4X65Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65Q00
1YI2A 1VQOA 4R1JA 3K81C 2B29A 4FDBA 1XNQQ 2GN5A 1Y1VG 2JA9A 5JEAJ 4A3JG 2MQHA 3W5OA 3AFQA 4DR5Q 2D0OA 1UE5A 5GAEC 3VDYA 3CCLA 4BXXG 1A63A 4X66L 5JJLA 1J5EQ 4B3TQ 3STBD 1SN8A 2ZM6Q 4X6AH 4LFCL 4QL5A 5C44H 1W3SA 4AH6A 3J81j 5C0XJ 5FJ8G 1L0WA 5IYBH 4GNXC 2UUAQ 2JA6H 1K83H 2ES2A 1PYSB 3RZDH 4DK3C 4P72A 1KD1C 2ID0A 4R4OA 1VQKA 2JA5H 2YTYA 4UY8C 4B3RQ 4IJHA 3NBHB 1VQDA 4L5QA 5AJ3L 2YV5A 4YCUA 1K9MC 5E7NA 4IOAA 5IT9c 2ZTEA 3HOYH 3K8AA 4DAYB 2VQEL 1GVPA 5FLMG 2JEBI 1D8LA 4LF6Q 2HT1A 4B3ML 4GKKL 1TWFH 1VQJA 1YJWA 4A3GH 1JT8A 4YHHQ 1VQEA 1N8RC 1I94Q 1IXRA 4A3CG 3D0FA 1LTLA 3U4VA 1NBWA 4LF9Q 1PHJA 1OXTA 1QUQA 5EAYA 4GOPC 2CFMA 4AQYL 1Q8KA 4JI1L 4UP8A 2D0PA 1IBML 4APVA 4C3IH 3S14H 3S2HH 2B63H 1VQLA 1VQFA 2JA8H 2B3GA 5DLQE 1HNWQ 3PGZA 4UP7A 4HJ5A 3A74A 3EN2A 3RLNA 4P73A 4OONA 1YNXA 1VQ7A 1IL2A 4A3DH 1JJCB 4JCVE 4A3DG 4PZ8A 3WWVA 2HIVA 4KHPQ 2HIXA 5IYDH 3PUWA 5IYDG 1QVFA 3KJOA 4L5TA 3F2CA 1W2BA 2D62A 2MNAA 5C4XH 1N9WA 3PO2G 4JI5L 3CC4A 3M85A 4A93H 4JI8Q 2UUBL 4LF5Q 2R93H 1X56A 1VQ9A 1AE3A 4QQBX 4BBSH 1FVIA 3TRZA 2UU9L 1X6OA 1VCIA 5GAGC 4DV7Q 2KHIA 4JG2A 1EIFA 1OXUA 4DKAC 4DNIA 3NEMA 4JBMA 4DV5Q 4UP9A 1SMXA 5LMUL 4R4TA 2VS1A 5LMNW 4MZ9A 5JJKA 4P74A 3S15H 3L0OA 4A3LG 2AWOA 1K8AC 4JV5Q 3KF6A 4GN3B 3G71A 1DGSA 4A75A 1YHQA 1FJGL 4DV3Q 4DR1L 5M3FG 2UXDL 1XPOA 2QA4A 2AHOB 2JJQA 3CD6A 1U0LA 1PV4A 4A3FG 2N49A 4TVAB 4DR7L 4C3HH 1UE6A 1GKHA 3CCSA 3T1YL 2E5LL 3UDIA 4ALPA 3HOVG 1VQ6A 3AEVA 3GO5A 3M9BA 3Q8DA 1EQQA 2EQSA 1E24A 4BY1H 3HOUG 2NVQH 3I4NH 3S17H 1XNRL 3CC7A 2HHHL 3CXCA 3GD7A 4JI6Q 2ZJPA 4H02A 4JI7Q 2NN6I 4BY7G 1VQGA 3K80C 5HGQA 3J7ZC 3IRBA 4NXNQ 1N33Q 1X55A 2R7DA 4A3EG 3L7ZC 4AYBG 4BA2I 1BBWA 1PH5A 1EIYB 1WCMG 1YIJA 1OXSC 2VUMG 2DUDA 3AFPA 1SLJA 5C4JH 4A3IG 2IX0A 4DR2Q 3GTGH 3TREA 5M5YH 3M3YH 1TXYA 1Y14B 2N8NA 3GDEA 4LFAQ 1O7IA 2OTLA 1QZHA 2R92G 1N32L 1XMOL 3HKZG 2I5LX 1HH2P 4JI3Q 2ZJRA 4JI4L 3DLLA 4NPSA 4X62L 4B3SQ 3CCEA 1QVGA 2VL6A 1KL9A 3BJUA 4DR3Q 2Q2UA 3H0GH 1UE1A 1Z47A 1UEBA 2JA7H 2EIFA 1BVSA 1WOCA 4JBWA 3U4ZA 2CCZA 1Y1WG 4WJ3M 3J7A5 1PH3A 3LGJA 3HOXG 3TEHB 2IY5B 3HKSA 4DV6Q 4LF7L 3HOZG 4YY3Q 3A5UA 1UWVA 4HIOA 2YU9H 2R7ZG 3A0JA 4WJ4A 5M3MG 1X3FA 4IFDI 3OTOQ 2K5VA 5GQOA 3SGIA 1HNXL 3S16H 4BBRG 1Y1VH 1TWAH 3KLWA 4A3JH 5GROA 3J80i 3F2DA 1XMQL 4X64L 4LF8L 4JYAL 3OYYA 4LF4L 3W1GA 1FL0A 1EOVA 4BXXH 1S3OA 3ULJA 1OXVA 3S1RH 2F4VL 2GVBA 3KF8B 5H1SE 4QIWE 3HOWG 1EYGA 4DV2L 2UXCL 5ELOA 5FJ8H 1C7YA 1PH9A 2K5NA 4DR6Q 1CKNB 1CKNA 2ZJQA 4DV0L 4OX9Q 2GVAA 1PH7A 3K0XA 1VQ4A 3PCOB 1SRUA 1HR0L 3G48A 1JMCA 2YTVA 3F1ZA 4L5RC 3DM3A 1IZ6A 4DUZL 1L1OA 5FLMH 3PF4A 2MO1A 3CAMA 3EIVA 3RLOA 2AKWB 4OWXB 1PH2A 1HNZQ 4A3CH 1TWHH 1YZ6A 2Z6KC 3JC66 4NXML 2HQLA 2EXDA 4X65Q 3T1HL 1KIXA 5K36G 4DV1Q 1P16A 1A62A 3I4MH 3PO3G 1H95A 5IWAL 3I4MG 3TS2A 1NE3A 1V9PA 1QUQB 3GTLH 1X3EA 3PUXA 3CPWA 3E9IA 1YBYA 4HJ7A 4A3BG 2BA0A 5J3BA 5M5WH 3PUZA 3W1BA 4AIMA 4RG1A 5LMNL 2WFWA 1NJIC 4IPHA 1IBLL 3PSIA 4DAMA 1WI5A 4HIMA 2N3SA 4DV4Q 3GTOH 5IY0A 1IBKQ 4JI2L 1U5KA 4DUYL 5IYCG 3AQQA 1Q46A 1VQNA 3RLFA 4LFBQ 2WB1G 2BA1A 4DR4Q 3AYHB 4QY7A 4A3MH 1G6PA 4YWMA 1WYDA 4A3MG 2HHHQ 3PO2H 3H3VH 4IPDA 1XNQL 4UPAA 2Y0SG 2R6GA 1G291 1L2FA 1B70B 1BKBA 1CSPA 2KCTA 3NENA 4J15A 4DR5L 1MJEA 3RZOH 1RIPA 2WAQG 4BA1I 2JK8A 1J5EL 2CKZB 4B3TL 4MNOA 2FXQA 1GD7A 3MXNB 5GADC 2ZM6L 4QGUA 2K50A 3E9HA 3J80c 1M90C 3I4OA 2R7FA 2C35B 2UXBQ 2UUCQ 1XPUA 2UUAL 1EQRA 3UDXA 1SE8A 1VQCA 2AMCB 5IP9G 1GM5A 2A8VA 4B3RL 1EWIA 3CF5A 3S1NH 3ULLA 3KOJA 1NTGA 4A3LH 4K0KQ 3L2PA 1M1KC 1LM0A 3ICEA 3KF6B 2OQ0A 3JAMi 1TWGH 5C0XI 5M3FH 4ME3A 4JBJA 1ASYA 4JI0Q 4A3FH 2H5XA 2NVYH 1VQPA 1YJNA 4LF6L 3HOVH 2VQFQ 1N36Q 4OO1I 4YWLA 4IFDJ 3HOUH 4YHHL 3E0EA 1I94L 1PH4A 1Q86C 1FGUA 4A3KG 1D7QA 4A76A 4GLAC 4EX5A 4LF9L 4BY7H 3BZCA 4GKJQ 1Q1BA 1VQIA 4A3EH 2IHEA 1N34Q 2CQOA 1WCMH 3UE0A 4TQUS 1T9HA 3KJPA 2VUMH 3S1QH 1HZ9A 3K7UC 4A3IH 1NMFA 1HNWL 4GNXB 4GNXA 3I7FA 2KHJA 2R92H 2A1AA 1UE7A 2F52A 2F3IA 3S2DH 2RF4A 4X66Q 2K14A 1HZBA 2BH8A 1GO3E 1EFWA 3PIPA 4GLVB 4LFCQ 4KHPL 4IPGA 3M7NA 4R4CA 4PG3A 1PVOA 1KRTA 1I3QH 1AH9A 2DGYA 5GAHC 4JI8L 4LF5L 1Y1WH 1PYBA 5AJ3Q 5BR8L 5M5XH 5C3EG 1HZCA 4PZ7A 1K3RA 3TQYA 4YCWA 2ZTDA 3HOXH 2VQEQ 2Y0SE 2PI2A 4DV7L 2E2IH 2CWPA 1YEZA 1WFQA 4GOPB 4GOPA 2NZHA 1Q12A 1JB7A 2I5HA 1K0RA 4B3MQ 2R7ZH 3PV0A 4GKKQ 5M3MH 2K52A 4KI0A 4DV5L 4NXMQ 1SFOH 1JE5A 3FKIG 1VQMA 1X9NA 4BBRH 4C2MH 2YTXA 2K5HA 4Y7NH 1J6QA 4JV5L 2ALYB 1PFSA 1VQBA 4DV3L 4AQYQ 4JI1Q 1Q1EA 3PF5A 2KENA 3UE1A 1C9OA 1E7ZA 1IBMQ 1JJGA 2KBNA 3CCRA 3CPFA 3HOWH 1NMGA 3HOZH 4IO9A 4YCVA 3OW2A 3MEFA 1G51A 3U50C 3JAMc 3M4OH 4OWTB 1KC8C 4JOIA 1QVCA 4JI6L 4JI7L 4GN4B 1WJJA 4GLXA 4NXNL 2I5MX 1N33L 3G6EA 4HIDA 3FHWA 3CW2C 4P75A 1YHBA 3M4PA 1YITA 1L1OB 4HJ9A 3CCVA 4DR2L 1JJ2A 4JI5Q 3BU2A 1VQ5A 1K73C 2UUBQ 1HJPA 3RN5A 4AYBE 4LFAL 2LXKA 3CCUA 2UU9Q 2IT1A 3B6YA 3CMEA 4JI3L 4P71A 3PO3H 1E1OA 3H3VI 5C44G 4KHZA 2ATWA 3HFZB 4NB3A 1LYLA 1P8LA 5IYBG 4B3SL 2JA6G 4POGA 2CWAA 1MKHA 2PMZE 4DR3L 2OWOA 1OTCA 2JA5G 4A3BH 3HKZE 5FLXc 5LMUQ 4PMWA 2OCEA 2IHFA 4A4IA 2N78A 2IX1A 1V43A 2RHSB 1I6HH 2E2HH 4POFA 4IOCA 1A8VA 4IFDG 3HOYG 1FJGQ 4DR1Q 2UXDQ 2OTJA 1VS0A 3F2BA 3A5ZB 3KYHC 4DV6L 4DR7Q 5IYCH 4YY3L 2I0QA 1C0AA 3T1YQ 3CP0A 2E5LQ 3RNUA 4A3GG 2JE6I 3CCJA 1V1QA 1QZGA 3OTOL 3I55A 1XNRQ 2Z0SA 1E1TA 1VQHA 3PUVA 4IJLA 4XTCS 1MIUA 1E22A 4KLKA 3KFUA 1KQSA 3I56A 2Q2IA 3CCMA 4EQ5A 3G4SA 1BBUA 2RCNA 2B63G 5HY6A 4O0AA 3GTKH 1KXLA 1KHIA 2OQKA 2JA8G 3ERSX 1MJCA 4DR6L 4LUZA 3ULPA 4OX9L 5IP9H 1X65A 1N32Q 1HR0W 1TWCH 1XMOQ 2KCMA 1CKOA 3UDGA 1K8GA 2NVXH 3M4QA 1RL2A 3J81c 4JI4Q 1CKMA 1ASZA 4X62Q 4DPGA 2QEXA 3CMAA 4GN5A 4C3JH 1X3GA 4JOIC 3U58A 4OXPA 1Q81C 1PH6A 5C4XG 2BH2A 1NY4A 2PQAB 2PQAA 5ELNA 4A93G 2R93G 1I50H 5BR8Q 2ASBA 4HJ8A 1Z9FA 3ZJYC 3I2ZA 1HNZL 4A3KH 3F8TA 4JC0A 2K4KA 4BBSG 1LUZA 3K7AH 4X65L 2LXJA 2WP8J 4DV1L 1EUJA 1L1OC 2LSSA 4LF7Q 3PIOA 2V1CC 2ZTCA 4L5SA 4XIGS 2Q2HA 3STBC 2AWNA 1SR3A 1SROA 1A0IA 1PA6A 1I5FA 2MFIA 1HNXQ 1XMQQ 3PUYA 1KAWA 1XTDA 4DK6C 4X64Q 4LF8Q 4JYAQ 2A19A 4LF4Q 3S24A 3CQZH 4DV4L 4HJAA 1YJ9A 4HIKA 2F4VQ 3GTQH 3CCQA 1IBKL 1HZAA 2XGTA 4IPCA 3GTPH 4LFBL 4LW1A 4DV2Q 4DR4L 2UXCQ 4LUVA 2VNUD 3I4NG 4BY1G 4DV0Q 2E2JH 4OWWB 4GS3A 4YWKA 1XJVA 2Q2TA 1CSQA 2WB1E 3ER0A 4LWCA 5JEAG 1HR0Q 5IE8A 3GTMH 1CUKA 5C3EH 2Z6KA 3EBEA 1OXXK 2VZAA 2RHQB 1XPRA 1E3PA 1VQ8A 4DUZQ 5IP7H 1Q7YC 3RN2A 2UXBL 1S40A 5IP7G 2NZOA 2UUCL 3TS0A 1PH1A 1S72A 2JEAI 2WAQE 2L15A 5C0XG 3UDFA 5JJIA 1YVCA 3FKIH 4OO1G 4Y52H 3T1HQ 4PZ6A 3NELA 4K0KL 3S1MH 5IWAQ 4R4QA 3KDFB 3KDFA 4RMFA 2VY3A 2JQOA 2PNHA 4MTNA 3D31A 4JI0L 3RR5A 4QJFA 2VW9A 1KRSA 3H0GG 3GTJH 2NN6G 2NVTH 1IYJB 2VQFL 2XTIA 1N36L 1B7YB 2JA7G 4JBKA 3BZKA 3J81i 5LMNQ 4O2DA 1R9TH 1Q82C 2K75A 4R4IA 1X54A 1IBLQ 4LUOA 1B8AA 2PI2E 1PH8A 4JI2Q 3CC2A 2E8GA 4GKJL 2YYZA 4DUYQ 3H15A 1VQAA 4LNQA 2MO0A 2QGQA 3FP9A 1N34L 1AE2A 1YHAA
chains in the Genus database with same CATH superfamily
1VQOA 3NPPA 4DK1A 1XNQQ 1JOOA 1Y1VG 2JA9A 5JEAJ 3NE5B 3W5OA 1B9MA 3AFQA 4DR5Q 2D0OA 2PZTA 1A63A 4B3TQ 4F88A 3CHBD 1LT4D 5EBCA 3BDCA 3T16A 4RGTA 2F0VA 5D65A 3M3YB 5M5YB 5IYBH 2C9OA 1PYSB 1VQKA 2ID0A 4UY8C 4B3RQ 4IJHA 1D2BA 5AJ3L 2YV5A 4YCUA 3TZUA 5JVG3 5IT9c 2A6HD 3HOYH 1G8ZD 1I3QB 1C48A 4DAYA 1SE3A 3H0GB 1GVPA 5CV8A 2HT1A 1JT8A 1YJWA 4A3GH 1FGBD 1N8RC 2K1BA 3LNNA 4V190 2YU9B 3S9WA 2K04A 5NUCA 5CYUA 4X3UA 4UP8A 4JI1L 4Q5VA 3P1HA 3S2HH 4C3IG 1TWAB 1VQLA 2LMCB 3D3RA 1PTOF 1B50A 2Q8IB 3DEOA 2E76C 2F0LA 2JYOA 4UHVA 3PO2G 1CM9A 1EOTA 4KJNA 4LF5Q 1LTTD 3T56B 1FVIA 3TRZA 2UU9L 2KHIA 1WTVA 2GA4B 1IL8A 1A3UA 5FO7B 3H91A 1SNOA 1TWHB 2NWGA 1SMXA 5JJKA 5I2YA 2AWOA 3G71A 1HQMC 1K0SA 2F0NA 3CD6A 4A3FG 4TVAB 4CGYB 1GKHA 3HOVG 2TMPA 4ALPA 1VQ6A 3HOUG 1EQQA 3M9BA 2EQSA 1E24A 4LAAA 4GZYC 3CC7A 4JI6Q 4ZCKA 2ZJPA 4H02A 5KNDA 5G3LD 2KVMA 5JEAH 5HGQA 4NXNQ 2R7DA 4A3EG 1LT3D 4ZUIA 3RD4A 5FOBB 2DUDA 1SLJA 5C4JH 2WKDA 3T53B 3GDEA 4J6HA 4OO1H 3HKZG 1KLGD 2BE5D 2ZJRA 1AW7A 4NPSA 4X62L 3H6MA 4B3SQ 4R8IA 1QVGA 2VL6A 1KL9A 3BJUA 1Z47A 2NTSA 1UEBA 2B2VA 3J7A5 1JR0D 4HCEA 4RHRA 3TEHB 1FYCA 4LF7L 1CZWA 1UWVA 2AUJD 2V4DA 5GQOA 3SGIA 5A2QL 4BY7B 1Y1VH 3KLWA 1EWCA 1XMQL 1O7YA 3G7LA 2EZVA 4LF4L 1EOVA 2F4VL 1OXVA 1PLFA 2SNMA 2RBMA 1PH9A 2ZJQA 2O5JC 2PMZB 4DV0L 1VQ4A 1BF4A 4KMUC 1JMCA 1EY7A 3QOLA 1I4PA 2QF7A 2Z4IA 4K8IA 1TQOA 4RCOA 4RWSC 1L1OA 3OWEB 2F03A 3EIVA 4OWXB 3J7AV 3T1HL 2E2IB 1P16A 4C56C 5CBAE 1B44D 1X3EA 3PUXA 1KLUD 3FMCA 1E2ZA 1HA5A 1QB5D 3E9IA 2IX3A 4L8JA 5M5WH 3PUZA 4BBRB 2EVBA 2G9HD 4G7HC 5LMNL 3R2IA 4IPHA 1TS2A 3PSIA 4DAMA 1WI5A 4HIMA 4TSSA 2N3SA 3GTJB 3QOJA 4EGVA 2RSOA 4CJ1B 2M9VA 3CU7A 4ODGA 1Q46A 2E75C 4F7XA 2J4XA 5IODA 1WTQA 1G6PA 1H9KA 3PO2H 3H3VH 4ULLA 2P5ZX 1F2ZA 1B70B 1CSPA 2KCTA 2ZXOA 4BA1I 3H94A 1GUGA 4MNOA 1LT6D 5GADC 2ZM6L 3A7AB 2UXBQ 3J80c 2C5CA 1HFNA 3DMUA 2AMCB 3MEHA 3TMEA 2KA7A 3PO3B 3KOJA 3EA6A 1JOQA 1M1KC 2DY8A 2JA5B 2FMMA 2Z6BA 4A3FH 4LF6L 3HOVH 4OO1I 1N36Q 3H09A 3W3AA 1E2WA 2E2HB 3HOUH 4I7AA 3NSWA 2A74C 1Q86C 1DD2A 3NBIA 4A3KG 4GLAC 1S5CD 1M4VA 4GKJQ 2WB1B 1QG7A 4A3EH 1U4RA 1XXGA 5C4ZA 3SE0A 1NMFA 4I7ZC 1HNWL 2KHJA 5CORA 2F3IA 4HR7B 4X66Q 2F0WA 5FKAC 1EFWA 3PIPA 3A55A 1ESRA 2DNEA 2RKSA 4HCSA 1PVOA 1KRTA 3HG9A 1I3QH 1AH9A 1WD0A 1TWCB 2DGYA 5GAHC 4JI8L 2CW0C 