4I65A

Crystal structure of staphylococcal nuclease mutant v23i/l25v/i72v/i92v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKVMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4i65A00
3NXWA 5CV6A 4KTAA 2PW5A 4E6IA 2F0WA 5IGFA 4IZ8A 4NKLA 5EGTA 4DGZA 1F2YA 4HMJA 5ISRA 2KQ3A 4HTHA 2EY5A 5J22A 1SNCA 4KY7A 4YIJA 3QOJA 4TRDA 1A3VA 3SHLA 3QOLA 1JORA 1F2ZA 1STNA 2SOBA 3TP7A 1KDAA 1NUCA 3S9WA 5CV5A 4KJOA 3MHBA 5I6YA 3T13A 4LAAA 2F0HA 4F7XA 4IALA 4KD3A 4K8IA 4QB4A 4RKBA 4QMGA 2RKSA 3HZXA 3NK9A 1TQOA 4IUNA 2OXPA 2SNSA 5KYLA 1EZ8A 1SYBA 4PMCA 5KGUA 3EJIA 3H6MA 5JAVA 2F0DA 4ME5A 2EYMA 2OEOA 2PYKA 2HQEA 1JOOA 2F0VA 1ENAA 5I9PA 2F0IA 4B9WA 1TR5A 2PZWA 4K8JA 5C3WA 1EY6A 3T16A 1EY0A 2PQEA 5KYIA 4H7BA 3D4DA 4G57A 4WORA 1II3A 5C5MA 4DU9A 1A2UA 5IGDA 2F0QA 3D6CA 2RDFA 5M9OA 3NQTA 1NSNS 5E3FA 1EY7A 2F0JA 5KIXA 5CV7A 3SXHA 3TP6A 3NP8A 4EVOA 5KEEA 1STHA 1STYA 2F0GA 4ZUIA 2F0LA 5C4HA 2F0TA 4QF4A 2F3WA 1SYFA 3ITPA 4J1MA 5IGGA 4DF7A 5J39A 1STAA 1JOQA 2F0PA 3BDCA 5IIFA 2EYJA 2EYLA 4KV6A 1KABA 4K2KA 1A3TA 2PZUA 4EQPA 5C3XA 2EYHA 3C1EA 2F0UA 3V2TA 4K5WA 2F0KA 5J1ZA 5IGBA 1SYCA 4KJNA 3OWFA 5C4ZA 2EXZA 3BDLA 3OMGA 2PZTA 3P1HA 3OMCA 4PMBA 5CV4A 2EYFA 4NP5A 3LX0A 5HGTA 2QDBA 1U9RA 2EY1A 4K5VA 4PNYA 1KDBA 4ODGA 4KY6A 1IHZA 4EQNA 3MXPA 2WACA 4I65A 3C1FA 3MEHA 3SK8A 1EQVA 1STGA 3QB3A 4NDXA 4HMIA 5CR3A 4ZUJA 3SR1A 1EYDA 3SK6A 5EKKA 4J6HA 3U9OA 1SNPA 5DAUA 3D8GA 2M00A 5CC4A 2SNMA 1EYCA 4K2LA 3DHQA 3HEJA 3RUZA 3D4WA 3DMUA 5DEHA 4DFAA 3TMEA 4ZQ3A 4ID6A 1SYGA 3ERQA 4K6DA 2F0SA 4N9TA 1ENCA 1STBA 3R3OA 3TP8A 5IGEA 1TT2A 3EVQA 2F0NA 5CV9A 5KRUA 2LKVA 5IODA 4N9PA 1SYEA 3SK5A 5EKLA 2EY2A 2F0OA 3NUCA 4K14A 5IGCA 1A3UA 2EYPA 5CV8A 5I9OA 4KY5A 4R8NA 4KD4A 1F2MA 1A2TA 4WRDA 1SNDA 4NMZA 2F0MA 2RBMA 3OSOA 1KAAA 3SK4A 2EY6A 2F3VA 3MZ5A 1EYAA 3MVVA 4KHVA 4EQOA 5CGKA 1AEXA 1RKNA 3P75A 1EY8A 1SNMA 4OL7A 1EY5A 2NUCA 5E1FA 2PW7A 4MIUA 4B9XA 4F8MA 1SNQA 2OF1A 2F0FA 2KHSA 1SNOA 2F0EA 5C5LA 3VA5A 1JOKA 1KDCA 3EROA 3NHHA 4K5XA 1EY9A 4RKLA 5NUCA 5C6AA 2O4XA 1EZ6A 4S3SA 5F2DA 1EY4A 2EYOA 5JOBA 5IOCA 5K5PA 3E5SA 1SYDA 2ENBA 3PMFA 5I6WA 3TP5A 5HURA
chains in the Genus database with same CATH superfamily
4A3JG 1NAPA 5IT9c 3H0GB 4DK3C 3PUYA 1KXLA 5IYBH 2L1BA 2MO0A 1S5DD 3BVMA 3PIP3 3MHBA 2EOTA 2G5DA 3ULJA 1HA6A 1G6ZA 1XMQL 3E9HA 2CH4W 1H9SB 3IKJA 2LXJA 3K6OA 4BS9A 1D6EC 1YEZA 2YU9B 3F1ZA 1PYWD 3IL8A 1BBWA 4MTNA 1PDQA 4TQUS 5I9PA 4K0KQ 1TR5A 5FLXL 1KIXA 2XTIA 1P8LA 1OO9B 1Q86C 1OTCA 2BDOA 5C5MA 4OGQC 1PH9A 3J81j 3S16B 4RHRA 4ZUIA 2RSNA 1SE2A 2IX3A 2VQEQ 2F52A 4ABNA 1B4OA 1KRSA 2L11A 2EYJA 2K05A 2ZT9C 1YI2A 1EFID 2EJGC 3PF4A 4FXDA 4L5SA 1DZ1A 3BYTB 2I5LX 4DAPA 3MXPA 4A3JH 4DR6L 1TWFH 3FKIG 4YCUA 1Q8IA 2IL8A 4LW1A 1WTQA 4QGUA 3M4OB 1C0AA 4R4QA 3SK6A 2K32A 2IHFA 3KDFA 4QJFA 4CJ0B 3TZDA 3EFXD 4A76A 4N9TA 3HOYG 5EQ0A 2UUBQ 2UXDL 1O7YA 2XNAC 4YY3Q 3CCJA 4DR5Q 4ZKCB 4JI8Q 5IODA 4LF5L 5T1GA 4A3BH 2E2JB 1I3QH 1AW7A 5CV8A 1JQYD 4KY5A 2M9VA 1CKNA 4UAIA 2MP1A 4BA1I 2DUDA 3BG3A 1IL8A 3MZ5A 2YTXA 3BZKA 4A3IH 2A6ED 3S2HH 4DV6L 4KKTA 4MIUA 4GOPA 2PQAB 1ICFB 3KOJA 4F8MA 1YJNA 3I4LA 3K5MA 1Y14B 4C2MH 2M2LA 3HOYB 1YNNC 3JC66 5ELBA 3U58A 1E24A 4LF6L 5CV6A 2JE6I 3C46A 5J22A 1VQKA 1K3RA 1ZYRD 4JYAQ 1F2ZA 1KLGD 1W3SA 5IT9L 2N49A 4B3RQ 3HOWG 3FKIH 3S15H 4AQYQ 1PV4A 4BY1G 3S1NB 2PO4A 1S5CD 1BQQT 3AFPA 1EU4A 1Y8PB 2MGSA 1VCIA 3I4NG 1IBLQ 2PYKA 2VQFQ 1PZJD 2JJQA 3PGZA 1ENAA 4A3DG 1L0WA 1TWCH 3A7AB 2JA5H 3TZUA 2BA1A 4YWMA 2A68C 2CWAA 1PTOH 4IURA 3VR2A 3PO3G 4GKJL 4JBMA 5IYDG 3DWQA 4HCSA 1RF2D 3DM3A 4OIKA 3HOWB 1O7ZA 1S5ED 4DF7A 1STAA 5A35A 1KABA 5IWAL 3CCSA 2PZUA 1T5XD 1T5EA 5A2QE 1LTSD 3OTOL 3HP3A 4C56C 3I4NB 3M4QA 3CQZB 2Q2IA 4A3DB 2EY1A 1VQ5A 4R4TA 1BKBA 3N52A 3PO3B 4NDXA 5CR3A 1FD7D 4P75A 3T1YL 4JI3L 2HHHL 1S72A 3H91A 2F4VQ 3HEJA 4CKBA 3HOWH 4K6DA 1U4RA 2JA8G 4JCVE 5IGEA 3EVQA 1YHAA 4BY1H 2FINB 2A19A 3GTKB 1ASZA 1SYEA 2Z9HA 2B2YA 2RVLA 1KQSA 1DXMA 3M9BA 1MHWC 5C4XG 3I4NH 2YV5A 3A55A 2A73B 4A3DH 1KAAA 4JVZA 2EY6A 2R3ZA 1G2TA 1TWAB 3TBIB 5E1FA 3PIPA 2AHOB 5EKIA 1HZAA 2MFIA 1PFMA 3D0FA 3OHXC 2ZJQA 4A3KG 2KECA 1SLJA 2IY5B 4WJ4A 3S1QH 2JA8B 5IOCA 1Q12A 4JI2L 5I6WA 1BNZA 1XX8A 4L5TA 2QF7A 1WTRA 1R9TH 5C4XB 4B3SL 3I8ZA 4H44C 4HTHA 2EY5A 5EPKA 3S2DB 4P72A 2C35B 2G9HD 4YIJA 3I90A 4OX9L 3MXUA 3TP7A 1E2VA 1A63A 1YBYA 4LFAQ 1ENFA 2H5XA 3HS0C 2Y0SE 1IW7C 4GN4B 2WB1G 4L5RC 2MHVA 1HR0Q 1K28A 2SNSA 4UPAA 1DJRD 3MEFA 4DPGA 2X6GA 3CC7A 1SJHD 5C3WA 4M1UB 1I6VC 1RTNA 3IAYA 1WTVA 3PUVA 4BWGB 5KYIA 1SEBD 1ET6A 3STBC 5M9OA 4HN7A 1E0BA 4DR2Q 1DD2A 5GAHC 2N3SA 1HNZQ 1TS5A 2F0LA 3DXJC 2E2HH 5COYA 1PH1A 4K2KA 5TSSA 2WB1B 2F0UA 3S14B 4A3KH 1SYCA 3GTMH 3OMCA 5ELFA 5HGTA 2QW7A 2B2TC 4LF5Q 1JJ2A 3BYYB 5EBCA 3CCVA 2I07B 4A93G 4I65A 1K3BC 3QJYA 2ICIA 1STGA 1VQ4A 1Q81C 2XRSD 4L5QA 1KTKA 1NR4A 4RAUC 2EDGA 3S17H 4X3KA 1MBYA 4K2LA 2CKZB 4IJHA 4U673 1BCPC 4I7ZC 1HZ9A 2HCCA 1SMXA 1YNJC 1KD1C 3PUXA 1VQMA 1WOCA 3AFQA 2MUYA 1S5FD 1A2TA 4C3IB 4P73A 4LF6Q 1XNRL 3TRZA 1VQPA 5EAYA 3I3CA 3CW2C 2WKDA 4HR7B 3I4MH 3G6JB 3GTOB 2NVTB 1YJWA 1GOZA 1BF4A 4IFDI 3EA6A 1N34L 1BO0A 2ID0A 5NUCA 3GTQB 2BOSA 3KF6A 3E5SA 1XJVA 2B2WC 2L5TA 4E6IA 4X66Q 1AZPA 2K01A 4XQJA 5EGTA 1LO5D 1QJOA 4HSPA 4HIMA 1E2WA 1X3FA 1JORA 2K04A 3NBHA 2NVYH 2SOBA 1LM0A 1IBKL 1PH4A 4A93H 3DWPA 4IFDG 3S9WA 5CV5A 4GKJQ 2B63G 1Z6HA 3R8BA 2K33A 3VR6A 2OXPA 3TEHB 5KGUA 3CAMA 3Q8DA 2ZM6L 1N32Q 1XXGA 1JOOA 2PZWA 2JQOA 3MTSA 4JI6L 4GLAC 1C4QA 2QCPX 1RHPA 1VQIA 4GLVB 4YHHL 1R4QB 5D3DA 4GKKL 1VQOA 2EQSA 1OXVA 2NVQH 4KK7A 5E7NA 5IIFA 4RGMA 3T1YQ 1HQRD 1V1PA 4FF2A 1DOLA 1K83B 1TS4A 2KA7A 4DAMA 5C3XA 3J7AV 2JXMB 3KF8A 4DA2A 1PZID 4JOIA 4G7HC 1A0IA 1LABA 4FNFA 3W5OA 2KBNA 1PTOD 4ODGA 3HOZG 2AUJD 3RN2A 2Q2UA 2KEEA 5LMUL 1LT3D 1VQ8A 1XPRA 4RMFA 4DFAA 3G6EA 4IFDH 2KHJA 2R61A 2B63H 1PH8A 4POGA 4IPHA 1Q1BA 2EY2A 1UAPA 1SFOB 2EYPA 4DNTB 2V4DA 2E2IH 1F2MA 3PV0A 1K8OA 1SMYC 2A6EC 3K81C 3J81c 5EPLA 1ILPA 3H09A 3MVVA 5CGKA 4B3SQ 4B3MQ 2L0CA 1VQJA 1B9NA 4MHEA 5IP7H 1HHVA 2FHTA 4U68A 3VA5A 4FVMA 5M3MH 1DYQA 4KN7C 4EQ5A 1XNQL 1U5KA 1H9RA 2VNUD 1E1TA 3KLSX 3J81i 5DNFA 4BBRG 1SFOH 1NMGA 1NR2A 1VQCA 2Z0SA 1HNXQ 2EJFC 3GO5A 2UXCQ 1B2TA 4DR3L 3HOZH 1H95A 2F03A 1NUCA 4Z9CB 4RA8A 3T13A 4A3LH 1GUTA 2K03A 2NN6I 4QB4A 1UE1A 3K57A 5C44G 4AYBE 2ZXOA 1GUSA 1N33L 3A56A 2DNEA 3G7LA 3GTGH 1QCBD 2F1MA 3E0EA 2QA4A 3T16A 1X32A 4R4CA 1SE4A 4A3MH 4BBRB 4XQQA 1KAWA 2R93G 1SROA 3CF5A 2F0QA 3ONAB 4FF3A 5E3FA 1PFBA 4HIOA 1EEFD 2YTYA 1VMCA 4LF8Q 2AQ1B 4DR1Q 4BBSG 4DV1Q 2WB1E 5FKAC 4Q0FA 3S1RH 1QE6A 1L0XB 3F2CA 2OTLA 3GDEA 5C44B 2RDHA 5J1ZA 4JI0L 1Z9FA 1HCZA 4A3FG 1KNEA 1QUQB 2B2VA 1V9PA 3OW2A 2D9UA 2PMZE 2BDNA 3CCLA 4YCVA 1D5XC 3DEOA 1CI3M 1L1OC 2IWHA 4IPGA 2WAQE 4LMQD 5A2QL 5M5WB 2L4NA 2R93B 4RCOA 2JN4A 3NPPA 1ZKOA 3H3VI 4AIMA 1EQRA 2R7ZG 4BBSB 1PA6A 1BDOA 4UDUC 1FL0A 1O7IA 2ICEC 3RLFA 1N34Q 2AMCB 2EJMA 4A3FB 1A3UA 1CSQA 4RHSA 1HXYD 1ET9A 4NB3A 4EQOA 2HIVA 1RKNA 2ZJPA 2R93H 4V190 1QUQA 2E8GA 4MZ9A 2JEAI 3MWYW 2F0FA 1RJTA 2NN6H 2ZTEA 2OT2A 2QEJC 3AMUA 2R7ZB 3CMEA 1EZ6A 3GTJH 5JOBA 5LL6X 4JI4L 2AWOA 3A7LA 1LYLA 5IGFA 1T9HA 4DV3L 4DGZA 1XTDA 1MGSA 4H0LC 5M5YH 4NXML 1IYUA 5JEAH 2BH2A 3PIOA 4ZCKA 4JI6Q 4X62L 1X3QA 1MJEA 3OW7A 3URYA 3M7GA 2VW9A 1LT5D 3N6RA 4X65L 1ILQA 2JP1A 4YHHQ 2R7ZH 5EBDA 1EZ8A 1X6OA 1JE5A 2E2DC 1I6HH 4G7ZC 2H1EA 4IUTA 4DNRB 4JI7L 1EUJA 1X56A 3HGBA 1EQTA 3WOFA 2XVSA 1D2BA 3P20A 5IYCH 1A2UA 1NTGA 1MD2D 3VYRA 1DONA 2X69A 3NP8A 5KEEA 5AJ3Q 5IE8A 4ILWA 1SE8A 4A3GG 1F77A 1FR3A 3H3VH 1QILA 1SYFA 5LMUQ 4IO9A 4A3BG 3MXNA 3C1EA 1UE7A 1JE4A 3FPPA 2B8FA 1HZBA 1A15A 3DWAA 4LNQA 3X3NA 2UU9L 3QIAA 2EXZA 1I4RA 3KDFB 3MA2B 4A3JB 3C2PA 4HSVA 1TWFB 4A3IG 2Q8IB 2Z1CA 1X9NA 5M5XH 4ZUJA 2ZTCA 5C4JH 2D0PA 1AH9A 2FFKB 2NTTA 3DHQA 3RUZA 4A3GB 3D4WA 2OQKA 3ND8A 1ICWA 1VQAA 1CKNB 3L9AX 4JV5Q 1MI2A 3MXGA 4RGOS 2JEBI 3QO2A 3SDZA 2PI2E 4A3BB 1D1KA 3CPWA 1EIHA 2FMMA 1EOVA 4OWWB 1I3QB 2F0OA 2JA9A 3NUCA 3OPOA 1B44D 2JA6G 4GOPB 1IXRA 5ELCA 3RZOH 5BR8L 1SNDA 1M8AA 1E7ZA 2OTJA 3T51B 4A3IB 3S2HB 1YZ6A 3HRZC 4JC0A 3R2IA 1I94L 1VQHA 2QDLA 2UUAL 4C2MB 4A3GH 4P74A 2O4XA 4S3SA 5F2DA 2HIXA 3RLNA 1CA5A 1WTOA 4CHTB 2JA5G 3AEVA 1PRTB 3T56B 4LFCQ 1PTOF 2KENA 1V8QA 4XTCS 1QVGA 2I5MX 1SN8A 2IT1A 3QOLA 5EJWA 3K0YA 2XWBB 3FKIB 4L63B 3U50C 2E5LL 3S15B 2BCOA 1D8LA 4UP9A 3R93A 4UY8C 5D3IB 5FO9B 1LTLA 3CCUA 4YCWA 2UXBL 3ND9A 4PMCA 1K0RA 4ULLA 2F0DA 1PH2A 4ZAIA 4C3JH 1K8AC 1TWCB 2JA5B 3EBEA 3MFYA 4QCLA 2WIIB 4JW0A 1PTOB 1M4VA 2JA6H 3NQTA 1J6QA 