2F0TA

Crystal structure of staphylococcal nuclease mutant v66l/v99i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMINEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0tA00
2SOBA 2KQ3A 4J6HA 5M9OA 4S3SA 2F0FA 1EYDA 1U9RA 5JOBA 4KD3A 3OMCA 5KRUA 4KHVA 1SYGA 2F0VA 2EY1A 2EYLA 4IUNA 3MHBA 4ME5A 5E3FA 2F0WA 1STBA 2PW5A 4R8NA 4DU9A 5J39A 3SK8A 3P75A 1ENCA 1TQOA 1F2YA 3E5SA 1STYA 3NQTA 3H6MA 4K2LA 1SYBA 4K5XA 4ZQ3A 3SXHA 4F7XA 1EY7A 4LAAA 1JOOA 2QDBA 2EYMA 5KYIA 5IIFA 1EYAA 5CV9A 5HGTA 2F0HA 1EQVA 1EY0A 2SNSA 3SK5A 2F0PA 5K5PA 3BDLA 4ID6A 4PNYA 5NUCA 2F0MA 1SNQA 2F0NA 4DF7A 3MVVA 4H7BA 4DFAA 2ENBA 4IALA 3D6CA 4KY6A 5J1ZA 4B9WA 4KJNA 4NP5A 2PW7A 5C3WA 3OSOA 3OWFA 1EY6A 1TT2A 1EZ6A 1NSNS 5CV6A 4K5VA 5C4HA 4KY5A 2EY6A 3HZXA 4EQPA 4KV6A 5CV8A 5KGUA 5C4ZA 2EY2A 1SNMA 1A3TA 5JAVA 1RKNA 5EKKA 5CR3A 3TP5A 2PZWA 3PMFA 2F3VA 1SNDA 4NDXA 3NHHA 1SNOA 4K8JA 4PMBA 3QOLA 4E6IA 5IGCA 3NK9A 2F0KA 1EYCA 1TR5A 3EROA 5J22A 1KDBA 1JOQA 2EYPA 5C5MA 4J1MA 1F2MA 4QMGA 4YIJA 4F8MA 5C5LA 3C1FA 1EY5A 1A3UA 1SYEA 1A3VA 2EYFA 2PZUA 4I65A 4MIUA 5F2DA 4EQOA 3R3OA 3RUZA 5I6WA 5IGGA 4OL7A 4TRDA 5IGDA 2F0GA 5DEHA 4KD4A 1NUCA 4NMZA 3P1HA 5IODA 3OMGA 4KJOA 2F0JA 3C1EA 3D8GA 2EYHA 4K5WA 5IGEA 3SR1A 2F0LA 3MZ5A 4DGZA 5DAUA 3SHLA 3U9OA 3HEJA 4HMIA 4NKLA 1AEXA 2F0DA 3TMEA 2NUCA 2OF1A 4N9TA 5KEEA 2HQEA 2F0OA 4QF4A 3D4WA 4IZ8A 2KHSA 3BDCA 5KIXA 2EYOA 2PZTA 2PYKA 5CV7A 5HURA 2F0EA 4N9PA 3TP6A 2RKSA 5EKLA 4RKBA 3S9WA 1STNA 1SYDA 3EVQA 3MXPA 5CV4A 5E1FA 1SYFA 3T13A 5CC4A 5KYLA 2OXPA 5IOCA 2LKVA 1JOKA 4EVOA 2M00A 4KY7A 1SYCA 2F0TA 1SNCA 1II3A 2F0QA 3ITPA 4K8IA 4ZUJA 3V2TA 4EQNA 5IGBA 3TP8A 5ISRA 1EY9A 3D4DA 4KTAA 1ENAA 1SNPA 2RDFA 2PQEA 4WRDA 1KAAA 2O4XA 4QB4A 5EGTA 3T16A 1JORA 2SNMA 5C3XA 4B9XA 2F0IA 3DHQA 3DMUA 3LX0A 5CGKA 3SK4A 2EXZA 1KABA 1F2ZA 3SK6A 1EZ8A 1KDAA 1A2TA 2F0UA 2RBMA 3EJIA 3VA5A 3NXWA 2EYJA 5I6YA 4G57A 5I9OA 1EY4A 2OEOA 5I9PA 4ODGA 4WORA 5CV5A 2F3WA 2F0SA 3NUCA 4HTHA 2WACA 3MEHA 4PMCA 4K6DA 4RKLA 3QB3A 1IHZA 5C6AA 1STAA 4K2KA 4HMJA 4K14A 1EY8A 3NP8A 1KDCA 4ZUIA 5IGFA 3QOJA 2EY5A 1A2UA 1STHA 1STGA 3TP7A 3ERQA
chains in the Genus database with same CATH superfamily
3E3XA 1CKNB 1K0SA 2WB1E 4KHVA 4GOPA 1QVGA 3M85A 3K7AB 3S1MH 4P2CB 4HIMA 3A7LA 1EY0A 2SNSA 2FXQA 3MXGA 3ZYYX 4F87A 5EBDA 4CDCC 2PPBC 3D6CA 1AZPA 3EFXD 4G7OC 1LV9A 5KGUA 5CV8A 4BBRB 4QGUA 1MBYA 2IHEA 2D9UA 5IYBH 2IJ0A 2AQ2B 3S1RB 1HHVA 1WCMG 3NTHA 2X69A 2K33A 2ASBA 1KRTA 4OELB 1CKMA 1WTPA 3DWPA 3AFPA 1NUCA 4HJ7A 5K36H 4QJFA 4I7AA 4A3KH 2LXKA 3F2UA 1CT1D 2LMCB 1WTVA 2E2IH 1JB7A 2JA9A 4RGMA 4RHRA 3L0OA 4WJ3M 4JI8Q 1LT4D 4IPCA 1AH9A 1HUMA 2YU9H 3S1NB 3RN5A 4DV1Q 1YITA 1B1ZA 4OX9Q 1HNZQ 4DR1L 1HR0L 1VQBA 3CQZH 4JI5L 3ULJA 2JA6B 4I7ZC 1GHJA 4A3FG 3TP8A 1PRTC 2TMPA 1NY4A 1NMFA 2SNMA 3HRZC 3E6ZX 2F0IA 4O2DA 1FR3A 1ONLA 4LF7Q 2UU9L 4G57A 5C0XG 1F9PA 2EDGA 1L0YB 2A8VA 2L15A 2OT2A 2OQ0A 2NVQB 4LWCA 2SEBD 3CHBD 4JI1Q 1YIJA 3D0FA 1EOVA 3GTJB 3PQIA 4LF4L 1HUNA 4K14A 2KA7A 3M3YB 1FNWA 2UXDQ 2BH2A 1GUSA 3H09A 4BY7H 3GTKH 4AYBG 4LF9L 5JOBA 2N78A 4KD3A 1WTWA 4DNTB 1SYGA 2EY1A 1N33Q 1STBA 1G51A 1B8AA 3GD7A 2E2JH 1F2YA 4K2LA 1B9MA 3NTIA 4K5XA 1EY7A 4X66L 4A3JB 3S2DB 4K6LA 4X3SA 2GVBA 3PO2H 1HA6A 3ULLA 1IZ6A 4R4IA 3CCLA 3HS0C 1OXXK 1YEZA 4IPHA 4A93B 1JJCB 2A74C 2A69C 3MVVA 3S16B 4CKCA 3M4YA 3A8KE 1I4GA 1JC7A 4KJNA 4Y52H 2B39A 3OSOA 1MSHA 5C4ZA 4X3TA 5C4HA 4K5VA 1PLFA 4GNXC 1A62A 4BBSG 2D62A 1KC8C 3TS2A 5IP9G 4M1UB 1A0IA 1SNOA 3G71A 3NEMA 1V1PA 2NN6I 3KBXA 2JYOA 3RZOH 3GQBA 4QMGA 1OO9B 4F8MA 4Y7NH 1VQ8A 2B8GA 1S3OA 2BOSA 4B3SQ 1ET6A 1A3VA 4ZK9B 4ILWA 2LXJA 1FNUA 2AQ3B 2UUAL 2PO4A 3OMGA 4DV2L 4XYQA 2RDHA 1SFOB 5LL6S 1TWFB 3MXNB 1RF2D 2AWNA 2VB2X 1Y8NB 4RCOA 5M3FG 4JVZA 3I91A 1GUGA 1SMXA 3HKZE 2VL6A 5IYCG 1PH3A 4XQJA 1JWSD 4RA8A 2R92B 3K0YA 1SYDA 1WI5A 1E1TA 3W3AA 5IOCA 2JA7G 1MHWC 2SDFA 1RCVD 2VY3A 2Q8IB 4A3MG 4N8FA 3OHXC 2E75C 4X3KA 3URYA 1D5XC 5GROA 5C3EG 3CCSA 1GUTA 4C1NK 4ZUJA 1E1OA 4DR1Q 3I4OA 1RJTA 4JI5Q 1N36L 3ICEA 1EQRA 4U673 1GVPA 1RD9D 4DR4L 1WOCA 3SK4A 1L0WA 5GAHC 1PMRA 3I4MH 3GTGB 1BCPC 2EVBA 4WJWA 4C3JH 4LUOA 2R93B 2NN6H 1EFWA 1F77A 2B2VC 1EY4A 1BBUA 2ZJQA 1VQ6A 2A6HD 2F0SA 4HTHA 1BDOA 3FKIH 2UU9Q 1EL0A 3QOJA 1X54A 1JB3A 3DM3A 3UDFA 1TWAB 3HOXB 3L3OC 2WV6D 4B3ML 5M9OA 1WFQA 5BN3A 4K0KQ 1EYDA 4LF4Q 5KRUA 5DM73 3M7GA 4R8NA 4JI3L 2NBFA 3NBIA 5E4XA 3ULPA 1TQOA 4OIKA 1STYA 4LF9Q 3VR4A 4A3GH 2A6EC 2PMZB 5ELFA 4UP9A 4O0AA 1YNJC 4DV0L 1VMCA 5ELOA 2H5XA 1Q7YC 3K80C 4J8QA 1K8AC 4C3IB 3H91A 4NXML 3JAMc 1KXLA 3BJUA 1YI2A 4KY5A 5ELCA 1SMYC 4LJZC 2B2TA 5FO9B 3MWYW 3E0JA 4LFBQ 2XN9C 1R4QB 4HSVA 4G7HC 2K50A 3JC66 3RUZA 5C4XH 4HAEA 3HOVB 4WJ4A 1OXTA 2DY8A 2NWGA 3C1EA 2I0QA 4NXNL 1I4PA 5IGEA 1N32L 1YZ6A 3SR1A 1DM0B 1K73C 1K28A 2UUAQ 1JJGA 4DV2Q 4DV4Q 4HEDA 4C3HH 2WAQG 3D6WA 1YBYA 4IZ8A 4OHJA 2Q2UA 2B2UA 4N9PA 4RGOS 2K75A 1STNA 1EOTA 1SJHD 3K8AA 4DXGA 2JA8G 2RSNA 5IWAL 2H1EA 5JPMC 1K8GA 1HFGA 4DAYB 1TWGB 4Q5VA 2Q2HA 1OXVA 3L9AX 3J80E 4LF5L 1HXYD 2Q8RE 2V1CC 4A3IH 2R61A 3KJOA 2MQHA 4JI2Q 1VQEA 2L11A 1IKLA 1PH2A 1CSPA 3LX0A 4YWMA 1X6OA 2ZTEA 5J3BA 3VYRA 3WOFA 1PHJA 1XMOL 5GAGC 2EE1A 1N36Q 2HQLA 1CHPD 3H0GH 1NE3A 5GAEC 2OEOA 3BZDB 2EQSA 3VR3A 3N6RA 5C44H 4HMJA 2K14A 3TREA 2HCCA 3J81c 1R9TB 4UP8A 4A4IA 1IBKL 1WCMB 3OWEB 5EPLA 2WIIB 1Q1BA 5EPJA 4B3MQ 1IBML 3E5SA 3CMEA 4IO9A 1VQGA 2L55A 1X56A 5JEAH 1JOOA 2QDBA 4KKUA 4HIOA 1MJEA 3NELA 2F0HA 2J7ZA 2HHHL 2VS1A 5NUCA 1WTOA 1G8ZD 2N49A 4XXEA 4XIGS 3H3VC 4ZYSA 4DV0Q 1ICFB 2B63G 4AQYL 3M4OH 1Q82C 4FF1A 1BR9A 4X65L 5M3MH 2KJXA 4NXMQ 1W3SA 1Y1VB 2XRSD 1PH6A 2NVTB 1CKOA 3NK9A 5IT9E 4O42A 1TR5A 5C5MA 1EQTA 4FVMA 2UUCL 1BVSA 3PF5A 4DV3L 3VYSA 5I6WA 4A3FB 4TRDA 1VQFA 5A35A 2QDLA 2F0JA 4DGZA 1L2FA 2VZAA 3SHLA 3NSWA 1L1OB 1IXRA 2CWPA 5DNFA 1SLJA 4NXNQ 4DA2A 2O5IC 4L6TB 4F88A 1O7IA 1IKMA 1MSGA 1C48A 2PQAB 1R4PB 3U4VA 1UUPA 1SYFA 4DAPA 1E0BA 2LKVA 1VDZA 4DR5L 4HJ9A 1NBWA 1SYCA 2F0TA 1B9NA 4V190 4AYBB 2CVRA 4LF8L 3I55A 3S2HB 2KOLA 3K7AH 2Z0SA 1KAAA 4DK6C 1SE3A 2RVLA 4LF5Q 4X64L 3WOEA 1UEAB 3I2ZA 3K5NA 3DWQA 4XT3B 1WD0A 4QUCA 1YHQA 1SR3A 3BZCA 4PV1C 3KLSA 3TS0A 2JXMB 5FLMG 4ODGA 1H9SA 3DXJC 3JAML 3MAQA 2GVAA 4BBRH 1STAA 4JBWA 4OEMB 1I4XA 4JI7Q 3S1RH 3F8TA 3GV6A 3W1BA 3CKIB 1GD7A 3HFZB 4RHSA 3K5MA 1SJED 5E3FA 4FXGC 4DV7Q 4TVAB 2KHJA 3AEVA 4OIJA 3SGIA 2VNUD 1U5KA 3M4QA 4N8X1 1Y1WG 2RF4A 4JPBW 3IFDA 1M1KC 1IBKQ 1VF5C 3GO5A 4UP7A 1UNSA 4MTNA 5CV9A 1AZQA 1IBMQ 1XWEA 3S1NH 2F0MA 1DZ1A 1V43A 4HJAA 3I8ZA 1X3GA 2HIVA 4IALA 1PRTF 5M3FB 1SSOA 4KHZA 2F4VQ 1NSNS 2HHHQ 1A3TA 1S4ZA 4A75A 4MZ9A 2CFMA 1SNDA 2L0CA 2RA4A 4GNXA 2C35B 2JA7B 1VQDA 4A3MB 1F2MA 4YIJA 4BY1G 4X65Q 2K5QA 1DOKA 4OL7A 1OXSC 3GTQB 4LMQD 1S5CD 4KJOA 2UUCQ 4A3LG 4DV3Q 4RMFA 1VQLA 1T5EA 3J7YW 1GKHA 2RHSB 1LYLA 3IKJA 3RNUA 2NVQH 2B2TC 1FVIA 3UE1A 3PO3B 2OF1A 1LTBD 2F0OA 3SE0A 1B3QA 3GTJH 2D0OA 2WINB 3M3YH 4ABNA 4L5TA 2NTSA 2VB3X 1M8AA 2ICEC 1O7LA 3ND9A 5CV4A 3HOZG 2Z4HA 1CA5A 1XPUA 4GOPB 3MFGA 1G2SA 3J81L 4DR7L 2F4IA 2NVYB 1YJNA 2I5LX 3T53B 1DXMA 4NPSA 3QG1A 2JJQA 2UUBL 4KTAA 4L63B 4DR5Q 1VQ4A 5EGTA 4A3JH 1D2BA 2V4DA 4A3DG 5CGKA 4LF8Q 2B2UC 2EXZA 2O5JC 1F2ZA 2KECA 4A93H 3KF6B 3S16H 4A3KG 1EWHA 5IP7H 1WJJA 2Y0SB 3J80i 4HSPA 5I9PA 1XNQL 3GDEA 4JBKA 2AHOB 3X3MA 2DJGC 4PMCA 4RKLA 1YNNC 1GO3E 3I90A 2P5ZX 1YHBA 2DNCA 4DNIA 2HT1A 4TQUS 3TSSA 1STGA 4A3CH 3TRZA 4R4OA 3CCJA 4RH6A 4CDFC 2EPBA 1U9RA 1S40A 4ME5A 5JJKA 1PRTD 1EIHA 3MHBA 3GTPB 3PIO3 2F3IA 2GA4B 5I2YA 1SFOH 4ZQ3A 1J9OA 5KNCA 1C9OA 1TWFH 1ILQA 2AMCB 3UE0A 3UI2A 3CC7A 1EYAA 3OIQA 1XTDA 3SK5A 2BH8A 2N55A 4ID6A 3AMUA 1QOHA 1MJCA 4DFAA 4HJ8A 4L5SA 2ZXPA 2L1BA 2WAQB 4L5RC 3HOUB 3OWFA 2R92H 5C4JB 1KL9A 5FK9C 5BR8Q 1SNMA 3BYTB 4EQ5A 4ULLA 3L2PA 1BCPF 3NHHA 2CW0C 4OWWB 3QOLA 2VUMB 3W2DA 2K6AA 2JSOA 3EROA 1S72A 4J1MA 1LT5D 3CXCA 4BY7G 2CWAA 3P1HA 3UDXA 5CBEE 5IODA 3GTGH 1L0XB 4YHHL 1VQIA 2R93H 2WB1G 4DUZL 2VQFQ 2RCNA 2HIXA 4NKLA 2A69D 1E24A 3T51B 1SE4A 2F52A 3Q0AA 3PO2G 4QIWB 3NWTA 1IBLL 5HURA 3A54A 4HCSA 2RKSA 1U4LA 3K58A 1EWIA 1TWAH 3HOXH 3KDFB 2R7ZG 2ES2A 2HDLA 5FJ8G 3ITPA 2ZTCA 1FNVA 1HZCA 1NMGA 1O78A 3LGJA 2UXBL 1C7YA 2XSCA 4LUZA 4CJ2C 1UE1A 1STEA 3DMUA 3P7JA 3NBHA 2UUBQ 3PIOA 4C3IH 4R1JA 2RBMA 1VQMA 2JQOA 4XYOA 4DNRB 1E2VA 3GTOB 2JA5G 3BVGA 4K6DA 5C6AA 1V1PB 2B63B 4JOIA 3TQYA 1XNQQ 3AQQA 1JR0D 2F0FA 3HOVH 1KAWA 1PFNA 4IUNA 1NR4A 4DU9A 4B08A 4A3BB 3CAMA 3CCRA 2DN8A 1Q8KA 5BN5A 1CZGA 5KNBA 1BCPD 5D65A 3K81C 1VQCA 5HGTA 1X65A 1I4HA 1ZXTA 1PDQA 4YY3L 4DF7A 1BOSA 