUBQ 3S1QB 5I6YA 1M4VA 3I4MH 1LT5D 4BBRH 4IFDI 3S15B 1OXUA 2RHSB 4DAYA 1TWFH 1PZID 2PZWA 4KK7A 5E4XA 4AYBG 2NBFA 1TXYA 3HG9A 3W3AA 2XWBB 5CV8A 2ZTCA 3ULJA 3LNNA 1AN8A 3VYRA 2NN6G 2PW7A 3KBXA 1VQ5A 4KHVA 1HNXL 4UP8A 4X66Q 1PRTF 4IFDH 4HEDA 1VMPA 4IO9A 4F8MA 3F1ZA 1SNDA 4AQYQ 2HT1A 1FNUA 1DOMA 5C44B 4ME3A 3K0YA 2KCTA 5KNCA 4DR6L 3K8AA 4KLKA 1HPCA 1VS0A 2IX3A 3A5UA 2FINB 4JBKA 5D14A 3SDZA 2CKZB 2B63B 1QOHA 1QG7A 4DV4Q 3STBD 2X6GA 5GAGC 2PNHA 4R8IA 1I6HB 4B9XA 2E75C 3R3OA 4CDFC 2CQOA 4KHPL 1FD7D 5FLXE 1J5EQ 1AE2A 1VQ6A 3KJOA 4BY1G 1QUQA 1SEBD 5I9PA 3TEHB 1BR9A 4RKLA 4OL7A 5FJ8H 4NW2A 4R4IA 4RH6A 3ONAB 1RHPA 4HIMA 2E2HB 2EJGC 2LKVA 2SNMA 3KK7A 2DY7A 2JSOA 1PH5A 3M4OH 1BOSA 1AW7A 3CMEA 1SROA 1ENFA 4FXDA 2IL8A 5EBDA 2DUDA 4J6HA 1TS5A 4G4KA 2OT2A 3N6RA 1SYFA 1EQQA 4ME5A 5A2QE 3CMAA 3CCSA 5FKAC 4DPGA 1R9TH 3STBC 1YEZA 2K32A 3CU7A 5EKLA 4JOIC 2HIVA 1BQQT 2F0PA 4QCLA 1EOTA 1F9RA 5CV7A 3S2DH 4LFAQ 1OO9B 4A93G 3I2ZA 4IUUA 1SXTA 1XTDA 1PHJA 4P74A 3BVZA 2JA7B 4UHVA 4C3HG 4GKKL 3I4NB 2B2UC 2M9VA 2F0QA 1I4QA 2AUJD 1CM9A 1I3QH 1VQ8A 1YJWA 3I8ZA 5I4DA 4DR4L 2NVXB 5ELCA 4MN3A 4K2KA 1S40A 1HQRD 5JJKA 2F3IA 4X62L 4YHHL 3HOVH 3RNUA 1TS3A 2ID0A 1UE1A 4DUYQ 2UUBL 2D9UA 4LAAA 1Q82C 3HOZH 1VF5C 4CGYB 4A3KG 5FLMG 3BZKA 4DNTB 3MAQA 3W2DA 4OO1I 1SRUA 4OGQC 1MBYA 1X32A 1CA6A 3M3YB 2Z6BA 3W1GA 5KYIA 1I4RA 2ZXRA 2HCIA 4P2CB 1STYA 3OMGA 2NZOA 2ZTDA 2E74C 4ALPA 3CC4A 4BBRG 3QO2A 3S2HB 2CH4W 1X54A 3GTKH 3KLSA 2NTTA 1X3FA 4PZ7A 3QOLA 3SXHA 4GLVB 3TP7A 4TKOB 2WB1G 5KGUA 1G2TA 5IT9L 5EGTA 2F4VL 4DV7Q 2F0KA 4C3IH 1YIJA 2HQLA 1RD9D 2JN4A 4RWSC 3I7FA 1VQHA 1HR0Q 1ONLA 2EZVA 2KQ3A 4O2DA 5M3FB 4X6AH 3A8JE 4AYBB 1WCMG 2OTLA 4BBSG 3CC7A 2L0CA 3K58A 3EA6A 3RN2A 3PO2H 1SE3A 5CC4A 1KD1C 4APVA 1BCPB 2TSSA 5A35A 3TZUA 4QUFA 4IUVA 3EQLC 4LF6Q 2E5LL 1HRJA 2F1MA 5JJZA 1I94L 2EY6A 3J81E 3HEJA 3T1HQ 3D4DA 4FF3A 1SYDA 3UE0A 4N9TA 5CR3A 2OEOA 2XRSD 4KKUA 1LTSD 1A3VA 3I73A 4RCNA 4OX9L 1JWMD 4HJAA 2ZXOA 4A4IA 4A3FH 3CAMA 2RBMA 3BVGA 1LTRD 1I94Q 1MHWC 5CMDA 1C48A 3QOJA 1CUKA 1K9MC 3DWQA 1PZJD 1MIUA 4GN4B 1LT3D 5CBEE 1JB7A 1KIXA 5DEHA 3NUCA 4IPCA 1JOKA 1SE2A 4J1MA 4FYDA 2K5NA 5M3MB 2WAQB 5IP7H 1EY6A 2VZAA 2KEEA 3FKIB 2Z4IA 2VS1A 3CCEA 3H3VH 2CWPA 2JA7H 1V9PA 3SVMA 2G9DA 4NDXA 3RLOA 5BN4A 4CKCA 2R7ZH 4QL5A 2IX0A 2I07B 4EQNA 2RKSA 1TWHB 3NK9A 4DR2L 4X62Q 1GXDC 2E2IB 1C8CA 2PI2A 2A5HA 4GS3A 4UDUC 3GTMB 4C3HH 1Q8KA 4A3DG 2MUYA 4K8IA 3FDTA 3ITPA 2B63G 3H3VI 1GUTA 3D0FA 4IJLA 5KNDA 4A3DB 5G3LD 2PQAA 1C4QA 2KEDA 4N8X1 2HIXA 5LMUQ 3K81C 3MXUA 2K4KA 3JAML 4K5WA 1W2BA 4X3SA 1KDCA 5GROA 1ET9A 1Q81C 1CI3M 4K5VA 3PIO3 3C46A 5ELNA 2HDMA 1SNOA 5GAHC 3KOJA 5IYBH 2K05A 3GO5A 5GADC 1DOKA 4QGUA 3G71A 2K75A 2O5JC 1RF2D 5CV6A 2CW0D 1IW7D 1I50H 1QVGA 1KXLA 4YY3L 4DR3L 2Q2IA 1J9OA 1DM0B 2I5LX 1NR2A 2Y0SB 3TN2A 2O4XA 5C0XH 3CCMA 5IY0A 3LX0A 4MTKA 3WOFA 1HZCA 1K8MA 2UUAQ 1NTGA 1PYWD 4JI0L 3FP9A 2IW3A 5JEAJ 3UDGA 1NE3A 2RCFA 1KDAA 4LNQA 3I55A 4DR3Q 3EIVA 2WB1B 3T1HL 4A3MH 1HFNA 1YNJC 4JI2Q 3RUZA 1H95A 4ODGA 3RN5A 3I72A 4OX9Q 5ELBA 3RZOH 5C0XI 4JI0Q 4L6TB 2D62A 1K8AC 3S1RH 3WDNA 3E5SA 3HGBA 2PMZE 2JA8B 1EQRA 1WJJA 1EUJA 2AMCB 2JXMB 3UDIA 2EY1A 1IHZA 2MO0A 1XMOQ 1Q7YC 1HXYD 4BY7B 2OTJA 4C1NI 1II3A 2Z6KC 2M2LA 1Q1BA 4TVAB 4XDXA 1PDQA 3CCQA 2X69A 3KJPA 2JYOA 1GUGA 5J39A 4DA2A 1XMQQ 1PMRA 4GOPC 3KBGA 5HGTA 2F0GA 4L5RC 1AZQA 3AMUA 4ZUJA 2UU9Q 4E6IA 1EU4A 2JE6I 1OXTA 3LGJA 4KY5A 1I5FA 2CFMA 1EY0A 5JVH3 1XMOL 2AWOA 2VQEQ 5C3EB 1Q90A 2L4NA 2RDHA 1A15A 2JP1A 1ESRA 3J81j 1B9MA 5C3EG 3NBIA 5I9OA 1XJVA 3PIPA 1GO3E 1HZAA 3H6MA 3IRBA 5C5LA 4YWKA 4XQNA 2L55A 1V1PA 4FO2A 4MIUA 3G4SA 4FNFA 4LF5Q 1LUZA 1WTQA 5IYBG 5M3FG 2B2WC 5CV5A 2E2IH 2LXKA 1LTAD 2HCCA 2F0LA 1HFGA 3F2BA 4L8JA 3RZDH 3CRKC 1WFQA 4NXNL 5C0XG 4F88A 4C3IG 5DM63 4KD4A 4C2MB 2QA4A 1WTPA 2F0IA 5JJIA 1SSOA 4OIJA 1RDPD 3UDFA 1Y8NB 3PF5A 4LJZC 2NVYB 5HGQA 4RGOS 1PH7A 1IL2A 2R7DA 1B2TA 2C9OA 4O0AA 5LL6S 1S72A 3H94A 3HKSA 2AHOB 1GJXA 3KDFB 1VQGA 4GNXA 2R7FA 2QCPX 5E3FA 1NJIC 3WWVA 3DMUA 2UUCQ 3URYA 5C0XJ 2R92G 4B3ML 1NAPA 4B3TQ 3ERSX 5JJLA 4U673 3HS0C 3OW7A 2A73B 3FMCA 3SE0A 2EYFA 3CXCA 3IAYA 2K7VA 4MHEA 1F2ZA 1U0LA 4ABNA 2A68D 2WINB 5IODA 4DK0A 4UPAA 5FLXL 3PIOA 1VQNA 2HD3A 4LF8Q 5IWAL 3D3RA 4KY6A 1N34Q 2HQEA 5EPLA 5D3IB 2PI2E 3G6JB 1O7LA 2RF4A 1SNMA 2F0VA 1E1TA 1W6KA 2A1AA 4CDDC 2NVTH 3MA2B 3J7A5 1MI2A 3NE5B 4JPBW 4V0BA 3I4LA 1L2FA 5IYDH 4IPHA 2B2TA 1NNXA 1B3QA 2NYZD 4TQUS 4K5XA 2D5DA 3E6ZX 3HKZE 1YJNA 3CCRA 3PGZA 4YCVA 4HIDA 1XMQL 1EWCA 4OHJA 4R4OA 1YITA 1SBBB 1NMGA 2R7ZG 1T5EA 2BH2A 3V05A 5T1IA 2C5CA 3SEBA 3ZYYX 2DN8A 4R4TA 3TP6A 1LM0A 3GTLH 2IHFA 4BY1B 4X66L 5L37A 1N32L 2AWNA 3BDLA 1GM5A 1BBUA 4A3MB 1Q8IA 3GDEA 4AQYL 1K83B 4Y7NB 1K28A 3S17H 2H5XA 2F0UA 1X65A 4BY7G 2V1CC 3PUYA 3RMHA 3S1MH 1A2UA 1D1KA 2TMPA 1HA5A 3OYYA 1DONA 4CDEC 1UWVA 1D5ZC 2ICEC 3E9HA 4DR1Q 5LMNL 1FGUA 1VQ4A 1Y1VG 5IYCG 2KHJA 1F2MA 1IXRA 3FRPB 4X3TA 2IJ0A 1QE6A 3K6OA 4EGVA 4EX5A 5AJ3Q 1BXTA 3NSWA 4JOIA 4NXNQ 3GTJB 3A56A 3C3LA 1HR0W 3M7GA 2BCOA 2GN5A 5E1FA 3SR1A 4A93B 4LF4L 4DNRB 1I50B 1JJGA 3HOYH 2B3GA 2C35B 2IT1A 3JAMc 3N52A 3M4YA 1PRTB 4C3IB 5IP9G 5IGFA 1YVCA 3FEWX 2AQ3B 5KNBA 1M90C 3I4MG 2YTYA 5KRUA 3DWPA 2RCNA 5AJ3L 2WAQG 2Q8RE 2B2YC 2XRQD 3S2DB 1BVSA 3I3CA 4QJFA 1PH2A 5ISRA 2UUCL 4A76A 4A3EG 4KN4C 2BA1A 2MJ8A 1A2TA 4DGZA 1SDFA 3F2CA 2BE5D 1GUOA 3D4RA 1IYVA 1BKBA 1A3UA 1R4PB 1UEBA 1JR0D 1V1OA 4PZ8A 1H9SB 1WCMH 3S17B 3C1FA 4EQ5A 2B2VA 3CD6A 1FNWA 3TMEA 4YWMA 2IWHA 4IOCA 3DXJC 4A3JH 3PUXA 1EYAA 2SDFA 2A69C 2Y0SE 3K57A 1SFOH 1K0RA 4LF8L 2KCMA 4QQBX 2VY3A 4H0LC 1EEFD 4TRDA 4XQQA 4K14A 1EQTA 4CHTB 1W6JA 1EOVA 3HOUB 4I7AA 1L0YB 1MJCA 1MGSA 2FFKB 4H13C 4YHHQ 3S1QH 1CHQD 3AFPA 1B50A 3DHQA 4BA1I 4F7XA 3I4NG 1KDBA 1STAA 1V43A 2D2CC 1L0XB 3ICEA 1LLRD 1E2ZA 2ENBA 2ZJRA 1TY2A 2L11A 1VQOA 2V4DA 1EY8A 2RSNA 3NQTA 4CBVA 4DR7Q 1IKMA 1Q3LA 5JVG3 2PMZB 3HOUG 5I2YA 3MVVA 3GTMH 2CHBD 2BDNA 4LK1C 2DJFC 5ELEA 1T5XD 5IP7G 5HURA 1CT1D 1IBKQ 1N32Q 2GVAA 2R61A 1B4OA 3TQYA 3F2DA 1XXGA 2E8GA 3DLLA 2AQ2B 4GLAC 5GAEC 3MEHA 4DV6Q 2JEBI 4IN3A 4RHSA 4K6LA 4KJNA 1B1ZA 3BU2A 4A3BG 2EXZA 3H0GB 3PCOB 3PV0A 1HR0L 1BO0A 3NELA 1JWUD 1SE4A 2OF1A 4Q5VA 1PYSB 4GZYC 1CFMA 1IBKL 2F0NA 5KEEA 2KHIA 3MFGA 3GTPH 1WTXA 4LFBQ 1GUSA 1JJCB 4JI1L 4LMQD 2BA0A 4X3UA 1FVIA 4PG3A 2N3SA 5M5WH 4DR6Q 4BY7H 1TR5A 1V1QA 4A3GB 4YIJA 3KF8B 2PNRC 1LT6D 4KD3A 4JI5L 4LF4Q 2QGQA 4RFBA 3JAME 4A3MG 1HTPA 4KKSA 4HCEA 3D4WA 3J80L 2A6ED 4DV4L 2LSSA 3HOYB 4LFBL 4JI1Q 4OO1H 3HOUH 3IFDA 3X3NA 3T51B 2HHHL 2X6LA 1VDZA 2RQXA 3HOZG 1PXUA 3GTJH 3E3XA 3MXNA 4DN4M 5CORA 3J80E 1KL9A 1S4ZA 4Y7NH 1SMYC 3L2PA 1Y1VB 1L1OA 3NHHA 1PA6A 2D0OA 3H91A 1O7IA 5EPKA 5IE8A 3PIP3 4HJ9A 1HTLD 1TY0A 1F9PA 1ML0D 2UXCL 4HJ7A 1KC8C 1CKNA 3JC66 4A3IH 5CYUA 1EFID 3T16A 1RIPA 4OXPA 3QWNA 3Q24A 5IIFA 4AH6A 3NTIA 2VL6A 2FJ2A 2MPMA 4DAPA 1GUNA 4MTNA 2NVQH 3PQIA 4PNYA 2EJFC 5K36H 5F2DA 1STHA 1HQMC 1JQYD 1G6PA 2MO1A 1K83H 2QDLA 4XYOA 4LWCA 3MC0B 4HSPA 2WP8J 3FKIG 1A63A 1VF7A 1SNPA 2L9HA 4LFAL 3H3VC 1J8IA 4DR2Q 4XTCS 1C7YA 4IZ8A 3U9SA 4HIOA 3VR4A 3VYTA 1QB5D 2N49A 2K28A 3PO2G 4GKKQ 4M8AA 4NXML 4C1NK 1F9SA 4B3SQ 3ULLA 4OEMB 3B6YA 4LW1A 2K52A 1VMCA 4XYQA 5IT9c 1HUMA 2JA5G 1HA6A 3A7AB 1SYBA 5TSSA 1JB3A 3NQIA 4L5TA 1B3AA 3KDFA 3OWFA 1EIGA 1RTOA 3S9WA 1X3QA 1PFNA 1CA5A 1YBYA 2ZJPA 2A8VA 1XNQL 1PH1A 5C4ZA 4B3SL 2KVMA 2ZXPA 5C3XA 1YHQA 3BG3A 1IZ6A 1E0BA 2B39A 1WTHA 3X3MA 1E7ZA 3FPPA 1VQBA 3TP5A 2F0FA 1JICA 2JQOA 