4X65Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65Q00
4LW1A 3EN2A 5J3BA 3KJOA 3WWVA 3BZKA 4JI7Q 4DV7Q 3J80c 3EIVA 4IJHA 3GTGH 4A3IG 5M5XH 1X3EA 1YNXA 1VQDA 3RR5A 4OONA 5M3MG 1MIUA 1TWCH 4A3GH 2K5VA 4LFBQ 1Y1WG 3EBEA 2NN6I 3TREA 3HOYG 1BBWA 4R4OA 1WJJA 4GKJL 2A1AA 3LGJA 2ZM6L 3HOVH 4B3RL 1HNZL 4JOIC 4BY1H 4QL5A 2F4VQ 5JJIA 4Y7NH 1Y1VG 1V9PA 1M90C 2R92H 3KDFA 3GTJH 4LF5Q 2HQLA 2RHQB 4X64L 2VNUD 4KI0A 1Q12A 2UXCQ 4GN4B 4JYAL 4WJ4A 1N36Q 3CPFA 3ULJA 1XNQL 3FKIG 2ZTCA 4A3IH 2E2JH 2F52A 4BBSG 1EWIA 3RZDH 3PO3G 1I94Q 2WFWA 2YV5A 4A3DH 2BA0A 1OXTA 3S1MH 2PNHA 2UUCQ 5BR8L 3ER0A 2UUAL 1YBYA 1EIFA 2JE6I 1JJCB 1NMGA 2KHIA 4O2DA 4HJ5A 1XMQL 1S40A 4DV4Q 1Z9FA 4XIGS 4OX9L 4DR4L 1JMCA 2A8VA 4LUOA 1HZAA 2AMCB 1UE1A 1I94L 4LF8L 4JI2Q 1D8LA 2E5LL 4DV4L 1A8VA 1XNQQ 1EQQA 4JBWA 1PYSB 1N36L 1QVGA 4JYAQ 3OYYA 4DV0L 1SFOH 1WOCA 4X64Q 2V1CC 4DUYL 1QUQB 4HIKA 3G4SA 3CMAA 4DV3Q 4YWMA 1ASZA 3UE0A 1HNZQ 3W1GA 1K8AC 3CMEA 4GKJQ 5IYCH 1Q7YC 1VQAA 4UP8A 4HJ9A 2NVQH 4BA2I 5M3FH 4OWXB 1BKBA 1KAWA 1Q86C 1PH5A 3U4ZA 5IY0A 2RF4A 4JI4L 4X62L 3T1HL 3K7AH 1TWFH 4QJFA 5E7NA 5FJ8H 1TXYA 4A93H 4IFDI 1EOVA 1UWVA 5K36G 1HR0Q 4A3MH 1AE3A 3K80C 1C0AA 4L5TA 1K9MC 3S24A 1FGUA 3FHWA 3BZCA 1NJIC 2MO0A 3CW2C 4NXNQ 3S14H 4YHHQ 4LF4Q 1J5EQ 3ULLA 2Y0SG 3CPWA 2QA4A 4B3SQ 3H0GH 1VQBA 3HKZE 3CCUA 4A3MG 1PH9A 4LF7Q 2HT1A 4JI6L 1D7QA 1IBMQ 4DAYB 5C4XG 3ERSX 1JT8A 2PMZE 1TWHH 2JA9A 4DR1Q 4MTNA 3UDXA 1JE5A 4PZ8A 2UXDQ 1HZBA 3PUXA 4DK3C 3HOXG 4EQ5A 1YHQA 1OXXK 3PO3H 1K0RA 4JI1L 4BBSH 2CQOA 2ASBA 3GO5A 1Y1VH 1TWAH 4O0AA 3OW2A 2PQAA 2JA7G 2B29A 3GD7A 3M4PA 1UEBA 3HOYH 4DR6Q 4R1JA 4GLVB 4OWTB 1X65A 3NEMA 1KQSA 4X6AH 4NXNL 1W3SA 3D0FA 5ELOA 1NBWA 1FJGQ 3F2BA 3CD6A 4A3BG 4A3LG 2N78A 4XTCS 4YWLA 1CKMA 3PO2H 3S1QH 1Y1WH 3S15H 4UY8C 1S3OA 1YEZA 3U58A 4DR2L 4DV5L 1R9TH 1N33L 2E8GA 1PH7A 1PHJA 3UDFA 3J80i 3TS0A 2NVXH 1JJGA 1L1OB 5IT9c 2VW9A 1HZCA 4GLXA 3NELA 1GD7A 5DLQE 4BBRH 1BBUA 1QVFA 2VUMH 2UXBQ 1C9OA 1RL2A 4JV5L 1IXRA 4GN3B 1YI2A 3J81j 2NN6G 2ALYB 3UDIA 1CSQA 3PIPA 2VL6A 4JI4Q 1EUJA 4YY3L 3CXCA 1VQFA 3G6EA 2NVTH 2R6GA 2KCTA 2HHHQ 5FLXc 3CCRA 1IBLL 4NXML 4JG2A 3G71A 5ELNA 4JI3Q 2PQAB 2VY3A 1WCMG 1IBKQ 2CCZA 3S1RH 1LYLA 1YJ9A 3M4OH 4DV0Q 5JJLA 1HNXQ 5JJKA 3RLFA 1Y14B 4LFAL 4H02A 4DR5Q 1GO3E 2OTLA 2KHJA 1PH2A 1VQKA 4B3TQ 5IP9G 4P72A 2ZJPA 4JI3L 1OXUA 1RIPA 4HJ8A 3GTMH 4A3FG 3L2PA 2JA6G 1PH8A 2ZTEA 1HNXL 1NY4A 2RHSB 5GADC 4MZ9A 3I55A 1X6OA 1XPRA 2MQHA 2HHHL 1CSPA 2UUCL 1B7YB 3AQQA 2E2IH 3GTPH 3CCEA 3CCLA 3CC4A 3E9HA 3RLOA 4Y52H 4PG3A 2EIFA 2B3GA 3PGZA 3STBC 4NXMQ 3RZOH 4IPDA 4GKKQ 2ZM6Q 2VQFL 4JBKA 3M85A 4AYBE 1VQIA 2AKWB 2XTIA 3HOWG 4OO1I 3G48A 2VUMG 2IT1A 2F4VL 1PFSA 3I4NH 4BA1I 4GOPC 2OCEA 4HIMA 4JI5L 5GAEC 1YITA 3S2HH 2GVAA 3M9BA 4DV7L 4JV5Q 3CCSA 1XNRL 2UXBL 1VQEA 5IYBG 3I56A 5IE8A 2Q2HA 4A3KH 1PH4A 1BVSA 3GTQH 3L0OA 4KHPL 2Q2UA 5C44G 1SR3A 2Z6KA 1FJGL 3E0EA 1PH1A 2WAQG 4NB3A 3GTOH 1EFWA 2MO1A 2ZJQA 4JI7L 3BU2A 1WYDA 3A5ZB 3PUWA 2LXKA 3JAMc 1Q46A 4OXPA 1QZHA 4LFCQ 2AWNA 5C0XJ 4DR7Q 2D0PA 3RLNA 1E22A 1SLJA 1JB7A 2OQKA 3NENA 4JI1Q 3M3YH 1KRSA 1HJPA 3MXNB 1I5FA 1E1OA 4GLAC 4POFA 4X65L 5HGQA 4GOPB 3A74A 3CC2A 5IYBH 1E24A 2D62A 3J81c 2JEAI 4YCVA 4C3JH 4OWWB 2VS1A 2A19A 1IL2A 1L1OA 1VCIA 1E3PA 2H5XA 1N32Q 1SMXA 2AWOA 1IZ6A 3A5UA 3MEFA 1B8AA 2EQSA 5LMUL 4TQUS 1GVPA 3U50C 3CCJA 4HIOA 1J5EL 1VQ8A 1VQ9A 2UXDL 3AEVA 4X66L 4IO9A 3HOWH 1VQ7A 1CUKA 1G6PA 2F3IA 2I5MX 5C4XH 1IBML 2WB1E 4LF7L 4A3CH 3CAMA 4A3JH 1XNRQ 4BY7G 5EAYA 4B3SL 1UE6A 3PUZA 4YHHL 3KF6A 4LF4L 4X62Q 5H1SE 4P75A 3T1HQ 4A3EG 4KHPQ 1OXVA 1VQCA 1XPOA 3PV0A 4BXXH 3AFPA 2R7ZG 2I0QA 1VQLA 1K3RA 3JC66 3HFZB 2PI2A 1P16A 5FJ8G 3PF5A 1OXSC 2IHFA 2HIVA 3L7ZC 5IYCG 1Q82C 4JI5Q 3STBD 1YVCA 1VQ5A 3TRZA 3M4QA 4GN5A 3CCQA 4DV2L 4A3LH 3S16H 2NVYH 4UP7A 2JA8G 4A3GG 3K0XA 5M5YH 4K0KL 3CF5A 3VDYA 1K83H 4JI8Q 4LF6Q 2R7ZH 3F2CA 2VQFQ 5IYDG 2UUBQ 3FP9A 3DLLA 1XMOQ 1C7YA 3PUVA 4DV3L 2JA5G 2AHOB 2B63H 2RCNA 4A76A 2WB1G 4JBMA 2MFIA 1G291 3OTOQ 1VQOA 4DUYQ 4IJLA 5FLMG 3KF6B 5C44H 2VQEL 1MJCA 2K14A 5IWAQ 1KD1C 3AFQA 3I4MH 1PVOA 1XMQQ 2ZTDA 4AQYQ 3RN5A 4B3ML 4KLKA 2R93G 2R93H 1M1KC 2DUDA 2VQEQ 1HR0W 4C3IH 4LF8Q 4JC0A 4YWKA 4A3DG 4WJ3M 1FL0A 2YTXA 4DKAC 4RG1A 3UE1A 3KYHC 3OTOL 3K7UC 3PUYA 1KRTA 3CC7A 4YCWA 3I4MG 4AQYL 4B3MQ 2UUBL 3IRBA 5GAHC 1YIJA 3SGIA 2XGTA 4UPAA 2Q2IA 3J81i 4LF6L 4LF5L 2K5NA 2EXDA 1NMFA 2N3SA 3KF8B 4ME3A 4YY3Q 4HIDA 2JA8H 1XMOL 2FXQA 4B3RQ 1U5KA 1VS0A 4L5QA 1HZ9A 4YCUA 1EYGA 4DNIA 3KLWA 4A3BH 1PH3A 1PV4A 2JK8A 5M3MH 4DPGA 1LTLA 4ALPA 3CCVA 1I50H 2NZHA 1KC8C 2UU9L 1VQJA 4AIMA 2ATWA 2JA7H 4IOAA 5C0XI 1YZ6A 4PMWA 4DV5Q 1Q81C 4DR2Q 4P74A 5IYDH 4GNXB 4QIWE 4LFBL 4A3EH 2OQ0A 2Z6KC 2I5HA 2ZJRA 1X9NA 1CKOA 4X66Q 1L1OC 4AYBG 1X3FA 2K5HA 5LMUQ 1J6QA 1S72A 2CKZB 2OTJA 3KJPA 3ZJYC 3HOUG 3KDFB 2CFMA 4IPGA 3J7ZC 2JJQA 1W2BA 1SE8A 3HKSA 2K52A 4LF9L 2ID0A 4IOCA 2CWAA 5LMNQ 4R4QA 3E9IA 4DUZL 4C2MH 3RN2A 1T9HA 1PH6A 5AJ3Q 1CKNA 4IFDJ 3PIOA 4DR6L 2K75A 1V43A 4DR1L 1X54A 5C3EH 1AH9A 1N32L 2IX1A 3PO2G 4LF9Q 4IFDG 1MJEA 3M7NA 4GNXA 4X65Q 1UE5A 2R7DA 4IPHA 5C4JH 4P73A 1PA6A 5AJ3L 1VQNA 2N49A 1NTGA 3GDEA 5M3FG 4HJ7A 4UP9A 3NBHB 4BY1G 4C3HH 3H3VH 1AE2A 1HH2P 2JEBI 4FDBA 4LFCL 1U0LA 1H95A 4J15A 1E1TA 4BXXG 5GROA 2NZOA 3I7FA 2DGYA 2QEXA 1VQ4A 3UDGA 3ICEA 3S17H 1Q1EA 1L2FA 4POGA 1O7IA 4APVA 2UU9Q 1HR0L 2BH2A 5IP7H 1QUQA 4JI0L 3I4NG 5GQOA 4TVAB 3T1YL 4A3JG 4LUVA 1TWGH 1IYJB 2VZAA 1A63A 4R4IA 3CQZH 4GNXC 3HOUH 3F2DA 1XTDA 1L0WA 4DR3L 2KENA 1VQMA 4LUZA 3H3VI 3HOZG 4JCVE 2CWPA 4QGUA 2Z0SA 1EQRA 4A75A 1UE7A 3KOJA 1YJWA 1HNWL 4R4CA 2QGQA 1YHAA 2YYZA 5JEAG 4NPSA 2C35B 1DGSA 1I3QH 2HIXA 4PZ7A 4GKKL 4A93G 2YU9H 3FKIH 1I6HH 3ULPA 3TQYA 1SN8A 4BBRG 2I5LX 1SRUA 1N34Q 2ES2A 1PYBA 3K8AA 3GTKH 1VQPA 3CP0A 3I2ZA 3BJUA 1KIXA 2JA6H 1LM0A 5GAGC 1B70B 2UUAQ 3JAMi 5IWAL 2E5LQ 4JI2L 3S2DH 5M5WH 4LFAQ 1N8RC 4HJAA 1N34L 1NE3A 1IBKL 4B3TL 1MKHA 3KFUA 4OX9Q 4DR4Q 4GOPA 4LNQA 4DR5L 4BY7H 1P8LA 2L15A 4A3CG 3K81C 4PZ6A 2MNAA 2Q2TA 3TS2A 2LSSA 5BR8Q 1Q1BA 4JI8L 4A4IA 2WAQE 4DAMA 2UXCL 1FVIA 3GTLH 2K4KA 1YJNA 1X3GA 4KHZA 2GN5A 1KL9A 3HKZG 4LWCA 1CKNB 4MNOA 1IBLQ 2Y0SE 2K50A 1KHIA 2YTVA 1QZGA 1LUZA 1HNWQ 3F1ZA 3T1YQ 4K0KQ 4L5SA 4DV2Q 4DR3Q 3B6YA 5LMNW 1KXLA 3S1NH 4IPCA 3I4OA 5C0XG 1N33Q 2WP8J 1SROA 2R7FA 1GKHA 2JA5H 2PI2E 2B63G 1A62A 4JI0Q 1A0IA 2GVBA 1N9WA 5IP7G 4QY7A 5IP9H 2BA1A 3PSIA 4P71A 2R92G 4JBJA 4A3FH 3PF4A 2E2HH 1OTCA 1XPUA 2JQOA 1ASYA 1X55A 3TEHB 2YTYA 3W5OA 4EX5A 1WCMH 1QVCA 4DV1L 1Z47A 1E7ZA 4R4TA 4JOIA 3CCMA 4L5RC 4OO1G 1YHBA 3U4VA 4RMFA 1VQHA 1XJVA 2IX0A 4DV6L 1K73C 4QQBX 3H15A 1EIYB 3HOVG 3HOXH 2KBNA 3AYHB 5HY6A 4AH6A 4A3KG 1WFQA 2LXJA 5LMNL 4DUZQ 3J7A5 5C3EG 3PCOB 1X56A 2KCMA 1G51A 4DV1Q 1K8GA 4DK6C 4JI6Q 1VQ6A 1Q8KA 3W1BA 2D0OA 2N8NA 1V1QA 3A0JA 2IHEA 2IY5B 1VQGA 1GM5A 3H0GG 4DV6Q 1JJ2A 2BH8A 3Q8DA 1WI5A 2OWOA 3HOZH 4DR7L 3D31A 3RNUA 3F8TA 3DM3A 5FLMH 4GS3A 5JEAJ
chains in the Genus database with same CATH superfamily
3VYRA 4LW1A 3EN2A 5J3BA 3K7AB 2AUKA 3GTGH 1TR5A 3TZUA 2ZT9C 4K6LA 1VQDA 1FNVA 2PQEA 1STYA 3BVGA 2NN6I 4H13C 3HOYG 4R4OA 1WJJA 2A1AA 4QUCA 4DAVA 4EGVA 2F0LA 4QL5A 2F4VQ 4Y7NH 1GHJA 4LF5Q 2RHQB 3MAQA 1OO9B 4GN4B 1IW7D 1XNQL 2NUCA 2ZTCA 4A3IH 1ENFA 2E2JH 1I94Q 4DXFA 4CJ0B 2JA6B 1KLGD 3DWAA 4CDCC 5BR8L 1JJCB 1NMGA 1DONA 4O2DA 1XMQL 1PTOD 2K28A 1LT3D 4DK1A 2A8VA 1UE1A 4M1UB 3L9AX 3PMFA 4DV0L 1SFOH 4IUTA 4X64Q 4DUYL 4HSPA 1IL8A 1G8ZD 1Z7TA 2ZXRA 4HIKA 1E0BA 3G4SA 4DV3Q 4YWMA 5I2YA 3G7LA 1HNZQ 3DWPA 1RODA 2N55A 5CBEE 1Q7YC 4GKJQ 3IL8A 3HOZB 1PH5A 4QUFA 1IYVA 3Q24A 5IY0A 3NHHA 3PIO3 4JI4L 4X62L 3T1HL 3K7AH 2QEJC 1B9NA 4QJFA 2RVLA 1JQYD 5E7NA 3GTGB 5I6WA 2RSNA 4EQNA 1UWVA 1EU4A 4H44C 4L5TA 4X3KA 4NXNQ 3DEOA 4RH6A 1CZGA 1J5EQ 4PNYA 4Y7NB 1IBMQ 2PMZE 1TWHH 4C1NK 5ELFA 1ET9A 4MHEA 1W6JA 3PUXA 4ID6A 5CV8A 3WDNA 1XTCD 3IFDA 2A6HC 3PO3H 4BBSH 2O5JC 5DAUA 2G9HD 2PQAA 1VMCA 2JA7G 2SNMA 4DR6Q 2Z4IA 4R1JA 4FXDA 1KQSA 1ET6A 2ICIA 1W3SA 4A3LG 2GA4B 2F0DA 3OMCA 4KN4C 1WTXA 3S15H 4UY8C 1S3OA 1QB5D 1VF5C 2E8GA 1RD9D 3I72A 3UDFA 1PH7A 1PHJA 2NVXH 2VW9A 4FYDA 4BBRH 2Q8RE 4HAEA 2UXBQ 2QCPX 3HOVB 1IKLA 4IUUA 1TKWB 2F0UA 2L9HA 3NTIA 2VL6A 2E2DC 3CXCA 5CC4A 3G6EA 3SK8A 4KK7A 5JVG3 2B2VC 2KCTA 2HHHQ 2WKDA 4JPBW 5A2QL 1T5XD 1IBLL 1K83B 3IFTA 4JG2A 2RSOA 3DUZA 5IGCA 2PQAB 3A8KE 1BUVT 3S1RH 1I4XA 3CRLC 3M4OH 2F3VA 3F2UA 4CJ2C 2L12A 3MWYW 5JJKA 3RLFA 4DR5Q 1PH2A 5J39A 1VQKA 1TWHB 4K2KA 1E2WA 1KDBA 1RIPA 4HJ8A 2JA6G 3I55A 3PO3B 4BBSB 2MQHA 2WB1B 1RF2D 4Y52H 1C48A 2B3GA 1WTVA 4WJWA 4NXMQ 3H09A 5J22A 1IYUA 5M3FB 2AKWB 3NP8A 3G48A 4OL7A 1F2MA 2A5HA 2IT1A 1PFSA 1Q3LA 2NVYB 4BA1I 5C3WA 3I4NH 3S15B 2OCEA 4DV7L 3K5LA 3X3NA 4NP5A 1VQEA 3I56A 5EJWA 4BBRB 1PH4A 1BVSA 2H1EA 1PH1A 3GTOH 2FINB 1EYCA 1EIGA 1B2TA 1Q8IA 2L11A 1WYDA 3JAMc 1TS4A 2HD3A 2LXKA 2RCFA 4LFCQ 1EIHA 2AWNA 5C0XJ 1DZ1A 2ZXPA 5T1IA 4JI1Q 3NUCA 1E1OA 4C3JH 1SAPA 3S1RB 1N32Q 1U4MA 1IZ6A 3M7GA 3A5UA 2L55A 1B8AA 3CCJA 1GVPA 1VQ9A 3HOWH 2HUGA 1EEFD 3ERQA 5FK9C 3T4AC 3CAMA 2I46A 4BY7G 4B3SL 3FPUB 4YHHL 3KF6A 3R8BA 1HCZA 4X62Q 5H1SE 1D6EC 4P75A 3T1HQ 4A3EG 4X3TA 5KEEA 1VQCA 2ENBA 3HRZC 2I0QA 1VQLA 3R93A 3HFZB 5IYDH 1OXSC 3L7ZC 4JI5Q 3STBD 1YVCA 3TRZA 1SNMA 2BOSA 4A3LH 1H9RA 2NVYH 2JA8G 4A3GG 4C1NI 4N9TA 3CF5A 1SYDA 4AYBB 3K57A 1ZKOA 1C7YA 