3KF8B 1S5DD 4UY8C 2ZM6L 5CV6A 3J7AF 2EY2A 2C9OA 4JI4L 1A6XA 2PZWA 2K01A 1TWGH 4JG2A 1EYCA 4P73A 2NTTA 3FMCA 1Q86C 4IOCA 1OTCA 3I73A 1EY5A 1V1QA 3MTSA 3RD4A 4RGTA 2MGSA 2F0GA 2MUYA 3CCMA 1HNXL 4LF6L 1NAPA 3EBEA 1QVFA 2A6ED 4KN4C 1ML0D 3IAYA 2E2HB 1YNJD 1N34L 1ET9A 1U0LA 3G7LA 2YTVA 1PH8A 4MN3A 2Z6KA 5KEEA 4DUZQ 4A3EG 4DK0A 4JBJA 2RDGA 3Q23A 1SMYD 1TWCB 1ZKOA 4RKBA 3EVQA 5KYLA 2OXPA 1SN8A 1BBWA 2M00A 3G6JB 2RSOA 1WCMH 5EJWA 2L9HA 2ZTDA 4EQNA 4FYDA 1J5EL 3AB9A 3M4PA 3D4DA 1AFPA 1H9MA 1XXGA 3PCOB 2LSSA 2WKCA 3T16A 3J7ZC 1VQ5A 2JEAI 5M5WB 3S24A 2LY7A 5I2XA 3S14B 1SBBB 1Z6HA 2UXBQ 4B3TL 5M5YB 4X3UA 4BWGB 1VQ7A 1BUVT 2VXWA 3F1ZA 2B3GA 3GTLB 3Q6SA 2A1AA 1X3EA 4RFBA 3RLFA 3QB3A 1JQYD 2QA4A 5LMNL 1X9NA 2A68C 3PUXA 1Y1VH 4JV5L 4C3HG 2NVTH 2Q8TA 1HR0Q 1J8IA 3C3LA 4DV6L 4WFN3 3TBIB 2KQ3A 4JYAL 1PYWD 1C8CA 1VQ9A 3BG3A 3HKZG 1DCZA 1CQVA 3MFYA 3L7ZC 1E3PA 4A3FH 3E9IA 4BY1B 4GKKL 2PW5A 1TU2B 4OWTB 2MFIA 2XVSA 1RDPD 2NYZD 3HG9A 4V0BA 2VW9A 1ZYRC 5C0XH 2IW3A 2JEBI 1Q3LA 2ZXOA 2L12A 3V96A 5C3WA 2IPKD 3OPOA 1I50B 1RTOA 3FRPB 4YY3Q 1TWHB 3KBGA 3HOYB 2OTLA 1EWCA 3W1GA 3Q8DA 1CA6A 1Z9FA 3HOZB 2Z1CA 5J22A 2ZM6Q 3S2HH 2C5CA 4I65A 4EQOA 1QG7A 4MIUA 3GTMB 3K6OA 2AUKA 4MTKA 1QB5D 2Z9HA 3W5OA 2E5LL 1K3BC 2Y0SE 4OONA 1QVCA 3GP7A 4TSSA 4X66Q 4A3DB 1K0RA 2J0TD 4JBMA 1HNXQ 4LF6Q 5KNDA 1LACA 2KCNA 3CD6A 3Q24A 1N34Q 2K05A 1M90C 1FJGL 4AIMA 3OYYA 4GN5A 4UHVA 1HR0W 3MC0B 3MXNA 3T13A 5IP9H 3CRKC 2WFWA 3J7AV 3BYYB 1MIUA 1HTPA 1D8LA 2I46A 1SNCA 2PNRC 3STBC 4QQBX 1TIID 4WRDA 3RMHA 3I4NB 3U4ZA 3AFQA 5EPKA 2K5DA 3DHQA 3I7FA 3OIPA 3VA5A 1LTLA 4HJ5A 1H9KA 1QJOA 3KK7A 5M3FH 3S1QB 2EJFC 3MA2B 2E74C 2F3WA 4QL5A 3A56A 3VYUA 1QNKA 1NTGA 2B2YA 2LFNA 5IYCH 2K5VA 4IJLA 4ZUIA 2IHFA 2ZXRA 2JA7H 1B4OA 3IL8A 4A3MH 4MNOA 3Q22A 4RWSC 5LMNQ 1VQNA 4JV5Q 2F0VA 1IW7C 1Q81C 3GTQH 3T4AC 3CPWA 3FEWX 4KKTA 4JYAQ 1HFNA 3NQTA 3K5LA 1MGSA 4DR4Q 3CP0A 4HR7B 1GM5A 4QIWE 4JOIC 1EQVA 2FMMA 1AN8A 1VQAA 3PO3H 4IUVA 3TZUA 2ZJPA 1O7ZA 1VQHA 1NCVA 3BS1A 2IX3A 4H02A 1EY6A 4HCEA 4DAMA 4GN3B 5JAVA 1YJ9A 2D0PA 4DR2L 4C2MB 5HGQA 4KMUC 2R7ZB 2NVYH 1JT8A 1JOQA 1PRTB 3R3OA 3CCUA 1HNWL 4JI3Q 2WKDA 2OWOA 3D8GA 1VQKA 2EYHA 3U50C 5IYDG 1H9SB 5DAUA 3F2CA 1K83B 2E5LQ 3HEJA 1PH7A 3PUWA 1P8LA 4OGQC 4N9TA 1LTTD 1GOZA 2IX0A 1DD2A 3ERSX 2ALYB 2EYOA 1GUOA 5D3DA 2JA5B 2QGQA 5EKLA 5A2QL 1KQSA 1VS0A 4EVOA 3WWVA 1T5XD 2RQXA 1II3A 1BF4A 1C0AA 3V2TA 1VQOA 3GTPH 3PSIA 2Z6KC 5E7NA 1PYBA 3MXUA 3M7NA 2NZHA 2PQEA 2JE6I 2B2WA 4BXXH 1N32Q 2QILA 3VDYA 2NZOA 4CJ0B 4IN3A 2KBNA 3HOUH 3PV0A 3DWAA 3S15B 5C4JH 3KJPA 4Z9CB 1E2ZA 4GNXB 1HJPA 2CH4W 4RCNA 2VUMH 5FLXc 3V05A 1STHA 2SOBA 5IWAQ 3HOWG 1DONA 3JAME 1FGUA 1UE5A 4IUTA 3A0JA 4F7XA 2G9HD 4KI0A 4YCVA 1U4RA 4R8IA 1XMOQ 4ZKCB 2ID0A 2YTXA 4IOAA 1PZJD 2R3ZA 3K5OA 2ENBA 5J1ZA 4BBSB 2PW7A 2K1BA 1YNND 3PUVA 3H3VH 1I4RA 5EKIA 4A3EB 1FYCA 4KK7A 1A15A 1PFMA 1RKNA 2K52A 2F3VA 4ZKBB 2KUMA 1XPOA 1Q46A 3FP9A 2FMCA 3CC4A 3T56B 1PTOC 4H44C 3QWNA 4DR2Q 4L8JA 2A5HA 4J15A 2IY5B 5E4WC 1HQMC 2KHIA 3OW2A 1BCPB 3MZ5A 1WD1A 3U58A 2KCTA 3T1HL 4IFDI 3CPFA 2IWHA 3GTOH 1DJRD 1XNRL 3ND8A 4GLVB 2B63H 2JA6H 4OO1I 4AQYQ 1KNAA 5E1FA 2CW0D 3K59A 5C3EB 2DY7A 1I4QA 2FFKB 5LHY1 3DM1A 2JN4A 1JE4A 1S5BD 1J6QA 1TY2A 3WDNA 1LTSD 1I3QB 1TS5A 4K8IA 4A3BH 3HKZB 3I4LA 1PH4A 2HD3A 3UDIA 4JK1C 3HGBA 2TSSA 2PQAA 3DUZA 1JORA 2PCFB 5T1IA 5C3XA 1SEBD 3A8JE 4QCLA 1PV4A 4GZYC 2BE5C 1EZ8A 1HZAA 2E2DC 2ATWA 2F0UA 4IQZA 3J81E 5DLQE 3CCQA 3G4SA 3NWSA 1W2BA 4R4CA 3A8IE 1FD7D 2KEDA 2A19A 2K03A 2EIFA 3MEHA 5LMUL 1IHZA 2Z6BA 3C46A 4K2KA 1RIPA 5IYBG 1G291 2PMZE 3ERQA 4IJHA 4J6HA 1EIGA 3M9BA 3S2DH 1RHPA 4IFDH 1Z7TA 4JI0L 2E8GA 1Q12A 2E2HH 3NQIA 4KHPL 4OO1H 1TS4A 5K36G 2I5HA 2B2YC 3A7AB 4LAAA 4X64Q 1G91A 4ALPA 3T1YL 1GJXA 5JEAJ 2F0PA 2K04A 4C56C 1HQRD 1FGBD 5FLMH 1X3QA 1SNQA 2F0NA 3LWUA 4KY6A 1CZWA 1XTCD 1TWCH 2NVXB 4C3IG 2X6LA 1O80A 1LTGD 5CR3A 3TP5A 3BZKA 3CCEA 2EYPA 1Y8PB 3VA7A 1SYEA 5IGGA 2E76C 4R4QA 5M5WH 3NBHB 4IURA 3S14H 5L37A 3S17B 1WYDA 4BS9A 4POFA 3VYTA 5M5YH 4LF7L 3I3CA 4JCVE 1F9QA 1EIYB 3GTLH 1UAPA 1N9WA 1AEXA 2F0DA 4L5QA 3D4WA 2PI2E 3T1HQ 5I4DA 1BNZA 2JA8B 3S9WA 2CH4A 3K7UC 5FLXL 1PYSB 2M9VA 4BY1H 3A5UA 1ASYA 4XDXA 5ELBA 2Q2TA 4YCWA 1QZGA 1IYJB 1EY9A 3ONAB 3PUZA 4ZCKA 4ZLTF 4RG1A 1BBXC 1F9SA 3OW7A 4A3LH 1QZHA 4DN4M 2Q2IA 4OWXB 4CBVA 2WP8J 4R4TA 4QUFA 2KCMA 1ZEQX 4IUUA 3OTOL 2KCCA 3RLOA 1I50H 4IPDA 1K8OA 1TWHH 3HOYH 2K32A 1NNXA 4B3RL 2MHVA 3HOZH 2CCZA 3KF6A 1ICWA 3I72A 1A2UA 1QUQA 2B2WC 5IY0A 4EX5A 5LMUQ 5LL6X 1S5FD 2MO1A 4S3SA 3GTMH 4B3SL 4DR7Q 2B29A 2R7DA 2HDMA 1EIFA 1ESFA 2DJFC 5M5XB 1X32A 1ILPA 3H6MA 1S5ED 4A3DH 1HPCA 4JI0Q 1LABA 1XYIA 4KHPQ 2K5HA 3I70A 3BDLA 4FF2A 1EU3A 1SRUA 3JAMi 4X6AH 3FVQA 3T1YQ 1DOMA 2A68D 1TT2A 4EQPA 1BKBA 4KV6A 3UDGA 4P74A 3PMFA 1BQQT 2AKWB 4RGNA 3E0EA 1MKHA 1KNEA 1JICA 2O2LD 1Y1VG 1E2WA 1JCKB 3I4NH 4A76A 1CKNA 1NR2A 3N52A 5HY6A 5G3LF 1YVCA 1DYQA 3I4MG 1ZYRD 1YNXA 3FDTA 1GUWA 3S1QH 3CRLC 4C3JG 1CUKA 2NN6G 3F2BA 1PZKD 4AYBE 2KHSA 3TDQA 4KKSA 4FXKC 4OXPA 2F0EA 3FKIG 2G9DA 1IL8A 2IL8A 3GV3A 3LWEA 2QKIC 1JJ2A 5IE8A 4FO2A 1YHAA 4K0KL 1V1OA 3HOWB 1SAPA 1Y69U 5ISRA 2R7FA 1ENAA 1IYUA 1PA6A 1PTOB 3D31A 3KDFA 4BA2I 1I94L 1I6HB 4B9XA 3QIAA 4IFDJ 5CYUA 4A3GG 4YHHQ 2G5DA 5D3IB 1A2TA 1L1OC 3R2IA 3J80c 1C4QA 4X62L 4LFAL 1R9TH 4GLXA 1QWYA 4JC0A 5C0XI 3R2TA 1JWMD 1IBLQ 3OTOQ 4C2MH 3NP8A 2R7ZH 1KRSA 4QY7A 1G6ZA 5FJ8H 3NENA 3CF5A 3J81i 3STBD 4LFBL 2JP1A 4B3RQ 1Y1WB 4CDDC 3NTKA 1X3FA 1D6EC 2XWBB 4DAVA 4CDEC 3P75A 5C4XG 1LM0A 4YWKA 2ZJRA 4GN4B 3SXHA 2MPMA 1D1KA 2XTIA 1K83H 1K9MC 3VR5A 4GKJL 4PZ8A 1MD2D 5CBAE 3SVMA 4DV4L 1EFID 1M4VA 1UWVA 1EUJA 1D5ZC 1HH2P 5JJZA 1SROA 4NP5A 1EU4A 2JA5H 4PZ6A 5G3LD 4TKOB 4XTCS 2N8NA 2EY6A 3U9SA 3RZDB 1HCZA 1B53A 1SE2A 4NDXA 5D14A 2BDOA 2KENA 3A74A 4E6IA 2F0KA 3TN2A 2CHBD 2D2CC 1V9PA 3KF8A 1IW7D 3DEOA 1PH5A 4RAUC 1JMCA 2XIWA 3C1FA 4LW1A 2EYFA 3SEBA 2NB0A 3CCVA 2IT1A 4A3IG 4JI2L 5IGDA 4KN7C 1CSQA 1PVOA 3KOJA 1SE8A 2H4OA 1ESRA 2LS01 4FNFA 3S1MB 1Y8OB 2FINB 2HCIA 5IT9c 2QCPX 4DR6L 1VQJA 1CFMA 4P72A 3S15H 1XMQL 3H0GG 3CMAA 1KIXA 1KD1C 2CQAA 5T1GA 3A5ZB 3K0XA 1WTXA 3PO3G 2FHTA 5C44G 1WVLA 2L5TA 1HZ9A 1AW7A 4PZ7A 3RLNA 4DR3L 5ELNA 1CHQD 4JI4Q 5JJLA 2EOTA 3CU7A 3QJYA 4MHEA 4G7ZC 1SXTA 2AQ1B 2ZT9C 3PUYA 1LTRD 4DKAC 1B70B 1BO0A 1QNUA 4DV5L 1FL0A 1AE2A 3R93A 1SNPA 2RDFA 1T9HA 5CORA 2DUDA 5AJ3L 4UAIA 1PH9A 1NJIC 1I6VC 4A3KB 5JEAG 1PZID 2I5MX 1KDAA 1ASZA 3IFTA 3KYHC 1XPRA 1PTOF 2E2IB 5I9OA 1I94Q 4XT1B 4BBSH 4DK3C 1WTRA 2J4XA 1TXYA 5CV5A 4A3EH 2DGYA 3NUCA 3K57A 2YU9B 2Y0SG 2A73B 3BDOA 5FOBB 1E22A 4X62Q 5M3MG 4LFAQ 2EY5A 2M2LA 3CQZB 4GOPC 1E7ZA 4PG3A 3TZDA 1H9JA 2CQOA 2OQKA 5KYIA 3G48A 5J39A 1J5EQ 1Q90A 3SK8A 1HA5A 1TS2A 5EBCA 4ZRZA 1CTMA 1X3PA 2WAQE 1EQQA 1KTKA 2I07B 4H0LC 4P75A 5JPNC 5K5PA 4PNYA 4B3TQ 4BXXG 4KLKA 2EJGC 4GKJQ 2CKZB 2N88A 5FKAC 1XJVA 3F2DA 4GS3A 5C3EH 4R9WA 3HOUG 2QW7A 5EKKA 4DUYL 1I3QH 4POGA 4DV6Q 3I56A 1KDBA 1PH1A 4BY7B 3GTKB 5C5LA 2VUMG 1LT3D 5F2DA 2VQEL 4GKKQ 2MJ8A 1EYGA 2WB1B 3AU7A 4YWLA 3QO2A 4K5WA 2BDNA 2E2JB 3A55A 2ICIA 2F0LA 4UDUC 3FHWA 3VR2A 2MP1A 2K7VA 3PO2B 3EIVA 4BA1I 3J80L 2HQEA 4QF4A 5KIXA 4BBRG 2PZTA 3BU2A 2A6HC 4DR6Q 4GLAC 3TP6A 4JI7L 1XMQQ 3MXPA 2XGTA 1G6PA 1MI2A 5CC4A 3CC2A 1H9RA 4LUVA 1A63A 3RR5A 2NZ1D 1JOKA 4U68A 1PTOD 1N8RC 2JK8A 3PF4A 1CQFA 2RCFA 2F0QA 2YV5A 4DV7L 3RZOB 5IGBA 4DR3Q 2KVMA 2Z8LA 4Y7NB 1K8MA 2O4XA 4QB4A 3OOCA 4PQXA 1AP0A 5BN4A 5A2QE 1Z47A 1RODA 4DV5Q 4LFCL 5DM63 3EJIA 1O7YA 5AJ3Q 2EYJA 5I6YA 2RHQB 2NVXH 1B50A 4WORA 1I5FA 2F4VL 1FJGQ 3RN2A 4O1NA 5AFWA 5LMNW 4FP5D 5IGFA 1TY0A 2JA6G 5EAYA 3AYHB 3H3VI 1JE5A 3TEHB 1LT6D 3NE5B 5JJIA 3PIP3 4DAYA 3S17H 4APVA 1ENCA 4FF4A 2L4NA 2R6GA 4A3BG 2PI2A 2BE5D 1G2TA 4HIKA 4M8AA 2KEEA 5IIFA 2BA1A 1CM9A 3I4MB 1VMPA 3KLRA 4P71A 5IT9L 1WTQA 1VQPA 3HKSA 4C3JB 4H7BA 5C0XJ 1V8QA 1D5MC 4B9WA 1RL2A 2JA8H 4CKEA 3P20A 1EZ6A 3HZXA 3FKIB 1HZBA 4K8JA 5H1SE 3E9HA 1CK1A 1Y14B 3EN2A 1UE6A 3O13A 4DK1A 1A3UA 2PZUA 3EA6A 3VR6A 2OTJA 4DUYQ 3EQLC 1F2LA 1UE7A 5DEHA 4KD4A 4A3JG 4IFDG 1OXUA 3ER0A 4JI6L 1D1IA 2VQEQ 4A3GB 1TVXA 3CW2C 4OO1G 4A93G 4HMIA 5ELDA 5IP7G 3MEFA 2NUCA 2F1MA 2PYKA 5CV7A 1PXUA 1UEBA 4CKBA 4H13C 1IL2A 3FPUB 5FO7B 4JW0A 4A3CG 2K28A 1EEFD 5TSSA 4KY7A 2QF7A 4IUPA 4IUQA 1GUNA 2IX1A 2OCEA 3KFUA 5M5XH 1Q8IA 2XWJB 1KHIA 1TS3A 1QCBD 3SDZA 1QILA 1HNWQ 1PFSA 5C4XB 4HN7A 5IYDH 3KLSX 3PIPA 1KABA 1U4MA 5JVH3 3SK6A 1P16A 3BVMA 1LTID 3NXWA 2YTYA 1CI3M 1D7QA 5JVG3 1DGSA 2UXCL 3LNNA 5FO8B 1L1OA 2PNHA 1PFBA 4C3HB 2WACA 4LFCQ 2HUGA 2EJMA 5BR8L 2R92G 1EY8A 2YYZA 1KDCA 3B6YA 3J81j 4FDBA 3IRBA 1GXDC 3TP7A 1LTAD 3X3NA 1W6JA 1LUZA 4CGYB 3OMCA 3KUPA 4ZAIA 2EYLA 3R8BA 3DEPA 1B2TA 2F0WA 4NW2A 1A8VA 2D5DA 4CHTB 4A3IB 1B7YB 2DNEA 1AE3A 1SYBA 1HTLD 4C1NI 4XQNA 1HRJA 2EYMA 2VQFL 2R93G 3PGZA 3HP3A 3NPPA 3DLLA 3FPPA 5COYA 4IPGA 1B44D 2FJ2A 4G4KA 4Q0FA 1WTHA 3KLWA 4DPGA 2XRQD 3H0GB 4FF3A 3G6EA 5EQ0A 2EXDA 1KLGD 2MO0A 5C44B 2K5NA 3HOXG 1X55A 1ENFA 2AWOA 2BA0A 4PMBA 5IGCA 2F03A 3HOYG 3HOWH 1U4PA 4CJ1B 4FXDA 1EEID 3J7A5 1PTOH 4DXFA 4YCUA 1I6HH 1XX8A 4NMZA 4JI8L 2N3SA 4EGVA 2GN5A 2X6GA 2MNAA 4DV1L 3ZJYC 1TKWB 1W6KA 1SDFA 3U9OA 1Q1EA 4OX9L 3BVZA 1HNZL 3TMEA 4JI6Q 2K4KA 4PMWA 3QR8A 2Z4IA 3BDCA 1QUQB 4UPAA 2QEXA 3M4OB 5GQOA 1GHKA 2B8FA 4LK1C 4AH6A 3C2PA 2B2VA 4HIDA 5M3MB 4LNQA 4XQQA 1F9RA 1Y1WH 2XNAC 5ELEA 3H15A 3HOVG 1VCIA 1RTNA 5GADC 1H95A 1LLRD 1B3AA 1DOLA 1BXTA 1QE6A 2QEJC 4ME3A 5FLXE 3I4NG 1K3RA 2EZVA 1LO5D 4JI1L 3H94A 2K5WA 1YJWA 2BCOA 1IYVA 2UXDL 4NB3A 3RZDH 1XNRQ 1KLUD 2AUJD 3D4RA 5CMDA 1VF7A 3D3RA 2UXCQ 1N33L 1JWUD