2A6HD 1NJIC 2F0JA 1N36Q 1VQGA 3HOXG 4BXXG 4C3HG 3PUZA 4KLKA 1QNUA 5JJLA 4CJ1B 5J39A 1JC7A 4GNXC 4XQNA 3PO2H 4KV6A 1TY0A 3G48A 3GTLB 4CDDC 4KJNA 3KK7A 2ZXPA 5C4ZA 1S5BD 3NENA 3CCEA 1C9OA 4DNIA 4J15A 2CWPA 1N8RC 1OXUA 2K5QA 1JB3A 4FXGC 1O7LA 2RSOA 3SR1A 5K36H 3BVZA 1IBML 1PH5A 1V43A 4JBWA 3HOXB 2SNMA 4C3HB 1HUMA 3TMEA 4BY1B 3ER0A 3Q0AA 2R7FA 3GTLH 3HOUG 2A5HA 3A5ZB 2ZJRA 3BZCA 4LK1C 4DUYL 1FJGL 3CC2A 4KD4A 3J80i 4P2CB 1D7QA 1B1ZA 2KHIA 1LT4D 2F3VA 4DK6C 2XIWA 1EYAA 1BOSA 2NYZD 4DV3Q 2NUCA 2WP8J 3F2BA 1JWMD 5ELDA 1LTID 4RCNA 3HOXH 1BVSA 5CYUA 4C3HH 4BXXH 4O0AA 4JI5Q 5I2XA 3S1QB 4X62Q 1IYJB 2L15A 3D4RA 3K0XA 3RD4A 1DM0B 1HJPA 5E4XA 4OELB 1MKHA 4KMUC 5GAGC 5HURA 4X65Q 1R9TB 1VQ9A 1VQBA 1SXTA 4BY7H 3J81E 1BBUA 1Z7TA 1ZXTA 4TKOB 4XYQA 4HMJA 1SNCA 4N8X1 2X6LA 3QOJA 4JI7Q 1F9QA 1STNA 1KDAA 1GJXA 4LAAA 4QIWE 4KD3A 1EL0A 1IKMA 3NK9A 1PH6A 3EJIA 1XMQQ 5C3EH 2R92H 1B9MA 3M3YB 1XWEA 4A3EH 2F0IA 4IOAA 1X54A 4P71A 3HOUH 1CA6A 4DAVA 2B29A 2CW0D 5AFWA 2UU9Q 4IFDJ 5HY6A 4OO1I 1Y1VG 1B70B 1Y69U 4IUQA 5KIXA 2Q8RE 2EXDA 4GN3B 5G3LD 1STYA 1YITA 5C4HA 1F9RA 2F0TA 3V96A 2E2HB 1J5EL 4J1MA 3GV3A 1JOQA 3K80C 1JCKB 2SEBD 4A3KB 3LWUA 2HDLA 1OXTA 3GTMB 3U9SA 4LUVA 5LL6S 4DK0A 3P1HA 4PMBA 5CV4A 3M3YH 5ELNA 3Q23A 1C7YA 1U9RA 2K5HA 4X3TA 2O5IC 1DGSA 4KY6A 5I2YA 1PFSA 2E74C 2WACA 1WFQA 2FJ2A 3I4MG 3PUWA 1TWGH 4HMIA 2OCEA 1EYDA 4PQXA 2GN5A 3S17B 5DAUA 1KL9A 3DM1A 4DR6Q 2M00A 1EYCA 1X3GA 3D6WA 3K5OA 1C48A 3J7A5 1STBA 3A8KE 1W6KA 4N9PA 4YWLA 3QWNA 2N78A 2WKCA 4K14A 4NW2A 5I9OA 1HTPA 2UXDQ 4UHVA 1NY4A 4LFBL 5L37A 3SK4A 4J8QA 2RF4A 3G71A 1Q46A 3KF6B 1K9MC 3I4MB 2XRQD 1Y1VH 2D2CC 2C5CA 2KHSA 4EX5A 4DV6Q 1S4ZA 1FYCA 1TVXA 1XMOL 1JJGA 3SVMA 3NBHB 1I4PA 1DOMA 4HEDA 2K1BA 3KJOA 5LMNW 2RA4A 1D1IA 4TSSA 1F2YA 2GA4B 2R6GA 3Q22A 1HRJA 3CCQA 4OO1H 1EEID 2NVYB 5CORA 1TU2B 1PLFA 4A93B 3PCOB 2I5HA 4F88A 1WTHA 4OHJA 3QG1A 4MNOA 1G8ZD 4KJOA 1YIJA 3UI2A 5M3FG 2VB3X 4Y52H 2V1CC 2CFMA 1CK1A 5J3BA 2B2TA 4B3TL 2RKSA 4DV2L 2K28A 1I50H 2L9HA 4ME5A 2OEOA 1KC8C 2HQEA 2LFNA 2OWOA 1LUZA 1HQMC 4LF9L 1VQLA 1EY6A 2A74C 1N9WA 3GTPH 2HCIA 3D4DA 2IJ0A 1LTGD 1V1PB 4NXNL 2BH8A 4KHPL 4ZRZA 3KF8B 1EFWA 2MO1A 1ZEQX 1V1OA 1LACA 1OXXK 3A74A 1EIGA 4CDFC 2NVQB 3ITPA 1IZ6A 1NMFA 2XSCA 5M3FB 1O78A 2NZ1D 1QOHA 4LF4L 1JWUD 3E9IA 1B3QA 2EYHA 2K7VA 1Y8NB 1GHKA 1EYGA 5IGBA 1EU3A 1XPUA 2E75C 1ASYA 1NE3A 3A54A 5IWAQ 4HIDA 1Q1EA 1PRTD 3T4AC 3OTOQ 4XT1B 4RWSC 1FJGQ 3PQIA 5IP7G 2Z6KC 3U9OA 3PIO3 1A6XA 5M3MG 1BBXC 3L7ZC 2B2WA 4KKSA 1WJJA 2B63B 2IHEA 1ENCA 3R3OA 4DV4L 5M3FH 2J7ZA 4DR7L 1SDFA 4JI3Q 2HHHQ 4FP5D 4DV0L 1HNWL 2B3GA 3K7AH 3L0OA 5JEAJ 2BE5D 1YNND 3GP7A 2AWNA 4H13C 4X64L 3NELA 3HKZG 2E2IB 4N8FA 4R8NA 2EPBA 2FMCA 1Q8KA 1QB5D 4NMZA 4H02A 2IX1A 1AEXA 1EY8A 4A3LG 1B7YB 1JWSD 4RFBA 3MC0B 1SR3A 5C5LA 3WWVA 5M3MB 4DV7L 4LJZC 3TS2A 3OWEB 2CQOA 5JPMC 2Z6BA 3EN2A 1AE2A 5JJIA 3GV6A 1G51A 1I4QA 3T1HL 2KUMA 1GHJA 4A3MG 2BA0A 5CBEE 1V1QA 2NB0A 3HKZB 3ZYYX 4CGYB 4JI2Q 3FHWA 2MNAA 2K52A 4G4KA 4APVA 3HOZB 1XPOA 1KHIA 3KLRA 2ALYB 1FNVA 2ES2A 5I6YA 3CP0A 4F7XA 1MIUA 4PMWA 4AH6A 4DAYA 4FXKC 4K8IA 4OX9Q 4K0KL 4IUNA 4GLXA 3ULPA 1BXTA 1U0LA 3NSWA 3RZDH 1J5EQ 3H6MA 3GTGB 2GVBA 1XTCD 2KVMA 4B9WA 4A3MB 1ZYRC 2PPBC 2A6HC 1JJCB 4X3SA 4G57A 5BN4A 3I55A 2VQEL 3HKSA 1LTBD 2PNRC 5C0XI 1UEAB 3H94A 1CM9A 2KJXA 4QF4A 3S1RB 5BN3A 4V0BA 2Z4HA 1YVCA 4OONA 4QY7A 3X3MA 1RTOA 3KUPA 4OIJA 2QKIC 3NE5B 1A8VA 2KCCA 4HAEA 2B2UC 4DK1A 3S24A 1ML0D 2LXKA 2K4KA 2VY3A 2QDBA 1TXYA 3EIVA 1G6PA 4MTKA 2HUGA 3KBXA 3K59A 1PFNA 4GN5A 3I56A 1WTXA 1GUWA 3A0JA 4L6TB 3M7NA 3Q24A 2UUBL 2JA7G 4A4IA 4LFBQ 4XDXA 3D31A 3S1MH 2NN6G 4JI8L 5FJ8H 4POFA 4QUCA 3JAMc 2N55A 3TN2A 4FDBA 1RIPA 2Q8TA 1F9PA 4JK1C 2D0OA 4A3CG 1CKMA 1Q82C 5JPNC 1WD1A 1WYDA 2A1AA 5JEAG 2EVBA 3K5LA 3J80E 1PVOA 1TWHH 3VYTA 1L1OB 3UDXA 3P75A 3JAMi 4DXGA 1EY5A 5G3LF 4IOCA 3KJPA 2JA7B 3OIQA 1CHQD 1GUOA 1XNRQ 1Y1WH 4HJ9A 2IPKD 1JR0D 3NHHA 3FVQA 3GTJB 2Q2TA 1QNKA 2EYOA 5FLXc 4JYAL 1SSOA 3SK5A 4B3TQ 5CMDA 3TP5A 3NXWA 5FK9C 5IYCG 5DM63 2F0WA 1WCMH 5M5YB 3PSIA 4AQYL 5IP9H 1VDZA 1H9MA 1A3VA 4TRDA 4JI1L 3AU7A 3UDFA 3STBD 5C0XH 3ICEA 3J81L 1Z47A 4HJ7A 5I4DA 2F0HA 1W2BA 1IBLL 2JA7H 1D5MC 2ZTDA 1QG7A 1IBKQ 5EPJA 1L1OA 2E76C 3L2PA 1I6HB 2HQLA 4LF4Q 4ME3A 1EOTA 1U4PA 1EY0A 4A3CH 4DU9A 3Q6SA 1II3A 2ZM6Q 1S3OA 4OWTB 3NWSA 3MXNB 4RH6A 1GUGA 2AQ2B 1B3AA 1STHA 1QVCA 1WD0A 1VQFA 4DR4L 4RGNA 4GZYC 4KHZA 1H9KA 4F87A 3VR3A 1AZQA 4WJWA 1B53A 1A3TA 2QILA 5GROA 1PH7A 4GKKQ 4IUVA 3A5UA 2EYFA 3FDTA 5HGQA 4DV0Q 1YNJD 3H0GG 1L2FA 1MSGA 4PG3A 3W1BA 2J4XA 3KLSA 1K8GA 2F4VL 5M5XB 3HOVG 5C4JB 3LNNA 4ZK9B 2L55A 1PXUA 3H15A 4Y7NH 1RL2A 3WOEA 3DMUA 2Y0SG 1H9JA 2TSSA 1CSPA 2F0SA 1TT2A 2F0NA 3JAML 1M90C 4DUZL 1U4LA 1X3EA 3ERSX 2QEXA 4R1JA 3RZOB 2RDGA 3T1HQ 2I0QA 1ESRA 2RBMA 2NVXH 2LSSA 2VUMH 3AB9A 4IUPA 3J7YW 2RCFA 3HOVB 1PYSB 1SNQA 4K6LA 3UDIA 1JOKA 3BDOA 5JVG3 3CRKC 2Y0SB 3TDQA 1EY9A 1HFGA 4C3JG 1SYDA 3HKZE 3PMFA 1SBBB 1TIID 4JPBW 4NKLA 1PRTF 5ISRA 3DEPA 4JBJA 4QUFA 1XNQQ 4LFAL 1DCZA 1CKOA 3H0GH 4LWCA 4KI0A 4ZYSA 2HDMA 3O13A 4FF1A 1HR0L 2GVAA 3HOVH 1QWYA 1HH2P 5IY0A 5GAEC 3PO2G 4KKUA 1VS0A 4DR3Q 1XYIA 1HR0W 2YU9H 4GOPC 4C3JB 4PZ7A 2F0VA 3P7JA 5KNBA 4DR2L 3RMHA 1H9SA 2B39A 1MSHA 1HNZL 2PQEA 2JA6B 4Q5VA 1N33Q 2A69D 3ZJYC 5K36G 1SAPA 5ELOA 1EY7A 2UUCL 3S16H 3CU7A 1HFNA 3CRLC 4B08A 4WJ3M 2CH4A 2C9OA 4HJ5A 1EWCA 3PO2B 1JT8A 2AQ3B 3IFDA 1ESFA 3W2DA 3F2UA 1K73C 4O1NA 1PRTC 1G91A 3OMGA 1GO3E 2LS01 4K5VA 1KDBA 4CJ2C 4JI0Q 4CKEA 1CTMA 4EQNA 1RD9D 1Q3LA 3VYSA 3FEWX 3MEHA 1SMYD 3CC4A 1UNSA 1QZGA 2DNCA 3M4OH 2K5VA 4IN3A 3AQQA 3NEMA 3SGIA 1WVLA 2NTSA 4ID6A 4MN3A 4UP7A 3TP8A 4GNXB 2BE5C 3T53B 3CCMA 3BJUA 4BY7G 3A8JE 5GQOA 5EKLA 3IRBA 4ZKBB 2E2JH 3KFUA 1PTOC 1OXSC 1NNXA 3OSOA 3RNUA 2EIFA 3J7AF 3M4YA 4OWXB 3I4OA 3I7FA 3BVGA 1IKLA 3J80c 2IX0A 4JI1Q 3AYHB 3F8TA 1KDCA 4IQZA 3EROA 1G2SA 4K5XA 4X66L 5C3EG 3TS0A 3C3LA 2R92G 3HOYH 4A3EG 4CDEC 1VQ7A 1LTAD 1EQQA 2PQAA 3DUZA 4BY7B 3FMCA 4M8AA 1GD7A 2PW5A 4FF4A 4KY7A 4GNXA 4JI4Q 4G7OC 2B2YC 4XIGS 4NXMQ 2J0TD 1N32L 2KEDA 3S1NH 2WV6D 4QMGA 1LTRD 4DR4Q 1CUKA 5KYLA 3CCRA 1E2ZA 4DXFA 5C3EB 2R92B 4A3EB 2AKWB 2QGQA 3HOUB 4K8JA 2H4OA 1VQDA 1KLUD 1Q90A 2D62A 4H7BA 5ELEA 1NBWA 4EVOA 2F3WA 3VA7A 4TVAB 4LF7L 2B8GA 2OQ0A 5D14A 3GQBA 3ULLA 3L3OC 1G291 1UWVA 3OWFA 2AUKA 3BDLA 2VZAA 1DOKA 1PMRA 4NP5A 3CQZH 1IYVA 3V05A 4DUZQ 1EWIA 2LMCB 3C1FA 1CZGA 3SK8A 1TWGB 3PO3H 4EGVA 1HTLD 5EKKA 4J6HA 5IYDH 4CBVA 2KCNA 1SJED 2F3IA 3D8GA 5CC4A 3FP9A 4BA2I 5DEHA 3TREA 2L12A 2VL6A 3TQYA 1SYGA 3ERQA 2YTVA 3OYYA 4AYBG 3GTKH 2FXQA 1LLRD 1Q7YC 5IGCA 4B3ML 1LTTD 4X3UA 3G4SA 2VS1A 3UDGA 4OO1G 3FPUB 2DJGC 2F4IA 4OL7A 3DLLA 1TWAH 1SRUA 1Y1VB 4X6AH 5BR8Q 2CQAA 2D5DA 3JAME 2PCFB 2OF1A 1GUNA 3FRPB 3J80L 2VB2X 5JJKA 4R9WA 4CDCC 1BCPF 4IUUA 5K5PA 2JA8H 4AYBB 3BS1A 1I94Q 4ZLTF 1HNXL 2K5DA 4OXPA 1WTWA 2UUAQ 3RN5A 2UXCL 3SE0A 5C4XH 4O2DA 4IZ8A 2YYZA 3BU2A 1VQ6A 1HPCA 3S2DH 1FNWA 4RG1A 1WTPA 3VDYA 2WAQG 3J7ZC 4DV5L 1EIYB 2VXWA 5GADC 1C8CA 1K0SA 4R4OA 3CD6A 2UUCQ 5FLXE 1FNUA 5LMNL 1IL2A 2E5LQ 4YWKA 1BCPB 2N8NA 1I50B 3HFZB 5KNDA 5JAVA 3PF5A 2EYMA 1HUNA 4C3IG 3GTPB 4LF8L 2UXBQ 4DR1L 1I5FA 2PMZB 3KYHC 4DV1L 3D6CA 1NSNS 4WFN3 2NZOA 2WAQB 3MFGA 2F0GA 1I4GA 2R7DA 1KNAA 4QL5A 3I2ZA 5IGGA 2F0PA 3A8IE 4K5WA 5FO7B 4C1NK 1GKHA 1Y8OB 3S14H 3RR5A 2XN9C 3U4VA 1PHJA 1GVPA 3I73A 3LWEA 3CHBD 1UEBA 1IHZA 4RGTA 5D65A 1EIFA 2XWJB 3VYUA 3W3AA 1SNPA 3R2TA 5T1IA 1E3PA 2Z8LA 1IBMQ 1J8IA 5CV9A 5KRUA 3K7AB 2K5NA 3KBGA 3E3XA 5C0XJ 4PZ8A 1UUPA 2O2LD 3CPFA 3K7UC 4WRDA 4C3IH 2TMPA 4LUZA 2WFWA 4JOIC 4DUYQ 2RQXA 3OIPA 1SNMA 2CHBD 1RDPD 1SE3A 1HA5A 1F2LA 3GTOH 2NVTH 3D3RA 2F0EA 2WINB 1FVIA 1YHBA 4IPDA 2CVRA 5C6AA 3KLWA 3GTQH 2LY7A 2EZVA 3TP6A 5IT9E 4OEMB 1M1KC 1FGBD 3EQLC 3NQIA 4KTAA 4HJAA 2KQ3A 4DAYB 2MQHA 3NTKA 3K5NA 3SHLA 4DKAC 1YHQA 1FGUA 1VMPA 3U4ZA 3HZXA 1TQOA 3RZDB 1CQFA 1NCVA 5CBAE 2JYOA 4LF7Q 2PNHA 4JG2A 2Z6KA 2A69C 1RCVD 2NWGA 5AJ3L 4WORA 1JMCA 5IGDA 2HD3A 2A8VA 3GD7A 1YJ9A 5CV7A 3SXHA 2A68D 1I4XA 5FJ8G 1GM5A 5H1SE 3SEBA 4FO2A 1AP0A 1UE6A 1X55A 3BDCA 1RODA 1AE3A 2JSOA 4EQPA 3HG9A 3V2TA 1K83H 1D5ZC 2HT1A 3I70A 5DLQE 2PZTA 1K8MA 3LX0A 1LV9A 4PV1C 5FOBB 1BR9A 1EQVA 1GXDC 3QB3A 3K58A 2MPMA 4DN4M 3I91A 4JV5L 3TSSA 1Y1WG 3S1MB 1YNXA 3UE1A 4JBKA 4R8IA 1TKWB 3CMAA 2RCNA 3NTIA 5BN5A 1S40A 3IFTA 1TY2A 2LKVA 1AFPA 1WCMG 4HIKA 4XYOA 5KNCA 1F9SA 1TS3A 5IP9G 2KOLA 2G9DA 2F0MA 5FLMG 1TWHB 2JK8A 3BZDB 5C0XG 4C1NI 4KHVA 2B2VC 2PW7A 4B9XA 2PI2A 1KRTA 4YY3L 1Y1WB 2KCTA 4DR5L 5JJZA 1E1OA 2IW3A 4DV5Q 2N88A 4RKLA 4HCEA 4LFCL 2K75A 4PZ6A 2ENBA 5LMNQ 1MJCA 1UE5A 1U4MA 1B8AA 1P16A 2DY8A 1WCMB 4QQBX 4UP8A 5E4WC 1XMOQ 1BUVT 4XT3B 3WDNA 2O5JC 4ALPA 5FO8B 3CKIB 1JB7A 2MJ8A 1L0YB 4XXEA 2I46A 2K6AA 1PH3A 2NZHA 2P5ZX 1CFMA 1CQVA 4KN4C 4I7AA 2B2UA 3F2DA 1CZWA 4IALA 1EWHA 1X3PA 2DY7A 4RKBA 5LHY1 1VF5C 1IW7D 4LUOA 1SYBA 3LGJA 3UE0A 1B50A 2Q2HA 1JICA 1CT1D 2K14A 1N36L 1HZCA 4DV2Q 4B3RL 1I4HA 2EE1A 1O80A 1WI5A 1STEA 4BBRH 4A75A 2RDFA 4GS3A 4LF9Q 2DJFC 5FLMH 3I72A 4L8JA 2DN8A 2XGTA 4NXNQ 4KHPQ 2EYLA 2VQFL 1R4PB 3OOCA 1AN8A 3K8AA 2F0KA 5C44H 3NBIA 2ASBA 2Z4IA 2CW0C 3NTHA 3B6YA 1PYBA 2VUMG 5IYBG 4PNYA 3MAQA 3E6ZX 5JVH3 1A62A 1QZHA 2SDFA 3CXCA 1TS2A 2ATWA 5M5WH 1VQEA 1PZKD 2ZXRA 4Y7NB 4O42A 1VF7A 4BBSH 1ONLA 4ZQ3A 1J9OA 3VR5A 1BCPD 2RHSB 5DM73 1QVFA 3M85A 1VQNA 4DV4Q 4A3FH 3M4PA 4R4IA 2NBFA 4DR7Q 1W6JA 1HNWQ 2VUMB 2NVXB 1E22A 1LT6D 2CCZA 3QR8A 1CHPD 4IJLA 4X64Q 3RLOA 3NWTA 4JI5L 3H3VC 4HJ8A 2K50A 2KCMA 4NPSA 4IPCA 1SNOA 3W1GA 3VR4A 4FYDA 3E0JA 2DGYA 4QIWB 4CKCA 1EY4A 1X65A 2K5WA 2RHQB 4DV7Q
