4JYAQ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaQ00
5M3FG 2CWPA 4GOPB 4IO9A 3H0GH 3DLLA 1YJ9A 5IYBG 4X62L 1FL0A 1KRTA 1FVIA 1I5FA 3D0FA 1QZGA 3PUXA 5M5XH 1VQDA 3BJUA 4TQUS 2D0OA 2PI2E 4ALPA 4JI2Q 1C7YA 1X55A 2ATWA 3U50C 3PO3G 4JI4Q 4JI8L 1X6OA 3CC7A 4YCUA 3ER0A 4MZ9A 4DR4Q 4EQ5A 1I50H 5FLMG 4A3CH 4X62Q 3J81i 3PO3H 2R92G 3GTLH 1PFSA 1HR0Q 4A3GH 4R4QA 4B3SQ 4L5TA 1N36L 1EYGA 5K36G 4DUZL 1Q82C 3WWVA 1G6PA 2N78A 1JJGA 3HOVG 2KHJA 1UEBA 3S14H 2UU9L 5C0XG 1N9WA 4POGA 4JI4L 3FKIG 4L5SA 1HZ9A 2YTXA 3NELA 2RHSB 3T1HL 1Q81C 1VQ9A 3JC66 4DR5L 1G51A 3CCSA 3M9BA 4YY3L 1OXVA 3MXNB 3PCOB 4MNOA 1L2FA 3TEHB 2CCZA 1EIYB 4GKJL 4A3IG 4DUYL 4PZ6A 3CXCA 3F2BA 4DR3Q 3W1BA 1Y1WG 5EAYA 4LF5L 2VL6A 1Q8KA 4C3HH 1FJGL 2K14A 2K4KA 4GN3B 1NMGA 2LXKA 4OWTB 5BR8Q 1SR3A 2QGQA 4QQBX 3H0GG 1PH2A 1PH8A 4A3KH 4O2DA 4QGUA 4DR1L 4LF4Q 3HOVH 1E7ZA 1X3GA 3ULJA 1VQ5A 4NXNL 1XNQL 5IYDH 4LF6Q 5GADC 1KQSA 2YU9H 4X65Q 2VQFL 1OXUA 2VY3A 2QA4A 4DV1L 5LMNQ 3HKZE 2MO1A 1VQGA 4YWLA 1E3PA 4B3TL 3TQYA 1VQMA 4KI0A 2ZTEA 3E0EA 5IYCH 1N33Q 5JJIA 3H15A 4LF9Q 2JA5H 1E1TA 3RR5A 3PIPA 3S1RH 3I4MG 1WJJA 1IYJB 3KOJA 2ZJQA 1NY4A 4A3EG 4IPGA 3TREA 3HOUG 3F8TA 1IBLQ 3PF5A 4B3RL 2I5HA 5C4JH 1CKOA 4A3EH 1EQRA 1VQOA 1U5KA 2EXDA 4XTCS 3PIOA 3ERSX 4GOPC 4IPDA 4R4OA 4GOPA 1NE3A 3W5OA 2Q2TA 4A3GG 3PF4A 3S1QH 1DGSA 1VQEA 4NB3A 1YHQA 1HNWL 2V1CC 5JJLA 4JOIA 1GO3E 3LGJA 1IBLL 1OXSC 4JOIC 1PH1A 1L1OA 1SN8A 2BH8A 3FHWA 1PV4A 3HOXH 2R7FA 2DGYA 2Z6KC 3F1ZA 3HOWH 4IFDI 2Q2UA 4BY1H 1PYBA 3AQQA 5ELOA 1YIJA 4JI2L 2AWNA 2Q2IA 3RLFA 3UDIA 1GD7A 3OW2A 2MFIA 3PGZA 1JJCB 2PMZE 1X3EA 4C3JH 5IWAQ 1MKHA 4GNXB 3CC2A 1AE2A 4MTNA 3G71A 3RZOH 1VS0A 2CQOA 4QY7A 1Y1VG 4DNIA 4OONA 2LXJA 4UPAA 2JA7H 4PZ8A 1P8LA 1XNQQ 4A3JH 1N36Q 3CPFA 1WYDA 4LFBQ 3GO5A 2JQOA 5C44G 1CKMA 2HHHQ 5FLMH 4A3CG 3SGIA 5DLQE 1MJCA 1QVCA 4HJ7A 2YV5A 5LMUL 2UUCQ 4A93G 2OWOA 1OXTA 3KYHC 4JBMA 1JE5A 1K9MC 2QEXA 4DV0Q 3UDXA 1YJNA 5GQOA 1UE5A 2NVTH 1LM0A 5JEAJ 4OO1I 4UP9A 1XPOA 2OQKA 5C0XJ 3OTOQ 5LMNW 3HOUH 4BY7G 1EOVA 1NJIC 1BVSA 3OYYA 4FDBA 5LMUQ 1LYLA 1N8RC 4DV7L 4DK3C 4DR7L 4GN5A 2UUBL 3HOXG 4JI1Q 4GLXA 1KC8C 1JMCA 2B63H 2JA8G 3S2HH 4X66Q 3PO2H 3GTMH 1YI2A 4DPGA 3U4ZA 3GTGH 1IZ6A 1KHIA 3S15H 4RG1A 2NVQH 2JE6I 2I5LX 5M3FH 5ELNA 4A76A 1RL2A 4HJ8A 1HNZQ 2IX1A 3S17H 1N34Q 1N32Q 4B3MQ 2Q2HA 2F52A 1JB7A 4LF9L 2PQAB 1PH6A 5HGQA 2GVBA 3G4SA 4KHPL 1YHAA 1VQ7A 4DR5Q 5IT9c 4BBRH 2D0PA 3KLWA 2ZJPA 4HIMA 2D62A 5E7NA 1IBKQ 1HZCA 4HJ9A 3M7NA 2Y0SG 4BY7H 4WJ4A 3G6EA 1JT8A 4JI6L 1NMFA 1MIUA 5IY0A 3ICEA 4A3FG 1SMXA 3EN2A 4PMWA 5FJ8G 1Y1VH 3M4PA 3J81j 2R92H 3CCRA 2NN6I 1SROA 4DV5L 2HQLA 2R7DA 4JBKA 2VUMH 2RF4A 2UXDL 3J80i 4LF7L 1KD1C 4JI0L 4K0KL 4X64Q 4YWKA 2GN5A 2R93G 1VQ6A 5AJ3Q 1IBML 2Y0SE 5C4XH 3M3YH 4BY1G 5GAHC 1XMQL 1VQLA 1QVGA 1VCIA 4ME3A 1PYSB 2E5LL 3HOZH 3CCUA 1TWGH 2MQHA 1X54A 2OCEA 5IYDG 2BA1A 1D8LA 3KDFB 1PH7A 2MNAA 3F2DA 3CCJA 2B3GA 4LFCQ 4B3TQ 5C3EH 4LF7Q 1K73C 2JA6G 1NBWA 2K5NA 4GLVB 2E2HH 2IT1A 3K0XA 2UU9Q 1Q12A 2LSSA 1XMOL 1Q46A 4GN4B 4R1JA 2IHFA 1BBWA 1BBUA 3KF8B 4PZ7A 2N8NA 2VW9A 1WOCA 4A3LG 4IJLA 3AYHB 4QIWE 1A63A 4J15A 4DKAC 3L2PA 2KBNA 1Q1EA 4DR4L 2Z6KA 4HIOA 2K5VA 3J7A5 1N34L 3ULLA 4DV6Q 3I4NH 1TXYA 4R4TA 1J5EL 4P73A 3KJPA 2R7ZH 4KHPQ 1WCMG 4C3IH 1IL2A 4DV3Q 1W3SA 3A5ZB 3HKZG 4DR2Q 3CPWA 5LMNL 1D7QA 3I2ZA 4DV7Q 1VQFA 1HNXL 4DR7Q 1C0AA 1YHBA 2WB1E 3PUVA 1V9PA 3GTOH 2UXBQ 4JI5L 2UUAQ 4JI1L 2WB1G 4DV4L 3CCQA 1Q7YC 2YTVA 1S3OA 5IWAL 3F2CA 2BA0A 1FJGQ 3JAMc 1FGUA 1EWIA 5IP9H 5BR8L 2F3IA 1A0IA 1W2BA 3CCVA 3CQZH 4AYBG 4B3ML 2Z0SA 2ZTDA 3AFQA 4JI8Q 4R4CA 1C9OA 4A3DG 1Z9FA 4QL5A 4NXML 3AEVA 1Q86C 1GVPA 3GTKH 3VDYA 3HOZG 5IP9G 3A0JA 4JV5L 3CMEA 1K8AC 4LF8L 4YHHL 4OX9Q 3NBHB 4TVAB 3K7AH 3TS0A 2UUCL 3GD7A 4C2MH 1LUZA 3RZDH 1SE8A 3I4MH 2VQEQ 4AQYQ 4JI3Q 3CD6A 2ZTCA 1XJVA 2ZM6L 4LUZA 1YNXA 1G291 1S72A 4B3SL 3HKSA 2K52A 2K50A 3DM3A 2VZAA 2JK8A 2AMCB 2CWAA 4LFAQ 3OTOL 3KF6B 4NPSA 4GKJQ 2NVYH 4WJ3M 2ALYB 4DR3L 3PUYA 1XPRA 1HJPA 1VQBA 2E5LQ 2OTJA 1EQQA 1X56A 1L1OC 1HZAA 2FXQA 4A3DH 1N32L 4YY3Q 4A3KG 3T1YL 2YYZA 4IOAA 2ID0A 3RN5A 3S1MH 5M3MG 1QUQB 1TWCH 4KLKA 3I56A 1QZHA 5HY6A 4AYBE 1HNWQ 1UE7A 1E22A 1GKHA 4X65L 2VQFQ 2HHHL 4JI7L 3Q8DA 3RN2A 1V43A 2IX0A 4DV1Q 1XMOQ 4JI6Q 4DR1Q 3CCEA 1LTLA 4DR6L 4UP8A 3FP9A 2UXBL 4GKKL 4QJFA 4P75A 1YBYA 1SLJA 1K0RA 1Q1BA 2C35B 4GS3A 2PNHA 3KJOA 4HIDA 2AWOA 1VQKA 3K7UC 1K3RA 3GTPH 2VNUD 2CKZB 1VQCA 3BU2A 1QVFA 4A3JG 3S2DH 2KENA 1N33L 4DV2Q 5JJKA 3ZJYC 3K80C 4JBWA 2B29A 1XMQQ 1V1QA 2IHEA 2A19A 3HOYH 4JI0Q 3ULPA 2RHQB 3K81C 5IP7G 5AJ3L 1YVCA 1I94Q 1CSPA 4DAMA 1VQ4A 4JBJA 1VQNA 3H3VH 1WI5A 1K83H 3J7ZC 4IJHA 1Z47A 2OTLA 4X6AH 4JI3L 2VQEL 5JEAG 4AQYL 2JA9A 4JI5Q 1R9TH 4APVA 1ASYA 2JJQA 1PH9A 1KAWA 4DAYB 3J80c 2F4VQ 4LF4L 1IXRA 4DK6C 5M3MH 1CKNB 1L0WA 3UDFA 1VQ8A 2VUMG 3W1GA 1B70B 1SRUA 4OWWB 3RLNA 4P72A 3PV0A 4YWMA 3TS2A 1TWAH 1CKNA 3NEMA 4GLAC 1HR0W 2EIFA 3S16H 3H3VI 4NXMQ 3T1HQ 1I6HH 3TRZA 1YZ6A 3GTJH 4YCWA 2AKWB 2DUDA 3NENA 4YCVA 4L5RC 4LW1A 4X66L 1KRSA 2F4VL 2GVAA 2XTIA 2ZJRA 5C44H 3J81c 3IRBA 1UE1A 4BA1I 4BA2I 1ASZA 2UXCL 4K0KQ 4JYAL 4LUOA 2I0QA 4JC0A 2VS1A 2JA5G 4P71A 2ZM6Q 2CFMA 1EIFA 3GTQH 1UE6A 3L0OA 2NN6G 3AFPA 2R93H 3G48A 3U58A 1MJEA 1O7IA 2K75A 2N49A 2PI2A 4DV3L 1WCMH 2H5XA 3D31A 4DV0L 3CMAA 3PSIA 1IBKL 4RMFA 3STBD 1XNRQ 5M5WH 3M85A 3GDEA 3S1NH 1KL9A 1P16A 3KDFA 4DV2L 3HFZB 4A93H 4OXPA 1VQIA 3A74A 2JA6H 3A5UA 3M4OH 1EUJA 3HOYG 4DUZQ 2YTYA 1E1OA 3PO2G 2R6GA 1X3FA 4X64L 5GROA 1A62A 1X65A 4JI7Q 5FJ8H 3HOWG 1QUQA 4B3RQ 3CP0A 3I7FA 5IE8A 1K8GA 1E24A 2UUBQ 3M4QA 2A8VA 1KXLA 1HZBA 5C3EG 4IFDG 2WAQG 4YHHQ 3PUWA 1U0LA 1BKBA 2A1AA 2PQAA 3MEFA 3UE0A 3JAMi 4IPHA 4BBRG 2JA8H 4LFCL 1S40A 4P74A 2E2JH 1VQAA 4OWXB 3K8AA 3I4NG 3KF6A 4Y52H 1PA6A 1HH2P 1I3QH 2JA7G 4OO1G 5FLXc 1YJWA 1KIXA 1YEZA 4IOCA 5C0XI 3UE1A 3CC4A 2HIXA 4LNQA 5GAEC 1Y14B 3E9IA 3U4VA 4LFAL 5H1SE 2JEBI 3CW2C 2E2IH 1HR0L 4DV4Q 2HT1A 4DV5Q 4AH6A 1AE3A 2UXDQ 4HJAA 1CSQA 3RLOA 1M90C 1J6QA 4JYAQ 4HJ5A 1VQJA 1B8AA 2N3SA 3CCMA 1SFOH 2ASBA 4IPCA 5IP7H 3CAMA 5IYBH 5IYCG 4UY8C 2JEAI 4EX5A 2MO0A 1JJ2A 5M5YH 1TWFH 4A3LH 2L15A 1GM5A 2KHIA 4L5QA 4DR2L 4OX9L 3S24A 4BXXH 2NVXH 4A3MG 3E9HA 4R4IA 4POFA 3L7ZC 4DUYQ 2RCNA 4KHZA 3BZCA 1H95A 1XTDA 2NZHA 2EQSA 4GKKQ 3EIVA 4A4IA 1YITA 2E8GA 4XIGS 3CCLA 4UP7A 2WAQE 1PH4A 4A3BG 1PVOA 4IFDJ 2NZOA 4NXNQ 1RIPA 1EFWA 2KCMA 4JG2A 4LWCA 1PH3A 1A8VA 1VQPA 1I94L 4Y7NH 3STBC 4BBSG 5C4XG 5J3BA 4GNXC 1OTCA 2WP8J 1X9NA 1VQHA 2ES2A 4JV5Q 1B7YB 2HIVA 3T1YQ 1NTGA 4LF8Q 2KCTA 4AIMA 3KFUA 1J5EQ 2K5HA 1T9HA 1WFQA 4HIKA 1XPUA 4BBSH 1TWHH 4JCVE 2IY5B 4GNXA 1CUKA 2I5MX 2OQ0A 3I4OA 1XNRL 4H02A 4LF5Q 2BH2A 4O0AA 1PH5A 3PUZA 4LUVA 1HNZL 4A3BH 1IBMQ 4DV6L 3FKIH 4A75A 3I55A 4DR6Q 1PHJA 1L1OB 1AH9A 3RNUA 2R7ZG 4PG3A 4LF6L 2UUAL 4LFBL 1UWVA 2B63G 3B6YA 1OXXK 3CF5A 4A3IH 3UDGA 1Y1WH 1M1KC 4BXXG 4A3FH 3EBEA 4A3MH 2AHOB 3BZKA 1HNXQ 5GAGC 2UXCQ 2XGTA 2WFWA