4WORA 2EVBA 2JJQA 3MEFA 3R93A 2K5QA 1Y1VH 1KRTA 5IGEA 2FHTA 3I4OA 5HY6A 2IX1A 2I46A 5FOBB 3FKIH 5G3LF 5JPMC 4EQOA 1STNA 2Z1CA 4DR5L 1PTOC 4DUZQ 1DJRD 5M3FH 1O80A 2OXPA 3GTQH 2QKIC 1SLJA 1PTOB 4IUPA 2F4VQ 3K7UC 5IP9H 2NVXH 2F0JA 5AFWA 4A3BH 4GNXB 2AUKA 4RMFA 4HMJA 5M5WB 1DZ1A 4JI5Q 1PFMA 1X56A 4LF7L 2EE1A 5J1ZA 5D3DA 2XIWA 4A3FB 4XXEA 4DAMA 3V96A 3A74A 1NUCA 1J6QA 1QWYA 1X55A 1U4LA 4ZAIA 2NWGA 1EZ8A 1WI5A 4LF6L 5C4XB 4A3EH 2Q2HA 1CZWA 3R2IA 1LACA 1G51A 3AQQA 3C2PA 1TS4A 1JT8A 5IGGA 4LF9Q 2VUMG 2PW5A 4LF7Q 1EQVA 3DWAA 4A75A 4XT3B 4A3JB 1HZ9A 3I56A 3BZDB 4A3JG 2KA7A 2IY5B 5CV9A 2UU9L 4IURA 4JI6L 2GVBA 1EL0A 2KCNA 1E2WA 2J7ZA 2NB0A 2F52A 1Q46A 5KIXA 1SNCA 3UDXA 1MJEA 5LL6X 4B9WA 1PH8A 3CHBD 1Q86C 3TS2A 1B8AA 1JE4A 4DK3C 3PO3H 3S16B 3CQZH 4IOAA 1N36L 3K5NA 1LYLA 2I5HA 4DAYB 4JYAQ 2ATWA 4P72A 3PO3B 2KOLA 4KN7C 3G7LA 4IUQA 1XNRQ 1I4PA 3K7AB 5M5YB 4R9WA 4DKAC 4X65Q 5E7NA 1PV4A 2NVTB 1L1OC 4NXMQ 5IGDA 2N78A 5K36G 3CPFA 1SNQA 5C6AA 1TWCH 4GOPA 4QMGA 3H0GH 4G7OC 2CWAA 1XTCD 4JCVE 1JCKB 1U9RA 2F0WA 1S5CD 4JYAL 4UAIA 1VQIA 5C44H 1Z6HA 1YJ9A 1NCVA 1QNUA 1FNVA 4POFA 1ENAA 5DAUA 2DNCA 3BDCA 2PQEA 2SNSA 5C4JH 1STBA 3K5MA 1MD2D 1TU2B 2KJXA 1C9OA 5FO8B 3MZ5A 5BN3A 2XVSA 4JK1C 5C4HA 2A19A 1YZ6A 4R1JA 1PH3A 1FL0A 1JOOA 1VQPA 4DV1Q 3I4NH 1R4QB 3DM3A 1XPOA 3D8GA 3LWUA 2YV5A 1B9NA 1I4HA 1EU3A 2A68C 2B63H 1VQ7A 5ELOA 1NMFA 3VA7A 2F0OA 4DR5Q 1AEXA 4JV5L 2VUMH 3AB9A 5EKKA 1HNZL 1VQCA 1X3EA 1GOZA 4CJ0B 1WVLA 3HFZB 1YI2A 3H15A 1YHAA 3S16H 2H1EA 3P75A 4KY7A 1B53A 1LTID 1TS2A 2R3ZA 2QILA 4DV1L 1K73C 1JWSD 4HJ5A 4DXFA 3S24A 4K0KQ 4TSSA 5IWAQ 2PYKA 5COYA 1N34L 2CQAA 1G2SA 1XX8A 4OWWB 3Q23A 2PZTA 3GTKB 3CRLC 5C44G 3AFQA 5EPJA 1IBLQ 1KNEA 1IYJB 3LWEA 4K6DA 2XSCA 4PMCA 4IUTA 2H4OA 3RZOB 3OHXC 4FXKC 4IPGA 1KQSA 1HUNA 4DV2Q 1ILQA 3GV3A 1QJOA 2MQHA 3NEMA 3J7AV 3CCLA 3GTLB 1BF4A 2DGYA 4K2LA 4UY8C 4WJ3M 4JI8L 3E9IA 4B3RL 1BCPD 2XNAC 3M4PA 4EQPA 3HKZG 3MXGA 3HOXH 1Z47A 3RD4A 4BBRB 1H9RA 1M8AA 2BH8A 4BBSB 2WIIB 2YU9H 2K5VA 4PQXA 4A3BB 2DNEA 4B08A 5IYDG 4BBSH 2EJMA 2JA6B 4GNXC 3TZDA 4BA2I 3U50C 1ZYRC 2VQFL 3DM1A 2K03A 1KLGD 4PZ6A 2QEXA 1A3TA 1TWGH 3BZCA 2MNAA 2NTSA 2OCEA 2VUMB 1EZ6A 1H9KA 2F0HA 4M1UB 4JBMA 1RODA 4U68A 2YTVA 4AIMA 5JEAH 1CSQA 4Q0FA 4X65L 2YYZA 3WOEA 4JI4L 5LHY1
chains in the Genus database with same CATH topology
2R93B 2L1BA 1U4MA 1PTOD 1SJED 4CJ1B 1TWFB 2LMCB 3QG1A 4KI0A 4NMZA 2RDGA 2K6AA 5IGBA 1F77A 1DOLA 4C3HB 4G7ZC 3QIAA 4RAUC 5M9OA 3HOWB 1G6ZA 4NP5A 1QILA 3A55A 2WV6D 1BCPF 3EFXD 2RDFA 2K01A 1JOQA 2HDLA 1EEID 3VYUA 3P7JA 3NWSA 1TIID 2KECA 2EDGA 3HOXB 1EIHA 1UUPA 2NN6I 2K04A 4BWGB 3H09A 1U4PA 1F2LA 2A69D 3GV6A 2NUCA 3D6CA 4IUNA 1GHJA 1O7ZA 4XT1B 1HHVA 3NPPA 3VR5A 5J22A 3NTHA 1AFPA 1UAPA 3BDOA 1BUVT 5CV4A 2MHVA 2MGSA 1RTNA 1HCZA 2JA5B 1KTKA 1KABA 3HRZC 1UEAB 1A6XA 2CVRA 1EYDA 3NWTA 3MXPA 5T1GA 4WJWA 2WKCA 1WD0A 1S5FD 3K59A 2E2DC 2EYPA 5ELDA 2R7ZB 3OPOA 5JEAG 2LS01 1TT2A 1SAPA 2PZUA 2N55A 3MFYA 2QF7A 1LTTD 3OIPA 5A2QL 4NKLA 1S5ED 2A74C 2IPKD 4QB4A 2EPBA 3OWEB 4BS9A 4FF1A 1E2VA 3L7ZC 3GTPB 4O1NA 1PFBA 4FF2A 1MSGA 1I6VC 4KTAA 3A7LA 2VB2X 4PV1C 2NZ1D 2G9HD 2ICIA 3EJIA 4ILWA 3HKZB 4KKTA 4HR7B 3IFTA 5C4JB 1EY5A 1DD2A 2J0TD 2QDBA 4DK1A 2MP1A 1STGA 2Q8IB 3GTGB 4RGMA 3BS1A 3S14B 3E0JA 2B2TC 5CBAE 2F3WA 3SK6A 4I65A 1D2BA 1G91A 1G8ZD 3I4MB 2F0DA 2F03A 1K8OA 5IT9E 3DEPA 4KHZA 3Q6SA 1AP0A 3KUPA 1PRTD 4RGNA 1XWEA 3K5LA 1PZKD 5JAVA 3NP8A 1BCPC 2R6GA 3NTKA 2QEJC 3I70A 5KYLA 3S1RB 1YNNC 2ZT9C 1SJHD 3CKIB 1WCMB 1V1PB 3ND9A 2BE5C 3OMCA 1SYCA 3OOCA 4KJOA 1LV9A 4A3EB 1WTVA 4O42A 4ID6A 1D5XC 1NR4A 4HCSA 2PPBC 1OXSC 3MTSA 2F0SA 4OIKA 4WFN3 2RA4A 3MWYW 1GUWA 3P1HA 1JC7A 2RSOA 3M4OB 2WACA 1LABA 2B8FA 3S1NB 1CHPD 1FR3A 4L63B 1YNND 4ZQ3A 3Q22A 1PRTC 4QF4A 2VNUD 5BN5A 2O5IC 4A3KB 2F0EA 2R92B 1U4RA 1Y69U 1CTMA 1Q12A 4F87A 2PCFB 2BDOA 1OXVA 2E76C 1ESFA 1WTWA 4I7ZC 2F4IA 4DU9A 4FVMA 2NVQB 5FK9C 4RKBA 4IALA 1IL8A 5IOCA 3T4AC 4HAEA 1B44D 2K33A 2B2VC 5FO9B 1STEA 1D1IA 4IFDJ 4DFAA 3HOVB 4HSVA 2LY7A 1H9MA 1RKNA 1MSHA 1F9QA 3J7YW 2O2LD 4ZYSA 2XWJB 1EY9A 3K5OA 3HOZB 3VR6A 1KLUD 5FO7B 4CKBA 1EY4A 1IW7C 2DY8A 4ZUIA 1LO5D 2VXWA 4HTHA 4IFDG 4CJ2C 2K1BA 1ZYRD 3R2TA 2CW0C 1R9TB 4CKEA 3M85A 3TP8A 3NBHA 3EROA 1ZKOA 3GP7A 2EYHA 1QNKA 4C3JG 4RA8A 2KUMA 3C1EA 4K8JA 1SYEA 2M00A 4OO1G 1TWCB 1JORA 1RJTA 4S3SA 2EOTA 1TWAB 3Q0AA 1ICWA 3DEOA 4J8QA 5EKIA 1ILPA 4QIWB 2RVLA 1WTOA 1F2YA 2LFNA 2J4XA 3OSOA 3HZXA 4KV6A 4FF4A 1TWGB 1CQFA 4DAVA 4HMIA 1D5MC 2EYOA 1Q1EA 4N9PA 3KF8A 5D65A 2B2YA 2Z4HA 1CK1A 2B2UA 3T13A 2F0MA 4DF7A 2YU9B 3D31A 4FXGC 2A6HD 5K5PA 1BNZA 2SEBD 1BBXC 3RZDB 1SMYD 1KAAA 4RCOA 5EJWA 4ZK9B 3TSSA 4JBWA 4EVOA 5DM73 3I90A 3QB3A 1EY7A 1CQVA 3VA5A 5ELFA 1I3QB 1Y8PB 1PTOF 2N88A 3ND8A 2EY5A 4DXGA 1TKWB 2BOSA 4PMBA 3V2TA 2XN9C 1ZXTA 3PMFA 3BYYB 3PUZA 3DUZA 3J81L 3PO2B 3TBIB 1SFOB 4G7HC 3GD7A 1O7YA 4G57A 1RCVD 3TDQA 3A8KE 3PUWA 1Z7TA 1XYIA 3QJYA 3KLRA 3GTQB 3SK4A 4ZKBB 1NSNS 4ZLTF 1LT4D 3UI2A 5M5XB 3AU7A 1ENCA 1TQOA 3IKJA 1QCBD 1H9SA 1V8QA 2B2WA 3BVMA 2EYMA 2A6EC 3GQBA 5JPNC 3OIQA 3PUVA 2Z8LA 2JEAI 4QUCA 1SYGA 1S5DD 2HUGA 2FMCA 3HP3A 3D6WA 3NXWA 5E4WC 4H44C 3CQZB 1IKLA 1UNSA 5JOBA 1I4XA 3VR3A 3U9OA 1S5BD 5EBCA 3F2UA 1WD1A 2FMMA 4C3JB 1H9JA 4WRDA 3I91A 3P20A 3EVQA 1AZPA 2Q8TA 3VR2A 4ZKCB 1ZEQX 3O13A 2E2JB 3SHLA 2VB3X 4XIGS 5IGCA 3A54A 2WKDA 1PLFA 1Y1WB 3T56B 1KNAA 1Y8OB 5I2XA 3A8IE 4ULLA 4H7BA 3S1MB 1LTGD 1DXMA 4IQZA 2KCCA 2SOBA 1I4GA 1BDOA 1IYUA 1OXXK 2L5TA 3RLFA 4X3KA 5C3WA 2K5DA 1G291 3SK8A 1PTOH 1X3PA 5EQ0A 2NN6H 2F0TA 1WTRA 3FPUB 3M7NA 2F3VA 4Z9CB 3R8BA 3FVQA 5NUCA 1EYCA 2L12A 4C56C 4RGTA 2KHSA 5CGKA 4KMUC 1EWHA 3GTOB 5C5MA 1FYCA 4A3IB 3BYTB 3SK5A 1YNJD 5DNFA 3T53B 3L3OC 1D6EC 2EY2A 4FP5D 4ZRZA 2A6HC 2EYLA 2PO4A 1LTBD 1O78A 4R8NA 1FGBD 3KLSX 2K5WA 4XQJA 1DYQA 2B8GA 2GA4B 1TVXA 3J7AF 4HN7A 1CZGA 3IL8A 1DCZA 5I6WA 3L9AX 3ERQA 1ET6A 4V190 4RHRA 3VYSA 2EYJA 3MHBA 4PMWA 1VCIA 1GHKA 2AQ1B 3S1QB 5I6YA 1M4VA 1LT5D 4IFDI 3S15B 1OXUA 4DAYA 1PZID 2PZWA 4KK7A 5E4XA 2NBFA 3HG9A 3W3AA 2XWBB 5CV8A 3LNNA 1AN8A 3VYRA 2NN6G 2PW7A 3KBXA 4KHVA 1PRTF 4IFDH 4HEDA 1VMPA 4F8MA 1SNDA 1FNUA 1DOMA 5C44B 3K0YA 5KNCA 1HPCA 2IX3A 2FINB 5D14A 3SDZA 2B63B 1QOHA 1QG7A 2X6GA 4R8IA 1I6HB 4B9XA 2E75C 3R3OA 1FD7D 5FLXE 5I9PA 1SEBD 1BR9A 4RKLA 4OL7A 4NW2A 4RH6A 3ONAB 1RHPA 2E2HB 2EJGC 2LKVA 2SNMA 3KK7A 2DY7A 2JSOA 1BOSA 1AW7A 1ENFA 4FXDA 2IL8A 5EBDA 4J6HA 1TS5A 4G4KA 2OT2A 3N6RA 1SYFA 4ME5A 5A2QE 5FKAC 2K32A 3CU7A 5EKLA 1BQQT 2F0PA 4QCLA 1EOTA 1F9RA 5CV7A 1OO9B 4IUUA 1SXTA 3BVZA 2JA7B 4C3HG 3I4NB 2B2UC 2M9VA 2F0QA 1I4QA 2AUJD 1CM9A 3I8ZA 5I4DA 2NVXB 5ELCA 4MN3A 4K2KA 1HQRD 1TS3A 2ID0A 2D9UA 4LAAA 1VF5C 4CGYB 4DNTB 3MAQA 3W2DA 4OO1I 1MBYA 4OGQC 1X32A 1CA6A 3M3YB 5KYIA 1I4RA 2ZXRA 2HCIA 4P2CB 1STYA 3OMGA 2E74C 3QO2A 3S2HB 3KLSA 2NTTA 3QOLA 3SXHA 3TP7A 4TKOB 5KGUA 1G2TA 5IT9L 5EGTA 2F0KA 1RD9D 4RWSC 1ONLA 2EZVA 2KQ3A 5M3FB 3A8JE 4AYBB 2L0CA 3K58A 3EA6A 1SE3A 5CC4A 1BCPB 2TSSA 5A35A 3TZUA 4QUFA 4IUVA 3EQLC 1HRJA 2F1MA 5JJZA 2EY6A 3J81E 3HEJA 4FF3A 3D4DA 1SYDA 4N9TA 5CR3A 2OEOA 2XRSD 4KKUA 1LTSD 1A3VA 3I73A 4RCNA 1JWMD 2ZXOA 2RBMA 3BVGA 1LTRD 5CMDA 1C48A 3QOJA 3DWQA 1PZJD 1LT3D 5CBEE 5DEHA 3NUCA 1JOKA 1SE2A 4J1MA 4FYDA 5M3MB 2WAQB 1EY6A 2KEEA 3FKIB 2Z4IA 3SVMA 2G9DA 4NDXA 5BN4A 4CKCA 2IX0A 2I07B 4EQNA 2RKSA 1TWHB 3NK9A 1GXDC 2E2IB 1C8CA 2A5HA 4UDUC 3GTMB 2MUYA 4K8IA 3FDTA 3ITPA 1GUTA 5KNDA 4A3DB 5G3LD 1C4QA 2KEDA 3MXUA 3JAML 4K5WA 4X3SA 