chains in the Genus database with same CATH topology
1NAPA 3H0GB 3PUYA 2L1BA 1S5DD 3BVMA 3PIP3 3MHBA 2EOTA 1HA6A 1G6ZA 1H9SB 3IKJA 3K6OA 4BS9A 1D6EC 2YU9B 1PYWD 3IL8A 1PDQA 4TQUS 5I9PA 1TR5A 5FLXL 1OO9B 2BDOA 5C5MA 4OGQC 3S16B 4RHRA 4ZUIA 2RSNA 1SE2A 2IX3A 4ABNA 1B4OA 2L11A 2EYJA 2K05A 2ZT9C 1EFID 2EJGC 4FXDA 1DZ1A 3BYTB 4DAPA 3MXPA 1WTQA 1Q8IA 2IL8A 3M4OB 3SK6A 2K32A 4CJ0B 3TZDA 3EFXD 4N9TA 5EQ0A 1O7YA 2XNAC 4ZKCB 5IODA 5T1GA 2E2JB 1AW7A 5CV8A 1JQYD 4KY5A 2M9VA 4UAIA 2MP1A 4BA1I 3BG3A 1IL8A 3MZ5A 2A6ED 4KKTA 4MIUA 4F8MA 3I4LA 3K5MA 2M2LA 3HOYB 1YNNC 5ELBA 5CV6A 2JE6I 3C46A 5J22A 1ZYRD 1F2ZA 1KLGD 5IT9L 3S1NB 2PO4A 1S5CD 1BQQT 1EU4A 1Y8PB 2MGSA 1VCIA 2PYKA 1PZJD 1ENAA 3A7AB 3TZUA 2BA1A 2A68C 1PTOH 4IURA 3VR2A 3DWQA 4HCSA 1RF2D 4OIKA 3HOWB 1O7ZA 1S5ED 4DF7A 1STAA 5A35A 1KABA 2PZUA 1T5XD 1T5EA 5A2QE 1LTSD 3HP3A 4C56C 3I4NB 3CQZB 4A3DB 2EY1A 3N52A 3PO3B 4NDXA 5CR3A 1FD7D 3H91A 3HEJA 4CKBA 4K6DA 1U4RA 5IGEA 3EVQA 2FINB 3GTKB 1SYEA 2B2YA 2RVLA 1DXMA 3A55A 2A73B 1KAAA 2EY6A 2R3ZA 1G2TA 1TWAB 3TBIB 5E1FA 5EKIA 3OHXC 1PFMA 2KECA 2JA8B 5IOCA 1Q12A 5I6WA 1BNZA 1XX8A 2QF7A 1WTRA 5C4XB 3I8ZA 4H44C 4HTHA 2EY5A 5EPKA 3S2DB 2G9HD 4YIJA 3I90A 3MXUA 3TP7A 1E2VA 1ENFA 3HS0C 1IW7C 2MHVA 2SNSA 1DJRD 2X6GA 1SJHD 5C3WA 4M1UB 1I6VC 1RTNA 3IAYA 1WTVA 3PUVA 4BWGB 5KYIA 1SEBD 1ET6A 5M9OA 4HN7A 1E0BA 1DD2A 1TS5A 2F0LA 3DXJC 5COYA 4K2KA 5TSSA 2WB1B 2F0UA 3S14B 1SYCA 3OMCA 5ELFA 5HGTA 2B2TC 3BYYB 5EBCA 2I07B 4I65A 3QJYA 2ICIA 1STGA 2XRSD 1KTKA 1NR4A 4RAUC 2EDGA 4X3KA 1MBYA 4K2LA 4U673 1BCPC 4I7ZC 2HCCA 1YNJC 3PUXA 2MUYA 1S5FD 1A2TA 4C3IB 3I3CA 2WKDA 4HR7B 3G6JB 3GTOB 2NVTB 1GOZA 1BF4A 4IFDI 3EA6A 1BO0A 2ID0A 5NUCA 3GTQB 2BOSA 3E5SA 2B2WC 2L5TA 4E6IA 1AZPA 2K01A 4XQJA 5EGTA 1LO5D 1QJOA 4HSPA 1E2WA 1JORA 2K04A 3NBHA 2SOBA 3DWPA 4IFDG 3S9WA 5CV5A 1Z6HA 3R8BA 2K33A 3VR6A 2OXPA 5KGUA 1XXGA 1JOOA 2PZWA 3MTSA 1C4QA 2QCPX 1RHPA 1R4QB 5D3DA 1OXVA 4KK7A 5IIFA 4RGMA 1HQRD 1V1PA 4FF2A 1DOLA 5C3XA 1K83B 1TS4A 2KA7A 3J7AV 2JXMB 3KF8A 4DA2A 1PZID 4G7HC 1LABA 4FNFA 1PTOD 4ODGA 2AUJD 2KEEA 1LT3D 4DFAA 4IFDH 2R61A 1Q1BA 2EY2A 1UAPA 1SFOB 2EYPA 4DNTB 2V4DA 1F2MA 3PV0A 1K8OA 1SMYC 2A6EC 5EPLA 1ILPA 3H09A 3MVVA 5CGKA 2L0CA 1B9NA 4MHEA 1HHVA 2FHTA 4U68A 3VA5A 4FVMA 1DYQA 4KN7C 1H9RA 2VNUD 3KLSX 5DNFA 1NR2A 2EJFC 3GO5A 1B2TA 2F03A 1NUCA 4Z9CB 4RA8A 3T13A 1GUTA 2K03A 2NN6I 4QB4A 3K57A 2ZXOA 1GUSA 3A56A 2DNEA 3G7LA 1QCBD 2F1MA 3T16A 1X32A 1SE4A 4BBRB 4XQQA 2F0QA 3ONAB 4FF3A 5E3FA 1PFBA 1EEFD 1VMCA 2AQ1B 5FKAC 4Q0FA 1QE6A 1L0XB 5C44B 2RDHA 5J1ZA 1HCZA 1KNEA 2B2VA 2D9UA 2BDNA 1D5XC 3DEOA 1CI3M 2IWHA 4LMQD 5A2QL 5M5WB 2R93B 2L4NA 4RCOA 3NPPA 1ZKOA 4BBSB 1BDOA 4UDUC 2ICEC 3RLFA 2EJMA 4A3FB 1A3UA 4RHSA 1HXYD 1ET9A 4EQOA 1RKNA 4V190 2JEAI 3MWYW 2F0FA 1RJTA 2NN6H 2R7ZB 2OT2A 2QEJC 3AMUA 1EZ6A 5JOBA 5LL6X 2AWOA 3A7LA 5IGFA 4DGZA 1MGSA 4H0LC 1IYUA 5JEAH 1X3QA 3OW7A 3URYA 3M7GA 1LT5D 3N6RA 1ILQA 2JP1A 5EBDA 1EZ8A 2E2DC 4G7ZC 2H1EA 4IUTA 4DNRB 3HGBA 1EQTA 3WOFA 2XVSA 1D2BA 3P20A 1A2UA 1MD2D 3VYRA 1DONA 2X69A 3NP8A 5KEEA 4ILWA 1F77A 1FR3A 1QILA 1SYFA 3MXNA 3C1EA 1JE4A 3FPPA 2B8FA 1A15A 3DWAA 3X3NA 3QIAA 2EXZA 1I4RA 3MA2B 4A3JB 3C2PA 4HSVA 1TWFB 2Q8IB 2Z1CA 4ZUJA 2FFKB 2NTTA 3DHQA 3RUZA 4A3GB 3D4WA 3ND8A 1ICWA 3L9AX 1MI2A 3MXGA 4RGOS 2JEBI 3QO2A 3SDZA 4A3BB 1D1KA 1EIHA 2FMMA 1I3QB 2F0OA 3NUCA 3OPOA 1B44D 5ELCA 1SNDA 1M8AA 3T51B 4A3IB 3S2HB 3HRZC 3R2IA 4C2MB 2O4XA 4S3SA 5F2DA 1CA5A 1WTOA 4CHTB 1PRTB 3T56B 1PTOF 1V8QA 4XTCS 3QOLA 2IT1A 5EJWA 3K0YA 2XWBB 3FKIB 4L63B 3S15B 2BCOA 3R93A 5D3IB 5FO9B 3ND9A 4PMCA 4ULLA 2F0DA 4ZAIA 1TWCB 2JA5B 3MFYA 4QCLA 2WIIB 1PTOB 1M4VA 3NQTA 2A6HD 2F0JA 4C3HG 3PUZA 1QNUA 4CJ1B 5J39A 1JC7A 4XQNA 4KV6A 1TY0A 3GTLB 4KJNA 3KK7A 2ZXPA 5C4ZA 1S5BD 1OXUA 2K5QA 1JB3A 4FXGC 1O7LA 2RSOA 3SR1A 5K36H 3BVZA 1V43A 4JBWA 3HOXB 2SNMA 4C3HB 1HUMA 3TMEA 4BY1B 3Q0AA 2A5HA 4LK1C 4KD4A 4P2CB 1B1ZA 1LT4D 2F3VA 2XIWA 1EYAA 1BOSA 2NYZD 2NUCA 2WP8J 1JWMD 5ELDA 1LTID 4RCNA 5CYUA 5I2XA 3S1QB 3D4RA 3RD4A 1DM0B 5E4XA 4KMUC 5HURA 1R9TB 1SXTA 3J81E 1Z7TA 1ZXTA 4TKOB 4XYQA 4HMJA 1SNCA 2X6LA 3QOJA 1F9QA 1STNA 1KDAA 1GJXA 4LAAA 4KD3A 1EL0A 1IKMA 3NK9A 3EJIA 1B9MA 3M3YB 1XWEA 2F0IA 1CA6A 4DAVA 2CW0D 5AFWA 4IFDJ 4OO1I 1Y69U 4IUQA 5KIXA 2Q8RE 5G3LD 1STYA 5C4HA 1F9RA 2F0TA 3V96A 2E2HB 4J1MA 3GV3A 1JOQA 1JCKB 2SEBD 4A3KB 3LWUA 2HDLA 1OXTA 3GTMB 3U9SA 5LL6S 4DK0A 3P1HA 4PMBA 5CV4A 3Q23A 1U9RA 4X3TA 2O5IC 4KY6A 5I2YA 2E74C 2WACA 2FJ2A 3PUWA 4HMIA 1EYDA 4PQXA 3S17B 5DAUA 3DM1A 2M00A 1EYCA 3D6WA 3K5OA 1C48A 1STBA 3A8KE 1W6KA 4N9PA 3QWNA 2WKCA 4K14A 4NW2A 5I9OA 1HTPA 3SK4A 4J8QA 3I4MB 2XRQD 2D2CC 2C5CA 2KHSA 1S4ZA 1FYCA 1TVXA 3SVMA 1I4PA 4HEDA 1DOMA 2K1BA 2RA4A 1D1IA 4TSSA 1F2YA 2GA4B 2R6GA 3Q22A 1HRJA 4OO1H 1EEID 2NVYB 5CORA 1TU2B 1PLFA 4A93B 4F88A 4OHJA 3QG1A 1G8ZD 4KJOA 3UI2A 2VB3X 1CK1A 2B2TA 2RKSA 2K28A 2L9HA 4ME5A 2OEOA 2HQEA 2LFNA 1HQMC 1EY6A 2A74C 2HCIA 3D4DA 2IJ0A 1LTGD 1V1PB 4ZRZA 1ZEQX 1V1OA 1LACA 1OXXK 1EIGA 2NVQB 3ITPA 2XSCA 5M3FB 1O78A 2NZ1D 1QOHA 1JWUD 2EYHA 2K7VA 1Y8NB 1GHKA 5IGBA 1EU3A 2E75C 3A54A 1Q1EA 1PRTD 3T4AC 4XT1B 4RWSC 3U9OA 3PIO3 1A6XA 1BBXC 3L7ZC 2B2WA 4KKSA 2B63B 1ENCA 3R3OA 2J7ZA 1SDFA 4FP5D 5JEAJ 2BE5D 1YNND 3GP7A 2AWNA 4H13C 2E2IB 4R8NA 2EPBA 2FMCA 1QB5D 4NMZA 2IX1A 1AEXA 1EY8A 1JWSD 4RFBA 3MC0B 5C5LA 5M3MB 4LJZC 3OWEB 5JPMC 3GV6A 1I4QA 2KUMA 1GHJA 2BA0A 5CBEE 2NB0A 3HKZB 3ZYYX 4CGYB 4G4KA 3HOZB 3KLRA 1FNVA 5I6YA 4F7XA 4PMWA 4DAYA 4FXKC 4K8IA 4IUNA 1BXTA 3NSWA 3H6MA 3GTGB 1XTCD 2KVMA 4B9WA 4A3MB 1ZYRC 2PPBC 2A6HC 4X3SA 4G57A 5BN4A 1LTBD 2PNRC 5C0XI 1UEAB 3H94A 1CM9A 2KJXA 4QF4A 3S1RB 5BN3A 4V0BA 2Z4HA 3X3MA 1RTOA 3KUPA 4OIJA 2QKIC 3NE5B 2KCCA 4HAEA 2B2UC 4DK1A 1ML0D 2QDBA 2HUGA 3KBXA 3K59A 1PFNA 1WTXA 1GUWA 4L6TB 3M7NA 3Q24A 4XDXA 3D31A 2NN6G 4QUCA 2N55A 3TN2A 2Q8TA 1F9PA 4JK1C 5JPNC 1WD1A 5JEAG 2EVBA 3K5LA 3J80E 3VYTA 3P75A 4DXGA 1EY5A 5G3LF 2JA7B 3OIQA 1CHQD 1GUOA 2IPKD 1JR0D 3NHHA 3FVQA 3GTJB 1QNKA 2EYOA 1SSOA 3SK5A 5CMDA 3TP5A 3NXWA 5FK9C 5DM63 2F0WA 5M5YB 1VDZA 1H9MA 1A3VA 4TRDA 3AU7A 5C0XH 3J81L 1Z47A 5I4DA 2F0HA 1D5MC 1QG7A 5EPJA 2E76C 1I6HB 1EOTA 1U4PA 1EY0A 4DU9A 3Q6SA 1II3A 3NWSA 4RH6A 1GUGA 2AQ2B 1B3AA 1STHA 1WD0A 4RGNA 4GZYC 4KHZA 1H9KA 4F87A 3VR3A 1AZQA 4WJWA 1B53A 1A3TA 2QILA 4IUVA 2EYFA 3FDTA 1YNJD 1MSGA 2J4XA 3KLSA 5M5XB 5C4JB 3LNNA 4ZK9B 2L55A 1PXUA 3WOEA 3DMUA 1H9JA 2TSSA 2F0SA 1TT2A 2F0NA 3JAML 1U4LA 3RZOB 2RDGA 1ESRA 2RBMA 3AB9A 4IUPA 3J7YW 3HOVB 1SNQA 4K6LA 1JOKA 3BDOA 5JVG3 3CRKC 2Y0SB 3TDQA 1EY9A 1HFGA 4C3JG 1SYDA 3PMFA 1SBBB 1TIID 4NKLA 1PRTF 5ISRA 3DEPA 4QUFA 1DCZA 4KI0A 4ZYSA 2HDMA 3O13A 4FF1A 1QWYA 4KKUA 1XYIA 4C3JB 2F0VA 3P7JA 5KNBA 3RMHA 1H9SA 2B39A 1MSHA 2PQEA 2JA6B 4Q5VA 2A69D 5K36G 1SAPA 1EY7A 3CU7A 1HFNA 3CRLC 4B08A 2C9OA 1EWCA 3PO2B 2AQ3B 3IFDA 3W2DA 1ESFA 3F2UA 4O1NA 1PRTC 1G91A 3OMGA 2LS01 4K5VA 1KDBA 4CJ2C 4CKEA 4EQNA 1CTMA 1RD9D 1Q3LA 3VYSA 3FEWX 3MEHA 1SMYD 1UNSA 2DNCA 4IN3A 1WVLA 2NTSA 4ID6A 4MN3A 3TP8A 2BE5C 3T53B 3A8JE 5EKLA 4ZKBB 1PTOC 1OXSC 3OSOA 3J7AF 3M4YA 3BVGA 1IKLA 2IX0A 4IQZA 1KDCA 3EROA 1G2SA 4K5XA 3C3LA 1LTAD 3DUZA 4BY7B 3FMCA 4M8AA 2PW5A 4FF4A 4KY7A 4G7OC 2B2YC 4XIGS 2J0TD 2KEDA 2WV6D 4QMGA 1LTRD 5KYLA 1E2ZA 4DXFA 5C3EB 2R92B 4A3EB 3HOUB 4K8JA 2H4OA 1KLUD 1Q90A 2D62A 4H7BA 5ELEA 4EVOA 2F3WA 3VA7A 2B8GA 5D14A 3GQBA 3L3OC 1G291 3OWFA 2AUKA 3BDLA 1DOKA 1PMRA 4NP5A 1IYVA 3V05A 2LMCB 3C1FA 