1PYBA 3OPOA 5IT9L 5L37A 4DFAA 1HZCA 2VQEQ 4DV7L 4CHTB 1VF7A 1AEXA 2WIIB 4BBSB 1XX8A 4DV5L 2EXZA 4IUPA 2MGSA 4EQOA 2OXPA 4J1MA 4JV5L 2ALYB 1PFSA 4DV3L 5IGFA 3PF5A 3UE1A 2QCPX 4JW0A 1IBMQ 1LTGD 2KBNA 3CCRA 1NMGA 3NTHA 3MEFA 2JN4A 3CQZB 4OWTB 1DONA 3OOCA 3GTPB 3J81L 2ZXPA 3T51B 1N33L 3G6EA 4BY1B 1F2MA 1TS5A 2F0QA 2SOBA 3V96A 2EY1A 1KTKA 1YITA 2E2JB 4MTKA 3CCVA 1JJ2A 4KN4C 4B9WA 4LFAL 4NW2A 1GUNA 2H1EA 1E1OA 1K8OA 3H3VI 2DY7A 1A3VA 4KHZA 5C44G 3HFZB 4NB3A 3W2DA 2PMZE 2JA5G 5LMUQ 4A4IA 2IHFA 1V43A 1JQYD 3S1MB 2PO4A 4IFDG 4DR1Q 1VS0A 1NAPA 4DR7Q 4K5VA 1EL0A 1ESFA 2E5LQ 1QZGA 3SK5A 1NCVA 1TIID 3NWSA 1FNWA 5IGBA 4KLKA 3KFUA 3OMCA 1LO5D 3I56A 2SNSA 2MUYA 1EEFD 4O0AA 1K28A 1KHIA 3ERSX 1STYA 5C4HA 3EROA 1X3PA 4JVZA 4LUZA 5EGTA 1JC7A 4FXKC 1XMOQ 1K8GA 3M4QA 1CKMA 2K5QA 1EYDA 2J7ZA 1X3GA 4GN5A 1NY4A 5HGTA 2PQAB 2R93G 1ZYRD 4HJ8A 1F9RA 1HNZL 3HOYB 4A3KH 4BBSG 3LX0A 1LUZA 3K7AH 2LXJA 4DV1L 1EUJA 2XWBB 3LWUA 4A3GB 4G57A 1QE6A 3PIOA 2ZTCA 4XIGS 1DXMA 1E2VA 1I5FA 1FNVA 2MFIA 3DM1A 3OMGA 3GTLB 4EQPA 4LF8Q 3GV6A 2JXMB 1A6XA 4ILWA 4HIKA 3D6WA 1ENAA 2EOTA 1HCZA 2B8FA 4JPBW 4DR4L 4LUVA 2M2LA 4K14A 2VNUD 4BY1G 5G3LF 1Y8NB 5LHY1 1F77A 4YWKA 4ZAIA 1BR9A 1CSQA 2WB1E 2XSCA 3D6CA 1CUKA 2Z6KA 2VZAA 3IKJA 1E3PA 3EQLC 1VQ8A 2K28A 3F2UA 3SVMA 1S40A 1GUSA 2AUKA 1PH1A 1S72A 1U4PA 5C0XG 5JJIA 3VYTA 1Y8PB 4K8JA 1RJTA 5C3XA 2PNHA 3D31A 2NN6H 1GOZA 3GTJH 2VQFL 1B7YB 4O2DA 2K75A 5CMDA 1NR4A 5IOCA 1G2TA 4H44C 1DCZA 1EY5A 2EYMA 4K6DA 1D5MC 5KEEA 2Q2UA 4HMJA 1YI2A 4FDBA 2B29A 1XWEA 4U68A 2LY7A 1UE5A 3VDYA 2EJFC 1J5EQ 3STBD 1SN8A 3J80L 2HD3A 5C4JB 4LFCL 3TZDA 5C44H 1W3SA 5C0XJ 4GNXC 2ES2A 1D6EC 3RZDH 2JA5H 3FEWX 4R4OA 4KN7C 3NBHB 1VQDA 4L5QA 5CR3A 5I9OA 4IFDH 1OO9B 1H9RA 2XIWA 4OEMB 2QDBA 3CRLC 5FLMG 1D8LA 4B3ML 4GKKL 3DWPA 3NHHA 1MSHA 1I94Q 1JICA 1IXRA 1FD7D 1V8QA 3D0FA 4LF9Q 3I4LA 4GOPC 3HZXA 2CFMA 4AQYL 3KBGA 1Y1VB 1I4QA 1VQFA 5DLQE 2HDMA 1ZXTA 4UP7A 1EQVA 3HOWB 1MGSA 1IL2A 1EYAA 5FLXE 1SNQA 3PUWA 5CV9A 1EY8A 4HSVA 3CC4A 3M85A 2R93H 1PZID 1X56A 1AE3A 4N9PA 4BBSH 2L12A 5GAGC 1GHKA 3CRKC 3D8GA 3TP8A 2FJ2A 1H9JA 1KDCA 1EWHA 3MXPA 4KY7A 4MZ9A 5LMNW 4P74A 3S15H 4A3LG 1A15A 3IFTA 5KNCA 1YHQA 2RDHA 2UXDL 1FJGL 3X3NA 3NP8A 4K6LA 1UEAB 5M5WB 3T1YL 3UDIA 2WV6D 4KD3A 5LL6S 4BY1H 1XNRL 2AQ1B 3BVGA 3TP5A 2NN6I 1VQGA 1F9SA 3J7ZC 3BDLA 3IRBA 1T5EA 1WTWA 1S4ZA 3L7ZC 4AYBG 1BBWA 1PH5A 1SE2A 3PO2B 2D5DA 1YIJA 3VR3A 5EPLA 5I6WA 2BCOA 5E4WC 4DR2Q 5C0XH 1Y14B 2R92G 2OEOA 1QZHA 5CV4A 1N32L 1SAPA 1HH2P 4JI4L 4CBVA 3GQBA 1LTAD 3IFDA 3M4YA 4DR3Q 4G4KA 4JBWA 1SYDA 1JWUD 1Y1WG 4RCNA 1WVLA 2IWHA 1PH3A 3A8IE 3NUCA 3HOVB 3A5UA 2R7ZG 3HOUB 3A0JA 5M3MG 1X3FA 4IFDI 3OTOQ 5EKKA 3K59A 4IUQA 2I46A 1SYEA 4X64L 4A3EB 1ENFA 3W1GA 2SDFA 4DN4M 1S3OA 3OIQA 3G6JB 3KF8B 3HOWG 1EYGA 1SMYC 2IW3A 4DR6Q 2EYJA 1CKNB 4DA2A 2A69D 4OX9Q 2GVAA 3A56A 3HKZB 1SXTA 4FXGC 1SRUA 3F1ZA 2WINB 1QILA 3DM3A 1IZ6A 4DUZL 4XDXA 5FLMH 3CAMA 2QEJC 3GTMB 1CHQD 3RLOA 2AKWB 1PH2A 1S5FD 5I6YA 1SYGA 3P7JA 5K36G 5LL6X 4X65Q 3I4MH 1U4LA 4ZQ3A 3ND9A 1H95A 3TS2A 3GTLH 4DAVA 3PQIA 2RQXA 1PMRA 3W1BA 3MAQA 2O4XA 2F0EA 2KHSA 2F0IA 1NJIC 3VYSA 5CGKA 1EIHA 1EZ8A 3GTOH 4JI2L 1U5KA 5IYCG 1VQNA 3P75A 1I4XA 2BA1A 3AYHB 5DEHA 4YWMA 1WYDA 3KK7A 3O13A 4IPDA 2EJGC 1G291 2R6GA 3NENA 1MJEA 2KQ3A 4KHVA 2CKZB 1GD7A 4KKTA 5HURA 2K50A 1M90C 3I4OA 2F0JA 3RUZA 2UUAL 3OWFA 1SE8A 1VQCA 2RSNA 3CF5A 1V1PB 4A3LH 2CVRA 4K0KQ 3L2PA 1LM0A 1WTRA 3JAMi 5C0XI 4ME3A 1ASYA 4JI0Q 2H5XA 4YHHL 3E0EA 2ZXRA 1SJED 1PH4A 1FGUA 2DN8A 1I4RA 2FFKB 1LV9A 1Q1BA 1VQIA 2ICIA 1STBA 2IHEA 4IN3A 4OHJA 1TU2B 1BO0A 1T9HA 3KJPA 4WJWA 3K7UC 4GNXB 2R92H 2A1AA 3K5OA 3LWEA 3S2DH 3S14B 3OW7A 1HZBA 2L11A 3U9OA 2BH8A 1BCPC 2A6HC 5D3IB 1AZPA 4KHPL 4IPGA 2PW7A 2KCCA 3NTIA 4HTHA 4IQZA 1Y1WH 4RAUC 5AJ3Q 1EFID 1Q3LA 4IZ8A 3DWAA 4YCWA 1BOSA 2EY6A 4CDFC 1WFQA 3NTKA 4GOPB 1JB7A 1Q12A 3MTSA 2I5HA 1K0RA 1DOKA 2R7ZH 3IL8A 5M3MH 1D1IA 1C8CA 4A3KB 3V05A 4XQNA 1PRTC 3K7AB 1VQMA 1STGA 1EY0A 1SNDA 1VQBA 1LACA 4JI1Q 1Q1EA 1E7ZA 1A2TA 2A68D 4PV1C 3HOWH 1IYUA 1QWYA 1O7LA 1SSOA 1T5XD 4JOIA 1IW7C 3VYRA 4JI7L 4GN4B 2WACA 1WJJA 2EYHA 2I5MX 3I4NB 4XT1B 3CW2C 4P75A 1HPCA 3L3OC 3NWTA 3BU2A 2I07B 1VQ5A 1HJPA 2F0FA 3IAYA 3ZYYX 4KY6A 5KYIA 2UU9Q 3URYA 1ML0D 2IT1A 5K36H 3CMEA 3OHXC 4JI3L 4P71A 1FNUA 2PPBC 2F0SA 2ATWA 4LJZC 2JA6G 1LYLA 5IGDA 3U9SA 2OWOA 3HKZE 5FLXc 4PMWA 2IX1A 2F0TA 2EDGA 4IOCA 4IUNA 2JSOA 1FR3A 3F2BA 2JA7B 2G9DA 3KYHC 4DV6L 4Z9CB 5IYCH 4YY3L 1C0AA 4HEDA 2B2VC 2JE6I 2OT2A 1V1QA 3SR1A 2CW0D 1ICFB 5T1IA 3QJYA 2Z0SA 5ELCA 1E1TA 4XTCS 1MIUA 1L0XB 1KQSA 2Q2IA 3BDOA 1AFPA 3G4SA 2KEDA 3N6RA 3P20A 4P2CB 1D5XC 1KXLA 2OQKA 1Z7TA 1SNPA 1X65A 2CH4W 1HR0W 4MIUA 3SK8A 5C44B 2F3VA 1H9SA 4X62Q 2QEXA 3U58A 3RZDB 5JJZA 1HQRD 4JOIC 2EYOA 3K58A 4N8FA 1I50H 3ZJYC 4ZKBB 1CQVA 2F0MA 1RD9D 3NQIA 1L1OC 4LF7Q 4DF7A 5CV7A 1RTNA 3X3MA 5JOBA 1CA6A 4QMGA 1CA5A 4XT3B 3QO2A 1U9RA 1PA6A 2NZ1D 4YIJA 2RCFA 1XMQQ 1XTDA 2A19A 4LF4Q 3S24A 1HHVA 4DV4L 4HJAA 1YJ9A 2F4VQ 3AB9A 2HCIA 1HZAA 1IBKL 2XGTA 4IPCA 1SE4A 1RF2D 3PIP3 3Q23A 4LFBL 3I4NG 3WOFA 2MP1A 4DV0Q 1BUVT 2Q2TA 4LWCA 3ER0A 3KUPA 1STAA 5IE8A 3GTMH 1OXXK 1Q7YC 3RN2A 1EEID 2R93B 2NZOA 5I4DA 2UUCL 2A6ED 3I90A 3T1HQ 4PZ6A 4NMZA 2EY5A 3NELA 1MBYA 4R4QA 3KDFA 2A73B 4RMFA 4HMIA 2JQOA 3EJIA 3QB3A 5IIFA 3RR5A 4QJFA 2VW9A 2NN6G 2EYPA 2JA7G 3S15B 4JBKA 3BZKA 5LMNQ 4N9TA 3I91A 4RH6A 4R4IA 1X54A 4LUOA 3TDQA 1MD2D 2ICEC 4HSPA 1ET6A 2PI2E 2E8GA 1VF5C 4CJ2C 4LNQA 1HUMA 2K7VA 2QGQA 3FP9A 1N34L 3V2TA 1AE2A 1TKWB 1Q90A 3J7YW 4TRDA 3QWNA 3K81C 2B2WA 4RA8A 4A3JG 5K5PA 1KABA 4N8X1 4CKEA 2MQHA 1S5DD 5BN3A 3CCLA 4A3IB 2ZM6Q 4X6AH 4QL5A 1CTMA 4AH6A 2JA6H 1L0WA 1B3QA 5DM63 4MN3A 4DK3C 3MXUA 2YTYA 2BDNA 4M1UB 5E7NA 2ZTEA 4DAYB 3D4DA 3JAME 4LF6Q 1TWFH 1VQJA 4A3CG 1LTLA 3K5MA 3U4VA 1PHJA 1GUTA 4RFBA 4FNFA 1AZQA 2EY2A 3VR6A 1SFOB 2D0PA 1BCPB 3S14H 4EVOA 5IGCA 2B3GA 3I3CA 4RGOS 3PGZA 1HNWQ 4HJ5A 1DOMA 3EN2A 3RLNA 1HUNA 1YNXA 1VQ7A 2B2UA 1SYCA 4A3DH 1JJCB 4JCVE 4PZ8A 5IYDH 2HIXA 1QVFA 3KJOA 4L5TA 3F2CA 1W2BA 1M8AA 2K05A 2MNAA 1N9WA 4FF3A 4FF1A 3R3OA 4K2KA 4L6TB 4JI5L 4JI8Q 2UUBL 1DYQA 1G2SA 1VQ9A 4S3SA 4QQBX 1PRTB 1VCIA 4DV7Q 2B2WC 1OXUA 1SYBA 3GP7A 4DNIA 4JBMA 3PIO3 2QKIC 4DV5Q 2X6LA 3VA7A 4LMQD 1QJOA 3I4MB 1SNMA 1NUCA 1X32A 3L0OA 1K8AC 4JV5Q 4GN3B 1X3QA 4A75A 4DV3Q 5M3FG 3MXGA 1XPOA 2QA4A 2AHOB 2JJQA 1U0LA 2N49A 1GHJA 1UE6A 1I6HB 3CCSA 2O5IC 1LLRD 3AEVA 1RODA 3KBXA 5KGUA 3I4NH 1PDQA 3GTOB 5EBDA 4F87A 5ELBA 1N33Q 1X55A 4IURA 4KD4A 4BA2I 1EIYB 1WCMG 1CQFA 3WDNA 2A5HA 3AFPA 4A3IG 2IX0A 3GTGH 1TXYA 4LFAQ 1JE4A 1CHPD 1ZKOA 3DLLA 4L63B 5E1FA 3EFXD 1PTOC 4H0LC 5EKIA 2AQ2B 5FLXL 4DU9A 1UE1A 2PNRC 2JA7H 2B2UC 2CCZA 4WJ3M 1IKMA 1IYVA 2F0HA 2VXWA 2XRQD 2Z8LA 2X6GA 1YNJD 2IY5B 2KCNA 3OIPA 4E6IA 3HOZG 4HIOA 2HUGA 4K5WA 4XQJA 1JOKA 1HNXL 3S16H 4BS9A 4A3JH 5GROA 4JYAL 2L1BA 4AYBB 1FL0A 1LT5D 2K5WA 3ULJA 3S1RH 2B2YA 5H1SE 4ZYSA 4DV2L 2UXCL 2L5TA 5ELOA 2HQEA 2L4NA 1WTHA 2R92B 3GTQB 2K5NA 2DJGC 3SDZA 3S2DB 1PH7A 3K0XA 1HRJA 1B3AA 1HR0L 2PQEA 1G91A 1STNA 2YTVA 4R9WA 3OSOA 4L5RC 4XYQA 3PF4A 2MO1A 4FVMA 1Y1WB 1HNZQ 4A3CH 1W6KA 2Z6KC 3JC66 4DV1Q 2G5DA 1A62A 2R7ZB 5IWAL 3I4MG 1RTOA 1QUQB 3FVQA 5M3MB 1K3BC 5KIXA 2F0PA 1YBYA 3A8KE 3FKIB 4HJ7A 4A3BG 5J3BA 1HTPA 2PCFB 4KKUA 4IUTA 3EVQA 2WFWA 2MPMA 1IBLL 4J8QA 1IHZA 4FYDA 3Q0AA 5DNFA 1U4MA 5IY0A 4TKOB 4DUYL 5JPNC 4O42A 3RLFA 2AQ3B 4DR4Q 4X3TA 4QY7A 4A3MH 2K03A 1ICWA 1TR5A 3NXWA 1XNQL 1R4QB 4DR5L 3RZOH 1ENCA 1RIPA 2WAQG 2JK8A 4NP5A 3TP6A 4B3TL 2FXQA 3MXNB 3DWQA 2RDFA 4QGUA 2R7FA 2C35B 1BBXC 1QNKA 1EQRA 2Q8TA 1UAPA 5CV5A 3FRPB 2J0TD 4C1NI 5IP9G 3HGBA 4B3RL 3S1NH 1NTGA 1K83B 3ICEA 1LTRD 3KF6B 2OQ0A 1STHA 1TWGH 5M3FH 2NTTA 4Q0FA 4JBJA 4C3JG 5KNBA 2NVYH 2VQFQ 4YWLA 1GXDC 5I2XA 1RKNA 1D7QA 4XYOA 4A76A 1XTCD 1G6ZA 3BZCA 3A8JE 3N52A 3DEPA 4M8AA 3VR2A 1SJHD 4DGZA 1WCMH 3UE0A 3S1QH 2K32A 4UAIA 4A3IH 1UNSA 1YNNC 3I7FA 3KLSA 1UE7A 2F52A 2RF4A 2VB3X 5IGEA 1F2YA 5CC4A 3MC0B 2IL8A 2JA8B 4GLVB 4OIJA 4LFCQ 1HA6A 5EKLA 4R4CA 3M7NA 1JWSD 4PG3A 1VDZA 5BN4A 4LF5L 4F8MA 1DOLA 5BR8L 1IKLA 2EYFA 5M5XH 1B4OA 5C3EG 1K3RA 3E6ZX 2ZTDA 1LABA 2CWPA 3HOZH 4B3MQ 1I50B 4GKKQ 2K52A 3A7LA 1PFMA 4OELB 1SFOH 1JE5A 3FKIG 4FF4A 1HTLD 4C2MH 2YTXA 4OL7A 2K5HA 2QDLA 4Y7NH 3HS0C 4AQYQ 4X3SA 3CPFA 2CHBD 1WD1A 4IO9A 3OW2A 2IPKD 1EY4A 3JAMc 3M4OH 4JI6L 4C3HB 3I8ZA 4GLXA 1EZ6A 2M00A 4NXNL 5A35A 4HIDA 3FHWA 1GUOA 4EQNA 1YHBA 2ZT9C 4KTAA 1HFGA 3RN5A 4AYBE 3I70A 4KV6A 2Z9HA 2FINB 3K6OA 1I6VC 4B3SL 1P8LA 1CI3M 1EYCA 2F0UA 5EJWA 2CWAA 4POGA 4A3BH 1OTCA 2E74C 4H7BA 2OCEA 4G7ZC 2RHSB 1PFBA 3K5LA 1I6HH 4RGMA 1BCPD 1HXYD 4POFA 1SNCA 1A8VA 3HEJA 4RKLA 2UXDQ 1FJGQ 2PZUA 3AU7A 2Q8RE 1XYIA 3A5ZB 1AP0A 3T1YQ 1XNRQ 3MFYA 5AFWA 4CKBA 3VR5A 2L9HA 1VQHA 1PYWD 3GV3A 4EQ5A 1JB3A 1BBUA 3E0JA 1CZGA 2RCNA 1PRTD 3VR4A 2B63G 5HY6A 5FO9B 3GTKH 2JA8G 2K6AA 1PTOB 1MJCA 3K0YA 1J8IA 3FPUB 1QCBD 5IP9H 2XRSD 1N32Q 2KCMA 1CKOA 1RL2A 3J81c 4JI4Q 4WRDA 1J9OA 1R4PB 2JA6B 1H9MA 5E4XA 1NNXA 1EY9A 3CMAA 4C3JH 2N55A 4OXPA 1Q81C 1PH6A 5C4XG 1IW7D 5ELEA 4A93G 2PQAA 5BR8Q 3I2ZA 1NR2A 4U673 3F8TA 4JC0A 3M7GA 2CH4A 2WP8J 2L55A 1TWFB 2V1CC 1A3TA 1MSGA 4ZKCB 1SR3A 1SROA 1A0IA 1GUWA 2A69C 4CDCC 1KAWA 4X64Q 3GTQH 3CCQA 3SHLA 1SYFA 4C3HG 5ELDA 3Q6SA 4LW1A 4DK0A 3MA2B 4GS3A 1DM0B 1XJVA 4A3DB 