2C5CA 2AHOB 4HMJA 5BN4A 2WB1G 1VQOA 3NBHA 3D8GA 3MTSA 5IWAQ 3K0YA 1XMQQ 1EY0A 3RN5A 2R93G 4KLKA 4B08A 1SE2A 4XQNA 1SNCA 1M1KC 4PV1C 4WJ3M 1FL0A 2D9UA 2XN9C 4RG1A 3UE1A 3K7UC 2XWBB 4YCWA 1Y8NB 3SEBA 1MGSA 1K3BC 5IGBA 3SGIA 2NYZD 5HURA 1NMFA 2N3SA 4HIDA 1PFBA 1SYBA 1U5KA 1EY7A 4DNIA 4CBVA 1PH3A 1PV4A 5E1FA 4K2LA 4CHTB 5M3MH 4ALPA 3S2HB 1I50H 2NZHA 4AIMA 5C5MA 3KLSA 1JB3A 2J0TD 1Q81C 2K03A 3TP7A 1SE4A 2YU9B 4ZK9B 4BWGB 3OOCA 2JA5B 1S4ZA 2F0SA 2JXMB 1X3FA 1STGA 4KY7A 5LMUQ 3KJPA 4OGQC 1R4QB 2RDGA 4FNFA 3CRKC 4IPGA 1W2BA 2JJQA 1B1ZA 4RCOA 3HKSA 3SVMA 2H4OA 2ID0A 2A6ED 3E9IA 1AN8A 4HCSA 1PH6A 1CKNA 4ZQ3A 4HEDA 1SE3A 1X54A 1AH9A 4ME5A 3HOXB 2F0FA 4TKOB 1STHA 4CKEA 2XRQD 1HHVA 3I90A 2EE1A 1NTGA 4BY1G 4C3HH 1A3TA 2JEBI 2NBFA 4QCLA 1H95A 2SNSA 5FLXL 1E1TA 2NZOA 4HR7B 3ICEA 4F87A 3FRPB 1Q1EA 1DXMA 4POGA 1O7LA 1STBA 5IP7H 1SMYD 1QJOA 4TVAB 3NWSA 4RHRA 3JAME 1A63A 3H3VC 1E2ZA 2VB3X 3H3VI 1XTDA 1ICWA 2QILA 2KENA 4DR3L 3OIPA 3HOZG 1CHPD 1EQRA 5CV4A 1UE7A 3KOJA 3GV3A 1D5ZC 3EFXD 3DXJC 2YU9H 3NK9A 1N34Q 2ES2A 2X6GA 4ODGA 2E2JB 3K8AA 1FD7D 4JK1C 1KIXA 2JA6H 3NPPA 5GAGC 1B70B 2UUAQ 4JI2L 5IWAL 3S2DH 4IUPA 1MKHA 2C9OA 1K0SA 3RD4A 4BY7H 1P8LA 3K81C 2QKIC 1JWUD 1Q1BA 4G57A 2D5DA 2WAQE 5CORA 5M5XB 2K4KA 1PRTF 1X3GA 4HTHA 4LWCA 4A3GB 4A3BB 1T5EA 3HP3A 2YTVA 1TS2A 4C3HB 4C3JG 5CGKA 5LL6S 4L5SA 3B6YA 3NQIA 1ML0D 1KXLA 4IPCA 3DHQA 5C0XG 2A69D 2V4DA 2WP8J 1SROA 4A3EB 1LLRD 1LABA 1MBYA 1GKHA 2PI2E 1A62A 4QY7A 2BA1A 3C1EA 1YNJD 3P75A 4A3FH 4B9WA 3QWNA 1H9KA 1LT4D 2YTYA 3W5OA 1HPCA 1QVCA 1EL0A 1IW7C 2B2UA 4RMFA 1K73C 4QQBX 2EY5A 5C3EB 1WD0A 3KBXA 2SEBD 1WFQA 4DUZQ 1TT2A 3J7A5 1X56A 3H94A 4DK6C 2EY2A 3J80E 5JEAH 2IHEA 4DNTB 5E3FA 4KV6A 1EEID 3S2DB 1JJ2A 4KN7C 3Q8DA 3R2TA 2F0JA 3RNUA 2K01A 1R4PB 3SHLA 1SNPA 4JI7Q 1EYDA 3J80c 4IJHA 4V0BA 4A3IG 5M5XH 2KVMA 1YNXA 1STAA 3RR5A 1LTID 1O7ZA 4A3GH 2NVXB 3TREA 2XVSA 4GKJL 2F0EA 3LGJA 3HOVH 1HNZL 4N8FA 4JOIC 2B2UC 4XT3B 2DNCA 2R92H 4OO1H 3TDQA 3P7JA 2VNUD 3OPOA 1N36Q 1PZJD 4BBSG 3RZDH 3PO3G 5AFWA 1Y1VB 1X3PA 2BA0A 4A3FB 1OXTA 3S1MH 3OSOA 2EPBA 2UUCQ 2EYLA 2UUAL 1YBYA 4KY5A 1EIFA 2KHIA 2XIWA 3M4OB 4DU9A 4UHVA 4I65A 4ABNA 1I94L 4JI2Q 4TSSA 1BBXC 2EY6A 2CW0C 1A8VA 2SDFA 2EJGC 4RKBA 1R9TB 2V1CC 1JOOA 1A6XA 3CU7A 3UE0A 4K14A 1VQAA 2JN4A 2L1BA 2AQ3B 1H9MA 5M3FH 1GXDC 2F0WA 1BKBA 3BYYB 1KAWA 2TSSA 4K5WA 4PMBA 2X69A 3E0JA 4R9WA 1CI3M 3K59A 2NVTB 2QF7A 3I4NB 4KJOA 1HA5A 1EOVA 5K36G 4L63B 4A3MH 1C0AA 1JR0D 3BZCA 3QR8A 3FEWX 3CW2C 2DY8A 3ULLA 2Y0SG 3H0GH 3VYUA 2BDOA 4A3MG 1WTPA 4RKLA 4JI6L 5FKAC 2R92B 5C4XG 5IGGA 2JA9A 4DR1Q 4MTNA 5IT9E 1S5DD 1PDQA 4PZ8A 1B53A 5JPMC 2EYMA 3RZDB 2A6EC 1WVLA 4FXKC 1SYGA 2CQOA 2LMCB 2ASBA 2E2IB 3GO5A 1PMRA 1TWAH 1Y1VH 4FF3A 3S1MB 2EYFA 4C3JB 3I70A 4G7ZC 1DOKA 5M9OA 1MI2A 1WTOA 1FJGQ 4A3BG 3NQTA 2N78A 3PO2H 3S1QH 1BCPB 4DR2L 3J7AF 4DV5L 1EYAA 2L5TA 1R9TH 1EY5A 2B2YC 1JJGA 3FMCA 1L1OB 5IT9c 1HZCA 1MHWC 1GD7A 4EQOA 2VUMH 1BBUA 4IFDH 2HDLA 1HQRD 1RL2A 3CHBD 4KKSA 1IXRA 4GN3B 2ALYB 3UDIA 3PIPA 3KLSX 4JI4Q 4YY3L 4ZCKA 1AZPA 4J1MA 2NVTH 2LKVA 3A55A 1I4GA 2R6GA 2RBMA 3NWTA 5FLXc 2B8FA 3V2TA 5FLXE 2Z4HA 1F2YA 4JI3Q 1B50A 2KJXA 5JJLA 3IKJA 4H02A 2OTLA 1U4PA 1V1PB 2F0TA 1OXUA 3GTMH 2PW5A 2ZTEA 1NY4A 2IX3A 1LTSD 1Y69U 1B7YB 2E2IH 3CCEA 1TWAB 4KKUA 3RLOA 2NZ1D 1DOMA 4PG3A 2EIFA 3STBC 3RZOH 2ZM6Q 2VQFL 4JBKA 5JPNC 3HZXA 1DD2A 1VMPA 4X3UA 1G2TA 3PO2B 2NTTA 2EVBA 2Q8IB 4GOPC 3QG1A 1TS3A 1GUOA 5M3MB 4HIMA 1I50B 2GVAA 3M9BA 3S2HH 5IYBG 3S9WA 2Q2HA 1JORA 3GTQH 5C44G 1EZ6A 2KOLA 1EU3A 4NB3A 1BCPC 1EFWA 2MO1A 4LJZC 4DR7Q 5FO7B 2OQKA 1KRSA 4OEMB 3J81E 4POFA 2A68C 5HGQA 4X65L 1UEAB 2D62A 3J81c 4YCVA 5EGTA 1IL2A 2F0IA 1VCIA 2FHTA 1GUWA 2AWOA 1AW7A 3QIAA 1PZID 1ZYRC 4TQUS 4X66L 1VQ7A 1F2ZA 2I5MX 4J8QA 3GTMB 3AB9A 4LF7L 3K5OA 5ELCA 1UE6A 4R8IA 4LF4L 1QNKA 1XYIA 4CDEC 4ZUJA 2F0OA 4KHPQ 1XPOA 2Q8TA 3PV0A 4BXXH 3AFPA 2R7ZG 1K3RA 1BR9A 2PI2A 4PQXA 1P16A 3A56A 3PF5A 5IYCG 3J80L 3QOJA 2CH4W 3CKIB 3G6JB 3S16H 3L3OC 3K0XA 4I7AA 3VDYA 5I2XA 1NSNS 1LT5D 1F9QA 3PUVA 1B9MA 3KUPA 2JA5G 2AQ2B 4JBMA 2B63H 1G291 4CKBA 2HCCA 5JOBA 2B39A 2I07B 4IJLA 2O2LD 1MJCA 2K14A 5COYA 4V190 2DUDA 1LACA 4JC0A 4A3DG 1I4RA 4DKAC 3KYHC 3PUYA 2XNAC 1KRTA 1AZQA 3QO2A 5FOBB 4UPAA 2Q2IA 3J81i 4LF6L 4BY7B 2EXDA 3E3XA 3KF8B 4K6DA 4JW0A 4L5QA 3EA6A 4YCUA 3OHXC 3CQZB 4A3BH 4IUVA 1LTLA 1ICFB 3CCVA 1HQMC 2R3ZA 2UU9L 1DCZA 2ATWA 3C3LA 1K8OA 2HDMA 1YZ6A 3W3AA 4PMWA 5BN3A 3I8ZA 4F88A 2L0CA 4QIWE 4A3EH 3ZYYX 1CKOA 2J7ZA 1RKNA 1L1OC 1TVXA 3S16B 4LF9L 2K52A 4IALA 4IOCA 5LMNQ 2A6HD 4G7OC 3W2DA 1SYFA 3RN2A 4WRDA 1V1PA 5AJ3Q 4IFDJ 2K75A 1BOSA 5C3EH 1N32L 3VR4A 3PO2G 4LF9Q 4IFDG 1MJEA 3M7NA 4OIKA 4GNXA 1HTLD 4P73A 3T16A 3QOLA 5AJ3L 1VQNA 2F0GA 4RGOS 1ZEQX 4UAIA 3N6RA 5T1GA 4HJ7A 3U9OA 3H3VH 2R61A 4LFCL 3NE5B 1DM0B 1RTNA 1QNUA 5GROA 3GV6A 5LL6X 2DGYA 3UDGA 1O7IA 2UU9Q 1SSOA 2BH2A 4A3JG 4LUVA 1IYJB 2PYKA 1VF7A 3CQZH 4GNXC 3F2DA 4LUZA 2Z0SA 2F3WA 1YJWA 2QGQA 1YHAA 3Q0AA 2K32A 2G9DA 2NTSA 4PZ7A 3NTHA 1C4QA 3MXGA 5C44B 3TQYA 1SN8A 3I4MB 4BBRG 1SRUA 5ELDA 3D4DA 4H0LC 1V1OA 1VQPA 3I2ZA 3Q23A 4CJ1B 2E5LQ 3MHBA 5DM73 1N34L 3LNNA 3KFUA 2FFKB 5C6AA 4DR5L 2L15A 4A3CG 4PZ6A 3TS2A 1HA6A 1QG7A 4DAMA 4JI8L 4RFBA 5I9PA 2KQ3A 3GQBA 4KTAA 3TP8A 1KL9A 4DNRB 1IBLQ 4L6TB 4MNOA 5CV7A 3SK6A 2NN6H 1LUZA 1CA6A 1HNWQ 3T1YQ 2JA7B 1A15A 4DV2Q 5LMNW 1I4QA 3I4OA 2LY7A 4IUQA 4DA2A 3T56B 1A0IA 2GVBA 4JI0Q 1PTOC 3T53B 2D2CC 3PSIA 2R92G 3EVQA 3PF4A 5C5LA 4A3MB 1OTCA 1ASYA 3MXNA 4EX5A 4DV1L 3LX0A 1Z47A 3H0GB 1HFGA 2F0QA 4JOIA 4L5RC 1FGBD 3BDOA 1XJVA 1VQHA 4N9PA 2IX0A 3JAML 4DV6L 3O13A 3H15A 2F0MA 1ZYRD 1HTPA 1PZKD 3PCOB 2KCMA 4X3SA 4JI6Q 3FPPA 3FVQA 4KY6A 2N8NA 2IY5B 1VQGA 5IODA 3H0GG 1YNJC 4DV6Q 2MGSA 2RDHA 3SXHA 4LK1C 4DR7L 5KRUA 1GUSA 3DM3A 2WAQB 5FLMH 4GS3A 4IUNA 1TY2A 2FJ2A 2EYPA 3BZKA 3S1QB 5CYUA 3EIVA 5KNBA 1F9RA 1CZWA 3U9SA 2Z8LA 1G91A 1MIUA 1ENAA 4LFBQ 2K5VA 4QIWB 1Y1WG 1U4LA 2OT2A 2VUMB 1BBWA 2ZM6L 5JJIA 4L8JA 1Y1VG 1LO5D 3KDFA 4O42A 2HQLA 1F2LA 4KI0A 1Q12A 1FR3A 2UXCQ 3HKZB 4JYAL 1I6HB 2EJMA 2M2LA 2SOBA 3CPFA 2WFWA 4A3DH 3OW7A 5M5WB 2JE6I 1YNNC 2CW0D 1Z9FA 4XIGS 1JMCA 2MHVA 3MFYA 1HZAA 2AMCB 4ULLA 1STNA 2E5LL 1D8LA 1MD2D 1EQQA 4JBWA 1N36L 1QVGA 2KCCA 3OYYA 1WOCA 2LFNA 1EY8A 3PIP3 3I4LA 4FP5D 2K5DA 3CMAA 1ASZA 1GOZA 3W1GA 3CMEA 1K8AC 2O4XA 4UP8A 2NVQH 4BA2I 3RZOB 1SMYC 3S1NB 3U4ZA 3PQIA 2TMPA 5FJ8H 1TXYA 4PMCA 4IFDI 1AE3A 2E2HB 3K80C 1K8MA 1K9MC 1PFMA 3S24A 2K33A 1E2VA 5J1ZA 3S14H 4HN7A 3T51B 3GTQB 4YHHQ 1I4HA 2QA4A 4B3SQ 4F7XA 3HKZE 1D7QA 1KNEA 1JWSD 2PO4A 1F77A 5JVH3 4DAYB 3ERSX 1JT8A 3UDXA 1JE5A 4RGNA 2DJFC 4DK3C 3VR5A 1YHQA 1OXXK 1K0RA 4JI1L 1FNUA 5K36H 4U68A 1Y8OB 2K1BA 2K6AA 2B29A 3GD7A 2JSOA 2BE5D 2XWJB 3ND8A 1UEBA 3QJYA 4OWTB 4RGTA 2RKSA 3D0FA 1NBWA 3F2BA 4YWLA 1CKMA 2BDNA 1YEZA 3U58A 3WOEA 1EY4A 4BS9A 4K8JA 5EKIA 4GLXA 1S5CD 3NELA 4A3KB 5DLQE 5EQ0A 1QVFA 4GZYC 1F9PA 3DM1A 1C9OA 4RA8A 2NN6G 4QB4A 2EJFC 1CSQA 1RCVD 1EUJA 4RWSC 3TP6A 1AEXA 1CFMA 4XDXA 3CCRA 2Z1CA 5G3LF 4NXML 3J7AV 4N8X1 1K28A 2VY3A 2CCZA 3S14B 2B63B 2HQEA 1YJ9A 1DOLA 1JCKB 1CT1D 4ZKCB 1HNXQ 2KHJA 4P72A 2ZJPA 2N88A 5EBDA 3L2PA 1PH8A 5D65A 1HNXL 1CQVA 1LTTD 1HUNA 1ZXTA 5GADC 4MZ9A 5E4WC 2HHHL 1B44D 2UUCL 1CSPA 1CA5A 3AQQA 4K8IA 1A2UA 1PRTD 3CC4A 3E9HA 1EQVA 3P20A 4DGZA 5ISRA 4DFAA 4GKKQ 3NXWA 4DF7A 3M85A 5ELEA 4AYBE 1EY6A 1VQIA 1O78A 3HOWG 4OO1I 3MFGA 2VUMG 1TWFB 1F9SA 5GAEC 3OWFA 2UXBL 4A3KH 3L0OA 4KHPL 2Q2UA 1SR3A 2Z6KA 3E0EA 3E6ZX 1FYCA 2JYOA 1X3QA 4JI7L 3BU2A 3J7YW 1QILA 1EWCA 3PUWA 1Q46A 4OXPA 3FDTA 1FNWA 2M00A 3RLNA 3ITPA 3MXNB 1Q90A 5JJZA 5L37A 4NDXA 3A74A 5IYBH 1E24A 5EPKA 1WTQA 4OWWB 5D3IB 1E3PA 2M9VA 1RTOA 1SMXA 2OF1A 3AMUA 5LMUL 2PZWA 1J5EL 1VQ8A 4CDDC 1EFID 1CUKA 2PZTA 2F3IA 1LTAD 1SJED 1IBML 2WB1E 2AQ1B 1XNRQ 4A3JH 5EAYA 2WV6D 4XYQA 4RAUC 3K5MA 1OXVA 3JC66 5FJ8G 2K05A 2IHFA 2MJ8A 1Q82C 2PNRC 3CCQA 4K0KL 2CVRA 5M5YH 3F2CA 2VQFQ 5IYDG 2UUBQ 3FP9A 3DLLA 5A2QE 1ENCA 1XMOQ 4DV3L 3IAYA 4DUYQ 5C44H 3KF6B 5IGDA 2VQEL 1TQOA 2ICEC 3I4MH 1PVOA 4XXEA 4FF2A 2ZTDA 4AQYQ 1BF4A 4B3ML 2R93H 1NUCA 1PTOF 2VQEQ 1HR0W 4YWKA 5NUCA 3T13A 3I4MG 2F0NA 3DEPA 3IRBA 2UUBL 4P2CB 1YIJA 4QMGA 3VR6A 1RJTA 2EDGA 3MXUA 3D3RA 2K5NA 4LF5L 4YY3Q 2JA8H 5I6YA 5EKKA 1WTRA 4FVMA 1VS0A 3J81L 1EYGA 2A68D 4FXGC 5KYIA 1D1KA 4DPGA 4A3JB 2JA7H 3A8JE 4IOAA 1PFNA 4DV5Q 4NW2A 1BQQT 2B2TC 4DR2Q 4P74A 4KJNA 3TBIB 4LFBL 2KUMA 2OQ0A 2Z6KC 3R2IA 4S3SA 5D3DA 4AYBG 1B4OA 1I6VC 1S72A 1EOTA 2F0VA 3ZJYC 3HOUG 2CFMA 3J7ZC 4XT1B 1SE8A 1GJXA 1LTRD 5M5YB 2CWAA 2K5QA 4R4QA 2XSCA 3BZDB 3K5NA 4FO2A 4RHSA 3PIOA 2CQAA 3I3CA 4DR1L 3MC0B 3LWEA 2X6LA 3KK7A 3VA5A 1V8QA 4OIJA 1CK1A 4X65Q 2R7DA 1PA6A 5C4XB 2RQXA 3GDEA 4M8AA 5M3FG 2WINB 2P5ZX 4UP9A 1EY9A 3NBHB 4FDBA 1Y8PB 3EQLC 1IKMA 4WORA 4IZ8A 4BXXG 2CH4A 3I7FA 1VQ4A 1D1IA 3C46A 5DM63 1PLFA 3S17H 1L2FA 2E74C 1STEA 1HR0L 3I4NG 1H9SA 1QCBD 4JI0L 5GQOA 3T1YL 4K5VA 1B3QA 2VZAA 4R4IA 3HOUH 3A7AB 4C3IG 1J8IA 1G2SA 4QGUA 1WCMB 4DXGA 1HNWL 2YYZA 2L4NA 1DGSA 2HIXA 4A93G 3MA2B 1X32A 3SR1A 1I6HH 4MN3A 3WOFA 1BXTA 3CP0A 4A3DB 3BJUA 2PMZB 3P1HA 4U673 5CV6A 1DYQA 5M5WH 3D6CA 1N8RC 4HJAA 4B3TL 1L0YB 4OX9Q 4DR4Q 4LNQA 4KHVA 3OMGA 3URYA 3KLRA 2Q2TA 3LWUA 1BNZA 4A4IA 5ELBA 3TMEA 3GTLH 1YJNA 1M4VA 1KABA 3HKZG 1TWCB 2B8GA 3OWEB 1CKNB 4IURA 5C0XH 1HRJA 