3QOJA

Cryogenic structure of staphylococcal nuclease variant d+phs/v23k
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTKKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Determinants of pKa values of internal ionizable groups: properties of ion pairs in the protein core
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2011-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3qojA00
2ENBA 3OMCA 3SK6A 3NXWA 3OWFA 5EGTA 5IGDA 4K2LA 4KHVA 5CV6A 5I9PA 5IGFA 1KAAA 1NSNS 4PMBA 4RKLA 3NHHA 2M00A 5DAUA 3H6MA 5EKKA 3QB3A 5KYLA 1SNCA 2SNSA 2EYPA 1KDBA 4DU9A 5IGEA 2F0UA 1STHA 1SNOA 4EQPA 1SYFA 2F0LA 1SYGA 3D4DA 4S3SA 1SYEA 1SNMA 4LAAA 2RDFA 5E3FA 4DFAA 2PQEA 3E5SA 4ODGA 3U9OA 4E6IA 4RKBA 3NUCA 4KJOA 5IGBA 2RBMA 1A3TA 1EY7A 2PZTA 3SK8A 5IIFA 3SHLA 2F0EA 4HTHA 4ZQ3A 1EYCA 5CGKA 1EZ8A 2NUCA 2F0WA 5C5LA 3SR1A 1KDAA 4G57A 4EQNA 3HEJA 4F7XA 4WORA 2F0GA 5IGCA 5CR3A 5C4HA 1U9RA 3DMUA 4IUNA 2EYMA 3MZ5A 4ZUJA 1A2UA 5IODA 2EXZA 1ENAA 3OMGA 4QB4A 1STAA 3HZXA 3P1HA 4ID6A 3OSOA 1A3VA 5CV5A 2F3VA 4J1MA 3DHQA 4N9PA 5IOCA 1STYA 2F0DA 1SYCA 4NP5A 4K14A 4KY7A 3ITPA 5CV4A 3TMEA 3MVVA 4DGZA 3D4WA 3C1EA 1KDCA 3S9WA 5ISRA 4K8IA 1TT2A 4K6DA 3SK4A 2F0IA 3BDCA 4I65A 1SYBA 2OEOA 5EKLA 4NMZA 4WRDA 3SK5A 1SYDA 3MHBA 3D8GA 4K5WA 4B9XA 5KGUA 5J22A 2PZWA 1II3A 4YIJA 5JAVA 2EY6A 5DEHA 2KHSA 2EYJA 3P75A 4J6HA 4F8MA 1TQOA 2F0FA 2F0SA 2F0NA 4H7BA 4K5XA 2PW7A 4QF4A 3D6CA 2F0MA 1A3UA 3EVQA 2HQEA 5I6WA 4R8NA 3T16A 4EQOA 5IGGA 3C1FA 2EYHA 3MXPA 1RKNA 2EYFA 2WACA 4HMJA 2F0HA 4KTAA 3R3OA 4KV6A 4QMGA 5C5MA 5NUCA 2SNMA 5CC4A 5KIXA 5C6AA 2OF1A 5E1FA 2F0QA 2PZUA 1F2MA 1EY6A 5HURA 3TP7A 2F0TA 1EY0A 2O4XA 1EY5A 1EY9A 2F0JA 2LKVA 4KD4A 1A2TA 2QDBA 4PNYA 4KY5A 2F3WA 5KRUA 4K2KA 1KABA 3MEHA 4OL7A 3EROA 3LX0A 2F0OA 5CV9A 1EYAA 4K5VA 4KD3A 5C4ZA 4ME5A 3TP6A 5HGTA 4ZUIA 4N9TA 4K8JA 2EYLA 1JORA 3TP5A 1STNA 2EYOA 4TRDA 1AEXA 1SNDA 2KQ3A 1IHZA 3EJIA 5C3XA 3ERQA 1STBA 2F0PA 2F0VA 4HMIA 3PMFA 3QOLA 4PMCA 2OXPA 5CV7A 3QOJA 3T13A 5K5PA 5J39A 3TP8A 3RUZA 1EZ6A 4B9WA 3NQTA 4KJNA 4NKLA 5CV8A 4IALA 1STGA 1TR5A 5J1ZA 1JOKA 3BDLA 4MIUA 5JOBA 3VA5A 4EVOA 1JOQA 2EY2A 1EQVA 2F0KA 1SNQA 2RKSA 4NDXA 2PW5A 5M9OA 1F2YA 2SOBA 3NK9A 4KY6A 1EY8A 2EY5A 5KYIA 1NUCA 1JOOA 1SNPA 1EYDA 1F2ZA 2PYKA 3NP8A 5KEEA 1EY4A 4DF7A 3SXHA 5I6YA 5C3WA 2EY1A 5I9OA 1ENCA 4IZ8A 5F2DA 3V2TA
chains in the Genus database with same CATH superfamily
2ENBA 4IUVA 2KBNA 2NN6G 1VQFA 1ET9A 4DV1Q 2EYPA 1SYFA 1MD2D 2KHIA 4CBVA 1LABA 2GA4B 2Z6KA 1DJRD 2GN5A 4KJOA 3CAMA 1PH9A 2NWGA 2GVBA 2QEXA 3K0YA 1JWSD 3LGJA 1QE6A 5ELDA 2AQ2B 2A73B 1G291 1VQLA 3S14B 4RGNA 4A3MH 1RL2A 5JJKA 4FDBA 3A0JA 1EYGA 1PRTB 3GQBA 3HZXA 2G5DA 2EXDA 3DWAA 1PTOH 1VDZA 1C4QA 2IT1A 4P74A 3C1EA 1KDCA 3GV6A 4DXGA 3BDCA 1SYBA 4B9XA 3S1RH 3FKIG 2D5DA 3D8GA 3HKZG 4FXKC 4OXPA 4JOIA 3M4YA 4DR6L 1YIJA 4KHZA 4KN7C 1R9TB 2L5TA 1SJED 1GXDC 2QILA 4KHPL 5KIXA 3J81i 1YNXA 2ZJPA 5E1FA 4B3MQ 4GLAC 4UY8C 1IZ6A 3KF6A 2YTXA 2PNRC 1X3GA 3K5NA 4FYDA 3LNNA 5CYUA 3TP6A 4N9TA 2R92B 1HNZL 3D0FA 1QVFA 4JVZA 3FKIH 3ERQA 1ZEQX 1YNJC 3PUYA 1J9OA 4RWSC 3WDNA 1LTGD 1TY0A 3A5UA 4JYAQ 2I5HA 2B2UA 3CP0A 2B2WC 1CKOA 1CT1D 4JW0A 4UP9A 1BCPC 1E0BA 4GKKQ 3HOXB 3GTOH 3FEWX 4DV0Q 2OQKA 4KHVA 1SMYC 1B53A 1NSNS 4XQNA 2PNHA 1WD1A 4Y52H 2H5XA 4M8AA 4DR7L 2DUDA 3URYA 1KDBA 4A3KB 4DAYA 3UDFA 1TWHH 1KXLA 5E3FA 2YYZA 2R93G 4XQQA 2PMZB 1PRTD 1B9NA 2B2YC 3BVGA 2AWNA 5CGKA 4CHTB 5I9PA 1QNUA 1IYVA 1EEID 1JJCB 2WAQG 2CWPA 4CDCC 2RVLA 4IUQA 2Z1CA 5IT9E 2WB1B 2L0CA 2KOLA 4RHRA 1FNUA 2B2VA 5D3IB 3HOWB 3P20A 2BH8A 1E22A 3HP3A 4DGZA 3G71A 1Q82C 1Y1VB 5IP7H 2J0TD 4K6DA 4DV4Q 1SYDA 2KECA 1Y1VH 4B3RQ 1HQRD 2R93H 4JBMA 5FLMG 1CKNB 2QF7A 3CCJA 2F0NA 1QJOA 2Z0SA 1GVPA 3GTKB 3MXGA 3DLLA 1FR3A 5HY6A 4IUTA 2ASBA 2AUKA 2N49A 2C35B 1SMYD 1F2MA 2PZUA 3DWPA 4LJZC 4TVAB 4I7AA 1EY9A 2RA4A 5M5XB 1I50B 3DM1A 3J81j 1B1ZA 3M4PA 3OYYA 1E24A 1NBWA 1PH6A 3X3MA 1U4RA 2PQAB 3GD7A 1EIFA 2EYOA 3KK7A 1AEXA 4BWGB 4CGYB 1Y1WG 3K80C 1PFSA 2HCCA 5CV7A 3T13A 5K5PA 2B63B 2RSNA 1GUWA 2K52A 3RUZA 1EZ6A 4B9WA 2IJ0A 4A3EH 3NTHA 3MFGA 2H4OA 1DOKA 2A69C 1KQSA 3GP7A 1NR2A 2R7ZG 3NK9A 1EY8A 4R4IA 1XNRQ 1FL0A 2JA7B 1PYSB 3K58A 4YCVA 1EY4A 4KMUC 5C3WA 1YITA 1CM9A 2ES2A 4HSVA 1VQMA 3M4QA 5EGTA 5EJWA 1I94Q 1X6OA 5JJLA 1VQ5A 1KAAA 4NB3A 1CUKA 2XVSA 1PDQA 5FOBB 3GTPB 1CSQA 4R9WA 2JA6G 3GTQB 3QB3A 4A3DG 2SNSA 2E2DC 3MC0B 1TWCH 1XTCD 5E4XA 1G91A 2JA9A 1AZQA 1PRTF 4ODGA 2JJQA 2K04A 5M3MB 4GLVB 1KRSA 1QUQA 4G7HC 4IFDI 1Q3LA 1WTHA 1B4OA 2MUYA 3EIVA 5JPMC 3HS0C 4F7XA 2KCCA 4JI6L 3H3VI 2X6GA 4X65L 2DGYA 2ZJQA 2EXZA 1TY2A 1IBKL 1H9RA 1A62A 4IUUA 1QNKA 3EA6A 3RD4A 4X6AH 1B70B 1MJEA 1KD1C 3NWSA 1M4VA 2PQAA 3S1RB 4IPGA 1D5MC 1KAWA 3DWQA 3IAYA 1K83H 2AMCB 3P75A 1VQOA 3HOWH 4DPGA 4H7BA 3BZCA 1K3BC 3CPFA 1OXVA 2WACA 4KV6A 2F0HA 1NNXA 2R7FA 4RCOA 3PF5A 1EUJA 1HHVA 1Q86C 1O7IA 5AJ3Q 5EPKA 2E2JB 3S15H 1HNWL 4NW2A 3HOUH 3E0EA 1O7ZA 5CMDA 3HFZB 2NB0A 1IHZA 1V1OA 3S1MB 4NXNQ 4RA8A 1ZXTA 2ZXRA 2B2WA 2QW7A 1VQ7A 4YCWA 4A3JH 3RZOH 4K6LA 4BBRG 5EPLA 1WTPA 2E75C 3HOXH 4L5TA 2MPMA 4A3CG 2JA5B 1F2YA 4P71A 4IFDH 3AYHB 1Z9FA 1EOVA 2ZM6L 4LFBQ 1EYDA 3GTKH 3CCEA 2F4VQ 2EY1A 2EZVA 1K83B 1K8OA 1BCPB 1MIUA 3K57A 1HNWQ 4DAYB 1CA5A 4PMBA 2B8FA 3H6MA 4ABNA 1VQNA 4A3FG 1BO0A 4A3DH 3RNUA 4RFBA 1XNRL 4FO2A 3J80c 2JE6I 2L12A 1F2LA 1YHBA 3H0GG 1EU3A 1HZ9A 1Y8OB 4DAMA 3H0GH 2KCNA 1SLJA 1N33Q 1OXXK 2A6HD 4C3IH 1STEA 5IGCA 3EBEA 4ULLA 4AH6A 5IYCH 4XT1B 3OMGA 4JOIC 1STAA 2VL6A 1PH1A 4KLKA 1A3VA 4ZCKA 1XMQL 3K5OA 2TSSA 3SGIA 1L0YB 3L0OA 2FMMA 2HHHL 4A3KH 4RMFA 5CBEE 5IYBH 4O42A 4OO1H 5FKAC 1YBYA 3EQLC 4IJHA 5DEHA 2KHSA 3IRBA 4O0AA 2CFMA 5C0XI 3C46A 1HR0W 3D6CA 2UUBL 2JA7H 1YJ9A 4KTAA 3BYTB 2TMPA 2A6EC 2O2LD 1EQTA 1XMOQ 1JR0D 1YHQA 3S14H 3FP9A 1V1QA 1H9KA 4OWWB 3FMCA 1GKHA 1VF5C 4A3BH 4K2KA 2A6ED 3HOVG 2VQFQ 4LF9Q 5C3EH 3W1BA 4IQZA 1I4QA 1HZAA 5C44B 3A7LA 1LLRD 1STNA 1ILQA 2KHJA 2A69D 1UEAB 1AH9A 1DCZA 1X65A 2VY3A 4MTNA 4Q5VA 3J7YW 2KEDA 1A15A 3NQTA 4KJNA 1ZYRD 2VW9A 1A6XA 3MFYA 4C56C 5M9OA 1B2TA 3HOVB 2IL8A 5DM73 2VQEQ 1NAPA 3I4OA 3PO2H 1SRUA 5E4WC 1XNQQ 2K28A 4FF1A 4ME3A 2ICEC 4A93G 1PH8A 4N8FA 4XDXA 1HNXQ 4K0KL 1M8AA 1OXSC 4OGQC 1P8LA 3NELA 4EX5A 4A4IA 5KNDA 5IGEA 4EQPA 1SYGA 4DFAA 1GUTA 3A8JE 3U9OA 2RQXA 4LWCA 2KEEA 1LM0A 2PPBC 3W3AA 3G4SA 4DV7Q 1TWAH 1UNSA 1V1PB 1EFWA 1QB5D 3A74A 1Q1EA 3H3VH 1VS0A 1ONLA 3U50C 1WTRA 1I6HB 3MZ5A 1ZKOA 3PSIA 2VB2X 5A2QL 4GN5A 1PHJA 4OO1G 3P1HA 1HXYD 4HCSA 4POGA 5ELBA 2EVBA 5FO7B 4JI2Q 1SYCA 1L1OA 3CQZH 3S2DB 1PXUA 4ALPA 3TS0A 4JI0Q 1J8IA 1RTOA 4I65A 5GROA 2OQ0A 1X56A 1HNZQ 2M2LA 3VR6A 4QQBX 1JC7A 1JQYD 2ZT9C 4HIOA 2EYJA 4F8MA 3SEBA 2UXBL 2WAQB 3U4ZA 2CVRA 4CDEC 4P75A 2A68C 5IGGA 2HCIA 3MXPA 4RG1A 3DM3A 5EKIA 4DR4Q 3H91A 4IO9A 2KUMA 3R2IA 1CQFA 4JYAL 3GTMH 1I4XA 2OCEA 4JI2L 4ZLTF 4HJ5A 1WJJA 5GAGC 3CCUA 1U4LA 4DN4M 1W2BA 1JB3A 2EYLA 1CHPD 3A5ZB 4TRDA 3HKSA 4HAEA 2K75A 4LUVA 1XPOA 4A93B 1CK1A 4OIKA 1A63A 2QEJC 2Q8IB 4DR1L 2RF4A 2K5VA 4AQYQ 1XTDA 2F3IA 2EY5A 3GTGB 4IFDG 3P7JA 4TKOB 4ZK9B 1WTWA 2FINB 2R92G 2CHBD 2RDGA 2V1CC 3NWTA 4RGTA 4YY3Q 4JI3Q 4BXXG 5A35A 2E8GA 2XWBB 4IUPA 1B7YB 4PZ7A 1TVXA 2MO0A 1AP0A 3CD6A 2M00A 5ELEA 4R8IA 3AEVA 2EE1A 5BN3A 4DU9A 5TSSA 4JI8Q 4S3SA 2B39A 1VQCA 5LL6S 3E5SA 3G48A 1UAPA 2IHEA 3RLFA 4V190 1HA6A 2BOSA 1EY7A 1H9SA 3SK8A 4LF5Q 2JYOA 3K0XA 1PYBA 5C5LA 4A3MB 3JAME 1BCPD 1GHKA 2CH4A 5I2XA 5M5YH 4DV3Q 1I4PA 1N36L 4CKCA 1S5BD 3D31A 5G3LD 5IYDH 4ZYSA 1ENAA 4X62Q 5D3DA 2FMCA 3DXJC 4DV0L 5JEAH 1T5EA 2PCFB 4J1MA 1RTNA 4N9PA 1TXYA 3TDQA 4KY7A 1GUNA 3OTOQ 2I46A 5IYBG 1YNND 4HEDA 3HOYB 4QIWB 1QCBD 5JAVA 3PGZA 1G51A 5C0XH 3Q22A 4A3GG 4J6HA 1SMXA 4IOAA 2JXMB 4OWTB 4OELB 4HR7B 4X64L 5I4DA 5EQ0A 1MHWC 3T16A 2EJGC 1UUPA 3SVMA 2EYHA 5DLQE 2EYFA 3J81c 4LMQD 1S72A 2ID0A 4A3LH 4GZYC 2DY7A 4P73A 2LMCB 5FLXc 2K5DA 3GDEA 4HJ8A 1YEZA 4LFCQ 2DJGC 4JBWA 1N32L 2VS1A 4RGMA 2B63H 4C3JH 3EROA 1Q7YC 2UXBQ 2B2TA 3L3OC 2R7ZB 2CCZA 1S3OA 4K8JA 3HOUB 4XYQA 1WFQA 3EJIA 4R4CA 1S5ED 2B63G 2OXPA 4C3HB 1JORA 5M5XH 4LF4Q 3TS2A 2N88A 3I4MB 1IYJB 5K36H 2F0KA 1CKNA 4LF6Q 4C2MH 1BKBA 1JWMD 5M3FB 1PTOF 1BNZA 1F2ZA 1SE8A 5CBAE 1IW7D 2L9HA 2SEBD 3T56B 2UUCL 1PH2A 1VQAA 1BUVT 4CDDC 4A75A 4G7ZC 1N33L 4A3CH 3PO3H 4QUCA 1PFBA 1KHIA 4JV5Q 1RCVD 1TU2B 3CC7A 1EWHA 1DGSA 1I4GA 1WTXA 1DXMA 1XWEA 3BJUA 2BA0A 3PV0A 1VQJA 1S4ZA 2HDMA 1LACA 3AQQA 2HQLA 2N78A 3TREA 1H9SB 1YZ6A 2F0GA 2NVTH 4DR3L 1YNNC 4BY7B 2A68D 1IKLA 1I3QB 2EYMA 5IODA 4I7ZC 3OIQA 3DUZA 2WB1G 5LMNL 2WFWA 3DHQA 4QGUA 1STYA 5FLMH 