4I65A

Crystal structure of staphylococcal nuclease mutant v23i/l25v/i72v/i92v
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKVMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYVYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-11-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4i65A00
4KY7A 2SNMA 4K2LA 4K8IA 4N9TA 2HQEA 5KEEA 5JAVA 4QB4A 2EXZA 4ID6A 4EQPA 2EY6A 5C3WA 4DFAA 1SNMA 1ENAA 5CR3A 1SYDA 4R8NA 3DMUA 4ZQ3A 1KDCA 4EQNA 2PZTA 2F0GA 1A2TA 3SR1A 2F0PA 2RKSA 4KY6A 3TP6A 2OXPA 4KV6A 2SOBA 2EYMA 1SNPA 1EY5A 1JOOA 3ERQA 1KABA 1SNDA 2EY2A 2F0QA 3MVVA 4IUNA 2PZWA 4RKLA 5J1ZA 4K14A 1EY0A 4ZUJA 4J6HA 1EZ8A 2F0VA 5CC4A 1JORA 1TR5A 2PYKA 4K6DA 4DU9A 4EVOA 2KHSA 1NUCA 3EJIA 3EVQA 1EY8A 3H6MA 4IALA 2ENBA 3SK5A 2F0DA 1EY9A 4DGZA 1F2ZA 2PQEA 3NHHA 4YIJA 5EKKA 3SHLA 3SK8A 3DHQA 5I9OA 5IOCA 1SNOA 3MEHA 5C4ZA 3SK6A 2F0FA 5K5PA 3EROA 3D8GA 4K5VA 2F0SA 1STYA 3NXWA 3MXPA 1A3TA 3QOLA 2SNSA 3E5SA 1KAAA 3MHBA 4G57A 3V2TA 4B9XA 5CV7A 1TT2A 5IGBA 4QMGA 4NMZA 2F0TA 1A2UA 4KD4A 2KQ3A 4MIUA 3P75A 2LKVA 1KDAA 4KHVA 1STNA 3RUZA 5C4HA 1EZ6A 1STHA 2F0LA 1EY6A 3P1HA 4ODGA 5C5LA 5EKLA 1SYEA 4QF4A 1SYBA 3D4WA 3C1FA 1TQOA 4NP5A 5C6AA 4B9WA 1EY4A 4K8JA 5DAUA 2OF1A 4HTHA 2WACA 3VA5A 2F0NA 4LAAA 1NSNS 2EYOA 5I9PA 1JOKA 1A3UA 1EQVA 3NQTA 4N9PA 4PMCA 5KRUA 3S9WA 4KD3A 4TRDA 4F7XA 2QDBA 5CGKA 5C3XA 4I65A 3OWFA 5IGFA 1U9RA 3TP5A 3T16A 5CV6A 4K5WA 5CV8A 5IGEA 1STGA 1SYGA 3R3OA 5KIXA 5EGTA 5CV4A 5C5MA 5DEHA 2RBMA 2EYHA 5KGUA 2F0KA 4HMIA 3NUCA 5F2DA 4PMBA 3D4DA 2PZUA 3PMFA 3QB3A 5JOBA 3T13A 3U9OA 1SYCA 3HEJA 4KJNA 4EQOA 2F0WA 4HMJA 1KDBA 2F0MA 1EYDA 2PW7A 1JOQA 3BDCA 2EYJA 4F8MA 4PNYA 1F2YA 5ISRA 1EYAA 3NK9A 1II3A 1SNCA 4KJOA 4WRDA 5I6WA 2EYPA 2F0HA 2O4XA 5NUCA 4H7BA 3ITPA 5CV5A 4E6IA 3TMEA 5IGGA 5KYLA 4KY5A 5J39A 5HGTA 2OEOA 4IZ8A 3HZXA 3NP8A 2EY1A 3OMCA 5M9OA 3BDLA 2F0EA 3C1EA 4NDXA 2F0IA 1ENCA 2M00A 1STAA 5IGDA 3OSOA 4J1MA 1IHZA 1EY7A 1STBA 3LX0A 2RDFA 5E1FA 4S3SA 5HURA 5J22A 4DF7A 3OMGA 4ME5A 3SXHA 4NKLA 1A3VA 3SK4A 5I6YA 2F0JA 2F3WA 1F2MA 2NUCA 4K5XA 3TP8A 3MZ5A 1EYCA 1SYFA 4KTAA 1RKNA 3QOJA 5IIFA 5KYIA 2F3VA 5CV9A 2EYFA 1SNQA 2PW5A 5E3FA 4WORA 4RKBA 4ZUIA 4OL7A 3TP7A 5IODA 4K2KA 3D6CA 2F0OA 5IGCA 1AEXA 2F0UA 2EY5A 2EYLA
chains in the Genus database with same CATH superfamily
2ZM6L 4PZ7A 1HNXL 1PMRA 4DKAC 4DV1Q 2JA8G 1O7YA 2FXQA 5M5YB 2F0GA 1NNXA 2AUJD 4LFAQ 1CHPD 5AFWA 2KENA 1D5ZC 3K5NA 3I4MH 3BZDB 1HHVA 4DU9A 4HIOA 2K28A 1H9KA 1NUCA 3EJIA 2YU9B 4BBSB 1VS0A 2I5MX 1ZKOA 3IKJA 2QGQA 3SK5A 2E8GA 5DNFA 1PDQA 5IOCA 1C7YA 3H15A 4DR4Q 1TS5A 3EA6A 1STYA 1S5CD 1X65A 4KN4C 2B29A 1MHWC 1H9SA 2VY3A 2Z0SA 1QB5D 1PRTB 2LSSA 1EIYB 1KRTA 3P75A 2LKVA 1Y14B 2CW0C 4C3IB 4Q5VA 1HFNA 1CSPA 3K6OA 4X3SA 2FJ2A 1E2ZA 2LXKA 5A35A 2N8NA 3MWYW 3HOVB 2CKZB 1YNJC 5COYA 3W1GA 4B3SL 3VA5A 4RGMA 5C3EH 5CBEE 1BBWA 4JV5Q 1X54A 4GLAC 4A3KB 2JP1A 3K5OA 5I2XA 5C3XA 4B3TQ 2R7DA 2CHBD 3HKZB 3EFXD 2OTLA 1KL9A 3TS2A 1LUZA 4UPAA 1HA6A 2N49A 2XNAC 2K4KA 3S1QH 5GAGC 5F2DA 4PMWA 2J4XA 4EQOA 1O7LA 5HGQA 1H9SB 3ND8A 1E1TA 2Z6BA 5M3FG 3S2DB 3I90A 3MEFA 2AKWB 4F8MA 1F2YA 4HAEA 3S2HH 4A3MB 1EEID 1SNCA 2O4XA 4LUZA 2WAQE 2L0CA 2O5JC 1UNSA 4J8QA 5J39A 1K0RA 5LL6X 3KK7A 3FDTA 3GTGH 1TKWB 5GAEC 3T4AC 2BA1A 5D3DA 4IUTA 3NSWA 1ENCA 1WTWA 3OSOA 1I4QA 1YNND 4A3EH 3CCVA 3SXHA 2F0JA 2NUCA 4K5XA 2V1CC 1GD7A 4JI1Q 1DONA 4IFDH 2VB3X 5IT9L 4TQUS 1IBKL 1SNQA 1N33L 2Y0SG 1AEXA 3K0XA 1GUSA 5IP9G 2EQSA 2NN6I 2E2JB 2UUAL 2L15A 3ND9A 2EY6A 5IE8A 2N88A 1V8QA 3CC4A 5EPKA 2A73B 1V1QA 2K01A 4RCNA 1CFMA 2B2YA 2EYMA 2R92B 2A6HD 2L5TA 1G291 2E2IB 3A8JE 3C3LA 4HN7A 2CWPA 3SEBA 1YZ6A 2GA4B 3TDQA 3MXGA 1EWHA 1K8OA 1XJVA 1EY9A 5M3MG 1F2ZA 3NHHA 1HZAA 3K81C 3BVZA 2D5DA 1VQEA 2N55A 1PH5A 2PNRC 5IP7G 1DZ1A 4DV5L 3QOLA 1PRTD 4POFA 1TT2A 2R7ZB 4KHVA 5C4HA 3ONAB 1HNXQ 1FL0A 1EZ6A 1YBYA 1U4PA 1PH2A 4YWKA 1SYEA 3A0JA 4C3JB 2I46A 1OXSC 1E0BA 1PVOA 1AE2A 3P20A 5JVH3 1PTOH 4FO2A 1KAWA 4KD3A 3TRZA 1HPCA 3RZDH 1ESFA 5M5WB 3T16A 3ULPA 3PO2G 1SYGA 3QG1A 3HOZG 2X6LA 2JEBI 4G7ZC 1MKHA 1YVCA 2RBMA 3AYHB 3F1ZA 3HOXG 4OO1I 2ZJQA 3U9OA 5JOBA 5C0XJ 3HOWH 1LYLA 1R4PB 2E2DC 1E3PA 3I4MB 3BDCA 5ELFA 2BCOA 2HCCA 2MQHA 4P2CB 1WCMH 1STEA 1EU4A 4B3SQ 3J7ZC 4E6IA 5D65A 3MXUA 5D14A 4JBMA 3PO3H 4V0BA 1CQVA 1I4HA 1HUNA 2O2LD 2VUMH 3OTOL 4LF5L 1VQMA 4JBKA 5KNCA 4L5RC 4POGA 2OCEA 4A3IH 3HP3A 2NVXB 1IBLL 1B4OA 4A3CG 2RSNA 1AE3A 3AQQA 3KLSA 3I55A 3I4OA 2RCFA 1YHQA 4AYBB 1LM0A 3G71A 1SROA 2QW7A 2HQEA 2Z6KA 5C3EB 1VQAA 1PTOC 4DNRB 2G9HD 4FDBA 4H0LC 3U4ZA 3SR1A 2QILA 1PH6A 1SE4A 3DM1A 1SNDA 4KN7C 4CHTB 2AQ2B 5JPNC 1JWSD 2TMPA 1EY8A 1VQGA 3S16B 1RJTA 1ZYRD 1B3QA 1PRTF 4DPGA 1W6JA 3D0FA 1NJIC 5EKKA 2J0TD 2Q8RE 4H13C 3GD7A 4KMUC 1IBKQ 3K5MA 1B3AA 1SAPA 2YTXA 5JJIA 4F88A 2PI2A 1SE3A 4B9XA 1U5KA 1BDOA 1N33Q 3S24A 2UUAQ 3J80L 3P1HA 3HOYB 1EOVA 3GTGB 1RD9D 3OW7A 2MFIA 4R4IA 4BBSG 3AFPA 3J81L 1I3QH 1WI5A 4KHPL 1N34L 4A3GH 2H1EA 2C5CA 3I73A 3L9AX 1PFBA 2IPKD 2ID0A 4FF4A 1STGA 3MTSA 4R1JA 1MSGA 4X64L 2UXDL 1Q8KA 4C3IG 1HJPA 4DV5Q 1WTOA 4GOPA 1I4RA 1WTPA 3T13A 1C0AA 2YYZA 5A2QE 1UE5A 1JOQA 1CTMA 3KLWA 2WFWA 3H91A 2XWJB 5E4WC 5JJLA 3DM3A 1O80A 1EYAA 3OYYA 1II3A 4A3FH 1M90C 3R8BA 5EQ0A 4CKCA 1RF2D 4DUZL 4KY5A 3HKZG 2CH4A 3P7JA 4FF2A 2VNUD 2OWOA 1ET6A 2AHOB 1CSQA 4J1MA 1WOCA 3LGJA 2KVMA 1LTID 1FYCA 1EYCA 2F3IA 1GUNA 1I4GA 3RNUA 4JI8L 2EYFA 1BVSA 3AFQA 4A3MG 1TWCH 2QKIC 3R3OA 2SNMA 5KEEA 1HNWL 4GOPB 3A74A 2BH8A 5CR3A 1XTDA 1IYJB 3G4SA 2PZTA 2A74C 4LF4L 4L63B 1Y69U 1IW7D 3RZDB 2AWNA 1EY5A 2NN6H 3BG3A 1TWGH 3L3OC 2Y0SE 4RKLA 1HH2P 5FO7B 2ATWA 3OTOQ 2IT1A 3U4VA 4LF5Q 3HOUG 1V1PA 4MHEA 4IO9A 1IBLQ 2R93H 3HOWB 1D6EC 1VMCA 2ZXRA 1N36L 1JJ2A 3MHBA 5T1IA 1ZEQX 5CV7A 3O13A 1Y1VH 4O1NA 4QMGA 5K36H 4UY8C 2LMCB 4R4QA 3DEOA 3CPFA 1STNA 1S4ZA 3S14H 3I2ZA 4M1UB 4OXPA 2R92G 1EY6A 3PO3B 3CCEA 3TN2A 4V190 2DN8A 4U673 2VUMB 3C1FA 1NR4A 2WB1B 2ZXOA 4YCWA 1EU3A 3H0GG 1VDZA 1BUVT 2LXJA 4R4OA 3KDFA 5BN4A 1YIJA 2Q8IB 4LUOA 1WD1A 4PMCA 4FNFA 1B53A 2PNHA 1WYDA 1YI2A 5C0XG 5FLMH 3CKIB 1IYVA 3J80c 1JE4A 4GLVB 1SN8A 1V1PB 5DM63 5DEHA 4LF6L 1GUWA 2F0KA 3F2UA 4C3JG 2BA0A 4QGUA 1MSHA 1H95A 2RHQB 3MFGA 2F4VL 3IRBA 2G5DA 4OIJA 2R61A 4EQ5A 4OO1H 5M5YH 1PH3A 4A4IA 2B2WA 5KYLA 3TMEA 1A15A 4WFN3 2B2TC 4KHPQ 1N34Q 4G4KA 2DY7A 3PQIA 3KDFB 2KOLA 1O7IA 2RDFA 3MFYA 4S3SA 3KJOA 2D62A 3BYYB 3ICEA 3KF8A 1HTLD 5I6YA 4X64Q 2UXDQ 4DV3L 1XPUA 3A56A 2JN4A 2DUDA 3I4MG 4O42A 3J80i 4NXNL 5AJ3L 4HIKA 2NZHA 1K8MA 3CAMA 2Z4HA 2M2LA 1X32A 3EBEA 1GVPA 1PYSB 1I3QB 3J81i 5FLXL 3HOVH 4KY6A 4HSPA 4KV6A 3ERQA 4A3LH 4JVZA 1YNNC 3SDZA 1EQQA 4ZUJA 4GNXA 1QVFA 3C2PA 1JMCA 1DOKA 4A3KH 1YHBA 4R8IA 2MGSA 4AYBG 1Z7TA 2MO0A 1SNOA 4YHHL 3NQIA 4R9WA 4JI8Q 1MIUA 1C48A 1B9NA 3MXPA 5C3EG 1D8LA 1KNAA 3CRKC 3KF8B 5IT9E 1YJNA 1DM0B 3T56B 1CUKA 4A3FB 4KLKA 4JCVE 1HNWQ 3CC7A 1U4LA 4C3HH 5C4XH 2A6HC 4LF4Q 3T1HL 2K7VA 1EY4A 1GUOA 5FKAC 3Q22A 4JYAQ 1RIPA 4YCVA 2EYOA 1EQVA 1PFSA 4IN3A 2ZTDA 2BOSA 1KNEA 4GNXB 2R3ZA 1TWCB 3GTMB 1PRTC 3HKSA 1OXUA 5EJWA 1L0WA 5ELEA 1N36Q 5C5MA 4IUUA 1BO0A 1HZ9A 1NAPA 5KGUA 2B63H 1MJCA 1YJ9A 1OO9B 2PZUA 2CH4W 1BBUA 2JA9A 4A3EG 3SE0A 4AH6A 4C1NK 5CBAE 1KXLA 4A3BB 1KDBA 1TWGB 1EYDA 2F0MA 2K5NA 4MZ9A 4P74A 2EYJA 3GO5A 1HXYD 2WIIB 5KNDA 4IFDG 3PUZA 5CV5A 4LFCL 2XWBB 4IURA 2R93B 3HZXA 3G7LA 2ZTCA 4IPDA 4OEMB 4QUFA 1Q86C 5GROA 1FNUA 1BCPB 2VS1A 1CA6A 1Y1VB 3SK4A 3E0EA 5H1SE 3MZ5A 4LF6Q 5C4JB 3HKZE 1PZJD 2PW5A 3TP7A 5IODA 5IYCH 1CT1D 4DR3L 1SR3A 3BU2A 4OHJA 2EYLA 3A54A 2HCIA 2F4VQ 3S1MH 2R7ZH 4PZ6A 3Q0AA 1K73C 1X3GA 2Q8TA 1F9SA 4HIDA 2K5WA 5IGGA 1HQMC 2EY2A 2HDLA 1I6HB 2ZTEA 2O5IC 2F0VA 3M9BA 4N8X1 4K6DA 1VQPA 1XWEA 4RWSC 3CRLC 3GV3A 2CWAA 2PQEA 3I56A 4XQQA 1ASYA 1YNXA 4DV3Q 3CHBD 3AB9A 4C2MH 1O78A 1VQ4A 3KFUA 3NXWA 5FLXc 5AJ3Q 3T1YL 2IWHA 4NXNQ 2CFMA 1Y1WB 2HDMA 3X3NA 3DWAA 2K32A 1S5BD 2Z1CA 2IJ0A 5C5LA 4DN4M 3TZDA 4A75A 3I72A 3NTIA 2K04A 2WACA 4OWTB 3A7LA 1IXRA 1EIGA 2F0NA 3KOJA 3OIPA 2M9VA 3HOWG 3S9WA 2JK8A 4TRDA 4OX9L 1PH1A 3F8TA 3ULLA 3F2CA 1G8ZD 1WCMG 3NENA 4YHHQ 3M7GA 3M4YA 2NVXH 1Q8IA 1WJJA 5KIXA 1VQ8A 5E4XA 3PO3G 1WTRA 3PIO3 1EWCA 3NUCA 2JQOA 2ICEC 2L12A 2VUMG 3MC0B 3PMFA 2WB1G 1FGUA 4HMJA 4A3IG 3OPOA 4XT3B 4UAIA 3D6WA 3J80E 3S1RH 2A8VA 1JQYD 3T1HQ 3M4QA 5ISRA 1IKLA 1VF5C 1AN8A 1MBYA 4JBWA 1I50H 3J81E 5HGTA 1PYWD 1E22A 3OWEB 4ME3A 1BCPD 2R7FA 1EY7A 1HR0L 2VZAA 1SBBB 3OMGA 3S16H 1Q82C 1AZPA 1B44D 4BBRH 2KHJA 4L8JA 3ULJA 5IIFA 4FXGC 4AQYL 2MHVA 5CV9A 3WWVA 4DK6C 4C3HB 4DAVA 5C4XB 1IYUA 1EOTA 4RGNA 4KY7A 