4ILWA

Complex of matrix metalloproteinase-10 catalytic domain (mmp-10cd) with tissue inhibitor of metalloproteinases-2 (timp-2)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
182
structure length
182
Chain Sequence
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Metalloproteinase inhibitor 2
publication title Matrix Metalloproteinase-10/TIMP-2 Structure and Analyses Define Conserved Core Interactions and Diverse Exosite Interactions in MMP/TIMP Complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 182
sequence length 182
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4ilwA02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 4ilwA01
5JPNC 5FOBB 1JB3A 2WIIB 1BR9A 1XWEA 3HRZC 3V96A 3CU7A 2ICEC 1BUVT 2XWBB 5JPMC 3OHXC 2XWJB 2QKIC 2J0TD 1D2BA 2A74C 2A73B 3KLSA 3CKIB 1JC7A 2TMPA 2I07B 3I70A 3L3OC 1PXUA 5FO7B 4FXGC 3G6JB 5FO8B 1GXDC 1OO9B 3FRPB 3MA2B 2E2DC 4FXKC 3HS0C 2B39A 4ILWA 1BQQT 1UEAB 5FO9B 3T4AC 2WINB 1UAPA
chains in the Genus database with same CATH superfamily
1HUNA 4A3MB 4G7ZC 3CC2A 3U9OA 1F2MA 3NQIA 1VQPA 1LABA 3P7JA 1TT2A 4NPSA 1Q1EA 1V8QA 2E2IB 4RHSA 1K73C 3UE0A 2LY7A 3KLSA 3TS2A 1TIID 1JMCA 2A6ED 1P16A 1H9RA 1YNJC 1OO9B 2JN4A 3AYHB 2RDHA 4N8X1 4PMCA 4NXNL 2CW0C 1K8AC 1HRJA 2UUAL 4LF6Q 1VMPA 2F4VL 3J81j 1ONLA 4L8JA 1U4RA 5J1ZA 1NNXA 2PO4A 3CPWA 1QOHA 3STBC 4HJ5A 4FF1A 1D2BA 4L5QA 3RZOH 3K0XA 1PRTC 1Y1WH 5ISRA 3M4OH 1K8GA 2EYFA 3RZOB 3MXNB 1EQRA 3M4OB 4A3DG 1QWYA 5T1GA 1E1TA 3C46A 1SMYD 1OXXK 3L7ZC 5EJWA 3T16A 3RLFA 2F4IA 3FKIG 4DV2Q 2Z9HA 4DUYQ 2KUMA 5CV4A 2SOBA 4BY1H 2HIVA 1GUWA 1PTOF 3K0YA 3PF5A 2A8VA 3S1MH 1DM0B 4A3IH 2MGSA 3RMHA 1P8LA 1X3FA 3TSSA 5FKAC 2R7ZG 4HSVA 4BS9A 2HHHL 1PMRA 1SYBA 4A3IB 4G7HC 4H13C 4A3JH 4BBSB 1CQVA 2EYMA 4LF7Q 5FO9B 1M1KC 4KI0A 5I4DA 5HURA 1NCVA 1WTPA 2QEJC 5ELDA 2B2TC 3H0GH 1WTRA 1KNEA 1D1KA 1VQLA 5M5YB 4NMZA 4FO2A 2I46A 3H0GB 4R4TA 3BVMA 1VQ5A 1A3TA 3MFGA 1J5EQ 4DV7L 5C44G 3OIPA 2KCMA 1G6ZA 3A56A 2I07B 2CKZB 5KIXA 3CP0A 3P75A 1I3QH 2VUMH 4LW1A 1S5ED 2RHQB 3MA2B 2UUBL 1I3QB 2VUMB 1J8IA 1IW7D 5E4WC 1Z9FA 1MGSA 3E9IA 1A2UA 3CCSA 5LMNL 1HFNA 1XX8A 1I4XA 4MZ9A 2ZTEA 2R61A 2VB3X 1CZGA 2DY7A 5M3FG 3VR2A 1CSPA 3FDTA 2MJ8A 1ZYRC 4C3IH 2DNCA 3K8AA 1XNQQ 4XYOA 4C3IB 1RF2D 3M4QA 1FGBD 1SN8A 3K7AH 2Q2UA 4RWSC 2EJFC 1R9TH 4TRDA 3SE0A 1VQ7A 3K7AB 2O4XA 1S5BD 3QR8A 5ELNA 1R9TB 1BCPB 2I5LX 1X65A 3LWEA 2G9DA 2QA4A 3J81i 1VQMA 4EX5A 3W5OA 2F0SA 4ILWA 2ALYB 5AFWA 1TU2B 2PNHA 3D8GA 2BA1A 3R93A 3F8TA 3K57A 1JE4A 3KF6A 1VF7A 4Q5VA 4JYAQ 3X3MA 1SEBD 1VS0A 3SHLA 2AUKA 3HOZH 3OWEB 3Q23A 4K6LA 4A3FB 3G4SA 3HOZB 5DEHA 1BKBA 3K59A 4MIUA 3TN2A 4NP5A 1VQGA 2E2HB 1FYCA 4GOPC 2K5WA 2V1CC 2XRQD 1UEAB 4HJ8A 4QL5A 4HJAA 1LTAD 1X32A 1PYSB 2IJ0A 2A6HD 1Z6HA 2NBFA 1KDAA 1BUVT 1SROA 2MO0A 2NZOA 3QWNA 1IYUA 2C5CA 2N3SA 2PPBC 1VQ9A 1HQRD 2KVMA 3HOVH 4HTHA 5C4JB 1HHVA 1E2ZA 1VCIA 2XIWA 3HOVB 1TS3A 2L1BA 5KNDA 1I4HA 4KV6A 1LT3D 3KUPA 2F0FA 2E5LQ 2L4NA 1F9PA 3DLLA 1UE7A 1C8CA 3MXUA 4OX9L 3GTPH 1A6XA 1SJHD 4OL7A 1H9MA 4DR1L 5IYCH 3SK4A 1ESRA 2Y0SG 4LFBL 2FJ2A 5IWAL 3OMGA 1E0BA 4I65A 1NMFA 2OQKA 2PZTA 1PH2A 3I4MG 1CKOA 2MQHA 3CCMA 1TVXA 4R8IA 4AH6A 3GTQB 1GUGA 2MP1A 4KJOA 1EZ6A 1FL0A 5BN4A 2PMZB 3TP5A 3BDOA 3DEOA 3Q0AA 2K28A 4ZYSA 2F0OA 4B3SL 2IX1A 4YHHL 4BBRG 4KY5A 4JI5Q 1I6HB 4XT1B 3GO5A 3DUZA 4QIWB 1E3PA 2Q8RE 3IFDA 1FNWA 1PFBA 5EQ0A 4HIOA 1I94Q 4P71A 4DR5L 1YITA 3HOUG 2HQEA 3F1ZA 2A68D 2RDFA 1Y8PB 3OTOQ 3VDYA 4MTKA 3H09A 1GD7A 4HCEA 4A3DH 1S40A 1QZGA 3I4OA 4LF8Q 3NUCA 1EQQA 2BDNA 4B3RQ 4HAEA 3FKIH 1LTTD 3A8JE 1SNPA 3DHQA 3HKZE 3FKIB 1JWUD 3UI2A 4ZKBB 1PTOB 5C4XB 2ZXOA 1G91A 1Q8KA 4A3GG 1O78A 2WAQG 4IUTA 4GKKL 5ELCA 2DN8A 2UXCQ 2A5HA 5AJ3L 3T1YQ 1YJ9A 1Q7YC 1SDFA 3NBHB 3OHXC 1C7YA 2R7ZH 3IFTA 1U4MA 4CJ2C 4A3KG 1WTQA 4LMQD 1YNJD 3I55A 1KABA 3OW7A 4JVZA 1DOLA 1PH8A 1JJ2A 1HZCA 1ICWA 2CW0D 1EWHA 2UU9L 4IQZA 5CBEE 1BCPC 3CPFA 1RODA 2KCCA 1VQHA 5CYUA 4G7OC 3GTMB 3NELA 3RN2A 1ASZA 1XWEA 2UXBQ 4A3MG 1XMOQ 2RSOA 1K83H 2K5QA 1F2LA 4LUVA 5C44H 2ZJQA 3PUYA 1AZQA 1K83B 1GUSA 1CA5A 4LFAL 2OXPA 4X62L 3VR6A 4I7ZC 2BCOA 1PRTD 3J7AF 4C2MH 1SNMA 5JEAG 2O5IC 4DR2Q 3FPPA 2B2VA 2JEBI 2K1BA 4YIJA 1DOKA 2OEOA 3NXWA 3N6RA 5LL6S 4DV5L 3SK6A 5JJLA 1HCZA 1S72A 1PH9A 2CQAA 4XQJA 4QGUA 1W6KA 1OXTA 1PA6A 1V1PA 5M3FH 5CR3A 1N9WA 1EOTA 4R8NA 2DUDA 1JQYD 4MHEA 2L5TA 5CORA 4DV1L 1Q12A 1Q86C 1CQFA 5JEAJ 3S14H 5IIFA 4GS3A 2M00A 3PCOB 3K80C 1EY8A 1K0SA 3GV6A 3CQZH 1JB7A 1JB3A 1UE5A 4A3CG 2O5JC 4ZUJA 3QO2A 4BXXG 1EIYB 4BY7G 1HFGA 2HDMA 1LTID 2SNMA 4IPHA 3CF5A 3U50C 2R7DA 2M2LA 2WB1E 4CDCC 4YY3Q 4IO9A 2Q2TA 4IURA 1QVCA 4KTAA 2IX0A 1KTKA 3CMEA 1C9OA 4QQBX 4MNOA 1YHBA 4GLXA 2JJQA 4KD3A 2HIXA 1W2BA 2XVSA 4BBSG 4O1NA 4IPGA 4DV0L 1SSOA 4DK1A 3M4YA 4X64Q 2EOTA 1L1OB 1JT8A 4JBJA 1CT1D 4J8QA 5EGTA 4JI7L 1PH3A 3I3CA 1ILPA 4DA2A 1AH9A 1H9SB 4P73A 2MUYA 5M3MH 3AB9A 4JG2A 1SNDA 2KEDA 4DR7L 1B7YB 1ZYRD 3FP9A 1TY2A 3HS0C 3PUWA 4AIMA 4DV4L 4IUPA 1ICFB 3G6EA 3S24A 2QF7A 2YU9H 3UDXA 3IKJA 1IBMQ 2JA8G 1LTGD 4JI1L 1J6QA 1B9NA 2B2YA 2D0OA 5ELBA 5EPKA 4JI3L 5I9PA 1NBWA 1STAA 2F0IA 4WORA 2NN6G 2VQFL 1B3AA 2CFMA 4LF4L 3ND9A 4C1NI 2FMMA 4DK0A 4JI6L 4X65L 1UE1A 2OQ0A 4DAYA 3W1GA 2HCIA 4HJ9A 1U9RA 3H3VI 3S1RH 2L12A 3FRPB 3BYTB 3AEVA 3CHBD 3M3YH 5K5PA 3S1RB 4TQUS 4A4IA 5GAEC 3M3YB 4LAAA 1K28A 4IOCA 3PIOA 1M90C 1NUCA 1UE6A 3S1QB 2EY2A 5M5XB 4GNXB 1PTOC 1QCBD 4B3ML 2PQEA 1YI2A 1SYEA 2B29A 1OXUA 2RF4A 4QF4A 3NWSA 3OWFA 1TWFH 1QVGA 1YHQA 3T51B 4F7XA 2YTVA 4IUVA 5KYLA 3KJOA 2RBMA 1Z7TA 3DWPA 2IWHA 4IN3A 4ZRZA 3AMUA 1TWFB 1K3RA 2EXDA 5JOBA 3BVGA 3I4MB 3T4AC 2WINB 1LV9A 5I9OA 3J80c 2BH2A 1EUJA 5FLMG 4ALPA 1WTXA 2EDGA 1EY6A 4MTNA 2ZTDA 1EYDA 3HP3A 5E4XA 4WFN3 4OIKA 2CHBD 4BBRH 1T5EA 4GN4B 2NTSA 4BBRB 2BOSA 4JI0L 2CWAA 2JQOA 3HEJA 1H95A 1F77A 2UUCL 1O80A 2AKWB 2ZTCA 1E22A 3D0FA 3HOUH 1DYQA 5CV9A 4RGTA 4R4QA 3HOUB 1RTOA 3AU7A 3I4LA 4RKBA 3R2IA 1MIUA 3VA7A 2Z6KC 1CI3M 1WCMB 1WTWA 3PO3B 2F0WA 1XPRA 1FJGQ 1DD2A 2SNSA 3ULJA 2B2WC 3Q6SA 1ILQA 1A8VA 3G71A 1FD7D 1TR5A 5FJ8H 3VYSA 1AEXA 3M7GA 4A3GH 3KBXA 3NTKA 2B2UC 2KENA 2WKCA 4E6IA 1CHPD 3H3VH 2K50A 4OHJA 5I2YA 1HR0L 1IBLL 4RFBA 3PIPA 4A3KH 2F0HA 3EVQA 2XWJB 1IKLA 4P74A 5IY0A 1B50A 3BZCA 2AWNA 1JWSD 1XNRL 1IBKQ 2ID0A 3HFZB 1LYLA 1N32Q 2OF1A 5GROA 4A3MH 2UUAQ 2VZAA 3J80i 3PF4A 1CFMA 1MD2D 3DWQA 3EJIA 2WIIB 2EJMA 2OTLA 4LJZC 1WI5A 2RHSB 2FMCA 2OT2A 1N8RC 2E2IH 5IODA 1L1OC 4X3KA 4X3TA 4K8IA 2K5HA 2QKIC 5JEAH 1KDCA 1PZID 1NY4A 1D1IA 1ZXTA 5CC4A 1AFPA 3VR5A 3K5MA 3PO2B 2NN6I 1JWMD 3G6JB 1CZWA 2QEXA 5CMDA 4IALA 3W3AA 1Q82C 4LF5L 4KMUC 1GHKA 5C3XA 4LFCQ 4B3TQ 1M8AA 2KCNA 1IYJB 3DM1A 4QB4A 4WRDA 5FLXc 4DAMA 2D62A 4GZYC 1SJED 1SRUA 1VDZA 2B8GA 4HR7B 2Z0SA 1GOZA 1STEA 1ASYA 2Z1CA 4LWCA 3CRLC 4DN4M 1MBYA 4R4IA 4BXXH 2K6AA 2EJGC 1M4VA 1BCPD 1BQQT 1E7ZA 4BY7H 1V43A 3EQLC 4HCSA 5IGEA 1EQVA 4GOPA 1L0YB 1B8AA 4BY7B 3D6CA 3CCVA 5C4XG 2CH4W 5C3EB 1B1ZA 4QCLA 3F2BA 5JPMC 5G3LD 3H6MA 4KHPQ 1QUQA 1HZBA 1VQBA 4M8AA 5FO7B 2CQOA 1BVSA 4BBSH 4B9XA 1HNXQ 3A54A 2F3IA 1TS2A 1WFQA 3Q24A 3EBEA 1MI2A 4GKJQ 3J81c 1VQ6A 4RH6A 2JK8A 4LF6L 4X66Q 2PZWA 5M5YH 1LM0A 2D9UA 4AQYQ 2ICIA 1STGA 5LMNQ 1L2FA 2AHOB 1QVFA 4OWTB 2PI2E 3P1HA 5HGTA 4A76A 3ER0A 2VNUD 2NYZD 2B63G 2E2DC 3K5LA 4J6HA 2ZT9C 3MEFA 1ENCA 4HN7A 2JA8H 5TSSA 1SNOA 2L9HA 2XN9C 2EY1A 2NN6H 2JA8B 5BN5A 4DV6Q 3RLOA 3T13A 2K33A 4DUYL 2F0PA 5EBDA 5A35A 3RD4A 2BH8A 2X69A 2NZHA 2Q2IA 2IX3A 5E3FA 5D3DA 2F0EA 4PMWA 3UE1A 3WWVA 1DXMA 1GXDC 3TMEA 4LF7L 2JSOA 2HT1A 4OO1G 5DNFA 5DLQE 5J39A 2WP8J 4OONA 5BR8Q 2NUCA 2OTJA 3D3RA 3TZDA 1FGUA 2JEAI 2DY8A 3KF6B 1ML0D 3ND8A 4YWLA 4HIMA 3L0OA 1J5EL 4CHTB 2A73B 1YNXA 4RA8A 3TP7A 5FLXE 3H3VC 1TQOA 5LL6X 2BDOA 1LTSD 1I6VC 1SAPA 1G2TA 2NB0A 2K14A 3N52A 4CDEC 2WKDA 2GVAA 3S17H 3KBGA 5FLMH 4V190 4JBWA 1G291 4A3LG 4JOIC 4ZLTF 3S17B 1X3QA 5EKLA 1XPOA 2JA5B 3O13A 4KD4A 5I6WA 4A3FH 4FF3A 3MXPA 1NR4A 3OSOA 2I5HA 2E2HH 2F0GA 5FLXL 1EIHA 4PZ8A 2WFWA 1XNQL 5IP7G 1EIFA 1Q8IA 3J81E 4LUZA 1SNQA 1HNZQ 1TWHB 1F9SA 2NVTB 2Y0SE 1R4PB 2KECA 1CTMA 