4LF4L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title Crystal Structure of 30S ribosomal subunit from Thermus thermophilus
rcsb
molecule tags Ribosome
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4lf4L00
1PFSA 3HOXH 4B3ML 2UUBQ 2JA8H 4A3EH 1K9MC 2RF4A 3I7FA 1WCMG 4B3MQ 4GS3A 1E7ZA 4GOPB 4QJFA 5LMUL 4JBWA 5LMUQ 2UXCL 1WFQA 2UXCQ 2A1AA 4JI3L 4AYBG 2HIXA 1N36L 4JI3Q 4B3TL 1N36Q 4B3TQ 2IX1A 3GTOH 3ICEA 4LF6L 5IP7H 1KRSA 1Y1VH 4BA2I 2MQHA 2VZAA 4DR2L 3S2DH 4DR2Q 4K0KL 3UDFA 4GLXA 4A3JH 2JK8A 5IE8A 5FLMH 1A63A 2NVYH 4C3IH 1PYBA 4PZ8A 1PH9A 3J7ZC 1S40A 4X62L 3F2DA 2WB1G 2UUAL 1TWGH 2UUAQ 3MXNB 4A93H 1J5EL 1PH3A 4LFBL 1N9WA 1J5EQ 2MNAA 4LFBQ 5C4XG 5K36G 1LTLA 5BR8L 4EX5A 1NTGA 5BR8Q 2IHEA 4UPAA 3J80c 1BVSA 3K7AH 4HIOA 4UP8A 1P16A 3PO2G 1WCMH 3AFPA 3UE0A 4OX9L 4OX9Q 4KHPL 1N34L 1N34Q 3F1ZA 2ZJPA 2EQSA 4B3RL 1C9OA 4MZ9A 5AJ3L 1YITA 1NE3A 5HGQA 4BY7H 4B3RQ 1KHIA 1I94L 1FL0A 4Y7NH 1I94Q 1MIUA 2B3GA 2RHQB 4JI4L 5GQOA 3SGIA 3I56A 1M1KC 5GAEC 4WJ3M 1L1OB 4AYBE 3U4ZA 4L5SA 4MNOA 3GO5A 3M9BA 1JB7A 1PH2A 1X6OA 4DAMA 2ZM6L 1Y14B 4MTNA 3CC7A 5J3BA 4DV2L 1DGSA 2Q2IA 2GVAA 4DV2Q 1LYLA 3TREA 5C4XH 1YJWA 1CSPA 3K8AA 3TS2A 4IFDI 4A75A 3NEMA 2WB1E 4LFAL 4DAYB 4LFAQ 3PIOA 3CCMA 2AWNA 1X9NA 2PNHA 3PO2H 4TQUS 1SRUA 1MKHA 2KHIA 3KYHC 3S1RH 1LUZA 3CW2C 1VQAA 3CCUA 1L1OA 4A3MG 3I4OA 1PH6A 3CCJA 1N33L 5LMNW 1N33Q 4R4QA 1CSQA 3ULPA 3H0GG 1YZ6A 3J81j 3E0EA 4DR6Q 2WAQG 1HJPA 3M4QA 3MEFA 5IT9c 1PHJA 3OYYA 3HOZG 4P74A 3S16H 1XJVA 3RN5A 1VQGA 4JI6L 2ZTEA 3ULLA 3TRZA 4JI7Q 1TWFH 1HH2P 2HQLA 2B29A 3WWVA 3U58A 2EIFA 1YJ9A 1HNXL 3J81i 5JJLA 4DV0L 1HNXQ 4DV0Q 2CWAA 3M4OH 1HNZL 4OO1G 4GN4B 2R7ZG 2F52A 4A76A 4OWXB 1OXVA 2Z6KA 3GDEA 2H5XA 1R9TH 1C7YA 3LGJA 4UP7A 3TS0A 2OTLA 4A3BG 1GM5A 4LF9L 4A3MH 2K14A 4LF9Q 1NJIC 4DV5L 2BA1A 4DV5Q 4R1JA 3UDXA 1VQIA 4HJ8A 4DR5L 3H0GH 2YTYA 4A3IG 3CMEA 3HOZH 4IJHA 2NVXH 3CD6A 4DR3L 1EWIA 3PV0A 2B63G 4PG3A 5H1SE 1X55A 4AH6A 2CQOA 4A3GG 1I5FA 1X3GA 5C3EG 4DR7L 1VQLA 3PO3G 4DR7Q 4JI1Q 2WAQE 4NXML 4JI2Q 2KCTA 3AEVA 3K7UC 1BBWA 2QA4A 5M5WH 1Q12A 3KDFB 2BH2A 2YTVA 2R7ZH 2YTXA 1QVFA 3J7A5 1IYJB 1VQMA 5JEAG 1YHBA 4YWKA 4LWCA 3CC4A 1UWVA 4A3BH 2JA5G 1L1OC 2OQ0A 1C0AA 3L0OA 3G48A 1HR0W 4A3CG 5FLMG 1ASZA 2IX0A 1CKMA 4A3IH 2UXBQ 3H3VI 3UE1A 3PIPA 2Z0SA 3G6EA 5C0XG 3VDYA 2L15A 4A3GH 1JJ2A 3KDFA 2F3IA 4APVA 5IWAL 5C3EH 2OQKA 3PO3H 5LMNL 4GN5A 3K0XA 2Q2UA 2DGYA 2KBNA 2N49A 1PH5A 1OXTA 1SMXA 1YVCA 5GAGC 2YU9H 1VS0A 1UE6A 4DR4L 4DR4Q 3CCSA 1PH1A 2Z6KC 1TWCH 1UEBA 4O0AA 1HZCA 1SE8A 1VQFA 4IJLA 1E1TA 4YCUA 4X66L 5IY0A 1XTDA 4X66Q 2I0QA 4BY7G 2JA5H 2MO0A 4QIWE 4DV6L 2ZTDA 4DV6Q 5IP9G 4A3CH 2CWPA 3T1HL 1G6PA 3T1HQ 1G291 2KENA 3FP9A 3W1BA 2VUMH 1PVOA 2AWOA 3HKSA 3M3YH 4JV5L 1K8AC 1RIPA 2JQOA 3HKZG 4PMWA 4X65L 4JV5Q 4X65Q 1YIJA 1XPUA 4JCVE 3I4NG 4LFCQ 2FXQA 4A3FG 3OTOL 4OXPA 3J80i 5GAHC 3OTOQ 1I6HH 3G71A 4NPSA 2VQEL 2VQEQ 1E24A 1MJCA 1D8LA 4YHHL 3DLLA 4YHHQ 1SFOH 2BH8A 2K5VA 1CUKA 1Q82C 1PH4A 4LF5L 1KAWA 4P71A 4LF5Q 1K3RA 2MO1A 1H95A 1QUQB 4DK6C 1JJGA 4KLKA 3S2HH 1GVPA 2ATWA 1UE7A 5IP9H 3EIVA 4JBKA 1L0WA 3KJPA 3A5UA 2CKZB 2LSSA 5IYBG 2Y0SG 4UY8C 4JG2A 1Q1EA 1V1QA 4R4CA 3A0JA 3UDGA 4YWLA 1VQ4A 2IHFA 3CPWA 1J6QA 3I4NH 2LXJA 4XTCS 3CCVA 2NVQH 4A3FH 5FJ8G 1HR0L 2E2JH 4RG1A 3PUVA 4AQYL 1HR0Q 4AQYQ 1FGUA 1D7QA 5ELOA 3HKZE 2PQAB 1JJCB 3PF5A 1QZHA 1QUQA 4JOIA 2JA9A 4LF7Q 1AE3A 2VL6A 3JAMc 2HIVA 1SR3A 4DV3Q 3ER0A 4GNXA 1GD7A 1WI5A 5C4JH 1XNQQ 4PZ6A 3KF8B 3BZCA 3CPFA 5DLQE 5M5XH 3F2BA 4IFDJ 1UE1A 1LM0A 2JEAI 4DR6L 1T9HA 3AQQA 5IYBH 4LW1A 1RL2A 1XNRL 2RHSB 1KD1C 1JMCA 4JI7L 1XNRQ 3RNUA 2CFMA 2GN5A 2PQAA 2VS1A 1GO3E 2R7DA 3GTJH 2Y0SE 5FJ8H 4OO1I 2VQFQ 5M3MG 4QQBX 3PGZA 2JA6H 1NBWA 1PH7A 1X3EA 3S24A 4POFA 1V9PA 4R4OA 2JEBI 1K73C 4NB3A 2K5HA 3RN2A 3HOUG 1SLJA 1VCIA 3HOVG 2E8GA 1QVCA 5ELNA 1KL9A 3FKIG 2V1CC 1S3OA 3STBC 3I55A 3RZDH 1QZGA 1VQ8A 3STBD 1N32L 3AFQA 4DV1L 3GTQH 1N32Q 4DV1Q 4A3KG 4JI0L 1ASYA 4JI0Q 1FJGL 1IXRA 1FJGQ 1X65A 2NN6I 3JC66 1VQCA 3KF6B 3J81c 3M7NA 3PUYA 3A5ZB 2AKWB 3S14H 3TQYA 4X64L 3S1NH 4GKKL 1CKOA 4JI1L 4X64Q 2CCZA 4JI2L 3S1QH 2I5HA 3PSIA 1UE5A 3K80C 4GKKQ 3M4PA 5M3MH 1IBML 2ZJQA 2GVBA 3EBEA 4HJ9A 1IBMQ 1IBLL 4DUZL 4GLVB 1WYDA 1IBLQ 4DUZQ 2JJQA 2ASBA 4JOIC 4IOAA 1I3QH 4X6AH 2QGQA 1EQRA 1Q86C 4KI0A 3HOUH 3PF4A 4GNXC 3HOVH 4IO9A 2R7FA 2OCEA 3NBHB 3FKIH 3PUXA 1AH9A 1W3SA 4P72A 3RLNA 3KF6A 4P73A 1B70B 2I5LX 1V43A 2ZTCA 2ZJRA 2NZHA 1XMOL 3F8TA 1XMOQ 1A8VA 1I50H 1Z9FA 4A3KH 2A8VA 5GROA 4DR1Q 5C0XI 2VUMG 4LNQA 1O7IA 2R6GA 3BJUA 3A74A 2RCNA 1SN8A 2I5MX 2R93G 2F4VL 3PUWA 1HZAA 2F4VQ 3PUZA 3ERSX 2R92G 4R4TA 2E5LL 2N78A 2E5LQ 4DPGA 4EQ5A 1VQ6A 3HFZB 3KOJA 3U4VA 2A19A 3RLOA 1U5KA 2UUCL 2UUCQ 4JI5Q 4LUZA 1OXSC 3S15H 1Q46A 4OWTB 3H15A 4POGA 1IBKL 5JJIA 1WOCA 1IBKQ 2C35B 5IYDH 3Q8DA 1MJEA 1E22A 4BA1I 3UDIA 5M5YH 3GTLH 4IPHA 5M3FG 2YYZA 3S17H 1IZ6A 1U0LA 4FDBA 3BZKA 3I2ZA 1YBYA 4YCWA 1Y1WG 3I4MG 5E7NA 4LFCL 4L5RC 1GKHA 3KFUA 2KHJA 3RR5A 1P8LA 2K4KA 1EOVA 4LUVA 3FHWA 4BBRG 1XPOA 4JI4Q 2KCMA 4A4IA 2R93H 4L5QA 1Q7YC 3W5OA 2R92H 1WJJA 4XIGS 4OWWB 2D0PA 4L5TA 2D0OA 2N8NA 1YI2A 3RZOH 4LF6Q 2LXKA 3E9IA 1HNWL 2JA7G 1HNWQ 3CXCA 4K0KQ 1VQHA 3D0FA 1B8AA 1OXUA 1Q1BA 4C3HH 1K0RA 4IPDA 1YHAA 1TXYA 1CKNB 4GNXB 4X62Q 4RMFA 5FLXc 2MFIA 4LF8L 3NELA 1Z47A 4LF8Q 3H3VH 4BY1G 2BA0A 5M3FH 2YV5A 3OW2A 4GOPA 4JC0A 4A3LG 3I4MH 1YEZA 3GD7A 1Y1WH 1VQKA 2PI2E 4HIKA 2UXBL 2VY3A 3CQZH 1PV4A 3HOWG 4DV4L 2IY5B 2K75A 2Q2HA 4DV4Q 4BBRH 3GTMH 3HOYG 1JT8A 2IT1A 4YCVA 1EIYB 1KRTA 2JA6G 1Q8KA 1IL2A 2NVTH 4KHPQ 2QEXA 4LF7L 3JAMi 5AJ3Q 4DV3L 4IPGA 1EYGA 1FVIA 4TVAB 1CKNA 1PH8A 1XNQL 3CP0A 1HZBA 2UUBL 2JA7H 4UP9A 3TEHB 1M90C 4J15A 4HJ7A 1L2FA 4GLAC 3T1YL 4DUYL 3T1YQ 1TWHH 1JE5A 4A3DG 4DUYQ 1VQ7A 3ZJYC 4JYAL 4C2MH 4P75A 2HHHL 3NENA 2OWOA 4GN3B 4HIMA 2HHHQ 4JYAQ 1VQNA 2ZM6Q 4ALPA 4QL5A 4BY1H 1VQDA 3ULJA 3CMAA 3BU2A 4H02A 1NMGA 2K5NA 4OONA 3CCLA 4A3LH 4IOCA 4DNIA 1KXLA 3HOWH 4IFDG 1K83H 2VQFL 3CF5A 3HOYH 3KLWA 2N3SA 3B6YA 2K52A 1EUJA 5JJKA 1VQEA 2DUDA 3GTGH 1VQPA 3CAMA 1X3FA 3CCQA 4QY7A 1VQOA 5EAYA 3CCRA 1OTCA 3KJOA 2HT1A 1Q81C 1QVGA 1VQJA 4A3DH 2VNUD 1KQSA 3GTPH 4BBSG 4JI6Q 1PA6A 2ID0A 1VQBA 4DK3C 5IYCG 1B7YB 1XMQL 4GOPC 2NZOA 1XMQQ 1N8RC 4JBMA 5HY6A 2OTJA 1HNZQ 4C3JH 2XGTA 1BKBA 2D62A 4BXXG 3DM3A 4YY3L 3AYHB 4YY3Q 4DV7L 2UU9L 4DV7Q 2UU9Q 4WJ4A 1VQ5A 2Q2TA 3F2CA 2ALYB 4YWMA 3K81C 4GKJL 4JI8L 4HJAA 5GADC 2AMCB 4QGUA 4JI8Q 3W1GA 4DR5Q 4GKJQ 3E9HA 4R4IA 2K50A 4LUOA 2WFWA 4PZ7A 1YJNA 1KIXA 2EXDA 4HIDA 5IYDG 2PI2A 1VQ9A 1G51A 3RLFA 1A0IA 1NMFA 5JEAJ 5C44G 3S1MH 4DR3Q 4BBSH 4KHZA 1E1OA 4DR1L 1W2BA 2NN6G 2AHOB 5IYCH 1PYSB 4HJ5A 4ME3A 2WP8J 4NXMQ 1HZ9A 1EIFA 1X56A 4AIMA 3L2PA 3HOXG 3CC2A 4A3EG 2JA8G 2JE6I 3G4SA 3L7ZC 4BXXH 3CCEA 2VW9A 1NY4A 2UXDL 2XTIA 4JBJA 5C0XJ 2UXDQ 4JI5L 3EN2A 1KC8C 4DKAC 1Y1VG 5IP7G 1XPRA 1EQQA 1EFWA 2PMZE 1YNXA 3IRBA 1S72A 3M85A 4A3JG 4LF4L 4Y52H 3D31A 4LF4Q 1OXXK 1X54A 2E2HH 2ES2A 2E2IH 1BBUA 1YHQA 3U50C 1A62A 5C44H 1E3PA 2B63H 4NXNL 1TWAH 4O2DA 4A93G 4NXNQ 4B3SL 1AE2A 5IWAQ 4B3SQ 3PCOB 1SROA 1K8GA 4IPCA 5LMNQ 3GTKH
chains in the Genus database with same CATH superfamily
1PFSA 5T1GA 3HOXH 2K5DA 1K9MC 4GS3A 5LMUL 1RCVD 4CJ0B 3PIP3 1HCZA 1ENCA 1O80A 4FVMA 4B3TL 2Z1CA 1N36Q 5IP7H 2PO4A 4DXFA 2A74C 3UDFA 2JK8A 1A63A 4C3IH 3VA5A 1S40A 4X62L 2RSNA 4R8NA 4FO2A 2UUAL 3MXNB 3MEHA 1J5EQ 2K33A 1HTLD 3EA6A 3J80c 3K7AH 2NBFA 3A54A 4UP8A 1WCMH 4OX9Q 1S4ZA 4M1UB 1N34Q 3TZUA 1YITA 4RHRA 1KDAA 1FL0A 1KNAA 3OWEB 3MXNA 1UNSA 4WJ3M 4AYBE 3M9BA 2L1BA 2ZM6L 2GVAA 1LTRD 1CSPA 2E2IB 2OEOA 4EQPA 3TS2A 4A75A 4IFDI 2VB3X 1SMYC 2F0HA 3NEMA 1SMYD 5CGKA 4LFAQ 1X9NA 3I70A 4IUQA 3KYHC 3HOXB 4RWSC 1N33Q 3D4RA 4R4QA 1CSQA 2LKVA 5CV8A 1YZ6A 3J81j 1B44D 2WAQG 3M4QA 4XXEA 3OYYA 1BDOA 4P74A 1XJVA 3RN5A 3TRZA 1QOHA 1O7LA 5E1FA 5ELFA 3AMUA 1EIHA 1XWEA 5DNFA 3GDEA 1C7YA 1ENAA 3K7AB 3TS0A 2OTLA 1WCMB 3VR5A 1SYCA 5CORA 1M8AA 2BA1A 4DV5Q 2RQXA 2A5HA 4AYBB 3H0GH 2A69C 2LS01 2F0SA 2A69D 3CMEA 1LTID 4DR3L 3PV0A 4ABNA 1X55A 5EQ0A 2CQOA 4AH6A 1F2YA 3J7AV 4NXML 3NWTA 5CYUA 3TP7A 3DHQA 2NTTA 1BBWA 2WIIB 4OO1H 2R7ZH 2YTXA 1QVFA 1VQMA 4IUTA 4YWKA 4ZQ3A 4G7OC 1UWVA 1H9SB 2JA5G 4PMCA 3L0OA 2B2TA 3GTGB 5D65A 1ASZA 5C5MA 4C3IG 2UXBQ 4FF1A 2AQ2B 1RD9D 2L15A 1JJ2A 5C4ZA 5LMNL 2DGYA 3MWYW 1SMXA 1H9SA 1B4OA 2YU9H 1VS0A 4IURA 1UE6A 4DR4Q 2DJGC 1PH1A 1TWCH 2F0GA 4O0AA 1MSHA 4X66Q 3I90A 4QIWE 2ZTDA 1EY8A 2EYMA 2CWPA 5J1ZA 5EBDA 2AWOA 4JV5L 4DK1A 2B2WA 4H44C 2JQOA 2J0TD 3HKZG 4X65L 1K8AC 3H0GB 2KCCA 1I6HH 3J80i 3OTOQ 1W6JA 4KHVA 1E24A 2EYPA 2X69A 4EGVA 1D8LA 4YHHQ 1SFOH 1Q82C 1CUKA 1KAWA 2R7ZB 1H95A 4JBKA 2B2TC 4LJZC 2Z4HA 3A5UA 2LSSA 5IYBG 1DONA 1Q1EA 4YWLA 5I9OA 2LXJA 2E2HB 4K5VA 2E2JH 4AQYL 3PUVA 4KKSA 1V1OA 1FGUA 1HRJA 3DWPA 2XSCA 5CV6A 4JOIA 3RD4A 4KMUC 3JAMc 1ILQA 3D6WA 1XNQQ 4BWGB 4QIWB 4PZ6A 1CQFA 3F2BA 1TU2B 1Z7TA 1TWCB 4DR6L 4LW1A 1Y1VB 1XNRQ 2B2WC 1GO3E 3K6OA 1JWUD 2Y0SE 3SXHA 4OO1I 4DFAA 3DUZA 5M3MG 3PGZA 1NBWA 3BDLA 3OIPA 3BS1A 2JEBI 2P5ZX 1K73C 4RGNA 1I6HB 1H9KA 4ULLA 3TN2A 1VCIA 1KL9A 2L9HA 1EY6A 2V1CC 3STBC 1SFOB 1JR0D 3STBD 1N32L 3TP6A 3GTQH 4DV1Q 1QNKA 5DM73 1VQCA 3J81c 3A5ZB 2F0WA 2AKWB 3S14H 3S1NH 1RODA 1CKOA 1DZ1A 4X64Q 4JI2L 1HA5A 3K80C 3M4PA 2GVBA 3EBEA 3BVMA 4FP5D 4DUZL 4Q5VA 2E2JB 3QOJA 4JOIC 1I3QH 3LX0A 2RDFA 1EQRA 1Z6HA 