4I65A

Crystal structure of staphylococcal nuclease mutant v23i/l25v/i72v/i92v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKVMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4i65A00
5CR3A 4ODGA 4NDXA 5I9OA 2EY5A 4K2LA 4EVOA 5IIFA 2OXPA 3P75A 1A3TA 4K8JA 2F0IA 4K2KA 2NUCA 1EYCA 5KIXA 5C4HA 1STGA 2PZUA 5EKKA 4DU9A 3H6MA 3RUZA 1STYA 1SNCA 4G57A 2F0VA 3OMGA 1EQVA 4HMIA 4F7XA 5I6YA 5KYLA 4IUNA 4TRDA 5C3XA 2F3WA 3OWFA 2EY2A 4KHVA 1F2ZA 3BDLA 3TP5A 4K14A 4PMCA 5CV7A 1EZ6A 1KDAA 1EYDA 3D4DA 2RDFA 3NQTA 3QB3A 4H7BA 5DAUA 4ZQ3A 5E3FA 3SK4A 4B9XA 4R8NA 4OL7A 3DHQA 4I65A 4EQOA 5HGTA 5IGGA 3QOLA 5IGBA 5CV4A 3D6CA 3P1HA 2EYLA 1TQOA 5EKLA 3SXHA 1ENAA 1AEXA 4J1MA 5CGKA 1KDCA 5IGFA 5JOBA 5CV9A 3ITPA 1SNQA 4QB4A 3SHLA 5IODA 4MIUA 1STAA 2PQEA 4WORA 5C5MA 4DGZA 5C6AA 2F0UA 5KEEA 3MXPA 3TP8A 4B9WA 1SYGA 5K5PA 2F0SA 4HMJA 4K5XA 3DMUA 5M9OA 1II3A 2F0EA 2LKVA 1KABA 2F0WA 1STHA 4LAAA 2O4XA 5CC4A 4EQPA 1EY9A 2QDBA 4ZUJA 4KD4A 5KRUA 1JOQA 3QOJA 4KY5A 2F0QA 4WRDA 3C1FA 5J22A 2F0TA 5NUCA 1SNPA 2F0NA 2KQ3A 5KYIA 1JOKA 4NP5A 5C4ZA 2EYOA 2F0HA 1SYBA 2ENBA 3MEHA 3MVVA 3NUCA 3EROA 1EY6A 3SK5A 2KHSA 3ERQA 4ID6A 3SK8A 1F2YA 2EYPA 3T13A 1SNMA 3NP8A 1EY7A 5CV8A 1A2TA 4KJOA 1STNA 4DFAA 1SNDA 3C1EA 3OMCA 3NHHA 4F8MA 5CV6A 2F0FA 2F0LA 3D8GA 1JORA 1SYDA 3NK9A 3PMFA 1KAAA 3BDCA 4RKLA 5F2DA 2HQEA 5I6WA 3E5SA 1U9RA 1ENCA 2F0OA 2EYFA 4KTAA 4QF4A 5C3WA 4EQNA 4PNYA 2SNSA 3T16A 1A2UA 5HURA 3U9OA 4K5WA 4PMBA 3S9WA 2EXZA 3OSOA 4N9TA 4N9PA 5IGDA 1RKNA 4NMZA 4IALA 2EY6A 1STBA 2PZWA 2EYHA 2PYKA 3HEJA 2EY1A 1JOOA 2PW5A 4YIJA 4DF7A 5IOCA 4K8IA 2PW7A 3HZXA 4RKBA 1EZ8A 5E1FA 5EGTA 2OF1A 1SYFA 2EYJA 2F0MA 4NKLA 4ZUIA 4KV6A 4S3SA 5I9PA 1A3VA 4KY7A 1NUCA 5DEHA 2M00A 2RBMA 5KGUA 3TP6A 1SNOA 4J6HA 3D4WA 5ISRA 5J1ZA 1NSNS 5IGCA 1F2MA 1EY5A 2RKSA 3VA5A 5JAVA 1TR5A 3SK6A 2PZTA 2F0JA 1A3UA 1EY0A 3SR1A 1TT2A 3V2TA 3LX0A 3TP7A 2F0DA 5IGEA 5J39A 3TMEA 4E6IA 1EYAA 1SYEA 3NXWA 2F0KA 4K6DA 4KD3A 5CV5A 4KY6A 4KJNA 2SOBA 4HTHA 1SYCA 1KDBA 4K5VA 2F0GA 2OEOA 2SNMA 3EJIA 4ME5A 4IZ8A 4QMGA 2WACA 1EY4A 2F0PA 2F3VA 3MHBA 1EY8A 1IHZA 3MZ5A 2EYMA 5C5LA 3EVQA 3R3OA
chains in the Genus database with same CATH superfamily
2R92B 2B63B 2G9HD 2WAQB 3I73A 1V8QA 3GTJB 3U50C 1S5CD 4QIWB 4A76A 2RHQB 2K5VA 5EKKA 3K5LA 3UDGA 4A3IB 1XMQQ 4HJAA 1V9PA 5HY6A 1QOHA 1OXUA 3CKIB 1RHPA 3N52A 3ONAB 2EY2A 1K3BC 5JEAJ 4X66L 1BQQT 3Q22A 4BWGB 3TRZA 5BR8L 3Q6SA 4TKOB 1B9MA 5BR8Q 3DM3A 4G4KA 5A35A 3D6CA 4A3BH 2EIFA 2B39A 3NTKA 4WJ3M 4BA1I 4X66Q 1N36Q 3R93A 4DA2A 1SFOH 3M9BA 4PMWA 2JA8G 3OHXC 2P5ZX 1C7YA 4GLVB 4BY1B 4P73A 2WV6D 4LUOA 2ZJPA 4AYBE 5BN5A 2O4XA 5C0XJ 1YHBA 4JI8Q 4WRDA 5IT9E 3AU7A 4IUQA 3ICEA 2TMPA 4CKCA 1JE5A 4DUYL 5JEAH 3E6ZX 3S1MB 3S1MH 3ULPA 1SNMA 2I0QA 2YTVA 4A3EG 1SMXA 1SE2A 4KJOA 2UXBL 2QA4A 1PMRA 1WJJA 1S5ED 3CU7A 2MO0A 4JI7L 2JSOA 4C2MB 1A0IA 3HKSA 1EIGA 3I4NB 4HCSA 1M90C 3KBXA 1GUSA 4RA8A 3W1GA 3SVMA 3GTOB 5E1FA 1UWVA 3U58A 2IJ0A 3H3VH 2R7ZG 1QZHA 4A3EB 4YY3L 4N8FA 4H0LC 3TZUA 1JB7A 4J8QA 1RJTA 2L0CA 1BR9A 4GKJL 3TEHB 2KECA 3OPOA 4JBMA 1VS0A 1JC7A 3CCLA 3VR2A 5IWAL 2ALYB 1LTID 1UE1A 2B3GA 3FHWA 1Y8OB 3KFUA 3S1QH 1JWUD 3HOXG 1HH2P 3J81L 2EPBA 3UDXA 2YTYA 3FPPA 3J81j 3AYHB 5LMUL 2E5LL 4L5RC 1U4RA 1OXSC 2Z9HA 3Q24A 1XJVA 1VQFA 4I7ZC 1EQVA 5JPNC 3BVZA 2DUDA 1QJOA 2B2YC 1S5FD 2QW7A 3KJPA 3HKZG 3KF6A 2RDFA 3GV3A 1IYVA 4A3DB 3DEOA 2E2HB 4BBSG 4DNIA 1BXTA 1HQRD 5EKLA 3KBGA 1AZQA 4LWCA 1KL9A 4OIJA 1JE4A 5HGQA 4A3JG 2HDLA 4P75A 4JG2A 4A3MB 2LKVA 1G291 2Q8RE 3AFPA 3RN2A 4TSSA 2EZVA 1R4QB 1N32Q 3PSIA 2D2CC 3PF5A 1G51A 1EUJA 3KF6B 2D62A 1ONLA 2D0PA 4B3TQ 3NTHA 3EROA 3HOWH 4JV5L 4C56C 2EYPA 1M1KC 2KVMA 4PZ7A 1GUTA 1DCZA 2A5HA 3NPPA 4DK6C 2R61A 1DOMA 1HTPA 3C1EA 3OMCA 3STBC 5J3BA 3GTQH 3HOUB 2IY5B 2V1CC 3K80C 2E74C 1PFNA 4IJHA 1A2UA 2Q8TA 2DGYA 1XMOQ 1U5KA 3OSOA 4N9TA 3QJYA 4YWKA 1Y1WB 1V43A 5KYLA 2KCNA 3EIVA 2CW0D 4JW0A 4LFCQ 4A3FB 1VQPA 4BY7B 4KY7A 1XMOL 1UE7A 2RBMA 3T51B 5IP9H 1B3QA 2IX1A 1NNXA 3HOWG 1Q1BA 3GP7A 4XXEA 3RNUA 4DR6Q 1EY5A 1XPUA 5FLMH 1FD7D 3KF8A 3K6OA 2Q2HA 1C0AA 1VQ8A 1O7IA 1OXVA 1CQFA 1SYCA 1CZGA 2SNMA 3A0JA 1VCIA 5FK9C 1TWFH 3EVQA 1ASYA 1F77A 3AQQA 3NWTA 4FVMA 2PZUA 1HNZL 2R93G 2L1BA 3OMGA 2YU9H 5EBCA 1PH8A 2JE6I 4IUTA 2KCMA 3BDLA 1PYSB 1SJHD 4P74A 3DLLA 2NVYB 2DY7A 1IKMA 1D6EC 3VYUA 4YHHQ 2N3SA 3CPFA 4R8NA 3VYRA 1D2BA 2E2JB 2Y0SE 2JA5G 3A8IE 1N8RC 3S14B 3D3RA 3WWVA 2SEBD 3RLFA 1PZJD 4DV4L 1Q3LA 4Y7NH 4L5SA 3TP8A 4LW1A 1UEBA 2D0OA 3ERSX 1I6VC 2RSOA 4ALPA 1L2FA 2R93H 1QE6A 1PH7A 3C1FA 2F0TA 1IBLQ 3IFDA 2JA7B 1RD9D 3S17B 1SMYC 2MUYA 1I4HA 4JC0A 4DR5Q 4JI2L 3NUCA 2KEEA 3UDIA 3K57A 4HR7B 3BS1A 4JV5Q 1QVCA 2UXDQ 1TWCB 1A2TA 2KHJA 1I50B 1VQ6A 2R7ZB 3LNNA 1SYDA 3E3XA 3BDCA 1NMGA 5F2DA 1EFWA 1JICA 1ENCA 2F0OA 2Z4IA 3T16A 4GOPB 4JPBW 4POGA 1QUQB 4A3EH 1ESRA 4GNXC 1WCMH 4GS3A 1B50A 3TS2A 1B2TA 2EYJA 4QL5A 2UXCQ 4CJ1B 3W5OA 4HJ8A 4BXXG 2QGQA 3AMUA 4JBKA 2RDHA 2F1MA 3OIPA 1I6HB 3H0GB 4X62Q 4A3MH 4IN3A 4X62L 1SAPA 3J80i 1BUVT 1N33Q 5I2YA 5C0XH 1DOLA 1C4QA 2F4IA 2XN9C 5J39A 2K52A 2WB1E 2XIWA 3R2IA 2TSSA 5M5YH 2C35B 3H91A 1PFBA 3VYSA 1WCMG 4JI1Q 3K5MA 1R9TB 4KHPQ 1IBMQ 1N34Q 1X56A 2RQXA 3DUZA 3OIQA 3E0JA 1S72A 4DAMA 1QUQA 5IP7H 4A93B 3W2DA 1EYDA 1KXLA 5DAUA 1K73C 4KN4C 1UE5A 3VR5A 4DV3Q 2F4VQ 3A7AB 1WTRA 4V190 1X3EA 2E2IH 4OWTB 1ILPA 1JMCA 2O5JC 1Z47A 1Q8KA 1GUNA 1SNQA 5A2QE 1LTLA 2JEBI 2K33A 1VQLA 4WORA 5C5MA 3MXPA 4QJFA 2VUMG 3S1NH 5EPLA 3CCUA 4LFCL 4RCOA 1STHA 2CH4W 4KD4A 1XMQL 1SLJA 3SE0A 1AW7A 2AWNA 2SDFA 3DWPA 3QWNA 4C3HG 3F2BA 1G8ZD 3KF8B 2ENBA 1W6KA 1A6XA 4PG3A 1WTPA 2KENA 1U4LA 5H1SE 1TY2A 2CWAA 3PIO3 1UAPA 1Y69U 2K28A 2UXDL 1STNA 4DFAA 3K59A 1BBUA 1U0LA 5IT9c 4JI7Q 4X65L 5C3WA 3I91A 1DGSA 1Y14B 4EQ5A 1UUPA 2K50A 2L55A 4XQJA 2VUMH 3AFQA 1TKWB 4IPDA 1JT8A 3GTLH 2EYHA 4UP9A 2KHIA 4B3SQ 1SYFA 2JA8B 3S14H 2ES2A 1PVOA 1D1KA 1TWGH 1G6ZA 5ELDA 2JA6G 5M5WB 2A74C 3OYYA 3A8KE 4IPGA 3HKZB 2CQAA 1HA5A 5JAVA 3CCRA 3TN2A 3AEVA 1SDFA 4JI5L 1DOKA 2L12A 1X6OA 4R9WA 4KY6A 1PTOF 5T1GA 2YU9B 3ND9A 4GNXA 2F0PA 2R93B 2CH4A 1SNCA 5C3XA 2EQSA 2NVXH 4ODGA 4G7HC 5IWAQ 1A3TA 1B3AA 1O7ZA 2RSNA 4DU9A 1STYA 4G57A 1C8CA 1BDOA 4C3JH 4DXGA 1O7YA 4LF9Q 1CA5A 1B1ZA 1DYQA 4POFA 1P8LA 1TWAB 3FVQA 3MWYW 1KDAA 3D4DA 5K5PA 4FF4A 2K01A 4FF2A 3G6JB 3C2PA 2BH2A 4X3UA 1IYUA 1YZ6A 3FKIH 4HCEA 2QF7A 2RCFA 1WTHA 3GQBA 5C6AA 3M4OH 2JXMB 1SYGA 4RHRA 5GAGC 4UDUC 4B3RQ 2N8NA 4DR1L 1JOQA 3KK7A 4KY5A 3G6EA 2WAQG 1SSOA 2F0QA 5FLXL 5FOBB 3S2DB 5KYIA 4X3SA 4DUYQ 1HPCA 1EEFD 1VQKA 4K0KL 3MEFA 3SK8A 1H9JA 5EKIA 3K5NA 2R6GA 1CKMA 3P7JA 1LTRD 2WFWA 1PH9A 3H94A 3D8GA 3PMFA 1SR3A 5DLQE 2RHSB 1LTBD 4IPCA 1WTWA 3Q8DA 1V1QA 4BBSH 1RTNA 2SNSA 1I3QB 4GN3B 1HUNA 1SROA 1HCZA 1SE3A 1V1PA 2EXZA 1X3QA 1SJED 3O13A 1F9SA 1IL8A 1JOOA 3GTKB 2ICIA 4K8IA 3RLNA 4FP5D 1QG7A 1ILQA 4ZCKA 1M4VA 1WOCA 1EU3A 1A15A 5C4XG 5EPKA 1LTGD 4J6HA 3D4WA 3MXNB 4DR6L 2NZOA 4LUVA 2VQFQ 5DM63 1VQNA 3V2TA 1A8VA 4HIOA 1VQDA 3BYTB 5CV5A 3CCJA 1Y8PB 2G9DA 2YYZA 5EQ0A 2L4NA 1E7ZA 1Z6HA 1EY4A 1CKOA 5M3FG 1PYWD 4DNTB 1WVLA 2HDMA 1Q81C 5T1IA 2K6AA 5KIXA 4LF7Q 4DR4Q 4A3KB 5IE8A 4A3KH 1RL2A 1A63A 4FDBA 2LSSA 3D0FA 1S40A 1YJNA 4GOPC 4PQXA 4EQPA 3LWUA 4BY7G 3CF5A 3DHQA 4KMUC 1HZCA 1NE3A 1GXDC 2VS1A 2PMZB 2DNEA 5CGKA 4LMQD 1PYBA 1EWHA 1X55A 2BDNA 4B3RL 3SHLA 1KQSA 4UAIA 5I2XA 1K83H 2XSCA 1SFOB 3H3VI 1LTTD 2AMCB 1EQTA 1K28A 4B9WA 1I4XA 2EDGA 4K6LA 3I2ZA 4JI6L 2E2DC 1OXXK 1CFMA 4ZKBB 1MJCA 4JI0Q 1AE3A 2NYZD 5M5XB 1EU4A 4AYBG 1IBLL 2ATWA 1AFPA 4RKLA 3H0GG 3FRPB 1HFNA 4KTAA 2EYFA 4A3MG 4C2MH 4EQNA 3K0YA 1B44D 1TWGB 3U4ZA 3RZOB 4HJ7A 3QG1A 3EN2A 3HEJA 4DF7A 5JEAG 3F2UA 3T4AC 1G2TA 2HUGA 4HSVA 4ZUIA 2UU9Q 4KKSA 1HRJA 1TWAH 5I9PA 3A5UA 1C48A 2LMCB 1IZ6A 1Q12A 3TDQA 4JI3Q 4HSPA 2M00A 4A3DH 1PDQA 1VQGA 3HKZE 3E0EA 4ZYSA 3VDYA 1QB5D 4A3GH 4H44C 3MA2B 2A6HC 2Z6KC 1NSNS 4XYOA 5JVH3 4JBJA 3K0XA 1EEID 3F2CA 2JA6H 2Z6KA 4C1NK 3OWEB 1Q82C 2F0KA 3PV0A 1NCVA 4LF7L 1HZBA 4U673 1AE2A 1TY0A 1Q86C 5C3EG 1MI2A 1JQYD 2UXCL 5CR3A 1NR2A 4EVOA 3WDNA 5ELOA 2NUCA 3VR3A 4DK3C 1STGA 4Q5VA 4HMIA 3I7FA 2HHHL 2BE5D 4IUNA 1LTAD 4DR4L 4DV1L 4DR2L 1T9HA 3Q23A 1FYCA 1NY4A 1LUZA 3PCOB 3RZDB 1Z9FA 2GVAA 1HA6A 2JN4A 1VQ7A 5LMNW 4R8IA 4NB3A 4B9XA 1FNWA 3J7A5 1Q8IA 3NBIA 4I65A 1ENAA 4RGNA 3H15A 1KDCA 2A68C 4DV7L 4OIKA 1K8AC 1WTVA 2NN6H 3HRZC 3K7AB 1B8AA 3J80E 5LHY1 5C44G 4RG1A 1KHIA 3NENA 5CC4A 1EWIA 5KRUA 4JI0L 3GTPB 1UE6A 1CHPD 1TS4A 1HHVA 2WKDA 3PUXA 1JWSD 4X3TA 4A3LH 4NP5A 4IOAA 2EYOA 4DNRB 4U68A 1PH2A 4B3TL 