4OL7A

Crystal structure of staphylococcal nuclease variant delta+phs v66e a109e at cryogenic temperature
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMEENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLEKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS V66E A109E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 39
structure length 136
sequence length 136
chains with identical sequence B
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ol7A00
1TR5A 2F0PA 5IGFA 2QDBA 2PYKA 4YIJA 4NP5A 1EY8A 1EY4A 2EY5A 3D4DA 1STNA 4KV6A 5J1ZA 3TMEA 1A2TA 4K5VA 5C6AA 1JOQA 2F0UA 2NUCA 4NKLA 1EY5A 5NUCA 1KAAA 2SOBA 4N9PA 5E3FA 1SYFA 2PQEA 5C4HA 2PZTA 4OL7A 4ODGA 3C1FA 4KJOA 4KTAA 4HTHA 4DU9A 1JORA 3V2TA 2F0HA 3MHBA 4RKBA 2EYOA 1NSNS 2EY1A 3SHLA 4EQNA 2OXPA 1IHZA 1SNMA 1STBA 3DMUA 4TRDA 2HQEA 3T16A 4F7XA 5I9OA 1KABA 4KJNA 1SNOA 1SYBA 2F0TA 3OMGA 4KD4A 4KD3A 2F0FA 5DEHA 5IGCA 3TP5A 4K6DA 2RDFA 3NP8A 4QB4A 2O4XA 4WRDA 1EY0A 5IGBA 1EY6A 5CV9A 5CV8A 1A3UA 2F0NA 3P1HA 3HZXA 5IGDA 1ENAA 1TT2A 2SNMA 4K8IA 3EROA 5CV7A 5M9OA 1ENCA 1KDAA 4LAAA 2KHSA 1STYA 4KY5A 2EYJA 5I6YA 5IGGA 5KGUA 2F0MA 1EYCA 1AEXA 4IUNA 2PW7A 4KHVA 2F0KA 1EYDA 3C1EA 4ZQ3A 3TP6A 4E6IA 5CV5A 3S9WA 3OMCA 4NMZA 3OWFA 3QOJA 3D4WA 2EY2A 3ITPA 5EGTA 2ENBA 4PMCA 3EVQA 2F0QA 1F2YA 1EQVA 3BDLA 4HMIA 2F0VA 2EYLA 4IALA 4J6HA 5KYIA 1SYDA 5HGTA 3LX0A 4RKLA 4F8MA 2F0EA 1SNCA 5CGKA 4ZUJA 5ISRA 3SK8A 3OSOA 1SNPA 2OEOA 3DHQA 3SK4A 5KYLA 2EYMA 1F2ZA 2EXZA 2F0JA 5C5MA 1KDCA 4NDXA 4IZ8A 5KEEA 3SR1A 4B9XA 1EZ6A 1KDBA 4K5XA 5E1FA 5KRUA 1RKNA 3NQTA 5K5PA 5IOCA 5CR3A 1A2UA 1II3A 2EYFA 3BDCA 3MZ5A 5JAVA 1NUCA 5HURA 4ID6A 3HEJA 1STGA 1STHA 3NXWA 1A3VA 2PZWA 4ZUIA 4N9TA 2RBMA 5JOBA 4K2LA 4EQPA 5KIXA 2F0GA 4EQOA 5CV6A 3P75A 4DF7A 5C3WA 2EYHA 4K5WA 3MVVA 2KQ3A 3NK9A 4QMGA 1JOOA 5C4ZA 4H7BA 4EVOA 1U9RA 2M00A 2RKSA 3MEHA 3TP7A 3VA5A 4G57A 4KY6A 2WACA 5EKLA 5IIFA 1STAA 3D6CA 2F0SA 3E5SA 5CV4A 5I9PA 4PMBA 1EYAA 3MXPA 2OF1A 5CC4A 2F0WA 5IGEA 4I65A 2F0LA 2F0OA 4S3SA 3SK5A 1EY7A 3EJIA 4DFAA 5C5LA 3PMFA 4K8JA 4MIUA 3U9OA 5J39A 1SNDA 1SYGA 3NHHA 5F2DA 1TQOA 4PNYA 3NUCA 2F0IA 2LKVA 5I6WA 3QB3A 1A3TA 3QOLA 3H6MA 4J1MA 4KY7A 4ME5A 3RUZA 3SXHA 4K2KA 4QF4A 4WORA 4R8NA 1SNQA 2F0DA 2PW5A 3R3OA 4DGZA 5C3XA 1JOKA 5DAUA 5IODA 1SYCA 1EY9A 3SK6A 1F2MA 3T13A 4B9WA 5J22A 2F3WA 2EY6A 2PZUA 3D8GA 2SNSA 1EZ8A 1SYEA 3ERQA 3TP8A 2F3VA 4HMJA 4K14A 2EYPA 5EKKA
chains in the Genus database with same CATH superfamily
3U4VA 1HA6A 4YIJA 5A35A 4ME3A 1E2VA 1YEZA 3TMEA 2IHEA 3S15H 5CMDA 4NKLA 1EY5A 1NR2A 5GAHC 1G51A 3PUYA 4JI2Q 4X65L 4GOPA 4HTHA 4DAYB 3K5LA 3RMHA 4FP5D 3T56B 4F7XA 2JA8H 4JYAQ 4DK1A 2JE6I 1JJ2A 3NSWA 1VQKA 4DV4Q 1WTQA 1PH7A 5EJWA 1FVIA 1IBLQ 3PO2H 3PCOB 1EY0A 3NTIA 4JI7L 1F9PA 1GJXA 2H1EA 3LNNA 5M9OA 3VR4A 5LMUQ 2RVLA 5FO7B 4ULLA 2LS01 4X3UA 4X62L 4BY7H 1EYCA 3I4LA 2PW7A 3S9WA 4E6IA 5CV5A 2V1CC 3D3RA 1EOVA 4JI5Q 1VF5C 1QNKA 1B2TA 2NN6I 3K58A 4X3KA 2F0VA 1PFMA 5BN4A 3PO3B 4A3BH 1IBKQ 2F0EA 3ND8A 4RAUC 1S3OA 1B53A 2QF7A 4JI1Q 4A93G 1D6EC 2IPKD 2QCPX 5T1GA 1UE1A 4IUUA 5DNFA 5C5MA 4CJ2C 5C0XH 1DZ1A 1E1OA 2OTLA 1I3QH 1PH3A 3BDCA 2MJ8A 5M3MB 1HH2P 4ID6A 3HEJA 3AB9A 5KIXA 1CKMA 4U673 2EYHA 5I4DA 3MEHA 3MWYW 3A8JE 1X56A 1EWCA 2R6GA 1PH2A 3BZDB 3RR5A 4PMBA 3GTMB 3K57A 4XYOA 2R7ZG 4IFDI 2PMZE 1N36Q 5G3LD 3NWTA 4K6LA 1JJCB 2K05A 3EA6A 1LTGD 3HOWH 4KY7A 2F3IA 4L5QA 4XYQA 4OELB 3NWSA 1MIUA 1TWFH 3ULJA 1HR0L 4AYBE 4GKJQ 1K73C 3GDEA 1HRJA 2K5VA 2VW9A 1XNQL 4JC0A 1IBML 2E2HB 4N9PA 4KHPL 4IJLA 1XPRA 3PSIA 4A3EG 2R92B 4B3TQ 3C1FA 1HNXL 4X64L 4RGOS 2F0HA 2E2JH 1SR3A 3D31A 3PF5A 3GTLB 2J7ZA 1BBXC 4GN5A 3GTOB 4J15A 2SDFA 4TRDA 3HG9A 4ALPA 4POFA 2E2IB 2Q8TA 5IGCA 5EPKA 3RLNA 2B2TC 5M5YB 2BCOA 1PTOF 2ZJQA 5C4JH 1KRSA 3ZYYX 2VUMH 4N8X1 1EYGA 2K32A 4A3LH 1EU4A 1PLFA 1YHBA 4CDCC 5JVG3 2QILA 2E5LL 2VQEL 4BXXH 4BBRG 4A3JB 4ZCKA 4A3MB 2JA6G 3V2TA 1DD2A 2F0QA 1NR4A 1Y1WH 1Q90A 2EXDA 1S5DD 4RKLA 4FF4A 4A3DB 3A54A 3HOUG 5IP9H 3DUZA 4NPSA 1K0RA 4PZ7A 1KDCA 4EX5A 4IZ8A 4XDXA 1SMYD 1VQ4A 4A3FB 2AQ3B 3HOZG 1NUCA 2B63H 3S16B 2JA9A 2Y0SE 2RBMA 2A1AA 3P75A 4DF7A 4CHTB 3K7AH 2CWAA 4IPHA 2KCMA 4UP7A 1A6XA 2IL8A 4KY6A 1GUGA 4RCOA 3S14B 4LF4Q 4JI8L 3URYA 4GZYC 5IY0A 1H9JA 4XT3B 4EQ5A 3CPFA 4DV7L 2F0OA 2HD3A 3EBEA 4DV0L 4CDEC 3F2UA 1S5ED 2NB0A 5JEAG 4B3RQ 2B2VC 3GQBA 2EE1A 4JPBW 1D5XC 4OIJA 4JBMA 1HTLD 1A3TA 3GP7A 1E2ZA 3S24A 5E7NA 4KKUA 5EBDA 1VQOA 4DR6Q 4C3IH 4L5SA 4DR4L 1YNXA 1WTRA 4L8JA 5IT9c 1RDPD 1ET6A 1ZYRD 4LK1C 5EBCA 3STBC 1FNVA 3G4SA 2PYKA 2KVMA 4DR5L 1EY4A 3R8BA 1Q8IA 5IWAQ 2GVBA 1JOQA 1I4XA 1D5ZC 1JWUD 1NSNS 3GO5A 1FR3A 3VYSA 1SNMA 2RCFA 3LWUA 2HQEA 3NELA 3PUVA 5I9OA 2C35B 1N32L 1TWHH 2NZHA 5CBEE 3U4ZA 4DNIA 1BXTA 4QB4A 1QVCA 3I4OA 4CBVA 4MZ9A 3TSSA 2EQSA 4GNXA 1TT2A 1VQJA 3TEHB 5M3FH 1TKWB 2CKZB 1K83B 3VYRA 5IGGA 1YNJC 2DUDA 1AEXA 1CFMA 2NTTA 5IE8A 3M4OH 1V8QA 3G7LA 1IKMA 5FK9C 1A63A 3TDQA 1EQVA 4IALA 1I94L 5CBAE 5AJ3Q 2IY5B 1JJGA 2Q2HA 4V190 1HQMC 2AWOA 3F8TA 5FLXL 3GV6A 5A2QE 2N55A 1YJ9A 4B9XA 5JPNC 4A3KB 4DUZL 5HURA 2PZWA 1HFNA 2SEBD 3NBIA 2RHSB 3I91A 5C4ZA 5L37A 4H7BA 2M00A 3CC7A 2A6HD 2XSCA 4GN4B 1GUWA 3M9BA 1EL0A 2I0QA 1XPOA 5EKLA 3S2HB 4IQZA 1VQGA 5I9PA 3PO3H 1ESFA 1I4PA 4X65Q 3WOFA 3CPWA 5FKAC 3QWNA 4I65A 4IPGA 5ELEA 4BY1B 3RZOB 3P7JA 4CGYB 2B2UC 1LUZA 3MA2B 1JC7A 4DR2L 4ZYSA 4R4CA 2AUKA 1GXDC 3HFZB 4QF4A 4JI0L 1JB3A 4XTCS 3KK7A 2A6ED 3HKZE 3TP8A 1VQ6A 1ZXTA 2ZTEA 1QZHA 1VQAA 2XWBB 2B8GA 1WTVA 3S15B 3ND9A 3CCSA 1TR5A 4UPAA 2HDMA 1XTDA 2D0PA 5NUCA 2VY3A 2SOBA 1SE3A 2N88A 3GTMH 2Z6KA 4IPCA 5ELOA 2OXPA 1EFWA 1JMCA 3PIO3 3HOYH 3PO2B 5GAEC 4DV6Q 2JA8G 4KI0A 1KC8C 3OTOL 4OIKA 1W6JA 1JT8A 4FF1A 2RDFA 2XN9C 2NZOA 2F1MA 5IGDA 4IO9A 4PQXA 3K7UC 1ENCA 3J81L 3K5NA 3PIPA 1LTAD 4BY7G 3S2DH 4NMZA 5C0XJ 3KLRA 2E2HH 4A3BB 3FEWX 2BA0A 4FXKC 3EVQA 3O13A 2UUBL 4HMIA 2R92H 1HNWL 1SYDA 2I5LX 5HGTA 1KNAA 5CGKA 1GHKA 1EU3A 3KYHC 1Y1VB 1K8GA 3GTOH 1D1KA 1QILA 1AP0A 1VQHA 4EGVA 4A76A 5C0XG 4DR7L 3CHBD 1KLUD 4XQNA 1OXTA 3A7AB 4C1NI 5M5YH 3HOVB 3NQTA 1GHJA 2J0TD 1OTCA 1A2UA 4RHSA 1VQ5A 1VMPA 1A3VA 1HR0Q 3HKSA 5CV6A 1K9MC 4OHJA 1F9SA 3JC66 4QMGA 3S1NH 2NVXB 2GA4B 3TP7A 3M85A 4DN4M 3QG1A 1IBMQ 1QUQB 3D6CA 4KHPQ 1V9PA 1L2FA 4RCNA 3CCQA 4A3DH 3N6RA 1HNXQ 4X64Q 1R4PB 3JAML 1XXGA 1Y8NB 3HOWB 1YJWA 3KJPA 5J39A 2R93G 1TWFB 3IFDA 3RUZA 5C3XA 2QEXA 1AN8A 3W1GA 2BE5C 4OEMB 3X3MA 1HUNA 2E5LQ 2N78A 3FHWA 4L6TB 2VQEQ 1YI2A 1PHJA 2BE5D 3WDNA 5IYBH 3KUPA 1X65A 2ASBA 2Y0SB 2E2JB 4BBSH 1PZJD 1JWMD 2PZTA 4GOPB 4AH6A 3BZKA 1F9QA 2EY1A 2WB1G 1Q7YC 3J81c 1DOLA 2X6GA 5C4JB 2K5NA 3AFPA 1CK1A 2K4KA 4DNTB 2F0FA 3TREA 2ZTDA 5ELFA 2AHOB 3HZXA 1LACA 3J7AF 2VUMG 4K0KL 5I2XA 2Q2IA 1I4HA 2F0MA 3ER0A 1EUJA 1NAPA 3QO2A 1Y1WB 4BXXG 4O2DA 5M5WH 2ENBA 4QIWE 4DAPA 4ZLTF 4JI8Q 5BN3A 1CZWA 1PZKD 1YJNA 1SNCA 4DV7Q 3C2PA 5JJIA 4DV0Q 3PV0A 3DHQA 3SK4A 3VYTA 3K8AA 4HIOA 4YY3L 1L0WA 3SEBA 1TS3A 1X3QA 3I3CA 2EJFC 2B63B 1ASYA 4HN7A 5KRUA 4NXML 1SE2A 2MNAA 2AQ2B 3Q23A 4DR4Q 2KEDA 5GQOA 4JCVE 1OXSC 3JAMc 1UUPA 4F87A 1IW7D 1PRTD 3U58A 4DR5Q 1U4PA 1N33L 1XTCD 5COYA 4C1NK 4U68A 3TBIB 3G6JB 1STAA 1SBBB 1SDFA 2GVAA 3K0YA 4UP8A 2UU9L 1F2LA 2F0WA 1IYJB 2F0LA 3EQLC 4YWKA 3Q22A 5JJZA 4X3SA 2CH4W 5BR8L 1N32Q 1G91A 3I4MG 2L1BA 1BCPF 4J1MA 1LT5D 2K04A 2E76C 4MHEA 4DGZA 2ES2A 1C8CA 5DM73 1EY9A 1CM9A 4C3IG 1TU2B 4IPDA 4HAEA 1AE3A 4PG3A 4Z9CB 5FJ8H 2F3VA 1ASZA 2JYOA 1T5XD 5EAYA 4MTKA 2A73B 1KQSA 4DPGA 2AQ1B 4RWSC 4QGUA 3CD6A 2HT1A 3EN2A 1SYFA 4LF7Q 3CRLC 1HQRD 2PQAA 2YV5A 1MSGA 4KTAA 2G9HD 2MO0A 1KRTA 1I94Q 3D4RA 2A69C 4RKBA 5ELBA 2ZJRA 4EQNA 1TWHB 3RN5A 2JXMB 2KCTA 3HOXB 4JK1C 2Z8LA 4ILWA 2ID0A 1GO3E 1BOSA 4QY7A 1SROA 1RIPA 1Y14B 2NN6G 2NZ1D 1ICWA 3M4OB 4R4TA 5M3FG 1L0YB 2RSOA 5LHY1 2NVQB 3DM1A 2MGSA 2EVBA 3TS2A 3OWFA 3QOJA 3RLOA 4RG1A 1AZQA 3I4NH 1RTOA 3A8IE 3KDFA 1K8MA 3H15A 1KAWA 3CXCA 1X3PA 3OPOA 3S1MB 2B3GA 2AUJD 2OEOA 1HCZA 4TSSA 4A3GB 3MXGA 4IFDJ 1FNWA 1F9RA 2EYMA 3OW2A 2HDLA 3LGJA 1O7IA 3W3AA 4MN3A 5KEEA 1D1IA 1KDBA 4JBKA 1FJGL 3W5OA 4JI0Q 1PV4A 3KF8A 3I90A 3M4QA 2F4IA 4POGA 3K0XA 5FLMG 2JQOA 1PXUA 5D65A 4I7ZC 4IFDG 4LUZA 1K3BC 3K81C 3NK9A 4IUVA 2R3ZA 1GD7A 1EIGA 4RGTA 5CC4A 3I55A 3PO3G 1H95A 2Q2TA 2KENA 1HTPA 1Y1VH 5IYDG 2JEBI 4DXGA 3BG3A 1QCBD 1X54A 3T1HQ 4K8JA 3DXJC 1Z6HA 1SEBD 4LWCA 2F0IA 2ATWA 2TSSA 3OTOQ 3HOVH 3H6MA 1TWGH 4GNXC 1MGSA 4LF5L 2MQHA 3R3OA 4LF8L 3MXUA 1ONLA 5M3MG 1WVLA 3QIAA 2UXBL 1GUTA 4CKEA 1KIXA 3D8GA 4WJ3M 1A8VA 3VR5A 1SXTA 3ERSX 2EYPA 2D2CC 1G6ZA 1J9OA 2NVXH 3CU7A 1DYQA 3VR2A 2WKCA 