chains in the Genus database with same CATH superfamily
1BOSA 4GOPB 3DXJC 3NWTA 1YJ9A 5IYBG 1FL0A 4YIJA 1FVIA 2WIIB 1WTHA 3GTLB 1U4LA 3R3OA 2A6HC 5EBCA 1D5MC 1HXYD 4XXEA 4ZUJA 4DR4Q 2QW7A 1ET9A 5FLMG 4NKLA 3VYTA 4X62Q 2CQAA 5M5WB 1PFSA 1HR0Q 2ICEC 1N36L 5K36G 4FF2A 4BY1B 1G6PA 3I4NB 3HOVG 3S14H 5FK9C 2UU9L 1SMYC 1N9WA 5C0XG 4POGA 1H9SB 1LTRD 2EDGA 2YTXA 1HQRD 2KQ3A 1RF2D 4KKUA 4KJOA 3T1HL 1VQ9A 1E0BA 2B2UA 4MNOA 4QF4A 3TEHB 2B2VA 4IN3A 3Q0AA 1Y1WG 3RZOB 4PZ6A 4LK1C 1GUTA 2VL6A 1Q8KA 4GN3B 4ZQ3A 1SR3A 1PZJD 1Q8IA 4QGUA 1GUSA 1X3GA 5IYDH 3ULJA 1XNQL 3LWEA 4LF6Q 4P2CB 1JCKB 2CW0C 5KNCA 2QA4A 2JN4A 3DWQA 3HKZE 1E3PA 4IUNA 3E6ZX 5LL6S 3H15A 1ILQA 3PIPA 3MEHA 3S1RH 1WJJA 2ZJQA 1NY4A 1F9PA 4IPGA 1WTPA 2KJXA 1ICWA 2PW5A 3NPPA 1VQOA 1XTCD 2L55A 4C3HB 3W5OA 3D3RA 3FMCA 4DNRB 3S1QH 5M5YB 5A2QL 2L11A 3DWPA 4NB3A 3A8KE 5HURA 2BOSA 3IKJA 2BDOA 4JOIA 2KHSA 3LGJA 1OXSC 1F77A 4NW2A 2DGYA 2KVMA 3K59A 2EY1A 2Q2UA 2Q2IA 3I4MB 1AH9A 2F1MA 3PGZA 5IGCA 5NUCA 3C2PA 5F2DA 2XSCA 1VS0A 2Y0SB 2EXZA 4UAIA 1Y1VG 4DNIA 3OMCA 4UPAA 1TU2B 4LFBQ 3GO5A 5CR3A 2JQOA 2TSSA 1TS5A 1W6JA 1G2SA 3SGIA 2XWJB 5DLQE 2UUCQ 3H91A 1Q3LA 1L0XB 2MHVA 1TY2A 1D1IA 3QO2A 4RKBA 2FMMA 2JA7B 4UP9A 1XPOA 2OQKA 5CV8A 3MAQA 4BY7G 1EOVA 3X3NA 4FDBA 3FKIB 4DV7L 4K14A 1EIHA 2DY8A 4C3IB 2RCFA 1EY5A 3A56A 1KC8C 4IZ8A 4X66Q 4FO2A 4G7ZC 3S15H 1HNZQ 1N34Q 3SHLA 2F52A 2PQAB 1YHAA 4OIKA 4BBRH 3KLWA 2D62A 1PTOF 5E7NA 4F87A 3G6EA 4JI6L 4Q5VA 1MIUA 5IY0A 1TWHB 3TZDA 3EN2A 3MTSA 1AFPA 5FJ8G 1Y1VH 3M4PA 1SROA 5IGFA 1SDFA 2RF4A 3RMHA 3J80i 4LF7L 1UUPA 1KD1C 3HG9A 5BN3A 1VQ6A 1I4XA 5C4XH 3FRPB 4H44C 2A6EC 1VQLA 4ME3A 2LKVA 3HOZH 3CCUA 1IYVA 2F0TA 2NTSA 2BA1A 4JVZA 2MNAA 5C3EB 3F2DA 4B9WA 4LAAA 3CCJA 4K5VA 4OGQC 5C3XA 4GLVB 1TWCB 2MGSA 2L12A 2E2HH 4JK1C 4TKOB 1Q12A 4HSPA 1WD0A 2IHFA 1BBWA 1F2LA 4A3LG 4IJLA 1A63A 5I9OA 4RH6A 2JA8B 4OL7A 1Q1EA 1WTWA 4IUTA 3BDLA 2J0TD 1BCPC 4KV6A 2HQEA 2Z9HA 3U9OA 4R8IA 4P73A 1J5EL 2K05A 1VMPA 2B2VC 4KHPQ 4C3IH 1IL2A 1QILA 3A5ZB 1KTKA 3BYTB 4F88A 3VYUA 1LLRD 4RCOA 4KY7A 5JPNC 2J4XA 4RKLA 3NTIA 4XDXA 1D7QA 1B53A 3N52A 2WB1E 3PUVA 4A93B 1V9PA 1S5ED 2E75C 2UUAQ 3GTKB 1I4HA 1B3AA 2WB1G 5CYUA 3GTGB 1LT4D 3CCQA 2YTVA 4K5WA 2BA0A 5J22A 4C56C 1EWIA 5BR8L 1CHPD 1HFGA 1PRTC 1A0IA 2F3IA 2Z0SA 2ZTDA 3AFQA 3SDZA 4QL5A 1I50B 5KYLA 3VDYA 4A3FB 2VB3X 1UAPA 4DAVA 3SK4A 2NVTB 2EZVA 3RZDH 2EYJA 1S5DD 5EPJA 2VQEQ 1XJVA 2ZM6L 4LUZA 1PLFA 3HKSA 2K52A 1GHJA 2VZAA 2CWAA 4FXDA 4NPSA 4A3JB 2NVYH 4DR3L 1K0SA 4I7ZC 2OTJA 5G3LF 1HZAA 2FXQA 1N32L 3V96A 5KIXA 1EY4A 1Y69U 4YY3Q 4A3KG 2F0OA 4IOAA 2ID0A 3S1MH 3HP3A 3MC0B 5M3MG 2NZ1D 2SDFA 3S16B 1UE7A 1EWHA 2Z4IA 2XRQD 1V43A 2F0MA 4JI6Q 2F3VA 1FR3A 4UP8A 1RHPA 2F0WA 1SLJA 2C35B 4CJ0B 1TWFB 3KJOA 3Q24A 2E2DC 4HIDA 1VQKA 3K7UC 2PZUA 2CKZB 4ME5A 1U4PA 1O78A 2WB1B 1MD2D 1QVFA 4QCLA 1UNSA 3S2DH 4UDUC 4DV2Q 2PZWA 3MFYA 4JBWA 5EGTA 2VXWA 2IHEA 1I6VC 2M9VA 1OO9B 1SNQA 3K81C 5IP7G 3SK6A 1I94Q 1VQ4A 2PO4A 1B9MA 3GV6A 1LABA 5C6AA 5LL6X 5CV9A 4IJHA 1Z47A 2OTLA 2VQEL 1ILPA 1ASYA 5BN4A 1PH9A 4DAYB 3FEWX 3VR6A 1L0WA 4CKBA 1VQ8A 3W1GA 1A3UA 5EKLA 3PV0A 1TWAH 1QOHA 2E2IB 4K8IA 1HR0W 2EIFA 2E76C 2XIWA 1PFMA 3D4WA 3PO3B 4LW1A 1S5BD 2ZJRA 1B3QA 3IRBA 4BA1I 4K0KQ 5E4WC 4JYAL 3SVMA 1LT5D 4P71A 2LMCB 2ZM6Q 1DJRD 2CFMA 3AB9A 3U58A 2HUGA 3K6OA 4QUCA 1WCMH 2H5XA 3D31A 3CMAA 1IBKL 4CBVA 3S1NH 4DV2L 4A93H 1QB5D 2IW3A 1I4QA 1LT6D 3BDOA 3M4OH 1E1OA 1X3FA 2F0PA 4X64L 5GROA 1A62A 2RDGA 5FOBB 4FVMA 1SYEA 3HOWG 1STYA 5IE8A 1E24A 2WACA 2C9OA 1QG7A 1U4RA 1KXLA 2WAQG 4ZUIA 4RGNA 3T56B 2DJGC 4F8MA 1SXTA 1PA6A 1I3QH 5FLXc 1YEZA 4CHTB 5C0XI 2HIXA 2PW7A 3MXNA 1Y14B 3G7LA 3E9IA 3CW2C 3E0JA 1FD7D 4DV4Q 4FF1A 4DV5Q 4AH6A 2HT1A 4N8FA 2UXDQ 4HJAA 4JYAQ 1ML0D 4ODGA 2EYFA 3CCMA 1SFOH 4MN3A 5D65A 1JJ2A 1TWFH 2PQEA 3I90A 3RD4A 2KHIA 4DR2L 4C1NK 1EL0A 2NVXH 1TT2A 4DUYQ 3L7ZC 1ENFA 1AZPA 1Y1VB 3BZCA 1H95A 2NZHA 4RFBA 3OW7A 2X69A 1DXMA 2E8GA 2PNRC 1GUGA 1WTVA 4NXNQ 2G9HD 4JG2A 1EY7A 1JC7A 1PH3A 1VQPA 1I94L 3HGBA 2F0LA 3OHXC 2ES2A 1H9RA 1NTGA 3T1YQ 4LF8Q 1WTOA 4GNXA 1KLUD 1CUKA 2I5MX 3I4OA 3S14B 2K03A 3E5SA 4O0AA 1PH5A 4LUVA 1HNZL 1B50A 3S1MB 1BDOA 1PYWD 4J1MA 4A75A 2D9UA 1PHJA 3IFDA 1JOKA 2MP1A 1QE6A 2R7ZG 2NVYB 4A3MH 1FGUA 2EPBA 2PCFB 4X62L 1KRTA 1BCPB 3D0FA 5JJZA 3H0GB 3HS0C 5M5XH 4TQUS 3JAML 5IGBA 3PO3G 3ZYYX 3N6RA 2BCOA 2F0EA 4WORA 3CC7A 2K7VA 4KY5A 4N9TA 1EY0A 4A3CH 3WOFA 3J81i 2R92G 1PRTB 3GTLH 1KDAA 3I72A 2K1BA 4M8AA 4A3BB 3A54A 1XX8A 1ZYRC 1WCMB 3U9SA 5KGUA 2R93B 1X3PA 2NYZD 3SK8A 4L5SA 1QCBD 1G6ZA 3NELA 2RHSB 4CGYB 4DR5L 1I4GA 1G51A 1S4ZA 3CCSA 4RWSC 2FINB 1OXVA 1EIYB 2O5JC 5EKIA 3PIO3 4ZCKA 4A3IG 3CXCA 4DR3Q 3F2BA 4HMJA 1Y8OB 3W1BA 5I6YA 2D2CC 2K14A 4OWTB 1NMGA 2LXKA 1TS2A 4LMQD 1PH8A 1H9SA 3HRZC 2YU9H 1OXUA 2VY3A 3V2TA 4DNTB 1VQGA 4YWLA 4B3TL 5D3IB 3TSSA 4BS9A 4U68A 5ELFA 4A3KB 1EIGA 2I5HA 3O13A 1EY9A 1CKOA 4A3EH 4XTCS 3PIOA 4GOPC 3ERSX 4NMZA 3EJIA 1WTXA 4IPDA 2Q2TA 4A3GG 1YHQA 1BXTA 4H13C 2V1CC 5JJLA 1RTOA 1DOLA 1GO3E 1IBLL 2NVQB 1TS3A 3DMUA 1SN8A 1PV4A 2AUJD 5LHY1 2R7FA 2Z6KC 3HOWH 1HTPA 3ONAB 1EZ8A 1YNND 4BY1H 4JI2L 1LTTD 3UDIA 1GD7A 1PDQA 3S9WA 3G71A 2CQOA 2NUCA 4QY7A 2JA7H 4OO1H 1M8AA 3TDQA 3CPFA 3MXPA 5C44G 5E1FA 1SYCA 1PZKD 2RDFA 3S2HB 1QVCA 3NK9A 2YV5A 4A93G 4G7OC 2OWOA 4JBMA 3KYHC 1PFBA 1ZXTA 3VR5A 4WFN3 1CTMA 2NVTH 3MWYW 1D5XC 4A3IB 2PYKA 3VR3A 5C0XJ 3HOUH 4EGVA 1NJIC 4XQQA 5LMUQ 1N8RC 2I07B 4NDXA 4DR7L 1SJHD 2UUBL 1RJTA 4JI1Q 1T5EA 2Z8LA 2B63H 2JA8G 4DPGA 3U4ZA 1HTLD 1JQYD 1KHIA 2VB2X 2NVQH 2JE6I 5M3FH 2SNSA 3NHHA 4A76A 4HJ8A 2IX1A 3CU7A 4PMCA 4B3MQ 2B2TC 2Q2HA 4ULLA 5CBAE 2BE5C 4LF9L 3G4SA 