3TZDA 4K14A 3ITPA 2UUAQ 4EGVA 3D4WA 2OWOA 4KN4C 3BDOA 3SK4A 5J39A 5KGUA 1GUSA 4GOPC 1H9MA 1PLFA 1SXTA 1OO9B 4X62L 2NVYH 3W5OA 2L11A 2VXWA 4DR2L 2K05A 2Q2UA 3TBIB 4OONA 4R4QA 3FVQA 4X66Q 4ZAIA 1N9WA 4DV5Q 2LXKA 3T4AC 4QL5A 2NYZD 1Z47A 1CFMA 3I72A 1G6ZA 1LYLA 1L2FA 4KK7A 3RZDB 1HZBA 5G3LF 1EWCA 3D4RA 1BBXC 1W3SA 3CF5A 3H15A 4A3DB 1SJHD 1L0XB 1KTKA 4H0LC 1V43A 3R8BA 2QA4A 4BBSB 2NN6I 4J8QA 2AUJD 4BA2I 3I73A 1D8LA 1Y8NB 1B3QA 3RMHA 3VA5A 3PF4A 1BBUA 1EQVA 3HOZG 4NDXA 4LF8L 2DNEA 2K4KA 3KUPA 3BVMA 3BZDB 4LUZA 2LY7A 4OWXB 1KC8C 3C2PA 4BBSG 2Z4HA 1DD2A 1S5CD 1XX8A 2GVAA 5T1GA 1D5XC 1V8QA 4C1NI 2EDGA 2CWAA 4IPDA 1WTQA 1GJXA 1GHJA 1SFOB 5KYLA 2OTLA 3CCQA 2F0LA 2J7ZA 3LWEA 4JI1L 5JJZA 2Z9HA 1B44D 4HCEA 1TWFB 4KKSA 3S15B 4QY7A 1ASYA 1CHQD 4DUYQ 3SR1A 1FGUA 2B2YA 3HEJA 1LT4D 1PH4A 3I7FA 5GQOA 4IUNA 1Y14B 1CQVA 4HJAA 3UDGA 3CMEA 3DEPA 3FDTA 2A6HC 2NVXH 2A8VA 5C3EG 1XJVA 2R61A 2QKIC 4RHSA 3Q23A 1LTRD 3HRZC 3GTJB 4JI1Q 2NTTA 5EKLA 1Y1VG 1E2ZA 1ICFB 2PZWA 3L7ZC 4XXEA 1N34Q 4UAIA 1C8CA 3HOWG 3K7AB 2MQHA 4DV6Q 4O2DA 4K5XA 1HZCA 2L15A 5HGQA 4NXML 3A7AB 3I3CA 2VB3X 3NSWA 5C5MA 1AE3A 1EOTA 2ATWA 3IFDA 5K36G 2BE5C 4GN3B 2XIWA 4DAPA 1A2TA 2H1EA 3J7A5 1Q90A 1KABA 2K01A 5BN4A 2F0OA 4KD3A 4AIMA 1VQ4A 1KNEA 1HNXL 3KDFB 3WOEA 3KOJA 3MXUA 1YI2A 3M4OH 2XTIA 4TQUS 3I4NB 2F0PA 2K7VA 3GTQH 4X66L 5D14A 2FJ2A 3RLNA 1QZGA 3KBXA 5JEAJ 3W1GA 1YNJD 4H02A 1MBYA 5JOBA 4HJ9A 4EVOA 3MWYW 2EY2A 2RKSA 4L5QA 3I55A 1E1TA 4NPSA 3BVZA 2SDFA 5GAEC 3J7ZC 3M7GA 3VYUA 4C2MB 1D6EC 2ALYB 3MEFA 2PMZE 2X69A 4K2LA 4IPCA 4DUZL 3VYTA 4GKJL 1IXRA 1R4QB 3HGBA 3H09A 3D4DA 3M9BA 1PTOB 4GOPA 3NENA 2RSOA 1YJWA 1EIGA 3KJPA 4G7OC 1SR3A 3B6YA 3ND9A 4R4OA 2F0EA 4A3JG 4MZ9A 4DK3C 4YHHQ 2E76C 4EQNA 4B3SQ 1FNVA 3WWVA 3AMUA 3QG1A 2A5HA 1U9RA 4ZUJA 4L5SA 1A2UA 2VUMH 2OT2A 3T51B 2UU9L 2IHFA 3KYHC 4IN3A 1JB7A 5IYDG 1HR0L 2EIFA 2D62A 1WVLA 4GKJQ 2Q8RE 4BY1H 3C3LA 1NCVA 4MN3A 4DUYL 2ZXOA 3MXNB 1MKHA 3J81L 2Q2TA 1H9JA 1ESRA 5C0XG 3KFUA 3PO3B 2EY6A 3PCOB 2JQOA 3KLSX 3UE0A 1SAPA 2F0SA 1J6QA 1HFGA 4XQJA 4RAUC 2PW7A 4QF4A 2YU9B 1HFNA 1GO3E 4A3MG 4DNTB 3EVQA 3CW2C 3A54A 2JA5H 3K81C 1W6JA 2ICIA 2NVQH 4A3JB 3RZOB 2K5WA 1FD7D 1TWAB 1VQBA 1K28A 1WTVA 4GKKL 1KIXA 1SE3A 2NTSA 4YY3L 4L63B 3F2BA 2UXCL 3TRZA 3ZYYX 1MI2A 3CCRA 1QVGA 2NN6H 4MTKA 3S1NH 4DR6Q 2AWOA 3L9AX 3E0JA 2BH2A 2Z6BA 4LW1A 4X3SA 2NBFA 4IOCA 3ULPA 1LTBD 5CV8A 4C1NK 1K8AC 1CKMA 4MIUA 1ZYRC 5M5WH 2ZTCA 2PW5A 1BBWA 1S5DD 2Q8TA 2K1BA 3T1YL 3STBC 5EPJA 1KNAA 1GOZA 1SE4A 2YU9H 3CC2A 2FFKB 3PUWA 1ENCA 2QGQA 1WCMH 1R4PB 4HIKA 3D6WA 1C48A 2LSSA 1HRJA 3I70A 2UXCQ 2IW3A 3CC4A 4IFDJ 3NHHA 2XWJB 4GS3A 3RLOA 1SNCA 2EJMA 1QZHA 5I2YA 3M4OB 1STHA 4BBSH 4LK1C 1IBKQ 2K14A 2RDFA 4DV4L 1EQQA 2WB1E 2MHVA 3MA2B 2UUAL 1T5XD 4U68A 1RHPA 1LTID 1SSOA 4C3IG 4A3EG 5EBCA 4QIWE 3T1YQ 1QUQB 5CR3A 1LT5D 1SEBD 3I56A 3KF6B 4WJ4A 2UXDQ 3J80i 4JI7L 4JBJA 4LF7Q 3M3YB 5IOCA 4IURA 4B3TL 3NEMA 3G7LA 3NBHB 4K8IA 4YWMA 5IT9L 2Y0SG 3VYRA 4A3FB 4C3JG 4F87A 1NY4A 4K5WA 3BG3A 4A3FH 4OO1I 4DV2Q 3KDFA 2IX0A 4ZRZA 5C4XB 2EJFC 1J5EL 4LUOA 3UI2A 4EQOA 1A0IA 1KRTA 1EL0A 4Z9CB 1BOSA 1L1OB 1RD9D 1IYUA 5CC4A 4NXNL 2BDOA 1DM0B 1U5KA 1I6HH 3IFTA 3CCMA 2IWHA 2O5JC 4PQXA 4JI7Q 4LF7L 2R7DA 4FP5D 5KRUA 1IL8A 4B3TQ 4XIGS 4OL7A 3O13A 1O78A 1WYDA 1JE5A 2N3SA 4WJWA 3T1HQ 1I94L 3I8ZA 3N6RA 3I4MG 4JV5L 1V1PA 1LTTD 1GD7A 1PYWD 3AFQA 1G2SA 2I07B 2JEBI 1E2VA 2F0VA 3KLSA 1VQGA 4DR4L 1J5EQ 3F8TA 1JICA 3OHXC 4FNFA 1HPCA 1XXGA 1M1KC 1JOKA 1ML0D 3CCSA 1EQRA 1CZGA 3J80E 1W6KA 1X54A 3S2HB 4JI4L 3PO2B 4CKBA 2C9OA 3GV3A 1FNWA 1VQ6A 1FGBD 4JI6Q 1WI5A 1NUCA 3HOZB 5KEEA 4DF7A 4X65Q 1Q8IA 5F2DA 3HG9A 3KJOA 1XPRA 1SBBB 1RDPD 3KBGA 1JMCA 5EKKA 3U4VA 3K7UC 4AQYL 1SYEA 4LF4L 1CZWA 4E6IA 4B08A 1D2BA 2RBMA 5IIFA 3JAMi 1M90C 2HHHQ 1Q8KA 2F0WA 2AKWB 1KDAA 5AFWA 1PZID 1RODA 1IW7C 2HDLA 2A19A 2Q2HA 4QCLA 4H44C 1FYCA 1OXUA 5JVG3 4PG3A 5FK9C 2HD3A 4ID6A 1X3FA 1MGSA 5DNFA 1I4HA 2PO4A 2MNAA 3TSSA 4UDUC 3NTIA 2NVYB 3ERSX 1EEFD 5CV4A 4AYBB 5H1SE 1CSPA 1X3PA 1XMOL 1AFPA 1TT2A 1SFOH 3ICEA 2OEOA 4WRDA 2B3GA 4FF2A 3I91A 2RCNA 4YIJA 4CKEA 2E2IB 5FO8B 4LF9L 1PRTC 1XYIA 3VYSA 1Z7TA 3Q0AA 5LMNW 1EIYB 2D0PA 2O5IC 1UEBA 5IT9c 1X9NA 3ULLA 3NE5B 3OTOL 5BR8L 2MP1A 3VDYA 2IY5B 2SNMA 2VUMB 5KNBA 1I3QH 2F0QA 5JJIA 5HURA 1BR9A 2F0TA 1JWUD 1BDOA 4F88A 2CW0C 2F0JA 2NVTB 1EU4A 2QDBA 4PNYA 1Y1WH 3U58A 2JA8G 1K0SA 2YTYA 2K5HA 4DV2L 1NR4A 3X3NA 4B3RL 3I4NH 2G9DA 2CH4W 1WTOA 3L2PA 2Q2IA 4BBRH 1PMRA 5C44H 1Y69U 1E7ZA 2DN8A 4TSSA 1SNDA 4UP7A 1L1OC 2JP1A 2J4XA 4PMCA 3QOJA 3TP8A 4A3BB 2A1AA 3S1QB 2LS01 4QJFA 4IALA 1STGA 4UP8A 4A76A 1JOQA 1SN8A 1S5FD 2DNCA 5M3FG 2HIXA 5ELCA 3F1ZA 1OXTA 5C4XH 4PZ8A 4IZ8A 2QCPX 2N8NA 3V05A 5IP7G 4JI5Q 1XMQQ 4BXXH 4AYBE 3PQIA 1F9RA 1O7YA 1FJGQ 5IE8A 5C0XJ 3Q8DA 2Y0SB 2C5CA 1SNMA 5GAHC 4J15A 1HTLD 4L8JA 1PZJD 3S16B 1OTCA 2NVXB 1N34L 2E2HH 2FXQA 1ASZA 3H3VC 1YVCA 2F52A 4DK0A 5CORA 1QG7A 1TS3A 4LFBL 2IPKD 1JJ2A 2F4VL 2K6AA 2X6LA 1TS4A 1NE3A 3PIP3 1GUOA 2CQOA 2WKCA 2XGTA 4DXFA 2BCOA 4JI5L 1TWGH 4LFAQ 4A3GB 2P5ZX 4Y7NH 4KHPQ 3BZKA 3W2DA 1XPUA 2R93B 3MVVA 1I4RA 1VMCA 3CRLC 2WV6D 4KKTA 5J22A 4DR3Q 2NZHA 4O1NA 1HTPA 2MO1A 1UWVA 1WCMB 4N8X1 4DK6C 1IBML 4Y7NB 2E74C 1TWGB 3MAQA 2BA1A 3CXCA 3QR8A 4GNXC 3QIAA 4HMJA 1RKNA 3S2HH 3R3OA 5FO9B 1BCPF 5C6AA 2B2VC 5JPNC 1EY6A 1D1KA 3TP7A 5M5YB 1EY5A 2KCTA 2DJFC 2LKVA 1T9HA 5JVH3 2VQEL 1NTGA 2F3WA 1K73C 4DR1Q 2OTJA 5J3BA 2JA8H 1LUZA 3ZJYC 3PUVA 2EOTA 1AW7A 5ELFA 4UPAA 3MXNA 1X3EA 4BY1G 3UE1A 4K0KQ 4DR2Q 4DUZQ 1TWCB 3QWNA 1ICWA 2JEAI 5BR8Q 5EAYA 3F2DA 2AHOB 4NXMQ 4JBKA 1EFID 1DONA 5IY0A 1VQ9A 3BDLA 2EPBA 4JI8L 2E5LQ 4OHJA 1C9OA 4KY6A 3PIOA 4DV7L 4CJ2C 4B3SL 3GTLB 1VQDA 2PYKA 1N8RC 4LF5L 3ULJA 5FJ8G 3JAMc 4RCNA 4ZKBB 3NXWA 2G9HD 4GOPB 3S1QH 1PH3A 5IGFA 4DA2A 2NZOA 2Y0SE 1O7LA 3FKIB 3HKZB 3NPPA 3G6JB 3OW7A 4R4TA 4LF8Q 4UHVA 2RHQB 1UE1A 1RF2D 2PQEA 4JPBW 1TS2A 5GADC 3E9HA 5IGBA 3A55A 3K5LA 3CCLA 4KKUA 2MGSA 3FPPA 1PZKD 2KA7A 5C4HA 4DNIA 2QDLA 1PV4A 2DY8A 4FXDA 1FJGL 2LFNA 2WINB 4ILWA 5C4JB 3IKJA 1PVOA 1ENFA 2M9VA 2K5NA 2RHSB 3S16H 3AB9A 2F3VA 1Q12A 5FLXE 1IL2A 3D3RA 5A2QE 1KLUD 1D7QA 1ESFA 1NJIC 1II3A 1GUGA 1NMFA 1WOCA 1TQOA 1K8GA 3OWEB 3AFPA 3K5MA 1HCZA 1TKWB 4U673 1HUNA 3CRKC 3OIPA 4Q0FA 3R93A 3EN2A 1TS5A 4FVMA 5LMUL 3I4MH 4HIDA 1KL9A 4A3KG 4L5RC 4C3HH 1DZ1A 4LF6L 4DK1A 1IBMQ 3RR5A 2JA5G 4JI3L 1TWFH 1L0WA 3I4NG 1UE7A 4BBRB 3LWUA 1MJCA 1TWHB 2I5MX 5C3XA 4DAVA 3PMFA 1S40A 1I50H 2MJ8A 1TR5A 4APVA 4P72A 1SNQA 1UE5A 3E3XA 2SOBA 3VA7A 5LMUQ 3HOZH 3I2ZA 5ELNA 2XN9C 4PZ6A 5M3FH 1JOOA 1SNPA 3SXHA 4DKAC 3V2TA 4A3IH 3OMCA 2XSCA 3SK6A 2VUMG 3OPOA 4JCVE 1HUMA 4CJ1B 1ET6A 2UXDL 4MNOA 1F9SA 4CDFC 1E1OA 3I90A 2XRQD 1CA6A 3DEOA 1IBLL 2F1MA 4BY1B 5C44G 3E6ZX 4LAAA 3G6EA 2B29A 4A3GH 2KVMA 4RKBA 3J7AF 1I5FA 3T53B 3NBIA 5C3EB 1EYCA 2F03A 3FRPB 1SROA 2RCFA 2K50A 5T1IA 3FHWA 4X64Q 3DMUA 5EBDA 1VQ8A 5L37A 4JC0A 3VR2A 1B3AA 1DOLA 4DV1L 3N52A 2B8GA 2HUGA 4FXGC 4OIJA 1WD0A 4XT3B 1X55A 5E7NA 1SDFA 1PTOD 1R9TH 1WCMG 3S24A 2PI2A 1Q1BA 4HIMA 1N32Q 1EIHA 1Y8PB 3TEHB 3S9WA 4YHHL 2F0IA 3ER0A 3SK5A 1SE2A 4NMZA 3MHBA 2HIVA 1NMGA 3HOYH 1F9QA 4L6TB 3S17H 2CW0D 3Q24A 3GTOB 1MSHA 5AJ3L 2D0OA 2UU9Q 1VMPA 1KLGD 3OOCA 2F0MA 4BS9A 1DOMA 4LNQA 4DV3L 1N36Q 2HQEA 3GTGH 1U4MA 3PUZA 5C4JH 3ND8A 2YV5A 2NZ1D 4X3UA 3R2TA 4WJ3M 5COYA 1G6PA 2WAQE 3BS1A 1LTAD 4A93H 3BYYB 3H0GB 3MEHA 2JA7G 3KLRA 2UUCQ 2WKDA 3PO2G 1VQPA 4ZKCB 2Z8LA 3K8AA 1IKMA 5M3MH 4ZUIA 3I4LA 3Q6SA 1Z6HA 1HJPA 2KQ3A 4KI0A 3IL8A 2ZJRA 4XTCS 4B3ML 3GTPH 3H94A 2JSOA 1Y1WB 4POFA 1PA6A 4NKLA 3GTMB 5J1ZA 5FLXL 3MTSA 3AU7A 3CKIB 1JT8A 2AQ1B 3PIPA 4FF4A 3PIO3 1K0RA 5IWAQ 3GTLH 5IYCG 1U4PA 1QVCA 1E3PA 3NTKA 4LFCL 2CQAA 3VR4A 2K03A 3NBHA 2IX3A 2ZXPA 4YCUA 1VQEA 2WIIB 1F77A 2L1BA 3K7AH 5FJ8H 3T1HL 2E2IH 4A3BG 2BE5D 3OWFA 5CV6A 2YTVA 4A3IG 4GLXA 4RKLA 1F9PA 1VQHA 3RN5A 1YHAA 5DAUA 1A8VA 3S1MH 2CKZB 2WP8J 1E2WA 2F0UA 1QOHA 2JA6H 3M3YH 4GNXB 2K33A 1B9MA 1LT6D 3KF8A 3NUCA 4P2CB 5ELOA 2R7ZH 4XYOA 2JA8B 1K3RA 3SHLA 1PFMA 4C3JB 3UDXA 4ZQ3A 3A8IE 1D1IA 4WORA 2B2UC 5IWAL 1K8MA 3A56A 1X3QA 4BY7G 4DV6L 4G4KA 1BQQT 4HSPA 1MSGA 1IBLQ 1PTOC 4QB4A 3VR5A 4CJ0B 5DM63 4OEMB 4GN4B 2R3ZA 4OX9Q 3J80L 1BXTA 2F0DA 4QUFA 3UDIA 5LL6X 4X3TA 1YJNA 3M7NA 2MFIA 1X32A 1HH2P 4AYBG 2Z4IA 5D65A 2KJXA 4A3IB 1C7YA 1D5ZC 1B8AA 1AZPA 1C0AA 1A3UA 3F2UA 4RH6A 1LTLA 5I6WA 3CU7A 2V4DA 3QJYA 4QMGA 5NUCA 1CTMA 4JG2A 4X3KA 1I6VC 1EY0A 2AQ3B 4KD4A 3F2CA 1G8ZD 2XRSD 3TN2A 1HA5A 3LX0A 2K5QA 1EYAA 4K5VA 5M3MG 4C3HG 2E2HB 2JN4A 4WFN3 5C4ZA 2N55A 1G2TA 4ME5A 3RN2A 1LO5D 2JK8A 1EWIA 3TZUA 3RZDH 1JE4A 4HJ7A 2JA6B 1XNQL 2E2JH 4R1JA 4RGOS 1VF7A 3CPWA 1STBA 1PH5A 2I0QA 3QOLA 4PMWA 3EFXD 4YWKA 3J81E 2EQSA 3JAML 4DR5Q 1CI3M 2NVQB 1JCKB 1ILPA 2D2CC 3OW2A 4PV1C 1QWYA 3K6OA 2ZTEA 2I5LX 4DV5L 3HOVH 5IP9G 4HN7A 3V96A 5IP9H 1B50A 3CMAA 5IGDA 1AE2A 1K9MC 1BF4A 2F4IA 3SE0A 1SNOA 3HOYG 2LXJA 4JI4Q 1HR0Q 1AN8A 2A74C 3FPUB 2R92H 5KNCA 3KLWA 4DR5L 3PO3G 4H13C 1A3TA 2PZTA 1Q81C 3TQYA 4HTHA 4JI0L 1EZ8A 2K32A 2NUCA 5I6YA 4G57A 1LTSD 2ZM6Q 4BY7H 3CCVA 2UUBQ 3VR3A 1U0LA 1JJGA 2ZTDA 3QO2A 1TIID 2KENA 3BU2A 3OSOA 5C4XG 5CV5A 1UE6A 1V9PA 3A8KE 4YWLA 1GM5A 2PI2E 2L4NA 4NP5A 3TMEA 2VZAA 1O80A 3S17B 2HT1A 4FF3A 1LV9A 2BDNA 3GTJH 1QILA 3E9IA 3CQZB 3S2DH 2IX1A 3NQIA 1VQIA 2F0FA 5LMNQ 2KCMA 2D9UA 4R8NA 3WOFA 4OX9L 1VQKA 3C1FA 3CHBD 3GO5A 4JK1C 2L55A 5ISRA 1Q46A 1P16A 2VNUD 2E5LL 2OF1A 5M5WB 2O4XA 1DYQA 2FHTA 4C3IB 4A3EB 4DNRB 4LFAL 2B2TC 4KY5A 1RJTA 4V0BA 3M85A 4BA1I 2XNAC 5CV9A 1FVIA 4IPHA 3S1NB 3STBD 4A3LG 5HGTA 3K59A 3ONAB 3TP5A 1PH7A 1HQMC 2R6GA 4MHEA 4M1UB 3KF8B 4HMIA 4IJLA 4GNXA 3HKZE 3SDZA 3HOXG 1VCIA 2Z6KC 3PUXA 4DR7Q 3JC66 1BVSA 1RIPA 1LT3D 2RDHA 1H95A 5KYIA 3NP8A 4EQ5A 1PFNA 5LHY1 3J7AV 5JEAG 5BN5A 2VQFL 5I9OA 3HOUG 3U9SA