1PTOD 3MEHA 4AYBE 1EFID 3ERQA 4KK7A 1OXSC 1UNSA 3HOWG 3ITPA 4QY7A 4JI4Q 1FR3A 4XQNA 3GTGB 4FXKC 1SYCA 5C4JH 3ULLA 4DXGA 2MPMA 3W2DA 3RUZA 1STYA 5DAUA 3J81L 2ICEC 4JYAL 4A3EB 3BZKA 3I90A 5JAVA 2E76C 4H0LC 2QGQA 1Q81C 4TVAB 1NSNS 2C9OA 1WTVA 1AE3A 1ESFA 4PZ6A 1TY0A 4ZQ3A 1X3GA 1EY9A 4B3SQ 1CKNA 4DU9A 1EZ8A 2GN5A 5IGGA 3GTQH 1SLJA 1YBYA 1B70B 2K03A 5FOBB 4ZKCB 4DUZQ 3BG3A 3NWTA 5IGDA 4MN3A 4DNTB 1HQMC 1I4QA 4L5RC 1WVLA 2TMPA 1YEZA 1YNNC 1UEBA 1AZPA 2P5ZX 3QG1A 2WAQE 1C0AA 4F8MA 2KHSA 1I6HH 4RGOS 2JP1A 3T1HQ 4ME5A 3TP6A 3NTIA 4J1MA 3W1BA 2KEEA 3EFXD 4OO1I 4O42A 3NE5B 2AWOA 4K6DA 3LWUA 1J9OA 3C2PA 1EYCA 1HR0W 2JE6I 5CV8A 4GLAC 3CCRA 2R92B 1I50B 1WCMG 1PVOA 2B3GA 2ZXRA 5D14A 3PO3G 1O7YA 3SK5A 3V2TA 5KNBA 3SGIA 1BBXC 2H5XA 5C4XH 1IYVA 3D31A 2LKVA 1PTOH 1GUTA 4R4OA 1G8ZD 1OTCA 3A55A 1VQDA 1GJXA 1EOVA 2RCFA 2PW5A 2NZ1D 1XMQQ 4KLKA 1HUMA 2A19A 1G2SA 1TWCH 1Q46A 2EY6A 4JI8L 3S2HH 1WJJA 1CKMA 1TWCB 2EIFA 3G48A 4RMFA 5FO8B 1FNUA 3S2HB 2VY3A 1XXGA 3URYA 4JI5L 4L5TA 1HJPA 3GTMH 5JJKA 1IHZA 2EYOA 5IGBA 4DK6C 4K5VA 4GLVB 1RCVD 4N9PA 4PMBA 3CCEA 4DV3Q 3NHHA 4JK1C 2F0QA 4LF9Q 4TKOB 4DK3C 2JA7B 1I94L 3GDEA 4HIDA 4BA1I 1B9MA 5NUCA 5J3BA 2B63H 3OTOL 4DR4L 1PYWD 3VR3A 4K0KQ 4RGNA 4C56C 2IW3A 2B63B 1S5FD 2CWPA 4LF8L 1E24A 1STNA 1V1PB 4FXGC 1HNWQ 4C3HG 4C1NK 3PO2G 4JV5Q 3TP8A 3KLWA 2VQEQ 4R9WA 1D5MC 4IOAA 3H94A 2F0DA 1C4QA 1Q3LA 4GN5A 4DNRB 4CKEA 5KYIA 2UXCL 4KKTA 1I4PA 1RHPA 1VQJA 3T1YL 3EA6A 1JOOA 2QILA 2IHFA 1RDPD 1RIPA 4B08A 2ZJRA 3I8ZA 3BVZA 3L3OC 2Z4HA 4OO1H 2RKSA 4A75A 4IFDG 2K5NA 5C4ZA 1EFWA 1Y14B 2DGYA 3D4RA 5EKIA 2MNAA 4DKAC 3QOJA 2VL6A 4U68A 2UXBL 4N8FA 4OWXB 3NEMA 2FFKB 1EEID 1JR0D 1HA6A 3I4NB 1EL0A 2YTYA 3GTOB 1Y69U 1AN8A 5C3EG 1A63A 3EIVA 1JC7A 5M9OA 4OWWB 1GUNA 1G51A 4KY7A 2EXZA 5IP9G 3A5UA 3JAMc 4DR7Q 1N36Q 2L0CA 4CDDC 1NMGA 5C3WA 2XRSD 4DR3Q 4DR2L 2Z6KA 2ZXPA 4A3LH 1Y1WG 4IFDJ 5C4HA 4QUCA 4RCOA 1EQTA 4FDBA 1X55A 1I4RA 2B2WA 5KRUA 1ZKOA 4V0BA 5LHY1 2DJFC 1H9KA 3VYRA 3PMFA 4APVA 2RA4A 3K58A 1CUKA 1SR3A 2EYPA 1R4QB 4CBVA 4LF4Q 1CHQD 2PI2A 1EY7A 2IHEA 2B2UA 4NKLA 3S15B 3OPOA 1U4PA 1D7QA 1T5XD 4HMIA 4QMGA 1LT6D 4L5SA 5IP7H 4DR6Q 4DAVA 2F3WA 2YV5A 4WJ3M 4DAYB 3TREA 1VF5C 3QB3A 5JJZA 1S5CD 1DOMA 3GTLH 1HPCA 2SEBD 2K32A 4DGZA 1V9PA 3E0JA 4UPAA 5FK9C 3CC4A 3GTLB 3VR4A 4K14A 4DF7A 4YY3L 4U673 3OIQA 1X9NA 1LTRD 1SMXA 3I56A 3HOWB 2UXDL 1N34Q 1PLFA 2I0QA 2K01A 4A93G 3C1EA 3QOLA 3S16B 4HMJA 3A8IE 4K2LA 4X64L 1QE6A 1U5KA 2EY5A 3MWYW 5IYBG 1LTBD 2D2CC 2N88A 3S1QH 3PUZA 1AE2A 1BDOA 1PRTB 5M5XH 4HIKA 2D0PA 1N33Q 1B44D 3C1FA 3I7FA 1D5ZC 3M4PA 1V1QA 3JAMi 1RL2A 4JI2Q 5C0XG 2J4XA 2OCEA 3GTKB 4FP5D 2F0VA 2PNRC 4IJLA 3I4MH 1VQ4A 3TDQA 2A1AA 2MHVA 4IUNA 3AQQA 3I73A 4UHVA 4LK1C 3KF8A 4IUUA 3K81C 5LMUQ 1PZJD 2K4KA 1IBML 2R93B 1RD9D 1JJGA 3A5ZB 3PV0A 3L9AX 5CGKA 3E9HA 3MAQA 3CCLA 2YYZA 1DJRD 2JA5G 5D65A 1MJCA 5IGCA 5H1SE 2ZM6Q 1BOSA 4JC0A 3Q22A 2KHIA 4J15A 4DFAA 1UUPA 2FINB 3TZUA 1QB5D 1KIXA 5C0XJ 3GTJB 4KN4C 1SXTA 1KQSA 1CK1A 3H15A 1EU3A 4NXMQ 4O2DA 3PGZA 3HOXB 3CCUA 3BU2A 4IFDI 1DZ1A 1Y1VG 3K5OA 3PIO3 4ID6A 4EGVA 5CBAE 3VYUA 1BXTA 4UP9A 1Y8OB 1WCMH 2EQSA 1A15A 3PO3H 4KHZA 2LXKA 4KY6A 1NE3A 2B2TA 3E0EA 4NDXA 2NWGA 2K04A 1EYAA 1XNRQ 4EVOA 1SBBB 4Y7NH 1PHJA 4ZUIA 3LGJA 3D6WA 2AMCB 5EKKA 2K05A 3JAML 1SYGA 4Y7NB 1MJEA 3D4DA 2YTXA 4A3BG 2LSSA 1F9RA 5HY6A 2PMZE 1LUZA 1A62A 4DXFA 1BNZA 3I91A 4A3EG 1YVCA 2BA0A 1YNND 1XPUA 2KBNA 2PQAA 1HTLD 3DXJC 2N78A 3SEBA 1GUOA 4FYDA 4NXNQ 2EYHA 4QIWE 5IOCA 1F2YA 4POGA 2F4VQ 1STHA 2R7FA 3VYTA 1DGSA 1S5DD 1DCZA 2L15A 4NW2A 2E2JH 1UWVA 1KXLA 1A2TA 4N9TA 3F2DA 1MKHA 2VXWA 4C3HH 2E2JB 3PO2H 1FJGL 4G57A 3I70A 3U9SA 4C3HB 3UDIA 1F2ZA 3V05A 4FF2A 5EBCA 2WV6D 1NR2A 2ATWA 1EWCA 4X6AH 2EYLA 2QDLA 4LNQA 4RKLA 4YWKA 2CCZA 3A7LA 1YHAA 3HG9A 3M7NA 1NTGA 3H91A 1B2TA 5CV7A 3PIP3 2E8GA 2L55A 3J80E 3HKZB 1BBUA 2QDBA 4G4KA 4GOPB 1C48A 1ENFA 4JOIA 1WYDA 4IFDH 3GV3A 3GQBA 3A7AB 1I4GA 2R92G 2LXJA 4FNFA 3KDFA 5IYDG 4ME3A 2HHHQ 1IBKL 1QUQB 1D6EC 3EROA 1N32L 5ELOA 3A8KE 4A3CH 4XYQA 4IJHA 1TXYA 3A0JA 4P2CB 1PFMA 4S3SA 1K3BC 5C0XI 3WDNA 2F0KA 4ULLA 1GVPA 2A69C 3T56B 1L0WA 2CH4A 5C3EH 3WOEA 3S9WA 5T1IA 1A3UA 5JVG3 3J7AV 3VA5A 5IP9H 3NP8A 3J80L 2F0UA 1YJWA 4DV7Q 4XT3B 5IGFA 3TS0A 3BDCA 3RN5A 2KOLA 1Y1WB 2UUBQ 4GNXC 4OELB 4CKBA 2F1MA 3EN2A 2QCPX 3SVMA 4LFCL 1VQOA 5JVH3 3WOFA 3CXCA 2NTTA 4H02A 4B3TL 3V96A 2XTIA 5A2QE 2F0TA 2N49A 2IL8A 2M9VA 3LX0A 3OOCA 5KNCA 2JA7G 2JA6G 3NSWA 3MXNA 1Q90A 4BY1B 2XGTA 1PXUA 5F2DA 5I2XA 3KFUA 3S1MB 5GADC 3U58A 2TSSA 3TEHB 3RZDH 4A3JB 1PH5A 3S1NH 3RZDB 1VQAA 4P75A 1TS5A 3PSIA 3S1NB 3E5SA 4CDFC 3BJUA 4DV2L 4Y52H 5EPJA 4F87A 3DWAA 3FPUB 5ELEA 5A2QL 4CJ0B 2NVXH 4KHVA 4CJ1B 3NQTA 4KHPL 4A93H 1TWGH 2NVXB 2WB1B 3CW2C 1MSGA 4A93B 3DM3A 1HNXL 1O7LA 1TWGB 1RKNA 5IYBH 3DEPA 3MFYA 1PDQA 4R4CA 4WJWA 5D3IB 1RTNA 4GKJL 4KKUA 1IXRA 3MZ5A 2JYOA 2IY5B 3NK9A 1BF4A 4X66L 4IZ8A 4OEMB 4AQYL 5IE8A 2EE1A 4UDUC 4BA2I 3J7YW 5E7NA 5C0XH 3I4NG 2EPBA 1QILA 1ET6A 1IL2A 3BDLA 2BE5D 3HGBA 4YWMA 1KLGD 3FVQA 4JW0A 2IT1A 1ENAA 1X3PA 3KOJA 1O7ZA 5CV5A 4POFA 3NTHA 5K36G 4DV6L 4I7AA 4PG3A 4FVMA 2JA5H 2LS01 2Z4IA 3KLRA 1II3A 3CCJA 1KAWA 2O2LD 2HUGA 4L63B 4LUOA 4C3JG 3QIAA 2Q8IB 1D8LA 2G5DA 1Y1VH 2K75A 2PZUA 3KJPA 1UAPA 1VQIA 4FF4A 1Y1VB 1SYFA 1BR9A 2PCFB 5HGQA 2VB2X 5BR8L 1TWHH 1WOCA 2Q2HA 5GAHC 2H1EA 2NVTH 1ZEQX 2L11A 3NENA 1QNKA 4RCNA 4OX9Q 4DR1Q 3HKSA 3GTGH 5M3MG 4XTCS 4LFBQ 3OW2A 5IWAQ 3S2DH 1XJVA 4A3BH 2B8FA 1O7IA 4DPGA 3KLSX 5IT9c 3S2DB 2Q8TA 4DAPA 1CKNB 4A3BB 3SXHA 3HRZC 1Y8NB 4A3EH 4JPBW 1PFNA 3TBIB 5GAGC 4EQ5A 1LTLA 3A74A 1SFOH 1TKWB 3G7LA 2R6GA 2JA9A 1SFOB 1PRTF 3I72A 4K5WA 4H44C 1E2VA 2C35B 2JXMB 3SK8A 4YHHQ 3PUXA 3HOYG 1HZAA 3TRZA 4TSSA 1VQKA 3T53B 1HNZL 4UP8A 2ASBA 3NBIA 2R93G 3DMUA 4DR5Q 4ZCKA 2RSNA 2VS1A 1MHWC 3D4WA 2NVYH 3ULPA 3CKIB 4EQOA 4OGQC 3X3NA 1D5XC 2NVYB 1STBA 3J7A5 4JI4L 4DNIA 3GTPB 4Q0FA 1PH1A 4AYBG 3MTSA 2RQXA 4M1UB 1F9QA 1B4OA 4UAIA 2EZVA 1VQCA 3GP7A 1QG7A 5I6YA 1XYIA 4XIGS 3HOXG 1IZ6A 1I5FA 2MFIA 4GKKQ 5AJ3Q 3PUVA 3K7UC 2E5LL 2R92H 1I50H 2N8NA 4JI8Q 5IYDH 1HTPA 2HDLA 1JICA 2AQ1B 4F88A 4PNYA 1PYBA 2Z6BA 4PV1C 5C5LA 1KRTA 3PQIA 2E74C 2UU9Q 3SR1A 4EQPA 2EYJA 5GQOA 1SE3A 2HD3A 2GVBA 3ZYYX 3BYYB 2R3ZA 4DUZL 1X6OA 4L6TB 4OXPA 4B9WA 1JCKB 3CAMA 5DM63 5EAYA 4HJ7A 2F03A 1W6JA 4LFAQ 4DR4Q 3M85A 1SE8A 3AFQA 4X62Q 3IL8A 4KKSA 2KA7A 1KL9A 2A6EC 2RVLA 1B53A 3K5NA 1RJTA 2KCTA 4A3DB 4IUQA 3C3LA 2K7VA 5BN3A 1CM9A 1NAPA 4PQXA 3T1HL 1IL8A 4IPCA 5FJ8G 1KLUD 4DV5Q 2JA7H 1QNUA 5IT9E 1FNVA 1NJIC 2X6GA 2JA6H 1VQFA 3R2TA 2JA6B 1LT4D 5L37A 3E3XA 3OMCA 4CGYB 2J0TD 4X3SA 2A74C 3FHWA 4JBKA 2R7ZB 1WTHA 3CC7A 1ET9A 2F0LA 1YZ6A 3MXGA 1DONA 4DV1Q 5CV6A 4HEDA 4B3RL 2EVBA 3RNUA 4EQNA 3E6ZX 3I2ZA 3IAYA 5JPNC 1SMYC 2A69D 4RG1A 1K9MC 1VQ8A 2K5VA 4ZK9B 3RR5A 3NBHA 3IRBA 4JCVE 3ICEA 5IT9L 3F2UA 1SNCA 1CA6A 1XMQL 3UDGA 3STBD 5C44B 1XTCD 3HKZG 3K6OA 5J22A 3UDFA 1IKMA 2F52A 1HH2P 1EY4A 4CKCA 1JE5A 4C2MB 1GHJA 4UY8C 1MSHA 1EWIA 1WD0A 4DV0Q 4DV3L 1FVIA 3I4NH 4JI7Q 3BZDB 4RGMA 1XMOL 4LF9L 3GTOH 1X3EA 5DM73 1VMCA 2XWBB 4YCWA 2FXQA 3ERSX 1E1OA 4K0KL 3R3OA 5M3FB 3CCQA 1LLRD 1HNWL 4JV5L 5K36H 2VQEL 2H4OA 4DV4Q 2V4DA 4UP7A 3S14B 1Q1BA 1PH4A 1IW7C 1K8OA 5COYA 2F0MA 1PFSA 2WACA 1QZHA 1HA5A 1AW7A 3CQZB 4HSPA 3CU7A 1WD1A 3F2CA 4JI1Q 1PZKD 4JI3Q 2DJGC 2ENBA 3S15H 4C3JH 2VQFQ 4RAUC 4PZ7A 2UXDQ 4C3JB 4XDXA 4JI6Q 4X65Q 2BE5C 2RCNA 1X54A 1PH7A 1EY5A 4BY1G 4QJFA 5E1FA 4H7BA 1L0XB 4A3IG 1SE2A 1EU4A 1KDBA 3Q8DA 1A0IA 2NVQH 1XTDA 4JBMA 5C6AA 4A3JG 1KAAA 1YIJA 2NVQB 3KK7A 4IPDA 1EY0A 3AFPA 2CVRA 5C5MA 2D5DA 2G9HD 5LMNW 3H0GG 3HOWH 2Z8LA 4B3MQ 4R1JA 1U0LA 5M3MB 1JORA 1N36L 2F0JA 1L1OA 4O0AA 2WB1G 4BWGB 4DR3L 3S16H 3BS1A 1T9HA 2VUMG 5KEEA 1LACA 3CD6A 2F3VA 2N55A 1A3VA 2VW9A 3ZJYC 1H9SA 2YU9B 3KF8B 1E2WA 1HZ9A 3U4VA 2GA4B 2I5MX 1JOKA 1EIGA 5M5WH 1AP0A 4P72A 1GKHA 3GTKH 4X3UA 5M5WB 3HOYH 2F0NA 4DR6L 3GD7A 2HCCA 2AQ2B 3HOYB 4JI0Q 3RLNA 2QW7A 4QUFA 2UUCQ 2R93H 4C3IG 2PYKA 3MC0B 3FEWX 1KRSA 2A6HC 2HQLA 1YJNA 1KC8C 1SE4A 1KHIA 2LMCB 1LT5D 2LFNA 2ZJPA 4RHRA 1GO3E 1GM5A 1X56A 3SDZA 2IPKD 2B2VC 1N34L 4XXEA 1OXVA 4K2KA 3GTJH 2Y0SB 2ES2A 2DNEA 4KN7C 1VQEA 4AYBB 1K8MA 1U4LA 4OIJA 2OWOA 3HOXH 1BCPF 4KJNA 3JAME 3LNNA 1SYDA 1EYGA 2K52A 4K8JA 3CRKC 4GNXA 3J7ZC 4YCVA 5JJIA 1HR0Q 2SDFA 1IBLQ 4GN3B 1N33L 2J7ZA 1K0RA 5G3LF 4A3FG 1B3QA 3HOZG 3HZXA 5KGUA 4JI2L 1JOQA 1G6PA 2PW7A 3OYYA 4K5XA 2AQ3B 2PQAB 3MHBA 1PH6A 1LO5D 3U4ZA 1QJOA 3MVVA 5LMUL 3JC66 1V1OA 1S3OA 3P20A 1TWAH 1Z47A 2RDGA 2KHJA 1TWAB 4ZAIA 2ZM6L 1S4ZA 3TQYA 2AUJD 2KJXA 1HXYD 1KNAA 2X6LA 1CSQA 4FXDA 1PV4A 2KQ3A 2K5DA 3R8BA 4Z9CB 1VQNA 3FMCA 2B39A 1EEFD 2XSCA 4LF5Q 1W3SA 4NXML 3KYHC 2XNAC 4A3GB 3ONAB 2WAQB 3CMAA 1BBWA 3HOVG 4ODGA 1KD1C 1BO0A 3M9BA 3B6YA 4YCUA 2MO1A 2A68C 4A3KB 4WJ4A 4NB3A 4ABNA 2E75C 3NPPA 3QJYA 1H9JA 3L2PA 2FHTA 1TS4A 1JJCB 5IYCG 1WTOA 2B2YC 5EPLA 4XQQA 5ELFA 3KDFB