chains in the Genus database with same CATH topology
4KHVA 3M85A 3K7AB 4P2CB 3A7LA 1EY0A 2SNSA 3MXGA 3ZYYX 4F87A 5EBDA 2PPBC 3D6CA 1AZPA 3EFXD 4G7OC 1LV9A 5KGUA 5CV8A 4BBRB 1MBYA 2D9UA 2IJ0A 2AQ2B 3S1RB 1HHVA 3NTHA 2X69A 2K33A 1WTPA 3DWPA 1NUCA 5K36H 3F2UA 1CT1D 2LMCB 1WTVA 4RGMA 4RHRA 1LT4D 1HUMA 3S1NB 1B1ZA 2JA6B 4I7ZC 1GHJA 3TP8A 1PRTC 2TMPA 2SNMA 3HRZC 3E6ZX 2F0IA 1FR3A 1ONLA 4G57A 5C0XG 1F9PA 2EDGA 1L0YB 2OT2A 2NVQB 2SEBD 3CHBD 3GTJB 1HUNA 4K14A 2KA7A 3M3YB 1FNWA 1GUSA 3H09A 5JOBA 4KD3A 1WTWA 4DNTB 1SYGA 2EY1A 1STBA 3GD7A 1F2YA 4K2LA 1B9MA 3NTIA 4K5XA 1EY7A 4A3JB 3S2DB 4K6LA 4X3SA 1HA6A 3HS0C 1OXXK 4A93B 2A74C 2A69C 3MVVA 3S16B 4CKCA 3M4YA 3A8KE 1I4GA 1JC7A 4KJNA 2B39A 3OSOA 1MSHA 5C4ZA 4X3TA 5C4HA 4K5VA 1PLFA 2D62A 4M1UB 1SNOA 1V1PA 2NN6I 3KBXA 2JYOA 3GQBA 4QMGA 1OO9B 4F8MA 2B8GA 2BOSA 1ET6A 1A3VA 4ZK9B 4ILWA 1FNUA 2AQ3B 2PO4A 3OMGA 4XYQA 2RDHA 1SFOB 5LL6S 1TWFB 1RF2D 2AWNA 2VB2X 1Y8NB 4RCOA 3I91A 1GUGA 4XQJA 1JWSD 4RA8A 2R92B 3K0YA 1SYDA 3W3AA 5IOCA 2Q8IB 2SDFA 1RCVD 3URYA 3OHXC 2E75C 4X3KA 1D5XC 1GUTA 4C1NK 4ZUJA 1RJTA 4U673 1RD9D 3SK4A 3GTGB 1PMRA 1BCPC 2EVBA 4WJWA 2R93B 2NN6H 1F77A 2B2VC 1EY4A 2A6HD 2F0SA 4HTHA 1BDOA 1EL0A 3QOJA 1JB3A 1TWAB 3HOXB 3L3OC 2WV6D 5M9OA 5BN3A 1EYDA 5KRUA 5DM73 3M7GA 4R8NA 2NBFA 3NBIA 5E4XA 1TQOA 4OIKA 1STYA 3VR4A 2A6EC 2PMZB 5ELFA 1YNJC 1VMCA 4J8QA 4C3IB 3H91A 4KY5A 5ELCA 1SMYC 4LJZC 2B2TA 5FO9B 3MWYW 3E0JA 2XN9C 1R4QB 4HSVA 4G7HC 3RUZA 3HOVB 4HAEA 1OXTA 2DY8A 2NWGA 3C1EA 1I4PA 5IGEA 3SR1A 1DM0B 4HEDA 3D6WA 4IZ8A 4OHJA 2B2UA 4N9PA 4RGOS 1STNA 1EOTA 1SJHD 4DXGA 2RSNA 2H1EA 5JPMC 1HFGA 1TWGB 4Q5VA 3J80E 1OXVA 3L9AX 1HXYD 2Q8RE 2R61A 2L11A 1IKLA 3LX0A 3VYRA 3WOFA 2EE1A 1CHPD 2OEOA 3BZDB 3VR3A 3N6RA 4HMJA 2HCCA 1R9TB 1WCMB 3OWEB 5EPLA 2WIIB 1Q1BA 5EPJA 3E5SA 2L55A 5JEAH 1JOOA 2QDBA 4KKUA 2F0HA 2J7ZA 5NUCA 1WTOA 1G8ZD 4XXEA 4XIGS 3H3VC 4ZYSA 4FF1A 1BR9A 2KJXA 1Y1VB 2XRSD 2NVTB 3NK9A 5IT9E 4O42A 1TR5A 5C5MA 1EQTA 4FVMA 3VYSA 5I6WA 4A3FB 4TRDA 5A35A 2F0JA 4DGZA 3SHLA 3NSWA 5DNFA 4DA2A 2O5IC 4L6TB 4F88A 1IKMA 1MSGA 1C48A 1R4PB 1UUPA 1SYFA 4DAPA 1E0BA 2LKVA 1VDZA 1SYCA 2F0TA 1B9NA 4V190 4AYBB 2CVRA 3S2HB 2KOLA 1KAAA 1SE3A 2RVLA 3WOEA 1UEAB 3K5NA 3DWQA 4XT3B 1WD0A 4QUCA 4PV1C 3KLSA 2JXMB 4ODGA 1H9SA 3DXJC 3JAML 3MAQA 1STAA 4JBWA 1I4XA 3GV6A 3CKIB 4RHSA 3K5MA 1SJED 5E3FA 4FXGC 4OIJA 2VNUD 3IFDA 1VF5C 3GO5A 1UNSA 5CV9A 1AZQA 1XWEA 2F0MA 1DZ1A 1V43A 3I8ZA 4IALA 1PRTF 5M3FB 1SSOA 4KHZA 1NSNS 1A3TA 1S4ZA 1SNDA 2L0CA 2RA4A 2JA7B 4A3MB 1F2MA 4YIJA 2K5QA 1DOKA 4OL7A 1OXSC 3GTQB 4LMQD 1S5CD 4KJOA 1T5EA 3J7YW 3IKJA 2B2TC 3PO3B 2OF1A 1LTBD 2F0OA 3SE0A 2WINB 4ABNA 2NTSA 2VB3X 1M8AA 2ICEC 1O7LA 3ND9A 5CV4A 2Z4HA 1CA5A 3MFGA 1G2SA 3J81L 2F4IA 2NVYB 3T53B 1DXMA 3QG1A 4KTAA 4L63B 5EGTA 1D2BA 2V4DA 5CGKA 2B2UC 2EXZA 2O5JC 1F2ZA 2KECA 1EWHA 2Y0SB 5I9PA 4HSPA 3X3MA 4PMCA 4RKLA 1YNNC 3I90A 2DNCA 4TQUS 3TSSA 1STGA 4RH6A 2EPBA 1U9RA 4ME5A 1EIHA 1PRTD 3MHBA 3GTPB 3PIO3 2GA4B 5I2YA 4ZQ3A 1J9OA 5KNCA 1ILQA 3UI2A 1EYAA 3OIQA 3SK5A 2N55A 4ID6A 3AMUA 1QOHA 4DFAA 2ZXPA 2L1BA 2WAQB 3HOUB 3OWFA 5C4JB 5FK9C 1SNMA 3BYTB 4ULLA 1BCPF 3NHHA 2CW0C 3QOLA 2VUMB 3W2DA 2K6AA 2JSOA 3EROA 4J1MA 1LT5D 3P1HA 5CBEE 5IODA 1L0XB 4NKLA 2A69D 3T51B 1SE4A 3Q0AA 4QIWB 3NWTA 5HURA 3A54A 4HCSA 2RKSA 1U4LA 3K58A 2HDLA 3ITPA 1FNVA 1O78A 2XSCA 4CJ2C 1STEA 3DMUA 3P7JA 3NBHA 2RBMA 4XYOA 4DNRB 1E2VA 3GTOB 3BVGA 4K6DA 5C6AA 1V1PB 2B63B 1JR0D 2F0FA 1PFNA 4IUNA 1NR4A 4DU9A 4B08A 4A3BB 2DN8A 5BN5A 1CZGA 5KNBA 1BCPD 5D65A 5HGTA 1I4HA 1ZXTA 1PDQA 4DF7A 1BOSA 1S5DD 5CV6A 3J7AF 2EY2A 2C9OA 1A6XA 2PZWA 2K01A 1EYCA 2NTTA 3FMCA 3I73A 1EY5A 3MTSA 3RD4A 4RGTA 2MGSA 2F0GA 2MUYA 1NAPA 2A6ED 4KN4C 1ML0D 3IAYA 2E2HB 1YNJD 1ET9A 3G7LA 4MN3A 5KEEA 4DK0A 2RDGA 3Q23A 1SMYD 1TWCB 1ZKOA 4RKBA 3EVQA 5KYLA 2OXPA 2M00A 3G6JB 2RSOA 5EJWA 2L9HA 4EQNA 4FYDA 3AB9A 3D4DA 1AFPA 1H9MA 1XXGA 2WKCA 3T16A 2JEAI 5M5WB 2LY7A 5I2XA 3S14B 1SBBB 1Z6HA 5M5YB 4X3UA 4BWGB 1BUVT 2VXWA 3GTLB 3Q6SA 4RFBA 3RLFA 3QB3A 1JQYD 2A68C 3PUXA 4C3HG 2Q8TA 1J8IA 3C3LA 4WFN3 3TBIB 2KQ3A 1PYWD 1C8CA 3BG3A 1DCZA 1CQVA 3MFYA 3L7ZC 4BY1B 2PW5A 1TU2B 2XVSA 1RDPD 2NYZD 3HG9A 4V0BA 1ZYRC 5C0XH 2IW3A 2JEBI 1Q3LA 2ZXOA 2L12A 3V96A 5C3WA 2IPKD 3OPOA 1I50B 1RTOA 3FRPB 1TWHB 3KBGA 3HOYB 1EWCA 1CA6A 3HOZB 2Z1CA 5J22A 2C5CA 4I65A 4EQOA 1QG7A 4MIUA 3GTMB 3K6OA 2AUKA 1QB5D 3GP7A 4TSSA 4A3DB 2J0TD 5KNDA 1LACA 2KCNA 3Q24A 2K05A 3MC0B 3MXNA 3T13A 3CRKC 3J7AV 3BYYB 1HTPA 2I46A 1SNCA 2PNRC 1TIID 4WRDA 3RMHA 3I4NB 5EPKA 2K5DA 3DHQA 3OIPA 3VA5A 1H9KA 1QJOA 3KK7A 3S1QB 2EJFC 3MA2B 2E74C 2F3WA 3A56A 3VYUA 1QNKA 2B2YA 2LFNA 4ZUIA 2ZXRA 1B4OA 3IL8A 3Q22A 4RWSC 2F0VA 1IW7C 3T4AC 3FEWX 4KKTA 1HFNA 3NQTA 3K5LA 1MGSA 4HR7B 1EQVA 2FMMA 1AN8A 4IUVA 3TZUA 1O7ZA 1NCVA 3BS1A 2IX3A 1EY6A 4HCEA 5JAVA 4C2MB 4KMUC 2R7ZB 1JOQA 1PRTB 3R3OA 2WKDA 3D8GA 2EYHA 1H9SB 5DAUA 1K83B 3HEJA 3PUWA 4OGQC 4N9TA 1LTTD 1GOZA 2IX0A 1DD2A 2EYOA 1GUOA 5D3DA 2JA5B 5EKLA 5A2QL 4EVOA 1T5XD 2RQXA 1II3A 1BF4A 3V2TA 3MXUA 3M7NA 2PQEA 2JE6I 2B2WA 2QILA 4CJ0B 4IN3A 3PV0A 3DWAA 3S15B 4Z9CB 1E2ZA 4RCNA 3V05A 1STHA 2SOBA 1DONA 3JAME 4IUTA 4F7XA 2G9HD 4KI0A 1U4RA 4R8IA 4ZKCB 2ID0A 1PZJD 2R3ZA 3K5OA 2ENBA 5J1ZA 4BBSB 2PW7A 2K1BA 1YNND 3PUVA 1I4RA 5EKIA 4A3EB 1FYCA 4KK7A 1A15A 1PFMA 1RKNA 2F3VA 4ZKBB 2KUMA 2FMCA 3T56B 1PTOC 4H44C 3QWNA 4L8JA 2A5HA 5E4WC 1HQMC 1BCPB 3MZ5A 1WD1A 4IFDI 2IWHA 1DJRD 3ND8A 4OO1I 1KNAA 5E1FA 2CW0D 3K59A 5C3EB 2DY7A 1I4QA 2FFKB 5LHY1 3DM1A 1JE4A 1S5BD 1TY2A 3WDNA 1LTSD 1I3QB 1TS5A 4K8IA 3HKZB 3I4LA 4JK1C 3HGBA 2TSSA 3DUZA 1JORA 2PCFB 5T1IA 5C3XA 1SEBD 3A8JE 4QCLA 4GZYC 2BE5C 1EZ8A 2E2DC 2F0UA 4IQZA 3J81E 3NWSA 3A8IE 1FD7D 2KEDA 2K03A 3MEHA 1IHZA 3C46A 4K2KA 1G291 3ERQA 4J6HA 1EIGA 4IFDH 1RHPA 1Z7TA 1Q12A 3NQIA 4OO1H 1TS4A 5K36G 2B2YC 3A7AB 4LAAA 1G91A 1GJXA 5JEAJ 2F0PA 2K04A 4C56C 1HQRD 1FGBD 1X3QA 1SNQA 2F0NA 3LWUA 4KY6A 1CZWA 1XTCD 2NVXB 4C3IG 2X6LA 1O80A 1LTGD 5CR3A 3TP5A 2EYPA 1Y8PB 3VA7A 1SYEA 5IGGA 2E76C 4IURA 3S17B 4BS9A 3VYTA 3I3CA 1F9QA 1UAPA 1AEXA 2F0DA 3D4WA 5I4DA 1BNZA 2JA8B 3S9WA 5FLXL 2M9VA 4XDXA 5ELBA 3PUZA 1EY9A 3ONAB 4ZLTF 1BBXC 1F9SA 3OW7A 4DN4M 4CBVA 2WP8J 4QUFA 1ZEQX 4IUUA 2KCCA 1K8OA 2K32A 2MHVA 1ICWA 3I72A 1A2UA 2B2WC 5LL6X 1S5FD 4S3SA 2HDMA 1ESFA 5M5XB 1X32A 1ILPA 3H6MA 1S5ED 1HPCA 1LABA 1XYIA 3I70A 3BDLA 4FF2A 1EU3A 3FVQA 1DOMA 2A68D 1TT2A 4EQPA 4KV6A 3PMFA 1BQQT 4RGNA 1KNEA 1JICA 2O2LD 1E2WA 1JCKB 1NR2A 3N52A 5G3LF 1DYQA 1ZYRD 3FDTA 1GUWA 3CRLC 4C3JG 2NN6G 1PZKD 2KHSA 3TDQA 4KKSA 4FXKC 2F0EA 2G9DA 1IL8A 2IL8A 3GV3A 3LWEA 2QKIC 4FO2A 1V1OA 3HOWB 1SAPA 1Y69U 5ISRA 1ENAA 1IYUA 1PTOB 3D31A 4BA2I 1I6HB 4B9XA 3QIAA 4IFDJ 5CYUA 5D3IB 1A2TA 3R2IA 1C4QA 1QWYA 5C0XI 3R2TA 1JWMD 3NP8A 1G6ZA 2JP1A 1Y1WB 3NTKA 1D6EC 2XWBB 4DAVA 3P75A 3SXHA 2MPMA 1D1KA 3VR5A 1MD2D 5CBAE 3SVMA 1EFID 1M4VA 1D5ZC 5JJZA 4NP5A 1EU4A 5G3LD 4TKOB 4XTCS 3U9SA 2EY6A 3RZDB 1HCZA 1B53A 1SE2A 4NDXA 5D14A 2BDOA 4E6IA 2F0KA 3TN2A 2CHBD 2D2CC 3KF8A 1IW7D 3DEOA 4RAUC 2XIWA 3C1FA 2EYFA 3SEBA 2NB0A 2IT1A 5IGDA 4KN7C 2H4OA 1ESRA 2LS01 4FNFA 3S1MB 1Y8OB 2FINB 2HCIA 2QCPX 1CFMA 2CQAA 5T1GA 1WTXA 2FHTA 1WVLA 2L5TA 1AW7A 1CHQD 2EOTA 3CU7A 3QJYA 4MHEA 4G7ZC 1SXTA 2AQ1B 2ZT9C 3PUYA 1LTRD 1BO0A 1QNUA 3R93A 1SNPA 2RDFA 5CORA 4UAIA 1I6VC 4A3KB 5JEAG 1PZID 1KDAA 3IFTA 1PTOF 2E2IB 5I9OA 4XT1B 1WTRA 2J4XA 5CV5A 3NUCA 3K57A 2YU9B 2A73B 3BDOA 5FOBB 2EY5A 2M2LA 3CQZB 3TZDA 