3QOJA

Cryogenic structure of staphylococcal nuclease variant d+phs/v23k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTKKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Determinants of pKa values of internal ionizable groups: properties of ion pairs in the protein core
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qojA00
4KY5A 1NUCA 2HQEA 1F2MA 3MXPA 3C1EA 1IHZA 2O4XA 2RBMA 4K5XA 1EYCA 4IUNA 3LX0A 1AEXA 1SYGA 2EY6A 3PMFA 2F0TA 4NKLA 1STNA 4ZUJA 3T13A 5M9OA 1F2ZA 3D8GA 3MEHA 1KABA 2M00A 5IGGA 3SK6A 1KDAA 3TP6A 5IGCA 4PMBA 3SHLA 3TMEA 4KD3A 3P1HA 2PQEA 3HZXA 5I6WA 4YIJA 5JOBA 1EZ8A 2F0VA 2F0MA 4B9XA 2EY1A 5IGFA 3SK5A 1A3TA 4QF4A 3T16A 1II3A 4N9PA 5CV8A 1A3UA 3U9OA 5IGBA 5J22A 3DMUA 4DU9A 5C5MA 1KDBA 5CV7A 2LKVA 5EGTA 4WRDA 5EKKA 3V2TA 1NSNS 1EY0A 4KTAA 5JAVA 3SK4A 3R3OA 1SNDA 4K2LA 3MVVA 3OMCA 3OWFA 5CR3A 4NMZA 5J39A 4IZ8A 2PZTA 5E3FA 3EROA 1TT2A 1A2UA 4J6HA 1EY4A 5IGDA 5ISRA 1EY8A 4G57A 5CV6A 2SNMA 1SNQA 3EVQA 3TP8A 1STHA 3D6CA 4RKLA 4J1MA 1KDCA 5CV5A 4DFAA 4EQPA 2F0UA 4KD4A 2RDFA 5IOCA 3NQTA 5I9OA 2F0SA 2EYJA 4KHVA 5J1ZA 5C4ZA 2EYOA 2EYFA 3QB3A 4HMJA 4R8NA 3NXWA 5C6AA 5IGEA 2QDBA 1JOKA 3EJIA 2F3VA 1EYDA 4IALA 5CV9A 4E6IA 5KGUA 4B9WA 5C3XA 3ITPA 2EY5A 2PZWA 1ENCA 1SYFA 2F0EA 5C3WA 1JOQA 4HTHA 3MZ5A 3NHHA 3H6MA 2F0PA 1EZ6A 2F0GA 1SYEA 4QMGA 5I9PA 1SNPA 3MHBA 1EY5A 4H7BA 4WORA 3SK8A 3SR1A 5KIXA 5EKLA 4QB4A 1SNOA 1STBA 4RKBA 5CC4A 5KRUA 1U9RA 4ZUIA 1SNCA 2F0KA 2SOBA 3QOLA 2EXZA 1TQOA 4K14A 4HMIA 4NP5A 4LAAA 3S9WA 1STGA 2OEOA 3DHQA 3NUCA 5CV4A 2F0HA 4KJOA 3VA5A 5KEEA 2F0NA 4K6DA 4KV6A 1ENAA 4ME5A 2F0OA 1JOOA 3ERQA 4EQNA 4ID6A 3OMGA 5IIFA 3TP7A 2F0WA 3D4WA 5NUCA 1F2YA 1EYAA 1SYDA 1STYA 2KHSA 2KQ3A 2OXPA 4K5WA 4PMCA 1SYCA 4N9TA 5C4HA 1TR5A 5HURA 1A2TA 2EYMA 2PZUA 1A3VA 4K5VA 5DAUA 2EYHA 3SXHA 5I6YA 2ENBA 2F0FA 2F0LA 4ODGA 4F7XA 4S3SA 2F3WA 2NUCA 3P75A 4NDXA 1EY7A 4KY7A 2PW7A 2F0JA 2EYPA 4PNYA 4TRDA 5HGTA 3NP8A 5F2DA 3NK9A 2WACA 3QOJA 4I65A 4DGZA 4EQOA 1RKNA 4OL7A 3RUZA 4KY6A 3HEJA 5E1FA 5CGKA 5IODA 5KYLA 3OSOA 4MIUA 4ZQ3A 2RKSA 4DF7A 4F8MA 5K5PA 2F0IA 1EY9A 2F0QA 2F0DA 3BDLA 3E5SA 2SNSA 3C1FA 4K8JA 4KJNA 5KYIA 1JORA 2PW5A 4K2KA 5C5LA 1SYBA 1KAAA 2EY2A 2EYLA 2OF1A 3D4DA 3TP5A 1SNMA 2PYKA 1EQVA 1STAA 1EY6A 5DEHA 4EVOA 4K8IA 3BDCA
chains in the Genus database with same CATH superfamily
4JI1L 4FYDA 1JE4A 3RLFA 2QGQA 3PF4A 1CHQD 1SFOH 1BUVT 5LHY1 4IQZA 1EYGA 2HDLA 4A3DB 1MIUA 4PMBA 1X55A 5J3BA 4OWXB 5JOBA 1EZ8A 2F0VA 2F0MA 3SK5A 4RH6A 3HFZB 4LF5Q 3A7LA 1NJIC 3S17B 2XVSA 2RCFA 1EWIA 5IE8A 4GN3B 5EBCA 2EVBA 4A3KG 3CU7A 3OWFA 4BBRB 5E3FA 2QILA 1QJOA 2M2LA 3HOXB 1HXYD 1LT3D 1BVSA 4DN4M 2GVBA 3AFPA 3HP3A 3JAMc 2Z4IA 3UE1A 2K05A 1MSGA 1UWVA 3BVGA 3NQTA 5I9OA 2MHVA 4ABNA 2B63H 3LGJA 3BYTB 1QVCA 1JJ2A 3E9HA 5M5XH 3K80C 1E22A 3DLLA 3HOVB 1ENCA 3M3YB 1TVXA 4O2DA 2I5MX 2K03A 3K7AB 2F0GA 1I6HB 3O13A 4LF9L 1PFSA 1G2TA 3H15A 2F0KA 3RZDH 2RA4A 1A6XA 1B2TA 4OHJA 1AFPA 1PV4A 1WTVA 5GAEC 5ELEA 2K04A 4QIWB 4A4IA 1C9OA 2AWOA 4NPSA 1YHBA 1VQPA 1HNWQ 3D4WA 1IL2A 4K5WA 3NTKA 1SYCA 1UE6A 3GP7A 3CP0A 1GD7A 3I4MB 2C35B 4NDXA 5EJWA 5JJKA 1DJRD 4N8X1 1GHKA 3FKIH 1ML0D 3NP8A 3L9AX 1VMPA 3PUWA 3IFTA 1B53A 4RGTA 1VQNA 1BF4A 1KTKA 4ZQ3A 2BH2A 4F8MA 4YWMA 1LTRD 4DV4L 3RZOB 1YEZA 1WCMB 2JYOA 3NELA 3QJYA 3FDTA 4K2KA 4A3EG 2B2WA 1LLRD 3R2IA 1X65A 4IUTA 2ZXOA 2FJ2A 3TP5A 3J7YW 4JCVE 5JJIA 1EIFA 3U4VA 4DK6C 3TQYA 3ERSX 3J80c 2NZHA 1EYCA 3LX0A 2H5XA 3IFDA 3UDIA 5KNCA 5M9OA 4RHRA 5FLXE 2FFKB 2Z0SA 3ONAB 4A93G 3TMEA 4AYBE 4X66Q 4WFN3 1I94Q 3LWUA 5DNFA 4LFCL 2L1BA 3STBD 3CF5A 1N9WA 1WOCA 4DUZQ 2ZXRA 4A76A 1PH7A 3S15B 2O2LD 5EKKA 1V43A 1EY0A 1RCVD 3BVMA 3EIVA 4L5QA 4FF2A 3WWVA 1BR9A 5KNBA 1GXDC 4BS9A 5DLQE 2HDMA 1TT2A 3HOUB 3CCSA 3ZYYX 1GHJA 2B29A 4P72A 4FF4A 4GLAC 1Z47A 2RF4A 2RDFA 4BY1H 4DNTB 3MXNA 2WAQG 1VQDA 2EPBA 5C4XH 5JVH3 1A0IA 1TWCH 2K50A 2NVYH 2PO4A 3W5OA 4AH6A 5H1SE 5C44B 2AQ3B 3MXNB 4N8FA 5AJ3Q 3PUVA 1SYEA 2YV5A 3SK8A 1Y1WB 5KIXA 1EIYB 1EL0A 5M3FG 2A69C 1PRTD 2A6EC 2IWHA 4YHHL 4FDBA 3OWEB 1I4GA 4LAAA 4R4TA 2JA5H 4KJOA 1V1QA 4ME5A 1FJGL 1XNRQ 3MFYA 1PZJD 4ID6A 1K28A 1SYDA 3NWSA 3DEOA 1PH8A 1CA5A 3K5NA 3PO3G 2F0FA 5CMDA 3H0GG 1KHIA 2KEEA 1I4XA 3T4AC 3HOYH 4RHSA 2ICEC 4KLKA 1HPCA 1SJED 1Z9FA 2EJGC 2WACA 1TS2A 2P5ZX 2R61A 3I73A 5IYBH 3Q24A 3I3CA 5KNDA 3OTOQ 2L5TA 1KL9A 1PZKD 1GO3E 1PYWD 1A15A 1CKNB 3LNNA 3D4DA 1O7YA 1SEBD 1QZHA 2PYKA 3HKZB 2JP1A 1U4RA 1PTOB 3BDCA 5M5WB 3C46A 2A8VA 1RIPA 2HQEA 1SXTA 4MHEA 2HD3A 1IHZA 2BE5C 2O4XA 2NVQB 4DR2Q 1X56A 3GTLB 2A68C 2Y0SG 1YIJA 4UAIA 4BY7G 1BBXC 4UHVA 1AH9A 1P8LA 2B2TC 4B9XA 1J9OA 4DV0L 4OWTB 1PLFA 1LO5D 5M3MH 2NVXB 1ZYRD 1TIID 3DMUA 2BH8A 4C3IG 3J81c 1L1OC 5CV7A 3NTIA 2Z4HA 3SK4A 4K2LA 5M5YH 3Q23A 4NMZA 2EJFC 3GDEA 3J7ZC 3VR2A 1FJGQ 1Q82C 3AMUA 1W2BA 4GN5A 1PRTF 4QQBX 1K73C 1DZ1A 2K5VA 2L15A 3J7A5 3CXCA 4JI3Q 1D5XC 5LMUQ 1E7ZA 1H9KA 1TS4A 1SLJA 3GTGB 1DYQA 5IP9H 4A3JB 4BXXH 4XT3B 5IWAQ 2K5HA 3MZ5A 3CC2A 2G9DA 4DV7L 1FD7D 3K5LA 4C2MH 2UXBL 3PO2B 4P75A 1PH2A 3PUZA 1XPUA 4HR7B 3S1QB 1WTRA 4ULLA 3CCUA 2JEBI 2LMCB 3S9WA 1QCBD 3VYSA 4DK1A 5CV4A 1RF2D 3PIPA 3ERQA 1IW7D 2JJQA 3MC0B 2ZTCA 2ATWA 5C4HA 3DEPA 4XT1B 1VQJA 1F9PA 1X6OA 4S3SA 4JW0A 4DAYA 2OTLA 5D3DA 2JA7G 4JI0Q 3EFXD 1L0XB 2PMZE 3H94A 4EQOA 5JEAG 1HR0L 1V8QA 3JAME 5IODA 4B3ML 2VB3X 3TBIB 1P16A 4POGA 3BU2A 5C3EB 1Y69U 4K8JA 3VYUA 1B3AA 1DOLA 3FRPB 2CCZA 2XGTA 1WD1A 1TWGB 4DA2A 1F9QA 1ICFB 3KF8B 4A3DG 1EQVA 4EVOA 3CCLA 2JEAI 1Q12A 4DAMA 1PH1A 2E8GA 5GAGC 2NWGA 4CHTB 1KIXA 3TZDA 3FEWX 1CM9A 4JI2Q 2L12A 4DR1Q 3D8GA 5IGCA 2N3SA 5BN4A 1SE4A 1U4LA 1IXRA 2NN6G 2AUJD 4Y52H 4BBRG 1HHVA 1S5CD 4X65L 1S72A 4LF6L 1IBLL 3U9OA 2B2TA 2HQLA 1LT5D 1LTLA 4A3BH 3OIQA 3HOZH 2DY8A 3GTMB 1L1OA 2R7ZH 4JOIA 3BYYB 4IUVA 1C0AA 3SVMA 4PG3A 1CKOA 4ZYSA 1I50H 3HOVG 1WVLA 2RHQB 1MHWC 5JPMC 4KD4A 4OIKA 3K57A 4HJ8A 4KHVA 1X3QA 5J1ZA 4L63B 1TS3A 4R8NA 2YU9B 3W1BA 4IOAA 3Q8DA 3CQZB 3G48A 4JPBW 5FLMG 1X9NA 4JI7L 4ALPA 5C3WA 4GNXA 2K14A 2F0PA 3Q0AA 1BBUA 3UE0A 1DXMA 1SFOB 1RJTA 1VQFA 4JBKA 3V05A 3J80E 2XRSD 4FVMA 3PIO3 1T5EA 4P73A 1QVFA 2IT1A 2ZJQA 4P71A 5LMNW 4GNXB 3I4MG 4EX5A 1T5XD 5A2QL 1ILQA 4UY8C 1EFID 1N8RC 4DR7L 3NEMA 3KOJA 1B50A 1SROA 4OO1H 3NSWA 2HIVA 4X64L 3BZKA 1WTWA 2KJXA 2KA7A 4KY7A 4DV5Q 2PW7A 4DAVA 5BR8Q 3NBHB 4YWKA 4X65Q 1CFMA 4AYBB 4CGYB 1LT4D 3HEJA 2MO0A 1A62A 3VR6A 4RFBA 2K4KA 5K36H 2VZAA 4LFAQ 2VY3A 2QEJC 1VQ5A 2K28A 5M5XB 1M90C 1GUTA 1PVOA 3UI2A 3BDOA 3W3AA 2UUAQ 1HZ9A 1UNSA 1PDQA 3AQQA 3S24A 1K0RA 1PFNA 2F4IA 3JC66 4GS3A 4HCEA 4K5XA 1D6EC 4IJHA 2L0CA 1SYGA 3T13A 5E4WC 4JI5L 3I4LA 1KRTA 1GVPA 1QUQA 2E2IH 4JI4L 1QB5D 5IP7G 3HOUG 1A3TA 1II3A 4P2CB 4L5RC 5C5MA 1KDBA 2ZTEA 1CHPD 2LFNA 1HNXL 1WTQA 4JG2A 1Q3LA 5JAVA 4LMQD 1PH6A 4XYQA 4GOPC 1EEID 1YJWA 2VQFQ 1BOSA 3FKIB 1B9NA 3F2CA 2LS01 1XMQQ 5C44G 3EVQA 1CSPA 5T1GA 4RKLA 1UUPA 4IFDG 4DXFA 1JCKB 5FO7B 2KVMA 4NXML 1Y1WG 2ID0A 2RDHA 4DR5L 1VF5C 1EYDA 5KGUA 5C3XA 1EOTA 2AWNA 1JOQA 1EQRA 1XNQL 1W6JA 1Y1VH 3F2BA 3ULLA 1U4PA 1FNVA 2I46A 1QG7A 5JJZA 1YZ6A 1CT1D 1W3SA 4RCOA 3L0OA 5HGTA 2F0OA 2KHJA 3CPFA 1N32Q 1DCZA 1XWEA 3K8AA 3H3VI 1LTBD 3J81E 4JI6Q 3GTQH 2JN4A 4RGOS 1X3EA 4H13C 4FF1A 1OXTA 4LF7Q 1HUNA 1SMYD 3S2HH 4L5TA 4LW1A 2J4XA 1D5ZC 1PTOF 2EYPA 2PQAA 4LF5L 3DM1A 3IRBA 4DGZA 4I65A 1RKNA 1C7YA 1WTPA 5D65A 2NTTA 3HKZG 3RLOA 3S16H 4BY1B 1QNUA 3T51B 1LV9A 1FL0A 1ONLA 5IYCG 2CW0D 5C4XB 1LTTD 2A19A 4UP9A 2PQAB 1GKHA 3EA6A 1B1ZA 1E0BA 2AUKA 3A8IE 4C3JH 3FMCA 1ET6A 4ZUIA 4C1NI 1UE1A 1HTLD 3MXPA 3C1EA 2OTJA 3OPOA 1VQKA 2PI2E 4RG1A 3PMFA 4NKLA 4FXDA 1AP0A 5I2XA 5EPLA 1Q7YC 2JA5B 3CPWA 1LM0A 4BA2I 5C0XI 1BCPC 2B8FA 1UEAB 2KCMA 1BXTA 1XNQQ 3I70A 4H0LC 2A6HD 4X6AH 1ZEQX 1A63A 4IUPA 1B8AA 4NB3A 1DOKA 1HRJA 3KBXA 4KTAA 4UP8A 4QCLA 5FOBB 1PHJA 1PYSB 4RAUC 2DUDA 4X3TA 1HNWL 2EXDA 1LTID 5G3LD 1HA5A 3I72A 3ULJA 1EY4A 4GOPA 1A8VA 2QF7A 4A3JG 2IY5B 4J1MA 4YCVA 3J81j 3S1MH 4FXGC 2E75C 5IOCA 2Z8LA 3GTPH 4WJ3M 4V190 2CWPA 5E7NA 3PO2G 1VQBA 3V96A 5IGEA 3A5ZB 1AW7A 3F8TA 4B9WA 2G5DA 2F0EA 2VUMG 1B70B 1PZID 1UE7A 2PMZB 4Z9CB 1YNJD 3S1RH 1WD0A 2KBNA 5IT9L 2BA0A 1STBA 3I4NG 1U9RA 1TY0A 4BBSB 1D1IA 2ZM6Q 3CCQA 4A3IH 3NPPA 4HAEA 1JMCA 2IX1A 2F0WA 2DGYA 2LXJA 1Y8OB 4NW2A 4LK1C 4O1NA 1HCZA 4MTKA 4ME3A 3NE5B 1SJHD 2F0LA 4X66L 5M5YB 2IL8A 1I94L 2RDGA 1AN8A 5I2YA 4G4KA 3GTJH 4DUZL 3GTKH 3JAMi 3MWYW 3J7AV 2KHIA 2E2DC 4AQYQ 5ELNA 2SNSA 5M3FH 2UUCQ 1TWFH 3BS1A 4KK7A 3FPUB 3D4RA 2EY2A 1JT8A 4A3MH 3L3OC 2MP1A 1EY6A 2NVTB 2IW3A 4KY5A 4C2MB 1X32A 3M4PA 