chains in the Genus database with same CATH topology
2ENBA 4IUVA 2NN6G 1ET9A 2EYPA 1SYFA 1MD2D 4CBVA 1LABA 2GA4B 1DJRD 4KJOA 2NWGA 3K0YA 1JWSD 1QE6A 5ELDA 2AQ2B 2A73B 1G291 3S14B 4RGNA 1PRTB 3GQBA 3HZXA 3DWAA 1PTOH 1VDZA 1C4QA 2IT1A 3C1EA 1KDCA 3GV6A 4DXGA 3BDCA 1SYBA 4B9XA 2D5DA 3D8GA 4FXKC 3M4YA 4KHZA 4KN7C 1R9TB 2L5TA 1SJED 1GXDC 2QILA 5KIXA 5E1FA 2PNRC 3K5NA 4FYDA 3LNNA 5CYUA 3TP6A 4N9TA 2R92B 3ERQA 1ZEQX 1YNJC 3PUYA 1J9OA 4RWSC 3WDNA 1LTGD 1TY0A 2B2UA 2B2WC 1CT1D 1BCPC 1E0BA 3HOXB 3FEWX 4KHVA 1SMYC 1B53A 1NSNS 4XQNA 1WD1A 4M8AA 3URYA 4A3KB 1KDBA 4DAYA 5E3FA 2YYZA 4XQQA 2PMZB 1PRTD 1B9NA 2B2YC 3BVGA 2AWNA 5CGKA 4CHTB 5I9PA 1QNUA 1IYVA 1EEID 2RVLA 4IUQA 2Z1CA 5IT9E 2WB1B 2L0CA 2KOLA 4RHRA 1FNUA 2B2VA 5D3IB 3HOWB 3P20A 3HP3A 4DGZA 1Y1VB 2J0TD 4K6DA 1SYDA 2KECA 1HQRD 2QF7A 2F0NA 1QJOA 3GTKB 3MXGA 1FR3A 4IUTA 2AUKA 4LJZC 1SMYD 1F2MA 2PZUA 3DWPA 1EY9A 2RA4A 5M5XB 1I50B 3DM1A 1B1ZA 3X3MA 1U4RA 3GD7A 2EYOA 3KK7A 1AEXA 4BWGB 4CGYB 2HCCA 3T13A 5CV7A 5K5PA 2B63B 1GUWA 2RSNA 3RUZA 1EZ6A 4B9WA 2IJ0A 3NTHA 3MFGA 2H4OA 1DOKA 2A69C 3GP7A 1NR2A 3NK9A 1EY8A 2JA7B 3K58A 1EY4A 4KMUC 5C3WA 1CM9A 4HSVA 5EGTA 5EJWA 1KAAA 2XVSA 1PDQA 5FOBB 3GTPB 4R9WA 3GTQB 3QB3A 2SNSA 2E2DC 3MC0B 1XTCD 5E4XA 1G91A 1AZQA 1PRTF 4ODGA 2K04A 5M3MB 4G7HC 4IFDI 1Q3LA 1B4OA 2MUYA 5JPMC 3HS0C 4F7XA 2KCCA 2X6GA 2EXZA 1TY2A 1H9RA 4IUUA 1QNKA 3EA6A 3RD4A 3NWSA 1M4VA 3S1RB 1D5MC 3DWQA 3IAYA 3P75A 4H7BA 1OXVA 2WACA 4KV6A 2F0HA 4RCOA 1HHVA 5EPKA 2E2JB 4NW2A 1O7ZA 5CMDA 2NB0A 1IHZA 1V1OA 3S1MB 4RA8A 1ZXTA 2ZXRA 2B2WA 4K6LA 5EPLA 1WTPA 2E75C 2MPMA 2JA5B 1F2YA 4IFDH 1EYDA 2EY1A 2EZVA 1K83B 1K8OA 1BCPB 3K57A 1CA5A 4PMBA 2B8FA 3H6MA 4ABNA 1BO0A 4RFBA 4FO2A 2JE6I 2L12A 1F2LA 1EU3A 1Y8OB 2KCNA 1OXXK 2A6HD 1STEA 5IGCA 4ULLA 4XT1B 3OMGA 1STAA 1A3VA 3K5OA 2TSSA 1L0YB 2FMMA 5CBEE 4O42A 4OO1H 5FKAC 3EQLC 5DEHA 2KHSA 5C0XI 3C46A 3D6CA 4KTAA 3BYTB 2TMPA 2A6EC 2O2LD 1EQTA 1JR0D 1H9KA 3FMCA 1VF5C 4K2KA 2A6ED 4IQZA 1I4QA 5C44B 3A7LA 1LLRD 1STNA 1ILQA 2A69D 1UEAB 1DCZA 4Q5VA 3J7YW 2KEDA 1A15A 3NQTA 4KJNA 1ZYRD 1A6XA 3MFYA 4C56C 5M9OA 1B2TA 3HOVB 2IL8A 5DM73 1NAPA 5E4WC 2K28A 4FF1A 2ICEC 4XDXA 1M8AA 1OXSC 4OGQC 5KNDA 5IGEA 4EQPA 1SYGA 4DFAA 1GUTA 3A8JE 3U9OA 2RQXA 2KEEA 2PPBC 3W3AA 1UNSA 1V1PB 1QB5D 1Q1EA 1ONLA 1WTRA 1I6HB 3MZ5A 1ZKOA 2VB2X 5A2QL 4OO1G 3P1HA 1HXYD 4HCSA 5ELBA 2EVBA 5FO7B 1SYCA 3S2DB 1PXUA 1J8IA 1RTOA 4I65A 2M2LA 3VR6A 1JC7A 1JQYD 2ZT9C 2EYJA 4F8MA 3SEBA 2WAQB 2CVRA 2A68C 5IGGA 2HCIA 3MXPA 5EKIA 3H91A 2KUMA 3R2IA 1CQFA 1I4XA 4ZLTF 1U4LA 4DN4M 1JB3A 2EYLA 1CHPD 4TRDA 4HAEA 4A93B 1CK1A 4OIKA 2QEJC 2Q8IB 2EY5A 3GTGB 4IFDG 3P7JA 4TKOB 4ZK9B 1WTWA 2FINB 2CHBD 2RDGA 3NWTA 4RGTA 5A35A 2XWBB 4IUPA 1TVXA 1AP0A 2M00A 5ELEA 4R8IA 2EE1A 5BN3A 4DU9A 5TSSA 4S3SA 2B39A 5LL6S 3E5SA 1UAPA 1HA6A 3RLFA 4V190 2BOSA 1EY7A 1H9SA 3SK8A 2JYOA 5C5LA 4A3MB 3JAME 1BCPD 1GHKA 5I2XA 1I4PA 4CKCA 1S5BD 3D31A 5G3LD 4ZYSA 1ENAA 5D3DA 2FMCA 3DXJC 5JEAH 1T5EA 2PCFB 4J1MA 1RTNA 4N9PA 3TDQA 4KY7A 1GUNA 2I46A 1YNND 4HEDA 3HOYB 4QIWB 1QCBD 5JAVA 5C0XH 3Q22A 4J6HA 2JXMB 4HR7B 5I4DA 5EQ0A 3T16A 2EJGC 1UUPA 3SVMA 2EYHA 2EYFA 4LMQD 2ID0A 4GZYC 2DY7A 2LMCB 2K5DA 4JBWA 4RGMA 3EROA 2B2TA 3L3OC 2R7ZB 4K8JA 3HOUB 4XYQA 3EJIA 1S5ED 2OXPA 4C3HB 1JORA 2N88A 3I4MB 5K36H 2F0KA 1JWMD 5M3FB 1PTOF 1BNZA 1F2ZA 5CBAE 1IW7D 2L9HA 2SEBD 3T56B 1BUVT 4G7ZC 4QUCA 1PFBA 1RCVD 1TU2B 1EWHA 1I4GA 1WTXA 1DXMA 1XWEA 2BA0A 2HDMA 3PV0A 1S4ZA 1LACA 1H9SB 2F0GA 1YNNC 4BY7B 2A68D 1IKLA 1I3QB 2EYMA 5IODA 4I7ZC 3OIQA 3DUZA 3DHQA 1STYA 3TZDA 4K14A 3ITPA 4EGVA 3D4WA 4KN4C 3BDOA 3SK4A 5J39A 5KGUA 1GUSA 1H9MA 1PLFA 1SXTA 1OO9B 2L11A 2VXWA 2K05A 3TBIB 3FVQA 4ZAIA 3T4AC 2NYZD 1Z47A 1CFMA 3I72A 1G6ZA 3RZDB 4KK7A 5G3LF 1EWCA 3D4RA 1BBXC 4A3DB 1SJHD 1L0XB 1KTKA 4H0LC 1V43A 3R8BA 4BBSB 2NN6I 4J8QA 2AUJD 4BA2I 3I73A 1Y8NB 3VA5A 3RMHA 1EQVA 4NDXA 2DNEA 3KUPA 3BVMA 3BZDB 2LY7A 3C2PA 1DD2A 2Z4HA 1S5CD 1XX8A 5T1GA 1D5XC 1V8QA 4C1NI 2EDGA 1GJXA 1WTQA 1GHJA 1SFOB 5KYLA 2F0LA 2J7ZA 3LWEA 5JJZA 1B44D 4HCEA 1TWFB 4KKSA 3S15B 1CHQD 3SR1A 2B2YA 3HEJA 1LT4D 4IUNA 1CQVA 3DEPA 3FDTA 2A6HC 2R61A 2QKIC 4RHSA 3Q23A 1LTRD 3HRZC 3GTJB 2NTTA 5EKLA 1E2ZA 2PZWA 4XXEA 3L7ZC 1C8CA 4UAIA 3K7AB 4K5XA 3A7AB 3I3CA 2VB3X 3NSWA 5C5MA 1EOTA 3IFDA 5K36G 2BE5C 2XIWA 4DAPA 1A2TA 2H1EA 1Q90A 1KABA 2K01A 5BN4A 2F0OA 4KD3A 1KNEA 3WOEA 3MXUA 4TQUS 3I4NB 2F0PA 2K7VA 5D14A 2FJ2A 3KBXA 5JEAJ 1YNJD 1MBYA 5JOBA 4EVOA 3MWYW 2EY2A 2RKSA 3BVZA 2SDFA 3M7GA 3VYUA 4C2MB 1D6EC 2X69A 4K2LA 3VYTA 1R4QB 3HGBA 3H09A 3D4DA 1PTOB 2RSOA 1EIGA 4G7OC 3ND9A 2F0EA 2E76C 4EQNA 1FNVA 3AMUA 3QG1A 2A5HA 1U9RA 4ZUJA 1A2UA 2OT2A 3T51B 4IN3A 2D62A 1WVLA 2Q8RE 3C3LA 1NCVA 4MN3A 2ZXOA 3J81L 1H9JA 1ESRA 5C0XG 3PO3B 2EY6A 3KLSX 1SAPA 2F0SA 4XQJA 1HFGA 2YU9B 4RAUC 2PW7A 4QF4A 1HFNA 4DNTB 3EVQA 3A54A 1W6JA 2ICIA 4A3JB 3RZOB 2K5WA 1FD7D 1TWAB 1WTVA 1SE3A 2NTSA 4L63B 3ZYYX 1MI2A 2NN6H 2AWOA 3L9AX 3E0JA 4X3SA 2NBFA 1LTBD 5CV8A 4C1NK 4MIUA 1ZYRC 2PW5A 1S5DD 2Q8TA 2K1BA 5EPJA 1KNAA 1GOZA 1SE4A 2FFKB 3PUWA 1ENCA 1R4PB 3D6WA 1C48A 1HRJA 3I70A 2IW3A 4IFDJ 3NHHA 2XWJB 1SNCA 2EJMA 5I2YA 3M4OB 1STHA 4LK1C 2RDFA 2MHVA 3MA2B 1T5XD 4U68A 1RHPA 1LTID 1SSOA 4C3IG 5EBCA 5CR3A 1LT5D 1SEBD 3M3YB 5IOCA 4IURA 3G7LA 5IT9L 4K8IA 3VYRA 4A3FB 4C3JG 4F87A 4K5WA 3BG3A 4OO1I 2IX0A 4ZRZA 5C4XB 2EJFC 3UI2A 4EQOA 1EL0A 4Z9CB 1BOSA 1RD9D 1IYUA 5CC4A 2BDOA 1DM0B 3IFTA 2IWHA 2O5JC 4PQXA 4FP5D 5KRUA 1IL8A 4XIGS 4OL7A 3O13A 1O78A 4WJWA 3I8ZA 3N6RA 1V1PA 1LTTD 1PYWD 1G2SA 2I07B 2JEBI 1E2VA 2F0VA 3KLSA 1JICA 3OHXC 4FNFA 1HPCA 1XXGA 1JOKA 1ML0D 1CZGA 3J80E 1W6KA 3S2HB 3PO2B 4CKBA 2C9OA 3GV3A 1FNWA 1FGBD 1NUCA 3HOZB 5KEEA 4DF7A 1Q8IA 5F2DA 3HG9A 1SBBB 1RDPD 3KBGA 5EKKA 1SYEA 1CZWA 4E6IA 4B08A 1D2BA 2RBMA 5IIFA 2F0WA 1KDAA 5AFWA 1PZID 1RODA 1IW7C 2HDLA 4QCLA 4H44C 1FYCA 1OXUA 5JVG3 5FK9C 4ID6A 1MGSA 5DNFA 1I4HA 2PO4A 3TSSA 4UDUC 3NTIA 2NVYB 1EEFD 5CV4A 4AYBB 1X3PA 1AFPA 1TT2A 2OEOA 4WRDA 4FF2A 3I91A 4YIJA 4CKEA 2E2IB 5FO8B 1PRTC 1XYIA 3VYSA 1Z7TA 3Q0AA 2O5IC 3NE5B 2MP1A 2VUMB 2SNMA 5KNBA 2F0QA 5HURA 4F88A 1BR9A 2F0TA 1JWUD 1BDOA 2CW0C 2F0JA 2NVTB 1EU4A 2QDBA 4PNYA 1NR4A 3X3NA 2G9DA 1WTOA 1PMRA 1Y69U 2DN8A 4TSSA 1SNDA 2JP1A 2J4XA 4PMCA 3QOJA 3TP8A 4A3BB 3S1QB 2LS01 4IALA 1STGA 1JOQA 1S5FD 2DNCA 5ELCA 1OXTA 4IZ8A 2QCPX 3V05A 1F9RA 1O7YA 5C0XJ 2Y0SB 2C5CA 1SNMA 1HTLD 4L8JA 1PZJD 3S16B 2NVXB 3H3VC 4DK0A 5CORA 1QG7A 1TS3A 2IPKD 2K6AA 2X6LA 1TS4A 3PIP3 1GUOA 2WKCA 4DXFA 2BCOA 4A3GB 3W2DA 2R93B 3MVVA 1I4RA 1VMCA 3CRLC 2WV6D 4KKTA 5J22A 4O1NA 1HTPA 1WCMB 4Y7NB 2E74C 1TWGB 3MAQA 2BA1A 3QIAA 4HMJA 1RKNA 3R3OA 5FO9B 1BCPF 5C6AA 2B2VC 5JPNC 1EY6A 1D1KA 3TP7A 5M5YB 1EY5A 2LKVA 5JVH3 2F3WA 3PUVA 2EOTA 1AW7A 5ELFA 3MXNA 1TWCB 3QWNA 1ICWA 2JEAI 1EFID 1DONA 3BDLA 2EPBA 4OHJA 4KY6A 4CJ2C 3GTLB 2PYKA 4RCNA 4ZKBB 3NXWA 2G9HD 5IGFA 4DA2A 1O7LA 3FKIB 3HKZB 3NPPA 3G6JB 3OW7A 1RF2D 2PQEA 1TS2A 5IGBA 3A55A 3K5LA 4KKUA 2MGSA 3FPPA 1PZKD 2KA7A 5C4HA 2DY8A 4FXDA 2LFNA 2WINB 4ILWA 5C4JB 3IKJA 1ENFA 2M9VA 3AB9A 2F3VA 1Q12A 5FLXE 3D3RA 5A2QE 1KLUD 1ESFA 1II3A 1GUGA 1TQOA 3OWEB 3K5MA 1HCZA 1TKWB 4U673 1HUNA 3CRKC 3OIPA 4Q0FA 3R93A 1TS5A 4FVMA 1DZ1A 4DK1A 4BBRB 3LWUA 1TWHB 4DAVA 5C3XA 3PMFA 2MJ8A 1TR5A 1SNQA 2SOBA 3VA7A 2XN9C 1JOOA 1SNPA 3SXHA 