2F0TA

Crystal structure of staphylococcal nuclease mutant v66l/v99i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0tA00
5CV4A 4J6HA 3OWFA 2OF1A 3SK5A 5IGEA 5JOBA 4KY5A 1SNDA 3NP8A 5C5MA 2F3WA 2PW5A 5KRUA 4EQPA 1NSNS 1JOQA 5JAVA 3TP6A 4K6DA 5CV9A 5CGKA 1SYFA 5C5LA 1TQOA 4B9XA 2F0SA 2KQ3A 1EYAA 5E1FA 1ENAA 1KDAA 2QDBA 2F0NA 5J22A 2F0KA 3D8GA 4IUNA 5I9PA 3T16A 3SR1A 4LAAA 5I6YA 2EYHA 4K5XA 3P1HA 4K2KA 1SNPA 4ID6A 3EROA 2EY6A 2OXPA 3OMCA 5EKKA 2OEOA 4H7BA 4K8IA 2PZWA 3EJIA 4KV6A 5C4ZA 3NUCA 1SNMA 3NHHA 4ZUIA 2F0LA 2RKSA 5I9OA 2SNSA 4KHVA 1A3VA 5I6WA 4YIJA 4IZ8A 3SK4A 3ERQA 2EYOA 3QOLA 5CV7A 5E3FA 3LX0A 2F0HA 4K5WA 4K14A 1IHZA 1KABA 2EYPA 2F0PA 2F0IA 2O4XA 1EY0A 2PW7A 3C1FA 3P75A 1A2UA 2EY1A 4J1MA 5IGFA 5C6AA 5HGTA 3PMFA 3NQTA 5CV8A 2F0OA 1SYGA 4KY7A 1JORA 5DEHA 1TR5A 4QMGA 2LKVA 4E6IA 3DMUA 1SNCA 4RKBA 4K5VA 2M00A 2WACA 2F0VA 1STNA 5M9OA 4KY6A 1EY8A 4WORA 5J39A 2EY2A 2F0TA 5CV5A 2F0EA 4OL7A 5C4HA 4KJOA 3E5SA 3MXPA 2EYFA 1EZ6A 2F0GA 2F0QA 4HMIA 2EYJA 1STGA 4PMBA 5CV6A 4NKLA 4ZUJA 3S9WA 1KDCA 2EY5A 3SK6A 3U9OA 5DAUA 3RUZA 3R3OA 3SK8A 4DU9A 5KGUA 4KD4A 1STYA 2HQEA 4QB4A 2RDFA 2F0JA 3NK9A 1SNOA 3D6CA 2F0UA 1F2YA 2ENBA 2EYLA 3DHQA 4K2LA 1EY5A 1EY4A 1KDBA 4K8JA 4N9PA 5EGTA 4KTAA 5IGDA 5IOCA 4R8NA 1TT2A 1JOOA 1NUCA 3HZXA 4TRDA 5KIXA 1EQVA 4WRDA 2KHSA 4G57A 3TP8A 5KYLA 1RKNA 4HTHA 1EYDA 1STAA 5J1ZA 4QF4A 1II3A 2F0WA 5IGCA 4F7XA 3H6MA 1STHA 3C1EA 1SYBA 1SYDA 2F3VA 3MEHA 3OSOA 2NUCA 1AEXA 1EYCA 1A3TA 2F0DA 2PQEA 3BDCA 4B9WA 5ISRA 4ODGA 3OMGA 5IIFA 4MIUA 5NUCA 1ENCA 2SOBA 4NMZA 1F2ZA 3TP5A 3TP7A 4EQNA 2PZTA 2F0MA 3QOJA 1SNQA 3SHLA 3VA5A 4DGZA 4I65A 5F2DA 5C3XA 3QB3A 3SXHA 3EVQA 2RBMA 4DF7A 2SNMA 3MVVA 4EVOA 1JOKA 1U9RA 5CC4A 3BDLA 3TMEA 2F0FA 1EY7A 2PYKA 4HMJA 4PNYA 1EY6A 3ITPA 4S3SA 3V2TA 1EY9A 5IGGA 3T13A 4IALA 4ZQ3A 4DFAA 4ME5A 4RKLA 1A2TA 3D4WA 2PZUA 5EKLA 5CR3A 5IGBA 5K5PA 5KYIA 4N9TA 1STBA 1SYCA 2EXZA 2EYMA 1KAAA 3NXWA 3D4DA 4KJNA 3MHBA 4F8MA 4KD3A 4NP5A 1EZ8A 4PMCA 5HURA 4NDXA 5IODA 1SYEA 3MZ5A 5C3WA 3HEJA 4EQOA 1A3UA 1F2MA 5KEEA
chains in the Genus database with same CATH superfamily
1TWAH 5EAYA 3W5OA 4DR7L 2OF1A 5IGEA 1R4QB 4BWGB 2F52A 1PZID 4XQJA 3UE1A 3VR3A 1NSNS 2NN6H 1RD9D 4X66L 4L5TA 1SYFA 4BA1I 4RAUC 1KNAA 3S2DB 2F0SA 4TKOB 4QIWE 2IW3A 1Y1VG 5IT9L 4DV0Q 3T1HL 4A3IB 1W2BA 2UXDQ 1ET9A 5LMNQ 1CKOA 2O2LD 3JC66 2PZWA 3EJIA 4KV6A 1Q12A 5IY0A 3J81E 1HNXQ 1EWHA 2B63G 3RN2A 2LSSA 2PCFB 5CV7A 5E4WC 2F0HA 2R93H 1SN8A 1J9OA 4J1MA 2YV5A 3CU7A 1NY4A 4DKAC 1SXTA 5G3LD 1LO5D 2BH8A 2QW7A 3HKZB 3CQZB 3MTSA 4EGVA 2NB0A 2LXKA 4KI0A 2CH4W 5ELCA 2Z9HA 2F0GA 4PMBA 5CV6A 5I2YA 3GTGB 2HCCA 1NMGA 4LW1A 1X6OA 4HIDA 4AYBE 2E75C 1YHBA 3DHQA 2ENBA 2BA0A 4KTAA 1RIPA 1UE7A 3S2HH 2B39A 3CCLA 1GUTA 4HTHA 4BY1G 4DK0A 1IYVA 2DJFC 1K8GA 2VUMH 2JK8A 1GKHA 1IKLA 1J5EL 1S4ZA 2PPBC 3GTMH 4NPSA 1ASYA 3GO5A 4H0LC 2A73B 4P72A 1ONLA 2AWOA 3DWQA 1IKMA 1NAPA 2R7ZG 1ILQA 4IN3A 2NVYB 1KLGD 1PZJD 5C44B 4JI8L 5A35A 3K6OA 2RF4A 3PIP3 1JB7A 1O7ZA 5EKLA 1K83B 2PZUA 1CA6A 1H9MA 2J0TD 4BBRG 4GOPA 3HOUG 5HURA 4GN5A 5IODA 2JJQA 2C5CA 2ZJRA 4A3MG 3FDTA 1XNRL 1SRUA 1T9HA 3JAMi 4J6HA 3SK5A 2ES2A 4P73A 4X64L 2BA1A 2F3WA 1WTPA 5L37A 1GUSA 3KLSX 2L5TA 2Z1CA 4JW0A 3TP6A 2ASBA 2HDMA 1VMCA 1BBXC 2FINB 5FK9C 2VB3X 3T16A 3SR1A 5IWAL 4K6LA 2I5MX 2BDNA 1TWAB 3A8KE 3HKSA 2EDGA 5C4ZA 2XTIA 1NNXA 2PMZE 4PZ8A 3OPOA 5LMNW 1WCMG 2HD3A 1VQ7A 4IFDJ 2EYPA 1G91A 1HZBA 4RGMA 4CDCC 1CHQD 1FNVA 2K6AA 1SYGA 4R4QA 1X3PA 4JK1C 5M5YH 1PFBA 2ZJPA 1CKMA 1DONA 1VQEA 4R4IA 2B2VC 2F0TA 2I5HA 5CV5A 4UHVA 4B08A 4I7ZC 4A3JG 2JEAI 2R93B 3VYUA 1EIFA 3BS1A 1PYSB 3B6YA 2EQSA 2F0UA 5TSSA 4GS3A 2VNUD 4QIWB 1Y1VH 2WIIB 4WRDA 2F4VL 4QGUA 4CDDC 1I6HH 2EJGC 4KKTA 2VL6A 4DK6C 1WJJA 4AIMA 1PRTF 3MFGA 1ESFA 3T53B 1FYCA 5JPNC 2NTTA 4CHTB 1D8LA 1STEA 1PH9A 4GKKL 1EIYB 3GTOH 3IAYA 4DV7L 1QE6A 4RWSC 4DAYA 5NUCA 5D65A 1EYGA 1HTLD 3G6JB 5CYUA 1LTSD 2NVQH 2VUMB 1LUZA 4JV5L 3BDOA 4Q0FA 2CKZB 3GTMB 1YIJA 4PNYA 4RMFA 3U9SA 2ZTEA 3I72A 3CC2A 3EQLC 1U4MA 3D4WA 1X65A 2BE5C 1Q1BA 4FF1A 1PFNA 1PHJA 4JI7Q 3V96A 2L0CA 4AYBB 1SYEA 3MZ5A 1V8QA 1RDPD 1I4QA 4DR1Q 4A3FG 3VR4A 3EFXD 2MO1A 1YNJD 4BY1H 2PW5A 4XQQA 4YHHQ 3G4SA 4DUYQ 4B9XA 2QDBA 2EJFC 3S1MH 3QIAA 2F0KA 4DR2L 1JJ2A 1OTCA 2TSSA 4ULLA 5LL6X 4K2KA 4IUVA 3J80i 3HOZG 2JE6I 1I6VC 3KLSA 3C3LA 4HJAA 4RCOA 1TWHH 1IW7C 4LF7L 4UPAA 5JEAJ 4C56C 1C48A 3GTLH 3E3XA 2FHTA 2JA7G 4DV5Q 4X3UA 5C3EG 3F8TA 2F0IA 4K0KQ 1D2BA 2NN6I 1PRTC 5IP9G 3AFPA 1LT3D 2N3SA 2LFNA 1MGSA 3L3OC 4TQUS 4FO2A 2KENA 3DUZA 4JI1L 4QL5A 5M9OA 2VQEQ 2HDLA 2E5LL 2EE1A 1IYUA 2MNAA 1EFWA 4BBRH 1WD0A 2E2JH 3HOUH 4JI5Q 1H9KA 3KFUA 1Z7TA 4OX9Q 1KDCA 1O80A 2IX3A 4GZYC 3J7ZC 3FKIG 1STYA 3J81i 3CCJA 1IZ6A 4DN4M 3NPPA 2F0JA 4J8QA 3URYA 5JEAG 1PH2A 5M5YB 3D6CA 3S16B 3KF8A 4MTKA 2JA9A 1SAPA 2EXDA 3EN2A 4B3RQ 1QUQB 2AUJD 4DAMA 3E0EA 1UWVA 3DXJC 1B53A 2PMZB 1VMPA 1WCMH 4QCLA 5FJ8G 1Y1VB 3K0XA 4MIUA 5G3LF 2SOBA 3UDIA 1I6HB 2RDGA 4IJLA 4XDXA 5M3MH 1OXUA 2X69A 2K01A 4IJHA 4DV0L 1SNQA 5C3XA 4DR3L 1VQ4A 3NQIA 1PRTB 4QJFA 4JI4Q 5LMNL 3TMEA 2JN4A 1CT1D 2BOSA 3GTOB 4KKUA 2E76C 4ZQ3A 5FLXL 5C0XJ 3VDYA 3NELA 2PNHA 2EVBA 3NBHB 2NVQB 3TS0A 5LL6S 1EU4A 1ICWA 3RLNA 1XMQQ 4A93G 4PMCA 4NXMQ 3RNUA 3PIPA 1X55A 2Z6KC 1Y1WH 4JI3Q 3S1NH 4C2MH 5LMUQ 4OO1G 5T1IA 2OTJA 1S5BD 1DOLA 3J80c 3M4QA 4IPGA 2KOLA 1RODA 1PH3A 2UUAQ 3H0GG 5A2QL 1GD7A 1PH8A 4ZAIA 2EPBA 2OCEA 3PCOB 1C4QA 2OEOA 5JJIA 5C0XG 1Q8KA 3AB9A 2DNEA 2RKSA 4YIJA 2MFIA 1S72A 3HFZB 3S1MB 3A56A 2WAQB 3C46A 4HSPA 3F1ZA 4ZCKA 3Q6SA 3BZCA 1TWHB 4QMGA 4R4CA 1E0BA 4JOIC 4K5VA 2WV6D 3I73A 3GTJH 2VQFQ 2F0VA 4AQYQ 1CA5A 3GTLB 1EY8A 3I4LA 1PV4A 5CBAE 3NWTA 3J81c 4HMIA 5CORA 4A3FH 2EZVA 2RCFA 1FJGQ 4L5RC 1WTHA 3TBIB 1PH7A 4K2LA 1L1OC 4OELB 2IHFA 3ZYYX 2K5QA 5IGDA 4GKJQ 1AE3A 1TT2A 4BBRB 3HOUB 2E2JB 3H09A 4YWMA 2UUCL 2Q2IA 1XNQQ 4FXKC 1TY2A 2CFMA 3LNNA 1UEAB 3HOZH 2CCZA 4DR4L 3H91A 4ZYSA 1LT5D 4HJ5A 1LTLA 1BOSA 2HIXA 3S1RB 1QZGA 1MJEA 4A76A 2JA7H 5C3EH 3EIVA 3S24A 3PV0A 5IP9H 1SE4A 3K59A 2MPMA 1F9SA 1X3QA 1SDFA 3QOJA 3SHLA 3R2IA 4HAEA 3IKJA 2RBMA 1EL0A 4PZ7A 3VYSA 1KD1C 1P8LA 3G6EA 4S3SA 4OHJA 1KNEA 2Z8LA 4RKLA 1A2TA 5K5PA 5M3MB 3I4OA 3GV3A 3FKIH 1BNZA 5JEAH 1ESRA 2XVSA 3QR8A 5EBCA 1RF2D 3R2TA 1XYIA 4I7AA 1ZYRD 4JI2Q 1L1OB 5EPJA 1LTRD 3OWFA 1HR0W 2N55A 4KY5A 2KHJA 4R4TA 1UEBA 1TQOA 2Q8IB 4MNOA 3A7LA 1HNWL 2A19A 5M3FG 5H1SE 1C0AA 3CC7A 1HUNA 3T56B 5FJ8H 4KMUC 1Y1WB 3EROA 3HG9A 4JI6L 4LFAL 3S1NB 4C2MB 3K5MA 1C8CA 3PUXA 4IUTA 1GUGA 1TU2B 1AE2A 4TSSA 2L4NA 1EQRA 1GJXA 2WB1B 3AU7A 1HCZA 3K5OA 3P75A 4B3MQ 4O1NA 1TWCH 3G71A 1CI3M 4OWXB 5CV8A 2A6HD 5CMDA 1HQRD 1TR5A 1HFGA 2J7ZA 1IL2A 4JBKA 2K5DA 3KF6B 1EEFD 4GNXB 2C35B 4A93H 2D62A 3DWPA 2VS1A 1T5EA 1FGBD 1QZHA 4ZUJA 2EIFA 3BG3A 2K52A 1S40A 1NE3A 4H02A 3GDEA 2A5HA 5AFWA 4OO1H 3CF5A 1KLUD 1PH1A 2FMMA 3GTJB 2MUYA 1I94L 1Y14B 2HUGA 4JI0Q 4R8NA 4A3DG 1B70B 3A74A 3H0GH 2B2YA 2LXJA 4AH6A 4A3FB 3A5UA 1PTOD 1STHA 5C0XH 1DM0B 4DR1L 1CFMA 1SLJA 3MC0B 4KHPQ 2KUMA 1IBKQ 1DD2A 3KBGA 2KCMA 2F0DA 1ZEQX 1KL9A 4YHHL 4ODGA 5ELFA 3TREA 5EQ0A 1V1PA 2D0PA 2UXBL 2ZTCA 4DUYL 1F2ZA 1XJVA 1IL8A 2X6LA 1XPOA 3HOZB 3D0FA 2SDFA 1NBWA 4LF8Q 1JWUD 4Y7NH 2F0FA 3DEPA 3K5LA 2JA7B 5C3EB 1N32Q 5IYBG 4X6AH 3DM1A 2I07B 4X3TA 4DV5L 1LTGD 3G48A 5JVG3 4CGYB 1XTDA 2NBFA 1TS3A 2K5NA 1F2MA 2VQEL 4JYAQ 2RCNA 5D3IB 4JI5L 3FKIB 1YNJC 1XPRA 3D31A 1LACA 4IUNA 1TWGH 1I5FA 5BR8Q 4ID6A 3OMCA 2NZOA 5GAEC 1JE5A 2GN5A 1F2LA 4IO9A 4B3RL 1YITA 2EYOA 2B29A 4GOPC 2XN9C 1LTTD 5C6AA 2KCCA 1VQFA 4RKBA 4DNTB 1TS2A 2RVLA 4KY6A 2ZXOA 3IFDA 1S5ED 2BDOA 2L1BA 1PVOA 3CAMA 4NKLA 4LF9L 1A6XA 1TWCB 2FMCA 1EWCA 5KGUA 2HQEA 2PI2E 2EYLA 3VA7A 4K8JA 1YI2A 3RMHA 1JOOA 2Z0SA 1IBML 4A93B 1TXYA 1SE8A 1GO3E 4G57A 4YCVA 5M3FH 1HFNA 1HR0L 4O0AA 2KECA 5KNBA 2A6ED 5E4XA 2QEXA 5CBEE 1YBYA 1HZAA 1MD2D 3TZUA 1A63A 1EWIA 4ABNA 3UDGA 1VQKA 3KLWA 3BDCA 1LABA 1T5XD 4FVMA 4U68A 3TQYA 4B3TL 2CQAA 4RGOS 3H0GB 1RTOA 1Y8OB 4BA2I 4KN4C 4GOPB 1OXVA 4I65A 2M9VA 1E1TA 3D4RA 1BVSA 3RZOH 1JQYD 2JA5G 3M9BA 4H13C 4LUZA 2I46A 1QJOA 2EOTA 5CR3A 1VQLA 4GLXA 1VF5C 2WAQG 2UXCQ 4F8MA 1AH9A 2ZT9C 4LF4Q 1BCPD 4LFCL 3CCQA 2L9HA 2QF7A 3GQBA 1B3QA 5C3WA 4LNQA 4Y7NB 3BZKA 3HEJA 2JSOA 1E24A 3LWUA 1BF4A 4A3DH 4IQZA 4DR5L 2VB2X 1VQHA 4AQYL 5IT9E 1SNDA 5KRUA 1HNZQ 3M85A 3KUPA 4DV6L 2XWBB 1Q90A 4EX5A 2AKWB 1X54A 3BVMA 2Y0SG 2KQ3A 1FGUA 2F0NA 1MSGA 1WTVA 5I9PA 3AQQA 1FJGL 2EYHA 3I90A 2EY6A 4GKJL 4KHVA 1GHKA 3GTQH 1HRJA 1XNQL 3BVGA 3DLLA 4KLKA 2E2DC 1R9TH 