chains in the Genus database with same CATH topology
1HUNA 4A3MB 4G7ZC 3U9OA 1F2MA 3NQIA 1LABA 3P7JA 1TT2A 1Q1EA 1V8QA 2E2IB 4RHSA 2LY7A 3KLSA 1TIID 2A6ED 1H9RA 1YNJC 1OO9B 2RDHA 4PMCA 2CW0C 1HRJA 1VMPA 1ONLA 4L8JA 1U4RA 5J1ZA 2PO4A 1QOHA 1D2BA 4FF1A 1PRTC 5ISRA 2EYFA 3RZOB 3M4OB 1QWYA 5T1GA 3C46A 1SMYD 1OXXK 3L7ZC 5EJWA 3T16A 3RLFA 2F4IA 2KUMA 5CV4A 2SOBA 1GUWA 1PTOF 3K0YA 1DM0B 2MGSA 3RMHA 3TSSA 5FKAC 4HSVA 4BS9A 1PMRA 1SYBA 4A3IB 4G7HC 4H13C 4BBSB 1CQVA 2EYMA 5FO9B 4KI0A 5I4DA 5HURA 1NCVA 1WTPA 2QEJC 5ELDA 2B2TC 1WTRA 1KNEA 1D1KA 5M5YB 4NMZA 4FO2A 2I46A 3H0GB 3BVMA 1A3TA 3MFGA 3OIPA 1G6ZA 3A56A 2I07B 5KIXA 3P75A 1S5ED 3MA2B 1I3QB 2VUMB 1J8IA 1IW7D 5E4WC 1MGSA 1A2UA 1HFNA 1XX8A 1I4XA 2R61A 2VB3X 1CZGA 2DY7A 3VR2A 3FDTA 2MJ8A 1ZYRC 2DNCA 4XYOA 4C3IB 1RF2D 1FGBD 4RWSC 2EJFC 4TRDA 3SE0A 3K7AB 2O4XA 1S5BD 1R9TB 1BCPB 3LWEA 2G9DA 2F0SA 4ILWA 5AFWA 1TU2B 3D8GA 2BA1A 3R93A 3K57A 1JE4A 1VF7A 4Q5VA 3X3MA 1SEBD 3SHLA 2AUKA 3OWEB 3Q23A 4K6LA 4A3FB 3HOZB 5DEHA 3K59A 4MIUA 3TN2A 4NP5A 2E2HB 1FYCA 2K5WA 2XRQD 1UEAB 1LTAD 1X32A 2IJ0A 2A6HD 1Z6HA 2NBFA 1KDAA 1BUVT 3QWNA 1IYUA 2C5CA 2PPBC 1HQRD 2KVMA 4HTHA 5C4JB 1HHVA 1E2ZA 1VCIA 2XIWA 3HOVB 1TS3A 2L1BA 5KNDA 1I4HA 4KV6A 1LT3D 3KUPA 2F0FA 2L4NA 1F9PA 1C8CA 3MXUA 1A6XA 1SJHD 4OL7A 1H9MA 3SK4A 1ESRA 2FJ2A 3OMGA 1E0BA 4I65A 2PZTA 1TVXA 4R8IA 3GTQB 1GUGA 2MP1A 4KJOA 1EZ6A 5BN4A 2PMZB 3TP5A 3BDOA 3DEOA 3Q0AA 2K28A 4ZYSA 2F0OA 2IX1A 4KY5A 1I6HB 4XT1B 3GO5A 3DUZA 4QIWB 2Q8RE 3IFDA 1FNWA 1PFBA 5EQ0A 2HQEA 2A68D 2RDFA 1Y8PB 3H09A 4HCEA 3NUCA 2BDNA 4HAEA 1LTTD 3A8JE 1SNPA 3DHQA 3FKIB 1JWUD 3UI2A 4ZKBB 1PTOB 5C4XB 2ZXOA 1G91A 1O78A 4IUTA 5ELCA 2DN8A 2A5HA 1SDFA 3OHXC 3IFTA 1U4MA 4CJ2C 1WTQA 4LMQD 1YNJD 1KABA 3OW7A 1DOLA 1ICWA 2CW0D 1EWHA 4IQZA 5CBEE 1BCPC 1RODA 2KCCA 5CYUA 4G7OC 3GTMB 1XWEA 2RSOA 2K5QA 1F2LA 3PUYA 1AZQA 1K83B 1GUSA 1CA5A 2OXPA 3VR6A 4I7ZC 2BCOA 1PRTD 3J7AF 1SNMA 5JEAG 2O5IC 3FPPA 2B2VA 2JEBI 2K1BA 4YIJA 1DOKA 2OEOA 3NXWA 3N6RA 5LL6S 3SK6A 1HCZA 2CQAA 4XQJA 1W6KA 1OXTA 1V1PA 5CR3A 1EOTA 4R8NA 4MHEA 1JQYD 2L5TA 5CORA 1Q12A 1CQFA 5JEAJ 5IIFA 2M00A 1EY8A 3GV6A 1JB3A 2O5JC 4ZUJA 3QO2A 1HFGA 2HDMA 1LTID 2SNMA 2M2LA 4IURA 4KTAA 2IX0A 1KTKA 4KD3A 2XVSA 4O1NA 1SSOA 4DK1A 3M4YA 2EOTA 1CT1D 4J8QA 5EGTA 3I3CA 1ILPA 4DA2A 1H9SB 2MUYA 3AB9A 1SNDA 2KEDA 1ZYRD 1TY2A 3HS0C 3PUWA 4IUPA 2QF7A 3IKJA 1LTGD 1B9NA 2B2YA 5ELBA 5EPKA 5I9PA 1STAA 2F0IA 4WORA 2NN6G 1B3AA 3ND9A 4C1NI 2FMMA 4DK0A 4DAYA 2HCIA 1U9RA 2L12A 3FRPB 3BYTB 3CHBD 5K5PA 3S1RB 4TQUS 3M3YB 4LAAA 1NUCA 3S1QB 2EY2A 5M5XB 1PTOC 1QCBD 2PQEA 1SYEA 4QF4A 1OXUA 3NWSA 3OWFA 3T51B 4F7XA 4IUVA 5KYLA 2RBMA 1Z7TA 3DWPA 2IWHA 4IN3A 4ZRZA 3AMUA 1TWFB 5JOBA 3BVGA 3I4MB 3T4AC 2WINB 1LV9A 5I9OA 1WTXA 2EDGA 1EY6A 1EYDA 3HP3A 5E4XA 4WFN3 4OIKA 2CHBD 1T5EA 2NTSA 4BBRB 2BOSA 3HEJA 1F77A 1O80A 1DYQA 5CV9A 4RGTA 3HOUB 1RTOA 3AU7A 3I4LA 4RKBA 3R2IA 3VA7A 1CI3M 1WCMB 1WTWA 3PO3B 2F0WA 1DD2A 2SNSA 2B2WC 3Q6SA 1ILQA 1FD7D 1TR5A 3VYSA 1AEXA 3M7GA 3KBXA 3NTKA 2B2UC 2WKCA 4E6IA 1CHPD 4OHJA 5I2YA 4RFBA 2F0HA 3EVQA 2XWJB 1IKLA 1B50A 2AWNA 1JWSD 2ID0A 2OF1A 1CFMA 1MD2D 3DWQA 3EJIA 2WIIB 2EJMA 4LJZC 2FMCA 2OT2A 5IODA 4X3TA 4X3KA 4K8IA 2QKIC 5JEAH 1KDCA 1PZID 1D1IA 1ZXTA 5CC4A 1AFPA 3VR5A 3K5MA 3PO2B 2NN6I 1JWMD 3G6JB 1CZWA 5CMDA 4IALA 3W3AA 4KMUC 1GHKA 5C3XA 1M8AA 2KCNA 3DM1A 4QB4A 4WRDA 2D62A 4GZYC 1SJED 1VDZA 2B8GA 4HR7B 1GOZA 1STEA 2Z1CA 3CRLC 4DN4M 1MBYA 2K6AA 2EJGC 1M4VA 1BCPD 1BQQT 1V43A 3EQLC 4HCSA 5IGEA 1EQVA 4BY7B 1L0YB 3D6CA 5C3EB 1B1ZA 4QCLA 5JPMC 5G3LD 3H6MA 4M8AA 5FO7B 4B9XA 3A54A 1TS2A 3Q24A 1MI2A 4RH6A 2PZWA 2D9UA 2ICIA 1STGA 3P1HA 5HGTA 2VNUD 2NYZD 2E2DC 3K5LA 4J6HA 2ZT9C 1ENCA 4HN7A 5TSSA 1SNOA 2L9HA 2XN9C 2EY1A 2NN6H 2JA8B 5BN5A 3T13A 2K33A 2F0PA 5EBDA 5A35A 3RD4A 2X69A 2IX3A 5E3FA 5D3DA 2F0EA 4PMWA 1DXMA 1GXDC 3TMEA 2JSOA 4OO1G 5DNFA 5J39A 2WP8J 2NUCA 3D3RA 3TZDA 2JEAI 2DY8A 1ML0D 3ND8A 4CHTB 2A73B 4RA8A 3TP7A 5FLXE 3H3VC 1TQOA 5LL6X 2BDOA 1LTSD 1I6VC 1SAPA 1G2TA 2NB0A 3N52A 2WKDA 3KBGA 4V190 4JBWA 1G291 4ZLTF 3S17B 1X3QA 5EKLA 2JA5B 3O13A 4KD4A 5I6WA 4FF3A 3MXPA 1NR4A 3OSOA 2F0GA 5FLXL 1EIHA 1Q8IA 3J81E 1SNQA 1TWHB 1F9SA 2NVTB 1R4PB 2KECA 1CTMA 1PTOD 3MEHA 1EFID 3ERQA 4KK7A 1OXSC 1UNSA 3ITPA 1FR3A 4XQNA 3GTGB 4FXKC 1SYCA 4DXGA 2MPMA 3W2DA 3RUZA 1STYA 5DAUA 3J81L 2ICEC 4A3EB 3I90A 5JAVA 2E76C 4H0LC 1NSNS 2C9OA 1WTVA 1ESFA 1TY0A 4ZQ3A 1EY9A 4DU9A 1EZ8A 5IGGA 5FOBB 2K03A 4ZKCB 3BG3A 3NWTA 5IGDA 4MN3A 4DNTB 1HQMC 1I4QA 1WVLA 2TMPA 1YNNC 1AZPA 3QG1A 4F8MA 2KHSA 4RGOS 2JP1A 4ME5A 3TP6A 3NTIA 4J1MA 2KEEA 3EFXD 4OO1I 4O42A 3NE5B 2AWOA 4K6DA 3LWUA 1J9OA 3C2PA 1EYCA 2JE6I 5CV8A 2R92B 1I50B 5D14A 2ZXRA 1O7YA 3SK5A 3V2TA 5KNBA 1BBXC 1IYVA 3D31A 2LKVA 1PTOH 1GUTA 1G8ZD 3A55A 1GJXA 2PW5A 2NZ1D 1HUMA 1G2SA 2EY6A 1TWCB 5FO8B 3S2HB 1FNUA 1XXGA 3URYA 1IHZA 2EYOA 5IGBA 4K5VA 1RCVD 4N9PA 4PMBA 3NHHA 4JK1C 2F0QA 4TKOB 2JA7B 4BA1I 1B9MA 5NUCA 1PYWD 3VR3A 4RGNA 4C56C 2IW3A 2B63B 1S5FD 1V1PB 1STNA 4FXGC 4C3HG 4C1NK 3TP8A 4R9WA 1D5MC 3H94A 2F0DA 1C4QA 1Q3LA 4DNRB 4CKEA 5KYIA 4KKTA 1I4PA 1RHPA 3EA6A 1JOOA 2QILA 4B08A 1RDPD 3I8ZA 3BVZA 3L3OC 2Z4HA 4OO1H 2RKSA 4IFDG 5C4ZA 3D4RA 5EKIA 3QOJA 4U68A 2FFKB 1EEID 1JR0D 1HA6A 3I4NB 1EL0A 3GTOB 1Y69U 1AN8A 1JC7A 5M9OA 1GUNA 4KY7A 2EXZA 2L0CA 5C3WA 2XRSD 2ZXPA 4IFDJ 5C4HA 4QUCA 4RCOA 1EQTA 1I4RA 2B2WA 5KRUA 1ZKOA 4V0BA 5LHY1 1H9KA 3VYRA 3PMFA 2RA4A 3K58A 2EYPA 1R4QB 4CBVA 1CHQD 1EY7A 4NKLA 2B2UA 3S15B 3OPOA 1U4PA 1T5XD 4HMIA 4QMGA 1LT6D 4DAVA 2F3WA 1VF5C 3QB3A 5JJZA 1S5CD 1DOMA 1HPCA 2SEBD 2K32A 4DGZA 3E0JA 5FK9C 3GTLB 3VR4A 4K14A 4DF7A 4U673 3OIQA 1LTRD 3HOWB 1PLFA 2K01A 3C1EA 3QOLA 3S16B 4HMJA 3A8IE 4K2LA 1QE6A 3MWYW 2EY5A 1LTBD 2D2CC 2N88A 3PUZA 1BDOA 1PRTB 1B44D 3C1FA 1D5ZC 5C0XG 2J4XA 3GTKB 4FP5D 2F0VA 2PNRC 3TDQA 2MHVA 4IUNA 3I73A 4LK1C 3KF8A 4IUUA 1PZJD 2R93B 1RD9D 3PV0A 3L9AX 5CGKA 3MAQA 2YYZA 1DJRD 5D65A 5IGCA 1BOSA 3Q22A 4DFAA 1UUPA 2FINB 3TZUA 1QB5D 5C0XJ 3GTJB 4KN4C 1SXTA 1CK1A 1EU3A 3HOXB 4IFDI 1DZ1A 3K5OA 3PIO3 4ID6A 4EGVA 5CBAE 3VYUA 1BXTA 1Y8OB 1A15A 4KHZA 4KY6A 2B2TA 4NDXA 2NWGA 2K04A 1EYAA 4EVOA 1SBBB 4ZUIA 3D6WA 5EKKA 2K05A 3JAML 1SYGA 4Y7NB 3D4DA 1F9RA 4DXFA 1BNZA 3I91A 2BA0A 1YNND 1HTLD 3DXJC 3SEBA 1GUOA 4FYDA 2EYHA 5IOCA 1F2YA 1STHA 3VYTA 1S5DD 1DCZA 4NW2A 1A2TA 4N9TA 2VXWA 2E2JB 4G57A 3I70A 3U9SA 4C3HB 1F2ZA 3V05A 4FF2A 5EBCA 2WV6D 1NR2A 1EWCA 2EYLA 4RKLA 3A7LA 3HG9A 3M7NA 3H91A 1B2TA 5CV7A 3PIP3 2L55A 3J80E 3HKZB 2QDBA 4G4KA 1C48A 1ENFA 4IFDH 3GV3A 3GQBA 3A7AB 1I4GA 4FNFA 3EROA 1D6EC 3A8KE 4XYQA 4P2CB 1PFMA 4S3SA 5C0XI 3WDNA 2F0KA 4ULLA 2A69C 3T56B 3WOEA 3S9WA 5T1IA 1A3UA 5JVG3 3J7AV 3VA5A 3NP8A 3J80L 2F0UA 4XT3B 5IGFA 3BDCA 2KOLA 1Y1WB 4CKBA 2F1MA 2QCPX 3SVMA 5JVH3 3WOFA 2NTTA 3V96A 5A2QE 2F0TA 2IL8A 2M9VA 3LX0A 3OOCA 5KNCA 3NSWA 3MXNA 1Q90A 4BY1B 1PXUA 5F2DA 5I2XA 3S1MB 2TSSA 4A3JB 3RZDB 1TS5A 3S1NB 3E5SA 5EPJA 4F87A 3DWAA 3FPUB 5ELEA 5A2QL 4CJ0B 4KHVA 4CJ1B 3NQTA 2NVXB 2WB1B 1MSGA 4A93B 1O7LA 1TWGB 1RKNA 3DEPA 3MFYA 1PDQA 4WJWA 5D3IB 1RTNA 4KKUA 3MZ5A 2JYOA 3NK9A 1BF4A 4IZ8A 2EE1A 4UDUC 4BA2I 3J7YW 5C0XH 2EPBA 1QILA 1ET6A 3BDLA 2BE5D 3HGBA 1KLGD 3FVQA 2IT1A 1ENAA 1X3PA 1O7ZA 5CV5A 3NTHA 