3V2TA 3OMCA 3SK6A 2XSCA 3OPOA 1HUMA 4CJ1B 1ET6A 1F9SA 3I90A 2XRQD 1CA6A 3DEOA 2F1MA 4BY1B 3E6ZX 4LAAA 2KVMA 4RKBA 3J7AF 3T53B 5C3EB 3NBIA 1EYCA 2F03A 3FRPB 5T1IA 3DMUA 5EBDA 3VR2A 1B3AA 1DOLA 3N52A 2B8GA 2HUGA 4FXGC 4OIJA 1WD0A 4XT3B 1SDFA 1PTOD 1Q1BA 1EIHA 1Y8PB 3S9WA 2F0IA 3SK5A 1SE2A 4NMZA 3MHBA 1F9QA 4L6TB 2CW0D 3Q24A 3GTOB 1MSHA 1VMPA 1KLGD 3OOCA 2F0MA 4BS9A 1DOMA 2HQEA 1U4MA 3PUZA 3ND8A 2NZ1D 4X3UA 3R2TA 5COYA 3BS1A 1LTAD 3BYYB 3H0GB 3MEHA 3KLRA 2WKDA 4ZKCB 2Z8LA 1IKMA 4ZUIA 3I4LA 3Q6SA 1Z6HA 2KQ3A 4KI0A 3IL8A 4XTCS 3H94A 1Y1WB 2JSOA 4NKLA 3GTMB 5J1ZA 5FLXL 3MTSA 3AU7A 3CKIB 2AQ1B 4FF4A 3PIO3 1U4PA 3NTKA 2CQAA 3VR4A 2K03A 3NBHA 2IX3A 2ZXPA 2WIIB 1F77A 2L1BA 2BE5D 3OWFA 5CV6A 4RKLA 1F9PA 5DAUA 2WP8J 1E2WA 2F0UA 1QOHA 2K33A 1B9MA 1LT6D 3KF8A 3NUCA 4P2CB 4XYOA 2JA8B 3SHLA 1PFMA 4C3JB 4ZQ3A 3A8IE 1D1IA 4WORA 2B2UC 1K8MA 3A56A 1X3QA 4G4KA 1BQQT 4HSPA 1MSGA 1PTOC 4QB4A 3VR5A 4CJ0B 5DM63 2R3ZA 3J80L 1BXTA 2F0DA 4QUFA 5LL6X 4X3TA 3M7NA 1X32A 2Z4IA 5D65A 2KJXA 4A3IB 1D5ZC 1AZPA 1A3UA 3F2UA 4RH6A 5I6WA 3CU7A 2V4DA 3QJYA 4QMGA 5NUCA 1CTMA 4X3KA 1EY0A 1I6VC 2AQ3B 4KD4A 1G8ZD 2XRSD 3TN2A 1HA5A 3LX0A 2K5QA 1EYAA 4K5VA 4C3HG 2E2HB 4WFN3 5C4ZA 2N55A 1G2TA 4ME5A 1LO5D 3TZUA 1JE4A 2JA6B 4RGOS 1VF7A 1STBA 3QOLA 4PMWA 3EFXD 3J81E 3JAML 1CI3M 2NVQB 1JCKB 1ILPA 2D2CC 4PV1C 1QWYA 3K6OA 4HN7A 3V96A 1B50A 5IGDA 1BF4A 2F4IA 3SE0A 1SNOA 1AN8A 2A74C 3FPUB 5KNCA 4H13C 1A3TA 2PZTA 4HTHA 1EZ8A 2K32A 2NUCA 5I6YA 1LTSD 4G57A 3VR3A 3QO2A 1TIID 3OSOA 5CV5A 3A8KE 2L4NA 4NP5A 3TMEA 1O80A 3S17B 4FF3A 1LV9A 2BDNA 1QILA 3CQZB 2IX1A 3NQIA 2F0FA 2D9UA 4R8NA 3WOFA 3C1FA 3CHBD 5ISRA 3GO5A 2L55A 4JK1C 2VNUD 2OF1A 5M5WB 2O4XA 1DYQA 2FHTA 4C3IB 4A3EB 4DNRB 2B2TC 4KY5A 1RJTA 4V0BA 3M85A 4BA1I 2XNAC 5CV9A 3S1NB 5HGTA 3K59A 3ONAB 3TP5A 1HQMC 2R6GA 4MHEA 4M1UB 4HMIA 3SDZA 1VCIA 3PUXA 1LT3D 2RDHA 5KYIA 3NP8A 1PFNA 5LHY1 3J7AV 5JEAG 5BN5A 5I9OA 3U9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ENB A;  3OMC A;  3SK6 A;  3NXW A;  3OWF A;  5EGT A;  5IGD A;  4K2L A;  4KHV A;  5CV6 A;  5I9P A;  5IGF A;  1KAA A;  1NSN S;  4PMB A;  4RKL A;  3NHH A;  2M00 A;  5DAU A;  3H6M A;  5EKK A;  3QB3 A;  5KYL A;  1SNC A;  2SNS A;  2EYP A;  1KDB A;  4DU9 A;  5IGE A;  2F0U A;  1STH A;  1SNO A;  4EQP A;  1SYF A;  2F0L A;  1SYG A;  3D4D A;  4S3S A;  1SYE A;  1SNM A;  4LAA A;  2RDF A;  5E3F A;  4DFA A;  2PQE A;  3E5S A;  4ODG A;  3U9O A;  4E6I A;  4RKB A;  3NUC A;  4KJO A;  5IGB A;  2RBM A;  1A3T A;  1EY7 A;  2PZT A;  3SK8 A;  5IIF A;  3SHL A;  2F0E A;  4HTH A;  4ZQ3 A;  1EYC A;  5CGK A;  1EZ8 A;  2NUC A;  2F0W A;  5C5L A;  3SR1 A;  1KDA A;  4G57 A;  4EQN A;  3HEJ A;  4F7X A;  4WOR A;  2F0G A;  5IGC A;  5CR3 A;  5C4H A;  1U9R A;  3DMU A;  4IUN A;  2EYM A;  3MZ5 A;  4ZUJ A;  1A2U A;  5IOD A;  2EXZ A;  1ENA A;  3OMG A;  4QB4 A;  1STA A;  3HZX A;  3P1H A;  4ID6 A;  3OSO A;  1A3V A;  5CV5 A;  2F3V A;  4J1M A;  3DHQ A;  4N9P A;  5IOC A;  1STY A;  2F0D A;  1SYC A;  4NP5 A;  4K14 A;  4KY7 A;  3ITP A;  5CV4 A;  3TME A;  3MVV A;  4DGZ A;  3D4W A;  3C1E A;  1KDC A;  3S9W A;  5ISR A;  4K8I A;  1TT2 A;  4K6D A;  3SK4 A;  2F0I A;  3BDC A;  4I65 A;  1SYB A;  2OEO A;  5EKL A;  4NMZ A;  4WRD A;  3SK5 A;  1SYD A;  3MHB A;  3D8G A;  4K5W A;  4B9X A;  5KGU A;  5J22 A;  2PZW A;  1II3 A;  4YIJ A;  5JAV A;  2EY6 A;  5DEH A;  2KHS A;  2EYJ A;  3P75 A;  4J6H A;  4F8M A;  1TQO A;  2F0F A;  2F0S A;  2F0N A;  4H7B A;  4K5X A;  2PW7 A;  4QF4 A;  3D6C A;  2F0M A;  1A3U A;  3EVQ A;  2HQE A;  5I6W A;  4R8N A;  3T16 A;  4EQO A;  5IGG A;  3C1F A;  2EYH A;  3MXP A;  1RKN A;  2EYF A;  2WAC A;  4HMJ A;  2F0H A;  4KTA A;  3R3O A;  4KV6 A;  4QMG A;  5C5M A;  5NUC A;  2SNM A;  5CC4 A;  5KIX A;  5C6A A;  2OF1 A;  5E1F A;  2F0Q A;  2PZU A;  1F2M A;  1EY6 A;  5HUR A;  3TP7 A;  2F0T A;  1EY0 A;  2O4X A;  1EY5 A;  1EY9 A;  2F0J A;  2LKV A;  4KD4 A;  1A2T A;  2QDB A;  4PNY A;  4KY5 A;  2F3W A;  5KRU A;  4K2K A;  1KAB A;  3MEH A;  4OL7 A;  3ERO A;  3LX0 A;  2F0O A;  5CV9 A;  1EYA A;  4K5V A;  4KD3 A;  5C4Z A;  4ME5 A;  3TP6 A;  5HGT A;  4ZUI A;  4N9T A;  4K8J A;  2EYL A;  1JOR A;  3TP5 A;  1STN A;  2EYO A;  4TRD A;  1AEX A;  1SND A;  2KQ3 A;  1IHZ A;  3EJI A;  5C3X A;  3ERQ A;  1STB A;  2F0P A;  2F0V A;  4HMI A;  3PMF A;  3QOL A;  4PMC A;  2OXP A;  5CV7 A;  3QOJ A;  3T13 A;  5K5P A;  5J39 A;  3TP8 A;  3RUZ A;  1EZ6 A;  4B9W A;  3NQT A;  4KJN A;  4NKL A;  5CV8 A;  4IAL A;  1STG A;  1TR5 A;  5J1Z A;  1JOK A;  3BDL A;  4MIU A;  5JOB A;  3VA5 A;  4EVO A;  1JOQ A;  2EY2 A;  1EQV A;  2F0K A;  1SNQ A;  2RKS A;  4NDX A;  2PW5 A;  5M9O A;  1F2Y A;  2SOB A;  3NK9 A;  4KY6 A;  1EY8 A;  2EY5 A;  5KYI A;  1NUC A;  1JOO A;  1SNP A;  1EYD A;  1F2Z A;  2PYK A;  3NP8 A;  5KEE A;  1EY4 A;  4DF7 A;  3SXH A;  5I6Y A;  5C3W A;  2EY1 A;  5I9O A;  1ENC A;  4IZ8 A;  5F2D A;  3V2T A; 
#chains in the Genus database with same CATH topology
 2ENB A;  4IUV A;  2KBN A;  2NN6 G;  1VQF A;  1ET9 A;  4DV1 Q;  2EYP A;  1SYF A;  1MD2 D;  2KHI A;  4CBV A;  1LAB A;  2GA4 B;  2Z6K A;  1DJR D;  2GN5 A;  4KJO A;  3CAM A;  1PH9 A;  2NWG A;  2GVB A;  2QEX A;  3K0Y A;  1JWS D;  3LGJ A;  1QE6 A;  5ELD A;  2AQ2 B;  2A73 B;  1G29 1;  1VQL A;  3S14 B;  4RGN A;  4A3M H;  1RL2 A;  5JJK A;  4FDB A;  3A0J A;  1EYG A;  1PRT B;  3GQB A;  3HZX A;  2G5D A;  2EXD A;  3DWA A;  1PTO H;  1VDZ A;  1C4Q A;  2IT1 A;  4P74 A;  3C1E A;  1KDC A;  3GV6 A;  4DXG A;  3BDC A;  1SYB A;  4B9X A;  3S1R H;  3FKI G;  2D5D A;  3D8G A;  3HKZ G;  4FXK C;  4OXP A;  4JOI A;  3M4Y A;  4DR6 L;  1YIJ A;  4KHZ A;  4KN7 C;  1R9T B;  2L5T A;  1SJE D;  1GXD C;  2QIL A;  4KHP L;  5KIX A;  3J81 i;  1YNX A;  2ZJP A;  5E1F A;  4B3M Q;  4GLA C;  4UY8 C;  1IZ6 A;  3KF6 A;  2YTX A;  2PNR C;  1X3G A;  3K5N A;  4FYD A;  3LNN A;  5CYU A;  3TP6 A;  4N9T A;  2R92 B;  1HNZ L;  3D0F A;  1QVF A;  4JVZ A;  3FKI H;  3ERQ A;  1ZEQ X;  1YNJ C;  3PUY A;  1J9O A;  4RWS C;  3WDN A;  1LTG D;  1TY0 A;  3A5U A;  4JYA Q;  2I5H A;  2B2U A;  3CP0 A;  2B2W C;  1CKO A;  1CT1 D;  4JW0 A;  4UP9 A;  1BCP C;  1E0B A;  4GKK Q;  3HOX B;  3GTO H;  3FEW X;  4DV0 Q;  2OQK A;  4KHV A;  1SMY C;  1B53 A;  1NSN S;  4XQN A;  2PNH A;  1WD1 A;  4Y52 H;  2H5X A;  4M8A A;  4DR7 L;  2DUD A;  3URY A;  1KDB A;  4A3K B;  4DAY A;  3UDF A;  1TWH H;  1KXL A;  5E3F A;  2YYZ A;  2R93 G;  4XQQ A;  2PMZ B;  1PRT D;  1B9N A;  2B2Y C;  3BVG A;  2AWN A;  5CGK A;  4CHT B;  5I9P A;  1QNU A;  1IYV A;  1EEI D;  1JJC B;  2WAQ G;  2CWP A;  4CDC C;  2RVL A;  4IUQ A;  2Z1C A;  5IT9 E;  2WB1 B;  2L0C A;  2KOL A;  4RHR A;  1FNU A;  2B2V A;  5D3I B;  3HOW B;  3P20 A;  2BH8 A;  1E22 A;  3HP3 A;  4DGZ A;  3G71 A;  1Q82 C;  1Y1V B;  5IP7 H;  2J0T D;  4K6D A;  4DV4 Q;  1SYD A;  2KEC A;  1Y1V H;  4B3R Q;  1HQR D;  2R93 H;  4JBM A;  5FLM G;  1CKN B;  2QF7 A;  3CCJ A;  2F0N A;  1QJO A;  2Z0S A;  1GVP A;  3GTK B;  3MXG A;  3DLL A;  1FR3 A;  5HY6 A;  4IUT A;  2ASB A;  2AUK A;  2N49 A;  2C35 B;  1SMY D;  1F2M A;  2PZU A;  3DWP A;  4LJZ C;  4TVA B;  4I7A A;  1EY9 A;  2RA4 A;  5M5X B;  1I50 B;  3DM1 A;  3J81 j;  1B1Z A;  3M4P A;  3OYY A;  1E24 A;  1NBW A;  1PH6 A;  3X3M A;  1U4R A;  2PQA B;  3GD7 A;  1EIF A;  2EYO A;  3KK7 A;  1AEX A;  4BWG B;  4CGY B;  1Y1W G;  3K80 C;  1PFS A;  2HCC A;  5CV7 A;  3T13 A;  5K5P A;  2B63 B;  2RSN A;  1GUW A;  2K52 A;  3RUZ A;  1EZ6 A;  4B9W A;  2IJ0 A;  4A3E H;  3NTH A;  3MFG A;  2H4O A;  1DOK A;  2A69 C;  1KQS A;  3GP7 A;  1NR2 A;  2R7Z G;  3NK9 A;  1EY8 A;  4R4I A;  1XNR Q;  1FL0 A;  2JA7 B;  1PYS B;  3K58 A;  4YCV A;  1EY4 A;  4KMU C;  5C3W A;  1YIT A;  1CM9 A;  2ES2 A;  4HSV A;  1VQM A;  3M4Q A;  5EGT A;  5EJW A;  1I94 Q;  1X6O A;  5JJL A;  1VQ5 A;  1KAA A;  4NB3 A;  1CUK A;  2XVS A;  1PDQ A;  5FOB B;  3GTP B;  1CSQ A;  4R9W A;  2JA6 G;  3GTQ B;  3QB3 A;  4A3D G;  2SNS A;  2E2D C;  3MC0 B;  1TWC H;  1XTC D;  5E4X A;  1G91 A;  2JA9 A;  1AZQ A;  1PRT F;  4ODG A;  2JJQ A;  2K04 A;  5M3M B;  4GLV B;  1KRS A;  1QUQ A;  4G7H C;  4IFD I;  1Q3L A;  1WTH A;  1B4O A;  2MUY A;  3EIV A;  5JPM C;  3HS0 C;  4F7X A;  2KCC A;  4JI6 L;  3H3V I;  2X6G A;  4X65 L;  2DGY A;  2ZJQ A;  2EXZ A;  1TY2 A;  1IBK L;  1H9R A;  1A62 A;  4IUU A;  1QNK A;  3EA6 A;  3RD4 A;  4X6A H;  1B70 B;  1MJE A;  1KD1 C;  3NWS A;  1M4V A;  2PQA A;  3S1R B;  4IPG A;  1D5M C;  1KAW A;  3DWQ A;  3IAY A;  1K83 H;  2AMC B;  3P75 A;  1VQO A;  3HOW H;  4DPG A;  4H7B A;  3BZC A;  1K3B C;  3CPF A;  1OXV