1H9JA 5KYIA 5J39A 1Q90A 3SK8A 1HA5A 1TS2A 5EBCA 4ZRZA 1CTMA 1X3PA 1KTKA 2I07B 4H0LC 5JPNC 5K5PA 4PNYA 2EJGC 2N88A 5FKAC 4R9WA 5EKKA 1KDBA 4BY7B 3GTKB 5C5LA 1LT3D 5F2DA 2MJ8A 2WB1B 3AU7A 3QO2A 4K5WA 2BDNA 2E2JB 3A55A 2ICIA 2F0LA 4UDUC 3VR2A 2MP1A 2K7VA 3PO2B 4BA1I 3J80L 2HQEA 4QF4A 5KIXA 2PZTA 2A6HC 3TP6A 3MXPA 1MI2A 5CC4A 1H9RA 2NZ1D 1JOKA 4U68A 1PTOD 1CQFA 2F0QA 3RZOB 5IGBA 2KVMA 2Z8LA 4Y7NB 1K8MA 2O4XA 4QB4A 3OOCA 4PQXA 1AP0A 5BN4A 5A2QE 1Z47A 1RODA 5DM63 3EJIA 1O7YA 2EYJA 5I6YA 1B50A 4WORA 4O1NA 5AFWA 4FP5D 5IGFA 1TY0A 1LT6D 3NE5B 3PIP3 4DAYA 1ENCA 4FF4A 2L4NA 2R6GA 2BE5D 1G2TA 4M8AA 2KEEA 5IIFA 2BA1A 1CM9A 3I4MB 1VMPA 3KLRA 1WTQA 5IT9L 4C3JB 4H7BA 5C0XJ 1V8QA 1D5MC 4B9WA 4CKEA 3P20A 1EZ6A 3HZXA 3FKIB 4K8JA 1CK1A 4DK1A 3O13A 1A3UA 2PZUA 3EA6A 3VR6A 3EQLC 1F2LA 5DEHA 4KD4A 4IFDG 1OXUA 1D1IA 4A3GB 1TVXA 4OO1G 4HMIA 5ELDA 2NUCA 2F1MA 2PYKA 5CV7A 1PXUA 4CKBA 4H13C 3FPUB 5FO7B 2K28A 1EEFD 5TSSA 4KY7A 2QF7A 4IUPA 4IUQA 1GUNA 2IX1A 1Q8IA 2XWJB 1TS3A 1QCBD 3SDZA 1QILA 5C4XB 4HN7A 3KLSX 1KABA 1U4MA 5JVH3 3SK6A 3BVMA 1LTID 3NXWA 1CI3M 5JVG3 3LNNA 5FO8B 1PFBA 4C3HB 2WACA 2HUGA 2EJMA 1EY8A 2YYZA 1KDCA 1GXDC 3TP7A 1LTAD 3X3NA 1W6JA 4CGYB 3OMCA 3KUPA 4ZAIA 2EYLA 3R8BA 3DEPA 1B2TA 2F0WA 4NW2A 2D5DA 4CHTB 4A3IB 2DNEA 1SYBA 4C1NI 1HTLD 1HRJA 4XQNA 2EYMA 3HP3A 3NPPA 3FPPA 5COYA 1B44D 2FJ2A 4G4KA 4Q0FA 2XRQD 3H0GB 4FF3A 5EQ0A 1KLGD 5C44B 2AWOA 1ENFA 2BA0A 4PMBA 5IGCA 2F03A 1U4PA 4CJ1B 4FXDA 1EEID 1PTOH 4DXFA 1XX8A 4NMZA 4EGVA 2X6GA 1TKWB 1W6KA 1SDFA 3U9OA 1Q1EA 3BVZA 3TMEA 4PMWA 2Z4IA 3BDCA 3M4OB 1GHKA 2B8FA 4LK1C 3C2PA 2B2VA 5M3MB 4XQQA 1F9RA 2XNAC 5ELEA 1VCIA 1RTNA 1LLRD 1B3AA 1DOLA 1BXTA 1QE6A 2QEJC 5FLXE 2EZVA 1LO5D 3H94A 2K5WA 2BCOA 1IYVA 1KLUD 2AUJD 3D4RA 5CMDA 1VF7A 3D3RA 1JWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SOB A;  2KQ3 A;  4J6H A;  5M9O A;  4S3S A;  2F0F A;  1EYD A;  1U9R A;  5JOB A;  4KD3 A;  3OMC A;  5KRU A;  4KHV A;  1SYG A;  2F0V A;  2EY1 A;  2EYL A;  4IUN A;  3MHB A;  4ME5 A;  5E3F A;  2F0W A;  1STB A;  2PW5 A;  4R8N A;  4DU9 A;  5J39 A;  3SK8 A;  3P75 A;  1ENC A;  1TQO A;  1F2Y A;  3E5S A;  1STY A;  3NQT A;  3H6M A;  4K2L A;  1SYB A;  4K5X A;  4ZQ3 A;  3SXH A;  4F7X A;  1EY7 A;  4LAA A;  1JOO A;  2QDB A;  2EYM A;  5KYI A;  5IIF A;  1EYA A;  5CV9 A;  5HGT A;  2F0H A;  1EQV A;  1EY0 A;  2SNS A;  3SK5 A;  2F0P A;  5K5P A;  3BDL A;  4ID6 A;  4PNY A;  5NUC A;  2F0M A;  1SNQ A;  2F0N A;  4DF7 A;  3MVV A;  4H7B A;  4DFA A;  2ENB A;  4IAL A;  3D6C A;  4KY6 A;  5J1Z A;  4B9W A;  4KJN A;  4NP5 A;  2PW7 A;  5C3W A;  3OSO A;  3OWF A;  1EY6 A;  1TT2 A;  1EZ6 A;  1NSN S;  5CV6 A;  4K5V A;  5C4H A;  4KY5 A;  2EY6 A;  3HZX A;  4EQP A;  4KV6 A;  5CV8 A;  5KGU A;  5C4Z A;  2EY2 A;  1SNM A;  1A3T A;  5JAV A;  1RKN A;  5EKK A;  5CR3 A;  3TP5 A;  2PZW A;  3PMF A;  2F3V A;  1SND A;  4NDX A;  3NHH A;  1SNO A;  4K8J A;  4PMB A;  3QOL A;  4E6I A;  5IGC A;  3NK9 A;  2F0K A;  1EYC A;  1TR5 A;  3ERO A;  5J22 A;  1KDB A;  1JOQ A;  2EYP A;  5C5M A;  4J1M A;  1F2M A;  4QMG A;  4YIJ A;  4F8M A;  5C5L A;  3C1F A;  1EY5 A;  1A3U A;  1SYE A;  1A3V A;  2EYF A;  2PZU A;  4I65 A;  4MIU A;  5F2D A;  4EQO A;  3R3O A;  3RUZ A;  5I6W A;  5IGG A;  4OL7 A;  4TRD A;  5IGD A;  2F0G A;  5DEH A;  4KD4 A;  1NUC A;  4NMZ A;  3P1H A;  5IOD A;  3OMG A;  4KJO A;  2F0J A;  3C1E A;  3D8G A;  2EYH A;  4K5W A;  5IGE A;  3SR1 A;  2F0L A;  3MZ5 A;  4DGZ A;  5DAU A;  3SHL A;  3U9O A;  3HEJ A;  4HMI A;  4NKL A;  1AEX A;  2F0D A;  3TME A;  2NUC A;  2OF1 A;  4N9T A;  5KEE A;  2HQE A;  2F0O A;  4QF4 A;  3D4W A;  4IZ8 A;  2KHS A;  3BDC A;  5KIX A;  2EYO A;  2PZT A;  2PYK A;  5CV7 A;  5HUR A;  2F0E A;  4N9P A;  3TP6 A;  2RKS A;  5EKL A;  4RKB A;  3S9W A;  1STN A;  1SYD A;  3EVQ A;  3MXP A;  5CV4 A;  5E1F A;  1SYF A;  3T13 A;  5CC4 A;  5KYL A;  2OXP A;  5IOC A;  2LKV A;  1JOK A;  4EVO A;  2M00 A;  4KY7 A;  1SYC A;  2F0T A;  1SNC A;  1II3 A;  2F0Q A;  3ITP A;  4K8I A;  4ZUJ A;  3V2T A;  4EQN A;  5IGB A;  3TP8 A;  5ISR A;  1EY9 A;  3D4D A;  4KTA A;  1ENA A;  1SNP A;  2RDF A;  2PQE A;  4WRD A;  1KAA A;  2O4X A;  4QB4 A;  5EGT A;  3T16 A;  1JOR A;  2SNM A;  5C3X A;  4B9X A;  2F0I A;  3DHQ A;  3DMU A;  3LX0 A;  5CGK A;  3SK4 A;  2EXZ A;  1KAB A;  1F2Z A;  3SK6 A;  1EZ8 A;  1KDA A;  1A2T A;  2F0U A;  2RBM A;  3EJI A;  3VA5 A;  3NXW A;  2EYJ A;  5I6Y A;  4G57 A;  5I9O A;  1EY4 A;  2OEO A;  5I9P A;  4ODG A;  4WOR A;  5CV5 A;  2F3W A;  2F0S A;  3NUC A;  4HTH A;  2WAC A;  3MEH A;  4PMC A;  4K6D A;  4RKL A;  3QB3 A;  1IHZ A;  5C6A A;  1STA A;  4K2K A;  4HMJ A;  4K14 A;  1EY8 A;  3NP8 A;  1KDC A;  4ZUI A;  5IGF A;  3QOJ A;  2EY5 A;  1A2U A;  1STH A;  1STG A;  3TP7 A;  3ERQ A; 
#chains in the Genus database with same CATH topology
 3E3X A;  1CKN B;  1K0S A;  2WB1 E;  4KHV A;  4GOP A;  1QVG A;  3M85 A;  3K7A B;  3S1M H;  4P2C B;  4HIM A;  3A7L A;  1EY0 A;  2SNS A;  2FXQ A;  3MXG A;  3ZYY X;  4F87 A;  5EBD A;  4CDC C;  2PPB C;  3D6C A;  1AZP A;  3EFX D;  4G7O C;  1LV9 A;  5KGU A;  5CV8 A;  4BBR B;  4QGU A;  1MBY A;  2IHE A;  2D9U A;  5IYB H;  2IJ0 A;  2AQ2 B;  3S1R B;  1HHV A;  1WCM G;  3NTH A;  2X69 A;  2K33 A;  2ASB A;  1KRT A;  4OEL B;  1CKM A;  1WTP A;  3DWP A;  3AFP A;  1NUC A;  4HJ7 A;  5K36 H;  4QJF A;  4I7A A;  4A3K H;  2LXK A;  3F2U A;  1CT1 D;  2LMC B;  1WTV A;  2E2I H;  1JB7 A;  2JA9 A;  4RGM A;  4RHR A;  3L0O A;  4WJ3 M;  4JI8 Q;  1LT4 D;  4IPC A;  1AH9 A;  1HUM A;  2YU9 H;  3S1N B;  3RN5 A;  4DV1 Q;  1YIT A;  1B1Z A;  4OX9 Q;  1HNZ Q;  4DR1 L;  1HR0 L;  1VQB A;  3CQZ H;  4JI5 L;  3ULJ A;  2JA6 B;  4I7Z C;  1GHJ A;  4A3F G;  3TP8 A;  1PRT C;  2TMP A;  1NY4 A;  1NMF A;  2SNM A;  3HRZ C;  3E6Z X;  2F0I A;  4O2D A;  1FR3 A;  1ONL A;  4LF7 Q;  2UU9 L;  4G57 A;  5C0X G;  1F9P A;  2EDG A;  1L0Y B;  2A8V A;  2L15 A;  2OT2 A;  2OQ0 A;  2NVQ B;  4LWC A;  2SEB D;  3CHB D;  4JI1 Q;  1YIJ A;  3D0F A;  1EOV A;  3GTJ B;  3PQI A;  4LF4 L;  1HUN A;  4K14 A;  2KA7 A;  3M3Y B;  1FNW A;  2UXD Q;  2BH2 A;  1GUS A;  3H09 A;  4BY7 H;  3GTK H;  4AYB G;  4LF9 L;  5JOB A;  2N78 A;  4KD3 A;  1WTW A;  4DNT B;  1SYG A;  2EY1 A;  1N33 Q;  1STB A;  1G51 A;  1B8A A;  3GD7 A;  2E2J H;  1F2Y A;  4K2L A;  1B9M A;  3NTI A;  4K5X A;  1EY7 A;  4X66 L;  4A3J B;  3S2D B;  4K6L A;  4X3S A;  2GVB A;  3PO2 H;  1HA6 A;  3ULL A;  1IZ6 A;  4R4I A;  3CCL A;  3HS0 C;  1OXX K;  1YEZ A;  4IPH A;  4A93 B;  1JJC B;  2A74 C;  2A69 C;  3MVV A;  3S16 B;  4CKC A;  3M4Y A;  3A8K E;  1I4G A;  1JC7 A;  4KJN A;  4Y52 H;  2B39 A;  3OSO A;  1MSH A;  5C4Z A;  4X3T A;  5C4H A;  4K5V A;  1PLF A;  4GNX C;  1A62 A;  4BBS G;  2D62 A;  1KC8 C;  3TS2 A;  5IP9 G;  4M1U B;  1A0I A;  1SNO A;  3G71 A;  3NEM A;  1V1P A;  2NN6 I;  3KBX A;  2JYO A;  3RZO H;  3GQB A;  4QMG A;  1OO9 B;  4F8M A;  4Y7N H;  1VQ8 A;  2B8G A;  1S3O A;  2BOS A;  4B3S Q;  1ET6 A;  1A3V A;  4ZK9 B;  4ILW A;  2LXJ A;  1FNU A;  2AQ3 B;  2UUA L;  2PO4 A;  3OMG A;  4DV2 L;  4XYQ A;  2RDH A;  1SFO B;  5LL6 S;  1TWF B;  3MXN B;  1RF2 D;  2AWN A;  2VB2 X;  1Y8N B;  4RCO A;  5M3F G;  4JVZ A;  3I91 A;  1GUG A;  1SMX A;  3HKZ E;  2VL6 A;  5IYC G;  1PH3 A;  4XQJ A;  1JWS D;  4RA8 A;  2R92 B;  3K0Y A;  1SYD A;  1WI5 A;  1E1T A;  3W3A A;  5IOC A;  2JA7 G;  1MHW C;  2SDF A;  1RCV D;  2VY3 A;  2Q8I B;  4A3M G;  4N8F A;  3OHX C;  2E75 C;  4X3K A;  3URY A;  1D5X C;  5GRO A;  5C3E G;  3CCS A;  1GUT A;  4C1N K;  4ZUJ A;  1E1O A;  4DR1 Q;  3I4O A;  1RJT A;  4JI5 Q;  1N36 L;  3ICE A;  1EQR A;  4U67 3;  1GVP A;  1RD9 D;  4DR4 L;  1WOC A;  3SK4 A;  1L0W A;  5GAH C;  1PMR A;  3I4M H;  3GTG B;  1BCP C;  2EVB A;  4WJW A;  4C3J H;  4LUO A;  2R93 B;  2NN6 H;  1EFW A;  1F77 A;  2B2V C;  1EY4 A;  1BBU A;  2ZJQ A;  1VQ6 A;  2A6H D;  2F0S A;  4HTH A;  1BDO A;  3FKI H;  2UU9 Q;  1EL0 A;  3QOJ A;  1X54 A;  1JB3 A;  3DM3 A;  3UDF A;  1TWA B;  3HOX B;  3L3O C;  2WV6 D;  4B3M L;  5M9O A;  1WFQ A;  5BN3 A;  4K0K Q;  1EYD A;  4LF4 Q;  5KRU A;  5DM7 3;  3M7G A;  4R8N A;  4JI3 L;  2NBF A;  3NBI A;  5E4X A;  3ULP A;  1TQO A;  4OIK A;  1STY A;  4LF9 Q;  3VR4 A;  4A3G H;  2A6E C;  2PMZ B;  5ELF A;  4UP9 A;  4O0A A;  1YNJ C;  4DV0 L;  1VMC A;  5ELO A;  2H5X A;  1Q7Y C;  3K80 C;  4J8Q A;  1K8A C;  4C3I B;  3H91 A;  4NXM L;  3JAM c;  1KXL A;  3BJU A;  1YI2 A;  4KY5 A;  5ELC A;  1SMY C;  4LJZ C;  2B2T A;  5FO9 B;  3MWY W;  3E0J A;  4LFB Q;  2XN9 C;  1R4Q B;  4HSV A;  4G7H C;  2K50 