4JYAQ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaQ00
2HIXA 3D0FA 5IYCG 3W1BA 2JA9A 2JJQA 1YBYA 2GVBA 3I55A 1QVCA 2ZTCA 4B3TQ 2AWNA 1L1OA 1WOCA 3HKZG 3J81j 2LXJA 2KENA 2UUBQ 2F4VL 1N36L 1ASYA 4GS3A 2R93G 4WJ3M 2A19A 4OWTB 1OXUA 5EAYA 4PG3A 2PQAA 5GAGC 3VDYA 1EQRA 4BBSG 1B7YB 1YI2A 1K3RA 4OX9L 4BA1I 3I4NG 4A4IA 4DR1Q 1B70B 1Y1WH 4LF4Q 1L0WA 1UE1A 3TS2A 1K8AC 1XPRA 2UU9Q 2A8VA 3I2ZA 4DR6L 4A3LH 2WP8J 2RF4A 2UXCL 2BA1A 4X66L 4AH6A 2ZTEA 1VQ8A 3S14H 4UP7A 4LF6Q 2YTVA 4JI7L 4DKAC 4LF8Q 1XNQL 1X54A 4YCWA 2DGYA 4MZ9A 1BVSA 2N3SA 3S24A 2ZJRA 3CCSA 2OTLA 3L2PA 4K0KL 1NTGA 3A0JA 3E0EA 4A3MG 1YHQA 1Q86C 2UUAQ 4A3IH 3KF6A 4P72A 2YYZA 1E7ZA 3CCMA 3KJOA 3F2BA 1KAWA 1XMOL 1FJGQ 2UXDL 1KXLA 2K52A 4JI2Q 1VQDA 4YY3Q 2BA0A 1DGSA 2K50A 1JE5A 1HZCA 2MFIA 4YHHL 3H3VI 2OQ0A 2V1CC 5FJ8H 2ZTDA 1SMXA 4A3FG 4ALPA 3CC7A 2UUCQ 5JJLA 1BKBA 1PYBA 2JA6G 1JJGA 4A93H 3J81i 1PHJA 4X64Q 2CKZB 2D0OA 1QVGA 1VQ7A 1HJPA 3GTGH 3CXCA 1VQAA 2VY3A 1HNWL 2NVQH 4BY7H 3W5OA 5M5YH 4JI8L 2GVAA 3MXNB 2ALYB 5C0XI 3T1YQ 4DAMA 4QGUA 1N34Q 4A76A 2RHQB 5IWAQ 4X62L 3ERSX 1S3OA 4GKKL 1O7IA 1VS0A 4DUZQ 1I3QH 4AIMA 2AWOA 4PZ6A 1N32Q 1X6OA 2I5LX 2CCZA 2D62A 3CPWA 1EOVA 4XTCS 2L15A 4NXNL 1VQEA 3UE1A 4DV4Q 5M3MG 4DR5L 3T1HQ 3AFPA 4A3KG 3FP9A 2WFWA 4JI6Q 3L0OA 3CMAA 3HOUG 4C2MH 4UP9A 4AYBG 1NBWA 1QZGA 4JYAL 1M1KC 3S17H 2OQKA 4R4IA 4GKJQ 3CAMA 4A3GG 2IHFA 3GTJH 5C0XJ 2Q2UA 3PF4A 3RNUA 4LF9L 2E2HH 5HY6A 4YCVA 3PUWA 4LUZA 2ZJPA 2CWPA 4DK6C 4LW1A 5C4XG 1EYGA 4GOPB 2YU9H 5JJIA 1T9HA 3AYHB 4DV6Q 4JI5L 4JV5L 2XGTA 4R1JA 3KOJA 4JCVE 3TS0A 4B3RL 2K14A 3I4MH 1Z9FA 3BJUA 4DUYQ 4YWLA 1GKHA 1PH7A 3S16H 2VUMH 1QVFA 3CP0A 1Y1WG 3PF5A 3K8AA 4A3BH 3PUYA 4A3LG 5JJKA 2F4VQ 1AE3A 1N36Q 1IBMQ 3DLLA 1NMGA 1VQCA 2R7FA 2Q2HA 1CKNA 4C3JH 5C44H 4LFBL 1SE8A 1IBLL 3GTPH 4OX9Q 3NEMA 3S2HH 5BR8Q 1IZ6A 1WFQA 4A3IG 1Q1EA 3CCQA 3UDFA 5ELOA 1XTDA 4X66Q 1VQGA 5IYBH 1K8GA 3PV0A 3CW2C 1PH1A 1XNQQ 5C0XG 3OTOL 1Z47A 1E24A 4NXML 1C0AA 4K0KQ 1OXSC 1CSQA 3FKIH 1NMFA 3HOYH 4A3DH 4OONA 1WYDA 4APVA 3ER0A 1TWFH 4A93G 1E22A 1GD7A 2KCTA 4DV1L 4B3SL 4BXXH 5FLXc 4HIDA 1PH8A 4DPGA 3GTLH 4UP8A 1TWAH 3CCJA 2UXDQ 4ME3A 1KC8C 4HIOA 1L1OB 4HIMA 3UE0A 1K9MC 3G4SA 1UE5A 1SFOH 1U5KA 4JI4L 4BY7G 1D7QA 4YHHQ 1SROA 2YTXA 3M4QA 3S1RH 1KD1C 2PQAB 2VS1A 4JI1Q 1HNZL 2R7ZH 2ID0A 1Y1VH 3EN2A 3PUVA 4GLVB 1EFWA 1MJEA 1D8LA 1GM5A 4P75A 4KHPL 4JOIC 5C4XH 1CKMA 2YTYA 2MNAA 3PIPA 2JA8H 2K5NA 2FXQA 4LFCQ 3L7ZC 1HNWQ 1SR3A 4JBKA 5LMNL 2N8NA 4DV5Q 3GO5A 2Z0SA 3H15A 5C3EH 2B29A 2CQOA 4L5TA 2Y0SG 3TREA 2K4KA 1PV4A 3KF6B 1V43A 2AKWB 1VQ9A 1HZAA 3B6YA 1EIFA 1G51A 4X62Q 4IPGA 2YV5A 1XPOA 2ES2A 4GKKQ 1LUZA 1WCMH 5IY0A 5IYDH 1EQQA 4POFA 4JI0Q 5IT9c 1VQNA 3JC66 1XPUA 2JE6I 4QIWE 1XMQL 2ZJQA 2HHHL 4LF7L 2PMZE 3STBD 2N78A 3AFQA 1KL9A 4LFAQ 1Q1BA 3W1GA 1VQ4A 2GN5A 4DR5Q 2VQEL 1X3FA 3A5ZB 2E5LL 4AQYL 3HOZH 4PZ8A 5DLQE 1JJ2A 1J6QA 1IBKQ 1Y14B 4MTNA 4OWXB 2ZM6L 3UDXA 4JYAQ 1HR0L 3FHWA 3I4MG 2QGQA 5AJ3L 2NVTH 4MNOA 3HKSA 2QEXA 2C35B 3I56A 3OW2A 4A3JH 3KDFA 1A62A 1I94L 4DV2L 1LYLA 3IRBA 3TEHB 3CCEA 3CCLA 1S40A 2CFMA 4R4QA 4A3BG 1N9WA 2OTJA 3K7AH 5GAEC 4DV3Q 1QZHA 1RIPA 3PCOB 4B3TL 3JAMc 3WWVA 3RLNA 4JI5Q 3F2CA 4JV5Q 2EQSA 5C44G 2Q2TA 4QQBX 4R4TA 1TWHH 3NELA 3KLWA 3OYYA 1TWGH 3UDIA 3M7NA 1YIJA 4HIKA 4DR1L 2Y0SE 1X3EA 5IP9H 1KRSA 1YNXA 2VQFL 4HJ8A 5IYBG 1BBUA 3S2DH 4GNXC 1VCIA 3KYHC 1RL2A 3K0XA 4LFBQ 3BZKA 1IBLQ 1VQMA 4LF8L 3GTMH 2JK8A 4JOIA 4KHZA 1IXRA 3RN5A 1IYJB 3FKIG 2CWAA 2AHOB 2BH2A 1YJNA 4BY1H 3HOYG 4A3DG 4O2DA 4P73A 4JI3Q 1WJJA 2K75A 4X65L 2UUAL 4BXXG 1X3GA 1N33L 4DR4Q 2PI2A 2JA5H 4BBRH 3OTOQ 1EIYB 2IX1A 4JI2L 4DR7L 3GDEA 3RR5A 4NXMQ 4EX5A 2HT1A 2NZOA 5LMUQ 3HFZB 1WI5A 2R7ZG 1X9NA 3HOWH 1Y1VG 1OXVA 3J80i 2UUCL 3F1ZA 4DV1Q 4A3MH 1VQOA 2I0QA 4B3SQ 2NN6I 3CCUA 3J7ZC 1HZ9A 1PYSB 5HGQA 4QY7A 1P8LA 1I50H 5GROA 3CC4A 4YWKA 2OWOA 4O0AA 5GQOA 2JA7H 2JA8G 5FLMH 1YHBA 3AQQA 5JEAJ 1AH9A 1HNXL 2WAQE 3PIOA 4LUVA 1HNZQ 2R92H 1FL0A 1CKNB 4LWCA 5C3EG 2KBNA 4KLKA 3CD6A 1VQ6A 1E1TA 1KRTA 3DM3A 4C3IH 1K0RA 4PMWA 1KQSA 4B3ML 4KHPQ 1YITA 3H0GH 1OTCA 1PH3A 1N34L 3M4PA 2UXCQ 1YJWA 1WCMG 4DR6Q 5IYDG 4DV0L 2H5XA 4DR3L 1VQIA 4Y52H 4A75A 2RCNA 4JI7Q 4GLAC 4A3CH 4IOAA 1EWIA 4DR2L 1M90C 5FJ8G 2I5MX 1UWVA 5C4JH 4JBMA 1B8AA 3RZOH 1TWCH 3BU2A 4DV4L 2DUDA 2BH8A 2PNHA 3Q8DA 1XMOQ 1IL2A 3I7FA 1QUQA 3E9IA 5E7NA 4JG2A 4HJAA 2NVXH 4LF7Q 4QL5A 4IJHA 4A3JG 1XNRL 4GKJL 3TRZA 1JB7A 4GNXA 3K80C 1NY4A 3S1MH 1KIXA 3ULJA 3CQZH 4DV7L 1YVCA 5JEAG 3GD7A 1MIUA 2E5LQ 3GTKH 3A5UA 2N49A 3U4VA 1S72A 2ZM6Q 4DK3C 3K81C 3KF8B 2JQOA 4TQUS 1J5EL 2E8GA 3K7UC 2KCMA 5AJ3Q 4LF5L 4OXPA 1I5FA 3AEVA 1JT8A 1I94Q 5M5WH 4DV2Q 3PO2H 2VNUD 4IFDI 2F52A 4DUYL 3KJPA 4R4OA 5LMNW 5IP9G 4JI8Q 1Q7YC 3PSIA 4IPHA 2JEAI 1YZ6A 1KHIA 4OO1I 5ELNA 1PA6A 2MQHA 1YEZA 2IT1A 2B63H 1IBML 4HJ9A 2NN6G 1MKHA 1HZBA 3BZCA 3G6EA 3PO3H 1V9PA 3PGZA 3EIVA 2R7DA 2VL6A 4BY1G 4LNQA 2UXBL 4GN4B 5BR8L 2VQFQ 2Q2IA 2E2JH 1LTLA 1A8VA 3G48A 4NXNQ 3H3VH 5IP7H 1UEBA 3D31A 4GN5A 4BBRG 2QA4A 2JA5G 3HOVH 4UPAA 3J81c 2KHJA 4YWMA 3RN2A 1VQPA 4IFDJ 4A3EH 4LUOA 3HOWG 3A74A 3M85A 1A63A 1OXXK 4GOPC 1HR0W 2AMCB 3KDFB 4X65Q 3CC2A 1V1QA 1I6HH 2JEBI 3RZDH 5M3FH 4LF9Q 1N33Q 3PUZA 2VUMG 3ZJYC 1VQLA 1SRUA 5H1SE 1X55A 2JA7G 1FGUA 5FLMG 1P16A 2A1AA 5IE8A 1N8RC 4DR7Q 4NPSA 2D0PA 5GADC 4GN3B 4JC0A 3EBEA 2E2IH 1W2BA 2KHIA 4YCUA 2UUBL 2R92G 1ASZA 3S1NH 4B3RQ 3HOXH 4JI1L 2WAQG 1VQBA 3CCRA 4DAYB 1EUJA 3U4ZA 5IYCH 1PH5A 3H0GG 3HKZE 4TVAB 1CSPA 4JBWA 5GAHC 3ULLA 4LF4L 1HNXQ 4LFCL 2UU9L 4GLXA 4IPDA 2IY5B 1VQKA 3CMEA 4C3HH 3NENA 3CF5A 4A3CG 2R93H 4DV5L 1PH9A 4LF6L 4UY8C 1LM0A 1VQ5A 4IJLA 4BBSH 1BBWA 1Q8KA 2I5HA 2Z6KC 4B3MQ 3S15H 1JJCB 5K36G 3U50C 2VW9A 3I4NH 2WB1G 2EXDA 4JBJA 4L5RC 4IFDG 4NB3A 1SN8A 4RG1A 3JAMi 3GTQH 4IPCA 2IHEA 2VZAA 1CKOA 4DV0Q 4FDBA 3I4OA 4DR3Q 2LSSA 3MEFA 1FJGL 4OWWB 2K5HA 2RHSB 4JI0L 1PH2A 4OO1G 3J7A5 4QJFA 2NVYH 4YY3L 4DR2Q 4KI0A 1R9TH 1VQHA 2PI2E 3J80c 1L1OC 1YHAA 4P71A 5J3BA 4EQ5A 4LFAL 4DNIA 1JMCA 3PUXA 2LXKA 4HJ7A 3TQYA 3CCVA 4RMFA 1IBKL 2B3GA 3S1QH 1FVIA 4X64L 1Q82C 1VQFA 4Y7NH 2F3IA 1XNRQ 4JI4Q 1E3PA 3PO2G 1PFSA 2ATWA 1C9OA 4X6AH 2HIVA 2MO1A 1W3SA 1NE3A 4DV7Q 3ICEA 4BA2I 1G6PA 4A3FH 3F8TA 4IO9A 3M4OH 1NJIC 4DV3L 2JA6H 1J5EQ 3LGJA 4J15A 4GOPA 3T1YL 3UDGA 2B63G 5M5XH 1H95A 4LF5Q 3SGIA 3PO3G 2NZHA 4L5SA 5IWAL 1Q46A 5LMNQ 4DUZL 1UE6A 3U58A 2IX0A 2OCEA 3RLFA 3G71A 1Q81C 1PH4A 1CUKA 2WB1E 3NBHB 1N32L 4H02A 3GTOH 5IP7G 1GVPA 4HJ5A 3STBC 4IOCA 3HOVG 1AE2A 3HOZG 1OXTA 2ASBA 4POGA 4P74A 3T1HL 2HQLA 1Q12A 1QUQB 1L2FA 1UE7A 1E1OA 4A3EG 1SLJA 1GO3E 4PZ7A 4JI6L 1X56A 2K5VA 2UXBQ 2MO0A 1K73C 1XMQQ 2HHHQ 4GNXB 1C7YA 2R6GA 5M3FG 3CPFA 1XJVA 2XTIA 4JI3L 1X65A 1YJ9A 2VQEQ 3RLOA 2EIFA 1G291 4DR4L 3F2DA 1A0IA 1MJCA 4AQYQ 1HH2P 3ULPA 5M3MH 2Z6KA 4AYBE 3M3YH 1PVOA 3E9HA 4WJ4A 4XIGS 1TXYA 3M9BA 4A3KH 3KFUA 1HR0Q 4DV6L 5LMUL 1PH6A 3HOXG 3HOUH 1VQJA 1K83H 4R4CA 1U0LA 4L5QA 4A3GH
chains in the Genus database with same CATH superfamily
2F0JA 1WOCA 4HTHA 2KENA 1XTCD 4WJ3M 4C3HG 1ASYA 2R93G 2A68D 1OXUA 3HOVB 4IALA 2PQAA 3VDYA 3HOZB 1B7YB 4HAEA 1YI2A 4EQPA 1Y1WH 1L0WA 1UE1A 1D5ZC 4CDCC 4LF4Q 2BDOA 2A8VA 4R8IA 2WP8J 1E2VA 5M3FB 2EY6A 2BA1A 4AH6A 3S14H 4UP7A 4RH6A 4JI7L 4V190 1X54A 2N3SA 3EVQA 2OTLA 4A3MG 1SXTA 3TZDA 2UUAQ 4A3IH 4P72A 5KNBA 1TKWB 2H4OA 3CCMA 3QOJA 4DAVA 2UXDL 1TWGB 2HD3A 1A15A 2K50A 4EGVA 1DXMA 1HZCA 2MFIA 2XRQD 1ICWA 2G9HD 3NTHA 4WFN3 1DM0B 1BKBA 2JA6G 1JJGA 4A93H 1EY9A 4BBSB 3SVMA 1JOOA 5EPKA 3CXCA 2NVQH 2D2CC 1SNDA 2D9UA 1SE2A 4FVMA 3TDQA 5C0XI 4KK7A 5KGUA 3H6MA 1LACA 1PTOD 3P75A 4C1NK 5IWAQ 2I07B 3ERSX 3SK4A 4GKKL 1I3QH 1TT2A 4IUNA 5IT9L 3K5MA 1N32Q 2D62A 3CPWA 5EKIA 3J7AV 4HSPA 4XTCS 4NXNL 3UE1A 1E2WA 5M3MG 3R2IA 4X3TA 4DR5L 3X3NA 2A6HD 1IL8A 3OMGA 2A69D 4J8QA 4AYBG 1NBWA 1QZGA 5BN3A 1M1KC 5M5XB 2JXMB 3CAMA 1K3BC 3GTJH 5BN5A 2NWGA 3RNUA 1LTSD 1A6XA 2ICEC 4YCVA 4ZUIA 5I9PA 4KV6A 3HP3A 1T9HA 5C3WA 4JI5L 4FF3A 4JV5L 1HTPA 5EQ0A 2K14A 3I4MH 1UAPA 3CRKC 1KLUD 1R4PB 4YWLA 1GKHA 1VMCA 3S16H 4PMCA 3CP0A 3PF5A 4A3BH 2A6ED 3PUYA 1V1PA 1CQVA 1IBMQ 1F2MA 2R7FA 4OX9Q 5BR8Q 1IZ6A 1K83B 1WTOA 2SEBD 2RKSA 1VQGA 1JOKA 3CW2C 5C0XG 5IGDA 3OTOL 5LHY1 2CW0D 1FR3A 4ZK9B 3RMHA 1CSQA 1NMFA 4APVA 1WYDA 3G6JB 1TWFH 4BXXH 1JB3A 3MHBA 1TWAH 4ME3A 1KC8C 1L1OB 3IAYA 1PDQA 4OO1H 2XIWA 1ZXTA 1KDAA 4BY7G 1J8IA 2YTXA 1KD1C 2B2VA 3PUVA 4FF2A 4GLVB 4QB4A 2MJ8A 3GV3A 1D8LA 3I3CA 4KHPL 5C4XH 5T1IA 2XRSD 3KF8A 4N8X1 2PO4A 3PIPA 2K5NA 2FXQA 4JK1C 2RDGA 3BG3A 1L0XB 1LT3D 3PQIA 2N8NA 4DV5Q 2Z0SA 3OHXC 3TREA 2RVLA 5DM73 1EIFA 2PMZB 1MBYA 1EQQA 4POFA 3IFDA 4DK0A 2KQ3A 4QIWE 2HHHL 2F0KA 3SK5A 1Q1BA 1DJRD 3K59A 1X3FA 3HOZH 4CJ2C 4PZ8A 1JJ2A 1Y8OB 1J6QA 2EJGC 1IBKQ 3S15B 5CR3A 3UDXA 4JYAQ 1EZ8A 4OEMB 4K5WA 5M9OA 1RTNA 1PFBA 2QEXA 2F0PA 3IRBA 3CCEA 3CCLA 2CFMA 4R4QA 2OTJA 5CC4A 3K7AH 4K8IA 3JAMc 1AZPA 4FXGC 2EQSA 4FF4A 2Y0SB 5C44G 1S5FD 3M7GA 1TWHH 4R4TA 1TWGH 3NBIA 1NR4A 4KY6A 2F3WA 3SDZA 3S17B 1KRSA 2B39A 3DMUA 4QUCA 2E2HB 3NTIA 5CMDA 2B2VC 2JK8A 2JYOA 3FKIG 3HOYG 2CWAA 4A3DG 2QDLA 4JI3Q 2UUAL 1X3GA 2ICIA 2PNRC 4NP5A 4N8FA 1EIYB 1BO0A 4DR7L 3GDEA 4U673 2HT1A 1GXDC 1Y1VG 5A2QL 2A68C 3DM1A 2LS01 3H3VC 2HQEA 2NN6I 1M4VA 1PYSB 2OWOA 4YWKA 1EWCA 1IYVA 1HNXL 3J7AF 2K28A 1CKNB 1LTAD 5EKKA 5C3EG 2KBNA 1E1TA 4ZAIA 5IODA 3VA7A 