A;  2WAC A;  4KV6 A;  2F0H A;  1NNX A;  2R7F A;  4RCO A;  3PF5 A;  1EUJ A;  1HHV A;  1Q86 C;  1O7I A;  5AJ3 Q;  5EPK A;  2E2J B;  3S15 H;  1HNW L;  4NW2 A;  3HOU H;  3E0E A;  1O7Z A;  5CMD A;  3HFZ B;  2NB0 A;  1IHZ A;  1V1O A;  3S1M B;  4NXN Q;  4RA8 A;  1ZXT A;  2ZXR A;  2B2W A;  2QW7 A;  1VQ7 A;  4YCW A;  4A3J H;  3RZO H;  4K6L A;  4BBR G;  5EPL A;  1WTP A;  2E75 C;  3HOX H;  4L5T A;  2MPM A;  4A3C G;  2JA5 B;  1F2Y A;  4P71 A;  4IFD H;  3AYH B;  1Z9F A;  1EOV A;  2ZM6 L;  4LFB Q;  1EYD A;  3GTK H;  3CCE A;  2F4V Q;  2EY1 A;  2EZV A;  1K83 B;  1K8O A;  1BCP B;  1MIU A;  3K57 A;  1HNW Q;  4DAY B;  1CA5 A;  4PMB A;  2B8F A;  3H6M A;  4ABN A;  1VQN A;  4A3F G;  1BO0 A;  4A3D H;  3RNU A;  4RFB A;  1XNR L;  4FO2 A;  3J80 c;  2JE6 I;  2L12 A;  1F2L A;  1YHB A;  3H0G G;  1EU3 A;  1HZ9 A;  1Y8O B;  4DAM A;  3H0G H;  2KCN A;  1SLJ A;  1N33 Q;  1OXX K;  2A6H D;  4C3I H;  1STE A;  5IGC A;  3EBE A;  4ULL A;  4AH6 A;  5IYC H;  4XT1 B;  3OMG A;  4JOI C;  1STA A;  2VL6 A;  1PH1 A;  4KLK A;  1A3V A;  4ZCK A;  1XMQ L;  3K5O A;  2TSS A;  3SGI A;  1L0Y B;  3L0O A;  2FMM A;  2HHH L;  4A3K H;  4RMF A;  5CBE E;  5IYB H;  4O42 A;  4OO1 H;  5FKA C;  1YBY A;  3EQL C;  4IJH A;  5DEH A;  2KHS A;  3IRB A;  4O0A A;  2CFM A;  5C0X I;  3C46 A;  1HR0 W;  3D6C A;  2UUB L;  2JA7 H;  1YJ9 A;  4KTA A;  3BYT B;  2TMP A;  2A6E C;  2O2L D;  1EQT A;  1XMO Q;  1JR0 D;  1YHQ A;  3S14 H;  3FP9 A;  1V1Q A;  1H9K A;  4OWW B;  3FMC A;  1GKH A;  1VF5 C;  4A3B H;  4K2K A;  2A6E D;  3HOV G;  2VQF Q;  4LF9 Q;  5C3E H;  3W1B A;  4IQZ A;  1I4Q A;  1HZA A;  5C44 B;  3A7L A;  1LLR D;  1STN A;  1ILQ A;  2KHJ A;  2A69 D;  1UEA B;  1AH9 A;  1DCZ A;  1X65 A;  2VY3 A;  4MTN A;  4Q5V A;  3J7Y W;  2KED A;  1A15 A;  3NQT A;  4KJN A;  1ZYR D;  2VW9 A;  1A6X A;  3MFY A;  4C56 C;  5M9O A;  1B2T A;  3HOV B;  2IL8 A;  5DM7 3;  2VQE Q;  1NAP A;  3I4O A;  3PO2 H;  1SRU A;  5E4W C;  1XNQ Q;  2K28 A;  4FF1 A;  4ME3 A;  2ICE C;  4A93 G;  1PH8 A;  4N8F A;  4XDX A;  1HNX Q;  4K0K L;  1M8A A;  1OXS C;  4OGQ C;  1P8L A;  3NEL A;  4EX5 A;  4A4I A;  5KND A;  5IGE A;  4EQP A;  1SYG A;  4DFA A;  1GUT A;  3A8J E;  3U9O A;  2RQX A;  4LWC A;  2KEE A;  1LM0 A;  2PPB C;  3W3A A;  3G4S A;  4DV7 Q;  1TWA H;  1UNS A;  1V1P B;  1EFW A;  1QB5 D;  3A74 A;  1Q1E A;  3H3V H;  1VS0 A;  1ONL A;  3U50 C;  1WTR A;  1I6H B;  3MZ5 A;  1ZKO A;  3PSI A;  2VB2 X;  5A2Q L;  4GN5 A;  1PHJ A;  4OO1 G;  3P1H A;  1HXY D;  4HCS A;  4POG A;  5ELB A;  2EVB A;  5FO7 B;  4JI2 Q;  1SYC A;  1L1O A;  3CQZ H;  3S2D B;  1PXU A;  4ALP A;  3TS0 A;  4JI0 Q;  1J8I A;  1RTO A;  4I65 A;  5GRO A;  2OQ0 A;  1X56 A;  1HNZ Q;  2M2L A;  3VR6 A;  4QQB X;  1JC7 A;  1JQY D;  2ZT9 C;  4HIO A;  2EYJ A;  4F8M A;  3SEB A;  2UXB L;  2WAQ B;  3U4Z A;  2CVR A;  4CDE C;  4P75 A;  2A68 C;  5IGG A;  2HCI A;  3MXP A;  4RG1 A;  3DM3 A;  5EKI A;  4DR4 Q;  3H91 A;  4IO9 A;  2KUM A;  3R2I A;  1CQF A;  4JYA L;  3GTM H;  1I4X A;  2OCE A;  4JI2 L;  4ZLT F;  4HJ5 A;  1WJJ A;  5GAG C;  3CCU A;  1U4L A;  4DN4 M;  1W2B A;  1JB3 A;  2EYL A;  1CHP D;  3A5Z B;  4TRD A;  3HKS A;  4HAE A;  2K75 A;  4LUV A;  1XPO A;  4A93 B;  1CK1 A;  4OIK A;  1A63 A;  2QEJ C;  2Q8I B;  4DR1 L;  2RF4 A;  2K5V A;  4AQY Q;  1XTD A;  2F3I A;  2EY5 A;  3GTG B;  4IFD G;  3P7J A;  4TKO B;  4ZK9 B;  1WTW A;  2FIN B;  2R92 G;  2CHB D;  2RDG A;  2V1C C;  3NWT A;  4RGT A;  4YY3 Q;  4JI3 Q;  4BXX G;  5A35 A;  2E8G A;  2XWB B;  4IUP A;  1B7Y B;  4PZ7 A;  1TVX A;  2MO0 A;  1AP0 A;  3CD6 A;  2M00 A;  5ELE A;  4R8I A;  3AEV A;  2EE1 A;  5BN3 A;  4DU9 A;  5TSS A;  4JI8 Q;  4S3S A;  2B39 A;  1VQC A;  5LL6 S;  3E5S A;  3G48 A;  1UAP A;  2IHE A;  3RLF A;  4V19 0;  1HA6 A;  2BOS A;  1EY7 A;  1H9S A;  3SK8 A;  4LF5 Q;  2JYO A;  3K0X A;  1PYB A;  5C5L A;  4A3M B;  3JAM E;  1BCP D;  1GHK A;  2CH4 A;  5I2X A;  5M5Y H;  4DV3 Q;  1I4P A;  1N36 L;  4CKC A;  1S5B D;  3D31 A;  5G3L D;  5IYD H;  4ZYS A;  1ENA A;  4X62 Q;  5D3D A;  2FMC A;  3DXJ C;  4DV0 L;  5JEA H;  1T5E A;  2PCF B;  4J1M A;  1RTN A;  4N9P A;  1TXY A;  3TDQ A;  4KY7 A;  1GUN A;  3OTO Q;  2I46 A;  5IYB G;  1YNN D;  4HED A;  3HOY B;  4QIW B;  1QCB D;  5JAV A;  3PGZ A;  1G51 A;  5C0X H;  3Q22 A;  4A3G G;  4J6H A;  1SMX A;  4IOA A;  2JXM B;  4OWT B;  4OEL B;  4HR7 B;  4X64 L;  5I4D A;  5EQ0 A;  1MHW C;  3T16 A;  2EJG C;  1UUP A;  3SVM A;  2EYH A;  5DLQ E;  2EYF A;  3J81 c;  4LMQ D;  1S72 A;  2ID0 A;  4A3L H;  4GZY C;  2DY7 A;  4P73 A;  2LMC B;  5FLX c;  2K5D A;  3GDE A;  4HJ8 A;  1YEZ A;  4LFC Q;  2DJG C;  4JBW A;  1N32 L;  2VS1 A;  4RGM A;  2B63 H;  4C3J H;  3ERO A;  1Q7Y C;  2UXB Q;  2B2T A;  3L3O C;  2R7Z B;  2CCZ A;  1S3O A;  4K8J A;  3HOU B;  4XYQ A;  1WFQ A;  3EJI A;  4R4C A;  1S5E D;  2B63 G;  2OXP A;  4C3H B;  1JOR A;  5M5X H;  4LF4 Q;  3TS2 A;  2N88 A;  3I4M B;  1IYJ B;  5K36 H;  2F0K A;  1CKN A;  4LF6 Q;  4C2M H;  1BKB A;  1JWM D;  5M3F B;  1PTO F;  1BNZ A;  1F2Z A;  1SE8 A;  5CBA E;  1IW7 D;  2L9H A;  2SEB D;  3T56 B;  2UUC L;  1PH2 A;  1VQA A;  1BUV T;  4CDD C;  4A75 A;  4G7Z C;  1N33 L;  4A3C H;  3PO3 H;  4QUC A;  1PFB A;  1KHI A;  4JV5 Q;  1RCV D;  1TU2 B;  3CC7 A;  1EWH A;  1DGS A;  1I4G A;  1WTX A;  1DXM A;  1XWE A;  3BJU A;  2BA0 A;  3PV0 A;  1VQJ A;  1S4Z A;  2HDM A;  1LAC A;  3AQQ A;  2HQL A;  2N78 A;  3TRE A;  1H9S B;  1YZ6 A;  2F0G A;  2NVT H;  4DR3 L;  1YNN C;  4BY7 B;  2A68 D;  1IKL A;  1I3Q B;  2EYM A;  5IOD A;  4I7Z C;  3OIQ A;  3DUZ A;  2WB1 G;  5LMN L;  2WFW A;  3DHQ A;  4QGU A;  1STY A;  5FLM H;  3TZD A;  4K14 A;  3ITP A;  2UUA Q;  4EGV A;  3D4W A;  2OWO A;  4KN4 C;  3BDO A;  3SK4 A;  5J39 A;  5KGU A;  1GUS A;  4GOP C;  1H9M A;  1PLF A;  1SXT A;  1OO9 B;  4X62 L;  2NVY H;  3W5O A;  2L11 A;  2VXW A;  4DR2 L;  2K05 A;  2Q2U A;  3TBI B;  4OON A;  4R4Q A;  3FVQ A;  4X66 Q;  4ZAI A;  1N9W A;  4DV5 Q;  2LXK A;  3T4A C;  4QL5 A;  2NYZ D;  1Z47 A;  1CFM A;  3I72 A;  1G6Z A;  1LYL A;  1L2F A;  4KK7 A;  3RZD B;  1HZB A;  5G3L F;  1EWC A;  3D4R A;  1BBX C;  1W3S A;  3CF5 A;  3H15 A;  4A3D B;  1SJH D;  1L0X B;  1KTK A;  4H0L C;  1V43 A;  3R8B A;  2QA4 A;  4BBS B;  2NN6 I;  4J8Q A;  2AUJ D;  4BA2 I;  3I73 A;  1D8L A;  1Y8N B;  1B3Q A;  3RMH A;  3VA5 A;  3PF4 A;  1BBU A;  1EQV A;  3HOZ G;  4NDX A;  4LF8 L;  2DNE A;  2K4K A;  3KUP A;  3BVM A;  3BZD B;  4LUZ A;  2LY7 A;  4OWX B;  1KC8 C;  3C2P A;  4BBS G;  2Z4H A;  1DD2 A;  1S5C D;  1XX8 A;  2GVA A;  5T1G A;  1D5X C;  1V8Q A;  4C1N I;  2EDG A;  2CWA A;  4IPD A;  1WTQ A;  1GJX A;  1GHJ A;  1SFO B;  5KYL A;  2OTL A;  3CCQ A;  2F0L A;  2J7Z A;  3LWE A;  4JI1 L;  5JJZ A;  2Z9H A;  1B44 D;  4HCE A;  1TWF B;  4KKS A;  3S15 B;  4QY7 A;  1ASY A;  1CHQ D;  4DUY Q;  3SR1 A;  1FGU A;  2B2Y A;  3HEJ A;  1LT4 D;  1PH4 A;  3I7F A;  5GQO A;  4IUN A;  1Y14 B;  1CQV A;  4HJA A;  3UDG A;  3CME A;  3DEP A;  3FDT A;  2A6H C;  2NVX H;  2A8V A;  5C3E G;  1XJV A;  2R61 A;  2QKI C;  4RHS A;  3Q23 A;  1LTR D;  3HRZ C;  3GTJ B;  4JI1 Q;  2NTT A;  5EKL A;  1Y1V G;  1E2Z A;  1ICF B;  2PZW A;  3L7Z C;  4XXE A;  1N34 Q;  4UAI A;  1C8C A;  3HOW G;  3K7A B;  2MQH A;  4DV6 Q;  4O2D A;  4K5X A;  1HZC A;  2L15 A;  5HGQ A;  4NXM L;  3A7A B;  3I3C A;  2VB3 X;  3NSW A;  5C5M A;  1AE3 A;  1EOT A;  2ATW A;  3IFD A;  5K36 G;  2BE5 C;  4GN3 B;  2XIW A;  4DAP A;  1A2T A;  2H1E A;  3J7A 5;  1Q90 A;  1KAB A;  2K01 A;  5BN4 A;  2F0O A;  4KD3 A;  4AIM A;  1VQ4 A;  1KNE A;  1HNX L;  3KDF B;  3WOE A;  3KOJ A;  3MXU A;  1YI2 A;  3M4O H;  2XTI A;  4TQU S;  3I4N B;  2F0P A;  2K7V A;  3GTQ H;  4X66 L;  5D14 A;  2FJ2 A;  3RLN A;  1QZG A;  3KBX A;  5JEA J;  3W1G A;  1YNJ D;  4H02 A;  1MBY A;  5JOB A;  4HJ9 A;  4EVO A;  3MWY W;  2EY2 A;  2RKS A;  4L5Q A;  3I55 A;  1E1T A;  4NPS A;  3BVZ A;  2SDF A;  5GAE C;  3J7Z C;  3M7G A;  3VYU A;  4C2M B;  1D6E C;  2ALY B;  3MEF A;  2PMZ E;  2X69 A;  4K2L A;  4IPC A;  4DUZ L;  3VYT A;  4GKJ L;  1IXR A;  1R4Q B;  3HGB A;  3H09 A;  3D4D A;  3M9B A;  1PTO B;  4GOP A;  3NEN A;  2RSO A;  1YJW A;  1EIG A;  3KJP A;  4G7O C;  1SR3 A;  3B6Y A;  3ND9 A;  4R4O A;  2F0E A;  4A3J G;  4MZ9 A;  4DK3 C;  4YHH Q;  2E76 C;  4EQN A;  4B3S Q;  1FNV A;  3WWV A;  3AMU A;  3QG1 A;  2A5H A;  1U9R A;  4ZUJ A;  4L5S A;  1A2U A;  2VUM H;  2OT2 A;  3T51 B;  2UU9 L;  2IHF A;  3KYH C;  4IN3 A;  1JB7 A;  5IYD G;  1HR0 L;  2EIF A;  2D62 A;  1WVL A;  4GKJ Q;  2Q8R E;  4BY1 H;  3C3L A;  1NCV A;  4MN3 A;  4DUY L;  2ZXO A;  3MXN B;  1MKH