A;  3JC6 6;  3RUZ A;  5C4X H;  4HAE A;  3HOV B;  4WJ4 A;  1OXT A;  2DY8 A;  2NWG A;  3C1E A;  2I0Q A;  4NXN L;  1I4P A;  5IGE A;  1N32 L;  1YZ6 A;  3SR1 A;  1DM0 B;  1K73 C;  1K28 A;  2UUA Q;  1JJG A;  4DV2 Q;  4DV4 Q;  4HED A;  4C3H H;  2WAQ G;  3D6W A;  1YBY A;  4IZ8 A;  4OHJ A;  2Q2U A;  2B2U A;  4N9P A;  4RGO S;  2K75 A;  1STN A;  1EOT A;  1SJH D;  3K8A A;  4DXG A;  2JA8 G;  2RSN A;  5IWA L;  2H1E A;  5JPM C;  1K8G A;  1HFG A;  4DAY B;  1TWG B;  4Q5V A;  2Q2H A;  1OXV A;  3L9A X;  3J80 E;  4LF5 L;  1HXY D;  2Q8R E;  2V1C C;  4A3I H;  2R61 A;  3KJO A;  2MQH A;  4JI2 Q;  1VQE A;  2L11 A;  1IKL A;  1PH2 A;  1CSP A;  3LX0 A;  4YWM A;  1X6O A;  2ZTE A;  5J3B A;  3VYR A;  3WOF A;  1PHJ A;  1XMO L;  5GAG C;  2EE1 A;  1N36 Q;  2HQL A;  1CHP D;  3H0G H;  1NE3 A;  5GAE C;  2OEO A;  3BZD B;  2EQS A;  3VR3 A;  3N6R A;  5C44 H;  4HMJ A;  2K14 A;  3TRE A;  2HCC A;  3J81 c;  1R9T B;  4UP8 A;  4A4I A;  1IBK L;  1WCM B;  3OWE B;  5EPL A;  2WII B;  1Q1B A;  5EPJ A;  4B3M Q;  1IBM L;  3E5S A;  3CME A;  4IO9 A;  1VQG A;  2L55 A;  1X56 A;  5JEA H;  1JOO A;  2QDB A;  4KKU A;  4HIO A;  1MJE A;  3NEL A;  2F0H A;  2J7Z A;  2HHH L;  2VS1 A;  5NUC A;  1WTO A;  1G8Z D;  2N49 A;  4XXE A;  4XIG S;  3H3V C;  4ZYS A;  4DV0 Q;  1ICF B;  2B63 G;  4AQY L;  3M4O H;  1Q82 C;  4FF1 A;  1BR9 A;  4X65 L;  5M3M H;  2KJX A;  4NXM Q;  1W3S A;  1Y1V B;  2XRS D;  1PH6 A;  2NVT B;  1CKO A;  3NK9 A;  5IT9 E;  4O42 A;  1TR5 A;  5C5M A;  1EQT A;  4FVM A;  2UUC L;  1BVS A;  3PF5 A;  4DV3 L;  3VYS A;  5I6W A;  4A3F B;  4TRD A;  1VQF A;  5A35 A;  2QDL A;  2F0J A;  4DGZ A;  1L2F A;  2VZA A;  3SHL A;  3NSW A;  1L1O B;  1IXR A;  2CWP A;  5DNF A;  1SLJ A;  4NXN Q;  4DA2 A;  2O5I C;  4L6T B;  4F88 A;  1O7I A;  1IKM A;  1MSG A;  1C48 A;  2PQA B;  1R4P B;  3U4V A;  1UUP A;  1SYF A;  4DAP A;  1E0B A;  2LKV A;  1VDZ A;  4DR5 L;  4HJ9 A;  1NBW A;  1SYC A;  2F0T A;  1B9N A;  4V19 0;  4AYB B;  2CVR A;  4LF8 L;  3I55 A;  3S2H B;  2KOL A;  3K7A H;  2Z0S A;  1KAA A;  4DK6 C;  1SE3 A;  2RVL A;  4LF5 Q;  4X64 L;  3WOE A;  1UEA B;  3I2Z A;  3K5N A;  3DWQ A;  4XT3 B;  1WD0 A;  4QUC A;  1YHQ A;  1SR3 A;  3BZC A;  4PV1 C;  3KLS A;  3TS0 A;  2JXM B;  5FLM G;  4ODG A;  1H9S A;  3DXJ C;  3JAM L;  3MAQ A;  2GVA A;  4BBR H;  1STA A;  4JBW A;  4OEM B;  1I4X A;  4JI7 Q;  3S1R H;  3F8T A;  3GV6 A;  3W1B A;  3CKI B;  1GD7 A;  3HFZ B;  4RHS A;  3K5M A;  1SJE D;  5E3F A;  4FXG C;  4DV7 Q;  4TVA B;  2KHJ A;  3AEV A;  4OIJ A;  3SGI A;  2VNU D;  1U5K A;  3M4Q A;  4N8X 1;  1Y1W G;  2RF4 A;  4JPB W;  3IFD A;  1M1K C;  1IBK Q;  1VF5 C;  3GO5 A;  4UP7 A;  1UNS A;  4MTN A;  5CV9 A;  1AZQ A;  1IBM Q;  1XWE A;  3S1N H;  2F0M A;  1DZ1 A;  1V43 A;  4HJA A;  3I8Z A;  1X3G A;  2HIV A;  4IAL A;  1PRT F;  5M3F B;  1SSO A;  4KHZ A;  2F4V Q;  1NSN S;  2HHH Q;  1A3T A;  1S4Z A;  4A75 A;  4MZ9 A;  2CFM A;  1SND A;  2L0C A;  2RA4 A;  4GNX A;  2C35 B;  2JA7 B;  1VQD A;  4A3M B;  1F2M A;  4YIJ A;  4BY1 G;  4X65 Q;  2K5Q A;  1DOK A;  4OL7 A;  1OXS C;  3GTQ B;  4LMQ D;  1S5C D;  4KJO A;  2UUC Q;  4A3L G;  4DV3 Q;  4RMF A;  1VQL A;  1T5E A;  3J7Y W;  1GKH A;  2RHS B;  1LYL A;  3IKJ A;  3RNU A;  2NVQ H;  2B2T C;  1FVI A;  3UE1 A;  3PO3 B;  2OF1 A;  1LTB D;  2F0O A;  3SE0 A;  1B3Q A;  3GTJ H;  2D0O A;  2WIN B;  3M3Y H;  4ABN A;  4L5T A;  2NTS A;  2VB3 X;  1M8A A;  2ICE C;  1O7L A;  3ND9 A;  5CV4 A;  3HOZ G;  2Z4H A;  1CA5 A;  1XPU A;  4GOP B;  3MFG A;  1G2S A;  3J81 L;  4DR7 L;  2F4I A;  2NVY B;  1YJN A;  2I5L X;  3T53 B;  1DXM A;  4NPS A;  3QG1 A;  2JJQ A;  2UUB L;  4KTA A;  4L63 B;  4DR5 Q;  1VQ4 A;  5EGT A;  4A3J H;  1D2B A;  2V4D A;  4A3D G;  5CGK A;  4LF8 Q;  2B2U C;  2EXZ A;  2O5J C;  1F2Z A;  2KEC A;  4A93 H;  3KF6 B;  3S16 H;  4A3K G;  1EWH A;  5IP7 H;  1WJJ A;  2Y0S B;  3J80 i;  4HSP A;  5I9P A;  1XNQ L;  3GDE A;  4JBK A;  2AHO B;  3X3M A;  2DJG C;  4PMC A;  4RKL A;  1YNN C;  1GO3 E;  3I90 A;  2P5Z X;  1YHB A;  2DNC A;  4DNI A;  2HT1 A;  4TQU S;  3TSS A;  1STG A;  4A3C H;  3TRZ A;  4R4O A;  3CCJ A;  4RH6 A;  4CDF C;  2EPB A;  1U9R A;  1S40 A;  4ME5 A;  5JJK A;  1PRT D;  1EIH A;  3MHB A;  3GTP B;  3PIO 3;  2F3I A;  2GA4 B;  5I2Y A;  1SFO H;  4ZQ3 A;  1J9O A;  5KNC A;  1C9O A;  1TWF H;  1ILQ A;  2AMC B;  3UE0 A;  3UI2 A;  3CC7 A;  1EYA A;  3OIQ A;  1XTD A;  3SK5 A;  2BH8 A;  2N55 A;  4ID6 A;  3AMU A;  1QOH A;  1MJC A;  4DFA A;  4HJ8 A;  4L5S A;  2ZXP A;  2L1B A;  2WAQ B;  4L5R C;  3HOU B;  3OWF A;  2R92 H;  5C4J B;  1KL9 A;  5FK9 C;  5BR8 Q;  1SNM A;  3BYT B;  4EQ5 A;  4ULL A;  3L2P A;  1BCP F;  3NHH A;  2CW0 C;  4OWW B;  3QOL A;  2VUM B;  3W2D A;  2K6A A;  2JSO A;  3ERO A;  1S72 A;  4J1M A;  1LT5 D;  3CXC A;  4BY7 G;  2CWA A;  3P1H A;  3UDX A;  5CBE E;  5IOD A;  3GTG H;  1L0X B;  4YHH L;  1VQI A;  2R93 H;  2WB1 G;  4DUZ L;  2VQF Q;  2RCN A;  2HIX A;  4NKL A;  2A69 D;  1E24 A;  3T51 B;  1SE4 A;  2F52 A;  3Q0A A;  3PO2 G;  4QIW B;  3NWT A;  1IBL L;  5HUR A;  3A54 A;  4HCS A;  2RKS A;  1U4L A;  3K58 A;  1EWI A;  1TWA H;  3HOX H;  3KDF B;  2R7Z G;  2ES2 A;  2HDL A;  5FJ8 G;  3ITP A;  2ZTC A;  1FNV A;  1HZC A;  1NMG A;  1O78 A;  3LGJ A;  2UXB L;  1C7Y A;  2XSC A;  4LUZ A;  4CJ2 C;  1UE1 A;  1STE A;  3DMU A;  3P7J A;  3NBH A;  2UUB Q;  3PIO A;  4C3I H;  4R1J A;  2RBM A;  1VQM A;  2JQO A;  4XYO A;  4DNR B;  1E2V A;  3GTO B;  2JA5 G;  3BVG A;  4K6D A;  5C6A A;  1V1P B;  2B63 B;  4JOI A;  3TQY A;  1XNQ Q;  3AQQ A;  1JR0 D;  2F0F A;  3HOV H;  1KAW A;  1PFN A;  4IUN A;  1NR4 A;  4DU9 A;  4B08 A;  4A3B B;  3CAM A;  3CCR A;  2DN8 A;  1Q8K A;  5BN5 A;  1CZG A;  5KNB A;  1BCP D;  5D65 A;  3K81 C;  1VQC A;  5HGT A;  1X65 A;  1I4H A;  1ZXT A;  1PDQ A;  4YY3 L;  4DF7 A;  1BOS A;  3KF8 B;  1S5D D;  4UY8 C;  2ZM6 L;  5CV6 A;  3J7A F;  2EY2 A;  2C9O A;  4JI4 L;  1A6X A;  2PZW A;  2K01 A;  1TWG H;  4JG2 A;  1EYC A;  4P73 A;  2NTT A;  3FMC A;  1Q86 C;  4IOC A;  1OTC A;  3I73 A;  1EY5 A;  1V1Q A;  3MTS A;  3RD4 A;  4RGT A;  2MGS A;  2F0G A;  2MUY A;  3CCM A;  1HNX L;  4LF6 L;  1NAP A;  3EBE A;  1QVF A;  2A6E D;  4KN4 C;  1ML0 D;  3IAY A;  2E2H B;  1YNJ D;  1N34 L;  1ET9 A;  1U0L A;  3G7L A;  2YTV A;  1PH8 A;  4MN3 A;  2Z6K A;  5KEE A;  4DUZ Q;  4A3E G;  4DK0 A;  4JBJ A;  2RDG A;  3Q23 A;  1SMY D;  1TWC B;  1ZKO A;  4RKB A;  3EVQ A;  5KYL A;  2OXP A;  1SN8 A;  1BBW A;  2M00 A;  3G6J B;  2RSO A;  1WCM H;  5EJW A;  2L9H A;  2ZTD A;  4EQN A;  4FYD A;  1J5E L;  3AB9 A;  3M4P A;  3D4D A;  1AFP A;  1H9M A;  1XXG A;  3PCO B;  2LSS A;  2WKC A;  3T16 A;  3J7Z C;  1VQ5 A;  2JEA I;  5M5W B;  3S24 A;  2LY7 A;  5I2X A;  3S14 B;  1SBB B;  1Z6H A;  2UXB Q;  4B3T L;  5M5Y B;  4X3U A;  4BWG B;  1VQ7 A;  1BUV T;  2VXW A;  3F1Z A;  2B3G A;  3GTL B;  3Q6S A;  2A1A A;  1X3E A;  4RFB A;  3RLF A;  3QB3 A;  1JQY D;  2QA4 A;  5LMN L;  1X9N A;  2A68 C;  3PUX A;  1Y1V H;  4JV5 L;  4C3H G;  2NVT H;  2Q8T A;  1HR0 Q;  1J8I A;  3C3L A;  4DV6 L;  4WFN 3;  3TBI B;  2KQ3 A;  4JYA L;  1PYW D;  1C8C A;  1VQ9 A;  3BG3 A;  3HKZ G;  1DCZ A;  1CQV A;  3MFY A;  3L7Z C;  1E3P A;  4A3F H;  3E9I A;  4BY1 B;  4GKK L;  2PW5 A;  1TU2 B;  4OWT B;  2MFI A;  2XVS A;  1RDP D;  2NYZ D;  3HG9 A;  4V0B A;  2VW9 A;  1ZYR C;  5C0X H;  2IW3 A;  2JEB I;  1Q3L A;  2ZXO A;  2L12 A;  3V96 A;  5C3W A;  2IPK D;  3OPO A;  1I50 B;  1RTO A;  3FRP B;  4YY3 Q;  1TWH B;  3KBG A;  3HOY B;  2OTL A;  1EWC A;  3W1G A;  3Q8D A;  1CA6 A;  1Z9F A;  3HOZ B;  2Z1C A;  5J22 A;  2ZM6 Q;  3S2H H;  2C5C A;  4I65 A;  4EQO A;  1QG7 A;  4MIU A;  3GTM B;  3K6O A;  2AUK A;  4MTK A;  1QB5 D;  2Z9H A;  3W5O A;  2E5L L;  1K3B C;  2Y0S E;  4OON A;  1QVC A;  3GP7 A;  4TSS A;  4X66 Q;  4A3D B;  1K0R A;  2J0T D;  4JBM A;  1HNX Q;  4LF6 Q;  5KND A;  1LAC A;  2KCN A;  3CD6 A;  3Q24 A;  1N34 Q;  2K05 A;  1M90 C;  1FJG L;  4AIM A;  3OYY A;  4GN5 A;  4UHV A;  1HR0 W;  3MC0 B;  3MXN A;  3T13 A;  5IP9 H;  3CRK C;  2WFW A;  3J7A V;  3BYY B;  1MIU A;  1HTP A;  1D8L A;  2I46 A;  1SNC A;  2PNR C;  3STB C;  4QQB X;  1TII D;  4WRD A;  3RMH A;  3I4N B;  3U4Z A;  3AFQ A;  5EPK A;  2K5D A;  3DHQ A;  3I7F A;  3OIP A;  3VA5 A;  1LTL A;  4HJ5 A;  1H9K A;  1QJO A;  3KK7 A;  5M3F H;  3S1Q B;  2EJF C;  3MA2 B;  2E74 C;  2F3W A;  4QL5 A;  3A56 A;  3VYU A;  1QNK A;  1NTG A;  2B2Y A;  2LFN A;  5IYC H;  2K5V A;  4IJL A;  4ZUI A;  2IHF A;  2ZXR A;  2JA7 H;  1B4O A;  3IL8 A;  4A3M H;  4MNO A;  3Q22 A;  4RWS C;  5LMN Q;  1VQN