2K28A

Solution nmr structure of the chromo domain of the chromobox protein homolog 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the chromo domain of the chromobox protein homolog 4.
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 SUMO-protein ligase CBX4
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k28A00
3GV3A 1TVXA 1F9QA 1EQTA 1O7YA 4MN3A 1Q3LA 1NAPA 2L4NA 1O7ZA 3I8ZA 4ZK9B 4ZKBB 2N55A 1B50A 1EIHA 1GUWA 1SAPA 3H91A 3Q6SA 1U4PA 1IL8A 1G2SA 1ML0D 4R8IA 1ICWA 1J8IA 5EKIA 1F9SA 1BF4A 2B2UA 3FDTA 2FJ2A 1G6ZA 1WTOA 1U4LA 2FHTA 4ZAIA 1KNEA 3I91A 5D14A 3I90A 1PFNA 1RHPA 2KEEA 3DM1A 3DEOA 1MSGA 2B2VC 1NR4A 3QO2A 2FFKB 2FMMA 5CBAE 1QE6A 2HCIA 1NR2A 3DEPA 1AP0A 2CVRA 2L12A 3I3CA 2K01A 1WTRA 1M8AA 5T1IA 1X3QA 1PFBA 2B2TA 5CMDA 4IUVA 1DZ1A 4IUQA 2X6GA 4RA8A 1QG7A 1HFNA 1DOLA 1ESRA 5E4WC 2XIWA 2HUGA 1PFMA 2HDMA 2L1BA 3D6WA 4IUUA 1AZQA 2K04A 4HAEA 4CJ1B 2B2YC 3MWYW 4U68A 2EOTA 2D9UA 2IL8A 4HCSA 1HUMA 1WTVA 1F9RA 5E4XA 5CORA 5DNFA 1HHVA 1DOKA 1G91A 4QUFA 5AFWA 3F2UA 1DONA 3IFDA 4IURA 1G2TA 2J7ZA 3TN2A 2K28A 2B2TC 3TZDA 1HRJA 1NCVA 1RTNA 2K03A 1JICA 3IL8A 2B2VA 4IUTA 2NWGA 3R93A 2BDNA 2JP1A 1HUNA 4OIKA 2HCCA 1XYIA 2K1BA 2MPMA 1MI2A 5EPKA 4CJ2C 1EL0A 4ZLTF 2R3ZA 1MGSA 4NW2A 5CBEE 1U4MA 4R9WA 4X3TA 5EPJA 5T1GA 1HA6A 2KVMA 1CA6A 2FINB 1SSOA 1XX8A 1O80A 2L9HA 2VXWA 3FPUB 4X3KA 1IKLA 1S4ZA 3MTSA 4X3UA 1ILPA 2B2UC 1ILQA 1X32A 2NZ1D 4DN4M 2X69A 1F2LA 2RSOA 2H1EA 2KECA 4OIJA 2B2WC 1BO0A 3SVMA 2KEDA 1EIGA 2RVLA 2EPBA 1MSHA 1QNKA 1WD1A 1A15A 2Q8RE 2KOLA 1JE4A 4XT3B 2KUMA 1WD0A 2EE1A 1SDFA 1J9OA 2K05A 1RODA 2DY8A 1RTOA 2X6LA 4X3SA 3LWEA 1LV9A 2MGSA 4HEDA 5D65A 5EPLA 4XT1B 4CJ0B 5JJZA 1B2TA 1WTWA 1PDQA 4LMQD 2DY7A 2MJ8A 1X3PA 2HDLA 3N52A 2B2YA 2Q8TA 1BBXC 2JYOA 1B4OA 4ZKCB 3GV6A 4RAUC 1WTXA 1IKMA 5EJWA 1U4RA 2M2LA 4MHEA 2L11A 1VMPA 3P7JA 4RWSC 3UI2A 1WVLA 1KNAA 4XDXA 4UAIA 1DOMA 1B3AA 1ZXTA 3G7LA 2N88A 2RA4A 5COYA 1AZPA 1CM9A 2MP1A 2RSNA 2SDFA 4IUPA 5EQ0A 1WTQA 1PLFA 1RJTA 3KUPA 1B53A 1F9PA 2NYZD 3ONAB 3KBXA 4HSVA 4O42A 2B2WA 1VMCA 1C8CA 1CA5A 1BNZA 1EOTA 1WTPA 3HP3A 4QUCA 1E0BA 1HFGA
chains in the Genus database with same CATH superfamily
4YHHQ 2YTVA 1NAPA 2JA8G 5M5XB 2AHOB 2IHFA 3NTKA 4ABNA 2HD3A 1FD7D 3BVZA 5J22A 1PHJA 2R7ZB 4UHVA 3W2DA 1IW7C 2BA0A 4C3HB 1CZWA 1E2VA 4L8JA 2A5HA 4K8IA 1HR0W 1KDAA 1JT8A 3RZOH 1SNCA 1K8GA 1TWFB 3BZKA 4GOPA 4BA2I 2K4KA 1CTMA 2HCIA 4POFA 3M7NA 3ICEA 4JVZA 2F0OA 3MZ5A 4DR1Q 5EBCA 2B2TA 3J80i 1DZ1A 4RA8A 1QG7A 3MFYA 1E24A 1K3BC 1QUQA 3C1FA 3D4WA 3M3YB 1JWSD 4I7ZC 2R7DA 4KLKA 1JWMD 2XN9C 3TDQA 1YITA 4DV1L 1VQFA 1HUMA 2EJFC 2EY5A 4KI0A 1H9KA 5AFWA 4YWKA 5M9OA 1Q12A 3TP7A 4X66L 3D4RA 1UWVA 5ISRA 1A63A 2VZAA 2HCCA 4DAVA 2UUBQ 4JOIA 1MIUA 1UNSA 4DR3L 1O78A 3D31A 4HMJA 1GUTA 4TVAB 1SE3A 4QJFA 4P72A 1JJGA 3NBHA 3W5OA 1B44D 2LXKA 2G5DA 2OTJA 2E2DC 2LS01 2LKVA 1X32A 1PH7A 1T5XD 1QZHA 3HOXH 4JI6Q 5IIFA 2F0NA 4L5RC 3I72A 1N36Q 4NXML 3DWQA 2VUMG 1K9MC 2VB3X 2Q8RE 1F2MA 4N9PA 4DAYB 1IYUA 2MGSA 2OT2A 5IT9c 1YIJA 3PUWA 2JEBI 1GHJA 5CC4A 2JA8H 2IW3A 1GVPA 2LMCB 4YCUA 2YTYA 1EEID 2JA7G 3TMEA 1KC8C 5KRUA 2L15A 1IYVA 1LYLA 3HGBA 1JJ2A 4IUPA 2F4VQ 3PCOB 4DFAA 3FRPB 4FF3A 5M5YB 1EOTA 1WTQA 3BYTB 4QQBX 1F9QA 4GS3A 5GQOA 3URYA 4A3KB 2O2LD 1K83H 1RD9D 2Q2IA 3ND9A 4KJNA 1G2SA 2VQEL 2MHVA 1SNQA 1LTID 1KAAA 3EN2A 3AB9A 5D14A 3QOLA 3JAMi 2KCCA 1I94Q 2K5VA 1NR2A 2ZTCA 1SE4A 2H5XA 1IL2A 4DUYL 1SYDA 4LFCQ 4RGMA 1VQ5A 4IUVA 2F0IA 1E1TA 4AIMA 4A3MG 3PV0A 4P74A 4IPCA 1TU2B 1WTVA 5K5PA 1ENCA 3OYYA 3P20A 1G91A 3IFDA 4BWGB 2D62A 3I4OA 3PUXA 3HOXG 1X6OA 4BY7G 1O7LA 2RCNA 3Q24A 2EIFA 3K5OA 2JA5G 1GKHA 2K1BA 3HKSA 2K14A 2F0DA 3FMCA 4TSSA 3ERQA 1U4MA 3HOWG 4A3MB 4K5WA 1JJCB 3TS2A 5HURA 2A74C 1WFQA 4DV0Q 5GADC 3A55A 3M7GA 3E9HA 1UEBA 2TMPA 1L0XB 1KAWA 2NZ1D 1BDOA 1Z6HA 4CKBA 1WOCA 1SNPA 3MC0B 4ID6A 2EPBA 1QNKA 4B3SQ 3RZOB 1DM0B 3E3XA 1VDZA 3J7ZC 1RODA 2WV6D 3GTOB 3HOWB 4DR7Q 2F0JA 1II3A 1PDQA 2NTTA 1Z9FA 1EIFA 1X3PA 2M9VA 4DR6L 2HQEA 4ZKCB 1PYBA 2L11A 1QNUA 2KA7A 1L2FA 2F3IA 1FGBD 2KBNA 4ODGA 3BVGA 1AE2A 1AZPA 1B3QA 3NE5B 3TP6A 4B9WA 1RJTA 4O42A 1Q1BA 4DV3L 1VQIA 4QUCA 3GD7A 1PYSB 4A4IA 1Q81C 5CV7A 2OTLA 2WKDA 1EZ8A 4RKBA 4B3SL 4U673 2R93G 3JC66 1EOVA 4DPGA 1JB3A 5EKIA 4UPAA 2AKWB 1B70B 4ZRZA 3K5MA 1GUGA 1XMOQ 2NVTH 1PVOA 3G6JB 4JBJA 5BN4A 5GAEC 3CXCA 2XWBB 2L5TA 4C1NK 2FFKB 3VA5A 3OW7A 1LTAD 4A3DB 4HSPA 1Q7YC 1STBA 2JA5H 3GTKH 1H95A 2WB1B 3CCJA 1HQRD 4IUUA 4EVOA 4HAEA 1G51A 3MWYW 4HTHA 5KNCA 1EFWA 2BH8A 4POGA 5JAVA 3A8IE 1EY4A 5JVG3 3LWUA 4JI0L 4J8QA 2CCZA 1NJIC 1YZ6A 1VQ8A 2K03A 1I3QH 1SXTA 4JI5Q 1LTBD 1HUNA 1HNXQ 1DXMA 1I50B 2JQOA 3ER0A 1IBLL 2BE5D 5LL6X 1N34L 3QIAA 4L63B 4Y7NB 4FF2A 3NTIA 2RCFA 4FXKC 3H0GB 1CKMA 1TS2A 3OIPA 5IGBA 4J1MA 1IHZA 2F0WA 3MTSA 4B3ML 5NUCA 5M3FG 5DAUA 1WCMB 1FJGQ 3M4PA 3P75A 2BCOA 4QY7A 1PTOH 4WJWA 2X69A 2RSOA 4KJOA 4DV7L 4P75A 5IP7H 2RHSB 3K58A 3OIQA 4RG1A 2CH4W 2L55A 2B63B 2WACA 1YVCA 1SDFA 1TKWB 2SNSA 4I7AA 5C4JB 3D3RA 1X9NA 2I5LX 1A2UA 3BU2A 5M3MG 1B2TA 3VR4A 2EXDA 3L2PA 3ZYYX 1AEXA 1CHPD 3N52A 4DUZL 5DM63 1PXUA 2JYOA 3DXJC 1TWGB 1B4OA 1RL2A 3NUCA 4DK1A 1GXDC 4C3JB 2UXCQ 2WFWA 4A3JG 2UXDQ 1L0YB 4EQNA 2IX0A 5CV6A 3G71A 5JJIA 1NTGA 3OOCA 5IYCG 5AJ3Q 3UDIA 3M4OB 5GROA 1R9TB 3KUPA 2WAQE 1N8RC 2ZT9C 3C1EA 1SNMA 1AH9A 3OSOA 1QJOA 1CHQD 4FO2A 3I4NH 4MN3A 4XYOA 1K73C 5BR8Q 2RKSA 1IBLQ 3T1YQ 2Z6BA 4Y52H 1PTOC 1HNXL 1VQGA 2JA7H 3S17B 2PQEA 4XXEA 5I6WA 5CV9A 5LMUQ 1Q8KA 2UU9L 4LF7Q 4ALPA 2CHBD 4IFDG 3Q0AA 2FHTA 1VCIA 1E7ZA 2K75A 1XJVA 1K0SA 2VL6A 2E5LL 4BY1B 2XWJB 4OWTB 1Q8IA 1EUJA 3C2PA 1AW7A 1QE6A 1VQJA 3FPPA 1EYCA 3GTPH 5I9OA 4HR7B 3UDGA 3K5LA 2HHHQ 2JA6B 1KABA 2UXBL 1PZJD 4HJ9A 3A5ZB 1KIXA 1DOLA 1FYCA 2A1AA 4JI1L 5M5WH 1TWHB 2EJGC 5JOBA 1VQPA 4CJ1B 2B2YC 5C5MA 4A3CG 3NP8A 3H3VH 1VQBA 3HG9A 1BXTA 4ZUJA 1FGUA 2RDFA 2UU9Q 5EAYA 3U9SA 1LUZA 1RTNA 4OWWB 3SR1A 1GUOA 2Q2UA 4OIKA 2O5JC 1XYIA 5IWAQ 2ALYB 5IP7G 4CJ2C 3A8JE 4ZLTF 4BXXH 3M4QA 3K7AB 5CBEE 1HNWL 3J80c 2KVMA 4ULLA 4FF4A 1Q1EA 4PNYA 1D5XC 2NZHA 3TZUA 1SMYC 4X64L 4DR2L 1ZYRD 5GAGC 2H1EA 4BY7H 3TS0A 5IYCH 5J39A 4UP8A 4IJHA 4N8FA 1A15A 2K50A 3RLOA 2K7VA 3A8KE 4K6LA 3K0YA 1FNWA 3OWFA 3TREA 1YHQA 1HZCA 3RLNA 4DK3C 2PCFB 3SXHA 1CKOA 4HIKA 2F0EA 1FNUA 2O5IC 3HKZB 4A3DH 4ZQ3A 4CDCC 1V1QA 1LTLA 4KHPL 3KLSA 4FF1A 1D5ZC 1GO3E 4K0KQ 3VR3A 1I4QA 2B2WA 1PRTC 1TY0A 3GTMB 4QGUA 4NXNL 1I4PA 2B3GA 2NN6H 4DV5L 1AN8A 1ENAA 3HOUB 1SYFA 2E8GA 1SAPA 4IALA 1RDPD 5ELNA 1S40A 1JQYD 5FO9B 2B2UA 2A6HD 1B1ZA 4YWMA 5C0XI 4UY8C 2CWAA 2CQAA 2LFNA 3OWEB 3L7ZC 4FVMA 4ZYSA 1EYAA 3QWNA 2R92B 4JI2Q 5IWAL 2CQOA 4BBRG 3K80C 1VQDA 2KCMA 1YNJD 2XRQD 2OEOA 5ELCA 4L6TB 1SJHD 1PV4A 2L1BA 1N33L 1J5EQ 4U68A 4AYBG 2D9UA 2IL8A 4L5QA 5EBDA 3S1RH 1B7YB 4LFBQ 2JA9A 1H9SA 5E4XA 4QUFA 5LMNL 2J7ZA 1Y8OB 4A3JB 2HT1A 4IUTA 1D5MC 3M4YA 4XQQA 2VUMH 2MPMA 5BN5A 2BH2A 1RIPA 3OMGA 1EWCA 1JOKA 3OPOA 5C3EG 3KLWA 4DNRB 2L9HA 1BBUA 3E6ZX 2EYPA 4GLXA 3NELA 4F8MA 4LF6Q 2EYOA 2VB2X 1VQ7A 4A3DG 4DV4L 1F2LA 4EQPA 4C3IH 4DF7A 1I4RA 5IGCA 3GTLH 1BO0A 4HIDA 4X65L 3I7FA 4DR6Q 2I5MX 3GO5A 5IP9G 1QB5D 3BZCA 3E0EA 2HIVA 2K5WA 3D8GA 4LW1A 3EROA 5EPLA 1VQ4A 2F1MA 1FVIA 2NN6G 4JW0A 2F0VA 2NB0A 1WJJA 1X3FA 2I07B 2SEBD 1VQAA 1PTOF 1KNAA 2AQ3B 2ICIA 1VQCA 3NQIA 2CW0D 1ZXTA 3HS0C 5M5WB 1EYDA 2PW5A 3KBXA 5FLMH 1XNRL 1DYQA 1MJCA 2K5QA 3VR5A 2DJFC 3AMUA 4A3LH 5F2DA 2NVYB 2OQKA 3QJYA 1HXYD 1PFSA 1Q90A 4GZYC 4GLAC 4DR5Q 5EGTA 5C44G 1Y14B 4X62Q 4LFBL 2IY5B 4YIJA 4MZ9A 1J5EL 1I6HH 1MSGA 3BVMA 1HCZA 1XMQL 3I3CA 1M8AA 1KRSA 3NBIA 4RCOA 3SDZA 3MVVA 4FXGC 4LF4Q 4JBKA 3KJOA 1U9RA 3CRKC 4JI0Q 2ZM6L 1TS4A 4IOAA 4BBSB 4UDUC 1F9RA 2M00A 5CORA 1DOKA 3S2HB 3W1BA 4OO1I 3MXNB 5I6YA 3J80E 1P16A 2JP1A 4IO9A 3IKJA 1HA5A 4RFBA 5EPKA 4YCVA 4YHHL 1BCPB 1DD2A 3ND8A 4EQ5A 4NXNQ 1JORA 1XNRQ 3F8TA 3GQBA 3IRBA 4NB3A 3SK4A 3S1NH 3CD6A 4O0AA 3HOZH 2QCPX 3FP9A 3S14B 1PH9A 2QF7A 4H0LC 1Y1VG 4UP9A 4G7OC 2VW9A 5C5LA 4BXXG 4XT3B 4DGZA 2EE1A 1EQRA 5IGFA 1GM5A 1RTOA 4P2CB 5C4HA 1SYBA 3PUYA 3TQYA 3KF8A 4XT1B 1C0AA 3PIOA 1I6VC 2XRSD 1NUCA 2J0TD 4P73A 3HOXB 1A2TA 2R93H 4DR2Q 1KHIA 1DOMA 5KYIA 4CDEC 2RA4A 5COYA 1XPUA 2RSNA 3VYTA 3CPWA 2K5DA 4KKUA 2NYZD 4QB4A 4DK6C 2AQ2B 4FP5D 5J1ZA 3J81i 3L0OA 2VNUD 1NNXA 1D8LA 2OQ0A 2XGTA 5JEAG 1EIHA 2L4NA 4KK7A 1GUWA 2UUBL 2PO4A 1GHKA 4C3JG 1J8IA 3E0JA 4TRDA 5FO7B 5JJKA 1BVSA 3A7LA 2RF4A 1U4LA 2EYJA 4H13C 4G57A 2RQXA 4MTKA 2JSOA 4DV0L 1EIYB 1VQEA 2B2VC 4V190 3EBEA 3FEWX 2CVRA 1K8OA 