1LTBD 4QB4A 2PMZB 1LABA 2A19A 1K9MC 3QJYA 2VL6A 1TWAB 1PZID 4ZQ3A 1SDFA 3A8KE 3HOYH 4A3DH 4LFCQ 1DOLA 2RKSA 1SE8A 2PZWA 4ZLTF 1DCZA 5KNBA 4KK7A 2HHHL 2IHFA 4GN3B 2B63B 1CQFA 2DY8A 3CXCA 1G2TA 3UDIA 1Y8PB 3EROA 2YTYA 4DR3Q 4HJAA 2ZXPA 4KD4A 1TU2B 3TEHB 1K28A 4A3GG 3LNNA 1MJEA 1KTKA 4JI4L 4UHVA 4FF1A 2EJMA 4AYBE 3CMEA 2G9DA 3CCLA 1TQOA 3R2IA 2KECA 1RTOA 3PUYA 3PUWA 2OF1A 1ZXTA 2MNAA 1GHJA 4IJLA 1GM5A 1DXMA 3DLLA 4L6TB 4WJWA 2E76C 1GKHA 2E75C 4A3FG 3RLOA 3S1MB 5CV4A 4O0AA 4PQXA 3CCUA 1F9PA 3T1YQ 1UEAB 3HGBA 2KCNA 4DR5L 3KLRA 1TWFH 2QA4A 2NYZD 2Z6KC 3STBD 3VA7A 1NTGA 2SEBD 1I4PA 1BCPF 1VQFA 5NUCA 3BYTB 4XIGS 1TY2A 5JEAH 1L2FA 4RH6A 2D9UA 1WTHA 2B8GA 4C2MB 4OX9Q 3GTJB 4GS3A 5IYDH 2HIXA 3HRZC 2N78A 1BKBA 2NB0A 4WJ3M 3UI2A 1NMFA 3VYRA 2I5LX 2NN6G 3QOJA 4IOCA 2EE1A 2LY7A 2QEXA 2QCPX 4OGQC 4DK3C 1B7YB 5C3WA 3NELA 2D0PA 1ENAA 2F03A 1Q1BA 4X65L 4UP7A 2PI2E 1A2TA 3CCQA 2B2VA 2SOBA 4DAMA 2WAQB 5J1ZA 2VQEL 1Y1VG 4C1NI 4MTKA 2VQFL 2NBFA 3N52A 5K36G 1LACA 5LMNL 1HR0Q 5IYBH 3FPPA 2ENBA 2F0DA 1WTVA 4DUYL 4DV2L 1YITA 3RZOB 2QDLA 1FNVA 4Q0FA 5C4ZA 3CU7A 4AQYQ 4K5VA 2JA7B 1K3RA 5E7NA 3S1RB 3PCOB 1HZBA 4IJHA 2XN9C 4DR2L 5FLMG 1Q46A 1I50B 1V1OA 2BE5D 4CDDC 2EJFC 3FKIB 1M1KC 1PFMA 2KJXA 4B08A 4CJ0B 3TS0A 3QO2A 3H3VI 1BR9A 4CDEC 1CKNB 3KF6A 5FLXE 2HUGA 4X3TA 2A68D 1IBML 2JA5B 2XRQD 3I3CA 4LWCA 4R4TA 1QZHA 4HCSA 1A3UA 3NQTA 4BBRB 2RF4A 2HHHQ 1EIHA 4Z9CB 5IGFA 4IPHA 3KYHC 4K5WA 1I6VC 2K33A 4OO1G 2ASBA 5LMNW 2AQ3B 2AUKA 3QIAA 3VDYA 1ESRA 2KA7A 4A3DB 1VQBA 4QUCA 4JI4Q 1A8VA 5IWAL 2HT1A 3WDNA 2Z4IA 1JCKB 4KJOA 1S5DD 2AQ1B 3ZYYX 1EUJA 3ERSX 1ILPA 2CW0D 1DYQA 2WB1E 3KF6B 3UE1A 2RQXA 2UXBL 4QIWB 2NVTH 1HCZA 3VYUA 3NPPA 1YNJD 1EQRA 4DR1L 1F2MA 2JA6H 1G6PA 3HOVG 4ZCKA 4A3LG 2NVQH 1ET9A 3GTLB 4DR5Q 4K2KA 3D6CA 5IGCA 3E3XA 2JE6I 3NE5B 4A3KG 4K8IA 1A0IA 1A62A 1VF7A 4GZYC 1E2VA 1XMOL 1H9JA 2QF7A 4DXFA 2QEJC 3BVMA 2OXPA 1JOOA 2WV6D 1KABA 1VQJA 2IX1A 3K58A 1H9RA 4K14A 4IFDJ 1EZ8A 1JORA 3H6MA 1UE1A 4OELB 2UU9L 2RA4A 4C3HG 5C4XG 1MGSA 3GQBA 1LO5D 1D1IA 3MEHA 1TWFB 3GTMH 1T9HA 4WJ4A 1GJXA 3S1NH 1U0LA 3TSSA 1E24A 1LV9A 1Q90A 1SSOA 5L37A 3PIOA 3IL8A 3DWQA 1KDAA 2LFNA 1SJED 4B3ML 4GN4B 4A3BH 4X65Q 4JYAL 3D4WA 4GN5A 3J7A5 2B63G 2VQEQ 2B2WC 2VQFQ 1CM9A 3M4OB 1CZGA 4CJ1B 4BA2I 4HCEA 4N9PA 5LMNQ 2I07B 5G3LD 1XXGA 1X55A 1PH8A 4QQBX 1U9RA 4DNIA 1K83B 4DUYQ 4DV2Q 2JA8B 4LFBL 5CV8A 3AMUA 5ELOA 1AFPA 5JJZA 3E6ZX 3I8ZA 1FNWA 4CKBA 5C4JH 3F2DA 2L4NA 4DR2Q 1G91A 3M3YB 1LTGD 1HA5A 3HEJA 4KJNA 2KCMA 2Q2UA 4P72A 2NZOA 3VR5A 1KD1C 3J7AF 2EJGC 1MD2D 2PCFB 1IBMQ 5IYCG 3ITPA 4C56C 1VQHA 2IY5B 4GNXC 1I6HH 3S17B 4A93H 3C1EA 3UDXA 2R7ZG 1SMYD 3IFTA 1D2BA 1CK1A 3NBHA 1G6ZA 3K7AB 4BA1I 1JT8A 2CQAA 4DV7L 4LF8L 1B1ZA 1PZKD 1PLFA 3J7AV 2XGTA 2RCNA 2AMCB 3DXJC 5FJ8G 1CKMA 2JXMB 3KBGA 1C9OA 2CQOA 4K2LA 1Y1WH 5IWAQ 3LWUA 2WKDA 3CCMA 1SYDA 4BWGB 4R8NA 1I94L 3GTOH 5EBDA 4EQNA 3FPUB 1EWIA 4BXXH 5IGBA 3K57A 4IUNA 1BCPC 4AIMA 4X3UA 2UXBQ 1X3EA 3PIP3 4IALA 4L5TA 4BY7H 2OTJA 5M3FB 2KCCA 1WVLA 2GVBA 4DR1Q 3SHLA 3R2TA 4DXGA 4JI0L 1SEBD 3D4RA 5LHY1 3NWSA 3NBHB 2K5QA 1W6KA 4ZYSA 4DV0L 5ELDA 3M85A 3E5SA 3UDGA 1X9NA 2OQKA 3OHXC 4KKUA 3OW2A 1A2UA 5C44H 4MIUA 1XNRQ 2P5ZX 1SJHD 2F0LA 3CP0A 3PUVA 3CF5A 1BXTA 4CDCC 5DM73 1XMOQ 2NVTB 5G3LF 2KEDA 1S3OA 4K8JA 4MTNA 2K5HA 3C46A 1K8GA 4LAAA 5D3IB 2Y0SB 1HZCA 2JA6B 1VQ7A 2UU9Q 4FYDA 3H3VH 2NVQB 2RSOA 3OWFA 4Y52H 2AWOA 2ES2A 1LT6D 2FFKB 4KI0A 3JAML 3T53B 2H4OA 1PH9A 3GDEA 1FGBD 4B3MQ 5M3MB 4HJ5A 3FEWX 2ICIA 4BBRG 2XIWA 1JJGA 5EPLA 1WD0A 4RGTA 1TWAH 2IW3A 4WRDA 1JB7A 3U58A 1X3PA 2OEOA 2EY1A 2B2UA 4NDXA 2PO4A 3S1NB 2CCZA 1B2TA 3QR8A 2EPBA 2J7ZA 3GTPB 2ZJRA 4LFBQ 4ME5A 4KHZA 3HOYG 4MN3A 4P71A 3S15H 4A3DG 1L1OA 1XX8A 4JI3L 3GP7A 1EFWA 4PV1C 2A69D 4U68A 1OXXK 2E2HB 4OWXB 4ZAIA 2EDGA 4ULLA 4JOIA 2EY5A 4N9TA 3BS1A 4JI7Q 4DR6L 4XQNA 4DFAA 4RFBA 2DNEA 3A5UA 3PO2B 3LWEA 1K0SA 5CORA 3IAYA 3G6JB 3TP8A 5I2YA 5EPJA 2EXDA 4X66L 1CHQD 4DR7L 1DJRD 3EVQA 3VR6A 1LTLA 3A5ZB 3F2BA 4DV7Q 4DV4L 4LF8Q 1E2WA 1IKMA 2D0OA 3SK6A 5EBCA 5K5PA 1Q12A 1JR0D 2MUYA 3RR5A 2SNSA 4G57A 4EX5A 2I0QA 1FR3A 1L1OB 1ONLA 4QL5A 1A6XA 1RTNA 3G6EA 2BDOA 3FVQA 2GVAA 3WOEA 4ZKBB 1STHA 2DJGC 2NTSA 5EKLA 1I94Q 4XXEA 2DJFC 3PGZA 4QF4A 3HS0C 4A93B 5GQOA 2PMZE 4B9WA 4HTHA 1U4RA 4GKJL 1LLRD 1Z6HA 1PFNA 1NSNS 4LMQD 5KRUA 1FVIA 1GUTA 3BDOA 2E5LL 4RAUC 3GTJH 3K80C 1VQOA 4JI0Q 3GTKB 4K0KL 1VQCA 1YHAA 4DV0Q 4IUVA 4B3RL 5EGTA 3FHWA 1PYBA 2PPBC 4LF9L 3BVGA 5JEAG 4DA2A 4NW2A 2EYHA 4LUVA 3GTOB 2K6AA 4PG3A 3MAQA 4A76A 2L55A 3NWTA 5IYDG 3J81j 4PZ8A 1EQTA 2B39A 2JSOA 1F77A 1BNZA 2IL8A 1HTPA 4IPGA 1ZYRC 1LT4D 5I6WA 2XVSA 3EN2A 4BY7B 4X62L 2B3GA 1VQKA 5FO9B 5ELBA 1STAA 3K5LA 4X3KA 3JAMc 5JJKA 3CC2A 1TWHB 5C44B 3RZOH 1NMGA 4RHRA 4IPCA 2UUCL 3FP9A 4ZKCB 3TZUA 2F3VA 2ZT9C 5E3FA 2JA7H 3OOCA 1U4MA 5IYBG 1O7ZA 4JI5L 1B9MA 3NEMA 3FMCA 2K03A 1GUGA 2B2YC 3NTKA 1SNMA 3FKIH 4JC0A 2RVLA 2WP8J 1KDCA 3RN2A 2K52A 4QY7A 4G7OC 3BJUA 1KC8C 2JA5H 1HQRD 3GTQH 2RDGA 1TR5A 2K1BA 1X56A 4EVOA 3UDFA 3CD6A 4I7ZC 4DGZA 4JI3Q 3G48A 3DHQA 5I9OA 3JAMi 2UUBL 3V96A 2Q2TA 3E9HA 3I4NH 2F0SA 1JWUD 1A3TA 2K14A 1M4VA 2F0TA 1QZGA 3VR2A 2I5HA 1AW7A 2FMMA 2L11A 4DR6Q 1XTCD 4ZRZA 5GAHC 3H09A 3M7NA 2X6GA 4UP9A 2A5HA 1VQNA 4YY3L 1TXYA 3KLSX 4ALPA 1DGSA 5I9PA 3S15B 2NZ1D 4X66Q 4FXDA 2JJQA 3J7YW 4DR7Q 1E7ZA 4BS9A 3X3MA 4F7XA 3I70A 1S5FD 4I65A 1HR0W 4DV4Q 3RN5A 1UE6A 2VB2X 5EAYA 3FRPB 4BY1H 1OXTA 1ASZA 3GTLH 1ILQA 1I5FA 1IW7C 1PHJA 1SFOB 5TSSA 4A3JH 1R9TB 1J9OA 1SYCA 1CA5A 1QJOA 3HOUB 3Q24A 4H02A 2JA6G 1EYGA 2K5DA 3D31A 2DGYA 1YEZA 2OT2A 3NK9A 3SVMA 4GKJQ 2B2VC 3MA2B 2DNCA 1EFID 4DNTB 1FD7D 4IQZA 1QILA 2F1MA 2NTTA 4GLXA 5JPMC 4QJFA 2VXWA 2E5LQ 3HFZB 3PIPA 4DF7A 2UXCL 3R93A 4K0KQ 2F3WA 4B3RQ 1AH9A 4KTAA 4LF9Q 2X69A 1RKNA 1PH7A 3H0GB 1X3FA 4KKTA 4LF7L 2XTIA 4ABNA 4JI6L 3PSIA 1LT3D 4RKBA 4WORA 4RGOS 2LS01 1WTXA 1OXVA 3OMCA 1QVCA 1BQQT 2C35B 2GN5A 4EQPA 3PF5A 4NXML 3DMUA 3AEVA 2F4IA 2YTVA 2ZM6Q 3AU7A 4X62Q 1SMYC 1BBXC 3ZJYC 1SMXA 5FK9C 1UEBA 5LMUL 2VW9A 4JPBW 4FVMA 4J6HA 4UDUC 3M4OH 5DLQE 3CQZH 4YCUA 2KHSA 3JC66 4L5SA 2NWGA 4A3BG 2A6ED 2KBNA 1K83H 4QIWE 2JA8H 4O2DA 4RHSA 2UUCQ 2F0FA 1LTTD 1CKNA 4LNQA 1IL8A 2R93G 1SRUA 4JI5Q 1LTAD 3M3YH 1K8AC 4HJ7A 1P8LA 1HRJA 4APVA 4GKKL 1SYBA 3CCSA 1N8RC 1RCVD 3W5OA 4JI2L 3Q8DA 1QNKA 1V9PA 1JC7A 1W3SA 2V4DA 2SDFA 3U50C 3BZCA 4XTCS 4YWLA 3TREA 3S17H 5CGKA 2WINB 3TP5A 5CV6A 4OWWB 4GOPC 2UUBQ 4N8FA 1EIFA 3K7AH 2IX3A 1JE5A 1HUMA 1JJCB 4A93G 5BR8L 1K3BC 1KHIA 2N3SA 4J15A 3BZKA 2F0WA 3K8AA 3GV6A 4NPSA 4CGYB 2C9OA 1VMPA 3GTQB 4DAYA 3RD4A 4YWMA 1DOMA 4YY3Q 1VCIA 2WKCA 3CW2C 2BH2A 4X6AH 5BN3A 3NP8A 1ICWA 1Y1WG 2F0EA 2HQLA 3CCJA 3VYSA 3I4NB 1EEFD 1IHZA 4IOAA 5HURA 1PA6A 3RMHA 2MJ8A 1QCBD 1A3VA 5M3FH 5IT9c 3CMAA 4DV6L 1XMQL 2Z9HA 4CKEA 4BXXG 1TS4A 1WFQA 3S1QB 1UE7A 4ZUIA 4OL7A 2RHSB 5M5XH 1B8AA 2MP1A 3JAME 1X6OA 1I4XA 3VYTA 2K75A 3N6RA 4NB3A 4BY7G 2EXZA 4ID6A 4CJ2C 3S2HB 4M8AA 2F0QA 2Q2IA 2KUMA 3Q23A 5BN5A 5C44G 1HFGA 1RDPD 2HIVA 2NVYH 4DAYB 5CMDA 3K59A 1J5EL 1D1KA 3H94A 3E0JA 4A3EB 5IP9H 2XRSD 1HNZL 4BY1B 4DAPA 2ALYB 1G51A 3K0YA 2A69C 1KLGD 2UXCQ 4YIJA 4A3JB 1PH4A 4XYQA 4RA8A 4LF7Q 4FP5D 2TSSA 4JI6Q 1XNRL 3UE0A 1NE3A 2FHTA 1F2LA 1KAAA 1KRSA 1RHPA 4NMZA 3DWPA 1RL2A 2EZVA 4F87A 4NXMQ 4HIMA 2PQAA 5M3MH 2ZJPA 1DD2A 1N9WA 1OTCA 4XQJA 2MPMA 1TVXA 1IZ6A 5IP7H 5LMUQ 1EL0A 1L0YB 3GTPH 4HJ8A 5IGEA 3QWNA 2MO1A 3W1BA 3VR3A 4G7HC 5C0XI 4OONA 4HMIA 1L0XB 1YJWA 1QE6A 3L7ZC 3VR4A 4KKSA 1WTQA 2E2HH 2K05A 1UUPA 4JW0A 4CBVA 2EOTA 4GKKQ 1SXTA 4JI2Q 1NBWA 4MNOA 1SE2A 3CQZB 3PO2H 2CVRA 2EYPA 2F0HA 3W3AA 3HOZH 1M8AA 1PTOB 1GXDC 1AZQA 3U9SA 2PQAB 3T51B 5EKIA 5T1GA 3HOXH 4CDFC 5IGDA 2F0IA 2M00A 1STBA 3LX0A 5E1FA 5J22A 2E74C 2Z8LA 3A8IE 4K6LA 4DK1A 3EQLC 4TKOB 1SYFA 5KYIA 5ELCA 4JI7L 5BR8Q 2F0OA 3L2PA 2RDHA 2F0UA 4TVAB 5JEAJ 5CYUA 4EGVA 5JAVA 1S5ED 2KHIA 2R6GA 1NCVA 5I4DA 5HY6A 3B6YA 1LT5D 1WCMB 3TBIB 4A3CH 1XNQL 2F0PA 1QNUA 1LTRD 1C4QA 3TP6A 1SNPA 1N32L 3MVVA 3DEPA 1Q3LA 1Q81C 1EY0A 1UAPA 4UP8A 2KCTA 2YV5A 1E1OA 5GADC 3I4LA 4Y7NH 5J3BA 4A3IB 1MI2A 1VQLA 3SK8A 1W2BA 4DV6Q 4JK1C 1XMQQ 1LTSD 1VQ5A 3GTKH 1V43A 2F52A 3KJPA 3V2TA 1TY0A 4L5QA 1GHKA 2A1AA 2KQ3A 4RG1A 2D2CC 3M4PA 2K50A 3RUZA 1FJGL 1VQ9A 4HEDA 4ODGA 3Q6SA 3J81c 1JB3A 1BOSA 1QUQA 1PV4A 1GO3E 1GOZA 5C6AA 2JEAI 5DAUA 1KIXA 5LL6S 1G2SA 2K5VA 4XDXA 1J5EQ 1T5EA 4LJZC 4R4CA 4OIKA 2B2UC 3RLFA 1HNZQ 1D5MC 4IUQA 3URYA 1TS2A 5M5XB 1TWHH 1L1OC 1CI3M 1Z47A 1JICA 2YU9H 4I7AA 4BBSH 2WAQG 4IUPA 2L1BA 3MXNA 4JOIC 1ENFA 3QB3A 1T5XD 2H5XA 1P16A 3IFDA 2PW7A 1ML0D 3I91A 2NVYB 2XSCA 4DV1L 1QG7A 1C8CA 1XPOA 1PTOD 2JA7G 4LFAL 4C3IH 1IL2A 4IFDI 4XYOA 1QUQB 1X3QA 2L9HA 4A3GB 3BDLA 1TS3A 4DUZQ 3PV0A 3E9IA 1J6QA 3FKIG 2OQ0A 1VQDA 4DR4L 3WOFA 1CKOA 3K7UC 2JA5G 1J8IA 1JWMD 1SLJA 3PUXA 4NKLA 4HJ9A 1F9QA 4QCLA 4P75A 3MXNB 1A63A 4P73A 1R4QB 3KUPA 3I4NG 4FXKC 1XYIA 2FMCA 5ELNA 1VQIA 1ICFB 3S2DH 3SGIA 5FOBB 2B2TA 5CC4A 1NY4A 4A3MH 2PYKA 5FO8B 5JVG3 4JV5L 1XPRA 4LW1A 3RLNA 4B3TL 2FINB 3EIVA 2IHEA 4LK1C 3STBC 1F9RA 1Z9FA 3D3RA 3D8GA 1B50A 1H9MA 2JYOA 5A2QL 1AP0A 1SFOH 3HOZB 1QWYA 1R9TH 4RMFA 3H3VC 1TIID 3OIQA 4H44C 3KBXA 3HOUH 4RCOA 3HOXB 3L0OA 4JG2A 1D5XC 4FF3A 3PF4A 1XNQQ 4NP5A 2E2JH 1S72A 4BY1G 3CCRA 1N32Q 2EIFA 4XT1B 1UWVA 4HSVA 3V05A 1B70B 1JOKA 4A3JG 4ILWA 1D7QA 2A6EC 2QDBA 1BF4A 4TSSA 2R92H 1Y8NB 2E2IH 2EVBA 1VQ6A 4JI1L 2HD3A 1Y8OB 1QOHA 3H0GH 3A7AB 3NTHA 4PMBA 3D4DA 3S14B 1CZWA 1FJGQ 3ER0A 1S40A 1PTOF 3TQYA 1RODA 5C0XH 1KQSA 5IY0A 4PNYA 4Y7NB 2IX0A 4H7BA 1PXUA 4IZ8A 3A55A 4C3JH 5M9OA 1QVGA 1NR2A 3W2DA 3HG9A 1KLUD 3NBIA 5FJ8H 1Q1EA 2BDNA 2KEEA 2BE5C 3CPWA 2Q2HA 3DUZA 2B8FA 4JBJA 5M5WH 3I7FA 4ZK9B 2A68C 4HR7B 4DK0A 1Q7YC