1VQ7A 4DR5Q 3D8GA 2ZJPA 1IBKQ 2A5HA 4BY7H 1TS4A 3WOEA 1SEBD 2OXPA 2ZXPA 4A3FG 4PMWA 3H3VC 2R92H 3CCRA 4DV5L 2VUMH 1U4MA 3OIQA 4K0KL 4X64Q 4YWKA 3S1QB 4XT3B 4DR6L 2E5LL 1QVGA 2B2UC 5JEAH 1PYSB 3I3CA 3NBHA 4IQZA 5C4HA 1TWGH 2WKCA 2OCEA 1X54A 5IYDG 4X3SA 4KN7C 2F0JA 2B2YC 2YU9B 2F0IA 4L63B 1EZ6A 4Z9CB 2K28A 1IL8A 1ZKOA 5DAUA 1K73C 2JA6G 2K5NA 2IT1A 1GOZA 2UU9Q 2LSSA 1XMOL 4R1JA 3M3YB 2N8NA 4ZRZA 4O42A 3AYHB 3BVMA 3L2PA 2KBNA 5M3FB 2Z6KA 4HIOA 3IAYA 1I4RA 3I4NH 1TXYA 2F03A 3KJPA 2LS01 5KNDA 1TKWB 2MPMA 5FO8B 3K7AB 5LMNL 1TQOA 3I2ZA 4E6IA 1Z6HA 4DR7Q 1C0AA 3GTOH 4JI5L 1BCPD 4JI1L 1K3BC 1JWSD 1II3A 1QJOA 1W2BA 4AYBG 4B3ML 4JI8Q 3P7JA 3AEVA 3GTKH 1PZID 1Q86C 4JV5L 3NBHB 1G2TA 4F7XA 3TS0A 2UUCL 4C2MH 1LUZA 2M00A 5E4XA 3I4MH 2QKIC 3GV3A 2JYOA 4H0LC 1G291 4B3SL 2K50A 4LFAQ 1D1KA 1TR5A 3A7LA 1WD1A 4B9XA 2AUKA 3KF6B 2DJFC 4GKJQ 4WJ3M 1XPRA 1A3TA 3L9AX 1SNCA 1X56A 1L1OC 1JWMD 1BF4A 2P5ZX 3K5NA 4FF3A 4PQXA 3Q23A 4KKTA 1QUQB 2HDMA 2Q8TA 3SEBA 4DK0A 4AYBE 1E22A 5I9PA 3RN2A 1HQMC 1XMOQ 1DOKA 3CCEA 2NB0A 2UXBL 2EJMA 1AEXA 5CV7A 1K8OA 3GTPH 1RD9D 4A3JG 2KENA 2ZT9C 4HCEA 3HOYB 4HEDA 4MHEA 3HOYH 3ULPA 3S1RB 3HOZB 4G57A 3J7ZC 4KN4C 1MBYA 4X6AH 4AQYL 2DY7A 5JEAG 4JI5Q 1R9TH 4APVA 1EWCA 3BZDB 2HDLA 3J80c 3X3MA 4KK7A 1LTBD 2F4VQ 1IXRA 1O80A 1SRUA 3RLNA 4CDEC 5DEHA 1O7YA 3NQTA 4GLAC 2EY2A 1SYFA 1J9OA 3TP7A 4WJWA 3D4RA 3TRZA 2DUDA 4X66L 1J8IA 1W6KA 2A74C 2GVAA 1ENCA 4DXGA 2L5TA 4LUOA 1A15A 2VS1A 3KF8A 1PFNA 1EIFA 3GTQH 1UE6A 3L0OA 3QOLA 1MJEA 5EJWA 4DV3L 2N49A 4DV0L 3KBXA 1CM9A 3PSIA 4K8JA 4DAPA 1Y8PB 3J80L 3M85A 1P16A 3KDFA 3HFZB 4OXPA 1VQIA 2QILA 4MTKA 3A5UA 3HOYG 1HRJA 3VR4A 1B9NA 4JI7Q 3J80E 3MHBA 5FJ8H 2KA7A 1QUQA 2FFKB 2Z6BA 3KLSA 4LJZC 4B3RQ 4PMBA 2A8VA 5C3EG 4IFDG 1JB3A 2KUMA 3QIAA 2PQAA 3VR2A 3JAMi 5IOCA 4LFCL 3LX0A 4P74A 1S40A 2E2JH 3I4NG 1GHKA 1CZWA 1RDPD 3ERQA 1B4OA 1EEFD 4ILWA 1LV9A 1RKNA 5GAEC 2F3WA 4RAUC 4DA2A 2QEJC 5H1SE 1CA6A 2E2IH 2A73B 1AE3A 3I70A 3R93A 1BR9A 3RLOA 1XYIA 5ELDA 3BG3A 2N3SA 2ASBA 5IP7H 5IYBH 1R9TB 4UY8C 2JEAI 4EX5A 3K5MA 2L15A 1GM5A 1IKMA 4OEMB 4X3TA 4BXXH 5M9OA 1EYCA 1ESFA 2RQXA 2JXMB 2PPBC 2KOLA 4A3BG 1PVOA 1U9RA 2Q8IB 1RIPA 3LWUA 3FPUB 2F0FA 1A8VA 2LFNA 3STBC 4BBSG 5J3BA 3OIPA 1OTCA 3AMUA 2WP8J 1K8MA 1IW7C 4IUPA 4JW0A 4CJ1B 1J5EQ 2K5HA 1T9HA 4HIKA 1S5CD 2H4OA 3QB3A 4H02A 4IUQA 2BH2A 3PUZA 4B08A 2PZTA 3GP7A 1Z7TA 4PG3A 4LF6L 2B63G 1OXXK 4A3IH 3UDGA 1M1KC 3BVZA 2AHOB 5GAGC 2WFWA 5M3FG 3CQZB 2B2TA 4IO9A 1KNEA 5CC4A 1NR4A 3TP8A 1G8ZD 3BJUA 1V1PA 3IFTA 4ALPA 3GTOB 1X55A 2DN8A 3U50C 3T4AC 4EQNA 4JI8L 4MZ9A 2RA4A 2HCCA 2K5QA 3D4DA 1I50H 1C4QA 4C3HG 3PIP3 3PO3H 1EY8A 1Q82C 1JJGA 2KHJA 1UEBA 3K5LA 1PRTD 3EFXD 2RDHA 4JI4L 2RSNA 3FKIG 4EVOA 4KJNA 1HUMA 3M9BA 4YY3L 3MXNB 3R8BA 4K2LA 3EA6A 4GKJL 5ELCA 5EAYA 4LF5L 1FJGL 4C3JB 3A55A 4QQBX 1I6HB 4J8QA 3H0GG 1LT3D 3PQIA 3T51B 1F9RA 4FYDA 1E7ZA 1F9QA 5GADC 1KQSA 3OMGA 5EPKA 3DM1A 4RGOS 5LMNQ 2MO1A 2A6ED 3TQYA 4KI0A 3E0EA 2IL8A 1F2YA 5IYCH 3LNNA 4DN4M 3PMFA 2JA5H 4ZK9B 3RR5A 3I4MG 1IYJB 1Y8NB 4EQPA 3EROA 4QB4A 4A3EG 5A2QE 3TREA 4PNYA 4CJ2C 1IBLQ 5C4JH 4JPBW 1EQRA 1U5KA 2EXDA 1VF5C 2NVXB 4GOPA 3KUPA 4R4OA 1NE3A 4M1UB 3MZ5A 3QOJA 4I65A 1DGSA 2WINB 4ZKCB 3TP5A 5FO9B 2ICIA 1QNKA 1F2ZA 2EOTA 2GA4B 1PH1A 2BH8A 3OPOA 3HOXH 1TVXA 3F1ZA 4PV1C 2B63B 3AQQA 4BY7B 3OW2A 4C3JH 1JJCB 5IWAQ 4MTNA 5IT9E 2X6GA 2L0CA 4OONA 1P8LA 1XNQQ 1N36Q 3DEOA 1SNOA 1STHA 5IGEA 4A3CG 4HJ7A 5LMUL 1OXTA 3KLRA 4A3GB 2QDLA 1K9MC 4DV0Q 5GQOA 1UE5A 1LM0A 3TBIB 2B2WC 3HKZB 1Y1WB 4ZAIA 4OO1I 2K33A 3OTOQ 5LMNW 4HAEA 5L37A 1LYLA 4DK3C 4GN5A 2F0DA 3VA7A 1IHZA 1H9MA 1JMCA 3KBGA 4V190 3HOWB 5KYIA 3PO2H 1MGSA 4RCNA 3GTGH 3ND8A 5CGKA 2I5LX 1N32Q 5ELNA 4A3MB 1RL2A 1NCVA 3HEJA 5HGQA 5C44B 4KHPL 2XVSA 5IT9c 1DM0B 5DNFA 4ZLTF 3M7NA 4WJ4A 4HJ9A 1LTSD 5K5PA 4ZKBB 3DWAA 3ICEA 1SMXA 2OT2A 4KKSA 1XXGA 1VMCA 1UEAB 2NN6I 5M3MB 2JSOA 1A6XA 2R7DA 4DK1A 1GXDC 4JI0L 1HPCA 2R93G 1JORA 1IBML 2Y0SE 3M3YH 1VCIA 2MQHA 2EJFC 2R92B 1AW7A 1D8LA 2OEOA 3SE0A 3CHBD 1PTOH 3F2UA 3W3AA 1PTOB 3P75A 4CDDC 4B3TQ 4LFCQ 5C3EH 1NBWA 3K0XA 1E2WA 2A69C 1F9SA 3GTPB 5AFWA 1BBUA 1D5ZC 1TY0A 3TMEA 3Q22A 3J7A5 2K5VA 3GTMB 1N34L 3ULLA 4DV6Q 4HCSA 4HR7B 3MXGA 4DV3Q 4IALA 3L3OC 3J7AV 5D3DA 1HNXL 4TRDA 4DV7Q 1IYUA 5CBEE 5K36H 3NTHA 4H7BA 3F2CA 1S3OA 2NN6H 4KD3A 1ENAA 3MA2B 3CCVA 2C5CA 5C5LA 1C9OA 5DM63 4A3DG 1Z9FA 3HOZG 5IP9G 1E2ZA 4YHHL 2K5DA 1IKLA 4N9PA 4TVAB 3NP8A 5FLXL 2KECA 5KEEA 1NAPA 1SE8A 1E2VA 1R4PB 1KAAA 4WRDA 5JOBA 4JI3Q 3CD6A 1SNDA 1YNXA 1GUNA 2F0SA 1SNPA 2EYOA 2JK8A 2AMCB 5CV4A 5KNBA 1SNMA 1V1OA 2F0QA 2ALYB 3PUYA 5CORA 1HJPA 1C8CA 2F0GA 3R2IA 4A3DH 2YYZA 3RN5A 2R7ZB 1TWCH 2E2HB 2IPKD 4FP5D 5HY6A 3URYA 1HNWQ 1G91A 2HHHL 5CMDA 4X65L 2VQFQ 4KHVA 1PRTF 4DV1Q 1T5XD 2FJ2A 2EYLA 1JWUD 4QJFA 4P75A 1K0RA 1Q1BA 4GS3A 5T1GA 2KEDA 3QG1A 1K3RA 1AP0A 3NBIA 3TZUA 1VQCA 2RVLA 3SXHA 2EYHA 3D6WA 1B1ZA 1PXUA 2A19A 5CV6A 1FYCA 1CQFA 1S5FD 2G5DA 2RHQB 5AJ3L 1VQNA 1YVCA 3H3VH 1WI5A 4K2KA 1RODA 1CA5A 4JI3L 2JA9A 1DZ1A 1YNJD 1KAWA 3OSOA 2CHBD 2QCPX 4DK6C 5M3MH 3UDFA 2VUMG 2F0NA 4OWWB 2L1BA 5I4DA 3TS2A 4YWMA 1SMYD 1ET6A 2D5DA 3BDCA 3S16H 5E3FA 1CT1D 3T1HQ 4DAYA 1I6HH 3I91A 2AKWB 4YCVA 4L5RC 4GZYC 2F4VL 2N55A 3HOUB 1DYQA 2B39A 2KCCA 2N88A 5J39A 1ASZA 3M7GA 3ITPA 1ONLA 1A3VA 4KY6A 3SK5A 1EY6A 1KLGD 3AFPA 2R93H 3G48A 1SJED 2WV6D 4XYOA 3P20A 4FXKC 4XT1B 2WAQB 4RMFA 3STBD 1XNRQ 2SEBD 5M5WH 1H9JA 3I8ZA 3M4OB 1RCVD 2NWGA 3NSWA 2JA6B 3A74A 2JA6H 1EUJA 4X3UA 4DUZQ 1V8QA 2YTYA 3PO2G 2R6GA 4K6LA 3EVQA 5EPLA 4KD4A 1K8GA 4L6TB 5ELBA 3NUCA 1U0LA 3PUWA 1BKBA 2A1AA 3UE0A 4IPHA 4BBRG 4QUFA 1STEA 4OWXB 3KF6A 2JA7G 4OO1G 2EY5A 3J7AF 1QWYA 5COYA 1KNAA 3UE1A 3CC4A 4N8X1 4X3KA 4LNQA 3K58A 4LFAL 2JEBI 5DM73 2O4XA 1CSQA 1LACA 1J6QA 3C3LA 1VQJA 1B8AA 4IPCA 4Y7NB 2MO0A 4A3LH 2EY6A 5EBDA 4OX9L 4V0BA 3HZXA 1PTOD 4R4IA 1BO0A 2EQSA 1MHWC 4R8NA 1K28A 4GKKQ 5ELEA 1V1PB 3HOVB 2F4IA 3CCLA 2WAQE 4IURA 4IFDJ 2F0HA 1EFWA 4LWCA 4XYQA 5A35A 4Y7NH 5C4XG 1ESRA 2BE5D 4CDFC 4DF7A 1X9NA 1VQHA 1X3QA 4RA8A 4JV5Q 1BCPF 2HIVA 5FO7B 1HA5A 1JR0D 2KCTA 4AIMA 3KFUA 4BBSH 1XPUA 1WFQA 2IY5B 1TWHH 2A68D 4JCVE 1XNRL 2CVRA 3I73A 1IBMQ 4DV6L 1STGA 2ENBA 1HUNA 2EYPA 2F0UA 5JVG3 1L1OB 4MIUA 4EQOA 1WTRA 3B6YA 2E2JB 3CF5A 1Y1WH 3VA5A 2Z1CA 3BZKA 