5K36G 4FVMA 2LS01 2Z4IA 3KLRA 1II3A 2O2LD 2HUGA 4L63B 4C3JG 3QIAA 2Q8IB 2PZUA 1UAPA 4FF4A 1Y1VB 1SYFA 1BR9A 2PCFB 2VB2X 2H1EA 1ZEQX 2L11A 1QNKA 4RCNA 4XTCS 2B8FA 3KLSX 3S2DB 2Q8TA 4DAPA 4A3BB 3SXHA 3HRZC 1Y8NB 1PFNA 3TBIB 1TKWB 3G7LA 2R6GA 1SFOB 1PRTF 3I72A 4K5WA 4H44C 1E2VA 2JXMB 3SK8A 3PUXA 4TSSA 3T53B 3NBIA 3DMUA 2RSNA 3D4WA 3CKIB 4EQOA 4OGQC 3X3NA 1D5XC 2NVYB 1STBA 3GTPB 4Q0FA 3MTSA 2RQXA 4M1UB 1F9QA 1B4OA 4UAIA 2EZVA 3GP7A 1QG7A 5I6YA 1XYIA 4XIGS 3PUVA 1HTPA 2HDLA 1JICA 2AQ1B 4F88A 4PNYA 4PV1C 5C5LA 2E74C 3SR1A 4EQPA 2EYJA 1SE3A 3ZYYX 3BYYB 2R3ZA 4L6TB 4B9WA 1JCKB 5DM63 2F03A 1W6JA 3M85A 3IL8A 4KKSA 2KA7A 2A6EC 2RVLA 1B53A 3K5NA 1RJTA 4A3DB 4IUQA 3C3LA 2K7VA 5BN3A 1CM9A 1NAPA 4PQXA 1IL8A 1KLUD 1QNUA 5IT9E 1FNVA 2X6GA 3R2TA 2JA6B 1LT4D 3OMCA 4CGYB 2J0TD 4X3SA 2A74C 2R7ZB 1ET9A 2F0LA 3MXGA 1DONA 5CV6A 4HEDA 2EVBA 4EQNA 3E6ZX 3IAYA 5JPNC 1SMYC 2A69D 4ZK9B 3NBHA 5IT9L 3F2UA 1SNCA 1CA6A 5C44B 1XTCD 3K6OA 5J22A 1IKMA 4CKCA 1EY4A 4C2MB 1GHJA 1MSHA 1WD0A 3BZDB 4RGMA 5DM73 1VMCA 2XWBB 3R3OA 5M3FB 1LLRD 5K36H 2H4OA 2V4DA 3S14B 1Q1BA 1IW7C 1K8OA 5COYA 2F0MA 2WACA 1HA5A 1AW7A 3CQZB 4HSPA 3CU7A 1WD1A 1PZKD 2ENBA 4RAUC 4C3JB 4XDXA 2BE5C 1EY5A 5E1FA 4H7BA 1L0XB 1SE2A 1EU4A 1KDBA 5C6AA 1KAAA 2NVQB 3KK7A 1EY0A 2CVRA 5C5MA 2D5DA 2G9HD 2Z8LA 5M3MB 1JORA 2F0JA 4BWGB 3BS1A 5KEEA 1LACA 2F3VA 2N55A 1A3VA 1H9SA 2YU9B 1E2WA 2GA4B 1JOKA 1EIGA 1AP0A 4X3UA 5M5WB 2F0NA 3GD7A 2HCCA 2AQ2B 3HOYB 4QUFA 4C3IG 2PYKA 3MC0B 3FEWX 2A6HC 1SE4A 2LMCB 1LT5D 2LFNA 4RHRA 3SDZA 2IPKD 2B2VC 4XXEA 1OXVA 4K2KA 2Y0SB 2DNEA 4KN7C 4AYBB 1K8MA 1U4LA 4OIJA 1BCPF 4KJNA 3JAME 3LNNA 1SYDA 4K8JA 3CRKC 2SDFA 2J7ZA 5G3LF 3HZXA 5KGUA 1JOQA 2PW7A 4K5XA 2AQ3B 3MHBA 1LO5D 1QJOA 3MVVA 1V1OA 3P20A 1Z47A 2RDGA 1TWAB 4ZAIA 1S4ZA 2AUJD 2KJXA 1HXYD 1KNAA 2X6LA 4FXDA 2KQ3A 2K5DA 3R8BA 4Z9CB 3FMCA 2B39A 1EEFD 2XSCA 2XNAC 4A3GB 3ONAB 2WAQB 4ODGA 1BO0A 4A3KB 2A68C 4ABNA 2E75C 3NPPA 3QJYA 1H9JA 2FHTA 1TS4A 1WTOA 2B2YC 5EPLA 4XQQA 5ELFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JPN C;  5FOB B;  1JB3 A;  2WII B;  1BR9 A;  1XWE A;  3HRZ C;  3V96 A;  3CU7 A;  2ICE C;  1BUV T;  2XWB B;  5JPM C;  3OHX C;  2XWJ B;  2QKI C;  2J0T D;  1D2B A;  2A74 C;  2A73 B;  3KLS A;  3CKI B;  1JC7 A;  2TMP A;  2I07 B;  3I70 A;  3L3O C;  1PXU A;  5FO7 B;  4FXG C;  3G6J B;  5FO8 B;  1GXD C;  1OO9 B;  3FRP B;  3MA2 B;  2E2D C;  4FXK C;  3HS0 C;  2B39 A;  4ILW A;  1BQQ T;  1UEA B;  5FO9 B;  3T4A C;  2WIN B;  1UAP A; 
#chains in the Genus database with same CATH topology
 1HUN A;  4A3M B;  4G7Z C;  3CC2 A;  3U9O A;  1F2M A;  3NQI A;  1VQP A;  1LAB A;  3P7J A;  1TT2 A;  4NPS A;  1Q1E A;  1V8Q A;  2E2I B;  4RHS A;  1K73 C;  3UE0 A;  2LY7 A;  3KLS A;  3TS2 A;  1TII D;  1JMC A;  2A6E D;  1P16 A;  1H9R A;  1YNJ C;  1OO9 B;  2JN4 A;  3AYH B;  2RDH A;  4N8X 1;  4PMC A;  4NXN L;  2CW0 C;  1K8A C;  1HRJ A;  2UUA L;  4LF6 Q;  1VMP A;  2F4V L;  3J81 j;  1ONL A;  4L8J A;  1U4R A;  5J1Z A;  1NNX A;  2PO4 A;  3CPW A;  1QOH A;  3STB C;  4HJ5 A;  4FF1 A;  1D2B A;  4L5Q A;  3RZO H;  3K0X A;  1PRT C;  1Y1W H;  5ISR A;  3M4O H;  1K8G A;  2EYF A;  3RZO B;  3MXN B;  1EQR A;  3M4O B;  4A3D G;  1QWY A;  5T1G A;  1E1T A;  3C46 A;  1SMY D;  1OXX K;  3L7Z C;  5EJW A;  3T16 A;  3RLF A;  2F4I A;  3FKI G;  4DV2 Q;  2Z9H A;  4DUY Q;  2KUM A;  5CV4 A;  2SOB A;  4BY1 H;  2HIV A;  1GUW A;  1PTO F;  3K0Y A;  3PF5 A;  2A8V A;  3S1M H;  1DM0 B;  4A3I H;  2MGS A;  3RMH A;  1P8L A;  1X3F A;  3TSS A;  5FKA C;  2R7Z G;  4HSV A;  4BS9 A;  2HHH L;  1PMR A;  1SYB A;  4A3I B;  4G7H C;  4H13 C;  4A3J H;  4BBS B;  1CQV A;  2EYM A;  4LF7 Q;  5FO9 B;  1M1K C;  4KI0 A;  5I4D A;  5HUR A;  1NCV A;  1WTP A;  2QEJ C;  5ELD A;  2B2T C;  3H0G H;  1WTR A;  1KNE A;  1D1K A;  1VQL A;  5M5Y B;  4NMZ A;  4FO2 A;  2I46 A;  3H0G B;  4R4T A;  3BVM A;  1VQ5 A;  1A3T A;  3MFG A;  1J5E Q;  4DV7 L;  5C44 G;  3OIP A;  2KCM A;  1G6Z A;  3A56 A;  2I07 B;  2CKZ B;  5KIX A;  3CP0 A;  3P75 A;  1I3Q H;  2VUM H;  4LW1 A;  1S5E D;  2RHQ B;  3MA2 B;  2UUB L;  1I3Q B;  2VUM B;  1J8I A;  1IW7 D;  5E4W C;  1Z9F A;  1MGS A;  3E9I A;  1A2U A;  3CCS A;  5LMN L;  1HFN A;  1XX8 A;  1I4X A;  4MZ9 A;  2ZTE A;  2R61 A;  2VB3 X;  1CZG A;  2DY7 A;  5M3F G;  3VR2 A;  1CSP A;  3FDT A;  2MJ8 A;  1ZYR C;  4C3I H;  2DNC A;  3K8A A;  1XNQ Q;  4XYO A;  4C3I B;  1RF2 D;  3M4Q A;  1FGB D;  1SN8 A;  3K7A H;  2Q2U A;  4RWS C;  2EJF C;  1R9T H;  4TRD A;  3SE0 A;  1VQ7 A;  3K7A B;  2O4X A;  1S5B D;  3QR8 A;  5ELN A;  1R9T B;  1BCP B;  2I5L X;  1X65 A;  3LWE A;  2G9D A;  2QA4 A;  3J81 i;  1VQM A;  4EX5 A;  3W5O A;  2F0S A;  4ILW A;  2ALY B;  5AFW A;  1TU2 B;  2PNH A;  3D8G A;  2BA1 A;  3R93 A;  3F8T A;  3K57 A;  1JE4 A;  3KF6 A;  1VF7 A;  4Q5V A;  4JYA Q;  3X3M A;  1SEB D;  1VS0 A;  3SHL A;  2AUK A;  3HOZ H;  3OWE B;  3Q23 A;  4K6L A;  4A3F B;  3G4S A;  3HOZ B;  5DEH A;  1BKB A;  3K59 A;  4MIU A;  3TN2 A;  4NP5 A;  1VQG A;  2E2H B;  1FYC A;  4GOP C;  2K5W A;  2V1C C;  2XRQ D;  1UEA B;  4HJ8 A;  4QL5 A;  4HJA A;  1LTA D;  1X32 A;  1PYS B;  2IJ0 A;  2A6H D;  1Z6H A;  2NBF A;  1KDA A;  1BUV T;  1SRO A;  2MO0 A;  2NZO A;  3QWN A;  1IYU A;  2C5C A;  2N3S A;  2PPB C;  1VQ9 A;  1HQR D;  2KVM A;  3HOV H;  4HTH A;  5C4J B;  1HHV A;  1E2Z A;  1VCI A;  2XIW A;  3HOV B;  1TS3 A;  2L1B A;  5KND A;  1I4H A;  4KV6 A;  1LT3 D;  3KUP A;  2F0F A;  2E5L Q;  2L4N A;  1F9P A;  3DLL A;  1UE7 A;  1C8C A;  3MXU A;  4OX9 L;  3GTP H;  1A6X A;  1SJH D;  4OL7 A;  1H9M A;  4DR1 L;  5IYC H;  3SK4 A;  1ESR A;  2Y0S G;  4LFB L;  2FJ2 A;  5IWA L;  3OMG A;  1E0B A;  4I65 A;  1NMF A;  2OQK A;  2PZT A;  1PH2 A;  3I4M G;  1CKO A;  2MQH A;  3CCM A;  1TVX A;  4R8I A;  4AH6 A;  3GTQ B;  1GUG A;  2MP1 A;  4KJO A;  1EZ6 A;  1FL0 A;  5BN4 A;  2PMZ B;  3TP5 A;  3BDO A;  3DEO A;  3Q0A A;  2K28 A;  4ZYS A;  2F0O A;  4B3S L;  2IX1 A;  4YHH L;  4BBR G;  4KY5 A;  4JI5 Q;  1I6H B;  4XT1 B;  3GO5 A;  3DUZ A;  4QIW B;  1E3P A;  2Q8R E;  3IFD A;  1FNW A;  1PFB A;  5EQ0 A;  4HIO A;  1I94 Q;  4P71 A;  4DR5 L;  1YIT A;  3HOU G;  2HQE A;  3F1Z A;  2A68 D;  2RDF A;  1Y8P B;  3OTO Q;  3VDY A;  4MTK A;  3H09 A;  1GD7 A;  4HCE A;  4A3D H;  1S40 A;  1QZG A;  3I4O A;  4LF8 Q;  3NUC A;  1EQQ A;  2BDN A;  4B3R Q;  4HAE A;  3FKI H;  1LTT D;  3A8J E;  1SNP A;  3DHQ A;  3HKZ E;  3FKI B;  1JWU D;  3UI2 A;  4ZKB B;  1PTO B;  5C4X B;  2ZXO A;  1G91 A;  1Q8K A;  4A3G G;  1O78 A;  2WAQ G;  4IUT A;  4GKK L;  5ELC A;  2DN8 A;  2UXC Q;  2A5H A;  5AJ3 L;  3T1Y Q;  1YJ9 A;  1Q7Y C;  1SDF A;  3NBH B;  3OHX C;  1C7Y A;  2R7Z H;  3IFT A;  1U4M A;  4CJ2 C;  4A3K G;  1WTQ A;  4LMQ D;  1YNJ D;  3I55 A;  1KAB A;  3OW7 A;  4JVZ A;  1DOL A;  1PH8 A;  1JJ2 A;  1HZC A;  1ICW A;  2CW0 D;  1EWH A;  2UU9 L;  4IQZ A;  5CBE E;  1BCP C;  3CPF A;  1ROD A;  2KCC A;  1VQH A;  5CYU A;  4G7O C;  3GTM B;  3NEL A;  3RN2 A;  1ASZ A;  1XWE A;  2UXB Q;  4A3M G;  1XMO Q;  2RSO A;  1K83 H;  2K5Q A;  1F2L A;  4LUV A;  5C44 H;  2ZJQ A;  3PUY A;  1AZQ A;  1K83 B;  1GUS A;  1CA5 A;  4LFA L;  2OXP A;  4X62 L;  3VR6 A;  4I7Z C;  2BCO A;  1PRT D;  3J7A F;  4C2M H;  1SNM A;  5JEA G;  2O5I C;  4DR2 Q;  3FPP A;  2B2V A;  2JEB I;  2K1B A;  4YIJ A;  1DOK A;  2OEO A;  3NXW A;  3N6R A;  5LL6 S;  4DV5 L;  3SK6 A;  5JJL A;  1HCZ A;  1S72 A;  1PH9 A;  2CQA A;  4XQJ A;  4QGU A;  1W6K A;  1OXT A;  1PA6 A;  1V1P A;  5M3F H;  5CR3 A;  1N9W A;  1EOT A;  4R8N A;  2DUD A;  1JQY D;  4MHE A;  2L5T A;  5COR A;  4DV1 L;  1Q12 A;  1Q86 C;  1CQF A;  5JEA J;  3S14 H;  5IIF A;  4GS3 A;  2M00 A;  3PCO B;  3K80 C;  1EY8 A;  1K0S A;  3GV6 A;  3CQZ H;  1JB7 A;  1JB3 A;  1UE5 A;  4A3C G;  2O5J C;  4ZUJ A;  3QO2 A;  4BXX G;  1EIY B;  4BY7 G;  1HFG A;  2HDM A;  1LTI D;  2SNM A;  4IPH A;  3CF5 A;  3U50 C;  2R7D A;  2M2L A;  2WB1 E;  4CDC C;  4YY3 Q;  4IO9 A;  2Q2T A;  4IUR A;  1QVC A;  4KTA A;  2IX0 A;  1KTK A;  3CME A;  1C9O A;  4QQB X;  4MNO A;  1YHB A;  4GLX A;  2JJQ A;  4KD3 A;  2HIX A;  1W2B