4LF4L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf4L00
1VQ5A 1KHIA 2NZOA 2K5VA 4RG1A 5LMNQ 3GTKH 1OXVA 4HIDA 4JV5L 4JI6L 4A3CH 4A75A 2JE6I 1N33L 5GROA 4OX9L 2R7FA 4A3EG 4BBRG 2VQEL 1JMCA 1XMQL 2EIFA 2JK8A 1K83H 1E7ZA 2B29A 1EFWA 1C9OA 1YI2A 1PHJA 3AEVA 1XTDA 1VQHA 4QJFA 1NTGA 1N34L 2JA5H 4BBSG 1L2FA 4LFBQ 3CCMA 2MNAA 2EQSA 3CXCA 2AHOB 4PZ7A 4TQUS 5LMNW 1J5EQ 3CCEA 4MZ9A 2NVXH 4B3SL 3I4MH 4Y7NH 2AKWB 3CD6A 1T9HA 4QGUA 1TWAH 4X62Q 3J81j 3BZCA 4LF6L 1RL2A 3FHWA 4YWMA 1VQEA 4YWKA 3D31A 3KOJA 4GS3A 1JT8A 2ES2A 4A4IA 5GADC 2MO0A 3AFQA 2N78A 1PH5A 2VL6A 3F2BA 4GN3B 2HHHQ 2PI2A 4BY1G 1BBUA 5DLQE 5C0XJ 3FKIH 2UUCQ 4JI7Q 3TS2A 4C2MH 1B70B 4PG3A 1P16A 1XNRL 1X65A 1O7IA 1FVIA 2ALYB 4DK6C 4GKJL 3CPFA 2R7ZG 1IBMQ 1I94Q 3PO2H 2D0PA 4AYBE 1KQSA 2JEBI 2DUDA 2ZTDA 5IYDG 4HJ7A 5AJ3L 1H95A 4IPHA 5ELOA 1HZCA 1YHQA 1EIYB 1L1OC 4DV1Q 3EBEA 4KHPL 3KF6B 1V1QA 3HOXG 4A3IH 2UU9L 4YCWA 4FDBA 5M5YH 1CKMA 3UDGA 1W2BA 3PUZA 1G291 1UWVA 3L0OA 4DV7Q 1VQ8A 4A3KG 1Y1VG 2UUAQ 3D0FA 5BR8Q 3ULPA 2NN6I 3ULLA 1E24A 1YITA 2UUBL 5GAGC 4YY3L 5IT9c 1I6HH 2QEXA 2Q2UA 4A3EH 2YV5A 1HZAA 1YVCA 5HY6A 4BBRH 3U58A 3DM3A 1VQPA 1AH9A 5LMUQ 2RHSB 2PNHA 1VQ7A 1KD1C 3F1ZA 2ZTCA 3AFPA 4R4QA 4DV4L 4BBSH 1ASZA 3S15H 1IXRA 4JBKA 4A93G 3NELA 1E22A 4AH6A 1TWHH 4A76A 4NXMQ 3PUVA 3WWVA 4P73A 1KIXA 4JI0Q 1NMGA 4JC0A 2ID0A 1XMOL 2KENA 4OWXB 4R1JA 1OXUA 2K52A 2RF4A 2I5MX 2MFIA 4LF9Q 3RR5A 1MIUA 3H3VI 1N32L 3KDFA 3G71A 4B3TQ 4JYAQ 3NBHB 1PH4A 2Z6KA 4DR4Q 5IY0A 3HOWG 1E1TA 4EQ5A 3RLFA 4BY1H 1FL0A 4O0AA 4YWLA 2B63G 1YJNA 2F4VQ 3UE0A 4LF8Q 4P71A 1NBWA 4DKAC 4JI1L 4X66Q 4DUYL 2PMZE 1S40A 1QVGA 1WOCA 1B8AA 3I4MG 4DR6Q 4X64L 3HOZG 4LW1A 1U0LA 5IYDH 4JOIA 5C44G 1LUZA 3GD7A 3ULJA 5M3MG 3H15A 4GLAC 1HNZQ 1X3GA 4DR1Q 1QUQB 4YHHQ 3CCQA 4B3RQ 1GKHA 4DV6Q 4JBJA 3STBD 1IYJB 3NENA 1ASYA 2BA0A 4IOAA 3VDYA 2IX1A 2HIXA 4A3BG 2PQAA 3S1RH 3W1BA 2HT1A 3FKIG 4KHZA 2NN6G 4LFAQ 3TEHB 3U4ZA 2GN5A 1VQMA 5IYCG 2XTIA 3L2PA 1D8LA 4JV5Q 4A3KH 1Y1VH 4IO9A 2H5XA 3BJUA 2UXBL 1Z9FA 3G4SA 1HR0L 2VQEQ 5IP7H 1MJCA 1Q8KA 2VS1A 2DGYA 2K4KA 2ZM6Q 1L0WA 4DAYB 1RIPA 3BZKA 4L5TA 3S1QH 1EUJA 1WYDA 3UDXA 3RZDH 3RLOA 4GLXA 2FXQA 1YHBA 4C3IH 4A93H 4O2DA 4B3SQ 3K0XA 4A3LG 5C3EG 4C3HH 3ZJYC 4EX5A 3J7ZC 1PA6A 4LF7L 5HGQA 5M3FH 4DR2Q 4JI2L 4GNXA 3E0EA 1VS0A 2R93G 1VQIA 2VQFQ 2JJQA 3S24A 4KI0A 2IT1A 3F2DA 2NVYH 4IJHA 1KRTA 5C0XI 2E5LL 4GKKQ 1PVOA 1GM5A 2UXCL 3HOWH 3CW2C 4QY7A 3PUXA 4HIKA 3J7A5 1EOVA 2R7DA 3RN5A 3TS0A 2B63H 4LF4L 1NMFA 4JBMA 4GKJQ 3K7AH 3CCVA 1JB7A 4LUVA 2A19A 2KHIA 1Y14B 1HNWL 3A0JA 4IOCA 2Q2IA 2PI2E 4A3JG 1IBKQ 3CPWA 1X6OA 2K14A 4MTNA 2CKZB 3DLLA 4GOPA 2AWNA 4B3ML 3HOZH 5C44H 5M3MH 4KHPQ 1SROA 1PYSB 1Q81C 4LFCL 1K0RA 4DUZL 2UU9Q 3S16H 4L5QA 3HKZG 1VQFA 2WAQG 2JA7G 2N8NA 4BA1I 1E3PA 3CC2A 3S2DH 3T1HL 3I2ZA 1Q1BA 1FJGL 3GDEA 2OWOA 2K5HA 2ZJPA 4A3BH 3ERSX 1S3OA 4XTCS 1X54A 1HH2P 3G6EA 5IYCH 1EQRA 1X56A 4HIMA 4BXXH 1PYBA 2JQOA 3CF5A 4DV0Q 3E9IA 1CKOA 3CCRA 1XPOA 3M4OH 2KCMA 4PMWA 1CKNB 2WB1G 1LM0A 4LF5L 2OCEA 1I3QH 1JJ2A 5IWAQ 1XNQL 3S14H 2JEAI 1K8AC 1UE1A 2AMCB 3A5UA 5ELNA 5LMNL 1X55A 1PH6A 1J6QA 2WAQE 5C3EH 4R4CA 4A3LH 1N36L 3H3VH 1EYGA 1N32Q 2KCTA 5C0XG 1G51A 4LUZA 5IYBG 2R93H 2E8GA 3GTQH 3H0GG 2Q2HA 2HQLA 3U4VA 1G6PA 4HIOA 2NVTH 5IP7G 2R6GA 4JBWA 3PV0A 2ZTEA 4LFBL 4QQBX 5GQOA 3OTOQ 4BY7G 1DGSA 2JA9A 4NXNQ 1J5EL 2D0OA 1IZ6A 3CMAA 4DV3L 1N9WA 3K81C 2QA4A 4J15A 4X62L 3I4NG 1JE5A 3M4QA 3UDFA 1UEBA 2OTLA 4JI3Q 3GTOH 4A3JH 4A3DG 1WJJA 1Y1WH 1LTLA 1KL9A 5M3FG 1L1OA 4IPDA 4KLKA 1EWIA 3PUWA 4DV2L 3MEFA 2UUCL 2YU9H 1P8LA 5M5WH 3HOYG 1FGUA 1GO3E 2CFMA 4ALPA 4JI7L 1IBLQ 1VQAA 4GN4B 1K9MC 2JA7H 3CCLA 1CUKA 1K3RA 1A63A 1IBML 1Q1EA 1I94L 2UXBQ 4X65L 2UXDQ 1HR0Q 5C4JH 1W3SA 2I5HA 3RN2A 2E2IH 2Z0SA 2I5LX 4DR7Q 4IFDJ 3GTLH 2VW9A 4DV1L 5C4XG 3K7UC 1XJVA 3M3YH 2N49A 4DR3Q 1WCMG 1NJIC 1YHAA 4JG2A 2CQOA 1VQ4A 2NVQH 5FJ8G 4A3GG 2IHEA 2MQHA 5M5XH 4DV7L 5IP9G 4JI8L 1HNXL 1EIFA 2VNUD 5BR8L 2Y0SG 1VCIA 1EQQA 1HR0W 1SR3A 3F8TA 2JA8G 3RNUA 3SGIA 5FLMH 1R9TH 4A3FG 2RHQB 1OXSC 3FP9A 3OYYA 3JAMc 2B3GA 2LXKA 1OXXK 1QZGA 1PV4A 4DV5L 1CSPA 5IYBH 5LMUL 4JI6Q 4UP8A 4BXXG 3H0GH 1N33Q 2YTXA 4OX9Q 3HOUH 1IL2A 3KJOA 1QZHA 1XMQQ 5GAHC 4P75A 4LFAL 4BY7H 4LF4Q 4AIMA 4NXML 1K8GA 4JI0L 1V43A 1N34Q 1I50H 4HJ8A 1LYLA 2JA6G 3S17H 3GTJH 1HNWQ 4LNQA 1E1OA 1KAWA 3GTPH 4LF9L 2F52A 3PO3H 4DK3C 3IRBA 4QIWE 1KC8C 1M90C 4B3MQ 3I4NH 3HFZB 5JEAJ 4A3DH 2D62A 2K75A 5FLXc 4DR4L 2Y0SE 4R4OA 4POFA 2BH2A 3B6YA 5K36G 3KDFB 4LF6Q 4WJ3M 2R92G 2YYZA 3GTGH 3HOYH 2CCZA 1U5KA 1TWCH 4LF8L 3M7NA 4JI5L 4GN5A 1SLJA 3I4OA 1OTCA 1HJPA 1BKBA 4DAMA 4A3MG 2GVAA 4R4TA 3I7FA 1XNRQ 3PIPA 1VQ9A 1JJGA 5JJIA 1NY4A 3J81i 4HJ5A 1NE3A 4AQYL 1HNZL 4NB3A 4GLVB 4YHHL 4PZ8A 4B3RL 4YCUA 5C4XH 3GO5A 1VQBA 2BH8A 5AJ3Q 4DV6L 1Q12A 1AE2A 3STBC 2ZJQA 1WCMH 1VQGA 3KF6A 3UE1A 3W1GA 4APVA 1Y1WG 3I55A 4LF5Q 5FJ8H 2A8VA 4A3GH 4WJ4A 1GVPA 1AE3A 3ER0A 3S1NH 4QL5A 4R4IA 3CCUA 2ZJRA 3M4PA 1Q86C 3T1YL 1PH7A 1OXTA 2GVBA 5IP9H 3I56A 1PH2A 3E9HA 4P74A 4JI4L 4POGA 3GTMH 1N36Q 1YNXA 2PQAB 3BU2A 4L5RC 2WP8J 2JA8H 1KRSA 4K0KL 3TREA 1Z47A 4XIGS 4A3FH 2ZM6L 4NPSA 1WI5A 2Q2TA 4UPAA 3PF5A 2UUBQ 2VY3A 4YY3Q 3JAMi 2RCNA 4AYBG 4HJ9A 4DR5L 1VQJA 1BVSA 2OQKA 1UE5A 3PIOA 1MJEA 3PSIA 4L5SA 4DV3Q 2JA6H 4DV4Q 4UP9A 4DR2L 1S72A 3J80i 5GAEC 1WFQA 2VQFL 4OO1I 3KF8B 3HKZE 2VZAA 1XMOQ 4GNXB 1B7YB 4GKKL 4X6AH 5FLMG 4DV2Q 1VQCA 4IPGA 1YZ6A 2ASBA 1VQNA 3AYHB 2R92H 1SMXA 2KBNA 1JJCB 4H02A 4JCVE 3S2HH 1YIJA 3HOUG 2V1CC 4MNOA 1C7YA 1Q82C 2QGQA 4ME3A 5JJKA 2OQ0A 2K50A 1VQ6A 4X65Q 3HOVG 3RZOH 1QVFA 3A74A 2IHFA 3UDIA 4A3MH 1PH3A 1IBKL 4BA2I 4IFDI 4JI1Q 4DUYQ 4C3JH 1K73C 2VUMG 2WB1E 3PO3G 3CAMA 5H1SE 2MO1A 2YTYA 1PH9A 4X64Q 3CCSA 4GOPB 1QUQA 3PGZA 3MXNB 1Q7YC 1PFSA 2Z6KC 4HJAA 2L15A 4JI8Q 3A5ZB 1YEZA 2HIVA 1HNXQ 1PH8A 2HHHL 4UY8C 3KJPA 4PZ6A 3CC7A 3F2CA 2K5NA 4YCVA 1VQDA 2CWAA 4LWCA 4UP7A 4DV0L 2OTJA 4IPCA 1V9PA 2NZHA 2F3IA 4DV5Q 3M9BA 3J81c 4OXPA 1D7QA 4JOIC 3OW2A 4OONA 5IWAL 3L7ZC 1TWGH 3TQYA 3K80C 5IE8A 3Q8DA 3M85A 3CMEA 1I5FA 3EIVA 2XGTA 1A8VA 1QVCA 5JJLA 1UE6A 4OWWB 4OO1G 1A0IA 2AWOA 1XPRA 3CQZH 3G48A 1YJWA 2UUAL 3JC66 2A1AA 4LF7Q 4A3CG 2BA1A 1GD7A 1C0AA 1UE7A 4OWTB 1CSQA 4JI2Q 1VQOA 3ICEA 2KHJA 1PH1A 1KXLA 1SRUA 3K8AA 4RMFA 3OTOL 2YTVA 2CWPA 3RLNA 4NXNL 4Y52H 2E5LQ 2JA5G 4JI5Q 2UXCQ 3KYHC 2ATWA 5J3BA 2R7ZH 4IFDG 1MKHA 1VQLA 3HOVH 3AQQA 3PUYA 1YJ9A 4JI3L 2LSSA 4AQYQ 2E2JH 1SE8A 1X3FA 3J80c 2VUMH 4GNXC 1HZ9A 1BBWA 1XPUA 1HZBA 4IJLA 4LUOA 3HOXH 1A62A 2EXDA 4DNIA 4B3TL 3KFUA 1L1OB 1IBLL 1VQKA 4JYAL 3S1MH 2C35B 4TVAB 3T1YQ 4LFCQ 4DUZQ 4JI4Q 3U50C 1SFOH 1M1KC 3KLWA 1TWFH 2UXDL 2F4VL 1SN8A 2IX0A 3T1HQ 3EN2A 1FJGQ 3PO2G 1N8RC 2I0QA 4DR7L 4X66L 4K0KQ 1YBYA 1X3EA 3HKSA 2E2HH 4DR6L 3PCOB 4DR3L 5EAYA 4GOPC 3NEMA 3CCJA 3PF4A 1TXYA 4DR5Q 3TRZA 2LXJA 2N3SA 1CKNA 3W5OA 4DR1L 4A3IG 3CP0A 4P72A 3LGJA 5E7NA 1X9NA 3CC4A 1Q46A 5JEAG 4DPGA 1XNQQ 2WFWA 2IY5B
chains in the Genus database with same CATH superfamily
2F0WA 2N88A 2K5VA 1EYCA 4RG1A 3PO3B 4HIDA 4ZKCB 3SEBA 2WIIB 3P75A 1WTQA 1HPCA 4OX9L 4A3DB 1X3QA 3TP8A 1JMCA 1XMQL 2XVSA 5EKIA 2B29A 4MIUA 1EFWA 1K8OA 2RSOA 3GTGB 1IYVA 2D2CC 1XTDA 1VQHA 1N34L 3X3MA 3CCMA 4IALA 4DA2A 2EQSA 1SEBD 4IFDH 4PZ7A 4TQUS 2NVXH 3CCEA 4B3SL 3NK9A 1A3TA 4C56C 1FYCA 3CD6A 4QGUA 4KY6A 3KOJA 1JT8A 4YIJA 2N78A 2FMCA 3F2BA 1D5MC 1WCMB 2HHHQ 5C0XJ 3FKIH 4JI7Q 3HP3A 4DK6C 1IBMQ 1SYCA 2JA8B 5IYDG 2LKVA 4H44C 5AJ3L 3D4WA 5ELOA 1TS3A 1EIYB 3ERQA 4DV1Q 2TSSA 3EBEA 1SJED 3KF6B 1G2SA 1HA5A 4A3IH 2UU9L 2F0PA 2ENBA 1W2BA 2NVXB 1KNAA 5EKLA 1G291 5JEAH 1C48A 1PTOH 2NYZD 2E75C 3BDCA 5GAGC 3OHXC 2YV5A 4BBRH 1ONLA 2R92B 1GJXA 3AFPA 3S2HB 4BBSH 2A69D 4C3IG 4A93G 3SE0A 1SMYD 1TWHH 4P73A 3CRKC 3RZOB 3K59A 2MFIA 3D3RA 3H3VI 4B3TQ 3G71A 1YNJD 2F3WA 4HTHA 4EQ5A 3HOWG 3C2PA 1RTOA 2K1BA 2DY7A 2PPBC 3H09A 4KJOA 1NBWA 4PV1C 4DKAC 5I2YA 1E2ZA 1BQQT 1S40A 4DR6Q 4HN7A 4X64L 4Q5VA 3ULJA 1HNZQ 4GLAC 3QJYA 4JBJA 3STBD 3NENA 4P2CB 1TWHB 3VDYA 4OEMB 2HT1A 2NN6G 4ZK9B 5IYCG 4JV5Q 3DUZA 4IO9A 1AW7A 1PRTB 3CQZB 2KCNA 3VYTA 4LAAA 2B2UC 3M7GA 1NUCA 2DGYA 1I6VC 3K5LA 2ZM6Q 1L0WA 4DAYB 3LX0A 1WYDA 1STGA 3D6WA 1DM0B 2FXQA 4GLXA 1EYDA 1PMRA 2JP1A 3K0XA 4A3LG 5LL6S 4C3HH 3ZJYC 3J7ZC 4LF7L 1PLFA 3KF8A 4DR2Q 3BYYB 2VQFQ 4KI0A 4GKKQ 1W6KA 2UXCL 4OHJA 3PUXA 5IGDA 2VB2X 3TN2A 1DZ1A 4LF4L 1CT1D 1S5FD 2XNAC 1CZWA 2B2YA 5KEEA 1Y14B 3I91A 4L6TB 5ELEA 4HR7B 3J80L 2Q2IA 2PI2E 5IGFA 4B3ML 3HOZH 2CKZB 4CJ2C 3MXNA 1SROA 4LFCL 2BE5C 3N52A 1VQFA 5DM73 2JA7G 3CC2A 1IHZA 1I4GA 1FJGL 4L63B 1VMCA 3MVVA 4XTCS 1CI3M 1X54A 4HIMA 1PYBA 3CF5A 4IUQA 1XX8A 5ISRA 1SJHD 3VR3A 1XPOA 2EE1A 2KCMA 1V8QA 3M4OH 1I3QH 5IWAQ 4KY5A 2JEAI 1UE1A 1SE2A 3A5UA 1X55A 2K5WA 1R4QB 1O7LA 2WAQE 5C3EH 4R4CA 3I4MB 2AQ2B 4J6HA 1K3BC 3OOCA 4LUZA 2E8GA 2Q2HA 2HQLA 1ICWA 1G6PA 3I90A 4K6DA 5IP7G 2A6ED 2NVTH 2ZTEA 1E0BA 2F0NA 3BDLA 4DV3L 1N9WA 3PQIA 4F88A 1MHWC 3K6OA 2EYHA 2Z6BA 3BVMA 4XT3B 3CU7A 5KYIA 3VA7A 3I4NG 1JE5A 2IL8A 3UDFA 4A3DG 2F0MA 5M3FG 4IPDA 1CA6A 5KNDA 1SYEA 2OF1A 3F2UA 1I3QB 4I7ZC 5M5WH 1FGUA 1GO3E 2CFMA 5IIFA 4KD4A 1IBLQ 3C1FA 1IL8A 4GN4B 3H6MA 1VDZA 1K9MC 1KLGD 1CFMA 1A63A 1I94L 2FHTA 4X3KA 4K5WA 1TU2B 3VYUA 2E2IH 2I5HA 2I5LX 2NVTB 3K7UC 1LO5D 1NSNS 4OIKA 1WCMG 4DR3Q 1NJIC 2NVQH 5FJ8G 2SEBD 4K8JA 2NB0A 4DV7L 4JI8L 