1HNXQ 2XGTA 2CWPA 5IGDA 1CI3M 3H0GH 3DLLA 3DEPA 1I5FA 1QZGA 1NUCA 3PUXA 1VQDA 2D0OA 1JOQA 2PI2E 2B8GA 4JI2Q 1C7YA 4TSSA 2ATWA 4JI4Q 1X6OA 1TIID 4YCUA 3ER0A 2B2YA 1QNUA 4EQ5A 4C3JG 2F0VA 4A3GH 4R4QA 4B3SQ 1RTNA 2HD3A 4L5TA 1EYGA 4DUZL 3WWVA 2N78A 1C48A 1HCZA 1R4QB 3A8IE 3HOXB 2PMZB 2RBMA 4UHVA 1HZ9A 1Q81C 2IJ0A 3JC66 1KDBA 4S3SA 2AQ3B 3PCOB 2CCZA 1L2FA 5EQ0A 4DUYL 2L4NA 4C3HH 2K4KA 5BR8Q 2KEEA 2QGQA 3AU7A 1PH2A 3C1FA 4A3KH 4O2DA 3HOVH 4DR1L 4LF4Q 4NXNL 1BUVT 2IWHA 3T16A 1X32A 4X65Q 2VQFL 1HFNA 1B44D 3S2DB 1JICA 2I46A 4DV1L 3NTKA 5G3LD 3OWFA 1VQMA 1AZQA 1STNA 2ZTEA 1N33Q 1XWEA 3W2DA 1D2BA 1K83B 5JJIA 4LF9Q 1E1TA 5J1ZA 5I2YA 3KOJA 4ABNA 5ISRA 4OELB 3HOUG 3F8TA 3PF5A 4B3RL 3K0YA 2G9DA 4XQJA 3PF4A 1FNUA 1VQEA 1HNWL 2VUMB 4DGZA 5IT9L 4JOIC 2X6LA 1L1OA 3FHWA 3NXWA 4IUVA 4IFDI 1FNWA 2K04A 1PYBA 1YIJA 5ELOA 4CKCA 2AWNA 3RLFA 3BYYB 2MFIA 2PMZE 1X3EA 4GNXB 1MKHA 3RZDB 3CC2A 1AE2A 2O5IC 3RZOH 3FDTA 2R3ZA 3TN2A 1LTGD 4QMGA 2LXJA 5HGTA 3C46A 4PZ8A 4HMIA 4A3JH 1WYDA 3SR1A 3JAME 2QF7A 2A6HD 3VYSA 1CKMA 1LTID 2HHHQ 5FLMH 4OIJA 5M5XB 1MJCA 1CHQD 1JE5A 3QWNA 2WKDA 2QEXA 3UDXA 1YJNA 2MJ8A 1STBA 4O1NA 5JEAJ 2H1EA 4QIWB 3V05A 1BVSA 1EFID 3OYYA 2K01A 1ZEQX 4KTAA 3HOXG 4GLXA 5C3WA 4KMUC 3S2HH 1TWAB 3GTMH 1YI2A 2O2LD 1SBBB 2RSOA 1IZ6A 2CH4A 4RG1A 3S17H 5D14A 1NSNS 1JB7A 1PH6A 2GVBA 2EYMA 1EQVA 2M2LA 2D0PA 1EEID 4HIMA 1HZCA 3M4YA 1JT8A 2Y0SG 3H09A 4Q0FA 2AQ1B 1EQTA 2LY7A 1NMFA 2Z4HA 2ZXRA 3J81j 4L8JA 2OF1A 2HQLA 4JBKA 2UXDL 2JA5B 2GN5A 3NE5B 5AJ3Q 5C0XH 1LTAD 4FF4A 5BN5A 2A69D 1EOTA 4BY1G 5GAHC 2RKSA 1XMQL 4J6HA 1SFOB 2CW0D 3KDFB 4CKEA 1PH7A 3MFGA 2B3GA 4LF7Q 1FNVA 2SNMA 4RHRA 2V4DA 1Q46A 4GN4B 5C4XB 1SYGA 3A8JE 4PZ7A 3KF8B 2VW9A 1WOCA 1MSGA 1Q90A 4QIWE 1A2TA 4J15A 4DKAC 3S17B 4IFDH 3VYRA 5I2XA 4DU9A 4DR4L 1SSOA 4R4TA 4FXGC 2MUYA 2R7ZH 5TSSA 1WCMG 3WDNA 1W3SA 3HKZG 2BDNA 3OOCA 5JPMC 4DR2Q 1YNNC 3CPWA 1VQFA 1YHBA 2UXBQ 1BBXC 1A2UA 2EVBA 1JOOA 3R2TA 3CKIB 4DV4L 1Q7YC 5IWAL 1O7LA 1FJGQ 3JAMc 5IP9H 1NR2A 1YNJC 4RHSA 3CQZH 5T1IA 3GTQB 4R4CA 1AN8A 2QDBA 3NQIA 4C2MB 4NXML 1GVPA 1M4VA 3A0JA 3CMEA 1K8AC 4LF8L 4OX9Q 3K7AH 3GD7A 3GTJB 1SYBA 4AQYQ 3FVQA 2ZTCA 4IUUA 2SOBA 2XRSD 1S72A 3DM3A 3OTOL 5FLXE 3RUZA 1F2MA 1VQBA 3FPPA 2E5LQ 4HSVA 1EQQA 1ICFB 2XN9C 3G6JB 4XQNA 2AQ2B 3T1YL 1HHVA 1D6EC 1KABA 4A3EB 4KLKA 3I56A 1QZHA 3TP6A 1GKHA 2K5WA 4JI7L 3P1HA 3Q8DA 2IX0A 1DOMA 5C4ZA 3CRLC 4DFAA 4DR1Q 3A7AB 3J81E 1LTLA 3FP9A 4GKKL 1O7ZA 1YBYA 1KDCA 1SE3A 4C1NI 1FGBD 2PNHA 4HTHA 2AWOA 2VNUD 1STAA 1EYAA 2KCNA 3BU2A 1MI2A 2EE1A 2TMPA 3OWEB 2L9HA 1N33L 4I7AA 5JJKA 1DCZA 3QJYA 3ZJYC 3J7YW 3K80C 2B29A 1XMQQ 1V1QA 2F0KA 2JP1A 4JI0Q 1CSPA 1PTOC 1BQQT 4JBJA 4DAMA 1K83H 4BBRB 3T13A 1I4PA 1IW7D 1JE4A 1PMRA 2JJQA 5EKKA 2FMCA 4LF4L 1SE2A 2DNEA 1CKNB 1B70B 4P72A 3PO2B 2E74C 3E3XA 3NEMA 1CKNA 4ID6A 3CRKC 3H3VI 4NXMQ 1YZ6A 3GTJH 4YCWA 5JAVA 2B8FA 3NENA 1CFMA 2R61A 2HCIA 1KRSA 2XTIA 5KRUA 5C44H 1I3QB 3J81c 1UE1A 4BA2I 1GUWA 2UXCL 4K6DA 2I0QA 3GQBA 4JC0A 2JA5G 2B2WA 3S1NB 2Q8RE 2NN6G 3I4LA 1O7IA 2K75A 2PI2A 4AYBB 4C3IG 1SAPA 1ZYRD 3D6CA 3GDEA 3T53B 4K5XA 3K57A 1KL9A 3QR8A 1CZGA 2J7ZA 4G7HC 4FNFA 1SE4A 2EJGC 1X65A 1MSHA 1WTQA 1LO5D 3NWSA 3CP0A 3I7FA 5IGGA 3DUZA 1B2TA 3EQLC 3M4QA 2UUBQ 2XWBB 3Q6SA 1HZBA 4BBSB 4YHHQ 3MEFA 2JA8H 3MXUA 4R9WA 1H9KA 4RGMA 1VQAA 3K8AA 4Y52H 1HH2P 2K6AA 4CDCC 4DXFA 1YJWA 1KIXA 3J81L 5I6WA 4IOCA 3ND9A 5IIFA 1VF7A 1SYDA 3U4VA 3KLSX 5C4JB 2IX3A 3H94A 2A68C 1HR0L 5CV5A 1HA6A 3K5OA 4U673 1M90C 4HJ5A 1WVLA 4HN7A 5C5MA 1NNXA 3CAMA 3H6MA 5IYCG 4RGTA 1VDZA 3BS1A 5M5YH 2DNCA 4NP5A 4L5QA 3S24A 4A3MG 3E9HA 2XNAC 4POFA 2NBFA 2RCNA 4KHZA 2CH4W 2FHTA 1XTDA 2NTTA 4ZYSA 1BNZA 3EIVA 4A4IA 1DONA 1YITA 4XIGS 4UP7A 1PH4A 1TWGB 1L0YB 1EU3A 2NZOA 1EYDA 2KCMA 3IL8A 3KK7A 4GNXC 5FKAC 2ZXOA 1DD2A 1B7YB 3S15B 1GUOA 1CQVA 2K32A 2OQ0A 4LF5Q 3BVGA 4G4KA 4BWGB 4A3BH 5JVH3 3FKIH 1GJXA 1CK1A 3I55A 4DR6Q 1EU4A 3RNUA 3UI2A 3C1EA 4LFBL 4A3DB 3DHQA 4OHJA 1UWVA 3MVVA 2UUAL 4BXXG 4A3FH 3EBEA 5IODA 1VQ5A 2UXCQ
chains in the Genus database with same CATH topology
5M3FG 2CWPA 4GOPB 4IO9A 3H0GH 3DLLA 1YJ9A 5IYBG 4X62L 1FL0A 1KRTA 1FVIA 1I5FA 3D0FA 1QZGA 3PUXA 5M5XH 1VQDA 3BJUA 4TQUS 2D0OA 2PI2E 4ALPA 4JI2Q 1C7YA 1X55A 2ATWA 3U50C 3PO3G 4JI4Q 4JI8L 1X6OA 3CC7A 4YCUA 3ER0A 4MZ9A 4DR4Q 4EQ5A 1I50H 5FLMG 4A3CH 4X62Q 3J81i 3PO3H 2R92G 3GTLH 1PFSA 1HR0Q 4A3GH 4R4QA 4B3SQ 4L5TA 1N36L 1EYGA 5K36G 4DUZL 1Q82C 3WWVA 1G6PA 2N78A 1JJGA 3HOVG 2KHJA 1UEBA 3S14H 2UU9L 5C0XG 1N9WA 4POGA 4JI4L 3FKIG 4L5SA 1HZ9A 2YTXA 3NELA 2RHSB 3T1HL 1Q81C 1VQ9A 3JC66 4DR5L 1G51A 3CCSA 3M9BA 4YY3L 1OXVA 3MXNB 3PCOB 4MNOA 1L2FA 3TEHB 2CCZA 1EIYB 4GKJL 4A3IG 4DUYL 4PZ6A 3CXCA 3F2BA 4DR3Q 3W1BA 1Y1WG 5EAYA 4LF5L 2VL6A 1Q8KA 4C3HH 1FJGL 2K14A 2K4KA 4GN3B 1NMGA 2LXKA 4OWTB 5BR8Q 1SR3A 2QGQA 4QQBX 3H0GG 1PH2A 1PH8A 4A3KH 4O2DA 4QGUA 4DR1L 4LF4Q 3HOVH 1E7ZA 1X3GA 3ULJA 1VQ5A 4NXNL 1XNQL 5IYDH 4LF6Q 5GADC 1KQSA 2YU9H 4X65Q 2VQFL 1OXUA 2VY3A 2QA4A 4DV1L 5LMNQ 3HKZE 2MO1A 1VQGA 4YWLA 1E3PA 4B3TL 3TQYA 1VQMA 4KI0A 2ZTEA 3E0EA 5IYCH 1N33Q 5JJIA 3H15A 4LF9Q 2JA5H 1E1TA 3RR5A 3PIPA 3S1RH 3I4MG 1WJJA 1IYJB 3KOJA 2ZJQA 1NY4A 4A3EG 4IPGA 3TREA 3HOUG 3F8TA 1IBLQ 3PF5A 4B3RL 2I5HA 5C4JH 1CKOA 4A3EH 1EQRA 1VQOA 1U5KA 2EXDA 4XTCS 3PIOA 3ERSX 4GOPC 4IPDA 4R4OA 4GOPA 1NE3A 3W5OA 2Q2TA 4A3GG 3PF4A 3S1QH 1DGSA 1VQEA 4NB3A 1YHQA 1HNWL 2V1CC 5JJLA 4JOIA 1GO3E 3LGJA 1IBLL 1OXSC 4JOIC 1PH1A 1L1OA 1SN8A 2BH8A 3FHWA 1PV4A 3HOXH 2R7FA 2DGYA 2Z6KC 3F1ZA 3HOWH 4IFDI 2Q2UA 4BY1H 1PYBA 3AQQA 5ELOA 1YIJA 4JI2L 2AWNA 2Q2IA 3RLFA 3UDIA 1GD7A 3OW2A 2MFIA 3PGZA 1JJCB 2PMZE 1X3EA 4C3JH 5IWAQ 1MKHA 4GNXB 3CC2A 1AE2A 4MTNA 3G71A 3RZOH 1VS0A 2CQOA 4QY7A 1Y1VG 4DNIA 4OONA 2LXJA 4UPAA 2JA7H 4PZ8A 1P8LA 1XNQQ 4A3JH 1N36Q 3CPFA 1WYDA 4LFBQ 3GO5A 2JQOA 5C44G 1CKMA 2HHHQ 5FLMH 4A3CG 3SGIA 5DLQE 1MJCA 1QVCA 4HJ7A 2YV5A 5LMUL 2UUCQ 4A93G 2OWOA 1OXTA 3KYHC 4JBMA 1JE5A 1K9MC 2QEXA 4DV0Q 3UDXA 1YJNA 5GQOA 1UE5A 2NVTH 1LM0A 5JEAJ 4OO1I 4UP9A 1XPOA 2OQKA 5C0XJ 3OTOQ 5LMNW 3HOUH 4BY7G 1EOVA 1NJIC 1BVSA 3OYYA 4FDBA 5LMUQ 1LYLA 1N8RC 4DV7L 4DK3C 4DR7L 4GN5A 2UUBL 3HOXG 4JI1Q 4GLXA 1KC8C 1JMCA 2B63H 2JA8G 3S2HH 4X66Q 3PO2H 3GTMH 1YI2A 4DPGA 3U4ZA 3GTGH 1IZ6A 1KHIA 3S15H 4RG1A 2NVQH 2JE6I 2I5LX 5M3FH 