3NXWA 5T1IA 2F0LA 1JE5A 2ZXRA 2UXBQ 3MEFA 5I4DA 4N8X1 1F77A 3MXGA 5CMDA 4JI2L 3DMUA 2X6GA 1HZBA 2ZXPA 1NSNS 1PH5A 4A3GB 5LMNQ 5JJLA 2HDMA 3D6WA 2V1CC 4DR4L 2EOTA 4HCSA 3RN2A 4KD3A 3SEBA 2Z4HA 4DNTB 1TT2A 2GVBA 4C56C 4FNFA 4R4TA 2K28A 1V8QA 4L5TA 5M3FB 3FKIB 2BDNA 3K5NA 3KYHC 3AFQA 1TWAH 1MGSA 4NW2A 5KEEA 4HIOA 1CA6A 4HMIA 1M90C 4JI7L 1QCBD 1IKLA 4JI3Q 3S16H 2QDBA 1WCMH 1EZ6A 1PTOB 4R1JA 3KFUA 3NQTA 1S5ED 1JR0D 3U9OA 4IFDJ 3PUZA 3T13A 2WP8J 4GKJL 1WTHA 2ZJQA 2F0GA 2K05A 1I6HB 2A69C 3LWEA 3K0XA 5C4JH 3NTHA 4KHZA 3UE1A 3OTOQ 3S1QH 1PZID 3I4NG 3H15A 5KIXA 3GV6A 1WTXA 4K0KL 4DV7Q 1TWGH 3EJIA 2K6AA 1WVLA 4C3JH 2NUCA 1U5KA 4KN4C 2N88A 5CGKA 3VDYA 3R2TA 2MP1A 1C4QA 1J6QA 1UAPA 1FJGL 4M1UB 1PLFA 1HRJA 3PO3B 1CA5A 5IOCA 4DV6Q 3EIVA 3A7AB 1CI3M 4GNXC 5KNBA 5C3WA 3I73A 5C0XG 1LLRD 2SOBA 1ET6A 4WJ3M 3I4NB 4Z9CB 4PMCA 4IFDI 3Q6SA 4M8AA 2KCTA 2DUDA 2ICEC 4R8IA 1ICWA 5ELEA 3KF8B 1PMRA 1ASYA 3CC2A 1IZ6A 1TS5A 1TY2A 3AQQA 1KNEA 5FLMG 2YU9B 3I91A 2L0CA 3AEVA 1EQQA 1EWIA 1HJPA 1UE6A 4DR4Q 3S1MB 3BZDB 4QIWE 4YY3L 2Q2HA 3T51B 2ATWA 2IWHA 1Y1WG 4DR3Q 3F2DA 2CWPA 4DV2Q 2EJMA 2IPKD 4X66Q 2DNCA 5C44H 1I4HA 4A75A 5E4WC 2EYFA 5JEAJ 3KOJA 2HUGA 3OW2A 3DHQA 4WORA 2VQFL 2DNEA 4Q0FA 3DM3A 1QVFA 4KTAA 1N33Q 1JCKB 2WB1E 1A3VA 3F2BA 1YHBA 3L9AX 1KDBA 2IJ0A 1N32L 5TSSA 1BQQT 5BR8L 2HHHL 1G8ZD 2R3ZA 1E22A 2KHJA 5T1GA 3MXPA 1R4PB 1S5FD 1SSOA 4LAAA 1O80A 5CV4A 3CQZH 5EKLA 1ILPA 4OL7A 2MQHA 3T1HQ 1Z47A 4OIJA 5FLXc 3U50C 3S2DB 4XIGS 1SJED 1CQFA 1A6XA 1WD1A 3AU7A 4EX5A 3N6RA 4CHTB 4JPBW 4ME3A 3RD4A 5JPNC 5JJZA 4HEDA 4KKSA 3PO2B 3GP7A 3RUZA 4DAPA 4DV6L 3I4MG 3HOZG 1TWFH 5EJWA 3R2IA 3Q23A 3UDXA 2AWNA 1EY9A 2DGYA 2MUYA 4RWSC 3UI2A 1JMCA 5C4XB 1NBWA 4F7XA 3G7LA 2UUCQ 4RCNA 1CM9A 4CBVA 5M3MB 4GKKL 2AUKA 1BCPF 4HCEA 1HFGA 3M3YH 2IX1A 2NBFA 1IXRA 2HIXA 1X65A 2N3SA 4LF9Q 1H9MA 3RN5A 1IYJB 3FKIH 1UE5A 1Y1WH 1PH1A 1XXGA 1ML0D 3CC7A 1EEFD 1F9SA 2JN4A 4IUNA 1R9TH 1I4XA 1D1KA 5ELDA 4B3MQ 3EA6A 4MIUA 1T9HA 1STGA 3KDFB 4K6DA 3J81L 3QO2A 3BG3A 1RCVD 4A3FB 3K81C 3KF6A 5E1FA 4JOIC 3TBIB 4KD4A 4O1NA 1VQLA 2AMCB 3A0JA 4IZ8A 2JA7B 2BDOA 3KF6B 4L5SA 1X3QA 2J4XA 4A93B 1KTKA 2F0SA 3T56B 1D7QA 4K2KA 4R4CA 4BY1H 4JYAL 1P8LA 1AE3A 3GTQB 4KKTA 4X62L 5A2QE 1Q46A 2R7ZH 1S3OA 1RKNA 2B2TC 1NCVA 1SMYD 4LFAL 1X54A 1X56A 4H44C 4JI4Q 1Z7TA 4PV1C 1STNA 2Z8LA 3HRZC 3CRLC 1SLJA 4YCWA 2G9HD 4H7BA 1ZYRC 3RLFA 5C3EB 2FINB 2PNHA 3EVQA 4DV3Q 1KL9A 4RH6A 4G7HC 2UUAL 2VXWA 5D3DA 2O4XA 4KY5A 1TQOA 5HGTA 2EYHA 3Q22A 4HJ8A 3CCRA 5E3FA 2NVQB 3R8BA 4C3IB 3EQLC 1K83B 2YU9H 1NY4A 2RBMA 4K14A 1OXUA 1CT1D 1DCZA 2G9DA 3DUZA 3K6OA 1A8VA 2PYKA 1GJXA 1IKMA 1W3SA 4N9TA 3FKIG 1PRTD 5AJ3L 2QA4A 4LF8L 5C44B 2Z0SA 1WYDA 1VS0A 5EQ0A 1FL0A 2A73B 1OTCA 1VMCA 1BNZA 1UE1A 5FKAC 2OXPA 1L1OC 1BKBA 2LY7A 3J81j 1T5EA 3TRZA 4K2LA 3ULPA 1TXYA 1YBYA 4LFAQ 1TWCB 3AYHB 3Q8DA 2KCNA 3NENA 2F03A 3HEJA 1GOZA 3NSWA 4NDXA 1M1KC 3J80L 3H3VC 3GTMH 5D3IB 4OGQC 1C48A 1UUPA 4B3TL 3BYYB 2YYZA 1LTTD 4R4QA 2PI2A 3S2DH 4PQXA 1HR0L 2WIIB 2ENBA 4YWLA 2F0FA 4JI5L 2B39A 2N8NA 5M5YH 1HFNA 2E2HH 4CKCA 4DU9A 3UE0A 5FLXE 1A3TA 1PFMA 1AZQA 3CCEA 5G3LD 1B9NA 5DEHA 4I65A 2KQ3A 2IX3A 5BN3A 4RHSA 4B08A 3PIP3 3QR8A 5KYLA 1HHVA 1EY6A 5EKKA 1PYWD 2ZM6Q 3GTOH 5K36G 1DONA 2AUJD 1GD7A 3TN2A 3S2HH 2CH4A 5J3BA 2NVXH 3IL8A 4XTCS 1V1PB 2GN5A 2VQEQ 2F0UA 4IPGA 1U0LA 4LFCL 4B3RQ 1Y1VH 2P5ZX 3SK5A 4LK1C 2WINB 2JE6I 3CPFA 4DV5Q 3GTJB 4HIMA 4XQNA 3BDCA 2E2JH 1S5CD 3S24A 4GKKQ 3S1RB 1TR5A 1BR9A 4F87A 4AYBB 4A3FG 3BDLA 1A3UA 3KK7A 2EXZA 4A3JH 1I5FA 4R4IA 4DR5L 5LHY1 4HJ7A 3SK8A 3K59A 2VUMB 2MO1A 2KUMA 5LL6S 1PH8A 3X3NA 2MNAA 1A0IA 2IT1A 4GN5A 2MJ8A 4NMZA 1LTRD 1SNOA 2IHEA 2EQSA 3ITPA 3VR2A 5JEAH 3I55A 4RAUC 3LGJA 1D6EC 2K52A 4AQYL 1JOQA 4A76A 3T1HL 5ELFA 3DWPA 4GOPC 3M9BA 2SDFA 3JAMc 3PF5A 1MJEA 3KLSX 1B53A 4R9WA 1BOSA 1CKNB 4JBWA 3GTQH 3GTKB 2JA5B 1SE2A 1XTDA 2K5NA 4ZKBB 1STEA 1PZKD 4GN3B 2A68D 1U4PA 4JI4L 3J7AV 1K28A 4NXMQ 4PG3A 1YJ9A 1DJRD 1I3QB 2F0HA 2FJ2A 3FDTA 4A93G 2C5CA 3ULJA 4CKEA 5JPMC 3GTGB 3NWSA 3T4AC 2VQFQ 1STYA 1RHPA 2UUAQ 2K33A 4EGVA 4A3BH 1NR4A 2FMMA 2K01A 2NVQH 1ENFA 1ET9A 1CUKA 1PFBA 2F3WA 3MFGA 2XTIA 4XQJA 2QW7A 3I2ZA 3AFPA 4OWXB 3RZDH 4IPHA 1JOOA 1HZ9A 2K04A 1IBKL 2RHQB 5IYBG 3WWVA 4JI8Q 2BE5C 2D0PA 3DLLA 3F2UA 1EWHA 4KY7A 2OCEA 1WCMG 3MHBA 1K0RA 1HTPA 3MXNA 2Z1CA 2NVTB 3HZXA 3J7AF 4DUYQ 1VF7A 4LUOA 4X3TA 1XMQQ 1HA6A 1PA6A 3NEMA 1I94L 1NE3A 2V4DA 3I4MB 4X3UA 1STHA 2B2UC 1CZGA 5C0XJ 3J81E 5IYDH 2KECA 2PI2E 1QWYA 1ZEQX 4AH6A 4OELB 3TP8A 1CSPA 1Q82C 3J81c 3S17H 4PZ7A 4PMWA 3SE0A 4CGYB 1J9OA 3OTOL 1Y69U 2DY8A 3W1GA 4NP5A 3PO2G 2CFMA 3NPPA 1N9WA 4LMQD 3TEHB 5C0XH 4FXDA 3S1NB 4BBSG 1OXVA 1MBYA 2RDHA 1SRUA 2M2LA 3D4DA 1XNQQ 2Z6KC 2CKZB 1LT4D 1VMPA 4DA2A 2TSSA 2EDGA 5I2YA 4LF8Q 1UEAB 1D2BA 1XWEA 4G7ZC 1F9PA 3J7YW 1VQNA 4CDDC 2Z9HA 2A8VA 4IUQA 4X6AH 1TVXA 3NBHB 4CDFC 2K5HA 3U4VA 1I4GA 3A54A 1IBMQ 3B6YA 2WAQG 1L1OB 2FXQA 2R93B 4BBRH 2R92G 2CW0C 4IQZA 3NHHA 4TQUS 4JI6L 1GUSA 3CC4A 4KV6A 2E2JB 1S72A 1H9RA 3I4LA 3I90A 4H02A 1TS3A 2F0MA 2F3VA 5IE8A 4LJZC 4EQOA 3DEOA 3G48A 3PGZA 2XVSA 3M85A 4ZCKA 1V43A 4JI1Q 4WJ4A 2LSSA 5FJ8H 3G6EA 3M4OH 1PH2A 1E2WA 1IW7D 2Y0SG 4KY6A 3U4ZA 1B8AA 3FHWA 1MD2D 4IOCA 4JV5L 4OO1G 2EZVA 2XIWA 3A5UA 3ZJYC 4DAMA 2F0PA 3S15B 2KENA 4JYAQ 1X55A 4PZ8A 1EY7A 4Q5VA 3T16A 5G3LF 3R93A 3VA7A 2B2VA 4FDBA 3CP0A 4DR1L 1IBML 1BUVT 2QEJC 3A74A 1MI2A 5IP9H 4A3GH 5GAHC 5EPJA 4RGNA 2Q8IB 4ME5A 2E2IH 2PZTA 3GTPB 4X3KA 4E6IA 4C2MB 3H6MA 3CCSA 2EYLA 3K8AA 1C7YA 2JA8B 3CMAA 2C35B 1YNND 1OXTA 3PIO3 1ILQA 1ZKOA 3LX0A 2QGQA 3HKZG 1SYEA 4RGOS 3HOUH 2JK8A 1XNQL 2F0QA 2OWOA 1JWUD 2Z6KA 3OHXC 3GTGH 4O2DA 3STBC 5IODA 3HOYB 1EQVA 4OONA 1TWAB 3PMFA 2X6LA 4GNXB 2A6ED 3U58A 4A3BB 2OF1A 5D65A 1YNXA 4K5XA 2HDLA 5FLXL 3HFZB 2WAQB 1LT6D 2R61A 1U4RA 2ID0A 1NMGA 4MHEA 4F88A 1EU4A 4XDXA 4KHPQ 3VR6A 2R92H 3RZDB 1PH6A 5C4XH 4IPDA 4LUZA 4JI7Q 2QILA 1PRTF 5M3MH 3CF5A 3S1QB 3WOEA 4LUVA 4LWCA 1D1IA 3PUVA 3I8ZA 4A3IH 1N34Q 5KNDA 2YV5A 5FK9C 1EY8A 3RNUA 4LNQA 1LABA 1Y1WB 4JBMA 2A19A 2ASBA 4DAYA 1E3PA 3KLRA 5I9PA 5A2QL 1WTOA 4DXGA 4JI8L 2SNMA 3PO3H 2XNAC 4JI3L 4BY1G 2EY6A 3F1ZA 3K57A 1H9JA 1VQ6A 1ICFB 4ILWA 1HNZL 5CV5A 2ZXOA 2HQLA 2R6GA 3GDEA 1N32Q 1QZGA 4PZ6A 1HR0Q 4BA1I 3CCMA 4K5VA 5IGDA 2NTSA 4A93H 2A69D 3H0GG 1MKHA 4A3BG 1IBKQ 4DK0A 3S1MH 1EYGA 3EFXD 4MNOA 1SYGA 4IURA 1LTSD 3TZDA 4DNIA 2JXMB 1JICA 3W3AA 3QG1A 1E1OA 4AYBE 1Y8NB 3ULLA 1S5DD 4NPSA 3O13A 2PZWA 4NKLA 4PMBA 1CSQA 4A3CH 3FPUB 3PF4A 4WRDA 1S4ZA 2E74C 1V1PA 1XMOL 3KDFA 3NK9A 1YI2A 4BBRB 4GOPB 1QOHA 2K32A 4GNXA 4ZUIA 1EIGA 5FO8B 2N78A 2I5HA 4QCLA 1LV9A 1LACA 2A6HC 2B8FA 4CJ0B 4HJ5A 3CCVA 1BBXC 3TP5A 4A3IG 2E76C 3SHLA 3MXUA 1HZAA 3I70A 1F2ZA 1K8MA 2ZTEA 1SR3A 4UAIA 2D0OA 5IGEA 2XSCA 2UXDL 1OO9B 5A35A 3KBGA 1M4VA 3IAYA 3S15H 3P7JA 1Q86C 3PO2H 1G291 4DR7L 4A3KH 3L3OC 4BBSH 4RMFA 1KRTA 1O7ZA 4ZK9B 2N55A 1BBWA 3GTLB 1ONLA 3PSIA 2PMZE 2KHSA 2BOSA 3CU7A 2Q2TA 1SBBB 2DJGC 3X3MA 1G6ZA 2EYMA 1QVCA 1SFOH 5IT9E 3MAQA 2DN8A 2E2IB 4GLVB 4C2MH 4RGTA 1PFNA 2JEAI 1PH4A 4OX9L 1K3RA 1AP0A 1KQSA 5K36H 2QEXA 1B9MA 1WTRA 4P71A 2ES2A 4S3SA 4LF4L 1FR3A 3HOVB 1I50H 3HOYH 3HOZB 1A62A 2H4OA 1SROA 2KJXA 3S14H 3FVQA 4Y7NH 4R4OA 1E2ZA 4B3TQ 3DWAA 1H9SB 3R3OA 2GVAA 2ZJPA 5DNFA 1LT5D 3RMHA 4A3FH 4OHJA 1KXLA 1QVGA 5DM73 1G2TA 5FJ8G 1F2YA 3MEHA 2F4IA 1EY0A 5I2XA 1CQVA 4OXPA 2NVXB 1EFID 4OO1H 1ESFA 4A3MH 2VS1A 1EL0A 2B63H 4IN3A 2LXJA 4OX9Q 3GTJH 1XX8A 2JJQA 3VYRA 4A3IB 2MFIA 2F4VL 3CCUA 1C9OA 4A3EH 4DN4M 5C4ZA 3VYSA 2R7FA 3SVMA 4KMUC 3RR5A 3A56A 4C3HG 3CMEA 3E9IA 2KOLA 3K7UC 3KJPA 3CCLA 3HOWH 5C3EH 3SGIA 1PRTB 2PPBC 3WDNA 2AWOA 4DKAC 2KHIA 1WTWA 5ELOA 5IT9L 5JVH3 3SK6A 2B2YA 4QMGA 1GUNA 1LO5D 1OXXK 4FYDA 4LF5L 1KLUD 5E7NA 4C3IG 1N36L 2Z4IA 5H1SE 2AQ1B 3PQIA 2F52A 4AQYQ 1VQ9A 1G6PA 5IY0A 4K8JA 1YEZA 2D5DA 2ZJRA 1YJNA 1KDCA 5HGQA 1HNWQ 1VQOA 1EQTA 1XPRA 1B50A 4TKOB 1SNDA 3G4SA 3HOVG 4X65Q 3MA2B 1YHAA 1LT3D 4GN4B 1LM0A 5C4XG 3HOYG 1BF4A 3P1HA 2ZTDA 5FOBB 3H94A 3F2CA 2QDLA 1AFPA 4DV1Q 4RKLA 3DM1A 5IYBH 1XTCD 4KHVA 4A3LG 2EY1A 4HN7A 3UDFA 4JV5Q 3V2TA 2L12A 1JB7A 1K8AC 1O7IA 1JC7A 2RDGA 4B3RL 1TWCH 1Y8PB 2MO0A 1MHWC 3LNNA 4B9XA 4QL5A 4QIWB 3K7AH 2B63G 1WI5A 3CW2C 5HY6A 2E5LQ 3CHBD 3ERSX 1W6KA 2JA6G 4LF7L 1XPOA 5M5XH 4A3EG 2D2CC 1EU3A 2YTXA 5IYDG 1EY5A 1CKNA 4R8NA 1KLGD 2E2HB 4LF9L 3H0GH 4C3HH 4RHRA 1HNZQ 2PZUA 1CFMA 4HJAA 3I4MH 1L1OA 4V0BA 2KEDA 1Y1VB 3I56A 1SFOB 2RVLA 4C1NI 1X3EA 3J7A5 3D6CA 3BS1A 1UE7A 1V1OA 3T53B 1YNNC 1X3GA 2F0KA 2Y0SE 3IFTA 3VYUA 5M3FH 2Q8TA 3STBD 4DXFA 2I0QA 1L0WA 4APVA 3HOVH 2E75C 5CR3A 1QUQB 4X64Q 1B3AA 3C46A 2NN6I 1SE8A 3V96A 2PNRC 3ONAB 1BCPC 3CKIB 2A68C 2A6EC 3S16B 4BS9A 1WTPA 1S5BD 1SMXA 1V9PA 3GV3A 1VQKA 1ASZA 5DLQE 1O7YA 3S9WA 1Q3LA 4JG2A 3H09A 3H91A 1W6JA 1IL8A 3OMCA 2N49A 3JAME 4UP7A 1VF5C 1LTGD 4DV4Q 5C3XA 1W2BA 2Y0SB 4ZAIA 4LF6L 3PIPA 4XYQA 3HKZE 2KEEA 4A3KG 1PH3A 5CBAE 2PQAA 4J6HA 4A3EB 3DEPA 2JA6H 2R7ZG 4WFN3 2C9OA 2QKIC 5L37A 4DV2L 4OEMB 5LMNW 1TWHH 2B8GA 2F0TA 4KN7C 1SEBD 2PW7A 1ESRA 1SYCA 3D0FA 2VY3A 4JC0A 1HQMC 4IFDH 2WB1G 1KD1C 4A3GG 3QB3A 5CYUA 1HTLD 1OXSC 1YNJC 3C3LA 1RF2D 2EVBA 2PQAB 3CAMA 1HPCA 1NMFA 4JCVE 3HOUG 2NWGA 4MTNA 3BDOA 1HH2P 1YJWA 5C6AA 3NWTA 3CCQA 2NZOA 1CK1A 4YY3Q 1TIID 2FMCA 1VQMA 1BCPD 3WOFA 4BY7B 5LMUL 1R4QB 4LF5Q 2B2WC 2UXCL 3QOJA 5ELBA 1MSHA 1DGSA 2I46A 4QF4A 5IGGA 3T1YL 1JE4A 2B29A 5CV8A 1WD0A 3TSSA 3JAML 4X3SA 1VQHA 4IJLA 4J15A 1QILA 2BA1A 4G4KA 1SN8A 2DY7A 4GKJQ 2NVYH 4JK1C 2UUCL 5KGUA 3BJUA 3E5SA 3H3VI 1FNVA 3V05A 3CQZB 1STAA 4DUZQ 3PO3G 4HSVA 2WKCA 1PTOD 2PMZB 1C8CA 2EY2A 3HP3A 1E0BA 2GA4B