1CZGA 3SK8A 1TWGB 4EGVA 1HTLD 5EKKA 4J6HA 4CBVA 2KCNA 1SJED 3D8GA 5CC4A 4BA2I 5DEHA 2L12A 1SYGA 3ERQA 1LLRD 5IGCA 1LTTD 4X3UA 4OO1G 3FPUB 2F4IA 4OL7A 1Y1VB 2CQAA 2D5DA 3JAME 2PCFB 2OF1A 1GUNA 3FRPB 3J80L 2VB2X 4R9WA 1BCPF 4IUUA 5K5PA 4AYBB 3BS1A 4ZLTF 2K5DA 1WTWA 3SE0A 4IZ8A 2YYZA 1HPCA 1FNWA 1WTPA 2VXWA 1C8CA 5FLXE 1FNUA 1BCPB 1I50B 5KNDA 5JAVA 2EYMA 1HUNA 4C3IG 3GTPB 2PMZB 3D6CA 1NSNS 4WFN3 2WAQB 3MFGA 2F0GA 1I4GA 1KNAA 5IGGA 2F0PA 3A8IE 4K5WA 5FO7B 4C1NK 1Y8OB 2XN9C 3I73A 3LWEA 3CHBD 1IHZA 4RGTA 5D65A 2XWJB 3VYUA 3W3AA 1SNPA 3R2TA 5T1IA 2Z8LA 1J8IA 5CV9A 5KRUA 3K7AB 3KBGA 5C0XJ 1UUPA 2O2LD 4WRDA 2TMPA 2RQXA 3OIPA 1SNMA 2CHBD 1RDPD 1SE3A 1HA5A 1F2LA 3D3RA 2F0EA 2WINB 2CVRA 5C6AA 2LY7A 2EZVA 3TP6A 5IT9E 1FGBD 3EQLC 3NQIA 4KTAA 2KQ3A 3NTKA 3K5NA 3SHLA 1VMPA 3HZXA 1TQOA 3RZDB 1CQFA 1NCVA 5CBAE 2JYOA 2A69C 1RCVD 2NWGA 4WORA 5IGDA 3GD7A 5CV7A 3SXHA 2A68D 1I4XA 3SEBA 4FO2A 1AP0A 3BDCA 1RODA 4EQPA 3HG9A 3V2TA 1D5ZC 3I70A 2PZTA 1K8MA 3LX0A 1LV9A 4PV1C 5FOBB 1BR9A 1EQVA 1GXDC 3QB3A 3K58A 2MPMA 4DN4M 3I91A 3TSSA 3S1MB 4R8IA 1TKWB 3NTIA 5BN5A 3IFTA 1TY2A 2LKVA 1AFPA 4XYOA 5KNCA 1F9SA 1TS3A 2KOLA 2G9DA 2F0MA 1TWHB 3BZDB 5C0XG 4C1NI 4KHVA 2B2VC 2PW7A 4B9XA 1Y1WB 5JJZA 2IW3A 2N88A 4RKLA 4HCEA 2ENBA 1U4MA 2DY8A 1WCMB 5E4WC 1BUVT 4XT3B 3WDNA 2O5JC 5FO8B 3CKIB 2MJ8A 1L0YB 4XXEA 2I46A 2K6AA 1CFMA 1CQVA 4KN4C 2B2UA 1CZWA 4IALA 1EWHA 1X3PA 2DY7A 4RKBA 5LHY1 1VF5C 1IW7D 1SYBA 1B50A 1JICA 1CT1D 1I4HA 2EE1A 1O80A 1STEA 2RDFA 3I72A 4L8JA 2DN8A 2EYLA 1R4PB 3OOCA 1AN8A 2F0KA 3NBIA 2Z4IA 2CW0C 3NTHA 4PNYA 3MAQA 3E6ZX 5JVH3 2SDFA 1TS2A 1PZKD 2ZXRA 4Y7NB 4O42A 1VF7A 1ONLA 4ZQ3A 1J9OA 3VR5A 1BCPD 5DM73 3M85A 2NBFA 1W6JA 2NVXB 2VUMB 1LT6D 1CHPD 3NWTA 3H3VC 1SNOA 3VR4A 4FYDA 3E0JA 4QIWB 4CKCA 1EY4A 2K5WA 2JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXW A;  5CV6 A;  4KTA A;  2PW5 A;  4E6I A;  2F0W A;  5IGF A;  4IZ8 A;  4NKL A;  5EGT A;  4DGZ A;  1F2Y A;  4HMJ A;  5ISR A;  2KQ3 A;  4HTH A;  2EY5 A;  5J22 A;  1SNC A;  4KY7 A;  4YIJ A;  3QOJ A;  4TRD A;  1A3V A;  3SHL A;  3QOL A;  1JOR A;  1F2Z A;  1STN A;  2SOB A;  3TP7 A;  1KDA A;  1NUC A;  3S9W A;  5CV5 A;  4KJO A;  3MHB A;  5I6Y A;  3T13 A;  4LAA A;  2F0H A;  4F7X A;  4IAL A;  4KD3 A;  4K8I A;  4QB4 A;  4RKB A;  4QMG A;  2RKS A;  3HZX A;  3NK9 A;  1TQO A;  4IUN A;  2OXP A;  2SNS A;  5KYL A;  1EZ8 A;  1SYB A;  4PMC A;  5KGU A;  3EJI A;  3H6M A;  5JAV A;  2F0D A;  4ME5 A;  2EYM A;  2OEO A;  2PYK A;  2HQE A;  1JOO A;  2F0V A;  1ENA A;  5I9P A;  2F0I A;  4B9W A;  1TR5 A;  2PZW A;  4K8J A;  5C3W A;  1EY6 A;  3T16 A;  1EY0 A;  2PQE A;  5KYI A;  4H7B A;  3D4D A;  4G57 A;  4WOR A;  1II3 A;  5C5M A;  4DU9 A;  1A2U A;  5IGD A;  2F0Q A;  3D6C A;  2RDF A;  5M9O A;  3NQT A;  1NSN S;  5E3F A;  1EY7 A;  2F0J A;  5KIX A;  5CV7 A;  3SXH A;  3TP6 A;  3NP8 A;  4EVO A;  5KEE A;  1STH A;  1STY A;  2F0G A;  4ZUI A;  2F0L A;  5C4H A;  2F0T A;  4QF4 A;  2F3W A;  1SYF A;  3ITP A;  4J1M A;  5IGG A;  4DF7 A;  5J39 A;  1STA A;  1JOQ A;  2F0P A;  3BDC A;  5IIF A;  2EYJ A;  2EYL A;  4KV6 A;  1KAB A;  4K2K A;  1A3T A;  2PZU A;  4EQP A;  5C3X A;  2EYH A;  3C1E A;  2F0U A;  3V2T A;  4K5W A;  2F0K A;  5J1Z A;  5IGB A;  1SYC A;  4KJN A;  3OWF A;  5C4Z A;  2EXZ A;  3BDL A;  3OMG A;  2PZT A;  3P1H A;  3OMC A;  4PMB A;  5CV4 A;  2EYF A;  4NP5 A;  3LX0 A;  5HGT A;  2QDB A;  1U9R A;  2EY1 A;  4K5V A;  4PNY A;  1KDB A;  4ODG A;  4KY6 A;  1IHZ A;  4EQN A;  3MXP A;  2WAC A;  4I65 A;  3C1F A;  3MEH A;  3SK8 A;  1EQV A;  1STG A;  3QB3 A;  4NDX A;  4HMI A;  5CR3 A;  4ZUJ A;  3SR1 A;  1EYD A;  3SK6 A;  5EKK A;  4J6H A;  3U9O A;  1SNP A;  5DAU A;  3D8G A;  2M00 A;  5CC4 A;  2SNM A;  1EYC A;  4K2L A;  3DHQ A;  3HEJ A;  3RUZ A;  3D4W A;  3DMU A;  5DEH A;  4DFA A;  3TME A;  4ZQ3 A;  4ID6 A;  1SYG A;  3ERQ A;  4K6D A;  2F0S A;  4N9T A;  1ENC A;  1STB A;  3R3O A;  3TP8 A;  5IGE A;  1TT2 A;  3EVQ A;  2F0N A;  5CV9 A;  5KRU A;  2LKV A;  5IOD A;  4N9P A;  1SYE A;  3SK5 A;  5EKL A;  2EY2 A;  2F0O A;  3NUC A;  4K14 A;  5IGC A;  1A3U A;  2EYP A;  5CV8 A;  5I9O A;  4KY5 A;  4R8N A;  4KD4 A;  1F2M A;  1A2T A;  4WRD A;  1SND A;  4NMZ A;  2F0M A;  2RBM A;  3OSO A;  1KAA A;  3SK4 A;  2EY6 A;  2F3V A;  3MZ5 A;  1EYA A;  3MVV A;  4KHV A;  4EQO A;  5CGK A;  1AEX A;  1RKN A;  3P75 A;  1EY8 A;  1SNM A;  4OL7 A;  1EY5 A;  2NUC A;  5E1F A;  2PW7 A;  4MIU A;  4B9X A;  4F8M A;  1SNQ A;  2OF1 A;  2F0F A;  2KHS A;  1SNO A;  2F0E A;  5C5L A;  3VA5 A;  1JOK A;  1KDC A;  3ERO A;  3NHH A;  4K5X A;  1EY9 A;  4RKL A;  5NUC A;  5C6A A;  2O4X A;  1EZ6 A;  4S3S A;  5F2D A;  1EY4 A;  2EYO A;  5JOB A;  5IOC A;  5K5P A;  3E5S A;  1SYD A;  2ENB A;  3PMF A;  5I6W A;  3TP5 A;  5HUR A; 
#chains in the Genus database with same CATH topology
 4A3J G;  1NAP A;  5IT9 c;  3H0G B;  4DK3 C;  3PUY A;  1KXL A;  5IYB H;  2L1B A;  2MO0 A;  1S5D D;  3BVM A;  3PIP 3;  3MHB A;  2EOT A;  2G5D A;  3ULJ A;  1HA6 A;  1G6Z A;  1XMQ L;  3E9H A;  2CH4 W;  1H9S B;  3IKJ A;  2LXJ A;  3K6O A;  4BS9 A;  1D6E C;  1YEZ A;  2YU9 B;  3F1Z A;  1PYW D;  3IL8 A;  1BBW A;  4MTN A;  1PDQ A;  4TQU S;  5I9P A;  4K0K Q;  1TR5 A;  5FLX L;  1KIX A;  2XTI A;  1P8L A;  1OO9 B;  1Q86 C;  1OTC A;  2BDO A;  5C5M A;  4OGQ C;  1PH9 A;  3J81 j;  3S16 B;  4RHR A;  4ZUI A;  2RSN A;  1SE2 A;  2IX3 A;  2VQE Q;  2F52 A;  4ABN A;  1B4O A;  1KRS A;  2L11 A;  2EYJ A;  2K05 A;  2ZT9 C;  1YI2 A;  1EFI D;  2EJG C;  3PF4 A;  4FXD A;  4L5S A;  1DZ1 A;  3BYT B;  2I5L X;  4DAP A;  3MXP A;  4A3J H;  4DR6 L;  1TWF H;  3FKI G;  4YCU A;  1Q8I A;  2IL8 A;  4LW1 A;  1WTQ A;  4QGU A;  3M4O B;  1C0A A;  4R4Q A;  3SK6 A;  2K32 A;  2IHF A;  3KDF A;  4QJF A;  4CJ0 B;  3TZD A;  3EFX D;  4A76 A;  4N9T A;  3HOY G;  5EQ0 A;  2UUB Q;  2UXD L;  1O7Y A;  2XNA C;  4YY3 Q;  3CCJ A;  4DR5 Q;  4ZKC B;  4JI8 Q;  5IOD A;  4LF5 L;  5T1G A;  4A3B H;  2E2J B;  1I3Q H;  1AW7 A;  5CV8 A;  1JQY D;  4KY5 A;  2M9V A;  1CKN A;  4UAI A;  2MP1 A;  4BA1 I;  2DUD A;  3BG3 A;  1IL8 A;  3MZ5 A;  2YTX A;  3BZK A;  4A3I H;  2A6E D;  3S2H H;  4DV6 L;  4KKT A;  4MIU A;  4GOP A;  2PQA B;  1ICF B;  3KOJ A;  4F8M A;  1YJN A;  3I4L A;  3K5M A;  1Y14 B;  4C2M H;  2M2L A;  3HOY B;  1YNN C;  3JC6 6;  5ELB A;  3U58 A;  1E24 A;  4LF6 L;  5CV6 A;  2JE6 I;  3C46 A;  5J22 A;  1VQK A;  1K3R A;  1ZYR D;  4JYA Q;  1F2Z A;  1KLG D;  1W3S A;  5IT9 L;  2N49 A;  4B3R Q;  3HOW G;  3FKI H;  3S15 H;  4AQY Q;  1PV4 A;  4BY1 G;  3S1N B;  2PO4 A;  1S5C D;  1BQQ T;  3AFP A;  1EU4 A;  1Y8P B;  2MGS A;  1VCI A;  3I4N G;  1IBL Q;  2PYK A;  2VQF Q;  1PZJ D;  2JJQ A;  3PGZ A;  1ENA A;  4A3D G;  1L0W A;  1TWC H;  3A7A B;  2JA5 H;  3TZU A;  2BA1 A;  4YWM A;  2A68 C;  2CWA A;  1PTO H;  4IUR A;  3VR2 A;  3PO3 G;  4GKJ L;  4JBM A;  5IYD G;  3DWQ A;  4HCS A;  1RF2 D;  3DM3 A;  4OIK A;  3HOW B;  1O7Z A;  1S5E D;  4DF7 A;  1STA A;  5A35 A;  1KAB A;  5IWA L;  3CCS A;  2PZU A;  1T5X D;  1T5E A;  5A2Q E;  1LTS D;  3OTO L;  3HP3 A;  4C56 C;  3I4N B;  3M4Q A;  3CQZ B;  2Q2I A;  4A3D B;  2EY1 A;  1VQ5 A;  4R4T A;  1BKB A;  3N52 A;  3PO3 B;  4NDX A;  5CR3 A;  1FD7 D;  4P75 A;  3T1Y L;  4JI3 L;  2HHH L;  1S72 A;  3H91 A;  2F4V Q;  3HEJ A;  4CKB A;  3HOW H;  4K6D A;  1U4R A;  2JA8 G;  4JCV E;  5IGE A;  3EVQ A;  1YHA A;  4BY1 H;  2FIN B;  2A19 A;  3GTK B;  1ASZ A;  1SYE A;  2Z9H A;  2B2Y A;  2RVL A;  1KQS A;  1DXM A;  3M9B A;  1MHW C;  5C4X G;  3I4N H;  2YV5 A;  3A55 A;  2A73 B;  4A3D H;  1KAA A;  4JVZ A;  2EY6 A;  2R3Z A;  1G2T A;  1TWA B;  3TBI B;  5E1F A;  3PIP A;  2AHO B;  5EKI A;  1HZA A;  2MFI A;  1PFM A;  3D0F A;  3OHX C;  2ZJQ A;  4A3K G;  2KEC A;  1SLJ A;  2IY5 B;  4WJ4 A;  3S1Q H;  2JA8 B;  5IOC A;  1Q12 A;  4JI2 L;  5I6W A;  1BNZ A;  1XX8 A;  4L5T A;  2QF7 A;  1WTR A;  1R9T H;  5C4X B;  4B3S L;  3I8Z A;  4H44 C;  4HTH A;  2EY5 A;  5EPK A;  3S2D B;  4P72 A;  2C35 B;  2G9H D;  4YIJ A;  3I90 A;  4OX9 L;  3MXU A;  3TP7 A;  1E2V A;  1A63 A;  1YBY A;  4LFA Q;  1ENF A;  2H5X A;  3HS0 C;  2Y0S E;  1IW7 C;  4GN4 B;  2WB1 G;  4L5R C;  2MHV A;  1HR0 Q;  1K28 A;  2SNS A;  4UPA A;  1DJR D;  3MEF A;  4DPG A;  2X6G A;  3CC7 A;  1SJH D;  5C3W A;  4M1U B;  1I6V C;  1RTN A;  3IAY A;  1WTV A;  3PUV A;  4BWG B;  5KYI A;  1SEB D;  1ET6 A;  3STB C;  5M9O A;  4HN7 A;  1E0B A;  4DR2 Q;  1DD2 A;  5GAH C;  2N3S A;  1HNZ Q;  1TS5 A;  2F0L A;  3DXJ C;  2E2H H;  5COY A;  1PH1 A;  4K2K A;  5TSS A;  2WB1 B;  2F0U A;  