chains in the Genus database with same CATH topology
1PMRA 1O7YA 5M5YB 2F0GA 2AUJD 1CHPD 5AFWA 1D5ZC 3K5NA 3BZDB 1HHVA 4DU9A 2K28A 1H9KA 1NUCA 3EJIA 2YU9B 4BBSB 1ZKOA 3IKJA 3SK5A 5DNFA 1PDQA 5IOCA 1TS5A 3EA6A 1STYA 1S5CD 4KN4C 1H9SA 1QB5D 1PRTB 3P75A 2LKVA 1HFNA 2CW0C 4C3IB 4Q5VA 3K6OA 4X3SA 2FJ2A 1E2ZA 5A35A 3MWYW 3HOVB 1YNJC 5COYA 3VA5A 4RGMA 5CBEE 4A3KB 2JP1A 3K5OA 5I2XA 5C3XA 2CHBD 3HKZB 3EFXD 1HA6A 2XNAC 5F2DA 4PMWA 2J4XA 4EQOA 1O7LA 1H9SB 3ND8A 3S2DB 3I90A 4F8MA 1F2YA 4HAEA 4A3MB 1EEID 1SNCA 2O4XA 2L0CA 2O5JC 1UNSA 4J8QA 5J39A 5LL6X 3KK7A 3FDTA 1TKWB 3T4AC 2BA1A 5D3DA 4IUTA 3NSWA 1ENCA 1WTWA 3OSOA 1I4QA 1YNND 3SXHA 2F0JA 2NUCA 4K5XA 1DONA 4IFDH 2VB3X 5IT9L 4TQUS 1SNQA 1AEXA 1GUSA 2E2JB 2NN6I 3ND9A 2EY6A 2N88A 1V8QA 5EPKA 2A73B 2K01A 4RCNA 1CFMA 2B2YA 2EYMA 2R92B 2A6HD 2L5TA 1G291 2E2IB 3A8JE 3C3LA 4HN7A 3SEBA 3TDQA 2GA4B 3MXGA 1EWHA 1K8OA 1EY9A 1F2ZA 3NHHA 3BVZA 2D5DA 2N55A 2PNRC 1DZ1A 3QOLA 1PRTD 1TT2A 2R7ZB 4KHVA 5C4HA 3ONAB 1EZ6A 1U4PA 1SYEA 4C3JB 2I46A 1OXSC 1E0BA 3P20A 5JVH3 1PTOH 4FO2A 4KD3A 1HPCA 1ESFA 5M5WB 3T16A 1SYGA 3QG1A 2X6LA 2JEBI 4G7ZC 2RBMA 4OO1I 3U9OA 5JOBA 5C0XJ 1R4PB 2E2DC 3I4MB 3BDCA 5ELFA 2BCOA 2HCCA 4P2CB 1STEA 1EU4A 4E6IA 5D65A 3MXUA 5D14A 4V0BA 1CQVA 1I4HA 1HUNA 2O2LD 5KNCA 3HP3A 2NVXB 1B4OA 2RSNA 3KLSA 4AYBB 2HQEA 5C3EB 1PTOC 4DNRB 2G9HD 4H0LC 3SR1A 2QILA 1SE4A 3DM1A 1SNDA 4KN7C 4CHTB 2AQ2B 5JPNC 1JWSD 2TMPA 1EY8A 3S16B 1RJTA 1ZYRD 1PRTF 1W6JA 5EKKA 2J0TD 2Q8RE 4H13C 3GD7A 4KMUC 3K5MA 1B3AA 1SAPA 4F88A 1SE3A 4B9XA 1BDOA 3J80L 3P1HA 3HOYB 3GTGB 1RD9D 3OW7A 3J81L 2H1EA 2C5CA 3I73A 3L9AX 1PFBA 2IPKD 2ID0A 4FF4A 1STGA 3MTSA 1MSGA 4C3IG 1WTOA 1I4RA 1WTPA 3T13A 2YYZA 5A2QE 1JOQA 1CTMA 3H91A 2XWJB 5E4WC 1O80A 1EYAA 1II3A 3R8BA 5EQ0A 4CKCA 1RF2D 4KY5A 4FF2A 3P7JA 2VNUD 1ET6A 4J1MA 2KVMA 1LTID 1FYCA 1EYCA 1GUNA 1I4GA 2EYFA 2QKIC 3R3OA 2SNMA 5KEEA 5CR3A 2PZTA 2A74C 4L63B 1Y69U 1IW7D 3RZDB 2AWNA 1EY5A 2NN6H 3BG3A 4RKLA 3L3OC 5FO7B 2IT1A 1V1PA 4MHEA 3HOWB 1D6EC 1VMCA 2ZXRA 3MHBA 5T1IA 1ZEQX 5CV7A 3O13A 4QMGA 4O1NA 5K36H 2LMCB 3DEOA 1STNA 1S4ZA 4M1UB 1EY6A 3PO3B 3TN2A 4V190 2DN8A 4U673 2VUMB 3C1FA 1NR4A 2WB1B 2ZXOA 1EU3A 1VDZA 1BUVT 5BN4A 2Q8IB 1WD1A 4PMCA 4FNFA 1B53A 5C0XG 3CKIB 1IYVA 1JE4A 5DM63 1V1PB 5DEHA 1GUWA 2F0KA 3F2UA 4C3JG 2BA0A 1MSHA 3MFGA 4OIJA 2R61A 4OO1H 2B2WA 5KYLA 3TMEA 1A15A 4WFN3 2B2TC 4G4KA 2DY7A 2KOLA 2RDFA 3MFYA 4S3SA 2D62A 3BYYB 3KF8A 1HTLD 5I6YA 3A56A 4O42A 1K8MA 2Z4HA 2M2LA 1X32A 1I3QB 5FLXL 4KY6A 4HSPA 4KV6A 3ERQA 1YNNC 3SDZA 4ZUJA 3C2PA 1DOKA 4R8IA 2MGSA 1Z7TA 1SNOA 3NQIA 4R9WA 1C48A 1B9NA 3MXPA 1KNAA 3CRKC 5IT9E 1DM0B 3T56B 4A3FB 1U4LA 2A6HC 2K7VA 1EY4A 1GUOA 5FKAC 3Q22A 2EYOA 1EQVA 4IN3A 2BOSA 1KNEA 2R3ZA 1TWCB 3GTMB 1PRTC 1OXUA 5EJWA 5ELEA 5C5MA 4IUUA 1BO0A 1NAPA 5KGUA 1OO9B 2PZUA 3SE0A 5CBAE 4C1NK 4A3BB 1KDBA 1TWGB 1EYDA 2F0MA 2EYJA 3GO5A 1HXYD 2WIIB 5KNDA 4IFDG 3PUZA 5CV5A 2XWBB 4IURA 2R93B 3HZXA 3G7LA 4QUFA 1FNUA 1BCPB 1CA6A 1Y1VB 3SK4A 3MZ5A 5C4JB 1PZJD 2PW5A 3TP7A 5IODA 1CT1D 4OHJA 2EYLA 3A54A 2HCIA 3Q0AA 2Q8TA 1F9SA 2K5WA 5IGGA 1HQMC 2EY2A 2HDLA 1I6HB 2O5IC 2F0VA 4K6DA 1XWEA 4RWSC 3CRLC 3GV3A 2PQEA 4XQQA 3CHBD 3AB9A 1O78A 3NXWA 2IWHA 1Y1WB 2HDMA 3X3NA 3DWAA 2K32A 1S5BD 2Z1CA 2IJ0A 5C5LA 4DN4M 3TZDA 3I72A 3NTIA 2K04A 2WACA 3A7LA 2F0NA 1EIGA 3OIPA 2M9VA 3S9WA 4TRDA 1G8ZD 3M7GA 3M4YA 1Q8IA 5KIXA 5E4XA 1WTRA 3PIO3 1EWCA 3NUCA 2ICEC 2L12A 3MC0B 3PMFA 4HMJA 3OPOA 4XT3B 4UAIA 3D6WA 3J80E 1JQYD 5ISRA 1IKLA 1VF5C 1AN8A 1MBYA 4JBWA 3J81E 5HGTA 1PYWD 3OWEB 1BCPD 1EY7A 1SBBB 3OMGA 1AZPA 1B44D 4L8JA 5IIFA 4FXGC 2MHVA 5CV9A 4C3HB 4DAVA 5C4XB 1IYUA 1EOTA 4RGNA 4KY7A 1LTBD 4QB4A 2PMZB 1LABA 3QJYA 1TWAB 1PZID 4ZQ3A 1SDFA 3A8KE 1DOLA 2RKSA 2PZWA 4ZLTF 1DCZA 5KNBA 4KK7A 2B63B 1CQFA 2DY8A 1G2TA 1Y8PB 3EROA 2ZXPA 4KD4A 1TU2B 3LNNA 1KTKA 4FF1A 2EJMA 2G9DA 1TQOA 3R2IA 2KECA 1RTOA 3PUYA 3PUWA 2OF1A 1ZXTA 1GHJA 1DXMA 4L6TB 4WJWA 2E76C 2E75C 3S1MB 5CV4A 4PQXA 1F9PA 1UEAB 3HGBA 2KCNA 3KLRA 2NYZD 3VA7A 2SEBD 1I4PA 1BCPF 5NUCA 3BYTB 4XIGS 1TY2A 5JEAH 4RH6A 2D9UA 2B8GA 4C2MB 3GTJB 3HRZC 2NB0A 3UI2A 3VYRA 2NN6G 3QOJA 2EE1A 2LY7A 2QCPX 4OGQC 5C3WA 1ENAA 2F03A 1Q1BA 1A2TA 2B2VA 2SOBA 2WAQB 5J1ZA 4C1NI 2NBFA 3N52A 5K36G 1LACA 3FPPA 2ENBA 2F0DA 1WTVA 3RZOB 1FNVA 4Q0FA 5C4ZA 3CU7A 4K5VA 2JA7B 3S1RB 2XN9C 1I50B 1V1OA 2BE5D 2EJFC 3FKIB 1PFMA 2KJXA 4B08A 4CJ0B 3QO2A 1BR9A 5FLXE 2HUGA 4X3TA 2A68D 2JA5B 2XRQD 3I3CA 4HCSA 1A3UA 3NQTA 4BBRB 1EIHA 4Z9CB 5IGFA 4K5WA 1I6VC 2K33A 4OO1G 2AQ3B 2AUKA 3QIAA 1ESRA 2KA7A 4A3DB 4QUCA 3WDNA 2Z4IA 1JCKB 4KJOA 1S5DD 2AQ1B 3ZYYX 1ILPA 2CW0D 1DYQA 2RQXA 4QIWB 1HCZA 3VYUA 3NPPA 1YNJD 1F2MA 3GTLB 1ET9A 4K2KA 3D6CA 5IGCA 2JE6I 3NE5B 4K8IA 1VF7A 4GZYC 1E2VA 1H9JA 2QF7A 4DXFA 2QEJC 3BVMA 2OXPA 1JOOA 2WV6D 1KABA 2IX1A 3K58A 1H9RA 4K14A 4IFDJ 1EZ8A 1JORA 3H6MA 2RA4A 4C3HG 1MGSA 3GQBA 1LO5D 1D1IA 3MEHA 1TWFB 1GJXA 3TSSA 1LV9A 1SSOA 1Q90A 3IL8A 3DWQA 1KDAA 2LFNA 1SJED 3D4WA 2B2WC 1CM9A 3M4OB 1CZGA 4CJ1B 4BA2I 4HCEA 4N9PA 2I07B 5G3LD 1XXGA 1U9RA 2JA8B 1K83B 5CV8A 3AMUA 1AFPA 5JJZA 3E6ZX 3I8ZA 1FNWA 4CKBA 2L4NA 1G91A 3M3YB 1LTGD 1HA5A 3HEJA 4KJNA 3VR5A 3J7AF 2EJGC 1MD2D 2PCFB 3ITPA 4C56C 3S17B 3C1EA 1SMYD 3IFTA 1D2BA 1CK1A 3NBHA 1G6ZA 3K7AB 4BA1I 2CQAA 1B1ZA 1PZKD 1PLFA 3J7AV 3DXJC 2JXMB 3KBGA 4K2LA 3LWUA 2WKDA 1SYDA 4BWGB 4R8NA 5EBDA 4EQNA 3FPUB 5IGBA 3K57A 4IUNA 1BCPC 4X3UA 3PIP3 4IALA 5M3FB 2KCCA 1WVLA 3SHLA 3R2TA 4DXGA 1SEBD 3D4RA 5LHY1 3NWSA 2K5QA 1W6KA 4ZYSA 5ELDA 3M85A 3E5SA 3OHXC 4KKUA 1A2UA 4MIUA 1SJHD 2F0LA 3PUVA 1BXTA 5DM73 2NVTB 5G3LF 2KEDA 4K8JA 3C46A 4LAAA 5D3IB 2Y0SB 2JA6B 4FYDA 2NVQB 2RSOA 3OWFA 2AWOA 1LT6D 2FFKB 4KI0A 3JAML 3T53B 2H4OA 1FGBD 5M3MB 3FEWX 2ICIA 2XIWA 5EPLA 1WD0A 4RGTA 2IW3A 4WRDA 1X3PA 2OEOA 2EY1A 2B2UA 4NDXA 2PO4A 3S1NB 1B2TA 2EPBA 2J7ZA 3GTPB 4ME5A 4KHZA 4MN3A 1XX8A 3GP7A 4PV1C 2A69D 4U68A 1OXXK 2E2HB 4ZAIA 2EDGA 4ULLA 2EY5A 4N9TA 3BS1A 4XQNA 4DFAA 4RFBA 2DNEA 3PO2B 3LWEA 5CORA 3IAYA 3G6JB 3TP8A 5I2YA 5EPJA 1CHQD 1DJRD 3EVQA 3VR6A 1IKMA 1E2WA 3SK6A 5EBCA 5K5PA 1Q12A 1JR0D 2MUYA 2SNSA 4G57A 1FR3A 1ONLA 1A6XA 1RTNA 2BDOA 3FVQA 3WOEA 4ZKBB 1STHA 2NTSA 5EKLA 4XXEA 4QF4A 3HS0C 4A93B 4B9WA 4HTHA 1U4RA 1LLRD 1Z6HA 1PFNA 1NSNS 4LMQD 5KRUA 1GUTA 3BDOA 4RAUC 3GTKB 4IUVA 5EGTA 2PPBC 3BVGA 5JEAG 4DA2A 4NW2A 2EYHA 3GTOB 2K6AA 3MAQA 2L55A 3NWTA 1EQTA 2B39A 2JSOA 1F77A 1BNZA 2IL8A 1HTPA 1ZYRC 1LT4D 5I6WA 2XVSA 4BY7B 5FO9B 5ELBA 1STAA 3K5LA 4X3KA 1TWHB 5C44B 4RHRA 4ZKCB 3TZUA 2F3VA 2ZT9C 5E3FA 3OOCA 1U4MA 1O7ZA 1B9MA 3FMCA 2K03A 1GUGA 2B2YC 3NTKA 1SNMA 2RVLA 2WP8J 1KDCA 4G7OC 1HQRD 2RDGA 1TR5A 2K1BA 4EVOA 4I7ZC 4DGZA 3DHQA 5I9OA 3V96A 2F0SA 1JWUD 1A3TA 1M4VA 2F0TA 3VR2A 1AW7A 2FMMA 2L11A 1XTCD 4ZRZA 3M7NA 3H09A 2X6GA 2A5HA 3KLSX 5I9PA 3S15B 2NZ1D 4FXDA 3J7YW 4BS9A 3X3MA 4F7XA 3I70A 1S5FD 4I65A 2VB2X 3FRPB 1OXTA 1ILQA 1IW7C 1SFOB 5TSSA 1R9TB 1J9OA 1SYCA 1CA5A 1QJOA 3HOUB 3Q24A 2K5DA 3D31A 2OT2A 3NK9A 3SVMA 2B2VC 3MA2B 2DNCA 1EFID 4DNTB 1FD7D 4IQZA 1QILA 2F1MA 2NTTA 5JPMC 2VXWA 4DF7A 3R93A 2F3WA 4KTAA 2X69A 1RKNA 3H0GB 4KKTA 4ABNA 1LT3D 4RKBA 4WORA 4RGOS 2LS01 1WTXA 1OXVA 3OMCA 1BQQT 4EQPA 3DMUA 2F4IA 3AU7A 1SMYC 1BBXC 5FK9C 4FVMA 4J6HA 4UDUC 2KHSA 2NWGA 2A6ED 4RHSA 2F0FA 1LTTD 1IL8A 1LTAD 1HRJA 1SYBA 1RCVD 1QNKA 1JC7A 2V4DA 2SDFA 4XTCS 5CGKA 2WINB 3TP5A 5CV6A 2IX3A 1HUMA 