2K28A

Solution nmr structure of the chromo domain of the chromobox protein homolog 4
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
b'GSEHVFAVESIEKKRIRKGRVEYLVKWRGWSPKYNTWEPEENILDPRLLIAFQNRERQEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase CBX4
publication title Solution NMR structure of the chromo domain of the chromobox protein homolog 4.
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 11
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2008-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k28A00
3I8ZA 4X3KA 1X3PA 1U4LA 1O7ZA 2L12A 1EQTA 1M8AA 1ML0D 2HDLA 2X69A 1CA6A 2XIWA 2HUGA 3TN2A 2BDNA 3LWEA 4O42A 1E0BA 2Q8TA 3MTSA 1ILQA 2KOLA 2KVMA 3GV3A 5CBAE 2N88A 1U4PA 2N55A 1RJTA 1Q3LA 1G6ZA 2M2LA 2RSNA 1NAPA 1NCVA 3FDTA 4IUVA 1IKMA 2NWGA 1B3AA 1EIGA 3KBXA 1PFNA 2MP1A 4IURA 1DOKA 2SDFA 4CJ2C 5CMDA 2B2TA 2FHTA 4ZK9B 3DM1A 2JP1A 2MGSA 1WD0A 2FFKB 5CORA 4NW2A 5CBEE 5D65A 4ZKBB 1RTNA 2B2UC 1EIHA 4RAUC 1VMPA 4MHEA 2X6GA 2RVLA 2MPMA 2KEEA 3IFDA 4ZKCB 3P7JA 1HFNA 2B2VC 1G2TA 1DOMA 1MI2A 3FPUB 5EJWA 4HEDA 2EOTA 1DOLA 2IL8A 1B2TA 1NR2A 2KUMA 4ZAIA 1KNAA 1U4MA 1HHVA 2K28A 1ZXTA 2K03A 2K1BA 3F2UA 5DNFA 5EQ0A 1DZ1A 4XDXA 1F2LA 3G7LA 1PFMA 1XX8A 1AZQA 5EPLA 1A15A 4XT3B 1WTRA 2NZ1D 4HAEA 1O80A 1WVLA 2FMMA 4UAIA 3N52A 3MWYW 1J9OA 5T1IA 1EOTA 1B50A 2EPBA 3I3CA 3I91A 4IUTA 1WTWA 1MGSA 1B53A 1BO0A 4RA8A 1SDFA 1QG7A 5EPKA 4QUFA 1NR4A 4R8IA 1AZPA 1HA6A 1WTQA 5JJZA 2JYOA 1VMCA 2B2YC 4X3TA 4IUPA 1RODA 1EL0A 1BF4A 3H91A 1O7YA 2K04A 2KECA 2NYZD 4HCSA 5AFWA 2B2UA 3DEOA 1SSOA 3DEPA 2B2VA 1F9QA 4OIJA 4R9WA 3GV6A 4X3UA 2FINB 5D14A 5E4XA 1HUMA 5E4WC 1JE4A 3TZDA 1SAPA 4OIKA 2EE1A 2L11A 2L4NA 1QNKA 1RTOA 1XYIA 1ILPA 2X6LA 4CJ0B 1B4OA 1PFBA 2K05A 2HCCA 2R3ZA 2DY8A 1ICWA 2KEDA 3KUPA 1WTXA 1F9PA 1U4RA 1CA5A 1ESRA 4U68A 1IKLA 2L1BA 5T1GA 4LMQD 1GUWA 2L9HA 4CJ1B 1WTOA 3HP3A 3IL8A 3SVMA 1WTVA 2HDMA 3Q6SA 1AP0A 1X32A 4DN4M 1BBXC 1S4ZA 1QE6A 3D6WA 1IL8A 4HSVA 4QUCA 1LV9A 1PDQA 1F9RA 1F9SA 2B2YA 4RWSC 5COYA 2HCIA 1C8CA 1HRJA 1TVXA 2DY7A 2J7ZA 1HFGA 1RHPA 1DONA 2B2WC 3R93A 3UI2A 2K01A 1KNEA 1CM9A 1PLFA 2B2WA 2RA4A 2D9UA 3ONAB 2FJ2A 2MJ8A 2B2TC 2VXWA 5EKIA 1HUNA 2Q8RE 1JICA 1G2SA 2RSOA 3QO2A 4XT1B 1J8IA 4IUQA 4X3SA 1WD1A 1WTPA 2CVRA 1BNZA 1MSGA 1G91A 4IUUA 1X3QA 5EPJA 3I90A 2H1EA 4ZLTF 4MN3A 1MSHA
chains in the Genus database with same CATH superfamily
1EY0A 2PCFB 4RCNA 2E2HH 1L0YB 4A3IG 3KYHC 1ML0D 2X69A 5AJ3L 4PZ7A 2JA7H 1BQQT 4JPBW 3H09A 1SN8A 2GVBA 1KAAA 3QB3A 2F0GA 3K7AH 3H15A 1CKNA 4C3HB 4NKLA 1XPRA 2XWJB 4KHZA 1B3AA 3SGIA 3CC2A 4DR5L 1V1QA 1PFNA 3SHLA 1EY7A 3H3VH 3BDCA 4LFCL 1QJOA 4CHTB 1I6HB 2XN9C 5G3LF 4FXGC 1K3BC 3D8GA 2OTLA 1VMPA 3IKJA 3IRBA 2VY3A 3IFDA 3CP0A 1X65A 2XVSA 4BBRH 2IL8A 1PYBA 2F3IA 2ZM6L 1LACA 4K2LA 4RGTA 3KLWA 1IHZA 3K5LA 1A6XA 1LT3D 3ERQA 4OHJA 2EJGC 4MZ9A 4UAIA 1VQBA 4DGZA 4HIMA 5T1IA 5M5XH 3KDFB 2PO4A 3S16B 4F88A 3GTPB 4DV7L 1EEFD 3OYYA 1HZ9A 2WAQG 4NPSA 2WFWA 1AH9A 2C9OA 1XNRL 5LMNL 3LNNA 5JPMC 1SSOA 4AQYL 2NVYB 4LF9L 4GKKL 1NMFA 2F4VL 3CC7A 4QCLA 1KL9A 4R4OA 1R9TH 2HHHQ 1SNPA 3VYRA 1TR5A 2X6LA 4C3JH 3J7A5 2G9HD 3K57A 1F9PA 4K0KQ 3J81c 1ESRA 3I70A 4P75A 2VB3X 5C3EB 3WDNA 1X32A 3HOYH 4LF6L 3D6WA 1IL8A 5M9OA 1VQMA 1PDQA 1PTOB 1W6JA 2M00A 1CTMA 2BCOA 4CDDC 1Q46A 1FNUA 2F0JA 2F0WA 4KJNA 1YIJA 1QUQB 3MXGA 1G2SA 1N36Q 4XT1B 3GTLH 3K80C 2JK8A 2H1EA 4B3SL 1SXTA 4ZLTF 2WIIB 3I8ZA 4C2MH 1ESFA 2B3GA 4V190 1YJWA 1Y1WH 1E2ZA 2B63G 2KCCA 3T16A 3J7YW 3NK9A 4BA1I 2KVMA 3GV3A 3A56A 1VQFA 4Z9CB 2KBNA 1B9NA 1EIGA 3OPOA 3CAMA 4LF7L 5C0XH 1I6VC 1MKHA 3KJPA 1VQCA 1TWCH 3TRZA 2K5WA 3HEJA 3J81i 4B3RQ 1KC8C 3P7JA 1UWVA 1I4HA 2SOBA 2LMCB 4IUNA 4K5WA 5KYLA 3GTJH 5JEAH 5DNFA 2R92G 2UUAQ 4OO1I 1A15A 1X3EA 4HAEA 4A3MB 2QA4A 3MWYW 3S9WA 5E7NA 4A3FH 2O5IC 4IUTA 5I4DA 1AZPA 4CDCC 4JYAL 1NR4A 2R93G 5ELBA 4LNQA 1WFQA 1WTQA 1ONLA 1VMCA 4OGQC 4X3TA 4C3IB 2F0KA 2C35B 2IX0A 5C4XH 3K6OA 2H4OA 4DK1A 4PMBA 2WACA 1X3GA 3GV6A 5F2DA 2FINB 3Q0AA 4B3MQ 3S14H 5HY6A 3RD4A 4A3BH 2JA5G 1STHA 3C3LA 5JJIA 4GKJQ 3ZYYX 3VR4A 2HCCA 2MHVA 3HOUG 1JB7A 2MO0A 1UE7A 2L1BA 3TBIB 4LMQD 3HFZB 1VQOA 1SMYC 2EYOA 4IZ8A 3CHBD 4X6AH 3NWTA 1N34Q 3JAML 2QILA 4FDBA 1Q1BA 3M4QA 5C4ZA 1EOVA 1FJGQ 2RDFA 3RZDH 2JA7G 1BCPD 3LX0A 2WB1E 3G6JB 4GNXA 1CUKA 2VXWA 4DK3C 1KXLA 5C4JH 3TDQA 1NSNS 3X3NA 2CVRA 2KCNA 3ND9A 4F7XA 1ASZA 4CKEA 4QGUA 4DV5Q 1MSHA 3HOVH 1KQSA 3EQLC 3W1BA 5IYCH 4G7HC 2GA4B 5CV7A 4KHVA 4KJOA 1GUSA 3C1EA 4FXKC 4BBRG 2K14A 4RMFA 5GAGC 4IUVA 1NCVA 4PZ6A 2HIVA 1C7YA 2JA8H 3TP5A 2A73B 1CHPD 5I9OA 3E9HA 1F2YA 1CKMA 1EWCA 3MXNB 4HMJA 2Q2UA 2UXCQ 3HOZH 1IBML 3M3YH 4MHEA 2X6GA 4E6IA 3L2PA 4HEDA 1ET6A 4ABNA 5JAVA 1TS2A 3KLSA 1F2LA 3G7LA 4K6LA 1XX8A 4NXMQ 5IE8A 3OWEB 2K33A 4IFDH 4IO9A 1NNXA 1O80A 4C3JG 1J9OA 1EIFA 5IT9L 1XMOQ 2NBFA 1EQQA 1O7LA 4DA2A 1FL0A 4IUPA 4JI4L 1O7YA 2O2LD 3ER0A 5KNDA 3PO3B 3CCSA 4Y7NB 1BUVT 5IGBA 2VQFL 1VQGA 5E4WC 3GTOB 1A63A 4X66L 4DAVA 3A7LA 3MEHA 4GLAC 4K8IA 4OWTB 3JAME 1H9MA 2NVTH 1YNJD 4DV3L 2UUBL 1S5ED 2KHIA 1Q90A 1SFOB 1SMXA 1QNUA 1K8OA 1CKNB 4LFAQ 2HCIA 1D1KA 1Y1WG 3S15H 3DWQA 4N9TA 3PUYA 5AJ3Q 4RKBA 3NQIA 4TQUS 1Y14B 4GS3A 4L5SA 3UDIA 2CCZA 3GP7A 1R4PB 3ONAB 5IP7H 4MIUA 3K59A 2DN8A 2QEJC 3OW7A 4ODGA 1WTPA 3T13A 4LFCQ 3V96A 5GAEC 3VYTA 1XNQQ 2L12A 2N78A 3FKIH 1UEAB 3GTGH 4DU9A 2CFMA 4AYBG 1LTRD 1ENCA 3MTSA 4N9PA 1OO9B 1Q86C 2N55A 5LL6S 5EAYA 1WYDA 2ES2A 2ZM6Q 2R92B 1H9SA 4RG1A 1LT6D 2A74C 5ELNA 1IYUA 5M3MH 3I56A 2ZJQA 4A93G 1WD0A 1W2BA 1G8ZD 1FNVA 4JOIC 4A3FG 3PIOA 4RGOS 4PMCA 1EIHA 4DNRB 4DV7Q 2MPMA 4DR6Q 1STEA 2R93B 3S1QH 3HOWH 4KY7A 1XNRQ 5LMNQ 1DD2A 3R8BA 3D31A 5C4XG 2K03A 3CU7A 4P74A 1SE4A 1YVCA 5CV4A 4DK0A 1K0RA 1KDAA 4GOPC 4B9WA 4A3BG 4KHPL 3FVQA 1HR0W 1K9MC 4KN4C 3I91A 3CCJA 3GDEA 3HOUB 1VQIA 1K8GA 2F0PA 1CSPA 3RR5A 5KEEA 2EY2A 1RL2A 5KGUA 1Y1VH 2ZT9C 4A3CH 4CGYB 3CCVA 4RGMA 4IALA 1F9QA 1Q12A 4C3HG 2E2HB 1FVIA 4NXNQ 1YNNC 2JA7B 5IP9H 2L4NA 4EVOA 3PMFA 4GN3B 3RN5A 1N33Q 3K7AB 1HNWL 5C3WA 1D1IA 2PW7A 4IOCA 3H6MA 2OWOA 1WTOA 3M4PA 2NVXH 4LK1C 2Y0SB 1LV9A 3JAMc 5CV5A 4DR3L 3S2DH 3I2ZA 1J5EL 1HFGA 4TSSA 3MA2B 3R93A 5IYDG 5A2QE 1L0XB 3CQZH 4BBRB 2XSCA 1DGSA 5BN3A 1SEBD 1NMGA 4YY3L 4H0LC 3L3OC 3SK4A 1A8VA 4K14A 5CV8A 2JA8G 1AN8A 5LHY1 4LF7Q 4B08A 4DXGA 3K5NA 3NEMA 4QJFA 2H5XA 1E22A 2NN6I 4FYDA 1EQTA 5GAHC 4JI6Q 3V2TA 3HOZG 5M5XB 2YU9B 1A2TA 2EY1A 4JI0L 1I94L 2XGTA 3K8AA 2AUKA 2F0EA 1V1PA 4YIJA 3T1HL 2N88A 1QVGA 4XXEA 1VQPA 2HD3A 3CMAA 2PNRC 3M7NA 2MO1A 1R9TB 1IBLL 4IPGA 2EY5A 4IFDG 3WOEA 3CF5A 4C3JB 2EYPA 4ZKBB 1EWHA 1RTNA 1C9OA 1E2VA 3M4OH 2DUDA 4JYAQ 4DR7L 3Q23A 2IHFA 5IGFA 5EJWA 1PRTD 2OQKA 4ZAIA 2KUMA 3JAMi 1PH9A 4DR2Q 3HOYB 2K28A 1B7YB 3BG3A 4HSPA 4HTHA 4OELB 4JW0A 4DAYB 3A5ZB 3MEFA 5IOCA 2NUCA 4XT3B 1WTRA 1EYCA 1TS4A 4G7ZC 2LKVA 1PZJD 2NZ1D 1PH2A 4ILWA 4IQZA 4OO1H 5IT9c 2A6EC 1I4RA 1JJ2A 2EYHA 3CCRA 4JK1C 4FF1A 1MIUA 1L1OA 3DLLA 3GTLB 4BA2I 2K04A 1PTOF 2A68D 3H0GH 2WKCA 3R2IA 1K3RA 1C48A 4GNXB 3E6ZX 4C2MB 4F8MA 2EZVA 1E1OA 4C56C 1Y1WB 4OIKA 4WJWA 4GN4B 1TWHH 1Z6HA 1PH8A 2KHSA 4KTAA 4DUYL 1QNKA 1TWAH 1KRSA 1NTGA 1OXSC 5IP7G 3KUPA 2DY8A 4ZQ3A 1X55A 3WWVA 1LABA 3UDXA 4QQBX 3S1NB 4XIGS 4JG2A 1EWIA 3SDZA 1PYSB 2LS01 1BBXC 5IWAQ 4JI2Q 1TWCB 4HSVA 1UAPA 3KF8A 4B3TL 3FKIG 1EFWA 4YCUA 1J6QA 2AWNA 1QB5D 3S2HH 1HNXL 5M5WH 3GO5A 2MJ8A 3GTJB 3E5SA 4IPHA 4IUQA 4X3SA 3K5MA 1B8AA 2K5DA 3RNUA 1RF2D 1VS0A 5EPJA 5K5PA 3OIPA 3I55A 4IJHA 5M3MG 1Q81C 1NY4A 4S3SA 1BBUA 1HZCA 3OOCA 3HG9A 1IBMQ 3CCQA 2YTXA 1VQ4A 3HOWG 2A5HA 2OF1A 1U4PA 1PH5A 1T5EA 1EEID 2ICIA 3TS2A 5C4XB 3HKZE 3DHQA 2Z0SA 1LT5D 4IPDA 2RQXA 3S14B 2YV5A 3F2CA 3DM1A 1Q1EA 3MZ5A 5FLMH 4A3BB 3D4DA 1X56A 1A3VA 2UXBL 4Q5VA 2F52A 2AMCB 3STBD 2CW0D 4JI4Q 1Y1VG 1Q8KA 2K52A 2Z6KC 4A3CG 4IOAA 4UY8C 1XTCD 1YI2A 4DR4L 1HTPA 2VQFQ 3RZDB 5IP9G 1I4GA 1KDBA 5K36H 1D5ZC 1B50A 3B6YA 3PF4A 1TWFH 1GOZA 4FXDA 4QL5A 5C4JB 1D8LA 4A76A 3S1RH 2IW3A 3H91A 4JOIA 3BS1A 1JJGA 3HOVB 2OXPA 1XMQQ 1D5MC 5TSSA 4X3UA 3W1GA 2D2CC 2EJMA 5JVG3 2PZWA 1DYQA 3ICEA 2WAQE 1PVOA 1KIXA 4KY6A 3HOXH 5C6AA 1MHWC 4R4IA 4LF5L 1SE2A 5LMUQ 4GOPA 2YU9H 1QCBD 2HDMA 1AP0A 2JA8B 1VQ7A 2UU9L 2CHBD 3MXPA 2CWAA 2LSSA 3NHHA 1FYCA 3KK7A 2VQEL 2K4KA 1RIPA 1W6KA 3HOZB 2ZJPA 3M3YB 4IN3A 4KKSA 4RH6A 1DJRD 4LFBQ 1STAA 2D9UA 2JJQA 3HRZC 1C4QA 5IYBH 3QWNA 4PNYA 2NB0A 3W5OA 1WD1A 1U5KA 3K81C 2PZUA 2E75C 1EYGA 4JV5L 5DLQE 3N6RA 1O7ZA 3PO3G 1LTID 3NELA 2HDLA 4GZYC 4XYQA 4K8JA 3FEWX 1E0BA 4EQ5A 3P75A 4EQOA 1RJTA 4IJLA 1IKMA 4QIWE 