1KLUD 4KI0A 3HOVH 4Q0FA 1F77A 2EPBA 2R7FA 4DF7A 1AH9A 3RLNA 3VYTA 2ZTCA 1XMOL 3F8TA 3ONAB 4A3KH 1BCPB 2B2VC 3H91A 3OMCA 1O7IA 2F0KA 3BJUA 5I6WA 2Y0SB 2L55A 5CV4A 1TS5A 2I5MX 1NNXA 3PUZA 3J7AF 1EY0A 2R92G 3VYRA 2E5LQ 1J9OA 1SBBB 1VQ6A 3U4VA 2A19A 1U5KA 4LUZA 2HUGA 1OXSC 1Q46A 4GZYC 3H15A 5D3DA 1WOCA 1IBKQ 3LWEA 3A56A 3GTLH 3S17H 2L5TA 3I2ZA 1EY9A 1Y1WG 2RDHA 1PZID 1GKHA 1P8LA 3FHWA 1XPOA 2Q8RE 3WOEA 1BBXC 4ZKCB 3S14B 1CK1A 5CV9A 5ELDA 4OHJA 1LT5D 3Q23A 4KJOA 1F2MA 1YI2A 2I07B 2KJXA 1B8AA 4C3HH 5CMDA 1K0RA 1I3QB 1SAPA 2ZXOA 3HOVB 3H3VH 4BY1G 2YV5A 3MFYA 4GOPA 4A3LG 3LNNA 4HIKA 2K01A 3KLSA 4DV4L 2K75A 2OXPA 4BBRH 3GTMH 1JT8A 1T5EA 3SK5A 5I6YA 5C5LA 3J80E 3JAMi 4OIJA 5AJ3Q 1EYGA 4TVAB 1SE2A 2L12A 3CP0A 2JA7H 1S5DD 4JI4Q 5JVH3 1JOOA 3T1YQ 1BCPC 4DUYQ 4A3DG 4C2MH 1BCPD 2OWOA 3DM1A 2HHHQ 1G6ZA 4CJ2C 4QL5A 1VQDA 4XT3B 1EU4A 4OONA 2C5CA 2H1EA 3OW7A 3SHLA 4ZUIA 4DNIA 1BR9A 3A7LA 1E0BA 3S17B 2VQFL 2EY1A 4F8MA 1JWMD 4KK7A 2N3SA 2K52A 2G5DA 3A8JE 2EYHA 3ND9A 1LT6D 1X3FA 4QY7A 1VQOA 4C1NI 1X32A 1IW7C 3PIO3 1UUPA 1IW7D 4MTKA 2VNUD 2A68C 1MD2D 4PMBA 2A68D 1YNNC 4RHSA 1VQBA 2VB2X 4DK3C 1YNND 3Q6SA 1B7YB 1GUTA 4GOPC 1CA5A 1N8RC 4JBMA 4HTHA 1HNZQ 2D62A 4BXXG 1MSGA 3DM3A 4YY3Q 1PTOH 2UU9Q 1GHJA 4BBRB 1FNUA 3GTMB 4HJAA 2AMCB 4QGUA 4JI8Q 3P1HA 3E9HA 4LUOA 1I4PA 5EPKA 4HIDA 4FXGC 1G51A 3RLFA 5C44G 1V1PA 2K6AA 2JA7B 4BBSH 4KHZA 1E1OA 1RTNA 1JC7A 4DR1L 1W2BA 1EYDA 1PRTF 2AHOB 2D5DA 4ME3A 1TY2A 4PQXA 5EBCA 4C2MB 5F2DA 1ONLA 4AIMA 3NSWA 2KVMA 1C48A 2BCOA 1WD1A 2L4NA 2UXDL 2O4XA 1CT1D 4A3JG 4LF4L 4C3HG 3GV6A 1OXXK 1BUVT 1X54A 2ES2A 1H9RA 3U50C 2B63H 2M9VA 2NN6H 3MVVA 1XYIA 2ICIA 1DJRD 2KEDA 2F0IA 1UAPA 1HQRD 4A3EH 4B3MQ 3I7FA 3I3CA 2DY8A 1WFQA 2UXCQ 5KYLA 1N36L 4JI3Q 4DA2A 3NTHA 1T5XD 1ET6A 1KRSA 2EXZA 1PTOB 3S2DH 4DR2Q 4WORA 5FLMH 5IE8A 2NVYH 2K04A 3H3VC 4A93H 1J5EL 5C4XG 2MNAA 4I65A 1B9MA 1CI3M 4BBSB 1I50B 1BVSA 3PO2G 4OX9L 1GHKA 4KHPL 1N34L 1DOMA 2ZJPA 4MZ9A 4B3RQ 4BY7H 1NE3A 3OOCA 5CC4A 1MIUA 2B3GA 2RHQB 3I56A 4IZ8A 3SGIA 1M1KC 1L1OB 1HHVA 4HSVA 3D6CA 1PH2A 4DAMA 3NHHA 3S15B 4QUFA 4FXKC 1DGSA 4DV2Q 1ICWA 3BYTB 1YJWA 5KGUA 5AFWA 4LFAL 4DAYB 2PNHA 1DD2A 1SRUA 1VF7A 2KECA 4K8JA 4A3EB 1VQAA 1BQQT 1L1OA 5ELEA 4A3MG 3CCJA 3FPPA 1N33L 2NUCA 3JAME 1LLRD 1K3BC 1HJPA 5IT9c 2XWJB 1VQGA 4JI6L 3RUZA 4JI7Q 3S2DB 4OIKA 2B29A 2CW0C 1TS2A 4DAYA 2SNSA 2CW0D 5CBAE 4DV0Q 3M4OH 1RKNA 2E75C 2SEBD 3KUPA 4GN4B 4A93B 4Z9CB 2F52A 1A3TA 4OWXB 1IL8A 1OXVA 2Z6KA 2CQAA 1K8OA 1PTOC 4F7XA 4UP7A 1PTOD 5J22A 1KABA 1NJIC 4DV5L 2EYFA 4DR5L 5ELBA 4X3KA 3K5MA 1NR2A 4A3IG 2C9OA 3CD6A 2B63G 4PG3A 5H1SE 5C3EG 2QF7A 1VQLA 3PO3G 4DR7Q 1F2ZA 4JI1Q 2WAQE 3K7UC 3K5NA 1WVLA 1JOKA 1A6XA 2R3ZA 1DYQA 1XXGA 3ND8A 1L1OC 2OQ0A 3J80L 3G48A 2XN9C 3I4LA 5FLMG 1PLFA 2EE1A 2IX0A 3UE1A 2Z0SA 4ZK9B 2F3IA 4IUNA 4APVA 5EGTA 2Q2UA 3K0XA 1PH5A 3SR1A 4DR4L 1QB5D 3M4OB 2EJFC 2Z6KC 1UEBA 1SE8A 4BY7G 4YCUA 4X66L 5IY0A 3D3RA 4P2CB 3SK4A 2JA5H 5FKAC 4DV6Q 2X6GA 2CHBD 1G6PA 3FP9A 3W1BA 1GOZA 2Z4IA 3HKSA 3T51B 1F9RA 1RIPA 4HEDA 1YIJA 1XPUA 3I4NG 1B3AA 2WAQB 3NXWA 3OTOL 5FO9B 3TZDA 3Q0AA 5JVG3 1JORA 4EQOA 4YHHL 2BH8A 2F0FA 1CA6A 4LF5Q 2QCPX 2MO1A 3I73A 1QUQB 1E2WA 1EWHA 3S2HH 1GVPA 1UE7A 1BNZA 3EIVA 2HQEA 1A3VA 1V1QA 4R4CA 3A0JA 3UDGA 2I46A 5M9OA 3CPWA 3FPUB 2L11A 5FJ8G 4HCEA 4PNYA 4KTAA 1D7QA 1AEXA 5ELOA 1NAPA 3HKZE 2PQAB 4G7HC 1QUQA 4LF7Q 2VL6A 4DV3Q 3ER0A 1PFNA 4RGMA 4GNXA 1GD7A 5C4JH 1AZPA 4CDDC 5DLQE 3BVGA 4S3SA 4FYDA 2JEAI 4LAAA 1JB3A 5IYBH 1EL0A 3L3OC 1E2VA 2JA5B 1RL2A 1E2ZA 1XNRL 2RHSB 3RNUA 2TSSA 2PQAA 1HA6A 4C3IB 2KCNA 2BDNA 1HUNA 2K1BA 2BE5D 2KA7A 2DNEA 2LFNA 5A35A 4QQBX 2JA6H 1U4PA 1PH7A 1QCBD 1V9PA 4R4OA 2WV6D 4NB3A 1RHPA 2OF1A 1D5MC 2G9DA 5IGBA 1O7YA 3HOUG 1SLJA 2E8GA 1RDPD 5DM63 3VR4A 3TDQA 5BN3A 3I55A 1QZGA 4DV1L 1ASYA 3E6ZX 3AU7A 1IKLA 3MZ5A 3ZYYX 4X64L 2CCZA 4N8FA 2I5HA 3P7JA 3HKZB 5M3MH 5COYA 4FF2A 5IGGA 1IBLQ 4HMIA 2ASBA 4IALA 4IOAA 1Q86C 4X3SA 1CHPD 4GNXC 2MPMA 3NBHB 3PUXA 1CZWA 1I4QA 1V43A 4WJWA 2ZJRA 1U4MA 5C4JB 3P75A 2R6GA 3SVMA 1MGSA 2RCNA 2R93G 1HZAA 2F4VQ 4TRDA 2E5LL 4DPGA 3NBHA 2K32A 3KOJA 4JI5Q 1GUWA 4FF4A 3PQIA 1TKWB 2XIWA 4OWTB 1IBKL 4I7AA 2C35B 5IYDH 1E22A 2K5QA 3UDIA 3JAML 3DMUA 1IZ6A 3BZKA 3I4MG 1LTTD 2K05A 4CKEA 4LFCL 4K5WA 3KFUA 3RR5A 4LUVA 4H7BA 4LMQD 3A7AB 5IODA 5BN4A 4CKBA 3W5OA 2R92H 1TR5A 1ZYRC 1NCVA 1ZYRD 2D0PA 3D8GA 2D0OA 3EROA 2ZXPA 5M3MB 3MXUA 2NYZD 3QB3A 3D0FA 4KY6A 2F0QA 3BYYB 1YHAA 1TXYA 2N88A 1B53A 3HP3A 4X62Q 4RMFA 5FLXc 3C3LA 2MHVA 4L6TB 4JC0A 1WTXA 1VQKA 1Y1WH 2PI2E 2NZ1D 3CQZH 1I6VC 2IY5B 2Q2HA 1GUNA 4YCVA 2JA6G 4K2KA 2NVTH 4ZUJA 3Q22A 2QEXA 1I4RA 1WTOA 3R2TA 4IPGA 1FVIA 5IGCA 4CDCC 2XRSD 3LWUA 2YU9B 3QJYA 3T1YL 1L2FA 4GLAC 4DUYL 1JE5A 1G91A 2M2LA 1O78A 2HHHL 3NENA 4HIMA 1HUMA 2ZM6Q 4BY1H 2B2VA 3ULJA 5C6AA 2K5NA 4A3LH 5G3LF 3WOFA 1KXLA 1K83H 3X3MA 1LACA 4HR7B 4G57A 3KBGA 1VQEA 1ILPA 2IW3A 1VQPA 4ODGA 3OWFA 4CKCA 4CJ1B 5EAYA 2R92B 1XX8A 2LMCB 2HT1A 1Q81C 1QVGA 1VQJA 4A3DH 5KIXA 2EY2A 2NB0A 1LV9A 5IYCG 1ICFB 1HFGA 5IT9E 2NZOA 4NW2A 5HY6A 4XYQA 4C3JH 2XGTA 4YY3L 1Y1WB 2UU9L 5C4HA 2AQ1B 4DV7Q 4WJ4A 3CQZB 4ZKBB 1VQ5A 2ALYB 4JI8L 5GADC 4FF3A 4GKJQ 1KIXA 4WFN3 1O7ZA 5IYDG 2PI2A 1VQ9A 1ET9A 3S1MH 1SYEA 4DR3Q 2F0UA 4B08A 3SE0A 4BS9A 2WP8J 2PW5A 4NXMQ 1HZ9A 1EIFA 3G7LA 3OHXC 3CC2A 2JA8G 2F3VA 3SEBA 2JSOA 4BY1B 1JICA 4BXXH 1JWSD 3CCEA 3FMCA 2VW9A 2F0LA 3OIQA 2XRQD 4JBJA 5C0XJ 1K83B 5IGFA 3EN2A 5CV7A 1KC8C 1Y1VG 3IRBA 2FMCA 4HN7A 1C4QA 2FHTA 1A62A 4NMZA 5ISRA 5C44H 1WTRA 3A55A 4JW0A 4HMJA 2WACA 3K0YA 4A3DB 4IPCA 5LMNQ 3GTQB 3CHBD 4MN3A 4B3ML 2RF4A 4QUCA 1S5FD 4KJNA 4GOPB 2EY5A 3QIAA 4CBVA 2UXCL 2J7ZA 1F2LA 1KTKA 2A1AA 2VXWA 2HIXA 4H0LC 4JI3L 3S1NB 4LF6L 5IOCA 3EFXD 1STHA 2VZAA 1V8QA 4DR2L 2TMPA 4K0KL 4A3JH 5KNDA 3I72A 1PH9A 3J7ZC 4KKUA 2WB1G 5C0XH 5K5PA 1PH3A 5K36G 4LFBQ 1LTLA 2BDOA 5BR8Q 3S1MB 4UPAA 4A3KB 2MJ8A 1P16A 4B3RL 5JPMC 1C9OA 5HGQA 1KHIA 4K14A 1I94Q 5LL6X 5GQOA 2G9HD 1STNA 4L5SA 3DEOA 3U4ZA 3GO5A 3TMEA 1JB7A 2R61A 1X6OA 3VR3A 2SOBA 2E2DC 4MTNA 3CC7A 5J3BA 2QDLA 4DV2L 2Q2IA 3TP8A 3TREA 5C4XH 1FD7D 3GTLB 4RAUC 5C44B 1FYCA 4C3JG 2XNAC 3PO2H 4NKLA 2AWNA 4DNTB 4TQUS 2F0TA 2KHIA 3K5OA 1LUZA 1QILA 1I4GA 3CW2C 3F2UA 4E6IA 2BOSA 1PH6A 3T53B 1SNPA 4RA8A 1B9NA 3C1FA 1F9SA 4DR6Q 3E0EA 1PHJA 3T16A 3HOZG 3S16H 4PV1C 2ZTEA 3ULLA 1EYCA 3FDTA 1TWFH 2HQLA 4A3JB 2EIFA 4C3HB 3J81i 5JJLA 4DV0L 1HNXQ 5ELCA 1X3PA 1NSNS 1V1PB 1U4LA 4UHVA 3DXJC 1R9TH 3LGJA 1ESFA 1TVXA 4A3BG 4A3MH 4LF9Q 3IL8A 2RSOA 1IYUA 1VQIA 2ENBA 3DWAA 2YTYA 2K7VA 4B9WA 4IJHA 2HCIA 2KHSA 3Q24A 1EWIA 3BZDB 4A3GG 1I5FA 1EWCA 1S5BD 3NP8A 2PQEA 4DR7L 2B39A 4JI2Q 2KCTA 1I4XA 3HS0C 2QA4A 3KDFB 2YTVA 5C4XB 1AN8A 2JN4A 4KD3A 1YHBA 3K58A 4LWCA 1G2SA 3PO2B 1C0AA 4DXGA 1HR0W 4A3CG 5A2QE 3QG1A 4A3IH 4J1MA 3H3VI 5LL6S 4DGZA 3PIPA 3G6EA 5C0XG 4MHEA 1FNVA 1LT4D 3KDFA 5IWAL 5C3EH 3FVQA 3PO3H 1SJHD 4GN5A 3S16B 2DJFC 2HCCA 4I7ZC 1OXTA 1TWFB 5FOBB 5GAGC 2IL8A 1STAA 3CCSA 1SE3A 1VQFA 4IJLA 2I0QA 2MO0A 4DV6L 1BOSA 1SNMA 5IP9G 1R9TB 1WTPA 1EY7A 1KNEA 3T1HQ 1G291 2KENA 2O5IC 2VUMH 1PVOA 3N52A 3GP7A 4XQJA 4JCVE 2FXQA 4A3FG 4OXPA 4EQNA 3NTIA 5GAHC 3G71A 1GXDC 1QWYA 4UDUC 1QE6A 1STYA 5IT9L 4NPSA 2VQEQ 3E5SA 3W3AA 2F0DA 3DLLA 2PNRC 4M8AA 3NQIA 1PH4A 4RGTA 4LF5L 3L9AX 4P71A 1STBA 1K3RA 4K5XA 5KEEA 4K6LA 2ATWA 3IKJA 4DAVA 3KJPA 1TS3A 1SYGA 4UY8C 4JG2A 2DN8A 1Q8IA 5HURA 1I4HA 1QNUA 1WTHA 5FLXE 1BXTA 3I4NH 3EJIA 4XTCS 4A3IB 3K5LA 2NVQH 3HZXA 2V4DA 1HR0Q 2B63B 4LK1C 5C3EB 4ME5A 1QZHA 3PO3B 2JA9A 1AE3A 1SR3A 5EPJA 2AUKA 1WI5A 2AUJD 1F9QA 3AB9A 3CPFA 4IFDJ 5M5XH 4K6DA 1UE1A 1F9PA 1LM0A 3KBXA 3MC0B 1D1IA 4X3TA 1BO0A 2GN5A 4ZCKA 4JVZA 2NVYB 3GTJH 1Q3LA 5FJ8H 1S5CD 2VQFQ 3J7YW 3R3OA 1LABA 4MIUA 4POFA 5EJWA 2IJ0A 3A8KE 1ML0D 2K5HA 2K28A 3RMHA 1QVCA 5ELNA 4ZYSA 3FKIG 2O2LD 3RZDH 1S3OA 1AP0A 1VQ8A 2QW7A 2N55A 3AFQA 3ERQA 4KN7C 4BY7B 2PCFB 4JI0Q 1IXRA 1FJGQ 2NN6I 3S9WA 4GKKQ 3S1QH 3PSIA 1UE5A 1RJTA 3J81E 4HJ9A 1IBMQ 3I4NB 1IBLL 2NVQB 1WYDA 2JJQA 5G3LD 4X6AH 2QGQA 3HOUH 3PF4A 1WTWA 2Q8TA 1W3SA 2HD3A 1IHZA 1WTVA 4P73A 2I5LX 2NZHA 1A8VA 1Z9FA 2F0PA 2A8VA 1YNJC 2VUMG 4DR1Q 1X3QA 2UXBL 5M5XB 1YNJD 2RDGA 4LNQA 3GTPB 1ZXTA 4KN4C 2RBMA 2F4VL 3PUWA 2XWBB 1CZGA 3VYUA 2EJGC 3ERSX 1VF5C 2N78A 3GTJB 4EQ5A 2M00A 3NE5B 3RLOA 4ILWA 2UUCQ 2EZVA 3X3NA 4O42A 3H09A 4C56C 2E74C 5IGEA 1JCKB 4IPHA 5M3FG 2YYZA 1U0LA 4U673 3RZDB 4FDBA 1YBYA 2HDMA 1CFMA 5E7NA 4L5RC 2K4KA 1EYAA 2R93H 1WJJA 1BCPF 3S1QB 4K2LA 4L5TA 2RCFA 3MHBA 1HFNA 2LXKA 3E9IA 1HNWQ 3CXCA 3PMFA 1JQYD 1VQHA 1EY5A 4IPDA 2WINB 4GNXB 3HOUB 2MFIA 4LF8Q 2KQ3A 1D2BA 2BA0A 2CH4A 3OW2A 2B8GA 1TS4A 3I4MH 3GQBA 2KUMA 3HOWG 1SJED 1SNCA 2EOTA 3HOYG 2HDLA 1KRTA 1IL2A 1S5ED 4KHPQ 4OL7A 3W2DA 4N8X1 1UEAB 3I8ZA 2XVSA 4L63B 1XNQL 4UP9A 2UUBQ 5DEHA 1TWHH 1JJGA 3ZJYC 4JYAQ 4P75A 4GN3B 1ZEQX 1VQNA 1EQVA 2EJMA 5A2QL 3BVZA 3CCLA 4QCLA 4IFDG 2BE5C 4ID6A 3SK6A 3KLRA 3KLWA 2DUDA 5JOBA 3GTGH 1SYFA 2GA4B 1PRTB 2R93B 3OMGA 1QJOA 4TKOB 3CCQA 3E3XA 3BDOA 1AZQA 3CCRA 1CTMA 3UI2A 2QILA 5EKKA 2LY7A 5DAUA 4KY7A 1KQSA 3GV3A 4JI6Q 1PA6A 1SSOA 3QO2A 2B8FA 4RGOS 5D14A 4F88A 3S2HB 1G2TA 1XMQQ 2MGSA 2F1MA 3I4MB 4DV7L 3F2CA 4J8QA 3MTSA 2PW7A 2RVLA 1DXMA 3K81C 4GKJL 3W1GA 4DR5Q 1TQOA 5E3FA 4PZ7A 1YJNA 4F87A 2DY7A 2EXDA 3QR8A 4IUUA 3H6MA 5NUCA 5JEAJ 3E0JA 5EKLA 1D1KA 1TWHB 4OELB 