3J80E 3D4DA 5J1ZA 3A55A 4BA2I 3A5UA 5C4HA 2UUBQ 2YYZA 1B4OA 3HOYB 3FPUB 1HNWQ 2A19A 2K14A 1NMGA 2VQFQ 1O78A 1PTOB 1JQYD 3V96A 5D14A 4L63B 3GTPB 1K8AC 3MXNA 1GOZA 5IP7H 2O4XA 4M8AA 4JOIC 4ZAIA 4CKBA 1PDQA 3BVZA 2VS1A 2VXWA 5CV9A 3SVMA 4HIDA 1ENAA 4K8IA 4TQUS 3MAQA 4GNXB 3S2DB 3CW2C 4NXNL 2XVSA 4KY5A 4OONA 1WTPA 1VQ7A 2QDLA 1HPCA 2F0KA 2QEJC 1VQIA 1RODA 1V1QA 3CCUA 4FO2A 1TVXA 2A8VA 4PV1C 4DK3C 2HHHL 1LTBD 3HGBA 5KYIA 4KN7C 2R92G 3E6ZX 1LABA 2YTVA 3TQYA 1LO5D 3H0GH 3L7ZC 1I6HB 2B2YC 2CWPA 1I4RA 4JI6L 3H3VH 1LT4D 5IOCA 2M2LA 2RQXA 1E3PA 3NXWA 4UAIA 5JOBA 3S1NB 1PYBA 4HSPA 4A3CH 1L1OA 3T53B 3EFXD 1HR0W 4DA2A 3I72A 2WV6D 1JWSD 4A3JG 1UE6A 4A3MG 2XIWA 5FO9B 4FYDA 2ICIA 2LXKA 4A3DG 3T1YL 4GLXA 1M1KC 4Q0FA 3U9SA 4A3IH 3PMFA 1XX8A 2ZM6L 5H1SE 1AE2A 3NQIA 4RHRA 1VCIA 3J7A5 4GN3B 4APVA 4A3FG 4OGQC 3OW7A 5JEAJ 2F3WA 1DOKA 1UE7A 1BNZA 3TRZA 4K14A 1XNRL 4DAVA 2DJGC 4BBSB 1SSOA 5G3LF 2DNCA 1PVOA 1TS4A 3AU7A 3NPPA 4HJ9A 2O2LD 1PA6A 1G8ZD 5ELCA 1LT6D 3A56A 2F0UA 2NUCA 5IYBG 4QL5A 3VR6A 2WB1E 4BS9A 1U4LA 4DU9A 1FL0A 3IKJA 3NTKA 1T5EA 2BDOA 3CCMA 4Y52H 1IHZA 1WCMH 3T16A 2ZXRA 1VQNA 4OXPA 4YY3Q 4OWXB 5KNCA 4R1JA 4OO1I 4IUTA 2UUCQ 3NP8A 4NXMQ 1BBUA 1AFPA 4QUCA 1HNZL 1EY6A 2K28A 1HZBA 1DXMA 4P2CB 1MSHA 1WD1A 1HA5A 5M5WB 2R61A 3STBD 3C1EA 1EYDA 1WTHA 1PH8A 1LLRD 4F88A 1N33Q 4YCWA 4XT1B 4R8IA 1BDOA 2UU9Q 2DNEA 2L12A 2WAQE 3KF6A 3NEMA 1BVSA 4FVMA 1YHAA 1WTXA 2CCZA 3I56A 5C4XB 3AQQA 4L5TA 1Q82C 2RSNA 3E0EA 3W2DA 3HOXH 5JPMC 2DY8A 5BR8Q 5ELNA 3DLLA 2R7DA 1CHQD 4O1NA 3AFQA 4CJ1B 3L2PA 3NBHA 2NVQH 2I5MX 1YNJD 1X3FA 1HZCA 1VS0A 3VA5A 5EPJA 2WACA 3H09A 4PZ8A 1XYIA 1WTOA 4H13C 4C3HB 3K80C 3S1MH 4ZKCB 4LF6Q 4A3GH 1BUVT 4HJ8A 2NWGA 3I2ZA 1VQBA 2WKDA 1TY2A 4O0AA 2E8GA 1E0BA 4JI3L 4K2KA 2RA4A 5DAUA 4A3KG 1JE4A 1L0XB 4IUPA 4HMJA 3CCLA 1FNUA 1QWYA 5EKKA 1GUNA 1R4QB 2F0PA 2HUGA 3OIPA 4XXEA 4NP5A 2K75A 3S1RB 4K5VA 2FFKB 1KNEA 1Z47A 1C9OA 3X3NA 4JW0A 3PUWA 1TXYA 3BZCA 3DMUA 4BY1G 4DV5L 1YZ6A 1XWEA 4JI7Q 4A93H 5DEHA 5D3IB 5IT9E 4DV4L 1D8LA 3OWEB 1O7YA 4X62Q 3A7LA 3GTGH 5CV7A 3SE0A 1PYWD 2CVRA 1WFQA 3I4NB 2XNAC 4KLKA 1NY4A 4RA8A 3L9AX 3VA7A 2VL6A 1I6VC 4PMCA 1HHVA 4IN3A 2R7FA 1HFGA 2J4XA 1D5MC 4KMUC 1PTOH 1FD7D 1VQDA 1PZID 2RCNA 1I4QA 3GTPH 3PO2G 1IBKL 3R2TA 2R7ZH 2JA5B 2B8FA 1KHIA 1B3QA 2PMZB 1M4VA 4LF5Q 1S5BD 2HIVA 4LF8Q 1RL2A 3K59A 3PIOA 1VQPA 2UXBQ 3PIP3 1OXVA 5FLXc 1VQ8A 1TIID 4XQQA 5GADC 4FF3A 3KOJA 4QCLA 1V43A 3EIVA 4AYBB 3PQIA 3ULLA 4EVOA 1S5FD 1OXUA 2K33A 4P75A 4A3BG 5D3DA 2E2DC 1A15A 1EYAA 3K5OA 2A5HA 5IGEA 1E22A 4P74A 2PNHA 2F52A 1Y1VG 2IJ0A 1E1TA 1I6HH 1LTSD 1TWGB 3E3XA 2E75C 4MIUA 3RLFA 3NHHA 4DR1L 2D0OA 2LSSA 3QB3A 4WJWA 1LTLA 3HOVG 4WORA 1S40A 1N36L 1FYCA 3M7GA 2ZJPA 1D7QA 2ICEC 2KCNA 4JI4L 2PZUA 1ET9A 3ONAB 4GOPC 4NXNQ 1CHPD 1XNQQ 4KHZA 1HZ9A 2JK8A 2CW0C 2XWJB 1AZPA 3IRBA 5IGFA 3E0JA 3RD4A 5I2YA 2PPBC 2UXDL 2KOLA 2FMCA 4OO1H 2E74C 1S72A 5M5XB 1O7LA 3GV3A 1G291 2HHHQ 2V4DA 3H3VC 2PQAB 4ODGA 1WD0A 2I5HA 4KJOA 1JORA 1BO0A 2MPMA 4WFN3 1DONA 4QQBX 3HOWG 3QR8A 4LUVA 1OO9B 3J80i 4H44C 2F0TA 1SYBA 4JI6Q 2NVYH 4X66L 4O42A 3HOUH 1LYLA 5IP7G 1PH1A 1E2WA 4FF2A 5LL6S 2F0NA 2SNMA 4HJ7A 2ZT9C 2PCFB 1PH5A 3T51B 1XMOL 5LMNL 5LL6X 3GD7A 1BCPC 1FGBD 1SLJA 2Y0SG 3FKIB 1F2YA 1YNNC 3H0GB 3KDFB 1MJEA 4UHVA 4C3JB 2QW7A 1EFID 2RF4A 1QVGA 3PF4A 4CJ0B 1DGSA 3T1YQ 1WI5A 1YNND 3OHXC 2EXZA 2F0JA 2C5CA 1PFBA 2ZM6Q 4NDXA 1UE5A 4R4IA 3VR3A 1E24A 2IT1A 4HIKA 1II3A 3MZ5A 5C3EB 4A3LG 3KF8B 3CMEA 1K8OA 4GS3A 5FLXE 2LMCB 2HIXA 3GTJH 1KXLA 1XNRQ 4K5WA 4A3CG 1I4GA 1JOOA 2L5TA 1NTGA 1H9SA 1SJED 4DAMA 1Y1WG 1GM5A 1CSQA 2D5DA 1B9MA 1NMFA 1NCVA 3VYUA 5CV4A 4A3IB 2NVTH 1BCPB 3TZDA 5IP9G 1MI2A 2JA7B 4AQYL 5C4XH 4LF4L 1CUKA 3SK5A 3A8KE 4LF9L 2PI2A 3BYYB 2K5DA 5C5LA 2I46A 5F2DA 1VQ9A 3CCRA 2EPBA 1RCVD 2B63G 2WAQB 5IODA 1JOKA 1SYCA 1TS2A 3C46A 5J22A 1HNZQ 4B3SL 2CH4A 3S1QB 3UE0A 1ICFB 3K6OA 1VQMA 3H3VI 4DK0A 4CDFC 2H5XA 1M8AA 2A68C 2L55A 1P8LA 4FXDA 2OTJA 1A2TA 1PYSB 4IOCA 1KAAA 1GKHA 2CQAA 1VQLA 1X55A 4C3HH 1Q1EA 1Y8OB 3W1BA 3G48A 1WCMB 4P71A 3MHBA 1NJIC 4RFBA 3AEVA 1IL8A 4FDBA 2EDGA 2P5ZX 1YHQA 1YITA 4DV1L 3MXNB 1TWAH 3IL8A 1TY0A 4XQJA 1IL2A 1L1OC 2HQLA 4LJZC 3P1HA 3KLSX 1CI3M 1LTTD 1J5EL 3H91A 2Q2UA 1B9NA 1RTNA 3S1RH 2WINB 1KL9A 5HGQA 1B44D 1W6KA 4J6HA 3J81E 5C44B 3OYYA 2A69D 3F1ZA 5ISRA 3Q0AA 4LUOA 1SNPA 1IXRA 1NBWA 1MHWC 1VMCA 2L11A 3NTHA 3HRZC 4DUZQ 1DJRD 3CAMA 3HOXG 4Y7NB 2B2WA 1YIJA 4MTNA 4JI3Q 5E1FA 1PFSA 1CZGA 2YU9B 3CKIB 3RZDB 4P73A 1H9KA 3KBGA 1EWIA 1ILQA 3DM3A 2Z4HA 4K2LA 1ESRA 1L1OB 1X6OA 3HKZB 3UDFA 2KQ3A 1VQFA 3MFGA 1J8IA 3CC2A 1BR9A 4FXGC 4DUYL 1CKOA 1EIFA 1UNSA 4C2MH 3OOCA 2MFIA 4RH6A 3E5SA 2XRSD 2K7VA 3MXPA 1SN8A 3P20A 4P72A 3S17H 4DR2Q 3I73A 1TS5A 4A3GG 2CHBD 4DV5Q 1PRTF 1SYGA 2JA5H 1TQOA 1C48A 3NUCA 2BH2A 1P16A 1STEA 3QOLA 1PMRA 1CA6A 3JAME 4IJHA 4H0LC 2KECA 2K50A 4QUFA 1Z7TA 1UAPA 2KHJA 2N3SA 4NB3A 3UE1A 4GKKL 3RNUA 4R4QA 1PTOC 3KFUA 3U50C 2EIFA 4B3ML 1QJOA 4DV3L 5C6AA 2FJ2A 2GN5A 1LT3D 1PTOD 5CORA 3PGZA 1DCZA 4OL7A 3F2BA 3BU2A 1Q81C 2EYOA 2BDNA 3A74A 4A93B 2JSOA 1STBA 2IX0A 2VB2X 1KABA 3IAYA 4KD4A 1V1PA 4PZ6A 3GTGB 1HUMA 1BKBA 1WJJA 2D62A 4CDDC 4DV6L 1XMQL 2QGQA 5IGBA 1Y69U 1MJCA 1TWCH 5CV8A 1UEBA 1YBYA 3MC0B 3FMCA 1WYDA 4YHHL 2JP1A 3D4WA 2EY2A 4RGNA 1BQQT 2PI2E 2KBNA 5M5XH 2JEAI 2Z4IA 5A2QL 1ZEQX 3HOYG 3LX0A 1MBYA 1Z9FA 2R7ZB 1RJTA 2L4NA 3H94A 3KF6B 4DR7Q 3D6WA 5KYLA 1AH9A 4HIMA 5KNDA 2LFNA 4DR1Q 4YCVA 1CKNA 4K5XA 4RGMA 1SE4A 4LW1A 2R93H 5K36H 5JAVA 2AKWB 4UDUC 3J81j 4GLVB 1MKHA 4ZUIA 3G71A 4JI4Q 3CF5A 4EQOA 3NBHB 2NYZD 1OXXK 1B70B 3ULPA 4DNRB 1U9RA 3TZUA 1G2TA 2UXDQ 1B8AA 3FPPA 3CCVA 3FKIH 4KKSA 2D9UA 1N34L 4A3EB 2O5IC 3A5ZB 1B3AA 2YTXA 1KTKA 4C3JH 1Q86C 3L3OC 4LFAL 2K01A 3I8ZA 2HCIA 2HCCA 3EJIA 2KHIA 2PO4A 5IT9L 1V1OA 2WFWA 2TMPA 2NBFA 4X66Q 1SRUA 5C3EH 2K52A 2JJQA 2K1BA 1GVPA 1IKLA 1SYEA 1Y8PB 3SDZA 2VZAA 2Z6KC 3D0FA 4OX9L 3FVQA 3M3YH 1LTRD 4BBRB 2QDBA 5EPLA 1EY8A 1LTID 1XMOQ 5LMNQ 1RHPA 2MHVA 3PUXA 1QE6A 2JA6B 4GLAC 4OO1G 3UI2A 1T9HA 4ZRZA 2EZVA 4QIWB 1EOTA 2JA7H 4DAYA 2NVYB 3HOUB 4DR3L 1DM0B 4IOAA 2O5JC 1JB7A 1SNOA 3OMGA 2EJMA 4KD3A 2FHTA 3TP5A 1SMYC 4K0KQ 3HOZB 3F2DA 2L15A 4YWMA 1VDZA 4A4IA 3S1QH 1E7ZA 1M90C 1RD9D 1PH6A 3EROA 1A62A 4LAAA 5I6YA 3ZJYC 4ZQ3A 3IFTA 2BA1A 4XIGS 2F4VL 3J7YW 4BBSG 3CQZH 4DV2L 1VQEA 3PUZA 3VDYA 5EGTA 2WP8J 1EQQA 2G9DA 1LV9A 1UEAB 5IYCH 4F8MA 4AQYQ 1XJVA 4HJAA 2MO1A 4LF9Q 5CYUA 4H02A 4ZK9B 4KKTA 3SR1A 1CSPA 4LFBL 1SFOH 3GTJB 1QVFA 3I4MH 1MD2D 4DXFA 4B3SQ 1I50H 1SE8A 4B08A 1ML0D 1ZYRC 3RN2A 3AMUA 4LFCL 2NVTB 4G57A 4KK7A 3LWEA 2Z1CA 2DY7A 2F0SA 2FINB 5C44H 5EQ0A 2IWHA 4G7OC 2N8NA 5GROA 5C4XG 5TSSA 1QB5D 1K3RA 2Z0SA 3U9OA 3BDOA 4PNYA 2DN8A 2LKVA 4AIMA 4Y7NH 4DV1Q 2UXCL 2YU9H 3RZDH 1C0AA 3SK6A 3QJYA 1Q1BA 2B29A 2K5QA 3ERQA 4A75A 4TKOB 2XRQD 2JN4A 3GTKB 2NN6H 3Q6SA 1IYVA 1D2BA 1J5EQ 3J7ZC 1XPUA 3E9IA 2EY5A 1KD1C 1GUOA 2OCEA 3F2CA 4N8FA 2IW3A 2PQEA 1PH9A 1CQFA 1HJPA 1R9TB 2X69A 4C3HG 2K5WA 4OWWB 4LF7L 4JV5L 3M4YA 3E9HA 1G2SA 1EQRA 1HZAA 1TWAB 4KJNA 3J7AV 2RDHA 2N49A 4K6DA 1YVCA 1IZ6A 5JVH3 5FJ8G 2MP1A 2UUAL 3KLSA 2ZXOA 1X32A 3GTQB 2FMMA 1X9NA 2KUMA 1VF7A 4QJFA 1STYA 4R4OA 2EYJA 5KGUA 2CFMA 4KHVA 5J3BA 3TP6A 1S5CD 1JR0D 5FLMH 3OMCA 2IX3A 2A6HC 4DK6C 4IUQA 4DUYQ 3UDGA 4JOIA 4IFDH 5JJLA 3ITPA 5AFWA 4YCUA 4JI2L 5KNBA 4TVAB 2XGTA 4KN4C 1U4RA 1EEID 3TS0A 4L5RC 4ZUJA 3SK8A 3OSOA 4JBWA 4JYAL 1JICA 4RMFA 1FJGQ 5IYDH 3DWQA 3UDXA 1S4ZA 3HP3A 1IBLL 5K5PA 3J81i 3R93A 4LNQA 2A6EC 1FGUA 1DOMA 1STHA 2Z9HA 2B2TA 4EQPA 5LMUL 3CC4A 4GKKQ 2B2YA 4C2MB 1Q12A 5M3MH 3MVVA 5ELDA 1H9SB 3I4NG 4B3MQ 4C56C 5FO8B 2FXQA 4JI5L 4DV3Q 2ALYB 5IIFA 3S17B 4ZKBB 2MUYA 4HCSA 3CCJA 4R9WA 4UY8C 2RDGA 4JI1L 4S3SA 2JA8B 5GAGC 5DM63 1QZGA 5I6WA 3C3LA 4LMQD 2JA5G 4ME5A 3T1HL 3FRPB 2F0DA 2PNRC 1XMQQ 3DWPA 4HSVA 4G7ZC 1EIYB 1X3GA 2KEEA 1F2MA 3TN2A 4B9WA 4WJ4A 2EY6A 2SNSA 1JCKB 1CQVA 4X6AH 2ZXPA 2H4OA 2OT2A 1CT1D 4BY7B 4AYBG 4G7HC 1U0LA 2QA4A 4YHHQ 2K03A 3JAMi 4MNOA 5E3FA 1ENFA 4A3EH 3G6EA 2K5HA 1CTMA 3SHLA 2C9OA 2B2WC 1IYUA 1EIHA 2VQFL 3GTLH 3DWAA 2DGYA 3FP9A 4FNFA 1TWCB 2L9HA 4WRDA 2B2VA 1I3QB 3CMAA 3KBXA 2E2IH 2YTYA 4GKJL 1JE5A 2CW0D 1H9MA 4BBRH 3WWVA 2EOTA 2X6LA 1SAPA 3DEPA 5JJKA 2JA6H 1EWHA 1N34Q 3BDLA 1BF4A 2EYLA 4B3TL 4A3JH 3MFYA 4LFAQ 1K28A 1F77A 1NNXA 4A3MH 1QNUA 3Q8DA 2NTSA 2F03A 2KCCA 2R93B 4ABNA 1WTWA 1N9WA 3HOZH 4DKAC 5K36G 1STGA 1H9RA 2OQ0A 4N9TA 1QOHA 4A3FH 3Q24A 2F0GA 1W2BA 2Q8IB 4OX9Q 3S16H 2QKIC 5C0XI 3K5MA 3MTSA 1BCPD 2BH8A 1B7YB 4J8QA 2L0CA 4HEDA 5E4WC 3FKIG 1SJHD 1PH4A 3H0GG 