A;  2XVS A;  4BBS G;  4O1N A;  4IPG A;  4DV0 L;  1SSO A;  4DK1 A;  3M4Y A;  4X64 Q;  2EOT A;  1L1O B;  1JT8 A;  4JBJ A;  1CT1 D;  4J8Q A;  5EGT A;  4JI7 L;  1PH3 A;  3I3C A;  1ILP A;  4DA2 A;  1AH9 A;  1H9S B;  4P73 A;  2MUY A;  5M3M H;  3AB9 A;  4JG2 A;  1SND A;  2KED A;  4DR7 L;  1B7Y B;  1ZYR D;  3FP9 A;  1TY2 A;  3HS0 C;  3PUW A;  4AIM A;  4DV4 L;  4IUP A;  1ICF B;  3G6E A;  3S24 A;  2QF7 A;  2YU9 H;  3UDX A;  3IKJ A;  1IBM Q;  2JA8 G;  1LTG D;  4JI1 L;  1J6Q A;  1B9N A;  2B2Y A;  2D0O A;  5ELB A;  5EPK A;  4JI3 L;  5I9P A;  1NBW A;  1STA A;  2F0I A;  4WOR A;  2NN6 G;  2VQF L;  1B3A A;  2CFM A;  4LF4 L;  3ND9 A;  4C1N I;  2FMM A;  4DK0 A;  4JI6 L;  4X65 L;  1UE1 A;  2OQ0 A;  4DAY A;  3W1G A;  2HCI A;  4HJ9 A;  1U9R A;  3H3V I;  3S1R H;  2L12 A;  3FRP B;  3BYT B;  3AEV A;  3CHB D;  3M3Y H;  5K5P A;  3S1R B;  4TQU S;  4A4I A;  5GAE C;  3M3Y B;  4LAA A;  1K28 A;  4IOC A;  3PIO A;  1M90 C;  1NUC A;  1UE6 A;  3S1Q B;  2EY2 A;  5M5X B;  4GNX B;  1PTO C;  1QCB D;  4B3M L;  2PQE A;  1YI2 A;  1SYE A;  2B29 A;  1OXU A;  2RF4 A;  4QF4 A;  3NWS A;  3OWF A;  1TWF H;  1QVG A;  1YHQ A;  3T51 B;  4F7X A;  2YTV A;  4IUV A;  5KYL A;  3KJO A;  2RBM A;  1Z7T A;  3DWP A;  2IWH A;  4IN3 A;  4ZRZ A;  3AMU A;  1TWF B;  1K3R A;  2EXD A;  5JOB A;  3BVG A;  3I4M B;  3T4A C;  2WIN B;  1LV9 A;  5I9O A;  3J80 c;  2BH2 A;  1EUJ A;  5FLM G;  4ALP A;  1WTX A;  2EDG A;  1EY6 A;  4MTN A;  2ZTD A;  1EYD A;  3HP3 A;  5E4X A;  4WFN 3;  4OIK A;  2CHB D;  4BBR H;  1T5E A;  4GN4 B;  2NTS A;  4BBR B;  2BOS A;  4JI0 L;  2CWA A;  2JQO A;  3HEJ A;  1H95 A;  1F77 A;  2UUC L;  1O80 A;  2AKW B;  2ZTC A;  1E22 A;  3D0F A;  3HOU H;  1DYQ A;  5CV9 A;  4RGT A;  4R4Q A;  3HOU B;  1RTO A;  3AU7 A;  3I4L A;  4RKB A;  3R2I A;  1MIU A;  3VA7 A;  2Z6K C;  1CI3 M;  1WCM B;  1WTW A;  3PO3 B;  2F0W A;  1XPR A;  1FJG Q;  1DD2 A;  2SNS A;  3ULJ A;  2B2W C;  3Q6S A;  1ILQ A;  1A8V A;  3G71 A;  1FD7 D;  1TR5 A;  5FJ8 H;  3VYS A;  1AEX A;  3M7G A;  4A3G H;  3KBX A;  3NTK A;  2B2U C;  2KEN A;  2WKC A;  4E6I A;  1CHP D;  3H3V H;  2K50 A;  4OHJ A;  5I2Y A;  1HR0 L;  1IBL L;  4RFB A;  3PIP A;  4A3K H;  2F0H A;  3EVQ A;  2XWJ B;  1IKL A;  4P74 A;  5IY0 A;  1B50 A;  3BZC A;  2AWN A;  1JWS D;  1XNR L;  1IBK Q;  2ID0 A;  3HFZ B;  1LYL A;  1N32 Q;  2OF1 A;  5GRO A;  4A3M H;  2UUA Q;  2VZA A;  3J80 i;  3PF4 A;  1CFM A;  1MD2 D;  3DWQ A;  3EJI A;  2WII B;  2EJM A;  2OTL A;  4LJZ C;  1WI5 A;  2RHS B;  2FMC A;  2OT2 A;  1N8R C;  2E2I H;  5IOD A;  1L1O C;  4X3K A;  4X3T A;  4K8I A;  2K5H A;  2QKI C;  5JEA H;  1KDC A;  1PZI D;  1NY4 A;  1D1I A;  1ZXT A;  5CC4 A;  1AFP A;  3VR5 A;  3K5M A;  3PO2 B;  2NN6 I;  1JWM D;  3G6J B;  1CZW A;  2QEX A;  5CMD A;  4IAL A;  3W3A A;  1Q82 C;  4LF5 L;  4KMU C;  1GHK A;  5C3X A;  4LFC Q;  4B3T Q;  1M8A A;  2KCN A;  1IYJ B;  3DM1 A;  4QB4 A;  4WRD A;  5FLX c;  4DAM A;  2D62 A;  4GZY C;  1SJE D;  1SRU A;  1VDZ A;  2B8G A;  4HR7 B;  2Z0S A;  1GOZ A;  1STE A;  1ASY A;  2Z1C A;  4LWC A;  3CRL C;  4DN4 M;  1MBY A;  4R4I A;  4BXX H;  2K6A A;  2EJG C;  1M4V A;  1BCP D;  1BQQ T;  1E7Z A;  4BY7 H;  1V43 A;  3EQL C;  4HCS A;  5IGE A;  1EQV A;  4GOP A;  1L0Y B;  1B8A A;  4BY7 B;  3D6C A;  3CCV A;  5C4X G;  2CH4 W;  5C3E B;  1B1Z A;  4QCL A;  3F2B A;  5JPM C;  5G3L D;  3H6M A;  4KHP Q;  1QUQ A;  1HZB A;  1VQB A;  4M8A A;  5FO7 B;  2CQO A;  1BVS A;  4BBS H;  4B9X A;  1HNX Q;  3A54 A;  2F3I A;  1TS2 A;  1WFQ A;  3Q24 A;  3EBE A;  1MI2 A;  4GKJ Q;  3J81 c;  1VQ6 A;  4RH6 A;  2JK8 A;  4LF6 L;  4X66 Q;  2PZW A;  5M5Y H;  1LM0 A;  2D9U A;  4AQY Q;  2ICI A;  1STG A;  5LMN Q;  1L2F A;  2AHO B;  1QVF A;  4OWT B;  2PI2 E;  3P1H A;  5HGT A;  4A76 A;  3ER0 A;  2VNU D;  2NYZ D;  2B63 G;  2E2D C;  3K5L A;  4J6H A;  2ZT9 C;  3MEF A;  1ENC A;  4HN7 A;  2JA8 H;  5TSS A;  1SNO A;  2L9H A;  2XN9 C;  2EY1 A;  2NN6 H;  2JA8 B;  5BN5 A;  4DV6 Q;  3RLO A;  3T13 A;  2K33 A;  4DUY L;  2F0P A;  5EBD A;  5A35 A;  3RD4 A;  2BH8 A;  2X69 A;  2NZH A;  2Q2I A;  2IX3 A;  5E3F A;  5D3D A;  2F0E A;  4PMW A;  3UE1 A;  3WWV A;  1DXM A;  1GXD C;  3TME A;  4LF7 L;  2JSO A;  2HT1 A;  4OO1 G;  5DNF A;  5DLQ E;  5J39 A;  2WP8 J;  4OON A;  5BR8 Q;  2NUC A;  2OTJ A;  3D3R A;  3TZD A;  1FGU A;  2JEA I;  2DY8 A;  3KF6 B;  1ML0 D;  3ND8 A;  4YWL A;  4HIM A;  3L0O A;  1J5E L;  4CHT B;  2A73 B;  1YNX A;  4RA8 A;  3TP7 A;  5FLX E;  3H3V C;  1TQO A;  5LL6 X;  2BDO A;  1LTS D;  1I6V C;  1SAP A;  1G2T A;  2NB0 A;  2K14 A;  3N52 A;  4CDE C;  2WKD A;  2GVA A;  3S17 H;  3KBG A;  5FLM H;  4V19 0;  4JBW A;  1G29 1;  4A3L G;  4JOI C;  4ZLT F;  3S17 B;  1X3Q A;  5EKL A;  1XPO A;  2JA5 B;  3O13 A;  4KD4 A;  5I6W A;  4A3F H;  4FF3 A;  3MXP A;  1NR4 A;  3OSO A;  2I5H A;  2E2H H;  2F0G A;  5FLX L;  1EIH A;  4PZ8 A;  2WFW A;  1XNQ L;  5IP7 G;  1EIF A;  1Q8I A;  3J81 E;  4LUZ A;  1SNQ A;  1HNZ Q;  1TWH B;  1F9S A;  2NVT B;  2Y0S E;  1R4P B;  2KEC A;  1CTM A;  1PTO D;  3MEH A;  4AYB E;  1EFI D;  3ERQ A;  4KK7 A;  1OXS C;  1UNS A;  3HOW G;  3ITP A;  4QY7 A;  4JI4 Q;  1FR3 A;  4XQN A;  3GTG B;  4FXK C;  1SYC A;  5C4J H;  3ULL A;  4DXG A;  2MPM A;  3W2D A;  3RUZ A;  1STY A;  5DAU A;  3J81 L;  2ICE C;  4JYA L;  4A3E B;  3BZK A;  3I90 A;  5JAV A;  2E76 C;  4H0L C;  2QGQ A;  1Q81 C;  4TVA B;  1NSN S;  2C9O A;  1WTV A;  1AE3 A;  1ESF A;  4PZ6 A;  1TY0 A;  4ZQ3 A;  1X3G A;  1EY9 A;  4B3S Q;  1CKN A;  4DU9 A;  1EZ8 A;  2GN5 A;  5IGG A;  3GTQ H;  1SLJ A;  1YBY A;  1B70 B;  2K03 A;  5FOB B;  4ZKC B;  4DUZ Q;  3BG3 A;  3NWT A;  5IGD A;  4MN3 A;  4DNT B;  1HQM C;  1I4Q A;  4L5R C;  1WVL A;  2TMP A;  1YEZ A;  1YNN C;  1UEB A;  1AZP A;  2P5Z X;  3QG1 A;  2WAQ E;  1C0A A;  4F8M A;  2KHS A;  1I6H H;  4RGO S;  2JP1 A;  3T1H Q;  4ME5 A;  3TP6 A;  3NTI A;  4J1M A;  3W1B A;  2KEE A;  3EFX D;  4OO1 I;  4O42 A;  3NE5 B;  2AWO A;  4K6D A;  3LWU A;  1J9O A;  3C2P A;  1EYC A;  1HR0 W;  2JE6 I;  5CV8 A;  4GLA C;  3CCR A;  2R92 B;  1I50 B;  1WCM G;  1PVO A;  2B3G A;  2ZXR A;  5D14 A;  3PO3 G;  1O7Y A;  3SK5 A;  3V2T A;  5KNB A;  3SGI A;  1BBX C;  2H5X A;  5C4X H;  1IYV A;  3D31 A;  2LKV A;  1PTO H;  1GUT A;  4R4O A;  1G8Z D;  1OTC A;  3A55 A;  1VQD A;  1GJX A;  1EOV A;  2RCF A;  2PW5 A;  2NZ1 D;  1XMQ Q;  4KLK A;  1HUM A;  2A19 A;  1G2S A;  1TWC H;  1Q46 A;  2EY6 A;  4JI8 L;  3S2H H;  1WJJ A;  1CKM A;  1TWC B;  2EIF A;  3G48 A;  4RMF A;  5FO8 B;  1FNU A;  3S2H B;  2VY3 A;  1XXG A;  3URY A;  4JI5 L;  4L5T A;  1HJP A;  3GTM H;  5JJK A;  1IHZ A;  2EYO A;  5IGB A;  4DK6 C;  4K5V A;  4GLV B;  1RCV D;  4N9P A;  4PMB A;  3CCE A;  4DV3 Q;  3NHH A;  4JK1 C;  2F0Q A;  4LF9 Q;  4TKO B;  4DK3 C;  2JA7 B;  1I94 L;  3GDE A;  4HID A;  4BA1 I;  1B9M A;  5NUC A;  5J3B A;  2B63 H;  3OTO L;  4DR4 L;  1PYW D;  3VR3 A;  4K0K Q;  4RGN A;  4C56 C;  2IW3 A;  2B63 B;  1S5F D;  2CWP A;  4LF8 L;  1E24 A;  1STN A;  1V1P B;  4FXG C;  1HNW Q;  4C3H G;  4C1N K;  3PO2 G;  4JV5 Q;  3TP8 A;  3KLW A;  2VQE Q;  4R9W A;  1D5M C;  4IOA A;  3H94 A;  2F0D A;  1C4Q A;  1Q3L A;  4GN5 A;  4DNR B;  4CKE A;  5KYI A;  2UXC L;  4KKT A;  1I4P A;  1RHP A;  1VQJ A;  3T1Y L;  3EA6 A;  1JOO A;  2QIL A;  2IHF A;  1RDP D;  1RIP A;  4B08 A;  2ZJR A;  3I8Z A;  3BVZ A;  3L3O C;  2Z4H A;  4OO1 H;  2RKS A;  4A75 A;  4IFD G;  2K5N A;  5C4Z A;  1EFW A;  1Y14 B;  2DGY A;  3D4R A;  5EKI A;  2MNA A;  4DKA C;  3QOJ A;  2VL6 A;  4U68 A;  2UXB L;  4N8F A;  4OWX B;  3NEM A;  2FFK B;  1EEI D;  1JR0 D;  1HA6 A;  3I4N B;  1EL0 A;  2YTY A;  3GTO B;  1Y69 U;  1AN8 A;  5C3E G;  1A63 A;  3EIV A;  1JC7 A;  5M9O A;  4OWW B;  1GUN A;  1G51 A;  4KY7 A;  2EXZ A;  5IP9 G;  3A5U A;  3JAM c;  4DR7 Q;  1N36 Q;  2L0C A;  4CDD C;  1NMG A;  5C3W A;  2XRS D;  4DR3 Q;  4DR2 L;  2Z6K A;  2ZXP A;  4A3L H;  1Y1W G;  4IFD J;  5C4H A;  4QUC A;  4RCO A;  1EQT A;  4FDB A;  1X55 A;  1I4R A;  2B2W A;  5KRU A;  1ZKO A;  4V0B A;  5LHY 1;  2DJF C;  1H9K A;  3VYR A;  3PMF A;  4APV A;  2RA4 A;  3K58 A;  1CUK A;  1SR3 