chains in the Genus database with same CATH topology
1NAPA 5M5XB 3NTKA 4ABNA 1FD7D 3BVZA 5J22A 2R7ZB 3W2DA 1IW7C 2BA0A 4C3HB 1CZWA 1E2VA 4L8JA 2A5HA 4K8IA 1KDAA 1SNCA 1TWFB 4BA2I 1CTMA 2HCIA 3M7NA 2F0OA 3MZ5A 5EBCA 2B2TA 1DZ1A 4RA8A 1QG7A 3MFYA 3D4WA 3C1FA 3M3YB 1JWSD 4I7ZC 1JWMD 2XN9C 3TDQA 1HUMA 2EJFC 2EY5A 4KI0A 1H9KA 5AFWA 5M9OA 1Q12A 3TP7A 3D4RA 5ISRA 4DAVA 2HCCA 1UNSA 1O78A 3D31A 4HMJA 1GUTA 1SE3A 3NBHA 1B44D 2E2DC 2LS01 2LKVA 1X32A 1T5XD 5IIFA 2F0NA 3I72A 3DWQA 2VB3X 2Q8RE 1F2MA 4N9PA 1IYUA 2MGSA 2OT2A 3PUWA 2JEBI 1GHJA 5CC4A 2IW3A 2LMCB 1EEID 3TMEA 5KRUA 1IYVA 3HGBA 4IUPA 4DFAA 3FRPB 4FF3A 5M5YB 1EOTA 1WTQA 3BYTB 1F9QA 3URYA 4A3KB 2O2LD 1RD9D 3ND9A 4KJNA 1G2SA 2MHVA 1SNQA 1LTID 1KAAA 3AB9A 5D14A 3QOLA 2KCCA 1NR2A 1SE4A 1SYDA 4RGMA 4IUVA 2F0IA 3PV0A 1TU2B 1WTVA 5K5PA 1ENCA 3P20A 1G91A 3IFDA 4BWGB 2D62A 3PUXA 1O7LA 3Q24A 3K5OA 2K1BA 2F0DA 3FMCA 4TSSA 3ERQA 1U4MA 4A3MB 4K5WA 5HURA 2A74C 3A55A 3M7GA 2TMPA 1L0XB 2NZ1D 1BDOA 1Z6HA 4CKBA 1SNPA 3MC0B 4ID6A 2EPBA 1QNKA 3RZOB 1DM0B 1VDZA 1RODA 2WV6D 3GTOB 3HOWB 2F0JA 1II3A 1PDQA 2NTTA 1X3PA 2M9VA 2HQEA 4ZKCB 2L11A 1QNUA 2KA7A 1FGBD 4ODGA 3BVGA 1AZPA 3NE5B 3TP6A 4B9WA 1RJTA 4O42A 1Q1BA 4QUCA 3GD7A 5CV7A 2WKDA 1EZ8A 4RKBA 4U673 1JB3A 5EKIA 4ZRZA 3K5MA 1GUGA 3G6JB 5BN4A 2XWBB 2L5TA 4C1NK 2FFKB 3VA5A 3OW7A 1LTAD 4A3DB 4HSPA 1STBA 2WB1B 1HQRD 4IUUA 4EVOA 4HAEA 3MWYW 4HTHA 5KNCA 5JAVA 3A8IE 1EY4A 5JVG3 3LWUA 4J8QA 2K03A 1SXTA 1LTBD 1HUNA 1DXMA 1I50B 2BE5D 5LL6X 3QIAA 4L63B 4Y7NB 4FF2A 3NTIA 4FXKC 3H0GB 1TS2A 3OIPA 5IGBA 4J1MA 1IHZA 2F0WA 3MTSA 5NUCA 5DAUA 1WCMB 3P75A 2BCOA 1PTOH 4WJWA 2X69A 2RSOA 4KJOA 3K58A 3OIQA 2L55A 2B63B 2WACA 1SDFA 1TKWB 2SNSA 5C4JB 3D3RA 1A2UA 1B2TA 3VR4A 3ZYYX 1AEXA 1CHPD 3N52A 5DM63 1PXUA 2JYOA 3DXJC 1TWGB 1B4OA 3NUCA 4DK1A 1GXDC 4C3JB 1L0YB 4EQNA 2IX0A 5CV6A 3OOCA 3M4OB 1R9TB 3KUPA 2ZT9C 3C1EA 1SNMA 3OSOA 1QJOA 1CHQD 4FO2A 4MN3A 4XYOA 2RKSA 1PTOC 3S17B 2PQEA 4XXEA 5I6WA 5CV9A 2CHBD 4IFDG 3Q0AA 2FHTA 1VCIA 4BY1B 2XWJB 1Q8IA 3C2PA 1AW7A 1QE6A 3FPPA 1EYCA 5I9OA 4HR7B 3K5LA 2JA6B 1KABA 1PZJD 1DOLA 1FYCA 1TWHB 2EJGC 5JOBA 4CJ1B 2B2YC 5C5MA 3NP8A 3HG9A 1BXTA 4ZUJA 2RDFA 3U9SA 1RTNA 3SR1A 1GUOA 2O5JC 4OIKA 1XYIA 4CJ2C 3A8JE 4ZLTF 3K7AB 5CBEE 2KVMA 4FF4A 4ULLA 1Q1EA 4PNYA 1D5XC 3TZUA 1SMYC 1ZYRD 2H1EA 5J39A 1A15A 2K7VA 3A8KE 4K6LA 3K0YA 1FNWA 3OWFA 2PCFB 3SXHA 2F0EA 1FNUA 2O5IC 3HKZB 4ZQ3A 3KLSA 4FF1A 1D5ZC 3VR3A 1I4QA 2B2WA 1PRTC 1TY0A 3GTMB 1I4PA 2NN6H 1AN8A 1ENAA 3HOUB 1SYFA 1SAPA 4IALA 1RDPD 1JQYD 5FO9B 2B2UA 2A6HD 1B1ZA 5C0XI 2CQAA 2LFNA 3OWEB 3L7ZC 4FVMA 4ZYSA 1EYAA 3QWNA 2R92B 1YNJD 2XRQD 2OEOA 5ELCA 4L6TB 1SJHD 2L1BA 4U68A 2D9UA 2IL8A 5EBDA 5E4XA 1H9SA 4QUFA 2J7ZA 1Y8OB 4A3JB 4IUTA 1D5MC 3M4YA 4XQQA 2MPMA 5BN5A 3OMGA 1EWCA 1JOKA 3OPOA 4DNRB 2L9HA 3E6ZX 2EYPA 4F8MA 2EYOA 2VB2X 1F2LA 4EQPA 5IGCA 4DF7A 1I4RA 1BO0A 3GO5A 1QB5D 2K5WA 3D8GA 3EROA 5EPLA 2F1MA 2NN6G 2F0VA 2NB0A 2I07B 2SEBD 1PTOF 1KNAA 2AQ3B 2ICIA 3NQIA 2CW0D 1ZXTA 3HS0C 5M5WB 1EYDA 2PW5A 3KBXA 1DYQA 2K5QA 3VR5A 3AMUA 5F2DA 2NVYB 3QJYA 1HXYD 1Q90A 4GZYC 5EGTA 4YIJA 1MSGA 3BVMA 1HCZA 3I3CA 1M8AA 3NBIA 4RCOA 3SDZA 3MVVA 4FXGC 1U9RA 3CRKC 1TS4A 4BBSB 4UDUC 1F9RA 2M00A 5CORA 1DOKA 3S2HB 4OO1I 5I6YA 3J80E 2JP1A 3IKJA 1HA5A 4RFBA 5EPKA 1BCPB 1DD2A 3ND8A 1JORA 3GQBA 3SK4A 2QCPX 3S14B 2QF7A 4H0LC 4G7OC 5C5LA 4XT3B 4DGZA 2EE1A 5IGFA 1RTOA 4P2CB 5C4HA 1SYBA 3PUYA 3KF8A 4XT1B 1I6VC 2XRSD 1NUCA 2J0TD 3HOXB 1A2TA 1DOMA 5KYIA 2RA4A 5COYA 2RSNA 3VYTA 2K5DA 4KKUA 2NYZD 4QB4A 2AQ2B 4FP5D 5J1ZA 2VNUD 5JEAG 1EIHA 2L4NA 4KK7A 1GUWA 2PO4A 1GHKA 4C3JG 1J8IA 3E0JA 4TRDA 5FO7B 3A7LA 1U4LA 2EYJA 4H13C 4G57A 2RQXA 2JSOA 2B2VC 4V190 3FEWX 2CVRA 1K8OA 3NXWA 5T1IA 2F0LA 2ZXRA 5I4DA 1F77A 3MXGA 5CMDA 3DMUA 2X6GA 2ZXPA 1NSNS 4A3GB 2HDMA 3D6WA 2EOTA 4HCSA 4KD3A 3SEBA 2Z4HA 4DNTB 1TT2A 4C56C 4FNFA 2K28A 1V8QA 5M3FB 3FKIB 2BDNA 3K5NA 1MGSA 4NW2A 5KEEA 1CA6A 4HMIA 1QCBD 1IKLA 2QDBA 1EZ6A 1PTOB 3NQTA 1S5ED 1JR0D 3U9OA 4IFDJ 3PUZA 3T13A 2WP8J 2F0GA 2K05A 1I6HB 2A69C 3LWEA 3NTHA 4KHZA 1PZID 5KIXA 3GV6A 1WTXA 3EJIA 2K6AA 1WVLA 2NUCA 4KN4C 2N88A 5CGKA 3R2TA 2MP1A 1C4QA 1UAPA 4M1UB 1PLFA 1HRJA 3PO3B 1CA5A 5IOCA 3A7AB 1CI3M 5KNBA 5C3WA 3I73A 5C0XG 1LLRD 2SOBA 1ET6A 3I4NB 4Z9CB 4PMCA 4IFDI 3Q6SA 4M8AA 2ICEC 4R8IA 1ICWA 5ELEA 1PMRA 1TS5A 1TY2A 1KNEA 2YU9B 3I91A 2L0CA 3S1MB 3BZDB 3T51B 2IWHA 2EJMA 2IPKD 2DNCA 1I4HA 5E4WC 2EYFA 5JEAJ 2HUGA 3DHQA 4WORA 2DNEA 4Q0FA 4KTAA 1JCKB 1A3VA 3L9AX 1KDBA 2IJ0A 5TSSA 1BQQT 1G8ZD 2R3ZA 5T1GA 3MXPA 1R4PB 1S5FD 1SSOA 4LAAA 1O80A 5CV4A 5EKLA 1ILPA 4OL7A 1Z47A 4OIJA 3S2DB 4XIGS 1SJED 1CQFA 1A6XA 1WD1A 3AU7A 3N6RA 4CHTB 3RD4A 5JPNC 5JJZA 4HEDA 4KKSA 3PO2B 3GP7A 3RUZA 4DAPA 5EJWA 3R2IA 3Q23A 2AWNA 1EY9A 2MUYA 4RWSC 3UI2A 5C4XB 4F7XA 3G7LA 4RCNA 1CM9A 4CBVA 5M3MB 2AUKA 1BCPF 4HCEA 1HFGA 2IX1A 2NBFA 1H9MA 1XXGA 1ML0D 1EEFD 1F9SA 4IUNA 1I4XA 1D1KA 5ELDA 3EA6A 4MIUA 1STGA 4K6DA 3J81L 3QO2A 3BG3A 1RCVD 4A3FB 5E1FA 3TBIB 4KD4A 4O1NA 4IZ8A 2JA7B 2BDOA 1X3QA 2J4XA 4A93B 1KTKA 2F0SA 3T56B 4K2KA 3GTQB 4KKTA 5A2QE 1RKNA 2B2TC 1NCVA 1SMYD 4H44C 1Z7TA 4PV1C 1STNA 2Z8LA 3HRZC 3CRLC 2G9HD 4H7BA 1ZYRC 3RLFA 5C3EB 2FINB 3EVQA 4RH6A 4G7HC 2VXWA 5D3DA 2O4XA 4KY5A 1TQOA 5HGTA 2EYHA 3Q22A 5E3FA 2NVQB 3R8BA 4C3IB 3EQLC 1K83B 2RBMA 4K14A 1OXUA 1CT1D 1DCZA 2G9DA 3DUZA 3K6OA 2PYKA 1GJXA 1IKMA 4N9TA 1PRTD 5C44B 5EQ0A 2A73B 1VMCA 1BNZA 5FKAC 2OXPA 2LY7A 1T5EA 4K2LA 1TWCB 2KCNA 2F03A 3HEJA 1GOZA 3NSWA 4NDXA 3J80L 3H3VC 5D3IB 4OGQC 1C48A 1UUPA 3BYYB 2YYZA 1LTTD 4PQXA 2WIIB 2ENBA 2F0FA 2B39A 1HFNA 4CKCA 4DU9A 5FLXE 1A3TA 1PFMA 1AZQA 5G3LD 1B9NA 5DEHA 4I65A 2KQ3A 2IX3A 5BN3A 4RHSA 4B08A 3PIP3 5KYLA 1HHVA 1EY6A 5EKKA 1PYWD 5K36G 1DONA 2AUJD 3TN2A 3IL8A 4XTCS 1V1PB 2F0UA 3SK5A 4LK1C 2WINB 2JE6I 3GTJB 4XQNA 3BDCA 1S5CD 3S1RB 1TR5A 1BR9A 4F87A 4AYBB 3BDLA 1A3UA 3KK7A 2EXZA 5LHY1 3SK8A 3K59A 2VUMB 2KUMA 5LL6S 3X3NA 2IT1A 2MJ8A 1LTRD 1SNOA 3ITPA 4NMZA 5JEAH 3VR2A 4RAUC 1D6EC 1JOQA 5ELFA 3DWPA 2SDFA 3KLSX 1B53A 4R9WA 1BOSA 4JBWA 3GTKB 2JA5B 1SE2A 4ZKBB 1STEA 1PZKD 2A68D 1U4PA 3J7AV 1DJRD 1I3QB 2F0HA 2FJ2A 3FDTA 2C5CA 4CKEA 5JPMC 3GTGB 3NWSA 3T4AC 1STYA 1RHPA 2K33A 4EGVA 1NR4A 2FMMA 2K01A 1ENFA 1ET9A 1PFBA 2F3WA 3MFGA 4XQJA 1JOOA 2K04A 2BE5C 3F2UA 1EWHA 4KY7A 3MHBA 1HTPA 3MXNA 2Z1CA 2NVTB 3HZXA 3J7AF 1VF7A 4X3TA 1HA6A 2V4DA 3I4MB 4X3UA 1STHA 2B2UC 1CZGA 5C0XJ 3J81E 2KECA 1QWYA 1ZEQX 3TP8A 4PMWA 3SE0A 4CGYB 1J9OA 1Y69U 2DY8A 4NP5A 3NPPA 5C0XH 4LMQD 4FXDA 3S1NB 1OXVA 1MBYA 2RDHA 3D4DA 2M2LA 1LT4D 1VMPA 4DA2A 2TSSA 2EDGA 5I2YA 1UEAB 1D2BA 1XWEA 4G7ZC 1F9PA 3J7YW 4IUQA 1TVXA 1I4GA 3A54A 2R93B 2CW0C 4IQZA 3NHHA 4TQUS 1GUSA 4KV6A 2E2JB 1H9RA 3I4LA 3I90A 1TS3A 2F0MA 2F3VA 4LJZC 4EQOA 3DEOA 2XVSA 3M85A 1V43A 1E2WA 1IW7D 4KY6A 1MD2D 4OO1G 2EZVA 2XIWA 2F0PA 3S15B 1EY7A 4Q5VA 3T16A 5G3LF 3R93A 3VA7A 2B2VA 1BUVT 2QEJC 1MI2A 5EPJA 4RGNA 2Q8IB 4ME5A 2PZTA 3GTPB 4X3KA 4E6IA 4C2MB 3H6MA 2EYLA 2JA8B 1YNND 1OXTA 3PIO3 1ILQA 1ZKOA 3LX0A 1SYEA 4RGOS 2F0QA 1JWUD 3OHXC 3HOYB 5IODA 1EQVA 1TWAB 3PMFA 2X6LA 2A6ED 4A3BB 2OF1A 5D65A 4K5XA 2HDLA 5FLXL 2WAQB 1LT6D 2R61A 1U4RA 2ID0A 4MHEA 4F88A 1EU4A 4XDXA 3VR6A 3RZDB 2QILA 1PRTF 3S1QB 3WOEA 1D1IA 3PUVA 3I8ZA 5KNDA 5FK9C 1EY8A 1LABA 1Y1WB 4DAYA 3KLRA 5I9PA 5A2QL 1WTOA 4DXGA 2SNMA 2XNAC 2EY6A 3K57A 1H9JA 4ILWA 5CV5A 2ZXOA 