2K28A

Solution nmr structure of the chromo domain of the chromobox protein homolog 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of the chromo domain of the chromobox protein homolog 4.
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords E3 SUMO-protein ligase CBX4
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k28A00
2B2VA 4QUFA 2MGSA 1LV9A 3P7JA 1DOMA 2CVRA 4NW2A 2B2WC 1PFBA 1ZXTA 2FMMA 2DY8A 1F9QA 1AZQA 2Q8RE 2FHTA 4X3TA 1SDFA 2HCIA 4IUQA 1WVLA 1BNZA 1PFNA 1QNKA 4ZAIA 2HUGA 1F9SA 1DONA 1G2TA 1HHVA 1X32A 2B2TC 3LWEA 4CJ2C 2KECA 1QE6A 1C8CA 1VMCA 1B4OA 2DY7A 2K28A 2H1EA 2L12A 5EPLA 4QUCA 1JE4A 4U68A 3SVMA 1SAPA 1WTWA 4HAEA 1ILPA 3DEPA 4HSVA 1O80A 5EPKA 4R9WA 4ZK9B 1B50A 3H91A 2NWGA 1BBXC 3ONAB 3HP3A 1RHPA 1O7YA 2IL8A 1EIGA 1MGSA 1WTRA 4XT3B 3Q6SA 1S4ZA 2FINB 1VMPA 1IKMA 2L4NA 2FFKB 1E0BA 1EQTA 3IL8A 3MWYW 2JP1A 2HCCA 2EPBA 1EOTA 2X6LA 1TVXA 2KEDA 1F2LA 1DOLA 4LMQD 5D65A 5T1IA 1J8IA 1HUNA 2NYZD 2KOLA 3F2UA 3DM1A 4CJ1B 3IFDA 5EPJA 5CMDA 4IUVA 2K03A 5AFWA 2X6GA 1IL8A 1F9RA 2RSNA 1WTPA 1EL0A 1PDQA 1A15A 1IKLA 1RODA 2NZ1D 2B2VC 2KUMA 4X3KA 4UAIA 2EE1A 2BDNA 1HFNA 2XIWA 5COYA 1AZPA 1AP0A 1RTNA 1X3QA 3I90A 4IUUA 2RSOA 1KNEA 2HDLA 5JJZA 1WTXA 1CA6A 1WTVA 1ESRA 1HRJA 1HFGA 1HUMA 2B2UC 1U4LA 3GV6A 2R3ZA 2B2TA 3I3CA 1ML0D 1NR2A 1RJTA 2L11A 3I8ZA 3FDTA 4XDXA 5EQ0A 1BF4A 1NCVA 1WTQA 2MP1A 4MN3A 5CBEE 4DN4M 2J7ZA 4X3UA 2RA4A 3UI2A 1GUWA 1WD1A 3D6WA 1O7ZA 3I91A 1KNAA 2B2WA 4O42A 2X69A 4XT1B 2MPMA 1CA5A 4RWSC 1XX8A 1WTOA 2EOTA 2VXWA 1XYIA 4RAUC 2B2UA 1Q3LA 2FJ2A 4HCSA 1X3PA 1BO0A 3MTSA 2Q8TA 1RTOA 5E4WC 1PFMA 3KUPA 3TN2A 1F9PA 1M8AA 3GV3A 1PLFA 5EJWA 4IUPA 4OIKA 2D9UA 1B3AA 2KVMA 3R93A 3TZDA 1U4PA 3G7LA 1SSOA 1NAPA 2K05A 4CJ0B 1J9OA 2B2YA 1ILQA 2SDFA 1MSGA 2MJ8A 1ICWA 1NR4A 1B53A 2K1BA 3FPUB 4ZKBB 4ZLTF 3QO2A 1U4MA 4R8IA 1WD0A 1DOKA 5T1GA 5E4XA 3N52A 5EKIA 3KBXA 4ZKCB 2KEEA 1JICA 2K01A 2JYOA 2N55A 4IUTA 1B2TA 2HDMA 1MSHA 2L1BA 2L9HA 5CORA 5D14A 5DNFA 4OIJA 1EIHA 1HA6A 1QG7A 2B2YC 2M2LA 4HEDA 4IURA 1G2SA 4X3SA 1DZ1A 2RVLA 2N88A 1MI2A 4MHEA 2K04A 1CM9A 1G91A 1G6ZA 4RA8A 5CBAE 1U4RA 3DEOA
chains in the Genus database with same CATH superfamily
1UWVA 3KBGA 5FJ8G 1SEBD 2AKWB 3CMEA 4B3SQ 2WINB 4ZAIA 1A0IA 3DWAA 1DONA 2UXBL 4L8JA 3D4RA 2XTIA 4WORA 3W1BA 1E24A 4LAAA 3IRBA 4N8X1 4U68A 1JOOA 4K2KA 2EZVA 2WAQE 2XWBB 2VY3A 5GQOA 1HTLD 4TSSA 2RDHA 1XPRA 1RHPA 1N33Q 2PNHA 3CKIB 3P20A 1LT5D 2NVTH 1HCZA 2L4NA 3GTOH 2IHEA 3R3OA 1HR0Q 2MQHA 1WCMH 3MXUA 4B08A 2KEDA 4PG3A 4A3KH 2NYZD 4P75A 1S5CD 1Q7YC 3CCEA 1VQKA 3RZOB 4FXDA 1KD1C 3U58A 4YY3Q 2R92G 3J7AF 4RHSA 5IP9G 2L15A 1CHQD 2EY6A 3PF5A 2EY1A 2PYKA 1BBWA 1KABA 1HFNA 1A3TA 1PH4A 3K58A 3HOUH 4AYBB 1BXTA 4TVAB 1E2ZA 3M3YB 1JB3A 3AU7A 1XMQQ 5DM73 1FNVA 4ME3A 3L3OC 4DAYA 2RDFA 3FDTA 1V43A 1TWAB 2KA7A 2VZAA 4DUZL 1TR5A 1TWCH 5DLQE 2VUMB 4KKUA 2XGTA 3M7GA 2K5QA 1DYQA 4NXML 1RTOA 1DXMA 3SR1A 4KI0A 1M1KC 1HQRD 4JI3L 1EUJA 4DAMA 4R8NA 1FNWA 2C35B 1PYBA 4CJ0B 1SSOA 4ODGA 3OSOA 4AQYQ 3NTKA 4YWLA 1PH3A 3N52A 1SMXA 4IPCA 1F2YA 4KLKA 1JJCB 4HEDA 1EZ8A 1CQVA 4LUVA 2ZXPA 4DR2Q 1ONLA 4IJLA 4MHEA 1I3QH 2PO4A 3KK7A 3DEOA 2QDBA 1LV9A 3E0EA 5EKKA 2WKCA 2O2LD 2B8GA 4L5SA 4UP8A 1PFNA 5C3EB 3C1EA 1JWUD 3PQIA 3M7NA 5C4XB 4A3DB 2A6HD 1EY8A 3HOZB 2PQAA 3H3VH 1N36Q 3H6MA 3ND8A 3QB3A 3HFZB 3CPWA 2A19A 3SK6A 1Z47A 5LMUQ 2I5LX 5IYBG 1Q8IA 1JJGA 5KYIA 1WOCA 3K5NA 1VQ8A 2X6LA 1TVXA 3NP8A 1XTCD 2WAQB 3K0YA 2Z1CA 5C0XJ 2JA8H 2A8VA 2KOLA 2F0JA 3KF8B 1X3EA 2X6GA 1B44D 1EY7A 1LTRD 3AB9A 1X55A 3G6EA 1Y8OB 2N3SA 4IUNA 1JOQA 1RD9D 3T4AC 4GNXB 3PUYA 2NVTB 3WDNA 4P73A 2CH4A 4O2DA 1SNMA 1E7ZA 1UE7A 2XIWA 5COYA 5LHY1 1OXVA 1J5EQ 2RSOA 4ABNA 1WTXA 4RH6A 3KF8A 4FXGC 2E2HH 3GV6A 2Z0SA 2EY5A 4RHRA 4R4TA 2F0WA 5M3MH 3K80C 4EQNA 3TDQA 1NCVA 4FYDA 1MD2D 1V1PA 1EIFA 1E1TA 1WD1A 3K5LA 2B2WA 4K5WA 3A56A 3H0GH 1JCKB 1KHIA 3D0FA 1I6HH 1VQPA 5C4HA 4JI8L 1GVPA 2L55A 2FJ2A 2C5CA 4BWGB 2BCOA 4QQBX 2F0OA 1QNUA 1MKHA 1F9PA 3S15H 3KYHC 1Y1VB 4ZUJA 2GVBA 4OX9Q 4DV7L 3GTQH 2GA4B 4DUYQ 3MXNA 3KBXA 4A3BG 2CW0C 5FLMH 3HRZC 2L9HA 4ILWA 4QGUA 5LL6S 4A3BH 1HZ9A 1L1OC 4ZCKA 4F8MA 4IURA 1L0XB 1NTGA 1Y8PB 2D2CC 5M5WB 1IYVA 1N9WA 4ZYSA 1CM9A 4A3EG 1E2VA 4IFDG 1PFBA 1R4PB 3E5SA 2F0KA 3BDOA 4MNOA 1Q86C 1Q82C 4B3TL 2IY5B 5I2YA 1L0YB 5JJKA 1G2TA 1TY2A 1V8QA 3KOJA 1VQOA 1WYDA 1WCMG 3IFTA 2H1EA 4C3HG 3QOLA 2Z4IA 2JSOA 4DF7A 4A76A 4R9WA 4ZK9B 5I4DA 4LFAQ 1WI5A 2F3VA 1U9RA 1B50A 4OWXB 4A3LG 5IP7H 1WTRA 2CCZA 4IJHA 4QB4A 1D2BA 2NVXB 1FR3A 1PV4A 3PO2G 2DJFC 3J80L 3F2UA 3DM1A 1O7LA 3SXHA 1OXUA 4PV1C 1IBLL 4IOCA 4LFAL 2RSNA 2I5MX 2MO0A 1N32Q 1STNA 4X62L 3S14H 1E2WA 3X3MA 1K8MA 3MXGA 5HY6A 3R8BA 2N78A 4IUUA 3I73A 2LXKA 2QA4A 2VQEL 1EWIA 4JI6Q 3N6RA 2K75A 1U4LA 2F0PA 4ZQ3A 2PQEA 1IBKL 1KDCA 2Q2HA 5EQ0A 1YBYA 1BF4A 4I7ZC 2A68C 3A7LA 2PZTA 1PH2A 2RCFA 1I4PA 2M00A 5NUCA 1HTPA 5KIXA 2UUAQ 1LT3D 3S15B 1T5XD 5JEAG 1VQNA 3C1FA 2UU9Q 2M9VA 3FKIH 4GN4B 3GV3A 3S14B 1BOSA 4X66Q 5E3FA 3S1RH 3CRLC 1YVCA 1RIPA 2K05A 4JOIC 3K8AA 1CSPA 3QO2A 4BBSB 5T1GA 4B3SL 1D6EC 2NN6H 4KJOA 2BOSA 2QF7A 4YCUA 4PMCA 1S5ED 3TEHB 4LF7Q 2F0QA 3QIAA 5EAYA 3VR6A 3GD7A 4V190 2N88A 3J81c 1H95A 1DD2A 1MI2A 2IHFA 3GTMH 2N8NA 2PPBC 1BCPC 4GN3B 3A55A 5DAUA 3UDGA 2A5HA 1YNND 2DY8A 1SNPA 4ZRZA 1VQCA 1QNKA 4JI7Q 3S24A 3NENA 4J1MA 3HOZG 2R93B 1VQJA 3BG3A 1SYEA 4GKKL 4N9PA 1ILPA 2N49A 5IGGA 1D1IA 1SR3A 4P2CB 3AFQA 5CV9A 1MGSA 1L1OB 2R7FA 2EYHA 4LFBL 4GN5A 4EVOA 4JI7L 4LJZC 4DV1Q 2EPBA 5FK9C 2VQFQ 1HNWL 2Y0SG 1ET6A 2UUCQ 4DR1Q 5BN4A 5CMDA 1YNNC 2R92B 4DNIA 3BZCA 1SNOA 2NTSA 1RODA 2PZWA 2JA5B 1YZ6A 4KMUC 3R2IA 1TWAH 3PV0A 5C3WA 1PH1A 3CQZH 1YJWA 3TP6A 5H1SE 3TREA 3K81C 5IP9H 2PW5A 1S5BD 2CH4W 3T53B 4LF4Q 3D4WA 1M90C 1VQAA 2F4VQ 4DK0A 4K5VA 2J7ZA 1EY5A 2HQLA 2X69A 4U673 3J81E 4J8QA 3EQLC 3VA7A 1V1OA 4UDUC 1A62A 3VR4A 2EYLA 4EGVA 3HOYH 5IY0A 4GNXC 4H13C 2LY7A 1CZWA 4F88A 4JI2Q 2K32A 4K6DA 1ILQA 3UE1A 2WV6D 2XRSD 5EKIA 4JI5L 2KEEA 1CKMA 1EIYB 1MSHA 1Z6HA 5J39A 1NUCA 2BA1A 1G2SA 1SE2A 2EJGC 1C9OA 1CI3M 1SROA 3K7AH 3VDYA 5JVG3 1K3BC 2K04A 5C4ZA 3KFUA 1PH6A 2XN9C 4LW1A 3EN2A 4JVZA 2OCEA 3CU7A 5G3LF 3VA5A 4P71A 4YCVA 1HNZL 4H0LC 1PTOF 1F9SA 2AWOA 3EJIA 3S1RB 1Y1WH 4C3JB 4DR4Q 1EFWA 1B1ZA 1LM0A 2I46A 4X64Q 4HIDA 3A74A 3NWSA 3G71A 4DV4L 2K50A 4DV3Q 2F0MA 2ZJQA 1N32L 3HP3A 1HR0L 4XT3B 1TT2A 4RGMA 3GTLH 3OYYA 4JI6L 1TS3A 3SHLA 2JE6I 1VQ9A 4RCOA 2F0HA 1VCIA 1YHAA 4C1NK 4L5RC 2F1MA 3JAME 2HT1A 5CC4A 2E2DC 4C3IB 4BXXG 2A6ED 3H0GB 4FF3A 1KDAA 3NSWA 1JC7A 1EOVA 1NMFA 1PTOD 3M4OB 1ESRA 3T1YQ 1LTID 2EJFC 4RGNA 1TKWB 2CHBD 3PIPA 3W1GA 1TWCB 4UHVA 3UDXA 1Y8NB 1HJPA 1YHBA 2SNSA 3A54A 4GOPB 4OL7A 1VQDA 1KDBA 3BVGA 4OHJA 3VYRA 5C3XA 1KAAA 1LO5D 2KQ3A 1XMOQ 1CA5A 3OIQA 4IPGA 3NBHA 5J3BA 4NB3A 3JC66 3M3YH 2ZTDA 5EBDA 1V9PA 4Q5VA 2E2IH 2A73B 1KLGD 4APVA 3BJUA 4GLVB 4IQZA 2B63G 4BY7H 1UEAB 4OIKA 1PH7A 2V4DA 3S1MH 2K5DA 5JVH3 1XMOL 3OTOQ 1B53A 1Q8KA 3WWVA 2ASBA 3CHBD 4PZ8A 4XYOA 4OELB 4KY6A 3J81L 1W3SA 3HOXH 1I4HA 2WFWA 4BY7B 4DR7L 3BDCA 4KJNA 4DFAA 2ID0A 4G7OC 5LL6X 2YU9B 4OWWB 4DXGA 4KHPQ 1Q1BA 2VS1A 3OW2A 2EYFA 2RHSB 1Q12A 4QJFA 2F0GA 1JJ2A 3U50C 3HOXB 4WJWA 1QE6A 1N36L 1C8CA 2O5JC 1UUPA 2K28A 2PI2A 5I9OA 1I3QB 4RKLA 4NXMQ 4MZ9A 3HG9A 2R93H 2WB1B 3H91A 1LYLA 3J80c 2R93G 2R7DA 1PRTC 1UE5A 1S4ZA 2Z6BA 2ALYB 3NE5B 1E0BA 3TSSA 4A3KG 4QIWE 4C3HH 4Y52H 4LMQD 1VQMA 1UAPA 1K8AC 1TWFB 3Q0AA 1R9TH 4OEMB 1UE1A 2LSSA 3JAML 1STGA 3E9IA 1GUTA 1YNJD 5FLXL 5C3EH 2KUMA 4UAIA 3BZDB 1I4QA 1MHWC 4DV2L 3FEWX 4C56C 2VB3X 1I4XA 2WACA 1RCVD 2JA5G 1PRTD 4IO9A 3QJYA 5JJZA 1ET9A 2DNEA 1IZ6A 2E5LQ 3OOCA 1QJOA 4HJ7A 1PH8A 1NY4A 2EIFA 5HURA 4A3CG 4J15A 3M85A 1CQFA 2MP1A 4HR7B 5CBEE 5DM63 4OO1G 1A2TA 4KHZA 4OGQC 5TSSA 2EVBA 3RN2A 4QCLA 2AUJD 1QWYA 3D6CA 4ME5A 3FHWA 4E6IA 3PO3H 1ESFA 2KCMA 3KUPA 4LF5Q 3CCUA 2LMCB 3IKJA 3STBC 1GHKA 4QF4A 5IGFA 3FKIG 1XNQL 2J0TD 2F52A 4XQJA 3BU2A 4XYQA 2M2LA 5JPNC 1DZ1A 4X64L 2YTVA 5JEAJ 3GTPB 1FVIA 4JI4L 1I94Q 3AQQA 4HTHA 2L5TA 2V1CC 2MGSA 1ZXTA 4YIJA 3S2HH 3SDZA 3ULPA 4A3GG 1OTCA 2JN4A 4CJ2C 4A75A 2Z9HA 2L12A 2UUCL 4C3IH 1JE4A 4HSPA 1EWCA 5CR3A 4HSVA 5EKLA 4BBSH 5IT9c 1EYCA 1RL2A 3CCSA 5M3FB 1HNXQ 3BVZA 4RGTA 3LX0A 4MTNA 3GTJB 1A6XA 3S17B 2YTXA 3H94A 4X65L 4DUYL 4FDBA 4R4IA 1ZEQX 4QIWB 1WTHA 2A6HC 3HOVB 3H09A 3DM3A 4DPGA 3OIPA 1ASYA 2CWAA 1HNXL 1JMCA 4DK1A 1X9NA 2UUBL 5M9OA 3K57A 1SE8A 2MNAA 3PIO3 1FGUA 2RF4A 1AP0A 1JOKA 1X3QA 5LMNQ 3GTKB 2KBNA 2IT1A 4N9TA 3WOEA 4CDEC 5GROA 1M4VA 