2K28A

Solution nmr structure of the chromo domain of the chromobox protein homolog 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords E3 SUMO-protein ligase CBX4
publication title Solution NMR structure of the chromo domain of the chromobox protein homolog 4.
rcsb
source organism Homo sapiens
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k28A00
1F9QA 1Q3LA 1AZPA 3D6WA 5T1IA 1XYIA 1SAPA 2K04A 3F2UA 1ZXTA 2B2VA 2K28A 4ZKBB 4R9WA 1LV9A 2L4NA 5CORA 1SSOA 2NYZD 4UAIA 3IFDA 1CM9A 1DONA 1AP0A 1M8AA 2L9HA 1O7YA 1U4PA 2B2UC 1MI2A 2H1EA 1EL0A 2HDLA 3N52A 1A15A 2X6GA 4IUPA 5COYA 2Q8TA 1J8IA 3P7JA 1JE4A 2CVRA 2HCIA 2DY7A 4X3UA 4X3KA 5EPKA 3MWYW 4HAEA 4IUUA 5D14A 1RHPA 3GV6A 2MP1A 3KBXA 5EKIA 2DY8A 2KUMA 1C8CA 2KEDA 1GUWA 1E0BA 1WTWA 1IL8A 4OIKA 4IUQA 1G91A 1RTOA 1MGSA 1U4RA 2IL8A 3G7LA 1WTPA 5EJWA 1F9PA 4XT1B 2L11A 5AFWA 4CJ1B 2NZ1D 1J9OA 2FFKB 3I91A 4IURA 4LMQD 2KEEA 4OIJA 2MGSA 1WVLA 2D9UA 1BBXC 1G2TA 1NR4A 1PLFA 2B2UA 1EIHA 2K1BA 4X3TA 1DOLA 3DEOA 3KUPA 1B3AA 1RTNA 1ICWA 2HDMA 2SDFA 3MTSA 4HSVA 3DM1A 5DNFA 1BO0A 1HFNA 1X32A 1XX8A 1CA6A 1ML0D 4CJ0B 2R3ZA 4MN3A 1WD0A 4RAUC 1NCVA 1HA6A 1G6ZA 1VMCA 1VMPA 2B2TC 1G2SA 3FPUB 2L1BA 4MHEA 4RA8A 1S4ZA 3LWEA 1MSGA 2B2WC 2FMMA 1O80A 2K05A 1HHVA 1B4OA 1F2LA 2M2LA 4O42A 1HUNA 3TN2A 1PFNA 1KNAA 3GV3A 5E4WC 2B2VC 2B2YC 1AZQA 1WTQA 4QUCA 1IKLA 2JYOA 4ZK9B 4ZLTF 1WTOA 1NR2A 2J7ZA 1QE6A 2Q8RE 3DEPA 1PDQA 1HUMA 2RSNA 5EQ0A 1IKMA 5D65A 2KOLA 1CA5A 4U68A 4CJ2C 4ZKCB 1F9SA 1DOMA 1BNZA 2B2TA 2VXWA 3I90A 2FINB 2FJ2A 2MJ8A 5E4XA 1WTXA 4R8IA 2KECA 2HCCA 3R93A 3H91A 4NW2A 1U4MA 5CMDA 4HEDA 2JP1A 1JICA 2KVMA 2K01A 2RSOA 1KNEA 2MPMA 1EQTA 3FDTA 3HP3A 5EPJA 1X3QA 2K03A 1ILQA 2EPBA 1EIGA 4XT3B 2XIWA 5CBAE 4HCSA 1SDFA 4X3SA 1DZ1A 2B2YA 2RVLA 3SVMA 1O7ZA 5EPLA 5JJZA 1MSHA 1BF4A 1DOKA 4IUVA 1PFMA 4DN4M 1ESRA 2HUGA 3IL8A 4QUFA 1PFBA 2X69A 2RA4A 4IUTA 2X6LA 4ZAIA 1WTVA 3QO2A 3ONAB 1WD1A 1B50A 2N55A 3TZDA 2BDNA 3I3CA 4XDXA 1ILPA 1RJTA 1U4LA 1EOTA 1B2TA 1QNKA 2NWGA 5CBEE 1TVXA 1NAPA 2L12A 3Q6SA 1RODA 2B2WA 2EOTA 1QG7A 2FHTA 5T1GA 1HFGA 2N88A 1WTRA 2EE1A 4RWSC 3UI2A 1F9RA 1HRJA 1B53A 3I8ZA 1X3PA
chains in the Genus database with same CATH superfamily
5DEHA 2PZWA 4LAAA 1UAPA 1TY0A 2EDGA 4KHPQ 2ZXOA 2Z1CA 3KFUA 3GTPH 1PH3A 3GTLB 1RKNA 3PIOA 1N34Q 3M7GA 4UAIA 4IJHA 1LTBD 1EYGA 4CHTB 5C3EB 3CC4A 2H1EA 3GTOH 3N52A 4J6HA 3I2ZA 2E2DC 2DGYA 4GNXB 3WWVA 3HOUH 3DLLA 1TS5A 1QOHA 4QCLA 2E8GA 2I0QA 1EY4A 1F9PA 2NZ1D 3WDNA 4IURA 2CW0D 1PRTD 4DV5L 5EGTA 2D9UA 4BY1B 5M3MH 1G2TA 2WB1B 3CPWA 5M3FB 3NQTA 5M9OA 3HKZG 4BBSH 1BCPC 1CTMA 3G6EA 3VR6A 2F3IA 2B2TC 1I3QB 3FPUB 1OXUA 2XTIA 2JEAI 4NKLA 4DAPA 2NN6G 3I72A 1HCZA 1KL9A 1RF2D 4K14A 1PFNA 2L55A 1FYCA 1WFQA 3M4OB 4G7HC 4A3EH 2VW9A 1LTGD 1RL2A 3J80L 4PMWA 1EEID 5D65A 2EJMA 1JJCB 2G9HD 5CYUA 3VA5A 4CDEC 1DOMA 5K5PA 1EU3A 1KHIA 4LFAL 4GN4B 3S9WA 3K6OA 5CMDA 3T51B 2YU9H 1JICA 3PUXA 3HZXA 3J7ZC 1SBBB 4DR2L 1SMXA 4JI5L 3DXJC 4HCSA 3K59A 4LF8Q 1EWIA 3RLOA 1IL2A 2BH8A 1STYA 2JA9A 4F7XA 4HIDA 1PFMA 1KDCA 2HUGA 3VR4A 1BCPB 1SE2A 2E74C 5HGTA 1L0XB 5LMNQ 1H9RA 3CW2C 1B50A 5CV8A 3PIP3 4P72A 4EQPA 1B2TA 1PH4A 4FDBA 3TBIB 1I94Q 2CW0C 1PRTC 1OTCA 3PF5A 3SR1A 3S17B 1HFGA 1TWFB 4PZ6A 4K5WA 1N34L 2CCZA 2B2VA 1K3BC 1JC7A 3FKIH 4R9WA 4G7OC 1BXTA 5CORA 4HR7B 2A74C 1STNA 4BXXG 1VQBA 4H44C 4KK7A 2ICIA 2EYPA 4H13C 3T4AC 3ULPA 4A3IB 1NSNS 5COYA 4A93H 2DY7A 1HR0Q 4N9PA 3KBXA 4L5RC 1PH1A 1KIXA 2KUMA 3TS2A 3CQZH 1MD2D 1NUCA 5FLXL 2KJXA 1U4RA 5I4DA 5DAUA 5BR8Q 1HA5A 4DU9A 3PUYA 2R7ZG 4DR4L 1S3OA 3PMFA 4BBRB 3KLSA 4X3TA 3DEOA 2NUCA 1PRTB 3LWUA 4HSVA 4MIUA 4PG3A 3GTJB 1B9NA 4EQNA 1SYEA 2HT1A 2KHIA 1WCMH 1HH2P 4JOIA 4RAUC 3A7AB 4FP5D 1EY5A 4A3DB 3VR3A 1I4PA 4DV7L 2ZTCA 1I4HA 5C6AA 1F2YA 1PYWD 1SXTA 4Y52H 4GLVB 1NMFA 1PTOH 2BE5D 4TVAB 2Y0SE 3DWQA 1EQRA 3S15B 4JBJA 1P8LA 1TS3A 2ICEC 2JK8A 5ELBA 4NB3A 1R9TH 1I6VC 4KKTA 5HURA 3H94A 1ONLA 1I4QA 1PV4A 3FVQA 1JOOA 4RGNA 1RD9D 2FJ2A 2WV6D 4KLKA 4OO1G 4NMZA 3H15A 4LF8L 2K01A 3CCEA 2LMCB 1KLGD 3E3XA 1PYSB 1VDZA 2Z6KC 2SNSA 4WORA 2MFIA 4DV0Q 2RVLA 2UXBQ 4DA2A 1U0LA 3EA6A 5LMNL 4DR1Q 2YTVA 3MA2B 4LW1A 3ULLA 5FLMG 1SNMA 3NBHB 1Q81C 2EYHA 2CWAA 1CSQA 4IUTA 3J81j 3UE0A 1K0SA 2HIXA 1AH9A 1RJTA 4LUOA 3J80i 1FNWA 1QUQA 2B63G 3KYHC 3CRKC 2L12A 3PIPA 4YWMA 1BCPF 1TT2A 3NENA 3K57A 1VS0A 3D6WA 1D5XC 2HQEA 4HJ5A 2Z4IA 4C3IB 4ZYSA 5IGGA 4KKSA 1HPCA 4R4TA 1LACA 2WIIB 2O2LD 3FMCA 2NYZD 1SJED 1HZCA 3HOXG 1G51A 5IYBH 1HR0L 1AP0A 1HQMC 2HDLA 2NVXB 2KQ3A 1YVCA 2JXMB 4QL5A 2BE5C 4FF1A 3MWYW 2R61A 5IYDG 1E24A 2JA5H 5BR8L 4IPCA 2E5LQ 1GUWA 3DWPA 2GA4B 4RHRA 1QILA 4XT1B 2UUAQ 2B8GA 3T16A 1LTID 3K58A 2ZTEA 1CZGA 1WVLA 2EQSA 3HEJA 4UPAA 4ZUIA 1L0WA 3KJPA 1N33Q 5C44B 5K36H 2PI2A 4IUNA 1YHQA 3W1BA 3RZDH 2IY5B 4BWGB 1VQOA 3C3LA 1F2MA 5JPMC 1GM5A 3HOYB 1VQKA 1XXGA 4A3FB 3RZOB 1W6KA 3HS0C 4DAVA 4A3CG 2K05A 4XYQA 1PRTF 4DV6Q 1A2UA 1HQRD 2K50A 1ET6A 1Y1WG 3DUZA 1KNAA 1LM0A 2Z4HA 5HY6A 4I7ZC 1IHZA 3L7ZC 3G71A 4KN4C 1KQSA 1STBA 2KOLA 5ISRA 1WYDA 1UE5A 3OHXC 1GUGA 3H91A 1PXUA 4DV0L 1NMGA 2UXBL 1QJOA 3QR8A 1J6QA 5GROA 4DR1L 2F0WA 3P20A 1D7QA 3QOJA 3S1NB 4RKLA 1JWUD 4IPDA 2Q2UA 5M5WB 4LF6Q 4IFDI 1QVCA 3KLWA 3TP7A 2AMCB 3A7LA 2JEBI 1E2WA 3BVMA 3E5SA 4U673 1TU2B 1ZEQX 5I2YA 3QO2A 1Z9FA 4LJZC 1SNQA 1S5FD 1TWHH 1Y1VH 3RMHA 1B70B 1QNKA 5LL6S 5KNCA 1TVXA 3G6JB 4QIWB 3PUVA 4JVZA 2F0MA 2M9VA 1SNDA 3PUWA 1PH5A 3UDXA 4J8QA 4BY7H 2K04A 2VUMG 4FF2A 3HKZB 4ZKBB 2K5NA 5KGUA 3M85A 3G4SA 2B2UC 3PUZA 2E5LL 4X3UA 1GUOA 3L9AX 2DN8A 4QMGA 1E1TA 2A6ED 1Q46A 2RBMA 4B9WA 2UUAL 4IFDJ 5I6YA 1ZYRD 3ND9A 1I6HB 2NVYH 1J9OA 5EAYA 1XJVA 2YYZA 4LF7Q 1WJJA 1O78A 3KUPA 4NP5A 4JI3L 2SDFA 3QB3A 1HFNA 4RGOS 4QF4A 1SE4A 3IFTA 4QY7A 2A73B 4GN5A 4GKKQ 1KTKA 3U9OA 1NCVA 2D0OA 4DV6L 2IX3A 3DMUA 4CKEA 4DAYA 4HMJA 1F2LA 1B8AA 4WJWA 1IYUA 2MNAA 1VF5C 1XTDA 3MXNB 1A63A 1GHJA 1ENCA 4AH6A 5BN4A 2I5HA 3LX0A 2O5JC 4KTAA 1YHAA 3QIAA 3ITPA 2CKZB 1R4PB 1IKMA 2B3GA 2ZXRA 3VYUA 3AMUA 1F9SA 5JVH3 2UUCQ 4LF5Q 3OOCA 1WTXA 3S2DB 1GJXA 4HEDA 4QJFA 1PFSA 5GQOA 1QWYA 4HSPA 4IPGA 1AW7A 1G6PA 4DNTB 1HNZQ 4LF6L 3J7YW 1BF4A 4C56C 3S1RH 3E9HA 3E0EA 1HZ9A 2A6EC 2CH4A 1AFPA 5JJKA 4KI0A 1II3A 1ZYRC 1EWCA 4DV4Q 4AQYQ 1LT5D 1NBWA 1CKOA 2EXZA 5CBEE 3S1QB 2CWPA 2M00A 4O1NA 2GVAA 2DJGC 2R7ZB 2F0PA 2MO0A 1OXTA 4Q5VA 2EE1A 3A0JA 4RGMA 1BOSA 2A69D 1FNUA 1JQYD 3GDEA 4A3LG 2PW7A 4FXKC 4NXNQ 5ELEA 1D1IA 2WP8J 2R92H 1Y69U 1E3PA 5G3LD 1IYVA 5IGEA 1CM9A 1EUJA 1F2ZA 3S14B 1GUTA 2V4DA 2JA6G 2Q2TA 3GTLH 3BYTB 1KD1C 2JA7G 4K5VA 4M8AA 5IGBA 5C3EH 1VQDA 1EY6A 5A2QE 4LF7L 5EJWA 4YCVA 1T9HA 2F4IA 1SRUA 2KHSA 4OIJA 4OONA 4R4CA 1U5KA 4RKBA 2VY3A 3EFXD 4B3SQ 4JCVE 2K1BA 1DOLA 3A8IE 3CU7A 4GKKL 1K8OA 2Q8IB 2IWHA 2Z0SA 5C0XG 5KYIA 2KHJA 3F2DA 1PH7A 4C1NI 4EQOA 5C4JB 3VYTA 2Z8LA 4BY1H 2F0IA 1HA6A 1JWMD 5M3FH 1MBYA 4DR7Q 1SJHD 1S5ED 3HG9A 4C2MB 1PHJA 2VNUD 4A3EG 1D6EC 1GHKA 2ASBA 1AE3A 2JA8G 1I3QH 3DM3A 1QZGA 2B63B 2UUCL 1M90C 2Z6BA 2V1CC 1NR2A 3G48A 5JPNC 4OX9Q 1BQQT 1ET9A 2A69C 3MEHA 4IQZA 4A3BH 3M3YB 4CJ2C 1BNZA 2PZUA 1VF7A 2FINB 1FVIA 4FO2A 3OTOQ 4JK1C 1HNZL 3M4OH 1KNEA 3LNNA 4V190 2ZT9C 3S16B 2K6AA 4IO9A 2ID0A 3HOXB 5JJZA 3J7AV 3BJUA 2IT1A 4DV4L 3EROA 3S24A 1FNVA 2X6LA 2NVQB 2PQEA 2WAQE 4KN7C 4O2DA 4JI1Q 4HJ7A 3VDYA 1U4LA 3A8KE 2XN9C 2PMZB 3PO2G 1B7YB 5GAGC 2RF4A 2K4KA 4NXNL 1YIJA 3UI2A 4DXGA 2EJFC 3FKIG 4LFAQ 3J81c 1UE6A 1AZPA 3BZKA 3PO3G 4EX5A 3HRZC 5LMUQ 1IW7C 4ZRZA 3M9BA 3S17H 4JBMA 4A93G 1QCBD 1HZBA 4K5XA 1U4PA 1TWFH 3HKSA 1YZ6A 2LXJA 4X3KA 5KNBA 2E2IH 2G9DA 2MP1A 4H0LC 2QDBA 1Y1WB 2EYFA 4UP7A 5FO9B 1FR3A 1VQAA 1B9MA 4IUQA 2F0DA 1UE7A 3RD4A 4A3IH 3HOZG 2LY7A 4AYBG 1S72A 2ES2A 1N9WA 5IYCH 1SYBA 3K8AA 2PI2E 4OO1I 2F0HA 1BBUA 4CBVA 4C3JG 1B3AA 1RTNA 2H4OA 3BZCA 4J1MA 4UP8A 3SGIA 1J5EL 4WRDA 2EY5A 1BR9A 1A3VA 1WD0A 3CCSA 1YJ9A 4DR7L 2H5XA 4BBRH 1LTTD 2UXCQ 2AHOB 4A3JH 3S2HH 1BBWA 1DCZA 3CKIB 1W2BA 3GTJH 5DLQE 4B3RQ 2I46A 2F0OA 3I4NH 4YHHQ 4PZ8A 3L2PA 4OX9L 4FVMA 1G291 1KDAA 5ELFA 2JYOA 4A3DH 4KHZA 4A3GG 2Q8RE 3OTOL 4DR4Q 4GLAC 4RH6A 3V96A 1LTAD 2B2TA 3I90A 4ALPA 2A5HA 4FYDA 3I70A 3VR2A 4X62Q 1MJCA 3EN2A 4B3TQ 2VUMB 5IT9c 5EPJA 5IP7H 2K03A 1DD2A 2LKVA 4TSSA 2F3VA 3RUZA 2D2CC 4HTHA 2NVTB 5A2QL 1VQ9A 1JJGA 4DV7Q 4JI1L 2AUKA 3NELA 4ZAIA 1Y8NB 5E3FA 4ABNA 3O13A 5EBCA 1EFWA 3P75A 2B2WA 3HOVG 5CC4A 2I5LX 4IFDH 4FF3A 3AB9A 3PSIA 5LMUL 2EVBA 1I50B 4PV1C 4HIMA 3KK7A 4DUZQ 2RKSA 3KBGA 2Q2IA 3SK5A 4JW0A 2MO1A 3ERQA 4R4OA 5C5MA 1UEBA 1DM0B 1YEZA 