3MZ5A 3NQTA 4IUUA 3BVZA 5C3EH 2FMCA 4DUZQ 5IP7H 2UXBL 5KYLA 2E2DC 3TS0A 2JEAI 2L15A 3UDFA 1B9NA 2H4OA 3Q24A 2XWJB 1YVCA 3FKIH 4Y52H 3PMFA 4PMCA 3FDTA 4B08A 3ERQA 2VY3A 5ISRA 1BXTA 3H0GG 2NVTH 1IYJB 1N36L 2XTIA 1PXUA 4QIWB 5D14A 4FF2A 1D1KA 3J81i 1R9TH 5FK9C 4DXFA 1B8AA 1PH8A 2RDGA 4JI2Q 4GKJL 3H15A 4KJOA 1VQAA 1ET9A 1ZEQX 2R3ZA 1YHAA 5EAYA 2NUCA 2XN9C 4R1JA 2GN5A 4CKCA 3KLSX 5GAEC 4BXXG 4X66L 5JJLA 2VUMB 2F0DA 4PNYA 2NBFA 3GTGB 4KY5A 3J81j 5FJ8G 2UUAQ 1K83H 1KD1C 4P72A 3NBHA 1WTOA 1K9MC 4IOAA 1Y69U 3K8AA 2JP1A 2KJXA 2VQEL 4RKBA 2FHTA 2JEBI 1PFNA 1II3A 1QNUA 4YHHQ 1VQEA 3HOXB 1NBWA 1OXTA 3I73A 4DNRB 1QUQA 1Y8OB 1Q8KA 2BE5C 2TSSA 1IBML 4APVA 4C3IH 2RA4A 3S16B 4A3JB 2B63H 2K01A 1TS3A 2JA8H 1I4GA 1LTID 4CJ0B 3S1RB 1KAAA 1O78A 3A74A 1S5BD 4G7OC 4P73A 4OONA 1STEA 4KHPQ 4A3DG 3T13A 2HIVA 3WWVA 5IYDG 4IUVA 4QUFA 3DUZA 2D62A 5C4XH 2F4IA 1VMCA 4A93H 5T1GA 3SXHA 4IALA 2D9UA 4JK1C 1X6OA 3MXNA 4JG2A 1EIFA 4DKAC 4ZLTF 3BS1A 3NEMA 4O1NA 2A68C 5A2QE 2PYKA 4UP9A 5LMUL 1JWMD 4R4TA 2VS1A 3KF6A 1DGSA 4DR1L 1BQQT 1PV4A 4DR7L 1B1ZA 2EPBA 4C3HH 2E5LL 3ND8A 3GO5A 3JAML 3Q8DA 3S17H 2NVQH 4QB4A 2HHHL 3CXCA 3GD7A 3L9AX 4JI7Q 4QUCA 4BY7G 3K80C 3TBIB 4A3MB 3D4RA 1B53A 1V1OA 1UUPA 4FP5D 2Y0SB 1OXSC 2VUMG 5F2DA 3RZOB 3TREA 5M5YH 3M3YH 2N8NA 5BN5A 1O7IA 2OTLA 1EQTA 1XMOL 2I5LX 4JI3Q 4KK7A 1JORA 3R8BA 2PZWA 3CCEA 2NVXB 3H0GH 3S1NB 2EIFA 1BVSA 3FPPA 1WOCA 3U4ZA 3DHQA 1CT1D 2Z1CA 5M3FB 1TWGB 3LGJA 1W6JA 3E3XA 3HOXG 2XNAC 2NVYB 3A54A 5COYA 3HKSA 4DV6Q 4YY3Q 2YU9H 1EY6A 4WJ4A 3TP7A 4XQQA 4R8NA 2F1MA 2K5VA 4BBRG 1TWAH 3J80i 2EE1A 3F2DA 1WTXA 4LF8L 3OYYA 1KDBA 1PTOH 4BXXH 1WCMB 2GVBA 2LKVA 1TY2A 3ONAB 3S1QB 3KF8A 4QIWE 3E5SA 1D5ZC 5FJ8H 4ABNA 1C7YA 2B39A 1CKNA 2SEBD 2D2CC 2F3WA 2O2LD 3PCOB 2RVLA 3G48A 4OGQC 1ILPA 4PQXA 1AN8A 5J22A 5ELFA 2DNCA 3R2TA 2ENBA 2N88A 5M5XB 3BG3A 3J7AF 1TWHH 3R93A 1E0BA 1YZ6A 3BZDB 4NXML 2HQLA 2EXDA 5J39A 1KIXA 3H3VC 5D3DA 5J1ZA 3PO3G 3HOZB 1K8MA 1NE3A 1V9PA 3BVMA 3CPWA 1F9PA 2BA0A 4C2MB 1BCPF 4KKSA 4AIMA 4UDUC 4RG1A 4Y7NB 3SEBA 1BDOA 3TN2A 1TY0A 4DV4Q 4DAPA 1IBKQ 1PTOD 1VMPA 2B8GA 2NYZD 3AQQA 4I65A 4LFBQ 2WB1G 1S5ED 3M4OB 2HHHQ 4A3MG 2A6EC 2HDLA 5IT9E 4UPAA 2Y0SG 3C46A 1L2FA 4PMBA 1BKBA 4J15A 1PRTF 1J5EL 3E9HA 2UUCQ 1XPUA 3VA5A 3UDXA 1DJRD 4NKLA 1GM5A 2A8VA 1EWIA 3ULLA 1V1PA 3QG1A 4RGNA 4A3BB 4QF4A 1I4HA 1YJNA 1VQPA 4IFDJ 5FO8B 3C2PA 1I94L 2KEEA 5JPMC 2NB0A 4NDXA 3T4AC 1SEBD 3J81E 4EX5A 4LF9L 4BY7H 2LS01 5C5LA 5C5MA 3WOEA 1N34Q 2CQOA 3QIAA 4TQUS 2WKCA 1JCKB 1PZKD 2VUMH 1HZ9A 1LTBD 3MVVA 4GNXA 2DJFC 2WAQB 1SDFA 3SK6A 5M9OA 3S2HB 2K14A 1GO3E 3GTKB 4K5XA 4ID6A 3HP3A 4FXDA 4ME5A 1ILQA 1O7ZA 1RDPD 5EPKA 4PZ7A 3TQYA 4C3JB 3HOXH 2Y0SE 2PI2A 2E2IH 1YEZA 3BYYB 5E3FA 2NZHA 1EU3A 4GOPA 4DXGA 3PV0A 4KI0A 3KLRA 4QCLA 4NXMQ 3CKIB 1X9NA 4BBRH 2MHVA 3MHBA 4CDEC 1Q8IA 1J6QA 4HN7A 3D4WA 2BOSA 2KENA 1C9OA 1JJGA 2F0KA 4K2LA 1KNEA 1C4QA 4YCVA 3C3LA 1G51A 2LFNA 3U50C 4ZK9B 2F0GA 1KC8C 1QVCA 1BNZA 1ZYRC 2K33A 4CDDC 2VB2X 3M4PA 1DZ1A 2EJMA 2KECA 2R61A 1PZJD 1L1OB 4HJ9A 4JI5Q 4DR2L 1K73C 2UUBQ 2F0OA 5C3EB 5CV6A 5EQ0A 2LXKA 3CCUA 3B6YA 3PO3H 2PW5A 3I72A 5IYBG 1YNND 4MHEA 1MKHA 3C1FA 4B9XA 4DR3L 2B2TA 5DM73 2N78A 5DAUA 2MJ8A 2E2HH 2KOLA 3C1EA 3HOYG 1Z6HA 2OTJA 2NVTB 1TVXA 1CFMA 2I0QA 1B2TA 3CP0A 2L0CA 3RNUA 2CQAA 5CBEE 3CCJA 4OIKA 1R9TB 4A3GG 3OTOL 3I55A 4WORA 3PUVA 4IJLA 1E22A 2KUMA 4LK1C 4FO2A 1LTSD 3CCMA 1TT2A 3K5NA 3MWYW 1O80A 3K57A 3QR8A 2Z4HA 4DR6L 1L0YB 4ZRZA 1CK1A 4OX9L 3ULPA 1KNAA 4RHSA 2NVXH 1TWCH 5EPJA 3UDGA 2B2YC 3HRZC 1ASZA 1H9SB 1YNJC 4DPGA 4WFN3 1SMYD 1RHPA 3Q22A 2OF1A 2BH2A 5ELNA 5JVH3 3BYTB 2ASBA 1Z9FA 2K4KA 4BWGB 4X65L 2LSSA 3VYUA 4L5SA 1GJXA 2Q2HA 3STBC 2AWNA 2K5DA 1F2LA 3MFGA 1HNXQ 2XVSA 3PUYA 2X69A 4DK6C 4JYAQ 5C3WA 1RCVD 1QOHA 3CQZH 3DXJC 4X3KA 3J80E 4C3IB 2BDOA 2B2TC 5JAVA 2B63B 3GTPH 1KDAA 4DV2Q 2UXCQ 5KRUA 1MI2A 1EIGA 5I9PA 1EU4A 2E2JH 4OWWB 1F9QA 5JEAG 1HR0Q 3ITPA 3EBEA 1XPRA 2RHQB 3NK9A 2IJ0A 5C4XB 3SK4A 4A93B 5IP7G 1WTPA 2HCCA 4ZUJA 4DNTB 1SBBB 2WAQE 2QILA 4OO1G 5TSSA 1ONLA 3RMHA 4K0KL 3S1MH 5IWAQ 3KDFB 4V0BA 1MHWC 1NSNS 4MTNA 4JI0L 2QW7A 1KRSA 1A2UA 2EYLA 5IGGA 3UI2A 1Q82C 1IBLQ 3TSSA 4C1NK 4A3FB 1TS4A 4H13C 3AMUA 4HAEA 3CC2A 5C6AA 2YYZA 4DUYQ 2MO0A 4XXEA 3S17B 2NVQB
chains in the Genus database with same CATH topology
1YI2A 1VQOA 4R1JA 3K81C 2B29A 4FDBA 1XNQQ 2GN5A 1Y1VG 2JA9A 5JEAJ 4A3JG 2MQHA 3W5OA 3AFQA 4DR5Q 2D0OA 1UE5A 5GAEC 3VDYA 3CCLA 4BXXG 1A63A 4X66L 5JJLA 1J5EQ 4B3TQ 3STBD 1SN8A 2ZM6Q 4X6AH 4LFCL 4QL5A 5C44H 1W3SA 4AH6A 3J81j 5C0XJ 5FJ8G 1L0WA 5IYBH 4GNXC 2UUAQ 2JA6H 1K83H 2ES2A 1PYSB 3RZDH 4DK3C 4P72A 1KD1C 2ID0A 4R4OA 1VQKA 2JA5H 2YTYA 4UY8C 4B3RQ 4IJHA 3NBHB 1VQDA 4L5QA 5AJ3L 2YV5A 4YCUA 1K9MC 5E7NA 4IOAA 5IT9c 2ZTEA 3HOYH 3K8AA 4DAYB 2VQEL 1GVPA 5FLMG 2JEBI 1D8LA 4LF6Q 2HT1A 4B3ML 4GKKL 1TWFH 1VQJA 1YJWA 4A3GH 1JT8A 4YHHQ 1VQEA 1N8RC 1I94Q 1IXRA 4A3CG 3D0FA 1LTLA 3U4VA 1NBWA 4LF9Q 1PHJA 1OXTA 1QUQA 5EAYA 4GOPC 2CFMA 4AQYL 1Q8KA 4JI1L 4UP8A 2D0PA 1IBML 4APVA 4C3IH 3S14H 3S2HH 2B63H 1VQLA 1VQFA 2JA8H 2B3GA 5DLQE 1HNWQ 3PGZA 4UP7A 4HJ5A 3A74A 3EN2A 3RLNA 4P73A 4OONA 1YNXA 1VQ7A 1IL2A 4A3DH 1JJCB 4JCVE 4A3DG 4PZ8A 3WWVA 2HIVA 4KHPQ 2HIXA 5IYDH 3PUWA 5IYDG 1QVFA 3KJOA 4L5TA 3F2CA 1W2BA 2D62A 2MNAA 5C4XH 1N9WA 3PO2G 4JI5L 3CC4A 3M85A 4A93H 4JI8Q 2UUBL 4LF5Q 2R93H 1X56A 1VQ9A 1AE3A 4QQBX 4BBSH 1FVIA 3TRZA 2UU9L 1X6OA 1VCIA 5GAGC 4DV7Q 2KHIA 4JG2A 1EIFA 1OXUA 4DKAC 4DNIA 3NEMA 4JBMA 4DV5Q 4UP9A 1SMXA 5LMUL 4R4TA 2VS1A 5LMNW 4MZ9A 5JJKA 4P74A 3S15H 3L0OA 4A3LG 2AWOA 1K8AC 4JV5Q 3KF6A 4GN3B 3G71A 1DGSA 4A75A 1YHQA 1FJGL 4DV3Q 4DR1L 5M3FG 2UXDL 1XPOA 2QA4A 2AHOB 2JJQA 3CD6A 1U0LA 1PV4A 4A3FG 2N49A 4TVAB 4DR7L 4C3HH 1UE6A 1GKHA 3CCSA 3T1YL 2E5LL 3UDIA 4ALPA 3HOVG 1VQ6A 3AEVA 3GO5A 3M9BA 3Q8DA 1EQQA 2EQSA 1E24A 4BY1H 3HOUG 2NVQH 3I4NH 3S17H 1XNRL 3CC7A 2HHHL 3CXCA 3GD7A 4JI6Q 2ZJPA 4H02A 4JI7Q 2NN6I 4BY7G 1VQGA 3K80C 5HGQA 3J7ZC 3IRBA 4NXNQ 1N33Q 1X55A 2R7DA 4A3EG 3L7ZC 4AYBG 4BA2I 1BBWA 1PH5A 1EIYB 1WCMG 1YIJA 1OXSC 2VUMG 2DUDA 3AFPA 1SLJA 5C4JH 4A3IG 2IX0A 4DR2Q 3GTGH 3TREA 5M5YH 3M3YH 1TXYA 1Y14B 2N8NA 3GDEA 4LFAQ 1O7IA 2OTLA 1QZHA 2R92G 1N32L 1XMOL 3HKZG 2I5LX 1HH2P 4JI3Q 2ZJRA 4JI4L 3DLLA 4NPSA 4X62L 4B3SQ 3CCEA 1QVGA 2VL6A 1KL9A 3BJUA 4DR3Q 2Q2UA 3H0GH 1UE1A 1Z47A 1UEBA 2JA7H 2EIFA 1BVSA 1WOCA 4JBWA 3U4ZA 2CCZA 1Y1WG 4WJ3M 3J7A5 1PH3A 3LGJA 3HOXG 3TEHB 2IY5B 3HKSA 4DV6Q 4LF7L 3HOZG 4YY3Q 3A5UA 1UWVA 4HIOA 2YU9H 2R7ZG 3A0JA 4WJ4A 5M3MG 1X3FA 4IFDI 3OTOQ 2K5VA 5GQOA 3SGIA 1HNXL 3S16H 4BBRG 1Y1VH 1TWAH 3KLWA 4A3JH 5GROA 3J80i 3F2DA 1XMQL 4X64L 4LF8L 4JYAL 3OYYA 4LF4L 3W1GA 1FL0A 1EOVA 4BXXH 1S3OA 3ULJA 1OXVA 3S1RH 2F4VL 2GVBA 3KF8B 5H1SE 4QIWE 3HOWG 1EYGA 4DV2L 2UXCL 5ELOA 5FJ8H 1C7YA 1PH9A 2K5NA 4DR6Q 1CKNB 1CKNA 2ZJQA 4DV0L 4OX9Q 2GVAA 1PH7A 3K0XA 1VQ4A 3PCOB 1SRUA 1HR0L 3G48A 1JMCA 2YTVA 3F1ZA 4L5RC 3DM3A 1IZ6A 4DUZL 1L1OA 5FLMH 3PF4A 2MO1A 3CAMA 3EIVA 3RLOA 2AKWB 4OWXB 1PH2A 1HNZQ 4A3CH 1TWHH 1YZ6A 2Z6KC 3JC66 4NXML 2HQLA 2EXDA 4X65Q 3T1HL 1KIXA 5K36G 4DV1Q 1P16A 1A62A 3I4MH 3PO3G 1H95A 5IWAL 3I4MG 3TS2A 1NE3A 1V9PA 1QUQB 3GTLH 1X3EA 3PUXA 3CPWA 3E9IA 1YBYA 4HJ7A 4A3BG 2BA0A 5J3BA 5M5WH 3PUZA 3W1BA 4AIMA 4RG1A 5LMNL 2WFWA 1NJIC 4IPHA 1IBLL 3PSIA 4DAMA 1WI5A 4HIMA 2N3SA 4DV4Q 3GTOH 5IY0A 1IBKQ 4JI2L 1U5KA 4DUYL 5IYCG 3AQQA 1Q46A 1VQNA 3RLFA 4LFBQ 2WB1G 2BA1A 4DR4Q 3AYHB 4QY7A 4A3MH 1G6PA 4YWMA 1WYDA 4A3MG 2HHHQ 3PO2H 3H3VH 4IPDA 1XNQL 4UPAA 2Y0SG 2R6GA 1G291 1L2FA 1B70B 1BKBA 1CSPA 2KCTA 3NENA 4J15A 4DR5L 1MJEA 3RZOH 1RIPA 2WAQG 4BA1I 2JK8A 1J5EL 2CKZB 4B3TL 4MNOA 2FXQA 1GD7A 3MXNB 5GADC 2ZM6L 4QGUA 2K50A 3E9HA 3J80c 1M90C 3I4OA 2R7FA 2C35B 2UXBQ 2UUCQ 1XPUA 2UUAL 1EQRA 3UDXA 1SE8A 1VQCA 2AMCB 5IP9G 1GM5A 2A8VA 4B3RL 1EWIA 3CF5A 3S1NH 3ULLA 3KOJA 1NTGA 4A3LH 4K0KQ 3L2PA 1M1KC 1LM0A 3ICEA 3KF6B 2OQ0A 3JAMi 1TWGH 5C0XI 5M3FH 4ME3A 4JBJA 1ASYA 4JI0Q 4A3FH 2H5XA 2NVYH 1VQPA 1YJNA 4LF6L 3HOVH 2VQFQ 1N36Q 4OO1I 4YWLA 4IFDJ 3HOUH 4YHHL 3E0EA 1I94L 1PH4A 1Q86C 1FGUA 4A3KG 1D7QA 4A76A 4GLAC 4EX5A 4LF9L 4BY7H 3BZCA 4GKJQ 1Q1BA 1VQIA 4A3EH 2IHEA 1N34Q 2CQOA 1WCMH 3UE0A 4TQUS 1T9HA 3KJPA 2VUMH 3S1QH 1HZ9A 3K7UC 4A3IH 1NMFA 1HNWL 4GNXB 4GNXA 3I7FA 2KHJA 2R92H 2A1AA 1UE7A 2F52A 2F3IA 3S2DH 2RF4A 4X66Q 2K14A 1HZBA 2BH8A 1GO3E 1EFWA 3PIPA 4GLVB 4LFCQ 4KHPL 4IPGA 3M7NA 4R4CA 4PG3A 1PVOA 1KRTA 1I3QH 1AH9A 2DGYA 5GAHC 4JI8L 4LF5L 1Y1WH 1PYBA 5AJ3Q 5BR8L 5M5XH 5C3EG 1HZCA 4PZ7A 1K3RA 3TQYA 4YCWA 2ZTDA 3HOXH 2VQEQ 2Y0SE 2PI2A 4DV7L 2E2IH 2CWPA 1YEZA 1WFQA 4GOPB 4GOPA 2NZHA 1Q12A 1JB7A 2I5HA 1K0RA 4B3MQ 2R7ZH 3PV0A 4GKKQ 5M3MH 2K52A 4KI0A 4DV5L 4NXMQ 1SFOH 1JE5A 3FKIG 1VQMA 1X9NA 4BBRH 4C2MH 2YTXA 2K5HA 4Y7NH 1J6QA 4JV5L 2ALYB 1PFSA 1VQBA 4DV3L 4AQYQ 4JI1Q 1Q1EA 3PF5A 2KENA 3UE1A 1C9OA 1E7ZA 1IBMQ 1JJGA 2KBNA 3CCRA 3CPFA 3HOWH 1NMGA 3HOZH 4IO9A 4YCVA 3OW2A 3MEFA 1G51A 3U50C 3JAMc 3M4OH 4OWTB 1KC8C 4JOIA 1QVCA 4JI6L 4JI7L 4GN4B 1WJJA 4GLXA 4NXNL 2I5MX 1N33L 3G6EA 4HIDA 3FHWA 3CW2C 4P75A 1YHBA 3M4PA 1YITA 1L1OB 4HJ9A 3CCVA 4DR2L 1JJ2A 4JI5Q 3BU2A 1VQ5A 1K73C 2UUBQ 1HJPA 3RN5A 4AYBE 4LFAL 2LXKA 3CCUA 2UU9Q 2IT1A 3B6YA 3CMEA 4JI3L 4P71A 3PO3H 1E1OA 3H3VI 5C44G 4KHZA 2ATWA 3HFZB 4NB3A 1LYLA 1P8LA 5IYBG 4B3SL 2JA6G 4POGA 2CWAA 1MKHA 2PMZE 