4ILWA

Complex of matrix metalloproteinase-10 catalytic domain (mmp-10cd) with tissue inhibitor of metalloproteinases-2 (timp-2)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metalloproteinase inhibitor 2
publication title Matrix Metalloproteinase-10/TIMP-2 Structure and Analyses Define Conserved Core Interactions and Diverse Exosite Interactions in MMP/TIMP Complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ilwA02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 4ilwA01
2TMPA 3OHXC 3FRPB 3KLSA 2WIIB 2QKIC 2XWBB 2XWJB 1PXUA 3MA2B 3V96A 1JB3A 5FO8B 5JPMC 1BQQT 2E2DC 3HRZC 2A73B 2ICEC 5JPNC 1BUVT 2J0TD 2B39A 3I70A 4FXKC 4ILWA 1UAPA 1JC7A 3HS0C 3G6JB 2WINB 3L3OC 3T4AC 1OO9B 3CU7A 1D2BA 5FO7B 4FXGC 1XWEA 5FO9B 1BR9A 1GXDC 2A74C 3CKIB 5FOBB 2I07B 1UEAB
chains in the Genus database with same CATH superfamily
2KEDA 4JCVE 5C4XG 1AH9A 2N49A 3CP0A 4R4CA 2LSSA 3ITPA 4XQNA 1U0LA 2VB3X 3S15B 1FJGL 2HQLA 3I4NH 4ME3A 2P5ZX 2ASBA 4MHEA 1VF7A 2RF4A 4ZAIA 3S2HB 2PQAA 1IBLQ 4A3JH 1JC7A 2V1CC 4F87A 1JB7A 3C2PA 4OWWB 2EJFC 4G7OC 1K73C 2VNUD 1WD0A 2I5HA 2MO1A 2PPBC 2HDMA 2EXDA 2JXMB 1S40A 1TWGH 1E2VA 2C9OA 4KKTA 1PZKD 4KKUA 2JA5G 4K8JA 1QUQA 4BBRB 1LTID 4FYDA 4C1NK 2B63G 5IYBH 2O5IC 3A7AB 2VQFQ 2G9DA 2R92H 3FMCA 4A3IH 2HCIA 2F0DA 3T51B 3BS1A 4A76A 4DR4Q 1X3FA 1IBKQ 3F2DA 2JYOA 1M1KC 4YWLA 3VA7A 3PO3B 1PYWD 1EEFD 3TS0A 1WTXA 3W1BA 4JI5L 3NTKA 1XNRQ 2D5DA 1AFPA 3CCUA 1S5DD 1UE1A 1KRTA 3GP7A 2LXKA 4HEDA 4IUPA 3S1MB 2CW0D 5IT9E 4DK0A 2M9VA 3FPUB 4IOCA 2KCTA 3S17B 1EIGA 2PZTA 4O2DA 1E2WA 2E75C 2R93G 3NQTA 4LF8L 3IL8A 2X69A 3E0EA 2UUBL 1VQDA 4G7ZC 4DV3Q 4FVMA 2F3VA 2GA4B 3R3OA 5LMNW 4HJ7A 1F9PA 3J81i 2QCPX 1E3PA 2MHVA 3HOXH 4LFBL 3NPPA 5EKLA 2Q8IB 1BUVT 4FXKC 2D0PA 5ELBA 4ZKCB 5D3DA 1O7LA 2CH4A 3G6JB 1ASYA 2ES2A 1FGUA 1XPOA 4K0KQ 5LMNL 4B9XA 5AJ3L 2K7VA 2FMCA 4AQYQ 2E2HH 1X32A 5J22A 2JA6B 2RDHA 4DV2Q 4IJLA 4PNYA 1T9HA 1SMYD 1DGSA 4A3MH 4AYBB 2K5VA 3C3LA 3RNUA 4L63B 3QOJA 2QGQA 4R8NA 1Q46A 4DV1L 5HY6A 4DV7L 4XQQA 2CWAA 3PQIA 3WOEA 4P72A 4A3GH 4JV5L 2PZUA 1YEZA 3E0JA 2XN9C 3K7AB 3F8TA 2BE5D 2WB1G 3T1HQ 2LFNA 1O7YA 5HGTA 1HNXQ 3IAYA 1D6EC 1YNND 3F2BA 2EYLA 2IY5B 1X3EA 2WAQB 2GVBA 3H0GH 3DWPA 2VUMG 1B50A 2ALYB 4N8FA 4DAPA 4RG1A 3U4VA 1BBWA 3VYTA 1WD1A 5H1SE 1A3VA 1A62A 4CDCC 1BBUA 1U4MA 2F0FA 3L9AX 3MFGA 4F88A 2R7ZG 3R8BA 1LT3D 1R4PB 5C0XI 1U4LA 2B2YA 4DNTB 5F2DA 4YY3Q 3QIAA 1F9SA 5IT9c 3J80i 1UNSA 1A2UA 1GKHA 2N55A 3HOVH 3DHQA 4DR4L 5M5XB 1IBKL 3PUYA 1SXTA 1TS3A 2KJXA 3HS0C 1MSHA 2LS01 1VQ6A 2N8NA 3CW2C 3QG1A 4YHHQ 3CKIB 4X3TA 4A3BG 4JBWA 2ATWA 3UDGA 1IW7C 3CQZB 3D8GA 2YU9H 1O78A 1BCPD 4X65L 5C0XH 1SNQA 1JICA 4OWTB 4DV5Q 1EY4A 1QNUA 3TP5A 1NR2A 4GOPC 2E2IB 1N33Q 4WORA 4JI0Q 3HKZG 4JI2L 3GTGH 4K2LA 3KF6A 3GTLH 2ZXPA 2WINB 3CCVA 2EYJA 1J5EQ 1V43A 4FNFA 2I46A 2EY6A 5EBDA 5J39A 2HIVA 5C3EG 1CHPD 2TMPA 1SLJA 1PH8A 5BN4A 1LTGD 4LAAA 1TWHB 4DV4Q 5CV8A 1AN8A 3S9WA 5JEAH 1N32L 3S15H 4IOAA 5D3IB 3RLOA 4KI0A 3K57A 2F0IA 5CV5A 2R7DA 3RD4A 4DV0L 3BU2A 4DUZL 3SK4A 1HNZL 3S2HH 1A63A 1KLUD 2B2UA 2JE6I 4LF9L 2ZJPA 5C4XB 3W5OA 2WAQE 4I7ZC 1EEID 3K7UC 2RVLA 1SNDA 1VQEA 2FFKB 4HR7B 2NBFA 5C0XJ 1NE3A 1UE5A 3CCEA 1J9OA 5CV7A 4BBRH 4CKCA 3CC2A 4OGQC 2K05A 2IW3A 3A54A 4DV6Q 4X62Q 2Z6KA 4LF6Q 4ZCKA 2XNAC 5EBCA 3GV6A 4BBSG 2EYOA 2R61A 1W3SA 4B3ML 2E5LL 3K5LA 5ELOA 1D1KA 3PIPA 2JA5B 3D6CA 2J4XA 2JA8G 1JQYD 2HIXA 1N8RC 4K5WA 4QJFA 3ONAB 3K5MA 1B2TA 5JEAJ 2V4DA 1X3GA 2A6HD 4N8X1 3TSSA 4ZUIA 1KRSA 2E74C 3S1MH 1V1PB 5IP9H 1ICFB 1WTPA 1P8LA 1G291 3BVZA 1CKOA 3AB9A 3S17H 1UWVA 4A3KG 1RF2D 1PRTC 1SNCA 3VR5A 1WTRA 1SE3A 3MXNA 3BVMA 1A15A 4MTKA 4S3SA 4H7BA 1EWCA 1TS4A 3ND9A 1BNZA 2BOSA 1FVIA 1VDZA 1N36Q 1AZQA 2VQEL 1EYDA 2F0OA 4I65A 5C44G 3UE1A 1HZ9A 4DV5L 4A3LG 4X3KA 1QUQB 4DR3L 2E76C 1SNMA 2PI2E 1OXVA 3S14B 4JI3L 2UXCL 4GLVB 1KIXA 1EQVA 5IGBA 1PTOD 2B8GA 5C6AA 1FNUA 2JA6H 5JAVA 1JB3A 5JPMC 4BWGB 1J5EL 4TQUS 3X3NA 1Q82C 1PH7A 2QDBA 1HA6A 1KDCA 2R6GA 5EGTA 1CZGA 5FLXE 5I2YA 4CJ2C 5I6WA 3OSOA 3AQQA 1OTCA 3B6YA 1DZ1A 4G57A 3K7AH 1MBYA 1ML0D 1H9SA 4UP8A 3FPPA 4NP5A 2AMCB 4JI7Q 4B3RL 4X66Q 1PLFA 5GAGC 1SYFA 3KK7A 4OWXB 1LABA 4K2KA 1YNJC 1S5CD 1BR9A 1I4HA 5FOBB 1XMQL 2WB1B 4ZYSA 4PZ7A 1ZYRC 3VA5A 4JOIA 3NUCA 3KDFB 2R7FA 4EQNA 3CC4A 5IIFA 3PIP3 5JVH3 3RLFA 4NW2A 3NSWA 4OELB 1EYCA 2ZM6L 4DAMA 4LF6L 3GTMB 1OXTA 2VUMB 3OMGA 2F4VQ 3Q6SA 5E4WC 1B3QA 1Q1EA 1EFID 3D4DA 4HTHA 5M5XH 2EY2A 3TEHB 5ELDA 2UUAQ 4IFDG 2FHTA 3GTOB 2R7ZB 4R9WA 4JI8L 3NWTA 3IRBA 4DR6Q 1CI3M 2I5LX 4NKLA 3MC0B 1SJHD 3CQZH 3VR4A 3OMCA 4DR1Q 1Q12A 2PCFB 1WJJA 1OXUA 1VQ7A 1KD1C 4H44C 4L5QA 1Y8NB 2EXZA 1G8ZD 2E2IH 1X9NA 2BA0A 1EY8A 3FEWX 4XYQA 4C3JG 1I5FA 2QA4A 4L8JA 1AEXA 4A3BB 4BXXH 3NQIA 3OYYA 5JJLA 4GN3B 2K32A 1NMFA 4QUCA 1NBWA 5IY0A 2MGSA 1JMCA 1TWHH 3HKZB 5I2XA 3NWSA 3IFDA 4KKSA 4GZYC 3V2TA 3AMUA 5FLXL 3GO5A 3OIQA 1VQMA 4NXMQ 1OXSC 5FLXc 1CSQA 2TSSA 5C3EB 1O80A 2YTYA 4NXNL 1H9JA 4RGTA 2HCCA 2BA1A 5M3MG 4K5VA 5C4XH 1YVCA 2EYPA 2L0CA 3KF8B 4TVAB 1R9TB 4FO2A 3DWQA 1VF5C 4LUOA 2Q2UA 1EY0A 2XWBB 3G48A 5FK9C 2IWHA 2WB1E 3BG3A 3GV3A 4XT3B 2A6EC 3I91A 4LF5L 5A2QE 1K3BC 4DKAC 1SE8A 4L5RC 1GO3E 1STHA 2OQ0A 2KA7A 1STAA 2OQKA 4C1NI 4XXEA 2WKDA 1E0BA 1HHVA 3VDYA 2F52A 5FLMG 2UUCL 3KF6B 4CGYB 2JA5H 4X64Q 1PRTB 3BYTB 4OO1G 3E9HA 5M3FG 3KFUA 4DXGA 1LUZA 3PO2B 4DXFA 2XRQD 2Q2IA 1PFSA 3DXJC 1Y69U 2IX1A 3K0XA 4BBSB 2K52A 5IWAL 2X6LA 3QOLA 4BY7G 3S1QB 1U5KA 1HZAA 5CYUA 4JBMA 3NXWA 1E2ZA 2K04A 4QGUA 5JJKA 1B44D 4KN7C 1TQOA 1KNEA 3E6ZX 3UDFA 1TS5A 3KLSA 3QJYA 1TY2A 2N78A 4PZ8A 4XTCS 5CV6A 2K5QA 3J81E 4C2MB 4RWSC 1GUGA 1CZWA 1GUNA 4HJAA 3T1YL 3TDQA 2F0TA 2NWGA 1ENCA 3HOUB 3SEBA 1GUSA 1HH2P 1D7QA 4FF1A 2F0KA 2CVRA 3HKSA 1EFWA 1L0XB 3NENA 2A74C 4DR1L 4A3KB 2JEBI 4DGZA 3I70A 2VS1A 1A8VA 5C3XA 3J7YW 4YCWA 3CXCA 4JPBW 3S14H 4LF7L 1KLGD 2MFIA 1M4VA 3I73A 4NPSA 3JAMi 1I94Q 4ODGA 1XMOQ 1Q86C 5IYCH 1NJIC 3Q23A 3T4AC 5C44B 1A0IA 1O7IA 5GADC 2BH8A 2KHSA 2K01A 1K83B 5EAYA 2SEBD 2CH4W 4G4KA 4FF3A 4JI6Q 4ZQ3A 3OTOL 3OIPA 1VQBA 4RKBA 1EIHA 2OWOA 1SR3A 4GN4B 1XXGA 5A2QL 4HCEA 3M4OB 5JOBA 1E22A 2UXBL 3VYRA 2XTIA 1HTPA 1FNWA 2KCMA 2KBNA 3S24A 2EE1A 3LWUA 1J8IA 1C48A 1UE6A 2F3WA 2A5HA 4ZRZA 3I4OA 1CTMA 1XJVA 2B2TA 2PW5A 3A55A 4J8QA 2K03A 2JEAI 1HXYD 5CC4A 1MGSA 3CHBD 3EJIA 2F0MA 3L2PA 4FF2A 1GHJA 2RSNA 2B2WA 4ABNA 2NTSA 4N9PA 2VUMH 3GTMH 3NELA 3I90A 5KNCA 3BDLA 1EOTA 3SK8A 1N34Q 3IFTA 2B2VA 2YV5A 4P74A 5FO9B 3KYHC 1RHPA 2R3ZA 3UDXA 3TMEA 1V9PA 3J81L 1EQTA 1T5XD 3ULLA 4RGOS 3J81c 2R7ZH 3GTOH 1EYGA 3IKJA 3HOWG 1JR0D 4OONA 3WDNA 2RCFA 4LFCQ 2QKIC 4DR7Q 3P7JA 3H94A 1WVLA 4A3CG 4OX9L 1QILA 3L3OC 1IBMQ 4H02A 1J6QA 1Y14B 3D31A 3L0OA 4DR5L 3GTQB 4A3BH 1GJXA 2EY5A 4CDFC 4Y7NB 4GNXB 2IPKD 1EYAA 2BE5C 3STBC 3TP8A 3LWEA 1S4ZA 2WKCA 4ALPA 1ZXTA 1U9RA 3SE0A 4GKJL 1F9RA 1SRUA 1D5XC 1HFGA 3FDTA 1YNNC 2JK8A 1HRJA 1KDAA 2EJMA 4UPAA 4C3JB 4O42A 2B39A 5ELFA 2A69C 3TZUA 2CCZA 4QCLA 2QF7A 1B8AA 3P75A 3M7NA 4EQPA 4KV6A 2Y0SG 1QNKA 1O7ZA 4R4IA 5C3EH 1NSNS 1RL2A 4KHPL 2AUJD 3FKIG 2IX0A 1HNWQ 3I4LA 2ID0A 4LF4Q 1HPCA 3AYHB 4CDEC 5KRUA 1F2ZA 5KYIA 4JG2A 5LL6X 1R9TH 1X55A 1VQ8A 2UU9L 1A6XA 2WP8J 2NZ1D 2IHFA 5EPJA 4DU9A 3HGBA 1I4QA 4YCUA 1KC8C 1HQMC 4UDUC 5M3MB 1KL9A 3I4MB 5M5YB 2MO0A 2I07B 3CAMA 1V8QA 3OHXC 2ZTEA 1STNA 3JC66 2N3SA 1I6VC 1DONA 1VMPA 2NVTB 1TIID 1HJPA 1IBLL 4WJ4A 1ESFA 3M4QA 1PYBA 4UY8C 3K5NA 3HZXA 1SE4A 1E24A 2A73B 1YI2A 1Y1WG 1I50B 4ILWA 1VQAA 2G5DA 3A5UA 5IP7G 4JW0A 3PO2H 5BR8Q 1Q90A 1CFMA 1TWFB 4FP5D 2EJGC 1B1ZA 2WFWA 4FDBA 4BBSH 3ZYYX 1G51A 5CV9A 3S1QH 3TN2A 5I6YA 1WCMB 1L1OA 2UXDQ 2VQFL 1VQJA 5IT9L 5M3FB 1SSOA 2PYKA 4YIJA 2RSOA 5IYBG 4OEMB 2HDLA 1I6HB 2JJQA 2R92G 3HOUH 2WV6D 1B4OA 1YHBA 4ZLTF 3PMFA 1XNRL 5EPKA 3ULPA 4A3KH 5KNBA 5ISRA 3D4RA 1MIUA 1A2TA 2EZVA 3KBXA 3I7FA 3U50C 4M8AA 3DEPA 1LO5D 1I3QB 4IPGA 1JE4A 1Q81C 1IXRA 2MJ8A 1PH1A 1V1OA 3HOZB 1G6ZA 5IGGA 1PH2A 4DV3L 1TXYA 1KTKA 1IZ6A 1TU2B 5C44H 1TS2A 4R4QA 4A3LH 4RGNA 1IYUA 4BA1I 3J7A5 1LTAD 1K83H 4EX5A 1ENFA 4J1MA 3VR3A 2D9UA 3U58A 