3TMEA 3AYHB 4JI0Q 1STHA 4EQ5A 4C3IH 1YITA 2AUJD 4IUUA 1RCVD 2PO4A 1SFOB 3HOWG 2XVSA 1LTSD 1YHBA 4GZYC 1K73C 3ER0A 3OWFA 4E6IA 3PGZA 1G91A 3G7LA 2IL8A 2NVXH 4K2KA 5ELOA 5AFWA 5C5LA 3M4PA 4HJ8A 2VL6A 3STBD 2ZTDA 2A68D 2TMPA 5J3BA 3TP5A 2HHHL 2KCCA 3MTSA 1K83B 1BKBA 3OSOA 5D3DA 1BO0A 2WKDA 5FOBB 2UXCL 3VYSA 1CA6A 3C46A 2B8FA 4MN3A 2CQOA 2NZOA 1CKNB 1KC8C 1M4VA 1YNND 4B3RL 4DV3Q 3J81L 4LFBQ 2F0JA 4YHHL 4A76A 3KDFB 1OO9B 1HHVA 1D1KA 1KRTA 3U58A 4K8IA 3TREA 1QZHA 3ULJA 4QGUA 4CKCA 4DKAC 2OT2A 5CV5A 3HOYH 4A3FH 2B2VC 1SNOA 3CCJA 3RZOH 2I5MX 1V9PA 3NBHA 2F1MA 1K3RA 1K8GA 2J7ZA 4ILWA 5C4XG 1PDQA 1HUMA 2QILA 3SEBA 4X62L 1CA5A 4B3TL 3TDQA 4L63B 3CC7A 2PCFB 3EQLC 4DGZA 1EYAA 1PH2A 2WFWA 1A3UA 2R93G 1B1ZA 1GXDC 5I9PA 5KYLA 5FJ8H 4IUVA 1FD7D 4DFAA 1RIPA 2EYJA 4DR5L 4P75A 2MHVA 3I55A 3ERSX 3DWAA 2JA6B 1MKHA 1WTVA 1V43A 2WKCA 4B08A 1VQIA 4DK3C 3MC0B 2JA7B 1ILPA 3S1NH 3STBC 1HNXQ 2Z6KA 1KXLA 2XGTA 1E22A 3FP9A 5F2DA 1EIYB 2DNCA 3ND8A 4KD3A 3MXPA 1HXYD 1A0IA 4DUZL 3CP0A 1VQEA 3CHBD 2B29A 5EBDA 1VCIA 1STEA 1X3GA 3CCVA 1EEFD 1SLJA 4JI0L 1PTOD 4JI2Q 3B6YA 4QB4A 5IGCA 1QVGA 1JE4A 2HCIA 5M5XB 3JAMc 1E2VA 3IAYA 3GTGH 4C3HG 2F4VL 4A3EB 2DY8A 3NEMA 3W1GA 1Q8KA 3EJIA 4KV6A 3I4LA 2JA8B 2K32A 3BS1A 2YTXA 2C5CA 3L3OC 3A8JE 2LXKA 1Y8PB 2NN6H 3IKJA 3CMAA 3OW7A 1ICWA 2JE6I 1I6HH 1X32A 5FK9C 4XQQA 5GADC 4DV3L 4GOPC 2N8NA 5KEEA 3A55A 4LFBL 2A1AA 3J7A5 4JV5L 3D4RA 1SN8A 5IY0A 4KY5A 1R4QB 2UUBQ 2ZJQA 1G2SA 4RA8A 4DR6Q 3Q22A 2K52A 1VQLA 2F0QA 3K80C 1UEAB 3TN2A 5L37A 2GN5A 2KBNA 4POFA 2EZVA 3D8GA 2B2YC 1VQJA 1IKLA 3PO2B 4A3MH 4XQNA 3CF5A 5BN3A 3BVGA 4OELB 4GKJL 5JJIA 3FKIB 1XNQL 4JI3Q 2IX1A 5EKKA 4X66Q 3PO3B 2MPMA 3I56A 3GTKH 1E1OA 1EYDA 2CHBD 1VQCA 3J81i 3I4MG 3KOJA 4A93B 4ID6A 4TKOB 1TWCB 1TY2A 3L0OA 1X56A 4GOPB 1SE8A 2PNRC 1TWGB 4IOAA 1TWAB 2A19A 4RCNA 5J1ZA 1DGSA 3GO5A 1HNXL 2BDNA 1GKHA 3I3CA 4BXXH 1VQFA 3X3NA 1WI5A 1KDBA 1NAPA 3HOZB 4AYBB 2CFMA 1B53A 1Q3LA 1YNXA 4C3JB 5C0XI 4JI2L 1FJGQ 2K28A 4R1JA 3S1QH 2R7ZH 2WB1E 1A6XA 3M7NA 4RMFA 5CV9A 4CDDC 3IRBA 5TSSA 1LTLA 4ZQ3A 1X9NA 1V1OA 4ZCKA 1R9TB 3CAMA 1XTCD 3JC66 1YNJD 1IL8A 3MFYA 4OIKA 3CCRA 5E7NA 3S14H 5JEAG 1WTPA 4A3GB 1K9MC 4G7ZC 2ALYB 1SYFA 2B2UA 3MXNA 1HNWQ 4JPBW 4Z9CB 3U9SA 2UUBL 4K6LA 4L6TB 4DR6L 5C0XJ 1JWSD 1SEBD 3H0GH 3P1HA 2L1BA 4OO1H 2AQ1B 5IODA 4NXMQ 1C4QA 1YBYA 5C4JH 4IOCA 2YV5A 3H09A 5E1FA 5I6WA 1EIFA 2RQXA 1PH9A 2QEXA 2DJFC 5AJ3Q 1AZQA 4A3BG 3T53B 4G4KA 5FLMH 3OIPA 4RGTA 1X3FA 4X66L 2N3SA 3HOVB 4CGYB 2O5IC 1K28A 4C2MH 1X3EA 5KRUA 2ZXPA 3TZUA 3CRLC 3Q8DA 4TQUS 3S1MB 4TRDA 2JP1A 5J22A 2B63H 4CKBA 5IOCA 3KJOA 2NB0A 5CBAE 4A3KG 1SDFA 3M3YH 1VQ7A 1DZ1A 3GD7A 1EY0A 1AN8A 1B3QA 1ESRA 2F0VA 3IL8A 2RA4A 2E2JH 4GN3B 5IP9H 3HOWB 3BZDB 1YNJC 2MQHA 1I4RA 4FXGC 3TZDA 5IWAQ 2OXPA 4RG1A 3HOXH 1EOTA 4XIGS 1JB7A 1FJGL 1RDPD 2IW3A 4F8MA 2IPKD 2NVQH 5IYDH 2NBFA 1H9MA 1QNUA 5T1IA 1NJIC 3N6RA 2K5DA 2EYLA 2OCEA 4GS3A 5FO7B 3H3VC 1DJRD 1T5XD 4MZ9A 4L5SA 3KF6B 3CMEA 2AWOA 4HJ9A 4R8NA 1AEXA 1DONA 2CQAA 1CK1A 3D31A 2SEBD 4DK6C 2X6GA 5D14A 2VQFQ 2AQ2B 4DK1A 2SOBA 2NTSA 2ZJPA 4DF7A 5I2XA 2F0TA 3RR5A 1E7ZA 3I7FA 1MGSA 5IE8A 1TS4A 4PMCA 3GQBA 4A3CH 1HNWL 3RN2A 4LNQA 4LMQD 5C4XB 2KEEA 4L8JA 3OMCA 4N8FA 1S40A 1PLFA 1Y1WH 3HGBA 1ENAA 2HDMA 3DM1A 4IN3A 4CJ0B 3NHHA 4A3JG 3MAQA 4OEMB 4F87A 3HOUG 4KY7A 2R93B 2NN6I 2NZHA 3A5ZB 4NXML 1EFID 2ZJRA 1VMPA 2C9OA 4DNRB 1MSGA 3I4NG 4QQBX 1X6OA 2K75A 4K0KL 1PH6A 3KLSX 4JBWA 5AJ3L 1HUNA 3NWTA 5M3MG 1VQ8A 1JJ2A 4QUCA 4M1UB 4MTNA 4BBSG 2VS1A 4R4IA 3DEPA 5EKLA 2BA1A 5IGDA 1O7IA 2EIFA 2QA4A 2HCCA 1J5EQ 1JCKB 2F0NA 5FO8B 1A2TA 2KA7A 3V05A 3A74A 1CKMA 3M4QA 1EZ8A 4X3SA 3Q0AA 3D0FA 1EYCA 3HFZB 4YCUA 3BDLA 4CDFC 2A6HD 2VUMH 4IALA 1PFBA 2RHSB 5IWAL 1UWVA 3RN5A 1L1OC 4K8JA 4C3HB 3LGJA 1EWHA 2DUDA 1Q90A 2NVTH 1I4XA 1CT1D 2NWGA 3EIVA 4HJAA 1XWEA 1WOCA 3WOEA 1LUZA 2DNEA 2K5QA 1FL0A 4BA2I 1STGA 4IPHA 1X3PA 1N8RC 3BDCA 1XYIA 1SAPA 4KKUA 1ZXTA 2F0LA 3FHWA 4ME5A 2L4NA 1NE3A 3TSSA 1SMYD 3UDGA 3IFDA 1SE3A 3D4DA 2KCTA 3CCUA 2VQFL 2B39A 2L9HA 3CC2A 1MI2A 1LT6D 1I50H 2OEOA 1V1PB 4JC0A 3KF8B 3J81E 4A75A 1D5ZC 1VQ4A 3T56B 1XNRQ 5EKIA 3K7AB 4K2LA 3VYRA 3SDZA 4APVA 1L1OB 4DAMA 2P5ZX 5ELNA 1SFOH 4XXEA 3T1HQ 1OXXK 4OHJA 4DV1Q 2PQAB 3I4MB 2WAQG 5DM63 4OWWB 1V8QA 2A6HC 2LSSA 3U4ZA 1WTHA 3NBIA 1K83H 2FMMA 1GUNA 1O80A 1BCPD 4GNXC 1XMOQ 1HTPA 5JOBA 4O42A 2JSOA 5FLXc 2F03A 4DR3Q 4KJNA 2EYMA 3GV3A 1XMQQ 1L0YB 4R4QA 1WTQA 1D8LA 1EQVA 1WTOA 5M5YB 5EQ0A 3A5UA 2CH4W 2ENBA 3NP8A 1WCMG 4U68A 4FXDA 2HHHQ 4N8X1 3W5OA 1H9SB 3PV0A 4QIWE 3HP3A 1EQTA 3GP7A 2SNMA 4H7BA 3GTQB 5LHY1 1N32Q 2EY6A 3SE0A 1U9RA 1NY4A 4NPSA 1IBLL 1Z7TA 3RNUA 3HKZE 3NE5B 4DN4M 4LUVA 2K33A 2FMCA 4A3LH 4OL7A 3BG3A 1A3TA 4X64L 2RCNA 1Q86C 2BA0A 1XPUA 5IT9E 4XDXA 4JG2A 4B3MQ 4H02A 1IBKQ 3AEVA 3S15H 3Q6SA 2EOTA 1Q8IA 2RCFA 1E2ZA 4KY6A 2JN4A 1PYBA 2N88A 1WTRA 3SHLA 2JA6H 2OTLA 2F0KA 3AFPA 2JA7H 3BDOA 1DYQA 1HTLD 1FGUA 1JORA 4Y7NB 1KAWA 2OTJA 1GD7A 4HMIA 5H1SE 4WJ4A 1PZKD 1ENFA 4I7AA 3OYYA 1XNRL 1S5BD 4DR5Q 3DHQA 5EPKA 5C0XH 3C1EA 5JJLA 4HAEA 2EYOA 4LFCQ 1IZ6A 2F0FA 1CKNA 2PZTA 4HIKA 2IHFA 4DXFA 1WTWA 2UU9Q 4A3BB 2F0GA 2XNAC 1KRSA 3KDFA 5M5XH 2FFKB 2E2HB 3NXWA 2J4XA 3T1HL 1JMCA 3I73A 1SR3A 5IYBG 2QGQA 4DV1L 4OGQC 5DNFA 2JA8H 1STAA 1EOVA 1XX8A 4J15A 4IZ8A 4ULLA 3K81C 2JA5G 1BUVT 1LO5D 4A3KB 1AE2A 3GTMB 1X55A 1QB5D 1XMOL 3OIQA 1UNSA 4MHEA 3NUCA 2MUYA 4IJLA 4DR3L 2NTTA 2B2WC 3FPPA 1CUKA 1XMQL 5GAHC 3TS0A 5JAVA 1OXVA 4A4IA 2F4VQ 1ZKOA 5K36G 4A3MG 3CCQA 5E4WC 5G3LF 3VR5A 5J39A 1ICFB 2PYKA 1EQQA 1B44D 4HN7A 2RDFA 1Y14B 3ZJYC 2E75C 2VXWA 5DM73 5E4XA 4R8IA 1N32L 3R93A 2K5WA 3OWEB 3MHBA 4KHPL 2EY1A 3FDTA 5C44H 1VQNA 3PO2H 3NTHA 3NK9A 4JV5Q 3NSWA 1MJEA 4LF4Q 2RDGA 4YWKA 2E2IB 4G57A 3E6ZX 2TSSA 3A56A 3NTIA 3PO3H 3OPOA 4B3ML 1NNXA 1IBKL 4NDXA 3ONAB 2N55A 3CCMA 4YWLA 1TWCH 5BN5A 4JI6Q 3K5LA 3GTPB 1TWGH 1PMRA 1G8ZD 1TWAH 3BU2A 4GKJQ 1XNQQ 1EY9A 3I8ZA 3PCOB 4LUZA 4JYAQ 4PMBA 2OWOA 1K0RA 3GTOB 3MVVA 3F2UA 1LV9A 3HOZH 4A3JB 3S2HB 1UE1A 3OMGA 3HOUB 3F2BA 1Y1VG 4LFCL 1M8AA 2C35B 1S5CD 4C3JH 2Q8TA 4ODGA 4JBKA 1ASYA 3I4NB 2UU9L 1I4GA 5D3IB 4F88A 2HQLA 5M5WH 3NQIA 5M3MB 2BOSA 2D5DA 3WOFA 1C8CA 4BY7G 1I5FA 1VQHA 2YTYA 3URYA 3A54A 2A68C 3CPFA 4JOIC 4BBSB 4JI4Q 2JJQA 4CJ1B 3I91A 4POGA 3T13A 1OXSC 3AQQA 4FNFA 5JEAJ 1NR4A 3K5OA 2IJ0A 1JT8A 1YNNC 1K8MA 1CHQD 2K7VA 3JAME 3QG1A 5ELDA 3H0GG 2Y0SG 4WJ3M 4A3GH 4XTCS 3ZYYX 3K7UC 4X6AH 4EGVA 2F0EA 5IT9L 1G6ZA 4KD4A 1S4ZA 3LWEA 1CQFA 3F2CA 1TXYA 1P16A 1C7YA 3RLNA 1L2FA 4Q0FA 4C1NK 3K0YA 2PW5A 2IX0A 1IYJB 2L15A 1MHWC 4P73A 2YU9B 1I94L 3NTKA 4GOPA 4ZLTF 1K8AC 1LTRD 3K5MA 3V2TA 3AU7A 3W3AA 2PMZE 3TRZA 5JVG3 2PPBC 1U4MA 4MTKA 1PZJD 2RSOA 3CD6A 4LF4L 2F3WA 3I4OA 3VA7A 2XIWA 3HOVH 2KCMA 2B2YA 3SVMA 1EZ6A 5EPLA 3TEHB 5GAEC 1VQPA 1CI3M 5IP9G 3S1MH 1Q1BA 2VZAA 2XSCA 3RLFA 1JR0D 4JI6L 2BCOA 3U4VA 2LFNA 5KIXA 4GLXA 1JOKA 2QEJC 1MIUA 1O7LA 1H9KA 3D3RA 5LL6X 4JYAL 3QWNA 5KNDA 1W6JA 5T1GA 4OXPA 5C4HA 3Q24A 4RWSC 1F9RA 1PTOC 3HOWH 1F9QA 4KHVA 2K5VA 1TS2A 3T1YQ 1YJNA 4HCEA 2XRSD 4DNIA 1H9JA 2QCPX 3S2DH 1KLUD 4MNOA 1SSOA 3CQZB 1SNCA 2L5TA 2WAQB 3M4YA 1CQVA 3SK8A 1EL0A 1KABA 4IUPA 3UE1A 1A15A 1QUQB 3TQYA 4X65Q 1J8IA 3P7JA 3C1FA 4JI4L 4XQJA 4XYOA 1E0BA 1N36Q 1KAAA 3AFQA 4YIJA 2R92G 4YY3Q 3EVQA 2MGSA 1WCMB 3FRPB 2VB3X 1CHPD 3TP6A 2OF1A 1PTOB 4UP9A 5C4XH 2ZM6Q 1HZAA 5C3EG 1VMCA 4AIMA 3SK6A 1B4OA 4B9XA 3MZ5A 2R93H 2N78A 5I9OA 1TR5A 2I07B 3KLRA 3H3VH 4BA1I 2N49A 3MXUA 1UUPA 2RSNA 4BY1G 4ZKCB 2WB1G 1T5EA 3MXGA 2MJ8A 5M3FG 4P74A 4NW2A 5CV6A 1D2BA 1X3QA 1ILQA 3OW2A 1EIGA 2IHEA 2QDLA 2A8VA 1BVSA 3BYYB 4KMUC 1PH8A 3GTGB 5CGKA 4K0KQ 2WINB 2UXDQ 4RCOA 1EY8A 1M1KC 1X65A 2RDHA 3KF6A 2QW7A 1TIID 1C9OA 5HGQA 3K5NA 3JAML 1Q7YC 4P71A 2AWNA 1Z47A 2FHTA 1QG7A 1YJWA 3T1YL 3F8TA 4C3HH 1HRJA 4LK1C 4S3SA 1N33L 5ELCA 5IGFA 1LT4D 4PNYA 2F0SA 3Q23A 3EBEA 5C4ZA 5A35A 3QOLA 1X54A 3E0JA 4UDUC 4X65L 2JA5B 3R3OA 1O7YA 3S16H 2E76C 1YI2A 2R7DA 1Q12A 2CVRA 1TQOA 1N36L 1RHPA 4RFBA 3BVZA 4YY3L 1XPOA 2KEDA 4A3MB 3CCLA 1W3SA 2L11A 2EY2A 3RZDB 1JE5A 4DV2Q 2XRQD 3R8BA 2XWBB 2XWJB 4LF9Q 3GTKB 1GOZA 3K7AH 2ZM6L 2Q2HA 2KCNA 4JI8Q 1D5MC 1GO3E 2R3ZA 5CR3A 1PVOA 1SYGA 4ME3A 4A3IG 5IYCG 1S5DD 3D6CA 1C48A 3I4MH 1H95A 1PTOF 1VQMA 3UDFA 2F52A 2D62A 5C3WA 1C0AA 1EU4A 2KENA 1QE6A 2EJGC 3TP8A 2VQEQ 3SK4A 4BBRG 3QJYA 1BDOA 4JI7Q 4DAYB 2KECA 1SYDA 1Y8OB 5NUCA 2Z9HA 2KVMA 1VQGA 2FXQA 4UHVA 4V0BA 2EPBA 5M5YH 2UXDL 3CXCA 1ESFA 1TWHB 1Y1VB 1MSHA 1DOKA 4A3DG 5LMNW 1VQ6A 5IIFA 4QUFA 2VB2X 1CFMA 4OWTB 3GTQH 2OQ0A 3PQIA 1WD1A 4BY7B 3H6MA 4N9TA 2BH2A 5CV7A 2L0CA 5IP7G 1IBMQ 1CSPA 1JOQA 1V1PA 3KF8A 3R2IA 4PZ7A 2AKWB 4O0AA 4FF4A 3PIO3 2D0PA 3SXHA 2WACA 3D4WA 2OQKA 1NTGA 4DUYQ 1ASZA 3H0GB 2Y0SB 5JEAH 1L1OA 3NPPA 1V1QA 1A8VA 3J80E 3F1ZA 3R2TA 5FKAC 4HIOA 4L5QA 1IBLQ 1FGBD 1HR0W 2NVYB 3X3MA 2K14A 3J80c 1IW7D 4Y7NH 2JQOA 3JAMi 4IFDG 3GV6A 4X64Q 2PQAA 3K0XA 3MFGA 3NWSA 1Z6HA 2PNHA 4DV2L 1Q82C 1A62A 1DXMA 1RTOA 4WFN3 4LF9L 4PQXA 4ZUJA 4JI8L 1BBXC 3ICEA 1SYCA 5CV4A 1F77A 1EIHA 4LF5L 2QF7A 4DPGA 4C3IG 4DV5Q 1JB3A 1LLRD 1ML0D 2ATWA 2K5HA 2E2HH 1IXRA 3U50C 3PF4A 1TKWB 1H9SA 2E2JB 4UY8C 4DK0A 1PA6A 2EXDA 2F0UA 2M2LA 2RHQB 4BS9A 3J7AF 4A3KH 3GTMH 4AQYL 4I65A 2AQ3B 2VQEL 4RHSA 4ZK9B 3E9IA 3FEWX 1EY7A 4JI7L 4EVOA 2BDOA 2GVBA 3UDIA 5C44G 3S1RB 3W2DA 2QKIC 4KJOA 1HJPA 4LWCA 4AYBE 3MEFA 4GNXA 2J0TD 5FLXE 3H3VI 1GUSA 2HIVA 1QVFA 4XT3B 1XPRA 3HOYG 2R7FA 2R6GA 4L5TA 4YCWA 4A3FG 1O7ZA 4K6DA 4DR2Q 1LT3D 1Q1EA 1LABA 4JI5Q 1SNPA 1SROA 2X69A 1VQ5A 1IBML 1LYLA 1GVPA 4CDCC 2G5DA 3C2PA 2LS01 5C3XA 2R92B 1PZID 1RODA 4OWXB 1SMYC 4P2CB 4DUYL 2O4XA 1CZWA 5FJ8G 2HD3A 4B3SL