A;  4JV5 Q;  2F0V A;  1IW7 C;  1Q81 C;  3GTQ H;  3T4A C;  3CPW A;  3FEW X;  4KKT A;  4JYA Q;  1HFN A;  3NQT A;  3K5L A;  1MGS A;  4DR4 Q;  3CP0 A;  4HR7 B;  1GM5 A;  4QIW E;  4JOI C;  1EQV A;  2FMM A;  1AN8 A;  1VQA A;  3PO3 H;  4IUV A;  3TZU A;  2ZJP A;  1O7Z A;  1VQH A;  1NCV A;  3BS1 A;  2IX3 A;  4H02 A;  1EY6 A;  4HCE A;  4DAM A;  4GN3 B;  5JAV A;  1YJ9 A;  2D0P A;  4DR2 L;  4C2M B;  5HGQ A;  4KMU C;  2R7Z B;  2NVY H;  1JT8 A;  1JOQ A;  1PRT B;  3R3O A;  3CCU A;  1HNW L;  4JI3 Q;  2WKD A;  2OWO A;  3D8G A;  1VQK A;  2EYH A;  3U50 C;  5IYD G;  1H9S B;  5DAU A;  3F2C A;  1K83 B;  2E5L Q;  3HEJ A;  1PH7 A;  3PUW A;  1P8L A;  4OGQ C;  4N9T A;  1LTT D;  1GOZ A;  2IX0 A;  1DD2 A;  3ERS X;  2ALY B;  2EYO A;  1GUO A;  5D3D A;  2JA5 B;  2QGQ A;  5EKL A;  5A2Q L;  1KQS A;  1VS0 A;  4EVO A;  3WWV A;  1T5X D;  2RQX A;  1II3 A;  1BF4 A;  1C0A A;  3V2T A;  1VQO A;  3GTP H;  3PSI A;  2Z6K C;  5E7N A;  1PYB A;  3MXU A;  3M7N A;  2NZH A;  2PQE A;  2JE6 I;  2B2W A;  4BXX H;  1N32 Q;  2QIL A;  3VDY A;  2NZO A;  4CJ0 B;  4IN3 A;  2KBN A;  3HOU H;  3PV0 A;  3DWA A;  3S15 B;  5C4J H;  3KJP A;  4Z9C B;  1E2Z A;  4GNX B;  1HJP A;  2CH4 W;  4RCN A;  2VUM H;  5FLX c;  3V05 A;  1STH A;  2SOB A;  5IWA Q;  3HOW G;  1DON A;  3JAM E;  1FGU A;  1UE5 A;  4IUT A;  3A0J A;  4F7X A;  2G9H D;  4KI0 A;  4YCV A;  1U4R A;  4R8I A;  1XMO Q;  4ZKC B;  2ID0 A;  2YTX A;  4IOA A;  1PZJ D;  2R3Z A;  3K5O A;  2ENB A;  5J1Z A;  4BBS B;  2PW7 A;  2K1B A;  1YNN D;  3PUV A;  3H3V H;  1I4R A;  5EKI A;  4A3E B;  1FYC A;  4KK7 A;  1A15 A;  1PFM A;  1RKN A;  2K52 A;  2F3V A;  4ZKB B;  2KUM A;  1XPO A;  1Q46 A;  3FP9 A;  2FMC A;  3CC4 A;  3T56 B;  1PTO C;  4H44 C;  3QWN A;  4DR2 Q;  4L8J A;  2A5H A;  4J15 A;  2IY5 B;  5E4W C;  1HQM C;  2KHI A;  3OW2 A;  1BCP B;  3MZ5 A;  1WD1 A;  3U58 A;  2KCT A;  3T1H L;  4IFD I;  3CPF A;  2IWH A;  3GTO H;  1DJR D;  1XNR L;  3ND8 A;  4GLV B;  2B63 H;  2JA6 H;  4OO1 I;  4AQY Q;  1KNA A;  5E1F A;  2CW0 D;  3K59 A;  5C3E B;  2DY7 A;  1I4Q A;  2FFK B;  5LHY 1;  3DM1 A;  2JN4 A;  1JE4 A;  1S5B D;  1J6Q A;  1TY2 A;  3WDN A;  1LTS D;  1I3Q B;  1TS5 A;  4K8I A;  4A3B H;  3HKZ B;  3I4L A;  1PH4 A;  2HD3 A;  3UDI A;  4JK1 C;  3HGB A;  2TSS A;  2PQA A;  3DUZ A;  1JOR A;  2PCF B;  5T1I A;  5C3X A;  1SEB D;  3A8J E;  4QCL A;  1PV4 A;  4GZY C;  2BE5 C;  1EZ8 A;  1HZA A;  2E2D C;  2ATW A;  2F0U A;  4IQZ A;  3J81 E;  5DLQ E;  3CCQ A;  3G4S A;  3NWS A;  1W2B A;  4R4C A;  3A8I E;  1FD7 D;  2KED A;  2A19 A;  2K03 A;  2EIF A;  3MEH A;  5LMU L;  1IHZ A;  2Z6B A;  3C46 A;  4K2K A;  1RIP A;  5IYB G;  1G29 1;  2PMZ E;  3ERQ A;  4IJH A;  4J6H A;  1EIG A;  3M9B A;  3S2D H;  1RHP A;  4IFD H;  1Z7T A;  4JI0 L;  2E8G A;  1Q12 A;  2E2H H;  3NQI A;  4KHP L;  4OO1 H;  1TS4 A;  5K36 G;  2I5H A;  2B2Y C;  3A7A B;  4LAA A;  4X64 Q;  1G91 A;  4ALP A;  3T1Y L;  1GJX A;  5JEA J;  2F0P A;  2K04 A;  4C56 C;  1HQR D;  1FGB D;  5FLM H;  1X3Q A;  1SNQ A;  2F0N A;  3LWU A;  4KY6 A;  1CZW A;  1XTC D;  1TWC H;  2NVX B;  4C3I G;  2X6L A;  1O80 A;  1LTG D;  5CR3 A;  3TP5 A;  3BZK A;  3CCE A;  2EYP A;  1Y8P B;  3VA7 A;  1SYE A;  5IGG A;  2E76 C;  4R4Q A;  5M5W H;  3NBH B;  4IUR A;  3S14 H;  5L37 A;  3S17 B;  1WYD A;  4BS9 A;  4POF A;  3VYT A;  5M5Y H;  4LF7 L;  3I3C A;  4JCV E;  1F9Q A;  1EIY B;  3GTL H;  1UAP A;  1N9W A;  1AEX A;  2F0D A;  4L5Q A;  3D4W A;  2PI2 E;  3T1H Q;  5I4D A;  1BNZ A;  2JA8 B;  3S9W A;  2CH4 A;  3K7U C;  5FLX L;  1PYS B;  2M9V A;  4BY1 H;  3A5U A;  1ASY A;  4XDX A;  5ELB A;  2Q2T A;  4YCW A;  1QZG A;  1IYJ B;  1EY9 A;  3ONA B;  3PUZ A;  4ZCK A;  4ZLT F;  4RG1 A;  1BBX C;  1F9S A;  3OW7 A;  4A3L H;  1QZH A;  4DN4 M;  2Q2I A;  4OWX B;  4CBV A;  2WP8 J;  4R4T A;  4QUF A;  2KCM A;  1ZEQ X;  4IUU A;  3OTO L;  2KCC A;  3RLO A;  1I50 H;  4IPD A;  1K8O A;  1TWH H;  3HOY H;  2K32 A;  1NNX A;  4B3R L;  2MHV A;  3HOZ H;  2CCZ A;  3KF6 A;  1ICW A;  3I72 A;  1A2U A;  1QUQ A;  2B2W C;  5IY0 A;  4EX5 A;  5LMU Q;  5LL6 X;  1S5F D;  2MO1 A;  4S3S A;  3GTM H;  4B3S L;  4DR7 Q;  2B29 A;  2R7D A;  2HDM A;  1EIF A;  1ESF A;  2DJF C;  5M5X B;  1X32 A;  1ILP A;  3H6M A;  1S5E D;  4A3D H;  1HPC A;  4JI0 Q;  1LAB A;  1XYI A;  4KHP Q;  2K5H A;  3I70 A;  3BDL A;  4FF2 A;  1EU3 A;  1SRU A;  3JAM i;  4X6A H;  3FVQ A;  3T1Y Q;  1DOM A;  2A68 D;  1TT2 A;  4EQP A;  1BKB A;  4KV6 A;  3UDG A;  4P74 A;  3PMF A;  1BQQ T;  2AKW B;  4RGN A;  3E0E A;  1MKH A;  1KNE A;  1JIC A;  2O2L D;  1Y1V G;  1E2W A;  1JCK B;  3I4N H;  4A76 A;  1CKN A;  1NR2 A;  3N52 A;  5HY6 A;  5G3L F;  1YVC A;  1DYQ A;  3I4M G;  1ZYR D;  1YNX A;  3FDT A;  1GUW A;  3S1Q H;  3CRL C;  4C3J G;  1CUK A;  2NN6 G;  3F2B A;  1PZK D;  4AYB E;  2KHS A;  3TDQ A;  4KKS A;  4FXK C;  4OXP A;  2F0E A;  3FKI G;  2G9D A;  1IL8 A;  2IL8 A;  3GV3 A;  3LWE A;  2QKI C;  1JJ2 A;  5IE8 A;  4FO2 A;  1YHA A;  4K0K L;  1V1O A;  3HOW B;  1SAP A;  1Y69 U;  5ISR A;  2R7F A;  1ENA A;  1IYU A;  1PA6 A;  1PTO B;  3D31 A;  3KDF A;  4BA2 I;  1I94 L;  1I6H B;  4B9X A;  3QIA A;  4IFD J;  5CYU A;  4A3G G;  4YHH Q;  2G5D A;  5D3I B;  1A2T A;  1L1O C;  3R2I A;  3J80 c;  1C4Q A;  4X62 L;  4LFA L;  1R9T H;  4GLX A;  1QWY A;  4JC0 A;  5C0X I;  3R2T A;  1JWM D;  1IBL Q;  3OTO Q;  4C2M H;  3NP8 A;  2R7Z H;  1KRS A;  4QY7 A;  1G6Z A;  5FJ8 H;  3NEN A;  3CF5 A;  3J81 i;  3STB D;  4LFB L;  2JP1 A;  4B3R Q;  1Y1W B;  4CDD C;  3NTK A;  1X3F A;  1D6E C;  2XWB B;  4DAV A;  4CDE C;  3P75 A;  5C4X G;  1LM0 A;  4YWK A;  2ZJR A;  4GN4 B;  3SXH A;  2MPM A;  1D1K A;  2XTI A;  1K83 H;  1K9M C;  3VR5 A;  4GKJ L;  4PZ8 A;  1MD2 D;  5CBA E;  3SVM A;  4DV4 L;  1EFI D;  1M4V A;  1UWV A;  1EUJ A;  1D5Z C;  1HH2 P;  5JJZ A;  1SRO A;  4NP5 A;  1EU4 A;  2JA5 H;  4PZ6 A;  5G3L D;  4TKO B;  4XTC S;  2N8N A;  2EY6 A;  3U9S A;  3RZD B;  1HCZ A;  1B53 A;  1SE2 A;  4NDX A;  5D14 A;  2BDO A;  2KEN A;  3A74 A;  4E6I A;  2F0K A;  3TN2 A;  2CHB D;  2D2C C;  1V9P A;  3KF8 A;  1IW7 D;  3DEO A;  1PH5 A;  4RAU C;  1JMC A;  2XIW A;  3C1F A;  4LW1 A;  2EYF A;  3SEB A;  2NB0 A;  3CCV A;  2IT1 A;  4A3I G;  4JI2 L;  5IGD A;  4KN7 C;  1CSQ A;  1PVO A;  3KOJ A;  1SE8 A;  2H4O A;  1ESR A;  2LS0 1;  4FNF A;  3S1M B;  1Y8O B;  2FIN B;  2HCI A;  5IT9 c;  2QCP X;  4DR6 L;  1VQJ A;  1CFM A;  4P72 A;  3S15 H;  1XMQ L;  3H0G G;  3CMA A;  1KIX A;  1KD1 C;  2CQA A;  5T1G A;  3A5Z B;  3K0X A;  1WTX A;  3PO3 G;  2FHT A;  5C44 G;  1WVL A;  2L5T A;  1HZ9 A;  1AW7 A;  4PZ7 A;  3RLN A;  4DR3 L;  5ELN A;  1CHQ D;  4JI4 Q;  5JJL A;  2EOT A;  3CU7 A;  3QJY A;  4MHE A;  4G7Z C;  1SXT A;  2AQ1 B;  2ZT9 C;  3PUY A;  1LTR D;  4DKA C;  1B70 B;  1BO0 A;  1QNU A;  4DV5 L;  1FL0 A;  1AE2 A;  3R93 A;  1SNP A;  2RDF A;  1T9H A;  5COR A;  2DUD A;  5AJ3 L;  4UAI A;  1PH9 A;  1NJI C;  1I6V C;  4A3K B;  5JEA G;  1PZI D;  2I5M X;  1KDA A;  1ASZ A;  3IFT A;  3KYH C;  1XPR A;  1PTO F;  2E2I B;  5I9O A;  1I94 Q;  4XT1 B;  4BBS H;  4DK3 C;  1WTR A;  2J4X A;  1TXY A;  5CV5 A;  4A3E H;  2DGY A;  3NUC A;  3K57 A;  2YU9 B;  2Y0S G;  2A73 B;  3BDO A;  5FOB B;  1E22 A;  4X62 Q;  5M3M G;  4LFA Q;  2EY5 A;  2M2L A;  3CQZ B;  4GOP C;  1E7Z A;  4PG3 A;  3TZD A;  1H9J A;  2CQO A;  2OQK A;  5KYI A;  3G48 A;  5J39 A;  1J5E Q;  1Q90 A;  3SK8 A;  1HA5 A;  1TS2 A;  5EBC A;  4ZRZ A;  1CTM A;  1X3P A;  2WAQ E;  1EQQ A;  1KTK A;  2I07 B;  4H0L C;  4P75 A;  5JPN C;  5K5P A;  4PNY A;  4B3T Q;  4BXX G;  4KLK A;  2EJG C;  4GKJ Q;  2CKZ B;  2N88 A;  5FKA C;  1XJV A;  3F2D A;  4GS3 A;  5C3E H;  4R9W A;  3HOU G;  2QW7 A;  5EKK A;  4DUY L;  1I3Q H;  4POG A;  4DV6 Q;  3I56 A;  1KDB A;  1PH1 A;  4BY7 B;  3GTK B;  5C5L A;  2VUM G;  1LT3 D;  5F2D A;  2VQE L;  4GKK Q;  2MJ8 A;  1EYG A;  2WB1 B;  3AU7 A;  4YWL A;  3QO2 A;  4K5W A;  2BDN A;  2E2J B;  3A55 A;  2ICI A;  2F0L A;  4UDU C;  3FHW A;  3VR2 A;  2MP1 A;  2K7V A;  3PO2 B;  3EIV A;  4BA1 I;  3J80 L;  2HQE A;  4QF4 A;  5KIX A;  4BBR G;  2PZT A;  3BU2 A;  2A6H C;  4DR6 Q;  4GLA C;  3TP6 A;  4JI7 L;  1XMQ Q;  3MXP A;  2XGT A;  1G6P A;  1MI2 A;  5CC4 A;  3CC2 A;  1H9R A;  4LUV A;  1A63 A;  3RR5 A;  2NZ1 D;  1JOK A;  4U68 A;  1PTO D;  1N8R C;  2JK8 A;  3PF4 A;  1CQF A;  2RCF A;  2F0Q A;  2YV5 A;  4DV7 L;  3RZO B;  5IGB A;  4DR3 Q;  2KVM A;  2Z8L A;  4Y7N B;  1K8M A;  2O4X A;  4QB4 A;  3OOC A;  4PQX A;  1AP0 A;  5BN4 A;  5A2Q E;  1Z47 A;  1ROD A;  4DV5 Q;  4LFC L;  5DM6 3;  3EJI A;  1O7Y A;  5AJ3 