5IYCH 1PYSB 3VYSA 3L2PA 3HOXG 3V05A 3EQLC 3L7ZC 1C8CA 5FLXL 1JOQA 2DNCA 4FNFA 4RCNA 5IP7G 1EQQA 2PZTA 2JA6B 2PMZE 1NUCA 4L8JA 1LT3D 3D31A 2JYOA 2PZUA 4OGQC 3NWSA 4NDXA 2E2HH 1BBUA 1YHQA 5IIFA 2Z8LA 3NTKA 2MUYA 1TWAH 4O2DA 4NXNQ 4B3SQ 3PCOB 1HPCA 3NQTA 3GTKH 3IFTA 4IN3A 2JA8H 1WCMG 3T56B 1E7ZA 4QJFA 1TIID 1PRTC 5JEAH 4JBWA 2B2UA 1LTBD 1PRTD 3CKIB 5LMUQ 4AYBG 4B3TQ 2IX1A 3GTOH 3ICEA 4BA2I 1Y1VH 2NWGA 2IPKD 2MQHA 3DEPA 4CDFC 4GLXA 2H4OA 1PYBA 4PZ8A 3F2DA 1TWGH 2UUAQ 4LFBL 1N9WA 4CHTB 5BR8L 4EX5A 1NTGA 2IHEA 2A6HC 5CV5A 2A6HD 4HIOA 4JK1C 3AFPA 3UE0A 4DN4M 5E4XA 3F1ZA 3T4AC 2EQSA 5AJ3L 3J81L 2PMZB 1I94L 4Y7NH 1IKMA 4JI4L 2QDBA 3HRZC 3OSOA 1Q90A 5GAEC 1EY4A 2AQ3B 4MNOA 1PFMA 2F0NA 2ICEC 4X3UA 1Y14B 1EEFD 1AFPA 1LYLA 1BF4A 5K36H 1PTOF 2FMMA 3K8AA 3NUCA 1TWAB 2WB1E 3PIOA 3CCMA 2F0VA 4RFBA 1MKHA 3GTKB 3S1RH 2B2UC 2JA8B 1B50A 3CCUA 5TSSA 3I4OA 3WDNA 1LO5D 5LMNW 2K03A 4RCOA 1STEA 2ZT9C 3ULPA 3H0GG 1EZ6A 3MEFA 3GTOB 1PZJD 3BDCA 3SDZA 1HH2P 3WWVA 3U58A 1YJ9A 3U9OA 1HNXL 3MXPA 4IUVA 2CWAA 1K0SA 1B1ZA 1TWGB 1HNZL 2Z9HA 4OO1G 1FGBD 2R7ZG 4A76A 3P20A 3G6JB 3CU7A 4DNRB 2H5XA 1GM5A 4LF9L 2K14A 2NTSA 2NVTB 4CGYB 4R1JA 3UDXA 4HJ8A 2OT2A 3HOZH 4Y7NB 2NVXH 1RF2D 2F0MA 1X3GA 2CH4W 1DOLA 1SNOA 1FNWA 3NK9A 1STGA 4EVOA 3AEVA 2WB1B 1AW7A 1GUOA 5M5WH 1Q12A 1LTSD 4DK0A 2QEJC 2BH2A 3J7A5 1IYJB 5JEAG 2K5WA 2EYOA 3CC4A 4A3BH 2B2YA 3S1RB 3V96A 4XYOA 3ITPA 1CKMA 4XDXA 3VDYA 2PPBC 4A3GH 5L37A 3MXGA 3R8BA 1EIGA 2OQKA 1TY0A 2N49A 2KBNA 3TP5A 1QG7A 1YVCA 5KYIA 4K8IA 3C1EA 3VR6A 1PYWD 1U9RA 5IGDA 1HZCA 4C3JB 4B9XA 1XTCD 1E1TA 5JAVA 3V2TA 1XTDA 4XQNA 4A3CH 3T1HL 4O1NA 2EY6A 2PZWA 4YIJA 3U9SA 1SEBD 3M3YH 1A15A 4PMWA 4JV5Q 1EZ8A 4X65Q 1B3QA 1ZKOA 1II3A 4G7ZC 4LFCQ 2EVBA 3QOLA 3HOZB 2NVXB 1MHWC 5J39A 2VQEL 3FRPB 1ESRA 1IYVA 1MJCA 2SDFA 3R2IA 1K8MA 2F4IA 2K5VA 5M5WB 1EFID 4HSPA 2J4XA 1SYBA 1W6KA 4DK6C 4IQZA 4KLKA 2Q8IB 2B2YC 5C3WA 1PZKD 5IP9H 1L0WA 2CKZB 2Y0SG 4A3BB 1Y8OB 1U4RA 3URYA 1VQ4A 2IHFA 3NPPA 1J6QA 2ZXRA 3CCVA 4A3FH 1HR0L 1RTOA 1LTGD 4RG1A 2KEEA 4AQYQ 4A3GB 5KNBA 1JJCB 1PMRA 3PF5A 3CRLC 5BN5A 3OPOA 2HIVA 2Z6BA 2JXMB 4V190 3KF8B 3BZCA 3N6RA 1G8ZD 4N9TA 1T9HA 3AQQA 2RKSA 1KD1C 1JMCA 4JI7L 1D6EC 2CFMA 2VS1A 4U68A 5KRUA 2F0OA 2R7DA 1GJXA 3M3YB 5I9PA 1KLGD 2FJ2A 4NP5A 1X3EA 3S24A 2L0CA 3KF8A 1GUGA 3MA2B 3QWNA 4UAIA 2D2CC 3RN2A 2JP1A 1SNDA 3HOVG 1FR3A 1VMPA 5FK9C 4V0BA 1M4VA 2F03A 1N32Q 2D9UA 3KLSX 4A3KG 4JI0L 1A2TA 1FJGL 1X65A 3KF6B 3JC66 3M7NA 3PUYA 3TQYA 4GKKL 3TBIB 4JI1L 5CBEE 2ZJQA 1IBML 4C1NK 3HG9A 1EOTA 4GLVB 2WKCA 4DUZQ 1LTAD 4A3FB 3CRKC 4KKTA 4XQQA 4IO9A 2OCEA 3BG3A 3FKIH 4KV6A 4P72A 5CR3A 3KF6A 1B70B 4QF4A 1XMOQ 1I50H 1DOKA 5GROA 5C0XI 1H9JA 2IWHA 4WRDA 3M7GA 5KNCA 3A74A 1SN8A 1PDQA 1R4QB 3C46A 4FXDA 3T13A 4R4TA 1CM9A 3HFZB 1SDFA 2FINB 5I2XA 2UUCL 1WTQA 1SNQA 1WD0A 4J6HA 1VDZA 3VA7A 3S15H 2CVRA 1KAAA 4POGA 3SK8A 2MP1A 2PYKA 4G4KA 4RKLA 5JJIA 3C2PA 3Q8DA 1MJEA 4BA1I 5M5YH 1TT2A 3O13A 3I91A 4A3MB 4DU9A 4YCWA 4KD4A 2KHJA 1EOVA 4BBRG 1KDBA 1ENFA 2KCMA 1H9MA 3TSSA 4A4IA 2F3WA 1PXUA 4L5QA 1D5XC 1Q7YC 2EYJA 2A73B 4XIGS 4OWWB 1EQTA 2N8NA 1K28A 5HGTA 2IX3A 4LF6Q 4IUPA 3RZOH 1HNWL 2JA7G 2FFKB 3R93A 4K0KQ 1OXUA 1DCZA 1Q1BA 1CKNB 1DM0B 4DAPA 4LF8L 3NELA 1Z47A 4R9WA 5M3FH 3FKIB 4ZRZA 1YEZA 3GD7A 1CQVA 2VY3A 1PV4A 1JE4A 4DV4Q 1SE4A 5LHY1 2IT1A 1EIYB 1Q8KA 3NBIA 1R4PB 2WKDA 1HXYD 4LF7L 2X6LA 4DV3L 1KDCA 1Y69U 1CKNA 1PH8A 1HZBA 2UUBL 5C3XA 3TEHB 1M90C 1D5ZC 4J15A 1PFBA 4HJ7A 4JYAL 1VQ7A 2KOLA 4RKBA 2QKIC 5FO8B 1B2TA 4RH6A 1EEID 4ALPA 2EDGA 3CMAA 5JPNC 3BU2A 4H02A 1NMGA 4IOCA 1A2UA 3MFGA 5M5YB 3HOWH 2VUMB 3IFDA 3M4YA 2O5JC 3CF5A 3VR2A 1VMCA 3H94A 3HOYH 3IAYA 5JJKA 3B6YA 1EUJA 4N9PA 3CAMA 3DWQA 3A8IE 4QMGA 1OTCA 1GUSA 3K59A 3KJOA 2F0JA 2A6EC 3RZOB 1EU3A 3KK7A 2A6ED 4TSSA 4JPBW 3GTPH 4BBSG 5EPLA 2ID0A 3MAQA 3EVQA 1Y8PB 5I4DA 1XMQL 4ZAIA 1MBYA 3HGBA 2OTJA 1Y8NB 4XT1B 4H13C 3D4DA 5M3FB 1BKBA 4IFDH 4HAEA 2RA4A 3AYHB 1SYDA 1L0XB 5E4WC 2Q2TA 1J8IA 2SNMA 3HEJA 4YWMA 1HTPA 4R4IA 4ZLTF 2K50A 2WFWA 1MI2A 4R8IA 4CDEC 4KY5A 1A0IA 1NMFA 1HQMC 2NN6G 5I2YA 4OEMB 4HJ5A 5FO7B 1X56A 4A3EG 2JE6I 5T1IA 3G4SA 2F0EA 3D4WA 1NY4A 2XTIA 2UXDQ 3HOWB 4QB4A 4JI5L 1L0YB 1OO9B 2EYLA 4DKAC 5JJZA 1XPRA 1EFWA 3HOYB 1YNXA 1NR4A 1S72A 3K57A 3M85A 4Y52H 4HCSA 2E76C 4LF4Q 5EKIA 3FEWX 1SXTA 2E2IH 1CHQD 1E3PA 4NXNL 4A93G 4B3SL 1AE2A 5D3IB 5IWAQ 1K8GA 1SROA 1A3UA
chains in the Genus database with same CATH topology
1PFSA 3HOXH 4B3ML 2UUBQ 2JA8H 4A3EH 1K9MC 2RF4A 3I7FA 1WCMG 4B3MQ 4GS3A 1E7ZA 4GOPB 4QJFA 5LMUL 4JBWA 5LMUQ 2UXCL 1WFQA 2UXCQ 2A1AA 4JI3L 4AYBG 2HIXA 1N36L 4JI3Q 4B3TL 1N36Q 4B3TQ 2IX1A 3GTOH 3ICEA 4LF6L 5IP7H 1KRSA 1Y1VH 4BA2I 2MQHA 2VZAA 4DR2L 3S2DH 4DR2Q 4K0KL 3UDFA 4GLXA 4A3JH 2JK8A 5IE8A 5FLMH 1A63A 2NVYH 4C3IH 1PYBA 4PZ8A 1PH9A 3J7ZC 1S40A 4X62L 3F2DA 2WB1G 2UUAL 1TWGH 2UUAQ 3MXNB 4A93H 1J5EL 1PH3A 4LFBL 1N9WA 1J5EQ 2MNAA 4LFBQ 5C4XG 5K36G 1LTLA 5BR8L 4EX5A 1NTGA 5BR8Q 2IHEA 4UPAA 3J80c 1BVSA 3K7AH 4HIOA 4UP8A 1P16A 3PO2G 1WCMH 3AFPA 3UE0A 4OX9L 4OX9Q 4KHPL 1N34L 1N34Q 3F1ZA 2ZJPA 2EQSA 4B3RL 1C9OA 4MZ9A 5AJ3L 1YITA 1NE3A 5HGQA 4BY7H 4B3RQ 1KHIA 1I94L 1FL0A 4Y7NH 1I94Q 1MIUA 2B3GA 2RHQB 4JI4L 5GQOA 3SGIA 3I56A 1M1KC 5GAEC 4WJ3M 1L1OB 4AYBE 3U4ZA 4L5SA 4MNOA 3GO5A 3M9BA 1JB7A 1PH2A 1X6OA 4DAMA 2ZM6L 1Y14B 4MTNA 3CC7A 5J3BA 4DV2L 1DGSA 2Q2IA 2GVAA 4DV2Q 1LYLA 3TREA 5C4XH 1YJWA 1CSPA 3K8AA 3TS2A 4IFDI 4A75A 3NEMA 2WB1E 4LFAL 4DAYB 4LFAQ 3PIOA 3CCMA 2AWNA 1X9NA 2PNHA 3PO2H 4TQUS 1SRUA 1MKHA 2KHIA 3KYHC 3S1RH 1LUZA 3CW2C 1VQAA 3CCUA 1L1OA 4A3MG 3I4OA 1PH6A 3CCJA 1N33L 5LMNW 1N33Q 4R4QA 1CSQA 3ULPA 3H0GG 1YZ6A 3J81j 3E0EA 4DR6Q 2WAQG 1HJPA 3M4QA 3MEFA 5IT9c 1PHJA 3OYYA 3HOZG 4P74A 3S16H 1XJVA 3RN5A 1VQGA 4JI6L 2ZTEA 3ULLA 3TRZA 4JI7Q 1TWFH 1HH2P 2HQLA 2B29A 3WWVA 3U58A 2EIFA 1YJ9A 1HNXL 3J81i 5JJLA 4DV0L 1HNXQ 4DV0Q 2CWAA 3M4OH 1HNZL 4OO1G 4GN4B 2R7ZG 2F52A 4A76A 4OWXB 1OXVA 2Z6KA 3GDEA 2H5XA 1R9TH 1C7YA 3LGJA 4UP7A 3TS0A 2OTLA 4A3BG 1GM5A 4LF9L 4A3MH 2K14A 4LF9Q 1NJIC 4DV5L 2BA1A 4DV5Q 4R1JA 3UDXA 1VQIA 4HJ8A 4DR5L 3H0GH 2YTYA 4A3IG 3CMEA 3HOZH 4IJHA 2NVXH 3CD6A 4DR3L 1EWIA 3PV0A 2B63G 4PG3A 5H1SE 1X55A 4AH6A 2CQOA 4A3GG 1I5FA 1X3GA 5C3EG 4DR7L 1VQLA 3PO3G 4DR7Q 4JI1Q 2WAQE 4NXML 4JI2Q 2KCTA 3AEVA 3K7UC 1BBWA 2QA4A 5M5WH 1Q12A 3KDFB 2BH2A 2YTVA 2R7ZH 2YTXA 1QVFA 3J7A5 1IYJB 1VQMA 5JEAG 1YHBA 4YWKA 4LWCA 3CC4A 1UWVA 4A3BH 2JA5G 1L1OC 2OQ0A 1C0AA 3L0OA 3G48A 1HR0W 4A3CG 5FLMG 1ASZA 2IX0A 1CKMA 4A3IH 2UXBQ 3H3VI 3UE1A 3PIPA 2Z0SA 3G6EA 5C0XG 3VDYA 2L15A 4A3GH 1JJ2A 3KDFA 2F3IA 4APVA 5IWAL 5C3EH 2OQKA 3PO3H 5LMNL 4GN5A 3K0XA 2Q2UA 2DGYA 2KBNA 2N49A 1PH5A 1OXTA 1SMXA 1YVCA 5GAGC 2YU9H 1VS0A 1UE6A 4DR4L 4DR4Q 3CCSA 1PH1A 2Z6KC 1TWCH 1UEBA 4O0AA 1HZCA 1SE8A 1VQFA 4IJLA 1E1TA 4YCUA 4X66L 5IY0A 1XTDA 4X66Q 2I0QA 4BY7G 2JA5H 2MO0A 4QIWE 4DV6L 2ZTDA 4DV6Q 5IP9G 4A3CH 2CWPA 3T1HL 1G6PA 3T1HQ 1G291 2KENA 3FP9A 3W1BA 2VUMH 1PVOA 2AWOA 3HKSA 3M3YH 4JV5L 1K8AC 1RIPA 2JQOA 3HKZG 4PMWA 4X65L 4JV5Q 4X65Q 1YIJA 1XPUA 4JCVE 3I4NG 4LFCQ 2FXQA 4A3FG 3OTOL 4OXPA 3J80i 5GAHC 3OTOQ 1I6HH 3G71A 4NPSA 2VQEL 2VQEQ 1E24A 1MJCA 1D8LA 4YHHL 3DLLA 4YHHQ 1SFOH 2BH8A 2K5VA 1CUKA 1Q82C 1PH4A 4LF5L 1KAWA 4P71A 4LF5Q 1K3RA 2MO1A 1H95A 1QUQB 4DK6C 1JJGA 4KLKA 3S2HH 1GVPA 2ATWA 1UE7A 5IP9H 3EIVA 4JBKA 1L0WA 3KJPA 3A5UA 2CKZB 2LSSA 5IYBG 2Y0SG 4UY8C 4JG2A 1Q1EA 1V1QA 4R4CA 3A0JA 3UDGA 4YWLA 1VQ4A 2IHFA 3CPWA 1J6QA 3I4NH 2LXJA 4XTCS 3CCVA 2NVQH 4A3FH 5FJ8G 1HR0L 2E2JH 4RG1A 3PUVA 4AQYL 1HR0Q 4AQYQ 1FGUA 1D7QA 5ELOA 3HKZE 2PQAB 1JJCB 3PF5A 1QZHA 1QUQA 4JOIA 2JA9A 4LF7Q 1AE3A 2VL6A 3JAMc 2HIVA 1SR3A 4DV3Q 3ER0A 4GNXA 1GD7A 1WI5A 5C4JH 1XNQQ 4PZ6A 3KF8B 3BZCA 3CPFA 5DLQE 5M5XH 3F2BA 4IFDJ 1UE1A 1LM0A 2JEAI 4DR6L 1T9HA 3AQQA 5IYBH 4LW1A 1RL2A 1XNRL 2RHSB 1KD1C 1JMCA 4JI7L 1XNRQ 3RNUA 2CFMA 2GN5A 2PQAA 2VS1A 1GO3E 2R7DA 3GTJH 2Y0SE 5FJ8H 4OO1I 2VQFQ 5M3MG 4QQBX 3PGZA 2JA6H 1NBWA 1PH7A 1X3EA 3S24A 4POFA 1V9PA 4R4OA 2JEBI 1K73C 4NB3A 2K5HA 3RN2A 3HOUG 1SLJA 1VCIA 3HOVG 2E8GA 1QVCA 5ELNA 1KL9A 3FKIG 2V1CC 1S3OA 3STBC 3I55A 3RZDH 1QZGA 1VQ8A 3STBD 1N32L 3AFQA 4DV1L 3GTQH 1N32Q 4DV1Q 4A3KG 4JI0L 1ASYA 4JI0Q 1FJGL 1IXRA 1FJGQ 1X65A 2NN6I 3JC66 1VQCA 3KF6B 3J81c 3M7NA 3PUYA 3A5ZB 2AKWB 3S14H 3TQYA 4X64L 3S1NH 4GKKL 1CKOA 4JI1L 4X64Q 2CCZA 4JI2L 3S1QH 2I5HA 3PSIA 1UE5A 3K80C 4GKKQ 3M4PA 5M3MH 1IBML 2ZJQA 2GVBA 3EBEA 4HJ9A 1IBMQ 1IBLL 4DUZL 4GLVB 1WYDA 1IBLQ 4DUZQ 2JJQA 2ASBA 4JOIC 4IOAA 1I3QH 4X6AH 2QGQA 1EQRA 1Q86C 4KI0A 3HOUH 3PF4A 4GNXC 3HOVH 4IO9A 2R7FA 2OCEA 3NBHB 3FKIH 3PUXA 1AH9A 1W3SA 4P72A 3RLNA 3KF6A 4P73A 1B70B 2I5LX 1V43A 2ZTCA 2ZJRA 2NZHA 1XMOL 3F8TA 1XMOQ 1A8VA 1I50H 1Z9FA 4A3KH 2A8VA 5GROA 4DR1Q 5C0XI 2VUMG 4LNQA 1O7IA 2R6GA 3BJUA 3A74A 2RCNA 1SN8A 2I5MX 2R93G 2F4VL 3PUWA 1HZAA 2F4VQ 3PUZA 3ERSX 2R92G 4R4TA 2E5LL 2N78A 2E5LQ 4DPGA 4EQ5A 1VQ6A 3HFZB 3KOJA 3U4VA 2A19A 3RLOA 1U5KA 2UUCL 2UUCQ 4JI5Q 4LUZA 1OXSC 3S15H 1Q46A 4OWTB 3H15A 4POGA 1IBKL 5JJIA 1WOCA 1IBKQ 2C35B 5IYDH 3Q8DA 1MJEA 1E22A 4BA1I 3UDIA 5M5YH 3GTLH 4IPHA 5M3FG 2YYZA 3S17H 1IZ6A 1U0LA 4FDBA 3BZKA 3I2ZA 1YBYA 4YCWA 1Y1WG 3I4MG 5E7NA 4LFCL 4L5RC 1GKHA 3KFUA 2KHJA 3RR5A 1P8LA 2K4KA 1EOVA 4LUVA 3FHWA 4BBRG 1XPOA 4JI4Q 2KCMA 4A4IA 2R93H 4L5QA 1Q7YC 3W5OA 2R92H 1WJJA 4XIGS 4OWWB 2D0PA 4L5TA 