1KDCA 1ET9A 1CI3M 4K5VA 3PIO3 3C46A 2HDMA 1SNOA 2K05A 3GO5A 1DOKA 2O5JC 1RF2D 5CV6A 2CW0D 1IW7D 1J9OA 1DM0B 1NR2A 2Y0SB 3TN2A 2O4XA 5C0XH 3LX0A 3WOFA 1K8MA 1PYWD 2IW3A 5JEAJ 1KDAA 2WB1B 1HFNA 1YNJC 3RUZA 4ODGA 3I72A 5ELBA 5C0XI 4L6TB 2D62A 3WDNA 3E5SA 3HGBA 2JA8B 2JXMB 2EY1A 1IHZA 1HXYD 4BY7B 4C1NI 1II3A 2M2LA 1Q1BA 4XDXA 1PDQA 2X69A 2JYOA 1GUGA 5J39A 4DA2A 1PMRA 3KBGA 5HGTA 2F0GA 1AZQA 3AMUA 4ZUJA 4E6IA 1EU4A 2JE6I 1OXTA 4KY5A 1EY0A 5JVH3 2AWOA 5C3EB 1Q90A 2L4NA 2RDHA 1A15A 2JP1A 1ESRA 1B9MA 3NBIA 5I9OA 3H6MA 5C5LA 4XQNA 2L55A 1V1PA 4FO2A 4MIUA 4FNFA 1WTQA 2B2WC 5CV5A 1LTAD 2HCCA 2F0LA 1HFGA 4L8JA 3CRKC 5C0XG 4F88A 4C3IG 5DM63 4KD4A 4C2MB 1WTPA 2F0IA 1SSOA 4OIJA 1RDPD 1Y8NB 4LJZC 2NVYB 4RGOS 1B2TA 2C9OA 5LL6S 3H94A 1GJXA 2QCPX 5E3FA 3DMUA 3URYA 5C0XJ 1NAPA 4U673 3HS0C 3OW7A 2A73B 3FMCA 3SE0A 2EYFA 3IAYA 2K7VA 4MHEA 1F2ZA 4ABNA 2A68D 2WINB 5IODA 4DK0A 5FLXL 3D3RA 4KY6A 2HQEA 5EPLA 5D3IB 3G6JB 1O7LA 1SNMA 2F0VA 1W6KA 3MA2B 1MI2A 3NE5B 4V0BA 3I4LA 2B2TA 2NYZD 4TQUS 4K5XA 2D5DA 3E6ZX 1EWCA 4OHJA 1SBBB 1T5EA 3V05A 5T1IA 2C5CA 3SEBA 3ZYYX 2DN8A 3TP6A 4BY1B 2AWNA 3BDLA 4A3MB 1Q8IA 1K83B 4Y7NB 2F0UA 3RMHA 3PUYA 1A2UA 1D1KA 2TMPA 1HA5A 1DONA 1D5ZC 2ICEC 1F2MA 3FRPB 4X3TA 2IJ0A 1QE6A 3K6OA 4EGVA 1BXTA 3NSWA 3GTJB 3A56A 3C3LA 3M7GA 2BCOA 5E1FA 3SR1A 4A93B 4DNRB 1I50B 2IT1A 3N52A 3M4YA 1PRTB 4C3IB 5IGFA 3FEWX 2AQ3B 5KNBA 5KRUA 3DWPA 2Q8RE 2B2YC 2XRQD 3S2DB 3I3CA 5ISRA 4KN4C 2BA1A 2MJ8A 1A2TA 4DGZA 1SDFA 2BE5D 1GUOA 3D4RA 1IYVA 1A3UA 1R4PB 1JR0D 1V1OA 1H9SB 3S17B 3C1FA 2B2VA 1FNWA 3TMEA 2IWHA 3DXJC 3PUXA 1EYAA 2SDFA 2A69C 3K57A 4H0LC 4XQQA 1EEFD 4TRDA 4K14A 1EQTA 4CHTB 1W6JA 3HOUB 1L0YB 1MGSA 2FFKB 4H13C 1CHQD 1B50A 3DHQA 4BA1I 4F7XA 1KDBA 1STAA 1V43A 2D2CC 1L0XB 1LLRD 1E2ZA 2ENBA 1TY2A 2L11A 2V4DA 1EY8A 2RSNA 3NQTA 4CBVA 1IKMA 1Q3LA 5JVG3 2PMZB 5I2YA 3MVVA 2CHBD 2BDNA 4LK1C 5ELEA 1T5XD 5HURA 1CT1D 2R61A 1B4OA 1XXGA 2AQ2B 3MEHA 2JEBI 4IN3A 4RHSA 4K6LA 4KJNA 1B1ZA 2EXZA 3H0GB 3PV0A 1BO0A 1JWUD 1SE4A 2OF1A 4Q5VA 4GZYC 1CFMA 2F0NA 5KEEA 3MFGA 1WTXA 1GUSA 4LMQD 2BA0A 4X3UA 1TR5A 4A3GB 4YIJA 2PNRC 1LT6D 4KD3A 4RFBA 3JAME 1HTPA 4KKSA 4HCEA 3D4WA 3J80L 2A6ED 3HOYB 4OO1H 3IFDA 3X3NA 3T51B 2X6LA 1VDZA 2RQXA 1PXUA 3MXNA 4DN4M 5CORA 3J80E 1S4ZA 1SMYC 1Y1VB 3NHHA 3H91A 5EPKA 3PIP3 1HTLD 1TY0A 1F9PA 1ML0D 5CYUA 1EFID 3T16A 3QWNA 3Q24A 5IIFA 3NTIA 2FJ2A 2MPMA 4DAPA 1GUNA 4PNYA 2EJFC 5K36H 5F2DA 1STHA 1HQMC 1JQYD 4XYOA 3MC0B 4HSPA 2WP8J 1VF7A 1SNPA 2L9HA 3H3VC 1J8IA 4XTCS 4IZ8A 3U9SA 3VR4A 3VYTA 1QB5D 2K28A 4M8AA 4C1NK 1F9SA 1VMCA 4XYQA 1HUMA 1HA6A 3A7AB 1SYBA 5TSSA 1JB3A 3NQIA 1B3AA 3OWFA 1EIGA 1RTOA 3S9WA 1X3QA 1PFNA 1CA5A 5C4ZA 2KVMA 2ZXPA 5C3XA 3BG3A 1E0BA 2B39A 3X3MA 3FPPA 3TP5A 2F0FA 1JICA 4WORA 2EVBA 3R93A 2K5QA 5IGEA 2FHTA 2IX1A 2I46A 5FOBB 5G3LF 5JPMC 4EQOA 1STNA 2Z1CA 1PTOC 1DJRD 1O80A 2OXPA 2QKIC 1PTOB 4IUPA 2F0JA 5AFWA 2AUKA 4HMJA 5M5WB 1DZ1A 1PFMA 2EE1A 5J1ZA 5D3DA 2XIWA 4A3FB 4XXEA 3V96A 1NUCA 1QWYA 1U4LA 4ZAIA 2NWGA 1EZ8A 5C4XB 1CZWA 3R2IA 1LACA 3C2PA 1TS4A 5IGGA 2PW5A 1EQVA 3DWAA 4XT3B 4A3JB 3BZDB 2KA7A 5CV9A 4IURA 1EL0A 2KCNA 1E2WA 2J7ZA 2NB0A 5KIXA 1SNCA 5LL6X 4B9WA 3CHBD 1JE4A 3S16B 3K5NA 3PO3B 2KOLA 4KN7C 3G7LA 4IUQA 1I4PA 3K7AB 5M5YB 4R9WA 2NVTB 5IGDA 5K36G 1SNQA 5C6AA 4QMGA 4G7OC 1XTCD 1JCKB 1U9RA 2F0WA 1S5CD 4UAIA 1Z6HA 1NCVA 1QNUA 1FNVA 1ENAA 5DAUA 2DNCA 3BDCA 2PQEA 2SNSA 1STBA 3K5MA 1MD2D 1TU2B 2KJXA 5FO8B 3MZ5A 5BN3A 2XVSA 4JK1C 5C4HA 1JOOA 1R4QB 3D8GA 3LWUA 1B9NA 1I4HA 1EU3A 2A68C 3VA7A 2F0OA 1AEXA 3AB9A 5EKKA 1WVLA 1GOZA 4CJ0B 2H1EA 3P75A 4KY7A 1B53A 1LTID 1TS2A 2R3ZA 2QILA 1JWSD 4DXFA 4TSSA 2PYKA 5COYA 2CQAA 1G2SA 1XX8A 3Q23A 2PZTA 3GTKB 3CRLC 5EPJA 1KNEA 3LWEA 4K6DA 2XSCA 4PMCA 4IUTA 2H4OA 3RZOB 3OHXC 4FXKC 1HUNA 1ILQA 3GV3A 1QJOA 3J7AV 3GTLB 1BF4A 4K2LA 1BCPD 2XNAC 4EQPA 3MXGA 1Z47A 3RD4A 4BBRB 1H9RA 1M8AA 4BBSB 2WIIB 4PQXA 4A3BB 2DNEA 4B08A 2EJMA 2JA6B 4BA2I 3TZDA 1ZYRC 3DM1A 2K03A 1KLGD 1A3TA 2NTSA 2VUMB 1EZ6A 1H9KA 2F0HA 4M1UB 1RODA 4U68A 5JEAH 4Q0FA 2YYZA 3WOEA 5LHY1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY6 A;  3ERQ A;  3MZ5 A;  4HMJ A;  2EYJ A;  3HEJ A;  2F0S A;  3MHB A;  4NKL A;  3TP6 A;  5EKL A;  3D4D A;  4PMB A;  1SYD A;  3DHQ A;  3TP8 A;  3ERO A;  5CV6 A;  3T16 A;  4N9T A;  3V2T A;  4F7X A;  2F0P A;  5CR3 A;  2F0L A;  1JOO A;  2OEO A;  1KDB A;  4QB4 A;  1STA A;  3P1H A;  5CV7 A;  5J1Z A;  3PMF A;  1A3V A;  3BDL A;  4H7B A;  4NMZ A;  5I6Y A;  5IIF A;  3D8G A;  2EYH A;  5IGB A;  2WAC A;  1NUC A;  2O4X A;  2SOB A;  2ENB A;  4PNY A;  2F0O A;  3LX0 A;  1EZ8 A;  1AEX A;  2F0U A;  2RBM A;  3C1E A;  4G57 A;  4K8J A;  4KD4 A;  2PZW A;  4KTA A;  2F0I A;  5F2D A;  5EKK A;  1EY8 A;  2F0Q A;  5M9O A;  1A2U A;  4ZQ3 A;  3NQT A;  4NP5 A;  1STH A;  1SYE A;  3QOJ A;  2M00 A;  2RDF A;  3P75 A;  4K2K A;  5IGG A;  4KY7 A;  4QF4 A;  1KDA A;  2PW5 A;  1JOR A;  1EQV A;  5CV8 A;  3MVV A;  5EGT A;  4S3S A;  5C3W A;  3EJI A;  1SNP A;  2F0E A;  1JOQ A;  5DEH A;  2PW7 A;  3NUC A;  1F2M A;  4KHV A;  3SK4 A;  4IZ8 A;  3SK8 A;  1JOK A;  2PYK A;  1NSN S;  4J1M A;  5CV9 A;  3RUZ A;  5HUR A;  1EY5 A;  4LAA A;  5E3F A;  4ODG A;  2PZT A;  1EY6 A;  2QDB A;  1STG A;  1ENC A;  2F0T A;  1TQO A;  3DMU A;  4F8M A;  1F2Y A;  1SND A;  3MEH A;  2F3V A;  3E5S A;  5E1F A;  3SR1 A;  5KIX A;  1SNC A;  5NUC A;  1EYC A;  1SYB A;  3OSO A;  3HZX A;  4KJN A;  4KV6 A;  4K6D A;  4PMC A;  4B9W A;  4RKB A;  2F3W A;  4NDX A;  2EYM A;  2KHS A;  3OWF A;  2EYF A;  1IHZ A;  2EY1 A;  2EXZ A;  2NUC A;  3D6C A;  4I65 A;  4IAL A;  3SK6 A;  5CGK A;  5KYI A;  3S9W A;  4HMI A;  5IGF A;  5IOC A;  2OF1 A;  1F2Z A;  2EYO A;  4N9P A;  1STY A;  5IOD A;  3OMG A;  4IUN A;  4EQN A;  2F0N A;  1II3 A;  5KRU A;  5C5M A;  5KEE A;  2F0D A;  2RKS A;  3T13 A;  3NK9 A;  5C4Z A;  3SK5 A;  5J22 A;  5J39 A;  4K2L A;  4B9X A;  1SYG A;  2F0M A;  3QOL A;  5C3X A;  3R3O A;  4DF7 A;  3SXH A;  5C4H A;  5HGT A;  3TP7 A;  4DFA A;  2F0G A;  4KY6 A;  5CV4 A;  2HQE A;  5K5P A;  3NXW A;  4EQP A;  4ZUJ A;  5KGU A;  4E6I A;  1RKN A;  5IGD A;  4K8I A;  5I9P A;  1SNQ A;  5C6A A;  3ITP A;  2EY2 A;  4KY5 A;  4QMG A;  4RKL A;  1EY0 A;  1SNM A;  1TR5 A;  4OL7 A;  1A2T A;  2F0K A;  2F0V A;  1KAB A;  2F0F A;  4YIJ A;  5JOB A;  3TP5 A;  4DGZ A;  5JAV A;  2LKV A;  3NP8 A;  4KD3 A;  4WOR A;  2EYL A;  2SNM A;  1KAA A;  3U9O A;  1U9R A;  3D4W A;  1EY9 A;  1A3U A;  2F0W A;  5IGE A;  5KYL A;  2KQ3 A;  4WRD A;  4R8N A;  5I9O A;  1EYD A;  3C1F A;  4EVO A;  3MXP A;  3TME A;  1STN A;  4EQO A;  4K5W A;  4J6H A;  3EVQ A;  3H6M A;  3QB3 A;  1EY4 A;  1A3T A;  1EY7 A;  1KDC A;  4K5X A;  5ISR A;  5C5L A;  1ENA A;  2EYP A;  2OXP A;  5DAU A;  1EYA A;  4ZUI A;  3VA5 A;  1EZ6 A;  1SYF A;  5CC4 A;  4K5V A;  4DU9 A;  3BDC A;  2F0H A;  3OMC A;  2PQE A;  1SYC A;  4HTH A;  2SNS A;  4ME5 A;  1TT2 A;  4MIU A;  1SNO A;  3SHL A;  5IGC A;  1STB A;  2F0J A;  4TRD A;  2PZU A;  4K14 A;  4KJO A;  5CV5 A;  5I6W A;  3NHH A;  4ID6 A;  2EY5 A; 
#chains in the Genus database with same CATH topology