2A19A 4JOIA 4A3JH 3T13A 2XWBB 3GTJH 2UUCQ 1Z7TA 4IFDG 1HFGA 4RMFA 4RGOS 1BBXC 4X65Q 5C44B 2HQEA 3MC0B 2J7ZA 1KLGD 2I5LX 4ZAIA 2L11A 1W3SA 3S2HB 3U9SA 5HURA 3OTOL 1B7YB 1GUGA 5D65A 2A8VA 3R2TA 1YIJA 4A3FG 2EY6A 1SN8A 4FO2A 5GAEC 3GTLB 3T53B 4OX9Q 4A75A 4A3BB 5I4DA 2NB0A 1S5DD 1QVFA 2VUMB 4Z9CB 1I5FA 5E7NA 1KTKA 1K0SA 3K8AA 2ZXRA 1D8LA 1SNOA 2HIVA 4GN4B 1H9MA 3M3YH 5IGCA 1H95A 4LJZC 2LY7A 3SR1A 1D5XC 1K83B 3TP7A 2OWOA 2VL6A 4E6IA 1SYEA 2PQAA 2YTXA 1IW7D 1EY8A 1ASZA 1CSPA 4NDXA 1BO0A 5M5XH 3GTMH 2IWHA 1X65A 1EYCA 3S17H 1VQJA 1LT6D 1MIUA 2I07B 1CQVA 2L5TA 3CCMA 1SRUA 4IOCA 4DV1Q 4DR2Q 4PMCA 4X3KA 3NBHA 3P20A 3KYHC 1I94Q 2E2JH 4DV6Q 4JI2Q 2A6EC 3CXCA 1H9SA 2D5DA 4CJ2C 4DR7L 1HR0Q 4NXNQ 5CV9A 1EQRA 3PIOA 2UUCL 1K8OA 1E1OA 4DV5L 4BXXH 5M9OA 4RGMA 1MJEA 3OTOQ 1X9NA 4BS9A 4YCUA 2QDBA 1RDPD 4OELB 4WJWA 5J22A 1B4OA 3K7UC 1SNPA 4OX9L 4R4OA 2LFNA 3NBHB 2JA5H 3I70A 1XNQL 2X6GA 1HR0W 1PHJA 1XNQQ 1SYBA 3S1QB 1TWHH 1TWHB 2F03A 2EVBA 2B2TA 1WD0A 3S2DH 4OO1H 4NXML 1E22A 2JP1A 3NK9A 4R4CA 4X6AH 3E9IA 4JBWA 1YI2A 3D4RA 1XXGA 3FPUB 3U9OA 3MTSA 2N88A 2WP8J 4LF6Q 1RKNA 2IT1A 3HOYB 1J5EQ 2Z1CA 4PZ6A 2KEDA 3CC2A 1L1OB 1YITA 5FLXc 5A2QL 5JPMC 3H0GH 3UI2A 3H3VC 3I4NG 5E4XA 2CFMA 3L3OC 3H09A 4DV3L 4KHZA 3L0OA 4RFBA 3UE0A 1S3OA 2PPBC 3A5ZB 4BBRB 1I4GA 2JJQA 1EYAA 1O80A 4HTHA 5LL6X 2BOSA 1SMYD 3EJIA 1ZYRD 4KLKA 1YNXA 2NWGA 1SEBD 2JEAI 4YCVA 3KOJA 5I9OA 3CMAA 3P75A 4C3IB 2NN6I 3HGBA 5EJWA 4PV1C 4QQBX 2B2VA 4R4QA 3HOZG 3GO5A 1IYJB 1ET6A 2VB3X 4A3CH 1Q90A 3OW7A 4KHVA 1KRSA 2ZJRA 1EZ6A 1EWCA 1IXRA 4ZQ3A 4YWMA 1JCKB 3VYTA 1GHKA 1EIYB 3D6WA 5C4XH 4K0KQ 5C4XB 1PFMA 3A55A 3SXHA 1AEXA 1YEZA 5M3MH 1TS3A 3HP3A 4BA2I 2B2VC 2F0UA 2RF4A 5G3LD 4HMJA 2D9UA 4UP8A 4B3SL 3HOXB 2F0EA 2V4DA 1YHAA 4MZ9A 1PXUA 1VQ5A 4ZRZA 2KOLA 3IAYA 1TWFB 5AJ3Q 1BCPF 1B9NA 4JCVE 2DJGC 3OOCA 1N9WA 1JJGA 2F0NA 1NR4A 5C4ZA 4GLAC 1NAPA 4ZK9B 1YNJD 1RODA 2E75C 4QY7A 4A3DG 4KKUA 2FINB 1PTOD 1PTOB 1JORA 1KLUD 1K3RA 1BOSA 1KAAA 4L5TA 2JYOA 2QEXA 5COYA 2JA8H 2A69D 2H1EA 4RHSA 2C5CA 2I5MX 5CMDA 4K5WA 4PMBA 3CC7A 1IBML 2E8GA 1GVPA 2EOTA 2K75A 4NMZA 1OO9B 1STBA 2GVBA 1J5EL 3S16H 1DD2A 4RKBA 1X3FA 2HCCA 5EGTA 4O42A 1I4RA 3IKJA 3ULLA 1LV9A 2XVSA 1KD1C 2H5XA 5M5WH 1JWMD 2YV5A 5FJ8H 1BF4A 3A7LA 1MBYA 3I8ZA 1HNWQ 1BNZA 2NBFA 1HNXQ 4JYAL 5LMNL 1KC8C 5K36H 2AKWB 4ILWA 1FGUA 3CPWA 4NPSA 3FP9A 4WJ4A 4TQUS 2CVRA 5JJKA 1GUOA 3ZJYC 2R7DA 2SOBA 5G3LF 5LMNQ 3JAME 1KNAA 1C9OA 3B6YA 2KCCA 5IGBA 3CQZH 3I3CA 3J81c 1G2SA 4MNOA 1B53A 5IIFA 4R4TA 3CAMA 2G5DA 4UP7A 4BBRG 1HNWL 1MGSA 1NJIC 1PRTC 1VQEA 2MP1A 3JAML 2EJMA 2K7VA 3KLRA 2BA0A 3TP5A 3JAMi 4C1NI 3HOVG 3J81E 2MQHA 5ELBA 1BVSA 2XTIA 5GAHC 2VQEQ 4MTKA 4I7AA 3HOZB 1W2BA 4UPAA 3J7AF 3KDFB 4XIGS 4LFAL 1RCVD 1V1OA 3IRBA 3R8BA 3SGIA 4IPHA 1LT3D 3BVMA 3BVGA 1OTCA 2EJFC 5C4JH 4DAYB 1PZID 3RR5A 4QUCA 4DAVA 3MVVA 5M5YB 3GTPH 1LTSD 5IYBG 2QKIC 4YY3Q 2PO4A 1TS5A 1EL0A 1R9TH 4YHHL 2DY8A 5FLMG 3URYA 3HS0C 4KK7A 5CV6A 1PH6A 2WAQE 2Z8LA 5GADC 3CMEA 4DR5L 2UUBQ 3HOUH 2MFIA 4GOPA 1PH1A 2E2IB 4DV7Q 2NVQB 2ASBA 3RN5A 4A3IG 5IY0A 4N9PA 4WFN3 4IFDI 4F7XA 3F8TA 5IOCA 3UDFA 1SE8A 2K5HA 3V05A 4DUZQ 3W1BA 4UHVA 4LNQA 2PMZE 1FNVA 2CHBD 3S1NB 4M1UB 1VF5C 2F52A 1LT4D 2XRSD 4C3HB 1EY0A 2PCFB 2WB1B 1KRTA 4K6DA 2O5IC 1IBKQ 1CTMA 1KDBA 5EBDA 4M8AA 4HJ5A 4DR3Q 2BDOA 5KGUA 3R3OA 3BZDB 4L8JA 1VQ9A 2B29A 4HIDA 4GLXA 4XDXA 2KA7A 3I4MB 5IYDG 4GZYC 3CCVA 1X3PA 3IFTA 3M4YA 1CKNA 3OWFA 4CGYB 1O78A 3NSWA 5CV7A 2Y0SB 2QEJC 3NQTA 3QB3A 5E3FA 3F1ZA 1QZGA 5M3MB 1PTOH 5GQOA 1VQOA 3DWQA 3S1RH 5IGGA 3BYYB 1JR0D 1QNUA 1VQBA 1J8IA 2A69C 3A8JE 2IX0A 4QB4A 1PH4A 1FL0A 5IODA 5D3DA 3S16B 3PQIA 2K14A 3PUVA 1EYGA 1PH3A 3T1HQ 1KABA 3HOYG 3I4MG 5IYDH 1ML0D 1XTCD 2PI2E 2AHOB 3QOJA 4JOIC 1T5EA 5E4WC 5M3MG 1F9RA 2JA7H 2JA9A 4LUZA 3DWAA 3BG3A 2OCEA 1ICFB 2ID0A 4LF4L 2Z4HA 2CKZB 2JQOA 4LF4Q 1VQHA 4ID6A 1EIHA 2VB2X 1YBYA 2DJFC 1YNJC 4A93G 4LF5Q 4HIMA 3I4NH 1FVIA 2N49A 2K4KA 4GKKQ 2I46A 4G7OC 2UUBL 2AQ2B 4QF4A 2RVLA 2M2LA 2A1AA 3QO2A 2JK8A 1L0YB 1L0WA 2MGSA 3HOYH 1ZEQX 2PZWA 2EY1A 3HZXA 2Q2IA 4AH6A 1PFSA 4S3SA 2KBNA 3VR6A 1A3VA 1GUWA 2E2HH 1L0XB 3GTKH 1CSQA 5IP7G 5JJZA 1NTGA 3F2DA 1XX8A 2RKSA 2XNAC 1TXYA 2PZTA 2F0JA 1G6PA 2H4OA 4EGVA 2F0DA 1GM5A 1SBBB 5FJ8G 5ELFA 3X3MA 4ME5A 4QMGA 4A3KG 5K36G 2WINB 4FF3A 5C5LA 1IHZA 4JI1L 2EYMA 2B2YA 1UNSA 3FDTA 4K2LA 2GA4B 4A3GG 2F0IA 1Y1VH 5C4HA 4IUVA 5IYCG 5AFWA 3J81i 3CD6A 1ESFA 3L9AX 3CP0A 1K8MA 1KAWA 4K14A 5CORA 2IHFA 4DV2L 4IUUA 2F4VL 1GKHA 3CHBD 4JYAQ 5D14A 4JVZA 2AUKA 5CV4A 4LF9L 1HXYD 1WTXA 4A3FH 4DV0L 4MIUA 4O2DA 3RMHA 3J7ZC 1N34L 1JJCB 1MSGA 3FEWX 4O0AA 1WTQA 2IL8A 2UUAL 4FYDA 3KLSA 3DMUA 2IPKD 5ELNA 3E9HA 1II3A 1CM9A 4LAAA 2K5QA 3KJOA 1IL2A 1YNNC 4BY1G 4AYBB 3ZYYX 5M3FB 1YJ9A 3L2PA 4JI4Q 3K5OA 2CQOA 2AUJD 1BCPD 1BCPB 1ZKOA 2EE1A 3PO2G 4GKKL 2KHSA 3ERQA 5FLXE 3TREA 1EOTA 3A56A 4A4IA 3NP8A 3TBIB 4IUPA 1EIFA 2PQAB 2PNRC 2A73B 1SNDA 5C44H 1E3PA 5I6WA 2CWPA 4CJ0B 4O1NA 2IX3A 1JB3A 3EA6A 3SDZA 3S2HH 3NELA 2VY3A 2O2LD 2B63G 1KNEA 3S9WA 4XT1B 4OONA 3I90A 5EPJA 2PYKA 3BZCA 4PZ8A 3PO2B 3HOUG 3M3YB 1WFQA 4V0BA 2K04A 3RD4A 2RA4A 2WIIB 2R3ZA 5EAYA 3TP6A 1F9QA 3G4SA 3ULJA 1CA6A 3NQIA 3TZDA 4F88A 5J1ZA 5KNBA 4QCLA 5C3EH 4P2CB 3CCSA 3AB9A 4CKBA 2NTTA 4KHPL 5IGEA 4ULLA 1DONA 4ABNA 4OXPA 4IO9A 3FKIG 4LF6L 2FFKB 2K5WA 1AZPA 3A74A 2HQLA 4IZ8A 5LL6S 1CKNB 1S4ZA 1E1TA 2F3VA 3MHBA 4IFDJ 1K0RA 2GN5A 3CQZB 3KLWA 2J4XA 4HN7A 2OXPA 2EJGC 1D5MC 1RTOA 2MHVA 1I50H 3RUZA 4MTNA 4CHTB 4TRDA 3VR4A 2F3WA 4JI3L 3MXGA 3GTGB 1IKLA 1VMPA 2NN6G 2R7ZH 2FMMA 1HNXL 2ZJQA 5FKAC 1T5XD 3JC66 4DV5Q 3M7NA 1Q46A 1VMCA 3DXJC 3P1HA 2B2WC 3J7AV 4J1MA 2QILA 1X54A 1FJGQ 4OWWB 3M4PA 4OO1I 2PQEA 4DV0Q 5CBEE 1LLRD 4YCWA 3PUYA 4KKTA 2JA5B 1D5ZC 5JJLA 1QWYA 1YNND 3CW2C 5LMUQ 2E5LQ 2ZM6Q 4RH6A 4C3IG 1I6HH 4JI8L 3PO3B 2KQ3A 2PNHA 2MO1A 3HFZB 2I5HA 3I4LA 1KIXA 3SK5A 4BBRH 2ZTCA 3NTIA 3G7LA 1MSHA 1VQIA 2JA7G 2RDGA 5IP9G 4HIKA 2AQ3B 4P72A 1EOVA 5DNFA 2B2UA 2IW3A 1XTDA 4A93H 1VF7A 4OHJA 1PLFA 3X3NA 1FR3A 1VQAA 1HZ9A 1AN8A 2PW5A 4YIJA 5KNDA 1NBWA 3DEPA 1UEAB 3CRKC 2F0MA 3Q0AA 1NUCA 2F3IA 1Y1WH 4B08A 4OO1G 4KI0A 1QCBD 5BN3A 5ISRA 1E24A 1D7QA 1F2LA 1TR5A 2HD3A 4BY7H 3TSSA 3TQYA 1PRTF 4RGTA 3WOFA 4A3JB 4KD3A 3MAQA 1H9SB 3C3LA 4H13C 2MPMA 4N8X1 1PTOC 1HUMA 1M8AA 1HTLD 1ZYRC 2WACA 3VA5A 2R92H 2NVQH 2B2UC 2L15A 1OXTA 4OEMB 3JAMc 4K2KA 1E0BA 4XT3B 2AWOA 4A3IH 3GD7A 1L1OC 2ZTEA 2F0VA 1CI3M 2VQFL 3QIAA 1F2ZA 2OT2A 3EFXD 3GTMB 5C0XI 1E2VA 1YHQA 5HGTA 4EQOA 4DK0A 1LYLA 1SE4A 3PUZA 2VQEL 5IYCH 1TQOA 1K9MC 3M7GA 2R7FA 5KNCA 2NVYH 2Z6BA 4DAPA 4DR3L 5JOBA 4L6TB 1B70B 2UXBQ 4FF1A 5JJIA 1N36L 1GOZA 2OTJA 4DGZA 1G91A 3S24A 4Y7NB 1N32L 4IURA 5M3FH 2F0SA 2R92G 2K5DA 1R4PB 3EQLC 4A3CG 3FMCA 3KLSX 3WOEA 2A68D 3T56B 5C3EB 1H9KA 4ZLTF 3PF4A 4ZUJA 5JVG3 4DR1Q 3HOVB 2B2WA 4ZKCB 2KUMA 3CC4A 5GROA 3L7ZC 3G48A 2F0HA 3MEHA 4AQYL 2VW9A 3BJUA 4JI5Q 4R1JA 1AH9A 5CV8A 1VQMA 1TWCH 3NHHA 1FNUA 2A6ED 2WKCA 2Y0SG 5FO9B 3S1RB 1DM0B 1BCPC 1AP0A 3E5SA 1U9RA 3SEBA 1WTOA 3PO2H 3CRLC 1J6QA 3PO3G 4DUZL 2Z0SA 4FXDA 3CCQA 1JJ2A 3J7YW 3RZOH 1I4PA 2X6LA 5C0XG 1E2ZA 1CHQD 4IALA 2ZXOA 2UU9L 2B8FA 1V1PB 3MXUA 1DXMA 4B3ML 4NKLA 2J0TD 3GTGH 2C9OA 3DM1A 4L63B 2E76C 5DEHA 4J15A 1H9RA 3T1YQ 1XNRL 1F2MA 1HZAA 2EXDA 4ME3A 2X69A 1P16A 2AQ1B 4FXGC 2FHTA 1D1IA 1K8GA 1S5BD 4CKEA 1A62A 3NE5B 1EFID 2JA6B 4DN4M 4X64Q 1MHWC 2XWJB 1ENFA 1XPRA 3I72A 3PO3H 4X64L 5L37A 2F0GA 2OEOA 3I55A 3CCEA 4C3JB 4B3MQ 3MZ5A 1A3UA 2K1BA 1O7LA 2EY5A 4IQZA 1CZWA 1ICWA 1YJWA 4LFAQ 2LXJA 3N6RA 2XRQD 1QNKA 2Q2UA 5I6YA 3PUWA 2MNAA 5IYBH 4A3BG 2HHHQ 4A3LG 4OGQC 4H7BA 3SK4A 2BH8A 3BU2A 3W3AA 4DV4Q 4FXKC 1PA6A 3GTQB 3ND8A 3QOLA 1IBKL 2HIXA 4C3JG 1WD1A 1VQ4A 2EYLA 4HJ9A 2CCZA 5IGFA 3BDOA 1PH5A 2OQ0A 1CK1A 2WB1G 3MFGA 2OTLA 3I56A 3U4VA 1HQMC 1I94L 3HG9A 3STBD 2IHEA 3K7AH 4IJLA 5FO7B 2QCPX 2ZTDA 4JK1C 2F0WA 3PIPA 3T1HL 5C4JB 4AQYQ 4NW2A 1EY9A 2ZXPA 4DKAC 1XPOA 3HOWB 1GJXA 4RAUC 2LXKA 4UY8C 2B63H 3LWEA 2DN8A 5NUCA 1LO5D 1PZKD 4R4IA 2PI2A 1JOKA 1Y1VB 1BBWA 4LF8Q 3TS0A 3J80L 4YWLA 4GKJQ 1EY6A 4QIWE 2NZ1D 1SXTA 4BBSB 4XTCS 1EY7A 4C3IH 1Q1EA 4F8MA 1IW7C 2F0FA 2F0LA 2ZT9C 2VNUD 1RF2D 5IT9L 2K5NA 2KJXA 1CUKA 5ELEA 1U4MA 4NXNL 1HR0L 4PNYA 3GV6A 5BN4A 3M4QA 4CDEC 1L1OA 2ICEC 1LACA 1TVXA 1GHJA 1MKHA 4LFBQ 5CYUA 2PW7A 3I4OA 4AIMA 1EZ8A 2HT1A 4LFBL 2OF1A 4EX5A 1DJRD 4KV6A 3ER0A 3D31A 4CDFC 3J80c 4LF5L 1RIPA 3S15H 3GTOH 3NWSA 4GN5A 4BY1H 4RCNA 3S15B 5TSSA 2OQKA 3T1YL 1XNRQ 3HOXH 2NZHA 4C3HH 3PGZA 1MD2D 2CW0C 2MJ8A 3GDEA 4IFDH 3VA7A 1X32A 1I4QA 1Y1WG 3TMEA 4XQQA 4OWXB 4FNFA 2BCOA 4P71A 4K5VA 2A6HD 4MN3A 3I4MH 1LM0A 1GD7A 1WI5A 1VDZA 4APVA 3PIP3 3KDFA 1N33L 2NVXB 2HCIA 3HOVH 1J9OA 1STEA 4K8JA 4DV2Q 2KCTA 2UUAQ 3H6MA 1LABA 4DAYA 4LF8L 1NMFA 1TU2B 3LGJA 2L9HA 3C46A 1VQCA 1XYIA 4HEDA 2K05A 1CT1D 4OL7A 4DK1A 1WYDA 1LT5D 2B8GA 4H02A 1W6JA 2K32A 1ZXTA 2K03A 1X3GA 4XQNA 3IL8A 2NTSA 3ITPA 1STAA 3K81C 4CDDC 5KEEA 1TS2A 3M4OB 4TVAB 1QVGA 1E2WA 4K5XA 3FKIB 3RLOA 1PV4A 4DXFA 2QDLA 2ZM6L 4CBVA 2M9VA 2FMCA 2VXWA 1Y8NB 4A3GB 1DZ1A 3MXNA 2Q8IB 3M85A 4XYQA 5CBAE 3A54A 2BA1A 3KUPA 4Q0FA 3OW2A 1F2YA 2FXQA 2XGTA 1GO3E 2N78A 1XWEA 4JI4L 3EBEA 3BZKA 1WCMB 1TIID 2LS01 4CDCC 1FJGL 5D3IB 2FJ2A 1Y1VG 2RCNA 4LK1C 4MHEA 3RZDH 4GNXB 2N55A 1F9PA 5IGDA 4NXMQ 4QGUA 1QILA 2Q2TA 1HNZQ 4DPGA 3NEMA 4JI6Q 1I3QH 1FGBD 5AJ3L 4HAEA 2DNCA 3HOZH 4KN7C 4F87A 5ELCA 1Q7YC 3UE1A 4G7ZC 3MFYA 2NVTB 4Y52H 2NVTH 1ET9A 5DM73 3QR8A 1EQQA 4DV6L 4RWSC 4L5QA 3SK6A 1U4PA 1TT2A 3LX0A 1BKBA 4KJNA 3K58A 2B2TC 1HJPA 3G71A 1PRTD 1PRTB 4QUFA 2BE5C 3V96A 4DR7Q 5FO8B 3NXWA 2VZAA 1YVCA