A;  3J81 L;  2Q2T A;  1H9J A;  1ESR A;  5C0X G;  3KFU A;  3PO3 B;  2EY6 A;  3PCO B;  2JQO A;  3KLS X;  3UE0 A;  1SAP A;  2F0S A;  1J6Q A;  1HFG A;  4XQJ A;  4RAU C;  2PW7 A;  4QF4 A;  2YU9 B;  1HFN A;  1GO3 E;  4A3M G;  4DNT B;  3EVQ A;  3CW2 C;  3A54 A;  2JA5 H;  3K81 C;  1W6J A;  2ICI A;  2NVQ H;  4A3J B;  3RZO B;  2K5W A;  1FD7 D;  1TWA B;  1VQB A;  1K28 A;  1WTV A;  4GKK L;  1KIX A;  1SE3 A;  2NTS A;  4YY3 L;  4L63 B;  3F2B A;  2UXC L;  3TRZ A;  3ZYY X;  1MI2 A;  3CCR A;  1QVG A;  2NN6 H;  4MTK A;  3S1N H;  4DR6 Q;  2AWO A;  3L9A X;  3E0J A;  2BH2 A;  2Z6B A;  4LW1 A;  4X3S A;  2NBF A;  4IOC A;  3ULP A;  1LTB D;  5CV8 A;  4C1N K;  1K8A C;  1CKM A;  4MIU A;  1ZYR C;  5M5W H;  2ZTC A;  2PW5 A;  1BBW A;  1S5D D;  2Q8T A;  2K1B A;  3T1Y L;  3STB C;  5EPJ A;  1KNA A;  1GOZ A;  1SE4 A;  2YU9 H;  3CC2 A;  2FFK B;  3PUW A;  1ENC A;  2QGQ A;  1WCM H;  1R4P B;  4HIK A;  3D6W A;  1C48 A;  2LSS A;  1HRJ A;  3I70 A;  2UXC Q;  2IW3 A;  3CC4 A;  4IFD J;  3NHH A;  2XWJ B;  4GS3 A;  3RLO A;  1SNC A;  2EJM A;  1QZH A;  5I2Y A;  3M4O B;  1STH A;  4BBS H;  4LK1 C;  1IBK Q;  2K14 A;  2RDF A;  4DV4 L;  1EQQ A;  2WB1 E;  2MHV A;  3MA2 B;  2UUA L;  1T5X D;  4U68 A;  1RHP A;  1LTI D;  1SSO A;  4C3I G;  4A3E G;  5EBC A;  4QIW E;  3T1Y Q;  1QUQ B;  5CR3 A;  1LT5 D;  1SEB D;  3I56 A;  3KF6 B;  4WJ4 A;  2UXD Q;  3J80 i;  4JI7 L;  4JBJ A;  4LF7 Q;  3M3Y B;  5IOC A;  4IUR A;  4B3T L;  3NEM A;  3G7L A;  3NBH B;  4K8I A;  4YWM A;  5IT9 L;  2Y0S G;  3VYR A;  4A3F B;  4C3J G;  4F87 A;  1NY4 A;  4K5W A;  3BG3 A;  4A3F H;  4OO1 I;  4DV2 Q;  3KDF A;  2IX0 A;  4ZRZ A;  5C4X B;  2EJF C;  1J5E L;  4LUO A;  3UI2 A;  4EQO A;  1A0I A;  1KRT A;  1EL0 A;  4Z9C B;  1BOS A;  1L1O B;  1RD9 D;  1IYU A;  5CC4 A;  4NXN L;  2BDO A;  1DM0 B;  1U5K A;  1I6H H;  3IFT A;  3CCM A;  2IWH A;  2O5J C;  4PQX A;  4JI7 Q;  4LF7 L;  2R7D A;  4FP5 D;  5KRU A;  1IL8 A;  4B3T Q;  4XIG S;  4OL7 A;  3O13 A;  1O78 A;  1WYD A;  1JE5 A;  2N3S A;  4WJW A;  3T1H Q;  1I94 L;  3I8Z A;  3N6R A;  3I4M G;  4JV5 L;  1V1P A;  1LTT D;  1GD7 A;  1PYW D;  3AFQ A;  1G2S A;  2I07 B;  2JEB I;  1E2V A;  2F0V A;  3KLS A;  1VQG A;  4DR4 L;  1J5E Q;  3F8T A;  1JIC A;  3OHX C;  4FNF A;  1HPC A;  1XXG A;  1M1K C;  1JOK A;  1ML0 D;  3CCS A;  1EQR A;  1CZG A;  3J80 E;  1W6K A;  1X54 A;  3S2H B;  4JI4 L;  3PO2 B;  4CKB A;  2C9O A;  3GV3 A;  1FNW A;  1VQ6 A;  1FGB D;  4JI6 Q;  1WI5 A;  1NUC A;  3HOZ B;  5KEE A;  4DF7 A;  4X65 Q;  1Q8I A;  5F2D A;  3HG9 A;  3KJO A;  1XPR A;  1SBB B;  1RDP D;  3KBG A;  1JMC A;  5EKK A;  3U4V A;  3K7U C;  4AQY L;  1SYE A;  4LF4 L;  1CZW A;  4E6I A;  4B08 A;  1D2B A;  2RBM A;  5IIF A;  3JAM i;  1M90 C;  2HHH Q;  1Q8K A;  2F0W A;  2AKW B;  1KDA A;  5AFW A;  1PZI D;  1ROD A;  1IW7 C;  2HDL A;  2A19 A;  2Q2H A;  4QCL A;  4H44 C;  1FYC A;  1OXU A;  5JVG 3;  4PG3 A;  5FK9 C;  2HD3 A;  4ID6 A;  1X3F A;  1MGS A;  5DNF A;  1I4H A;  2PO4 A;  2MNA A;  3TSS A;  4UDU C;  3NTI A;  2NVY B;  3ERS X;  1EEF D;  5CV4 A;  4AYB B;  5H1S E;  1CSP A;  1X3P A;  1XMO L;  1AFP A;  1TT2 A;  1SFO H;  3ICE A;  2OEO A;  4WRD A;  2B3G A;  4FF2 A;  3I91 A;  2RCN A;  4YIJ A;  4CKE A;  2E2I B;  5FO8 B;  4LF9 L;  1PRT C;  1XYI A;  3VYS A;  1Z7T A;  3Q0A A;  5LMN W;  1EIY B;  2D0P A;  2O5I C;  1UEB A;  5IT9 c;  1X9N A;  3ULL A;  3NE5 B;  3OTO L;  5BR8 L;  2MP1 A;  3VDY A;  2IY5 B;  2SNM A;  2VUM B;  5KNB A;  1I3Q H;  2F0Q A;  5JJI A;  5HUR A;  1BR9 A;  2F0T A;  1JWU D;  1BDO A;  4F88 A;  2CW0 C;  2F0J A;  2NVT B;  1EU4 A;  2QDB A;  4PNY A;  1Y1W H;  3U58 A;  2JA8 G;  1K0S A;  2YTY A;  2K5H A;  4DV2 L;  1NR4 A;  3X3N A;  4B3R L;  3I4N H;  2G9D A;  2CH4 W;  1WTO A;  3L2P A;  2Q2I A;  4BBR H;  1PMR A;  5C44 H;  1Y69 U;  1E7Z A;  2DN8 A;  4TSS A;  1SND A;  4UP7 A;  1L1O C;  2JP1 A;  2J4X A;  4PMC A;  3QOJ A;  3TP8 A;  4A3B B;  2A1A A;  3S1Q B;  2LS0 1;  4QJF A;  4IAL A;  1STG A;  4UP8 A;  4A76 A;  1JOQ A;  1SN8 A;  1S5F D;  2DNC A;  5M3F G;  2HIX A;  5ELC A;  3F1Z A;  1OXT A;  5C4X H;  4PZ8 A;  4IZ8 A;  2QCP X;  2N8N A;  3V05 A;  5IP7 G;  4JI5 Q;  1XMQ Q;  4BXX H;  4AYB E;  3PQI A;  1F9R A;  1O7Y A;  1FJG Q;  5IE8 A;  5C0X J;  3Q8D A;  2Y0S B;  2C5C A;  1SNM A;  5GAH C;  4J15 A;  1HTL D;  4L8J A;  1PZJ D;  3S16 B;  1OTC A;  2NVX B;  1N34 L;  2E2H H;  2FXQ A;  1ASZ A;  3H3V C;  1YVC A;  2F52 A;  4DK0 A;  5COR A;  1QG7 A;  1TS3 A;  4LFB L;  2IPK D;  1JJ2 A;  2F4V L;  2K6A A;  2X6L A;  1TS4 A;  1NE3 A;  3PIP 3;  1GUO A;  2CQO A;  2WKC A;  2XGT A;  4DXF A;  2BCO A;  4JI5 L;  1TWG H;  4LFA Q;  4A3G B;  2P5Z X;  4Y7N H;  4KHP Q;  3BZK A;  3W2D A;  1XPU A;  2R93 B;  3MVV A;  1I4R A;  1VMC A;  3CRL C;  2WV6 D;  4KKT A;  5J22 A;  4DR3 Q;  2NZH A;  4O1N A;  1HTP A;  2MO1 A;  1UWV A;  1WCM B;  4N8X 1;  4DK6 C;  1IBM L;  4Y7N B;  2E74 C;  1TWG B;  3MAQ A;  2BA1 A;  3CXC A;  3QR8 A;  4GNX C;  3QIA A;  4HMJ A;  1RKN A;  3S2H H;  3R3O A;  5FO9 B;  1BCP F;  5C6A A;  2B2V C;  5JPN C;  1EY6 A;  1D1K A;  3TP7 A;  5M5Y B;  1EY5 A;  2KCT A;  2DJF C;  2LKV A;  1T9H A;  5JVH 3;  2VQE L;  1NTG A;  2F3W A;  1K73 C;  4DR1 Q;  2OTJ A;  5J3B A;  2JA8 H;  1LUZ A;  3ZJY C;  3PUV A;  2EOT A;  1AW7 A;  5ELF A;  4UPA A;  3MXN A;  1X3E A;  4BY1 G;  3UE1 A;  4K0K Q;  4DR2 Q;  4DUZ Q;  1TWC B;  3QWN A;  1ICW A;  2JEA I;  5BR8 Q;  5EAY A;  3F2D A;  2AHO B;  4NXM Q;  4JBK A;  1EFI D;  1DON A;  5IY0 A;  1VQ9 A;  3BDL A;  2EPB A;  4JI8 L;  2E5L Q;  4OHJ A;  1C9O A;  4KY6 A;  3PIO A;  4DV7 L;  4CJ2 C;  4B3S L;  3GTL B;  1VQD A;  2PYK A;  1N8R C;  4LF5 L;  3ULJ A;  5FJ8 G;  3JAM c;  4RCN A;  4ZKB B;  3NXW A;  2G9H D;  4GOP B;  3S1Q H;  1PH3 A;  5IGF A;  4DA2 A;  2NZO A;  2Y0S E;  1O7L A;  3FKI B;  3HKZ B;  3NPP A;  3G6J B;  3OW7 A;  4R4T A;  4LF8 Q;  4UHV A;  2RHQ B;  1UE1 A;  1RF2 D;  2PQE A;  4JPB W;  1TS2 A;  5GAD C;  3E9H A;  5IGB A;  3A55 A;  3K5L A;  3CCL A;  4KKU A;  2MGS A;  3FPP A;  1PZK D;  2KA7 A;  5C4H A;  4DNI A;  2QDL A;  1PV4 A;  2DY8 A;  4FXD A;  1FJG L;  2LFN A;  2WIN B;  4ILW A;  5C4J B;  3IKJ A;  1PVO A;  1ENF A;  2M9V A;  2K5N A;  2RHS B;  3S16 H;  3AB9 A;  2F3V A;  1Q12 A;  5FLX E;  1IL2 A;  3D3R A;  5A2Q E;  1KLU D;  1D7Q A;  1ESF A;  1NJI C;  1II3 A;  1GUG A;  1NMF A;  1WOC A;  1TQO A;  1K8G A;  3OWE B;  3AFP A;  3K5M A;  1HCZ A;  1TKW B;  4U67 3;  1HUN A;  3CRK C;  3OIP A;  4Q0F A;  3R93 A;  3EN2 A;  1TS5 A;  4FVM A;  5LMU L;  3I4M H;  4HID A;  1KL9 A;  4A3K G;  4L5R C;  4C3H H;  1DZ1 A;  4LF6 L;  4DK1 A;  1IBM Q;  3RR5 A;  2JA5 G;  4JI3 L;  1TWF H;  1L0W A;  3I4N G;  1UE7 A;  4BBR B;  3LWU A;  1MJC A;  1TWH B;  2I5M X;  5C3X A;  4DAV A;  3PMF A;  1S40 A;  1I50 H;  2MJ8 A;  1TR5 A;  4APV A;  4P72 A;  1SNQ A;  1UE5 A;  3E3X A;  2SOB A;  3VA7 A;  5LMU Q;  3HOZ H;  3I2Z A;  5ELN A;  2XN9 C;  4PZ6 A;  5M3F H;  1JOO A;  1SNP A;  3SXH A;  4DKA C;  3V2T A;  4A3I H;  3OMC A;  2XSC A;  3SK6 A;  2VUM G;  3OPO A;  4JCV E;  1HUM A;  4CJ1 B;  1ET6 A;  2UXD L;  4MNO A;  1F9S A;  4CDF C;  1E1O A;  3I90 A;  2XRQ D;  1CA6 A;  3DEO A;  1IBL L;  2F1M A;  4BY1 B;  5C44 G;  3E6Z X;  4LAA A;  3G6E A;  2B29 A;  4A3G H;  2KVM A;  4RKB A;  3J7A F;  1I5F A;  3T53 B;  3NBI A;  5C3E B;  1EYC A;  2F03 A;  3FRP B;  1SRO A;  2RCF A;  2K50 A;  5T1I A;  3FHW A;  4X64 Q;  3DMU A;  5EBD A;  1VQ8 A;  5L37 A;  4JC0 A;  3VR2 A;  1B3A A;  1DOL A;  4DV1 L;  3N52 A;  2B8G A;  2HUG A;  4FXG C;  4OIJ A;  1WD0 A;  4XT3 B;  1X55 A;  5E7N A;  1SDF A;  1PTO D;  1R9T H;  1WCM G;  3S24 A;  2PI2 A;  1Q1B A;  4HIM A;  1N32 Q;  1EIH A;  1Y8P B;  3TEH B;  3S9W A;  4YHH L;  2F0I A;  3ER0 A;  3SK5 A;  1SE2 A;  4NMZ A;  3MHB A;  2HIV A;  1NMG A;  3HOY H;  1F9Q A;  4L6T B;  3S17 H;  2CW0 D;  3Q24 A;  3GTO B;  1MSH A;  5AJ3 L;  2D0O A;  2UU9 Q;  1VMP A;  1KLG D;  3OOC A;  2F0M A;  4BS9 A;  1DOM A;  4LNQ A;  4DV3 L;  1N36 Q;  2HQE A;  3GTG H;  1U4M A;  3PUZ A;  5C4J H;  3ND8 A;  2YV5 A;  2NZ1 D;  4X3U A;  3R2T A;  4WJ3 M;  5COY A;  1G6P A;  2WAQ E;  3BS1 A;  1LTA D;  4A93 H;  3BYY B;  3H0G B;  3MEH A;  2JA7 G;  3KLR A;  2UUC Q;  2WKD A;  3PO2 G;  1VQP A;  4ZKC B;  2Z8L A;  3K8A A;  1IKM A;  5M3M H;  4ZUI A;  3I4L A;  3Q6S A;  1Z6H A;  1HJP A;  2KQ3 A;  4KI0 A;  3IL8 A;  2ZJR A;  4XTC S;  4B3M L;  3GTP H;  3H94 A;  2JSO A;  1Y1W B;  4POF A;  1PA6 A;  4NKL A;  3GTM B;  5J1Z A;  5FLX L;  3MTS A;  3AU7 A;  3CKI B;  1JT8 A;  2AQ1 B;  3PIP A;  4FF4 A;  3PIO 3;  1K0R A;  5IWA Q;  3GTL H;  5IYC