3S14 B;  4A3K H;  1SYC A;  3GTM H;  3OMC A;  5ELF A;  5HGT A;  2QW7 A;  2B2T C;  4LF5 Q;  1JJ2 A;  3BYY B;  5EBC A;  3CCV A;  2I07 B;  4A93 G;  4I65 A;  1K3B C;  3QJY A;  2ICI A;  1STG A;  1VQ4 A;  1Q81 C;  2XRS D;  4L5Q A;  1KTK A;  1NR4 A;  4RAU C;  2EDG A;  3S17 H;  4X3K A;  1MBY A;  4K2L A;  2CKZ B;  4IJH A;  4U67 3;  1BCP C;  4I7Z C;  1HZ9 A;  2HCC A;  1SMX A;  1YNJ C;  1KD1 C;  3PUX A;  1VQM A;  1WOC A;  3AFQ A;  2MUY A;  1S5F D;  1A2T A;  4C3I B;  4P73 A;  4LF6 Q;  1XNR L;  3TRZ A;  1VQP A;  5EAY A;  3I3C A;  3CW2 C;  2WKD A;  4HR7 B;  3I4M H;  3G6J B;  3GTO B;  2NVT B;  1YJW A;  1GOZ A;  1BF4 A;  4IFD I;  3EA6 A;  1N34 L;  1BO0 A;  2ID0 A;  5NUC A;  3GTQ B;  2BOS A;  3KF6 A;  3E5S A;  1XJV A;  2B2W C;  2L5T A;  4E6I A;  4X66 Q;  1AZP A;  2K01 A;  4XQJ A;  5EGT A;  1LO5 D;  1QJO A;  4HSP A;  4HIM A;  1E2W A;  1X3F A;  1JOR A;  2K04 A;  3NBH A;  2NVY H;  2SOB A;  1LM0 A;  1IBK L;  1PH4 A;  4A93 H;  3DWP A;  4IFD G;  3S9W A;  5CV5 A;  4GKJ Q;  2B63 G;  1Z6H A;  3R8B A;  2K33 A;  3VR6 A;  2OXP A;  3TEH B;  5KGU A;  3CAM A;  3Q8D A;  2ZM6 L;  1N32 Q;  1XXG A;  1JOO A;  2PZW A;  2JQO A;  3MTS A;  4JI6 L;  4GLA C;  1C4Q A;  2QCP X;  1RHP A;  1VQI A;  4GLV B;  4YHH L;  1R4Q B;  5D3D A;  4GKK L;  1VQO A;  2EQS A;  1OXV A;  2NVQ H;  4KK7 A;  5E7N A;  5IIF A;  4RGM A;  3T1Y Q;  1HQR D;  1V1P A;  4FF2 A;  1DOL A;  1K83 B;  1TS4 A;  2KA7 A;  4DAM A;  5C3X A;  3J7A V;  2JXM B;  3KF8 A;  4DA2 A;  1PZI D;  4JOI A;  4G7H C;  1A0I A;  1LAB A;  4FNF A;  3W5O A;  2KBN A;  1PTO D;  4ODG A;  3HOZ G;  2AUJ D;  3RN2 A;  2Q2U A;  2KEE A;  5LMU L;  1LT3 D;  1VQ8 A;  1XPR A;  4RMF A;  4DFA A;  3G6E A;  4IFD H;  2KHJ A;  2R61 A;  2B63 H;  1PH8 A;  4POG A;  4IPH A;  1Q1B A;  2EY2 A;  1UAP A;  1SFO B;  2EYP A;  4DNT B;  2V4D A;  2E2I H;  1F2M A;  3PV0 A;  1K8O A;  1SMY C;  2A6E C;  3K81 C;  3J81 c;  5EPL A;  1ILP A;  3H09 A;  3MVV A;  5CGK A;  4B3S Q;  4B3M Q;  2L0C A;  1VQJ A;  1B9N A;  4MHE A;  5IP7 H;  1HHV A;  2FHT A;  4U68 A;  3VA5 A;  4FVM A;  5M3M H;  1DYQ A;  4KN7 C;  4EQ5 A;  1XNQ L;  1U5K A;  1H9R A;  2VNU D;  1E1T A;  3KLS X;  3J81 i;  5DNF A;  4BBR G;  1SFO H;  1NMG A;  1NR2 A;  1VQC A;  2Z0S A;  1HNX Q;  2EJF C;  3GO5 A;  2UXC Q;  1B2T A;  4DR3 L;  3HOZ H;  1H95 A;  2F03 A;  1NUC A;  4Z9C B;  4RA8 A;  3T13 A;  4A3L H;  1GUT A;  2K03 A;  2NN6 I;  4QB4 A;  1UE1 A;  3K57 A;  5C44 G;  4AYB E;  2ZXO A;  1GUS A;  1N33 L;  3A56 A;  2DNE A;  3G7L A;  3GTG H;  1QCB D;  2F1M A;  3E0E A;  2QA4 A;  3T16 A;  1X32 A;  4R4C A;  1SE4 A;  4A3M H;  4BBR B;  4XQQ A;  1KAW A;  2R93 G;  1SRO A;  3CF5 A;  2F0Q A;  3ONA B;  4FF3 A;  5E3F A;  1PFB A;  4HIO A;  1EEF D;  2YTY A;  1VMC A;  4LF8 Q;  2AQ1 B;  4DR1 Q;  4BBS G;  4DV1 Q;  2WB1 E;  5FKA C;  4Q0F A;  3S1R H;  1QE6 A;  1L0X B;  3F2C A;  2OTL A;  3GDE A;  5C44 B;  2RDH A;  5J1Z A;  4JI0 L;  1Z9F A;  1HCZ A;  4A3F G;  1KNE A;  1QUQ B;  2B2V A;  1V9P A;  3OW2 A;  2D9U A;  2PMZ E;  2BDN A;  3CCL A;  4YCV A;  1D5X C;  3DEO A;  1CI3 M;  1L1O C;  2IWH A;  4IPG A;  2WAQ E;  4LMQ D;  5A2Q L;  5M5W B;  2L4N A;  2R93 B;  4RCO A;  2JN4 A;  3NPP A;  1ZKO A;  3H3V I;  4AIM A;  1EQR A;  2R7Z G;  4BBS B;  1PA6 A;  1BDO A;  4UDU C;  1FL0 A;  1O7I A;  2ICE C;  3RLF A;  1N34 Q;  2AMC B;  2EJM A;  4A3F B;  1A3U A;  1CSQ A;  4RHS A;  1HXY D;  1ET9 A;  4NB3 A;  4EQO A;  2HIV A;  1RKN A;  2ZJP A;  2R93 H;  4V19 0;  1QUQ A;  2E8G A;  4MZ9 A;  2JEA I;  3MWY W;  2F0F A;  1RJT A;  2NN6 H;  2ZTE A;  2OT2 A;  2QEJ C;  3AMU A;  2R7Z B;  3CME A;  1EZ6 A;  3GTJ H;  5JOB A;  5LL6 X;  4JI4 L;  2AWO A;  3A7L A;  1LYL A;  5IGF A;  1T9H A;  4DV3 L;  4DGZ A;  1XTD A;  1MGS A;  4H0L C;  5M5Y H;  4NXM L;  1IYU A;  5JEA H;  2BH2 A;  3PIO A;  4ZCK A;  4JI6 Q;  4X62 L;  1X3Q A;  1MJE A;  3OW7 A;  3URY A;  3M7G A;  2VW9 A;  1LT5 D;  3N6R A;  4X65 L;  1ILQ A;  2JP1 A;  4YHH Q;  2R7Z H;  5EBD A;  1EZ8 A;  1X6O A;  1JE5 A;  2E2D C;  1I6H H;  4G7Z C;  2H1E A;  4IUT A;  4DNR B;  4JI7 L;  1EUJ A;  1X56 A;  3HGB A;  1EQT A;  3WOF A;  2XVS A;  1D2B A;  3P20 A;  5IYC H;  1A2U A;  1NTG A;  1MD2 D;  3VYR A;  1DON A;  2X69 A;  3NP8 A;  5KEE A;  5AJ3 Q;  5IE8 A;  4ILW A;  1SE8 A;  4A3G G;  1F77 A;  1FR3 A;  3H3V H;  1QIL A;  1SYF A;  5LMU Q;  4IO9 A;  4A3B G;  3MXN A;  3C1E A;  1UE7 A;  1JE4 A;  3FPP A;  2B8F A;  1HZB A;  1A15 A;  3DWA A;  4LNQ A;  3X3N A;  2UU9 L;  3QIA A;  2EXZ A;  1I4R A;  3KDF B;  3MA2 B;  4A3J B;  3C2P A;  4HSV A;  1TWF B;  4A3I G;  2Q8I B;  2Z1C A;  1X9N A;  5M5X H;  4ZUJ A;  2ZTC A;  5C4J H;  2D0P A;  1AH9 A;  2FFK B;  2NTT A;  3DHQ A;  3RUZ A;  4A3G B;  3D4W A;  2OQK A;  3ND8 A;  1ICW A;  1VQA A;  1CKN B;  3L9A X;  4JV5 Q;  1MI2 A;  3MXG A;  4RGO S;  2JEB I;  3QO2 A;  3SDZ A;  2PI2 E;  4A3B B;  1D1K A;  3CPW A;  1EIH A;  2FMM A;  1EOV A;  4OWW B;  1I3Q B;  2F0O A;  2JA9 A;  3NUC A;  3OPO A;  1B44 D;  2JA6 G;  4GOP B;  1IXR A;  5ELC A;  3RZO H;  5BR8 L;  1SND A;  1M8A A;  1E7Z A;  2OTJ A;  3T51 B;  4A3I B;  3S2H B;  1YZ6 A;  3HRZ C;  4JC0 A;  3R2I A;  1I94 L;  1VQH A;  2QDL A;  2UUA L;  4C2M B;  4A3G H;  4P74 A;  2O4X A;  4S3S A;  5F2D A;  2HIX A;  3RLN A;  1CA5 A;  1WTO A;  4CHT B;  2JA5 G;  3AEV A;  1PRT B;  3T56 B;  4LFC Q;  1PTO F;  2KEN A;  1V8Q A;  4XTC S;  1QVG A;  2I5M X;  1SN8 A;  2IT1 A;  3QOL A;  5EJW A;  3K0Y A;  2XWB B;  3FKI B;  4L63 B;  3U50 C;  2E5L L;  3S15 B;  2BCO A;  1D8L A;  4UP9 A;  3R93 A;  4UY8 C;  5D3I B;  5FO9 B;  1LTL A;  3CCU A;  4YCW A;  2UXB L;  3ND9 A;  4PMC A;  1K0R A;  4ULL A;  2F0D A;  1PH2 A;  4ZAI A;  4C3J H;  1K8A C;  1TWC B;  2JA5 B;  3EBE A;  3MFY A;  4QCL A;  2WII B;  4JW0 A;  1PTO B;  1M4V A;  2JA6 H;  3NQT A;  1J6Q A;  2A6H D;  1NJI C;  2F0J A;  1N36 Q;  1VQG A;  3HOX G;  4BXX G;  4C3H G;  3PUZ A;  4KLK A;  1QNU A;  5JJL A;  4CJ1 B;  5J39 A;  1JC7 A;  4GNX C;  4XQN A;  3PO2 H;  4KV6 A;  1TY0 A;  3G48 A;  3GTL B;  4CDD C;  4KJN A;  3KK7 A;  2ZXP A;  5C4Z A;  1S5B D;  3NEN A;  3CCE A;  1C9O A;  4DNI A;  4J15 A;  2CWP A;  1N8R C;  1OXU A;  2K5Q A;  1JB3 A;  4FXG C;  1O7L A;  2RSO A;  3SR1 A;  5K36 H;  3BVZ A;  1IBM L;  1PH5 A;  1V43 A;  4JBW A;  3HOX B;  2SNM A;  4C3H B;  1HUM A;  3TME A;  4BY1 B;  3ER0 A;  3Q0A A;  2R7F A;  3GTL H;  3HOU G;  2A5H A;  3A5Z B;  2ZJR A;  3BZC A;  4LK1 C;  4DUY L;  1FJG L;  3CC2 A;  4KD4 A;  3J80 i;  4P2C B;  1D7Q A;  1B1Z A;  2KHI A;  1LT4 D;  2F3V A;  4DK6 C;  2XIW A;  1EYA A;  1BOS A;  2NYZ D;  4DV3 Q;  2NUC A;  2WP8 J;  3F2B A;  1JWM D;  5ELD A;  1LTI D;  4RCN A;  3HOX H;  1BVS A;  5CYU A;  4C3H H;  4BXX H;  4O0A A;  4JI5 Q;  5I2X A;  3S1Q B;  4X62 Q;  1IYJ B;  2L15 A;  3D4R A;  3K0X A;  3RD4 A;  1DM0 B;  1HJP A;  5E4X A;  4OEL B;  1MKH A;  4KMU C;  5GAG C;  5HUR A;  4X65 Q;  1R9T B;  1VQ9 A;  1VQB A;  1SXT A;  4BY7 H;  3J81 E;  1BBU A;  1Z7T A;  1ZXT A;  4TKO B;  4XYQ A;  4HMJ A;  1SNC A;  4N8X 1;  2X6L A;  3QOJ A;  4JI7 Q;  1F9Q A;  1STN A;  1KDA A;  1GJX A;  4LAA A;  4QIW E;  4KD3 A;  1EL0 A;  1IKM A;  3NK9 A;  1PH6 A;  3EJI A;  1XMQ Q;  5C3E H;  2R92 H;  1B9M A;  3M3Y B;  1XWE A;  4A3E H;  2F0I A;  4IOA A;  1X54 A;  4P71 A;  3HOU H;  1CA6 A;  4DAV A;  2B29 A;  2CW0 D;  5AFW A;  2UU9 Q;  4IFD J;  5HY6 A;  4OO1 I;  1Y1V G;  1B70 B;  1Y69 U;  4IUQ A;  5KIX A;  2Q8R E;  2EXD A;  4GN3 B;  5G3L D;  1STY A;  1YIT A;  5C4H A;  1F9R A;  2F0T A;  3V96 A;  2E2H B;  1J5E L;  4J1M A;  3GV3 A;  1JOQ A;  3K80 C;  1JCK B;  2SEB D;  4A3K B;  3LWU A;  2HDL A;  1OXT A;  3GTM B;  3U9S A;  4LUV A;  5LL6 S;  4DK0 A;  3P1H A;  4PMB A;  5CV4 A;  3M3Y H;  5ELN A;  3Q23 A;  1C7Y A;  1U9R A;  2K5H A;  4X3T A;  2O5I C;  1DGS A;  4KY6 A;  5I2Y A;  1PFS A;  2E74 C;  2WAC A;  1WFQ A;  2FJ2 A;  3I4M G;  3PUW A;  1TWG H;  4HMI A;  2OCE A;  1EYD A;  4PQX A;  2GN5 A;  3S17 B;  5DAU A;  1KL9 A;  3DM1 A;  4DR6 Q;  2M00 A;  1EYC A;  1X3G A;  3D6W A;  3K5O A;  1C48 A;  3J7A 5;  1STB A;  3A8K E;  1W6K A;  4N9P A;  4YWL A;  3QWN A;  2N78 A;  2WKC A;  4K14 A;  4NW2 A;  5I9O A;  1HTP A;  2UXD Q;  4UHV A;  1NY4 A;  4LFB L;  5L37 A;  3SK4 A;  4J8Q A;  2RF4 A;  3G71 A;  1Q46 A;  3KF6 B;  1K9M C;  3I4M B;  2XRQ D;  1Y1V H;  2D2C C;  2C5C A;  2KHS A;  4EX5 A;  4DV6 Q;  1S4Z A;  1FYC A;  1TVX A;  1XMO L;  1JJG A;  3SVM A;  3NBH B;  1I4P A;  1DOM A;  4HED A;  2K1B A;  3KJO A;  5LMN W;  2RA4 A;  1D1I A;  4TSS A;  1F2Y A;  2GA4 B;  2R6G A;  3Q22 A;  1HRJ A;  3CCQ A;  