2F4IA 1K8AC 3T53B 3A0JA 5FO7B 4BXXG 1SYEA 3D3RA 1YJ9A 2E8GA 3EBEA 2K7VA 1CZGA 3Q8DA 4N8FA 3OWFA 1V1OA 4FVMA 4KHPQ 3E3XA 1I50H 5FOBB 4OO1G 3VYUA 2Q2IA 3DUZA 5C44B 3BZKA 1HFNA 3HKSA 2KEEA 4ZKCB 4X64L 2NVTB 4NDXA 1DOLA 2EDGA 2QGQA 3H0GG 4ZUJA 1QZHA 3F8TA 1DZ1A 2Q2HA 4M8AA 2ZXRA 4HJ9A 3S15B 4OX9Q 2A1AA 3S1NH 2PQAB 4X65Q 4QB4A 1I4QA 4MNOA 2K5QA 3CPFA 2PPBC 5JJZA 4M1UB 1JOOA 1KHIA 1EL0A 2Z9HA 3UE1A 1E7ZA 3I73A 2RBMA 1Q82C 3OSOA 4XTCS 3PF5A 4J15A 1PFSA 2L0CA 3FKIB 3GTGB 3TREA 4JI7L 5NUCA 3K0XA 2QW7A 2BE5D 5EKKA 4CDFC 2JQOA 2KEDA 3SE0A 4YHHL 3SVMA 4BY7B 4LF8L 2UUCQ 4L5QA 3ULJA 4DV2L 1STNA 1E3PA 1V1PB 3PQIA 5M3MB 1LT4D 1HRJA 3C46A 1BR9A 1TWGH 2ZTEA 1STYA 4TKOB 1BOSA 1I94Q 5DAUA 3S1QB 3HOWB 4JI1Q 3T1HQ 4IFDJ 2B2WA 3BDOA 3UE0A 1RD9D 1PA6A 2K6AA 2UXDL 2YTVA 3CCLA 2HIXA 1SJHD 2F3WA 2E5LL 2XWBB 5I9PA 3GTMH 1G91A 1IBLQ 1IBKQ 4MN3A 3ULPA 4X3KA 1KRTA 1U4LA 5FLMG 4DAMA 1JMCA 4TRDA 3CCEA 1M8AA 1GUTA 1MBYA 4DR7Q 1B44D 2NN6H 3RUZA 2WKDA 2L55A 4JCVE 5BR8L 1Y1VB 3AMUA 2IJ0A 4C1NI 1YJNA 3KBXA 2MP1A 4HJ7A 4DUZL 2B8FA 4IURA 2BH8A 4DR1L 1KLGD 1CHQD 1S5DD 3SK5A 2E2IH 4A4IA 2J4XA 1A62A 3PV0A 5J3BA 5D65A 3D4WA 4NB3A 2Y0SG 1IYVA 4LUVA 2RKSA 2AQ1B 3J81j 2B2VC 1BCPC 2EYFA 2ZTDA 3FPUB 2EOTA 1B2TA 4LJZC 3BVMA 1UNSA 1KNAA 3EN2A 3TEHB 5G3LD 1SYFA 2NVXB 4XQNA 2VB2X 2JN4A 3K7UC 5JPNC 3S2DB 1X9NA 1HCZA 4OONA 3HOXG 2FMMA 4AIMA 1E1TA 4RHSA 2RHSB 1EOTA 3CQZB 3K5OA 4KY5A 2JE6I 4H02A 2NVQH 1L1OC 3KF8B 2JEAI 1KAWA 5M5YB 3D4RA 3I4NH 3CCUA 3NQTA 4RCOA 3PSIA 3G71A 3CXCA 4B3TQ 4R9WA 2P5ZX 1SAPA 2TMPA 2Z6KA 2A8VA 1D6EC 1Q7YC 2EJFC 1YHBA 1E2WA 1JWSD 2AQ3B 5IIFA 1WTXA 5IYBG 4UHVA 3IL8A 3PGZA 1X54A 1VQNA 1TT2A 4H7BA 2F0HA 3HOYG 3M4OB 2K01A 4PMWA 1AFPA 2PMZE 1HJPA 2B2TC 3I4OA 2JA9A 4OXPA 2DJFC 3O13A 5DM73 5C44H 1BNZA 1IXRA 2MQHA 2ENBA 3EFXD 3GD7A 2XIWA 1YEZA 3F1ZA 1AE2A 2LXKA 4KKTA 3LWEA 2Q8TA 1SBBB 3ITPA 1STBA 1TS5A 2M2LA 1GKHA 3A8JE 3H0GB 3T1YL 1X6OA 1HR0L 1YNJC 4CJ2C 1EYDA 4ZK9B 4DR5Q 4N8X1 1TWHB 4HMIA 4AYBE 4R4QA 2JP1A 5I2YA 1TWAB 5C0XG 2XRQD 1IW7D 4A3KH 1YITA 1PH3A 3GQBA 4F87A 1KLUD 3I7FA 3FPPA 5JJKA 4JI5L 3A54A 4TVAB 3J7ZC 3AU7A 1WCMH 1GXDC 3PIPA 1U4MA 2N3SA 2R61A 5EQ0A 4A3DH 1A3TA 4RHRA 2NZHA 4H44C 1GJXA 2WV6D 3VR6A 5JEAG 4GOPB 3J7AV 2A69D 2A6HD 4O1NA 1T9HA 4MTNA 4BY7H 3S2HB 1WVLA 5M5WB 1WOCA 1U0LA 5FO9B 3RLFA 4LF5Q 4KI0A 1MGSA 4RA8A 4QY7A 1FGBD 1HNZL 4PZ8A 3UDFA 5ELFA 3U4ZA 5GQOA 4LWCA 3DM3A 1VQKA 2WINB 2EIFA 1VQ9A 2JXMB 3DEOA 2UU9Q 2HHHL 4JC0A 2F0IA 1SNMA 2BA1A 2PYKA 4LUZA 4PQXA 3TZUA 2A6HC 4AQYQ 2Z8LA 4LF9Q 1DXMA 2EE1A 4RKLA 3CMEA 4GKKQ 5IT9E 2F4VQ 1XXGA 1YNXA 4K0KL 1S5CD 2K05A 2Q8IB 3KOJA 1H95A 3MHBA 4FF4A 5IGEA 1GUWA 3EA6A 3NTKA 2L9HA 1RCVD 1B70B 5KNCA 1ENAA 5D3DA 2F0UA 2VZAA 4C1NK 1C8CA 4LF6Q 3G4SA 1I3QH 1SE3A 2M9VA 4P73A 2QDLA 4BY1H 1DM0B 5FLXL 1N36L 2NN6G 2JSOA 3KF6A 3S24A 1G51A 2VUMH 1JICA 1J8IA 5J1ZA 4G57A 5CV6A 1X3QA 4HIOA 2HT1A 4BBSH 3AQQA 4A3IH 4UP9A 3RZOH 1TXYA 1Y8PB 2K75A 4OL7A 1GHJA 4B3SQ 3HOVG 1RKNA 2E76C 3R3OA 5IYCG 1TWFB 5KNBA 4X64Q 5CBAE 1O78A 1T5XD 2KENA 1H9KA 3S1RB 1EZ6A 1SJED 5I2XA 2QF7A 3OW2A 1HA5A 2QEXA 2CH4W 5IODA 1LTSD 4LW1A 1ICFB 1DOKA 2SDFA 1YHQA 1WI5A 3VA7A 2FHTA 2F0LA 1S5FD 2OQ0A 5M5YH 1OTCA 5CORA 3HOXB 3H94A 2OEOA 2B2UC 2WB1B 4QMGA 3QR8A 3NPPA 3SEBA 2UUAL 2OCEA 1NR2A 3I4NG 1F2MA 2PW5A 2LFNA 3QOJA 4A3EH 1HHVA 4EQNA 3BDLA 1TU2B 2I5LX 1PH4A 1TY0A 2NTSA 1IL2A 1JOKA 2RCFA 2V4DA 4FF3A 3U50C 4L8JA 5EPKA 1BO0A 2NTTA 4R8IA 2F03A 4YHHQ 4JBKA 2O4XA 3U9OA 4HCSA 4KD3A 1VQ5A 1PH1A 2E2JH 4DV2Q 1STGA 2B2VA 1Z9FA 1XTDA 1UE6A 1JE4A 1PMRA 4GKJL 4JI3L 2PZTA 5FK9C 1HZBA 2XRSD 3Q22A 3S1MH 3DWPA 2R6GA 3NTHA 1AE3A 3KFUA 3EIVA 1SR3A 3J80L 2UXDQ 2HQEA 1ENFA 2FMCA 4KKUA 1TS3A 3WOFA 5KRUA 5C44G 5LL6X 4ME3A 2E5LQ 3Q6SA 1PRTC 1QE6A 5FLXE 1FJGL 1LLRD 1ZYRD 5COYA 2AQ2B 2Q2TA 1I50B 4XYOA 3RLNA 2B2WC 2E2DC 3V05A 5H1SE 1PLFA 1KTKA 4IPCA 2FJ2A 1HUNA 5CYUA 1NUCA 3VDYA 2RSOA 1CQVA 2XNAC 3I4LA 3C2PA 1SYDA 4DR1Q 5IGGA 3PUZA 1ZYRC 3RMHA 2B63H 1Q8IA 2A68C 2KCTA 1KABA 4A3KG 1LTBD 1JE5A 5E1FA 3A74A 3C1FA 1PH6A 1ILQA 1K8MA 1SNOA 1I4XA 1PYWD 1TIID 1SNDA 5EBCA 1EY5A 5L37A 3RN2A 3VR2A 3FP9A 2B2TA 2UXCL 3VA5A 4BY7G 4K2KA 3R2TA 1M1KC 3TP8A 5ELDA 3TP6A 1G2TA 1MI2A 3BZCA 1FR3A 1VQLA 5HGQA 4KV6A 4KN7C 2K1BA 2N8NA 4YCVA 1VQEA 1P16A 1YHAA 5EPLA 3HZXA 3OTOL 2OTJA 1TWGB 1XMOL 3NSWA 4Q0FA 1F2ZA 5FJ8H 2IWHA 2QDBA 4DAPA 2ID0A 1WTWA 1HA6A 1GUGA 4ZCKA 2IPKD 3TS0A 3GTMB 5FO8B 5CV9A 4LAAA 4DKAC 2F0DA 3CRKC 3J80E 5D14A 2JA5H 4OWXB 1MJCA 4K5XA 3NUCA 2G9DA 4BY1G 2ALYB 1ILPA 4WJ3M 1CQFA 1AEXA 2B39A 3FRPB 3ULLA 4X66Q 1VQ8A 2VUMG 2D0PA 1A0IA 1WJJA 3A8IE 4J8QA 4A3GH 3NBHA 2JEBI 3HKZG 3STBC 1WTVA 2CW0C 1BCPF 2I07B 4ULLA 4LFAL 4BBSG 2E2IB 1CT1D 4DV3Q 1Y8OB 2VS1A 4HCEA 2UUBQ 4KK7A 5M3FH 1S3OA 3GTQH 1PH7A 3LGJA 2KA7A 1KNEA 4LUOA 2F0SA 5FLXc 4R4TA 5C5MA 3BJUA 4G7OC 5C0XJ 4O0AA 3P1HA 4KLKA 1ZKOA 5I6WA 1JB3A 2CWPA 4ZUIA 3DXJC 2EYLA 3T1YQ 1XNQL 1FGUA 1HR0Q 3I90A 5KIXA 1SYCA 1EY4A 3L7ZC 4R8NA 5EGTA 1K83H 3NENA 1OXXK 3SK6A 1HQMC 5C4HA 1CA6A 2HUGA 4RFBA 4DV0L 2ZTCA 5JEAJ 2NVQB 4JI5Q 3ND8A 1SNQA 2KOLA 1H9SB 3I4NB 2RSNA 3FDTA 4A3EG 5JVH3 4BWGB 1M90C 1EIYB 1FNWA 4ID6A 2Z1CA 4JVZA 1OXVA 2IHEA 3P20A 4L5RC 3MVVA 2FFKB 1R4QB 4DR6L 3PUXA 2L5TA 1XPOA 5ELCA 3QIAA 1HNZQ 3AFPA 1KDCA 3BVGA 4I65A 2F0NA 1D7QA 1EUJA 2G5DA 2RDGA 4NMZA 1LO5D 4JI8L 4HJAA 1VQ6A 4DV6L 1B53A 2K5HA 4BS9A 2IY5B 2B2YC 3M85A 2KECA 3GTKH 2B2UA 5CGKA 4NXNL 3G48A 5JJLA 2BH2A 2EXDA 3KF6B 2R7ZH 1HQRD 1HUMA 1N33L 1B1ZA 2SNMA 1PTOD 2MUYA 1W3SA 1MD2D 1N8RC 2F0QA 1KD1C 3J80c 1U4RA 4HR7B 4X62L 1QWYA 1A3UA 1HNWQ 3S17H 2OT2A 2DNEA 1S4ZA 3MFGA 3CRLC 1MJEA 2SEBD 1F9RA 5LMNW 2LXJA 4A3KB 1PTOC 3I72A 2J7ZA 2K32A 1DONA 2EQSA 4DR3Q 3UI2A 1J5EQ 1CM9A 1YZ6A 1GHKA 2VL6A 4O2DA 1WCMB 3PO2H 4A3DB 2JA6H 2D0OA 1UE5A 2BOSA 4YY3Q 4DV4L 4JI6L 2O5JC 1SRUA 1ET9A 2Z4IA 1Z7TA 2ZJRA 2BDNA 4FO2A 2RHQB 3OMGA 4A3JH 4JI0Q 2BE5C 3I4MH 3A8KE 1O7IA 4JBMA 3AYHB 4LF4L 1VQJA 4K6DA 4A93H 1FD7D 1UEBA 3JC66 3J80i 2GN5A 2F0TA 4JBWA 2I46A 4NW2A 4OEMB 5GROA 5FJ8G 3Q24A 4HIDA 3NBIA 5CR3A 1BCPB 3NWSA 4DR2L 1SMYD 4JBJA 4DK6C 1N32L 1CZWA 2MFIA 2SNSA 1AW7A 1BXTA 4K5VA 3BYTB 4A3LH 1ZXTA 4WRDA 4ALPA 1AZQA 1HPCA 2F0MA 4GLVB 5D3IB 2Y0SE 4POGA 1I3QB 1LTGD 4DAYA 4JI3Q 5DEHA 1K28A 1RDPD 4BY1B 4H13C 1SNCA 1EQRA 2EPBA 1GD7A 1L1OB 3EVQA 2VUMB 5K36G 4A3GG 1B9MA 1B3QA 1I5FA 3HKZB 1CKOA 1G291 2F0OA 3F2BA 1JWMD 4C3HH 4BBSB 4J6HA 4A3IB 2J0TD 1LUZA 2DGYA 3RZOB 2RF4A 5M3FG 3TZDA 4DNIA 3MXUA 1II3A 2GVAA 1LTLA 1V8QA 1I6HH 1RTOA 2DJGC 1XYIA 1L0WA 4QF4A 3OIQA 4CJ0B 4Y52H 1PFBA 2F0FA 4XQQA 4DV1L 1BDOA 2R3ZA 4POFA 4DUYQ 4U68A 1XJVA 1IKLA 4U673 5T1GA 3TQYA 5IWAL 4JI2L 2WB1G 2EVBA 3HP3A 4DXFA 3FMCA 3PIP3 3VR3A 4A75A 3PUVA 5IYDH 1V43A 1PZKD 3NTIA 3T4AC 1IZ6A 2ATWA 2AHOB 3TMEA 5J22A 2RA4A 1HTLD 5ELOA 3S16H 5EKIA 3GTPH 2PNHA 4A3EB 1HNXQ 3LWUA 3QO2A 3PIO3 1QVCA 2MNAA 4PV1C 1CK1A 2ICEC 2NVYH 1Y69U 1PHJA 1X3PA 4P71A 3OHXC 2WAQB 5ISRA 2PQEA 3TN2A 3AB9A 1TKWB 3HGBA 1NBWA 3H3VI 3E0EA 1VF5C 4HIKA 2E2JB 1Z47A 1EY8A 1H9JA 5C3EH 4YWKA 3OTOQ 1C0AA 1PRTF 3UDGA 1PTOH 4R4CA 5CBEE 3S1MB 4L6TB 4RAUC 2D5DA 3U4VA 1DOMA 2UXBQ 2NZOA 3EROA 4G4KA 4XDXA 1PFMA 2R7ZG 4WFN3 1V9PA 3NBHB 4CKCA 1BBWA 3VR5A 4DR4Q 3TSSA 2YYZA 2EY6A 2PI2A 1EFID 3HS0C 3L9AX 1SDFA 4QUFA 1JJCB 2HQLA 1JWUD 1QILA 4KD4A 1LTTD 1F77A 1RODA 4RGNA 4QIWB 1LTAD 1BF4A 1XMQL 5AFWA 4I7ZC 2IX3A 4ME5A 2B63B 1BKBA 3M4YA 2E74C 4CBVA 1D5XC 1TQOA 5HGTA 3CD6A 2I5HA 3OMCA 3IAYA 3ERSX 5LMUL 1LYLA 4HN7A 1S40A 2XTIA 2AUJD 1IW7C 3VYSA 1ICWA 1DCZA 5A35A 3TP7A 5A2QL 3PO2G 2Z4HA 2KQ3A 2JA6G 3M9BA 4CJ1B 1YBYA 4L63B 4DN4M 1SE8A 1EZ8A 3KDFA 3RLOA 4QUCA 2CKZB 2B2YA 2BDOA 1HZAA 2ZXOA 2DY7A 4LFBL 1HXYD 4DV0Q 5BN4A 2VQEQ 2QCPX 4A3MH 2A69C 1GVPA 3T56B 4A3JG 2VW9A 1H9RA 3I4MG 1PV4A 4PG3A 2FXQA 4C3IH 4XQJA 3CCMA 4V0BA 4DF7A 3ZJYC 1S5BD 1SROA 3FHWA 2F3VA 4KMUC 2PI2E 4P72A 4JV5Q 1WTHA 2C5CA 1OXTA 1L2FA 5HURA 1I4PA 4FP5D 3URYA 1JOQA 4B9XA 5C0XI 1EY6A 4GLXA 1Q3LA 1G6ZA 4ZYSA 1XPUA 3E9IA 4A3LG 3K0YA 4CDEC 3U58A 1IYJB 3CC4A 1PXUA 3EJIA 1CI3M 1YNND 2A19A 2Z6BA 5CMDA 1VDZA 3KLRA 4HJ8A 1QVFA 2JA5B 1EYAA 4JI8Q 3QJYA 5IY0A 3G6EA 1P8LA 1QUQA 2TSSA 2CH4A 4WJ4A 4DV6Q 3QG1A 2RVLA 5BN5A 3BU2A 4A3GB 4UP7A 5JOBA 2R7FA 4OX9L 3F2UA 4X65L 2L15A 5M3FB 1JORA 3GTQB 2WP8J 1HH2P 2VNUD 2IT1A 3AEVA 4B3RL 3I3CA 2PQAA 1VQDA 2CQAA 2F1MA 4X62Q 2KCMA 1S72A 3D0FA 4YWMA 3SR1A 2ASBA 2NYZD 2CQOA 1EU4A 1GM5A 1VCIA 3F2DA 1UE1A 4L5TA 1K73C 1K83B 5FKAC 1QZGA 5CC4A 2L11A 1JR0D 4EGVA 5GADC 1CFMA 1B4OA 1CA5A 3D6CA 3CPWA 4J1MA 3J81L 4JI7Q 