chains in the Genus database with same CATH topology
2R92B 2B63B 2G9HD 2WAQB 3I73A 1V8QA 3GTJB 1S5CD 4QIWB 5EKKA 3K5LA 4A3IB 1QOHA 1OXUA 3CKIB 1RHPA 3N52A 3ONAB 2EY2A 5JEAJ 1BQQT 3Q22A 4BWGB 3Q6SA 4TKOB 1B9MA 4G4KA 5A35A 3D6CA 2B39A 3NTKA 4BA1I 3R93A 4DA2A 4PMWA 3OHXC 4BY1B 2WV6D 5BN5A 2O4XA 5C0XJ 4WRDA 5IT9E 3AU7A 4IUQA 2TMPA 4CKCA 5JEAH 3E6ZX 3S1MB 1SNMA 1SE2A 4KJOA 1PMRA 1S5ED 3CU7A 2JSOA 4C2MB 1EIGA 3I4NB 4HCSA 3KBXA 1GUSA 4RA8A 3SVMA 3GTOB 5E1FA 2IJ0A 4A3EB 4H0LC 3TZUA 4J8QA 1RJTA 2L0CA 1BR9A 2KECA 3OPOA 1JC7A 3VR2A 1LTID 1Y8OB 1JWUD 3J81L 2EPBA 3FPPA 1U4RA 1OXSC 3Q24A 4I7ZC 1EQVA 5JPNC 3BVZA 1QJOA 2B2YC 1S5FD 2RDFA 3GV3A 1IYVA 4A3DB 3DEOA 2E2HB 1BXTA 1HQRD 5EKLA 3KBGA 1AZQA 4OIJA 1JE4A 2HDLA 4A3MB 2LKVA 1G291 2Q8RE 4TSSA 2EZVA 1R4QB 2D2CC 2D62A 1ONLA 3NTHA 3EROA 4C56C 2EYPA 2KVMA 1GUTA 1DCZA 2A5HA 3NPPA 2R61A 1DOMA 1HTPA 3C1EA 3OMCA 3HOUB 2E74C 1PFNA 1A2UA 2Q8TA 3OSOA 4N9TA 1Y1WB 3QJYA 1V43A 5KYLA 2KCNA 2CW0D 4A3FB 4BY7B 4KY7A 2RBMA 3T51B 2IX1A 1Q1BA 3GP7A 4XXEA 1EY5A 1FD7D 3KF8A 3K6OA 1OXVA 1CQFA 1SYCA 1CZGA 2SNMA 1VCIA 5FK9C 3EVQA 1F77A 3NWTA 4FVMA 2PZUA 2L1BA 3OMGA 5EBCA 2JE6I 4IUTA 3BDLA 1SJHD 2NVYB 2DY7A 1IKMA 1D6EC 3VYUA 4R8NA 3VYRA 1D2BA 2E2JB 3A8IE 3S14B 3D3RA 2SEBD 3RLFA 1PZJD 1Q3LA 3TP8A 1I6VC 2RSOA 1QE6A 3C1FA 2F0TA 2JA7B 3IFDA 1RD9D 3S17B 1SMYC 2MUYA 1I4HA 3NUCA 2KEEA 3K57A 4HR7B 3BS1A 1TWCB 1A2TA 1I50B 2R7ZB 3LNNA 1SYDA 3BDCA 5F2DA 1JICA 1ENCA 2F0OA 2Z4IA 3T16A 1ESRA 1B50A 1B2TA 2EYJA 4CJ1B 3AMUA 2RDHA 2F1MA 3OIPA 1I6HB 3H0GB 4IN3A 1SAPA 1BUVT 5I2YA 5C0XH 1DOLA 1C4QA 2F4IA 2XN9C 5J39A 2XIWA 3R2IA 2TSSA 3H91A 1PFBA 3VYSA 3K5MA 1R9TB 2RQXA 3DUZA 3OIQA 3E0JA 4A93B 3W2DA 1EYDA 5DAUA 4KN4C 3VR5A 3A7AB 1WTRA 4V190 1ILPA 2O5JC 1Z47A 1GUNA 1SNQA 5A2QE 2JEBI 2K33A 4WORA 5C5MA 3MXPA 5EPLA 4RCOA 1STHA 4KD4A 3SE0A 1AW7A 2AWNA 2SDFA 3DWPA 3QWNA 4C3HG 1G8ZD 2ENBA 1W6KA 1A6XA 1WTPA 1U4LA 1TY2A 3PIO3 1UAPA 1Y69U 2K28A 1STNA 4DFAA 3K59A 5C3WA 3I91A 1UUPA 2L55A 4XQJA 1TKWB 2EYHA 1SYFA 2JA8B 1D1KA 1G6ZA 5ELDA 5M5WB 2A74C 3A8KE 3HKZB 2CQAA 1HA5A 5JAVA 3TN2A 1SDFA 1DOKA 2L12A 4R9WA 4KY6A 1PTOF 5T1GA 2YU9B 3ND9A 2F0PA 2R93B 1SNCA 5C3XA 4ODGA 4G7HC 1A3TA 1B3AA 1O7ZA 2RSNA 4DU9A 1STYA 4G57A 1C8CA 1BDOA 4DXGA 1O7YA 1CA5A 1B1ZA 1DYQA 1TWAB 3FVQA 3MWYW 1KDAA 3D4DA 5K5PA 4FF4A 2K01A 4FF2A 3G6JB 3C2PA 4X3UA 1IYUA 4HCEA 2QF7A 3GQBA 5C6AA 2JXMB 1SYGA 4RHRA 4UDUC 1JOQA 3KK7A 4KY5A 1SSOA 2F0QA 5FLXL 5FOBB 3S2DB 5KYIA 4X3SA 1HPCA 1EEFD 3K5NA 3SK8A 1H9JA 5EKIA 2R6GA 3P7JA 1LTRD 3H94A 3D8GA 3PMFA 1LTBD 1WTWA 1RTNA 2SNSA 1I3QB 1HUNA 1HCZA 1SE3A 1V1PA 2EXZA 1X3QA 1SJED 3O13A 1F9SA 1IL8A 3GTKB 1JOOA 2ICIA 4K8IA 4FP5D 1QG7A 1ILQA 1M4VA 1EU3A 1A15A 5EPKA 1LTGD 4J6HA 3D4WA 5DM63 3V2TA 3BYTB 5CV5A 1Y8PB 2G9DA 2YYZA 5EQ0A 2L4NA 1Z6HA 1EY4A 1PYWD 4DNTB 1WVLA 2HDMA 5T1IA 2K6AA 5KIXA 4A3KB 4PQXA 4EQPA 3LWUA 3DHQA 4KMUC 1GXDC 2PMZB 2DNEA 5CGKA 4LMQD 1EWHA 2BDNA 3SHLA 4UAIA 5I2XA 2XSCA 1SFOB 1LTTD 1EQTA 4B9WA 1I4XA 2EDGA 4K6LA 2E2DC 1OXXK 1CFMA 4ZKBB 2NYZD 5M5XB 1EU4A 1AFPA 4RKLA 3FRPB 1HFNA 4KTAA 2EYFA 4EQNA 3K0YA 1B44D 1TWGB 3RZOB 3QG1A 3HEJA 4DF7A 5JEAG 3F2UA 3T4AC 1G2TA 2HUGA 4HSVA 4ZUIA 1HRJA 4KKSA 5I9PA 1C48A 2LMCB 1Q12A 3TDQA 4HSPA 2M00A 1PDQA 4ZYSA 1QB5D 4H44C 3MA2B 2A6HC 1NSNS 4XYOA 5JVH3 1EEID 4C1NK 3OWEB 2F0KA 3PV0A 1NCVA 4U673 1TY0A 1MI2A 1JQYD 5CR3A 1NR2A 4EVOA 3WDNA 2NUCA 3VR3A 1STGA 4Q5VA 4HMIA 2BE5D 4IUNA 1LTAD 3Q23A 1FYCA 3RZDB 1HA6A 4R8IA 4B9XA 1FNWA 1Q8IA 3NBIA 4I65A 1ENAA 4RGNA 1KDCA 2A68C 4OIKA 1WTVA 2NN6H 3HRZC 3K7AB 3J80E 5LHY1 5CC4A 5KRUA 3GTPB 1CHPD 1TS4A 1HHVA 2WKDA 3PUXA 1JWSD 4X3TA 4NP5A 2EYOA 4DNRB 4U68A 3T13A 2XWBB 1Z7TA 4IFDG 1HFGA 4RGOS 1BBXC 5C44B 2HQEA 3MC0B 2J7ZA 1KLGD 4ZAIA 2L11A 3S2HB 3U9SA 5HURA 1GUGA 5D65A 3R2TA 2EY6A 4FO2A 3GTLB 3T53B 4A3BB 5I4DA 2NB0A 1S5DD 2VUMB 4Z9CB 1KTKA 2ZXRA 1SNOA 1H9MA 5IGCA 4LJZC 2LY7A 3SR1A 1D5XC 1K83B 3TP7A 4E6IA 1SYEA 1IW7D 1EY8A 4NDXA 1BO0A 2IWHA 1EYCA 1LT6D 2I07B 1CQVA 2L5TA 4PMCA 4X3KA 3NBHA 3P20A 2A6EC 1H9SA 2D5DA 4CJ2C 5CV9A 1K8OA 5M9OA 4RGMA 4BS9A 2QDBA 1RDPD 4WJWA 5J22A 1B4OA 1SNPA 2LFNA 3I70A 2X6GA 3S1QB 1SYBA 1TWHB 2F03A 2EVBA 2B2TA 1WD0A 4OO1H 2JP1A 3NK9A 4JBWA 3D4RA 1XXGA 3FPUB 3U9OA 3MTSA 2N88A 2WP8J 1RKNA 2IT1A 3HOYB 2Z1CA 2KEDA 5A2QL 5JPMC 3UI2A 3H3VC 5E4XA 3L3OC 3H09A 4KHZA 4RFBA 2PPBC 4BBRB 1I4GA 1EYAA 1O80A 4HTHA 5LL6X 2BOSA 1SMYD 3EJIA 1ZYRD 2NWGA 2JEAI 1SEBD 5I9OA 3P75A 4C3IB 2NN6I 3HGBA 5EJWA 4PV1C 2B2VA 3GO5A 1ET6A 2VB3X 1Q90A 3OW7A 4KHVA 1EZ6A 1EWCA 4ZQ3A 1JCKB 3VYTA 1GHKA 3D6WA 5C4XB 1PFMA 3A55A 3SXHA 1AEXA 1TS3A 3HP3A 4BA2I 2B2VC 2F0UA 5G3LD 4HMJA 2D9UA 3HOXB 2F0EA 2V4DA 1PXUA 4ZRZA 2KOLA 3IAYA 1TWFB 1BCPF 1B9NA 3OOCA 2F0NA 1NR4A 5C4ZA 1NAPA 4ZK9B 1YNJD 1RODA 2E75C 4KKUA 2FINB 1PTOD 1PTOB 1JORA 1KLUD 1BOSA 1KAAA 2JYOA 5COYA 2A69D 2H1EA 4RHSA 2C5CA 5CMDA 4K5WA 4PMBA 2EOTA 4NMZA 1OO9B 1STBA 1DD2A 4RKBA 2HCCA 5EGTA 4O42A 1I4RA 3IKJA 1LV9A 2XVSA 1JWMD 1BF4A 3A7LA 1MBYA 3I8ZA 1BNZA 2NBFA 5K36H 4ILWA 4TQUS 2CVRA 1GUOA 2SOBA 5G3LF 3JAME 1KNAA 2KCCA 5IGBA 3I3CA 1G2SA 1B53A 5IIFA 1MGSA 1PRTC 2MP1A 3JAML 2EJMA 2K7VA 3KLRA 2BA0A 3TP5A 4C1NI 3J81E 5ELBA 3HOZB 3J7AF 4XIGS 1RCVD 1V1OA 3R8BA 1LT3D 3BVMA 3BVGA 2EJFC 1PZID 4QUCA 4DAVA 3MVVA 5M5YB 1LTSD 2QKIC 2PO4A 1TS5A 1EL0A 2DY8A 3URYA 3HS0C 4KK7A 5CV6A 2Z8LA 2E2IB 2NVQB 4N9PA 4WFN3 4IFDI 4F7XA 5IOCA 3V05A 1FNVA 2CHBD 3S1NB 4M1UB 1VF5C 1LT4D 2XRSD 4C3HB 1EY0A 2PCFB 2WB1B 4K6DA 2O5IC 1CTMA 1KDBA 5EBDA 4M8AA 2BDOA 5KGUA 3R3OA 3BZDB 4L8JA 4XDXA 2KA7A 3I4MB 4GZYC 1X3PA 3IFTA 3M4YA 4CGYB 3OWFA 1O78A 3NSWA 5CV7A 2Y0SB 2QEJC 3NQTA 3QB3A 5E3FA 5M3MB 1PTOH 3DWQA 5IGGA 3BYYB 1JR0D 1QNUA 1J8IA 2A69C 3A8JE 2IX0A 4QB4A 5IODA 5D3DA 3S16B 3PUVA 1KABA 1ML0D 1XTCD 3QOJA 5E4WC 1T5EA 1F9RA 3DWAA 3BG3A 2ID0A 2Z4HA 4ID6A 1EIHA 2VB2X 1YNJC 2I46A 4G7OC 2AQ2B 4QF4A 2RVLA 2M2LA 3QO2A 1L0YB 2MGSA 1ZEQX 2PZWA 2EY1A 3HZXA 4S3SA 3VR6A 1A3VA 1GUWA 1L0XB 5JJZA 1XX8A 2RKSA 2XNAC 2PZTA 2F0JA 2H4OA 4EGVA 2F0DA 1SBBB 5ELFA 3X3MA 4ME5A 4QMGA 5K36G 2WINB 4FF3A 5C5LA 1IHZA 2EYMA 2B2YA 1UNSA 3FDTA 4K2LA 2GA4B 2F0IA 5C4HA 4IUVA 5AFWA 1ESFA 3L9AX 1K8MA 4K14A 5CORA 4IUUA 3CHBD 5D14A 2AUKA 5CV4A 1HXYD 1WTXA 4MIUA 3RMHA 1MSGA 1WTQA 3FEWX 2IL8A 4FYDA 3KLSA 3DMUA 2IPKD 1II3A 1CM9A 4LAAA 2K5QA 1YNNC 4AYBB 3ZYYX 5M3FB 3K5OA 2AUJD 1BCPD 1BCPB 1ZKOA 2EE1A 2KHSA 3ERQA 5FLXE 1EOTA 3A56A 3NP8A 3TBIB 4IUPA 2PNRC 2A73B 1SNDA 5I6WA 4CJ0B 4O1NA 2IX3A 1JB3A 3EA6A 3SDZA 2O2LD 1KNEA 3S9WA 4XT1B 3I90A 5EPJA 2PYKA 3PO2B 3M3YB 4V0BA 2K04A 3RD4A 2RA4A 2WIIB 2R3ZA 3TP6A 1F9QA 1CA6A 3NQIA 3TZDA 4F88A 5J1ZA 5KNBA 4QCLA 4P2CB 3AB9A 4CKBA 2NTTA 5IGEA 4ULLA 1DONA 4ABNA 2FFKB 2K5WA 1AZPA 4IZ8A 5LL6S 1S4ZA 3MHBA 2F3VA 4IFDJ 3CQZB 2J4XA 4HN7A 2OXPA 2EJGC 1D5MC 1RTOA 2MHVA 3RUZA 4CHTB 4TRDA 3VR4A 2F3WA 3MXGA 3GTGB 1IKLA 1VMPA 2NN6G 2FMMA 5FKAC 1T5XD 3M7NA 1VMCA 3DXJC 3P1HA 2B2WC 3J7AV 4J1MA 2QILA 4OO1I 2PQEA 5CBEE 1LLRD 3PUYA 4KKTA 2JA5B 1D5ZC 1QWYA 1YNND 4RH6A 4C3IG 3PO3B 2KQ3A 3I4LA 3SK5A 3NTIA 3G7LA 1MSHA 2RDGA 2AQ3B 5DNFA 2B2UA 2IW3A 1VF7A 3X3NA 1PLFA 4OHJA 1FR3A 1AN8A 2PW5A 4YIJA 5KNDA 3DEPA 1UEAB 3CRKC 2F0MA 3Q0AA 1NUCA 4B08A 4OO1G 4KI0A 1QCBD 5BN3A 5ISRA 1F2LA 1TR5A 3TSSA 1PRTF 4RGTA 3WOFA 4A3JB 4KD3A 3MAQA 1H9SB 3C3LA 4H13C 2MPMA 1PTOC 1HUMA 1M8AA 1HTLD 1ZYRC 2WACA 3VA5A 2B2UC 1OXTA 4K2KA 1E0BA 4XT3B 2AWOA 3GD7A 2F0VA 1CI3M 3QIAA 1F2ZA 2OT2A 3EFXD 3GTMB 5C0XI 