2JEBI 2B2TA 1VDZA 3F2BA 3PO2B 3DXJC 2QCPX 4UP7A 4L5TA 2UUBQ 1J6QA 4LF6L 4YCWA 2K5WA 3OTOL 4DR3Q 4O42A 2EOTA 4B3MQ 4IN3A 4R1JA 4RAUC 2WB1E 1EYDA 1GUSA 4DR7Q 1PFMA 4TKOB 3CF5A 4RFBA 2C9OA 1LTGD 4JBWA 3K7AB 2YTYA 1I50H 3QOJA 1D8LA 3TZDA 2XSCA 1QVGA 5KNDA 1ICFB 1VQGA 1I4GA 2D5DA 2G9HD 4G57A 3FPUB 1DOKA 2HHHL 5KNCA 3RZOH 2VL6A 5DNFA 1W6JA 4A3EH 3NTIA 1ENFA 3MFYA 3H3VI 3U9OA 4GOPC 2JA7B 1TWFH 4QY7A 4XIGS 2SOBA 2E76C 2FMMA 4C2MH 1F9QA 4IUQA 4GNXA 4OWTB 1YIJA 3BYYB 1KTKA 3X3NA 3LWEA 3HOWH 5ISRA 1B9MA 4N8FA 4Y7NB 2JA7H 1ENCA 1PZID 1WTWA 3M4OH 4H44C 1D5MC 2KCTA 3CXCA 1ASZA 3RN5A 1IL2A 5FLXc 4X62Q 3Q8DA 2CWPA 2H4OA 3QWNA 1HH2P 2WB1G 4KHVA 2EXDA 3FRPB 4KN4C 2E5LL 3C3LA 2PQAB 3PCOB 1IYUA 4Y7NH 1KQSA 1I50B 2JA5H 4CDFC 2HQEA 3HKZB 2OF1A 1C0AA 1SYDA 5M3MB 2ICEC 2ZJPA 2EE1A 3F1ZA 3NBHB 2BDNA 4A3CH 3ICEA 4P74A 4PZ7A 4IFDI 1B3QA 4XTCS 3G4SA 1GOZA 3K6OA 1Y14B 3V05A 1HRJA 1CKNA 4DK6C 4BA2I 4WJ3M 1RJTA 1EQRA 2WAQG 1EYGA 3I4OA 1AE2A 3GQBA 1PYSB 2OWOA 1CUKA 2KCNA 1GKHA 4RWSC 1EU3A 1PA6A 4YWMA 3I4MG 3KLSX 4A3JH 2VQFL 2RBMA 1PFSA 4A93G 5IYDH 4H7BA 3I4MB 1QUQA 2PNRC 4YY3L 2B63H 4KN7C 3TS2A 2I07B 2B2YA 2BDOA 2SDFA 3NXWA 3W5OA 5KNBA 1LT6D 4K2LA 1VQBA 2F0VA 4DU9A 1SNCA 2BH8A 4JYAL 4JV5L 1JICA 1U0LA 1DGSA 3WOFA 2A69D 4V0BA 2BA0A 2I0QA 3I4NB 1L2FA 3F2DA 4X3SA 4L6TB 1TS2A 3HOXG 2AUKA 3SGIA 5KYLA 4G7HC 1YJNA 4M8AA 3MHBA 3LNNA 1ZYRD 2OQ0A 1G6ZA 1U4RA 1CT1D 3URYA 4C3IG 1UEBA 3KJPA 3CCMA 4NW2A 1STBA 1HNZQ 1S5FD 1X54A 2CQAA 2DJGC 2OXPA 1WVLA 2AHOB 4DR5L 4X65Q 4EX5A 4F87A 1B8AA 1TY0A 1X32A 1HZBA 3B6YA 3ULLA 5C44G 4H02A 3JAMc 4HJ5A 1G8ZD 2RCNA 4IFDH 3M4PA 1TWHB 4HAEA 1PH9A 1AE3A 2H5XA 4IPHA 2QILA 1BBXC 3MFGA 4JOIA 2A69C 1D5ZC 3D8GA 3PSIA 1D5XC 2JA9A 2F0LA 2QGQA 2ZTCA 5C0XH 3F2CA 3IL8A 1VQ4A 3MWYW 2KHIA 3UDIA 2HCCA 1QZHA 1EOTA 3HOWB 3K0XA 1HUNA 1NBWA 2FXQA 5D65A 3S17H 4A4IA 3KLSA 5KEEA 3U4ZA 3TS0A 3OWEB 4A3LH 3OWFA 4LF4L 4HJ8A 1IL8A 2F4VL 2R6GA 2MHVA 1EL0A 3A8IE 2B2VC 4LF6Q 3GTMB 4DR3L 3H3VC 1JWMD 3I7FA 4EQ5A 1AZPA 2EY2A 3T1YL 1SYGA 3NWTA 4CKCA 2IWHA 1LLRD 3OHXC 1PVOA 2F4IA 2B8FA 2KHJA 4JW0A 2F0FA 1C48A 3OMCA 3STBD 4HN7A 1GHJA 4MN3A 1R4QB 1TS4A 3D6WA 4PNYA 1O7ZA 4DV3L 1KNAA 2E2JB 2EYMA 1XNRQ 3L7ZC 3CRKC 4JI5Q 3Q22A 1QOHA 3HEJA 3TZUA 3CC2A 1NSNS 1GUOA 1BKBA 3W3AA 3KJOA 1MJCA 4IUPA 2OT2A 4KY7A 2QEXA 4DV7Q 3GTQB 1R9TB 3GTPH 1PTOH 2NZOA 3S16B 1E22A 1W2BA 3CCRA 3D4DA 4R8IA 2VB2X 4HCEA 1A3VA 4LUZA 1H9SB 1C4QA 2N55A 2HDMA 3TMEA 4DR4L 2PZUA 4JBMA 2RQXA 5FO9B 4DKAC 1S5DD 2OTLA 2QKIC 2AQ2B 3QR8A 4NXNQ 2F0DA 1XPOA 3HOWG 3VYTA 1QB5D 2MFIA 5EBCA 1VQIA 3U4VA 3A5ZB 1BNZA 5K5PA 1F2MA 4LNQA 3M4YA 3HS0C 5GAHC 5EPLA 4DXFA 3FMCA 2GN5A 4BY1B 3CAMA 3S2DH 1U5KA 1I5FA 3DEPA 3MVVA 4K5XA 4JI0Q 3SE0A 4BBRH 1DJRD 1TWGB 2NZHA 4LWCA 4A3GH 4BBRG 1EY9A 3PIOA 1N33L 4GS3A 2F0TA 4NDXA 4CKBA 5L37A 3LWUA 4WRDA 1BR9A 1G291 5M5YB 1AFPA 3M4QA 1H9MA 1K3RA 5JJLA 1S72A 4G4KA 3DWQA 3AFPA 4A3KB 1A15A 1WFQA 4DNTB 5ELEA 3RZDB 4BXXH 3FP9A 5GAGC 3EBEA 1X56A 2CQOA 2NVYB 3KDFA 4B3ML 1STYA 1STAA 1H9RA 3J81j 1VQFA 1DM0B 3CCQA 4PQXA 5C44B 3ULJA 4NP5A 1E1OA 3GDEA 2JXMB 3I3CA 2CW0D 2QW7A 1PRTF 1RKNA 3VR5A 3UI2A 4POGA 2NVQB 1Q1EA 3SK5A 4XT1B 5ELNA 4UP9A 2SEBD 1XX8A 2F0UA 3HGBA 1WTOA 1K73C 2K14A 1P16A 5HGQA 1I6VC 3UE0A 1X3PA 1ZKOA 1QVFA 4X66L 1I6HB 1PTOC 1MJEA 2K4KA 2ENBA 3TN2A 3OPOA 1ENAA 5EJWA 3C46A 2D9UA 1SLJA 1IBLQ 1CHPD 4JPBW 2YU9H 3G7LA 2G5DA 2MJ8A 1ICWA 3TP7A 1HPCA 5CGKA 4LUOA 4DAPA 1LTAD 2JYOA 3MA2B 4LF8Q 2TSSA 3PF4A 5C0XI 2UXCQ 5LMNW 2IX0A 5K36G 4KTAA 4TQUS 2YV5A 4O1NA 1TIID 1IBKQ 2QEJC 5K36H 1H9SA 2EQSA 2E8GA 5FLXE 1D7QA 5A2QE 2VW9A 5G3LD 4DR6Q 3A8JE 1KRTA 1AZQA 2OEOA 4LF8L 4K0KL 5ELFA 2JJQA 1IW7C 3PIP3 4HMJA 1F2ZA 1VMCA 3E3XA 2LXJA 2UU9L 1TWGH 3RLOA 3TP5A 2AQ1B 4LF5L 1SXTA 3S2HB 4DV1L 5CV8A 5C3EG 5HGTA 1TXYA 2EYOA 5LMUL 1W6KA 1YNXA 2JA7G 5T1IA 2UXDQ 3S2DB 4KKSA 3HOUG 2XVSA 4B9WA 4ID6A 4AH6A 1KIXA 4A3FH 1SMYD 5M3FH 3ZYYX 2Z4HA 4A3IB 1LT4D 4A3FG 1BVSA 2R61A 3S1NH 3GTKH 2JEAI 1K0SA 2PI2E 3KLWA 2IX1A 1LUZA 3I90A 3J7AV 4JCVE 1HR0W 2UXDL 4HJ9A 1UE6A 1YI2A 4KV6A 1SBBB 3K5MA 5IGDA 4M1UB 5IT9L 2L11A 3ER0A 1HXYD 3NTHA 1QVCA 4Q0FA 2Q2TA 2LKVA 1K9MC 2IPKD 1AW7A 3CMAA 1GUWA 3NQTA 4F7XA 1H9KA 3I91A 4DAVA 1E3PA 3A0JA 2NVYH 4C3JH 1BCPD 3C2PA 3PO3G 3HOVH 4JYAQ 2XNAC 1SMYC 2DN8A 3RZDH 1T9HA 5E1FA 4JI8Q 3J81i 4DR1L 3EROA 4A93H 1AEXA 4P72A 5CV4A 1RDPD 3PMFA 1PH5A 1XTDA 1GUNA 5AJ3Q 1Z7TA 2NN6G 2ZM6Q 1PRTB 2O4XA 3S1QH 1LABA 1D1KA 3O13A 1O7IA 3GTGB 4DR5Q 5D14A 4FF2A 1SNDA 5LMNL 1VQHA 1HA6A 3R2TA 4K6LA 1G51A 3AYHB 3P1HA 1C7YA 4POFA 1YJ9A 1NNXA 1JE5A 2NBFA 4LFCQ 2OQKA 3MXNB 2NUCA 5ELOA 5AJ3L 3P7JA 4FO2A 3RR5A 2B2WC 4IZ8A 1STHA 4CDCC 4X3TA 1FNUA 5GADC 5D3IB 3GTJH 1NMGA 2Z6KA 1FGBD 1QUQB 3FVQA 1FJGQ 4RMFA 1IXRA 1IYJB 1EEFD 3ITPA 2KECA 1K83B 2F0SA 5C4JB 5FJ8H 5EPKA 4K8JA 2NWGA 1JR0D 2A1AA 4KKTA 3DLLA 2Z8LA 2KJXA 2IL8A 4UPAA 3GTLB 3GO5A 4WFN3 1XXGA 4J6HA 4IOAA 2HHHQ 2D0PA 4QMGA 2DNCA 2ZXRA 3EA6A 4KY5A 5C4JH 3L2PA 3IFDA 4HIOA 1NJIC 2PCFB 2XWJB 1STEA 2FMCA 1PDQA 2NZ1D 3FKIB 4X3KA 3VR2A 3CQZB 2R92H 2BE5C 1VQEA 1XNRL 2RKSA 1RTNA 1DCZA 1KNEA 1HZAA 1BBUA 4S3SA 3HOUB 2ICIA 2R3ZA 2B39A 2K6AA 3K7UC 4DNRB 3CCJA 1NR2A 3VYUA 3I8ZA 2O5IC 1VF5C 1A8VA 5BR8L 3RLFA 3F8TA 3NELA 4YWKA 4DV5Q 1F77A 1BDOA 1VS0A 4A3DH 3BVMA 4JBKA 1Q3LA 4CKEA 4MIUA 2JA6G 2HD3A 3I4LA 2UXCL 2NTTA 2E74C 1M8AA 5FLMG 2BE5D 5IYCG 3E9HA 2KVMA 3I55A 3NBIA 2K33A 2Z6KC 2VUMH 2EYPA 5IYCH 1U4PA 3HZXA 3G48A 3Q24A 2F0NA 1NE3A 4DV0L 5I2XA 2K1BA 4BS9A 2JA8B 2E2IB 1X65A 1HNWQ 4IUTA 2K01A 3SK4A 4RGOS 4OO1I 2VNUD 4OIJA 5I6WA 4KHPL 1PZKD 3BYTB 3RNUA 3ERQA 1OO9B 1QZGA 2ZXOA 5ELBA 4NMZA 3T16A 4CDDC 4JI3Q 4A93B 3CCLA 5JJIA 4IUVA 4QUFA 1DOMA 1SJHD 3TP8A 4FXKC 5BN3A 1QCBD 1Y1WB 1SDFA 4Z9CB 1K83H 1SRUA 5JPMC 1XMQL 4JI1L 1JWSD 4JK1C 4L63B 2DY7A 4K14A 4R4QA 5F2DA 1VQ6A 2D62A 1LTLA 3NPPA 4UY8C 2CKZB 2KENA 3FPPA 3MXPA 1EIGA 1A63A 3Q6SA 3EFXD 2FINB 5D3DA 5FOBB 3KF6A 1IKMA 1TS5A 4PMBA 2JP1A 2IJ0A 1F2LA 4KK7A 4A3IG 1HZCA 3I4NG 4FF4A 4A3IH 3HKZG 1F9RA 1VF7A 4AYBE 1IKLA 4R4OA 2L0CA 1UNSA 3V96A 2TMPA 4LF9L 3HOYB 2F0IA 3J7YW 3T56B 1YITA 1GM5A 4NPSA 4HIMA 2MUYA 1PYWD 2EJMA 1LTBD 2E75C 1HUMA 2AMCB 3PUVA 4DGZA 4RKBA 1SN8A 3SEBA 4DN4M 2ATWA 4GZYC 3CC7A 4BBRB 4OONA 1XYIA 4GLXA 4JV5Q 4BY7G 1BO0A 1JORA 5E7NA 4B3RL 3EVQA 4DV4Q 1PHJA 3ND9A 4AIMA 2R7ZG 1Y1VH 3VYSA 4EQOA 4DR6L 5J22A 4ZLTF 3V2TA 4FP5D 1SJED 1IW7D 1FJGL 5IWAL 3A7AB 3PUZA 5C5LA 4NXNL 1IBMQ 2WP8J 3GP7A 1EIHA 3DMUA 3AMUA 5IGCA 1CK1A 1BQQT 4DV6L 3HOZH 1G91A 3VR3A 3KF6B 5JAVA 1EFID 4DR2L 2F3IA 3HKSA 2CVRA 3I70A 5A35A 1N34L 4RG1A 5C44H 5IWAQ 1YNJC 4GKJL 4PMWA 1LTSD 1I4RA 1IBML 1TU2B 5I9PA 3S16H 3UDFA 4QUCA 4DV6Q 3NHHA 2NVQH 1O80A 1WJJA 3EIVA 1GO3E 2B29A 2KHSA 1VMPA 1EY0A 5I6YA 2UXBQ 2NN6I 3S1QB 1EWHA 4BY1H 1SNQA 4C3HB 4CJ1B 3MC0B 2LS01 2PW7A 2E2HB 1CFMA 2A68D 4PZ6A 4A3JB 1SFOH 1WTPA 5IE8A 4XQNA 3NQIA 4XXEA 3QG1A 2Y0SE 1Q46A 2MO1A 3IAYA 3CW2C 3J7ZC 5M5YH 4A3EB 2HDLA 5DEHA 4TRDA 1CA6A 1WTVA 5M3FG 1HFGA 4A3DG 1J5EL 3CPFA 3CCVA 4A3MB 1GD7A 4NKLA 2JA6H 4JC0A 3GTOB 4OO1H 1WTQA 2Q2IA 4A3BB 3HOYG 4X3UA 5IODA 4JI0L 3HKZE 3LGJA 2GVAA 4I7AA 4QL5A 4IFDJ 4DV0Q 1X3FA 1V1PB 3I2ZA 4CGYB 3CC4A 3M9BA 4JBJA 2ES2A 3PO3B 1AH9A 4DA2A 5BN5A 3MAQA 2DGYA 1HQMC 3MTSA 1S40A 2PMZB 3HOVG 4IPDA 4FNFA 5IIFA 2LFNA 3L0OA 3R93A 2Q2UA 2D0OA 4DUZQ 1L0WA 5KRUA 3S1MB 1U4MA 4O0AA 4GOPA 1B70B 5CORA 5CYUA 4JI1Q 2DUDA 3TQYA 4A3FB 5JOBA 4HIKA 1QG7A 3T13A 3I56A 1OXTA 2K52A 2Y0SB 3OMGA 3MZ5A 5IT9E 1Y1WG 4OXPA 5FKAC 1XJVA 1B7YB 2EXZA 4I65A 1OXSC 4K0KQ 4DK3C 2Q8RE 2FHTA 3DWPA 3RUZA 1EQQA 2PMZE 3AEVA 2HUGA 2VQEQ 1SYFA 3T1HQ 4B3TQ 5IGBA 1HHVA 2B2TC 3RD4A 2K5VA 3BDLA 3KLRA 2ZTEA 3H15A 1KL9A 1SAPA 2HIXA 4MTKA 3RLNA 4A3GB 1CZGA 1XWEA 5IYBH 1Y69U 3ONAB 2AWNA 1O7YA 4BBSG 1PXUA 3T1HL 1KAWA 4LK1C 2SNMA 3W2DA 2NVXH 1EU4A 5A2QL 2EYJA 5EPJA 5C6AA 1B9NA 2K03A 1K28A 4IALA 5AFWA 4B9XA 3D31A 5C0XG 2NB0A 2K5NA 1AN8A 5BR8Q 5IGEA 3NUCA 1Z9FA 1CSQA 4LFBQ 2IW3A 3DUZA 4K8IA 4DV2Q 2F0EA 1LACA 5M3MG 3Q23A 4JG2A 1PMRA 1SYBA 3G6JB 3ZJYC 4C1NI 1K0RA 1CKNB 1ML0D 1I94L 1P8LA 4XDXA 4EQPA 4FVMA 2F3WA 2YYZA 2JQOA 1O78A 3S9WA 4R4CA 3S1NB 1TWHH 2RA4A 1BCPF 4YHHL 1KRSA 2A74C 2MPMA 1RF2D 5J1ZA 2VXWA 1FD7D 4DAYB 1EYAA 2UUAL 3T51B 2IX3A 1PLFA 3PUWA 2ZM6L 4YHHQ 1IHZA 4FF1A 1J9OA 1XPUA 1NR4A 1N34Q 2VUMG 4BA1I 1A2UA 4ZKBB 1TQOA 5E4XA 2I5HA 4ZKCB 1EQVA 1QILA 5FO8B 3CP0A 2L1BA 1XNQQ 5IOCA 5C5MA 1JT8A 1PZJD 3E0JA 1X6OA 3J80E 1WCMB 3PGZA 4LF7L 1GXDC 3K59A 2B63B 4AYBG 4OX9L 1MIUA 2ZT9C 1KXLA 2B2VA 2OTJA 1EZ6A 3J80i 4AQYL 4JI4Q 3NK9A 1VQ7A 3DHQA 4L5QA 2HCIA 1FL0A 3PUXA 3GTGH 5IP7G 1JQYD 4C2MB 5KGUA 1FYCA 3NEMA 3U9SA 1B4OA 3SVMA 4KD4A 4CHTB 5ELCA 2CFMA 5GAEC 5EGTA 2F03A 4BY1G 4GKKQ 4X6AH 2HIVA 4KD3A 4LF9Q 1JB7A 1H9JA 2A6EC 3PO2H 2FFKB 2J4XA 1EQTA 2AQ3B 4RCNA 5M5WH 3BS1A 1DOLA 1J8IA 3E6ZX 3K5OA 1BCPB 4XQQA 5M5XB 1K8GA 3A8KE 1PTOB 3ERSX 3TBIB 4G7ZC 5CV6A 1SYCA 4HMIA 1SE3A 4JI2L 1V1QA 2JK8A 3CD6A 4LFCL 2BH2A 3J7A5 5FO7B 4A3MG 2JA8G 1OXXK 1VQLA 2QDLA 2B3GA 2RHQB 2Q8IB 3I4NH 1G6PA 3JAMi 4A3MH 3L9AX 2WIIB 2B2UC 5CV7A 1LTTD 3MEHA 1CKOA 1X3GA 4B3RQ 1MBYA 1KLUD 4DV5L 1EY6A 4HJAA 3D3RA 2ZJRA 1EEID 4C3JG 2JA6B 1YHQA 1K8OA 4ZUIA 1L1OA 5JEAH 3P75A 4A3JG 1ZYRC 2R7ZB 2EDGA 1HA5A 2XRQD 1CTMA 2G9DA 3RMHA 2B2UA 5IYDG 4HCSA 3I72A 2Q8TA 5E4WC 2P5ZX 3I4MH 1Q90A 2K7VA 1II3A 1EY4A 1A3UA 1B3AA 3KDFB 1BUVT 2WKDA 1N8RC 3H0GG 2K5HA 4CBVA 2RDGA 5CV5A 3MEFA 3A5UA 1NAPA 1SFOB 1KC8C 1MSGA 1GUGA 2R7ZH 3OW7A 1WD0A 3TRZA 1Y1VG 5ELDA 1YEZA 1SE4A 5M5XH 1B2TA 3SK8A 1Q81C 4GKJQ 1S3OA 1VQ5A 2B2YC 5C4XH 1T5EA 2RVLA 2E2JH 4WJ4A 4ALPA 5C4XG 4RA8A 3BZKA 5CBAE 4ULLA 1GJXA 2KCCA 4GLAC