2F0JA 3E6ZX 4FO2A 2DJFC 2F0TA 2JA8G 2HDLA 4OELB 2RHQB 3JAMc 1CA5A 5M5WB 5IYBH 2YTXA 4OX9Q 3HOUH 1ILQA 1SYGA 2JXMB 3P1HA 2Q8TA 3KJOA 4IUVA 1XMQQ 1QZHA 1IL2A 2A69C 1SMYC 3BVZA 4AIMA 1N34Q 1ZXTA 3GTJH 2K7VA 1O7ZA 4PQXA 3KLRA 4LF9L 1HRJA 3HFZB 4DNRB 2D62A 2PZUA 2BOSA 2B2WC 2R92G 2F0OA 2QF7A 1SYFA 3HOYH 1FNVA 4LF8L 2HCCA 5E1FA 1OTCA 1BKBA 5COYA 3H91A 2A5HA 1D2BA 5EBDA 4RH6A 4DNTB 1T5XD 4YHHL 5C4XH 1DOLA 4KKTA 4DV6L 5AJ3Q 1F9RA 3STBC 5J39A 3UE1A 4LF5Q 2A8VA 4EQNA 2Z9HA 4ME5A 1GVPA 3R3OA 1NR2A 3VR6A 3S1NH 3MFGA 4R4IA 5G3LF 3T1YL 4LFAL 5IP9H 1PZID 4JI4L 4P74A 2SNMA 2JSOA 1N36Q 3EQLC 1A2UA 1BF4A 3G6JB 4XIGS 2F0HA 2B2TA 3HOYB 1B3QA 1HTPA 3ITPA 2XWBB 4QF4A 2NVYB 4DR5L 1VQJA 1BVSA 5CV9A 4L5SA 2CW0D 4H7BA 1STNA 4DK1A 1J8IA 3EROA 2JA6H 1B50A 1LT3D 3C1EA 1LTGD 1H9SA 3KF8B 4N8X1 4DV2Q 4XDXA 2ASBA 3MHBA 1VQNA 5M3MB 4IZ8A 1SMXA 3A8JE 1D6EC 3I3CA 2V1CC 4MNOA 1F77A 2QGQA 3S2DB 4A3BB 3A74A 2IHFA 3UDIA 5CV5A 2C9OA 4A3MH 2QEJC 1WTVA 1IBKL 4BA2I 4IFDI 2MO1A 2YTYA 2G9HD 1EY4A 4X64Q 4K5XA 2KUMA 3W3AA 3MXNB 1RODA 2Z6KC 2M00A 1DJRD 1PFNA 4ODGA 2L15A 2JA6B 2HHHL 4CHTB 3HRZC 3GV6A 3KJPA 1HCZA 3V96A 3S9WA 2K5NA 2K01A 1XXGA 2SOBA 4UP7A 4DV0L 1V9PA 2NZHA 4DV5Q 1PTOF 4HMIA 4OXPA 3HG9A 4FP5D 4JOIC 5T1GA 4CDEC 3OW2A 1TWGH 3TQYA 3Q8DA 2XGTA 4A3MB 1A8VA 1MI2A 1UE6A 4OO1G 4ZYSA 2AWOA 2J4XA 2L12A 1S4ZA 4LF7Q 1SNPA 4A3CG 1GD7A 2EJFC 3GTOB 4A3JB 1Y1WB 2A6EC 3PMFA 5IT9L 1SRUA 4RMFA 1Q8IA 4JI5Q 2UXCQ 2RKSA 1SE4A 3KBXA 1CHQD 1MKHA 1VQLA 4EVOA 1SE8A 2ZXPA 5C4JB 2VUMH 4ID6A 1GUOA 4IJLA 3GTLB 4LUOA 4B3TL 3KFUA 1DOKA 4LFCQ 1SFOH 2J7ZA 2PO4A 2RDGA 2N55A 5E3FA 3EN2A 1NR4A 1FJGQ 2I0QA 4DR7L 1YBYA 1X3EA 3O13A 2E2HH 4DR6L 4ZUJA 1QNUA 4GOPC 3NEMA 4Q0FA 3H0GB 5NUCA 1ENCA 1BCPD 3CC4A 1B44D 1NAPA 2KEEA 1Q46A 4DPGA 1I50B 1VQ5A 5JVH3 3IL8A 1OXVA 4JV5L 4A75A 4A3EG 1A2TA 3OWFA 1DD2A 1E7ZA 1SNQA 1C9OA 1PHJA 4QJFA 1NTGA 1TWCB 3A7LA 1HFNA 1LTAD 1SAPA 2H4OA 2AHOB 4MZ9A 2AKWB 4FXDA 1TWAH 4M1UB 4RWSC 4DFAA 3J81j 2EPBA 1RL2A 3LWEA 3N6RA 1PH5A 4GN3B 4BY1G 1BBUA 5DLQE 5EPJA 1CM9A 1Z7TA 4PG3A 1XNRL 1O7IA 2ALYB 3CPFA 1I94Q 3PO2H 2D0PA 3VR4A 2ZTDA 1MSGA 2R61A 1SNOA 1H95A 2CHBD 1YHQA 1QJOA 3KBGA 4KK7A 3HOXG 1EWCA 3FRPB 4HEDA 4YCWA 4FDBA 5M5YH 1CKMA 3PUZA 1V1PA 2FFKB 4DV7Q 1TWAB 4A3KG 2EY2A 2ZXOA 3D0FA 3ULLA 1E24A 5IT9E 3T13A 1I6HH 3R2IA 1YVCA 5HY6A 4IUUA 2PNHA 2CW0C 2HUGA 2JYOA 3F1ZA 2ZTCA 1KD1C 1A6XA 4R4QA 4HCEA 3S15H 1IXRA 1BO0A 1PYWD 5JPMC 3PO2B 3PUVA 3WWVA 3R93A 1KIXA 2BDNA 3TP7A 5EGTA 1NMGA 1SYDA 4R1JA 2K52A 4LF9Q 3RR5A 3SHLA 1H9SB 3KDFA 1FNWA 4KV6A 1E1TA 3TMEA 1FD7D 3AMUA 1RF2D 1YJNA 4LF8Q 4WORA 1BXTA 4IUPA 4P71A 2EVBA 5LL6X 2EYLA 1QVGA 2PZTA 1FGBD 1RD9D 1KLUD 4LW1A 4U68A 1LUZA 5M3MG 3H15A 1X3GA 4DR1Q 4YHHQ 3J7AV 1Q3LA 1GKHA 2F0QA 4DV6Q 2ZXRA 4AYBB 4DAVA 1PDQA 3RD4A 2BA0A 4IOAA 4WJWA 4A3BG 2NTTA 3C46A 1CQVA 3DEOA 4KHZA 4LFAQ 3TEHB 1U4MA 1CZGA 2DNCA 1Y1VH 3BJUA 3G4SA 4J8QA 5IP7H 2NZ1D 2VS1A 4OIJA 2K4KA 5C4HA 3TDQA 2LS01 1I4QA 1RIPA 2O5IC 1WTPA 3RZDH 4CGYB 2R7ZB 1LTRD 2PYKA 1MGSA 4KTAA 3HOVB 1PA6A 1VF7A 5HGQA 2EZVA 5M3FH 2E2JB 1VS0A 2R93G 1VQIA 1JR0D 5C5MA 2JJQA 3S24A 5EBCA 3F2DA 4IJHA 1D5ZC 3NSWA 3CW2C 4QY7A 4B9XA 5CGKA 2R7DA 3TS0A 2B63H 1JB7A 3A0JA 1F2MA 4BS9A 4A3JG 1IBKQ 1JWSD 3DLLA 2XN9C 5C44H 2MPMA 3TZUA 5FLXL 4KHPQ 1PYSB 3A54A 2PMZB 3IKJA 1O78A 2WAQG 2N8NA 1E3PA 4WRDA 3GDEA 1WTWA 2ZJPA 3ERSX 1S3OA 2PNRC 1HH2P 1U4RA 2A68D 4DV0Q 3E9IA 1BCPC 2NBFA 3CCRA 4PMWA 1I4PA 4LF5L 2FJ2A 1JJ2A 1XNQL 1C4QA 5FO7B 2AMCB 2AQ3B 3ND9A 5TSSA 3MC0B 3K0YA 2B2VC 1N36L 2AUJD 1EYGA 3EA6A 2KCTA 3SK8A 1X32A 1TY2A 1EY7A 1JB3A 3GTQH 3H0GG 1ZYRD 4TSSA 4B9WA 2A73B 2R6GA 3PV0A 4QQBX 4LFBL 1JWMD 2Z1CA 1DGSA 2JA9A 1J5EL 1EY9A 2D0OA 3FKIB 3E0JA 1SDFA 4KJNA 5C3WA 5D3DA 2RDHA 4DK0A 3X3NA 1ET6A 3R2TA 4KLKA 1EWIA 3PUWA 4DV2L 5K5PA 4RHRA 4KY7A 3Q22A 1STYA 4A3IB 5JAVA 1EQVA 3CCLA 4NP5A 3EVQA 1A3UA 2UXBQ 1PTOB 1W3SA 3GTQB 5EKKA 4DR7Q 3EFXD 1XJVA 3M3YH 2N49A 3NHHA 4JG2A 4BBRB 4A3GG 1LT5D 2MQHA 3OWEB 2V4DA 3HS0C 5M5XH 2RBMA 1ESFA 1EIFA 4J1MA 4BBSB 2QW7A 1V1PB 1HR0W 1IW7D 1SR3A 4LK1C 1WTOA 1R9TH 2C5CA 1OXSC 3FP9A 4V190 1OXXK 5C0XH 4DV5L 2BCOA 3DMUA 3J81L 4ILWA 5M9OA 5ELCA 4BY7H 1K8GA 1V43A 4HJ8A 1LYLA 4ABNA 4RGTA 5IGBA 2QCPX 1XYIA 1EY8A 4F8MA 1Y8OB 4LNQA 1E1OA 1KAWA 2RVLA 3GTPH 4DK3C 5FLXE 2K75A 3A56A 3KDFB 1UAPA 2KA7A 3HGBA 2PZWA 3ND8A 2EJMA 4JI5L 3I4OA 2WKDA 2EDGA 4GZYC 1R9TB 3HEJA 4FF1A 3WOFA 1F2LA 4R4TA 1XNRQ 3PIPA 5JJIA 2B2UA 2L4NA 2Z4IA 2CH4A 1FR3A 1SNCA 4B3RL 1AE2A 4APVA 4WJ4A 3NWSA 3NTKA 2B39A 3ER0A 4IN3A 4QL5A 4CJ0B 4XQNA 2ZJRA 3BVGA 1E2WA 3GTPB 1EEFD 1RDPD 4POGA 1AP0A 3GTMH 4RGNA 2I46A 2F0UA 3BG3A 4C3HB 3TREA 1OO9B 4A3FH 4NPSA 3OMCA 2Q2TA 4UPAA 2VY3A 3JAMi 2LY7A 2RCNA 4AYBG 1ESRA 4NMZA 1R4PB 1RKNA 1KDAA 3FEWX 3PIOA 2FINB 1TS2A 2EY5A 1EY6A 1MSHA 4L8JA 4K14A 1VF5C 2VZAA 3QIAA 4CDFC 3HOZB 2QILA 5K36H 3Q0AA 1B1ZA 2KBNA 1JJCB 2L55A 4H02A 4JCVE 4QIWB 2Y0SB 1C7YA 1Q82C 4ME3A 5JJKA 2K50A 4H13C 4X65Q 3HOVG 2MHVA 1QVFA 1EU3A 1PH3A 1ET9A 4C3JH 1K73C 4QMGA 5EPKA 3PO3G 5H1SE 3NBIA 1VMPA 2EYFA 1QUQA 1TY0A 5ELBA 5DNFA 4HJAA 3M4OB 1HNXQ 1PH8A 3CC7A 1MD2D 4HSVA 1F2ZA 4YCVA 1VQDA 2A68C 4TKOB 5C3EB 2OTJA 4IPCA 1ILPA 3J81E 3M9BA 3U9OA 1YNND 4JPBW 1QILA 2KECA 1CK1A 3L7ZC 4CKCA 5IE8A 2L11A 3CMEA 1I5FA 1AEXA 1WVLA 3GQBA 4OWWB 5D65A 1G8ZD 4G4KA 3QR8A 2WACA 1E2VA 1C0AA 1UE7A 1ZYRC 2SDFA 1CSQA 3URYA 1VQOA 2KHJA 1KXLA 1JWUD 4BWGB 4PMBA 3OTOL 1WTRA 2KCCA 3RLNA 4NXNL 4Y52H 3NTIA 3KYHC 2ATWA 5J3BA 1PFMA 3K5OA 1PZKD 4IFDG 3KUPA 5I2XA 5BN4A 3AQQA 3G7LA 4JI3L 3VR5A 1JICA 5JJZA 3J80E 2E2IB 3MTSA 4GNXC 3HOXH 4I65A 1VQKA 2IPKD 4HAEA 4TVAB 2F0LA 2H1EA 2NVQB 3U50C 2QDLA 1TWFH 2UXDL 4FF3A 3GP7A 1HFGA 3PCOB 1F9QA 1TXYA 2E2DC 2HD3A 4RHSA 1X9NA 4DR1L 4A3IG 3HOUB 3LGJA 4N9TA 1K0SA 5JEAG 5C4ZA 1XNQQ 2WFWA 1IW7C 2RQXA 3GTJB 2OEOA 1TIID 4JVZA 1N33L 5GROA 2R7FA 4BBRG 2L5TA 2B2WA 1K83H 5C5LA 1YI2A 5CV7A 1TWFB 4C1NI 2JA5H 4BBSG 4LFBQ 2RA4A 3CXCA 1J5EQ 5LMNW 1HA6A 4Y7NH 2K5QA 1T9HA 3FVQA 4LF6L 3FHWA 4YWMA 1VQEA 2L0CA 3D31A 4YWKA 5C4XB 4A4IA 4RGMA 5GADC 3BYTB 2MO0A 4X3UA 1RJTA 3UI2A 1EY0A 4C2MH 3S1NB 3GV3A 1B70B 1KDBA 5A35A 1P16A 1LTSD 1X65A 5KIXA 1FVIA 1BNZA 4AYBE 2JEBI 4HJ7A 4OGQC 1HUNA 4IPHA 4K5VA 2K6AA 1L1OC 1GOZA 3NPPA 4KHPL 4ZRZA 1V1QA 1A15A 1QWYA 3NE5B 1UWVA 5D14A 3L0OA 1NCVA 1VQ8A 2UUAQ 4KN7C 5KRUA 3ULPA 1YITA 4R9WA 2Q2UA 1HZAA 1VQPA 1AH9A 2RHSB 4RCNA 1VQ7A 1ASZA 1GHJA 4JBKA 4AH6A 4RFBA 5JVG3 4C3HG 1KDCA 4JC0A 3MXGA 3I70A 2RF4A 2JN4A 1S5BD 3MA2B 1PH4A 1QE6A 2Z6KA 2HDMA 4RA8A 3T4AC 3RLFA 1FL0A 2IX3A 2X6GA 4IQZA 4JI1L 1TVXA 2PMZE 1WOCA 3I4MG 1TQOA 1Y8PB 3HOZG 5IYDH 4JOIA 2D5DA 4DN4M 4PMCA 1QUQB 3CCQA 4B3RQ 3V05A 4ZAIA 1RHPA 2MJ8A 1TWGB 4MTKA 1ASYA 2IX1A 2HIXA 2G5DA 1BUVT 3FMCA 5JJLA 3U4ZA 2GN5A 1EWHA 3L2PA 2XTIA 2UXBL 1D8LA 1Z9FA 2VQEQ 1Q8KA 1YNNC 1FNUA 1TS4A 3BZKA 4L5TA 3S1QH 1EUJA 3IAYA 4FYDA 3UDXA 3RLOA 1YHBA 3NP8A 4C3IH 2NTSA 2KEDA 2QDBA 4K2LA 4MHEA 4O2DA 4A93H 1DONA 5C3EG 2CH4W 1SNMA 2VUMB 4KMUC 2HCIA 4X3TA 3JAML 2EYOA 2X6LA 3VYSA 1STHA 1KRTA 5C0XI 1PVOA 1GM5A 3HOWH 2MP1A 5I4DA 4HIKA 1EQTA 1SFOB 1M8AA 4GKJQ 3K7AH 4LUVA 1LT6D 2KHIA 3NUCA 4IOCA 1KABA 1O7YA 1X6OA 2K14A 4MTNA 4GOPA 2E2HB 4ZUIA 4DGZA 3CKIB 1K0RA 3S16H 1LTTD 1HQMC 3SK4A 4G7HC 2NN6H 3G6EA 5IYCH 5KYLA 2L1BA 5FOBB 2PQEA 1CKOA 1LM0A 1GUNA 4FNFA 2OCEA 1WTHA 3K7AB 3S14H 1K8AC 2OT2A 5LMNL 1PH6A 4K8IA 1EY5A 4RGOS 2SNSA 3T56B 4A3LH 2E74C 4DXGA 1PRTC 1N32Q 5EPLA 2WINB 1LLRD 5IYBG 4HCSA 4F7XA 3QOLA 5DEHA 1H9RA 3U4VA 1KTKA 4HIOA 3VA5A 4U673 4JBWA 2K33A 5LHY1 5GQOA 3OTOQ 4DAPA 4NXNQ 1IZ6A 2KJXA 3CMAA 1AZPA 3D4RA 4J15A 4FF2A 3R8BA 4X62L 4NKLA 1B3AA 4IUNA 1NNXA 3M4QA 2OTLA 1UEBA 3I4LA 4DU9A 4JI3Q 1WJJA 1LTLA 1KL9A 2UUCL 2YU9H 1P8LA 3HOYG 3VYRA 3S14B 4ALPA 4KHVA 1VQAA 2BDOA 1SXTA 2JA7H 2F0DA 5M5YB 1K3RA 2WKCA 5CMDA 4X65L 2UXDQ 1HR0Q 1U9RA 3SVMA 3A55A 2F0GA 4IFDJ 4S3SA 2VW9A 3D8GA 1I6HB 5C4XG 1LABA 4DXFA 1BOSA 2CQOA 1DOMA 2XRSD 1BCPF 4EQOA 1GUWA 1BR9A 5IP9G 1HNXL 3DHQA 3S15B 4RKBA 2D9UA 2F1MA 5BR8L 1EQQA 1B9NA 3F8TA 5I6YA 3SGIA 2B8GA 5DM63 1PZJD 2B3GA 2LXKA 1PV4A 3OIPA 2DJGC 3BS1A 5LMUL 4BXXG 5L37A 1N33Q 2MUYA 4E6IA 1H9MA 4G7OC 1PFBA 3WDNA 4NXML 4JI0L 3S17H 2JA6G 1HNWQ 3PO3H 1CQFA 5I9OA 3IRBA 3L9AX 4QIWE 1M90C 3I4NH 5JEAJ 4A3DH 4DR4L 2Y0SE 4R4OA 4POFA 2BH2A 3B6YA 3P7JA 4LF6Q 2YYZA 3GTGH 1U5KA 1EIGA 3M7NA 3BZDB 4GN5A 1HJPA 5E4XA 4A3MG 2GVAA 3I7FA 1VQ9A 1JJGA 4JK1C 1NY4A 1Y1VB 4HJ5A 5FO8B 4KKSA 4PZ8A 4YCUA 3GO5A 1VQBA 2BH8A 1Q12A 3NXWA 1WCMH 1Y1WG 4NW2A 5FJ8H 4RKLA 3K58A 1CTMA 3TBIB 4XQQA 5IGGA 3CCUA 3RZDB 1EYAA 1PH7A 1TR5A 3I56A 1PH2A 3E9HA 1YNXA 3I4NB 1LTID 4L5RC 3SDZA 2JA8H 3WOEA 5M3FB 4N9PA 1WI5A 4XT1B 5BN3A 4QB4A 1STBA 5IGCA 1UE5A 5CBAE 3PSIA 5JPNC 1MJEA 1JOKA 3QWNA 1Y8NB 2B63B 5GAEC 1WFQA 5HGTA 1HUMA 1JQYD 3NBHA 3NQIA 5FLMG 4ZCKA 5C44B 1DCZA 2R92H 2F0IA 2MGSA 1WD0A 3S2HH 1YIJA 3H94A 4ZKBB 3CHBD 3TSSA 2OQ0A 3RZOH 2J0TD 1I4XA 1L0YB 4JI1Q 2VUMG 2KOLA 3DEPA 1PH9A 3CCSA 1QOHA 4GOPB 3SK5A 3PGZA 3LNNA 3OPOA 3SR1A 1LV9A 3QO2A 1M4VA 4O1NA 3A5ZB 1YEZA 2HIVA 4UY8C 4PZ6A 3SK6A 5I9PA 2B2VA 1I4RA 2CWAA 3QG1A 1PXUA 2F3IA 1D7QA 1JE4A 2K04A 2RDFA 2EYPA 4IURA 2K32A 1GUTA 5C3XA 5C6AA 1G6ZA 2QKIC 1UNSA 2AUKA 3CQZH 2UUAL 3JC66 4UHVA 2ZT9C 4M8AA 3FPPA 1EZ8A 3HKZB 2K03A 3KLSX 5CV4A 1EL0A 2OXPA 1F9SA 3PUYA 4WFN3 4N8FA 4AQYQ 3D6CA 