2ZTDA 2E74C 1TWGB 3EA6A 2DNCA 3PGZA 3RLOA 2GVAA 2B2UA 4C3JG 4DNIA 5IYBH 1BBWA 3NE5B 1TS4A 4DV1L 1V43A 2AHOB 2GA4B 4ALPA 2K5HA 3E5SA 4LJZC 1VQNA 4DAPA 3MXNB 2XSCA 2F0QA 4JCVE 2EYJA 3SK6A 4NXNQ 3F2CA 4LF6L 3A55A 3QJYA 4G4KA 2UU9Q 1E7ZA 4DAYB 2B2WA 3A7AB 3TN2A 5M3MG 4CJ0B 1U5KA 3ONAB 2K4KA 3S16H 1W6KA 1ZKOA 1VQCA 1G6ZA 1H9JA 4X3SA 1AEXA 1MJCA 1VQOA 3PIO3 1X3GA 5IIFA 3J81j 5M3FB 4A75A 1IYJB 4OO1I 3AEVA 4A3CG 3SEBA 4ZKBB 2F0MA 4GLVB 1Q46A 3SXHA 1FD7D 2XRQD 2RHSB 2KEDA 4IFDG 1CKNB 4LF5Q 1Q1EA 3WOEA 1Y1WG 3Q23A 3G7LA 2K7VA 2D2CC 5C0XI 4N8X1 5IGBA 1BQQT 3STBC 4XTCS 3OYYA 1IBLL 1A62A 4HSVA 2WB1G 1YNXA 2HT1A 1SJHD 3MHBA 3RZOB 4HJ9A 1E1OA 1H9SA 1WTQA 1LLRD 2XNAC 2ICEC 2A1AA 4IPDA 4B3ML 1GVPA 2KJXA 1PTOF 3MFYA 3SDZA 5FKAC 1PTOH 3NWSA 3PF5A 2AQ3B 3AFQA 5C5MA 1U4RA 3QG1A 2VY3A 1ZYRC 2NYZD 4P75A 1GUNA 4YY3L 5JAVA 2WAQE 5E7NA 5GAHC 4POGA 1LV9A 2K32A 4FF3A 1YHAA 4A3DB 4MHEA 3PSIA 2AMCB 4LK1C 5I6WA 2Y0SE 1JOQA 1N36Q 1KABA 2IJ0A 2PW7A 1IXRA 3MAQA 5IGFA 2JA5H 3J7A5 1XTCD 3A5ZB 3HOWH 5HGTA 1HJPA 1VQAA 3PMFA 5FO7B 5DEHA 5AJ3Q 1Y8NB 1W3SA 1I4XA 3GTQB 4WORA 2A6HC 1QCBD 4DV4Q 3UI2A 1R9TB 4PQXA 2YTVA 5DAUA 3OTOQ 3WDNA 4G7OC 3R3OA 4KD4A 3T51B 1CM9A 1F2YA 4N9PA 2L11A 1ET6A 4TRDA 2K5VA 2MP1A 3H3VH 2KHSA 2G9DA 4LUOA 3GTPH 4O2DA 4F87A 1HTPA 1U0LA 2EJMA 3U4ZA 4NW2A 1QNUA 2K50A 2VZAA 4XYOA 4ZRZA 1A0IA 3OHXC 1VQBA 1X3EA 2IHEA 1PTOC 4Y52H 1EIHA 4DV3Q 4NMZA 4RGTA 2HHHQ 2NTSA 4DGZA 4IPHA 4C3JH 3Q22A 5EJWA 2B2VA 3S1RH 4EVOA 4WJWA 2DN8A 3E6ZX 2R92G 5BN3A 1FL0A 4DFAA 4ME5A 1TIID 3TRZA 1SMYD 2MHVA 4N9TA 1KAAA 4DR6Q 1UUPA 4KD3A 2MQHA 3IFTA 1PYBA 5GROA 2OQ0A 3J7YW 1TKWB 3S14H 3VYRA 1JMCA 1JWSD 1GHJA 2UXDL 2FJ2A 2WB1E 4K6DA 5CV9A 4KN7C 5CGKA 2CHBD 1AZPA 5E1FA 4A4IA 3M4YA 4UDUC 5GAGC 1DJRD 1VF7A 2GVBA 4LAAA 1XPUA 1FNWA 1HNXL 2PO4A 2F1MA 5EKKA 1PTOB 3Q0AA 3T1HQ 4A3CH 3H3VC 4HIKA 2M2LA 3CCUA 3W2DA 2CQOA 4IFDH 1PMRA 2A74C 1TWFH 4FXGC 2NVXH 2CWPA 3WWVA 2KA7A 3DEOA 5FO8B 2WACA 4M8AA 1PH5A 1LTID 3CCSA 4U673 1B4OA 4CDEC 3DWAA 1KIXA 2JA5B 3TSSA 3J7AF 4RHRA 3U9OA 3HOWB 1MI2A 2G5DA 4OONA 3RUZA 5M5WH 3BU2A 1N34Q 1ICFB 4JBWA 2NZHA 1EQVA 3K8AA 2ATWA 2UXCL 1EYDA 5I4DA 2LMCB 2QGQA 4LF4L 1II3A 2F0WA 3FEWX 1SJED 2A6EC 2K75A 4XXEA 5I2XA 4PMWA 2G9HD 1Z47A 2RSNA 1NR2A 3VR6A 1BR9A 1HNZL 2Y0SB 2WKDA 2AWNA 3MEFA 2O5IC 1QILA 3GTPB 2MO0A 2H1EA 3SVMA 4WFN3 4G7HC 3VA5A 3SE0A 4M1UB 4FP5D 2XRSD 4DF7A 1K28A 5FLXE 4ZKCB 2X6GA 3KJOA 2I0QA 3VR5A 3BDLA 3JAML 4DV2Q 1XMOQ 3NBHA 3PIOA 2R7FA 4IALA 1K0SA 4O42A 5BN5A 2IWHA 3P7JA 1STBA 3NSWA 3CCEA 2B2YC 4JI8Q 3KLRA 1EOTA 3CPFA 4NP5A 4C3JB 4MN3A 1O7YA 2A68D 4RA8A 2PQAA 2ZJQA 2LS01 3A8JE 4LFBQ 1SEBD 4HEDA 1K8MA 5ELNA 5A2QE 3KDFB 2BCOA 1TY0A 2Q2TA 5GQOA 4C3HG 3CKIB 4X65Q 1XNRQ 4WJ4A 3L7ZC 4X64Q 2WINB 3D8GA 1B1ZA 3PUVA 3RLFA 5I6YA 1X3FA 4K5XA 4OGQC 3S14B 1C7YA 1W6JA 1X9NA 2UU9L 1DOKA 3T4AC 1PYWD 1ZXTA 5IT9c 1SNMA 5IWAQ 1KRTA 4RG1A 1GM5A 1B50A 5KNDA 4LUVA 3M4PA 4K5WA 2F0PA 2K05A 1A2UA 4CKCA 3I4MH 3K7UC 2R92H 1WTWA 4KY7A 2ZM6Q 1O7LA 4CJ1B 3N6RA 1L0XB 2F0EA 1HUMA 4L6TB 1TWFB 1QVFA 4RH6A 4LF5L 1XX8A 4OEMB 3JAME 4QB4A 2NVXB 2RDFA 4B3SQ 3MA2B 3VYTA 4R8IA 1EY5A 1V1PB 1M8AA 4LWCA 3PF4A 2I5LX 3S1QH 1ILPA 1RKNA 4JG2A 1K0RA 5J1ZA 3PUZA 3K58A 2YU9H 1A15A 5M5WB 1YNND 3H6MA 2F4VQ 5JJZA 1JJCB 1SYDA 2F3VA 3MEHA 3PQIA 3CCVA 3M4OH 3E0JA 1EFID 1PFSA 1K3RA 3BJUA 2B2TA 1PZKD 3K7AH 2OWOA 3TP7A 4EQNA 4GKKQ 1YHQA 5JJKA 3QB3A 3H3VI 3GTKH 1U9RA 2N78A 1N9WA 4JI7L 1LT4D 1OXSC 3ICEA 1IW7D 2QCPX 4KJNA 1DYQA 5FLMG 2IPKD 1HQMC 2L55A 1PRTD 3J80L 5D3DA 1UNSA 3X3NA 2Q2UA 4HJ7A 2V4DA 2E2IH 5AJ3L 1HH2P 4EQ5A 4P74A 3AYHB 2JA8G 3ERSX 1DCZA 3RZDH 4DV4L 1F77A 3A0JA 3CPWA 1RL2A 2R6GA 5ELDA 3OTOL 3I56A 3R8BA 3O13A 1X56A 5C4XH 1K8AC 2HCIA 4BBSG 1RTNA 1EIGA 3CMAA 3NUCA 1QOHA 4K0KL 1HPCA 5I9OA 4P2CB 1I50H 1R4PB 1N8RC 2JA6G 3U58A 4LF7Q 4IUQA 4GNXA 3J81L 1H95A 3TZDA 2F0OA 1YJ9A 1EQQA 4OX9L 4RFBA 1VQ6A 1NJIC 1AN8A 4DV3L 4FF2A 4OXPA 2QKIC 1CUKA 3I7FA 4JC0A 2RA4A 2XWJB 1N33Q 1WTRA 1LYLA 1VDZA 4CDFC 3I4MB 2R92B 4IFDI 2CWAA 2KHIA 3CXCA 5DM73 4C3HH 3HOVH 4N8FA 1PH4A 3HRZC 1TVXA 2D5DA 1CZWA 4YWKA 4F88A 4Q5VA 4DR6L 2Q8RE 1SE3A 2WKCA 3T1YQ 1G51A 4UAIA 3HOXG 5IP7H 2YYZA 1Y8PB 3OSOA 2RHQB 1CTMA 1MKHA 3SGIA 1A3TA 4JI4L 3S1QB 3GD7A 4BXXG 1D1IA 1E22A 2YU9B 4BY7G 3FP9A 1U4LA 1D6EC 4HN7A 3M4OB 1PDQA 4A3EG 3ND8A 1B44D 4DR3Q 3V2TA 3P20A 1XMQL 2B2WC 2ICIA 4NXML 5IE8A 1F9PA 1K8OA 2Q8TA 3K7AB 1SYCA 4A3GG 3D4DA 1BXTA 1SMYC 4JI3L 5LMUL 1L0WA 3GTKB 4EQOA 4A3LG 1VQGA 2R61A 5EPKA 3TDQA 5C4JH 2UUAL 1S5DD 3K57A 1F9RA 1QG7A 1ML0D 1CQVA 1KDAA 1RCVD 4IURA 3LGJA 3HOWG 2E2IB 1N34L 4X3KA 2R3ZA 4ZUIA 1HXYD 1XXGA 3RZDB 4IZ8A 4OWTB 4K8IA 2O4XA 3I4NG 2VQFL 5C4XB 2DGYA 2V1CC 4JBMA 1SSOA 3ULJA 1AFPA 1D1KA 4E6IA 3GP7A 1SFOH 3HOYB 2NWGA 1B7YB 1STNA 5FLMH 3I55A 1G2TA 4H44C 1I50B 4KJOA 1KTKA 4A3BG 3CRKC 3V05A 1VQ9A 5LHY1 4DK1A 1L2FA 2K33A 1YJWA 4YWLA 3SK8A 2BH2A 1GXDC 4DV2L 4TVAB 1XMOL 3BYTB 5COYA 2JA8H 3UE0A 3W3AA 4UY8C 5J3BA 4BBSH 2JYOA 1E2WA 4HIOA 3C1EA 4IUUA 3K81C 2H5XA 2UUCQ 2K14A 1JWMD 3CC4A 4LFBL 4HR7B 4C3HB 3HOVB 4DR4Q 1B9NA 1Q8IA 4C1NK 2JA6H 1HZ9A 4X65L 1PA6A 2Z6BA 2PZTA 1E2ZA 4GN3B 1H9SB 4C3IB 3MVVA 3K0YA 1RJTA 1EY6A 1O7IA 2SEBD 1YZ6A 1QB5D 5JPMC 5IYCG 3W1GA 2EXZA 4DXFA 3PUWA 3NXWA 1C9OA 3UDXA 5HGQA 4JI2L 1VQJA 1D5ZC 1EZ8A 2KVMA 3OWEB 4POFA 1SMXA 5FLXc 3NTHA 1I4RA 1I3QH 2ZM6L 1B2TA 1CZGA 1NMFA 2K28A 3FRPB 2A68C 5JVH3 1UAPA 1VS0A 1B8AA 2F4IA 1AZQA 4KK7A 3WOFA 3HOXH 3R93A 1ENAA 1VQIA 2ID0A 2FFKB 4YCUA 1SNPA 4B3SL 3S17H 3LWEA 4ZK9B 2AUKA 3CW2C 4H7BA 1HNWQ 5C4JB 1PH6A 4BXXH 3NHHA 5HY6A 2F0LA 4BY7H 1DOMA 3CP0A 4UP9A 2NZ1D 4JI6Q 4LFAQ 1Y69U 2ZXRA 1EY0A 2CW0D 2EY1A 4A3EH 1HHVA 5ELBA 2MGSA 3MXNA 3HGBA 4P71A 4ZLTF 3ULPA 2M00A 4A3GH 1Q82C 5M5XH 2DY8A 2YTYA 1UE6A 2K03A 2B63H 1K9MC 3NEMA 4MZ9A 1KAWA 1STGA 4DUZQ 4A3LH 3S2HB 1KHIA 4JI0L 1M1KC 3IRBA 4JPBW 4DU9A 3CCMA 1VQPA 4RCNA 2MJ8A 1SFOB 3NTIA 1VCIA 3HZXA 4A3KG 5KYLA 4KHPL 1BKBA 1IBKL 1D5XC 3Q24A 4NB3A 1M90C 4QF4A 1I94Q 3KF8B 2F03A 5IGCA 1Z6HA 1KC8C 5EBDA 1SYBA 2ALYB 3JAMc 4L5SA 2JA8B 3F2BA 1QNKA 1YNNC 4RGNA 2PQEA 5IYDG 3PO2G 1WVLA 4LF8L 4DA2A 1CKNA 3I4NH 4DNRB 4BBSB 2IX0A 1SROA 1Q7YC 1TS5A 1N32L 1PLFA 1VQDA 2UXBQ 1SBBB 5CC4A 2JP1A 3RR5A 1EY7A 3ITPA 2WFWA 4C1NI 4A3BH 1WYDA 2UUBQ 2JA6B 1MBYA 2A69D 1JCKB 1CSQA 2PI2A 3C2PA 3TS2A 3K80C 2L15A 2JQOA 1EQTA 2AQ2B 5GADC 1A8VA 3PO3G 1KRSA 2TMPA 4JYAL 1OXTA 1WI5A 2P5ZX 2R7DA 1X32A 3VR2A 2R7ZH 3A8IE 2KCNA 1LT6D 4OIJA 1I4HA 5ELEA 1I4GA 5C5LA 1D7QA 3D6WA 5BR8L 1EYAA 1N33L 1V1QA 4X62Q 3OW2A 3I4MG 3U50C 1I3QB 3K5NA 3F2UA 1KQSA 2OXPA 4A3MH 4R1JA 1YJNA 1Z9FA 1SE2A 3OW7A 3ULLA 1E2VA 3HOXB 1MIUA 3CD6A 5D14A 3T1YL 2N8NA 1WTXA 4QUCA 2HIVA 4XYQA 3S17B 1DZ1A 3DM3A 3NQTA 5JJLA 3I3CA 1JORA 3L2PA 4DR7Q 2LY7A 5IYCH 4BY7B 5J39A 5K36G 3PUYA 4X66Q 4FYDA 4ME3A 2B8GA 4A3EB 3NENA 1HZCA 3ER0A 2VW9A 4A3IG 4LF9Q 1EY4A 4A3GB 5EGTA 3MXGA 2Q2HA 5KIXA 5M5XB 1H9RA 3D3RA 1BCPF 2B63B 1J8IA 1UE1A 1STAA 2RQXA 4A3JH 3KYHC 1WD1A 1RHPA 4CJ2C 2OT2A 1IBMQ 2A8VA 5FO9B 3J7AV 2N88A 3AMUA 1HR0Q 2QA4A 2NUCA 5T1GA 1EYCA 2JXMB 1VQ8A 3KJPA 4GLAC 2IY5B 1NCVA 1YVCA 3MWYW 3HKZG 1QUQA 4JBJA 2PQAB 4PG3A 1NTGA 4B3TQ 4V0BA 1MHWC 3CHBD 1V1OA 2CVRA 2PYKA 4GN4B 1EY9A 2RSOA 4UP8A 1HA5A 3I4NB 3RN5A 4YCWA 4BY1B 5KNCA 1JT8A 1ASZA 1S5FD 1NR4A 4MTNA 4NDXA 1K73C 3ND9A 5C4XG 1XWEA 5EPLA 1LTAD 3H94A 3N52A 5KEEA 1J5EQ 4QQBX 4L63B 3HOYG 2H4OA 4A3BB 4IPCA 3CMEA 3NP8A 4A3KH 1LTBD 4LFCQ 1QVGA 2B2TC 2K1BA 2AQ1B 2IL8A 4DR5Q 4XT1B 4HJ8A 4DV6Q 4XQNA 1BUVT 3P1HA 4FDBA 2R7ZB 1BDOA 4WJ3M 5IYDH 3PO2H 4DPGA 2VXWA 2N49A 3CRLC 4L8JA 2KCTA 1A3VA 3EBEA 5C44G 1CK1A 3ERQA 5E3FA 1BCPC 4K14A 3OIPA 1V9PA 3C1FA 3HS0C 1GUWA 1G6PA 1MSHA 2J4XA 1KXLA 4A3MB 3HOVG 2LKVA 1JB3A 3OIQA 3DMUA 1SNCA 1D5MC 5DNFA 3BVZA 1WFQA 4NXNL 1FVIA 4Z9CB 4L5QA 4OL7A 5C4HA 3PO3H 3MXPA 2EYFA 4PV1C 2E2HH 1Q81C 1EZ6A 2DJGC 2DUDA 4C3IG 3U4VA 4XT3B 5IP7G 4DV1Q 3S15H 3ZJYC 1O78A 3H15A 1CHPD 3M3YH 1E3PA 1OO9B 1WOCA 1SNOA 4KHZA 5EKIA 1KDBA 2E8GA 3Q8DA 5DLQE 1AW7A 1EUJA 4KKSA 5IOCA 5DM63 4OWWB 1NUCA 4OIKA 1J6QA 1QVCA 3M7NA 3TP8A 4LF6Q 3STBD 2D9UA 1Q3LA 1WCMB 2NN6G 1GOZA 4CKEA 4GNXC 4F7XA 2YTXA 3MXUA 1UE5A 4CKBA 2Z6KA 1F9QA 2PNRC 1LM0A 2L12A 2NVTH 2DY7A 3OMGA 2Z4IA 5ELOA 3I2ZA 3OOCA 1GUOA 3I91A 3TP5A 4IUPA 1BCPB 4A3JB 3KBXA 3TEHB 2O5JC 5F2DA 1G2SA 3FHWA 1DGSA 2R93G 2BE5D 4HMJA 5K36H 2K04A 3X3MA 3T13A 1G8ZD 4UP7A 1JE4A 1P16A 5KYIA 3HKZE 2EYMA 1PFMA 4JVZA 3S2DH 3NTKA 3FMCA 2QILA 3KDFA 2HQLA 4A3IH 1IBLQ 1A3UA 1ENFA 4DAVA 5CV4A 2WP8J 1S5CD 1QWYA 4JOIA 4EQPA 4DV7Q 3GV6A 5BN4A 1CQFA 3E9IA 2B8FA 1B9MA 5FOBB 4DUZL 2OQKA 5J22A 4YY3Q 1EOVA 4JV5Q 1G291 3CCRA 4G7ZC 2VUMG 4A3KB 1L1OA 1N36L 4LMQD 2K5WA 1S3OA 3F2DA 1B3AA 2SNSA 2QEJC 3CQZH 1PXUA 1U4PA 1EEID 2RDHA 3UDFA 3SK4A 3A54A 1CSPA 3QOLA 1WTOA 1DXMA 3LX0A 4APVA 2CH4A 1IHZA 3GTGH 3PO2B 2C9OA 3E9HA 2CW0C 2Z4HA 4AYBG 2KBNA 4QY7A 3M7GA 4FNFA 2QDLA 1VQ5A 2EY2A 3I8ZA 1YEZA 4DXGA 3S9WA 2XIWA 2EY5A 1BBUA 1OXXK 2B3GA 1SR3A 4R9WA 4DR2Q 3HOYH 1K3BC 1HA6A 3NK9A 5JOBA 3KOJA 2UUBL 3BYYB 3QO2A 1JICA 3FVQA 3KF6A 3PO3B 4V190 3KK7A 2E2HB 1JJGA 3L9AX 4CBVA 3BZDB 2KEEA 4PZ6A 1JR0D 3S15B 1FR3A 1L0YB 4J15A 3M3YB 1JC7A 2NVYH 2HHHL 5C44H 5ISRA 1I4PA 4ILWA 4B9WA 4HCEA 3I70A 4JI1Q 3W1BA 2E5LQ 4XIGS 4HIMA 1ENCA 1K83H 2F3IA 2IX1A 3NBIA 2D0OA 4FF4A 1EU3A 1Q86C 3IL8A 2OTLA 2JEBI 4X62L 3EVQA 2SNMA 3RD4A 4DK3C 1JOKA 4HCSA 4IOAA 1BO0A 3L0OA 3FPPA 3HP3A 2NVTB 2FXQA 4IOCA 5IGGA 3QWNA 4BS9A 4C3IH 3J80E 2IT1A 3FPUB 2B2UC 2A69C 4QUFA 2XGTA 2ZXPA 1VQMA 1M4VA 1AP0A 1FNUA 4R4OA 4FXDA 4RHSA