chains in the Genus database with same CATH topology
5DEHA 2PZWA 4LAAA 1UAPA 1TY0A 2EDGA 2ZXOA 2Z1CA 3GTLB 1RKNA 3M7GA 4UAIA 1LTBD 4CHTB 5C3EB 2H1EA 3N52A 4J6HA 2E2DC 1TS5A 1QOHA 4QCLA 1EY4A 1F9PA 2NZ1D 3WDNA 4IURA 2CW0D 1PRTD 5EGTA 2D9UA 4BY1B 1G2TA 2WB1B 5M3FB 3NQTA 5M9OA 1BCPC 1CTMA 3VR6A 2B2TC 1I3QB 3FPUB 1OXUA 2JEAI 4NKLA 4DAPA 2NN6G 3I72A 1HCZA 1RF2D 4K14A 1PFNA 2L55A 1FYCA 3M4OB 4G7HC 1LTGD 3J80L 4PMWA 1EEID 5D65A 2EJMA 2G9HD 5CYUA 3VA5A 1DOMA 5K5PA 1EU3A 3S9WA 3K6OA 5CMDA 3T51B 1JICA 3PUXA 3HZXA 1SBBB 3DXJC 4HCSA 3K59A 1STYA 4F7XA 1PFMA 1KDCA 2HUGA 3VR4A 1BCPB 1SE2A 2E74C 5HGTA 1L0XB 1H9RA 1B50A 5CV8A 3PIP3 4EQPA 1B2TA 3TBIB 2CW0C 1PRTC 3SR1A 3S17B 1HFGA 1TWFB 4K5WA 2B2VA 1JC7A 4R9WA 4G7OC 1BXTA 5CORA 4HR7B 2A74C 1STNA 4H44C 4KK7A 2ICIA 2EYPA 4H13C 3T4AC 4A3IB 1NSNS 5COYA 2DY7A 4N9PA 3KBXA 2KUMA 1MD2D 1NUCA 5FLXL 2KJXA 1U4RA 5I4DA 5DAUA 1HA5A 4DU9A 3PUYA 3PMFA 4BBRB 3KLSA 4X3TA 3DEOA 2NUCA 1PRTB 3LWUA 4HSVA 4MIUA 3GTJB 1B9NA 4EQNA 1SYEA 4RAUC 3A7AB 4FP5D 1EY5A 4A3DB 3VR3A 1I4PA 1I4HA 5C6AA 1F2YA 1PYWD 1SXTA 1PTOH 2BE5D 3DWQA 3S15B 1TS3A 2ICEC 5ELBA 1I6VC 4KKTA 5HURA 3H94A 1ONLA 1I4QA 3FVQA 1JOOA 4RGNA 1RD9D 2FJ2A 2WV6D 4OO1G 4NMZA 2K01A 2LMCB 1KLGD 1VDZA 2SNSA 4WORA 2RVLA 4DA2A 3EA6A 3MA2B 1SNMA 2EYHA 4IUTA 1RJTA 1FNWA 3CRKC 2L12A 1BCPF 1TT2A 3K57A 3D6WA 1D5XC 2HQEA 2Z4IA 4C3IB 4ZYSA 5IGGA 4KKSA 1HPCA 1LACA 2WIIB 2O2LD 3FMCA 2NYZD 1SJED 1AP0A 1HQMC 2HDLA 2NVXB 2KQ3A 2JXMB 2BE5C 4FF1A 3MWYW 2R61A 1GUWA 3DWPA 2GA4B 4RHRA 1QILA 4XT1B 2B8GA 3T16A 1LTID 3K58A 1CZGA 1WVLA 3HEJA 4ZUIA 5C44B 5K36H 4IUNA 4BWGB 3C3LA 1F2MA 5JPMC 3HOYB 1XXGA 4A3FB 3RZOB 1W6KA 3HS0C 4DAVA 2K05A 4XYQA 1PRTF 1A2UA 1HQRD 1ET6A 3DUZA 1KNAA 2Z4HA 4I7ZC 1IHZA 3L7ZC 4KN4C 1STBA 2KOLA 5ISRA 3OHXC 1GUGA 3H91A 1PXUA 1QJOA 2F0WA 3P20A 3QOJA 3S1NB 4RKLA 1JWUD 5M5WB 4IFDI 3TP7A 3A7LA 2JEBI 1E2WA 3BVMA 3E5SA 4U673 1TU2B 1ZEQX 5I2YA 3QO2A 4LJZC 1SNQA 1S5FD 3RMHA 1QNKA 5LL6S 5KNCA 1TVXA 3G6JB 4QIWB 3PUVA 2F0MA 2M9VA 1SNDA 3PUWA 4J8QA 2K04A 4FF2A 3HKZB 4ZKBB 5KGUA 3M85A 2B2UC 3PUZA 4X3UA 1GUOA 3L9AX 2DN8A 4QMGA 2A6ED 2RBMA 4B9WA 4IFDJ 5I6YA 1ZYRD 3ND9A 1I6HB 1J9OA 2YYZA 1O78A 3KUPA 4NP5A 2SDFA 3QB3A 1HFNA 4RGOS 4QF4A 1SE4A 3IFTA 2A73B 1KTKA 3U9OA 1NCVA 2IX3A 3DMUA 4CKEA 4DAYA 4HMJA 1F2LA 4WJWA 1IYUA 1VF5C 1GHJA 1ENCA 5BN4A 3LX0A 2O5JC 4KTAA 3QIAA 3ITPA 1R4PB 1IKMA 2ZXRA 3VYUA 3AMUA 1F9SA 5JVH3 3OOCA 1WTXA 3S2DB 1GJXA 4HEDA 1QWYA 4HSPA 1AW7A 4DNTB 3J7YW 1BF4A 4C56C 2A6EC 1AFPA 4KI0A 1II3A 1ZYRC 1EWCA 1LT5D 2EXZA 5CBEE 3S1QB 2M00A 4O1NA 2R7ZB 2F0PA 1OXTA 4Q5VA 2EE1A 4RGMA 1BOSA 2A69D 1FNUA 1JQYD 2PW7A 4FXKC 5ELEA 1D1IA 2WP8J 1Y69U 5G3LD 1IYVA 5IGEA 1CM9A 3S14B 1F2ZA 1GUTA 2V4DA 3BYTB 4K5VA 4M8AA 5IGBA 1EY6A 5A2QE 5EJWA 2F4IA 2KHSA 4OIJA 4RKBA 3EFXD 2K1BA 1DOLA 3A8IE 3CU7A 1K8OA 2Q8IB 2IWHA 5C0XG 5KYIA 4C1NI 4EQOA 5C4JB 3VYTA 2Z8LA 2F0IA 1HA6A 1JWMD 1MBYA 1SJHD 1S5ED 3HG9A 4C2MB 2VNUD 1D6EC 1GHKA 2B63B 1NR2A 5JPNC 1BQQT 1ET9A 2A69C 3MEHA 4IQZA 3M3YB 4CJ2C 1BNZA 2PZUA 1VF7A 2FINB 4FO2A 4JK1C 1KNEA 3LNNA 4V190 2ZT9C 3S16B 2K6AA 2ID0A 3HOXB 5JJZA 3J7AV 2IT1A 3EROA 1FNVA 2X6LA 2NVQB 2PQEA 4KN7C 1U4LA 3A8KE 2XN9C 2PMZB 3UI2A 4DXGA 2EJFC 1AZPA 3HRZC 1IW7C 4ZRZA 1QCBD 4K5XA 1U4PA 4X3KA 5KNBA 2G9DA 2MP1A 4H0LC 2QDBA 1Y1WB 2EYFA 5FO9B 1FR3A 1B9MA 4IUQA 2F0DA 3RD4A 2LY7A 1SYBA 4OO1I 2F0HA 4CBVA 4C3JG 1B3AA 1RTNA 2H4OA 4J1MA 4WRDA 2EY5A 1BR9A 1A3VA 1WD0A 1LTTD 1DCZA 3CKIB 2I46A 2F0OA 4FVMA 1G291 1KDAA 5ELFA 2JYOA 4KHZA 2Q8RE 4RH6A 3V96A 1LTAD 2B2TA 3I90A 2A5HA 4FYDA 3I70A 3VR2A 2VUMB 5EPJA 2K03A 1DD2A 2LKVA 4TSSA 2F3VA 3RUZA 2D2CC 4HTHA 2NVTB 5A2QL 2AUKA 4ZAIA 1Y8NB 5E3FA 4ABNA 3O13A 5EBCA 3P75A 2B2WA 5CC4A 4IFDH 4FF3A 3AB9A 2EVBA 1I50B 4PV1C 3KK7A 2RKSA 3KBGA 3SK5A 3ERQA 5C5MA 1DM0B 3TMEA 1STHA 2AUJD 4IUUA 1RCVD 2PO4A 1SFOB 2XVSA 1LTSD 4GZYC 3OWFA 4E6IA 1G91A 3G7LA 2IL8A 4K2KA 5AFWA 5C5LA 2A68D 2TMPA 3TP5A 2KCCA 3MTSA 1K83B 3OSOA 5D3DA 1BO0A 2WKDA 5FOBB 3VYSA 1CA6A 3C46A 2B8FA 4MN3A 1M4VA 1YNND 3J81L 2F0JA 1OO9B 1HHVA 1D1KA 4K8IA 4CKCA 2OT2A 5CV5A 2B2VC 1SNOA 3NBHA 2F1MA 2J7ZA 4ILWA 1PDQA 1HUMA 2QILA 3SEBA 1CA5A 3TDQA 4L63B 2PCFB 3EQLC 4DGZA 1EYAA 1A3UA 1B1ZA 1GXDC 5I9PA 5KYLA 4IUVA 1FD7D 4DFAA 2EYJA 2MHVA 3DWAA 2JA6B 1WTVA 1V43A 2WKCA 4B08A 3MC0B 2JA7B 1ILPA 5F2DA 2DNCA 3ND8A 4KD3A 3MXPA 1HXYD 3CHBD 5EBDA 1VCIA 1STEA 1EEFD 1PTOD 4QB4A 5IGCA 1JE4A 2HCIA 5M5XB 1E2VA 3IAYA 4C3HG 4A3EB 2DY8A 3EJIA 4KV6A 3I4LA 2JA8B 2K32A 3BS1A 2C5CA 3L3OC 3A8JE 1Y8PB 2NN6H 3IKJA 3OW7A 1ICWA 2JE6I 1X32A 5FK9C 4XQQA 5KEEA 3A55A 3D4RA 4KY5A 1R4QB 1G2SA 4RA8A 3Q22A 2F0QA 1UEAB 3TN2A 2EZVA 3D8GA 2B2YC 1IKLA 3PO2B 4XQNA 5BN3A 3BVGA 3FKIB 2IX1A 5EKKA 3PO3B 2MPMA 1EYDA 2CHBD 4A93B 4ID6A 4TKOB 1TWCB 1TY2A 2PNRC 1TWGB 1TWAB 4RCNA 5J1ZA 3GO5A 2BDNA 3I3CA 3X3NA 1KDBA 1NAPA 3HOZB 4AYBB 1B53A 1Q3LA 4C3JB 5C0XI 2K28A 1A6XA 3M7NA 5CV9A 5TSSA 4ZQ3A 1V1OA 1R9TB 1XTCD 1YNJD 1IL8A 3MFYA 4OIKA 5JEAG 1WTPA 4A3GB 4G7ZC 3MXNA 1SYFA 2B2UA 4Z9CB 3U9SA 4K6LA 4L6TB 5C0XJ 1JWSD 1SEBD 3P1HA 2L1BA 4OO1H 2AQ1B 5IODA 1C4QA 3H09A 5E1FA 5I6WA 2RQXA 1AZQA 3T53B 4G4KA 3OIPA 4RGTA 3HOVB 4CGYB 2O5IC 5KRUA 2ZXPA 3TZUA 3CRLC 4TQUS 3S1MB 4TRDA 2JP1A 5J22A 4CKBA 5IOCA 2NB0A 5CBAE 1SDFA 1DZ1A 3GD7A 1EY0A 1AN8A 1ESRA 2F0VA 3IL8A 2RA4A 3HOWB 3BZDB 1YNJC 1I4RA 4FXGC 3TZDA 2OXPA 1EOTA 4XIGS 1RDPD 2IW3A 4F8MA 2IPKD 2NBFA 1H9MA 1QNUA 5T1IA 3N6RA 2K5DA 2EYLA 5FO7B 3H3VC 1DJRD 1T5XD 2AWOA 4R8NA 1AEXA 1DONA 2CQAA 1CK1A 3D31A 2SEBD 2X6GA 5D14A 2AQ2B 4DK1A 2SOBA 2NTSA 4DF7A 5I2XA 2F0TA 1MGSA 1TS4A 4PMCA 3GQBA 4LMQD 5C4XB 2KEEA 4L8JA 3OMCA 1PLFA 3HGBA 1ENAA 2HDMA 3DM1A 4IN3A 4CJ0B 3NHHA 3MAQA 4F87A 2R93B 4KY7A 2NN6I 1EFID 1VMPA 2C9OA 4DNRB 1MSGA 3KLSX 4JBWA 1HUNA 3NWTA 4QUCA 4M1UB 3DEPA 5EKLA 2BA1A 5IGDA 2HCCA 1JCKB 2F0NA 5FO8B 1A2TA 2KA7A 3V05A 1EZ8A 4X3SA 3Q0AA 1EYCA 3BDLA 2A6HD 4IALA 1PFBA 4K8JA 4C3HB 1EWHA 1Q90A 1I4XA 1CT1D 2NWGA 1XWEA 3WOEA 2DNEA 2K5QA 4BA2I 1STGA 1X3PA 3BDCA 1XYIA 1SAPA 4KKUA 1ZXTA 2F0LA 4ME5A 2L4NA 3TSSA 1SMYD 3IFDA 1SE3A 3D4DA 2B39A 2L9HA 1MI2A 1LT6D 2OEOA 1V1PB 3J81E 1D5ZC 3T56B 5EKIA 3K7AB 4K2LA 3VYRA 3SDZA 4XXEA 1OXXK 4OHJA 3I4MB 5DM63 1V8QA 2A6HC 3NBIA 2FMMA 1GUNA 1O80A 1BCPD 1HTPA 5JOBA 4O42A 2JSOA 2F03A 4KJNA 2EYMA 3GV3A 1L0YB 1WTQA 1EQVA 1WTOA 5M5YB 5EQ0A 2ENBA 3NP8A 4U68A 4FXDA 1H9SB 3PV0A 3HP3A 1EQTA 3GP7A 2SNMA 4H7BA 3GTQB 5LHY1 2EY6A 3SE0A 1U9RA 1Z7TA 3NE5B 4DN4M 2K33A 2FMCA 4OL7A 3BG3A 1A3TA 2BA0A 5IT9E 4XDXA 3Q6SA 2EOTA 1Q8IA 1E2ZA 4KY6A 2N88A 1WTRA 3SHLA 2F0KA 3BDOA 1DYQA 1HTLD 1JORA 4Y7NB 4HMIA 1PZKD 1ENFA 1S5BD 3DHQA 5EPKA 5C0XH 3C1EA 4HAEA 2EYOA 2F0FA 2PZTA 4DXFA 1WTWA 4A3BB 2F0GA 2XNAC 2FFKB 2E2HB 3NXWA 2J4XA 3I73A 4OGQC 5DNFA 1STAA 1XX8A 4IZ8A 4ULLA 1BUVT 1LO5D 4A3KB 3GTMB 1QB5D 3OIQA 1UNSA 4MHEA 3NUCA 2MUYA 2NTTA 2B2WC 3FPPA 5JAVA 1OXVA 1ZKOA 5K36G 5E4WC 5G3LF 3VR5A 5J39A 2PYKA 1B44D 4HN7A 2RDFA 2E75C 2VXWA 5DM73 5E4XA 4R8IA 3R93A 2K5WA 3OWEB 3MHBA 2EY1A 3FDTA 3NTHA 3NK9A 3NSWA 2RDGA 2E2IB 4G57A 3E6ZX 2TSSA 3A56A 3NTIA 3OPOA 4NDXA 3ONAB 2N55A 5BN5A 3K5LA 3GTPB 1PMRA 1G8ZD 1EY9A 3I8ZA 4PMBA 3GTOB 3MVVA 3F2UA 1LV9A 4A3JB 3S2HB 3OMGA 3HOUB 1M8AA 1S5CD 2Q8TA 4ODGA 3I4NB 1I4GA 5D3IB 4F88A 3NQIA 5M3MB 2BOSA 2D5DA 3WOFA 1C8CA 3URYA 3A54A 2A68C 4BBSB 4CJ1B 3I91A 3T13A 1OXSC 4FNFA 5JEAJ 