chains in the Genus database with same CATH topology
3KBGA 1SEBD 2WINB 4ZAIA 3DWAA 1DONA 4L8JA 3D4RA 4WORA 4U68A 4LAAA 1JOOA 4K2KA 2EZVA 2XWBB 1HTLD 4TSSA 2RDHA 1RHPA 3CKIB 3P20A 1LT5D 1HCZA 2L4NA 3R3OA 3MXUA 4B08A 2KEDA 2NYZD 1S5CD 3RZOB 4FXDA 3J7AF 4RHSA 1CHQD 2EY6A 2EY1A 2PYKA 1HFNA 1KABA 1A3TA 3K58A 4AYBB 1BXTA 1E2ZA 3M3YB 1JB3A 3AU7A 5DM73 1FNVA 3L3OC 4DAYA 2RDFA 3FDTA 1V43A 1TWAB 2KA7A 1TR5A 2VUMB 4KKUA 3M7GA 2K5QA 1DYQA 1RTOA 1DXMA 3SR1A 4KI0A 1HQRD 4R8NA 1FNWA 4CJ0B 1SSOA 4ODGA 3OSOA 3NTKA 3N52A 1F2YA 4HEDA 1EZ8A 1CQVA 2ZXPA 1ONLA 4MHEA 2PO4A 3KK7A 3DEOA 2QDBA 1LV9A 5EKKA 2WKCA 2O2LD 2B8GA 1PFNA 5C3EB 3C1EA 1JWUD 3M7NA 5C4XB 4A3DB 2A6HD 1EY8A 3HOZB 3H6MA 3ND8A 3QB3A 3SK6A 1Z47A 1Q8IA 5KYIA 3K5NA 2X6LA 1TVXA 3NP8A 1XTCD 2WAQB 3K0YA 2Z1CA 5C0XJ 2KOLA 2F0JA 2X6GA 1B44D 1EY7A 1LTRD 3AB9A 1Y8OB 4IUNA 1JOQA 1RD9D 3T4AC 3PUYA 2NVTB 3WDNA 1SNMA 2XIWA 5COYA 5LHY1 1OXVA 2RSOA 4ABNA 1WTXA 4RH6A 3KF8A 4FXGC 3GV6A 2EY5A 4RHRA 2F0WA 4EQNA 3TDQA 1NCVA 4FYDA 1MD2D 1V1PA 1WD1A 3K5LA 2B2WA 4K5WA 3A56A 1JCKB 5C4HA 2L55A 2FJ2A 2C5CA 4BWGB 2BCOA 2F0OA 1QNUA 1F9PA 1Y1VB 4ZUJA 2GA4B 3MXNA 3KBXA 2CW0C 3HRZC 2L9HA 4ILWA 5LL6S 4F8MA 4IURA 1L0XB 1Y8PB 2D2CC 5M5WB 1IYVA 4ZYSA 1CM9A 1E2VA 4IFDG 1PFBA 1R4PB 3E5SA 2F0KA 3BDOA 5I2YA 1L0YB 1G2TA 1TY2A 1V8QA 3IFTA 2H1EA 4C3HG 3QOLA 2Z4IA 2JSOA 4DF7A 4R9WA 4ZK9B 5I4DA 2F3VA 1B50A 1U9RA 1WTRA 4QB4A 1D2BA 2NVXB 1FR3A 3J80L 3F2UA 3DM1A 1O7LA 3SXHA 1OXUA 4PV1C 2RSNA 1STNA 5CBAE 1E2WA 3X3MA 1K8MA 3MXGA 3R8BA 4IUUA 3I73A 3N6RA 1U4LA 2F0PA 4ZQ3A 2PQEA 1KDCA 5EQ0A 1BF4A 4I7ZC 2A68C 3A7LA 2PZTA 1I4PA 2M00A 5NUCA 1HTPA 5KIXA 1LT3D 3S15B 1T5XD 5JEAG 3C1FA 2M9VA 3GV3A 3S14B 1BOSA 5E3FA 3CRLC 2K05A 3QO2A 4BBSB 5T1GA 1D6EC 2NN6H 4KJOA 2BOSA 2QF7A 4PMCA 1S5ED 2F0QA 3QIAA 3VR6A 3GD7A 4V190 2N88A 1DD2A 1MI2A 2PPBC 1BCPC 3A55A 5DAUA 2A5HA 1YNND 2DY8A 1SNPA 4ZRZA 1QNKA 4J1MA 2R93B 3BG3A 1SYEA 4N9PA 1ILPA 5IGGA 1D1IA 4P2CB 5CV9A 1MGSA 2EYHA 4EVOA 4LJZC 2EPBA 5FK9C 1ET6A 5BN4A 5CMDA 1YNNC 2R92B 1SNOA 2NTSA 1RODA 2PZWA 2JA5B 4KMUC 3R2IA 3PV0A 5C3WA 3TP6A 2PW5A 1S5BD 3T53B 3D4WA 4DK0A 4K5VA 2J7ZA 1EY5A 2X69A 4U673 3J81E 4J8QA 3EQLC 3VA7A 1V1OA 4UDUC 3VR4A 2EYLA 4EGVA 2LY7A 4H13C 1CZWA 4F88A 2K32A 4K6DA 1ILQA 2WV6D 2XRSD 5EKIA 2KEEA 1MSHA 1Z6HA 5J39A 1NUCA 2BA1A 1G2SA 1SE2A 2EJGC 1CI3M 5JVG3 2K04A 5C4ZA 2XN9C 3CU7A 5G3LF 3VA5A 4H0LC 1PTOF 1F9SA 2AWOA 3EJIA 3S1RB 4C3JB 1B1ZA 2I46A 3NWSA 2F0MA 3HP3A 4XT3B 1TT2A 4RGMA 1TS3A 3SHLA 2JE6I 4RCOA 2F0HA 1VCIA 4C1NK 2F1MA 3JAME 5CC4A 2E2DC 4C3IB 2A6ED 3H0GB 4FF3A 1KDAA 3NSWA 1JC7A 1PTOD 3M4OB 1ESRA 1LTID 2EJFC 4RGNA 1TKWB 2CHBD 1TWCB 1Y8NB 3A54A 2SNSA 4OL7A 1KDBA 3BVGA 4OHJA 3VYRA 5C3XA 1KAAA 1LO5D 2KQ3A 1CA5A 3OIQA 3NBHA 5EBDA 4Q5VA 2A73B 1KLGD 4IQZA 1UEAB 4OIKA 2V4DA 2K5DA 5JVH3 1B53A 3CHBD 4XYOA 4KY6A 3J81L 1I4HA 4BY7B 3BDCA 4KJNA 4DFAA 2ID0A 4G7OC 5LL6X 2YU9B 4DXGA 1Q1BA 2EYFA 1Q12A 2F0GA 3HOXB 4WJWA 1QE6A 1C8CA 2O5JC 1UUPA 2K28A 5I9OA 1I3QB 4RKLA 3HG9A 2WB1B 3H91A 1PRTC 1S4ZA 3NE5B 1E0BA 3TSSA 4LMQD 1UAPA 1TWFB 3Q0AA 3JAML 1STGA 1GUTA 1YNJD 5FLXL 2KUMA 4UAIA 3BZDB 1I4QA 3FEWX 4C56C 2VB3X 1I4XA 2WACA 1RCVD 3QJYA 5JJZA 1ET9A 2DNEA 3OOCA 1QJOA 5HURA 3M85A 1CQFA 2MP1A 4HR7B 5CBEE 5DM63 4OO1G 1A2TA 4KHZA 4OGQC 5TSSA 2EVBA 4QCLA 2AUJD 1QWYA 3D6CA 4ME5A 4E6IA 1ESFA 3KUPA 2LMCB 3IKJA 1GHKA 4QF4A 5IGFA 2J0TD 4XQJA 4XYQA 2M2LA 5JPNC 1DZ1A 5JEAJ 3GTPB 4HTHA 2L5TA 2MGSA 1ZXTA 4YIJA 3SDZA 4CJ2C 2L12A 1JE4A 4HSPA 1EWCA 5CR3A 4HSVA 5EKLA 1EYCA 5M3FB 3BVZA 4RGTA 3LX0A 3GTJB 1A6XA 3S17B 3H94A 4QIWB 1ZEQX 2A6HC 3HOVB 3H09A 3OIPA 4DK1A 5M9OA 3K57A 3PIO3 1AP0A 1JOKA 1X3QA 3GTKB 2IT1A 4N9TA 3WOEA 1M4VA 2JEBI 2B2TA 1VDZA 3PO2B 3DXJC 2QCPX 2K5WA 4O42A 2EOTA 4IN3A 4RAUC 1EYDA 1GUSA 1PFMA 4TKOB 4RFBA 2C9OA 1LTGD 4JBWA 3K7AB 3TZDA 3QOJA 2XSCA 5KNDA 1I4GA 2D5DA 2G9HD 3FPUB 4G57A 1DOKA 5KNCA 5DNFA 1W6JA 3NTIA 1ENFA 3MFYA 3U9OA 2JA7B 4XIGS 2SOBA 2E76C 2FMMA 1F9QA 4IUQA 3BYYB 1KTKA 3X3NA 3LWEA 5ISRA 1B9MA 4Y7NB 1ENCA 1PZID 1WTWA 4H44C 1D5MC 2H4OA 3QWNA 4KHVA 3FRPB 4KN4C 3C3LA 1IYUA 1I50B 2HQEA 3HKZB 2OF1A 1SYDA 5M3MB 2ICEC 2EE1A 2BDNA 4IFDI 4XTCS 1GOZA 3K6OA 3V05A 1HRJA 4BA2I 1RJTA 3GQBA 2KCNA 4RWSC 1EU3A 3KLSX 2RBMA 4H7BA 3I4MB 2PNRC 4KN7C 2I07B 2B2YA 2BDOA 2SDFA 3NXWA 5KNBA 1LT6D 4K2LA 2F0VA 4DU9A 1SNCA 1JICA 3WOFA 2A69D 4V0BA 2BA0A 3I4NB 4X3SA 4L6TB 1TS2A 2AUKA 5KYLA 4G7HC 4M8AA 3MHBA 3LNNA 1ZYRD 1G6ZA 3URYA 1U4RA 1CT1D 4C3IG 4NW2A 1STBA 1S5FD 2CQAA 1WVLA 2OXPA 4F87A 1TY0A 1X32A 1G8ZD 4IFDH 1TWHB 4HAEA 2QILA 1BBXC 3MFGA 2A69C 1D5ZC 3D8GA 1D5XC 2F0LA 5C0XH 3IL8A 3MWYW 2HCCA 1EOTA 3HOWB 1HUNA 5D65A 3KLSA 5KEEA 3OWEB 3OWFA 1IL8A 2R6GA 2MHVA 1EL0A 3A8IE 2B2VC 3GTMB 3H3VC 1JWMD 1AZPA 2EY2A 1SYGA 3NWTA 4CKCA 2IWHA 1LLRD 3OHXC 2F4IA 2B8FA 2F0FA 1C48A 3OMCA 4HN7A 1GHJA 4MN3A 1R4QB 1TS4A 3D6WA 4PNYA 1O7ZA 2E2JB 1KNAA 2EYMA 3L7ZC 3CRKC 3Q22A 1QOHA 3HEJA 3TZUA 1NSNS 1GUOA 3W3AA 4IUPA 2OT2A 4KY7A 3GTQB 1R9TB 1PTOH 3S16B 3D4DA 4R8IA 2VB2X 4HCEA 1A3VA 1H9SB 1C4QA 2N55A 2HDMA 3TMEA 2PZUA 2RQXA 5FO9B 1S5DD 2QKIC 2AQ2B 2F0DA 3VYTA 1QB5D 5EBCA 1BNZA 5K5PA 1F2MA 3M4YA 3HS0C 5EPLA 4DXFA 3FMCA 4BY1B 3DEPA 3MVVA 4K5XA 3SE0A 1DJRD 1TWGB 1EY9A 2F0TA 4NDXA 4CKBA 3LWUA 4WRDA 1BR9A 1G291 5M5YB 1AFPA 1H9MA 4G4KA 3DWQA 4A3KB 1A15A 3RZDB 4DNTB 5ELEA 2NVYB 1STYA 1STAA 1H9RA 1DM0B 4PQXA 5C44B 4NP5A 2JXMB 3I3CA 2CW0D 1PRTF 1RKNA 3VR5A 3UI2A 2NVQB 1Q1EA 3SK5A 4XT1B 2SEBD 1XX8A 2F0UA 3HGBA 1WTOA 1I6VC 1X3PA 1ZKOA 1I6HB 1PTOC 2ENBA 3TN2A 3OPOA 1ENAA 5EJWA 3C46A 2D9UA 1CHPD 3G7LA 2MJ8A 1ICWA 3TP7A 1HPCA 5CGKA 4DAPA 1LTAD 2JYOA 3MA2B 2TSSA 5C0XI 2IX0A 5K36G 4KTAA 4TQUS 4O1NA 1TIID 2QEJC 5K36H 1H9SA 5FLXE 5A2QE 5G3LD 3A8JE 1AZQA 2OEOA 5ELFA 1IW7C 3PIP3 4HMJA 1F2ZA 1VMCA 3TP5A 2AQ1B 1SXTA 3S2HB 5CV8A 5HGTA 2EYOA 1W6KA 5T1IA 3S2DB 4KKSA 2XVSA 4B9WA 4ID6A 1SMYD 3ZYYX 2Z4HA 4A3IB 1LT4D 2R61A 2JEAI 2IX1A 3I90A 3J7AV 4KV6A 1SBBB 3K5MA 5IGDA 4M1UB 5IT9L 2L11A 1HXYD 3NTHA 4Q0FA 2LKVA 2IPKD 1AW7A 1GUWA 3NQTA 4F7XA 1H9KA 3I91A 4DAVA 1BCPD 3C2PA 2XNAC 1SMYC 2DN8A 5E1FA 3EROA 1AEXA 5CV4A 1RDPD 3PMFA 1GUNA 1Z7TA 2NN6G 1PRTB 2O4XA 1LABA 1D1KA 3O13A 3GTGB 4FF2A 5D14A 1SNDA 1HA6A 3R2TA 4K6LA 3P1HA 2NBFA 2NUCA 3P7JA 4FO2A 2B2WC 4IZ8A 1STHA 4X3TA 1FNUA 5D3IB 1FGBD 3FVQA 1EEFD 3ITPA 2KECA 1K83B 2F0SA 5C4JB 5EPKA 4K8JA 2NWGA 1JR0D 4KKTA 2Z8LA 2KJXA 2IL8A 3GTLB 3GO5A 4WFN3 1XXGA 4J6HA 4QMGA 2DNCA 2ZXRA 3EA6A 4KY5A 3IFDA 2PCFB 2XWJB 1STEA 2FMCA 1PDQA 2NZ1D 3FKIB 4X3KA 3VR2A 3CQZB 2BE5C 2RKSA 1RTNA 1DCZA 1KNEA 4S3SA 3HOUB 2ICIA 2R3ZA 2B39A 2K6AA 4DNRB 1NR2A 3VYUA 3I8ZA 2O5IC 1VF5C 3RLFA 1F77A 1BDOA 3BVMA 1Q3LA 4CKEA 4MIUA 3I4LA 2NTTA 2E74C 1M8AA 2BE5D 2KVMA 3NBIA 2K33A 2EYPA 1U4PA 3HZXA 3Q24A 2F0NA 5I2XA 2K1BA 4BS9A 2JA8B 2E2IB 2K01A 4IUTA 3SK4A 4RGOS 4OO1I 2VNUD 4OIJA 5I6WA 1PZKD 3BYTB 3ERQA 1OO9B 2ZXOA 5ELBA 4NMZA 3T16A 4A93B 4IUVA 4QUFA 1DOMA 1SJHD 3TP8A 4FXKC 5BN3A 1QCBD 1Y1WB 1SDFA 4Z9CB 5JPMC 1JWSD 4JK1C 4L63B 2DY7A 4K14A 5F2DA 2D62A 3NPPA 3FPPA 3MXPA 1EIGA 3Q6SA 3EFXD 2FINB 5D3DA 5FOBB 1IKMA 1TS5A 4PMBA 2JP1A 2IJ0A 1F2LA 4KK7A 4FF4A 1F9RA 1VF7A 1IKLA 2L0CA 1UNSA 3V96A 2TMPA 3HOYB 2F0IA 3J7YW 3T56B 2MUYA 1PYWD 2EJMA 1LTBD 2E75C 1HUMA 3PUVA 4DGZA 4RKBA 3SEBA 4DN4M 4GZYC 4BBRB 1XYIA 1BO0A 1JORA 3EVQA 3ND9A 3VYSA 4EQOA 5J22A 4ZLTF 3V2TA 4FP5D 1SJED 