chains in the Genus database with same CATH topology
2OF1A 5IGEA 1R4QB 4BWGB 1PZID 4XQJA 3VR3A 1NSNS 2NN6H 1RD9D 1SYFA 4BA1I 4RAUC 1KNAA 3S2DB 2F0SA 4TKOB 2IW3A 5IT9L 4A3IB 1ET9A 2O2LD 2PZWA 3EJIA 4KV6A 1Q12A 3J81E 1EWHA 2PCFB 5CV7A 5E4WC 2F0HA 1J9OA 4J1MA 3CU7A 1SXTA 5G3LD 1LO5D 3HKZB 3CQZB 3MTSA 4EGVA 2NB0A 4KI0A 5ELCA 4PMBA 2F0GA 5CV6A 5I2YA 3GTGB 2HCCA 2E75C 3DHQA 2ENBA 2BA0A 4KTAA 2B39A 1GUTA 4HTHA 4DK0A 1IYVA 1IKLA 1S4ZA 2PPBC 3GO5A 4H0LC 2A73B 1ONLA 2AWOA 3DWQA 1IKMA 1NAPA 1ILQA 4IN3A 2NVYB 1KLGD 1PZJD 5C44B 5A35A 3K6OA 3PIP3 1O7ZA 5EKLA 1K83B 2PZUA 1CA6A 1H9MA 2J0TD 5HURA 5IODA 2C5CA 3FDTA 4J6HA 3SK5A 2BA1A 2F3WA 1WTPA 1GUSA 3KLSX 2L5TA 2Z1CA 3TP6A 2HDMA 1VMCA 1BBXC 2FINB 5FK9C 2VB3X 3T16A 3SR1A 4K6LA 2BDNA 1TWAB 3A8KE 2EDGA 5C4ZA 3OPOA 4IFDJ 2EYPA 1G91A 4RGMA 1CHQD 1FNVA 2K6AA 1SYGA 1X3PA 4JK1C 1PFBA 1DONA 2B2VC 2F0TA 5CV5A 4B08A 4I7ZC 2JEAI 2R93B 3VYUA 3BS1A 2F0UA 5TSSA 2VNUD 4QIWB 4WRDA 2WIIB 2EJGC 4KKTA 1PRTF 3MFGA 1ESFA 3T53B 1FYCA 5JPNC 2NTTA 4CHTB 1STEA 3IAYA 1QE6A 4RWSC 4DAYA 5NUCA 5D65A 1HTLD 3G6JB 5CYUA 1LTSD 2VUMB 3BDOA 4Q0FA 3GTMB 4PNYA 3U9SA 3I72A 3EQLC 1U4MA 3D4WA 2BE5C 1Q1BA 4FF1A 1PFNA 3V96A 2L0CA 4AYBB 1SYEA 3MZ5A 1V8QA 1RDPD 1I4QA 3VR4A 3EFXD 1YNJD 2PW5A 4XQQA 4B9XA 2QDBA 2EJFC 3QIAA 2F0KA 2TSSA 4ULLA 5LL6X 4K2KA 4IUVA 2JE6I 1I6VC 3KLSA 3C3LA 4RCOA 1IW7C 5JEAJ 4C56C 1C48A 2FHTA 4X3UA 2F0IA 1D2BA 2NN6I 1PRTC 1LT3D 2LFNA 1MGSA 3L3OC 4TQUS 4FO2A 3DUZA 5M9OA 2HDLA 2EE1A 1IYUA 1WD0A 1H9KA 1Z7TA 1KDCA 1O80A 2IX3A 4GZYC 1STYA 4DN4M 3NPPA 2F0JA 4J8QA 3URYA 5JEAG 5M5YB 3D6CA 3S16B 3KF8A 1SAPA 2AUJD 3DXJC 1B53A 2PMZB 1VMPA 4QCLA 1Y1VB 4MIUA 5G3LF 2SOBA 1I6HB 2RDGA 4XDXA 1OXUA 2X69A 2K01A 1SNQA 5C3XA 3NQIA 1PRTB 3TMEA 1CT1D 2BOSA 3GTOB 4KKUA 2E76C 4ZQ3A 5FLXL 5C0XJ 2EVBA 2NVQB 5LL6S 1EU4A 1ICWA 4PMCA 4OO1G 5T1IA 1S5BD 1DOLA 2KOLA 1RODA 5A2QL 4ZAIA 2EPBA 1C4QA 2OEOA 5C0XG 3AB9A 2DNEA 2RKSA 4YIJA 3S1MB 3A56A 2WAQB 3C46A 4HSPA 3Q6SA 1TWHB 4QMGA 1E0BA 4K5VA 2WV6D 3I73A 2F0VA 1CA5A 3GTLB 1EY8A 3I4LA 5CBAE 3NWTA 4HMIA 5CORA 2EZVA 3TBIB 4K2LA 3ZYYX 2K5QA 5IGDA 1TT2A 4BBRB 3HOUB 2E2JB 3H09A 4FXKC 1TY2A 3LNNA 1UEAB 3H91A 4ZYSA 1LT5D 1BOSA 3S1RB 3PV0A 3K59A 1SE4A 2MPMA 1F9SA 1X3QA 1SDFA 3QOJA 3SHLA 3R2IA 4HAEA 3IKJA 2RBMA 1EL0A 3VYSA 4S3SA 4OHJA 1KNEA 2Z8LA 4RKLA 1A2TA 5K5PA 5M3MB 3GV3A 1BNZA 5JEAH 1ESRA 2XVSA 5EBCA 1RF2D 3R2TA 1XYIA 1ZYRD 5EPJA 1LTRD 3OWFA 2N55A 4KY5A 1TQOA 2Q8IB 3A7LA 1HUNA 3T56B 4KMUC 1Y1WB 3EROA 3HG9A 3S1NB 4C2MB 3K5MA 1C8CA 3PUXA 4IUTA 1GUGA 1TU2B 4TSSA 2L4NA 1GJXA 2WB1B 3AU7A 1HCZA 3K5OA 3P75A 4O1NA 1CI3M 5CV8A 2A6HD 5CMDA 1HQRD 1TR5A 1HFGA 2J7ZA 2K5DA 1EEFD 2D62A 3DWPA 1T5EA 1FGBD 4ZUJA 3BG3A 2A5HA 5AFWA 4OO1H 1KLUD 2FMMA 3GTJB 2MUYA 2HUGA 4R8NA 2B2YA 4A3FB 1PTOD 1STHA 5C0XH 1DM0B 1CFMA 3MC0B 2KUMA 1DD2A 3KBGA 2F0DA 1ZEQX 4ODGA 5ELFA 5EQ0A 1V1PA 1F2ZA 1IL8A 2X6LA 3HOZB 2SDFA 1JWUD 2F0FA 3DEPA 3K5LA 2JA7B 5C3EB 3DM1A 2I07B 4X3TA 1LTGD 5JVG3 4CGYB 2NBFA 1TS3A 1F2MA 5D3IB 3FKIB 1YNJC 3D31A 1LACA 4IUNA 4ID6A 3OMCA 1F2LA 2EYOA 2XN9C 1LTTD 5C6AA 2KCCA 4RKBA 4DNTB 1TS2A 2RVLA 4KY6A 2ZXOA 3IFDA 1S5ED 2BDOA 2L1BA 4NKLA 1A6XA 1TWCB 2FMCA 1EWCA 5KGUA 2HQEA 2EYLA 3VA7A 4K8JA 3RMHA 1JOOA 4A93B 4G57A 1HFNA 2KECA 5KNBA 2A6ED 5E4XA 5CBEE 1MD2D 3TZUA 4ABNA 3BDCA 1LABA 1T5XD 4FVMA 4U68A 2CQAA 4RGOS 3H0GB 1RTOA 1Y8OB 4BA2I 4KN4C 1OXVA 4I65A 2M9VA 3D4RA 1JQYD 4H13C 2I46A 1QJOA 2EOTA 5CR3A 1VF5C 4F8MA 2ZT9C 1BCPD 2L9HA 2QF7A 3GQBA 5C3WA 4Y7NB 3HEJA 2JSOA 1BF4A 3LWUA 4IQZA 2VB2X 5IT9E 1SNDA 5KRUA 3M85A 3KUPA 2XWBB 1Q90A 3BVMA 2KQ3A 2F0NA 1WTVA 1MSGA 5I9PA 2EYHA 3I90A 2EY6A 4KHVA 1GHKA 1HRJA 3BVGA 2E2DC 2E74C 1TWGB 3EA6A 2DNCA 2B2UA 4C3JG 3NE5B 1TS4A 1V43A 2GA4B 3E5SA 4LJZC 4DAPA 2XSCA 2F0QA 2EYJA 3SK6A 3A55A 3QJYA 4G4KA 2B2WA 3A7AB 3TN2A 4CJ0B 3ONAB 1W6KA 1ZKOA 1G6ZA 1H9JA 4X3SA 1AEXA 3PIO3 5IIFA 5M3FB 4OO1I 3SEBA 4ZKBB 2F0MA 3SXHA 1FD7D 2XRQD 2KEDA 4IFDG 1Q1EA 3WOEA 3Q23A 3G7LA 2K7VA 2D2CC 5C0XI 5IGBA 1BQQT 4XTCS 4HSVA 1SJHD 3MHBA 3RZOB 1H9SA 1WTQA 1LLRD 2XNAC 2ICEC 2KJXA 1PTOF 3MFYA 3SDZA 5FKAC 1PTOH 3NWSA 2AQ3B 5C5MA 1U4RA 3QG1A 1ZYRC 2NYZD 1GUNA 5JAVA 1LV9A 2K32A 4FF3A 4A3DB 4MHEA 4LK1C 5I6WA 1JOQA 1KABA 2IJ0A 2PW7A 3MAQA 5IGFA 1XTCD 5HGTA 3PMFA 5FO7B 5DEHA 1Y8NB 1I4XA 3GTQB 4WORA 2A6HC 1QCBD 3UI2A 1R9TB 4PQXA 5DAUA 4G7OC 3WDNA 3R3OA 4KD4A 3T51B 1CM9A 1F2YA 4N9PA 2L11A 1ET6A 4TRDA 2MP1A 2KHSA 2G9DA 4F87A 1HTPA 2EJMA 4NW2A 1QNUA 4XYOA 4ZRZA 3OHXC 1PTOC 1EIHA 4NMZA 4RGTA 2NTSA 4DGZA 3Q22A 5EJWA 2B2VA 4EVOA 4WJWA 2DN8A 3E6ZX 5BN3A 4DFAA 4ME5A 1TIID 1SMYD 2MHVA 4N9TA 1KAAA 1UUPA 4KD3A 3IFTA 3J7YW 1TKWB 3VYRA 1JWSD 1GHJA 2FJ2A 4K6DA 5CV9A 4KN7C 5CGKA 2CHBD 1AZPA 5E1FA 3M4YA 4UDUC 1DJRD 1VF7A 4LAAA 1FNWA 2PO4A 2F1MA 5EKKA 1PTOB 3Q0AA 3H3VC 2M2LA 3W2DA 4IFDH 1PMRA 2A74C 4FXGC 2KA7A 3DEOA 5FO8B 2WACA 4M8AA 1LTID 4U673 1B4OA 3DWAA 2JA5B 3TSSA 3J7AF 4RHRA 3U9OA 3HOWB 1MI2A 3RUZA 4JBWA 1EQVA 1EYDA 5I4DA 2LMCB 1II3A 2F0WA 3FEWX 1SJED 2A6EC 4XXEA 5I2XA 4PMWA 2G9HD 1Z47A 2RSNA 1NR2A 3VR6A 1BR9A 2Y0SB 2WKDA 2AWNA 2O5IC 1QILA 3GTPB 3SVMA 2H1EA 4WFN3 4G7HC 3VA5A 3SE0A 4M1UB 4FP5D 2XRSD 4DF7A 5FLXE 4ZKCB 2X6GA 3VR5A 3BDLA 3JAML 3NBHA 4IALA 4O42A 5BN5A 2IWHA 3P7JA 1STBA 3NSWA 2B2YC 3KLRA 1EOTA 4NP5A 4C3JB 4MN3A 1O7YA 2A68D 4RA8A 2LS01 3A8JE 1SEBD 4HEDA 1K8MA 5A2QE 2BCOA 1TY0A 4C3HG 3CKIB 3L7ZC 2WINB 3D8GA 1B1ZA 3PUVA 3RLFA 5I6YA 4K5XA 4OGQC 3S14B 1W6JA 1DOKA 3T4AC 1PYWD 1ZXTA 1SNMA 1B50A 5KNDA 4K5WA 2F0PA 2K05A 1A2UA 4CKCA 1WTWA 4KY7A 1O7LA 4CJ1B 3N6RA 1L0XB 2F0EA 1HUMA 4L6TB 1TWFB 4RH6A 1XX8A 3JAME 4QB4A 2NVXB 2RDFA 3MA2B 3VYTA 4R8IA 1EY5A 1V1PB 1M8AA 1ILPA 1RKNA 5J1ZA 3PUZA 3K58A 1A15A 5M5WB 1YNND 3H6MA 5JJZA 1SYDA 2F3VA 3MEHA 3E0JA 1EFID 2B2TA 1PZKD 3TP7A 4EQNA 3QB3A 1U9RA 1LT4D 1OXSC 1IW7D 2QCPX 4KJNA 1DYQA 2IPKD 1HQMC 2L55A 1PRTD 3J80L 5D3DA 1UNSA 3X3NA 2V4DA 1DCZA 1F77A 2R6GA 5ELDA 3R8BA 3O13A 2HCIA 1RTNA 1EIGA 3NUCA 1QOHA 1HPCA 5I9OA 4P2CB 1R4PB 4IUQA 3J81L 3TZDA 2F0OA 4RFBA 1AN8A 4FF2A 2QKIC 2RA4A 2XWJB 1WTRA 1VDZA 3I4MB 2R92B 4IFDI 5DM73 3HRZC 1TVXA 2D5DA 1CZWA 4F88A 4Q5VA 2Q8RE 1SE3A 2WKCA 4UAIA 2YYZA 1Y8PB 3OSOA 1CTMA 1A3TA 3S1QB 3GD7A 1D1IA 2YU9B 1U4LA 1D6EC 4HN7A 3M4OB 1PDQA 3ND8A 1B44D 3V2TA 3P20A 2B2WC 2ICIA 1F9PA 1K8OA 2Q8TA 3K7AB 1SYCA 3D4DA 1BXTA 1SMYC 3GTKB 4EQOA 2R61A 5EPKA 3TDQA 1S5DD 3K57A 1F9RA 1QG7A 1ML0D 1CQVA 1KDAA 1RCVD 4IURA 2E2IB 4X3KA 2R3ZA 4ZUIA 1HXYD 1XXGA 3RZDB 4IZ8A 4K8IA 2O4XA 5C4XB 1SSOA 1AFPA 1D1KA 4E6IA 3GP7A 3HOYB 2NWGA 1STNA 1G2TA 4H44C 1I50B 4KJOA 1KTKA 3CRKC 3V05A 5LHY1 4DK1A 2K33A 3SK8A 1GXDC 3BYTB 5COYA 3W3AA 2JYOA 1E2WA 3C1EA 4IUUA 1JWMD 4HR7B 4C3HB 3HOVB 1B9NA 1Q8IA 4C1NK 2PZTA 1E2ZA 1H9SB 4C3IB 3MVVA 3K0YA 1RJTA 1EY6A 2SEBD 5JPMC 1QB5D 2EXZA 4DXFA 3PUWA 3NXWA 1D5ZC 1EZ8A 2KVMA 3OWEB 3NTHA 1I4RA 1B2TA 1CZGA 2K28A 3FRPB 2A68C 5JVH3 1UAPA 2F4IA 1AZQA 4KK7A 3WOFA 3R93A 1ENAA 2ID0A 2FFKB 1SNPA 3LWEA 4ZK9B 2AUKA 4H7BA 5C4JB 3NHHA 2F0LA 1DOMA 2NZ1D 1Y69U 2ZXRA 1EY0A 2CW0D 2EY1A 1HHVA 5ELBA 2MGSA 3MXNA 3HGBA 4ZLTF 2M00A 2DY8A 2K03A 1STGA 3S2HB 4DU9A 4RCNA 2MJ8A 1SFOB 3NTIA 1VCIA 3HZXA 5KYLA 1D5XC 3Q24A 2F03A 4QF4A 5IGCA 1Z6HA 5EBDA 1SYBA 2JA8B 1QNKA 1YNNC 4RGNA 2PQEA 1WVLA 4DA2A 4DNRB 4BBSB 2IX0A 1TS5A 1PLFA 1SBBB 5CC4A 2JP1A 1EY7A 3ITPA 4C1NI 2JA6B 1MBYA 2A69D 1JCKB 3C2PA 1EQTA 2AQ2B 2TMPA 1OXTA 3VR2A 1X32A 3A8IE 2KCNA 1LT6D 4OIJA 1I4HA 5ELEA 1I4GA 5C5LA 3D6WA 1EYAA 1I3QB 3K5NA 3F2UA 2OXPA 1SE2A 3OW7A 