1X6OA 2K5DA 1YBYA 1BQQT 2H4OA 1MHWC 4PZ6A 2L15A 2JA7G 3M3YB 4K0KL 1XNQQ 2A6HC 1HR0Q 4AQYL 5C4ZA 3TREA 1RKNA 2VB2X 1RTNA 4IPDA 4MIUA 2D2CC 3GTPB 1H95A 3S1RB 4ID6A 2F0HA 5E1FA 5IGDA 4DV2L 1DYQA 1EZ8A 4HIKA 2IL8A 5A35A 1Z6HA 4O0AA 4IUTA 3MHBA 4HJ5A 4A3MG 4JYAQ 1EY6A 4UP7A 1YJWA 1JOQA 1PH4A 1VQHA 4RCNA 5GROA 3BZKA 2E2JB 1PH3A 1ENAA 2GN5A 3ND8A 3BJUA 1STEA 2B2YC 3CRLC 1DCZA 3T1HL 1BF4A 4A3GG 3SR1A 2FJ2A 2PW7A 2CQOA 3OWEB 4E6IA 1HNXL 4IFDI 3D3RA 2F0SA 1SYBA 4I7AA 3A5ZB 4RHRA 1Q8IA 5IGFA 2HQEA 4G7HC 1PTOC 3DM1A 1PXUA 3RZDB 3PO3H 2Z6BA 2OF1A 2B63B 1EQRA 4KHVA 3BVGA 3SVMA 1EU3A 3BZCA 2EQSA 4KD3A 2F0GA 3I72A 1LT4D 2AHOB 4IJHA 4IFDH 4YY3L 3K0YA 3NBIA 3PUWA 3GTQH 3FRPB 4Y7NH 3RMHA 1Q1BA 3BZDB 3R2TA 3TBIB 1CM9A 1G2SA 1IHZA 2PQAB 4RH6A 4B9WA 1STGA 2Q2HA 4YHHL 2Z1CA 1RIPA 5J3BA 4C3JH 1XPRA 4X3UA 4FXGC 3S16B 2F0NA 2F0QA 2R93B 4DUYQ 1S5ED 1N33L 4JI0L 1LTTD 2NVQB 2AWOA 5C0XG 4GKKQ 2BDNA 2B2UC 4DFAA 4C3HG 4POFA 4ME5A 4IPCA 4JK1C 4R4OA 1BCPB 2DN8A 5LHY1 1K0RA 4R4TA 5CV4A 2CKZB 1HR0W 1CKNA 4ULLA 3CU7A 5KEEA 1GUTA 1VQ5A 4DV4L 1JOKA 3MVVA 2K4KA 1MI2A 3FKIB 1VQLA 5M3MH 4LUVA 5M5YH 1C7YA 3I4MH 1H9KA 3D4WA 3GDEA 4EVOA 5E7NA 2F0WA 1JCKB 1HZBA 4BY1G 1Q7YC 4IFDJ 4IO9A 4H13C 5I9OA 5JEAG 2A68C 1HR0L 2Z6KC 4Y52H 3MTSA 2L11A 2NVTH 3VR2A 1X54A 3R2IA 4F7XA 2Z9HA 5E3FA 1B9MA 2KECA 3VYSA 4A3DG 4IUVA 1BXTA 1I50H 2EPBA 2L5TA 1HZCA 5FJ8G 3PF5A 4A3FG 1ASZA 4K5XA 4MZ9A 1AE2A 1TWFH 1STYA 3PUZA 5FLMH 4P75A 1RDPD 4PV1C 1WCMH 4NB3A 1Y1WB 4B08A 4DV6L 5JPNC 4X62L 4BBRG 5M3FH 5G3LD 1QVCA 1HCZA 1K0SA 5AFWA 1GM5A 4XDXA 3K5OA 1QOHA 1I6HH 2O4XA 3VYUA 3A7LA 2BCOA 1KQSA 2NTTA 1GXDC 3J81j 4K14A 2I0QA 1SROA 4P71A 4A93G 4A4IA 3CRKC 3CCLA 2DJFC 2F0LA 2IX3A 3C1EA 3SK5A 5CR3A 2E8GA 4AH6A 3I2ZA 4H0LC 3QB3A 2B8FA 3OPOA 1K9MC 5IGCA 3F2CA 2CHBD 1CKMA 3MXPA 1EY5A 1I3QH 2QILA 5FKAC 1EWIA 4LUZA 3HOYG 3K81C 5C4JB 4CHTB 1C8CA 2DY7A 2VZAA 1AE3A 4M1UB 3HOZH 1SYEA 4HMJA 1JWUD 1X3QA 2K14A 5IOCA 3ERSX 4JI4Q 3A0JA 3UI2A 2Y0SE 5LMUQ 2I5MX 3HG9A 2Q2TA 3GTKB 1PA6A 2RDFA 4X6AH 1WTOA 1N36L 3H91A 3I56A 1CSPA 1FL0A 1Y1VG 1IYJB 2L12A 2SOBA 3M3YH 2G9HD 4GNXC 5EQ0A 1EY9A 1YNJD 4QB4A 1G6PA 5FO7B 3E9IA 1L1OB 1V1QA 4KY5A 2DY8A 3GTPH 1ZYRD 4QY7A 3S1RH 2GVAA 3C1FA 1QVFA 1VQOA 2J7ZA 3A74A 1WTWA 1U4PA 1ILPA 1CA6A 2JA7B 4PMWA 1EQQA 1VCIA 2KHIA 4JOIC 4AYBG 3KLRA 1FJGQ 1PTOB 1VQNA 5EJWA 2E2JH 1E7ZA 3J7ZC 4XT1B 2JP1A 1GUOA 3I55A 5COYA 1Q8KA 2RKSA 5M5WB 4KTAA 4UHVA 3EROA 4JI7L 1EUJA 3Q0AA 4A3MB 5BN5A 1SNOA 4X66L 5K36G 3DWAA 5CGKA 1BVSA 1HQRD 4IPHA 3Q24A 4C3IG 4R8IA 4GLAC 3RZDH 1VQGA 4MNOA 2B63H 1TWCB 1NMGA 1MKHA 3MWYW 1MJCA 4B3TQ 5IE8A 1Z7TA 1KAWA 5DM73 1D8LA 4A3EG 2PQEA 1UEAB 2VY3A 1K8AC 2AUKA 5IODA 2JA8B 2NN6G 3CMEA 5DNFA 2F4VL 1FNVA 1HFNA 3H6MA 1KDBA 2F0VA 2KQ3A 2K28A 1YNXA 2X6GA 2LMCB 3RUZA 4ZKBB 2UUAL 1OXXK 4KMUC 4JI5Q 1JORA 3K6OA 3OOCA 2F0PA 3CCJA 4DR6L 1K8OA 1PZJD 1FYCA 4HSVA 1LTRD 2Z4IA 4OHJA 1YHQA 4LK1C 3S16H 4DNRB 4CKEA 3FP9A 1KAAA 2R93H 2MUYA 1C4QA 1FGBD 3W3AA 2NVQH 2K50A 4HN7A 3TP7A 2VL6A 4K6LA 2DJGC 1STBA 2OEOA 1IL8A 2A6ED 1A3TA 2ICEC 2UUBQ 4IN3A 4DAVA 1UAPA 2EDGA 4P73A 4DK1A 3QWNA 1F2MA 1ICWA 2H5XA 5KIXA 1PYSB 2YU9B 1PH5A 1GHKA 3FKIH 1D1IA 3U4ZA 4C3HB 4QF4A 1CUKA 2RHSB 3EFXD 5DAUA 3LGJA 5AJ3Q 2NVYB 5LMNQ 2AQ1B 4NXML 2KVMA 1LT5D 1QG7A 1S3OA 1JJCB 3GTJB 2CW0C 4RHSA 1I4RA 1I4PA 4CBVA 4WRDA 3MEFA 1AW7A 3PUVA 1LM0A 4N9TA 4CKBA 3TRZA 2B29A 1Q3LA 1VQCA 2EIFA 1VQ4A 1YHAA 3MXNB 1V1PA 1PRTF 4DV1Q 4BY1B 4DV7Q 1LV9A 1T5EA 1W6KA 4XYOA 1HTLD 4P2CB 2FXQA 1EOVA 4JV5Q 4GN5A 5D14A 3CCQA 3J80E 4RA8A 1MJEA 4MTNA 3M7GA 1WTVA 2F03A 1GVPA 4UP9A 1Z9FA 2HUGA 3KBGA 4A3DB 5G3LF 1Y1WH 4XQJA 5JJZA 3M4PA 4A3FB 5IP7H 2M2LA 4KY7A 1D2BA 3AFQA 1XTCD 1CQVA 1X65A 3PV0A 1LTLA 2KHJA 1CK1A 3HP3A 4X64L 1B53A 4MN3A 3U9SA 2NYZD 1U4RA 3LX0A 3P1HA 3QO2A 5CBEE 3V96A 4B3TL 1SMYC 5KNDA 5ELNA 1CKNB 3AU7A 5IYDG 1R4QB 3MFYA 3A8JE 1YIJA 3UDIA 2MQHA 5E4XA 4JI1Q 2C35B 3EA6A 5KYLA 3OWFA 4A93B 1JJGA 5C4JH 1E1TA 2ZXOA 1H9SB 2KCNA 4DAYA 1DOKA 2A19A 1QB5D 2EVBA 3BDCA 3EQLC 3SDZA 1TWAB 2AQ2B 2CQAA 4K6DA 1SFOB 2NUCA 4QMGA 1QCBD 4V190 3GTKH 4IUUA 5DEHA 4WFN3 2D62A 4X65Q 2HHHQ 3HOYB 1SBBB 2K75A 4JI2Q 1ZKOA 1PMRA 1KNAA 1SMXA 4LWCA 4V0BA 1I94L 1NY4A 1KHIA 1XMOL 5HGQA 3RN2A 4PMBA 5ELEA 1P16A 2YYZA 2B2TC 3KDFA 2CFMA 5FO8B 5IYCG 4NDXA 1Y1VB 2Z0SA 3DM3A 2JA7H 1RD9D 3KLSX 3E3XA 2PNHA 4RKLA 4IURA 1K3RA 1EZ6A 1N32Q 2VXWA 1PTOH 3NP8A 2F1MA 3PSIA 2B2WC 1DOLA 4JI6L 4DV0Q 4RFBA 2F0JA 1CA5A 4DUZQ 4GOPA 1HUMA 3NBHA 1HNZQ 1G91A 2RHQB 3J80L 1ESRA 2CWPA 3I4NG 3J80c 1BCPC 4LF9Q 5M5WH 2B2VC 3DLLA 2PZWA 4AIMA 1NAPA 1HA5A 1EY7A 1QZHA 3D6WA 3W1GA 3SGIA 2J0TD 4A3JG 4JVZA 3NE5B 2SDFA 3I8ZA 2ICIA 3BYYB 5DLQE 4U673 2KUMA 1TWCH 3CCMA 5TSSA 2YTXA 3OW7A 1NTGA 2BH2A 1VQFA 4TRDA 1JOOA 2K1BA 2JA9A 2AKWB 2K6AA 1MSGA 3STBD 1IL2A 2IHEA 3NK9A 4YCVA 1JT8A 3HEJA 3O13A 4C3IB 2JA8H 5T1GA 2XWJB 3NEMA 2LKVA 4B3MQ 2E5LQ 4O1NA 2RQXA 4OXPA 1N34L 2YTVA 1PHJA 2A69D 1IKMA 4C2MH 1JE5A 4B3SQ 5JJIA 3DUZA 4A3IG 4A3EB 3J7AV 4BY7B 3S1NB 2K5HA 3WWVA 4JBJA 4YWMA 4LFCL 4DR7L 2SNSA 5C5LA 5HURA 1Z47A 2RCNA 3A56A 1QJOA 5T1IA 1SYGA 3PIOA 1PH9A 2NB0A 2PO4A 4JI1L 3KF8A 1IBML 2EYMA 2L1BA 1QZGA 4HSPA 3GQBA 2O2LD 3ICEA 2KCCA 4U68A 5K5PA 4POGA 1MD2D 1NR4A 3PUXA 3T13A 5I9PA 1JWMD 1XWEA 2XIWA 3TP6A 1LTSD 3ZJYC 2VQEQ 3BDOA 1LT6D 2HHHL 4C3HH 1A3UA 4DR3Q 4CJ0B 1PVOA 3URYA 3HOXG 2NVYH 4JBKA 3M85A 3QR8A 2EY1A 1F2YA 1LLRD 4JI3Q 2UXCQ 4HJ9A 4KD4A 2ZT9C 5GAHC 3GTJH 4KN4C 3M4OH 4LFAQ 1ET6A 1QE6A 3PCOB 4AYBE 3G7LA 4EQ5A 5KGUA 1HNWL 4RAUC 3RN5A 4LF4L 2JQOA 4KLKA 5EKIA 1NUCA 4FXDA 5CMDA 4BY1H 4IALA 1RTOA 2BDOA 3I3CA 1F2LA 2NVXB 4KK7A 3KUPA 2QEJC 4KJNA 2LY7A 2B3GA 3T53B 3W2DA 4A3DH 1L1OC 4QIWB 2K33A 1LACA 2HD3A 3HFZB 1PH6A 5FJ8H 4A3FH 2AWNA 4B3RQ 1GOZA 1IW7D 1SAPA 1WTQA 4FF4A 1IYVA 4WJ3M 1SYDA 1FD7D 1TY0A 3ERQA 1PZID 4HJ8A 5GQOA 1XMQQ 4Q5VA 3MA2B 1B7YB 2ZXRA 4TSSA 5BR8L 4LJZC 2F4IA 4HAEA 2K5NA 3TZDA 3H0GG 2H1EA 4J15A 3PO2G 3SK6A 1EU4A 2ZM6Q 3KJOA 3H3VI 4CJ1B 4DNIA 4RMFA 3CD6A 1L0YB 1PDQA 2UXDL 4A93H 2HT1A 4LMQD 3HOWB 5CORA 3E5SA 3N6RA 5JVG3 3MXGA 4NMZA 1VQIA 1VQKA 4CDDC 3EN2A 4TKOB 4B3SL 2OXPA 3M4YA 3MZ5A 5D65A 1TWAH 4JI8Q 1X3PA 4HIDA 3PIO3 3HOVG 2OT2A 2XGTA 3TQYA 1SFOH 4QUFA 2RDGA 4WJWA 5GAEC 3HOUG 3FVQA 3H3VH 4EQOA 3HOYH 1WFQA 2DUDA 1I4GA 3S2DB 4DF7A 5J1ZA 3P20A 5NUCA 3N52A 1XYIA 4DK3C 1SEBD 2L4NA 2ZTDA 3NTHA 1SDFA 4LW1A 1UEBA 1L2FA 2L9HA 1TT2A 3CF5A 1BBXC 4L5SA 2OTLA 4OIKA 4DN4M 1SJED 3T56B 1BKBA 2KEEA 1Y1VH 1YITA 1EWHA 2Y0SB 1XPUA 4XIGS 4DK6C 3RZOB 3Q8DA 4DR2Q 1XTDA 2FINB 4IUNA 2WACA 2A1AA 1L0WA 4QIWE 1UE7A 1X56A 3F2UA 4NXNQ 2XRSD 1XNQL 1M8AA 3NHHA 4GS3A 4BA2I 1GD7A 4LFAL 1RODA 2IT1A 4PMCA 3RR5A 4C56C 5I4DA 1XX8A 4R1JA 3CCRA 4OO1I 2ENBA 3U9OA 1G2TA 3MAQA 4DAYB 1W2BA 3X3MA 4LF5Q 4JYAL 1RCVD 1SN8A 3I4NB 1RJTA 1PRTD 1YZ6A 1DXMA 2NN6I 4GNXA 5K36H 4HCSA 2C5CA 1ZEQX 4C3IH 3OW2A 1K8MA 4A3JB 4KY6A 4OO1H 2UUCQ 3C46A 3RLNA 1PV4A 1HUNA 2IJ0A 2EOTA 3AEVA 3J7AF 1QVGA 1DD2A 1EIFA 1ILQA 1QWYA 5EPLA 5DM63 1TWGB 2VW9A 3TS2A 1NCVA 4A3EH 2FMMA 4L5TA 2MPMA 2Z4HA 1SE2A 1PFBA 3CMAA 3S1NH 1F9QA 2F3IA 2ZJQA 3H09A 4BY7H 2NN6H 4DPGA 5IWAQ 3JAME 3PO3G 4YWKA 2JSOA 2ZTCA 3HRZC 4ZUJA 2AQ3B 2R92B 3H15A 4GOPB 3NBHB 4A3IB 4Z9CB 4LNQA 1FR3A 5IP9G 2F0UA 3T1YQ 1KXLA 1LYLA 1KABA 1LTBD 1SYCA 5EKKA 5C5MA 1S72A 5C4HA 1GUWA 1BCPF 4F8MA 3D0FA 2A68D 3L7ZC 2XSCA 3GD7A 2DGYA 4QL5A 2QW7A 3EVQA 1JWSD 2JN4A 4LF7Q 3A8IE 4RGMA 2K5WA 4DUYL 4ZK9B 2EYFA 3DEOA 4IQZA 1N9WA 3A8KE 3SHLA 4GKKL 4X3SA 5CBAE 1YJ9A 3Q22A 1DM0B 2DNEA 2L55A 1CQFA 1B3AA 2NZHA 4IUQA 4PQXA 3HOXB 2JA6G 1H9MA 3H3VC 4J6HA 3G71A 1D5MC 2O5JC 2XVSA 2E2DC 2NVXH 4DR2L 3CPFA 3WOFA 3OTOQ 4UAIA 2MP1A 1TKWB 1BO0A 2A8VA 1JJ2A 1VQ9A 3UE0A 2EYHA 2UXBQ 2QEXA 3F1ZA 2E2HB 2ZJRA 1NNXA 2M00A 3I4MG 4JC0A 3K80C 4K8IA 1PFMA 4Q0FA 3KLWA 3KOJA 4APVA 2OTJA 4KJOA 2PMZB 1M90C 1S5FD 4KHZA 1ONLA 5IGEA 3KJPA 1BOSA 1I4XA 5ELCA 2WAQG 5BN3A 1C9OA 4HIOA 3PF4A 4A3GB 1W6JA 2SNMA 4IZ8A 3ER0A 3JAML 5L37A 3EBEA 3JAMc 2DNCA 3HOWH 1II3A 1F77A 1WCMG 3DMUA 3CCSA 3K58A 4DA2A 3H0GB 1S5BD 1B70B 5IYDH 1H9RA 1D5ZC 3FHWA 3R93A 2NZOA 1TR5A 4A3CH 1Y8OB 1CHQD 1SNPA 1AP0A 2OCEA 3K8AA 1DJRD 2PI2A 4EGVA 3S2DH 1TVXA 4OX9Q 3G4SA 2Z8LA 3MEHA 4A75A 1ET9A 1VQPA 4DR5Q 2D0OA 3HOVB 2N88A 2RA4A 3NTIA 2Q8TA 5M9OA 4LF8Q 1K8GA 3V05A 1YJNA 4BS9A 3LNNA 1E1OA 4GKJQ 3CC7A 4RCOA 2Q8RE 2RBMA 4BXXG 4GLXA 4JI4L 1WTHA 3HKZE 1PFNA 3HOZG 4HMIA 5LMUL 4LFBQ 1EIYB 3CPWA 3RZOH 2F0EA 1UUPA 3M9BA 1VMCA 3T16A 2QDLA 3G6EA 1PTOF 1WYDA 1WI5A 1DOMA 4OL7A 2LXJA 2WIIB 3ULJA 3PGZA 3EIVA 3SXHA 1CT1D 3GTGB 1K28A 5C3WA 4KHPQ 3MXUA 1EL0A 2KOLA 1Y8PB 1WOCA 4L6TB 3GTLB 3AFPA 5LL6S 1AZPA 1C0AA 1IKLA 3K59A 3VR6A 4OIJA 1OO9B 4PG3A 1BDOA 4HIMA 2PMZE 2MNAA 4QQBX 1VS0A 2UU9Q 1B9NA 2PNRC 2KENA