3AEVA 2EY6A 3KFUA 3CW2C 1KLGD 3H0GH 3AU7A 5AJ3L 2A1AA 4FO2A 3CCVA 3H3VC 4R9WA 2K5NA 4L5SA 5JJLA 5D14A 3PCOB 3L7ZC 1A3UA 5IGBA 4OEMB 5EGTA 4KKUA 2YYZA 3V2TA 2UXDQ 1SNDA 4YCWA 3S1NH 1VQ4A 2KCCA 1XNRL 1NMFA 5L37A 2TMPA 2XNAC 5ELCA 5IGDA 1FVIA 4G57A 4XXEA 1PTOC 1SNQA 2DN8A 2JSOA 2R7DA 3KJPA 5CV5A 1TU2B 2O5IC 2F0UA 4JYAQ 1DOMA 4LJZC 3OW7A 1VQHA 3GTOH 2WV6D 1XMOQ 1SRUA 1I4QA 3NXWA 3MEFA 3EJIA 1ICWA 2ES2A 4HJ5A 3OTOL 4BY7H 3MA2B 3A74A 2QW7A 4LFBQ 4LF8L 1I4PA 1HZBA 4H7BA 3J80i 2R93G 4YCUA 2ZT9C 3SR1A 2WAQE 1TXYA 3I2ZA 1KNAA 3U9SA 4TKOB 1DM0B 1K3RA 3A54A 4F87A 2J7ZA 4I7AA 5KEEA 4IUQA 5CORA 3VYRA 3K58A 3NQIA 4KV6A 3T1YQ 4OWWB 1FNUA 4DR2L 2YTVA 2RVLA 1I5FA 4O42A 4XQJA 4A3FH 2E5LQ 1BBWA 4A3BB 4TSSA 4DV6Q 3IKJA 3HOZB 3VA7A 2XWJB 2R7ZB 2AHOB 2K01A 5ELBA 1I50B 1X3PA 2I0QA 3RMHA 3MFGA 2C5CA 1LABA 4CKCA 3KUPA 4KY6A 4MIUA 2K32A 2D5DA 1N34Q 1F2LA 3RN2A 2JA6H 4OX9Q 1E3PA 1SNMA 1JC7A 2E2JB 4R4IA 4JI3L 3I56A 5LMUL 1VQEA 3F2UA 2Z6KC 2RBMA 4OELB 2IX0A 2IPKD 1ILPA 2HIXA 5IWAL 2EZVA 4RGMA 1XTCD 2M00A 5COYA 1NTGA 1H9SA 2JA7H 5LL6X 4LF8Q 1EFWA 5GADC 1NR4A 5C4JH 4R4OA 2EY1A 4FF3A 2KCNA 2QCPX 3FKIG 4A3LG 1IKMA 4J8QA 5JEAH 4DU9A 1YHQA 1JJGA 1H9SB 3SGIA 5ELOA 1XX8A 2Y0SE 4RA8A 4KI0A 2B2VC 3F1ZA 3J7AF 2PPBC 1M8AA 1OXVA 3P20A 2M9VA 4A3DH 1IYJB 2I5LX 1VCIA 1YNND 4PMWA 2HCIA 4JI0L 2EYFA 3PIOA 1RD9D 1MBYA 1ET9A 4WJ4A 1TY2A 4X3SA 1VQIA 2ALYB 4PZ8A 2MGSA 4BA1I 4A3CH 1WYDA 1RTOA 1X3GA 2E2IB 2G9HD 1UAPA 2Q8IB 1L0WA 2PI2A 2OCEA 4PMCA 4C3HG 4JI2L 3J80L 4XYOA 3CCMA 2LSSA 3OIPA 4DR1L 3J81i 2ZJRA 3CCRA 2E2HH 2HHHL 1BQQT 1KRSA 5I6YA 3M3YH 2ENBA 1YITA 4F7XA 3A8JE 4BY1G 1BNZA 1EY7A 1I6HH 5C4XG 1BKBA 3DWAA 2HUGA 4JBJA 2EE1A 3OW2A 5FO9B 4JV5Q 4CJ0B 1WTOA 1D7QA 2QKIC 3A55A 2ASBA 1JWSD 2Z9HA 2F0DA 3BZDB 3E5SA 4K0KQ 4MN3A 1XJVA 4BWGB 1YHAA 1I4RA 2L9HA 3A7AB 3BG3A 2GVAA 1PFBA 2UXCQ 3KYHC 3I4MH 2F52A 2JA5G 4V0BA 5IYDH 4MTNA 3M85A 3U50C 1NUCA 1Y1VB 2WIIB 3EBEA 1N36L 3VDYA 2Q8TA 2Z6KA 1KABA 5IGGA 2J0TD 4DAYB 1HA6A 1BDOA 3KJOA 2ZJPA 3CD6A 3RZOH 4JC0A 4GKKQ 1R9TH 4N9PA 5J22A 1GUOA 5IYBG 4UPAA 2NB0A 1T9HA 3KK7A 1IYUA 2YTYA 1PMRA 3E3XA 3GTQB 2N78A 3E0EA 1WI5A 1X3FA 2K6AA 2R6GA 1Z6HA 3KLWA 3S2HB 2K5WA 1O7ZA 2X69A 2B2VA 2JA8H 4IURA 3VR3A 3E9IA 5CV6A 3FVQA 2HHHQ 3S16B 3K59A 2XWBB 4DV5L 3D6WA 3G6JB 1YVCA 5BR8L 4QGUA 1S5DD 2NN6I 2VB2X 3E6ZX 3HOXG 2X6GA 2IHFA 4E6IA 4C3JB 4BBSG 3RNUA 1TWHB 4RGNA 2O5JC 1CUKA 3RN5A 3SEBA 3GO5A 3G7LA 3H6MA 1WJJA 2D2CC 3CKIB 3QIAA 4QMGA 5IP7H 3KF6A 4LFAL 1PH9A 2KOLA 4QB4A 1K9MC 4LUOA 1SN8A 2UUAL 3FP9A 4CJ2C 3QR8A 1L1OB 1S40A 4A75A 3KF6B 1KLUD 1O7IA 1QWYA 3OMGA 4FXKC 4QIWE 3PF5A 1N36Q 4ZK9B 2KCTA 5C44H 2VL6A 3SXHA 4O0AA 4A3GB 4ODGA 3TEHB 4DV2Q 4DXGA 4J15A 3STBC 1ENFA 1JQYD 1VQ8A 2F0JA 5CBAE 1PH4A 1LYLA 2FHTA 5EKIA 2B2YC 5D3IB 5FJ8H 5IP9G 4BXXG 1SE8A 5LMNQ 3N52A 3PUYA 2IJ0A 3GTPB 2VQFL 2RCNA 1J8IA 4KJNA 2PNRC 3EQLC 2BDNA 1XMQL 1PA6A 3R2TA 4XQQA 4M8AA 4CKBA 3T1HL 2XN9C 3QG1A 1Q90A 4P74A 2VXWA 3H3VH 1WTHA 4HSPA 1K83H 1WCMG 3B6YA 3IAYA 1ESFA 4ZUJA 3SK6A 4A3IB 1DGSA 3P1HA 1PRTC 1HNZQ 3HOWH 2B63B 4PZ7A 4IOCA 4U673 1NAPA 1WTXA 1KNEA 2WB1E 1PTOH 3R3OA 2WAQB 1H9MA 3MVVA 2CKZB 5CR3A 2PZTA 1ASZA 1N32L 2CWAA 1K3BC 2SNMA 3RZDB 4DFAA 4JI6L 4JVZA 4LF7L 4WJWA 4DR3Q 1GUWA 5M3FB 2OWOA 2FMCA 4APVA 1EIGA 5FO8B 4EQ5A 2F3VA 1HUMA 5C0XH 4A3MB 1IYVA 2EY5A 2PZWA 4HN7A 1NR2A 1FGBD 2F4VQ 1QUQB 2MO1A 4R1JA 1JB3A 5ELFA 3P7JA 1I4HA 1SNPA 3MHBA 2Z1CA 2EIFA 2R7FA 1OXSC 4RKBA 4KHPQ 2A73B 3H0GB 2ZXPA 3HOZG 1IL8A 2R92H 3T1HQ 2F0HA 4EQNA 5IT9c 1Q8IA 2B3GA 4CJ1B 2DY7A 4IFDI 4K6LA 2CQAA 2AQ1B 3GTGH 1S4ZA 2NYZD 1A3VA 4JBMA 2AKWB 2Q8RE 2RQXA 3S1NB 1QE6A 1ZYRC 3IL8A 3PO2H 4PNYA 3S1QH 4GKJQ 4Y7NH 3QOJA 1G6ZA 3HRZC 2XRQD 1PYBA 3M4QA 2FINB 5CGKA 5KYLA 4QJFA 4DF7A 2VUMH 4DR4Q 4H02A 4A3KH 2FMMA 3TS2A 2F0QA 3G71A 1V9PA 1C8CA 1JORA 4IPDA 5JPNC 5HGQA 4G7HC 3I4NH 3R8BA 2Y0SB 2A69D 2A6ED 2D0OA 5BN3A 1RL2A 4BY7B 4IPGA 1G51A 1SMXA 2DNEA 2L4NA 2KUMA 4HJ9A 4OGQC 1IBKQ 1FYCA 1QVGA 1EQQA 1STNA 2CVRA 1VQ6A 3TP6A 1RHPA 2YTXA 1FGUA 2KEDA 5A35A 4OIJA 5IGFA 3UDFA 1AE3A 4DV3Q 1SDFA 4A3FB 4JBWA 5ELDA 1U4MA 1TWCB 2NVYB 2D62A 3I8ZA 1PFMA 2ZM6L 1IW7C 3EN2A 5K36G 2UU9Q 4CDEC 4QUCA 2E74C 1YBYA 4Q5VA 3D6CA 4EQPA 5C4ZA 4NXNQ 3WOEA 1MJCA 3A8KE 2JA6B 3BVZA 1MJEA 2BE5D 3BJUA 5FLXL 3GTMH 3T56B 2A68D 4HTHA 4AQYL 5GQOA 3HS0C 5EBDA 3HOYB 5I9PA 4DV1Q 1Q81C 2UUCL 3I91A 1LUZA 5EQ0A 5CC4A 1U5KA 1TS5A 2QA4A 2V4DA 4A3EH 3A56A 1QZGA 2SOBA 2Z6BA 1E24A 1LTSD 1QILA 1TQOA 4DAPA 4FP5D 3NUCA 3BZCA 5C4JB 1B4OA 4GOPB 2SDFA 3CQZH 2NZOA 4B3RQ 5HURA 1HQMC 3M4YA 5EAYA 4A93H 3P75A 1LTAD 3GV6A 1IBMQ 4CBVA 5FKAC 1H9RA 4HEDA 1X54A 1H95A 1YJ9A 4DR6Q 5F2DA 3NK9A 4CDFC 2KENA 1I3QH 2UXDL 2RKSA 1JICA 3G6EA 3ICEA 1W6KA 1Y1VG 1RODA 2R93H 5EPKA 1IKLA 5M3MB 4XDXA 1SE3A 3CMAA 1VS0A 4JYAL 3K0YA 1STAA 2NZ1D 3KLSX 1XMOL 5C3EG 5DM63 1PH3A 2RSNA 3KBGA 1M1KC 1JWUD 4TVAB 1E2ZA 4LFBL 1Q86C 1EU4A 3KDFA 4ZCKA 1K0SA 1NMGA 1QNKA 1YI2A 2E2HB 3OHXC 4RCNA 3S2DH 2LKVA 4B3SQ 4DNRB 1R4QB 3VR5A 1E1OA 3KDFB 3T1YL 1MD2D 1AE2A 4H44C 2A5HA 1CTMA 2E5LL 3ER0A 4KKSA 1EY8A 3CC4A 2K75A 4C3JG 3A5UA 3PQIA 4DV6L 3PO3H 5G3LF 3CCEA 5GAHC 5BN5A 3CRLC 4LUZA 1NE3A 4JI1Q 1XTDA 2MJ8A 4IUUA 2QDBA 3MXUA 4LNQA 2OT2A 1SYFA 1VQ7A 1GUNA 1CI3M 2K33A 1N34L 4HIOA 1L2FA 1EY5A 1FR3A 1Q1BA 1YNXA 3W1GA 4A3LH 1BCPB 3TSSA 1SNOA 1SNCA 4OX9L 4PZ6A 4LUVA 3DXJC 4A3GG 2LY7A 1MSHA 2F0NA 2PNHA 2AMCB 3W2DA 1R9TB 1CSQA 1F2YA 2OQ0A 4N9TA 2N49A 2PZUA 4X3UA 1D2BA 1EUJA 1D1KA 1VQGA 1S5FD 2WINB 2JA8B 1E2WA 3K6OA 1S3OA 3DUZA 4C3IH 4EGVA 1TKWB 3OSOA 1TWAH 5K5PA 2F0IA 1O7LA 4LF9Q 2WB1B 1OXUA 1KAAA 4XQNA 2EYLA 3AB9A 2D0PA 2OF1A 4AYBG 2K1BA 2Q2TA 2QEXA 2RHSB 4A3IG 1GOZA 3K5MA 4HCSA 1E2VA 2B63G 4C3HH 4IUNA 1AEXA 3PV0A 2CHBD 2DJFC 4DUYL 1G2SA 3LWEA 1Q1EA 3N6RA 2N55A 3HZXA 4X3KA 1V1PA 1H9JA 4M1UB 4CDCC 2CH4W 1SR3A 1WFQA 3DWQA 4IO9A 5IT9E 2GA4B 4TQUS 1SE2A 1G8ZD 3QO2A 3S14H 1HZAA 2UUBL 1V1PB 3JAML 1AZPA 4DK3C 4RWSC 3M4OH 5TSSA 4DV4Q 2CFMA 3GV3A 1JE5A 3PUXA 4HIKA 4ZKCB 3UDXA 4A3MG 1EOVA 3I90A 1JB7A 1KDCA 1SMYC 2WFWA 2XTIA 4FNFA 2F0SA 3D3RA 1J6QA 2I07B 3K5OA 3QB3A 2ICIA 4HMJA 4YWLA 5C6AA 4OXPA 4JV5L 5CV9A 5GROA 1EWCA 5JVG3 4ILWA 2CW0C 1R4PB 3CMEA 5E4XA 3F2DA 4K0KL 4XTCS 4AIMA 2K5QA 3TZUA 4IPHA 1K83B 4OONA 5AFWA 5EKLA 4LFCQ 2UXCL 2N8NA 1CKNA 1CA6A 4HMIA 1STGA 3M7GA 2D9UA 1F9RA 3Q6SA 1D8LA 1Y8NB 1I6VC 1SSOA 1ENAA 3HOWB 1JOOA 1VQLA 3K7UC 2WKCA 3TP7A 2LXKA 4GLVB 4XIGS 2OXPA 2HCCA 2EYMA 2GN5A 4K5VA 3KLRA 5DAUA 2EYHA 4ZRZA 3S17H 4DUYQ 3CCJA 1GM5A 1IZ6A 1VQ9A 2H1EA 2A6HC 1VQAA 1VMCA 2NN6H 4GKKL 4BBRH 3Q22A 4QUFA 1LTGD 3HOXH 4JI8L 1C4QA 1RDPD 3URYA 4BBSH 1JWMD 4GN4B 1BO0A 3FPPA 3VYTA 4POFA 2UUBQ 2BOSA 4HJ7A 1O78A 1XPOA 1K8MA 1N33L 3NBIA 3C2PA 4JOIC 3HOVH 4YHHQ 3A0JA 1S5BD 4K8IA 5CYUA 3K7AH 1YJNA 4LF4L 1F2MA 1K8OA 3KLSA 4A3FG 2R3ZA 3M9BA 2V1CC 5FLMH 5LL6S 5IY0A 1HTPA 3RLNA 2R92B 1YNJC 3SHLA 1AZQA 2EQSA 1G6PA 2KECA 2EOTA 3HG9A 1F9SA 3T16A 5CV8A 1PXUA 2H4OA 4GNXC 1EWHA 2MFIA 3ND9A 2B39A 1NSNS 2AQ2B 2NVTH 5J39A 1O80A 4IZ8A 1UEBA 3TREA 3AFQA 1A2UA 2ZTDA 2JA6G 4Y7NB 1Z7TA 3I7FA 2I5HA 5T1IA 4DV2L 2VUMB 4A3KB 3HOYG 1KC8C 2XIWA 3R93A 4ZKBB 3G4SA 4DNIA 4MNOA 1WCMH 4RMFA 2VNUD 3I4NB 4IALA 3CRKC 4JI8Q 5LMNL 2DJGC 2TSSA 3AYHB 3NHHA 1MGSA 3QWNA 4IN3A 5JEAJ 1BCPD 1N33Q 4ZAIA 4DV0Q 5DM73 1JR0D 3NWTA 3KF8A 3QOLA 4K14A 1OO9B 2E76C 3H91A 2JQOA 2B2UC 5CBEE 2WKDA 3DHQA 4UP7A 1EQTA 4K6DA 3SE0A 5IIFA 2PCFB 4LF4Q 2KHSA 1G291 3MAQA 1XXGA 3L2PA 1A2TA 1MI2A 3S15H 2IX3A 4IPCA 1L0YB 2HT1A 3GD7A 2F3WA 1Y8PB 1B3QA 1HNZL 4KKTA 4KMUC 3T53B 1QOHA 2JK8A 2EDGA 3M7NA 3HOUH 4C1NK 2F1MA 1UE5A 5M3MG 1F77A 1OTCA 3RUZA 2MUYA 3I55A 3VR4A 4G7OC 1ASYA 2X6LA 2QDLA 4HSVA 4HJAA 4DV7Q 1Q8KA 2L55A 4G7ZC 2UXBQ 2PW5A 1SYBA 1G91A 4A3CG 4C56C 2DNCA 3HKSA 3NENA 1STEA 5DEHA 4IFDH 1EIHA 4DR3L 2NBFA 1Y1WH 3NTHA 3DM3A 1VQOA 1KQSA 4R4QA 4A3EB 2B8GA 5ISRA 3J81L 2F4VL 2WP8J 1V1OA 3S1MB 4I7ZC 2PQEA 5I6WA 4X62L 1HH2P 3HGBA 1EU3A 4PQXA 4QF4A 4KHPL 1VDZA 2F03A 1HR0Q 4WRDA 1HR0W 5FK9C 2MNAA 1U0LA 4A93B 4B3MQ 2E2JH 3RR5A 3OMCA 3UDGA 2K7VA 3S1RB 1BCPF 3TP8A 1I3QB 4ZLTF 1CQVA 1NNXA 4JK1C 5IYDG 3CAMA 2EYJA 2R93B 1FNWA 4R4CA 1D5MC 2EYOA 4PV1C 3NBHA 4GKJL 1JOKA 2VQEL 1B9MA 2BA1A 2MQHA 3ITPA 1GUGA 1B44D 4DR4L 1ESRA 5M5WH 5IYCH 4WORA 4L8JA 4KN4C 3GTJB 3PGZA 4LF6Q 2NVQH 1IBLQ 3GQBA 3GTLH 1RTNA 5FLXc 3GTKB 3TDQA 2EXZA 1CZWA 4NP5A 1K8AC 3WDNA 1HFNA 2XSCA 4B08A 1K8GA 3OYYA 1IBKL 2B2UA 1Y14B 5NUCA 3TRZA 2JA8G 4GLXA 2Q2IA 1TWFB 2NVXH 3S2DB 1E1TA 1PTOD 1SAPA 2VS1A 2NUCA 3C3LA 4X62Q 2IHEA 2A74C 4DV3L 3E0JA 3PIP3 2WB1G 3DWPA 4LWCA 3WOFA 3PO3B 4JI7Q 4A3BG 3ND8A 5E1FA 4B3TL 2JE6I 2R7ZG 2UU9L 3BDLA 2JXMB 3C1FA 5KYIA 1XPRA 1CZGA 3I4OA 5C5LA 1KD1C 3CHBD 3K0XA 3OOCA 4A3JH 3MTSA 1DD2A 1YNNC 1NCVA 3H09A 4KN7C 3ULPA 1KXLA 1NY4A 2VW9A 1J5EL 4YY3L 1XYIA 1CQFA 4NXNL 1CKMA 4DR7Q 4DKAC 1DONA 4R8IA 1C48A 2F0TA 4IFDJ 1F2ZA 3MEHA 2VQEQ 1GUSA 1KDAA 3TN2A 2B2YA 3PSIA 3D31A 4KD3A 3ZJYC 4X64Q 3GTOB 4U68A 4YIJA 4DK0A 3CC7A 4DV1L 2Q2HA 3FHWA 5FJ8G 5I4DA 1HFGA 3MXGA 2RSOA 2CH4A 3TS0A 1LT6D 1MKHA 1VF7A 2NTSA 3U4ZA 4L6TB 3HKZE 3EROA 4J6HA 4B3RL 2CQOA 4C3IB 4OO1G 4HIDA 1STHA 4KHZA 2K5DA 1LACA 1KAWA 1TWAB 4QL5A 4OO1I 1Q46A 1NBWA 2EJMA 4F88A 1IBML 2BCOA 4DPGA 2L11A 5C3EH 4DR6L 1TWGH 4JI5Q 2JA9A 3D0FA 2BDOA 4B3TQ 5HY6A 1CK1A 3RD4A 5A2QE 1EZ6A 4JI4Q 3HOWG 1M4VA 4C3HB 1JJCB 4GZYC 4MZ9A 1PRTB 1SBBB 3X3MA 5KRUA 1VQCA 3SDZA 2N88A 1S5ED 1HNXQ 2OEOA 1HJPA 1EEFD 1OXXK 3VA5A 4Q0FA 1PH5A 1J5EQ 2OQKA 5EPJA 4YY3Q 4CDDC 1EYAA 2KQ3A 1STYA 4CKEA 3X3NA 1TR5A 1TWHH 3S14B 1HQRD 1ZXTA 3M4OB 3K81C 1VQMA 4NXMQ 4TRDA 5C0XJ 4DR5Q 2FXQA 5C0XG 4OL7A 4B3SL 2Q2UA 4IJLA 1B7YB 1EY9A 2JA7B 1HZCA 2B2WC 2F3IA 2SEBD 2YU9H 1ZKOA 4QY7A 2MPMA 1GJXA 4HIMA 4UDUC 3U58A 4A3GH 2K52A 2R92G 2C9OA