1KDBA 1KQSA 2EYLA 2A74C 4ZKCB 2UXCQ 3EJIA 4DR3L 1VQIA 1JORA 3GTLB 1EFID 1UEAB 4DR2L 1SFOB 1ZEQX 2XWJB 1ZKOA 4X3KA 1UWVA 3S1RB 3I4LA 5C4JH 3HG9A 4K2KA 3BU2A 1XMOQ 3Q8DA 4FXKC 1EZ6A 1HRJA 3MEHA 2JA8B 3TRZA 3MTSA 2PW7A 3CQZH 3ULJA 1K8OA 5JEAG 1CHPD 2L11A 2ZM6Q 4PMBA 3ND8A 1SYCA 5AJ3Q 2KCMA 4ZRZA 1G2SA 1PTOC 1JT8A 2WV6D 5M5WH 1I94Q 4IUVA 2K5QA 4CJ1B 1TS5A 3DEPA 1KHIA 2E74C 5JJZA 2MQHA 3V2TA 1IBML 1Z7TA 2NN6G 4HJ9A 2KA7A 3MC0B 1QG7A 2A6HC 4LNQA 2A69C 2UXBL 1B50A 5BR8L 5EBDA 1DCZA 2Q2IA 4A3JB 3G48A 1UEBA 1QWYA 2B2UA 3D31A 2QA4A 2JA5G 2KHJA 3A74A 1A63A 1OXXK 4GOPC 4X65Q 3CC2A 1V1QA 3RZDH 4ZUJA 3PUZA 1VQLA 4XT3B 2JA7G 2F0HA 5IE8A 2KEDA 4GN3B 2A6EC 2UUBL 2L12A 2KHIA 3LWEA 5CYUA 2R92G 3S1NH 2PZUA 3S2DB 2SNSA 2RSOA 1TVXA 1VQBA 2WAQG 5FO8B 2BCOA 3CCRA 3U4ZA 4XXEA 5IYCH 1PH5A 1LTGD 4BY1B 3U9OA 3L9AX 1VQKA 4A3CG 3NENA 4DV5L 4UY8C 5IGBA 1BBWA 1Q8KA 2Z6KC 1EY7A 2CW0C 2TSSA 4B3MQ 3S15H 3U50C 3HOWB 2FMMA 3JAMi 4RG1A 3FMCA 3GQBA 3H09A 2VUMB 3OWFA 3S1QB 1CA5A 4QJFA 3OW7A 4OELB 1R9TH 1VQHA 3J80c 1IYUA 1SJED 1YHAA 5J3BA 2ZXOA 4A3GH 3FPUB 3K6OA 4ZYSA 1CFMA 4U68A 3CCVA 1PXUA 4C3IB 1IBKL 2B3GA 1Q82C 1ENCA 1VQFA 4GZYC 1E3PA 2ATWA 1C9OA 2DNEA 3VA5A 1WD1A 4DV7Q 1ENAA 1G6PA 2B2UC 2EXZA 5I2YA 2EZVA 3UI2A 2G9DA 1SBBB 4LF5Q 3PO3G 3RZOB 2WB1B 4JW0A 4L5SA 2B2YC 3U58A 2OCEA 3RLFA 3G71A 3K0YA 2F0NA 4H02A 3GTOH 5IP7G 3S1MB 3J80L 1GUOA 1A2TA 1AE2A 4B08A 2HQLA 1Q12A 2OT2A 1L2FA 1SLJA 3CHBD 4JI6L 1X56A 2K33A 4QMGA 1I4QA 2EE1A 1I4XA 1LTRD 2R6GA 2XTIA 4JI3L 3PO2B 1CI3M 1O7ZA 1YJ9A 1Q8IA 1A0IA 4AQYQ 3ULPA 3M3YH 3E9HA 4XIGS 3KFUA 3HOUH 3HOXG 5KYIA 2B63B 3A55A 1HPCA 2L5TA 1KNEA 1EYDA 1MD2D 1EU4A 2JJQA 1YBYA 3V96A 4CDFC 2AWNA 1L1OA 5JPMC 4F8MA 3SE0A 1WTHA 4OWTB 2F0OA 1O78A 4OHJA 4PG3A 5GAGC 3R2TA 2EPBA 4A3EB 3I4NG 4A4IA 5CBAE 4RAUC 1B70B 4DR1Q 2NVTB 3TP5A 4A3LH 2UXCL 4X66L 1VQ8A 2ZTEA 1NUCA 4IURA 1XNQL 2YTVA 2FHTA 4ODGA 2DGYA 1SAPA 1H9MA 2E2IB 5KIXA 1NTGA 2PZTA 3A0JA 2IX3A 3OWEB 3KJOA 1XMOL 3A8JE 1KXLA 2B2WC 2K52A 3I72A 1JE5A 1NR2A 1IKLA 1RODA 4YHHL 3H3VI 2OQ0A 3H94A 5FJ8H 4A3FG 2UUCQ 4C3HB 5ELCA 4ALPA 2R93B 2WINB 1ICFB 3DXJC 1EWHA 4X64Q 2CKZB 1QVGA 2OXPA 2EJFC 5M5YH 2IL8A 2AUJD 4IQZA 2NVYB 1Z6HA 2NTTA 1KAAA 1PTOB 1DOMA 4DAMA 1N34Q 4DFAA 4A76A 4QCLA 1S3OA 4A3MB 1O7IA 4DUZQ 4RKBA 2K32A 2DNCA 2KHSA 1C4QA 2AWOA 3ITPA 2CCZA 1EOVA 2WIIB 1STEA 4DV4Q 3T1HQ 1G6ZA 3G7LA 4A3KG 2WFWA 2ZXRA 3L0OA 1HXYD 2JA6B 5LL6S 2OQKA 4R4IA 1BUVT 4Q5VA 4A3GG 2IHFA 2F0WA 5C0XJ 2Q2UA 4KJOA 3TP7A 4LUZA 1A3VA 1TU2B 2R61A 4LW1A 4DK6C 4GOPB 2YU9H 5JJIA 2X6GA 4DV6Q 4CKBA 1SE4A 3OMCA 2VUMH 1PZKD 1T5XD 1Y1WG 3D8GA 2F4VQ 1AE3A 1N36Q 1D6EC 1NMGA 1VQCA 4C3JH 1CKNA 5M3MB 4FP5D 4LFBL 2P5ZX 3GTPH 3S2HH 1SYBA 2EYOA 1WTQA 4AYBB 4A3IG 1GUWA 1CT1D 1FYCA 5KNCA 2FMCA 1GHJA 4K5XA 5IYBH 1K8GA 3PV0A 5J22A 1E24A 1LABA 4NXML 1C0AA 4K0KQ 1DOKA 3KBXA 3QWNA 4A93G 4DV1L 2KCTA 4B3SL 4HIDA 3HZXA 4HIOA 1PLFA 4UHVA 3G4SA 1UE5A 2E2JB 1U5KA 2R7ZH 4JI1Q 2ID0A 4G7OC 3E6ZX 5FK9C 3ONAB 1GM5A 4O42A 1HNWQ 1SR3A 4JBKA 1TQOA 3H15A 1AEXA 3RD4A 4G7HC 2CQOA 4L5TA 4KD4A 2K4KA 2TMPA 3KF6B 2QEJC 1VQ9A 2ES2A 4X62Q 4B9WA 2YV5A 1XPOA 2SOBA 3RUZA 1LUZA 1WCMH 5D3DA 3URYA 1NAPA 4C56C 5IT9c 2K04A 3CU7A 1F9RA 1XPUA 2ZJQA 1D1IA 1RTOA 3GTGB 1HUMA 1B9MA 3AFQA 4KKUA 1WVLA 4LFAQ 1VQ4A 4BY7B 2DN8A 2GN5A 1NCVA 2Q8IB 3I90A 2E5LL 4AQYL 5DLQE 1Y14B 2Z9HA 3DWAA 5JVG3 1QCBD 4CJ0B 3I4MG 2NVTH 4N9PA 3PIO3 4MNOA 2C35B 3OW2A 1HA6A 4A3BG 1N9WA 4HR7B 1QZHA 4RWSC 3PCOB 3WWVA 4TRDA 2Q2TA 4MN3A 5I4DA 3MVVA 3I8ZA 4C2MB 3BDOA 4CKEA 3AU7A 4DR1L 4IUQA 2C9OA 2VQFL 1AFPA 4HJ8A 1BBUA 3I91A 1VCIA 3KYHC 2WKCA 2EVBA 3BZKA 1IBLQ 3T13A 1VQMA 3W2DA 2D5DA 3HS0C 2AHOB 1RDPD 1WJJA 4BXXG 1A3UA 1SMYD 2K05A 2PI2A 4BBRH 1STHA 2IX1A 2PYKA 1XWEA 2NZOA 3HFZB 1WI5A 5AFWA 1JCKB 4LK1C 2UUCL 1MSGA 5C44B 3F1ZA 3VR2A 4A3MH 3NSWA 1CHQD 1VQOA 1HZ9A 3CC4A 5C4XG 4O0AA 2BDNA 5FLMH 1C48A 3HGBA 2EY2A 3AQQA 3N52A 5JEAJ 1AH9A 4LUVA 1EIHA 1HNZQ 1FL0A 4KLKA 2QF7A 5E4WC 3C46A 4I65A 4CDDC 1FGBD 5CV5A 3H0GH 3FKIB 1N34L 3M4PA 1XYIA 3HOYB 1D5MC 4DR6Q 4A3DB 3EQLC 4DV0L 2H5XA 1H9SB 1HFNA 2HDMA 4JPBW 3NXWA 1SYDA 4DV4L 2DUDA 4IFDH 1Y1VB 2BH8A 1JE4A 3JAME 4MTKA 5KYLA 5E7NA 4LF7Q 5DM63 4QL5A 3ND9A 1AN8A 4FNFA 4C1NI 1B3QA 1YVCA 5C3EB 5CV6A 2N49A 3U4VA 2RSNA 4DK3C 2JQOA 3T51B 3K7UC 3K57A 2F4IA 4OXPA 3VYUA 4CDEC 4DV2Q 2VNUD 3OIQA 4F88A 1RHPA 2EY5A 5IGEA 3KJPA 4JI8Q 3PSIA 4IPHA 1YZ6A 3BYTB 1PA6A 5HURA 2CH4A 1YEZA 1MKHA 3G6EA 3EIVA 2VL6A 1B1ZA 4GN4B 2F0MA 1HCZA 2E2JH 1NNXA 3HOVH 4UPAA 1EY5A 3CRLC 3J81c 5IGFA 2Z1CA 2BOSA 1WTXA 3C1EA 4MIUA 3M85A 1HR0W 3NP8A 2AMCB 4RKLA 3KDFB 5ELFA 5KRUA 3MFGA 5M3FH 4LF9Q 1N33Q 5H1SE 3A7LA 1FGUA 1N8RC 2VXWA 1PYWD 4YCUA 1W2BA 3KUPA 3BDCA 1Q3LA 2DJGC 4JI1L 3SR1A 1GOZA 1DOLA 3K58A 4KD3A 4IUUA 4JBWA 4LF4L 1PTOF 5FLXE 4IPDA 4QUFA 4NKLA 3A56A 3CMEA 3J81L 1WTVA 3OPOA 1KNAA 4BBSH 1U4MA 4JVZA 1YNND 2EXDA 3NK9A 3SXHA 4IPCA 1B53A 1CKOA 1LLRD 3I4OA 3MWYW 3MEFA 1ESFA 4KJNA 2K5HA 1FNVA 5CV4A 1PH2A 1I50B 2JA7B 2F0UA 4WORA 2K7VA 1G2TA 1E0BA 4LFAL 4DNIA 2R92B 3VR4A 1IHZA 3FDTA 4OGQC 3SHLA 2WAQB 4FXDA 4RMFA 1SEBD 3PMFA 1FVIA 5F2DA 1STAA 4F87A 1WTWA 1ENFA 3V05A 1XNRQ 2XN9C 4DAPA 4KN7C 2HIVA 4BA2I 3F8TA 1SJHD 3T56B 5LL6X 2O5IC 1J5EQ 4GOPA 5C4ZA 5M5XH 1EY6A 2NUCA 1TWCB 5IWAL 2NBFA 3A8KE 4OIKA 1RJTA 1VF7A 4OL7A 1Q81C 1LTTD 1PH4A 3QIAA 1N32L 1W6KA 1GVPA 5TSSA 1S5ED 4EQOA 2HCIA 2SDFA 3DWPA 1UUPA 4P74A 3GTKB 1QUQB 4ZQ3A 4PZ7A 5JAVA 1GUNA 3MA2B 3IKJA 3T53B 1XJVA 1X65A 5L37A 2EIFA 5HGTA 1HH2P 2Z6KA 4AYBE 1TXYA 1HR0Q 1I4RA 1PH6A 1K83H 4KN4C 3W3AA 1U0LA 4L5QA 1K0SA 3PO3B 2HIXA 3D0FA 3EFXD 5IYCG 2VB2X 2JA9A 3W1BA 5DEHA 1QVCA 2ZTCA 4B3TQ 3HKZG 3J81j 2LXJA 2L9HA 2MGSA 4GS3A 2A19A 5EAYA 2NTSA 4XT1B 1EQRA 1PFMA 4OX9L 4BA1I 5JPNC 5NUCA 2NB0A 1I6HB 2IJ0A 1XPRA 2UU9Q 4DR6L 1VMPA 2SNMA 1SMYC 4LF6Q 4DKAC 4LF8Q 4YCWA 4MZ9A 1BVSA 4CBVA 2K01A 2ZJRA 3L2PA 2B2YA 1Q86C 3HOXB 4CKCA 3KF6A 1E7ZA 3F2BA 1KAWA 4HCSA 1FJGQ 4ABNA 4YY3Q 3DHQA 1DGSA 4L6TB 4LMQD 1JWSD 2V1CC 2ZTDA 4P2CB 5JJLA 2ZT9C 3J81i 1PHJA 5CV7A 1ESRA 1G8ZD 1VQ7A 3I4NB 4HMIA 5FO9B 1O80A 1B3AA 1SE3A 1VQAA 2VY3A 1LT4D 1BOSA 3EA6A 5JEAH 1PMRA 4JI8L 3NE5B 3T1YQ 4QGUA 1HQRD 3FPPA 2RHQB 1VS0A 3SK8A 5C6AA 4TKOB 4AIMA 4PZ6A 4Y7NB 2A5HA 1X6OA 3U9SA 1LTID 4X3UA 2L15A 3S9WA 1VQEA 4B9XA 3A54A 4A3FB 2F3VA 2NN6H 3MZ5A 3CMAA 3HOUG 5DAUA 1B44D 2F0TA 4JYAL 2RDHA 2EYFA 3S17H 3PF4A 4PNYA 1SNMA 4LF9L 2E2HH 5HY6A 1RF2D 1FNUA 3T16A 1K8MA 3PIP3 2XGTA 1GUSA 3KOJA 4JCVE 3TS0A 3BJUA 1QB5D 1LV9A 2B2WA 1PH7A 4V0BA 2NVXB 2QKIC 4A3LG 5JJKA 5JVH3 4H13C 4KTAA 2J4XA 2O2LD 1H9RA 1CA6A 1MSHA 4RGNA 1SDFA 1QE6A 4A3KB 3AMUA 5FOBB 4Q0FA 1Q1EA 4RGTA 1CK1A 5ELOA 1XTDA 4A3GB 1D2BA 3R93A 4NMZA 4G4KA 1BCPB 3VR3A 1Z47A 3D4DA 1MHWC 1KLGD 2F0LA 3ER0A 1E22A 1GD7A 4RCOA 2UXDQ 3GTLH 1S5BD 4XQJA 4K14A 2K03A 4RHRA 1F2ZA 3UE0A 4DXGA 1Y1WB 5CGKA 3MAQA 1SFOH 1D7QA 2IW3A 1SROA 3S1RH 5COYA 3S14B 1LTBD 3EN2A 1EEFD 1EFWA 1MJEA 4P75A 4JOIC 1LO5D 1YNNC 3BVMA 3CKIB 4A3IB 3L7ZC 2JA8H 1BXTA 4F7XA 2B29A 1O7YA 5C5LA 1PV4A 1L0YB 1V43A 1HZAA 1G51A 4GKKQ 5IY0A 5IYDH 4A93B 4JI0Q 4ULLA 4H44C 1TR5A 2PMZE 3STBD 3VR5A 3VYTA 2NVQB 4DR5Q 1LT5D 2CHBD 2ZM6L 1HR0L 5AJ3L 3GTQB 4A3JH 5EJWA 3KDFA 1A62A 1JR0D 1I94L 1LYLA 3TEHB 5A35A 3C3LA 1UNSA 1RIPA 4B3TL 4L63B 2QCPX 3RLNA 4JI5Q 3F2CA 1HQMC 4N9TA 4JV5Q 3BDLA 4IN3A 4C3JG 3E3XA 3Q0AA 3NELA 1RD9D 1BR9A 2EYJA 2RA4A 3VYSA 1DZ1A 3M7NA 3L3OC 1YIJA 4DXFA 2Y0SE 1X3EA 2LKVA 5IP9H 1YNXA 1IKMA 3GTJB 5IYBG 3S2DH 4GNXC 1RL2A 4WRDA 2AQ1B 3M4OB 4LF8L 2AQ3B 1JOQA 4KHZA 1IYJB 2DJFC 3T4AC 2BH2A 4BY1H 4P73A 3QB3A 3I4MB 2WACA 4X65L 5BN4A 3D4WA 3S16B 4DR4Q 5EPLA 3OTOQ 3O13A 4A3BB 3RR5A 4EX5A 3E5SA 2R7ZG 1DYQA 2ZXPA 3HOWH 3J80i 2I0QA 1HTLD 4FF1A 3CCUA 4KKTA 1GUGA 1W6JA 5HGQA 4QY7A 1P8LA 5IGGA 3J7ZC 1JWMD 3GP7A 3S1QH 1YHBA 5IT9E 2WAQE 3VR6A 1VQ6A 1KRTA 2OEOA 3DM3A 3LX0A 4C3IH 4KHPQ 4B3ML 1YITA 3OOCA 5D65A 1FD7D 1YJWA 1WCMG 5IGCA 1RKNA 4Y52H 1F9SA 4A75A 1ILPA 1TWAB 2AUKA 4IOAA 4KY5A 1M90C 2PZWA 1BCPD 1ET6A 5K36H 2I5MX 2EYMA 4JBMA 1B8AA 3RZOH 2I46A 5E1FA 2HCCA 1F2LA 1Y69U 1IL2A 1QUQA 2HDLA 2J7ZA 4HJAA 1BBXC 4JG2A 2NVXH 5C4XB 1EEID 1JB7A 1BF4A 3K80C 1NY4A 3S1MH 2KJXA 4DV7L 4KMUC 2IPKD 3A5UA 1S72A 3K81C 3KK7A 2KCNA 2N55A 4LF5L 2F0IA 4J1MA 1GHKA 3AEVA 4KKSA 3PO2H 2KOLA 4IFDI 5LMNW 5J1ZA 3FVQA 1Q7YC 1EYCA 4EVOA 3IFTA 4OO1I 2EYHA 2B63H 1WTPA 1G91A 4XQNA 1I4GA 1V9PA 3PGZA 3MXGA 2LY7A 3N6RA 1U4PA 3H3VH 3BVZA 3MXPA 4GN5A 4RFBA 4BBRG 2PPBC 1BQQT 3HEJA 3K7AB 3BYYB 1VQPA 4A3EH 4LUOA 1B2TA 4DU9A 1T5EA 1KABA 2KVMA 2JEBI 1TWHB 4K2LA 4K6DA 5C3XA 2E75C 1C8CA 5FLMG 4ZKBB 1P16A 2A1AA 4XDXA 4DR7Q 2D0PA 1EYAA 1TS4A 5GADC 4JC0A 3EBEA 4H7BA 2WKDA 3K5NA 2E2IH 4B3RQ 1SSOA 4DAYB 1EUJA 3H0GG 5DNFA 3P1HA 5GAHC 1HNXQ 2IY5B 5D14A 2KECA 4C3HH 2R93H 4M1UB 4LJZC 1VQ5A 1HA5A 5EPJA 3D4RA 4L5RC 3A8IE 4IFDG 1SN8A 3R8BA 3GTQH 2IHEA 2VZAA 5EGTA 4DR3Q 4O1NA 2L4NA 1CZGA 2RQXA 2RHSB 4JI0L 4OO1G 2MPMA 1PRTD 1F9QA 1GUTA 2NVYH 4DR2Q 4KI0A 2K5DA 1PTOH 2PI2E 4K8JA 4EQ5A 4P71A 3WDNA 1JMCA 3PUXA 2LXKA 2K1BA 1EL0A 4HJ7A 2NZ1D 1YNJD 4X64L 3P7JA 2QILA 4JI4Q 1PFSA 4MHEA 1MGSA 4BS9A 4X6AH 2MO1A 1TY2A 1NE3A 1QNUA 1W3SA 2EYPA 4IO9A 3C1FA 1CZWA 3M4OH 2X6LA 1NJIC 2JA6H 3FEWX 3LGJA 4J15A 3UDGA 3J81E 5C4JB 3SGIA 1Q46A 1JWUD 2O4XA 3BZDB 5LMNQ 4DUZL 1UE6A 1EY8A 2IX0A 3MXUA 4Z9CB 4K5VA 