chains in the Genus database with same CATH topology
2KEDA 3ITPA 4XQNA 2VB3X 3S15B 4MHEA 1VF7A 4ZAIA 3S2HB 1JC7A 4F87A 3C2PA 2EJFC 4G7OC 2VNUD 1WD0A 2PPBC 2HDMA 2JXMB 1E2VA 2C9OA 4KKTA 1PZKD 4KKUA 4K8JA 4BBRB 1LTID 4FYDA 4C1NK 2O5IC 3A7AB 2G9DA 3FMCA 2HCIA 2F0DA 3T51B 3BS1A 2JYOA 3VA7A 3PO3B 1PYWD 1EEFD 1WTXA 3NTKA 2D5DA 1AFPA 1S5DD 3GP7A 4HEDA 4IUPA 3S1MB 2CW0D 5IT9E 4DK0A 2M9VA 3FPUB 3S17B 1EIGA 2PZTA 1E2WA 2E75C 3NQTA 3IL8A 2X69A 4G7ZC 4FVMA 2F3VA 2GA4B 3R3OA 1F9PA 2QCPX 2MHVA 3NPPA 5EKLA 2Q8IB 1BUVT 4FXKC 5ELBA 4ZKCB 5D3DA 1O7LA 3G6JB 4B9XA 2K7VA 2FMCA 1X32A 5J22A 2JA6B 2RDHA 4PNYA 1SMYD 4AYBB 3C3LA 4L63B 3QOJA 4R8NA 4XQQA 3WOEA 2PZUA 3E0JA 2XN9C 3K7AB 2BE5D 2LFNA 1O7YA 5HGTA 3IAYA 1D6EC 1YNND 2EYLA 2WAQB 3DWPA 1B50A 4DAPA 3VYTA 1WD1A 1A3VA 1U4MA 2F0FA 3L9AX 3MFGA 4F88A 3R8BA 1LT3D 1R4PB 5C0XI 1U4LA 2B2YA 4DNTB 5F2DA 3QIAA 1F9SA 1UNSA 1A2UA 2N55A 3DHQA 5M5XB 3PUYA 1SXTA 1TS3A 2KJXA 3HS0C 1MSHA 2LS01 3QG1A 3CKIB 4X3TA 4JBWA 1IW7C 3CQZB 3D8GA 1O78A 1BCPD 5C0XH 1SNQA 1JICA 1EY4A 1QNUA 3TP5A 1NR2A 2E2IB 4WORA 4K2LA 2ZXPA 2WINB 2EYJA 1V43A 4FNFA 2I46A 2EY6A 5EBDA 5J39A 1CHPD 2TMPA 5BN4A 1LTGD 4LAAA 1TWHB 5CV8A 1AN8A 3S9WA 5JEAH 5D3IB 3K57A 4KI0A 2F0IA 5CV5A 3RD4A 3SK4A 1KLUD 2B2UA 2JE6I 5C4XB 4I7ZC 1EEID 2RVLA 1SNDA 2FFKB 4HR7B 2NBFA 5C0XJ 1J9OA 5CV7A 4CKCA 4OGQC 2K05A 2IW3A 3A54A 2XNAC 5EBCA 3GV6A 2EYOA 2R61A 3K5LA 1D1KA 2JA5B 3D6CA 2J4XA 1JQYD 4K5WA 3ONAB 3K5MA 1B2TA 5JEAJ 2V4DA 2A6HD 3TSSA 4ZUIA 2E74C 1V1PB 1WTPA 1G291 3BVZA 3AB9A 1RF2D 1PRTC 1SNCA 3VR5A 1WTRA 1SE3A 3MXNA 3BVMA 1A15A 4S3SA 4H7BA 1EWCA 1TS4A 3ND9A 1BNZA 2BOSA 1VDZA 1AZQA 1EYDA 2F0OA 4I65A 4X3KA 2E76C 1SNMA 1OXVA 3S14B 1EQVA 5IGBA 1PTOD 2B8GA 5C6AA 1FNUA 5JAVA 1JB3A 5JPMC 4BWGB 4TQUS 3X3NA 2QDBA 1HA6A 1KDCA 2R6GA 5EGTA 1CZGA 5FLXE 5I2YA 4CJ2C 5I6WA 3OSOA 1DZ1A 4G57A 1MBYA 1ML0D 1H9SA 3FPPA 4NP5A 1PLFA 1SYFA 3KK7A 1LABA 4K2KA 1YNJC 1S5CD 1BR9A 1I4HA 5FOBB 2WB1B 4ZYSA 1ZYRC 3VA5A 3NUCA 4EQNA 5IIFA 3PIP3 5JVH3 3RLFA 4NW2A 3NSWA 1EYCA 3GTMB 2VUMB 1OXTA 3OMGA 3Q6SA 5E4WC 1Q1EA 1EFID 3D4DA 4HTHA 2EY2A 5ELDA 4IFDG 2FHTA 3GTOB 2R7ZB 4R9WA 3NWTA 1CI3M 4NKLA 3MC0B 1SJHD 3VR4A 3OMCA 1Q12A 2PCFB 1OXUA 4H44C 1Y8NB 2EXZA 1G8ZD 4XYQA 2BA0A 1EY8A 4C3JG 3FEWX 4L8JA 1AEXA 4A3BB 3NQIA 2K32A 4QUCA 2MGSA 3HKZB 5I2XA 3NWSA 3IFDA 4KKSA 4GZYC 3V2TA 3AMUA 5FLXL 3GO5A 3OIQA 1OXSC 2TSSA 5C3EB 1O80A 1H9JA 4RGTA 2HCCA 2BA1A 4K5VA 2EYPA 2L0CA 1R9TB 4FO2A 3DWQA 1VF5C 1EY0A 2XWBB 5FK9C 2IWHA 3BG3A 3GV3A 4XT3B 2A6EC 3I91A 5A2QE 1STHA 2KA7A 1STAA 4C1NI 4XXEA 2WKDA 1E0BA 1HHVA 4CGYB 1PRTB 3BYTB 4OO1G 4DXGA 3PO2B 4DXFA 2XRQD 3DXJC 1Y69U 2IX1A 4BBSB 2X6LA 3QOLA 3S1QB 5CYUA 3NXWA 1E2ZA 2K04A 1B44D 4KN7C 1TQOA 1KNEA 3E6ZX 1TS5A 3KLSA 3QJYA 1TY2A 5CV6A 3J81E 4XTCS 2K5QA 4C2MB 4RWSC 1GUGA 1CZWA 1GUNA 3TDQA 2F0TA 2NWGA 1ENCA 3HOUB 3SEBA 1GUSA 4FF1A 2F0KA 2CVRA 1L0XB 2A74C 4A3KB 2JEBI 4DGZA 3I70A 5C3XA 3J7YW 1KLGD 1M4VA 3I73A 4ODGA 3Q23A 3T4AC 5C44B 2KHSA 2K01A 1K83B 2SEBD 4G4KA 4FF3A 4ZQ3A 3OIPA 4RKBA 1EIHA 1XXGA 5A2QL 4HCEA 3M4OB 5JOBA 3VYRA 1HTPA 1FNWA 2EE1A 3LWUA 1J8IA 1C48A 2F3WA 2A5HA 4ZRZA 1CTMA 2B2TA 2PW5A 3A55A 4J8QA 2K03A 2JEAI 1HXYD 5CC4A 1MGSA 3CHBD 3EJIA 2F0MA 4FF2A 1GHJA 2RSNA 2B2WA 4ABNA 2NTSA 4N9PA 3I90A 5KNCA 3BDLA 1EOTA 3SK8A 3IFTA 2B2VA 5FO9B 1RHPA 2R3ZA 3TMEA 3J81L 1EQTA 1T5XD 4RGOS 3IKJA 1JR0D 3WDNA 2QKIC 3P7JA 3H94A 1WVLA 1QILA 3L3OC 3D31A 3GTQB 1GJXA 2EY5A 4Y7NB 2IPKD 1EYAA 2BE5C 3TP8A 3LWEA 1S4ZA 2WKCA 1ZXTA 1U9RA 3SE0A 1F9RA 1D5XC 1HFGA 3FDTA 1YNNC 1HRJA 1KDAA 2EJMA 4C3JB 4O42A 2B39A 5ELFA 2A69C 3TZUA 4QCLA 2QF7A 3P75A 3M7NA 4EQPA 4KV6A 1QNKA 1O7ZA 1NSNS 2AUJD 2IX0A 3I4LA 2ID0A 1HPCA 5KRUA 1F2ZA 5KYIA 5LL6X 1A6XA 2WP8J 2NZ1D 5EPJA 4DU9A 3HGBA 1I4QA 1HQMC 4UDUC 5M3MB 5M5YB 3I4MB 2I07B 1V8QA 3OHXC 1STNA 1I6VC 1DONA 1VMPA 2NVTB 1TIID 1ESFA 3K5NA 3HZXA 1SE4A 2A73B 1I50B 4ILWA 1Q90A 1CFMA 1TWFB 4FP5D 2EJGC 1B1ZA 3ZYYX 5CV9A 3TN2A 5I6YA 1WCMB 5IT9L 5M3FB 1SSOA 2PYKA 4YIJA 2RSOA 2HDLA 1I6HB 2WV6D 1B4OA 4ZLTF 3PMFA 5EPKA 5KNBA 5ISRA 3D4RA 1A2TA 2EZVA 3KBXA 4M8AA 3DEPA 1LO5D 1I3QB 1JE4A 2MJ8A 1V1OA 3HOZB 1G6ZA 5IGGA 1KTKA 1TU2B 1TS2A 4RGNA 1IYUA 4BA1I 1LTAD 1ENFA 4J1MA 3VR3A 2D9UA 2K5DA 1BQQT 2H4OA 3M3YB 2A6HC 5C4ZA 1RKNA 2VB2X 1RTNA 4MIUA 2D2CC 3GTPB 3S1RB 4ID6A 5IGDA 2F0HA 5E1FA 1DYQA 1EZ8A 2IL8A 5A35A 1Z6HA 4IUTA 3MHBA 1EY6A 1JOQA 4RCNA 2E2JB 1ENAA 3ND8A 1STEA 2B2YC 3CRLC 1DCZA 1BF4A 3SR1A 2FJ2A 2PW7A 3OWEB 4E6IA 4IFDI 3D3RA 2F0SA 1SYBA 4RHRA 1Q8IA 5IGFA 2HQEA 4G7HC 1PTOC 3DM1A 1PXUA 3RZDB 2OF1A 2B63B 4KHVA 3BVGA 3SVMA 1EU3A 4KD3A 2F0GA 3I72A 1LT4D 4IFDH 3K0YA 3NBIA 3PUWA 3FRPB 3RMHA 1Q1BA 3BZDB 3R2TA 3TBIB 1CM9A 1G2SA 1IHZA 4RH6A 4B9WA 1STGA 2Z1CA 4X3UA 4FXGC 3S16B 2F0NA 2F0QA 2R93B 1S5ED 1LTTD 2NVQB 2AWOA 5C0XG 2BDNA 2B2UC 4DFAA 4C3HG 4ME5A 4JK1C 1BCPB 2DN8A 5LHY1 5CV4A 4ULLA 3CU7A 5KEEA 1GUTA 1JOKA 3MVVA 1MI2A 3FKIB 1H9KA 3D4WA 4EVOA 4IFDJ 2F0WA 1JCKB 4H13C 5I9OA 5JEAG 2A68C 3MTSA 2L11A 3VR2A 3R2IA 4F7XA 5E3FA 1B9MA 2KECA 3VYSA 4IUVA 1BXTA 2EPBA 2L5TA 4K5XA 1STYA 3PUZA 1RDPD 4PV1C 1Y1WB 4B08A 5JPNC 5G3LD 1HCZA 5AFWA 4XDXA 3K5OA 1QOHA 2O4XA 3VYUA 3A7LA 2BCOA 2NTTA 1GXDC 4K14A 3CRKC 2F0LA 2IX3A 3C1EA 3SK5A 5CR3A 4H0LC 3QB3A 2B8FA 3OPOA 5IGCA 2CHBD 3MXPA 1EY5A 2QILA 5FKAC 5C4JB 4CHTB 1C8CA 2DY7A 4M1UB 1SYEA 4HMJA 1JWUD 1X3QA 5IOCA 3UI2A 3HG9A 3GTKB 2RDFA 1WTOA 3H91A 2L12A 2SOBA 2G9HD 5EQ0A 1EY9A 1YNJD 4QB4A 5FO7B 4KY5A 2DY8A 1ZYRD 3C1FA 2J7ZA 1WTWA 1U4PA 1ILPA 1CA6A 2JA7B 4PMWA 1VCIA 3KLRA 1PTOB 5EJWA 4XT1B 2JP1A 1GUOA 5COYA 2RKSA 5M5WB 4KTAA 3EROA 3Q0AA 4A3MB 5BN5A 1SNOA 5K36G 3DWAA 5CGKA 1HQRD 3Q24A 4C3IG 4R8IA 1TWCB 3MWYW 1Z7TA 5DM73 2PQEA 1UEAB 2AUKA 5IODA 2JA8B 2NN6G 5DNFA 1HFNA 1FNVA 3H6MA 1KDBA 2F0VA 2KQ3A 2K28A 2X6GA 2LMCB 3RUZA 4ZKBB 1OXXK 4KMUC 1JORA 3K6OA 3OOCA 2F0PA 1K8OA 1PZJD 1FYCA 4HSVA 1LTRD 2Z4IA 4OHJA 4LK1C 4DNRB 4CKEA 1KAAA 2MUYA 1C4QA 1FGBD 3W3AA 4HN7A 3TP7A 4K6LA 1STBA 2OEOA 1IL8A 2A6ED 1A3TA 2ICEC 4IN3A 4DAVA 1UAPA 2EDGA 4DK1A 3QWNA 1F2MA 1ICWA 2YU9B 5KIXA 1GHKA 1D1IA 4C3HB 4QF4A 3EFXD 5DAUA 2NVYB 2AQ1B 2KVMA 1LT5D 1QG7A 3GTJB 2CW0C 4RHSA 1I4RA 1I4PA 4CBVA 4WRDA 1AW7A 3PUVA 4N9TA 4CKBA 1Q3LA 4BY1B 1V1PA 1PRTF 1LV9A 1T5EA 1W6KA 4XYOA 1HTLD 4P2CB 5D14A 3J80E 4RA8A 3M7GA 1WTVA 2F03A 2HUGA 3KBGA 4A3DB 5G3LF 4XQJA 5JJZA 4A3FB 2M2LA 4KY7A 1D2BA 1XTCD 1CQVA 3PV0A 1CK1A 3HP3A 1B53A 4MN3A 3U9SA 2NYZD 1U4RA 3LX0A 3P1HA 3QO2A 5CBEE 3V96A 1SMYC 5KNDA 3AU7A 1R4QB 3MFYA 3A8JE 5E4XA 3EA6A 5KYLA 3OWFA 4A93B 2ZXOA 1H9SB 2KCNA 4DAYA 1DOKA 2EVBA 1QB5D 3BDCA 3EQLC 3SDZA 1TWAB 2AQ2B 2CQAA 4K6DA 1SFOB 2NUCA 4QMGA 1QCBD 4V190 4IUUA 5DEHA 4WFN3 2D62A 3HOYB 1SBBB 1ZKOA 1PMRA 1KNAA 4V0BA 4PMBA 5ELEA 2YYZA 2B2TC 5FO8B 4NDXA 1Y1VB 1RD9D 3KLSX 4RKLA 4IURA 1EZ6A 2VXWA 1PTOH 3NP8A 2F1MA 2B2WC 1DOLA 4RFBA 2F0JA 1CA5A 1HUMA 3NBHA 1G91A 3J80L 1ESRA 1BCPC 2B2VC 2PZWA 1NAPA 1HA5A 1EY7A 3D6WA 2J0TD 3NE5B 2SDFA 3I8ZA 2ICIA 3BYYB 4U673 2KUMA 5TSSA 3OW7A 4TRDA 1JOOA 2K1BA 2K6AA 1MSGA 3NK9A 3HEJA 3O13A 4C3IB 5T1GA 2XWJB 2LKVA 4O1NA 2RQXA 1IKMA 2A69D 3DUZA 4A3EB 3J7AV 4BY7B 3S1NB 2SNSA 5C5LA 5HURA 1Z47A 3A56A 1QJOA 5T1IA 1SYGA 2NB0A 2PO4A 3KF8A 2EYMA 2L1BA 4HSPA 3GQBA 2O2LD 2KCCA 4U68A 5K5PA 1MD2D 1NR4A 3PUXA 3T13A 5I9PA 1JWMD 1XWEA 2XIWA 3TP6A 1LTSD 3BDOA 1LT6D 1A3UA 4CJ0B 3URYA 