5CMDA 2EYOA 2KHSA 1VDZA 1KHIA 1SNQA 1QZGA 1O7YA 3F1ZA 4K0KQ 2NVQB 5KNCA 3S1NH 2EXZA 2BCOA 2R7FA 1EQTA 5IP9H 4P71A 1YNND 4QF4A 3SDZA 5KGUA 2IL8A 3NBIA 4JBJA 2E2HH 1XPUA 2JQOA 2PZUA 3TEHB 2IPKD 1WCMH 3HG9A 1E7ZA 3Q22A 4OO1G 3CCMA 3V05A 1PXUA 2B2WC 1YHBA 3U4VA 4O1NA 1EIYB 5TSSA 3HOVG 2KBNA 2A73B 4AH6A 2LXJA 5LMNL 1BDOA 5C3EG 1KTKA 1G51A 1K8GA 5DEHA 5C4ZA 1Q8KA 4Q5VA 2D0OA 2QW7A 2IJ0A 1LV9A 1GM5A 1NAPA 2BH8A 1WI5A 1JICA 2F4IA 3F8TA 2CHBD 5JEAJ 3KJOA 3WWVA 1AFPA 4DV7Q 1X3EA 4NKLA 5FO9B 4OONA 5M3MG 1TWCH 1SYEA 4ZAIA 3EBEA 3A54A 4B3RL 1D5MC 2B2WA 4C3HG 4BY1H 1NCVA 2IWHA 5FO8B 4CDFC 1V9PA 1M90C 3GTJH 3VR2A 4X64L 4XYOA 4OELB 4WJ4A 5A35A 3FKIB 5CV9A 2PW7A 3ULJA 3E5SA 3FKIG 3DWQA 2F52A 1EWIA 2YV5A 1WTWA 2PNHA 1C8CA 3N52A 3ER0A 4HJ5A 3HOYB 1S40A 4DV4Q 2WACA 4HMIA 4OX9L 4DR4L 3RUZA 4R8NA 3GP7A 5I4DA 4LUOA 2PCFB 3I91A 4LF8L 4DV4L 1XNQQ 4EQPA 3MVVA 1PYSB 4JYAQ 5BN5A 4F8MA 2MPMA 1QUQB 3SK5A 3HGBA 1II3A 1D5XC 1A2TA 5IYCH 1S5FD 2RDFA 4HJ9A 4C56C 3MEHA 4OWXB 1Q86C 4ZLTF 1SXTA 5F2DA 2RF4A 1TWFH 1GUNA 4A93H 3NSWA 3SK4A 1HR0Q 1IHZA 1FGUA 4JVZA 3FHWA 1NJIC 2MO0A 4LF4Q 4RGMA 3CPWA 4BY1B 1VQBA 3CCUA 1PH9A 4LF7Q 2HT1A 2A69C 2MUYA 4DAYA 4HCEA 1U9RA 1SNOA 1KNAA 2UXDQ 1HZBA 4OHJA 3HOXG 2B2VA 4EQ5A 5EKLA 3GTPB 2IW3A 4O0AA 3OW2A 1MSGA 3BVMA 3OIQA 3MXPA 3M4PA 3H6MA 1GHKA 1TIID 3HOYH 4GLVB 3MZ5A 1X65A 3NEMA 4X6AH 2F0KA 4KD3A 4E6IA 4NXNL 1DJRD 3CD6A 5ELOA 2EZVA 2NWGA 1WTHA 2QDBA 4XTCS 4DAPA 1Y1WH 5IGFA 4IN3A 3Q6SA 1NNXA 1TU2B 2OEOA 1N33L 1A3VA 1GUGA 3TS0A 3J80i 2K04A 4ZKBB 4JV5L 1H9JA 1YI2A 3J81j 1MSHA 3X3MA 4DN4M 4RCNA 3BG3A 3VYTA 1VQFA 4LAAA 3K6OA 3HS0C 1LTGD 1Z6HA 2DJGC 4G4KA 4A93B 3G71A 2DNEA 5ELNA 2G5DA 1IBKQ 1WCMG 4WFN3 1LYLA 1BCPF 4DV0Q 3EROA 2K5WA 1SBBB 1Y14B 1GO3E 5E4XA 3KF8A 4B3TQ 5IP9G 2R93B 4JI3L 1KLUD 4FF4A 2JP1A 4A3FG 1SFOB 2B2YA 1ONLA 2RHSB 1XPRA 1X6OA 3K58A 3GTPH 3BS1A 4UDUC 3CCLA 3EJIA 3PGZA 1SYCA 4ILWA 4TRDA 4IPDA 3BYTB 2MP1A 4IQZA 2JA8B 3UI2A 3VR3A 2XTIA 1ILPA 1Y1WB 2F4VL 1YITA 4JI5L 2R7ZB 4MTKA 4JV5Q 3CCSA 1XNRL 5IE8A 3C1FA 1JOKA 3A7LA 3TN2A 1FJGL 1L0XB 2WAQG 2VXWA 3V96A 2ZJQA 1HXYD 3R3OA 3A5ZB 1QZHA 1HUMA 1M8AA 4C3IB 2D0PA 1E22A 1SLJA 1JB7A 1PRTB 3NENA 3M3YH 1HJPA 1I5FA 5KNDA 4GLAC 4GOPB 3CC2A 2JEAI 2A19A 2VS1A 1L1OA 2H5XA 2F0PA 2RA4A 4KD4A 3H91A 3I73A 3TP5A 5CBAE 3MEFA 2EQSA 1RDPD 3U50C 2UXDL 4HIOA 5EPLA 3AEVA 4IO9A 1G6PA 5KIXA 2A74C 2KEEA 5IOCA 5C4XH 4A3CH 3VYSA 5KYLA 2Z6BA 3PUZA 2KECA 3S17B 1SNDA 2HIVA 1VQ5A 2KA7A 3M4QA 2E76C 2EYJA 4GN5A 4DV2L 3C2PA 1PRTC 4G7HC 4UP7A 3HOUB 4LF6Q 2R7ZH 1K83H 4JI8Q 4C2MB 4H7BA 4Z9CB 3NTKA 5IT9L 2KEDA 2RCNA 4A76A 2MFIA 3OTOQ 4CKCA 2J4XA 2PPBC 3BDLA 5FLMG 1KD1C 4LFAL 5CV5A 3AFQA 1AP0A 1QE6A 2WKCA 4ZRZA 1WD1A 4CGYB 1SEBD 2WIIB 2NB0A 3AU7A 1XX8A 4LF8Q 4C3IH 5CR3A 2FMMA 2YTXA 5LHY1 5I9OA 3OTOL 3M3YB 3CC7A 4AQYL 1CM9A 4B3MQ 5GAHC 1XWEA 4I7ZC 2XGTA 2EY1A 1ILQA 4ME3A 1XMOL 2FXQA 3GTLB 4B3RQ 1JE4A 1UNSA 1W6KA 1HZ9A 1KAAA 4KKTA 4Q0FA 3KLWA 2JK8A 4KMUC 5JAVA 1KC8C 5EBCA 2VB2X 3ND9A 1VQJA 5C0XI 1PTOH 1KDAA 3DMUA 4GNXB 3D4WA 5IIFA 3GTOB 1BCPD 2I5HA 2ZJRA 1G6ZA 1X9NA 3KBGA 4X66Q 1SDFA 2BE5C 1QWYA 2K5HA 1J6QA 2CKZB 2OTJA 3KDFB 1H9SB 2OXPA 4DUZL 4YIJA 3HEJA 4C2MH 4HSVA 1T9HA 1JWMD 2K7VA 4DR6L 1V43A 1UUPA 2B2TA 1CTMA 4XQQA 2IX1A 3HOWB 1UE5A 4IPHA 5C4JH 2F03A 2N49A 2KCNA 1RHPA 1S5BD 2ZXOA 3QB3A 1O80A 1AE2A 1HH2P 1U0LA 3BVZA 2DY7A 2Y0SB 4J15A 2O5IC 5DNFA 4EVOA 5IGEA 1BO0A 2QEXA 1PYWD 2F1MA 3BDCA 1NR4A 2LS01 2DN8A 4APVA 1QUQA 1TWGH 1NR2A 3TSSA 5C3XA 1LTBD 3ONAB 1L0WA 1VQMA 5D14A 4JCVE 2CWPA 4A75A 1PTOB 4R4CA 5JEAG 4NPSA 2C35B 4DK0A 3GTJB 1I3QH 5G3LD 4GKKL 2EOTA 2XRSD 3FKIH 2QDLA 4LMQD 3ULPA 3D6WA 2I5LX 1EZ8A 1PYBA 3GTKH 1QOHA 4XQJA 1LM0A 1XXGA 5EPJA 3JAMi 1ESRA 1EWHA 2F0HA 4LFAQ 1NE3A 1IBKL 4GOPA 1KDCA 2FMCA 1A3UA 2MNAA 2LSSA 5BR8Q 2UXCL 1FVIA 1LT6D 2Z9HA 5K5PA 4KHZA 2GN5A 5C4JB 1TY0A 2Y0SE 2K50A 2EYHA 4DR3Q 4B9XA 1HFNA 1N33Q 1GUTA 3M4YA 5C4HA 4FF1A 1TS5A 2JA5H 2B63G 2HCIA 4A3IB 1N9WA 5IP7G 1TWGB 1CQFA 3RMHA 4ZYSA 3TZDA 4J6HA 1X55A 4NMZA 4R4TA 4K5XA 3A8IE 4MIUA 1I3QB 2E75C 1JOQA 1CHQD 1I4PA 3HOXH 3AYHB 5HY6A 2AUJD 4A3KG 5HGTA 1ESFA 4DV1Q 3D4RA 1VQ6A 3GTKB 3W1BA 1J9OA 1V1QA 3A0JA 3SE0A 1JC7A 1D2BA 1SJHD 1S5ED 4ZUIA 3VA7A 2OWOA 1UAPA 3HOZH 3D31A 1B3AA 1U4RA
chains in the Genus database with same CATH topology
4LW1A 3EN2A 5J3BA 3KJOA 3WWVA 3BZKA 4JI7Q 4DV7Q 3J80c 3EIVA 4IJHA 3GTGH 4A3IG 5M5XH 1X3EA 1YNXA 1VQDA 3RR5A 4OONA 5M3MG 1MIUA 1TWCH 4A3GH 2K5VA 4LFBQ 1Y1WG 3EBEA 2NN6I 3TREA 3HOYG 1BBWA 4R4OA 1WJJA 4GKJL 2A1AA 3LGJA 2ZM6L 3HOVH 4B3RL 1HNZL 4JOIC 4BY1H 4QL5A 2F4VQ 5JJIA 4Y7NH 1Y1VG 1V9PA 1M90C 2R92H 3KDFA 3GTJH 4LF5Q 2HQLA 2RHQB 4X64L 2VNUD 4KI0A 1Q12A 2UXCQ 4GN4B 4JYAL 4WJ4A 1N36Q 3CPFA 3ULJA 1XNQL 3FKIG 2ZTCA 4A3IH 2E2JH 2F52A 4BBSG 1EWIA 3RZDH 3PO3G 1I94Q 2WFWA 2YV5A 4A3DH 2BA0A 1OXTA 3S1MH 2PNHA 2UUCQ 5BR8L 3ER0A 2UUAL 1YBYA 1EIFA 2JE6I 1JJCB 1NMGA 2KHIA 4O2DA 4HJ5A 1XMQL 1S40A 4DV4Q 1Z9FA 4XIGS 4OX9L 4DR4L 1JMCA 2A8VA 4LUOA 1HZAA 2AMCB 1UE1A 1I94L 4LF8L 4JI2Q 1D8LA 2E5LL 4DV4L 1A8VA 1XNQQ 1EQQA 4JBWA 1PYSB 1N36L 1QVGA 4JYAQ 3OYYA 4DV0L 1SFOH 1WOCA 4X64Q 2V1CC 4DUYL 1QUQB 4HIKA 3G4SA 3CMAA 4DV3Q 4YWMA 1ASZA 3UE0A 1HNZQ 3W1GA 1K8AC 3CMEA 4GKJQ 5IYCH 1Q7YC 1VQAA 4UP8A 4HJ9A 2NVQH 4BA2I 5M3FH 4OWXB 1BKBA 1KAWA 1Q86C 1PH5A 3U4ZA 5IY0A 2RF4A 4JI4L 4X62L 3T1HL 3K7AH 1TWFH 4QJFA 5E7NA 5FJ8H 1TXYA 4A93H 4IFDI 1EOVA 1UWVA 5K36G 1HR0Q 4A3MH 1AE3A 3K80C 1C0AA 4L5TA 1K9MC 3S24A 1FGUA 3FHWA 3BZCA 1NJIC 2MO0A 3CW2C 4NXNQ 3S14H 4YHHQ 4LF4Q 1J5EQ 3ULLA 2Y0SG 3CPWA 2QA4A 4B3SQ 3H0GH 1VQBA 3HKZE 3CCUA 4A3MG 1PH9A 4LF7Q 2HT1A 4JI6L 1D7QA 1IBMQ 4DAYB 5C4XG 3ERSX 1JT8A 2PMZE 1TWHH 2JA9A 4DR1Q 4MTNA 3UDXA 1JE5A 4PZ8A 2UXDQ 1HZBA 3PUXA 4DK3C 3HOXG 4EQ5A 1YHQA 1OXXK 3PO3H 1K0RA 4JI1L 4BBSH 2CQOA 2ASBA 3GO5A 1Y1VH 1TWAH 4O0AA 3OW2A 2PQAA 2JA7G 2B29A 3GD7A 3M4PA 1UEBA 3HOYH 4DR6Q 4R1JA 4GLVB 4OWTB 1X65A 3NEMA 1KQSA 4X6AH 4NXNL 1W3SA 3D0FA 5ELOA 1NBWA 1FJGQ 3F2BA 3CD6A 4A3BG 4A3LG 2N78A 4XTCS 4YWLA 1CKMA 3PO2H 3S1QH 1Y1WH 3S15H 4UY8C 1S3OA 1YEZA 3U58A 4DR2L 4DV5L 1R9TH 1N33L 2E8GA 1PH7A 1PHJA 3UDFA 3J80i 3TS0A 2NVXH 1JJGA 1L1OB 5IT9c 2VW9A 1HZCA 4GLXA 3NELA 1GD7A 5DLQE 4BBRH 1BBUA 1QVFA 2VUMH 2UXBQ 1C9OA 1RL2A 4JV5L 1IXRA 4GN3B 1YI2A 3J81j 2NN6G 2ALYB 3UDIA 1CSQA 3PIPA 2VL6A 4JI4Q 1EUJA 4YY3L 3CXCA 1VQFA 3G6EA 2NVTH 2R6GA 2KCTA 2HHHQ 5FLXc 3CCRA 1IBLL 4NXML 4JG2A 3G71A 5ELNA 4JI3Q 2PQAB 2VY3A 1WCMG 1IBKQ 2CCZA 3S1RH 1LYLA 1YJ9A 3M4OH 4DV0Q 5JJLA 1HNXQ 5JJKA 3RLFA 1Y14B 4LFAL 4H02A 4DR5Q 1GO3E 2OTLA 2KHJA 1PH2A 1VQKA 4B3TQ 5IP9G 4P72A 2ZJPA 4JI3L 1OXUA 1RIPA 4HJ8A 3GTMH 4A3FG 3L2PA 2JA6G 1PH8A 2ZTEA 1HNXL 1NY4A 2RHSB 5GADC 4MZ9A 3I55A 1X6OA 1XPRA 2MQHA 2HHHL 1CSPA 2UUCL 1B7YB 3AQQA 2E2IH 3GTPH 3CCEA 3CCLA 3CC4A 3E9HA 3RLOA 4Y52H 4PG3A 2EIFA 2B3GA 3PGZA 3STBC 4NXMQ 3RZOH 4IPDA 4GKKQ 2ZM6Q 2VQFL 4JBKA 3M85A 4AYBE 1VQIA 2AKWB 2XTIA 3HOWG 4OO1I 3G48A 2VUMG 2IT1A 2F4VL 1PFSA 3I4NH 4BA1I 4GOPC 2OCEA 4HIMA 4JI5L 5GAEC 1YITA 3S2HH 2GVAA 3M9BA 4DV7L 4JV5Q 3CCSA 1XNRL 2UXBL 1VQEA 5IYBG 3I56A 5IE8A 2Q2HA 4A3KH 1PH4A 1BVSA 3GTQH 3L0OA 4KHPL 2Q2UA 5C44G 1SR3A 2Z6KA 1FJGL 3E0EA 1PH1A 2WAQG 4NB3A 3GTOH 1EFWA 2MO1A 2ZJQA 4JI7L 3BU2A 1WYDA 3A5ZB 3PUWA 2LXKA 3JAMc 1Q46A 4OXPA 1QZHA 4LFCQ 2AWNA 5C0XJ 4DR7Q 2D0PA 3RLNA 1E22A 1SLJA 1JB7A 2OQKA 3NENA 4JI1Q 3M3YH 1KRSA 1HJPA 3MXNB 1I5FA 1E1OA 4GLAC 4POFA 4X65L 5HGQA 4GOPB 3A74A 3CC2A 5IYBH 1E24A 2D62A 3J81c 2JEAI 4YCVA 4C3JH 4OWWB 2VS1A 2A19A 1IL2A 1L1OA 1VCIA 1E3PA 2H5XA 1N32Q 1SMXA 2AWOA 1IZ6A 3A5UA 3MEFA 1B8AA 2EQSA 5LMUL 4TQUS 1GVPA 3U50C 3CCJA 4HIOA 1J5EL 1VQ8A 1VQ9A 2UXDL 3AEVA 4X66L 4IO9A 3HOWH 1VQ7A 1CUKA 1G6PA 2F3IA 2I5MX 5C4XH 1IBML 2WB1E 4LF7L 4A3CH 3CAMA 4A3JH 1XNRQ 4BY7G 5EAYA 4B3SL 1UE6A 3PUZA 4YHHL 3KF6A 4LF4L 4X62Q 5H1SE 4P75A 3T1HQ 4A3EG 4KHPQ 1OXVA 1VQCA 1XPOA 3PV0A 4BXXH 3AFPA 2R7ZG 2I0QA 1VQLA 1K3RA 3JC66 3HFZB 2PI2A 1P16A 5FJ8G 3PF5A 1OXSC 2IHFA 2HIVA 3L7ZC 5IYCG 1Q82C 4JI5Q 3STBD 1YVCA 1VQ5A 3TRZA 3M4QA 4GN5A 3CCQA 4DV2L 4A3LH 3S16H 2NVYH 4UP7A 2JA8G 4A3GG 3K0XA 5M5YH 4K0KL 3CF5A 3VDYA 1K83H 4JI8Q 4LF6Q 2R7ZH 3F2CA 2VQFQ 5IYDG 2UUBQ 3FP9A 3DLLA 1XMOQ 1C7YA 3PUVA 4DV3L 2JA5G 2AHOB 2B63H 2RCNA 4A76A 2WB1G 4JBMA 2MFIA 1G291 3OTOQ 1VQOA 4DUYQ 4IJLA 5FLMG 3KF6B 5C44H 2VQEL 1MJCA 2K14A 5IWAQ 1KD1C 3AFQA 3I4MH 1PVOA 1XMQQ 2ZTDA 4AQYQ 3RN5A 4B3ML 4KLKA 2R93G 2R93H 1M1KC 2DUDA 2VQEQ 1HR0W 4C3IH 4LF8Q 4JC0A 4YWKA 4A3DG 4WJ3M 1FL0A 2YTXA 4DKAC 4RG1A 3UE1A 3KYHC 3OTOL 3K7UC 3PUYA 1KRTA 3CC7A 4YCWA 3I4MG 4AQYL 4B3MQ 2UUBL 3IRBA 5GAHC 1YIJA 3SGIA 2XGTA 4UPAA 2Q2IA 3J81i 4LF6L 4LF5L 2K5NA 2EXDA 1NMFA 2N3SA 3KF8B 4ME3A 4YY3Q 4HIDA 2JA8H 1XMOL 2FXQA 4B3RQ 1U5KA 1VS0A 4L5QA 1HZ9A 4YCUA 1EYGA 4DNIA 3KLWA 4A3BH 1PH3A 1PV4A 2JK8A 5M3MH 4DPGA 1LTLA 4ALPA 3CCVA 1I50H 2NZHA 1KC8C 2UU9L 1VQJA 4AIMA 2ATWA 2JA7H 4IOAA 5C0XI 1YZ6A 4PMWA 4DV5Q 1Q81C 4DR2Q 4P74A 5IYDH 4GNXB 4QIWE 4LFBL 4A3EH 2OQ0A 2Z6KC 2I5HA 2ZJRA 1X9NA 1CKOA 4X66Q 1L1OC 4AYBG 1X3FA 2K5HA 5LMUQ 1J6QA 1S72A 2CKZB 2OTJA 3KJPA 3ZJYC 3HOUG 3KDFB 2CFMA 4IPGA 3J7ZC 2JJQA 1W2BA 1SE8A 3HKSA 2K52A 4LF9L 2ID0A 4IOCA 2CWAA 5LMNQ 4R4QA 3E9IA 4DUZL 4C2MH 3RN2A 1T9HA 1PH6A 5AJ3Q 1CKNA 4IFDJ 3PIOA 4DR6L 2K75A 1V43A 4DR1L 1X54A 5C3EH 1AH9A 1N32L 2IX1A 3PO2G 