 2R93 B;  2L1B A;  2KEN A;  2G5D A;  3MXN B;  1U4M A;  2ZTE A;  1PTO D;  1SJE D;  4CJ1 B;  1TWF B;  2LMC B;  3QG1 A;  1CKM A;  4KI0 A;  2RDG A;  4NMZ A;  2K6A A;  5IGB A;  1F77 A;  2ZM6 L;  1DOL A;  4C3H B;  4G7Z C;  3QIA A;  4RAU C;  4JI7 L;  5GQO A;  5M9O A;  3HOW B;  1G6Z A;  1E3P A;  4NP5 A;  1QIL A;  3A55 A;  2WV6 D;  2MFI A;  1BCP F;  3EFX D;  2RDF A;  4OEL B;  1QVF A;  4BXX G;  2K01 A;  1XPR A;  1JOQ A;  2HDL A;  1EEI D;  5BR8 Q;  3CCU A;  3VYU A;  3P7J A;  2RHQ B;  3NWS A;  4JW0 A;  3ULP A;  3U4V A;  2OQK A;  1TII D;  2KEC A;  4GLX A;  2EDG A;  1Y1W G;  2NVY H;  3HOX B;  1EIH A;  1UUP A;  2NN6 I;  2JA7 G;  2Q2T A;  2L15 A;  2K04 A;  4LFC L;  5M5Y H;  4BWG B;  5M3M H;  4L5Q A;  4A3I G;  3H09 A;  4A3C G;  1U4P A;  1F2L A;  2A69 D;  3GV6 A;  5BR8 L;  2NUC A;  3D6C A;  4CDC C;  4LUV A;  4FDB A;  1ASY A;  1ICF B;  4IUN A;  1GHJ A;  1O7Z A;  4XT1 B;  1HHV A;  3NPP A;  3VR5 A;  5J22 A;  3NTH A;  1HZB A;  1QZG A;  1AFP A;  3KYH C;  1UAP A;  4LFC Q;  3BDO A;  3HOX G;  4A3D H;  1BUV T;  3S14 H;  2JK8 A;  4R4Q A;  5CV4 A;  2MHV A;  4B3T L;  2MGS A;  1QZH A;  1RTN A;  1HCZ A;  1VQA A;  1QUQ B;  2JA5 B;  2WFW A;  1KTK A;  1KAB A;  3HRZ C;  1UEA B;  4IJH A;  3CF5 A;  2PQA B;  1A6X A;  2CVR A;  3CC2 A;  1EYD A;  3NWT A;  3MXP A;  5T1G A;  2R92 H;  4WJW A;  2WKC A;  1WD0 A;  2Z6K A;  1S5F D;  3K59 A;  2E2D C;  2EYP A;  5ELD A;  3M9B A;  2R7Z B;  4DR7 L;  3CW2 C;  4B3R Q;  3OPO A;  5JEA G;  2LS0 1;  1TT2 A;  1SAP A;  2PZU A;  1HNW Q;  2N55 A;  3K0X A;  3MFY A;  2QF7 A;  1LTT D;  2QW7 A;  1N9W A;  1K8G A;  3KF6 B;  3OIP A;  3QR8 A;  5A2Q L;  4NKL A;  1S5E D;  2A74 C;  2IPK D;  2I5M X;  4QB4 A;  2EPB A;  4A3G G;  1PFS A;  3OWE B;  4BS9 A;  4FF1 A;  1X6O A;  1E2V A;  2VQF Q;  4DV6 L;  3L7Z C;  3GTP B;  4O1N A;  1PFB A;  4FF2 A;  3H0G G;  1MSG A;  4LUZ A;  1I6V C;  4KTA A;  4JBJ A;  4DV0 L;  3A7L A;  1TWA H;  2VB2 X;  4PV1 C;  2NZ1 D;  2G9H D;  4JI3 Q;  3G6E A;  2ICI A;  3EJI A;  4HJ8 A;  4ILW A;  3HKZ B;  1IBM L;  4KKT A;  4HR7 B;  2E2J H;  3IFT A;  2R93 H;  5C4J B;  1EY5 A;  2R93 G;  1DD2 A;  2J0T D;  2JA5 H;  2QDB A;  5J3B A;  1CKN B;  4DK1 A;  2MP1 A;  1STG A;  2Q8I B;  3GTG B;  4RGM A;  4JI7 Q;  3W5O A;  3BS1 A;  3S14 B;  3E0J A;  2B2T C;  2Z9H A;  4JI3 L;  5CBA E;  4DR1 L;  2F3W A;  1Y14 B;  4P71 A;  3SK6 A;  4I65 A;  1D2B A;  1G91 A;  1IBM Q;  1G8Z D;  3I4M B;  2HHH Q;  3HOW G;  2F0D A;  2F03 A;  1KAW A;  4DK6 C;  4DNI A;  3RLN A;  1K8O A;  5IT9 E;  1JE5 A;  3DEP A;  1K3R A;  4KHZ A;  3Q6S A;  1HNX Q;  1EFW A;  1AP0 A;  4JC0 A;  3KUP A;  2K5H A;  1PRT D;  2OQ0 A;  4RGN A;  1VQL A;  1AE3 A;  1XWE A;  2UXD Q;  3OW2 A;  2UXC Q;  3K5L A;  1K0S A;  1PZK D;  5JAV A;  1FJG L;  3NP8 A;  1BCP C;  2EIF A;  2E5L Q;  2R6G A;  1XPU A;  1Z9F A;  3NTK A;  3TS0 A;  2QEJ C;  3I70 A;  4X64 Q;  5KYL A;  3S1R B;  4GKJ L;  1YNN C;  2ZT9 C;  4MNO A;  1SJH D;  3NBH B;  3CKI B;  1WCM B;  2UXD L;  1V1P B;  3ND9 A;  2BE5 C;  3OMC A;  5LMN W;  1SYC A;  3OOC A;  2JA6 G;  2JA9 A;  3NEN A;  1FJG Q;  4KHP Q;  3CPW A;  4KJO A;  1LV9 A;  4A3E B;  2OWO A;  1J5E L;  1WTV A;  4O42 A;  4ID6 A;  1D5X C;  1NR4 A;  4HCS A;  4X64 L;  2PPB C;  1OXS C;  3MTS A;  2F0S A;  4OIK A;  4WFN 3;  2RA4 A;  3MWY W;  1GUW A;  3P1H A;  1JC7 A;  2RSO A;  3M4O B;  2WAC A;  1LAB A;  2B8F A;  3S1N B;  1CHP D;  3T1Y Q;  1FR3 A;  4L63 B;  1YNN D;  4ZQ3 A;  1C0A A;  1JJ2 A;  3Q22 A;  2ASB A;  1HNW L;  1PRT C;  4QF4 A;  3AYH B;  5BN5 A;  2O5I C;  2VNU D;  4A3K B;  1XNQ Q;  1X3G A;  2F0E A;  2R92 B;  1U4R A;  1UE7 A;  1Y69 U;  1CTM A;  3J81 i;  4HIK A;  1Q12 A;  3KF6 A;  4F87 A;  3HOV G;  2PCF B;  2BDO A;  3TRE A;  3T1Y L;  1OXV A;  3KLW A;  2E76 C;  2JA8 G;  1ESF A;  1WTW A;  4I7Z C;  1SN8 A;  2F4I A;  4DU9 A;  4YWL A;  3KFU A;  4FVM A;  2NVQ B;  5FK9 C;  4DV0 Q;  4RKB A;  4IAL A;  1IL8 A;  4DR4 Q;  5IOC A;  3T4A C;  1E22 A;  4HAE A;  5LMU L;  1HH2 P;  1B44 D;  2K33 A;  1D8L A;  2B2V C;  5M5X H;  5FO9 B;  4IPD A;  1STE A;  1D1I A;  4IFD J;  4DFA A;  3HOV B;  4HSV A;  4DUY L;  2LY7 A;  1H9M A;  4J15 A;  1RKN A;  1VQK A;  4GN5 A;  1MSH A;  1F9Q A;  5C4X H;  3J7Y W;  2O2L D;  1BBW A;  4ZYS A;  2XWJ B;  3EBE A;  1EY9 A;  2YTX A;  3K5O A;  4OWT B;  3HOZ B;  3VR6 A;  1KLU D;  5FO7 B;  2Y0S G;  4CKB A;  4YY3 Q;  1EY4 A;  1IW7 C;  2DY8 A;  3J81 c;  1GD7 A;  2WB1 E;  4ZUI A;  2LXJ A;  1LO5 D;  2VXW A;  4HTH A;  4IFD G;  3M4Q A;  4CJ2 C;  2K1B A;  1ZYR D;  3R2T A;  2CW0 C;  1B70 B;  2UUA L;  1AH9 A;  1OTC A;  1A8V A;  4DV7 L;  1R9T B;  4CKE A;  3M85 A;  3TP8 A;  3S2H H;  2IHE A;  1KRS A;  3ERO A;  3NBH A;  4QIW E;  1W3S A;  1ZKO A;  3GP7 A;  3SGI A;  2EYH A;  1B7Y B;  4QY7 A;  4GKJ Q;  1QNK A;  1VQD A;  2FXQ A;  4POG A;  4C3J G;  4RA8 A;  3CCV A;  2KUM A;  3C1E A;  4K8J A;  3U58 A;  2ES2 A;  1N8R C;  1SYE A;  2M00 A;  3VDY A;  2ALY B;  4OO1 G;  1TWC B;  1JOR A;  1RJT A;  1GKH A;  4S3S A;  4A3L G;  2EOT A;  3W1B A;  3PSI A;  4NPS A;  5C4X G;  3S15 H;  2K14 A;  1TWA B;  3Q0A A;  1N33 L;  1ICW A;  3J7Z C;  1VQJ A;  3GTO H;  3DEO A;  1XNR L;  4J8Q A;  5EKI A;  1E24 A;  1ILP A;  4QIW B;  2RVL A;  4L5S A;  1WTO A;  1CSP A;  1F2Y A;  2LFN A;  1PH4 A;  1QVC A;  2J4X A;  5FLM H;  1CKO A;  3OSO A;  4KV6 A;  3HZX A;  4FF4 A;  1TWG B;  3PO3 G;  3J80 i;  1CQF A;  4DAV A;  3AEV A;  2CH4 A;  1D7Q A;  4HMI A;  1D5M C;  2EYO A;  1Q1E A;  2VQE L;  4N9P A;  1EIY B;  3HOY G;  3KF8 A;  5D65 A;  1ASZ A;  2B2Y A;  2Z4H A;  1CK1 A;  4OON A;  3ZJY C;  2B2U A;  3T13 A;  3K80 C;  1L1O B;  2F0M A;  1X9N A;  4DF7 A;  2YU9 B;  3D31 A;  1MKH A;  4FXG C;  2A6H D;  5K5P A;  4N8F A;  3TRZ A;  1BNZ A;  2SEB D;  1BBX C;  3RZD B;  1SMY D;  4DV5 L;  1P16 A;  1E1O A;  1KAA A;  4RCO A;  5EJW A;  5FLX c;  4ZK9 B;  1RL2 A;  3TSS A;  3PF4 A;  1UE5 A;  3GTG H;  4JBW A;  2XTI A;  5EAY A;  5DM7 3;  4EVO A;  3I90 A;  3QB3 A;  1EY7 A;  1CQV A;  4LUO A;  1WYD A;  3VA5 A;  3RR5 A;  2DJG C;  5ELF A;  4JG2 A;  1I3Q B;  1Y8P B;  1PTO F;  2N88 A;  1DGS A;  3ND8 A;  1GVP A;  2EY5 A;  4DXG A;  1TKW B;  2BOS A;  4UP9 A;  1NY4 A;  4PMB A;  3V2T A;  4K0K L;  2XN9 C;  4C2M H;  1ZXT A;  3PMF A;  3BYY B;  4DUZ L;  2I0Q A;  4C3J H;  3PUZ A;  3DUZ A;  3J81 L;  3PO2 B;  5H1S E;  1S3O A;  3TBI B;  1SFO B;  1IBL L;  4G7H C;  3GD7 A;  3UE1 A;  1O7Y A;  4G57 A;  2ZJQ A;  1RCV D;  3TDQ A;  3A8K E;  3PUW A;  4MZ9 A;  1VQE A;  3J80 c;  1PH9 A;  1Z7T A;  4DV2 L;  1XYI A;  3QJY A;  4P75 A;  2NZH A;  3KLR A;  2N8N A;  3GTQ B;  4R4C A;  3SK4 A;  4JI8 Q;  1SMX A;  1Y1W H;  4ZKB B;  1NSN S;  4NB3 A;  4YCU A;  4ZLT F;  2WAQ E;  3A5Z B;  1LT4 D;  3UI2 A;  5M5X B;  3AU7 A;  3ER0 A;  1ENC A;  1TQO A;  3IKJ A;  3OTO Q;  1L0W A;  4JVZ A;  3L0O A;  1QCB D;  4A3C H;  1H9S A;  1VQ9 A;  4LF9 L;  1V8Q A;  1U5K A;  2B2W A;  3BVM A;  2EYM A;  2A6E C;  3BJU A;  3GQB A;  5JPN C;  3OIQ A;  4JI6 Q;  3PUV A;  3JAM i;  3K7A H;  2Z8L A;  2JEA I;  4QUC A;  2CCZ A;  4A93 H;  1SYG A;  1N33 Q;  3OTO L;  1S5D D;  2HUG A;  2FMC A;  3HP3 A;  3D6W A;  2E2H H;  4JI2 L;  2Z0S A;  3U4Z A;  3NXW A;  1A0I A;  5E4W C;  4H44 C;  3CQZ B;  1TWH H;  4JI4 Q;  1KHI A;  1WOC A;  4GOP B;  1IKL A;  1UNS A;  2K50 A;  5JOB A;  1I4X A;  3VR3 A;  2UXB L;  4GN3 B;  4Y52 H;  2EQS A;  3U9O A;  1UE6 A;  4DV3 L;  1S5B D;  5EBC A;  1N36 Q;  3F2U A;  1WD1 A;  4A3L H;  2FMM A;  4C3J B;  1H9J A;  2ZM6 Q;  4WRD A;  4H02 A;  3I91 A;  3P20 A;  3EVQ A;  1AZP A;  2JA8 H;  2Q8T A;  3VR2 A;  4ZKC B;  1ZEQ X;  1HJP A;  3O13 A;  2E2J B;  2VB3 X;  4XIG S;  3SHL A;  5IGC A;  4P73 A;  3A54 A;  2D0P A;  1EWI A;  2WKD A;  1PLF A;  1PVO A;  4DV3 Q;  1Y1W B;  4DV5 Q;  3T56 B;  3F8T A;  1KNA A;  4AYB E;  1Y8O B;  4WJ4 A;  5I2X A;  4UP7 A;  3A8I E;  4ULL A;  5LMN Q;  4H7B A;  3S1M B;  1YNX A;  