3NXWA 2UUCL 3MC0B 5KYIA 1G6PA 1TY2A 4DPGA 1PRTB 3SXHA 1EU3A 3H3VC 4DV4Q 4I7AA 5ELEA 5EKLA 4FNFA 2K50A 3W3AA 1F9SA 4LF8Q 4B3ML 1TVXA 4JI1L 1EQVA 3J7AF 1Y8NB 2B29A 3IFTA 2EXZA 5J39A 4MTKA 4ZRZA 3BYYB 3CW2C 3MAQA 1JC7A 3PUWA 1IBKL 4LF4Q 5C3EG 2I5MX 1SYBA 3PO3H 3DWAA 1N34L 3KLSX 4Y7NH 1PZID 4EQPA 5E3FA 2IX1A 2A6ED 3W2DA 3GTOH 1D2BA 4EX5A 2V1CC 4O42A 1GO3E 1N32Q 2LY7A 5IGCA 1BVSA 1E24A 1VQHA 4BXXH 1NAPA 3GTKB 4UPAA 2NWGA 2QKIC 4AH6A 5BR8Q 2R7DA 2F0VA 2R7ZB 1XWEA 1SFOH 1EY9A 4DV5L 1NJIC 4DUZQ 2MGSA 3E0JA 2KHJA 3M7GA 3BZDB 3K58A 1ZEQX 2PMZB 1OXUA 3QOLA 3NE5B 1CSQA 4OWWB 5C5LA 3S17B 4CKBA 1ASYA 4IFDI 4HJ5A 3X3MA 1WCMG 2B8GA 3KBGA 4NP5A 2D62A 3SK8A 4A3DG 4DFAA 1QOHA 4UDUC 1M4VA 3N52A 4YWLA 4DV1Q 4FF2A 1N9WA 1QG7A 3L0OA 3PO2B 1JT8A 1VF7A 2RDHA 2JYOA 2JA6B 2K5VA 1GUNA 2AWOA 3MXNA 5C3XA 1NE3A 1GUOA 3DEPA 2R92H 2N49A 3CKIB 3PCOB 4GNXC 4OIJA 4NXML 4AYBB 5E4XA 2BA0A 1SLJA 5IGDA 3J81E 4YCWA 3BVZA 4GN5A 4A3MG 3KJOA 2EYMA 3MFYA 3A55A 4WORA 2K5NA 4A3JB 3A5UA 2KJXA 1UUPA 3I4MB 1X3FA 2R93H 4C3IG 3U9SA 1A2UA 1VQAA 1LM0A 4P2CB 5DM63 4A93B 1K0SA 4R1JA 4A3FB 2I0QA 2DNCA 2RCNA 1JCKB 3A7AB 4RWSC 5EBDA 1U9RA 3DMUA 3NP8A 1RHPA 1SYGA 3AFQA 4UP8A 2ZXPA 4APVA 4DNTB 2EYJA 3HOUH 2Q8RE 2YTYA 1JQYD 1MSGA 4IUUA 5I6YA 3T51B 2AKWB
chains in the Genus database with same CATH topology
1EY0A 2PCFB 4RCNA 1L0YB 1ML0D 2X69A 1BQQT 3H09A 1KAAA 3QB3A 2F0GA 4C3HB 4NKLA 2XWJB 4KHZA 1B3AA 1PFNA 3SHLA 1EY7A 3BDCA 1QJOA 4CHTB 1I6HB 2XN9C 5G3LF 4FXGC 3D8GA 1VMPA 3IKJA 3IFDA 2XVSA 2IL8A 1LACA 4K2LA 4RGTA 1IHZA 3K5LA 1A6XA 1LT3D 3ERQA 4OHJA 2EJGC 4UAIA 4DGZA 5T1IA 2PO4A 3S16B 4F88A 3GTPB 1EEFD 2C9OA 3LNNA 5JPMC 1SSOA 2NVYB 4QCLA 1SNPA 3VYRA 1TR5A 2X6LA 2G9HD 3K57A 1F9PA 1ESRA 3I70A 2VB3X 5C3EB 3WDNA 1X32A 3D6WA 1IL8A 5M9OA 1PDQA 1PTOB 1W6JA 2M00A 1CTMA 2BCOA 1FNUA 2F0JA 2F0WA 4KJNA 3MXGA 1G2SA 4XT1B 2H1EA 1SXTA 4ZLTF 2WIIB 3I8ZA 1ESFA 4V190 1E2ZA 2KCCA 3T16A 3J7YW 3NK9A 4BA1I 2KVMA 3GV3A 3A56A 4Z9CB 1B9NA 1EIGA 3OPOA 5C0XH 1I6VC 2K5WA 3HEJA 3P7JA 1I4HA 2SOBA 2LMCB 4IUNA 4K5WA 5KYLA 5JEAH 5DNFA 4OO1I 1A15A 4HAEA 4A3MB 3MWYW 3S9WA 2O5IC 4IUTA 5I4DA 1AZPA 1NR4A 5ELBA 1WTQA 4C3IB 1ONLA 4X3TA 1VMCA 4OGQC 2F0KA 2IX0A 3K6OA 2H4OA 4DK1A 4PMBA 2WACA 3GV6A 5F2DA 2FINB 3Q0AA 3RD4A 1STHA 3C3LA 3ZYYX 3VR4A 2HCCA 2MHVA 2L1BA 3TBIB 4LMQD 1SMYC 2EYOA 4IZ8A 3CHBD 3NWTA 3JAML 2QILA 1Q1BA 5C4ZA 2RDFA 1BCPD 3LX0A 3G6JB 2VXWA 3TDQA 1NSNS 3X3NA 2CVRA 2KCNA 3ND9A 4F7XA 4CKEA 1MSHA 3EQLC 4G7HC 2GA4B 5CV7A 4KHVA 4KJOA 1GUSA 3C1EA 4FXKC 4IUVA 1NCVA 3TP5A 2A73B 1CHPD 5I9OA 1F2YA 1EWCA 4HMJA 4MHEA 2X6GA 4E6IA 4HEDA 1ET6A 4ABNA 5JAVA 1TS2A 3KLSA 1F2LA 3G7LA 4K6LA 1XX8A 3OWEB 2K33A 4IFDH 1O80A 4C3JG 1J9OA 5IT9L 2NBFA 1O7LA 4DA2A 4IUPA 1O7YA 2O2LD 5KNDA 3PO3B 4Y7NB 1BUVT 5IGBA 5E4WC 3GTOB 4DAVA 3A7LA 3MEHA 4K8IA 3JAME 1H9MA 1YNJD 1S5ED 1Q90A 1SFOB 1QNUA 1K8OA 2HCIA 1D1KA 3DWQA 4N9TA 3PUYA 4RKBA 3NQIA 4TQUS 3GP7A 1R4PB 3ONAB 4MIUA 3K59A 2DN8A 2QEJC 3OW7A 4ODGA 1WTPA 3T13A 3V96A 3VYTA 2L12A 1UEAB 4DU9A 1LTRD 1ENCA 3MTSA 4N9PA 1OO9B 2N55A 5LL6S 2R92B 1H9SA 1LT6D 2A74C 1IYUA 1WD0A 1G8ZD 1FNVA 4RGOS 4PMCA 1EIHA 4DNRB 2MPMA 1STEA 2R93B 4KY7A 1DD2A 3R8BA 3D31A 2K03A 3CU7A 1SE4A 5CV4A 4DK0A 1KDAA 4B9WA 3FVQA 4KN4C 3I91A 3HOUB 2F0PA 5KEEA 2EY2A 5KGUA 2ZT9C 4CGYB 4RGMA 4IALA 1F9QA 1Q12A 4C3HG 2E2HB 1YNNC 2JA7B 2L4NA 4EVOA 3PMFA 3K7AB 5C3WA 1D1IA 2PW7A 3H6MA 1WTOA 4LK1C 2Y0SB 1LV9A 5CV5A 1HFGA 4TSSA 3MA2B 3R93A 5A2QE 1L0XB 4BBRB 2XSCA 5BN3A 1SEBD 4H0LC 3L3OC 3SK4A 4K14A 5CV8A 1AN8A 5LHY1 4B08A 4DXGA 3K5NA 2NN6I 4FYDA 1EQTA 3V2TA 5M5XB 2YU9B 1A2TA 2EY1A 2AUKA 2F0EA 1V1PA 4YIJA 2N88A 4XXEA 2PNRC 3M7NA 1R9TB 2EY5A 4IFDG 3WOEA 4C3JB 2EYPA 4ZKBB 1EWHA 1RTNA 1E2VA 3Q23A 5IGFA 5EJWA 1PRTD 4ZAIA 2KUMA 3HOYB 2K28A 4HSPA 3BG3A 4HTHA 5IOCA 2NUCA 4XT3B 1WTRA 1EYCA 1TS4A 4G7ZC 2LKVA 1PZJD 2NZ1D 4ILWA 4IQZA 4OO1H 2A6EC 1I4RA 2EYHA 4JK1C 4FF1A 3GTLB 4BA2I 2K04A 1PTOF 2A68D 2WKCA 3R2IA 1C48A 3E6ZX 4C2MB 4F8MA 2EZVA 4C56C 1Y1WB 4OIKA 4WJWA 1Z6HA 2KHSA 4KTAA 1QNKA 1OXSC 3KUPA 2DY8A 4ZQ3A 1LABA 3S1NB 4XIGS 3SDZA 2LS01 1BBXC 1TWCB 4HSVA 1UAPA 3KF8A 2AWNA 1QB5D 3GO5A 2MJ8A 3GTJB 3E5SA 4IUQA 4X3SA 3K5MA 2K5DA 1RF2D 5EPJA 5K5PA 3OIPA 4S3SA 3OOCA 3HG9A 2A5HA 2OF1A 1U4PA 1T5EA 1EEID 2ICIA 5C4XB 3DHQA 1LT5D 2RQXA 3S14B 3DM1A 1Q1EA 3MZ5A 4A3BB 3D4DA 1A3VA 4Q5VA 2CW0D 1XTCD 1HTPA 3RZDB 1I4GA 1KDBA 5K36H 1D5ZC 1B50A 1GOZA 4FXDA 5C4JB 2IW3A 3H91A 3BS1A 3HOVB 2OXPA 1D5MC 5TSSA 4X3UA 2D2CC 2EJMA 5JVG3 2PZWA 1DYQA 4KY6A 5C6AA 1SE2A 1QCBD 2HDMA 1AP0A 2JA8B 2CHBD 3MXPA 1FYCA 3NHHA 3KK7A 1W6KA 3HOZB 3M3YB 4IN3A 4KKSA 4RH6A 1DJRD 1STAA 2D9UA 3HRZC 1C4QA 3QWNA 4PNYA 2NB0A 1WD1A 2PZUA 2E75C 3N6RA 1O7ZA 1LTID 2HDLA 4GZYC 4XYQA 4K8JA 3FEWX 1E0BA 3P75A 4EQOA 1RJTA 1IKMA 2F4IA 3T53B 5FO7B 1SYEA 3D3RA 2K7VA 1CZGA 3OWFA 1V1OA 4FVMA 5FOBB 4OO1G 3VYUA 3DUZA 5C44B 1HFNA 2NVTB 2KEEA 4ZKCB 4NDXA 1DOLA 2EDGA 4ZUJA 1DZ1A 4M8AA 2ZXRA 3S15B 4QB4A 1I4QA 2K5QA 2PPBC 5JJZA 4M1UB 1JOOA 1EL0A 3I73A 2RBMA 3OSOA 4XTCS 2L0CA 3FKIB 3GTGB 5NUCA 2BE5D 5EKKA 2KEDA 3SE0A 3SVMA 4BY7B 1STNA 1V1PB 5M3MB 1LT4D 1HRJA 3C46A 1BR9A 1STYA 4TKOB 1BOSA 5DAUA 3S1QB 3HOWB 4IFDJ 2B2WA 3BDOA 1RD9D 2K6AA 1SJHD 2F3WA 2XWBB 5I9PA 1G91A 4MN3A 4X3KA 1U4LA 4TRDA 1M8AA 1GUTA 1MBYA 1B44D 2NN6H 3RUZA 2WKDA 2L55A 1Y1VB 3AMUA 2IJ0A 4C1NI 3KBXA 2MP1A 2B8FA 4IURA 3SK5A 1CHQD 1KLGD 1S5DD 2J4XA 3PV0A 5D65A 3D4WA 1IYVA 2RKSA 2AQ1B 2B2VC 1BCPC 2EYFA 3FPUB 2EOTA 1B2TA 4LJZC 3BVMA 1UNSA 1KNAA 5G3LD 1SYFA 2NVXB 4XQNA 2VB2X 5JPNC 3S2DB 1HCZA 2FMMA 4RHSA 1EOTA 3CQZB 3K5OA 4KY5A 2JE6I 2JEAI 5M5YB 3D4RA 3NQTA 4RCOA 4R9WA 1SAPA 2TMPA 1D6EC 2EJFC 1E2WA 1JWSD 2AQ3B 5IIFA 1WTXA 3IL8A 1TT2A 4H7BA 2F0HA 3M4OB 2K01A 4PMWA 1AFPA 2B2TC 3O13A 5DM73 1BNZA 2ENBA 3EFXD 3GD7A 2XIWA 4KKTA 3LWEA 2Q8TA 1SBBB 3ITPA 1STBA 1TS5A 2M2LA 3A8JE 3H0GB 1YNJC 4CJ2C 1EYDA 4ZK9B 1TWHB 4HMIA 2JP1A 5I2YA 1TWAB 5C0XG 2XRQD 1IW7D 3GQBA 4F87A 1KLUD 3FPPA 3A54A 3AU7A 1GXDC 1U4MA 2R61A 5EQ0A 1A3TA 4RHRA 1GJXA 4H44C 2WV6D 3VR6A 5JEAG 3J7AV 2A69D 2A6HD 4O1NA 3S2HB 1WVLA 5M5WB 5FO9B 3RLFA 4KI0A 1MGSA 4RA8A 1FGBD 5ELFA 2WINB 2JXMB 3DEOA 2F0IA 1SNMA 2BA1A 2PYKA 3TZUA 4PQXA 2A6HC 2Z8LA 1DXMA 2EE1A 4RKLA 5IT9E 1XXGA 1S5CD 2K05A 2Q8IB 3MHBA 4FF4A 5IGEA 1GUWA 3EA6A 3NTKA 2L9HA 1RCVD 5KNCA 1ENAA 5D3DA 2F0UA 4C1NK 1C8CA 1SE3A 2M9VA 1DM0B 5FLXL 2NN6G 2JSOA 1JICA 1J8IA 5J1ZA 4G57A 5CV6A 1X3QA 1Y8PB 4OL7A 1GHJA 1RKNA 2E76C 3R3OA 1TWFB 5KNBA 5CBAE 1O78A 1T5XD 1H9KA 3S1RB 1EZ6A 1SJED 5I2XA 2QF7A 1HA5A 5IODA 1LTSD 1DOKA 2SDFA 3VA7A 2FHTA 2F0LA 1S5FD 5CORA 3HOXB 3H94A 2OEOA 2B2UC 2WB1B 4QMGA 3NPPA 3SEBA 1NR2A 1F2MA 2PW5A 2LFNA 3QOJA 1HHVA 4EQNA 3BDLA 1TU2B 1TY0A 2NTSA 1JOKA 2V4DA 4FF3A 4L8JA 5EPKA 1BO0A 2NTTA 4R8IA 2F03A 2O4XA 3U9OA 4HCSA 4KD3A 1STGA 2B2VA 1JE4A 1PMRA 2PZTA 5FK9C 2XRSD 3Q22A 3DWPA 2R6GA 3NTHA 3J80L 2HQEA 1ENFA 2FMCA 4KKUA 1TS3A 3WOFA 5KRUA 5LL6X 3Q6SA 1PRTC 1QE6A 5FLXE 1LLRD 1ZYRD 5COYA 2AQ2B 1I50B 4XYOA 2B2WC 2E2DC 3V05A 1PLFA 1KTKA 2FJ2A 1HUNA 5CYUA 1NUCA 2RSOA 1CQVA 2XNAC 3I4LA 3C2PA 1SYDA 5IGGA 3PUZA 1ZYRC 3RMHA 1Q8IA 2A68C 1KABA 1LTBD 5E1FA 3C1FA 1ILQA 1K8MA 1SNOA 1I4XA 1PYWD 1TIID 1SNDA 5EBCA 1EY5A 3VR2A 2B2TA 3VA5A 4K2KA 3R2TA 3TP8A 5ELDA 3TP6A 1G2TA 1MI2A 1FR3A 4KV6A 4KN7C 2K1BA 5EPLA 3HZXA 1TWGB 3NSWA 4Q0FA 1F2ZA 2IWHA 2QDBA 4DAPA 2ID0A 1WTWA 1HA6A 1GUGA 2IPKD 3GTMB 5FO8B 5CV9A 4LAAA 2F0DA 3CRKC 3J80E 5D14A 4K5XA 3NUCA 2G9DA 1ILPA 1CQFA 1AEXA 2B39A 3FRPB 3A8IE 4J8QA 3NBHA 2JEBI 1WTVA 2CW0C 1BCPF 2I07B 4ULLA 2E2IB 1CT1D 1Y8OB 4HCEA 4KK7A 2KA7A 1KNEA 2F0SA 4G7OC 5C5MA 5C0XJ 3P1HA 1ZKOA 5I6WA 1JB3A 4ZUIA 3DXJC 2EYLA 3I90A 5KIXA 1SYCA 1EY4A 3L7ZC 4R8NA 5EGTA 1OXXK 3SK6A 1HQMC 5C4HA 1CA6A 2HUGA 4RFBA 5JEAJ 2NVQB 3ND8A 1SNQA 2KOLA 1H9SB 3I4NB 2RSNA 3FDTA 5JVH3 4BWGB 1FNWA 4ID6A 2Z1CA 1OXVA 3P20A 3MVVA 2FFKB 1R4QB 3PUXA 2L5TA 5ELCA 3QIAA 1KDCA 3BVGA 4I65A 2F0NA 2RDGA 4NMZA 1LO5D 1B53A 4BS9A 2B2YC 3M85A 2KECA 2B2UA 5CGKA 1HQRD 1HUMA 1B1ZA 2SNMA 1PTOD 2MUYA 1MD2D 2F0QA 1U4RA 4HR7B 1QWYA 1A3UA 2OT2A 2DNEA 1S4ZA 3MFGA 3CRLC 2SEBD 1F9RA 4A3KB 1PTOC 3I72A 2J7ZA 2K32A 1DONA 3UI2A 1CM9A 1GHKA 1WCMB 4A3DB 2BOSA 2O5JC 1ET9A 2Z4IA 1Z7TA 2BDNA 4FO2A 3OMGA 2BE5C 3A8KE 4K6DA 1FD7D 4JBWA 2F0TA 2I46A 4NW2A 3Q24A 3NBIA 5CR3A 1BCPB 3NWSA 1SMYD 1CZWA 2SNSA 1AW7A 1BXTA 4K5VA 3BYTB 1ZXTA 4WRDA 1AZQA 1HPCA 2F0MA 5D3IB 1I3QB 1LTGD 4DAYA 5DEHA 1RDPD 4BY1B 4H13C 1SNCA 2EPBA 3EVQA 2VUMB 5K36G 1B9MA 3HKZB 1G291 2F0OA 1JWMD 4BBSB 4J6HA 4A3IB 