5ELNA 4A76A 1RL2A 4HJ8A 1HNZQ 2IX1A 3S17H 1N34Q 1N32Q 4B3MQ 2Q2HA 2F52A 1JB7A 4LF9L 2PQAB 1PH6A 5HGQA 2GVBA 3G4SA 4KHPL 1YHAA 1VQ7A 4DR5Q 5IT9c 4BBRH 2D0PA 3KLWA 2ZJPA 4HIMA 2D62A 5E7NA 1IBKQ 1HZCA 4HJ9A 3M7NA 2Y0SG 4BY7H 4WJ4A 3G6EA 1JT8A 4JI6L 1NMFA 1MIUA 5IY0A 3ICEA 4A3FG 1SMXA 3EN2A 4PMWA 5FJ8G 1Y1VH 3M4PA 3J81j 2R92H 3CCRA 2NN6I 1SROA 4DV5L 2HQLA 2R7DA 4JBKA 2VUMH 2RF4A 2UXDL 3J80i 4LF7L 1KD1C 4JI0L 4K0KL 4X64Q 4YWKA 2GN5A 2R93G 1VQ6A 5AJ3Q 1IBML 2Y0SE 5C4XH 3M3YH 4BY1G 5GAHC 1XMQL 1VQLA 1QVGA 1VCIA 4ME3A 1PYSB 2E5LL 3HOZH 3CCUA 1TWGH 2MQHA 1X54A 2OCEA 5IYDG 2BA1A 1D8LA 3KDFB 1PH7A 2MNAA 3F2DA 3CCJA 2B3GA 4LFCQ 4B3TQ 5C3EH 4LF7Q 1K73C 2JA6G 1NBWA 2K5NA 4GLVB 2E2HH 2IT1A 3K0XA 2UU9Q 1Q12A 2LSSA 1XMOL 1Q46A 4GN4B 4R1JA 2IHFA 1BBWA 1BBUA 3KF8B 4PZ7A 2N8NA 2VW9A 1WOCA 4A3LG 4IJLA 3AYHB 4QIWE 1A63A 4J15A 4DKAC 3L2PA 2KBNA 1Q1EA 4DR4L 2Z6KA 4HIOA 2K5VA 3J7A5 1N34L 3ULLA 4DV6Q 3I4NH 1TXYA 4R4TA 1J5EL 4P73A 3KJPA 2R7ZH 4KHPQ 1WCMG 4C3IH 1IL2A 4DV3Q 1W3SA 3A5ZB 3HKZG 4DR2Q 3CPWA 5LMNL 1D7QA 3I2ZA 4DV7Q 1VQFA 1HNXL 4DR7Q 1C0AA 1YHBA 2WB1E 3PUVA 1V9PA 3GTOH 2UXBQ 4JI5L 2UUAQ 4JI1L 2WB1G 4DV4L 3CCQA 1Q7YC 2YTVA 1S3OA 5IWAL 3F2CA 2BA0A 1FJGQ 3JAMc 1FGUA 1EWIA 5IP9H 5BR8L 2F3IA 1A0IA 1W2BA 3CCVA 3CQZH 4AYBG 4B3ML 2Z0SA 2ZTDA 3AFQA 4JI8Q 4R4CA 1C9OA 4A3DG 1Z9FA 4QL5A 4NXML 3AEVA 1Q86C 1GVPA 3GTKH 3VDYA 3HOZG 5IP9G 3A0JA 4JV5L 3CMEA 1K8AC 4LF8L 4YHHL 4OX9Q 3NBHB 4TVAB 3K7AH 3TS0A 2UUCL 3GD7A 4C2MH 1LUZA 3RZDH 1SE8A 3I4MH 2VQEQ 4AQYQ 4JI3Q 3CD6A 2ZTCA 1XJVA 2ZM6L 4LUZA 1YNXA 1G291 1S72A 4B3SL 3HKSA 2K52A 2K50A 3DM3A 2VZAA 2JK8A 2AMCB 2CWAA 4LFAQ 3OTOL 3KF6B 4NPSA 4GKJQ 2NVYH 4WJ3M 2ALYB 4DR3L 3PUYA 1XPRA 1HJPA 1VQBA 2E5LQ 2OTJA 1EQQA 1X56A 1L1OC 1HZAA 2FXQA 4A3DH 1N32L 4YY3Q 4A3KG 3T1YL 2YYZA 4IOAA 2ID0A 3RN5A 3S1MH 5M3MG 1QUQB 1TWCH 4KLKA 3I56A 1QZHA 5HY6A 4AYBE 1HNWQ 1UE7A 1E22A 1GKHA 4X65L 2VQFQ 2HHHL 4JI7L 3Q8DA 3RN2A 1V43A 2IX0A 4DV1Q 1XMOQ 4JI6Q 4DR1Q 3CCEA 1LTLA 4DR6L 4UP8A 3FP9A 2UXBL 4GKKL 4QJFA 4P75A 1YBYA 1SLJA 1K0RA 1Q1BA 2C35B 4GS3A 2PNHA 3KJOA 4HIDA 2AWOA 1VQKA 3K7UC 1K3RA 3GTPH 2VNUD 2CKZB 1VQCA 3BU2A 1QVFA 4A3JG 3S2DH 2KENA 1N33L 4DV2Q 5JJKA 3ZJYC 3K80C 4JBWA 2B29A 1XMQQ 1V1QA 2IHEA 2A19A 3HOYH 4JI0Q 3ULPA 2RHQB 3K81C 5IP7G 5AJ3L 1YVCA 1I94Q 1CSPA 4DAMA 1VQ4A 4JBJA 1VQNA 3H3VH 1WI5A 1K83H 3J7ZC 4IJHA 1Z47A 2OTLA 4X6AH 4JI3L 2VQEL 5JEAG 4AQYL 2JA9A 4JI5Q 1R9TH 4APVA 1ASYA 2JJQA 1PH9A 1KAWA 4DAYB 3J80c 2F4VQ 4LF4L 1IXRA 4DK6C 5M3MH 1CKNB 1L0WA 3UDFA 1VQ8A 2VUMG 3W1GA 1B70B 1SRUA 4OWWB 3RLNA 4P72A 3PV0A 4YWMA 3TS2A 1TWAH 1CKNA 3NEMA 4GLAC 1HR0W 2EIFA 3S16H 3H3VI 4NXMQ 3T1HQ 1I6HH 3TRZA 1YZ6A 3GTJH 4YCWA 2AKWB 2DUDA 3NENA 4YCVA 4L5RC 4LW1A 4X66L 1KRSA 2F4VL 2GVAA 2XTIA 2ZJRA 5C44H 3J81c 3IRBA 1UE1A 4BA1I 4BA2I 1ASZA 2UXCL 4K0KQ 4JYAL 4LUOA 2I0QA 4JC0A 2VS1A 2JA5G 4P71A 2ZM6Q 2CFMA 1EIFA 3GTQH 1UE6A 3L0OA 2NN6G 3AFPA 2R93H 3G48A 3U58A 1MJEA 1O7IA 2K75A 2N49A 2PI2A 4DV3L 1WCMH 2H5XA 3D31A 4DV0L 3CMAA 3PSIA 1IBKL 4RMFA 3STBD 1XNRQ 5M5WH 3M85A 3GDEA 3S1NH 1KL9A 1P16A 3KDFA 4DV2L 3HFZB 4A93H 4OXPA 1VQIA 3A74A 2JA6H 3A5UA 3M4OH 1EUJA 3HOYG 4DUZQ 2YTYA 1E1OA 3PO2G 2R6GA 1X3FA 4X64L 5GROA 1A62A 1X65A 4JI7Q 5FJ8H 3HOWG 1QUQA 4B3RQ 3CP0A 3I7FA 5IE8A 1K8GA 1E24A 2UUBQ 3M4QA 2A8VA 1KXLA 1HZBA 5C3EG 4IFDG 2WAQG 4YHHQ 3PUWA 1U0LA 1BKBA 2A1AA 2PQAA 3MEFA 3UE0A 3JAMi 4IPHA 4BBRG 2JA8H 4LFCL 1S40A 4P74A 2E2JH 1VQAA 4OWXB 3K8AA 3I4NG 3KF6A 4Y52H 1PA6A 1HH2P 1I3QH 2JA7G 4OO1G 5FLXc 1YJWA 1KIXA 1YEZA 4IOCA 5C0XI 3UE1A 3CC4A 2HIXA 4LNQA 5GAEC 1Y14B 3E9IA 3U4VA 4LFAL 5H1SE 2JEBI 3CW2C 2E2IH 1HR0L 4DV4Q 2HT1A 4DV5Q 4AH6A 1AE3A 2UXDQ 4HJAA 1CSQA 3RLOA 1M90C 1J6QA 4JYAQ 4HJ5A 1VQJA 1B8AA 2N3SA 3CCMA 1SFOH 2ASBA 4IPCA 5IP7H 3CAMA 5IYBH 5IYCG 4UY8C 2JEAI 4EX5A 2MO0A 1JJ2A 5M5YH 1TWFH 4A3LH 2L15A 1GM5A 2KHIA 4L5QA 4DR2L 4OX9L 3S24A 4BXXH 2NVXH 4A3MG 3E9HA 4R4IA 4POFA 3L7ZC 4DUYQ 2RCNA 4KHZA 3BZCA 1H95A 1XTDA 2NZHA 2EQSA 4GKKQ 3EIVA 4A4IA 1YITA 2E8GA 4XIGS 3CCLA 4UP7A 2WAQE 1PH4A 4A3BG 1PVOA 4IFDJ 2NZOA 4NXNQ 1RIPA 1EFWA 2KCMA 4JG2A 4LWCA 1PH3A 1A8VA 1VQPA 1I94L 4Y7NH 3STBC 4BBSG 5C4XG 5J3BA 4GNXC 1OTCA 2WP8J 1X9NA 1VQHA 2ES2A 4JV5Q 1B7YB 2HIVA 3T1YQ 1NTGA 4LF8Q 2KCTA 4AIMA 3KFUA 1J5EQ 2K5HA 1T9HA 1WFQA 4HIKA 1XPUA 4BBSH 1TWHH 4JCVE 2IY5B 4GNXA 1CUKA 2I5MX 2OQ0A 3I4OA 1XNRL 4H02A 4LF5Q 2BH2A 4O0AA 1PH5A 3PUZA 4LUVA 1HNZL 4A3BH 1IBMQ 4DV6L 3FKIH 4A75A 3I55A 4DR6Q 1PHJA 1L1OB 1AH9A 3RNUA 2R7ZG 4PG3A 4LF6L 2UUAL 4LFBL 1UWVA 2B63G 3B6YA 1OXXK 3CF5A 4A3IH 3UDGA 1Y1WH 1M1KC 4BXXG 4A3FH 3EBEA 4A3MH 2AHOB 3BZKA 1HNXQ 5GAGC 2UXCQ 2XGTA 2WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3F G;  2CWP A;  4GOP B;  4IO9 A;  3H0G H;  3DLL A;  1YJ9 A;  5IYB G;  4X62 L;  1FL0 A;  1KRT A;  1FVI A;  1I5F A;  3D0F A;  1QZG A;  3PUX A;  5M5X H;  1VQD A;  3BJU A;  4TQU S;  2D0O A;  2PI2 E;  4ALP A;  4JI2 Q;  1C7Y A;  1X55 A;  2ATW A;  3U50 C;  3PO3 G;  4JI4 Q;  4JI8 L;  1X6O A;  3CC7 A;  4YCU A;  3ER0 A;  4MZ9 A;  4DR4 Q;  4EQ5 A;  1I50 H;  5FLM G;  4A3C H;  4X62 Q;  3J81 i;  3PO3 H;  2R92 G;  3GTL H;  1PFS A;  1HR0 Q;  4A3G H;  4R4Q A;  4B3S Q;  4L5T A;  1N36 L;  1EYG A;  5K36 G;  4DUZ L;  1Q82 C;  3WWV A;  1G6P A;  2N78 A;  1JJG A;  3HOV G;  2KHJ A;  1UEB A;  3S14 H;  2UU9 L;  5C0X G;  1N9W A;  4POG A;  4JI4 L;  3FKI G;  4L5S A;  1HZ9 A;  2YTX A;  3NEL A;  2RHS B;  3T1H L;  1Q81 C;  1VQ9 A;  3JC6 6;  4DR5 L;  1G51 A;  3CCS A;  3M9B A;  4YY3 L;  1OXV A;  3MXN B;  3PCO B;  4MNO A;  1L2F A;  3TEH B;  2CCZ A;  1EIY B;  4GKJ L;  4A3I G;  4DUY L;  4PZ6 A;  3CXC A;  3F2B A;  4DR3 Q;  3W1B A;  1Y1W G;  5EAY A;  4LF5 L;  2VL6 A;  1Q8K A;  4C3H H;  1FJG L;  2K14 A;  2K4K A;  4GN3 B;  1NMG A;  2LXK A;  4OWT B;  5BR8 Q;  1SR3 A;  2QGQ A;  4QQB X;  3H0G G;  1PH2 A;  1PH8 A;  4A3K H;  4O2D A;  4QGU A;  4DR1 L;  4LF4 Q;  3HOV H;  1E7Z A;  1X3G A;  3ULJ A;  1VQ5 A;  4NXN L;  1XNQ L;  5IYD H;  4LF6 Q;  5GAD C;  1KQS A;  2YU9 H;  4X65 Q;  2VQF L;  1OXU A;  2VY3 A;  2QA4 A;  4DV1 L;  5LMN Q;  3HKZ E;  2MO1 A;  1VQG A;  4YWL A;  1E3P A;  4B3T L;  3TQY A;  1VQM A;  4KI0 A;  2ZTE A;  3E0E A;  5IYC H;  1N33 Q;  5JJI A;  3H15 A;  4LF9 Q;  2JA5 H;  1E1T A;  3RR5 A;  3PIP A;  3S1R H;  3I4M