1E2VA 5HGTA 4EQOA 4DK0A 1SE4A 3PUZA 1TQOA 3M7GA 5KNCA 4DAPA 5JOBA 4L6TB 4FF1A 1GOZA 1G91A 4DGZA 4Y7NB 4IURA 2F0SA 2K5DA 1R4PB 3EQLC 3FMCA 3KLSX 3WOEA 2A68D 3T56B 5C3EB 1H9KA 4ZLTF 4ZUJA 5JVG3 3HOVB 2B2WA 4ZKCB 2KUMA 3L7ZC 2F0HA 3MEHA 5CV8A 3NHHA 1FNUA 2A6ED 2WKCA 5FO9B 3S1RB 1DM0B 1BCPC 1AP0A 3E5SA 1U9RA 3SEBA 1WTOA 3CRLC 4FXDA 3J7YW 1I4PA 2X6LA 5C0XG 1E2ZA 1CHQD 4IALA 2ZXOA 2B8FA 1V1PB 3MXUA 1DXMA 4NKLA 2J0TD 2C9OA 3DM1A 4L63B 2E76C 5DEHA 1H9RA 1F2MA 2X69A 2AQ1B 4FXGC 2FHTA 1D1IA 1S5BD 4CKEA 3NE5B 1EFID 2JA6B 4DN4M 2XWJB 1ENFA 3I72A 2F0GA 2OEOA 4C3JB 3MZ5A 1A3UA 2K1BA 1O7LA 2EY5A 4IQZA 1CZWA 1ICWA 3N6RA 2XRQD 1QNKA 5I6YA 3PUWA 4OGQC 4H7BA 3SK4A 3W3AA 4FXKC 3GTQB 3ND8A 3QOLA 4C3JG 1WD1A 2EYLA 5IGFA 3BDOA 1CK1A 3MFGA 1HQMC 3HG9A 5FO7B 2QCPX 4JK1C 2F0WA 5C4JB 3HOWB 1EY9A 4NW2A 2ZXPA 1GJXA 4RAUC 3LWEA 2DN8A 5NUCA 1LO5D 1PZKD 1JOKA 1Y1VB 3J80L 1EY6A 2NZ1D 1SXTA 4BBSB 4XTCS 1EY7A 1Q1EA 4F8MA 1IW7C 2F0FA 2F0LA 2ZT9C 2VNUD 1RF2D 5IT9L 2KJXA 5ELEA 1U4MA 4PNYA 3GV6A 5BN4A 2ICEC 1LACA 1TVXA 1GHJA 5CYUA 2PW7A 1EZ8A 2OF1A 1DJRD 4KV6A 3D31A 3NWSA 3S15B 4RCNA 5TSSA 1MD2D 2CW0C 2MJ8A 4IFDH 3VA7A 1X32A 1I4QA 3TMEA 4XQQA 4FNFA 2BCOA 4K5VA 2A6HD 4MN3A 1VDZA 3PIP3 2NVXB 2HCIA 1J9OA 1STEA 4K8JA 3H6MA 1LABA 4DAYA 1TU2B 2L9HA 3C46A 1XYIA 4HEDA 2K05A 1CT1D 4OL7A 4DK1A 1LT5D 2B8GA 1W6JA 2K32A 1ZXTA 2K03A 4XQNA 3IL8A 2NTSA 3ITPA 1STAA 5KEEA 1TS2A 3M4OB 1E2WA 4K5XA 3FKIB 4DXFA 4CBVA 2M9VA 2FMCA 2VXWA 1Y8NB 4A3GB 1DZ1A 3MXNA 2Q8IB 3M85A 4XYQA 5CBAE 3A54A 2BA1A 3KUPA 4Q0FA 1F2YA 1XWEA 1WCMB 1TIID 2LS01 5D3IB 2FJ2A 4MHEA 4LK1C 2N55A 1F9PA 5IGDA 1QILA 1FGBD 4HAEA 2DNCA 4KN7C 4F87A 5ELCA 4G7ZC 3MFYA 2NVTB 1ET9A 5DM73 4RWSC 3SK6A 1U4PA 1TT2A 3LX0A 4KJNA 3K58A 2B2TC 1PRTD 1PRTB 4QUFA 2BE5C 3V96A 5FO8B 3NXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CR3 A;  4ODG A;  4NDX A;  5I9O A;  2EY5 A;  4K2L A;  4EVO A;  5IIF A;  2OXP A;  3P75 A;  1A3T A;  4K8J A;  2F0I A;  4K2K A;  2NUC A;  1EYC A;  5KIX A;  5C4H A;  1STG A;  2PZU A;  5EKK A;  4DU9 A;  3H6M A;  3RUZ A;  1STY A;  1SNC A;  4G57 A;  2F0V A;  3OMG A;  1EQV A;  4HMI A;  4F7X A;  5I6Y A;  5KYL A;  4IUN A;  4TRD A;  5C3X A;  2F3W A;  3OWF A;  2EY2 A;  4KHV A;  1F2Z A;  3BDL A;  3TP5 A;  4K14 A;  4PMC A;  5CV7 A;  1EZ6 A;  1KDA A;  1EYD A;  3D4D A;  2RDF A;  3NQT A;  3QB3 A;  4H7B A;  5DAU A;  4ZQ3 A;  5E3F A;  3SK4 A;  4B9X A;  4R8N A;  4OL7 A;  3DHQ A;  4I65 A;  4EQO A;  5HGT A;  5IGG A;  3QOL A;  5IGB A;  5CV4 A;  3D6C A;  3P1H A;  2EYL A;  1TQO A;  5EKL A;  3SXH A;  1ENA A;  1AEX A;  4J1M A;  5CGK A;  1KDC A;  5IGF A;  5JOB A;  5CV9 A;  3ITP A;  1SNQ A;  4QB4 A;  3SHL A;  5IOD A;  4MIU A;  1STA A;  2PQE A;  4WOR A;  5C5M A;  4DGZ A;  5C6A A;  2F0U A;  5KEE A;  3MXP A;  3TP8 A;  4B9W A;  1SYG A;  5K5P A;  2F0S A;  4HMJ A;  4K5X A;  3DMU A;  5M9O A;  1II3 A;  2F0E A;  2LKV A;  1KAB A;  2F0W A;  1STH A;  4LAA A;  2O4X A;  5CC4 A;  4EQP A;  1EY9 A;  2QDB A;  4ZUJ A;  4KD4 A;  5KRU A;  1JOQ A;  3QOJ A;  4KY5 A;  2F0Q A;  4WRD A;  3C1F A;  5J22 A;  2F0T A;  5NUC A;  1SNP A;  2F0N A;  2KQ3 A;  5KYI A;  1JOK A;  4NP5 A;  5C4Z A;  2EYO A;  2F0H A;  1SYB A;  2ENB A;  3MEH A;  3MVV A;  3NUC A;  3ERO A;  1EY6 A;  3SK5 A;  2KHS A;  3ERQ A;  4ID6 A;  3SK8 A;  1F2Y A;  2EYP A;  3T13 A;  1SNM A;  3NP8 A;  1EY7 A;  5CV8 A;  1A2T A;  4KJO A;  1STN A;  4DFA A;  1SND A;  3C1E A;  3OMC A;  3NHH A;  4F8M A;  5CV6 A;  2F0F A;  2F0L A;  3D8G A;  1JOR A;  1SYD A;  3NK9 A;  3PMF A;  1KAA A;  3BDC A;  4RKL A;  5F2D A;  2HQE A;  5I6W A;  3E5S A;  1U9R A;  1ENC A;  2F0O A;  2EYF A;  4KTA A;  4QF4 A;  5C3W A;  4EQN A;  4PNY A;  2SNS A;  3T16 A;  1A2U A;  5HUR A;  3U9O A;  4K5W A;  4PMB A;  3S9W A;  2EXZ A;  3OSO A;  4N9T A;  4N9P A;  5IGD A;  1RKN A;  4NMZ A;  4IAL A;  2EY6 A;  1STB A;  2PZW A;  2EYH A;  2PYK A;  3HEJ A;  2EY1 A;  1JOO A;  2PW5 A;  4YIJ A;  4DF7 A;  5IOC A;  4K8I A;  2PW7 A;  3HZX A;  4RKB A;  1EZ8 A;  5E1F A;  5EGT A;  2OF1 A;  1SYF A;  2EYJ A;  2F0M A;  4NKL A;  4ZUI A;  4KV6 A;  4S3S A;  5I9P A;  1A3V A;  4KY7 A;  1NUC A;  5DEH A;  2M00 A;  2RBM A;  5KGU A;  3TP6 A;  1SNO A;  4J6H A;  3D4W A;  5ISR A;  5J1Z A;  1NSN S;  5IGC A;  1F2M A;  1EY5 A;  2RKS A;  3VA5 A;  5JAV A;  1TR5 A;  3SK6 A;  2PZT A;  2F0J A;  1A3U A;  1EY0 A;  3SR1 A;  1TT2 A;  3V2T A;  3LX0 A;  3TP7 A;  2F0D A;  5IGE A;  5J39 A;  3TME A;  4E6I A;  1EYA A;  1SYE A;  3NXW A;  2F0K A;  4K6D A;  4KD3 A;  5CV5 A;  4KY6 A;  4KJN A;  2SOB A;  4HTH A;  1SYC A;  1KDB A;  4K5V A;  2F0G A;  2OEO A;  2SNM A;  3EJI A;  4ME5 A;  4IZ8 A;  4QMG A;  2WAC A;  1EY4 A;  2F0P A;  2F3V A;  3MHB A;  1EY8 A;  1IHZ A;  3MZ5 A;  2EYM A;  5C5L A;  3EVQ A;  3R3O A; 
#chains in the Genus database with same CATH topology
 2R92 B;  2B63 B;  2G9H D;  2WAQ B;  3I73 A;  1V8Q A;  3GTJ B;  3U50 C;  1S5C D;  4QIW B;  4A76 A;  2RHQ B;  2K5V A;  5EKK A;  3K5L A;  3UDG A;  4A3I B;  1XMQ Q;  4HJA A;  1V9P A;  5HY6 A;  1QOH A;  1OXU A;  3CKI B;  1RHP A;  3N52 A;  3ONA B;  2EY2 A;  1K3B C;  5JEA J;  4X66 L;  1BQQ T;  3Q22 A;  4BWG B;  3TRZ A;  5BR8 L;  3Q6S A;  4TKO B;  1B9M A;  5BR8 Q;  3DM3 A;  4G4K A;  5A35 A;  3D6C A;  4A3B H;  2EIF A;  2B39 A;  3NTK A;  4WJ3 M;  4BA1 I;  4X66 Q;  1N36 Q;  3R93 A;  4DA2 A;  1SFO H;  3M9B A;  4PMW A;  2JA8 G;  3OHX C;  2P5Z X;  1C7Y A;  4GLV B;  4BY1 B;  4P73 A;  2WV6 D;  4LUO A;  2ZJP A;  4AYB E;  5BN5 A;  2O4X A;  5C0X J;  1YHB A;  4JI8 Q;  4WRD A;  5IT9 E;  3AU7 A;  4IUQ A;  3ICE A;  2TMP A;  4CKC A;  1JE5 A;  4DUY L;  5JEA H;  3E6Z X;  3S1M B;  3S1M H;  3ULP A;  1SNM A;  2I0Q A;  2YTV A;  4A3E G;  1SMX A;  1SE2 A;  4KJO A;  2UXB L;  2QA4 A;  1PMR A;  1WJJ A;  1S5E D;  3CU7 A;  2MO0 A;  4JI7 L;  2JSO A;  4C2M B;  1A0I A;  3HKS A;  1EIG A;  3I4N B;  4HCS A;  1M90 C;  3KBX A;  1GUS A;  4RA8 A;  3W1G A;  3SVM A;  3GTO B;  5E1F A;  1UWV A;  3U58 A;  2IJ0 A;  3H3V H;  2R7Z G;  1QZH A;  4A3E B;  4YY3 L;  4N8F A;  4H0L C;  3TZU A;  1JB7 A;  4J8Q A;  1RJT A;  2L0C A;  1BR9 A;  4GKJ L;  3TEH B;  2KEC A;  3OPO A;  4JBM A;  1VS0 A;  1JC7 A;  3CCL A;  3VR2 A;  5IWA L;  2ALY B;  1LTI D;  1UE1 A;  2B3G A;  3FHW A;  1Y8O B;  3KFU A;  3S1Q H;  1JWU D;  3HOX G;  1HH2 P;  3J81 L;  2EPB A;  3UDX A;  2YTY A;  3FPP A;  3J81 j;  3AYH B;  5LMU L;  2E5L L;  4L5R C;  1U4R A;  1OXS C;  2Z9H A;  3Q24 A;  1XJV A;  1VQF A;  4I7Z C;  1EQV A;  5JPN C;  3BVZ A;  2DUD A;  1QJO A;  2B2Y C;  1S5F D;  2QW7 A;  3KJP A;  3HKZ G;  3KF6 A;  2RDF A;  3GV3 A;  1IYV A;  4A3D B;  3DEO A;  2E2H B;  4BBS G;  4DNI A;  1BXT A;  1HQR D;  5EKL A;  3KBG A;  1AZQ A;  4LWC A;  1KL9 A;  4OIJ A;  1JE4 A;  5HGQ A;  4A3J G;  2HDL A;  4P75 A;  4JG2 A;  4A3M B;  2LKV A;  1G29 1;  2Q8R E;  3AFP A;  3RN2 A;  4TSS A;  2EZV A;  1R4Q B;  1N32 Q;  3PSI A;  2D2C C;  3PF5 A;  1G51 A;  1EUJ A;  3KF6 B;  2D62 A;  1ONL A;  2D0P A;  4B3T Q;  3NTH A;  3ERO A;  3HOW H;  4JV5 L;  4C56 C;  2EYP A;  1M1K C;  2KVM A;  4PZ7 A;  1GUT A;  1DCZ A;  2A5H A;  3NPP A;  4DK6 C;  2R61 A;  1DOM A;  1HTP A;  3C1E A;  3OMC A;  3STB C;  5J3B A;  3GTQ H;  3HOU B;  2IY5 B;  2V1C C;  3K80 C;  2E74 C;  1PFN A;  4IJH A;  1A2U A;  2Q8T A;  2DGY A;  1XMO Q;  1U5K A;  3OSO A;  4N9T A;  3QJY A;  4YWK A;  1Y1W B;  1V43 A;  5KYL A;  2KCN A;  3EIV A;  2CW0 D;  4JW0 A;  4LFC Q;  4A3F B;  1VQP A;  4BY7 B;  4KY7 A;  1XMO L;  1UE7 A;  2RBM A;  3T51 B;  5IP9 H;  1B3Q A;  2IX1 A;  1NNX A;  3HOW G;  1Q1B A;  3GP7 A;  4XXE A;  3RNU A;  4DR6 Q;  1EY5 A;  1XPU A;  5FLM H;  1FD7 D;  3KF8 A;  3K6O A;  2Q2H A;  1C0A A;  1VQ8 A;  1O7I A;  1OXV A;  1CQF A;  1SYC A;  1CZG A;  2SNM A;  3A0J A;  1VCI A;  5FK9 C;  1TWF H;  3EVQ A;  1ASY A;  1F77 A;  3AQQ A;  3NWT A;  4FVM A;  2PZU A;  1HNZ L;  2R93 G;  2L1B A;  3OMG A;  2YU9 H;  5EBC A;  1PH8 A;  2JE6 I;  4IUT A;  2KCM A;  3BDL A;  1PYS B;  1SJH D;  4P74 A;  3DLL A;  2NVY B;  2DY7 A;  1IKM A;  1D6E C;  3VYU A;  4YHH Q;  2N3S A;  3CPF A;  4R8N A;  3VYR A;  1D2B A;  2E2J B;  2Y0S E;  2JA5 G;  3A8I E;  1N8R C;  3S14 B;  3D3R A;  3WWV A;  2SEB D;  3RLF A;  1PZJ D;  4DV4 L;  1Q3L A;  4Y7N H;  4L5S A;  3TP8 A;  4LW1 A;  1UEB A;  2D0O A;  3ERS X;  1I6V C;  2RSO A;  4ALP A;  1L2F A;  2R93 H;  1QE6 A;  1PH7 A;  3C1F A;  2F0T A;  1IBL Q;  3IFD A;  2JA7 B;  1RD9 D;  3S17 B;  1SMY C;  2MUY A;  1I4H A;  4JC0 A;  4DR5 Q;  4JI2 L;  3NUC A;  2KEE A;  3UDI A;  3K57 A;  4HR7 B;  3BS1 A;  