3QOJA 1V1OA 1XPUA 1HZBA 2EXDA 4DNIA 1II3A 3M3YB 3S1MH 2C35B 2EJGC 1SYBA 3E5SA 1U4PA 2O4XA 1EU4A 2WB1B 3IFDA 1M1KC 3KLWA 5M5XB 3M4YA 5CBEE 2IX0A 3K57A 3PO2G 4K0KQ 2B2YC 1N8RC 1GXDC 3VR2A 3HKSA 4QCLA 1JC7A 5EAYA 3KLSA 2DN8A 4CBVA 3CCJA 2I07B 2LXJA 1CKNA 3W5OA 3CP0A 4RAUC 1QG7A 3MXPA 3DWAA 4BY7B 2IY5B 3DXJC 1KHIA 1SBBB 2NZOA 5LMNQ 3GTKH 5IODA 5EJWA 2PCFB 4OO1H 3J7YW 3H3VC 4JI6L 4A3CH 2JE6I 1D1IA 3S1MB 3E3XA 2VQEL 2EIFA 2JK8A 4KKUA 2EOTA 4B08A 3K5NA 4CKBA 3AEVA 1L2FA 2A74C 4H0LC 2MNAA 1UEAB 1J9OA 3I4MH 1A3VA 2F0FA 3HZXA 4XYQA 4X62Q 3BZCA 2K05A 1LT4D 4LJZC 1B53A 4GS3A 3LWUA 3MZ5A 2ES2A 3AFQA 2VL6A 2PI2A 1JORA 2UUCQ 5CORA 3TS2A 2O2LD 2P5ZX 2XRQD 3GTKB 4GKJL 3GTMB 2R7ZG 3AB9A 1KQSA 1I4HA 1Y69U 2DUDA 4A3FB 4RCOA 1HZCA 1IYUA 3A8IE 4CDCC 3BDOA 3Q24A 2A6HD 5G3LD 2F0SA 3UDGA 2R3ZA 4X3SA 5BN5A 1IKMA 1Y1VG 1XWEA 5BR8Q 1ENAA 5KNBA 5A2QL 2NN6I 2UUBL 1H9KA 4YY3L 1W6JA 4G57A 2IJ0A 4HMJA 5IT9c 2QEXA 2LFNA 4A3EH 3U58A 3DM3A 5LMUQ 5D3IB 3AU7A 3IFTA 1DXMA 1TS5A 4DV4L 3Q23A 4FXKC 3NELA 1E22A 4A76A 4NXMQ 2TMPA 3MWYW 4JI0Q 2EXZA 2CQAA 2ID0A 1XMOL 2KENA 4OWXB 1OXUA 2I5MX 4QUCA 4ULLA 1MIUA 3CRLC 4C3JB 1N32L 4JYAQ 3MXUA 3NBHB 4DR4Q 5IY0A 5ELFA 4FF4A 2EY6A 2RCFA 5IGEA 3ONAB 3TP6A 4BY1H 4O0AA 4YWLA 2B63G 2F4VQ 3UE0A 2X69A 5KGUA 3V2TA 3T53B 4X66Q 4DUYL 1B8AA 2M2LA 4A3EB 3NQTA 1B4OA 1S5DD 1U0LA 5C44G 3GD7A 1BCPB 4TRDA 1IYJB 3OSOA 4UAIA 4K6LA 4XXEA 2PQAA 3S1RH 3W1BA 3FKIG 1VQMA 2F0VA 4A3KH 2H5XA 1PTOD 4Z9CB 1HR0L 1MJCA 1C8CA 1RCVD 3TP5A 1TT2A 4BY1B 1EIHA 1STEA 4IUTA 2NUCA 3DWPA 3T16A 3U9SA 1ML0D 2F0KA 2F03A 2KVMA 4B3SQ 1YNJC 4EX5A 5CV6A 4JI2L 4GNXA 3E0EA 2XIWA 1AZQA 3K5MA 2IT1A 2B2TC 2NVYH 2E5LL 3HOXB 4OL7A 1PRTD 5CC4A 3DM1A 3J7A5 3S1RB 1EOVA 1KAAA 3RN5A 1JOOA 1NMFA 4JBMA 4A3KB 3CCVA 1O80A 3Q6SA 2A19A 1HNWL 1ENFA 1GHKA 3CPWA 1HXYD 3W2DA 4UDUC 2AWNA 1EOTA 1LACA 2VXWA 5M3MH 2PW5A 4MN3A 1Q81C 2UU9Q 4KN4C 4DUZL 4L5QA 3HKZG 2KHSA 1D5XC 1JOQA 3A8KE 4BA1I 3S2DH 3T1HL 3I2ZA 1Q1BA 2OWOA 2K5HA 5A2QE 4A3BH 4HSPA 4ZQ3A 1EQRA 1X56A 3OIQA 4BXXH 2JQOA 4I7AA 1QB5D 1K83B 3FDTA 1CKNB 2WB1G 2EYJA 2JA5B 1GUSA 5ELNA 2ICIA 1J6QA 3H3VH 1K8MA 4Y7NB 5C0XG 1G51A 2R93H 4R8NA 2HQEA 3C3LA 2F0EA 2E76C 1QCBD 5AFWA 1WD1A 1L0XB 4C1NK 4BY7G 1S5CD 2K28A 4C2MB 3K81C 4FVMA 2QA4A 1AN8A 2NWGA 1U4LA 3GTOH 4A3JH 1Y1WH 1RTNA 3A7AB 1L1OA 1F9PA 3MEFA 4LMQD 4JI7L 3MAQA 2XSCA 1CUKA 1IBML 1Q1EA 5HURA 4K2KA 5DAUA 3J7AF 2R93B 5C4JH 3RN2A 2Z0SA 1Z6HA 5FK9C 1S5ED 4DV1L 3GTLH 1H9JA 3NWTA 2B8FA 1YHAA 1CHPD 5JOBA 1BBXC 1VQ4A 2A6HC 2IHEA 5KNCA 2CVRA 2VNUD 4F87A 3L3OC 4EQPA 2Y0SG 1VCIA 3RNUA 5FLMH 1KNEA 4A3FG 1ZKOA 1LTBD 3OYYA 5I6WA 1QZGA 1BDOA 1CSPA 4JI6Q 1PRTF 4UP8A 3H0GH 2WAQB 5GAHC 3KK7A 4P75A 3SXHA 4LF4Q 1I50H 1B9MA 2IW3A 3T51B 5E4WC 2K5DA 1T5EA 2F52A 4PNYA 5FO9B 1KC8C 4B3MQ 5FLXc 1JCKB 4R8IA 5K36G 3TZDA 4WJ3M 4DF7A 2CCZA 1TKWB 1TWCH 5ELDA 3MFYA 1SLJA 5FKAC 4CKEA 2RSNA 4DAMA 3QB3A 2O5JC 1GUGA 2Z8LA 3NTHA 3D4DA 4C3JG 3J81i 1NE3A 3P20A 4AQYL 1HNZL 2IWHA 1DYQA 4NB3A 4GLVB 1MBYA 2ZJQA 1Q90A 3KF6A 1VQGA 3W1GA 2XWJB 1F2YA 3I55A 4A3GH 3PIP3 4FXGC 1AE3A 3S1QB 1Q86C 3M4PA 1OXTA 2GVBA 2GA4B 1STAA 5CV8A 4C3IB 4A93B 4XQJA 2PQAB 2VB3X 1PTOC 3BU2A 5CYUA 2WP8J 1KRSA 4K0KL 1Z47A 2ZM6L 3PF5A 1G2TA 2UUBQ 2EYMA 4YY3Q 2KQ3A 4HJ9A 2OQKA 3DWQA 3HOWB 4CJ1B 4DV3Q 3RMHA 1SE3A 1AFPA 4DV4Q 2LMCB 2AQ1B 4UP9A 4DR2L 1S72A 3I73A 3J80i 2VQFL 5T1IA 4OO1I 3PIO3 3HKZE 1XMOQ 4GNXB 1B7YB 4GKKL 4X6AH 1VQCA 4IPGA 4A3GB 1YZ6A 1QNKA 3AYHB 3MEHA 3S16B 1SNDA 3HOUG 3I8ZA 1VQ6A 4XYOA 4DUYQ 2WB1E 4JW0A 3CAMA 4V0BA 4NDXA 1SSOA 1HTLD 1Q7YC 1PFSA 2F4IA 2Q8RE 4JI8Q 1K28A 2EY1A 4QUFA 3F2CA 1UUPA 3OW7A 1EEID 4LWCA 2F3VA 4EGVA 5J1ZA 3J81c 4DAYA 5J22A 5EQ0A 4OONA 2M9VA 5IOCA 5IWAL 3K80C 3FPUB 3M85A 4KD3A 1ICFB 3EIVA 3RUZA 1QVCA 2FMMA 3ZYYX 1X3PA 1A0IA 2DY8A 4O42A 1XPRA 3OMGA 3G48A 1YJWA 2L9HA 3I72A 2A1AA 2BA1A 2PW7A 4OWTB 4JI2Q 3ICEA 2DNEA 1PH1A 3JAME 2WV6D 3K8AA 2YTVA 2CWPA 2YU9B 1IKLA 3EJIA 2E5LQ 2JA5G 2R7ZH 2JA7B 1ZEQX 1D1KA 3HOVH 1YJ9A 2LSSA 1XTCD 1EZ6A 1B2TA 2E2JH 1X3FA 3J80c 1HZ9A 1BBWA 5F2DA 4JYAL 1A62A 1L1OB 1IBLL 1HHVA 2Z4HA 2BE5D 3T1YQ 4DUZQ 4JI4Q 2F4VL 4CDDC 1SN8A 3T1HQ 2G9DA 4X66L 2ICEC 4DR3L 1HQRD 4G7ZC 4ZLTF 3PF4A 4DR5Q 3TRZA 2N3SA 4P72A 5E7NA 1G91A 1WTXA 2Q8IB 1EFID 3S17B 5CR3A
chains in the Genus database with same CATH topology
1VQ5A 1KHIA 2NZOA 2K5VA 4RG1A 5LMNQ 3GTKH 1OXVA 4HIDA 4JV5L 4JI6L 4A3CH 4A75A 2JE6I 1N33L 5GROA 4OX9L 2R7FA 4A3EG 4BBRG 2VQEL 1JMCA 1XMQL 2EIFA 2JK8A 1K83H 1E7ZA 2B29A 1EFWA 1C9OA 1YI2A 1PHJA 3AEVA 1XTDA 1VQHA 4QJFA 1NTGA 1N34L 2JA5H 4BBSG 1L2FA 4LFBQ 3CCMA 2MNAA 2EQSA 3CXCA 2AHOB 4PZ7A 4TQUS 5LMNW 1J5EQ 3CCEA 4MZ9A 2NVXH 4B3SL 3I4MH 4Y7NH 2AKWB 3CD6A 1T9HA 4QGUA 1TWAH 4X62Q 3J81j 3BZCA 4LF6L 1RL2A 3FHWA 4YWMA 1VQEA 4YWKA 3D31A 3KOJA 4GS3A 1JT8A 2ES2A 4A4IA 5GADC 2MO0A 3AFQA 2N78A 1PH5A 2VL6A 3F2BA 4GN3B 2HHHQ 2PI2A 4BY1G 1BBUA 5DLQE 5C0XJ 3FKIH 2UUCQ 4JI7Q 3TS2A 4C2MH 1B70B 4PG3A 1P16A 1XNRL 1X65A 1O7IA 1FVIA 2ALYB 4DK6C 4GKJL 3CPFA 2R7ZG 1IBMQ 1I94Q 3PO2H 2D0PA 4AYBE 1KQSA 2JEBI 2DUDA 2ZTDA 5IYDG 4HJ7A 5AJ3L 1H95A 4IPHA 5ELOA 1HZCA 1YHQA 1EIYB 1L1OC 4DV1Q 3EBEA 4KHPL 3KF6B 1V1QA 3HOXG 4A3IH 2UU9L 4YCWA 4FDBA 5M5YH 1CKMA 3UDGA 1W2BA 3PUZA 1G291 1UWVA 3L0OA 4DV7Q 1VQ8A 4A3KG 1Y1VG 2UUAQ 3D0FA 5BR8Q 3ULPA 2NN6I 3ULLA 1E24A 1YITA 2UUBL 5GAGC 4YY3L 5IT9c 1I6HH 2QEXA 2Q2UA 4A3EH 2YV5A 1HZAA 1YVCA 5HY6A 4BBRH 3U58A 3DM3A 1VQPA 1AH9A 5LMUQ 2RHSB 2PNHA 1VQ7A 1KD1C 3F1ZA 2ZTCA 3AFPA 4R4QA 4DV4L 4BBSH 1ASZA 3S15H 1IXRA 4JBKA 4A93G 3NELA 1E22A 4AH6A 1TWHH 4A76A 4NXMQ 3PUVA 3WWVA 4P73A 1KIXA 4JI0Q 1NMGA 4JC0A 2ID0A 1XMOL 2KENA 4OWXB 4R1JA 1OXUA 2K52A 2RF4A 2I5MX 2MFIA 4LF9Q 3RR5A 1MIUA 3H3VI 1N32L 3KDFA 3G71A 4B3TQ 4JYAQ 3NBHB 1PH4A 2Z6KA 4DR4Q 5IY0A 3HOWG 1E1TA 4EQ5A 3RLFA 4BY1H 1FL0A 4O0AA 4YWLA 2B63G 1YJNA 2F4VQ 3UE0A 4LF8Q 4P71A 1NBWA 4DKAC 4JI1L 4X66Q 4DUYL 2PMZE 1S40A 1QVGA 1WOCA 1B8AA 3I4MG 4DR6Q 4X64L 3HOZG 4LW1A 1U0LA 5IYDH 4JOIA 5C44G 1LUZA 3GD7A 3ULJA 5M3MG 3H15A 4GLAC 1HNZQ 1X3GA 4DR1Q 1QUQB 4YHHQ 3CCQA 4B3RQ 1GKHA 4DV6Q 4JBJA 3STBD 1IYJB 3NENA 1ASYA 2BA0A 4IOAA 3VDYA 2IX1A 2HIXA 4A3BG 2PQAA 3S1RH 3W1BA 2HT1A 3FKIG 4KHZA 2NN6G 4LFAQ 3TEHB 3U4ZA 2GN5A 1VQMA 5IYCG 2XTIA 3L2PA 1D8LA 4JV5Q 4A3KH 1Y1VH 4IO9A 2H5XA 3BJUA 2UXBL 1Z9FA 3G4SA 1HR0L 2VQEQ 5IP7H 1MJCA 1Q8KA 2VS1A 2DGYA 2K4KA 2ZM6Q 1L0WA 4DAYB 1RIPA 3BZKA 4L5TA 3S1QH 1EUJA 1WYDA 3UDXA 3RZDH 3RLOA 4GLXA 2FXQA 1YHBA 4C3IH 4A93H 4O2DA 4B3SQ 3K0XA 4A3LG 5C3EG 4C3HH 3ZJYC 4EX5A 3J7ZC 1PA6A 4LF7L 5HGQA 5M3FH 4DR2Q 4JI2L 4GNXA 3E0EA 1VS0A 2R93G 1VQIA 2VQFQ 2JJQA 3S24A 4KI0A 2IT1A 3F2DA 2NVYH 4IJHA 1KRTA 5C0XI 2E5LL 4GKKQ 1PVOA 1GM5A 2UXCL 3HOWH 3CW2C 4QY7A 3PUXA 4HIKA 3J7A5 1EOVA 2R7DA 3RN5A 3TS0A 2B63H 4LF4L 1NMFA 4JBMA 4GKJQ 3K7AH 3CCVA 1JB7A 4LUVA 2A19A 2KHIA 1Y14B 1HNWL 3A0JA 4IOCA 2Q2IA 2PI2E 4A3JG 1IBKQ 3CPWA 1X6OA 2K14A 4MTNA 2CKZB 3DLLA 4GOPA 2AWNA 4B3ML 3HOZH 5C44H 5M3MH 4KHPQ 1SROA 1PYSB 1Q81C 4LFCL 1K0RA 4DUZL 2UU9Q 3S16H 4L5QA 3HKZG 1VQFA 2WAQG 2JA7G 2N8NA 4BA1I 1E3PA 3CC2A 3S2DH 3T1HL 3I2ZA 1Q1BA 1FJGL 3GDEA 2OWOA 2K5HA 2ZJPA 4A3BH 3ERSX 1S3OA 4XTCS 1X54A 1HH2P 3G6EA 5IYCH 1EQRA 1X56A 4HIMA 4BXXH 1PYBA 2JQOA 3CF5A 4DV0Q 3E9IA 1CKOA 3CCRA 1XPOA 3M4OH 2KCMA 4PMWA 1CKNB 2WB1G 1LM0A 4LF5L 2OCEA 1I3QH 1JJ2A 5IWAQ 1XNQL 3S14H 2JEAI 1K8AC 1UE1A 2AMCB 3A5UA 5ELNA 5LMNL 1X55A 1PH6A 1J6QA 2WAQE 5C3EH 4R4CA 4A3LH 1N36L 3H3VH 1EYGA 1N32Q 2KCTA 5C0XG 1G51A 4LUZA 5IYBG 2R93H 2E8GA 3GTQH 3H0GG 2Q2HA 2HQLA 3U4VA 1G6PA 4HIOA 2NVTH 5IP7G 2R6GA 4JBWA 3PV0A 2ZTEA 4LFBL 4QQBX 5GQOA 3OTOQ 4BY7G 1DGSA 2JA9A 4NXNQ 1J5EL 2D0OA 1IZ6A 3CMAA 4DV3L 1N9WA 3K81C 2QA4A 4J15A 4X62L 3I4NG 1JE5A 3M4QA 3UDFA 1UEBA 2OTLA 4JI3Q 3GTOH 4A3JH 4A3DG 1WJJA 1Y1WH 1LTLA 1KL9A 5M3FG 1L1OA 4IPDA 4KLKA 1EWIA 3PUWA 4DV2L 3MEFA 2UUCL 2YU9H 1P8LA 5M5WH 3HOYG 1FGUA 1GO3E 2CFMA 4ALPA 4JI7L 1IBLQ 1VQAA 4GN4B 1K9MC 2JA7H 3CCLA 1CUKA 1K3RA 1A63A 1IBML 1Q1EA 1I94L 2UXBQ 4X65L 2UXDQ 1HR0Q 5C4JH 1W3SA 2I5HA 3RN2A 2E2IH 2Z0SA 2I5LX 4DR7Q 4IFDJ 3GTLH 2VW9A 4DV1L 5C4XG 3K7UC 1XJVA 3M3YH 2N49A 4DR3Q 1WCMG 1NJIC 1YHAA 4JG2A 2CQOA 1VQ4A 2NVQH 5FJ8G 4A3GG 2IHEA 2MQHA 5M5XH 4DV7L 5IP9G 4JI8L 1HNXL 1EIFA 2VNUD 5BR8L 2Y0SG 1VCIA 1EQQA 1HR0W 1SR3A 3F8TA 2JA8G 3RNUA 3SGIA 5FLMH 1R9TH 4A3FG 2RHQB 1OXSC 3FP9A 3OYYA 3JAMc 2B3GA 2LXKA 1OXXK 1QZGA 1PV4A 4DV5L 1CSPA 5IYBH 5LMUL 4JI6Q 4UP8A 4BXXG 3H0GH 1N33Q 2YTXA 4OX9Q 3HOUH 1IL2A 3KJOA 1QZHA 1XMQQ 5GAHC 4P75A 4LFAL 4BY7H 4LF4Q 4AIMA 4NXML 1K8GA 4JI0L 1V43A 1N34Q 1I50H 4HJ8A 1LYLA 2JA6G 3S17H 3GTJH 1HNWQ 4LNQA 1E1OA 1KAWA 3GTPH 4LF9L 2F52A 3PO3H 4DK3C 3IRBA 4QIWE 1KC8C 1M90C 4B3MQ 3I4NH 3HFZB 5JEAJ 4A3DH 2D62A 2K75A 5FLXc 4DR4L 2Y0SE 4R4OA 4POFA 2BH2A 3B6YA 5K36G 3KDFB 4LF6Q 4WJ3M 2R92G 2YYZA 3GTGH 3HOYH 2CCZA 1U5KA 1TWCH 4LF8L 3M7NA 4JI5L 4GN5A 1SLJA 3I4OA 1OTCA 1HJPA 1BKBA 4DAMA 4A3MG 2GVAA 4R4TA 3I7FA 1XNRQ 3PIPA 1VQ9A 1JJGA 5JJIA 1NY4A 3J81i 4HJ5A 1NE3A 4AQYL 1HNZL 4NB3A 4GLVB 4YHHL 4PZ8A 4B3RL 4YCUA 5C4XH 3GO5A 1VQBA 2BH8A 5AJ3Q 4DV6L 1Q12A 1AE2A 3STBC 2ZJQA 1WCMH 1VQGA 3KF6A 3UE1A 3W1GA 4APVA 1Y1WG 3I55A 4LF5Q 5FJ8H 2A8VA 4A3GH 4WJ4A 1GVPA 1AE3A 3ER0A 3S1NH 4QL5A 4R4IA 3CCUA 2ZJRA 3M4PA 1Q86C 3T1YL 1PH7A 1OXTA 2GVBA 5IP9H 3I56A 1PH2A 3E9HA 4P74A 4JI4L 4POGA 3GTMH 