chains in the Genus database with same CATH topology
4FYDA 1JE4A 3RLFA 1CHQD 1BUVT 5LHY1 4IQZA 2HDLA 4A3DB 4PMBA 5JOBA 1EZ8A 2F0VA 2F0MA 3SK5A 4RH6A 3A7LA 3S17B 2XVSA 5EBCA 2EVBA 3CU7A 3OWFA 4BBRB 5E3FA 2QILA 1QJOA 2M2LA 3HOXB 1HXYD 1LT3D 4DN4M 3HP3A 2Z4IA 2K05A 1MSGA 3NQTA 3BVGA 5I9OA 2MHVA 4ABNA 3BYTB 3HOVB 1ENCA 3M3YB 1TVXA 2K03A 3K7AB 2F0GA 1I6HB 3O13A 1G2TA 2F0KA 1A6XA 2RA4A 1B2TA 4OHJA 1AFPA 1WTVA 5ELEA 2K04A 4QIWB 2AWOA 3D4WA 4K5WA 3NTKA 1SYCA 3GP7A 3I4MB 4NDXA 5EJWA 1DJRD 1GHKA 1ML0D 3NP8A 3L9AX 1VMPA 3PUWA 3IFTA 1B53A 4RGTA 1BF4A 1KTKA 4ZQ3A 4F8MA 1LTRD 3RZOB 1WCMB 2JYOA 3QJYA 3FDTA 4K2KA 2B2WA 1LLRD 3R2IA 4IUTA 2ZXOA 2FJ2A 3TP5A 3J7YW 1EYCA 3LX0A 3IFDA 5KNCA 5M9OA 4RHRA 5FLXE 2FFKB 3ONAB 3TMEA 4WFN3 3LWUA 5DNFA 2L1BA 2ZXRA 3S15B 2O2LD 5EKKA 1V43A 1EY0A 1RCVD 3BVMA 4FF2A 1BR9A 5KNBA 1GXDC 4BS9A 2HDMA 1TT2A 3HOUB 3ZYYX 1GHJA 4FF4A 1Z47A 2RDFA 4DNTB 3MXNA 2EPBA 5JVH3 5C44B 2PO4A 2AQ3B 3PUVA 1SYEA 3SK8A 1Y1WB 5KIXA 1EL0A 2A69C 1PRTD 2A6EC 2IWHA 3OWEB 1I4GA 4LAAA 4KJOA 4ME5A 3MFYA 1PZJD 4ID6A 1SYDA 3NWSA 3DEOA 1CA5A 3K5NA 2F0FA 5CMDA 2KEEA 1I4XA 3T4AC 4RHSA 2ICEC 1HPCA 1SJED 2EJGC 2WACA 1TS2A 2R61A 3I73A 3Q24A 3I3CA 5KNDA 2L5TA 1PZKD 1PYWD 1A15A 3LNNA 3D4DA 1O7YA 1SEBD 2PYKA 3HKZB 2JP1A 1U4RA 1PTOB 3BDCA 5M5WB 3C46A 2HQEA 1SXTA 4MHEA 1IHZA 2BE5C 2O4XA 2NVQB 3GTLB 2A68C 4UAIA 1BBXC 2B2TC 4B9XA 1J9OA 1PLFA 1LO5D 2NVXB 1ZYRD 1TIID 3DMUA 4C3IG 5CV7A 3NTIA 2Z4HA 3SK4A 4K2LA 3Q23A 4NMZA 2EJFC 3VR2A 3AMUA 1PRTF 1DZ1A 1D5XC 1H9KA 1TS4A 3GTGB 1DYQA 4A3JB 4XT3B 3MZ5A 2G9DA 1FD7D 3K5LA 3PO2B 3PUZA 4HR7B 3S1QB 1WTRA 4ULLA 2JEBI 2LMCB 3S9WA 1QCBD 3VYSA 4DK1A 5CV4A 1RF2D 3ERQA 1IW7D 3MC0B 5C4HA 3DEPA 4XT1B 1F9PA 4S3SA 4DAYA 5D3DA 3EFXD 1L0XB 3H94A 4EQOA 5JEAG 1V8QA 3JAME 5IODA 2VB3X 3TBIB 1Y69U 5C3EB 4K8JA 3VYUA 1B3AA 1DOLA 3FRPB 1WD1A 1TWGB 4DA2A 1F9QA 1EQVA 4EVOA 2JEAI 1Q12A 2NWGA 4CHTB 3TZDA 3FEWX 1CM9A 2L12A 3D8GA 5IGCA 5BN4A 1SE4A 1U4LA 2NN6G 2AUJD 1HHVA 1S5CD 3U9OA 2B2TA 1LT5D 3OIQA 2DY8A 3GTMB 3BYYB 4IUVA 3SVMA 4ZYSA 1WVLA 5JPMC 4KD4A 4OIKA 3K57A 4KHVA 1X3QA 5J1ZA 4L63B 1TS3A 4R8NA 2YU9B 3CQZB 5C3WA 2F0PA 3Q0AA 1DXMA 1SFOB 1RJTA 3V05A 3J80E 2XRSD 4FVMA 3PIO3 1T5EA 2IT1A 1T5XD 5A2QL 1ILQA 1EFID 1B50A 4OO1H 3NSWA 1WTWA 2KJXA 2KA7A 4KY7A 2PW7A 4DAVA 1CFMA 4AYBB 4CGYB 1LT4D 3HEJA 3VR6A 4RFBA 5K36H 2QEJC 2K28A 5M5XB 1GUTA 3UI2A 3BDOA 3W3AA 1UNSA 1PDQA 1PFNA 2F4IA 4HCEA 4K5XA 1D6EC 2L0CA 1SYGA 3T13A 5E4WC 3I4LA 1QB5D 1A3TA 1II3A 4P2CB 5C5MA 1KDBA 1CHPD 2LFNA 1WTQA 1Q3LA 5JAVA 4LMQD 4XYQA 1EEID 1BOSA 3FKIB 1B9NA 2LS01 3EVQA 5T1GA 4RKLA 1UUPA 4IFDG 4DXFA 1JCKB 5FO7B 2KVMA 2ID0A 2RDHA 1VF5C 1EYDA 5KGUA 5C3XA 1EOTA 2AWNA 1JOQA 1W6JA 1U4PA 1FNVA 2I46A 1QG7A 5JJZA 1CT1D 4RCOA 5HGTA 2F0OA 1DCZA 1XWEA 1LTBD 3J81E 4RGOS 4H13C 4FF1A 1OXTA 1HUNA 1SMYD 2J4XA 1D5ZC 1PTOF 2EYPA 3DM1A 4DGZA 4I65A 1RKNA 1WTPA 5D65A 2NTTA 4BY1B 1QNUA 3T51B 1LV9A 1ONLA 2CW0D 5C4XB 1LTTD 3EA6A 1B1ZA 1E0BA 2AUKA 3A8IE 3FMCA 1ET6A 4ZUIA 4C1NI 1HTLD 3MXPA 3C1EA 3OPOA 3PMFA 4NKLA 4FXDA 1AP0A 5I2XA 5EPLA 2JA5B 4BA2I 5C0XI 1BCPC 2B8FA 1UEAB 1BXTA 3I70A 4H0LC 2A6HD 1ZEQX 4IUPA 1DOKA 1HRJA 3KBXA 4KTAA 4QCLA 5FOBB 4RAUC 4X3TA 1LTID 5G3LD 1HA5A 3I72A 1EY4A 2QF7A 4J1MA 4FXGC 2E75C 5IOCA 2Z8LA 4V190 5IGEA 3V96A 1AW7A 4B9WA 2F0EA 1PZID 2PMZB 4Z9CB 1YNJD 1WD0A 5IT9L 2BA0A 1STBA 1U9RA 1TY0A 4BBSB 1D1IA 3NPPA 4HAEA 2IX1A 2F0WA 1Y8OB 4NW2A 4LK1C 4O1NA 1HCZA 3NE5B 1SJHD 2F0LA 5M5YB 2IL8A 2RDGA 1AN8A 5I2YA 4G4KA 3MWYW 3J7AV 2E2DC 2SNSA 3BS1A 4KK7A 3FPUB 3D4RA 2EY2A 3L3OC 2MP1A 1EY6A 2NVTB 2IW3A 4KY5A 4C2MB 1X32A 2EY6A 1KLGD 3AU7A 4FO2A 3H3VC 4R9WA 5D14A 3L7ZC 1A3UA 5IGBA 5EGTA 4KKUA 2YYZA 3V2TA 1SNDA 2KCCA 2TMPA 2XNAC 5ELCA 5IGDA 4G57A 4XXEA 1PTOC 1SNQA 2DN8A 2JSOA 5CV5A 1TU2B 2O5IC 2F0UA 1DOMA 4LJZC 3OW7A 2WV6D 1I4QA 3NXWA 3EJIA 1ICWA 3MA2B 1I4PA 4H7BA 3SR1A 2ZT9C 1KNAA 3U9SA 4TKOB 1DM0B 3A54A 4F87A 2J7ZA 5KEEA 4IUQA 5CORA 3VYRA 3K58A 3NQIA 4KV6A 1FNUA 2RVLA 4O42A 4XQJA 4A3BB 4TSSA 3IKJA 3HOZB 3VA7A 2XWJB 2R7ZB 2K01A 5ELBA 1I50B 1X3PA 3RMHA 3MFGA 2C5CA 1LABA 4CKCA 3KUPA 4KY6A 4MIUA 2K32A 2D5DA 1F2LA 1SNMA 1JC7A 2E2JB 3F2UA 2RBMA 2IX0A 2IPKD 1ILPA 2EZVA 4RGMA 1XTCD 2M00A 5COYA 1H9SA 5LL6X 1NR4A 2EY1A 4FF3A 2KCNA 2QCPX 1IKMA 4J8QA 5JEAH 4DU9A 1H9SB 1XX8A 4RA8A 4KI0A 2B2VC 3J7AF 2PPBC 1M8AA 1OXVA 3P20A 2M9VA 1VCIA 1YNND 4PMWA 2HCIA 2EYFA 1RD9D 1MBYA 1ET9A 1TY2A 4X3SA 2MGSA 4BA1I 1RTOA 2E2IB 2G9HD 1UAPA 2Q8IB 4PMCA 4C3HG 3J80L 4XYOA 3OIPA 1BQQT 5I6YA 2ENBA 4F7XA 3A8JE 1BNZA 1EY7A 3DWAA 2HUGA 2EE1A 5FO9B 4CJ0B 1WTOA 2QKIC 3A55A 1JWSD 2F0DA 3BZDB 3E5SA 4MN3A 4BWGB 2L9HA 1I4RA 3A7AB 3BG3A 1PFBA 4V0BA 3M85A 1NUCA 1Y1VB 2WIIB 2Q8TA 1KABA 5IGGA 2J0TD 1HA6A 1BDOA 4N9PA 5J22A 1GUOA 2NB0A 3KK7A 1IYUA 1PMRA 3GTQB 2K6AA 2R6GA 1Z6HA 3S2HB 2K5WA 1O7ZA 2X69A 2B2VA 4IURA 3VR3A 5CV6A 3FVQA 3S16B 3K59A 2XWBB 3D6WA 3G6JB 1S5DD 2NN6I 2VB2X 3E6ZX 2X6GA 4E6IA 4C3JB 1TWHB 4RGNA 2O5JC 3SEBA 3GO5A 3G7LA 3H6MA 2D2CC 3CKIB 3QIAA 4QMGA 2KOLA 4QB4A 4CJ2C 1KLUD 1QWYA 3OMGA 4FXKC 4ZK9B 3SXHA 4A3GB 4ODGA 4DXGA 1ENFA 1JQYD 2F0JA 5CBAE 2FHTA 5EKIA 2B2YC 5D3IB 3N52A 3PUYA 2IJ0A 3GTPB 1J8IA 4KJNA 2PNRC 3EQLC 2BDNA 3R2TA 4XQQA 4M8AA 4CKBA 2XN9C 3QG1A 1Q90A 2VXWA 4HSPA 3IAYA 1ESFA 4ZUJA 3SK6A 4A3IB 3P1HA 1PRTC 2B63B 4U673 1NAPA 1WTXA 1KNEA 1PTOH 3R3OA 2WAQB 1H9MA 3MVVA 5CR3A 2PZTA 2SNMA 3RZDB 4DFAA 4WJWA 1GUWA 5M3FB 2FMCA 1EIGA 5FO8B 2F3VA 1HUMA 5C0XH 4A3MB 1IYVA 2EY5A 2PZWA 4HN7A 1NR2A 1FGBD 1JB3A 5ELFA 3P7JA 1I4HA 1SNPA 3MHBA 2Z1CA 1OXSC 4RKBA 2A73B 3H0GB 2ZXPA 1IL8A 2F0HA 4EQNA 1Q8IA 4CJ1B 2DY7A 4IFDI 4K6LA 2CQAA 2AQ1B 1S4ZA 2NYZD 1A3VA 2Q8RE 2RQXA 3S1NB 1QE6A 1ZYRC 3IL8A 4PNYA 3QOJA 1G6ZA 3HRZC 2XRQD 2FINB 5CGKA 5KYLA 4DF7A 2FMMA 2F0QA 1C8CA 1JORA 5JPNC 4G7HC 3R8BA 2Y0SB 2A69D 2A6ED 5BN3A 4BY7B 2DNEA 2L4NA 2KUMA 4OGQC 1FYCA 1STNA 2CVRA 3TP6A 1RHPA 2KEDA 5A35A 4OIJA 5IGFA 1SDFA 4A3FB 4JBWA 5ELDA 1U4MA 1TWCB 2NVYB 2D62A 3I8ZA 1PFMA 1IW7C 5K36G 4QUCA 2E74C 4Q5VA 3D6CA 4EQPA 5C4ZA 3WOEA 3A8KE 2JA6B 3BVZA 2BE5D 5FLXL 3T56B 2A68D 4HTHA 3HS0C 5EBDA 3HOYB 5I9PA 3I91A 5EQ0A 5CC4A 1TS5A 2V4DA 3A56A 2SOBA 1LTSD 1TQOA 1QILA 4DAPA 4FP5D 3NUCA 5C4JB 1B4OA 2SDFA 5HURA 1HQMC 3M4YA 3P75A 1LTAD 3GV6A 4CBVA 5FKAC 1H9RA 4HEDA 5F2DA 3NK9A 2RKSA 1JICA 1W6KA 1RODA 5EPKA 1IKLA 5M3MB 4XDXA 1SE3A 3K0YA 1STAA 2NZ1D 3KLSX 5DM63 2RSNA 3KBGA 1JWUD 1E2ZA 1EU4A 1QNKA 2E2HB 3OHXC 4RCNA 2LKVA 4DNRB 1R4QB 3VR5A 1MD2D 4H44C 2A5HA 1CTMA 4KKSA 1EY8A 4C3JG 5G3LF 5BN5A 3CRLC 2MJ8A 4IUUA 2QDBA 3MXUA 2OT2A 1SYFA 1GUNA 1CI3M 2K33A 1Q1BA 1EY5A 1FR3A 1BCPB 3TSSA 1SNOA 1SNCA 3DXJC 2LY7A 1MSHA 2F0NA 3W2DA 1R9TB 1F2YA 4N9TA 2PZUA 4X3UA 1D2BA 1D1KA 1S5FD 2WINB 2JA8B 1E2WA 3K6OA 3DUZA 4EGVA 1TKWB 3OSOA 5K5PA 2F0IA 1O7LA 2WB1B 1OXUA 1KAAA 4XQNA 2EYLA 3AB9A 2OF1A 2K1BA 1GOZA 3K5MA 4HCSA 1E2VA 4IUNA 1AEXA 3PV0A 2CHBD 1G2SA 3LWEA 1Q1EA 3N6RA 2N55A 3HZXA 4X3KA 1V1PA 1H9JA 4M1UB 3DWQA 5IT9E 2GA4B 4TQUS 1SE2A 1G8ZD 3QO2A 1V1PB 3JAML 1AZPA 4RWSC 5TSSA 3GV3A 3PUXA 4ZKCB 3I90A 1KDCA 1SMYC 4FNFA 2F0SA 3D3RA 2I07B 3K5OA 3QB3A 2ICIA 4HMJA 5C6AA 5CV9A 1EWCA 5JVG3 4ILWA 2CW0C 1R4PB 5E4XA 4XTCS 2K5QA 3TZUA 1K83B 5AFWA 5EKLA 1CA6A 4HMIA 1STGA 3M7GA 2D9UA 1F9RA 3Q6SA 1Y8NB 1I6VC 1SSOA 1ENAA 3HOWB 1JOOA 2WKCA 3TP7A 4XIGS 2OXPA 2HCCA 2EYMA 4K5VA 5DAUA 3KLRA 4ZRZA 