4LF4L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf4L00
1CSPA 3U50C 4L5QA 4AQYQ 1SFOH 1TWCH 3TS0A 1G6PA 4YCVA 2YV5A 5GADC 5IYBH 1S40A 3ER0A 1B70B 4K0KQ 1MIUA 2R7DA 4LFAL 5C44G 1RIPA 3GTOH 2R93G 2RHSB 5GAHC 2CWPA 4DNIA 2Q2IA 4DV4L 1XNQL 3K7AH 2DUDA 3F2BA 3JAMc 1YJ9A 1HR0L 1KAWA 4A3EH 3W1BA 1YVCA 1O7IA 4LF7L 2VY3A 2NN6G 1ASYA 2HQLA 2YTVA 1HNXL 1KD1C 4YWKA 1IBML 2ZJPA 3ULPA 2E5LL 2EQSA 4R4QA 3OTOL 4DK6C 2Q2HA 3HOVG 3PIPA 3KOJA 4A3JG 1PVOA 1ASZA 1I94Q 3UDGA 3WWVA 2PNHA 1KRTA 4DV5L 4DV7L 1Y1VH 1E22A 4YWLA 1R9TH 1VQEA 4QL5A 3I7FA 4X66L 4A4IA 3CCSA 2AWOA 4IPGA 4P72A 5BR8L 4WJ4A 1VQHA 2F3IA 3UE0A 1E3PA 1G291 3JC66 4JOIC 5M3FH 1OXUA 2NN6I 3NEMA 1PH7A 2JA5H 2N3SA 4TVAB 3M4OH 2E8GA 4OWWB 2AWNA 3FKIG 3PUVA 4JG2A 3UDXA 4POFA 2GVAA 3A74A 1PH3A 1EIYB 2ASBA 2N8NA 1JJGA 1BBWA 1HNZL 3DLLA 2KHIA 3RZDH 1Q1EA 3CPWA 4GKJL 4IFDG 2VQFQ 3BZKA 2JA6H 3G6EA 1TWFH 1TWGH 3CCEA 1QVGA 1NJIC 4JV5L 1VQ8A 4A76A 1PV4A 4BXXH 1XJVA 1KQSA 5AJ3Q 3K7UC 4QGUA 3F1ZA 5GAEC 1V43A 3T1YL 2ZTDA 2RCNA 2JEBI 2VS1A 2Z0SA 4HJ5A 1VQJA 1KC8C 4KLKA 2OTLA 4X64L 4L5RC 5LMUL 3PO2H 1LUZA 3S24A 4DV6L 4JCVE 4DAMA 4IFDI 3HOYG 2BH2A 1HZCA 3RZOH 4JI5L 2KBNA 4JI3L 4C3IH 3A5ZB 4XIGS 3I4NH 1BBUA 2ES2A 2UXDL 2CWAA 3S17H 4NB3A 1GVPA 3GO5A 2KCMA 3TRZA 3J80i 1CSQA 1EFWA 4X65L 5IYBG 1N34Q 1SN8A 5M3MH 2IX0A 3KJPA 1BVSA 5J3BA 1UE6A 4DK3C 1C9OA 1V9PA 4R4CA 3JAMi 1Q1BA 1UE7A 2PQAA 5HGQA 4DR2Q 4TQUS 4DV3Q 1RL2A 3AEVA 4DR7L 1VCIA 2GN5A 3W1GA 3W5OA 1Q82C 3CCLA 3CF5A 1N32L 3CMEA 3M4QA 5C4JH 3I4MG 2AMCB 2K5HA 2HT1A 4B3SL 3PUYA 1YIJA 1IBLQ 2LXKA 2C35B 4AYBG 3UDIA 4HJ9A 4IJLA 3AQQA 2L15A 4BBRH 3J81j 4LW1A 4OWTB 1AE2A 2CKZB 4JI4Q 1G51A 2WB1G 1YEZA 1S72A 3SGIA 4JBWA 2MFIA 2K50A 5IYDH 4BA1I 1M1KC 4A3GH 4A3DG 4EX5A 1OXSC 3KDFA 4HIKA 2PQAB 3RR5A 1EYGA 4X6AH 1UE1A 3ULJA 3D0FA 1L1OA 1Q12A 2K5VA 4AIMA 2NVTH 3S2DH 1I94L 4YY3Q 4YHHQ 1X55A 2ALYB 3S14H 3G4SA 4J15A 1SE8A 3DM3A 1N36Q 4LUOA 1I50H 4DV2L 2VW9A 3TREA 3KF8B 1HH2P 5JEAG 4HIDA 1JJ2A 1OTCA 2JEAI 2K5NA 3ERSX 1VQ4A 2ATWA 4A3LH 2MO0A 2JA6G 4IOAA 5IT9c 1YI2A 4JBJA 4OX9Q 4UP8A 4BXXG 1OXXK 4JC0A 4LUVA 1VQKA 3NENA 1HZAA 2BH8A 3KDFB 4UP9A 4DKAC 2R7FA 5ELNA 3T1HQ 1XPRA 1UE5A 1L1OB 2YTYA 3RLOA 3U4VA 1QVCA 2VQFL 4HJ8A 2E2JH 3U58A 2UUBQ 4QIWE 1XNRQ 3PO2G 3HOWH 3MEFA 4A3MG 4R4TA 4JI7Q 1TXYA 3PUXA 5AJ3L 4PZ7A 1PH8A 4LF4Q 3NELA 2IT1A 1MKHA 3I4NG 3I55A 5LMNW 1JE5A 1JMCA 3TS2A 2UXBQ 1YHBA 1WFQA 2VQEQ 4LF5Q 4X62Q 1N8RC 2VUMH 2OCEA 3UE1A 2UUAQ 4KHPQ 4HIOA 4JI8Q 3GTMH 4NPSA 1UEBA 4YCUA 3RLFA 3TQYA 3PV0A 5C0XJ 2CFMA 1BKBA 5IWAQ 1K73C 4JOIA 2DGYA 2JJQA 4JI2Q 4P75A 1YJWA 1X3FA 1VQAA 4GNXC 2NVQH 1QUQA 3GTLH 3S1NH 1N36L 4DR6Q 1HR0W 3HOZG 1Z9FA 4DR2L 1IZ6A 4AH6A 3KLWA 4DV3L 4GOPC 4A3IG 1VQ5A 2R92G 3OYYA 4GN5A 2B63H 3PO3H 4GKKQ 5ELOA 1HNWL 4A3KH 4BA2I 2BA0A 2K75A 4IOCA 4BY1G 3RLNA 2KCTA 4NXNQ 4DV1L 1HZ9A 4A3FH 1IL2A 4OONA 4A93G 5IP9H 3CCRA 4B3MQ 3J7A5 4A3GG 1IBLL 3KYHC 2WAQG 1N33Q 5FJ8H 2F52A 4JI6Q 4O0AA 5M5YH 1PH6A 3CC2A 1IXRA 4ME3A 4JI4L 1WOCA 1XNRL 4OXPA 3KFUA 1XMQL 4DUYQ 1X3GA 1YNXA 4DR1Q 2JA9A 1QUQB 4JI1L 4MNOA 4QY7A 5IY0A 1DGSA 1Y14B 4POGA 1TWHH 4IPDA 2MNAA 4A3LG 1X3EA 3UDFA 3CAMA 2D0PA 2UXCQ 4YHHL 5GROA 3S1MH 1E7ZA 3A5UA 4PZ6A 3M3YH 1A0IA 2GVBA 1I6HH 2Z6KC 4MZ9A 3U4ZA 4BY7H 4BBSH 4JI0L 4DV4Q 5DLQE 4UY8C 3S1RH 3M85A 5FLMH 1NMFA 3F8TA 3ULLA 4AYBE 4DV0Q 4LFBL 3PIOA 4GN3B 3HOWG 1FL0A 1MJCA 4OX9L 3HOUH 2OTJA 4Y7NH 3CCMA 2WB1E 3G48A 4GS3A 1AE3A 5IP7H 2R7ZH 3CPFA 1VQIA 3J81c 4A3EG 1XPUA 4WJ3M 4AQYL 1A8VA 3M9BA 3T1HL 1YHQA 1EWIA 2I0QA 2UUBL 3M7NA 1NY4A 2KHJA 4DV5Q 1Q7YC 4K0KL 3K0XA 3L0OA 4LNQA 2VUMG 4JI7L 2A8VA 3CC7A 5BR8Q 1B7YB 1OXTA 2UUCQ 1PH1A 4LF4L 1KXLA 1NMGA 4IFDJ 1Y1VG 2BA1A 1M90C 4YCWA 4DAYB 1X65A 4C2MH 3CCJA 2KENA 2OQKA 2RHQB 4FDBA 4EQ5A 2UXBL 4DR5Q 2JQOA 4DPGA 1VQDA 2A19A 3GDEA 4QJFA 4X62L 2VQEL 4LF5L 1VQ6A 5M3FG 1SRUA 2HIXA 3FP9A 1EUJA 2UU9Q 2JA5G 2ZJRA 2UUAL 3PO3G 4KHPL 3PUZA 3Q8DA 3HKZG 1HZBA 4JI8L 3E9IA 2EXDA 4A3KG 2B63G 1IYJB 1IBKQ 5IWAL 3GTKH 4IPHA 2JA7H 4A3FG 2VNUD 1JB7A 1PH5A 4JI2L 1K8AC 1FJGQ 2D0OA 1VQNA 4PG3A 1KRSA 1VS0A 2MO1A 4DR6L 5E7NA 3BJUA 5FJ8G 4JYAQ 1YZ6A 3K81C 2ZTCA 2EIFA 4PZ8A 4GKKL 1LYLA 1Y1WH 3HFZB 2YYZA 2NVXH 1SR3A 4B3TQ 2Y0SG 1D7QA 4NXNL 2QGQA 3GD7A 1K9MC 5JJIA 3K8AA 4LF9Q 4DR4Q 4DV6Q 4B3ML 3BU2A 1EIFA 1N33L 1NE3A 1CKNA 2R6GA 4RMFA 4DR3Q 3PF5A 4JI6L 4OO1G 1WI5A 4JBKA 1KIXA 2HHHQ 1E1OA 2UXDQ 1VQFA 2K52A 2FXQA 2E2IH 2V1CC 2AKWB 1K3RA 4DUZQ 1E24A 4DR1L 1C7YA 4UPAA 3CCUA 5IYCH 2IX1A 1LM0A 1VQLA 4BY7G 4BBSG 1J5EQ 3F2DA 4P73A 1CUKA 4P71A 5FLMG 5JJKA 5M3MG 1N32Q 1QZGA 4IO9A 2UXCL 1A63A 4A75A 4MTNA 1GD7A 1EOVA 4LF8Q 3J81i 4OO1I 4APVA 3HOUG 2IHFA 5K36G 2N78A 4ALPA 4B3SQ 1LTLA 4JBMA 1PHJA 2NVYH 5IP7G 4GNXA 2R7ZG 4UP7A 1VQOA 3J80c 1CKNB 3H3VH 5EAYA 4A3CH 1VQGA 5HY6A 1SLJA 4GOPA 1N34L 3KF6A 3PSIA 4DV0L 3S2HH 3I2ZA 2XTIA 3H0GH 5IE8A 2WAQE 3B6YA 3STBD 3I4MH 1XTDA 2VZAA 4BBRG 2ZJQA 2I5HA 4PMWA 3VDYA 4H02A 3GTGH 5JEAJ 4B3RQ 1J6QA 1EQRA 5GAGC 4LF6Q 1CKMA 5FLXc 1X6OA 5IYDG 3L7ZC 1PA6A 1GM5A 2JE6I 1GKHA 3D31A 2Q2UA 3E9HA 4LFCQ 3CP0A 4NXMQ 1L2FA 4Y52H 2JK8A 4KHZA 4DV2Q 1I5FA 3L2PA 1YITA 4GN4B 4GNXB 2UUCL 4A3DH 2F4VQ 5M5XH 1K0RA 4HIMA 3BZCA 2RF4A 1XMOQ 1PH4A 4GOPB 2I5MX 3CCQA 3KF6B 5LMNQ 2JA7G 2ZM6Q 4GLXA 4DR5L 1QZHA 2CCZA 3FHWA 1Q46A 5C4XH 1UWVA 1P8LA 1EQQA 2UU9L 1N9WA 2N49A 2YTXA 3F2CA 4A3BH 5C3EH 4YY3L 2WFWA 2E2HH 2Z6KA 2JA8H 1Y1WG 3EIVA 4C3JH 1IBKL 2ID0A 3ZJYC 3GTJH 1WCMH 4LFAQ 3G71A 1X54A 1WYDA 2HIVA 2NZHA 2IHEA 4IJHA 1FJGL 4KI0A 2IY5B 3OW2A 1CKOA 1XNQQ 1SMXA 3HOXH 1W2BA 3CW2C 4C3HH 1HR0Q 1PFSA 1TWAH 1VQBA 4JYAL 4XTCS 1PH2A 1QVFA 3I56A 4LF7Q 4B3TL 1HNXQ 3M4PA 3KJOA 5C44H 1IBMQ 3K80C 4A3MH 1MJEA 5IYCG 4LF9L 4DR4L 2E5LQ 5M5WH 2R93H 3OTOQ 2PMZE 1V1QA 3RN5A 1XPOA 2LSSA 3CC4A 1KL9A 1NTGA 3STBC 1X56A 1YBYA 2CQOA 3AFQA 3AYHB 4R4OA 4DV7Q 4HJAA 3AFPA 4DR3L 1VQPA 2K4KA 2PI2E 4GLVB 3CMAA 2HHHL 1JJCB 4X66Q 2ZTEA 1U5KA 2QEXA 4DUZL 1W3SA 3EBEA 3HKZE 2VL6A 1K8GA 3I4OA 4L5SA 2NZOA 5GQOA 3CQZH 3HOVH 4A3JH 4LUZA 3CD6A 1J5EL 3GTPH 1Q81C 3PUWA 1PYSB 1B8AA 4IPCA 4A3CG 1HNWQ 1VQCA 1NBWA 1OXVA 3H0GG 4RG1A 3CCVA 4DV1Q 1VQ9A 4LF8L 1VQMA 1HNZQ 4R4IA 2B3GA 2H5XA 4OWXB 1AH9A 1Q86C 1JT8A 4L5TA 4GKJQ 2OWOA 1Q8KA 2Y0SE 1S3OA 3S15H 3E0EA 2AHOB 3HOZH 5H1SE 1YHAA 1P16A 2B29A 4A3IH 1I3QH 1Z47A 2I5LX 4GLAC 2R92H 1FVIA 4O2DA 4R1JA 1D8LA 5IP9G 4JV5Q 3FKIH 4YWMA 3MXNB 1XMQQ 3J7ZC 1SROA 1T9HA 1WJJA 4BY1H 3S16H 3EN2A 3H3VI 1FGUA 3S1QH 3A0JA 4A93H 3T1YQ 3IRBA 4JI1Q 1H95A 3LGJA 1C0AA 4B3RL 3RN2A 3TEHB 2WP8J 4LWCA 1L0WA 5C0XG 4LF6L 4X64Q 5LMUQ 1HJPA 1YJNA 5JJLA 2YU9H 3PGZA 3ICEA 3NBHB 4LFCL 4JI5Q 4QQBX 3CXCA 4JI3Q 1L1OC 4NXML 5C4XG 4P74A 1U0LA 2OQ0A 2K14A 3HKSA 5C3EG 4A3BG 1K83H 2F4VL 1X9NA 3RNUA 4JI0Q 2PI2A 4DUYL 2JA8G 4X65Q 1KHIA 1XMOL 1E1TA 2D62A 5LMNL 1WCMG 4LFBQ 3HOYH 1A62A 2ZM6L 3PF4A 2A1AA 1GO3E 5C0XI 2MQHA 4HJ7A 2XGTA 1PYBA 1PH9A 1VQ7A 3GTQH 2QA4A 2LXJA 3PCOB 3H15A 2Q2TA 3HOXG 4DR7Q
chains in the Genus database with same CATH superfamily
3TDQA 3TS0A 1G6PA 1XTCD 5GADC 1S40A 2K32A 1B70B 1Y1VB 4B9XA 3GTOH 1XXGA 3GP7A 2R93G 2HUGA 2Q2IA 4DV4L 1BDOA 3T53B 3BZDB 3W1BA 4A3EH 1F2MA 1XX8A 3QIAA 3ULPA 2E5LL 2MJ8A 4R4QA 4A3FB 4MTKA 3KOJA 3UDGA 2PNHA 1KRTA 4DV7L 4HAEA 3PIO3 1VQEA 2OT2A 3P75A 1SNPA 1TWFB 3T13A 4MN3A 1BF4A 2KA7A 3DHQA 2F3IA 2Y0SB 1E3PA 1SE2A 3JC66 1EIGA 2NN6I 1B53A 1I6VC 2B2WA 2E8GA 2AWNA 4LMQD 1EIYB 1PH3A 2ASBA 1LACA 2EYMA 1WTQA 5JEAH 3GV6A 3BDOA 3S1MB 1EL0A 1QG7A 3E0JA 5IGGA 3CCEA 1NJIC 2PW7A 1PV4A 4N8FA 5CV8A 3S1RB 1TY0A 4QGUA 5IGFA 2RCNA 1KC8C 2IW3A 3MXGA 2L1BA 4L5RC 1KDCA 2R7ZB 2N55A 3FPUB 1FGBD 2BH2A 1UEAB 1RHPA 4JI3L 5FK9C 2F0SA 3I4NH 2ES2A 2UXDL 3S17H 4NB3A 2B39A 1GVPA 3GO5A 5KNCA 2KCMA 2X6GA 5FO7B 1EFWA 3NWSA 1SN8A 2JYOA 5I9OA 1Q1BA 1JOOA 2JSOA 4DV3Q 3AEVA 1I4QA 3MA2B 2GN5A 2O2LD 2WAQB 3M4QA 5C4JH 3K58A 2AMCB 4B3SL 2B2YC 1S4ZA 1YNNC 4RWSC 3UDIA 1I50B 4BBRH 4F87A 4LW1A 4JI4Q 1G51A 1PLFA 2L9HA 2RDHA 2Z6BA 4BA1I 5IYDH 3I90A 3MEHA 1WTVA 1BQQT 2QCPX 4EVOA 4Q5VA 1G2SA 3CRKC 3HGBA 1Q12A 1SAPA 3DM3A 4KTAA 4RA8A 3KF8B 1XYIA 2E2IB 1VQ4A 4A3LH 1I4HA 4IOAA 5IT9c 4UP8A 1AEXA 1HZAA 2E76C 2BH8A 4OGQC 2F0QA 1ZYRC 5KYIA 1A2UA 2P5ZX 1QVCA 1RDPD 1R4QB 3BYYB 4R4TA 2EYJA 1PH8A 4PZ7A 2KQ3A 3C1EA 1NR4A 1K8OA 5LMNW 4HEDA 1JMCA 3GTGB 4E6IA 1YHBA 1WD1A 3SEBA 2EYLA 4F7XA 4LF5Q 4X62Q 1U4LA 3UE1A 1PXUA 3NQTA 3R3OA 1BKBA 4M1UB 1SSOA 5IWAQ 3KBGA 1X3FA 1VQAA 4GNXC 2NVQH 1D1KA 4DR6Q 4DR2L 2R92G 4A3IG 3PO3H 2B63H 4GKKQ 4IOCA 1TWHB 5DM73 1GUSA 4DV1L 4A3FH 5C3EB 5D14A 1F9PA 4A93G 5IP9H 4KY6A 2E2HB 1PRTD 1I6HB 5FJ8H 1U4PA 1IXRA 1WOCA 2OEOA 3KFUA 3KLSA 3HOXB 4O42A 2L5TA 2K01A 3MVVA 5E1FA 5A2QE 4JI1L 4QY7A 5IY0A 1DGSA 1O7YA 2R93B 3CAMA 2D0PA 2UXCQ 1PZID 2DY7A 2BE5D 4XT1B 3S1MH 1E7ZA 3A5UA 2GVBA 5D3IB 4K2LA 4MZ9A 4DXGA 4JI0L 1A3VA 5I6WA 4KKUA 3S1RH 3OWFA 3M85A 1F9QA 1O7LA 3HOWG 1BR9A 5K36H 1RD9D 3CCMA 3GTPB 1HUNA 2R7ZH 3HP3A 4L6TB 4A3EG 4AQYL 3M9BA 1BO0A 5ELFA 1L0YB 3K0XA 4KJOA 4C56C 2VUMG 3MXNA 3E5SA 5BR8Q 1B7YB 1KXLA 4LF4L 3S16B 4IFDJ 1WTOA 1EEFD 1X32A 4C2MH 3CCJA 2UXBL 4KN7C 4DR5Q 4QJFA 3GDEA 1VQ6A 3FP9A 3BDLA 2DNEA 1S5FD 1JC7A 2J4XA 4KHPL 3VYTA 2EY1A 1LTSD 3E9IA 2EXDA 4A3KG 1JE4A 4ULLA 3BVMA 1IBKQ 4IPHA 2AQ3B 1JB7A 4H0LC 4CDEC 1VS0A 2MO1A 1HTPA 2R3ZA 3PIP3 2EJFC 1YZ6A 3ZYYX 2EIFA 1LYLA 1K28A 4B3TQ 2NVXH 1SR3A 