2D0OA 2N8NA 1YI2A 3RZOH 4LF6Q 2LXKA 3E9IA 1HNWL 2JA7G 1HNWQ 3CXCA 4K0KQ 1VQHA 3D0FA 1B8AA 1OXUA 1Q1BA 4C3HH 1K0RA 4IPDA 1YHAA 1TXYA 1CKNB 4GNXB 4X62Q 4RMFA 5FLXc 2MFIA 4LF8L 3NELA 1Z47A 4LF8Q 3H3VH 4BY1G 2BA0A 5M3FH 2YV5A 3OW2A 4GOPA 4JC0A 4A3LG 3I4MH 1YEZA 3GD7A 1Y1WH 1VQKA 2PI2E 4HIKA 2UXBL 2VY3A 3CQZH 1PV4A 3HOWG 4DV4L 2IY5B 2K75A 2Q2HA 4DV4Q 4BBRH 3GTMH 3HOYG 1JT8A 2IT1A 4YCVA 1EIYB 1KRTA 2JA6G 1Q8KA 1IL2A 2NVTH 4KHPQ 2QEXA 4LF7L 3JAMi 5AJ3Q 4DV3L 4IPGA 1EYGA 1FVIA 4TVAB 1CKNA 1PH8A 1XNQL 3CP0A 1HZBA 2UUBL 2JA7H 4UP9A 3TEHB 1M90C 4J15A 4HJ7A 1L2FA 4GLAC 3T1YL 4DUYL 3T1YQ 1TWHH 1JE5A 4A3DG 4DUYQ 1VQ7A 3ZJYC 4JYAL 4C2MH 4P75A 2HHHL 3NENA 2OWOA 4GN3B 4HIMA 2HHHQ 4JYAQ 1VQNA 2ZM6Q 4ALPA 4QL5A 4BY1H 1VQDA 3ULJA 3CMAA 3BU2A 4H02A 1NMGA 2K5NA 4OONA 3CCLA 4A3LH 4IOCA 4DNIA 1KXLA 3HOWH 4IFDG 1K83H 2VQFL 3CF5A 3HOYH 3KLWA 2N3SA 3B6YA 2K52A 1EUJA 5JJKA 1VQEA 2DUDA 3GTGH 1VQPA 3CAMA 1X3FA 3CCQA 4QY7A 1VQOA 5EAYA 3CCRA 1OTCA 3KJOA 2HT1A 1Q81C 1QVGA 1VQJA 4A3DH 2VNUD 1KQSA 3GTPH 4BBSG 4JI6Q 1PA6A 2ID0A 1VQBA 4DK3C 5IYCG 1B7YB 1XMQL 4GOPC 2NZOA 1XMQQ 1N8RC 4JBMA 5HY6A 2OTJA 1HNZQ 4C3JH 2XGTA 1BKBA 2D62A 4BXXG 3DM3A 4YY3L 3AYHB 4YY3Q 4DV7L 2UU9L 4DV7Q 2UU9Q 4WJ4A 1VQ5A 2Q2TA 3F2CA 2ALYB 4YWMA 3K81C 4GKJL 4JI8L 4HJAA 5GADC 2AMCB 4QGUA 4JI8Q 3W1GA 4DR5Q 4GKJQ 3E9HA 4R4IA 2K50A 4LUOA 2WFWA 4PZ7A 1YJNA 1KIXA 2EXDA 4HIDA 5IYDG 2PI2A 1VQ9A 1G51A 3RLFA 1A0IA 1NMFA 5JEAJ 5C44G 3S1MH 4DR3Q 4BBSH 4KHZA 1E1OA 4DR1L 1W2BA 2NN6G 2AHOB 5IYCH 1PYSB 4HJ5A 4ME3A 2WP8J 4NXMQ 1HZ9A 1EIFA 1X56A 4AIMA 3L2PA 3HOXG 3CC2A 4A3EG 2JA8G 2JE6I 3G4SA 3L7ZC 4BXXH 3CCEA 2VW9A 1NY4A 2UXDL 2XTIA 4JBJA 5C0XJ 2UXDQ 4JI5L 3EN2A 1KC8C 4DKAC 1Y1VG 5IP7G 1XPRA 1EQQA 1EFWA 2PMZE 1YNXA 3IRBA 1S72A 3M85A 4A3JG 4LF4L 4Y52H 3D31A 4LF4Q 1OXXK 1X54A 2E2HH 2ES2A 2E2IH 1BBUA 1YHQA 3U50C 1A62A 5C44H 1E3PA 2B63H 4NXNL 1TWAH 4O2DA 4A93G 4NXNQ 4B3SL 1AE2A 5IWAQ 4B3SQ 3PCOB 1SROA 1K8GA 4IPCA 5LMNQ 3GTKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFS A;  3HOX H;  4B3M L;  2UUB Q;  2JA8 H;  4A3E H;  1K9M C;  2RF4 A;  3I7F A;  1WCM G;  4B3M Q;  4GS3 A;  1E7Z A;  4GOP B;  4QJF A;  5LMU L;  4JBW A;  5LMU Q;  2UXC L;  1WFQ A;  2UXC Q;  2A1A A;  4JI3 L;  4AYB G;  2HIX A;  1N36 L;  4JI3 Q;  4B3T L;  1N36 Q;  4B3T Q;  2IX1 A;  3GTO H;  3ICE A;  4LF6 L;  5IP7 H;  1KRS A;  1Y1V H;  4BA2 I;  2MQH A;  2VZA A;  4DR2 L;  3S2D H;  4DR2 Q;  4K0K L;  3UDF A;  4GLX A;  4A3J H;  2JK8 A;  5IE8 A;  5FLM H;  1A63 A;  2NVY H;  4C3I H;  1PYB A;  4PZ8 A;  1PH9 A;  3J7Z C;  1S40 A;  4X62 L;  3F2D A;  2WB1 G;  2UUA L;  1TWG H;  2UUA Q;  3MXN B;  4A93 H;  1J5E L;  1PH3 A;  4LFB L;  1N9W A;  1J5E Q;  2MNA A;  4LFB Q;  5C4X G;  5K36 G;  1LTL A;  5BR8 L;  4EX5 A;  1NTG A;  5BR8 Q;  2IHE A;  4UPA A;  3J80 c;  1BVS A;  3K7A H;  4HIO A;  4UP8 A;  1P16 A;  3PO2 G;  1WCM H;  3AFP A;  3UE0 A;  4OX9 L;  4OX9 Q;  4KHP L;  1N34 L;  1N34 Q;  3F1Z A;  2ZJP A;  2EQS A;  4B3R L;  1C9O A;  4MZ9 A;  5AJ3 L;  1YIT A;  1NE3 A;  5HGQ A;  4BY7 H;  4B3R Q;  1KHI A;  1I94 L;  1FL0 A;  4Y7N H;  1I94 Q;  1MIU A;  2B3G A;  2RHQ B;  4JI4 L;  5GQO A;  3SGI A;  3I56 A;  1M1K C;  5GAE C;  4WJ3 M;  1L1O B;  4AYB E;  3U4Z A;  4L5S A;  4MNO A;  3GO5 A;  3M9B A;  1JB7 A;  1PH2 A;  1X6O A;  4DAM A;  2ZM6 L;  1Y14 B;  4MTN A;  3CC7 A;  5J3B A;  4DV2 L;  1DGS A;  2Q2I A;  2GVA A;  4DV2 Q;  1LYL A;  3TRE A;  5C4X H;  1YJW A;  1CSP A;  3K8A A;  3TS2 A;  4IFD I;  4A75 A;  3NEM A;  2WB1 E;  4LFA L;  4DAY B;  4LFA Q;  3PIO A;  3CCM A;  2AWN A;  1X9N A;  2PNH A;  3PO2 H;  4TQU S;  1SRU A;  1MKH A;  2KHI A;  3KYH C;  3S1R H;  1LUZ A;  3CW2 C;  1VQA A;  3CCU A;  1L1O A;  4A3M G;  3I4O A;  1PH6 A;  3CCJ A;  1N33 L;  5LMN W;  1N33 Q;  4R4Q A;  1CSQ A;  3ULP A;  3H0G G;  1YZ6 A;  3J81 j;  3E0E A;  4DR6 Q;  2WAQ G;  1HJP A;  3M4Q A;  3MEF A;  5IT9 c;  1PHJ A;  3OYY A;  3HOZ G;  4P74 A;  3S16 H;  1XJV A;  3RN5 A;  1VQG A;  4JI6 L;  2ZTE A;  3ULL A;  3TRZ A;  4JI7 Q;  1TWF H;  1HH2 P;  2HQL A;  2B29 A;  3WWV A;  3U58 A;  2EIF A;  1YJ9 A;  1HNX L;  3J81 i;  5JJL A;  4DV0 L;  1HNX Q;  4DV0 Q;  2CWA A;  3M4O H;  1HNZ L;  4OO1 G;  4GN4 B;  2R7Z G;  2F52 A;  4A76 A;  4OWX B;  1OXV A;  2Z6K A;  3GDE A;  2H5X A;  1R9T H;  1C7Y A;  3LGJ A;  4UP7 A;  3TS0 A;  2OTL A;  4A3B G;  1GM5 A;  4LF9 L;  4A3M H;  2K14 A;  4LF9 Q;  1NJI C;  4DV5 L;  2BA1 A;  4DV5 Q;  4R1J A;  3UDX A;  1VQI A;  4HJ8 A;  4DR5 L;  3H0G H;  2YTY A;  4A3I G;  3CME A;  3HOZ H;  4IJH A;  2NVX H;  3CD6 A;  4DR3 L;  1EWI A;  3PV0 A;  2B63 G;  4PG3 A;  5H1S E;  1X55 A;  4AH6 A;  2CQO A;  4A3G G;  1I5F A;  1X3G A;  5C3E G;  4DR7 L;  1VQL A;  3PO3 G;  4DR7 Q;  4JI1 Q;  2WAQ E;  4NXM L;  4JI2 Q;  2KCT A;  3AEV A;  3K7U C;  1BBW A;  2QA4 A;  5M5W H;  1Q12 A;  3KDF B;  2BH2 A;  2YTV A;  2R7Z H;  2YTX A;  1QVF A;  3J7A 5;  1IYJ B;  1VQM A;  5JEA G;  1YHB A;  4YWK A;  4LWC A;  3CC4 A;  1UWV A;  4A3B H;  2JA5 G;  1L1O C;  2OQ0 A;  1C0A A;  3L0O A;  3G48 A;  1HR0 W;  4A3C G;  5FLM G;  1ASZ A;  2IX0 A;  1CKM A;  4A3I H;  2UXB Q;  3H3V I;  3UE1 A;  3PIP A;  2Z0S A;  3G6E A;  5C0X G;  3VDY A;  2L15 A;  4A3G H;  1JJ2 A;  3KDF A;  2F3I A;  4APV A;  5IWA L;  5C3E H;  2OQK A;  3PO3 H;  5LMN L;  4GN5 A;  3K0X A;  2Q2U A;  2DGY A;  2KBN A;  2N49 A;  1PH5 A;  1OXT A;  1SMX A;  1YVC A;  5GAG C;  2YU9 H;  1VS0 A;  1UE6 A;  4DR4 L;  4DR4 Q;  3CCS A;  1PH1 A;  2Z6K C;  1TWC H;  1UEB A;  4O0A A;  1HZC A;  1SE8 A;  1VQF A;  4IJL A;  1E1T A;  4YCU A;  4X66 L;  5IY0 A;  1XTD A;  4X66 Q;  2I0Q A;  4BY7 G;  2JA5 H;  2MO0 A;  4QIW E;  4DV6 L;  2ZTD A;  4DV6 Q;  5IP9 G;  4A3C H;  2CWP A;  3T1H L;  1G6P A;  3T1H Q;  1G29 1;  2KEN A;  3FP9 A;  3W1B A;  2VUM H;  1PVO A;  2AWO A;  3HKS A;  3M3Y H;  4JV5 L;  1K8A C;  1RIP A;  2JQO A;  3HKZ G;  4PMW A;  4X65 L;  4JV5 Q;  4X65 Q;  1YIJ A;  1XPU A;  4JCV E;  3I4N G;  4LFC Q;  2FXQ A;  4A3F G;  3OTO L;  4OXP A;  3J80 i;  5GAH C;  3OTO Q;  1I6H H;  3G71 A;  4NPS A;  2VQE L;  2VQE Q;  1E24 A;  1MJC A;  1D8L A;  4YHH L;  3DLL A;  4YHH Q;  1SFO H;  2BH8 A;  2K5V A;  1CUK A;  1Q82 C;  1PH4 A;  4LF5 L;  1KAW A;  4P71 A;  4LF5 Q;  1K3R A;  2MO1 A;  1H95 A;  1QUQ B;  4DK6 C;  1JJG A;  4KLK A;  3S2H H;  1GVP A;  2ATW A;  1UE7 A;  5IP9 H;  3EIV A;  4JBK A;  1L0W A;  3KJP A;  3A5U A;  2CKZ B;  2LSS A;  5IYB G;  2Y0S G;  4UY8 C;  4JG2 A;  1Q1E A;  1V1Q A;  4R4C A;  3A0J A;  3UDG A;  4YWL A;  1VQ4 A;  2IHF A;  3CPW A;  1J6Q A;  3I4N H;  2LXJ A;  4XTC S;  3CCV A;  2NVQ H;  4A3F H;  5FJ8 G;  1HR0 L;  2E2J H;  4RG1 A;  3PUV A;  4AQY L;  1HR0 Q;  4AQY Q;  1FGU A;  1D7Q A;  5ELO A;  3HKZ E;  2PQA B;  1JJC B;  3PF5 A;  1QZH A;  1QUQ A;  4JOI A;  2JA9 A;  4LF7 Q;  1AE3 A;  2VL6 A;  3JAM c;  2HIV A;  1SR3 A;  4DV3 Q;  3ER0 A;  4GNX A;  1GD7 A;  1WI5 A;  5C4J H;  1XNQ Q;  4PZ6 A;  3KF8 B;  3BZC A;  3CPF A;  5DLQ E;  5M5X H;  3F2B A;  4IFD J;  1UE1 A;  1LM0 A;  2JEA I;  4DR6 L;  1T9H A;  3AQQ A;  5IYB H;  4LW1 A;  1RL2 A;  1XNR L;  2RHS B;  1KD1 C;  1JMC A;  4JI7 L;  1XNR Q;  3RNU A;  2CFM A;  2GN5 A;  2PQA A;  2VS1 A;  1GO3 E;  2R7D A;  3GTJ H;  2Y0S E;  5FJ8 H;  4OO1 I;  2VQF Q;  5M3M G;  4QQB X;  3PGZ A;  2JA6 H;  1NBW A;  1PH7 A;  1X3E A;  3S24 A;  4POF A;  1V9P A;  4R4O A;  2JEB I;  1K73 C;  4NB3 A;  2K5H A;  3RN2 A;  3HOU G;  1SLJ A;  1VCI A;  3HOV G;  2E8G A;  1QVC A;  5ELN A;  1KL9 A;  3FKI G;  2V1C C;  1S3O A;  3STB C;  3I55 A;  3RZD H;  1QZG A;  1VQ8 A;  3STB D;  1N32 L;  3AFQ A;  4DV1 L;  3GTQ H;  1N32 Q;  4DV1 Q;  4A3K G;  4JI0 L;  1ASY A;  4JI0 Q;  1FJG L;  1IXR A;  1FJG Q;  1X65 A;  2NN6 I;  3JC6 6;  1VQC A;  3KF6 B;  3J81 c;  3M7N A;  3PUY A;  3A5Z B;  2AKW B;  3S14 H;  3TQY A;  4X64 L;  3S1N H;  4GKK L;  1CKO A;  4JI1 L;  4X64 Q;  2CCZ A;  4JI2 L;  3S1Q H;  2I5H A;  3PSI A;  1UE5 A;  3K80 C;  4GKK Q;  3M4P A;  5M3M H;  1IBM L;  2ZJQ A;  2GVB A;  3EBE A;  4HJ9 A;  1IBM Q;  1IBL L;  4DUZ L;  4GLV B;  1WYD A;  1IBL Q;  4DUZ Q;  2JJQ A;  2ASB A;  4JOI C;  4IOA A;  1I3Q H;  4X6A H;  2QGQ A;  1EQR A;  1Q86 C;  4KI0 A;  3HOU H;  3PF4 A;  4GNX C;  3HOV H;  4IO9 A;  2R7F A;  2OCE A;  3NBH B;  3FKI H;  3PUX A;  1AH9 A;  1W3S A;  4P72 A;  3RLN A;  3KF6 A;  4P73 A;  1B70 B;  2I5L X;  1V43 A;  2ZTC A;  2ZJR A;  2NZH A;  1XMO L;  3F8T A;  1XMO Q;  1A8V A;  1I50 H;  1Z9F A;  4A3K H;  2A8V A;  5GRO A;  4DR1 Q;  5C0X I;  2VUM G;  4LNQ A;  1O7I A;  2R6G A;  3BJU A;  3A74 A;  2RCN A;  1SN8 A;  2I5M X;  2R93 G;  2F4V L;  3PUW A;  1HZA A;  2F4V Q;  3PUZ A;  3ERS X;  2R92 G;  4R4T A;  2E5L L;  2N78 A;  2E5L Q;  4DPG A;  4EQ5 A;  1VQ6 A;  3HFZ B;  3KOJ A;  3U4V A;  2A19 A;  3RLO A;  1U5K A;  2UUC L;  2UUC Q;  4JI5 Q;  4LUZ A;  1OXS C;  3S15 H;  1Q46 A;  4OWT B;  3H15 A;  4POG A;  1IBK L;  5JJI A;  1WOC A;  1IBK Q;  2C35 B;  5IYD H;  3Q8D A;  1MJE A;  1E22 A;  4BA1 I;  3UDI A;  5M5Y H;  3GTL H;  4IPH A;  5M3F G;  2YYZ A;  3S17 H;  1IZ6 A;  1U0L A;  4FDB A;  3BZK A;  3I2Z A;  1YBY A;  4YCW A;  1Y1W G;  3I4M G;  5E7N A;  4LFC L;  4L5R C;  1GKH A;  3KFU A;  2KHJ A;  3RR5 A;  1P8L A;  2K4K A;  1EOV A;  4LUV A;  3FHW A;  4BBR G;  1XPO A;  4JI4 Q;  2KCM A;  4A4I A;  2R93 H;  4L5Q A;  1Q7Y C;  3W5O A;  2R92 H;  1WJJ A;  4XIG S;  4OWW B;  