5I2XA 2WB1E 3NBHB 4TSSA 1HFGA 2MUYA 4OIJA 3STBC 4HJ5A 4IOCA 3HOVG 3CQZB 3NUCA 3HOZG 1OXTA 3T1HL 1CTMA 1GO3E 1CM9A 1EIGA 2K5VA 4NDXA 2UXBQ 1K73C 1BCPF 3NTKA 4CHTB 5A2QE 1XMQQ 4BWGB 4GNXB 1R4QB 4EQNA 5M3FG 3CPFA 2M00A 5C5MA 1EQVA 3NHHA 5M5WB 1H9JA 2VQEQ 3RLOA 1G291 2EJMA 5ELDA 1MJCA 3F2DA 4DR4L 3R3OA 5CBEE 5M3MH 1PVOA 5J39A 4DV6L 1A2UA 1F2YA 4RGMA 4DN4M 2GVBA 3I55A 3J7YW 1WD0A 2UUBQ 2F4VL 2L0CA 1N36L 4J6HA 3AB9A 4BBSG 1K3RA 1MI2A 2JSOA 3KLRA 1SNCA 3TS2A 1K8AC 1V8QA 3I2ZA 3RZDB 1AP0A 2RF4A 2M2LA 3S24A 2N88A 3E0JA 3CCSA 4K0KL 3S1NB 1YHQA 3E0EA 1JC7A 2YYZA 2KCCA 2FJ2A 1SNQA 3ERQA 4I7AA 4JI2Q 2F1MA 1VQDA 2BA0A 5C0XH 2Z4HA 3HKZB 1SNOA 4ZLTF 2JP1A 1SMXA 2DY8A 3CC7A 1PYBA 1ONLA 2G5DA 4IUTA 3GTMB 1CQFA 1PFNA 1PZJD 3D3RA 2D0OA 2CVRA 1B9NA 1HJPA 3GTGH 1HNWL 1VF5C 4BY7H 3W5OA 1K28A 2F0EA 2JA5B 1J9OA 2VB3X 1QNKA 2GVAA 3MXNB 2ALYB 1H9KA 1R9TB 5E4XA 1BCPC 2BE5D 4X62L 3FRPB 2L55A 2F0SA 3QR8A 2I5LX 3Q6SA 5CV8A 3NWTA 2A73B 2NYZD 3QO2A 3LWUA 1D1KA 3AFPA 3FP9A 4JI6Q 1PRTF 1ML0D 4C2MH 4UP9A 1EOTA 4GKJQ 4E6IA 5EKLA 1Q90A 3PUWA 2ZJPA 1F9PA 2CWPA 1EYGA 3GTOB 3AYHB 5ISRA 3JAML 2OF1A 4R1JA 1IW7D 5K5PA 4M8AA 4B3RL 1XX8A 3BS1A 1Z9FA 4YIJA 2QW7A 4DUYQ 1QVFA 3SK6A 1ZYRD 3K8AA 1SYFA 3D6WA 3TZUA 3DLLA 3NPPA 3IL8A 2Q2HA 5C44H 3M3YB 1SE8A 4X3SA 1IBLL 3NEMA 3HOUB 1U4LA 1WFQA 2PCFB 3CCQA 3UDFA 1EY0A 5JOBA 3H91A 2LFNA 4X66Q 1PH1A 1XNQQ 3Q23A 2X69A 2PW5A 1OXSC 3NQIA 2CQAA 3FKIH 3HOYH 1STNA 4A3DH 4OONA 4ILWA 4HSVA 3X3MA 5FLXc 1PH8A 2AQ2B 1JICA 4UP8A 4DPGA 3CCJA 4DK1A 4HIMA 4DNRB 1K9MC 4LAAA 4JI4L 1A3TA 4YHHQ 3M4QA 2PQAB 2VS1A 1HNZL 4FO2A 1RCVD 1Y1VH 3J80E 2Z8LA 1CKMA 2YTYA 2MNAA 1DONA 1QILA 4LFCQ 2RDFA 5LMNL 1FNWA 2L1BA 2XWBB 1I6VC 2DY7A 3GO5A 1WTRA 2F0GA 5C3EH 1LT6D 1PRTC 1QJOA 2Y0SG 1E2ZA 2AKWB 1EU3A 3B6YA 1TS2A 4ME5A 4UAIA 4IPGA 4HMJA 5KEEA 5FLXL 1YNJC 1VQNA 1AW7A 3JC66 5KNDA 2JE6I 1XMQL 4LF7L 4KHVA 2N78A 1KL9A 5T1GA 3W1GA 2XVSA 5M5YB 2VQEL 2MP1A 3A5ZB 4MTNA 3F2UA 4OWXB 3FHWA 2QGQA 2R3ZA 3HKSA 1M8AA 3I56A 3I70A 4DV2L 1JQYD 2KUMA 2B8GA 1S40A 3K5LA 2FFKB 3EROA 1S5DD 4I7ZC 5GAEC 4DV3Q 2EDGA 4PV1C 4RA8A 4DGZA 1F77A 3NQTA 1D5XC 4K6LA 4QQBX 3KLWA 2B8FA 3OYYA 3UDIA 4DAYA 1U4RA 4HIKA 1EY4A 2HUGA 1V1OA 4FYDA 5FO7B 4XYQA 5G3LD 3K0XA 4LFBQ 3GTMH 2B2TA 4JOIA 2YU9B 3OIPA 1IXRA 1PZID 3KLSX 3RN5A 1YJNA 4O2DA 5D3IB 2K75A 4QF4A 1N33L 2J0TD 2Z6BA 3QJYA 3TSSA 2JA5H 4JI2L 1S4ZA 2F0VA 4NXMQ 1BDOA 5I6WA 5LMUQ 2QDBA 1HUNA 1X9NA 1OXVA 3A7AB 4C3JB 4DV1Q 4B3SQ 3GTPB 3S2HB 1I4PA 1I50H 5GROA 2JA8G 5GQOA 2JA7H 1V1PB 3D6CA 1HHVA 2F0DA 3DUZA 2IWHA 4XYOA 3PIOA 2GA4B 2R92H 3M4YA 4LWCA 3CD6A 4HN7A 3VYRA 3LNNA 3TN2A 1ILQA 2F0QA 1SYGA 4ID6A 1K0RA 4PMWA 5FKAC 4RCNA 2ENBA 1OTCA 1PH3A 3TBIB 5IYDG 4HEDA 2RCNA 2E2DC 1H9SA 4JI7Q 2JN4A 2V4DA 4GLAC 4A3CH 1KTKA 1EWIA 2K5WA 1GJXA 5FJ8G 3NBHA 2O5JC 2R7ZB 4KY7A 1TWCH 2PNHA 3I7FA 2LMCB 1X3PA 3E9IA 2EOTA 4IJHA 4A3JG 2RCFA 1XNRL 4GKJL 1QOHA 4GNXA 3GV6A 4XQQA 1KIXA 5I9OA 3GD7A 1MIUA 2E5LQ 3GTKH 3TP6A 1STYA 1BNZA 1Y8NB 3KF8B 1J5EL 2B2TC 4TQUS 1TY0A 3HRZC 2E8GA 2BE5C 1I5FA 2XSCA 2C5CA 1WCMB 5C4HA 2F52A 4DUYL 2Z4IA 4R4OA 5IP9G 2JEAI 5ELNA 2IT1A 4QIWB 4H0LC 1HZBA 2XNAC 3BZCA 3PO3H 4PQXA 2R7DA 4BY1G 1DD2A 3MFYA 4RHSA 2VQFQ 1LTLA 1A8VA 4R9WA 4L8JA 4NXNQ 5IP7H 4G57A 2RBMA 1STGA 1ET9A 4UDUC 1STBA 4YWMA 3RN2A 4IFDJ 1II3A 3HOWG 1U9RA 5IOCA 3BVGA 1IW7C 5CV9A 3DEOA 1I6HH 4RGOS 2VUMG 4IUPA 1B4OA 1I3QB 4IZ8A 3NWSA 3ZJYC 1SRUA 1X55A 2Q8TA 1TS3A 4NPSA 3OSOA 1ZYRC 4DF7A 5EBCA 1ASZA 3KBGA 4NW2A 3HOXH 2E76C 1NSNS 3ZYYX 4C3IG 2F0FA 3HKZE 3KLSA 4TVAB 2F03A 1CSPA 4WJWA 3ULLA 3C2PA 2K6AA 4LFCL 2UU9L 4GLXA 2EY1A 2H1EA 3CF5A 4BBRB 1PH9A 4LF6L 1LM0A 4IJLA 5K36G 2I5HA 3TMEA 3QOLA 1JJCB 3MXNA 2VW9A 3I4NH 2WB1G 4JBJA 4NB3A 3DWQA 5I6YA 1X3QA 5G3LF 4DV0Q 5ELBA 4FDBA 2LSSA 1FJGL 1PRTB 4OWWB 3P20A 1S5CD 3J7A5 3I73A 4YY3L 2FINB 1L1OC 3WOEA 4R8NA 4S3SA 4ZCKA 2M9VA 3TQYA 3Q24A 4HCEA 3WOFA 1EQTA 4Y7NH 2F3IA 3H0GB 2MHVA 3PO2G 1O7LA 4G7ZC 3ICEA 4A3FH 5CORA 4DV3L 2B63G 3T1YL 1H95A 3K5OA 2NZHA 1I4HA 1TWFB 5E3FA 1SNPA 1X32A 3SEBA 1CUKA 1SYEA 1KDCA 3QG1A 1XXGA 4CGYB 1VDZA 2CH4W 2ASBA 4POGA 5IIFA 5ELEA 1UE7A 3TP8A 1E1OA 4A3EG 1Y8PB 2MO0A 2HHHQ 2PQEA 1C7YA 1TIID 4DNTB 2KEEA 4WJ4A 4A3KH 3M9BA 5LMUL 1OO9B 1VQJA 4R4CA 2Q8RE 3Q22A 1AZQA 4DA2A
chains in the Genus database with same CATH topology
2HIXA 3D0FA 5IYCG 3W1BA 2JA9A 2JJQA 1YBYA 2GVBA 3I55A 1QVCA 2ZTCA 4B3TQ 2AWNA 1L1OA 1WOCA 3HKZG 3J81j 2LXJA 2KENA 2UUBQ 2F4VL 1N36L 1ASYA 4GS3A 2R93G 4WJ3M 2A19A 4OWTB 1OXUA 5EAYA 4PG3A 2PQAA 5GAGC 3VDYA 1EQRA 4BBSG 1B7YB 1YI2A 1K3RA 4OX9L 4BA1I 3I4NG 4A4IA 4DR1Q 1B70B 1Y1WH 4LF4Q 1L0WA 1UE1A 3TS2A 1K8AC 1XPRA 2UU9Q 2A8VA 3I2ZA 4DR6L 4A3LH 2WP8J 2RF4A 2UXCL 2BA1A 4X66L 4AH6A 2ZTEA 1VQ8A 3S14H 4UP7A 4LF6Q 2YTVA 4JI7L 4DKAC 4LF8Q 1XNQL 1X54A 4YCWA 2DGYA 4MZ9A 1BVSA 2N3SA 3S24A 2ZJRA 3CCSA 2OTLA 3L2PA 4K0KL 1NTGA 3A0JA 3E0EA 4A3MG 1YHQA 1Q86C 2UUAQ 4A3IH 3KF6A 4P72A 2YYZA 1E7ZA 3CCMA 3KJOA 3F2BA 1KAWA 1XMOL 1FJGQ 2UXDL 1KXLA 2K52A 4JI2Q 1VQDA 4YY3Q 2BA0A 1DGSA 2K50A 1JE5A 1HZCA 2MFIA 4YHHL 3H3VI 2OQ0A 2V1CC 5FJ8H 2ZTDA 1SMXA 4A3FG 4ALPA 3CC7A 2UUCQ 5JJLA 1BKBA 1PYBA 2JA6G 1JJGA 4A93H 3J81i 1PHJA 4X64Q 2CKZB 2D0OA 1QVGA 1VQ7A 1HJPA 3GTGH 3CXCA 1VQAA 2VY3A 1HNWL 2NVQH 4BY7H 3W5OA 5M5YH 4JI8L 2GVAA 3MXNB 2ALYB 5C0XI 3T1YQ 4DAMA 4QGUA 1N34Q 4A76A 2RHQB 5IWAQ 4X62L 3ERSX 1S3OA 4GKKL 1O7IA 1VS0A 4DUZQ 1I3QH 4AIMA 2AWOA 4PZ6A 1N32Q 1X6OA 2I5LX 2CCZA 2D62A 3CPWA 1EOVA 4XTCS 2L15A 4NXNL 1VQEA 3UE1A 4DV4Q 5M3MG 4DR5L 3T1HQ 3AFPA 4A3KG 3FP9A 2WFWA 4JI6Q 3L0OA 3CMAA 3HOUG 4C2MH 4UP9A 4AYBG 1NBWA 1QZGA 4JYAL 1M1KC 3S17H 2OQKA 4R4IA 4GKJQ 3CAMA 4A3GG 2IHFA 3GTJH 5C0XJ 2Q2UA 3PF4A 3RNUA 4LF9L 2E2HH 5HY6A 4YCVA 3PUWA 4LUZA 2ZJPA 2CWPA 4DK6C 4LW1A 5C4XG 1EYGA 4GOPB 2YU9H 5JJIA 1T9HA 3AYHB 4DV6Q 4JI5L 4JV5L 2XGTA 4R1JA 3KOJA 4JCVE 3TS0A 4B3RL 2K14A 3I4MH 1Z9FA 3BJUA 4DUYQ 4YWLA 1GKHA 1PH7A 3S16H 2VUMH 1QVFA 3CP0A 1Y1WG 3PF5A 3K8AA 4A3BH 3PUYA 4A3LG 5JJKA 2F4VQ 1AE3A 1N36Q 1IBMQ 3DLLA 1NMGA 1VQCA 2R7FA 2Q2HA 1CKNA 4C3JH 5C44H 4LFBL 1SE8A 1IBLL 3GTPH 4OX9Q 3NEMA 3S2HH 5BR8Q 1IZ6A 1WFQA 4A3IG 1Q1EA 3CCQA 3UDFA 5ELOA 1XTDA 4X66Q 1VQGA 5IYBH 1K8GA 3PV0A 3CW2C 1PH1A 1XNQQ 5C0XG 3OTOL 1Z47A 1E24A 4NXML 1C0AA 4K0KQ 1OXSC 1CSQA 3FKIH 1NMFA 3HOYH 4A3DH 4OONA 1WYDA 4APVA 3ER0A 1TWFH 4A93G 1E22A 1GD7A 2KCTA 4DV1L 4B3SL 4BXXH 5FLXc 4HIDA 1PH8A 4DPGA 3GTLH 4UP8A 1TWAH 3CCJA 2UXDQ 4ME3A 1KC8C 4HIOA 1L1OB 4HIMA 3UE0A 1K9MC 3G4SA 1UE5A 1SFOH 1U5KA 4JI4L 4BY7G 1D7QA 4YHHQ 1SROA 2YTXA 3M4QA 3S1RH 1KD1C 2PQAB 2VS1A 4JI1Q 1HNZL 2R7ZH 2ID0A 1Y1VH 3EN2A 3PUVA 4GLVB 1EFWA 1MJEA 1D8LA 1GM5A 4P75A 4KHPL 4JOIC 5C4XH 1CKMA 2YTYA 2MNAA 3PIPA 2JA8H 2K5NA 2FXQA 4LFCQ 3L7ZC 1HNWQ 1SR3A 4JBKA 5LMNL 2N8NA 4DV5Q 3GO5A 2Z0SA 3H15A 5C3EH 2B29A 2CQOA 4L5TA 2Y0SG 3TREA 2K4KA 1PV4A 3KF6B 1V43A 2AKWB 1VQ9A 1HZAA 3B6YA 1EIFA 1G51A 4X62Q 4IPGA 2YV5A 1XPOA 2ES2A 4GKKQ 1LUZA 1WCMH 5IY0A 5IYDH 1EQQA 4POFA 4JI0Q 5IT9c 1VQNA 3JC66 1XPUA 2JE6I 4QIWE 1XMQL 2ZJQA 2HHHL 4LF7L 2PMZE 3STBD 2N78A 3AFQA 1KL9A 4LFAQ 1Q1BA 3W1GA 1VQ4A 2GN5A 4DR5Q 2VQEL 1X3FA 3A5ZB 2E5LL 4AQYL 3HOZH 4PZ8A 5DLQE 1JJ2A 1J6QA 1IBKQ 1Y14B 4MTNA 4OWXB 2ZM6L 3UDXA 4JYAQ 1HR0L 3FHWA 3I4MG 2QGQA 5AJ3L 2NVTH 4MNOA 3HKSA 2QEXA 2C35B 3I56A 3OW2A 4A3JH 3KDFA 1A62A 1I94L 4DV2L 1LYLA 3IRBA 3TEHB 3CCEA 3CCLA 1S40A 2CFMA 4R4QA 4A3BG 1N9WA 2OTJA 3K7AH 5GAEC 4DV3Q 1QZHA 1RIPA 3PCOB 4B3TL 3JAMc 3WWVA 3RLNA 4JI5Q 3F2CA 4JV5Q 2EQSA 5C44G 2Q2TA 4QQBX 4R4TA 1TWHH 3NELA 3KLWA 3OYYA 1TWGH 3UDIA 3M7NA 1YIJA 4HIKA 4DR1L 2Y0SE 1X3EA 5IP9H 1KRSA 1YNXA 2VQFL 4HJ8A 5IYBG 1BBUA 3S2DH 4GNXC 1VCIA 3KYHC 1RL2A 3K0XA 4LFBQ 3BZKA 1IBLQ 1VQMA 4LF8L 3GTMH 2JK8A 4JOIA 4KHZA 1IXRA 3RN5A 1IYJB 3FKIG 2CWAA 2AHOB 2BH2A 1YJNA 4BY1H 3HOYG 4A3DG 4O2DA 4P73A 4JI3Q 1WJJA 2K75A 4X65L 2UUAL 4BXXG 1X3GA 1N33L 4DR4Q 2PI2A 2JA5H 4BBRH 3OTOQ 1EIYB 2IX1A 4JI2L 4DR7L 3GDEA 3RR5A 4NXMQ 4EX5A 2HT1A 2NZOA 5LMUQ 3HFZB 1WI5A 2R7ZG 1X9NA 3HOWH 1Y1VG 1OXVA 3J80i 2UUCL 3F1ZA 4DV1Q 4A3MH 1VQOA 2I0QA 4B3SQ 2NN6I 3CCUA 3J7ZC 1HZ9A 1PYSB 5HGQA 4QY7A 1P8LA 1I50H 5GROA 3CC4A 4YWKA 2OWOA 4O0AA 5GQOA 2JA7H 2JA8G 5FLMH 1YHBA 3AQQA 5JEAJ 1AH9A 1HNXL 2WAQE 3PIOA 4LUVA 1HNZQ 2R92H 1FL0A 1CKNB 4LWCA 5C3EG 2KBNA 4KLKA 3CD6A 1VQ6A 1E1TA 1KRTA 3DM3A 4C3IH 1K0RA 4PMWA 1KQSA 4B3ML 4KHPQ 1YITA 3H0GH 1OTCA 1PH3A 1N34L 3M4PA 2UXCQ 1YJWA 1WCMG 4DR6Q 5IYDG 4DV0L 2H5XA 4DR3L 1VQIA 4Y52H 4A75A 2RCNA 4JI7Q 4GLAC 4A3CH 4IOAA 1EWIA 4DR2L 1M90C 5FJ8G 2I5MX 1UWVA 5C4JH 4JBMA 1B8AA 3RZOH 1TWCH 3BU2A 4DV4L 2DUDA 2BH8A 2PNHA 3Q8DA 1XMOQ 1IL2A 3I7FA 1QUQA 3E9IA 5E7NA 4JG2A 4HJAA 2NVXH 4LF7Q 4QL5A 4IJHA 4A3JG 1XNRL 4GKJL 3TRZA 1JB7A 4GNXA 3K80C 1NY4A 3S1MH 1KIXA 3ULJA 3CQZH 4DV7L 1YVCA 5JEAG 3GD7A 1MIUA 2E5LQ 3GTKH 3A5UA 2N49A 3U4VA 1S72A 2ZM6Q 4DK3C 3K81C 3KF8B 2JQOA 4TQUS 1J5EL 2E8GA 3K7UC 2KCMA 5AJ3Q 4LF5L 4OXPA 1I5FA 3AEVA 1JT8A 1I94Q 5M5WH 4DV2Q 3PO2H 2VNUD 4IFDI 2F52A 4DUYL 3KJPA 4R4OA 5LMNW 5IP9G 4JI8Q 1Q7YC 3PSIA 4IPHA 2JEAI 1YZ6A 1KHIA 4OO1I 5ELNA 1PA6A 2MQHA 1YEZA 2IT1A 2B63H 1IBML 4HJ9A 2NN6G 1MKHA 1HZBA 3BZCA 3G6EA 3PO3H 1V9PA 3PGZA 3EIVA 2R7DA 2VL6A 4BY1G 4LNQA 2UXBL 4GN4B 5BR8L 2VQFQ 2Q2IA 2E2JH 1LTLA 1A8VA 3G48A 4NXNQ 3H3VH 5IP7H 1UEBA 3D31A 4GN5A 4BBRG 2QA4A 2JA5G 3HOVH 4UPAA 3J81c 