3M85A 2EY1A 1F2YA 1LLRD 4KD4A 2ZT9C 4KN4C 1ET6A 1QE6A 5KGUA 3G7LA 4RAUC 5EKIA 1NUCA 4FXDA 5CMDA 4IALA 1RTOA 2BDOA 3I3CA 1F2LA 2NVXB 4KK7A 3KUPA 2QEJC 4KJNA 2LY7A 3T53B 3W2DA 4QIWB 2K33A 1LACA 2AWNA 1GOZA 1IW7D 1SAPA 1WTQA 4FF4A 1IYVA 1SYDA 1FD7D 1TY0A 3ERQA 1PZID 4Q5VA 3MA2B 2ZXRA 4TSSA 4LJZC 2F4IA 4HAEA 3TZDA 2H1EA 3SK6A 1EU4A 4CJ1B 1L0YB 1PDQA 4LMQD 3HOWB 5CORA 3E5SA 3N6RA 5JVG3 3MXGA 4NMZA 4TKOB 2OXPA 3M4YA 3MZ5A 5D65A 1X3PA 3PIO3 2OT2A 4QUFA 2RDGA 4WJWA 3FVQA 4EQOA 1I4GA 3S2DB 4DF7A 5J1ZA 3P20A 5NUCA 3N52A 1XYIA 1SEBD 2L4NA 3NTHA 1SDFA 2L9HA 1TT2A 1BBXC 4OIKA 4DN4M 1SJED 3T56B 2KEEA 1EWHA 2Y0SB 4XIGS 3RZOB 2FINB 4IUNA 2WACA 3F2UA 2XRSD 1M8AA 3NHHA 4BA2I 1RODA 2IT1A 4PMCA 4C56C 5I4DA 1XX8A 4OO1I 2ENBA 3U9OA 1G2TA 3MAQA 3X3MA 1RCVD 3I4NB 1RJTA 1PRTD 1DXMA 2NN6I 5K36H 4HCSA 2C5CA 1ZEQX 1K8MA 4A3JB 4KY6A 4OO1H 3C46A 1HUNA 2IJ0A 2EOTA 3J7AF 1DD2A 1ILQA 1QWYA 5EPLA 5DM63 1TWGB 1NCVA 2FMMA 2MPMA 2Z4HA 1SE2A 1PFBA 1F9QA 3H09A 2NN6H 3JAME 2JSOA 3HRZC 4ZUJA 2AQ3B 2R92B 4A3IB 4Z9CB 1FR3A 2F0UA 1SYCA 1KABA 1LTBD 5EKKA 5C5MA 5C4HA 1GUWA 1BCPF 4F8MA 2A68D 3L7ZC 2XSCA 3GD7A 3EVQA 1JWSD 3A8IE 4RGMA 2K5WA 4ZK9B 2EYFA 3DEOA 4IQZA 3A8KE 3SHLA 4X3SA 5CBAE 3Q22A 1DM0B 2DNEA 2L55A 1CQFA 1B3AA 4IUQA 4PQXA 3HOXB 1H9MA 3H3VC 4J6HA 1D5MC 2O5JC 2XVSA 2E2DC 3WOFA 4UAIA 2MP1A 1TKWB 1BO0A 2EYHA 2E2HB 2M00A 4K8IA 1PFMA 4Q0FA 4KJOA 2PMZB 1S5FD 4KHZA 1ONLA 5IGEA 1BOSA 1I4XA 5ELCA 5BN3A 4A3GB 1W6JA 2SNMA 4IZ8A 3JAML 2DNCA 1II3A 1F77A 3DMUA 3K58A 4DA2A 3H0GB 1S5BD 1H9RA 1D5ZC 3R93A 1TR5A 1Y8OB 1CHQD 1SNPA 1AP0A 1DJRD 4EGVA 1TVXA 2Z8LA 3MEHA 1ET9A 3HOVB 2N88A 2RA4A 3NTIA 2Q8TA 5M9OA 3V05A 4BS9A 3LNNA 4RCOA 2Q8RE 2RBMA 1PFNA 4HMIA 2F0EA 1UUPA 1VMCA 3T16A 1PTOF 1DOMA 4OL7A 2WIIB 3SXHA 1CT1D 3GTGB 5C3WA 3MXUA 1EL0A 2KOLA 1Y8PB 4L6TB 3GTLB 5LL6S 1AZPA 1IKLA 3K59A 3VR6A 4OIJA 1OO9B 1BDOA 1B9NA 2PNRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2TMP A;  3OHX C;  3FRP B;  3KLS A;  2WII B;  2QKI C;  2XWB B;  2XWJ B;  1PXU A;  3MA2 B;  3V96 A;  1JB3 A;  5FO8 B;  5JPM C;  1BQQ T;  2E2D C;  3HRZ C;  2A73 B;  2ICE C;  5JPN C;  1BUV T;  2J0T D;  2B39 A;  3I70 A;  4FXK C;  4ILW A;  1UAP A;  1JC7 A;  3HS0 C;  3G6J B;  2WIN B;  3L3O C;  3T4A C;  1OO9 B;  3CU7 A;  1D2B A;  5FO7 B;  4FXG C;  1XWE A;  5FO9 B;  1BR9 A;  1GXD C;  2A74 C;  3CKI B;  5FOB B;  2I07 B;  1UEA B; 
#chains in the Genus database with same CATH topology
 2KED A;  4JCV E;  5C4X G;  1AH9 A;  2N49 A;  3CP0 A;  4R4C A;  2LSS A;  3ITP A;  4XQN A;  1U0L A;  2VB3 X;  3S15 B;  1FJG L;  2HQL A;  3I4N H;  4ME3 A;  2P5Z X;  2ASB A;  4MHE A;  1VF7 A;  2RF4 A;  4ZAI A;  3S2H B;  2PQA A;  1IBL Q;  4A3J H;  1JC7 A;  2V1C C;  4F87 A;  1JB7 A;  3C2P A;  4OWW B;  2EJF C;  4G7O C;  1K73 C;  2VNU D;  1WD0 A;  2I5H A;  2MO1 A;  2PPB C;  2HDM A;  2EXD A;  2JXM B;  1S40 A;  1TWG H;  1E2V A;  2C9O A;  4KKT A;  1PZK D;  4KKU A;  2JA5 G;  4K8J A;  1QUQ A;  4BBR B;  1LTI D;  4FYD A;  4C1N K;  2B63 G;  5IYB H;  2O5I C;  3A7A B;  2VQF Q;  2G9D A;  2R92 H;  3FMC A;  4A3I H;  2HCI A;  2F0D A;  3T51 B;  3BS1 A;  4A76 A;  4DR4 Q;  1X3F A;  1IBK Q;  3F2D A;  2JYO A;  1M1K C;  4YWL A;  3VA7 A;  3PO3 B;  1PYW D;  1EEF D;  3TS0 A;  1WTX A;  3W1B A;  4JI5 L;  3NTK A;  1XNR Q;  2D5D A;  1AFP A;  3CCU A;  1S5D D;  1UE1 A;  1KRT A;  3GP7 A;  2LXK A;  4HED A;  4IUP A;  3S1M B;  2CW0 D;  5IT9 E;  4DK0 A;  2M9V A;  3FPU B;  4IOC A;  2KCT A;  3S17 B;  1EIG A;  2PZT A;  4O2D A;  1E2W A;  2E75 C;  2R93 G;  3NQT A;  4LF8 L;  3IL8 A;  2X69 A;  3E0E A;  2UUB L;  1VQD A;  4G7Z C;  4DV3 Q;  4FVM A;  2F3V A;  2GA4 B;  3R3O A;  5LMN W;  4HJ7 A;  1F9P A;  3J81 i;  2QCP X;  1E3P A;  2MHV A;  3HOX H;  4LFB L;  3NPP A;  5EKL A;  2Q8I B;  1BUV T;  4FXK C;  2D0P A;  5ELB A;  4ZKC B;  5D3D A;  1O7L A;  2CH4 A;  3G6J B;  1ASY A;  2ES2 A;  1FGU A;  1XPO A;  4K0K Q;  5LMN L;  4B9X A;  5AJ3 L;  2K7V A;  2FMC A;  4AQY Q;  2E2H H;  1X32 A;  5J22 A;  2JA6 B;  2RDH A;  4DV2 Q;  4IJL A;  4PNY A;  1T9H A;  1SMY D;  1DGS A;  4A3M H;  4AYB B;  2K5V A;  3C3L A;  3RNU A;  4L63 B;  3QOJ A;  2QGQ A;  4R8N A;  1Q46 A;  4DV1 L;  5HY6 A;  4DV7 L;  4XQQ A;  2CWA A;  3PQI A;  3WOE A;  4P72 A;  4A3G H;  4JV5 L;  2PZU A;  1YEZ A;  3E0J A;  2XN9 C;  3K7A B;  3F8T A;  2BE5 D;  2WB1 G;  3T1H Q;  2LFN A;  1O7Y A;  5HGT A;  1HNX Q;  3IAY A;  1D6E C;  1YNN D;  3F2B A;  2EYL A;  2IY5 B;  1X3E A;  2WAQ B;  2GVB A;  3H0G H;  3DWP A;  2VUM G;  1B50 A;  2ALY B;  4N8F A;  4DAP A;  4RG1 A;  3U4V A;  1BBW A;  3VYT A;  1WD1 A;  5H1S E;  1A3V A;  1A62 A;  4CDC C;  1BBU A;  1U4M A;  2F0F A;  3L9A X;  3MFG A;  4F88 A;  2R7Z G;  3R8B A;  1LT3 D;  1R4P B;  5C0X I;  1U4L A;  2B2Y A;  4DNT B;  5F2D A;  4YY3 Q;  3QIA A;  1F9S A;  5IT9 c;  3J80 i;  1UNS A;  1A2U A;  1GKH A;  2N55 A;  3HOV H;  3DHQ A;  4DR4 L;  5M5X B;  1IBK L;  3PUY A;  1SXT A;  1TS3 A;  2KJX A;  3HS0 C;  1MSH A;  2LS0 1;  1VQ6 A;  2N8N A;  3CW2 C;  3QG1 A;  4YHH Q;  3CKI B;  4X3T A;  4A3B G;  4JBW A;  2ATW A;  3UDG A;  1IW7 C;  3CQZ B;  3D8G A;  2YU9 H;  1O78 A;  1BCP D;  4X65 L;  5C0X H;  1SNQ A;  1JIC A;  4OWT B;  4DV5 Q;  1EY4 A;  1QNU A;  3TP5 A;  1NR2 A;  4GOP C;  2E2I B;  1N33 Q;  4WOR A;  4JI0 Q;  3HKZ G;  4JI2 L;  3GTG H;  4K2L A;  3KF6 A;  3GTL H;  2ZXP A;  2WIN B;  3CCV A;  2EYJ A;  1J5E Q;  1V43 A;  4FNF A;  2I46 A;  2EY6 A;  5EBD A;  5J39 A;  2HIV A;  5C3E G;  1CHP D;  2TMP A;  1SLJ A;  1PH8 A;  5BN4 A;  1LTG D;  4LAA A;  1TWH B;  4DV4 Q;  5CV8 A;  1AN8 A;  3S9W A;  5JEA H;  1N32 L;  3S15 H;  4IOA A;  5D3I B;  3RLO A;  4KI0 A;  3K57 A;  2F0I A;  5CV5 A;  2R7D A;  3RD4 A;  4DV0 L;  3BU2 A;  4DUZ L;  3SK4 A;  1HNZ L;  3S2H H;  1A63 A;  1KLU D;  2B2U A;  2JE6 I;  4LF9 L;  2ZJP A;  5C4X B;  3W5O A;  2WAQ E;  4I7Z C;  1EEI D;  3K7U C;  2RVL A;  1SND A;  1VQE A;  2FFK B;  4HR7 B;  2NBF A;  5C0X J;  1NE3 A;  1UE5 A;  3CCE A;  1J9O A;  5CV7 A;  4BBR H;  4CKC A;  3CC2 A;  4OGQ C;  2K05 A;  2IW3 A;  3A54 A;  4DV6 Q;  4X62 Q;  2Z6K A;  4LF6 Q;  4ZCK A;  2XNA C;  5EBC A;  3GV6 A;  4BBS G;  2EYO A;  2R61 A;  1W3S A;  4B3M L;  2E5L L;  3K5L A;  5ELO A;  1D1K A;  3PIP A;  2JA5 B;  3D6C A;  2J4X A;  2JA8 G;  1JQY D;  2HIX A;  1N8R C;  4K5W A;  4QJF A;  3ONA B;  3K5M A;  1B2T A;  5JEA J;  2V4D A;  1X3G A;  2A6H D;  4N8X 1;  3TSS A;  4ZUI A;  1KRS A;  2E74 C;  3S1M H;  1V1P B;  5IP9 H;  1ICF B;  1WTP A;  1P8L A;  1G29 1;  3BVZ A;  1CKO A;  3AB9 A;  3S17 H;  1UWV A;  4A3K G;  1RF2 D;  1PRT C;  1SNC A;  3VR5 A;  1WTR A;  1SE3 A;  3MXN A;  3BVM A;  1A15 A;  4MTK A;  4S3S A;  4H7B A;  1EWC A;  1TS4 A;  3ND9 A;  1BNZ A;  2BOS A;  1FVI A;  1VDZ A;  1N36 Q;  1AZQ A;  2VQE L;  1EYD A;  2F0O A;  4I65 A;  5C44 G;  3UE1 A;  1HZ9 A;  4DV5 L;  4A3L G;  4X3K A;  1QUQ B;  4DR3 L;  2E76 C;  1SNM A;  2PI2 E;  1OXV A;  3S14 B;  4JI3 L;  2UXC L;  4GLV B;  1KIX A;  1EQV A;  5IGB A;  1PTO D;  2B8G A;  5C6A A;  1FNU A;  2JA6 H;  5JAV A;  1JB3 A;  5JPM C;  4BWG B;  1J5E L;  4TQU S;  3X3N A;  1Q82 C;  1PH7 A;  2QDB A;  1HA6 A;  1KDC A;  2R6G A;  5EGT A;  1CZG A;  5FLX E;  5I2Y A;  4CJ2 C;  5I6W A;  3OSO A;  3AQQ A;  1OTC A;  3B6Y A;  1DZ1 A;  4G57 A;  3K7A H;  1MBY A;  1ML0 D;  1H9S A;  4UP8 A;  3FPP A;  4NP5 A;  2AMC B;  4JI7 Q;  4B3R L;  4X66 Q;  1PLF A;  5GAG C;  1SYF A;  3KK7 A;  4OWX B;  1LAB A;  4K2K A;  1YNJ C;  1S5C D;  1BR9 A;  1I4H A;  5FOB B;  1XMQ L;  2WB1 B;  4ZYS A;  4PZ7 A;  1ZYR C;  3VA5 A;  4JOI A;  3NUC A;  3KDF B;  2R7F A;  4EQN A;  3CC4 A;  5IIF A;  3PIP 3;  5JVH 3;  3RLF A;  4NW2 A;  3NSW A;  4OEL B;  1EYC A;  2ZM6 L;  4DAM A;  4LF6 L;  3GTM B;  1OXT A;  2VUM B;  3OMG A;  2F4V Q;  3Q6S A;  5E4W C;  1B3Q A;  1Q1E A;  1EFI D;  3D4D A;  4HTH A;  5M5X H;  2EY2 A;  3TEH B;  5ELD A;  2UUA Q;  4IFD G;  2FHT A;  3GTO B;  2R7Z B;  4R9W A;  4JI8 L;  3NWT A;  3IRB A;  4DR6 Q;  1CI3 M;  2I5L X;  4NKL A;  3MC0 B;  1SJH D;  3CQZ H;  3VR4 A;  3OMC A;  4DR1 Q;  1Q12 A;  2PCF B;  