2D0P A;  4L5T A;  2D0O A;  2N8N A;  1YI2 A;  3RZO H;  4LF6 Q;  2LXK A;  3E9I A;  1HNW L;  2JA7 G;  1HNW Q;  3CXC A;  4K0K Q;  1VQH A;  3D0F A;  1B8A A;  1OXU A;  1Q1B A;  4C3H H;  1K0R A;  4IPD A;  1YHA A;  1TXY A;  1CKN B;  4GNX B;  4X62 Q;  4RMF A;  5FLX c;  2MFI A;  4LF8 L;  3NEL A;  1Z47 A;  4LF8 Q;  3H3V H;  4BY1 G;  2BA0 A;  5M3F H;  2YV5 A;  3OW2 A;  4GOP A;  4JC0 A;  4A3L G;  3I4M H;  1YEZ A;  3GD7 A;  1Y1W H;  1VQK A;  2PI2 E;  4HIK A;  2UXB L;  2VY3 A;  3CQZ H;  1PV4 A;  3HOW G;  4DV4 L;  2IY5 B;  2K75 A;  2Q2H A;  4DV4 Q;  4BBR H;  3GTM H;  3HOY G;  1JT8 A;  2IT1 A;  4YCV A;  1EIY B;  1KRT A;  2JA6 G;  1Q8K A;  1IL2 A;  2NVT H;  4KHP Q;  2QEX A;  4LF7 L;  3JAM i;  5AJ3 Q;  4DV3 L;  4IPG A;  1EYG A;  1FVI A;  4TVA B;  1CKN A;  1PH8 A;  1XNQ L;  3CP0 A;  1HZB A;  2UUB L;  2JA7 H;  4UP9 A;  3TEH B;  1M90 C;  4J15 A;  4HJ7 A;  1L2F A;  4GLA C;  3T1Y L;  4DUY L;  3T1Y Q;  1TWH H;  1JE5 A;  4A3D G;  4DUY Q;  1VQ7 A;  3ZJY C;  4JYA L;  4C2M H;  4P75 A;  2HHH L;  3NEN A;  2OWO A;  4GN3 B;  4HIM A;  2HHH Q;  4JYA Q;  1VQN A;  2ZM6 Q;  4ALP A;  4QL5 A;  4BY1 H;  1VQD A;  3ULJ A;  3CMA A;  3BU2 A;  4H02 A;  1NMG A;  2K5N A;  4OON A;  3CCL A;  4A3L H;  4IOC A;  4DNI A;  1KXL A;  3HOW H;  4IFD G;  1K83 H;  2VQF L;  3CF5 A;  3HOY H;  3KLW A;  2N3S A;  3B6Y A;  2K52 A;  1EUJ A;  5JJK A;  1VQE A;  2DUD A;  3GTG H;  1VQP A;  3CAM A;  1X3F A;  3CCQ A;  4QY7 A;  1VQO A;  5EAY A;  3CCR A;  1OTC A;  3KJO A;  2HT1 A;  1Q81 C;  1QVG A;  1VQJ A;  4A3D H;  2VNU D;  1KQS A;  3GTP H;  4BBS G;  4JI6 Q;  1PA6 A;  2ID0 A;  1VQB A;  4DK3 C;  5IYC G;  1B7Y B;  1XMQ L;  4GOP C;  2NZO A;  1XMQ Q;  1N8R C;  4JBM A;  5HY6 A;  2OTJ A;  1HNZ Q;  4C3J H;  2XGT A;  1BKB A;  2D62 A;  4BXX G;  3DM3 A;  4YY3 L;  3AYH B;  4YY3 Q;  4DV7 L;  2UU9 L;  4DV7 Q;  2UU9 Q;  4WJ4 A;  1VQ5 A;  2Q2T A;  3F2C A;  2ALY B;  4YWM A;  3K81 C;  4GKJ L;  4JI8 L;  4HJA A;  5GAD C;  2AMC B;  4QGU A;  4JI8 Q;  3W1G A;  4DR5 Q;  4GKJ Q;  3E9H A;  4R4I A;  2K50 A;  4LUO A;  2WFW A;  4PZ7 A;  1YJN A;  1KIX A;  2EXD A;  4HID A;  5IYD G;  2PI2 A;  1VQ9 A;  1G51 A;  3RLF A;  1A0I A;  1NMF A;  5JEA J;  5C44 G;  3S1M H;  4DR3 Q;  4BBS H;  4KHZ A;  1E1O A;  4DR1 L;  1W2B A;  2NN6 G;  2AHO B;  5IYC H;  1PYS B;  4HJ5 A;  4ME3 A;  2WP8 J;  4NXM Q;  1HZ9 A;  1EIF A;  1X56 A;  4AIM A;  3L2P A;  3HOX G;  3CC2 A;  4A3E G;  2JA8 G;  2JE6 I;  3G4S A;  3L7Z C;  4BXX H;  3CCE A;  2VW9 A;  1NY4 A;  2UXD L;  2XTI A;  4JBJ A;  5C0X J;  2UXD Q;  4JI5 L;  3EN2 A;  1KC8 C;  4DKA C;  1Y1V G;  5IP7 G;  1XPR A;  1EQQ A;  1EFW A;  2PMZ E;  1YNX A;  3IRB A;  1S72 A;  3M85 A;  4A3J G;  4LF4 L;  4Y52 H;  3D31 A;  4LF4 Q;  1OXX K;  1X54 A;  2E2H H;  2ES2 A;  2E2I H;  1BBU A;  1YHQ A;  3U50 C;  1A62 A;  5C44 H;  1E3P A;  2B63 H;  4NXN L;  1TWA H;  4O2D A;  4A93 G;  4NXN Q;  4B3S L;  1AE2 A;  5IWA Q;  4B3S Q;  3PCO B;  1SRO A;  1K8G A;  4IPC A;  5LMN Q;  3GTK H; 
#chains in the Genus database with same CATH topology
 1PFS A;  5T1G A;  3HOX H;  2K5D A;  1K9M C;  4GS3 A;  5LMU L;  1RCV D;  4CJ0 B;  3PIP 3;  1HCZ A;  1ENC A;  1O80 A;  4FVM A;  4B3T L;  2Z1C A;  1N36 Q;  5IP7 H;  2PO4 A;  4DXF A;  2A74 C;  3UDF A;  2JK8 A;  1A63 A;  4C3I H;  3VA5 A;  1S40 A;  4X62 L;  2RSN A;  4R8N A;  4FO2 A;  2UUA L;  3MXN B;  3MEH A;  1J5E Q;  2K33 A;  1HTL D;  3EA6 A;  3J80 c;  3K7A H;  2NBF A;  3A54 A;  4UP8 A;  1WCM H;  4OX9 Q;  1S4Z A;  4M1U B;  1N34 Q;  3TZU A;  1YIT A;  4RHR A;  1KDA A;  1FL0 A;  1KNA A;  3OWE B;  3MXN A;  1UNS A;  4WJ3 M;  4AYB E;  3M9B A;  2L1B A;  2ZM6 L;  2GVA A;  1LTR D;  1CSP A;  2E2I B;  2OEO A;  4EQP A;  3TS2 A;  4A75 A;  4IFD I;  2VB3 X;  1SMY C;  2F0H A;  3NEM A;  1SMY D;  5CGK A;  4LFA Q;  1X9N A;  3I70 A;  4IUQ A;  3KYH C;  3HOX B;  4RWS C;  1N33 Q;  3D4R A;  4R4Q A;  1CSQ A;  2LKV A;  5CV8 A;  1YZ6 A;  3J81 j;  1B44 D;  2WAQ G;  3M4Q A;  4XXE A;  3OYY A;  1BDO A;  4P74 A;  1XJV A;  3RN5 A;  3TRZ A;  1QOH A;  1O7L A;  5E1F A;  5ELF A;  3AMU A;  1EIH A;  1XWE A;  5DNF A;  3GDE A;  1C7Y A;  1ENA A;  3K7A B;  3TS0 A;  2OTL A;  1WCM B;  3VR5 A;  1SYC A;  5COR A;  1M8A A;  2BA1 A;  4DV5 Q;  2RQX A;  2A5H A;  4AYB B;  3H0G H;  2A69 C;  2LS0 1;  2F0S A;  2A69 D;  3CME A;  1LTI D;  4DR3 L;  3PV0 A;  4ABN A;  1X55 A;  5EQ0 A;  2CQO A;  4AH6 A;  1F2Y A;  3J7A V;  4NXM L;  3NWT A;  5CYU A;  3TP7 A;  3DHQ A;  2NTT A;  1BBW A;  2WII B;  4OO1 H;  2R7Z H;  2YTX A;  1QVF A;  1VQM A;  4IUT A;  4YWK A;  4ZQ3 A;  4G7O C;  1UWV A;  1H9S B;  2JA5 G;  4PMC A;  3L0O A;  2B2T A;  3GTG B;  5D65 A;  1ASZ A;  5C5M A;  4C3I G;  2UXB Q;  4FF1 A;  2AQ2 B;  1RD9 D;  2L15 A;  1JJ2 A;  5C4Z A;  5LMN L;  2DGY A;  3MWY W;  1SMX A;  1H9S A;  1B4O A;  2YU9 H;  1VS0 A;  4IUR A;  1UE6 A;  4DR4 Q;  2DJG C;  1PH1 A;  1TWC H;  2F0G A;  4O0A A;  1MSH A;  4X66 Q;  3I90 A;  4QIW E;  2ZTD A;  1EY8 A;  2EYM A;  2CWP A;  5J1Z A;  5EBD A;  2AWO A;  4JV5 L;  4DK1 A;  2B2W A;  4H44 C;  2JQO A;  2J0T D;  3HKZ G;  4X65 L;  1K8A C;  3H0G B;  2KCC A;  1I6H H;  3J80 i;  3OTO Q;  1W6J A;  4KHV A;  1E24 A;  2EYP A;  2X69 A;  4EGV A;  1D8L A;  4YHH Q;  1SFO H;  1Q82 C;  1CUK A;  1KAW A;  2R7Z B;  1H95 A;  4JBK A;  2B2T C;  4LJZ C;  2Z4H A;  3A5U A;  2LSS A;  5IYB G;  1DON A;  1Q1E A;  4YWL A;  5I9O A;  2LXJ A;  2E2H B;  4K5V A;  2E2J H;  4AQY L;  3PUV A;  4KKS A;  1V1O A;  1FGU A;  1HRJ A;  3DWP A;  2XSC A;  5CV6 A;  4JOI A;  3RD4 A;  4KMU C;  3JAM c;  1ILQ A;  3D6W A;  1XNQ Q;  4BWG B;  4QIW B;  4PZ6 A;  1CQF A;  3F2B A;  1TU2 B;  1Z7T A;  1TWC B;  4DR6 L;  4LW1 A;  1Y1V B;  1XNR Q;  2B2W C;  1GO3 E;  3K6O A;  1JWU D;  2Y0S E;  3SXH A;  4OO1 I;  4DFA A;  3DUZ A;  5M3M G;  3PGZ A;  1NBW A;  3BDL A;  3OIP A;  3BS1 A;  2JEB I;  2P5Z X;  1K73 C;  4RGN A;  1I6H B;  1H9K A;  4ULL A;  3TN2 A;  1VCI A;  1KL9 A;  2L9H A;  1EY6 A;  2V1C C;  3STB C;  1SFO B;  1JR0 D;  3STB D;  1N32 L;  3TP6 A;  3GTQ H;  4DV1 Q;  1QNK A;  5DM7 3;  1VQC A;  3J81 c;  3A5Z B;  2F0W A;  2AKW B;  3S14 H;  3S1N H;  1ROD A;  1CKO A;  1DZ1 A;  4X64 Q;  4JI2 L;  1HA5 A;  3K80 C;  3M4P A;  2GVB A;  3EBE A;  3BVM A;  4FP5 D;  4DUZ L;  4Q5V A;  2E2J B;  3QOJ A;  4JOI C;  1I3Q H;  3LX0 A;  2RDF A;  1EQR A;  1Z6H A;  1KLU D;  4KI0 A;  3HOV H;  4Q0F A;  1F77 A;  2EPB A;  2R7F A;  4DF7 A;  1AH9 A;  3RLN A;  3VYT A;  2ZTC A;  1XMO L;  3F8T A;  3ONA B;  4A3K H;  1BCP B;  2B2V C;  3H91 A;  3OMC A;  1O7I A;  2F0K A;  3BJU A;  5I6W A;  2Y0S B;  2L55 A;  5CV4 A;  1TS5 A;  2I5M X;  1NNX A;  3PUZ A;  3J7A F;  1EY0 A;  2R92 G;  3VYR A;  2E5L Q;  1J9O A;  1SBB B;  1VQ6 A;  3U4V A;  2A19 A;  1U5K A;  4LUZ A;  2HUG A;  1OXS C;  1Q46 A;  4GZY C;  3H15 A;  5D3D A;  1WOC A;  1IBK Q;  3LWE A;  3A56 A;  3GTL H;  3S17 H;  2L5T A;  3I2Z A;  1EY9 A;  1Y1W G;  2RDH A;  1PZI D;  1GKH A;  1P8L A;  3FHW A;  1XPO A;  2Q8R E;  3WOE A;  1BBX C;  4ZKC B;  3S14 B;  1CK1 A;  5CV9 A;  5ELD A;  4OHJ A;  1LT5 D;  3Q23 A;  4KJO A;  1F2M A;  1YI2 A;  2I07 B;  2KJX A;  1B8A A;  4C3H H;  5CMD A;  1K0R A;  1I3Q B;  1SAP A;  2ZXO A;  3HOV B;  3H3V H;  4BY1 G;  2YV5 A;  3MFY A;  4GOP A;  4A3L G;  3LNN A;  4HIK A;  2K01 A;  3KLS A;  4DV4 L;  2K75 A;  2OXP A;  4BBR H;  3GTM H;  1JT8 A;  1T5E A;  3SK5 A;  5I6Y A;  5C5L A;  3J80 E;  3JAM i;  4OIJ A;  5AJ3 Q;  1EYG A;  4TVA B;  1SE2 A;  2L12 A;  3CP0 A;  2JA7 H;  1S5D D;  4JI4 Q;  5JVH 3;  1JOO A;  3T1Y Q;  1BCP C;  4DUY Q;  4A3D G;  4C2M H;  1BCP D;  2OWO A;  3DM1 A;  2HHH Q;  1G6Z A;  4CJ2 C;  4QL5 A;  1VQD A;  4XT3 B;  1EU4 A;  4OON A;  2C5C A;  2H1E A;  3OW7 A;  3SHL A;  4ZUI A;  4DNI A;  1BR9 A;  3A7L A;  1E0B A;  3S17 B;  2VQF L;  2EY1 A;  4F8M A;  1JWM D;  4KK7 A;  2N3S A;  2K52 A;  2G5D A;  3A8J E;  2EYH A;  3ND9 A;  1LT6 D;  1X3F A;  4QY7 A;  1VQO A;  4C1N I;  1X32 A;  1IW7 C;  3PIO 3;  1UUP A;  1IW7 D;  4MTK A;  2VNU D;  2A68 C;  1MD2 D;  4PMB A;  2A68 D;  1YNN C;  4RHS A;  1VQB A;  2VB2 X;  4DK3 C;  1YNN D;  3Q6S A;  1B7Y B;  1GUT A;  4GOP C;  1CA5 A;  1N8R C;  4JBM A;  4HTH A;  1HNZ Q;  2D62 A;  4BXX G;  1MSG A;  3DM3 A;  4YY3 Q;  1PTO H;  2UU9 Q;  1GHJ A;  4BBR B;  1FNU A;  3GTM B;  4HJA A;  2AMC B;  4QGU A;  4JI8 Q;  3P1H A;  3E9H A;  4LUO A;  1I4P A;  5EPK A;  4HID A;  4FXG C;  1G51 A;  3RLF A;  5C44 G;  1V1P A;  2K6A A;  2JA7 B;  4BBS H;  4KHZ A;  1E1O A;  1RTN A;  1JC7 A;  4DR1 L;  1W2B A;  1EYD A;  1PRT F;  2AHO B;  2D5D A;  4ME3 A;  1TY2 A;  4PQX A;  5EBC A;  4C2M B;  5F2D A;  1ONL A;  4AIM A;  3NSW A;  2KVM A;  1C48 A;  2BCO A;  1WD1 A;  2L4N A;  2UXD L;  2O4X A;  1CT1 D;  4A3J G;  4LF4 L;  4C3H G;  3GV6 A;  1OXX K;  1BUV T;  1X54 A;  2ES2 A;  1H9R A;  3U50 C;  2B63 H;  2M9V A;  2NN6 H;  3MVV A;  1XYI A;  2ICI A;  1DJR D;  2KED A;  2F0I A;  1UAP A;  1HQR D;  4A3E H;  4B3M Q;  3I7F A;  3I3C A;  2DY8 A;  1WFQ A;  2UXC Q;  5KYL A;  1N36 L;  4JI3 Q;  4DA2 A;  3NTH A;  1T5X D;  1ET6 A;  1KRS A;  2EXZ A;  1PTO B;  3S2D H;  4DR2 Q;  4WOR A;  5FLM H;  5IE8 A;  2NVY H;  2K04 A;  3H3V C;  4A93 H;  1J5E L;  5C4X G;  2MNA A;  4I65 A;  1B9M A;  1CI3 M;  4BBS B;  1I50 B;  1BVS A;  3PO2 G;  4OX9 L;  1GHK A;  4KHP L;  1N34 L;  1DOM A;  2ZJP A;  4MZ9 A;  4B3R Q;  4BY7 H;  1NE3 A;  3OOC A;  5CC4 A;  1MIU A;  2B3G A;  2RHQ B;  3I56 A;  4IZ8 A;  3SGI A;  1M1K C;  1L1O B;  1HHV A;  4HSV A;  3D6C A;  1PH2 A;  4DAM A;  3NHH A;  3S15 B;  4QUF A;  4FXK C;  1DGS A;  4DV2 Q;  1ICW A;  3BYT B;  1YJW A;  5KGU A;  5AFW A;  4LFA L;  4DAY B;  2PNH A;  1DD2 A;  1SRU A;  1VF7 A;  2KEC A;  4K8J A;  4A3E B;  1VQA A;  1BQQ T;  1L1O A;  5ELE A;  4A3M G;  3CCJ A;  3FPP A;  1N33 L;  2NUC A;  3JAM E;  1LLR D;  1K3B C;  1HJP A;  5IT9 c;  2XWJ B;  1VQG A;  4JI6 L;  3RUZ A;  4JI7 Q;  3S2D B;  4OIK A;  2B29 A;  2CW0 C;  1TS2 A;  4DAY A;  2SNS A;  2CW0 D;  5CBA E;  4DV0 Q;  3M4O H;  1RKN A;  2E75 C;  2SEB D;  3KUP A;  4GN4 B;  4A93 B;  4Z9C B;  2F52 A;  1A3T A;  4OWX B;  1IL8 A;  1OXV A;  2Z6K A;  2CQA A;  1K8O A;  1PTO C;  4F7X A;  4UP7 A;  1PTO D;  5J22 A;  1KAB A;  1NJI C;  4DV5 L;  2EYF A;  4DR5 L;  5ELB A;  4X3K A;  3K5M A;  1NR2 A;  4A3I G;  2C9O A;  3CD6 A;  2B63 G;  4PG3 A;  5H1S E;  5C3E G;  2QF7 A;  1VQL A;  3PO3 G;  4DR7 Q;  1F2Z A;  4JI1 Q;  2WAQ E;  3K7U C;  3K5N A;  1WVL A;  1JOK A;  1A6X A;  2R3Z A;  1DYQ A;  1XXG A;  3ND8 A;  1L1O C;  2OQ0 A;  3J80 L;  3G48 A;  2XN9 C;  3I4L A;  5FLM G;  1PLF A;  2EE1 A;  2IX0 A;  3UE1 A;  2Z0S A;  4ZK9 B;  2F3I A;  4IUN A;  4APV A;  5EGT A;  2Q2U A;  3K0X A;  1PH5 A;  3SR1 A;  4DR4 L;  1QB5 D;  3M4O B;  2EJF C;  2Z6K C;  1UEB A;  1SE8 A;  4BY7 G;  4YCU A;  4X66 L;  5IY0 A;  3D3R A;  4P2C B;  3SK4 A;  2JA5 H;  5FKA C;  4DV6 Q;  2X6G A;  2CHB D;  1G6P A;  3FP9 A;  3W1B A;  1GOZ A;  2Z4I A;  3HKS A;  3T51 B;  1F9R A;  1RIP A;  4HED A;  1YIJ A;  1XPU A;  3I4N G;  1B3A A;  2WAQ B;  3NXW A;  3OTO L;  5FO9 B;  3TZD A;  3Q0A A;  5JVG 3;  1JOR A;  4EQO A;  4YHH L;  2BH8 A;  2F0F A;  1CA6 A;  4LF5 Q;  2QCP X;  2MO1 A;  3I73 A;  1QUQ B;  1E2W A;  1EWH A;  3S2H H;  1GVP A;  1UE7 A;  1BNZ A;  3EIV A;  2HQE A;  1A3V A;  1V1Q A;  4R4C A;  3A0J A;  3UDG A;  2I46 A;  5M9O A;  3CPW A;  3FPU B;  2L11 A;  5FJ8 G;  4HCE A;  4PNY A;  4KTA A;  1D7Q A;  1AEX A;  5ELO A;  1NAP A;  3HKZ E;  2PQA B;  4G7H C;  1QUQ A;  4LF7 Q;  2VL6 A;  4DV3 Q;  3ER0 A;  1PFN A;  4RGM A;  4GNX A;  1GD7 A;  5C4J H;  1AZP A;  4CDD C;  5DLQ E;  3BVG A;  4S3S A;  4FYD A;  2JEA I;  4LAA A;  1JB3 A;  5IYB H;  1EL0 A;  3L3O C;  1E2V A;  2JA5 B;  1RL2 A;  1E2Z A;  1XNR L;  2RHS B;  3RNU A;  2TSS A;  2PQA A;  1HA6 A;  4C3I B;  2KCN A;  2BDN A;  1HUN A;  2K1B A;  2BE5 D;  2KA7 A;  2DNE A;  2LFN A;  5A35 A;  4QQB X;  2JA6 H;  1U4P A;  1PH7 A;  1QCB D;  1V9P A;  4R4O A;  2WV6 D;  4NB3 A;  1RHP A;  2OF1 A;  1D5M C;  2G9D A;  5IGB A;  1O7Y A;  3HOU G;  1SLJ A;  2E8G A;  1RDP D;  5DM6 3;  3VR4 A;  3TDQ A;  5BN3 A;  3I55 A;  1QZG A;  4DV1 L;  1ASY A;  3E6Z X;  3AU7 A;  1IKL A;  3MZ5 A;  3ZYY X;  4X64 L;  2CCZ A;  4N8F A;  2I5H A;  3P7J A;  3HKZ B;  5M3M H;  5COY A;  4FF2 A;  5IGG A;  1IBL Q;  4HMI A;  2ASB A;  4IAL A;  4IOA A;  1Q86 C;  4X3S A;  1CHP D;  4GNX C;  2MPM A;  3NBH B;  3PUX A;  1CZW A;  1I4Q A;  1V43 A;  4WJW A;  2ZJR A;  1U4M A;  5C4J B;  3P75 A;  2R6G A;  3SVM A;  1MGS A;  2RCN A;  2R93 G;  1HZA A;  2F4V Q;  4TRD A;  2E5L L;  4DPG A;  3NBH A;  2K32 A;  3KOJ A;  4JI5 Q;  1GUW A;  4FF4 A;  3PQI A;  1TKW B;  2XIW A;  4OWT B;  1IBK L;  4I7A A;  2C35 B;  5IYD H;  1E22 A;  2K5Q A;  3UDI A;  3JAM L;  3DMU A;  1IZ6 A;  3BZK A;  3I4M G;  1LTT D;  2K05 A;  4CKE A;  4LFC L;  4K5W A;  3KFU A;  3RR5 A;  4LUV A;  4H7B A;  4LMQ D;  3A7A B;  5IOD A;  5BN4 A;  4CKB A;  3W5O A;  2R92 H;  1TR5 A;  1ZYR C;  1NCV A;  1ZYR D;  2D0P A;  3D8G A;  2D0O A;  3ERO A;  2ZXP A;  5M3M B;  3MXU A;  2NYZ D;  3QB3 A;  3D0F A;  4KY6 A;  2F0Q A;  3BYY B;  1YHA A;  1TXY A;  2N88 A;  1B53 A;  3HP3 A;  4X62 Q;  4RMF A;  5FLX c;  3C3L A;  2MHV A;  4L6T B;  4JC0 A;  1WTX A;  1VQK A;  1Y1W H;  2PI2 E;  2NZ1 D;  3CQZ H;  1I6V C;  2IY5 B;  2Q2H A;  1GUN A;  4YCV A;  2JA6 G;  4K2K A;  2NVT H;  4ZUJ A;  3Q22 A;  2QEX A;  1I4R A;  1WTO A;  3R2T A;  4IPG A;  1FVI A;  5IGC A;  4CDC C;  2XRS D;  3LWU A;  2YU9 B;  3QJY A;  3T1Y L;  1L2F A;  4GLA C;  4DUY L;  1JE5 A;  1G91 A;  2M2L A;  1O78 A;  2HHH L;  3NEN A;  4HIM A;  1HUM A;  2ZM6 Q;  4BY1 H;  2B2V A;  3ULJ A;  5C6A A;  2K5N A;  4A3L H;  5G3L F;  3WOF A;  1KXL A;  1K83 H;  3X3M A;  1LAC A;  4HR7 B;  4G57 A;  3KBG A;  1VQE A;  1ILP A;  2IW3 A;  1VQP A;  4ODG A;  3OWF A;  4CKC A;  4CJ1 B;  5EAY A;  2R92 B;  1XX8 A;  2LMC B;  2HT1 A;  1Q81 C;  1QVG A;  1VQJ A;  4A3D H;  5KIX A;  2EY2 A;  2NB0 A;  1LV9 A;  5IYC G;  1ICF B;  1HFG A;  5IT9 E;  2NZO A;  4NW2 A;  5HY6 A;  4XYQ A;  4C3J H;  2XGT A;  4YY3 L;  1Y1W B;  2UU9 L;  5C4H A;  2AQ1 B;  4DV7 Q;  4WJ4 A;  3CQZ B;  4ZKB B;  1VQ5 A;  2ALY B;  4JI8 L;  5GAD C;  4FF3 A;  4GKJ Q;  1KIX A;  4WFN 3;  1O7Z A;  5IYD G;  2PI2 A;  1VQ9 A;  1ET9 A;  3S1M H;  1SYE A;  4DR3 Q;  2F0U A;  4B08 A;  3SE0 A;  4BS9 A;  2WP8 J;  2PW5 A;  4NXM Q;  1HZ9 A;  1EIF A;  3G7L A;  3OHX C;  3CC2 A;  2JA8 G;  2F3V A;  3SEB A;  2JSO A;  4BY1 B;  1JIC A;  4BXX H;  1JWS D;  3CCE A;  3FMC A;  2VW9 A;  2F0L A;  3OIQ A;  2XRQ D;  4JBJ A;  5C0X J;  1K83 B;  5IGF A;  3EN2 A;  5CV7 A;  1KC8 C;  1Y1V G;  3IRB A;  2FMC A;  4HN7 A;  1C4Q A;  2FHT A;  1A62 A;  4NMZ A;  5ISR A;  5C44 H;  1WTR A;  3A55 A;  4JW0 A;  4HMJ A;  2WAC A;  3K0Y A;  4A3D B;  4IPC A;  5LMN Q;  3GTQ B;  3CHB D;  4MN3 A;  4B3M L;  2RF4 A;  4QUC A;  1S5F D;  4KJN A;  4GOP B;  2EY5 A;  3QIA A;  4CBV A;  2UXC L;  2J7Z A;  1F2L A;  1KTK A;  2A1A A;  2VXW A;  2HIX A;  4H0L C;  4JI3 L;  3S1N B;  4LF6 L;  5IOC A;  3EFX D;  1STH A;  2VZA A;  1V8Q A;  4DR2 L;  2TMP A;  4K0K L;  4A3J H;  5KND A;  3I72 A;  1PH9 A;  3J7Z C;  4KKU A;  2WB1 G;  5C0X H;  5K5P A;  1PH3 A;  5K36 G;  4LFB Q;  1LTL A;  2BDO A;  5BR8 Q;  3S1M B;  4UPA A;  4A3K B;  2MJ8 A;  1P16 A;  4B3R L;  5JPM C;  1C9O A;  5HGQ A;  1KHI A;  4K14 A;  1I94 Q;  5LL6 X;  5GQO A;  2G9H D;  1STN A;  4L5S A;  3DEO A;  3U4Z A;  3GO5 A;  3TME A;  1JB7 A;  2R61 A;  1X6O A;  3VR3 A;  2SOB A;  2E2D C;  4MTN A;  3CC7 A;  5J3B A;  2QDL A;  4DV2 L;  2Q2I A;  3TP8 A;  3TRE A;  5C4X H;  1FD7 D;  3GTL B;  4RAU C;  5C44 B;  1FYC A;  4C3J G;  2XNA C;  3PO2 H;  4NKL A;  2AWN A;  4DNT B;  4TQU S;  2F0T A;  2KHI A;  3K5O A;  1LUZ A;  1QIL A;  1I4G A;  3CW2 C;  3F2U A;  4E6I A;  2BOS A;  1PH6 A;  3T53 B;  1SNP A;  4RA8 A;  1B9N A;  3C1F A;  1F9S A;  4DR6 Q;  3E0E A;  1PHJ A;  3T16 A;  3HOZ G;  3S16 H;  4PV1 C;  2ZTE A;  3ULL A;  1EYC A;  3FDT A;  1TWF H;  2HQL A;  4A3J B;  2EIF A;  4C3H B;  3J81 i;  5JJL A;  4DV0 L;  1HNX Q;  5ELC A;  1X3P A;  1NSN S;  1V1P B;  1U4L A;  4UHV A;  3DXJ C;  1R9T H;  3LGJ A;  1ESF A;  1TVX A;  4A3B G;  4A3M H;  4LF9 Q;  3IL8 A;  2RSO A;  1IYU A;  1VQI A;  2ENB A;  3DWA A;  2YTY A;  2K7V A;  4B9W A;  4IJH A;  2HCI A;  2KHS A;  3Q24 A;  1EWI A;  3BZD B;  4A3G G;  1I5F A;  1EWC A;  1S5B D;  3NP8 A;  2PQE A;  4DR7 L;  2B39 A;  4JI2 Q;  2KCT A;  1I4X A;  3HS0 C;  2QA4 A;  3KDF B;  2YTV A;  5C4X B;  1AN8 A;  2JN4 A;  4KD3 A;  1YHB A;  3K58 A;  4LWC A;  1G2S A;  3PO2 B;  1C0A A;  4DXG A;  1HR0 W;  4A3C G;  5A2Q E;  3QG1 A;  4A3I H;  4J1M A;  3H3V I;  5LL6 S;  4DGZ A;  3PIP A;  3G6E A;  5C0X G;  4MHE A;  1FNV A;  1LT4 D;  3KDF A;  5IWA L;  5C3E H;  3FVQ A;  3PO3 H;  1SJH D;  4GN5 A;  3S16 B;  2DJF C;  2HCC A;  4I7Z C;  1OXT A;  1TWF B;  5FOB B;  5GAG C;  2IL8 A;  1STA A;  3CCS A;  1SE3 A;  1VQF A;  4IJL A;  2I0Q A;  2MO0 A;  4DV6 L;  1BOS A;  1SNM A;  5IP9 G;  1R9T B;  1WTP A;  1EY7 A;  1KNE A;  3T1H Q;  1G29 1;  2KEN A;  2O5I C;  2VUM H;  1PVO A;  3N52 A;  3GP7 A;  4XQJ A;  4JCV E;  2FXQ A;  4A3F G;  4OXP A;  4EQN A;  3NTI A;  5GAH C;  3G71 A;  1GXD C;  1QWY A;  4UDU C;  1QE6 A;  1STY A;  5IT9 L;  4NPS A;  2VQE Q;  3E5S A;  3W3A A;  2F0D A;  3DLL A;  2PNR C;  4M8A A;  3NQI A;  1PH4 A;  4RGT A;  4LF5 L;  3L9A X;  4P71 A;  1STB A;  1K3R A;  4K5X A;  5KEE A;  4K6L A;  2ATW A;  3IKJ A;  4DAV A;  3KJP A;  1TS3 A;  1SYG A;  4UY8 C;  4JG2 A;  2DN8 A;  1Q8I A;  5HUR A;  1I4H A;  1QNU A;  1WTH A;  5FLX E;  1BXT A;  3I4N H;  3EJI A;  4XTC S;  4A3I B;  3K5L A;  2NVQ H;  3HZX A;  2V4D A;  1HR0 Q;  2B63 B;  4LK1 C;  5C3E B;  4ME5 A;  1QZH A;  3PO3 B;  2JA9 A;  1AE3 A;  1SR3 A;  5EPJ A;  2AUK A;  1WI5 A;  2AUJ D;  1F9Q A;  3AB9 A;  3CPF A;  4IFD J;  5M5X H;  4K6D A;  1UE1 A;  1F9P A;  1LM0 A;  3KBX A;  3MC0 B;  1D1I A;  4X3T A;  1BO0 A;  2GN5 A;  4ZCK A;  4JVZ A;  2NVY B;  3GTJ H;  1Q3L A;  5FJ8 H;  1S5C D;  2VQF Q;  3J7Y W;  3R3O A;  1LAB A;  4MIU A;  4POF A;  5EJW A;  2IJ0 A;  3A8K E;  1ML0 D;  2K5H A;  2K28 A;  3RMH A;  1QVC A;  5ELN A;  4ZYS A;  3FKI G;  2O2L D;  3RZD H;  1S3O A;  1AP0 A;  1VQ8 A;  2QW7 A;  2N55 A;  3AFQ A;  3ERQ A;  4KN7 C;  4BY7 B;  2PCF B;  4JI0 Q;  1IXR A;  1FJG Q;  2NN6 I;  3S9W A;  4GKK Q;  3S1Q H;  3PSI A;  1UE5 A;  1RJT A;  3J81 E;  4HJ9 A;  1IBM Q;  3I4N B;  1IBL L;  2NVQ B;  1WYD A;  2JJQ A;  5G3L D;  4X6A H;  2QGQ A;  3HOU H;  3PF4 A;  1WTW A;  2Q8T A;  1W3S A;  2HD3 A;  1IHZ A;  1WTV A;  4P73 A;  2I5L X;  2NZH A;  1A8V A;  1Z9F A;  2F0P A;  2A8V A;  1YNJ C;  2VUM G;  4DR1 Q;  1X3Q A;  2UXB L;  5M5X B;  1YNJ D;  2RDG A;  4LNQ A;  3GTP B;  1ZXT A;  4KN4 C;  2RBM A;  2F4V L;  3PUW A;  2XWB B;  1CZG A;  3VYU