3GD7A 1JB3A 2O5JC 3A7LA 3URYA 2PZTA 3TP7A 3J81L 3MAQA 1E1OA 4JBKA 1MHWC 2E2IH 2V1CC 4DUZQ 4UPAA 3CCUA 1EFID 5BN3A 4C1NI 4P71A 5EPLA 1QWYA 3KBXA 2K28A 1Q90A 3HOUG 1H9JA 1LTLA 4HSVA 1PHJA 5T1GA 4RGMA 4GNXA 2A5HA 1SLJA 4DNRB 5M5XB 3KF6A 3PSIA 3S2HH 3I2ZA 3B6YA 3QB3A 4BBRG 2ZJQA 3BDCA 4RCNA 4H02A 3T51B 4CJ1B 3GTGH 5GAGC 5KEEA 5IYDG 3L7ZC 1PA6A 3D31A 3E9HA 3VA5A 5KYLA 4KY5A 5ELCA 1I5FA 3L2PA 2EYFA 4GN4B 4GNXB 4HIMA 3BZCA 1TWAB 2D9UA 4PMCA 3KF6B 4HCSA 4LAAA 4ZRZA 4GLXA 4FP5D 1Q46A 3I3CA 5C4XH 1N9WA 5C3EH 2E2HH 4NW2A 1X3QA 5CV9A 3VR3A 3ZJYC 2VXWA 1TQOA 2HIVA 2NZHA 4KI0A 2IY5B 3D6WA 1XNQQ 3HOXH 4QIWB 1PH2A 1QVFA 3J80L 4OHJA 3M4PA 2IJ0A 1EQVA 2HD3A 2L11A 4DR4L 2R93H 5IYCG 2JP1A 2JN4A 2PMZE 4DAVA 1SDFA 2LSSA 3FRPB 3CC4A 1KL9A 3A8IE 2CQOA 3AYHB 4R4OA 3TP5A 2PI2E 3CMAA 4K8JA 2R92B 1JJCB 4A3IB 3OMGA 1U5KA 2QEXA 3MWYW 2VL6A 3OSOA 3I4OA 2NZOA 5GQOA 1A2TA 4LUZA 4ZLTF 3I4LA 4A93B 1J5EL 1CQFA 1C8CA 4FXDA 3GTPH 1GXDC 1Q81C 1HNWQ 1NBWA 4R4IA 2H5XA 2YU9B 4OWXB 1EU3A 4XYQA 1ICFB 3S15H 1YHAA 4GLAC 1J9OA 3N6RA 1FVIA 1HCZA 4O2DA 4JV5Q 5IP9G 5DAUA 5CBAE 3S16H 1B9MA 1HA5A 4ME5A 1H95A 5IT9E 4B3RL 2WP8J 5C0XG 4QB4A 5JJLA 2AQ2B 2F0JA 2K1BA 2ENBA 3CXCA 4NXML 3GTOB 3BS1A 1MSHA 3HOWB 2OQ0A 4A3BG 3HKSA 3RNUA 2PI2A 1ILPA 2JA8G 4EQOA 1CHQD 1XMOL 4C3JG 4A3EB 1K3BC 1A62A 1EZ6A 4N9TA 4C3HG 1CSPA 1LLRD 4L5QA 3QWNA 1S5BD 4YCVA 1DOMA 2F0MA 1VDZA 4K0KQ 4QMGA 3CU7A 2PMZB 2RHSB 3F2BA 3JAMc 1HR0L 1WTPA 4N9PA 1A6XA 1SNMA 1YVCA 1WD0A 3DXJC 2NZ1D 2YTVA 1KD1C 4A3KB 1CTMA 1NAPA 3EA6A 3HOVG 4A3JG 1PVOA 4XQJA 3SK5A 3DEOA 1B3AA 3VYRA 4DN4M 2RKSA 1R9TH 5I2XA 4QL5A 2EYPA 1KABA 2AWOA 1EU4A 1VF5C 1BXTA 1VQHA 3N52A 1HFNA 2SNMA 2Q8RE 4JOIC 5M3FH 1TS2A 2N3SA 4TVAB 3M4OH 2F0WA 1Y8OB 1STAA 2GVAA 1BBWA 1EY6A 4K8IA 1HNZL 1SNQA 2KHIA 3C46A 4GKJL 3AB9A 2VQFQ 3BZKA 3G6EA 1AFPA 2KJXA 1TWGH 2DJFC 1QVGA 3S17B 3K57A 1XJVA 1JCKB 1KQSA 1ZXTA 5AJ3Q 3K7UC 3RUZA 3F1ZA 1D5ZC 1V43A 2PW5A 2ZTDA 2VS1A 3HOUB 4HJ5A 4KLKA 4X64L 5LMUL 3TSSA 3S24A 4DV6L 1UNSA 4Q0FA 5C4JB 5CYUA 3HOYG 3RZOH 1HA6A 4K5XA 1B4OA 4JI5L 3QOLA 1G6ZA 2BCOA 1KNAA 3A7AB 4BBRB 3OMCA 4HMJA 4DGZA 3J80i 2N88A 5M3MH 3KJPA 1FD7D 2XWJB 1UE6A 4DK3C 1E2VA 1UE7A 5HGQA 3TN2A 3WDNA 1Q82C 3Q24A 2F0DA 3MHBA 1SNDA 1YIJA 1IBLQ 4HJ9A 5EBDA 4IJLA 1NNXA 2JXMB 1GHKA 3J81j 4CDFC 2DJGC 1AE2A 3DWAA 5C5LA 3SGIA 4JBWA 4KY7A 2MFIA 5KRUA 1PRTB 4EX5A 1OXSC 3KDFA 1EWCA 2HDMA 3RR5A 4X6AH 3TZUA 3V05A 3ULJA 3D0FA 1IL8A 2HDLA 5KIXA 4YY3Q 4YHHQ 1EY8A 1O7ZA 4J15A 1DONA 1JJ2A 2K5NA 2MO0A 2RSNA 2F1MA 4OX9Q 2SNSA 5G3LF 2F0OA 4X3SA 3KDFB 4UP9A 3NK9A 2R7FA 1KNEA 1IW7C 1AN8A 2E2JH 3U58A 2WKCA 3PO2G 3HOWH 3MEFA 1NCVA 3MFYA 4JK1C 1KDBA 4JI7Q 2IX3A 4WORA 1B1ZA 3NELA 1ESFA 2NVQB 1SYGA 1MKHA 4ODGA 3PO3B 3K5MA 2ZXPA 1SJHD 2B63B 3TS2A 4S3SA 4FF1A 1CI3M 1WFQA 2VQEQ 1N8RC 2VUMH 4CDCC 3NBIA 4HIOA 4JI8Q 4NPSA 3TQYA 3RLFA 1S5CD 2CFMA 1K73C 4JOIA 2K33A 2JJQA 4JI2Q 4P75A 4G57A 2K04A 3S1NH 1HR0W 1GUTA 3NPPA 4DV3L 2EY5A 1ET9A 3OYYA 5ELOA 4A3KH 2BA0A 2K75A 5CORA 1IL2A 4A3BB 1S5DD 4OONA 5CR3A 4G7ZC 4A3GG 2JA8B 4I7ZC 4DNTB 1N33Q 4C3JB 5M5YH 1PH6A 4JI4L 1FR3A 4OXPA 4DUYQ 3VR5A 5EKKA 4C3HB 2EE1A 2JA9A 1Y14B 3SE0A 2BOSA 5KNDA 2MNAA 1X3EA 4KMUC 3Q23A 2RQXA 4DU9A 1KTKA 4XYOA 4PZ6A 2LKVA 3M3YH 1A0IA 4IN3A 3KLRA 4RHRA 4EQNA 3OIPA 3QR8A 2Q8TA 4DV4Q 2PNRC 4XDXA 3F8TA 2M9VA 5CC4A 3MXPA 3PIOA 1WTXA 4LFBL 4A3JB 4JW0A 2OTJA 4C2MB 3HOUH 1I4GA 3G48A 1AE3A 1VQIA 2F0HA 2I0QA 5C3WA 1MSGA 1Q7YC 3L0OA 4LNQA 1TVXA 2WV6D 3E6ZX 1DM0B 3BVGA 1OXTA 2L12A 4CDDC 1WTWA 3GV3A 1DYQA 1X65A 2KENA 2OQKA 2RHQB 3PMFA 4HCEA 5EKLA 3TZDA 2NVXB 4DPGA 3MZ5A 4LF5L 4X62L 5M3FG 2UU9Q 2HIXA 1EEID 1I4PA 3Q8DA 5FOBB 1I4XA 1IYJB 2XRSD 5J39A 5IWAL 1MGSA 4PG3A 1KRSA 4DR6L 5E7NA 5FO9B 3HOYB 2ZTCA 4GKKL 2C9OA 5K5PA 3K8AA 4LF9Q 4TRDA 1SFOB 1TWCB 3RMHA 2EVBA 3BU2A 1G2TA 1EIFA 1LTAD 1NE3A 3PF5A 4OO1G 4DR3Q 4MIUA 2UXDQ 2HHHQ 2K52A 1TS3A 2FXQA 4WFN3 1K3RA 1ONLA 1ET6A 1E24A 2FHTA 1C7YA 1F2ZA 4L63B 2IX1A 5IYCH 1L0XB 3S2HB 5EJWA 5J22A 3JAME 4BY7G 4BBSG 4P73A 4K6DA 2DN8A 5JJKA 5M3MG 4RH6A 2F03A 2UXCL 1A63A 1BCPF 4DAPA 1EOVA 4H44C 2PZWA 4B3SQ 4JBMA 1B2TA 2NVYH 4UP7A 4QUCA 3NTIA 3H3VH 1JICA 1N34L 4LJZC 1VMCA 1KAAA 5IE8A 1EIHA 1EY9A 2EPBA 1DZ1A 1XTDA 4H7BA 4PMWA 5JEAJ 1EQRA 5C4XB 5FLXc 2JE6I 3HRZC 2PO4A 1RF2D 2D5DA 2Q2UA 5BN5A 1L2FA 2JK8A 3K5NA 1F2YA 4A3DH 2SEBD 2F4VQ 1B3QA 1T5XD 5C0XH 4IZ8A 1M4VA 2O5IC 2ZM6Q 4DR5L 2I07B 1QZHA 3L3OC 3FHWA 2CCZA 3PO2B 1ZKOA 4A3BH 2PYKA 1Y1WG 2JA8H 1AZPA 3ERQA 4C3JH 1IBKL 3GTJH 4LFAQ 1X54A 2WKDA 1GUNA 2IHEA 4NKLA 1W2BA 2EY2A 4C3HH 1PFSA 2IL8A 3OHXC 4XTCS 1DOLA 5DM63 2KCNA 4K5WA 4FF2A 5CV4A 4LF7Q 1LTBD 4B3TL 2ZT9C 2QDBA 1HNXQ 1IBMQ 4A3MH 5LL6X 3OTOQ 3RN5A 2KECA 1QNKA 5C3XA 5JPNC 3STBC 1XNRL 1LT3D 1YBYA 3S15B 4X3UA 2K4KA 1EYDA 2AQ1B 4X66Q 4DUZL 3EJIA 3EBEA 3TMEA 3HOVH 3CQZH 4ABNA 4A3JH 2EY6A 3CD6A 1H9KA 4A3GB 2NBFA 3PUWA 1B8AA 1VQCA 3H0GG 4FYDA 4DV1Q 2B3GA 1Q86C 1DJRD 3EROA 2QILA 3S14B 3E0EA 1Q3LA 5COYA 4PQXA 1ML0D 4JVZA 2CH4A 3KUPA 5BN4A 3MXNB 3J7ZC 1SROA 2HCIA 3EN2A 3H3VI 2OXPA 4NDXA 5EPJA 3T1YQ 4JI1Q 2XIWA 5IODA 2M2LA 1TR5A 4LWCA 2KHSA 1TKWB 1L0WA 5A2QL 1HJPA 5IGCA 3K6OA 3S9WA 2F0IA 4WJWA 4QQBX 1L1OC 1SMYC 1X9NA 4JI0Q 3R8BA 4X65Q 1E1TA 3SR1A 5CMDA 3HOYH 1HHVA 2A1AA 5C0XI 3GTQH 4PNYA 4HJ7A 2XGTA 1VQ7A 2QA4A 2Q2TA 3H15A 4DR7Q 1RKNA 4KKSA 1STHA 3U50C 5EKIA 4AQYQ 1SFOH 1TWCH 2B2VC 1SJED 3ER0A 1MIUA 1R9TB 1RIPA 2F0VA 5GAHC 2CWPA 1BOSA 3BYTB 1XNQL 5C4HA 2DUDA 1YJ9A 1KAWA 4RGTA 1EY4A 5M3FB 1LABA 3I8ZA 2VY3A 3M4OB 1ASYA 2RCFA 4YWKA 3J7YW 2ZJPA 1LTRD 4TSSA 4K2KA 1H9SA 4DK6C 4RAUC 3PIPA 3IFTA 1ASZA 1I94Q 4P2CB 4DV5L 4YWLA 3I7FA 4KN4C 3DMUA 1PTOF 1DXMA 1TWGB 4I7AA 4IPGA 4A4IA 4ID6A 3UE0A 1M8AA 2H4OA 1OXUA 2A73B 2JA5H 2X69A 4OWWB 3H09A 3FKIG 3PUVA 4JG2A 3UDXA 4POFA 3E3XA 3DLLA 3P1HA 2DNCA 3DEPA 3CPWA 3RZDH 2RDGA 4IFDG 1STYA 3K0YA 3RZOB 5IGBA 2VB2X 2B8FA 4JV5L 1VQ8A 4BBSB 4BY7B 3Q0AA 4TKOB 5IGEA 4CJ2C 5M3MB 2A69D 2O4XA 1SYCA 1VQJA 3U9OA 1X3PA 1QILA 3PO2H 4IUUA 2HQEA 4JCVE 5EQ0A 3FDTA 4G4KA 4DAMA 1HZCA 4Z9CB 4CGYB 2X6LA 4C3IH 3A5ZB 4XIGS 1BBUA 1MBYA 1RJTA 3A56A 2LFNA 4HR7B 5IYBG 4DAYA 5I9PA 1IW7D 2PZUA 2K7VA 1BVSA 1N36Q 3JAMi 1V9PA 2QDLA 4TQUS 1RL2A 3TP6A 2EDGA 1VCIA 3K59A 3W1GA 3CCLA 3CF5A 1N32L 3SK8A 3CMEA 1HTLD 4FXGC 3A54A 4WRDA 2K5DA 2SDFA 3PUYA 2RBMA 3LWUA 2LXKA 1YNJC 3SK4A 2M00A 4AYBG 1BUVT 4QUFA 3AQQA 1D5MC 1K8MA 2CKZB 4OWTB 2K50A 1M1KC 1IKLA 5C4ZA 1D1IA 4DA2A 4A3GH 4A3DG 2IPKD 3ND9A 1UE1A 1IYUA 3ITPA 1L1OA 2K5VA 3S2DH 1CM9A 3KLSX 2F0FA 3D4RA 4KV6A 3S14H 3G4SA 1SE8A 2E2JB 4LUOA 4DV2L 2F0LA 2VW9A 1JOQA 1CZWA 1HH2P 4HIDA 3H3VC 3ERSX 2JA6G 1YI2A 1BCPC 4KK7A 1UUPA 4JBJA 2A74C 4BXXG 2B2VA 2MGSA 3EQLC 1VQKA 3NENA 1AP0A 2VUMB 1O80A 5ELNA 3T1HQ 3VYSA 4K6LA 1UE5A 4M8AA 1L1OB 3RLOA 2VQFL 1A3UA 4HJ8A 2UUBQ 4A3MG 3ONAB 1TXYA 3PUXA 5AJ3L 3J7AV 3WOFA 3S1NB 3H0GB 3I55A 5ELBA 3DM1A 1JE5A 2CVRA 3IFDA 3VR4A 2EJGC 4N8X1 3LX0A 1V1PA 2OCEA 4EQPA 5FLXE 2UUAQ 2QW7A 5L37A 3GTMH 1UEBA 5M5YB 4KD3A 4NP5A 2DGYA 2NWGA 1YJWA 3UI2A 4ZQ3A 3NHHA 1Y69U 4ZUJA 1IZ6A 1LTID 3KLWA 3K5OA 3NWTA 4AH6A 5C6AA 1VQ5A 4GN5A 4BA2I 3C3LA 1RODA 5CV7A 2Z9HA 3RLNA 4NXNQ 1DCZA 5KNBA 1HZ9A 5DNFA 5IT9L 4K5VA 4B3MQ 3J7A5 3R93A 1IBLL 1LV9A 3LNNA 3M3YB 3KYHC 2WAQG 4FO2A 4JI6Q 3CC2A 4ME3A 2KEEA 2EYHA 4K14A 1XMQL 5I2YA 3MC0B 1X3GA 3QOJA 4DR1Q 1EZ8A 1JOKA 1PMRA 4OIJA 2F0KA 4OO1H 4IPDA 3RD4A 1CHPD 3KK7A 3UDFA 3T56B 1HQRD 4KD4A 4YHHL 1QE6A 1JR0D 1C48A 3NSWA 3NUCA 2KUMA 4BBSH 4BY7H 5DLQE 4UY8C 1FNWA 5JVH3 3ULLA 5JOBA 4DV0Q 4AYBE 5A35A 2B8GA 2J7ZA 2AUJD 4GN3B 3J7AF 1FL0A 4OX9L 5FO8B 4Y7NH 4GS3A 3CPFA 2KCCA 1CZGA 3J81c 4WJ3M 3DWPA 1YHQA 1Y8NB 3M7NA 1E2WA 1NY4A 2KHJA 3L9AX 4V0BA 1KLGD 1A3TA 2XWBB 4JI7L 2A8VA 1F77A 2UUCQ 1PH1A 1JORA 4UDUC 2F0UA 1NMGA 2ZXOA 1E0BA 3G7LA 3SK6A 2H1EA 2KOLA 4FDBA 2WINB 2JQOA 1VQDA 2A19A 1ENFA 2VQEL 1EUJA 2JA5G 1T5EA 2ZJRA 3HKZG 4JI8L 1B50A 1CQVA 3GTKH 1CFMA 2VNUD 2A69C 4JI2L 1K8AC 1CK1A 1FJGQ 2D0OA 5EPKA 2NTTA 1VQNA 2NB0A 3DWQA 4JYAQ 2K03A 2C5CA 3K81C 1Y1WH 1D7QA 1SYEA 3FVQA 1H9RA 1KLUD 5LHY1 5JJIA 1U4RA 4DV6Q 2PCFB 2CW0C 4H13C 3I70A 4J6HA 1N33L 1CKNA 2R6GA 3D3RA 3NQIA 2NYZD 4RMFA 1WI5A 2NVYB 3ND8A 1KIXA 1D6EC 1Q8IA 4IURA 1W6JA 2AKWB 4RKLA 3OPOA 4C3IG 1BCPB 5ISRA 1F2LA 3EFXD 4LK1C 1MD2D 5FLMG 2QEJC 1IYVA 1PTOC 1U9RA 4IO9A 4LF8Q 5DEHA 2RDFA 4OIKA 4OO1I 1STBA 4ALPA 2ICIA 5IP7G 1VQOA 3J80c 1CKNB 5EAYA 4A3DB 1VQGA 5HY6A 3H0GH 2WAQE 3STBD 3I4MH 2F0NA 2E75C 2FJ2A 1J6QA 3VR6A 4LF6Q 1CKMA 1X6OA 1GKHA 4ILWA 2RSOA 1F9RA 4LFCQ 1Z7TA 2JA6B 3VR2A 2NUCA 4RCOA 2A6HD 4KHZA 1BNZA 1W6KA 3GTJB 1LT5D 1SBBB 4IUVA 2IWHA 2FFKB 4F88A 2RF4A 1A15A 2I5MX 3U9SA 3G6JB 3QO2A 5LMNQ 1PZKD 2JA7G 4IUNA 4CKEA 5G3LD 2UU9L 4A3MB 1ENCA 2YTXA 2I46A 2XVSA 3EIVA 4R9WA 2ID0A 3G71A 3R2IA 2TSSA 2Z4HA 2F3WA 2Z8LA 4PV1C 1WYDA 3V2TA 3BG3A 1CKOA 1SMXA 1ILQA 1CA5A 1SYDA 1V8QA 4QF4A 3HOVB 3CQZB 3I56A 2F3VA 1FNVA 2D2CC 2V4DA 1SMYD 1V1OA 4LF9L 1E2ZA 5LL6S 1RTOA 2E5LQ 5M5WH 4OEMB 4U673 1XPOA 1ESRA 2PPBC 1DOKA 4HJAA 1X56A 5IOCA 4DR3L 3AFQA 3NTHA 4DV7Q 1J8IA 3AFPA 2L4NA 2HHHL 2RA4A 1PYWD 4IUTA 1W3SA 3HKZE 2EJMA 1K8GA 4L5SA 5JVG3 5JAVA 4G7HC 4RGNA 1PYSB 4A3CG 4IALA 4IPCA 4XT3B 4FVMA 1OXVA 1WTHA 5ELDA 4RG1A 3CCVA 4HTHA 1VQMA 1AH9A 2NVTB 3D4WA 3H6MA 2OWOA 1PDQA 1S3OA 1SNOA 3KF8A 2AHOB 4DF7A 4U68A 5CGKA 3HOZH 5H1SE 1P16A 