4DR3L 2OWOA 1OTCA 2JA5G 4A3BH 3HKZE 5FLXc 5LMUQ 4PMWA 2OCEA 2IHFA 4A4IA 2N78A 2IX1A 1V43A 2RHSB 1I6HH 2E2HH 4POFA 4IOCA 1A8VA 4IFDG 3HOYG 1FJGQ 4DR1Q 2UXDQ 2OTJA 1VS0A 3F2BA 3A5ZB 3KYHC 4DV6L 4DR7Q 5IYCH 4YY3L 2I0QA 1C0AA 3T1YQ 3CP0A 2E5LQ 3RNUA 4A3GG 2JE6I 3CCJA 1V1QA 1QZGA 3OTOL 3I55A 1XNRQ 2Z0SA 1E1TA 1VQHA 3PUVA 4IJLA 4XTCS 1MIUA 1E22A 4KLKA 3KFUA 1KQSA 3I56A 2Q2IA 3CCMA 4EQ5A 3G4SA 1BBUA 2RCNA 2B63G 5HY6A 4O0AA 3GTKH 1KXLA 1KHIA 2OQKA 2JA8G 3ERSX 1MJCA 4DR6L 4LUZA 3ULPA 4OX9L 5IP9H 1X65A 1N32Q 1HR0W 1TWCH 1XMOQ 2KCMA 1CKOA 3UDGA 1K8GA 2NVXH 3M4QA 1RL2A 3J81c 4JI4Q 1CKMA 1ASZA 4X62Q 4DPGA 2QEXA 3CMAA 4GN5A 4C3JH 1X3GA 4JOIC 3U58A 4OXPA 1Q81C 1PH6A 5C4XG 2BH2A 1NY4A 2PQAB 2PQAA 5ELNA 4A93G 2R93G 1I50H 5BR8Q 2ASBA 4HJ8A 1Z9FA 3ZJYC 3I2ZA 1HNZL 4A3KH 3F8TA 4JC0A 2K4KA 4BBSG 1LUZA 3K7AH 4X65L 2LXJA 2WP8J 4DV1L 1EUJA 1L1OC 2LSSA 4LF7Q 3PIOA 2V1CC 2ZTCA 4L5SA 4XIGS 2Q2HA 3STBC 2AWNA 1SR3A 1SROA 1A0IA 1PA6A 1I5FA 2MFIA 1HNXQ 1XMQQ 3PUYA 1KAWA 1XTDA 4DK6C 4X64Q 4LF8Q 4JYAQ 2A19A 4LF4Q 3S24A 3CQZH 4DV4L 4HJAA 1YJ9A 4HIKA 2F4VQ 3GTQH 3CCQA 1IBKL 1HZAA 2XGTA 4IPCA 3GTPH 4LFBL 4LW1A 4DV2Q 4DR4L 2UXCQ 4LUVA 2VNUD 3I4NG 4BY1G 4DV0Q 2E2JH 4OWWB 4GS3A 4YWKA 1XJVA 2Q2TA 1CSQA 2WB1E 3ER0A 4LWCA 5JEAG 1HR0Q 5IE8A 3GTMH 1CUKA 5C3EH 2Z6KA 3EBEA 1OXXK 2VZAA 2RHQB 1XPRA 1E3PA 1VQ8A 4DUZQ 5IP7H 1Q7YC 3RN2A 2UXBL 1S40A 5IP7G 2NZOA 2UUCL 3TS0A 1PH1A 1S72A 2JEAI 2WAQE 2L15A 5C0XG 3UDFA 5JJIA 1YVCA 3FKIH 4OO1G 4Y52H 3T1HQ 4PZ6A 3NELA 4K0KL 3S1MH 5IWAQ 4R4QA 3KDFB 3KDFA 4RMFA 2VY3A 2JQOA 2PNHA 4MTNA 3D31A 4JI0L 3RR5A 4QJFA 2VW9A 1KRSA 3H0GG 3GTJH 2NN6G 2NVTH 1IYJB 2VQFL 2XTIA 1N36L 1B7YB 2JA7G 4JBKA 3BZKA 3J81i 5LMNQ 4O2DA 1R9TH 1Q82C 2K75A 4R4IA 1X54A 1IBLQ 4LUOA 1B8AA 2PI2E 1PH8A 4JI2Q 3CC2A 2E8GA 4GKJL 2YYZA 4DUYQ 3H15A 1VQAA 4LNQA 2MO0A 2QGQA 3FP9A 1N34L 1AE2A 1YHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 A;  1VQO A;  4R1J A;  3K81 C;  2B29 A;  4FDB A;  1XNQ Q;  2GN5 A;  1Y1V G;  2JA9 A;  5JEA J;  4A3J G;  2MQH A;  3W5O A;  3AFQ A;  4DR5 Q;  2D0O A;  1UE5 A;  5GAE C;  3VDY A;  3CCL A;  4BXX G;  1A63 A;  4X66 L;  5JJL A;  1J5E Q;  4B3T Q;  3STB D;  1SN8 A;  2ZM6 Q;  4X6A H;  4LFC L;  4QL5 A;  5C44 H;  1W3S A;  4AH6 A;  3J81 j;  5C0X J;  5FJ8 G;  1L0W A;  5IYB H;  4GNX C;  2UUA Q;  2JA6 H;  1K83 H;  2ES2 A;  1PYS B;  3RZD H;  4DK3 C;  4P72 A;  1KD1 C;  2ID0 A;  4R4O A;  1VQK A;  2JA5 H;  2YTY A;  4UY8 C;  4B3R Q;  4IJH A;  3NBH B;  1VQD A;  4L5Q A;  5AJ3 L;  2YV5 A;  4YCU A;  1K9M C;  5E7N A;  4IOA A;  5IT9 c;  2ZTE A;  3HOY H;  3K8A A;  4DAY B;  2VQE L;  1GVP A;  5FLM G;  2JEB I;  1D8L A;  4LF6 Q;  2HT1 A;  4B3M L;  4GKK L;  1TWF H;  1VQJ A;  1YJW A;  4A3G H;  1JT8 A;  4YHH Q;  1VQE A;  1N8R C;  1I94 Q;  1IXR A;  4A3C G;  3D0F A;  1LTL A;  3U4V A;  1NBW A;  4LF9 Q;  1PHJ A;  1OXT A;  1QUQ A;  5EAY A;  4GOP C;  2CFM A;  4AQY L;  1Q8K A;  4JI1 L;  4UP8 A;  2D0P A;  1IBM L;  4APV A;  4C3I H;  3S14 H;  3S2H H;  2B63 H;  1VQL A;  1VQF A;  2JA8 H;  2B3G A;  5DLQ E;  1HNW Q;  3PGZ A;  4UP7 A;  4HJ5 A;  3A74 A;  3EN2 A;  3RLN A;  4P73 A;  4OON A;  1YNX A;  1VQ7 A;  1IL2 A;  4A3D H;  1JJC B;  4JCV E;  4A3D G;  4PZ8 A;  3WWV A;  2HIV A;  4KHP Q;  2HIX A;  5IYD H;  3PUW A;  5IYD G;  1QVF A;  3KJO A;  4L5T A;  3F2C A;  1W2B A;  2D62 A;  2MNA A;  5C4X H;  1N9W A;  3PO2 G;  4JI5 L;  3CC4 A;  3M85 A;  4A93 H;  4JI8 Q;  2UUB L;  4LF5 Q;  2R93 H;  1X56 A;  1VQ9 A;  1AE3 A;  4QQB X;  4BBS H;  1FVI A;  3TRZ A;  2UU9 L;  1X6O A;  1VCI A;  5GAG C;  4DV7 Q;  2KHI A;  4JG2 A;  1EIF A;  1OXU A;  4DKA C;  4DNI A;  3NEM A;  4JBM A;  4DV5 Q;  4UP9 A;  1SMX A;  5LMU L;  4R4T A;  2VS1 A;  5LMN W;  4MZ9 A;  5JJK A;  4P74 A;  3S15 H;  3L0O A;  4A3L G;  2AWO A;  1K8A C;  4JV5 Q;  3KF6 A;  4GN3 B;  3G71 A;  1DGS A;  4A75 A;  1YHQ A;  1FJG L;  4DV3 Q;  4DR1 L;  5M3F G;  2UXD L;  1XPO A;  2QA4 A;  2AHO B;  2JJQ A;  3CD6 A;  1U0L A;  1PV4 A;  4A3F G;  2N49 A;  4TVA B;  4DR7 L;  4C3H H;  1UE6 A;  1GKH A;  3CCS A;  3T1Y L;  2E5L L;  3UDI A;  4ALP A;  3HOV G;  1VQ6 A;  3AEV A;  3GO5 A;  3M9B A;  3Q8D A;  1EQQ A;  2EQS A;  1E24 A;  4BY1 H;  3HOU G;  2NVQ H;  3I4N H;  3S17 H;  1XNR L;  3CC7 A;  2HHH L;  3CXC A;  3GD7 A;  4JI6 Q;  2ZJP A;  4H02 A;  4JI7 Q;  2NN6 I;  4BY7 G;  1VQG A;  3K80 C;  5HGQ A;  3J7Z C;  3IRB A;  4NXN Q;  1N33 Q;  1X55 A;  2R7D A;  4A3E G;  3L7Z C;  4AYB G;  4BA2 I;  1BBW A;  1PH5 A;  1EIY B;  1WCM G;  1YIJ A;  1OXS C;  2VUM G;  2DUD A;  3AFP A;  1SLJ A;  5C4J H;  4A3I G;  2IX0 A;  4DR2 Q;  3GTG H;  3TRE A;  5M5Y H;  3M3Y H;  1TXY A;  1Y14 B;  2N8N A;  3GDE A;  4LFA Q;  1O7I A;  2OTL A;  1QZH A;  2R92 G;  1N32 L;  1XMO L;  3HKZ G;  2I5L X;  1HH2 P;  4JI3 Q;  2ZJR A;  4JI4 L;  3DLL A;  4NPS A;  4X62 L;  4B3S Q;  3CCE A;  1QVG A;  2VL6 A;  1KL9 A;  3BJU A;  4DR3 Q;  2Q2U A;  3H0G H;  1UE1 A;  1Z47 A;  1UEB A;  2JA7 H;  2EIF A;  1BVS A;  1WOC A;  4JBW A;  3U4Z A;  2CCZ A;  1Y1W G;  4WJ3 M;  3J7A 5;  1PH3 A;  3LGJ A;  3HOX G;  3TEH B;  2IY5 B;  3HKS A;  4DV6 Q;  4LF7 L;  3HOZ G;  4YY3 Q;  3A5U A;  1UWV A;  4HIO A;  2YU9 H;  2R7Z G;  3A0J A;  4WJ4 A;  5M3M G;  1X3F A;  4IFD I;  3OTO Q;  2K5V A;  5GQO A;  3SGI A;  1HNX L;  3S16 H;  4BBR G;  1Y1V H;  1TWA H;  3KLW A;  4A3J H;  5GRO A;  3J80 i;  3F2D A;  1XMQ L;  4X64 L;  4LF8 L;  4JYA L;  3OYY A;  4LF4 L;  3W1G A;  1FL0 A;  1EOV A;  4BXX H;  1S3O A;  3ULJ A;  1OXV A;  3S1R H;  2F4V L;  2GVB A;  3KF8 B;  5H1S E;  4QIW E;  3HOW G;  1EYG A;  4DV2 L;  2UXC L;  5ELO A;  5FJ8 H;  1C7Y A;  1PH9 A;  2K5N A;  4DR6 Q;  1CKN B;  1CKN A;  2ZJQ A;  4DV0 L;  4OX9 Q;  2GVA A;  1PH7 A;  3K0X A;  1VQ4 A;  3PCO B;  1SRU A;  1HR0 L;  3G48 A;  1JMC A;  2YTV A;  3F1Z A;  4L5R C;  3DM3 A;  1IZ6 A;  4DUZ L;  1L1O A;  5FLM H;  3PF4 A;  2MO1 A;  3CAM A;  3EIV A;  3RLO A;  2AKW B;  4OWX B;  1PH2 A;  1HNZ Q;  4A3C H;  1TWH H;  1YZ6 A;  2Z6K C;  3JC6 6;  4NXM L;  2HQL A;  2EXD A;  4X65 Q;  3T1H L;  1KIX A;  5K36 G;  4DV1 Q;  1P16 A;  1A62 A;  3I4M H;  3PO3 G;  1H95 A;  5IWA L;  3I4M G;  3TS2 A;  1NE3 A;  1V9P A;  1QUQ B;  3GTL H;  1X3E A;  3PUX A;  3CPW A;  3E9I A;  1YBY A;  4HJ7 A;  4A3B G;  2BA0 A;  5J3B A;  5M5W H;  3PUZ A;  3W1B A;  4AIM A;  4RG1 A;  5LMN L;  2WFW A;  1NJI C;  4IPH A;  1IBL L;  3PSI A;  4DAM A;  1WI5 A;  4HIM A;  2N3S A;  4DV4 Q;  3GTO H;  5IY0 A;  1IBK Q;  4JI2 L;  1U5K A;  4DUY L;  5IYC G;  3AQQ A;  1Q46 A;  1VQN A;  3RLF A;  4LFB Q;  2WB1 G;  2BA1 A;  4DR4 Q;  3AYH B;  4QY7 A;  4A3M H;  1G6P A;  4YWM A;  1WYD A;  4A3M G;  2HHH Q;  3PO2 H;  3H3V H;  4IPD A;  1XNQ L;  4UPA A;  2Y0S G;  2R6G A;  1G29 1;  1L2F A;  1B70 B;  1BKB A;  1CSP A;  2KCT A;  3NEN A;  4J15 A;  4DR5 L;  1MJE A;  3RZO H;  1RIP A;  2WAQ G;  4BA1 I;  2JK8 A;  1J5E L;  2CKZ B;  4B3T L;  4MNO A;  2FXQ A;  1GD7 A;  3MXN B;  5GAD C;  2ZM6 L;  4QGU A;  2K50 A;  3E9H A;  3J80 c;  1M90 C;  3I4O A;  2R7F A;  2C35 B;  2UXB Q;  2UUC Q;  1XPU A;  2UUA L;  1EQR A;  3UDX A;  1SE8 A;  1VQC A;  2AMC B;  5IP9 G;  1GM5 A;  2A8V A;  4B3R L;  1EWI A;  3CF5 A;  3S1N H;  3ULL A;  3KOJ A;  1NTG A;  4A3L H;  4K0K Q;  3L2P A;  1M1K C;  1LM0 A;  3ICE A;  3KF6 B;  2OQ0 A;  3JAM i;  1TWG H;  5C0X I;  5M3F H;  4ME3 A;  4JBJ A;  1ASY A;  4JI0 Q;  4A3F H;  2H5X A;  2NVY H;  1VQP A;  1YJN A;  4LF6 L;  3HOV H;  2VQF Q;  1N36 Q;  4OO1 I;  4YWL A;  4IFD J;  3HOU H;  4YHH L;  3E0E A;  1I94 L;  1PH4 A;  1Q86 C;  1FGU A;  4A3K G;  1D7Q A;  4A76 A;  4GLA C;  4EX5 A;  4LF9 L;  4BY7 H;  3BZC A;  4GKJ Q;  1Q1B A;  1VQI A;  4A3E H;  2IHE A;  1N34 Q;  2CQO A;  1WCM H;  3UE0 A;  4TQU S;  1T9H A;  3KJP A;  2VUM H;  3S1Q H;  1HZ9 A;  3K7U C;  4A3I H;  1NMF A;  1HNW L;  4GNX B;  4GNX A;  3I7F A;  2KHJ A;  2R92 H;  2A1A A;  1UE7 A;  2F52 A;  2F3I A;  3S2D H;  2RF4 A;  4X66 Q;  2K14 A;  1HZB A;  2BH8 A;  1GO3 E;  1EFW A;  3PIP A;  4GLV B;  4LFC Q;  4KHP L;  4IPG A;  3M7N A;  4R4C A;  4PG3 A;  1PVO A;  1KRT A;  1I3Q H;  1AH9 A;  2DGY A;  5GAH C;  4JI8 L;  4LF5 L;  1Y1W H;  1PYB A;  5AJ3 Q;  5BR8 L;  5M5X H;  5C3E G;  1HZC A;  4PZ7 A;  1K3R A;  3TQY A;  4YCW A;  2ZTD A;  3HOX H;  2VQE Q;  2Y0S E;  2PI2 A;  4DV7 L;  2E2I H;  2CWP A;  1YEZ A;  1WFQ A;  4GOP B;  4GOP A;  2NZH A;  1Q12 A;  1JB7 A;  2I5H A;  1K0R A;  4B3M Q;  2R7Z H;  3PV0 A;  4GKK Q;  5M3M H;  2K52 A;  4KI0 A;  4DV5 L;  4NXM Q;  1SFO H;  1JE5 A;  3FKI G;  1VQM A;  1X9N A;  4BBR H;  4C2M H;  2YTX A;  2K5H A;  4Y7N H;  1J6Q A;  4JV5 L;  2ALY B;  1PFS A;  1VQB A;  4DV3 L;  4AQY Q;  4JI1 Q;  1Q1E A;  3PF5 A;  2KEN A;  3UE1 A;  1C9O A;  1E7Z A;  1IBM Q;  1JJG A;  2KBN A;  3CCR A;  3CPF A;  3HOW H;  1NMG A;  3HOZ H;  4IO9 A;  4YCV A;  3OW2 A;  3MEF A;  1G51 A;  3U50 C;  3JAM c;  3M4O H;  4OWT B;  1KC8 C;  4JOI A;  1QVC A;  4JI6 L;  4JI7 L;  4GN4 B;  1WJJ A;  4GLX A;  4NXN L;  2I5M X;  1N33 L;  3G6E A;  4HID A;  3FHW A;  3CW2 C;  4P75 A;  1YHB A;  3M4P A;  1YIT A;  1L1O B;  4HJ9 A;  3CCV A;  4DR2 L;  1JJ2 A;  4JI5 Q;  3BU2 A;  1VQ5 A;  1K73 C;  2UUB Q;  1HJP A;  3RN5 A;  4AYB E;  4LFA L;  2LXK A;  3CCU A;  2UU9 Q;  2IT1 A;  3B6Y A;  3CME A;  4JI3 L;  4P71 A;  3PO3 H;  1E1O A;  3H3V I;  5C44 G;  4KHZ A;  2ATW A;  3HFZ B;  4NB3 A;  