4JV5 Q;  1QVC A;  2UXD Q;  1TWC B;  1A2T A;  2KHJ A;  1I50 B;  1VQ6 A;  2R7Z B;  3LNN A;  1SYD A;  3E3X A;  3BDC A;  1NMG A;  5F2D A;  1EFW A;  1JIC A;  1ENC A;  2F0O A;  2Z4I A;  3T16 A;  4GOP B;  4JPB W;  4POG A;  1QUQ B;  4A3E H;  1ESR A;  4GNX C;  1WCM H;  4GS3 A;  1B50 A;  3TS2 A;  1B2T A;  2EYJ A;  4QL5 A;  2UXC Q;  4CJ1 B;  3W5O A;  4HJ8 A;  4BXX G;  2QGQ A;  3AMU A;  4JBK A;  2RDH A;  2F1M A;  3OIP A;  1I6H B;  3H0G B;  4X62 Q;  4A3M H;  4IN3 A;  4X62 L;  1SAP A;  3J80 i;  1BUV T;  1N33 Q;  5I2Y A;  5C0X H;  1DOL A;  1C4Q A;  2F4I A;  2XN9 C;  5J39 A;  2K52 A;  2WB1 E;  2XIW A;  3R2I A;  2TSS A;  5M5Y H;  2C35 B;  3H91 A;  1PFB A;  3VYS A;  1WCM G;  4JI1 Q;  3K5M A;  1R9T B;  4KHP Q;  1IBM Q;  1N34 Q;  1X56 A;  2RQX A;  3DUZ A;  3OIQ A;  3E0J A;  1S72 A;  4DAM A;  1QUQ A;  5IP7 H;  4A93 B;  3W2D A;  1EYD A;  1KXL A;  5DAU A;  1K73 C;  4KN4 C;  1UE5 A;  3VR5 A;  4DV3 Q;  2F4V Q;  3A7A B;  1WTR A;  4V19 0;  1X3E A;  2E2I H;  4OWT B;  1ILP A;  1JMC A;  2O5J C;  1Z47 A;  1Q8K A;  1GUN A;  1SNQ A;  5A2Q E;  1LTL A;  2JEB I;  2K33 A;  1VQL A;  4WOR A;  5C5M A;  3MXP A;  4QJF A;  2VUM G;  3S1N H;  5EPL A;  3CCU A;  4LFC L;  4RCO A;  1STH A;  2CH4 W;  4KD4 A;  1XMQ L;  1SLJ A;  3SE0 A;  1AW7 A;  2AWN A;  2SDF A;  3DWP A;  3QWN A;  4C3H G;  3F2B A;  1G8Z D;  3KF8 B;  2ENB A;  1W6K A;  1A6X A;  4PG3 A;  1WTP A;  2KEN A;  1U4L A;  5H1S E;  1TY2 A;  2CWA A;  3PIO 3;  1UAP A;  1Y69 U;  2K28 A;  2UXD L;  1STN A;  4DFA A;  3K59 A;  1BBU A;  1U0L A;  5IT9 c;  4JI7 Q;  4X65 L;  5C3W A;  3I91 A;  1DGS A;  1Y14 B;  4EQ5 A;  1UUP A;  2K50 A;  2L55 A;  4XQJ A;  2VUM H;  3AFQ A;  1TKW B;  4IPD A;  1JT8 A;  3GTL H;  2EYH A;  4UP9 A;  2KHI A;  4B3S Q;  1SYF A;  2JA8 B;  3S14 H;  2ES2 A;  1PVO A;  1D1K A;  1TWG H;  1G6Z A;  5ELD A;  2JA6 G;  5M5W B;  2A74 C;  3OYY A;  3A8K E;  4IPG A;  3HKZ B;  2CQA A;  1HA5 A;  5JAV A;  3CCR A;  3TN2 A;  3AEV A;  1SDF A;  4JI5 L;  1DOK A;  2L12 A;  1X6O A;  4R9W A;  4KY6 A;  1PTO F;  5T1G A;  2YU9 B;  3ND9 A;  4GNX A;  2F0P A;  2R93 B;  2CH4 A;  1SNC A;  5C3X A;  2EQS A;  2NVX H;  4ODG A;  4G7H C;  5IWA Q;  1A3T A;  1B3A A;  1O7Z A;  2RSN A;  4DU9 A;  1STY A;  4G57 A;  1C8C A;  1BDO A;  4C3J H;  4DXG A;  1O7Y A;  4LF9 Q;  1CA5 A;  1B1Z A;  1DYQ A;  4POF A;  1P8L A;  1TWA B;  3FVQ A;  3MWY W;  1KDA A;  3D4D A;  5K5P A;  4FF4 A;  2K01 A;  4FF2 A;  3G6J B;  3C2P A;  2BH2 A;  4X3U A;  1IYU A;  1YZ6 A;  3FKI H;  4HCE A;  2QF7 A;  2RCF A;  1WTH A;  3GQB A;  5C6A A;  3M4O H;  2JXM B;  1SYG A;  4RHR A;  5GAG C;  4UDU C;  4B3R Q;  2N8N A;  4DR1 L;  1JOQ A;  3KK7 A;  4KY5 A;  3G6E A;  2WAQ G;  1SSO A;  2F0Q A;  5FLX L;  5FOB B;  3S2D B;  5KYI A;  4X3S A;  4DUY Q;  1HPC A;  1EEF D;  1VQK A;  4K0K L;  3MEF A;  3SK8 A;  1H9J A;  5EKI A;  3K5N A;  2R6G A;  1CKM A;  3P7J A;  1LTR D;  2WFW A;  1PH9 A;  3H94 A;  3D8G A;  3PMF A;  1SR3 A;  5DLQ E;  2RHS B;  1LTB D;  4IPC A;  1WTW A;  3Q8D A;  1V1Q A;  4BBS H;  1RTN A;  2SNS A;  1I3Q B;  4GN3 B;  1HUN A;  1SRO A;  1HCZ A;  1SE3 A;  1V1P A;  2EXZ A;  1X3Q A;  1SJE D;  3O13 A;  1F9S A;  1IL8 A;  1JOO A;  3GTK B;  2ICI A;  4K8I A;  3RLN A;  4FP5 D;  1QG7 A;  1ILQ A;  4ZCK A;  1M4V A;  1WOC A;  1EU3 A;  1A15 A;  5C4X G;  5EPK A;  1LTG D;  4J6H A;  3D4W A;  3MXN B;  4DR6 L;  2NZO A;  4LUV A;  2VQF Q;  5DM6 3;  1VQN A;  3V2T A;  1A8V A;  4HIO A;  1VQD A;  3BYT B;  5CV5 A;  3CCJ A;  1Y8P B;  2G9D A;  2YYZ A;  5EQ0 A;  2L4N A;  1E7Z A;  1Z6H A;  1EY4 A;  1CKO A;  5M3F G;  1PYW D;  4DNT B;  1WVL A;  2HDM A;  1Q81 C;  5T1I A;  2K6A A;  5KIX A;  4LF7 Q;  4DR4 Q;  4A3K B;  5IE8 A;  4A3K H;  1RL2 A;  1A63 A;  4FDB A;  2LSS A;  3D0F A;  1S40 A;  1YJN A;  4GOP C;  4PQX A;  4EQP A;  3LWU A;  4BY7 G;  3CF5 A;  3DHQ A;  4KMU C;  1HZC A;  1NE3 A;  1GXD C;  2VS1 A;  2PMZ B;  2DNE A;  5CGK A;  4LMQ D;  1PYB A;  1EWH A;  1X55 A;  2BDN A;  4B3R L;  3SHL A;  1KQS A;  4UAI A;  5I2X A;  1K83 H;  2XSC A;  1SFO B;  3H3V I;  1LTT D;  2AMC B;  1EQT A;  1K28 A;  4B9W A;  1I4X A;  2EDG A;  4K6L A;  3I2Z A;  4JI6 L;  2E2D C;  1OXX K;  1CFM A;  4ZKB B;  1MJC A;  4JI0 Q;  1AE3 A;  2NYZ D;  5M5X B;  1EU4 A;  4AYB G;  1IBL L;  2ATW A;  1AFP A;  4RKL A;  3H0G G;  3FRP B;  1HFN A;  4KTA A;  2EYF A;  4A3M G;  4C2M H;  4EQN A;  3K0Y A;  1B44 D;  1TWG B;  3U4Z A;  3RZO B;  4HJ7 A;  3QG1 A;  3EN2 A;  3HEJ A;  4DF7 A;  5JEA G;  3F2U A;  3T4A C;  1G2T A;  2HUG A;  4HSV A;  4ZUI A;  2UU9 Q;  4KKS A;  1HRJ A;  1TWA H;  5I9P A;  3A5U A;  1C48 A;  2LMC B;  1IZ6 A;  1Q12 A;  3TDQ A;  4JI3 Q;  4HSP A;  2M00 A;  4A3D H;  1PDQ A;  1VQG A;  3HKZ E;  3E0E A;  4ZYS A;  3VDY A;  1QB5 D;  4A3G H;  4H44 C;  3MA2 B;  2A6H C;  2Z6K C;  1NSN S;  4XYO A;  5JVH 3;  4JBJ A;  3K0X A;  1EEI D;  3F2C A;  2JA6 H;  2Z6K A;  4C1N K;  3OWE B;  1Q82 C;  2F0K A;  3PV0 A;  1NCV A;  4LF7 L;  1HZB A;  4U67 3;  1AE2 A;  1TY0 A;  1Q86 C;  5C3E G;  1MI2 A;  1JQY D;  2UXC L;  5CR3 A;  1NR2 A;  4EVO A;  3WDN A;  5ELO A;  2NUC A;  3VR3 A;  4DK3 C;  1STG A;  4Q5V A;  4HMI A;  3I7F A;  2HHH L;  2BE5 D;  4IUN A;  1LTA D;  4DR4 L;  4DV1 L;  4DR2 L;  1T9H A;  3Q23 A;  1FYC A;  1NY4 A;  1LUZ A;  3PCO B;  3RZD B;  1Z9F A;  2GVA A;  1HA6 A;  2JN4 A;  1VQ7 A;  5LMN W;  4R8I A;  4NB3 A;  4B9X A;  1FNW A;  3J7A 5;  1Q8I A;  3NBI A;  4I65 A;  1ENA A;  4RGN A;  3H15 A;  1KDC A;  2A68 C;  4DV7 L;  4OIK A;  1K8A C;  1WTV A;  2NN6 H;  3HRZ C;  3K7A B;  1B8A A;  3J80 E;  5LHY 1;  5C44 G;  4RG1 A;  1KHI A;  3NEN A;  5CC4 A;  1EWI A;  5KRU A;  4JI0 L;  3GTP B;  1UE6 A;  1CHP D;  1TS4 A;  1HHV A;  2WKD A;  3PUX A;  1JWS D;  4X3T A;  4A3L H;  4NP5 A;  4IOA A;  2EYO A;  4DNR B;  4U68 A;  1PH2 A;  4B3T L;  2A19 A;  4JOI A;  4A3J H;  3T13 A;  2XWB B;  3GTJ H;  2UUC Q;  1Z7T A;  4IFD G;  1HFG A;  4RMF A;  4RGO S;  1BBX C;  4X65 Q;  5C44 B;  2HQE A;  3MC0 B;  2J7Z A;  1KLG D;  2I5L X;  4ZAI A;  2L11 A;  1W3S A;  3S2H B;  3U9S A;  5HUR A;  3OTO L;  1B7Y B;  1GUG A;  5D65 A;  2A8V A;  3R2T A;  1YIJ A;  4A3F G;  2EY6 A;  1SN8 A;  4FO2 A;  5GAE C;  3GTL B;  3T53 B;  4OX9 Q;  4A75 A;  4A3B B;  5I4D A;  2NB0 A;  1S5D D;  1QVF A;  2VUM B;  4Z9C B;  1I5F A;  5E7N A;  1KTK A;  1K0S A;  3K8A A;  2ZXR A;  1D8L A;  1SNO A;  2HIV A;  4GN4 B;  1H9M A;  3M3Y H;  5IGC A;  1H95 A;  4LJZ C;  2LY7 A;  3SR1 A;  1D5X C;  1K83 B;  3TP7 A;  2OWO A;  2VL6 A;  4E6I A;  1SYE A;  2PQA A;  2YTX A;  1IW7 D;  1EY8 A;  1ASZ A;  1CSP A;  4NDX A;  1BO0 A;  5M5X H;  3GTM H;  2IWH A;  1X65 A;  1EYC A;  3S17 H;  1VQJ A;  1LT6 D;  1MIU A;  2I07 B;  1CQV A;  2L5T A;  3CCM A;  1SRU A;  4IOC A;  4DV1 Q;  4DR2 Q;  4PMC A;  4X3K A;  3NBH A;  3P20 A;  3KYH C;  1I94 Q;  2E2J H;  4DV6 Q;  4JI2 Q;  2A6E C;  3CXC A;  1H9S A;  2D5D A;  4CJ2 C;  4DR7 L;  1HR0 Q;  4NXN Q;  5CV9 A;  1EQR A;  3PIO A;  2UUC L;  1K8O A;  1E1O A;  4DV5 L;  4BXX H;  5M9O A;  4RGM A;  1MJE A;  3OTO Q;  1X9N A;  4BS9 A;  4YCU A;  2QDB A;  1RDP D;  4OEL B;  4WJW A;  5J22 A;  1B4O A;  3K7U C;  1SNP A;  4OX9 L;  4R4O A;  2LFN A;  3NBH B;  2JA5 H;  3I70 A;  1XNQ L;  2X6G A;  1HR0 W;  1PHJ A;  1XNQ Q;  1SYB A;  3S1Q B;  1TWH H;  1TWH B;  2F03 A;  2EVB A;  2B2T A;  1WD0 A;  3S2D H;  4OO1 H;  4NXM L;  1E22 A;  2JP1 A;  3NK9 A;  4R4C A;  4X6A H;  3E9I A;  4JBW A;  1YI2 A;  3D4R A;  1XXG A;  3FPU B;  3U9O A;  3MTS A;  2N88 A;  2WP8 J;  4LF6 Q;  1RKN A;  2IT1 A;  3HOY B;  1J5E Q;  2Z1C A;  4PZ6 A;  2KED A;  3CC2 A;  1L1O B;  1YIT A;  5FLX c;  5A2Q L;  5JPM C;  3H0G H;  3UI2 A;  3H3V C;  3I4N G;  5E4X A;  2CFM A;  3L3O C;  3H09 A;  4DV3 L;  4KHZ A;  3L0O A;  4RFB A;  3UE0 A;  1S3O A;  2PPB C;  3A5Z B;  4BBR B;  1I4G A;  2JJQ A;  1EYA A;  1O80 A;  4HTH A;  5LL6 X;  2BOS A;  1SMY D;  3EJI A;  1ZYR D;  4KLK A;  1YNX A;  2NWG A;  1SEB D;  2JEA I;  4YCV A;  3KOJ A;  5I9O A;  3CMA A;  3P75 A;  4C3I B;  2NN6 I;  3HGB A;  5EJW A;  4PV1 C;  4QQB X;  2B2V A;  4R4Q A;  3HOZ G;  3GO5 A;  1IYJ B;  1ET6 A;  2VB3 X;  4A3C H;  1Q90 A;  3OW7 A;  4KHV A;  1KRS A;  2ZJR A;  1EZ6 A;  1EWC A;  1IXR A;  4ZQ3 A;  4YWM A;  1JCK B;  3VYT A;  1GHK A;  1EIY B;  3D6W A;  5C4X H;  4K0K Q;  5C4X B;  1PFM A;  3A55 A;  3SXH A;  1AEX A;  1YEZ A;  5M3M H;  1TS3 A;  3HP3 A;  4BA2 I;  2B2V C;  2F0U A;  2RF4 A;  5G3L D;  4HMJ A;  2D9U A;  4UP8 A;  4B3S L;  3HOX B;  2F0E A;  2V4D A;  1YHA A;  4MZ9 A;  1PXU A;  1VQ5 A;  4ZRZ A;  2KOL A;  3IAY A;  1TWF B;  5AJ3 Q;  