A;  2EYP A;  1R4Q B;  4CBV A;  4LF4 Q;  1CHQ D;  2PI2 A;  1EY7 A;  2IHE A;  2B2U A;  4NKL A;  3S15 B;  3OPO A;  1U4P A;  1D7Q A;  1T5X D;  4HMI A;  4QMG A;  1LT6 D;  4L5S A;  5IP7 H;  4DR6 Q;  4DAV A;  2F3W A;  2YV5 A;  4WJ3 M;  4DAY B;  3TRE A;  1VF5 C;  3QB3 A;  5JJZ A;  1S5C D;  1DOM A;  3GTL H;  1HPC A;  2SEB D;  2K32 A;  4DGZ A;  1V9P A;  3E0J A;  4UPA A;  5FK9 C;  3CC4 A;  3GTL B;  3VR4 A;  4K14 A;  4DF7 A;  4YY3 L;  4U67 3;  3OIQ A;  1X9N A;  1LTR D;  1SMX A;  3I56 A;  3HOW B;  2UXD L;  1N34 Q;  1PLF A;  2I0Q A;  2K01 A;  4A93 G;  3C1E A;  3QOL A;  3S16 B;  4HMJ A;  3A8I E;  4K2L A;  4X64 L;  1QE6 A;  1U5K A;  2EY5 A;  3MWY W;  5IYB G;  1LTB D;  2D2C C;  2N88 A;  3S1Q H;  3PUZ A;  1AE2 A;  1BDO A;  1PRT B;  5M5X H;  4HIK A;  2D0P A;  1N33 Q;  1B44 D;  3C1F A;  3I7F A;  1D5Z C;  3M4P A;  1V1Q A;  3JAM i;  1RL2 A;  4JI2 Q;  5C0X G;  2J4X A;  2OCE A;  3GTK B;  4FP5 D;  2F0V A;  2PNR C;  4IJL A;  3I4M H;  1VQ4 A;  3TDQ A;  2A1A A;  2MHV A;  4IUN A;  3AQQ A;  3I73 A;  4UHV A;  4LK1 C;  3KF8 A;  4IUU A;  3K81 C;  5LMU Q;  1PZJ D;  2K4K A;  1IBM L;  2R93 B;  1RD9 D;  1JJG A;  3A5Z B;  3PV0 A;  3L9A X;  5CGK A;  3E9H A;  3MAQ A;  3CCL A;  2YYZ A;  1DJR D;  2JA5 G;  5D65 A;  1MJC A;  5IGC A;  5H1S E;  2ZM6 Q;  1BOS A;  4JC0 A;  3Q22 A;  2KHI A;  4J15 A;  4DFA A;  1UUP A;  2FIN B;  3TZU A;  1QB5 D;  1KIX A;  5C0X J;  3GTJ B;  4KN4 C;  1SXT A;  1KQS A;  1CK1 A;  3H15 A;  1EU3 A;  4NXM Q;  4O2D A;  3PGZ A;  3HOX B;  3CCU A;  3BU2 A;  4IFD I;  1DZ1 A;  1Y1V G;  3K5O A;  3PIO 3;  4ID6 A;  4EGV A;  5CBA E;  3VYU A;  1BXT A;  4UP9 A;  1Y8O B;  1WCM H;  2EQS A;  1A15 A;  3PO3 H;  4KHZ A;  2LXK A;  4KY6 A;  1NE3 A;  2B2T A;  3E0E A;  4NDX A;  2NWG A;  2K04 A;  1EYA A;  1XNR Q;  4EVO A;  1SBB B;  4Y7N H;  1PHJ A;  4ZUI A;  3LGJ A;  3D6W A;  2AMC B;  5EKK A;  2K05 A;  3JAM L;  1SYG A;  4Y7N B;  1MJE A;  3D4D A;  2YTX A;  4A3B G;  2LSS A;  1F9R A;  5HY6 A;  2PMZ E;  1LUZ A;  1A62 A;  4DXF A;  1BNZ A;  3I91 A;  4A3E G;  1YVC A;  2BA0 A;  1YNN D;  1XPU A;  2KBN A;  2PQA A;  1HTL D;  3DXJ C;  2N78 A;  3SEB A;  1GUO A;  4FYD A;  4NXN Q;  2EYH A;  4QIW E;  5IOC A;  1F2Y A;  4POG A;  2F4V Q;  1STH A;  2R7F A;  3VYT A;  1DGS A;  1S5D D;  1DCZ A;  2L15 A;  4NW2 A;  2E2J H;  1UWV A;  1KXL A;  1A2T A;  4N9T A;  3F2D A;  1MKH A;  2VXW A;  4C3H H;  2E2J B;  3PO2 H;  1FJG L;  4G57 A;  3I70 A;  3U9S A;  4C3H B;  3UDI A;  1F2Z A;  3V05 A;  4FF2 A;  5EBC A;  2WV6 D;  1NR2 A;  2ATW A;  1EWC A;  4X6A H;  2EYL A;  2QDL A;  4LNQ A;  4RKL A;  4YWK A;  2CCZ A;  3A7L A;  1YHA A;  3HG9 A;  3M7N A;  1NTG A;  3H91 A;  1B2T A;  5CV7 A;  3PIP 3;  2E8G A;  2L55 A;  3J80 E;  3HKZ B;  1BBU A;  2QDB A;  4G4K A;  4GOP B;  1C48 A;  1ENF A;  4JOI A;  1WYD A;  4IFD H;  3GV3 A;  3GQB A;  3A7A B;  1I4G A;  2R92 G;  2LXJ A;  4FNF A;  3KDF A;  5IYD G;  4ME3 A;  2HHH Q;  1IBK L;  1QUQ B;  1D6E C;  3ERO A;  1N32 L;  5ELO A;  3A8K E;  4A3C H;  4XYQ A;  4IJH A;  1TXY A;  3A0J A;  4P2C B;  1PFM A;  4S3S A;  1K3B C;  5C0X I;  3WDN A;  2F0K A;  4ULL A;  1GVP A;  2A69 C;  3T56 B;  1L0W A;  2CH4 A;  5C3E H;  3WOE A;  3S9W A;  5T1I A;  1A3U A;  5JVG 3;  3J7A V;  3VA5 A;  5IP9 H;  3NP8 A;  3J80 L;  2F0U A;  1YJW A;  4DV7 Q;  4XT3 B;  5IGF A;  3TS0 A;  3BDC A;  3RN5 A;  2KOL A;  1Y1W B;  2UUB Q;  4GNX C;  4OEL B;  4CKB A;  2F1M A;  3EN2 A;  2QCP X;  3SVM A;  4LFC L;  1VQO A;  5JVH 3;  3WOF A;  3CXC A;  2NTT A;  4H02 A;  4B3T L;  3V96 A;  2XTI A;  5A2Q E;  2F0T A;  2N49 A;  2IL8 A;  2M9V A;  3LX0 A;  3OOC A;  5KNC A;  2JA7 G;  2JA6 G;  3NSW A;  3MXN A;  1Q90 A;  4BY1 B;  2XGT A;  1PXU A;  5F2D A;  5I2X A;  3KFU A;  3S1M B;  5GAD C;  3U58 A;  2TSS A;  3TEH B;  3RZD H;  4A3J B;  1PH5 A;  3S1N H;  3RZD B;  1VQA A;  4P75 A;  1TS5 A;  3PSI A;  3S1N B;  3E5S A;  4CDF C;  3BJU A;  4DV2 L;  4Y52 H;  5EPJ A;  4F87 A;  3DWA A;  3FPU B;  5ELE A;  5A2Q L;  4CJ0 B;  2NVX H;  4KHV A;  4CJ1 B;  3NQT A;  4KHP L;  4A93 H;  1TWG H;  2NVX B;  2WB1 B;  3CW2 C;  1MSG A;  4A93 B;  3DM3 A;  1HNX L;  1O7L A;  1TWG B;  1RKN A;  5IYB H;  3DEP A;  3MFY A;  1PDQ A;  4R4C A;  4WJW A;  5D3I B;  1RTN A;  4GKJ L;  4KKU A;  1IXR A;  3MZ5 A;  2JYO A;  2IY5 B;  3NK9 A;  1BF4 A;  4X66 L;  4IZ8 A;  4OEM B;  4AQY L;  5IE8 A;  2EE1 A;  4UDU C;  4BA2 I;  3J7Y W;  5E7N A;  5C0X H;  3I4N G;  2EPB A;  1QIL A;  1ET6 A;  1IL2 A;  3BDL A;  2BE5 D;  3HGB A;  4YWM A;  1KLG D;  3FVQ A;  4JW0 A;  2IT1 A;  1ENA A;  1X3P A;  3KOJ A;  1O7Z A;  5CV5 A;  4POF A;  3NTH A;  5K36 G;  4DV6 L;  4I7A A;  4PG3 A;  4FVM A;  2JA5 H;  2LS0 1;  2Z4I A;  3KLR A;  1II3 A;  3CCJ A;  1KAW A;  2O2L D;  2HUG A;  4L63 B;  4LUO A;  4C3J G;  3QIA A;  2Q8I B;  1D8L A;  2G5D A;  1Y1V H;  2K75 A;  2PZU A;  3KJP A;  1UAP A;  1VQI A;  4FF4 A;  1Y1V B;  1SYF A;  1BR9 A;  2PCF B;  5HGQ A;  2VB2 X;  5BR8 L;  1TWH H;  1WOC A;  2Q2H A;  5GAH C;  2H1E A;  2NVT H;  1ZEQ X;  2L11 A;  3NEN A;  1QNK A;  4RCN A;  4OX9 Q;  4DR1 Q;  3HKS A;  3GTG H;  5M3M G;  4XTC S;  4LFB Q;  3OW2 A;  5IWA Q;  3S2D H;  1XJV A;  4A3B H;  2B8F A;  1O7I A;  4DPG A;  3KLS X;  5IT9 c;  3S2D B;  2Q8T A;  4DAP A;  1CKN B;  4A3B B;  3SXH A;  3HRZ C;  1Y8N B;  4A3E H;  4JPB W;  1PFN A;  3TBI B;  5GAG C;  4EQ5 A;  1LTL A;  3A74 A;  1SFO H;  1TKW B;  3G7L A;  2R6G A;  2JA9 A;  1SFO B;  1PRT F;  3I72 A;  4K5W A;  4H44 C;  1E2V A;  2C35 B;  2JXM B;  3SK8 A;  4YHH Q;  3PUX A;  3HOY G;  1HZA A;  3TRZ A;  4TSS A;  1VQK A;  3T53 B;  1HNZ L;  4UP8 A;  2ASB A;  3NBI A;  2R93 G;  3DMU A;  4DR5 Q;  4ZCK A;  2RSN A;  2VS1 A;  1MHW C;  3D4W A;  2NVY H;  3ULP A;  3CKI B;  4EQO A;  4OGQ C;  3X3N A;  1D5X C;  2NVY B;  1STB A;  3J7A 5;  4JI4 L;  4DNI A;  3GTP B;  4Q0F A;  1PH1 A;  4AYB G;  3MTS A;  2RQX A;  4M1U B;  1F9Q A;  1B4O A;  4UAI A;  2EZV A;  1VQC A;  3GP7 A;  1QG7 A;  5I6Y A;  1XYI A;  4XIG S;  3HOX G;  1IZ6 A;  1I5F A;  2MFI A;  4GKK Q;  5AJ3 Q;  3PUV A;  3K7U C;  2E5L L;  2R92 H;  1I50 H;  2N8N A;  4JI8 Q;  5IYD H;  1HTP A;  2HDL A;  1JIC A;  2AQ1 B;  4F88 A;  4PNY A;  1PYB A;  2Z6B A;  4PV1 C;  5C5L A;  1KRT A;  3PQI A;  2E74 C;  2UU9 Q;  3SR1 A;  4EQP A;  2EYJ A;  5GQO A;  1SE3 A;  2HD3 A;  2GVB A;  3ZYY X;  3BYY B;  2R3Z A;  4DUZ L;  1X6O A;  4L6T B;  4OXP A;  4B9W A;  1JCK B;  3CAM A;  5DM6 3;  5EAY A;  4HJ7 A;  2F03 A;  1W6J A;  4LFA Q;  4DR4 Q;  3M85 A;  1SE8 A;  3AFQ A;  4X62 Q;  3IL8 A;  4KKS A;  2KA7 A;  1KL9 A;  2A6E C;  2RVL A;  1B53 A;  3K5N A;  1RJT A;  2KCT A;  4A3D B;  4IUQ A;  3C3L A;  2K7V A;  5BN3 A;  1CM9 A;  1NAP A;  4PQX A;  3T1H L;  1IL8 A;  4IPC A;  5FJ8 G;  1KLU D;  4DV5 Q;  2JA7 H;  1QNU A;  5IT9 E;  1FNV A;  1NJI C;  2X6G A;  2JA6 H;  1VQF A;  3R2T A;  2JA6 B;  1LT4 D;  5L37 A;  3E3X A;  3OMC A;  4CGY B;  2J0T D;  4X3S A;  2A74 C;  3FHW A;  4JBK A;  2R7Z B;  1WTH A;  3CC7 A;  1ET9 A;  2F0L A;  1YZ6 A;  3MXG A;  1DON A;  4DV1 Q;  5CV6 A;  4HED A;  4B3R L;  2EVB A;  3RNU A;  4EQN A;  3E6Z X;  3I2Z A;  3IAY A;  5JPN C;  1SMY C;  2A69 D;  4RG1 A;  1K9M C;  1VQ8 A;  2K5V A;  4ZK9 B;  3RR5 A;  3NBH A;  3IRB A;  4JCV E;  3ICE A;  5IT9 L;  3F2U A;  1SNC A;  1CA6 A;  1XMQ L;  3UDG A;  3STB D;  5C44 B;  1XTC D;  3HKZ G;  3K6O A;  5J22 A;  3UDF A;  1IKM A;  2F52 A;  1HH2 P;  1EY4 A;  4CKC A;  1JE5 A;  4C2M B;  1GHJ A;  4UY8 C;  1MSH A;  1EWI A;  1WD0 A;  4DV0 Q;  4DV3 L;  1FVI A;  3I4N H;  4JI7 Q;  3BZD B;  4RGM A;  1XMO L;  4LF9 L;  3GTO H;  1X3E A;  5DM7 3;  1VMC A;  2XWB B;  4YCW A;  2FXQ A;  3ERS X;  1E1O A;  4K0K L;  3R3O A;  5M3F B;  3CCQ A;  1LLR D;  1HNW L;  4JV5 L;  5K36 H;  2VQE L;  2H4O A;  4DV4 Q;  2V4D A;  4UP7 A;  3S14 B;  1Q1B A;  1PH4 A;  1IW7 C;  1K8O A;  5COY A;  2F0M A;  1PFS A;  2WAC A;  1QZH A;  1HA5 A;  1AW7 A;  3CQZ B;  4HSP A;  3CU7 A;  1WD1 A;  3F2C A;  4JI1 Q;  1PZK D;  4JI3 Q;  2DJG C;  2ENB A;  3S15 H;  4C3J H;  2VQF Q;  4RAU C;  4PZ7 A;  2UXD Q;  4C3J B;  4XDX A;  4JI6 Q;  4X65 Q;  2BE5 C;  2RCN A;  1X54 A;  