4LF9Q 4IFDG 1MJEA 3M7NA 4GNXA 4X65Q 1UE5A 2R7DA 4IPHA 5C4JH 4P73A 1PA6A 5AJ3L 1VQNA 2N49A 1NTGA 3GDEA 5M3FG 4HJ7A 4UP9A 3NBHB 4BY1G 4C3HH 3H3VH 1AE2A 1HH2P 2JEBI 4FDBA 4LFCL 1U0LA 1H95A 4J15A 1E1TA 4BXXG 5GROA 2NZOA 3I7FA 2DGYA 2QEXA 1VQ4A 3UDGA 3ICEA 3S17H 1Q1EA 1L2FA 4POGA 1O7IA 4APVA 2UU9Q 1HR0L 2BH2A 5IP7H 1QUQA 4JI0L 3I4NG 5GQOA 4TVAB 3T1YL 4A3JG 4LUVA 1TWGH 1IYJB 2VZAA 1A63A 4R4IA 3CQZH 4GNXC 3HOUH 3F2DA 1XTDA 1L0WA 4DR3L 2KENA 1VQMA 4LUZA 3H3VI 3HOZG 4JCVE 2CWPA 4QGUA 2Z0SA 1EQRA 4A75A 1UE7A 3KOJA 1YJWA 1HNWL 4R4CA 2QGQA 1YHAA 2YYZA 5JEAG 4NPSA 2C35B 1DGSA 1I3QH 2HIXA 4PZ7A 4GKKL 4A93G 2YU9H 3FKIH 1I6HH 3ULPA 3TQYA 1SN8A 4BBRG 2I5LX 1SRUA 1N34Q 2ES2A 1PYBA 3K8AA 3GTKH 1VQPA 3CP0A 3I2ZA 3BJUA 1KIXA 2JA6H 1LM0A 5GAGC 1B70B 2UUAQ 3JAMi 5IWAL 2E5LQ 4JI2L 3S2DH 5M5WH 4LFAQ 1N8RC 4HJAA 1N34L 1NE3A 1IBKL 4B3TL 1MKHA 3KFUA 4OX9Q 4DR4Q 4GOPA 4LNQA 4DR5L 4BY7H 1P8LA 2L15A 4A3CG 3K81C 4PZ6A 2MNAA 2Q2TA 3TS2A 2LSSA 5BR8Q 1Q1BA 4JI8L 4A4IA 2WAQE 4DAMA 2UXCL 1FVIA 3GTLH 2K4KA 1YJNA 1X3GA 4KHZA 2GN5A 1KL9A 3HKZG 4LWCA 1CKNB 4MNOA 1IBLQ 2Y0SE 2K50A 1KHIA 2YTVA 1QZGA 1LUZA 1HNWQ 3F1ZA 3T1YQ 4K0KQ 4L5SA 4DV2Q 4DR3Q 3B6YA 5LMNW 1KXLA 3S1NH 4IPCA 3I4OA 5C0XG 1N33Q 2WP8J 1SROA 2R7FA 1GKHA 2JA5H 2PI2E 2B63G 1A62A 4JI0Q 1A0IA 2GVBA 1N9WA 5IP7G 4QY7A 5IP9H 2BA1A 3PSIA 4P71A 2R92G 4JBJA 4A3FH 3PF4A 2E2HH 1OTCA 1XPUA 2JQOA 1ASYA 1X55A 3TEHB 2YTYA 3W5OA 4EX5A 1WCMH 1QVCA 4DV1L 1Z47A 1E7ZA 4R4TA 4JOIA 3CCMA 4L5RC 4OO1G 1YHBA 3U4VA 4RMFA 1VQHA 1XJVA 2IX0A 4DV6L 1K73C 4QQBX 3H15A 1EIYB 3HOVG 3HOXH 2KBNA 3AYHB 5HY6A 4AH6A 4A3KG 1WFQA 2LXJA 5LMNL 4DUZQ 3J7A5 5C3EG 3PCOB 1X56A 2KCMA 1G51A 4DV1Q 1K8GA 4DK6C 4JI6Q 1VQ6A 1Q8KA 3W1BA 2D0OA 2N8NA 1V1QA 3A0JA 2IHEA 2IY5B 1VQGA 1GM5A 3H0GG 4DV6Q 1JJ2A 2BH8A 3Q8DA 1WI5A 2OWOA 3HOZH 4DR7L 3D31A 3RNUA 3F8TA 3DM3A 5FLMH 4GS3A 5JEAJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW1 A;  3EN2 A;  5J3B A;  3KJO A;  3WWV A;  3BZK A;  4JI7 Q;  4DV7 Q;  3J80 c;  3EIV A;  4IJH A;  3GTG H;  4A3I G;  5M5X H;  1X3E A;  1YNX A;  1VQD A;  3RR5 A;  4OON A;  5M3M G;  1MIU A;  1TWC H;  4A3G H;  2K5V A;  4LFB Q;  1Y1W G;  3EBE A;  2NN6 I;  3TRE A;  3HOY G;  1BBW A;  4R4O A;  1WJJ A;  4GKJ L;  2A1A A;  3LGJ A;  2ZM6 L;  3HOV H;  4B3R L;  1HNZ L;  4JOI C;  4BY1 H;  4QL5 A;  2F4V Q;  5JJI A;  4Y7N H;  1Y1V G;  1V9P A;  1M90 C;  2R92 H;  3KDF A;  3GTJ H;  4LF5 Q;  2HQL A;  2RHQ B;  4X64 L;  2VNU D;  4KI0 A;  1Q12 A;  2UXC Q;  4GN4 B;  4JYA L;  4WJ4 A;  1N36 Q;  3CPF A;  3ULJ A;  1XNQ L;  3FKI G;  2ZTC A;  4A3I H;  2E2J H;  2F52 A;  4BBS G;  1EWI A;  3RZD H;  3PO3 G;  1I94 Q;  2WFW A;  2YV5 A;  4A3D H;  2BA0 A;  1OXT A;  3S1M H;  2PNH A;  2UUC Q;  5BR8 L;  3ER0 A;  2UUA L;  1YBY A;  1EIF A;  2JE6 I;  1JJC B;  1NMG A;  2KHI A;  4O2D A;  4HJ5 A;  1XMQ L;  1S40 A;  4DV4 Q;  1Z9F A;  4XIG S;  4OX9 L;  4DR4 L;  1JMC A;  2A8V A;  4LUO A;  1HZA A;  2AMC B;  1UE1 A;  1I94 L;  4LF8 L;  4JI2 Q;  1D8L A;  2E5L L;  4DV4 L;  1A8V A;  1XNQ Q;  1EQQ A;  4JBW A;  1PYS B;  1N36 L;  1QVG A;  4JYA Q;  3OYY A;  4DV0 L;  1SFO H;  1WOC A;  4X64 Q;  2V1C C;  4DUY L;  1QUQ B;  4HIK A;  3G4S A;  3CMA A;  4DV3 Q;  4YWM A;  1ASZ A;  3UE0 A;  1HNZ Q;  3W1G A;  1K8A C;  3CME A;  4GKJ Q;  5IYC H;  1Q7Y C;  1VQA A;  4UP8 A;  4HJ9 A;  2NVQ H;  4BA2 I;  5M3F H;  4OWX B;  1BKB A;  1KAW A;  1Q86 C;  1PH5 A;  3U4Z A;  5IY0 A;  2RF4 A;  4JI4 L;  4X62 L;  3T1H L;  3K7A H;  1TWF H;  4QJF A;  5E7N A;  5FJ8 H;  1TXY A;  4A93 H;  4IFD I;  1EOV A;  1UWV A;  5K36 G;  1HR0 Q;  4A3M H;  1AE3 A;  3K80 C;  1C0A A;  4L5T A;  1K9M C;  3S24 A;  1FGU A;  3FHW A;  3BZC A;  1NJI C;  2MO0 A;  3CW2 C;  4NXN Q;  3S14 H;  4YHH Q;  4LF4 Q;  1J5E Q;  3ULL A;  2Y0S G;  3CPW A;  2QA4 A;  4B3S Q;  3H0G H;  1VQB A;  3HKZ E;  3CCU A;  4A3M G;  1PH9 A;  4LF7 Q;  2HT1 A;  4JI6 L;  1D7Q A;  1IBM Q;  4DAY B;  5C4X G;  3ERS X;  1JT8 A;  2PMZ E;  1TWH H;  2JA9 A;  4DR1 Q;  4MTN A;  3UDX A;  1JE5 A;  4PZ8 A;  2UXD Q;  1HZB A;  3PUX A;  4DK3 C;  3HOX G;  4EQ5 A;  1YHQ A;  1OXX K;  3PO3 H;  1K0R A;  4JI1 L;  4BBS H;  2CQO A;  2ASB A;  3GO5 A;  1Y1V H;  1TWA H;  4O0A A;  3OW2 A;  2PQA A;  2JA7 G;  2B29 A;  3GD7 A;  3M4P A;  1UEB A;  3HOY H;  4DR6 Q;  4R1J A;  4GLV B;  4OWT B;  1X65 A;  3NEM A;  1KQS A;  4X6A H;  4NXN L;  1W3S A;  3D0F A;  5ELO A;  1NBW A;  1FJG Q;  3F2B A;  3CD6 A;  4A3B G;  4A3L G;  2N78 A;  4XTC S;  4YWL A;  1CKM A;  3PO2 H;  3S1Q H;  1Y1W H;  3S15 H;  4UY8 C;  1S3O A;  1YEZ A;  3U58 A;  4DR2 L;  4DV5 L;  1R9T H;  1N33 L;  2E8G A;  1PH7 A;  1PHJ A;  3UDF A;  3J80 i;  3TS0 A;  2NVX H;  1JJG A;  1L1O B;  5IT9 c;  2VW9 A;  1HZC A;  4GLX A;  3NEL A;  1GD7 A;  5DLQ E;  4BBR H;  1BBU A;  1QVF A;  2VUM H;  2UXB Q;  1C9O A;  1RL2 A;  4JV5 L;  1IXR A;  4GN3 B;  1YI2 A;  3J81 j;  2NN6 G;  2ALY B;  3UDI A;  1CSQ A;  3PIP A;  2VL6 A;  4JI4 Q;  1EUJ A;  4YY3 L;  3CXC A;  1VQF A;  3G6E A;  2NVT H;  2R6G A;  2KCT A;  2HHH Q;  5FLX c;  3CCR A;  1IBL L;  4NXM L;  4JG2 A;  3G71 A;  5ELN A;  4JI3 Q;  2PQA B;  2VY3 A;  1WCM G;  1IBK Q;  2CCZ A;  3S1R H;  1LYL A;  1YJ9 A;  3M4O H;  4DV0 Q;  5JJL A;  1HNX Q;  5JJK A;  3RLF A;  1Y14 B;  4LFA L;  4H02 A;  4DR5 Q;  1GO3 E;  2OTL A;  2KHJ A;  1PH2 A;  1VQK A;  4B3T Q;  5IP9 G;  4P72 A;  2ZJP A;  4JI3 L;  1OXU A;  1RIP A;  4HJ8 A;  3GTM H;  4A3F G;  3L2P A;  2JA6 G;  1PH8 A;  2ZTE A;  1HNX L;  1NY4 A;  2RHS B;  5GAD C;  4MZ9 A;  3I55 A;  1X6O A;  1XPR A;  2MQH A;  2HHH L;  1CSP A;  2UUC L;  1B7Y B;  3AQQ A;  2E2I H;  3GTP H;  3CCE A;  3CCL A;  3CC4 A;  3E9H A;  3RLO A;  4Y52 H;  4PG3 A;  2EIF A;  2B3G A;  3PGZ A;  3STB C;  4NXM Q;  3RZO H;  4IPD A;  4GKK Q;  2ZM6 Q;  2VQF L;  4JBK A;  3M85 A;  4AYB E;  1VQI A;  2AKW B;  2XTI A;  3HOW G;  4OO1 I;  3G48 A;  2VUM G;  2IT1 A;  2F4V L;  1PFS A;  3I4N H;  4BA1 I;  4GOP C;  2OCE A;  4HIM A;  4JI5 L;  5GAE C;  1YIT A;  3S2H H;  2GVA A;  3M9B A;  4DV7 L;  4JV5 Q;  3CCS A;  1XNR L;  2UXB L;  1VQE A;  5IYB G;  3I56 A;  5IE8 A;  2Q2H A;  4A3K H;  1PH4 A;  1BVS A;  3GTQ H;  3L0O A;  4KHP L;  2Q2U A;  5C44 G;  1SR3 A;  2Z6K A;  1FJG L;  3E0E A;  1PH1 A;  2WAQ G;  4NB3 A;  3GTO H;  1EFW A;  2MO1 A;  2ZJQ A;  4JI7 L;  3BU2 A;  1WYD A;  3A5Z B;  3PUW A;  2LXK A;  3JAM c;  1Q46 A;  4OXP A;  1QZH A;  4LFC Q;  2AWN A;  5C0X J;  4DR7 Q;  2D0P A;  3RLN A;  1E22 A;  1SLJ A;  1JB7 A;  2OQK A;  3NEN A;  4JI1 Q;  3M3Y H;  1KRS A;  1HJP A;  3MXN B;  1I5F A;  1E1O A;  4GLA C;  4POF A;  4X65 L;  5HGQ A;  4GOP B;  3A74 A;  3CC2 A;  5IYB H;  1E24 A;  2D62 A;  3J81 c;  2JEA I;  4YCV A;  4C3J H;  4OWW B;  2VS1 A;  2A19 A;  1IL2 A;  1L1O A;  1VCI A;  1E3P A;  2H5X A;  1N32 Q;  1SMX A;  2AWO A;  1IZ6 A;  3A5U A;  3MEF A;  1B8A A;  2EQS A;  5LMU L;  4TQU S;  1GVP A;  3U50 C;  3CCJ A;  4HIO A;  1J5E L;  1VQ8 A;  1VQ9 A;  2UXD L;  3AEV A;  4X66 L;  4IO9 A;  3HOW H;  1VQ7 A;  1CUK A;  1G6P A;  2F3I A;  2I5M X;  5C4X H;  1IBM L;  2WB1 E;  4LF7 L;  4A3C H;  3CAM A;  4A3J H;  1XNR Q;  4BY7 G;  5EAY A;  4B3S L;  1UE6 A;  3PUZ A;  4YHH L;  3KF6 A;  4LF4 L;  4X62 Q;  5H1S E;  4P75 A;  3T1H Q;  4A3E G;  4KHP Q;  1OXV A;  1VQC A;  1XPO A;  3PV0 A;  4BXX H;  3AFP A;  2R7Z G;  2I0Q A;  1VQL A;  1K3R A;  3JC6 6;  3HFZ B;  2PI2 A;  1P16 A;  5FJ8 G;  3PF5 A;  1OXS C;  2IHF A;  2HIV A;  3L7Z C;  5IYC G;  1Q82 C;  4JI5 Q;  3STB D;  1YVC A;  1VQ5 A;  3TRZ A;  3M4Q A;  4GN5 A;  3CCQ A;  4DV2 L;  4A3L H;  3S16 H;  2NVY H;  4UP7 A;  2JA8 G;  4A3G G;  3K0X A;  5M5Y H;  4K0K L;  3CF5 A;  3VDY A;  1K83 H;  4JI8 Q;  4LF6 Q;  2R7Z H;  3F2C A;  2VQF Q;  5IYD G;  2UUB Q;  3FP9 A;  3DLL A;  1XMO Q;  1C7Y A;  3PUV A;  4DV3 L;  2JA5 G;  2AHO B;  2B63 H;  2RCN A;  4A76 A;  2WB1 G;  4JBM A;  2MFI A;  1G29 1;  3OTO Q;  1VQO A;  4DUY Q;  4IJL A;  5FLM G;  3KF6 B;  5C44 H;  2VQE L;  1MJC A;  2K14 A;  5IWA Q;  1KD1 C;  3AFQ A;  3I4M H;  1PVO A;  1XMQ Q;  2ZTD A;  4AQY Q;  3RN5 A;  4B3M L;  4KLK A;  2R93 G;  2R93 H;  1M1K C;  2DUD A;  2VQE Q;  1HR0 W;  4C3I H;  4LF8 Q;  4JC0 A;  4YWK A;  4A3D G;  4WJ3 M;  1FL0 A;  2YTX A;  4DKA C;  4RG1 A;  3UE1 A;  3KYH C;  3OTO L;  3K7U C;  3PUY A;  1KRT A;  3CC7 A;  4YCW A;  3I4M G;  4AQY L;  4B3M Q;  2UUB L;  3IRB A;  5GAH C;  1YIJ A;  3SGI A;  2XGT A;  4UPA A;  2Q2I A;  3J81 i;  4LF6 L;  4LF5 L;  2K5N A;  2EXD A;  1NMF A;  2N3S A;  3KF8 B;  4ME3 A;  4YY3 Q;  4HID A;  2JA8 H;  1XMO L;  2FXQ A;  4B3R Q;  1U5K A;  1VS0 A;  4L5Q A;  1HZ9 A;  4YCU A;  1EYG A;  4DNI A;  3KLW A;  4A3B H;  1PH3 A;  1PV4 A;  2JK8 A;  5M3M H;  4DPG A;  1LTL A;  4ALP A;  3CCV A;  1I50 H;  2NZH A;  1KC8 C;  2UU9 L;  1VQJ A;  4AIM A;  2ATW A;  2JA7 H;  4IOA A;  5C0X I;  1YZ6 A;  4PMW A;  4DV5 Q;  1Q81 C;  4DR2 Q;  4P74 A;  5IYD H;  4GNX B;  4QIW E;  4LFB L;  4A3E H;  2OQ0 A;  2Z6K C;  2I5H A;  2ZJR A;  1X9N A;  1CKO A;  4X66 Q;  1L1O C;  4AYB G;  1X3F A;  2K5H A;  5LMU Q;  1J6Q A;  1S72 A;  2CKZ B;  2OTJ A;  3KJP A;  3ZJY C;  3HOU G;  3KDF B;  2CFM A;  4IPG A;  3J7Z C;  2JJQ A;  1W2B A;  1SE8 A;  3HKS A;  2K52 A;  4LF9 L;  2ID0 A;  4IOC A;  2CWA A;  5LMN Q;  4R4Q A;  3E9I A;  4DUZ L;  4C2M H;  3RN2 A;  1T9H A;  1PH6 A;  5AJ3 Q;  1CKN A;  4IFD J;  3PIO A;  4DR6 L;  