1LTG D;  1DXM A;  4IQZ A;  4A3F G;  2KCC A;  2SOB A;  1PH6 A;  1I4G A;  1PYB A;  2XGT A;  1EYG A;  4LF5 L;  1BDO A;  2P5Z X;  1IYU A;  1OXX K;  2L5T A;  3RLF A;  4X3K A;  4YCW A;  5C3W A;  1SE8 A;  1I6H H;  2K5D A;  1G29 1;  3Q8D A;  1EIF A;  3SK8 A;  1PTO H;  1X3P A;  3S1N H;  5EQ0 A;  1NBW A;  2NN6 H;  3EN2 A;  4JV5 Q;  5M3M G;  3G48 A;  1HNZ Q;  2F0T A;  1WTR A;  3FPU B;  3CP0 A;  3M7N A;  2F3V A;  4Z9C B;  2VW9 A;  3R8B A;  2AKW B;  3FVQ A;  5NUC A;  1EYC A;  2L12 A;  4C56 C;  3E0E A;  1P8L A;  2KHS A;  4RGT A;  5CGK A;  4KMU C;  3HOW H;  1EWH A;  3GTO B;  5C5M A;  3CCJ A;  1FYC A;  1YHB A;  3BYT B;  4A3I B;  3A0J A;  3SK5 A;  1M1K C;  1YNJ D;  5DNF A;  3T53 B;  3FHW A;  2Q2U A;  1VQF A;  3L3O C;  1D6E C;  3M3Y H;  2EY2 A;  4FP5 D;  4ZRZ A;  4B3M Q;  2A6H C;  5FJ8 G;  2EYL A;  4BXX H;  2PO4 A;  4BY1 H;  1LTB D;  1O78 A;  2EXD A;  4R8N A;  5DLQ E;  5IYC H;  1FGB D;  1A62 A;  2K5W A;  3KLS X;  4XQJ A;  1T9H A;  5C3E H;  1DYQ A;  4A3K H;  2B8G A;  2GA4 B;  1TVX A;  2B29 A;  2JA6 H;  3J7A F;  4HN7 A;  4ZCK A;  1CZG A;  1JMC A;  3IL8 A;  1DCZ A;  4OWX B;  5I6W A;  3L9A X;  3ERQ A;  1ET6 A;  1LTL A;  4V19 0;  4A3G H;  4RHR A;  3VYS A;  2EYJ A;  1SR3 A;  3MHB A;  2UXB Q;  4RG1 A;  1K3B C;  4PMW A;  1VQM A;  1VCI A;  1GHK A;  2AQ1 B;  2KBN A;  2UUB Q;  3S1Q B;  5I6Y A;  1M4V A;  3I4M H;  1LT5 D;  4BBR H;  4IFD I;  3S15 B;  1OXU A;  2RHS B;  4DAY A;  1TWF H;  1PZI D;  2PZW A;  4KK7 A;  5E4X A;  4AYB G;  2NBF A;  1TXY A;  3HG9 A;  3W3A A;  2XWB B;  5CV8 A;  2ZTC A;  3ULJ A;  3LNN A;  1AN8 A;  3VYR A;  2NN6 G;  2PW7 A;  3KBX A;  1VQ5 A;  4KHV A;  1HNX L;  4UP8 A;  4X66 Q;  1PRT F;  4IFD H;  4HED A;  1VMP A;  4IO9 A;  4F8M A;  3F1Z A;  1SND A;  4AQY Q;  2HT1 A;  1FNU A;  1DOM A;  5C44 B;  4ME3 A;  3K0Y A;  2KCT A;  5KNC A;  4DR6 L;  3K8A A;  4KLK A;  1HPC A;  1VS0 A;  2IX3 A;  3A5U A;  2FIN B;  4JBK A;  5D14 A;  3SDZ A;  2CKZ B;  2B63 B;  1QOH A;  1QG7 A;  4DV4 Q;  3STB D;  2X6G A;  5GAG C;  2PNH A;  4R8I A;  1I6H B;  4B9X A;  2E75 C;  3R3O A;  4CDF C;  2CQO A;  4KHP L;  1FD7 D;  5FLX E;  1J5E Q;  1AE2 A;  1VQ6 A;  3KJO A;  4BY1 G;  1QUQ A;  1SEB D;  5I9P A;  3TEH B;  1BR9 A;  4RKL A;  4OL7 A;  5FJ8 H;  4NW2 A;  4R4I A;  4RH6 A;  3ONA B;  1RHP A;  4HIM A;  2E2H B;  2EJG C;  2LKV A;  2SNM A;  3KK7 A;  2DY7 A;  2JSO A;  1PH5 A;  3M4O H;  1BOS A;  1AW7 A;  3CME A;  1SRO A;  1ENF A;  4FXD A;  2IL8 A;  5EBD A;  2DUD A;  4J6H A;  1TS5 A;  4G4K A;  2OT2 A;  3N6R A;  1SYF A;  1EQQ A;  4ME5 A;  5A2Q E;  3CMA A;  3CCS A;  5FKA C;  4DPG A;  1R9T H;  3STB C;  1YEZ A;  2K32 A;  3CU7 A;  5EKL A;  4JOI C;  2HIV A;  1BQQ T;  2F0P A;  4QCL A;  1EOT A;  1F9R A;  5CV7 A;  3S2D H;  4LFA Q;  1OO9 B;  4A93 G;  3I2Z A;  4IUU A;  1SXT A;  1XTD A;  1PHJ A;  4P74 A;  3BVZ A;  2JA7 B;  4UHV A;  4C3H G;  4GKK L;  3I4N B;  2B2U C;  2M9V A;  2F0Q A;  1I4Q A;  2AUJ D;  1CM9 A;  1I3Q H;  1VQ8 A;  1YJW A;  3I8Z A;  5I4D A;  4DR4 L;  2NVX B;  5ELC A;  4MN3 A;  4K2K A;  1S40 A;  1HQR D;  5JJK A;  2F3I A;  4X62 L;  4YHH L;  3HOV H;  3RNU A;  1TS3 A;  2ID0 A;  1UE1 A;  4DUY Q;  2UUB L;  2D9U A;  4LAA A;  1Q82 C;  3HOZ H;  1VF5 C;  4CGY B;  4A3K G;  5FLM G;  3BZK A;  4DNT B;  3MAQ A;  3W2D A;  4OO1 I;  1SRU A;  4OGQ C;  1MBY A;  1X32 A;  1CA6 A;  3M3Y B;  2Z6B A;  3W1G A;  5KYI A;  1I4R A;  2ZXR A;  2HCI A;  4P2C B;  1STY A;  3OMG A;  2NZO A;  2ZTD A;  2E74 C;  4ALP A;  3CC4 A;  4BBR G;  3QO2 A;  3S2H B;  2CH4 W;  1X54 A;  3GTK H;  3KLS A;  2NTT A;  1X3F A;  4PZ7 A;  3QOL A;  3SXH A;  4GLV B;  3TP7 A;  4TKO B;  2WB1 G;  5KGU A;  1G2T A;  5IT9 L;  5EGT A;  2F4V L;  4DV7 Q;  2F0K A;  4C3I H;  1YIJ A;  2HQL A;  1RD9 D;  2JN4 A;  4RWS C;  3I7F A;  1VQH A;  1HR0 Q;  1ONL A;  2EZV A;  2KQ3 A;  4O2D A;  5M3F B;  4X6A H;  3A8J E;  4AYB B;  1WCM G;  2OTL A;  4BBS G;  3CC7 A;  2L0C A;  3K58 A;  3EA6 A;  3RN2 A;  3PO2 H;  1SE3 A;  5CC4 A;  1KD1 C;  4APV A;  1BCP B;  2TSS A;  5A35 A;  3TZU A;  4QUF A;  4IUV A;  3EQL C;  4LF6 Q;  2E5L L;  1HRJ A;  2F1M A;  5JJZ A;  1I94 L;  2EY6 A;  3J81 E;  3HEJ A;  3T1H Q;  3D4D A;  4FF3 A;  1SYD A;  3UE0 A;  4N9T A;  5CR3 A;  2OEO A;  2XRS D;  4KKU A;  1LTS D;  1A3V A;  3I73 A;  4RCN A;  4OX9 L;  1JWM D;  4HJA A;  2ZXO A;  4A4I A;  4A3F H;  3CAM A;  2RBM A;  3BVG A;  1LTR D;  1I94 Q;  1MHW C;  5CMD A;  1C48 A;  3QOJ A;  1CUK A;  1K9M C;  3DWQ A;  1PZJ D;  1MIU A;  4GN4 B;  1LT3 D;  5CBE E;  1JB7 A;  1KIX A;  5DEH A;  3NUC A;  4IPC A;  1JOK A;  1SE2 A;  4J1M A;  4FYD A;  2K5N A;  5M3M B;  2WAQ B;  5IP7 H;  1EY6 A;  2VZA A;  2KEE A;  3FKI B;  2Z4I A;  2VS1 A;  3CCE A;  3H3V H;  2CWP A;  2JA7 H;  1V9P A;  3SVM A;  2G9D A;  4NDX A;  3RLO A;  5BN4 A;  4CKC A;  2R7Z H;  4QL5 A;  2IX0 A;  2I07 B;  4EQN A;  2RKS A;  1TWH B;  3NK9 A;  4DR2 L;  4X62 Q;  1GXD C;  2E2I B;  1C8C A;  2PI2 A;  2A5H A;  4GS3 A;  4UDU C;  3GTM B;  4C3H H;  1Q8K A;  4A3D G;  2MUY A;  4K8I A;  3FDT A;  3ITP A;  2B63 G;  3H3V I;  1GUT A;  3D0F A;  4IJL A;  5KND A;  4A3D B;  5G3L D;  2PQA A;  1C4Q A;  2KED A;  4N8X 1;  2HIX A;  5LMU Q;  3K81 C;  3MXU A;  2K4K A;  3JAM L;  4K5W A;  1W2B A;  4X3S A;  1KDC A;  5GRO A;  1ET9 A;  1Q81 C;  1CI3 M;  4K5V A;  3PIO 3;  3C46 A;  5ELN A;  2HDM A;  1SNO A;  5GAH C;  3KOJ A;  5IYB H;  2K05 A;  3GO5 A;  5GAD C;  1DOK A;  4QGU A;  3G71 A;  2K75 A;  2O5J C;  1RF2 D;  5CV6 A;  2CW0 D;  1IW7 D;  1I50 H;  1QVG A;  1KXL A;  4YY3 L;  4DR3 L;  2Q2I A;  1J9O A;  1DM0 B;  2I5L X;  1NR2 A;  2Y0S B;  3TN2 A;  2O4X A;  5C0X H;  3CCM A;  5IY0 A;  3LX0 A;  4MTK A;  3WOF A;  1HZC A;  1K8M A;  2UUA Q;  1NTG A;  1PYW D;  4JI0 L;  3FP9 A;  2IW3 A;  5JEA J;  3UDG A;  1NE3 A;  2RCF A;  1KDA A;  4LNQ A;  3I55 A;  4DR3 Q;  3EIV A;  2WB1 B;  3T1H L;  4A3M H;  1HFN A;  1YNJ C;  4JI2 Q;  3RUZ A;  1H95 A;  4ODG A;  3RN5 A;  3I72 A;  4OX9 Q;  5ELB A;  3RZO H;  5C0X I;  4JI0 Q;  4L6T B;  2D62 A;  1K8A C;  3S1R H;  3WDN A;  3E5S A;  3HGB A;  2PMZ E;  2JA8 B;  1EQR A;  1WJJ A;  1EUJ A;  2AMC B;  2JXM B;  3UDI A;  2EY1 A;  1IHZ A;  2MO0 A;  1XMO Q;  1Q7Y C;  1HXY D;  4BY7 B;  2OTJ A;  4C1N I;  1II3 A;  2Z6K C;  2M2L A;  1Q1B A;  4TVA B;  4XDX A;  1PDQ A;  3CCQ A;  2X69 A;  3KJP A;  2JYO A;  1GUG A;  5J39 A;  4DA2 A;  1XMQ Q;  1PMR A;  4GOP C;  3KBG A;  5HGT A;  2F0G A;  4L5R C;  1AZQ A;  3AMU A;  4ZUJ A;  2UU9 Q;  4E6I A;  1EU4 A;  2JE6 I;  1OXT A;  3LGJ A;  4KY5 A;  1I5F A;  2CFM A;  1EY0 A;  5JVH 3;  1XMO L;  2AWO A;  2VQE Q;  5C3E B;  1Q90 A;  2L4N A;  2RDH A;  1A15 A;  2JP1 A;  1ESR A;  3J81 j;  1B9M A;  5C3E G;  3NBI A;  5I9O A;  1XJV A;  3PIP A;  1GO3 E;  1HZA A;  3H6M A;  3IRB A;  5C5L A;  4YWK A;  4XQN A;  2L55 A;  1V1P A;  4FO2 A;  4MIU A;  3G4S A;  4FNF A;  4LF5 Q;  1LUZ A;  1WTQ A;  5IYB G;  5M3F G;  2B2W C;  5CV5 A;  2E2I H;  2LXK A;  1LTA D;  2HCC A;  2F0L A;  1HFG A;  3F2B A;  4L8J A;  3RZD H;  3CRK C;  1WFQ A;  4NXN L;  5C0X G;  4F88 A;  4C3I G;  5DM6 3;  4KD4 A;  4C2M B;  2QA4 A;  1WTP A;  2F0I A;  5JJI A;  1SSO A;  4OIJ A;  1RDP D;  3UDF A;  1Y8N B;  3PF5 A;  4LJZ C;  2NVY B;  5HGQ A;  4RGO S;  1PH7 A;  1IL2 A;  2R7D A;  1B2T A;  2C9O A;  4O0A A;  5LL6 S;  1S72 A;  3H94 A;  3HKS A;  2AHO B;  1GJX A;  3KDF B;  1VQG A;  4GNX A;  2R7F A;  2QCP X;  5E3F A;  1NJI C;  3WWV A;  3DMU A;  2UUC Q;  3URY A;  5C0X J;  2R92 G;  4B3M L;  1NAP A;  4B3T Q;  3ERS X;  5JJL A;  