1E2VA 3HOXB 5D14A 1WTXA 4QUCA 4XYQA 3S17B 1DZ1A 3NQTA 3I3CA 1JORA 2LY7A 4BY7B 5J39A 5K36G 3PUYA 4FYDA 2B8GA 4A3EB 1EY4A 4A3GB 5EGTA 3MXGA 5KIXA 5M5XB 1H9RA 3D3RA 1BCPF 2B63B 1J8IA 1STAA 2RQXA 1WD1A 1RHPA 4CJ2C 2OT2A 5FO9B 3J7AV 2N88A 3AMUA 2NUCA 5T1GA 1EYCA 2JXMB 1NCVA 3MWYW 4V0BA 3CHBD 1V1OA 2CVRA 2PYKA 1EY9A 2RSOA 1HA5A 3I4NB 4BY1B 5KNCA 1S5FD 1NR4A 4NDXA 3ND9A 1XWEA 5EPLA 1LTAD 3H94A 3N52A 5KEEA 4L63B 4A3BB 2H4OA 3NP8A 1LTBD 2B2TC 2K1BA 2AQ1B 2IL8A 4XT1B 4XQNA 1BUVT 3P1HA 2R7ZB 1BDOA 2VXWA 3CRLC 4L8JA 1A3VA 1CK1A 3ERQA 5E3FA 1BCPC 4K14A 3OIPA 3C1FA 3HS0C 1GUWA 1MSHA 2J4XA 4A3MB 2LKVA 1JB3A 3OIQA 3DMUA 1SNCA 1D5MC 5DNFA 3BVZA 4Z9CB 4OL7A 5C4HA 3MXPA 2EYFA 4PV1C 1EZ6A 4C3IG 4XT3B 1O78A 1CHPD 1OO9B 1SNOA 4KHZA 5EKIA 1KDBA 5IOCA 1AW7A 4KKSA 5DM63 1NUCA 4OIKA 3M7NA 3TP8A 2D9UA 1Q3LA 1WCMB 2NN6G 1GOZA 4CKEA 4F7XA 3MXUA 4CKBA 1F9QA 2PNRC 2L12A 2DY7A 3OMGA 2Z4IA 3OOCA 1GUOA 3I91A 3TP5A 4IUPA 1BCPB 4A3JB 3KBXA 2O5JC 5F2DA 1G2SA 2BE5D 4HMJA 5K36H 2K04A 3X3MA 3T13A 1G8ZD 1JE4A 5KYIA 2EYMA 1PFMA 3NTKA 3FMCA 2QILA 1A3UA 1ENFA 4DAVA 5CV4A 2WP8J 1S5CD 1QWYA 4EQPA 3GV6A 5BN4A 1CQFA 2B8FA 1B9MA 5FOBB 5J22A 1G291 4G7ZC 4A3KB 4LMQD 2K5WA 1B3AA 2SNSA 2QEJC 1PXUA 1U4PA 1EEID 2RDHA 3SK4A 3A54A 3QOLA 1WTOA 1DXMA 3LX0A 1IHZA 3PO2B 2C9OA 2CW0C 2Z4HA 3M7GA 4FNFA 2EY2A 3I8ZA 4DXGA 3S9WA 2XIWA 2EY5A 1OXXK 4R9WA 1HA6A 3NK9A 5JOBA 3BYYB 3QO2A 1JICA 3FVQA 3PO3B 4V190 3KK7A 2E2HB 3L9AX 4CBVA 3BZDB 2KEEA 1JR0D 3S15B 1FR3A 1L0YB 3M3YB 1JC7A 5ISRA 1I4PA 4ILWA 4B9WA 4HCEA 3I70A 4XIGS 1ENCA 2IX1A 3NBIA 4FF4A 1EU3A 3IL8A 2JEBI 3EVQA 2SNMA 3RD4A 1JOKA 4HCSA 1BO0A 3FPPA 3HP3A 2NVTB 5IGGA 3QWNA 4BS9A 3J80E 2IT1A 3FPUB 2B2UC 2A69C 4QUFA 2ZXPA 1M4VA 1AP0A 1FNUA 4FXDA 4RHSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV4 A;  4J6H A;  3OWF A;  2OF1 A;  3SK5 A;  5IGE A;  5JOB A;  4KY5 A;  1SND A;  3NP8 A;  5C5M A;  2F3W A;  2PW5 A;  5KRU A;  4EQP A;  1NSN S;  1JOQ A;  5JAV A;  3TP6 A;  4K6D A;  5CV9 A;  5CGK A;  1SYF A;  5C5L A;  1TQO A;  4B9X A;  2F0S A;  2KQ3 A;  1EYA A;  5E1F A;  1ENA A;  1KDA A;  2QDB A;  2F0N A;  5J22 A;  2F0K A;  3D8G A;  4IUN A;  5I9P A;  3T16 A;  3SR1 A;  4LAA A;  5I6Y A;  2EYH A;  4K5X A;  3P1H A;  4K2K A;  1SNP A;  4ID6 A;  3ERO A;  2EY6 A;  2OXP A;  3OMC A;  5EKK A;  2OEO A;  4H7B A;  4K8I A;  2PZW A;  3EJI A;  4KV6 A;  5C4Z A;  3NUC A;  1SNM A;  3NHH A;  4ZUI A;  2F0L A;  2RKS A;  5I9O A;  2SNS A;  4KHV A;  1A3V A;  5I6W A;  4YIJ A;  4IZ8 A;  3SK4 A;  3ERQ A;  2EYO A;  3QOL A;  5CV7 A;  5E3F A;  3LX0 A;  2F0H A;  4K5W A;  4K14 A;  1IHZ A;  1KAB A;  2EYP A;  2F0P A;  2F0I A;  2O4X A;  1EY0 A;  2PW7 A;  3C1F A;  3P75 A;  1A2U A;  2EY1 A;  4J1M A;  5IGF A;  5C6A A;  5HGT A;  3PMF A;  3NQT A;  5CV8 A;  2F0O A;  1SYG A;  4KY7 A;  1JOR A;  5DEH A;  1TR5 A;  4QMG A;  2LKV A;  4E6I A;  3DMU A;  1SNC A;  4RKB A;  4K5V A;  2M00 A;  2WAC A;  2F0V A;  1STN A;  5M9O A;  4KY6 A;  1EY8 A;  4WOR A;  5J39 A;  2EY2 A;  2F0T A;  5CV5 A;  2F0E A;  4OL7 A;  5C4H A;  4KJO A;  3E5S A;  3MXP A;  2EYF A;  1EZ6 A;  2F0G A;  2F0Q A;  4HMI A;  2EYJ A;  1STG A;  4PMB A;  5CV6 A;  4NKL A;  4ZUJ A;  3S9W A;  1KDC A;  2EY5 A;  3SK6 A;  3U9O A;  5DAU A;  3RUZ A;  3R3O A;  3SK8 A;  4DU9 A;  5KGU A;  4KD4 A;  1STY A;  2HQE A;  4QB4 A;  2RDF A;  2F0J A;  3NK9 A;  1SNO A;  3D6C A;  2F0U A;  1F2Y A;  2ENB A;  2EYL A;  3DHQ A;  4K2L A;  1EY5 A;  1EY4 A;  1KDB A;  4K8J A;  4N9P A;  5EGT A;  4KTA A;  5IGD A;  5IOC A;  4R8N A;  1TT2 A;  1JOO A;  1NUC A;  3HZX A;  4TRD A;  5KIX A;  1EQV A;  4WRD A;  2KHS A;  4G57 A;  3TP8 A;  5KYL A;  1RKN A;  4HTH A;  1EYD A;  1STA A;  5J1Z A;  4QF4 A;  1II3 A;  2F0W A;  5IGC A;  4F7X A;  3H6M A;  1STH A;  3C1E A;  1SYB A;  1SYD A;  2F3V A;  3MEH A;  3OSO A;  2NUC A;  1AEX A;  1EYC A;  1A3T A;  2F0D A;  2PQE A;  3BDC A;  4B9W A;  5ISR A;  4ODG A;  3OMG A;  5IIF A;  4MIU A;  5NUC A;  1ENC A;  2SOB A;  4NMZ A;  1F2Z A;  3TP5 A;  3TP7 A;  4EQN A;  2PZT A;  2F0M A;  3QOJ A;  1SNQ A;  3SHL A;  3VA5 A;  4DGZ A;  4I65 A;  5F2D A;  5C3X A;  3QB3 A;  3SXH A;  3EVQ A;  2RBM A;  4DF7 A;  2SNM A;  3MVV A;  4EVO A;  1JOK A;  1U9R A;  5CC4 A;  3BDL A;  3TME A;  2F0F A;  1EY7 A;  2PYK A;  4HMJ A;  4PNY A;  1EY6 A;  3ITP A;  4S3S A;  3V2T A;  1EY9 A;  5IGG A;  3T13 A;  4IAL A;  4ZQ3 A;  4DFA A;  4ME5 A;  4RKL A;  1A2T A;  3D4W A;  2PZU A;  5EKL A;  5CR3 A;  5IGB A;  5K5P A;  5KYI A;  4N9T A;  1STB A;  1SYC A;  2EXZ A;  2EYM A;  1KAA A;  3NXW A;  3D4D A;  4KJN A;  3MHB A;  4F8M A;  4KD3 A;  4NP5 A;  1EZ8 A;  4PMC A;  5HUR A;  4NDX A;  5IOD A;  1SYE A;  3MZ5 A;  5C3W A;  3HEJ A;  4EQO A;  1A3U A;  1F2M A;  5KEE A; 
#chains in the Genus database with same CATH topology
 1TWA H;  5EAY A;  3W5O A;  4DR7 L;  2OF1 A;  5IGE A;  1R4Q B;  4BWG B;  2F52 A;  1PZI D;  4XQJ A;  3UE1 A;  3VR3 A;  1NSN S;  2NN6 H;  1RD9 D;  4X66 L;  4L5T A;  1SYF A;  4BA1 I;  4RAU C;  1KNA A;  3S2D B;  2F0S A;  4TKO B;  4QIW E;  2IW3 A;  1Y1V G;  5IT9 L;  4DV0 Q;  3T1H L;  4A3I B;  1W2B A;  2UXD Q;  1ET9 A;  5LMN Q;  1CKO A;  2O2L D;  3JC6 6;  2PZW A;  3EJI A;  4KV6 A;  1Q12 A;  5IY0 A;  3J81 E;  1HNX Q;  1EWH A;  2B63 G;  3RN2 A;  2LSS A;  2PCF B;  5CV7 A;  5E4W C;  2F0H A;  2R93 H;  1SN8 A;  1J9O A;  4J1M A;  2YV5 A;  3CU7 A;  1NY4 A;  4DKA C;  1SXT A;  5G3L D;  1LO5 D;  2BH8 A;  2QW7 A;  3HKZ B;  3CQZ B;  3MTS A;  4EGV A;  2NB0 A;  2LXK A;  4KI0 A;  2CH4 W;  5ELC A;  2Z9H A;  2F0G A;  4PMB A;  5CV6 A;  5I2Y A;  3GTG B;  2HCC A;  1NMG A;  4LW1 A;  1X6O A;  4HID A;  4AYB E;  2E75 C;  1YHB A;  3DHQ A;  2ENB A;  2BA0 A;  4KTA A;  1RIP A;  1UE7 A;  3S2H H;  2B39 A;  3CCL A;  1GUT A;  4HTH A;  4BY1 G;  4DK0 A;  1IYV A;  2DJF C;  1K8G A;  2VUM H;  2JK8 A;  1GKH A;  1IKL A;  1J5E L;  1S4Z A;  2PPB C;  3GTM H;  4NPS A;  1ASY A;  3GO5 A;  4H0L C;  2A73 B;  4P72 A;  1ONL A;  2AWO A;  3DWQ A;  1IKM A;  1NAP A;  2R7Z G;  1ILQ A;  4IN3 A;  2NVY B;  1KLG D;  1PZJ D;  5C44 B;  4JI8 L;  5A35 A;  3K6O A;  2RF4 A;  3PIP 3;  1JB7 A;  1O7Z A;  5EKL A;  1K83 B;  2PZU A;  1CA6 A;  1H9M A;  2J0T D;  4BBR G;  4GOP A;  3HOU G;  5HUR A;  4GN5 A;  5IOD A;  2JJQ A;  2C5C A;  2ZJR A;  4A3M G;  3FDT A;  1XNR L;  1SRU A;  1T9H A;  3JAM i;  4J6H A;  3SK5 A;  2ES2 A;  4P73 A;  4X64 L;  2BA1 A;  2F3W A;  1WTP A;  5L37 A;  1GUS A;  3KLS X;  2L5T A;  2Z1C A;  4JW0 A;  3TP6 A;  2ASB A;  2HDM A;  1VMC A;  1BBX C;  2FIN B;  5FK9 C;  2VB3 X;  3T16 A;  3SR1 A;  5IWA L;  4K6L A;  2I5M X;  2BDN A;  1TWA B;  3A8K E;  3HKS A;  2EDG A;  5C4Z A;  2XTI A;  1NNX A;  2PMZ E;  4PZ8 A;  3OPO A;  5LMN W;  1WCM G;  2HD3 A;  1VQ7 A;  4IFD J;  2EYP A;  1G91 A;  1HZB A;  4RGM A;  4CDC C;  1CHQ D;  1FNV A;  2K6A A;  1SYG A;  4R4Q A;  1X3P A;  4JK1 C;  5M5Y H;  1PFB A;  2ZJP A;  1CKM A;  1DON A;  1VQE A;  4R4I A;  2B2V C;  2F0T A;  2I5H A;  5CV5 A;  4UHV A;  4B08 A;  4I7Z C;  4A3J G;  2JEA I;  2R93 B;  3VYU A;  1EIF A;  3BS1 A;  1PYS B;  3B6Y A;  2EQS A;  2F0U A;  5TSS A;  4GS3 A;  2VNU D;  4QIW B;  1Y1V H;  2WII B;  4WRD A;  2F4V L;  4QGU A;  4CDD C;  1I6H H;  2EJG C;  4KKT A;  2VL6 A;  4DK6 C;  1WJJ A;  4AIM A;  1PRT F;  3MFG A;  1ESF A;  3T53 B;  1FYC A;  5JPN C;  2NTT A;  4CHT B;  1D8L A;  1STE A;  1PH9 A;  4GKK L;  1EIY B;  3GTO H;  3IAY A;  4DV7 L;  1QE6 A;  4RWS C;  4DAY A;  5NUC A;  5D65 A;  1EYG A;  1HTL D;  3G6J B;  5CYU A;  1LTS D;  2NVQ H;  2VUM B;  1LUZ A;  4JV5 L;  3BDO A;  4Q0F A;  2CKZ B;  3GTM B;  1YIJ A;  4PNY A;  4RMF A;  3U9S A;  2ZTE A;  3I72 A;  3CC2 A;  3EQL C;  1U4M A;  3D4W A;  1X65 A;  2BE5 C;  1Q1B A;  4FF1 A;  1PFN A;  1PHJ A;  4JI7 Q;  3V96 A;  2L0C A;  4AYB B;  1SYE A;  3MZ5 A;  1V8Q A;  1RDP D;  1I4Q A;  4DR1 Q;  4A3F G;  3VR4 A;  3EFX D;  2MO1 A;  1YNJ D;  4BY1 H;  2PW5 A;  4XQQ A;  4YHH Q;  3G4S A;  4DUY Q;  4B9X A;  2QDB A;  2EJF C;  3S1M H;  3QIA A;  2F0K A;  4DR2 L;  1JJ2 A;  1OTC A;  2TSS A;  4ULL A;  5LL6 X;  4K2K A;  4IUV A;  3J80 i;  3HOZ G;  2JE6 I;  1I6V C;  3KLS A;  3C3L A;  4HJA A;  4RCO A;  1TWH H;  1IW7 C;  4LF7 L;  4UPA A;  5JEA J;  4C56 C;  1C48 A;  3GTL H;  3E3X A;  2FHT A;  2JA7 G;  4DV5 Q;  4X3U A;  5C3E G;  3F8T A;  2F0I A;  4K0K Q;  1D2B A;  2NN6 I;  1PRT C;  5IP9 G;  3AFP A;  1LT3 D;  2N3S A;  2LFN A;  1MGS A;  3L3O C;  4TQU S;  4FO2 A;  2KEN A;  3DUZ A;  4JI1 L;  4QL5 A;  5M9O A;  2VQE Q;  2HDL A;  2E5L L;  2EE1 A;  1IYU A;  2MNA A;  1EFW A;  