4OO1 H;  1EEI D;  2NVY B;  5COR A;  1TU2 B;  1PLF A;  4A93 B;  3PCO B;  2I5H A;  4F88 A;  1WTH A;  4OHJ A;  3QG1 A;  4MNO A;  1G8Z D;  4KJO A;  1YIJ A;  3UI2 A;  5M3F G;  2VB3 X;  4Y52 H;  2V1C C;  2CFM A;  1CK1 A;  5J3B A;  2B2T A;  4B3T L;  2RKS A;  4DV2 L;  2K28 A;  1I50 H;  2L9H A;  4ME5 A;  2OEO A;  1KC8 C;  2HQE A;  2LFN A;  2OWO A;  1LUZ A;  1HQM C;  4LF9 L;  1VQL A;  1EY6 A;  2A74 C;  1N9W A;  3GTP H;  2HCI A;  3D4D A;  2IJ0 A;  1LTG D;  1V1P B;  4NXN L;  2BH8 A;  4KHP L;  4ZRZ A;  3KF8 B;  1EFW A;  2MO1 A;  1ZEQ X;  1V1O A;  1LAC A;  1OXX K;  3A74 A;  1EIG A;  4CDF C;  2NVQ B;  3ITP A;  1IZ6 A;  1NMF A;  2XSC A;  5M3F B;  1O78 A;  2NZ1 D;  1QOH A;  4LF4 L;  1JWU D;  3E9I A;  1B3Q A;  2EYH A;  2K7V A;  1Y8N B;  1GHK A;  1EYG A;  5IGB A;  1EU3 A;  1XPU A;  2E75 C;  1ASY A;  1NE3 A;  3A54 A;  5IWA Q;  4HID A;  1Q1E A;  1PRT D;  3T4A C;  3OTO Q;  4XT1 B;  4RWS C;  1FJG Q;  3PQI A;  5IP7 G;  2Z6K C;  3U9O A;  3PIO 3;  1A6X A;  5M3M G;  1BBX C;  3L7Z C;  2B2W A;  4KKS A;  1WJJ A;  2B63 B;  2IHE A;  1ENC A;  3R3O A;  4DV4 L;  5M3F H;  2J7Z A;  4DR7 L;  1SDF A;  4JI3 Q;  2HHH Q;  4FP5 D;  4DV0 L;  1HNW L;  2B3G A;  3K7A H;  3L0O A;  5JEA J;  2BE5 D;  1YNN D;  3GP7 A;  2AWN A;  4H13 C;  4X64 L;  3NEL A;  3HKZ G;  2E2I B;  4N8F A;  4R8N A;  2EPB A;  2FMC A;  1Q8K A;  1QB5 D;  4NMZ A;  4H02 A;  2IX1 A;  1AEX A;  1EY8 A;  4A3L G;  1B7Y B;  1JWS D;  4RFB A;  3MC0 B;  1SR3 A;  5C5L A;  3WWV A;  5M3M B;  4DV7 L;  4LJZ C;  3TS2 A;  3OWE B;  2CQO A;  5JPM C;  2Z6B A;  3EN2 A;  1AE2 A;  5JJI A;  3GV6 A;  1G51 A;  1I4Q A;  3T1H L;  2KUM A;  1GHJ A;  4A3M G;  2BA0 A;  5CBE E;  1V1Q A;  2NB0 A;  3HKZ B;  3ZYY X;  4CGY B;  4JI2 Q;  3FHW A;  2MNA A;  2K52 A;  4G4K A;  4APV A;  3HOZ B;  1XPO A;  1KHI A;  3KLR A;  2ALY B;  1FNV A;  2ES2 A;  5I6Y A;  3CP0 A;  4F7X A;  1MIU A;  4PMW A;  4AH6 A;  4DAY A;  4FXK C;  4K8I A;  4OX9 Q;  4K0K L;  4IUN A;  4GLX A;  3ULP A;  1BXT A;  1U0L A;  3NSW A;  3RZD H;  1J5E Q;  3H6M A;  3GTG B;  2GVB A;  1XTC D;  2KVM A;  4B9W A;  4A3M B;  1ZYR C;  2PPB C;  2A6H C;  1JJC B;  4X3S A;  4G57 A;  5BN4 A;  3I55 A;  2VQE L;  3HKS A;  1LTB D;  2PNR C;  5C0X I;  1UEA B;  3H94 A;  1CM9 A;  2KJX A;  4QF4 A;  3S1R B;  5BN3 A;  4V0B A;  2Z4H A;  1YVC A;  4OON A;  4QY7 A;  3X3M A;  1RTO A;  3KUP A;  4OIJ A;  2QKI C;  3NE5 B;  1A8V A;  2KCC A;  4HAE A;  2B2U C;  4DK1 A;  3S24 A;  1ML0 D;  2LXK A;  2K4K A;  2VY3 A;  2QDB A;  1TXY A;  3EIV A;  1G6P A;  4MTK A;  2HUG A;  3KBX A;  3K59 A;  1PFN A;  4GN5 A;  3I56 A;  1WTX A;  1GUW A;  3A0J A;  4L6T B;  3M7N A;  3Q24 A;  2UUB L;  2JA7 G;  4A4I A;  4LFB Q;  4XDX A;  3D31 A;  3S1M H;  2NN6 G;  4JI8 L;  5FJ8 H;  4POF A;  4QUC A;  3JAM c;  2N55 A;  3TN2 A;  4FDB A;  1RIP A;  2Q8T A;  1F9P A;  4JK1 C;  2D0O A;  4A3C G;  1CKM A;  1Q82 C;  5JPN C;  1WD1 A;  1WYD A;  2A1A A;  5JEA G;  2EVB A;  3K5L A;  3J80 E;  1PVO A;  1TWH H;  3VYT A;  1L1O B;  3UDX A;  3P75 A;  3JAM i;  4DXG A;  1EY5 A;  5G3L F;  4IOC A;  3KJP A;  2JA7 B;  3OIQ A;  1CHQ D;  1GUO A;  1XNR Q;  1Y1W H;  4HJ9 A;  2IPK D;  1JR0 D;  3NHH A;  3FVQ A;  3GTJ B;  2Q2T A;  1QNK A;  2EYO A;  5FLX c;  4JYA L;  1SSO A;  3SK5 A;  4B3T Q;  5CMD A;  3TP5 A;  3NXW A;  5FK9 C;  5IYC G;  5DM6 3;  2F0W A;  1WCM H;  5M5Y B;  3PSI A;  4AQY L;  5IP9 H;  1VDZ A;  1H9M A;  1A3V A;  4TRD A;  4JI1 L;  3AU7 A;  3UDF A;  3STB D;  5C0X H;  3ICE A;  3J81 L;  1Z47 A;  4HJ7 A;  5I4D A;  2F0H A;  1W2B A;  1IBL L;  2JA7 H;  1D5M C;  2ZTD A;  1QG7 A;  1IBK Q;  5EPJ A;  1L1O A;  2E76 C;  3L2P A;  1I6H B;  2HQL A;  4LF4 Q;  4ME3 A;  1EOT A;  1U4P A;  1EY0 A;  4A3C H;  4DU9 A;  3Q6S A;  1II3 A;  2ZM6 Q;  1S3O A;  4OWT B;  3NWS A;  3MXN B;  4RH6 A;  1GUG A;  2AQ2 B;  1B3A A;  1STH A;  1QVC A;  1WD0 A;  1VQF A;  4DR4 L;  4RGN A;  4GZY C;  4KHZ A;  1H9K A;  4F87 A;  3VR3 A;  1AZQ A;  4WJW A;  1B53 A;  1A3T A;  2QIL A;  5GRO A;  1PH7 A;  4GKK Q;  4IUV A;  3A5U A;  2EYF A;  3FDT A;  5HGQ A;  4DV0 Q;  1YNJ D;  3H0G G;  1L2F A;  1MSG A;  4PG3 A;  3W1B A;  2J4X A;  3KLS A;  1K8G A;  2F4V L;  5M5X B;  3HOV G;  5C4J B;  3LNN A;  4ZK9 B;  2L55 A;  1PXU A;  3H15 A;  4Y7N H;  1RL2 A;  3WOE A;  3DMU A;  2Y0S G;  1H9J A;  2TSS A;  1CSP A;  2F0S A;  1TT2 A;  2F0N A;  3JAM L;  1M90 C;  4DUZ L;  1U4L A;  1X3E A;  3ERS X;  2QEX A;  4R1J A;  3RZO B;  2RDG A;  3T1H Q;  2I0Q A;  1ESR A;  2RBM A;  2NVX H;  2LSS A;  2VUM H;  3AB9 A;  4IUP A;  3J7Y W;  2RCF A;  3HOV B;  1PYS B;  1SNQ A;  4K6L A;  3UDI A;  1JOK A;  3BDO A;  5JVG 3;  3CRK C;  2Y0S B;  3TDQ A;  1EY9 A;  1HFG A;  4C3J G;  1SYD A;  3HKZ E;  3PMF A;  1SBB B;  1TII D;  4JPB W;  4NKL A;  1PRT F;  5ISR A;  3DEP A;  4JBJ A;  4QUF A;  1XNQ Q;  4LFA L;  1DCZ A;  1CKO A;  3H0G H;  4LWC A;  4KI0 A;  4ZYS A;  2HDM A;  3O13 A;  4FF1 A;  1HR0 L;  2GVA A;  3HOV H;  1QWY A;  1HH2 P;  5IY0 A;  5GAE C;  3PO2 G;  4KKU A;  1VS0 A;  4DR3 Q;  1XYI A;  1HR0 W;  2YU9 H;  4GOP C;  4C3J B;  4PZ7 A;  2F0V A;  3P7J A;  5KNB A;  4DR2 L;  3RMH A;  1H9S A;  2B39 A;  1MSH A;  1HNZ L;  2PQE A;  2JA6 B;  4Q5V A;  1N33 Q;  2A69 D;  3ZJY C;  5K36 G;  1SAP A;  5ELO A;  1EY7 A;  2UUC L;  3S16 H;  3CU7 A;  1HFN A;  3CRL C;  4B08 A;  4WJ3 M;  2CH4 A;  2C9O A;  4HJ5 A;  1EWC A;  3PO2 B;  1JT8 A;  2AQ3 B;  3IFD A;  1ESF A;  3W2D A;  3F2U A;  1K73 C;  4O1N A;  1PRT C;  1G91 A;  3OMG A;  1GO3 E;  2LS0 1;  4K5V A;  1KDB A;  4CJ2 C;  4JI0 Q;  4CKE A;  1CTM A;  4EQN A;  1RD9 D;  1Q3L A;  3VYS A;  3FEW X;  3MEH A;  1SMY D;  3CC4 A;  1UNS A;  1QZG A;  2DNC A;  3M4O H;  2K5V A;  4IN3 A;  3AQQ A;  3NEM A;  3SGI A;  1WVL A;  2NTS A;  4ID6 A;  4MN3 A;  4UP7 A;  3TP8 A;  4GNX B;  2BE5 C;  3T53 B;  3CCM A;  3BJU A;  4BY7 G;  3A8J E;  5GQO A;  5EKL A;  3IRB A;  4ZKB B;  2E2J H;  3KFU A;  1PTO C;  1OXS C;  1NNX A;  3OSO A;  3RNU A;  2EIF A;  3J7A F;  3M4Y A;  4OWX B;  3I4O A;  3I7F A;  3BVG A;  1IKL A;  3J80 c;  2IX0 A;  4JI1 Q;  3AYH B;  3F8T A;  1KDC A;  4IQZ A;  3ERO A;  1G2S A;  4K5X A;  4X66 L;  5C3E G;  3TS0 A;  3C3L A;  2R92 G;  3HOY H;  4A3E G;  4CDE C;  1VQ7 A;  1LTA D;  1EQQ A;  2PQA A;  3DUZ A;  4BY7 B;  3FMC A;  4M8A A;  1GD7 A;  2PW5 A;  4FF4 A;  4KY7 A;  4GNX A;  4JI4 Q;  4G7O C;  2B2Y C;  4XIG S;  4NXM Q;  2J0T D;  1N32 L;  2KED A;  3S1N H;  2WV6 D;  4QMG A;  1LTR D;  4DR4 Q;  1CUK A;  5KYL A;  3CCR A;  1E2Z A;  4DXF A;  5C3E B;  2R92 B;  4A3E B;  2AKW B;  2QGQ A;  3HOU B;  4K8J A;  2H4O A;  1VQD A;  1KLU D;  1Q90 A;  2D62 A;  4H7B A;  5ELE A;  1NBW A;  4EVO A;  2F3W A;  3VA7 A;  4TVA B;  4LF7 L;  2B8G A;  2OQ0 A;  5D14 A;  3GQB A;  3ULL A;  3L3O C;  1G29 1;  1UWV A;  3OWF A;  2AUK A;  3BDL A;  2VZA A;  1DOK A;  1PMR A;  4NP5 A;  3CQZ H;  1IYV A;  3V05 A;  4DUZ Q;  1EWI A;  2LMC B;  3C1F A;  1CZG A;  3SK8 A;  1TWG B;  3PO3 H;  4EGV A;  1HTL D;  5EKK A;  4J6H A;  5IYD H;  4CBV A;  2KCN A;  1SJE D;  2F3I A;  3D8G A;  5CC4 A;  3FP9 A;  4BA2 I;  5DEH A;  3TRE A;  2L12 A;  2VL6 A;  3TQY A;  1SYG A;  3ERQ A;  2YTV A;  3OYY A;  4AYB G;  3GTK H;  2FXQ A;  1LLR D;  1Q7Y C;  5IGC A;  4B3M L;  1LTT D;  4X3U A;  3G4S A;  2VS1 A;  3UDG A;  4OO1 G;  3FPU B;  2DJG C;  2F4I A;  4OL7 A;  3DLL A;  1TWA H;  1SRU A;  1Y1V B;  4X6A H;  5BR8 Q;  2CQA A;  2D5D A;  3JAM E;  2PCF B;  2OF1 A;  1GUN A;  3FRP B;  3J80 L;  2VB2 X;  5JJK A;  4R9W A;  4CDC C;  1BCP F;  4IUU A;  5K5P A;  2JA8 H;  4AYB B;  3BS1 A;  1I94 Q;  4ZLT F;  1HNX L;  2K5D A;  4OXP A;  1WTW A;  2UUA Q;  3RN5 A;  2UXC L;  3SE0 A;  5C4X H;  4O2D A;  4IZ8 A;  2YYZ A;  3BU2 A;  1VQ6 A;  1HPC A;  3S2D H;  1FNW A;  4RG1 A;  1WTP A;  3VDY A;  2WAQ G;  3J7Z C;  4DV5 L;  1EIY B;  2VXW A;  5GAD C;  1C8C A;  1K0S A;  4R4O A;  3CD6 A;  2UUC Q;  5FLX E;  1FNU A;  5LMN L;  1IL2 A;  2E5L Q;  4YWK A;  1BCP B;  2N8N A;  1I50 B;  3HFZ B;  5KND A;  5JAV A;  3PF5 A;  2EYM A;  1HUN A;  4C3I G;  3GTP B;  4LF8 L;  2UXB Q;  4DR1 L;  1I5F A;  2PMZ B;  3KYH C;  4DV1 L;  3D6C A;  1NSN S;  4WFN 3;  2NZO A;  2WAQ B;  3MFG A;  2F0G A;  1I4G A;  2R7D A;  1KNA A;  4QL5 A;  3I2Z A;  5IGG A;  2F0P A;  3A8I E;  4K5W A;  5FO7 B;  4C1N K;  1GKH A;  1Y8O B;  3S14 H;  3RR5 A;  2XN9 C;  3U4V A;  1PHJ A;  1GVP A;  3I73 A;  3LWE A;  3CHB D;  1UEB A;  1IHZ A;  4RGT A;  5D65 A;  1EIF A;  2XWJ B;  3VYU A;  3W3A A;  1SNP A;  3R2T A;  5T1I A;  1E3P A;  2Z8L A;  1IBM Q;  1J8I A;  5CV9 A;  5KRU A;  3K7A B;  2K5N A;  3KBG A;  3E3X