2J0TD 3RZOB 3TZDA 3MXUA 1II3A 1V8QA 1RTOA 1XYIA 4QF4A 3OIQA 4CJ0B 1PFBA 2F0FA 4XQQA 1BDOA 2R3ZA 4U68A 1IKLA 4U673 5T1GA 2EVBA 3HP3A 4DXFA 3FMCA 3PIP3 3VR3A 3PUVA 1V43A 1PZKD 3NTIA 3T4AC 3TMEA 5J22A 2RA4A 1HTLD 5EKIA 4A3EB 3LWUA 3QO2A 3PIO3 4PV1C 1CK1A 2ICEC 1Y69U 1X3PA 3OHXC 2WAQB 5ISRA 2PQEA 3TN2A 3AB9A 1TKWB 3HGBA 1VF5C 2E2JB 1Z47A 1EY8A 1H9JA 1PRTF 1PTOH 3S1MB 5CBEE 4L6TB 4RAUC 2D5DA 1DOMA 3EROA 4G4KA 4XDXA 1PFMA 4WFN3 4CKCA 3VR5A 3TSSA 2YYZA 2EY6A 1EFID 3HS0C 3L9AX 1SDFA 4QUFA 1JWUD 1QILA 4KD4A 1LTTD 1F77A 1RODA 4RGNA 4QIWB 1LTAD 1BF4A 5AFWA 4I7ZC 2IX3A 4ME5A 2B63B 3M4YA 2E74C 4CBVA 1D5XC 1TQOA 5HGTA 3OMCA 3IAYA 4HN7A 2AUJD 1IW7C 3VYSA 1ICWA 1DCZA 5A35A 3TP7A 5A2QL 2Z4HA 2KQ3A 4CJ1B 4L63B 4DN4M 1EZ8A 4QUCA 2B2YA 2BDOA 2ZXOA 2DY7A 1HXYD 5BN4A 2QCPX 2A69C 3T56B 1H9RA 4XQJA 4V0BA 4DF7A 1S5BD 2F3VA 4KMUC 2C5CA 1OXTA 5HURA 1I4PA 4FP5D 3URYA 1JOQA 4B9XA 5C0XI 1EY6A 1Q3LA 1G6ZA 4ZYSA 3K0YA 1PXUA 3EJIA 1CI3M 1YNND 5CMDA 1VDZA 3KLRA 2JA5B 1EYAA 3QJYA 2TSSA 3QG1A 2RVLA 5BN5A 4A3GB 5JOBA 3F2UA 5M3FB 1JORA 3GTQB 2WP8J 2VNUD 2IT1A 3I3CA 2CQAA 2F1MA 3SR1A 2NYZD 1EU4A 1VCIA 1K83B 5FKAC 5CC4A 2L11A 1JR0D 4EGVA 1CFMA 1B4OA 1CA5A 3D6CA 4J1MA 3J81L 3NXWA 3MC0B 5KYIA 1TY2A 1PRTB 3SXHA 1EU3A 3H3VC 5ELEA 5EKLA 4FNFA 3W3AA 1F9SA 1TVXA 1EQVA 3J7AF 1Y8NB 3IFTA 2EXZA 5J39A 4ZRZA 3BYYB 3MAQA 1JC7A 3PUWA 1SYBA 3DWAA 3KLSX 1PZID 4EQPA 5E3FA 2IX1A 2A6ED 3W2DA 1D2BA 4O42A 2LY7A 5IGCA 1NAPA 3GTKB 2NWGA 2QKIC 2F0VA 2R7ZB 1XWEA 1EY9A 2MGSA 3E0JA 3M7GA 3BZDB 3K58A 1ZEQX 2PMZB 1OXUA 3QOLA 3NE5B 5C5LA 3S17B 4CKBA 4IFDI 3X3MA 3KBGA 2B8GA 4NP5A 2D62A 3SK8A 4DFAA 1QOHA 4UDUC 1M4VA 3N52A 4FF2A 1QG7A 3PO2B 1VF7A 2RDHA 2JYOA 2JA6B 1GUNA 2AWOA 3MXNA 5C3XA 1GUOA 3DEPA 3CKIB 4OIJA 4AYBB 5E4XA 2BA0A 3J81E 5IGDA 3BVZA 2EYMA 3MFYA 3A55A 4WORA 4A3JB 2KJXA 1UUPA 3I4MB 4C3IG 3U9SA 1A2UA 4P2CB 5DM63 4A93B 4A3FB 2DNCA 1JCKB 3A7AB 4RWSC 5EBDA 1U9RA 3DMUA 3NP8A 1RHPA 1SYGA 2ZXPA 4DNTB 2EYJA 2Q8RE 1JQYD 1MSGA 4IUUA 5I6YA 3T51B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I8Z A;  4X3K A;  1X3P A;  1U4L A;  1O7Z A;  2L12 A;  1EQT A;  1M8A A;  1ML0 D;  2HDL A;  2X69 A;  1CA6 A;  2XIW A;  2HUG A;  3TN2 A;  2BDN A;  3LWE A;  4O42 A;  1E0B A;  2Q8T A;  3MTS A;  1ILQ A;  2KOL A;  2KVM A;  3GV3 A;  5CBA E;  2N88 A;  1U4P A;  2N55 A;  1RJT A;  1Q3L A;  1G6Z A;  2M2L A;  2RSN A;  1NAP A;  1NCV A;  3FDT A;  4IUV A;  1IKM A;  2NWG A;  1B3A A;  1EIG A;  3KBX A;  1PFN A;  2MP1 A;  4IUR A;  1DOK A;  2SDF A;  4CJ2 C;  5CMD A;  2B2T A;  2FHT A;  4ZK9 B;  3DM1 A;  2JP1 A;  2MGS A;  1WD0 A;  2FFK B;  5COR A;  4NW2 A;  5CBE E;  5D65 A;  4ZKB B;  1RTN A;  2B2U C;  1EIH A;  4RAU C;  1VMP A;  4MHE A;  2X6G A;  2RVL A;  2MPM A;  2KEE A;  3IFD A;  4ZKC B;  3P7J A;  1HFN A;  2B2V C;  1G2T A;  1DOM A;  1MI2 A;  3FPU B;  5EJW A;  4HED A;  2EOT A;  1DOL A;  2IL8 A;  1B2T A;  1NR2 A;  2KUM A;  4ZAI A;  1KNA A;  1U4M A;  1HHV A;  2K28 A;  1ZXT A;  2K03 A;  2K1B A;  3F2U A;  5DNF A;  5EQ0 A;  1DZ1 A;  4XDX A;  1F2L A;  3G7L A;  1PFM A;  1XX8 A;  1AZQ A;  5EPL A;  1A15 A;  4XT3 B;  1WTR A;  2NZ1 D;  4HAE A;  1O80 A;  1WVL A;  2FMM A;  4UAI A;  3N52 A;  3MWY W;  1J9O A;  5T1I A;  1EOT A;  1B50 A;  2EPB A;  3I3C A;  3I91 A;  4IUT A;  1WTW A;  1MGS A;  1B53 A;  1BO0 A;  4RA8 A;  1SDF A;  1QG7 A;  5EPK A;  4QUF A;  1NR4 A;  4R8I A;  1AZP A;  1HA6 A;  1WTQ A;  5JJZ A;  2JYO A;  1VMC A;  2B2Y C;  4X3T A;  4IUP A;  1ROD A;  1EL0 A;  1BF4 A;  3H91 A;  1O7Y A;  2K04 A;  2KEC A;  2NYZ D;  4HCS A;  5AFW A;  2B2U A;  3DEO A;  1SSO A;  3DEP A;  2B2V A;  1F9Q A;  4OIJ A;  4R9W A;  3GV6 A;  4X3U A;  2FIN B;  5D14 A;  5E4X A;  1HUM A;  5E4W C;  1JE4 A;  3TZD A;  1SAP A;  4OIK A;  2EE1 A;  2L11 A;  2L4N A;  1QNK A;  1RTO A;  1XYI A;  1ILP A;  2X6L A;  4CJ0 B;  1B4O A;  1PFB A;  2K05 A;  2HCC A;  2R3Z A;  2DY8 A;  1ICW A;  2KED A;  3KUP A;  1WTX A;  1F9P A;  1U4R A;  1CA5 A;  1ESR A;  4U68 A;  1IKL A;  2L1B A;  5T1G A;  4LMQ D;  1GUW A;  2L9H A;  4CJ1 B;  1WTO A;  3HP3 A;  3IL8 A;  3SVM A;  1WTV A;  2HDM A;  3Q6S A;  1AP0 A;  1X32 A;  4DN4 M;  1BBX C;  1S4Z A;  1QE6 A;  3D6W A;  1IL8 A;  4HSV A;  4QUC A;  1LV9 A;  1PDQ A;  1F9R A;  1F9S A;  2B2Y A;  4RWS C;  5COY A;  2HCI A;  1C8C A;  1HRJ A;  1TVX A;  2DY7 A;  2J7Z A;  1HFG A;  1RHP A;  1DON A;  2B2W C;  3R93 A;  3UI2 A;  2K01 A;  1KNE A;  1CM9 A;  1PLF A;  2B2W A;  2RA4 A;  2D9U A;  3ONA B;  2FJ2 A;  2MJ8 A;  2B2T C;  2VXW A;  5EKI A;  1HUN A;  2Q8R E;  1JIC A;  1G2S A;  2RSO A;  3QO2 A;  4XT1 B;  1J8I A;  4IUQ A;  4X3S A;  1WD1 A;  1WTP A;  2CVR A;  1BNZ A;  1MSG A;  1G91 A;  4IUU A;  1X3Q A;  5EPJ A;  3I90 A;  2H1E A;  4ZLT F;  4MN3 A;  1MSH A; 
#chains in the Genus database with same CATH topology
 1EY0 A;  2PCF B;  4RCN A;  2E2H H;  1L0Y B;  4A3I G;  3KYH C;  1ML0 D;  2X69 A;  5AJ3 L;  4PZ7 A;  2JA7 H;  1BQQ T;  4JPB W;  3H09 A;  1SN8 A;  2GVB A;  1KAA A;  3QB3 A;  2F0G A;  3K7A H;  3H15 A;  1CKN A;  4C3H B;  4NKL A;  1XPR A;  2XWJ B;  4KHZ A;  1B3A A;  3SGI A;  3CC2 A;  4DR5 L;  1V1Q A;  1PFN A;  3SHL A;  1EY7 A;  3H3V H;  3BDC A;  4LFC L;  1QJO A;  4CHT B;  1I6H B;  2XN9 C;  5G3L F;  4FXG C;  1K3B C;  3D8G A;  2OTL A;  1VMP A;  3IKJ A;  3IRB A;  2VY3 A;  3IFD A;  3CP0 A;  1X65 A;  2XVS A;  4BBR H;  2IL8 A;  1PYB A;  2F3I A;  2ZM6 L;  1LAC A;  4K2L A;  4RGT A;  3KLW A;  1IHZ A;  3K5L A;  1A6X A;  1LT3 D;  3ERQ A;  4OHJ A;  2EJG C;  4MZ9 A;  4UAI A;  1VQB A;  4DGZ A;  4HIM A;  5T1I A;  5M5X H;  3KDF B;  2PO4 A;  3S16 B;  4F88 A;  3GTP B;  4DV7 L;  1EEF D;  3OYY A;  1HZ9 A;  2WAQ G;  4NPS A;  2WFW A;  1AH9 A;  2C9O A;  1XNR L;  5LMN L;  3LNN A;  5JPM C;  1SSO A;  4AQY L;  2NVY B;  4LF9 L;  4GKK L;  1NMF A;  2F4V L;  3CC7 A;  4QCL A;  1KL9 A;  4R4O A;  1R9T H;  2HHH Q;  1SNP A;  3VYR A;  1TR5 A;  2X6L A;  4C3J H;  3J7A 5;  2G9H D;  3K57 A;  1F9P A;  4K0K Q;  3J81 c;  1ESR A;  3I70 A;  4P75 A;  2VB3 X;  5C3E B;  3WDN A;  1X32 A;  3HOY H;  4LF6 L;  3D6W A;  1IL8 A;  5M9O A;  1VQM A;  1PDQ A;  1PTO B;  1W6J A;  2M00 A;  1CTM A;  2BCO A;  4CDD C;  1Q46 A;  1FNU A;  2F0J A;  2F0W A;  4KJN A;  1YIJ A;  1QUQ B;  3MXG A;  1G2S A;  1N36 Q;  4XT1 B;  3GTL H;  3K80 C;  2JK8 A;  2H1E A;  4B3S L;  1SXT A;  4ZLT F;  2WII B;  3I8Z A;  4C2M H;  1ESF A;  2B3G A;  4V19 0;  1YJW A;  1Y1W H;  1E2Z A;  2B63 G;  2KCC A;  3T16 A;  3J7Y W;  3NK9 A;  4BA1 I;  2KVM A;  3GV3 A;  3A56 A;  1VQF A;  4Z9C B;  2KBN A;  1B9N A;  1EIG A;  3OPO A;  3CAM A;  4LF7 L;  5C0X H;  1I6V C;  1MKH A;  3KJP A;  1VQC A;  1TWC H;  3TRZ A;  2K5W A;  3HEJ A;  3J81 i;  4B3R Q;  1KC8 C;  3P7J A;  1UWV A;  1I4H A;  2SOB A;  2LMC B;  4IUN A;  4K5W A;  5KYL A;  3GTJ H;  5JEA H;  5DNF A;  2R92 G;  2UUA Q;  4OO1 I;  1A15 A;  1X3E A;  4HAE A;  4A3M B;  2QA4 A;  3MWY W;  3S9W A;  5E7N A;  4A3F H;  2O5I C;  4IUT A;  5I4D A;  1AZP A;  4CDC C;  4JYA L;  1NR4 A;  2R93 G;  5ELB A;  4LNQ A;  1WFQ A;  1WTQ A;  1ONL A;  1VMC A;  4OGQ C;  4X3T A;  4C3I B;  2F0K A;  2C35 B;  2IX0 A;  5C4X H;  3K6O A;  2H4O A;  4DK1 A;  4PMB A;  2WAC A;  1X3G A;  3GV6 A;  5F2D A;  2FIN B;  3Q0A A;  4B3M Q;  3S14 H;  5HY6 A;  3RD4 A;  4A3B H;  2JA5 G;  1STH A;  3C3L A;  5JJI A;  4GKJ Q;  3ZYY X;  3VR4 A;  2HCC A;  2MHV A;  3HOU G;  1JB7 A;  2MO0 A;  1UE7 A;  2L1B A;  3TBI B;  4LMQ D;  3HFZ B;  1VQO A;  1SMY C;  2EYO A;  4IZ8 A;  3CHB D;  4X6A H;  3NWT A;  1N34 Q;  3JAM L;  2QIL A;  4FDB A;  1Q1B A;  3M4Q A;  5C4Z A;  1EOV A;  1FJG Q;  2RDF A;  3RZD H;  2JA7 G;  1BCP D;  3LX0 A;  2WB1 E;  3G6J B;  4GNX A;  1CUK A;  2VXW A;  4DK3 C;  1KXL A;  5C4J H;  3TDQ A;  1NSN S;  3X3N A;  2CVR A;  2KCN A;  3ND9 A;  4F7X A;  1ASZ A;  4CKE A;  4QGU A;  4DV5 Q;  1MSH A;  3HOV H;  1KQS A;  3EQL C;  3W1B A;  5IYC H;  4G7H C;  2GA4 B;  5CV7 A;  4KHV A;  4KJO A;  1GUS A;  3C1E A;  4FXK C;  4BBR G;  2K14 A;  4RMF A;  5GAG C;  4IUV A;  1NCV A;  4PZ6 A;  2HIV A;  1C7Y A;  2JA8 H;  3TP5 A;  2A73 B;  1CHP D;  5I9O A;  3E9H A;  1F2Y A;  1CKM A;  1EWC A;  3MXN B;  4HMJ A;  2Q2U A;  2UXC Q;  3HOZ H;  1IBM L;  3M3Y H;  4MHE A;  2X6G A;  4E6I A;  3L2P A;  4HED A;  1ET6 A;  4ABN A;  5JAV A;  1TS2 A;  3KLS A;  1F2L A;  3G7L A;  4K6L A;  1XX8 A;  4NXM Q;  5IE8 A;  3OWE B;  2K33 A;  4IFD H;  4IO9 A;  1NNX A;  1O80 A;  4C3J G;  1J9O A;  1EIF A;  5IT9 L;  1XMO Q;  2NBF A;  1EQQ A;  1O7L A;  4DA2 A;  1FL0 A;  4IUP A;  4JI4 L;  1O7Y A;  2O2L D;  