4HJ5A 3NENA 1G6PA 4C3JG 2WB1B 3FDTA 3S14H 3I70A 1EY7A 5JEAH 3M7NA 4HR7B 4DR3Q 3A0JA 3BS1A 4CKCA 4R8NA 1SNQA 2PW5A 2WIIB 5C3EG 3J80L 1Q8KA 4NW2A 1VQCA 3V05A 3M3YB 4JVZA 2VUMB 1C4QA 5DLQE 1AW7A 4HCEA 2VNUD 3DEOA 2F4VQ 1ZKOA 1STNA 1RF2D 4KV6A 4DV2Q 1O7ZA 5E4XA 3M4PA 5LMNW 1W3SA 2IX1A 1KLGD 4A3IG 1K0SA 3N52A 3BJUA 2JA7G 1NE3A 2BOSA 2DJFC 5T1IA 3BYTB 2Q8RE 4B3RL 1UWVA 1A0IA 3MEFA 1V1PB 2Z6BA 2VB3X 3AYHB 2AMCB 4LFBQ 4JG2A 4BA1I 2B2UA 4DR6L 2WAQG 5BN5A 1A3UA 1BBWA 2IHFA 1EEFD 2I07B 2UUCL 3CQZB 3GTKH 3WOEA 1KDAA 2KHSA 3KLWA 3K7AB 4IUNA 3SGIA 1IW7C 1PRTC 2A68D 2LXJA 5FOBB 5IWAL 3UDIA 1J6QA 1K83H 5HY6A 3KJOA 4LFCQ 4UP9A 1B50A 1X3EA 4BWGB 1CA5A 1R9TH 2XTIA 1Q46A 4IURA 1WCMG 1U5KA 3ICEA 4X3TA 2KJXA 5IYCG 4YWLA 3BVGA 1SFOB 1ILPA 1F2ZA 3T4AC 3NE5B 2B39A 2G5DA 4V0BA 3I4MB 1B1ZA 1I5FA 1EZ6A 1CKNB 1RKNA 2OWOA 1I50B 4G4KA 2UXCQ 1Q3LA 5CR3A 2EYFA 3GTQH 1GUSA 3OIQA 4C3IB 1SMXA 5C3WA 2LY7A 3R2IA 4A3KH 2ZTCA 1O80A 3B6YA 5EKIA 2RKSA 4Q5VA 1U4MA 3I7FA 2K6AA 1LM0A 1C7YA 1QUQA 1EQTA 1PRTB 2AWNA 4I7AA 2OF1A 3J80c 5C44G 1QG7A 5AJ3L 4JBJA 3S2HH 1HXYD 2RHQB 4JV5Q 4DFAA 2CQOA 3CRKC 2EJGC 3CP0A 3HS0C 1SNDA 4PMWA 3BVMA 4LF6L 4M1UB 4BY1H 3RZOH 3SXHA 2A74C 2M9VA 1PFNA 3L0OA 2KA7A 3CCEA 2UUAQ 3T13A 1WOCA 4OWTB 1EZ8A 5M3FB 1N8RC 2OQKA 3HKZG
chains in the Genus database with same CATH topology
1HA6A 4YIJA 5A35A 1E2VA 3TMEA 5CMDA 4NKLA 1EY5A 1NR2A 3PUYA 4HTHA 3K5LA 3RMHA 4FP5D 3T56B 4F7XA 4DK1A 2JE6I 3NSWA 1WTQA 5EJWA 1EY0A 3NTIA 1F9PA 1GJXA 2H1EA 3LNNA 5M9OA 3VR4A 2RVLA 5FO7B 4ULLA 2LS01 4X3UA 1EYCA 3I4LA 2PW7A 3S9WA 4E6IA 5CV5A 3D3RA 1VF5C 1QNKA 1B2TA 2NN6I 3K58A 4X3KA 2F0VA 1PFMA 5BN4A 3PO3B 2F0EA 3ND8A 4RAUC 2QF7A 1B53A 1D6EC 2IPKD 2QCPX 5T1GA 4IUUA 5DNFA 5C5MA 4CJ2C 5C0XH 1DZ1A 3BDCA 2MJ8A 5M3MB 4ID6A 3HEJA 3AB9A 5KIXA 4U673 2EYHA 5I4DA 3MEHA 3MWYW 3A8JE 1EWCA 2R6GA 3BZDB 4PMBA 3GTMB 3K57A 4XYOA 4IFDI 5G3LD 3NWTA 4K6LA 2K05A 3EA6A 1LTGD 4KY7A 4XYQA 3NWSA 1HRJA 2E2HB 4N9PA 2R92B 3C1FA 4RGOS 2F0HA 3D31A 3GTLB 2J7ZA 1BBXC 3GTOB 2SDFA 4TRDA 3HG9A 2E2IB 2Q8TA 5IGCA 5EPKA 2B2TC 5M5YB 2BCOA 1PTOF 3ZYYX 2K32A 1EU4A 1PLFA 5JVG3 2QILA 4A3JB 4A3MB 3V2TA 1DD2A 2F0QA 1NR4A 1Q90A 1S5DD 4RKLA 4FF4A 4A3DB 3A54A 3DUZA 1KDCA 4IZ8A 4XDXA 1SMYD 4A3FB 2AQ3B 1NUCA 3S16B 2RBMA 3P75A 4DF7A 4CHTB 1A6XA 2IL8A 4KY6A 1GUGA 4RCOA 3S14B 4GZYC 3URYA 1H9JA 4XT3B 2F0OA 3F2UA 1S5ED 2NB0A 5JEAG 2B2VC 3GQBA 2EE1A 1D5XC 4OIJA 1HTLD 1A3TA 3GP7A 1E2ZA 4KKUA 5EBDA 1WTRA 4L8JA 1RDPD 1ET6A 1ZYRD 4LK1C 5EBCA 1FNVA 2PYKA 2KVMA 1EY4A 3R8BA 1Q8IA 1JOQA 1I4XA 1D5ZC 1JWUD 1NSNS 3GO5A 1FR3A 3VYSA 1SNMA 3PUVA 3LWUA 2HQEA 5I9OA 5CBEE 1BXTA 4QB4A 4CBVA 3TSSA 1TT2A 1TKWB 3VYRA 1K83B 5IGGA 1YNJC 1AEXA 1CFMA 2NTTA 1V8QA 3G7LA 1IKMA 5FK9C 3TDQA 1EQVA 4IALA 5CBAE 4V190 1HQMC 2AWOA 5FLXL 3GV6A 5A2QE 2N55A 4B9XA 5JPNC 4A3KB 5HURA 2PZWA 1HFNA 2SEBD 3NBIA 3I91A 5C4ZA 4H7BA 2M00A 2A6HD 2XSCA 1GUWA 1EL0A 5EKLA 3S2HB 4IQZA 5I9PA 1ESFA 1I4PA 3WOFA 5FKAC 3QWNA 4I65A 5ELEA 4BY1B 3RZOB 3P7JA 4CGYB 2B2UC 3MA2B 1JC7A 4ZYSA 2AUKA 1GXDC 4QF4A 1JB3A 4XTCS 3KK7A 2A6ED 3TP8A 1ZXTA 2XWBB 2B8GA 1WTVA 3S15B 3ND9A 1TR5A 2HDMA 5NUCA 2SOBA 1SE3A 2N88A 2OXPA 3PIO3 3PO2B 4KI0A 4OIKA 1W6JA 4FF1A 2RDFA 2XN9C 2F1MA 5IGDA 4PQXA 1ENCA 3J81L 3K5NA 1LTAD 4NMZA 5C0XJ 3KLRA 4A3BB 3FEWX 2BA0A 4FXKC 3EVQA 3O13A 4HMIA 1SYDA 5HGTA 1KNAA 5CGKA 1GHKA 1EU3A 1Y1VB 1D1KA 1QILA 1AP0A 4EGVA 5C0XG 3CHBD 1KLUD 4XQNA 1OXTA 3A7AB 4C1NI 3HOVB 3NQTA 1GHJA 2J0TD 1A2UA 4RHSA 1VMPA 1A3VA 5CV6A 4OHJA 1F9SA 4QMGA 2NVXB 2GA4B 3TP7A 3M85A 4DN4M 3QG1A 3D6CA 4RCNA 3N6RA 1R4PB 3JAML 1XXGA 1Y8NB 3HOWB 5J39A 1TWFB 3IFDA 3RUZA 5C3XA 1AN8A 2BE5C 3X3MA 1HUNA 4L6TB 2BE5D 3WDNA 3KUPA 2Y0SB 2E2JB 1PZJD 1JWMD 2PZTA 1F9QA 2EY1A 1DOLA 2X6GA 5C4JB 1CK1A 4DNTB 2F0FA 5ELFA 3HZXA 1LACA 3J7AF 5I2XA 1I4HA 2F0MA 3QO2A 1NAPA 1Y1WB 2ENBA 4DAPA 4ZLTF 5BN3A 1CZWA 1PZKD 1SNCA 3C2PA 3PV0A 3DHQA 3SK4A 3VYTA 3SEBA 1TS3A 1X3QA 3I3CA 2EJFC 2B63B 4HN7A 5KRUA 1SE2A 2AQ2B 3Q23A 2KEDA 1OXSC 1UUPA 4F87A 1IW7D 1PRTD 1U4PA 1XTCD 5COYA 4C1NK 4U68A 3TBIB 3G6JB 1STAA 1SBBB 1SDFA 3K0YA 1F2LA 2F0WA 2F0LA 3EQLC 3Q22A 5JJZA 4X3SA 1G91A 2L1BA 1BCPF 4J1MA 1LT5D 2K04A 2E76C 4MHEA 4DGZA 1C8CA 5DM73 1EY9A 1CM9A 4C3IG 1TU2B 4HAEA 4Z9CB 2F3VA 2JYOA 1T5XD 2A73B 2AQ1B 4RWSC 1SYFA 3CRLC 1HQRD 1MSGA 4KTAA 2G9HD 3D4RA 2A69C 4RKBA 5ELBA 4EQNA 1TWHB 2JXMB 3HOXB 4JK1C 2Z8LA 4ILWA 2ID0A 1BOSA 2NN6G 2NZ1D 1ICWA 3M4OB 1L0YB 2RSOA 5LHY1 2NVQB 3DM1A 2MGSA 2EVBA 3OWFA 3QOJA 1AZQA 1RTOA 3A8IE 1K8MA 1X3PA 3OPOA 3S1MB 2AUJD 2OEOA 1HCZA 4TSSA 4A3GB 3MXGA 4IFDJ 1FNWA 1F9RA 2EYMA 2HDLA 3W3AA 4MN3A 5KEEA 1D1IA 1KDBA 3KF8A 3I90A 2F4IA 1PXUA 5D65A 4I7ZC 4IFDG 3NK9A 4IUVA 2R3ZA 1EIGA 4RGTA 5CC4A 1HTPA 2JEBI 4DXGA 3BG3A 1QCBD 4K8JA 3DXJC 1Z6HA 1SEBD 2F0IA 2TSSA 3H6MA 1MGSA 3R3OA 3MXUA 1ONLA 1WVLA 3QIAA 1GUTA 4CKEA 3D8GA 3VR5A 1SXTA 2EYPA 2D2CC 1G6ZA 1J9OA 3CU7A 1DYQA 3VR2A 2WKCA 3J80E 3D4DA 5J1ZA 3A55A 4BA2I 5C4HA 2YYZA 1B4OA 3HOYB 3FPUB 1O78A 3V96A 1JQYD 1PTOB 5D14A 4L63B 3GTPB 3MXNA 1GOZA 2O4XA 4M8AA 4ZAIA 4CKBA 1PDQA 3BVZA 2VXWA 5CV9A 3SVMA 1ENAA 4K8IA 4TQUS 3MAQA 3S2DB 2XVSA 4KY5A 1WTPA 1HPCA 2F0KA 2QEJC 1RODA 4FO2A 1TVXA 4PV1C 1LTBD 3HGBA 5KYIA 4KN7C 3E6ZX 1LABA 1LO5D 3L7ZC 1I6HB 2B2YC 1I4RA 1LT4D 5IOCA 2M2LA 2RQXA 3NXWA 4UAIA 5JOBA 3S1NB 4HSPA 3T53B 3EFXD 4DA2A 3I72A 2WV6D 1JWSD 2XIWA 5FO9B 4FYDA 2ICIA 4Q0FA 3U9SA 3PMFA 1XX8A 3NQIA 4RHRA 1VCIA 4OGQC 3OW7A 5JEAJ 2F3WA 1DOKA 1BNZA 4K14A 4DAVA 4BBSB 1SSOA 5G3LF 2DNCA 1TS4A 3AU7A 3NPPA 2O2LD 1G8ZD 5ELCA 1LT6D 3A56A 2F0UA 2NUCA 3VR6A 4BS9A 1U4LA 4DU9A 3IKJA 3NTKA 1T5EA 2BDOA 1IHZA 3T16A 2ZXRA 5KNCA 4OO1I 4IUTA 3NP8A 1AFPA 4QUCA 1EY6A 2K28A 1DXMA 4P2CB 1MSHA 1WD1A 1HA5A 5M5WB 2R61A 3C1EA 1EYDA 1LLRD 4F88A 4XT1B 4R8IA 1BDOA 2DNEA 2L12A 4FVMA 1WTXA 5C4XB 2RSNA 3W2DA 5JPMC 2DY8A 1CHQD 4O1NA 4CJ1B 3NBHA 1YNJD 3VA5A 5EPJA 2WACA 3H09A 1XYIA 1WTOA 4H13C 4C3HB 4ZKCB 1BUVT 2NWGA 2WKDA 1TY2A 1E0BA 4K2KA 2RA4A 5DAUA 1JE4A 1L0XB 4IUPA 4HMJA 1FNUA 5EKKA 1QWYA 1GUNA 1R4QB 2F0PA 2HUGA 3OIPA 4XXEA 4NP5A 3S1RB 4K5VA 2FFKB 1KNEA 1Z47A 3X3NA 3PUWA 3DMUA 1XWEA 5DEHA 5D3IB 5IT9E 3OWEB 1O7YA 3A7LA 5CV7A 3SE0A 1PYWD 2CVRA 3I4NB 2XNAC 4RA8A 3L9AX 3VA7A 1I6VC 4PMCA 1HHVA 4IN3A 1HFGA 2J4XA 1D5MC 4KMUC 1PTOH 1FD7D 1PZID 1I4QA 3R2TA 2JA5B 2B8FA 2PMZB 1M4VA 1S5BD 3K59A 3PIP3 1OXVA 1TIID 4XQQA 4FF3A 4QCLA 1V43A 4AYBB 4EVOA 1S5FD 1OXUA 2K33A 5D3DA 2E2DC 1A15A 1EYAA 3K5OA 2A5HA 5IGEA 2IJ0A 1LTSD 1TWGB 2E75C 4MIUA 3RLFA 3NHHA 3QB3A 4WJWA 4WORA 1FYCA 3M7GA 2ICEC 2KCNA 2PZUA 1ET9A 3ONAB 1CHPD 4KHZA 2CW0C 2XWJB 1AZPA 5IGFA 3E0JA 3RD4A 5I2YA 2PPBC 2KOLA 2FMCA 4OO1H 2E74C 5M5XB 1O7LA 3GV3A 1G291 2V4DA 3H3VC 4ODGA 1WD0A 4KJOA 1JORA 1BO0A 2MPMA 4WFN3 1DONA 1OO9B 4H44C 2F0TA 1SYBA 4O42A 1E2WA 4FF2A 5LL6S 2F0NA 2SNMA 2ZT9C 2PCFB 3T51B 5LL6X 3GD7A 1BCPC 1FGBD 3FKIB 1F2YA 1YNNC 3H0GB 4C3JB 1EFID 4CJ0B 1YNND 3OHXC 2EXZA 2F0JA 2C5CA 1PFBA 4NDXA 3VR3A 2IT1A 1II3A 3MZ5A 5C3EB 1K8OA 5FLXE 2LMCB 4K5WA 1I4GA 1JOOA 2L5TA 1H9SA 1SJED 2D5DA 1B9MA 1NCVA 3VYUA 5CV4A 4A3IB 1BCPB 3TZDA 1MI2A 2JA7B 3SK5A 3A8KE 3BYYB 5C5LA 2K5DA 2I46A 5F2DA 2EPBA 1RCVD 2WAQB 5IODA 1JOKA 1SYCA 1TS2A 3C46A 5J22A 3S1QB 3K6OA 4DK0A 1M8AA 2A68C 2L55A 4FXDA 1A2TA 1KAAA 2CQAA 1Q1EA 1Y8OB 1WCMB 3MHBA 4RFBA 1IL8A 2EDGA 3IL8A 1TY0A 4XQJA 4LJZC 3P1HA 3KLSX 1CI3M 1LTTD 3H91A 1B9NA 1RTNA 2WINB 1B44D 1W6KA 4J6HA 3J81E 5C44B 2A69D 5ISRA 3Q0AA 1SNPA 1VMCA 2L11A 3NTHA 3HRZC 1DJRD 4Y7NB 2B2WA 5E1FA 2YU9B 1CZGA 3CKIB 3RZDB 1H9KA 3KBGA 1ILQA 2Z4HA 4K2LA 1ESRA 3HKZB 2KQ3A 3MFGA 1J8IA 1BR9A 4FXGC 1UNSA 3OOCA 4RH6A 3E5SA 2XRSD 2K7VA 3MXPA 3P20A 3I73A 1TS5A 2CHBD 1PRTF 1SYGA 1TQOA 1C48A 3NUCA 1STEA 3QOLA 1PMRA 1CA6A 3JAME 4H0LC 2KECA 4QUFA 1Z7TA 1UAPA 1PTOC 1QJOA 5C6AA 2FJ2A 1LT3D 1PTOD 5CORA 1DCZA 4OL7A 2EYOA 2BDNA 4A93B 2JSOA 1STBA 2IX0A 2VB2X 1KABA 3IAYA 4KD4A 1V1PA 3GTGB 1HUMA 2D62A 5IGBA 1Y69U 5CV8A 3MC0B 3FMCA 2JP1A 3D4WA 2EY2A 4RGNA 1BQQT 2JEAI 2Z4IA 5A2QL 1ZEQX 3LX0A 1MBYA 2R7ZB 1RJTA 2L4NA 3H94A 3D6WA 5KYLA 5KNDA 2LFNA 4K5XA 4RGMA 1SE4A 5K36H 5JAVA 4UDUC 4ZUIA 4EQOA 2NYZD 1OXXK 4DNRB 1U9RA 3TZUA 1G2TA 3FPPA 4KKSA 2D9UA 4A3EB 2O5IC 1B3AA 1KTKA 3L3OC 2K01A 3I8ZA 2HCIA 2HCCA 3EJIA 2PO4A 5IT9L 1V1OA 2TMPA 2NBFA 2K1BA 3SDZA 1IKLA 1SYEA 1Y8PB 3FVQA 1LTRD 4BBRB 2QDBA 5EPLA 1EY8A 1LTID 1RHPA 2MHVA 3PUXA 1QE6A 2JA6B 4OO1G 3UI2A 4ZRZA 2EZVA 4QIWB 1EOTA 4DAYA 2NVYB 3HOUB 1DM0B 2O5JC 1SNOA 3OMGA 2EJMA 4KD3A 2FHTA 3TP5A 1SMYC 3HOZB 1VDZA 1RD9D 3EROA 5I6YA 4LAAA 4ZQ3A 3IFTA 2BA1A 4XIGS 3J7YW 3PUZA 