G;  1U4P A;  1QVC A;  1E3P A;  3NTK A;  4LFC L;  2CQA A;  3VR4 A;  2K03 A;  3NBH A;  2IX3 A;  2ZXP A;  4YCU A;  1VQE A;  2WII B;  1F77 A;  2L1B A;  3K7A H;  5FJ8 H;  3T1H L;  2E2I H;  4A3B G;  2BE5 D;  3OWF A;  5CV6 A;  2YTV A;  4A3I G;  4GLX A;  4RKL A;  1F9P A;  1VQH A;  3RN5 A;  1YHA A;  5DAU A;  1A8V A;  3S1M H;  2CKZ B;  2WP8 J;  1E2W A;  2F0U A;  1QOH A;  2JA6 H;  3M3Y H;  4GNX B;  2K33 A;  1B9M A;  1LT6 D;  3KF8 A;  3NUC A;  4P2C B;  5ELO A;  2R7Z H;  4XYO A;  2JA8 B;  1K3R A;  3SHL A;  1PFM A;  4C3J B;  3UDX A;  4ZQ3 A;  3A8I E;  1D1I A;  4WOR A;  2B2U C;  5IWA L;  1K8M A;  3A56 A;  1X3Q A;  4BY7 G;  4DV6 L;  4G4K A;  1BQQ T;  4HSP A;  1MSG A;  1IBL Q;  1PTO C;  4QB4 A;  3VR5 A;  4CJ0 B;  5DM6 3;  4OEM B;  4GN4 B;  2R3Z A;  4OX9 Q;  3J80 L;  1BXT A;  2F0D A;  4QUF A;  3UDI A;  5LL6 X;  4X3T A;  1YJN A;  3M7N A;  2MFI A;  1X32 A;  1HH2 P;  4AYB G;  2Z4I A;  5D65 A;  2KJX A;  4A3I B;  1C7Y A;  1D5Z C;  1B8A A;  1AZP A;  1C0A A;  1A3U A;  3F2U A;  4RH6 A;  1LTL A;  5I6W A;  3CU7 A;  2V4D A;  3QJY A;  4QMG A;  5NUC A;  1CTM A;  4JG2 A;  4X3K A;  1I6V C;  1EY0 A;  2AQ3 B;  4KD4 A;  3F2C A;  1G8Z D;  2XRS D;  3TN2 A;  1HA5 A;  3LX0 A;  2K5Q A;  1EYA A;  4K5V A;  5M3M G;  4C3H G;  2E2H B;  2JN4 A;  4WFN 3;  5C4Z A;  2N55 A;  1G2T A;  4ME5 A;  3RN2 A;  1LO5 D;  2JK8 A;  1EWI A;  3TZU A;  3RZD H;  1JE4 A;  4HJ7 A;  2JA6 B;  1XNQ L;  2E2J H;  4R1J A;  4RGO S;  1VF7 A;  3CPW A;  1STB A;  1PH5 A;  2I0Q A;  3QOL A;  4PMW A;  3EFX D;  4YWK A;  3J81 E;  2EQS A;  3JAM L;  4DR5 Q;  1CI3 M;  2NVQ B;  1JCK B;  1ILP A;  2D2C C;  3OW2 A;  4PV1 C;  1QWY A;  3K6O A;  2ZTE A;  2I5L X;  4DV5 L;  3HOV H;  5IP9 G;  4HN7 A;  3V96 A;  5IP9 H;  1B50 A;  3CMA A;  5IGD A;  1AE2 A;  1K9M C;  1BF4 A;  2F4I A;  3SE0 A;  1SNO A;  3HOY G;  2LXJ A;  4JI4 Q;  1HR0 Q;  1AN8 A;  2A74 C;  3FPU B;  2R92 H;  5KNC A;  3KLW A;  4DR5 L;  3PO3 G;  4H13 C;  1A3T A;  2PZT A;  1Q81 C;  3TQY A;  4HTH A;  4JI0 L;  1EZ8 A;  2K32 A;  2NUC A;  5I6Y A;  4G57 A;  1LTS D;  2ZM6 Q;  4BY7 H;  3CCV A;  2UUB Q;  3VR3 A;  1U0L A;  1JJG A;  2ZTD A;  3QO2 A;  1TII D;  2KEN A;  3BU2 A;  3OSO A;  5C4X G;  5CV5 A;  1UE6 A;  1V9P A;  3A8K E;  4YWL A;  1GM5 A;  2PI2 E;  2L4N A;  4NP5 A;  3TME A;  2VZA A;  1O80 A;  3S17 B;  2HT1 A;  4FF3 A;  1LV9 A;  2BDN A;  3GTJ H;  1QIL A;  3E9I A;  3CQZ B;  3S2D H;  2IX1 A;  3NQI A;  1VQI A;  2F0F A;  5LMN Q;  2KCM A;  2D9U A;  4R8N A;  3WOF A;  4OX9 L;  1VQK A;  3C1F A;  3CHB D;  3GO5 A;  4JK1 C;  2L55 A;  5ISR A;  1Q46 A;  1P16 A;  2VNU D;  2E5L L;  2OF1 A;  5M5W B;  2O4X A;  1DYQ A;  2FHT A;  4C3I B;  4A3E B;  4DNR B;  4LFA L;  2B2T C;  4KY5 A;  1RJT A;  4V0B A;  3M85 A;  4BA1 I;  2XNA C;  5CV9 A;  1FVI A;  4IPH A;  3S1N B;  3STB D;  4A3L G;  5HGT A;  3K59 A;  3ONA B;  3TP5 A;  1PH7 A;  1HQM C;  2R6G A;  4MHE A;  4M1U B;  3KF8 B;  4HMI A;  4IJL A;  4GNX A;  3HKZ E;  3SDZ A;  3HOX G;  1VCI A;  2Z6K C;  3PUX A;  4DR7 Q;  3JC6 6;  1BVS A;  1RIP A;  1LT3 D;  2RDH A;  1H95 A;  5KYI A;  3NP8 A;  4EQ5 A;  1PFN A;  5LHY 1;  3J7A V;  5JEA G;  5BN5 A;  2VQF L;  5I9O A;  3HOU G;  3U9S A; 
#chains in the Genus database with same CATH homology
 2ENB A;  4IUV A;  2NN6 G;  1ET9 A;  2EYP A;  1SYF A;  1MD2 D;  4CBV A;  1LAB A;  2GA4 B;  1DJR D;  4KJO A;  2NWG A;  3K0Y A;  1JWS D;  1QE6 A;  5ELD A;  2AQ2 B;  2A73 B;  1G29 1;  3S14 B;  4RGN A;  1PRT B;  3GQB A;  3HZX A;  3DWA A;  1PTO H;  1VDZ A;  1C4Q A;  2IT1 A;  3C1E A;  1KDC A;  3GV6 A;  4DXG A;  3BDC A;  1SYB A;  4B9X A;  2D5D A;  3D8G A;  4FXK C;  3M4Y A;  4KHZ A;  4KN7 C;  1R9T B;  2L5T A;  1SJE D;  1GXD C;  2QIL A;  5KIX A;  5E1F A;  2PNR C;  3K5N A;  4FYD A;  3LNN A;  5CYU A;  3TP6 A;  4N9T A;  2R92 B;  3ERQ A;  1ZEQ X;  1YNJ C;  3PUY A;  1J9O A;  4RWS C;  3WDN A;  1LTG D;  1TY0 A;  2B2U A;  2B2W C;  1CT1 D;  1BCP C;  1E0B A;  3HOX B;  3FEW X;  4KHV A;  1SMY C;  1B53 A;  1NSN S;  4XQN A;  1WD1 A;  4M8A A;  3URY A;  4A3K B;  1KDB A;  4DAY A;  5E3F A;  2YYZ A;  4XQQ A;  2PMZ B;  1PRT D;  1B9N A;  2B2Y C;  3BVG A;  2AWN A;  5CGK A;  4CHT B;  5I9P A;  1QNU A;  1IYV A;  1EEI D;  2RVL A;  4IUQ A;  2Z1C A;  5IT9 E;  2WB1 B;  2L0C A;  2KOL A;  4RHR A;  1FNU A;  2B2V A;  5D3I B;  3HOW B;  3P20 A;  3HP3 A;  4DGZ A;  1Y1V B;  2J0T D;  4K6D A;  1SYD A;  2KEC A;  1HQR D;  2QF7 A;  2F0N A;  1QJO A;  3GTK B;  3MXG A;  1FR3 A;  4IUT A;  2AUK A;  4LJZ C;  1SMY D;  1F2M A;  2PZU A;  3DWP A;  1EY9 A;  2RA4 A;  5M5X B;  1I50 B;  3DM1 A;  1B1Z A;  3X3M A;  1U4R A;  3GD7 A;  2EYO A;  3KK7 A;  1AEX A;  4BWG B;  4CGY B;  2HCC A;  3T13 A;  5CV7 A;  5K5P A;  2B63 B;  1GUW A;  2RSN A;  3RUZ A;  1EZ6 A;  4B9W A;  2IJ0 A;  3NTH A;  3MFG A;  2H4O A;  1DOK A;  2A69 C;  3GP7 A;  1NR2 A;  3NK9 A;  1EY8 A;  2JA7 B;  3K58 A;  1EY4 A;  4KMU C;  5C3W A;  1CM9 A;  4HSV A;  5EGT A;  5EJW A;  1KAA A;  2XVS A;  1PDQ A;  5FOB B;  3GTP B;  4R9W A;  3GTQ B;  3QB3 A;  2SNS A;  2E2D C;  3MC0 B;  1XTC D;  5E4X A;  1G91 A;  1AZQ A;  1PRT F;  4ODG A;  2K04 A;  5M3M B;  4G7H C;  4IFD I;  1Q3L A;  1B4O A;  2MUY A;  5JPM C;  3HS0 C;  4F7X A;  2KCC A;  2X6G A;  2EXZ A;  1TY2 A;  1H9R A;  4IUU A;  1QNK A;  3EA6 A;  3RD4 A;  3NWS A;  1M4V A;  3S1R B;  1D5M C;  3DWQ A;  3IAY A;  3P75 A;  4H7B A;  1OXV A;  2WAC A;  4KV6 A;  2F0H A;  4RCO A;  1HHV A;  5EPK A;  2E2J B;  4NW2 A;  1O7Z A;  5CMD A;  2NB0 A;  1IHZ A;  1V1O A;  3S1M B;  4RA8 A;  1ZXT A;  2ZXR A;  2B2W A;  4K6L A;  5EPL A;  1WTP A;  2E75 C;  2MPM A;  2JA5 B;  1F2Y A;  4IFD H;  1EYD A;  2EY1 A;  2EZV A;  1K83 B;  1K8O A;  1BCP B;  3K57 A;  1CA5 A;  4PMB A;  2B8F A;  3H6M A;  4ABN A;  1BO0 A;  4RFB A;  4FO2 A;  2JE6 I;  2L12 A;  1F2L A;  1EU3 A;  1Y8O B;  2KCN A;  1OXX K;  2A6H D;  1STE A;  5IGC A;  4ULL A;  4XT1 B;  3OMG A;  1STA A;  1A3V A;  3K5O A;  2TSS A;  1L0Y B;  2FMM A;  5CBE E;  4O42 A;  4OO1 H;  5FKA C;  3EQL C;  5DEH A;  2KHS A;  5C0X I;  3C46 A;  3D6C A;  4KTA A;  3BYT B;  2TMP A;  2A6E C;  2O2L D;  1EQT A;  1JR0 D;  1H9K A;  3FMC A;  1VF5 C;  4K2K A;  2A6E D;  4IQZ A;  1I4Q A;  5C44 B;  3A7L A;  1LLR D;  1STN A;  1ILQ A;  2A69 D;  1UEA B;  1DCZ A;  4Q5V A;  3J7Y W;  2KED A;  1A15 A;  3NQT A;  4KJN A;  1ZYR D;  1A6X A;  3MFY A;  4C56 C;  5M9O A;  1B2T A;  3HOV B;  2IL8 A;  5DM7 3;  1NAP A;  5E4W C;  2K28 A;  4FF1 A;  2ICE C;  4XDX A;  1M8A A;  1OXS C;  4OGQ C;  5KND A;  5IGE A;  4EQP A;  1SYG A;  4DFA A;  1GUT A;  3A8J E;  3U9O A;  2RQX A;  2KEE A;  2PPB C;  3W3A A;  1UNS A;  1V1P B;  1QB5 D;  1Q1E A;  1ONL A;  1WTR A;  1I6H B;  3MZ5 A;  1ZKO A;  2VB2 X;  5A2Q L;  4OO1 G;  3P1H A;  1HXY D;  4HCS A;  5ELB A;  2EVB A;  5FO7 B;  1SYC A;  3S2D B;  1PXU A;  1J8I A;  1RTO A;  4I65 A;  2M2L A;  3VR6 A;  1JC7 A;  1JQY D;  2ZT9 C;  2EYJ A;  4F8M A;  3SEB A;  2WAQ B;  2CVR A;  2A68 C;  5IGG A;  2HCI A;  3MXP A;  5EKI A;  3H91 A;  2KUM A;  3R2I A;  1CQF A;  1I4X A;  4ZLT F;  1U4L A;  4DN4 M;  1JB3 A;  2EYL A;  1CHP D;  4TRD A;  4HAE A;  4A93 B;  1CK1 A;  4OIK A;  2QEJ C;  2Q8I B;  2EY5 A;  3GTG B;  4IFD G;  3P7J A;  4TKO B;  4ZK9 B;  1WTW A;  2FIN B;  2CHB D;  2RDG A;  3NWT A;  4RGT A;  5A35 A;  2XWB B;  4IUP A;  1TVX A;  1AP0 A;  2M00 A;  5ELE A;  4R8I A;  2EE1 A;  5BN3 A;  4DU9 A;  5TSS A;  4S3S A;  2B39 A;  5LL6 S;  3E5S A;  1UAP A;  1HA6 A;  3RLF A;  4V19 0;  2BOS A;  1EY7 A;  1H9S A;  3SK8 A;  2JYO A;  5C5L A;  4A3M B;  3JAM E;  1BCP D;  1GHK A;  5I2X A;  1I4P A;  4CKC A;  1S5B D;  3D31 A;  5G3L D;  4ZYS A;  1ENA A;  5D3D A;  2FMC A;  3DXJ C;  5JEA H;  1T5E A;  2PCF B;  4J1M A;  1RTN A;  4N9P A;  3TDQ A;  4KY7 A;  1GUN A;  2I46 A;  1YNN D;  4HED A;  3HOY B;  4QIW B;  1QCB D;  5JAV A;  5C0X H;  3Q22 A;  4J6H A;  2JXM B;  4HR7 B;  5I4D A;  5EQ0 A;  3T16 A;  2EJG C;  1UUP A;  3SVM A;  2EYH A;  2EYF A;  4LMQ D;  2ID0 A;  4GZY C;  2DY7 A;  2LMC B;  2K5D A;  4JBW A;  4RGM A;  3ERO A;  2B2T A;  3L3O C;  2R7Z B;  4K8J A;  3HOU B;  4XYQ A;  3EJI A;  1S5E D;  2OXP A;  4C3H B;  1JOR A;  2N88 A;  3I4M B;  5K36 H;  2F0K A;  1JWM D;  5M3F B;  1PTO F;  1BNZ A;  1F2Z A;  5CBA E;  1IW7 D;  2L9H A;  2SEB D;  3T56 B;  1BUV T;  4G7Z C;  4QUC A;  1PFB A;  1RCV D;  1TU2 B;  1EWH A;  1I4G A;  1WTX A;  1DXM A;  1XWE A;  2BA0 A;  2HDM A;  3PV0 A;  1S4Z A;  1LAC A;  1H9S B;  2F0G A;  1YNN C;  4BY7 B;  2A68 D;  1IKL A;  1I3Q B;  2EYM A;  5IOD A;  4I7Z C;  3OIQ A;  3DUZ A;  3DHQ A;  1STY A;  3TZD A;  4K14 A;  3ITP