2R6GA 4BA1I 4K5VA 5IGDA 2NTSA 2A69D 4DK0A 3EFXD 1SYGA 4IURA 1LTSD 3TZDA 2JXMB 1JICA 3W3AA 3QG1A 1Y8NB 1S5DD 3O13A 2PZWA 4NKLA 4PMBA 3FPUB 4WRDA 1S4ZA 2E74C 1V1PA 3NK9A 4BBRB 1QOHA 2K32A 4ZUIA 1EIGA 5FO8B 4QCLA 1LV9A 1LACA 2A6HC 2B8FA 4CJ0B 1BBXC 3TP5A 2E76C 3SHLA 3I70A 3MXUA 1F2ZA 1K8MA 4UAIA 5IGEA 2XSCA 1OO9B 5A35A 3KBGA 1M4VA 3IAYA 3P7JA 1G291 3L3OC 4ZK9B 1O7ZA 2N55A 3GTLB 1ONLA 2KHSA 2BOSA 3CU7A 1SBBB 3X3MA 1G6ZA 2EYMA 5IT9E 3MAQA 2DN8A 2E2IB 4RGTA 1PFNA 2JEAI 1AP0A 5K36H 1B9MA 1WTRA 4S3SA 1FR3A 3HOVB 3HOZB 2H4OA 2KJXA 3FVQA 1E2ZA 3DWAA 1H9SB 3R3OA 5DNFA 1LT5D 3RMHA 4OHJA 5DM73 1G2TA 1F2YA 3MEHA 2F4IA 1EY0A 5I2XA 1CQVA 2NVXB 1EFID 4OO1H 1ESFA 1EL0A 4IN3A 1XX8A 3VYRA 4A3IB 4DN4M 5C4ZA 3VYSA 3SVMA 4KMUC 3A56A 4C3HG 2KOLA 1PRTB 2PPBC 3WDNA 2AWOA 1WTWA 5IT9L 5JVH3 3SK6A 2B2YA 4QMGA 1GUNA 1LO5D 1OXXK 4FYDA 1KLUD 4C3IG 2Z4IA 2AQ1B 4K8JA 2D5DA 1KDCA 1EQTA 1B50A 4TKOB 1SNDA 3MA2B 1LT3D 1BF4A 3P1HA 5FOBB 3H94A 1AFPA 4RKLA 3DM1A 1XTCD 4KHVA 2EY1A 4HN7A 3V2TA 2L12A 1JC7A 2RDGA 1Y8PB 3LNNA 4B9XA 4QIWB 3CHBD 1W6KA 2D2CC 1EU3A 1EY5A 4R8NA 1KLGD 2E2HB 4RHRA 2PZUA 1CFMA 4V0BA 2KEDA 1Y1VB 1SFOB 2RVLA 4C1NI 3D6CA 3BS1A 1V1OA 3T53B 1YNNC 2F0KA 3IFTA 3VYUA 2Q8TA 4DXFA 2E75C 5CR3A 1B3AA 3C46A 2NN6I 3V96A 2PNRC 3ONAB 1BCPC 3CKIB 2A68C 2A6EC 3S16B 4BS9A 1WTPA 1S5BD 3GV3A 3S9WA 1O7YA 1Q3LA 3H09A 3H91A 1W6JA 1IL8A 3OMCA 3JAME 1VF5C 1LTGD 5C3XA 2Y0SB 4ZAIA 4XYQA 2KEEA 5CBAE 4J6HA 4A3EB 3DEPA 4WFN3 2C9OA 2QKIC 2B8GA 2F0TA 4KN7C 1SEBD 2PW7A 1ESRA 1SYCA 4IFDH 1HQMC 3QB3A 5CYUA 1HTLD 1OXSC 1YNJC 3C3LA 1RF2D 2EVBA 1HPCA 2NWGA 3BDOA 5C6AA 3NWTA 1CK1A 1TIID 2FMCA 1BCPD 3WOFA 4BY7B 1R4QB 2B2WC 3QOJA 5ELBA 1MSHA 2I46A 4QF4A 5IGGA 1JE4A 1WD0A 5CV8A 3TSSA 3JAML 4X3SA 1QILA 2BA1A 4G4KA 2DY7A 4JK1C 5KGUA 3E5SA 1FNVA 3V05A 3CQZB 1STAA 4HSVA 2WKCA 1C8CA 1PTOD 2PMZB 2EY2A 3HP3A 1E0BA 2GA4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GV3 A;  1TVX A;  1F9Q A;  1EQT A;  1O7Y A;  4MN3 A;  1Q3L A;  1NAP A;  2L4N A;  1O7Z A;  3I8Z A;  4ZK9 B;  4ZKB B;  2N55 A;  1B50 A;  1EIH A;  1GUW A;  1SAP A;  3H91 A;  3Q6S A;  1U4P A;  1IL8 A;  1G2S A;  1ML0 D;  4R8I A;  1ICW A;  1J8I A;  5EKI A;  1F9S A;  1BF4 A;  2B2U A;  3FDT A;  2FJ2 A;  1G6Z A;  1WTO A;  1U4L A;  2FHT A;  4ZAI A;  1KNE A;  3I91 A;  5D14 A;  3I90 A;  1PFN A;  1RHP A;  2KEE A;  3DM1 A;  3DEO A;  1MSG A;  2B2V C;  1NR4 A;  3QO2 A;  2FFK B;  2FMM A;  5CBA E;  1QE6 A;  2HCI A;  1NR2 A;  3DEP A;  1AP0 A;  2CVR A;  2L12 A;  3I3C A;  2K01 A;  1WTR A;  1M8A A;  5T1I A;  1X3Q A;  1PFB A;  2B2T A;  5CMD A;  4IUV A;  1DZ1 A;  4IUQ A;  2X6G A;  4RA8 A;  1QG7 A;  1HFN A;  1DOL A;  1ESR A;  5E4W C;  2XIW A;  2HUG A;  1PFM A;  2HDM A;  2L1B A;  3D6W A;  4IUU A;  1AZQ A;  2K04 A;  4HAE A;  4CJ1 B;  2B2Y C;  3MWY W;  4U68 A;  2EOT A;  2D9U A;  2IL8 A;  4HCS A;  1HUM A;  1WTV A;  1F9R A;  5E4X A;  5COR A;  5DNF A;  1HHV A;  1DOK A;  1G91 A;  4QUF A;  5AFW A;  3F2U A;  1DON A;  3IFD A;  4IUR A;  1G2T A;  2J7Z A;  3TN2 A;  2K28 A;  2B2T C;  3TZD A;  1HRJ A;  1NCV A;  1RTN A;  2K03 A;  1JIC A;  3IL8 A;  2B2V A;  4IUT A;  2NWG A;  3R93 A;  2BDN A;  2JP1 A;  1HUN A;  4OIK A;  2HCC A;  1XYI A;  2K1B A;  2MPM A;  1MI2 A;  5EPK A;  4CJ2 C;  1EL0 A;  4ZLT F;  2R3Z A;  1MGS A;  4NW2 A;  5CBE E;  1U4M A;  4R9W A;  4X3T A;  5EPJ A;  5T1G A;  1HA6 A;  2KVM A;  1CA6 A;  2FIN B;  1SSO A;  1XX8 A;  1O80 A;  2L9H A;  2VXW A;  3FPU B;  4X3K A;  1IKL A;  1S4Z A;  3MTS A;  4X3U A;  1ILP A;  2B2U C;  1ILQ A;  1X32 A;  2NZ1 D;  4DN4 M;  2X69 A;  1F2L A;  2RSO A;  2H1E A;  2KEC A;  4OIJ A;  2B2W C;  1BO0 A;  3SVM A;  2KED A;  1EIG A;  2RVL A;  2EPB A;  1MSH A;  1QNK A;  1WD1 A;  1A15 A;  2Q8R E;  2KOL A;  1JE4 A;  4XT3 B;  2KUM A;  1WD0 A;  2EE1 A;  1SDF A;  1J9O A;  2K05 A;  1ROD A;  2DY8 A;  1RTO A;  2X6L A;  4X3S A;  3LWE A;  1LV9 A;  2MGS A;  4HED A;  5D65 A;  5EPL A;  4XT1 B;  4CJ0 B;  5JJZ A;  1B2T A;  1WTW A;  1PDQ A;  4LMQ D;  2DY7 A;  2MJ8 A;  1X3P A;  2HDL A;  3N52 A;  2B2Y A;  2Q8T A;  1BBX C;  2JYO A;  1B4O A;  4ZKC B;  3GV6 A;  4RAU C;  1WTX A;  1IKM A;  5EJW A;  1U4R A;  2M2L A;  4MHE A;  2L11 A;  1VMP A;  3P7J A;  4RWS C;  3UI2 A;  1WVL A;  1KNA A;  4XDX A;  4UAI A;  1DOM A;  1B3A A;  1ZXT A;  3G7L A;  2N88 A;  2RA4 A;  5COY A;  1AZP A;  1CM9 A;  2MP1 A;  2RSN A;  2SDF A;  4IUP A;  5EQ0 A;  1WTQ A;  1PLF A;  1RJT A;  3KUP A;  1B53 A;  1F9P A;  2NYZ D;  3ONA B;  3KBX A;  4HSV A;  4O42 A;  2B2W A;  1VMC A;  1C8C A;  1CA5 A;  1BNZ A;  1EOT A;  1WTP A;  3HP3 A;  4QUC A;  1E0B A;  1HFG A; 
#chains in the Genus database with same CATH topology
 4YHH Q;  2YTV A;  1NAP A;  2JA8 G;  5M5X B;  2AHO B;  2IHF A;  3NTK A;  4ABN A;  2HD3 A;  1FD7 D;  3BVZ A;  5J22 A;  1PHJ A;  2R7Z B;  4UHV A;  3W2D A;  1IW7 C;  2BA0 A;  4C3H B;  1CZW A;  1E2V A;  4L8J A;  2A5H A;  4K8I A;  1HR0 W;  1KDA A;  1JT8 A;  3RZO H;  1SNC A;  1K8G A;  1TWF B;  3BZK A;  4GOP A;  4BA2 I;  2K4K A;  1CTM A;  2HCI A;  4POF A;  3M7N A;  3ICE A;  4JVZ A;  2F0O A;  3MZ5 A;  4DR1 Q;  5EBC A;  2B2T A;  3J80 i;  1DZ1 A;  4RA8 A;  1QG7 A;  3MFY A;  1E24 A;  1K3B C;  1QUQ A;  3C1F A;  3D4W A;  3M3Y B;  1JWS D;  4I7Z C;  2R7D A;  4KLK A;  1JWM D;  2XN9 C;  3TDQ A;  1YIT A;  4DV1 L;  1VQF A;  1HUM A;  2EJF C;  2EY5 A;  4KI0 A;  1H9K A;  5AFW A;  4YWK A;  5M9O A;  1Q12 A;  3TP7 A;  4X66 L;  3D4R A;  1UWV A;  5ISR A;  1A63 A;  2VZA A;  2HCC A;  4DAV A;  2UUB Q;  4JOI A;  1MIU A;  1UNS A;  4DR3 L;  1O78 A;  3D31 A;  4HMJ A;  1GUT A;  4TVA B;  1SE3 A;  4QJF A;  4P72 A;  1JJG A;  3NBH A;  3W5O A;  1B44 D;  2LXK A;  2G5D A;  2OTJ A;  2E2D C;  2LS0 1;  2LKV A;  1X32 A;  1PH7 A;  1T5X D;  1QZH A;  3HOX H;  4JI6 Q;  5IIF A;  2F0N A;  4L5R C;  3I72 A;  1N36 Q;  4NXM L;  3DWQ A;  2VUM G;  1K9M C;  2VB3 X;  2Q8R E;  1F2M A;  4N9P A;  4DAY B;  1IYU A;  2MGS A;  2OT2 A;  5IT9 c;  1YIJ A;  3PUW A;  2JEB I;  1GHJ A;  5CC4 A;  2JA8 H;  2IW3 A;  1GVP A;  2LMC B;  4YCU A;  2YTY A;  1EEI D;  2JA7 G;  3TME A;  1KC8 C;  5KRU A;  2L15 A;  1IYV A;  1LYL A;  3HGB A;  1JJ2 A;  4IUP A;  2F4V Q;  3PCO B;  4DFA A;  3FRP B;  4FF3 A;  5M5Y B;  1EOT A;  1WTQ A;  3BYT B;  4QQB X;  1F9Q A;  4GS3 A;  5GQO A;  3URY A;  4A3K B;  2O2L D;  1K83 H;  1RD9 D;  2Q2I A;  3ND9 A;  4KJN A;  1G2S A;  2VQE L;  2MHV A;  1SNQ A;  1LTI D;  1KAA A;  3EN2 A;  3AB9 A;  5D14 A;  3QOL A;  3JAM i;  2KCC A;  1I94 Q;  2K5V A;  1NR2 A;  2ZTC A;  1SE4 A;  2H5X A;  1IL2 A;  4DUY L;  1SYD A;  4LFC Q;  4RGM A;  1VQ5 A;  4IUV A;  2F0I A;  1E1T A;  4AIM A;  4A3M G;  3PV0 A;  4P74 A;  4IPC A;  1TU2 B;  1WTV A;  5K5P A;  1ENC A;  3OYY A;  3P20 A;  1G91 A;  3IFD A;  4BWG B;  2D62 A;  3I4O A;  3PUX A;  3HOX G;  1X6O A;  4BY7 G;  1O7L A;  2RCN A;  3Q24 A;  2EIF A;  3K5O A;  2JA5 G;  1GKH A;  2K1B A;  3HKS A;  2K14 A;  2F0D A;  3FMC A;  4TSS A;  3ERQ A;  1U4M A;  3HOW G;  4A3M B;  4K5W A;  1JJC B;  3TS2 A;  5HUR A;  2A74 C;  1WFQ A;  4DV0 Q;  5GAD C;  3A55 A;  3M7G A;  3E9H A;  1UEB A;  2TMP A;  1L0X B;  1KAW A;  2NZ1 D;  1BDO A;  1Z6H A;  4CKB A;  1WOC A;  1SNP A;  3MC0 B;  4ID6 A;  2EPB A;  1QNK A;  4B3S Q;  3RZO B;  1DM0 B;  3E3X A;  1VDZ A;  3J7Z C;  1ROD A;  2WV6 D;  3GTO B;  3HOW B;  4DR7 Q;  2F0J A;  1II3 A;  1PDQ A;  2NTT A;  1Z9F A;  1EIF A;  1X3P A;  2M9V A;  4DR6 L;  2HQE A;  4ZKC B;  1PYB A;  2L11 A;  1QNU A;  2KA7 A;  1L2F A;  2F3I A;  1FGB D;  2KBN A;  4ODG A;  3BVG A;  1AE2 A;  1AZP A;  1B3Q A;  3NE5 B;  3TP6 A;  4B9W A;  1RJT A;  4O42 A;  1Q1B A;  4DV3 L;  1VQI A;  4QUC A;  3GD7 A;  1PYS B;  4A4I A;  1Q81 C;  5CV7 A;  2OTL A;  2WKD A;  1EZ8 A;  4RKB A;  4B3S L;  4U67 3;  2R93 G;  3JC6 6;  1EOV A;  4DPG A;  1JB3 A;  5EKI A;  4UPA A;  2AKW B;  1B70 B;  4ZRZ A;  3K5M A;  1GUG A;  1XMO Q;  2NVT H;  1PVO A;  3G6J B;  4JBJ A;  5BN4 A;  5GAE C;  3CXC A;  2XWB B;  2L5T A;  4C1N K;  2FFK B;  3VA5 A;  3OW7 A;  1LTA D;  4A3D B;  4HSP A;  1Q7Y C;  1STB A;  2JA5 H;  3GTK H;  1H95 A;  2WB1 B;  3CCJ A;  1HQR D;  4IUU A;  4EVO A;  4HAE A;  1G51 A;  3MWY W;  4HTH A;  5KNC A;  1EFW A;  2BH8 A;  4POG A;  5JAV A;  3A8I E;  1EY4 A;  5JVG 3;  3LWU A;  4JI0 L;  4J8Q A;  2CCZ A;  1NJI C;  1YZ6 A;  1VQ8 A;  2K03 A;  1I3Q H;  1SXT A;  4JI5 Q;  1LTB D;  1HUN A;  1HNX Q;  1DXM A;  1I50 B;  2JQO A;  3ER0 A;  1IBL L;  2BE5 D;  5LL6 X;  1N34 L;  3QIA A;  4L63 B;  4Y7N B;  4FF2 A;  3NTI A;  2RCF A;  4FXK