1IW7D 3A7AB 3PUZA 5C5LA 1EIHA 2WP8J 3GP7A 3DMUA 3AMUA 1CK1A 1BQQT 1G91A 3VR3A 5JAVA 1EFID 2CVRA 3I70A 5A35A 1YNJC 4PMWA 1LTSD 1I4RA 1TU2B 5I9PA 4QUCA 3NHHA 1O80A 2KHSA 1VMPA 1EY0A 5I6YA 2NN6I 3S1QB 1EWHA 1SNQA 4C3HB 4CJ1B 3MC0B 2LS01 2PW7A 2E2HB 1CFMA 2A68D 4A3JB 1WTPA 4XQNA 3NQIA 4XXEA 3QG1A 3IAYA 4A3EB 2HDLA 5DEHA 4TRDA 1CA6A 1WTVA 1HFGA 4A3MB 4NKLA 3GTOB 4OO1H 1WTQA 4A3BB 4X3UA 5IODA 4IFDJ 1V1PB 4CGYB 3PO3B 4DA2A 5BN5A 3MAQA 1HQMC 3MTSA 2PMZB 4FNFA 5IIFA 2LFNA 3R93A 5KRUA 3S1MB 1U4MA 5CORA 5CYUA 4A3FB 5JOBA 1QG7A 3T13A 4ULLA 1OXTA 2Y0SB 3OMGA 3MZ5A 5IT9E 5FKAC 2EXZA 4I65A 1OXSC 2Q8RE 2FHTA 3DWPA 3RUZA 2HUGA 1SYFA 5IGBA 1HHVA 2B2TC 3RD4A 3BDLA 3KLRA 1SAPA 4A3GB 1CZGA 1XWEA 1Y69U 3ONAB 2AWNA 1O7YA 1PXUA 4LK1C 2SNMA 3W2DA 1EU4A 5A2QL 2EYJA 5EPJA 5C6AA 1B9NA 2K03A 4IALA 5AFWA 4B9XA 3D31A 5C0XG 2NB0A 1AN8A 3NUCA 2IW3A 3DUZA 4K8IA 2F0EA 1LACA 3Q23A 1PMRA 1SYBA 3G6JB 4C1NI 1ML0D 4XDXA 4EQPA 4FVMA 2F3WA 2YYZA 1O78A 3S9WA 3S1NB 2RA4A 1BCPF 2A74C 2MPMA 1RF2D 5J1ZA 2VXWA 1FD7D 1EYAA 3T51B 2IX3A 1PLFA 3PUWA 1IHZA 4FF1A 1J9OA 1NR4A 4ZKBB 4BA1I 1A2UA 1TQOA 5E4XA 4ZKCB 1EQVA 1QILA 5FO8B 2L1BA 5IOCA 5C5MA 1PZJD 3E0JA 3J80E 1WCMB 1GXDC 3K59A 2B63B 2ZT9C 2B2VA 1EZ6A 3NK9A 3DHQA 2HCIA 3PUXA 1JQYD 4C2MB 5KGUA 1FYCA 3U9SA 1B4OA 3SVMA 4KD4A 4CHTB 5ELCA 5EGTA 2F03A 4KD3A 1H9JA 2A6EC 2FFKB 2J4XA 1EQTA 2AQ3B 4RCNA 3BS1A 1DOLA 1J8IA 3E6ZX 3K5OA 1BCPB 4XQQA 5M5XB 3A8KE 1PTOB 3TBIB 4G7ZC 5CV6A 1SYCA 4HMIA 1SE3A 5FO7B 1OXXK 2Q8IB 3L9AX 2WIIB 2B2UC 5CV7A 1LTTD 3MEHA 1MBYA 1KLUD 1EY6A 3D3RA 1EEID 4C3JG 2JA6B 1K8OA 4ZUIA 5JEAH 3P75A 1ZYRC 2R7ZB 2EDGA 1HA5A 2XRQD 1CTMA 2G9DA 3RMHA 2B2UA 4HCSA 3I72A 2Q8TA 5E4WC 1Q90A 2K7VA 1II3A 1EY4A 1A3UA 1B3AA 1BUVT 2WKDA 4CBVA 2RDGA 5CV5A 1NAPA 1SFOB 1MSGA 1GUGA 3OW7A 1WD0A 5ELDA 1SE4A 1B2TA 3SK8A 2B2YC 1T5EA 2RVLA 4RA8A 5IGEA 5IGCA 1GJXA 2KCCA 1PRTD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2V A;  4QUF A;  2MGS A;  1LV9 A;  3P7J A;  1DOM A;  2CVR A;  4NW2 A;  2B2W C;  1PFB A;  1ZXT A;  2FMM A;  2DY8 A;  1F9Q A;  1AZQ A;  2Q8R E;  2FHT A;  4X3T A;  1SDF A;  2HCI A;  4IUQ A;  1WVL A;  1BNZ A;  1PFN A;  1QNK A;  4ZAI A;  2HUG A;  1F9S A;  1DON A;  1G2T A;  1HHV A;  1X32 A;  2B2T C;  3LWE A;  4CJ2 C;  2KEC A;  1QE6 A;  1C8C A;  1VMC A;  1B4O A;  2DY7 A;  2K28 A;  2H1E A;  2L12 A;  5EPL A;  4QUC A;  1JE4 A;  4U68 A;  3SVM A;  1SAP A;  1WTW A;  4HAE A;  1ILP A;  3DEP A;  4HSV A;  1O80 A;  5EPK A;  4R9W A;  4ZK9 B;  1B50 A;  3H91 A;  2NWG A;  1BBX C;  3ONA B;  3HP3 A;  1RHP A;  1O7Y A;  2IL8 A;  1EIG A;  1MGS A;  1WTR A;  4XT3 B;  3Q6S A;  1S4Z A;  2FIN B;  1VMP A;  1IKM A;  2L4N A;  2FFK B;  1E0B A;  1EQT A;  3IL8 A;  3MWY W;  2JP1 A;  2HCC A;  2EPB A;  1EOT A;  2X6L A;  1TVX A;  2KED A;  1F2L A;  1DOL A;  4LMQ D;  5D65 A;  5T1I A;  1J8I A;  1HUN A;  2NYZ D;  2KOL A;  3F2U A;  3DM1 A;  4CJ1 B;  3IFD A;  5EPJ A;  5CMD A;  4IUV A;  2K03 A;  5AFW A;  2X6G A;  1IL8 A;  1F9R A;  2RSN A;  1WTP A;  1EL0 A;  1PDQ A;  1A15 A;  1IKL A;  1ROD A;  2NZ1 D;  2B2V C;  2KUM A;  4X3K A;  4UAI A;  2EE1 A;  2BDN A;  1HFN A;  2XIW A;  5COY A;  1AZP A;  1AP0 A;  1RTN A;  1X3Q A;  3I90 A;  4IUU A;  2RSO A;  1KNE A;  2HDL A;  5JJZ A;  1WTX A;  1CA6 A;  1WTV A;  1ESR A;  1HRJ A;  1HFG A;  1HUM A;  2B2U C;  1U4L A;  3GV6 A;  2R3Z A;  2B2T A;  3I3C A;  1ML0 D;  1NR2 A;  1RJT A;  2L11 A;  3I8Z A;  3FDT A;  4XDX A;  5EQ0 A;  1BF4 A;  1NCV A;  1WTQ A;  2MP1 A;  4MN3 A;  5CBE E;  4DN4 M;  2J7Z A;  4X3U A;  2RA4 A;  3UI2 A;  1GUW A;  1WD1 A;  3D6W A;  1O7Z A;  3I91 A;  1KNA A;  2B2W A;  4O42 A;  2X69 A;  4XT1 B;  2MPM A;  1CA5 A;  4RWS C;  1XX8 A;  1WTO A;  2EOT A;  2VXW A;  1XYI A;  4RAU C;  2B2U A;  1Q3L A;  2FJ2 A;  4HCS A;  1X3P A;  1BO0 A;  3MTS A;  2Q8T A;  1RTO A;  5E4W C;  1PFM A;  3KUP A;  3TN2 A;  1F9P A;  1M8A A;  3GV3 A;  1PLF A;  5EJW A;  4IUP A;  4OIK A;  2D9U A;  1B3A A;  2KVM A;  3R93 A;  3TZD A;  1U4P A;  3G7L A;  1SSO A;  1NAP A;  2K05 A;  4CJ0 B;  1J9O A;  2B2Y A;  1ILQ A;  2SDF A;  1MSG A;  2MJ8 A;  1ICW A;  1NR4 A;  1B53 A;  2K1B A;  3FPU B;  4ZKB B;  4ZLT F;  3QO2 A;  1U4M A;  4R8I A;  1WD0 A;  1DOK A;  5T1G A;  5E4X A;  3N52 A;  5EKI A;  3KBX A;  4ZKC B;  2KEE A;  1JIC A;  2K01 A;  2JYO A;  2N55 A;  4IUT A;  1B2T A;  2HDM A;  1MSH A;  2L1B A;  2L9H A;  5COR A;  5D14 A;  5DNF A;  4OIJ A;  1EIH A;  1HA6 A;  1QG7 A;  2B2Y C;  2M2L A;  4HED A;  4IUR A;  1G2S A;  4X3S A;  1DZ1 A;  2RVL A;  2N88 A;  1MI2 A;  4MHE A;  2K04 A;  1CM9 A;  1G91 A;  1G6Z A;  4RA8 A;  5CBA E;  1U4R A;  3DEO A; 
#chains in the Genus database with same CATH topology
 1UWV A;  3KBG A;  5FJ8 G;  1SEB D;  2AKW B;  3CME A;  4B3S Q;  2WIN B;  4ZAI A;  1A0I A;  3DWA A;  1DON A;  2UXB L;  4L8J A;  3D4R A;  2XTI A;  4WOR A;  3W1B A;  1E24 A;  4LAA A;  3IRB A;  4N8X 1;  4U68 A;  1JOO A;  4K2K A;  2EZV A;  2WAQ E;  2XWB B;  2VY3 A;  5GQO A;  1HTL D;  4TSS A;  2RDH A;  1XPR A;  1RHP A;  1N33 Q;  2PNH A;  3CKI B;  3P20 A;  1LT5 D;  2NVT H;  1HCZ A;  2L4N A;  3GTO H;  2IHE A;  3R3O A;  1HR0 Q;  2MQH A;  1WCM H;  3MXU A;  4B08 A;  2KED A;  4PG3 A;  4A3K H;  2NYZ D;  4P75 A;  1S5C D;  1Q7Y C;  3CCE A;  1VQK A;  3RZO B;  4FXD A;  1KD1 C;  3U58 A;  4YY3 Q;  2R92 G;  3J7A F;  4RHS A;  5IP9 G;  2L15 A;  1CHQ D;  2EY6 A;  3PF5 A;  2EY1 A;  2PYK A;  1BBW A;  1KAB A;  1HFN A;  1A3T A;  1PH4 A;  3K58 A;  3HOU H;  4AYB B;  1BXT A;  4TVA B;  1E2Z A;  3M3Y B;  1JB3 A;  3AU7 A;  1XMQ Q;  5DM7 3;  1FNV A;  4ME3 A;  3L3O C;  4DAY A;  2RDF A;  3FDT A;  1V43 A;  1TWA B;  2KA7 A;  2VZA A;  4DUZ L;  1TR5 A;  1TWC H;  5DLQ E;  2VUM B;  4KKU A;  2XGT A;  3M7G A;  2K5Q A;  1DYQ A;  4NXM L;  1RTO A;  1DXM A;  3SR1 A;  4KI0 A;  1M1K C;  1HQR D;  4JI3 L;  1EUJ A;  4DAM A;  4R8N A;  1FNW A;  2C35 B;  1PYB A;  4CJ0 B;  1SSO A;  4ODG A;  3OSO A;  4AQY Q;  3NTK A;  4YWL A;  1PH3 A;  3N52 A;  1SMX A;  4IPC A;  1F2Y A;  4KLK A;  1JJC B;  4HED A;  1EZ8 A;  1CQV A;  4LUV A;  2ZXP A;  4DR2 Q;  1ONL A;  4IJL A;  4MHE A;  1I3Q H;  2PO4 A;  3KK7 A;  3DEO A;  2QDB A;  1LV9 A;  3E0E A;  5EKK A;  2WKC A;  2O2L D;  2B8G A;  4L5S A;  4UP8 A;  1PFN A;  5C3E B;  3C1E A;  1JWU D;  3PQI A;  3M7N A;  5C4X B;  4A3D B;  2A6H D;  1EY8 A;  3HOZ B;  2PQA A;  3H3V H;  1N36 Q;  3H6M A;  3ND8 A;  3QB3 A;  3HFZ B;  3CPW A;  2A19 A;  3SK6 A;  1Z47 A;  5LMU Q;  2I5L X;  5IYB G;  1Q8I A;  1JJG A;  5KYI A;  1WOC A;  3K5N A;  1VQ8 A;  2X6L A;  1TVX A;  3NP8 A;  1XTC D;  2WAQ B;  3K0Y A;  2Z1C A;  5C0X J;  2JA8 H;  2A8V A;  2KOL A;  2F0J A;  3KF8 B;  1X3E A;  2X6G A;  1B44 D;  1EY7 A;  1LTR D;  3AB9 A;  1X55 A;  3G6E A;  1Y8O B;  2N3S A;  4IUN A;  1JOQ A;  1RD9 D;  3T4A C;  4GNX B;  3PUY A;  2NVT B;  3WDN A;  4P73 A;  2CH4 A;  4O2D A;  1SNM A;  1E7Z A;  1UE7 A;  2XIW A;  5COY A;  5LHY 1;  1OXV A;  1J5E Q;  2RSO A;  4ABN A;  1WTX A;  4RH6 A;  3KF8 A;  4FXG C;  2E2H H;  3GV6 A;  2Z0S A;  2EY5 A;  4RHR A;  4R4T A;  2F0W A;  5M3M H;  3K80 C;  4EQN A;  3TDQ A;  1NCV A;  4FYD A;  1MD2 D;  1V1P A;  1EIF A;  1E1T A;  1WD1 A;  3K5L A;  2B2W A;  4K5W A;  3A56 A;  3H0G H;  1JCK B;  1KHI A;  3D0F A;  1I6H H;  1VQP A;  5C4H A;  4JI8 L;  1GVP A;  2L55 A;  2FJ2 A;  2C5C A;  4BWG B;  2BCO A;  4QQB X;  2F0O A;  1QNU A;  1MKH A;  1F9P A;  3S15 H;  3KYH C;  1Y1V B;  4ZUJ A;  2GVB A;  4OX9 Q;  4DV7 L;  3GTQ H;  2GA4 B;  4DUY Q;  3MXN A;  3KBX A;  4A3B G;  2CW0 C;  5FLM H;  3HRZ C;  2L9H A;  4ILW A;  4QGU A;  5LL6 S;  4A3B H;  1HZ9 A;  1L1O C;  4ZCK A;  4F8M A;  4IUR A;  1L0X B;  1NTG A;  1Y8P B;  2D2C C;  5M5W B;  1IYV A;  1N9W A;  4ZYS A;  1CM9 A;  4A3E G;  1E2V A;  4IFD G;  1PFB A;  1R4P B;  3E5S A;  2F0K A;  3BDO A;  4MNO A;  1Q86 C;  1Q82 C;  4B3T L;  2IY5 B;  5I2Y A;  1L0Y B;  5JJK A;  1G2T A;  1TY2 A;  1V8Q A;  3KOJ A;  1VQO A;  1WYD A;  1WCM G;  3IFT A;  2H1E A;  4C3H G;  3QOL A;  2Z4I A;  2JSO A;  4DF7 A;  4A76 A;  4R9W A;  4ZK9 B;  5I4D A;  4LFA Q;  1WI5 A;  2F3V A;  1U9R A;  1B50 A;  4OWX B;  4A3L G;  5IP7 H;  1WTR A;  2CCZ A;  4IJH A;  4QB4 A;  1D2B A;  2NVX B;  1FR3 A;  1PV4 A;  3PO2 G;  2DJF C;  3J80 L;  3F2U A;  3DM1 A;  1O7L A;  3SXH A;  1OXU A;  4PV1 C;  1IBL L;  4IOC A;  4LFA L;  2RSN A;  2I5M X;  2MO0 A;  1N32 Q;  1STN A;  4X62 L;  3S14 H;  1E2W A;  3X3M A;  1K8M A;  3MXG A;  5HY6 A;  3R8B A;  2N78 A;  4IUU A;  3I73 A;  2LXK A;  2QA4 A;  2VQE L;  1EWI A;  4JI6 Q;  