2K75 A;  1V43 A;  4DR1 L;  1X54 A;  5C3E H;  1AH9 A;  1N32 L;  2IX1 A;  3PO2 G;  4LF9 Q;  4IFD G;  1MJE A;  3M7N A;  4GNX A;  4X65 Q;  1UE5 A;  2R7D A;  4IPH A;  5C4J H;  4P73 A;  1PA6 A;  5AJ3 L;  1VQN A;  2N49 A;  1NTG A;  3GDE A;  5M3F G;  4HJ7 A;  4UP9 A;  3NBH B;  4BY1 G;  4C3H H;  3H3V H;  1AE2 A;  1HH2 P;  2JEB I;  4FDB A;  4LFC L;  1U0L A;  1H95 A;  4J15 A;  1E1T A;  4BXX G;  5GRO A;  2NZO A;  3I7F A;  2DGY A;  2QEX A;  1VQ4 A;  3UDG A;  3ICE A;  3S17 H;  1Q1E A;  1L2F A;  4POG A;  1O7I A;  4APV A;  2UU9 Q;  1HR0 L;  2BH2 A;  5IP7 H;  1QUQ A;  4JI0 L;  3I4N G;  5GQO A;  4TVA B;  3T1Y L;  4A3J G;  4LUV A;  1TWG H;  1IYJ B;  2VZA A;  1A63 A;  4R4I A;  3CQZ H;  4GNX C;  3HOU H;  3F2D A;  1XTD A;  1L0W A;  4DR3 L;  2KEN A;  1VQM A;  4LUZ A;  3H3V I;  3HOZ G;  4JCV E;  2CWP A;  4QGU A;  2Z0S A;  1EQR A;  4A75 A;  1UE7 A;  3KOJ A;  1YJW A;  1HNW L;  4R4C A;  2QGQ A;  1YHA A;  2YYZ A;  5JEA G;  4NPS A;  2C35 B;  1DGS A;  1I3Q H;  2HIX A;  4PZ7 A;  4GKK L;  4A93 G;  2YU9 H;  3FKI H;  1I6H H;  3ULP A;  3TQY A;  1SN8 A;  4BBR G;  2I5L X;  1SRU A;  1N34 Q;  2ES2 A;  1PYB A;  3K8A A;  3GTK H;  1VQP A;  3CP0 A;  3I2Z A;  3BJU A;  1KIX A;  2JA6 H;  1LM0 A;  5GAG C;  1B70 B;  2UUA Q;  3JAM i;  5IWA L;  2E5L Q;  4JI2 L;  3S2D H;  5M5W H;  4LFA Q;  1N8R C;  4HJA A;  1N34 L;  1NE3 A;  1IBK L;  4B3T L;  1MKH A;  3KFU A;  4OX9 Q;  4DR4 Q;  4GOP A;  4LNQ A;  4DR5 L;  4BY7 H;  1P8L A;  2L15 A;  4A3C G;  3K81 C;  4PZ6 A;  2MNA A;  2Q2T A;  3TS2 A;  2LSS A;  5BR8 Q;  1Q1B A;  4JI8 L;  4A4I A;  2WAQ E;  4DAM A;  2UXC L;  1FVI A;  3GTL H;  2K4K A;  1YJN A;  1X3G A;  4KHZ A;  2GN5 A;  1KL9 A;  3HKZ G;  4LWC A;  1CKN B;  4MNO A;  1IBL Q;  2Y0S E;  2K50 A;  1KHI A;  2YTV A;  1QZG A;  1LUZ A;  1HNW Q;  3F1Z A;  3T1Y Q;  4K0K Q;  4L5S A;  4DV2 Q;  4DR3 Q;  3B6Y A;  5LMN W;  1KXL A;  3S1N H;  4IPC A;  3I4O A;  5C0X G;  1N33 Q;  2WP8 J;  1SRO A;  2R7F A;  1GKH A;  2JA5 H;  2PI2 E;  2B63 G;  1A62 A;  4JI0 Q;  1A0I A;  2GVB A;  1N9W A;  5IP7 G;  4QY7 A;  5IP9 H;  2BA1 A;  3PSI A;  4P71 A;  2R92 G;  4JBJ A;  4A3F H;  3PF4 A;  2E2H H;  1OTC A;  1XPU A;  2JQO A;  1ASY A;  1X55 A;  3TEH B;  2YTY A;  3W5O A;  4EX5 A;  1WCM H;  1QVC A;  4DV1 L;  1Z47 A;  1E7Z A;  4R4T A;  4JOI A;  3CCM A;  4L5R C;  4OO1 G;  1YHB A;  3U4V A;  4RMF A;  1VQH A;  1XJV A;  2IX0 A;  4DV6 L;  1K73 C;  4QQB X;  3H15 A;  1EIY B;  3HOV G;  3HOX H;  2KBN A;  3AYH B;  5HY6 A;  4AH6 A;  4A3K G;  1WFQ A;  2LXJ A;  5LMN L;  4DUZ Q;  3J7A 5;  5C3E G;  3PCO B;  1X56 A;  2KCM A;  1G51 A;  4DV1 Q;  1K8G A;  4DK6 C;  4JI6 Q;  1VQ6 A;  1Q8K A;  3W1B A;  2D0O A;  2N8N A;  1V1Q A;  3A0J A;  2IHE A;  2IY5 B;  1VQG A;  1GM5 A;  3H0G G;  4DV6 Q;  1JJ2 A;  2BH8 A;  3Q8D A;  1WI5 A;  2OWO A;  3HOZ H;  4DR7 L;  3D31 A;  3RNU A;  3F8T A;  3DM3 A;  5FLM H;  4GS3 A;  5JEA J; 
#chains in the Genus database with same CATH topology
 3VYR A;  4LW1 A;  3EN2 A;  5J3B A;  3K7A B;  2AUK A;  3GTG H;  1TR5 A;  3TZU A;  2ZT9 C;  4K6L A;  1VQD A;  1FNV A;  2PQE A;  1STY A;  3BVG A;  2NN6 I;  4H13 C;  3HOY G;  4R4O A;  1WJJ A;  2A1A A;  4QUC A;  4DAV A;  4EGV A;  2F0L A;  4QL5 A;  2F4V Q;  4Y7N H;  1GHJ A;  4LF5 Q;  2RHQ B;  3MAQ A;  1OO9 B;  4GN4 B;  1IW7 D;  1XNQ L;  2NUC A;  2ZTC A;  4A3I H;  1ENF A;  2E2J H;  1I94 Q;  4DXF A;  4CJ0 B;  2JA6 B;  1KLG D;  3DWA A;  4CDC C;  5BR8 L;  1JJC B;  1NMG A;  1DON A;  4O2D A;  1XMQ L;  1PTO D;  2K28 A;  1LT3 D;  4DK1 A;  2A8V A;  1UE1 A;  4M1U B;  3L9A X;  3PMF A;  4DV0 L;  1SFO H;  4IUT A;  4X64 Q;  4DUY L;  4HSP A;  1IL8 A;  1G8Z D;  1Z7T A;  2ZXR A;  4HIK A;  1E0B A;  3G4S A;  4DV3 Q;  4YWM A;  5I2Y A;  3G7L A;  1HNZ Q;  3DWP A;  1ROD A;  2N55 A;  5CBE E;  1Q7Y C;  4GKJ Q;  3IL8 A;  3HOZ B;  1PH5 A;  4QUF A;  1IYV A;  3Q24 A;  5IY0 A;  3NHH A;  3PIO 3;  4JI4 L;  4X62 L;  3T1H L;  3K7A H;  2QEJ C;  1B9N A;  4QJF A;  2RVL A;  1JQY D;  5E7N A;  3GTG B;  5I6W A;  2RSN A;  4EQN A;  1UWV A;  1EU4 A;  4H44 C;  4L5T A;  4X3K A;  4NXN Q;  3DEO A;  4RH6 A;  1CZG A;  1J5E Q;  4PNY A;  4Y7N B;  1IBM Q;  2PMZ E;  1TWH H;  4C1N K;  5ELF A;  1ET9 A;  4MHE A;  1W6J A;  3PUX A;  4ID6 A;  5CV8 A;  3WDN A;  1XTC D;  3IFD A;  2A6H C;  3PO3 H;  4BBS H;  2O5J C;  5DAU A;  2G9H D;  2PQA A;  1VMC A;  2JA7 G;  2SNM A;  4DR6 Q;  2Z4I A;  4R1J A;  4FXD A;  1KQS A;  1ET6 A;  2ICI A;  1W3S A;  4A3L G;  2GA4 B;  2F0D A;  3OMC A;  4KN4 C;  1WTX A;  3S15 H;  4UY8 C;  1S3O A;  1QB5 D;  1VF5 C;  2E8G A;  1RD9 D;  3I72 A;  3UDF A;  1PH7 A;  1PHJ A;  2NVX H;  2VW9 A;  4FYD A;  4BBR H;  2Q8R E;  4HAE A;  2UXB Q;  2QCP X;  3HOV B;  1IKL A;  4IUU A;  1TKW B;  2F0U A;  2L9H A;  3NTI A;  2VL6 A;  2E2D C;  3CXC A;  5CC4 A;  3G6E A;  3SK8 A;  4KK7 A;  5JVG 3;  2B2V C;  2KCT A;  2HHH Q;  2WKD A;  4JPB W;  5A2Q L;  1T5X D;  1IBL L;  1K83 B;  3IFT A;  4JG2 A;  2RSO A;  3DUZ A;  5IGC A;  2PQA B;  3A8K E;  1BUV T;  3S1R H;  1I4X A;  3CRL C;  3M4O H;  2F3V A;  3F2U A;  4CJ2 C;  2L12 A;  3MWY W;  5JJK A;  3RLF A;  4DR5 Q;  1PH2 A;  5J39 A;  1VQK A;  1TWH B;  4K2K A;  1E2W A;  1KDB A;  1RIP A;  4HJ8 A;  2JA6 G;  3I55 A;  3PO3 B;  4BBS B;  2MQH A;  2WB1 B;  1RF2 D;  4Y52 H;  1C48 A;  2B3G A;  1WTV A;  4WJW A;  4NXM Q;  3H09 A;  5J22 A;  1IYU A;  5M3F B;  2AKW B;  3NP8 A;  3G48 A;  4OL7 A;  1F2M A;  2A5H A;  2IT1 A;  1PFS A;  1Q3L A;  2NVY B;  4BA1 I;  5C3W A;  3I4N H;  3S15 B;  2OCE A;  4DV7 L;  3K5L A;  3X3N A;  4NP5 A;  1VQE A;  3I56 A;  5EJW A;  4BBR B;  1PH4 A;  1BVS A;  2H1E A;  1PH1 A;  3GTO H;  2FIN B;  1EYC A;  1EIG A;  1B2T A;  1Q8I A;  2L11 A;  1WYD A;  3JAM c;  1TS4 A;  2HD3 A;  2LXK A;  2RCF A;  4LFC Q;  1EIH A;  2AWN A;  5C0X J;  1DZ1 A;  2ZXP A;  5T1I A;  4JI1 Q;  3NUC A;  1E1O A;  4C3J H;  1SAP A;  3S1R B;  1N32 Q;  1U4M A;  1IZ6 A;  3M7G A;  3A5U A;  2L55 A;  1B8A A;  3CCJ A;  1GVP A;  1VQ9 A;  3HOW H;  2HUG A;  1EEF D;  3ERQ A;  5FK9 C;  3T4A C;  3CAM A;  2I46 A;  4BY7 G;  4B3S L;  3FPU B;  4YHH L;  3KF6 A;  3R8B A;  1HCZ A;  4X62 Q;  5H1S E;  1D6E C;  4P75 A;  3T1H Q;  4A3E G;  4X3T A;  5KEE A;  1VQC A;  2ENB A;  3HRZ C;  2I0Q A;  1VQL A;  3R93 A;  3HFZ B;  5IYD H;  1OXS C;  3L7Z C;  4JI5 Q;  3STB D;  1YVC A;  3TRZ A;  1SNM A;  2BOS A;  4A3L H;  1H9R A;  2NVY H;  2JA8 G;  4A3G G;  4C1N I;  4N9T A;  3CF5 A;  1SYD A;  4AYB B;  3K57 A;  1ZKO A;  1C7Y A;  2C5C A;  2AHO B;  4HMJ A;  5BN4 A;  2WB1 G;  1VQO A;  3NBH A;  3D8G A;  3MTS A;  5IWA Q;  3K0Y A;  1XMQ Q;  1EY0 A;  3RN5 A;  2R93 G;  4KLK A;  4B08 A;  1SE2 A;  4XQN A;  1SNC A;  1M1K C;  4PV1 C;  4WJ3 M;  1FL0 A;  2D9U A;  2XN9 C;  4RG1 A;  3UE1 A;  3K7U C;  2XWB B;  4YCW A;  1Y8N B;  3SEB A;  1MGS A;  1K3B C;  5IGB A;  3SGI A;  2NYZ D;  5HUR A;  1NMF A;  2N3S A;  4HID A;  1PFB A;  1SYB A;  1U5K A;  1EY7 A;  4DNI A;  4CBV A;  1PH3 A;  1PV4 A;  5E1F A;  4K2L A;  4CHT B;  5M3M H;  4ALP A;  3S2H B;  1I50 H;  2NZH A;  4AIM A;  5C5M A;  3KLS A;  1JB3 A;  2J0T D;  1Q81 C;  2K03 A;  3TP7 A;  1SE4 A;  2YU9 B;  4ZK9 B;  4BWG B;  3OOC A;  2JA5 B;  1S4Z A;  2F0S A;  2JXM B;  1X3F A;  1STG A;  4KY7 A;  5LMU Q;  3KJP A;  4OGQ C;  1R4Q B;  2RDG A;  4FNF A;  3CRK C;  4IPG A;  1W2B A;  2JJQ A;  1B1Z A;  4RCO A;  3HKS A;  3SVM A;  2H4O A;  2ID0 A;  2A6E D;  3E9I A;  1AN8 A;  4HCS A;  1PH6 A;  1CKN A;  4ZQ3 A;  4HED A;  1SE3 A;  1X54 A;  1AH9 A;  4ME5 A;  3HOX B;  2F0F A;  4TKO B;  1STH A;  4CKE A;  2XRQ D;  1HHV A;  3I90 A;  2EE1 A;  1NTG A;  4BY1 G;  4C3H H;  1A3T A;  2JEB I;  2NBF A;  4QCL A;  1H95 A;  2SNS A;  5FLX L;  1E1T A;  2NZO A;  4HR7 B;  3ICE A;  4F87 A;  3FRP B;  1Q1E A;  1DXM A;  4POG A;  1O7L A;  1STB A;  5IP7 H;  1SMY D;  1QJO A;  4TVA B;  3NWS A;  4RHR A;  3JAM E;  1A63 A;  3H3V C;  1E2Z A;  2VB3 X;  3H3V I;  1XTD A;  1ICW A;  2QIL A;  2KEN A;  4DR3 L;  3OIP A;  3HOZ G;  1CHP D;  1EQR A;  5CV4 A;  1UE7 A;  3KOJ A;  3GV3 A;  1D5Z C;  3EFX D;  3DXJ C;  2YU9 H;  3NK9 A;  1N34 Q;  2ES2 A;  2X6G A;  4ODG A;  2E2J B;  3K8A A;  1FD7 D;  4JK1 C;  1KIX A;  2JA6 H;  3NPP A;  5GAG C;  1B70 B;  2UUA Q;  4JI2 L;  5IWA L;  3S2D H;  4IUP A;  1MKH A;  2C9O A;  1K0S A;  3RD4 A;  4BY7 H;  1P8L A;  3K81 C;  2QKI C;  1JWU D;  1Q1B A;  4G57 A;  2D5D A;  2WAQ E;  5COR A;  5M5X B;  2K4K A;  1PRT F;  1X3G A;  4HTH A;  4LWC A;  4A3G B;  4A3B B;  1T5E A;  3HP3 A;  2YTV A;  1TS2 A;  4C3H B;  4C3J G;  5CGK A;  5LL6 S;  4L5S A;  3B6Y A;  3NQI A;  1ML0 D;  1KXL A;  4IPC A;  3DHQ A;  5C0X G;  2A69 D;  2V4D A;  2WP8 J;  1SRO A;  4A3E B;  1LLR D;  1LAB A;  1MBY A;  1GKH A;  2PI2 E;  1A62 A;  4QY7 A;  2BA1 A;  3C1E A;  1YNJ D;  3P75 A;  4A3F H;  4B9W A;  3QWN A;  1H9K A;  1LT4 D;  2YTY A;  3W5O A;  1HPC A;  1QVC A;  1EL0 A;  1IW7 C;  2B2U A;  4RMF A;  1K73 C;  4QQB X;  2EY5 A;  5C3E B;  1WD0 A;  3KBX A;  2SEB D;  1WFQ A;  4DUZ Q;  1TT2 A;  3J7A 5;  1X56 A;  3H94 A;  4DK6 C;  2EY2 A;  3J80 E;  5JEA H;  2IHE A;  4DNT B;  5E3F A;  4KV6 A;  1EEI D;  3S2D B;  1JJ2 A;  4KN7 C;  3Q8D A;  3R2T A;  2F0J A;  3RNU A;  2K01 A;  1R4P B;  3SHL A;  1SNP A;  4JI7 Q;  1EYD A;  3J80 c;  4IJH A;  4V0B A;  4A3I G;  5M5X H;  2KVM A;  1YNX A;  1STA A;  3RR5 A;  1LTI D;  1O7Z A;  4A3G H;  2NVX B;  3TRE