1LYL A;  1P8L A;  5IYB G;  4B3S L;  2JA6 G;  4POG A;  2CWA A;  1MKH A;  2PMZ E;  4DR3 L;  2OWO A;  1OTC A;  2JA5 G;  4A3B H;  3HKZ E;  5FLX c;  5LMU Q;  4PMW A;  2OCE A;  2IHF A;  4A4I A;  2N78 A;  2IX1 A;  1V43 A;  2RHS B;  1I6H H;  2E2H H;  4POF A;  4IOC A;  1A8V A;  4IFD G;  3HOY G;  1FJG Q;  4DR1 Q;  2UXD Q;  2OTJ A;  1VS0 A;  3F2B A;  3A5Z B;  3KYH C;  4DV6 L;  4DR7 Q;  5IYC H;  4YY3 L;  2I0Q A;  1C0A A;  3T1Y Q;  3CP0 A;  2E5L Q;  3RNU A;  4A3G G;  2JE6 I;  3CCJ A;  1V1Q A;  1QZG A;  3OTO L;  3I55 A;  1XNR Q;  2Z0S A;  1E1T A;  1VQH A;  3PUV A;  4IJL A;  4XTC S;  1MIU A;  1E22 A;  4KLK A;  3KFU A;  1KQS A;  3I56 A;  2Q2I A;  3CCM A;  4EQ5 A;  3G4S A;  1BBU A;  2RCN A;  2B63 G;  5HY6 A;  4O0A A;  3GTK H;  1KXL A;  1KHI A;  2OQK A;  2JA8 G;  3ERS X;  1MJC A;  4DR6 L;  4LUZ A;  3ULP A;  4OX9 L;  5IP9 H;  1X65 A;  1N32 Q;  1HR0 W;  1TWC H;  1XMO Q;  2KCM A;  1CKO A;  3UDG A;  1K8G A;  2NVX H;  3M4Q A;  1RL2 A;  3J81 c;  4JI4 Q;  1CKM A;  1ASZ A;  4X62 Q;  4DPG A;  2QEX A;  3CMA A;  4GN5 A;  4C3J H;  1X3G A;  4JOI C;  3U58 A;  4OXP A;  1Q81 C;  1PH6 A;  5C4X G;  2BH2 A;  1NY4 A;  2PQA B;  2PQA A;  5ELN A;  4A93 G;  2R93 G;  1I50 H;  5BR8 Q;  2ASB A;  4HJ8 A;  1Z9F A;  3ZJY C;  3I2Z A;  1HNZ L;  4A3K H;  3F8T A;  4JC0 A;  2K4K A;  4BBS G;  1LUZ A;  3K7A H;  4X65 L;  2LXJ A;  2WP8 J;  4DV1 L;  1EUJ A;  1L1O C;  2LSS A;  4LF7 Q;  3PIO A;  2V1C C;  2ZTC A;  4L5S A;  4XIG S;  2Q2H A;  3STB C;  2AWN A;  1SR3 A;  1SRO A;  1A0I A;  1PA6 A;  1I5F A;  2MFI A;  1HNX Q;  1XMQ Q;  3PUY A;  1KAW A;  1XTD A;  4DK6 C;  4X64 Q;  4LF8 Q;  4JYA Q;  2A19 A;  4LF4 Q;  3S24 A;  3CQZ H;  4DV4 L;  4HJA A;  1YJ9 A;  4HIK A;  2F4V Q;  3GTQ H;  3CCQ A;  1IBK L;  1HZA A;  2XGT A;  4IPC A;  3GTP H;  4LFB L;  4LW1 A;  4DV2 Q;  4DR4 L;  2UXC Q;  4LUV A;  2VNU D;  3I4N G;  4BY1 G;  4DV0 Q;  2E2J H;  4OWW B;  4GS3 A;  4YWK A;  1XJV A;  2Q2T A;  1CSQ A;  2WB1 E;  3ER0 A;  4LWC A;  5JEA G;  1HR0 Q;  5IE8 A;  3GTM H;  1CUK A;  5C3E H;  2Z6K A;  3EBE A;  1OXX K;  2VZA A;  2RHQ B;  1XPR A;  1E3P A;  1VQ8 A;  4DUZ Q;  5IP7 H;  1Q7Y C;  3RN2 A;  2UXB L;  1S40 A;  5IP7 G;  2NZO A;  2UUC L;  3TS0 A;  1PH1 A;  1S72 A;  2JEA I;  2WAQ E;  2L15 A;  5C0X G;  3UDF A;  5JJI A;  1YVC A;  3FKI H;  4OO1 G;  4Y52 H;  3T1H Q;  4PZ6 A;  3NEL A;  4K0K L;  3S1M H;  5IWA Q;  4R4Q A;  3KDF B;  3KDF A;  4RMF A;  2VY3 A;  2JQO A;  2PNH A;  4MTN A;  3D31 A;  4JI0 L;  3RR5 A;  4QJF A;  2VW9 A;  1KRS A;  3H0G G;  3GTJ H;  2NN6 G;  2NVT H;  1IYJ B;  2VQF L;  2XTI A;  1N36 L;  1B7Y B;  2JA7 G;  4JBK A;  3BZK A;  3J81 i;  5LMN Q;  4O2D A;  1R9T H;  1Q82 C;  2K75 A;  4R4I A;  1X54 A;  1IBL Q;  4LUO A;  1B8A A;  2PI2 E;  1PH8 A;  4JI2 Q;  3CC2 A;  2E8G A;  4GKJ L;  2YYZ A;  4DUY Q;  3H15 A;  1VQA A;  4LNQ A;  2MO0 A;  2QGQ A;  3FP9 A;  1N34 L;  1AE2 A;  1YHA A; 
#chains in the Genus database with same CATH topology
 1VQO A;  3NPP A;  4DK1 A;  1XNQ Q;  1JOO A;  1Y1V G;  2JA9 A;  5JEA J;  3NE5 B;  3W5O A;  1B9M A;  3AFQ A;  4DR5 Q;  2D0O A;  2PZT A;  1A63 A;  4B3T Q;  4F88 A;  3CHB D;  1LT4 D;  5EBC A;  3BDC A;  3T16 A;  4RGT A;  2F0V A;  5D65 A;  3M3Y B;  5M5Y B;  5IYB H;  2C9O A;  1PYS B;  1VQK A;  2ID0 A;  4UY8 C;  4B3R Q;  4IJH A;  1D2B A;  5AJ3 L;  2YV5 A;  4YCU A;  3TZU A;  5JVG 3;  5IT9 c;  2A6H D;  3HOY H;  1G8Z D;  1I3Q B;  1C48 A;  4DAY A;  1SE3 A;  3H0G B;  1GVP A;  5CV8 A;  2HT1 A;  1JT8 A;  1YJW A;  4A3G H;  1FGB D;  1N8R C;  2K1B A;  3LNN A;  4V19 0;  2YU9 B;  3S9W A;  2K04 A;  5NUC A;  5CYU A;  4X3U A;  4UP8 A;  4JI1 L;  4Q5V A;  3P1H A;  3S2H H;  4C3I G;  1TWA B;  1VQL A;  2LMC B;  3D3R A;  1PTO F;  1B50 A;  2Q8I B;  3DEO A;  2E76 C;  2F0L A;  2JYO A;  4UHV A;  3PO2 G;  1CM9 A;  1EOT A;  4KJN A;  4LF5 Q;  1LTT D;  3T56 B;  1FVI A;  3TRZ A;  2UU9 L;  2KHI A;  1WTV A;  2GA4 B;  1IL8 A;  1A3U A;  5FO7 B;  3H91 A;  1SNO A;  1TWH B;  2NWG A;  1SMX A;  5JJK A;  5I2Y A;  2AWO A;  3G71 A;  1HQM C;  1K0S A;  2F0N A;  3CD6 A;  4A3F G;  4TVA B;  4CGY B;  1GKH A;  3HOV G;  2TMP A;  4ALP A;  1VQ6 A;  3HOU G;  1EQQ A;  3M9B A;  2EQS A;  1E24 A;  4LAA A;  4GZY C;  3CC7 A;  4JI6 Q;  4ZCK A;  2ZJP A;  4H02 A;  5KND A;  5G3L D;  2KVM A;  5JEA H;  5HGQ A;  4NXN Q;  2R7D A;  4A3E G;  1LT3 D;  4ZUI A;  3RD4 A;  5FOB B;  2DUD A;  1SLJ A;  5C4J H;  2WKD A;  3T53 B;  3GDE A;  4J6H A;  4OO1 H;  3HKZ G;  1KLG D;  2BE5 D;  2ZJR A;  1AW7 A;  4NPS A;  4X62 L;  3H6M A;  4B3S Q;  4R8I A;  1QVG A;  2VL6 A;  1KL9 A;  3BJU A;  1Z47 A;  2NTS A;  1UEB A;  2B2V A;  3J7A 5;  1JR0 D;  4HCE A;  4RHR A;  3TEH B;  1FYC A;  4LF7 L;  1CZW A;  1UWV A;  2AUJ D;  2V4D A;  5GQO A;  3SGI A;  5A2Q L;  4BY7 B;  1Y1V H;  3KLW A;  1EWC A;  1XMQ L;  1O7Y A;  3G7L A;  2EZV A;  4LF4 L;  1EOV A;  2F4V L;  1OXV A;  1PLF A;  2SNM A;  2RBM A;  1PH9 A;  2ZJQ A;  2O5J C;  2PMZ B;  4DV0 L;  1VQ4 A;  1BF4 A;  4KMU C;  1JMC A;  1EY7 A;  3QOL A;  1I4P A;  2QF7 A;  2Z4I A;  4K8I A;  1TQO A;  4RCO A;  4RWS C;  1L1O A;  3OWE B;  2F03 A;  3EIV A;  4OWX B;  3J7A V;  3T1H L;  2E2I B;  1P16 A;  4C56 C;  5CBA E;  1B44 D;  1X3E A;  3PUX A;  1KLU D;  3FMC A;  1E2Z A;  1HA5 A;  1QB5 D;  3E9I A;  2IX3 A;  4L8J A;  5M5W H;  3PUZ A;  4BBR B;  2EVB A;  2G9H D;  4G7H C;  5LMN L;  3R2I A;  4IPH A;  1TS2 A;  3PSI A;  4DAM A;  1WI5 A;  4HIM A;  4TSS A;  2N3S A;  3GTJ B;  3QOJ A;  4EGV A;  2RSO A;  4CJ1 B;  2M9V A;  3CU7 A;  4ODG A;  1Q46 A;  2E75 C;  4F7X A;  2J4X A;  5IOD A;  1WTQ A;  1G6P A;  1H9K A;  3PO2 H;  3H3V H;  4ULL A;  2P5Z X;  1F2Z A;  1B70 B;  1CSP A;  2KCT A;  2ZXO A;  4BA1 I;  3H94 A;  1GUG A;  4MNO A;  1LT6 D;  5GAD C;  2ZM6 L;  3A7A B;  2UXB Q;  3J80 c;  2C5C A;  1HFN A;  3DMU A;  2AMC B;  3MEH A;  3TME A;  2KA7 A;  3PO3 B;  3KOJ A;  3EA6 A;  1JOQ A;  1M1K C;  2DY8 A;  2JA5 B;  2FMM A;  2Z6B A;  4A3F H;  4LF6 L;  3HOV H;  4OO1 I;  1N36 Q;  3H09 A;  3W3A A;  1E2W A;  2E2H B;  3HOU H;  4I7A A;  3NSW A;  2A74 C;  1Q86 C;  1DD2 A;  3NBI A;  4A3K G;  4GLA C;  1S5C D;  1M4V A;  4GKJ Q;  2WB1 B;  1QG7 A;  4A3E H;  1U4R A;  1XXG A;  5C4Z A;  3SE0 A;  1NMF A;  4I7Z C;  1HNW L;  2KHJ A;  5COR A;  2F3I A;  4HR7 B;  4X66 Q;  2F0W A;  5FKA C;  1EFW A;  3PIP A;  3A55 A;  1ESR A;  2DNE A;  2RKS A;  4HCS A;  1PVO A;  1KRT A;  3HG9 A;  1I3Q H;  1AH9 A;  1WD0 A;  1TWC B;  2DGY A;  5GAH C;  4JI8 L;  2CW0 C;  1PYB A;  3OPO A;  5IT9 L;  5L37 A;  4DFA A;  1HZC A;  2VQE Q;  4DV7 L;  4CHT B;  1VF7 A;  1AEX A;  2WII B;  4BBS B;  1XX8 A;  4DV5 L;  2EXZ A;  4IUP A;  2MGS A;  4EQO A;  2OXP A;  4J1M A;  4JV5 L;  2ALY B;  1PFS A;  4DV3 L;  5IGF A;  3PF5 A;  3UE1 A;  2QCP X;  4JW0 A;  1IBM Q;  1LTG D;  2KBN A;  3CCR A;  1NMG A;  3NTH A;  3MEF A;  2JN4 A;  3CQZ B;  4OWT B;  1DON A;  3OOC A;  3GTP B;  3J81 L;  2ZXP A;  3T51 B;  1N33 L;  3G6E A;  4BY1 B;  1F2M A;  1TS5 A;  2F0Q A;  2SOB A;  3V96 A;  2EY1 A;  1KTK A;  1YIT A;  2E2J B;  4MTK A;  3CCV A;  1JJ2 A;  4KN4 C;  4B9W A;  4LFA L;  4NW2 A;  1GUN A;  2H1E A;  1E1O A;  1K8O A;  3H3V I;  2DY7 A;  1A3V A;  4KHZ A;  5C44 G;  3HFZ B;  4NB3 A;  3W2D A;  2PMZ E;  2JA5 G;  5LMU Q;  4A4I A;  2IHF A;  1V43 A;  1JQY D;  3S1M B;  2PO4 A;  4IFD G;  4DR1 Q;  1VS0 A;  1NAP A;  4DR7 Q;  4K5V A;  1EL0 A;  1ESF A;  2E5L Q;  1QZG A;  3SK5 A;  1NCV A;  1TII D;  3NWS A;  1FNW A;  5IGB A;  4KLK A;  3KFU A;  3OMC A;  1LO5 D;  3I56 A;  2SNS A;  2MUY A;  1EEF D;  4O0A A;  1K28 A;  1KHI A;  3ERS X;  1STY A;  5C4H A;  3ERO A;  1X3P A;  4JVZ A;  4LUZ A;  5EGT A;  1JC7 A;  4FXK C;  1XMO Q;  1K8G A;  3M4Q A;  1CKM A;  2K5Q A;  1EYD A;  2J7Z A;  1X3G A;  4GN5 A;  1NY4 A;  5HGT A;  2PQA B;  2R93 G;  1ZYR D;  4HJ8 A;  1F9R A;  1HNZ L;  3HOY B;  4A3K H;  4BBS G;  3LX0 A;  1LUZ A;  3K7A H;  2LXJ A;  4DV1 L;  1EUJ A;  2XWB B;  3LWU A;  4A3G B;  4G57 A;  1QE6 A;  3PIO A;  2ZTC A;  4XIG S;  1DXM A;  1E2V A;  1I5F A;  1FNV A;  2MFI A;  3DM1 A;  3OMG A;  3GTL B;  4EQP A;  4LF8 Q;  3GV6 A;  2JXM B;  1A6X A;  4ILW A;  4HIK A;  3D6W A;  1ENA A;  2EOT A;  1HCZ A;  2B8F A;  4JPB W;  4DR4 L;  4LUV A;  2M2L A;  4K14 A;  2VNU D;  4BY1 G;  5G3L F;  1Y8N B;  5LHY 1;  1F77 A;  4YWK A;  4ZAI A;  1BR9 A;  1CSQ A;  2WB1 E;  2XSC A;  3D6C A;  1CUK A;  2Z6K A;  2VZA A;  3IKJ A;  1E3P A;  3EQL C;  1VQ8 A;  2K28 A;  3F2U A;  3SVM A;  1S40 A;  1GUS A;  2AUK A;  1PH1 A;  1S72 A;  1U4P A;  5C0X G;  5JJI A;  3VYT A;  1Y8P B;  4K8J A;  1RJT A;  5C3X A;  2PNH A;  3D31 A;  2NN6 H;  1GOZ A;  3GTJ H;  2VQF L;  1B7Y B;  4O2D A;  2K75 A;  5CMD A;  1NR4 A;  5IOC A;  1G2T A;  4H44 C;  1DCZ A;  1EY5 A;  2EYM A;  4K6D A;  1D5M C;  5KEE A;  2Q2U A;  4HMJ A;  1YI2 A;  4FDB A;  2B29 A;  1XWE A;  4U68 A;  2LY7 A;  1UE5 A;  3VDY A;  2EJF C;  1J5E Q;  3STB D;  1SN8 A;  3J80 L;  2HD3 A;  5C4J B;  4LFC L;  3TZD A;  5C44 H;  1W3S A;  5C0X J;  4GNX C;  2ES2 A;  1D6E C;  3RZD H;  2JA5 H;  3FEW X;  4R4O A;  4KN7 C;  3NBH B;  1VQD A;  4L5Q A;  5CR3 A;  5I9O A;  4IFD H;  1OO9 B;  1H9R A;  2XIW A;  4OEM B;  2QDB A;  3CRL C;  5FLM G;  1D8L A;  4B3M L;  4GKK L;  3DWP A;  3NHH A;  1MSH A;  1I94 Q;  1JIC A;  1IXR A;  1FD7 D;  1V8Q A;  3D0F A;  4LF9 Q;  3I4L A;  4GOP C;  3HZX A;  2CFM A;  4AQY L;  3KBG