1WJJ A;  1OXU A;  1VQ7 A;  1KD1 C;  4H44 C;  4L5Q A;  1Y8N B;  2EXZ A;  1G8Z D;  2E2I H;  1X9N A;  2BA0 A;  1EY8 A;  3FEW X;  4XYQ A;  4C3J G;  1I5F A;  2QA4 A;  4L8J A;  1AEX A;  4A3B B;  4BXX H;  3NQI A;  3OYY A;  5JJL A;  4GN3 B;  2K32 A;  1NMF A;  4QUC A;  1NBW A;  5IY0 A;  2MGS A;  1JMC A;  1TWH H;  3HKZ B;  5I2X A;  3NWS A;  3IFD A;  4KKS A;  4GZY C;  3V2T A;  3AMU A;  5FLX L;  3GO5 A;  3OIQ A;  1VQM A;  4NXM Q;  1OXS C;  5FLX c;  1CSQ A;  2TSS A;  5C3E B;  1O80 A;  2YTY A;  4NXN L;  1H9J A;  4RGT A;  2HCC A;  2BA1 A;  5M3M G;  4K5V A;  5C4X H;  1YVC A;  2EYP A;  2L0C A;  3KF8 B;  4TVA B;  1R9T B;  4FO2 A;  3DWQ A;  1VF5 C;  4LUO A;  2Q2U A;  1EY0 A;  2XWB B;  3G48 A;  5FK9 C;  2IWH A;  2WB1 E;  3BG3 A;  3GV3 A;  4XT3 B;  2A6E C;  3I91 A;  4LF5 L;  5A2Q E;  1K3B C;  4DKA C;  1SE8 A;  4L5R C;  1GO3 E;  1STH A;  2OQ0 A;  2KA7 A;  1STA A;  2OQK A;  4C1N I;  4XXE A;  2WKD A;  1E0B A;  1HHV A;  3VDY A;  2F52 A;  5FLM G;  2UUC L;  3KF6 B;  4CGY B;  2JA5 H;  4X64 Q;  1PRT B;  3BYT B;  4OO1 G;  3E9H A;  5M3F G;  3KFU A;  4DXG A;  1LUZ A;  3PO2 B;  4DXF A;  2XRQ D;  2Q2I A;  1PFS A;  3DXJ C;  1Y69 U;  2IX1 A;  3K0X A;  4BBS B;  2K52 A;  5IWA L;  2X6L A;  3QOL A;  4BY7 G;  3S1Q B;  1U5K A;  1HZA A;  5CYU A;  4JBM A;  3NXW A;  1E2Z A;  2K04 A;  4QGU A;  5JJK A;  1B44 D;  4KN7 C;  1TQO A;  1KNE A;  3E6Z X;  3UDF A;  1TS5 A;  3KLS A;  3QJY A;  1TY2 A;  2N78 A;  4PZ8 A;  4XTC S;  5CV6 A;  2K5Q A;  3J81 E;  4C2M B;  4RWS C;  1GUG A;  1CZW A;  1GUN A;  4HJA A;  3T1Y L;  3TDQ A;  2F0T A;  2NWG A;  1ENC A;  3HOU B;  3SEB A;  1GUS A;  1HH2 P;  1D7Q A;  4FF1 A;  2F0K A;  2CVR A;  3HKS A;  1EFW A;  1L0X B;  3NEN A;  2A74 C;  4DR1 L;  4A3K B;  2JEB I;  4DGZ A;  3I70 A;  2VS1 A;  1A8V A;  5C3X A;  3J7Y W;  4YCW A;  3CXC A;  4JPB W;  3S14 H;  4LF7 L;  1KLG D;  2MFI A;  1M4V A;  3I73 A;  4NPS A;  3JAM i;  1I94 Q;  4ODG A;  1XMO Q;  1Q86 C;  5IYC H;  1NJI C;  3Q23 A;  3T4A C;  5C44 B;  1A0I A;  1O7I A;  5GAD C;  2BH8 A;  2KHS A;  2K01 A;  1K83 B;  5EAY A;  2SEB D;  2CH4 W;  4G4K A;  4FF3 A;  4JI6 Q;  4ZQ3 A;  3OTO L;  3OIP A;  1VQB A;  4RKB A;  1EIH A;  2OWO A;  1SR3 A;  4GN4 B;  1XXG A;  5A2Q L;  4HCE A;  3M4O B;  5JOB A;  1E22 A;  2UXB L;  3VYR A;  2XTI A;  1HTP A;  1FNW A;  2KCM A;  2KBN A;  3S24 A;  2EE1 A;  3LWU A;  1J8I A;  1C48 A;  1UE6 A;  2F3W A;  2A5H A;  4ZRZ A;  3I4O A;  1CTM A;  1XJV A;  2B2T A;  2PW5 A;  3A55 A;  4J8Q A;  2K03 A;  2JEA I;  1HXY D;  5CC4 A;  1MGS A;  3CHB D;  3EJI A;  2F0M A;  3L2P A;  4FF2 A;  1GHJ A;  2RSN A;  2B2W A;  4ABN A;  2NTS A;  4N9P A;  2VUM H;  3GTM H;  3NEL A;  3I90 A;  5KNC A;  3BDL A;  1EOT A;  3SK8 A;  1N34 Q;  3IFT A;  2B2V A;  2YV5 A;  4P74 A;  5FO9 B;  3KYH C;  1RHP A;  2R3Z A;  3UDX A;  3TME A;  1V9P A;  3J81 L;  1EQT A;  1T5X D;  3ULL A;  4RGO S;  3J81 c;  2R7Z H;  3GTO H;  1EYG A;  3IKJ A;  3HOW G;  1JR0 D;  4OON A;  3WDN A;  2RCF A;  4LFC Q;  2QKI C;  4DR7 Q;  3P7J A;  3H94 A;  1WVL A;  4A3C G;  4OX9 L;  1QIL A;  3L3O C;  1IBM Q;  4H02 A;  1J6Q A;  1Y14 B;  3D31 A;  3L0O A;  4DR5 L;  3GTQ B;  4A3B H;  1GJX A;  2EY5 A;  4CDF C;  4Y7N B;  4GNX B;  2IPK D;  1EYA A;  2BE5 C;  3STB C;  3TP8 A;  3LWE A;  1S4Z A;  2WKC A;  4ALP A;  1ZXT A;  1U9R A;  3SE0 A;  4GKJ L;  1F9R A;  1SRU A;  1D5X C;  1HFG A;  3FDT A;  1YNN C;  2JK8 A;  1HRJ A;  1KDA A;  2EJM A;  4UPA A;  4C3J B;  4O42 A;  2B39 A;  5ELF A;  2A69 C;  3TZU A;  2CCZ A;  4QCL A;  2QF7 A;  1B8A A;  3P75 A;  3M7N A;  4EQP A;  4KV6 A;  2Y0S G;  1QNK A;  1O7Z A;  4R4I A;  5C3E H;  1NSN S;  1RL2 A;  4KHP L;  2AUJ D;  3FKI G;  2IX0 A;  1HNW Q;  3I4L A;  2ID0 A;  4LF4 Q;  1HPC A;  3AYH B;  4CDE C;  5KRU A;  1F2Z A;  5KYI A;  4JG2 A;  5LL6 X;  1R9T H;  1X55 A;  1VQ8 A;  2UU9 L;  1A6X A;  2WP8 J;  2NZ1 D;  2IHF A;  5EPJ A;  4DU9 A;  3HGB A;  1I4Q A;  4YCU A;  1KC8 C;  1HQM C;  4UDU C;  5M3M B;  1KL9 A;  3I4M B;  5M5Y B;  2MO0 A;  2I07 B;  3CAM A;  1V8Q A;  3OHX C;  2ZTE A;  1STN A;  3JC6 6;  2N3S A;  1I6V C;  1DON A;  1VMP A;  2NVT B;  1TII D;  1HJP A;  1IBL L;  4WJ4 A;  1ESF A;  3M4Q A;  1PYB A;  4UY8 C;  3K5N A;  3HZX A;  1SE4 A;  1E24 A;  2A73 B;  1YI2 A;  1Y1W G;  1I50 B;  4ILW A;  1VQA A;  2G5D A;  3A5U A;  5IP7 G;  4JW0 A;  3PO2 H;  5BR8 Q;  1Q90 A;  1CFM A;  1TWF B;  4FP5 D;  2EJG C;  1B1Z A;  2WFW A;  4FDB A;  4BBS H;  3ZYY X;  1G51 A;  5CV9 A;  3S1Q H;  3TN2 A;  5I6Y A;  1WCM B;  1L1O A;  2UXD Q;  2VQF L;  1VQJ A;  5IT9 L;  5M3F B;  1SSO A;  2PYK A;  4YIJ A;  2RSO A;  5IYB G;  4OEM B;  2HDL A;  1I6H B;  2JJQ A;  2R92 G;  3HOU H;  2WV6 D;  1B4O A;  1YHB A;  4ZLT F;  3PMF A;  1XNR L;  5EPK A;  3ULP A;  4A3K H;  5KNB A;  5ISR A;  3D4R A;  1MIU A;  1A2T A;  2EZV A;  3KBX A;  3I7F A;  3U50 C;  4M8A A;  3DEP A;  1LO5 D;  1I3Q B;  4IPG A;  1JE4 A;  1Q81 C;  1IXR A;  2MJ8 A;  1PH1 A;  1V1O A;  3HOZ B;  1G6Z A;  5IGG A;  1PH2 A;  4DV3 L;  1TXY A;  1KTK A;  1IZ6 A;  1TU2 B;  5C44 H;  1TS2 A;  4R4Q A;  4A3L H;  4RGN A;  1IYU A;  4BA1 I;  3J7A 5;  1LTA D;  1K83 H;  4EX5 A;  1ENF A;  4J1M A;  3VR3 A;  2D9U A;  3U58 A;  1X6O A;  2K5D A;  1YBY A;  1BQQ T;  2H4O A;  1MHW C;  4PZ6 A;  2L15 A;  2JA7 G;  3M3Y B;  4K0K L;  1XNQ Q;  2A6H C;  1HR0 Q;  4AQY L;  5C4Z A;  3TRE A;  1RKN A;  2VB2 X;  1RTN A;  4IPD A;  4MIU A;  2D2C C;  3GTP B;  1H95 A;  3S1R B;  4ID6 A;  2F0H A;  5E1F A;  5IGD A;  4DV2 L;  1DYQ A;  1EZ8 A;  4HIK A;  2IL8 A;  5A35 A;  1Z6H A;  4O0A A;  4IUT A;  3MHB A;  4HJ5 A;  4A3M G;  4JYA Q;  1EY6 A;  4UP7 A;  1YJW A;  1JOQ A;  1PH4 A;  1VQH A;  4RCN A;  5GRO A;  3BZK A;  2E2J B;  1PH3 A;  1ENA A;  2GN5 A;  3ND8 A;  3BJU A;  1STE A;  2B2Y C;  3CRL C;  1DCZ A;  3T1H L;  1BF4 A;  4A3G G;  3SR1 A;  2FJ2 A;  2PW7 A;  2CQO A;  3OWE B;  4E6I A;  1HNX L;  4IFD I;  3D3R A;  2F0S A;  1SYB A;  4I7A A;  3A5Z B;  4RHR A;  1Q8I A;  5IGF A;  2HQE A;  4G7H C;  1PTO C;  3DM1 A;  1PXU A;  3RZD B;  3PO3 H;  2Z6B A;  2OF1 A;  2B63 B;  1EQR A;  4KHV A;  3BVG A;  3SVM A;  1EU3 A;  3BZC A;  2EQS A;  4KD3 A;  2F0G A;  3I72 A;  1LT4 D;  2AHO B;  4IJH A;  4IFD H;  4YY3 L;  3K0Y A;  3NBI A;  3PUW A;  3GTQ H;  3FRP B;  4Y7N H;  3RMH A;  1Q1B A;  3BZD B;  3R2T A;  3TBI B;  1CM9 A;  1G2S A;  1IHZ A;  2PQA B;  4RH6 A;  4B9W A;  1STG A;  2Q2H A;  4YHH L;  2Z1C A;  1RIP A;  5J3B A;  4C3J H;  1XPR A;  4X3U A;  4FXG C;  3S16 B;  2F0N A;  2F0Q A;  2R93 B;  4DUY Q;  1S5E D;  1N33 L;  4JI0 L;  1LTT D;  2NVQ B;  2AWO A;  5C0X G;  4GKK Q;  2BDN A;  2B2U C;  4DFA A;  4C3H G;  4POF A;  4ME5 A;  4IPC A;  4JK1 C;  4R4O A;  1BCP B;  2DN8 A;  5LHY 1;  1K0R A;  4R4T A;  5CV4 A;  2CKZ B;  1HR0 W;  1CKN A;  4ULL A;  3CU7 A;  5KEE A;  1GUT A;  1VQ5 A;  4DV4 L;  1JOK A;  3MVV A;  2K4K A;  1MI2 A;  3FKI B;  1VQL A;  5M3M H;  4LUV A;  5M5Y H;  1C7Y A;  3I4M H;  1H9K A;  3D4W A;  3GDE A;  4EVO A;  5E7N A;  2F0W A;  1JCK B;  1HZB A;  4BY1 G;  1Q7Y C;  4IFD J;  4IO9 A;  4H13 C;  5I9O A;  5JEA G;  2A68 C;  1HR0 L;  2Z6K C;  4Y52 H;  3MTS A;  2L11 A;  2NVT H;  3VR2 A;  1X54 A;  3R2I A;  4F7X A;  2Z9H A;  5E3F A;  1B9M A;  2KEC A;  3VYS A;  4A3D G;  4IUV A;  1BXT A;  1I50 H;  2EPB A;  2L5T A;  1HZC A;  5FJ8 G;  3PF5 A;  4A3F G;  1ASZ A;  4K5X A;  4MZ9 A;  1AE2 A;  1TWF H;  1STY A;  3PUZ A;  5FLM H;  4P75 A;  1RDP D;  4PV1 C;  1WCM H;  4NB3 A;  1Y1W B;  4B08 A;  4DV6 L;  5JPN C;  4X62 L;  4BBR G;  5M3F H;  5G3L D;  1QVC A;  1HCZ A;  1K0S A;  5AFW A;  1GM5 A;  4XDX A;  3K5O A;  1QOH A;  1I6H H;  2O4X A;  3VYU A;  3A7L A;  2BCO A;  1KQS A;  2NTT A;  1GXD C;  3J81 j;  4K14 A;  2I0Q A;  1SRO A;  4P71 A;  4A93 G;  4A4I A;  3CRK C;  3CCL A;  2DJF C;  2F0L A;  2IX3 A;  3C1E A;  3SK5 A;  5CR3 A;  2E8G A;  4AH6 A;  3I2Z A;  4H0L C;  3QB3 A;  2B8F A;  3OPO A;  1K9M C;  5IGC A;  3F2C A;  2CHB D;  1CKM A;  3MXP A;  1EY5 A;  1I3Q H;  2QIL A;  5FKA C;  1EWI A;  4LUZ A;  3HOY G;  3K81 C;  5C4J B;  4CHT B;  1C8C A;  2DY7 A;  2VZA A;  1AE3 A;  4M1U