1Z47A 1RTNA 3FKIH 4YWMA 4F8MA 1XWEA 4BY1H 1QJOA 4QCLA 3A8KE 3OOCA 3A0JA 1MI2A 3GTQB 4IFDH 5CV5A 3V96A 1YJNA 2B2UC 2SOBA 3PGZA 1PRTF 3I72A 4JI3Q 4DK0A 4P74A 1HQMC 4FNFA 2F4VL 4KJNA 4ZKCB 2D62A 1PFBA 1WCMG 4LFBQ 4G7OC 3PF4A 2ZM6L 1PH9A 1GO3E 2MQHA 4R8IA 5IIFA 2J0TD 1C4QA 2YV5A 5IYBH 1QCBD 2R7DA 4LFAL 5C44G 2FMCA 4DNIA 3MFGA 3K7AH 2EXZA 3GTLB 2G9DA 3CHBD 1O7IA 4LF7L 1S5ED 2JA5B 2NN6G 3FPPA 2HQLA 2WACA 3HKZB 4DXFA 1HNXL 1IBML 1PTOB 1K0SA 2HCCA 2LMCB 2EQSA 1LTTD 3OTOL 2Q2HA 3Q6SA 5J1ZA 3X3MA 3WWVA 3P20A 3RZDB 1Y1VH 1E22A 3NTKA 3LWEA 4X66L 3CCSA 4P72A 5BR8L 4WJ4A 2GA4B 5E4XA 1G291 3NEMA 1YNJD 1PH7A 5M9OA 5F2DA 1IHZA 5IGDA 3A74A 1JJGA 2N8NA 3VYUA 4FF4A 2B2TC 1HRJA 1Q1EA 2QKIC 4C3IB 2JA6H 5EBCA 1TWFH 2AUKA 4A76A 4BXXH 1PFMA 5E3FA 4J8QA 4RKBA 4C1NK 5GAEC 3T1YL 4UHVA 1B9NA 2LY7A 2R61A 2JEBI 2Z0SA 4CBVA 2OTLA 2VB3X 3JAML 1LUZA 3QJYA 5D3DA 1SYFA 3F2UA 4IFDI 2MP1A 1CA6A 1BCPD 3J81E 1EY5A 2KBNA 4ZK9B 4DFAA 2CWAA 4IUPA 4O1NA 3TRZA 3IAYA 1VMPA 1CSQA 4X65L 2MUYA 1RCVD 1WVLA 1N34Q 3M4YA 2IX0A 5J3BA 1C9OA 4R4CA 2PQAA 4DR2Q 2F0EA 3R2TA 4DR7L 3W5OA 2A6HC 1O78A 2B2YA 4ZUIA 3I4MG 3S2DB 2K5HA 4CKBA 2HT1A 1GHJA 5HURA 2C35B 3P7JA 2L15A 2JA7B 2WB1G 1YEZA 1S72A 5ELEA 2G5DA 2PQEA 1EYCA 2Z4IA 2B2UA 4HIKA 2PQAB 1EYGA 2XSCA 4HN7A 4AIMA 1TIID 2NVTH 1AZQA 1I94L 4IQZA 1X55A 2ALYB 3NP8A 3BVZA 1I50H 3TREA 5JEAG 1OTCA 2JEAI 2ATWA 1II3A 5E4WC 3C1FA 1OXXK 1NUCA 4JC0A 1WTRA 4LUVA 4DKAC 1SE3A 1SYBA 1XPRA 5CV6A 2YTYA 3AU7A 2BDOA 3U4VA 1XNRQ 3GTMB 4QIWE 3O13A 2K05A 2MHVA 4ZCKA 5AFWA 1FYCA 3J80E 1GUWA 4LF4Q 1ENAA 2IT1A 4X3TA 1TS5A 5JPMC 3I4NG 2XNAC 2UXBQ 1ICWA 2TMPA 2EZVA 1HUMA 2A68D 4KHPQ 1GOZA 4RHSA 4HSPA 4YCUA 3CRLC 3PV0A 5C0XJ 2KEDA 3SVMA 1SNCA 1GJXA 3I73A 2LS01 1QUQA 3GTLH 1CT1D 2K6AA 1N36L 3HOZG 1Z9FA 4GOPC 4BS9A 1HNWL 2B2TA 2XN9C 1PTOH 2G9HD 4BY1G 2EYOA 2KCTA 3CKIB 1PFNA 3CCRA 1H9SB 4ZAIA 2F52A 1WCMB 4O0AA 1HXYD 3MXUA 3D8GA 4ZYSA 1NSNS 1QB5D 1TU2B 1YNXA 3MTSA 4X3KA 1QUQB 4MNOA 1EOTA 4Y7NB 4POGA 1TWHH 4A3LG 5C44B 2F0GA 5HGTA 3M7GA 5GROA 5T1IA 1FNUA 2XRQD 1I6HH 1QOHA 3W2DA 1TT2A 2Z6KC 3U4ZA 3NE5B 2CW0D 2KVMA 5FLMH 1NMFA 4OL7A 1MJCA 3FMCA 4XXEA 2WB1E 3NXWA 5IP7H 1VF7A 4PMBA 2A6ED 1XPUA 4KHVA 1A8VA 3T1HL 1EY0A 3A55A 3X3NA 1EWIA 2UUBL 4B9WA 1F9SA 4DV5Q 4K0KL 4FXKC 2MPMA 3IKJA 3GTKB 1D2BA 4IUQA 3CC7A 3D6CA 1I3QB 1Y8PB 1PTOD 2RVLA 4EGVA 1Y1VG 2BA1A 1G91A 1M90C 4YCWA 4DAYB 3S1QB 1PRTC 3A8JE 4EQ5A 1Y1WB 1LO5D 4V190 1PZJD 3T16A 3SHLA 3QG1A 2L0CA 1SRUA 4J1MA 3FEWX 3OW7A 2UUAL 4B08A 3PO3G 3PUZA 5KGUA 1DD2A 2B63G 1HZBA 3K5LA 1NR2A 3AMUA 2JA7H 4A3FG 1TY2A 4DK1A 1PH5A 1K83B 1SEBD 3TP8A 2K5WA 2OF1A 3PQIA 4GZYC 3BJUA 5FJ8G 2BE5C 1G8ZD 3T4AC 4PZ8A 2CHBD 4OELB 3HFZB 2YYZA 4L8JA 2Y0SG 4NXNL 2QGQA 1K9MC 4DR4Q 5NUCA 4B3ML 1EYAA 3D4DA 2QF7A 4JI6L 4HMIA 2FINB 2Z1CA 1EY7A 1VQFA 1LT4D 4DR1L 2CH4W 3VA7A 5I4DA 3I4MB 1LM0A 4JPBW 1VQLA 1J5EQ 3F2DA 1CUKA 3OWEB 5CBEE 1N32Q 1QZGA 1EQTA 4A75A 4MTNA 1GD7A 5K36G 3J81i 4APVA 2IHFA 2WB1B 2N78A 4BWGB 1BBXC 2R7ZG 1STGA 3EVQA 1HPCA 2ZXRA 4A3CH 4GOPA 4DV0L 2XTIA 5D65A 2NTSA 2VZAA 2FMMA 2I5HA 1B44D 3VDYA 1JWUD 4B3RQ 5C5MA 1OO9B 1GM5A 4NMZA 2WIIB 1V1PB 1GUOA 2K5QA 1R4PB 3H94A 3CP0A 4NXMQ 4Y52H 1STEA 4DV2Q 1YITA 2UUCL 5M5XH 1K0RA 5FKAC 4CKCA 1XMOQ 1PH4A 4GOPB 1YNND 3CCQA 2ICEC 4XQQA 3SDZA 1HFGA 3HS0C 1UWVA 1P8LA 2B2WC 1EQQA 2N49A 4R8NA 2L55A 3F2CA 5M5WB 4YY3L 2WFWA 2Z6KA 3HG9A 1JWSD 1IKMA 1WCMH 3I4NB 3H91A 1FJGL 4IJHA 3OW2A 3TBIB 3CW2C 1EWHA 3Q22A 1HR0Q 1AW7A 1TWAH 1VQBA 2A68C 3C2PA 1LT6D 4JYAL 2BDNA 4I65A 5TSSA 2DY8A 3HZXA 3KJOA 3HEJA 5C44H 3K80C 1MJEA 1GUGA 4XQNA 2Q8IB 1KDAA 1V1QA 1NTGA 4KKTA 1QNUA 5EGTA 1VQPA 4ZKBB 5FLXL 3HOZB 4GLVB 1Z6HA 2NN6H 2ZTEA 3DUZA 1ZYRD 2E74C 2CQAA 3FKIB 4CJ0B 4BY1B 1I4RA 1ZEQX 1U4MA 1UAPA 1JQYD 1JWMD 1VQ9A 4LF8L 1HNZQ 1TS4A 3NBHA 1JT8A 1H9MA 4L5TA 2E2DC 5I6YA 4GKJQ 4FF3A 1Q8KA 2Y0SE 4RFBA 4MHEA 2R92H 2B29A 4A3IH 1I3QH 2I5LX 4R1JA 1D8LA 4UAIA 2F4IA 1XMQQ 1WJJA 1T9HA 4CHTB 4YIJA 1FGUA 3S1QH 4A93H 3W3AA 3IRBA 3LGJA 3SXHA 3GQBA 1C0AA 1SE4A 3TEHB 3RN2A 4LF6L 4X64Q 5LMUQ 3WOEA 2YU9H 3OIQA 5JJZA 3ICEA 2F0PA 2EOTA 3NBHB 4LFCL 4JI5Q 5C4XG 1U0LA 3IL8A 1D5XC 2K14A 5C3EG 1K83H 2F0TA 4DUYL 3I91A 3K7AB 2A6EC 1KHIA 4RGOS 5LMNL 1SXTA 1STNA 1PYBA 2LXJA 3PCOB 3HOXG 4AYBB 1LTGD
chains in the Genus database with same CATH topology
1CSPA 3U50C 4L5QA 4AQYQ 1SFOH 1TWCH 3TS0A 1G6PA 4YCVA 2YV5A 5GADC 5IYBH 1S40A 3ER0A 1B70B 4K0KQ 1MIUA 2R7DA 4LFAL 5C44G 1RIPA 3GTOH 2R93G 2RHSB 5GAHC 2CWPA 4DNIA 2Q2IA 4DV4L 1XNQL 3K7AH 2DUDA 3F2BA 3JAMc 1YJ9A 1HR0L 1KAWA 4A3EH 3W1BA 1YVCA 1O7IA 4LF7L 2VY3A 2NN6G 1ASYA 2HQLA 2YTVA 1HNXL 1KD1C 4YWKA 1IBML 2ZJPA 3ULPA 2E5LL 2EQSA 4R4QA 3OTOL 4DK6C 2Q2HA 3HOVG 3PIPA 3KOJA 4A3JG 1PVOA 1ASZA 1I94Q 3UDGA 3WWVA 2PNHA 1KRTA 4DV5L 4DV7L 1Y1VH 1E22A 4YWLA 1R9TH 1VQEA 4QL5A 3I7FA 4X66L 4A4IA 3CCSA 2AWOA 4IPGA 4P72A 5BR8L 4WJ4A 1VQHA 2F3IA 3UE0A 1E3PA 1G291 3JC66 4JOIC 5M3FH 1OXUA 2NN6I 3NEMA 1PH7A 2JA5H 2N3SA 4TVAB 3M4OH 2E8GA 4OWWB 2AWNA 3FKIG 3PUVA 4JG2A 3UDXA 4POFA 2GVAA 3A74A 1PH3A 1EIYB 2ASBA 2N8NA 1JJGA 1BBWA 1HNZL 3DLLA 2KHIA 3RZDH 1Q1EA 3CPWA 4GKJL 4IFDG 2VQFQ 3BZKA 2JA6H 3G6EA 1TWFH 1TWGH 3CCEA 1QVGA 1NJIC 4JV5L 1VQ8A 4A76A 1PV4A 4BXXH 1XJVA 1KQSA 5AJ3Q 3K7UC 4QGUA 3F1ZA 5GAEC 1V43A 3T1YL 2ZTDA 2RCNA 2JEBI 2VS1A 2Z0SA 4HJ5A 1VQJA 1KC8C 4KLKA 2OTLA 4X64L 4L5RC 5LMUL 3PO2H 1LUZA 3S24A 4DV6L 4JCVE 4DAMA 4IFDI 3HOYG 2BH2A 1HZCA 3RZOH 4JI5L 2KBNA 4JI3L 4C3IH 3A5ZB 4XIGS 3I4NH 1BBUA 2ES2A 2UXDL 2CWAA 3S17H 4NB3A 1GVPA 3GO5A 2KCMA 3TRZA 3J80i 1CSQA 1EFWA 4X65L 5IYBG 1N34Q 1SN8A 5M3MH 2IX0A 3KJPA 1BVSA 5J3BA 1UE6A 4DK3C 1C9OA 1V9PA 4R4CA 3JAMi 1Q1BA 1UE7A 2PQAA 5HGQA 4DR2Q 4TQUS 4DV3Q 1RL2A 3AEVA 4DR7L 1VCIA 2GN5A 3W1GA 3W5OA 1Q82C 3CCLA 3CF5A 1N32L 3CMEA 3M4QA 5C4JH 3I4MG 2AMCB 2K5HA 2HT1A 4B3SL 3PUYA 1YIJA 1IBLQ 2LXKA 2C35B 4AYBG 3UDIA 4HJ9A 4IJLA 3AQQA 2L15A 4BBRH 3J81j 4LW1A 4OWTB 1AE2A 2CKZB 4JI4Q 1G51A 2WB1G 1YEZA 1S72A 3SGIA 4JBWA 2MFIA 2K50A 5IYDH 4BA1I 1M1KC 4A3GH 4A3DG 4EX5A 1OXSC 3KDFA 4HIKA 2PQAB 3RR5A 1EYGA 4X6AH 1UE1A 3ULJA 3D0FA 1L1OA 1Q12A 2K5VA 4AIMA 2NVTH 3S2DH 1I94L 4YY3Q 4YHHQ 1X55A 2ALYB 3S14H 3G4SA 4J15A 1SE8A 3DM3A 1N36Q 4LUOA 1I50H 4DV2L 2VW9A 3TREA 3KF8B 1HH2P 5JEAG 4HIDA 1JJ2A 1OTCA 2JEAI 2K5NA 3ERSX 1VQ4A 2ATWA 4A3LH 2MO0A 2JA6G 4IOAA 5IT9c 1YI2A 4JBJA 4OX9Q 4UP8A 4BXXG 1OXXK 4JC0A 4LUVA 1VQKA 3NENA 1HZAA 2BH8A 3KDFB 4UP9A 4DKAC 2R7FA 5ELNA 3T1HQ 1XPRA 1UE5A 1L1OB 2YTYA 3RLOA 3U4VA 1QVCA 2VQFL 4HJ8A 2E2JH 3U58A 2UUBQ 4QIWE 1XNRQ 3PO2G 3HOWH 3MEFA 4A3MG 4R4TA 4JI7Q 1TXYA 3PUXA 5AJ3L 4PZ7A 1PH8A 4LF4Q 3NELA 2IT1A 1MKHA 3I4NG 3I55A 5LMNW 1JE5A 1JMCA 3TS2A 2UXBQ 1YHBA 1WFQA 2VQEQ 4LF5Q 4X62Q 1N8RC 2VUMH 2OCEA 3UE1A 2UUAQ 4KHPQ 4HIOA 4JI8Q 3GTMH 4NPSA 1UEBA 4YCUA 3RLFA 3TQYA 3PV0A 5C0XJ 2CFMA 1BKBA 5IWAQ 1K73C 4JOIA 2DGYA 2JJQA 4JI2Q 4P75A 1YJWA 1X3FA 1VQAA 4GNXC 2NVQH 1QUQA 3GTLH 3S1NH 1N36L 4DR6Q 1HR0W 3HOZG 1Z9FA 4DR2L 1IZ6A 4AH6A 3KLWA 4DV3L 4GOPC 4A3IG 1VQ5A 2R92G 3OYYA 4GN5A 2B63H 3PO3H 4GKKQ 5ELOA 1HNWL 4A3KH 4BA2I 2BA0A 2K75A 4IOCA 4BY1G 3RLNA 2KCTA 4NXNQ 4DV1L 1HZ9A 4A3FH 1IL2A 4OONA 4A93G 5IP9H 3CCRA 4B3MQ 3J7A5 4A3GG 1IBLL 3KYHC 2WAQG 1N33Q 5FJ8H 2F52A 4JI6Q 4O0AA 5M5YH 1PH6A 3CC2A 1IXRA 4ME3A 4JI4L 1WOCA 1XNRL 4OXPA 3KFUA 1XMQL 4DUYQ 1X3GA 1YNXA 4DR1Q 2JA9A 1QUQB 4JI1L 4MNOA 4QY7A 5IY0A 1DGSA 1Y14B 4POGA 1TWHH 4IPDA 2MNAA 4A3LG 1X3EA 3UDFA 3CAMA 2D0PA 2UXCQ 4YHHL 5GROA 3S1MH 1E7ZA 3A5UA 4PZ6A 3M3YH 1A0IA 2GVBA 1I6HH 2Z6KC 4MZ9A 3U4ZA 4BY7H 4BBSH 4JI0L 4DV4Q 5DLQE 4UY8C 3S1RH 3M85A 5FLMH 1NMFA 3F8TA 3ULLA 4AYBE 4DV0Q 4LFBL 3PIOA 4GN3B 3HOWG 1FL0A 1MJCA 4OX9L 3HOUH 2OTJA 4Y7NH 3CCMA 2WB1E 3G48A 4GS3A 1AE3A 5IP7H 2R7ZH 3CPFA 1VQIA 3J81c 4A3EG 1XPUA 4WJ3M 4AQYL 1A8VA 3M9BA 3T1HL 1YHQA 1EWIA 2I0QA 2UUBL 3M7NA 1NY4A 2KHJA 4DV5Q 1Q7YC 4K0KL 3K0XA 3L0OA 4LNQA 2VUMG 4JI7L 2A8VA 3CC7A 5BR8Q 1B7YB 1OXTA 2UUCQ 1PH1A 4LF4L 1KXLA 1NMGA 4IFDJ 1Y1VG 2BA1A 1M90C 4YCWA 4DAYB 1X65A 4C2MH 3CCJA 2KENA 2OQKA 2RHQB 4FDBA 4EQ5A 2UXBL 4DR5Q 2JQOA 4DPGA 1VQDA 2A19A 3GDEA 4QJFA 4X62L 2VQEL 4LF5L 1VQ6A 5M3FG 1SRUA 2HIXA 3FP9A 1EUJA 2UU9Q 2JA5G 2ZJRA 2UUAL 3PO3G 4KHPL 3PUZA 3Q8DA 3HKZG 1HZBA 4JI8L 3E9IA 2EXDA 4A3KG 2B63G 1IYJB 1IBKQ 5IWAL 3GTKH 4IPHA 2JA7H 4A3FG 2VNUD 1JB7A 1PH5A 4JI2L 1K8AC 1FJGQ 2D0OA 1VQNA 4PG3A 1KRSA 1VS0A 2MO1A 4DR6L 5E7NA 3BJUA 5FJ8G 4JYAQ 1YZ6A 3K81C 2ZTCA 2EIFA 4PZ8A 4GKKL 1LYLA 1Y1WH 3HFZB 2YYZA 2NVXH 1SR3A 4B3TQ 2Y0SG 1D7QA 4NXNL 2QGQA 3GD7A 1K9MC 5JJIA 3K8AA 4LF9Q 4DR4Q 4DV6Q 4B3ML 3BU2A 1EIFA 1N33L 1NE3A 1CKNA 2R6GA 4RMFA 4DR3Q 3PF5A 4JI6L 4OO1G 1WI5A 4JBKA 1KIXA 2HHHQ 1E1OA 2UXDQ 1VQFA 2K52A 2FXQA 2E2IH 2V1CC 2AKWB 1K3RA 4DUZQ 1E24A 4DR1L 1C7YA 4UPAA 3CCUA 5IYCH 2IX1A 1LM0A 1VQLA 4BY7G 4BBSG 1J5EQ 3F2DA 4P73A 1CUKA 4P71A 5FLMG 5JJKA 5M3MG 1N32Q 1QZGA 4IO9A 2UXCL 1A63A 4A75A 4MTNA 1GD7A 1EOVA 4LF8Q 3J81i 4OO1I 4APVA 3HOUG 2IHFA 5K36G 2N78A 4ALPA 4B3SQ 1LTLA 4JBMA 1PHJA 2NVYH 5IP7G 4GNXA 2R7ZG 4UP7A 1VQOA 3J80c 1CKNB 3H3VH 5EAYA 4A3CH 1VQGA 5HY6A 1SLJA 4GOPA 1N34L 3KF6A 3PSIA 4DV0L 3S2HH 3I2ZA 2XTIA 3H0GH 5IE8A 2WAQE 3B6YA 3STBD 3I4MH 1XTDA 2VZAA 4BBRG 2ZJQA 2I5HA 4PMWA 3VDYA 4H02A 3GTGH 5JEAJ 4B3RQ 1J6QA 1EQRA 5GAGC 4LF6Q 1CKMA 5FLXc 1X6OA 5IYDG 3L7ZC 1PA6A 1GM5A 2JE6I 1GKHA 3D31A 