2KHJA 4YWMA 3RN2A 1VQPA 4IFDJ 4A3EH 4LUOA 3HOWG 3A74A 3M85A 1A63A 1OXXK 4GOPC 1HR0W 2AMCB 3KDFB 4X65Q 3CC2A 1V1QA 1I6HH 2JEBI 3RZDH 5M3FH 4LF9Q 1N33Q 3PUZA 2VUMG 3ZJYC 1VQLA 1SRUA 5H1SE 1X55A 2JA7G 1FGUA 5FLMG 1P16A 2A1AA 5IE8A 1N8RC 4DR7Q 4NPSA 2D0PA 5GADC 4GN3B 4JC0A 3EBEA 2E2IH 1W2BA 2KHIA 4YCUA 2UUBL 2R92G 1ASZA 3S1NH 4B3RQ 3HOXH 4JI1L 2WAQG 1VQBA 3CCRA 4DAYB 1EUJA 3U4ZA 5IYCH 1PH5A 3H0GG 3HKZE 4TVAB 1CSPA 4JBWA 5GAHC 3ULLA 4LF4L 1HNXQ 4LFCL 2UU9L 4GLXA 4IPDA 2IY5B 1VQKA 3CMEA 4C3HH 3NENA 3CF5A 4A3CG 2R93H 4DV5L 1PH9A 4LF6L 4UY8C 1LM0A 1VQ5A 4IJLA 4BBSH 1BBWA 1Q8KA 2I5HA 2Z6KC 4B3MQ 3S15H 1JJCB 5K36G 3U50C 2VW9A 3I4NH 2WB1G 2EXDA 4JBJA 4L5RC 4IFDG 4NB3A 1SN8A 4RG1A 3JAMi 3GTQH 4IPCA 2IHEA 2VZAA 1CKOA 4DV0Q 4FDBA 3I4OA 4DR3Q 2LSSA 3MEFA 1FJGL 4OWWB 2K5HA 2RHSB 4JI0L 1PH2A 4OO1G 3J7A5 4QJFA 2NVYH 4YY3L 4DR2Q 4KI0A 1R9TH 1VQHA 2PI2E 3J80c 1L1OC 1YHAA 4P71A 5J3BA 4EQ5A 4LFAL 4DNIA 1JMCA 3PUXA 2LXKA 4HJ7A 3TQYA 3CCVA 4RMFA 1IBKL 2B3GA 3S1QH 1FVIA 4X64L 1Q82C 1VQFA 4Y7NH 2F3IA 1XNRQ 4JI4Q 1E3PA 3PO2G 1PFSA 2ATWA 1C9OA 4X6AH 2HIVA 2MO1A 1W3SA 1NE3A 4DV7Q 3ICEA 4BA2I 1G6PA 4A3FH 3F8TA 4IO9A 3M4OH 1NJIC 4DV3L 2JA6H 1J5EQ 3LGJA 4J15A 4GOPA 3T1YL 3UDGA 2B63G 5M5XH 1H95A 4LF5Q 3SGIA 3PO3G 2NZHA 4L5SA 5IWAL 1Q46A 5LMNQ 4DUZL 1UE6A 3U58A 2IX0A 2OCEA 3RLFA 3G71A 1Q81C 1PH4A 1CUKA 2WB1E 3NBHB 1N32L 4H02A 3GTOH 5IP7G 1GVPA 4HJ5A 3STBC 4IOCA 3HOVG 1AE2A 3HOZG 1OXTA 2ASBA 4POGA 4P74A 3T1HL 2HQLA 1Q12A 1QUQB 1L2FA 1UE7A 1E1OA 4A3EG 1SLJA 1GO3E 4PZ7A 4JI6L 1X56A 2K5VA 2UXBQ 2MO0A 1K73C 1XMQQ 2HHHQ 4GNXB 1C7YA 2R6GA 5M3FG 3CPFA 1XJVA 2XTIA 4JI3L 1X65A 1YJ9A 2VQEQ 3RLOA 2EIFA 1G291 4DR4L 3F2DA 1A0IA 1MJCA 4AQYQ 1HH2P 3ULPA 5M3MH 2Z6KA 4AYBE 3M3YH 1PVOA 3E9HA 4WJ4A 4XIGS 1TXYA 3M9BA 4A3KH 3KFUA 1HR0Q 4DV6L 5LMUL 1PH6A 3HOXG 3HOUH 1VQJA 1K83H 4R4CA 1U0LA 4L5QA 4A3GH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HIX A;  3D0F A;  5IYC G;  3W1B A;  2JA9 A;  2JJQ A;  1YBY A;  2GVB A;  3I55 A;  1QVC A;  2ZTC A;  4B3T Q;  2AWN A;  1L1O A;  1WOC A;  3HKZ G;  3J81 j;  2LXJ A;  2KEN A;  2UUB Q;  2F4V L;  1N36 L;  1ASY A;  4GS3 A;  2R93 G;  4WJ3 M;  2A19 A;  4OWT B;  1OXU A;  5EAY A;  4PG3 A;  2PQA A;  5GAG C;  3VDY A;  1EQR A;  4BBS G;  1B7Y B;  1YI2 A;  1K3R A;  4OX9 L;  4BA1 I;  3I4N G;  4A4I A;  4DR1 Q;  1B70 B;  1Y1W H;  4LF4 Q;  1L0W A;  1UE1 A;  3TS2 A;  1K8A C;  1XPR A;  2UU9 Q;  2A8V A;  3I2Z A;  4DR6 L;  4A3L H;  2WP8 J;  2RF4 A;  2UXC L;  2BA1 A;  4X66 L;  4AH6 A;  2ZTE A;  1VQ8 A;  3S14 H;  4UP7 A;  4LF6 Q;  2YTV A;  4JI7 L;  4DKA C;  4LF8 Q;  1XNQ L;  1X54 A;  4YCW A;  2DGY A;  4MZ9 A;  1BVS A;  2N3S A;  3S24 A;  2ZJR A;  3CCS A;  2OTL A;  3L2P A;  4K0K L;  1NTG A;  3A0J A;  3E0E A;  4A3M G;  1YHQ A;  1Q86 C;  2UUA Q;  4A3I H;  3KF6 A;  4P72 A;  2YYZ A;  1E7Z A;  3CCM A;  3KJO A;  3F2B A;  1KAW A;  1XMO L;  1FJG Q;  2UXD L;  1KXL A;  2K52 A;  4JI2 Q;  1VQD A;  4YY3 Q;  2BA0 A;  1DGS A;  2K50 A;  1JE5 A;  1HZC A;  2MFI A;  4YHH L;  3H3V I;  2OQ0 A;  2V1C C;  5FJ8 H;  2ZTD A;  1SMX A;  4A3F G;  4ALP A;  3CC7 A;  2UUC Q;  5JJL A;  1BKB A;  1PYB A;  2JA6 G;  1JJG A;  4A93 H;  3J81 i;  1PHJ A;  4X64 Q;  2CKZ B;  2D0O A;  1QVG A;  1VQ7 A;  1HJP A;  3GTG H;  3CXC A;  1VQA A;  2VY3 A;  1HNW L;  2NVQ H;  4BY7 H;  3W5O A;  5M5Y H;  4JI8 L;  2GVA A;  3MXN B;  2ALY B;  5C0X I;  3T1Y Q;  4DAM A;  4QGU A;  1N34 Q;  4A76 A;  2RHQ B;  5IWA Q;  4X62 L;  3ERS X;  1S3O A;  4GKK L;  1O7I A;  1VS0 A;  4DUZ Q;  1I3Q H;  4AIM A;  2AWO A;  4PZ6 A;  1N32 Q;  1X6O A;  2I5L X;  2CCZ A;  2D62 A;  3CPW A;  1EOV A;  4XTC S;  2L15 A;  4NXN L;  1VQE A;  3UE1 A;  4DV4 Q;  5M3M G;  4DR5 L;  3T1H Q;  3AFP A;  4A3K G;  3FP9 A;  2WFW A;  4JI6 Q;  3L0O A;  3CMA A;  3HOU G;  4C2M H;  4UP9 A;  4AYB G;  1NBW A;  1QZG A;  4JYA L;  1M1K C;  3S17 H;  2OQK A;  4R4I A;  4GKJ Q;  3CAM A;  4A3G G;  2IHF A;  3GTJ H;  5C0X J;  2Q2U A;  3PF4 A;  3RNU A;  4LF9 L;  2E2H H;  5HY6 A;  4YCV A;  3PUW A;  4LUZ A;  2ZJP A;  2CWP A;  4DK6 C;  4LW1 A;  5C4X G;  1EYG A;  4GOP B;  2YU9 H;  5JJI A;  1T9H A;  3AYH B;  4DV6 Q;  4JI5 L;  4JV5 L;  2XGT A;  4R1J A;  3KOJ A;  4JCV E;  3TS0 A;  4B3R L;  2K14 A;  3I4M H;  1Z9F A;  3BJU A;  4DUY Q;  4YWL A;  1GKH A;  1PH7 A;  3S16 H;  2VUM H;  1QVF A;  3CP0 A;  1Y1W G;  3PF5 A;  3K8A A;  4A3B H;  3PUY A;  4A3L G;  5JJK A;  2F4V Q;  1AE3 A;  1N36 Q;  1IBM Q;  3DLL A;  1NMG A;  1VQC A;  2R7F A;  2Q2H A;  1CKN A;  4C3J H;  5C44 H;  4LFB L;  1SE8 A;  1IBL L;  3GTP H;  4OX9 Q;  3NEM A;  3S2H H;  5BR8 Q;  1IZ6 A;  1WFQ A;  4A3I G;  1Q1E A;  3CCQ A;  3UDF A;  5ELO A;  1XTD A;  4X66 Q;  1VQG A;  5IYB H;  1K8G A;  3PV0 A;  3CW2 C;  1PH1 A;  1XNQ Q;  5C0X G;  3OTO L;  1Z47 A;  1E24 A;  4NXM L;  1C0A A;  4K0K Q;  1OXS C;  1CSQ A;  3FKI H;  1NMF A;  3HOY H;  4A3D H;  4OON A;  1WYD A;  4APV A;  3ER0 A;  1TWF H;  4A93 G;  1E22 A;  1GD7 A;  2KCT A;  4DV1 L;  4B3S L;  4BXX H;  5FLX c;  4HID A;  1PH8 A;  4DPG A;  3GTL H;  4UP8 A;  1TWA H;  3CCJ A;  2UXD Q;  4ME3 A;  1KC8 C;  4HIO A;  1L1O B;  4HIM A;  3UE0 A;  1K9M C;  3G4S A;  1UE5 A;  1SFO H;  1U5K A;  4JI4 L;  4BY7 G;  1D7Q A;  4YHH Q;  1SRO A;  2YTX A;  3M4Q A;  3S1R H;  1KD1 C;  2PQA B;  2VS1 A;  4JI1 Q;  1HNZ L;  2R7Z H;  2ID0 A;  1Y1V H;  3EN2 A;  3PUV A;  4GLV B;  1EFW A;  1MJE A;  1D8L A;  1GM5 A;  4P75 A;  4KHP L;  4JOI C;  5C4X H;  1CKM A;  2YTY A;  2MNA A;  3PIP A;  2JA8 H;  2K5N A;  2FXQ A;  4LFC Q;  3L7Z C;  1HNW Q;  1SR3 A;  4JBK A;  5LMN L;  2N8N A;  4DV5 Q;  3GO5 A;  2Z0S A;  3H15 A;  5C3E H;  2B29 A;  2CQO A;  4L5T A;  2Y0S G;  3TRE A;  2K4K A;  1PV4 A;  3KF6 B;  1V43 A;  2AKW B;  1VQ9 A;  1HZA A;  3B6Y A;  1EIF A;  1G51 A;  4X62 Q;  4IPG A;  2YV5 A;  1XPO A;  2ES2 A;  4GKK Q;  1LUZ A;  1WCM H;  5IY0 A;  5IYD H;  1EQQ A;  4POF A;  4JI0 Q;  5IT9 c;  1VQN A;  3JC6 6;  1XPU A;  2JE6 I;  4QIW E;  1XMQ L;  2ZJQ A;  2HHH L;  4LF7 L;  2PMZ E;  3STB D;  2N78 A;  3AFQ A;  1KL9 A;  4LFA Q;  1Q1B A;  3W1G A;  1VQ4 A;  2GN5 A;  4DR5 Q;  2VQE L;  1X3F A;  3A5Z B;  2E5L L;  4AQY L;  3HOZ H;  4PZ8 A;  5DLQ E;  1JJ2 A;  1J6Q A;  1IBK Q;  1Y14 B;  4MTN A;  4OWX B;  2ZM6 L;  3UDX A;  4JYA Q;  1HR0 L;  3FHW A;  3I4M G;  2QGQ A;  5AJ3 L;  2NVT H;  4MNO A;  3HKS A;  2QEX A;  2C35 B;  3I56 A;  3OW2 A;  4A3J H;  3KDF A;  1A62 A;  1I94 L;  4DV2 L;  1LYL A;  3IRB A;  3TEH B;  3CCE A;  3CCL A;  1S40 A;  2CFM A;  4R4Q A;  4A3B G;  1N9W A;  2OTJ A;  3K7A H;  5GAE C;  4DV3 Q;  1QZH A;  1RIP A;  3PCO B;  4B3T L;  3JAM c;  3WWV A;  3RLN A;  4JI5 Q;  3F2C A;  4JV5 Q;  2EQS A;  5C44 G;  2Q2T A;  4QQB X;  4R4T A;  1TWH H;  3NEL A;  3KLW A;  3OYY A;  1TWG H;  3UDI A;  3M7N A;  1YIJ A;  4HIK A;  4DR1 L;  2Y0S E;  1X3E A;  5IP9 H;  1KRS A;  1YNX A;  2VQF L;  4HJ8 A;  5IYB G;  1BBU A;  3S2D H;  4GNX C;  1VCI A;  3KYH C;  1RL2 A;  3K0X A;  4LFB Q;  3BZK A;  1IBL Q;  1VQM A;  4LF8 L;  3GTM H;  2JK8 A;  4JOI A;  4KHZ A;  1IXR A;  3RN5 A;  1IYJ B;  3FKI G;  2CWA A;  2AHO B;  2BH2 A;  1YJN A;  4BY1 H;  3HOY G;  4A3D G;  4O2D A;  4P73 A;  4JI3 Q;  1WJJ A;  2K75 A;  4X65 L;  2UUA L;  4BXX G;  1X3G A;  1N33 L;  4DR4 Q;  2PI2 A;  2JA5 H;  4BBR H;  3OTO Q;  1EIY B;  2IX1 A;  4JI2 L;  4DR7 L;  3GDE A;  3RR5 A;  4NXM Q;  4EX5 A;  2HT1 A;  2NZO A;  5LMU Q;  3HFZ B;  1WI5 A;  2R7Z G;  1X9N A;  3HOW H;  1Y1V G;  1OXV A;  3J80 i;  2UUC L;  3F1Z A;  4DV1 Q;  4A3M H;  1VQO A;  2I0Q A;  4B3S Q;  2NN6 I;  3CCU A;  3J7Z C;  1HZ9 A;  1PYS B;  5HGQ A;  4QY7 A;  1P8L A;  1I50 H;  5GRO A;  3CC4 A;  4YWK A;  2OWO A;  4O0A A;  5GQO A;  2JA7 H;  2JA8 G;  5FLM H;  1YHB A;  3AQQ A;  5JEA J;  1AH9 A;  1HNX L;  2WAQ E;  3PIO A;  4LUV A;  1HNZ Q;  2R92 H;  1FL0 A;  1CKN B;  4LWC A;  5C3E G;  2KBN A;  4KLK A;  3CD6 A;  1VQ6 A;  1E1T A;  1KRT A;  3DM3 A;  4C3I H;  1K0R A;  4PMW A;  1KQS A;  4B3M L;  4KHP Q;  1YIT A;  3H0G H;  1OTC A;  1PH3 A;  1N34 L;  3M4P A;  2UXC Q;  1YJW A;  1WCM G;  4DR6 Q;  5IYD G;  4DV0 L;  2H5X A;  4DR3 L;  1VQI A;  4Y52 H;  4A75 A;  2RCN A;  4JI7 Q;  4GLA C;  4A3C H;  4IOA A;  1EWI A;  4DR2 L;  1M90 C;  5FJ8 G;  2I5M X;  1UWV A;  5C4J H;  4JBM A;  1B8A A;  3RZO H;  1TWC H;  3BU2 A;  4DV4 L;  2DUD A;  2BH8 A;  2PNH A;  3Q8D A;  1XMO Q;  1IL2 A;  3I7F A;  1QUQ A;  3E9I A;  5E7N A;  4JG2 A;  4HJA A;  2NVX H;  4LF7 Q;  4QL5 A;  4IJH A;  4A3J G;  1XNR L;  4GKJ L;  3TRZ A;  1JB7 A;  4GNX A;  3K80 C;  1NY4 A;  3S1M H;  1KIX A;  3ULJ A;  3CQZ H;  4DV7 L;  1YVC A;  5JEA G;  3GD7 A;  1MIU A;  2E5L Q;  3GTK H;  3A5U A;  2N49 A;  3U4V A;  1S72 A;  2ZM6 Q;  4DK3 C;  3K81 C;  3KF8 B;  2JQO A;  4TQU S;  1J5E L;  2E8G A;  3K7U C;  2KCM A;  5AJ3 Q;  4LF5 L;  4OXP A;  1I5F A;  3AEV A;  1JT8 A;  1I94 Q;  5M5W H;  4DV2 Q;  3PO2 H;  2VNU D;  4IFD I;  2F52 A;  4DUY L;  3KJP A;  4R4O A;  5LMN W;  5IP9 G;  4JI8 Q;  1Q7Y C;  3PSI A;  4IPH A;  2JEA I;  1YZ6 A;  1KHI A;  4OO1 I;  5ELN A;  1PA6 A;  2MQH A;  1YEZ A;  2IT1 A;  2B63 H;  1IBM L;  4HJ9 A;  2NN6 G;  1MKH A;  1HZB A;  3BZC A;  3G6E A;  3PO3 H;  1V9P A;  3PGZ A;  3EIV A;  2R7D A;  2VL6 A;  4BY1 G;  4LNQ A;  2UXB L;  4GN4 B;  5BR8 L;  2VQF Q;  2Q2I A;  2E2J H;  1LTL A;  1A8V A;  3G48 A;  4NXN Q;  3H3V H;  5IP7 H;  