B;  3HOZ H;  1SYE A;  4HMJ A;  1JWU D;  1X3Q A;  2K14 A;  5IOC A;  3ERS X;  4JI4 Q;  3A0J A;  3UI2 A;  2Y0S E;  5LMU Q;  2I5M X;  3HG9 A;  2Q2T A;  3GTK B;  1PA6 A;  2RDF A;  4X6A H;  1WTO A;  1N36 L;  3H91 A;  3I56 A;  1CSP A;  1FL0 A;  1Y1V G;  1IYJ B;  2L12 A;  2SOB A;  3M3Y H;  2G9H D;  4GNX C;  5EQ0 A;  1EY9 A;  1YNJ D;  4QB4 A;  1G6P A;  5FO7 B;  3E9I A;  1L1O B;  1V1Q A;  4KY5 A;  2DY8 A;  3GTP H;  1ZYR D;  4QY7 A;  3S1R H;  2GVA A;  3C1F A;  1QVF A;  1VQO A;  2J7Z A;  3A74 A;  1WTW A;  1U4P A;  1ILP A;  1CA6 A;  2JA7 B;  4PMW A;  1EQQ A;  1VCI A;  2KHI A;  4JOI C;  4AYB G;  3KLR A;  1FJG Q;  1PTO B;  1VQN A;  5EJW A;  2E2J H;  1E7Z A;  3J7Z C;  4XT1 B;  2JP1 A;  1GUO A;  3I55 A;  5COY A;  1Q8K A;  2RKS A;  5M5W B;  4KTA A;  4UHV A;  3ERO A;  4JI7 L;  1EUJ A;  3Q0A A;  4A3M B;  5BN5 A;  1SNO A;  4X66 L;  5K36 G;  3DWA A;  5CGK A;  1BVS A;  1HQR D;  4IPH A;  3Q24 A;  4C3I G;  4R8I A;  4GLA C;  3RZD H;  1VQG A;  4MNO A;  2B63 H;  1TWC B;  1NMG A;  1MKH A;  3MWY W;  1MJC A;  4B3T Q;  5IE8 A;  1Z7T A;  1KAW A;  5DM7 3;  1D8L A;  4A3E G;  2PQE A;  1UEA B;  2VY3 A;  1K8A C;  2AUK A;  5IOD A;  2JA8 B;  2NN6 G;  3CME A;  5DNF A;  2F4V L;  1FNV A;  1HFN A;  3H6M A;  1KDB A;  2F0V A;  2KQ3 A;  2K28 A;  1YNX A;  2X6G A;  2LMC B;  3RUZ A;  4ZKB B;  2UUA L;  1OXX K;  4KMU C;  4JI5 Q;  1JOR A;  3K6O A;  3OOC A;  2F0P A;  3CCJ A;  4DR6 L;  1K8O A;  1PZJ D;  1FYC A;  4HSV A;  1LTR D;  2Z4I A;  4OHJ A;  1YHQ A;  4LK1 C;  3S16 H;  4DNR B;  4CKE A;  3FP9 A;  1KAA A;  2R93 H;  2MUY A;  1C4Q A;  1FGB D;  3W3A A;  2NVQ H;  2K50 A;  4HN7 A;  3TP7 A;  2VL6 A;  4K6L A;  2DJG C;  1STB A;  2OEO A;  1IL8 A;  2A6E D;  1A3T A;  2ICE C;  2UUB Q;  4IN3 A;  4DAV A;  1UAP A;  2EDG A;  4P73 A;  4DK1 A;  3QWN A;  1F2M A;  1ICW A;  2H5X A;  5KIX A;  1PYS B;  2YU9 B;  1PH5 A;  1GHK A;  3FKI H;  1D1I A;  3U4Z A;  4C3H B;  4QF4 A;  1CUK A;  2RHS B;  3EFX D;  5DAU A;  3LGJ A;  5AJ3 Q;  2NVY B;  5LMN Q;  2AQ1 B;  4NXM L;  2KVM A;  1LT5 D;  1QG7 A;  1S3O A;  1JJC B;  3GTJ B;  2CW0 C;  4RHS A;  1I4R A;  1I4P A;  4CBV A;  4WRD A;  3MEF A;  1AW7 A;  3PUV A;  1LM0 A;  4N9T A;  4CKB A;  3TRZ A;  2B29 A;  1Q3L A;  1VQC A;  2EIF A;  1VQ4 A;  1YHA A;  3MXN B;  1V1P A;  1PRT F;  4DV1 Q;  4BY1 B;  4DV7 Q;  1LV9 A;  1T5E A;  1W6K A;  4XYO A;  1HTL D;  4P2C B;  2FXQ A;  1EOV A;  4JV5 Q;  4GN5 A;  5D14 A;  3CCQ A;  3J80 E;  4RA8 A;  1MJE A;  4MTN A;  3M7G A;  1WTV A;  2F03 A;  1GVP A;  4UP9 A;  1Z9F A;  2HUG A;  3KBG A;  4A3D B;  5G3L F;  1Y1W H;  4XQJ A;  5JJZ A;  3M4P A;  4A3F B;  5IP7 H;  2M2L A;  4KY7 A;  1D2B A;  3AFQ A;  1XTC D;  1CQV A;  1X65 A;  3PV0 A;  1LTL A;  2KHJ A;  1CK1 A;  3HP3 A;  4X64 L;  1B53 A;  4MN3 A;  3U9S A;  2NYZ D;  1U4R A;  3LX0 A;  3P1H A;  3QO2 A;  5CBE E;  3V96 A;  4B3T L;  1SMY C;  5KND A;  5ELN A;  1CKN B;  3AU7 A;  5IYD G;  1R4Q B;  3MFY A;  3A8J E;  1YIJ A;  3UDI A;  2MQH A;  5E4X A;  4JI1 Q;  2C35 B;  3EA6 A;  5KYL A;  3OWF A;  4A93 B;  1JJG A;  5C4J H;  1E1T A;  2ZXO A;  1H9S B;  2KCN A;  4DAY A;  1DOK A;  2A19 A;  1QB5 D;  2EVB A;  3BDC A;  3EQL C;  3SDZ A;  1TWA B;  2AQ2 B;  2CQA A;  4K6D A;  1SFO B;  2NUC A;  4QMG A;  1QCB D;  4V19 0;  3GTK H;  4IUU A;  5DEH A;  4WFN 3;  2D62 A;  4X65 Q;  2HHH Q;  3HOY B;  1SBB B;  2K75 A;  4JI2 Q;  1ZKO A;  1PMR A;  1KNA A;  1SMX A;  4LWC A;  4V0B A;  1I94 L;  1NY4 A;  1KHI A;  1XMO L;  5HGQ A;  3RN2 A;  4PMB A;  5ELE A;  1P16 A;  2YYZ A;  2B2T C;  3KDF A;  2CFM A;  5FO8 B;  5IYC G;  4NDX A;  1Y1V B;  2Z0S A;  3DM3 A;  2JA7 H;  1RD9 D;  3KLS X;  3E3X A;  2PNH A;  4RKL A;  4IUR A;  1K3R A;  1EZ6 A;  1N32 Q;  2VXW A;  1PTO H;  3NP8 A;  2F1M A;  3PSI A;  2B2W C;  1DOL A;  4JI6 L;  4DV0 Q;  4RFB A;  2F0J A;  1CA5 A;  4DUZ Q;  4GOP A;  1HUM A;  3NBH A;  1HNZ Q;  1G91 A;  2RHQ B;  3J80 L;  1ESR A;  2CWP A;  3I4N G;  3J80 c;  1BCP C;  4LF9 Q;  5M5W H;  2B2V C;  3DLL A;  2PZW A;  4AIM A;  1NAP A;  1HA5 A;  1EY7 A;  1QZH A;  3D6W A;  3W1G A;  3SGI A;  2J0T D;  4A3J G;  4JVZ A;  3NE5 B;  2SDF A;  3I8Z A;  2ICI A;  3BYY B;  5DLQ E;  4U67 3;  2KUM A;  1TWC H;  3CCM A;  5TSS A;  2YTX A;  3OW7 A;  1NTG A;  2BH2 A;  1VQF A;  4TRD A;  1JOO A;  2K1B A;  2JA9 A;  2AKW B;  2K6A A;  1MSG A;  3STB D;  1IL2 A;  2IHE A;  3NK9 A;  4YCV A;  1JT8 A;  3HEJ A;  3O13 A;  4C3I B;  2JA8 H;  5T1G A;  2XWJ B;  3NEM A;  2LKV A;  4B3M Q;  2E5L Q;  4O1N A;  2RQX A;  4OXP A;  1N34 L;  2YTV A;  1PHJ A;  2A69 D;  1IKM A;  4C2M H;  1JE5 A;  4B3S Q;  5JJI A;  3DUZ A;  4A3I G;  4A3E B;  3J7A V;  4BY7 B;  3S1N B;  2K5H A;  3WWV A;  4JBJ A;  4YWM A;  4LFC L;  4DR7 L;  2SNS A;  5C5L A;  5HUR A;  1Z47 A;  2RCN A;  3A56 A;  1QJO A;  5T1I A;  1SYG A;  3PIO A;  1PH9 A;  2NB0 A;  2PO4 A;  4JI1 L;  3KF8 A;  1IBM L;  2EYM A;  2L1B A;  1QZG A;  4HSP A;  3GQB A;  2O2L D;  3ICE A;  2KCC A;  4U68 A;  5K5P A;  4POG A;  1MD2 D;  1NR4 A;  3PUX A;  3T13 A;  5I9P A;  1JWM D;  1XWE A;  2XIW A;  3TP6 A;  1LTS D;  3ZJY C;  2VQE Q;  3BDO A;  1LT6 D;  2HHH L;  4C3H H;  1A3U A;  4DR3 Q;  4CJ0 B;  1PVO A;  3URY A;  3HOX G;  2NVY H;  4JBK A;  3M85 A;  3QR8 A;  2EY1 A;  1F2Y A;  1LLR D;  4JI3 Q;  2UXC Q;  4HJ9 A;  4KD4 A;  2ZT9 C;  5GAH C;  3GTJ H;  4KN4 C;  3M4O H;  4LFA Q;  1ET6 A;  1QE6 A;  3PCO B;  4AYB E;  3G7L A;  4EQ5 A;  5KGU A;  1HNW L;  4RAU C;  3RN5 A;  4LF4 L;  2JQO A;  4KLK A;  5EKI A;  1NUC A;  4FXD A;  5CMD A;  4BY1 H;  4IAL A;  1RTO A;  2BDO A;  3I3C A;  1F2L A;  2NVX B;  4KK7 A;  3KUP A;  2QEJ C;  4KJN A;  2LY7 A;  2B3G A;  3T53 B;  3W2D A;  4A3D H;  1L1O C;  4QIW B;  2K33 A;  1LAC A;  2HD3 A;  3HFZ B;  1PH6 A;  5FJ8 H;  4A3F H;  2AWN A;  4B3R Q;  1GOZ A;  1IW7 D;  1SAP A;  1WTQ A;  4FF4 A;  1IYV A;  4WJ3 M;  1SYD A;  1FD7 D;  1TY0 A;  3ERQ A;  1PZI D;  4HJ8 A;  5GQO A;  1XMQ Q;  4Q5V A;  3MA2 B;  1B7Y B;  2ZXR A;  4TSS A;  5BR8 L;  4LJZ C;  2F4I A;  4HAE A;  2K5N A;  3TZD A;  3H0G G;  2H1E A;  4J15 A;  3PO2 G;  3SK6 A;  1EU4 A;  2ZM6 Q;  3KJO A;  3H3V I;  4CJ1 B;  4DNI A;  4RMF A;  3CD6 A;  1L0Y B;  1PDQ A;  2UXD L;  4A93 H;  2HT1 A;  4LMQ D;  3HOW B;  5COR A;  3E5S A;  3N6R A;  5JVG 3;  3MXG A;  4NMZ A;  1VQI A;  1VQK A;  4CDD C;  3EN2 A;  4TKO B;  4B3S L;  2OXP A;  3M4Y A;  3MZ5 A;  5D65 A;  1TWA H;  4JI8 Q;  1X3P A;  4HID A;  3PIO 3;  3HOV G;  2OT2 A;  2XGT A;  3TQY A;  1SFO H;  4QUF A;  2RDG A;  4WJW A;  5GAE C;  3HOU G;  3FVQ A;  3H3V H;  4EQO A;  3HOY H;  1WFQ A;  2DUD A;  1I4G A;  3S2D B;  4DF7 A;  5J1Z A;  3P20 A;  5NUC A;  3N52 A;  1XYI A;  4DK3 C;  1SEB D;  2L4N A;  2ZTD A;  3NTH A;  1SDF A;  4LW1 A;  1UEB A;  1L2F A;  2L9H A;  1TT2 A;  3CF5 A;  1BBX C;  4L5S A;  2OTL A;  4OIK A;  4DN4 M;  1SJE D;  3T56 B;  1BKB A;  2KEE A;  1Y1V H;  1YIT A;  1EWH A;  2Y0S B;  1XPU A;  4XIG S;  4DK6 C;  3RZO B;  3Q8D A;  4DR2 Q;  1XTD A;  2FIN B;  4IUN A;  2WAC A;  2A1A A;  1L0W A;  4QIW E;  1UE7 A;  1X56 A;  3F2U A;  4NXN Q;  2XRS D;  1XNQ L;  1M8A A;  3NHH A;  4GS3 A;  4BA2 I;  1GD7 A;  4LFA L;  1ROD A;  2IT1 A;  4PMC A;  3RR5 A;  4C56 C;  5I4D A;  1XX8 A;  4R1J A;  3CCR A;  4OO1 I;  2ENB A;  3U9O A;  1G2T A;  3MAQ A;  4DAY B;  1W2B A;  3X3M A;  4LF5 Q;  4JYA L;  1RCV D;  1SN8 A;  3I4N B;  1RJT A;  1PRT D;  1YZ6 A;  1DXM A;  2NN6 I;  4GNX A;  5K36 H;  4HCS A;  2C5C A;  1ZEQ X;  4C3I H;  3OW2 A;  1K8M A;  4A3J B;  4KY6 A;  4OO1 H;  2UUC Q;  3C46 A;  3RLN A;  1PV4 A;  1HUN A;  2IJ0 A;  2EOT A;  3AEV A;  3J7A F;  1QVG A;  1DD2 A;  1EIF A;  1ILQ A;  1QWY A;  5EPL A;  5DM6 3;  1TWG B;  2VW9 A;  3TS2 A;  1NCV A;  4A3E H;  2FMM A;  4L5T A;  2MPM A;  2Z4H A;  1SE2 A;  1PFB A;  3CMA A;  3S1N H;  1F9Q A;  2F3I A;  2ZJQ A;  3H09 A;  4BY7 H;  2NN6 H;  4DPG A;  5IWA Q;  3JAM E;  3PO3 G;  4YWK A;  2JSO A;  2ZTC A;  3HRZ C;  4ZUJ A;  2AQ3 B;  2R92 B;  3H15 A;  4GOP B;  3NBH B;  4A3I B;  4Z9C B;  4LNQ A;  1FR3 A;  5IP9 G;  2F0U A;  3T1Y Q;  1KXL A;  1LYL A;  1KAB A;  1LTB D;  1SYC A;  5EKK A;  