2Q2UA 3E9HA 4LFCQ 3CP0A 4NXMQ 1L2FA 4Y52H 2JK8A 4KHZA 4DV2Q 1I5FA 3L2PA 1YITA 4GN4B 4GNXB 2UUCL 4A3DH 2F4VQ 5M5XH 1K0RA 4HIMA 3BZCA 2RF4A 1XMOQ 1PH4A 4GOPB 2I5MX 3CCQA 3KF6B 5LMNQ 2JA7G 2ZM6Q 4GLXA 4DR5L 1QZHA 2CCZA 3FHWA 1Q46A 5C4XH 1UWVA 1P8LA 1EQQA 2UU9L 1N9WA 2N49A 2YTXA 3F2CA 4A3BH 5C3EH 4YY3L 2WFWA 2E2HH 2Z6KA 2JA8H 1Y1WG 3EIVA 4C3JH 1IBKL 2ID0A 3ZJYC 3GTJH 1WCMH 4LFAQ 3G71A 1X54A 1WYDA 2HIVA 2NZHA 2IHEA 4IJHA 1FJGL 4KI0A 2IY5B 3OW2A 1CKOA 1XNQQ 1SMXA 3HOXH 1W2BA 3CW2C 4C3HH 1HR0Q 1PFSA 1TWAH 1VQBA 4JYAL 4XTCS 1PH2A 1QVFA 3I56A 4LF7Q 4B3TL 1HNXQ 3M4PA 3KJOA 5C44H 1IBMQ 3K80C 4A3MH 1MJEA 5IYCG 4LF9L 4DR4L 2E5LQ 5M5WH 2R93H 3OTOQ 2PMZE 1V1QA 3RN5A 1XPOA 2LSSA 3CC4A 1KL9A 1NTGA 3STBC 1X56A 1YBYA 2CQOA 3AFQA 3AYHB 4R4OA 4DV7Q 4HJAA 3AFPA 4DR3L 1VQPA 2K4KA 2PI2E 4GLVB 3CMAA 2HHHL 1JJCB 4X66Q 2ZTEA 1U5KA 2QEXA 4DUZL 1W3SA 3EBEA 3HKZE 2VL6A 1K8GA 3I4OA 4L5SA 2NZOA 5GQOA 3CQZH 3HOVH 4A3JH 4LUZA 3CD6A 1J5EL 3GTPH 1Q81C 3PUWA 1PYSB 1B8AA 4IPCA 4A3CG 1HNWQ 1VQCA 1NBWA 1OXVA 3H0GG 4RG1A 3CCVA 4DV1Q 1VQ9A 4LF8L 1VQMA 1HNZQ 4R4IA 2B3GA 2H5XA 4OWXB 1AH9A 1Q86C 1JT8A 4L5TA 4GKJQ 2OWOA 1Q8KA 2Y0SE 1S3OA 3S15H 3E0EA 2AHOB 3HOZH 5H1SE 1YHAA 1P16A 2B29A 4A3IH 1I3QH 1Z47A 2I5LX 4GLAC 2R92H 1FVIA 4O2DA 4R1JA 1D8LA 5IP9G 4JV5Q 3FKIH 4YWMA 3MXNB 1XMQQ 3J7ZC 1SROA 1T9HA 1WJJA 4BY1H 3S16H 3EN2A 3H3VI 1FGUA 3S1QH 3A0JA 4A93H 3T1YQ 3IRBA 4JI1Q 1H95A 3LGJA 1C0AA 4B3RL 3RN2A 3TEHB 2WP8J 4LWCA 1L0WA 5C0XG 4LF6L 4X64Q 5LMUQ 1HJPA 1YJNA 5JJLA 2YU9H 3PGZA 3ICEA 3NBHB 4LFCL 4JI5Q 4QQBX 3CXCA 4JI3Q 1L1OC 4NXML 5C4XG 4P74A 1U0LA 2OQ0A 2K14A 3HKSA 5C3EG 4A3BG 1K83H 2F4VL 1X9NA 3RNUA 4JI0Q 2PI2A 4DUYL 2JA8G 4X65Q 1KHIA 1XMOL 1E1TA 2D62A 5LMNL 1WCMG 4LFBQ 3HOYH 1A62A 2ZM6L 3PF4A 2A1AA 1GO3E 5C0XI 2MQHA 4HJ7A 2XGTA 1PYBA 1PH9A 1VQ7A 3GTQH 2QA4A 2LXJA 3PCOB 3H15A 2Q2TA 3HOXG 4DR7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CSP A;  3U50 C;  4L5Q A;  4AQY Q;  1SFO H;  1TWC H;  3TS0 A;  1G6P A;  4YCV A;  2YV5 A;  5GAD C;  5IYB H;  1S40 A;  3ER0 A;  1B70 B;  4K0K Q;  1MIU A;  2R7D A;  4LFA L;  5C44 G;  1RIP A;  3GTO H;  2R93 G;  2RHS B;  5GAH C;  2CWP A;  4DNI A;  2Q2I A;  4DV4 L;  1XNQ L;  3K7A H;  2DUD A;  3F2B A;  3JAM c;  1YJ9 A;  1HR0 L;  1KAW A;  4A3E H;  3W1B A;  1YVC A;  1O7I A;  4LF7 L;  2VY3 A;  2NN6 G;  1ASY A;  2HQL A;  2YTV A;  1HNX L;  1KD1 C;  4YWK A;  1IBM L;  2ZJP A;  3ULP A;  2E5L L;  2EQS A;  4R4Q A;  3OTO L;  4DK6 C;  2Q2H A;  3HOV G;  3PIP A;  3KOJ A;  4A3J G;  1PVO A;  1ASZ A;  1I94 Q;  3UDG A;  3WWV A;  2PNH A;  1KRT A;  4DV5 L;  4DV7 L;  1Y1V H;  1E22 A;  4YWL A;  1R9T H;  1VQE A;  4QL5 A;  3I7F A;  4X66 L;  4A4I A;  3CCS A;  2AWO A;  4IPG A;  4P72 A;  5BR8 L;  4WJ4 A;  1VQH A;  2F3I A;  3UE0 A;  1E3P A;  1G29 1;  3JC6 6;  4JOI C;  5M3F H;  1OXU A;  2NN6 I;  3NEM A;  1PH7 A;  2JA5 H;  2N3S A;  4TVA B;  3M4O H;  2E8G A;  4OWW B;  2AWN A;  3FKI G;  3PUV A;  4JG2 A;  3UDX A;  4POF A;  2GVA A;  3A74 A;  1PH3 A;  1EIY B;  2ASB A;  2N8N A;  1JJG A;  1BBW A;  1HNZ L;  3DLL A;  2KHI A;  3RZD H;  1Q1E A;  3CPW A;  4GKJ L;  4IFD G;  2VQF Q;  3BZK A;  2JA6 H;  3G6E A;  1TWF H;  1TWG H;  3CCE A;  1QVG A;  1NJI C;  4JV5 L;  1VQ8 A;  4A76 A;  1PV4 A;  4BXX H;  1XJV A;  1KQS A;  5AJ3 Q;  3K7U C;  4QGU A;  3F1Z A;  5GAE C;  1V43 A;  3T1Y L;  2ZTD A;  2RCN A;  2JEB I;  2VS1 A;  2Z0S A;  4HJ5 A;  1VQJ A;  1KC8 C;  4KLK A;  2OTL A;  4X64 L;  4L5R C;  5LMU L;  3PO2 H;  1LUZ A;  3S24 A;  4DV6 L;  4JCV E;  4DAM A;  4IFD I;  3HOY G;  2BH2 A;  1HZC A;  3RZO H;  4JI5 L;  2KBN A;  4JI3 L;  4C3I H;  3A5Z B;  4XIG S;  3I4N H;  1BBU A;  2ES2 A;  2UXD L;  2CWA A;  3S17 H;  4NB3 A;  1GVP A;  3GO5 A;  2KCM A;  3TRZ A;  3J80 i;  1CSQ A;  1EFW A;  4X65 L;  5IYB G;  1N34 Q;  1SN8 A;  5M3M H;  2IX0 A;  3KJP A;  1BVS A;  5J3B A;  1UE6 A;  4DK3 C;  1C9O A;  1V9P A;  4R4C A;  3JAM i;  1Q1B A;  1UE7 A;  2PQA A;  5HGQ A;  4DR2 Q;  4TQU S;  4DV3 Q;  1RL2 A;  3AEV A;  4DR7 L;  1VCI A;  2GN5 A;  3W1G A;  3W5O A;  1Q82 C;  3CCL A;  3CF5 A;  1N32 L;  3CME A;  3M4Q A;  5C4J H;  3I4M G;  2AMC B;  2K5H A;  2HT1 A;  4B3S L;  3PUY A;  1YIJ A;  1IBL Q;  2LXK A;  2C35 B;  4AYB G;  3UDI A;  4HJ9 A;  4IJL A;  3AQQ A;  2L15 A;  4BBR H;  3J81 j;  4LW1 A;  4OWT B;  1AE2 A;  2CKZ B;  4JI4 Q;  1G51 A;  2WB1 G;  1YEZ A;  1S72 A;  3SGI A;  4JBW A;  2MFI A;  2K50 A;  5IYD H;  4BA1 I;  1M1K C;  4A3G H;  4A3D G;  4EX5 A;  1OXS C;  3KDF A;  4HIK A;  2PQA B;  3RR5 A;  1EYG A;  4X6A H;  1UE1 A;  3ULJ A;  3D0F A;  1L1O A;  1Q12 A;  2K5V A;  4AIM A;  2NVT H;  3S2D H;  1I94 L;  4YY3 Q;  4YHH Q;  1X55 A;  2ALY B;  3S14 H;  3G4S A;  4J15 A;  1SE8 A;  3DM3 A;  1N36 Q;  4LUO A;  1I50 H;  4DV2 L;  2VW9 A;  3TRE A;  3KF8 B;  1HH2 P;  5JEA G;  4HID A;  1JJ2 A;  1OTC A;  2JEA I;  2K5N A;  3ERS X;  1VQ4 A;  2ATW A;  4A3L H;  2MO0 A;  2JA6 G;  4IOA A;  5IT9 c;  1YI2 A;  4JBJ A;  4OX9 Q;  4UP8 A;  4BXX G;  1OXX K;  4JC0 A;  4LUV A;  1VQK A;  3NEN A;  1HZA A;  2BH8 A;  3KDF B;  4UP9 A;  4DKA C;  2R7F A;  5ELN A;  3T1H Q;  1XPR A;  1UE5 A;  1L1O B;  2YTY A;  3RLO A;  3U4V A;  1QVC A;  2VQF L;  4HJ8 A;  2E2J H;  3U58 A;  2UUB Q;  4QIW E;  1XNR Q;  3PO2 G;  3HOW H;  3MEF A;  4A3M G;  4R4T A;  4JI7 Q;  1TXY A;  3PUX A;  5AJ3 L;  4PZ7 A;  1PH8 A;  4LF4 Q;  3NEL A;  2IT1 A;  1MKH A;  3I4N G;  3I55 A;  5LMN W;  1JE5 A;  1JMC A;  3TS2 A;  2UXB Q;  1YHB A;  1WFQ A;  2VQE Q;  4LF5 Q;  4X62 Q;  1N8R C;  2VUM H;  2OCE A;  3UE1 A;  2UUA Q;  4KHP Q;  4HIO A;  4JI8 Q;  3GTM H;  4NPS A;  1UEB A;  4YCU A;  3RLF A;  3TQY A;  3PV0 A;  5C0X J;  2CFM A;  1BKB A;  5IWA Q;  1K73 C;  4JOI A;  2DGY A;  2JJQ A;  4JI2 Q;  4P75 A;  1YJW A;  1X3F A;  1VQA A;  4GNX C;  2NVQ H;  1QUQ A;  3GTL H;  3S1N H;  1N36 L;  4DR6 Q;  1HR0 W;  3HOZ G;  1Z9F A;  4DR2 L;  1IZ6 A;  4AH6 A;  3KLW A;  4DV3 L;  4GOP C;  4A3I G;  1VQ5 A;  2R92 G;  3OYY A;  4GN5 A;  2B63 H;  3PO3 H;  4GKK Q;  5ELO A;  1HNW L;  4A3K H;  4BA2 I;  2BA0 A;  2K75 A;  4IOC A;  4BY1 G;  3RLN A;  2KCT A;  4NXN Q;  4DV1 L;  1HZ9 A;  4A3F H;  1IL2 A;  4OON A;  4A93 G;  5IP9 H;  3CCR A;  4B3M Q;  3J7A 5;  4A3G G;  1IBL L;  3KYH C;  2WAQ G;  1N33 Q;  5FJ8 H;  2F52 A;  4JI6 Q;  4O0A A;  5M5Y H;  1PH6 A;  3CC2 A;  1IXR A;  4ME3 A;  4JI4 L;  1WOC A;  1XNR L;  4OXP A;  3KFU A;  1XMQ L;  4DUY Q;  1X3G A;  1YNX A;  4DR1 Q;  2JA9 A;  1QUQ B;  4JI1 L;  4MNO A;  4QY7 A;  5IY0 A;  1DGS A;  1Y14 B;  4POG A;  1TWH H;  4IPD A;  2MNA A;  4A3L G;  1X3E A;  3UDF A;  3CAM A;  2D0P A;  2UXC Q;  4YHH L;  5GRO A;  3S1M H;  1E7Z A;  3A5U A;  4PZ6 A;  3M3Y H;  1A0I A;  2GVB A;  1I6H H;  2Z6K C;  4MZ9 A;  3U4Z A;  4BY7 H;  4BBS H;  4JI0 L;  4DV4 Q;  5DLQ E;  4UY8 C;  3S1R H;  3M85 A;  5FLM H;  1NMF A;  3F8T A;  3ULL A;  4AYB E;  4DV0 Q;  4LFB L;  3PIO A;  4GN3 B;  3HOW G;  1FL0 A;  1MJC A;  4OX9 L;  3HOU H;  2OTJ A;  4Y7N H;  3CCM A;  2WB1 E;  3G48 A;  4GS3 A;  1AE3 A;  5IP7 H;  2R7Z H;  3CPF A;  1VQI A;  3J81 c;  4A3E G;  1XPU A;  4WJ3 M;  4AQY L;  1A8V A;  3M9B A;  3T1H L;  1YHQ A;  1EWI A;  2I0Q A;  2UUB L;  3M7N A;  1NY4 A;  2KHJ A;  4DV5 Q;  1Q7Y C;  4K0K L;  3K0X A;  3L0O A;  4LNQ A;  2VUM G;  4JI7 L;  2A8V A;  3CC7 A;  5BR8 Q;  1B7Y B;  1OXT A;  2UUC Q;  1PH1 A;  4LF4 L;  1KXL A;  1NMG A;  4IFD J;  1Y1V G;  2BA1 A;  1M90 C;  4YCW A;  4DAY B;  1X65 A;  4C2M H;  3CCJ A;  2KEN A;  2OQK A;  2RHQ B;  4FDB A;  4EQ5 A;  2UXB L;  4DR5 Q;  2JQO A;  4DPG A;  1VQD A;  2A19 A;  3GDE A;  4QJF A;  4X62 L;  2VQE L;  4LF5 L;  1VQ6 A;  5M3F G;  1SRU A;  2HIX A;  3FP9 A;  1EUJ A;  2UU9 Q;  2JA5 G;  2ZJR A;  2UUA L;  3PO3 G;  4KHP L;  3PUZ A;  3Q8D A;  3HKZ G;  1HZB A;  4JI8 L;  3E9I A;  2EXD A;  4A3K G;  2B63 G;  1IYJ B;  1IBK Q;  5IWA L;  3GTK H;  4IPH A;  2JA7 H;  4A3F G;  2VNU D;  1JB7 A;  1PH5 A;  4JI2 L;  1K8A C;  1FJG Q;  2D0O A;  1VQN A;  4PG3 A;  1KRS A;  1VS0 A;  2MO1 A;  4DR6 L;  5E7N A;  3BJU A;  5FJ8 G;  4JYA Q;  1YZ6 A;  3K81 C;  2ZTC A;  2EIF A;  4PZ8 A;  4GKK L;  1LYL A;  1Y1W H;  3HFZ B;  2YYZ A;  2NVX H;  1SR3 A;  4B3T Q;  2Y0S G;  1D7Q A;  4NXN L;  2QGQ A;  3GD7 A;  1K9M C;  5JJI A;  3K8A A;  4LF9 Q;  4DR4 Q;  4DV6 Q;  4B3M L;  3BU2 A;  1EIF A;  1N33 L;  1NE3 A;  1CKN A;  2R6G A;  4RMF A;  4DR3 Q;  3PF5 A;  4JI6 L;  4OO1 G;  1WI5 A;  4JBK A;  1KIX A;  2HHH Q;  1E1O A;  2UXD Q;  1VQF A;  2K52 A;  2FXQ A;  2E2I H;  2V1C C;  2AKW B;  1K3R A;  4DUZ Q;  1E24 A;  4DR1 L;  1C7Y A;  4UPA A;  3CCU A;  5IYC H;  2IX1 A;  1LM0 A;  1VQL A;  4BY7 G;  4BBS G;  1J5E Q;  3F2D A;  4P73 A;  1CUK A;  4P71 A;  5FLM G;  5JJK A;  5M3M G;  1N32 Q;  1QZG A;  4IO9 A;  2UXC L;  1A63 A;  4A75 A;  4MTN A;  1GD7 A;  1EOV A;  4LF8 Q;  3J81 i;  4OO1 I;  4APV A;  3HOU G;  2IHF A;  5K36 G;  2N78 A;  4ALP A;  4B3S Q;  1LTL A;  4JBM A;  1PHJ A;  2NVY H;  5IP7 G;  4GNX A;  2R7Z G;  4UP7 A;  1VQO A;  3J80 c;  1CKN B;  3H3V H;  5EAY A;  4A3C H;  1VQG A;  5HY6 A;  1SLJ A;  4GOP A;  1N34 L;  3KF6 A;  3PSI A;  4DV0 L;  3S2H H;  3I2Z A;  2XTI A;  3H0G H;  5IE8 A;  2WAQ E;  3B6Y A;  3STB D;  3I4M H;  1XTD A;  2VZA A;  4BBR G;  2ZJQ A;  2I5H A;  4PMW A;  3VDY A;  4H02 A;  3GTG H;  5JEA J;  4B3R Q;  1J6Q A;  1EQR A;  5GAG C;  4LF6 Q;  1CKM