1BCP F;  1B9N A;  4JCV E;  2DJG C;  3OOC A;  1N9W A;  1JJG A;  2F0N A;  1NR4 A;  5C4Z A;  4GLA C;  1NAP A;  4ZK9 B;  1YNJ D;  1ROD A;  2E75 C;  4QY7 A;  4A3D G;  4KKU A;  2FIN B;  1PTO D;  1PTO B;  1JOR A;  1KLU D;  1K3R A;  1BOS A;  1KAA A;  4L5T A;  2JYO A;  2QEX A;  5COY A;  2JA8 H;  2A69 D;  2H1E A;  4RHS A;  2C5C A;  2I5M X;  5CMD A;  4K5W A;  4PMB A;  3CC7 A;  1IBM L;  2E8G A;  1GVP A;  2EOT A;  2K75 A;  4NMZ A;  1OO9 B;  1STB A;  2GVB A;  1J5E L;  3S16 H;  1DD2 A;  4RKB A;  1X3F A;  2HCC A;  5EGT A;  4O42 A;  1I4R A;  3IKJ A;  3ULL A;  1LV9 A;  2XVS A;  1KD1 C;  2H5X A;  5M5W H;  1JWM D;  2YV5 A;  5FJ8 H;  1BF4 A;  3A7L A;  1MBY A;  3I8Z A;  1HNW Q;  1BNZ A;  2NBF A;  1HNX Q;  4JYA L;  5LMN L;  1KC8 C;  5K36 H;  2AKW B;  4ILW A;  1FGU A;  3CPW A;  4NPS A;  3FP9 A;  4WJ4 A;  4TQU S;  2CVR A;  5JJK A;  1GUO A;  3ZJY C;  2R7D A;  2SOB A;  5G3L F;  5LMN Q;  3JAM E;  1KNA A;  1C9O A;  3B6Y A;  2KCC A;  5IGB A;  3CQZ H;  3I3C A;  3J81 c;  1G2S A;  4MNO A;  1B53 A;  5IIF A;  4R4T A;  3CAM A;  2G5D A;  4UP7 A;  4BBR G;  1HNW L;  1MGS A;  1NJI C;  1PRT C;  1VQE A;  2MP1 A;  3JAM L;  2EJM A;  2K7V A;  3KLR A;  2BA0 A;  3TP5 A;  3JAM i;  4C1N I;  3HOV G;  3J81 E;  2MQH A;  5ELB A;  1BVS A;  2XTI A;  5GAH C;  2VQE Q;  4MTK A;  4I7A A;  3HOZ B;  1W2B A;  4UPA A;  3J7A F;  3KDF B;  4XIG S;  4LFA L;  1RCV D;  1V1O A;  3IRB A;  3R8B A;  3SGI A;  4IPH A;  1LT3 D;  3BVM A;  3BVG A;  1OTC A;  2EJF C;  5C4J H;  4DAY B;  1PZI D;  3RR5 A;  4QUC A;  4DAV A;  3MVV A;  5M5Y B;  3GTP H;  1LTS D;  5IYB G;  2QKI C;  4YY3 Q;  2PO4 A;  1TS5 A;  1EL0 A;  1R9T H;  4YHH L;  2DY8 A;  5FLM G;  3URY A;  3HS0 C;  4KK7 A;  5CV6 A;  1PH6 A;  2WAQ E;  2Z8L A;  5GAD C;  3CME A;  4DR5 L;  2UUB Q;  3HOU H;  2MFI A;  4GOP A;  1PH1 A;  2E2I B;  4DV7 Q;  2NVQ B;  2ASB A;  3RN5 A;  4A3I G;  5IY0 A;  4N9P A;  4WFN 3;  4IFD I;  4F7X A;  3F8T A;  5IOC A;  3UDF A;  1SE8 A;  2K5H A;  3V05 A;  4DUZ Q;  3W1B A;  4UHV A;  4LNQ A;  2PMZ E;  1FNV A;  2CHB D;  3S1N B;  4M1U B;  1VF5 C;  2F52 A;  1LT4 D;  2XRS D;  4C3H B;  1EY0 A;  2PCF B;  2WB1 B;  1KRT A;  4K6D A;  2O5I C;  1IBK Q;  1CTM A;  1KDB A;  5EBD A;  4M8A A;  4HJ5 A;  4DR3 Q;  2BDO A;  5KGU A;  3R3O A;  3BZD B;  4L8J A;  1VQ9 A;  2B29 A;  4HID A;  4GLX A;  4XDX A;  2KA7 A;  3I4M B;  5IYD G;  4GZY C;  3CCV A;  1X3P A;  3IFT A;  3M4Y A;  1CKN A;  3OWF A;  4CGY B;  1O78 A;  3NSW A;  5CV7 A;  2Y0S B;  2QEJ C;  3NQT A;  3QB3 A;  5E3F A;  3F1Z A;  1QZG A;  5M3M B;  1PTO H;  5GQO A;  1VQO A;  3DWQ A;  3S1R H;  5IGG A;  3BYY B;  1JR0 D;  1QNU A;  1VQB A;  1J8I A;  2A69 C;  3A8J E;  2IX0 A;  4QB4 A;  1PH4 A;  1FL0 A;  5IOD A;  5D3D A;  3S16 B;  3PQI A;  2K14 A;  3PUV A;  1EYG A;  1PH3 A;  3T1H Q;  1KAB A;  3HOY G;  3I4M G;  5IYD H;  1ML0 D;  1XTC D;  2PI2 E;  2AHO B;  3QOJ A;  4JOI C;  1T5E A;  5E4W C;  5M3M G;  1F9R A;  2JA7 H;  2JA9 A;  4LUZ A;  3DWA A;  3BG3 A;  2OCE A;  1ICF B;  2ID0 A;  4LF4 L;  2Z4H A;  2CKZ B;  2JQO A;  4LF4 Q;  1VQH A;  4ID6 A;  1EIH A;  2VB2 X;  1YBY A;  2DJF C;  1YNJ C;  4A93 G;  4LF5 Q;  4HIM A;  3I4N H;  1FVI A;  2N49 A;  2K4K A;  4GKK Q;  2I46 A;  4G7O C;  2UUB L;  2AQ2 B;  4QF4 A;  2RVL A;  2M2L A;  2A1A A;  3QO2 A;  2JK8 A;  1L0Y B;  1L0W A;  2MGS A;  3HOY H;  1ZEQ X;  2PZW A;  2EY1 A;  3HZX A;  2Q2I A;  4AH6 A;  1PFS A;  4S3S A;  2KBN A;  3VR6 A;  1A3V A;  1GUW A;  2E2H H;  1L0X B;  3GTK H;  1CSQ A;  5IP7 G;  5JJZ A;  1NTG A;  3F2D A;  1XX8 A;  2RKS A;  2XNA C;  1TXY A;  2PZT A;  2F0J A;  1G6P A;  2H4O A;  4EGV A;  2F0D A;  1GM5 A;  1SBB B;  5FJ8 G;  5ELF A;  3X3M A;  4ME5 A;  4QMG A;  4A3K G;  5K36 G;  2WIN B;  4FF3 A;  5C5L A;  1IHZ A;  4JI1 L;  2EYM A;  2B2Y A;  1UNS A;  3FDT A;  4K2L A;  2GA4 B;  4A3G G;  2F0I A;  1Y1V H;  5C4H A;  4IUV A;  5IYC G;  5AFW A;  3J81 i;  3CD6 A;  1ESF A;  3L9A X;  3CP0 A;  1K8M A;  1KAW A;  4K14 A;  5COR A;  2IHF A;  4DV2 L;  4IUU A;  2F4V L;  1GKH A;  3CHB D;  4JYA Q;  5D14 A;  4JVZ A;  2AUK A;  5CV4 A;  4LF9 L;  1HXY D;  1WTX A;  4A3F H;  4DV0 L;  4MIU A;  4O2D A;  3RMH A;  3J7Z C;  1N34 L;  1JJC B;  1MSG A;  3FEW X;  4O0A A;  1WTQ A;  2IL8 A;  2UUA L;  4FYD A;  3KLS A;  3DMU A;  2IPK D;  5ELN A;  3E9H A;  1II3 A;  1CM9 A;  4LAA A;  2K5Q A;  3KJO A;  1IL2 A;  1YNN C;  4BY1 G;  4AYB B;  3ZYY X;  5M3F B;  1YJ9 A;  3L2P A;  4JI4 Q;  3K5O A;  2CQO A;  2AUJ D;  1BCP D;  1BCP B;  1ZKO A;  2EE1 A;  3PO2 G;  4GKK L;  2KHS A;  3ERQ A;  5FLX E;  3TRE A;  1EOT A;  3A56 A;  4A4I A;  3NP8 A;  3TBI B;  4IUP A;  1EIF A;  2PQA B;  2PNR C;  2A73 B;  1SND A;  5C44 H;  1E3P A;  5I6W A;  2CWP A;  4CJ0 B;  4O1N A;  2IX3 A;  1JB3 A;  3EA6 A;  3SDZ A;  3S2H H;  3NEL A;  2VY3 A;  2O2L D;  2B63 G;  1KNE A;  3S9W A;  4XT1 B;  4OON A;  3I90 A;  5EPJ A;  2PYK A;  3BZC A;  4PZ8 A;  3PO2 B;  3HOU G;  3M3Y B;  1WFQ A;  4V0B A;  2K04 A;  3RD4 A;  2RA4 A;  2WII B;  2R3Z A;  5EAY A;  3TP6 A;  1F9Q A;  3G4S A;  3ULJ A;  1CA6 A;  3NQI A;  3TZD A;  4F88 A;  5J1Z A;  5KNB A;  4QCL A;  5C3E H;  4P2C B;  3CCS A;  3AB9 A;  4CKB A;  2NTT A;  4KHP L;  5IGE A;  4ULL A;  1DON A;  4ABN A;  4OXP A;  4IO9 A;  3FKI G;  4LF6 L;  2FFK B;  2K5W A;  1AZP A;  3A74 A;  2HQL A;  4IZ8 A;  5LL6 S;  1CKN B;  1S4Z A;  1E1T A;  2F3V A;  3MHB A;  4IFD J;  1K0R A;  2GN5 A;  3CQZ B;  3KLW A;  2J4X A;  4HN7 A;  2OXP A;  2EJG C;  1D5M C;  1RTO A;  2MHV A;  1I50 H;  3RUZ A;  4MTN A;  4CHT B;  4TRD A;  3VR4 A;  2F3W A;  4JI3 L;  3MXG A;  3GTG B;  1IKL A;  1VMP A;  2NN6 G;  2R7Z H;  2FMM A;  1HNX L;  2ZJQ A;  5FKA C;  1T5X D;  3JC6 6;  4DV5 Q;  3M7N A;  1Q46 A;  1VMC A;  3DXJ C;  3P1H A;  2B2W C;  3J7A V;  4J1M A;  2QIL A;  1X54 A;  1FJG Q;  4OWW B;  3M4P A;  4OO1 I;  2PQE A;  4DV0 Q;  5CBE E;  1LLR D;  4YCW A;  3PUY A;  4KKT A;  2JA5 B;  1D5Z C;  5JJL A;  1QWY A;  1YNN D;  3CW2 C;  5LMU Q;  2E5L Q;  2ZM6 Q;  4RH6 A;  4C3I G;  1I6H H;  4JI8 L;  3PO3 B;  2KQ3 A;  2PNH A;  2MO1 A;  3HFZ B;  2I5H A;  3I4L A;  1KIX A;  3SK5 A;  4BBR H;  2ZTC A;  3NTI A;  3G7L A;  1MSH A;  1VQI A;  2JA7 G;  2RDG A;  5IP9 G;  4HIK A;  2AQ3 B;  4P72 A;  1EOV A;  5DNF A;  2B2U A;  2IW3 A;  1XTD A;  4A93 H;  1VF7 A;  4OHJ A;  1PLF A;  3X3N A;  1FR3 A;  1VQA A;  1HZ9 A;  1AN8 A;  2PW5 A;  4YIJ A;  5KND A;  1NBW A;  3DEP A;  1UEA B;  3CRK C;  2F0M A;  3Q0A A;  1NUC A;  2F3I A;  1Y1W H;  4B08 A;  4OO1 G;  4KI0 A;  1QCB D;  5BN3 A;  5ISR A;  1E24 A;  1D7Q A;  1F2L A;  1TR5 A;  2HD3 A;  4BY7 H;  3TSS A;  3TQY A;  1PRT F;  4RGT A;  3WOF A;  4A3J B;  4KD3 A;  3MAQ A;  1H9S B;  3C3L A;  4H13 C;  2MPM A;  4N8X 1;  1PTO C;  1HUM A;  1M8A A;  1HTL D;  1ZYR C;  2WAC A;  3VA5 A;  2R92 H;  2NVQ H;  2B2U C;  2L15 A;  1OXT A;  4OEM B;  3JAM c;  4K2K A;  1E0B A;  4XT3 B;  2AWO A;  4A3I H;  3GD7 A;  1L1O C;  2ZTE A;  2F0V A;  1CI3 M;  2VQF L;  3QIA A;  1F2Z A;  2OT2 A;  3EFX D;  3GTM B;  5C0X I;  1E2V A;  1YHQ A;  5HGT A;  4EQO A;  4DK0 A;  1LYL A;  1SE4 A;  3PUZ A;  2VQE L;  5IYC H;  1TQO A;  1K9M C;  3M7G A;  2R7F A;  5KNC A;  2NVY H;  2Z6B A;  4DAP A;  4DR3 L;  5JOB A;  4L6T B;  1B70 B;  2UXB Q;  4FF1 A;  5JJI A;  1N36 L;  1GOZ A;  2OTJ A;  4DGZ A;  1G91 A;  3S24 A;  4Y7N B;  1N32 L;  4IUR A;  5M3F H;  2F0S A;  2R92 G;  2K5D A;  1R4P B;  3EQL C;  4A3C G;  3FMC A;  3KLS X;  3WOE A;  2A68 D;  3T56 B;  5C3E B;  1H9K A;  4ZLT F;  3PF4 A;  4ZUJ A;  5JVG 3;  4DR1 Q;  3HOV B;  2B2W A;  4ZKC B;  2KUM A;  3CC4 A;  5GRO A;  3L7Z C;  3G48 A;  2F0H A;  3MEH A;  4AQY L;  2VW9 A;  3BJU A;  4JI5 Q;  4R1J A;  1AH9 A;  5CV8 A;  1VQM A;  1TWC H;  3NHH A;  1FNU A;  2A6E D;  2WKC A;  2Y0S G;  5FO9 B;  3S1R B;  1DM0 B;  1BCP C;  1AP0 A;  3E5S A;  1U9R A;  3SEB A;  1WTO A;  3PO2 H;  3CRL C;  1J6Q A;  3PO3 G;  4DUZ L;  2Z0S A;  4FXD A;  3CCQ A;  1JJ2 A;  3J7Y W;  3RZO H;  1I4P A;  2X6L A;  5C0X G;  1E2Z A;  1CHQ D;  4IAL A;  2ZXO A;  2UU9 L;  2B8F A;  1V1P B;  3MXU A;  1DXM A;  4B3M L;  4NKL A;  2J0T D;  3GTG H;  2C9O A;  3DM1 A;  4L63 B;  2E76 C;  5DEH A;  4J15 A;  1H9R A;  3T1Y Q;  1XNR L;  1F2M A;  1HZA A;  2EXD A;  4ME3 A;  2X69 A;  1P16 A;  2AQ1 B;  4FXG C;  2FHT A;  1D1I A;  1K8G A;  1S5B D;  4CKE A;  1A62 A;  3NE5 B;  1EFI D;  2JA6 B;  4DN4 M;  4X64 Q;  1MHW C;  2XWJ B;  1ENF A;  1XPR A;  3I72 A;  3PO3 H;  4X64 L;  5L37 A;  2F0G A;  2OEO A;  3I55 A;  3CCE A;  4C3J B;  4B3M Q;  3MZ5 A;  1A3U A;  2K1B A;  1O7L A;  2EY5 A;  4IQZ A;  1CZW A;  1ICW