5C5M A;  1S72 A;  5C4H A;  1GUW A;  1BCP F;  4F8M A;  3D0F A;  2A68 D;  3L7Z C;  2XSC A;  3GD7 A;  2DGY A;  4QL5 A;  2QW7 A;  3EVQ A;  1JWS D;  2JN4 A;  4LF7 Q;  3A8I E;  4RGM A;  2K5W A;  4DUY L;  4ZK9 B;  2EYF A;  3DEO A;  4IQZ A;  1N9W A;  3A8K E;  3SHL A;  4GKK L;  4X3S A;  5CBA E;  1YJ9 A;  3Q22 A;  1DM0 B;  2DNE A;  2L55 A;  1CQF A;  1B3A A;  2NZH A;  4IUQ A;  4PQX A;  3HOX B;  2JA6 G;  1H9M A;  3H3V C;  4J6H A;  3G71 A;  1D5M C;  2O5J C;  2XVS A;  2E2D C;  2NVX H;  4DR2 L;  3CPF A;  3WOF A;  3OTO Q;  4UAI A;  2MP1 A;  1TKW B;  1BO0 A;  2A8V A;  1JJ2 A;  1VQ9 A;  3UE0 A;  2EYH A;  2UXB Q;  2QEX A;  3F1Z A;  2E2H B;  2ZJR A;  1NNX A;  2M00 A;  3I4M G;  4JC0 A;  3K80 C;  4K8I A;  1PFM A;  4Q0F A;  3KLW A;  3KOJ A;  4APV A;  2OTJ A;  4KJO A;  2PMZ B;  1M90 C;  1S5F D;  4KHZ A;  1ONL A;  5IGE A;  3KJP A;  1BOS A;  1I4X A;  5ELC A;  2WAQ G;  5BN3 A;  1C9O A;  4HIO A;  3PF4 A;  4A3G B;  1W6J A;  2SNM A;  4IZ8 A;  3ER0 A;  3JAM L;  5L37 A;  3EBE A;  3JAM c;  2DNC A;  3HOW H;  1II3 A;  1F77 A;  1WCM G;  3DMU A;  3CCS A;  3K58 A;  4DA2 A;  3H0G B;  1S5B D;  1B70 B;  5IYD H;  1H9R A;  1D5Z C;  3FHW A;  3R93 A;  2NZO A;  1TR5 A;  4A3C H;  1Y8O B;  1CHQ D;  1SNP A;  1AP0 A;  2OCE A;  3K8A A;  1DJR D;  2PI2 A;  4EGV A;  3S2D H;  1TVX A;  4OX9 Q;  3G4S A;  2Z8L A;  3MEH A;  4A75 A;  1ET9 A;  1VQP A;  4DR5 Q;  2D0O A;  3HOV B;  2N88 A;  2RA4 A;  3NTI A;  2Q8T A;  5M9O A;  4LF8 Q;  1K8G A;  3V05 A;  1YJN A;  4BS9 A;  3LNN A;  1E1O A;  4GKJ Q;  3CC7 A;  4RCO A;  2Q8R E;  2RBM A;  4BXX G;  4GLX A;  4JI4 L;  1WTH A;  3HKZ E;  1PFN A;  3HOZ G;  4HMI A;  5LMU L;  4LFB Q;  1EIY B;  3CPW A;  3RZO H;  2F0E A;  1UUP A;  3M9B A;  1VMC A;  3T16 A;  2QDL A;  3G6E A;  1PTO F;  1WYD A;  1WI5 A;  1DOM A;  4OL7 A;  2LXJ A;  2WII B;  3ULJ A;  3PGZ A;  3EIV A;  3SXH A;  1CT1 D;  3GTG B;  1K28 A;  5C3W A;  4KHP Q;  3MXU A;  1EL0 A;  2KOL A;  1Y8P B;  1WOC A;  4L6T B;  3GTL B;  3AFP A;  5LL6 S;  1AZP A;  1C0A A;  1IKL A;  3K59 A;  3VR6 A;  4OIJ A;  1OO9 B;  4PG3 A;  1BDO A;  4HIM A;  2PMZ E;  2MNA A;  4QQB X;  1VS0 A;  2UU9 Q;  1B9N A;  2PNR C;  2KEN A; 
#chains in the Genus database with same CATH homology
 2KED A;  3ITP A;  4XQN A;  2VB3 X;  3S15 B;  4MHE A;  1VF7 A;  4ZAI A;  3S2H B;  1JC7 A;  4F87 A;  3C2P A;  2EJF C;  4G7O C;  2VNU D;  1WD0 A;  2PPB C;  2HDM A;  2JXM B;  1E2V A;  2C9O A;  4KKT A;  1PZK D;  4KKU A;  4K8J A;  4BBR B;  1LTI D;  4FYD A;  4C1N K;  2O5I C;  3A7A B;  2G9D A;  3FMC A;  2HCI A;  2F0D A;  3T51 B;  3BS1 A;  2JYO A;  3VA7 A;  3PO3 B;  1PYW D;  1EEF D;  1WTX A;  3NTK A;  2D5D A;  1AFP A;  1S5D D;  3GP7 A;  4HED A;  4IUP A;  3S1M B;  2CW0 D;  5IT9 E;  4DK0 A;  2M9V A;  3FPU B;  3S17 B;  1EIG A;  2PZT A;  1E2W A;  2E75 C;  3NQT A;  3IL8 A;  2X69 A;  4G7Z C;  4FVM A;  2F3V A;  2GA4 B;  3R3O A;  1F9P A;  2QCP X;  2MHV A;  3NPP A;  5EKL A;  2Q8I B;  1BUV T;  4FXK C;  5ELB A;  4ZKC B;  5D3D A;  1O7L A;  3G6J B;  4B9X A;  2K7V A;  2FMC A;  1X32 A;  5J22 A;  2JA6 B;  2RDH A;  4PNY A;  1SMY D;  4AYB B;  3C3L A;  4L63 B;  3QOJ A;  4R8N A;  4XQQ A;  3WOE A;  2PZU A;  3E0J A;  2XN9 C;  3K7A B;  2BE5 D;  2LFN A;  1O7Y A;  5HGT A;  3IAY A;  1D6E C;  1YNN D;  2EYL A;  2WAQ B;  3DWP A;  1B50 A;  4DAP A;  3VYT A;  1WD1 A;  1A3V A;  1U4M A;  2F0F A;  3L9A X;  3MFG A;  4F88 A;  3R8B A;  1LT3 D;  1R4P B;  5C0X I;  1U4L A;  2B2Y A;  4DNT B;  5F2D A;  3QIA A;  1F9S A;  1UNS A;  1A2U A;  2N55 A;  3DHQ A;  5M5X B;  3PUY A;  1SXT A;  1TS3 A;  2KJX A;  3HS0 C;  1MSH A;  2LS0 1;  3QG1 A;  3CKI B;  4X3T A;  4JBW A;  1IW7 C;  3CQZ B;  3D8G A;  1O78 A;  1BCP D;  5C0X H;  1SNQ A;  1JIC A;  1EY4 A;  1QNU A;  3TP5 A;  1NR2 A;  2E2I B;  4WOR A;  4K2L A;  2ZXP A;  2WIN B;  2EYJ A;  1V43 A;  4FNF A;  2I46 A;  2EY6 A;  5EBD A;  5J39 A;  1CHP D;  2TMP A;  5BN4 A;  1LTG D;  4LAA A;  1TWH B;  5CV8 A;  1AN8 A;  3S9W A;  5JEA H;  5D3I B;  3K57 A;  4KI0 A;  2F0I A;  5CV5 A;  3RD4 A;  3SK4 A;  1KLU D;  2B2U A;  2JE6 I;  5C4X B;  4I7Z C;  1EEI D;  2RVL A;  1SND A;  2FFK B;  4HR7 B;  2NBF A;  5C0X J;  1J9O A;  5CV7 A;  4CKC A;  4OGQ C;  2K05 A;  2IW3 A;  3A54 A;  2XNA C;  5EBC A;  3GV6 A;  2EYO A;  2R61 A;  3K5L A;  1D1K A;  2JA5 B;  3D6C A;  2J4X A;  1JQY D;  4K5W A;  3ONA B;  3K5M A;  1B2T A;  5JEA J;  2V4D A;  2A6H D;  3TSS A;  4ZUI A;  2E74 C;  1V1P B;  1WTP A;  1G29 1;  3BVZ A;  3AB9 A;  1RF2 D;  1PRT C;  1SNC A;  3VR5 A;  1WTR A;  1SE3 A;  3MXN A;  3BVM A;  1A15 A;  4S3S A;  4H7B A;  1EWC A;  1TS4 A;  3ND9 A;  1BNZ A;  2BOS A;  1VDZ A;  1AZQ A;  1EYD A;  2F0O A;  4I65 A;  4X3K A;  2E76 C;  1SNM A;  1OXV A;  3S14 B;  1EQV A;  5IGB A;  1PTO D;  2B8G A;  5C6A A;  1FNU A;  5JAV A;  1JB3 A;  5JPM C;  4BWG B;  4TQU S;  3X3N A;  2QDB A;  1HA6 A;  1KDC A;  2R6G A;  5EGT A;  1CZG A;  5FLX E;  5I2Y A;  4CJ2 C;  5I6W A;  3OSO A;  1DZ1 A;  4G57 A;  1MBY A;  1ML0 D;  1H9S A;  3FPP A;  4NP5 A;  1PLF A;  1SYF A;  3KK7 A;  1LAB A;  4K2K A;  1YNJ C;  1S5C D;  1BR9 A;  1I4H A;  5FOB B;  2WB1 B;  4ZYS A;  1ZYR C;  3VA5 A;  3NUC A;  4EQN A;  5IIF A;  3PIP 3;  5JVH 3;  3RLF A;  4NW2 A;  3NSW A;  1EYC A;  3GTM B;  2VUM B;  1OXT A;  3OMG A;  3Q6S A;  5E4W C;  1Q1E A;  1EFI D;  3D4D A;  4HTH A;  2EY2 A;  5ELD A;  4IFD G;  2FHT A;  3GTO B;  2R7Z B;  4R9W A;  3NWT A;  1CI3 M;  4NKL A;  3MC0 B;  1SJH D;  3VR4 A;  3OMC A;  1Q12 A;  2PCF B;  1OXU A;  4H44 C;  1Y8N B;  2EXZ A;  1G8Z D;  4XYQ A;  2BA0 A;  1EY8 A;  4C3J G;  3FEW X;  4L8J A;  1AEX A;  4A3B B;  3NQI A;  2K32 A;  4QUC A;  2MGS A;  3HKZ B;  5I2X A;  3NWS A;  3IFD A;  4KKS A;  4GZY C;  3V2T A;  3AMU A;  5FLX L;  3GO5 A;  3OIQ A;  1OXS C;  2TSS A;  5C3E B;  1O80 A;  1H9J A;  4RGT A;  2HCC A;  2BA1 A;  4K5V A;  2EYP A;  2L0C A;  1R9T B;  4FO2 A;  3DWQ A;  1VF5 C;  1EY0 A;  2XWB B;  5FK9 C;  2IWH A;  3BG3 A;  3GV3 A;  4XT3 B;  2A6E C;  3I91 A;  5A2Q E;  1STH A;  2KA7 A;  1STA A;  4C1N I;  4XXE A;  2WKD A;  1E0B A;  1HHV A;  4CGY B;  1PRT B;  3BYT B;  4OO1 G;  4DXG A;  3PO2 B;  4DXF A;  2XRQ D;  3DXJ C;  1Y69 U;  2IX1 A;  4BBS B;  2X6L A;  3QOL A;  3S1Q B;  5CYU A;  3NXW A;  1E2Z A;  2K04 A;  1B44 D;  4KN7 C;  1TQO A;  1KNE A;  3E6Z X;  1TS5 A;  3KLS A;  3QJY A;  1TY2 A;  5CV6 A;  3J81 E;  4XTC S;  2K5Q A;  4C2M B;  4RWS C;  1GUG A;  1CZW A;  1GUN A;  3TDQ A;  2F0T A;  2NWG A;  1ENC A;  3HOU B;  3SEB A;  1GUS A;  4FF1 A;  2F0K A;  2CVR A;  1L0X B;  2A74 C;  4A3K B;  2JEB I;  4DGZ A;  3I70 A;  5C3X A;  3J7Y W;  1KLG D;  1M4V A;  3I73 A;  4ODG A;  3Q23 A;  3T4A C;  5C44 B;  2KHS A;  2K01 A;  1K83 B;  2SEB D;  4G4K A;  4FF3 A;  4ZQ3 A;  3OIP A;  4RKB A;  1EIH A;  1XXG A;  5A2Q L;  4HCE A;  3M4O B;  5JOB A;  3VYR A;  1HTP A;  1FNW A;  2EE1 A;  3LWU A;  1J8I A;  1C48 A;  2F3W A;  2A5H A;  4ZRZ A;  1CTM A;  2B2T A;  2PW5 A;  3A55 A;  4J8Q A;  2K03 A;  2JEA I;  1HXY D;  5CC4 A;  1MGS A;  3CHB D;  3EJI A;  2F0M A;  4FF2 A;  1GHJ A;  2RSN A;  2B2W A;  4ABN A;  2NTS A;  4N9P A;  3I90 A;  5KNC A;  3BDL A;  1EOT A;  3SK8 A;  3IFT A;  2B2V A;  5FO9 B;  1RHP A;  2R3Z A;  3TME A;  3J81 L;  1EQT A;  1T5X D;  4RGO S;  3IKJ A;  1JR0 D;  3WDN A;  2QKI C;  3P7J A;  3H94 A;  1WVL A;  1QIL A;  3L3O C;  3D31 A;  3GTQ B;  1GJX A;  2EY5 A;  4Y7N B;  2IPK D;  1EYA A;  2BE5 C;  3TP8 A;  3LWE A;  1S4Z A;  2WKC A;  1ZXT A;  1U9R A;  3SE0 A;  1F9R A;  1D5X C;  1HFG A;  3FDT A;  1YNN C;  1HRJ A;  1KDA A;  2EJM A;  4C3J B;  4O42 A;  2B39 A;  5ELF A;  2A69 C;  3TZU A;  4QCL A;  2QF7 A;  3P75 A;  3M7N A;  4EQP A;  4KV6 A;  1QNK A;  1O7Z A;  1NSN S;  2AUJ D;  2IX0 A;  3I4L A;  2ID0 A;  1HPC A;  5KRU A;  1F2Z A;  5KYI A;  5LL6 X;  1A6X A;  2WP8 J;  2NZ1 D;  5EPJ A;  4DU9 A;  3HGB A;  1I4Q A;  1HQM C;  4UDU C;  5M3M B;  5M5Y B;  3I4M B;  2I07 B;  1V8Q A;  3OHX C;  1STN A;  1I6V C;  1DON A;  1VMP A;  2NVT B;  1TII D;  1ESF A;  3K5N A;  3HZX A;  1SE4 A;  2A73 B;  1I50 B;  4ILW A;  1Q90 A;  1CFM A;  