A;  5FLX c;  1X6O A;  5IYD G;  3L7Z C;  1PA6 A;  1GM5 A;  2JE6 I;  1GKH A;  3D31 A;  2Q2U A;  3E9H A;  4LFC Q;  3CP0 A;  4NXM Q;  1L2F A;  4Y52 H;  2JK8 A;  4KHZ A;  4DV2 Q;  1I5F A;  3L2P A;  1YIT A;  4GN4 B;  4GNX B;  2UUC L;  4A3D H;  2F4V Q;  5M5X H;  1K0R A;  4HIM A;  3BZC A;  2RF4 A;  1XMO Q;  1PH4 A;  4GOP B;  2I5M X;  3CCQ A;  3KF6 B;  5LMN Q;  2JA7 G;  2ZM6 Q;  4GLX A;  4DR5 L;  1QZH A;  2CCZ A;  3FHW A;  1Q46 A;  5C4X H;  1UWV A;  1P8L A;  1EQQ A;  2UU9 L;  1N9W A;  2N49 A;  2YTX A;  3F2C A;  4A3B H;  5C3E H;  4YY3 L;  2WFW A;  2E2H H;  2Z6K A;  2JA8 H;  1Y1W G;  3EIV A;  4C3J H;  1IBK L;  2ID0 A;  3ZJY C;  3GTJ H;  1WCM H;  4LFA Q;  3G71 A;  1X54 A;  1WYD A;  2HIV A;  2NZH A;  2IHE A;  4IJH A;  1FJG L;  4KI0 A;  2IY5 B;  3OW2 A;  1CKO A;  1XNQ Q;  1SMX A;  3HOX H;  1W2B A;  3CW2 C;  4C3H H;  1HR0 Q;  1PFS A;  1TWA H;  1VQB A;  4JYA L;  4XTC S;  1PH2 A;  1QVF A;  3I56 A;  4LF7 Q;  4B3T L;  1HNX Q;  3M4P A;  3KJO A;  5C44 H;  1IBM Q;  3K80 C;  4A3M H;  1MJE A;  5IYC G;  4LF9 L;  4DR4 L;  2E5L Q;  5M5W H;  2R93 H;  3OTO Q;  2PMZ E;  1V1Q A;  3RN5 A;  1XPO A;  2LSS A;  3CC4 A;  1KL9 A;  1NTG A;  3STB C;  1X56 A;  1YBY A;  2CQO A;  3AFQ A;  3AYH B;  4R4O A;  4DV7 Q;  4HJA A;  3AFP A;  4DR3 L;  1VQP A;  2K4K A;  2PI2 E;  4GLV B;  3CMA A;  2HHH L;  1JJC B;  4X66 Q;  2ZTE A;  1U5K A;  2QEX A;  4DUZ L;  1W3S A;  3EBE A;  3HKZ E;  2VL6 A;  1K8G A;  3I4O A;  4L5S A;  2NZO A;  5GQO A;  3CQZ H;  3HOV H;  4A3J H;  4LUZ A;  3CD6 A;  1J5E L;  3GTP H;  1Q81 C;  3PUW A;  1PYS B;  1B8A A;  4IPC A;  4A3C G;  1HNW Q;  1VQC A;  1NBW A;  1OXV A;  3H0G G;  4RG1 A;  3CCV A;  4DV1 Q;  1VQ9 A;  4LF8 L;  1VQM A;  1HNZ Q;  4R4I A;  2B3G A;  2H5X A;  4OWX B;  1AH9 A;  1Q86 C;  1JT8 A;  4L5T A;  4GKJ Q;  2OWO A;  1Q8K A;  2Y0S E;  1S3O A;  3S15 H;  3E0E A;  2AHO B;  3HOZ H;  5H1S E;  1YHA A;  1P16 A;  2B29 A;  4A3I H;  1I3Q H;  1Z47 A;  2I5L X;  4GLA C;  2R92 H;  1FVI A;  4O2D A;  4R1J A;  1D8L A;  5IP9 G;  4JV5 Q;  3FKI H;  4YWM A;  3MXN B;  1XMQ Q;  3J7Z C;  1SRO A;  1T9H A;  1WJJ A;  4BY1 H;  3S16 H;  3EN2 A;  3H3V I;  1FGU A;  3S1Q H;  3A0J A;  4A93 H;  3T1Y Q;  3IRB A;  4JI1 Q;  1H95 A;  3LGJ A;  1C0A A;  4B3R L;  3RN2 A;  3TEH B;  2WP8 J;  4LWC A;  1L0W A;  5C0X G;  4LF6 L;  4X64 Q;  5LMU Q;  1HJP A;  1YJN A;  5JJL A;  2YU9 H;  3PGZ A;  3ICE A;  3NBH B;  4LFC L;  4JI5 Q;  4QQB X;  3CXC A;  4JI3 Q;  1L1O C;  4NXM L;  5C4X G;  4P74 A;  1U0L A;  2OQ0 A;  2K14 A;  3HKS A;  5C3E G;  4A3B G;  1K83 H;  2F4V L;  1X9N A;  3RNU A;  4JI0 Q;  2PI2 A;  4DUY L;  2JA8 G;  4X65 Q;  1KHI A;  1XMO L;  1E1T A;  2D62 A;  5LMN L;  1WCM G;  4LFB Q;  3HOY H;  1A62 A;  2ZM6 L;  3PF4 A;  2A1A A;  1GO3 E;  5C0X I;  2MQH A;  4HJ7 A;  2XGT A;  1PYB A;  1PH9 A;  1VQ7 A;  3GTQ H;  2QA4 A;  2LXJ A;  3PCO B;  3H15 A;  2Q2T A;  3HOX G;  4DR7 Q; 
#chains in the Genus database with same CATH topology
 3TDQ A;  3TS0 A;  1G6P A;  1XTC D;  5GAD C;  1S40 A;  2K32 A;  1B70 B;  1Y1V B;  4B9X A;  3GTO H;  1XXG A;  3GP7 A;  2R93 G;  2HUG A;  2Q2I A;  4DV4 L;  1BDO A;  3T53 B;  3BZD B;  3W1B A;  4A3E H;  1F2M A;  1XX8 A;  3QIA A;  3ULP A;  2E5L L;  2MJ8 A;  4R4Q A;  4A3F B;  4MTK A;  3KOJ A;  3UDG A;  2PNH A;  1KRT A;  4DV7 L;  4HAE A;  3PIO 3;  1VQE A;  2OT2 A;  3P75 A;  1SNP A;  1TWF B;  3T13 A;  4MN3 A;  1BF4 A;  2KA7 A;  3DHQ A;  2F3I A;  2Y0S B;  1E3P A;  1SE2 A;  3JC6 6;  1EIG A;  2NN6 I;  1B53 A;  1I6V C;  2B2W A;  2E8G A;  2AWN A;  4LMQ D;  1EIY B;  1PH3 A;  2ASB A;  1LAC A;  2EYM A;  1WTQ A;  5JEA H;  3GV6 A;  3BDO A;  3S1M B;  1EL0 A;  1QG7 A;  3E0J A;  5IGG A;  3CCE A;  1NJI C;  2PW7 A;  1PV4 A;  4N8F A;  5CV8 A;  3S1R B;  1TY0 A;  4QGU A;  5IGF A;  2RCN A;  1KC8 C;  2IW3 A;  3MXG A;  2L1B A;  4L5R C;  1KDC A;  2R7Z B;  2N55 A;  3FPU B;  1FGB D;  2BH2 A;  1UEA B;  1RHP A;  4JI3 L;  5FK9 C;  2F0S A;  3I4N H;  2ES2 A;  2UXD L;  3S17 H;  4NB3 A;  2B39 A;  1GVP A;  3GO5 A;  5KNC A;  2KCM A;  2X6G A;  5FO7 B;  1EFW A;  3NWS A;  1SN8 A;  2JYO A;  5I9O A;  1Q1B A;  1JOO A;  2JSO A;  4DV3 Q;  3AEV A;  1I4Q A;  3MA2 B;  2GN5 A;  2O2L D;  2WAQ B;  3M4Q A;  5C4J H;  3K58 A;  2AMC B;  4B3S L;  2B2Y C;  1S4Z A;  1YNN C;  4RWS C;  3UDI A;  1I50 B;  4BBR H;  4F87 A;  4LW1 A;  4JI4 Q;  1G51 A;  1PLF A;  2L9H A;  2RDH A;  2Z6B A;  4BA1 I;  5IYD H;  3I90 A;  3MEH A;  1WTV A;  1BQQ T;  2QCP X;  4EVO A;  4Q5V A;  1G2S A;  3CRK C;  3HGB A;  1Q12 A;  1SAP A;  3DM3 A;  4KTA A;  4RA8 A;  3KF8 B;  1XYI A;  2E2I B;  1VQ4 A;  4A3L H;  1I4H A;  4IOA A;  5IT9 c;  4UP8 A;  1AEX A;  1HZA A;  2E76 C;  2BH8 A;  4OGQ C;  2F0Q A;  1ZYR C;  5KYI A;  1A2U A;  2P5Z X;  1QVC A;  1RDP D;  1R4Q B;  3BYY B;  4R4T A;  2EYJ A;  1PH8 A;  4PZ7 A;  2KQ3 A;  3C1E A;  1NR4 A;  1K8O A;  5LMN W;  4HED A;  1JMC A;  3GTG B;  4E6I A;  1YHB A;  1WD1 A;  3SEB A;  2EYL A;  4F7X A;  4LF5 Q;  4X62 Q;  1U4L A;  3UE1 A;  1PXU A;  3NQT A;  3R3O A;  1BKB A;  4M1U B;  1SSO A;  5IWA Q;  3KBG A;  1X3F A;  1VQA A;  4GNX C;  2NVQ H;  1D1K A;  4DR6 Q;  4DR2 L;  2R92 G;  4A3I G;  3PO3 H;  2B63 H;  4GKK Q;  4IOC A;  1TWH B;  5DM7 3;  1GUS A;  4DV1 L;  4A3F H;  5C3E B;  5D14 A;  1F9P A;  4A93 G;  5IP9 H;  4KY6 A;  2E2H B;  1PRT D;  1I6H B;  5FJ8 H;  1U4P A;  1IXR A;  1WOC A;  2OEO A;  3KFU A;  3KLS A;  3HOX B;  4O42 A;  2L5T A;  2K01 A;  3MVV A;  5E1F A;  5A2Q E;  4JI1 L;  4QY7 A;  5IY0 A;  1DGS A;  1O7Y A;  2R93 B;  3CAM A;  2D0P A;  2UXC Q;  1PZI D;  2DY7 A;  2BE5 D;  4XT1 B;  3S1M H;  1E7Z A;  3A5U A;  2GVB A;  5D3I B;  4K2L A;  4MZ9 A;  4DXG A;  4JI0 L;  1A3V A;  5I6W A;  4KKU A;  3S1R H;  3OWF A;  3M85 A;  1F9Q A;  1O7L A;  3HOW G;  1BR9 A;  5K36 H;  1RD9 D;  3CCM A;  3GTP B;  1HUN A;  2R7Z H;  3HP3 A;  4L6T B;  4A3E G;  4AQY L;  3M9B A;  1BO0 A;  5ELF A;  1L0Y B;  3K0X A;  4KJO A;  4C56 C;  2VUM G;  3MXN A;  3E5S A;  5BR8 Q;  1B7Y B;  1KXL A;  4LF4 L;  3S16 B;  4IFD J;  1WTO A;  1EEF D;  1X32 A;  4C2M H;  3CCJ A;  2UXB L;  4KN7 C;  4DR5 Q;  4QJF A;  3GDE A;  1VQ6 A;  3FP9 A;  3BDL A;  2DNE A;  1S5F D;  1JC7 A;  2J4X A;  4KHP L;  3VYT A;  2EY1 A;  1LTS D;  3E9I A;  2EXD A;  4A3K G;  1JE4 A;  4ULL A;  3BVM A;  1IBK Q;  4IPH A;  2AQ3 B;  1JB7 A;  4H0L C;  4CDE C;  1VS0 A;  2MO1 A;  1HTP A;  2R3Z A;  3PIP 3;  2EJF C;  1YZ6 A;  3ZYY X;  2EIF A;  1LYL A;  1K28 A;  4B3T Q;  2NVX H;  1SR3 A;  3GD7 A;  1JB3 A;  2O5J C;  3A7L A;  3URY A;  2PZT A;  3TP7 A;  3J81 L;  3MAQ A;  1E1O A;  4JBK A;  1MHW C;  2E2I H;  2V1C C;  4DUZ Q;  4UPA A;  3CCU A;  1EFI D;  5BN3 A;  4C1N I;  4P71 A;  5EPL A;  1QWY A;  3KBX A;  2K28 A;  1Q90 A;  3HOU G;  1H9J A;  1LTL A;  4HSV A;  1PHJ A;  5T1G A;  4RGM A;  4GNX A;  2A5H A;  1SLJ A;  4DNR B;  5M5X B;  3KF6 A;  3PSI A;  3S2H H;  3I2Z A;  3B6Y A;  3QB3 A;  4BBR G;  2ZJQ A;  3BDC A;  4RCN A;  4H02 A;  3T51 B;  4CJ1 B;  3GTG H;  5GAG C;  5KEE A;  5IYD G;  3L7Z C;  1PA6 A;  3D31 A;  3E9H A;  3VA5 A;  5KYL A;  4KY5 A;  5ELC A;  1I5F A;  3L2P A;  2EYF A;  4GN4 B;  4GNX B;  4HIM A;  3BZC A;  1TWA B;  2D9U A;  4PMC A;  3KF6 B;  4HCS A;  4LAA A;  4ZRZ A;  4GLX A;  4FP5 D;  1Q46 A;  3I3C A;  5C4X H;  1N9W A;  5C3E H;  2E2H H;  4NW2 A;  1X3Q A;  5CV9 A;  3VR3 A;  3ZJY C;  2VXW A;  1TQO A;  2HIV A;  2NZH A;  4KI0 A;  2IY5 B;  3D6W A;  1XNQ Q;  3HOX H;  4QIW B;  1PH2 A;  1QVF A;  3J80 L;  4OHJ A;  3M4P A;  2IJ0 A;  1EQV A;  2HD3 A;  2L11 A;  4DR4 L;  2R93 H;  5IYC G;  2JP1 A;  2JN4 A;  2PMZ E;  4DAV A;  1SDF A;  2LSS A;  3FRP B;  3CC4 A;  1KL9 A;  3A8I E;  2CQO A;  3AYH B;  4R4O A;  3TP5 A;  2PI2 E;  3CMA A;  4K8J A;  2R92 B;  1JJC B;  4A3I B;  3OMG A;  1U5K A;  2QEX A;  3MWY W;  2VL6 A;  3OSO A;  3I4O A;  2NZO A;  5GQO A;  1A2T A;  4LUZ A;  4ZLT F;  3I4L A;  4A93 B;  1J5E L;  1CQF A;  1C8C A;  4FXD A;  3GTP H;  1GXD C;  1Q81 C;  1HNW Q;  1NBW A;  4R4I A;  2H5X A;  2YU9 B;  4OWX B;  1EU3 A;  4XYQ A;  1ICF B;  3S15 H;  1YHA A;  4GLA C;  1J9O A;  3N6R A;  1FVI A;  1HCZ A;  4O2D A;  4JV5 Q;  5IP9 G;  5DAU A;  5CBA E;  3S16 H;  1B9M A;  1HA5 A;  4ME5 A;  1H95 A;  5IT9 E;  4B3R L;  2WP8 J;  5C0X G;  4QB4 A;  5JJL A;  2AQ2 B;  2F0J A;  2K1B A;  2ENB A;  3CXC A;  4NXM L;  3GTO B;  3BS1 A;  1MSH A;  3HOW B;  2OQ0 A;  4A3B G;  3HKS A;  3RNU A;  2PI2 A;  1ILP A;  2JA8 G;  4EQO A;  1CHQ D;  1XMO L;  4C3J G;  4A3E B;  1K3B C;  1A62 A;  1EZ6 A;  4N9T A;  4C3H G;  1CSP A;  1LLR D;  4L5Q A;  3QWN A;  1S5B D;  4YCV A;  1DOM A;  2F0M A;  1VDZ A;  4K0K Q;  4QMG A;  3CU7 A;  2PMZ B;  2RHS B;  3F2B A;  3JAM c;  1HR0 L;  1WTP A;  4N9P A;  1A6X A;  1SNM A;  1YVC A;  1WD0 A;  3DXJ C;  2NZ1 D;  2YTV A;  1KD1 C;  4A3K B;  1CTM A;  1NAP A;  3EA6 A;  3HOV G;  4A3J G;  1PVO A;  4XQJ A;  3SK5 A;  3DEO A;  1B3A A;  3VYR A;  4DN4 M;  2RKS A;  1R9T H;  5I2X A;  4QL5 A;  2EYP A;  1KAB A;  2AWO A;  1EU4 A;  1VF5 C;  1BXT A;  1VQH A;  3N52 A;  1HFN A;  2SNM A;  2Q8R E;  4JOI C;  5M3F H;  1TS2 A;  2N3S A;  4TVA B;  3M4O H;  2F0W A;  1Y8O B;  1STA A;  2GVA A;  1BBW A;  1EY6 A;  4K8I A;  1HNZ L;  1SNQ A;  2KHI A;  3C46 A;  4GKJ L;  3AB9 A;  2VQF Q;  3BZK A;  3G6E A;  1AFP A;  2KJX A;  1TWG H;  2DJF C;  1QVG A;  3S17 B;  3K57 A;  1XJV A;  1JCK B;  1KQS A;  