A;  2EJG C;  3ERS X;  1VF5 C;  2N78 A;  3GTJ B;  4EQ5 A;  2M00 A;  3NE5 B;  3RLO A;  4ILW A;  2UUC Q;  2EZV A;  3X3N A;  4O42 A;  3H09 A;  4C56 C;  2E74 C;  5IGE A;  1JCK B;  4IPH A;  5M3F G;  2YYZ A;  1U0L A;  4U67 3;  3RZD B;  4FDB A;  1YBY A;  2HDM A;  1CFM A;  5E7N A;  4L5R C;  2K4K A;  1EYA A;  2R93 H;  1WJJ A;  1BCP F;  3S1Q B;  4K2L A;  4L5T A;  2RCF A;  3MHB A;  1HFN A;  2LXK A;  3E9I A;  1HNW Q;  3CXC A;  3PMF A;  1JQY D;  1VQH A;  1EY5 A;  4IPD A;  2WIN B;  4GNX B;  3HOU B;  2MFI A;  4LF8 Q;  2KQ3 A;  1D2B A;  2BA0 A;  2CH4 A;  3OW2 A;  2B8G A;  1TS4 A;  3I4M H;  3GQB A;  2KUM A;  3HOW G;  1SJE D;  1SNC A;  2EOT A;  3HOY G;  2HDL A;  1KRT A;  1IL2 A;  1S5E D;  4KHP Q;  4OL7 A;  3W2D A;  4N8X 1;  1UEA B;  3I8Z A;  2XVS A;  4L63 B;  1XNQ L;  4UP9 A;  2UUB Q;  5DEH A;  1TWH H;  1JJG A;  3ZJY C;  4JYA Q;  4P75 A;  4GN3 B;  1ZEQ X;  1VQN A;  1EQV A;  2EJM A;  5A2Q L;  3BVZ A;  3CCL A;  4QCL A;  4IFD G;  2BE5 C;  4ID6 A;  3SK6 A;  3KLR A;  3KLW A;  2DUD A;  5JOB A;  3GTG H;  1SYF A;  2GA4 B;  1PRT B;  2R93 B;  3OMG A;  1QJO A;  4TKO B;  3CCQ A;  3E3X A;  3BDO A;  1AZQ A;  3CCR A;  1CTM A;  3UI2 A;  2QIL A;  5EKK A;  2LY7 A;  5DAU A;  4KY7 A;  1KQS A;  3GV3 A;  4JI6 Q;  1PA6 A;  1SSO A;  3QO2 A;  2B8F A;  4RGO S;  5D14 A;  4F88 A;  3S2H B;  1G2T A;  1XMQ Q;  2MGS A;  2F1M A;  3I4M B;  4DV7 L;  3F2C A;  4J8Q A;  3MTS A;  2PW7 A;  2RVL A;  1DXM A;  3K81 C;  4GKJ L;  3W1G A;  4DR5 Q;  1TQO A;  5E3F A;  4PZ7 A;  1YJN A;  4F87 A;  2DY7 A;  2EXD A;  3QR8 A;  4IUU A;  3H6M A;  5NUC A;  5JEA J;  3E0J A;  5EKL A;  1D1K A;  1TWH B;  4OEL B;  5IYC H;  1PYS B;  3VYS A;  3L2P A;  3HOX G;  3V05 A;  3EQL C;  3L7Z C;  1C8C A;  5FLX L;  1JOQ A;  2DNC A;  4FNF A;  4RCN A;  5IP7 G;  1EQQ A;  2PZT A;  2JA6 B;  2PMZ E;  1NUC A;  4L8J A;  1LT3 D;  3D31 A;  2JYO A;  2PZU A;  4OGQ C;  3NWS A;  4NDX A;  2E2H H;  1BBU A;  1YHQ A;  5IIF A;  2Z8L A;  3NTK A;  2MUY A;  1TWA H;  4O2D A;  4NXN Q;  4B3S Q;  3PCO B;  1HPC A;  3NQT A;  3GTK H;  3IFT A;  4IN3 A;  2JA8 H;  1WCM G;  3T56 B;  1E7Z A;  4QJF A;  1TII D;  1PRT C;  5JEA H;  4JBW A;  2B2U A;  1LTB D;  1PRT D;  3CKI B;  5LMU Q;  4AYB G;  4B3T Q;  2IX1 A;  3GTO H;  3ICE A;  4BA2 I;  1Y1V H;  2NWG A;  2IPK D;  2MQH A;  3DEP A;  4CDF C;  4GLX A;  2H4O A;  1PYB A;  4PZ8 A;  3F2D A;  1TWG H;  2UUA Q;  4LFB L;  1N9W A;  4CHT B;  5BR8 L;  4EX5 A;  1NTG A;  2IHE A;  2A6H C;  5CV5 A;  2A6H D;  4HIO A;  4JK1 C;  3AFP A;  3UE0 A;  4DN4 M;  5E4X A;  3F1Z A;  3T4A C;  2EQS A;  5AJ3 L;  3J81 L;  2PMZ B;  1I94 L;  4Y7N H;  1IKM A;  4JI4 L;  2QDB A;  3HRZ C;  3OSO A;  1Q90 A;  5GAE C;  1EY4 A;  2AQ3 B;  4MNO A;  1PFM A;  2F0N A;  2ICE C;  4X3U A;  1Y14 B;  1EEF D;  1AFP A;  1LYL A;  1BF4 A;  5K36 H;  1PTO F;  2FMM A;  3K8A A;  3NUC A;  1TWA B;  2WB1 E;  3PIO A;  3CCM A;  2F0V A;  4RFB A;  1MKH A;  3GTK B;  3S1R H;  2B2U C;  2JA8 B;  1B50 A;  3CCU A;  5TSS A;  3I4O A;  3WDN A;  1LO5 D;  5LMN W;  2K03 A;  4RCO A;  1STE A;  2ZT9 C;  3ULP A;  3H0G G;  1EZ6 A;  3MEF A;  3GTO B;  1PZJ D;  3BDC A;  3SDZ A;  1HH2 P;  3WWV A;  3U58 A;  1YJ9 A;  3U9O A;  1HNX L;  3MXP A;  4IUV A;  2CWA A;  1K0S A;  1B1Z A;  1TWG B;  1HNZ L;  2Z9H A;  4OO1 G;  1FGB D;  2R7Z G;  4A76 A;  3P20 A;  3G6J B;  3CU7 A;  4DNR B;  2H5X A;  1GM5 A;  4LF9 L;  2K14 A;  2NTS A;  2NVT B;  4CGY B;  4R1J A;  3UDX A;  4HJ8 A;  2OT2 A;  3HOZ H;  4Y7N B;  2NVX H;  1RF2 D;  2F0M A;  1X3G A;  2CH4 W;  1DOL A;  1SNO A;  1FNW A;  3NK9 A;  1STG A;  4EVO A;  3AEV A;  2WB1 B;  1AW7 A;  1GUO A;  5M5W H;  1Q12 A;  1LTS D;  4DK0 A;  2QEJ C;  2BH2 A;  3J7A 5;  1IYJ B;  5JEA G;  2K5W A;  2EYO A;  3CC4 A;  4A3B H;  2B2Y A;  3S1R B;  3V96 A;  4XYO A;  3ITP A;  1CKM A;  4XDX A;  3VDY A;  2PPB C;  4A3G H;  5L37 A;  3MXG A;  3R8B A;  1EIG A;  2OQK A;  1TY0 A;  2N49 A;  2KBN A;  3TP5 A;  1QG7 A;  1YVC A;  5KYI A;  4K8I A;  3C1E A;  3VR6 A;  1PYW D;  1U9R A;  5IGD A;  1HZC A;  4C3J B;  4B9X A;  1XTC D;  1E1T A;  5JAV A;  3V2T A;  1XTD A;  4XQN A;  4A3C H;  3T1H L;  4O1N A;  2EY6 A;  2PZW A;  4YIJ A;  3U9S A;  1SEB D;  3M3Y H;  1A15 A;  4PMW A;  4JV5 Q;  1EZ8 A;  4X65 Q;  1B3Q A;  1ZKO A;  1II3 A;  4G7Z C;  4LFC Q;  2EVB A;  3QOL A;  3HOZ B;  2NVX B;  1MHW C;  5J39 A;  2VQE L;  3FRP B;  1ESR A;  1IYV A;  1MJC A;  2SDF A;  3R2I A;  1K8M A;  2F4I A;  2K5V A;  5M5W B;  1EFI D;  4HSP A;  2J4X A;  1SYB A;  1W6K A;  4DK6 C;  4IQZ A;  4KLK A;  2Q8I B;  2B2Y C;  5C3W A;  1PZK D;  5IP9 H;  1L0W A;  2CKZ B;  2Y0S G;  4A3B B;  1Y8O B;  1U4R A;  3URY A;  1VQ4 A;  2IHF A;  3NPP A;  1J6Q A;  2ZXR A;  3CCV A;  4A3F H;  1HR0 L;  1RTO A;  1LTG D;  4RG1 A;  2KEE A;  4AQY Q;  4A3G B;  5KNB A;  1JJC B;  1PMR A;  3PF5 A;  3CRL C;  5BN5 A;  3OPO A;  2HIV A;  2Z6B A;  2JXM B;  4V19 0;  3KF8 B;  3BZC A;  3N6R A;  1G8Z D;  4N9T A;  1T9H A;  3AQQ A;  2RKS A;  1KD1 C;  1JMC A;  4JI7 L;  1D6E C;  2CFM A;  2VS1 A;  4U68 A;  5KRU A;  2F0O A;  2R7D A;  1GJX A;  3M3Y B;  5I9P A;  1KLG D;  2FJ2 A;  4NP5 A;  1X3E A;  3S24 A;  2L0C A;  3KF8 A;  1GUG A;  3MA2 B;  3QWN A;  4UAI A;  2D2C C;  3RN2 A;  2JP1 A;  1SND A;  3HOV G;  1FR3 A;  1VMP A;  5FK9 C;  4V0B A;  1M4V A;  2F03 A;  1N32 Q;  2D9U A;  3KLS X;  4A3K G;  4JI0 L;  1A2T A;  1FJG L;  1X65 A;  3KF6 B;  3JC6 6;  3M7N A;  3PUY A;  3TQY A;  4GKK L;  3TBI B;  4JI1 L;  5CBE E;  2ZJQ A;  1IBM L;  4C1N K;  3HG9 A;  1EOT A;  4GLV B;  2WKC A;  4DUZ Q;  1LTA D;  4A3F B;  3CRK C;  4KKT A;  4XQQ A;  4IO9 A;  2OCE A;  3BG3 A;  3FKI H;  4KV6 A;  4P72 A;  5CR3 A;  3KF6 A;  1B70 B;  4QF4 A;  1XMO Q;  1I50 H;  1DOK A;  5GRO A;  5C0X I;  1H9J A;  2IWH A;  4WRD A;  3M7G A;  5KNC A;  3A74 A;  1SN8 A;  1PDQ A;  1R4Q B;  3C46 A;  4FXD A;  3T13 A;  4R4T A;  1CM9 A;  3HFZ B;  1SDF A;  2FIN B;  5I2X A;  2UUC L;  1WTQ A;  1SNQ A;  1WD0 A;  4J6H A;  1VDZ A;  3VA7 A;  3S15 H;  2CVR A;  1KAA A;  4POG A;  3SK8 A;  2MP1 A;  2PYK A;  4G4K A;  4RKL A;  5JJI A;  3C2P A;  3Q8D A;  1MJE A;  4BA1 I;  5M5Y H;  1TT2 A;  3O13 A;  3I91 A;  4A3M B;  4DU9 A;  4YCW A;  4KD4 A;  2KHJ A;  1EOV A;  4BBR G;  1KDB A;  1ENF A;  2KCM A;  1H9M A;  3TSS A;  4A4I A;  2F3W A;  1PXU A;  4L5Q A;  1D5X C;  1Q7Y C;  2EYJ A;  2A73 B;  4XIG S;  4OWW B;  1EQT A;  2N8N A;  1K28 A;  5HGT A;  2IX3 A;  4LF6 Q;  4IUP A;  3RZO H;  1HNW L;  2JA7 G;  2FFK B;  3R93 A;  4K0K Q;  1OXU A;  1DCZ A;  1Q1B A;  1CKN B;  1DM0 B;  4DAP A;  4LF8 L;  3NEL A;  1Z47 A;  4R9W A;  5M3F H;  3FKI B;  4ZRZ A;  1YEZ A;  3GD7 A;  1CQV A;  2VY3 A;  1PV4 A;  1JE4 A;  4DV4 Q;  1SE4 A;  5LHY 1;  2IT1 A;  1EIY B;  1Q8K A;  3NBI A;  1R4P B;  2WKD A;  1HXY D;  4LF7 L;  2X6L A;  4DV3 L;  1KDC A;  1Y69 U;  1CKN A;  1PH8 A;  1HZB A;  2UUB L;  5C3X A;  3TEH B;  1M90 C;  1D5Z C;  4J15 A;  1PFB A;  4HJ7 A;  4JYA L;  1VQ7 A;  2KOL A;  4RKB A;  2QKI C;  5FO8 B;  1B2T A;  4RH6 A;  1EEI D;  4ALP A;  2EDG A;  3CMA A;  5JPN C;  3BU2 A;  4H02 A;  1NMG A;  4IOC A;  1A2U A;  3MFG A;  5M5Y B;  3HOW H;  2VUM B;  3IFD A;  3M4Y A;  2O5J C;  3CF5 A;  3VR2 A;  1VMC A;  3H94 A;  3HOY H;  3IAY A;  5JJK A;  3B6Y A;  1EUJ A;  4N9P A;  3CAM A;  3DWQ A;  3A8I E;  4QMG A;  1OTC A;  1GUS A;  3K59 A;  3KJO A;  2F0J A;  2A6E C;  3RZO B;  1EU3 A;  3KK7 A;  2A6E D;  4TSS A;  4JPB W;  3GTP H;  4BBS G;  5EPL A;  2ID0 A;  3MAQ A;  3EVQ A;  1Y8P B;  5I4D A;  1XMQ L;  4ZAI A;  1MBY A;  3HGB A;  2OTJ A;  1Y8N B;  4XT1 B;  4H13 C;  3D4D A;  5M3F B;  1BKB A;  4IFD H;  4HAE A;  2RA4 A;  3AYH B;  1SYD A;  1L0X B;  5E4W C;  2Q2T A;  1J8I A;  2SNM A;  3HEJ A;  4YWM A;  1HTP A;  4R4I A;  4ZLT F;  2K50 A;  2WFW A;  1MI2 A;  4R8I A;  4CDE C;  4KY5 A;  1A0I A;  1NMF A;  1HQM C;  2NN6 G;  5I2Y A;  4OEM B;  4HJ5 A;  5FO7 B;  1X56 A;  4A3E G;  2JE6 I;  5T1I A;  3G4S A;  2F0E A;  3D4W A;  1NY4 A;  2XTI A;  2UXD Q;  3HOW B;  4QB4 A;  4JI5 L;  1L0Y B;  1OO9 B;  2EYL A;  4DKA C;  5JJZ A;  1XPR A;  1EFW A;  3HOY B;  1YNX A;  1NR4 A;  1S72 A;  3K57 A;  3M85 A;  4Y52 H;  4HCS A;  2E76 C;  4LF4 Q;  5EKI A;  3FEW X;  1SXT A;  2E2I H;  1CHQ D;  1E3P A;  4NXN L;  4A93 G;  4B3S L;  1AE2 A;  5D3I B;  5IWA Q;  1K8G A;  1SRO A;  1A3U A; 
#chains in the Genus database with same CATH homology