1UEB A;  3D31 A;  4GN5 A;  4BBR G;  2QA4 A;  2JA5 G;  3HOV H;  4UPA A;  3J81 c;  2KHJ A;  4YWM A;  3RN2 A;  1VQP A;  4IFD J;  4A3E H;  4LUO A;  3HOW G;  3A74 A;  3M85 A;  1A63 A;  1OXX K;  4GOP C;  1HR0 W;  2AMC B;  3KDF B;  4X65 Q;  3CC2 A;  1V1Q A;  1I6H H;  2JEB I;  3RZD H;  5M3F H;  4LF9 Q;  1N33 Q;  3PUZ A;  2VUM G;  3ZJY C;  1VQL A;  1SRU A;  5H1S E;  1X55 A;  2JA7 G;  1FGU A;  5FLM G;  1P16 A;  2A1A A;  5IE8 A;  1N8R C;  4DR7 Q;  4NPS A;  2D0P A;  5GAD C;  4GN3 B;  4JC0 A;  3EBE A;  2E2I H;  1W2B A;  2KHI A;  4YCU A;  2UUB L;  2R92 G;  1ASZ A;  3S1N H;  4B3R Q;  3HOX H;  4JI1 L;  2WAQ G;  1VQB A;  3CCR A;  4DAY B;  1EUJ A;  3U4Z A;  5IYC H;  1PH5 A;  3H0G G;  3HKZ E;  4TVA B;  1CSP A;  4JBW A;  5GAH C;  3ULL A;  4LF4 L;  1HNX Q;  4LFC L;  2UU9 L;  4GLX A;  4IPD A;  2IY5 B;  1VQK A;  3CME A;  4C3H H;  3NEN A;  3CF5 A;  4A3C G;  2R93 H;  4DV5 L;  1PH9 A;  4LF6 L;  4UY8 C;  1LM0 A;  1VQ5 A;  4IJL A;  4BBS H;  1BBW A;  1Q8K A;  2I5H A;  2Z6K C;  4B3M Q;  3S15 H;  1JJC B;  5K36 G;  3U50 C;  2VW9 A;  3I4N H;  2WB1 G;  2EXD A;  4JBJ A;  4L5R C;  4IFD G;  4NB3 A;  1SN8 A;  4RG1 A;  3JAM i;  3GTQ H;  4IPC A;  2IHE A;  2VZA A;  1CKO A;  4DV0 Q;  4FDB A;  3I4O A;  4DR3 Q;  2LSS A;  3MEF A;  1FJG L;  4OWW B;  2K5H A;  2RHS B;  4JI0 L;  1PH2 A;  4OO1 G;  3J7A 5;  4QJF A;  2NVY H;  4YY3 L;  4DR2 Q;  4KI0 A;  1R9T H;  1VQH A;  2PI2 E;  3J80 c;  1L1O C;  1YHA A;  4P71 A;  5J3B A;  4EQ5 A;  4LFA L;  4DNI A;  1JMC A;  3PUX A;  2LXK A;  4HJ7 A;  3TQY A;  3CCV A;  4RMF A;  1IBK L;  2B3G A;  3S1Q H;  1FVI A;  4X64 L;  1Q82 C;  1VQF A;  4Y7N H;  2F3I A;  1XNR Q;  4JI4 Q;  1E3P A;  3PO2 G;  1PFS A;  2ATW A;  1C9O A;  4X6A H;  2HIV A;  2MO1 A;  1W3S A;  1NE3 A;  4DV7 Q;  3ICE A;  4BA2 I;  1G6P A;  4A3F H;  3F8T A;  4IO9 A;  3M4O H;  1NJI C;  4DV3 L;  2JA6 H;  1J5E Q;  3LGJ A;  4J15 A;  4GOP A;  3T1Y L;  3UDG A;  2B63 G;  5M5X H;  1H95 A;  4LF5 Q;  3SGI A;  3PO3 G;  2NZH A;  4L5S A;  5IWA L;  1Q46 A;  5LMN Q;  4DUZ L;  1UE6 A;  3U58 A;  2IX0 A;  2OCE A;  3RLF A;  3G71 A;  1Q81 C;  1PH4 A;  1CUK A;  2WB1 E;  3NBH B;  1N32 L;  4H02 A;  3GTO H;  5IP7 G;  1GVP A;  4HJ5 A;  3STB C;  4IOC A;  3HOV G;  1AE2 A;  3HOZ G;  1OXT A;  2ASB A;  4POG A;  4P74 A;  3T1H L;  2HQL A;  1Q12 A;  1QUQ B;  1L2F A;  1UE7 A;  1E1O A;  4A3E G;  1SLJ A;  1GO3 E;  4PZ7 A;  4JI6 L;  1X56 A;  2K5V A;  2UXB Q;  2MO0 A;  1K73 C;  1XMQ Q;  2HHH Q;  4GNX B;  1C7Y A;  2R6G A;  5M3F G;  3CPF A;  1XJV A;  2XTI A;  4JI3 L;  1X65 A;  1YJ9 A;  2VQE Q;  3RLO A;  2EIF A;  1G29 1;  4DR4 L;  3F2D A;  1A0I A;  1MJC A;  4AQY Q;  1HH2 P;  3ULP A;  5M3M H;  2Z6K A;  4AYB E;  3M3Y H;  1PVO A;  3E9H A;  4WJ4 A;  4XIG S;  1TXY A;  3M9B A;  4A3K H;  3KFU A;  1HR0 Q;  4DV6 L;  5LMU L;  1PH6 A;  3HOX G;  3HOU H;  1VQJ A;  1K83 H;  4R4C A;  1U0L A;  4L5Q A;  4A3G H; 
#chains in the Genus database with same CATH topology
 2F0J A;  1WOC A;  4HTH A;  2KEN A;  1XTC D;  4WJ3 M;  4C3H G;  1ASY A;  2R93 G;  2A68 D;  1OXU A;  3HOV B;  4IAL A;  2PQA A;  3VDY A;  3HOZ B;  1B7Y B;  4HAE A;  1YI2 A;  4EQP A;  1Y1W H;  1L0W A;  1UE1 A;  1D5Z C;  4CDC C;  4LF4 Q;  2BDO A;  2A8V A;  4R8I A;  2WP8 J;  1E2V A;  5M3F B;  2EY6 A;  2BA1 A;  4AH6 A;  3S14 H;  4UP7 A;  4RH6 A;  4JI7 L;  4V19 0;  1X54 A;  2N3S A;  3EVQ A;  2OTL A;  4A3M G;  1SXT A;  3TZD A;  2UUA Q;  4A3I H;  4P72 A;  5KNB A;  1TKW B;  2H4O A;  3CCM A;  3QOJ A;  4DAV A;  2UXD L;  1TWG B;  2HD3 A;  1A15 A;  2K50 A;  4EGV A;  1DXM A;  1HZC A;  2MFI A;  2XRQ D;  1ICW A;  2G9H D;  3NTH A;  4WFN 3;  1DM0 B;  1BKB A;  2JA6 G;  1JJG A;  4A93 H;  1EY9 A;  4BBS B;  3SVM A;  1JOO A;  5EPK A;  3CXC A;  2NVQ H;  2D2C C;  1SND A;  2D9U A;  1SE2 A;  4FVM A;  3TDQ A;  5C0X I;  4KK7 A;  5KGU A;  3H6M A;  1LAC A;  1PTO D;  3P75 A;  4C1N K;  5IWA Q;  2I07 B;  3ERS X;  3SK4 A;  4GKK L;  1I3Q H;  1TT2 A;  4IUN A;  5IT9 L;  3K5M A;  1N32 Q;  2D62 A;  3CPW A;  5EKI A;  3J7A V;  4HSP A;  4XTC S;  4NXN L;  3UE1 A;  1E2W A;  5M3M G;  3R2I A;  4X3T A;  4DR5 L;  3X3N A;  2A6H D;  1IL8 A;  3OMG A;  2A69 D;  4J8Q A;  4AYB G;  1NBW A;  1QZG A;  5BN3 A;  1M1K C;  5M5X B;  2JXM B;  3CAM A;  1K3B C;  3GTJ H;  5BN5 A;  2NWG A;  3RNU A;  1LTS D;  1A6X A;  2ICE C;  4YCV A;  4ZUI A;  5I9P A;  4KV6 A;  3HP3 A;  1T9H A;  5C3W A;  4JI5 L;  4FF3 A;  4JV5 L;  1HTP A;  5EQ0 A;  2K14 A;  3I4M H;  1UAP A;  3CRK C;  1KLU D;  1R4P B;  4YWL A;  1GKH A;  1VMC A;  3S16 H;  4PMC A;  3CP0 A;  3PF5 A;  4A3B H;  2A6E D;  3PUY A;  1V1P A;  1CQV A;  1IBM Q;  1F2M A;  2R7F A;  4OX9 Q;  5BR8 Q;  1IZ6 A;  1K83 B;  1WTO A;  2SEB D;  2RKS A;  1VQG A;  1JOK A;  3CW2 C;  5C0X G;  5IGD A;  3OTO L;  5LHY 1;  2CW0 D;  1FR3 A;  4ZK9 B;  3RMH A;  1CSQ A;  1NMF A;  4APV A;  1WYD A;  3G6J B;  1TWF H;  4BXX H;  1JB3 A;  3MHB A;  1TWA H;  4ME3 A;  1KC8 C;  1L1O B;  3IAY A;  1PDQ A;  4OO1 H;  2XIW A;  1ZXT A;  1KDA A;  4BY7 G;  1J8I A;  2YTX A;  1KD1 C;  2B2V A;  3PUV A;  4FF2 A;  4GLV B;  4QB4 A;  2MJ8 A;  3GV3 A;  1D8L A;  3I3C A;  4KHP L;  5C4X H;  5T1I A;  2XRS D;  3KF8 A;  4N8X 1;  2PO4 A;  3PIP A;  2K5N A;  2FXQ A;  4JK1 C;  2RDG A;  3BG3 A;  1L0X B;  1LT3 D;  3PQI A;  2N8N A;  4DV5 Q;  2Z0S A;  3OHX C;  3TRE A;  2RVL A;  5DM7 3;  1EIF A;  2PMZ B;  1MBY A;  1EQQ A;  4POF A;  3IFD A;  4DK0 A;  2KQ3 A;  4QIW E;  2HHH L;  2F0K A;  3SK5 A;  1Q1B A;  1DJR D;  3K59 A;  1X3F A;  3HOZ H;  4CJ2 C;  4PZ8 A;  1JJ2 A;  1Y8O B;  1J6Q A;  2EJG C;  1IBK Q;  3S15 B;  5CR3 A;  3UDX A;  4JYA Q;  1EZ8 A;  4OEM B;  4K5W A;  5M9O A;  1RTN A;  1PFB A;  2QEX A;  2F0P A;  3IRB A;  3CCE A;  3CCL A;  2CFM A;  4R4Q A;  2OTJ A;  5CC4 A;  3K7A H;  4K8I A;  3JAM c;  1AZP A;  4FXG C;  2EQS A;  4FF4 A;  2Y0S B;  5C44 G;  1S5F D;  3M7G A;  1TWH H;  4R4T A;  1TWG H;  3NBI A;  1NR4 A;  4KY6 A;  2F3W A;  3SDZ A;  3S17 B;  1KRS A;  2B39 A;  3DMU A;  4QUC A;  2E2H B;  3NTI A;  5CMD A;  2B2V C;  2JK8 A;  2JYO A;  3FKI G;  3HOY G;  2CWA A;  4A3D G;  2QDL A;  4JI3 Q;  2UUA L;  1X3G A;  2ICI A;  2PNR C;  4NP5 A;  4N8F A;  1EIY B;  1BO0 A;  4DR7 L;  3GDE A;  4U67 3;  2HT1 A;  1GXD C;  1Y1V G;  5A2Q L;  2A68 C;  3DM1 A;  2LS0 1;  3H3V C;  2HQE A;  2NN6 I;  1M4V A;  1PYS B;  2OWO A;  4YWK A;  1EWC A;  1IYV A;  1HNX L;  3J7A F;  2K28 A;  1CKN B;  1LTA D;  5EKK A;  5C3E G;  2KBN A;  1E1T A;  4ZAI A;  5IOD A;  3VA7 A;  1KDB A;  1KQS A;  2EYL A;  2A74 C;  4ZKC B;  2UXC Q;  3EJI A;  4DR3 L;  1VQI A;  1JOR A;  3GTL B;  1EFI D;  1UEA B;  4DR2 L;  1SFO B;  1ZEQ X;  2XWJ B;  1ZKO A;  4X3K A;  1UWV A;  3S1R B;  3I4L A;  5C4J H;  3HG9 A;  4K2K A;  3BU2 A;  1XMO Q;  3Q8D A;  4FXK C;  1EZ6 A;  1HRJ A;  3MEH A;  2JA8 B;  3TRZ A;  3MTS A;  2PW7 A;  3CQZ H;  3ULJ A;  1K8O A;  5JEA G;  1CHP D;  2L11 A;  2ZM6 Q;  4PMB A;  3ND8 A;  1SYC A;  5AJ3 Q;  2KCM A;  4ZRZ A;  1G2S A;  1PTO C;  1JT8 A;  2WV6 D;  5M5W H;  1I94 Q;  4IUV A;  2K5Q A;  4CJ1 B;  1TS5 A;  3DEP A;  1KHI A;  2E74 C;  5JJZ A;  2MQH A;  3V2T A;  1IBM L;  1Z7T A;  2NN6 G;  4HJ9 A;  2KA7 A;  3MC0 B;  1QG7 A;  2A6H C;  4LNQ A;  2A69 C;  2UXB L;  1B50 A;  5BR8 L;  5EBD A;  1DCZ A;  2Q2I A;  4A3J B;  3G48 A;  1UEB A;  1QWY A;  2B2U A;  3D31 A;  2QA4 A;  2JA5 G;  2KHJ A;  3A74 A;  1A63 A;  1OXX K;  4GOP C;  4X65 Q;  3CC2 A;  1V1Q A;  3RZD H;  4ZUJ A;  3PUZ A;  1VQL A;  4XT3 B;  2JA7 G;  2F0H A;  5IE8 A;  2KED A;  4GN3 B;  2A6E C;  2UUB L;  2L12 A;  2KHI A;  3LWE A;  5CYU A;  2R92 G;  3S1N H;  2PZU A;  3S2D B;  2SNS A;  2RSO A;  1TVX A;  1VQB A;  2WAQ G;  5FO8 B;  2BCO A;  3CCR A;  3U4Z A;  4XXE A;  5IYC H;  1PH5 A;  1LTG D;  4BY1 B;  3U9O A;  3L9A X;  1VQK A;  4A3C G;  3NEN A;  4DV5 L;  4UY8 C;  5IGB A;  1BBW A;  1Q8K A;  2Z6K C;  1EY7 A;  2CW0 C;  2TSS A;  4B3M Q;  3S15 H;  3U50 C;  3HOW B;  2FMM A;  3JAM i;  4RG1 A;  3FMC A;  3GQB A;  3H09 A;  2VUM B;  3OWF A;  3S1Q B;  1CA5 A;  4QJF A;  3OW7 A;  4OEL B;  1R9T H;  1VQH A;  3J80 c;  1IYU A;  1SJE D;  1YHA A;  5J3B A;  2ZXO A;  4A3G H;  3FPU B;  3K6O A;  4ZYS A;  1CFM A;  4U68 A;  3CCV A;  1PXU A;  4C3I B;  1IBK L;  2B3G A;  1Q82 C;  1ENC A;  1VQF A;  4GZY C;  1E3P A;  2ATW A;  1C9O A;  2DNE A;  3VA5 A;  1WD1 A;  4DV7 Q;  1ENA A;  1G6P A;  2B2U C;  2EXZ A;  5I2Y A;  2EZV A;  3UI2 A;  2G9D A;  1SBB B;  4LF5 Q;  3PO3 G;  3RZO B;  2WB1 B;  4JW0 A;  4L5S A;  2B2Y C;  3U58 A;  2OCE A;  3RLF A;  3G71 A;  3K0Y A;  2F0N A;  4H02 A;  3GTO H;  5IP7 G;  3S1M B;  3J80 L;  1GUO A;  1A2T A;  1AE2 A;  4B08 A;  2HQL A;  1Q12 A;  2OT2 A;  1L2F A;  1SLJ A;  3CHB D;  4JI6 L;  1X56 A;  2K33 A;  4QMG A;  1I4Q A;  2EE1 A;  1I4X A;  1LTR D;  2R6G A;  2XTI A;  4JI3 L;  3PO2 B;  1CI3 M;  1O7Z A;  1YJ9 A;  1Q8I A;  1A0I A;  4AQY Q;  3ULP A;  3M3Y H;  3E9H A;  4XIG S;  3KFU A;  3HOU H;  3HOX G;  5KYI A;  2B63 B;  3A55 A;  1HPC A;  2L5T A;  1KNE A;  1EYD A;  1MD2 D;  1EU4 A;  2JJQ A;  1YBY A;  3V96 A;  4CDF C;  2AWN A;  1L1O A;  5JPM C;  4F8M A;  3SE0 A;  1WTH A;  4OWT B;  2F0O A;  1O78 A;  4OHJ A;  4PG3 A;  5GAG C;  3R2T A;  2EPB A;  4A3E B;  3I4N G;  4A4I A;  5CBA E;  4RAU C;  1B70 B;  4DR1 Q;  2NVT B;  3TP5 A;  4A3L H;  2UXC L;  4X66 L;  1VQ8 A;  2ZTE A;  1NUC A;  4IUR A;  1XNQ L;  2YTV