1NR4A 3K5OA 2IJ0A 1YNNC 1K8MA 1CHQD 2K7VA 3JAME 3QG1A 5ELDA 4XTCS 3ZYYX 4EGVA 2F0EA 5IT9L 1G6ZA 4KD4A 1S4ZA 3LWEA 1CQFA 4Q0FA 4C1NK 3K0YA 2PW5A 2IX0A 2YU9B 3NTKA 4ZLTF 1LTRD 3K5MA 3V2TA 3AU7A 3W3AA 5JVG3 2PPBC 1U4MA 1PZJD 2RSOA 2F3WA 3VA7A 2XIWA 2B2YA 3SVMA 1EZ6A 5EPLA 1CI3M 1Q1BA 2XSCA 3RLFA 1JR0D 2BCOA 5KIXA 2LFNA 1JOKA 2QEJC 1O7LA 1H9KA 3D3RA 5LL6X 3QWNA 5KNDA 1W6JA 5T1GA 5C4HA 3Q24A 4RWSC 1F9RA 1PTOC 1F9QA 4KHVA 1TS2A 4HCEA 2XRSD 1H9JA 2QCPX 1KLUD 1SSOA 3CQZB 1SNCA 2L5TA 2WAQB 3M4YA 1CQVA 3SK8A 1EL0A 1KABA 4IUPA 1A15A 1J8IA 3P7JA 3C1FA 4XQJA 4XYOA 1E0BA 1KAAA 4YIJA 3EVQA 2MGSA 1WCMB 3FRPB 2VB3X 1CHPD 3TP6A 2OF1A 1PTOB 1VMCA 3SK6A 1B4OA 4B9XA 3MZ5A 5I9OA 1TR5A 2I07B 3KLRA 4BA1I 3MXUA 1UUPA 2RSNA 4ZKCB 1T5EA 3MXGA 2MJ8A 4NW2A 5CV6A 1D2BA 1X3QA 1ILQA 1EIGA 3BYYB 4KMUC 3GTGB 5CGKA 2WINB 4RCOA 1EY8A 2RDHA 1TIID 3K5NA 3JAML 2AWNA 1Z47A 2FHTA 1QG7A 1HRJA 4LK1C 4S3SA 5ELCA 5IGFA 4PNYA 1LT4D 2F0SA 3Q23A 5C4ZA 5A35A 3QOLA 4UDUC 3E0JA 2JA5B 3R3OA 1O7YA 2E76C 1Q12A 2CVRA 1TQOA 1RHPA 4RFBA 3BVZA 2KEDA 4A3MB 2L11A 2EY2A 3RZDB 2XRQD 3R8BA 2XWBB 2XWJB 3GTKB 1GOZA 2KCNA 1D5MC 2R3ZA 5CR3A 1SYGA 1S5DD 3D6CA 1C48A 1PTOF 2D62A 5C3WA 1EU4A 3TP8A 1QE6A 2EJGC 3SK4A 3QJYA 1BDOA 2KECA 1SYDA 1Y8OB 5NUCA 2KVMA 4V0BA 2EPBA 1ESFA 1TWHB 1Y1VB 1MSHA 1DOKA 5IIFA 4QUFA 2VB2X 1CFMA 1WD1A 4BY7B 3H6MA 4N9TA 5CV7A 2L0CA 1JOQA 1V1PA 3KF8A 3R2IA 4FF4A 3PIO3 3SXHA 2WACA 3D4WA 3H0GB 2Y0SB 5JEAH 3NPPA 3J80E 3R2TA 5FKAC 1FGBD 2NVYB 3X3MA 1IW7D 4IFDG 3GV6A 3MFGA 3NWSA 1Z6HA 1DXMA 1RTOA 4WFN3 4PQXA 4ZUJA 1BBXC 1SYCA 5CV4A 1F77A 1EIHA 2QF7A 4C3IG 1JB3A 1LLRD 1ML0D 1TKWB 1H9SA 2E2JB 4DK0A 2F0UA 2M2LA 4BS9A 3J7AF 4I65A 2AQ3B 4RHSA 4ZK9B 3FEWX 1EY7A 4EVOA 2BDOA 3S1RB 3W2DA 2QKIC 4KJOA 2J0TD 5FLXE 1GUSA 4XT3B 2R6GA 1O7ZA 4K6DA 1LT3D 1Q1EA 1LABA 1SNPA 2X69A 3C2PA 2LS01 5C3XA 2R92B 1PZID 1RODA 1SMYC 4P2CB 2O4XA 1CZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9Q A;  1Q3L A;  1AZP A;  3D6W A;  5T1I A;  1XYI A;  1SAP A;  2K04 A;  3F2U A;  1ZXT A;  2B2V A;  2K28 A;  4ZKB B;  4R9W A;  1LV9 A;  2L4N A;  5COR A;  1SSO A;  2NYZ D;  4UAI A;  3IFD A;  1CM9 A;  1DON A;  1AP0 A;  1M8A A;  2L9H A;  1O7Y A;  1U4P A;  2B2U C;  1MI2 A;  2H1E A;  1EL0 A;  2HDL A;  3N52 A;  1A15 A;  2X6G A;  4IUP A;  5COY A;  2Q8T A;  1J8I A;  3P7J A;  1JE4 A;  2CVR A;  2HCI A;  2DY7 A;  4X3U A;  4X3K A;  5EPK A;  3MWY W;  4HAE A;  4IUU A;  5D14 A;  1RHP A;  3GV6 A;  2MP1 A;  3KBX A;  5EKI A;  2DY8 A;  2KUM A;  1C8C A;  2KED A;  1GUW A;  1E0B A;  1WTW A;  1IL8 A;  4OIK A;  4IUQ A;  1G91 A;  1RTO A;  1MGS A;  1U4R A;  2IL8 A;  3G7L A;  1WTP A;  5EJW A;  1F9P A;  4XT1 B;  2L11 A;  5AFW A;  4CJ1 B;  2NZ1 D;  1J9O A;  2FFK B;  3I91 A;  4IUR A;  4LMQ D;  2KEE A;  4OIJ A;  2MGS A;  1WVL A;  2D9U A;  1BBX C;  1G2T A;  1NR4 A;  1PLF A;  2B2U A;  1EIH A;  2K1B A;  4X3T A;  1DOL A;  3DEO A;  3KUP A;  1B3A A;  1RTN A;  1ICW A;  2HDM A;  2SDF A;  3MTS A;  4HSV A;  3DM1 A;  5DNF A;  1BO0 A;  1HFN A;  1X32 A;  1XX8 A;  1CA6 A;  1ML0 D;  4CJ0 B;  2R3Z A;  4MN3 A;  1WD0 A;  4RAU C;  1NCV A;  1HA6 A;  1G6Z A;  1VMC A;  1VMP A;  2B2T C;  1G2S A;  3FPU B;  2L1B A;  4MHE A;  4RA8 A;  1S4Z A;  3LWE A;  1MSG A;  2B2W C;  2FMM A;  1O80 A;  2K05 A;  1HHV A;  1B4O A;  1F2L A;  2M2L A;  4O42 A;  1HUN A;  3TN2 A;  1PFN A;  1KNA A;  3GV3 A;  5E4W C;  2B2V C;  2B2Y C;  1AZQ A;  1WTQ A;  4QUC A;  1IKL A;  2JYO A;  4ZK9 B;  4ZLT F;  1WTO A;  1NR2 A;  2J7Z A;  1QE6 A;  2Q8R E;  3DEP A;  1PDQ A;  1HUM A;  2RSN A;  5EQ0 A;  1IKM A;  5D65 A;  2KOL A;  1CA5 A;  4U68 A;  4CJ2 C;  4ZKC B;  1F9S A;  1DOM A;  1BNZ A;  2B2T A;  2VXW A;  3I90 A;  2FIN B;  2FJ2 A;  2MJ8 A;  5E4X A;  1WTX A;  4R8I A;  2KEC A;  2HCC A;  3R93 A;  3H91 A;  4NW2 A;  1U4M A;  5CMD A;  4HED A;  2JP1 A;  1JIC A;  2KVM A;  2K01 A;  2RSO A;  1KNE A;  2MPM A;  1EQT A;  3FDT A;  3HP3 A;  5EPJ A;  1X3Q A;  2K03 A;  1ILQ A;  2EPB A;  1EIG A;  4XT3 B;  2XIW A;  5CBA E;  4HCS A;  1SDF A;  4X3S A;  1DZ1 A;  2B2Y A;  2RVL A;  3SVM A;  1O7Z A;  5EPL A;  5JJZ A;  1MSH A;  1BF4 A;  1DOK A;  4IUV A;  1PFM A;  4DN4 M;  1ESR A;  2HUG A;  3IL8 A;  4QUF A;  1PFB A;  2X69 A;  2RA4 A;  4IUT A;  2X6L A;  4ZAI A;  1WTV A;  3QO2 A;  3ONA B;  1WD1 A;  1B50 A;  2N55 A;  3TZD A;  2BDN A;  3I3C A;  4XDX A;  1ILP A;  1RJT A;  1U4L A;  1EOT A;  1B2T A;  1QNK A;  2NWG A;  5CBE E;  1TVX A;  1NAP A;  2L12 A;  3Q6S A;  1ROD A;  2B2W A;  2EOT A;  1QG7 A;  2FHT A;  5T1G A;  1HFG A;  2N88 A;  1WTR A;  2EE1 A;  4RWS C;  3UI2 A;  1F9R A;  1HRJ A;  1B53 A;  3I8Z A;  1X3P A; 
#chains in the Genus database with same CATH topology
 5DEH A;  2PZW A;  4LAA A;  1UAP A;  1TY0 A;  2EDG A;  4KHP Q;  2ZXO A;  2Z1C A;  3KFU A;  3GTP H;  1PH3 A;  3GTL B;  1RKN A;  3PIO A;  1N34 Q;  3M7G A;  4UAI A;  4IJH A;  1LTB D;  1EYG A;  4CHT B;  5C3E B;  3CC4 A;  2H1E A;  3GTO H;  3N52 A;  4J6H A;  3I2Z A;  2E2D C;  2DGY A;  4GNX B;  3WWV A;  3HOU H;  3DLL A;  1TS5 A;  1QOH A;  4QCL A;  2E8G A;  2I0Q A;  1EY4 A;  1F9P A;  2NZ1 D;  3WDN A;  4IUR A;  2CW0 D;  1PRT D;  4DV5 L;  5EGT A;  2D9U A;  4BY1 B;  5M3M H;  1G2T A;  2WB1 B;  3CPW A;  5M3F B;  3NQT A;  5M9O A;  3HKZ G;  4BBS H;  1BCP C;  1CTM A;  3G6E A;  3VR6 A;  2F3I A;  2B2T C;  1I3Q B;  3FPU B;  1OXU A;  2XTI A;  2JEA I;  4NKL A;  4DAP A;  2NN6 G;  3I72 A;  1HCZ A;  1KL9 A;  1RF2 D;  4K14 A;  1PFN A;  2L55 A;  1FYC A;  1WFQ A;  3M4O B;  4G7H C;  4A3E H;  2VW9 A;  1LTG D;  1RL2 A;  3J80 L;  4PMW A;  1EEI D;  5D65 A;  2EJM A;  1JJC B;  2G9H D;  5CYU A;  3VA5 A;  4CDE C;  1DOM A;  5K5P A;  1EU3 A;  1KHI A;  4LFA L;  4GN4 B;  3S9W A;  3K6O A;  5CMD A;  3T51 B;  2YU9 H;  1JIC A;  3PUX A;  3HZX A;  3J7Z C;  1SBB B;  4DR2 L;  1SMX A;  4JI5 L;  3DXJ C;  4HCS A;  3K59 A;  4LF8 Q;  1EWI A;  3RLO A;  1IL2 A;  2BH8 A;  1STY A;  2JA9 A;  4F7X A;  4HID A;  1PFM A;  1KDC A;  2HUG A;  3VR4 A;  1BCP B;  1SE2 A;  2E74 C;  5HGT A;  1L0X B;  5LMN Q;  1H9R A;  3CW2 C;  1B50 A;  5CV8 A;  3PIP 3;  4P72 A;  4EQP A;  1B2T A;  1PH4 A;  4FDB A;  3TBI B;  1I94 Q;  2CW0 C;  1PRT C;  1OTC A;  3PF5 A;  3SR1 A;  3S17 B;  1HFG A;  1TWF B;  4PZ6 A;  4K5W A;  1N34 L;  2CCZ A;  2B2V A;  1K3B C;  1JC7 A;  3FKI H;  4R9W A;  4G7O C;  1BXT A;  5COR A;  4HR7 B;  2A74 C;  1STN A;  4BXX G;  1VQB A;  4H44 C;  4KK7 A;  2ICI A;  2EYP A;  4H13 C;  3T4A C;  3ULP A;  4A3I B;  1NSN S;  5COY A;  4A93 H;  2DY7 A;  1HR0 Q;  4N9P A;  3KBX A;  4L5R C;  1PH1 A;  1KIX A;  2KUM A;  3TS2 A;  3CQZ H;  1MD2 D;  1NUC A;  5FLX L;  2KJX A;  1U4R A;  5I4D A;  5DAU A;  5BR8 Q;  1HA5 A;  4DU9 A;  3PUY A;  2R7Z G;  4DR4 L;  1S3O A;  3PMF A;  4BBR B;  3KLS A;  4X3T A;  3DEO A;  2NUC A;  1PRT B;  3LWU A;  4HSV A;  4MIU A;  4PG3 A;  3GTJ B;  1B9N A;  4EQN A;  1SYE A;  2HT1 A;  2KHI A;  1WCM H;  1HH2 P;  4JOI A;  4RAU C;  3A7A B;  4FP5 D;  1EY5 A;  4A3D B;  3VR3 A;  1I4P A;  4DV7 L;  2ZTC A;  1I4H A;  5C6A A;  1F2Y A;  1PYW D;  1SXT A;  4Y52 H;  4GLV B;  1NMF A;  1PTO H;  2BE5 D;  4TVA B;  2Y0S E;  3DWQ A;  1EQR A;  3S15 B;  4JBJ A;  1P8L A;  1TS3 A;  2ICE C;  2JK8 A;  5ELB A;  4NB3 A;  1R9T H;  1I6V C;  4KKT A;  5HUR A;  3H94 A;  1ONL A;  1I4Q A;  1PV4 A;  3FVQ A;  1JOO A;  4RGN A;  1RD9 D;  2FJ2 A;  2WV6 D;  4KLK A;  4OO1 G;  4NMZ A;  3H15 A;  4LF8 L;  2K01 A;  3CCE A;  2LMC B;  1KLG D;  3E3X A;  1PYS B;  1VDZ A;  2Z6K C;  2SNS A;  4WOR A;  2MFI A;  4DV0 Q;  2RVL A;  2UXB Q;  4DA2 A;  1U0L A;  3EA6 A;  5LMN L;  4DR1 Q;  2YTV A;  3MA2 B;  4LW1 A;  3ULL A;  5FLM G;  1SNM A;  3NBH B;  1Q81 C;  2EYH A;  2CWA A;  1CSQ A;  4IUT A;  3J81 j;  3UE0 A;  1K0S A;  2HIX A;  1AH9 A;  1RJT A;  4LUO A;  3J80 i;  1FNW A;  1QUQ A;  2B63 G;  3KYH C;  3CRK C;  2L12 A;  3PIP A;  4YWM A;  1BCP F;  1TT2 A;  3NEN A;  3K57 A;  1VS0 A;  3D6W A;  1D5X C;  2HQE A;  4HJ5 A;  2Z4I A;  4C3I B;  4ZYS A;  5IGG A;  4KKS A;  1HPC A;  4R4T A;  1LAC A;  2WII B;  2O2L D;  3FMC A;  2NYZ D;  1SJE D;  1HZC A;  3HOX G;  1G51 A;  5IYB H;  1HR0 L;  1AP0 A;  1HQM C;  2HDL A;  2NVX B;  2KQ3 A;  1YVC A;  2JXM B;  4QL5 A;  2BE5 C;  4FF1 A;  3MWY W;  2R61 A;  5IYD G;  1E24 A;  2JA5 H;  5BR8 L;  4IPC A;  2E5L Q;  1GUW A;  3DWP A;  2GA4 B;  4RHR A;  1QIL A;  4XT1 B;  2UUA Q;  2B8G A;  3T16 A;  1LTI D;  3K58 A;  2ZTE A;  1CZG A;  1WVL A;  2EQS A;  3HEJ A;  4UPA A;  4ZUI A;  1L0W A;  3KJP A;  1N33 Q;  5C44 B;  5K36 H;  2PI2 