3N6R A;  2K75 A;  1U4L A;  2F0P A;  4ZQ3 A;  2PQE A;  1IBK L;  1KDC A;  2Q2H A;  5EQ0 A;  1YBY A;  1BF4 A;  4I7Z C;  2A68 C;  3A7L A;  2PZT A;  1PH2 A;  2RCF A;  1I4P A;  2M00 A;  5NUC A;  1HTP A;  5KIX A;  2UUA Q;  1LT3 D;  3S15 B;  1T5X D;  5JEA G;  1VQN A;  3C1F A;  2UU9 Q;  2M9V A;  3FKI H;  4GN4 B;  3GV3 A;  3S14 B;  1BOS A;  4X66 Q;  5E3F A;  3S1R H;  3CRL C;  1YVC A;  1RIP A;  2K05 A;  4JOI C;  3K8A A;  1CSP A;  3QO2 A;  4BBS B;  5T1G A;  4B3S L;  1D6E C;  2NN6 H;  4KJO A;  2BOS A;  2QF7 A;  4YCU A;  4PMC A;  1S5E D;  3TEH B;  4LF7 Q;  2F0Q A;  3QIA A;  5EAY A;  3VR6 A;  3GD7 A;  4V19 0;  2N88 A;  3J81 c;  1H95 A;  1DD2 A;  1MI2 A;  2IHF A;  3GTM H;  2N8N A;  2PPB C;  1BCP C;  4GN3 B;  3A55 A;  5DAU A;  3UDG A;  2A5H A;  1YNN D;  2DY8 A;  1SNP A;  4ZRZ A;  1VQC A;  1QNK A;  4JI7 Q;  3S24 A;  3NEN A;  4J1M A;  3HOZ G;  2R93 B;  1VQJ A;  3BG3 A;  1SYE A;  4GKK L;  4N9P A;  1ILP A;  2N49 A;  5IGG A;  1D1I A;  1SR3 A;  4P2C B;  3AFQ A;  5CV9 A;  1MGS A;  1L1O B;  2R7F A;  2EYH A;  4LFB L;  4GN5 A;  4EVO A;  4JI7 L;  4LJZ C;  4DV1 Q;  2EPB A;  5FK9 C;  2VQF Q;  1HNW L;  2Y0S G;  1ET6 A;  2UUC Q;  4DR1 Q;  5BN4 A;  5CMD A;  1YNN C;  2R92 B;  4DNI A;  3BZC A;  1SNO A;  2NTS A;  1ROD A;  2PZW A;  2JA5 B;  1YZ6 A;  4KMU C;  3R2I A;  1TWA H;  3PV0 A;  5C3W A;  1PH1 A;  3CQZ H;  1YJW A;  3TP6 A;  5H1S E;  3TRE A;  3K81 C;  5IP9 H;  2PW5 A;  1S5B D;  2CH4 W;  3T53 B;  4LF4 Q;  3D4W A;  1M90 C;  1VQA A;  2F4V Q;  4DK0 A;  4K5V A;  2J7Z A;  1EY5 A;  2HQL A;  2X69 A;  4U67 3;  3J81 E;  4J8Q A;  3EQL C;  3VA7 A;  1V1O A;  4UDU C;  1A62 A;  3VR4 A;  2EYL A;  4EGV A;  3HOY H;  5IY0 A;  4GNX C;  4H13 C;  2LY7 A;  1CZW A;  4F88 A;  4JI2 Q;  2K32 A;  4K6D A;  1ILQ A;  3UE1 A;  2WV6 D;  2XRS D;  5EKI A;  4JI5 L;  2KEE A;  1CKM A;  1EIY B;  1MSH A;  1Z6H A;  5J39 A;  1NUC A;  2BA1 A;  1G2S A;  1SE2 A;  2EJG C;  1C9O A;  1CI3 M;  1SRO A;  3K7A H;  3VDY A;  5JVG 3;  1K3B C;  2K04 A;  5C4Z A;  3KFU A;  1PH6 A;  2XN9 C;  4LW1 A;  3EN2 A;  4JVZ A;  2OCE A;  3CU7 A;  5G3L F;  3VA5 A;  4P71 A;  4YCV A;  1HNZ L;  4H0L C;  1PTO F;  1F9S A;  2AWO A;  3EJI A;  3S1R B;  1Y1W H;  4C3J B;  4DR4 Q;  1EFW A;  1B1Z A;  1LM0 A;  2I46 A;  4X64 Q;  4HID A;  3A74 A;  3NWS A;  3G71 A;  4DV4 L;  2K50 A;  4DV3 Q;  2F0M A;  2ZJQ A;  1N32 L;  3HP3 A;  1HR0 L;  4XT3 B;  1TT2 A;  4RGM A;  3GTL H;  3OYY A;  4JI6 L;  1TS3 A;  3SHL A;  2JE6 I;  1VQ9 A;  4RCO A;  2F0H A;  1VCI A;  1YHA A;  4C1N K;  4L5R C;  2F1M A;  3JAM E;  2HT1 A;  5CC4 A;  2E2D C;  4C3I B;  4BXX G;  2A6E D;  3H0G B;  4FF3 A;  1KDA A;  3NSW A;  1JC7 A;  1EOV A;  1NMF A;  1PTO D;  3M4O B;  1ESR A;  3T1Y Q;  1LTI D;  2EJF C;  4RGN A;  1TKW B;  2CHB D;  3PIP A;  3W1G A;  1TWC B;  4UHV A;  3UDX A;  1Y8N B;  1HJP A;  1YHB A;  2SNS A;  3A54 A;  4GOP B;  4OL7 A;  1VQD A;  1KDB A;  3BVG A;  4OHJ A;  3VYR A;  5C3X A;  1KAA A;  1LO5 D;  2KQ3 A;  1XMO Q;  1CA5 A;  3OIQ A;  4IPG A;  3NBH A;  5J3B A;  4NB3 A;  3JC6 6;  3M3Y H;  2ZTD A;  5EBD A;  1V9P A;  4Q5V A;  2E2I H;  2A73 B;  1KLG D;  4APV A;  3BJU A;  4GLV B;  4IQZ A;  2B63 G;  4BY7 H;  1UEA B;  4OIK A;  1PH7 A;  2V4D A;  3S1M H;  2K5D A;  5JVH 3;  1XMO L;  3OTO Q;  1B53 A;  1Q8K A;  3WWV A;  2ASB A;  3CHB D;  4PZ8 A;  4XYO A;  4OEL B;  4KY6 A;  3J81 L;  1W3S A;  3HOX H;  1I4H A;  2WFW A;  4BY7 B;  4DR7 L;  3BDC A;  4KJN A;  4DFA A;  2ID0 A;  4G7O C;  5LL6 X;  2YU9 B;  4OWW B;  4DXG A;  4KHP Q;  1Q1B A;  2VS1 A;  3OW2 A;  2EYF A;  2RHS B;  1Q12 A;  4QJF A;  2F0G A;  1JJ2 A;  3U50 C;  3HOX B;  4WJW A;  1QE6 A;  1N36 L;  1C8C A;  2O5J C;  1UUP A;  2K28 A;  2PI2 A;  5I9O A;  1I3Q B;  4RKL A;  4NXM Q;  4MZ9 A;  3HG9 A;  2R93 H;  2WB1 B;  3H91 A;  1LYL A;  3J80 c;  2R93 G;  2R7D A;  1PRT C;  1UE5 A;  1S4Z A;  2Z6B A;  2ALY B;  3NE5 B;  1E0B A;  3TSS A;  4A3K G;  4QIW E;  4C3H H;  4Y52 H;  4LMQ D;  1VQM A;  1UAP A;  1K8A C;  1TWF B;  3Q0A A;  1R9T H;  4OEM B;  1UE1 A;  2LSS A;  3JAM L;  1STG A;  3E9I A;  1GUT A;  1YNJ D;  5FLX L;  5C3E H;  2KUM A;  4UAI A;  3BZD B;  1I4Q A;  1MHW C;  4DV2 L;  3FEW X;  4C56 C;  2VB3 X;  1I4X A;  2WAC A;  1RCV D;  2JA5 G;  1PRT D;  4IO9 A;  3QJY A;  5JJZ A;  1ET9 A;  2DNE A;  1IZ6 A;  2E5L Q;  3OOC A;  1QJO A;  4HJ7 A;  1PH8 A;  1NY4 A;  2EIF A;  5HUR A;  4A3C G;  4J15 A;  3M85 A;  1CQF A;  2MP1 A;  4HR7 B;  5CBE E;  5DM6 3;  4OO1 G;  1A2T A;  4KHZ A;  4OGQ C;  5TSS A;  2EVB A;  3RN2 A;  4QCL A;  2AUJ D;  1QWY A;  3D6C A;  4ME5 A;  3FHW A;  4E6I A;  3PO3 H;  1ESF A;  2KCM A;  3KUP A;  4LF5 Q;  3CCU A;  2LMC B;  3IKJ A;  3STB C;  1GHK A;  4QF4 A;  5IGF A;  3FKI G;  1XNQ L;  2J0T D;  2F52 A;  4XQJ A;  3BU2 A;  4XYQ A;  2M2L A;  5JPN C;  1DZ1 A;  4X64 L;  2YTV A;  5JEA J;  3GTP B;  1FVI A;  4JI4 L;  1I94 Q;  3AQQ A;  4HTH A;  2L5T A;  2V1C C;  2MGS A;  1ZXT A;  4YIJ A;  3S2H H;  3SDZ A;  3ULP A;  4A3G G;  1OTC A;  2JN4 A;  4CJ2 C;  4A75 A;  2Z9H A;  2L12 A;  2UUC L;  4C3I H;  1JE4 A;  4HSP A;  1EWC A;  5CR3 A;  4HSV A;  5EKL A;  4BBS H;  5IT9 c;  1EYC A;  1RL2 A;  3CCS A;  5M3F B;  1HNX Q;  3BVZ A;  4RGT A;  3LX0 A;  4MTN A;  3GTJ B;  1A6X A;  3S17 B;  2YTX A;  3H94 A;  4X65 L;  4DUY L;  4FDB A;  4R4I A;  1ZEQ X;  4QIW B;  1WTH A;  2A6H C;  3HOV B;  3H09 A;  3DM3 A;  4DPG A;  3OIP A;  1ASY A;  2CWA A;  1HNX L;  1JMC A;  4DK1 A;  1X9N A;  2UUB L;  5M9O A;  3K57 A;  1SE8 A;  2MNA A;  3PIO 3;  1FGU A;  2RF4 A;  1AP0 A;  1JOK A;  1X3Q A;  5LMN Q;  3GTK B;  2KBN A;  2IT1 A;  4N9T A;  3WOE A;  4CDE C;  5GRO A;  1M4V A;  2JEB I;  2B2T A;  1VDZ A;  3F2B A;  3PO2 B;  3DXJ C;  2QCP X;  4UP7 A;  4L5T A;  2UUB Q;  1J6Q A;  4LF6 L;  4YCW A;  2K5W A;  3OTO L;  4DR3 Q;  4O42 A;  2EOT A;  4B3M Q;  4IN3 A;  4R1J A;  4RAU C;  2WB1 E;  1EYD A;  1GUS A;  4DR7 Q;  1PFM A;  4TKO B;  3CF5 A;  4RFB A;  2C9O A;  1LTG D;  4JBW A;  3K7A B;  2YTY A;  1I50 H;  3QOJ A;  1D8L A;  3TZD A;  2XSC A;  1QVG A;  5KND A;  1ICF B;  1VQG A;  1I4G A;  2D5D A;  2G9H D;  4G57 A;  3FPU B;  1DOK A;  2HHH L;  5KNC A;  3RZO H;  2VL6 A;  5DNF A;  1W6J A;  4A3E H;  3NTI A;  1ENF A;  3MFY A;  3H3V I;  3U9O A;  4GOP C;  2JA7 B;  1TWF H;  4QY7 A;  4XIG S;  2SOB A;  2E76 C;  2FMM A;  4C2M H;  1F9Q A;  4IUQ A;  4GNX A;  4OWT B;  1YIJ A;  3BYY B;  1KTK A;  3X3N A;  3LWE A;  3HOW H;  5ISR A;  1B9M A;  4N8F A;  4Y7N B;  2JA7 H;  1ENC A;  1PZI D;  1WTW A;  3M4O H;  4H44 C;  1D5M C;  2KCT A;  3CXC A;  1ASZ A;  3RN5 A;  1IL2 A;  5FLX c;  4X62 Q;  3Q8D A;  2CWP A;  2H4O A;  3QWN A;  1HH2 P;  2WB1 G;  4KHV A;  2EXD A;  3FRP B;  4KN4 C;  2E5L L;  3C3L A;  2PQA B;  3PCO B;  1IYU A;  4Y7N H;  1KQS A;  1I50 B;  2JA5 H;  4CDF C;  2HQE A;  3HKZ B;  2OF1 A;  1C0A A;  1SYD A;  5M3M B;  2ICE C;  2ZJP A;  2EE1 A;  3F1Z A;  3NBH B;  2BDN A;  4A3C H;  3ICE A;  4P74 A;  4PZ7 A;  4IFD I;  1B3Q A;  4XTC S;  3G4S A;  1GOZ A;  3K6O A;  1Y14 B;  3V05 A;  1HRJ A;  1CKN A;  4DK6 C;  4BA2 I;  4WJ3 M;  1RJT A;  1EQR A;  2WAQ G;  1EYG A;  3I4O A;  1AE2 A;  3GQB A;  1PYS B;  2OWO A;  1CUK A;  2KCN A;  1GKH A;  4RWS C;  1EU3 A;  1PA6 A;  4YWM A;  3I4M G;  3KLS X;  4A3J H;  2VQF L;  2RBM A;  1PFS A;  4A93 G;  5IYD H;  4H7B A;  3I4M B;  1QUQ A;  2PNR C;  4YY3 L;  2B63 H;  4KN7 C;  3TS2 A;  2I07 B;  2B2Y A;  2BDO A;  2SDF A;  3NXW A;  3W5O A;  5KNB A;  1LT6 D;  4K2L A;  1VQB A;  2F0V A;  4DU9 A;  1SNC A;  2BH8 A;  4JYA L;  4JV5 L;  1JIC A;  1U0L A;  1DGS A;  3WOF A;  2A69 D;  4V0B A;  2BA0 A;  2I0Q A;  3I4N B;  1L2F A;  3F2D A;  4X3S A;  4L6T B;  1TS2 A;  3HOX G;  2AUK A;  3SGI A;  5KYL A;  4G7H C;  1YJN A;  4M8A A;  3MHB A;  3LNN A;  1ZYR D;  2OQ0 A;  1G6Z A;  1U4R A;  1CT1 D;  3URY A;  4C3I G;  1UEB A;  3KJP A;  3CCM A;  4NW2 A;  1STB A;  1HNZ Q;  1S5F D;  1X54 A;  2CQA A;  2DJG C;  2OXP A;  1WVL A;  2AHO B;  4DR5 L;  4X65 Q;  4EX5 A;  4F87 A;  1B8A A;  1TY0 A;  1X32 A;  1HZB A;  3B6Y A;  3ULL A;  5C44 G;  4H02 A;  3JAM c;  4HJ5 A;  1G8Z D;  2RCN A;  4IFD H;  3M4P A;  1TWH B;  4HAE A;  1PH9 A;  1AE3 A;  2H5X A;  4IPH A;  2QIL A;  1BBX C;  3MFG A;  4JOI A;  2A69 C;  1D5Z C;  3D8G A;  3PSI A;  1D5X C;  2JA9 A;  2F0L A;  2QGQ A;  2ZTC A;  5C0X H;  3F2C A;  3IL8 A;  1VQ4 A;  3MWY W;  2KHI A;  3UDI A;  2HCC A;  1QZH A;  1EOT A;  3HOW B;  3K0X A;  1HUN A;  1NBW A;  2FXQ A;  5D65 A;  3S17 H;  4A4I A;  3KLS A;  5KEE A;  3U4Z A;  3TS0 A;  3OWE B;  4A3L H;  3OWF A;  