A;  2FHT A;  4ODG A;  2DGY A;  1SAP A;  1H9M A;  2E2I B;  5KIX A;  1NTG A;  2PZT A;  3A0J A;  2IX3 A;  3OWE B;  3KJO A;  1XMO L;  3A8J E;  1KXL A;  2B2W C;  2K52 A;  3I72 A;  1JE5 A;  1NR2 A;  1IKL A;  1ROD A;  4YHH L;  3H3V I;  2OQ0 A;  3H94 A;  5FJ8 H;  4A3F G;  2UUC Q;  4C3H B;  5ELC A;  4ALP A;  2R93 B;  2WIN B;  1ICF B;  3DXJ C;  1EWH A;  4X64 Q;  2CKZ B;  1QVG A;  2OXP A;  2EJF C;  5M5Y H;  2IL8 A;  2AUJ D;  4IQZ A;  2NVY B;  1Z6H A;  2NTT A;  1KAA A;  1PTO B;  1DOM A;  4DAM A;  1N34 Q;  4DFA A;  4A76 A;  4QCL A;  1S3O A;  4A3M B;  1O7I A;  4DUZ Q;  4RKB A;  2K32 A;  2DNC A;  2KHS A;  1C4Q A;  2AWO A;  3ITP A;  2CCZ A;  1EOV A;  2WII B;  1STE A;  4DV4 Q;  3T1H Q;  1G6Z A;  3G7L A;  4A3K G;  2WFW A;  2ZXR A;  3L0O A;  1HXY D;  2JA6 B;  5LL6 S;  2OQK A;  4R4I A;  1BUV T;  4Q5V A;  4A3G G;  2IHF A;  2F0W A;  5C0X J;  2Q2U A;  4KJO A;  3TP7 A;  4LUZ A;  1A3V A;  1TU2 B;  2R61 A;  4LW1 A;  4DK6 C;  4GOP B;  2YU9 H;  5JJI A;  2X6G A;  4DV6 Q;  4CKB A;  1SE4 A;  3OMC A;  2VUM H;  1PZK D;  1T5X D;  1Y1W G;  3D8G A;  2F4V Q;  1AE3 A;  1N36 Q;  1D6E C;  1NMG A;  1VQC A;  4C3J H;  1CKN A;  5M3M B;  4FP5 D;  4LFB L;  2P5Z X;  3GTP H;  3S2H H;  1SYB A;  2EYO A;  1WTQ A;  4AYB B;  4A3I G;  1GUW A;  1CT1 D;  1FYC A;  5KNC A;  2FMC A;  1GHJ A;  4K5X A;  5IYB H;  1K8G A;  3PV0 A;  5J22 A;  1E24 A;  1LAB A;  4NXM L;  1C0A A;  4K0K Q;  1DOK A;  3KBX A;  3QWN A;  4A93 G;  4DV1 L;  2KCT A;  4B3S L;  4HID A;  3HZX A;  4HIO A;  1PLF A;  4UHV A;  3G4S A;  1UE5 A;  2E2J B;  1U5K A;  2R7Z H;  4JI1 Q;  2ID0 A;  4G7O C;  3E6Z X;  5FK9 C;  3ONA B;  1GM5 A;  4O42 A;  1HNW Q;  1SR3 A;  4JBK A;  1TQO A;  3H15 A;  1AEX A;  3RD4 A;  4G7H C;  2CQO A;  4L5T A;  4KD4 A;  2K4K A;  2TMP A;  3KF6 B;  2QEJ C;  1VQ9 A;  2ES2 A;  4X62 Q;  4B9W A;  2YV5 A;  1XPO A;  2SOB A;  3RUZ A;  1LUZ A;  1WCM H;  5D3D A;  3URY A;  1NAP A;  4C56 C;  5IT9 c;  2K04 A;  3CU7 A;  1F9R A;  1XPU A;  2ZJQ A;  1D1I A;  1RTO A;  3GTG B;  1HUM A;  1B9M A;  3AFQ A;  4KKU A;  1WVL A;  4LFA Q;  1VQ4 A;  4BY7 B;  2DN8 A;  2GN5 A;  1NCV A;  2Q8I B;  3I90 A;  2E5L L;  4AQY L;  5DLQ E;  1Y14 B;  2Z9H A;  3DWA A;  5JVG 3;  1QCB D;  4CJ0 B;  3I4M G;  2NVT H;  4N9P A;  3PIO 3;  4MNO A;  2C35 B;  3OW2 A;  1HA6 A;  4A3B G;  1N9W A;  4HR7 B;  1QZH A;  4RWS C;  3PCO B;  3WWV A;  4TRD A;  2Q2T A;  4MN3 A;  5I4D A;  3MVV A;  3I8Z A;  4C2M B;  3BDO A;  4CKE A;  3AU7 A;  4DR1 L;  4IUQ A;  2C9O A;  2VQF L;  1AFP A;  4HJ8 A;  1BBU A;  3I91 A;  1VCI A;  3KYH C;  2WKC A;  2EVB A;  3BZK A;  1IBL Q;  3T13 A;  1VQM A;  3W2D A;  2D5D A;  3HS0 C;  2AHO B;  1RDP D;  1WJJ A;  4BXX G;  1A3U A;  1SMY D;  2K05 A;  2PI2 A;  4BBR H;  1STH A;  2IX1 A;  2PYK A;  1XWE A;  2NZO A;  3HFZ B;  1WI5 A;  5AFW A;  1JCK B;  4LK1 C;  2UUC L;  1MSG A;  5C44 B;  3F1Z A;  3VR2 A;  4A3M H;  3NSW A;  1CHQ D;  1VQO A;  1HZ9 A;  3CC4 A;  5C4X G;  4O0A A;  2BDN A;  5FLM H;  1C48 A;  3HGB A;  2EY2 A;  3AQQ A;  3N52 A;  5JEA J;  1AH9 A;  4LUV A;  1EIH A;  1HNZ Q;  1FL0 A;  4KLK A;  2QF7 A;  5E4W C;  3C46 A;  4I65 A;  4CDD C;  1FGB D;  5CV5 A;  3H0G H;  3FKI B;  1N34 L;  3M4P A;  1XYI A;  3HOY B;  1D5M C;  4DR6 Q;  4A3D B;  3EQL C;  4DV0 L;  2H5X A;  1H9S B;  1HFN A;  2HDM A;  4JPB W;  3NXW A;  1SYD A;  4DV4 L;  2DUD A;  4IFD H;  1Y1V B;  2BH8 A;  1JE4 A;  3JAM E;  4MTK A;  5KYL A;  5E7N A;  4LF7 Q;  5DM6 3;  4QL5 A;  3ND9 A;  1AN8 A;  4FNF A;  4C1N I;  1B3Q A;  1YVC A;  5C3E B;  5CV6 A;  2N49 A;  3U4V A;  2RSN A;  4DK3 C;  2JQO A;  3T51 B;  3K7U C;  3K57 A;  2F4I A;  4OXP A;  3VYU A;  4CDE C;  4DV2 Q;  2VNU D;  3OIQ A;  4F88 A;  1RHP A;  2EY5 A;  5IGE A;  3KJP A;  4JI8 Q;  3PSI A;  4IPH A;  1YZ6 A;  3BYT B;  1PA6 A;  5HUR A;  2CH4 A;  1YEZ A;  1MKH A;  3G6E A;  3EIV A;  2VL6 A;  1B1Z A;  4GN4 B;  2F0M A;  1HCZ A;  2E2J H;  1NNX A;  3HOV H;  4UPA A;  1EY5 A;  3CRL C;  3J81 c;  5IGF A;  2Z1C A;  2BOS A;  1WTX A;  3C1E A;  4MIU A;  3M85 A;  1HR0 W;  3NP8 A;  2AMC B;  4RKL A;  3KDF B;  5ELF A;  5KRU A;  3MFG A;  5M3F H;  4LF9 Q;  1N33 Q;  5H1S E;  3A7L A;  1FGU A;  1N8R C;  2VXW A;  1PYW D;  4YCU A;  1W2B A;  3KUP A;  3BDC A;  1Q3L A;  2DJG C;  4JI1 L;  3SR1 A;  1GOZ A;  1DOL A;  3K58 A;  4KD3 A;  4IUU A;  4JBW A;  4LF4 L;  1PTO F;  5FLX E;  4IPD A;  4QUF A;  4NKL A;  3A56 A;  3CME A;  3J81 L;  1WTV A;  3OPO A;  1KNA A;  4BBS H;  1U4M A;  4JVZ A;  1YNN D;  2EXD A;  3NK9 A;  3SXH A;  4IPC A;  1B53 A;  1CKO A;  1LLR D;  3I4O A;  3MWY W;  3MEF A;  1ESF A;  4KJN A;  2K5H A;  1FNV A;  5CV4 A;  1PH2 A;  1I50 B;  2JA7 B;  2F0U A;  4WOR A;  2K7V A;  1G2T A;  1E0B A;  4LFA L;  4DNI A;  2R92 B;  3VR4 A;  1IHZ A;  3FDT A;  4OGQ C;  3SHL A;  2WAQ B;  4FXD A;  4RMF A;  1SEB D;  3PMF A;  1FVI A;  5F2D A;  1STA A;  4F87 A;  1WTW A;  1ENF A;  3V05 A;  1XNR Q;  2XN9 C;  4DAP A;  4KN7 C;  2HIV A;  4BA2 I;  3F8T A;  1SJH D;  3T56 B;  5LL6 X;  2O5I C;  1J5E Q;  4GOP A;  5C4Z A;  5M5X H;  1EY6 A;  2NUC A;  1TWC B;  5IWA L;  2NBF A;  3A8K E;  4OIK A;  1RJT A;  1VF7 A;  4OL7 A;  1Q81 C;  1LTT D;  1PH4 A;  3QIA A;  1N32 L;  1W6K A;  1GVP A;  5TSS A;  1S5E D;  4EQO A;  2HCI A;  2SDF A;  3DWP A;  1UUP A;  4P74 A;  3GTK B;  1QUQ B;  4ZQ3 A;  4PZ7 A;  5JAV A;  1GUN A;  3MA2 B;  3IKJ A;  3T53 B;  1XJV A;  1X65 A;  5L37 A;  2EIF A;  5HGT A;  1HH2 P;  2Z6K A;  4AYB E;  1TXY A;  1HR0 Q;  1I4R A;  1PH6 A;  1K83 H;  4KN4 C;  3W3A A;  1U0L A;  4L5Q A;  1K0S A;  3PO3 B;  2HIX A;  3D0F A;  3EFX D;  5IYC G;  2VB2 X;  2JA9 A;  3W1B A;  5DEH A;  1QVC A;  2ZTC A;  4B3T Q;  3HKZ G;  3J81 j;  2LXJ A;  2L9H A;  2MGS A;  4GS3 A;  2A19 A;  5EAY A;  2NTS A;  4XT1 B;  1EQR A;  1PFM A;  4OX9 L;  4BA1 I;  5JPN C;  5NUC A;  2NB0 A;  1I6H B;  2IJ0 A;  1XPR A;  2UU9 Q;  4DR6 L;  1VMP A;  2SNM A;  1SMY C;  4LF6 Q;  4DKA C;  4LF8 Q;  4YCW A;  4MZ9 A;  1BVS A;  4CBV A;  2K01 A;  2ZJR A;  3L2P A;  2B2Y A;  1Q86 C;  3HOX B;  4CKC A;  3KF6 A;  1E7Z A;  3F2B A;  1KAW A;  4HCS A;  1FJG Q;  4ABN A;  4YY3 Q;  3DHQ A;  1DGS A;  4L6T B;  4LMQ D;  1JWS D;  2V1C C;  2ZTD A;  4P2C B;  5JJL A;  2ZT9 C;  3J81 i;  1PHJ A;  5CV7 A;  1ESR A;  1G8Z D;  1VQ7 A;  3I4N B;  4HMI A;  5FO9 B;  1O80 A;  1B3A A;  1SE3 A;  1VQA A;  2VY3 A;  1LT4 D;  1BOS A;  3EA6 A;  5JEA H;  1PMR A;  4JI8 L;  3NE5 B;  3T1Y Q;  4QGU A;  1HQR D;  3FPP A;  2RHQ B;  1VS0 A;  3SK8 A;  5C6A A;  4TKO B;  4AIM A;  4PZ6 A;  4Y7N B;  2A5H A;  1X6O A;  3U9S A;  1LTI D;  4X3U A;  2L15 A;  3S9W A;  1VQE A;  4B9X A;  3A54 A;  4A3F B;  2F3V A;  2NN6 H;  3MZ5 A;  3CMA A;  3HOU G;  5DAU A;  1B44 D;  2F0T A;  4JYA L;  2RDH A;  2EYF A;  3S17 H;  3PF4 A;  4PNY A;  1SNM A;  4LF9 L;  2E2H H;  5HY6 A;  1RF2 D;  1FNU A;  3T16 A;  1K8M A;  3PIP 3;  2XGT A;  1GUS A;  3KOJ A;  4JCV E;  3TS0 A;  3BJU A;  1QB5 D;  1LV9 A;  2B2W A;  1PH7 A;  4V0B A;  2NVX B;  2QKI C;  4A3L G;  5JJK A;  5JVH 3;  4H13 C;  4KTA A;  2J4X A;  2O2L D;  1H9R A;  1CA6 A;  1MSH A;  4RGN A;  1SDF A;  1QE6 A;  4A3K B;  3AMU A;  5FOB B;  4Q0F A;  1Q1E A;  4RGT A;  1CK1 A;  5ELO A;  1XTD A;  4A3G B;  1D2B A;  3R93 A;  4NMZ A;  4G4K A;  1BCP B;  3VR3 A;  1Z47 A;  3D4D A;  1MHW C;  1KLG D;  2F0L A;  3ER0 A;  1E22 A;  1GD7 A;  4RCO A;  2UXD Q;  3GTL H;  1S5B D;  4XQJ A;  4K14 A;  2K03 A;  4RHR A;  1F2Z A;  3UE0 A;  4DXG A;  1Y1W B;  5CGK A;  3MAQ A;  1SFO H;  1D7Q A;  2IW3 A;  1SRO A;  3S1R H;  5COY A;  3S14 B;  1LTB D;  3EN2 A;  1EEF D;  1EFW A;  1MJE A;  4P75 A;  4JOI C;  1LO5 D;  1YNN C;  3BVM A;  3CKI B;  4A3I B;  3L7Z C;  2JA8 H;  1BXT A;  4F7X A;  2B29 A;  1O7Y A;  5C5L A;  1PV4 A;  1L0Y B;  1V43 A;  1HZA A;  1G51 A;  4GKK Q;  5IY0 A;  5IYD H;  4A93 B;  4JI0 Q;  4ULL A;  4H44 C;  1TR5 A;  2PMZ E;  3STB D;  3VR5 A;  3VYT A;  2NVQ B;  4DR5 Q;  1LT5 D;  2CHB D;  2ZM6 L;  1HR0 L;  5AJ3 L;  3GTQ B;  4A3J H;  5EJW A;  3KDF A;  1A62 A;  1JR0 D;  1I94 L;  1LYL A;  3TEH B;  5A35 A;  3C3L A;  1UNS A;  1RIP A;  4B3T L;  4L63 B;  2QCP X;  3RLN A;  4JI5 Q;  3F2C A;  1HQM C;  4N9T A;  4JV5 Q;  3BDL A;  4IN3 A;  4C3J G;  3E3X A;  3Q0A A;  3NEL A;  1RD9 D;  1BR9 A;  2EYJ A;  2RA4 A;  3VYS A;  1DZ1 A;  3M7N A;  3L3O C;  1YIJ A;  4DXF A;  2Y0S E;  1X3E A;  2LKV A;  5IP9 H;  1YNX A;  1IKM A;  3GTJ B;  5IYB G;  3S2D H;  4GNX C;  1RL2 A;  4WRD A;  2AQ1 B;  3M4O B;  4LF8 L;  2AQ3 B;  1JOQ A;  4KHZ A;  1IYJ B;  2DJF C;  3T4A C;  2BH2 A;  4BY1 H;  4P73 A;  3QB3 A;  3I4M B;  2WAC A;  4X65 L;  5BN4 A;  3D4W A;  3S16 B;  4DR4 Q;  5EPL A;  3OTO Q;  3O13 A;  4A3B B;  3RR5 A;  4EX5 A;  3E5S A;  2R7Z G;  1DYQ A;  2ZXP A;  3HOW H;  3J80 i;  2I0Q A;  1HTL D;  4FF1 A;  3CCU A;  4KKT A;  1GUG A;  1W6J A;  5HGQ A;  4QY7 A;  1P8L A;  5IGG A;  3J7Z C;  1JWM D;  3GP7 A;  3S1Q H;  1YHB A;  5IT9 E;  2WAQ E;  3VR6 A;  1VQ6 A;  1KRT A;  2OEO A;  3DM3 A;  3LX0 A;  4C3I H;  4KHP Q;  4B3M L;  1YIT A;  3OOC A;  5D65 A;  1FD7 D;  1YJW A;  1WCM G;  5IGC A;  1RKN A;  4Y52 H;  1F9S A;  4A75 A;  1ILP A;  1TWA B;  2AUK A;  4IOA A;  4KY5 A;  1M90 C;  2PZW A;  1BCP D;  1ET6 A;  5K36 H;  2I5M X;  2EYM A;  4JBM A;  1B8A A;  3RZO H;  2I46 A;  5E1F A;  2HCC A;  1F2L A;  1Y69 U;  1IL2 A;  1QUQ A;  2HDL A;  2J7Z A;  4HJA A;  1BBX C;  4JG2 A;  