G;  1WJJ A;  1IYJ B;  3KOJ A;  2ZJQ A;  1NY4 A;  4A3E G;  4IPG A;  3TRE A;  3HOU G;  3F8T A;  1IBL Q;  3PF5 A;  4B3R L;  2I5H A;  5C4J H;  1CKO A;  4A3E H;  1EQR A;  1VQO A;  1U5K A;  2EXD A;  4XTC S;  3PIO A;  3ERS X;  4GOP C;  4IPD A;  4R4O A;  4GOP A;  1NE3 A;  3W5O A;  2Q2T A;  4A3G G;  3PF4 A;  3S1Q H;  1DGS A;  1VQE A;  4NB3 A;  1YHQ A;  1HNW L;  2V1C C;  5JJL A;  4JOI A;  1GO3 E;  3LGJ A;  1IBL L;  1OXS C;  4JOI C;  1PH1 A;  1L1O A;  1SN8 A;  2BH8 A;  3FHW A;  1PV4 A;  3HOX H;  2R7F A;  2DGY A;  2Z6K C;  3F1Z A;  3HOW H;  4IFD I;  2Q2U A;  4BY1 H;  1PYB A;  3AQQ A;  5ELO A;  1YIJ A;  4JI2 L;  2AWN A;  2Q2I A;  3RLF A;  3UDI A;  1GD7 A;  3OW2 A;  2MFI A;  3PGZ A;  1JJC B;  2PMZ E;  1X3E A;  4C3J H;  5IWA Q;  1MKH A;  4GNX B;  3CC2 A;  1AE2 A;  4MTN A;  3G71 A;  3RZO H;  1VS0 A;  2CQO A;  4QY7 A;  1Y1V G;  4DNI A;  4OON A;  2LXJ A;  4UPA A;  2JA7 H;  4PZ8 A;  1P8L A;  1XNQ Q;  4A3J H;  1N36 Q;  3CPF A;  1WYD A;  4LFB Q;  3GO5 A;  2JQO A;  5C44 G;  1CKM A;  2HHH Q;  5FLM H;  4A3C G;  3SGI A;  5DLQ E;  1MJC A;  1QVC A;  4HJ7 A;  2YV5 A;  5LMU L;  2UUC Q;  4A93 G;  2OWO A;  1OXT A;  3KYH C;  4JBM A;  1JE5 A;  1K9M C;  2QEX A;  4DV0 Q;  3UDX A;  1YJN A;  5GQO A;  1UE5 A;  2NVT H;  1LM0 A;  5JEA J;  4OO1 I;  4UP9 A;  1XPO A;  2OQK A;  5C0X J;  3OTO Q;  5LMN W;  3HOU H;  4BY7 G;  1EOV A;  1NJI C;  1BVS A;  3OYY A;  4FDB A;  5LMU Q;  1LYL A;  1N8R C;  4DV7 L;  4DK3 C;  4DR7 L;  4GN5 A;  2UUB L;  3HOX G;  4JI1 Q;  4GLX A;  1KC8 C;  1JMC A;  2B63 H;  2JA8 G;  3S2H H;  4X66 Q;  3PO2 H;  3GTM H;  1YI2 A;  4DPG A;  3U4Z A;  3GTG H;  1IZ6 A;  1KHI A;  3S15 H;  4RG1 A;  2NVQ H;  2JE6 I;  2I5L X;  5M3F H;  5ELN A;  4A76 A;  1RL2 A;  4HJ8 A;  1HNZ Q;  2IX1 A;  3S17 H;  1N34 Q;  1N32 Q;  4B3M Q;  2Q2H A;  2F52 A;  1JB7 A;  4LF9 L;  2PQA B;  1PH6 A;  5HGQ A;  2GVB A;  3G4S A;  4KHP L;  1YHA A;  1VQ7 A;  4DR5 Q;  5IT9 c;  4BBR H;  2D0P A;  3KLW A;  2ZJP A;  4HIM A;  2D62 A;  5E7N A;  1IBK Q;  1HZC A;  4HJ9 A;  3M7N A;  2Y0S G;  4BY7 H;  4WJ4 A;  3G6E A;  1JT8 A;  4JI6 L;  1NMF A;  1MIU A;  5IY0 A;  3ICE A;  4A3F G;  1SMX A;  3EN2 A;  4PMW A;  5FJ8 G;  1Y1V H;  3M4P A;  3J81 j;  2R92 H;  3CCR A;  2NN6 I;  1SRO A;  4DV5 L;  2HQL A;  2R7D A;  4JBK A;  2VUM H;  2RF4 A;  2UXD L;  3J80 i;  4LF7 L;  1KD1 C;  4JI0 L;  4K0K L;  4X64 Q;  4YWK A;  2GN5 A;  2R93 G;  1VQ6 A;  5AJ3 Q;  1IBM L;  2Y0S E;  5C4X H;  3M3Y H;  4BY1 G;  5GAH C;  1XMQ L;  1VQL A;  1QVG A;  1VCI A;  4ME3 A;  1PYS B;  2E5L L;  3HOZ H;  3CCU A;  1TWG H;  2MQH A;  1X54 A;  2OCE A;  5IYD G;  2BA1 A;  1D8L A;  3KDF B;  1PH7 A;  2MNA A;  3F2D A;  3CCJ A;  2B3G A;  4LFC Q;  4B3T Q;  5C3E H;  4LF7 Q;  1K73 C;  2JA6 G;  1NBW A;  2K5N A;  4GLV B;  2E2H H;  2IT1 A;  3K0X A;  2UU9 Q;  1Q12 A;  2LSS A;  1XMO L;  1Q46 A;  4GN4 B;  4R1J A;  2IHF A;  1BBW A;  1BBU A;  3KF8 B;  4PZ7 A;  2N8N A;  2VW9 A;  1WOC A;  4A3L G;  4IJL A;  3AYH B;  4QIW E;  1A63 A;  4J15 A;  4DKA C;  3L2P A;  2KBN A;  1Q1E A;  4DR4 L;  2Z6K A;  4HIO A;  2K5V A;  3J7A 5;  1N34 L;  3ULL A;  4DV6 Q;  3I4N H;  1TXY A;  4R4T A;  1J5E L;  4P73 A;  3KJP A;  2R7Z H;  4KHP Q;  1WCM G;  4C3I H;  1IL2 A;  4DV3 Q;  1W3S A;  3A5Z B;  3HKZ G;  4DR2 Q;  3CPW A;  5LMN L;  1D7Q A;  3I2Z A;  4DV7 Q;  1VQF A;  1HNX L;  4DR7 Q;  1C0A A;  1YHB A;  2WB1 E;  3PUV A;  1V9P A;  3GTO H;  2UXB Q;  4JI5 L;  2UUA Q;  4JI1 L;  2WB1 G;  4DV4 L;  3CCQ A;  1Q7Y C;  2YTV A;  1S3O A;  5IWA L;  3F2C A;  2BA0 A;  1FJG Q;  3JAM c;  1FGU A;  1EWI A;  5IP9 H;  5BR8 L;  2F3I A;  1A0I A;  1W2B A;  3CCV A;  3CQZ H;  4AYB G;  4B3M L;  2Z0S A;  2ZTD A;  3AFQ A;  4JI8 Q;  4R4C A;  1C9O A;  4A3D G;  1Z9F A;  4QL5 A;  4NXM L;  3AEV A;  1Q86 C;  1GVP A;  3GTK H;  3VDY A;  3HOZ G;  5IP9 G;  3A0J A;  4JV5 L;  3CME A;  1K8A C;  4LF8 L;  4YHH L;  4OX9 Q;  3NBH B;  4TVA B;  3K7A H;  3TS0 A;  2UUC L;  3GD7 A;  4C2M H;  1LUZ A;  3RZD H;  1SE8 A;  3I4M H;  2VQE Q;  4AQY Q;  4JI3 Q;  3CD6 A;  2ZTC A;  1XJV A;  2ZM6 L;  4LUZ A;  1YNX A;  1G29 1;  1S72 A;  4B3S L;  3HKS A;  2K52 A;  2K50 A;  3DM3 A;  2VZA A;  2JK8 A;  2AMC B;  2CWA A;  4LFA Q;  3OTO L;  3KF6 B;  4NPS A;  4GKJ Q;  2NVY H;  4WJ3 M;  2ALY B;  4DR3 L;  3PUY A;  1XPR A;  1HJP A;  1VQB A;  2E5L Q;  2OTJ A;  1EQQ A;  1X56 A;  1L1O C;  1HZA A;  2FXQ A;  4A3D H;  1N32 L;  4YY3 Q;  4A3K G;  3T1Y L;  2YYZ A;  4IOA A;  2ID0 A;  3RN5 A;  3S1M H;  5M3M G;  1QUQ B;  1TWC H;  4KLK A;  3I56 A;  1QZH A;  5HY6 A;  4AYB E;  1HNW Q;  1UE7 A;  1E22 A;  1GKH A;  4X65 L;  2VQF Q;  2HHH L;  4JI7 L;  3Q8D A;  3RN2 A;  1V43 A;  2IX0 A;  4DV1 Q;  1XMO Q;  4JI6 Q;  4DR1 Q;  3CCE A;  1LTL A;  4DR6 L;  4UP8 A;  3FP9 A;  2UXB L;  4GKK L;  4QJF A;  4P75 A;  1YBY A;  1SLJ A;  1K0R A;  1Q1B A;  2C35 B;  4GS3 A;  2PNH A;  3KJO A;  4HID A;  2AWO A;  1VQK A;  3K7U C;  1K3R A;  3GTP H;  2VNU D;  2CKZ B;  1VQC A;  3BU2 A;  1QVF A;  4A3J G;  3S2D H;  2KEN A;  1N33 L;  4DV2 Q;  5JJK A;  3ZJY C;  3K80 C;  4JBW A;  2B29 A;  1XMQ Q;  1V1Q A;  2IHE A;  2A19 A;  3HOY H;  4JI0 Q;  3ULP A;  2RHQ B;  3K81 C;  5IP7 G;  5AJ3 L;  1YVC A;  1I94 Q;  1CSP A;  4DAM A;  1VQ4 A;  4JBJ A;  1VQN A;  3H3V H;  1WI5 A;  1K83 H;  3J7Z C;  4IJH A;  1Z47 A;  2OTL A;  4X6A H;  4JI3 L;  2VQE L;  5JEA G;  4AQY L;  2JA9 A;  4JI5 Q;  1R9T H;  4APV A;  1ASY A;  2JJQ A;  1PH9 A;  1KAW A;  4DAY B;  3J80 c;  2F4V Q;  4LF4 L;  1IXR A;  4DK6 C;  5M3M H;  1CKN B;  1L0W A;  3UDF A;  1VQ8 A;  2VUM G;  3W1G A;  1B70 B;  1SRU A;  4OWW B;  3RLN A;  4P72 A;  3PV0 A;  4YWM A;  3TS2 A;  1TWA H;  1CKN A;  3NEM A;  4GLA C;  1HR0 W;  2EIF A;  3S16 H;  3H3V I;  4NXM Q;  3T1H Q;  1I6H H;  3TRZ A;  1YZ6 A;  3GTJ H;  4YCW A;  2AKW B;  2DUD A;  3NEN A;  4YCV A;  4L5R C;  4LW1 A;  4X66 L;  1KRS A;  2F4V L;  2GVA A;  2XTI A;  2ZJR A;  5C44 H;  3J81 c;  3IRB A;  1UE1 A;  4BA1 I;  4BA2 I;  1ASZ A;  2UXC L;  4K0K Q;  4JYA L;  4LUO A;  2I0Q A;  4JC0 A;  2VS1 A;  2JA5 G;  4P71 A;  2ZM6 Q;  2CFM A;  1EIF A;  3GTQ H;  1UE6 A;  3L0O A;  2NN6 G;  3AFP A;  2R93 H;  3G48 A;  3U58 A;  1MJE A;  1O7I A;  2K75 A;  2N49 A;  2PI2 A;  4DV3 L;  1WCM H;  2H5X A;  3D31 A;  4DV0 L;  3CMA A;  3PSI A;  1IBK L;  4RMF A;  3STB