1TWF B;  4FP5 D;  2EJG C;  1B1Z A;  3ZYY X;  5CV9 A;  3TN2 A;  5I6Y A;  1WCM B;  5IT9 L;  5M3F B;  1SSO A;  2PYK A;  4YIJ A;  2RSO A;  2HDL A;  1I6H B;  2WV6 D;  1B4O A;  4ZLT F;  3PMF A;  5EPK A;  5KNB A;  5ISR A;  3D4R A;  1A2T A;  2EZV A;  3KBX A;  4M8A A;  3DEP A;  1LO5 D;  1I3Q B;  1JE4 A;  2MJ8 A;  1V1O A;  3HOZ B;  1G6Z A;  5IGG A;  1KTK A;  1TU2 B;  1TS2 A;  4RGN A;  1IYU A;  4BA1 I;  1LTA D;  1ENF A;  4J1M A;  3VR3 A;  2D9U A;  2K5D A;  1BQQ T;  2H4O A;  3M3Y B;  2A6H C;  5C4Z A;  1RKN A;  2VB2 X;  1RTN A;  4MIU A;  2D2C C;  3GTP B;  3S1R B;  4ID6 A;  5IGD A;  2F0H A;  5E1F A;  1DYQ A;  1EZ8 A;  2IL8 A;  5A35 A;  1Z6H A;  4IUT A;  3MHB A;  1EY6 A;  1JOQ A;  4RCN A;  2E2J B;  1ENA A;  3ND8 A;  1STE A;  2B2Y C;  3CRL C;  1DCZ A;  1BF4 A;  3SR1 A;  2FJ2 A;  2PW7 A;  3OWE B;  4E6I A;  4IFD I;  3D3R A;  2F0S A;  1SYB A;  4RHR A;  1Q8I A;  5IGF A;  2HQE A;  4G7H C;  1PTO C;  3DM1 A;  1PXU A;  3RZD B;  2OF1 A;  2B63 B;  4KHV A;  3BVG A;  3SVM A;  1EU3 A;  4KD3 A;  2F0G A;  3I72 A;  1LT4 D;  4IFD H;  3K0Y A;  3NBI A;  3PUW A;  3FRP B;  3RMH A;  1Q1B A;  3BZD B;  3R2T A;  3TBI B;  1CM9 A;  1G2S A;  1IHZ A;  4RH6 A;  4B9W A;  1STG A;  2Z1C A;  4X3U A;  4FXG C;  3S16 B;  2F0N A;  2F0Q A;  2R93 B;  1S5E D;  1LTT D;  2NVQ B;  2AWO A;  5C0X G;  2BDN A;  2B2U C;  4DFA A;  4C3H G;  4ME5 A;  4JK1 C;  1BCP B;  2DN8 A;  5LHY 1;  5CV4 A;  4ULL A;  3CU7 A;  5KEE A;  1GUT A;  1JOK A;  3MVV A;  1MI2 A;  3FKI B;  1H9K A;  3D4W A;  4EVO A;  4IFD J;  2F0W A;  1JCK B;  4H13 C;  5I9O A;  5JEA G;  2A68 C;  3MTS A;  2L11 A;  3VR2 A;  3R2I A;  4F7X A;  5E3F A;  1B9M A;  2KEC A;  3VYS A;  4IUV A;  1BXT A;  2EPB A;  2L5T A;  4K5X A;  1STY A;  3PUZ A;  1RDP D;  4PV1 C;  1Y1W B;  4B08 A;  5JPN C;  5G3L D;  1HCZ A;  5AFW A;  4XDX A;  3K5O A;  1QOH A;  2O4X A;  3VYU A;  3A7L A;  2BCO A;  2NTT A;  1GXD C;  4K14 A;  3CRK C;  2F0L A;  2IX3 A;  3C1E A;  3SK5 A;  5CR3 A;  4H0L C;  3QB3 A;  2B8F A;  3OPO A;  5IGC A;  2CHB D;  3MXP A;  1EY5 A;  2QIL A;  5FKA C;  5C4J B;  4CHT B;  1C8C A;  2DY7 A;  4M1U B;  1SYE A;  4HMJ A;  1JWU D;  1X3Q A;  5IOC A;  3UI2 A;  3HG9 A;  3GTK B;  2RDF A;  1WTO A;  3H91 A;  2L12 A;  2SOB A;  2G9H D;  5EQ0 A;  1EY9 A;  1YNJ D;  4QB4 A;  5FO7 B;  4KY5 A;  2DY8 A;  1ZYR D;  3C1F A;  2J7Z A;  1WTW A;  1U4P A;  1ILP A;  1CA6 A;  2JA7 B;  4PMW A;  1VCI A;  3KLR A;  1PTO B;  5EJW A;  4XT1 B;  2JP1 A;  1GUO A;  5COY A;  2RKS A;  5M5W B;  4KTA A;  3ERO A;  3Q0A A;  4A3M B;  5BN5 A;  1SNO A;  5K36 G;  3DWA A;  5CGK A;  1HQR D;  3Q24 A;  4C3I G;  4R8I A;  1TWC B;  3MWY W;  1Z7T A;  5DM7 3;  2PQE A;  1UEA B;  2AUK A;  5IOD A;  2JA8 B;  2NN6 G;  5DNF A;  1HFN A;  1FNV A;  3H6M A;  1KDB A;  2F0V A;  2KQ3 A;  2K28 A;  2X6G A;  2LMC B;  3RUZ A;  4ZKB B;  1OXX K;  4KMU C;  1JOR A;  3K6O A;  3OOC A;  2F0P A;  1K8O A;  1PZJ D;  1FYC A;  4HSV A;  1LTR D;  2Z4I A;  4OHJ A;  4LK1 C;  4DNR B;  4CKE A;  1KAA A;  2MUY A;  1C4Q A;  1FGB D;  3W3A A;  4HN7 A;  3TP7 A;  4K6L A;  1STB A;  2OEO A;  1IL8 A;  2A6E D;  1A3T A;  2ICE C;  4IN3 A;  4DAV A;  1UAP A;  2EDG A;  4DK1 A;  3QWN A;  1F2M A;  1ICW A;  2YU9 B;  5KIX A;  1GHK A;  1D1I A;  4C3H B;  4QF4 A;  3EFX D;  5DAU A;  2NVY B;  2AQ1 B;  2KVM A;  1LT5 D;  1QG7 A;  3GTJ B;  2CW0 C;  4RHS A;  1I4R A;  1I4P A;  4CBV A;  4WRD A;  1AW7 A;  3PUV A;  4N9T A;  4CKB A;  1Q3L A;  4BY1 B;  1V1P A;  1PRT F;  1LV9 A;  1T5E A;  1W6K A;  4XYO A;  1HTL D;  4P2C B;  5D14 A;  3J80 E;  4RA8 A;  3M7G A;  1WTV A;  2F03 A;  2HUG A;  3KBG A;  4A3D B;  5G3L F;  4XQJ A;  5JJZ A;  4A3F B;  2M2L A;  4KY7 A;  1D2B A;  1XTC D;  1CQV A;  3PV0 A;  1CK1 A;  3HP3 A;  1B53 A;  4MN3 A;  3U9S A;  2NYZ D;  1U4R A;  3LX0 A;  3P1H A;  3QO2 A;  5CBE E;  3V96 A;  1SMY C;  5KND A;  3AU7 A;  1R4Q B;  3MFY A;  3A8J E;  5E4X A;  3EA6 A;  5KYL A;  3OWF A;  4A93 B;  2ZXO A;  1H9S B;  2KCN A;  4DAY A;  1DOK A;  2EVB A;  1QB5 D;  3BDC A;  3EQL C;  3SDZ A;  1TWA B;  2AQ2 B;  2CQA A;  4K6D A;  1SFO B;  2NUC A;  4QMG A;  1QCB D;  4V19 0;  4IUU A;  5DEH A;  4WFN 3;  2D62 A;  3HOY B;  1SBB B;  1ZKO A;  1PMR A;  1KNA A;  4V0B A;  4PMB A;  5ELE A;  2YYZ A;  2B2T C;  5FO8 B;  4NDX A;  1Y1V B;  1RD9 D;  3KLS X;  4RKL A;  4IUR A;  1EZ6 A;  2VXW A;  1PTO H;  3NP8 A;  2F1M A;  2B2W C;  1DOL A;  4RFB A;  2F0J A;  1CA5 A;  1HUM A;  3NBH A;  1G91 A;  3J80 L;  1ESR A;  1BCP C;  2B2V C;  2PZW A;  1NAP A;  1HA5 A;  1EY7 A;  3D6W A;  2J0T D;  3NE5 B;  2SDF A;  3I8Z A;  2ICI A;  3BYY B;  4U67 3;  2KUM A;  5TSS A;  3OW7 A;  4TRD A;  1JOO A;  2K1B A;  2K6A A;  1MSG A;  3NK9 A;  3HEJ A;  3O13 A;  4C3I B;  5T1G A;  2XWJ B;  2LKV A;  4O1N A;  2RQX A;  1IKM A;  2A69 D;  3DUZ A;  4A3E B;  3J7A V;  4BY7 B;  3S1N B;  2SNS A;  5C5L A;  5HUR A;  1Z47 A;  3A56 A;  1QJO A;  5T1I A;  1SYG A;  2NB0 A;  2PO4 A;  3KF8 A;  2EYM A;  2L1B A;  4HSP A;  3GQB A;  2O2L D;  2KCC A;  4U68 A;  5K5P A;  1MD2 D;  1NR4 A;  3PUX A;  3T13 A;  5I9P A;  1JWM D;  1XWE A;  2XIW A;  3TP6 A;  1LTS D;  3BDO A;  1LT6 D;  1A3U A;  4CJ0 B;  3URY A;  3M85 A;  2EY1 A;  1F2Y A;  1LLR D;  4KD4 A;  2ZT9 C;  4KN4 C;  1ET6 A;  1QE6 A;  5KGU A;  3G7L A;  4RAU C;  5EKI A;  1NUC A;  4FXD A;  5CMD A;  4IAL A;  1RTO A;  2BDO A;  3I3C A;  1F2L A;  2NVX B;  4KK7 A;  3KUP A;  2QEJ C;  4KJN A;  2LY7 A;  3T53 B;  3W2D A;  4QIW B;  2K33 A;  1LAC A;  2AWN A;  1GOZ A;  1IW7 D;  1SAP A;  1WTQ A;  4FF4 A;  1IYV A;  1SYD A;  1FD7 D;  1TY0 A;  3ERQ A;  1PZI D;  4Q5V A;  3MA2 B;  2ZXR A;  4TSS A;  4LJZ C;  2F4I A;  4HAE A;  3TZD A;  2H1E A;  3SK6 A;  1EU4 A;  4CJ1 B;  1L0Y B;  1PDQ A;  4LMQ D;  3HOW B;  5COR A;  3E5S A;  3N6R A;  5JVG 3;  3MXG A;  4NMZ A;  4TKO B;  2OXP A;  3M4Y A;  3MZ5 A;  5D65 A;  1X3P A;  3PIO 3;  2OT2 A;  4QUF A;  2RDG A;  4WJW A;  3FVQ A;  4EQO A;  1I4G A;  3S2D B;  4DF7 A;  5J1Z A;  3P20 A;  5NUC A;  3N52 A;  1XYI A;  1SEB D;  2L4N A;  3NTH A;  1SDF A;  2L9H A;  1TT2 A;  1BBX C;  4OIK A;  4DN4 M;  1SJE D;  3T56 B;  2KEE A;  1EWH A;  2Y0S B;  4XIG S;  3RZO B;  2FIN B;  4IUN A;  2WAC A;  3F2U A;  2XRS D;  1M8A A;  3NHH A;  4BA2 I;  1ROD A;  2IT1 A;  4PMC A;  4C56 C;  5I4D A;  1XX8 A;  4OO1 I;  2ENB A;  3U9O A;  1G2T A;  3MAQ A;  3X3M A;  1RCV D;  3I4N B;  1RJT A;  1PRT D;  1DXM A;  2NN6 I;  5K36 H;  4HCS A;  2C5C A;  1ZEQ X;  1K8M A;  4A3J B;  4KY6 A;  4OO1 H;  3C46 A;  1HUN A;  2IJ0 A;  2EOT A;  3J7A F;  1DD2 A;  1ILQ A;  1QWY A;  5EPL A;  5DM6 3;  1TWG B;  1NCV A;  2FMM A;  2MPM A;  2Z4H A;  1SE2 A;  1PFB A;  1F9Q A;  3H09 A;  2NN6 H;  3JAM E;  2JSO A;  3HRZ C;  4ZUJ A;  2AQ3 B;  2R92 B;  4A3I B;  4Z9C B;  1FR3 A;  2F0U A;  1SYC A;  1KAB A;  1LTB D;  5EKK A;  5C5M A;  5C4H A;  1GUW A;  1BCP F;  4F8M A;  2A68 D;  3L7Z C;  2XSC A;  3GD7 A;  3EVQ A;  1JWS D;  3A8I E;  4RGM A;  2K5W A;  4ZK9 B;  2EYF A;  3DEO A;  4IQZ A;  3A8K E;  3SHL A;  4X3S A;  5CBA E;  3Q22 A;  1DM0 B;  2DNE A;  2L55 A;  1CQF A;  1B3A A;  4IUQ A;  4PQX A;  3HOX B;  1H9M A;  3H3V C;  4J6H A;  1D5M C;  2O5J C;  2XVS A;  2E2D C;  3WOF A;  4UAI A;  2MP1 A;  1TKW B;  1BO0 A;  2EYH A;  2E2H B;  2M00 A;  4K8I A;  1PFM A;  4Q0F A;  4KJO A;  2PMZ B;  1S5F D;  4KHZ A;  1ONL A;  5IGE A;  1BOS A;  1I4X A;  5ELC A;  5BN3 A;  4A3G B;  1W6J A;  2SNM A;  4IZ8 A;  3JAM L;  2DNC A;  1II3 A;  1F77 A;  3DMU A;  3K58 A;  4DA2 A;  3H0G B;  1S5B D;  1H9R A;  1D5Z C;  3R93 A;  1TR5 A;  1Y8O B;  1CHQ D;  1SNP A;  1AP0 A;  1DJR D;  4EGV A;  1TVX A;  2Z8L A;  3MEH A;  1ET9 A;  3HOV B;  2N88 A;  2RA4 A;  3NTI A;  2Q8T A;  5M9O A;  3V05 A;  4BS9 A;  3LNN A;  4RCO A;  2Q8R E;  2RBM A;  1PFN A;  4HMI A;  2F0E A;  1UUP A;  1VMC A;  3T16 A;  1PTO F;  1DOM A;  4OL7 A;  2WII B;  3SXH A;  1CT1 D;  3GTG B;  5C3W A;  3MXU A;  1EL0 A;  2KOL A;  1Y8P B;  4L6T B;  3GTL B;  5LL6 S;  1AZP A;  1IKL A;  3K59 A;  3VR6 A;  4OIJ A;  1OO9 B;  1BDO A;  1B9N A;  2PNR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...