2NVX H;  5C4X B;  1EEI D;  1JB7 A;  1BF4 A;  3K80 C;  1NY4 A;  3S1M H;  2KJX A;  4DV7 L;  4KMU C;  2IPK D;  3A5U A;  1S72 A;  3K81 C;  3KK7 A;  2KCN A;  2N55 A;  4LF5 L;  2F0I A;  4J1M A;  1GHK A;  3AEV A;  4KKS A;  3PO2 H;  2KOL A;  4IFD I;  5LMN W;  5J1Z A;  3FVQ A;  1Q7Y C;  1EYC A;  4EVO A;  3IFT A;  4OO1 I;  2EYH A;  2B63 H;  1WTP A;  1G91 A;  4XQN A;  1I4G A;  1V9P A;  3PGZ A;  3MXG A;  2LY7 A;  3N6R A;  1U4P A;  3H3V H;  3BVZ A;  3MXP A;  4GN5 A;  4RFB A;  4BBR G;  2PPB C;  1BQQ T;  3HEJ A;  3K7A B;  3BYY B;  1VQP A;  4A3E H;  4LUO A;  1B2T A;  4DU9 A;  1T5E A;  1KAB A;  2KVM A;  2JEB I;  1TWH B;  4K2L A;  4K6D A;  5C3X A;  2E75 C;  1C8C A;  5FLM G;  4ZKB B;  1P16 A;  2A1A A;  4XDX A;  4DR7 Q;  2D0P A;  1EYA A;  1TS4 A;  5GAD C;  4JC0 A;  3EBE A;  4H7B A;  2WKD A;  3K5N A;  2E2I H;  4B3R Q;  1SSO A;  4DAY B;  1EUJ A;  3H0G G;  5DNF A;  3P1H A;  5GAH C;  1HNX Q;  2IY5 B;  5D14 A;  2KEC A;  4C3H H;  2R93 H;  4M1U B;  4LJZ C;  1VQ5 A;  1HA5 A;  5EPJ A;  3D4R A;  4L5R C;  3A8I E;  4IFD G;  1SN8 A;  3R8B A;  3GTQ H;  2IHE A;  2VZA A;  5EGT A;  4DR3 Q;  4O1N A;  2L4N A;  1CZG A;  2RQX A;  2RHS B;  4JI0 L;  4OO1 G;  2MPM A;  1PRT D;  1F9Q A;  1GUT A;  2NVY H;  4DR2 Q;  4KI0 A;  2K5D A;  1PTO H;  2PI2 E;  4K8J A;  4EQ5 A;  4P71 A;  3WDN A;  1JMC A;  3PUX A;  2LXK A;  2K1B A;  1EL0 A;  4HJ7 A;  2NZ1 D;  1YNJ D;  4X64 L;  3P7J A;  2QIL A;  4JI4 Q;  1PFS A;  4MHE A;  1MGS A;  4BS9 A;  4X6A H;  2MO1 A;  1TY2 A;  1NE3 A;  1QNU A;  1W3S A;  2EYP A;  4IO9 A;  3C1F A;  1CZW A;  3M4O H;  2X6L A;  1NJI C;  2JA6 H;  3FEW X;  3LGJ A;  4J15 A;  3UDG A;  3J81 E;  5C4J B;  3SGI A;  1Q46 A;  1JWU D;  2O4X A;  3BZD B;  5LMN Q;  4DUZ L;  1UE6 A;  1EY8 A;  2IX0 A;  3MXU A;  4Z9C B;  4K5V A;  5I2X A;  2WB1 E;  3NBH B;  4TSS A;  1HFG A;  2MUY A;  4OIJ A;  3STB C;  4HJ5 A;  4IOC A;  3HOV G;  3CQZ B;  3NUC A;  3HOZ G;  1OXT A;  3T1H L;  1CTM A;  1GO3 E;  1CM9 A;  1EIG A;  2K5V A;  4NDX A;  2UXB Q;  1K73 C;  1BCP F;  3NTK A;  4CHT B;  5A2Q E;  1XMQ Q;  4BWG B;  4GNX B;  1R4Q B;  4EQN A;  5M3F G;  3CPF A;  2M00 A;  5C5M A;  1EQV A;  3NHH A;  5M5W B;  1H9J A;  2VQE Q;  3RLO A;  1G29 1;  2EJM A;  5ELD A;  1MJC A;  3F2D A;  4DR4 L;  3R3O A;  5CBE E;  5M3M H;  1PVO A;  5J39 A;  4DV6 L;  1A2U A;  1F2Y A;  4RGM A;  4DN4 M;  2GVB A;  3I55 A;  3J7Y W;  1WD0 A;  2UUB Q;  2F4V L;  2L0C A;  1N36 L;  4J6H A;  3AB9 A;  4BBS G;  1K3R A;  1MI2 A;  2JSO A;  3KLR A;  1SNC A;  3TS2 A;  1K8A C;  1V8Q A;  3I2Z A;  3RZD B;  1AP0 A;  2RF4 A;  2M2L A;  3S24 A;  2N88 A;  3E0J A;  3CCS A;  4K0K L;  3S1N B;  1YHQ A;  3E0E A;  1JC7 A;  2YYZ A;  2KCC A;  2FJ2 A;  1SNQ A;  3ERQ A;  4I7A A;  4JI2 Q;  2F1M A;  1VQD A;  2BA0 A;  5C0X H;  2Z4H A;  3HKZ B;  1SNO A;  4ZLT F;  2JP1 A;  1SMX A;  2DY8 A;  3CC7 A;  1PYB A;  1ONL A;  2G5D A;  4IUT A;  3GTM B;  1CQF A;  1PFN A;  1PZJ D;  3D3R A;  2D0O A;  2CVR A;  1B9N A;  1HJP A;  3GTG H;  1HNW L;  1VF5 C;  4BY7 H;  3W5O A;  1K28 A;  2F0E A;  2JA5 B;  1J9O A;  2VB3 X;  1QNK A;  2GVA A;  3MXN B;  2ALY B;  1H9K A;  1R9T B;  5E4X A;  1BCP C;  2BE5 D;  4X62 L;  3FRP B;  2L55 A;  2F0S A;  3QR8 A;  2I5L X;  3Q6S A;  5CV8 A;  3NWT A;  2A73 B;  2NYZ D;  3QO2 A;  3LWU A;  1D1K A;  3AFP A;  3FP9 A;  4JI6 Q;  1PRT F;  1ML0 D;  4C2M H;  4UP9 A;  1EOT A;  4GKJ Q;  4E6I A;  5EKL A;  1Q90 A;  3PUW A;  2ZJP A;  1F9P A;  2CWP A;  1EYG A;  3GTO B;  3AYH B;  5ISR A;  3JAM L;  2OF1 A;  4R1J A;  1IW7 D;  5K5P A;  4M8A A;  4B3R L;  1XX8 A;  3BS1 A;  1Z9F A;  4YIJ A;  2QW7 A;  4DUY Q;  1QVF A;  3SK6 A;  1ZYR D;  3K8A A;  1SYF A;  3D6W A;  3TZU A;  3DLL A;  3NPP A;  3IL8 A;  2Q2H A;  5C44 H;  3M3Y B;  1SE8 A;  4X3S A;  1IBL L;  3NEM A;  3HOU B;  1U4L A;  1WFQ A;  2PCF B;  3CCQ A;  3UDF A;  1EY0 A;  5JOB A;  3H91 A;  2LFN A;  4X66 Q;  1PH1 A;  1XNQ Q;  3Q23 A;  2X69 A;  2PW5 A;  1OXS C;  3NQI A;  2CQA A;  3FKI H;  3HOY H;  1STN A;  4A3D H;  4OON A;  4ILW A;  4HSV A;  3X3M A;  5FLX c;  1PH8 A;  2AQ2 B;  1JIC A;  4UP8 A;  4DPG A;  3CCJ A;  4DK1 A;  4HIM A;  4DNR B;  1K9M C;  4LAA A;  4JI4 L;  1A3T A;  4YHH Q;  3M4Q A;  2PQA B;  2VS1 A;  1HNZ L;  4FO2 A;  1RCV D;  1Y1V H;  3J80 E;  2Z8L A;  1CKM A;  2YTY A;  2MNA A;  1DON A;  1QIL A;  4LFC Q;  2RDF A;  5LMN L;  1FNW A;  2L1B A;  2XWB B;  1I6V C;  2DY7 A;  3GO5 A;  1WTR A;  2F0G A;  5C3E H;  1LT6 D;  1PRT C;  1QJO A;  2Y0S G;  1E2Z A;  2AKW B;  1EU3 A;  3B6Y A;  1TS2 A;  4ME5 A;  4UAI A;  4IPG A;  4HMJ A;  5KEE A;  5FLX L;  1YNJ C;  1VQN A;  1AW7 A;  3JC6 6;  5KND A;  2JE6 I;  1XMQ L;  4LF7 L;  4KHV A;  2N78 A;  1KL9 A;  5T1G A;  3W1G A;  2XVS A;  5M5Y B;  2VQE L;  2MP1 A;  3A5Z B;  4MTN A;  3F2U A;  4OWX B;  3FHW A;  2QGQ A;  2R3Z A;  3HKS A;  1M8A A;  3I56 A;  3I70 A;  4DV2 L;  1JQY D;  2KUM A;  2B8G A;  1S40 A;  3K5L A;  2FFK B;  3ERO A;  1S5D D;  4I7Z C;  5GAE C;  4DV3 Q;  2EDG A;  4PV1 C;  4RA8 A;  4DGZ A;  1F77 A;  3NQT A;  1D5X C;  4K6L A;  4QQB X;  3KLW A;  2B8F A;  3OYY A;  3UDI A;  4DAY A;  1U4R A;  4HIK A;  1EY4 A;  2HUG A;  1V1O A;  4FYD A;  5FO7 B;  4XYQ A;  5G3L D;  3K0X A;  4LFB Q;  3GTM H;  2B2T A;  4JOI A;  2YU9 B;  3OIP A;  1IXR A;  1PZI D;  3KLS X;  3RN5 A;  1YJN A;  4O2D A;  5D3I B;  2K75 A;  4QF4 A;  1N33 L;  2J0T D;  2Z6B A;  3QJY A;  3TSS A;  2JA5 H;  4JI2 L;  1S4Z A;  2F0V A;  4NXM Q;  1BDO A;  5I6W A;  5LMU Q;  2QDB A;  1HUN A;  1X9N A;  1OXV A;  3A7A B;  4C3J B;  4DV1 Q;  4B3S Q;  3GTP B;  3S2H B;  1I4P A;  1I50 H;  5GRO A;  2JA8 G;  5GQO A;  2JA7 H;  1V1P B;  3D6C A;  1HHV A;  2F0D A;  3DUZ A;  2IWH A;  4XYO A;  3PIO A;  2GA4 B;  2R92 H;  3M4Y A;  4LWC A;  3CD6 A;  4HN7 A;  3VYR A;  3LNN A;  3TN2 A;  1ILQ A;  2F0Q A;  1SYG A;  4ID6 A;  1K0R A;  4PMW A;  5FKA C;  4RCN A;  2ENB A;  1OTC A;  1PH3 A;  3TBI B;  5IYD G;  4HED A;  2RCN A;  2E2D C;  1H9S A;  4JI7 Q;  2JN4 A;  2V4D A;  4GLA C;  4A3C H;  1KTK A;  1EWI A;  2K5W A;  1GJX A;  5FJ8 G;  3NBH A;  2O5J C;  2R7Z B;  4KY7 A;  1TWC H;  2PNH A;  3I7F A;  2LMC B;  1X3P A;  3E9I A;  2EOT A;  4IJH A;  4A3J G;  2RCF A;  1XNR L;  4GKJ L;  1QOH A;  4GNX A;  3GV6 A;  4XQQ A;  1KIX A;  5I9O A;  3GD7 A;  1MIU A;  2E5L Q;  3GTK H;  3TP6 A;  1STY A;  1BNZ A;  1Y8N B;  3KF8 B;  1J5E L;  2B2T C;  4TQU S;  1TY0 A;  3HRZ C;  2E8G A;  2BE5 C;  1I5F A;  2XSC A;  2C5C A;  1WCM B;  5C4H A;  2F52 A;  4DUY L;  2Z4I A;  4R4O A;  5IP9 G;  2JEA I;  5ELN A;  2IT1 A;  4QIW B;  4H0L C;  1HZB A;  2XNA C;  3BZC A;  3PO3 H;  4PQX A;  2R7D A;  4BY1 G;  1DD2 A;  3MFY A;  4RHS A;  2VQF Q;  1LTL A;  1A8V A;  4R9W A;  4L8J A;  4NXN Q;  5IP7 H;  4G57 A;  2RBM A;  1STG A;  1ET9 A;  4UDU C;  1STB A;  4YWM A;  3RN2 A;  4IFD J;  1II3 A;  3HOW G;  1U9R A;  5IOC A;  3BVG A;  1IW7 C;  5CV9 A;  3DEO A;  1I6H H;  4RGO S;  2VUM G;  4IUP A;  1B4O A;  1I3Q B;  4IZ8 A;  3NWS A;  3ZJY C;  1SRU A;  1X55 A;  2Q8T A;  1TS3 A;  4NPS A;  3OSO A;  1ZYR C;  4DF7 A;  5EBC A;  1ASZ A;  3KBG A;  4NW2 A;  3HOX H;  2E76 C;  1NSN S;  3ZYY X;  4C3I G;  2F0F A;  3HKZ E;  3KLS A;  4TVA B;  2F03 A;  1CSP A;  4WJW A;  3ULL A;  3C2P A;  2K6A A;  4LFC L;  2UU9 L;  4GLX A;  2EY1 A;  2H1E A;  3CF5 A;  4BBR B;  1PH9 A;  4LF6 L;  1LM0 A;  4IJL A;  5K36 G;  2I5H A;  3TME A;  3QOL A;  1JJC B;  3MXN A;  2VW9 A;  3I4N H;  2WB1 G;  4JBJ A;  4NB3 A;  3DWQ A;  5I6Y A;  1X3Q A;  5G3L F;  4DV0 Q;  5ELB A;  4FDB A;  2LSS A;  1FJG L;  1PRT B;  4OWW B;  3P20 A;  1S5C D;  3J7A 5;  3I73 A;  4YY3 L;  2FIN B;  1L1O C;  3WOE A;  4R8N A;  4S3S A;  4ZCK A;  2M9V A;  3TQY A;  3Q24 A;  4HCE A;  3WOF A;  1EQT A;  4Y7N H;  2F3I A;  3H0G B;  2MHV A;  3PO2 G;  1O7L A;  4G7Z C;  3ICE A;  4A3F H;  5COR A;  4DV3 L;  2B63 G;  3T1Y L;  1H95 A;  3K5O A;  2NZH A;  1I4H A;  1TWF B;  5E3F A;  1SNP A;  1X32 A;  3SEB A;  1CUK A;  1SYE A;  1KDC A;  3QG1 A;  1XXG A;  4CGY B;  1VDZ A;  2CH4 W;  2ASB A;  4POG A;  5IIF A;  5ELE A;  1UE7 A;  3TP8 A;  1E1O A;  4A3E G;  1Y8P B;  2MO0 A;  2HHH Q;  2PQE A;  1C7Y A;  1TII D;  4DNT B;  2KEE A;  4WJ4 A;  4A3K H;  3M9B A;  5LMU L;  1OO9 B;  1VQJ A;  4R4C A;  2Q8R E;  3Q22 A;  1AZQ A;  4DA2 A; 
#chains in the Genus database with same CATH homology