4U67 3;  3HS0 C;  3OW7 A;  2A73 B;  3FMC A;  3SE0 A;  2EYF A;  3CXC A;  3IAY A;  2K7V A;  4MHE A;  1F2Z A;  1U0L A;  4ABN A;  2A68 D;  2WIN B;  5IOD A;  4DK0 A;  4UPA A;  5FLX L;  3PIO A;  1VQN A;  2HD3 A;  4LF8 Q;  5IWA L;  3D3R A;  4KY6 A;  1N34 Q;  2HQE A;  5EPL A;  5D3I B;  2PI2 E;  3G6J B;  1O7L A;  2RF4 A;  1SNM A;  2F0V A;  1E1T A;  1W6K A;  2A1A A;  4CDD C;  2NVT H;  3MA2 B;  3J7A 5;  1MI2 A;  3NE5 B;  4JPB W;  4V0B A;  3I4L A;  1L2F A;  5IYD H;  4IPH A;  2B2T A;  1NNX A;  1B3Q A;  2NYZ D;  4TQU S;  4K5X A;  2D5D A;  3E6Z X;  3HKZ E;  1YJN A;  3CCR A;  3PGZ A;  4YCV A;  4HID A;  1XMQ L;  1EWC A;  4OHJ A;  4R4O A;  1YIT A;  1SBB B;  1NMG A;  2R7Z G;  1T5E A;  2BH2 A;  3V05 A;  5T1I A;  2C5C A;  3SEB A;  3ZYY X;  2DN8 A;  4R4T A;  3TP6 A;  1LM0 A;  3GTL H;  2IHF A;  4BY1 B;  4X66 L;  5L37 A;  1N32 L;  2AWN A;  3BDL A;  1GM5 A;  1BBU A;  4A3M B;  1Q8I A;  3GDE A;  4AQY L;  1K83 B;  4Y7N B;  1K28 A;  3S17 H;  2H5X A;  2F0U A;  1X65 A;  4BY7 G;  2V1C C;  3PUY A;  3RMH A;  3S1M H;  1A2U A;  1D1K A;  2TMP A;  1HA5 A;  3OYY A;  1DON A;  4CDE C;  1UWV A;  1D5Z C;  2ICE C;  3E9H A;  4DR1 Q;  5LMN L;  1FGU A;  1VQ4 A;  1Y1V G;  5IYC G;  2KHJ A;  1F2M A;  1IXR A;  3FRP B;  4X3T A;  2IJ0 A;  1QE6 A;  3K6O A;  4EGV A;  4EX5 A;  5AJ3 Q;  1BXT A;  3NSW A;  4JOI A;  4NXN Q;  3GTJ B;  3A56 A;  3C3L A;  1HR0 W;  3M7G A;  2BCO A;  2GN5 A;  5E1F A;  3SR1 A;  4A93 B;  4LF4 L;  4DNR B;  1I50 B;  1JJG A;  3HOY H;  2B3G A;  2C35 B;  2IT1 A;  3JAM c;  3N52 A;  3M4Y A;  1PRT B;  4C3I B;  5IP9 G;  5IGF A;  1YVC A;  3FEW X;  2AQ3 B;  5KNB A;  1M90 C;  3I4M G;  2YTY A;  5KRU A;  3DWP A;  2RCN A;  5AJ3 L;  2WAQ G;  2Q8R E;  2B2Y C;  2XRQ D;  3S2D B;  1BVS A;  3I3C A;  4QJF A;  1PH2 A;  5ISR A;  2UUC L;  4A76 A;  4A3E G;  4KN4 C;  2BA1 A;  2MJ8 A;  1A2T A;  4DGZ A;  1SDF A;  3F2C A;  2BE5 D;  1GUO A;  3D4R A;  1IYV A;  1BKB A;  1A3U A;  1R4P B;  1UEB A;  1JR0 D;  1V1O A;  4PZ8 A;  1H9S B;  1WCM H;  3S17 B;  3C1F A;  4EQ5 A;  2B2V A;  3CD6 A;  1FNW A;  3TME A;  4YWM A;  2IWH A;  4IOC A;  3DXJ C;  4A3J H;  3PUX A;  1EYA A;  2SDF A;  2A69 C;  2Y0S E;  3K57 A;  1SFO H;  1K0R A;  4LF8 L;  2KCM A;  4QQB X;  2VY3 A;  4H0L C;  1EEF D;  4TRD A;  4XQQ A;  4K14 A;  1EQT A;  4CHT B;  1W6J A;  1EOV A;  3HOU B;  4I7A A;  1L0Y B;  1MJC A;  1MGS A;  2FFK B;  4H13 C;  4YHH Q;  3S1Q H;  1CHQ D;  3AFP A;  1B50 A;  3DHQ A;  4BA1 I;  4F7X A;  3I4N G;  1KDB A;  1STA A;  1V43 A;  2D2C C;  1L0X B;  3ICE A;  1LLR D;  1E2Z A;  2ENB A;  2ZJR A;  1TY2 A;  2L11 A;  1VQO A;  2V4D A;  1EY8 A;  2RSN A;  3NQT A;  4CBV A;  4DR7 Q;  1IKM A;  1Q3L A;  5JVG 3;  2PMZ B;  3HOU G;  5I2Y A;  3MVV A;  3GTM H;  2CHB D;  2BDN A;  4LK1 C;  2DJF C;  5ELE A;  1T5X D;  5IP7 G;  5HUR A;  1CT1 D;  1IBK Q;  1N32 Q;  2GVA A;  2R61 A;  1B4O A;  3TQY A;  3F2D A;  1XXG A;  2E8G A;  3DLL A;  2AQ2 B;  4GLA C;  5GAE C;  3MEH A;  4DV6 Q;  2JEB I;  4IN3 A;  4RHS A;  4K6L A;  4KJN A;  1B1Z A;  3BU2 A;  4A3B G;  2EXZ A;  3H0G B;  3PCO B;  3PV0 A;  1HR0 L;  1BO0 A;  3NEL A;  1JWU D;  1SE4 A;  2OF1 A;  4Q5V A;  1PYS B;  4GZY C;  1CFM A;  1IBK L;  2F0N A;  5KEE A;  2KHI A;  3MFG A;  3GTP H;  1WTX A;  4LFB Q;  1GUS A;  1JJC B;  4JI1 L;  4LMQ D;  2BA0 A;  4X3U A;  1FVI A;  4PG3 A;  2N3S A;  5M5W H;  4DR6 Q;  4BY7 H;  1TR5 A;  1V1Q A;  4A3G B;  4YIJ A;  3KF8 B;  2PNR C;  1LT6 D;  4KD3 A;  4JI5 L;  4LF4 Q;  2QGQ A;  4RFB A;  3JAM E;  4A3M G;  1HTP A;  4KKS A;  4HCE A;  3D4W A;  3J80 L;  2A6E D;  4DV4 L;  2LSS A;  3HOY B;  4LFB L;  4JI1 Q;  4OO1 H;  3HOU H;  3IFD A;  3X3N A;  3T51 B;  2HHH L;  2X6L A;  1VDZ A;  2RQX A;  3HOZ G;  1PXU A;  3GTJ H;  3E3X A;  3MXN A;  4DN4 M;  5COR A;  3J80 E;  1KL9 A;  1S4Z A;  4Y7N H;  1SMY C;  3L2P A;  1Y1V B;  1L1O A;  3NHH A;  1PA6 A;  2D0O A;  3H91 A;  1O7I A;  5EPK A;  5IE8 A;  3PIP 3;  4HJ9 A;  1HTL D;  1TY0 A;  1F9P A;  1ML0 D;  2UXC L;  4HJ7 A;  1KC8 C;  1CKN A;  3JC6 6;  4A3I H;  5CYU A;  1EFI D;  3T16 A;  1RIP A;  4OXP A;  3QWN A;  3Q24 A;  5IIF A;  4AH6 A;  3NTI A;  2VL6 A;  2FJ2 A;  2MPM A;  4DAP A;  1GUN A;  4MTN A;  2NVQ H;  3PQI A;  4PNY A;  2EJF C;  5K36 H;  5F2D A;  1STH A;  1HQM C;  1JQY D;  1G6P A;  2MO1 A;  1K83 H;  2QDL A;  4XYO A;  4LWC A;  3MC0 B;  4HSP A;  2WP8 J;  3FKI G;  1A63 A;  1VF7 A;  1SNP A;  2L9H A;  4LFA L;  3H3V C;  1J8I A;  4DR2 Q;  4XTC S;  1C7Y A;  4IZ8 A;  3U9S A;  4HIO A;  3VR4 A;  3VYT A;  1QB5 D;  2N49 A;  2K28 A;  3PO2 G;  4GKK Q;  4M8A A;  4NXM L;  4C1N K;  1F9S A;  4B3S Q;  3ULL A;  4OEM B;  3B6Y A;  4LW1 A;  2K52 A;  1VMC A;  4XYQ A;  5IT9 c;  1HUM A;  2JA5 G;  1HA6 A;  3A7A B;  1SYB A;  5TSS A;  1JB3 A;  3NQI A;  4L5T A;  1B3A A;  3KDF A;  3OWF A;  1EIG A;  1RTO A;  3S9W A;  1X3Q A;  1PFN A;  1CA5 A;  1YBY A;  2ZJP A;  2A8V A;  1XNQ L;  1PH1 A;  5C4Z A;  4B3S L;  2KVM A;  2ZXP A;  5C3X A;  1YHQ A;  3BG3 A;  1IZ6 A;  1E0B A;  2B39 A;  1WTH A;  3X3M A;  1E7Z A;  3FPP A;  1VQB A;  3TP5 A;  2F0F A;  1JIC A;  2JQO A;  4WOR A;  2EVB A;  2JJQ A;  3MEF A;  3R93 A;  2K5Q A;  1Y1V H;  1KRT A;  5IGE A;  2FHT A;  3I4O A;  5HY6 A;  2IX1 A;  2I46 A;  5FOB B;  3FKI H;  5G3L F;  5JPM C;  4EQO A;  1STN A;  2Z1C A;  4DR5 L;  1PTO C;  4DUZ Q;  1DJR D;  5M3F H;  1O80 A;  2OXP A;  3GTQ H;  2QKI C;  1SLJ A;  1PTO B;  4IUP A;  2F4V Q;  3K7U C;  5IP9 H;  2NVX H;  2F0J A;  5AFW A;  4A3B H;  4GNX B;  2AUK A;  4RMF A;  4HMJ A;  5M5W B;  1DZ1 A;  4JI5 Q;  1PFM A;  1X56 A;  4LF7 L;  2EE1 A;  5J1Z A;  5D3D A;  2XIW A;  4A3F B;  4XXE A;  4DAM A;  3V96 A;  3A74 A;  1NUC A;  1J6Q A;  1QWY A;  1X55 A;  1U4L A;  4ZAI A;  2NWG A;  1EZ8 A;  1WI5 A;  4LF6 L;  5C4X B;  4A3E H;  2Q2H A;  1CZW A;  3R2I A;  1LAC A;  1G51 A;  3AQQ A;  3C2P A;  1TS4 A;  1JT8 A;  5IGG A;  4LF9 Q;  2VUM G;  2PW5 A;  4LF7 Q;  1EQV A;  3DWA A;  4A75 A;  4XT3 B;  4A3J B;  1HZ9 A;  3I56 A;  3BZD B;  4A3J G;  2KA7 A;  2IY5 B;  5CV9 A;  2UU9 L;  4IUR A;  4JI6 L;  2GVB A;  1EL0 A;  2KCN A;  1E2W A;  2J7Z A;  2NB0 A;  2F52 A;  1Q46 A;  5KIX A;  1SNC A;  3UDX A;  1MJE A;  5LL6 X;  4B9W A;  1PH8 A;  3CHB D;  1Q86 C;  3TS2 A;  1B8A A;  1JE4 A;  4DK3 C;  3PO3 H;  3S16 B;  3CQZ H;  4IOA A;  1N36 L;  3K5N A;  1LYL A;  2I5H A;  4DAY B;  4JYA Q;  2ATW A;  4P72 A;  3PO3 B;  2KOL A;  4KN7 C;  3G7L A;  4IUQ A;  1XNR Q;  1I4P A;  3K7A B;  5M5Y B;  4R9W A;  4DKA C;  4X65 Q;  5E7N A;  1PV4 A;  2NVT B;  1L1O C;  4NXM Q;  5IGD A;  2N78 A;  5K36 G;  3CPF A;  1SNQ A;  5C6A A;  1TWC H;  4GOP A;  4QMG A;  3H0G H;  4G7O C;  2CWA A;  1XTC D;  4JCV E;  1JCK B;  1U9R A;  2F0W A;  1S5C D;  4JYA L;  4UAI A;  1VQI A;  5C44 H;  1Z6H A;  1YJ9 A;  1NCV A;  1QNU A;  1FNV A;  4POF A;  1ENA A;  5DAU A;  2DNC A;  3BDC A;  2PQE A;  2SNS A;  5C4J H;  1STB A;  3K5M A;  1MD2 D;  1TU2 B;  2KJX A;  1C9O A;  5FO8 B;  3MZ5 A;  5BN3 A;  2XVS A;  4JK1 C;  5C4H A;  2A19 A;  1YZ6 A;  4R1J A;  1PH3 A;  1FL0 A;  1JOO A;  1VQP A;  4DV1 Q;  3I4N H;  1R4Q B;  3DM3 A;  1XPO A;  3D8G A;  3LWU A;  2YV5 A;  1B9N A;  1I4H A;  1EU3 A;  2A68 C;  2B63 H;  1VQ7 A;  5ELO A;  1NMF A;  3VA7 A;  2F0O A;  4DR5 Q;  1AEX A;  4JV5 L;  2VUM H;  3AB9 A;  5EKK A;  1HNZ L;  1VQC A;  1X3E A;  1GOZ A;  4CJ0 B;  1WVL A;  3HFZ B;  1YI2 A;  3H15 A;  1YHA A;  3S16 H;  2H1E A;  3P75 A;  4KY7 A;  1B53 A;  1LTI D;  1TS2 A;  2R3Z A;  2QIL A;  4DV1 L;  1K73 C;  1JWS D;  4HJ5 A;  4DXF A;  3S24 A;  4K0K Q;  4TSS A;  5IWA Q;  2PYK A;  5COY A;  1N34 L;  2CQA A;  1G2S A;  1XX8 A;  4OWW B;  3Q23 A;  2PZT A;  3GTK B;  3CRL C;  5C44 G;  3AFQ A;  5EPJ A;  1IBL Q;  1KNE A;  1IYJ B;  3LWE A;  4K6D A;  2XSC A;  4PMC A;  4IUT A;  2H4O A;  3RZO B;  3OHX C;  4FXK C;  4IPG A;  1KQS A;  1HUN A;  4DV2 Q;  1ILQ A;  3GV3 A;  1QJO A;  2MQH A;  3NEM A;  3J7A V;  3CCL A;  3GTL B;  1BF4 A;  2DGY A;  4K2L A;  4UY8 C;  4WJ3 M;  4JI8 L;  3E9I A;  4B3R L;  1BCP D;  2XNA C;  3M4P A;  4EQP A;  3HKZ G;  3MXG A;  3HOX H;  1Z47 A;  3RD4 A;  4BBR B;  1H9R A;  1M8A A;  2BH8 A;  4BBS B;  2WII B;  2YU9 H;  2K5V A;  4PQX A;  4A3B B;  2DNE A;  4B08 A;  5IYD G;  4BBS H;  2EJM A;  2JA6 B;  4GNX C;  3TZD A;  4BA2 I;  3U50 C;  1ZYR C;  2VQF L;  3DM1 A;  2K03 A;  1KLG D;  4PZ6 A;  2QEX A;  1A3T A;  1TWG H;  3BZC A;  2MNA A;  2NTS A;  2OCE A;  2VUM B;  1EZ6 A;  1H9K A;  2F0H A;  4M1U B;  4JBM A;  1ROD A;  4U68 A;  2YTV A;  4AIM A;  5JEA H;  1CSQ A;  4Q0F A;  4X65 L;  2YYZ A;  3WOE A;  4JI4 L;  5LHY 1; 
#chains in the Genus database with same CATH homology
 2R93 B;  2L1B A;  1U4M A;  1PTO D;  1SJE D;  4CJ1 B;  1TWF B;  2LMC B;  3QG1 A;  4KI0 A;  4NMZ A;  2RDG A;  2K6A A;  5IGB A;  1F77 A;  1DOL A;  4C3H B;  4G7Z C;  3QIA A;  4RAU C;  5M9O A;  3HOW B;  1G6Z A;  4NP5 A;  1QIL A;  3A55 A;  2WV6 D;  1BCP F;  3EFX D;  2RDF A;  2K01 A;  1JOQ A;  2HDL A;  1EEI D;  3VYU A;  3P7J A;  3NWS A;  1TII D;  2KEC A;  2EDG A;  3HOX B;  1EIH A;  1UUP A;  2NN6 I;  2K04 A;  4BWG B;  3H09 A;  1U4P A;  1F2L A;  2A69 D;  3GV6 A;  2NUC A;  3D6C A;  4IUN A;  1GHJ A;  1O7Z A;  4XT1 B;  1HHV A;  3NPP A;  3VR5 A;  5J22 A;  3NTH A;  1AFP A;  1UAP A;  3BDO A;  1BUV T;  5CV4 A;  2MHV A;  2MGS A;  1RTN A;  1HCZ A;  2JA5 B;  1KTK A;  1KAB A;  3HRZ C;  1UEA B;  1A6X A;  2CVR A;  1EYD A;  3NWT A;  3MXP A;  5T1G A;  4WJW A;  2WKC A;  1WD0 A;  1S5F D;  3K59 A;  2E2D C;  2EYP A;  5ELD A;  2R7Z B;  3OPO A;  5JEA G;  2LS0 1;  1TT2 A;  1SAP A;  2PZU A;  2N55 A;  3MFY A;  2QF7 A;  1LTT D;  3OIP A;  5A2Q L;  4NKL A;  1S5E D;  2A74 C;  2IPK D;  4QB4 A;  2EPB A;  3OWE B;  4BS9 A;  4FF1 A;  1E2V A;  3L7Z C;  3GTP B;  4O1N A;  1PFB A;  4FF2 A;  1MSG A;  1I6V C;  4KTA A;  3A7L A;  2VB2 X;  4PV1 C;  2NZ1 D;  2G9H D;  2ICI A;  3EJI A;  4ILW A;  3HKZ B;  4KKT A;  4HR7 B;  3IFT A;  5C4J B;  1EY5 A;  1DD2 A;  2J0T D;  2QDB A;  4DK1 A;  2MP1 A;  1STG A;  2Q8I B;  3GTG B;  4RGM A;  3BS1 A;  3S14 B;  3E0J A;  2B2T C;  5CBA E;  2F3W A;  3SK6 A;  4I65 A;  1D2B A;  1G91 A;  1G8Z D;  3I4M B;  2F0D A;  2F03 A;  1K8O A;  5IT9 E;  3DEP A;  4KHZ A;  3Q6S A;  1AP0 A;  3KUP A;  1PRT D;  4RGN A;  1XWE A;  3K5L A;  1PZK D;  5JAV A;  3NP8 A;  1BCP C;  2R6G A;  3NTK A;  2QEJ C;  3I70 A;  5KYL A;  3S1R B;  1YNN C;  2ZT9 C;  1SJH D;  3CKI B;  1WCM B;  1V1P B;  3ND9 A;  2BE5 C;  3OMC A;  1SYC A;  3OOC A;  4KJO A;  1LV9 A;  4A3E B;  1WTV A;  4O42 A;  4ID6 A;  1D5X C;  1NR4 A;  4HCS A;  2PPB C;  1OXS C;  3MTS A;  2F0S A;  4OIK A;  4WFN 3;  2RA4 A;  3MWY W;  1GUW A;  3P1H A;  1JC7 A;  2RSO A;  3M4O B;  2WAC A;  1LAB A;  2B8F A;  3S1N B;  1CHP D;  1FR3 A;  4L63 B;  1YNN D;  4ZQ3 A;  3Q22 A;  1PRT C;  4QF4 A;  2VNU D;  5BN5 A;  2O5I C;  4A3K B;  2F0E A;  2R92 B;  1U4R A;  1Y69 U;  1CTM A;  1Q12 A;  4F87 A;  2PCF B;  2BDO A;  1OXV A;  2E76 C;  1ESF A;  1WTW A;  4I7Z C;  2F4I A;  4DU9 A;  4FVM A;  2NVQ B;  5FK9 C;  4RKB A;  4IAL A;  1IL8 A;  5IOC A;  3T4A C;  4HAE A;  1B44 D;  2K33 A;  2B2V C;  5FO9 B;  1STE A;  1D1I A;  4IFD J;  4DFA A;  3HOV B;  4HSV A;  2LY7 A;  1H9M A;  1RKN A;  1MSH A;  1F9Q A;  3J7Y W;  2O2L D;  4ZYS A;  2XWJ B;  1EY9 A;  3K5O A;  3HOZ B;  3VR6 A;  1KLU D;  5FO7 B;  4CKB A;  1EY4 A;  1IW7 C;  2DY8 A;  4ZUI A;  1LO5 D;  2VXW A;  4HTH A;  4IFD G;  4CJ2 C;  2K1B A;  1ZYR D;  3R2T A;  2CW0 C;  1R9T B;  4CKE A;  3M85 A;  3TP8 A;  3NBH A;  3ERO A;  1ZKO A;  3GP7 A;  2EYH A;  1QNK A;  4C3J G;  4RA8 A;  2KUM A;  3C1E A;  4K8J A;  1SYE A;  2M00 A;  4OO1 G;  1TWC B;  1JOR A;  1RJT A;  4S3S A;  2EOT A;  1TWA B;  3Q0A A;  1ICW A;  3DEO A;  4J8Q A;  5EKI A;  1ILP A;  4QIW B;  2RVL A;  1WTO A;  1F2Y A;  2LFN A;  2J4X A;  3OSO A;  3HZX A;  4KV6 A;  4FF4 A;  1TWG B;  1CQF A;  4DAV A;  4HMI A;  1D5M C;  2EYO A;  1Q1E A;  4N9P A;  3KF8 A;  5D65 A;  2B2Y A;  2Z4H A;  1CK1 A;  2B2U A;  3T13 A;  2F0M A;  4DF7 A;  2YU9 B;  3D31 A;  4FXG C;  2A6H D;  5K5P A;  1BNZ A;  2SEB D;  1BBX C;  3RZD B;  1SMY D;  1KAA A;  4RCO A;  5EJW A;  4ZK9 B;  3TSS A;  4JBW A;  4EVO A;  5DM7 3;  3I90 A;  3QB3 A;  1EY7 A;  1CQV A;  3VA5 A;  5ELF A;  1I3Q B;  1Y8P B;  1PTO F;  2N88 A;  3ND8 A;  2EY5 A;  4DXG A;  1TKW B;  2BOS A;  4PMB A;  3V2T A;  2XN9 C;  1ZXT A;  3PMF A;  3BYY B;  3PUZ A;  3DUZ A;  3J81 L;  3PO2 B;  3TBI B;  1SFO B;  4G7H C;  3GD7 A;  1O7Y A;  4G57 A;  1RCV D;  3TDQ A;  3A8K E;  3PUW A;  1Z7T A;  1XYI A;  3QJY A;  3KLR A;  3GTQ B;  3SK4 A;  4ZKB B;  1NSN S;  4ZLT F;  1LT4 D;  3UI2 A;  5M5X B;  3AU7 A;  1ENC A;  1TQO A;  3IKJ A;  1QCB D;  1H9S A;  1V8Q A;  2B2W A;  3BVM A;  2EYM A;  2A6E C;  3GQB A;  5JPN C;  3OIQ A;  3PUV A;  2Z8L A;  2JEA I;  4QUC A;  1SYG A;  1S5D D;  2HUG A;  2FMC A;  3HP3 A;  3D6W A;  3NXW A;  5E4W C;  4H44 C;  3CQZ B;  1IKL A;  1UNS A;  5JOB A;  1I4X A;  3VR3 A;  3U9O A;  1S5B D;  5EBC A;  3F2U A;  1WD1 A;  2FMM A;  4C3J B;  1H9J A;  4WRD A;  3I91 A;  3P20 A;  3EVQ A;  1AZP A;  2Q8T A;  3VR2 A;  4ZKC B;  1ZEQ X;  3O13 A;  2E2J B;  3SHL A;  2VB3 X;  4XIG S;  5IGC A;  3A54 A;  2WKD A;  1PLF A;  1Y1W B;  3T56 B;  1KNA A;  1Y8O B;  5I2X A;  3A8I E;  4ULL A;  4H7B A;  3S1M B;  1LTG D;  1DXM A;  4IQZ A;  2KCC A;  2SOB A;  1I4G A;  1BDO A;  1IYU A;  1OXX K;  2L5T A;  3RLF A;  4X3K A;  5C3W A;  2K5D A;  1G29 1;  3SK8 A;  1PTO H;  1X3P A;  5EQ0 A;  2NN6 H;  2F0T A;  1WTR A;  3FPU B;  3M7N A;  2F3V A;  4Z9C B;  3R8B A;  3FVQ A;  5NUC A;  1EYC A;  2L12 A;  4C56 C;  4RGT A;  2KHS A;  5CGK A;  4KMU C;  1EWH A;  3GTO B;  5C5M A;  1FYC A;  4A3I B;  3BYT B;  3SK5 A;  1YNJ D;  5DNF A;  3T53 B;  3L3O C;  1D6E C;  2EY2 A;  4FP5 D;  4ZRZ A;  2A6H C;  2EYL A;  2PO4 A;  1LTB D;  1O78 A;  4R8N A;  1FGB D;  3KLS X;  2K5W A;  4XQJ A;  1DYQ A;  2B8G A;  2GA4 B;  1TVX A;  3J7A F;  4HN7 A;  1CZG A;  3IL8 A;  1DCZ A;  5I6W A;  3L9A X;  3ERQ A;  1ET6 A;  4V19 0;  4RHR A;  3VYS A;  2EYJ A;  3MHB A;  4PMW A;  1VCI A;  1GHK A;  2AQ1 B;  3S1Q B;  5I6Y A;  1M4V A;  1LT5 D;  4IFD I;  3S15 B;  1OXU A;  4DAY A;  1PZI D;  2PZW A;  4KK7 A;  5E4X A;  2NBF A;  3HG9 A;  3W3A A;  2XWB B;  5CV8 A;  3LNN A;  1AN8 A;  3VYR A;  2NN6 G;  2PW7 A;  3KBX A;  4KHV A;  1PRT F;  4IFD H;  4HED A;  1VMP A;  4F8M A;  1SND A;  1FNU A;  1DOM A;  5C44 B;  3K0Y A;  5KNC A;  1HPC A;  2IX3 A;  2FIN B;  5D14 A;  3SDZ A;  2B63 B;  1QOH A;  1QG7 A;  2X6G A;  4R8I A;  1I6H B;  4B9X A;  2E75 C;  3R3O A;  1FD7 D;  5FLX E;  5I9P A;  1SEB D;  1BR9 A;  4RKL A;  4OL7 A;  4NW2 A;  4RH6 A;  3ONA B;  1RHP A;  2E2H B;  2EJG C;  2LKV A;  2SNM A;  3KK7 A;  2DY7 A;  2JSO A;  1BOS A;  1AW7 A;  1ENF A;  4FXD A;  2IL8 A;  5EBD A;  4J6H A;  1TS5 A;  4G4K A;  2OT2 A;  3N6R A;  1SYF A;  4ME5 A;  5A2Q E;  5FKA C;  2K32 A;  3CU7 A;  5EKL A;  1BQQ T;  2F0P A;  4QCL A;  1EOT A;  1F9R A;  5CV7 A;  1OO9 B;  4IUU A;  1SXT A;  3BVZ A;  2JA7 B;  4C3H G;  3I4N B;  2B2U C;  2M9V A;  2F0Q A;  1I4Q A;  2AUJ D;  