2EYHA 2H1EA 2A6HC 1VMCA 2NN6H 3Q22A 4QUFA 1LTGD 1C4QA 1RDPD 3URYA 1JWMD 1BO0A 3FPPA 3VYTA 2BOSA 1O78A 1K8MA 3NBIA 3C2PA 1S5BD 4K8IA 5CYUA 1F2MA 1K8OA 3KLSA 2R3ZA 5LL6S 1HTPA 2R92B 1YNJC 3SHLA 1AZQA 2KECA 2EOTA 3HG9A 1F9SA 3T16A 5CV8A 1PXUA 2H4OA 1EWHA 3ND9A 2B39A 1NSNS 2AQ2B 5J39A 1O80A 4IZ8A 1A2UA 4Y7NB 1Z7TA 5T1IA 2VUMB 4A3KB 2XIWA 3R93A 4ZKBB 2VNUD 3I4NB 4IALA 3CRKC 2TSSA 3NHHA 1MGSA 3QWNA 4IN3A 5JEAJ 1BCPD 4ZAIA 5DM73 1JR0D 3NWTA 3KF8A 3QOLA 4K14A 1OO9B 2E76C 3H91A 2B2UC 5CBEE 2WKDA 3DHQA 1EQTA 4K6DA 3SE0A 5IIFA 2PCFB 2KHSA 1G291 3MAQA 1XXGA 1A2TA 1MI2A 2IX3A 1L0YB 3GD7A 2F3WA 1Y8PB 4KKTA 4KMUC 3T53B 1QOHA 2EDGA 3M7NA 4C1NK 2F1MA 1F77A 3RUZA 2MUYA 3VR4A 4G7OC 2X6LA 4HSVA 2L55A 4G7ZC 2PW5A 1SYBA 1G91A 4C56C 2DNCA 1STEA 5DEHA 4IFDH 1EIHA 2NBFA 3NTHA 4A3EB 2B8GA 5ISRA 3J81L 2WP8J 1V1OA 3S1MB 4I7ZC 2PQEA 5I6WA 3HGBA 1EU3A 4PQXA 4QF4A 1VDZA 2F03A 4WRDA 5FK9C 4A93B 3OMCA 2K7VA 3S1RB 1BCPF 3TP8A 1I3QB 4ZLTF 1CQVA 4JK1C 2EYJA 2R93B 1FNWA 1D5MC 2EYOA 4PV1C 3NBHA 1JOKA 1B9MA 2BA1A 3ITPA 1GUGA 1B44D 1ESRA 4WORA 4L8JA 4KN4C 3GTJB 3GQBA 1RTNA 3GTKB 3TDQA 2EXZA 1CZWA 4NP5A 3WDNA 1HFNA 2XSCA 4B08A 2B2UA 5NUCA 1TWFB 3S2DB 1PTOD 1SAPA 2NUCA 3C3LA 2A74C 3E0JA 3PIP3 3DWPA 3WOFA 3PO3B 3ND8A 5E1FA 2JE6I 3BDLA 2JXMB 3C1FA 5KYIA 1CZGA 5C5LA 3CHBD 3OOCA 3MTSA 1DD2A 1YNNC 1NCVA 3H09A 4KN7C 1XYIA 1CQFA 1DONA 4R8IA 1C48A 2F0TA 4IFDJ 1F2ZA 3MEHA 1GUSA 1KDAA 3TN2A 2B2YA 3D31A 4KD3A 3GTOB 4U68A 4YIJA 4DK0A 5I4DA 1HFGA 3MXGA 2RSOA 1LT6D 1VF7A 2NTSA 4L6TB 3EROA 4J6HA 4C3IB 4OO1G 1STHA 4KHZA 2K5DA 1LACA 1TWAB 4OO1I 4F88A 2EJMA 2BCOA 2L11A 2BDOA 1CK1A 3RD4A 5A2QE 1EZ6A 1M4VA 4C3HB 4GZYC 1PRTB 1SBBB 3X3MA 5KRUA 3SDZA 2N88A 1S5ED 2OEOA 1EEFD 1OXXK 3VA5A 4Q0FA 5EPJA 1EYAA 2KQ3A 1STYA 4CKEA 3X3NA 1TR5A 3S14B 1HQRD 1ZXTA 3M4OB 4TRDA 5C0XJ 5C0XG 4OL7A 1EY9A 2JA7B 2B2WC 2SEBD 1ZKOA 2MPMA 1GJXA 4UDUC 2C9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  1NUC A;  2HQE A;  1F2M A;  3MXP A;  3C1E A;  1IHZ A;  2O4X A;  2RBM A;  4K5X A;  1EYC A;  4IUN A;  3LX0 A;  1AEX A;  1SYG A;  2EY6 A;  3PMF A;  2F0T A;  4NKL A;  1STN A;  4ZUJ A;  3T13 A;  5M9O A;  1F2Z A;  3D8G A;  3MEH A;  1KAB A;  2M00 A;  5IGG A;  3SK6 A;  1KDA A;  3TP6 A;  5IGC A;  4PMB A;  3SHL A;  3TME A;  4KD3 A;  3P1H A;  2PQE A;  3HZX A;  5I6W A;  4YIJ A;  5JOB A;  1EZ8 A;  2F0V A;  2F0M A;  4B9X A;  2EY1 A;  5IGF A;  3SK5 A;  1A3T A;  4QF4 A;  3T16 A;  1II3 A;  4N9P A;  5CV8 A;  1A3U A;  3U9O A;  5IGB A;  5J22 A;  3DMU A;  4DU9 A;  5C5M A;  1KDB A;  5CV7 A;  2LKV A;  5EGT A;  4WRD A;  5EKK A;  3V2T A;  1NSN S;  1EY0 A;  4KTA A;  5JAV A;  3SK4 A;  3R3O A;  1SND A;  4K2L A;  3MVV A;  3OMC A;  3OWF A;  5CR3 A;  4NMZ A;  5J39 A;  4IZ8 A;  2PZT A;  5E3F A;  3ERO A;  1TT2 A;  1A2U A;  4J6H A;  1EY4 A;  5IGD A;  5ISR A;  1EY8 A;  4G57 A;  5CV6 A;  2SNM A;  1SNQ A;  3EVQ A;  3TP8 A;  1STH A;  3D6C A;  4RKL A;  4J1M A;  1KDC A;  5CV5 A;  4DFA A;  4EQP A;  2F0U A;  4KD4 A;  2RDF A;  5IOC A;  3NQT A;  5I9O A;  2F0S A;  2EYJ A;  4KHV A;  5J1Z A;  5C4Z A;  2EYO A;  2EYF A;  3QB3 A;  4HMJ A;  4R8N A;  3NXW A;  5C6A A;  5IGE A;  2QDB A;  1JOK A;  3EJI A;  2F3V A;  1EYD A;  4IAL A;  5CV9 A;  4E6I A;  5KGU A;  4B9W A;  5C3X A;  3ITP A;  2EY5 A;  2PZW A;  1ENC A;  1SYF A;  2F0E A;  5C3W A;  1JOQ A;  4HTH A;  3MZ5 A;  3NHH A;  3H6M A;  2F0P A;  1EZ6 A;  2F0G A;  1SYE A;  4QMG A;  5I9P A;  1SNP A;  3MHB A;  1EY5 A;  4H7B A;  4WOR A;  3SK8 A;  3SR1 A;  5KIX A;  5EKL A;  4QB4 A;  1SNO A;  1STB A;  4RKB A;  5CC4 A;  5KRU A;  1U9R A;  4ZUI A;  1SNC A;  2F0K A;  2SOB A;  3QOL A;  2EXZ A;  1TQO A;  4K14 A;  4HMI A;  4NP5 A;  4LAA A;  3S9W A;  1STG A;  2OEO A;  3DHQ A;  3NUC A;  5CV4 A;  2F0H A;  4KJO A;  3VA5 A;  5KEE A;  2F0N A;  4K6D A;  4KV6 A;  1ENA A;  4ME5 A;  2F0O A;  1JOO A;  3ERQ A;  4EQN A;  4ID6 A;  3OMG A;  5IIF A;  3TP7 A;  2F0W A;  3D4W A;  5NUC A;  1F2Y A;  1EYA A;  1SYD A;  1STY A;  2KHS A;  2KQ3 A;  2OXP A;  4K5W A;  4PMC A;  1SYC A;  4N9T A;  5C4H A;  1TR5 A;  5HUR A;  1A2T A;  2EYM A;  2PZU A;  1A3V A;  4K5V A;  5DAU A;  2EYH A;  3SXH A;  5I6Y A;  2ENB A;  2F0F A;  2F0L A;  4ODG A;  4F7X A;  4S3S A;  2F3W A;  2NUC A;  3P75 A;  4NDX A;  1EY7 A;  4KY7 A;  2PW7 A;  2F0J A;  2EYP A;  4PNY A;  4TRD A;  5HGT A;  3NP8 A;  5F2D A;  3NK9 A;  2WAC A;  3QOJ A;  4I65 A;  4DGZ A;  4EQO A;  1RKN A;  4OL7 A;  3RUZ A;  4KY6 A;  3HEJ A;  5E1F A;  5CGK A;  5IOD A;  5KYL A;  3OSO A;  4MIU A;  4ZQ3 A;  2RKS A;  4DF7 A;  4F8M A;  5K5P A;  2F0I A;  1EY9 A;  2F0Q A;  2F0D A;  3BDL A;  3E5S A;  2SNS A;  3C1F A;  4K8J A;  4KJN A;  5KYI A;  1JOR A;  2PW5 A;  4K2K A;  5C5L A;  1SYB A;  1KAA A;  2EY2 A;  2EYL A;  2OF1 A;  3D4D A;  3TP5 A;  1SNM A;  2PYK A;  1EQV A;  1STA A;  1EY6 A;  5DEH A;  4EVO A;  4K8I A;  3BDC A; 
#chains in the Genus database with same CATH topology
 4JI1 L;  4FYD A;  1JE4 A;  3RLF A;  2QGQ A;  3PF4 A;  1CHQ D;  1SFO H;  1BUV T;  5LHY 1;  4IQZ A;  1EYG A;  2HDL A;  4A3D B;  1MIU A;  4PMB A;  1X55 A;  5J3B A;  4OWX B;  5JOB A;  1EZ8 A;  2F0V A;  2F0M A;  3SK5 A;  4RH6 A;  3HFZ B;  4LF5 Q;  3A7L A;  1NJI C;  3S17 B;  2XVS A;  2RCF A;  1EWI A;  5IE8 A;  4GN3 B;  5EBC A;  2EVB A;  4A3K G;  3CU7 A;  3OWF A;  4BBR B;  5E3F A;  2QIL A;  1QJO A;  2M2L A;  3HOX B;  1HXY D;  1LT3 D;  1BVS A;  4DN4 M;  2GVB A;  3AFP A;  3HP3 A;  3JAM c;  2Z4I A;  3UE1 A;  2K05 A;  1MSG A;  1UWV A;  3BVG A;  3NQT A;  5I9O A;  2MHV A;  4ABN A;  2B63 H;  3LGJ A;  3BYT B;  1QVC A;  1JJ2 A;  3E9H A;  5M5X H;  3K80 C;  1E22 A;  3DLL A;  3HOV B;  1ENC A;  3M3Y B;  1TVX A;  4O2D A;  2I5M X;  2K03 A;  3K7A B;  2F0G A;  1I6H B;  3O13 A;  4LF9 L;  1PFS A;  1G2T A;  3H15 A;  2F0K A;  3RZD H;  2RA4 A;  1A6X A;  1B2T A;  4OHJ A;  1AFP A;  1PV4 A;  1WTV A;  5GAE C;  5ELE A;  2K04 A;  4QIW B;  4A4I A;  1C9O A;  2AWO A;  4NPS A;  1YHB A;  1VQP A;  1HNW Q;  3D4W A;  1IL2 A;  4K5W A;  3NTK A;  1SYC A;  1UE6 A;  3GP7 A;  3CP0 A;  1GD7 A;  3I4M B;  2C35 B;  4NDX A;  5EJW A;  5JJK A;  1DJR D;  4N8X 1;  1GHK A;  3FKI H;  1ML0 D;  3NP8 A;  3L9A X;  1VMP A;  3PUW A;  3IFT A;  1B53 A;  4RGT A;  1VQN A;  1BF4 A;  1KTK A;  4ZQ3 A;  2BH2 A;  4F8M A;  4YWM A;  1LTR D;  4DV4 L;  3RZO B;  1YEZ A;  1WCM B;  2JYO A;  3NEL A;  3QJY A;  3FDT A;  4K2K A;  4A3E G;  2B2W A;  1LLR D;  3R2I A;  1X65 A;  4IUT A;  2ZXO A;  2FJ2 A;  3TP5 A;  3J7Y W;  4JCV E;  5JJI A;  1EIF A;  3U4V A;  4DK6 C;  3TQY A;  3ERS X;  3J80 c;  2NZH A;  1EYC A;  3LX0 A;  2H5X A;  3IFD A;  3UDI A;  5KNC A;  5M9O A;  4RHR A;  5FLX E;  2FFK B;  2Z0S A;  3ONA B;  4A93 G;  3TME A;  4AYB E;  4X66 Q;  4WFN 3;  1I94 Q;  3LWU A;  5DNF A;  4LFC L;  2L1B A;  3STB D;  3CF5 A;  1N9W A;  1WOC A;  4DUZ Q;  2ZXR A;  4A76 A;  1PH7 A;  3S15 B;  2O2L D;  5EKK A;  1V43 A;  1EY0 A;  1RCV D;  3BVM A;  3EIV A;  4L5Q A;  4FF2 A;  3WWV A;  1BR9 A;  5KNB A;  1GXD C;  4BS9 A;  5DLQ E;  2HDM A;  1TT2 A;  3HOU B;  3CCS A;  3ZYY X;  1GHJ A;  2B29 A;  4P72 A;  4FF4 A;  4GLA C;  1Z47 A;  2RF4 A;  2RDF A;  4BY1 H;  4DNT B;  3MXN A;  2WAQ G;  1VQD A;  2EPB A;  5C4X H;  5JVH 3;  1A0I A;  1TWC H;  2K50 A;  2NVY H;  2PO4 A;  3W5O A;  4AH6 A;  5H1S E;  5C44 B;  2AQ3 B;  3MXN B;  4N8F A;  5AJ3 Q;  3PUV A;  1SYE A;  2YV5 A;  3SK8 A;  1Y1W B;  5KIX A;  1EIY B;  1EL0 A;  5M3F G;  2A69 C;  1PRT D;  2A6E C;  2IWH A;  4YHH L;  4FDB A;  3OWE B;  1I4G A;  4LAA A;  4R4T A;  2JA5 H;  4KJO A;  1V1Q A;  4ME5 A;  1FJG L;  1XNR Q;  3MFY A;  1PZJ D;  4ID6 A;  1K28 A;  1SYD A;  3NWS A;  3DEO A;  1PH8 A;  1CA5 A;  3K5N A;  3PO3 G;  2F0F A;  5CMD A;  3H0G G;  1KHI A;  2KEE A;  1I4X A;  3T4A C;  3HOY H;  4RHS A;  2ICE C;  4KLK A;  1HPC A;  1SJE D;  1Z9F A;  2EJG C;  2WAC A;  1TS2 A;  2P5Z X;  2R61 A;  3I73 A;  5IYB H;  3Q24 A;  3I3C A;  5KND A;  3OTO Q;  2L5T A;  1KL9 A;  1PZK D;  1GO3 E;  1PYW D;  1A15 A;  1CKN B;  3LNN A;  3D4D A;  1O7Y A;  1SEB D;  1QZH A;  2PYK A;  3HKZ B;  2JP1 A;  1U4R A;  1PTO B;  3BDC A;  5M5W B;  3C46 A;  2A8V A;  1RIP A;  2HQE A;  1SXT A;  4MHE A;  2HD3 A;  1IHZ A;  2BE5 C;  2O4X A;  2NVQ B;  4DR2 Q;  1X56 A;  3GTL B;  2A68 C;  2Y0S G;  1YIJ A;  4UAI A;  4BY7 G;  1BBX C;  4UHV A;  1AH9 A;  1P8L A;  2B2T C;  4B9X A;  1J9O A;  4DV0 L;  4OWT B;  1PLF A;  1LO5 D;  5M3M H;  2NVX B;  1ZYR D;  1TII D;  3DMU A;  2BH8 A;  4C3I G;  3J81 c;  1L1O C;  5CV7 A;  3NTI A;  2Z4H A;  3SK4 A;  4K2L A;  5M5Y H;  3Q23 A;  4NMZ A;  