4BBR H;  1WD0 A;  2E2J H;  3HOU H;  4JI5 Q;  1H9K A;  3KFU A;  1Z7T A;  4OX9 Q;  1KDC A;  1O80 A;  2IX3 A;  4GZY C;  3J7Z C;  3FKI G;  1STY A;  3J81 i;  3CCJ A;  1IZ6 A;  4DN4 M;  3NPP A;  2F0J A;  4J8Q A;  3URY A;  5JEA G;  1PH2 A;  5M5Y B;  3D6C A;  3S16 B;  3KF8 A;  4MTK A;  2JA9 A;  1SAP A;  2EXD A;  3EN2 A;  4B3R Q;  1QUQ B;  2AUJ D;  4DAM A;  3E0E A;  1UWV A;  3DXJ C;  1B53 A;  2PMZ B;  1VMP A;  1WCM H;  4QCL A;  5FJ8 G;  1Y1V B;  3K0X A;  4MIU A;  5G3L F;  2SOB A;  3UDI A;  1I6H B;  2RDG A;  4IJL A;  4XDX A;  5M3M H;  1OXU A;  2X69 A;  2K01 A;  4IJH A;  4DV0 L;  1SNQ A;  5C3X A;  4DR3 L;  1VQ4 A;  3NQI A;  1PRT B;  4QJF A;  4JI4 Q;  5LMN L;  3TME A;  2JN4 A;  1CT1 D;  2BOS A;  3GTO B;  4KKU A;  2E76 C;  4ZQ3 A;  5FLX L;  5C0X J;  3VDY A;  3NEL A;  2PNH A;  2EVB A;  3NBH B;  2NVQ B;  3TS0 A;  5LL6 S;  1EU4 A;  1ICW A;  3RLN A;  1XMQ Q;  4A93 G;  4PMC A;  4NXM Q;  3RNU A;  3PIP A;  1X55 A;  2Z6K C;  1Y1W H;  4JI3 Q;  3S1N H;  4C2M H;  5LMU Q;  4OO1 G;  5T1I A;  2OTJ A;  1S5B D;  1DOL A;  3J80 c;  3M4Q A;  4IPG A;  2KOL A;  1ROD A;  1PH3 A;  2UUA Q;  3H0G G;  5A2Q L;  1GD7 A;  1PH8 A;  4ZAI A;  2EPB A;  2OCE A;  3PCO B;  1C4Q A;  2OEO A;  5JJI A;  5C0X G;  1Q8K A;  3AB9 A;  2DNE A;  2RKS A;  4YIJ A;  2MFI A;  1S72 A;  3HFZ B;  3S1M B;  3A56 A;  2WAQ B;  3C46 A;  4HSP A;  3F1Z A;  4ZCK A;  3Q6S A;  3BZC A;  1TWH B;  4QMG A;  4R4C A;  1E0B A;  4JOI C;  4K5V A;  2WV6 D;  3I73 A;  3GTJ H;  2VQF Q;  2F0V A;  4AQY Q;  1CA5 A;  3GTL B;  1EY8 A;  3I4L A;  1PV4 A;  5CBA E;  3NWT A;  3J81 c;  4HMI A;  5COR A;  4A3F H;  2EZV A;  2RCF A;  1FJG Q;  4L5R C;  1WTH A;  3TBI B;  1PH7 A;  4K2L A;  1L1O C;  4OEL B;  2IHF A;  3ZYY X;  2K5Q A;  5IGD A;  4GKJ Q;  1AE3 A;  1TT2 A;  4BBR B;  3HOU B;  2E2J B;  3H09 A;  4YWM A;  2UUC L;  2Q2I A;  1XNQ Q;  4FXK C;  1TY2 A;  2CFM A;  3LNN A;  1UEA B;  3HOZ H;  2CCZ A;  4DR4 L;  3H91 A;  4ZYS A;  1LT5 D;  4HJ5 A;  1LTL A;  1BOS A;  2HIX A;  3S1R B;  1QZG A;  1MJE A;  4A76 A;  2JA7 H;  5C3E H;  3EIV A;  3S24 A;  3PV0 A;  5IP9 H;  1SE4 A;  3K59 A;  2MPM A;  1F9S A;  1X3Q A;  1SDF A;  3QOJ A;  3SHL A;  3R2I A;  4HAE A;  3IKJ A;  2RBM A;  1EL0 A;  4PZ7 A;  3VYS A;  1KD1 C;  1P8L A;  3G6E A;  4S3S A;  4OHJ A;  1KNE A;  2Z8L A;  4RKL A;  1A2T A;  5K5P A;  5M3M B;  3I4O A;  3GV3 A;  3FKI H;  1BNZ A;  5JEA H;  1ESR A;  2XVS A;  3QR8 A;  5EBC A;  1RF2 D;  3R2T A;  1XYI A;  4I7A A;  1ZYR D;  4JI2 Q;  1L1O B;  5EPJ A;  1LTR D;  3OWF A;  1HR0 W;  2N55 A;  4KY5 A;  2KHJ A;  4R4T A;  1UEB A;  1TQO A;  2Q8I B;  4MNO A;  3A7L A;  1HNW L;  2A19 A;  5M3F G;  5H1S E;  1C0A A;  3CC7 A;  1HUN A;  3T56 B;  5FJ8 H;  4KMU C;  1Y1W B;  3ERO A;  3HG9 A;  4JI6 L;  4LFA L;  3S1N B;  4C2M B;  3K5M A;  1C8C A;  3PUX A;  4IUT A;  1GUG A;  1TU2 B;  1AE2 A;  4TSS A;  2L4N A;  1EQR A;  1GJX A;  2WB1 B;  3AU7 A;  1HCZ A;  3K5O A;  3P75 A;  4B3M Q;  4O1N A;  1TWC H;  3G71 A;  1CI3 M;  4OWX B;  5CV8 A;  2A6H D;  5CMD A;  1HQR D;  1TR5 A;  1HFG A;  2J7Z A;  1IL2 A;  4JBK A;  2K5D A;  3KF6 B;  1EEF D;  4GNX B;  2C35 B;  4A93 H;  2D62 A;  3DWP A;  2VS1 A;  1T5E A;  1FGB D;  1QZH A;  4ZUJ A;  2EIF A;  3BG3 A;  2K52 A;  1S40 A;  1NE3 A;  4H02 A;  3GDE A;  2A5H A;  5AFW A;  4OO1 H;  3CF5 A;  1KLU D;  1PH1 A;  2FMM A;  3GTJ B;  2MUY A;  1I94 L;  1Y14 B;  2HUG A;  4JI0 Q;  4R8N A;  4A3D G;  1B70 B;  3A74 A;  3H0G H;  2B2Y A;  2LXJ A;  4AH6 A;  4A3F B;  3A5U A;  1PTO D;  1STH A;  5C0X H;  1DM0 B;  4DR1 L;  1CFM A;  1SLJ A;  3MC0 B;  4KHP Q;  2KUM A;  1IBK Q;  1DD2 A;  3KBG A;  2KCM A;  2F0D A;  1ZEQ X;  1KL9 A;  4YHH L;  4ODG A;  5ELF A;  3TRE A;  5EQ0 A;  1V1P A;  2D0P A;  2UXB L;  2ZTC A;  4DUY L;  1F2Z A;  1XJV A;  1IL8 A;  2X6L A;  1XPO A;  3HOZ B;  3D0F A;  2SDF A;  1NBW A;  4LF8 Q;  1JWU D;  4Y7N H;  2F0F A;  3DEP A;  3K5L A;  2JA7 B;  5C3E B;  1N32 Q;  5IYB G;  4X6A H;  3DM1 A;  2I07 B;  4X3T A;  4DV5 L;  1LTG D;  3G48 A;  5JVG 3;  4CGY B;  1XTD A;  2NBF A;  1TS3 A;  2K5N A;  1F2M A;  2VQE L;  4JYA Q;  2RCN A;  5D3I B;  4JI5 L;  3FKI B;  1YNJ C;  1XPR A;  3D31 A;  1LAC A;  4IUN A;  1TWG H;  1I5F A;  5BR8 Q;  4ID6 A;  3OMC A;  2NZO A;  5GAE C;  1JE5 A;  2GN5 A;  1F2L A;  4IO9 A;  4B3R L;  1YIT A;  2EYO A;  2B29 A;  4GOP C;  2XN9 C;  1LTT D;  5C6A A;  2KCC A;  1VQF A;  4RKB A;  4DNT B;  1TS2 A;  2RVL A;  4KY6 A;  2ZXO A;  3IFD A;  1S5E D;  2BDO A;  2L1B A;  1PVO A;  3CAM A;  4NKL A;  4LF9 L;  1A6X A;  1TWC B;  2FMC A;  1EWC A;  5KGU A;  2HQE A;  2PI2 E;  2EYL A;  3VA7 A;  4K8J A;  1YI2 A;  3RMH A;  1JOO A;  2Z0S A;  1IBM L;  4A93 B;  1TXY A;  1SE8 A;  1GO3 E;  4G57 A;  4YCV A;  5M3F H;  1HFN A;  1HR0 L;  4O0A A;  2KEC A;  5KNB A;  2A6E D;  5E4X A;  2QEX A;  5CBE E;  1YBY A;  1HZA A;  1MD2 D;  3TZU A;  1A63 A;  1EWI A;  4ABN A;  3UDG A;  1VQK A;  3KLW A;  3BDC A;  1LAB A;  1T5X D;  4FVM A;  4U68 A;  3TQY A;  4B3T L;  2CQA A;  4RGO S;  3H0G B;  1RTO A;  1Y8O B;  4BA2 I;  4KN4 C;  4GOP B;  1OXV A;  4I65 A;  2M9V A;  1E1T A;  3D4R A;  1BVS A;  3RZO H;  1JQY D;  2JA5 G;  3M9B A;  4H13 C;  4LUZ A;  2I46 A;  1QJO A;  2EOT A;  5CR3 A;  1VQL A;  4GLX A;  1VF5 C;  2WAQ G;  2UXC Q;  4F8M A;  1AH9 A;  2ZT9 C;  4LF4 Q;  1BCP D;  4LFC L;  3CCQ A;  2L9H A;  2QF7 A;  3GQB A;  1B3Q A;  5C3W A;  4LNQ A;  4Y7N B;  3BZK A;  3HEJ A;  2JSO A;  1E24 A;  3LWU A;  1BF4 A;  4A3D H;  4IQZ A;  4DR5 L;  2VB2 X;  1VQH A;  4AQY L;  5IT9 E;  1SND A;  5KRU A;  1HNZ Q;  3M85 A;  3KUP A;  4DV6 L;  2XWB B;  1Q90 A;  4EX5 A;  2AKW B;  1X54 A;  3BVM A;  2Y0S G;  2KQ3 A;  1FGU A;  2F0N A;  1MSG A;  1WTV A;  5I9P A;  3AQQ A;  1FJG L;  2EYH A;  3I90 A;  2EY6 A;  4GKJ L;  4KHV A;  1GHK A;  3GTQ H;  1HRJ A;  1XNQ L;  3BVG A;  3DLL A;  4KLK A;  2E2D C;  1R9T H;  2ZTD A;  2E74 C;  1TWG B;  3EA6 A;  2DNC A;  3PGZ A;  3RLO A;  2GVA A;  2B2U A;  4C3J G;  4DNI A;  5IYB H;  1BBW A;  3NE5 B;  1TS4 A;  4DV1 L;  1V43 A;  2AHO B;  2GA4 B;  4ALP A;  2K5H A;  3E5S A;  4LJZ C;  1VQN A;  4DAP A;  3MXN B;  2XSC A;  2F0Q A;  4JCV E;  2EYJ A;  3SK6 A;  4NXN Q;  3F2C A;  4LF6 L;  3A55 A;  3QJY A;  4G4K A;  2UU9 Q;  1E7Z A;  4DAY B;  2B2W A;  3A7A B;  3TN2 A;  5M3M G;  4CJ0 B;  1U5K A;  3ONA B;  2K4K A;  3S16 H;  1W6K A;  1ZKO A;  1VQC A;  1G6Z A;  1H9J A;  4X3S A;  1AEX A;  1MJC A;  1VQO A;  3PIO 3;  1X3G A;  5IIF A;  3J81 j;  5M3F B;  4A75 A;  1IYJ B;  4OO1 I;  3AEV A;  4A3C G;  3SEB A;  4ZKB B;  2F0M A;  4GLV B;  1Q46 A;  3SXH A;  1FD7 D;  2XRQ D;  2RHS B;  2KED A;  4IFD G;  1CKN B;  4LF5 Q;  1Q1E A;  3WOE A;  1Y1W G;  3Q23 A;  3G7L A;  2K7V A;  2D2C C;  5C0X I;  4N8X 1;  5IGB A;  1BQQ T;  3STB C;  4XTC S;  3OYY A;  1IBL L;  1A62 A;  4HSV A;  2WB1 G;  1YNX A;  2HT1 A;  1SJH D;  3MHB A;  3RZO B;  4HJ9 A;  1E1O A;  1H9S A;  1WTQ A;  1LLR D;  2XNA C;  2ICE C;  2A1A A;  4IPD A;  4B3M L;  1GVP A;  2KJX A;  1PTO F;  3MFY A;  3SDZ A;  5FKA C;  1PTO H;  3NWS A;  3PF5 A;  2AQ3 B;  3AFQ A;  5C5M A;  1U4R A;  3QG1 A;  2VY3 A;  1ZYR C;  2NYZ D;  4P75 A;  1GUN A;  4YY3 L;  5JAV A;  2WAQ E;  5E7N A;  5GAH C;  4POG A;  1LV9 A;  2K32 A;  4FF3 A;  1YHA A;  4A3D B;  4MHE A;  3PSI A;  2AMC B;  4LK1 C;  5I6W A;  2Y0S E;  1JOQ A;  1N36 Q;  1KAB A;  2IJ0 A;  2PW7 A;  1IXR A;  3MAQ A;  5IGF A;  2JA5 H;  3J7A 5;  1XTC D;  3A5Z B;  3HOW H;  5HGT A;  1HJP A;  1VQA A;  3PMF A;  5FO7 B;  5DEH A;  5AJ3 Q;  1Y8N B;  1W3S A;  1I4X A;  3GTQ B;  4WOR A;  2A6H C;  1QCB D;  4DV4 Q;  3UI2 A;  1R9T B;  4PQX A;  2YTV A;  5DAU A;  3OTO Q;  3WDN A;  4G7O C;  3R3O A;  4KD4 A;  3T51 B;  1CM9 A;  1F2Y A;  4N9P A;  2L11 A;  1ET6 A;  4TRD A;  2K5V A;  2MP1 A;  3H3V H;  2KHS A;  2G9D A;  4LUO A;  3GTP H;  4O2D A;  4F87 A;  1HTP A;  1U0L A;  2EJM A;  3U4Z A;  4NW2 A;  1QNU A;  2K50 A;  2VZA A;  4XYO A;  4ZRZ A;  1A0I A;  3OHX C;  1VQB A;  1X3E A;  2IHE A;  1PTO C;  4Y52 H;  1EIH A;  4DV3 Q;  4NMZ A;  4RGT A;  2HHH Q;  2NTS A;  4DGZ A;  4IPH A;  4C3J H;  3Q22 A;  5EJW A;  2B2V A;  3S1R H;  4EVO A;  4WJW A;  2DN8 A;  3E6Z X;  2R92 G;  5BN3 A;  1FL0 A;  4DFA A;  4ME5 A;  1TII D;  3TRZ A;  1SMY D;  2MHV A;  4N9T A;  1KAA A;  4DR6 Q;  1UUP A;  4KD3 A;  2MQH A;  3IFT A;  1PYB A;  5GRO A;  2OQ0 A;  3J7Y W;  1TKW B;  3S14 H;  3VYR A;  1JMC A;  1JWS D;  1GHJ A;  2UXD L;  2FJ2 A;  2WB1 E;  4K6D A;  5CV9 A;  4KN7 C;  5CGK A;  2CHB D;  1AZP A;  5E1F A;  4A4I A;  3M4Y A;  4UDU C;  5GAG C;  1DJR D;  1VF7 A;  