2F0WA 3GV6A 4CGYB 2C9OA 1VMPA 3GTQB 4DAYA 3RD4A 1DOMA 1VCIA 2WKCA 5BN3A 3NP8A 1ICWA 2F0EA 3VYSA 3I4NB 1EEFD 1IHZA 5HURA 3RMHA 2MJ8A 1QCBD 1A3VA 4CKEA 1TS4A 3S1QB 4ZUIA 4OL7A 2MP1A 3JAME 1I4XA 3VYTA 3N6RA 2EXZA 4ID6A 4CJ2C 3S2HB 4M8AA 2F0QA 2KUMA 3Q23A 5BN5A 1HFGA 1RDPD 5CMDA 3K59A 1D1KA 3H94A 3E0JA 4A3EB 2XRSD 4BY1B 4DAPA 3K0YA 2A69C 1KLGD 4YIJA 4A3JB 4XYQA 4RA8A 4FP5D 2TSSA 2FHTA 1F2LA 1KAAA 1RHPA 4NMZA 3DWPA 2EZVA 4F87A 1DD2A 4XQJA 2MPMA 1TVXA 1EL0A 1L0YB 5IGEA 3QWNA 3VR3A 4G7HC 5C0XI 4HMIA 1L0XB 1QE6A 3L7ZC 3VR4A 4KKSA 1WTQA 2K05A 1UUPA 4CBVA 2EOTA 1SXTA 1SE2A 3CQZB 2CVRA 2EYPA 2F0HA 3W3AA 1M8AA 1PTOB 1GXDC 1AZQA 3U9SA 3T51B 5EKIA 5T1GA 5IGDA 2F0IA 2M00A 1STBA 3LX0A 5E1FA 5J22A 2E74C 2Z8LA 3A8IE 4K6LA 4DK1A 3EQLC 4TKOB 1SYFA 5KYIA 5ELCA 2F0OA 2RDHA 2F0UA 5JEAJ 5CYUA 4EGVA 5JAVA 1S5ED 2R6GA 1NCVA 5I4DA 1LT5D 1WCMB 3TBIB 2F0PA 1QNUA 1LTRD 1C4QA 3TP6A 1SNPA 3MVVA 3DEPA 1Q3LA 1EY0A 1UAPA 3I4LA 4A3IB 1MI2A 3SK8A 4JK1C 1LTSD 1V43A 3V2TA 1TY0A 1GHKA 2KQ3A 2D2CC 3RUZA 4HEDA 4ODGA 3Q6SA 1JB3A 1BOSA 1GOZA 5C6AA 2JEAI 5DAUA 5LL6S 1G2SA 4XDXA 1T5EA 4LJZC 4OIKA 2B2UC 3RLFA 1D5MC 4IUQA 3URYA 1TS2A 5M5XB 1CI3M 1Z47A 1JICA 4IUPA 2L1BA 3MXNA 1ENFA 3QB3A 1T5XD 3IFDA 2PW7A 1ML0D 3I91A 2NVYB 2XSCA 1QG7A 1C8CA 1PTOD 4IFDI 4XYOA 2L9HA 1X3QA 4A3GB 3BDLA 1TS3A 3PV0A 3WOFA 1J8IA 1JWMD 3PUXA 4NKLA 1F9QA 4QCLA 1R4QB 3KUPA 4FXKC 1XYIA 2FMCA 5FOBB 2B2TA 5CC4A 2PYKA 5FO8B 5JVG3 2FINB 4LK1C 1F9RA 3D3RA 3D8GA 1B50A 1H9MA 2JYOA 5A2QL 1AP0A 3HOZB 1QWYA 3H3VC 1TIID 3OIQA 4H44C 3KBXA 4RCOA 3HOXB 1D5XC 4FF3A 4NP5A 4XT1B 4HSVA 3V05A 1JOKA 4ILWA 2A6EC 2QDBA 1BF4A 4TSSA 1Y8NB 2EVBA 1Y8OB 1QOHA 3A7AB 3NTHA 4PMBA 3D4DA 3S14B 1CZWA 1PTOF 1RODA 5C0XH 4PNYA 4Y7NB 2IX0A 4H7BA 1PXUA 4IZ8A 3A55A 5M9OA 1NR2A 3W2DA 3HG9A 1KLUD 3NBIA 1Q1EA 2BDNA 2KEEA 2BE5C 3DUZA 2B8FA 4ZK9B 2A68C 4HR7B 4DK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY7 A;  2SNM A;  4K2L A;  4K8I A;  4N9T A;  2HQE A;  5KEE A;  5JAV A;  4QB4 A;  2EXZ A;  4ID6 A;  4EQP A;  2EY6 A;  5C3W A;  4DFA A;  1SNM A;  1ENA A;  5CR3 A;  1SYD A;  4R8N A;  3DMU A;  4ZQ3 A;  1KDC A;  4EQN A;  2PZT A;  2F0G A;  1A2T A;  3SR1 A;  2F0P A;  2RKS A;  4KY6 A;  3TP6 A;  2OXP A;  4KV6 A;  2SOB A;  2EYM A;  1SNP A;  1EY5 A;  1JOO A;  3ERQ A;  1KAB A;  1SND A;  2EY2 A;  2F0Q A;  3MVV A;  4IUN A;  2PZW A;  4RKL A;  5J1Z A;  4K14 A;  1EY0 A;  4ZUJ A;  4J6H A;  1EZ8 A;  2F0V A;  5CC4 A;  1JOR A;  1TR5 A;  2PYK A;  4K6D A;  4DU9 A;  4EVO A;  2KHS A;  1NUC A;  3EJI A;  3EVQ A;  1EY8 A;  3H6M A;  4IAL A;  2ENB A;  3SK5 A;  2F0D A;  1EY9 A;  4DGZ A;  1F2Z A;  2PQE A;  3NHH A;  4YIJ A;  5EKK A;  3SHL A;  3SK8 A;  3DHQ A;  5I9O A;  5IOC A;  1SNO A;  3MEH A;  5C4Z A;  3SK6 A;  2F0F A;  5K5P A;  3ERO A;  3D8G A;  4K5V A;  2F0S A;  1STY A;  3NXW A;  3MXP A;  1A3T A;  3QOL A;  2SNS A;  3E5S A;  1KAA A;  3MHB A;  4G57 A;  3V2T A;  4B9X A;  5CV7 A;  1TT2 A;  5IGB A;  4QMG A;  4NMZ A;  2F0T A;  1A2U A;  4KD4 A;  2KQ3 A;  4MIU A;  3P75 A;  2LKV A;  1KDA A;  4KHV A;  1STN A;  3RUZ A;  5C4H A;  1EZ6 A;  1STH A;  2F0L A;  1EY6 A;  3P1H A;  4ODG A;  5C5L A;  5EKL A;  1SYE A;  4QF4 A;  1SYB A;  3D4W A;  3C1F A;  1TQO A;  4NP5 A;  5C6A A;  4B9W A;  1EY4 A;  4K8J A;  5DAU A;  2OF1 A;  4HTH A;  2WAC A;  3VA5 A;  2F0N A;  4LAA A;  1NSN S;  2EYO A;  5I9P A;  1JOK A;  1A3U A;  1EQV A;  3NQT A;  4N9P A;  4PMC A;  5KRU A;  3S9W A;  4KD3 A;  4TRD A;  4F7X A;  2QDB A;  5CGK A;  5C3X A;  4I65 A;  3OWF A;  5IGF A;  1U9R A;  3TP5 A;  3T16 A;  5CV6 A;  4K5W A;  5CV8 A;  5IGE A;  1STG A;  1SYG A;  3R3O A;  5KIX A;  5EGT A;  5CV4 A;  5C5M A;  5DEH A;  2RBM A;  2EYH A;  5KGU A;  2F0K A;  4HMI A;  3NUC A;  5F2D A;  4PMB A;  3D4D A;  2PZU A;  3PMF A;  3QB3 A;  5JOB A;  3T13 A;  3U9O A;  1SYC A;  3HEJ A;  4KJN A;  4EQO A;  2F0W A;  4HMJ A;  1KDB A;  2F0M A;  1EYD A;  2PW7 A;  1JOQ A;  3BDC A;  2EYJ A;  4F8M A;  4PNY A;  1F2Y A;  5ISR A;  1EYA A;  3NK9 A;  1II3 A;  1SNC A;  4KJO A;  4WRD A;  5I6W A;  2EYP A;  2F0H A;  2O4X A;  5NUC A;  4H7B A;  3ITP A;  5CV5 A;  4E6I A;  3TME A;  5IGG A;  5KYL A;  4KY5 A;  5J39 A;  5HGT A;  2OEO A;  4IZ8 A;  3HZX A;  3NP8 A;  2EY1 A;  3OMC A;  5M9O A;  3BDL A;  2F0E A;  3C1E A;  4NDX A;  2F0I A;  1ENC A;  2M00 A;  1STA A;  5IGD A;  3OSO A;  4J1M A;  1IHZ A;  1EY7 A;  1STB A;  3LX0 A;  2RDF A;  5E1F A;  4S3S A;  5HUR A;  5J22 A;  4DF7 A;  3OMG A;  4ME5 A;  3SXH A;  4NKL A;  1A3V A;  3SK4 A;  5I6Y A;  2F0J A;  2F3W A;  1F2M A;  2NUC A;  4K5X A;  3TP8 A;  3MZ5 A;  1EYC A;  1SYF A;  4KTA A;  1RKN A;  3QOJ A;  5IIF A;  5KYI A;  2F3V A;  5CV9 A;  2EYF A;  1SNQ A;  2PW5 A;  5E3F A;  4WOR A;  4RKB A;  4ZUI A;  4OL7 A;  3TP7 A;  5IOD A;  4K2K A;  3D6C A;  2F0O A;  5IGC A;  1AEX A;  2F0U A;  2EY5 A;  2EYL A; 
#chains in the Genus database with same CATH topology
 2ZM6 L;  4PZ7 A;  1HNX L;  1PMR A;  4DKA C;  4DV1 Q;  2JA8 G;  1O7Y A;  2FXQ A;  5M5Y B;  2F0G A;  1NNX A;  2AUJ D;  4LFA Q;  1CHP D;  5AFW A;  2KEN A;  1D5Z C;  3K5N A;  3I4M H;  3BZD B;  1HHV A;  4DU9 A;  4HIO A;  2K28 A;  1H9K A;  1NUC A;  3EJI A;  2YU9 B;  4BBS B;  1VS0 A;  2I5M X;  1ZKO A;  3IKJ A;  2QGQ A;  3SK5 A;  2E8G A;  5DNF A;  1PDQ A;  5IOC A;  1C7Y A;  3H15 A;  4DR4 Q;  1TS5 A;  3EA6 A;  1STY A;  1S5C D;  1X65 A;  4KN4 C;  2B29 A;  1MHW C;  1H9S A;  2VY3 A;  2Z0S A;  1QB5 D;  1PRT B;  2LSS A;  1EIY B;  1KRT A;  3P75 A;  2LKV A;  1Y14 B;  2CW0 C;  4C3I B;  4Q5V A;  1HFN A;  1CSP A;  3K6O A;  4X3S A;  2FJ2 A;  1E2Z A;  2LXK A;  5A35 A;  2N8N A;  3MWY W;  3HOV B;  2CKZ B;  1YNJ C;  5COY A;  3W1G A;  4B3S L;  3VA5 A;  4RGM A;  5C3E H;  5CBE E;  1BBW A;  4JV5 Q;  1X54 A;  4GLA C;  4A3K B;  2JP1 A;  3K5O A;  5I2X A;  5C3X A;  4B3T Q;  2R7D A;  2CHB D;  3HKZ B;  3EFX D;  2OTL A;  1KL9 A;  3TS2 A;  1LUZ A;  4UPA A;  1HA6 A;  2N49 A;  2XNA C;  2K4K A;  3S1Q H;  5GAG C;  5F2D A;  4PMW A;  2J4X A;  4EQO A;  1O7L A;  5HGQ A;  1H9S B;  3ND8 A;  1E1T A;  2Z6B A;  5M3F G;  3S2D B;  3I90 A;  3MEF A;  2AKW B;  4F8M A;  1F2Y A;  4HAE A;  3S2H H;  4A3M B;  1EEI D;  1SNC A;  2O4X A;  4LUZ A;  2WAQ E;  2L0C A;  2O5J C;  1UNS A;  4J8Q A;  5J39 A;  1K0R A;  5LL6 X;  3KK7 A;  3FDT A;  3GTG H;  1TKW B;  5GAE C;  3T4A C;  2BA1 A;  5D3D A;  4IUT A;  3NSW A;  1ENC A;  1WTW A;  3OSO A;  1I4Q A;  1YNN D;  4A3E H;  3CCV A;  3SXH A;  2F0J A;  2NUC A;  4K5X A;  2V1C C;  1GD7 A;  4JI1 Q;  1DON A;  4IFD H;  2VB3 X;  5IT9 L;  4TQU S;  1IBK L;  1SNQ A;  1N33 L;  2Y0S G;  1AEX A;  3K0X A;  1GUS A;  5IP9 G;  2EQS A;  2NN6 I;  2E2J B;  2UUA L;  2L15 A;  3ND9 A;  2EY6 A;  5IE8 A;  2N88 A;  1V8Q A;  3CC4 A;  5EPK A;  2A73 B;  1V1Q A;  2K01 A;  4RCN A;  1CFM A;  2B2Y A;  2EYM A;  2R92 B;  2A6H D;  2L5T A;  1G29 1;  2E2I B;  3A8J E;  3C3L A;  4HN7 A;  2CWP A;  3SEB A;  1YZ6 A;  2GA4 B;  3TDQ A;  3MXG A;  1EWH A;  1K8O A;  1XJV A;  1EY9 A;  5M3M G;  1F2Z A;  3NHH A;  1HZA A;  3K81 C;  3BVZ A;  2D5D A;  1VQE A;  2N55 A;  1PH5 A;  2PNR C;  5IP7 G;  1DZ1 A;  4DV5 L;  3QOL A;  1PRT D;  4POF A;  1TT2 A;  2R7Z B;  4KHV A;  5C4H A;  3ONA B;  1HNX Q;  1FL0 A;  1EZ6 A;  1YBY A;  1U4P A;  1PH2 A;  4YWK A;  1SYE A;  3A0J A;  4C3J B;  2I46 A;  1OXS C;  1E0B A;  1PVO A;  1AE2 A;  3P20 A;  5JVH 3;  1PTO H;  4FO2 A;  1KAW A;  4KD3 A;  3TRZ A;  1HPC A;  3RZD H;  1ESF A;  5M5W B;  3T16 A;  3ULP A;  3PO2 G;  1SYG A;  3QG1 A;  3HOZ G;  2X6L A;  2JEB I;  4G7Z C;  1MKH A;  1YVC A;  2RBM A;  3AYH B;  3F1Z A;  3HOX G;  4OO1 I;  2ZJQ A;  3U9O A;  5JOB A;  5C0X J;  3HOW H;  1LYL A;  1R4P B;  2E2D C;  1E3P A;  3I4M B;  3BDC A;  5ELF A;  2BCO A;  2HCC A;  2MQH A;  4P2C B;  1WCM H;  1STE A;  1EU4 A;  4B3S Q;  3J7Z C;  4E6I A;  5D65 A;  3MXU A;  5D14 A;  4JBM A;  3PO3 H;  4V0B A;  1CQV A;  1I4H A;  1HUN A;  2O2L D;  2VUM H;  3OTO L;  4LF5 L;  1VQM A;  4JBK A;  5KNC A;  4L5R C;  4POG A;  2OCE A;  4A3I H;  3HP3 A;  2NVX B;  1IBL L;  1B4O A;  4A3C G;  2RSN A;  1AE3 A;  3AQQ A;  3KLS A;  3I55 A;  3I4O A;  2RCF A;  1YHQ A;  4AYB B;  1LM0 A;  3G71 A;  1SRO A;  2QW7 A;  2HQE A;  2Z6K A;  5C3E B;  1VQA A;  1PTO C;  4DNR B;  2G9H D;  4FDB A;  4H0L C;  3U4Z A;  3SR1 A;  2QIL A;  1PH6 A;  1SE4 A;  3DM1 A;  1SND A;  4KN7 C;  4CHT B;  2AQ2 B;  5JPN C;  1JWS D;  2TMP A;  1EY8 A;  1VQG A;  3S16 B;  1RJT A;  1ZYR D;  1B3Q A;  1PRT F;  4DPG A;  1W6J A;  3D0F A;  1NJI C;  5EKK A;  2J0T D;  2Q8R E;  4H13 C;  3GD7 A;  4KMU C;  1IBK