A;  1Y1V B;  1I4Q A;  1VQF A;  5DLQ E;  2HDM A;  1ZXT A;  4UP7 A;  1EQV A;  3HOW B;  1MGS A;  1IL2 A;  1EYA A;  5FLX E;  1SNQ A;  3PUW A;  5CV9 A;  1EY8 A;  4HSV A;  3CC4 A;  3M85 A;  2R93 H;  1PZI D;  1X56 A;  1AE3 A;  4N9P A;  4BBS H;  2L12 A;  5GAG C;  1GHK A;  3CRK C;  3D8G A;  3TP8 A;  2FJ2 A;  1H9J A;  1KDC A;  1EWH A;  3MXP A;  4KY7 A;  4MZ9 A;  5LMN W;  4P74 A;  3S15 H;  4A3L G;  1A15 A;  3IFT A;  5KNC A;  1YHQ A;  2RDH A;  2UXD L;  1FJG L;  3X3N A;  3NP8 A;  4K6L A;  1UEA B;  5M5W B;  3T1Y L;  3UDI A;  2WV6 D;  4KD3 A;  5LL6 S;  4BY1 H;  1XNR L;  2AQ1 B;  3BVG A;  3TP5 A;  2NN6 I;  1VQG A;  1F9S A;  3J7Z C;  3BDL A;  3IRB A;  1T5E A;  1WTW A;  1S4Z A;  3L7Z C;  4AYB G;  1BBW A;  1PH5 A;  1SE2 A;  3PO2 B;  2D5D A;  1YIJ A;  3VR3 A;  5EPL A;  5I6W A;  2BCO A;  5E4W C;  4DR2 Q;  5C0X H;  1Y14 B;  2R92 G;  2OEO A;  1QZH A;  5CV4 A;  1N32 L;  1SAP A;  1HH2 P;  4JI4 L;  4CBV A;  3GQB A;  1LTA D;  3IFD A;  3M4Y A;  4DR3 Q;  4G4K A;  4JBW A;  1SYD A;  1JWU D;  1Y1W G;  4RCN A;  1WVL A;  2IWH A;  1PH3 A;  3A8I E;  3NUC A;  3HOV B;  3A5U A;  2R7Z G;  3HOU B;  3A0J A;  5M3M G;  1X3F A;  4IFD I;  3OTO Q;  5EKK A;  3K59 A;  4IUQ A;  2I46 A;  1SYE A;  4X64 L;  4A3E B;  1ENF A;  3W1G A;  2SDF A;  4DN4 M;  1S3O A;  3OIQ A;  3G6J B;  3KF8 B;  3HOW G;  1EYG A;  1SMY C;  2IW3 A;  4DR6 Q;  2EYJ A;  1CKN B;  4DA2 A;  2A69 D;  4OX9 Q;  2GVA A;  3A56 A;  3HKZ B;  1SXT A;  4FXG C;  1SRU A;  3F1Z A;  2WIN B;  1QIL A;  3DM3 A;  1IZ6 A;  4DUZ L;  4XDX A;  5FLM H;  3CAM A;  2QEJ C;  3GTM B;  1CHQ D;  3RLO A;  2AKW B;  1PH2 A;  1S5F D;  5I6Y A;  1SYG A;  3P7J A;  5K36 G;  5LL6 X;  4X65 Q;  3I4M H;  1U4L A;  4ZQ3 A;  3ND9 A;  1H95 A;  3TS2 A;  3GTL H;  4DAV A;  3PQI A;  2RQX A;  1PMR A;  3W1B A;  3MAQ A;  2O4X A;  2F0E A;  2KHS A;  2F0I A;  1NJI C;  3VYS A;  5CGK A;  1EIH A;  1EZ8 A;  3GTO H;  4JI2 L;  1U5K A;  5IYC G;  1VQN A;  3P75 A;  1I4X A;  2BA1 A;  3AYH B;  5DEH A;  4YWM A;  1WYD A;  3KK7 A;  3O13 A;  4IPD A;  2EJG C;  1G29 1;  2R6G A;  3NEN A;  1MJE A;  2KQ3 A;  4KHV A;  2CKZ B;  1GD7 A;  4KKT A;  5HUR A;  2K50 A;  1M90 C;  3I4O A;  2F0J A;  3RUZ A;  2UUA L;  3OWF A;  1SE8 A;  1VQC A;  2RSN A;  3CF5 A;  1V1P B;  4A3L H;  2CVR A;  4K0K Q;  3L2P A;  1LM0 A;  1WTR A;  3JAM i;  5C0X I;  4ME3 A;  1ASY A;  4JI0 Q;  2H5X A;  4YHH L;  3E0E A;  2ZXR A;  1SJE D;  1PH4 A;  1FGU A;  2DN8 A;  1I4R A;  2FFK B;  1LV9 A;  1Q1B A;  1VQI A;  2ICI A;  1STB A;  2IHE A;  4IN3 A;  4OHJ A;  1TU2 B;  1BO0 A;  1T9H A;  3KJP A;  4WJW A;  3K7U C;  4GNX B;  2R92 H;  2A1A A;  3K5O A;  3LWE A;  3S2D H;  3S14 B;  3OW7 A;  1HZB A;  2L11 A;  3U9O A;  2BH8 A;  1BCP C;  2A6H C;  5D3I B;  1AZP A;  4KHP L;  4IPG A;  2PW7 A;  2KCC A;  3NTI A;  4HTH A;  4IQZ A;  1Y1W H;  4RAU C;  5AJ3 Q;  1EFI D;  1Q3L A;  4IZ8 A;  3DWA A;  4YCW A;  1BOS A;  2EY6 A;  4CDF C;  1WFQ A;  3NTK A;  4GOP B;  1JB7 A;  1Q12 A;  3MTS A;  2I5H A;  1K0R A;  1DOK A;  2R7Z H;  3IL8 A;  5M3M H;  1D1I A;  1C8C A;  4A3K B;  3V05 A;  4XQN A;  1PRT C;  3K7A B;  1VQM A;  1STG A;  1EY0 A;  1SND A;  1VQB A;  1LAC A;  4JI1 Q;  1Q1E A;  1E7Z A;  1A2T A;  2A68 D;  4PV1 C;  3HOW H;  1IYU A;  1QWY A;  1O7L A;  1SSO A;  1T5X D;  4JOI A;  1IW7 C;  3VYR A;  4JI7 L;  4GN4 B;  2WAC A;  1WJJ A;  2EYH A;  2I5M X;  3I4N B;  4XT1 B;  3CW2 C;  4P75 A;  1HPC A;  3L3O C;  3NWT A;  3BU2 A;  2I07 B;  1VQ5 A;  1HJP A;  2F0F A;  3IAY A;  3ZYY X;  4KY6 A;  5KYI A;  2UU9 Q;  3URY A;  1ML0 D;  2IT1 A;  5K36 H;  3CME A;  3OHX C;  4JI3 L;  4P71 A;  1FNU A;  2PPB C;  2F0S A;  2ATW A;  4LJZ C;  2JA6 G;  1LYL A;  5IGD A;  3U9S A;  2OWO A;  3HKZ E;  5FLX c;  4PMW A;  2IX1 A;  2F0T A;  2EDG A;  4IOC A;  4IUN A;  2JSO A;  1FR3 A;  3F2B A;  2JA7 B;  2G9D A;  3KYH C;  4DV6 L;  4Z9C B;  5IYC H;  4YY3 L;  1C0A A;  4HED A;  2B2V C;  2JE6 I;  2OT2 A;  1V1Q A;  3SR1 A;  2CW0 D;  1ICF B;  5T1I A;  3QJY A;  2Z0S A;  5ELC A;  1E1T A;  4XTC S;  1MIU A;  1L0X B;  1KQS A;  2Q2I A;  3BDO A;  1AFP A;  3G4S A;  2KED A;  3N6R A;  3P20 A;  4P2C B;  1D5X C;  1KXL A;  2OQK A;  1Z7T A;  1SNP A;  1X65 A;  2CH4 W;  1HR0 W;  4MIU A;  3SK8 A;  5C44 B;  2F3V A;  1H9S A;  4X62 Q;  2QEX A;  3U58 A;  3RZD B;  5JJZ A;  1HQR D;  4JOI C;  2EYO A;  3K58 A;  4N8F A;  1I50 H;  3ZJY C;  4ZKB B;  1CQV A;  2F0M A;  1RD9 D;  3NQI A;  1L1O C;  4LF7 Q;  4DF7 A;  5CV7 A;  1RTN A;  3X3M A;  5JOB A;  1CA6 A;  4QMG A;  1CA5 A;  4XT3 B;  3QO2 A;  1U9R A;  1PA6 A;  2NZ1 D;  4YIJ A;  2RCF A;  1XMQ Q;  1XTD A;  2A19 A;  4LF4 Q;  3S24 A;  1HHV A;  4DV4 L;  4HJA A;  1YJ9 A;  2F4V Q;  3AB9 A;  2HCI A;  1HZA A;  1IBK L;  2XGT A;  4IPC A;  1SE4 A;  1RF2 D;  3PIP 3;  3Q23 A;  4LFB L;  3I4N G;  3WOF A;  2MP1 A;  4DV0 Q;  1BUV T;  2Q2T A;  4LWC A;  3ER0 A;  3KUP A;  1STA A;  5IE8 A;  3GTM H;  1OXX K;  1Q7Y C;  3RN2 A;  1EEI D;  2R93 B;  2NZO A;  5I4D A;  2UUC L;  2A6E D;  3I90 A;  3T1H Q;  4PZ6 A;  4NMZ A;  2EY5 A;  3NEL A;  1MBY A;  4R4Q A;  3KDF A;  2A73 B;  4RMF A;  4HMI A;  2JQO A;  3EJI A;  3QB3 A;  5IIF A;  3RR5 A;  4QJF A;  2VW9 A;  2NN6 G;  2EYP A;  2JA7 G;  3S15 B;  4JBK A;  3BZK A;  5LMN Q;  4N9T A;  3I91 A;  4RH6 A;  4R4I A;  1X54 A;  4LUO A;  3TDQ A;  1MD2 D;  2ICE C;  4HSP A;  1ET6 A;  2PI2 E;  2E8G A;  1VF5 C;  4CJ2 C;  4LNQ A;  1HUM A;  2K7V A;  2QGQ A;  3FP9 A;  1N34 L;  3V2T A;  1AE2 A;  1TKW B;  1Q90 A;  3J7Y W;  4TRD A;  3QWN A;  3K81 C;  2B2W A;  4RA8 A;  4A3J G;  5K5P A;  1KAB A;  4N8X 1;  4CKE A;  2MQH A;  1S5D D;  5BN3 A;  3CCL A;  4A3I B;  2ZM6 Q;  4X6A H;  4QL5 A;  1CTM A;  4AH6 A;  2JA6 H;  1L0W A;  1B3Q A;  5DM6 3;  4MN3 A;  4DK3 C;  3MXU A;  2YTY A;  2BDN A;  4M1U B;  5E7N A;  2ZTE A;  4DAY B;  3D4D A;  3JAM E;  4LF6 Q;  1TWF H;  1VQJ A;  4A3C G;  1LTL A;  3K5M A;  3U4V A;  1PHJ A;  1GUT A;  4RFB A;  4FNF A;  1AZQ A;  2EY2 A;  3VR6 A;  1SFO B;  2D0P A;  1BCP B;  3S14 H;  4EVO A;  5IGC A;  2B3G A;  3I3C A;  4RGO S;  3PGZ A;  1HNW Q;  4HJ5 A;  1DOM A;  3EN2 A;  3RLN A;  1HUN A;  1YNX A;  1VQ7 A;  2B2U A;  1SYC A;  4A3D H;  1JJC B;  4JCV E;  4PZ8 A;  5IYD H;  2HIX A;  1QVF A;  3KJO A;  4L5T A;  3F2C A;  1W2B A;  1M8A A;  2K05 A;  2MNA A;  1N9W A;  4FF3 A;  4FF1 A;  3R3O A;  4K2K A;  4L6T B;  4JI5 L;  4JI8 Q;  2UUB L;  1DYQ A;  1G2S A;  1VQ9 A;  4S3S A;  4QQB X;  1PRT B;  1VCI A;  4DV7 Q;  2B2W C;  1OXU A;  1SYB A;  3GP7 A;  4DNI A;  4JBM A;  3PIO 3;  2QKI C;  4DV5 Q;  2X6L A;  3VA7 A;  4LMQ D;  1QJO A;  3I4M B;  1SNM A;  1NUC A;  1X32 A;  3L0O A;  1K8A C;  4JV5 Q;  4GN3 B;  1X3Q A;  4A75 A;  4DV3 Q;  5M3F G;  3MXG A;  1XPO A;  2QA4 A;  2AHO B;  2JJQ A;  1U0L A;  2N49 A;  1GHJ A;  1UE6 A;  1I6H B;  3CCS A;  2O5I C;  1LLR D;  3AEV A;  1ROD A;  3KBX A;  5KGU A;  3I4N H;  1PDQ A;  3GTO B;  5EBD A;  4F87 A;  5ELB A;  1N33 Q;  1X55 A;  4IUR A;  4KD4 A;  4BA2 I;  1EIY B;  1WCM G;  1CQF A;  3WDN A;  2A5H A;  3AFP A;  4A3I G;  2IX0 A;  3GTG H;  1TXY A;  4LFA Q;  1JE4 A;  1CHP D;  1ZKO A;  3DLL A;  4L63 B;  5E1F A;  3EFX D;  1PTO C;  4H0L C;  5EKI A;  2AQ2 B;  5FLX L;  4DU9 A;  1UE1 A;  2PNR C;  2JA7 H;  2B2U C;  2CCZ A;  4WJ3 M;  1IKM A;  1IYV A;  2F0H A;  2VXW A;  2XRQ D;  2Z8L A;  2X6G A;  1YNJ D;  2IY5 B;  2KCN A;  3OIP A;  4E6I A;  3HOZ G;  4HIO A;  2HUG A;  4K5W A;  4XQJ A;  1JOK A;  1HNX L;  3S16 H;  4BS9 A;  4A3J H;  5GRO A;  4JYA L;  2L1B A;  4AYB B;  1FL0 A;  1LT5 D;  2K5W A;  3ULJ A;  3S1R H;  2B2Y A;  5H1S E;  4ZYS A;  4DV2 L;  2UXC L;  2L5T A;  5ELO A;  2HQE A;  2L4N A;  1WTH A;  2R92 B;  3GTQ B;  2K5N A;  2DJG C;  3SDZ A;  3S2D B;  1PH7 A;  3K0X A;  1HRJ A;  1B3A A;  1HR0 L;  2PQE A;  1G91 A;  1STN A;  2YTV A;  4R9W A;  3OSO A;  4L5R C;  4XYQ A;  3PF4 A;  2MO1 A;  4FVM A;  1Y1W B;  1HNZ Q;  4A3C H;  1W6K A;  2Z6K C;  3JC6 6;  4DV1 Q;  2G5D A;  1A62 A;  2R7Z B;  5IWA L;  3I4M G;  1RTO A;  1QUQ B;  3FVQ A;  5M3M B;  1K3B C;  5KIX A;  2F0P A;  1YBY A;  3A8K E;  3FKI B;  4HJ7 A;  4A3B G;  5J3B A;  1HTP A;  2PCF B;  4KKU A;  4IUT A;  3EVQ A;  2WFW A;  2MPM A;  1IBL L;  4J8Q A;  1IHZ A;  4FYD A;  3Q0A A;  5DNF A;  1U4M A;  5IY0 A;  4TKO B;  4DUY L;  5JPN C;  4O42 A;  3RLF A;  2AQ3 B;  4DR4 Q;  4X3T A;  4QY7 A;  4A3M H;  2K03 A;  1ICW A;  1TR5 A;  3NXW A;  1XNQ L;  1R4Q B;  4DR5 L;  3RZO H;  1ENC A;  1RIP A;  2WAQ G;  2JK8 A;  4NP5 A;  3TP6 A;  4B3T L;  2FXQ A;  3MXN B;  3DWQ A;  2RDF A;  4QGU A;  2R7F A;  2C35 B;  1BBX C;  1QNK A;  1EQR A;  2Q8T A;  1UAP A;  5CV5 A;  3FRP B;  2J0T D;  4C1N I;  5IP9 G;  3HGB A;  4B3R L;  3S1N H;  1NTG A;  1K83 B;  3ICE A;  1LTR D;  3KF6 B;  2OQ0 A;  1STH A;  1TWG H;  5M3F H;  2NTT A;  4Q0F A;  4JBJ A;  4C3J G;  5KNB A;  2NVY H;  2VQF Q;  4YWL A;  1GXD C;  5I2X A;  1RKN A;  1D7Q A;  4XYO A;  4A76 A;  1XTC D;  1G6Z A;  3BZC A;  3A8J E;  3N52 A;  3DEP A;  4M8A A;  3VR2 A;  1SJH D;  4DGZ A;  1WCM H;  3UE0 A;  3S1Q H;  2K32 A;  4UAI A;  4A3I H;  1UNS A;  1YNN C;  3I7F A;  3KLS A;  1UE7 A;  2F52 A;  2RF4 A;  2VB3 X;  5IGE A;  1F2Y A;  5CC4 A;  3MC0 B;  2IL8 A;  2JA8 B;  4GLV B;  4OIJ A;  4LFC Q;  1HA6 A;  5EKL A;  4R4C A;  3M7N A;  1JWS D;  4PG3 A;  1VDZ A;  5BN4 A;  4LF5 L;  4F8M A;  1DOL A;  5BR8 L;  1IKL A;  2EYF A;  5M5X H;  1B4O