C;  3H0G B;  1CKM A;  1TS2 A;  3OIP A;  5IGB A;  4J1M A;  1IHZ A;  2F0W A;  3MTS A;  4B3M L;  5NUC A;  5M3F G;  5DAU A;  1WCM B;  1FJG Q;  3M4P A;  3P75 A;  2BCO A;  4QY7 A;  1PTO H;  4WJW A;  2X69 A;  2RSO A;  4KJO A;  4DV7 L;  4P75 A;  5IP7 H;  2RHS B;  3K58 A;  3OIQ A;  4RG1 A;  2CH4 W;  2L55 A;  2B63 B;  2WAC A;  1YVC A;  1SDF A;  1TKW B;  2SNS A;  4I7A A;  5C4J B;  3D3R A;  1X9N A;  2I5L X;  1A2U A;  3BU2 A;  5M3M G;  1B2T A;  3VR4 A;  2EXD A;  3L2P A;  3ZYY X;  1AEX A;  1CHP D;  3N52 A;  4DUZ L;  5DM6 3;  1PXU A;  2JYO A;  3DXJ C;  1TWG B;  1B4O A;  1RL2 A;  3NUC A;  4DK1 A;  1GXD C;  4C3J B;  2UXC Q;  2WFW A;  4A3J G;  2UXD Q;  1L0Y B;  4EQN A;  2IX0 A;  5CV6 A;  3G71 A;  5JJI A;  1NTG A;  3OOC A;  5IYC G;  5AJ3 Q;  3UDI A;  3M4O B;  5GRO A;  1R9T B;  3KUP A;  2WAQ E;  1N8R C;  2ZT9 C;  3C1E A;  1SNM A;  1AH9 A;  3OSO A;  1QJO A;  1CHQ D;  4FO2 A;  3I4N H;  4MN3 A;  4XYO A;  1K73 C;  5BR8 Q;  2RKS A;  1IBL Q;  3T1Y Q;  2Z6B A;  4Y52 H;  1PTO C;  1HNX L;  1VQG A;  2JA7 H;  3S17 B;  2PQE A;  4XXE A;  5I6W A;  5CV9 A;  5LMU Q;  1Q8K A;  2UU9 L;  4LF7 Q;  4ALP A;  2CHB D;  4IFD G;  3Q0A A;  2FHT A;  1VCI A;  1E7Z A;  2K75 A;  1XJV A;  1K0S A;  2VL6 A;  2E5L L;  4BY1 B;  2XWJ B;  4OWT B;  1Q8I A;  1EUJ A;  3C2P A;  1AW7 A;  1QE6 A;  1VQJ A;  3FPP A;  1EYC A;  3GTP H;  5I9O A;  4HR7 B;  3UDG A;  3K5L A;  2HHH Q;  2JA6 B;  1KAB A;  2UXB L;  1PZJ D;  4HJ9 A;  3A5Z B;  1KIX A;  1DOL A;  1FYC A;  2A1A A;  4JI1 L;  5M5W H;  1TWH B;  2EJG C;  5JOB A;  1VQP A;  4CJ1 B;  2B2Y C;  5C5M A;  4A3C G;  3NP8 A;  3H3V H;  1VQB A;  3HG9 A;  1BXT A;  4ZUJ A;  1FGU A;  2RDF A;  2UU9 Q;  5EAY A;  3U9S A;  1LUZ A;  1RTN A;  4OWW B;  3SR1 A;  1GUO A;  2Q2U A;  4OIK A;  2O5J C;  1XYI A;  5IWA Q;  2ALY B;  5IP7 G;  4CJ2 C;  3A8J E;  4ZLT F;  4BXX H;  3M4Q A;  3K7A B;  5CBE E;  1HNW L;  3J80 c;  2KVM A;  4ULL A;  4FF4 A;  1Q1E A;  4PNY A;  1D5X C;  2NZH A;  3TZU A;  1SMY C;  4X64 L;  4DR2 L;  1ZYR D;  5GAG C;  2H1E A;  4BY7 H;  3TS0 A;  5IYC H;  5J39 A;  4UP8 A;  4IJH A;  4N8F A;  1A15 A;  2K50 A;  3RLO A;  2K7V A;  3A8K E;  4K6L A;  3K0Y A;  1FNW A;  3OWF A;  3TRE A;  1YHQ A;  1HZC A;  3RLN A;  4DK3 C;  2PCF B;  3SXH A;  1CKO A;  4HIK A;  2F0E A;  1FNU A;  2O5I C;  3HKZ B;  4A3D H;  4ZQ3 A;  4CDC C;  1V1Q A;  1LTL A;  4KHP L;  3KLS A;  4FF1 A;  1D5Z C;  1GO3 E;  4K0K Q;  3VR3 A;  1I4Q A;  2B2W A;  1PRT C;  1TY0 A;  3GTM B;  4QGU A;  4NXN L;  1I4P A;  2B3G A;  2NN6 H;  4DV5 L;  1AN8 A;  1ENA A;  3HOU B;  1SYF A;  2E8G A;  1SAP A;  4IAL A;  1RDP D;  5ELN A;  1S40 A;  1JQY D;  5FO9 B;  2B2U A;  2A6H D;  1B1Z A;  4YWM A;  5C0X I;  4UY8 C;  2CWA A;  2CQA A;  2LFN A;  3OWE B;  3L7Z C;  4FVM A;  4ZYS A;  1EYA A;  3QWN A;  2R92 B;  4JI2 Q;  5IWA L;  2CQO A;  4BBR G;  3K80 C;  1VQD A;  2KCM A;  1YNJ D;  2XRQ D;  2OEO A;  5ELC A;  4L6T B;  1SJH D;  1PV4 A;  2L1B A;  1N33 L;  1J5E Q;  4U68 A;  4AYB G;  2D9U A;  2IL8 A;  4L5Q A;  5EBD A;  3S1R H;  1B7Y B;  4LFB Q;  2JA9 A;  1H9S A;  5E4X A;  4QUF A;  5LMN L;  2J7Z A;  1Y8O B;  4A3J B;  2HT1 A;  4IUT A;  1D5M C;  3M4Y A;  4XQQ A;  2VUM H;  2MPM A;  5BN5 A;  2BH2 A;  1RIP A;  3OMG A;  1EWC A;  1JOK A;  3OPO A;  5C3E G;  3KLW A;  4DNR B;  2L9H A;  1BBU A;  3E6Z X;  2EYP A;  4GLX A;  3NEL A;  4F8M A;  4LF6 Q;  2EYO A;  2VB2 X;  1VQ7 A;  4A3D G;  4DV4 L;  1F2L A;  4EQP A;  4C3I H;  4DF7 A;  1I4R A;  5IGC A;  3GTL H;  1BO0 A;  4HID A;  4X65 L;  3I7F A;  4DR6 Q;  2I5M X;  3GO5 A;  5IP9 G;  1QB5 D;  3BZC A;  3E0E A;  2HIV A;  2K5W A;  3D8G A;  4LW1 A;  3ERO A;  5EPL A;  1VQ4 A;  2F1M A;  1FVI A;  2NN6 G;  4JW0 A;  2F0V A;  2NB0 A;  1WJJ A;  1X3F A;  2I07 B;  2SEB D;  1VQA A;  1PTO F;  1KNA A;  2AQ3 B;  2ICI A;  1VQC A;  3NQI A;  2CW0 D;  1ZXT A;  3HS0 C;  5M5W B;  1EYD A;  2PW5 A;  3KBX A;  5FLM H;  1XNR L;  1DYQ A;  1MJC A;  2K5Q A;  3VR5 A;  2DJF C;  3AMU A;  4A3L H;  5F2D A;  2NVY B;  2OQK A;  3QJY A;  1HXY D;  1PFS A;  1Q90 A;  4GZY C;  4GLA C;  4DR5 Q;  5EGT A;  5C44 G;  1Y14 B;  4X62 Q;  4LFB L;  2IY5 B;  4YIJ A;  4MZ9 A;  1J5E L;  1I6H H;  1MSG A;  3BVM A;  1HCZ A;  1XMQ L;  3I3C A;  1M8A A;  1KRS A;  3NBI A;  4RCO A;  3SDZ A;  3MVV A;  4FXG C;  4LF4 Q;  4JBK A;  3KJO A;  1U9R A;  3CRK C;  4JI0 Q;  2ZM6 L;  1TS4 A;  4IOA A;  4BBS B;  4UDU C;  1F9R A;  2M00 A;  5COR A;  1DOK A;  3S2H B;  3W1B A;  4OO1 I;  3MXN B;  5I6Y A;  3J80 E;  1P16 A;  2JP1 A;  4IO9 A;  3IKJ A;  1HA5 A;  4RFB A;  5EPK A;  4YCV A;  4YHH L;  1BCP B;  1DD2 A;  3ND8 A;  4EQ5 A;  4NXN Q;  1JOR A;  1XNR Q;  3F8T A;  3GQB A;  3IRB A;  4NB3 A;  3SK4 A;  3S1N H;  3CD6 A;  4O0A A;  3HOZ H;  2QCP X;  3FP9 A;  3S14 B;  1PH9 A;  2QF7 A;  4H0L C;  1Y1V G;  4UP9 A;  4G7O C;  2VW9 A;  5C5L A;  4BXX G;  4XT3 B;  4DGZ A;  2EE1 A;  1EQR A;  5IGF A;  1GM5 A;  1RTO A;  4P2C B;  5C4H A;  1SYB A;  3PUY A;  3TQY A;  3KF8 A;  4XT1 B;  1C0A A;  3PIO A;  1I6V C;  2XRS D;  1NUC A;  2J0T D;  4P73 A;  3HOX B;  1A2T A;  2R93 H;  4DR2 Q;  1KHI A;  1DOM A;  5KYI A;  4CDE C;  2RA4 A;  5COY A;  1XPU A;  2RSN A;  3VYT A;  3CPW A;  2K5D A;  4KKU A;  2NYZ D;  4QB4 A;  4DK6 C;  2AQ2 B;  4FP5 D;  5J1Z A;  3J81 i;  3L0O A;  2VNU D;  1NNX A;  1D8L A;  2OQ0 A;  2XGT A;  5JEA G;  1EIH A;  2L4N A;  4KK7 A;  1GUW A;  2UUB L;  2PO4 A;  1GHK A;  4C3J G;  1J8I A;  3E0J A;  4TRD A;  5FO7 B;  5JJK A;  1BVS A;  3A7L A;  2RF4 A;  1U4L A;  2EYJ A;  4H13 C;  4G57 A;  2RQX A;  4MTK A;  2JSO A;  4DV0 L;  1EIY B;  1VQE A;  2B2V C;  4V19 0;  3EBE A;  3FEW X;  2CVR A;  1K8O A;  3NXW A;  5T1I A;  2F0L A;  1JE5 A;  2ZXR A;  2UXB Q;  3MEF A;  5I4D A;  4N8X 1;  1F77 A;  3MXG A;  5CMD A;  4JI2 L;  3DMU A;  2X6G A;  1HZB A;  2ZXP A;  1NSN S;  1PH5 A;  4A3G B;  5LMN Q;  5JJL A;  2HDM A;  3D6W A;  2V1C C;  4DR4 L;  2EOT A;  4HCS A;  3RN2 A;  4KD3 A;  3SEB A;  2Z4H A;  4DNT B;  1TT2 A;  2GVB A;  4C56 C;  4FNF A;  4R4T A;  2K28 A;  1V8Q A;  4L5T A;  5M3F B;  3FKI B;  2BDN A;  3K5N A;  3KYH C;  3AFQ A;  1TWA H;  1MGS A;  4NW2 A;  5KEE A;  4HIO A;  1CA6 A;  4HMI A;  1M90 C;  4JI7 L;  1QCB D;  1IKL A;  4JI3 Q;  3S16 H;  2QDB A;  1WCM H;  1EZ6 A;  1PTO B;  4R1J A;  3KFU A;  3NQT A;  1S5E D;  1JR0 D;  3U9O A;  4IFD J;  3PUZ A;  3T13 A;  2WP8 J;  4GKJ L;  1WTH A;  2ZJQ A;  2F0G A;  2K05 A;  1I6H B;  2A69 C;  3LWE A;  3K0X A;  5C4J H;  3NTH A;  4KHZ A;  3UE1 A;  3OTO Q;  3S1Q H;  1PZI D;  3I4N G;  3H15 A;  5KIX A;  3GV6 A;  1WTX A;  4K0K L;  4DV7 Q;  1TWG H;  3EJI A;  2K6A A;  1WVL A;  4C3J H;  2NUC A;  1U5K A;  4KN4 C;  2N88 A;  5CGK A;  3VDY A;  3R2T A;  2MP1 A;  1C4Q A;  1J6Q A;  1UAP A;  1FJG L;  4M1U B;  1PLF A;  1HRJ A;  3PO3 B;  1CA5 A;  5IOC A;  4DV6 Q;  3EIV A;  3A7A B;  1CI3 M;  4GNX C;  5KNB A;  5C3W A;  3I73 A;  5C0X G;  1LLR D;  2SOB A;  1ET6 A;  4WJ3 M;  3I4N B;  4Z9C B;  4PMC A;  4IFD I;  3Q6S A;  4M8A A;  2KCT A;  2DUD A;  2ICE C;  4R8I A;  1ICW A;  5ELE A;  3KF8 B;  1PMR A;  1ASY A;  3CC2 A;  1IZ6 A;  1TS5 A;  1TY2 A;  3AQQ A;  1KNE A;  5FLM G;  2YU9 B;  3I91 A;  2L0C A;  3AEV A;  1EQQ A;  1EWI A;  1HJP A;  1UE6 A;  4DR4 Q;  3S1M B;  3BZD B;  4QIW E;  4YY3 L;  2Q2H A;  3T51 B;  2ATW A;  2IWH A;  1Y1W G;  4DR3 Q;  3F2D A;  2CWP A;  4DV2 Q;  2EJM A;  2IPK D;  4X66 Q;  2DNC A;  5C44 H;  1I4H A;  4A75 A;  5E4W C;  2EYF A;  5JEA J;  3KOJ A;  2HUG A;  3OW2 A;  3DHQ A;  4WOR A;  2VQF L;  2DNE A;  4Q0F A;  3DM3 A;  1QVF A;  4KTA A;  1N33 Q;  1JCK B;  2WB1 E;  1A3V A;  3F2B A;  1YHB A;  3L9A X;  1KDB A;  2IJ0 A;  1N32 L;  5TSS A;  1BQQ T;  5BR8 L;  2HHH L;  1G8Z D;  2R3Z A;  1E22 A;  2KHJ A;  5T1G A;  3MXP A;  1R4P B;  1S5F D;  1SSO A;  4LAA A;  1O80 A;  5CV4 A;  3CQZ H;  5EKL A;  1ILP A;  4OL7 A;  2MQH A;  3T1H Q;  1Z47 A;  4OIJ A;  5FLX c;  3U50 C;  3S2D B;  4XIG S;  1SJE D;  1CQF A;  1A6X A;  1WD1 A;  3AU7 A;  4EX5 A;  3N6R A;  4CHT B;  4JPB W;  4ME3 A;  3RD4 A;  5JPN C;  5JJZ A;  4HED A;  4KKS A;  3PO2 B;  3GP7 A;  3RUZ A;  4DAP A;  4DV6 L;  3I4M G;  3HOZ G;  1TWF H;  5EJW A;  3R2I A;  3Q23 A;  3UDX A;  2AWN A;  1EY9 A;  2DGY A;  2MUY A;  4RWS C;  3UI2 A;  1JMC A;  5C4X B;  1NBW A;  4F7X A;  3G7L A;  2UUC Q;  4RCN A;  1CM9 A;  4CBV A;  5M3M B;  4GKK L;  2AUK A;  1BCP F;  4HCE A;  1HFG A;  3M3Y H;  2IX1 A;  2NBF A;  1IXR A;  2HIX A;  1X65 A;  2N3S A;  4LF9 Q;  1H9M A;  3RN5 A;  1IYJ B;  3FKI H;  1UE5 A;  1Y1W H;  1PH1 A;  1XXG A;  