2GVB A;  4LAA A;  1XPU A;  1FNW A;  1HNX L;  2PO4 A;  2F1M A;  5EKK A;  1PTO B;  3Q0A A;  3T1H Q;  4A3C H;  3H3V C;  4HIK A;  2M2L A;  3CCU A;  3W2D A;  2CQO A;  4IFD H;  1PMR A;  2A74 C;  1TWF H;  4FXG C;  2NVX H;  2CWP A;  3WWV A;  2KA7 A;  3DEO A;  5FO8 B;  2WAC A;  4M8A A;  1PH5 A;  1LTI D;  3CCS A;  4U67 3;  1B4O A;  4CDE C;  3DWA A;  1KIX A;  2JA5 B;  3TSS A;  3J7A F;  4RHR A;  3U9O A;  3HOW B;  1MI2 A;  2G5D A;  4OON A;  3RUZ A;  5M5W H;  3BU2 A;  1N34 Q;  1ICF B;  4JBW A;  2NZH A;  1EQV A;  3K8A A;  2ATW A;  2UXC L;  1EYD A;  5I4D A;  2LMC B;  2QGQ A;  4LF4 L;  1II3 A;  2F0W A;  3FEW X;  1SJE D;  2A6E C;  2K75 A;  4XXE A;  5I2X A;  4PMW A;  2G9H D;  1Z47 A;  2RSN A;  1NR2 A;  3VR6 A;  1BR9 A;  1HNZ L;  2Y0S B;  2WKD A;  2AWN A;  3MEF A;  2O5I C;  1QIL A;  3GTP B;  2MO0 A;  2H1E A;  3SVM A;  4WFN 3;  4G7H C;  3VA5 A;  3SE0 A;  4M1U B;  4FP5 D;  2XRS D;  4DF7 A;  1K28 A;  5FLX E;  4ZKC B;  2X6G A;  3KJO A;  2I0Q A;  3VR5 A;  3BDL A;  3JAM L;  4DV2 Q;  1XMO Q;  3NBH A;  3PIO A;  2R7F A;  4IAL A;  1K0S A;  4O42 A;  5BN5 A;  2IWH A;  3P7J A;  1STB A;  3NSW A;  3CCE A;  2B2Y C;  4JI8 Q;  3KLR A;  1EOT A;  3CPF A;  4NP5 A;  4C3J B;  4MN3 A;  1O7Y A;  2A68 D;  4RA8 A;  2PQA A;  2ZJQ A;  2LS0 1;  3A8J E;  4LFB Q;  1SEB D;  4HED A;  1K8M A;  5ELN A;  5A2Q E;  3KDF B;  2BCO A;  1TY0 A;  2Q2T A;  5GQO A;  4C3H G;  3CKI B;  4X65 Q;  1XNR Q;  4WJ4 A;  3L7Z C;  4X64 Q;  2WIN B;  3D8G A;  1B1Z A;  3PUV A;  3RLF A;  5I6Y A;  1X3F A;  4K5X A;  4OGQ C;  3S14 B;  1C7Y A;  1W6J A;  1X9N A;  2UU9 L;  1DOK A;  3T4A C;  1PYW D;  1ZXT A;  5IT9 c;  1SNM A;  5IWA Q;  1KRT A;  4RG1 A;  1GM5 A;  1B50 A;  5KND A;  4LUV A;  3M4P A;  4K5W A;  2F0P A;  2K05 A;  1A2U A;  4CKC A;  3I4M H;  3K7U C;  2R92 H;  1WTW A;  4KY7 A;  2ZM6 Q;  1O7L A;  4CJ1 B;  3N6R A;  1L0X B;  2F0E A;  1HUM A;  4L6T B;  1TWF B;  1QVF A;  4RH6 A;  4LF5 L;  1XX8 A;  4OEM B;  3JAM E;  4QB4 A;  2NVX B;  2RDF A;  4B3S Q;  3MA2 B;  3VYT A;  4R8I A;  1EY5 A;  1V1P B;  1M8A A;  4LWC A;  3PF4 A;  2I5L X;  3S1Q H;  1ILP A;  1RKN A;  4JG2 A;  1K0R A;  5J1Z A;  3PUZ A;  3K58 A;  2YU9 H;  1A15 A;  5M5W B;  1YNN D;  3H6M A;  2F4V Q;  5JJZ A;  1JJC B;  1SYD A;  2F3V A;  3MEH A;  3PQI A;  3CCV A;  3M4O H;  3E0J A;  1EFI D;  1PFS A;  1K3R A;  3BJU A;  2B2T A;  1PZK D;  3K7A H;  2OWO A;  3TP7 A;  4EQN A;  4GKK Q;  1YHQ A;  5JJK A;  3QB3 A;  3H3V I;  3GTK H;  1U9R A;  2N78 A;  1N9W A;  4JI7 L;  1LT4 D;  1OXS C;  3ICE A;  1IW7 D;  2QCP X;  4KJN A;  1DYQ A;  5FLM G;  2IPK D;  1HQM C;  2L55 A;  1PRT D;  3J80 L;  5D3D A;  1UNS A;  3X3N A;  2Q2U A;  4HJ7 A;  2V4D A;  2E2I H;  5AJ3 L;  1HH2 P;  4EQ5 A;  4P74 A;  3AYH B;  2JA8 G;  3ERS X;  1DCZ A;  3RZD H;  4DV4 L;  1F77 A;  3A0J A;  3CPW A;  1RL2 A;  2R6G A;  5ELD A;  3OTO L;  3I56 A;  3R8B A;  3O13 A;  1X56 A;  5C4X H;  1K8A C;  2HCI A;  4BBS G;  1RTN A;  1EIG A;  3CMA A;  3NUC A;  1QOH A;  4K0K L;  1HPC A;  5I9O A;  4P2C B;  1I50 H;  1R4P B;  1N8R C;  2JA6 G;  3U58 A;  4LF7 Q;  4IUQ A;  4GNX A;  3J81 L;  1H95 A;  3TZD A;  2F0O A;  1YJ9 A;  1EQQ A;  4OX9 L;  4RFB A;  1VQ6 A;  1NJI C;  1AN8 A;  4DV3 L;  4FF2 A;  4OXP A;  2QKI C;  1CUK A;  3I7F A;  4JC0 A;  2RA4 A;  2XWJ B;  1N33 Q;  1WTR A;  1LYL A;  1VDZ A;  4CDF C;  3I4M B;  2R92 B;  4IFD I;  2CWA A;  2KHI A;  3CXC A;  5DM7 3;  4C3H H;  3HOV H;  4N8F A;  1PH4 A;  3HRZ C;  1TVX A;  2D5D A;  1CZW A;  4YWK A;  4F88 A;  4Q5V A;  4DR6 L;  2Q8R E;  1SE3 A;  2WKC A;  3T1Y Q;  1G51 A;  4UAI A;  3HOX G;  5IP7 H;  2YYZ A;  1Y8P B;  3OSO A;  2RHQ B;  1CTM A;  1MKH A;  3SGI A;  1A3T A;  4JI4 L;  3S1Q B;  3GD7 A;  4BXX G;  1D1I A;  1E22 A;  2YU9 B;  4BY7 G;  3FP9 A;  1U4L A;  1D6E C;  4HN7 A;  3M4O B;  1PDQ A;  4A3E G;  3ND8 A;  1B44 D;  4DR3 Q;  3V2T A;  3P20 A;  1XMQ L;  2B2W C;  2ICI A;  4NXM L;  5IE8 A;  1F9P A;  1K8O A;  2Q8T A;  3K7A B;  1SYC A;  4A3G G;  3D4D A;  1BXT A;  1SMY C;  4JI3 L;  5LMU L;  1L0W A;  3GTK B;  4EQO A;  4A3L G;  1VQG A;  2R61 A;  5EPK A;  3TDQ A;  5C4J H;  2UUA L;  1S5D D;  3K57 A;  1F9R A;  1QG7 A;  1ML0 D;  1CQV A;  1KDA A;  1RCV D;  4IUR A;  3LGJ A;  3HOW G;  2E2I B;  1N34 L;  4X3K A;  2R3Z A;  4ZUI A;  1HXY D;  1XXG A;  3RZD B;  4IZ8 A;  4OWT B;  4K8I A;  2O4X A;  3I4N G;  2VQF L;  5C4X B;  2DGY A;  2V1C C;  4JBM A;  1SSO A;  3ULJ A;  1AFP A;  1D1K A;  4E6I A;  3GP7 A;  1SFO H;  3HOY B;  2NWG A;  1B7Y B;  1STN A;  5FLM H;  3I55 A;  1G2T A;  4H44 C;  1I50 B;  4KJO A;  1KTK A;  4A3B G;  3CRK C;  3V05 A;  1VQ9 A;  5LHY 1;  4DK1 A;  1L2F A;  2K33 A;  1YJW A;  4YWL A;  3SK8 A;  2BH2 A;  1GXD C;  4DV2 L;  4TVA B;  1XMO L;  3BYT B;  5COY A;  2JA8 H;  3UE0 A;  3W3A A;  4UY8 C;  5J3B A;  4BBS H;  2JYO A;  1E2W A;  4HIO A;  3C1E A;  4IUU A;  3K81 C;  2H5X A;  2UUC Q;  2K14 A;  1JWM D;  3CC4 A;  4LFB L;  4HR7 B;  4C3H B;  3HOV B;  4DR4 Q;  1B9N A;  1Q8I A;  4C1N K;  2JA6 H;  1HZ9 A;  4X65 L;  1PA6 A;  2Z6B A;  2PZT A;  1E2Z A;  4GN3 B;  1H9S B;  4C3I B;  3MVV A;  3K0Y A;  1RJT A;  1EY6 A;  1O7I A;  2SEB D;  1YZ6 A;  1QB5 D;  5JPM C;  5IYC G;  3W1G A;  2EXZ A;  4DXF A;  3PUW A;  3NXW A;  1C9O A;  3UDX A;  5HGQ A;  4JI2 L;  1VQJ A;  1D5Z C;  1EZ8 A;  2KVM A;  3OWE B;  4POF A;  1SMX A;  5FLX c;  3NTH A;  1I4R A;  1I3Q H;  2ZM6 L;  1B2T A;  1CZG A;  1NMF A;  2K28 A;  3FRP B;  2A68 C;  5JVH 3;  1UAP A;  1VS0 A;  1B8A A;  2F4I A;  1AZQ A;  4KK7 A;  3WOF A;  3HOX H;  3R93 A;  1ENA A;  1VQI A;  2ID0 A;  2FFK B;  4YCU A;  1SNP A;  4B3S L;  3S17 H;  3LWE A;  4ZK9 B;  2AUK A;  3CW2 C;  4H7B A;  1HNW Q;  5C4J B;  1PH6 A;  4BXX H;  3NHH A;  5HY6 A;  2F0L A;  4BY7 H;  1DOM A;  3CP0 A;  4UP9 A;  2NZ1 D;  4JI6 Q;  4LFA Q;  1Y69 U;  2ZXR A;  1EY0 A;  2CW0 D;  2EY1 A;  4A3E H;  1HHV A;  5ELB A;  2MGS A;  3MXN A;  3HGB A;  4P71 A;  4ZLT F;  3ULP A;  2M00 A;  4A3G H;  1Q82 C;  5M5X H;  2DY8 A;  2YTY A;  1UE6 A;  2K03 A;  2B63 H;  1K9M C;  3NEM A;  4MZ9 A;  1KAW A;  1STG A;  4DUZ Q;  4A3L H;  3S2H B;  1KHI A;  4JI0 L;  1M1K C;  3IRB A;  4JPB W;  4DU9 A;  3CCM A;  1VQP A;  4RCN A;  2MJ8 A;  1SFO B;  3NTI A;  1VCI A;  3HZX A;  4A3K G;  5KYL A;  4KHP L;  1BKB A;  1IBK L;  1D5X C;  3Q24 A;  4NB3 A;  1M90 C;  4QF4 A;  1I94 Q;  3KF8 B;  2F03 A;  5IGC A;  1Z6H A;  1KC8 C;  5EBD A;  1SYB A;  2ALY B;  3JAM c;  4L5S A;  2JA8 B;  3F2B A;  1QNK A;  1YNN C;  4RGN A;  2PQE A;  5IYD G;  3PO2 G;  1WVL A;  4LF8 L;  4DA2 A;  1CKN A;  3I4N H;  4DNR B;  4BBS B;  2IX0 A;  1SRO A;  1Q7Y C;  1TS5 A;  1N32 L;  1PLF A;  1VQD A;  2UXB Q;  1SBB B;  5CC4 A;  2JP1 A;  3RR5 A;  1EY7 A;  3ITP A;  2WFW A;  4C1N I;  4A3B H;  1WYD A;  2UUB Q;  2JA6 B;  1MBY A;  2A69 D;  1JCK B;  1CSQ A;  2PI2 A;  3C2P A;  3TS2 A;  3K80 C;  2L15 A;  2JQO A;  1EQT A;  2AQ2 B;  5GAD C;  1A8V A;  3PO3 G;  1KRS A;  2TMP A;  4JYA L;  1OXT A;  1WI5 A;  2P5Z X;  2R7D A;  1X32 A;  3VR2 A;  2R7Z H;  3A8I E;  2KCN A;  1LT6 D;  4OIJ A;  1I4H A;  5ELE A;  1I4G A;  5C5L A;  1D7Q A;  3D6W A;  5BR8 L;  1EYA A;  1N33 L;  1V1Q A;  4X62 Q;  3OW2 A;  3I4M G;  3U50 C;  1I3Q B;  3K5N A;  3F2U A;  1KQS A;  2OXP A;  4A3M H;  4R1J A;  1YJN A;  1Z9F A;  1SE2 A;  3OW7 A;  3ULL A;  1E2V A;  3HOX B;  1MIU A;  3CD6 A;  5D14 A;  3T1Y L;  2N8N A;  1WTX A;  4QUC A;  2HIV A;  4XYQ A;  3S17 B;  1DZ1 A;  3DM3 A;  3NQT A;  5JJL A;  3I3C A;  1JOR A;  3L2P A;  4DR7 Q;  2LY7 A;  5IYC H;  4BY7 B;  5J39 A;  5K36 G;  3PUY A;  4X66 Q;  4FYD A;  4ME3 A;  2B8G A;  4A3E B;  3NEN A;  1HZC A;  3ER0 A;  2VW9 A;  4A3I G;  4LF9 Q;  1EY4 A;  4A3G B;  5EGT A;  3MXG A;  2Q2H A;  5KIX A;  5M5X B;  1H9R A;  3D3R A;  1BCP F;  2B63 B;  1J8I A;  1UE1 A;  1STA A;  2RQX A;  4A3J H;  3KYH C;  1WD1 A;  1RHP A;  4CJ2 C;  2OT2 A;  1IBM Q;  2A8V A;  5FO9 B;  3J7A V;  2N88 A;  3AMU A;  1HR0 Q;  2QA4 A;  2NUC A;  5T1G A;  1EYC A;  2JXM B;  1VQ8 A;  3KJP A;  4GLA C;  2IY5 B;  1NCV A;  1YVC A;  3MWY W;  3HKZ G;  1QUQ A;  4JBJ A;  2PQA B;  4PG3 A;  1NTG A;  4B3T Q;  4V0B A;  1MHW C;  3CHB D;  1V1O A;  2CVR A;  2PYK A;  4GN4 B;  1EY9 A;  2RSO A;  4UP8 A;  1HA5 A;  3I4N B;  3RN5 A;  4YCW A;  4BY1 B;  5KNC A;  1JT8 A;  1ASZ A;  1S5F D;  1NR4 A;  4MTN A;  4NDX A;  1K73 C;  3ND9 A;  5C4X G;  1XWE A;  5EPL A;  1LTA D;  3H94 A;  3N52 A;  5KEE A;  1J5E Q;  4QQB X;  4L63 B;  3HOY G;  2H4O A;  4A3B B;  4IPC A;  3CME A;  3NP8 A;  4A3K H;  1LTB D;  4LFC Q;  1QVG A;  2B2T C;  2K1B A;  2AQ1 B;  2IL8 