5EGTA 2WP8J 2G9DA 1LV9A 1UEAB 4F8MA 5CYUA 4ZK9B 4KKTA 3SR1A 3GTJB 1MD2D 4DXFA 4B08A 1ML0D 1ZYRC 3AMUA 2NVTB 4G57A 4KK7A 3LWEA 2Z1CA 2DY7A 2F0SA 2FINB 5EQ0A 2IWHA 4G7OC 5TSSA 1QB5D 3U9OA 3BDOA 4PNYA 2DN8A 2LKVA 3SK6A 3QJYA 1Q1BA 2K5QA 3ERQA 4TKOB 2XRQD 3GTKB 2NN6H 3Q6SA 1IYVA 1D2BA 2EY5A 1GUOA 2IW3A 2PQEA 1CQFA 1R9TB 2X69A 4C3HG 2K5WA 3M4YA 1G2SA 1TWAB 4KJNA 3J7AV 2RDHA 4K6DA 5JVH3 2MP1A 3KLSA 2ZXOA 1X32A 3GTQB 2FMMA 2KUMA 1VF7A 1STYA 2EYJA 5KGUA 4KHVA 3TP6A 1S5CD 1JR0D 3OMCA 2IX3A 2A6HC 4IUQA 4IFDH 3ITPA 5AFWA 5KNBA 4KN4C 1U4RA 1EEID 4ZUJA 3SK8A 3OSOA 4JBWA 1JICA 3DWQA 1S4ZA 3HP3A 5K5PA 3R93A 2A6EC 1DOMA 1STHA 2B2TA 4EQPA 2B2YA 4C2MB 1Q12A 3MVVA 5ELDA 1H9SB 4C56C 5FO8B 5IIFA 3S17B 4ZKBB 2MUYA 4HCSA 4R9WA 2RDGA 4S3SA 2JA8B 5DM63 5I6WA 3C3LA 4LMQD 4ME5A 3FRPB 2F0DA 2PNRC 3DWPA 4HSVA 4G7ZC 2KEEA 1F2MA 3TN2A 4B9WA 2EY6A 2SNSA 1JCKB 1CQVA 2ZXPA 2H4OA 2OT2A 1CT1D 4BY7B 4G7HC 2K03A 5E3FA 1ENFA 1CTMA 3SHLA 2C9OA 2B2WC 1IYUA 1EIHA 3DWAA 4FNFA 1TWCB 2L9HA 4WRDA 2B2VA 1I3QB 3KBXA 2CW0D 1H9MA 2EOTA 2X6LA 1SAPA 3DEPA 1EWHA 3BDLA 1BF4A 2EYLA 3MFYA 1F77A 1QNUA 2NTSA 2F03A 2KCCA 2R93B 4ABNA 1WTWA 5K36G 1STGA 1H9RA 4N9TA 1QOHA 3Q24A 2F0GA 2Q8IB 2QKIC 5C0XI 3K5MA 3MTSA 1BCPD 4J8QA 2L0CA 4HEDA 5E4WC 1SJHD 4C3JG 2WB1B 3FDTA 3I70A 1EY7A 5JEAH 3M7NA 4HR7B 3BS1A 4CKCA 4R8NA 1SNQA 2PW5A 2WIIB 3J80L 4NW2A 3M3YB 3V05A 2VUMB 1C4QA 1AW7A 4HCEA 2VNUD 3DEOA 1ZKOA 1STNA 1RF2D 4KV6A 1O7ZA 5E4XA 2IX1A 1KLGD 3N52A 2BOSA 5T1IA 3BYTB 2Q8RE 1V1PB 2VB3X 4BA1I 2B2UA 5BN5A 1A3UA 1EEFD 2I07B 3CQZB 3WOEA 1KDAA 2KHSA 3K7AB 4IUNA 1IW7C 1PRTC 2A68D 5FOBB 1B50A 4BWGB 1CA5A 4IURA 4X3TA 2KJXA 3BVGA 1SFOB 1ILPA 1F2ZA 3T4AC 3NE5B 2B39A 4V0BA 3I4MB 1B1ZA 1EZ6A 1RKNA 1I50B 4G4KA 1Q3LA 5CR3A 2EYFA 1GUSA 3OIQA 4C3IB 5C3WA 2LY7A 3R2IA 1O80A 5EKIA 2RKSA 4Q5VA 1U4MA 2K6AA 2AWNA 1EQTA 1PRTB 2OF1A 1QG7A 1HXYD 4DFAA 3CRKC 2EJGC 3HS0C 1SNDA 4PMWA 3BVMA 4M1UB 3SXHA 2A74C 2M9VA 1PFNA 2KA7A 3T13A 1EZ8A 5M3FB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR5 A;  2F0P A;  5IGF A;  2QDB A;  2PYK A;  4YIJ A;  4NP5 A;  1EY8 A;  1EY4 A;  2EY5 A;  3D4D A;  1STN A;  4KV6 A;  5J1Z A;  3TME A;  1A2T A;  4K5V A;  5C6A A;  1JOQ A;  2F0U A;  2NUC A;  4NKL A;  1EY5 A;  5NUC A;  1KAA A;  2SOB A;  4N9P A;  5E3F A;  1SYF A;  2PQE A;  5C4H A;  2PZT A;  4OL7 A;  4ODG A;  3C1F A;  4KJO A;  4KTA A;  4HTH A;  4DU9 A;  1JOR A;  3V2T A;  2F0H A;  3MHB A;  4RKB A;  2EYO A;  1NSN S;  2EY1 A;  3SHL A;  4EQN A;  2OXP A;  1IHZ A;  1SNM A;  1STB A;  3DMU A;  4TRD A;  2HQE A;  3T16 A;  4F7X A;  5I9O A;  1KAB A;  4KJN A;  1SNO A;  1SYB A;  2F0T A;  3OMG A;  4KD4 A;  4KD3 A;  2F0F A;  5DEH A;  5IGC A;  3TP5 A;  4K6D A;  2RDF A;  3NP8 A;  4QB4 A;  2O4X A;  4WRD A;  1EY0 A;  5IGB A;  1EY6 A;  5CV9 A;  5CV8 A;  1A3U A;  2F0N A;  3P1H A;  3HZX A;  5IGD A;  1ENA A;  1TT2 A;  2SNM A;  4K8I A;  3ERO A;  5CV7 A;  5M9O A;  1ENC A;  1KDA A;  4LAA A;  2KHS A;  1STY A;  4KY5 A;  2EYJ A;  5I6Y A;  5IGG A;  5KGU A;  2F0M A;  1EYC A;  1AEX A;  4IUN A;  2PW7 A;  4KHV A;  2F0K A;  1EYD A;  3C1E A;  4ZQ3 A;  3TP6 A;  4E6I A;  5CV5 A;  3S9W A;  3OMC A;  4NMZ A;  3OWF A;  3QOJ A;  3D4W A;  2EY2 A;  3ITP A;  5EGT A;  2ENB A;  4PMC A;  3EVQ A;  2F0Q A;  1F2Y A;  1EQV A;  3BDL A;  4HMI A;  2F0V A;  2EYL A;  4IAL A;  4J6H A;  5KYI A;  1SYD A;  5HGT A;  3LX0 A;  4RKL A;  4F8M A;  2F0E A;  1SNC A;  5CGK A;  4ZUJ A;  5ISR A;  3SK8 A;  3OSO A;  1SNP A;  2OEO A;  3DHQ A;  3SK4 A;  5KYL A;  2EYM A;  1F2Z A;  2EXZ A;  2F0J A;  5C5M A;  1KDC A;  4NDX A;  4IZ8 A;  5KEE A;  3SR1 A;  4B9X A;  1EZ6 A;  1KDB A;  4K5X A;  5E1F A;  5KRU A;  1RKN A;  3NQT A;  5K5P A;  5IOC A;  5CR3 A;  1A2U A;  1II3 A;  2EYF A;  3BDC A;  3MZ5 A;  5JAV A;  1NUC A;  5HUR A;  4ID6 A;  3HEJ A;  1STG A;  1STH A;  3NXW A;  1A3V A;  2PZW A;  4ZUI A;  4N9T A;  2RBM A;  5JOB A;  4K2L A;  4EQP A;  5KIX A;  2F0G A;  4EQO A;  5CV6 A;  3P75 A;  4DF7 A;  5C3W A;  2EYH A;  4K5W A;  3MVV A;  2KQ3 A;  3NK9 A;  4QMG A;  1JOO A;  5C4Z A;  4H7B A;  4EVO A;  1U9R A;  2M00 A;  2RKS A;  3MEH A;  3TP7 A;  3VA5 A;  4G57 A;  4KY6 A;  2WAC A;  5EKL A;  5IIF A;  1STA A;  3D6C A;  2F0S A;  3E5S A;  5CV4 A;  5I9P A;  4PMB A;  1EYA A;  3MXP A;  2OF1 A;  5CC4 A;  2F0W A;  5IGE A;  4I65 A;  2F0L A;  2F0O A;  4S3S A;  3SK5 A;  1EY7 A;  3EJI A;  4DFA A;  5C5L A;  3PMF A;  4K8J A;  4MIU A;  3U9O A;  5J39 A;  1SND A;  1SYG A;  3NHH A;  5F2D A;  1TQO A;  4PNY A;  3NUC A;  2F0I A;  2LKV A;  5I6W A;  3QB3 A;  1A3T A;  3QOL A;  3H6M A;  4J1M A;  4KY7 A;  4ME5 A;  3RUZ A;  3SXH A;  4K2K A;  4QF4 A;  4WOR A;  4R8N A;  1SNQ A;  2F0D A;  2PW5 A;  3R3O A;  4DGZ A;  5C3X A;  1JOK A;  5DAU A;  5IOD A;  1SYC A;  1EY9 A;  3SK6 A;  1F2M A;  3T13 A;  4B9W A;  5J22 A;  2F3W A;  2EY6 A;  2PZU A;  3D8G A;  2SNS A;  1EZ8 A;  1SYE A;  3ERQ A;  3TP8 A;  2F3V A;  4HMJ A;  4K14 A;  2EYP A;  5EKK A; 
#chains in the Genus database with same CATH topology
 3U4V A;  1HA6 A;  4YIJ A;  5A35 A;  4ME3 A;  1E2V A;  1YEZ A;  3TME A;  2IHE A;  3S15 H;  5CMD A;  4NKL A;  1EY5 A;  1NR2 A;  5GAH C;  1G51 A;  3PUY A;  4JI2 Q;  4X65 L;  4GOP A;  4HTH A;  4DAY B;  3K5L A;  3RMH A;  4FP5 D;  3T56 B;  4F7X A;  2JA8 H;  4JYA Q;  4DK1 A;  2JE6 I;  1JJ2 A;  3NSW A;  1VQK A;  4DV4 Q;  1WTQ A;  1PH7 A;  5EJW A;  1FVI A;  1IBL Q;  3PO2 H;  3PCO B;  1EY0 A;  3NTI A;  4JI7 L;  1F9P A;  1GJX A;  2H1E A;  3LNN A;  5M9O A;  3VR4 A;  5LMU Q;  2RVL A;  5FO7 B;  4ULL A;  2LS0 1;  4X3U A;  4X62 L;  4BY7 H;  1EYC A;  3I4L A;  2PW7 A;  3S9W A;  4E6I A;  5CV5 A;  2V1C C;  3D3R A;  1EOV A;  4JI5 Q;  1VF5 C;  1QNK A;  1B2T A;  2NN6 I;  3K58 A;  4X3K A;  2F0V A;  1PFM A;  5BN4 A;  3PO3 B;  4A3B H;  1IBK Q;  2F0E A;  3ND8 A;  4RAU C;  1S3O A;  1B53 A;  2QF7 A;  4JI1 Q;  4A93 G;  1D6E C;  2IPK D;  2QCP X;  5T1G A;  1UE1 A;  4IUU A;  5DNF A;  5C5M A;  4CJ2 C;  5C0X H;  1DZ1 A;  1E1O A;  2OTL A;  1I3Q H;  1PH3 A;  3BDC A;  2MJ8 A;  5M3M B;  1HH2 P;  4ID6 A;  3HEJ A;  3AB9 A;  5KIX A;  1CKM A;  4U67 3;  2EYH A;  5I4D A;  3MEH A;  3MWY W;  3A8J E;  1X56 A;  1EWC A;  2R6G A;  1PH2 A;  3BZD B;  3RR5 A;  4PMB A;  3GTM B;  3K57 A;  4XYO A;  2R7Z G;  4IFD I;  2PMZ E;  1N36 Q;  5G3L D;  3NWT A;  4K6L A;  1JJC B;  2K05 A;  3EA6 A;  1LTG D;  3HOW H;  4KY7 A;  2F3I A;  4L5Q A;  4XYQ A;  4OEL B;  3NWS A;  1MIU A;  1TWF H;  3ULJ A;  1HR0 L;  4AYB E;  4GKJ Q;  1K73 C;  3GDE A;  1HRJ A;  2K5V A;  2VW9 A;  1XNQ L;  4JC0 A;  1IBM L;  2E2H B;  4N9P A;  4KHP L;  4IJL A;  1XPR A;  3PSI A;  4A3E G;  2R92 B;  4B3T Q;  3C1F A;  1HNX L;  4X64 L;  4RGO S;  2F0H A;  2E2J H;  1SR3 A;  3D31 A;  3PF5 A;  3GTL B;  2J7Z A;  1BBX C;  4GN5 A;  3GTO B;  4J15 A;  2SDF A;  4TRD A;  3HG9 A;  4ALP A;  4POF A;  2E2I B;  2Q8T A;  5IGC A;  5EPK A;  3RLN A;  2B2T C;  5M5Y B;  2BCO A;  1PTO F;  2ZJQ A;  5C4J H;  1KRS A;  3ZYY X;  2VUM H;  4N8X 1;  1EYG A;  2K32 A;  4A3L H;  1EU4 A;  1PLF A;  1YHB A;  4CDC C;  5JVG 3;  2QIL A;  2E5L L;  2VQE L;  4BXX H;  4BBR G;  4A3J B;  4ZCK A;  4A3M B;  2JA6 G;  3V2T A;  1DD2 A;  2F0Q A;  1NR4 A;  1Y1W H;  1Q90 A;  2EXD A;  1S5D D;  4RKL A;  4FF4 A;  4A3D B;  3A54 A;  3HOU G;  5IP9 H;  3DUZ A;  4NPS A;  1K0R A;  4PZ7 A;  1KDC A;  4EX5 A;  4IZ8 A;  4XDX A;  1SMY D;  1VQ4 A;  4A3F B;  2AQ3 B;  3HOZ G;  1NUC A;  2B63 H;  3S16 B;  2JA9 A;  2Y0S E;  2RBM A;  2A1A A;  3P75 A;  4DF7 A;  4CHT B;  3K7A H;  2CWA A;  4IPH A;  2KCM A;  4UP7 A;  1A6X A;  2IL8 A;  4KY6 A;  1GUG A;  4RCO A;  3S14 B;  4LF4 Q;  4JI8 L;  3URY A;  4GZY C;  5IY0 A;  1H9J A;  4XT3 B;  4EQ5 A;  3CPF A;  4DV7 L;  2F0O A;  2HD3 A;  3EBE A;  4DV0 L;  4CDE C;  3F2U A;  1S5E D;  2NB0 A;  5JEA G;  4B3R Q;  2B2V C;  3GQB A;  2EE1 A;  4JPB W;  1D5X C;  4OIJ A;  4JBM A;  1HTL D;  1A3T A;  3GP7 A;  1E2Z A;  3S24 A;  5E7N A;  4KKU A;  5EBD A;  1VQO A;  4DR6 Q;  4C3I H;  4L5S A;  4DR4 L;  1YNX A;  1WTR A;  4L8J A;  5IT9 c;  1RDP D;  1ET6 A;  1ZYR D;  4LK1 C;  5EBC A;  3STB C;  1FNV A;  3G4S A;  2PYK A;  2KVM A;  4DR5 L;  1EY4 A;  3R8B A;  1Q8I A;  5IWA Q;  2GVB A;  1JOQ A;  1I4X A;  1D5Z C;  1JWU D;  1NSN S;  3GO5 A;  1FR3 A;  3VYS A;  1SNM A;  2RCF A;  3LWU A;  2HQE A;  3NEL A;  3PUV A;  5I9O A;  2C35 B;  1N32 L;  1TWH H;  2NZH A;  5CBE E;  3U4Z A;  4DNI A;  1BXT A;  4QB4 A;  1QVC A;  3I4O A;  4CBV A;  4MZ9 A;  3TSS A;  2EQS A;  4GNX A;  1TT2 A;  1VQJ A;  3TEH B;  5M3F H;  1TKW B;  2CKZ B;  1K83 B;  3VYR A;  5IGG A;  1YNJ C;  2DUD A;  1AEX A;  1CFM A;  2NTT A;  5IE8 A;  3M4O H;  1V8Q A;  3G7L A;  1IKM A;  5FK9 C;  1A63 A;  3TDQ A;  1EQV A;  4IAL A;  1I94 L;  5CBA E;  5AJ3 Q;  2IY5 B;  1JJG A;  2Q2H A;  4V19 0;  1HQM C;  2AWO A;  3F8T A;  5FLX L;  3GV6 A;  5A2Q E;  2N55 A;  1YJ9 A;  4B9X A;  5JPN C;  4A3K B;  4DUZ L;  5HUR A;  2PZW A;  1HFN A;  2SEB D;  3NBI A;  2RHS B;  3I91 A;  5C4Z A;  5L37 A;  4H7B A;  2M00 A;  3CC7 A;  2A6H D;  2XSC A;  4GN4 B;  1GUW A;  3M9B A;  1EL0 A;  2I0Q A;  1XPO A;  5EKL A;  3S2H B;  4IQZ A;  1VQG A;  5I9P A;  3PO3 H;  1ESF A;  1I4P A;  4X65 Q;  3WOF A;  3CPW A;  5FKA C;  3QWN A;  4I65 A;  4IPG A;  5ELE A;  4BY1 B;  3RZO B;  3P7J A;  4CGY B;  2B2U C;  1LUZ A;  3MA2 B;  1JC7 A;  4DR2 L;  4ZYS A;  4R4C A;  2AUK A;  1GXD C;  3HFZ B;  4QF4 A;  4JI0 L;  1JB3 A;  4XTC S;  3KK7 A;  2A6E D;  3HKZ E;  3TP8 A;  1VQ6 A;  1ZXT A;  2ZTE A;  1QZH A;  1VQA A;  2XWB B;  2B8G A;  1WTV A;  3S15 B;  3ND9 A;  3CCS A;  1TR5 A;  4UPA A;  2HDM A;  1XTD A;  2D0P A;  5NUC A;  2VY3 A;  2SOB A;  1SE3 A;  2N88 A;  3GTM H;  2Z6K A;  4IPC A;  5ELO A;  2OXP A;  1EFW A;  1JMC A;  3PIO 3;  3HOY H;  3PO2 B;  5GAE C;  4DV6 Q;  2JA8 G;  4KI0 A;  1KC8 C;  3OTO L;  4OIK A;  1W6J A;  1JT8 A;  4FF1 A;  2RDF A;  2XN9 C;  2NZO A;  2F1M A;  5IGD A;  4IO9 A;  4PQX A;  3K7U C;  1ENC A;  3J81 L;  3K5N A;  3PIP A;  1LTA D;  4BY7 G;  3S2D H;  4NMZ A;  5C0X J;  3KLR A;  2E2H H;  4A3B B;  3FEW X;  2BA0 A;  4FXK C;  3EVQ A;  3O13 A;  2UUB L;  4HMI A;  2R92 H;  1HNW L;  1SYD A;  2I5L X;  5HGT A;  1KNA A;  5CGK A;  1GHK A;  1EU3 A;  3KYH C;  1Y1V B;  1K8G A;  3GTO H;  1D1K A;  1QIL A;  1AP0 A;  1VQH A;  4EGV A;  4A76 A;  5C0X G;  4DR7 L;  3CHB D;  1KLU D;  4XQN A;  1OXT A;  3A7A B;  4C1N I;  5M5Y H;  3HOV B;  3NQT A;  1GHJ A;  2J0T D;  1OTC A;  1A2U A;  4RHS A;  1VQ5 A;  1VMP A;  1A3V A;  1HR0 Q;  3HKS A;  5CV6 A;  1K9M C;  4OHJ A;  1F9S A;  3JC6 6;  4QMG A;  3S1N H;  2NVX B;  2GA4 B;  3TP7 A;  3M85 A;  4DN4 M;  3QG1 A;  1IBM Q;  1QUQ B;  3D6C A;  4KHP Q;  1V9P A;  1L2F A;  4RCN A;  3CCQ A;  4A3D H;  3N6R A;  1HNX Q;  4X64 Q;  1R4P B;  3JAM L;  1XXG A;  1Y8N B;  3HOW B;  1YJW A;  3KJP A;  5J39 A;  2R93 G;  1TWF B;  3IFD A;  3RUZ A;  5C3X A;  2QEX A;  1AN8 A;  3W1G A;  2BE5 C;  4OEM B;  3X3M A;  1HUN A;  2E5L Q;  2N78 A;  3FHW A;  4L6T B;  2VQE Q;  1YI2 A;  1PHJ A;  2BE5 D;  3WDN A;  5IYB H;  3KUP A;  1X65 A;  2ASB A;  2Y0S B;  2E2J B;  4BBS H;  1PZJ D;  1JWM D;  2PZT A;  4GOP B;  4AH6 A;  3BZK A;  1F9Q A;  2EY1 A;  2WB1 G;  1Q7Y C;  3J81 c;  1DOL A;  2X6G A;  5C4J B;  2K5N A;  3AFP A;  1CK1 A;  2K4K A;  4DNT B;  2F0F A;  3TRE A;  2ZTD A;  5ELF A;  2AHO B;  3HZX A;  1LAC A;  3J7A F;  2VUM G;  4K0K L;  5I2X A;  2Q2I A;  1I4H A;  2F0M A;  3ER0 A;  1EUJ A;  1NAP A;  3QO2 A;  1Y1W B;  4BXX G;  4O2D A;  5M5W H;  2ENB A;  4QIW E;  4DAP A;  4ZLT F;  4JI8 Q;  5BN3 A;  1CZW A;  1PZK D;  1YJN A;  1SNC A;  4DV7 Q;  3C2P A;  5JJI A;  4DV0 Q;  3PV0 A;  3DHQ A;  3SK4 A;  3VYT A;  3K8A A;  4HIO A;  4YY3 L;  1L0W A;  3SEB A;  1TS3 A;  1X3Q A;  3I3C A;  2EJF C;  2B63 B;  1ASY A;  4HN7 A;  5KRU A;  4NXM L;  1SE2 A;  2MNA A;  2AQ2 B;  3Q23 A;  4DR4 Q;  2KED A;  5GQO A;  4JCV E;  1OXS C;  3JAM c;  1UUP A;  4F87 A;  1IW7 D;  1PRT D;  3U58 A;  4DR5 Q;  1U4P A;  1N33 L;  1XTC D;  5COY A;  4C1N K;  4U68 A;  3TBI B;  3G6J B;  1STA A;  1SBB B;  1SDF A;  2GVA A;  3K0Y A;  4UP8 A;  2UU9 L;  1F2L A;  2F0W A;  1IYJ B;  2F0L A;  3EQL C;  4YWK A;  3Q22 A;  5JJZ A;  4X3S A;  2CH4 W;  5BR8 L;  1N32 Q;  1G91 A;  3I4M G;  2L1B A;  1BCP F;  4J1M A;  1LT5 D;  2K04 A;  2E76 C;  4MHE A;  4DGZ A;  2ES2 A;  1C8C A;  5DM7 3;  1EY9 A;  1CM9 A;  4C3I G;  1TU2 B;  4IPD A;  4HAE A;  1AE3 A;  4PG3 A;  4Z9C B;  5FJ8 H;  2F3V A;  1ASZ A;  2JYO A;  1T5X D;  5EAY A;  4MTK A;  2A73 B;  1KQS A;  4DPG A;  2AQ1 B;  4RWS C;  4QGU A;  3CD6 A;  2HT1 A;  3EN2 A;  1SYF A;  4LF7 Q;  3CRL C;  1HQR D;  2PQA A;  2YV5 A;  1MSG A;  4KTA A;  2G9H D;  2MO0 A;  1KRT A;  1I94 Q;  3D4R A;  2A69 C;  4RKB A;  5ELB A;  2ZJR A;  4EQN A;  1TWH B;  3RN5 A;  2JXM B;  2KCT A;  3HOX B;  4JK1 C;  2Z8L A;  4ILW A;  2ID0 A;  1GO3 E;  1BOS A;  4QY7 A;  1SRO A;  1RIP A;  1Y14 B;  2NN6 G;  2NZ1 D;  1ICW A;  3M4O B;  4R4T A;  5M3F G;  1L0Y B;  2RSO A;  5LHY 1;  2NVQ B;  3DM1 A;  2MGS A;  2EVB A;  3TS2 A;  3OWF A;  3QOJ A;  3RLO A;  4RG1 A;  1AZQ A;  3I4N H;  1RTO A;  3A8I E;  3KDF A;  1K8M A;  3H15 A;  1KAW A;  3CXC A;  1X3P A;  3OPO A;  3S1M B;  2B3G A;  2AUJ D;  2OEO A;  1HCZ A;  4TSS A;  4A3G B;  3MXG A;  4IFD J;  1FNW A;  1F9R A;  2EYM A;  3OW2 A;  2HDL A;  3LGJ A;  1O7I A;  3W3A A;  4MN3 A;  5KEE A;  1D1I A;  1KDB A;  4JBK A;  1FJG L;  3W5O A;  4JI0 Q;  1PV4 A;  3KF8 A;  3I90 A;  3M4Q A;  2F4I A;  4POG A;  3K0X A;  5FLM G;  2JQO A;  1PXU A;  5D65 A;  4I7Z C;  4IFD G;  4LUZ A;  1K3B C;  3K81 C;  3NK9 A;  4IUV A;  2R3Z A;  1GD7 A;  1EIG A;  4RGT A;  5CC4 A;  3I55 A;  3PO3 G;  1H95 A;  2Q2T A;  2KEN A;  1HTP A;  1Y1V H;  5IYD G;  2JEB I;  4DXG A;  3BG3 A;  1QCB D;  1X54 A;  3T1H Q;  4K8J A;  3DXJ C;  1Z6H A;  1SEB D;  4LWC A;  2F0I A;  2ATW A;  2TSS A;  3OTO Q;  3HOV H;  3H6M A;  1TWG H;  4GNX C;  1MGS A;  4LF5 L;  2MQH A;  3R3O A;  4LF8 L;  3MXU A;  1ONL A;  5M3M G;  1WVL A;  3QIA A;  2UXB L;  1GUT A;  4CKE A;  1KIX A;  3D8G A;  4WJ3 M;  1A8V A;  3VR5 A;  1SXT A;  3ERS X;  2EYP A;  2D2C C;  1G6Z A;  1J9O A;  2NVX H;  3CU7 A;  1DYQ A;  3VR2 A;  2WKC A;  3J80 E;  3D4D A;  5J1Z A;  3A55 A;  4BA2 I;  3A5U A;  5C4H A;  2UUB Q;  2YYZ A;  1B4O A;  3HOY B;  3FPU B;  1HNW Q;  2A19 A;  2K14 A;  1NMG A;  2VQF Q;  1O78 A;  1PTO B;  1JQY D;  3V96 A;  5D14 A;  4L63 B;  3GTP B;  1K8A C;  3MXN A;  1GOZ A;  5IP7 H;  2O4X A;  4M8A A;  4JOI C;  4ZAI A;  4CKB A;  1PDQ A;  3BVZ A;  2VS1 A;  2VXW A;  5CV9 A;  3SVM A;  4HID A;  1ENA A;  4K8I A;  4TQU S;  3MAQ A;  4GNX B;  3S2D B;  3CW2 C;  4NXN L;  2XVS A;  4KY5 A;  4OON A;  1WTP A;  1VQ7 A;  2QDL A;  1HPC A;  2F0K A;  2QEJ C;  1VQI A;  1ROD A;  1V1Q A;  3CCU A;  4FO2 A;  1TVX A;  2A8V A;  4PV1 C;  4DK3 C;  2HHH L;  1LTB D;  3HGB A;  5KYI A;  4KN7 C;  2R92 G;  3E6Z X;  1LAB A;  2YTV A;  3TQY A;  1LO5 D;  3H0G H;  3L7Z C;  1I6H B;  2B2Y C;  2CWP A;  1I4R A;  4JI6 L;  3H3V H;  1LT4 D;  5IOC A;  2M2L A;  2RQX A;  1E3P A;  3NXW A;  4UAI A;  5JOB A;  3S1N B;  1PYB A;  4HSP A;  4A3C H;  1L1O A;  3T53 B;  3EFX D;  1HR0 W;  4DA2 A;  3I72 A;  2WV6 D;  1JWS D;  4A3J G;  1UE6 A;  4A3M G;  2XIW A;  5FO9 B;  4FYD A;  2ICI A;  2LXK A;  4A3D G;  3T1Y L;  4GLX A;  1M1K C;  4Q0F A;  3U9S A;  4A3I H;  3PMF A;  1XX8 A;  2ZM6 L;  5H1S E;  1AE2 A;  3NQI A;  4RHR A;  1VCI A;  3J7A 5;  4GN3 B;  4APV A;  4A3F G;  4OGQ C;  3OW7 A;  5JEA J;  2F3W A;  1DOK A;  1UE7 A;  1BNZ A;  3TRZ A;  4K14 A;  1XNR L;  4DAV A;  2DJG C;  4BBS B;  1SSO A;  5G3L F;  2DNC A;  1PVO A;  1TS4 A;  3AU7 A;  3NPP A;  4HJ9 A;  2O2L D;  1PA6 A;  1G8Z D;  5ELC A;  1LT6 D;  3A56 A;  2F0U A;  2NUC A;  5IYB G;  4QL5 A;  3VR6 A;  2WB1 E;  4BS9 A;  1U4L A;  4DU9 A;  1FL0 A;  3IKJ A;  3NTK A;  1T5E A;  2BDO A;  3CCM A;  4Y52 H;  1IHZ A;  1WCM H;  3T16 A;  2ZXR A;  1VQN A;  4OXP A;  4YY3 Q;  4OWX B;  5KNC A;  4R1J A;  4OO1 I;  4IUT A;  2UUC Q;  3NP8 A;  4NXM Q;  1BBU A;  1AFP A;  4QUC A;  1HNZ L;  1EY6 A;  2K28 A;  1HZB A;  1DXM A;  4P2C B;  1MSH A;  1WD1 A;  1HA5 A;  5M5W B;  2R61 A;  3STB D;  3C1E A;  1EYD A;  1WTH A;  1PH8 A;  1LLR D;  4F88 A;  1N33 Q;  4YCW A;  4XT1 B;  4R8I A;  1BDO A;  2UU9 Q;  2DNE A;  2L12 A;  2WAQ E;  3KF6 A;  3NEM A;  1BVS A;  4FVM A;  1YHA A;  1WTX A;  2CCZ A;  3I56 A;  5C4X B;  3AQQ A;  4L5T A;  1Q82 C;  2RSN A;  3E0E A;  3W2D A;  3HOX H;  5JPM C;  2DY8 A;  5BR8 Q;  5ELN A;  3DLL A;  2R7D A;  1CHQ D;  4O1N A;  3AFQ A;  4CJ1 B;  3L2P A;  3NBH A;  2NVQ H;  2I5M X;  1YNJ D;  1X3F A;  1HZC A;  1VS0 A;  3VA5 A;  5EPJ A;  2WAC A;  3H09 A;  4PZ8 A;  1XYI A;  1WTO A;  4H13 C;  4C3H B;  3K80 C;  3S1M H;  4ZKC B;  4LF6 Q;  4A3G H;  1BUV T;  4HJ8 A;  2NWG A;  3I2Z A;  1VQB A;  2WKD A;  1TY2 A;  4O0A A;  2E8G A;  1E0B A;  4JI3 L;  4K2K A;  2RA4 A;  5DAU A;  4A3K G;  1JE4 A;  1L0X B;  4IUP A;  4HMJ A;  3CCL A;  1FNU A;  1QWY A;  5EKK A;  1GUN A;  1R4Q B;  2F0P A;  2HUG A;  3OIP A;  4XXE A;  4NP5 A;  2K75 A;  3S1R B;  4K5V A;  2FFK B;  1KNE A;  1Z47 A;  1C9O A;  3X3N A;  4JW0 A;  3PUW A;  1TXY A;  3BZC A;  3DMU A;  4BY1 G;  4DV5 L;  1YZ6 A;  1XWE A;  4JI7 Q;  4A93 