2EJF C;  3GDE A;  3J7Z C;  3VR2 A;  1FJG Q;  1Q82 C;  3AMU A;  1W2B A;  4GN5 A;  1PRT F;  4QQB X;  1K73 C;  1DZ1 A;  2K5V A;  2L15 A;  3J7A 5;  3CXC A;  4JI3 Q;  1D5X C;  5LMU Q;  1E7Z A;  1H9K A;  1TS4 A;  1SLJ A;  3GTG B;  1DYQ A;  5IP9 H;  4A3J B;  4BXX H;  4XT3 B;  5IWA Q;  2K5H A;  3MZ5 A;  3CC2 A;  2G9D A;  4DV7 L;  1FD7 D;  3K5L A;  4C2M H;  2UXB L;  3PO2 B;  4P75 A;  1PH2 A;  3PUZ A;  1XPU A;  4HR7 B;  3S1Q B;  1WTR A;  4ULL A;  3CCU A;  2JEB I;  2LMC B;  3S9W A;  1QCB D;  3VYS A;  4DK1 A;  5CV4 A;  1RF2 D;  3PIP A;  3ERQ A;  1IW7 D;  2JJQ A;  3MC0 B;  2ZTC A;  2ATW A;  5C4H A;  3DEP A;  4XT1 B;  1VQJ A;  1F9P A;  1X6O A;  4S3S A;  4JW0 A;  4DAY A;  2OTL A;  5D3D A;  2JA7 G;  4JI0 Q;  3EFX D;  1L0X B;  2PMZ E;  3H94 A;  4EQO A;  5JEA G;  1HR0 L;  1V8Q A;  3JAM E;  5IOD A;  4B3M L;  2VB3 X;  3TBI B;  1P16 A;  4POG A;  3BU2 A;  5C3E B;  1Y69 U;  4K8J A;  3VYU A;  1B3A A;  1DOL A;  3FRP B;  2CCZ A;  2XGT A;  1WD1 A;  1TWG B;  4DA2 A;  1F9Q A;  1ICF B;  3KF8 B;  4A3D G;  1EQV A;  4EVO A;  3CCL A;  2JEA I;  1Q12 A;  4DAM A;  1PH1 A;  2E8G A;  5GAG C;  2NWG A;  4CHT B;  1KIX A;  3TZD A;  3FEW X;  1CM9 A;  4JI2 Q;  2L12 A;  4DR1 Q;  3D8G A;  5IGC A;  2N3S A;  5BN4 A;  1SE4 A;  1U4L A;  1IXR A;  2NN6 G;  2AUJ D;  4Y52 H;  4BBR G;  1HHV A;  1S5C D;  4X65 L;  1S72 A;  4LF6 L;  1IBL L;  3U9O A;  2B2T A;  2HQL A;  1LT5 D;  1LTL A;  4A3B H;  3OIQ A;  3HOZ H;  2DY8 A;  3GTM B;  1L1O A;  2R7Z H;  4JOI A;  3BYY B;  4IUV A;  1C0A A;  3SVM A;  4PG3 A;  1CKO A;  4ZYS A;  1I50 H;  3HOV G;  1WVL A;  2RHQ B;  1MHW C;  5JPM C;  4KD4 A;  4OIK A;  3K57 A;  4HJ8 A;  4KHV A;  1X3Q A;  5J1Z A;  4L63 B;  1TS3 A;  4R8N A;  2YU9 B;  3W1B A;  4IOA A;  3Q8D A;  3CQZ B;  3G48 A;  4JPB W;  5FLM G;  1X9N A;  4JI7 L;  4ALP A;  5C3W A;  4GNX A;  2K14 A;  2F0P A;  3Q0A A;  1BBU A;  3UE0 A;  1DXM A;  1SFO B;  1RJT A;  1VQF A;  4JBK A;  3V05 A;  3J80 E;  2XRS D;  4FVM A;  3PIO 3;  1T5E A;  4P73 A;  1QVF A;  2IT1 A;  2ZJQ A;  4P71 A;  5LMN W;  4GNX B;  3I4M G;  4EX5 A;  1T5X D;  5A2Q L;  1ILQ A;  4UY8 C;  1EFI D;  1N8R C;  4DR7 L;  3NEM A;  3KOJ A;  1B50 A;  1SRO A;  4OO1 H;  3NSW A;  2HIV A;  4X64 L;  3BZK A;  1WTW A;  2KJX A;  2KA7 A;  4KY7 A;  4DV5 Q;  2PW7 A;  4DAV A;  5BR8 Q;  3NBH B;  4YWK A;  4X65 Q;  1CFM A;  4AYB B;  4CGY B;  1LT4 D;  3HEJ A;  2MO0 A;  1A62 A;  3VR6 A;  4RFB A;  2K4K A;  5K36 H;  2VZA A;  4LFA Q;  2VY3 A;  2QEJ C;  1VQ5 A;  2K28 A;  5M5X B;  1M90 C;  1GUT A;  1PVO A;  3UI2 A;  3BDO A;  3W3A A;  2UUA Q;  1HZ9 A;  1UNS A;  1PDQ A;  3AQQ A;  3S24 A;  1K0R A;  1PFN A;  2F4I A;  3JC6 6;  4GS3 A;  4HCE A;  4K5X A;  1D6E C;  4IJH A;  2L0C A;  1SYG A;  3T13 A;  5E4W C;  4JI5 L;  3I4L A;  1KRT A;  1GVP A;  1QUQ A;  2E2I H;  4JI4 L;  1QB5 D;  5IP7 G;  3HOU G;  1A3T A;  1II3 A;  4P2C B;  4L5R C;  5C5M A;  1KDB A;  2ZTE A;  1CHP D;  2LFN A;  1HNX L;  1WTQ A;  4JG2 A;  1Q3L A;  5JAV A;  4LMQ D;  1PH6 A;  4XYQ A;  4GOP C;  1EEI D;  1YJW A;  2VQF Q;  1BOS A;  3FKI B;  1B9N A;  3F2C A;  2LS0 1;  1XMQ Q;  5C44 G;  3EVQ A;  1CSP A;  5T1G A;  4RKL A;  1UUP A;  4IFD G;  4DXF A;  1JCK B;  5FO7 B;  2KVM A;  4NXM L;  1Y1W G;  2ID0 A;  2RDH A;  4DR5 L;  1VF5 C;  1EYD A;  5KGU A;  5C3X A;  1EOT A;  2AWN A;  1JOQ A;  1EQR A;  1XNQ L;  1W6J A;  1Y1V H;  3F2B A;  3ULL A;  1U4P A;  1FNV A;  2I46 A;  1QG7 A;  5JJZ A;  1YZ6 A;  1CT1 D;  1W3S A;  4RCO A;  3L0O A;  5HGT A;  2F0O A;  2KHJ A;  3CPF A;  1N32 Q;  1DCZ A;  1XWE A;  3K8A A;  3H3V I;  1LTB D;  3J81 E;  4JI6 Q;  3GTQ H;  2JN4 A;  4RGO S;  1X3E A;  4H13 C;  4FF1 A;  1OXT A;  4LF7 Q;  1HUN A;  1SMY D;  3S2H H;  4L5T A;  4LW1 A;  2J4X A;  1D5Z C;  1PTO F;  2EYP A;  2PQA A;  4LF5 L;  3DM1 A;  3IRB A;  4DGZ A;  4I65 A;  1RKN A;  1C7Y A;  1WTP A;  5D65 A;  2NTT A;  3HKZ G;  3RLO A;  3S16 H;  4BY1 B;  1QNU A;  3T51 B;  1LV9 A;  1FL0 A;  1ONL A;  5IYC G;  2CW0 D;  5C4X B;  1LTT D;  2A19 A;  4UP9 A;  2PQA B;  1GKH A;  3EA6 A;  1B1Z A;  1E0B A;  2AUK A;  3A8I E;  4C3J H;  3FMC A;  1ET6 A;  4ZUI A;  4C1N I;  1UE1 A;  1HTL D;  3MXP A;  3C1E A;  2OTJ A;  3OPO A;  1VQK A;  2PI2 E;  4RG1 A;  3PMF A;  4NKL A;  4FXD A;  1AP0 A;  5I2X A;  5EPL A;  1Q7Y C;  2JA5 B;  3CPW A;  1LM0 A;  4BA2 I;  5C0X I;  1BCP C;  2B8F A;  1UEA B;  2KCM A;  1BXT A;  1XNQ Q;  3I70 A;  4H0L C;  2A6H D;  4X6A H;  1ZEQ X;  1A63 A;  4IUP A;  1B8A A;  4NB3 A;  1DOK A;  1HRJ A;  3KBX A;  4KTA A;  4UP8 A;  4QCL A;  5FOB B;  1PHJ A;  1PYS B;  4RAU C;  2DUD A;  4X3T A;  1HNW L;  2EXD A;  1LTI D;  5G3L D;  1HA5 A;  3I72 A;  3ULJ A;  1EY4 A;  4GOP A;  1A8V A;  2QF7 A;  4A3J G;  2IY5 B;  4J1M A;  4YCV A;  3J81 j;  3S1M H;  4FXG C;  2E75 C;  5IOC A;  2Z8L A;  3GTP H;  4WJ3 M;  4V19 0;  2CWP A;  5E7N A;  3PO2 G;  1VQB A;  3V96 A;  5IGE A;  3A5Z B;  1AW7 A;  3F8T A;  4B9W A;  2G5D A;  2F0E A;  2VUM G;  1B70 B;  1PZI D;  1UE7 A;  2PMZ B;  4Z9C B;  1YNJ D;  3S1R H;  1WD0 A;  2KBN A;  5IT9 L;  2BA0 A;  1STB A;  3I4N G;  1U9R A;  1TY0 A;  4BBS B;  1D1I A;  2ZM6 Q;  3CCQ A;  4A3I H;  3NPP A;  4HAE A;  1JMC A;  2IX1 A;  2F0W A;  2DGY A;  2LXJ A;  1Y8O B;  4NW2 A;  4LK1 C;  4O1N A;  1HCZ A;  4MTK A;  4ME3 A;  3NE5 B;  1SJH D;  2F0L A;  4X66 L;  5M5Y B;  2IL8 A;  1I94 L;  2RDG A;  1AN8 A;  5I2Y A;  4G4K A;  3GTJ H;  4DUZ L;  3GTK H;  3JAM i;  3MWY W;  3J7A V;  2KHI A;  2E2D C;  4AQY Q;  5ELN A;  2SNS A;  5M3F H;  2UUC Q;  1TWF H;  3BS1 A;  4KK7 A;  3FPU B;  3D4R A;  2EY2 A;  1JT8 A;  4A3M H;  3L3O C;  2MP1 A;  1EY6 A;  2NVT B;  2IW3 A;  4KY5 A;  4C2M B;  1X32 A;  3M4P A;  3AEV A;  2EY6 A;  3KFU A;  3CW2 C;  1KLG D;  3H0G H;  3AU7 A;  5AJ3 L;  2A1A A;  4FO2 A;  3CCV A;  3H3V C;  4R9W A;  2K5N A;  4L5S A;  5JJL A;  5D14 A;  3PCO B;  3L7Z C;  1A3U A;  5IGB A;  4OEM B;  5EGT A;  4KKU A;  2YYZ A;  3V2T A;  2UXD Q;  1SND A;  4YCW A;  3S1N H;  1VQ4 A;  2KCC A;  1XNR L;  1NMF A;  5L37 A;  2TMP A;  2XNA C;  5ELC A;  5IGD A;  1FVI A;  4G57 A;  4XXE A;  1PTO C;  1SNQ A;  2DN8 A;  2JSO A;  2R7D A;  3KJP A;  5CV5 A;  1TU2 B;  2O5I C;  2F0U A;  4JYA Q;  1DOM A;  4LJZ C;  3OW7 A;  1VQH A;  3GTO H;  2WV6 D;  1XMO Q;  1SRU A;  1I4Q A;  3NXW A;  3MEF A;  3EJI A;  1ICW A;  2ES2 A;  4HJ5 A;  3OTO L;  4BY7 H;  3MA2 B;  3A74 A;  2QW7 A;  4LFB Q;  4LF8 L;  1I4P A;  1HZB A;  4H7B A;  3J80 i;  2R93 G;  4YCU A;  2ZT9 C;  3SR1 A;  2WAQ E;  1TXY A;  3I2Z A;  1KNA A;  3U9S A;  4TKO B;  1DM0 B;  1K3R A;  3A54 A;  4F87 A;  2J7Z A;  4I7A A;  5KEE A;  4IUQ A;  5COR A;  3VYR A;  3K58 A;  3NQI A;  4KV6 A;  3T1Y Q;  4OWW B;  1FNU A;  4DR2 L;  2YTV A;  2RVL A;  1I5F A;  4O42 A;  4XQJ A;  4A3F H;  2E5L Q;  1BBW A;  4A3B B;  4TSS A;  4DV6 Q;  3IKJ A;  3HOZ B;  3VA7 A;  2XWJ B;  2R7Z B;  2AHO B;  2K01 A;  5ELB A;  1I50 B;  1X3P A;  2I0Q A;  3RMH A;  3MFG A;  2C5C A;  1LAB A;  4CKC A;  3KUP A;  4KY6 A;  4MIU A;  2K32 A;  2D5D A;  1N34 Q;  1F2L A;  3RN2 A;  2JA6 H;  4OX9 Q;  1E3P A;  1SNM A;  1JC7 A;  2E2J B;  4R4I A;  4JI3 L;  3I56 A;  5LMU L;  1VQE A;  3F2U A;  2Z6K C;  2RBM A;  4OEL B;  2IX0 A;  2IPK D;  1ILP A;  2HIX A;  5IWA L;  2EZV A;  4RGM A;  1XTC D;  2M00 A;  5COY A;  1NTG A;  1H9S A;  2JA7 H;  5LL6 X;  4LF8 Q;  1EFW A;  5GAD C;  1NR4 A;  5C4J H;  4R4O A;  2EY1 A;  4FF3 A;  2KCN A;  2QCP X;  3FKI G;  4A3L G;  1IKM A;  4J8Q A;  5JEA H;  4DU9 A;  1YHQ A;  1JJG A;  1H9S B;  3SGI A;  5ELO A;  1XX8 A;  2Y0S E;  4RA8 A;  4KI0 A;  2B2V C;  3F1Z A;  3J7A F;  2PPB C;  1M8A A;  1OXV A;  3P20 A;  2M9V A;  4A3D H;  1IYJ B;  2I5L X;  1VCI A;  1YNN D;  4PMW A;  2HCI A;  4JI0 L;  2EYF A;  3PIO A;  1RD9 D;  1MBY A;  1ET9 A;  4WJ4 A;  1TY2 A;  4X3S A;  1VQI A;  2ALY B;  4PZ8 A;  2MGS A;  4BA1 I;  4A3C H;  1WYD A;  1RTO A;  1X3G A;  2E2I B;  2G9H D;  1UAP A;  2Q8I B;  1L0W A;  2PI2 A;  2OCE A;  4PMC A;  4C3H G;  4JI2 L;  3J80 L;  4XYO A;  3CCM A;  2LSS A;  3OIP A;  4DR1 L;  3J81 i;  2ZJR A;  3CCR A;  2E2H H;  2HHH L;  1BQQ T;  1KRS A;  5I6Y A;  3M3Y H;  2ENB A;  1YIT A;  4F7X A;  3A8J E;  4BY1 G;  1BNZ A;  1EY7 A;  1I6H H;  5C4X G;  1BKB A;  3DWA A;  2HUG A;  4JBJ A;  2EE1 A;  3OW2 A;  5FO9 B;  4JV5 Q;  4CJ0 B;  1WTO A;  1D7Q A;  2QKI C;  3A55 A;  2ASB A;  1JWS D;  2Z9H A;  2F0D A;  3BZD B;  3E5S A;  4K0K Q;  4MN3 A;  1XJV A;  4BWG B;  1YHA A;  1I4R A;  2L9H A;  3A7A B;  3BG3 A;  2GVA A;  1PFB A;  2UXC Q;  3KYH C;  3I4M H;  2F52 A;  2JA5 G;  4V0B A;  5IYD H;  4MTN A;  3M85 A;  3U50 C;  1NUC A;  1Y1V