A;  4EGV A;  3D4W A;  4KN4 C;  3BDO A;  3SK4 A;  5J39 A;  5KGU A;  1GUS A;  1H9M A;  1PLF A;  1SXT A;  1OO9 B;  2L11 A;  2VXW A;  2K05 A;  3TBI B;  3FVQ A;  4ZAI A;  3T4A C;  2NYZ D;  1Z47 A;  1CFM A;  3I72 A;  1G6Z A;  3RZD B;  4KK7 A;  5G3L F;  1EWC A;  3D4R A;  1BBX C;  4A3D B;  1SJH D;  1L0X B;  1KTK A;  4H0L C;  1V43 A;  3R8B A;  4BBS B;  2NN6 I;  4J8Q A;  2AUJ D;  4BA2 I;  3I73 A;  1Y8N B;  3VA5 A;  3RMH A;  1EQV A;  4NDX A;  2DNE A;  3KUP A;  3BVM A;  3BZD B;  2LY7 A;  3C2P A;  1DD2 A;  2Z4H A;  1S5C D;  1XX8 A;  5T1G A;  1D5X C;  1V8Q A;  4C1N I;  2EDG A;  1GJX A;  1WTQ A;  1GHJ A;  1SFO B;  5KYL A;  2F0L A;  2J7Z A;  3LWE A;  5JJZ A;  1B44 D;  4HCE A;  1TWF B;  4KKS A;  3S15 B;  1CHQ D;  3SR1 A;  2B2Y A;  3HEJ A;  1LT4 D;  4IUN A;  1CQV A;  3DEP A;  3FDT A;  2A6H C;  2R61 A;  2QKI C;  4RHS A;  3Q23 A;  1LTR D;  3HRZ C;  3GTJ B;  2NTT A;  5EKL A;  1E2Z A;  2PZW A;  4XXE A;  3L7Z C;  1C8C A;  4UAI A;  3K7A B;  4K5X A;  3A7A B;  3I3C A;  2VB3 X;  3NSW A;  5C5M A;  1EOT A;  3IFD A;  5K36 G;  2BE5 C;  2XIW A;  4DAP A;  1A2T A;  2H1E A;  1Q90 A;  1KAB A;  2K01 A;  5BN4 A;  2F0O A;  4KD3 A;  1KNE A;  3WOE A;  3MXU A;  4TQU S;  3I4N B;  2F0P A;  2K7V A;  5D14 A;  2FJ2 A;  3KBX A;  5JEA J;  1YNJ D;  1MBY A;  5JOB A;  4EVO A;  3MWY W;  2EY2 A;  2RKS A;  3BVZ A;  2SDF A;  3M7G A;  3VYU A;  4C2M B;  1D6E C;  2X69 A;  4K2L A;  3VYT A;  1R4Q B;  3HGB A;  3H09 A;  3D4D A;  1PTO B;  2RSO A;  1EIG A;  4G7O C;  3ND9 A;  2F0E A;  2E76 C;  4EQN A;  1FNV A;  3AMU A;  3QG1 A;  2A5H A;  1U9R A;  4ZUJ A;  1A2U A;  2OT2 A;  3T51 B;  4IN3 A;  2D62 A;  1WVL A;  2Q8R E;  3C3L A;  1NCV A;  4MN3 A;  2ZXO A;  3J81 L;  1H9J A;  1ESR A;  5C0X G;  3PO3 B;  2EY6 A;  3KLS X;  1SAP A;  2F0S A;  4XQJ A;  1HFG A;  2YU9 B;  4RAU C;  2PW7 A;  4QF4 A;  1HFN A;  4DNT B;  3EVQ A;  3A54 A;  1W6J A;  2ICI A;  4A3J B;  3RZO B;  2K5W A;  1FD7 D;  1TWA B;  1WTV A;  1SE3 A;  2NTS A;  4L63 B;  3ZYY X;  1MI2 A;  2NN6 H;  2AWO A;  3L9A X;  3E0J A;  4X3S A;  2NBF A;  1LTB D;  5CV8 A;  4C1N K;  4MIU A;  1ZYR C;  2PW5 A;  1S5D D;  2Q8T A;  2K1B A;  5EPJ A;  1KNA A;  1GOZ A;  1SE4 A;  2FFK B;  3PUW A;  1ENC A;  1R4P B;  3D6W A;  1C48 A;  1HRJ A;  3I70 A;  2IW3 A;  4IFD J;  3NHH A;  2XWJ B;  1SNC A;  2EJM A;  5I2Y A;  3M4O B;  1STH A;  4LK1 C;  2RDF A;  2MHV A;  3MA2 B;  1T5X D;  4U68 A;  1RHP A;  1LTI D;  1SSO A;  4C3I G;  5EBC A;  5CR3 A;  1LT5 D;  1SEB D;  3M3Y B;  5IOC A;  4IUR A;  3G7L A;  5IT9 L;  4K8I A;  3VYR A;  4A3F B;  4C3J G;  4F87 A;  4K5W A;  3BG3 A;  4OO1 I;  2IX0 A;  4ZRZ A;  5C4X B;  2EJF C;  3UI2 A;  4EQO A;  1EL0 A;  4Z9C B;  1BOS A;  1RD9 D;  1IYU A;  5CC4 A;  2BDO A;  1DM0 B;  3IFT A;  2IWH A;  2O5J C;  4PQX A;  4FP5 D;  5KRU A;  1IL8 A;  4XIG S;  4OL7 A;  3O13 A;  1O78 A;  4WJW A;  3I8Z A;  3N6R A;  1V1P A;  1LTT D;  1PYW D;  1G2S A;  2I07 B;  2JEB I;  1E2V A;  2F0V A;  3KLS A;  1JIC A;  3OHX C;  4FNF A;  1HPC A;  1XXG A;  1JOK A;  1ML0 D;  1CZG A;  3J80 E;  1W6K A;  3S2H B;  3PO2 B;  4CKB A;  2C9O A;  3GV3 A;  1FNW A;  1FGB D;  1NUC A;  3HOZ B;  5KEE A;  4DF7 A;  1Q8I A;  5F2D A;  3HG9 A;  1SBB B;  1RDP D;  3KBG A;  5EKK A;  1SYE A;  1CZW A;  4E6I A;  4B08 A;  1D2B A;  2RBM A;  5IIF A;  2F0W A;  1KDA A;  5AFW A;  1PZI D;  1ROD A;  1IW7 C;  2HDL A;  4QCL A;  4H44 C;  1FYC A;  1OXU A;  5JVG 3;  5FK9 C;  4ID6 A;  1MGS A;  5DNF A;  1I4H A;  2PO4 A;  3TSS A;  4UDU C;  3NTI A;  2NVY B;  1EEF D;  5CV4 A;  4AYB B;  1X3P A;  1AFP A;  1TT2 A;  2OEO A;  4WRD A;  4FF2 A;  3I91 A;  4YIJ A;  4CKE A;  2E2I B;  5FO8 B;  1PRT C;  1XYI A;  3VYS A;  1Z7T A;  3Q0A A;  2O5I C;  3NE5 B;  2MP1 A;  2VUM B;  2SNM A;  5KNB A;  2F0Q A;  5HUR A;  4F88 A;  1BR9 A;  2F0T A;  1JWU D;  1BDO A;  2CW0 C;  2F0J A;  2NVT B;  1EU4 A;  2QDB A;  4PNY A;  1NR4 A;  3X3N A;  2G9D A;  1WTO A;  1PMR A;  1Y69 U;  2DN8 A;  4TSS A;  1SND A;  2JP1 A;  2J4X A;  4PMC A;  3QOJ A;  3TP8 A;  4A3B B;  3S1Q B;  2LS0 1;  4IAL A;  1STG A;  1JOQ A;  1S5F D;  2DNC A;  5ELC A;  1OXT A;  4IZ8 A;  2QCP X;  3V05 A;  1F9R A;  1O7Y A;  5C0X J;  2Y0S B;  2C5C A;  1SNM A;  1HTL D;  4L8J A;  1PZJ D;  3S16 B;  2NVX B;  3H3V C;  4DK0 A;  5COR A;  1QG7 A;  1TS3 A;  2IPK D;  2K6A A;  2X6L A;  1TS4 A;  3PIP 3;  1GUO A;  2WKC A;  4DXF A;  2BCO A;  4A3G B;  3W2D A;  2R93 B;  3MVV A;  1I4R A;  1VMC A;  3CRL C;  2WV6 D;  4KKT A;  5J22 A;  4O1N A;  1HTP A;  1WCM B;  4Y7N B;  2E74 C;  1TWG B;  3MAQ A;  2BA1 A;  3QIA A;  4HMJ A;  1RKN A;  3R3O A;  5FO9 B;  1BCP F;  5C6A A;  2B2V C;  5JPN C;  1EY6 A;  1D1K A;  3TP7 A;  5M5Y B;  1EY5 A;  2LKV A;  5JVH 3;  2F3W A;  3PUV A;  2EOT A;  1AW7 A;  5ELF A;  3MXN A;  1TWC B;  3QWN A;  1ICW A;  2JEA I;  1EFI D;  1DON A;  3BDL A;  2EPB A;  4OHJ A;  4KY6 A;  4CJ2 C;  3GTL B;  2PYK A;  4RCN A;  4ZKB B;  3NXW A;  2G9H D;  5IGF A;  4DA2 A;  1O7L A;  3FKI B;  3HKZ B;  3NPP A;  3G6J B;  3OW7 A;  1RF2 D;  2PQE A;  1TS2 A;  5IGB A;  3A55 A;  3K5L A;  4KKU A;  2MGS A;  3FPP A;  1PZK D;  2KA7 A;  5C4H A;  2DY8 A;  4FXD A;  2LFN A;  2WIN B;  4ILW A;  5C4J B;  3IKJ A;  1ENF A;  2M9V A;  3AB9 A;  2F3V A;  1Q12 A;  5FLX E;  3D3R A;  5A2Q E;  1KLU D;  1ESF A;  1II3 A;  1GUG A;  1TQO A;  3OWE B;  3K5M A;  1HCZ A;  1TKW B;  4U67 3;  1HUN A;  3CRK C;  3OIP A;  4Q0F A;  3R93 A;  1TS5 A;  4FVM A;  1DZ1 A;  4DK1 A;  4BBR B;  3LWU A;  1TWH B;  4DAV A;  5C3X A;  3PMF A;  2MJ8 A;  1TR5 A;  1SNQ A;  2SOB A;  3VA7 A;  2XN9 C;  1JOO A;  1SNP A;  3SXH A;  3V2T A;  3OMC A;  3SK6 A;  2XSC A;  3OPO A;  1HUM A;  4CJ1 B;  1ET6 A;  1F9S A;  3I90 A;  2XRQ D;  1CA6 A;  3DEO A;  2F1M A;  4BY1 B;  3E6Z X;  4LAA A;  2KVM A;  4RKB A;  3J7A F;  3T53 B;  5C3E B;  3NBI A;  1EYC A;  2F03 A;  3FRP B;  5T1I A;  3DMU A;  5EBD A;  3VR2 A;  1B3A A;  1DOL A;  3N52 A;  2B8G A;  2HUG A;  4FXG C;  4OIJ A;  1WD0 A;  4XT3 B;  1SDF A;  1PTO D;  1Q1B A;  1EIH A;  1Y8P B;  3S9W A;  2F0I A;  3SK5 A;  1SE2 A;  4NMZ A;  3MHB A;  1F9Q A;  4L6T B;  2CW0 D;  3Q24 A;  3GTO B;  1MSH A;  1VMP A;  1KLG D;  3OOC A;  2F0M A;  4BS9 A;  1DOM A;  2HQE A;  1U4M A;  3PUZ A;  3ND8 A;  2NZ1 D;  4X3U A;  3R2T A;  5COY A;  3BS1 A;  1LTA D;  3BYY B;  3H0G B;  3MEH A;  3KLR A;  2WKD A;  4ZKC B;  2Z8L A;  1IKM A;  4ZUI A;  3I4L A;  3Q6S A;  1Z6H A;  2KQ3 A;  4KI0 A;  3IL8 A;  4XTC S;  3H94 A;  1Y1W B;  2JSO A;  4NKL A;  3GTM B;  5J1Z A;  5FLX L;  3MTS A;  3AU7 A;  3CKI B;  2AQ1 B;  4FF4 A;  3PIO 3;  1U4P A;  3NTK A;  2CQA A;  3VR4 A;  2K03 A;  3NBH A;  2IX3 A;  2ZXP A;  2WII B;  1F77 A;  2L1B A;  2BE5 D;  3OWF A;  5CV6 A;  4RKL A;  1F9P A;  5DAU A;  2WP8 J;  1E2W A;  2F0U A;  1QOH A;  2K33 A;  1B9M A;  1LT6 D;  3KF8 A;  3NUC A;  4P2C B;  4XYO A;  2JA8 B;  3SHL A;  1PFM A;  4C3J B;  4ZQ3 A;  3A8I E;  1D1I A;  4WOR A;  2B2U C;  1K8M A;  3A56 A;  1X3Q A;  4G4K A;  1BQQ T;  4HSP A;  1MSG A;  1PTO C;  4QB4 A;  3VR5 A;  4CJ0 B;  5DM6 3;  2R3Z A;  3J80 L;  1BXT A;  2F0D A;  4QUF A;  5LL6 X;  4X3T A;  3M7N A;  1X32 A;  2Z4I A;  5D65 A;  2KJX A;  4A3I B;  1D5Z C;  1AZP A;  1A3U A;  3F2U A;  4RH6 A;  5I6W A;  3CU7 A;  2V4D A;  3QJY A;  4QMG A;  5NUC A;  1CTM A;  4X3K A;  1EY0 A;  1I6V C;  2AQ3 B;  4KD4 A;  1G8Z D;  2XRS D;  3TN2 A;  1HA5 A;  3LX0 A;  2K5Q A;  1EYA A;  4K5V A;  4C3H G;  2E2H B;  4WFN 3;  5C4Z A;  2N55 A;  1G2T A;  4ME5 A;  1LO5 D;  3TZU A;  1JE4 A;  2JA6 B;  4RGO S;  1VF7 A;  1STB A;  3QOL A;  4PMW A;  3EFX D;  3J81 E;  3JAM L;  1CI3 M;  2NVQ B;  1JCK B;  1ILP A;  2D2C C;  4PV1 C;  1QWY A;  3K6O A;  4HN7 A;  3V96 A;  1B50 A;  5IGD A;  1BF4 A;  2F4I A;  3SE0 A;  1SNO A;  1AN8 A;  2A74 C;  3FPU B;  5KNC A;  4H13 C;  1A3T A;  2PZT A;  4HTH A;  1EZ8 A;  2K32 A;  2NUC A;  5I6Y A;  1LTS D;  4G57 A;  3VR3 A;  3QO2 A;  1TII D;  3OSO A;  5CV5 A;  3A8K E;  2L4N A;  4NP5 A;  3TME A;  1O80 A;  3S17 B;  4FF3 A;  1LV9 A;  2BDN A;  1QIL A;  3CQZ B;  2IX1 A;  3NQI A;  2F0F A;  2D9U A;  4R8N A;  3WOF A;  3C1F A;  3CHB D;  5ISR A;  3GO5 A;  2L55 A;  4JK1 C;  2VNU D;  2OF1 A;  5M5W B;  2O4X A;  1DYQ A;  2FHT A;  4C3I B;  4A3E B;  4DNR B;  2B2T C;  4KY5 A;  1RJT A;  4V0B A;  3M85 A;  4BA1 I;  2XNA C;  5CV9 A;  3S1N B;  5HGT A;  3K59 A;  3ONA B;  3TP5 A;  1HQM C;  2R6G A;  4MHE A;  4M1U B;  4HMI A;  3SDZ A;  1VCI A;  3PUX A;  1LT3 D;  2RDH A;  5KYI A;  3NP8 A;  1PFN A;  5LHY 1;  3J7A V;  5JEA G;  5BN5 A;  5I9O A;  3U9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...