A;  1YJW A;  4LFA Q;  2LXJ A;  3N6R A;  2XRQ D;  1QNK A;  2Q2U A;  5I6Y A;  3PUW A;  2MNA A;  5IYB H;  4A3B G;  2HHH Q;  4A3L G;  4OGQ C;  4H7B A;  3SK4 A;  2BH8 A;  3BU2 A;  3W3A A;  4DV4 Q;  4FXK C;  1PA6 A;  3GTQ B;  3ND8 A;  3QOL A;  1IBK L;  2HIX A;  4C3J G;  1WD1 A;  1VQ4 A;  2EYL A;  4HJ9 A;  2CCZ A;  5IGF A;  3BDO A;  1PH5 A;  2OQ0 A;  1CK1 A;  2WB1 G;  3MFG A;  2OTL A;  3I56 A;  3U4V A;  1HQM C;  1I94 L;  3HG9 A;  3STB D;  2IHE A;  3K7A H;  4IJL A;  5FO7 B;  2QCP X;  2ZTD A;  4JK1 C;  2F0W A;  3PIP A;  3T1H L;  5C4J B;  4AQY Q;  4NW2 A;  1EY9 A;  2ZXP A;  4DKA C;  1XPO A;  3HOW B;  1GJX A;  4RAU C;  2LXK A;  4UY8 C;  2B63 H;  3LWE A;  2DN8 A;  5NUC A;  1LO5 D;  1PZK D;  4R4I A;  2PI2 A;  1JOK A;  1Y1V B;  1BBW A;  4LF8 Q;  3TS0 A;  3J80 L;  4YWL A;  4GKJ Q;  1EY6 A;  4QIW E;  2NZ1 D;  1SXT A;  4BBS B;  4XTC S;  1EY7 A;  4C3I H;  1Q1E A;  4F8M A;  1IW7 C;  2F0F A;  2F0L A;  2ZT9 C;  2VNU D;  1RF2 D;  5IT9 L;  2K5N A;  2KJX A;  1CUK A;  5ELE A;  1U4M A;  4NXN L;  1HR0 L;  4PNY A;  3GV6 A;  5BN4 A;  3M4Q A;  4CDE C;  1L1O A;  2ICE C;  1LAC A;  1TVX A;  1GHJ A;  1MKH A;  4LFB Q;  5CYU A;  2PW7 A;  3I4O A;  4AIM A;  1EZ8 A;  2HT1 A;  4LFB L;  2OF1 A;  4EX5 A;  1DJR D;  4KV6 A;  3ER0 A;  3D31 A;  4CDF C;  3J80 c;  4LF5 L;  1RIP A;  3S15 H;  3GTO H;  3NWS A;  4GN5 A;  4BY1 H;  4RCN A;  3S15 B;  5TSS A;  2OQK A;  3T1Y L;  1XNR Q;  3HOX H;  2NZH A;  4C3H H;  3PGZ A;  1MD2 D;  2CW0 C;  2MJ8 A;  3GDE A;  4IFD H;  3VA7 A;  1X32 A;  1I4Q A;  1Y1W G;  3TME A;  4XQQ A;  4OWX B;  4FNF A;  2BCO A;  4P71 A;  4K5V A;  2A6H D;  4MN3 A;  3I4M H;  1LM0 A;  1GD7 A;  1WI5 A;  1VDZ A;  4APV A;  3PIP 3;  3KDF A;  1N33 L;  2NVX B;  2HCI A;  3HOV H;  1J9O A;  1STE A;  4K8J A;  4DV2 Q;  2KCT A;  2UUA Q;  3H6M A;  1LAB A;  4DAY A;  4LF8 L;  1NMF A;  1TU2 B;  3LGJ A;  2L9H A;  3C46 A;  1VQC A;  1XYI A;  4HED A;  2K05 A;  1CT1 D;  4OL7 A;  4DK1 A;  1WYD A;  1LT5 D;  2B8G A;  4H02 A;  1W6J A;  2K32 A;  1ZXT A;  2K03 A;  1X3G A;  4XQN A;  3IL8 A;  2NTS A;  3ITP A;  1STA A;  3K81 C;  4CDD C;  5KEE A;  1TS2 A;  3M4O B;  4TVA B;  1QVG A;  1E2W A;  4K5X A;  3FKI B;  3RLO A;  1PV4 A;  4DXF A;  2QDL A;  2ZM6 L;  4CBV A;  2M9V A;  2FMC A;  2VXW A;  1Y8N B;  4A3G B;  1DZ1 A;  3MXN A;  2Q8I B;  3M85 A;  4XYQ A;  5CBA E;  3A54 A;  2BA1 A;  3KUP A;  4Q0F A;  3OW2 A;  1F2Y A;  2FXQ A;  2XGT A;  1GO3 E;  2N78 A;  1XWE A;  4JI4 L;  3EBE A;  3BZK A;  1WCM B;  1TII D;  2LS0 1;  4CDC C;  1FJG L;  5D3I B;  2FJ2 A;  1Y1V G;  2RCN A;  4LK1 C;  4MHE A;  3RZD H;  4GNX B;  2N55 A;  1F9P A;  5IGD A;  4NXM Q;  4QGU A;  1QIL A;  2Q2T A;  1HNZ Q;  4DPG A;  3NEM A;  4JI6 Q;  1I3Q H;  1FGB D;  5AJ3 L;  4HAE A;  2DNC A;  3HOZ H;  4KN7 C;  4F87 A;  5ELC A;  1Q7Y C;  3UE1 A;  4G7Z C;  3MFY A;  2NVT B;  4Y52 H;  2NVT H;  1ET9 A;  5DM7 3;  3QR8 A;  1EQQ A;  4DV6 L;  4RWS C;  4L5Q A;  3SK6 A;  1U4P A;  1TT2 A;  3LX0 A;  1BKB A;  4KJN A;  3K58 A;  2B2T C;  1HJP A;  3G71 A;  1PRT D;  1PRT B;  4QUF A;  2BE5 C;  3V96 A;  4DR7 Q;  5FO8 B;  3NXW A;  2VZA A;  1YVC A; 
#chains in the Genus database with same CATH homology
 2R92 B;  2B63 B;  2G9H D;  2WAQ B;  3I73 A;  1V8Q A;  3GTJ B;  1S5C D;  4QIW B;  5EKK A;  3K5L A;  4A3I B;  1QOH A;  1OXU A;  3CKI B;  1RHP A;  3N52 A;  3ONA B;  2EY2 A;  5JEA J;  1BQQ T;  3Q22 A;  4BWG B;  3Q6S A;  4TKO B;  1B9M A;  4G4K A;  5A35 A;  3D6C A;  2B39 A;  3NTK A;  4BA1 I;  3R93 A;  4DA2 A;  4PMW A;  3OHX C;  4BY1 B;  2WV6 D;  5BN5 A;  2O4X A;  5C0X J;  4WRD A;  5IT9 E;  3AU7 A;  4IUQ A;  2TMP A;  4CKC A;  5JEA H;  3E6Z X;  3S1M B;  1SNM A;  1SE2 A;  4KJO A;  1PMR A;  1S5E D;  3CU7 A;  2JSO A;  4C2M B;  1EIG A;  3I4N B;  4HCS A;  3KBX A;  1GUS A;  4RA8 A;  3SVM A;  3GTO B;  5E1F A;  2IJ0 A;  4A3E B;  4H0L C;  3TZU A;  4J8Q A;  1RJT A;  2L0C A;  1BR9 A;  2KEC A;  3OPO A;  1JC7 A;  3VR2 A;  1LTI D;  1Y8O B;  1JWU D;  3J81 L;  2EPB A;  3FPP A;  1U4R A;  1OXS C;  3Q24 A;  4I7Z C;  1EQV A;  5JPN C;  3BVZ A;  1QJO A;  2B2Y C;  1S5F D;  2RDF A;  3GV3 A;  1IYV A;  4A3D B;  3DEO A;  2E2H B;  1BXT A;  1HQR D;  5EKL A;  3KBG A;  1AZQ A;  4OIJ A;  1JE4 A;  2HDL A;  4A3M B;  2LKV A;  1G29 1;  2Q8R E;  4TSS A;  2EZV A;  1R4Q B;  2D2C C;  2D62 A;  1ONL A;  3NTH A;  3ERO A;  4C56 C;  2EYP A;  2KVM A;  1GUT A;  1DCZ A;  2A5H A;  3NPP A;  2R61 A;  1DOM A;  1HTP A;  3C1E A;  3OMC A;  3HOU B;  2E74 C;  1PFN A;  1A2U A;  2Q8T A;  3OSO A;  4N9T A;  1Y1W B;  3QJY A;  1V43 A;  5KYL A;  2KCN A;  2CW0 D;  4A3F B;  4BY7 B;  4KY7 A;  2RBM A;  3T51 B;  2IX1 A;  1Q1B A;  3GP7 A;  4XXE A;  1EY5 A;  1FD7 D;  3KF8 A;  3K6O A;  1OXV A;  1CQF A;  1SYC A;  1CZG A;  2SNM A;  1VCI A;  5FK9 C;  3EVQ A;  1F77 A;  3NWT A;  4FVM A;  2PZU A;  2L1B A;  3OMG A;  5EBC A;  2JE6 I;  4IUT A;  3BDL A;  1SJH D;  2NVY B;  2DY7 A;  1IKM A;  1D6E C;  3VYU A;  4R8N A;  3VYR A;  1D2B A;  2E2J B;  3A8I E;  3S14 B;  3D3R A;  2SEB D;  3RLF A;  1PZJ D;  1Q3L A;  3TP8 A;  1I6V C;  2RSO A;  1QE6 A;  3C1F A;  2F0T A;  2JA7 B;  3IFD A;  1RD9 D;  3S17 B;  1SMY C;  2MUY A;  1I4H A;  3NUC A;  2KEE A;  3K57 A;  4HR7 B;  3BS1 A;  1TWC B;  1A2T A;  1I50 B;  2R7Z B;  3LNN A;  1SYD A;  3BDC A;  5F2D A;  1JIC A;  1ENC A;  2F0O A;  2Z4I A;  3T16 A;  1ESR A;  1B50 A;  1B2T A;  2EYJ A;  4CJ1 B;  3AMU A;  2RDH A;  2F1M A;  3OIP A;  1I6H B;  3H0G B;  4IN3 A;  1SAP A;  1BUV T;  5I2Y A;  5C0X H;  1DOL A;  1C4Q A;  2F4I A;  2XN9 C;  5J39 A;  2XIW A;  3R2I A;  2TSS A;  3H91 A;  1PFB A;  3VYS A;  3K5M A;  1R9T B;  2RQX A;  3DUZ A;  3OIQ A;  3E0J A;  4A93 B;  3W2D A;  1EYD A;  5DAU A;  4KN4 C;  3VR5 A;  3A7A B;  1WTR A;  4V19 0;  1ILP A;  2O5J C;  1Z47 A;  1GUN A;  1SNQ A;  5A2Q E;  2JEB I;  2K33 A;  4WOR A;  5C5M A;  3MXP A;  5EPL A;  4RCO A;  1STH A;  4KD4 A;  3SE0 A;  1AW7 A;  2AWN A;  2SDF A;  3DWP A;  3QWN A;  4C3H G;  1G8Z D;  2ENB A;  1W6K A;  1A6X A;  1WTP A;  1U4L A;  1TY2 A;  3PIO 3;  1UAP A;  1Y69 U;  2K28 A;  1STN A;  4DFA A;  3K59 A;  5C3W A;  3I91 A;  1UUP A;  2L55 A;  4XQJ A;  1TKW B;  2EYH A;  1SYF A;  2JA8 B;  1D1K A;  1G6Z A;  5ELD A;  5M5W B;  2A74 C;  3A8K E;  3HKZ B;  2CQA A;  1HA5 A;  5JAV A;  3TN2 A;  1SDF A;  1DOK A;  2L12 A;  4R9W A;  4KY6 A;  1PTO F;  5T1G A;  2YU9 B;  3ND9 A;  2F0P A;  2R93 B;  1SNC A;  5C3X A;  4ODG A;  4G7H C;  1A3T A;  1B3A A;  1O7Z A;  2RSN A;  4DU9 A;  1STY A;  4G57 A;  1C8C A;  1BDO A;  4DXG A;  1O7Y A;  1CA5 A;  1B1Z A;  1DYQ A;  1TWA B;  3FVQ A;  3MWY W;  1KDA A;  3D4D A;  5K5P A;  4FF4 A;  2K01 A;  4FF2 A;  3G6J B;  3C2P A;  4X3U A;  1IYU A;  4HCE A;  2QF7 A;  3GQB A;  5C6A A;  2JXM B;  1SYG A;  4RHR A;  4UDU C;  1JOQ A;  3KK7 A;  4KY5 A;  1SSO A;  2F0Q A;  5FLX L;  5FOB B;  3S2D B;  5KYI A;  4X3S A;  1HPC A;  1EEF D;  3K5N A;  3SK8 A;  1H9J A;  5EKI A;  2R6G A;  3P7J A;  1LTR D;  3H94 A;  3D8G A;  3PMF A;  1LTB D;  1WTW A;  1RTN A;  2SNS A;  1I3Q B;  1HUN A;  1HCZ A;  1SE3 A;  1V1P A;  2EXZ A;  1X3Q A;  1SJE D;  3O13 A;  1F9S A;  1IL8 A;  3GTK B;  1JOO A;  2ICI A;  4K8I A;  4FP5 D;  1QG7 A;  1ILQ A;  1M4V A;  1EU3 A;  1A15 A;  5EPK A;  1LTG D;  4J6H A;  3D4W A;  5DM6 3;  3V2T A;  3BYT B;  5CV5 A;  1Y8P B;  2G9D A;  2YYZ A;  5EQ0 A;  2L4N A;  1Z6H A;  1EY4 A;  1PYW D;  4DNT B;  1WVL A;  2HDM A;  5T1I A;  2K6A A;  5KIX A;  4A3K B;  4PQX A;  4EQP A;  3LWU A;  3DHQ A;  4KMU C;  1GXD C;  2PMZ B;  2DNE A;  5CGK A;  4LMQ D;  1EWH A;  2BDN A;  3SHL A;  4UAI A;  5I2X A;  2XSC A;  1SFO B;  1LTT D;  1EQT A;  4B9W A;  1I4X A;  2EDG A;  4K6L A;  2E2D C;  1OXX K;  1CFM A;  4ZKB B;  2NYZ D;  5M5X B;  1EU4 A;  1AFP A;  4RKL A;  3FRP B;  1HFN A;  4KTA A;  2EYF A;  4EQN A;  3K0Y A;  1B44 D;  1TWG B;  3RZO B;  3QG1 A;  3HEJ A;  4DF7 A;  5JEA G;  3F2U A;  3T4A C;  1G2T A;  2HUG A;  4HSV A;  4ZUI A;  1HRJ A;  4KKS A;  5I9P A;  1C48 A;  2LMC B;  1Q12 A;  3TDQ A;  4HSP A;  2M00 A;  1PDQ A;  4ZYS A;  1QB5 D;  4H44 C;  3MA2 B;  2A6H C;  1NSN S;  4XYO A;  5JVH 3;  1EEI D;  4C1N K;  3OWE B;  2F0K A;  3PV0 A;  1NCV A;  4U67 3;  1TY0 A;  1MI2 A;  1JQY D;  5CR3 A;  1NR2 A;  4EVO A;  3WDN A;  2NUC A;  3VR3 A;  1STG A;  4Q5V A;  4HMI A;  2BE5 D;  4IUN A;  1LTA D;  3Q23 A;  1FYC A;  3RZD B;  1HA6 A;  4R8I A;  4B9X A;  1FNW A;  1Q8I A;  3NBI A;  4I65 A;  1ENA A;  4RGN A;  1KDC A;  2A68 C;  4OIK A;  1WTV A;  2NN6 H;  3HRZ C;  3K7A B;  3J80 E;  5LHY 1;  5CC4 A;  5KRU A;  3GTP B;  1CHP