 2HIX A;  3D0F A;  5IYC G;  3W1B A;  2JA9 A;  2JJQ A;  1YBY A;  2GVB A;  3I55 A;  1QVC A;  2ZTC A;  4B3T Q;  2AWN A;  1L1O A;  1WOC A;  3HKZ G;  3J81 j;  2LXJ A;  2KEN A;  2UUB Q;  2F4V L;  1N36 L;  1ASY A;  4GS3 A;  2R93 G;  4WJ3 M;  2A19 A;  4OWT B;  1OXU A;  5EAY A;  4PG3 A;  2PQA A;  5GAG C;  3VDY A;  1EQR A;  4BBS G;  1B7Y B;  1YI2 A;  1K3R A;  4OX9 L;  4BA1 I;  3I4N G;  4A4I A;  4DR1 Q;  1B70 B;  1Y1W H;  4LF4 Q;  1L0W A;  1UE1 A;  3TS2 A;  1K8A C;  1XPR A;  2UU9 Q;  2A8V A;  3I2Z A;  4DR6 L;  4A3L H;  2WP8 J;  2RF4 A;  2UXC L;  2BA1 A;  4X66 L;  4AH6 A;  2ZTE A;  1VQ8 A;  3S14 H;  4UP7 A;  4LF6 Q;  2YTV A;  4JI7 L;  4DKA C;  4LF8 Q;  1XNQ L;  1X54 A;  4YCW A;  2DGY A;  4MZ9 A;  1BVS A;  2N3S A;  3S24 A;  2ZJR A;  3CCS A;  2OTL A;  3L2P A;  4K0K L;  1NTG A;  3A0J A;  3E0E A;  4A3M G;  1YHQ A;  1Q86 C;  2UUA Q;  4A3I H;  3KF6 A;  4P72 A;  2YYZ A;  1E7Z A;  3CCM A;  3KJO A;  3F2B A;  1KAW A;  1XMO L;  1FJG Q;  2UXD L;  1KXL A;  2K52 A;  4JI2 Q;  1VQD A;  4YY3 Q;  2BA0 A;  1DGS A;  2K50 A;  1JE5 A;  1HZC A;  2MFI A;  4YHH L;  3H3V I;  2OQ0 A;  2V1C C;  5FJ8 H;  2ZTD A;  1SMX A;  4A3F G;  4ALP A;  3CC7 A;  2UUC Q;  5JJL A;  1BKB A;  1PYB A;  2JA6 G;  1JJG A;  4A93 H;  3J81 i;  1PHJ A;  4X64 Q;  2CKZ B;  2D0O A;  1QVG A;  1VQ7 A;  1HJP A;  3GTG H;  3CXC A;  1VQA A;  2VY3 A;  1HNW L;  2NVQ H;  4BY7 H;  3W5O A;  5M5Y H;  4JI8 L;  2GVA A;  3MXN B;  2ALY B;  5C0X I;  3T1Y Q;  4DAM A;  4QGU A;  1N34 Q;  4A76 A;  2RHQ B;  5IWA Q;  4X62 L;  3ERS X;  1S3O A;  4GKK L;  1O7I A;  1VS0 A;  4DUZ Q;  1I3Q H;  4AIM A;  2AWO A;  4PZ6 A;  1N32 Q;  1X6O A;  2I5L X;  2CCZ A;  2D62 A;  3CPW A;  1EOV A;  4XTC S;  2L15 A;  4NXN L;  1VQE A;  3UE1 A;  4DV4 Q;  5M3M G;  4DR5 L;  3T1H Q;  3AFP A;  4A3K G;  3FP9 A;  2WFW A;  4JI6 Q;  3L0O A;  3CMA A;  3HOU G;  4C2M H;  4UP9 A;  4AYB G;  1NBW A;  1QZG A;  4JYA L;  1M1K C;  3S17 H;  2OQK A;  4R4I A;  4GKJ Q;  3CAM A;  4A3G G;  2IHF A;  3GTJ H;  5C0X J;  2Q2U A;  3PF4 A;  3RNU A;  4LF9 L;  2E2H H;  5HY6 A;  4YCV A;  3PUW A;  4LUZ A;  2ZJP A;  2CWP A;  4DK6 C;  4LW1 A;  5C4X G;  1EYG A;  4GOP B;  2YU9 H;  5JJI A;  1T9H A;  3AYH B;  4DV6 Q;  4JI5 L;  4JV5 L;  2XGT A;  4R1J A;  3KOJ A;  4JCV E;  3TS0 A;  4B3R L;  2K14 A;  3I4M H;  1Z9F A;  3BJU A;  4DUY Q;  4YWL A;  1GKH A;  1PH7 A;  3S16 H;  2VUM H;  1QVF A;  3CP0 A;  1Y1W G;  3PF5 A;  3K8A A;  4A3B H;  3PUY A;  4A3L G;  5JJK A;  2F4V Q;  1AE3 A;  1N36 Q;  1IBM Q;  3DLL A;  1NMG A;  1VQC A;  2R7F A;  2Q2H A;  1CKN A;  4C3J H;  5C44 H;  4LFB L;  1SE8 A;  1IBL L;  3GTP H;  4OX9 Q;  3NEM A;  3S2H H;  5BR8 Q;  1IZ6 A;  1WFQ A;  4A3I G;  1Q1E A;  3CCQ A;  3UDF A;  5ELO A;  1XTD A;  4X66 Q;  1VQG A;  5IYB H;  1K8G A;  3PV0 A;  3CW2 C;  1PH1 A;  1XNQ Q;  5C0X G;  3OTO L;  1Z47 A;  1E24 A;  4NXM L;  1C0A A;  4K0K Q;  1OXS C;  1CSQ A;  3FKI H;  1NMF A;  3HOY H;  4A3D H;  4OON A;  1WYD A;  4APV A;  3ER0 A;  1TWF H;  4A93 G;  1E22 A;  1GD7 A;  2KCT A;  4DV1 L;  4B3S L;  4BXX H;  5FLX c;  4HID A;  1PH8 A;  4DPG A;  3GTL H;  4UP8 A;  1TWA H;  3CCJ A;  2UXD Q;  4ME3 A;  1KC8 C;  4HIO A;  1L1O B;  4HIM A;  3UE0 A;  1K9M C;  3G4S A;  1UE5 A;  1SFO H;  1U5K A;  4JI4 L;  4BY7 G;  1D7Q A;  4YHH Q;  1SRO A;  2YTX A;  3M4Q A;  3S1R H;  1KD1 C;  2PQA B;  2VS1 A;  4JI1 Q;  1HNZ L;  2R7Z H;  2ID0 A;  1Y1V H;  3EN2 A;  3PUV A;  4GLV B;  1EFW A;  1MJE A;  1D8L A;  1GM5 A;  4P75 A;  4KHP L;  4JOI C;  5C4X H;  1CKM A;  2YTY A;  2MNA A;  3PIP A;  2JA8 H;  2K5N A;  2FXQ A;  4LFC Q;  3L7Z C;  1HNW Q;  1SR3 A;  4JBK A;  5LMN L;  2N8N A;  4DV5 Q;  3GO5 A;  2Z0S A;  3H15 A;  5C3E H;  2B29 A;  2CQO A;  4L5T A;  2Y0S G;  3TRE A;  2K4K A;  1PV4 A;  3KF6 B;  1V43 A;  2AKW B;  1VQ9 A;  1HZA A;  3B6Y A;  1EIF A;  1G51 A;  4X62 Q;  4IPG A;  2YV5 A;  1XPO A;  2ES2 A;  4GKK Q;  1LUZ A;  1WCM H;  5IY0 A;  5IYD H;  1EQQ A;  4POF A;  4JI0 Q;  5IT9 c;  1VQN A;  3JC6 6;  1XPU A;  2JE6 I;  4QIW E;  1XMQ L;  2ZJQ A;  2HHH L;  4LF7 L;  2PMZ E;  3STB D;  2N78 A;  3AFQ A;  1KL9 A;  4LFA Q;  1Q1B A;  3W1G A;  1VQ4 A;  2GN5 A;  4DR5 Q;  2VQE L;  1X3F A;  3A5Z B;  2E5L L;  4AQY L;  3HOZ H;  4PZ8 A;  5DLQ E;  1JJ2 A;  1J6Q A;  1IBK Q;  1Y14 B;  4MTN A;  4OWX B;  2ZM6 L;  3UDX A;  4JYA Q;  1HR0 L;  3FHW A;  3I4M G;  2QGQ A;  5AJ3 L;  2NVT H;  4MNO A;  3HKS A;  2QEX A;  2C35 B;  3I56 A;  3OW2 A;  4A3J H;  3KDF A;  1A62 A;  1I94 L;  4DV2 L;  1LYL A;  3IRB A;  3TEH B;  3CCE A;  3CCL A;  1S40 A;  2CFM A;  4R4Q A;  4A3B G;  1N9W A;  2OTJ A;  3K7A H;  5GAE C;  4DV3 Q;  1QZH A;  1RIP A;  3PCO B;  4B3T L;  3JAM c;  3WWV A;  3RLN A;  4JI5 Q;  3F2C A;  4JV5 Q;  2EQS A;  5C44 G;  2Q2T A;  4QQB X;  4R4T A;  1TWH H;  3NEL A;  3KLW A;  3OYY A;  1TWG H;  3UDI A;  3M7N A;  1YIJ A;  4HIK A;  4DR1 L;  2Y0S E;  1X3E A;  5IP9 H;  1KRS A;  1YNX A;  2VQF L;  4HJ8 A;  5IYB G;  1BBU A;  3S2D H;  4GNX C;  1VCI A;  3KYH C;  1RL2 A;  3K0X A;  4LFB Q;  3BZK A;  1IBL Q;  1VQM A;  4LF8 L;  3GTM H;  2JK8 A;  4JOI A;  4KHZ A;  1IXR A;  3RN5 A;  1IYJ B;  3FKI G;  2CWA A;  2AHO B;  2BH2 A;  1YJN A;  4BY1 H;  3HOY G;  4A3D G;  4O2D A;  4P73 A;  4JI3 Q;  1WJJ A;  2K75 A;  4X65 L;  2UUA L;  4BXX G;  1X3G A;  1N33 L;  4DR4 Q;  2PI2 A;  2JA5 H;  4BBR H;  3OTO Q;  1EIY B;  2IX1 A;  4JI2 L;  4DR7 L;  3GDE A;  3RR5 A;  4NXM Q;  4EX5 A;  2HT1 A;  2NZO A;  5LMU Q;  3HFZ B;  1WI5 A;  2R7Z G;  1X9N A;  3HOW H;  1Y1V G;  1OXV A;  3J80 i;  2UUC L;  3F1Z A;  4DV1 Q;  4A3M H;  1VQO A;  2I0Q A;  4B3S Q;  2NN6 I;  3CCU A;  3J7Z C;  1HZ9 A;  1PYS B;  5HGQ A;  4QY7 A;  1P8L A;  1I50 H;  5GRO A;  3CC4 A;  4YWK A;  2OWO A;  4O0A A;  5GQO A;  2JA7 H;  2JA8 G;  5FLM H;  1YHB A;  3AQQ A;  5JEA J;  1AH9 A;  1HNX L;  2WAQ E;  3PIO A;  4LUV A;  1HNZ Q;  2R92 H;  1FL0 A;  1CKN B;  4LWC A;  5C3E G;  2KBN A;  4KLK A;  3CD6 A;  1VQ6 A;  1E1T A;  1KRT A;  3DM3 A;  4C3I H;  1K0R A;  4PMW A;  1KQS A;  4B3M L;  4KHP Q;  1YIT A;  3H0G H;  1OTC A;  1PH3 A;  1N34 L;  3M4P A;  2UXC Q;  1YJW A;  1WCM G;  4DR6 Q;  5IYD G;  4DV0 L;  2H5X A;  4DR3 L;  1VQI A;  4Y52 H;  4A75 A;  2RCN A;  4JI7 Q;  4GLA C;  4A3C H;  4IOA A;  1EWI A;  4DR2 L;  1M90 C;  5FJ8 G;  2I5M X;  1UWV A;  5C4J H;  4JBM A;  1B8A A;  3RZO H;  1TWC H;  3BU2 A;  4DV4 L;  2DUD A;  2BH8 A;  2PNH A;  3Q8D A;  1XMO Q;  1IL2 A;  3I7F A;  1QUQ A;  3E9I A;  5E7N A;  4JG2 A;  4HJA A;  2NVX H;  4LF7 Q;  4QL5 A;  4IJH A;  4A3J G;  1XNR L;  4GKJ L;  3TRZ A;  1JB7 A;  4GNX A;  3K80 C;  1NY4 A;  3S1M H;  1KIX A;  3ULJ A;  3CQZ H;  4DV7 L;  1YVC A;  5JEA G;  3GD7 A;  1MIU A;  2E5L Q;  3GTK H;  3A5U A;  2N49 A;  3U4V A;  1S72 A;  2ZM6 Q;  4DK3 C;  3K81 C;  3KF8 B;  2JQO A;  4TQU S;  1J5E L;  2E8G A;  3K7U C;  2KCM A;  5AJ3 Q;  4LF5 L;  4OXP A;  1I5F A;  3AEV A;  1JT8 A;  1I94 Q;  5M5W H;  4DV2 Q;  3PO2 H;  2VNU D;  4IFD I;  2F52 A;  4DUY L;  3KJP A;  4R4O A;  5LMN W;  5IP9 G;  4JI8 Q;  1Q7Y C;  3PSI A;  4IPH A;  2JEA I;  1YZ6 A;  1KHI A;  4OO1 I;  5ELN A;  1PA6 A;  2MQH A;  1YEZ A;  2IT1 A;  2B63 H;  1IBM L;  4HJ9 A;  2NN6 G;  1MKH A;  1HZB A;  3BZC A;  3G6E A;  3PO3 H;  1V9P A;  3PGZ A;  3EIV A;  2R7D A;  2VL6 A;  4BY1 G;  4LNQ A;  2UXB L;  4GN4 B;  5BR8 L;  2VQF Q;  2Q2I A;  2E2J H;  1LTL A;  1A8V A;  3G48 A;  4NXN Q;  3H3V H;  5IP7 H;  1UEB A;  3D31 A;  4GN5 A;  4BBR G;  2QA4 A;  2JA5 G;  3HOV H;  4UPA A;  3J81 c;  2KHJ A;  4YWM A;  3RN2 A;  1VQP A;  4IFD J;  4A3E H;  4LUO A;  3HOW G;  3A74 A;  3M85 A;  1A63 A;  1OXX K;  4GOP C;  1HR0 W;  2AMC B;  3KDF B;  4X65 Q;  3CC2 A;  1V1Q A;  1I6H H;  2JEB I;  3RZD H;  5M3F H;  4LF9 Q;  1N33 Q;  3PUZ A;  2VUM G;  3ZJY C;  1VQL A;  1SRU A;  5H1S E;  1X55 A;  2JA7 G;  1FGU A;  5FLM G;  1P16 A;  2A1A A;  5IE8 A;  1N8R C;  4DR7 Q;  4NPS A;  2D0P A;  5GAD C;  4GN3 B;  4JC0 A;  3EBE A;  2E2I H;  1W2B A;  2KHI A;  4YCU A;  2UUB L;  2R92 G;  1ASZ A;  3S1N H;  4B3R Q;  3HOX H;  4JI1 L;  2WAQ G;  1VQB A;  3CCR A;  4DAY B;  1EUJ A;  3U4Z A;  5IYC H;  1PH5 A;  3H0G G;  3HKZ E;  4TVA B;  1CSP A;  4JBW A;  5GAH C;  3ULL A;  4LF4 L;  1HNX Q;  4LFC L;  2UU9 L;  4GLX A;  4IPD A;  2IY5 B;  1VQK A;  3CME A;  4C3H H;  3NEN A;  3CF5 A;  4A3C G;  2R93 H;  4DV5 L;  1PH9 A;  4LF6 L;  4UY8 C;  1LM0 A;  1VQ5 A;  4IJL A;  4BBS H;  1BBW A;  1Q8K A;  2I5H A;  2Z6K C;  4B3M Q;  3S15 H;  1JJC B;  5K36 G;  3U50 C;  2VW9 A;  3I4N H;  2WB1 G;  2EXD A;  4JBJ A;  4L5R C;  4IFD G;  4NB3 A;  1SN8 A;  4RG1 A;  3JAM i;  3GTQ H;  4IPC A;  2IHE A;  2VZA A;  1CKO A;  4DV0 Q;  4FDB A;  3I4O A;  4DR3 Q;  2LSS A;  3MEF A;  1FJG L;  4OWW B;  2K5H A;  2RHS B;  4JI0 L;  1PH2 A;  4OO1 G;  3J7A 5;  4QJF A;  2NVY H;  4YY3 L;  4DR2 Q;  4KI0 A;  1R9T H;  1VQH A;  2PI2 E;  3J80 c;  1L1O C;  1YHA A;  4P71 A;  5J3B A;  4EQ5 A;  4LFA L;  4DNI A;  1JMC A;  3PUX A;  2LXK A;  4HJ7 A;  3TQY A;  3CCV A;  4RMF A;  1IBK L;  2B3G A;  3S1Q H;  1FVI A;  4X64 L;  1Q82 C;  1VQF A;  4Y7N H;  2F3I A;  1XNR Q;  4JI4 Q;  1E3P A;  3PO2 G;  1PFS A;  2ATW A;  1C9O A;  4X6A H;  2HIV A;  2MO1 A;  1W3S A;  1NE3 A;  4DV7 Q;  3ICE A;  4BA2 I;  1G6P A;  4A3F H;  3F8T A;  4IO9 A;  3M4O H;  1NJI C;  4DV3 L;  2JA6 H;  1J5E Q;  3LGJ A;  4J15 A;  4GOP A;  3T1Y L;  3UDG A;  2B63 G;  5M5X H;  1H95 A;  4LF5 Q;  3SGI A;  3PO3 G;  2NZH A;  4L5S A;  5IWA L;  1Q46 A;  5LMN Q;  4DUZ L;  1UE6 A;  3U58 A;  2IX0 A;  2OCE A;  3RLF A;  3G71 A;  1Q81 C;  1PH4 A;  1CUK A;  2WB1 E;  3NBH B;  1N32 L;  4H02 A;  3GTO H;  5IP7 G;  1GVP A;  4HJ5 A;  3STB C;  4IOC A;  3HOV G;  1AE2 A;  3HOZ G;  1OXT A;  2ASB A;  4POG A;  4P74 A;  3T1H L;  2HQL A;  1Q12 A;  1QUQ B;  1L2F A;  1UE7 A;  1E1O A;  4A3E G;  1SLJ A;  1GO3 E;  4PZ7 A;  4JI6 L;  1X56 A;  2K5V A;  2UXB Q;  2MO0 A;  1K73 C;  1XMQ Q;  2HHH Q;  4GNX B;  1C7Y A;  2R6G A;  5M3F G;  3CPF A;  1XJV A;  2XTI A;  4JI3 L;  1X65 A;  1YJ9 A;  2VQE Q;  3RLO A;  2EIF A;  1G29 1;  4DR4 L;  3F2D A;  1A0I A;  1MJC A;  4AQY Q;  1HH2 P;  3ULP A;  5M3M H;  2Z6K A;  4AYB E;  3M3Y H;  1PVO A;  3E9H A;  4WJ4 A;  4XIG S;  1TXY A;  3M9B A;  4A3K H;  3KFU A;  1HR0 Q;  4DV6 L;  5LMU L;  1PH6 A;  3HOX G;  3HOU H;  1VQJ A;  1K83 H;  4R4C A;  1U0L A;  4L5Q A;  4A3G H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...