3ER0 A;  5KND A;  3PO3 B;  3CCS A;  4Y7N B;  1BUV T;  5IGB A;  2VQF L;  1VQG A;  5E4W C;  3GTO B;  1A63 A;  4X66 L;  4DAV A;  3A7L A;  3MEH A;  4GLA C;  4K8I A;  4OWT B;  3JAM E;  1H9M A;  2NVT H;  1YNJ D;  4DV3 L;  2UUB L;  1S5E D;  2KHI A;  1Q90 A;  1SFO B;  1SMX A;  1QNU A;  1K8O A;  1CKN B;  4LFA Q;  2HCI A;  1D1K A;  1Y1W G;  3S15 H;  3DWQ A;  4N9T A;  3PUY A;  5AJ3 Q;  4RKB A;  3NQI A;  4TQU S;  1Y14 B;  4GS3 A;  4L5S A;  3UDI A;  2CCZ A;  3GP7 A;  1R4P B;  3ONA B;  5IP7 H;  4MIU A;  3K59 A;  2DN8 A;  2QEJ C;  3OW7 A;  4ODG A;  1WTP A;  3T13 A;  4LFC Q;  3V96 A;  5GAE C;  3VYT A;  1XNQ Q;  2L12 A;  2N78 A;  3FKI H;  1UEA B;  3GTG H;  4DU9 A;  2CFM A;  4AYB G;  1LTR D;  1ENC A;  3MTS A;  4N9P A;  1OO9 B;  1Q86 C;  2N55 A;  5LL6 S;  5EAY A;  1WYD A;  2ES2 A;  2ZM6 Q;  2R92 B;  1H9S A;  4RG1 A;  1LT6 D;  2A74 C;  5ELN A;  1IYU A;  5M3M H;  3I56 A;  2ZJQ A;  4A93 G;  1WD0 A;  1W2B A;  1G8Z D;  1FNV A;  4JOI C;  4A3F G;  3PIO A;  4RGO S;  4PMC A;  1EIH A;  4DNR B;  4DV7 Q;  2MPM A;  4DR6 Q;  1STE A;  2R93 B;  3S1Q H;  3HOW H;  4KY7 A;  1XNR Q;  5LMN Q;  1DD2 A;  3R8B A;  3D31 A;  5C4X G;  2K03 A;  3CU7 A;  4P74 A;  1SE4 A;  1YVC A;  5CV4 A;  4DK0 A;  1K0R A;  1KDA A;  4GOP C;  4B9W A;  4A3B G;  4KHP L;  3FVQ A;  1HR0 W;  1K9M C;  4KN4 C;  3I91 A;  3CCJ A;  3GDE A;  3HOU B;  1VQI A;  1K8G A;  2F0P A;  1CSP A;  3RR5 A;  5KEE A;  2EY2 A;  1RL2 A;  5KGU A;  1Y1V H;  2ZT9 C;  4A3C H;  4CGY B;  3CCV A;  4RGM A;  4IAL A;  1F9Q A;  1Q12 A;  4C3H G;  2E2H B;  1FVI A;  4NXN Q;  1YNN C;  2JA7 B;  5IP9 H;  2L4N A;  4EVO A;  3PMF A;  4GN3 B;  3RN5 A;  1N33 Q;  3K7A B;  1HNW L;  5C3W A;  1D1I A;  2PW7 A;  4IOC A;  3H6M A;  2OWO A;  1WTO A;  3M4P A;  2NVX H;  4LK1 C;  2Y0S B;  1LV9 A;  3JAM c;  5CV5 A;  4DR3 L;  3S2D H;  3I2Z A;  1J5E L;  1HFG A;  4TSS A;  3MA2 B;  3R93 A;  5IYD G;  5A2Q E;  1L0X B;  3CQZ H;  4BBR B;  2XSC A;  1DGS A;  5BN3 A;  1SEB D;  1NMG A;  4YY3 L;  4H0L C;  3L3O C;  3SK4 A;  1A8V A;  4K14 A;  5CV8 A;  2JA8 G;  1AN8 A;  5LHY 1;  4LF7 Q;  4B08 A;  4DXG A;  3K5N A;  3NEM A;  4QJF A;  2H5X A;  1E22 A;  2NN6 I;  4FYD A;  1EQT A;  5GAH C;  4JI6 Q;  3V2T A;  3HOZ G;  5M5X B;  2YU9 B;  1A2T A;  2EY1 A;  4JI0 L;  1I94 L;  2XGT A;  3K8A A;  2AUK A;  2F0E A;  1V1P A;  4YIJ A;  3T1H L;  2N88 A;  1QVG A;  4XXE A;  1VQP A;  2HD3 A;  3CMA A;  2PNR C;  3M7N A;  2MO1 A;  1R9T B;  1IBL L;  4IPG A;  2EY5 A;  4IFD G;  3WOE A;  3CF5 A;  4C3J B;  2EYP A;  4ZKB B;  1EWH A;  1RTN A;  1C9O A;  1E2V A;  3M4O H;  2DUD A;  4JYA Q;  4DR7 L;  3Q23 A;  2IHF A;  5IGF A;  5EJW A;  1PRT D;  2OQK A;  4ZAI A;  2KUM A;  3JAM i;  1PH9 A;  4DR2 Q;  3HOY B;  2K28 A;  1B7Y B;  3BG3 A;  4HSP A;  4HTH A;  4OEL B;  4JW0 A;  4DAY B;  3A5Z B;  3MEF A;  5IOC A;  2NUC A;  4XT3 B;  1WTR A;  1EYC A;  1TS4 A;  4G7Z C;  2LKV A;  1PZJ D;  2NZ1 D;  1PH2 A;  4ILW A;  4IQZ A;  4OO1 H;  5IT9 c;  2A6E C;  1I4R A;  1JJ2 A;  2EYH A;  3CCR A;  4JK1 C;  4FF1 A;  1MIU A;  1L1O A;  3DLL A;  3GTL B;  4BA2 I;  2K04 A;  1PTO F;  2A68 D;  3H0G H;  2WKC A;  3R2I A;  1K3R A;  1C48 A;  4GNX B;  3E6Z X;  4C2M B;  4F8M A;  2EZV A;  1E1O A;  4C56 C;  1Y1W B;  4OIK A;  4WJW A;  4GN4 B;  1TWH H;  1Z6H A;  1PH8 A;  2KHS A;  4KTA A;  4DUY L;  1QNK A;  1TWA H;  1KRS A;  1NTG A;  1OXS C;  5IP7 G;  3KUP A;  2DY8 A;  4ZQ3 A;  1X55 A;  3WWV A;  1LAB A;  3UDX A;  4QQB X;  3S1N B;  4XIG S;  4JG2 A;  1EWI A;  3SDZ A;  1PYS B;  2LS0 1;  1BBX C;  5IWA Q;  4JI2 Q;  1TWC B;  4HSV A;  1UAP A;  3KF8 A;  4B3T L;  3FKI G;  1EFW A;  4YCU A;  1J6Q A;  2AWN A;  1QB5 D;  3S2H H;  1HNX L;  5M5W H;  3GO5 A;  2MJ8 A;  3GTJ B;  3E5S A;  4IPH A;  4IUQ A;  4X3S A;  3K5M A;  1B8A A;  2K5D A;  3RNU A;  1RF2 D;  1VS0 A;  5EPJ A;  5K5P A;  3OIP A;  3I55 A;  4IJH A;  5M3M G;  1Q81 C;  1NY4 A;  4S3S A;  1BBU A;  1HZC A;  3OOC A;  3HG9 A;  1IBM Q;  3CCQ A;  2YTX A;  1VQ4 A;  3HOW G;  2A5H A;  2OF1 A;  1U4P A;  1PH5 A;  1T5E A;  1EEI D;  2ICI A;  3TS2 A;  5C4X B;  3HKZ E;  3DHQ A;  2Z0S A;  1LT5 D;  4IPD A;  2RQX A;  3S14 B;  2YV5 A;  3F2C A;  3DM1 A;  1Q1E A;  3MZ5 A;  5FLM H;  4A3B B;  3D4D A;  1X56 A;  1A3V A;  2UXB L;  4Q5V A;  2F52 A;  2AMC B;  3STB D;  2CW0 D;  4JI4 Q;  1Y1V G;  1Q8K A;  2K52 A;  2Z6K C;  4A3C G;  4IOA A;  4UY8 C;  1XTC D;  1YI2 A;  4DR4 L;  1HTP A;  2VQF Q;  3RZD B;  5IP9 G;  1I4G A;  1KDB A;  5K36 H;  1D5Z C;  1B50 A;  3B6Y A;  3PF4 A;  1TWF H;  1GOZ A;  4FXD A;  4QL5 A;  5C4J B;  1D8L A;  4A76 A;  3S1R H;  2IW3 A;  3H91 A;  4JOI A;  3BS1 A;  1JJG A;  3HOV B;  2OXP A;  1XMQ Q;  1D5M C;  5TSS A;  4X3U A;  3W1G A;  2D2C C;  2EJM A;  5JVG 3;  2PZW A;  1DYQ A;  3ICE A;  2WAQ E;  1PVO A;  1KIX A;  4KY6 A;  3HOX H;  5C6A A;  1MHW C;  4R4I A;  4LF5 L;  1SE2 A;  5LMU Q;  4GOP A;  2YU9 H;  1QCB D;  2HDM A;  1AP0 A;  2JA8 B;  1VQ7 A;  2UU9 L;  2CHB D;  3MXP A;  2CWA A;  2LSS A;  3NHH A;  1FYC A;  3KK7 A;  2VQE L;  2K4K A;  1RIP A;  1W6K A;  3HOZ B;  2ZJP A;  3M3Y B;  4IN3 A;  4KKS A;  4RH6 A;  1DJR D;  4LFB Q;  1STA A;  2D9U A;  2JJQ A;  3HRZ C;  1C4Q A;  5IYB H;  3QWN A;  4PNY A;  2NB0 A;  3W5O A;  1WD1 A;  1U5K A;  3K81 C;  2PZU A;  2E75 C;  1EYG A;  4JV5 L;  5DLQ E;  3N6R A;  1O7Z A;  3PO3 G;  1LTI D;  3NEL A;  2HDL A;  4GZY C;  4XYQ A;  4K8J A;  3FEW X;  1E0B A;  4EQ5 A;  3P75 A;  4EQO A;  1RJT A;  4IJL A;  1IKM A;  4QIW E;  2F4I A;  1K8A C;  3T53 B;  3A0J A;  5FO7 B;  4BXX G;  1SYE A;  3D3R A;  1YJ9 A;  2E8G A;  3EBE A;  2K7V A;  1CZG A;  3Q8D A;  4N8F A;  3OWF A;  1V1O A;  4FVM A;  4KHP Q;  3E3X A;  1I50 H;  5FOB B;  4OO1 G;  3VYU A;  2Q2I A;  3DUZ A;  5C44 B;  3BZK A;  1HFN A;  3HKS A;  2KEE A;  4ZKC B;  4X64 L;  2NVT B;  4NDX A;  1DOL A;  2EDG A;  2QGQ A;  3H0G G;  4ZUJ A;  1QZH A;  3F8T A;  1DZ1 A;  2Q2H A;  4M8A A;  2ZXR A;  4HJ9 A;  3S15 B;  4OX9 Q;  2A1A A;  3S1N H;  2PQA B;  4X65 Q;  4QB4 A;  1I4Q A;  4MNO A;  2K5Q A;  3CPF A;  2PPB C;  5JJZ A;  4M1U B;  1JOO A;  1KHI A;  1EL0 A;  2Z9H A;  3UE1 A;  1E7Z A;  3I73 A;  2RBM A;  1Q82 C;  3OSO A;  4XTC S;  3PF5 A;  4J15 A;  1PFS A;  2L0C A;  3FKI B;  3GTG B;  3TRE A;  4JI7 L;  5NUC A;  3K0X A;  2QW7 A;  2BE5 D;  5EKK A;  4CDF C;  2JQO A;  2KED A;  3SE0 A;  4YHH L;  3SVM A;  4BY7 B;  4LF8 L;  2UUC Q;  4L5Q A;  3ULJ A;  4DV2 L;  1STN A;  1E3P A;  1V1P B;  3PQI A;  5M3M B;  1LT4 D;  1HRJ A;  3C46 A;  1BR9 A;  1TWG H;  2ZTE A;  1STY A;  4TKO B;  1BOS A;  1I94 Q;  5DAU A;  3S1Q B;  3HOW B;  4JI1 Q;  3T1H Q;  4IFD J;  2B2W A;  3BDO A;  3UE0 A;  1RD9 D;  1PA6 A;  2K6A A;  2UXD L;  2YTV A;  3CCL A;  2HIX A;  1SJH D;  2F3W A;  2E5L L;  2XWB B;  5I9P A;  3GTM H;  1G91 A;  1IBL Q;  1IBK Q;  4MN3 A;  3ULP A;  4X3K A;  1KRT A;  1U4L A;  5FLM G;  4DAM A;  1JMC A;  4TRD A;  3CCE A;  1M8A A;  1GUT A;  1MBY A;  4DR7 Q;  1B44 D;  2NN6 H;  3RUZ A;  2WKD A;  2L55 A;  4JCV E;  5BR8 L;  1Y1V B;  3AMU A;  2IJ0 A;  4C1N I;  1YJN A;  3KBX A;  2MP1 A;  4HJ7 A;  4DUZ L;  2B8F A;  4IUR A;  2BH8 A;  4DR1 L;  1KLG D;  1CHQ D;  1S5D D;  3SK5 A;  2E2I H;  4A4I A;  2J4X A;  1A62 A;  3PV0 A;  5J3B A;  5D65 A;  3D4W A;  4NB3 A;  2Y0S G;  1IYV A;  4LUV A;  2RKS A;  2AQ1 B;  3J81 j;  2B2V C;  1BCP C;  2EYF A;  2ZTD A;  3FPU B;  2EOT A;  1B2T A;  4LJZ C;  3BVM A;  1UNS A;  1KNA A;  3EN2 A;  3TEH B;  5G3L D;  1SYF A;  2NVX B;  4XQN A;  2VB2 X;  2JN4 A;  3K7U C;  5JPN C;  3S2D B;  1X9N A;  1HCZ A;  4OON A;  3HOX G;  2FMM A;  4AIM A;  1E1T A;  4RHS A;  2RHS B;  1EOT A;  3CQZ B;  3K5O A;  4KY5 A;  2JE6 I;  4H02 A;  2NVQ H;  1L1O C;  3KF8 B;  2JEA I;  1KAW A;  5M5Y B;  3D4R A;  3I4N H;  3CCU A;  3NQT A;  4RCO A;  3PSI A;  3G71 A;  3CXC A;  4B3T Q;  4R9W A;  2P5Z X;  1SAP A;  2TMP A;  2Z6K A;  2A8V A;  1D6E C;  1Q7Y C;  2EJF C;  1YHB A;  1E2W A;  1JWS D;  2AQ3 B;  5IIF A;  1WTX A;  5IYB G;  4UHV A;  3IL8 A;  3PGZ A;  1X54 A;  1VQN A;  1TT2 A;  4H7B A;  2F0H A;  3HOY G;  3M4O B;  2K01 A;  4PMW A;  1AFP A;  2PMZ E;  1HJP A;  2B2T C;  3I4O A;  2JA9 A;  4OXP A;  2DJF C;  3O13 A;  5DM7 3;  5C44 H;  1BNZ A;  1IXR A;  2MQH A;  2ENB A;  3EFX D;  3GD7 A;  2XIW A;  1YEZ A;  3F1Z A;  1AE2 A;  2LXK A;  4KKT A;  3LWE A;  2Q8T A;  1SBB B;  3ITP A;  1STB A;  1TS5 A;  2M2L A;  1GKH A;  3A8J E;  3H0G B;  3T1Y L;  1X6O A;  1HR0 L;  1YNJ C;  4CJ2 C;  1EYD A;  4ZK9 B;  4DR5 Q;  4N8X 1;  1TWH B;  4HMI A;  4AYB E;  4R4Q A;  2JP1 A;  5I2Y A;  1TWA B;  5C0X G;  2XRQ D;  1IW7 