D;  1XNR Q;  5M5W H;  3M85 A;  3GDE A;  3S1N H;  1KL9 A;  1P16 A;  3KDF A;  4DV2 L;  3HFZ B;  4A93 H;  4OXP A;  1VQI A;  3A74 A;  2JA6 H;  3A5U A;  3M4O H;  1EUJ A;  3HOY G;  4DUZ Q;  2YTY A;  1E1O A;  3PO2 G;  2R6G A;  1X3F A;  4X64 L;  5GRO A;  1A62 A;  1X65 A;  4JI7 Q;  5FJ8 H;  3HOW G;  1QUQ A;  4B3R Q;  3CP0 A;  3I7F A;  5IE8 A;  1K8G A;  1E24 A;  2UUB Q;  3M4Q A;  2A8V A;  1KXL A;  1HZB A;  5C3E G;  4IFD G;  2WAQ G;  4YHH Q;  3PUW A;  1U0L A;  1BKB A;  2A1A A;  2PQA A;  3MEF A;  3UE0 A;  3JAM i;  4IPH A;  4BBR G;  2JA8 H;  4LFC L;  1S40 A;  4P74 A;  2E2J H;  1VQA A;  4OWX B;  3K8A A;  3I4N G;  3KF6 A;  4Y52 H;  1PA6 A;  1HH2 P;  1I3Q H;  2JA7 G;  4OO1 G;  5FLX c;  1YJW A;  1KIX A;  1YEZ A;  4IOC A;  5C0X I;  3UE1 A;  3CC4 A;  2HIX A;  4LNQ A;  5GAE C;  1Y14 B;  3E9I A;  3U4V A;  4LFA L;  5H1S E;  2JEB I;  3CW2 C;  2E2I H;  1HR0 L;  4DV4 Q;  2HT1 A;  4DV5 Q;  4AH6 A;  1AE3 A;  2UXD Q;  4HJA A;  1CSQ A;  3RLO A;  1M90 C;  1J6Q A;  4JYA Q;  4HJ5 A;  1VQJ A;  1B8A A;  2N3S A;  3CCM A;  1SFO H;  2ASB A;  4IPC A;  5IP7 H;  3CAM A;  5IYB H;  5IYC G;  4UY8 C;  2JEA I;  4EX5 A;  2MO0 A;  1JJ2 A;  5M5Y H;  1TWF H;  4A3L H;  2L15 A;  1GM5 A;  2KHI A;  4L5Q A;  4DR2 L;  4OX9 L;  3S24 A;  4BXX H;  2NVX H;  4A3M G;  3E9H A;  4R4I A;  4POF A;  3L7Z C;  4DUY Q;  2RCN A;  4KHZ A;  3BZC A;  1H95 A;  1XTD A;  2NZH A;  2EQS A;  4GKK Q;  3EIV A;  4A4I A;  1YIT A;  2E8G A;  4XIG S;  3CCL A;  4UP7 A;  2WAQ E;  1PH4 A;  4A3B G;  1PVO A;  4IFD J;  2NZO A;  4NXN Q;  1RIP A;  1EFW A;  2KCM A;  4JG2 A;  4LWC A;  1PH3 A;  1A8V A;  1VQP A;  1I94 L;  4Y7N H;  3STB C;  4BBS G;  5C4X G;  5J3B A;  4GNX C;  1OTC A;  2WP8 J;  1X9N A;  1VQH A;  2ES2 A;  4JV5 Q;  1B7Y B;  2HIV A;  3T1Y Q;  1NTG A;  4LF8 Q;  2KCT A;  4AIM A;  3KFU A;  1J5E Q;  2K5H A;  1T9H A;  1WFQ A;  4HIK A;  1XPU A;  4BBS H;  1TWH H;  4JCV E;  2IY5 B;  4GNX A;  1CUK A;  2I5M X;  2OQ0 A;  3I4O A;  1XNR L;  4H02 A;  4LF5 Q;  2BH2 A;  4O0A A;  1PH5 A;  3PUZ A;  4LUV A;  1HNZ L;  4A3B H;  1IBM Q;  4DV6 L;  3FKI H;  4A75 A;  3I55 A;  4DR6 Q;  1PHJ A;  1L1O B;  1AH9 A;  3RNU A;  2R7Z G;  4PG3 A;  4LF6 L;  2UUA L;  4LFB L;  1UWV A;  2B63 G;  3B6Y A;  1OXX K;  3CF5 A;  4A3I H;  3UDG A;  1Y1W H;  1M1K C;  4BXX G;  4A3F H;  3EBE A;  4A3M H;  2AHO B;  3BZK A;  1HNX Q;  5GAG C;  2UXC Q;  2XGT A;  2WFW A; 
#chains in the Genus database with same CATH topology
 1BOS A;  4GOP B;  3DXJ C;  3NWT A;  1YJ9 A;  5IYB G;  1FL0 A;  4YIJ A;  1FVI A;  2WII B;  1WTH A;  3GTL B;  1U4L A;  3R3O A;  2A6H C;  5EBC A;  1D5M C;  1HXY D;  4XXE A;  4ZUJ A;  4DR4 Q;  2QW7 A;  1ET9 A;  5FLM G;  4NKL A;  3VYT A;  4X62 Q;  2CQA A;  5M5W B;  1PFS A;  1HR0 Q;  2ICE C;  1N36 L;  5K36 G;  4FF2 A;  4BY1 B;  1G6P A;  3I4N B;  3HOV G;  3S14 H;  5FK9 C;  2UU9 L;  1SMY C;  1N9W A;  5C0X G;  4POG A;  1H9S B;  1LTR D;  2EDG A;  2YTX A;  1HQR D;  2KQ3 A;  1RF2 D;  4KKU A;  4KJO A;  3T1H L;  1VQ9 A;  1E0B A;  2B2U A;  4MNO A;  4QF4 A;  3TEH B;  2B2V A;  4IN3 A;  3Q0A A;  1Y1W G;  3RZO B;  4PZ6 A;  4LK1 C;  1GUT A;  2VL6 A;  1Q8K A;  4GN3 B;  4ZQ3 A;  1SR3 A;  1PZJ D;  1Q8I A;  4QGU A;  1GUS A;  1X3G A;  5IYD H;  3ULJ A;  1XNQ L;  3LWE A;  4LF6 Q;  4P2C B;  1JCK B;  2CW0 C;  5KNC A;  2QA4 A;  2JN4 A;  3DWQ A;  3HKZ E;  1E3P A;  4IUN A;  3E6Z X;  5LL6 S;  3H15 A;  1ILQ A;  3PIP A;  3MEH A;  3S1R H;  1WJJ A;  2ZJQ A;  1NY4 A;  1F9P A;  4IPG A;  1WTP A;  2KJX A;  1ICW A;  2PW5 A;  3NPP A;  1VQO A;  1XTC D;  2L55 A;  4C3H B;  3W5O A;  3D3R A;  3FMC A;  4DNR B;  3S1Q H;  5M5Y B;  5A2Q L;  2L11 A;  3DWP A;  4NB3 A;  3A8K E;  5HUR A;  2BOS A;  3IKJ A;  2BDO A;  4JOI A;  2KHS A;  3LGJ A;  1OXS C;  1F77 A;  4NW2 A;  2DGY A;  2KVM A;  3K59 A;  2EY1 A;  2Q2U A;  2Q2I A;  3I4M B;  1AH9 A;  2F1M A;  3PGZ A;  5IGC A;  5NUC A;  3C2P A;  5F2D A;  2XSC A;  1VS0 A;  2Y0S B;  2EXZ A;  4UAI A;  1Y1V G;  4DNI A;  3OMC A;  4UPA A;  1TU2 B;  4LFB Q;  3GO5 A;  5CR3 A;  2JQO A;  2TSS A;  1TS5 A;  1W6J A;  1G2S A;  3SGI A;  2XWJ B;  5DLQ E;  2UUC Q;  3H91 A;  1Q3L A;  1L0X B;  2MHV A;  1TY2 A;  1D1I A;  3QO2 A;  4RKB A;  2FMM A;  2JA7 B;  4UP9 A;  1XPO A;  2OQK A;  5CV8 A;  3MAQ A;  4BY7 G;  1EOV A;  3X3N A;  4FDB A;  3FKI B;  4DV7 L;  4K14 A;  1EIH A;  2DY8 A;  4C3I B;  2RCF A;  1EY5 A;  3A56 A;  1KC8 C;  4IZ8 A;  4X66 Q;  4FO2 A;  4G7Z C;  3S15 H;  1HNZ Q;  1N34 Q;  3SHL A;  2F52 A;  2PQA B;  1YHA A;  4OIK A;  4BBR H;  3KLW A;  2D62 A;  1PTO F;  5E7N A;  4F87 A;  3G6E A;  4JI6 L;  4Q5V A;  1MIU A;  5IY0 A;  1TWH B;  3TZD A;  3EN2 A;  3MTS A;  1AFP A;  5FJ8 G;  1Y1V H;  3M4P A;  1SRO A;  5IGF A;  1SDF A;  2RF4 A;  3RMH A;  3J80 i;  4LF7 L;  1UUP A;  1KD1 C;  3HG9 A;  5BN3 A;  1VQ6 A;  1I4X A;  5C4X H;  3FRP B;  4H44 C;  2A6E C;  1VQL A;  4ME3 A;  2LKV A;  3HOZ H;  3CCU A;  1IYV A;  2F0T A;  2NTS A;  2BA1 A;  4JVZ A;  2MNA A;  5C3E B;  3F2D A;  4B9W A;  4LAA A;  3CCJ A;  4K5V A;  4OGQ C;  5C3X A;  4GLV B;  1TWC B;  2MGS A;  2L12 A;  2E2H H;  4JK1 C;  4TKO B;  1Q12 A;  4HSP A;  1WD0 A;  2IHF A;  1BBW A;  1F2L A;  4A3L G;  4IJL A;  1A63 A;  5I9O A;  4RH6 A;  2JA8 B;  4OL7 A;  1Q1E A;  1WTW A;  4IUT A;  3BDL A;  2J0T D;  1BCP C;  4KV6 A;  2HQE A;  2Z9H A;  3U9O A;  4R8I A;  4P73 A;  1J5E L;  2K05 A;  1VMP A;  2B2V C;  4KHP Q;  4C3I H;  1IL2 A;  1QIL A;  3A5Z B;  1KTK A;  3BYT B;  4F88 A;  3VYU A;  1LLR D;  4RCO A;  4KY7 A;  5JPN C;  2J4X A;  4RKL A;  3NTI A;  4XDX A;  1D7Q A;  1B53 A;  3N52 A;  2WB1 E;  3PUV A;  4A93 B;  1V9P A;  1S5E D;  2E75 C;  2UUA Q;  3GTK B;  1I4H A;  1B3A A;  2WB1 G;  5CYU A;  3GTG B;  1LT4 D;  3CCQ A;  2YTV A;  4K5W A;  2BA0 A;  5J22 A;  4C56 C;  1EWI A;  5BR8 L;  1CHP D;  1HFG A;  1PRT C;  1A0I A;  2F3I A;  2Z0S A;  2ZTD A;  3AFQ A;  3SDZ A;  4QL5 A;  1I50 B;  5KYL A;  3VDY A;  4A3F B;  2VB3 X;  1UAP A;  4DAV A;  3SK4 A;  2NVT B;  2EZV A;  3RZD H;  2EYJ A;  1S5D D;  5EPJ A;  2VQE Q;  1XJV A;  2ZM6 L;  4LUZ A;  1PLF A;  3HKS A;  2K52 A;  1GHJ A;  2VZA A;  2CWA A;  4FXD A;  4NPS A;  4A3J B;  2NVY H;  4DR3 L;  1K0S A;  4I7Z C;  2OTJ A;  5G3L F;  1HZA A;  2FXQ A;  1N32 L;  3V96 A;  5KIX A;  1EY4 A;  1Y69 U;  4YY3 Q;  4A3K G;  2F0O A;  4IOA