A;  4IUN A;  1YHQ A;  3W1B A;  3RZD H;  2IY5 B;  4BWG B;  1VQO A;  3C3L A;  1F2M A;  5JPM C;  1GM5 A;  3HOY B;  1VQK A;  1XXG A;  4A3F B;  3RZO B;  1W6K A;  3HS0 C;  4DAV A;  4A3C G;  2K05 A;  4XYQ A;  1PRT F;  4DV6 Q;  1A2U A;  1HQR D;  2K50 A;  1ET6 A;  1Y1W G;  3DUZ A;  1KNA A;  1LM0 A;  2Z4H A;  5HY6 A;  4I7Z C;  1IHZ A;  3L7Z C;  3G71 A;  4KN4 C;  1KQS A;  1STB A;  2KOL A;  5ISR A;  1WYD A;  1UE5 A;  3OHX C;  1GUG A;  3H91 A;  1PXU A;  4DV0 L;  1NMG A;  2UXB L;  1QJO A;  3QR8 A;  1J6Q A;  5GRO A;  4DR1 L;  2F0W A;  3P20 A;  1D7Q A;  3QOJ A;  3S1N B;  4RKL A;  1JWU D;  4IPD A;  2Q2U A;  5M5W B;  4LF6 Q;  4IFD I;  1QVC A;  3KLW A;  3TP7 A;  2AMC B;  3A7L A;  2JEB I;  1E2W A;  3BVM A;  3E5S A;  4U67 3;  1TU2 B;  1ZEQ X;  5I2Y A;  3QO2 A;  1Z9F A;  4LJZ C;  1SNQ A;  1S5F D;  1TWH H;  1Y1V H;  3RMH A;  1B70 B;  1QNK A;  5LL6 S;  5KNC A;  1TVX A;  3G6J B;  4QIW B;  3PUV A;  4JVZ A;  2F0M A;  2M9V A;  1SND A;  3PUW A;  1PH5 A;  3UDX A;  4J8Q A;  4BY7 H;  2K04 A;  2VUM G;  4FF2 A;  3HKZ B;  4ZKB B;  2K5N A;  5KGU A;  3M85 A;  3G4S A;  2B2U C;  3PUZ A;  2E5L L;  4X3U A;  1GUO A;  3L9A X;  2DN8 A;  4QMG A;  1E1T A;  2A6E D;  1Q46 A;  2RBM A;  4B9W A;  2UUA L;  4IFD J;  5I6Y A;  1ZYR D;  3ND9 A;  1I6H B;  2NVY H;  1J9O A;  5EAY A;  1XJV A;  2YYZ A;  4LF7 Q;  1WJJ A;  1O78 A;  3KUP A;  4NP5 A;  4JI3 L;  2SDF A;  3QB3 A;  1HFN A;  4RGO S;  4QF4 A;  1SE4 A;  3IFT A;  4QY7 A;  2A73 B;  4GN5 A;  4GKK Q;  1KTK A;  3U9O A;  1NCV A;  2D0O A;  4DV6 L;  2IX3 A;  3DMU A;  4CKE A;  4DAY A;  4HMJ A;  1F2L A;  1B8A A;  4WJW A;  1IYU A;  2MNA A;  1VF5 C;  1XTD A;  3MXN B;  1A63 A;  1GHJ A;  1ENC A;  4AH6 A;  5BN4 A;  2I5H A;  3LX0 A;  2O5J C;  4KTA A;  1YHA A;  3QIA A;  3ITP A;  2CKZ B;  1R4P B;  1IKM A;  2B3G A;  2ZXR A;  3VYU A;  3AMU A;  1F9S A;  5JVH 3;  2UUC Q;  4LF5 Q;  3OOC A;  1WTX A;  3S2D B;  1GJX A;  4HED A;  4QJF A;  1PFS A;  5GQO A;  1QWY A;  4HSP A;  4IPG A;  1AW7 A;  1G6P A;  4DNT B;  1HNZ Q;  4LF6 L;  3J7Y W;  1BF4 A;  4C56 C;  3S1R H;  3E9H A;  3E0E A;  1HZ9 A;  2A6E C;  2CH4 A;  1AFP A;  5JJK A;  4KI0 A;  1II3 A;  1ZYR C;  1EWC A;  4DV4 Q;  4AQY Q;  1LT5 D;  1NBW A;  1CKO A;  2EXZ A;  5CBE E;  3S1Q B;  2CWP A;  2M00 A;  4O1N A;  2GVA A;  2DJG C;  2R7Z B;  2F0P A;  2MO0 A;  1OXT A;  4Q5V A;  2EE1 A;  3A0J A;  4RGM A;  1BOS A;  2A69 D;  1FNU A;  1JQY D;  3GDE A;  4A3L G;  2PW7 A;  4FXK C;  4NXN Q;  5ELE A;  1D1I A;  2WP8 J;  2R92 H;  1Y69 U;  1E3P A;  5G3L D;  1IYV A;  5IGE A;  1CM9 A;  1EUJ A;  1F2Z A;  3S14 B;  1GUT A;  2V4D A;  2JA6 G;  2Q2T A;  3GTL H;  3BYT B;  1KD1 C;  2JA7 G;  4K5V A;  4M8A A;  5IGB A;  5C3E H;  1VQD A;  1EY6 A;  5A2Q E;  4LF7 L;  5EJW A;  4YCV A;  1T9H A;  2F4I A;  1SRU A;  2KHS A;  4OIJ A;  4OON A;  4R4C A;  1U5K A;  4RKB A;  2VY3 A;  3EFX D;  4B3S Q;  4JCV E;  2K1B A;  1DOL A;  3A8I E;  3CU7 A;  4GKK L;  1K8O A;  2Q8I B;  2IWH A;  2Z0S A;  5C0X G;  5KYI A;  2KHJ A;  3F2D A;  1PH7 A;  4C1N I;  4EQO A;  5C4J B;  3VYT A;  2Z8L A;  4BY1 H;  2F0I A;  1HA6 A;  1JWM D;  5M3F H;  1MBY A;  4DR7 Q;  1SJH D;  1S5E D;  3HG9 A;  4C2M B;  1PHJ A;  2VNU D;  4A3E G;  1D6E C;  1GHK A;  2ASB A;  1AE3 A;  2JA8 G;  1I3Q H;  3DM3 A;  1QZG A;  2B63 B;  2UUC L;  1M90 C;  2Z6B A;  2V1C C;  1NR2 A;  3G48 A;  5JPN C;  4OX9 Q;  1BQQ T;  1ET9 A;  2A69 C;  3MEH A;  4IQZ A;  4A3B H;  3M3Y B;  4CJ2 C;  1BNZ A;  2PZU A;  1VF7 A;  2FIN B;  1FVI A;  4FO2 A;  3OTO Q;  4JK1 C;  1HNZ L;  3M4O H;  1KNE A;  3LNN A;  4V19 0;  2ZT9 C;  3S16 B;  2K6A A;  4IO9 A;  2ID0 A;  3HOX B;  5JJZ A;  3J7A V;  3BJU A;  2IT1 A;  4DV4 L;  3ERO A;  3S24 A;  1FNV A;  2X6L A;  2NVQ B;  2PQE A;  2WAQ E;  4KN7 C;  4O2D A;  4JI1 Q;  4HJ7 A;  3VDY A;  1U4L A;  3A8K E;  2XN9 C;  2PMZ B;  3PO2 G;  1B7Y B;  5GAG C;  2RF4 A;  2K4K A;  4NXN L;  1YIJ A;  3UI2 A;  4DXG A;  2EJF C;  3FKI G;  4LFA Q;  3J81 c;  1UE6 A;  1AZP A;  3BZK A;  3PO3 G;  4EX5 A;  3HRZ C;  5LMU Q;  1IW7 C;  4ZRZ A;  3M9B A;  3S17 H;  4JBM A;  4A93 G;  1QCB D;  1HZB A;  4K5X A;  1U4P A;  1TWF H;  3HKS A;  1YZ6 A;  2LXJ A;  4X3K A;  5KNB A;  2E2I H;  2G9D A;  2MP1 A;  4H0L C;  2QDB A;  1Y1W B;  2EYF A;  4UP7 A;  5FO9 B;  1FR3 A;  1VQA A;  1B9M A;  4IUQ A;  2F0D A;  1UE7 A;  3RD4 A;  4A3I H;  3HOZ G;  2LY7 A;  4AYB G;  1S72 A;  2ES2 A;  1N9W A;  5IYC H;  1SYB A;  3K8A A;  2PI2 E;  4OO1 I;  2F0H A;  1BBU A;  4CBV A;  4C3J G;  1B3A A;  1RTN A;  2H4O A;  3BZC A;  4J1M A;  4UP8 A;  3SGI A;  1J5E L;  4WRD A;  2EY5 A;  1BR9 A;  1A3V A;  1WD0 A;  3CCS A;  1YJ9 A;  4DR7 L;  2H5X A;  4BBR H;  1LTT D;  2UXC Q;  2AHO B;  4A3J H;  3S2H H;  1BBW A;  1DCZ A;  3CKI B;  1W2B A;  3GTJ H;  5DLQ E;  4B3R Q;  2I46 A;  2F0O A;  3I4N H;  4YHH Q;  4PZ8 A;  3L2P A;  4OX9 L;  4FVM A;  1G29 1;  1KDA A;  5ELF A;  2JYO A;  4A3D H;  4KHZ A;  4A3G G;  2Q8R E;  3OTO L;  4DR4 Q;  4GLA C;  4RH6 A;  3V96 A;  1LTA D;  2B2T A;  3I90 A;  4ALP A;  2A5H A;  4FYD A;  3I70 A;  3VR2 A;  4X62 Q;  1MJC A;  3EN2 A;  4B3T Q;  2VUM B;  5IT9 c;  5EPJ A;  5IP7 H;  2K03 A;  1DD2 A;  2LKV A;  4TSS A;  2F3V A;  3RUZ A;  2D2C C;  4HTH A;  2NVT B;  5A2Q L;  1VQ9 A;  1JJG A;  4DV7 Q;  4JI1 L;  2AUK A;  3NEL A;  4ZAI A;  1Y8N B;  5E3F A;  4ABN A;  3O13 A;  5EBC A;  1EFW A;  3P75 A;  2B2W A;  3HOV G;  5CC4 A;  2I5L X;  4IFD H;  4FF3 A;  3AB9 A;  3PSI A;  5LMU L;  2EVB A;  1I50 B;  4PV1 C;  4HIM A;  3KK7 A;  4DUZ Q;  2RKS A;  3KBG A;  2Q2I A;  3SK5 A;  4JW0 A;  2MO1 A;  3ERQ A;  4R4O A;  5C5M A;  1UEB A;  1DM0 B;  1YEZ A;  3TME A;  3AYH B;  4JI0 Q;  1STH A;  4EQ5 A;  4C3I H;  1YIT A;  2AUJ D;  4IUU A;  1RCV D;  2PO4 A;  1SFO B;  3HOW G;  2XVS A;  1LTS D;  1YHB A;  4GZY C;  1K73 C;  3ER0 A;  3OWF A;  4E6I A;  3PGZ A;  1G91 A;  3G7L A;  2IL8 A;  2NVX H;  4K2K A;  5ELO A;  5AFW A;  5C5L A;  3M4P A;  4HJ8 A;  2VL6 A;  3STB D;  2ZTD A;  2A68 D;  2TMP A;  5J3B A;  3TP5 A;  2HHH L;  2KCC A;  3MTS A;  1K83 B;  1BKB A;  3OSO A;  5D3D A;  1BO0 A;  2WKD A;  5FOB B;  2UXC L;  3VYS A;  1CA6 A;  3C46 A;  2B8F A;  4MN3 A;  2CQO A;  2NZO A;  1CKN B;  1KC8 C;  1M4V A;  1YNN D;  4B3R L;  4DV3 Q;  3J81 L;  4LFB Q;  2F0J A;  4YHH L;  4A76 A;  3KDF B;  1OO9 B;  1HHV A;  1D1K A;  1KRT A;  3U58 A;  4K8I A;  3TRE A;  1QZH A;  3ULJ A;  4QGU A;  4CKC A;  4DKA C;  2OT2 A;  5CV5 A;  3HOY H;  4A3F H;  2B2V C;  1SNO A;  3CCJ A;  3RZO H;  2I5M X;  1V9P A;  3NBH A;  2F1M A;  1K3R A;  1K8G A;  2J7Z A;  4ILW A;  5C4X G;  1PDQ A;  1HUM A;  2QIL A;  3SEB A;  4X62 L;  1CA5 A;  4B3T L;  3TDQ A;  4L63 B;  3CC7 A;  2PCF B;  3EQL C;  4DGZ A;  1EYA A;  1PH2 A;  2WFW A;  1A3U A;  2R93 G;  1B1Z A;  1GXD C;  5I9P A;  5KYL A;  5FJ8 H;  4IUV A;  1FD7 D;  4DFA A;  1RIP A;  2EYJ A;  4DR5 L;  4P75 A;  2MHV A;  3I55 A;  3ERS X;  3DWA A;  2JA6 B;  1MKH A;  1WTV A;  1V43 A;  2WKC A;  4B08 A;  1VQI A;  4DK3 C;  3MC0 B;  2JA7 B;  1ILP A;  3S1N H;  3STB C;  1HNX Q;  2Z6K A;  1KXL A;  2XGT A;  1E22 A;  3FP9 A;  5F2D A;  1EIY B;  2DNC A;  3ND8 A;  4KD3 A;  3MXP A;  1HXY D;  1A0I A;  4DUZ L;  3CP0 A;  1VQE A;  3CHB D;  2B29 A;  5EBD A;  1VCI A;  1STE A;  1X3G A;  3CCV A;  1EEF D;  1SLJ A;  4JI0 L;  1PTO D;  4JI2 Q;  3B6Y A;  4QB4 A;  5IGC A;  1QVG A;  1JE4 A;  2HCI A;  5M5X B;  3JAM c;  1E2V A;  3IAY A;  3GTG H;  4C3H G;  2F4V L;  4A3E B;  2DY8 A;  3NEM A;  3W1G A;  1Q8K A;  3EJI A;  4KV6 A;  3I4L A;  2JA8 B;  2K32 A;  3BS1 A;  2YTX A;  2C5C A;  3L3O C;  3A8J E;  2LXK A;  1Y8P B;  2NN6 H;  3IKJ A;  3CMA A;  3OW7 A;  1ICW A;  2JE6 I;  1I6H H;  1X32 A;  5FK9 C;  4XQQ A;  5GAD C;  4DV3 L;  4GOP C;  2N8N A;  5KEE A;  3A55 A;  4LFB L;  2A1A A;  3J7A 5;  4JV5 L;  3D4R A;  1SN8 A;  5IY0 A;  4KY5 A;  1R4Q B;  2UUB Q;  2ZJQ A;  1G2S A;  4RA8 A;  4DR6 Q;  3Q22 A;  2K52 A;  1VQL A;  2F0Q A;  3K80 C;  1UEA B;  3TN2 A;  5L37 A;  2GN5 A;  2KBN A;  4POF A;  2EZV A;  3D8G A;  2B2Y C;  1VQJ A;  1IKL A;  3PO2 B;  4A3M H;  4XQN A;  3CF5 A;  5BN3 A;  3BVG A;  4OEL B;  4GKJ L;  5JJI A;  3FKI B;  1XNQ L;  4JI3 Q;  2IX1 A;  5EKK A;  4X66 Q;  3PO3 B;  2MPM A;  3I56 A;  3GTK H;  1E1O A;  1EYD A;  2CHB D;  1VQC A;  3J81 i;  3I4M G;  3KOJ A;  4A93 B;  4ID6 A;  4TKO B;  1TWC B;  1TY2 A;  3L0O A;  1X56 A;  4GOP B;  1SE8 A;  2PNR C;  1TWG B;  4IOA A;  1TWA B;  2A19 A;  4RCN A;  5J1Z A;  1DGS A;  3GO5 A;  1HNX L;  2BDN A;  1GKH A;  3I3C A;  4BXX H;  1VQF A;  3X3N A;  1WI5 A;  1KDB A;  