4LF4 L;  4HJ8 A;  1IL8 A;  2F4V L;  2R6G A;  2MHV A;  1EL0 A;  3A8I E;  2B2V C;  4LF6 Q;  3GTM B;  4DR3 L;  3H3V C;  1JWM D;  3I7F A;  4EQ5 A;  1AZP A;  2EY2 A;  3T1Y L;  1SYG A;  3NWT A;  4CKC A;  2IWH A;  1LLR D;  3OHX C;  1PVO A;  2F4I A;  2B8F A;  2KHJ A;  4JW0 A;  2F0F A;  1C48 A;  3OMC A;  3STB D;  4HN7 A;  1GHJ A;  4MN3 A;  1R4Q B;  1TS4 A;  3D6W A;  4PNY A;  1O7Z A;  4DV3 L;  1KNA A;  2E2J B;  2EYM A;  1XNR Q;  3L7Z C;  3CRK C;  4JI5 Q;  3Q22 A;  1QOH A;  3HEJ A;  3TZU A;  3CC2 A;  1NSN S;  1GUO A;  1BKB A;  3W3A A;  3KJO A;  1MJC A;  4IUP A;  2OT2 A;  4KY7 A;  2QEX A;  4DV7 Q;  3GTQ B;  1R9T B;  3GTP H;  1PTO H;  2NZO A;  3S16 B;  1E22 A;  1W2B A;  3CCR A;  3D4D A;  4R8I A;  2VB2 X;  4HCE A;  1A3V A;  4LUZ A;  1H9S B;  1C4Q A;  2N55 A;  2HDM A;  3TME A;  4DR4 L;  2PZU A;  4JBM A;  2RQX A;  5FO9 B;  4DKA C;  1S5D D;  2OTL A;  2QKI C;  2AQ2 B;  3QR8 A;  4NXN Q;  2F0D A;  1XPO A;  3HOW G;  3VYT A;  1QB5 D;  2MFI A;  5EBC A;  1VQI A;  3U4V A;  3A5Z B;  1BNZ A;  5K5P A;  1F2M A;  4LNQ A;  3M4Y A;  3HS0 C;  5GAH C;  5EPL A;  4DXF A;  3FMC A;  2GN5 A;  4BY1 B;  3CAM A;  3S2D H;  1U5K A;  1I5F A;  3DEP A;  3MVV A;  4K5X A;  4JI0 Q;  3SE0 A;  4BBR H;  1DJR D;  1TWG B;  2NZH A;  4LWC A;  4A3G H;  4BBR G;  1EY9 A;  3PIO A;  1N33 L;  4GS3 A;  2F0T A;  4NDX A;  4CKB A;  5L37 A;  3LWU A;  4WRD A;  1BR9 A;  1G29 1;  5M5Y B;  1AFP A;  3M4Q A;  1H9M A;  1K3R A;  5JJL A;  1S72 A;  4G4K A;  3DWQ A;  3AFP A;  4A3K B;  1A15 A;  1WFQ A;  4DNT B;  5ELE A;  3RZD B;  4BXX H;  3FP9 A;  5GAG C;  3EBE A;  1X56 A;  2CQO A;  2NVY B;  3KDF A;  4B3M L;  1STY A;  1STA A;  1H9R A;  3J81 j;  1VQF A;  1DM0 B;  3CCQ A;  4PQX A;  5C44 B;  3ULJ A;  4NP5 A;  1E1O A;  3GDE A;  2JXM B;  3I3C A;  2CW0 D;  2QW7 A;  1PRT F;  1RKN A;  3VR5 A;  3UI2 A;  4POG A;  2NVQ B;  1Q1E A;  3SK5 A;  4XT1 B;  5ELN A;  4UP9 A;  2SEB D;  1XX8 A;  2F0U A;  3HGB A;  1WTO A;  1K73 C;  2K14 A;  1P16 A;  5HGQ A;  1I6V C;  3UE0 A;  1X3P A;  1ZKO A;  1QVF A;  4X66 L;  1I6H B;  1PTO C;  1MJE A;  2K4K A;  2ENB A;  3TN2 A;  3OPO A;  1ENA A;  5EJW A;  3C46 A;  2D9U A;  1SLJ A;  1IBL Q;  1CHP D;  4JPB W;  2YU9 H;  3G7L A;  2G5D A;  2MJ8 A;  1ICW A;  3TP7 A;  1HPC A;  5CGK A;  4LUO A;  4DAP A;  1LTA D;  2JYO A;  3MA2 B;  4LF8 Q;  2TSS A;  3PF4 A;  5C0X I;  2UXC Q;  5LMN W;  2IX0 A;  5K36 G;  4KTA A;  4TQU S;  2YV5 A;  4O1N A;  1TII D;  1IBK Q;  2QEJ C;  5K36 H;  1H9S A;  2EQS A;  2E8G A;  5FLX E;  1D7Q A;  5A2Q E;  2VW9 A;  5G3L D;  4DR6 Q;  3A8J E;  1KRT A;  1AZQ A;  2OEO A;  4LF8 L;  4K0K L;  5ELF A;  2JJQ A;  1IW7 C;  3PIP 3;  4HMJ A;  1F2Z A;  1VMC A;  3E3X A;  2LXJ A;  2UU9 L;  1TWG H;  3RLO A;  3TP5 A;  2AQ1 B;  4LF5 L;  1SXT A;  3S2H B;  4DV1 L;  5CV8 A;  5C3E G;  5HGT A;  1TXY A;  2EYO A;  5LMU L;  1W6K A;  1YNX A;  2JA7 G;  5T1I A;  2UXD Q;  3S2D B;  4KKS A;  3HOU G;  2XVS A;  4B9W A;  4ID6 A;  4AH6 A;  1KIX A;  4A3F H;  1SMY D;  5M3F H;  3ZYY X;  2Z4H A;  4A3I B;  1LT4 D;  4A3F G;  1BVS A;  2R61 A;  3S1N H;  3GTK H;  2JEA I;  1K0S A;  2PI2 E;  3KLW A;  2IX1 A;  1LUZ A;  3I90 A;  3J7A V;  4JCV E;  1HR0 W;  2UXD L;  4HJ9 A;  1UE6 A;  1YI2 A;  4KV6 A;  1SBB B;  3K5M A;  5IGD A;  4M1U B;  5IT9 L;  2L11 A;  3ER0 A;  1HXY D;  3NTH A;  1QVC A;  4Q0F A;  2Q2T A;  2LKV A;  1K9M C;  2IPK D;  1AW7 A;  3CMA A;  1GUW A;  3NQT A;  4F7X A;  1H9K A;  3I91 A;  4DAV A;  1E3P A;  3A0J A;  2NVY H;  4C3J H;  1BCP D;  3C2P A;  3PO3 G;  3HOV H;  4JYA Q;  2XNA C;  1SMY C;  2DN8 A;  3RZD H;  1T9H A;  5E1F A;  4JI8 Q;  3J81 i;  4DR1 L;  3ERO A;  4A93 H;  1AEX A;  4P72 A;  5CV4 A;  1RDP D;  3PMF A;  1PH5 A;  1XTD A;  1GUN A;  5AJ3 Q;  1Z7T A;  2NN6 G;  2ZM6 Q;  1PRT B;  2O4X A;  3S1Q H;  1LAB A;  1D1K A;  3O13 A;  1O7I A;  3GTG B;  4DR5 Q;  5D14 A;  4FF2 A;  1SND A;  5LMN L;  1VQH A;  1HA6 A;  3R2T A;  4K6L A;  1G51 A;  3AYH B;  3P1H A;  1C7Y A;  4POF A;  1YJ9 A;  1NNX A;  1JE5 A;  2NBF A;  4LFC Q;  2OQK A;  3MXN B;  2NUC A;  5ELO A;  5AJ3 L;  3P7J A;  4FO2 A;  3RR5 A;  2B2W C;  4IZ8 A;  1STH A;  4CDC C;  4X3T A;  1FNU A;  5GAD C;  5D3I B;  3GTJ H;  1NMG A;  2Z6K A;  1FGB D;  1QUQ B;  3FVQ A;  1FJG Q;  4RMF A;  1IXR A;  1IYJ B;  1EEF D;  3ITP A;  2KEC A;  1K83 B;  2F0S A;  5C4J B;  5FJ8 H;  5EPK A;  4K8J A;  2NWG A;  1JR0 D;  2A1A A;  4KKT A;  3DLL A;  2Z8L A;  2KJX A;  2IL8 A;  4UPA A;  3GTL B;  3GO5 A;  4WFN 3;  1XXG A;  4J6H A;  4IOA A;  2HHH Q;  2D0P A;  4QMG A;  2DNC A;  2ZXR A;  3EA6 A;  4KY5 A;  5C4J H;  3L2P A;  3IFD A;  4HIO A;  1NJI C;  2PCF B;  2XWJ B;  1STE A;  2FMC A;  1PDQ A;  2NZ1 D;  3FKI B;  4X3K A;  3VR2 A;  3CQZ B;  2R92 H;  2BE5 C;  1VQE A;  1XNR L;  2RKS A;  1RTN A;  1DCZ A;  1KNE A;  1HZA A;  1BBU A;  4S3S A;  3HOU B;  2ICI A;  2R3Z A;  2B39 A;  2K6A A;  3K7U C;  4DNR B;  3CCJ A;  1NR2 A;  3VYU A;  3I8Z A;  2O5I C;  1VF5 C;  1A8V A;  5BR8 L;  3RLF A;  3F8T A;  3NEL A;  4YWK A;  4DV5 Q;  1F77 A;  1BDO A;  1VS0 A;  4A3D H;  3BVM A;  4JBK A;  1Q3L A;  4CKE A;  4MIU A;  2JA6 G;  2HD3 A;  3I4L A;  2UXC L;  2NTT A;  2E74 C;  1M8A A;  5FLM G;  2BE5 D;  5IYC G;  3E9H A;  2KVM A;  3I55 A;  3NBI A;  2K33 A;  2Z6K C;  2VUM H;  2EYP A;  5IYC H;  1U4P A;  3HZX A;  3G48 A;  3Q24 A;  2F0N A;  1NE3 A;  4DV0 L;  5I2X A;  2K1B A;  4BS9 A;  2JA8 B;  2E2I B;  1X65 A;  1HNW Q;  4IUT A;  2K01 A;  3SK4 A;  4RGO S;  4OO1 I;  2VNU D;  4OIJ A;  5I6W A;  4KHP L;  1PZK D;  3BYT B;  3RNU A;  3ERQ A;  1OO9 B;  1QZG A;  2ZXO A;  5ELB A;  4NMZ A;  3T16 A;  4CDD C;  4JI3 Q;  4A93 B;  3CCL A;  5JJI A;  4IUV A;  4QUF A;  1DOM A;  1SJH D;  3TP8 A;  4FXK C;  5BN3 A;  1QCB D;  1Y1W B;  1SDF A;  4Z9C B;  1K83 H;  1SRU A;  5JPM C;  1XMQ L;  4JI1 L;  1JWS D;  4JK1 C;  4L63 B;  2DY7 A;  4K14 A;  4R4Q A;  5F2D A;  1VQ6 A;  2D62 A;  1LTL A;  3NPP A;  4UY8 C;  2CKZ B;  2KEN A;  3FPP A;  3MXP A;  1EIG A;  1A63 A;  3Q6S A;  3EFX D;  2FIN B;  5D3D A;  5FOB B;  3KF6 A;  1IKM A;  1TS5 A;  4PMB A;  2JP1 A;  2IJ0 A;  1F2L A;  4KK7 A;  4A3I G;  1HZC A;  3I4N G;  4FF4 A;  4A3I H;  3HKZ G;  1F9R A;  1VF7 A;  4AYB E;  1IKL A;  4R4O A;  2L0C A;  1UNS A;  3V96 A;  2TMP A;  4LF9 L;  3HOY B;  2F0I A;  3J7Y W;  3T56 B;  1YIT A;  1GM5 A;  4NPS A;  4HIM A;  2MUY A;  1PYW D;  2EJM A;  1LTB D;  2E75 C;  1HUM A;  2AMC B;  3PUV A;  4DGZ A;  4RKB A;  1SN8 A;  3SEB A;  4DN4 M;  2ATW A;  4GZY C;  3CC7 A;  4BBR B;  4OON A;  1XYI A;  4GLX A;  4JV5 Q;  4BY7 G;  1BO0 A;  1JOR A;  5E7N A;  4B3R L;  3EVQ A;  4DV4 Q;  1PHJ A;  3ND9 A;  4AIM A;  2R7Z G;  1Y1V H;  3VYS A;  4EQO A;  4DR6 L;  5J22 A;  4ZLT F;  3V2T A;  4FP5 D;  1SJE D;  1IW7 D;  1FJG L;  5IWA L;  3A7A B;  3PUZ A;  5C5L A;  4NXN L;  1IBM Q;  2WP8 J;  3GP7 A;  1EIH A;  3DMU A;  3AMU A;  5IGC A;  1CK1 A;  1BQQ T;  4DV6 L;  3HOZ H;  1G91 A;  3VR3 A;  3KF6 B;  5JAV A;  1EFI D;  4DR2 L;  2F3I A;  3HKS A;  2CVR A;  3I70 A;  5A35 A;  1N34 L;  4RG1 A;  5C44 H;  5IWA Q;  1YNJ C;  4GKJ L;  4PMW A;  1LTS D;  1I4R A;  1IBM L;  1TU2 B;  5I9P A;  3S16 H;  3UDF A;  4QUC A;  4DV6 Q;  3NHH A;  2NVQ H;  1O80 A;  1WJJ A;  3EIV A;  1GO3 E;  2B29 A;  2KHS A;  1VMP A;  1EY0 A;  5I6Y A;  2UXB Q;  2NN6 I;  3S1Q B;  1EWH A;  4BY1 H;  1SNQ A;  4C3H B;  4CJ1 B;  3MC0 B;  2LS0 1;  2PW7 A;  2E2H B;  1CFM A;  2A68 D;  4PZ6 A;  4A3J B;  1SFO H;  1WTP A;  5IE8 A;  4XQN A;  3NQI A;  4XXE A;  3QG1 A;  2Y0S E;  1Q46 A;  2MO1 A;  3IAY A;  3CW2 C;  3J7Z C;  5M5Y H;  4A3E B;  2HDL A;  5DEH A;  4TRD A;  1CA6 A;  1WTV A;  5M3F G;  1HFG A;  4A3D G;  1J5E L;  3CPF A;  3CCV A;  4A3M B;  1GD7 A;  4NKL A;  2JA6 H;  4JC0 A;  3GTO B;  4OO1 H;  1WTQ A;  2Q2I A;  4A3B B;  3HOY G;  4X3U A;  5IOD A;  4JI0 L;  3HKZ E;  3LGJ A;  2GVA A;  4I7A A;  4QL5 A;  4IFD J;  4DV0 Q;  1X3F A;  1V1P B;  3I2Z A;  4CGY B;  3CC4 A;  3M9B A;  4JBJ A;  2ES2 A;  3PO3 B;  1AH9 A;  4DA2 A;  5BN5 A;  3MAQ A;  2DGY A;  1HQM C;  3MTS A;  1S40 A;  2PMZ B;  3HOV G;  4IPD A;  4FNF A;  5IIF A;  2LFN A;  3L0O A;  3R93 A;  2Q2U A;  2D0O A;  4DUZ Q;  1L0W A;  5KRU A;  3S1M B;  1U4M A;  4O0A A;  4GOP A;  1B70 B;  5COR A;  5CYU A;  4JI1 Q;  2DUD A;  3TQY A;  4A3F B;  5JOB A;  4HIK A;  1QG7 A;  3T13 A;  3I56 A;  1OXT A;  2K52 A;  2Y0S B;  3OMG A;  3MZ5 A;  5IT9 E;  1Y1W G;  4OXP A;  5FKA C;  1XJV A;  1B7Y B;  2EXZ A;  4I65 A;  1OXS C;  4K0K Q;  4DK3 C;  2Q8R E;  2FHT A;  3DWP A;  3RUZ A;  1EQQ A;  2PMZ E;  3AEV A;  