Q;  3K5M A;  1B3A A;  1SAP A;  2YTX A;  5JJI A;  4F88 A;  2PI2 A;  1SE3 A;  4B9X A;  1U5K A;  1BDO A;  1N33 Q;  3S24 A;  2UUA Q;  3J80 L;  3P1H A;  3HOY B;  1EOV A;  3GTG B;  1RD9 D;  3OW7 A;  2MFI A;  4R4I A;  4BBS G;  3AFP A;  3J81 L;  1I3Q H;  1WI5 A;  4KHP L;  1N34 L;  4A3G H;  2H1E A;  2C5C A;  3I73 A;  3L9A X;  1PFB A;  2IPK D;  2ID0 A;  4FF4 A;  1STG A;  3MTS A;  4R1J A;  1MSG A;  4X64 L;  2UXD L;  1Q8K A;  4C3I G;  1HJP A;  4DV5 Q;  1WTO A;  4GOP A;  1I4R A;  1WTP A;  3T13 A;  1C0A A;  2YYZ A;  5A2Q E;  1UE5 A;  1JOQ A;  1CTM A;  3KLW A;  2WFW A;  3H91 A;  2XWJ B;  5E4W C;  5JJL A;  3DM3 A;  1O80 A;  1EYA A;  3OYY A;  1II3 A;  4A3F H;  1M90 C;  3R8B A;  5EQ0 A;  4CKC A;  1RF2 D;  4DUZ L;  4KY5 A;  3HKZ G;  2CH4 A;  3P7J A;  4FF2 A;  2VNU D;  2OWO A;  1ET6 A;  2AHO B;  1CSQ A;  4J1M A;  1WOC A;  3LGJ A;  2KVM A;  1LTI D;  1FYC A;  1EYC A;  2F3I A;  1GUN A;  1I4G A;  3RNU A;  4JI8 L;  2EYF A;  1BVS A;  3AFQ A;  4A3M G;  1TWC H;  2QKI C;  3R3O A;  2SNM A;  5KEE A;  1HNW L;  4GOP B;  3A74 A;  2BH8 A;  5CR3 A;  1XTD A;  1IYJ B;  3G4S A;  2PZT A;  2A74 C;  4LF4 L;  4L63 B;  1Y69 U;  1IW7 D;  3RZD B;  2AWN A;  1EY5 A;  2NN6 H;  3BG3 A;  1TWG H;  3L3O C;  2Y0S E;  4RKL A;  1HH2 P;  5FO7 B;  2ATW A;  3OTO Q;  2IT1 A;  3U4V A;  4LF5 Q;  3HOU G;  1V1P A;  4MHE A;  4IO9 A;  1IBL Q;  2R93 H;  3HOW B;  1D6E C;  1VMC A;  2ZXR A;  1N36 L;  1JJ2 A;  3MHB A;  5T1I A;  1ZEQ X;  5CV7 A;  3O13 A;  1Y1V H;  4O1N A;  4QMG A;  5K36 H;  4UY8 C;  2LMC B;  4R4Q A;  3DEO A;  3CPF A;  1STN A;  1S4Z A;  3S14 H;  3I2Z A;  4M1U B;  4OXP A;  2R92 G;  1EY6 A;  3PO3 B;  3CCE A;  3TN2 A;  4V19 0;  2DN8 A;  4U67 3;  2VUM B;  3C1F A;  1NR4 A;  2WB1 B;  2ZXO A;  4YCW A;  1EU3 A;  3H0G G;  1VDZ A;  1BUV T;  2LXJ A;  4R4O A;  3KDF A;  5BN4 A;  1YIJ A;  2Q8I B;  4LUO A;  1WD1 A;  4PMC A;  4FNF A;  1B53 A;  2PNH A;  1WYD A;  1YI2 A;  5C0X G;  5FLM H;  3CKI B;  1IYV A;  3J80 c;  1JE4 A;  4GLV B;  1SN8 A;  1V1P B;  5DM6 3;  5DEH A;  4LF6 L;  1GUW A;  2F0K A;  3F2U A;  4C3J G;  2BA0 A;  4QGU A;  1MSH A;  1H95 A;  2RHQ B;  3MFG A;  2F4V L;  3IRB A;  2G5D A;  4OIJ A;  2R61 A;  4EQ5 A;  4OO1 H;  5M5Y H;  1PH3 A;  4A4I A;  2B2W A;  5KYL A;  3TME A;  1A15 A;  4WFN 3;  2B2T C;  4KHP Q;  1N34 Q;  4G4K A;  2DY7 A;  3PQI A;  3KDF B;  2KOL A;  1O7I A;  2RDF A;  3MFY A;  4S3S A;  3KJO A;  2D62 A;  3BYY B;  3ICE A;  3KF8 A;  1HTL D;  5I6Y A;  4X64 Q;  2UXD Q;  4DV3 L;  1XPU A;  3A56 A;  2JN4 A;  2DUD A;  3I4M G;  4O42 A;  3J80 i;  4NXN L;  5AJ3 L;  4HIK A;  2NZH A;  1K8M A;  3CAM A;  2Z4H A;  2M2L A;  1X32 A;  3EBE A;  1GVP A;  1PYS B;  1I3Q B;  3J81 i;  5FLX L;  3HOV H;  4KY6 A;  4HSP A;  4KV6 A;  3ERQ A;  4A3L H;  4JVZ A;  1YNN C;  3SDZ A;  1EQQ A;  4ZUJ A;  4GNX A;  1QVF A;  3C2P A;  1JMC A;  1DOK A;  4A3K H;  1YHB A;  4R8I A;  2MGS A;  4AYB G;  1Z7T A;  2MO0 A;  1SNO A;  4YHH L;  3NQI A;  4R9W A;  4JI8 Q;  1MIU A;  1C48 A;  1B9N A;  3MXP A;  5C3E G;  1D8L A;  1KNA A;  3CRK C;  3KF8 B;  5IT9 E;  1YJN A;  1DM0 B;  3T56 B;  1CUK A;  4A3F B;  4KLK A;  4JCV E;  1HNW Q;  3CC7 A;  1U4L A;  4C3H H;  5C4X H;  2A6H C;  4LF4 Q;  3T1H L;  2K7V A;  1EY4 A;  1GUO A;  5FKA C;  3Q22 A;  4JYA Q;  1RIP A;  4YCV A;  2EYO A;  1EQV A;  1PFS A;  4IN3 A;  2ZTD A;  2BOS A;  1KNE A;  4GNX B;  2R3Z A;  1TWC B;  3GTM B;  1PRT C;  3HKS A;  1OXU A;  5EJW A;  1L0W A;  5ELE A;  1N36 Q;  5C5M A;  4IUU A;  1BO0 A;  1HZ9 A;  1NAP A;  5KGU A;  2B63 H;  1MJC A;  1YJ9 A;  1OO9 B;  2PZU A;  2CH4 W;  1BBU A;  2JA9 A;  4A3E G;  3SE0 A;  4AH6 A;  4C1N K;  5CBA E;  1KXL A;  4A3B B;  1KDB A;  1TWG B;  1EYD A;  2F0M A;  2K5N A;  4MZ9 A;  4P74 A;  2EYJ A;  3GO5 A;  1HXY D;  2WII B;  5KND A;  4IFD G;  3PUZ A;  5CV5 A;  4LFC L;  2XWB B;  4IUR A;  2R93 B;  3HZX A;  3G7L A;  2ZTC A;  4IPD A;  4OEM B;  4QUF A;  1Q86 C;  5GRO A;  1FNU A;  1BCP B;  2VS1 A;  1CA6 A;  1Y1V B;  3SK4 A;  3E0E A;  5H1S E;  3MZ5 A;  4LF6 Q;  5C4J B;  3HKZ E;  1PZJ D;  2PW5 A;  3TP7 A;  5IOD A;  5IYC H;  1CT1 D;  4DR3 L;  1SR3 A;  3BU2 A;  4OHJ A;  2EYL A;  3A54 A;  2HCI A;  2F4V Q;  3S1M H;  2R7Z H;  4PZ6 A;  3Q0A A;  1K73 C;  1X3G A;  2Q8T A;  1F9S A;  4HID A;  2K5W A;  5IGG A;  1HQM C;  2EY2 A;  2HDL A;  1I6H B;  2ZTE A;  2O5I C;  2F0V A;  3M9B A;  4N8X 1;  4K6D A;  1VQP A;  1XWE A;  4RWS C;  3CRL C;  3GV3 A;  2CWA A;  2PQE A;  3I56 A;  4XQQ A;  1ASY A;  1YNX A;  4DV3 Q;  3CHB D;  3AB9 A;  4C2M H;  1O78 A;  1VQ4 A;  3KFU A;  3NXW A;  5FLX c;  5AJ3 Q;  3T1Y L;  2IWH A;  4NXN Q;  2CFM A;  1Y1W B;  2HDM A;  3X3N A;  3DWA A;  2K32 A;  1S5B D;  2Z1C A;  2IJ0 A;  5C5L A;  4DN4 M;  3TZD A;  4A75 A;  3I72 A;  3NTI A;  2K04 A;  2WAC A;  4OWT B;  3A7L A;  1IXR A;  1EIG A;  2F0N A;  3KOJ A;  3OIP A;  2M9V A;  3HOW G;  3S9W A;  2JK8 A;  4TRD A;  4OX9 L;  1PH1 A;  3F8T A;  3ULL A;  3F2C A;  1G8Z D;  1WCM G;  3NEN A;  4YHH Q;  3M7G A;  3M4Y A;  2NVX H;  1Q8I A;  1WJJ A;  5KIX A;  1VQ8 A;  5E4X A;  3PO3 G;  1WTR A;  3PIO 3;  1EWC A;  3NUC A;  2JQO A;  2ICE C;  2L12 A;  2VUM G;  3MC0 B;  3PMF A;  2WB1 G;  1FGU A;  4HMJ A;  4A3I G;  3OPO A;  4XT3 B;  4UAI A;  3D6W A;  3J80 E;  3S1R H;  2A8V A;  1JQY D;  3T1H Q;  3M4Q A;  5ISR A;  1IKL A;  1VF5 C;  1AN8 A;  1MBY A;  4JBW A;  1I50 H;  3J81 E;  5HGT A;  1PYW D;  1E22 A;  3OWE B;  4ME3 A;  1BCP D;  2R7F A;  1EY7 A;  1HR0 L;  2VZA A;  1SBB B;  3OMG A;  3S16 H;  1Q82 C;  1AZP A;  1B44 D;  4BBR H;  2KHJ A;  4L8J A;  3ULJ A;  5IIF A;  4FXG C;  4AQY L;  2MHV A;  5CV9 A;  3WWV A;  4DK6 C;  4C3H B;  4DAV A;  5C4X B;  1IYU A;  1EOT A;  4RGN A;  4KY7 A;  1LTB D;  4QB4 A;  2PMZ B;  1LAB A;  2A19 A;  1K9M C;  3QJY A;  2VL6 A;  1TWA B;  1PZI D;  4ZQ3 A;  1SDF A;  3A8K E;  3HOY H;  4A3D H;  4LFC Q;  1DOL A;  2RKS A;  1SE8 A;  2PZW A;  4ZLT F;  1DCZ A;  5KNB A;  4KK7 A;  2HHH L;  2IHF A;  4GN3 B;  2B63 B;  1CQF A;  2DY8 A;  3CXC A;  1G2T A;  3UDI A;  1Y8P B;  3ERO A;  2YTY A;  4DR3 Q;  4HJA A;  2ZXP A;  4KD4 A;  1TU2 B;  3TEH B;  1K28 A;  4A3G G;  3LNN A;  1MJE A;  1KTK A;  4JI4 L;  4UHV A;  4FF1 A;  2EJM A;  4AYB E;  3CME A;  2G9D A;  3CCL A;  1TQO A;  3R2I A;  2KEC A;  1RTO A;  3PUY A;  3PUW A;  2OF1 A;  1ZXT A;  2MNA A;  1GHJ A;  4IJL A;  1GM5 A;  1DXM A;  3DLL A;  4L6T B;  4WJW A;  2E76 C;  1GKH A;  2E75 C;  4A3F G;  3RLO A;  3S1M B;  5CV4 A;  4O0A A;  4PQX A;  3CCU A;  1F9P A;  3T1Y Q;  1UEA B;  3HGB A;  2KCN A;  4DR5 L;  3KLR A;  1TWF H;  2QA4 A;  2NYZ D;  2Z6K C;  3STB D;  3VA7 A;  1NTG A;  2SEB D;  1I4P A;  1BCP F;  1VQF A;  5NUC A;  3BYT B;  4XIG S;  1TY2 A;  5JEA H;  1L2F A;  4RH6 A;  2D9U A;  1WTH A;  2B8G A;  4C2M B;  4OX9 Q;  3GTJ B;  4GS3 A;  5IYD H;  2HIX A;  3HRZ C;  2N78 A;  1BKB A;  2NB0 A;  4WJ3 M;  3UI2 A;  1NMF A;  3VYR A;  2I5L X;  2NN6 G;  3QOJ A;  4IOC A;  2EE1 A;  2LY7 A;  2QEX A;  2QCP X;  4OGQ C;  4DK3 C;  1B7Y B;  5C3W A;  3NEL A;  2D0P A;  1ENA A;  2F03 A;  1Q1B A;  4X65 L;  4UP7 A;  2PI2 E;  1A2T A;  3CCQ A;  2B2V A;  2SOB A;  4DAM A;  2WAQ B;  5J1Z A;  2VQE L;  1Y1V G;  4C1N I;  4MTK A;  2VQF L;  2NBF A;  3N52 A;  5K36 G;  1LAC A;  5LMN L;  1HR0 Q;  5IYB H;  3FPP A;  2ENB A;  2F0D A;  1WTV A;  4DUY L;  4DV2 L;  1YIT A;  3RZO B;  2QDL A;  1FNV A;  4Q0F A;  5C4Z A;  3CU7 A;  4AQY Q;  4K5V A;  2JA7 B;  1K3R A;  5E7N A;  3S1R B;  3PCO B;  1HZB A;  4IJH A;  2XN9 C;  4DR2 L;  5FLM G;  1Q46 A;  1I50 B;  1V1O A;  2BE5 D;  4CDD C;  2EJF C;  3FKI B;  1M1K C;  1PFM A;  2KJX A;  4B08 A;  4CJ0 B;  3TS0 A;  3QO2 A;  3H3V I;  1BR9 A;  4CDE C;  1CKN B;  3KF6 A;  5FLX E;  2HUG A;  4X3T A;  2A68 D;  1IBM L;  2JA5 B;  2XRQ D;  3I3C A;  4LWC A;  4R4T A;  1QZH A;  4HCS A;  1A3U A;  3NQT A;  4BBR B;  2RF4 A;  2HHH Q;  1EIH A;  4Z9C B;  5IGF A;  4IPH A;  3KYH C;  4K5W A;  1I6V C;  2K33 A;  4OO1 G;  2ASB A;  5LMN W;  2AQ3 B;  2AUK A;  3QIA A;  3VDY A;  1ESR A;  2KA7 A;  4A3D B;  1VQB A;  4QUC A;  4JI4 Q;  1A8V A;  5IWA L;  2HT1 A;  3WDN A;  2Z4I A;  1JCK B;  4KJO A;  1S5D D;  2AQ1 B;  3ZYY X;  1EUJ A;  3ERS X;  1ILP A;  2CW0 D;  1DYQ A;  2WB1 E;  3KF6 B;  3UE1 A;  2RQX A;  2UXB L;  4QIW B;  2NVT H;  1HCZ A;  3VYU A;  3NPP A;  1YNJ D;  1EQR A;  4DR1 L;  1F2M A;  2JA6 H;  1G6P A;  3HOV G;  4ZCK A;  4A3L G;  2NVQ H;  1ET9 A;  3GTL B;  4DR5 Q;  4K2K A;  3D6C A;  5IGC A;  3E3X A;  2JE6 I;  3NE5 B;  4A3K G;  4K8I A;  1A0I A;  1A62 A;  1VF7 A;  4GZY C;  1E2V A;  1XMO L;  1H9J A;  2QF7 A;  4DXF A;  2QEJ C;  3BVM A;  2OXP A;  1JOO A;  2WV6 D;  1KAB A;  1VQJ A;  2IX1 A;  3K58 A;  1H9R A;  4K14 A;  4IFD J;  1EZ8 A;  1JOR A;  3H6M A;  1UE1 A;  4OEL B;  2UU9 L;  2RA4 A;  4C3H G;  5C4X G;  1MGS A;  3GQB A;  1LO5 D;  1D1I A;  3MEH A;  1TWF B;  3GTM H;  1T9H A;  4WJ4 A;  1GJX A;  3S1N H;  1U0L A;  3TSS A;  1E24 A;  1LV9 A;  1Q90 A;  1SSO A;  5L37 A;  3PIO A;  3IL8 A;  3DWQ A;  1KDA A;  2LFN A;  1SJE D;  4B3M L;  4GN4 B;  4A3B H;  4X65 Q;  4JYA L;  3D4W A;  4GN5 A;  3J7A 5;  2B63 G;  2VQE Q;  2B2W C;  2VQF Q;  1CM9 A;  3M4O B;  1CZG A;  4CJ1 B;  4BA2 I;  4HCE A;  4N9P A;  5LMN Q;  2I07 B;  5G3L D;  1XXG A;  1X55 A;  1PH8 A;  4QQB X;  1U9R A;  4DNI A;  1K83 B;  4DUY Q;  4DV2 Q;  2JA8 B;  4LFB L;  5CV8 A;  3AMU A;  5ELO A;  1AFP A;  5JJZ A;  3E6Z X;  3I8Z A;  1FNW A;  4CKB A;  5C4J H;  3F2D A;  2L4N A;  4DR2 Q;  1G91 A;  3M3Y B;  1LTG D;  1HA5 A;  3HEJ A;  4KJN A;  2KCM A;  2Q2U A;  4P72 A;  2NZO A;  3VR5 A;  1KD1 C;  3J7A F;  2EJG C;  1MD2 D;  2PCF B;  1IBM Q;  5IYC G;  3ITP A;  4C56 C;  1VQH A;  2IY5 B;  4GNX C;  1I6H H;  3S17 B;  4A93 H;  3C1E A;  3UDX A;  2R7Z G;  1SMY D;  3IFT A;  1D2B A;  1CK1 A;  3NBH A;  1G6Z A;  3K7A B;  4BA1 I;  1JT8 A;  2CQA A;  4DV7 L;  4LF8 L;  1B1Z A;  1PZK D;  1PLF A;  3J7A V;  2XGT A;  2RCN A;  2AMC B;  3DXJ C;  5FJ8 G;  1CKM A;  2JXM B;  3KBG A;  1C9O A;  2CQO A;  4K2L A;  1Y1W H;  5IWA Q;  3LWU A;  2WKD A;  3CCM A;  1SYD A;  4BWG B;  4R8N A;  1I94 L;  3GTO H;  5EBD A;  4EQN A;  3FPU B;  1EWI A;  4BXX H;  5IGB A;  3K57 A;  4IUN A;  1BCP C;  4AIM A;  4X3U A;  2UXB Q;  1X3E A;  3PIP 3;  4IAL A;  4L5T A;  4BY7 H;  2OTJ A;  5M3F B;  2KCC A;  1WVL A;  2GVB A;  4DR1 Q;  3SHL A;  3R2T A;  4DXG A;  4JI0 L;  1SEB D;  3D4R A;  5LHY 1;  3NWS A;  3NBH B;  2K5Q A;  1W6K A;  4ZYS A;  4DV0 L;  5ELD A;  3M85 A;  3E5S A;  3UDG A;  1X9N A;  2OQK A;  3OHX C;  4KKU A;  3OW2 A;  1A2U A;  5C44 H;  4MIU A;  1XNR Q;  2P5Z X;  1SJH D;  2F0L A;  3CP0 A;  3PUV A;  3CF5 A;  1BXT A;  4CDC C;  5DM7 3;  1XMO Q;  2NVT B;  5G3L F;  2KED A;  1S3O A;  4K8J A;  4MTN A;  2K5H A;  3C46 A;  1K8G A;  4LAA A;  5D3I B;  2Y0S B;  1HZC A;  2JA6 B;  1VQ7 A;  2UU9 Q;  4FYD A;  3H3V H;  2NVQ B;  2RSO A;  3OWF A;  4Y52 H;  2AWO A;  2ES2 A;  1LT6 D;  2FFK B;  4KI0 A;  3JAM L;  3T53 B;  2H4O A;  1PH9 A;  3GDE A;  1FGB D;  4B3M Q;  5M3M B;  4HJ5 A;  3FEW X;  2ICI A;  4BBR G;  2XIW A;  1JJG A;  5EPL A;  1WD0 A;  4RGT A;  1TWA H;  2IW3 A;  4WRD A;  1JB7 A;  3U58 A;  1X3P A;  2OEO A;  2EY1 A;  2B2U A;  4NDX A;  2PO4 A;  3S1N B;  2CCZ A;  1B2T A;  3QR8 A;  2EPB A;  2J7Z A;  3GTP B;  2ZJR A;  4LFB Q;  4ME5 A;  4KHZ A;  3HOY G;  4MN3 A;  4P71 A;  3S15 H;  4A3D G;  1L1O A;  1XX8 A;  4JI3 L;  3GP7 A;  1EFW A;  4PV1 C;  2A69 D;  4U68 A;  1OXX K;  2E2H B;  4OWX B;  4ZAI A;  2EDG A;  4ULL A;  4JOI A;  2EY5 A;  4N9T A;  3BS1 A;  4JI7 Q;  4DR6 L;  4XQN A;  4DFA A;  4RFB A;  2DNE A;  3A5U A;  3PO2 B;  3LWE A;  1K0S A;  5COR A;  3IAY A;  3G6J B;  3TP8 A;  5I2Y A;  5EPJ A;  2EXD A;  4X66 L;  1CHQ D;  4DR7 L;  1DJR D;  3EVQ A;  3VR6 A;  1LTL A;  3A5Z B;  3F2B A;  4DV7 Q;  4DV4 L;  4LF8 Q;  1E2W A;  1IKM A;  2D0O A;  3SK6 A;  5EBC A;  5K5P A;  1Q12 A;  1JR0 D;  2MUY A;  3RR5 A;  2SNS A;  4G57 A;  4EX5 A;  2I0Q A;  1FR3 A;  1L1O B;  1ONL A;  4QL5 A;  1A6X A;  1RTN A;  3G6E A;  2BDO A;  3FVQ A;  2GVA A;  3WOE A;  4ZKB B;  1STH A;  2DJG C;  2NTS A;  5EKL A;  1I94 Q;  4XXE A;  2DJF C;  3PGZ A;  4QF4 A;  3HS0 C;  4A93 B;  5GQO A;  2PMZ E;  4B9W A;  4HTH A;  1U4R A;  4GKJ L;  1LLR D;  1Z6H A;  1PFN A;  1NSN S;  4LMQ D;  5KRU A;  1FVI A;  1GUT A;  3BDO A;  2E5L L;  4RAU C;  3GTJ H;  3K80 C;  1VQO A;  4JI0 Q;  3GTK B;  4K0K L;  1VQC A;  1YHA A;  4DV0 Q;  4IUV A;  4B3R L;  5EGT A;  3FHW A;  1PYB A;  2PPB C;  4LF9 L;  3BVG A;  5JEA G;  4DA2 A;  4NW2 A;  2EYH A;  4LUV A;  3GTO B;  2K6A A;  4PG3 A;  3MAQ A;  4A76 A;  2L55 A;  3NWT A;  5IYD G;  3J81 j;  4PZ8 A;  1EQT A;  2B39 A;  2JSO A;  1F77 A;  1BNZ A;  2IL8 A;  1HTP A;  4IPG A;  1ZYR C;  1LT4 D;  5I6W A;  2XVS A;  3EN2 A;  4BY7 B;  4X62 L;  2B3G A;  1VQK A;  5FO9 B;  5ELB A;  1STA A;  3K5L A;  4X3K A;  3JAM c;  5JJK A;  3CC2 A;  1TWH B;  5C44 B;  3RZO H;  1NMG A;  4RHR A;  4IPC A;  2UUC L;  3FP9 A;  4ZKC B;  3TZU A;  2F3V A;  2ZT9 C;  5E3F A;  2JA7 H;  3OOC A;  1U4M A;  5IYB G;  1O7Z A;  4JI5 L;  1B9M A;  3NEM A;  3FMC A;  2K03 A;  1GUG A;  2B2Y C;  3NTK A;  1SNM A;  3FKI H;  4JC0 A;  2RVL A;  2WP8 J;  1KDC A;  3RN2 A;  2K52 A;  4QY7 A;  4G7O C;  3BJU A;  1KC8 C;  2JA5 H;  1HQR D;  3GTQ H;  2RDG A;  1TR5 A;  2K1B A;  1X56 A;  4EVO A;  3UDF A;  3CD6 A;  4I7Z C;  4DGZ A;  4JI3 Q;  3G48 A;  3DHQ A;  5I9O A;  3JAM i;  2UUB L;  3V96 A;  2Q2T A;  3E9H A;  3I4N H;  2F0S A;  1JWU D;  1A3T A;  2K14 A;  1M4V A;  2F0T A;  1QZG A;  3VR2 A;  2I5H A;  1AW7 A;  2FMM A;  2L11 A;  4DR6 Q;  1XTC D;  4ZRZ A;  5GAH C;  3H09 A;  3M7N A;  2X6G A;  4UP9 A;  2A5H A;  1VQN A;  4YY3 L;  1TXY A;  3KLS X;  4ALP A;  1DGS A;  5I9P A;  3S15 B;  2NZ1 D;  4X66 Q;  4FXD A;  2JJQ A;  3J7Y W;  4DR7 Q;  1E7Z A;  4BS9 A;  3X3M A;  4F7X A;  3I70 A;  1S5F D;  4I65 A;  1HR0 W;  4DV4 Q;  3RN5 A;  1UE6 A;  2VB2 X;  5EAY A;  3FRP B;  4BY1 H;  1OXT A;  1ASZ A;  3GTL H;  1ILQ A;  1I5F A;  1IW7 C;  1PHJ A;  1SFO B;  5TSS A;  4A3J H;  1R9T B;  1J9O A;  1SYC A;  1CA5 A;  1QJO A;  3HOU B;  3Q24 A;  4H02 A;  2JA6 G;  1EYG A;  2K5D A;  3D31 A;  2DGY A;  1YEZ A;  2OT2 A;  3NK9 A;  3SVM A;  4GKJ Q;  2B2V C;  3MA2 B;  2DNC A;  1EFI D;  4DNT B;  1FD7 D;  4IQZ A;  1QIL A;  2F1M A;  2NTT A;  4GLX A;  5JPM C;  4QJF A;  2VXW A;  2E5L Q;  3HFZ B;  3PIP A;  4DF7 A;  2UXC L;  3R93 A;  4K0K Q;  2F3W A;  4B3R Q;  1AH9 A;  4KTA A;  4LF9 Q;  2X69 A;  1RKN A;  1PH7 A;  3H0G B;  1X3F A;  4KKT A;  4LF7 L;  2XTI A;  4ABN A;  4JI6 L;  3PSI A;  1LT3 D;  4RKB A;  4WOR A;  4RGO S;  2LS0 1;  1WTX A;  1OXV A;  3OMC A;  1QVC A;  1BQQ T;  2C35 B;  2GN5 A;  4EQP A;  3PF5 A;  4NXM L;  3DMU A;  3AEV A;  2F4I A;  2YTV A;  2ZM6 Q;  3AU7 A;  4X62 Q;  1SMY C;  1BBX C;  3ZJY C;  1SMX A;  5FK9 C;  1UEB A;  5LMU L;  2VW9 A;  4JPB W;  4FVM A;  4J6H A;  4UDU C;  3M4O H;  5DLQ E;  3CQZ H;  4YCU A;  2KHS A;  3JC6 6;  4L5S A;  2NWG A;  4A3B G;  2A6E D;  2KBN A;  1K83 H;  4QIW E;  2JA8 H;  4O2D A;  4RHS A;  2UUC Q;  2F0F A;  1LTT D;  1CKN A;  4LNQ A;  1IL8 A;  2R93 G;  1SRU A;  4JI5 Q;  1LTA D;  3M3Y H;  1K8A C;  4HJ7 A;  1P8L A;  1HRJ A;  4APV A;  4GKK L;  1SYB A;  3CCS A;  1N8R C;  1RCV D;  3W5O A;  4JI2 L;  3Q8D A;  1QNK A;  1V9P A;  1JC7 A;  1W3S A;  2V4D A;  2SDF A;  3U50 C;  3BZC A;  4XTC S;  4YWL A;  3TRE A;  3S17 H;  5CGK A;  2WIN B;  3TP5 A;  5CV6 A;  4OWW B;  4GOP C;  2UUB Q;  4N8F A;  1EIF A;  3K7A H;  2IX3 A;  1JE5 A;  1HUM A;  1JJC B;  4A93 G;  5BR8 L;  1K3B C;  1KHI A;  2N3S A;  4J15 A;  3BZK A;  2F0W A;  3K8A A;  3GV6 A;  4NPS A;  4CGY B;  2C9O A;  1VMP A;  3GTQ B;  4DAY A;  3RD4 A;  4YWM A;  1DOM A;  4YY3 Q;  1VCI A;  2WKC A;  3CW2 C;  2BH2 A;  4X6A H;  5BN3 A;  3NP8 A;  1ICW A;  1Y1W G;  2F0E A;  2HQL A;  3CCJ A;  3VYS A;  3I4N B;  1EEF D;  1IHZ A;  4IOA A;  5HUR A;  1PA6 A;  3RMH A;  2MJ8 A;  1QCB D;  1A3V A;  5M3F H;  5IT9 c;  3CMA A;  4DV6 L;  1XMQ L;  2Z9H A;  4CKE A;  4BXX G;  1TS4 A;  1WFQ A;  3S1Q B;  1UE7 A;  4ZUI A;  4OL7 A;  2RHS B;  5M5X H;  1B8A A;  2MP1 A;  3JAM E;  1X6O A;  1I4X A;  3VYT A;  2K75 A;  3N6R A;  4NB3 A;  4BY7 G;  2EXZ A;  4ID6 A;  4CJ2 C;  3S2H B;  4M8A A;  2F0Q A;  2Q2I A;  2KUM A;  3Q23 A;  5BN5 A;  5C44 G;  1HFG A;  1RDP D;  2HIV A;  2NVY H;  4DAY B;  5CMD A;  3K59 A;  1J5E L;  1D1K A;  3H94 A;  3E0J A;  4A3E B;  5IP9 H;  2XRS D;  1HNZ L;  4BY1 B;  4DAP A;  2ALY B;  1G51 A;  3K0Y A;  2A69 C;  1KLG D;  2UXC Q;  4YIJ A;  4A3J B;  1PH4 A;  4XYQ A;  4RA8 A;  4LF7 Q;  4FP5 D;  2TSS A;  4JI6 Q;  1XNR L;  3UE0 A;  1NE3 A;  2FHT A;  1F2L A;  1KAA A;  1KRS A;  1RHP A;  4NMZ A;  3DWP A;  1RL2 A;  2EZV A;  4F87 A;  4NXM Q;  4HIM A;  2PQA A;  5M3M H;  2ZJP A;  1DD2 A;  1N9W A;  1OTC A;  4XQJ A;  2MPM A;  1TVX A;  1IZ6 A;  5IP7 H;  5LMU Q;  1EL0 A;  1L0Y B;  3GTP H;  4HJ8 A;  5IGE A;  3QWN A;  2MO1 A;  3W1B A;  3VR3 A;  4G7H C;  5C0X I;  4OON A;  4HMI A;  1L0X B;  1YJW A;  1QE6 A;  3L7Z C;  3VR4 A;  4KKS A;  1WTQ A;  2E2H H;  2K05 A;  1UUP A;  4JW0 A;  4CBV A;  2EOT A;  4GKK Q;  1SXT A;  4JI2 Q;  1NBW A;  4MNO A;  1SE2 A;  3CQZ B;  3PO2 H;  2CVR A;  2EYP A;  