1NAP A;  3HOZ B;  4AYB B;  2CFM A;  1B53 A;  1Q3L A;  1YNX A;  4C3J B;  5C0X I;  4JI2 L;  1FJG Q;  2K28 A;  4R1J A;  3S1Q H;  2R7Z H;  2WB1 E;  1A6X A;  3M7N A;  4RMF A;  5CV9 A;  4CDD C;  3IRB A;  5TSS A;  1LTL A;  4ZQ3 A;  1X9N A;  1V1O A;  4ZCK A;  1R9T B;  3CAM A;  1XTC D;  3JC6 6;  1YNJ D;  1IL8 A;  3MFY A;  4OIK A;  3CCR A;  5E7N A;  3S14 H;  5JEA G;  1WTP A;  4A3G B;  1K9M C;  4G7Z C;  2ALY B;  1SYF A;  2B2U A;  3MXN A;  1HNW Q;  4JPB W;  4Z9C B;  3U9S A;  2UUB L;  4K6L A;  4L6T B;  4DR6 L;  5C0X J;  1JWS D;  1SEB D;  3H0G H;  3P1H A;  2L1B A;  4OO1 H;  2AQ1 B;  5IOD A;  4NXM Q;  1C4Q A;  1YBY A;  5C4J H;  4IOC A;  2YV5 A;  3H09 A;  5E1F A;  5I6W A;  1EIF A;  2RQX A;  1PH9 A;  2QEX A;  2DJF C;  5AJ3 Q;  1AZQ A;  4A3B G;  3T53 B;  4G4K A;  5FLM H;  3OIP A;  4RGT A;  1X3F A;  4X66 L;  2N3S A;  3HOV B;  4CGY B;  2O5I C;  1K28 A;  4C2M H;  1X3E A;  5KRU A;  2ZXP A;  3TZU A;  3CRL C;  3Q8D A;  4TQU S;  3S1M B;  4TRD A;  2JP1 A;  5J22 A;  2B63 H;  4CKB A;  5IOC A;  3KJO A;  2NB0 A;  5CBA E;  4A3K G;  1SDF A;  3M3Y H;  1VQ7 A;  1DZ1 A;  3GD7 A;  1EY0 A;  1AN8 A;  1B3Q A;  1ESR A;  2F0V A;  3IL8 A;  2RA4 A;  2E2J H;  4GN3 B;  5IP9 H;  3HOW B;  3BZD B;  1YNJ C;  2MQH A;  1I4R A;  4FXG C;  3TZD A;  5IWA Q;  2OXP A;  4RG1 A;  3HOX H;  1EOT A;  4XIG S;  1JB7 A;  1FJG L;  1RDP D;  2IW3 A;  4F8M A;  2IPK D;  2NVQ H;  5IYD H;  2NBF A;  1H9M A;  1QNU A;  5T1I A;  1NJI C;  3N6R A;  2K5D A;  2EYL A;  2OCE A;  4GS3 A;  5FO7 B;  3H3V C;  1DJR D;  1T5X D;  4MZ9 A;  4L5S A;  3KF6 B;  3CME A;  2AWO A;  4HJ9 A;  4R8N A;  1AEX A;  1DON A;  2CQA A;  1CK1 A;  3D31 A;  2SEB D;  4DK6 C;  2X6G A;  5D14 A;  2VQF Q;  2AQ2 B;  4DK1 A;  2SOB A;  2NTS A;  2ZJP A;  4DF7 A;  5I2X A;  2F0T A;  3RR5 A;  1E7Z A;  3I7F A;  1MGS A;  5IE8 A;  1TS4 A;  4PMC A;  3GQB A;  4A3C H;  1HNW L;  3RN2 A;  4LNQ A;  4LMQ D;  5C4X B;  2KEE A;  4L8J A;  3OMC A;  4N8F A;  1S40 A;  1PLF A;  1Y1W H;  3HGB A;  1ENA A;  2HDM A;  3DM1 A;  4IN3 A;  4CJ0 B;  3NHH A;  4A3J G;  3MAQ A;  4OEM B;  4F87 A;  3HOU G;  4KY7 A;  2R93 B;  2NN6 I;  2NZH A;  3A5Z B;  4NXM L;  1EFI D;  2ZJR A;  1VMP A;  2C9O A;  4DNR B;  1MSG A;  3I4N G;  4QQB X;  1X6O A;  2K75 A;  4K0K L;  1PH6 A;  3KLS X;  4JBW A;  5AJ3 L;  1HUN A;  3NWT A;  5M3M G;  1VQ8 A;  1JJ2 A;  4QUC A;  4M1U B;  4MTN A;  4BBS G;  2VS1 A;  4R4I A;  3DEP A;  5EKL A;  2BA1 A;  5IGD A;  1O7I A;  2EIF A;  2QA4 A;  2HCC A;  1J5E Q;  1JCK B;  2F0N A;  5FO8 B;  1A2T A;  2KA7 A;  3V05 A;  3A74 A;  1CKM A;  3M4Q A;  1EZ8 A;  4X3S A;  3Q0A A;  3D0F A;  1EYC A;  3HFZ B;  4YCU A;  3BDL A;  4CDF C;  2A6H D;  2VUM H;  4IAL A;  1PFB A;  2RHS B;  5IWA L;  1UWV A;  3RN5 A;  1L1O C;  4K8J A;  4C3H B;  3LGJ A;  1EWH A;  2DUD A;  1Q90 A;  2NVT H;  1I4X A;  1CT1 D;  2NWG A;  3EIV A;  4HJA A;  1XWE A;  1WOC A;  3WOE A;  1LUZ A;  2DNE A;  2K5Q A;  1FL0 A;  4BA2 I;  1STG A;  4IPH A;  1X3P A;  1N8R C;  3BDC A;  1XYI A;  1SAP A;  4KKU A;  1ZXT A;  2F0L A;  3FHW A;  4ME5 A;  2L4N A;  1NE3 A;  3TSS A;  1SMY D;  3UDG A;  3IFD A;  1SE3 A;  3D4D A;  2KCT A;  3CCU A;  2VQF L;  2B39 A;  2L9H A;  3CC2 A;  1MI2 A;  1LT6 D;  1I50 H;  2OEO A;  1V1P B;  4JC0 A;  3KF8 B;  3J81 E;  4A75 A;  1D5Z C;  1VQ4 A;  3T56 B;  1XNR Q;  5EKI A;  3K7A B;  4K2L A;  3VYR A;  3SDZ A;  4APV A;  1L1O B;  4DAM A;  2P5Z X;  5ELN A;  1SFO H;  4XXE A;  3T1H Q;  1OXX K;  4OHJ A;  4DV1 Q;  2PQA B;  3I4M B;  2WAQ G;  5DM6 3;  4OWW B;  1V8Q A;  2A6H C;  2LSS A;  3U4Z A;  1WTH A;  3NBI A;  1K83 H;  2FMM A;  1GUN A;  1O80 A;  1BCP D;  4GNX C;  1XMO Q;  1HTP A;  5JOB A;  4O42 A;  2JSO A;  5FLX c;  2F03 A;  4DR3 Q;  4KJN A;  2EYM A;  3GV3 A;  1XMQ Q;  1L0Y B;  4R4Q A;  1WTQ A;  1D8L A;  1EQV A;  1WTO A;  5M5Y B;  5EQ0 A;  3A5U A;  2CH4 W;  2ENB A;  3NP8 A;  1WCM G;  4U68 A;  4FXD A;  2HHH Q;  4N8X 1;  3W5O A;  1H9S B;  3PV0 A;  4QIW E;  3HP3 A;  1EQT A;  3GP7 A;  2SNM A;  4H7B A;  3GTQ B;  5LHY 1;  1N32 Q;  2EY6 A;  3SE0 A;  1U9R A;  1NY4 A;  4NPS A;  1IBL L;  1Z7T A;  3RNU A;  3HKZ E;  3NE5 B;  4DN4 M;  4LUV A;  2K33 A;  2FMC A;  4A3L H;  4OL7 A;  3BG3 A;  1A3T A;  4X64 L;  2RCN A;  1Q86 C;  2BA0 A;  1XPU A;  5IT9 E;  4XDX A;  4JG2 A;  4B3M Q;  4H02 A;  1IBK Q;  3AEV A;  3S15 H;  3Q6S A;  2EOT A;  1Q8I A;  2RCF A;  1E2Z A;  4KY6 A;  2JN4 A;  1PYB A;  2N88 A;  1WTR A;  3SHL A;  2JA6 H;  2OTL A;  2F0K A;  3AFP A;  2JA7 H;  3BDO A;  1DYQ A;  1HTL D;  1FGU A;  1JOR A;  4Y7N B;  1KAW A;  2OTJ A;  1GD7 A;  4HMI A;  5H1S E;  4WJ4 A;  1PZK D;  1ENF A;  4I7A A;  3OYY A;  1XNR L;  1S5B D;  4DR5 Q;  3DHQ A;  5EPK A;  5C0X H;  3C1E A;  5JJL A;  4HAE A;  2EYO A;  4LFC Q;  1IZ6 A;  2F0F A;  1CKN A;  2PZT A;  4HIK A;  2IHF A;  4DXF A;  1WTW A;  2UU9 Q;  4A3B B;  2F0G A;  2XNA C;  1KRS A;  3KDF A;  5M5X H;  2FFK B;  2E2H B;  3NXW A;  2J4X A;  3T1H L;  1JMC A;  3I73 A;  1SR3 A;  5IYB G;  2QGQ A;  4DV1 L;  4OGQ C;  5DNF A;  2JA8 H;  1STA A;  1EOV A;  1XX8 A;  4J15 A;  4IZ8 A;  4ULL A;  3K81 C;  2JA5 G;  1BUV T;  1LO5 D;  4A3K B;  1AE2 A;  3GTM B;  1X55 A;  1QB5 D;  1XMO L;  3OIQ A;  1UNS A;  4MHE A;  3NUC A;  2MUY A;  4IJL A;  4DR3 L;  2NTT A;  2B2W C;  3FPP A;  1CUK A;  1XMQ L;  5GAH C;  3TS0 A;  5JAV A;  1OXV A;  4A4I A;  2F4V Q;  1ZKO A;  5K36 G;  4A3M G;  3CCQ A;  5E4W C;  5G3L F;  3VR5 A;  5J39 A;  1ICF B;  2PYK A;  1EQQ A;  1B44 D;  4HN7 A;  2RDF A;  1Y14 B;  3ZJY C;  2E75 C;  2VXW A;  5DM7 3;  5E4X A;  4R8I A;  1N32 L;  3R93 A;  2K5W A;  3OWE B;  3MHB A;  4KHP L;  2EY1 A;  3FDT A;  5C44 H;  1VQN A;  3PO2 H;  3NTH A;  3NK9 A;  4JV5 Q;  3NSW A;  1MJE A;  4LF4 Q;  2RDG A;  4YWK A;  2E2I B;  4G57 A;  3E6Z X;  2TSS A;  3A56 A;  3NTI A;  3PO3 H;  3OPO A;  4B3M L;  1NNX A;  1IBK L;  4NDX A;  3ONA B;  2N55 A;  3CCM A;  4YWL A;  1TWC H;  5BN5 A;  4JI6 Q;  3K5L A;  3GTP B;  1TWG H;  1PMR A;  1G8Z D;  1TWA H;  3BU2 A;  4GKJ Q;  1XNQ Q;  1EY9 A;  3I8Z A;  3PCO B;  4LUZ A;  4JYA Q;  4PMB A;  2OWO A;  1K0R A;  3GTO B;  3MVV A;  3F2U A;  1LV9 A;  3HOZ H;  4A3J B;  3S2H B;  1UE1 A;  3OMG A;  3HOU B;  3F2B A;  1Y1V G;  4LFC L;  1M8A A;  2C35 B;  1S5C D;  4C3J H;  2Q8T A;  4ODG A;  4JBK A;  1ASY A;  3I4N B;  2UU9 L;  1I4G A;  5D3I B;  4F88 A;  2HQL A;  5M5W H;  3NQI A;  5M3M B;  2BOS A;  2D5D A;  3WOF A;  1C8C A;  4BY7 G;  1I5F A;  1VQH A;  2YTY A;  3URY A;  3A54 A;  2A68 C;  3CPF A;  4JOI C;  4BBS B;  4JI4 Q;  2JJQ A;  4CJ1 B;  3I91 A;  4POG A;  3T13 A;  1OXS C;  3AQQ A;  4FNF A;  5JEA J;  1NR4 A;  3K5O A;  2IJ0 A;  1JT8 A;  1YNN C;  1K8M A;  1CHQ D;  2K7V A;  3JAM E;  3QG1 A;  5ELD A;  3H0G G;  2Y0S G;  4WJ3 M;  4A3G H;  4XTC S;  3ZYY X;  3K7U C;  4X6A H;  4EGV A;  2F0E A;  5IT9 L;  1G6Z A;  4KD4 A;  1S4Z A;  3LWE A;  1CQF A;  3F2C A;  1TXY A;  1P16 A;  1C7Y A;  3RLN A;  1L2F A;  4Q0F A;  4C1N K;  3K0Y A;  2PW5 A;  2IX0 A;  1IYJ B;  2L15 A;  1MHW C;  4P73 A;  2YU9 B;  1I94 L;  3NTK A;  4GOP A;  4ZLT F;  1K8A C;  1LTR D;  3K5M A;  3V2T A;  3AU7 A;  3W3A A;  2PMZ E;  3TRZ A;  5JVG 3;  2PPB C;  1U4M A;  4MTK A;  1PZJ D;  2RSO A;  3CD6 A;  4LF4 L;  2F3W A;  3I4O A;  3VA7 A;  2XIW A;  3HOV H;  2KCM A;  2B2Y A;  3SVM A;  1EZ6 A;  5EPL A;  3TEH B;  5GAE C;  1VQP A;  1CI3 M;  5IP9 G;  3S1M H;  1Q1B A;  2VZA A;  2XSC A;  3RLF A;  1JR0 D;  4JI6 L;  2BCO A;  3U4V A;  2LFN A;  5KIX A;  4GLX A;  1JOK A;  2QEJ C;  1MIU A;  1O7L A;  1H9K A;  3D3R A;  5LL6 X;  4JYA L;  3QWN A;  5KND A;  1W6J A;  5T1G A;  4OXP A;  5C4H A;  3Q24 A;  4RWS C;  1F9R A;  1PTO C;  3HOW H;  1F9Q A;  4KHV A;  2K5V A;  1TS2 A;  3T1Y Q;  1YJN A;  4HCE A;  2XRS D;  4DNI A;  1H9J A;  2QCP X;  3S2D H;  1KLU D;  4MNO A;  1SSO A;  3CQZ B;  1SNC A;  2L5T A;  2WAQ B;  3M4Y A;  1CQV A;  3SK8 A;  1EL0 A;  1KAB A;  4IUP A;  3UE1 A;  1A15 A;  1QUQ B;  3TQY A;  4X65 Q;  1J8I A;  3P7J A;  3C1F A;  4JI4 L;  4XQJ A;  4XYO A;  1E0B A;  1N36 Q;  1KAA A;  3AFQ A;  4YIJ A;  2R92 G;  4YY3 Q;  3EVQ A;  2MGS A;  1WCM B;  3FRP B;  2VB3 X;  1CHP D;  3TP6 A;  2OF1 A;  1PTO B;  4UP9 A;  5C4X H;  2ZM6 Q;  1HZA A;  5C3E G;  1VMC A;  4AIM A;  3SK6 A;  1B4O A;  4B9X A;  3MZ5 A;  2R93 H;  2N78 A;  5I9O A;  1TR5 A;  2I07 B;  3KLR A;  3H3V H;  4BA1 I;  2N49 A;  3MXU A;  1UUP A;  2RSN A;  4BY1 G;  4ZKC B;  2WB1 G;  1T5E A;  3MXG A;  2MJ8 A;  5M3F G;  4P74 A;  4NW2 A;  5CV6 A;  1D2B A;  1X3Q A;  1ILQ A;  3OW2 A;  1EIG A;  2IHE A;  2QDL A;  