1N36Q 1YNXA 2PQAB 3BU2A 4L5RC 2WP8J 2JA8H 1KRSA 4K0KL 3TREA 1Z47A 4XIGS 4A3FH 2ZM6L 4NPSA 1WI5A 2Q2TA 4UPAA 3PF5A 2UUBQ 2VY3A 4YY3Q 3JAMi 2RCNA 4AYBG 4HJ9A 4DR5L 1VQJA 1BVSA 2OQKA 1UE5A 3PIOA 1MJEA 3PSIA 4L5SA 4DV3Q 2JA6H 4DV4Q 4UP9A 4DR2L 1S72A 3J80i 5GAEC 1WFQA 2VQFL 4OO1I 3KF8B 3HKZE 2VZAA 1XMOQ 4GNXB 1B7YB 4GKKL 4X6AH 5FLMG 4DV2Q 1VQCA 4IPGA 1YZ6A 2ASBA 1VQNA 3AYHB 2R92H 1SMXA 2KBNA 1JJCB 4H02A 4JCVE 3S2HH 1YIJA 3HOUG 2V1CC 4MNOA 1C7YA 1Q82C 2QGQA 4ME3A 5JJKA 2OQ0A 2K50A 1VQ6A 4X65Q 3HOVG 3RZOH 1QVFA 3A74A 2IHFA 3UDIA 4A3MH 1PH3A 1IBKL 4BA2I 4IFDI 4JI1Q 4DUYQ 4C3JH 1K73C 2VUMG 2WB1E 3PO3G 3CAMA 5H1SE 2MO1A 2YTYA 1PH9A 4X64Q 3CCSA 4GOPB 1QUQA 3PGZA 3MXNB 1Q7YC 1PFSA 2Z6KC 4HJAA 2L15A 4JI8Q 3A5ZB 1YEZA 2HIVA 1HNXQ 1PH8A 2HHHL 4UY8C 3KJPA 4PZ6A 3CC7A 3F2CA 2K5NA 4YCVA 1VQDA 2CWAA 4LWCA 4UP7A 4DV0L 2OTJA 4IPCA 1V9PA 2NZHA 2F3IA 4DV5Q 3M9BA 3J81c 4OXPA 1D7QA 4JOIC 3OW2A 4OONA 5IWAL 3L7ZC 1TWGH 3TQYA 3K80C 5IE8A 3Q8DA 3M85A 3CMEA 1I5FA 3EIVA 2XGTA 1A8VA 1QVCA 5JJLA 1UE6A 4OWWB 4OO1G 1A0IA 2AWOA 1XPRA 3CQZH 3G48A 1YJWA 2UUAL 3JC66 2A1AA 4LF7Q 4A3CG 2BA1A 1GD7A 1C0AA 1UE7A 4OWTB 1CSQA 4JI2Q 1VQOA 3ICEA 2KHJA 1PH1A 1KXLA 1SRUA 3K8AA 4RMFA 3OTOL 2YTVA 2CWPA 3RLNA 4NXNL 4Y52H 2E5LQ 2JA5G 4JI5Q 2UXCQ 3KYHC 2ATWA 5J3BA 2R7ZH 4IFDG 1MKHA 1VQLA 3HOVH 3AQQA 3PUYA 1YJ9A 4JI3L 2LSSA 4AQYQ 2E2JH 1SE8A 1X3FA 3J80c 2VUMH 4GNXC 1HZ9A 1BBWA 1XPUA 1HZBA 4IJLA 4LUOA 3HOXH 1A62A 2EXDA 4DNIA 4B3TL 3KFUA 1L1OB 1IBLL 1VQKA 4JYAL 3S1MH 2C35B 4TVAB 3T1YQ 4LFCQ 4DUZQ 4JI4Q 3U50C 1SFOH 1M1KC 3KLWA 1TWFH 2UXDL 2F4VL 1SN8A 2IX0A 3T1HQ 3EN2A 1FJGQ 3PO2G 1N8RC 2I0QA 4DR7L 4X66L 4K0KQ 1YBYA 1X3EA 3HKSA 2E2HH 4DR6L 3PCOB 4DR3L 5EAYA 4GOPC 3NEMA 3CCJA 3PF4A 1TXYA 4DR5Q 3TRZA 2LXJA 2N3SA 1CKNA 3W5OA 4DR1L 4A3IG 3CP0A 4P72A 3LGJA 5E7NA 1X9NA 3CC4A 1Q46A 5JEAG 4DPGA 1XNQQ 2WFWA 2IY5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ5 A;  1KHI A;  2NZO A;  2K5V A;  4RG1 A;  5LMN Q;  3GTK H;  1OXV A;  4HID A;  4JV5 L;  4JI6 L;  4A3C H;  4A75 A;  2JE6 I;  1N33 L;  5GRO A;  4OX9 L;  2R7F A;  4A3E G;  4BBR G;  2VQE L;  1JMC A;  1XMQ L;  2EIF A;  2JK8 A;  1K83 H;  1E7Z A;  2B29 A;  1EFW A;  1C9O A;  1YI2 A;  1PHJ A;  3AEV A;  1XTD A;  1VQH A;  4QJF A;  1NTG A;  1N34 L;  2JA5 H;  4BBS G;  1L2F A;  4LFB Q;  3CCM A;  2MNA A;  2EQS A;  3CXC A;  2AHO B;  4PZ7 A;  4TQU S;  5LMN W;  1J5E Q;  3CCE A;  4MZ9 A;  2NVX H;  4B3S L;  3I4M H;  4Y7N H;  2AKW B;  3CD6 A;  1T9H A;  4QGU A;  1TWA H;  4X62 Q;  3J81 j;  3BZC A;  4LF6 L;  1RL2 A;  3FHW A;  4YWM A;  1VQE A;  4YWK A;  3D31 A;  3KOJ A;  4GS3 A;  1JT8 A;  2ES2 A;  4A4I A;  5GAD C;  2MO0 A;  3AFQ A;  2N78 A;  1PH5 A;  2VL6 A;  3F2B A;  4GN3 B;  2HHH Q;  2PI2 A;  4BY1 G;  1BBU A;  5DLQ E;  5C0X J;  3FKI H;  2UUC Q;  4JI7 Q;  3TS2 A;  4C2M H;  1B70 B;  4PG3 A;  1P16 A;  1XNR L;  1X65 A;  1O7I A;  1FVI A;  2ALY B;  4DK6 C;  4GKJ L;  3CPF A;  2R7Z G;  1IBM Q;  1I94 Q;  3PO2 H;  2D0P A;  4AYB E;  1KQS A;  2JEB I;  2DUD A;  2ZTD A;  5IYD G;  4HJ7 A;  5AJ3 L;  1H95 A;  4IPH A;  5ELO A;  1HZC A;  1YHQ A;  1EIY B;  1L1O C;  4DV1 Q;  3EBE A;  4KHP L;  3KF6 B;  1V1Q A;  3HOX G;  4A3I H;  2UU9 L;  4YCW A;  4FDB A;  5M5Y H;  1CKM A;  3UDG A;  1W2B A;  3PUZ A;  1G29 1;  1UWV A;  3L0O A;  4DV7 Q;  1VQ8 A;  4A3K G;  1Y1V G;  2UUA Q;  3D0F A;  5BR8 Q;  3ULP A;  2NN6 I;  3ULL A;  1E24 A;  1YIT A;  2UUB L;  5GAG C;  4YY3 L;  5IT9 c;  1I6H H;  2QEX A;  2Q2U A;  4A3E H;  2YV5 A;  1HZA A;  1YVC A;  5HY6 A;  4BBR H;  3U58 A;  3DM3 A;  1VQP A;  1AH9 A;  5LMU Q;  2RHS B;  2PNH A;  1VQ7 A;  1KD1 C;  3F1Z A;  2ZTC A;  3AFP A;  4R4Q A;  4DV4 L;  4BBS H;  1ASZ A;  3S15 H;  1IXR A;  4JBK A;  4A93 G;  3NEL A;  1E22 A;  4AH6 A;  1TWH H;  4A76 A;  4NXM Q;  3PUV A;  3WWV A;  4P73 A;  1KIX A;  4JI0 Q;  1NMG A;  4JC0 A;  2ID0 A;  1XMO L;  2KEN A;  4OWX B;  4R1J A;  1OXU A;  2K52 A;  2RF4 A;  2I5M X;  2MFI A;  4LF9 Q;  3RR5 A;  1MIU A;  3H3V I;  1N32 L;  3KDF A;  3G71 A;  4B3T Q;  4JYA Q;  3NBH B;  1PH4 A;  2Z6K A;  4DR4 Q;  5IY0 A;  3HOW G;  1E1T A;  4EQ5 A;  3RLF A;  4BY1 H;  1FL0 A;  4O0A A;  4YWL A;  2B63 G;  1YJN A;  2F4V Q;  3UE0 A;  4LF8 Q;  4P71 A;  1NBW A;  4DKA C;  4JI1 L;  4X66 Q;  4DUY L;  2PMZ E;  1S40 A;  1QVG A;  1WOC A;  1B8A A;  3I4M G;  4DR6 Q;  4X64 L;  3HOZ G;  4LW1 A;  1U0L A;  5IYD H;  4JOI A;  5C44 G;  1LUZ A;  3GD7 A;  3ULJ A;  5M3M G;  3H15 A;  4GLA C;  1HNZ Q;  1X3G A;  4DR1 Q;  1QUQ B;  4YHH Q;  3CCQ A;  4B3R Q;  1GKH A;  4DV6 Q;  4JBJ A;  3STB D;  1IYJ B;  3NEN A;  1ASY A;  2BA0 A;  4IOA A;  3VDY A;  2IX1 A;  2HIX A;  4A3B G;  2PQA A;  3S1R H;  3W1B A;  2HT1 A;  3FKI G;  4KHZ A;  2NN6 G;  4LFA Q;  3TEH B;  3U4Z A;  2GN5 A;  1VQM A;  5IYC G;  2XTI A;  3L2P A;  1D8L A;  4JV5 Q;  4A3K H;  1Y1V H;  4IO9 A;  2H5X A;  3BJU A;  2UXB L;  1Z9F A;  3G4S A;  1HR0 L;  2VQE Q;  5IP7 H;  1MJC A;  1Q8K A;  2VS1 A;  2DGY A;  2K4K A;  2ZM6 Q;  1L0W A;  4DAY B;  1RIP A;  3BZK A;  4L5T A;  3S1Q H;  1EUJ A;  1WYD A;  3UDX A;  3RZD H;  3RLO A;  4GLX A;  2FXQ A;  1YHB A;  4C3I H;  4A93 H;  4O2D A;  4B3S Q;  3K0X A;  4A3L G;  5C3E G;  4C3H H;  3ZJY C;  4EX5 A;  3J7Z C;  1PA6 A;  4LF7 L;  5HGQ A;  5M3F H;  4DR2 Q;  4JI2 L;  4GNX A;  3E0E A;  1VS0 A;  2R93 G;  1VQI A;  2VQF Q;  2JJQ A;  3S24 A;  4KI0 A;  2IT1 A;  3F2D A;  2NVY H;  4IJH A;  1KRT A;  5C0X I;  2E5L L;  4GKK Q;  1PVO A;  1GM5 A;  2UXC L;  3HOW H;  3CW2 C;  4QY7 A;  3PUX A;  4HIK A;  3J7A 5;  1EOV A;  2R7D A;  3RN5 A;  3TS0 A;  2B63 H;  4LF4 L;  1NMF A;  4JBM A;  4GKJ Q;  3K7A H;  3CCV A;  1JB7 A;  4LUV A;  2A19 A;  2KHI A;  1Y14 B;  1HNW L;  3A0J A;  4IOC A;  2Q2I A;  2PI2 E;  4A3J G;  1IBK Q;  3CPW A;  1X6O A;  2K14 A;  4MTN A;  2CKZ B;  3DLL A;  4GOP A;  2AWN A;  4B3M L;  3HOZ H;  5C44 H;  5M3M H;  4KHP Q;  1SRO A;  1PYS B;  1Q81 C;  4LFC L;  1K0R A;  4DUZ L;  2UU9 Q;  3S16 H;  4L5Q A;  3HKZ G;  1VQF A;  2WAQ G;  2JA7 G;  2N8N A;  4BA1 I;  1E3P A;  3CC2 A;  3S2D H;  3T1H L;  3I2Z A;  1Q1B A;  1FJG L;  3GDE A;  2OWO A;  2K5H A;  2ZJP A;  4A3B H;  3ERS X;  1S3O A;  4XTC S;  1X54 A;  1HH2 P;  3G6E A;  5IYC H;  1EQR A;  1X56 A;  4HIM A;  4BXX H;  1PYB A;  2JQO A;  3CF5 A;  4DV0 Q;  3E9I A;  1CKO A;  3CCR A;  1XPO A;  3M4O H;  2KCM A;  4PMW A;  1CKN B;  2WB1 G;  1LM0 A;  4LF5 L;  2OCE A;  1I3Q H;  1JJ2 A;  5IWA Q;  1XNQ L;  3S14 H;  2JEA I;  1K8A C;  1UE1 A;  2AMC B;  3A5U A;  5ELN A;  5LMN L;  1X55 A;  1PH6 A;  1J6Q A;  2WAQ E;  5C3E H;  4R4C A;  4A3L H;  1N36 L;  3H3V H;  1EYG A;  1N32 Q;  2KCT A;  5C0X G;  1G51 A;  4LUZ A;  5IYB G;  2R93 H;  2E8G A;  3GTQ H;  3H0G G;  2Q2H A;  2HQL A;  3U4V A;  1G6P A;  4HIO A;  2NVT H;  5IP7 G;  2R6G A;  4JBW A;  3PV0 A;  2ZTE A;  4LFB L;  4QQB X;  5GQO A;  3OTO Q;  4BY7 G;  1DGS A;  2JA9 A;  4NXN Q;  1J5E L;  2D0O A;  1IZ6 A;  3CMA A;  4DV3 L;  1N9W A;  3K81 C;  2QA4 A;  4J15 A;  4X62 L;  3I4N G;  1JE5 A;  3M4Q A;  3UDF A;  1UEB A;  2OTL A;  4JI3 Q;  3GTO H;  4A3J H;  4A3D G;  1WJJ A;  1Y1W H;  1LTL A;  1KL9 A;  5M3F G;  1L1O A;  4IPD A;  4KLK A;  1EWI A;  3PUW A;  4DV2 L;  3MEF A;  2UUC L;  2YU9 H;  1P8L A;  5M5W H;  3HOY G;  1FGU A;  1GO3 E;  2CFM A;  4ALP A;  4JI7 L;  1IBL Q;  1VQA A;  4GN4 B;  1K9M C;  2JA7 H;  3CCL A;  1CUK A;  1K3R A;  1A63 A;  1IBM L;  1Q1E A;  1I94 L;  2UXB Q;  4X65 L;  2UXD Q;  1HR0 Q;  5C4J H;  1W3S A;  2I5H A;  3RN2 A;  2E2I H;  2Z0S A;  2I5L X;  4DR7 Q;  4IFD J;  3GTL H;  2VW9 A;  4DV1 L;  5C4X G;  3K7U C;  1XJV A;  3M3Y H;  2N49 A;  4DR3 Q;  1WCM G;  1NJI C;  1YHA A;  4JG2 A;  2CQO A;  1VQ4 A;  2NVQ H;  5FJ8 G;  4A3G G;  2IHE A;  2MQH A;  5M5X H;  4DV7 L;  5IP9 G;  4JI8 L;  1HNX L;  1EIF A;  2VNU D;  5BR8 L;  2Y0S G;  1VCI A;  1EQQ A;  1HR0 W;  1SR3 A;  3F8T A;  2JA8 G;  3RNU A;  3SGI A;  5FLM H;  1R9T H;  4A3F G;  2RHQ B;  1OXS C;  3FP9 A;  3OYY A;  3JAM c;  2B3G A;  2LXK A;  1OXX K;  1QZG A;  1PV4 A;  4DV5 L;  1CSP A;  5IYB H;  5LMU L;  4JI6 Q;  4UP8 A;  4BXX G;  3H0G H;  1N33 Q;  2YTX A;  4OX9 Q;  3HOU H;  1IL2 A;  3KJO A;  1QZH A;  1XMQ Q;  5GAH C;  4P75 A;  4LFA L;  4BY7 H;  4LF4 Q;  4AIM A;  4NXM L;  1K8G A;  4JI0 L;  1V43 A;  1N34 Q;  1I50 H;  4HJ8 A;  1LYL A;  2JA6 G;  3S17 H;  3GTJ H;  1HNW Q;  4LNQ A;  1E1O A;  1KAW A;  3GTP H;  4LF9 L;  2F52 A;  3PO3 H;  4DK3 C;  3IRB A;  4QIW E;  1KC8 C;  1M90 C;  4B3M Q;  3I4N H;  3HFZ B;  5JEA J;  4A3D H;  2D62 A;  2K75 A;  5FLX c;  4DR4 L;  2Y0S E;  4R4O A;  4POF A;  2BH2 A;  3B6Y A;  5K36 G;  3KDF B;  4LF6 Q;  4WJ3 M;  2R92 G;  2YYZ A;  3GTG H;  3HOY H;  2CCZ A;  1U5K A;  1TWC H;  4LF8 L;  3M7N A;  4JI5 L;  4GN5 A;  1SLJ A;  3I4O A;  1OTC A;  1HJP A;  1BKB A;  4DAM A;  4A3M G;  2GVA A;  4R4T A;  3I7F A;  1XNR Q;  3PIP A;  1VQ9 A;  1JJG A;  5JJI A;  1NY4 A;  3J81 i;  4HJ5 A;  1NE3 A;  4AQY L;  1HNZ L;  4NB3 A;  4GLV B;  4YHH L;  4PZ8 A;  4B3R L;  4YCU A;  5C4X H;  3GO5 A;  1VQB A;  2BH8 A;  5AJ3 Q;  4DV6 L;  1Q12 A;  1AE2 A;  3STB C;  2ZJQ A;  1WCM H;  1VQG A;  3KF6 A;  3UE1 A;  3W1G A;  4APV A;  1Y1W G;  3I55 A;  4LF5 Q;  5FJ8 H;  2A8V A;  4A3G H;  4WJ4 A;  1GVP A;  1AE3 A;  3ER0 A;  3S1N H;  4QL5 A;  4R4I A;  3CCU A;  2ZJR A;  3M4P A;  1Q86 C;  3T1Y L;  1PH7 A;  1OXT A;  