1ZXT A;  5AJ3 Q;  3K7U C;  3RUZ A;  3F1Z A;  1D5Z C;  1V43 A;  2PW5 A;  2ZTD A;  2VS1 A;  3HOU B;  4HJ5 A;  4KLK A;  4X64 L;  5LMU L;  3TSS A;  3S24 A;  4DV6 L;  1UNS A;  4Q0F A;  5C4J B;  5CYU A;  3HOY G;  3RZO H;  1HA6 A;  4K5X A;  1B4O A;  4JI5 L;  3QOL A;  1G6Z A;  2BCO A;  1KNA A;  3A7A B;  4BBR B;  3OMC A;  4HMJ A;  4DGZ A;  3J80 i;  2N88 A;  5M3M H;  3KJP A;  1FD7 D;  2XWJ B;  1UE6 A;  4DK3 C;  1E2V A;  1UE7 A;  5HGQ A;  3TN2 A;  3WDN A;  1Q82 C;  3Q24 A;  2F0D A;  3MHB A;  1SND A;  1YIJ A;  1IBL Q;  4HJ9 A;  5EBD A;  4IJL A;  1NNX A;  2JXM B;  1GHK A;  3J81 j;  4CDF C;  2DJG C;  1AE2 A;  3DWA A;  5C5L A;  3SGI A;  4JBW A;  4KY7 A;  2MFI A;  5KRU A;  1PRT B;  4EX5 A;  1OXS C;  3KDF A;  1EWC A;  2HDM A;  3RR5 A;  4X6A H;  3TZU A;  3V05 A;  3ULJ A;  3D0F A;  1IL8 A;  2HDL A;  5KIX A;  4YY3 Q;  4YHH Q;  1EY8 A;  1O7Z A;  4J15 A;  1DON A;  1JJ2 A;  2K5N A;  2MO0 A;  2RSN A;  2F1M A;  4OX9 Q;  2SNS A;  5G3L F;  2F0O A;  4X3S A;  3KDF B;  4UP9 A;  3NK9 A;  2R7F A;  1KNE A;  1IW7 C;  1AN8 A;  2E2J H;  3U58 A;  2WKC A;  3PO2 G;  3HOW H;  3MEF A;  1NCV A;  3MFY A;  4JK1 C;  1KDB A;  4JI7 Q;  2IX3 A;  4WOR A;  1B1Z A;  3NEL A;  1ESF A;  2NVQ B;  1SYG A;  1MKH A;  4ODG A;  3PO3 B;  3K5M A;  2ZXP A;  1SJH D;  2B63 B;  3TS2 A;  4S3S A;  4FF1 A;  1CI3 M;  1WFQ A;  2VQE Q;  1N8R C;  2VUM H;  4CDC C;  3NBI A;  4HIO A;  4JI8 Q;  4NPS A;  3TQY A;  3RLF A;  1S5C D;  2CFM A;  1K73 C;  4JOI A;  2K33 A;  2JJQ A;  4JI2 Q;  4P75 A;  4G57 A;  2K04 A;  3S1N H;  1HR0 W;  1GUT A;  3NPP A;  4DV3 L;  2EY5 A;  1ET9 A;  3OYY A;  5ELO A;  4A3K H;  2BA0 A;  2K75 A;  5COR A;  1IL2 A;  4A3B B;  1S5D D;  4OON A;  5CR3 A;  4G7Z C;  4A3G G;  2JA8 B;  4I7Z C;  4DNT B;  1N33 Q;  4C3J B;  5M5Y H;  1PH6 A;  4JI4 L;  1FR3 A;  4OXP A;  4DUY Q;  3VR5 A;  5EKK A;  4C3H B;  2EE1 A;  2JA9 A;  1Y14 B;  3SE0 A;  2BOS A;  5KND A;  2MNA A;  1X3E A;  4KMU C;  3Q23 A;  2RQX A;  4DU9 A;  1KTK A;  4XYO A;  4PZ6 A;  2LKV A;  3M3Y H;  1A0I A;  4IN3 A;  3KLR A;  4RHR A;  4EQN A;  3OIP A;  3QR8 A;  2Q8T A;  4DV4 Q;  2PNR C;  4XDX A;  3F8T A;  2M9V A;  5CC4 A;  3MXP A;  3PIO A;  1WTX A;  4LFB L;  4A3J B;  4JW0 A;  2OTJ A;  4C2M B;  3HOU H;  1I4G A;  3G48 A;  1AE3 A;  1VQI A;  2F0H A;  2I0Q A;  5C3W A;  1MSG A;  1Q7Y C;  3L0O A;  4LNQ A;  1TVX A;  2WV6 D;  3E6Z X;  1DM0 B;  3BVG A;  1OXT A;  2L12 A;  4CDD C;  1WTW A;  3GV3 A;  1DYQ A;  1X65 A;  2KEN A;  2OQK A;  2RHQ B;  3PMF A;  4HCE A;  5EKL A;  3TZD A;  2NVX B;  4DPG A;  3MZ5 A;  4LF5 L;  4X62 L;  5M3F G;  2UU9 Q;  2HIX A;  1EEI D;  1I4P A;  3Q8D A;  5FOB B;  1I4X A;  1IYJ B;  2XRS D;  5J39 A;  5IWA L;  1MGS A;  4PG3 A;  1KRS A;  4DR6 L;  5E7N A;  5FO9 B;  3HOY B;  2ZTC A;  4GKK L;  2C9O A;  5K5P A;  3K8A A;  4LF9 Q;  4TRD A;  1SFO B;  1TWC B;  3RMH A;  2EVB A;  3BU2 A;  1G2T A;  1EIF A;  1LTA D;  1NE3 A;  3PF5 A;  4OO1 G;  4DR3 Q;  4MIU A;  2UXD Q;  2HHH Q;  2K52 A;  1TS3 A;  2FXQ A;  4WFN 3;  1K3R A;  1ONL A;  1ET6 A;  1E24 A;  2FHT A;  1C7Y A;  1F2Z A;  4L63 B;  2IX1 A;  5IYC H;  1L0X B;  3S2H B;  5EJW A;  5J22 A;  3JAM E;  4BY7 G;  4BBS G;  4P73 A;  4K6D A;  2DN8 A;  5JJK A;  5M3M G;  4RH6 A;  2F03 A;  2UXC L;  1A63 A;  1BCP F;  4DAP A;  1EOV A;  4H44 C;  2PZW A;  4B3S Q;  4JBM A;  1B2T A;  2NVY H;  4UP7 A;  4QUC A;  3NTI A;  3H3V H;  1JIC A;  1N34 L;  4LJZ C;  1VMC A;  1KAA A;  5IE8 A;  1EIH A;  1EY9 A;  2EPB A;  1DZ1 A;  1XTD A;  4H7B A;  4PMW A;  5JEA J;  1EQR A;  5C4X B;  5FLX c;  2JE6 I;  3HRZ C;  2PO4 A;  1RF2 D;  2D5D A;  2Q2U A;  5BN5 A;  1L2F A;  2JK8 A;  3K5N A;  1F2Y A;  4A3D H;  2SEB D;  2F4V Q;  1B3Q A;  1T5X D;  5C0X H;  4IZ8 A;  1M4V A;  2O5I C;  2ZM6 Q;  4DR5 L;  2I07 B;  1QZH A;  3L3O C;  3FHW A;  2CCZ A;  3PO2 B;  1ZKO A;  4A3B H;  2PYK A;  1Y1W G;  2JA8 H;  1AZP A;  3ERQ A;  4C3J H;  1IBK L;  3GTJ H;  4LFA Q;  1X54 A;  2WKD A;  1GUN A;  2IHE A;  4NKL A;  1W2B A;  2EY2 A;  4C3H H;  1PFS A;  2IL8 A;  3OHX C;  4XTC S;  1DOL A;  5DM6 3;  2KCN A;  4K5W A;  4FF2 A;  5CV4 A;  4LF7 Q;  1LTB D;  4B3T L;  2ZT9 C;  2QDB A;  1HNX Q;  1IBM Q;  4A3M H;  5LL6 X;  3OTO Q;  3RN5 A;  2KEC A;  1QNK A;  5C3X A;  5JPN C;  3STB C;  1XNR L;  1LT3 D;  1YBY A;  3S15 B;  4X3U A;  2K4K A;  1EYD A;  2AQ1 B;  4X66 Q;  4DUZ L;  3EJI A;  3EBE A;  3TME A;  3HOV H;  3CQZ H;  4ABN A;  4A3J H;  2EY6 A;  3CD6 A;  1H9K A;  4A3G B;  2NBF A;  3PUW A;  1B8A A;  1VQC A;  3H0G G;  4FYD A;  4DV1 Q;  2B3G A;  1Q86 C;  1DJR D;  3ERO A;  2QIL A;  3S14 B;  3E0E A;  1Q3L A;  5COY A;  4PQX A;  1ML0 D;  4JVZ A;  2CH4 A;  3KUP A;  5BN4 A;  3MXN B;  3J7Z C;  1SRO A;  2HCI A;  3EN2 A;  3H3V I;  2OXP A;  4NDX A;  5EPJ A;  3T1Y Q;  4JI1 Q;  2XIW A;  5IOD A;  2M2L A;  1TR5 A;  4LWC A;  2KHS A;  1TKW B;  1L0W A;  5A2Q L;  1HJP A;  5IGC A;  3K6O A;  3S9W A;  2F0I A;  4WJW A;  4QQB X;  1L1O C;  1SMY C;  1X9N A;  4JI0 Q;  3R8B A;  4X65 Q;  1E1T A;  3SR1 A;  5CMD A;  3HOY H;  1HHV A;  2A1A A;  5C0X I;  3GTQ H;  4PNY A;  4HJ7 A;  2XGT A;  1VQ7 A;  2QA4 A;  2Q2T A;  3H15 A;  4DR7 Q;  1RKN A;  4KKS A;  1STH A;  3U50 C;  5EKI A;  4AQY Q;  1SFO H;  1TWC H;  2B2V C;  1SJE D;  3ER0 A;  1MIU A;  1R9T B;  1RIP A;  2F0V A;  5GAH C;  2CWP A;  1BOS A;  3BYT B;  1XNQ L;  5C4H A;  2DUD A;  1YJ9 A;  1KAW A;  4RGT A;  1EY4 A;  5M3F B;  1LAB A;  3I8Z A;  2VY3 A;  3M4O B;  1ASY A;  2RCF A;  4YWK A;  3J7Y W;  2ZJP A;  1LTR D;  4TSS A;  4K2K A;  1H9S A;  4DK6 C;  4RAU C;  3PIP A;  3IFT A;  1ASZ A;  1I94 Q;  4P2C B;  4DV5 L;  4YWL A;  3I7F A;  4KN4 C;  3DMU A;  1PTO F;  1DXM A;  1TWG B;  4I7A A;  4IPG A;  4A4I A;  4ID6 A;  3UE0 A;  1M8A A;  2H4O A;  1OXU A;  2A73 B;  2JA5 H;  2X69 A;  4OWW B;  3H09 A;  3FKI G;  3PUV A;  4JG2 A;  3UDX A;  4POF A;  3E3X A;  3DLL A;  3P1H A;  2DNC A;  3DEP A;  3CPW A;  3RZD H;  2RDG A;  4IFD G;  1STY A;  3K0Y A;  3RZO B;  5IGB A;  2VB2 X;  2B8F A;  4JV5 L;  1VQ8 A;  4BBS B;  4BY7 B;  3Q0A A;  4TKO B;  5IGE A;  4CJ2 C;  5M3M B;  2A69 D;  2O4X A;  1SYC A;  1VQJ A;  3U9O A;  1X3P A;  1QIL A;  3PO2 H;  4IUU A;  2HQE A;  4JCV E;  5EQ0 A;  3FDT A;  4G4K A;  4DAM A;  1HZC A;  4Z9C B;  4CGY B;  2X6L A;  4C3I H;  3A5Z B;  4XIG S;  1BBU A;  1MBY A;  1RJT A;  3A56 A;  2LFN A;  4HR7 B;  5IYB G;  4DAY A;  5I9P A;  1IW7 D;  2PZU A;  2K7V A;  1BVS A;  1N36 Q;  3JAM i;  1V9P A;  2QDL A;  4TQU S;  1RL2 A;  3TP6 A;  2EDG A;  1VCI A;  3K59 A;  3W1G A;  3CCL A;  3CF5 A;  1N32 L;  3SK8 A;  3CME A;  1HTL D;  4FXG C;  3A54 A;  4WRD A;  2K5D A;  2SDF A;  3PUY A;  2RBM A;  3LWU A;  2LXK A;  1YNJ C;  3SK4 A;  2M00 A;  4AYB G;  1BUV T;  4QUF A;  3AQQ A;  1D5M C;  1K8M A;  2CKZ B;  4OWT B;  2K50 A;  1M1K C;  1IKL A;  5C4Z A;  1D1I A;  4DA2 A;  4A3G H;  4A3D G;  2IPK D;  3ND9 A;  1UE1 A;  1IYU A;  3ITP A;  1L1O A;  2K5V A;  3S2D H;  1CM9 A;  3KLS X;  2F0F A;  3D4R A;  4KV6 A;  3S14 H;  3G4S A;  1SE8 A;  2E2J B;  4LUO A;  4DV2 L;  2F0L A;  2VW9 A;  1JOQ A;  1CZW A;  1HH2 P;  4HID A;  3H3V C;  3ERS X;  2JA6 G;  1YI2 A;  1BCP C;  4KK7 A;  1UUP A;  4JBJ A;  2A74 C;  4BXX G;  2B2V A;  2MGS A;  3EQL C;  1VQK A;  3NEN A;  1AP0 A;  2VUM B;  1O80 A;  5ELN A;  3T1H Q;  3VYS A;  4K6L A;  1UE5 A;  4M8A A;  1L1O B;  3RLO A;  2VQF L;  1A3U A;  4HJ8 A;  2UUB Q;  4A3M G;  3ONA B;  1TXY A;  3PUX A;  5AJ3 L;  3J7A V;  3WOF A;  3S1N B;  3H0G B;  3I55 A;  5ELB A;  3DM1 A;  1JE5 A;  2CVR A;  3IFD A;  3VR4 A;  2EJG C;  4N8X 1;  3LX0 A;  1V1P A;  2OCE A;  4EQP A;  5FLX E;  2UUA Q;  2QW7 A;  5L37 A;  3GTM H;  1UEB A;  5M5Y B;  4KD3 A;  4NP5 A;  2DGY A;  2NWG A;  1YJW A;  3UI2 A;  4ZQ3 A;  3NHH A;  1Y69 U;  4ZUJ A;  1IZ6 A;  1LTI D;  3KLW A;  3K5O A;  3NWT A;  4AH6 A;  5C6A A;  1VQ5 A;  4GN5 A;  4BA2 I;  3C3L A;  1ROD A;  5CV7 A;  2Z9H A;  3RLN A;  4NXN Q;  1DCZ A;  5KNB A;  1HZ9 A;  5DNF A;  5IT9 L;  4K5V A;  4B3M Q;  3J7A 5;  3R93 A;  1IBL L;  1LV9 A;  3LNN A;  3M3Y B;  3KYH C;  2WAQ G;  4FO2 A;  4JI6 Q;  3CC2 A;  4ME3 A;  2KEE A;  2EYH A;  4K14 A;  1XMQ L;  5I2Y A;  3MC0 B;  1X3G A;  3QOJ A;  4DR1 Q;  1EZ8 A;  1JOK A;  1PMR A;  4OIJ A;  2F0K A;  4OO1 H;  4IPD A;  3RD4 A;  1CHP D;  3KK7 A;  3UDF A;  3T56 B;  1HQR D;  4KD4 A;  4YHH L;  1QE6 A;  1JR0 D;  1C48 A;  3NSW A;  3NUC A;  2KUM A;  4BBS H;  4BY7 H;  5DLQ E;  4UY8 C;  1FNW A;  5JVH 3;  3ULL A;  5JOB A;  4DV0 Q;  4AYB E;  5A35 A;  2B8G A;  2J7Z A;  2AUJ D;  4GN3 B;  3J7A F;  1FL0 A;  4OX9 L;  5FO8 B;  4Y7N H;  4GS3 A;  3CPF A;  2KCC A;  1CZG A;  3J81 c;  4WJ3 M;  3DWP A;  1YHQ A;  1Y8N B;  3M7N A;  1E2W A;  1NY4 A;  2KHJ A;  3L9A X;  4V0B A;  1KLG D;  1A3T A;  2XWB B;  4JI7 L;  2A8V A;  1F77 A;  2UUC Q;  1PH1 A;  1JOR A;  4UDU C;  2F0U A;  1NMG A;  2ZXO A;  1E0B A;  3G7L A;  3SK6 A;  2H1E A;  2KOL A;  4FDB A;  2WIN B;  2JQO A;  1VQD A;  2A19 A;  1ENF A;  2VQE L;  1EUJ A;  2JA5 G;  1T5E A;  2ZJR A;  3HKZ G;  4JI8 L;  1B50 A;  1CQV A;  3GTK H;  1CFM A;  2VNU D;  2A69 C;  4JI2 L;  1K8A C;  1CK1 A;  1FJG Q;  2D0O A;  5EPK A;  2NTT A;  1VQN A;  2NB0 A;  3DWQ A;  4JYA Q;  2K03 A;  2C5C A;  3K81 C;  1Y1W H;  1D7Q A;  1SYE A;  3FVQ A;  1H9R A;  1KLU D;  5LHY 1;  5JJI A;  1U4R A;  4DV6 Q;  2PCF B;  2CW0 C;  4H13 C;  3I70 A;  4J6H A;  1N33 L;  1CKN