D;  4A3K H;  1YIT A;  1PH3 A;  3GQB A;  4F87 A;  1KLU D;  3I7F A;  3FPP A;  5JJK A;  4JI5 L;  3A54 A;  4TVA B;  3J7Z C;  3AU7 A;  1WCM H;  1GXD C;  3PIP A;  1U4M A;  2N3S A;  2R61 A;  5EQ0 A;  4A3D H;  1A3T A;  4RHR A;  2NZH A;  4H44 C;  1GJX A;  2WV6 D;  3VR6 A;  5JEA G;  4GOP B;  3J7A V;  2A69 D;  2A6H D;  4O1N A;  1T9H A;  4MTN A;  4BY7 H;  3S2H B;  1WVL A;  5M5W B;  1WOC A;  1U0L A;  5FO9 B;  3RLF A;  4LF5 Q;  4KI0 A;  1MGS A;  4RA8 A;  4QY7 A;  1FGB D;  1HNZ L;  4PZ8 A;  3UDF A;  5ELF A;  3U4Z A;  5GQO A;  4LWC A;  3DM3 A;  1VQK A;  2WIN B;  2EIF A;  1VQ9 A;  2JXM B;  3DEO A;  2UU9 Q;  2HHH L;  4JC0 A;  2F0I A;  1SNM A;  2BA1 A;  2PYK A;  4LUZ A;  4PQX A;  3TZU A;  2A6H C;  4AQY Q;  2Z8L A;  4LF9 Q;  1DXM A;  2EE1 A;  4RKL A;  3CME A;  4GKK Q;  5IT9 E;  2F4V Q;  1XXG A;  1YNX A;  4K0K L;  1S5C D;  2K05 A;  2Q8I B;  3KOJ A;  1H95 A;  3MHB A;  4FF4 A;  5IGE A;  1GUW A;  3EA6 A;  3NTK A;  2L9H A;  1RCV D;  1B70 B;  5KNC A;  1ENA A;  5D3D A;  2F0U A;  2VZA A;  4C1N K;  1C8C A;  4LF6 Q;  3G4S A;  1I3Q H;  1SE3 A;  2M9V A;  4P73 A;  2QDL A;  4BY1 H;  1DM0 B;  5FLX L;  1N36 L;  2NN6 G;  2JSO A;  3KF6 A;  3S24 A;  1G51 A;  2VUM H;  1JIC A;  1J8I A;  5J1Z A;  4G57 A;  5CV6 A;  1X3Q A;  4HIO A;  2HT1 A;  4BBS H;  3AQQ A;  4A3I H;  4UP9 A;  3RZO H;  1TXY A;  1Y8P B;  2K75 A;  4OL7 A;  1GHJ A;  4B3S Q;  3HOV G;  1RKN A;  2E76 C;  3R3O A;  5IYC G;  1TWF B;  5KNB A;  4X64 Q;  5CBA E;  1O78 A;  1T5X D;  2KEN A;  1H9K A;  3S1R B;  1EZ6 A;  1SJE D;  5I2X A;  2QF7 A;  3OW2 A;  1HA5 A;  2QEX A;  2CH4 W;  5IOD A;  1LTS D;  4LW1 A;  1ICF B;  1DOK A;  2SDF A;  1YHQ A;  1WI5 A;  3VA7 A;  2FHT A;  2F0L A;  1S5F D;  2OQ0 A;  5M5Y H;  1OTC A;  5COR A;  3HOX B;  3H94 A;  2OEO A;  2B2U C;  2WB1 B;  4QMG A;  3QR8 A;  3NPP A;  3SEB A;  2UUA L;  2OCE A;  1NR2 A;  3I4N G;  1F2M A;  2PW5 A;  2LFN A;  3QOJ A;  4A3E H;  1HHV A;  4EQN A;  3BDL A;  1TU2 B;  2I5L X;  1PH4 A;  1TY0 A;  2NTS A;  1IL2 A;  1JOK A;  2RCF A;  2V4D A;  4FF3 A;  3U50 C;  4L8J A;  5EPK A;  1BO0 A;  2NTT A;  4R8I A;  2F03 A;  4YHH Q;  4JBK A;  2O4X A;  3U9O A;  4HCS A;  4KD3 A;  1VQ5 A;  1PH1 A;  2E2J H;  4DV2 Q;  1STG A;  2B2V A;  1Z9F A;  1XTD A;  1UE6 A;  1JE4 A;  1PMR A;  4GKJ L;  4JI3 L;  2PZT A;  5FK9 C;  1HZB A;  2XRS D;  3Q22 A;  3S1M H;  3DWP A;  2R6G A;  3NTH A;  1AE3 A;  3KFU A;  3EIV A;  1SR3 A;  3J80 L;  2UXD Q;  2HQE A;  1ENF A;  2FMC A;  4KKU A;  1TS3 A;  3WOF A;  5KRU A;  5C44 G;  5LL6 X;  4ME3 A;  2E5L Q;  3Q6S A;  1PRT C;  1QE6 A;  5FLX E;  1FJG L;  1LLR D;  1ZYR D;  5COY A;  2AQ2 B;  2Q2T A;  1I50 B;  4XYO A;  3RLN A;  2B2W C;  2E2D C;  3V05 A;  5H1S E;  1PLF A;  1KTK A;  4IPC A;  2FJ2 A;  1HUN A;  5CYU A;  1NUC A;  3VDY A;  2RSO A;  1CQV A;  2XNA C;  3I4L A;  3C2P A;  1SYD A;  4DR1 Q;  5IGG A;  3PUZ A;  1ZYR C;  3RMH A;  2B63 H;  1Q8I A;  2A68 C;  2KCT A;  1KAB A;  4A3K G;  1LTB D;  1JE5 A;  5E1F A;  3A74 A;  3C1F A;  1PH6 A;  1ILQ A;  1K8M A;  1SNO A;  1I4X A;  1PYW D;  1TII D;  1SND A;  5EBC A;  1EY5 A;  5L37 A;  3RN2 A;  3VR2 A;  3FP9 A;  2B2T A;  2UXC L;  3VA5 A;  4BY7 G;  4K2K A;  3R2T A;  1M1K C;  3TP8 A;  5ELD A;  3TP6 A;  1G2T A;  1MI2 A;  3BZC A;  1FR3 A;  1VQL A;  5HGQ A;  4KV6 A;  4KN7 C;  2K1B A;  2N8N A;  4YCV A;  1VQE A;  1P16 A;  1YHA A;  5EPL A;  3HZX A;  3OTO L;  2OTJ A;  1TWG B;  1XMO L;  3NSW A;  4Q0F A;  1F2Z A;  5FJ8 H;  2IWH A;  2QDB A;  4DAP A;  2ID0 A;  1WTW A;  1HA6 A;  1GUG A;  4ZCK A;  2IPK D;  3TS0 A;  3GTM B;  5FO8 B;  5CV9 A;  4LAA A;  4DKA C;  2F0D A;  3CRK C;  3J80 E;  5D14 A;  2JA5 H;  4OWX B;  1MJC A;  4K5X A;  3NUC A;  2G9D A;  4BY1 G;  2ALY B;  1ILP A;  4WJ3 M;  1CQF A;  1AEX A;  2B39 A;  3FRP B;  3ULL A;  4X66 Q;  1VQ8 A;  2VUM G;  2D0P A;  1A0I A;  1WJJ A;  3A8I E;  4J8Q A;  4A3G H;  3NBH A;  2JEB I;  3HKZ G;  3STB C;  1WTV A;  2CW0 C;  1BCP F;  2I07 B;  4ULL A;  4LFA L;  4BBS G;  2E2I B;  1CT1 D;  4DV3 Q;  1Y8O B;  2VS1 A;  4HCE A;  2UUB Q;  4KK7 A;  5M3F H;  1S3O A;  3GTQ H;  1PH7 A;  3LGJ A;  2KA7 A;  1KNE A;  4LUO A;  2F0S A;  5FLX c;  4R4T A;  5C5M A;  3BJU A;  4G7O C;  5C0X J;  4O0A A;  3P1H A;  4KLK A;  1ZKO A;  5I6W A;  1JB3 A;  2CWP A;  4ZUI A;  3DXJ C;  2EYL A;  3T1Y Q;  1XNQ L;  1FGU A;  1HR0 Q;  3I90 A;  5KIX A;  1SYC A;  1EY4 A;  3L7Z C;  4R8N A;  5EGT A;  1K83 H;  3NEN A;  1OXX K;  3SK6 A;  1HQM C;  5C4H A;  1CA6 A;  2HUG A;  4RFB A;  4DV0 L;  2ZTC A;  5JEA J;  2NVQ B;  4JI5 Q;  3ND8 A;  1SNQ A;  2KOL A;  1H9S B;  3I4N B;  2RSN A;  3FDT A;  4A3E G;  5JVH 3;  4BWG B;  1M90 C;  1EIY B;  1FNW A;  4ID6 A;  2Z1C A;  4JVZ A;  1OXV A;  2IHE A;  3P20 A;  4L5R C;  3MVV A;  2FFK B;  1R4Q B;  4DR6 L;  3PUX A;  2L5T A;  1XPO A;  5ELC A;  3QIA A;  1HNZ Q;  3AFP A;  1KDC A;  3BVG A;  4I65 A;  2F0N A;  1D7Q A;  1EUJ A;  2G5D A;  2RDG A;  4NMZ A;  1LO5 D;  4JI8 L;  4HJA A;  1VQ6 A;  4DV6 L;  1B53 A;  2K5H A;  4BS9 A;  2IY5 B;  2B2Y C;  3M85 A;  2KEC A;  3GTK H;  2B2U A;  5CGK A;  4NXN L;  3G48 A;  5JJL A;  2BH2 A;  2EXD A;  3KF6 B;  2R7Z H;  1HQR D;  1HUM A;  1N33 L;  1B1Z A;  2SNM A;  1PTO D;  2MUY A;  1W3S A;  1MD2 D;  1N8R C;  2F0Q A;  1KD1 C;  3J80 c;  1U4R A;  4HR7 B;  4X62 L;  1QWY A;  1A3U A;  1HNW Q;  3S17 H;  2OT2 A;  2DNE A;  1S4Z A;  3MFG A;  3CRL C;  1MJE A;  2SEB D;  1F9R A;  5LMN W;  2LXJ A;  4A3K B;  1PTO C;  3I72 A;  2J7Z A;  2K32 A;  1DON A;  2EQS A;  4DR3 Q;  3UI2 A;  1J5E Q;  1CM9 A;  1YZ6 A;  1GHK A;  2VL6 A;  4O2D A;  1WCM B;  3PO2 H;  4A3D B;  2JA6 H;  2D0O A;  1UE5 A;  2BOS A;  4YY3 Q;  4DV4 L;  4JI6 L;  2O5J C;  1SRU A;  1ET9 A;  2Z4I A;  1Z7T A;  2ZJR A;  2BDN A;  4FO2 A;  2RHQ B;  3OMG A;  4A3J H;  4JI0 Q;  2BE5 C;  3I4M H;  3A8K E;  1O7I A;  4JBM A;  3AYH B;  4LF4 L;  1VQJ A;  4K6D A;  4A93 H;  1FD7 D;  1UEB A;  3JC6 6;  3J80 i;  2GN5 A;  2F0T A;  4JBW A;  2I46 A;  4NW2 A;  4OEM B;  5GRO A;  5FJ8 G;  3Q24 A;  4HID A;  3NBI A;  5CR3 A;  1BCP B;  3NWS A;  4DR2 L;  1SMY D;  4JBJ A;  4DK6 C;  1N32 L;  1CZW A;  2MFI A;  2SNS A;  1AW7 A;  1BXT A;  4K5V A;  3BYT B;  4A3L H;  1ZXT A;  4WRD A;  4ALP A;  1AZQ A;  1HPC A;  2F0M A;  4GLV B;  5D3I B;  2Y0S E;  4POG A;  1I3Q B;  1LTG D;  4DAY A;  4JI3 Q;  5DEH A;  1K28 A;  1RDP D;  4BY1 B;  4H13 C;  1SNC A;  1EQR A;  2EPB A;  1GD7 A;  1L1O B;  3EVQ A;  2VUM B;  5K36 G;  4A3G G;  1B9M A;  1B3Q A;  1I5F A;  3HKZ B;  1CKO A;  1G29 1;  2F0O A;  3F2B A;  1JWM D;  4C3H H;  4BBS B;  4J6H A;  4A3I B;  2J0T D;  1LUZ A;  2DGY A;  3RZO B;  2RF4 A;  5M3F G;  3TZD A;  4DNI A;  3MXU A;  1II3 A;  2GVA A;  1LTL A;  1V8Q A;  1I6H H;  1RTO A;  2DJG C;  1XYI A;  1L0W A;  4QF4 A;  3OIQ A;  4CJ0 B;  4Y52 H;  1PFB A;  2F0F A;  4XQQ A;  4DV1 L;  1BDO A;  2R3Z A;  4POF A;  4DUY Q;  4U68 A;  1XJV A;  1IKL A;  4U67 3;  5T1G A;  3TQY A;  5IWA L;  4JI2 L;  2WB1 G;  2EVB A;  3HP3 A;  4DXF A;  3FMC A;  3PIP 3;  3VR3 A;  4A75 A;  3PUV A;  5IYD H;  1V43 A;  1PZK D;  3NTI A;  3T4A C;  1IZ6 A;  2ATW A;  2AHO B;  3TME A;  5J22 A;  2RA4 A;  1HTL D;  5ELO A;  3S16 H;  5EKI A;  3GTP H;  2PNH A;  4A3E B;  1HNX Q;  3LWU A;  3QO2 A;  3PIO 3;  1QVC A;  2MNA A;  4PV1 C;  1CK1 A;  2ICE C;  2NVY H;  1Y69 U;  1PHJ A;  1X3P A;  4P71 A;  3OHX C;  2WAQ B;  5ISR A;  2PQE A;  3TN2 A;  3AB9 A;  1TKW B;  3HGB A;  1NBW A;  3H3V I;  3E0E A;  1VF5 C;  4HIK A;  2E2J B;  1Z47 A;  1EY8 A;  1H9J A;  5C3E H;  4YWK A;  3OTO Q;  1C0A A;  1PRT F;  3UDG A;  1PTO H;  4R4C A;  5CBE E;  3S1M B;  4L6T B;  4RAU C;  2D5D A;  3U4V A;  1DOM A;  2UXB Q;  2NZO A;  3ERO A;  4G4K A;  4XDX A;  1PFM A;  2R7Z G;  4WFN 3;  1V9P A;  3NBH B;  4CKC A;  1BBW A;  3VR5 A;  4DR4 Q;  3TSS A;  2YYZ A;  2EY6 A;  2PI2 A;  1EFI D;  3HS0 C;  3L9A X;  1SDF A;  4QUF A;  1JJC B;  2HQL A;  1JWU D;  1QIL A;  4KD4 A;  1LTT D;  1F77 A;  1ROD A;  4RGN A;  4QIW B;  1LTA D;  1BF4 A;  1XMQ L;  5AFW A;  4I7Z C;  2IX3 A;  4ME5 A;  2B63 B;  1BKB A;  3M4Y A;  2E74 C;  4CBV A;  1D5X C;  1TQO A;  5HGT A;  3CD6 A;  2I5H A;  3OMC A;  3IAY A;  3ERS X;  5LMU L;  1LYL A;  4HN7 A;  1S40 A;  2XTI A;  2AUJ D;  1IW7 C;  3VYS A;  1ICW A;  1DCZ A;  5A35 A;  3TP7 A;  5A2Q L;  3PO2 G;  2Z4H A;  2KQ3 A;  2JA6 G;  3M9B A;  4CJ1 B;  1YBY A;  4L63 B;  4DN4 M;  1SE8 A;  1EZ8 A;  3KDF A;  3RLO A;  4QUC A;  2CKZ B;  2B2Y A;  2BDO A;  1HZA A;  2ZXO A;  2DY7 A;  4LFB L;  1HXY D;  4DV0 Q;  5BN4 A;  2VQE Q;  2QCP X;  4A3M H;  2A69 C;  1GVP A;  3T56 B;  4A3J