2GVB A;  5IP9 H;  3I56 A;  1PH2 A;  3E9H A;  4P74 A;  4JI4 L;  4POG A;  3GTM H;  1N36 Q;  1YNX A;  2PQA B;  3BU2 A;  4L5R C;  2WP8 J;  2JA8 H;  1KRS A;  4K0K L;  3TRE A;  1Z47 A;  4XIG S;  4A3F H;  2ZM6 L;  4NPS A;  1WI5 A;  2Q2T A;  4UPA A;  3PF5 A;  2UUB Q;  2VY3 A;  4YY3 Q;  3JAM i;  2RCN A;  4AYB G;  4HJ9 A;  4DR5 L;  1VQJ A;  1BVS A;  2OQK A;  1UE5 A;  3PIO A;  1MJE A;  3PSI A;  4L5S A;  4DV3 Q;  2JA6 H;  4DV4 Q;  4UP9 A;  4DR2 L;  1S72 A;  3J80 i;  5GAE C;  1WFQ A;  2VQF L;  4OO1 I;  3KF8 B;  3HKZ E;  2VZA A;  1XMO Q;  4GNX B;  1B7Y B;  4GKK L;  4X6A H;  5FLM G;  4DV2 Q;  1VQC A;  4IPG A;  1YZ6 A;  2ASB A;  1VQN A;  3AYH B;  2R92 H;  1SMX A;  2KBN A;  1JJC B;  4H02 A;  4JCV E;  3S2H H;  1YIJ A;  3HOU G;  2V1C C;  4MNO A;  1C7Y A;  1Q82 C;  2QGQ A;  4ME3 A;  5JJK A;  2OQ0 A;  2K50 A;  1VQ6 A;  4X65 Q;  3HOV G;  3RZO H;  1QVF A;  3A74 A;  2IHF A;  3UDI A;  4A3M H;  1PH3 A;  1IBK L;  4BA2 I;  4IFD I;  4JI1 Q;  4DUY Q;  4C3J H;  1K73 C;  2VUM G;  2WB1 E;  3PO3 G;  3CAM A;  5H1S E;  2MO1 A;  2YTY A;  1PH9 A;  4X64 Q;  3CCS A;  4GOP B;  1QUQ A;  3PGZ A;  3MXN B;  1Q7Y C;  1PFS A;  2Z6K C;  4HJA A;  2L15 A;  4JI8 Q;  3A5Z B;  1YEZ A;  2HIV A;  1HNX Q;  1PH8 A;  2HHH L;  4UY8 C;  3KJP A;  4PZ6 A;  3CC7 A;  3F2C A;  2K5N A;  4YCV A;  1VQD A;  2CWA A;  4LWC A;  4UP7 A;  4DV0 L;  2OTJ A;  4IPC A;  1V9P A;  2NZH A;  2F3I A;  4DV5 Q;  3M9B A;  3J81 c;  4OXP A;  1D7Q A;  4JOI C;  3OW2 A;  4OON A;  5IWA L;  3L7Z C;  1TWG H;  3TQY A;  3K80 C;  5IE8 A;  3Q8D A;  3M85 A;  3CME A;  1I5F A;  3EIV A;  2XGT A;  1A8V A;  1QVC A;  5JJL A;  1UE6 A;  4OWW B;  4OO1 G;  1A0I A;  2AWO A;  1XPR A;  3CQZ H;  3G48 A;  1YJW A;  2UUA L;  3JC6 6;  2A1A A;  4LF7 Q;  4A3C G;  2BA1 A;  1GD7 A;  1C0A A;  1UE7 A;  4OWT B;  1CSQ A;  4JI2 Q;  1VQO A;  3ICE A;  2KHJ A;  1PH1 A;  1KXL A;  1SRU A;  3K8A A;  4RMF A;  3OTO L;  2YTV A;  2CWP A;  3RLN A;  4NXN L;  4Y52 H;  2E5L Q;  2JA5 G;  4JI5 Q;  2UXC Q;  3KYH C;  2ATW A;  5J3B A;  2R7Z H;  4IFD G;  1MKH A;  1VQL A;  3HOV H;  3AQQ A;  3PUY A;  1YJ9 A;  4JI3 L;  2LSS A;  4AQY Q;  2E2J H;  1SE8 A;  1X3F A;  3J80 c;  2VUM H;  4GNX C;  1HZ9 A;  1BBW A;  1XPU A;  1HZB A;  4IJL A;  4LUO A;  3HOX H;  1A62 A;  2EXD A;  4DNI A;  4B3T L;  3KFU A;  1L1O B;  1IBL L;  1VQK A;  4JYA L;  3S1M H;  2C35 B;  4TVA B;  3T1Y Q;  4LFC Q;  4DUZ Q;  4JI4 Q;  3U50 C;  1SFO H;  1M1K C;  3KLW A;  1TWF H;  2UXD L;  2F4V L;  1SN8 A;  2IX0 A;  3T1H Q;  3EN2 A;  1FJG Q;  3PO2 G;  1N8R C;  2I0Q A;  4DR7 L;  4X66 L;  4K0K Q;  1YBY A;  1X3E A;  3HKS A;  2E2H H;  4DR6 L;  3PCO B;  4DR3 L;  5EAY A;  4GOP C;  3NEM A;  3CCJ A;  3PF4 A;  1TXY A;  4DR5 Q;  3TRZ A;  2LXJ A;  2N3S A;  1CKN A;  3W5O A;  4DR1 L;  4A3I G;  3CP0 A;  4P72 A;  3LGJ A;  5E7N A;  1X9N A;  3CC4 A;  1Q46 A;  5JEA G;  4DPG A;  1XNQ Q;  2WFW A;  2IY5 B; 
#chains in the Genus database with same CATH topology
 2F0W A;  2N88 A;  2K5V A;  1EYC A;  4RG1 A;  3PO3 B;  4HID A;  4ZKC B;  3SEB A;  2WII B;  3P75 A;  1WTQ A;  1HPC A;  4OX9 L;  4A3D B;  1X3Q A;  3TP8 A;  1JMC A;  1XMQ L;  2XVS A;  5EKI A;  2B29 A;  4MIU A;  1EFW A;  1K8O A;  2RSO A;  3GTG B;  1IYV A;  2D2C C;  1XTD A;  1VQH A;  1N34 L;  3X3M A;  3CCM A;  4IAL A;  4DA2 A;  2EQS A;  1SEB D;  4IFD H;  4PZ7 A;  4TQU S;  2NVX H;  3CCE A;  4B3S L;  3NK9 A;  1A3T A;  4C56 C;  1FYC A;  3CD6 A;  4QGU A;  4KY6 A;  3KOJ A;  1JT8 A;  4YIJ A;  2N78 A;  2FMC A;  3F2B A;  1D5M C;  1WCM B;  2HHH Q;  5C0X J;  3FKI H;  4JI7 Q;  3HP3 A;  4DK6 C;  1IBM Q;  1SYC A;  2JA8 B;  5IYD G;  2LKV A;  4H44 C;  5AJ3 L;  3D4W A;  5ELO A;  1TS3 A;  1EIY B;  3ERQ A;  4DV1 Q;  2TSS A;  3EBE A;  1SJE D;  3KF6 B;  1G2S A;  1HA5 A;  4A3I H;  2UU9 L;  2F0P A;  2ENB A;  1W2B A;  2NVX B;  1KNA A;  5EKL A;  1G29 1;  5JEA H;  1C48 A;  1PTO H;  2NYZ D;  2E75 C;  3BDC A;  5GAG C;  3OHX C;  2YV5 A;  4BBR H;  1ONL A;  2R92 B;  1GJX A;  3AFP A;  3S2H B;  4BBS H;  2A69 D;  4C3I G;  4A93 G;  3SE0 A;  1SMY D;  1TWH H;  4P73 A;  3CRK C;  3RZO B;  3K59 A;  2MFI A;  3D3R A;  3H3V I;  4B3T Q;  3G71 A;  1YNJ D;  2F3W A;  4HTH A;  4EQ5 A;  3HOW G;  3C2P A;  1RTO A;  2K1B A;  2DY7 A;  2PPB C;  3H09 A;  4KJO A;  1NBW A;  4PV1 C;  4DKA C;  5I2Y A;  1E2Z A;  1BQQ T;  1S40 A;  4DR6 Q;  4HN7 A;  4X64 L;  4Q5V A;  3ULJ A;  1HNZ Q;  4GLA C;  3QJY A;  4JBJ A;  3STB D;  3NEN A;  4P2C B;  1TWH B;  3VDY A;  4OEM B;  2HT1 A;  2NN6 G;  4ZK9 B;  5IYC G;  4JV5 Q;  3DUZ A;  4IO9 A;  1AW7 A;  1PRT B;  3CQZ B;  2KCN A;  3VYT A;  4LAA A;  2B2U C;  3M7G A;  1NUC A;  2DGY A;  1I6V C;  3K5L A;  2ZM6 Q;  1L0W A;  4DAY B;  3LX0 A;  1WYD A;  1STG A;  3D6W A;  1DM0 B;  2FXQ A;  4GLX A;  1EYD A;  1PMR A;  2JP1 A;  3K0X A;  4A3L G;  5LL6 S;  4C3H H;  3ZJY C;  3J7Z C;  4LF7 L;  1PLF A;  3KF8 A;  4DR2 Q;  3BYY B;  2VQF Q;  4KI0 A;  4GKK Q;  1W6K A;  2UXC L;  4OHJ A;  3PUX A;  5IGD A;  2VB2 X;  3TN2 A;  1DZ1 A;  4LF4 L;  1CT1 D;  1S5F D;  2XNA C;  1CZW A;  2B2Y A;  5KEE A;  1Y14 B;  3I91 A;  4L6T B;  5ELE A;  4HR7 B;  3J80 L;  2Q2I A;  2PI2 E;  5IGF A;  4B3M L;  3HOZ H;  2CKZ B;  4CJ2 C;  3MXN A;  1SRO A;  4LFC L;  2BE5 C;  3N52 A;  1VQF A;  5DM7 3;  2JA7 G;  3CC2 A;  1IHZ A;  1I4G A;  1FJG L;  4L63 B;  1VMC A;  3MVV A;  4XTC S;  1CI3 M;  1X54 A;  4HIM A;  1PYB A;  3CF5 A;  4IUQ A;  1XX8 A;  5ISR A;  1SJH D;  3VR3 A;  1XPO A;  2EE1 A;  2KCM A;  1V8Q A;  3M4O H;  1I3Q H;  5IWA Q;  4KY5 A;  2JEA I;  1UE1 A;  1SE2 A;  3A5U A;  1X55 A;  2K5W A;  1R4Q B;  1O7L A;  2WAQ E;  5C3E H;  4R4C A;  3I4M B;  2AQ2 B;  4J6H A;  1K3B C;  3OOC A;  4LUZ A;  2E8G A;  2Q2H A;  2HQL A;  1ICW A;  1G6P A;  3I90 A;  4K6D A;  5IP7 G;  2A6E D;  2NVT H;  2ZTE A;  1E0B A;  2F0N A;  3BDL A;  4DV3 L;  1N9W A;  3PQI A;  4F88 A;  1MHW C;  3K6O A;  2EYH A;  2Z6B A;  3BVM A;  4XT3 B;  3CU7 A;  5KYI A;  3VA7 A;  3I4N G;  1JE5 A;  2IL8 A;  3UDF A;  4A3D G;  2F0M A;  5M3F G;  4IPD A;  1CA6 A;  5KND A;  1SYE A;  2OF1 A;  3F2U A;  1I3Q B;  4I7Z C;  5M5W H;  1FGU A;  1GO3 E;  2CFM A;  5IIF A;  4KD4 A;  1IBL Q;  3C1F A;  1IL8 A;  4GN4 B;  3H6M A;  1VDZ A;  1K9M C;  1KLG D;  1CFM A;  1A63 A;  1I94 L;  2FHT A;  4X3K A;  4K5W A;  1TU2 B;  3VYU A;  2E2I H;  2I5H A;  2I5L X;  2NVT B;  3K7U C;  1LO5 D;  1NSN S;  4OIK A;  1WCM G;  4DR3 Q;  1NJI C;  2NVQ H;  5FJ8 G;  2SEB D;  4K8J A;  2NB0 A;  4DV7 L;  4JI8 L;  2F0J A;  3E6Z X;  4FO2 A;  2DJF C;  2F0T A;  2JA8 G;  2HDL A;  4OEL B;  2RHQ B;  3JAM c;  1CA5 A;  5M5W B;  5IYB H;  2YTX A;  4OX9 Q;  3HOU H;  1ILQ A;  1SYG A;  2JXM B;  3P1H A;  2Q8T A;  3KJO A;  4IUV A;  1XMQ Q;  1QZH A;  1IL2 A;  2A69 C;  1SMY C;  3BVZ A;  4AIM A;  1N34 Q;  1ZXT A;  3GTJ H;  2K7V A;  1O7Z A;  4PQX A;  3KLR A;  4LF9 L;  1HRJ A;  3HFZ B;  4DNR B;  2D62 A;  2PZU A;  2BOS A;  2B2W C;  2R92 G;  2F0O A;  2QF7 A;  1SYF A;  3HOY H;  1FNV A;  4LF8 L;  2HCC A;  5E1F A;  1OTC A;  1BKB A;  5COY A;  3H91 A;  2A5H A;  1D2B A;  5EBD A;  4RH6 A;  4DNT B;  1T5X D;  4YHH L;  5C4X H;  1DOL A;  4KKT A;  4DV6 L;  5AJ3 Q;  1F9R A;  3STB C;  5J39 A;  3UE1 A;  4LF5 Q;  2A8V A;  4EQN A;  2Z9H A;  4ME5 A;  1GVP A;  3R3O A;  1NR2 A;  3VR6 A;  3S1N H;  3MFG A;  4R4I A;  5G3L F;  3T1Y L;  4LFA L;  5IP9 H;  1PZI D;  4JI4 L;  4P74 A;  2SNM A;  2JSO A;  1N36 Q;  3EQL C;  1A2U A;  1BF4 A;  3G6J B;  4XIG S;  2F0H A;  2B2T A;  3HOY B;  1B3Q A;  1HTP A;  3ITP A;  2XWB B;  4QF4 A;  2NVY B;  4DR5 L;  1VQJ A;  1BVS A;  5CV9 A;  4L5S A;  2CW0 D;  4H7B A;  1STN A;  4DK1 A;  1J8I A;  3ERO A;  2JA6 H;  1B50 A;  1LT3 D;  3C1E A;  1LTG D;  1H9S A;  3KF8 B;  4N8X 1;  4DV2 Q;  4XDX A;  2ASB A;  3MHB A;  1VQN A;  5M3M B;  4IZ8 A;  1SMX A;  3A8J E;  1D6E C;  3I3C A;  2V1C C;  4MNO A;  1F77 A;  2QGQ A;  3S2D B;  4A3B B;  3A74 A;  2IHF A;  3UDI A;  5CV5 A;  2C9O A;  4A3M H;  2QEJ C;  1WTV A;  1IBK L;  4BA2 I;  4IFD I;  2MO1 A;  2YTY A;  2G9H D;  1EY4 A;  4X64 Q;  4K5X A;  2KUM A;  3W3A A;  3MXN B;  1ROD A;  2Z6K C;  2M00 A;  1DJR D;  1PFN A;  4ODG A;  2L15 A;  2JA6 B;  2HHH L;  4CHT B;  3HRZ C;  3GV6 A;  3KJP A;  1HCZ A;  3V96 A;  3S9W A;  2K5N A;  2K01 A;  1XXG A;  2SOB A;  4UP7 A;  4DV0 L;  1V9P A;  2NZH A;  4DV5 Q;  1PTO F;  4HMI A;  4OXP A;  3HG9 A;  4FP5 D;  4JOI C;  5T1G A;  4CDE C;  3OW2 A;  1TWG H;  3TQY A;  3Q8D A;  2XGT A;  4A3M B;  1A8V A;  1MI2 A;  1UE6 A;  4OO1 G;  4ZYS A;  2AWO A;  2J4X A;  2L12 A;  1S4Z A;  4LF7 Q;  1SNP A;  4A3C G;  1GD7 A;  2EJF C;  3GTO B;  4A3J B;  1Y1W B;  2A6E C;  3PMF A;  5IT9 L;  1SRU A;  4RMF A;  1Q8I A;  4JI5 Q;  2UXC Q;  2RKS A;  1SE4 A;  3KBX A;  1CHQ D;  1MKH A;  1VQL A;  4EVO A;  1SE8 A;  2ZXP A;  5C4J B;  2VUM H;  4ID6 A;  1GUO A;  4IJL A;  3GTL B;  4LUO A;  4B3T L;  3KFU A;  1DOK A;  4LFC Q;  1SFO H;  2J7Z A;  2PO4 A;  2RDG A;  2N55 A;  5E3F A;  3EN2 A;  1NR4 A;  1FJG Q;  2I0Q A;  4DR7 L;  1YBY A;  1X3E A;  3O13 A;  2E2H H;  4DR6 L;  4ZUJ A;  1QNU A;  4GOP C;  3NEM A;  4Q0F A;  3H0G B;  5NUC A;  1ENC A;  1BCP D;  3CC4 A;  1B44 D;  1NAP A;  2KEE A;  1Q46 A;  4DPG A;  1I50 B;  1VQ5 A;  5JVH 3;  3IL8 A;  1OXV A;  4JV5 L;  4A75 A;  4A3E G;  1A2T A;  3OWF A;  1DD2 A;  1E7Z A;  1SNQ A;  1C9O A;  1PHJ A;  4QJF A;  1NTG A;  1TWC B;  