A;  2R6G A;  3D3R A;  3NQI A;  2NYZ D;  4RMF A;  1WI5 A;  2NVY B;  3ND8 A;  1KIX A;  1D6E C;  1Q8I A;  4IUR A;  1W6J A;  2AKW B;  4RKL A;  3OPO A;  4C3I G;  1BCP B;  5ISR A;  1F2L A;  3EFX D;  4LK1 C;  1MD2 D;  5FLM G;  2QEJ C;  1IYV A;  1PTO C;  1U9R A;  4IO9 A;  4LF8 Q;  5DEH A;  2RDF A;  4OIK A;  4OO1 I;  1STB A;  4ALP A;  2ICI A;  5IP7 G;  1VQO A;  3J80 c;  1CKN B;  5EAY A;  4A3D B;  1VQG A;  5HY6 A;  3H0G H;  2WAQ E;  3STB D;  3I4M H;  2F0N A;  2E75 C;  2FJ2 A;  1J6Q A;  3VR6 A;  4LF6 Q;  1CKM A;  1X6O A;  1GKH A;  4ILW A;  2RSO A;  1F9R A;  4LFC Q;  1Z7T A;  2JA6 B;  3VR2 A;  2NUC A;  4RCO A;  2A6H D;  4KHZ A;  1BNZ A;  1W6K A;  3GTJ B;  1LT5 D;  1SBB B;  4IUV A;  2IWH A;  2FFK B;  4F88 A;  2RF4 A;  1A15 A;  2I5M X;  3U9S A;  3G6J B;  3QO2 A;  5LMN Q;  1PZK D;  2JA7 G;  4IUN A;  4CKE A;  5G3L D;  2UU9 L;  4A3M B;  1ENC A;  2YTX A;  2I46 A;  2XVS A;  3EIV A;  4R9W A;  2ID0 A;  3G71 A;  3R2I A;  2TSS A;  2Z4H A;  2F3W A;  2Z8L A;  4PV1 C;  1WYD A;  3V2T A;  3BG3 A;  1CKO A;  1SMX A;  1ILQ A;  1CA5 A;  1SYD A;  1V8Q A;  4QF4 A;  3HOV B;  3CQZ B;  3I56 A;  2F3V A;  1FNV A;  2D2C C;  2V4D A;  1SMY D;  1V1O A;  4LF9 L;  1E2Z A;  5LL6 S;  1RTO A;  2E5L Q;  5M5W H;  4OEM B;  4U67 3;  1XPO A;  1ESR A;  2PPB C;  1DOK A;  4HJA A;  1X56 A;  5IOC A;  4DR3 L;  3AFQ A;  3NTH A;  4DV7 Q;  1J8I A;  3AFP A;  2L4N A;  2HHH L;  2RA4 A;  1PYW D;  4IUT A;  1W3S A;  3HKZ E;  2EJM A;  1K8G A;  4L5S A;  5JVG 3;  5JAV A;  4G7H C;  4RGN A;  1PYS B;  4A3C G;  4IAL A;  4IPC A;  4XT3 B;  4FVM A;  1OXV A;  1WTH A;  5ELD A;  4RG1 A;  3CCV A;  4HTH A;  1VQM A;  1AH9 A;  2NVT B;  3D4W A;  3H6M A;  2OWO A;  1PDQ A;  1S3O A;  1SNO A;  3KF8 A;  2AHO B;  4DF7 A;  4U68 A;  5CGK A;  3HOZ H;  5H1S E;  1P16 A;  1Z47 A;  1RTN A;  3FKI H;  4YWM A;  4F8M A;  1XWE A;  4BY1 H;  1QJO A;  4QCL A;  3A8K E;  3OOC A;  3A0J A;  1MI2 A;  3GTQ B;  4IFD H;  5CV5 A;  3V96 A;  1YJN A;  2B2U C;  2SOB A;  3PGZ A;  1PRT F;  3I72 A;  4JI3 Q;  4DK0 A;  4P74 A;  1HQM C;  4FNF A;  2F4V L;  4KJN A;  4ZKC B;  2D62 A;  1PFB A;  1WCM G;  4LFB Q;  4G7O C;  3PF4 A;  2ZM6 L;  1PH9 A;  1GO3 E;  2MQH A;  4R8I A;  5IIF A;  2J0T D;  1C4Q A;  2YV5 A;  5IYB H;  1QCB D;  2R7D A;  4LFA L;  5C44 G;  2FMC A;  4DNI A;  3MFG A;  3K7A H;  2EXZ A;  3GTL B;  2G9D A;  3CHB D;  1O7I A;  4LF7 L;  1S5E D;  2JA5 B;  2NN6 G;  3FPP A;  2HQL A;  2WAC A;  3HKZ B;  4DXF A;  1HNX L;  1IBM L;  1PTO B;  1K0S A;  2HCC A;  2LMC B;  2EQS A;  1LTT D;  3OTO L;  2Q2H A;  3Q6S A;  5J1Z A;  3X3M A;  3WWV A;  3P20 A;  3RZD B;  1Y1V H;  1E22 A;  3NTK A;  3LWE A;  4X66 L;  3CCS A;  4P72 A;  5BR8 L;  4WJ4 A;  2GA4 B;  5E4X A;  1G29 1;  3NEM A;  1YNJ D;  1PH7 A;  5M9O A;  5F2D A;  1IHZ A;  5IGD A;  3A74 A;  1JJG A;  2N8N A;  3VYU A;  4FF4 A;  2B2T C;  1HRJ A;  1Q1E A;  2QKI C;  4C3I B;  2JA6 H;  5EBC A;  1TWF H;  2AUK A;  4A76 A;  4BXX H;  1PFM A;  5E3F A;  4J8Q A;  4RKB A;  4C1N K;  5GAE C;  3T1Y L;  4UHV A;  1B9N A;  2LY7 A;  2R61 A;  2JEB I;  2Z0S A;  4CBV A;  2OTL A;  2VB3 X;  3JAM L;  1LUZ A;  3QJY A;  5D3D A;  1SYF A;  3F2U A;  4IFD I;  2MP1 A;  1CA6 A;  1BCP D;  3J81 E;  1EY5 A;  2KBN A;  4ZK9 B;  4DFA A;  2CWA A;  4IUP A;  4O1N A;  3TRZ A;  3IAY A;  1VMP A;  1CSQ A;  4X65 L;  2MUY A;  1RCV D;  1WVL A;  1N34 Q;  3M4Y A;  2IX0 A;  5J3B A;  1C9O A;  4R4C A;  2PQA A;  4DR2 Q;  2F0E A;  3R2T A;  4DR7 L;  3W5O A;  2A6H C;  1O78 A;  2B2Y A;  4ZUI A;  3I4M G;  3S2D B;  2K5H A;  4CKB A;  2HT1 A;  1GHJ A;  5HUR A;  2C35 B;  3P7J A;  2L15 A;  2JA7 B;  2WB1 G;  1YEZ A;  1S72 A;  5ELE A;  2G5D A;  2PQE A;  1EYC A;  2Z4I A;  2B2U A;  4HIK A;  2PQA B;  1EYG A;  2XSC A;  4HN7 A;  4AIM A;  1TII D;  2NVT H;  1AZQ A;  1I94 L;  4IQZ A;  1X55 A;  2ALY B;  3NP8 A;  3BVZ A;  1I50 H;  3TRE A;  5JEA G;  1OTC A;  2JEA I;  2ATW A;  1II3 A;  5E4W C;  3C1F A;  1OXX K;  1NUC A;  4JC0 A;  1WTR A;  4LUV A;  4DKA C;  1SE3 A;  1SYB A;  1XPR A;  5CV6 A;  2YTY A;  3AU7 A;  2BDO A;  3U4V A;  1XNR Q;  3GTM B;  4QIW E;  3O13 A;  2K05 A;  2MHV A;  4ZCK A;  5AFW A;  1FYC A;  3J80 E;  1GUW A;  4LF4 Q;  1ENA A;  2IT1 A;  4X3T A;  1TS5 A;  5JPM C;  3I4N G;  2XNA C;  2UXB Q;  1ICW A;  2TMP A;  2EZV A;  1HUM A;  2A68 D;  4KHP Q;  1GOZ A;  4RHS A;  4HSP A;  4YCU A;  3CRL C;  3PV0 A;  5C0X J;  2KED A;  3SVM A;  1SNC A;  1GJX A;  3I73 A;  2LS0 1;  1QUQ A;  3GTL H;  1CT1 D;  2K6A A;  1N36 L;  3HOZ G;  1Z9F A;  4GOP C;  4BS9 A;  1HNW L;  2B2T A;  2XN9 C;  1PTO H;  2G9H D;  4BY1 G;  2EYO A;  2KCT A;  3CKI B;  1PFN A;  3CCR A;  1H9S B;  4ZAI A;  2F52 A;  1WCM B;  4O0A A;  1HXY D;  3MXU A;  3D8G A;  4ZYS A;  1NSN S;  1QB5 D;  1TU2 B;  1YNX A;  3MTS A;  4X3K A;  1QUQ B;  4MNO A;  1EOT A;  4Y7N B;  4POG A;  1TWH H;  4A3L G;  5C44 B;  2F0G A;  5HGT A;  3M7G A;  5GRO A;  5T1I A;  1FNU A;  2XRQ D;  1I6H H;  1QOH A;  3W2D A;  1TT2 A;  2Z6K C;  3U4Z A;  3NE5 B;  2CW0 D;  2KVM A;  5FLM H;  1NMF A;  4OL7 A;  1MJC A;  3FMC A;  4XXE A;  2WB1 E;  3NXW A;  5IP7 H;  1VF7 A;  4PMB A;  2A6E D;  1XPU A;  4KHV A;  1A8V A;  3T1H L;  1EY0 A;  3A55 A;  3X3N A;  1EWI A;  2UUB L;  4B9W A;  1F9S A;  4DV5 Q;  4K0K L;  4FXK C;  2MPM A;  3IKJ A;  3GTK B;  1D2B A;  4IUQ A;  3CC7 A;  3D6C A;  1I3Q B;  1Y8P B;  1PTO D;  2RVL A;  4EGV A;  1Y1V G;  2BA1 A;  1G91 A;  1M90 C;  4YCW A;  4DAY B;  3S1Q B;  1PRT C;  3A8J E;  4EQ5 A;  1Y1W B;  1LO5 D;  4V19 0;  1PZJ D;  3T16 A;  3SHL A;  3QG1 A;  2L0C A;  1SRU A;  4J1M A;  3FEW X;  3OW7 A;  2UUA L;  4B08 A;  3PO3 G;  3PUZ A;  5KGU A;  1DD2 A;  2B63 G;  1HZB A;  3K5L A;  1NR2 A;  3AMU A;  2JA7 H;  4A3F G;  1TY2 A;  4DK1 A;  1PH5 A;  1K83 B;  1SEB D;  3TP8 A;  2K5W A;  2OF1 A;  3PQI A;  4GZY C;  3BJU A;  5FJ8 G;  2BE5 C;  1G8Z D;  3T4A C;  4PZ8 A;  2CHB D;  4OEL B;  3HFZ B;  2YYZ A;  4L8J A;  2Y0S G;  4NXN L;  2QGQ A;  1K9M C;  4DR4 Q;  5NUC A;  4B3M L;  1EYA A;  3D4D A;  2QF7 A;  4JI6 L;  4HMI A;  2FIN B;  2Z1C A;  1EY7 A;  1VQF A;  1LT4 D;  4DR1 L;  2CH4 W;  3VA7 A;  5I4D A;  3I4M B;  1LM0 A;  4JPB W;  1VQL A;  1J5E Q;  3F2D A;  1CUK A;  3OWE B;  5CBE E;  1N32 Q;  1QZG A;  1EQT A;  4A75 A;  4MTN A;  1GD7 A;  5K36 G;  3J81 i;  4APV A;  2IHF A;  2WB1 B;  2N78 A;  4BWG B;  1BBX C;  2R7Z G;  1STG A;  3EVQ A;  1HPC A;  2ZXR A;  4A3C H;  4GOP A;  4DV0 L;  2XTI A;  5D65 A;  2NTS A;  2VZA A;  2FMM A;  2I5H A;  1B44 D;  3VDY A;  1JWU D;  4B3R Q;  5C5M A;  1OO9 B;  1GM5 A;  4NMZ A;  2WII B;  1V1P B;  1GUO A;  2K5Q A;  1R4P B;  3H94 A;  3CP0 A;  4NXM Q;  4Y52 H;  1STE A;  4DV2 Q;  1YIT A;  2UUC L;  5M5X H;  1K0R A;  5FKA C;  4CKC A;  1XMO Q;  1PH4 A;  4GOP B;  1YNN D;  3CCQ A;  2ICE C;  4XQQ A;  3SDZ A;  1HFG A;  3HS0 C;  1UWV A;  1P8L A;  2B2W C;  1EQQ A;  2N49 A;  4R8N A;  2L55 A;  3F2C A;  5M5W B;  4YY3 L;  2WFW A;  2Z6K A;  3HG9 A;  1JWS D;  1IKM A;  1WCM H;  3I4N B;  3H91 A;  1FJG L;  4IJH A;  3OW2 A;  3TBI B;  3CW2 C;  1EWH A;  3Q22 A;  1HR0 Q;  1AW7 A;  1TWA H;  1VQB A;  2A68 C;  3C2P A;  1LT6 D;  4JYA L;  2BDN A;  4I65 A;  5TSS A;  2DY8 A;  3HZX A;  3KJO A;  3HEJ A;  5C44 H;  3K80 C;  1MJE A;  1GUG A;  4XQN A;  2Q8I B;  1KDA A;  1V1Q A;  1NTG A;  4KKT A;  1QNU A;  5EGT A;  1VQP A;  4ZKB B;  5FLX L;  3HOZ B;  4GLV B;  1Z6H A;  2NN6 H;  2ZTE A;  3DUZ A;  1ZYR D;  2E74 C;  2CQA A;  3FKI B;  4CJ0 B;  4BY1 B;  1I4R A;  1ZEQ X;  1U4M A;  1UAP A;  1JQY D;  1JWM D;  1VQ9 A;  4LF8 L;  1HNZ Q;  1TS4 A;  3NBH A;  1JT8 A;  1H9M A;  4L5T A;  2E2D C;  5I6Y A;  4GKJ Q;  4FF3 A;  1Q8K A;  2Y0S E;  4RFB A;  4MHE A;  2R92 H;  2B29 A;  4A3I H;  1I3Q H;  2I5L X;  4R1J A;  1D8L A;  4UAI A;  2F4I A;  1XMQ Q;  1WJJ A;  1T9H A;  4CHT B;  4YIJ A;  1FGU A;  3S1Q H;  4A93 H;  3W3A A;  3IRB A;  3LGJ A;  3SXH A;  3GQB A;  1C0A A;  1SE4 A;  3TEH B;  3RN2 A;  4LF6 L;  4X64 Q;  5LMU Q;  3WOE A;  2YU9 H;  3OIQ A;  5JJZ A;  3ICE A;  2F0P A;  2EOT A;  3NBH B;  4LFC L;  4JI5 Q;  5C4X G;  1U0L A;  3IL8 A;  1D5X C;  2K14 A;  5C3E G;  1K83 H;  2F0T A;  4DUY L;  3I91 A;  3K7A B;  2A6E C;  1KHI A;  4RGO S;  5LMN L;  1SXT A;  1STN A;  1PYB A;  2LXJ A;  3PCO B;  3HOX G;  4AYB B;  1LTG D; 
#chains in the Genus database with same CATH homology