Q;  2EYJ A;  5I6Y A;  2RHQ B;  2NVX H;  1B50 A;  4WOR A;  1I5F A;  2F4V L;  1FJG Q;  3RN2 A;  4O1N A;  5AFW A;  5LMN W;  4FP5 D;  5IGF A;  1TY0 A;  2JA6 G;  5EAY A;  3AYH B;  3H3V I;  1JE5 A;  3TEH B;  1LT6 D;  3NE5 B;  5JJI A;  3PIP 3;  4DAY A;  3S17 H;  4APV A;  1ENC A;  4FF4 A;  2L4N A;  2R6G A;  4A3B G;  2PI2 A;  2BE5 D;  1G2T A;  4HIK A;  4M8A A;  2KEE A;  5IIF A;  2BA1 A;  1CM9 A;  3I4M B;  1VMP A;  3KLR A;  4P71 A;  5IT9 L;  1WTQ A;  1VQP A;  3HKS A;  4C3J B;  4H7B A;  5C0X J;  1V8Q A;  1D5M C;  4B9W A;  1RL2 A;  2JA8 H;  4CKE A;  3P20 A;  1EZ6 A;  3HZX A;  3FKI B;  1HZB A;  4K8J A;  5H1S E;  3E9H A;  1CK1 A;  1Y14 B;  3EN2 A;  1UE6 A;  3O13 A;  4DK1 A;  1A3U A;  2PZU A;  3EA6 A;  3VR6 A;  2OTJ A;  4DUY Q;  3EQL C;  1F2L A;  1UE7 A;  5DEH A;  4KD4 A;  4A3J G;  4IFD G;  1OXU A;  3ER0 A;  4JI6 L;  1D1I A;  2VQE Q;  4A3G B;  1TVX A;  3CW2 C;  4OO1 G;  4A93 G;  4HMI A;  5ELD A;  5IP7 G;  3MEF A;  2NUC A;  2F1M A;  2PYK A;  5CV7 A;  1PXU A;  1UEB A;  4CKB A;  4H13 C;  1IL2 A;  3FPU B;  5FO7 B;  4JW0 A;  4A3C G;  2K28 A;  1EEF D;  5TSS A;  4KY7 A;  2QF7 A;  4IUP A;  4IUQ A;  1GUN A;  2IX1 A;  2OCE A;  3KFU A;  5M5X H;  1Q8I A;  2XWJ B;  1KHI A;  1TS3 A;  1QCB D;  3SDZ A;  1QIL A;  1HNW Q;  1PFS A;  5C4X B;  4HN7 A;  5IYD H;  3KLS X;  3PIP A;  1KAB A;  1U4M A;  5JVH 3;  3SK6 A;  1P16 A;  3BVM A;  1LTI D;  3NXW A;  2YTY A;  1CI3 M;  1D7Q A;  5JVG 3;  1DGS A;  2UXC L;  3LNN A;  5FO8 B;  1L1O A;  2PNH A;  1PFB A;  4C3H B;  2WAC A;  4LFC Q;  2HUG A;  2EJM A;  5BR8 L;  2R92 G;  1EY8 A;  2YYZ A;  1KDC A;  3B6Y A;  3J81 j;  4FDB A;  3IRB A;  1GXD C;  3TP7 A;  1LTA D;  3X3N A;  1W6J A;  1LUZ A;  4CGY B;  3OMC A;  3KUP A;  4ZAI A;  2EYL A;  3R8B A;  3DEP A;  1B2T A;  2F0W A;  4NW2 A;  1A8V A;  2D5D A;  4CHT B;  4A3I B;  1B7Y B;  2DNE A;  1AE3 A;  1SYB A;  1HTL D;  4C1N I;  4XQN A;  1HRJ A;  2EYM A;  2VQF L;  2R93 G;  3PGZ A;  3HP3 A;  3NPP A;  3DLL A;  3FPP A;  5COY A;  4IPG A;  1B44 D;  2FJ2 A;  4G4K A;  4Q0F A;  1WTH A;  3KLW A;  4DPG A;  2XRQ D;  3H0G B;  4FF3 A;  3G6E A;  5EQ0 A;  2EXD A;  1KLG D;  2MO0 A;  5C44 B;  2K5N A;  3HOX G;  1X55 A;  1ENF A;  2AWO A;  2BA0 A;  4PMB A;  5IGC A;  2F03 A;  3HOY G;  3HOW H;  1U4P A;  4CJ1 B;  4FXD A;  1EEI D;  3J7A 5;  1PTO H;  4DXF A;  4YCU A;  1I6H H;  1XX8 A;  4NMZ A;  4JI8 L;  2N3S A;  4EGV A;  2GN5 A;  2X6G A;  2MNA A;  4DV1 L;  3ZJY C;  1TKW B;  1W6K A;  1SDF A;  3U9O A;  1Q1E A;  4OX9 L;  3BVZ A;  1HNZ L;  3TME A;  4JI6 Q;  2K4K A;  4PMW A;  3QR8 A;  2Z4I A;  3BDC A;  1QUQ B;  4UPA A;  2QEX A;  3M4O B;  5GQO A;  1GHK A;  2B8F A;  4LK1 C;  4AH6 A;  3C2P A;  2B2V A;  4HID A;  5M3M B;  4LNQ A;  4XQQ A;  1F9R A;  1Y1W H;  2XNA C;  5ELE A;  3H15 A;  3HOV G;  1VCI A;  1RTN A;  5GAD C;  1H95 A;  1LLR D;  1B3A A;  1DOL A;  1BXT A;  1QE6 A;  2QEJ C;  4ME3 A;  5FLX E;  3I4N G;  1K3R A;  2EZV A;  1LO5 D;  4JI1 L;  3H94 A;  2K5W A;  1YJW A;  2BCO A;  1IYV A;  2UXD L;  4NB3 A;  3RZD H;  1XNR Q;  1KLU D;  2AUJ D;  3D4R A;  5CMD A;  1VF7 A;  3D3R A;  2UXC Q;  1N33 L;  1JWU D; 
#chains in the Genus database with same CATH homology
 4KHV A;  3M85 A;  3K7A B;  4P2C B;  3A7L A;  1EY0 A;  2SNS A;  3MXG A;  3ZYY X;  4F87 A;  5EBD A;  2PPB C;  3D6C A;  1AZP A;  3EFX D;  4G7O C;  1LV9 A;  5KGU A;  5CV8 A;  4BBR B;  1MBY A;  2D9U A;  2IJ0 A;  2AQ2 B;  3S1R B;  1HHV A;  3NTH A;  2X69 A;  2K33 A;  1WTP A;  3DWP A;  1NUC A;  5K36 H;  3F2U A;  1CT1 D;  2LMC B;  1WTV A;  4RGM A;  4RHR A;  1LT4 D;  1HUM A;  3S1N B;  1B1Z A;  2JA6 B;  4I7Z C;  1GHJ A;  3TP8 A;  1PRT C;  2TMP A;  2SNM A;  3HRZ C;  3E6Z X;  2F0I A;  1FR3 A;  1ONL A;  4G57 A;  5C0X G;  1F9P A;  2EDG A;  1L0Y B;  2OT2 A;  2NVQ B;  2SEB D;  3CHB D;  3GTJ B;  1HUN A;  4K14 A;  2KA7 A;  3M3Y B;  1FNW A;  1GUS A;  3H09 A;  5JOB A;  4KD3 A;  1WTW A;  4DNT B;  1SYG A;  2EY1 A;  1STB A;  3GD7 A;  1F2Y A;  4K2L A;  1B9M A;  3NTI A;  4K5X A;  1EY7 A;  4A3J B;  3S2D B;  4K6L A;  4X3S A;  1HA6 A;  3HS0 C;  1OXX K;  4A93 B;  2A74 C;  2A69 C;  3MVV A;  3S16 B;  4CKC A;  3M4Y A;  3A8K E;  1I4G A;  1JC7 A;  4KJN A;  2B39 A;  3OSO A;  1MSH A;  5C4Z A;  4X3T A;  5C4H A;  4K5V A;  1PLF A;  2D62 A;  4M1U B;  1SNO A;  1V1P A;  2NN6 I;  3KBX A;  2JYO A;  3GQB A;  4QMG A;  1OO9 B;  4F8M A;  2B8G A;  2BOS A;  1ET6 A;  1A3V A;  4ZK9 B;  4ILW A;  1FNU A;  2AQ3 B;  2PO4 A;  3OMG A;  4XYQ A;  2RDH A;  1SFO B;  5LL6 S;  1TWF B;  1RF2 D;  2AWN A;  2VB2 X;  1Y8N B;  4RCO A;  3I91 A;  1GUG A;  4XQJ A;  1JWS D;  4RA8 A;  2R92 B;  3K0Y A;  1SYD A;  3W3A A;  5IOC A;  2Q8I B;  2SDF A;  1RCV D;  3URY A;  3OHX C;  2E75 C;  4X3K A;  1D5X C;  1GUT A;  4C1N K;  4ZUJ A;  1RJT A;  4U67 3;  1RD9 D;  3SK4 A;  3GTG B;  1PMR A;  1BCP C;  2EVB A;  4WJW A;  2R93 B;  2NN6 H;  1F77 A;  2B2V C;  1EY4 A;  2A6H D;  2F0S A;  4HTH A;  1BDO A;  1EL0 A;  3QOJ A;  1JB3 A;  1TWA B;  3HOX B;  3L3O C;  2WV6 D;  5M9O A;  5BN3 A;  1EYD A;  5KRU A;  5DM7 3;  3M7G A;  4R8N A;  2NBF A;  3NBI A;  5E4X A;  1TQO A;  4OIK A;  1STY A;  3VR4 A;  2A6E C;  2PMZ B;  5ELF A;  1YNJ C;  1VMC A;  4J8Q A;  4C3I B;  3H91 A;  4KY5 A;  5ELC A;  1SMY C;  4LJZ C;  2B2T A;  5FO9 B;  3MWY W;  3E0J A;  2XN9 C;  1R4Q B;  4HSV A;  4G7H C;  3RUZ A;  3HOV B;  4HAE A;  1OXT A;  2DY8 A;  2NWG A;  3C1E A;  1I4P A;  5IGE A;  3SR1 A;  1DM0 B;  4HED A;  3D6W A;  4IZ8 A;  4OHJ A;  2B2U A;  4N9P A;  4RGO S;  1STN A;  1EOT A;  1SJH D;  4DXG A;  2RSN A;  2H1E A;  5JPM C;  1HFG A;  1TWG B;  4Q5V A;  3J80 E;  1OXV A;  3L9A X;  1HXY D;  2Q8R E;  2R61 A;  2L11 A;  1IKL A;  3LX0 A;  3VYR A;  3WOF A;  2EE1 A;  1CHP D;  2OEO A;  3BZD B;  3VR3 A;  3N6R A;  4HMJ A;  2HCC A;  1R9T B;  1WCM B;  3OWE B;  5EPL A;  2WII B;  1Q1B A;  5EPJ A;  3E5S A;  2L55 A;  5JEA H;  1JOO A;  2QDB A;  4KKU A;  2F0H A;  2J7Z A;  5NUC A;  1WTO A;  1G8Z D;  4XXE A;  4XIG S;  3H3V C;  4ZYS A;  4FF1 A;  1BR9 A;  2KJX A;  1Y1V B;  2XRS D;  2NVT B;  3NK9 A;  5IT9 E;  4O42 A;  1TR5 A;  5C5M A;  1EQT A;  4FVM A;  3VYS A;  5I6W A;  4A3F B;  4TRD A;  5A35 A;  2F0J A;  4DGZ A;  3SHL A;  3NSW A;  5DNF A;  4DA2 A;  2O5I C;  4L6T B;  4F88 A;  1IKM A;  1MSG A;  1C48 A;  1R4P B;  1UUP A;  1SYF A;  4DAP A;  1E0B A;  2LKV A;  1VDZ A;  1SYC A;  2F0T A;  1B9N A;  4V19 0;  4AYB B;  2CVR A;  3S2H B;  2KOL A;  1KAA A;  1SE3 A;  2RVL A;  3WOE A;  1UEA B;  3K5N A;  3DWQ A;  4XT3 B;  1WD0 A;  4QUC A;  4PV1 C;  3KLS A;  2JXM B;  4ODG A;  1H9S A;  3DXJ C;  3JAM L;  3MAQ A;  1STA A;  4JBW A;  1I4X A;  3GV6 A;  3CKI B;  4RHS A;  3K5M A;  1SJE D;  5E3F A;  4FXG C;  4OIJ A;  2VNU D;  3IFD A;  1VF5 C;  3GO5 A;  1UNS A;  5CV9 A;  1AZQ A;  1XWE A;  2F0M A;  1DZ1 A;  1V43 A;  3I8Z A;  4IAL A;  1PRT F;  5M3F B;  1SSO A;  4KHZ A;  1NSN S;  1A3T A;  1S4Z A;  1SND A;  2L0C A;  2RA4 A;  2JA7 B;  4A3M B;  1F2M A;  4YIJ A;  2K5Q A;  1DOK A;  4OL7 A;  1OXS C;  3GTQ B;  4LMQ D;  1S5C D;  4KJO A;  1T5E A;  3J7Y W;  3IKJ A;  2B2T C;  3PO3 B;  2OF1 A;  1LTB D;  2F0O A;  3SE0 A;  2WIN B;  4ABN A;  2NTS A;  2VB3 X;  1M8A A;  2ICE C;  1O7L A;  3ND9 A;  5CV4 A;  2Z4H A;  1CA5 A;  3MFG A;  1G2S A;  3J81 L;  2F4I A;  2NVY B;  3T53 B;  1DXM A;  3QG1 A;  4KTA A;  4L63 B;  5EGT A;  1D2B A;  2V4D A;  5CGK A;  2B2U C;  2EXZ A;  2O5J C;  1F2Z A;  2KEC A;  1EWH A;  2Y0S B;  5I9P A;  4HSP A;  3X3M A;  4PMC A;  4RKL A;  1YNN C;  3I90 A;  2DNC A;  4TQU S;  3TSS A;  1STG A;  4RH6 A;  2EPB A;  1U9R A;  4ME5 A;  1EIH A;  1PRT D;  3MHB A;  3GTP B;  3PIO 3;  2GA4 B;  5I2Y A;  4ZQ3 A;  1J9O A;  5KNC A;  1ILQ A;  3UI2 A;  1EYA A;  3OIQ A;  3SK5 A;  2N55 A;  4ID6 A;  3AMU A;  1QOH A;  4DFA A;  2ZXP A;  2L1B A;  2WAQ B;  3HOU B;  3OWF A;  5C4J B;  5FK9 C;  1SNM A;  3BYT B;  4ULL A;  1BCP F;  3NHH A;  2CW0 C;  3QOL A;  2VUM B;  3W2D A;  2K6A A;  2JSO A;  3ERO A;  4J1M A;  1LT5 D;  3P1H A;  5CBE E;  5IOD A;  1L0X B;  4NKL A;  2A69 D;  3T51 B;  1SE4 A;  3Q0A A;  4QIW B;  3NWT A;  5HUR A;  3A54 A;  4HCS A;  2RKS A;  1U4L A;  3K58 A;  2HDL A;  3ITP A;  1FNV A;  1O78 A;  2XSC A;  4CJ2 C;  1STE A;  3DMU A;  3P7J A;  3NBH A;  2RBM A;  4XYO A;  4DNR B;  1E2V A;  3GTO B;  3BVG A;  4K6D A;  5C6A A;  1V1P B;  2B63 B;  1JR0 D;  2F0F A;  1PFN A;  4IUN A;  1NR4 A;  4DU9 A;  4B08 A;  4A3B B;  2DN8 A;  5BN5 A;  1CZG A;  5KNB A;  1BCP D;  5D65 A;  5HGT A;  1I4H A;  1ZXT A;  1PDQ A;  4DF7 A;  1BOS A;  1S5D D;  5CV6 A;  3J7A F;  2EY2 