H;  5DEH A;  5D3I B;  5IT9 E;  4DV4 L;  1D8L A;  3OWE B;  1O7Y A;  4X62 Q;  3A7L A;  3GTG H;  5CV7 A;  3SE0 A;  1PYW D;  2CVR A;  1WFQ A;  3I4N B;  2XNA C;  4KLK A;  1NY4 A;  4RA8 A;  3L9A X;  3VA7 A;  2VL6 A;  1I6V C;  4PMC A;  1HHV A;  4IN3 A;  2R7F A;  1HFG A;  2J4X A;  1D5M C;  4KMU C;  1PTO H;  1FD7 D;  1VQD A;  1PZI D;  2RCN A;  1I4Q A;  3GTP H;  3PO2 G;  1IBK L;  3R2T A;  2R7Z H;  2JA5 B;  2B8F A;  1KHI A;  1B3Q A;  2PMZ B;  1M4V A;  4LF5 Q;  1S5B D;  2HIV A;  4LF8 Q;  1RL2 A;  3K59 A;  3PIO A;  1VQP A;  2UXB Q;  3PIP 3;  1OXV A;  5FLX c;  1VQ8 A;  1TII D;  4XQQ A;  5GAD C;  4FF3 A;  3KOJ A;  4QCL A;  1V43 A;  3EIV A;  4AYB B;  3PQI A;  3ULL A;  4EVO A;  1S5F D;  1OXU A;  2K33 A;  4P75 A;  4A3B G;  5D3D A;  2E2D C;  1A15 A;  1EYA A;  3K5O A;  2A5H A;  5IGE A;  1E22 A;  4P74 A;  2PNH A;  2F52 A;  1Y1V G;  2IJ0 A;  1E1T A;  1I6H H;  1LTS D;  1TWG B;  3E3X A;  2E75 C;  4MIU A;  3RLF A;  3NHH A;  4DR1 L;  2D0O A;  2LSS A;  3QB3 A;  4WJW A;  1LTL A;  3HOV G;  4WOR A;  1S40 A;  1N36 L;  1FYC A;  3M7G A;  2ZJP A;  1D7Q A;  2ICE C;  2KCN A;  4JI4 L;  2PZU A;  1ET9 A;  3ONA B;  4GOP C;  4NXN Q;  1CHP D;  1XNQ Q;  4KHZ A;  1HZ9 A;  2JK8 A;  2CW0 C;  2XWJ B;  1AZP A;  3IRB A;  5IGF A;  3E0J A;  3RD4 A;  5I2Y A;  2PPB C;  2UXD L;  2KOL A;  2FMC A;  4OO1 H;  2E74 C;  1S72 A;  5M5X B;  1O7L A;  3GV3 A;  1G29 1;  2HHH Q;  2V4D A;  3H3V C;  2PQA B;  4ODG A;  1WD0 A;  2I5H A;  4KJO A;  1JOR A;  1BO0 A;  2MPM A;  4WFN 3;  1DON A;  4QQB X;  3HOW G;  3QR8 A;  4LUV A;  1OO9 B;  3J80 i;  4H44 C;  2F0T A;  1SYB A;  4JI6 Q;  2NVY H;  4X66 L;  4O42 A;  3HOU H;  1LYL A;  5IP7 G;  1PH1 A;  1E2W A;  4FF2 A;  5LL6 S;  2F0N A;  2SNM A;  4HJ7 A;  2ZT9 C;  2PCF B;  1PH5 A;  3T51 B;  1XMO L;  5LMN L;  5LL6 X;  3GD7 A;  1BCP C;  1FGB D;  1SLJ A;  2Y0S G;  3FKI B;  1F2Y A;  1YNN C;  3H0G B;  3KDF B;  1MJE A;  4UHV A;  4C3J B;  2QW7 A;  1EFI D;  2RF4 A;  1QVG A;  3PF4 A;  4CJ0 B;  1DGS A;  3T1Y Q;  1WI5 A;  1YNN D;  3OHX C;  2EXZ A;  2F0J A;  2C5C A;  1PFB A;  2ZM6 Q;  4NDX A;  1UE5 A;  4R4I A;  3VR3 A;  1E24 A;  2IT1 A;  4HIK A;  1II3 A;  3MZ5 A;  5C3E B;  4A3L G;  3KF8 B;  3CME A;  1K8O A;  4GS3 A;  5FLX E;  2LMC B;  2HIX A;  3GTJ H;  1KXL A;  1XNR Q;  4K5W A;  4A3C G;  1I4G A;  1JOO A;  2L5T A;  1NTG A;  1H9S A;  1SJE D;  4DAM A;  1Y1W G;  1GM5 A;  1CSQ A;  2D5D A;  1B9M A;  1NMF A;  1NCV A;  3VYU A;  5CV4 A;  4A3I B;  2NVT H;  1BCP B;  3TZD A;  5IP9 G;  1MI2 A;  2JA7 B;  4AQY L;  5C4X H;  4LF4 L;  1CUK A;  3SK5 A;  3A8K E;  4LF9 L;  2PI2 A;  3BYY B;  2K5D A;  5C5L A;  2I46 A;  5F2D A;  1VQ9 A;  3CCR A;  2EPB A;  1RCV D;  2B63 G;  2WAQ B;  5IOD A;  1JOK A;  1SYC A;  1TS2 A;  3C46 A;  5J22 A;  1HNZ Q;  4B3S L;  2CH4 A;  3S1Q B;  3UE0 A;  1ICF B;  3K6O A;  1VQM A;  3H3V I;  4DK0 A;  4CDF C;  2H5X A;  1M8A A;  2A68 C;  2L55 A;  1P8L A;  4FXD A;  2OTJ A;  1A2T A;  1PYS B;  4IOC A;  1KAA A;  1GKH A;  2CQA A;  1VQL A;  1X55 A;  4C3H H;  1Q1E A;  1Y8O B;  3W1B A;  3G48 A;  1WCM B;  4P71 A;  3MHB A;  1NJI C;  4RFB A;  3AEV A;  1IL8 A;  4FDB A;  2EDG A;  2P5Z X;  1YHQ A;  1YIT A;  4DV1 L;  3MXN B;  1TWA H;  3IL8 A;  1TY0 A;  4XQJ A;  1IL2 A;  1L1O C;  2HQL A;  4LJZ C;  3P1H A;  3KLS X;  1CI3 M;  1LTT D;  1J5E L;  3H91 A;  2Q2U A;  1B9N A;  1RTN A;  3S1R H;  2WIN B;  1KL9 A;  5HGQ A;  1B44 D;  1W6K A;  4J6H A;  3J81 E;  5C44 B;  3OYY A;  2A69 D;  3F1Z A;  5ISR A;  3Q0A A;  4LUO A;  1SNP A;  1IXR A;  1NBW A;  1MHW C;  1VMC A;  2L11 A;  3NTH A;  3HRZ C;  4DUZ Q;  1DJR D;  3CAM A;  3HOX G;  4Y7N B;  2B2W A;  1YIJ A;  4MTN A;  4JI3 Q;  5E1F A;  1PFS A;  1CZG A;  2YU9 B;  3CKI B;  3RZD B;  4P73 A;  1H9K A;  3KBG A;  1EWI A;  1ILQ A;  3DM3 A;  2Z4H A;  4K2L A;  1ESR A;  1L1O B;  1X6O A;  3HKZ B;  3UDF A;  2KQ3 A;  1VQF A;  3MFG A;  1J8I A;  3CC2 A;  1BR9 A;  4FXG C;  4DUY L;  1CKO A;  1EIF A;  1UNS A;  4C2M H;  3OOC A;  2MFI A;  4RH6 A;  3E5S A;  2XRS D;  2K7V A;  3MXP A;  1SN8 A;  3P20 A;  4P72 A;  3S17 H;  4DR2 Q;  3I73 A;  1TS5 A;  4A3G G;  2CHB D;  4DV5 Q;  1PRT F;  1SYG A;  2JA5 H;  1TQO A;  1C48 A;  3NUC A;  2BH2 A;  1P16 A;  1STE A;  3QOL A;  1PMR A;  1CA6 A;  3JAM E;  4IJH A;  4H0L C;  2KEC A;  2K50 A;  4QUF A;  1Z7T A;  1UAP A;  2KHJ A;  2N3S A;  4NB3 A;  3UE1 A;  4GKK L;  3RNU A;  4R4Q A;  1PTO C;  3KFU A;  3U50 C;  2EIF A;  4B3M L;  1QJO A;  4DV3 L;  5C6A A;  2FJ2 A;  2GN5 A;  1LT3 D;  1PTO D;  5COR A;  3PGZ A;  1DCZ A;  4OL7 A;  3F2B A;  3BU2 A;  1Q81 C;  2EYO A;  2BDN A;  3A74 A;  4A93 B;  2JSO A;  1STB A;  2IX0 A;  2VB2 X;  1KAB A;  3IAY A;  4KD4 A;  1V1P A;  4PZ6 A;  3GTG B;  1HUM A;  1BKB A;  1WJJ A;  2D62 A;  4CDD C;  4DV6 L;  1XMQ L;  2QGQ A;  5IGB A;  1Y69 U;  1MJC A;  1TWC H;  5CV8 A;  1UEB A;  1YBY A;  3MC0 B;  3FMC A;  1WYD A;  4YHH L;  2JP1 A;  3D4W A;  2EY2 A;  4RGN A;  1BQQ T;  2PI2 E;  2KBN A;  5M5X H;  2JEA I;  2Z4I A;  5A2Q L;  1ZEQ X;  3HOY G;  3LX0 A;  1MBY A;  1Z9F A;  2R7Z B;  1RJT A;  2L4N A;  3H94 A;  3KF6 B;  4DR7 Q;  3D6W A;  5KYL A;  1AH9 A;  4HIM A;  5KND A;  2LFN A;  4DR1 Q;  4YCV A;  1CKN A;  4K5X A;  4RGM A;  1SE4 A;  4LW1 A;  2R93 H;  5K36 H;  5JAV A;  2AKW B;  4UDU C;  3J81 j;  4GLV B;  1MKH A;  4ZUI A;  3G71 A;  4JI4 Q;  3CF5 A;  4EQO A;  3NBH B;  2NYZ D;  1OXX K;  1B70 B;  3ULP A;  4DNR B;  1U9R A;  3TZU A;  1G2T A;  2UXD Q;  1B8A A;  3FPP A;  3CCV A;  3FKI H;  4KKS A;  2D9U A;  1N34 L;  4A3E B;  2O5I C;  3A5Z B;  1B3A A;  2YTX A;  1KTK A;  4C3J H;  1Q86 C;  3L3O C;  4LFA L;  2K01 A;  3I8Z A;  2HCI A;  2HCC A;  3EJI A;  2KHI A;  2PO4 A;  5IT9 L;  1V1O A;  2WFW A;  2TMP A;  2NBF A;  4X66 Q;  1SRU A;  5C3E H;  2K52 A;  2JJQ A;  2K1B A;  1GVP A;  1IKL A;  1SYE A;  1Y8P B;  3SDZ A;  2VZA A;  2Z6K C;  3D0F A;  4OX9 L;  3FVQ A;  3M3Y H;  1LTR D;  4BBR B;  2QDB A;  5EPL A;  1EY8 A;  1LTI D;  1XMO Q;  5LMN Q;  1RHP A;  2MHV A;  3PUX A;  1QE6 A;  2JA6 B;  4GLA C;  4OO1 G;  3UI2 A;  1T9H A;  4ZRZ A;  2EZV A;  4QIW B;  1EOT A;  2JA7 H;  4DAY A;  2NVY B;  3HOU B;  4DR3 L;  1DM0 B;  4IOA A;  2O5J C;  1JB7 A;  1SNO A;  3OMG A;  2EJM A;  4KD3 A;  2FHT A;  3TP5 A;  1SMY C;  4K0K Q;  3HOZ B;  3F2D A;  2L15 A;  4YWM A;  1VDZ A;  4A4I A;  3S1Q H;  1E7Z A;  1M90 C;  1RD9 D;  1PH6 A;  3ERO A;  1A62 A;  4LAA A;  5I6Y A;  3ZJY C;  4ZQ3 A;  3IFT A;  2BA1 A;  4XIG S;  2F4V L;  3J7Y W;  4BBS G;  3CQZ H;  4DV2 L;  1VQE A;  3PUZ A;  3VDY A;  5EGT A;  2WP8 J;  1EQQ A;  2G9D A;  1LV9 A;  1UEA B;  5IYC H;  4F8M A;  4AQY Q;  1XJV A;  4HJA A;  2MO1 A;  4LF9 Q;  5CYU A;  4H02 A;  4ZK9 B;  4KKT A;  3SR1 A;  1CSP A;  4LFB L;  1SFO H;  3GTJ B;  1QVF A;  3I4M H;  1MD2 D;  4DXF A;  4B3S Q;  1I50 H;  1SE8 A;  4B08 A;  1ML0 D;  1ZYR C;  3RN2 A;  3AMU A;  4LFC L;  2NVT B;  4G57 A;  4KK7 A;  3LWE A;  2Z1C A;  2DY7 A;  2F0S A;  2FIN B;  5C44 H;  5EQ0 A;  2IWH A;  4G7O C;  2N8N A;  5GRO A;  5C4X G;  5TSS A;  1QB5 D;  1K3R A;  2Z0S A;  3U9O A;  3BDO A;  4PNY A;  2DN8 A;  2LKV A;  4AIM A;  4Y7N H;  4DV1 Q;  2UXC L;  2YU9 H;  3RZD H;  1C0A A;  3SK6 A;  3QJY A;  1Q1B A;  2B29 A;  2K5Q A;  3ERQ A;  4A75 A;  4TKO B;  2XRQ D;  2JN4 A;  3GTK B;  2NN6 H;  3Q6S A;  1IYV A;  1D2B A;  1J5E Q;  3J7Z C;  1XPU A;  3E9I A;  2EY5 A;  1KD1 C;  1GUO A;  2OCE A;  3F2C A;  4N8F A;  2IW3 A;  2PQE A;  1PH9 A;  1CQF A;  1HJP A;  1R9T B;  2X69 A;  4C3H G;  2K5W A;  4OWW B;  4LF7 L;  4JV5 L;  3M4Y A;  3E9H A;  1G2S A;  1EQR A;  1HZA A;  1TWA B;  4KJN A;  3J7A V;  2RDH A;  2N49 A;  4K6D A;  1YVC A;  1IZ6 A;  5JVH 3;  5FJ8 G;  2MP1 A;  2UUA L;  3KLS A;  2ZXO A;  1X32 A;  3GTQ B;  2FMM A;  1X9N A;  2KUM A;  1VF7 A;  4QJF A;  1STY A;  4R4O A;  2EYJ A;  5KGU A;  2CFM A;  4KHV A;  5J3B A;  3TP6 A;  1S5C D;  1JR0 D;  5FLM H;  3OMC A;  2IX3 A;  2A6H C;  4DK6 C;  4IUQ A;  4DUY Q;  3UDG A;  4JOI A;  4IFD H;  5JJL A;  3ITP A;  5AFW A;  4YCU A;  4JI2 L;  5KNB A;  4TVA B;  2XGT A;  4KN4 C;  1U4R A;  1EEI D;  3TS0 A;  4L5R C;  4ZUJ A;  3SK8 A;  3OSO A;  4JBW A;  4JYA L;  1JIC A;  4RMF A;  1FJG Q;  5IYD H;  3DWQ A;  3UDX A;  1S4Z A;  3HP3 A;  1IBL L;  5K5P A;  3J81 i;  3R93 A;  4LNQ A;  2A6E C;  1FGU A;  1DOM A;  1STH A;  2Z9H A;  2B2T A;  4EQP A;  5LMU L;  3CC4 A;  4GKK Q;  2B2Y A;  4C2M B;  1Q12 A;  5M3M H;  3MVV A;  5ELD A;  1H9S B;  3I4N G;  4B3M Q;  4C56 C;  5FO8 B;  2FXQ A;  4JI5 L;  4DV3 Q;  2ALY B;  5IIF A;  3S17 B;  4ZKB B;  2MUY A;  4HCS A;  3CCJ A;  4R9W A;  4UY8 C;  2RDG A;  4JI1 L;  4S3S