2A8V A;  1BVS A;  3BYY B;  4KMU C;  1PH8 A;  3GTG B;  5CGK A;  4K0K Q;  2WIN B;  2UXD Q;  4RCO A;  1EY8 A;  1M1K C;  1X65 A;  2RDH A;  3KF6 A;  2QW7 A;  1TII D;  1C9O A;  5HGQ A;  3K5N A;  3JAM L;  1Q7Y C;  4P71 A;  2AWN A;  1Z47 A;  2FHT A;  1QG7 A;  1YJW A;  3T1Y L;  3F8T A;  4C3H H;  1HRJ A;  4LK1 C;  4S3S A;  1N33 L;  5ELC A;  5IGF A;  1LT4 D;  4PNY A;  2F0S A;  3Q23 A;  3EBE A;  5C4Z A;  5A35 A;  3QOL A;  1X54 A;  3E0J A;  4UDU C;  4X65 L;  2JA5 B;  3R3O A;  1O7Y A;  3S16 H;  2E76 C;  1YI2 A;  2R7D A;  1Q12 A;  2CVR A;  1TQO A;  1N36 L;  1RHP A;  4RFB A;  3BVZ A;  4YY3 L;  1XPO A;  2KED A;  4A3M B;  3CCL A;  1W3S A;  2L11 A;  2EY2 A;  3RZD B;  1JE5 A;  4DV2 Q;  2XRQ D;  3R8B A;  2XWB B;  2XWJ B;  4LF9 Q;  3GTK B;  1GOZ A;  3K7A H;  2ZM6 L;  2Q2H A;  2KCN A;  4JI8 Q;  1D5M C;  1GO3 E;  2R3Z A;  5CR3 A;  1PVO A;  1SYG A;  4ME3 A;  4A3I G;  5IYC G;  1S5D D;  3D6C A;  1C48 A;  3I4M H;  1H95 A;  1PTO F;  1VQM A;  3UDF A;  2F52 A;  2D62 A;  5C3W A;  1C0A A;  1EU4 A;  2KEN A;  1QE6 A;  2EJG C;  3TP8 A;  2VQE Q;  3SK4 A;  4BBR G;  3QJY A;  1BDO A;  4JI7 Q;  4DAY B;  2KEC A;  1SYD A;  1Y8O B;  5NUC A;  2Z9H A;  2KVM A;  1VQG A;  2FXQ A;  4UHV A;  4V0B A;  2EPB A;  5M5Y H;  2UXD L;  3CXC A;  1ESF A;  1TWH B;  1Y1V B;  1MSH A;  1DOK A;  4A3D G;  5LMN W;  1VQ6 A;  5IIF A;  4QUF A;  2VB2 X;  1CFM A;  4OWT B;  3GTQ H;  2OQ0 A;  3PQI A;  1WD1 A;  4BY7 B;  3H6M A;  4N9T A;  2BH2 A;  5CV7 A;  2L0C A;  5IP7 G;  1IBM Q;  1CSP A;  1JOQ A;  1V1P A;  3KF8 A;  3R2I A;  4PZ7 A;  2AKW B;  4O0A A;  4FF4 A;  3PIO 3;  2D0P A;  3SXH A;  2WAC A;  3D4W A;  2OQK A;  1NTG A;  4DUY Q;  1ASZ A;  3H0G B;  2Y0S B;  5JEA H;  1L1O A;  3NPP A;  1V1Q A;  1A8V A;  3J80 E;  3F1Z A;  3R2T A;  5FKA C;  4HIO A;  4L5Q A;  1IBL Q;  1FGB D;  1HR0 W;  2NVY B;  3X3M A;  2K14 A;  3J80 c;  1IW7 D;  4Y7N H;  2JQO A;  3JAM i;  4IFD G;  3GV6 A;  4X64 Q;  2PQA A;  3K0X A;  3MFG A;  3NWS A;  1Z6H A;  2PNH A;  4DV2 L;  1Q82 C;  1A62 A;  1DXM A;  1RTO A;  4WFN 3;  4LF9 L;  4PQX A;  4ZUJ A;  4JI8 L;  1BBX C;  3ICE A;  1SYC A;  5CV4 A;  1F77 A;  1EIH A;  4LF5 L;  2QF7 A;  4DPG A;  4C3I G;  4DV5 Q;  1JB3 A;  1LLR D;  1ML0 D;  2ATW A;  2K5H A;  2E2H H;  1IXR A;  3U50 C;  3PF4 A;  1TKW B;  1H9S A;  2E2J B;  4UY8 C;  4DK0 A;  1PA6 A;  2EXD A;  2F0U A;  2M2L A;  2RHQ B;  4BS9 A;  3J7A F;  4A3K H;  3GTM H;  4AQY L;  4I65 A;  2AQ3 B;  2VQE L;  4RHS A;  4ZK9 B;  3E9I A;  3FEW X;  1EY7 A;  4JI7 L;  4EVO A;  2BDO A;  2GVB A;  3UDI A;  5C44 G;  3S1R B;  3W2D A;  2QKI C;  4KJO A;  1HJP A;  4LWC A;  4AYB E;  3MEF A;  4GNX A;  2J0T D;  5FLX E;  3H3V I;  1GUS A;  2HIV A;  1QVF A;  4XT3 B;  1XPR A;  3HOY G;  2R7F A;  2R6G A;  4L5T A;  4YCW A;  4A3F G;  1O7Z A;  4K6D A;  4DR2 Q;  1LT3 D;  1Q1E A;  1LAB A;  4JI5 Q;  1SNP A;  1SRO A;  2X69 A;  1VQ5 A;  1IBM L;  1LYL A;  1GVP A;  4CDC C;  2G5D A;  3C2P A;  2LS0 1;  5C3X A;  2R92 B;  1PZI D;  1ROD A;  4OWX B;  1SMY C;  4P2C B;  4DUY L;  2O4X A;  1CZW A;  5FJ8 G;  2HD3 A;  4B3S L; 
#chains in the Genus database with same CATH homology
 5DEH A;  2PZW A;  4LAA A;  1UAP A;  1TY0 A;  2EDG A;  2ZXO A;  2Z1C A;  3GTL B;  1RKN A;  3M7G A;  4UAI A;  1LTB D;  4CHT B;  5C3E B;  2H1E A;  3N52 A;  4J6H A;  2E2D C;  1TS5 A;  1QOH A;  4QCL A;  1EY4 A;  1F9P A;  2NZ1 D;  3WDN A;  4IUR A;  2CW0 D;  1PRT D;  5EGT A;  2D9U A;  4BY1 B;  1G2T A;  2WB1 B;  5M3F B;  3NQT A;  5M9O A;  1BCP C;  1CTM A;  3VR6 A;  2B2T C;  1I3Q B;  3FPU B;  1OXU A;  2JEA I;  4NKL A;  4DAP A;  2NN6 G;  3I72 A;  1HCZ A;  1RF2 D;  4K14 A;  1PFN A;  2L55 A;  1FYC A;  3M4O B;  4G7H C;  1LTG D;  3J80 L;  4PMW A;  1EEI D;  5D65 A;  2EJM A;  2G9H D;  5CYU A;  3VA5 A;  1DOM A;  5K5P A;  1EU3 A;  3S9W A;  3K6O A;  5CMD A;  3T51 B;  1JIC A;  3PUX A;  3HZX A;  1SBB B;  3DXJ C;  4HCS A;  3K59 A;  1STY A;  4F7X A;  1PFM A;  1KDC A;  2HUG A;  3VR4 A;  1BCP B;  1SE2 A;  2E74 C;  5HGT A;  1L0X B;  1H9R A;  1B50 A;  5CV8 A;  3PIP 3;  4EQP A;  1B2T A;  3TBI B;  2CW0 C;  1PRT C;  3SR1 A;  3S17 B;  1HFG A;  1TWF B;  4K5W A;  2B2V A;  1JC7 A;  4R9W A;  4G7O C;  1BXT A;  5COR A;  4HR7 B;  2A74 C;  1STN A;  4H44 C;  4KK7 A;  2ICI A;  2EYP A;  4H13 C;  3T4A C;  4A3I B;  1NSN S;  5COY A;  2DY7 A;  4N9P A;  3KBX A;  2KUM A;  1MD2 D;  1NUC A;  5FLX L;  2KJX A;  1U4R A;  5I4D A;  5DAU A;  1HA5 A;  4DU9 A;  3PUY A;  3PMF A;  4BBR B;  3KLS A;  4X3T A;  3DEO A;  2NUC A;  1PRT B;  3LWU A;  4HSV A;  4MIU A;  3GTJ B;  1B9N A;  4EQN A;  1SYE A;  4RAU C;  3A7A B;  4FP5 D;  1EY5 A;  4A3D B;  3VR3 A;  1I4P A;  1I4H A;  5C6A A;  1F2Y A;  1PYW D;  1SXT A;  1PTO H;  2BE5 D;  3DWQ A;  3S15 B;  1TS3 A;  2ICE C;  5ELB A;  1I6V C;  4KKT A;  5HUR A;  3H94 A;  1ONL A;  1I4Q A;  3FVQ A;  1JOO A;  4RGN A;  1RD9 D;  2FJ2 A;  2WV6 D;  4OO1 G;  4NMZ A;  2K01 A;  2LMC B;  1KLG D;  1VDZ A;  2SNS A;  4WOR A;  2RVL A;  4DA2 A;  3EA6 A;  3MA2 B;  1SNM A;  2EYH A;  4IUT A;  1RJT A;  1FNW A;  3CRK C;  2L12 A;  1BCP F;  1TT2 A;  3K57 A;  3D6W A;  1D5X C;  2HQE A;  2Z4I A;  4C3I B;  4ZYS A;  5IGG A;  4KKS A;  1HPC A;  1LAC A;  2WII B;  2O2L D;  3FMC A;  2NYZ D;  1SJE D;  1AP0 A;  1HQM C;  2HDL A;  2NVX B;  2KQ3 A;  2JXM B;  2BE5 C;  4FF1 A;  3MWY W;  2R61 A;  1GUW A;  3DWP A;  2GA4 B;  4RHR A;  1QIL A;  4XT1 B;  2B8G A;  3T16 A;  1LTI D;  3K58 A;  1CZG A;  1WVL A;  3HEJ A;  4ZUI A;  5C44 B;  5K36 H;  4IUN A;  4BWG B;  3C3L A;  1F2M A;  5JPM C;  3HOY B;  1XXG A;  4A3F B;  3RZO B;  1W6K A;  3HS0 C;  4DAV A;  2K05 A;  4XYQ A;  1PRT F;  1A2U A;  1HQR D;  1ET6 A;  3DUZ A;  1KNA A;  2Z4H A;  4I7Z C;  1IHZ A;  3L7Z C;  4KN4 C;  1STB A;  2KOL A;  5ISR A;  3OHX C;  1GUG A;  3H91 A;  1PXU A;  1QJO A;  2F0W A;  3P20 A;  3QOJ A;  3S1N B;  4RKL A;  1JWU D;  5M5W B;  4IFD I;  3TP7 A;  3A7L A;  2JEB I;  1E2W A;  3BVM A;  3E5S A;  4U67 3;  1TU2 B;  1ZEQ X;  5I2Y A;  3QO2 A;  4LJZ C;  1SNQ A;  1S5F D;  3RMH A;  1QNK A;  5LL6 S;  5KNC A;  1TVX A;  3G6J B;  4QIW B;  3PUV A;  2F0M A;  2M9V A;  1SND A;  3PUW A;  4J8Q A;  2K04 A;  4FF2 A;  3HKZ B;  4ZKB B;  5KGU A;  3M85 A;  2B2U C;  3PUZ A;  4X3U A;  1GUO A;  3L9A X;  2DN8 A;  4QMG A;  2A6E D;  2RBM A;  4B9W A;  4IFD J;  5I6Y A;  1ZYR D;  3ND9 A;  1I6H B;  1J9O A;  2YYZ A;  1O78 A;  3KUP A;  4NP5 A;  2SDF A;  3QB3 A;  1HFN A;  4RGO S;  4QF4 A;  1SE4 A;  3IFT A;  2A73 B;  1KTK A;  3U9O A;  1NCV A;  2IX3 A;  3DMU A;  4CKE A;  4DAY A;  4HMJ A;  1F2L A;  4WJW A;  1IYU A;  1VF5 C;  1GHJ A;  1ENC A;  5BN4 A;  3LX0 A;  2O5J C;  4KTA A;  3QIA A;  3ITP A;  1R4P B;  1IKM A;  2ZXR A;  3VYU A;  3AMU A;  1F9S A;  5JVH 3;  3OOC A;  1WTX A;  3S2D B;  1GJX A;  4HED A;  1QWY A;  4HSP A;  1AW7 A;  4DNT B;  3J7Y W;  1BF4 A;  4C56 C;  2A6E C;  1AFP A;  4KI0 A;  1II3 A;  1ZYR C;  1EWC A;  1LT5 D;  2EXZ A;  5CBE E;  3S1Q B;  2M00 A;  4O1N A;  2R7Z B;  2F0P A;  1OXT A;  4Q5V A;  2EE1 A;  4RGM A;  1BOS A;  2A69 D;  1FNU A;  1JQY D;  2PW7 A;  4FXK C;  5ELE A;  1D1I A;  2WP8 J;  1Y69 U;  5G3L D;  1IYV A;  5IGE A;  1CM9 A;  3S14 B;  1F2Z A;  1GUT A;  2V4D A;  3BYT B;  4K5V A;  4M8A A;  5IGB A;  1EY6 A;  5A2Q E;  5EJW A;  2F4I A;  2KHS A;  4OIJ A;  4RKB A;  3EFX D;  2K1B A;  1DOL A;  3A8I E;  3CU7 A;  1K8O A;  2Q8I B;  2IWH A;  5C0X G;  5KYI A;  4C1N I;  4EQO A;  5C4J B;  3VYT A;  2Z8L A;  2F0I A;  1HA6 A;  1JWM D;  1MBY A;  1SJH D;  1S5E D;  3HG9 A;  4C2M B;  2VNU D;  1D6E C;  1GHK A;  2B63 B;  1NR2 A;  5JPN C;  1BQQ T;  1ET9 A;  2A69 C;  3MEH A;  4IQZ A;  3M3Y B;  4CJ2 C;  1BNZ A;  2PZU A;  1VF7 A;  2FIN B;  4FO2 A;  4JK1 C;  1KNE A;  3LNN A;  4V19 0;  2ZT9 C;  3S16 B;  2K6A A;  2ID0 A;  3HOX B;  5JJZ A;  3J7A V;  2IT1 A;  3ERO A;  1FNV A;  2X6L A;  2NVQ B;  2PQE A;  4KN7 C;  1U4L A;  3A8K E;  2XN9 C;  2PMZ B;  3UI2 A;  4DXG A;  2EJF C;  1AZP A;  3HRZ C;  1IW7 C;  4ZRZ A;  1QCB D;  4K5X A;  1U4P A;  4X3K A;  5KNB A;  2G9D A;  2MP1 A;  4H0L C;  2QDB A;  1Y1W B;  2EYF A;  5FO9 B;  1FR3 A;  1B9M A;  4IUQ A;  2F0D A;  3RD4 A;  2LY7 A;  1SYB A;  4OO1 I;  2F0H A;  4CBV A;  4C3J G;  1B3A A;  1RTN A;  2H4O A;  4J1M A;  4WRD A;  2EY5 A;  1BR9 A;  1A3V A;  1WD0 A;  1LTT D;  1DCZ A;  3CKI B;  2I46 A;  2F0O A;  4FVM A;  1G29 1;  1KDA A;  5ELF A;  2JYO A;  4KHZ A;  2Q8R E;  4RH6 A;  3V96 A;  1LTA D;  2B2T A;  3I90 A;  2A5H A;  4FYD A;  3I70 A;  3VR2 A;  2VUM B;  5EPJ A;  2K03 A;  1DD2 A;  2LKV A;  4TSS