3A7L A;  1HFN A;  1LTA D;  1SAP A;  2H4O A;  2AHO B;  4MZ9 A;  2AKW B;  4FXD A;  1TWA H;  4M1U B;  4RWS C;  4DFA A;  3J81 j;  2EPB A;  1RL2 A;  3LWE A;  3N6R A;  1PH5 A;  4GN3 B;  4BY1 G;  1BBU A;  5DLQ E;  5EPJ A;  1CM9 A;  1Z7T A;  4PG3 A;  1XNR L;  1O7I A;  2ALY B;  3CPF A;  1I94 Q;  3PO2 H;  2D0P A;  3VR4 A;  2ZTD A;  1MSG A;  2R61 A;  1SNO A;  1H95 A;  2CHB D;  1YHQ A;  1QJO A;  3KBG A;  4KK7 A;  3HOX G;  1EWC A;  3FRP B;  4HED A;  4YCW A;  4FDB A;  5M5Y H;  1CKM A;  3PUZ A;  1V1P A;  2FFK B;  4DV7 Q;  1TWA B;  4A3K G;  2EY2 A;  2ZXO A;  3D0F A;  3ULL A;  1E24 A;  5IT9 E;  3T13 A;  1I6H H;  3R2I A;  1YVC A;  5HY6 A;  4IUU A;  2PNH A;  2CW0 C;  2HUG A;  2JYO A;  3F1Z A;  2ZTC A;  1KD1 C;  1A6X A;  4R4Q A;  4HCE A;  3S15 H;  1IXR A;  1BO0 A;  1PYW D;  5JPM C;  3PO2 B;  3PUV A;  3WWV A;  3R93 A;  1KIX A;  2BDN A;  3TP7 A;  5EGT A;  1NMG A;  1SYD A;  4R1J A;  2K52 A;  4LF9 Q;  3RR5 A;  3SHL A;  1H9S B;  3KDF A;  1FNW A;  4KV6 A;  1E1T A;  3TME A;  1FD7 D;  3AMU A;  1RF2 D;  1YJN A;  4LF8 Q;  4WOR A;  1BXT A;  4IUP A;  4P71 A;  2EVB A;  5LL6 X;  2EYL A;  1QVG A;  2PZT A;  1FGB D;  1RD9 D;  1KLU D;  4LW1 A;  4U68 A;  1LUZ A;  5M3M G;  3H15 A;  1X3G A;  4DR1 Q;  4YHH Q;  3J7A V;  1Q3L A;  1GKH A;  2F0Q A;  4DV6 Q;  2ZXR A;  4AYB B;  4DAV A;  1PDQ A;  3RD4 A;  2BA0 A;  4IOA A;  4WJW A;  4A3B G;  2NTT A;  3C46 A;  1CQV A;  3DEO A;  4KHZ A;  4LFA Q;  3TEH B;  1U4M A;  1CZG A;  2DNC A;  1Y1V H;  3BJU A;  3G4S A;  4J8Q A;  5IP7 H;  2NZ1 D;  2VS1 A;  4OIJ A;  2K4K A;  5C4H A;  3TDQ A;  2LS0 1;  1I4Q A;  1RIP A;  2O5I C;  1WTP A;  3RZD H;  4CGY B;  2R7Z B;  1LTR D;  2PYK A;  1MGS A;  4KTA A;  3HOV B;  1PA6 A;  1VF7 A;  5HGQ A;  2EZV A;  5M3F H;  2E2J B;  1VS0 A;  2R93 G;  1VQI A;  1JR0 D;  5C5M A;  2JJQ A;  3S24 A;  5EBC A;  3F2D A;  4IJH A;  1D5Z C;  3NSW A;  3CW2 C;  4QY7 A;  4B9X A;  5CGK A;  2R7D A;  3TS0 A;  2B63 H;  1JB7 A;  3A0J A;  1F2M A;  4BS9 A;  4A3J G;  1IBK Q;  1JWS D;  3DLL A;  2XN9 C;  5C44 H;  2MPM A;  3TZU A;  5FLX L;  4KHP Q;  1PYS B;  3A54 A;  2PMZ B;  3IKJ A;  1O78 A;  2WAQ G;  2N8N A;  1E3P A;  4WRD A;  3GDE A;  1WTW A;  2ZJP A;  3ERS X;  1S3O A;  2PNR C;  1HH2 P;  1U4R A;  2A68 D;  4DV0 Q;  3E9I A;  1BCP C;  2NBF A;  3CCR A;  4PMW A;  1I4P A;  4LF5 L;  2FJ2 A;  1JJ2 A;  1XNQ L;  1C4Q A;  5FO7 B;  2AMC B;  2AQ3 B;  3ND9 A;  5TSS A;  3MC0 B;  3K0Y A;  2B2V C;  1N36 L;  2AUJ D;  1EYG A;  3EA6 A;  2KCT A;  3SK8 A;  1X32 A;  1TY2 A;  1EY7 A;  1JB3 A;  3GTQ H;  3H0G G;  1ZYR D;  4TSS A;  4B9W A;  2A73 B;  2R6G A;  3PV0 A;  4QQB X;  4LFB L;  1JWM D;  2Z1C A;  1DGS A;  2JA9 A;  1J5E L;  1EY9 A;  2D0O A;  3FKI B;  3E0J A;  1SDF A;  4KJN A;  5C3W A;  5D3D A;  2RDH A;  4DK0 A;  3X3N A;  1ET6 A;  3R2T A;  4KLK A;  1EWI A;  3PUW A;  4DV2 L;  5K5P A;  4RHR A;  4KY7 A;  3Q22 A;  1STY A;  4A3I B;  5JAV A;  1EQV A;  3CCL A;  4NP5 A;  3EVQ A;  1A3U A;  2UXB Q;  1PTO B;  1W3S A;  3GTQ B;  5EKK A;  4DR7 Q;  3EFX D;  1XJV A;  3M3Y H;  2N49 A;  3NHH A;  4JG2 A;  4BBR B;  4A3G G;  1LT5 D;  2MQH A;  3OWE B;  2V4D A;  3HS0 C;  5M5X H;  2RBM A;  1ESF A;  1EIF A;  4J1M A;  4BBS B;  2QW7 A;  1V1P B;  1HR0 W;  1IW7 D;  1SR3 A;  4LK1 C;  1WTO A;  1R9T H;  2C5C A;  1OXS C;  3FP9 A;  4V19 0;  1OXX K;  5C0X H;  4DV5 L;  2BCO A;  3DMU A;  3J81 L;  4ILW A;  5M9O A;  5ELC A;  4BY7 H;  1K8G A;  1V43 A;  4HJ8 A;  1LYL A;  4ABN A;  4RGT A;  5IGB A;  2QCP X;  1XYI A;  1EY8 A;  4F8M A;  1Y8O B;  4LNQ A;  1E1O A;  1KAW A;  2RVL A;  3GTP H;  4DK3 C;  5FLX E;  2K75 A;  3A56 A;  3KDF B;  1UAP A;  2KA7 A;  3HGB A;  2PZW A;  3ND8 A;  2EJM A;  4JI5 L;  3I4O A;  2WKD A;  2EDG A;  4GZY C;  1R9T B;  3HEJ A;  4FF1 A;  3WOF A;  1F2L A;  4R4T A;  1XNR Q;  3PIP A;  5JJI A;  2B2U A;  2L4N A;  2Z4I A;  2CH4 A;  1FR3 A;  1SNC A;  4B3R L;  1AE2 A;  4APV A;  4WJ4 A;  3NWS A;  3NTK A;  2B39 A;  3ER0 A;  4IN3 A;  4QL5 A;  4CJ0 B;  4XQN A;  2ZJR A;  3BVG A;  1E2W A;  3GTP B;  1EEF D;  1RDP D;  4POG A;  1AP0 A;  3GTM H;  4RGN A;  2I46 A;  2F0U A;  3BG3 A;  4C3H B;  3TRE A;  1OO9 B;  4A3F H;  4NPS A;  3OMC A;  2Q2T A;  4UPA A;  2VY3 A;  3JAM i;  2LY7 A;  2RCN A;  4AYB G;  1ESR A;  4NMZ A;  1R4P B;  1RKN A;  1KDA A;  3FEW X;  3PIO A;  2FIN B;  1TS2 A;  2EY5 A;  1EY6 A;  1MSH A;  4L8J A;  4K14 A;  1VF5 C;  2VZA A;  3QIA A;  4CDF C;  3HOZ B;  2QIL A;  5K36 H;  3Q0A A;  1B1Z A;  2KBN A;  1JJC B;  2L55 A;  4H02 A;  4JCV E;  4QIW B;  2Y0S B;  1C7Y A;  1Q82 C;  4ME3 A;  5JJK A;  2K50 A;  4H13 C;  4X65 Q;  3HOV G;  2MHV A;  1QVF A;  1EU3 A;  1PH3 A;  1ET9 A;  4C3J H;  1K73 C;  4QMG A;  5EPK A;  3PO3 G;  5H1S E;  3NBI A;  1VMP A;  2EYF A;  1QUQ A;  1TY0 A;  5ELB A;  5DNF A;  4HJA A;  3M4O B;  1HNX Q;  1PH8 A;  3CC7 A;  1MD2 D;  4HSV A;  1F2Z A;  4YCV A;  1VQD A;  2A68 C;  4TKO B;  5C3E B;  2OTJ A;  4IPC A;  1ILP A;  3J81 E;  3M9B A;  3U9O A;  1YNN D;  4JPB W;  1QIL A;  2KEC A;  1CK1 A;  3L7Z C;  4CKC A;  5IE8 A;  2L11 A;  3CME A;  1I5F A;  1AEX A;  1WVL A;  3GQB A;  4OWW B;  5D65 A;  1G8Z D;  4G4K A;  3QR8 A;  2WAC A;  1E2V A;  1C0A A;  1UE7 A;  1ZYR C;  2SDF A;  1CSQ A;  3URY A;  1VQO A;  2KHJ A;  1KXL A;  1JWU D;  4BWG B;  4PMB A;  3OTO L;  1WTR A;  2KCC A;  3RLN A;  4NXN L;  4Y52 H;  3NTI A;  3KYH C;  2ATW A;  5J3B A;  1PFM A;  3K5O A;  1PZK D;  4IFD G;  3KUP A;  5I2X A;  5BN4 A;  3AQQ A;  3G7L A;  4JI3 L;  3VR5 A;  1JIC A;  5JJZ A;  3J80 E;  2E2I B;  3MTS A;  4GNX C;  3HOX H;  4I65 A;  1VQK A;  2IPK D;  4HAE A;  4TVA B;  2F0L A;  2H1E A;  2NVQ B;  3U50 C;  2QDL A;  1TWF H;  2UXD L;  4FF3 A;  3GP7 A;  1HFG A;  3PCO B;  1F9Q A;  1TXY A;  2E2D C;  2HD3 A;  4RHS A;  1X9N A;  4DR1 L;  4A3I G;  3HOU B;  3LGJ A;  4N9T A;  1K0S A;  5JEA G;  5C4Z A;  1XNQ Q;  2WFW A;  1IW7 C;  2RQX A;  3GTJ B;  2OEO A;  1TII D;  4JVZ A;  1N33 L;  5GRO A;  2R7F A;  4BBR G;  2L5T A;  2B2W A;  1K83 H;  5C5L A;  1YI2 A;  5CV7 A;  1TWF B;  4C1N I;  2JA5 H;  4BBS G;  4LFB Q;  2RA4 A;  3CXC A;  1J5E Q;  5LMN W;  1HA6 A;  4Y7N H;  2K5Q A;  1T9H A;  3FVQ A;  4LF6 L;  3FHW A;  4YWM A;  1VQE A;  2L0C A;  3D31 A;  4YWK A;  5C4X B;  4A4I A;  4RGM A;  5GAD C;  3BYT B;  2MO0 A;  4X3U A;  1RJT A;  3UI2 A;  1EY0 A;  4C2M H;  3S1N B;  3GV3 A;  1B70 B;  1KDB A;  5A35 A;  1P16 A;  1LTS D;  1X65 A;  5KIX A;  1FVI A;  1BNZ A;  4AYB E;  2JEB I;  4HJ7 A;  4OGQ C;  1HUN A;  4IPH A;  4K5V A;  2K6A A;  1L1O C;  1GOZ A;  3NPP A;  4KHP L;  4ZRZ A;  1V1Q A;  1A15 A;  1QWY A;  3NE5 B;  1UWV A;  5D14 A;  3L0O A;  1NCV A;  1VQ8 A;  2UUA Q;  4KN7 C;  5KRU A;  3ULP A;  1YIT A;  4R9W A;  2Q2U A;  1HZA A;  1VQP A;  1AH9 A;  2RHS B;  4RCN A;  1VQ7 A;  1ASZ A;  1GHJ A;  4JBK A;  4AH6 A;  4RFB A;  5JVG 3;  4C3H G;  1KDC A;  4JC0 A;  3MXG A;  3I70 A;  2RF4 A;  2JN4 A;  1S5B D;  3MA2 B;  1PH4 A;  1QE6 A;  2Z6K A;  2HDM A;  4RA8 A;  3T4A C;  3RLF A;  1FL0 A;  2IX3 A;  2X6G A;  4IQZ A;  4JI1 L;  1TVX A;  2PMZ E;  1WOC A;  3I4M G;  1TQO A;  1Y8P B;  3HOZ G;  5IYD H;  4JOI A;  2D5D A;  4DN4 M;  4PMC A;  1QUQ B;  3CCQ A;  4B3R Q;  3V05 A;  4ZAI A;  1RHP A;  2MJ8 A;  1TWG B;  4MTK A;  1ASY A;  2IX1 A;  2HIX A;  2G5D A;  1BUV T;  3FMC A;  5JJL A;  3U4Z A;  2GN5 A;  1EWH A;  3L2P A;  2XTI A;  2UXB L;  1D8L A;  1Z9F A;  2VQE Q;  1Q8K A;  1YNN C;  1FNU A;  1TS4 A;  3BZK A;  4L5T A;  3S1Q H;  1EUJ A;  3IAY A;  4FYD A;  3UDX A;  3RLO A;  1YHB A;  3NP8 A;  4C3I H;  2NTS A;  2KED A;  2QDB A;  4K2L A;  4MHE A;  4O2D A;  4A93 H;  1DON A;  5C3E G;  2CH4 W;  1SNM A;  2VUM B;  4KMU C;  2HCI A;  4X3T A;  3JAM L;  2EYO A;  2X6L A;  3VYS A;  1STH A;  1KRT A;  5C0X I;  1PVO A;  1GM5 A;  3HOW H;  2MP1 A;  5I4D A;  4HIK A;  1EQT A;  1SFO B;  1M8A A;  4GKJ Q;  3K7A H;  4LUV A;  1LT6 D;  2KHI A;  3NUC A;  4IOC A;  1KAB A;  1O7Y A;  1X6O A;  2K14 A;  4MTN A;  4GOP A;  2E2H B;  4ZUI A;  4DGZ A;  3CKI B;  1K0R A;  3S16 H;  1LTT D;  1HQM C;  3SK4 A;  4G7H C;  2NN6 H;  3G6E A;  5IYC H;  5KYL A;  2L1B A;  5FOB B;  2PQE A;  1CKO A;  1LM0 A;  1GUN A;  4FNF A;  2OCE A;  1WTH A;  3K7A B;  3S14 H;  1K8A C;  2OT2 A;  5LMN L;  1PH6 A;  4K8I A;  1EY5 A;  4RGO S;  2SNS A;  3T56 B;  4A3L H;  2E74 C;  4DXG A;  1PRT C;  1N32 Q;  5EPL A;  2WIN B;  1LLR D;  5IYB G;  4HCS A;  4F7X A;  3QOL A;  5DEH A;  1H9R A;  3U4V A;  1KTK A;  4HIO A;  3VA5 A;  4U67 3;  4JBW A;  2K33 A;  5LHY 1;  5GQO A;  3OTO Q;  4DAP A;  4NXN Q;  1IZ6 A;  2KJX A;  3CMA A;  1AZP A;  3D4R A;  4J15 A;  4FF2 A;  3R8B A;  4X62 L;  4NKL A;  1B3A A;  4IUN A;  1NNX A;  3M4Q A;  2OTL A;  1UEB A;  3I4L A;  4DU9 A;  4JI3 Q;  1WJJ A;  1LTL A;  1KL9 A;  2UUC L;  2YU9 H;  1P8L A;  3HOY G;  3VYR A;  3S14 B;  4ALP A;  4KHV A;  1VQA A;  2BDO A;  1SXT A;  2JA7 H;  2F0D A;  5M5Y B;  1K3R A;  2WKC A;  5CMD A;  4X65 L;  2UXD Q;  1HR0 Q;  1U9R A;  3SVM A;  3A55 A;  2F0G A;  4IFD J;  4S3S A;  2VW9 A;  3D8G A;  1I6H B;  5C4X G;  1LAB A;  4DXF A;  1BOS A;  2CQO A;  1DOM A;  2XRS D;  1BCP F;  4EQO A;  1GUW A;  1BR9 A;  5IP9 G;  1HNX L;  3DHQ A;  3S15 B;  4RKB A;  2D9U A;  2F1M A;  5BR8 L;  1EQQ A;  1B9N A;  3F8T A;  5I6Y A;  3SGI A;  2B8G A;  5DM6 3;  1PZJ D;  2B3G A;  2LXK A;  1PV4 A;  3OIP A;  2DJG C;  3BS1 A;  5LMU L;  4BXX G;  5L37 