A;  5C3E G;  1K3R A;  3E6Z X;  2ZTD A;  1LAB A;  2CWP A;  3HOZ H;  4B3M Q;  1I50 B;  4GKK Q;  2K52 A;  3A7L A;  1PFM A;  4OEL B;  1SFO H;  1JE5 A;  3FKI G;  4FF4 A;  1HTL D;  4C2M H;  2YTX A;  4OL7 A;  2K5H A;  2QDL A;  4Y7N H;  3HS0 C;  4AQY Q;  4X3S A;  3CPF A;  2CHB D;  1WD1 A;  4IO9 A;  3OW2 A;  2IPK D;  1EY4 A;  3JAM c;  3M4O H;  4JI6 L;  4C3H B;  3I8Z A;  4GLX A;  1EZ6 A;  2M00 A;  4NXN L;  5A35 A;  4HID A;  3FHW A;  1GUO A;  4EQN A;  1YHB A;  2ZT9 C;  4KTA A;  1HFG A;  3RN5 A;  4AYB E;  3I70 A;  4KV6 A;  2Z9H A;  2FIN B;  3K6O A;  1I6V C;  4B3S L;  1P8L A;  1CI3 M;  1EYC A;  2F0U A;  5EJW A;  2CWA A;  4POG A;  4A3B H;  1OTC A;  2E74 C;  4H7B A;  2OCE A;  4G7Z C;  2RHS B;  1PFB A;  3K5L A;  1I6H H;  4RGM A;  1BCP D;  1HXY D;  4POF A;  1SNC A;  1A8V A;  3HEJ A;  4RKL A;  2UXD Q;  1FJG Q;  2PZU A;  3AU7 A;  2Q8R E;  1XYI A;  3A5Z B;  1AP0 A;  3T1Y Q;  1XNR Q;  3MFY A;  5AFW A;  4CKB A;  3VR5 A;  2L9H A;  1VQH A;  1PYW D;  3GV3 A;  4EQ5 A;  1JB3 A;  1BBU A;  3E0J A;  1CZG A;  2RCN A;  1PRT D;  3VR4 A;  2B63 G;  5HY6 A;  5FO9 B;  3GTK H;  2JA8 G;  2K6A A;  1PTO B;  1MJC A;  3K0Y A;  1J8I A;  3FPU B;  1QCB D;  5IP9 H;  2XRS D;  1N32 Q;  2KCM A;  1CKO A;  1RL2 A;  3J81 c;  4JI4 Q;  4WRD A;  1J9O A;  1R4P B;  2JA6 B;  1H9M A;  5E4X A;  1NNX A;  1EY9 A;  3CMA A;  4C3J H;  2N55 A;  4OXP A;  1Q81 C;  1PH6 A;  5C4X G;  1IW7 D;  5ELE A;  4A93 G;  2PQA A;  5BR8 Q;  3I2Z A;  1NR2 A;  4U67 3;  3F8T A;  4JC0 A;  3M7G A;  2CH4 A;  2WP8 J;  2L55 A;  1TWF B;  2V1C C;  1A3T A;  1MSG A;  4ZKC B;  1SR3 A;  1SRO A;  1A0I A;  1GUW A;  2A69 C;  4CDC C;  1KAW A;  4X64 Q;  3GTQ H;  3CCQ A;  3SHL A;  1SYF A;  4C3H G;  5ELD A;  3Q6S A;  4LW1 A;  4DK0 A;  3MA2 B;  4GS3 A;  1DM0 B;  1XJV A;  4A3D B;  3MZ5 A;  3NQT A;  4IUU A;  3BVZ A;  5C3E H;  2FMC A;  4DUZ Q;  5IP7 H;  2UXB L;  5KYL A;  2E2D C;  3TS0 A;  2JEA I;  2L15 A;  3UDF A;  1B9N A;  2H4O A;  3Q24 A;  2XWJ B;  1YVC A;  3FKI H;  4Y52 H;  3PMF A;  4PMC A;  3FDT A;  4B08 A;  3ERQ A;  2VY3 A;  5ISR A;  1BXT A;  3H0G G;  2NVT H;  1IYJ B;  1N36 L;  2XTI A;  1PXU A;  4QIW B;  5D14 A;  4FF2 A;  1D1K A;  3J81 i;  1R9T H;  5FK9 C;  4DXF A;  1B8A A;  1PH8 A;  2RDG A;  4JI2 Q;  4GKJ L;  3H15 A;  4KJO A;  1VQA A;  1ET9 A;  1ZEQ X;  2R3Z A;  1YHA A;  5EAY A;  2NUC A;  2XN9 C;  4R1J A;  2GN5 A;  4CKC A;  3KLS X;  5GAE C;  4BXX G;  4X66 L;  5JJL A;  2VUM B;  2F0D A;  4PNY A;  2NBF A;  3GTG B;  4KY5 A;  3J81 j;  5FJ8 G;  2UUA Q;  1K83 H;  1KD1 C;  4P72 A;  3NBH A;  1WTO A;  1K9M C;  4IOA A;  1Y69 U;  3K8A A;  2JP1 A;  2KJX A;  2VQE L;  4RKB A;  2FHT A;  2JEB I;  1PFN A;  1II3 A;  1QNU A;  4YHH Q;  1VQE A;  3HOX B;  1NBW A;  1OXT A;  3I73 A;  4DNR B;  1QUQ A;  1Y8O B;  1Q8K A;  2BE5 C;  2TSS A;  1IBM L;  4APV A;  4C3I H;  2RA4 A;  3S16 B;  4A3J B;  2B63 H;  2K01 A;  1TS3 A;  2JA8 H;  1I4G A;  1LTI D;  4CJ0 B;  3S1R B;  1KAA A;  1O78 A;  3A74 A;  1S5B D;  4G7O C;  4P73 A;  4OON A;  1STE A;  4KHP Q;  4A3D G;  3T13 A;  2HIV A;  3WWV A;  5IYD G;  4IUV A;  4QUF A;  3DUZ A;  2D62 A;  5C4X H;  2F4I A;  1VMC A;  4A93 H;  5T1G A;  3SXH A;  4IAL A;  2D9U A;  4JK1 C;  1X6O A;  3MXN A;  4JG2 A;  1EIF A;  4DKA C;  4ZLT F;  3BS1 A;  3NEM A;  4O1N A;  2A68 C;  5A2Q E;  2PYK A;  4UP9 A;  5LMU L;  1JWM D;  4R4T A;  2VS1 A;  3KF6 A;  1DGS A;  4DR1 L;  1BQQ T;  1PV4 A;  4DR7 L;  1B1Z A;  2EPB A;  4C3H H;  2E5L L;  3ND8 A;  3GO5 A;  3JAM L;  3Q8D A;  3S17 H;  2NVQ H;  4QB4 A;  2HHH L;  3CXC A;  3GD7 A;  3L9A X;  4JI7 Q;  4QUC A;  4BY7 G;  3K80 C;  3TBI B;  4A3M B;  3D4R A;  1B53 A;  1V1O A;  1UUP A;  4FP5 D;  2Y0S B;  1OXS C;  2VUM G;  5F2D A;  3RZO B;  3TRE A;  5M5Y H;  3M3Y H;  2N8N A;  5BN5 A;  1O7I A;  2OTL A;  1EQT A;  1XMO L;  2I5L X;  4JI3 Q;  4KK7 A;  1JOR A;  3R8B A;  2PZW A;  3CCE A;  2NVX B;  3H0G H;  3S1N B;  2EIF A;  1BVS A;  3FPP A;  1WOC A;  3U4Z A;  3DHQ A;  1CT1 D;  2Z1C A;  5M3F B;  1TWG B;  3LGJ A;  1W6J A;  3E3X A;  3HOX G;  2XNA C;  2NVY B;  3A54 A;  5COY A;  3HKS A;  4DV6 Q;  4YY3 Q;  2YU9 H;  1EY6 A;  4WJ4 A;  3TP7 A;  4XQQ A;  4R8N A;  2F1M A;  2K5V A;  4BBR G;  1TWA H;  3J80 i;  2EE1 A;  3F2D A;  1WTX A;  4LF8 L;  3OYY A;  1KDB A;  1PTO H;  4BXX H;  1WCM B;  2GVB A;  2LKV A;  1TY2 A;  3ONA B;  3S1Q B;  3KF8 A;  4QIW E;  3E5S A;  1D5Z C;  5FJ8 H;  4ABN A;  1C7Y A;  2B39 A;  1CKN A;  2SEB D;  2D2C C;  2F3W A;  2O2L D;  3PCO B;  2RVL A;  3G48 A;  4OGQ C;  1ILP A;  4PQX A;  1AN8 A;  5J22 A;  5ELF A;  2DNC A;  3R2T A;  2ENB A;  2N88 A;  5M5X B;  3BG3 A;  3J7A F;  1TWH H;  3R93 A;  1E0B A;  1YZ6 A;  3BZD B;  4NXM L;  2HQL A;  2EXD A;  5J39 A;  1KIX A;  3H3V C;  5D3D A;  5J1Z A;  3PO3 G;  3HOZ B;  1K8M A;  1NE3 A;  1V9P A;  3BVM A;  3CPW A;  1F9P A;  2BA0 A;  4C2M B;  1BCP F;  4KKS A;  4AIM A;  4UDU C;  4RG1 A;  4Y7N B;  3SEB A;  1BDO A;  3TN2 A;  1TY0 A;  4DV4 Q;  4DAP A;  1IBK Q;  1PTO D;  1VMP A;  2B8G A;  2NYZ D;  3AQQ A;  4I65 A;  4LFB Q;  2WB1 G;  1S5E D;  3M4O B;  2HHH Q;  4A3M G;  2A6E C;  2HDL A;  5IT9 E;  4UPA A;  2Y0S G;  3C46 A;  1L2F A;  4PMB A;  1BKB A;  4J15 A;  1PRT F;  1J5E L;  3E9H A;  2UUC Q;  1XPU A;  3VA5 A;  3UDX A;  1DJR D;  4NKL A;  1GM5 A;  2A8V A;  1EWI A;  3ULL A;  1V1P A;  3QG1 A;  4RGN A;  4A3B B;  4QF4 A;  1I4H A;  1YJN A;  1VQP A;  4IFD J;  5FO8 B;  3C2P A;  1I94 L;  2KEE A;  5JPM C;  2NB0 A;  4NDX A;  3T4A C;  1SEB D;  3J81 E;  4EX5 A;  4LF9 L;  4BY7 H;  2LS0 1;  5C5L A;  5C5M A;  3WOE A;  1N34 Q;  2CQO A;  3QIA A;  4TQU S;  2WKC A;  1JCK B;  1PZK D;  2VUM H;  1HZ9 A;  1LTB D;  3MVV A;  4GNX A;  2DJF C;  2WAQ B;  1SDF A;  3SK6 A;  5M9O A;  3S2H B;  2K14 A;  1GO3 E;  3GTK B;  4K5X A;  4ID6 A;  3HP3 A;  4FXD A;  4ME5 A;  1ILQ A;  1O7Z A;  1RDP D;  5EPK A;  4PZ7 A;  3TQY A;  4C3J B;  3HOX H;  2Y0S E;  2PI2 A;  2E2I H;  1YEZ A;  3BYY B;  5E3F A;  2NZH A;  1EU3 A;  4GOP A;  4DXG A;  3PV0 A;  4KI0 A;  3KLR A;  4QCL A;  4NXM Q;  3CKI B;  1X9N A;  4BBR H;  2MHV A;  3MHB A;  4CDE C;  1Q8I A;  1J6Q A;  4HN7 A;  3D4W A;  2BOS A;  2KEN A;  1C9O A;  1JJG A;  2F0K A;  4K2L A;  1KNE A;  1C4Q A;  4YCV A;  3C3L A;  1G51 A;  2LFN A;  3U50 C;  4ZK9 B;  2F0G A;  1KC8 C;  1QVC A;  1BNZ A;  1ZYR C;  2K33 A;  4CDD C;  2VB2 X;  3M4P A;  1DZ1 A;  2EJM A;  2KEC A;  2R61 A;  1PZJ D;  1L1O B;  4HJ9 A;  4JI5 Q;  4DR2 L;  1K73 C;  2UUB Q;  2F0O A;  5C3E B;  5CV6 A;  5EQ0 A;  2LXK A;  3CCU A;  3B6Y A;  3PO3 H;  2PW5 A;  3I72 A;  5IYB G;  1YNN D;  4MHE A;  1MKH A;  3C1F A;  4B9X A;  4DR3 L;  2B2T A;  5DM7 3;  2N78 A;  5DAU A;  2MJ8 A;  2E2H H;  2KOL A;  3C1E A;  3HOY G;  1Z6H A;  2OTJ A;  2NVT B;  1TVX A;  1CFM A;  2I0Q A;  1B2T A;  3CP0 A;  2L0C A;  3RNU A;  2CQA A;  5CBE E;  3CCJ A;  4OIK A;  1R9T B;  4A3G G;  3OTO L;  3I55 A;  4WOR A;  3PUV A;  4IJL A;  1E22 A;  2KUM A;  4LK1 C;  4FO2 A;  1LTS D;  3CCM A;  1TT2 A;  3K5N A;  3MWY W;  1O80 A;  3K57 A;  3QR8 A;  2Z4H A;  4DR6 L;  1L0Y B;  4ZRZ A;  1CK1 A;  4OX9 L;  3ULP A;  1KNA A;  4RHS A;  2NVX H;  1TWC H;  5EPJ A;  3UDG A;  2B2Y C;  3HRZ C;  1ASZ A;  1H9S B;  1YNJ C;  4DPG A;  4WFN 3;  1SMY D;  1RHP A;  3Q22 A;  2OF1 A;  2BH2 A;  5ELN A;  5JVH 3;  3BYT B;  2ASB A;  1Z9F A;  2K4K A;  4BWG B;  4X65 L;  2LSS A;  3VYU A;  4L5S A;  1GJX A;  2Q2H A;  3STB C;  2AWN A;  2K5D A;  1F2L A;  3MFG A;  1HNX Q;  2XVS A;  3PUY A;  2X69 A;  4DK6 C;  4JYA Q;  5C3W A;  1RCV D;  1QOH A;  3CQZ H;  3DXJ C;  4X3K A;  3J80 E;  4C3I B;  2BDO A;  2B2T C;  5JAV A;  2B63 B;  3GTP H;  1KDA A;  4DV2 Q;  2UXC Q;  5KRU A;  1MI2 A;  1EIG A;  5I9P A;  1EU4 A;  2E2J H;  4OWW B;  1F9Q A;  5JEA G;  1HR0 Q;  3ITP A;  3EBE A;  1XPR A;  2RHQ B;  3NK9 A;  2IJ0 A;  5C4X B;  3SK4 A;  4A93 B;  5IP7 G;  1WTP A;  2HCC A;  4ZUJ A;  4DNT B;  1SBB B;  2WAQ E;  2QIL A;  4OO1 G;  5TSS A;  1ONL A;  3RMH A;  4K0K L;  3S1M H;  5IWA Q;  3KDF B;  4V0B A;  1MHW C;  1NSN S;  4MTN A;  4JI0 L;  2QW7 A;  1KRS A;  1A2U A;  2EYL A;  5IGG A;  3UI2 A;  1Q82 C;  1IBL Q;  3TSS A;  4C1N K;  4A3F B;  1TS4 A;  4H13 C;  3AMU A;  4HAE A;  3CC2 A;  5C6A A;  2YYZ A;  4DUY Q;  2MO0 A;  4XXE A;  3S17 B;  2NVQ B; 
#chains in the Genus database with same CATH homology