A;  2XVS A;  4GKJ L;  2F0E A;  3LGJ A;  3HOV H;  1HNZ L;  4N8F A;  4JOI C;  2B2U C;  4XT3 B;  2DNC A;  2R92 H;  4OO1 H;  3TDQ A;  3P7J A;  2VNU D;  3OPO A;  1N36 Q;  1PZJ D;  4BBS G;  3RZD H;  3PO3 G;  5AFW A;  1Y1V B;  1X3P A;  2BA0 A;  4A3F B;  1OXT A;  3S1M H;  3OSO A;  2EPB A;  2UUC Q;  2EYL A;  2UUA L;  1YBY A;  4KY5 A;  1EIF A;  2KHI A;  2XIW A;  3M4O B;  4DU9 A;  4UHV A;  4I65 A;  4ABN A;  1I94 L;  4JI2 Q;  4TSS A;  1BBX C;  2EY6 A;  2CW0 C;  1A8V A;  2SDF A;  2EJG C;  4RKB A;  1R9T B;  2V1C C;  1JOO A;  1A6X A;  3CU7 A;  3UE0 A;  4K14 A;  1VQA A;  2JN4 A;  2L1B A;  2AQ3 B;  1H9M A;  5M3F H;  1GXD C;  2F0W A;  1BKB A;  3BYY B;  1KAW A;  2TSS A;  4K5W A;  4PMB A;  2X69 A;  3E0J A;  4R9W A;  1CI3 M;  3K59 A;  2NVT B;  2QF7 A;  3I4N B;  4KJO A;  1HA5 A;  1EOV A;  5K36 G;  4L63 B;  4A3M H;  1C0A A;  1JR0 D;  3BZC A;  3QR8 A;  3FEW X;  3CW2 C;  2DY8 A;  3ULL A;  2Y0S G;  3H0G H;  3VYU A;  2BDO A;  4A3M G;  1WTP A;  4RKL A;  4JI6 L;  5FKA C;  2R92 B;  5C4X G;  5IGG A;  2JA9 A;  4DR1 Q;  4MTN A;  5IT9 E;  1S5D D;  1PDQ A;  4PZ8 A;  1B53 A;  5JPM C;  2EYM A;  3RZD B;  2A6E C;  1WVL A;  4FXK C;  1SYG A;  2CQO A;  2LMC B;  2ASB A;  2E2I B;  3GO5 A;  1PMR A;  1TWA H;  1Y1V H;  4FF3 A;  3S1M B;  2EYF A;  4C3J B;  3I70 A;  4G7Z C;  1DOK A;  5M9O A;  1MI2 A;  1WTO A;  1FJG Q;  4A3B G;  3NQT A;  2N78 A;  3PO2 H;  3S1Q H;  1BCP B;  4DR2 L;  3J7A F;  4DV5 L;  1EYA A;  2L5T A;  1R9T H;  1EY5 A;  2B2Y C;  1JJG A;  3FMC A;  1L1O B;  5IT9 c;  1HZC A;  1MHW C;  1GD7 A;  4EQO A;  2VUM H;  1BBU A;  4IFD H;  2HDL A;  1HQR D;  1RL2 A;  3CHB D;  4KKS A;  1IXR A;  4GN3 B;  2ALY B;  3UDI A;  3PIP A;  3KLS X;  4JI4 Q;  4YY3 L;  4ZCK A;  1AZP A;  4J1M A;  2NVT H;  2LKV A;  3A55 A;  1I4G A;  2R6G A;  2RBM A;  3NWT A;  5FLX c;  2B8F A;  3V2T A;  5FLX E;  2Z4H A;  1F2Y A;  4JI3 Q;  1B50 A;  2KJX A;  5JJL A;  3IKJ A;  4H02 A;  2OTL A;  1U4P A;  1V1P B;  2F0T A;  1OXU A;  3GTM H;  2PW5 A;  2ZTE A;  1NY4 A;  2IX3 A;  1LTS D;  1Y69 U;  1B7Y B;  2E2I H;  3CCE A;  1TWA B;  4KKU A;  3RLO A;  2NZ1 D;  1DOM A;  4PG3 A;  2EIF A;  3STB C;  3RZO H;  2ZM6 Q;  2VQF L;  4JBK A;  5JPN C;  3HZX A;  1DD2 A;  1VMP A;  4X3U A;  1G2T A;  3PO2 B;  2NTT A;  2EVB A;  2Q8I B;  4GOP C;  3QG1 A;  1TS3 A;  1GUO A;  5M3M B;  4HIM A;  1I50 B;  2GVA A;  3M9B A;  3S2H H;  5IYB G;  3S9W A;  2Q2H A;  1JOR A;  3GTQ H;  5C44 G;  1EZ6 A;  2KOL A;  1EU3 A;  4NB3 A;  1BCP C;  1EFW A;  2MO1 A;  4LJZ C;  4DR7 Q;  5FO7 B;  2OQK A;  1KRS A;  4OEM B;  3J81 E;  4POF A;  2A68 C;  5HGQ A;  4X65 L;  1UEA B;  2D62 A;  3J81 c;  4YCV A;  5EGT A;  1IL2 A;  2F0I A;  1VCI A;  2FHT A;  1GUW A;  2AWO A;  1AW7 A;  3QIA A;  1PZI D;  1ZYR C;  4TQU S;  4X66 L;  1VQ7 A;  1F2Z A;  2I5M X;  4J8Q A;  3GTM B;  3AB9 A;  4LF7 L;  3K5O A;  5ELC A;  1UE6 A;  4R8I A;  4LF4 L;  1QNK A;  1XYI A;  4CDE C;  4ZUJ A;  2F0O A;  4KHP Q;  1XPO A;  2Q8T A;  3PV0 A;  4BXX H;  3AFP A;  2R7Z G;  1K3R A;  1BR9 A;  2PI2 A;  4PQX A;  1P16 A;  3A56 A;  3PF5 A;  5IYC G;  3J80 L;  3QOJ A;  2CH4 W;  3CKI B;  3G6J B;  3S16 H;  3L3O C;  3K0X A;  4I7A A;  3VDY A;  5I2X A;  1NSN S;  1LT5 D;  1F9Q A;  3PUV A;  1B9M A;  3KUP A;  2JA5 G;  2AQ2 B;  4JBM A;  2B63 H;  1G29 1;  4CKB A;  2HCC A;  5JOB A;  2B39 A;  2I07 B;  4IJL A;  2O2L D;  1MJC A;  2K14 A;  5COY A;  4V19 0;  2DUD A;  1LAC A;  4JC0 A;  4A3D G;  1I4R A;  4DKA C;  3KYH C;  3PUY A;  2XNA C;  1KRT A;  1AZQ A;  3QO2 A;  5FOB B;  4UPA A;  2Q2I A;  3J81 i;  4LF6 L;  4BY7 B;  2EXD A;  3E3X A;  3KF8 B;  4K6D A;  4JW0 A;  4L5Q A;  3EA6 A;  4YCU A;  3OHX C;  3CQZ B;  4A3B H;  4IUV A;  1LTL A;  1ICF B;  3CCV A;  1HQM C;  2R3Z A;  2UU9 L;  1DCZ A;  2ATW A;  3C3L A;  1K8O A;  2HDM A;  1YZ6 A;  3W3A A;  4PMW A;  5BN3 A;  3I8Z A;  4F88 A;  2L0C A;  4QIW E;  4A3E H;  3ZYY X;  1CKO A;  2J7Z A;  1RKN A;  1L1O C;  1TVX A;  3S16 B;  4LF9 L;  2K52 A;  4IAL A;  4IOC A;  5LMN Q;  2A6H D;  4G7O C;  3W2D A;  1SYF A;  3RN2 A;  4WRD A;  1V1P A;  5AJ3 Q;  4IFD J;  2K75 A;  1BOS A;  5C3E H;  1N32 L;  3VR4 A;  3PO2 G;  4LF9 Q;  4IFD G;  1MJE A;  3M7N A;  4OIK A;  4GNX A;  1HTL D;  4P73 A;  3T16 A;  3QOL A;  5AJ3 L;  1VQN A;  2F0G A;  4RGO S;  1ZEQ X;  4UAI A;  3N6R A;  5T1G A;  4HJ7 A;  3U9O A;  3H3V H;  2R61 A;  4LFC L;  3NE5 B;  1DM0 B;  1RTN A;  1QNU A;  5GRO A;  3GV6 A;  5LL6 X;  2DGY A;  3UDG A;  1O7I A;  2UU9 Q;  1SSO A;  2BH2 A;  4A3J G;  4LUV A;  1IYJ B;  2PYK A;  1VF7 A;  3CQZ H;  4GNX C;  3F2D A;  4LUZ A;  2Z0S A;  2F3W A;  1YJW A;  2QGQ A;  1YHA A;  3Q0A A;  2K32 A;  2G9D A;  2NTS A;  4PZ7 A;  3NTH A;  1C4Q A;  3MXG A;  5C44 B;  3TQY A;  1SN8 A;  3I4M B;  4BBR G;  1SRU A;  5ELD A;  3D4D A;  4H0L C;  1V1O A;  1VQP A;  3I2Z A;  3Q23 A;  4CJ1 B;  2E5L Q;  3MHB A;  5DM7 3;  1N34 L;  3LNN A;  3KFU A;  2FFK B;  5C6A A;  4DR5 L;  2L15 A;  4A3C G;  4PZ6 A;  3TS2 A;  1HA6 A;  1QG7 A;  4DAM A;  4JI8 L;  4RFB A;  5I9P A;  2KQ3 A;  3GQB A;  4KTA A;  3TP8 A;  1KL9 A;  4DNR B;  1IBL Q;  4L6T B;  4MNO A;  5CV7 A;  3SK6 A;  2NN6 H;  1LUZ A;  1CA6 A;  1HNW Q;  3T1Y Q;  2JA7 B;  1A15 A;  4DV2 Q;  5LMN W;  1I4Q A;  3I4O A;  2LY7 A;  4IUQ A;  4DA2 A;  3T56 B;  1A0I A;  2GVB A;  4JI0 Q;  1PTO C;  3T53 B;  2D2C C;  3PSI A;  2R92 G;  3EVQ A;  3PF4 A;  5C5L A;  4A3M B;  1OTC A;  1ASY A;  3MXN A;  4EX5 A;  4DV1 L;  3LX0 A;  1Z47 A;  3H0G B;  1HFG A;  2F0Q A;  4JOI A;  4L5R C;  1FGB D;  3BDO A;  1XJV A;  1VQH A;  4N9P A;  2IX0 A;  3JAM L;  4DV6 L;  3O13 A;  3H15 A;  2F0M A;  1ZYR D;  1HTP A;  1PZK D;  3PCO B;  2KCM A;  4X3S A;  4JI6 Q;  3FPP A;  3FVQ A;  4KY6 A;  2N8N A;  2IY5 B;  1VQG A;  5IOD A;  3H0G G;  1YNJ C;  4DV6 Q;  2MGS A;  2RDH A;  3SXH A;  4LK1 C;  4DR7 L;  5KRU A;  1GUS A;  3DM3 A;  2WAQ B;  5FLM H;  4GS3 A;  4IUN A;  1TY2 A;  2FJ2 A;  2EYP A;  3BZK A;  3S1Q B;  5CYU A;  3EIV A;  5KNB A;  1F9R A;  1CZW A;  3U9S A;  2Z8L A;  1G91 A;  1MIU A;  1ENA A;  4LFB Q;  2K5V A;  4QIW B;  1Y1W G;  1U4L A;  2OT2 A;  2VUM B;  1BBW A;  2ZM6 L;  5JJI A;  4L8J A;  1Y1V G;  1LO5 D;  3KDF A;  4O42 A;  2HQL A;  1F2L A;  4KI0 A;  1Q12 A;  1FR3 A;  2UXC Q;  3HKZ B;  4JYA L;  1I6H B;  2EJM A;  2M2L A;  2SOB A;  3CPF A;  2WFW A;  4A3D H;  3OW7 A;  5M5W B;  2JE6 I;  1YNN C;  2CW0 D;  1Z9F A;  4XIG S;  1JMC A;  2MHV A;  3MFY A;  1HZA A;  2AMC B;  4ULL A;  1STN A;  2E5L L;  1D8L A;  1MD2 D;  1EQQ A;  4JBW A;  1N36 L;  1QVG A;  2KCC A;  3OYY A;  1WOC A;  2LFN A;  1EY8 A;  3PIP 3;  3I4L A;  4FP5 D;  2K5D A;  3CMA A;  1ASZ A;  1GOZ A;  3W1G A;  3CME A;  1K8A C;  2O4X A;  4UP8 A;  2NVQ H;  4BA2 I;  3RZO B;  1SMY C;  3S1N B;  3U4Z A;  3PQI A;  2TMP A;  5FJ8 H;  1TXY A;  4PMC A;  4IFD I;  1AE3 A;  2E2H B;  3K80 C;  1K8M A;  1K9M C;  1PFM A;  3S24 A;  2K33 A;  1E2V A;  5J1Z A;  3S14 H;  4HN7 A;  3T51 B;  3GTQ B;  4YHH Q;  1I4H A;  2QA4 A;  4B3S Q;  4F7X A;  3HKZ E;  1D7Q A;  1KNE A;  1JWS D;  2PO4 A;  1F77 A;  5JVH 3;  4DAY B;  3ERS X;  1JT8 A;  3UDX A;  1JE5 A;  4RGN A;  2DJF C;  4DK3 C;  3VR5 A;  1YHQ A;  1OXX K;  1K0R A;  4JI1 L;  1FNU A;  5K36 H;  4U68 A;  1Y8O B;  2K1B A;  2K6A A;  2B29 A;  3GD7 A;  2JSO A;  2BE5 D;  2XWJ B;  3ND8 A;  1UEB A;  3QJY A;  4OWT B;  4RGT A;  2RKS A;  3D0F A;  1NBW A;  3F2B A;  4YWL A;  1CKM A;  2BDN A;  1YEZ A;  3U58 A;  3WOE A;  1EY4 A;  4BS9 A;  4K8J A;  5EKI A;  4GLX A;  1S5C D;  3NEL A;  4A3K B;  5DLQ E;  5EQ0 A;  1QVF A;  4GZY C;  1F9P A;  3DM1 A;  1C9O A;  4RA8 A;  2NN6 G;  4QB4 A;  2EJF C;  1CSQ A;  1RCV D;  1EUJ A;  4RWS C;  3TP6 A;  1AEX A;  1CFM A;  4XDX A;  3CCR A;  2Z1C A;  5G3L F;  4NXM L;  3J7A V;  4N8X 1;  1K28 A;  2VY3 A;  2CCZ A;  3S14 B;  2B63 B;  2HQE A;  1YJ9 A;  1DOL A;  1JCK B;  1CT1 D;  4ZKC B;  1HNX Q;  2KHJ A;  4P72 A;  2ZJP A;  2N88 A;  5EBD A;  3L2P A;  1PH8 A;  5D65 A;  1HNX L;  1CQV A;  1LTT D;  1HUN A;  1ZXT A;  5GAD C;  4MZ9 A;  5E4W C;  2HHH L;  1B44 D;  2UUC L;  1CSP A;  1CA5 A;  3AQQ A;  4K8I A;  1A2U A;  1PRT D;  3CC4 A;  3E9H A;  1EQV A;  3P20 A;  4DGZ A;  5ISR A;  4DFA A;  4GKK Q;  3NXW A;  4DF7 A;  3M85 A;  5ELE A;  4AYB E;  1EY6 A;  1VQI A;  1O78 A;  3HOW G;  4OO1 I;  3MFG A;  2VUM G;  1TWF B;  1F9S A;  5GAE C;  3OWF A;  2UXB L;  4A3K H;  3L0O A;  4KHP L;  2Q2U A;  1SR3 A;  2Z6K A;  3E0E A;  3E6Z X;  1FYC A;  2JYO A;  1X3Q A;  4JI7 L;  3BU2 A;  3J7Y W;  1QIL A;  1EWC A;  3PUW A;  1Q46 A;  4OXP A;  3FDT A;  1FNW A;  2M00 A;  3RLN A;  3ITP A;  3MXN B;  1Q90 A;  5JJZ A;  5L37 A;  4NDX A;  3A74 A;  5IYB H;  1E24 A;  5EPK A;  1WTQ A;  4OWW B;  5D3I B;  1E3P A;  2M9V A;  1RTO A;  1SMX A;  2OF1 A;  3AMU A;  5LMU L;  2PZW A;  1J5E L;  1VQ8 A;  4CDD C;  1EFI D;  1CUK A;  2PZT A;  2F3I A;  1LTA D;  1SJE D;  1IBM L;  2WB1 E;  2AQ1 B;  1XNR Q;  4A3J H;  5EAY A;  2WV6 D;  4XYQ A;  4RAU C;  3K5M A;  1OXV A;  3JC6 6;  5FJ8 G;  2K05 A;  2IHF A;  2MJ8 A;  1Q82 C;  2PNR C;  3CCQ A;  4K0K L;  2CVR A;  5M5Y H;  3F2C A;  2VQF Q;  5IYD G;  2UUB Q;  3FP9 A;  3DLL A;  5A2Q E;  1ENC A;  1XMO Q;  4DV3 L;  3IAY A;  4DUY Q;  5C44 H;  3KF6 B;  5IGD A;  2VQE L;  1TQO A;  2ICE C;  3I4M H;  1PVO A;  4XXE A;  4FF2 A;  2ZTD A;  4AQY Q;  1BF4 A;  4B3M L;  2R93 H;  1NUC A;  1PTO F;  2VQE Q;  1HR0 W;  