2F0H A;  3W3A A;  3HOZ H;  1M8A A;  1PTO B;  1GXD C;  1AZQ A;  3U9S A;  2PQA B;  3T51 B;  5EKI A;  5T1G A;  3HOX H;  4CDF C;  5IGD A;  2F0I A;  2M00 A;  1STB A;  3LX0 A;  5E1F A;  5J22 A;  2E74 C;  2Z8L A;  3A8I E;  4K6L A;  4DK1 A;  3EQL C;  4TKO B;  1SYF A;  5KYI A;  5ELC A;  4JI7 L;  5BR8 Q;  2F0O A;  3L2P A;  2RDH A;  2F0U A;  4TVA B;  5JEA J;  5CYU A;  4EGV A;  5JAV A;  1S5E D;  2KHI A;  2R6G A;  1NCV A;  5I4D A;  5HY6 A;  3B6Y A;  1LT5 D;  1WCM B;  3TBI B;  4A3C H;  1XNQ L;  2F0P A;  1QNU A;  1LTR D;  1C4Q A;  3TP6 A;  1SNP A;  1N32 L;  3MVV A;  3DEP A;  1Q3L A;  1Q81 C;  1EY0 A;  1UAP A;  4UP8 A;  2KCT A;  2YV5 A;  1E1O A;  5GAD C;  3I4L A;  4Y7N H;  5J3B A;  4A3I B;  1MI2 A;  1VQL A;  3SK8 A;  1W2B A;  4DV6 Q;  4JK1 C;  1XMQ Q;  1LTS D;  1VQ5 A;  3GTK H;  1V43 A;  2F52 A;  3KJP A;  3V2T A;  1TY0 A;  4L5Q A;  1GHK A;  2A1A A;  2KQ3 A;  4RG1 A;  2D2C C;  3M4P A;  2K50 A;  3RUZ A;  1FJG L;  1VQ9 A;  4HED A;  4ODG A;  3Q6S A;  3J81 c;  1JB3 A;  1BOS A;  1QUQ A;  1PV4 A;  1GO3 E;  1GOZ A;  5C6A A;  2JEA I;  5DAU A;  1KIX A;  5LL6 S;  1G2S A;  2K5V A;  4XDX A;  1J5E Q;  1T5E A;  4LJZ C;  4R4C A;  4OIK A;  2B2U C;  3RLF A;  1HNZ Q;  1D5M C;  4IUQ A;  3URY A;  1TS2 A;  5M5X B;  1TWH H;  1L1O C;  1CI3 M;  1Z47 A;  1JIC A;  2YU9 H;  4I7A A;  4BBS H;  2WAQ G;  4IUP A;  2L1B A;  3MXN A;  4JOI C;  1ENF A;  3QB3 A;  1T5X D;  2H5X A;  1P16 A;  3IFD A;  2PW7 A;  1ML0 D;  3I91 A;  2NVY B;  2XSC A;  4DV1 L;  1QG7 A;  1C8C A;  1XPO A;  1PTO D;  2JA7 G;  4LFA L;  4C3I H;  1IL2 A;  4IFD I;  4XYO A;  1QUQ B;  1X3Q A;  2L9H A;  4A3G B;  3BDL A;  1TS3 A;  4DUZ Q;  3PV0 A;  3E9I A;  1J6Q A;  3FKI G;  2OQ0 A;  1VQD A;  4DR4 L;  3WOF A;  1CKO A;  3K7U C;  2JA5 G;  1J8I A;  1JWM D;  1SLJ A;  3PUX A;  4NKL A;  4HJ9 A;  1F9Q A;  4QCL A;  4P75 A;  3MXN B;  1A63 A;  4P73 A;  1R4Q B;  3KUP A;  3I4N G;  4FXK C;  1XYI A;  2FMC A;  5ELN A;  1VQI A;  1ICF B;  3S2D H;  3SGI A;  5FOB B;  2B2T A;  5CC4 A;  1NY4 A;  4A3M H;  2PYK A;  5FO8 B;  5JVG 3;  4JV5 L;  1XPR A;  4LW1 A;  3RLN A;  4B3T L;  2FIN B;  3EIV A;  2IHE A;  4LK1 C;  3STB C;  1F9R A;  1Z9F A;  3D3R A;  3D8G A;  1B50 A;  1H9M A;  2JYO A;  5A2Q L;  1AP0 A;  1SFO H;  3HOZ B;  1QWY A;  1R9T H;  4RMF A;  3H3V C;  1TII D;  3OIQ A;  4H44 C;  3KBX A;  3HOU H;  4RCO A;  3HOX B;  3L0O A;  4JG2 A;  1D5X C;  4FF3 A;  3PF4 A;  1XNQ Q;  4NP5 A;  2E2J H;  1S72 A;  4BY1 G;  3CCR A;  1N32 Q;  2EIF A;  4XT1 B;  1UWV A;  4HSV A;  3V05 A;  1B70 B;  1JOK A;  4A3J G;  4ILW A;  1D7Q A;  2A6E C;  2QDB A;  1BF4 A;  4TSS A;  2R92 H;  1Y8N B;  2E2I H;  2EVB A;  1VQ6 A;  4JI1 L;  2HD3 A;  1Y8O B;  1QOH A;  3H0G H;  3A7A B;  3NTH A;  4PMB A;  3D4D A;  3S14 B;  1CZW A;  1FJG Q;  3ER0 A;  1S40 A;  1PTO F;  3TQY A;  1ROD A;  5C0X H;  1KQS A;  5IY0 A;  4PNY A;  4Y7N B;  2IX0 A;  4H7B A;  1PXU A;  4IZ8 A;  3A55 A;  4C3J H;  5M9O A;  1QVG A;  1NR2 A;  3W2D A;  3HG9 A;  1KLU D;  3NBI A;  5FJ8 H;  1Q1E A;  2BDN A;  2KEE A;  2BE5 C;  3CPW A;  2Q2H A;  3DUZ A;  2B8F A;  4JBJ A;  5M5W H;  3I7F A;  4ZK9 B;  2A68 C;  4HR7 B;  4DK0 A;  1Q7Y C; 
#chains in the Genus database with same CATH homology
 1PMR A;  1O7Y A;  5M5Y B;  2F0G A;  2AUJ D;  1CHP D;  5AFW A;  1D5Z C;  3K5N A;  3BZD B;  1HHV A;  4DU9 A;  2K28 A;  1H9K A;  1NUC A;  3EJI A;  2YU9 B;  4BBS B;  1ZKO A;  3IKJ A;  3SK5 A;  5DNF A;  1PDQ A;  5IOC A;  1TS5 A;  3EA6 A;  1STY A;  1S5C D;  4KN4 C;  1H9S A;  1QB5 D;  1PRT B;  3P75 A;  2LKV A;  1HFN A;  2CW0 C;  4C3I B;  4Q5V A;  3K6O A;  4X3S A;  2FJ2 A;  1E2Z A;  5A35 A;  3MWY W;  3HOV B;  1YNJ C;  5COY A;  3VA5 A;  4RGM A;  5CBE E;  4A3K B;  2JP1 A;  3K5O A;  5I2X A;  5C3X A;  2CHB D;  3HKZ B;  3EFX D;  1HA6 A;  2XNA C;  5F2D A;  4PMW A;  2J4X A;  4EQO A;  1O7L A;  1H9S B;  3ND8 A;  3S2D B;  3I90 A;  4F8M A;  1F2Y A;  4HAE A;  4A3M B;  1EEI D;  1SNC A;  2O4X A;  2L0C A;  2O5J C;  1UNS A;  4J8Q A;  5J39 A;  5LL6 X;  3KK7 A;  3FDT A;  1TKW B;  3T4A C;  2BA1 A;  5D3D A;  4IUT A;  3NSW A;  1ENC A;  1WTW A;  3OSO A;  1I4Q A;  1YNN D;  3SXH A;  2F0J A;  2NUC A;  4K5X A;  1DON A;  4IFD H;  2VB3 X;  5IT9 L;  4TQU S;  1SNQ A;  1AEX A;  1GUS A;  2E2J B;  2NN6 I;  3ND9 A;  2EY6 A;  2N88 A;  1V8Q A;  5EPK A;  2A73 B;  2K01 A;  4RCN A;  1CFM A;  2B2Y A;  2EYM A;  2R92 B;  2A6H D;  2L5T A;  1G29 1;  2E2I B;  3A8J E;  3C3L A;  4HN7 A;  3SEB A;  3TDQ A;  2GA4 B;  3MXG A;  1EWH A;  1K8O A;  1EY9 A;  1F2Z A;  3NHH A;  3BVZ A;  2D5D A;  2N55 A;  2PNR C;  1DZ1 A;  3QOL A;  1PRT D;  1TT2 A;  2R7Z B;  4KHV A;  5C4H A;  3ONA B;  1EZ6 A;  1U4P A;  1SYE A;  4C3J B;  2I46 A;  1OXS C;  1E0B A;  3P20 A;  5JVH 3;  1PTO H;  4FO2 A;  4KD3 A;  1HPC A;  1ESF A;  5M5W B;  3T16 A;  1SYG A;  3QG1 A;  2X6L A;  2JEB I;  4G7Z C;  2RBM A;  4OO1 I;  3U9O A;  5JOB A;  5C0X J;  1R4P B;  2E2D C;  3I4M B;  3BDC A;  5ELF A;  2BCO A;  2HCC A;  4P2C B;  1STE A;  1EU4 A;  4E6I A;  5D65 A;  3MXU A;  5D14 A;  4V0B A;  1CQV A;  1I4H A;  1HUN A;  2O2L D;  5KNC A;  3HP3 A;  2NVX B;  1B4O A;  2RSN A;  3KLS A;  4AYB B;  2HQE A;  5C3E B;  1PTO C;  4DNR B;  2G9H D;  4H0L C;  3SR1 A;  2QIL A;  1SE4 A;  3DM1 A;  1SND A;  4KN7 C;  4CHT B;  2AQ2 B;  5JPN C;  1JWS D;  2TMP A;  1EY8 A;  3S16 B;  1RJT A;  1ZYR D;  1PRT F;  1W6J A;  5EKK A;  2J0T D;  2Q8R E;  4H13 C;  3GD7 A;  4KMU C;  3K5M A;  1B3A A;  1SAP A;  4F88 A;  1SE3 A;  4B9X A;  1BDO A;  3J80 L;  3P1H A;  3HOY B;  3GTG B;  1RD9 D;  3OW7 A;  3J81 L;  2H1E A;  2C5C A;  3I73 A;  3L9A X;  1PFB A;  2IPK D;  2ID0 A;  4FF4 A;  1STG A;  3MTS A;  1MSG A;  4C3I G;  1WTO A;  1I4R A;  1WTP A;  3T13 A;  2YYZ A;  5A2Q E;  1JOQ A;  1CTM A;  3H91 A;  2XWJ B;  5E4W C;  1O80 A;  1EYA A;  1II3 A;  3R8B A;  5EQ0 A;  4CKC A;  1RF2 D;  4KY5 A;  4FF2 A;  3P7J A;  2VNU D;  1ET6 A;  4J1M A;  2KVM A;  1LTI D;  1FYC A;  1EYC A;  1GUN A;  1I4G A;  2EYF A;  2QKI C;  3R3O A;  2SNM A;  5KEE A;  5CR3 A;  2PZT A;  2A74 C;  4L63 B;  1Y69 U;  1IW7 D;  3RZD B;  2AWN A;  1EY5 A;  2NN6 H;  3BG3 A;  4RKL A;  3L3O C;  5FO7 B;  2IT1 A;  1V1P A;  4MHE A;  3HOW B;  1D6E C;  1VMC A;  2ZXR A;  3MHB A;  5T1I A;  1ZEQ X;  5CV7 A;  3O13 A;  4QMG A;  4O1N A;  5K36 H;  2LMC B;  3DEO A;  1STN A;  1S4Z A;  4M1U B;  1EY6 A;  3PO3 B;  3TN2 A;  4V19 0;  2DN8 A;  4U67 3;  2VUM B;  3C1F A;  1NR4 A;  2WB1 B;  2ZXO A;  1EU3 A;  1VDZ A;  1BUV T;  5BN4 A;  2Q8I B;  1WD1 A;  4PMC A;  4FNF A;  1B53 A;  5C0X G;  3CKI B;  1IYV A;  1JE4 A;  5DM6 3;  1V1P B;  5DEH A;  1GUW A;  2F0K A;  3F2U A;  4C3J G;  2BA0 A;  1MSH A;  3MFG A;  4OIJ A;  2R61 A;  4OO1 H;  2B2W A;  5KYL A;  3TME A;  1A15 A;  4WFN 3;  2B2T C;  4G4K A;  2DY7 A;  2KOL A;  2RDF A;  3MFY A;  4S3S A;  2D62 A;  3BYY B;  3KF8 A;  1HTL D;  5I6Y A;  3A56 A;  4O42 A;  1K8M A;  2Z4H A;  2M2L A;  1X32 A;  1I3Q B;  5FLX L;  4KY6 A;  4HSP A;  4KV6 A;  3ERQ A;  1YNN C;  3SDZ A;  4ZUJ A;  3C2P A;  1DOK A;  4R8I A;  2MGS A;  1Z7T A;  1SNO A;  3NQI A;  4R9W A;  1C48 A;  1B9N A;  3MXP A;  1KNA A;  3CRK C;  5IT9 E;  1DM0 B;  3T56 B;  4A3F B;  1U4L A;  2A6H C;  2K7V A;  1EY4 A;  1GUO A;  5FKA C;  3Q22 A;  2EYO A;  1EQV A;  4IN3 A;  2BOS A;  1KNE A;  2R3Z A;  1TWC B;  3GTM B;  1PRT C;  1OXU A;  5EJW A;  5ELE A;  5C5M A;  4IUU A;  1BO0 A;  1NAP A;  5KGU A;  1OO9 B;  2PZU A;  3SE0 A;  5CBA E;  4C1N K;  4A3B B;  1KDB A;  1TWG B;  1EYD A;  2F0M A;  2EYJ A;  3GO5 A;  1HXY D;  2WII B;  5KND A;  4IFD G;  3PUZ A;  5CV5 A;  2XWB B;  4IUR A;  2R93 B;  3HZX A;  3G7L A;  4QUF A;  1FNU A;  1BCP B;  1CA6 A;  1Y1V B;  3SK4 A;  3MZ5 A;  5C4J B;  1PZJ D;  2PW5 A;  3TP7 A;  5IOD A;  1CT1 D;  4OHJ A;  2EYL A;  3A54 A;  2HCI A;  3Q0A A;  2Q8T A;  1F9S A;  2K5W A;  5IGG A;  1HQM C;  2EY2 A;  2HDL A;  1I6H B;  2O5I C;  2F0V A;  4K6D A;  1XWE A;  4RWS C;  3CRL C;  3GV3 A;  2PQE A;  4XQQ A;  3CHB D;  3AB9 A;  1O78 A;  3NXW A;  2IWH A;  1Y1W B;  2HDM A;  3X3N A;  3DWA A;  2K32 A;  1S5B D;  2Z1C A;  2IJ0 A;  5C5L A;  4DN4 M;  3TZD A;  3I72 A;  3NTI A;  2K04 A;  2WAC A;  3A7L A;  2F0N A;  1EIG A;  3OIP A;  2M9V A;  3S9W A;  4TRD A;  1G8Z D;  3M7G A;  3M4Y A;  1Q8I A;  5KIX A;  5E4X A;  1WTR A;  3PIO 3;  1EWC A;  3NUC A;  2ICE C;  2L12 A;  3MC0 B;  3PMF A;  4HMJ A;  3OPO A;  4XT3 B;  4UAI A;  3D6W A;  3J80 E;  1JQY D;  5ISR A;  1IKL A;  1VF5 C;  1AN8 A;  1MBY A;  4JBW A;  3J81 E;  5HGT A;  1PYW D;  3OWE B;  1BCP D;  1EY7 A;  1SBB B;  3OMG A;  1AZP A;  1B44 D;  