A;  2C9O A;  1A6X A;  2PZW A;  2K01 A;  1EYC A;  2NTT A;  3FMC A;  3I73 A;  1EY5 A;  3MTS A;  3RD4 A;  4RGT A;  2MGS A;  2F0G A;  2MUY A;  1NAP A;  2A6E D;  4KN4 C;  1ML0 D;  3IAY A;  2E2H B;  1YNJ D;  1ET9 A;  3G7L A;  4MN3 A;  5KEE A;  4DK0 A;  2RDG A;  3Q23 A;  1SMY D;  1TWC B;  1ZKO A;  4RKB A;  3EVQ A;  5KYL A;  2OXP A;  2M00 A;  3G6J B;  2RSO A;  5EJW A;  2L9H A;  4EQN A;  4FYD A;  3AB9 A;  3D4D A;  1AFP A;  1H9M A;  1XXG A;  2WKC A;  3T16 A;  2JEA I;  5M5W B;  2LY7 A;  5I2X A;  3S14 B;  1SBB B;  1Z6H A;  5M5Y B;  4X3U A;  4BWG B;  1BUV T;  2VXW A;  3GTL B;  3Q6S A;  4RFB A;  3RLF A;  3QB3 A;  1JQY D;  2A68 C;  3PUX A;  4C3H G;  2Q8T A;  1J8I A;  3C3L A;  4WFN 3;  3TBI B;  2KQ3 A;  1PYW D;  1C8C A;  3BG3 A;  1DCZ A;  1CQV A;  3MFY A;  3L7Z C;  4BY1 B;  2PW5 A;  1TU2 B;  2XVS A;  1RDP D;  2NYZ D;  3HG9 A;  4V0B A;  1ZYR C;  5C0X H;  2IW3 A;  2JEB I;  1Q3L A;  2ZXO A;  2L12 A;  3V96 A;  5C3W A;  2IPK D;  3OPO A;  1I50 B;  1RTO A;  3FRP B;  1TWH B;  3KBG A;  3HOY B;  1EWC A;  1CA6 A;  3HOZ B;  2Z1C A;  5J22 A;  2C5C A;  4I65 A;  4EQO A;  1QG7 A;  4MIU A;  3GTM B;  3K6O A;  2AUK A;  1QB5 D;  3GP7 A;  4TSS A;  4A3D B;  2J0T D;  5KND A;  1LAC A;  2KCN A;  3Q24 A;  2K05 A;  3MC0 B;  3MXN A;  3T13 A;  3CRK C;  3J7A V;  3BYY B;  1HTP A;  2I46 A;  1SNC A;  2PNR C;  1TII D;  4WRD A;  3RMH A;  3I4N B;  5EPK A;  2K5D A;  3DHQ A;  3OIP A;  3VA5 A;  1H9K A;  1QJO A;  3KK7 A;  3S1Q B;  2EJF C;  3MA2 B;  2E74 C;  2F3W A;  3A56 A;  3VYU A;  1QNK A;  2B2Y A;  2LFN A;  4ZUI A;  2ZXR A;  1B4O A;  3IL8 A;  3Q22 A;  4RWS C;  2F0V A;  1IW7 C;  3T4A C;  3FEW X;  4KKT A;  1HFN A;  3NQT A;  3K5L A;  1MGS A;  4HR7 B;  1EQV A;  2FMM A;  1AN8 A;  4IUV A;  3TZU A;  1O7Z A;  1NCV A;  3BS1 A;  2IX3 A;  1EY6 A;  4HCE A;  5JAV A;  4C2M B;  4KMU C;  2R7Z B;  1JOQ A;  1PRT B;  3R3O A;  2WKD A;  3D8G A;  2EYH A;  1H9S B;  5DAU A;  1K83 B;  3HEJ A;  3PUW A;  4OGQ C;  4N9T A;  1LTT D;  1GOZ A;  2IX0 A;  1DD2 A;  2EYO A;  1GUO A;  5D3D A;  2JA5 B;  5EKL A;  5A2Q L;  4EVO A;  1T5X D;  2RQX A;  1II3 A;  1BF4 A;  3V2T A;  3MXU A;  3M7N A;  2PQE A;  2JE6 I;  2B2W A;  2QIL A;  4CJ0 B;  4IN3 A;  3PV0 A;  3DWA A;  3S15 B;  4Z9C B;  1E2Z A;  4RCN A;  3V05 A;  1STH A;  2SOB A;  1DON A;  3JAM E;  4IUT A;  4F7X A;  2G9H D;  4KI0 A;  1U4R A;  4R8I A;  4ZKC B;  2ID0 A;  1PZJ D;  2R3Z A;  3K5O A;  2ENB A;  5J1Z A;  4BBS B;  2PW7 A;  2K1B A;  1YNN D;  3PUV A;  1I4R A;  5EKI A;  4A3E B;  1FYC A;  4KK7 A;  1A15 A;  1PFM A;  1RKN A;  2F3V A;  4ZKB B;  2KUM A;  2FMC A;  3T56 B;  1PTO C;  4H44 C;  3QWN A;  4L8J A;  2A5H A;  5E4W C;  1HQM C;  1BCP B;  3MZ5 A;  1WD1 A;  4IFD I;  2IWH A;  1DJR D;  3ND8 A;  4OO1 I;  1KNA A;  5E1F A;  2CW0 D;  3K59 A;  5C3E B;  2DY7 A;  1I4Q A;  2FFK B;  5LHY 1;  3DM1 A;  1JE4 A;  1S5B D;  1TY2 A;  3WDN A;  1LTS D;  1I3Q B;  1TS5 A;  4K8I A;  3HKZ B;  3I4L A;  4JK1 C;  3HGB A;  2TSS A;  3DUZ A;  1JOR A;  2PCF B;  5T1I A;  5C3X A;  1SEB D;  3A8J E;  4QCL A;  4GZY C;  2BE5 C;  1EZ8 A;  2E2D C;  2F0U A;  4IQZ A;  3J81 E;  3NWS A;  3A8I E;  1FD7 D;  2KED A;  2K03 A;  3MEH A;  1IHZ A;  3C46 A;  4K2K A;  1G29 1;  3ERQ A;  4J6H A;  1EIG A;  4IFD H;  1RHP A;  1Z7T A;  1Q12 A;  3NQI A;  4OO1 H;  1TS4 A;  5K36 G;  2B2Y C;  3A7A B;  4LAA A;  1G91 A;  1GJX A;  5JEA J;  2F0P A;  2K04 A;  4C56 C;  1HQR D;  1FGB D;  1X3Q A;  1SNQ A;  2F0N A;  3LWU A;  4KY6 A;  1CZW A;  1XTC D;  2NVX B;  4C3I G;  2X6L A;  1O80 A;  1LTG D;  5CR3 A;  3TP5 A;  2EYP A;  1Y8P B;  3VA7 A;  1SYE A;  5IGG A;  2E76 C;  4IUR A;  3S17 B;  4BS9 A;  3VYT A;  3I3C A;  1F9Q A;  1UAP A;  1AEX A;  2F0D A;  3D4W A;  5I4D A;  1BNZ A;  2JA8 B;  3S9W A;  5FLX L;  2M9V A;  4XDX A;  5ELB A;  3PUZ A;  1EY9 A;  3ONA B;  4ZLT F;  1BBX C;  1F9S A;  3OW7 A;  4DN4 M;  4CBV A;  2WP8 J;  4QUF A;  1ZEQ X;  4IUU A;  2KCC A;  1K8O A;  2K32 A;  2MHV A;  1ICW A;  3I72 A;  1A2U A;  2B2W C;  5LL6 X;  1S5F D;  4S3S A;  2HDM A;  1ESF A;  5M5X B;  1X32 A;  1ILP A;  3H6M A;  1S5E D;  1HPC A;  1LAB A;  1XYI A;  3I70 A;  3BDL A;  4FF2 A;  1EU3 A;  3FVQ A;  1DOM A;  2A68 D;  1TT2 A;  4EQP A;  4KV6 A;  3PMF A;  1BQQ T;  4RGN A;  1KNE A;  1JIC A;  2O2L D;  1E2W A;  1JCK B;  1NR2 A;  3N52 A;  5G3L F;  1DYQ A;  1ZYR D;  3FDT A;  1GUW A;  3CRL C;  4C3J G;  2NN6 G;  1PZK D;  2KHS A;  3TDQ A;  4KKS A;  4FXK C;  2F0E A;  2G9D A;  1IL8 A;  2IL8 A;  3GV3 A;  3LWE A;  2QKI C;  4FO2 A;  1V1O A;  3HOW B;  1SAP A;  1Y69 U;  5ISR A;  1ENA A;  1IYU A;  1PTO B;  3D31 A;  4BA2 I;  1I6H B;  4B9X A;  3QIA A;  4IFD J;  5CYU A;  5D3I B;  1A2T A;  3R2I A;  1C4Q A;  1QWY A;  5C0X I;  3R2T A;  1JWM D;  3NP8 A;  1G6Z A;  2JP1 A;  1Y1W B;  3NTK A;  1D6E C;  2XWB B;  4DAV A;  3P75 A;  3SXH A;  2MPM A;  1D1K A;  3VR5 A;  1MD2 D;  5CBA E;  3SVM A;  1EFI D;  1M4V A;  1D5Z C;  5JJZ A;  4NP5 A;  1EU4 A;  5G3L D;  4TKO B;  4XTC S;  3U9S A;  2EY6 A;  3RZD B;  1HCZ A;  1B53 A;  1SE2 A;  4NDX A;  5D14 A;  2BDO A;  4E6I A;  2F0K A;  3TN2 A;  2CHB D;  2D2C C;  3KF8 A;  1IW7 D;  3DEO A;  4RAU C;  2XIW A;  3C1F A;  2EYF A;  3SEB A;  2NB0 A;  2IT1 A;  5IGD A;  4KN7 C;  2H4O A;  1ESR A;  2LS0 1;  4FNF A;  3S1M B;  1Y8O B;  2FIN B;  2HCI A;  2QCP X;  1CFM A;  2CQA A;  5T1G A;  1WTX A;  2FHT A;  1WVL A;  2L5T A;  1AW7 A;  1CHQ D;  2EOT A;  3CU7 A;  3QJY A;  4MHE A;  4G7Z C;  1SXT A;  2AQ1 B;  2ZT9 C;  3PUY A;  1LTR D;  1BO0 A;  1QNU A;  3R93 A;  1SNP A;  2RDF A;  5COR A;  4UAI A;  1I6V C;  4A3K B;  5JEA G;  1PZI D;  1KDA A;  3IFT A;  1PTO F;  2E2I B;  5I9O A;  4XT1 B;  1WTR A;  2J4X A;  5CV5 A;  3NUC A;  3K57 A;  2YU9 B;  2A73 B;  3BDO A;  5FOB B;  2EY5 A;  2M2L A;  3CQZ B;  3TZD A;  1H9J A;  5KYI A;  5J39 A;  1Q90 A;  3SK8 A;  1HA5 A;  1TS2 A;  5EBC A;  4ZRZ A;  1CTM A;  1X3P A;  1KTK A;  2I07 B;  4H0L C;  5JPN C;  5K5P A;  4PNY A;  2EJG C;  2N88 A;  5FKA C;  4R9W A;  5EKK A;  1KDB A;  4BY7 B;  3GTK B;  5C5L A;  1LT3 D;  5F2D A;  2MJ8 A;  2WB1 B;  3AU7 A;  3QO2 A;  4K5W A;  2BDN A;  2E2J B;  3A55 A;  2ICI A;  2F0L A;  4UDU C;  3VR2 A;  2MP1 A;  2K7V A;  3PO2 B;  4BA1 I;  3J80 L;  2HQE A;  4QF4 A;  5KIX A;  2PZT A;  2A6H C;  3TP6 A;  3MXP A;  1MI2 A;  5CC4 A;  1H9R A;  2NZ1 D;  1JOK A;  4U68 A;  1PTO D;  1CQF A;  2F0Q A;  3RZO B;  5IGB A;  2KVM A;  2Z8L A;  4Y7N B;  1K8M A;  2O4X A;  4QB4 A;  3OOC A;  4PQX A;  1AP0 A;  5BN4 A;  5A2Q E;  1Z47 A;  1ROD A;  5DM6 3;  3EJI A;  1O7Y A;  2EYJ A;  5I6Y A;  1B50 A;  4WOR A;  4O1N A;  5AFW A;  4FP5 D;  5IGF A;  1TY0 A;  1LT6 D;  3NE5 B;  3PIP 3;  4DAY A;  1ENC A;  4FF4 A;  2L4N A;  2R6G A;  2BE5 D;  1G2T A;  4M8A A;  2KEE A;  5IIF A;  2BA1 A;  1CM9 A;  3I4M B;  1VMP A;  3KLR A;  1WTQ A;  5IT9 L;  4C3J B;  4H7B A;  5C0X J;  1V8Q A;  1D5M C;  4B9W A;  4CKE A;  3P20 A;  1EZ6 A;  3HZX A;  3FKI B;  4K8J A;  1CK1 A;  4DK1 A;  3O13 A;  1A3U A;  2PZU A;  3EA6 A;  3VR6 A;  3EQL C;  1F2L A;  5DEH A;  4KD4 A;  4IFD G;  1OXU A;  1D1I A;  4A3G B;  1TVX A;  4OO1 G;  4HMI A;  5ELD A;  2NUC A;  2F1M A;  2PYK A;  5CV7 A;  1PXU A;  4CKB A;  4H13 C;  3FPU B;  5FO7 B;  2K28 A;  1EEF D;  5TSS A;  4KY7 A;  2QF7 A;  4IUP A;  4IUQ A;  1GUN A;  2IX1 A;  1Q8I A;  2XWJ B;  1TS3 A;  1QCB D;  3SDZ A;  1QIL A;  5C4X B;  4HN7 A;  3KLS X;  1KAB A;  1U4M A;  5JVH 3;  3SK6 A;  3BVM A;  1LTI D;  3NXW A;  1CI3 M;  5JVG 3;  3LNN A;  5FO8 B;  1PFB A;  4C3H B;  2WAC A;  2HUG A;  2EJM A;  1EY8 A;  2YYZ A;  1KDC A;  1GXD C;  3TP7 A;  1LTA D;  3X3N A;  1W6J A;  4CGY B;  3OMC A;  3KUP A;  4ZAI A;  2EYL A;  3R8B A;  3DEP A;  1B2T A;  2F0W A;  4NW2 A;  2D5D A;  4CHT B;  4A3I B;  2DNE A;  1SYB A;  4C1N I;  1HTL D;  1HRJ A;  4XQN A;  2EYM A;  3HP3 A;  3NPP A;  3FPP A;  5COY A;  1B44 D;  2FJ2 A;  4G4K A;  4Q0F A;  2XRQ D;  3H0G B;  4FF3 A;  5EQ0 A;  1KLG D;  5C44 B;  2AWO A;  1ENF A;  2BA0 A;  4PMB A;  5IGC A;  2F03 A;  1U4P A;  4CJ1 B;  4FXD A;  1EEI D;  1PTO H;  4DXF A;  1XX8 A;  4NMZ A;  4EGV A;  2X6G A;  1TKW B;  1W6K A;  1SDF A;  3U9O A;  1Q1E A;  3BVZ A;  3TME A;  4PMW A;  2Z4I A;  3BDC A;  3M4O B;  1GHK A;  2B8F A;  4LK1 C;  3C2P A;  2B2V A;  5M3M B;  4XQQ A;  1F9R A;  2XNA C;  5ELE A;  1VCI A;  1RTN A;  1LLR D;  1B3A A;  1DOL A;  1BXT A;  1QE6 A;  2QEJ C;  5FLX E;  2EZV A;  1LO5 D;  3H94 A;  2K5W A;  2BCO A;  1IYV A;  1KLU D;  2AUJ D;  3D4R A;  5CMD A;  1VF7 A;  3D3R A;  1JWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...