4YWK A;  5NUC A;  3T13 A;  3I4M G;  2F0N A;  3DEP A;  3IRB A;  2UUB L;  4P2C B;  1YIJ A;  4QMG A;  3VR6 A;  1RJT A;  2EDG A;  3MXU A;  3D3R A;  2K5N A;  4LF5 L;  4YY3 Q;  2JA8 H;  5I6Y A;  5EKK A;  1WTR A;  4FVM A;  1VS0 A;  3J81 L;  1EYG A;  2A68 D;  4FXG C;  5KYI A;  1D1K A;  4DPG A;  4A3J B;  2JA7 H;  3A8J E;  4IOA A;  1PFN A;  4DV5 Q;  4NW2 A;  1BQQ T;  2B2T C;  4DR2 Q;  4P74 A;  4KJN A;  3TBI B;  4LFB L;  2KUM A;  2OQ0 A;  2Z6K C;  3R2I A;  4S3S A;  5D3D A;  4AYB G;  1B4O A;  1I6V C;  1S72 A;  1EOT A;  2F0V A;  3ZJY C;  3HOU G;  2CFM A;  3J7Z C;  4XT1 B;  1SE8 A;  1GJX A;  1LTR D;  5M5Y B;  2CWA A;  2K5Q A;  4R4Q A;  2XSC A;  3BZD B;  3K5N A;  4FO2 A;  4RHS A;  3PIO A;  2CQA A;  3I3C A;  4DR1 L;  3MC0 B;  3LWE A;  2X6L A;  3KK7 A;  3VA5 A;  1V8Q A;  4OIJ A;  1CK1 A;  4X65 Q;  2R7D A;  1PA6 A;  5C4X B;  2RQX A;  3GDE A;  4M8A A;  5M3F G;  2WIN B;  2P5Z X;  4UP9 A;  1EY9 A;  3NBH B;  4FDB A;  1Y8P B;  3EQL C;  1IKM A;  4WOR A;  4IZ8 A;  4BXX G;  2CH4 A;  3I7F A;  1VQ4 A;  1D1I A;  3C46 A;  5DM6 3;  1PLF A;  3S17 H;  1L2F A;  2E74 C;  1STE A;  1HR0 L;  3I4N G;  1H9S A;  1QCB D;  4JI0 L;  5GQO A;  3T1Y L;  4K5V A;  1B3Q A;  2VZA A;  4R4I A;  3HOU H;  3A7A B;  4C3I G;  1J8I A;  1G2S A;  4QGU A;  1WCM B;  4DXG A;  1HNW L;  2YYZ A;  2L4N A;  1DGS A;  2HIX A;  4A93 G;  3MA2 B;  1X32 A;  3SR1 A;  1I6H H;  4MN3 A;  3WOF A;  1BXT A;  3CP0 A;  4A3D B;  3BJU A;  2PMZ B;  3P1H A;  4U67 3;  5CV6 A;  1DYQ A;  5M5W H;  3D6C A;  1N8R C;  4HJA A;  4B3T L;  1L0Y B;  4OX9 Q;  4DR4 Q;  4LNQ A;  4KHV A;  3OMG A;  3URY A;  3KLR A;  2Q2T A;  3LWU A;  1BNZ A;  4A4I A;  5ELB A;  3TME A;  3GTL H;  1YJN A;  1M4V A;  1KAB A;  3HKZ G;  1TWC B;  2B8G A;  3OWE B;  1CKN B;  4IUR A;  5C0X H;  1HRJ A;  5CMD A;  2EYO A;  2KHS A;  1VDZ A;  1KHI A;  1SNQ A;  1QZG A;  1O7Y A;  3F1Z A;  4K0K Q;  2NVQ B;  5KNC A;  3S1N H;  2EXZ A;  2BCO A;  2R7F A;  1EQT A;  5IP9 H;  4P71 A;  1YNN D;  4QF4 A;  3SDZ A;  5KGU A;  2IL8 A;  3NBI A;  4JBJ A;  2E2H H;  1XPU A;  2JQO A;  2PZU A;  3TEH B;  2IPK D;  1WCM H;  3HG9 A;  1E7Z A;  3Q22 A;  4OO1 G;  3CCM A;  3V05 A;  1PXU A;  2B2W C;  1YHB A;  3U4V A;  4O1N A;  1EIY B;  5TSS A;  3HOV G;  2KBN A;  2A73 B;  4AH6 A;  2LXJ A;  5LMN L;  1BDO A;  5C3E G;  1KTK A;  1G51 A;  1K8G A;  5DEH A;  5C4Z A;  1Q8K A;  4Q5V A;  2D0O A;  2QW7 A;  2IJ0 A;  1LV9 A;  1GM5 A;  1NAP A;  2BH8 A;  1WI5 A;  1JIC A;  2F4I A;  3F8T A;  2CHB D;  5JEA J;  3KJO A;  3WWV A;  1AFP A;  4DV7 Q;  1X3E A;  4NKL A;  5FO9 B;  4OON A;  5M3M G;  1TWC H;  1SYE A;  4ZAI A;  3EBE A;  3A54 A;  4B3R L;  1D5M C;  2B2W A;  4C3H G;  4BY1 H;  1NCV A;  2IWH A;  5FO8 B;  4CDF C;  1V9P A;  1M90 C;  3GTJ H;  3VR2 A;  4X64 L;  4XYO A;  4OEL B;  4WJ4 A;  5A35 A;  3FKI B;  5CV9 A;  2PW7 A;  3ULJ A;  3E5S A;  3FKI G;  3DWQ A;  2F52 A;  1EWI A;  2YV5 A;  1WTW A;  2PNH A;  1C8C A;  3N52 A;  3ER0 A;  4HJ5 A;  3HOY B;  1S40 A;  4DV4 Q;  2WAC A;  4HMI A;  4OX9 L;  4DR4 L;  3RUZ A;  4R8N A;  3GP7 A;  5I4D A;  4LUO A;  2PCF B;  3I91 A;  4LF8 L;  4DV4 L;  1XNQ Q;  4EQP A;  3MVV A;  1PYS B;  4JYA Q;  5BN5 A;  4F8M A;  2MPM A;  1QUQ B;  3SK5 A;  3HGB A;  1II3 A;  1D5X C;  1A2T A;  5IYC H;  1S5F D;  2RDF A;  4HJ9 A;  4C56 C;  3MEH A;  4OWX B;  1Q86 C;  4ZLT F;  1SXT A;  5F2D A;  2RF4 A;  1TWF H;  1GUN A;  4A93 H;  3NSW A;  3SK4 A;  1HR0 Q;  1IHZ A;  1FGU A;  4JVZ A;  3FHW A;  1NJI C;  2MO0 A;  4LF4 Q;  4RGM A;  3CPW A;  4BY1 B;  1VQB A;  3CCU A;  1PH9 A;  4LF7 Q;  2HT1 A;  2A69 C;  2MUY A;  4DAY A;  4HCE A;  1U9R A;  1SNO A;  1KNA A;  2UXD Q;  1HZB A;  4OHJ A;  3HOX G;  2B2V A;  4EQ5 A;  5EKL A;  3GTP B;  2IW3 A;  4O0A A;  3OW2 A;  1MSG A;  3BVM A;  3OIQ A;  3MXP A;  3M4P A;  3H6M A;  1GHK A;  1TII D;  3HOY H;  4GLV B;  3MZ5 A;  1X65 A;  3NEM A;  4X6A H;  2F0K A;  4KD3 A;  4E6I A;  4NXN L;  1DJR D;  3CD6 A;  5ELO A;  2EZV A;  2NWG A;  1WTH A;  2QDB A;  4XTC S;  4DAP A;  1Y1W H;  5IGF A;  4IN3 A;  3Q6S A;  1NNX A;  1TU2 B;  2OEO A;  1N33 L;  1A3V A;  1GUG A;  3TS0 A;  3J80 i;  2K04 A;  4ZKB B;  4JV5 L;  1H9J A;  1YI2 A;  3J81 j;  1MSH A;  3X3M A;  4DN4 M;  4RCN A;  3BG3 A;  3VYT A;  1VQF A;  4LAA A;  3K6O A;  3HS0 C;  1LTG D;  1Z6H A;  2DJG C;  4G4K A;  4A93 B;  3G71 A;  2DNE A;  5ELN A;  2G5D A;  1IBK Q;  1WCM G;  4WFN 3;  1LYL A;  1BCP F;  4DV0 Q;  3ERO A;  2K5W A;  1SBB B;  1Y14 B;  1GO3 E;  5E4X A;  3KF8 A;  4B3T Q;  5IP9 G;  2R93 B;  4JI3 L;  1KLU D;  4FF4 A;  2JP1 A;  4A3F G;  1SFO B;  2B2Y A;  1ONL A;  2RHS B;  1XPR A;  1X6O A;  3K58 A;  3GTP H;  3BS1 A;  4UDU C;  3CCL A;  3EJI A;  3PGZ A;  1SYC A;  4ILW A;  4TRD A;  4IPD A;  3BYT B;  2MP1 A;  4IQZ A;  2JA8 B;  3UI2 A;  3VR3 A;  2XTI A;  1ILP A;  1Y1W B;  2F4V L;  1YIT A;  4JI5 L;  2R7Z B;  4MTK A;  4JV5 Q;  3CCS A;  1XNR L;  5IE8 A;  3C1F A;  1JOK A;  3A7L A;  3TN2 A;  1FJG L;  1L0X B;  2WAQ G;  2VXW A;  3V96 A;  2ZJQ A;  1HXY D;  3R3O A;  3A5Z B;  1QZH A;  1HUM A;  1M8A A;  4C3I B;  2D0P A;  1E22 A;  1SLJ A;  1JB7 A;  1PRT B;  3NEN A;  3M3Y H;  1HJP A;  1I5F A;  5KND A;  4GLA C;  4GOP B;  3CC2 A;  2JEA I;  2A19 A;  2VS1 A;  1L1O A;  2H5X A;  2F0P A;  2RA4 A;  4KD4 A;  3H91 A;  3I73 A;  3TP5 A;  5CBA E;  3MEF A;  2EQS A;  1RDP D;  3U50 C;  2UXD L;  4HIO A;  5EPL A;  3AEV A;  4IO9 A;  1G6P A;  5KIX A;  2A74 C;  2KEE A;  5IOC A;  5C4X H;  4A3C H;  3VYS A;  5KYL A;  2Z6B A;  3PUZ A;  2KEC A;  3S17 B;  1SND A;  2HIV A;  1VQ5 A;  2KA7 A;  3M4Q A;  2E76 C;  2EYJ A;  4GN5 A;  4DV2 L;  3C2P A;  1PRT C;  4G7H C;  4UP7 A;  3HOU B;  4LF6 Q;  2R7Z H;  1K83 H;  4JI8 Q;  4C2M B;  4H7B A;  4Z9C B;  3NTK A;  5IT9 L;  2KED A;  2RCN A;  4A76 A;  2MFI A;  3OTO Q;  4CKC A;  2J4X A;  2PPB C;  3BDL A;  5FLM G;  1KD1 C;  4LFA L;  5CV5 A;  3AFQ A;  1AP0 A;  1QE6 A;  2WKC A;  4ZRZ A;  1WD1 A;  4CGY B;  1SEB D;  2WII B;  2NB0 A;  3AU7 A;  1XX8 A;  4LF8 Q;  4C3I H;  5CR3 A;  2FMM A;  2YTX A;  5LHY 1;  5I9O A;  3OTO L;  3M3Y B;  3CC7 A;  4AQY L;  1CM9 A;  4B3M Q;  5GAH C;  1XWE A;  4I7Z C;  2XGT A;  2EY1 A;  1ILQ A;  4ME3 A;  1XMO L;  2FXQ A;  3GTL B;  4B3R Q;  1JE4 A;  1UNS A;  1W6K A;  1HZ9 A;  1KAA A;  4KKT A;  4Q0F A;  3KLW A;  2JK8 A;  4KMU C;  5JAV A;  1KC8 C;  5EBC A;  2VB2 X;  3ND9 A;  1VQJ A;  5C0X I;  1PTO H;  1KDA A;  3DMU A;  4GNX B;  3D4W A;  5IIF A;  3GTO B;  1BCP D;  2I5H A;  2ZJR A;  1G6Z A;  1X9N A;  3KBG A;  4X66 Q;  1SDF A;  2BE5 C;  1QWY A;  2K5H A;  1J6Q A;  2CKZ B;  2OTJ A;  3KDF B;  1H9S B;  2OXP A;  4DUZ L;  4YIJ A;  3HEJ A;  4C2M H;  4HSV A;  1T9H A;  1JWM D;  2K7V A;  4DR6 L;  1V43 A;  1UUP A;  2B2T A;  1CTM A;  4XQQ A;  2IX1 A;  3HOW B;  1UE5 A;  4IPH A;  5C4J H;  2F03 A;  2N49 A;  2KCN A;  1RHP A;  1S5B D;  2ZXO A;  3QB3 A;  1O80 A;  1AE2 A;  1HH2 P;  1U0L A;  3BVZ A;  2DY7 A;  2Y0S B;  4J15 A;  2O5I C;  5DNF A;  4EVO A;  5IGE A;  1BO0 A;  2QEX A;  1PYW D;  2F1M A;  3BDC A;  1NR4 A;  2LS0 1;  2DN8 A;  4APV A;  1QUQ A;  1TWG H;  1NR2 A;  3TSS A;  5C3X A;  1LTB D;  3ONA B;  1L0W A;  1VQM A;  5D14 A;  4JCV E;  2CWP A;  4A75 A;  1PTO B;  4R4C A;  5JEA G;  4NPS A;  2C35 B;  4DK0 A;  3GTJ B;  1I3Q H;  5G3L D;  4GKK L;  2EOT A;  2XRS D;  3FKI H;  2QDL A;  4LMQ D;  3ULP A;  3D6W A;  2I5L X;  1EZ8 A;  1PYB A;  3GTK H;  1QOH A;  4XQJ A;  1LM0 A;  1XXG A;  5EPJ A;  3JAM i;  1ESR A;  1EWH A;  2F0H A;  4LFA Q;  1NE3 A;  1IBK L;  4GOP A;  1KDC A;  2FMC A;  1A3U A;  2MNA A;  2LSS A;  5BR8 Q;  2UXC L;  1FVI A;  1LT6 D;  2Z9H A;  5K5P A;  4KHZ A;  2GN5 A;  5C4J B;  1TY0 A;  2Y0S E;  2K50 A;  2EYH A;  4DR3 Q;  4B9X A;  1HFN A;  1N33 Q;  1GUT A;  3M4Y A;  5C4H A;  4FF1 A;  1TS5 A;  2JA5 H;  2B63 G;  2HCI A;  4A3I B;  1N9W A;  5IP7 G;  1TWG B;  1CQF A;  3RMH A;  4ZYS A;  3TZD A;  4J6H A;  1X55 A;  4NMZ A;  4R4T A;  4K5X A;  3A8I E;  4MIU A;  1I3Q B;  2E75 C;  1JOQ A;  1CHQ D;  1I4P A;  3HOX H;  3AYH B;  5HY6 A;  2AUJ D;  4A3K G;  5HGT A;  1ESF A;  4DV1 Q;  3D4R A;  1VQ6 A;  3GTK B;  3W1B A;  1J9O A;  1V1Q A;  3A0J A;  3SE0 A;  1JC7 A;  1D2B A;  1SJH D;  1S5E D;  4ZUI A;  3VA7 A;  2OWO A;  1UAP A;  3HOZ H;  3D31 A;  1B3A A;  1U4R A; 
#chains in the Genus database with same CATH homology