A;  1N33 Q;  2MUY A;  4E6I A;  1H9M A;  4G7O C;  1PFB A;  3WDN A;  4NXM L;  4JI0 L;  3S17 H;  2JA6 G;  1HNW Q;  3PO3 H;  1CQF A;  5I9O A;  3IRB A;  3L9A X;  4QIW E;  1M90 C;  3I4N H;  5JEA J;  4A3D H;  4DR4 L;  2Y0S E;  4R4O A;  4POF A;  2BH2 A;  3B6Y A;  3P7J A;  4LF6 Q;  2YYZ A;  3GTG H;  1U5K A;  1EIG A;  3M7N A;  3BZD B;  4GN5 A;  1HJP A;  5E4X A;  4A3M G;  2GVA A;  3I7F A;  1VQ9 A;  1JJG A;  4JK1 C;  1NY4 A;  1Y1V B;  4HJ5 A;  5FO8 B;  4KKS A;  4PZ8 A;  4YCU A;  3GO5 A;  1VQB A;  2BH8 A;  1Q12 A;  3NXW A;  1WCM H;  1Y1W G;  4NW2 A;  5FJ8 H;  4RKL A;  3K58 A;  1CTM A;  3TBI B;  4XQQ A;  5IGG A;  3CCU A;  3RZD B;  1EYA A;  1PH7 A;  1TR5 A;  3I56 A;  1PH2 A;  3E9H A;  1YNX A;  3I4N B;  1LTI D;  4L5R C;  3SDZ A;  2JA8 H;  3WOE A;  5M3F B;  4N9P A;  1WI5 A;  4XT1 B;  5BN3 A;  4QB4 A;  1STB A;  5IGC A;  1UE5 A;  5CBA E;  3PSI A;  5JPN C;  1MJE A;  1JOK A;  3QWN A;  1Y8N B;  2B63 B;  5GAE C;  1WFQ A;  5HGT A;  1HUM A;  1JQY D;  3NBH A;  3NQI A;  5FLM G;  4ZCK A;  5C44 B;  1DCZ A;  2R92 H;  2F0I A;  2MGS A;  1WD0 A;  3S2H H;  1YIJ A;  3H94 A;  4ZKB B;  3CHB D;  3TSS A;  2OQ0 A;  3RZO H;  2J0T D;  1I4X A;  1L0Y B;  4JI1 Q;  2VUM G;  2KOL A;  3DEP A;  1PH9 A;  3CCS A;  1QOH A;  4GOP B;  3SK5 A;  3PGZ A;  3LNN A;  3OPO A;  3SR1 A;  1LV9 A;  3QO2 A;  1M4V A;  4O1N A;  3A5Z B;  1YEZ A;  2HIV A;  4UY8 C;  4PZ6 A;  3SK6 A;  5I9P A;  2B2V A;  1I4R A;  2CWA A;  3QG1 A;  1PXU A;  2F3I A;  1D7Q A;  1JE4 A;  2K04 A;  2RDF A;  2EYP A;  4IUR A;  2K32 A;  1GUT A;  5C3X A;  5C6A A;  1G6Z A;  2QKI C;  1UNS A;  2AUK A;  3CQZ H;  2UUA L;  3JC6 6;  4UHV A;  2ZT9 C;  4M8A A;  3FPP A;  1EZ8 A;  3HKZ B;  2K03 A;  3KLS X;  5CV4 A;  1EL0 A;  2OXP A;  1F9S A;  3PUY A;  4WFN 3;  4N8F A;  4AQY Q;  3D6C A;  3QOJ A;  1V1O A;  1XPU A;  1HZB A;  2EXD A;  4DNI A;  1II3 A;  3M3Y B;  3S1M H;  2C35 B;  2EJG C;  1SYB A;  3E5S A;  1U4P A;  2O4X A;  1EU4 A;  2WB1 B;  3IFD A;  1M1K C;  3KLW A;  5M5X B;  3M4Y A;  5CBE E;  2IX0 A;  3K57 A;  3PO2 G;  4K0K Q;  2B2Y C;  1N8R C;  1GXD C;  3VR2 A;  3HKS A;  4QCL A;  1JC7 A;  5EAY A;  3KLS A;  2DN8 A;  4CBV A;  3CCJ A;  2I07 B;  2LXJ A;  1CKN A;  3W5O A;  3CP0 A;  4RAU C;  1QG7 A;  3MXP A;  3DWA A;  4BY7 B;  2IY5 B;  3DXJ C;  1KHI A;  1SBB B;  2NZO A;  5LMN Q;  3GTK H;  5IOD A;  5EJW A;  2PCF B;  4OO1 H;  3J7Y W;  3H3V C;  4JI6 L;  4A3C H;  2JE6 I;  1D1I A;  3S1M B;  3E3X A;  2VQE L;  2EIF A;  2JK8 A;  4KKU A;  2EOT A;  4B08 A;  3K5N A;  4CKB A;  3AEV A;  1L2F A;  2A74 C;  4H0L C;  2MNA A;  1UEA B;  1J9O A;  3I4M H;  1A3V A;  2F0F A;  3HZX A;  4XYQ A;  4X62 Q;  3BZC A;  2K05 A;  1LT4 D;  4LJZ C;  1B53 A;  4GS3 A;  3LWU A;  3MZ5 A;  2ES2 A;  3AFQ A;  2VL6 A;  2PI2 A;  1JOR A;  2UUC Q;  5COR A;  3TS2 A;  2O2L D;  2P5Z X;  2XRQ D;  3GTK B;  4GKJ L;  3GTM B;  2R7Z G;  3AB9 A;  1KQS A;  1I4H A;  1Y69 U;  2DUD A;  4A3F B;  4RCO A;  1HZC A;  1IYU A;  3A8I E;  4CDC C;  3BDO A;  3Q24 A;  2A6H D;  5G3L D;  2F0S A;  3UDG A;  2R3Z A;  4X3S A;  5BN5 A;  1IKM A;  1Y1V G;  1XWE A;  5BR8 Q;  1ENA A;  5KNB A;  5A2Q L;  2NN6 I;  2UUB L;  1H9K A;  4YY3 L;  1W6J A;  4G57 A;  2IJ0 A;  4HMJ A;  5IT9 c;  2QEX A;  2LFN A;  4A3E H;  3U58 A;  3DM3 A;  5LMU Q;  5D3I B;  3AU7 A;  3IFT A;  1DXM A;  1TS5 A;  4DV4 L;  3Q23 A;  4FXK C;  3NEL A;  1E22 A;  4A76 A;  4NXM Q;  2TMP A;  3MWY W;  4JI0 Q;  2EXZ A;  2CQA A;  2ID0 A;  1XMO L;  2KEN A;  4OWX B;  1OXU A;  2I5M X;  4QUC A;  4ULL A;  1MIU A;  3CRL C;  4C3J B;  1N32 L;  4JYA Q;  3MXU A;  3NBH B;  4DR4 Q;  5IY0 A;  5ELF A;  4FF4 A;  2EY6 A;  2RCF A;  5IGE A;  3ONA B;  3TP6 A;  4BY1 H;  4O0A A;  4YWL A;  2B63 G;  2F4V Q;  3UE0 A;  2X69 A;  5KGU A;  3V2T A;  3T53 B;  4X66 Q;  4DUY L;  1B8A A;  2M2L A;  4A3E B;  3NQT A;  1B4O A;  1S5D D;  1U0L A;  5C44 G;  3GD7 A;  1BCP B;  4TRD A;  1IYJ B;  3OSO A;  4UAI A;  4K6L A;  4XXE A;  2PQA A;  3S1R H;  3W1B A;  3FKI G;  1VQM A;  2F0V A;  4A3K H;  2H5X A;  1PTO D;  4Z9C B;  1HR0 L;  1MJC A;  1C8C A;  1RCV D;  3TP5 A;  1TT2 A;  4BY1 B;  1EIH A;  1STE A;  4IUT A;  2NUC A;  3DWP A;  3T16 A;  3U9S A;  1ML0 D;  2F0K A;  2F03 A;  2KVM A;  4B3S Q;  1YNJ C;  4EX5 A;  5CV6 A;  4JI2 L;  4GNX A;  3E0E A;  2XIW A;  1AZQ A;  3K5M A;  2IT1 A;  2B2T C;  2NVY H;  2E5L L;  3HOX B;  4OL7 A;  1PRT D;  5CC4 A;  3DM1 A;  3J7A 5;  3S1R B;  1EOV A;  1KAA A;  3RN5 A;  1JOO A;  1NMF A;  4JBM A;  4A3K B;  3CCV A;  1O80 A;  3Q6S A;  2A19 A;  1HNW L;  1ENF A;  1GHK A;  3CPW A;  1HXY D;  3W2D A;  4UDU C;  2AWN A;  1EOT A;  1LAC A;  2VXW A;  5M3M H;  2PW5 A;  4MN3 A;  1Q81 C;  2UU9 Q;  4KN4 C;  4DUZ L;  4L5Q A;  3HKZ G;  2KHS A;  1D5X C;  1JOQ A;  3A8K E;  4BA1 I;  3S2D H;  3T1H L;  3I2Z A;  1Q1B A;  2OWO A;  2K5H A;  5A2Q E;  4A3B H;  4HSP A;  4ZQ3 A;  1EQR A;  1X56 A;  3OIQ A;  4BXX H;  2JQO A;  4I7A A;  1QB5 D;  1K83 B;  3FDT A;  1CKN B;  2WB1 G;  2EYJ A;  2JA5 B;  1GUS A;  5ELN A;  2ICI A;  1J6Q A;  3H3V H;  1K8M A;  4Y7N B;  5C0X G;  1G51 A;  2R93 H;  4R8N A;  2HQE A;  3C3L A;  2F0E A;  2E76 C;  1QCB D;  5AFW A;  1WD1 A;  1L0X B;  4C1N K;  4BY7 G;  1S5C D;  2K28 A;  4C2M B;  3K81 C;  4FVM A;  2QA4 A;  1AN8 A;  2NWG A;  1U4L A;  3GTO H;  4A3J H;  1Y1W H;  1RTN A;  3A7A B;  1L1O A;  1F9P A;  3MEF A;  4LMQ D;  4JI7 L;  3MAQ A;  2XSC A;  1CUK A;  1IBM L;  1Q1E A;  5HUR A;  4K2K A;  5DAU A;  3J7A F;  2R93 B;  5C4J H;  3RN2 A;  2Z0S A;  1Z6H A;  5FK9 C;  1S5E D;  4DV1 L;  3GTL H;  1H9J A;  3NWT A;  2B8F A;  1YHA A;  1CHP D;  5JOB A;  1BBX C;  1VQ4 A;  2A6H C;  2IHE A;  5KNC A;  2CVR A;  2VNU D;  4F87 A;  3L3O C;  4EQP A;  2Y0S G;  1VCI A;  3RNU A;  5FLM H;  1KNE A;  4A3F G;  1ZKO A;  1LTB D;  3OYY A;  5I6W A;  1QZG A;  1BDO A;  1CSP A;  4JI6 Q;  1PRT F;  4UP8 A;  3H0G H;  2WAQ B;  5GAH C;  3KK7 A;  4P75 A;  3SXH A;  4LF4 Q;  1I50 H;  1B9M A;  2IW3 A;  3T51 B;  5E4W C;  2K5D A;  1T5E A;  2F52 A;  4PNY A;  5FO9 B;  1KC8 C;  4B3M Q;  5FLX c;  1JCK B;  4R8I A;  5K36 G;  3TZD A;  4WJ3 M;  4DF7 A;  2CCZ A;  1TKW B;  1TWC H;  5ELD A;  3MFY A;  1SLJ A;  5FKA C;  4CKE A;  2RSN A;  4DAM A;  3QB3 A;  2O5J C;  1GUG A;  2Z8L A;  3NTH A;  3D4D A;  4C3J G;  3J81 i;  1NE3 A;  3P20 A;  4AQY L;  1HNZ L;  2IWH A;  1DYQ A;  4NB3 A;  4GLV B;  1MBY A;  2ZJQ A;  1Q90 A;  3KF6 A;  1VQG A;  3W1G A;  2XWJ B;  1F2Y A;  3I55 A;  4A3G H;  3PIP 3;  4FXG C;  1AE3 A;  3S1Q B;  1Q86 C;  3M4P A;  1OXT A;  2GVB A;  2GA4 B;  1STA A;  5CV8 A;  4C3I B;  4A93 B;  4XQJ A;  2PQA B;  2VB3 X;  1PTO C;  3BU2 A;  5CYU A;  2WP8 J;  1KRS A;  4K0K L;  1Z47 A;  2ZM6 L;  3PF5 A;  1G2T A;  2UUB Q;  2EYM A;  4YY3 Q;  2KQ3 A;  4HJ9 A;  2OQK A;  3DWQ A;  3HOW B;  4CJ1 B;  4DV3 Q;  3RMH A;  1SE3 A;  1AFP A;  4DV4 Q;  2LMC B;  2AQ1 B;  4UP9 A;  4DR2 L;  1S72 A;  3I73 A;  3J80 i;  2VQF L;  5T1I A;  4OO1 I;  3PIO 3;  3HKZ E;  1XMO Q;  4GNX B;  1B7Y B;  4GKK L;  4X6A H;  1VQC A;  4IPG A;  4A3G B;  1YZ6 A;  1QNK A;  3AYH B;  3MEH A;  3S16 B;  1SND A;  3HOU G;  3I8Z A;  1VQ6 A;  4XYO A;  4DUY Q;  2WB1 E;  4JW0 A;  3CAM A;  4V0B A;  4NDX A;  1SSO A;  1HTL D;  1Q7Y C;  1PFS A;  2F4I A;  2Q8R E;  4JI8 Q;  1K28 A;  2EY1 A;  4QUF A;  3F2C A;  1UUP A;  3OW7 A;  1EEI D;  4LWC A;  2F3V A;  4EGV A;  5J1Z A;  3J81 c;  4DAY A;  5J22 A;  5EQ0 A;  4OON A;  2M9V A;  5IOC A;  5IWA L;  3K80 C;  3FPU B;  3M85 A;  4KD3 A;  1ICF B;  3EIV A;  3RUZ A;  1QVC A;  2FMM A;  3ZYY X;  1X3P A;  1A0I A;  2DY8 A;  4O42 A;  1XPR A;  3OMG A;  3G48 A;  1YJW A;  2L9H A;  3I72 A;  2A1A A;  2BA1 A;  2PW7 A;  4OWT B;  4JI2 Q;  3ICE A;  2DNE A;  1PH1 A;  3JAM E;  2WV6 D;  3K8A A;  2YTV A;  2CWP A;  2YU9 B;  1IKL A;  3EJI A;  2E5L Q;  2JA5 G;  2R7Z H;  2JA7 B;  1ZEQ X;  1D1K A;  3HOV H;  1YJ9 A;  2LSS A;  1XTC D;  1EZ6 A;  1B2T A;  2E2J H;  1X3F A;  3J80 c;  1HZ9 A;  1BBW A;  5F2D A;  4JYA L;  1A62 A;  1L1O B;  1IBL L;  1HHV A;  2Z4H A;  2BE5 D;  3T1Y Q;  4DUZ Q;  4JI4 Q;  2F4V L;  4CDD C;  1SN8 A;  3T1H Q;  2G9D A;  4X66 L;  2ICE C;  4DR3 L;  1HQR D;  4G7Z C;  4ZLT F;  3PF4 A;  4DR5 Q;  3TRZ A;  2N3S A;  4P72 A;  5E7N A;  1G91 A;  1WTX A;  2Q8I B;  1EFI D;  3S17 B;  5CR3 A; 
#chains in the Genus database with same CATH homology