1ML0 D;  3CC7 A;  1EEF D;  1F9S A;  2JN4 A;  4IUN A;  1R9T H;  1I4X A;  1D1K A;  5ELD A;  4B3M Q;  3EA6 A;  4MIU A;  1T9H A;  1STG A;  3KDF B;  4K6D A;  3J81 L;  3QO2 A;  3BG3 A;  1RCV D;  4A3F B;  3K81 C;  3KF6 A;  5E1F A;  4JOI C;  3TBI B;  4KD4 A;  4O1N A;  1VQL A;  2AMC B;  3A0J A;  4IZ8 A;  2JA7 B;  2BDO A;  3KF6 B;  4L5S A;  1X3Q A;  2J4X A;  4A93 B;  1KTK A;  2F0S A;  3T56 B;  1D7Q A;  4K2K A;  4R4C A;  4BY1 H;  4JYA L;  1P8L A;  1AE3 A;  3GTQ B;  4KKT A;  4X62 L;  5A2Q E;  1Q46 A;  2R7Z H;  1S3O A;  1RKN A;  2B2T C;  1NCV A;  1SMY D;  4LFA L;  1X54 A;  1X56 A;  4H44 C;  4JI4 Q;  1Z7T A;  4PV1 C;  1STN A;  2Z8L A;  3HRZ C;  3CRL C;  1SLJ A;  4YCW A;  2G9H D;  4H7B A;  1ZYR C;  3RLF A;  5C3E B;  2FIN B;  2PNH A;  3EVQ A;  4DV3 Q;  1KL9 A;  4RH6 A;  4G7H C;  2UUA L;  2VXW A;  5D3D A;  2O4X A;  4KY5 A;  1TQO A;  5HGT A;  2EYH A;  3Q22 A;  4HJ8 A;  3CCR A;  5E3F A;  2NVQ B;  3R8B A;  4C3I B;  3EQL C;  1K83 B;  2YU9 H;  1NY4 A;  2RBM A;  4K14 A;  1OXU A;  1CT1 D;  1DCZ A;  2G9D A;  3DUZ A;  3K6O A;  1A8V A;  2PYK A;  1GJX A;  1IKM A;  1W3S A;  4N9T A;  3FKI G;  1PRT D;  5AJ3 L;  2QA4 A;  4LF8 L;  5C44 B;  2Z0S A;  1WYD A;  1VS0 A;  5EQ0 A;  1FL0 A;  2A73 B;  1OTC A;  1VMC A;  1BNZ A;  1UE1 A;  5FKA C;  2OXP A;  1L1O C;  1BKB A;  2LY7 A;  3J81 j;  1T5E A;  3TRZ A;  4K2L A;  3ULP A;  1TXY A;  1YBY A;  4LFA Q;  1TWC B;  3AYH B;  3Q8D A;  2KCN A;  3NEN A;  2F03 A;  3HEJ A;  1GOZ A;  3NSW A;  4NDX A;  1M1K C;  3J80 L;  3H3V C;  3GTM H;  5D3I B;  4OGQ C;  1C48 A;  1UUP A;  4B3T L;  3BYY B;  2YYZ A;  1LTT D;  4R4Q A;  2PI2 A;  3S2D H;  4PQX A;  1HR0 L;  2WII B;  2ENB A;  4YWL A;  2F0F A;  4JI5 L;  2B39 A;  2N8N A;  5M5Y H;  1HFN A;  2E2H H;  4CKC A;  4DU9 A;  3UE0 A;  5FLX E;  1A3T A;  1PFM A;  1AZQ A;  3CCE A;  5G3L D;  1B9N A;  5DEH A;  4I65 A;  2KQ3 A;  2IX3 A;  5BN3 A;  4RHS A;  4B08 A;  3PIP 3;  3QR8 A;  5KYL A;  1HHV A;  1EY6 A;  5EKK A;  1PYW D;  2ZM6 Q;  3GTO H;  5K36 G;  1DON A;  2AUJ D;  1GD7 A;  3TN2 A;  3S2H H;  2CH4 A;  5J3B A;  2NVX H;  3IL8 A;  4XTC S;  1V1P B;  2GN5 A;  2VQE Q;  2F0U A;  4IPG A;  1U0L A;  4LFC L;  4B3R Q;  1Y1V H;  2P5Z X;  3SK5 A;  4LK1 C;  2WIN B;  2JE6 I;  3CPF A;  4DV5 Q;  3GTJ B;  4HIM A;  4XQN A;  3BDC A;  2E2J H;  1S5C D;  3S24 A;  4GKK Q;  3S1R B;  1TR5 A;  1BR9 A;  4F87 A;  4AYB B;  4A3F G;  3BDL A;  1A3U A;  3KK7 A;  2EXZ A;  4A3J H;  1I5F A;  4R4I A;  4DR5 L;  5LHY 1;  4HJ7 A;  3SK8 A;  3K59 A;  2VUM B;  2MO1 A;  2KUM A;  5LL6 S;  1PH8 A;  3X3N A;  2MNA A;  1A0I A;  2IT1 A;  4GN5 A;  2MJ8 A;  4NMZ A;  1LTR D;  1SNO A;  2IHE A;  2EQS A;  3ITP A;  3VR2 A;  5JEA H;  3I55 A;  4RAU C;  3LGJ A;  1D6E C;  2K52 A;  4AQY L;  1JOQ A;  4A76 A;  3T1H L;  5ELF A;  3DWP A;  4GOP C;  3M9B A;  2SDF A;  3JAM c;  3PF5 A;  1MJE A;  3KLS X;  1B53 A;  4R9W A;  1BOS A;  1CKN B;  4JBW A;  3GTQ H;  3GTK B;  2JA5 B;  1SE2 A;  1XTD A;  2K5N A;  4ZKB B;  1STE A;  1PZK D;  4GN3 B;  2A68 D;  1U4P A;  4JI4 L;  3J7A V;  1K28 A;  4NXM Q;  4PG3 A;  1YJ9 A;  1DJR D;  1I3Q B;  2F0H A;  2FJ2 A;  3FDT A;  4A93 G;  2C5C A;  3ULJ A;  4CKE A;  5JPM C;  3GTG B;  3NWS A;  3T4A C;  2VQF Q;  1STY A;  1RHP A;  2UUA Q;  2K33 A;  4EGV A;  4A3B H;  1NR4 A;  2FMM A;  2K01 A;  2NVQ H;  1ENF A;  1ET9 A;  1CUK A;  1PFB A;  2F3W A;  3MFG A;  2XTI A;  4XQJ A;  2QW7 A;  3I2Z A;  3AFP A;  4OWX B;  3RZD H;  4IPH A;  1JOO A;  1HZ9 A;  2K04 A;  1IBK L;  2RHQ B;  5IYB G;  3WWV A;  4JI8 Q;  2BE5 C;  2D0P A;  3DLL A;  3F2U A;  1EWH A;  4KY7 A;  2OCE A;  1WCM G;  3MHB A;  1K0R A;  1HTP A;  3MXN A;  2Z1C A;  2NVT B;  3HZX A;  3J7A F;  4DUY Q;  1VF7 A;  4LUO A;  4X3T A;  1XMQ Q;  1HA6 A;  1PA6 A;  3NEM A;  1I94 L;  1NE3 A;  2V4D A;  3I4M B;  4X3U A;  1STH A;  2B2U C;  1CZG A;  5C0X J;  3J81 E;  5IYD H;  2KEC A;  2PI2 E;  1QWY A;  1ZEQ X;  4AH6 A;  4OEL B;  3TP8 A;  1CSP A;  1Q82 C;  3J81 c;  3S17 H;  4PZ7 A;  4PMW A;  3SE0 A;  4CGY B;  1J9O A;  3OTO L;  1Y69 U;  2DY8 A;  3W1G A;  4NP5 A;  3PO2 G;  2CFM A;  3NPP A;  1N9W A;  4LMQ D;  3TEH B;  5C0X H;  4FXD A;  3S1N B;  4BBS G;  1OXV A;  1MBY A;  2RDH A;  1SRU A;  2M2L A;  3D4D A;  1XNQ Q;  2Z6K C;  2CKZ B;  1LT4 D;  1VMP A;  4DA2 A;  2TSS A;  2EDG A;  5I2Y A;  4LF8 Q;  1UEA B;  1D2B A;  1XWE A;  4G7Z C;  1F9P A;  3J7Y W;  1VQN A;  4CDD C;  2Z9H A;  2A8V A;  4IUQ A;  4X6A H;  1TVX A;  3NBH B;  4CDF C;  2K5H A;  3U4V A;  1I4G A;  3A54 A;  1IBM Q;  3B6Y A;  2WAQ G;  1L1O B;  2FXQ A;  2R93 B;  4BBR H;  2R92 G;  2CW0 C;  4IQZ A;  3NHH A;  4TQU S;  4JI6 L;  1GUS A;  3CC4 A;  4KV6 A;  2E2J B;  1S72 A;  1H9R A;  3I4L A;  3I90 A;  4H02 A;  1TS3 A;  2F0M A;  2F3V A;  5IE8 A;  4LJZ C;  4EQO A;  3DEO A;  3G48 A;  3PGZ A;  2XVS A;  3M85 A;  4ZCK A;  1V43 A;  4JI1 Q;  4WJ4 A;  2LSS A;  5FJ8 H;  3G6E A;  3M4O H;  1PH2 A;  1E2W A;  1IW7 D;  2Y0S G;  4KY6 A;  3U4Z A;  1B8A A;  3FHW A;  1MD2 D;  4IOC A;  4JV5 L;  4OO1 G;  2EZV A;  2XIW A;  3A5U A;  3ZJY C;  4DAM A;  2F0P A;  3S15 B;  2KEN A;  4JYA Q;  1X55 A;  4PZ8 A;  1EY7 A;  4Q5V A;  3T16 A;  5G3L F;  3R93 A;  3VA7 A;  2B2V A;  4FDB A;  3CP0 A;  4DR1 L;  1IBM L;  1BUV T;  2QEJ C;  3A74 A;  1MI2 A;  5IP9 H;  4A3G H;  5GAH C;  5EPJ A;  4RGN A;  2Q8I B;  4ME5 A;  2E2I H;  2PZT A;  3GTP B;  4X3K A;  4E6I A;  4C2M B;  3H6M A;  3CCS A;  2EYL A;  3K8A A;  1C7Y A;  2JA8 B;  3CMA A;  2C35 B;  1YNN D;  1OXT A;  3PIO 3;  1ILQ A;  1ZKO A;  3LX0 A;  2QGQ A;  3HKZ G;  1SYE A;  4RGO S;  3HOU H;  2JK8 A;  1XNQ L;  2F0Q A;  2OWO A;  1JWU D;  2Z6K A;  3OHX C;  3GTG H;  4O2D A;  3STB C;  5IOD A;  3HOY B;  1EQV A;  4OON A;  1TWA B;  3PMF A;  2X6L A;  4GNX B;  2A6E D;  3U58 A;  4A3B B;  2OF1 A;  5D65 A;  1YNX A;  4K5X A;  2HDL A;  5FLX L;  3HFZ B;  2WAQ B;  1LT6 D;  2R61 A;  1U4R A;  2ID0 A;  1NMG A;  4MHE A;  4F88 A;  1EU4 A;  4XDX A;  4KHP Q;  3VR6 A;  2R92 H;  3RZD B;  1PH6 A;  5C4X H;  4IPD A;  4LUZ A;  4JI7 Q;  2QIL A;  1PRT F;  5M3M H;  3CF5 A;  3S1Q B;  3WOE A;  4LUV A;  4LWC A;  1D1I A;  3PUV A;  3I8Z A;  4A3I H;  1N34 Q;  5KND A;  2YV5 A;  5FK9 C;  1EY8 A;  3RNU A;  4LNQ A;  1LAB A;  1Y1W B;  4JBM A;  2A19 A;  2ASB A;  4DAY A;  1E3P A;  3KLR A;  5I9P A;  5A2Q L;  1WTO A;  4DXG A;  4JI8 L;  2SNM A;  3PO3 H;  2XNA C;  4JI3 L;  4BY1 G;  2EY6 A;  3F1Z A;  3K57 A;  1H9J A;  1VQ6 A;  1ICF B;  4ILW A;  1HNZ L;  5CV5 A;  2ZXO A;  2HQL A;  2R6G A;  3GDE A;  1N32 Q;  1QZG A;  4PZ6 A;  1HR0 Q;  4BA1 I;  3CCM A;  4K5V A;  5IGD A;  2NTS A;  4A93 H;  2A69 D;  3H0G G;  1MKH A;  4A3B G;  1IBK Q;  4DK0 A;  3S1M H;  1EYG A;  3EFX D;  4MNO A;  1SYG A;  4IUR A;  1LTS D;  3TZD A;  4DNI A;  2JXM B;  1JIC A;  3W3A A;  3QG1 A;  1E1O A;  4AYB E;  1Y8N B;  3ULL A;  1S5D D;  4NPS A;  3O13 A;  2PZW A;  4NKL A;  4PMB A;  1CSQ A;  4A3C H;  3FPU B;  3PF4 A;  4WRD A;  1S4Z A;  2E74 C;  1V1P A;  1XMO L;  3KDF A;  3NK9 A;  1YI2 A;  4BBR B;  4GOP B;  1QOH A;  2K32 A;  4GNX A;  4ZUI A;  1EIG A;  5FO8 B;  2N78 A;  2I5H A;  4QCL A;  1LV9 A;  1LAC A;  2A6H C;  2B8F A;  4CJ0 B;  4HJ5 A;  3CCV A;  1BBX C;  3TP5 A;  4A3I G;  2E76 C;  3SHL A;  3MXU A;  1HZA A;  3I70 A;  1F2Z A;  1K8M A;  2ZTE A;  1SR3 A;  4UAI A;  2D0O A;  5IGE A;  2XSC A;  2UXD L;  1OO9 B;  5A35 A;  3KBG A;  1M4V A;  3IAY A;  3S15 H;  3P7J A;  1Q86 C;  3PO2 H;  1G29 1;  4DR7 L;  4A3K H;  3L3O C;  4BBS H;  4RMF A;  1KRT A;  1O7Z A;  4ZK9 B;  2N55 A;  1BBW A;  3GTL B;  1ONL A;  3PSI A;  2PMZ E;  2KHS A;  2BOS A;  3CU7 A;  2Q2T A;  1SBB B;  2DJG C;  3X3M A;  1G6Z A;  2EYM A;  1QVC A;  1SFO H;  5IT9 E;  3MAQ A;  2DN8 A;  2E2I B;  4GLV B;  4C2M H;  4RGT A;  1PFN A;  2JEA I;  1PH4 A;  4OX9 L;  1K3R A;  1AP0 A;  1KQS A;  5K36 H;  2QEX A;  1B9M A;  1WTR A;  4P71 A;  2ES2 A;  4S3S A;  4LF4 L;  1FR3 A;  3HOV B;  1I50 H;  3HOY H;  3HOZ B;  1A62 A;  2H4O A;  1SRO A;  2KJX A;  3S14 H;  3FVQ A;  4Y7N H;  4R4O A;  1E2Z A;  4B3T Q;  3DWA A;  1H9S B;  3R3O A;  2GVA A;  2ZJP A;  5DNF A;  1LT5 D;  3RMH A;  4A3F H;  4OHJ A;  1KXL A;  1QVG A;  5DM7 3;  1G2T A;  5FJ8 G;  1F2Y A;  3MEH A;  2F4I A;  1EY0 A;  5I2X A;  1CQV A;  4OXP A;  2NVX B;  1EFI D;  4OO1 H;  1ESF A;  4A3M H;  2VS1 A;  1EL0 A;  2B63 H;  4IN3 A;  2LXJ A;  4OX9 Q;  3GTJ H;  1XX8 A;  2JJQ A;  3VYR A;  4A3I B;  2MFI A;  2F4V L;  3CCU A;  1C9O A;  4A3E H;  4DN4 M;  5C4Z A;  3VYS A;  2R7F A;  3SVM A;  4KMU C;  3RR5 A;  3A56 A;  4C3H G;  3CME A;  