A;  2JA8 B;  5GAG C;  5DM6 3;  1QZG A;  5I6W A;  3C3L A;  4LMQ D;  2JA5 G;  4ME5 A;  3T1H L;  3FRP B;  2F0D A;  2PNR C;  1XMQ Q;  3DWP A;  4HSV A;  4G7Z C;  1EIY B;  1X3G A;  2KEE A;  1F2M A;  3TN2 A;  4B9W A;  4WJ4 A;  2EY6 A;  2SNS A;  1JCK B;  1CQV A;  4X6A H;  2ZXP A;  2H4O A;  2OT2 A;  1CT1 D;  4BY7 B;  4AYB G;  4G7H C;  1U0L A;  2QA4 A;  4YHH Q;  2K03 A;  3JAM i;  4MNO A;  5E3F A;  1ENF A;  4A3E H;  3G6E A;  2K5H A;  1CTM A;  3SHL A;  2C9O A;  2B2W C;  1IYU A;  1EIH A;  2VQF L;  3GTL H;  3DWA A;  2DGY A;  3FP9 A;  4FNF A;  1TWC B;  2L9H A;  4WRD A;  2B2V A;  1I3Q B;  3CMA A;  3KBX A;  2E2I H;  2YTY A;  4GKJ L;  1JE5 A;  2CW0 D;  1H9M A;  4BBR H;  3WWV A;  2EOT A;  2X6L A;  1SAP A;  3DEP A;  5JJK A;  2JA6 H;  1EWH A;  1N34 Q;  3BDL A;  1BF4 A;  2EYL A;  4B3T L;  4A3J H;  3MFY A;  4LFA Q;  1K28 A;  1F77 A;  1NNX A;  4A3M H;  1QNU A;  3Q8D A;  2NTS A;  2F03 A;  2KCC A;  2R93 B;  4ABN A;  1WTW A;  1N9W A;  3HOZ H;  4DKA C;  5K36 G;  1STG A;  1H9R A;  2OQ0 A;  4N9T A;  1QOH A;  4A3F H;  3Q24 A;  2F0G A;  1W2B A;  2Q8I B;  4OX9 Q;  3S16 H;  2QKI C;  5C0X I;  3K5M A;  3MTS A;  1BCP D;  2BH8 A;  1B7Y B;  4J8Q A;  2L0C A;  4HED A;  5E4W C;  3FKI G;  1SJH D;  1PH4 A;  3H0G G;  4HJ5 A;  3NEN A;  1G6P A;  4C3J G;  2WB1 B;  3FDT A;  3S14 H;  3I70 A;  1EY7 A;  5JEA H;  3M7N A;  4HR7 B;  4DR3 Q;  3A0J A;  3BS1 A;  4CKC A;  4R8N A;  1SNQ A;  2PW5 A;  2WII B;  5C3E G;  3J80 L;  1Q8K A;  4NW2 A;  1VQC A;  3V05 A;  3M3Y B;  4JVZ A;  2VUM B;  1C4Q A;  5DLQ E;  1AW7 A;  4HCE A;  2VNU D;  3DEO A;  2F4V Q;  1ZKO A;  1STN A;  1RF2 D;  4KV6 A;  4DV2 Q;  1O7Z A;  5E4X A;  3M4P A;  5LMN W;  1W3S A;  2IX1 A;  1KLG D;  4A3I G;  1K0S A;  3N52 A;  3BJU A;  2JA7 G;  1NE3 A;  2BOS A;  2DJF C;  5T1I A;  3BYT B;  2Q8R E;  4B3R L;  1UWV A;  1A0I A;  3MEF A;  1V1P B;  2Z6B A;  2VB3 X;  3AYH B;  2AMC B;  4LFB Q;  4JG2 A;  4BA1 I;  2B2U A;  4DR6 L;  2WAQ G;  5BN5 A;  1A3U A;  1BBW A;  2IHF A;  1EEF D;  2I07 B;  2UUC L;  3CQZ B;  3GTK H;  3WOE A;  1KDA A;  2KHS A;  3KLW A;  3K7A B;  4IUN A;  3SGI A;  1IW7 C;  1PRT C;  2A68 D;  2LXJ A;  5FOB B;  5IWA L;  3UDI A;  1J6Q A;  1K83 H;  5HY6 A;  3KJO A;  4LFC Q;  4UP9 A;  1B50 A;  1X3E A;  4BWG B;  1CA5 A;  1R9T H;  2XTI A;  1Q46 A;  4IUR A;  1WCM G;  1U5K A;  3ICE A;  4X3T A;  2KJX A;  5IYC G;  4YWL A;  3BVG A;  1SFO B;  1ILP A;  1F2Z A;  3T4A C;  3NE5 B;  2B39 A;  2G5D A;  4V0B A;  3I4M B;  1B1Z A;  1I5F A;  1EZ6 A;  1CKN B;  1RKN A;  2OWO A;  1I50 B;  4G4K A;  2UXC Q;  1Q3L A;  5CR3 A;  2EYF A;  3GTQ H;  1GUS A;  3OIQ A;  4C3I B;  1SMX A;  5C3W A;  2LY7 A;  3R2I A;  4A3K H;  2ZTC A;  1O80 A;  3B6Y A;  5EKI A;  2RKS A;  4Q5V A;  1U4M A;  3I7F A;  2K6A A;  1LM0 A;  1C7Y A;  1QUQ A;  1EQT A;  1PRT B;  2AWN A;  4I7A A;  2OF1 A;  3J80 c;  5C44 G;  1QG7 A;  5AJ3 L;  4JBJ A;  3S2H H;  1HXY D;  2RHQ B;  4JV5 Q;  4DFA A;  2CQO A;  3CRK C;  2EJG C;  3CP0 A;  3HS0 C;  1SND A;  4PMW A;  3BVM A;  4LF6 L;  4M1U B;  4BY1 H;  3RZO H;  3SXH A;  2A74 C;  2M9V A;  1PFN A;  3L0O A;  2KA7 A;  3CCE A;  2UUA Q;  3T13 A;  1WOC A;  4OWT B;  1EZ8 A;  5M3F B;  1N8R C;  2OQK A;  3HKZ G; 
#chains in the Genus database with same CATH homology
 1HA6 A;  4YIJ A;  5A35 A;  1E2V A;  3TME A;  5CMD A;  4NKL A;  1EY5 A;  1NR2 A;  3PUY A;  4HTH A;  3K5L A;  3RMH A;  4FP5 D;  3T56 B;  4F7X A;  4DK1 A;  2JE6 I;  3NSW A;  1WTQ A;  5EJW A;  1EY0 A;  3NTI A;  1F9P A;  1GJX A;  2H1E A;  3LNN A;  5M9O A;  3VR4 A;  2RVL A;  5FO7 B;  4ULL A;  2LS0 1;  4X3U A;  1EYC A;  3I4L A;  2PW7 A;  3S9W A;  4E6I A;  5CV5 A;  3D3R A;  1VF5 C;  1QNK A;  1B2T A;  2NN6 I;  3K58 A;  4X3K A;  2F0V A;  1PFM A;  5BN4 A;  3PO3 B;  2F0E A;  3ND8 A;  4RAU C;  2QF7 A;  1B53 A;  1D6E C;  2IPK D;  2QCP X;  5T1G A;  4IUU A;  5DNF A;  5C5M A;  4CJ2 C;  5C0X H;  1DZ1 A;  3BDC A;  2MJ8 A;  5M3M B;  4ID6 A;  3HEJ A;  3AB9 A;  5KIX A;  4U67 3;  2EYH A;  5I4D A;  3MEH A;  3MWY W;  3A8J E;  1EWC A;  2R6G A;  3BZD B;  4PMB A;  3GTM B;  3K57 A;  4XYO A;  4IFD I;  5G3L D;  3NWT A;  4K6L A;  2K05 A;  3EA6 A;  1LTG D;  4KY7 A;  4XYQ A;  3NWS A;  1HRJ A;  2E2H B;  4N9P A;  2R92 B;  3C1F A;  4RGO S;  2F0H A;  3D31 A;  3GTL B;  2J7Z A;  1BBX C;  3GTO B;  2SDF A;  4TRD A;  3HG9 A;  2E2I B;  2Q8T A;  5IGC A;  5EPK A;  2B2T C;  5M5Y B;  2BCO A;  1PTO F;  3ZYY X;  2K32 A;  1EU4 A;  1PLF A;  5JVG 3;  2QIL A;  4A3J B;  4A3M B;  3V2T A;  1DD2 A;  2F0Q A;  1NR4 A;  1Q90 A;  1S5D D;  4RKL A;  4FF4 A;  4A3D B;  3A54 A;  3DUZ A;  1KDC A;  4IZ8 A;  4XDX A;  1SMY D;  4A3F B;  2AQ3 B;  1NUC A;  3S16 B;  2RBM A;  3P75 A;  4DF7 A;  4CHT B;  1A6X A;  2IL8 A;  4KY6 A;  1GUG A;  4RCO A;  3S14 B;  4GZY C;  3URY A;  1H9J A;  4XT3 B;  2F0O A;  3F2U A;  1S5E D;  2NB0 A;  5JEA G;  2B2V C;  3GQB A;  2EE1 A;  1D5X C;  4OIJ A;  1HTL D;  1A3T A;  3GP7 A;  1E2Z A;  4KKU A;  5EBD A;  1WTR A;  4L8J A;  1RDP D;  1ET6 A;  1ZYR D;  4LK1 C;  5EBC A;  1FNV A;  2PYK A;  2KVM A;  1EY4 A;  3R8B A;  1Q8I A;  1JOQ A;  1I4X A;  1D5Z C;  1JWU D;  1NSN S;  3GO5 A;  1FR3 A;  3VYS A;  1SNM A;  3PUV A;  3LWU A;  2HQE A;  5I9O A;  5CBE E;  1BXT A;  4QB4 A;  4CBV A;  3TSS A;  1TT2 A;  1TKW B;  3VYR A;  1K83 B;  5IGG A;  1YNJ C;  1AEX A;  1CFM A;  2NTT A;  1V8Q A;  3G7L A;  1IKM A;  5FK9 C;  3TDQ A;  1EQV A;  4IAL A;  5CBA E;  4V19 0;  1HQM C;  2AWO A;  5FLX L;  3GV6 A;  5A2Q E;  2N55 A;  4B9X A;  5JPN C;  4A3K B;  5HUR A;  2PZW A;  1HFN A;  2SEB D;  3NBI A;  3I91 A;  5C4Z A;  4H7B A;  2M00 A;  2A6H D;  2XSC A;  1GUW A;  1EL0 A;  5EKL A;  3S2H B;  4IQZ A;  5I9P A;  1ESF A;  1I4P A;  3WOF A;  5FKA C;  3QWN A;  4I65 A;  5ELE A;  4BY1 B;  3RZO B;  3P7J A;  4CGY B;  2B2U C;  3MA2 B;  1JC7 A;  4ZYS A;  2AUK A;  1GXD C;  4QF4 A;  1JB3 A;  4XTC S;  3KK7 A;  2A6E D;  3TP8 A;  1ZXT A;  2XWB B;  2B8G A;  1WTV A;  3S15 B;  3ND9 A;  1TR5 A;  2HDM A;  5NUC A;  2SOB A;  1SE3 A;  2N88 A;  2OXP A;  3PIO 3;  3PO2 B;  4KI0 A;  4OIK A;  1W6J A;  4FF1 A;  2RDF A;  2XN9 C;  2F1M A;  5IGD A;  4PQX A;  1ENC A;  3J81 L;  3K5N A;  1LTA D;  4NMZ A;  5C0X J;  3KLR A;  4A3B B;  3FEW X;  2BA0 A;  4FXK C;  3EVQ A;  3O13 A;  4HMI A;  1SYD A;  5HGT A;  1KNA A;  5CGK A;  1GHK A;  1EU3 A;  1Y1V B;  1D1K A;  1QIL A;  1AP0 A;  4EGV A;  5C0X G;  3CHB D;  1KLU D;  4XQN A;  1OXT A;  3A7A B;  4C1N I;  3HOV B;  3NQT A;  1GHJ A;  2J0T D;  1A2U A;  4RHS A;  1VMP A;  1A3V A;  5CV6 A;  4OHJ A;  1F9S A;  4QMG A;  2NVX B;  2GA4 B;  3TP7 A;  3M85 A;  4DN4 M;  3QG1 A;  3D6C A;  4RCN A;  3N6R A;  1R4P B;  3JAM L;  1XXG A;  1Y8N B;  3HOW B;  5J39 A;  1TWF B;  3IFD A;  3RUZ A;  5C3X A;  1AN8 A;  2BE5 C;  3X3M A;  1HUN A;  4L6T B;  2BE5 D;  3WDN A;  3KUP A;  2Y0S B;  2E2J B;  1PZJ D;  1JWM D;  2PZT A;  1F9Q A;  2EY1 A;  1DOL A;  2X6G A;  5C4J B;  1CK1 A;  4DNT B;  2F0F A;  5ELF A;  3HZX A;  1LAC A;  3J7A F;  5I2X A;  1I4H A;  2F0M A;  3QO2 A;  1NAP A;  1Y1W B;  2ENB A;  4DAP A;  4ZLT F;  5BN3 A;  1CZW A;  1PZK D;  1SNC A;  3C2P A;  3PV0 A;  3DHQ A;  3SK4 A;  3VYT A;  3SEB A;  1TS3 A;  1X3Q A;  3I3C A;  2EJF C;  2B63 B;  4HN7 A;  5KRU A;  1SE2 A;  2AQ2 B;  3Q23 A;  2KED A;  1OXS C;  1UUP A;  4F87 A;  1IW7 D;  1PRT D;  1U4P A;  1XTC D;  5COY A;  4C1N K;  4U68 A;  3TBI B;  3G6J B;  1STA A;  1SBB B;  1SDF A;  3K0Y A;  1F2L A;  2F0W A;  2F0L A;  3EQL C;  3Q22 A;  5JJZ A;  4X3S A;  1G91 A;  2L1B A;  1BCP F;  4J1M A;  1LT5 D;  2K04 A;  2E76 C;  4MHE A;  4DGZ A;  1C8C A;  5DM7 3;  1EY9 A;  1CM9 A;  4C3I G;  1TU2 B;  4HAE A;  4Z9C B;  2F3V A;  2JYO A;  1T5X D;  2A73 B;  2AQ1 B;  4RWS C;  1SYF A;  3CRL C;  1HQR D;  1MSG A;  4KTA A;  2G9H D;  3D4R A;  2A69 C;  4RKB A;  5ELB A;  4EQN A;  1TWH B;  2JXM B;  3HOX B;  4JK1 C;  2Z8L A;  4ILW A;  2ID0 A;  1BOS A;  2NN6 G;  2NZ1 D;  1ICW A;  3M4O B;  1L0Y B;  2RSO A;  5LHY 1;  2NVQ B;  3DM1 A;  2MGS A;  2EVB A;  3OWF A;  3QOJ A;  1AZQ A;  1RTO A;  3A8I E;  1K8M A;  1X3P A;  3OPO A;  3S1M B;  2AUJ D;  2OEO A;  1HCZ A;  4TSS A;  4A3G B;  3MXG A;  4IFD J;  1FNW A;  1F9R A;  2EYM A;  2HDL A;  3W3A A;  4MN3 A;  5KEE A;  1D1I A;  1KDB A;  3KF8 A;  3I90 A;  2F4I A;  1PXU A;  5D65 A;  4I7Z C;  4IFD G;  3NK9 A;  4IUV A;  2R3Z A;  1EIG A;  4RGT A;  5CC4 A;  1HTP A;  2JEB I;  4DXG A;  3BG3 A;  1QCB D;  4K8J A;  3DXJ C;  1Z6H A;  1SEB D;  2F0I A;  2TSS A;  3H6M A;  1MGS A;  3R3O A;  3MXU A;  1ONL A;  1WVL A;  3QIA A;  1GUT A;  4CKE A;  3D8G A;  3VR5 A;  1SXT A;  2EYP A;  2D2C