B;  2WII B;  3EBE A;  1N36 L;  3VDY A;  2Q8T A;  2Z6K A;  1KAB A;  5IGG A;  2J0T D;  4DAY B;  1HA6 A;  1BDO A;  3KJO A;  2ZJP A;  3CD6 A;  3RZO H;  4JC0 A;  4GKK Q;  1R9T H;  4N9P A;  5J22 A;  1GUO A;  5IYB G;  4UPA A;  2NB0 A;  1T9H A;  3KK7 A;  1IYU A;  2YTY A;  1PMR A;  3E3X A;  3GTQ B;  2N78 A;  3E0E A;  1WI5 A;  1X3F A;  2K6A A;  2R6G A;  1Z6H A;  3KLW A;  3S2H B;  2K5W A;  1O7Z A;  2X69 A;  2B2V A;  2JA8 H;  4IUR A;  3VR3 A;  3E9I A;  5CV6 A;  3FVQ A;  2HHH Q;  3S16 B;  3K59 A;  2XWB B;  4DV5 L;  3D6W A;  3G6J B;  1YVC A;  5BR8 L;  4QGU A;  1S5D D;  2NN6 I;  2VB2 X;  3E6Z X;  3HOX G;  2X6G A;  2IHF A;  4E6I A;  4C3J B;  4BBS G;  3RNU A;  1TWH B;  4RGN A;  2O5J C;  1CUK A;  3RN5 A;  3SEB A;  3GO5 A;  3G7L A;  3H6M A;  1WJJ A;  2D2C C;  3CKI B;  3QIA A;  4QMG A;  5IP7 H;  3KF6 A;  4LFA L;  1PH9 A;  2KOL A;  4QB4 A;  1K9M C;  4LUO A;  1SN8 A;  2UUA L;  3FP9 A;  4CJ2 C;  3QR8 A;  1L1O B;  1S40 A;  4A75 A;  3KF6 B;  1KLU D;  1O7I A;  1QWY A;  3OMG A;  4FXK C;  4QIW E;  3PF5 A;  1N36 Q;  4ZK9 B;  2KCT A;  5C44 H;  2VL6 A;  3SXH A;  4O0A A;  4A3G B;  4ODG A;  3TEH B;  4DV2 Q;  4DXG A;  4J15 A;  3STB C;  1ENF A;  1JQY D;  1VQ8 A;  2F0J A;  5CBA E;  1PH4 A;  1LYL A;  2FHT A;  5EKI A;  2B2Y C;  5D3I B;  5FJ8 H;  5IP9 G;  4BXX G;  1SE8 A;  5LMN Q;  3N52 A;  3PUY A;  2IJ0 A;  3GTP B;  2VQF L;  2RCN A;  1J8I A;  4KJN A;  2PNR C;  3EQL C;  2BDN A;  1XMQ L;  1PA6 A;  3R2T A;  4XQQ A;  4M8A A;  4CKB A;  3T1H L;  2XN9 C;  3QG1 A;  1Q90 A;  4P74 A;  2VXW A;  3H3V H;  1WTH A;  4HSP A;  1K83 H;  1WCM G;  3B6Y A;  3IAY A;  1ESF A;  4ZUJ A;  3SK6 A;  4A3I B;  1DGS A;  3P1H A;  1PRT C;  1HNZ Q;  3HOW H;  2B63 B;  4PZ7 A;  4IOC A;  4U67 3;  1NAP A;  1WTX A;  1KNE A;  2WB1 E;  1PTO H;  3R3O A;  2WAQ B;  1H9M A;  3MVV A;  2CKZ B;  5CR3 A;  2PZT A;  1ASZ A;  1N32 L;  2CWA A;  1K3B C;  2SNM A;  3RZD B;  4DFA A;  4JI6 L;  4JVZ A;  4LF7 L;  4WJW A;  4DR3 Q;  1GUW A;  5M3F B;  2OWO A;  2FMC A;  4APV A;  1EIG A;  5FO8 B;  4EQ5 A;  2F3V A;  1HUM A;  5C0X H;  4A3M B;  1IYV A;  2EY5 A;  2PZW A;  4HN7 A;  1NR2 A;  1FGB D;  2F4V Q;  1QUQ B;  2MO1 A;  4R1J A;  1JB3 A;  5ELF A;  3P7J A;  1I4H A;  1SNP A;  3MHB A;  2Z1C A;  2EIF A;  2R7F A;  1OXS C;  4RKB A;  4KHP Q;  2A73 B;  3H0G B;  2ZXP A;  3HOZ G;  1IL8 A;  2R92 H;  3T1H Q;  2F0H A;  4EQN A;  5IT9 c;  1Q8I A;  2B3G A;  4CJ1 B;  2DY7 A;  4IFD I;  4K6L A;  2CQA A;  2AQ1 B;  3GTG H;  1S4Z A;  2NYZ D;  1A3V A;  4JBM A;  2AKW B;  2Q8R E;  2RQX A;  3S1N B;  1QE6 A;  1ZYR C;  3IL8 A;  3PO2 H;  4PNY A;  3S1Q H;  4GKJ Q;  4Y7N H;  3QOJ A;  1G6Z A;  3HRZ C;  2XRQ D;  1PYB A;  3M4Q A;  2FIN B;  5CGK A;  5KYL A;  4QJF A;  4DF7 A;  2VUM H;  4DR4 Q;  4H02 A;  4A3K H;  2FMM A;  3TS2 A;  2F0Q A;  3G71 A;  1V9P A;  1C8C A;  1JOR A;  4IPD A;  5JPN C;  5HGQ A;  4G7H C;  3I4N H;  3R8B A;  2Y0S B;  2A69 D;  2A6E D;  2D0O A;  5BN3 A;  1RL2 A;  4BY7 B;  4IPG A;  1G51 A;  1SMX A;  2DNE A;  2L4N A;  2KUM A;  4HJ9 A;  4OGQ C;  1IBK Q;  1FYC A;  1QVG A;  1EQQ A;  1STN A;  2CVR A;  1VQ6 A;  3TP6 A;  1RHP A;  2YTX A;  1FGU A;  2KED A;  5A35 A;  4OIJ A;  5IGF A;  3UDF A;  1AE3 A;  4DV3 Q;  1SDF A;  4A3F B;  4JBW A;  5ELD A;  1U4M A;  1TWC B;  2NVY B;  2D62 A;  3I8Z A;  1PFM A;  2ZM6 L;  1IW7 C;  3EN2 A;  5K36 G;  2UU9 Q;  4CDE C;  4QUC A;  2E74 C;  1YBY A;  4Q5V A;  3D6C A;  4EQP A;  5C4Z A;  4NXN Q;  3WOE A;  1MJC A;  3A8K E;  2JA6 B;  3BVZ A;  1MJE A;  2BE5 D;  3BJU A;  5FLX L;  3GTM H;  3T56 B;  2A68 D;  4HTH A;  4AQY L;  5GQO A;  3HS0 C;  5EBD A;  3HOY B;  5I9P A;  4DV1 Q;  1Q81 C;  2UUC L;  3I91 A;  1LUZ A;  5EQ0 A;  5CC4 A;  1U5K A;  1TS5 A;  2QA4 A;  2V4D A;  4A3E H;  3A56 A;  1QZG A;  2SOB A;  2Z6B A;  1E24 A;  1LTS D;  1QIL A;  1TQO A;  4DAP A;  4FP5 D;  3NUC A;  3BZC A;  5C4J B;  1B4O A;  4GOP B;  2SDF A;  3CQZ H;  2NZO A;  4B3R Q;  5HUR A;  1HQM C;  3M4Y A;  5EAY A;  4A93 H;  3P75 A;  1LTA D;  3GV6 A;  1IBM Q;  4CBV A;  5FKA C;  1H9R A;  4HED A;  1X54 A;  1H95 A;  1YJ9 A;  4DR6 Q;  5F2D A;  3NK9 A;  4CDF C;  2KEN A;  1I3Q H;  2UXD L;  2RKS A;  1JIC A;  3G6E A;  3ICE A;  1W6K A;  1Y1V G;  1ROD A;  2R93 H;  5EPK A;  1IKL A;  5M3M B;  4XDX A;  1SE3 A;  3CMA A;  1VS0 A;  4JYA L;  3K0Y A;  1STA A;  2NZ1 D;  3KLS X;  1XMO L;  5C3E G;  5DM6 3;  1PH3 A;  2RSN A;  3KBG A;  1M1K C;  1JWU D;  4TVA B;  1E2Z A;  4LFB L;  1Q86 C;  1EU4 A;  3KDF A;  4ZCK A;  1K0S A;  1NMG A;  1QNK A;  1YI2 A;  2E2H B;  3OHX C;  4RCN A;  3S2D H;  2LKV A;  4B3S Q;  4DNR B;  1R4Q B;  3VR5 A;  1E1O A;  3KDF B;  3T1Y L;  1MD2 D;  1AE2 A;  4H44 C;  2A5H A;  1CTM A;  2E5L L;  3ER0 A;  4KKS A;  1EY8 A;  3CC4 A;  2K75 A;  4C3J G;  3A5U A;  3PQI A;  4DV6 L;  3PO3 H;  5G3L F;  3CCE A;  5GAH C;  5BN5 A;  3CRL C;  4LUZ A;  1NE3 A;  4JI1 Q;  1XTD A;  2MJ8 A;  4IUU A;  2QDB A;  3MXU A;  4LNQ A;  2OT2 A;  1SYF A;  1VQ7 A;  1GUN A;  1CI3 M;  2K33 A;  1N34 L;  4HIO A;  1L2F A;  1EY5 A;  1FR3 A;  1Q1B A;  1YNX A;  3W1G A;  4A3L H;  1BCP B;  3TSS A;  1SNO A;  1SNC A;  4OX9 L;  4PZ6 A;  4LUV A;  3DXJ C;  4A3G G;  2LY7 A;  1MSH A;  2F0N A;  2PNH A;  2AMC B;  3W2D A;  1R9T B;  1CSQ A;  1F2Y A;  2OQ0 A;  4N9T A;  2N49 A;  2PZU A;  4X3U A;  1D2B A;  1EUJ A;  1D1K A;  1VQG A;  1S5F D;  2WIN B;  2JA8 B;  1E2W A;  3K6O A;  1S3O A;  3DUZ A;  4C3I H;  4EGV A;  1TKW B;  3OSO A;  1TWA H;  5K5P A;  2F0I A;  1O7L A;  4LF9 Q;  2WB1 B;  1OXU A;  1KAA A;  4XQN A;  2EYL A;  3AB9 A;  2D0P A;  2OF1 A;  4AYB G;  2K1B A;  2Q2T A;  2QEX A;  2RHS B;  4A3I G;  1GOZ A;  3K5M A;  4HCS A;  1E2V A;  2B63 G;  4C3H H;  4IUN A;  1AEX A;  3PV0 A;  2CHB D;  2DJF C;  4DUY L;  1G2S A;  3LWE A;  1Q1E A;  3N6R A;  2N55 A;  3HZX A;  4X3K A;  1V1P A;  1H9J A;  4M1U B;  4CDC C;  2CH4 W;  1SR3 A;  1WFQ A;  3DWQ A;  4IO9 A;  5IT9 E;  2GA4 B;  4TQU S;  1SE2 A;  1G8Z D;  3QO2 A;  3S14 H;  1HZA A;  2UUB L;  1V1P B;  3JAM L;  1AZP A;  4DK3 C;  4RWS C;  3M4O H;  5TSS A;  4DV4 Q;  2CFM A;  3GV3 A;  1JE5 A;  3PUX A;  4HIK A;  4ZKC B;  3UDX A;  4A3M G;  1EOV A;  3I90 A;  1JB7 A;  1KDC A;  1SMY C;  2WFW A;  2XTI A;  4FNF A;  2F0S A;  3D3R A;  1J6Q A;  2I07 B;  3K5O A;  3QB3 A;  2ICI A;  4HMJ A;  4YWL A;  5C6A A;  4OXP A;  4JV5 L;  5CV9 A;  5GRO A;  1EWC A;  5JVG 3;  4ILW A;  2CW0 C;  1R4P B;  3CME A;  5E4X A;  3F2D A;  4K0K L;  4XTC S;  4AIM A;  2K5Q A;  3TZU A;  4IPH A;  1K83 B;  4OON A;  5AFW A;  5EKL A;  4LFC Q;  2UXC L;  2N8N A;  1CKN A;  1CA6 A;  4HMI A;  1STG A;  3M7G A;  2D9U A;  1F9R A;  3Q6S A;  1D8L A;  1Y8N B;  1I6V C;  1SSO A;  1ENA A;  3HOW B;  1JOO A;  1VQL A;  3K7U C;  2WKC A;  3TP7 A;  2LXK A;  4GLV B;  4XIG S;  2OXP A;  2HCC A;  2EYM A;  2GN5 A;  4K5V A;  3KLR A;  5DAU A;  2EYH A;  4ZRZ A;  3S17 H;  4DUY Q;  3CCJ A;  1GM5 A;  1IZ6 A;  1VQ9 A;  2H1E A;  2A6H C;  1VQA A;  1VMC A;  2NN6 H;  4GKK L;  4BBR H;  3Q22 A;  4QUF A;  1LTG D;  3HOX H;  4JI8 L;  1C4Q A;  1RDP D;  3URY A;  4BBS H;  1JWM D;  4GN4 B;  1BO0 A;  3FPP A;  3VYT A;  4POF A;  2UUB Q;  2BOS A;  4HJ7 A;  1O78 A;  1XPO A;  1K8M A;  1N33 L;  3NBI A;  3C2P A;  4JOI C;  3HOV H;  4YHH Q;  3A0J A;  1S5B D;  4K8I A;  5CYU A;  3K7A H;  1YJN A;  4LF4 L;  1F2M A;  1K8O A;  3KLS A;  4A3F G;  2R3Z A;  3M9B A;  2V1C C;  5FLM H;  5LL6 S;  5IY0 A;  1HTP A;  3RLN A;  2R92 B;  1YNJ C;  3SHL A;  1AZQ A;  2EQS A;  1G6P A;  2KEC A;  2EOT A;  3HG9 A;  1F9S A;  3T16 A;  5CV8 A;  1PXU A;  2H4O A;  4GNX C;  1EWH A;  2MFI A;  3ND9 A;  2B39 A;  1NSN S;  2AQ2 B;  2NVT H;  5J39 A;  1O80 A;  4IZ8 A;  1UEB A;  3TRE A;  3AFQ A;  1A2U A;  2ZTD A;  2JA6 G;  4Y7N B;  1Z7T A;  3I7F A;  2I5H A;  5T1I A;  4DV2 L;  2VUM B;  4A3K B;  3HOY G;  1KC8 C;  2XIW A;  3R93 A;  4ZKB B;  3G4S A;  4DNI A;  4MNO A;  1WCM H;  4RMF A;  2VNU D;  3I4N B;  4IAL A;  3CRK C;  4JI8 Q;  5LMN L;  2DJG C;  2TSS A;  3AYH B;  3NHH A;  1MGS A;  3QWN A;  4IN3 A;  5JEA J;  1BCP D;  1N33 Q;  4ZAI A;  4DV0 Q;  5DM7 3;  1JR0 D;  3NWT A;  3KF8 A;  3QOL A;  4K14 A;  1OO9 B;  2E76 C;  3H91 A;  2JQO A;  2B2U C;  5CBE E;  2WKD A;  3DHQ A;  4UP7 A;  1EQT A;  4K6D A;  3SE0 A;  5IIF A;  2PCF B;  4LF4 Q;  2KHS A;  1G29 1;  3MAQ A;  1XXG A;  3L2P A;  1A2T A;  1MI2 A;  3S15 H;  2IX3 A;  4IPC A;  1L0Y B;  2HT1 A;  3GD7 A;  2F3W A;  1Y8P B;  1B3Q A;  1HNZ L;  4KKT A;  4KMU C;  3T53 B;  1QOH A;  2JK8 A;  2EDG A;  3M7N A;  3HOU H;  4C1N K;  2F1M A;  1UE5 A;  5M3M G;  1F77 A;  1OTC A;  3RUZ A;  2MUY A;  3I55 