3E9I A;  2KOL A;  3K7U C;  3KJP A;  3CCL A;  3HOW H;  5C3E H;  3SGI A;  1PRT B;  2PPB C;  3WDN A;  2AWO A;  4DKA C;  2KHI A;  1WTW A;  5ELO A;  5IT9 L;  5JVH 3;  3SK6 A;  2B2Y A;  4QMG A;  1GUN A;  1LO5 D;  1OXX K;  4FYD A;  4LF5 L;  1KLU D;  5E7N A;  4C3I G;  1N36 L;  2Z4I A;  5H1S E;  2AQ1 B;  3PQI A;  2F52 A;  4AQY Q;  1VQ9 A;  1G6P A;  5IY0 A;  4K8J A;  1YEZ A;  2D5D A;  2ZJR A;  1YJN A;  1KDC A;  5HGQ A;  1HNW Q;  1VQO A;  1EQT A;  1XPR A;  1B50 A;  4TKO B;  1SND A;  3G4S A;  3HOV G;  4X65 Q;  3MA2 B;  1YHA A;  1LT3 D;  4GN4 B;  1LM0 A;  5C4X G;  3HOY G;  1BF4 A;  3P1H A;  2ZTD A;  5FOB B;  3H94 A;  3F2C A;  2QDL A;  1AFP A;  4DV1 Q;  4RKL A;  3DM1 A;  5IYB H;  1XTC D;  4KHV A;  4A3L G;  2EY1 A;  4HN7 A;  3UDF A;  4JV5 Q;  3V2T A;  2L12 A;  1JB7 A;  1K8A C;  1O7I A;  1JC7 A;  2RDG A;  4B3R L;  1TWC H;  1Y8P B;  2MO0 A;  1MHW C;  3LNN A;  4B9X A;  4QL5 A;  4QIW B;  3K7A H;  2B63 G;  1WI5 A;  3CW2 C;  5HY6 A;  2E5L Q;  3CHB D;  3ERS X;  1W6K A;  2JA6 G;  4LF7 L;  1XPO A;  5M5X H;  4A3E G;  2D2C C;  1EU3 A;  2YTX A;  5IYD G;  1EY5 A;  1CKN A;  4R8N A;  1KLG D;  2E2H B;  4LF9 L;  3H0G H;  4C3H H;  4RHR A;  1HNZ Q;  2PZU A;  1CFM A;  4HJA A;  3I4M H;  1L1O A;  4V0B A;  2KED A;  1Y1V B;  3I56 A;  1SFO B;  2RVL A;  4C1N I;  1X3E A;  3J7A 5;  3D6C A;  3BS1 A;  1UE7 A;  1V1O A;  3T53 B;  1YNN C;  1X3G A;  2F0K A;  2Y0S E;  3IFT A;  3VYU A;  5M3F H;  2Q8T A;  3STB D;  4DXF A;  2I0Q A;  1L0W A;  4APV A;  3HOV H;  2E75 C;  5CR3 A;  1QUQ B;  4X64 Q;  1B3A A;  3C46 A;  2NN6 I;  1SE8 A;  3V96 A;  2PNR C;  3ONA B;  1BCP C;  3CKI B;  2A68 C;  2A6E C;  3S16 B;  4BS9 A;  1WTP A;  1S5B D;  1SMX A;  1V9P A;  3GV3 A;  1VQK A;  1ASZ A;  5DLQ E;  1O7Y A;  3S9W A;  1Q3L A;  4JG2 A;  3H09 A;  3H91 A;  1W6J A;  1IL8 A;  3OMC A;  2N49 A;  3JAM E;  4UP7 A;  1VF5 C;  1LTG D;  4DV4 Q;  5C3X A;  1W2B A;  2Y0S B;  4ZAI A;  4LF6 L;  3PIP A;  4XYQ A;  3HKZ E;  2KEE A;  4A3K G;  1PH3 A;  5CBA E;  2PQA A;  4J6H A;  4A3E B;  3DEP A;  2JA6 H;  2R7Z G;  4WFN 3;  2C9O A;  2QKI C;  5L37 A;  4DV2 L;  4OEM B;  5LMN W;  1TWH H;  2B8G A;  2F0T A;  4KN7 C;  1SEB D;  2PW7 A;  1ESR A;  1SYC A;  3D0F A;  2VY3 A;  4JC0 A;  1HQM C;  4IFD H;  2WB1 G;  1KD1 C;  4A3G G;  3QB3 A;  5CYU A;  1HTL D;  1OXS C;  1YNJ C;  3C3L A;  1RF2 D;  2EVB A;  2PQA B;  3CAM A;  1HPC A;  1NMF A;  4JCV E;  3HOU G;  2NWG A;  4MTN A;  3BDO A;  1HH2 P;  1YJW A;  5C6A A;  3NWT A;  3CCQ A;  2NZO A;  1CK1 A;  4YY3 Q;  1TII D;  2FMC A;  1VQM A;  1BCP D;  3WOF A;  4BY7 B;  5LMU L;  1R4Q B;  4LF5 Q;  2B2W C;  2UXC L;  3QOJ A;  5ELB A;  1MSH A;  1DGS A;  2I46 A;  4QF4 A;  5IGG A;  3T1Y L;  1JE4 A;  2B29 A;  5CV8 A;  1WD0 A;  3TSS A;  3JAM L;  4X3S A;  1VQH A;  4IJL A;  4J15 A;  1QIL A;  2BA1 A;  4G4K A;  1SN8 A;  2DY7 A;  4GKJ Q;  2NVY H;  4JK1 C;  2UUC L;  5KGU A;  3BJU A;  3E5S A;  3H3V I;  1FNV A;  3V05 A;  3CQZ B;  1STA A;  4DUZ Q;  3PO3 G;  4HSV A;  2WKC A;  1PTO D;  2PMZ B;  1C8C A;  2EY2 A;  3HP3 A;  1E0B A;  2GA4 B; 
#chains in the Genus database with same CATH homology
 1NAP A;  5M5X B;  3NTK A;  4ABN A;  1FD7 D;  3BVZ A;  5J22 A;  2R7Z B;  3W2D A;  1IW7 C;  2BA0 A;  4C3H B;  1CZW A;  1E2V A;  4L8J A;  2A5H A;  4K8I A;  1KDA A;  1SNC A;  1TWF B;  4BA2 I;  1CTM A;  2HCI A;  3M7N A;  2F0O A;  3MZ5 A;  5EBC A;  2B2T A;  1DZ1 A;  4RA8 A;  1QG7 A;  3MFY A;  3D4W A;  3C1F A;  3M3Y B;  1JWS D;  4I7Z C;  1JWM D;  2XN9 C;  3TDQ A;  1HUM A;  2EJF C;  2EY5 A;  4KI0 A;  1H9K A;  5AFW A;  5M9O A;  1Q12 A;  3TP7 A;  3D4R A;  5ISR A;  4DAV A;  2HCC A;  1UNS A;  1O78 A;  3D31 A;  4HMJ A;  1GUT A;  1SE3 A;  3NBH A;  1B44 D;  2E2D C;  2LS0 1;  2LKV A;  1X32 A;  1T5X D;  5IIF A;  2F0N A;  3I72 A;  3DWQ A;  2VB3 X;  2Q8R E;  1F2M A;  4N9P A;  1IYU A;  2MGS A;  2OT2 A;  3PUW A;  2JEB I;  1GHJ A;  5CC4 A;  2IW3 A;  2LMC B;  1EEI D;  3TME A;  5KRU A;  1IYV A;  3HGB A;  4IUP A;  4DFA A;  3FRP B;  4FF3 A;  5M5Y B;  1EOT A;  1WTQ A;  3BYT B;  1F9Q A;  3URY A;  4A3K B;  2O2L D;  1RD9 D;  3ND9 A;  4KJN A;  1G2S A;  2MHV A;  1SNQ A;  1LTI D;  1KAA A;  3AB9 A;  5D14 A;  3QOL A;  2KCC A;  1NR2 A;  1SE4 A;  1SYD A;  4RGM A;  4IUV A;  2F0I A;  3PV0 A;  1TU2 B;  1WTV A;  5K5P A;  1ENC A;  3P20 A;  1G91 A;  3IFD A;  4BWG B;  2D62 A;  3PUX A;  1O7L A;  3Q24 A;  3K5O A;  2K1B A;  2F0D A;  3FMC A;  4TSS A;  3ERQ A;  1U4M A;  4A3M B;  4K5W A;  5HUR A;  2A74 C;  3A55 A;  3M7G A;  2TMP A;  1L0X B;  2NZ1 D;  1BDO A;  1Z6H A;  4CKB A;  1SNP A;  3MC0 B;  4ID6 A;  2EPB A;  1QNK A;  3RZO B;  1DM0 B;  1VDZ A;  1ROD A;  2WV6 D;  3GTO B;  3HOW B;  2F0J A;  1II3 A;  1PDQ A;  2NTT A;  1X3P A;  2M9V A;  2HQE A;  4ZKC B;  2L11 A;  1QNU A;  2KA7 A;  1FGB D;  4ODG A;  3BVG A;  1AZP A;  3NE5 B;  3TP6 A;  4B9W A;  1RJT A;  4O42 A;  1Q1B A;  4QUC A;  3GD7 A;  5CV7 A;  2WKD A;  1EZ8 A;  4RKB A;  4U67 3;  1JB3 A;  5EKI A;  4ZRZ A;  3K5M A;  1GUG A;  3G6J B;  5BN4 A;  2XWB B;  2L5T A;  4C1N K;  2FFK B;  3VA5 A;  3OW7 A;  1LTA D;  4A3D B;  4HSP A;  1STB A;  2WB1 B;  1HQR D;  4IUU A;  4EVO A;  4HAE A;  3MWY W;  4HTH A;  5KNC A;  5JAV A;  3A8I E;  1EY4 A;  5JVG 3;  3LWU A;  4J8Q A;  2K03 A;  1SXT A;  1LTB D;  1HUN A;  1DXM A;  1I50 B;  2BE5 D;  5LL6 X;  3QIA A;  4L63 B;  4Y7N B;  4FF2 A;  3NTI A;  4FXK C;  3H0G B;  1TS2 A;  3OIP A;  5IGB A;  4J1M A;  1IHZ A;  2F0W A;  3MTS A;  5NUC A;  5DAU A;  1WCM B;  3P75 A;  2BCO A;  1PTO H;  4WJW A;  2X69 A;  2RSO A;  4KJO A;  3K58 A;  3OIQ A;  2L55 A;  2B63 B;  2WAC A;  1SDF A;  1TKW B;  2SNS A;  5C4J B;  3D3R A;  1A2U A;  1B2T A;  3VR4 A;  3ZYY X;  1AEX A;  1CHP D;  3N52 A;  5DM6 3;  1PXU A;  2JYO A;  3DXJ C;  1TWG B;  1B4O A;  3NUC A;  4DK1 A;  1GXD C;  4C3J B;  1L0Y B;  4EQN A;  2IX0 A;  5CV6 A;  3OOC A;  3M4O B;  1R9T B;  3KUP A;  2ZT9 C;  3C1E A;  1SNM A;  3OSO A;  1QJO A;  1CHQ D;  4FO2 A;  4MN3 A;  4XYO A;  2RKS A;  1PTO C;  3S17 B;  2PQE A;  4XXE A;  5I6W A;  5CV9 A;  2CHB D;  4IFD G;  3Q0A A;  2FHT A;  1VCI A;  4BY1 B;  2XWJ B;  1Q8I A;  3C2P A;  1AW7 A;  1QE6 A;  3FPP A;  1EYC A;  5I9O A;  4HR7 B;  3K5L A;  2JA6 B;  1KAB A;  1PZJ D;  1DOL A;  1FYC A;  1TWH B;  2EJG C;  5JOB A;  4CJ1 B;  2B2Y C;  5C5M A;  3NP8 A;  3HG9 A;  1BXT A;  4ZUJ A;  2RDF A;  3U9S A;  1RTN A;  3SR1 A;  1GUO A;  2O5J C;  4OIK A;  1XYI A;  4CJ2 C;  3A8J E;  4ZLT F;  3K7A B;  5CBE E;  2KVM A;  4FF4 A;  4ULL A;  1Q1E A;  4PNY A;  1D5X C;  3TZU A;  1SMY C;  1ZYR D;  2H1E A;  5J39 A;  1A15 A;  2K7V A;  3A8K E;  4K6L A;  3K0Y A;  1FNW A;  3OWF A;  2PCF B;  3SXH A;  2F0E A;  1FNU A;  2O5I C;  3HKZ B;  4ZQ3 A;  3KLS A;  4FF1 A;  1D5Z C;  3VR3 A;  1I4Q A;  2B2W A;  1PRT C;  1TY0 A;  3GTM B;  1I4P A;  2NN6 H;  1AN8 A;  1ENA A;  3HOU B;  1SYF A;  1SAP A;  4IAL A;  1RDP D;  1JQY D;  5FO9 B;  2B2U A;  2A6H D;  1B1Z A;  5C0X I;  2CQA A;  2LFN A;  3OWE B;  3L7Z C;  4FVM A;  4ZYS A;  1EYA A;  3QWN A;  2R92 B;  1YNJ D;  2XRQ D;  2OEO A;  5ELC A;  4L6T B;  1SJH D;  2L1B A;  4U68 A;  2D9U A;  2IL8 A;  5EBD A;  5E4X A;  1H9S A;  4QUF A;  2J7Z A;  1Y8O B;  4A3J B;  4IUT A;  1D5M C;  3M4Y A;  4XQQ A;  2MPM A;  5BN5 A;  3OMG A;  1EWC A;  1JOK A;  3OPO A;  4DNR B;  2L9H A;  3E6Z X;  2EYP A;  4F8M A;  2EYO A;  2VB2 X;  1F2L A;  4EQP A;  5IGC A;  4DF7 A;  1I4R A;  1BO0 A;  3GO5 A;  1QB5 D;  2K5W A;  3D8G A;  3ERO A;  5EPL A;  2F1M A;  2NN6 G;  2F0V A;  2NB0 A;  2I07 B;  2SEB D;  1PTO F;  1KNA A;  2AQ3 B;  2ICI A;  3NQI A;  2CW0 D;  1ZXT A;  3HS0 C;  5M5W B;  1EYD A;  2PW5 A;  3KBX A;  1DYQ A;  2K5Q A;  3VR5 A;  3AMU A;  5F2D A;  2NVY B;  3QJY A;  1HXY D;  1Q90 A;  4GZY C;  5EGT A;  4YIJ A;  1MSG A;  3BVM A;  1HCZ A;  3I3C A;  1M8A A;  3NBI A;  4RCO A;  3SDZ A;  3MVV A;  4FXG C;  1U9R A;  3CRK C;  1TS4 A;  4BBS B;  4UDU C;  1F9R A;  2M00 A;  5COR A;  1DOK A;  3S2H B;  4OO1 I;  5I6Y A;  3J80 E;  2JP1 A;  3IKJ A;  1HA5 A;  4RFB A;  5EPK A;  1BCP B;  1DD2 A;  3ND8 A;  1JOR A;  3GQB A;  3SK4 A;  2QCP X;  3S14 B;  2QF7 A;  4H0L C;  4G7O C;  5C5L A;  4XT3 B;  4DGZ A;  2EE1 A;  5IGF A;  1RTO A;  4P2C B;  5C4H A;  1SYB A;  3PUY A;  3KF8 A;  4XT1 B;  1I6V C;  2XRS D;  1NUC A;  2J0T D;  3HOX B;  1A2T A;  1DOM A;  5KYI A;  2RA4 A;  5COY A;  2RSN A;  3VYT A;  2K5D A;  4KKU A;  2NYZ D;  4QB4 A;  2AQ2 B;  4FP5 D;  5J1Z A;  2VNU D;  5JEA G;  1EIH A;  2L4N A;  4KK7 A;  1GUW A;  2PO4 A;  1GHK A;  4C3J G;  1J8I A;  