D;  1TS4 A;  1HHV A;  2WKD A;  3PUX A;  1JWS D;  4X3T A;  4NP5 A;  2EYO A;  4DNR B;  4U68 A;  3T13 A;  2XWB B;  1Z7T A;  4IFD G;  1HFG A;  4RGO S;  1BBX C;  5C44 B;  2HQE A;  3MC0 B;  2J7Z A;  1KLG D;  4ZAI A;  2L11 A;  3S2H B;  3U9S A;  5HUR A;  1GUG A;  5D65 A;  3R2T A;  2EY6 A;  4FO2 A;  3GTL B;  3T53 B;  4A3B B;  5I4D A;  2NB0 A;  1S5D D;  2VUM B;  4Z9C B;  1KTK A;  2ZXR A;  1SNO A;  1H9M A;  5IGC A;  4LJZ C;  2LY7 A;  3SR1 A;  1D5X C;  1K83 B;  3TP7 A;  4E6I A;  1SYE A;  1IW7 D;  1EY8 A;  4NDX A;  1BO0 A;  2IWH A;  1EYC A;  1LT6 D;  2I07 B;  1CQV A;  2L5T A;  4PMC A;  4X3K A;  3NBH A;  3P20 A;  2A6E C;  1H9S A;  2D5D A;  4CJ2 C;  5CV9 A;  1K8O A;  5M9O A;  4RGM A;  4BS9 A;  2QDB A;  1RDP D;  4WJW A;  5J22 A;  1B4O A;  1SNP A;  2LFN A;  3I70 A;  2X6G A;  3S1Q B;  1SYB A;  1TWH B;  2F03 A;  2EVB A;  2B2T A;  1WD0 A;  4OO1 H;  2JP1 A;  3NK9 A;  4JBW A;  3D4R A;  1XXG A;  3FPU B;  3U9O A;  3MTS A;  2N88 A;  2WP8 J;  1RKN A;  2IT1 A;  3HOY B;  2Z1C A;  2KED A;  5A2Q L;  5JPM C;  3UI2 A;  3H3V C;  5E4X A;  3L3O C;  3H09 A;  4KHZ A;  4RFB A;  2PPB C;  4BBR B;  1I4G A;  1EYA A;  1O80 A;  4HTH A;  5LL6 X;  2BOS A;  1SMY D;  3EJI A;  1ZYR D;  2NWG A;  2JEA I;  1SEB D;  5I9O A;  3P75 A;  4C3I B;  2NN6 I;  3HGB A;  5EJW A;  4PV1 C;  2B2V A;  3GO5 A;  1ET6 A;  2VB3 X;  1Q90 A;  3OW7 A;  4KHV A;  1EZ6 A;  1EWC A;  4ZQ3 A;  1JCK B;  3VYT A;  1GHK A;  3D6W A;  5C4X B;  1PFM A;  3A55 A;  3SXH A;  1AEX A;  1TS3 A;  3HP3 A;  4BA2 I;  2B2V C;  2F0U A;  5G3L D;  4HMJ A;  2D9U A;  3HOX B;  2F0E A;  2V4D A;  1PXU A;  4ZRZ A;  2KOL A;  3IAY A;  1TWF B;  1BCP F;  1B9N A;  3OOC A;  2F0N A;  1NR4 A;  5C4Z A;  1NAP A;  4ZK9 B;  1YNJ D;  1ROD A;  2E75 C;  4KKU A;  2FIN B;  1PTO D;  1PTO B;  1JOR A;  1KLU D;  1BOS A;  1KAA A;  2JYO A;  5COY A;  2A69 D;  2H1E A;  4RHS A;  2C5C A;  5CMD A;  4K5W A;  4PMB A;  2EOT A;  4NMZ A;  1OO9 B;  1STB A;  1DD2 A;  4RKB A;  2HCC A;  5EGT A;  4O42 A;  1I4R A;  3IKJ A;  1LV9 A;  2XVS A;  1JWM D;  1BF4 A;  3A7L A;  1MBY A;  3I8Z A;  1BNZ A;  2NBF A;  5K36 H;  4ILW A;  4TQU S;  2CVR A;  1GUO A;  2SOB A;  5G3L F;  3JAM E;  1KNA A;  2KCC A;  5IGB A;  3I3C A;  1G2S A;  1B53 A;  5IIF A;  1MGS A;  1PRT C;  2MP1 A;  3JAM L;  2EJM A;  2K7V A;  3KLR A;  2BA0 A;  3TP5 A;  4C1N I;  3J81 E;  5ELB A;  3HOZ B;  3J7A F;  4XIG S;  1RCV D;  1V1O A;  3R8B A;  1LT3 D;  3BVM A;  3BVG A;  2EJF C;  1PZI D;  4QUC A;  4DAV A;  3MVV A;  5M5Y B;  1LTS D;  2QKI C;  2PO4 A;  1TS5 A;  1EL0 A;  2DY8 A;  3URY A;  3HS0 C;  4KK7 A;  5CV6 A;  2Z8L A;  2E2I B;  2NVQ B;  4N9P A;  4WFN 3;  4IFD I;  4F7X A;  5IOC A;  3V05 A;  1FNV A;  2CHB D;  3S1N B;  4M1U B;  1VF5 C;  1LT4 D;  2XRS D;  4C3H B;  1EY0 A;  2PCF B;  2WB1 B;  4K6D A;  2O5I C;  1CTM A;  1KDB A;  5EBD A;  4M8A A;  2BDO A;  5KGU A;  3R3O A;  3BZD B;  4L8J A;  4XDX A;  2KA7 A;  3I4M B;  4GZY C;  1X3P A;  3IFT A;  3M4Y A;  4CGY B;  3OWF A;  1O78 A;  3NSW A;  5CV7 A;  2Y0S B;  2QEJ C;  3NQT A;  3QB3 A;  5E3F A;  5M3M B;  1PTO H;  3DWQ A;  5IGG A;  3BYY B;  1JR0 D;  1QNU A;  1J8I A;  2A69 C;  3A8J E;  2IX0 A;  4QB4 A;  5IOD A;  5D3D A;  3S16 B;  3PUV A;  1KAB A;  1ML0 D;  1XTC D;  3QOJ A;  5E4W C;  1T5E A;  1F9R A;  3DWA A;  3BG3 A;  2ID0 A;  2Z4H A;  4ID6 A;  1EIH A;  2VB2 X;  1YNJ C;  2I46 A;  4G7O C;  2AQ2 B;  4QF4 A;  2RVL A;  2M2L A;  3QO2 A;  1L0Y B;  2MGS A;  1ZEQ X;  2PZW A;  2EY1 A;  3HZX A;  4S3S A;  3VR6 A;  1A3V A;  1GUW A;  1L0X B;  5JJZ A;  1XX8 A;  2RKS A;  2XNA C;  2PZT A;  2F0J A;  2H4O A;  4EGV A;  2F0D A;  1SBB B;  5ELF A;  3X3M A;  4ME5 A;  4QMG A;  5K36 G;  2WIN B;  4FF3 A;  5C5L A;  1IHZ A;  2EYM A;  2B2Y A;  1UNS A;  3FDT A;  4K2L A;  2GA4 B;  2F0I A;  5C4H A;  4IUV A;  5AFW A;  1ESF A;  3L9A X;  1K8M A;  4K14 A;  5COR A;  4IUU A;  3CHB D;  5D14 A;  2AUK A;  5CV4 A;  1HXY D;  1WTX A;  4MIU A;  3RMH A;  1MSG A;  1WTQ A;  3FEW X;  2IL8 A;  4FYD A;  3KLS A;  3DMU A;  2IPK D;  1II3 A;  1CM9 A;  4LAA A;  2K5Q A;  1YNN C;  4AYB B;  3ZYY X;  5M3F B;  3K5O A;  2AUJ D;  1BCP D;  1BCP B;  1ZKO A;  2EE1 A;  2KHS A;  3ERQ A;  5FLX E;  1EOT A;  3A56 A;  3NP8 A;  3TBI B;  4IUP A;  2PNR C;  2A73 B;  1SND A;  5I6W A;  4CJ0 B;  4O1N A;  2IX3 A;  1JB3 A;  3EA6 A;  3SDZ A;  2O2L D;  1KNE A;  3S9W A;  4XT1 B;  3I90 A;  5EPJ A;  2PYK A;  3PO2 B;  3M3Y B;  4V0B A;  2K04 A;  3RD4 A;  2RA4 A;  2WII B;  2R3Z A;  3TP6 A;  1F9Q A;  1CA6 A;  3NQI A;  3TZD A;  4F88 A;  5J1Z A;  5KNB A;  4QCL A;  4P2C B;  3AB9 A;  4CKB A;  2NTT A;  5IGE A;  4ULL A;  1DON A;  4ABN A;  2FFK B;  2K5W A;  1AZP A;  4IZ8 A;  5LL6 S;  1S4Z A;  3MHB A;  2F3V A;  4IFD J;  3CQZ B;  2J4X A;  4HN7 A;  2OXP A;  2EJG C;  1D5M C;  1RTO A;  2MHV A;  3RUZ A;  4CHT B;  4TRD A;  3VR4 A;  2F3W A;  3MXG A;  3GTG B;  1IKL A;  1VMP A;  2NN6 G;  2FMM A;  5FKA C;  1T5X D;  3M7N A;  1VMC A;  3DXJ C;  3P1H A;  2B2W C;  3J7A V;  4J1M A;  2QIL A;  4OO1 I;  2PQE A;  5CBE E;  1LLR D;  3PUY A;  4KKT A;  2JA5 B;  1D5Z C;  1QWY A;  1YNN D;  4RH6 A;  4C3I G;  3PO3 B;  2KQ3 A;  3I4L A;  3SK5 A;  3NTI A;  3G7L A;  1MSH A;  2RDG A;  2AQ3 B;  5DNF A;  2B2U A;  2IW3 A;  1VF7 A;  3X3N A;  1PLF A;  4OHJ A;  1FR3 A;  1AN8 A;  2PW5 A;  4YIJ A;  5KND A;  3DEP A;  1UEA B;  3CRK C;  2F0M A;  3Q0A A;  1NUC A;  4B08 A;  4OO1 G;  4KI0 A;  1QCB D;  5BN3 A;  5ISR A;  1F2L A;  1TR5 A;  3TSS A;  1PRT F;  4RGT A;  3WOF A;  4A3J B;  4KD3 A;  3MAQ A;  1H9S B;  3C3L A;  4H13 C;  2MPM A;  1PTO C;  1HUM A;  1M8A A;  1HTL D;  1ZYR C;  2WAC A;  3VA5 A;  2B2U C;  1OXT A;  4K2K A;  1E0B A;  4XT3 B;  2AWO A;  3GD7 A;  2F0V A;  1CI3 M;  3QIA A;  1F2Z A;  2OT2 A;  3EFX D;  3GTM B;  5C0X I;  1E2V A;  5HGT A;  4EQO A;  4DK0 A;  1SE4 A;  3PUZ A;  1TQO A;  3M7G A;  5KNC A;  4DAP A;  5JOB A;  4L6T B;  4FF1 A;  1GOZ A;  1G91 A;  4DGZ A;  4Y7N B;  4IUR A;  2F0S A;  2K5D A;  1R4P B;  3EQL C;  3FMC A;  3KLS X;  3WOE A;  2A68 D;  3T56 B;  5C3E B;  1H9K A;  4ZLT F;  4ZUJ A;  5JVG 3;  3HOV B;  2B2W A;  4ZKC B;  2KUM A;  3L7Z C;  2F0H A;  3MEH A;  5CV8 A;  3NHH A;  1FNU A;  2A6E D;  2WKC A;  5FO9 B;  3S1R B;  1DM0 B;  1BCP C;  1AP0 A;  3E5S A;  1U9R A;  3SEB A;  1WTO A;  3CRL C;  4FXD A;  3J7Y W;  1I4P A;  2X6L A;  5C0X G;  1E2Z A;  1CHQ D;  4IAL A;  2ZXO A;  2B8F A;  1V1P B;  3MXU A;  1DXM A;  4NKL A;  2J0T D;  2C9O A;  3DM1 A;  4L63 B;  2E76 C;  5DEH A;  1H9R A;  1F2M A;  2X69 A;  2AQ1 B;  4FXG C;  2FHT A;  1D1I A;  1S5B D;  4CKE A;  3NE5 B;  1EFI D;  2JA6 B;  4DN4 M;  2XWJ B;  1ENF A;  3I72 A;  2F0G A;  2OEO A;  4C3J B;  3MZ5 A;  1A3U A;  2K1B A;  1O7L A;  2EY5 A;  4IQZ A;  1CZW A;  1ICW A;  3N6R A;  2XRQ D;  1QNK A;  5I6Y A;  3PUW A;  4OGQ C;  4H7B A;  3SK4 A;  3W3A A;  4FXK C;  3GTQ B;  3ND8 A;  3QOL A;  4C3J G;  1WD1 A;  2EYL A;  5IGF A;  3BDO A;  1CK1 A;  3MFG A;  1HQM C;  3HG9 A;  5FO7 B;  2QCP X;  4JK1 C;  2F0W A;  5C4J B;  3HOW B;  1EY9 A;  4NW2 A;  2ZXP A;  1GJX A;  4RAU C;  3LWE A;  2DN8 A;  5NUC A;  1LO5 D;  1PZK D;  1JOK A;  1Y1V B;  3J80 L;  1EY6 A;  2NZ1 D;  1SXT A;  4BBS B;  4XTC S;  1EY7 A;  1Q1E A;  4F8M A;  1IW7 C;  2F0F A;  2F0L A;  2ZT9 C;  2VNU D;  1RF2 D;  5IT9 L;  2KJX A;  5ELE A;  1U4M A;  4PNY A;  3GV6 A;  5BN4 A;  2ICE C;  1LAC A;  1TVX A;  1GHJ A;  5CYU A;  2PW7 A;  1EZ8 A;  2OF1 A;  1DJR D;  4KV6 A;  3D31 A;  3NWS A;  3S15 B;  4RCN A;  5TSS A;  1MD2 D;  2CW0 C;  2MJ8 A;  4IFD H;  3VA7 A;  1X32 A;  1I4Q A;  3TME A;  4XQQ A;  4FNF A;  2BCO A;  4K5V A;  2A6H D;  4MN3 A;  1VDZ A;  3PIP 3;  2NVX B;  2HCI A;  1J9O A;  1STE A;  4K8J A;  3H6M A;  1LAB A;  4DAY A;  1TU2 B;  2L9H A;  3C46 A;  1XYI A;  4HED A;  2K05 A;  1CT1 D;  4OL7 A;  4DK1 A;  1LT5 D;  2B8G A;  1W6J A;  2K32 A;  1ZXT A;  2K03 A;  4XQN A;  3IL8 A;  2NTS A;  3ITP A;  1STA A;  5KEE A;  1TS2 A;  3M4O B;  1E2W A;  4K5X A;  3FKI B;  4DXF A;  4CBV A;  2M9V A;  2FMC A;  2VXW A;  1Y8N B;  4A3G B;  1DZ1 A;  3MXN A;  2Q8I B;  3M85 A;  4XYQ A;  5CBA E;  3A54 A;  2BA1 A;  3KUP A;  4Q0F A;  1F2Y A;  1XWE A;  1WCM B;  1TII D;  2LS0 1;  5D3I B;  2FJ2 A;  4MHE A;  4LK1 C;  2N55 A;  1F9P A;  5IGD A;  1QIL A;  1FGB D;  4HAE A;  2DNC A;  4KN7 C;  4F87 A;  5ELC A;  4G7Z C;  3MFY A;  2NVT B;  1ET9 A;  5DM7 3;  4RWS C;  3SK6 A;  1U4P A;  1TT2 A;  3LX0 A;  4KJN A;  3K58 A;  2B2T C;  1PRT D;  1PRT B;  4QUF A;  2BE5 C;  3V96 A;  5FO8 B;  3NXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...