A;  5C0X J;  4PZ8 A;  1UUP A;  2O2L D;  3CPF A;  3K7U C;  4WRD A;  4C3I H;  2TMP A;  4LUZ A;  2WFW A;  4JOI C;  4DUY Q;  2RQX A;  3OIP A;  1SNM A;  2CHB D;  1RDP D;  1SE3 A;  1HA5 A;  1F2L A;  3GTO H;  2NVT H;  3D3R A;  2F0E A;  2WIN B;  1FVI A;  1YHB A;  4IPD A;  2CVR A;  5C6A A;  3KLW A;  3GTQ H;  2LY7 A;  2EZV A;  3TP6 A;  5IT9 E;  4OEM B;  1M1K C;  1FGB D;  3EQL C;  3NQI A;  4KTA A;  4HJA A;  2KQ3 A;  4DAY B;  2MQH A;  3NTK A;  3K5N A;  3SHL A;  4DKA C;  1YHQ A;  1FGU A;  1VMP A;  3U4Z A;  3HZX A;  1TQO A;  3RZD B;  1CQF A;  1NCV A;  5CBA E;  2JYO A;  4LF7 Q;  2PNH A;  4JG2 A;  2Z6K A;  2A69 C;  1RCV D;  2NWG A;  5AJ3 L;  4WOR A;  1JMC A;  5IGD A;  2HD3 A;  2A8V A;  3GD7 A;  1YJ9 A;  5CV7 A;  3SXH A;  2A68 D;  1I4X A;  5FJ8 G;  1GM5 A;  5H1S E;  3SEB A;  4FO2 A;  1AP0 A;  1UE6 A;  1X55 A;  3BDC A;  1ROD A;  1AE3 A;  2JSO A;  4EQP A;  3HG9 A;  3V2T A;  1K83 H;  1D5Z C;  2HT1 A;  3I70 A;  5DLQ E;  2PZT A;  1K8M A;  3LX0 A;  1LV9 A;  4PV1 C;  5FOB B;  1BR9 A;  1EQV A;  1GXD C;  3QB3 A;  3K58 A;  2MPM A;  4DN4 M;  3I91 A;  4JV5 L;  3TSS A;  1Y1W G;  3S1M B;  1YNX A;  3UE1 A;  4JBK A;  4R8I A;  1TKW B;  3CMA A;  2RCN A;  3NTI A;  5BN5 A;  1S40 A;  3IFT A;  1TY2 A;  2LKV A;  1AFP A;  1WCM G;  4HIK A;  4XYO A;  5KNC A;  1F9S A;  1TS3 A;  5IP9 G;  2KOL A;  2G9D A;  2F0M A;  5FLM G;  1TWH B;  2JK8 A;  3BZD B;  5C0X G;  4C1N I;  4KHV A;  2B2V C;  2PW7 A;  4B9X A;  2PI2 A;  1KRT A;  4YY3 L;  1Y1W B;  2KCT A;  4DR5 L;  5JJZ A;  1E1O A;  2IW3 A;  4DV5 Q;  2N88 A;  4RKL A;  4HCE A;  4LFC L;  2K75 A;  4PZ6 A;  2ENB A;  5LMN Q;  1MJC A;  1UE5 A;  1U4M A;  1B8A A;  1P16 A;  2DY8 A;  1WCM B;  4QQB X;  4UP8 A;  5E4W C;  1XMO Q;  1BUV T;  4XT3 B;  3WDN A;  2O5J C;  4ALP A;  5FO8 B;  3CKI B;  1JB7 A;  2MJ8 A;  1L0Y B;  4XXE A;  2I46 A;  2K6A A;  1PH3 A;  2NZH A;  2P5Z X;  1CFM A;  1CQV A;  4KN4 C;  4I7A A;  2B2U A;  3F2D A;  1CZW A;  4IAL A;  1EWH A;  1X3P A;  2DY7 A;  4RKB A;  5LHY 1;  1VF5 C;  1IW7 D;  4LUO A;  1SYB A;  3LGJ A;  3UE0 A;  1B50 A;  2Q2H A;  1JIC A;  1CT1 D;  2K14 A;  1N36 L;  1HZC A;  4DV2 Q;  4B3R L;  1I4H A;  2EE1 A;  1O80 A;  1WI5 A;  1STE A;  4BBR H;  4A75 A;  2RDF A;  4GS3 A;  4LF9 Q;  2DJF C;  5FLM H;  3I72 A;  4L8J A;  2DN8 A;  2XGT A;  4NXN Q;  4KHP Q;  2EYL A;  2VQF L;  1R4P B;  3OOC A;  1AN8 A;  3K8A A;  2F0K A;  5C44 H;  3NBI A;  2ASB A;  2Z4I A;  2CW0 C;  3NTH A;  3B6Y A;  1PYB A;  2VUM G;  5IYB G;  4PNY A;  3MAQ A;  3E6Z X;  5JVH 3;  1A62 A;  1QZH A;  2SDF A;  3CXC A;  1TS2 A;  2ATW A;  5M5W H;  1VQE A;  1PZK D;  2ZXR A;  4Y7N B;  4O42 A;  1VF7 A;  4BBS H;  1ONL A;  4ZQ3 A;  1J9O A;  3VR5 A;  1BCP D;  2RHS B;  5DM7 3;  1QVF A;  3M85 A;  1VQN A;  4DV4 Q;  4A3F H;  3M4P A;  4R4I A;  2NBF A;  4DR7 Q;  1W6J A;  1HNW Q;  2VUM B;  2NVX B;  1E22 A;  1LT6 D;  2CCZ A;  3QR8 A;  1CHP D;  4IJL A;  4X64 Q;  3RLO A;  3NWT A;  4JI5 L;  3H3V C;  4HJ8 A;  2K50 A;  2KCM A;  4NPS A;  4IPC A;  1SNO A;  3W1G A;  3VR4 A;  4FYD A;  3E0J A;  2DGY A;  4QIW B;  4CKC A;  1EY4 A;  1X65 A;  2K5W A;  2RHQ B;  4DV7 Q; 
#chains in the Genus database with same CATH homology
 1NAP A;  3H0G B;  3PUY A;  2L1B A;  1S5D D;  3BVM A;  3PIP 3;  3MHB A;  2EOT A;  1HA6 A;  1G6Z A;  1H9S B;  3IKJ A;  3K6O A;  4BS9 A;  1D6E C;  2YU9 B;  1PYW D;  3IL8 A;  1PDQ A;  4TQU S;  5I9P A;  1TR5 A;  5FLX L;  1OO9 B;  2BDO A;  5C5M A;  4OGQ C;  3S16 B;  4RHR A;  4ZUI A;  2RSN A;  1SE2 A;  2IX3 A;  4ABN A;  1B4O A;  2L11 A;  2EYJ A;  2K05 A;  2ZT9 C;  1EFI D;  2EJG C;  4FXD A;  1DZ1 A;  3BYT B;  4DAP A;  3MXP A;  1WTQ A;  1Q8I A;  2IL8 A;  3M4O B;  3SK6 A;  2K32 A;  4CJ0 B;  3TZD A;  3EFX D;  4N9T A;  5EQ0 A;  1O7Y A;  2XNA C;  4ZKC B;  5IOD A;  5T1G A;  2E2J B;  1AW7 A;  5CV8 A;  1JQY D;  4KY5 A;  2M9V A;  4UAI A;  2MP1 A;  4BA1 I;  3BG3 A;  1IL8 A;  3MZ5 A;  2A6E D;  4KKT A;  4MIU A;  4F8M A;  3I4L A;  3K5M A;  2M2L A;  3HOY B;  1YNN C;  5ELB A;  5CV6 A;  2JE6 I;  3C46 A;  5J22 A;  1ZYR D;  1F2Z A;  1KLG D;  5IT9 L;  3S1N B;  2PO4 A;  1S5C D;  1BQQ T;  1EU4 A;  1Y8P B;  2MGS A;  1VCI A;  2PYK A;  1PZJ D;  1ENA A;  3A7A B;  3TZU A;  2BA1 A;  2A68 C;  1PTO H;  4IUR A;  3VR2 A;  3DWQ A;  4HCS A;  1RF2 D;  4OIK A;  3HOW B;  1O7Z A;  1S5E D;  4DF7 A;  1STA A;  5A35 A;  1KAB A;  2PZU A;  1T5X D;  1T5E A;  5A2Q E;  1LTS D;  3HP3 A;  4C56 C;  3I4N B;  3CQZ B;  4A3D B;  2EY1 A;  3N52 A;  3PO3 B;  4NDX A;  5CR3 A;  1FD7 D;  3H91 A;  3HEJ A;  4CKB A;  4K6D A;  1U4R A;  5IGE A;  3EVQ A;  2FIN B;  3GTK B;  1SYE A;  2B2Y A;  2RVL A;  1DXM A;  3A55 A;  2A73 B;  1KAA A;  2EY6 A;  2R3Z A;  1G2T A;  1TWA B;  3TBI B;  5E1F A;  5EKI A;  3OHX C;  1PFM A;  2KEC A;  2JA8 B;  5IOC A;  1Q12 A;  5I6W A;  1BNZ A;  1XX8 A;  2QF7 A;  1WTR A;  5C4X B;  3I8Z A;  4H44 C;  4HTH A;  2EY5 A;  5EPK A;  3S2D B;  2G9H D;  4YIJ A;  3I90 A;  3MXU A;  3TP7 A;  1E2V A;  1ENF A;  3HS0 C;  1IW7 C;  2MHV A;  2SNS A;  1DJR D;  2X6G A;  1SJH D;  5C3W A;  4M1U B;  1I6V C;  1RTN A;  3IAY A;  1WTV A;  3PUV A;  4BWG B;  5KYI A;  1SEB D;  1ET6 A;  5M9O A;  4HN7 A;  1E0B A;  1DD2 A;  1TS5 A;  2F0L A;  3DXJ C;  5COY A;  4K2K A;  5TSS A;  2WB1 B;  2F0U A;  3S14 B;  1SYC A;  3OMC A;  5ELF A;  5HGT A;  2B2T C;  3BYY B;  5EBC A;  2I07 B;  4I65 A;  3QJY A;  2ICI A;  1STG A;  2XRS D;  1KTK A;  1NR4 A;  4RAU C;  2EDG A;  4X3K A;  1MBY A;  4K2L A;  4U67 3;  1BCP C;  4I7Z C;  2HCC A;  1YNJ C;  3PUX A;  2MUY A;  1S5F D;  1A2T A;  4C3I B;  3I3C A;  2WKD A;  4HR7 B;  3G6J B;  3GTO B;  2NVT B;  1GOZ A;  1BF4 A;  4IFD I;  3EA6 A;  1BO0 A;  2ID0 A;  5NUC A;  3GTQ B;  2BOS A;  3E5S A;  2B2W C;  2L5T A;  4E6I A;  1AZP A;  2K01 A;  4XQJ A;  5EGT A;  1LO5 D;  1QJO A;  4HSP A;  1E2W A;  1JOR A;  2K04 A;  3NBH A;  2SOB A;  3DWP A;  4IFD G;  3S9W A;  5CV5 A;  1Z6H A;  3R8B A;  2K33 A;  3VR6 A;  2OXP A;  5KGU A;  1XXG A;  1JOO A;  2PZW A;  3MTS A;  1C4Q A;  2QCP X;  1RHP A;  1R4Q B;  5D3D A;  1OXV A;  4KK7 A;  5IIF A;  4RGM A;  1HQR D;  1V1P A;  4FF2 A;  1DOL A;  5C3X A;  1K83 B;  1TS4 A;  2KA7 A;  3J7A V;  2JXM B;  3KF8 A;  4DA2 A;  1PZI D;  4G7H C;  1LAB A;  4FNF A;  1PTO D;  4ODG A;  2AUJ D;  2KEE A;  1LT3 D;  4DFA A;  4IFD H;  2R61 A;  1Q1B A;  2EY2 A;  1UAP A;  1SFO B;  2EYP A;  4DNT B;  2V4D A;  1F2M A;  3PV0 A;  1K8O A;  1SMY C;  2A6E C;  5EPL A;  1ILP A;  3H09 A;  3MVV A;  5CGK A;  2L0C A;  1B9N A;  4MHE A;  1HHV A;  2FHT A;  4U68 A;  3VA5 A;  4FVM A;  1DYQ A;  4KN7 C;  1H9R A;  2VNU D;  3KLS X;  5DNF A;  1NR2 A;  2EJF C;  3GO5 A;  1B2T A;  2F03 A;  1NUC A;  4Z9C B;  4RA8 A;  3T13 A;  1GUT A;  2K03 A;  2NN6 I;  4QB4 A;  3K57 A;  2ZXO A;  1GUS A;  3A56 A;  2DNE A;  3G7L A;  1QCB D;  2F1M A;  3T16 A;  1X32 A;  1SE4 A;  4BBR B;  4XQQ A;  2F0Q A;  3ONA B;  4FF3 A;  5E3F A;  1PFB A;  1EEF D;  1VMC A;  2AQ1 B;  5FKA C;  4Q0F A;  1QE6 A;  1L0X B;  5C44 B;  2RDH A;  5J1Z A;  1HCZ A;  1KNE A;  2B2V A;  2D9U A;  2BDN A;  1D5X C;  3DEO A;  1CI3 M;  2IWH A;  4LMQ D;  5A2Q L;  5M5W B;  2R93 B;  2L4N A;  4RCO A;  3NPP A;  1ZKO A;  4BBS B;  1BDO A;  4UDU C;  2ICE C;  3RLF A;  2EJM A;  4A3F B;  1A3U A;  4RHS A;  1HXY D;  1ET9 A;  4EQO A;  1RKN A;  4V19 0;  2JEA I;  3MWY W;  2F0F A;  1RJT A;  2NN6 H;  2R7Z B;  2OT2 A;  2QEJ C;  3AMU A;  1EZ6 A;  5JOB A;  5LL6 X;  2AWO A;  3A7L A;  5IGF A;  4DGZ A;  1MGS A;  4H0L C;  1IYU A;  5JEA H;  1X3Q A;  3OW7 A;  3URY A;  3M7G A;  1LT5 D;  3N6R A;  1ILQ A;  2JP1 A;  5EBD A;  1EZ8 A;  2E2D C;  4G7Z C;  2H1E A;  4IUT A;  4DNR B;  3HGB A;  1EQT A;  3WOF A;  2XVS A;  1D2B A;  3P20 A;  1A2U A;  1MD2 D;  3VYR A;  1DON A;  2X69 A;  3NP8 A;  5KEE A;  4ILW A;  1F77 A;  1FR3 A;  1QIL A;  1SYF A;  3MXN A;  3C1E A;  1JE4 A;  3FPP A;  2B8F A;  1A15 A;  3DWA A;  3X3N A;  3QIA A;  2EXZ A;  1I4R A;  3MA2 B;  4A3J B;  3C2P A;  4HSV A;  1TWF B;  2Q8I B;  2Z1C A;  4ZUJ A;  2FFK B;  2NTT A;  3DHQ A;  3RUZ A;  4A3G B;  3D4W A;  3ND8 A;  1ICW A;  3L9A X;  1MI2 A;  3MXG A;  4RGO S;  2JEB I;  3QO2 A;  3SDZ A;  4A3B B;  1D1K A;  1EIH A;  2FMM A;  1I3Q B;  2F0O A;  3NUC A;  3OPO A;  1B44 D;  5ELC A;  1SND A;  1M8A A;  3T51 B;  4A3I B;  3S2H B;  3HRZ C;  3R2I A;  4C2M B;  2O4X A;  4S3S A;  5F2D A;  1CA5 A;  1WTO A;  4CHT B;  1PRT B;  3T56 B;  1PTO F;  1V8Q A;  4XTC S;  3QOL A;  2IT1 A;  5EJW A;  3K0Y A;  2XWB B;  3FKI B;  4L63 B;  3S15 B;  2BCO A;  3R93 A;  5D3I B;  5FO9 B;  3ND9 A;  4PMC A;  4ULL