G;  2VW9 A;  1H9R A;  3I4M G;  1PV4 A;  4PG3 A;  2FXQ A;  4C3I H;  4XQJ A;  3CCM A;  4V0B A;  4DF7 A;  3ZJY C;  1S5B D;  1SRO A;  3FHW A;  2F3V A;  4KMU C;  2PI2 E;  4P72 A;  4JV5 Q;  1WTH A;  2C5C A;  1OXT A;  1L2F A;  5HUR A;  1I4P A;  4FP5 D;  3URY A;  1JOQ A;  4B9X A;  5C0X I;  1EY6 A;  4GLX A;  1Q3L A;  1G6Z A;  4ZYS A;  1XPU A;  3E9I A;  4A3L G;  3K0Y A;  4CDE C;  3U58 A;  1IYJ B;  3CC4 A;  1PXU A;  3EJI A;  1CI3 M;  1YNN D;  2A19 A;  2Z6B A;  5CMD A;  1VDZ A;  3KLR A;  4HJ8 A;  1QVF A;  2JA5 B;  1EYA A;  4JI8 Q;  3QJY A;  5IY0 A;  3G6E A;  1P8L A;  1QUQ A;  2TSS A;  2CH4 A;  4WJ4 A;  4DV6 Q;  3QG1 A;  2RVL A;  5BN5 A;  3BU2 A;  4A3G B;  4UP7 A;  5JOB A;  2R7F A;  4OX9 L;  3F2U A;  4X65 L;  2L15 A;  5M3F B;  1JOR A;  3GTQ B;  2WP8 J;  1HH2 P;  2VNU D;  2IT1 A;  3AEV A;  4B3R L;  3I3C A;  2PQA A;  1VQD A;  2CQA A;  2F1M A;  4X62 Q;  2KCM A;  1S72 A;  3D0F A;  4YWM A;  3SR1 A;  2ASB A;  2NYZ D;  2CQO A;  1EU4 A;  1GM5 A;  1VCI A;  3F2D A;  1UE1 A;  4L5T A;  1K73 C;  1K83 B;  5FKA C;  1QZG A;  5CC4 A;  2L11 A;  1JR0 D;  4EGV A;  5GAD C;  1CFM A;  1B4O A;  1CA5 A;  3D6C A;  3CPW A;  4J1M A;  3J81 L;  4JI7 Q;  3NXW A;  2UUC L;  3MC0 B;  5KYI A;  1G6P A;  1TY2 A;  4DPG A;  1PRT B;  3SXH A;  1EU3 A;  3H3V C;  4DV4 Q;  4I7A A;  5ELE A;  5EKL A;  4FNF A;  2K50 A;  3W3A A;  1F9S A;  4LF8 Q;  4B3M L;  1TVX A;  4JI1 L;  1EQV A;  3J7A F;  1Y8N B;  2B29 A;  3IFT A;  2EXZ A;  5J39 A;  4MTK A;  4ZRZ A;  3BYY B;  3CW2 C;  3MAQ A;  1JC7 A;  3PUW A;  1IBK L;  4LF4 Q;  5C3E G;  2I5M X;  1SYB A;  3PO3 H;  3DWA A;  1N34 L;  3KLS X;  4Y7N H;  1PZI D;  4EQP A;  5E3F A;  2IX1 A;  2A6E D;  3W2D A;  3GTO H;  1D2B A;  4EX5 A;  2V1C C;  4O42 A;  1GO3 E;  1N32 Q;  2LY7 A;  5IGC A;  1BVS A;  1E24 A;  1VQH A;  4BXX H;  1NAP A;  3GTK B;  4UPA A;  2NWG A;  2QKI C;  4AH6 A;  5BR8 Q;  2R7D A;  2F0V A;  2R7Z B;  1XWE A;  1SFO H;  1EY9 A;  4DV5 L;  1NJI C;  4DUZ Q;  2MGS A;  3E0J A;  2KHJ A;  3M7G A;  3BZD B;  3K58 A;  1ZEQ X;  2PMZ B;  1OXU A;  3QOL A;  3NE5 B;  1CSQ A;  4OWW B;  5C5L A;  3S17 B;  4CKB A;  1ASY A;  4IFD I;  4HJ5 A;  3X3M A;  1WCM G;  2B8G A;  3KBG A;  4NP5 A;  2D62 A;  3SK8 A;  4A3D G;  4DFA A;  1QOH A;  4UDU C;  1M4V A;  3N52 A;  4YWL A;  4DV1 Q;  4FF2 A;  1N9W A;  1QG7 A;  3L0O A;  3PO2 B;  1JT8 A;  1VF7 A;  2RDH A;  2JYO A;  2JA6 B;  2K5V A;  1GUN A;  2AWO A;  3MXN A;  5C3X A;  1NE3 A;  1GUO A;  3DEP A;  2R92 H;  2N49 A;  3CKI B;  3PCO B;  4GNX C;  4OIJ A;  4NXM L;  4AYB B;  5E4X A;  2BA0 A;  1SLJ A;  5IGD A;  3J81 E;  4YCW A;  3BVZ A;  4GN5 A;  4A3M G;  3KJO A;  2EYM A;  3MFY A;  3A55 A;  4WOR A;  2K5N A;  4A3J B;  3A5U A;  2KJX A;  1UUP A;  3I4M B;  1X3F A;  2R93 H;  4C3I G;  3U9S A;  1A2U A;  1VQA A;  1LM0 A;  4P2C B;  5DM6 3;  4A93 B;  1K0S A;  4R1J A;  4A3F B;  2I0Q A;  2DNC A;  2RCN A;  1JCK B;  3A7A B;  4RWS C;  5EBD A;  1U9R A;  3DMU A;  3NP8 A;  1RHP A;  1SYG A;  3AFQ A;  4UP8 A;  2ZXP A;  4APV A;  4DNT B;  2EYJ A;  3HOU H;  2Q8R E;  2YTY A;  1JQY D;  1MSG A;  4IUU A;  5I6Y A;  3T51 B;  2AKW B; 
#chains in the Genus database with same CATH homology
 1EY0 A;  2PCF B;  4RCN A;  1L0Y B;  1ML0 D;  2X69 A;  1BQQ T;  3H09 A;  1KAA A;  3QB3 A;  2F0G A;  4C3H B;  4NKL A;  2XWJ B;  4KHZ A;  1B3A A;  1PFN A;  3SHL A;  1EY7 A;  3BDC A;  1QJO A;  4CHT B;  1I6H B;  2XN9 C;  5G3L F;  4FXG C;  3D8G A;  1VMP A;  3IKJ A;  3IFD A;  2XVS A;  2IL8 A;  1LAC A;  4K2L A;  4RGT A;  1IHZ A;  3K5L A;  1A6X A;  1LT3 D;  3ERQ A;  4OHJ A;  2EJG C;  4UAI A;  4DGZ A;  5T1I A;  2PO4 A;  3S16 B;  4F88 A;  3GTP B;  1EEF D;  2C9O A;  3LNN A;  5JPM C;  1SSO A;  2NVY B;  4QCL A;  1SNP A;  3VYR A;  1TR5 A;  2X6L A;  2G9H D;  3K57 A;  1F9P A;  1ESR A;  3I70 A;  2VB3 X;  5C3E B;  3WDN A;  1X32 A;  3D6W A;  1IL8 A;  5M9O A;  1PDQ A;  1PTO B;  1W6J A;  2M00 A;  1CTM A;  2BCO A;  1FNU A;  2F0J A;  2F0W A;  4KJN A;  3MXG A;  1G2S A;  4XT1 B;  2H1E A;  1SXT A;  4ZLT F;  2WII B;  3I8Z A;  1ESF A;  4V19 0;  1E2Z A;  2KCC A;  3T16 A;  3J7Y W;  3NK9 A;  4BA1 I;  2KVM A;  3GV3 A;  3A56 A;  4Z9C B;  1B9N A;  1EIG A;  3OPO A;  5C0X H;  1I6V C;  2K5W A;  3HEJ A;  3P7J A;  1I4H A;  2SOB A;  2LMC B;  4IUN A;  4K5W A;  5KYL A;  5JEA H;  5DNF A;  4OO1 I;  1A15 A;  4HAE A;  4A3M B;  3MWY W;  3S9W A;  2O5I C;  4IUT A;  5I4D A;  1AZP A;  1NR4 A;  5ELB A;  1WTQ A;  4C3I B;  1ONL A;  4X3T A;  1VMC A;  4OGQ C;  2F0K A;  2IX0 A;  3K6O A;  2H4O A;  4DK1 A;  4PMB A;  2WAC A;  3GV6 A;  5F2D A;  2FIN B;  3Q0A A;  3RD4 A;  1STH A;  3C3L A;  3ZYY X;  3VR4 A;  2HCC A;  2MHV A;  2L1B A;  3TBI B;  4LMQ D;  1SMY C;  2EYO A;  4IZ8 A;  3CHB D;  3NWT A;  3JAM L;  2QIL A;  1Q1B A;  5C4Z A;  2RDF A;  1BCP D;  3LX0 A;  3G6J B;  2VXW A;  3TDQ A;  1NSN S;  3X3N A;  2CVR A;  2KCN A;  3ND9 A;  4F7X A;  4CKE A;  1MSH A;  3EQL C;  4G7H C;  2GA4 B;  5CV7 A;  4KHV A;  4KJO A;  1GUS A;  3C1E A;  4FXK C;  4IUV A;  1NCV A;  3TP5 A;  2A73 B;  1CHP D;  5I9O A;  1F2Y A;  1EWC A;  4HMJ A;  4MHE A;  2X6G A;  4E6I A;  4HED A;  1ET6 A;  4ABN A;  5JAV A;  1TS2 A;  3KLS A;  1F2L A;  3G7L A;  4K6L A;  1XX8 A;  3OWE B;  2K33 A;  4IFD H;  1O80 A;  4C3J G;  1J9O A;  5IT9 L;  2NBF A;  1O7L A;  4DA2 A;  4IUP A;  1O7Y A;  2O2L D;  5KND A;  3PO3 B;  4Y7N B;  1BUV T;  5IGB A;  5E4W C;  3GTO B;  4DAV A;  3A7L A;  3MEH A;  4K8I A;  3JAM E;  1H9M A;  1YNJ D;  1S5E D;  1Q90 A;  1SFO B;  1QNU A;  1K8O A;  2HCI A;  1D1K A;  3DWQ A;  4N9T A;  3PUY A;  4RKB A;  3NQI A;  4TQU S;  3GP7 A;  1R4P B;  3ONA B;  4MIU A;  3K59 A;  2DN8 A;  2QEJ C;  3OW7 A;  4ODG A;  1WTP A;  3T13 A;  3V96 A;  3VYT A;  2L12 A;  1UEA B;  4DU9 A;  1LTR D;  1ENC A;  3MTS A;  4N9P A;  1OO9 B;  2N55 A;  5LL6 S;  2R92 B;  1H9S A;  1LT6 D;  2A74 C;  1IYU A;  1WD0 A;  1G8Z D;  1FNV A;  4RGO S;  4PMC A;  1EIH A;  4DNR B;  2MPM A;  1STE A;  2R93 B;  4KY7 A;  1DD2 A;  3R8B A;  3D31 A;  2K03 A;  3CU7 A;  1SE4 A;  5CV4 A;  4DK0 A;  1KDA A;  4B9W A;  3FVQ A;  4KN4 C;  3I91 A;  3HOU B;  2F0P A;  5KEE A;  2EY2 A;  5KGU A;  2ZT9 C;  4CGY B;  4RGM A;  4IAL A;  1F9Q A;  1Q12 A;  4C3H G;  2E2H B;  1YNN C;  2JA7 B;  2L4N A;  4EVO A;  3PMF A;  3K7A B;  5C3W A;  1D1I A;  2PW7 A;  3H6M A;  1WTO A;  4LK1 C;  2Y0S B;  1LV9 A;  5CV5 A;  1HFG A;  4TSS A;  3MA2 B;  3R93 A;  5A2Q E;  1L0X B;  4BBR B;  2XSC A;  5BN3 A;  1SEB D;  4H0L C;  3L3O C;  3SK4 A;  4K14 A;  5CV8 A;  1AN8 A;  5LHY 1;  4B08 A;  4DXG A;  3K5N A;  2NN6 I;  4FYD A;  1EQT A;  3V2T A;  5M5X B;  2YU9 B;  1A2T A;  2EY1 A;  2AUK A;  2F0E A;  1V1P A;  4YIJ A;  2N88 A;  4XXE A;  2PNR C;  3M7N A;  1R9T B;  2EY5 A;  4IFD G;  3WOE A;  4C3J B;  2EYP A;  4ZKB B;  1EWH A;  1RTN A;  1E2V A;  3Q23 A;  5IGF A;  5EJW A;  1PRT D;  4ZAI A;  2KUM A;  3HOY B;  2K28 A;  4HSP A;  3BG3 A;  4HTH A;  5IOC A;  2NUC A;  4XT3 B;  1WTR A;  1EYC A;  1TS4 A;  4G7Z C;  2LKV A;  1PZJ D;  2NZ1 D;  4ILW A;  4IQZ A;  4OO1 H;  2A6E C;  1I4R A;  2EYH A;  4JK1 C;  4FF1 A;  3GTL B;  4BA2 I;  2K04 A;  1PTO F;  2A68 D;  2WKC A;  3R2I A;  1C48 A;  3E6Z X;  4C2M B;  4F8M A;  2EZV A;  4C56 C;  1Y1W B;  4OIK A;  4WJW A;  1Z6H A;  2KHS A;  4KTA A;  1QNK A;  1OXS C;  3KUP A;  2DY8 A;  4ZQ3 A;  1LAB A;  3S1N B;  4XIG S;  3SDZ A;  2LS0 1;  1BBX C;  1TWC B;  4HSV A;  1UAP A;  3KF8 A;  2AWN A;  1QB5 D;  3GO5 A;  2MJ8 A;  3GTJ B;  3E5S A;  4IUQ A;  4X3S A;  3K5M A;  2K5D A;  1RF2 D;  5EPJ A;  5K5P A;  3OIP A;  4S3S A;  3OOC A;  3HG9 A;  2A5H A;  2OF1 A;  1U4P A;  1T5E A;  1EEI D;  2ICI A;  5C4X B;  3DHQ A;  1LT5 D;  2RQX A;  3S14 B;  3DM1 A;  1Q1E A;  3MZ5 A;  4A3B B;  3D4D A;  1A3V A;  4Q5V A;  2CW0 D;  1XTC D;  1HTP A;  3RZD B;  1I4G A;  1KDB A;  5K36 H;  1D5Z C;  1B50 A;  1GOZ A;  4FXD A;  5C4J B;  2IW3 A;  3H91 A;  3BS1 A;  3HOV B;  2OXP A;  1D5M C;  5TSS A;  4X3U A;  2D2C C;  2EJM A;  5JVG 3;  2PZW A;  1DYQ A;  4KY6 A;  5C6A A;  1SE2 A;  1QCB D;  2HDM A;  1AP0 A;  2JA8 B;  2CHB D;  3MXP A;  1FYC A;  3NHH A;  3KK7 A;  1W6K A;  3HOZ B;  3M3Y B;  4IN3 A;  4KKS A;  4RH6 A;  1DJR D;  1STA A;  2D9U A;  3HRZ C;  1C4Q A;  3QWN A;  4PNY A;  2NB0 A;  1WD1 A;  2PZU A;  2E75 C;  3N6R A;  1O7Z A;  1LTI D;  2HDL A;  4GZY C;  4XYQ A;  4K8J A;  3FEW X;  1E0B A;  3P75 A;  4EQO A;  1RJT A;  1IKM A;  2F4I A;  3T53 B;  5FO7 B;  1SYE A;  3D3R A;  2K7V A;  1CZG A;  3OWF A;  1V1O A;  4FVM A;  5FOB B;  4OO1 G;  3VYU A;  3DUZ A;  5C44 B;  1HFN A;  2NVT B;  