A;  3VR4 A;  4G7O C;  1ASY A;  2X6L A;  2QDL A;  4HSV A;  4HJA A;  4DV7 Q;  1Q8K A;  2L55 A;  4G7Z C;  2UXB Q;  2PW5 A;  1SYB A;  1G91 A;  4A3C G;  4C56 C;  2DNC A;  3HKS A;  3NEN A;  1STE A;  5DEH A;  4IFD H;  1EIH A;  4DR3 L;  2NBF A;  1Y1W H;  3NTH A;  3DM3 A;  1VQO A;  1KQS A;  4R4Q A;  4A3E B;  2B8G A;  5ISR A;  3J81 L;  2F4V L;  2WP8 J;  1V1O A;  3S1M B;  4I7Z C;  2PQE A;  5I6W A;  4X62 L;  1HH2 P;  3HGB A;  1EU3 A;  4PQX A;  4QF4 A;  4KHP L;  1VDZ A;  2F03 A;  1HR0 Q;  4WRD A;  1HR0 W;  5FK9 C;  2MNA A;  1U0L A;  4A93 B;  4B3M Q;  2E2J H;  3RR5 A;  3OMC A;  3UDG A;  2K7V A;  3S1R B;  1BCP F;  3TP8 A;  1I3Q B;  4ZLT F;  1CQV A;  1NNX A;  4JK1 C;  5IYD G;  3CAM A;  2EYJ A;  2R93 B;  1FNW A;  4R4C A;  1D5M C;  2EYO A;  4PV1 C;  3NBH A;  4GKJ L;  1JOK A;  2VQE L;  1B9M A;  2BA1 A;  2MQH A;  3ITP A;  1GUG A;  1B44 D;  4DR4 L;  1ESR A;  5M5W H;  5IYC H;  4WOR A;  4L8J A;  4KN4 C;  3GTJ B;  3PGZ A;  4LF6 Q;  2NVQ H;  1IBL Q;  3GQB A;  3GTL H;  1RTN A;  5FLX c;  3GTK B;  3TDQ A;  2EXZ A;  1CZW A;  4NP5 A;  1K8A C;  3WDN A;  1HFN A;  2XSC A;  4B08 A;  1K8G A;  3OYY A;  1IBK L;  2B2U A;  1Y14 B;  5NUC A;  3TRZ A;  2JA8 G;  4GLX A;  2Q2I A;  1TWF B;  2NVX H;  3S2D B;  1E1T A;  1PTO D;  1SAP A;  2VS1 A;  2NUC A;  3C3L A;  4X62 Q;  2IHE A;  2A74 C;  4DV3 L;  3E0J A;  3PIP 3;  2WB1 G;  3DWP A;  4LWC A;  3WOF A;  3PO3 B;  4JI7 Q;  4A3B G;  3ND8 A;  5E1F A;  4B3T L;  2JE6 I;  2R7Z G;  2UU9 L;  3BDL A;  2JXM B;  3C1F A;  5KYI A;  1XPR A;  1CZG A;  3I4O A;  5C5L A;  1KD1 C;  3CHB D;  3K0X A;  3OOC A;  4A3J H;  3MTS A;  1DD2 A;  1YNN C;  1NCV A;  3H09 A;  4KN7 C;  3ULP A;  1KXL A;  1NY4 A;  2VW9 A;  1J5E L;  4YY3 L;  1XYI A;  1CQF A;  4NXN L;  1CKM A;  4DR7 Q;  4DKA C;  1DON A;  4R8I A;  1C48 A;  2F0T A;  4IFD J;  1F2Z A;  3MEH A;  2VQE Q;  1GUS A;  1KDA A;  3TN2 A;  2B2Y A;  3PSI A;  3D31 A;  4KD3 A;  3ZJY C;  4X64 Q;  3GTO B;  4U68 A;  4YIJ A;  4DK0 A;  3CC7 A;  4DV1 L;  2Q2H A;  3FHW A;  5FJ8 G;  5I4D A;  1HFG A;  3MXG A;  2RSO A;  2CH4 A;  3TS0 A;  1LT6 D;  1MKH A;  1VF7 A;  2NTS A;  3U4Z A;  4L6T B;  3HKZ E;  3ERO A;  4J6H A;  4B3R L;  2CQO A;  4C3I B;  4OO1 G;  4HID A;  1STH A;  4KHZ A;  2K5D A;  1LAC A;  1KAW A;  1TWA B;  4QL5 A;  4OO1 I;  1Q46 A;  1NBW A;  2EJM A;  4F88 A;  1IBM L;  2BCO A;  4DPG A;  2L11 A;  5C3E H;  4DR6 L;  1TWG H;  4JI5 Q;  2JA9 A;  3D0F A;  2BDO A;  4B3T Q;  5HY6 A;  1CK1 A;  3RD4 A;  5A2Q E;  1EZ6 A;  4JI4 Q;  3HOW G;  1M4V A;  4C3H B;  1JJC B;  4GZY C;  4MZ9 A;  1PRT B;  1SBB B;  3X3M A;  5KRU A;  1VQC A;  3SDZ A;  2N88 A;  1S5E D;  1HNX Q;  2OEO A;  1HJP A;  1EEF D;  1OXX K;  3VA5 A;  4Q0F A;  1PH5 A;  1J5E Q;  2OQK A;  5EPJ A;  4YY3 Q;  4CDD C;  1EYA A;  2KQ3 A;  1STY A;  4CKE A;  3X3N A;  1TR5 A;  1TWH H;  3S14 B;  1HQR D;  1ZXT A;  3M4O B;  3K81 C;  1VQM A;  4NXM Q;  4TRD A;  5C0X J;  4DR5 Q;  2FXQ A;  5C0X G;  4OL7 A;  4B3S L;  2Q2U A;  4IJL A;  1B7Y B;  1EY9 A;  2JA7 B;  1HZC A;  2B2W C;  2F3I A;  2SEB D;  2YU9 H;  1ZKO A;  4QY7 A;  2MPM A;  1GJX A;  4HIM A;  4UDU C;  3U58 A;  4A3G H;  2K52 A;  2R92 G;  2C9O A; 
#chains in the Genus database with same CATH homology
 4FYD A;  1JE4 A;  3RLF A;  1CHQ D;  1BUV T;  5LHY 1;  4IQZ A;  2HDL A;  4A3D B;  4PMB A;  5JOB A;  1EZ8 A;  2F0V A;  2F0M A;  3SK5 A;  4RH6 A;  3A7L A;  3S17 B;  2XVS A;  5EBC A;  2EVB A;  3CU7 A;  3OWF A;  4BBR B;  5E3F A;  2QIL A;  1QJO A;  2M2L A;  3HOX B;  1HXY D;  1LT3 D;  4DN4 M;  3HP3 A;  2Z4I A;  2K05 A;  1MSG A;  3NQT A;  3BVG A;  5I9O A;  2MHV A;  4ABN A;  3BYT B;  3HOV B;  1ENC A;  3M3Y B;  1TVX A;  2K03 A;  3K7A B;  2F0G A;  1I6H B;  3O13 A;  1G2T A;  2F0K A;  1A6X A;  2RA4 A;  1B2T A;  4OHJ A;  1AFP A;  1WTV A;  5ELE A;  2K04 A;  4QIW B;  2AWO A;  3D4W A;  4K5W A;  3NTK A;  1SYC A;  3GP7 A;  3I4M B;  4NDX A;  5EJW A;  1DJR D;  1GHK A;  1ML0 D;  3NP8 A;  3L9A X;  1VMP A;  3PUW A;  3IFT A;  1B53 A;  4RGT A;  1BF4 A;  1KTK A;  4ZQ3 A;  4F8M A;  1LTR D;  3RZO B;  1WCM B;  2JYO A;  3QJY A;  3FDT A;  4K2K A;  2B2W A;  1LLR D;  3R2I A;  4IUT A;  2ZXO A;  2FJ2 A;  3TP5 A;  3J7Y W;  1EYC A;  3LX0 A;  3IFD A;  5KNC A;  5M9O A;  4RHR A;  5FLX E;  2FFK B;  3ONA B;  3TME A;  4WFN 3;  3LWU A;  5DNF A;  2L1B A;  2ZXR A;  3S15 B;  2O2L D;  5EKK A;  1V43 A;  1EY0 A;  1RCV D;  3BVM A;  4FF2 A;  1BR9 A;  5KNB A;  1GXD C;  4BS9 A;  2HDM A;  1TT2 A;  3HOU B;  3ZYY X;  1GHJ A;  4FF4 A;  1Z47 A;  2RDF A;  4DNT B;  3MXN A;  2EPB A;  5JVH 3;  5C44 B;  2PO4 A;  2AQ3 B;  3PUV A;  1SYE A;  3SK8 A;  1Y1W B;  5KIX A;  1EL0 A;  2A69 C;  1PRT D;  2A6E C;  2IWH A;  3OWE B;  1I4G A;  4LAA A;  4KJO A;  4ME5 A;  3MFY A;  1PZJ D;  4ID6 A;  1SYD A;  3NWS A;  3DEO A;  1CA5 A;  3K5N A;  2F0F A;  5CMD A;  2KEE A;  1I4X A;  3T4A C;  4RHS A;  2ICE C;  1HPC A;  1SJE D;  2EJG C;  2WAC A;  1TS2 A;  2R61 A;  3I73 A;  3Q24 A;  3I3C A;  5KND A;  2L5T A;  1PZK D;  1PYW D;  1A15 A;  3LNN A;  3D4D A;  1O7Y A;  1SEB D;  2PYK A;  3HKZ B;  2JP1 A;  1U4R A;  1PTO B;  3BDC A;  5M5W B;  3C46 A;  2HQE A;  1SXT A;  4MHE A;  1IHZ A;  2BE5 C;  2O4X A;  2NVQ B;  3GTL B;  2A68 C;  4UAI A;  1BBX C;  2B2T C;  4B9X A;  1J9O A;  1PLF A;  1LO5 D;  2NVX B;  1ZYR D;  1TII D;  3DMU A;  4C3I G;  5CV7 A;  3NTI A;  2Z4H A;  3SK4 A;  4K2L A;  3Q23 A;  4NMZ A;  2EJF C;  3VR2 A;  3AMU A;  1PRT F;  1DZ1 A;  1D5X C;  1H9K A;  1TS4 A;  3GTG B;  1DYQ A;  4A3J B;  4XT3 B;  3MZ5 A;  2G9D A;  1FD7 D;  3K5L A;  3PO2 B;  3PUZ A;  4HR7 B;  3S1Q B;  1WTR A;  4ULL A;  2JEB I;  2LMC B;  3S9W A;  1QCB D;  3VYS A;  4DK1 A;  5CV4 A;  1RF2 D;  3ERQ A;  1IW7 D;  3MC0 B;  5C4H A;  3DEP A;  4XT1 B;  1F9P A;  4S3S A;  4DAY A;  5D3D A;  3EFX D;  1L0X B;  3H94 A;  4EQO A;  5JEA G;  1V8Q A;  3JAM E;  5IOD A;  2VB3 X;  3TBI B;  1Y69 U;  5C3E B;  4K8J A;  3VYU A;  1B3A A;  1DOL A;  3FRP B;  1WD1 A;  1TWG B;  4DA2 A;  1F9Q A;  1EQV A;  4EVO A;  2JEA I;  1Q12 A;  2NWG A;  4CHT B;  3TZD A;  3FEW X;  1CM9 A;  2L12 A;  3D8G A;  5IGC A;  5BN4 A;  1SE4 A;  1U4L A;  2NN6 G;  2AUJ D;  1HHV A;  1S5C D;  3U9O A;  2B2T A;  1LT5 D;  3OIQ A;  2DY8 A;  3GTM B;  3BYY B;  4IUV A;  3SVM A;  4ZYS A;  1WVL A;  5JPM C;  4KD4 A;  4OIK A;  3K57 A;  4KHV A;  1X3Q A;  5J1Z A;  4L63 B;  1TS3 A;  4R8N A;  2YU9 B;  3CQZ B;  5C3W A;  2F0P A;  3Q0A A;  1DXM A;  1SFO B;  1RJT A;  3V05 A;  3J80 E;  2XRS D;  4FVM A;  3PIO 3;  1T5E A;  2IT1 A;  1T5X D;  5A2Q L;  1ILQ A;  1EFI D;  1B50 A;  4OO1 H;  3NSW A;  1WTW A;  2KJX A;  2KA7 A;  4KY7 A;  2PW7 A;  4DAV A;  1CFM A;  4AYB B;  4CGY B;  1LT4 D;  3HEJ A;  3VR6 A;  4RFB A;  5K36 H;  2QEJ C;  2K28 A;  5M5X B;  1GUT A;  3UI2 A;  3BDO A;  3W3A A;  1UNS A;  1PDQ A;  1PFN A;  2F4I A;  4HCE A;  4K5X A;  1D6E C;  2L0C A;  1SYG A;  3T13 A;  5E4W C;  3I4L A;  1QB5 D;  1A3T A;  1II3 A;  4P2C B;  5C5M A;  1KDB A;  1CHP D;  2LFN A;  1WTQ A;  1Q3L A;  5JAV A;  4LMQ D;  4XYQ A;  1EEI D;  1BOS A;  3FKI B;  1B9N A;  2LS0 1;  3EVQ A;  5T1G A;  4RKL A;  1UUP A;  4IFD G;  4DXF A;  1JCK B;  5FO7 B;  2KVM A;  2ID0 A;  2RDH A;  1VF5 C;  1EYD A;  5KGU A;  5C3X A;  1EOT A;  2AWN A;  1JOQ A;  1W6J A;  1U4P A;  1FNV A;  2I46 A;  1QG7 A;  5JJZ A;  1CT1 D;  4RCO A;  5HGT A;  2F0O A;  1DCZ A;  1XWE A;  1LTB D;  3J81 E;  4RGO S;  4H13 C;  4FF1 A;  1OXT A;  1HUN A;  1SMY D;  2J4X A;  1D5Z C;  1PTO F;  2EYP A;  3DM1 A;  4DGZ A;  4I65 A;  1RKN A;  1WTP A;  5D65 A;  2NTT A;  4BY1 B;  1QNU A;  3T51 B;  1LV9 A;  1ONL A;  2CW0 D;  5C4X B;  1LTT D;  3EA6 A;  1B1Z A;  1E0B A;  2AUK A;  3A8I E;  3FMC A;  1ET6 A;  4ZUI A;  4C1N I;  1HTL D;  3MXP A;  3C1E A;  3OPO A;  3PMF A;  4NKL A;  4FXD A;  1AP0 A;  5I2X A;  5EPL A;  2JA5 B;  4BA2 I;  5C0X I;  1BCP C;  2B8F A;  1UEA B;  1BXT A;  3I70 A;  4H0L C;  2A6H D;  1ZEQ X;  4IUP A;  1DOK A;  1HRJ A;  3KBX A;  4KTA A;  4QCL A;  5FOB B;  4RAU C;  4X3T A;  1LTI D;  5G3L D;  1HA5 A;  3I72 A;  1EY4 A;  2QF7 A;  4J1M A;  4FXG C;  2E75 C;  5IOC A;  2Z8L A;  4V19 0;  5IGE A;  3V96 A;  1AW7 A;  4B9W A;  2F0E A;  1PZI D;  2PMZ B;  4Z9C B;  1YNJ D;  1WD0 A;  5IT9 L;  2BA0 A;  1STB A;  1U9R A;  1TY0 A;  4BBS B;  1D1I A;  3NPP A;  4HAE A;  2IX1 A;  2F0W A;  1Y8O B;  4NW2 A;  4LK1 C;  4O1N A;  1HCZ A;  3NE5 B;  1SJH D;  2F0L A;  5M5Y B;  2IL8 A;  2RDG A;  1AN8 A;  5I2Y A;  4G4K A;  3MWY W;  3J7A V;  2E2D C;  2SNS A;  3BS1 A;  4KK7 A;  3FPU B;  3D4R A;  2EY2 A;  3L3O C;  2MP1 A;  1EY6 A;  2NVT B;  2IW3 