2HUG A;  2VQE Q;  1SYF A;  3T1H Q;  4B3T Q;  5IGB A;  1HHV A;  2B2T C;  3RD4 A;  2K5V A;  3BDL A;  3KLR A;  2ZTE A;  3H15 A;  1KL9 A;  1SAP A;  2HIX A;  4MTK A;  3RLN A;  4A3G B;  1CZG A;  1XWE A;  5IYB H;  1Y69 U;  3ONA B;  2AWN A;  1O7Y A;  4BBS G;  1PXU A;  3T1H L;  1KAW A;  4LK1 C;  2SNM A;  3W2D A;  2NVX H;  1EU4 A;  5A2Q L;  2EYJ A;  5EPJ A;  5C6A A;  1B9N A;  2K03 A;  1K28 A;  4IAL A;  5AFW A;  4B9X A;  3D31 A;  5C0X G;  2NB0 A;  2K5N A;  1AN8 A;  5BR8 Q;  5IGE A;  3NUC A;  1Z9F A;  1CSQ A;  4LFB Q;  2IW3 A;  3DUZ A;  4K8I A;  4DV2 Q;  2F0E A;  1LAC A;  5M3M G;  3Q23 A;  4JG2 A;  1PMR A;  1SYB A;  3G6J B;  3ZJY C;  4C1N I;  1K0R A;  1CKN B;  1ML0 D;  1I94 L;  1P8L A;  4XDX A;  4EQP A;  4FVM A;  2F3W A;  2YYZ A;  2JQO A;  1O78 A;  3S9W A;  4R4C A;  3S1N B;  1TWH H;  2RA4 A;  1BCP F;  4YHH L;  1KRS A;  2A74 C;  2MPM A;  1RF2 D;  5J1Z A;  2VXW A;  1FD7 D;  4DAY B;  1EYA A;  2UUA L;  3T51 B;  2IX3 A;  1PLF A;  3PUW A;  2ZM6 L;  4YHH Q;  1IHZ A;  4FF1 A;  1J9O A;  1XPU A;  1NR4 A;  1N34 Q;  2VUM G;  4BA1 I;  1A2U A;  4ZKB B;  1TQO A;  5E4X A;  2I5H A;  4ZKC B;  1EQV A;  1QIL A;  5FO8 B;  3CP0 A;  2L1B A;  1XNQ Q;  5IOC A;  5C5M A;  1JT8 A;  1PZJ D;  3E0J A;  1X6O A;  3J80 E;  1WCM B;  3PGZ A;  4LF7 L;  1GXD C;  3K59 A;  2B63 B;  4AYB G;  4OX9 L;  1MIU A;  2ZT9 C;  1KXL A;  2B2V A;  2OTJ A;  1EZ6 A;  3J80 i;  4AQY L;  4JI4 Q;  3NK9 A;  1VQ7 A;  3DHQ A;  4L5Q A;  2HCI A;  1FL0 A;  3PUX A;  3GTG H;  5IP7 G;  1JQY D;  4C2M B;  5KGU A;  1FYC A;  3NEM A;  3U9S A;  1B4O A;  3SVM A;  4KD4 A;  4CHT B;  5ELC A;  2CFM A;  5GAE C;  5EGT A;  2F03 A;  4BY1 G;  4GKK Q;  4X6A H;  2HIV A;  4KD3 A;  4LF9 Q;  1JB7 A;  1H9J A;  2A6E C;  3PO2 H;  2FFK B;  2J4X A;  1EQT A;  2AQ3 B;  4RCN A;  5M5W H;  3BS1 A;  1DOL A;  1J8I A;  3E6Z X;  3K5O A;  1BCP B;  4XQQ A;  5M5X B;  1K8G A;  3A8K E;  1PTO B;  3ERS X;  3TBI B;  4G7Z C;  5CV6 A;  1SYC A;  4HMI A;  1SE3 A;  4JI2 L;  1V1Q A;  2JK8 A;  3CD6 A;  4LFC L;  2BH2 A;  3J7A 5;  5FO7 B;  4A3M G;  2JA8 G;  1OXX K;  1VQL A;  2QDL A;  2B3G A;  2RHQ B;  2Q8I B;  3I4N H;  1G6P A;  3JAM i;  4A3M H;  3L9A X;  2WII B;  2B2U C;  5CV7 A;  1LTT D;  3MEH A;  1CKO A;  1X3G A;  4B3R Q;  1MBY A;  1KLU D;  4DV5 L;  1EY6 A;  4HJA A;  3D3R A;  2ZJR A;  1EEI D;  4C3J G;  2JA6 B;  1YHQ A;  1K8O A;  4ZUI A;  1L1O A;  5JEA H;  3P75 A;  4A3J G;  1ZYR C;  2R7Z B;  2EDG A;  1HA5 A;  2XRQ D;  1CTM A;  2G9D A;  3RMH A;  2B2U A;  5IYD G;  4HCS A;  3I72 A;  2Q8T A;  5E4W C;  2P5Z X;  3I4M H;  1Q90 A;  2K7V A;  1II3 A;  1EY4 A;  1A3U A;  1B3A A;  3KDF B;  1BUV T;  2WKD A;  1N8R C;  3H0G G;  2K5H A;  4CBV A;  2RDG A;  5CV5 A;  3MEF A;  3A5U A;  1NAP A;  1SFO B;  1KC8 C;  1MSG A;  1GUG A;  2R7Z H;  3OW7 A;  1WD0 A;  3TRZ A;  1Y1V G;  5ELD A;  1YEZ A;  1SE4 A;  5M5X H;  1B2T A;  3SK8 A;  1Q81 C;  4GKJ Q;  1S3O A;  1VQ5 A;  2B2Y C;  5C4X H;  1T5E A;  2RVL A;  2E2J H;  4WJ4 A;  4ALP A;  5C4X G;  4RA8 A;  3BZK A;  5CBA E;  4ULL A;  1GJX A;  2KCC A;  4GLA C; 
#chains in the Genus database with same CATH homology
 3KBG A;  1SEB D;  2WIN B;  4ZAI A;  3DWA A;  1DON A;  4L8J A;  3D4R A;  4WOR A;  4U68 A;  4LAA A;  1JOO A;  4K2K A;  2EZV A;  2XWB B;  1HTL D;  4TSS A;  2RDH A;  1RHP A;  3CKI B;  3P20 A;  1LT5 D;  1HCZ A;  2L4N A;  3R3O A;  3MXU A;  4B08 A;  2KED A;  2NYZ D;  1S5C D;  3RZO B;  4FXD A;  3J7A F;  4RHS A;  1CHQ D;  2EY6 A;  2EY1 A;  2PYK A;  1HFN A;  1KAB A;  1A3T A;  3K58 A;  4AYB B;  1BXT A;  1E2Z A;  3M3Y B;  1JB3 A;  3AU7 A;  5DM7 3;  1FNV A;  3L3O C;  4DAY A;  2RDF A;  3FDT A;  1V43 A;  1TWA B;  2KA7 A;  1TR5 A;  2VUM B;  4KKU A;  3M7G A;  2K5Q A;  1DYQ A;  1RTO A;  1DXM A;  3SR1 A;  4KI0 A;  1HQR D;  4R8N A;  1FNW A;  4CJ0 B;  1SSO A;  4ODG A;  3OSO A;  3NTK A;  3N52 A;  1F2Y A;  4HED A;  1EZ8 A;  1CQV A;  2ZXP A;  1ONL A;  4MHE A;  2PO4 A;  3KK7 A;  3DEO A;  2QDB A;  1LV9 A;  5EKK A;  2WKC A;  2O2L D;  2B8G A;  1PFN A;  5C3E B;  3C1E A;  1JWU D;  3M7N A;  5C4X B;  4A3D B;  2A6H D;  1EY8 A;  3HOZ B;  3H6M A;  3ND8 A;  3QB3 A;  3SK6 A;  1Z47 A;  1Q8I A;  5KYI A;  3K5N A;  2X6L A;  1TVX A;  3NP8 A;  1XTC D;  2WAQ B;  3K0Y A;  2Z1C A;  5C0X J;  2KOL A;  2F0J A;  2X6G A;  1B44 D;  1EY7 A;  1LTR D;  3AB9 A;  1Y8O B;  4IUN A;  1JOQ A;  1RD9 D;  3T4A C;  3PUY A;  2NVT B;  3WDN A;  1SNM A;  2XIW A;  5COY A;  5LHY 1;  1OXV A;  2RSO A;  4ABN A;  1WTX A;  4RH6 A;  3KF8 A;  4FXG C;  3GV6 A;  2EY5 A;  4RHR A;  2F0W A;  4EQN A;  3TDQ A;  1NCV A;  4FYD A;  1MD2 D;  1V1P A;  1WD1 A;  3K5L A;  2B2W A;  4K5W A;  3A56 A;  1JCK B;  5C4H A;  2L55 A;  2FJ2 A;  2C5C A;  4BWG B;  2BCO A;  2F0O A;  1QNU A;  1F9P A;  1Y1V B;  4ZUJ A;  2GA4 B;  3MXN A;  3KBX A;  2CW0 C;  3HRZ C;  2L9H A;  4ILW A;  5LL6 S;  4F8M A;  4IUR A;  1L0X B;  1Y8P B;  2D2C C;  5M5W B;  1IYV A;  4ZYS A;  1CM9 A;  1E2V A;  4IFD G;  1PFB A;  1R4P B;  3E5S A;  2F0K A;  3BDO A;  5I2Y A;  1L0Y B;  1G2T A;  1TY2 A;  1V8Q A;  3IFT A;  2H1E A;  4C3H G;  3QOL A;  2Z4I A;  2JSO A;  4DF7 A;  4R9W A;  4ZK9 B;  5I4D A;  2F3V A;  1B50 A;  1U9R A;  1WTR A;  4QB4 A;  1D2B A;  2NVX B;  1FR3 A;  3J80 L;  3F2U A;  3DM1 A;  1O7L A;  3SXH A;  1OXU A;  4PV1 C;  2RSN A;  1STN A;  5CBA E;  1E2W A;  3X3M A;  1K8M A;  3MXG A;  3R8B A;  4IUU A;  3I73 A;  3N6R A;  1U4L A;  2F0P A;  4ZQ3 A;  2PQE A;  1KDC A;  5EQ0 A;  1BF4 A;  4I7Z C;  2A68 C;  3A7L A;  2PZT A;  1I4P A;  2M00 A;  5NUC A;  1HTP A;  5KIX A;  1LT3 D;  3S15 B;  1T5X D;  5JEA G;  3C1F A;  2M9V A;  3GV3 A;  3S14 B;  1BOS A;  5E3F A;  3CRL C;  2K05 A;  3QO2 A;  4BBS B;  5T1G A;  1D6E C;  2NN6 H;  4KJO A;  2BOS A;  2QF7 A;  4PMC A;  1S5E D;  2F0Q A;  3QIA A;  3VR6 A;  3GD7 A;  4V19 0;  2N88 A;  1DD2 A;  1MI2 A;  2PPB C;  1BCP C;  3A55 A;  5DAU A;  2A5H A;  1YNN D;  2DY8 A;  1SNP A;  4ZRZ A;  1QNK A;  4J1M A;  2R93 B;  3BG3 A;  1SYE A;  4N9P A;  1ILP A;  5IGG A;  1D1I A;  4P2C B;  5CV9 A;  1MGS A;  2EYH A;  4EVO A;  4LJZ C;  2EPB A;  5FK9 C;  1ET6 A;  5BN4 A;  5CMD A;  1YNN C;  2R92 B;  1SNO A;  2NTS A;  1ROD A;  2PZW A;  2JA5 B;  4KMU C;  3R2I A;  3PV0 A;  5C3W A;  3TP6 A;  2PW5 A;  1S5B D;  3T53 B;  3D4W A;  4DK0 A;  4K5V A;  2J7Z A;  1EY5 A;  2X69 A;  4U67 3;  3J81 E;  4J8Q A;  3EQL C;  3VA7 A;  1V1O A;  4UDU C;  3VR4 A;  2EYL A;  4EGV A;  2LY7 A;  4H13 C;  1CZW A;  4F88 A;  2K32 A;  4K6D A;  1ILQ A;  2WV6 D;  2XRS D;  5EKI A;  2KEE A;  1MSH A;  1Z6H A;  5J39 A;  1NUC A;  2BA1 A;  1G2S A;  1SE2 A;  2EJG C;  1CI3 M;  5JVG 3;  2K04 A;  5C4Z A;  2XN9 C;  3CU7 A;  5G3L F;  3VA5 A;  4H0L C;  1PTO F;  1F9S A;  2AWO A;  3EJI A;  3S1R B;  4C3J B;  1B1Z A;  2I46 A;  3NWS A;  2F0M A;  3HP3 A;  4XT3 B;  1TT2 A;  4RGM A;  1TS3 A;  3SHL A;  2JE6 I;  4RCO A;  2F0H A;  1VCI A;  4C1N K;  2F1M A;  3JAM E;  5CC4 A;  2E2D C;  4C3I B;  2A6E D;  3H0G B;  4FF3 A;  1KDA A;  3NSW A;  1JC7 A;  1PTO D;  3M4O B;  1ESR A;  1LTI D;  2EJF C;  4RGN A;  1TKW B;  2CHB D;  1TWC B;  1Y8N B;  3A54 A;  2SNS A;  4OL7 A;  1KDB A;  3BVG A;  4OHJ A;  3VYR A;  5C3X A;  1KAA A;  1LO5 D;  2KQ3 A;  1CA5 A;  3OIQ A;  3NBH A;  5EBD A;  4Q5V A;  2A73 B;  1KLG D;  4IQZ A;  1UEA B;  4OIK A;  2V4D A;  2K5D A;  5JVH 3;  1B53 A;  3CHB D;  4XYO A;  4KY6 A;  3J81 L;  1I4H A;  4BY7 B;  3BDC A;  4KJN A;  4DFA A;  2ID0 A;  4G7O C;  5LL6 X;  2YU9 B;  4DXG A;  1Q1B A;  2EYF A;  1Q12 A;  2F0G A;  3HOX B;  4WJW A;  1QE6 A;  1C8C A;  2O5J C;  1UUP A;  2K28 A;  5I9O A;  1I3Q B;  4RKL A;  3HG9 A;  2WB1 B;  3H91 A;  1PRT C;  1S4Z A;  3NE5 B;  1E0B A;  3TSS A;  4LMQ D;  1UAP A;  1TWF B;  3Q0A A;  3JAM L;  1STG A;  1GUT A;  1YNJ D;  5FLX L;  2KUM A;  4UAI A;  3BZD B;  1I4Q A;  3FEW X;  4C56 C;  2VB3 X;  1I4X A;  2WAC A;  1RCV D;  3QJY A;  5JJZ A;  1ET9 A;  2DNE A;  3OOC A;  1QJO A;  5HUR A;  3M85 A;  1CQF A;  2MP1 A;  4HR7 B;  5CBE E;  5DM6 3;  4OO1 G;  1A2T A;  4KHZ A;  4OGQ C;  5TSS A;  2EVB A;  4QCL A;  2AUJ D;  1QWY A;  3D6C A;  4ME5 A;  4E6I A;  1ESF A;  3KUP A;  2LMC B;  3IKJ A;  1GHK A;  4QF4 A;  5IGF A;  2J0T D;  4XQJ A;  4XYQ A;  2M2L A;  5JPN C;  1DZ1 A;  5JEA J;  3GTP B;  4HTH A;  2L5T A;  2MGS A;  1ZXT A;  4YIJ A;  3SDZ A;  4CJ2 C;  2L12 A;  1JE4 A;  4HSP A;  1EWC A;  5CR3 A;  4HSV A;  5EKL A;  1EYC A;  5M3F B;  3BVZ A;  4RGT A;  3LX0 A;  3GTJ B;  1A6X A;  3S17 B;  3H94 A;  4QIW B;  1ZEQ X;  2A6H C;  3HOV B;  3H09 A;  3OIP A;  4DK1 A;  