 1PFS A;  3HOX H;  4B3M L;  2UUB Q;  2JA8 H;  4A3E H;  1K9M C;  2RF4 A;  3I7F A;  1WCM G;  4B3M Q;  4GS3 A;  1E7Z A;  4GOP B;  4QJF A;  5LMU L;  4JBW A;  5LMU Q;  2UXC L;  1WFQ A;  2UXC Q;  2A1A A;  4JI3 L;  4AYB G;  2HIX A;  1N36 L;  4JI3 Q;  4B3T L;  1N36 Q;  4B3T Q;  2IX1 A;  3GTO H;  3ICE A;  4LF6 L;  5IP7 H;  1KRS A;  1Y1V H;  4BA2 I;  2MQH A;  2VZA A;  4DR2 L;  3S2D H;  4DR2 Q;  4K0K L;  3UDF A;  4GLX A;  4A3J H;  2JK8 A;  5IE8 A;  5FLM H;  1A63 A;  2NVY H;  4C3I H;  1PYB A;  4PZ8 A;  1PH9 A;  3J7Z C;  1S40 A;  4X62 L;  3F2D A;  2WB1 G;  2UUA L;  1TWG H;  2UUA Q;  3MXN B;  4A93 H;  1J5E L;  1PH3 A;  4LFB L;  1N9W A;  1J5E Q;  2MNA A;  4LFB Q;  5C4X G;  5K36 G;  1LTL A;  5BR8 L;  4EX5 A;  1NTG A;  5BR8 Q;  2IHE A;  4UPA A;  3J80 c;  1BVS A;  3K7A H;  4HIO A;  4UP8 A;  1P16 A;  3PO2 G;  1WCM H;  3AFP A;  3UE0 A;  4OX9 L;  4OX9 Q;  4KHP L;  1N34 L;  1N34 Q;  3F1Z A;  2ZJP A;  2EQS A;  4B3R L;  1C9O A;  4MZ9 A;  5AJ3 L;  1YIT A;  1NE3 A;  5HGQ A;  4BY7 H;  4B3R Q;  1KHI A;  1I94 L;  1FL0 A;  4Y7N H;  1I94 Q;  1MIU A;  2B3G A;  2RHQ B;  4JI4 L;  5GQO A;  3SGI A;  3I56 A;  1M1K C;  5GAE C;  4WJ3 M;  1L1O B;  4AYB E;  3U4Z A;  4L5S A;  4MNO A;  3GO5 A;  3M9B A;  1JB7 A;  1PH2 A;  1X6O A;  4DAM A;  2ZM6 L;  1Y14 B;  4MTN A;  3CC7 A;  5J3B A;  4DV2 L;  1DGS A;  2Q2I A;  2GVA A;  4DV2 Q;  1LYL A;  3TRE A;  5C4X H;  1YJW A;  1CSP A;  3K8A A;  3TS2 A;  4IFD I;  4A75 A;  3NEM A;  2WB1 E;  4LFA L;  4DAY B;  4LFA Q;  3PIO A;  3CCM A;  2AWN A;  1X9N A;  2PNH A;  3PO2 H;  4TQU S;  1SRU A;  1MKH A;  2KHI A;  3KYH C;  3S1R H;  1LUZ A;  3CW2 C;  1VQA A;  3CCU A;  1L1O A;  4A3M G;  3I4O A;  1PH6 A;  3CCJ A;  1N33 L;  5LMN W;  1N33 Q;  4R4Q A;  1CSQ A;  3ULP A;  3H0G G;  1YZ6 A;  3J81 j;  3E0E A;  4DR6 Q;  2WAQ G;  1HJP A;  3M4Q A;  3MEF A;  5IT9 c;  1PHJ A;  3OYY A;  3HOZ G;  4P74 A;  3S16 H;  1XJV A;  3RN5 A;  1VQG A;  4JI6 L;  2ZTE A;  3ULL A;  3TRZ A;  4JI7 Q;  1TWF H;  1HH2 P;  2HQL A;  2B29 A;  3WWV A;  3U58 A;  2EIF A;  1YJ9 A;  1HNX L;  3J81 i;  5JJL A;  4DV0 L;  1HNX Q;  4DV0 Q;  2CWA A;  3M4O H;  1HNZ L;  4OO1 G;  4GN4 B;  2R7Z G;  2F52 A;  4A76 A;  4OWX B;  1OXV A;  2Z6K A;  3GDE A;  2H5X A;  1R9T H;  1C7Y A;  3LGJ A;  4UP7 A;  3TS0 A;  2OTL A;  4A3B G;  1GM5 A;  4LF9 L;  4A3M H;  2K14 A;  4LF9 Q;  1NJI C;  4DV5 L;  2BA1 A;  4DV5 Q;  4R1J A;  3UDX A;  1VQI A;  4HJ8 A;  4DR5 L;  3H0G H;  2YTY A;  4A3I G;  3CME A;  3HOZ H;  4IJH A;  2NVX H;  3CD6 A;  4DR3 L;  1EWI A;  3PV0 A;  2B63 G;  4PG3 A;  5H1S E;  1X55 A;  4AH6 A;  2CQO A;  4A3G G;  1I5F A;  1X3G A;  5C3E G;  4DR7 L;  1VQL A;  3PO3 G;  4DR7 Q;  4JI1 Q;  2WAQ E;  4NXM L;  4JI2 Q;  2KCT A;  3AEV A;  3K7U C;  1BBW A;  2QA4 A;  5M5W H;  1Q12 A;  3KDF B;  2BH2 A;  2YTV A;  2R7Z H;  2YTX A;  1QVF A;  3J7A 5;  1IYJ B;  1VQM A;  5JEA G;  1YHB A;  4YWK A;  4LWC A;  3CC4 A;  1UWV A;  4A3B H;  2JA5 G;  1L1O C;  2OQ0 A;  1C0A A;  3L0O A;  3G48 A;  1HR0 W;  4A3C G;  5FLM G;  1ASZ A;  2IX0 A;  1CKM A;  4A3I H;  2UXB Q;  3H3V I;  3UE1 A;  3PIP A;  2Z0S A;  3G6E A;  5C0X G;  3VDY A;  2L15 A;  4A3G H;  1JJ2 A;  3KDF A;  2F3I A;  4APV A;  5IWA L;  5C3E H;  2OQK A;  3PO3 H;  5LMN L;  4GN5 A;  3K0X A;  2Q2U A;  2DGY A;  2KBN A;  2N49 A;  1PH5 A;  1OXT A;  1SMX A;  1YVC A;  5GAG C;  2YU9 H;  1VS0 A;  1UE6 A;  4DR4 L;  4DR4 Q;  3CCS A;  1PH1 A;  2Z6K C;  1TWC H;  1UEB A;  4O0A A;  1HZC A;  1SE8 A;  1VQF A;  4IJL A;  1E1T A;  4YCU A;  4X66 L;  5IY0 A;  1XTD A;  4X66 Q;  2I0Q A;  4BY7 G;  2JA5 H;  2MO0 A;  4QIW E;  4DV6 L;  2ZTD A;  4DV6 Q;  5IP9 G;  4A3C H;  2CWP A;  3T1H L;  1G6P A;  3T1H Q;  1G29 1;  2KEN A;  3FP9 A;  3W1B A;  2VUM H;  1PVO A;  2AWO A;  3HKS A;  3M3Y H;  4JV5 L;  1K8A C;  1RIP A;  2JQO A;  3HKZ G;  4PMW A;  4X65 L;  4JV5 Q;  4X65 Q;  1YIJ A;  1XPU A;  4JCV E;  3I4N G;  4LFC Q;  2FXQ A;  4A3F G;  3OTO L;  4OXP A;  3J80 i;  5GAH C;  3OTO Q;  1I6H H;  3G71 A;  4NPS A;  2VQE L;  2VQE Q;  1E24 A;  1MJC A;  1D8L A;  4YHH L;  3DLL A;  4YHH Q;  1SFO H;  2BH8 A;  2K5V A;  1CUK A;  1Q82 C;  1PH4 A;  4LF5 L;  1KAW A;  4P71 A;  4LF5 Q;  1K3R A;  2MO1 A;  1H95 A;  1QUQ B;  4DK6 C;  1JJG A;  4KLK A;  3S2H H;  1GVP A;  2ATW A;  1UE7 A;  5IP9 H;  3EIV A;  4JBK A;  1L0W A;  3KJP A;  3A5U A;  2CKZ B;  2LSS A;  5IYB G;  2Y0S G;  4UY8 C;  4JG2 A;  1Q1E A;  1V1Q A;  4R4C A;  3A0J A;  3UDG A;  4YWL A;  1VQ4 A;  2IHF A;  3CPW A;  1J6Q A;  3I4N H;  2LXJ A;  4XTC S;  3CCV A;  2NVQ H;  4A3F H;  5FJ8 G;  1HR0 L;  2E2J H;  4RG1 A;  3PUV A;  4AQY L;  1HR0 Q;  4AQY Q;  1FGU A;  1D7Q A;  5ELO A;  3HKZ E;  2PQA B;  1JJC B;  3PF5 A;  1QZH A;  1QUQ A;  4JOI A;  2JA9 A;  4LF7 Q;  1AE3 A;  2VL6 A;  3JAM c;  2HIV A;  1SR3 A;  4DV3 Q;  3ER0 A;  4GNX A;  1GD7 A;  1WI5 A;  5C4J H;  1XNQ Q;  4PZ6 A;  3KF8 B;  3BZC A;  3CPF A;  5DLQ E;  5M5X H;  3F2B A;  4IFD J;  1UE1 A;  1LM0 A;  2JEA I;  4DR6 L;  1T9H A;  3AQQ A;  5IYB H;  4LW1 A;  1RL2 A;  1XNR L;  2RHS B;  1KD1 C;  1JMC A;  4JI7 L;  1XNR Q;  3RNU A;  2CFM A;  2GN5 A;  2PQA A;  2VS1 A;  1GO3 E;  2R7D A;  3GTJ H;  2Y0S E;  5FJ8 H;  4OO1 I;  2VQF Q;  5M3M G;  4QQB X;  3PGZ A;  2JA6 H;  1NBW A;  1PH7 A;  1X3E A;  3S24 A;  4POF A;  1V9P A;  4R4O A;  2JEB I;  1K73 C;  4NB3 A;  2K5H A;  3RN2 A;  3HOU G;  1SLJ A;  1VCI A;  3HOV G;  2E8G A;  1QVC A;  5ELN A;  1KL9 A;  3FKI G;  2V1C C;  1S3O A;  3STB C;  3I55 A;  3RZD H;  1QZG A;  1VQ8 A;  3STB D;  1N32 L;  3AFQ A;  4DV1 L;  3GTQ H;  1N32 Q;  4DV1 Q;  4A3K G;  4JI0 L;  1ASY A;  4JI0 Q;  1FJG L;  1IXR A;  1FJG Q;  1X65 A;  2NN6 I;  3JC6 6;  1VQC A;  3KF6 B;  3J81 c;  3M7N A;  3PUY A;  3A5Z B;  2AKW B;  3S14 H;  3TQY A;  4X64 L;  3S1N H;  4GKK L;  1CKO A;  4JI1 L;  4X64 Q;  2CCZ A;  4JI2 L;  3S1Q H;  2I5H A;  3PSI A;  1UE5 A;  3K80 C;  4GKK Q;  3M4P A;  5M3M H;  1IBM L;  2ZJQ A;  2GVB A;  3EBE A;  4HJ9 A;  1IBM Q;  1IBL L;  4DUZ L;  4GLV B;  1WYD A;  1IBL Q;  4DUZ Q;  2JJQ A;  2ASB A;  4JOI C;  4IOA A;  1I3Q H;  4X6A H;  2QGQ A;  1EQR A;  1Q86 C;  4KI0 A;  3HOU H;  3PF4 A;  4GNX C;  3HOV H;  4IO9 A;  2R7F A;  2OCE A;  3NBH B;  3FKI H;  3PUX A;  1AH9 A;  1W3S A;  4P72 A;  3RLN A;  3KF6 A;  4P73 A;  1B70 B;  2I5L X;  1V43 A;  2ZTC A;  2ZJR A;  2NZH A;  1XMO L;  3F8T A;  1XMO Q;  1A8V A;  1I50 H;  1Z9F A;  4A3K H;  2A8V A;  5GRO A;  4DR1 Q;  5C0X I;  2VUM G;  4LNQ A;  1O7I A;  2R6G A;  3BJU A;  3A74 A;  2RCN A;  1SN8 A;  2I5M X;  2R93 G;  2F4V L;  3PUW A;  1HZA A;  2F4V Q;  3PUZ A;  3ERS X;  2R92 G;  4R4T A;  2E5L L;  2N78 A;  2E5L Q;  4DPG A;  4EQ5 A;  1VQ6 A;  3HFZ B;  3KOJ A;  3U4V A;  2A19 A;  3RLO A;  1U5K A;  2UUC L;  2UUC Q;  4JI5 Q;  4LUZ A;  1OXS C;  3S15 H;  1Q46 A;  4OWT B;  3H15 A;  4POG A;  1IBK L;  5JJI A;  1WOC A;  1IBK Q;  2C35 B;  5IYD H;  3Q8D A;  1MJE A;  1E22 A;  4BA1 I;  3UDI A;  5M5Y H;  3GTL H;  4IPH A;  5M3F G;  2YYZ A;  3S17 H;  1IZ6 A;  1U0L A;  4FDB A;  3BZK A;  3I2Z A;  1YBY A;  4YCW A;  1Y1W G;  3I4M G;  5E7N A;  4LFC L;  4L5R C;  1GKH A;  3KFU A;  2KHJ A;  3RR5 A;  1P8L A;  2K4K A;  1EOV A;  4LUV A;  3FHW A;  4BBR G;  1XPO A;  4JI4 Q;  2KCM A;  4A4I A;  2R93 H;  4L5Q A;  1Q7Y C;  3W5O A;  2R92 H;  1WJJ A;  4XIG S;  4OWW B;  2D0P A;  4L5T A;  2D0O A;  2N8N A;  1YI2 A;  3RZO H;  4LF6 Q;  2LXK A;  3E9I A;  1HNW L;  2JA7 G;  1HNW Q;  3CXC A;  4K0K Q;  1VQH A;  3D0F A;  1B8A A;  1OXU A;  1Q1B A;  4C3H H;  1K0R A;  4IPD A;  1YHA A;  1TXY A;  1CKN B;  4GNX B;  4X62 Q;  4RMF A;  5FLX c;  2MFI A;  4LF8 L;  3NEL A;  1Z47 A;  4LF8 Q;  3H3V H;  4BY1 G;  2BA0 A;  5M3F H;  2YV5 A;  3OW2 A;  4GOP A;  4JC0 A;  4A3L G;  3I4M H;  1YEZ A;  3GD7 A;  1Y1W H;  1VQK A;  2PI2 E;  4HIK A;  2UXB L;  2VY3 A;  3CQZ H;  1PV4 A;  3HOW G;  4DV4 L;  2IY5 B;  2K75 A;  2Q2H A;  4DV4 Q;  4BBR H;  3GTM H;  3HOY G;  1JT8 A;  2IT1 A;  4YCV A;  1EIY B;  1KRT A;  2JA6 G;  1Q8K A;  1IL2 A;  2NVT H;  4KHP Q;  2QEX A;  4LF7 L;  3JAM i;  5AJ3 Q;  4DV3 L;  4IPG A;  1EYG A;  1FVI A;  4TVA B;  1CKN A;  1PH8 A;  1XNQ L;  3CP0 A;  1HZB A;  2UUB L;  2JA7 H;  4UP9 A;  3TEH B;  1M90 C;  4J15 A;  4HJ7 A;  1L2F A;  4GLA C;  3T1Y L;  4DUY L;  3T1Y Q;  1TWH H;  1JE5 A;  4A3D G;  4DUY Q;  1VQ7 A;  3ZJY C;  4JYA L;  4C2M H;  4P75 A;  2HHH L;  3NEN A;  2OWO A;  4GN3 B;  4HIM A;  2HHH Q;  4JYA Q;  1VQN A;  2ZM6 Q;  4ALP A;  4QL5 A;  4BY1 H;  1VQD A;  3ULJ A;  3CMA A;  3BU2 A;  4H02 A;  1NMG A;  2K5N A;  4OON A;  3CCL A;  4A3L H;  4IOC A;  4DNI A;  1KXL A;  3HOW H;  4IFD G;  1K83 H;  2VQF L;  3CF5 A;  3HOY H;  3KLW A;  2N3S A;  3B6Y A;  2K52 A;  1EUJ A;  5JJK A;  1VQE A;  2DUD A;  3GTG H;  1VQP A;  3CAM A;  1X3F A;  3CCQ A;  4QY7 A;  1VQO A;  5EAY A;  3CCR A;  1OTC A;  3KJO A;  2HT1 A;  1Q81 C;  1QVG A;  1VQJ A;  4A3D H;  2VNU D;  1KQS A;  3GTP H;  4BBS G;  4JI6 Q;  1PA6 A;  2ID0 A;  1VQB A;  4DK3 C;  5IYC G;  1B7Y B;  1XMQ L;  4GOP C;  2NZO A;  1XMQ Q;  1N8R C;  4JBM A;  5HY6 A;  2OTJ A;  1HNZ Q;  4C3J H;  2XGT A;  1BKB A;  2D62 A;  4BXX G;  3DM3 A;  4YY3 L;  3AYH B;  4YY3 Q;  4DV7 L;  2UU9 L;  4DV7 Q;  2UU9 Q;  4WJ4 A;  1VQ5 A;  2Q2T A;  3F2C A;  2ALY B;  4YWM A;  3K81 C;  4GKJ L;  4JI8 L;  4HJA A;  5GAD C;  2AMC B;  4QGU A;  4JI8 Q;  3W1G A;  4DR5 Q;  4GKJ Q;  3E9H A;  4R4I A;  2K50 A;  4LUO A;  2WFW A;  4PZ7 A;  1YJN A;  1KIX A;  2EXD A;  4HID A;  5IYD G;  2PI2 A;  1VQ9 A;  1G51 A;  3RLF A;  1A0I A;  1NMF A;  5JEA J;  5C44 G;  3S1M H;  4DR3 Q;  4BBS H;  4KHZ A;  1E1O A;  4DR1 L;  1W2B A;  2NN6 G;  2AHO B;  5IYC H;  1PYS B;  4HJ5 A;  4ME3 A;  2WP8 J;  4NXM Q;  1HZ9 A;  1EIF A;  1X56 A;  4AIM A;  3L2P A;  3HOX G;  3CC2 A;  4A3E G;  2JA8 G;  2JE6 I;  3G4S A;  3L7Z C;  4BXX H;  3CCE A;  2VW9 A;  1NY4 A;  2UXD L;  2XTI A;  4JBJ A;  5C0X J;  2UXD Q;  4JI5 L;  3EN2 A;  1KC8 C;  4DKA C;  1Y1V G;  5IP7 G;  1XPR A;  1EQQ A;  1EFW A;  2PMZ E;  1YNX A;  3IRB A;  1S72 A;  3M85 A;  4A3J G;  4LF4 L;  4Y52 H;  3D31 A;  4LF4 Q;  1OXX K;  1X54 A;  2E2H H;  2ES2 A;  2E2I H;  1BBU A;  1YHQ A;  3U50 C;  1A62 A;  5C44 H;  1E3P A;  2B63 H;  4NXN L;  1TWA H;  4O2D A;  4A93 G;  4NXN Q;  4B3S L;  1AE2 A;  5IWA Q;  4B3S Q;  3PCO B;  1SRO A;  1K8G A;  4IPC A;  5LMN Q;  3GTK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...