3E0J A;  4TRD A;  5FO7 B;  3A7L A;  1U4L A;  2EYJ A;  4H13 C;  4G57 A;  2RQX A;  2JSO A;  2B2V C;  4V19 0;  3FEW X;  2CVR A;  1K8O A;  3NXW A;  5T1I A;  2F0L A;  2ZXR A;  5I4D A;  1F77 A;  3MXG A;  5CMD A;  3DMU A;  2X6G A;  2ZXP A;  1NSN S;  4A3G B;  2HDM A;  3D6W A;  2EOT A;  4HCS A;  4KD3 A;  3SEB A;  2Z4H A;  4DNT B;  1TT2 A;  4C56 C;  4FNF A;  2K28 A;  1V8Q A;  5M3F B;  3FKI B;  2BDN A;  3K5N A;  1MGS A;  4NW2 A;  5KEE A;  1CA6 A;  4HMI A;  1QCB D;  1IKL A;  2QDB A;  1EZ6 A;  1PTO B;  3NQT A;  1S5E D;  1JR0 D;  3U9O A;  4IFD J;  3PUZ A;  3T13 A;  2WP8 J;  2F0G A;  2K05 A;  1I6H B;  2A69 C;  3LWE A;  3NTH A;  4KHZ A;  1PZI D;  5KIX A;  3GV6 A;  1WTX A;  3EJI A;  2K6A A;  1WVL A;  2NUC A;  4KN4 C;  2N88 A;  5CGK A;  3R2T A;  2MP1 A;  1C4Q A;  1UAP A;  4M1U B;  1PLF A;  1HRJ A;  3PO3 B;  1CA5 A;  5IOC A;  3A7A B;  1CI3 M;  5KNB A;  5C3W A;  3I73 A;  5C0X G;  1LLR D;  2SOB A;  1ET6 A;  3I4N B;  4Z9C B;  4PMC A;  4IFD I;  3Q6S A;  4M8A A;  2ICE C;  4R8I A;  1ICW A;  5ELE A;  1PMR A;  1TS5 A;  1TY2 A;  1KNE A;  2YU9 B;  3I91 A;  2L0C A;  3S1M B;  3BZD B;  3T51 B;  2IWH A;  2EJM A;  2IPK D;  2DNC A;  1I4H A;  5E4W C;  2EYF A;  5JEA J;  2HUG A;  3DHQ A;  4WOR A;  2DNE A;  4Q0F A;  4KTA A;  1JCK B;  1A3V A;  3L9A X;  1KDB A;  2IJ0 A;  5TSS A;  1BQQ T;  1G8Z D;  2R3Z A;  5T1G A;  3MXP A;  1R4P B;  1S5F D;  1SSO A;  4LAA A;  1O80 A;  5CV4 A;  5EKL A;  1ILP A;  4OL7 A;  1Z47 A;  4OIJ A;  3S2D B;  4XIG S;  1SJE D;  1CQF A;  1A6X A;  1WD1 A;  3AU7 A;  3N6R A;  4CHT B;  3RD4 A;  5JPN C;  5JJZ A;  4HED A;  4KKS A;  3PO2 B;  3GP7 A;  3RUZ A;  4DAP A;  5EJW A;  3R2I A;  3Q23 A;  2AWN A;  1EY9 A;  2MUY A;  4RWS C;  3UI2 A;  5C4X B;  4F7X A;  3G7L A;  4RCN A;  1CM9 A;  4CBV A;  5M3M B;  2AUK A;  1BCP F;  4HCE A;  1HFG A;  2IX1 A;  2NBF A;  1H9M A;  1XXG A;  1ML0 D;  1EEF D;  1F9S A;  4IUN A;  1I4X A;  1D1K A;  5ELD A;  3EA6 A;  4MIU A;  1STG A;  4K6D A;  3J81 L;  3QO2 A;  3BG3 A;  1RCV D;  4A3F B;  5E1F A;  3TBI B;  4KD4 A;  4O1N A;  4IZ8 A;  2JA7 B;  2BDO A;  1X3Q A;  2J4X A;  4A93 B;  1KTK A;  2F0S A;  3T56 B;  4K2K A;  3GTQ B;  4KKT A;  5A2Q E;  1RKN A;  2B2T C;  1NCV A;  1SMY D;  4H44 C;  1Z7T A;  4PV1 C;  1STN A;  2Z8L A;  3HRZ C;  3CRL C;  2G9H D;  4H7B A;  1ZYR C;  3RLF A;  5C3E B;  2FIN B;  3EVQ A;  4RH6 A;  4G7H C;  2VXW A;  5D3D A;  2O4X A;  4KY5 A;  1TQO A;  5HGT A;  2EYH A;  3Q22 A;  5E3F A;  2NVQ B;  3R8B A;  4C3I B;  3EQL C;  1K83 B;  2RBM A;  4K14 A;  1OXU A;  1CT1 D;  1DCZ A;  2G9D A;  3DUZ A;  3K6O A;  2PYK A;  1GJX A;  1IKM A;  4N9T A;  1PRT D;  5C44 B;  5EQ0 A;  2A73 B;  1VMC A;  1BNZ A;  5FKA C;  2OXP A;  2LY7 A;  1T5E A;  4K2L A;  1TWC B;  2KCN A;  2F03 A;  3HEJ A;  1GOZ A;  3NSW A;  4NDX A;  3J80 L;  3H3V C;  5D3I B;  4OGQ C;  1C48 A;  1UUP A;  3BYY B;  2YYZ A;  1LTT D;  4PQX A;  2WII B;  2ENB A;  2F0F A;  2B39 A;  1HFN A;  4CKC A;  4DU9 A;  5FLX E;  1A3T A;  1PFM A;  1AZQ A;  5G3L D;  1B9N A;  5DEH A;  4I65 A;  2KQ3 A;  2IX3 A;  5BN3 A;  4RHS A;  4B08 A;  3PIP 3;  5KYL A;  1HHV A;  1EY6 A;  5EKK A;  1PYW D;  5K36 G;  1DON A;  2AUJ D;  3TN2 A;  3IL8 A;  4XTC S;  1V1P B;  2F0U A;  3SK5 A;  4LK1 C;  2WIN B;  2JE6 I;  3GTJ B;  4XQN A;  3BDC A;  1S5C D;  3S1R B;  1TR5 A;  1BR9 A;  4F87 A;  4AYB B;  3BDL A;  1A3U A;  3KK7 A;  2EXZ A;  5LHY 1;  3SK8 A;  3K59 A;  2VUM B;  2KUM A;  5LL6 S;  3X3N A;  2IT1 A;  2MJ8 A;  1LTR D;  1SNO A;  3ITP A;  4NMZ A;  5JEA H;  3VR2 A;  4RAU C;  1D6E C;  1JOQ A;  5ELF A;  3DWP A;  2SDF A;  3KLS X;  1B53 A;  4R9W A;  1BOS A;  4JBW A;  3GTK B;  2JA5 B;  1SE2 A;  4ZKB B;  1STE A;  1PZK D;  2A68 D;  1U4P A;  3J7A V;  1DJR D;  1I3Q B;  2F0H A;  2FJ2 A;  3FDT A;  2C5C A;  4CKE A;  5JPM C;  3GTG B;  3NWS A;  3T4A C;  1STY A;  1RHP A;  2K33 A;  4EGV A;  1NR4 A;  2FMM A;  2K01 A;  1ENF A;  1ET9 A;  1PFB A;  2F3W A;  3MFG A;  4XQJ A;  1JOO A;  2K04 A;  2BE5 C;  3F2U A;  1EWH A;  4KY7 A;  3MHB A;  1HTP A;  3MXN A;  2Z1C A;  2NVT B;  3HZX A;  3J7A F;  1VF7 A;  4X3T A;  1HA6 A;  2V4D A;  3I4M B;  4X3U A;  1STH A;  2B2U C;  1CZG A;  5C0X J;  3J81 E;  2KEC A;  1QWY A;  1ZEQ X;  3TP8 A;  4PMW A;  3SE0 A;  4CGY B;  1J9O A;  1Y69 U;  2DY8 A;  4NP5 A;  3NPP A;  5C0X H;  4LMQ D;  4FXD A;  3S1N B;  1OXV A;  1MBY A;  2RDH A;  3D4D A;  2M2L A;  1LT4 D;  1VMP A;  4DA2 A;  2TSS A;  2EDG A;  5I2Y A;  1UEA B;  1D2B A;  1XWE A;  4G7Z C;  1F9P A;  3J7Y W;  4IUQ A;  1TVX A;  1I4G A;  3A54 A;  2R93 B;  2CW0 C;  4IQZ A;  3NHH A;  4TQU S;  1GUS A;  4KV6 A;  2E2J B;  1H9R A;  3I4L A;  3I90 A;  1TS3 A;  2F0M A;  2F3V A;  4LJZ C;  4EQO A;  3DEO A;  2XVS A;  3M85 A;  1V43 A;  1E2W A;  1IW7 D;  4KY6 A;  1MD2 D;  4OO1 G;  2EZV A;  2XIW A;  2F0P A;  3S15 B;  1EY7 A;  4Q5V A;  3T16 A;  5G3L F;  3R93 A;  3VA7 A;  2B2V A;  1BUV T;  2QEJ C;  1MI2 A;  5EPJ A;  4RGN A;  2Q8I B;  4ME5 A;  2PZT A;  3GTP B;  4X3K A;  4E6I A;  4C2M B;  3H6M A;  2EYL A;  2JA8 B;  1YNN D;  1OXT A;  3PIO 3;  1ILQ A;  1ZKO A;  3LX0 A;  1SYE A;  4RGO S;  2F0Q A;  1JWU D;  3OHX C;  3HOY B;  5IOD A;  1EQV A;  1TWA B;  3PMF A;  2X6L A;  2A6E D;  4A3B B;  2OF1 A;  5D65 A;  4K5X A;  2HDL A;  5FLX L;  2WAQ B;  1LT6 D;  2R61 A;  1U4R A;  2ID0 A;  4MHE A;  4F88 A;  1EU4 A;  4XDX A;  3VR6 A;  3RZD B;  2QIL A;  1PRT F;  3S1Q B;  3WOE A;  1D1I A;  3PUV A;  3I8Z A;  5KND A;  5FK9 C;  1EY8 A;  1LAB A;  1Y1W B;  4DAY A;  3KLR A;  5I9P A;  5A2Q L;  1WTO A;  4DXG A;  2SNM A;  2XNA C;  2EY6 A;  3K57 A;  1H9J A;  4ILW A;  5CV5 A;  2ZXO A;  2R6G A;  4BA1 I;  4K5V A;  5IGD A;  2NTS A;  2A69 D;  4DK0 A;  3EFX D;  1SYG A;  4IUR A;  1LTS D;  3TZD A;  2JXM B;  1JIC A;  3W3A A;  3QG1 A;  1Y8N B;  1S5D D;  3O13 A;  2PZW A;  4NKL A;  4PMB A;  3FPU B;  4WRD A;  1S4Z A;  2E74 C;  1V1P A;  3NK9 A;  4BBR B;  1QOH A;  2K32 A;  4ZUI A;  1EIG A;  5FO8 B;  4QCL A;  1LV9 A;  1LAC A;  2A6H C;  2B8F A;  4CJ0 B;  1BBX C;  3TP5 A;  2E76 C;  3SHL A;  3I70 A;  3MXU A;  1F2Z A;  1K8M A;  4UAI A;  5IGE A;  2XSC A;  1OO9 B;  5A35 A;  3KBG A;  1M4V A;  3IAY A;  3P7J A;  1G29 1;  3L3O C;  4ZK9 B;  1O7Z A;  2N55 A;  3GTL B;  1ONL A;  2KHS A;  2BOS A;  3CU7 A;  1SBB B;  3X3M A;  1G6Z A;  2EYM A;  5IT9 E;  3MAQ A;  2DN8 A;  2E2I B;  4RGT A;  1PFN A;  2JEA I;  1AP0 A;  5K36 H;  1B9M A;  1WTR A;  4S3S A;  1FR3 A;  3HOV B;  3HOZ B;  2H4O A;  2KJX A;  3FVQ A;  1E2Z A;  3DWA A;  1H9S B;  3R3O A;  5DNF A;  1LT5 D;  3RMH A;  4OHJ A;  5DM7 3;  1G2T A;  1F2Y A;  3MEH A;  2F4I A;  1EY0 A;  5I2X A;  1CQV A;  2NVX B;  1EFI D;  4OO1 H;  1ESF A;  1EL0 A;  4IN3 A;  1XX8 A;  3VYR A;  4A3I B;  4DN4 M;  5C4Z A;  3VYS A;  3SVM A;  4KMU C;  3A56 A;  4C3H G;  2KOL A;  1PRT B;  2PPB C;  3WDN A;  2AWO A;  1WTW A;  5IT9 L;  5JVH 3;  3SK6 A;  2B2Y A;  4QMG A;  1GUN A;  1LO5 D;  1OXX K;  4FYD A;  1KLU D;  4C3I G;  2Z4I A;  2AQ1 B;  4K8J A;  2D5D A;  1KDC A;  1EQT A;  1B50 A;  4TKO B;  1SND A;  3MA2 B;  1LT3 D;  1BF4 A;  3P1H A;  5FOB B;  3H94 A;  1AFP A;  4RKL A;  3DM1 A;  1XTC D;  4KHV A;  2EY1 A;  4HN7 A;  3V2T A;  2L12 A;  1JC7 A;  2RDG A;  1Y8P B;  3LNN A;  4B9X A;  4QIW B;  3CHB D;  1W6K A;  2D2C C;  1EU3 A;  1EY5 A;  4R8N A;  1KLG D;  2E2H B;  4RHR A;  2PZU A;  1CFM A;  4V0B A;  2KED A;  1Y1V B;  1SFO B;  2RVL A;  4C1N I;  3D6C A;  3BS1 A;  1V1O A;  3T53 B;  1YNN C;  2F0K A;  3IFT A;  3VYU A;  2Q8T A;  4DXF A;  2E75 C;  5CR3 A;  1B3A A;  3C46 A;  2NN6 I;  3V96 A;  2PNR C;  3ONA B;  1BCP C;  3CKI B;  2A68 C;  2A6E C;  3S16 B;  4BS9 A;  1WTP A;  1S5B D;  3GV3 A;  3S9W A;  1O7Y A;  1Q3L A;  3H09 A;  3H91 A;  1W6J A;  1IL8 A;  3OMC A;  3JAM E;  1VF5 C;  1LTG D;  5C3X A;  2Y0S B;  4ZAI A;  4XYQ A;  2KEE A;  5CBA E;  4J6H A;  4A3E B;  3DEP A;  4WFN 3;  2C9O A;  2QKI C;  2B8G A;  2F0T A;  4KN7 C;  1SEB D;  2PW7 A;  1ESR A;  1SYC A;  4IFD H;  1HQM C;  3QB3 A;  5CYU A;  1HTL D;  1OXS C;  1YNJ C;  3C3L A;  1RF2 D;  2EVB A;  1HPC A;  2NWG A;  3BDO A;  5C6A A;  3NWT A;  1CK1 A;  1TII D;  2FMC A;  1BCP D;  3WOF A;  4BY7 B;  1R4Q B;  2B2W C;  3QOJ A;  5ELB A;  1MSH A;  2I46 A;  4QF4 A;  5IGG A;  1JE4 A;  1WD0 A;  5CV8 A;  3TSS A;  3JAM L;  4X3S A;  1QIL A;  2BA1 A;  4G4K A;  2DY7 A;  4JK1 C;  5KGU A;  3E5S A;  1FNV A;  3V05 A;  3CQZ B;  1STA A;  4HSV A;  2WKC A;  1C8C A;  1PTO D;  2PMZ B;  2EY2 A;  3HP3 A;  1E0B A;  2GA4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...