4L8J A;  5IIF A;  4FXG C;  2MHV A;  5CV9 A;  4C3H B;  4DAV A;  5C4X B;  1IYU A;  1EOT A;  4RGN A;  4KY7 A;  1LTB D;  4QB4 A;  2PMZ B;  1LAB A;  3QJY A;  1TWA B;  1PZI D;  4ZQ3 A;  1SDF A;  3A8K E;  1DOL A;  2RKS A;  2PZW A;  4ZLT F;  1DCZ A;  5KNB A;  4KK7 A;  2B63 B;  1CQF A;  2DY8 A;  1G2T A;  1Y8P B;  3ERO A;  2ZXP A;  4KD4 A;  1TU2 B;  3LNN A;  1KTK A;  4FF1 A;  2EJM A;  2G9D A;  1TQO A;  3R2I A;  2KEC A;  1RTO A;  3PUY A;  3PUW A;  2OF1 A;  1ZXT A;  1GHJ A;  1DXM A;  4L6T B;  4WJW A;  2E76 C;  2E75 C;  3S1M B;  5CV4 A;  4PQX A;  1F9P A;  1UEA B;  3HGB A;  2KCN A;  3KLR A;  2NYZ D;  3VA7 A;  2SEB D;  1I4P A;  1BCP F;  5NUC A;  3BYT B;  4XIG S;  1TY2 A;  5JEA H;  4RH6 A;  2D9U A;  2B8G A;  4C2M B;  3GTJ B;  3HRZ C;  2NB0 A;  3UI2 A;  3VYR A;  2NN6 G;  3QOJ A;  2EE1 A;  2LY7 A;  2QCP X;  4OGQ C;  5C3W A;  1ENA A;  2F03 A;  1Q1B A;  1A2T A;  2B2V A;  2SOB A;  2WAQ B;  5J1Z A;  4C1N I;  2NBF A;  3N52 A;  5K36 G;  1LAC A;  3FPP A;  2ENB A;  2F0D A;  1WTV A;  3RZO B;  1FNV A;  4Q0F A;  5C4Z A;  3CU7 A;  4K5V A;  2JA7 B;  3S1R B;  2XN9 C;  1I50 B;  1V1O A;  2BE5 D;  2EJF C;  3FKI B;  1PFM A;  2KJX A;  4B08 A;  4CJ0 B;  3QO2 A;  1BR9 A;  5FLX E;  2HUG A;  4X3T A;  2A68 D;  2JA5 B;  2XRQ D;  3I3C A;  4HCS A;  1A3U A;  3NQT A;  4BBR B;  1EIH A;  4Z9C B;  5IGF A;  4K5W A;  1I6V C;  2K33 A;  4OO1 G;  2AQ3 B;  2AUK A;  3QIA A;  1ESR A;  2KA7 A;  4A3D B;  4QUC A;  3WDN A;  2Z4I A;  1JCK B;  4KJO A;  1S5D D;  2AQ1 B;  3ZYY X;  1ILP A;  2CW0 D;  1DYQ A;  2RQX A;  4QIW B;  1HCZ A;  3VYU A;  3NPP A;  1YNJ D;  1F2M A;  3GTL B;  1ET9 A;  4K2K A;  3D6C A;  5IGC A;  2JE6 I;  3NE5 B;  4K8I A;  1VF7 A;  4GZY C;  1E2V A;  1H9J A;  2QF7 A;  4DXF A;  2QEJ C;  3BVM A;  2OXP A;  1JOO A;  2WV6 D;  1KAB A;  2IX1 A;  3K58 A;  1H9R A;  4K14 A;  4IFD J;  1EZ8 A;  1JOR A;  3H6M A;  2RA4 A;  4C3H G;  1MGS A;  3GQB A;  1LO5 D;  1D1I A;  3MEH A;  1TWF B;  1GJX A;  3TSS A;  1LV9 A;  1SSO A;  1Q90 A;  3IL8 A;  3DWQ A;  1KDA A;  2LFN A;  1SJE D;  3D4W A;  2B2W C;  1CM9 A;  3M4O B;  1CZG A;  4CJ1 B;  4BA2 I;  4HCE A;  4N9P A;  2I07 B;  5G3L D;  1XXG A;  1U9R A;  2JA8 B;  1K83 B;  5CV8 A;  3AMU A;  1AFP A;  5JJZ A;  3E6Z X;  3I8Z A;  1FNW A;  4CKB A;  2L4N A;  1G91 A;  3M3Y B;  1LTG D;  1HA5 A;  3HEJ A;  4KJN A;  3VR5 A;  3J7A F;  2EJG C;  1MD2 D;  2PCF B;  3ITP A;  4C56 C;  3S17 B;  3C1E A;  1SMY D;  3IFT A;  1D2B A;  1CK1 A;  3NBH A;  1G6Z A;  3K7A B;  4BA1 I;  2CQA A;  1B1Z A;  1PZK D;  1PLF A;  3J7A V;  3DXJ C;  2JXM B;  3KBG A;  4K2L A;  3LWU A;  2WKD A;  1SYD A;  4BWG B;  4R8N A;  5EBD A;  4EQN A;  3FPU B;  5IGB A;  3K57 A;  4IUN A;  1BCP C;  4X3U A;  3PIP 3;  4IAL A;  5M3F B;  2KCC A;  1WVL A;  3SHL A;  3R2T A;  4DXG A;  1SEB D;  3D4R A;  5LHY 1;  3NWS A;  2K5Q A;  1W6K A;  4ZYS A;  5ELD A;  3M85 A;  3E5S A;  3OHX C;  4KKU A;  1A2U A;  4MIU A;  1SJH D;  2F0L A;  3PUV A;  1BXT A;  5DM7 3;  2NVT B;  5G3L F;  2KED A;  4K8J A;  3C46 A;  4LAA A;  5D3I B;  2Y0S B;  2JA6 B;  4FYD A;  2NVQ B;  2RSO A;  3OWF A;  2AWO A;  1LT6 D;  2FFK B;  4KI0 A;  3JAM L;  3T53 B;  2H4O A;  1FGB D;  5M3M B;  3FEW X;  2ICI A;  2XIW A;  5EPL A;  1WD0 A;  4RGT A;  2IW3 A;  4WRD A;  1X3P A;  2OEO A;  2EY1 A;  2B2U A;  4NDX A;  2PO4 A;  3S1N B;  1B2T A;  2EPB A;  2J7Z A;  3GTP B;  4ME5 A;  4KHZ A;  4MN3 A;  1XX8 A;  3GP7 A;  4PV1 C;  2A69 D;  4U68 A;  1OXX K;  2E2H B;  4ZAI A;  2EDG A;  4ULL A;  2EY5 A;  4N9T A;  3BS1 A;  4XQN A;  4DFA A;  4RFB A;  2DNE A;  3PO2 B;  3LWE A;  5COR A;  3IAY A;  3G6J B;  3TP8 A;  5I2Y A;  5EPJ A;  1CHQ D;  1DJR D;  3EVQ A;  3VR6 A;  1IKM A;  1E2W A;  3SK6 A;  5EBC A;  5K5P A;  1Q12 A;  1JR0 D;  2MUY A;  2SNS A;  4G57 A;  1FR3 A;  1ONL A;  1A6X A;  1RTN A;  2BDO A;  3FVQ A;  3WOE A;  4ZKB B;  1STH A;  2NTS A;  5EKL A;  4XXE A;  4QF4 A;  3HS0 C;  4A93 B;  4B9W A;  4HTH A;  1U4R A;  1LLR D;  1Z6H A;  1PFN A;  1NSN S;  4LMQ D;  5KRU A;  1GUT A;  3BDO A;  4RAU C;  3GTK B;  4IUV A;  5EGT A;  2PPB C;  3BVG A;  5JEA G;  4DA2 A;  4NW2 A;  2EYH A;  3GTO B;  2K6A A;  3MAQ A;  2L55 A;  3NWT A;  1EQT A;  2B39 A;  2JSO A;  1F77 A;  1BNZ A;  2IL8 A;  1HTP A;  1ZYR C;  1LT4 D;  5I6W A;  2XVS A;  4BY7 B;  5FO9 B;  5ELB A;  1STA A;  3K5L A;  4X3K A;  1TWH B;  5C44 B;  4RHR A;  4ZKC B;  3TZU A;  2F3V A;  2ZT9 C;  5E3F A;  3OOC A;  1U4M A;  1O7Z A;  1B9M A;  3FMC A;  2K03 A;  1GUG A;  2B2Y C;  3NTK A;  1SNM A;  2RVL A;  2WP8 J;  1KDC A;  4G7O C;  1HQR D;  2RDG A;  1TR5 A;  2K1B A;  4EVO A;  4I7Z C;  4DGZ A;  3DHQ A;  5I9O A;  3V96 A;  2F0S A;  1JWU D;  1A3T A;  1M4V A;  2F0T A;  3VR2 A;  1AW7 A;  2FMM A;  2L11 A;  1XTC D;  4ZRZ A;  3M7N A;  3H09 A;  2X6G A;  2A5H A;  3KLS X;  5I9P A;  3S15 B;  2NZ1 D;  4FXD A;  3J7Y W;  4BS9 A;  3X3M A;  4F7X A;  3I70 A;  1S5F D;  4I65 A;  2VB2 X;  3FRP B;  1OXT A;  1ILQ A;  1IW7 C;  1SFO B;  5TSS A;  1R9T B;  1J9O A;  1SYC A;  1CA5 A;  1QJO A;  3HOU B;  3Q24 A;  2K5D A;  3D31 A;  2OT2 A;  3NK9 A;  3SVM A;  2B2V C;  3MA2 B;  2DNC A;  1EFI D;  4DNT B;  1FD7 D;  4IQZ A;  1QIL A;  2F1M A;  2NTT A;  5JPM C;  2VXW A;  4DF7 A;  3R93 A;  2F3W A;  4KTA A;  2X69 A;  1RKN A;  3H0G B;  4KKT A;  4ABN A;  1LT3 D;  4RKB A;  4WOR A;  4RGO S;  2LS0 1;  1WTX A;  1OXV A;  3OMC A;  1BQQ T;  4EQP A;  3DMU A;  2F4I A;  3AU7 A;  1SMY C;  1BBX C;  5FK9 C;  4FVM A;  4J6H A;  4UDU C;  2KHS A;  2NWG A;  2A6E D;  4RHS A;  2F0F A;  1LTT D;  1IL8 A;  1LTA D;  1HRJ A;  1SYB A;  1RCV D;  1QNK A;  1JC7 A;  2V4D A;  2SDF A;  4XTC S;  5CGK A;  2WIN B;  3TP5 A;  5CV6 A;  2IX3 A;  1HUM A;  2F0W A;  3GV6 A;  4CGY B;  2C9O A;  1VMP A;  3GTQ B;  4DAY A;  3RD4 A;  1DOM A;  1VCI A;  2WKC A;  5BN3 A;  3NP8 A;  1ICW A;  2F0E A;  3VYS A;  3I4N B;  1EEF D;  1IHZ A;  5HUR A;  3RMH A;  2MJ8 A;  1QCB D;  1A3V A;  4CKE A;  1TS4 A;  3S1Q B;  4ZUI A;  4OL7 A;  2MP1 A;  3JAM E;  1I4X A;  3VYT A;  3N6R A;  2EXZ A;  4ID6 A;  4CJ2 C;  3S2H B;  4M8A A;  2F0Q A;  2KUM A;  3Q23 A;  5BN5 A;  1HFG A;  1RDP D;  5CMD A;  3K59 A;  1D1K A;  3H94 A;  3E0J A;  4A3E B;  2XRS D;  4BY1 B;  4DAP A;  3K0Y A;  2A69 C;  1KLG D;  4YIJ A;  4A3J B;  4XYQ A;  4RA8 A;  4FP5 D;  2TSS A;  2FHT A;  1F2L A;  1KAA A;  1RHP A;  4NMZ A;  3DWP A;  2EZV A;  4F87 A;  1DD2 A;  4XQJ A;  2MPM A;  1TVX A;  1EL0 A;  1L0Y B;  5IGE A;  3QWN A;  3VR3 A;  4G7H C;  5C0X I;  4HMI A;  1L0X B;  1QE6 A;  3L7Z C;  3VR4 A;  4KKS A;  1WTQ A;  2K05 A;  1UUP A;  4CBV A;  2EOT A;  1SXT A;  1SE2 A;  3CQZ B;  2CVR A;  2EYP A;  2F0H A;  3W3A A;  1M8A A;  1PTO B;  1GXD C;  1AZQ A;  3U9S A;  3T51 B;  5EKI A;  5T1G A;  5IGD A;  2F0I A;  2M00 A;  1STB A;  3LX0 A;  5E1F A;  5J22 A;  2E74 C;  2Z8L A;  3A8I E;  4K6L A;  4DK1 A;  3EQL C;  4TKO B;  1SYF A;  5KYI A;  5ELC A;  2F0O A;  2RDH A;  2F0U A;  5JEA J;  5CYU A;  4EGV A;  5JAV A;  1S5E D;  2R6G A;  1NCV A;  5I4D A;  1LT5 D;  1WCM B;  3TBI B;  2F0P A;  1QNU A;  1LTR D;  1C4Q A;  3TP6 A;  1SNP A;  3MVV A;  3DEP A;  1Q3L A;  1EY0 A;  1UAP A;  3I4L A;  4A3I B;  1MI2 A;  3SK8 A;  4JK1 C;  1LTS D;  1V43 A;  3V2T A;  1TY0 A;  1GHK A;  2KQ3 A;  2D2C C;  3RUZ A;  4HED A;  4ODG A;  3Q6S A;  1JB3 A;  1BOS A;  1GOZ A;  5C6A A;  2JEA I;  5DAU A;  5LL6 S;  1G2S A;  4XDX A;  1T5E A;  4LJZ C;  4OIK A;  2B2U C;  3RLF A;  1D5M C;  4IUQ A;  3URY A;  1TS2 A;  5M5X B;  1CI3 M;  1Z47 A;  1JIC A;  4IUP A;  2L1B A;  3MXN A;  1ENF A;  3QB3 A;  1T5X D;  3IFD A;  2PW7 A;  1ML0 D;  3I91 A;  2NVY B;  2XSC A;  1QG7 A;  1C8C A;  1PTO D;  4IFD I;  4XYO A;  2L9H A;  1X3Q A;  4A3G B;  3BDL A;  1TS3 A;  3PV0 A;  3WOF A;  1J8I A;  1JWM D;  3PUX A;  4NKL A;  1F9Q A;  4QCL A;  1R4Q B;  3KUP A;  4FXK C;  1XYI A;  2FMC A;  5FOB B;  2B2T A;  5CC4 A;  2PYK A;  5FO8 B;  5JVG 3;  2FIN B;  4LK1 C;  1F9R A;  3D3R A;  3D8G A;  1B50 A;  1H9M A;  2JYO A;  5A2Q L;  1AP0 A;  3HOZ B;  1QWY A;  3H3V C;  1TII D;  3OIQ A;  4H44 C;  3KBX A;  4RCO A;  3HOX B;  1D5X C;  4FF3 A;  4NP5 A;  4XT1 B;  4HSV A;  3V05 A;  1JOK A;  4ILW A;  2A6E C;  2QDB A;  1BF4 A;  4TSS A;  1Y8N B;  2EVB A;  1Y8O B;  1QOH A;  3A7A B;  3NTH A;  4PMB A;  3D4D A;  3S14 B;  1CZW A;  1PTO F;  1ROD A;  5C0X H;  4PNY A;  4Y7N B;  2IX0 A;  4H7B A;  1PXU A;  4IZ8 A;  3A55 A;  5M9O A;  1NR2 A;  3W2D A;  3HG9 A;  1KLU D;  3NBI A;  1Q1E A;  2BDN A;  2KEE A;  2BE5 C;  3DUZ A;  2B8F A;  4ZK9 B;  2A68 C;  4HR7 B;  4DK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...