A;  4DR5 Q;  4XT1 B;  4HJ8 A;  4DV6 Q;  4XQN A;  1BUV T;  3P1H A;  4FDB A;  2R7Z B;  1BDO A;  4WJ3 M;  5IYD H;  3PO2 H;  4DPG A;  2VXW A;  2N49 A;  3CRL C;  4L8J A;  2KCT A;  1A3V A;  3EBE A;  5C44 G;  1CK1 A;  3ERQ A;  5E3F A;  1BCP C;  4K14 A;  3OIP A;  1V9P A;  3C1F A;  3HS0 C;  1GUW A;  1G6P A;  1MSH A;  2J4X A;  1KXL A;  4A3M B;  3HOV G;  2LKV A;  1JB3 A;  3OIQ A;  3DMU A;  1SNC A;  1D5M C;  5DNF A;  3BVZ A;  1WFQ A;  4NXN L;  1FVI A;  4Z9C B;  4L5Q A;  4OL7 A;  5C4H A;  3PO3 H;  3MXP A;  2EYF A;  4PV1 C;  2E2H H;  1Q81 C;  1EZ6 A;  2DJG C;  2DUD A;  4C3I G;  3U4V A;  4XT3 B;  5IP7 G;  4DV1 Q;  3S15 H;  3ZJY C;  1O78 A;  3H15 A;  1CHP D;  3M3Y H;  1E3P A;  1OO9 B;  1WOC A;  1SNO A;  4KHZ A;  5EKI A;  1KDB A;  2E8G A;  3Q8D A;  5DLQ E;  1AW7 A;  1EUJ A;  4KKS A;  5IOC A;  5DM6 3;  4OWW B;  1NUC A;  4OIK A;  1J6Q A;  1QVC A;  3M7N A;  3TP8 A;  4LF6 Q;  3STB D;  2D9U A;  1Q3L A;  1WCM B;  2NN6 G;  1GOZ A;  4CKE A;  4GNX C;  4F7X A;  2YTX A;  3MXU A;  1UE5 A;  4CKB A;  2Z6K A;  1F9Q A;  2PNR C;  1LM0 A;  2L12 A;  2NVT H;  2DY7 A;  3OMG A;  2Z4I A;  5ELO A;  3I2Z A;  3OOC A;  1GUO A;  3I91 A;  3TP5 A;  4IUP A;  1BCP B;  4A3J B;  3KBX A;  3TEH B;  2O5J C;  5F2D A;  1G2S A;  3FHW A;  1DGS A;  2R93 G;  2BE5 D;  4HMJ A;  5K36 H;  2K04 A;  3X3M A;  3T13 A;  1G8Z D;  4UP7 A;  1JE4 A;  1P16 A;  5KYI A;  3HKZ E;  2EYM A;  1PFM A;  4JVZ A;  3S2D H;  3NTK A;  3FMC A;  2QIL A;  3KDF A;  2HQL A;  4A3I H;  1IBL Q;  1A3U A;  1ENF A;  4DAV A;  5CV4 A;  2WP8 J;  1S5C D;  1QWY A;  4JOI A;  4EQP A;  4DV7 Q;  3GV6 A;  5BN4 A;  1CQF A;  3E9I A;  2B8F A;  1B9M A;  5FOB B;  4DUZ L;  2OQK A;  5J22 A;  4YY3 Q;  1EOV A;  4JV5 Q;  1G29 1;  3CCR A;  4G7Z C;  2VUM G;  4A3K B;  1L1O A;  1N36 L;  4LMQ D;  2K5W A;  1S3O A;  3F2D A;  1B3A A;  2SNS A;  2QEJ C;  3CQZ H;  1PXU A;  1U4P A;  1EEI D;  2RDH A;  3UDF A;  3SK4 A;  3A54 A;  1CSP A;  3QOL A;  1WTO A;  1DXM A;  3LX0 A;  4APV A;  2CH4 A;  1IHZ A;  3GTG H;  3PO2 B;  2C9O A;  3E9H A;  2CW0 C;  2Z4H A;  4AYB G;  2KBN A;  4QY7 A;  3M7G A;  4FNF A;  2QDL A;  1VQ5 A;  2EY2 A;  3I8Z A;  1YEZ A;  4DXG A;  3S9W A;  2XIW A;  2EY5 A;  1BBU A;  1OXX K;  2B3G A;  1SR3 A;  4R9W A;  4DR2 Q;  3HOY H;  1K3B C;  1HA6 A;  3NK9 A;  5JOB A;  3KOJ A;  2UUB L;  3BYY B;  3QO2 A;  1JIC A;  3FVQ A;  3KF6 A;  3PO3 B;  4V19 0;  3KK7 A;  2E2H B;  1JJG A;  3L9A X;  4CBV A;  3BZD B;  2KEE A;  4PZ6 A;  1JR0 D;  3S15 B;  1FR3 A;  1L0Y B;  4J15 A;  3M3Y B;  1JC7 A;  2NVY H;  2HHH L;  5C44 H;  5ISR A;  1I4P A;  4ILW A;  4B9W A;  4HCE A;  3I70 A;  4JI1 Q;  3W1B A;  2E5L Q;  4XIG S;  4HIM A;  1ENC A;  1K83 H;  2F3I A;  2IX1 A;  3NBI A;  2D0O A;  4FF4 A;  1EU3 A;  1Q86 C;  3IL8 A;  2OTL A;  2JEB I;  4X62 L;  3EVQ A;  2SNM A;  3RD4 A;  4DK3 C;  1JOK A;  4HCS A;  4IOA A;  1BO0 A;  3L0O A;  3FPP A;  3HP3 A;  2NVT B;  2FXQ A;  4IOC A;  5IGG A;  3QWN A;  4BS9 A;  4C3I H;  3J80 E;  2IT1 A;  3FPU B;  2B2U C;  2A69 C;  4QUF A;  2XGT A;  2ZXP A;  1VQM A;  1M4V A;  1AP0 A;  1FNU A;  4R4O A;  4FXD A;  4RHS A; 
#chains in the Genus database with same CATH homology
 2OF1 A;  5IGE A;  1R4Q B;  4BWG B;  1PZI D;  4XQJ A;  3VR3 A;  1NSN S;  2NN6 H;  1RD9 D;  1SYF A;  4BA1 I;  4RAU C;  1KNA A;  3S2D B;  2F0S A;  4TKO B;  2IW3 A;  5IT9 L;  4A3I B;  1ET9 A;  2O2L D;  2PZW A;  3EJI A;  4KV6 A;  1Q12 A;  3J81 E;  1EWH A;  2PCF B;  5CV7 A;  5E4W C;  2F0H A;  1J9O A;  4J1M A;  3CU7 A;  1SXT A;  5G3L D;  1LO5 D;  3HKZ B;  3CQZ B;  3MTS A;  4EGV A;  2NB0 A;  4KI0 A;  5ELC A;  4PMB A;  2F0G A;  5CV6 A;  5I2Y A;  3GTG B;  2HCC A;  2E75 C;  3DHQ A;  2ENB A;  2BA0 A;  4KTA A;  2B39 A;  1GUT A;  4HTH A;  4DK0 A;  1IYV A;  1IKL A;  1S4Z A;  2PPB C;  3GO5 A;  4H0L C;  2A73 B;  1ONL A;  2AWO A;  3DWQ A;  1IKM A;  1NAP A;  1ILQ A;  4IN3 A;  2NVY B;  1KLG D;  1PZJ D;  5C44 B;  5A35 A;  3K6O A;  3PIP 3;  1O7Z A;  5EKL A;  1K83 B;  2PZU A;  1CA6 A;  1H9M A;  2J0T D;  5HUR A;  5IOD A;  2C5C A;  3FDT A;  4J6H A;  3SK5 A;  2BA1 A;  2F3W A;  1WTP A;  1GUS A;  3KLS X;  2L5T A;  2Z1C A;  3TP6 A;  2HDM A;  1VMC A;  1BBX C;  2FIN B;  5FK9 C;  2VB3 X;  3T16 A;  3SR1 A;  4K6L A;  2BDN A;  1TWA B;  3A8K E;  2EDG A;  5C4Z A;  3OPO A;  4IFD J;  2EYP A;  1G91 A;  4RGM A;  1CHQ D;  1FNV A;  2K6A A;  1SYG A;  1X3P A;  4JK1 C;  1PFB A;  1DON A;  2B2V C;  2F0T A;  5CV5 A;  4B08 A;  4I7Z C;  2JEA I;  2R93 B;  3VYU A;  3BS1 A;  2F0U A;  5TSS A;  2VNU D;  4QIW B;  4WRD A;  2WII B;  2EJG C;  4KKT A;  1PRT F;  3MFG A;  1ESF A;  3T53 B;  1FYC A;  5JPN C;  2NTT A;  4CHT B;  1STE A;  3IAY A;  1QE6 A;  4RWS C;  4DAY A;  5NUC A;  5D65 A;  1HTL D;  3G6J B;  5CYU A;  1LTS D;  2VUM B;  3BDO A;  4Q0F A;  3GTM B;  4PNY A;  3U9S A;  3I72 A;  3EQL C;  1U4M A;  3D4W A;  2BE5 C;  1Q1B A;  4FF1 A;  1PFN A;  3V96 A;  2L0C A;  4AYB B;  1SYE A;  3MZ5 A;  1V8Q A;  1RDP D;  1I4Q A;  3VR4 A;  3EFX D;  1YNJ D;  2PW5 A;  4XQQ A;  4B9X A;  2QDB A;  2EJF C;  3QIA A;  2F0K A;  2TSS A;  4ULL A;  5LL6 X;  4K2K A;  4IUV A;  2JE6 I;  1I6V C;  3KLS A;  3C3L A;  4RCO A;  1IW7 C;  5JEA J;  4C56 C;  1C48 A;  2FHT A;  4X3U A;  2F0I A;  1D2B A;  2NN6 I;  1PRT C;  1LT3 D;  2LFN A;  1MGS A;  3L3O C;  4TQU S;  4FO2 A;  3DUZ A;  5M9O A;  2HDL A;  2EE1 A;  1IYU A;  1WD0 A;  1H9K A;  1Z7T A;  1KDC A;  1O80 A;  2IX3 A;  4GZY C;  1STY A;  4DN4 M;  3NPP A;  2F0J A;  4J8Q A;  3URY A;  5JEA G;  5M5Y B;  3D6C A;  3S16 B;  3KF8 A;  1SAP A;  2AUJ D;  3DXJ C;  1B53 A;  2PMZ B;  1VMP A;  4QCL A;  1Y1V B;  4MIU A;  5G3L F;  2SOB A;  1I6H B;  2RDG A;  4XDX A;  1OXU A;  2X69 A;  2K01 A;  1SNQ A;  5C3X A;  3NQI A;  1PRT B;  3TME A;  1CT1 D;  2BOS A;  3GTO B;  4KKU A;  2E76 C;  4ZQ3 A;  5FLX L;  5C0X J;  2EVB A;  2NVQ B;  5LL6 S;  1EU4 A;  1ICW A;  4PMC A;  4OO1 G;  5T1I A;  1S5B D;  1DOL A;  2KOL A;  1ROD A;  5A2Q L;  4ZAI A;  2EPB A;  1C4Q A;  2OEO A;  5C0X G;  3AB9 A;  2DNE A;  2RKS A;  4YIJ A;  3S1M B;  3A56 A;  2WAQ B;  3C46 A;  4HSP A;  3Q6S A;  1TWH B;  4QMG A;  1E0B A;  4K5V A;  2WV6 D;  3I73 A;  2F0V A;  1CA5 A;  3GTL B;  1EY8 A;  3I4L A;  5CBA E;  3NWT A;  4HMI A;  5COR A;  2EZV A;  3TBI B;  4K2L A;  3ZYY X;  2K5Q A;  5IGD A;  1TT2 A;  4BBR B;  3HOU B;  2E2J B;  3H09 A;  4FXK C;  1TY2 A;  3LNN A;  1UEA B;  3H91 A;  4ZYS A;  1LT5 D;  1BOS A;  3S1R B;  3PV0 A;  3K59 A;  1SE4 A;  2MPM A;  1F9S A;  1X3Q A;  1SDF A;  3QOJ A;  3SHL A;  3R2I A;  4HAE A;  3IKJ A;  2RBM A;  1EL0 A;  3VYS A;  4S3S A;  4OHJ A;  1KNE A;  2Z8L A;  4RKL A;  1A2T A;  5K5P A;  5M3M B;  3GV3 A;  1BNZ A;  5JEA H;  1ESR A;  2XVS A;  5EBC A;  1RF2 D;  3R2T A;  1XYI A;  1ZYR D;  5EPJ A;  1LTR D;  3OWF A;  2N55 A;  4KY5 A;  1TQO A;  2Q8I B;  3A7L A;  1HUN A;  3T56 B;  4KMU C;  1Y1W B;  3ERO A;  3HG9 A;  3S1N B;  4C2M B;  3K5M A;  1C8C A;  3PUX A;  4IUT A;  1GUG A;  1TU2 B;  4TSS A;  2L4N A;  1GJX A;  2WB1 B;  3AU7 A;  1HCZ A;  3K5O A;  3P75 A;  4O1N A;  1CI3 M;  5CV8 A;  2A6H D;  5CMD A;  1HQR D;  1TR5 A;  1HFG A;  2J7Z A;  2K5D A;  1EEF D;  2D62 A;  3DWP A;  1T5E A;  1FGB D;  4ZUJ A;  3BG3 A;  2A5H A;  5AFW A;  4OO1 H;  1KLU D;  2FMM A;  3GTJ B;  2MUY A;  2HUG A;  4R8N A;  2B2Y A;  4A3F B;  1PTO D;  1STH A;  5C0X H;  1DM0 B;  1CFM A;  3MC0 B;  2KUM A;  1DD2 A;  3KBG A;  2F0D A;  1ZEQ X;  4ODG A;  5ELF A;  5EQ0 A;  1V1P A;  1F2Z A;  1IL8 A;  2X6L A;  3HOZ B;  2SDF A;  1JWU D;  2F0F A;  3DEP A;  3K5L A;  2JA7 B;  5C3E B;  3DM1 A;  2I07 B;  4X3T A;  1LTG D;  5JVG 3;  4CGY B;  2NBF A;  1TS3 A;  1F2M A;  5D3I B;  3FKI B;  1YNJ C;  3D31 A;  1LAC A;  4IUN A;  4ID6 A;  3OMC A;  1F2L A;  2EYO A;  2XN9 C;  1LTT D;  5C6A A;  2KCC A;  4RKB A;  4DNT B;  1TS2 A;  2RVL A;  4KY6 A;  2ZXO A;  3IFD A;  1S5E D;  2BDO A;  2L1B A;  4NKL A;  1A6X A;  1TWC B;  2FMC A;  1EWC A;  5KGU A;  2HQE A;  2EYL A;  3VA7 A;  4K8J A;  3RMH A;  1JOO A;  4A93 B;  4G57 A;  1HFN A;  2KEC A;  5KNB A;  2A6E D;  5E4X A;  5CBE E;  1MD2 D;  3TZU A;  4ABN A;  3BDC A;  1LAB A;  1T5X D;  4FVM A;  4U68 A;  2CQA A;  4RGO S;  3H0G B;  1RTO A;  1Y8O B;  4BA2 I;  4KN4 C;  1OXV A;  4I65 A;  2M9V A;  3D4R A;  1JQY D;  4H13 C;  2I46 A;  1QJO A;  2EOT A;  5CR3 A;  1VF5 C;  4F8M A;  2ZT9 C;  1BCP D;  2L9H A;  2QF7 A;  3GQB A;  5C3W A;  4Y7N B;  3HEJ A;  2JSO A;  1BF4 A;  3LWU A;  4IQZ A;  2VB2 X;  5IT9 E;  1SND A;  5KRU A;  3M85 A;  3KUP A;  2XWB B;  1Q90 A;  3BVM A;  2KQ3 A;  2F0N A;  1WTV