5M9O A;  3K57 A;  3PIO 3;  1AP0 A;  1JOK A;  1X3Q A;  3GTK B;  2IT1 A;  4N9T A;  3WOE A;  1M4V A;  2JEB I;  2B2T A;  1VDZ A;  3PO2 B;  3DXJ C;  2QCP X;  2K5W A;  4O42 A;  2EOT A;  4IN3 A;  4RAU C;  1EYD A;  1GUS A;  1PFM A;  4TKO B;  4RFB A;  2C9O A;  1LTG D;  4JBW A;  3K7A B;  3TZD A;  3QOJ A;  2XSC A;  5KND A;  1I4G A;  2D5D A;  2G9H D;  3FPU B;  4G57 A;  1DOK A;  5KNC A;  5DNF A;  1W6J A;  3NTI A;  1ENF A;  3MFY A;  3U9O A;  2JA7 B;  4XIG S;  2SOB A;  2E76 C;  2FMM A;  1F9Q A;  4IUQ A;  3BYY B;  1KTK A;  3X3N A;  3LWE A;  5ISR A;  1B9M A;  4Y7N B;  1ENC A;  1PZI D;  1WTW A;  4H44 C;  1D5M C;  2H4O A;  3QWN A;  4KHV A;  3FRP B;  4KN4 C;  3C3L A;  1IYU A;  1I50 B;  2HQE A;  3HKZ B;  2OF1 A;  1SYD A;  5M3M B;  2ICE C;  2EE1 A;  2BDN A;  4IFD I;  4XTC S;  1GOZ A;  3K6O A;  3V05 A;  1HRJ A;  4BA2 I;  1RJT A;  3GQB A;  2KCN A;  4RWS C;  1EU3 A;  3KLS X;  2RBM A;  4H7B A;  3I4M B;  2PNR C;  4KN7 C;  2I07 B;  2B2Y A;  2BDO A;  2SDF A;  3NXW A;  5KNB A;  1LT6 D;  4K2L A;  2F0V A;  4DU9 A;  1SNC A;  1JIC A;  3WOF A;  2A69 D;  4V0B A;  2BA0 A;  3I4N B;  4X3S A;  4L6T B;  1TS2 A;  2AUK A;  5KYL A;  4G7H C;  4M8A A;  3MHB A;  3LNN A;  1ZYR D;  1G6Z A;  3URY A;  1U4R A;  1CT1 D;  4C3I G;  4NW2 A;  1STB A;  1S5F D;  2CQA A;  1WVL A;  2OXP A;  4F87 A;  1TY0 A;  1X32 A;  1G8Z D;  4IFD H;  1TWH B;  4HAE A;  2QIL A;  1BBX C;  3MFG A;  2A69 C;  1D5Z C;  3D8G A;  1D5X C;  2F0L A;  5C0X H;  3IL8 A;  3MWY W;  2HCC A;  1EOT A;  3HOW B;  1HUN A;  5D65 A;  3KLS A;  5KEE A;  3OWE B;  3OWF A;  1IL8 A;  2R6G A;  2MHV A;  1EL0 A;  3A8I E;  2B2V C;  3GTM B;  3H3V C;  1JWM D;  1AZP A;  2EY2 A;  1SYG A;  3NWT A;  4CKC A;  2IWH A;  1LLR D;  3OHX C;  2F4I A;  2B8F A;  2F0F A;  1C48 A;  3OMC A;  4HN7 A;  1GHJ A;  4MN3 A;  1R4Q B;  1TS4 A;  3D6W A;  4PNY A;  1O7Z A;  2E2J B;  1KNA A;  2EYM A;  3L7Z C;  3CRK C;  3Q22 A;  1QOH A;  3HEJ A;  3TZU A;  1NSN S;  1GUO A;  3W3A A;  4IUP A;  2OT2 A;  4KY7 A;  3GTQ B;  1R9T B;  1PTO H;  3S16 B;  3D4D A;  4R8I A;  2VB2 X;  4HCE A;  1A3V A;  1H9S B;  1C4Q A;  2N55 A;  2HDM A;  3TME A;  2PZU A;  2RQX A;  5FO9 B;  1S5D D;  2QKI C;  2AQ2 B;  2F0D A;  3VYT A;  1QB5 D;  5EBC A;  1BNZ A;  5K5P A;  1F2M A;  3M4Y A;  3HS0 C;  5EPL A;  4DXF A;  3FMC A;  4BY1 B;  3DEP A;  3MVV A;  4K5X A;  3SE0 A;  1DJR D;  1TWG B;  1EY9 A;  2F0T A;  4NDX A;  4CKB A;  3LWU A;  4WRD A;  1BR9 A;  1G29 1;  5M5Y B;  1AFP A;  1H9M A;  4G4K A;  3DWQ A;  4A3K B;  1A15 A;  3RZD B;  4DNT B;  5ELE A;  2NVY B;  1STY A;  1STA A;  1H9R A;  1DM0 B;  4PQX A;  5C44 B;  4NP5 A;  2JXM B;  3I3C A;  2CW0 D;  1PRT F;  1RKN A;  3VR5 A;  3UI2 A;  2NVQ B;  1Q1E A;  3SK5 A;  4XT1 B;  2SEB D;  1XX8 A;  2F0U A;  3HGB A;  1WTO A;  1I6V C;  1X3P A;  1ZKO A;  1I6H B;  1PTO C;  2ENB A;  3TN2 A;  3OPO A;  1ENA A;  5EJW A;  3C46 A;  2D9U A;  1CHP D;  3G7L A;  2MJ8 A;  1ICW A;  3TP7 A;  1HPC A;  5CGK A;  4DAP A;  1LTA D;  2JYO A;  3MA2 B;  2TSS A;  5C0X I;  2IX0 A;  5K36 G;  4KTA A;  4TQU S;  4O1N A;  1TII D;  2QEJ C;  5K36 H;  1H9S A;  5FLX E;  5A2Q E;  5G3L D;  3A8J E;  1AZQ A;  2OEO A;  5ELF A;  1IW7 C;  3PIP 3;  4HMJ A;  1F2Z A;  1VMC A;  3TP5 A;  2AQ1 B;  1SXT A;  3S2H B;  5CV8 A;  5HGT A;  2EYO A;  1W6K A;  5T1I A;  3S2D B;  4KKS A;  2XVS A;  4B9W A;  4ID6 A;  1SMY D;  3ZYY X;  2Z4H A;  4A3I B;  1LT4 D;  2R61 A;  2JEA I;  2IX1 A;  3I90 A;  3J7A V;  4KV6 A;  1SBB B;  3K5M A;  5IGD A;  4M1U B;  5IT9 L;  2L11 A;  1HXY D;  3NTH A;  4Q0F A;  2LKV A;  2IPK D;  1AW7 A;  1GUW A;  3NQT A;  4F7X A;  1H9K A;  3I91 A;  4DAV A;  1BCP D;  3C2P A;  2XNA C;  1SMY C;  2DN8 A;  5E1F A;  3ERO A;  1AEX A;  5CV4 A;  1RDP D;  3PMF A;  1GUN A;  1Z7T A;  2NN6 G;  1PRT B;  2O4X A;  1LAB A;  1D1K A;  3O13 A;  3GTG B;  4FF2 A;  5D14 A;  1SND A;  1HA6 A;  3R2T A;  4K6L A;  3P1H A;  2NBF A;  2NUC A;  3P7J A;  4FO2 A;  2B2W C;  4IZ8 A;  1STH A;  4X3T A;  1FNU A;  5D3I B;  1FGB D;  3FVQ A;  1EEF D;  3ITP A;  2KEC A;  1K83 B;  2F0S A;  5C4J B;  5EPK A;  4K8J A;  2NWG A;  1JR0 D;  4KKT A;  2Z8L A;  2KJX A;  2IL8 A;  3GTL B;  3GO5 A;  4WFN 3;  1XXG A;  4J6H A;  4QMG A;  2DNC A;  2ZXR A;  3EA6 A;  4KY5 A;  3IFD A;  2PCF B;  2XWJ B;  1STE A;  2FMC A;  1PDQ A;  2NZ1 D;  3FKI B;  4X3K A;  3VR2 A;  3CQZ B;  2BE5 C;  2RKS A;  1RTN A;  1DCZ A;  1KNE A;  4S3S A;  3HOU B;  2ICI A;  2R3Z A;  2B39 A;  2K6A A;  4DNR B;  1NR2 A;  3VYU A;  3I8Z A;  2O5I C;  1VF5 C;  3RLF A;  1F77 A;  1BDO A;  3BVM A;  1Q3L A;  4CKE A;  4MIU A;  3I4L A;  2NTT A;  2E74 C;  1M8A A;  2BE5 D;  2KVM A;  3NBI A;  2K33 A;  2EYP A;  1U4P A;  3HZX A;  3Q24 A;  2F0N A;  5I2X A;  2K1B A;  4BS9 A;  2JA8 B;  2E2I B;  2K01 A;  4IUT A;  3SK4 A;  4RGO S;  4OO1 I;  2VNU D;  4OIJ A;  5I6W A;  1PZK D;  3BYT B;  3ERQ A;  1OO9 B;  2ZXO A;  5ELB A;  4NMZ A;  3T16 A;  4A93 B;  4IUV A;  4QUF A;  1DOM A;  1SJH D;  3TP8 A;  4FXK C;  5BN3 A;  1QCB D;  1Y1W B;  1SDF A;  4Z9C B;  5JPM C;  1JWS D;  4JK1 C;  4L63 B;  2DY7 A;  4K14 A;  5F2D A;  2D62 A;  3NPP A;  3FPP A;  3MXP A;  1EIG A;  3Q6S A;  3EFX D;  2FIN B;  5D3D A;  5FOB B;  1IKM A;  1TS5 A;  4PMB A;  2JP1 A;  2IJ0 A;  1F2L A;  4KK7 A;  4FF4 A;  1F9R A;  1VF7 A;  1IKL A;  2L0C A;  1UNS A;  3V96 A;  2TMP A;  3HOY B;  2F0I A;  3J7Y W;  3T56 B;  2MUY A;  1PYW D;  2EJM A;  1LTB D;  2E75 C;  1HUM A;  3PUV A;  4DGZ A;  4RKB A;  3SEB A;  4DN4 M;  4GZY C;  4BBR B;  1XYI A;  1BO0 A;  1JOR A;  3EVQ A;  3ND9 A;  3VYS A;  4EQO A;  5J22 A;  4ZLT F;  3V2T A;  4FP5 D;  1SJE D;  1IW7 D;  3A7A B;  3PUZ A;  5C5L A;  1EIH A;  2WP8 J;  3GP7 A;  3DMU A;  3AMU A;  1CK1 A;  1BQQ T;  1G91 A;  3VR3 A;  5JAV A;  1EFI D;  2CVR A;  3I70 A;  5A35 A;  1YNJ C;  4PMW A;  1LTS D;  1I4R A;  1TU2 B;  5I9P A;  4QUC A;  3NHH A;  1O80 A;  2KHS A;  1VMP A;  1EY0 A;  5I6Y A;  2NN6 I;  3S1Q B;  1EWH A;  1SNQ A;  4C3H B;  4CJ1 B;  3MC0 B;  2LS0 1;  2PW7 A;  2E2H B;  1CFM A;  2A68 D;  4A3J B;  1WTP A;  4XQN A;  3NQI A;  4XXE A;  3QG1 A;  3IAY A;  4A3E B;  2HDL A;  5DEH A;  4TRD A;  1CA6 A;  1WTV A;  1HFG A;  4A3M B;  4NKL A;  3GTO B;  4OO1 H;  1WTQ A;  4A3B B;  4X3U A;  5IOD A;  4IFD J;  1V1P B;  4CGY B;  3PO3 B;  4DA2 A;  5BN5 A;  3MAQ A;  1HQM C;  3MTS A;  2PMZ B;  4FNF A;  5IIF A;  2LFN A;  3R93 A;  5KRU A;  3S1M B;  1U4M A;  5COR A;  5CYU A;  4A3F B;  5JOB A;  1QG7 A;  3T13 A;  4ULL A;  1OXT A;  2Y0S B;  3OMG A;  3MZ5 A;  5IT9 E;  5FKA C;  2EXZ A;  4I65 A;  1OXS C;  2Q8R E;  2FHT A;  3DWP A;  3RUZ A;  2HUG A;  1SYF A;  5IGB A;  1HHV A;  2B2T C;  3RD4 A;  3BDL A;  3KLR A;  1SAP A;  4A3G B;  1CZG A;  1XWE A;  1Y69 U;  3ONA B;  2AWN A;  1O7Y A;  1PXU A;  4LK1 C;  2SNM A;  3W2D A;  1EU4 A;  5A2Q L;  2EYJ A;  5EPJ A;  5C6A A;  1B9N A;  2K03 A;  4IAL A;  5AFW A;  4B9X A;  3D31 A;  5C0X G;  2NB0 A;  1AN8 A;  3NUC A;  2IW3 A;  3DUZ A;  4K8I A;  2F0E A;  1LAC A;  3Q23 A;  1PMR A;  1SYB A;  3G6J B;  4C1N I;  1ML0 D;  4XDX A;  4EQP A;  4FVM A;  2F3W A;  2YYZ A;  1O78 A;  3S9W A;  3S1N B;  2RA4 A;  1BCP F;  2A74 C;  2MPM A;  1RF2 D;  5J1Z A;  2VXW A;  1FD7 D;  1EYA A;  3T51 B;  2IX3 A;  1PLF A;  3PUW A;  1IHZ A;  4FF1 A;  1J9O A;  1NR4 A;  4ZKB B;  4BA1 I;  1A2U A;  1TQO A;  5E4X A;  4ZKC B;  1EQV A;  1QIL A;  5FO8 B;  2L1B A;  5IOC A;  5C5M A;  1PZJ D;  3E0J A;  3J80 E;  1WCM B;  1GXD C;  3K59 A;  2B63 B;  2ZT9 C;  2B2V A;  1EZ6 A;  3NK9 A;  3DHQ A;  2HCI A;  3PUX A;  1JQY D;  4C2M B;  5KGU A;  1FYC A;  3U9S A;  1B4O A;  3SVM A;  4KD4 A;  4CHT B;  5ELC A;  5EGT A;  2F03 A;  4KD3 A;  1H9J A;  2A6E C;  2FFK B;  2J4X A;  1EQT A;  2AQ3 B;  4RCN A;  3BS1 A;  1DOL A;  1J8I A;  3E6Z X;  3K5O A;  1BCP B;  4XQQ A;  5M5X B;  3A8K E;  1PTO B;  3TBI B;  4G7Z C;  5CV6 A;  1SYC A;  4HMI A;  1SE3 A;  5FO7 B;  1OXX K;  2Q8I B;  3L9A X;  2WII B;  2B2U C;  5CV7 A;  1LTT D;  3MEH A;  1MBY A;  1KLU D;  1EY6 A;  3D3R A;  1EEI D;  4C3J G;  2JA6 B;  1K8O A;  4ZUI A;  5JEA H;  3P75 A;  1ZYR C;  2R7Z B;  2EDG A;  1HA5 A;  2XRQ D;  1CTM A;  2G9D A;  3RMH A;  2B2U A;  4HCS A;  3I72 A;  2Q8T A;  5E4W C;  1Q90 A;  2K7V A;  1II3 A;  1EY4 A;  1A3U A;  1B3A A;  1BUV T;  2WKD A;  4CBV A;  2RDG A;  5CV5 A;  1NAP A;  1SFO B;  1MSG A;  1GUG A;  3OW7 A;  1WD0 A;  5ELD A;  1SE4 A;  1B2T A;  3SK8 A;  2B2Y C;  1T5E A;  2RVL A;  4RA8 A;  5IGE A;  5IGC A;  1GJX A;  2KCC A;  1PRT D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...