1CM9 A;  3I8Z A;  5I4D A;  2NVX B;  5ELC A;  4MN3 A;  4K2K A;  1HQR D;  1TS3 A;  2ID0 A;  2D9U A;  4LAA A;  1VF5 C;  4CGY B;  4DNT B;  3MAQ A;  3W2D A;  4OO1 I;  1MBY A;  4OGQ C;  1X32 A;  1CA6 A;  3M3Y B;  5KYI A;  1I4R A;  2ZXR A;  2HCI A;  4P2C B;  1STY A;  3OMG A;  2E74 C;  3QO2 A;  3S2H B;  3KLS A;  2NTT A;  3QOL A;  3SXH A;  3TP7 A;  4TKO B;  5KGU A;  1G2T A;  5IT9 L;  5EGT A;  2F0K A;  1RD9 D;  4RWS C;  1ONL A;  2EZV A;  2KQ3 A;  5M3F B;  3A8J E;  4AYB B;  2L0C A;  3K58 A;  3EA6 A;  1SE3 A;  5CC4 A;  1BCP B;  2TSS A;  5A35 A;  3TZU A;  4QUF A;  4IUV A;  3EQL C;  1HRJ A;  2F1M A;  5JJZ A;  2EY6 A;  3J81 E;  3HEJ A;  4FF3 A;  3D4D A;  1SYD A;  4N9T A;  5CR3 A;  2OEO A;  2XRS D;  4KKU A;  1LTS D;  1A3V A;  3I73 A;  4RCN A;  1JWM D;  2ZXO A;  2RBM A;  3BVG A;  1LTR D;  5CMD A;  1C48 A;  3QOJ A;  3DWQ A;  1PZJ D;  1LT3 D;  5CBE E;  5DEH A;  3NUC A;  1JOK A;  1SE2 A;  4J1M A;  4FYD A;  5M3M B;  2WAQ B;  1EY6 A;  2KEE A;  3FKI B;  2Z4I A;  3SVM A;  2G9D A;  4NDX A;  5BN4 A;  4CKC A;  2IX0 A;  2I07 B;  4EQN A;  2RKS A;  1TWH B;  3NK9 A;  1GXD C;  2E2I B;  1C8C A;  2A5H A;  4UDU C;  3GTM B;  2MUY A;  4K8I A;  3FDT A;  3ITP A;  1GUT A;  5KND A;  4A3D B;  5G3L D;  1C4Q A;  2KED A;  3MXU A;  3JAM L;  4K5W A;  4X3S A;  1KDC A;  1ET9 A;  1CI3 M;  4K5V A;  3PIO 3;  3C46 A;  2HDM A;  1SNO A;  2K05 A;  3GO5 A;  1DOK A;  2O5J C;  1RF2 D;  5CV6 A;  2CW0 D;  1IW7 D;  1J9O A;  1DM0 B;  1NR2 A;  2Y0S B;  3TN2 A;  2O4X A;  5C0X H;  3LX0 A;  3WOF A;  1K8M A;  1PYW D;  2IW3 A;  5JEA J;  1KDA A;  2WB1 B;  1HFN A;  1YNJ C;  3RUZ A;  4ODG A;  3I72 A;  5ELB A;  5C0X I;  4L6T B;  2D62 A;  3WDN A;  3E5S A;  3HGB A;  2JA8 B;  2JXM B;  2EY1 A;  1IHZ A;  1HXY D;  4BY7 B;  4C1N I;  1II3 A;  2M2L A;  1Q1B A;  4XDX A;  1PDQ A;  2X69 A;  2JYO A;  1GUG A;  5J39 A;  4DA2 A;  1PMR A;  3KBG A;  5HGT A;  2F0G A;  1AZQ A;  3AMU A;  4ZUJ A;  4E6I A;  1EU4 A;  2JE6 I;  1OXT A;  4KY5 A;  1EY0 A;  5JVH 3;  2AWO A;  5C3E B;  1Q90 A;  2L4N A;  2RDH A;  1A15 A;  2JP1 A;  1ESR A;  1B9M A;  3NBI A;  5I9O A;  3H6M A;  5C5L A;  4XQN A;  2L55 A;  1V1P A;  4FO2 A;  4MIU A;  4FNF A;  1WTQ A;  2B2W C;  5CV5 A;  1LTA D;  2HCC A;  2F0L A;  1HFG A;  4L8J A;  3CRK C;  5C0X G;  4F88 A;  4C3I G;  5DM6 3;  4KD4 A;  4C2M B;  1WTP A;  2F0I A;  1SSO A;  4OIJ A;  1RDP D;  1Y8N B;  4LJZ C;  2NVY B;  4RGO S;  1B2T A;  2C9O A;  5LL6 S;  3H94 A;  1GJX A;  2QCP X;  5E3F A;  3DMU A;  3URY A;  5C0X J;  1NAP A;  4U67 3;  3HS0 C;  3OW7 A;  2A73 B;  3FMC A;  3SE0 A;  2EYF A;  3IAY A;  2K7V A;  4MHE A;  1F2Z A;  4ABN A;  2A68 D;  2WIN B;  5IOD A;  4DK0 A;  5FLX L;  3D3R A;  4KY6 A;  2HQE A;  5EPL A;  5D3I B;  3G6J B;  1O7L A;  1SNM A;  2F0V A;  1W6K A;  3MA2 B;  1MI2 A;  3NE5 B;  4V0B A;  3I4L A;  2B2T A;  2NYZ D;  4TQU S;  4K5X A;  2D5D A;  3E6Z X;  1EWC A;  4OHJ A;  1SBB B;  1T5E A;  3V05 A;  5T1I A;  2C5C A;  3SEB A;  3ZYY X;  2DN8 A;  3TP6 A;  4BY1 B;  2AWN A;  3BDL A;  4A3M B;  1Q8I A;  1K83 B;  4Y7N B;  2F0U A;  3RMH A;  3PUY A;  1A2U A;  1D1K A;  2TMP A;  1HA5 A;  1DON A;  1D5Z C;  2ICE C;  1F2M A;  3FRP B;  4X3T A;  2IJ0 A;  1QE6 A;  3K6O A;  4EGV A;  1BXT A;  3NSW A;  3GTJ B;  3A56 A;  3C3L A;  3M7G A;  2BCO A;  5E1F A;  3SR1 A;  4A93 B;  4DNR B;  1I50 B;  2IT1 A;  3N52 A;  3M4Y A;  1PRT B;  4C3I B;  5IGF A;  3FEW X;  2AQ3 B;  5KNB A;  5KRU A;  3DWP A;  2Q8R E;  2B2Y C;  2XRQ D;  3S2D B;  3I3C A;  5ISR A;  4KN4 C;  2BA1 A;  2MJ8 A;  1A2T A;  4DGZ A;  1SDF A;  2BE5 D;  1GUO A;  3D4R A;  1IYV A;  1A3U A;  1R4P B;  1JR0 D;  1V1O A;  1H9S B;  3S17 B;  3C1F A;  2B2V A;  1FNW A;  3TME A;  2IWH A;  3DXJ C;  3PUX A;  1EYA A;  2SDF A;  2A69 C;  3K57 A;  4H0L C;  4XQQ A;  1EEF D;  4TRD A;  4K14 A;  1EQT A;  4CHT B;  1W6J A;  3HOU B;  1L0Y B;  1MGS A;  2FFK B;  4H13 C;  1CHQ D;  1B50 A;  3DHQ A;  4BA1 I;  4F7X A;  1KDB A;  1STA A;  1V43 A;  2D2C C;  1L0X B;  1LLR D;  1E2Z A;  2ENB A;  1TY2 A;  2L11 A;  2V4D A;  1EY8 A;  2RSN A;  3NQT A;  4CBV A;  1IKM A;  1Q3L A;  5JVG 3;  2PMZ B;  5I2Y A;  3MVV A;  2CHB D;  2BDN A;  4LK1 C;  5ELE A;  1T5X D;  5HUR A;  1CT1 D;  2R61 A;  1B4O A;  1XXG A;  2AQ2 B;  3MEH A;  2JEB I;  4IN3 A;  4RHS A;  4K6L A;  4KJN A;  1B1Z A;  2EXZ A;  3H0G B;  3PV0 A;  1BO0 A;  1JWU D;  1SE4 A;  2OF1 A;  4Q5V A;  4GZY C;  1CFM A;  2F0N A;  5KEE A;  3MFG A;  1WTX A;  1GUS A;  4LMQ D;  2BA0 A;  4X3U A;  1TR5 A;  4A3G B;  4YIJ A;  2PNR C;  1LT6 D;  4KD3 A;  4RFB A;  3JAM E;  1HTP A;  4KKS A;  4HCE A;  3D4W A;  3J80 L;  2A6E D;  3HOY B;  4OO1 H;  3IFD A;  3X3N A;  3T51 B;  2X6L A;  1VDZ A;  2RQX A;  1PXU A;  3MXN A;  4DN4 M;  5COR A;  3J80 E;  1S4Z A;  1SMY C;  1Y1V B;  3NHH A;  3H91 A;  5EPK A;  3PIP 3;  1HTL D;  1TY0 A;  1F9P A;  1ML0 D;  5CYU A;  1EFI D;  3T16 A;  3QWN A;  3Q24 A;  5IIF A;  3NTI A;  2FJ2 A;  2MPM A;  4DAP A;  1GUN A;  4PNY A;  2EJF C;  5K36 H;  5F2D A;  1STH A;  1HQM C;  1JQY D;  4XYO A;  3MC0 B;  4HSP A;  2WP8 J;  1VF7 A;  1SNP A;  2L9H A;  3H3V C;  1J8I A;  4XTC S;  4IZ8 A;  3U9S A;  3VR4 A;  3VYT A;  1QB5 D;  2K28 A;  4M8A A;  4C1N K;  1F9S A;  1VMC A;  4XYQ A;  1HUM A;  1HA6 A;  3A7A B;  1SYB A;  5TSS A;  1JB3 A;  3NQI A;  1B3A A;  3OWF A;  1EIG A;  1RTO A;  3S9W A;  1X3Q A;  1PFN A;  1CA5 A;  5C4Z A;  2KVM A;  2ZXP A;  5C3X A;  3BG3 A;  1E0B A;  2B39 A;  3X3M A;  3FPP A;  3TP5 A;  2F0F A;  1JIC A;  4WOR A;  2EVB A;  3R93 A;  2K5Q A;  5IGE A;  2FHT A;  2IX1 A;  2I46 A;  5FOB B;  5G3L F;  5JPM C;  4EQO A;  1STN A;  2Z1C A;  1PTO C;  1DJR D;  1O80 A;  2OXP A;  2QKI C;  1PTO B;  4IUP A;  2F0J A;  5AFW A;  2AUK A;  4HMJ A;  5M5W B;  1DZ1 A;  1PFM A;  2EE1 A;  5J1Z A;  5D3D A;  2XIW A;  4A3F B;  4XXE A;  3V96 A;  1NUC A;  1QWY A;  1U4L A;  4ZAI A;  2NWG A;  1EZ8 A;  5C4X B;  1CZW A;  3R2I A;  1LAC A;  3C2P A;  1TS4 A;  5IGG A;  2PW5 A;  1EQV A;  3DWA A;  4XT3 B;  4A3J B;  3BZD B;  2KA7 A;  5CV9 A;  4IUR A;  1EL0 A;  2KCN A;  1E2W A;  2J7Z A;  2NB0 A;  5KIX A;  1SNC A;  5LL6 X;  4B9W A;  3CHB D;  1JE4 A;  3S16 B;  3K5N A;  3PO3 B;  2KOL A;  4KN7 C;  3G7L A;  4IUQ A;  1I4P A;  3K7A B;  5M5Y B;  4R9W A;  2NVT B;  5IGD A;  5K36 G;  1SNQ A;  5C6A A;  4QMG A;  4G7O C;  1XTC D;  1JCK B;  1U9R A;  2F0W A;  1S5C D;  4UAI A;  1Z6H A;  1NCV A;  1QNU A;  1FNV A;  1ENA A;  5DAU A;  2DNC A;  3BDC A;  2PQE A;  2SNS A;  1STB A;  3K5M A;  1MD2 D;  1TU2 B;  2KJX A;  5FO8 B;  3MZ5 A;  5BN3 A;  2XVS A;  4JK1 C;  5C4H A;  1JOO A;  1R4Q B;  3D8G A;  3LWU A;  1B9N A;  1I4H A;  1EU3 A;  2A68 C;  3VA7 A;  2F0O A;  1AEX A;  3AB9 A;  5EKK A;  1WVL A;  1GOZ A;  4CJ0 B;  2H1E A;  3P75 A;  4KY7 A;  1B53 A;  1LTI D;  1TS2 A;  2R3Z A;  2QIL A;  1JWS D;  4DXF A;  4TSS A;  2PYK A;  5COY A;  2CQA A;  1G2S A;  1XX8 A;  3Q23 A;  2PZT A;  3GTK B;  3CRL C;  5EPJ A;  1KNE A;  3LWE A;  4K6D A;  2XSC A;  4PMC A;  4IUT A;  2H4O A;  3RZO B;  3OHX C;  4FXK C;  1HUN A;  1ILQ A;  3GV3 A;  1QJO A;  3J7A V;  3GTL B;  1BF4 A;  4K2L A;  1BCP D;  2XNA C;  4EQP A;  3MXG A;  1Z47 A;  3RD4 A;  4BBR B;  1H9R A;  1M8A A;  4BBS B;  2WII B;  4PQX A;  4A3B B;  2DNE A;  4B08 A;  2EJM A;  2JA6 B;  4BA2 I;  3TZD A;  1ZYR C;  3DM1 A;  2K03 A;  1KLG D;  1A3T A;  2NTS A;  2VUM B;  1EZ6 A;  1H9K A;  2F0H A;  4M1U B;  1ROD A;  4U68 A;  5JEA H;  4Q0F A;  2YYZ A;  3WOE A;  5LHY 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...