A;  1MSG A;  5I9P A;  2EYH A;  3I90 A;  2EY6 A;  4KHV A;  1GHK A;  1HRJ A;  3BVG A;  2E2D C;  2E74 C;  1TWG B;  3EA6 A;  2DNC A;  2B2U A;  4C3J G;  3NE5 B;  1TS4 A;  1V43 A;  2GA4 B;  3E5S A;  4LJZ C;  4DAP A;  2XSC A;  2F0Q A;  2EYJ A;  3SK6 A;  3A55 A;  3QJY A;  4G4K A;  2B2W A;  3A7A B;  3TN2 A;  4CJ0 B;  3ONA B;  1W6K A;  1ZKO A;  1G6Z A;  1H9J A;  4X3S A;  1AEX A;  3PIO 3;  5IIF A;  5M3F B;  4OO1 I;  3SEB A;  4ZKB B;  2F0M A;  3SXH A;  1FD7 D;  2XRQ D;  2KED A;  4IFD G;  1Q1E A;  3WOE A;  3Q23 A;  3G7L A;  2K7V A;  2D2C C;  5C0X I;  5IGB A;  1BQQ T;  4XTC S;  4HSV A;  1SJH D;  3MHB A;  3RZO B;  1H9S A;  1WTQ A;  1LLR D;  2XNA C;  2ICE C;  2KJX A;  1PTO F;  3MFY A;  3SDZ A;  5FKA C;  1PTO H;  3NWS A;  2AQ3 B;  5C5M A;  1U4R A;  3QG1 A;  1ZYR C;  2NYZ D;  1GUN A;  5JAV A;  1LV9 A;  2K32 A;  4FF3 A;  4A3D B;  4MHE A;  4LK1 C;  5I6W A;  1JOQ A;  1KAB A;  2IJ0 A;  2PW7 A;  3MAQ A;  5IGF A;  1XTC D;  5HGT A;  3PMF A;  5FO7 B;  5DEH A;  1Y8N B;  1I4X A;  3GTQ B;  4WOR A;  2A6H C;  1QCB D;  3UI2 A;  1R9T B;  4PQX A;  5DAU A;  4G7O C;  3WDN A;  3R3O A;  4KD4 A;  3T51 B;  1CM9 A;  1F2Y A;  4N9P A;  2L11 A;  1ET6 A;  4TRD A;  2MP1 A;  2KHS A;  2G9D A;  4F87 A;  1HTP A;  2EJM A;  4NW2 A;  1QNU A;  4XYO A;  4ZRZ A;  3OHX C;  1PTO C;  1EIH A;  4NMZ A;  4RGT A;  2NTS A;  4DGZ A;  3Q22 A;  5EJW A;  2B2V A;  4EVO A;  4WJW A;  2DN8 A;  3E6Z X;  5BN3 A;  4DFA A;  4ME5 A;  1TII D;  1SMY D;  2MHV A;  4N9T A;  1KAA A;  1UUP A;  4KD3 A;  3IFT A;  3J7Y W;  1TKW B;  3VYR A;  1JWS D;  1GHJ A;  2FJ2 A;  4K6D A;  5CV9 A;  4KN7 C;  5CGK A;  2CHB D;  1AZP A;  5E1F A;  3M4Y A;  4UDU C;  1DJR D;  1VF7 A;  4LAA A;  1FNW A;  2PO4 A;  2F1M A;  5EKK A;  1PTO B;  3Q0A A;  3H3V C;  2M2L A;  3W2D A;  4IFD H;  1PMR A;  2A74 C;  4FXG C;  2KA7 A;  3DEO A;  5FO8 B;  2WAC A;  4M8A A;  1LTI D;  4U67 3;  1B4O A;  3DWA A;  2JA5 B;  3TSS A;  3J7A F;  4RHR A;  3U9O A;  3HOW B;  1MI2 A;  3RUZ A;  4JBW A;  1EQV A;  1EYD A;  5I4D A;  2LMC B;  1II3 A;  2F0W A;  3FEW X;  1SJE D;  2A6E C;  4XXE A;  5I2X A;  4PMW A;  2G9H D;  1Z47 A;  2RSN A;  1NR2 A;  3VR6 A;  1BR9 A;  2Y0S B;  2WKD A;  2AWN A;  2O5I C;  1QIL A;  3GTP B;  3SVM A;  2H1E A;  4WFN 3;  4G7H C;  3VA5 A;  3SE0 A;  4M1U B;  4FP5 D;  2XRS D;  4DF7 A;  5FLX E;  4ZKC B;  2X6G A;  3VR5 A;  3BDL A;  3JAM L;  3NBH A;  4IAL A;  4O42 A;  5BN5 A;  2IWH A;  3P7J A;  1STB A;  3NSW A;  2B2Y C;  3KLR A;  1EOT A;  4NP5 A;  4C3J B;  4MN3 A;  1O7Y A;  2A68 D;  4RA8 A;  2LS0 1;  3A8J E;  1SEB D;  4HED A;  1K8M A;  5A2Q E;  2BCO A;  1TY0 A;  4C3H G;  3CKI B;  3L7Z C;  2WIN B;  3D8G A;  1B1Z A;  3PUV A;  3RLF A;  5I6Y A;  4K5X A;  4OGQ C;  3S14 B;  1W6J A;  1DOK A;  3T4A C;  1PYW D;  1ZXT A;  1SNM A;  1B50 A;  5KND A;  4K5W A;  2F0P A;  2K05 A;  1A2U A;  4CKC A;  1WTW A;  4KY7 A;  1O7L A;  4CJ1 B;  3N6R A;  1L0X B;  2F0E A;  1HUM A;  4L6T B;  1TWF B;  4RH6 A;  1XX8 A;  3JAM E;  4QB4 A;  2NVX B;  2RDF A;  3MA2 B;  3VYT A;  4R8I A;  1EY5 A;  1V1P B;  1M8A A;  1ILP A;  1RKN A;  5J1Z A;  3PUZ A;  3K58 A;  1A15 A;  5M5W B;  1YNN D;  3H6M A;  5JJZ A;  1SYD A;  2F3V A;  3MEH A;  3E0J A;  1EFI D;  2B2T A;  1PZK D;  3TP7 A;  4EQN A;  3QB3 A;  1U9R A;  1LT4 D;  1OXS C;  1IW7 D;  2QCP X;  4KJN A;  1DYQ A;  2IPK D;  1HQM C;  2L55 A;  1PRT D;  3J80 L;  5D3D A;  1UNS A;  3X3N A;  2V4D A;  1DCZ A;  1F77 A;  2R6G A;  5ELD A;  3R8B A;  3O13 A;  2HCI A;  1RTN A;  1EIG A;  3NUC A;  1QOH A;  1HPC A;  5I9O A;  4P2C B;  1R4P B;  4IUQ A;  3J81 L;  3TZD A;  2F0O A;  4RFB A;  1AN8 A;  4FF2 A;  2QKI C;  2RA4 A;  2XWJ B;  1WTR A;  1VDZ A;  3I4M B;  2R92 B;  4IFD I;  5DM7 3;  3HRZ C;  1TVX A;  2D5D A;  1CZW A;  4F88 A;  4Q5V A;  2Q8R E;  1SE3 A;  2WKC A;  4UAI A;  2YYZ A;  1Y8P B;  3OSO A;  1CTM A;  1A3T A;  3S1Q B;  3GD7 A;  1D1I A;  2YU9 B;  1U4L A;  1D6E C;  4HN7 A;  3M4O B;  1PDQ A;  3ND8 A;  1B44 D;  3V2T A;  3P20 A;  2B2W C;  2ICI A;  1F9P A;  1K8O A;  2Q8T A;  3K7A B;  1SYC A;  3D4D A;  1BXT A;  1SMY C;  3GTK B;  4EQO A;  2R61 A;  5EPK A;  3TDQ A;  1S5D D;  3K57 A;  1F9R A;  1QG7 A;  1ML0 D;  1CQV A;  1KDA A;  1RCV D;  4IUR A;  2E2I B;  4X3K A;  2R3Z A;  4ZUI A;  1HXY D;  1XXG A;  3RZD B;  4IZ8 A;  4K8I A;  2O4X A;  5C4X B;  1SSO A;  1AFP A;  1D1K A;  4E6I A;  3GP7 A;  3HOY B;  2NWG A;  1STN A;  1G2T A;  4H44 C;  1I50 B;  4KJO A;  1KTK A;  3CRK C;  3V05 A;  5LHY 1;  4DK1 A;  2K33 A;  3SK8 A;  1GXD C;  3BYT B;  5COY A;  3W3A A;  2JYO A;  1E2W A;  3C1E A;  4IUU A;  1JWM D;  4HR7 B;  4C3H B;  3HOV B;  1B9N A;  1Q8I A;  4C1N K;  2PZT A;  1E2Z A;  1H9S B;  4C3I B;  3MVV A;  3K0Y A;  1RJT A;  1EY6 A;  2SEB D;  5JPM C;  1QB5 D;  2EXZ A;  4DXF A;  3PUW A;  3NXW A;  1D5Z C;  1EZ8 A;  2KVM A;  3OWE B;  3NTH A;  1I4R A;  1B2T A;  1CZG A;  2K28 A;  3FRP B;  2A68 C;  5JVH 3;  1UAP A;  2F4I A;  1AZQ A;  4KK7 A;  3WOF A;  3R93 A;  1ENA A;  2ID0 A;  2FFK B;  1SNP A;  3LWE A;  4ZK9 B;  2AUK A;  4H7B A;  5C4J B;  3NHH A;  2F0L A;  1DOM A;  2NZ1 D;  1Y69 U;  2ZXR A;  1EY0 A;  2CW0 D;  2EY1 A;  1HHV A;  5ELB A;  2MGS A;  3MXN A;  3HGB A;  4ZLT F;  2M00 A;  2DY8 A;  2K03 A;  1STG A;  3S2H B;  4DU9 A;  4RCN A;  2MJ8 A;  1SFO B;  3NTI A;  1VCI A;  3HZX A;  5KYL A;  1D5X C;  3Q24 A;  2F03 A;  4QF4 A;  5IGC A;  1Z6H A;  5EBD A;  1SYB A;  2JA8 B;  1QNK A;  1YNN C;  4RGN A;  2PQE A;  1WVL A;  4DA2 A;  4DNR B;  4BBS B;  2IX0 A;  1TS5 A;  1PLF A;  1SBB B;  5CC4 A;  2JP1 A;  1EY7 A;  3ITP A;  4C1N I;  2JA6 B;  1MBY A;  2A69 D;  1JCK B;  3C2P A;  1EQT A;  2AQ2 B;  2TMP A;  1OXT A;  3VR2 A;  1X32 A;  3A8I E;  2KCN A;  1LT6 D;  4OIJ A;  1I4H A;  5ELE A;  1I4G A;  5C5L A;  3D6W A;  1EYA A;  1I3Q B;  3K5N A;  3F2U A;  2OXP A;  1SE2 A;  3OW7 A;  1E2V A;  3HOX B;  5D14 A;  1WTX A;  4QUC A;  4XYQ A;  3S17 B;  1DZ1 A;  3NQT A;  3I3C A;  1JOR A;  2LY7 A;  4BY7 B;  5J39 A;  5K36 G;  3PUY A;  4FYD A;  2B8G A;  4A3E B;  1EY4 A;  4A3G B;  5EGT A;  3MXG A;  5KIX A;  5M5X B;  1H9R A;  3D3R A;  1BCP F;  2B63 B;  1J8I A;  1STA A;  2RQX A;  1WD1 A;  1RHP A;  4CJ2 C;  2OT2 A;  5FO9 B;  3J7A V;  2N88 A;  3AMU A;  2NUC A;  5T1G A;  1EYC A;  2JXM B;  1NCV A;  3MWY W;  4V0B A;  3CHB D;  1V1O A;  2CVR A;  2PYK A;  1EY9 A;  2RSO A;  1HA5 A;  3I4N B;  4BY1 B;  5KNC A;  1S5F D;  1NR4 A;  4NDX A;  3ND9 A;  1XWE A;  5EPL A;  1LTA D;  3H94 A;  3N52 A;  5KEE A;  4L63 B;  4A3B B;  2H4O A;  3NP8 A;  1LTB D;  2B2T C;  2K1B A;  2AQ1 B;  2IL8 A;  4XT1 B;  4XQN A;  1BUV T;  3P1H A;  2R7Z B;  1BDO A;  2VXW A;  3CRL C;  4L8J A;  1A3V A;  1CK1 A;  3ERQ A;  5E3F A;  1BCP C;  4K14 A;  3OIP A;  3C1F A;  3HS0 C;  1GUW A;  1MSH A;  2J4X A;  4A3M B;  2LKV A;  1JB3 A;  3OIQ A;  3DMU A;  1SNC A;  1D5M C;  5DNF A;  3BVZ A;  4Z9C B;  4OL7 A;  5C4H A;  3MXP A;  2EYF A;  4PV1 C;  1EZ6 A;  4C3I G;  4XT3 B;  1O78 A;  1CHP D;  1OO9 B;  1SNO A;  4KHZ A;  5EKI A;  1KDB A;  5IOC A;  1AW7 A;  4KKS A;  5DM6 3;  1NUC A;  4OIK A;  3M7N A;  3TP8 A;  2D9U A;  1Q3L A;  1WCM B;  2NN6 G;  1GOZ A;  4CKE A;  4F7X A;  3MXU A;  4CKB A;  1F9Q A;  2PNR C;  2L12 A;  2DY7 A;  3OMG A;  2Z4I A;  3OOC A;  1GUO A;  3I91 A;  3TP5 A;  4IUP A;  1BCP B;  4A3J B;  3KBX A;  2O5J C;  5F2D A;  1G2S A;  2BE5 D;  4HMJ A;  5K36 H;  2K04 A;  3X3M A;  3T13 A;  1G8Z D;  1JE4 A;  5KYI A;  2EYM A;  1PFM A;  3NTK A;  3FMC A;  2QIL A;  1A3U A;  1ENF A;  4DAV A;  5CV4 A;  2WP8 J;  1S5C D;  1QWY A;  4EQP A;  3GV6 A;  5BN4 A;  1CQF A;  2B8F A;  1B9M A;  5FOB B;  5J22 A;  1G29 1;  4G7Z C;  4A3K B;  4LMQ D;  2K5W A;  1B3A A;  2SNS A;  2QEJ C;  1PXU A;  1U4P A;  1EEI D;  2RDH A;  3SK4 A;  3A54 A;  3QOL A;  1WTO A;  1DXM A;  3LX0 A;  1IHZ A;  3PO2 B;  2C9O A;  2CW0 C;  2Z4H A;  3M7G A;  4FNF A;  2EY2 A;  3I8Z A;  4DXG A;  3S9W A;  2XIW A;  2EY5 A;  1OXX K;  4R9W A;  1HA6 A;  3NK9 A;  5JOB A;  3BYY B;  3QO2 A;  1JIC A;  3FVQ A;  3PO3 B;  4V19 0;  3KK7 A;  2E2H B;  3L9A X;  4CBV A;  3BZD B;  2KEE A;  1JR0 D;  3S15 B;  1FR3 A;  1L0Y B;  3M3Y B;  1JC7 A;  5ISR A;  1I4P A;  4ILW A;  4B9W A;  4HCE A;  3I70 A;  4XIG S;  1ENC A;  2IX1 A;  3NBI A;  4FF4 A;  1EU3 A;  3IL8 A;  2JEB I;  3EVQ A;  2SNM A;  3RD4 A;  1JOK A;  4HCS A;  1BO0 A;  3FPP A;  3HP3 A;  2NVT B;  5IGG A;  3QWN A;  4BS9 A;  3J80 E;  2IT1 A;  3FPU B;  2B2U C;  2A69 C;  4QUF A;  2ZXP A;  1M4V A;  1AP0 A;  1FNU A;  4FXD A;  4RHS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...