2KEE A;  4ZKC B;  4NDX A;  1DOL A;  2EDG A;  4ZUJ A;  1DZ1 A;  4M8A A;  2ZXR A;  3S15 B;  4QB4 A;  1I4Q A;  2K5Q A;  2PPB C;  5JJZ A;  4M1U B;  1JOO A;  1EL0 A;  3I73 A;  2RBM A;  3OSO A;  4XTC S;  2L0C A;  3FKI B;  3GTG B;  5NUC A;  2BE5 D;  5EKK A;  2KED A;  3SE0 A;  3SVM A;  4BY7 B;  1STN A;  1V1P B;  5M3M B;  1LT4 D;  1HRJ A;  3C46 A;  1BR9 A;  1STY A;  4TKO B;  1BOS A;  5DAU A;  3S1Q B;  3HOW B;  4IFD J;  2B2W A;  3BDO A;  1RD9 D;  2K6A A;  1SJH D;  2F3W A;  2XWB B;  5I9P A;  1G91 A;  4MN3 A;  4X3K A;  1U4L A;  4TRD A;  1M8A A;  1GUT A;  1MBY A;  1B44 D;  2NN6 H;  3RUZ A;  2WKD A;  2L55 A;  1Y1V B;  3AMU A;  2IJ0 A;  4C1N I;  3KBX A;  2MP1 A;  2B8F A;  4IUR A;  3SK5 A;  1CHQ D;  1KLG D;  1S5D D;  2J4X A;  3PV0 A;  5D65 A;  3D4W A;  1IYV A;  2RKS A;  2AQ1 B;  2B2V C;  1BCP C;  2EYF A;  3FPU B;  2EOT A;  1B2T A;  4LJZ C;  3BVM A;  1UNS A;  1KNA A;  5G3L D;  1SYF A;  2NVX B;  4XQN A;  2VB2 X;  5JPN C;  3S2D B;  1HCZ A;  2FMM A;  4RHS A;  1EOT A;  3CQZ B;  3K5O A;  4KY5 A;  2JE6 I;  2JEA I;  5M5Y B;  3D4R A;  3NQT A;  4RCO A;  4R9W A;  1SAP A;  2TMP A;  1D6E C;  2EJF C;  1E2W A;  1JWS D;  2AQ3 B;  5IIF A;  1WTX A;  3IL8 A;  1TT2 A;  4H7B A;  2F0H A;  3M4O B;  2K01 A;  4PMW A;  1AFP A;  2B2T C;  3O13 A;  5DM7 3;  1BNZ A;  2ENB A;  3EFX D;  3GD7 A;  2XIW A;  4KKT A;  3LWE A;  2Q8T A;  1SBB B;  3ITP A;  1STB A;  1TS5 A;  2M2L A;  3A8J E;  3H0G B;  1YNJ C;  4CJ2 C;  1EYD A;  4ZK9 B;  1TWH B;  4HMI A;  2JP1 A;  5I2Y A;  1TWA B;  5C0X G;  2XRQ D;  1IW7 D;  3GQB A;  4F87 A;  1KLU D;  3FPP A;  3A54 A;  3AU7 A;  1GXD C;  1U4M A;  2R61 A;  5EQ0 A;  1A3T A;  4RHR A;  1GJX A;  4H44 C;  2WV6 D;  3VR6 A;  5JEA G;  3J7A V;  2A69 D;  2A6H D;  4O1N A;  3S2H B;  1WVL A;  5M5W B;  5FO9 B;  3RLF A;  4KI0 A;  1MGS A;  4RA8 A;  1FGB D;  5ELF A;  2WIN B;  2JXM B;  3DEO A;  2F0I A;  1SNM A;  2BA1 A;  2PYK A;  3TZU A;  4PQX A;  2A6H C;  2Z8L A;  1DXM A;  2EE1 A;  4RKL A;  5IT9 E;  1XXG A;  1S5C D;  2K05 A;  2Q8I B;  3MHB A;  4FF4 A;  5IGE A;  1GUW A;  3EA6 A;  3NTK A;  2L9H A;  1RCV D;  5KNC A;  1ENA A;  5D3D A;  2F0U A;  4C1N K;  1C8C A;  1SE3 A;  2M9V A;  1DM0 B;  5FLX L;  2NN6 G;  2JSO A;  1JIC A;  1J8I A;  5J1Z A;  4G57 A;  5CV6 A;  1X3Q A;  1Y8P B;  4OL7 A;  1GHJ A;  1RKN A;  2E76 C;  3R3O A;  1TWF B;  5KNB A;  5CBA E;  1O78 A;  1T5X D;  1H9K A;  3S1R B;  1EZ6 A;  1SJE D;  5I2X A;  2QF7 A;  1HA5 A;  5IOD A;  1LTS D;  1DOK A;  2SDF A;  3VA7 A;  2FHT A;  2F0L A;  1S5F D;  5COR A;  3HOX B;  3H94 A;  2OEO A;  2B2U C;  2WB1 B;  4QMG A;  3NPP A;  3SEB A;  1NR2 A;  1F2M A;  2PW5 A;  2LFN A;  3QOJ A;  1HHV A;  4EQN A;  3BDL A;  1TU2 B;  1TY0 A;  2NTS A;  1JOK A;  2V4D A;  4FF3 A;  4L8J A;  5EPK A;  1BO0 A;  2NTT A;  4R8I A;  2F03 A;  2O4X A;  3U9O A;  4HCS A;  4KD3 A;  1STG A;  2B2V A;  1JE4 A;  1PMR A;  2PZT A;  5FK9 C;  2XRS D;  3Q22 A;  3DWP A;  2R6G A;  3NTH A;  3J80 L;  2HQE A;  1ENF A;  2FMC A;  4KKU A;  1TS3 A;  3WOF A;  5KRU A;  5LL6 X;  3Q6S A;  1PRT C;  1QE6 A;  5FLX E;  1LLR D;  1ZYR D;  5COY A;  2AQ2 B;  1I50 B;  4XYO A;  2B2W C;  2E2D C;  3V05 A;  1PLF A;  1KTK A;  2FJ2 A;  1HUN A;  5CYU A;  1NUC A;  2RSO A;  1CQV A;  2XNA C;  3I4L A;  3C2P A;  1SYD A;  5IGG A;  3PUZ A;  1ZYR C;  3RMH A;  1Q8I A;  2A68 C;  1KAB A;  1LTB D;  5E1F A;  3C1F A;  1ILQ A;  1K8M A;  1SNO A;  1I4X A;  1PYW D;  1TII D;  1SND A;  5EBC A;  1EY5 A;  3VR2 A;  2B2T A;  3VA5 A;  4K2K A;  3R2T A;  3TP8 A;  5ELD A;  3TP6 A;  1G2T A;  1MI2 A;  1FR3 A;  4KV6 A;  4KN7 C;  2K1B A;  5EPL A;  3HZX A;  1TWG B;  3NSW A;  4Q0F A;  1F2Z A;  2IWH A;  2QDB A;  4DAP A;  2ID0 A;  1WTW A;  1HA6 A;  1GUG A;  2IPK D;  3GTM B;  5FO8 B;  5CV9 A;  4LAA A;  2F0D A;  3CRK C;  3J80 E;  5D14 A;  4K5X A;  3NUC A;  2G9D A;  1ILP A;  1CQF A;  1AEX A;  2B39 A;  3FRP B;  3A8I E;  4J8Q A;  3NBH A;  2JEB I;  1WTV A;  2CW0 C;  1BCP F;  2I07 B;  4ULL A;  2E2I B;  1CT1 D;  1Y8O B;  4HCE A;  4KK7 A;  2KA7 A;  1KNE A;  2F0S A;  4G7O C;  5C5M A;  5C0X J;  3P1H A;  1ZKO A;  5I6W A;  1JB3 A;  4ZUI A;  3DXJ C;  2EYL A;  3I90 A;  5KIX A;  1SYC A;  1EY4 A;  3L7Z C;  4R8N A;  5EGT A;  1OXX K;  3SK6 A;  1HQM C;  5C4H A;  1CA6 A;  2HUG A;  4RFB A;  5JEA J;  2NVQ B;  3ND8 A;  1SNQ A;  2KOL A;  1H9S B;  3I4N B;  2RSN A;  3FDT A;  5JVH 3;  4BWG B;  1FNW A;  4ID6 A;  2Z1C A;  1OXV A;  3P20 A;  3MVV A;  2FFK B;  1R4Q B;  3PUX A;  2L5T A;  5ELC A;  3QIA A;  1KDC A;  3BVG A;  4I65 A;  2F0N A;  2RDG A;  4NMZ A;  1LO5 D;  1B53 A;  4BS9 A;  2B2Y C;  3M85 A;  2KEC A;  2B2U A;  5CGK A;  1HQR D;  1HUM A;  1B1Z A;  2SNM A;  1PTO D;  2MUY A;  1MD2 D;  2F0Q A;  1U4R A;  4HR7 B;  1QWY A;  1A3U A;  2OT2 A;  2DNE A;  1S4Z A;  3MFG A;  3CRL C;  2SEB D;  1F9R A;  4A3K B;  1PTO C;  3I72 A;  2J7Z A;  2K32 A;  1DON A;  3UI2 A;  1CM9 A;  1GHK A;  1WCM B;  4A3D B;  2BOS A;  2O5J C;  1ET9 A;  2Z4I A;  1Z7T A;  2BDN A;  4FO2 A;  3OMG A;  2BE5 C;  3A8K E;  4K6D A;  1FD7 D;  4JBW A;  2F0T A;  2I46 A;  4NW2 A;  3Q24 A;  3NBI A;  5CR3 A;  1BCP B;  3NWS A;  1SMY D;  1CZW A;  2SNS A;  1AW7 A;  1BXT A;  4K5V A;  3BYT B;  1ZXT A;  4WRD A;  1AZQ A;  1HPC A;  2F0M A;  5D3I B;  1I3Q B;  1LTG D;  4DAY A;  5DEH A;  1RDP D;  4BY1 B;  4H13 C;  1SNC A;  2EPB A;  3EVQ A;  2VUM B;  5K36 G;  1B9M A;  3HKZ B;  1G29 1;  2F0O A;  1JWM D;  4BBS B;  4J6H A;  4A3I B;  2J0T D;  3RZO B;  3TZD A;  3MXU A;  1II3 A;  1V8Q A;  1RTO A;  1XYI A;  4QF4 A;  3OIQ A;  4CJ0 B;  1PFB A;  2F0F A;  4XQQ A;  1BDO A;  2R3Z A;  4U68 A;  1IKL A;  4U67 3;  5T1G A;  2EVB A;  3HP3 A;  4DXF A;  3FMC A;  3PIP 3;  3VR3 A;  3PUV A;  1V43 A;  1PZK D;  3NTI A;  3T4A C;  3TME A;  5J22 A;  2RA4 A;  1HTL D;  5EKI A;  4A3E B;  3LWU A;  3QO2 A;  3PIO 3;  4PV1 C;  1CK1 A;  2ICE C;  1Y69 U;  1X3P A;  3OHX C;  2WAQ B;  5ISR A;  2PQE A;  3TN2 A;  3AB9 A;  1TKW B;  3HGB A;  1VF5 C;  2E2J B;  1Z47 A;  1EY8 A;  1H9J A;  1PRT F;  1PTO H;  3S1M B;  5CBE E;  4L6T B;  4RAU C;  2D5D A;  1DOM A;  3ERO A;  4G4K A;  4XDX A;  1PFM A;  4WFN 3;  4CKC A;  3VR5 A;  3TSS A;  2YYZ A;  2EY6 A;  1EFI D;  3HS0 C;  3L9A X;  1SDF A;  4QUF A;  1JWU D;  1QIL A;  4KD4 A;  1LTT D;  1F77 A;  1ROD A;  4RGN A;  4QIW B;  1LTA D;  1BF4 A;  5AFW A;  4I7Z C;  2IX3 A;  4ME5 A;  2B63 B;  3M4Y A;  2E74 C;  4CBV A;  1D5X C;  1TQO A;  5HGT A;  3OMC A;  3IAY A;  4HN7 A;  2AUJ D;  1IW7 C;  3VYS A;  1ICW A;  1DCZ A;  5A35 A;  3TP7 A;  5A2Q L;  2Z4H A;  2KQ3 A;  4CJ1 B;  4L63 B;  4DN4 M;  1EZ8 A;  4QUC A;  2B2Y A;  2BDO A;  2ZXO A;  2DY7 A;  1HXY D;  5BN4 A;  2QCP X;  2A69 C;  3T56 B;  1H9R A;  4XQJ A;  4V0B A;  4DF7 A;  1S5B D;  2F3V A;  4KMU C;  2C5C A;  1OXT A;  5HUR A;  1I4P A;  4FP5 D;  3URY A;  1JOQ A;  4B9X A;  5C0X I;  1EY6 A;  1Q3L A;  1G6Z A;  4ZYS A;  3K0Y A;  1PXU A;  3EJI A;  1CI3 M;  1YNN D;  5CMD A;  1VDZ A;  3KLR A;  2JA5 B;  1EYA A;  3QJY A;  2TSS A;  3QG1 A;  2RVL A;  5BN5 A;  4A3G B;  5JOB A;  3F2U A;  5M3F B;  1JOR A;  3GTQ B;  2WP8 J;  2VNU D;  2IT1 A;  3I3C A;  2CQA A;  2F1M A;  3SR1 A;  2NYZ D;  1EU4 A;  1VCI A;  1K83 B;  5FKA C;  5CC4 A;  2L11 A;  1JR0 D;  4EGV A;  1CFM A;  1B4O A;  1CA5 A;  3D6C A;  4J1M A;  3J81 L;  3NXW A;  3MC0 B;  5KYI A;  1TY2 A;  1PRT B;  3SXH A;  1EU3 A;  3H3V C;  5ELE A;  5EKL A;  4FNF A;  3W3A A;  1F9S A;  1TVX A;  1EQV A;  3J7A F;  1Y8N B;  3IFT A;  2EXZ A;  5J39 A;  4ZRZ A;  3BYY B;  3MAQ A;  1JC7 A;  3PUW A;  1SYB A;  3DWA A;  3KLS X;  1PZI D;  4EQP A;  5E3F A;  2IX1 A;  2A6E D;  3W2D A;  1D2B A;  4O42 A;  2LY7 A;  5IGC A;  1NAP A;  3GTK B;  2NWG A;  2QKI C;  2F0V A;  2R7Z B;  1XWE A;  1EY9 A;  2MGS A;  3E0J A;  3M7G A;  3BZD B;  3K58 A;  1ZEQ X;  2PMZ B;  1OXU A;  3QOL A;  3NE5 B;  5C5L A;  3S17 B;  4CKB A;  4IFD I;  3X3M A;  3KBG A;  2B8G A;  4NP5 A;  2D62 A;  3SK8 A;  4DFA A;  1QOH A;  4UDU C;  1M4V A;  3N52 A;  4FF2 A;  1QG7 A;  3PO2 B;  1VF7 A;  2RDH A;  2JYO A;  2JA6 B;  1GUN A;  2AWO A;  3MXN A;  5C3X A;  1GUO A;  3DEP A;  3CKI B;  4OIJ A;  4AYB B;  5E4X A;  2BA0 A;  3J81 E;  5IGD A;  3BVZ A;  2EYM A;  3MFY A;  3A55 A;  4WOR A;  4A3J B;  2KJX A;  1UUP A;  3I4M B;  4C3I G;  3U9S A;  1A2U A;  4P2C B;  5DM6 3;  4A93 B;  4A3F B;  2DNC A;  1JCK B;  3A7A B;  4RWS C;  5EBD A;  1U9R A;  3DMU A;  3NP8 A;  1RHP A;  1SYG A;  2ZXP A;  4DNT B;  2EYJ A;  2Q8R E;  1JQY D;  1MSG A;  4IUU A;  5I6Y A;  3T51 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...