 1YI2 A;  1VQO A;  4R1J A;  3K81 C;  2B29 A;  4FDB A;  1XNQ Q;  2GN5 A;  1Y1V G;  2JA9 A;  5JEA J;  4A3J G;  2MQH A;  3W5O A;  3AFQ A;  4DR5 Q;  2D0O A;  1UE5 A;  5GAE C;  3VDY A;  3CCL A;  4BXX G;  1A63 A;  4X66 L;  5JJL A;  1J5E Q;  4B3T Q;  3STB D;  1SN8 A;  2ZM6 Q;  4X6A H;  4LFC L;  4QL5 A;  5C44 H;  1W3S A;  4AH6 A;  3J81 j;  5C0X J;  5FJ8 G;  1L0W A;  5IYB H;  4GNX C;  2UUA Q;  2JA6 H;  1K83 H;  2ES2 A;  1PYS B;  3RZD H;  4DK3 C;  4P72 A;  1KD1 C;  2ID0 A;  4R4O A;  1VQK A;  2JA5 H;  2YTY A;  4UY8 C;  4B3R Q;  4IJH A;  3NBH B;  1VQD A;  4L5Q A;  5AJ3 L;  2YV5 A;  4YCU A;  1K9M C;  5E7N A;  4IOA A;  5IT9 c;  2ZTE A;  3HOY H;  3K8A A;  4DAY B;  2VQE L;  1GVP A;  5FLM G;  2JEB I;  1D8L A;  4LF6 Q;  2HT1 A;  4B3M L;  4GKK L;  1TWF H;  1VQJ A;  1YJW A;  4A3G H;  1JT8 A;  4YHH Q;  1VQE A;  1N8R C;  1I94 Q;  1IXR A;  4A3C G;  3D0F A;  1LTL A;  3U4V A;  1NBW A;  4LF9 Q;  1PHJ A;  1OXT A;  1QUQ A;  5EAY A;  4GOP C;  2CFM A;  4AQY L;  1Q8K A;  4JI1 L;  4UP8 A;  2D0P A;  1IBM L;  4APV A;  4C3I H;  3S14 H;  3S2H H;  2B63 H;  1VQL A;  1VQF A;  2JA8 H;  2B3G A;  5DLQ E;  1HNW Q;  3PGZ A;  4UP7 A;  4HJ5 A;  3A74 A;  3EN2 A;  3RLN A;  4P73 A;  4OON A;  1YNX A;  1VQ7 A;  1IL2 A;  4A3D H;  1JJC B;  4JCV E;  4A3D G;  4PZ8 A;  3WWV A;  2HIV A;  4KHP Q;  2HIX A;  5IYD H;  3PUW A;  5IYD G;  1QVF A;  3KJO A;  4L5T A;  3F2C A;  1W2B A;  2D62 A;  2MNA A;  5C4X H;  1N9W A;  3PO2 G;  4JI5 L;  3CC4 A;  3M85 A;  4A93 H;  4JI8 Q;  2UUB L;  4LF5 Q;  2R93 H;  1X56 A;  1VQ9 A;  1AE3 A;  4QQB X;  4BBS H;  1FVI A;  3TRZ A;  2UU9 L;  1X6O A;  1VCI A;  5GAG C;  4DV7 Q;  2KHI A;  4JG2 A;  1EIF A;  1OXU A;  4DKA C;  4DNI A;  3NEM A;  4JBM A;  4DV5 Q;  4UP9 A;  1SMX A;  5LMU L;  4R4T A;  2VS1 A;  5LMN W;  4MZ9 A;  5JJK A;  4P74 A;  3S15 H;  3L0O A;  4A3L G;  2AWO A;  1K8A C;  4JV5 Q;  3KF6 A;  4GN3 B;  3G71 A;  1DGS A;  4A75 A;  1YHQ A;  1FJG L;  4DV3 Q;  4DR1 L;  5M3F G;  2UXD L;  1XPO A;  2QA4 A;  2AHO B;  2JJQ A;  3CD6 A;  1U0L A;  1PV4 A;  4A3F G;  2N49 A;  4TVA B;  4DR7 L;  4C3H H;  1UE6 A;  1GKH A;  3CCS A;  3T1Y L;  2E5L L;  3UDI A;  4ALP A;  3HOV G;  1VQ6 A;  3AEV A;  3GO5 A;  3M9B A;  3Q8D A;  1EQQ A;  2EQS A;  1E24 A;  4BY1 H;  3HOU G;  2NVQ H;  3I4N H;  3S17 H;  1XNR L;  3CC7 A;  2HHH L;  3CXC A;  3GD7 A;  4JI6 Q;  2ZJP A;  4H02 A;  4JI7 Q;  2NN6 I;  4BY7 G;  1VQG A;  3K80 C;  5HGQ A;  3J7Z C;  3IRB A;  4NXN Q;  1N33 Q;  1X55 A;  2R7D A;  4A3E G;  3L7Z C;  4AYB G;  4BA2 I;  1BBW A;  1PH5 A;  1EIY B;  1WCM G;  1YIJ A;  1OXS C;  2VUM G;  2DUD A;  3AFP A;  1SLJ A;  5C4J H;  4A3I G;  2IX0 A;  4DR2 Q;  3GTG H;  3TRE A;  5M5Y H;  3M3Y H;  1TXY A;  1Y14 B;  2N8N A;  3GDE A;  4LFA Q;  1O7I A;  2OTL A;  1QZH A;  2R92 G;  1N32 L;  1XMO L;  3HKZ G;  2I5L X;  1HH2 P;  4JI3 Q;  2ZJR A;  4JI4 L;  3DLL A;  4NPS A;  4X62 L;  4B3S Q;  3CCE A;  1QVG A;  2VL6 A;  1KL9 A;  3BJU A;  4DR3 Q;  2Q2U A;  3H0G H;  1UE1 A;  1Z47 A;  1UEB A;  2JA7 H;  2EIF A;  1BVS A;  1WOC A;  4JBW A;  3U4Z A;  2CCZ A;  1Y1W G;  4WJ3 M;  3J7A 5;  1PH3 A;  3LGJ A;  3HOX G;  3TEH B;  2IY5 B;  3HKS A;  4DV6 Q;  4LF7 L;  3HOZ G;  4YY3 Q;  3A5U A;  1UWV A;  4HIO A;  2YU9 H;  2R7Z G;  3A0J A;  4WJ4 A;  5M3M G;  1X3F A;  4IFD I;  3OTO Q;  2K5V A;  5GQO A;  3SGI A;  1HNX L;  3S16 H;  4BBR G;  1Y1V H;  1TWA H;  3KLW A;  4A3J H;  5GRO A;  3J80 i;  3F2D A;  1XMQ L;  4X64 L;  4LF8 L;  4JYA L;  3OYY A;  4LF4 L;  3W1G A;  1FL0 A;  1EOV A;  4BXX H;  1S3O A;  3ULJ A;  1OXV A;  3S1R H;  2F4V L;  2GVB A;  3KF8 B;  5H1S E;  4QIW E;  3HOW G;  1EYG A;  4DV2 L;  2UXC L;  5ELO A;  5FJ8 H;  1C7Y A;  1PH9 A;  2K5N A;  4DR6 Q;  1CKN B;  1CKN A;  2ZJQ A;  4DV0 L;  4OX9 Q;  2GVA A;  1PH7 A;  3K0X A;  1VQ4 A;  3PCO B;  1SRU A;  1HR0 L;  3G48 A;  1JMC A;  2YTV A;  3F1Z A;  4L5R C;  3DM3 A;  1IZ6 A;  4DUZ L;  1L1O A;  5FLM H;  3PF4 A;  2MO1 A;  3CAM A;  3EIV A;  3RLO A;  2AKW B;  4OWX B;  1PH2 A;  1HNZ Q;  4A3C H;  1TWH H;  1YZ6 A;  2Z6K C;  3JC6 6;  4NXM L;  2HQL A;  2EXD A;  4X65 Q;  3T1H L;  1KIX A;  5K36 G;  4DV1 Q;  1P16 A;  1A62 A;  3I4M H;  3PO3 G;  1H95 A;  5IWA L;  3I4M G;  3TS2 A;  1NE3 A;  1V9P A;  1QUQ B;  3GTL H;  1X3E A;  3PUX A;  3CPW A;  3E9I A;  1YBY A;  4HJ7 A;  4A3B G;  2BA0 A;  5J3B A;  5M5W H;  3PUZ A;  3W1B A;  4AIM A;  4RG1 A;  5LMN L;  2WFW A;  1NJI C;  4IPH A;  1IBL L;  3PSI A;  4DAM A;  1WI5 A;  4HIM A;  2N3S A;  4DV4 Q;  3GTO H;  5IY0 A;  1IBK Q;  4JI2 L;  1U5K A;  4DUY L;  5IYC G;  3AQQ A;  1Q46 A;  1VQN A;  3RLF A;  4LFB Q;  2WB1 G;  2BA1 A;  4DR4 Q;  3AYH B;  4QY7 A;  4A3M H;  1G6P A;  4YWM A;  1WYD A;  4A3M G;  2HHH Q;  3PO2 H;  3H3V H;  4IPD A;  1XNQ L;  4UPA A;  2Y0S G;  2R6G A;  1G29 1;  1L2F A;  1B70 B;  1BKB A;  1CSP A;  2KCT A;  3NEN A;  4J15 A;  4DR5 L;  1MJE A;  3RZO H;  1RIP A;  2WAQ G;  4BA1 I;  2JK8 A;  1J5E L;  2CKZ B;  4B3T L;  4MNO A;  2FXQ A;  1GD7 A;  3MXN B;  5GAD C;  2ZM6 L;  4QGU A;  2K50 A;  3E9H A;  3J80 c;  1M90 C;  3I4O A;  2R7F A;  2C35 B;  2UXB Q;  2UUC Q;  1XPU A;  2UUA L;  1EQR A;  3UDX A;  1SE8 A;  1VQC A;  2AMC B;  5IP9 G;  1GM5 A;  2A8V A;  4B3R L;  1EWI A;  3CF5 A;  3S1N H;  3ULL A;  3KOJ A;  1NTG A;  4A3L H;  4K0K Q;  3L2P A;  1M1K C;  1LM0 A;  3ICE A;  3KF6 B;  2OQ0 A;  3JAM i;  1TWG H;  5C0X I;  5M3F H;  4ME3 A;  4JBJ A;  1ASY A;  4JI0 Q;  4A3F H;  2H5X A;  2NVY H;  1VQP A;  1YJN A;  4LF6 L;  3HOV H;  2VQF Q;  1N36 Q;  4OO1 I;  4YWL A;  4IFD J;  3HOU H;  4YHH L;  3E0E A;  1I94 L;  1PH4 A;  1Q86 C;  1FGU A;  4A3K G;  1D7Q A;  4A76 A;  4GLA C;  4EX5 A;  4LF9 L;  4BY7 H;  3BZC A;  4GKJ Q;  1Q1B A;  1VQI A;  4A3E H;  2IHE A;  1N34 Q;  2CQO A;  1WCM H;  3UE0 A;  4TQU S;  1T9H A;  3KJP A;  2VUM H;  3S1Q H;  1HZ9 A;  3K7U C;  4A3I H;  1NMF A;  1HNW L;  4GNX B;  4GNX A;  3I7F A;  2KHJ A;  2R92 H;  2A1A A;  1UE7 A;  2F52 A;  2F3I A;  3S2D H;  2RF4 A;  4X66 Q;  2K14 A;  1HZB A;  2BH8 A;  1GO3 E;  1EFW A;  3PIP A;  4GLV B;  4LFC Q;  4KHP L;  4IPG A;  3M7N A;  4R4C A;  4PG3 A;  1PVO A;  1KRT A;  1I3Q H;  1AH9 A;  2DGY A;  5GAH C;  4JI8 L;  4LF5 L;  1Y1W H;  1PYB A;  5AJ3 Q;  5BR8 L;  5M5X H;  5C3E G;  1HZC A;  4PZ7 A;  1K3R A;  3TQY A;  4YCW A;  2ZTD A;  3HOX H;  2VQE Q;  2Y0S E;  2PI2 A;  4DV7 L;  2E2I H;  2CWP A;  1YEZ A;  1WFQ A;  4GOP B;  4GOP A;  2NZH A;  1Q12 A;  1JB7 A;  2I5H A;  1K0R A;  4B3M Q;  2R7Z H;  3PV0 A;  4GKK Q;  5M3M H;  2K52 A;  4KI0 A;  4DV5 L;  4NXM Q;  1SFO H;  1JE5 A;  3FKI G;  1VQM A;  1X9N A;  4BBR H;  4C2M H;  2YTX A;  2K5H A;  4Y7N H;  1J6Q A;  4JV5 L;  2ALY B;  1PFS A;  1VQB A;  4DV3 L;  4AQY Q;  4JI1 Q;  1Q1E A;  3PF5 A;  2KEN A;  3UE1 A;  1C9O A;  1E7Z A;  1IBM Q;  1JJG A;  2KBN A;  3CCR A;  3CPF A;  3HOW H;  1NMG A;  3HOZ H;  4IO9 A;  4YCV A;  3OW2 A;  3MEF A;  1G51 A;  3U50 C;  3JAM c;  3M4O H;  4OWT B;  1KC8 C;  4JOI A;  1QVC A;  4JI6 L;  4JI7 L;  4GN4 B;  1WJJ A;  4GLX A;  4NXN L;  2I5M X;  1N33 L;  3G6E A;  4HID A;  3FHW A;  3CW2 C;  4P75 A;  1YHB A;  3M4P A;  1YIT A;  1L1O B;  4HJ9 A;  3CCV A;  4DR2 L;  1JJ2 A;  4JI5 Q;  3BU2 A;  1VQ5 A;  1K73 C;  2UUB Q;  1HJP A;  3RN5 A;  4AYB E;  4LFA L;  2LXK A;  3CCU A;  2UU9 Q;  2IT1 A;  3B6Y A;  3CME A;  4JI3 L;  4P71 A;  3PO3 H;  1E1O A;  3H3V I;  5C44 G;  4KHZ A;  2ATW A;  3HFZ B;  4NB3 A;  1LYL A;  1P8L A;  5IYB G;  4B3S L;  2JA6 G;  4POG A;  2CWA A;  1MKH A;  2PMZ E;  4DR3 L;  2OWO A;  1OTC A;  2JA5 G;  4A3B H;  3HKZ E;  5FLX c;  5LMU Q;  4PMW A;  2OCE A;  2IHF A;  4A4I A;  2N78 A;  2IX1 A;  1V43 A;  2RHS B;  1I6H H;  2E2H H;  4POF A;  4IOC A;  1A8V A;  4IFD G;  3HOY G;  1FJG Q;  4DR1 Q;  2UXD Q;  2OTJ A;  1VS0 A;  3F2B A;  3A5Z B;  3KYH C;  4DV6 L;  4DR7 Q;  5IYC H;  4YY3 L;  2I0Q A;  1C0A A;  3T1Y Q;  3CP0 A;  2E5L Q;  3RNU A;  4A3G G;  2JE6 I;  3CCJ A;  1V1Q A;  1QZG A;  3OTO L;  3I55 A;  1XNR Q;  2Z0S A;  1E1T A;  1VQH A;  3PUV A;  4IJL A;  4XTC S;  1MIU A;  1E22 A;  4KLK A;  3KFU A;  1KQS A;  3I56 A;  2Q2I A;  3CCM A;  4EQ5 A;  3G4S A;  1BBU A;  2RCN A;  2B63 G;  5HY6 A;  4O0A A;  3GTK H;  1KXL A;  1KHI A;  2OQK A;  2JA8 G;  3ERS X;  1MJC A;  4DR6 L;  4LUZ A;  3ULP A;  4OX9 L;  5IP9 H;  1X65 A;  1N32 Q;  1HR0 W;  1TWC H;  1XMO Q;  2KCM A;  1CKO A;  3UDG A;  1K8G A;  2NVX H;  3M4Q A;  1RL2 A;  3J81 c;  4JI4 Q;  1CKM A;  1ASZ A;  4X62 Q;  4DPG A;  2QEX A;  3CMA A;  4GN5 A;  4C3J H;  1X3G A;  4JOI C;  3U58 A;  4OXP A;  1Q81 C;  1PH6 A;  5C4X G;  2BH2 A;  1NY4 A;  2PQA B;  2PQA A;  5ELN A;  4A93 G;  2R93 G;  1I50 H;  5BR8 Q;  2ASB A;  4HJ8 A;  1Z9F A;  3ZJY C;  3I2Z A;  1HNZ L;  4A3K H;  3F8T A;  4JC0 A;  2K4K A;  4BBS G;  1LUZ A;  3K7A H;  4X65 L;  2LXJ A;  2WP8 J;  4DV1 L;  1EUJ A;  1L1O C;  2LSS A;  4LF7 Q;  3PIO A;  2V1C C;  2ZTC A;  4L5S A;  4XIG S;  2Q2H A;  3STB C;  2AWN A;  1SR3 A;  1SRO A;  1A0I A;  1PA6 A;  1I5F A;  2MFI A;  1HNX Q;  1XMQ Q;  3PUY A;  1KAW A;  1XTD A;  4DK6 C;  4X64 Q;  4LF8 Q;  4JYA Q;  2A19 A;  4LF4 Q;  3S24 A;  3CQZ H;  4DV4 L;  4HJA A;  1YJ9 A;  4HIK A;  2F4V Q;  3GTQ H;  3CCQ A;  1IBK L;  1HZA A;  2XGT A;  4IPC A;  3GTP H;  4LFB L;  4LW1 A;  4DV2 Q;  4DR4 L;  2UXC Q;  4LUV A;  2VNU D;  3I4N G;  4BY1 G;  4DV0 Q;  2E2J H;  4OWW B;  4GS3 A;  4YWK A;  1XJV A;  2Q2T A;  1CSQ A;  2WB1 E;  3ER0 A;  4LWC A;  5JEA G;  1HR0 Q;  5IE8 A;  3GTM H;  1CUK A;  5C3E H;  2Z6K A;  3EBE A;  1OXX K;  2VZA A;  2RHQ B;  1XPR A;  1E3P A;  1VQ8 A;  4DUZ Q;  5IP7 H;  1Q7Y C;  3RN2 A;  2UXB L;  1S40 A;  5IP7 G;  2NZO A;  2UUC L;  3TS0 A;  1PH1 A;  1S72 A;  2JEA I;  2WAQ E;  2L15 A;  5C0X G;  3UDF A;  5JJI A;  1YVC A;  3FKI H;  4OO1 G;  4Y52 H;  3T1H Q;  4PZ6 A;  3NEL A;  4K0K L;  3S1M H;  5IWA Q;  4R4Q A;  3KDF B;  3KDF A;  4RMF A;  2VY3 A;  2JQO A;  2PNH A;  4MTN A;  3D31 A;  4JI0 L;  3RR5 A;  4QJF A;  2VW9 A;  1KRS A;  3H0G G;  3GTJ H;  2NN6 G;  2NVT H;  1IYJ B;  2VQF L;  2XTI A;  1N36 L;  1B7Y B;  2JA7 G;  4JBK A;  3BZK A;  3J81 i;  5LMN Q;  4O2D A;  1R9T H;  1Q82 C;  2K75 A;  4R4I A;  1X54 A;  1IBL Q;  4LUO A;  1B8A A;  2PI2 E;  1PH8 A;  4JI2 Q;  3CC2 A;  2E8G A;  4GKJ L;  2YYZ A;  4DUY Q;  3H15 A;  1VQA A;  4LNQ A;  2MO0 A;  2QGQ A;  3FP9 A;  1N34 L;  1AE2 A;  1YHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...