A;  2F0D A;  4ZAI A;  1TWC B;  2JA5 B;  3MFY A;  4QCL A;  2WII B;  1PTO B;  1M4V A;  3NQT A;  2A6H D;  2F0J A;  4C3H G;  3PUZ A;  1QNU A;  4CJ1 B;  5J39 A;  1JC7 A;  4XQN A;  4KV6 A;  1TY0 A;  3GTL B;  4KJN A;  3KK7 A;  2ZXP A;  5C4Z A;  1S5B D;  1OXU A;  2K5Q A;  1JB3 A;  4FXG C;  1O7L A;  2RSO A;  3SR1 A;  5K36 H;  3BVZ A;  1V43 A;  4JBW A;  3HOX B;  2SNM A;  4C3H B;  1HUM A;  3TME A;  4BY1 B;  3Q0A A;  2A5H A;  4LK1 C;  4KD4 A;  4P2C B;  1B1Z A;  1LT4 D;  2F3V A;  2XIW A;  1EYA A;  1BOS A;  2NYZ D;  2NUC A;  2WP8 J;  1JWM D;  5ELD A;  1LTI D;  4RCN A;  5CYU A;  5I2X A;  3S1Q B;  3D4R A;  3RD4 A;  1DM0 B;  5E4X A;  4KMU C;  5HUR A;  1R9T B;  1SXT A;  3J81 E;  1Z7T A;  1ZXT A;  4TKO B;  4XYQ A;  4HMJ A;  1SNC A;  2X6L A;  3QOJ A;  1F9Q A;  1STN A;  1KDA A;  1GJX A;  4LAA A;  4KD3 A;  1EL0 A;  1IKM A;  3NK9 A;  3EJI A;  1B9M A;  3M3Y B;  1XWE A;  2F0I A;  1CA6 A;  4DAV A;  2CW0 D;  5AFW A;  4IFD J;  4OO1 I;  1Y69 U;  4IUQ A;  5KIX A;  2Q8R E;  5G3L D;  1STY A;  5C4H A;  1F9R A;  2F0T A;  3V96 A;  2E2H B;  4J1M A;  3GV3 A;  1JOQ A;  1JCK B;  2SEB D;  4A3K B;  3LWU A;  2HDL A;  1OXT A;  3GTM B;  3U9S A;  5LL6 S;  4DK0 A;  3P1H A;  4PMB A;  5CV4 A;  3Q23 A;  1U9R A;  4X3T A;  2O5I C;  4KY6 A;  5I2Y A;  2E74 C;  2WAC A;  2FJ2 A;  3PUW A;  4HMI A;  1EYD A;  4PQX A;  3S17 B;  5DAU A;  3DM1 A;  2M00 A;  1EYC A;  3D6W A;  3K5O A;  1C48 A;  1STB A;  3A8K E;  1W6K A;  4N9P A;  3QWN A;  2WKC A;  4K14 A;  4NW2 A;  5I9O A;  1HTP A;  3SK4 A;  4J8Q A;  3I4M B;  2XRQ D;  2D2C C;  2C5C A;  2KHS A;  1S4Z A;  1FYC A;  1TVX A;  3SVM A;  1I4P A;  4HED A;  1DOM A;  2K1B A;  2RA4 A;  1D1I A;  4TSS A;  1F2Y A;  2GA4 B;  2R6G A;  3Q22 A;  1HRJ A;  4OO1 H;  1EEI D;  2NVY B;  5COR A;  1TU2 B;  1PLF A;  4A93 B;  4F88 A;  4OHJ A;  3QG1 A;  1G8Z D;  4KJO A;  3UI2 A;  2VB3 X;  1CK1 A;  2B2T A;  2RKS A;  2K28 A;  2L9H A;  4ME5 A;  2OEO A;  2HQE A;  2LFN A;  1HQM C;  1EY6 A;  2A74 C;  2HCI A;  3D4D A;  2IJ0 A;  1LTG D;  1V1P B;  4ZRZ A;  1ZEQ X;  1V1O A;  1LAC A;  1OXX K;  1EIG A;  2NVQ B;  3ITP A;  2XSC A;  5M3F B;  1O78 A;  2NZ1 D;  1QOH A;  1JWU D;  2EYH A;  2K7V A;  1Y8N B;  1GHK A;  5IGB A;  1EU3 A;  2E75 C;  3A54 A;  1Q1E A;  1PRT D;  3T4A C;  4XT1 B;  4RWS C;  3U9O A;  3PIO 3;  1A6X A;  1BBX C;  3L7Z C;  2B2W A;  4KKS A;  2B63 B;  1ENC A;  3R3O A;  2J7Z A;  1SDF A;  4FP5 D;  5JEA J;  2BE5 D;  1YNN D;  3GP7 A;  2AWN A;  4H13 C;  2E2I B;  4R8N A;  2EPB A;  2FMC A;  1QB5 D;  4NMZ A;  2IX1 A;  1AEX A;  1EY8 A;  1JWS D;  4RFB A;  3MC0 B;  5C5L A;  5M3M B;  4LJZ C;  3OWE B;  5JPM C;  3GV6 A;  1I4Q A;  2KUM A;  1GHJ A;  2BA0 A;  5CBE E;  2NB0 A;  3HKZ B;  3ZYY X;  4CGY B;  4G4K A;  3HOZ B;  3KLR A;  1FNV A;  5I6Y A;  4F7X A;  4PMW A;  4DAY A;  4FXK C;  4K8I A;  4IUN A;  1BXT A;  3NSW A;  3H6M A;  3GTG B;  1XTC D;  2KVM A;  4B9W A;  4A3M B;  1ZYR C;  2PPB C;  2A6H C;  4X3S A;  4G57 A;  5BN4 A;  1LTB D;  2PNR C;  5C0X I;  1UEA B;  3H94 A;  1CM9 A;  2KJX A;  4QF4 A;  3S1R B;  5BN3 A;  4V0B A;  2Z4H A;  3X3M A;  1RTO A;  3KUP A;  4OIJ A;  2QKI C;  3NE5 B;  2KCC A;  4HAE A;  2B2U C;  4DK1 A;  1ML0 D;  2QDB A;  2HUG A;  3KBX A;  3K59 A;  1PFN A;  1WTX A;  1GUW A;  4L6T B;  3M7N A;  3Q24 A;  4XDX A;  3D31 A;  2NN6 G;  4QUC A;  2N55 A;  3TN2 A;  2Q8T A;  1F9P A;  4JK1 C;  5JPN C;  1WD1 A;  5JEA G;  2EVB A;  3K5L A;  3J80 E;  3VYT A;  3P75 A;  4DXG A;  1EY5 A;  5G3L F;  2JA7 B;  3OIQ A;  1CHQ D;  1GUO A;  2IPK D;  1JR0 D;  3NHH A;  3FVQ A;  3GTJ B;  1QNK A;  2EYO A;  1SSO A;  3SK5 A;  5CMD A;  3TP5 A;  3NXW A;  5FK9 C;  5DM6 3;  2F0W A;  5M5Y B;  1VDZ A;  1H9M A;  1A3V A;  4TRD A;  3AU7 A;  5C0X H;  3J81 L;  1Z47 A;  5I4D A;  2F0H A;  1D5M C;  1QG7 A;  5EPJ A;  2E76 C;  1I6H B;  1EOT A;  1U4P A;  1EY0 A;  4DU9 A;  3Q6S A;  1II3 A;  3NWS A;  4RH6 A;  1GUG A;  2AQ2 B;  1B3A A;  1STH A;  1WD0 A;  4RGN A;  4GZY C;  4KHZ A;  1H9K A;  4F87 A;  3VR3 A;  1AZQ A;  4WJW A;  1B53 A;  1A3T A;  2QIL A;  4IUV A;  2EYF A;  3FDT A;  1YNJ D;  1MSG A;  2J4X A;  3KLS A;  5M5X B;  5C4J B;  3LNN A;  4ZK9 B;  2L55 A;  1PXU A;  3WOE A;  3DMU A;  1H9J A;  2TSS A;  2F0S A;  1TT2 A;  2F0N A;  3JAM L;  1U4L A;  3RZO B;  2RDG A;  1ESR A;  2RBM A;  3AB9 A;  4IUP A;  3J7Y W;  3HOV B;  1SNQ A;  4K6L A;  1JOK A;  3BDO A;  5JVG 3;  3CRK C;  2Y0S B;  3TDQ A;  1EY9 A;  1HFG A;  4C3J G;  1SYD A;  3PMF A;  1SBB B;  1TII D;  4NKL A;  1PRT F;  5ISR A;  3DEP A;  4QUF A;  1DCZ A;  4KI0 A;  4ZYS A;  2HDM A;  3O13 A;  4FF1 A;  1QWY A;  4KKU A;  1XYI A;  4C3J B;  2F0V A;  3P7J A;  5KNB A;  3RMH A;  1H9S A;  2B39 A;  1MSH A;  2PQE A;  2JA6 B;  4Q5V A;  2A69 D;  5K36 G;  1SAP A;  1EY7 A;  3CU7 A;  1HFN A;  3CRL C;  4B08 A;  2C9O A;  1EWC A;  3PO2 B;  2AQ3 B;  3IFD A;  3W2D A;  1ESF A;  3F2U A;  4O1N A;  1PRT C;  1G91 A;  3OMG A;  2LS0 1;  4K5V A;  1KDB A;  4CJ2 C;  4CKE A;  4EQN A;  1CTM A;  1RD9 D;  1Q3L A;  3VYS A;  3FEW X;  3MEH A;  1SMY D;  1UNS A;  2DNC A;  4IN3 A;  1WVL A;  2NTS A;  4ID6 A;  4MN3 A;  3TP8 A;  2BE5 C;  3T53 B;  3A8J E;  5EKL A;  4ZKB B;  1PTO C;  1OXS C;  3OSO A;  3J7A F;  3M4Y A;  3BVG A;  1IKL A;  2IX0 A;  4IQZ A;  1KDC A;  3ERO A;  1G2S A;  4K5X A;  3C3L A;  1LTA D;  3DUZ A;  4BY7 B;  3FMC A;  4M8A A;  2PW5 A;  4FF4 A;  4KY7 A;  4G7O C;  2B2Y C;  4XIG S;  2J0T D;  2KED A;  2WV6 D;  4QMG A;  1LTR D;  5KYL A;  1E2Z A;  4DXF A;  5C3E B;  2R92 B;  4A3E B;  3HOU B;  4K8J A;  2H4O A;  1KLU D;  1Q90 A;  2D62 A;  4H7B A;  5ELE A;  4EVO A;  2F3W A;  3VA7 A;  2B8G A;  5D14 A;  3GQB A;  3L3O C;  1G29 1;  3OWF A;  2AUK A;  3BDL A;  1DOK A;  1PMR A;  4NP5 A;  1IYV A;  3V05 A;  2LMC B;  3C1F A;  1CZG A;  3SK8 A;  1TWG B;  4EGV A;  1HTL D;  5EKK A;  4J6H A;  4CBV A;  2KCN A;  1SJE D;  3D8G A;  5CC4 A;  4BA2 I;  5DEH A;  2L12 A;  1SYG A;  3ERQ A;  1LLR D;  5IGC A;  1LTT D;  4X3U A;  4OO1 G;  3FPU B;  2F4I A;  4OL7 A;  1Y1V B;  2CQA A;  2D5D A;  3JAM E;  2PCF B;  2OF1 A;  1GUN A;  3FRP B;  3J80 L;  2VB2 X;  4R9W A;  1BCP F;  4IUU A;  5K5P A;  4AYB B;  3BS1 A;  4ZLT F;  2K5D A;  1WTW A;  3SE0 A;  4IZ8 A;  2YYZ A;  1HPC A;  1FNW A;  1WTP A;  2VXW A;  1C8C A;  5FLX E;  1FNU A;  1BCP B;  1I50 B;  5KND A;  5JAV A;  2EYM A;  1HUN A;  4C3I G;  3GTP B;  2PMZ B;  3D6C A;  1NSN S;  4WFN 3;  2WAQ B;  3MFG A;  2F0G A;  1I4G A;  1KNA A;  5IGG A;  2F0P A;  3A8I E;  4K5W A;  5FO7 B;  4C1N K;  1Y8O B;  2XN9 C;  3I73 A;  3LWE A;  3CHB D;  1IHZ A;  4RGT A;  5D65 A;  2XWJ B;  3VYU A;  3W3A A;  1SNP A;  3R2T A;  5T1I A;  2Z8L A;  1J8I A;  5CV9 A;  5KRU A;  3K7A B;  3KBG A;  5C0X J;  1UUP A;  2O2L D;  4WRD A;  2TMP A;  2RQX A;  3OIP A;  1SNM A;  2CHB D;  1RDP D;  1SE3 A;  1HA5 A;  1F2L A;  3D3R A;  2F0E A;  2WIN B;  2CVR A;  5C6A A;  2LY7 A;  2EZV A;  3TP6 A;  5IT9 E;  1FGB D;  3EQL C;  3NQI A;  4KTA A;  2KQ3 A;  3NTK A;  3K5N A;  3SHL A;  1VMP A;  3HZX A;  1TQO A;  3RZD B;  1CQF A;  1NCV A;  5CBA E;  2JYO A;  2A69 C;  1RCV D;  2NWG A;  4WOR A;  5IGD A;  3GD7 A;  5CV7 A;  3SXH A;  2A68 D;  1I4X A;  3SEB A;  4FO2 A;  1AP0 A;  3BDC A;  1ROD A;  4EQP A;  3HG9 A;  3V2T A;  1D5Z C;  3I70 A;  2PZT A;  1K8M A;  3LX0 A;  1LV9 A;  4PV1 C;  5FOB B;  1BR9 A;  1EQV A;  1GXD C;  3QB3 A;  3K58 A;  2MPM A;  4DN4 M;  3I91 A;  3TSS A;  3S1M B;  4R8I A;  1TKW B;  3NTI A;  5BN5 A;  3IFT A;  1TY2 A;  2LKV A;  1AFP A;  4XYO A;  5KNC A;  1F9S A;  1TS3 A;  2KOL A;  2G9D A;  2F0M A;  1TWH B;  3BZD B;  5C0X G;  4C1N I;  4KHV A;  2B2V C;  2PW7 A;  4B9X A;  1Y1W B;  5JJZ A;  2IW3 A;  2N88 A;  4RKL A;  4HCE A;  2ENB A;  1U4M A;  2DY8 A;  1WCM B;  5E4W C;  1BUV T;  4XT3 B;  3WDN A;  2O5J C;  5FO8 B;  3CKI B;  2MJ8 A;  1L0Y B;  4XXE A;  2I46 A;  2K6A A;  1CFM A;  1CQV A;  4KN4 C;  2B2U A;  1CZW A;  4IAL A;  1EWH A;  1X3P A;  2DY7 A;  4RKB A;  5LHY 1;  1VF5 C;  1IW7 D;  1SYB A;  1B50 A;  1JIC A;  1CT1 D;  1I4H A;  2EE1 A;  1O80 A;  1STE A;  2RDF A;  3I72 A;  4L8J A;  2DN8 A;  2EYL A;  1R4P B;  3OOC A;  1AN8 A;  2F0K A;  3NBI A;  2Z4I A;  2CW0 C;  3NTH A;  4PNY A;  3MAQ A;  3E6Z X;  5JVH 3;  2SDF A;  1TS2 A;  1PZK D;  2ZXR A;  4Y7N B;  4O42 A;  1VF7 A;  1ONL A;  4ZQ3 A;  1J9O A;  3VR5 A;  1BCP D;  5DM7 3;  3M85 A;  2NBF A;  1W6J A;  2NVX B;  2VUM B;  1LT6 D;  1CHP D;  3NWT A;  3H3V C;  1SNO A;  3VR4 A;  4FYD A;  3E0J A;  4QIW B;  4CKC A;  1EY4 A;  2K5W A;  2JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...