 1CSP A;  3U50 C;  4L5Q A;  4AQY Q;  1SFO H;  1TWC H;  3TS0 A;  1G6P A;  4YCV A;  2YV5 A;  5GAD C;  5IYB H;  1S40 A;  3ER0 A;  1B70 B;  4K0K Q;  1MIU A;  2R7D A;  4LFA L;  5C44 G;  1RIP A;  3GTO H;  2R93 G;  2RHS B;  5GAH C;  2CWP A;  4DNI A;  2Q2I A;  4DV4 L;  1XNQ L;  3K7A H;  2DUD A;  3F2B A;  3JAM c;  1YJ9 A;  1HR0 L;  1KAW A;  4A3E H;  3W1B A;  1YVC A;  1O7I A;  4LF7 L;  2VY3 A;  2NN6 G;  1ASY A;  2HQL A;  2YTV A;  1HNX L;  1KD1 C;  4YWK A;  1IBM L;  2ZJP A;  3ULP A;  2E5L L;  2EQS A;  4R4Q A;  3OTO L;  4DK6 C;  2Q2H A;  3HOV G;  3PIP A;  3KOJ A;  4A3J G;  1PVO A;  1ASZ A;  1I94 Q;  3UDG A;  3WWV A;  2PNH A;  1KRT A;  4DV5 L;  4DV7 L;  1Y1V H;  1E22 A;  4YWL A;  1R9T H;  1VQE A;  4QL5 A;  3I7F A;  4X66 L;  4A4I A;  3CCS A;  2AWO A;  4IPG A;  4P72 A;  5BR8 L;  4WJ4 A;  1VQH A;  2F3I A;  3UE0 A;  1E3P A;  1G29 1;  3JC6 6;  4JOI C;  5M3F H;  1OXU A;  2NN6 I;  3NEM A;  1PH7 A;  2JA5 H;  2N3S A;  4TVA B;  3M4O H;  2E8G A;  4OWW B;  2AWN A;  3FKI G;  3PUV A;  4JG2 A;  3UDX A;  4POF A;  2GVA A;  3A74 A;  1PH3 A;  1EIY B;  2ASB A;  2N8N A;  1JJG A;  1BBW A;  1HNZ L;  3DLL A;  2KHI A;  3RZD H;  1Q1E A;  3CPW A;  4GKJ L;  4IFD G;  2VQF Q;  3BZK A;  2JA6 H;  3G6E A;  1TWF H;  1TWG H;  3CCE A;  1QVG A;  1NJI C;  4JV5 L;  1VQ8 A;  4A76 A;  1PV4 A;  4BXX H;  1XJV A;  1KQS A;  5AJ3 Q;  3K7U C;  4QGU A;  3F1Z A;  5GAE C;  1V43 A;  3T1Y L;  2ZTD A;  2RCN A;  2JEB I;  2VS1 A;  2Z0S A;  4HJ5 A;  1VQJ A;  1KC8 C;  4KLK A;  2OTL A;  4X64 L;  4L5R C;  5LMU L;  3PO2 H;  1LUZ A;  3S24 A;  4DV6 L;  4JCV E;  4DAM A;  4IFD I;  3HOY G;  2BH2 A;  1HZC A;  3RZO H;  4JI5 L;  2KBN A;  4JI3 L;  4C3I H;  3A5Z B;  4XIG S;  3I4N H;  1BBU A;  2ES2 A;  2UXD L;  2CWA A;  3S17 H;  4NB3 A;  1GVP A;  3GO5 A;  2KCM A;  3TRZ A;  3J80 i;  1CSQ A;  1EFW A;  4X65 L;  5IYB G;  1N34 Q;  1SN8 A;  5M3M H;  2IX0 A;  3KJP A;  1BVS A;  5J3B A;  1UE6 A;  4DK3 C;  1C9O A;  1V9P A;  4R4C A;  3JAM i;  1Q1B A;  1UE7 A;  2PQA A;  5HGQ A;  4DR2 Q;  4TQU S;  4DV3 Q;  1RL2 A;  3AEV A;  4DR7 L;  1VCI A;  2GN5 A;  3W1G A;  3W5O A;  1Q82 C;  3CCL A;  3CF5 A;  1N32 L;  3CME A;  3M4Q A;  5C4J H;  3I4M G;  2AMC B;  2K5H A;  2HT1 A;  4B3S L;  3PUY A;  1YIJ A;  1IBL Q;  2LXK A;  2C35 B;  4AYB G;  3UDI A;  4HJ9 A;  4IJL A;  3AQQ A;  2L15 A;  4BBR H;  3J81 j;  4LW1 A;  4OWT B;  1AE2 A;  2CKZ B;  4JI4 Q;  1G51 A;  2WB1 G;  1YEZ A;  1S72 A;  3SGI A;  4JBW A;  2MFI A;  2K50 A;  5IYD H;  4BA1 I;  1M1K C;  4A3G H;  4A3D G;  4EX5 A;  1OXS C;  3KDF A;  4HIK A;  2PQA B;  3RR5 A;  1EYG A;  4X6A H;  1UE1 A;  3ULJ A;  3D0F A;  1L1O A;  1Q12 A;  2K5V A;  4AIM A;  2NVT H;  3S2D H;  1I94 L;  4YY3 Q;  4YHH Q;  1X55 A;  2ALY B;  3S14 H;  3G4S A;  4J15 A;  1SE8 A;  3DM3 A;  1N36 Q;  4LUO A;  1I50 H;  4DV2 L;  2VW9 A;  3TRE A;  3KF8 B;  1HH2 P;  5JEA G;  4HID A;  1JJ2 A;  1OTC A;  2JEA I;  2K5N A;  3ERS X;  1VQ4 A;  2ATW A;  4A3L H;  2MO0 A;  2JA6 G;  4IOA A;  5IT9 c;  1YI2 A;  4JBJ A;  4OX9 Q;  4UP8 A;  4BXX G;  1OXX K;  4JC0 A;  4LUV A;  1VQK A;  3NEN A;  1HZA A;  2BH8 A;  3KDF B;  4UP9 A;  4DKA C;  2R7F A;  5ELN A;  3T1H Q;  1XPR A;  1UE5 A;  1L1O B;  2YTY A;  3RLO A;  3U4V A;  1QVC A;  2VQF L;  4HJ8 A;  2E2J H;  3U58 A;  2UUB Q;  4QIW E;  1XNR Q;  3PO2 G;  3HOW H;  3MEF A;  4A3M G;  4R4T A;  4JI7 Q;  1TXY A;  3PUX A;  5AJ3 L;  4PZ7 A;  1PH8 A;  4LF4 Q;  3NEL A;  2IT1 A;  1MKH A;  3I4N G;  3I55 A;  5LMN W;  1JE5 A;  1JMC A;  3TS2 A;  2UXB Q;  1YHB A;  1WFQ A;  2VQE Q;  4LF5 Q;  4X62 Q;  1N8R C;  2VUM H;  2OCE A;  3UE1 A;  2UUA Q;  4KHP Q;  4HIO A;  4JI8 Q;  3GTM H;  4NPS A;  1UEB A;  4YCU A;  3RLF A;  3TQY A;  3PV0 A;  5C0X J;  2CFM A;  1BKB A;  5IWA Q;  1K73 C;  4JOI A;  2DGY A;  2JJQ A;  4JI2 Q;  4P75 A;  1YJW A;  1X3F A;  1VQA A;  4GNX C;  2NVQ H;  1QUQ A;  3GTL H;  3S1N H;  1N36 L;  4DR6 Q;  1HR0 W;  3HOZ G;  1Z9F A;  4DR2 L;  1IZ6 A;  4AH6 A;  3KLW A;  4DV3 L;  4GOP C;  4A3I G;  1VQ5 A;  2R92 G;  3OYY A;  4GN5 A;  2B63 H;  3PO3 H;  4GKK Q;  5ELO A;  1HNW L;  4A3K H;  4BA2 I;  2BA0 A;  2K75 A;  4IOC A;  4BY1 G;  3RLN A;  2KCT A;  4NXN Q;  4DV1 L;  1HZ9 A;  4A3F H;  1IL2 A;  4OON A;  4A93 G;  5IP9 H;  3CCR A;  4B3M Q;  3J7A 5;  4A3G G;  1IBL L;  3KYH C;  2WAQ G;  1N33 Q;  5FJ8 H;  2F52 A;  4JI6 Q;  4O0A A;  5M5Y H;  1PH6 A;  3CC2 A;  1IXR A;  4ME3 A;  4JI4 L;  1WOC A;  1XNR L;  4OXP A;  3KFU A;  1XMQ L;  4DUY Q;  1X3G A;  1YNX A;  4DR1 Q;  2JA9 A;  1QUQ B;  4JI1 L;  4MNO A;  4QY7 A;  5IY0 A;  1DGS A;  1Y14 B;  4POG A;  1TWH H;  4IPD A;  2MNA A;  4A3L G;  1X3E A;  3UDF A;  3CAM A;  2D0P A;  2UXC Q;  4YHH L;  5GRO A;  3S1M H;  1E7Z A;  3A5U A;  4PZ6 A;  3M3Y H;  1A0I A;  2GVB A;  1I6H H;  2Z6K C;  4MZ9 A;  3U4Z A;  4BY7 H;  4BBS H;  4JI0 L;  4DV4 Q;  5DLQ E;  4UY8 C;  3S1R H;  3M85 A;  5FLM H;  1NMF A;  3F8T A;  3ULL A;  4AYB E;  4DV0 Q;  4LFB L;  3PIO A;  4GN3 B;  3HOW G;  1FL0 A;  1MJC A;  4OX9 L;  3HOU H;  2OTJ A;  4Y7N H;  3CCM A;  2WB1 E;  3G48 A;  4GS3 A;  1AE3 A;  5IP7 H;  2R7Z H;  3CPF A;  1VQI A;  3J81 c;  4A3E G;  1XPU A;  4WJ3 M;  4AQY L;  1A8V A;  3M9B A;  3T1H L;  1YHQ A;  1EWI A;  2I0Q A;  2UUB L;  3M7N A;  1NY4 A;  2KHJ A;  4DV5 Q;  1Q7Y C;  4K0K L;  3K0X A;  3L0O A;  4LNQ A;  2VUM G;  4JI7 L;  2A8V A;  3CC7 A;  5BR8 Q;  1B7Y B;  1OXT A;  2UUC Q;  1PH1 A;  4LF4 L;  1KXL A;  1NMG A;  4IFD J;  1Y1V G;  2BA1 A;  1M90 C;  4YCW A;  4DAY B;  1X65 A;  4C2M H;  3CCJ A;  2KEN A;  2OQK A;  2RHQ B;  4FDB A;  4EQ5 A;  2UXB L;  4DR5 Q;  2JQO A;  4DPG A;  1VQD A;  2A19 A;  3GDE A;  4QJF A;  4X62 L;  2VQE L;  4LF5 L;  1VQ6 A;  5M3F G;  1SRU A;  2HIX A;  3FP9 A;  1EUJ A;  2UU9 Q;  2JA5 G;  2ZJR A;  2UUA L;  3PO3 G;  4KHP L;  3PUZ A;  3Q8D A;  3HKZ G;  1HZB A;  4JI8 L;  3E9I A;  2EXD A;  4A3K G;  2B63 G;  1IYJ B;  1IBK Q;  5IWA L;  3GTK H;  4IPH A;  2JA7 H;  4A3F G;  2VNU D;  1JB7 A;  1PH5 A;  4JI2 L;  1K8A C;  1FJG Q;  2D0O A;  1VQN A;  4PG3 A;  1KRS A;  1VS0 A;  2MO1 A;  4DR6 L;  5E7N A;  3BJU A;  5FJ8 G;  4JYA Q;  1YZ6 A;  3K81 C;  2ZTC A;  2EIF A;  4PZ8 A;  4GKK L;  1LYL A;  1Y1W H;  3HFZ B;  2YYZ A;  2NVX H;  1SR3 A;  4B3T Q;  2Y0S G;  1D7Q A;  4NXN L;  2QGQ A;  3GD7 A;  1K9M C;  5JJI A;  3K8A A;  4LF9 Q;  4DR4 Q;  4DV6 Q;  4B3M L;  3BU2 A;  1EIF A;  1N33 L;  1NE3 A;  1CKN A;  2R6G A;  4RMF A;  4DR3 Q;  3PF5 A;  4JI6 L;  4OO1 G;  1WI5 A;  4JBK A;  1KIX A;  2HHH Q;  1E1O A;  2UXD Q;  1VQF A;  2K52 A;  2FXQ A;  2E2I H;  2V1C C;  2AKW B;  1K3R A;  4DUZ Q;  1E24 A;  4DR1 L;  1C7Y A;  4UPA A;  3CCU A;  5IYC H;  2IX1 A;  1LM0 A;  1VQL A;  4BY7 G;  4BBS G;  1J5E Q;  3F2D A;  4P73 A;  1CUK A;  4P71 A;  5FLM G;  5JJK A;  5M3M G;  1N32 Q;  1QZG A;  4IO9 A;  2UXC L;  1A63 A;  4A75 A;  4MTN A;  1GD7 A;  1EOV A;  4LF8 Q;  3J81 i;  4OO1 I;  4APV A;  3HOU G;  2IHF A;  5K36 G;  2N78 A;  4ALP A;  4B3S Q;  1LTL A;  4JBM A;  1PHJ A;  2NVY H;  5IP7 G;  4GNX A;  2R7Z G;  4UP7 A;  1VQO A;  3J80 c;  1CKN B;  3H3V H;  5EAY A;  4A3C H;  1VQG A;  5HY6 A;  1SLJ A;  4GOP A;  1N34 L;  3KF6 A;  3PSI A;  4DV0 L;  3S2H H;  3I2Z A;  2XTI A;  3H0G H;  5IE8 A;  2WAQ E;  3B6Y A;  3STB D;  3I4M H;  1XTD A;  2VZA A;  4BBR G;  2ZJQ A;  2I5H A;  4PMW A;  3VDY A;  4H02 A;  3GTG H;  5JEA J;  4B3R Q;  1J6Q A;  1EQR A;  5GAG C;  4LF6 Q;  1CKM A;  5FLX c;  1X6O A;  5IYD G;  3L7Z C;  1PA6 A;  1GM5 A;  2JE6 I;  1GKH A;  3D31 A;  2Q2U A;  3E9H A;  4LFC Q;  3CP0 A;  4NXM Q;  1L2F A;  4Y52 H;  2JK8 A;  4KHZ A;  4DV2 Q;  1I5F A;  3L2P A;  1YIT A;  4GN4 B;  4GNX B;  2UUC L;  4A3D H;  2F4V Q;  5M5X H;  1K0R A;  4HIM A;  3BZC A;  2RF4 A;  1XMO Q;  1PH4 A;  4GOP B;  2I5M X;  3CCQ A;  3KF6 B;  5LMN Q;  2JA7 G;  2ZM6 Q;  4GLX A;  4DR5 L;  1QZH A;  2CCZ A;  3FHW A;  1Q46 A;  5C4X H;  1UWV A;  1P8L A;  1EQQ A;  2UU9 L;  1N9W A;  2N49 A;  2YTX A;  3F2C A;  4A3B H;  5C3E H;  4YY3 L;  2WFW A;  2E2H H;  2Z6K A;  2JA8 H;  1Y1W G;  3EIV A;  4C3J H;  1IBK L;  2ID0 A;  3ZJY C;  3GTJ H;  1WCM H;  4LFA Q;  3G71 A;  1X54 A;  1WYD A;  2HIV A;  2NZH A;  2IHE A;  4IJH A;  1FJG L;  4KI0 A;  2IY5 B;  3OW2 A;  1CKO A;  1XNQ Q;  1SMX A;  3HOX H;  1W2B A;  3CW2 C;  4C3H H;  1HR0 Q;  1PFS A;  1TWA H;  1VQB A;  4JYA L;  4XTC S;  1PH2 A;  1QVF A;  3I56 A;  4LF7 Q;  4B3T L;  1HNX Q;  3M4P A;  3KJO A;  5C44 H;  1IBM Q;  3K80 C;  4A3M H;  1MJE A;  5IYC G;  4LF9 L;  4DR4 L;  2E5L Q;  5M5W H;  2R93 H;  3OTO Q;  2PMZ E;  1V1Q A;  3RN5 A;  1XPO A;  2LSS A;  3CC4 A;  1KL9 A;  1NTG A;  3STB C;  1X56 A;  1YBY A;  2CQO A;  3AFQ A;  3AYH B;  4R4O A;  4DV7 Q;  4HJA A;  3AFP A;  4DR3 L;  1VQP A;  2K4K A;  2PI2 E;  4GLV B;  3CMA A;  2HHH L;  1JJC B;  4X66 Q;  2ZTE A;  1U5K A;  2QEX A;  4DUZ L;  1W3S A;  3EBE A;  3HKZ E;  2VL6 A;  1K8G A;  3I4O A;  4L5S A;  2NZO A;  5GQO A;  3CQZ H;  3HOV H;  4A3J H;  4LUZ A;  3CD6 A;  1J5E L;  3GTP H;  1Q81 C;  3PUW A;  1PYS B;  1B8A A;  4IPC A;  4A3C G;  1HNW Q;  1VQC A;  1NBW A;  1OXV A;  3H0G G;  4RG1 A;  3CCV A;  4DV1 Q;  1VQ9 A;  4LF8 L;  1VQM A;  1HNZ Q;  4R4I A;  2B3G A;  2H5X A;  4OWX B;  1AH9 A;  1Q86 C;  1JT8 A;  4L5T A;  4GKJ Q;  2OWO A;  1Q8K A;  2Y0S E;  1S3O A;  3S15 H;  3E0E A;  2AHO B;  3HOZ H;  5H1S E;  1YHA A;  1P16 A;  2B29 A;  4A3I H;  1I3Q H;  1Z47 A;  2I5L X;  4GLA C;  2R92 H;  1FVI A;  4O2D A;  4R1J A;  1D8L A;  5IP9 G;  4JV5 Q;  3FKI H;  4YWM A;  3MXN B;  1XMQ Q;  3J7Z C;  1SRO A;  1T9H A;  1WJJ A;  4BY1 H;  3S16 H;  3EN2 A;  3H3V I;  1FGU A;  3S1Q H;  3A0J A;  4A93 H;  3T1Y Q;  3IRB A;  4JI1 Q;  1H95 A;  3LGJ A;  1C0A A;  4B3R L;  3RN2 A;  3TEH B;  2WP8 J;  4LWC A;  1L0W A;  5C0X G;  4LF6 L;  4X64 Q;  5LMU Q;  1HJP A;  1YJN A;  5JJL A;  2YU9 H;  3PGZ A;  3ICE A;  3NBH B;  4LFC L;  4JI5 Q;  4QQB X;  3CXC A;  4JI3 Q;  1L1O C;  4NXM L;  5C4X G;  4P74 A;  1U0L A;  2OQ0 A;  2K14 A;  3HKS A;  5C3E G;  4A3B G;  1K83 H;  2F4V L;  1X9N A;  3RNU A;  4JI0 Q;  2PI2 A;  4DUY L;  2JA8 G;  4X65 Q;  1KHI A;  1XMO L;  1E1T A;  2D62 A;  5LMN L;  1WCM G;  4LFB Q;  3HOY H;  1A62 A;  2ZM6 L;  3PF4 A;  2A1A A;  1GO3 E;  5C0X I;  2MQH A;  4HJ7 A;  2XGT A;  1PYB A;  1PH9 A;  1VQ7 A;  3GTQ H;  2QA4 A;  2LXJ A;  3PCO B;  3H15 A;  2Q2T A;  3HOX G;  4DR7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...