 4LW1 A;  3EN2 A;  5J3B A;  3KJO A;  3WWV A;  3BZK A;  4JI7 Q;  4DV7 Q;  3J80 c;  3EIV A;  4IJH A;  3GTG H;  4A3I G;  5M5X H;  1X3E A;  1YNX A;  1VQD A;  3RR5 A;  4OON A;  5M3M G;  1MIU A;  1TWC H;  4A3G H;  2K5V A;  4LFB Q;  1Y1W G;  3EBE A;  2NN6 I;  3TRE A;  3HOY G;  1BBW A;  4R4O A;  1WJJ A;  4GKJ L;  2A1A A;  3LGJ A;  2ZM6 L;  3HOV H;  4B3R L;  1HNZ L;  4JOI C;  4BY1 H;  4QL5 A;  2F4V Q;  5JJI A;  4Y7N H;  1Y1V G;  1V9P A;  1M90 C;  2R92 H;  3KDF A;  3GTJ H;  4LF5 Q;  2HQL A;  2RHQ B;  4X64 L;  2VNU D;  4KI0 A;  1Q12 A;  2UXC Q;  4GN4 B;  4JYA L;  4WJ4 A;  1N36 Q;  3CPF A;  3ULJ A;  1XNQ L;  3FKI G;  2ZTC A;  4A3I H;  2E2J H;  2F52 A;  4BBS G;  1EWI A;  3RZD H;  3PO3 G;  1I94 Q;  2WFW A;  2YV5 A;  4A3D H;  2BA0 A;  1OXT A;  3S1M H;  2PNH A;  2UUC Q;  5BR8 L;  3ER0 A;  2UUA L;  1YBY A;  1EIF A;  2JE6 I;  1JJC B;  1NMG A;  2KHI A;  4O2D A;  4HJ5 A;  1XMQ L;  1S40 A;  4DV4 Q;  1Z9F A;  4XIG S;  4OX9 L;  4DR4 L;  1JMC A;  2A8V A;  4LUO A;  1HZA A;  2AMC B;  1UE1 A;  1I94 L;  4LF8 L;  4JI2 Q;  1D8L A;  2E5L L;  4DV4 L;  1A8V A;  1XNQ Q;  1EQQ A;  4JBW A;  1PYS B;  1N36 L;  1QVG A;  4JYA Q;  3OYY A;  4DV0 L;  1SFO H;  1WOC A;  4X64 Q;  2V1C C;  4DUY L;  1QUQ B;  4HIK A;  3G4S A;  3CMA A;  4DV3 Q;  4YWM A;  1ASZ A;  3UE0 A;  1HNZ Q;  3W1G A;  1K8A C;  3CME A;  4GKJ Q;  5IYC H;  1Q7Y C;  1VQA A;  4UP8 A;  4HJ9 A;  2NVQ H;  4BA2 I;  5M3F H;  4OWX B;  1BKB A;  1KAW A;  1Q86 C;  1PH5 A;  3U4Z A;  5IY0 A;  2RF4 A;  4JI4 L;  4X62 L;  3T1H L;  3K7A H;  1TWF H;  4QJF A;  5E7N A;  5FJ8 H;  1TXY A;  4A93 H;  4IFD I;  1EOV A;  1UWV A;  5K36 G;  1HR0 Q;  4A3M H;  1AE3 A;  3K80 C;  1C0A A;  4L5T A;  1K9M C;  3S24 A;  1FGU A;  3FHW A;  3BZC A;  1NJI C;  2MO0 A;  3CW2 C;  4NXN Q;  3S14 H;  4YHH Q;  4LF4 Q;  1J5E Q;  3ULL A;  2Y0S G;  3CPW A;  2QA4 A;  4B3S Q;  3H0G H;  1VQB A;  3HKZ E;  3CCU A;  4A3M G;  1PH9 A;  4LF7 Q;  2HT1 A;  4JI6 L;  1D7Q A;  1IBM Q;  4DAY B;  5C4X G;  3ERS X;  1JT8 A;  2PMZ E;  1TWH H;  2JA9 A;  4DR1 Q;  4MTN A;  3UDX A;  1JE5 A;  4PZ8 A;  2UXD Q;  1HZB A;  3PUX A;  4DK3 C;  3HOX G;  4EQ5 A;  1YHQ A;  1OXX K;  3PO3 H;  1K0R A;  4JI1 L;  4BBS H;  2CQO A;  2ASB A;  3GO5 A;  1Y1V H;  1TWA H;  4O0A A;  3OW2 A;  2PQA A;  2JA7 G;  2B29 A;  3GD7 A;  3M4P A;  1UEB A;  3HOY H;  4DR6 Q;  4R1J A;  4GLV B;  4OWT B;  1X65 A;  3NEM A;  1KQS A;  4X6A H;  4NXN L;  1W3S A;  3D0F A;  5ELO A;  1NBW A;  1FJG Q;  3F2B A;  3CD6 A;  4A3B G;  4A3L G;  2N78 A;  4XTC S;  4YWL A;  1CKM A;  3PO2 H;  3S1Q H;  1Y1W H;  3S15 H;  4UY8 C;  1S3O A;  1YEZ A;  3U58 A;  4DR2 L;  4DV5 L;  1R9T H;  1N33 L;  2E8G A;  1PH7 A;  1PHJ A;  3UDF A;  3J80 i;  3TS0 A;  2NVX H;  1JJG A;  1L1O B;  5IT9 c;  2VW9 A;  1HZC A;  4GLX A;  3NEL A;  1GD7 A;  5DLQ E;  4BBR H;  1BBU A;  1QVF A;  2VUM H;  2UXB Q;  1C9O A;  1RL2 A;  4JV5 L;  1IXR A;  4GN3 B;  1YI2 A;  3J81 j;  2NN6 G;  2ALY B;  3UDI A;  1CSQ A;  3PIP A;  2VL6 A;  4JI4 Q;  1EUJ A;  4YY3 L;  3CXC A;  1VQF A;  3G6E A;  2NVT H;  2R6G A;  2KCT A;  2HHH Q;  5FLX c;  3CCR A;  1IBL L;  4NXM L;  4JG2 A;  3G71 A;  5ELN A;  4JI3 Q;  2PQA B;  2VY3 A;  1WCM G;  1IBK Q;  2CCZ A;  3S1R H;  1LYL A;  1YJ9 A;  3M4O H;  4DV0 Q;  5JJL A;  1HNX Q;  5JJK A;  3RLF A;  1Y14 B;  4LFA L;  4H02 A;  4DR5 Q;  1GO3 E;  2OTL A;  2KHJ A;  1PH2 A;  1VQK A;  4B3T Q;  5IP9 G;  4P72 A;  2ZJP A;  4JI3 L;  1OXU A;  1RIP A;  4HJ8 A;  3GTM H;  4A3F G;  3L2P A;  2JA6 G;  1PH8 A;  2ZTE A;  1HNX L;  1NY4 A;  2RHS B;  5GAD C;  4MZ9 A;  3I55 A;  1X6O A;  1XPR A;  2MQH A;  2HHH L;  1CSP A;  2UUC L;  1B7Y B;  3AQQ A;  2E2I H;  3GTP H;  3CCE A;  3CCL A;  3CC4 A;  3E9H A;  3RLO A;  4Y52 H;  4PG3 A;  2EIF A;  2B3G A;  3PGZ A;  3STB C;  4NXM Q;  3RZO H;  4IPD A;  4GKK Q;  2ZM6 Q;  2VQF L;  4JBK A;  3M85 A;  4AYB E;  1VQI A;  2AKW B;  2XTI A;  3HOW G;  4OO1 I;  3G48 A;  2VUM G;  2IT1 A;  2F4V L;  1PFS A;  3I4N H;  4BA1 I;  4GOP C;  2OCE A;  4HIM A;  4JI5 L;  5GAE C;  1YIT A;  3S2H H;  2GVA A;  3M9B A;  4DV7 L;  4JV5 Q;  3CCS A;  1XNR L;  2UXB L;  1VQE A;  5IYB G;  3I56 A;  5IE8 A;  2Q2H A;  4A3K H;  1PH4 A;  1BVS A;  3GTQ H;  3L0O A;  4KHP L;  2Q2U A;  5C44 G;  1SR3 A;  2Z6K A;  1FJG L;  3E0E A;  1PH1 A;  2WAQ G;  4NB3 A;  3GTO H;  1EFW A;  2MO1 A;  2ZJQ A;  4JI7 L;  3BU2 A;  1WYD A;  3A5Z B;  3PUW A;  2LXK A;  3JAM c;  1Q46 A;  4OXP A;  1QZH A;  4LFC Q;  2AWN A;  5C0X J;  4DR7 Q;  2D0P A;  3RLN A;  1E22 A;  1SLJ A;  1JB7 A;  2OQK A;  3NEN A;  4JI1 Q;  3M3Y H;  1KRS A;  1HJP A;  3MXN B;  1I5F A;  1E1O A;  4GLA C;  4POF A;  4X65 L;  5HGQ A;  4GOP B;  3A74 A;  3CC2 A;  5IYB H;  1E24 A;  2D62 A;  3J81 c;  2JEA I;  4YCV A;  4C3J H;  4OWW B;  2VS1 A;  2A19 A;  1IL2 A;  1L1O A;  1VCI A;  1E3P A;  2H5X A;  1N32 Q;  1SMX A;  2AWO A;  1IZ6 A;  3A5U A;  3MEF A;  1B8A A;  2EQS A;  5LMU L;  4TQU S;  1GVP A;  3U50 C;  3CCJ A;  4HIO A;  1J5E L;  1VQ8 A;  1VQ9 A;  2UXD L;  3AEV A;  4X66 L;  4IO9 A;  3HOW H;  1VQ7 A;  1CUK A;  1G6P A;  2F3I A;  2I5M X;  5C4X H;  1IBM L;  2WB1 E;  4LF7 L;  4A3C H;  3CAM A;  4A3J H;  1XNR Q;  4BY7 G;  5EAY A;  4B3S L;  1UE6 A;  3PUZ A;  4YHH L;  3KF6 A;  4LF4 L;  4X62 Q;  5H1S E;  4P75 A;  3T1H Q;  4A3E G;  4KHP Q;  1OXV A;  1VQC A;  1XPO A;  3PV0 A;  4BXX H;  3AFP A;  2R7Z G;  2I0Q A;  1VQL A;  1K3R A;  3JC6 6;  3HFZ B;  2PI2 A;  1P16 A;  5FJ8 G;  3PF5 A;  1OXS C;  2IHF A;  2HIV A;  3L7Z C;  5IYC G;  1Q82 C;  4JI5 Q;  3STB D;  1YVC A;  1VQ5 A;  3TRZ A;  3M4Q A;  4GN5 A;  3CCQ A;  4DV2 L;  4A3L H;  3S16 H;  2NVY H;  4UP7 A;  2JA8 G;  4A3G G;  3K0X A;  5M5Y H;  4K0K L;  3CF5 A;  3VDY A;  1K83 H;  4JI8 Q;  4LF6 Q;  2R7Z H;  3F2C A;  2VQF Q;  5IYD G;  2UUB Q;  3FP9 A;  3DLL A;  1XMO Q;  1C7Y A;  3PUV A;  4DV3 L;  2JA5 G;  2AHO B;  2B63 H;  2RCN A;  4A76 A;  2WB1 G;  4JBM A;  2MFI A;  1G29 1;  3OTO Q;  1VQO A;  4DUY Q;  4IJL A;  5FLM G;  3KF6 B;  5C44 H;  2VQE L;  1MJC A;  2K14 A;  5IWA Q;  1KD1 C;  3AFQ A;  3I4M H;  1PVO A;  1XMQ Q;  2ZTD A;  4AQY Q;  3RN5 A;  4B3M L;  4KLK A;  2R93 G;  2R93 H;  1M1K C;  2DUD A;  2VQE Q;  1HR0 W;  4C3I H;  4LF8 Q;  4JC0 A;  4YWK A;  4A3D G;  4WJ3 M;  1FL0 A;  2YTX A;  4DKA C;  4RG1 A;  3UE1 A;  3KYH C;  3OTO L;  3K7U C;  3PUY A;  1KRT A;  3CC7 A;  4YCW A;  3I4M G;  4AQY L;  4B3M Q;  2UUB L;  3IRB A;  5GAH C;  1YIJ A;  3SGI A;  2XGT A;  4UPA A;  2Q2I A;  3J81 i;  4LF6 L;  4LF5 L;  2K5N A;  2EXD A;  1NMF A;  2N3S A;  3KF8 B;  4ME3 A;  4YY3 Q;  4HID A;  2JA8 H;  1XMO L;  2FXQ A;  4B3R Q;  1U5K A;  1VS0 A;  4L5Q A;  1HZ9 A;  4YCU A;  1EYG A;  4DNI A;  3KLW A;  4A3B H;  1PH3 A;  1PV4 A;  2JK8 A;  5M3M H;  4DPG A;  1LTL A;  4ALP A;  3CCV A;  1I50 H;  2NZH A;  1KC8 C;  2UU9 L;  1VQJ A;  4AIM A;  2ATW A;  2JA7 H;  4IOA A;  5C0X I;  1YZ6 A;  4PMW A;  4DV5 Q;  1Q81 C;  4DR2 Q;  4P74 A;  5IYD H;  4GNX B;  4QIW E;  4LFB L;  4A3E H;  2OQ0 A;  2Z6K C;  2I5H A;  2ZJR A;  1X9N A;  1CKO A;  4X66 Q;  1L1O C;  4AYB G;  1X3F A;  2K5H A;  5LMU Q;  1J6Q A;  1S72 A;  2CKZ B;  2OTJ A;  3KJP A;  3ZJY C;  3HOU G;  3KDF B;  2CFM A;  4IPG A;  3J7Z C;  2JJQ A;  1W2B A;  1SE8 A;  3HKS A;  2K52 A;  4LF9 L;  2ID0 A;  4IOC A;  2CWA A;  5LMN Q;  4R4Q A;  3E9I A;  4DUZ L;  4C2M H;  3RN2 A;  1T9H A;  1PH6 A;  5AJ3 Q;  1CKN A;  4IFD J;  3PIO A;  4DR6 L;  2K75 A;  1V43 A;  4DR1 L;  1X54 A;  5C3E H;  1AH9 A;  1N32 L;  2IX1 A;  3PO2 G;  4LF9 Q;  4IFD G;  1MJE A;  3M7N A;  4GNX A;  4X65 Q;  1UE5 A;  2R7D A;  4IPH A;  5C4J H;  4P73 A;  1PA6 A;  5AJ3 L;  1VQN A;  2N49 A;  1NTG A;  3GDE A;  5M3F G;  4HJ7 A;  4UP9 A;  3NBH B;  4BY1 G;  4C3H H;  3H3V H;  1AE2 A;  1HH2 P;  2JEB I;  4FDB A;  4LFC L;  1U0L A;  1H95 A;  4J15 A;  1E1T A;  4BXX G;  5GRO A;  2NZO A;  3I7F A;  2DGY A;  2QEX A;  1VQ4 A;  3UDG A;  3ICE A;  3S17 H;  1Q1E A;  1L2F A;  4POG A;  1O7I A;  4APV A;  2UU9 Q;  1HR0 L;  2BH2 A;  5IP7 H;  1QUQ A;  4JI0 L;  3I4N G;  5GQO A;  4TVA B;  3T1Y L;  4A3J G;  4LUV A;  1TWG H;  1IYJ B;  2VZA A;  1A63 A;  4R4I A;  3CQZ H;  4GNX C;  3HOU H;  3F2D A;  1XTD A;  1L0W A;  4DR3 L;  2KEN A;  1VQM A;  4LUZ A;  3H3V I;  3HOZ G;  4JCV E;  2CWP A;  4QGU A;  2Z0S A;  1EQR A;  4A75 A;  1UE7 A;  3KOJ A;  1YJW A;  1HNW L;  4R4C A;  2QGQ A;  1YHA A;  2YYZ A;  5JEA G;  4NPS A;  2C35 B;  1DGS A;  1I3Q H;  2HIX A;  4PZ7 A;  4GKK L;  4A93 G;  2YU9 H;  3FKI H;  1I6H H;  3ULP A;  3TQY A;  1SN8 A;  4BBR G;  2I5L X;  1SRU A;  1N34 Q;  2ES2 A;  1PYB A;  3K8A A;  3GTK H;  1VQP A;  3CP0 A;  3I2Z A;  3BJU A;  1KIX A;  2JA6 H;  1LM0 A;  5GAG C;  1B70 B;  2UUA Q;  3JAM i;  5IWA L;  2E5L Q;  4JI2 L;  3S2D H;  5M5W H;  4LFA Q;  1N8R C;  4HJA A;  1N34 L;  1NE3 A;  1IBK L;  4B3T L;  1MKH A;  3KFU A;  4OX9 Q;  4DR4 Q;  4GOP A;  4LNQ A;  4DR5 L;  4BY7 H;  1P8L A;  2L15 A;  4A3C G;  3K81 C;  4PZ6 A;  2MNA A;  2Q2T A;  3TS2 A;  2LSS A;  5BR8 Q;  1Q1B A;  4JI8 L;  4A4I A;  2WAQ E;  4DAM A;  2UXC L;  1FVI A;  3GTL H;  2K4K A;  1YJN A;  1X3G A;  4KHZ A;  2GN5 A;  1KL9 A;  3HKZ G;  4LWC A;  1CKN B;  4MNO A;  1IBL Q;  2Y0S E;  2K50 A;  1KHI A;  2YTV A;  1QZG A;  1LUZ A;  1HNW Q;  3F1Z A;  3T1Y Q;  4K0K Q;  4L5S A;  4DV2 Q;  4DR3 Q;  3B6Y A;  5LMN W;  1KXL A;  3S1N H;  4IPC A;  3I4O A;  5C0X G;  1N33 Q;  2WP8 J;  1SRO A;  2R7F A;  1GKH A;  2JA5 H;  2PI2 E;  2B63 G;  1A62 A;  4JI0 Q;  1A0I A;  2GVB A;  1N9W A;  5IP7 G;  4QY7 A;  5IP9 H;  2BA1 A;  3PSI A;  4P71 A;  2R92 G;  4JBJ A;  4A3F H;  3PF4 A;  2E2H H;  1OTC A;  1XPU A;  2JQO A;  1ASY A;  1X55 A;  3TEH B;  2YTY A;  3W5O A;  4EX5 A;  1WCM H;  1QVC A;  4DV1 L;  1Z47 A;  1E7Z A;  4R4T A;  4JOI A;  3CCM A;  4L5R C;  4OO1 G;  1YHB A;  3U4V A;  4RMF A;  1VQH A;  1XJV A;  2IX0 A;  4DV6 L;  1K73 C;  4QQB X;  3H15 A;  1EIY B;  3HOV G;  3HOX H;  2KBN A;  3AYH B;  5HY6 A;  4AH6 A;  4A3K G;  1WFQ A;  2LXJ A;  5LMN L;  4DUZ Q;  3J7A 5;  5C3E G;  3PCO B;  1X56 A;  2KCM A;  1G51 A;  4DV1 Q;  1K8G A;  4DK6 C;  4JI6 Q;  1VQ6 A;  1Q8K A;  3W1B A;  2D0O A;  2N8N A;  1V1Q A;  3A0J A;  2IHE A;  2IY5 B;  1VQG A;  1GM5 A;  3H0G G;  4DV6 Q;  1JJ2 A;  2BH8 A;  3Q8D A;  1WI5 A;  2OWO A;  3HOZ H;  4DR7 L;  3D31 A;  3RNU A;  3F8T A;  3DM3 A;  5FLM H;  4GS3 A;  5JEA J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...