A;  4KY5 A;  4C2M B;  1X32 A;  2EY6 A;  1KLG D;  3AU7 A;  4FO2 A;  3H3V C;  4R9W A;  5D14 A;  3L7Z C;  1A3U A;  5IGB A;  5EGT A;  4KKU A;  2YYZ A;  3V2T A;  1SND A;  2KCC A;  2TMP A;  2XNA C;  5ELC A;  5IGD A;  4G57 A;  4XXE A;  1PTO C;  1SNQ A;  2DN8 A;  2JSO A;  5CV5 A;  1TU2 B;  2O5I C;  2F0U A;  1DOM A;  4LJZ C;  3OW7 A;  2WV6 D;  1I4Q A;  3NXW A;  3EJI A;  1ICW A;  3MA2 B;  1I4P A;  4H7B A;  3SR1 A;  2ZT9 C;  1KNA A;  3U9S A;  4TKO B;  1DM0 B;  3A54 A;  4F87 A;  2J7Z A;  5KEE A;  4IUQ A;  5COR A;  3VYR A;  3K58 A;  3NQI A;  4KV6 A;  1FNU A;  2RVL A;  4O42 A;  4XQJ A;  4A3B B;  4TSS A;  3IKJ A;  3HOZ B;  3VA7 A;  2XWJ B;  2R7Z B;  2K01 A;  5ELB A;  1I50 B;  1X3P A;  3RMH A;  3MFG A;  2C5C A;  1LAB A;  4CKC A;  3KUP A;  4KY6 A;  4MIU A;  2K32 A;  2D5D A;  1F2L A;  1SNM A;  1JC7 A;  2E2J B;  3F2U A;  2RBM A;  2IX0 A;  2IPK D;  1ILP A;  2EZV A;  4RGM A;  1XTC D;  2M00 A;  5COY A;  1H9S A;  5LL6 X;  1NR4 A;  2EY1 A;  4FF3 A;  2KCN A;  2QCP X;  1IKM A;  4J8Q A;  5JEA H;  4DU9 A;  1H9S B;  1XX8 A;  4RA8 A;  4KI0 A;  2B2V C;  3J7A F;  2PPB C;  1M8A A;  1OXV A;  3P20 A;  2M9V A;  1VCI A;  1YNN D;  4PMW A;  2HCI A;  2EYF A;  1RD9 D;  1MBY A;  1ET9 A;  1TY2 A;  4X3S A;  2MGS A;  4BA1 I;  1RTO A;  2E2I B;  2G9H D;  1UAP A;  2Q8I B;  4PMC A;  4C3H G;  3J80 L;  4XYO A;  3OIP A;  1BQQ T;  5I6Y A;  2ENB A;  4F7X A;  3A8J E;  1BNZ A;  1EY7 A;  3DWA A;  2HUG A;  2EE1 A;  5FO9 B;  4CJ0 B;  1WTO A;  2QKI C;  3A55 A;  1JWS D;  2F0D A;  3BZD B;  3E5S A;  4MN3 A;  4BWG B;  2L9H A;  1I4R A;  3A7A B;  3BG3 A;  1PFB A;  4V0B A;  3M85 A;  1NUC A;  1Y1V B;  2WII B;  2Q8T A;  1KAB A;  5IGG A;  2J0T D;  1HA6 A;  1BDO A;  4N9P A;  5J22 A;  1GUO A;  2NB0 A;  3KK7 A;  1IYU A;  1PMR A;  3GTQ B;  2K6A A;  2R6G A;  1Z6H A;  3S2H B;  2K5W A;  1O7Z A;  2X69 A;  2B2V A;  4IUR A;  3VR3 A;  5CV6 A;  3FVQ A;  3S16 B;  3K59 A;  2XWB B;  3D6W A;  3G6J B;  1S5D D;  2NN6 I;  2VB2 X;  3E6Z X;  2X6G A;  4E6I A;  4C3J B;  1TWH B;  4RGN A;  2O5J C;  3SEB A;  3GO5 A;  3G7L A;  3H6M A;  2D2C C;  3CKI B;  3QIA A;  4QMG A;  2KOL A;  4QB4 A;  4CJ2 C;  1KLU D;  1QWY A;  3OMG A;  4FXK C;  4ZK9 B;  3SXH A;  4A3G B;  4ODG A;  4DXG A;  1ENF A;  1JQY D;  2F0J A;  5CBA E;  2FHT A;  5EKI A;  2B2Y C;  5D3I B;  3N52 A;  3PUY A;  2IJ0 A;  3GTP B;  1J8I A;  4KJN A;  2PNR C;  3EQL C;  2BDN A;  3R2T A;  4XQQ A;  4M8A A;  4CKB A;  2XN9 C;  3QG1 A;  1Q90 A;  2VXW A;  4HSP A;  3IAY A;  1ESF A;  4ZUJ A;  3SK6 A;  4A3I B;  3P1H A;  1PRT C;  2B63 B;  4U67 3;  1NAP A;  1WTX A;  1KNE A;  1PTO H;  3R3O A;  2WAQ B;  1H9M A;  3MVV A;  5CR3 A;  2PZT A;  2SNM A;  3RZD B;  4DFA A;  4WJW A;  1GUW A;  5M3F B;  2FMC A;  1EIG A;  5FO8 B;  2F3V A;  1HUM A;  5C0X H;  4A3M B;  1IYV A;  2EY5 A;  2PZW A;  4HN7 A;  1NR2 A;  1FGB D;  1JB3 A;  5ELF A;  3P7J A;  1I4H A;  1SNP A;  3MHB A;  2Z1C A;  1OXS C;  4RKB A;  2A73 B;  3H0G B;  2ZXP A;  1IL8 A;  2F0H A;  4EQN A;  1Q8I A;  4CJ1 B;  2DY7 A;  4IFD I;  4K6L A;  2CQA A;  2AQ1 B;  1S4Z A;  2NYZ D;  1A3V A;  2Q8R E;  2RQX A;  3S1N B;  1QE6 A;  1ZYR C;  3IL8 A;  4PNY A;  3QOJ A;  1G6Z A;  3HRZ C;  2XRQ D;  2FIN B;  5CGK A;  5KYL A;  4DF7 A;  2FMM A;  2F0Q A;  1C8C A;  1JOR A;  5JPN C;  4G7H C;  3R8B A;  2Y0S B;  2A69 D;  2A6E D;  5BN3 A;  4BY7 B;  2DNE A;  2L4N A;  2KUM A;  4OGQ C;  1FYC A;  1STN A;  2CVR A;  3TP6 A;  1RHP A;  2KED A;  5A35 A;  4OIJ A;  5IGF A;  1SDF A;  4A3F B;  4JBW A;  5ELD A;  1U4M A;  1TWC B;  2NVY B;  2D62 A;  3I8Z A;  1PFM A;  1IW7 C;  5K36 G;  4QUC A;  2E74 C;  4Q5V A;  3D6C A;  4EQP A;  5C4Z A;  3WOE A;  3A8K E;  2JA6 B;  3BVZ A;  2BE5 D;  5FLX L;  3T56 B;  2A68 D;  4HTH A;  3HS0 C;  5EBD A;  3HOY B;  5I9P A;  3I91 A;  5EQ0 A;  5CC4 A;  1TS5 A;  2V4D A;  3A56 A;  2SOB A;  1LTS D;  1TQO A;  1QIL A;  4DAP A;  4FP5 D;  3NUC A;  5C4J B;  1B4O A;  2SDF A;  5HUR A;  1HQM C;  3M4Y A;  3P75 A;  1LTA D;  3GV6 A;  4CBV A;  5FKA C;  1H9R A;  4HED A;  5F2D A;  3NK9 A;  2RKS A;  1JIC A;  1W6K A;  1ROD A;  5EPK A;  1IKL A;  5M3M B;  4XDX A;  1SE3 A;  3K0Y A;  1STA A;  2NZ1 D;  3KLS X;  5DM6 3;  2RSN A;  3KBG A;  1JWU D;  1E2Z A;  1EU4 A;  1QNK A;  2E2H B;  3OHX C;  4RCN A;  2LKV A;  4DNR B;  1R4Q B;  3VR5 A;  1MD2 D;  4H44 C;  2A5H A;  1CTM A;  4KKS A;  1EY8 A;  4C3J G;  5G3L F;  5BN5 A;  3CRL C;  2MJ8 A;  4IUU A;  2QDB A;  3MXU A;  2OT2 A;  1SYF A;  1GUN A;  1CI3 M;  2K33 A;  1Q1B A;  1EY5 A;  1FR3 A;  1BCP B;  3TSS A;  1SNO A;  1SNC A;  3DXJ C;  2LY7 A;  1MSH A;  2F0N A;  3W2D A;  1R9T B;  1F2Y A;  4N9T A;  2PZU A;  4X3U A;  1D2B A;  1D1K A;  1S5F D;  2WIN B;  2JA8 B;  1E2W A;  3K6O A;  3DUZ A;  4EGV A;  1TKW B;  3OSO A;  5K5P A;  2F0I A;  1O7L A;  2WB1 B;  1OXU A;  1KAA A;  4XQN A;  2EYL A;  3AB9 A;  2OF1 A;  2K1B A;  1GOZ A;  3K5M A;  4HCS A;  1E2V A;  4IUN A;  1AEX A;  3PV0 A;  2CHB D;  1G2S A;  3LWE A;  1Q1E A;  3N6R A;  2N55 A;  3HZX A;  4X3K A;  1V1P A;  1H9J A;  4M1U B;  3DWQ A;  5IT9 E;  2GA4 B;  4TQU S;  1SE2 A;  1G8Z D;  3QO2 A;  1V1P B;  3JAM L;  1AZP A;  4RWS C;  5TSS A;  3GV3 A;  3PUX A;  4ZKC B;  3I90 A;  1KDC A;  1SMY C;  4FNF A;  2F0S A;  3D3R A;  2I07 B;  3K5O A;  3QB3 A;  2ICI A;  4HMJ A;  5C6A A;  5CV9 A;  1EWC A;  5JVG 3;  4ILW A;  2CW0 C;  1R4P B;  5E4X A;  4XTC S;  2K5Q A;  3TZU A;  1K83 B;  5AFW A;  5EKL A;  1CA6 A;  4HMI A;  1STG A;  3M7G A;  2D9U A;  1F9R A;  3Q6S A;  1Y8N B;  1I6V C;  1SSO A;  1ENA A;  3HOW B;  1JOO A;  2WKC A;  3TP7 A;  4XIG S;  2OXP A;  2HCC A;  2EYM A;  4K5V A;  5DAU A;  3KLR A;  4ZRZ A;  2EYH A;  2H1E A;  2A6H C;  1VMC A;  2NN6 H;  3Q22 A;  4QUF A;  1LTG D;  1C4Q A;  1RDP D;  3URY A;  1JWM D;  1BO0 A;  3FPP A;  3VYT A;  2BOS A;  1O78 A;  1K8M A;  3NBI A;  3C2P A;  1S5B D;  4K8I A;  5CYU A;  1F2M A;  1K8O A;  3KLS A;  2R3Z A;  5LL6 S;  1HTP A;  2R92 B;  1YNJ C;  3SHL A;  1AZQ A;  2KEC A;  2EOT A;  3HG9 A;  1F9S A;  3T16 A;  5CV8 A;  1PXU A;  2H4O A;  1EWH A;  3ND9 A;  2B39 A;  1NSN S;  2AQ2 B;  5J39 A;  1O80 A;  4IZ8 A;  1A2U A;  4Y7N B;  1Z7T A;  5T1I A;  2VUM B;  4A3K B;  2XIW A;  3R93 A;  4ZKB B;  2VNU D;  3I4N B;  4IAL A;  3CRK C;  2TSS A;  3NHH A;  1MGS A;  3QWN A;  4IN3 A;  5JEA J;  1BCP D;  4ZAI A;  5DM7 3;  1JR0 D;  3NWT A;  3KF8 A;  3QOL A;  4K14 A;  1OO9 B;  2E76 C;  3H91 A;  2B2U C;  5CBE E;  2WKD A;  3DHQ A;  1EQT A;  4K6D A;  3SE0 A;  5IIF A;  2PCF B;  2KHS A;  1G29 1;  3MAQ A;  1XXG A;  1A2T A;  1MI2 A;  2IX3 A;  1L0Y B;  3GD7 A;  2F3W A;  1Y8P B;  4KKT A;  4KMU C;  3T53 B;  1QOH A;  2EDG A;  3M7N A;  4C1N K;  2F1M A;  1F77 A;  3RUZ A;  2MUY A;  3VR4 A;  4G7O C;  2X6L A;  4HSV A;  2L55 A;  4G7Z C;  2PW5 A;  1SYB A;  1G91 A;  4C56 C;  2DNC A;  1STE A;  5DEH A;  4IFD H;  1EIH A;  2NBF A;  3NTH A;  4A3E B;  2B8G A;  5ISR A;  3J81 L;  2WP8 J;  1V1O A;  3S1M B;  4I7Z C;  2PQE A;  5I6W A;  3HGB A;  1EU3 A;  4PQX A;  4QF4 A;  1VDZ A;  2F03 A;  4WRD A;  5FK9 C;  4A93 B;  3OMC A;  2K7V A;  3S1R B;  1BCP F;  3TP8 A;  1I3Q B;  4ZLT F;  1CQV A;  4JK1 C;  2EYJ A;  2R93 B;  1FNW A;  1D5M C;  2EYO A;  4PV1 C;  3NBH A;  1JOK A;  1B9M A;  2BA1 A;  3ITP A;  1GUG A;  1B44 D;  1ESR A;  4WOR A;  4L8J A;  4KN4 C;  3GTJ B;  3GQB A;  1RTN A;  3GTK B;  3TDQ A;  2EXZ A;  1CZW A;  4NP5 A;  3WDN A;  1HFN A;  2XSC A;  4B08 A;  2B2U A;  5NUC A;  1TWF B;  3S2D B;  1PTO D;  1SAP A;  2NUC A;  3C3L A;  2A74 C;  3E0J A;  3PIP 3;  3DWP A;  3WOF A;  3PO3 B;  3ND8 A;  5E1F A;  2JE6 I;  3BDL A;  2JXM B;  3C1F A;  5KYI A;  1CZG A;  5C5L A;  3CHB D;  3OOC A;  3MTS A;  1DD2 A;  1YNN C;  1NCV A;  3H09 A;  4KN7 C;  1XYI A;  1CQF A;  1DON A;  4R8I A;  1C48 A;  2F0T A;  4IFD J;  1F2Z A;  3MEH A;  1GUS A;  1KDA A;  3TN2 A;  2B2Y A;  3D31 A;  4KD3 A;  3GTO B;  4U68 A;  4YIJ A;  4DK0 A;  5I4D A;  1HFG A;  3MXG A;  2RSO A;  1LT6 D;  1VF7 A;  2NTS A;  4L6T B;  3ERO A;  4J6H A;  4C3I B;  4OO1 G;  1STH A;  4KHZ A;  2K5D A;  1LAC A;  1TWA B;  4OO1 I;  4F88 A;  2EJM A;  2BCO A;  2L11 A;  2BDO A;  1CK1 A;  3RD4 A;  5A2Q E;  1EZ6 A;  1M4V A;  4C3H B;  4GZY C;  1PRT B;  1SBB B;  3X3M A;  5KRU A;  3SDZ A;  2N88 A;  1S5E D;  2OEO A;  1EEF D;  1OXX K;  3VA5 A;  4Q0F A;  5EPJ A;  1EYA A;  2KQ3 A;  1STY A;  4CKE A;  3X3N A;  1TR5 A;  3S14 B;  1HQR D;  1ZXT A;  3M4O B;  4TRD A;  5C0X J;  5C0X G;  4OL7 A;  1EY9 A;  2JA7 B;  2B2W C;  2SEB D;  1ZKO A;  2MPM A;  1GJX A;  4UDU C;  2C9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...