 1VQ5 A;  1KHI A;  2NZO A;  2K5V A;  4RG1 A;  5LMN Q;  3GTK H;  1OXV A;  4HID A;  4JV5 L;  4JI6 L;  4A3C H;  4A75 A;  2JE6 I;  1N33 L;  5GRO A;  4OX9 L;  2R7F A;  4A3E G;  4BBR G;  2VQE L;  1JMC A;  1XMQ L;  2EIF A;  2JK8 A;  1K83 H;  1E7Z A;  2B29 A;  1EFW A;  1C9O A;  1YI2 A;  1PHJ A;  3AEV A;  1XTD A;  1VQH A;  4QJF A;  1NTG A;  1N34 L;  2JA5 H;  4BBS G;  1L2F A;  4LFB Q;  3CCM A;  2MNA A;  2EQS A;  3CXC A;  2AHO B;  4PZ7 A;  4TQU S;  5LMN W;  1J5E Q;  3CCE A;  4MZ9 A;  2NVX H;  4B3S L;  3I4M H;  4Y7N H;  2AKW B;  3CD6 A;  1T9H A;  4QGU A;  1TWA H;  4X62 Q;  3J81 j;  3BZC A;  4LF6 L;  1RL2 A;  3FHW A;  4YWM A;  1VQE A;  4YWK A;  3D31 A;  3KOJ A;  4GS3 A;  1JT8 A;  2ES2 A;  4A4I A;  5GAD C;  2MO0 A;  3AFQ A;  2N78 A;  1PH5 A;  2VL6 A;  3F2B A;  4GN3 B;  2HHH Q;  2PI2 A;  4BY1 G;  1BBU A;  5DLQ E;  5C0X J;  3FKI H;  2UUC Q;  4JI7 Q;  3TS2 A;  4C2M H;  1B70 B;  4PG3 A;  1P16 A;  1XNR L;  1X65 A;  1O7I A;  1FVI A;  2ALY B;  4DK6 C;  4GKJ L;  3CPF A;  2R7Z G;  1IBM Q;  1I94 Q;  3PO2 H;  2D0P A;  4AYB E;  1KQS A;  2JEB I;  2DUD A;  2ZTD A;  5IYD G;  4HJ7 A;  5AJ3 L;  1H95 A;  4IPH A;  5ELO A;  1HZC A;  1YHQ A;  1EIY B;  1L1O C;  4DV1 Q;  3EBE A;  4KHP L;  3KF6 B;  1V1Q A;  3HOX G;  4A3I H;  2UU9 L;  4YCW A;  4FDB A;  5M5Y H;  1CKM A;  3UDG A;  1W2B A;  3PUZ A;  1G29 1;  1UWV A;  3L0O A;  4DV7 Q;  1VQ8 A;  4A3K G;  1Y1V G;  2UUA Q;  3D0F A;  5BR8 Q;  3ULP A;  2NN6 I;  3ULL A;  1E24 A;  1YIT A;  2UUB L;  5GAG C;  4YY3 L;  5IT9 c;  1I6H H;  2QEX A;  2Q2U A;  4A3E H;  2YV5 A;  1HZA A;  1YVC A;  5HY6 A;  4BBR H;  3U58 A;  3DM3 A;  1VQP A;  1AH9 A;  5LMU Q;  2RHS B;  2PNH A;  1VQ7 A;  1KD1 C;  3F1Z A;  2ZTC A;  3AFP A;  4R4Q A;  4DV4 L;  4BBS H;  1ASZ A;  3S15 H;  1IXR A;  4JBK A;  4A93 G;  3NEL A;  1E22 A;  4AH6 A;  1TWH H;  4A76 A;  4NXM Q;  3PUV A;  3WWV A;  4P73 A;  1KIX A;  4JI0 Q;  1NMG A;  4JC0 A;  2ID0 A;  1XMO L;  2KEN A;  4OWX B;  4R1J A;  1OXU A;  2K52 A;  2RF4 A;  2I5M X;  2MFI A;  4LF9 Q;  3RR5 A;  1MIU A;  3H3V I;  1N32 L;  3KDF A;  3G71 A;  4B3T Q;  4JYA Q;  3NBH B;  1PH4 A;  2Z6K A;  4DR4 Q;  5IY0 A;  3HOW G;  1E1T A;  4EQ5 A;  3RLF A;  4BY1 H;  1FL0 A;  4O0A A;  4YWL A;  2B63 G;  1YJN A;  2F4V Q;  3UE0 A;  4LF8 Q;  4P71 A;  1NBW A;  4DKA C;  4JI1 L;  4X66 Q;  4DUY L;  2PMZ E;  1S40 A;  1QVG A;  1WOC A;  1B8A A;  3I4M G;  4DR6 Q;  4X64 L;  3HOZ G;  4LW1 A;  1U0L A;  5IYD H;  4JOI A;  5C44 G;  1LUZ A;  3GD7 A;  3ULJ A;  5M3M G;  3H15 A;  4GLA C;  1HNZ Q;  1X3G A;  4DR1 Q;  1QUQ B;  4YHH Q;  3CCQ A;  4B3R Q;  1GKH A;  4DV6 Q;  4JBJ A;  3STB D;  1IYJ B;  3NEN A;  1ASY A;  2BA0 A;  4IOA A;  3VDY A;  2IX1 A;  2HIX A;  4A3B G;  2PQA A;  3S1R H;  3W1B A;  2HT1 A;  3FKI G;  4KHZ A;  2NN6 G;  4LFA Q;  3TEH B;  3U4Z A;  2GN5 A;  1VQM A;  5IYC G;  2XTI A;  3L2P A;  1D8L A;  4JV5 Q;  4A3K H;  1Y1V H;  4IO9 A;  2H5X A;  3BJU A;  2UXB L;  1Z9F A;  3G4S A;  1HR0 L;  2VQE Q;  5IP7 H;  1MJC A;  1Q8K A;  2VS1 A;  2DGY A;  2K4K A;  2ZM6 Q;  1L0W A;  4DAY B;  1RIP A;  3BZK A;  4L5T A;  3S1Q H;  1EUJ A;  1WYD A;  3UDX A;  3RZD H;  3RLO A;  4GLX A;  2FXQ A;  1YHB A;  4C3I H;  4A93 H;  4O2D A;  4B3S Q;  3K0X A;  4A3L G;  5C3E G;  4C3H H;  3ZJY C;  4EX5 A;  3J7Z C;  1PA6 A;  4LF7 L;  5HGQ A;  5M3F H;  4DR2 Q;  4JI2 L;  4GNX A;  3E0E A;  1VS0 A;  2R93 G;  1VQI A;  2VQF Q;  2JJQ A;  3S24 A;  4KI0 A;  2IT1 A;  3F2D A;  2NVY H;  4IJH A;  1KRT A;  5C0X I;  2E5L L;  4GKK Q;  1PVO A;  1GM5 A;  2UXC L;  3HOW H;  3CW2 C;  4QY7 A;  3PUX A;  4HIK A;  3J7A 5;  1EOV A;  2R7D A;  3RN5 A;  3TS0 A;  2B63 H;  4LF4 L;  1NMF A;  4JBM A;  4GKJ Q;  3K7A H;  3CCV A;  1JB7 A;  4LUV A;  2A19 A;  2KHI A;  1Y14 B;  1HNW L;  3A0J A;  4IOC A;  2Q2I A;  2PI2 E;  4A3J G;  1IBK Q;  3CPW A;  1X6O A;  2K14 A;  4MTN A;  2CKZ B;  3DLL A;  4GOP A;  2AWN A;  4B3M L;  3HOZ H;  5C44 H;  5M3M H;  4KHP Q;  1SRO A;  1PYS B;  1Q81 C;  4LFC L;  1K0R A;  4DUZ L;  2UU9 Q;  3S16 H;  4L5Q A;  3HKZ G;  1VQF A;  2WAQ G;  2JA7 G;  2N8N A;  4BA1 I;  1E3P A;  3CC2 A;  3S2D H;  3T1H L;  3I2Z A;  1Q1B A;  1FJG L;  3GDE A;  2OWO A;  2K5H A;  2ZJP A;  4A3B H;  3ERS X;  1S3O A;  4XTC S;  1X54 A;  1HH2 P;  3G6E A;  5IYC H;  1EQR A;  1X56 A;  4HIM A;  4BXX H;  1PYB A;  2JQO A;  3CF5 A;  4DV0 Q;  3E9I A;  1CKO A;  3CCR A;  1XPO A;  3M4O H;  2KCM A;  4PMW A;  1CKN B;  2WB1 G;  1LM0 A;  4LF5 L;  2OCE A;  1I3Q H;  1JJ2 A;  5IWA Q;  1XNQ L;  3S14 H;  2JEA I;  1K8A C;  1UE1 A;  2AMC B;  3A5U A;  5ELN A;  5LMN L;  1X55 A;  1PH6 A;  1J6Q A;  2WAQ E;  5C3E H;  4R4C A;  4A3L H;  1N36 L;  3H3V H;  1EYG A;  1N32 Q;  2KCT A;  5C0X G;  1G51 A;  4LUZ A;  5IYB G;  2R93 H;  2E8G A;  3GTQ H;  3H0G G;  2Q2H A;  2HQL A;  3U4V A;  1G6P A;  4HIO A;  2NVT H;  5IP7 G;  2R6G A;  4JBW A;  3PV0 A;  2ZTE A;  4LFB L;  4QQB X;  5GQO A;  3OTO Q;  4BY7 G;  1DGS A;  2JA9 A;  4NXN Q;  1J5E L;  2D0O A;  1IZ6 A;  3CMA A;  4DV3 L;  1N9W A;  3K81 C;  2QA4 A;  4J15 A;  4X62 L;  3I4N G;  1JE5 A;  3M4Q A;  3UDF A;  1UEB A;  2OTL A;  4JI3 Q;  3GTO H;  4A3J H;  4A3D G;  1WJJ A;  1Y1W H;  1LTL A;  1KL9 A;  5M3F G;  1L1O A;  4IPD A;  4KLK A;  1EWI A;  3PUW A;  4DV2 L;  3MEF A;  2UUC L;  2YU9 H;  1P8L A;  5M5W H;  3HOY G;  1FGU A;  1GO3 E;  2CFM A;  4ALP A;  4JI7 L;  1IBL Q;  1VQA A;  4GN4 B;  1K9M C;  2JA7 H;  3CCL A;  1CUK A;  1K3R A;  1A63 A;  1IBM L;  1Q1E A;  1I94 L;  2UXB Q;  4X65 L;  2UXD Q;  1HR0 Q;  5C4J H;  1W3S A;  2I5H A;  3RN2 A;  2E2I H;  2Z0S A;  2I5L X;  4DR7 Q;  4IFD J;  3GTL H;  2VW9 A;  4DV1 L;  5C4X G;  3K7U C;  1XJV A;  3M3Y H;  2N49 A;  4DR3 Q;  1WCM G;  1NJI C;  1YHA A;  4JG2 A;  2CQO A;  1VQ4 A;  2NVQ H;  5FJ8 G;  4A3G G;  2IHE A;  2MQH A;  5M5X H;  4DV7 L;  5IP9 G;  4JI8 L;  1HNX L;  1EIF A;  2VNU D;  5BR8 L;  2Y0S G;  1VCI A;  1EQQ A;  1HR0 W;  1SR3 A;  3F8T A;  2JA8 G;  3RNU A;  3SGI A;  5FLM H;  1R9T H;  4A3F G;  2RHQ B;  1OXS C;  3FP9 A;  3OYY A;  3JAM c;  2B3G A;  2LXK A;  1OXX K;  1QZG A;  1PV4 A;  4DV5 L;  1CSP A;  5IYB H;  5LMU L;  4JI6 Q;  4UP8 A;  4BXX G;  3H0G H;  1N33 Q;  2YTX A;  4OX9 Q;  3HOU H;  1IL2 A;  3KJO A;  1QZH A;  1XMQ Q;  5GAH C;  4P75 A;  4LFA L;  4BY7 H;  4LF4 Q;  4AIM A;  4NXM L;  1K8G A;  4JI0 L;  1V43 A;  1N34 Q;  1I50 H;  4HJ8 A;  1LYL A;  2JA6 G;  3S17 H;  3GTJ H;  1HNW Q;  4LNQ A;  1E1O A;  1KAW A;  3GTP H;  4LF9 L;  2F52 A;  3PO3 H;  4DK3 C;  3IRB A;  4QIW E;  1KC8 C;  1M90 C;  4B3M Q;  3I4N H;  3HFZ B;  5JEA J;  4A3D H;  2D62 A;  2K75 A;  5FLX c;  4DR4 L;  2Y0S E;  4R4O A;  4POF A;  2BH2 A;  3B6Y A;  5K36 G;  3KDF B;  4LF6 Q;  4WJ3 M;  2R92 G;  2YYZ A;  3GTG H;  3HOY H;  2CCZ A;  1U5K A;  1TWC H;  4LF8 L;  3M7N A;  4JI5 L;  4GN5 A;  1SLJ A;  3I4O A;  1OTC A;  1HJP A;  1BKB A;  4DAM A;  4A3M G;  2GVA A;  4R4T A;  3I7F A;  1XNR Q;  3PIP A;  1VQ9 A;  1JJG A;  5JJI A;  1NY4 A;  3J81 i;  4HJ5 A;  1NE3 A;  4AQY L;  1HNZ L;  4NB3 A;  4GLV B;  4YHH L;  4PZ8 A;  4B3R L;  4YCU A;  5C4X H;  3GO5 A;  1VQB A;  2BH8 A;  5AJ3 Q;  4DV6 L;  1Q12 A;  1AE2 A;  3STB C;  2ZJQ A;  1WCM H;  1VQG A;  3KF6 A;  3UE1 A;  3W1G A;  4APV A;  1Y1W G;  3I55 A;  4LF5 Q;  5FJ8 H;  2A8V A;  4A3G H;  4WJ4 A;  1GVP A;  1AE3 A;  3ER0 A;  3S1N H;  4QL5 A;  4R4I A;  3CCU A;  2ZJR A;  3M4P A;  1Q86 C;  3T1Y L;  1PH7 A;  1OXT A;  2GVB A;  5IP9 H;  3I56 A;  1PH2 A;  3E9H A;  4P74 A;  4JI4 L;  4POG A;  3GTM H;  1N36 Q;  1YNX A;  2PQA B;  3BU2 A;  4L5R C;  2WP8 J;  2JA8 H;  1KRS A;  4K0K L;  3TRE A;  1Z47 A;  4XIG S;  4A3F H;  2ZM6 L;  4NPS A;  1WI5 A;  2Q2T A;  4UPA A;  3PF5 A;  2UUB Q;  2VY3 A;  4YY3 Q;  3JAM i;  2RCN A;  4AYB G;  4HJ9 A;  4DR5 L;  1VQJ A;  1BVS A;  2OQK A;  1UE5 A;  3PIO A;  1MJE A;  3PSI A;  4L5S A;  4DV3 Q;  2JA6 H;  4DV4 Q;  4UP9 A;  4DR2 L;  1S72 A;  3J80 i;  5GAE C;  1WFQ A;  2VQF L;  4OO1 I;  3KF8 B;  3HKZ E;  2VZA A;  1XMO Q;  4GNX B;  1B7Y B;  4GKK L;  4X6A H;  5FLM G;  4DV2 Q;  1VQC A;  4IPG A;  1YZ6 A;  2ASB A;  1VQN A;  3AYH B;  2R92 H;  1SMX A;  2KBN A;  1JJC B;  4H02 A;  4JCV E;  3S2H H;  1YIJ A;  3HOU G;  2V1C C;  4MNO A;  1C7Y A;  1Q82 C;  2QGQ A;  4ME3 A;  5JJK A;  2OQ0 A;  2K50 A;  1VQ6 A;  4X65 Q;  3HOV G;  3RZO H;  1QVF A;  3A74 A;  2IHF A;  3UDI A;  4A3M H;  1PH3 A;  1IBK L;  4BA2 I;  4IFD I;  4JI1 Q;  4DUY Q;  4C3J H;  1K73 C;  2VUM G;  2WB1 E;  3PO3 G;  3CAM A;  5H1S E;  2MO1 A;  2YTY A;  1PH9 A;  4X64 Q;  3CCS A;  4GOP B;  1QUQ A;  3PGZ A;  3MXN B;  1Q7Y C;  1PFS A;  2Z6K C;  4HJA A;  2L15 A;  4JI8 Q;  3A5Z B;  1YEZ A;  2HIV A;  1HNX Q;  1PH8 A;  2HHH L;  4UY8 C;  3KJP A;  4PZ6 A;  3CC7 A;  3F2C A;  2K5N A;  4YCV A;  1VQD A;  2CWA A;  4LWC A;  4UP7 A;  4DV0 L;  2OTJ A;  4IPC A;  1V9P A;  2NZH A;  2F3I A;  4DV5 Q;  3M9B A;  3J81 c;  4OXP A;  1D7Q A;  4JOI C;  3OW2 A;  4OON A;  5IWA L;  3L7Z C;  1TWG H;  3TQY A;  3K80 C;  5IE8 A;  3Q8D A;  3M85 A;  3CME A;  1I5F A;  3EIV A;  2XGT A;  1A8V A;  1QVC A;  5JJL A;  1UE6 A;  4OWW B;  4OO1 G;  1A0I A;  2AWO A;  1XPR A;  3CQZ H;  3G48 A;  1YJW A;  2UUA L;  3JC6 6;  2A1A A;  4LF7 Q;  4A3C G;  2BA1 A;  1GD7 A;  1C0A A;  1UE7 A;  4OWT B;  1CSQ A;  4JI2 Q;  1VQO A;  3ICE A;  2KHJ A;  1PH1 A;  1KXL A;  1SRU A;  3K8A A;  4RMF A;  3OTO L;  2YTV A;  2CWP A;  3RLN A;  4NXN L;  4Y52 H;  2E5L Q;  2JA5 G;  4JI5 Q;  2UXC Q;  3KYH C;  2ATW A;  5J3B A;  2R7Z H;  4IFD G;  1MKH A;  1VQL A;  3HOV H;  3AQQ A;  3PUY A;  1YJ9 A;  4JI3 L;  2LSS A;  4AQY Q;  2E2J H;  1SE8 A;  1X3F A;  3J80 c;  2VUM H;  4GNX C;  1HZ9 A;  1BBW A;  1XPU A;  1HZB A;  4IJL A;  4LUO A;  3HOX H;  1A62 A;  2EXD A;  4DNI A;  4B3T L;  3KFU A;  1L1O B;  1IBL L;  1VQK A;  4JYA L;  3S1M H;  2C35 B;  4TVA B;  3T1Y Q;  4LFC Q;  4DUZ Q;  4JI4 Q;  3U50 C;  1SFO H;  1M1K C;  3KLW A;  1TWF H;  2UXD L;  2F4V L;  1SN8 A;  2IX0 A;  3T1H Q;  3EN2 A;  1FJG Q;  3PO2 G;  1N8R C;  2I0Q A;  4DR7 L;  4X66 L;  4K0K Q;  1YBY A;  1X3E A;  3HKS A;  2E2H H;  4DR6 L;  3PCO B;  4DR3 L;  5EAY A;  4GOP C;  3NEM A;  3CCJ A;  3PF4 A;  1TXY A;  4DR5 Q;  3TRZ A;  2LXJ A;  2N3S A;  1CKN A;  3W5O A;  4DR1 L;  4A3I G;  3CP0 A;  4P72 A;  3LGJ A;  5E7N A;  1X9N A;  3CC4 A;  1Q46 A;  5JEA G;  4DPG A;  1XNQ Q;  2WFW A;  2IY5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...