A;  2F3V A;  3RUZ A;  2D2C C;  4HTH A;  2NVT B;  5A2Q L;  2AUK A;  4ZAI A;  1Y8N B;  5E3F A;  4ABN A;  3O13 A;  5EBC A;  3P75 A;  2B2W A;  5CC4 A;  4IFD H;  4FF3 A;  3AB9 A;  2EVB A;  1I50 B;  4PV1 C;  3KK7 A;  2RKS A;  3KBG A;  3SK5 A;  3ERQ A;  5C5M A;  1DM0 B;  3TME A;  1STH A;  2AUJ D;  4IUU A;  1RCV D;  2PO4 A;  1SFO B;  2XVS A;  1LTS D;  4GZY C;  3OWF A;  4E6I A;  1G91 A;  3G7L A;  2IL8 A;  4K2K A;  5AFW A;  5C5L A;  2A68 D;  2TMP A;  3TP5 A;  2KCC A;  3MTS A;  1K83 B;  3OSO A;  5D3D A;  1BO0 A;  2WKD A;  5FOB B;  3VYS A;  1CA6 A;  3C46 A;  2B8F A;  4MN3 A;  1M4V A;  1YNN D;  3J81 L;  2F0J A;  1OO9 B;  1HHV A;  1D1K A;  4K8I A;  4CKC A;  2OT2 A;  5CV5 A;  2B2V C;  1SNO A;  3NBH A;  2F1M A;  2J7Z A;  4ILW A;  1PDQ A;  1HUM A;  2QIL A;  3SEB A;  1CA5 A;  3TDQ A;  4L63 B;  2PCF B;  3EQL C;  4DGZ A;  1EYA A;  1A3U A;  1B1Z A;  1GXD C;  5I9P A;  5KYL A;  4IUV A;  1FD7 D;  4DFA A;  2EYJ A;  2MHV A;  3DWA A;  2JA6 B;  1WTV A;  1V43 A;  2WKC A;  4B08 A;  3MC0 B;  2JA7 B;  1ILP A;  5F2D A;  2DNC A;  3ND8 A;  4KD3 A;  3MXP A;  1HXY D;  3CHB D;  5EBD A;  1VCI A;  1STE A;  1EEF D;  1PTO D;  4QB4 A;  5IGC A;  1JE4 A;  2HCI A;  5M5X B;  1E2V A;  3IAY A;  4C3H G;  4A3E B;  2DY8 A;  3EJI A;  4KV6 A;  3I4L A;  2JA8 B;  2K32 A;  3BS1 A;  2C5C A;  3L3O C;  3A8J E;  1Y8P B;  2NN6 H;  3IKJ A;  3OW7 A;  1ICW A;  2JE6 I;  1X32 A;  5FK9 C;  4XQQ A;  5KEE A;  3A55 A;  3D4R A;  4KY5 A;  1R4Q B;  1G2S A;  4RA8 A;  3Q22 A;  2F0Q A;  1UEA B;  3TN2 A;  2EZV A;  3D8G A;  2B2Y C;  1IKL A;  3PO2 B;  4XQN A;  5BN3 A;  3BVG A;  3FKI B;  2IX1 A;  5EKK A;  3PO3 B;  2MPM A;  1EYD A;  2CHB D;  4A93 B;  4ID6 A;  4TKO B;  1TWC B;  1TY2 A;  2PNR C;  1TWG B;  1TWA B;  4RCN A;  5J1Z A;  3GO5 A;  2BDN A;  3I3C A;  3X3N A;  1KDB A;  1NAP A;  3HOZ B;  4AYB B;  1B53 A;  1Q3L A;  4C3J B;  5C0X I;  2K28 A;  1A6X A;  3M7N A;  5CV9 A;  5TSS A;  4ZQ3 A;  1V1O A;  1R9T B;  1XTC D;  1YNJ D;  1IL8 A;  3MFY A;  4OIK A;  5JEA G;  1WTP A;  4A3G B;  4G7Z C;  3MXN A;  1SYF A;  2B2U A;  4Z9C B;  3U9S A;  4K6L A;  4L6T B;  5C0X J;  1JWS D;  1SEB D;  3P1H A;  2L1B A;  4OO1 H;  2AQ1 B;  5IOD A;  1C4Q A;  3H09 A;  5E1F A;  5I6W A;  2RQX A;  1AZQ A;  3T53 B;  4G4K A;  3OIP A;  4RGT A;  3HOV B;  4CGY B;  2O5I C;  5KRU A;  2ZXP A;  3TZU A;  3CRL C;  4TQU S;  3S1M B;  4TRD A;  2JP1 A;  5J22 A;  4CKB A;  5IOC A;  2NB0 A;  5CBA E;  1SDF A;  1DZ1 A;  3GD7 A;  1EY0 A;  1AN8 A;  1ESR A;  2F0V A;  3IL8 A;  2RA4 A;  3HOW B;  3BZD B;  1YNJ C;  1I4R A;  4FXG C;  3TZD A;  2OXP A;  1EOT A;  4XIG S;  1RDP D;  2IW3 A;  4F8M A;  2IPK D;  2NBF A;  1H9M A;  1QNU A;  5T1I A;  3N6R A;  2K5D A;  2EYL A;  5FO7 B;  3H3V C;  1DJR D;  1T5X D;  2AWO A;  4R8N A;  1AEX A;  1DON A;  2CQA A;  1CK1 A;  3D31 A;  2SEB D;  2X6G A;  5D14 A;  2AQ2 B;  4DK1 A;  2SOB A;  2NTS A;  4DF7 A;  5I2X A;  2F0T A;  1MGS A;  1TS4 A;  4PMC A;  3GQB A;  4LMQ D;  5C4X B;  2KEE A;  4L8J A;  3OMC A;  1PLF A;  3HGB A;  1ENA A;  2HDM A;  3DM1 A;  4IN3 A;  4CJ0 B;  3NHH A;  3MAQ A;  4F87 A;  2R93 B;  4KY7 A;  2NN6 I;  1EFI D;  1VMP A;  2C9O A;  4DNR B;  1MSG A;  3KLS X;  4JBW A;  1HUN A;  3NWT A;  4QUC A;  4M1U B;  3DEP A;  5EKL A;  2BA1 A;  5IGD A;  2HCC A;  1JCK B;  2F0N A;  5FO8 B;  1A2T A;  2KA7 A;  3V05 A;  1EZ8 A;  4X3S A;  3Q0A A;  1EYC A;  3BDL A;  2A6H D;  4IAL A;  1PFB A;  4K8J A;  4C3H B;  1EWH A;  1Q90 A;  1I4X A;  1CT1 D;  2NWG A;  1XWE A;  3WOE A;  2DNE A;  2K5Q A;  4BA2 I;  1STG A;  1X3P A;  3BDC A;  1XYI A;  1SAP A;  4KKU A;  1ZXT A;  2F0L A;  4ME5 A;  2L4N A;  3TSS A;  1SMY D;  3IFD A;  1SE3 A;  3D4D A;  2B39 A;  2L9H A;  1MI2 A;  1LT6 D;  2OEO A;  1V1P B;  3J81 E;  1D5Z C;  3T56 B;  5EKI A;  3K7A B;  4K2L A;  3VYR A;  3SDZ A;  4XXE A;  1OXX K;  4OHJ A;  3I4M B;  5DM6 3;  1V8Q A;  2A6H C;  3NBI A;  2FMM A;  1GUN A;  1O80 A;  1BCP D;  1HTP A;  5JOB A;  4O42 A;  2JSO A;  2F03 A;  4KJN A;  2EYM A;  3GV3 A;  1L0Y B;  1WTQ A;  1EQV A;  1WTO A;  5M5Y B;  5EQ0 A;  2ENB A;  3NP8 A;  4U68 A;  4FXD A;  1H9S B;  3PV0 A;  3HP3 A;  1EQT A;  3GP7 A;  2SNM A;  4H7B A;  3GTQ B;  5LHY 1;  2EY6 A;  3SE0 A;  1U9R A;  1Z7T A;  3NE5 B;  4DN4 M;  2K33 A;  2FMC A;  4OL7 A;  3BG3 A;  1A3T A;  2BA0 A;  5IT9 E;  4XDX A;  3Q6S A;  2EOT A;  1Q8I A;  1E2Z A;  4KY6 A;  2N88 A;  1WTR A;  3SHL A;  2F0K A;  3BDO A;  1DYQ A;  1HTL D;  1JOR A;  4Y7N B;  4HMI A;  1PZK D;  1ENF A;  1S5B D;  3DHQ A;  5EPK A;  5C0X H;  3C1E A;  4HAE A;  2EYO A;  2F0F A;  2PZT A;  4DXF A;  1WTW A;  4A3B B;  2F0G A;  2XNA C;  2FFK B;  2E2H B;  3NXW A;  2J4X A;  3I73 A;  4OGQ C;  5DNF A;  1STA A;  1XX8 A;  4IZ8 A;  4ULL A;  1BUV T;  1LO5 D;  4A3K B;  3GTM B;  1QB5 D;  3OIQ A;  1UNS A;  4MHE A;  3NUC A;  2MUY A;  2NTT A;  2B2W C;  3FPP A;  5JAV A;  1OXV A;  1ZKO A;  5K36 G;  5E4W C;  5G3L F;  3VR5 A;  5J39 A;  2PYK A;  1B44 D;  4HN7 A;  2RDF A;  2E75 C;  2VXW A;  5DM7 3;  5E4X A;  4R8I A;  3R93 A;  2K5W A;  3OWE B;  3MHB A;  2EY1 A;  3FDT A;  3NTH A;  3NK9 A;  3NSW A;  2RDG A;  2E2I B;  4G57 A;  3E6Z X;  2TSS A;  3A56 A;  3NTI A;  3OPO A;  4NDX A;  3ONA B;  2N55 A;  5BN5 A;  3K5L A;  3GTP B;  1PMR A;  1G8Z D;  1EY9 A;  3I8Z A;  4PMB A;  3GTO B;  3MVV A;  3F2U A;  1LV9 A;  4A3J B;  3S2H B;  3OMG A;  3HOU B;  1M8A A;  1S5C D;  2Q8T A;  4ODG A;  3I4N B;  1I4G A;  5D3I B;  4F88 A;  3NQI A;  5M3M B;  2BOS A;  2D5D A;  3WOF A;  1C8C A;  3URY A;  3A54 A;  2A68 C;  4BBS B;  4CJ1 B;  3I91 A;  3T13 A;  1OXS C;  4FNF A;  5JEA J;  1NR4 A;  3K5O A;  2IJ0 A;  1YNN C;  1K8M A;  1CHQ D;  2K7V A;  3JAM E;  3QG1 A;  5ELD A;  4XTC S;  3ZYY X;  4EGV A;  2F0E A;  5IT9 L;  1G6Z A;  4KD4 A;  1S4Z A;  3LWE A;  1CQF A;  4Q0F A;  4C1N K;  3K0Y A;  2PW5 A;  2IX0 A;  2YU9 B;  3NTK A;  4ZLT F;  1LTR D;  3K5M A;  3V2T A;  3AU7 A;  3W3A A;  5JVG 3;  2PPB C;  1U4M A;  1PZJ D;  2RSO A;  2F3W A;  3VA7 A;  2XIW A;  2B2Y A;  3SVM A;  1EZ6 A;  5EPL A;  1CI3 M;  1Q1B A;  2XSC A;  3RLF A;  1JR0 D;  2BCO A;  5KIX A;  2LFN A;  1JOK A;  2QEJ C;  1O7L A;  1H9K A;  3D3R A;  5LL6 X;  3QWN A;  5KND A;  1W6J A;  5T1G A;  5C4H A;  3Q24 A;  4RWS C;  1F9R A;  1PTO C;  1F9Q A;  4KHV A;  1TS2 A;  4HCE A;  2XRS D;  1H9J A;  2QCP X;  1KLU D;  1SSO A;  3CQZ B;  1SNC A;  2L5T A;  2WAQ B;  3M4Y A;  1CQV A;  3SK8 A;  1EL0 A;  1KAB A;  4IUP A;  1A15 A;  1J8I A;  3P7J A;  3C1F A;  4XQJ A;  4XYO A;  1E0B A;  1KAA A;  4YIJ A;  3EVQ A;  2MGS A;  1WCM B;  3FRP B;  2VB3 X;  1CHP D;  3TP6 A;  2OF1 A;  1PTO B;  1VMC A;  3SK6 A;  1B4O A;  4B9X A;  3MZ5 A;  5I9O A;  1TR5 A;  2I07 B;  3KLR A;  4BA1 I;  3MXU A;  1UUP A;  2RSN A;  4ZKC B;  1T5E A;  3MXG A;  2MJ8 A;  4NW2 A;  5CV6 A;  1D2B A;  1X3Q A;  1ILQ A;  1EIG A;  3BYY B;  4KMU C;  3GTG B;  5CGK A;  2WIN B;  4RCO A;  1EY8 A;  2RDH A;  1TII D;  3K5N A;  3JAM L;  2AWN A;  1Z47 A;  2FHT A;  1QG7 A;  1HRJ A;  4LK1 C;  4S3S A;  5ELC A;  5IGF A;  4PNY A;  1LT4 D;  2F0S A;  3Q23 A;  5C4Z A;  5A35 A;  3QOL A;  4UDU C;  3E0J A;  2JA5 B;  3R3O A;  1O7Y A;  2E76 C;  1Q12 A;  2CVR A;  1TQO A;  1RHP A;  4RFB A;  3BVZ A;  2KED A;  4A3M B;  2L11 A;  2EY2 A;  3RZD B;  2XRQ D;  3R8B A;  2XWB B;  2XWJ B;  3GTK B;  1GOZ A;  2KCN A;  1D5M C;  2R3Z A;  5CR3 A;  1SYG A;  1S5D D;  3D6C A;  1C48 A;  1PTO F;  2D62 A;  5C3W A;  1EU4 A;  3TP8 A;  1QE6 A;  2EJG C;  3SK4 A;  3QJY A;  1BDO A;  2KEC A;  1SYD A;  1Y8O B;  5NUC A;  2KVM A;  4V0B A;  2EPB A;  1ESF A;  1TWH B;  1Y1V B;  1MSH A;  1DOK A;  5IIF A;  4QUF A;  2VB2 X;  1CFM A;  1WD1 A;  4BY7 B;  3H6M A;  4N9T A;  5CV7 A;  2L0C A;  1JOQ A;  1V1P A;  3KF8 A;  3R2I A;  4FF4 A;  3PIO 3;  3SXH A;  2WAC A;  3D4W A;  3H0G B;  2Y0S B;  5JEA H;  3NPP A;  3J80 E;  3R2T A;  5FKA C;  1FGB D;  2NVY B;  3X3M A;  1IW7 D;  4IFD G;  3GV6 A;  3MFG A;  3NWS A;  1Z6H A;  1DXM A;  1RTO A;  4WFN 3;  4PQX A;  4ZUJ A;  1BBX C;  1SYC A;  5CV4 A;  1F77 A;  1EIH A;  2QF7 A;  4C3I G;  1JB3 A;  1LLR D;  1ML0 D;  1TKW B;  1H9S A;  2E2J B;  4DK0 A;  2F0U A;  2M2L A;  4BS9 A;  3J7A F;  4I65 A;  2AQ3 B;  4RHS A;  4ZK9 B;  3FEW X;  1EY7 A;  4EVO A;  2BDO A;  3S1R B;  3W2D A;  2QKI C;  4KJO A;  2J0T D;  5FLX E;  1GUS A;  4XT3 B;  2R6G A;  1O7Z A;  4K6D A;  1LT3 D;  1Q1E A;  1LAB A;  1SNP A;  2X69 A;  3C2P A;  2LS0 1;  5C3X A;  2R92 B;  1PZI D;  1ROD A;  1SMY C;  4P2C B;  2O4X A;  1CZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...