1PH7 A;  1EY5 A;  4BY1 G;  4QJF A;  5E1F A;  4H7B A;  1L0X B;  4A3I G;  1SE2 A;  1EU4 A;  1KDB A;  3Q8D A;  1A0I A;  2NVQ H;  1XTD A;  4JBM A;  5C6A A;  4A3J G;  1KAA A;  1YIJ A;  2NVQ B;  3KK7 A;  4IPD A;  1EY0 A;  3AFP A;  2CVR A;  5C5M A;  2D5D A;  2G9H D;  5LMN W;  3H0G G;  3HOW H;  2Z8L A;  4B3M Q;  4R1J A;  1U0L A;  5M3M B;  1JOR A;  1N36 L;  2F0J A;  1L1O A;  4O0A A;  2WB1 G;  4BWG B;  4DR3 L;  3S16 H;  3BS1 A;  1T9H A;  2VUM G;  5KEE A;  1LAC A;  3CD6 A;  2F3V A;  2N55 A;  1A3V A;  2VW9 A;  3ZJY C;  1H9S A;  2YU9 B;  3KF8 B;  1E2W A;  1HZ9 A;  3U4V A;  2GA4 B;  2I5M X;  1JOK A;  1EIG A;  5M5W H;  1AP0 A;  4P72 A;  1GKH A;  3GTK H;  4X3U A;  5M5W B;  3HOY H;  2F0N A;  4DR6 L;  3GD7 A;  2HCC A;  2AQ2 B;  3HOY B;  4JI0 Q;  3RLN A;  2QW7 A;  4QUF A;  2UUC Q;  2R93 H;  4C3I G;  2PYK A;  3MC0 B;  3FEW X;  1KRS A;  2A6H C;  2HQL A;  1YJN A;  1KC8 C;  1SE4 A;  1KHI A;  2LMC B;  1LT5 D;  2LFN A;  2ZJP A;  4RHR A;  1GO3 E;  1GM5 A;  1X56 A;  3SDZ A;  2IPK D;  2B2V C;  1N34 L;  4XXE A;  1OXV A;  4K2K A;  3GTJ H;  2Y0S B;  2ES2 A;  2DNE A;  4KN7 C;  1VQE A;  4AYB B;  1K8M A;  1U4L A;  4OIJ A;  2OWO A;  3HOX H;  1BCP F;  4KJN A;  3JAM E;  3LNN A;  1SYD A;  1EYG A;  2K52 A;  4K8J A;  3CRK C;  4GNX A;  3J7Z C;  4YCV A;  5JJI A;  1HR0 Q;  2SDF A;  1IBL Q;  4GN3 B;  1N33 L;  2J7Z A;  1K0R A;  5G3L F;  4A3F G;  1B3Q A;  3HOZ G;  3HZX A;  5KGU A;  4JI2 L;  1JOQ A;  1G6P A;  2PW7 A;  3OYY A;  4K5X A;  2AQ3 B;  2PQA B;  3MHB A;  1PH6 A;  1LO5 D;  3U4Z A;  1QJO A;  3MVV A;  5LMU L;  3JC6 6;  1V1O A;  1S3O A;  3P20 A;  1TWA H;  1Z47 A;  2RDG A;  2KHJ A;  1TWA B;  4ZAI A;  2ZM6 L;  1S4Z A;  3TQY A;  2AUJ D;  2KJX A;  1HXY D;  1KNA A;  2X6L A;  1CSQ A;  4FXD A;  1PV4 A;  2KQ3 A;  2K5D A;  3R8B A;  4Z9C B;  1VQN A;  3FMC A;  2B39 A;  1EEF D;  2XSC A;  4LF5 Q;  1W3S A;  4NXM L;  3KYH C;  2XNA C;  4A3G B;  3ONA B;  2WAQ B;  3CMA A;  1BBW A;  3HOV G;  4ODG A;  1KD1 C;  1BO0 A;  3M9B A;  3B6Y A;  4YCU A;  2MO1 A;  2A68 C;  4A3K B;  4WJ4 A;  4NB3 A;  4ABN A;  2E75 C;  3NPP A;  3QJY A;  1H9J A;  3L2P A;  2FHT A;  1TS4 A;  1JJC B;  5IYC G;  1WTO A;  2B2Y C;  5EPL A;  4XQQ A;  5ELF A;  3KDF B; 
#chains in the Genus database with same CATH homology
 1HUN A;  4A3M B;  4G7Z C;  3U9O A;  1F2M A;  3NQI A;  1LAB A;  3P7J A;  1TT2 A;  1Q1E A;  1V8Q A;  2E2I B;  4RHS A;  2LY7 A;  3KLS A;  1TII D;  2A6E D;  1H9R A;  1YNJ C;  1OO9 B;  2RDH A;  4PMC A;  2CW0 C;  1HRJ A;  1VMP A;  1ONL A;  4L8J A;  1U4R A;  5J1Z A;  2PO4 A;  1QOH A;  1D2B A;  4FF1 A;  1PRT C;  5ISR A;  2EYF A;  3RZO B;  3M4O B;  1QWY A;  5T1G A;  3C46 A;  1SMY D;  1OXX K;  3L7Z C;  5EJW A;  3T16 A;  3RLF A;  2F4I A;  2KUM A;  5CV4 A;  2SOB A;  1GUW A;  1PTO F;  3K0Y A;  1DM0 B;  2MGS A;  3RMH A;  3TSS A;  5FKA C;  4HSV A;  4BS9 A;  1PMR A;  1SYB A;  4A3I B;  4G7H C;  4H13 C;  4BBS B;  1CQV A;  2EYM A;  5FO9 B;  4KI0 A;  5I4D A;  5HUR A;  1NCV A;  1WTP A;  2QEJ C;  5ELD A;  2B2T C;  1WTR A;  1KNE A;  1D1K A;  5M5Y B;  4NMZ A;  4FO2 A;  2I46 A;  3H0G B;  3BVM A;  1A3T A;  3MFG A;  3OIP A;  1G6Z A;  3A56 A;  2I07 B;  5KIX A;  3P75 A;  1S5E D;  3MA2 B;  1I3Q B;  2VUM B;  1J8I A;  1IW7 D;  5E4W C;  1MGS A;  1A2U A;  1HFN A;  1XX8 A;  1I4X A;  2R61 A;  2VB3 X;  1CZG A;  2DY7 A;  3VR2 A;  3FDT A;  2MJ8 A;  1ZYR C;  2DNC A;  4XYO A;  4C3I B;  1RF2 D;  1FGB D;  4RWS C;  2EJF C;  4TRD A;  3SE0 A;  3K7A B;  2O4X A;  1S5B D;  1R9T B;  1BCP B;  3LWE A;  2G9D A;  2F0S A;  4ILW A;  5AFW A;  1TU2 B;  3D8G A;  2BA1 A;  3R93 A;  3K57 A;  1JE4 A;  1VF7 A;  4Q5V A;  3X3M A;  1SEB D;  3SHL A;  2AUK A;  3OWE B;  3Q23 A;  4K6L A;  4A3F B;  3HOZ B;  5DEH A;  3K59 A;  4MIU A;  3TN2 A;  4NP5 A;  2E2H B;  1FYC A;  2K5W A;  2XRQ D;  1UEA B;  1LTA D;  1X32 A;  2IJ0 A;  2A6H D;  1Z6H A;  2NBF A;  1KDA A;  1BUV T;  3QWN A;  1IYU A;  2C5C A;  2PPB C;  1HQR D;  2KVM A;  4HTH A;  5C4J B;  1HHV A;  1E2Z A;  1VCI A;  2XIW A;  3HOV B;  1TS3 A;  2L1B A;  5KND A;  1I4H A;  4KV6 A;  1LT3 D;  3KUP A;  2F0F A;  2L4N A;  1F9P A;  1C8C A;  3MXU A;  1A6X A;  1SJH D;  4OL7 A;  1H9M A;  3SK4 A;  1ESR A;  2FJ2 A;  3OMG A;  1E0B A;  4I65 A;  2PZT A;  1TVX A;  4R8I A;  3GTQ B;  1GUG A;  2MP1 A;  4KJO A;  1EZ6 A;  5BN4 A;  2PMZ B;  3TP5 A;  3BDO A;  3DEO A;  3Q0A A;  2K28 A;  4ZYS A;  2F0O A;  2IX1 A;  4KY5 A;  1I6H B;  4XT1 B;  3GO5 A;  3DUZ A;  4QIW B;  2Q8R E;  3IFD A;  1FNW A;  1PFB A;  5EQ0 A;  2HQE A;  2A68 D;  2RDF A;  1Y8P B;  3H09 A;  4HCE A;  3NUC A;  2BDN A;  4HAE A;  1LTT D;  3A8J E;  1SNP A;  3DHQ A;  3FKI B;  1JWU D;  3UI2 A;  4ZKB B;  1PTO B;  5C4X B;  2ZXO A;  1G91 A;  1O78 A;  4IUT A;  5ELC A;  2DN8 A;  2A5H A;  1SDF A;  3OHX C;  3IFT A;  1U4M A;  4CJ2 C;  1WTQ A;  4LMQ D;  1YNJ D;  1KAB A;  3OW7 A;  1DOL A;  1ICW A;  2CW0 D;  1EWH A;  4IQZ A;  5CBE E;  1BCP C;  1ROD A;  2KCC A;  5CYU A;  4G7O C;  3GTM B;  1XWE A;  2RSO A;  2K5Q A;  1F2L A;  3PUY A;  1AZQ A;  1K83 B;  1GUS A;  1CA5 A;  2OXP A;  3VR6 A;  4I7Z C;  2BCO A;  1PRT D;  3J7A F;  1SNM A;  5JEA G;  2O5I C;  3FPP A;  2B2V A;  2JEB I;  2K1B A;  4YIJ A;  1DOK A;  2OEO A;  3NXW A;  3N6R A;  5LL6 S;  3SK6 A;  1HCZ A;  2CQA A;  4XQJ A;  1W6K A;  1OXT A;  1V1P A;  5CR3 A;  1EOT A;  4R8N A;  4MHE A;  1JQY D;  2L5T A;  5COR A;  1Q12 A;  1CQF A;  5JEA J;  5IIF A;  2M00 A;  1EY8 A;  3GV6 A;  1JB3 A;  2O5J C;  4ZUJ A;  3QO2 A;  1HFG A;  2HDM A;  1LTI D;  2SNM A;  2M2L A;  4IUR A;  4KTA A;  2IX0 A;  1KTK A;  4KD3 A;  2XVS A;  4O1N A;  1SSO A;  4DK1 A;  3M4Y A;  2EOT A;  1CT1 D;  4J8Q A;  5EGT A;  3I3C A;  1ILP A;  4DA2 A;  1H9S B;  2MUY A;  3AB9 A;  1SND A;  2KED A;  1ZYR D;  1TY2 A;  3HS0 C;  3PUW A;  4IUP A;  2QF7 A;  3IKJ A;  1LTG D;  1B9N A;  2B2Y A;  5ELB A;  5EPK A;  5I9P A;  1STA A;  2F0I A;  4WOR A;  2NN6 G;  1B3A A;  3ND9 A;  4C1N I;  2FMM A;  4DK0 A;  4DAY A;  2HCI A;  1U9R A;  2L12 A;  3FRP B;  3BYT B;  3CHB D;  5K5P A;  3S1R B;  4TQU S;  3M3Y B;  4LAA A;  1NUC A;  3S1Q B;  2EY2 A;  5M5X B;  1PTO C;  1QCB D;  2PQE A;  1SYE A;  4QF4 A;  1OXU A;  3NWS A;  3OWF A;  3T51 B;  4F7X A;  4IUV A;  5KYL A;  2RBM A;  1Z7T A;  3DWP A;  2IWH A;  4IN3 A;  4ZRZ A;  3AMU A;  1TWF B;  5JOB A;  3BVG A;  3I4M B;  3T4A C;  2WIN B;  1LV9 A;  5I9O A;  1WTX A;  2EDG A;  1EY6 A;  1EYD A;  3HP3 A;  5E4X A;  4WFN 3;  4OIK A;  2CHB D;  1T5E A;  2NTS A;  4BBR B;  2BOS A;  3HEJ A;  1F77 A;  1O80 A;  1DYQ A;  5CV9 A;  4RGT A;  3HOU B;  1RTO A;  3AU7 A;  3I4L A;  4RKB A;  3R2I A;  3VA7 A;  1CI3 M;  1WCM B;  1WTW A;  3PO3 B;  2F0W A;  1DD2 A;  2SNS A;  2B2W C;  3Q6S A;  1ILQ A;  1FD7 D;  1TR5 A;  3VYS A;  1AEX A;  3M7G A;  3KBX A;  3NTK A;  2B2U C;  2WKC A;  4E6I A;  1CHP D;  4OHJ A;  5I2Y A;  4RFB A;  2F0H A;  3EVQ A;  2XWJ B;  1IKL A;  1B50 A;  2AWN A;  1JWS D;  2ID0 A;  2OF1 A;  1CFM A;  1MD2 D;  3DWQ A;  3EJI A;  2WII B;  2EJM A;  4LJZ C;  2FMC A;  2OT2 A;  5IOD A;  4X3T A;  4X3K A;  4K8I A;  2QKI C;  5JEA H;  1KDC A;  1PZI D;  1D1I A;  1ZXT A;  5CC4 A;  1AFP A;  3VR5 A;  3K5M A;  3PO2 B;  2NN6 I;  1JWM D;  3G6J B;  1CZW A;  5CMD A;  4IAL A;  3W3A A;  4KMU C;  1GHK A;  5C3X A;  1M8A A;  2KCN A;  3DM1 A;  4QB4 A;  4WRD A;  2D62 A;  4GZY C;  1SJE D;  1VDZ A;  2B8G A;  4HR7 B;  1GOZ A;  1STE A;  2Z1C A;  3CRL C;  4DN4 M;  1MBY A;  2K6A A;  2EJG C;  1M4V A;  1BCP D;  1BQQ T;  1V43 A;  3EQL C;  4HCS A;  5IGE A;  1EQV A;  4BY7 B;  1L0Y B;  3D6C A;  5C3E B;  1B1Z A;  4QCL A;  5JPM C;  5G3L D;  3H6M A;  4M8A A;  5FO7 B;  4B9X A;  3A54 A;  1TS2 A;  3Q24 A;  1MI2 A;  4RH6 A;  2PZW A;  2D9U A;  2ICI A;  1STG A;  3P1H A;  5HGT A;  2VNU D;  2NYZ D;  2E2D C;  3K5L A;  4J6H A;  2ZT9 C;  1ENC A;  4HN7 A;  5TSS A;  1SNO A;  2L9H A;  2XN9 C;  2EY1 A;  2NN6 H;  2JA8 B;  5BN5 A;  3T13 A;  2K33 A;  2F0P A;  5EBD A;  5A35 A;  3RD4 A;  2X69 A;  2IX3 A;  5E3F A;  5D3D A;  2F0E A;  4PMW A;  1DXM A;  1GXD C;  3TME A;  2JSO A;  4OO1 G;  5DNF A;  5J39 A;  2WP8 J;  2NUC A;  