C;  1G6Z A;  1J9O A;  3CU7 A;  1DYQ A;  3VR2 A;  2WKC A;  3J80 E;  3D4D A;  5J1Z A;  3A55 A;  4BA2 I;  5C4H A;  2YYZ A;  1B4O A;  3HOY B;  3FPU B;  1O78 A;  3V96 A;  1JQY D;  1PTO B;  5D14 A;  4L63 B;  3GTP B;  3MXN A;  1GOZ A;  2O4X A;  4M8A A;  4ZAI A;  4CKB A;  1PDQ A;  3BVZ A;  2VXW A;  5CV9 A;  3SVM A;  1ENA A;  4K8I A;  4TQU S;  3MAQ A;  3S2D B;  2XVS A;  4KY5 A;  1WTP A;  1HPC A;  2F0K A;  2QEJ C;  1ROD A;  4FO2 A;  1TVX A;  4PV1 C;  1LTB D;  3HGB A;  5KYI A;  4KN7 C;  3E6Z X;  1LAB A;  1LO5 D;  3L7Z C;  1I6H B;  2B2Y C;  1I4R A;  1LT4 D;  5IOC A;  2M2L A;  2RQX A;  3NXW A;  4UAI A;  5JOB A;  3S1N B;  4HSP A;  3T53 B;  3EFX D;  4DA2 A;  3I72 A;  2WV6 D;  1JWS D;  2XIW A;  5FO9 B;  4FYD A;  2ICI A;  4Q0F A;  3U9S A;  3PMF A;  1XX8 A;  3NQI A;  4RHR A;  1VCI A;  4OGQ C;  3OW7 A;  5JEA J;  2F3W A;  1DOK A;  1BNZ A;  4K14 A;  4DAV A;  4BBS B;  1SSO A;  5G3L F;  2DNC A;  1TS4 A;  3AU7 A;  3NPP A;  2O2L D;  1G8Z D;  5ELC A;  1LT6 D;  3A56 A;  2F0U A;  2NUC A;  3VR6 A;  4BS9 A;  1U4L A;  4DU9 A;  3IKJ A;  3NTK A;  1T5E A;  2BDO A;  1IHZ A;  3T16 A;  2ZXR A;  5KNC A;  4OO1 I;  4IUT A;  3NP8 A;  1AFP A;  4QUC A;  1EY6 A;  2K28 A;  1DXM A;  4P2C B;  1MSH A;  1WD1 A;  1HA5 A;  5M5W B;  2R61 A;  3C1E A;  1EYD A;  1LLR D;  4F88 A;  4XT1 B;  4R8I A;  1BDO A;  2DNE A;  2L12 A;  4FVM A;  1WTX A;  5C4X B;  2RSN A;  3W2D A;  5JPM C;  2DY8 A;  1CHQ D;  4O1N A;  4CJ1 B;  3NBH A;  1YNJ D;  3VA5 A;  5EPJ A;  2WAC A;  3H09 A;  1XYI A;  1WTO A;  4H13 C;  4C3H B;  4ZKC B;  1BUV T;  2NWG A;  2WKD A;  1TY2 A;  1E0B A;  4K2K A;  2RA4 A;  5DAU A;  1JE4 A;  1L0X B;  4IUP A;  4HMJ A;  1FNU A;  5EKK A;  1QWY A;  1GUN A;  1R4Q B;  2F0P A;  2HUG A;  3OIP A;  4XXE A;  4NP5 A;  3S1R B;  4K5V A;  2FFK B;  1KNE A;  1Z47 A;  3X3N A;  3PUW A;  3DMU A;  1XWE A;  5DEH A;  5D3I B;  5IT9 E;  3OWE B;  1O7Y A;  3A7L A;  5CV7 A;  3SE0 A;  1PYW D;  2CVR A;  3I4N B;  2XNA C;  4RA8 A;  3L9A X;  3VA7 A;  1I6V C;  4PMC A;  1HHV A;  4IN3 A;  1HFG A;  2J4X A;  1D5M C;  4KMU C;  1PTO H;  1FD7 D;  1PZI D;  1I4Q A;  3R2T A;  2JA5 B;  2B8F A;  2PMZ B;  1M4V A;  1S5B D;  3K59 A;  3PIP 3;  1OXV A;  1TII D;  4XQQ A;  4FF3 A;  4QCL A;  1V43 A;  4AYB B;  4EVO A;  1S5F D;  1OXU A;  2K33 A;  5D3D A;  2E2D C;  1A15 A;  1EYA A;  3K5O A;  2A5H A;  5IGE A;  2IJ0 A;  1LTS D;  1TWG B;  2E75 C;  4MIU A;  3RLF A;  3NHH A;  3QB3 A;  4WJW A;  4WOR A;  1FYC A;  3M7G A;  2ICE C;  2KCN A;  2PZU A;  1ET9 A;  3ONA B;  1CHP D;  4KHZ A;  2CW0 C;  2XWJ B;  1AZP A;  5IGF A;  3E0J A;  3RD4 A;  5I2Y A;  2PPB C;  2KOL A;  2FMC A;  4OO1 H;  2E74 C;  5M5X B;  1O7L A;  3GV3 A;  1G29 1;  2V4D A;  3H3V C;  4ODG A;  1WD0 A;  4KJO A;  1JOR A;  1BO0 A;  2MPM A;  4WFN 3;  1DON A;  1OO9 B;  4H44 C;  2F0T A;  1SYB A;  4O42 A;  1E2W A;  4FF2 A;  5LL6 S;  2F0N A;  2SNM A;  2ZT9 C;  2PCF B;  3T51 B;  5LL6 X;  3GD7 A;  1BCP C;  1FGB D;  3FKI B;  1F2Y A;  1YNN C;  3H0G B;  4C3J B;  1EFI D;  4CJ0 B;  1YNN D;  3OHX C;  2EXZ A;  2F0J A;  2C5C A;  1PFB A;  4NDX A;  3VR3 A;  2IT1 A;  1II3 A;  3MZ5 A;  5C3E B;  1K8O A;  5FLX E;  2LMC B;  4K5W A;  1I4G A;  1JOO A;  2L5T A;  1H9S A;  1SJE D;  2D5D A;  1B9M A;  1NCV A;  3VYU A;  5CV4 A;  4A3I B;  1BCP B;  3TZD A;  1MI2 A;  2JA7 B;  3SK5 A;  3A8K E;  3BYY B;  5C5L A;  2K5D A;  2I46 A;  5F2D A;  2EPB A;  1RCV D;  2WAQ B;  5IOD A;  1JOK A;  1SYC A;  1TS2 A;  3C46 A;  5J22 A;  3S1Q B;  3K6O A;  4DK0 A;  1M8A A;  2A68 C;  2L55 A;  4FXD A;  1A2T A;  1KAA A;  2CQA A;  1Q1E A;  1Y8O B;  1WCM B;  3MHB A;  4RFB A;  1IL8 A;  2EDG A;  3IL8 A;  1TY0 A;  4XQJ A;  4LJZ C;  3P1H A;  3KLS X;  1CI3 M;  1LTT D;  3H91 A;  1B9N A;  1RTN A;  2WIN B;  1B44 D;  1W6K A;  4J6H A;  3J81 E;  5C44 B;  2A69 D;  5ISR A;  3Q0A A;  1SNP A;  1VMC A;  2L11 A;  3NTH A;  3HRZ C;  1DJR D;  4Y7N B;  2B2W A;  5E1F A;  2YU9 B;  1CZG A;  3CKI B;  3RZD B;  1H9K A;  3KBG A;  1ILQ A;  2Z4H A;  4K2L A;  1ESR A;  3HKZ B;  2KQ3 A;  3MFG A;  1J8I A;  1BR9 A;  4FXG C;  1UNS A;  3OOC A;  4RH6 A;  3E5S A;  2XRS D;  2K7V A;  3MXP A;  3P20 A;  3I73 A;  1TS5 A;  2CHB D;  1PRT F;  1SYG A;  1TQO A;  1C48 A;  3NUC A;  1STE A;  3QOL A;  1PMR A;  1CA6 A;  3JAM E;  4H0L C;  2KEC A;  4QUF A;  1Z7T A;  1UAP A;  1PTO C;  1QJO A;  5C6A A;  2FJ2 A;  1LT3 D;  1PTO D;  5COR A;  1DCZ A;  4OL7 A;  2EYO A;  2BDN A;  4A93 B;  2JSO A;  1STB A;  2IX0 A;  2VB2 X;  1KAB A;  3IAY A;  4KD4 A;  1V1P A;  3GTG B;  1HUM A;  2D62 A;  5IGB A;  1Y69 U;  5CV8 A;  3MC0 B;  3FMC A;  2JP1 A;  3D4W A;  2EY2 A;  4RGN A;  1BQQ T;  2JEA I;  2Z4I A;  5A2Q L;  1ZEQ X;  3LX0 A;  1MBY A;  2R7Z B;  1RJT A;  2L4N A;  3H94 A;  3D6W A;  5KYL A;  5KND A;  2LFN A;  4K5X A;  4RGM A;  1SE4 A;  5K36 H;  5JAV A;  4UDU C;  4ZUI A;  4EQO A;  2NYZ D;  1OXX K;  4DNR B;  1U9R A;  3TZU A;  1G2T A;  3FPP A;  4KKS A;  2D9U A;  4A3E B;  2O5I C;  1B3A A;  1KTK A;  3L3O C;  2K01 A;  3I8Z A;  2HCI A;  2HCC A;  3EJI A;  2PO4 A;  5IT9 L;  1V1O A;  2TMP A;  2NBF A;  2K1B A;  3SDZ A;  1IKL A;  1SYE A;  1Y8P B;  3FVQ A;  1LTR D;  4BBR B;  2QDB A;  5EPL A;  1EY8 A;  1LTI D;  1RHP A;  2MHV A;  3PUX A;  1QE6 A;  2JA6 B;  4OO1 G;  3UI2 A;  4ZRZ A;  2EZV A;  4QIW B;  1EOT A;  4DAY A;  2NVY B;  3HOU B;  1DM0 B;  2O5J C;  1SNO A;  3OMG A;  2EJM A;  4KD3 A;  2FHT A;  3TP5 A;  1SMY C;  3HOZ B;  1VDZ A;  1RD9 D;  3ERO A;  5I6Y A;  4LAA A;  4ZQ3 A;  3IFT A;  2BA1 A;  4XIG S;  3J7Y W;  3PUZ A;  5EGT A;  2WP8 J;  2G9D A;  1LV9 A;  1UEA B;  4F8M A;  5CYU A;  4ZK9 B;  4KKT A;  3SR1 A;  3GTJ B;  1MD2 D;  4DXF A;  4B08 A;  1ML0 D;  1ZYR C;  3AMU A;  2NVT B;  4G57 A;  4KK7 A;  3LWE A;  2Z1C A;  2DY7 A;  2F0S A;  2FIN B;  5EQ0 A;  2IWH A;  4G7O C;  5TSS A;  1QB5 D;  3U9O A;  3BDO A;  4PNY A;  2DN8 A;  2LKV A;  3SK6 A;  3QJY A;  1Q1B A;  2K5Q A;  3ERQ A;  4TKO B;  2XRQ D;  3GTK B;  2NN6 H;  3Q6S A;  1IYV A;  1D2B A;  2EY5 A;  1GUO A;  2IW3 A;  2PQE A;  1CQF A;  1R9T B;  2X69 A;  4C3H G;  2K5W A;  3M4Y A;  1G2S A;  1TWA B;  4KJN A;  3J7A V;  2RDH A;  4K6D A;  5JVH 3;  2MP1 A;  3KLS A;  2ZXO A;  1X32 A;  3GTQ B;  2FMM A;  2KUM A;  1VF7 A;  1STY A;  2EYJ A;  5KGU A;  4KHV A;  3TP6 A;  1S5C D;  1JR0 D;  3OMC A;  2IX3 A;  2A6H C;  4IUQ A;  4IFD H;  3ITP A;  5AFW A;  5KNB A;  4KN4 C;  1U4R A;  1EEI D;  4ZUJ A;  3SK8 A;  3OSO A;  4JBW A;  1JIC A;  3DWQ A;  1S4Z A;  3HP3 A;  5K5P A;  3R93 A;  2A6E C;  1DOM A;  1STH A;  2B2T A;  4EQP A;  2B2Y A;  4C2M B;  1Q12 A;  3MVV A;  5ELD A;  1H9S B;  4C56 C;  5FO8 B;  5IIF A;  3S17 B;  4ZKB B;  2MUY A;  4HCS A;  4R9W A;  2RDG A;  4S3S A;  2JA8 B;  5DM6 3;  5I6W A;  3C3L A;  4LMQ D;  4ME5 A;  3FRP B;  2F0D A;  2PNR C;  3DWP A;  4HSV A;  4G7Z C;  2KEE A;  1F2M A;  3TN2 A;  4B9W A;  2EY6 A;  2SNS A;  1JCK B;  1CQV A;  2ZXP A;  2H4O A;  2OT2 A;  1CT1 D;  4BY7 B;  4G7H C;  2K03 A;  5E3F A;  1ENF A;  1CTM A;  3SHL A;  2C9O A;  2B2W C;  1IYU A;  1EIH A;  3DWA A;  4FNF A;  1TWC B;  2L9H A;  4WRD A;  2B2V A;  1I3Q B;  3KBX A;  2CW0 D;  1H9M A;  2EOT A;  2X6L A;  1SAP A;  3DEP A;  1EWH A;  3BDL A;  1BF4 A;  2EYL A;  3MFY A;  1F77 A;  1QNU A;  2NTS A;  2F03 A;  2KCC A;  2R93 B;  4ABN A;  1WTW A;  5K36 G;  1STG A;  1H9R A;  4N9T A;  1QOH A;  3Q24 A;  2F0G A;  2Q8I B;  2QKI C;  5C0X I;  3K5M A;  3MTS A;  1BCP D;  4J8Q A;  2L0C A;  4HED A;  5E4W C;  1SJH D;  4C3J G;  2WB1 B;  3FDT A;  3I70 A;  1EY7 A;  5JEA H;  3M7N A;  4HR7 B;  3BS1 A;  4CKC A;  4R8N A;  1SNQ A;  2PW5 A;  2WII B;  3J80 L;  4NW2 A;  3M3Y B;  3V05 A;  2VUM B;  1C4Q A;  1AW7 A;  4HCE A;  2VNU D;  3DEO A;  1ZKO A;  1STN A;  1RF2 D;  4KV6 A;  1O7Z A;  5E4X A;  2IX1 A;  1KLG D;  3N52 A;  2BOS A;  5T1I A;  3BYT B;  2Q8R E;  1V1P B;  2VB3 X;  4BA1 I;  2B2U A;  5BN5 A;  1A3U A;  1EEF D;  2I07 B;  3CQZ B;  3WOE A;  1KDA A;  2KHS A;  3K7A B;  4IUN A;  1IW7 C;  1PRT C;  2A68 D;  5FOB B;  1B50 A;  4BWG B;  1CA5 A;  4IUR A;  4X3T A;  2KJX A;  3BVG A;  1SFO B;  1ILP A;  1F2Z A;  3T4A C;  3NE5 B;  2B39 A;  4V0B A;  3I4M B;  1B1Z A;  1EZ6 A;  1RKN A;  1I50 B;  4G4K A;  1Q3L A;  5CR3 A;  2EYF A;  1GUS A;  3OIQ A;  4C3I B;  5C3W A;  2LY7 A;  3R2I A;  1O80 A;  5EKI A;  2RKS A;  4Q5V A;  1U4M A;  2K6A A;  2AWN A;  1EQT A;  1PRT B;  2OF1 A;  1QG7 A;  1HXY D;  4DFA A;  3CRK C;  2EJG C;  3HS0 C;  1SND A;  4PMW A;  3BVM A;  4M1U B;  3SXH A;  2A74 C;  2M9V A;  1PFN A;  2KA7 A;  3T13 A;  1EZ8 A;  5M3F B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...