3D3R A;  3TZD A;  2JEA I;  2DY8 A;  1ML0 D;  3ND8 A;  4CHT B;  2A73 B;  4RA8 A;  3TP7 A;  5FLX E;  3H3V C;  1TQO A;  5LL6 X;  2BDO A;  1LTS D;  1I6V C;  1SAP A;  1G2T A;  2NB0 A;  3N52 A;  2WKD A;  3KBG A;  4V19 0;  4JBW A;  1G29 1;  4ZLT F;  3S17 B;  1X3Q A;  5EKL A;  2JA5 B;  3O13 A;  4KD4 A;  5I6W A;  4FF3 A;  3MXP A;  1NR4 A;  3OSO A;  2F0G A;  5FLX L;  1EIH A;  1Q8I A;  3J81 E;  1SNQ A;  1TWH B;  1F9S A;  2NVT B;  1R4P B;  2KEC A;  1CTM A;  1PTO D;  3MEH A;  1EFI D;  3ERQ A;  4KK7 A;  1OXS C;  1UNS A;  3ITP A;  1FR3 A;  4XQN A;  3GTG B;  4FXK C;  1SYC A;  4DXG A;  2MPM A;  3W2D A;  3RUZ A;  1STY A;  5DAU A;  3J81 L;  2ICE C;  4A3E B;  3I90 A;  5JAV A;  2E76 C;  4H0L C;  1NSN S;  2C9O A;  1WTV A;  1ESF A;  1TY0 A;  4ZQ3 A;  1EY9 A;  4DU9 A;  1EZ8 A;  5IGG A;  5FOB B;  2K03 A;  4ZKC B;  3BG3 A;  3NWT A;  5IGD A;  4MN3 A;  4DNT B;  1HQM C;  1I4Q A;  1WVL A;  2TMP A;  1YNN C;  1AZP A;  3QG1 A;  4F8M A;  2KHS A;  4RGO S;  2JP1 A;  4ME5 A;  3TP6 A;  3NTI A;  4J1M A;  2KEE A;  3EFX D;  4OO1 I;  4O42 A;  3NE5 B;  2AWO A;  4K6D A;  3LWU A;  1J9O A;  3C2P A;  1EYC A;  2JE6 I;  5CV8 A;  2R92 B;  1I50 B;  5D14 A;  2ZXR A;  1O7Y A;  3SK5 A;  3V2T A;  5KNB A;  1BBX C;  1IYV A;  3D31 A;  2LKV A;  1PTO H;  1GUT A;  1G8Z D;  3A55 A;  1GJX A;  2PW5 A;  2NZ1 D;  1HUM A;  1G2S A;  2EY6 A;  1TWC B;  5FO8 B;  3S2H B;  1FNU A;  1XXG A;  3URY A;  1IHZ A;  2EYO A;  5IGB A;  4K5V A;  1RCV D;  4N9P A;  4PMB A;  3NHH A;  4JK1 C;  2F0Q A;  4TKO B;  2JA7 B;  4BA1 I;  1B9M A;  5NUC A;  1PYW D;  3VR3 A;  4RGN A;  4C56 C;  2IW3 A;  2B63 B;  1S5F D;  1V1P B;  1STN A;  4FXG C;  4C3H G;  4C1N K;  3TP8 A;  4R9W A;  1D5M C;  3H94 A;  2F0D A;  1C4Q A;  1Q3L A;  4DNR B;  4CKE A;  5KYI A;  4KKT A;  1I4P A;  1RHP A;  3EA6 A;  1JOO A;  2QIL A;  4B08 A;  1RDP D;  3I8Z A;  3BVZ A;  3L3O C;  2Z4H A;  4OO1 H;  2RKS A;  4IFD G;  5C4Z A;  3D4R A;  5EKI A;  3QOJ A;  4U68 A;  2FFK B;  1EEI D;  1JR0 D;  1HA6 A;  3I4N B;  1EL0 A;  3GTO B;  1Y69 U;  1AN8 A;  1JC7 A;  5M9O A;  1GUN A;  4KY7 A;  2EXZ A;  2L0C A;  5C3W A;  2XRS D;  2ZXP A;  4IFD J;  5C4H A;  4QUC A;  4RCO A;  1EQT A;  1I4R A;  2B2W A;  5KRU A;  1ZKO A;  4V0B A;  5LHY 1;  1H9K A;  3VYR A;  3PMF A;  2RA4 A;  3K58 A;  2EYP A;  1R4Q B;  4CBV A;  1CHQ D;  1EY7 A;  4NKL A;  2B2U A;  3S15 B;  3OPO A;  1U4P A;  1T5X D;  4HMI A;  4QMG A;  1LT6 D;  4DAV A;  2F3W A;  1VF5 C;  3QB3 A;  5JJZ A;  1S5C D;  1DOM A;  1HPC A;  2SEB D;  2K32 A;  4DGZ A;  3E0J A;  5FK9 C;  3GTL B;  3VR4 A;  4K14 A;  4DF7 A;  4U67 3;  3OIQ A;  1LTR D;  3HOW B;  1PLF A;  2K01 A;  3C1E A;  3QOL A;  3S16 B;  4HMJ A;  3A8I E;  4K2L A;  1QE6 A;  3MWY W;  2EY5 A;  1LTB D;  2D2C C;  2N88 A;  3PUZ A;  1BDO A;  1PRT B;  1B44 D;  3C1F A;  1D5Z C;  5C0X G;  2J4X A;  3GTK B;  4FP5 D;  2F0V A;  2PNR C;  3TDQ A;  2MHV A;  4IUN A;  3I73 A;  4LK1 C;  3KF8 A;  4IUU A;  1PZJ D;  2R93 B;  1RD9 D;  3PV0 A;  3L9A X;  5CGK A;  3MAQ A;  2YYZ A;  1DJR D;  5D65 A;  5IGC A;  1BOS A;  3Q22 A;  4DFA A;  1UUP A;  2FIN B;  3TZU A;  1QB5 D;  5C0X J;  3GTJ B;  4KN4 C;  1SXT A;  1CK1 A;  1EU3 A;  3HOX B;  4IFD I;  1DZ1 A;  3K5O A;  3PIO 3;  4ID6 A;  4EGV A;  5CBA E;  3VYU A;  1BXT A;  1Y8O B;  1A15 A;  4KHZ A;  4KY6 A;  2B2T A;  4NDX A;  2NWG A;  2K04 A;  1EYA A;  4EVO A;  1SBB B;  4ZUI A;  3D6W A;  5EKK A;  2K05 A;  3JAM L;  1SYG A;  4Y7N B;  3D4D A;  1F9R A;  4DXF A;  1BNZ A;  3I91 A;  2BA0 A;  1YNN D;  1HTL D;  3DXJ C;  3SEB A;  1GUO A;  4FYD A;  2EYH A;  5IOC A;  1F2Y A;  1STH A;  3VYT A;  1S5D D;  1DCZ A;  4NW2 A;  1A2T A;  4N9T A;  2VXW A;  2E2J B;  4G57 A;  3I70 A;  3U9S A;  4C3H B;  1F2Z A;  3V05 A;  4FF2 A;  5EBC A;  2WV6 D;  1NR2 A;  1EWC A;  2EYL A;  4RKL A;  3A7L A;  3HG9 A;  3M7N A;  3H91 A;  1B2T A;  5CV7 A;  3PIP 3;  2L55 A;  3J80 E;  3HKZ B;  2QDB A;  4G4K A;  1C48 A;  1ENF A;  4IFD H;  3GV3 A;  3GQB A;  3A7A B;  1I4G A;  4FNF A;  3ERO A;  1D6E C;  3A8K E;  4XYQ A;  4P2C B;  1PFM A;  4S3S A;  5C0X I;  3WDN A;  2F0K A;  4ULL A;  2A69 C;  3T56 B;  3WOE A;  3S9W A;  5T1I A;  1A3U A;  5JVG 3;  3J7A V;  3VA5 A;  3NP8 A;  3J80 L;  2F0U A;  4XT3 B;  5IGF A;  3BDC A;  2KOL A;  1Y1W B;  4CKB A;  2F1M A;  2QCP X;  3SVM A;  5JVH 3;  3WOF A;  2NTT A;  3V96 A;  5A2Q E;  2F0T A;  2IL8 A;  2M9V A;  3LX0 A;  3OOC A;  5KNC A;  3NSW A;  3MXN A;  1Q90 A;  4BY1 B;  1PXU A;  5F2D A;  5I2X A;  3S1M B;  2TSS A;  4A3J B;  3RZD B;  1TS5 A;  3S1N B;  3E5S A;  5EPJ A;  4F87 A;  3DWA A;  3FPU B;  5ELE A;  5A2Q L;  4CJ0 B;  4KHV A;  4CJ1 B;  3NQT A;  2NVX B;  2WB1 B;  1MSG A;  4A93 B;  1O7L A;  1TWG B;  1RKN A;  3DEP A;  3MFY A;  1PDQ A;  4WJW A;  5D3I B;  1RTN A;  4KKU A;  3MZ5 A;  2JYO A;  3NK9 A;  1BF4 A;  4IZ8 A;  2EE1 A;  4UDU C;  4BA2 I;  3J7Y W;  5C0X H;  2EPB A;  1QIL A;  1ET6 A;  3BDL A;  2BE5 D;  3HGB A;  1KLG D;  3FVQ A;  2IT1 A;  1ENA A;  1X3P A;  1O7Z A;  5CV5 A;  3NTH A;  5K36 G;  4FVM A;  2LS0 1;  2Z4I A;  3KLR A;  1II3 A;  2O2L D;  2HUG A;  4L63 B;  4C3J G;  3QIA A;  2Q8I B;  2PZU A;  1UAP A;  4FF4 A;  1Y1V B;  1SYF A;  1BR9 A;  2PCF B;  2VB2 X;  2H1E A;  1ZEQ X;  2L11 A;  1QNK A;  4RCN A;  4XTC S;  2B8F A;  3KLS X;  3S2D B;  2Q8T A;  4DAP A;  4A3B B;  3SXH A;  3HRZ C;  1Y8N B;  1PFN A;  3TBI B;  1TKW B;  3G7L A;  2R6G A;  1SFO B;  1PRT F;  3I72 A;  4K5W A;  4H44 C;  1E2V A;  2JXM B;  3SK8 A;  3PUX A;  4TSS A;  3T53 B;  3NBI A;  3DMU A;  2RSN A;  3D4W A;  3CKI B;  4EQO A;  4OGQ C;  3X3N A;  1D5X C;  2NVY B;  1STB A;  3GTP B;  4Q0F A;  3MTS A;  2RQX A;  4M1U B;  1F9Q A;  1B4O A;  4UAI A;  2EZV A;  3GP7 A;  1QG7 A;  5I6Y A;  1XYI A;  4XIG S;  3PUV A;  1HTP A;  2HDL A;  1JIC A;  2AQ1 B;  4F88 A;  4PNY A;  4PV1 C;  5C5L A;  2E74 C;  3SR1 A;  4EQP A;  2EYJ A;  1SE3 A;  3ZYY X;  3BYY B;  2R3Z A;  4L6T B;  4B9W A;  1JCK B;  5DM6 3;  2F03 A;  1W6J A;  3M85 A;  3IL8 A;  4KKS A;  2KA7 A;  2A6E C;  2RVL A;  1B53 A;  3K5N A;  1RJT A;  4A3D B;  4IUQ A;  3C3L A;  2K7V A;  5BN3 A;  1CM9 A;  1NAP A;  4PQX A;  1IL8 A;  1KLU D;  1QNU A;  5IT9 E;  1FNV A;  2X6G A;  3R2T A;  2JA6 B;  1LT4 D;  3OMC A;  4CGY B;  2J0T D;  4X3S A;  2A74 C;  2R7Z B;  1ET9 A;  2F0L A;  3MXG A;  1DON A;  5CV6 A;  4HED A;  2EVB A;  4EQN A;  3E6Z X;  3IAY A;  5JPN C;  1SMY C;  2A69 D;  4ZK9 B;  3NBH A;  5IT9 L;  3F2U A;  1SNC A;  1CA6 A;  5C44 B;  1XTC D;  3K6O A;  5J22 A;  1IKM A;  4CKC A;  1EY4 A;  4C2M B;  1GHJ A;  1MSH A;  1WD0 A;  3BZD B;  4RGM A;  5DM7 3;  1VMC A;  2XWB B;  3R3O A;  5M3F B;  1LLR D;  5K36 H;  2H4O A;  2V4D A;  3S14 B;  1Q1B A;  1IW7 C;  1K8O A;  5COY A;  2F0M A;  2WAC A;  1HA5 A;  1AW7 A;  3CQZ B;  4HSP A;  3CU7 A;  1WD1 A;  1PZK D;  2ENB A;  4RAU C;  4C3J B;  4XDX A;  2BE5 C;  1EY5 A;  5E1F A;  4H7B A;  1L0X B;  1SE2 A;  1EU4 A;  1KDB A;  5C6A A;  1KAA A;  2NVQ B;  3KK7 A;  1EY0 A;  2CVR A;  5C5M A;  2D5D A;  2G9H D;  2Z8L A;  5M3M B;  1JOR A;  2F0J A;  4BWG B;  3BS1 A;  5KEE A;  1LAC A;  2F3V A;  2N55 A;  1A3V A;  1H9S A;  2YU9 B;  1E2W A;  2GA4 B;  1JOK A;  1EIG A;  1AP0 A;  4X3U A;  5M5W B;  2F0N A;  3GD7 A;  2HCC A;  2AQ2 B;  3HOY B;  4QUF A;  4C3I G;  2PYK A;  3MC0 B;  3FEW X;  2A6H C;  1SE4 A;  2LMC B;  1LT5 D;  2LFN A;  4RHR A;  3SDZ A;  2IPK D;  2B2V C;  4XXE A;  1OXV A;  4K2K A;  2Y0S B;  2DNE A;  4KN7 C;  4AYB B;  1K8M A;  1U4L A;  4OIJ A;  1BCP F;  4KJN A;  3JAM E;  3LNN A;  1SYD A;  4K8J A;  3CRK C;  2SDF A;  2J7Z A;  5G3L F;  3HZX A;  5KGU A;  1JOQ A;  2PW7 A;  4K5X A;  2AQ3 B;  3MHB A;  1LO5 D;  1QJO A;  3MVV A;  1V1O A;  3P20 A;  1Z47 A;  2RDG A;  1TWA B;  4ZAI A;  1S4Z A;  2AUJ D;  2KJX A;  1HXY D;  1KNA A;  2X6L A;  4FXD A;  2KQ3 A;  2K5D A;  3R8B A;  4Z9C B;  3FMC A;  2B39 A;  1EEF D;  2XSC A;  2XNA C;  4A3G B;  3ONA B;  2WAQ B;  4ODG A;  1BO0 A;  4A3K B;  2A68 C;  4ABN A;  2E75 C;  3NPP A;  3QJY A;  1H9J A;  2FHT A;  1TS4 A;  1WTO A;  2B2Y C;  5EPL A;  4XQQ A;  5ELF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...