A;  2ID0 A;  3S1M H;  3HP3 A;  3MC0 B;  5M3M G;  2NZ1 D;  2SDF A;  3S16 B;  1UE7 A;  1EWH A;  2Z4I A;  2XRQ D;  1V43 A;  2F0M A;  4JI6 Q;  2F3V A;  1FR3 A;  4UP8 A;  1RHP A;  2F0W A;  1SLJ A;  2C35 B;  4CJ0 B;  1TWF B;  3KJO A;  3Q24 A;  2E2D C;  4HID A;  1VQK A;  3K7U C;  2PZU A;  2CKZ B;  4ME5 A;  1U4P A;  1O78 A;  2WB1 B;  1MD2 D;  1QVF A;  4QCL A;  1UNS A;  3S2D H;  4UDU C;  4DV2 Q;  2PZW A;  3MFY A;  4JBW A;  5EGT A;  2VXW A;  2IHE A;  1I6V C;  2M9V A;  1OO9 B;  1SNQ A;  3K81 C;  5IP7 G;  3SK6 A;  1I94 Q;  1VQ4 A;  2PO4 A;  1B9M A;  3GV6 A;  1LAB A;  5C6A A;  5LL6 X;  5CV9 A;  4IJH A;  1Z47 A;  2OTL A;  2VQE L;  1ILP A;  1ASY A;  5BN4 A;  1PH9 A;  4DAY B;  3FEW X;  3VR6 A;  1L0W A;  4CKB A;  1VQ8 A;  3W1G A;  1A3U A;  5EKL A;  3PV0 A;  1TWA H;  1QOH A;  2E2I B;  4K8I A;  1HR0 W;  2EIF A;  2E76 C;  2XIW A;  1PFM A;  3D4W A;  3PO3 B;  4LW1 A;  1S5B D;  2ZJR A;  1B3Q A;  3IRB A;  4BA1 I;  4K0K Q;  5E4W C;  4JYA L;  3SVM A;  1LT5 D;  4P71 A;  2LMC B;  2ZM6 Q;  1DJR D;  2CFM A;  3AB9 A;  3U58 A;  2HUG A;  3K6O A;  4QUC A;  1WCM H;  2H5X A;  3D31 A;  3CMA A;  1IBK L;  4CBV A;  3S1N H;  4DV2 L;  4A93 H;  1QB5 D;  2IW3 A;  1I4Q A;  1LT6 D;  3BDO A;  3M4O H;  1E1O A;  1X3F A;  2F0P A;  4X64 L;  5GRO A;  1A62 A;  2RDG A;  5FOB B;  4FVM A;  1SYE A;  3HOW G;  1STY A;  5IE8 A;  1E24 A;  2WAC A;  2C9O A;  1QG7 A;  1U4R A;  1KXL A;  2WAQ G;  4ZUI A;  4RGN A;  3T56 B;  2DJG C;  4F8M A;  1SXT A;  1PA6 A;  1I3Q H;  5FLX c;  1YEZ A;  4CHT B;  5C0X I;  2HIX A;  2PW7 A;  3MXN A;  1Y14 B;  3G7L A;  3E9I A;  3CW2 C;  3E0J A;  1FD7 D;  4DV4 Q;  4FF1 A;  4DV5 Q;  4AH6 A;  2HT1 A;  4N8F A;  2UXD Q;  4HJA A;  4JYA Q;  1ML0 D;  4ODG A;  2EYF A;  3CCM A;  1SFO H;  4MN3 A;  5D65 A;  1JJ2 A;  1TWF H;  2PQE A;  3I90 A;  3RD4 A;  2KHI A;  4DR2 L;  4C1N K;  1EL0 A;  2NVX H;  1TT2 A;  4DUY Q;  3L7Z C;  1ENF A;  1AZP A;  1Y1V B;  3BZC A;  1H95 A;  2NZH A;  4RFB A;  3OW7 A;  2X69 A;  1DXM A;  2E8G A;  2PNR C;  1GUG A;  1WTV A;  4NXN Q;  2G9H D;  4JG2 A;  1EY7 A;  1JC7 A;  1PH3 A;  1VQP A;  1I94 L;  3HGB A;  2F0L A;  3OHX C;  2ES2 A;  1H9R A;  1NTG A;  3T1Y Q;  4LF8 Q;  1WTO A;  4GNX A;  1KLU D;  1CUK A;  2I5M X;  3I4O A;  3S14 B;  2K03 A;  3E5S A;  4O0A A;  1PH5 A;  4LUV A;  1HNZ L;  1B50 A;  3S1M B;  1BDO A;  1PYW D;  4J1M A;  4A75 A;  2D9U A;  1PHJ A;  3IFD A;  1JOK A;  2MP1 A;  1QE6 A;  2R7Z G;  2NVY B;  4A3M H;  1FGU A;  2EPB A;  2PCF B;  4X62 L;  1KRT A;  1BCP B;  3D0F A;  5JJZ A;  3H0G B;  3HS0 C;  5M5X H;  4TQU S;  3JAM L;  5IGB A;  3PO3 G;  3ZYY X;  3N6R A;  2BCO A;  2F0E A;  4WOR A;  3CC7 A;  2K7V A;  4KY5 A;  4N9T A;  1EY0 A;  4A3C H;  3WOF A;  3J81 i;  2R92 G;  1PRT B;  3GTL H;  1KDA A;  3I72 A;  2K1B A;  4M8A A;  4A3B B;  3A54 A;  1XX8 A;  1ZYR C;  1WCM B;  3U9S A;  5KGU A;  2R93 B;  1X3P A;  2NYZ D;  3SK8 A;  4L5S A;  1QCB D;  1G6Z A;  3NEL A;  2RHS B;  4CGY B;  4DR5 L;  1I4G A;  1G51 A;  1S4Z A;  3CCS A;  4RWS C;  2FIN B;  1OXV A;  1EIY B;  2O5J C;  5EKI A;  3PIO 3;  4ZCK A;  4A3I G;  3CXC A;  4DR3 Q;  3F2B A;  4HMJ A;  1Y8O B;  3W1B A;  5I6Y A;  2D2C C;  2K14 A;  4OWT B;  1NMG A;  2LXK A;  1TS2 A;  4LMQ D;  1PH8 A;  1H9S A;  3HRZ C;  2YU9 H;  1OXU A;  2VY3 A;  3V2T A;  4DNT B;  1VQG A;  4YWL A;  4B3T L;  5D3I B;  3TSS A;  4BS9 A;  4U68 A;  5ELF A;  4A3K B;  1EIG A;  2I5H A;  3O13 A;  1EY9 A;  1CKO A;  4A3E H;  4XTC S;  3PIO A;  4GOP C;  3ERS X;  4NMZ A;  3EJI A;  1WTX A;  4IPD A;  2Q2T A;  4A3G G;  1YHQ A;  1BXT A;  4H13 C;  2V1C C;  5JJL A;  1RTO A;  1DOL A;  1GO3 E;  1IBL L;  2NVQ B;  1TS3 A;  3DMU A;  1SN8 A;  1PV4 A;  2AUJ D;  5LHY 1;  2R7F A;  2Z6K C;  3HOW H;  1HTP A;  3ONA B;  1EZ8 A;  1YNN D;  4BY1 H;  4JI2 L;  1LTT D;  3UDI A;  1GD7 A;  1PDQ A;  3S9W A;  3G71 A;  2CQO A;  2NUC A;  4QY7 A;  2JA7 H;  4OO1 H;  1M8A A;  3TDQ A;  3CPF A;  3MXP A;  5C44 G;  5E1F A;  1SYC A;  1PZK D;  2RDF A;  3S2H B;  1QVC A;  3NK9 A;  2YV5 A;  4A93 G;  4G7O C;  2OWO A;  4JBM A;  3KYH C;  1PFB A;  1ZXT A;  3VR5 A;  4WFN 3;  1CTM A;  2NVT H;  3MWY W;  1D5X C;  4A3I B;  2PYK A;  3VR3 A;  5C0X J;  3HOU H;  4EGV A;  1NJI C;  4XQQ A;  5LMU Q;  1N8R C;  2I07 B;  4NDX A;  4DR7 L;  1SJH D;  2UUB L;  1RJT A;  4JI1 Q;  1T5E A;  2Z8L A;  2B63 H;  2JA8 G;  4DPG A;  3U4Z A;  1HTL D;  1JQY D;  1KHI A;  2VB2 X;  2NVQ H;  2JE6 I;  5M3F H;  2SNS A;  3NHH A;  4A76 A;  4HJ8 A;  2IX1 A;  3CU7 A;  4PMC A;  4B3M Q;  2B2T C;  2Q2H A;  4ULL A;  5CBA E;  2BE5 C;  4LF9 L;  3G4S A;  1VQ7 A;  4DR5 Q;  3D8G A;  2ZJP A;  1IBK Q;  2A5H A;  4BY7 H;  1TS4 A;  3WOE A;  1SEB D;  2OXP A;  2ZXP A;  4A3F G;  4PMW A;  3H3V C;  2R92 H;  3CCR A;  4DV5 L;  2VUM H;  1U4M A;  3OIQ A;  4K0K L;  4X64 Q;  4YWK A;  3S1Q B;  4XT3 B;  4DR6 L;  2E5L L;  1QVG A;  2B2U C;  5JEA H;  1PYS B;  3I3C A;  3NBH A;  4IQZ A;  5C4H A;  1TWG H;  2WKC A;  2OCE A;  1X54 A;  5IYD G;  4X3S A;  4KN7 C;  2F0J A;  2B2Y C;  2YU9 B;  2F0I A;  4L63 B;  1EZ6 A;  4Z9C B;  2K28 A;  1IL8 A;  1ZKO A;  5DAU A;  1K73 C;  2JA6 G;  2K5N A;  2IT1 A;  1GOZ A;  2UU9 Q;  2LSS A;  1XMO L;  4R1J A;  3M3Y B;  2N8N A;  4ZRZ A;  4O42 A;  3AYH B;  3BVM A;  3L2P A;  2KBN A;  5M3F B;  2Z6K A;  4HIO A;  3IAY A;  1I4R A;  3I4N H;  1TXY A;  2F03 A;  3KJP A;  2LS0 1;  5KND A;  1TKW B;  2MPM A;  5FO8 B;  3K7A B;  5LMN L;  1TQO A;  3I2Z A;  4E6I A;  1Z6H A;  4DR7 Q;  1C0A A;  3GTO H;  4JI5 L;  1BCP D;  4JI1 L;  1K3B C;  1JWS D;  1II3 A;  1QJO A;  1W2B A;  4AYB G;  4B3M L;  4JI8 Q;  3P7J A;  3AEV A;  3GTK H;  1PZI D;  1Q86 C;  4JV5 L;  3NBH B;  1G2T A;  4F7X A;  3TS0 A;  2UUC L;  4C2M H;  1LUZ A;  2M00 A;  5E4X A;  3I4M H;  2QKI C;  3GV3 A;  2JYO A;  4H0L C;  1G29 1;  4B3S L;  2K50 A;  4LFA Q;  1D1K A;  1TR5 A;  3A7L A;  1WD1 A;  4B9X A;  2AUK A;  3KF6 B;  2DJF C;  4GKJ Q;  4WJ3 M;  1XPR A;  1A3T A;  3L9A X;  1SNC A;  1X56 A;  1L1O C;  1JWM D;  1BF4 A;  2P5Z X;  3K5N A;  4FF3 A;  4PQX A;  3Q23 A;  4KKT A;  1QUQ B;  2HDM A;  2Q8T A;  3SEB A;  4DK0 A;  4AYB E;  1E22 A;  5I9P A;  3RN2 A;  1HQM C;  1XMO Q;  1DOK A;  3CCE A;  2NB0 A;  2UXB L;  2EJM A;  1AEX A;  5CV7 A;  1K8O A;  3GTP H;  1RD9 D;  4A3J G;  2KEN A;  2ZT9 C;  4HCE A;  3HOY B;  4HED A;  4MHE A;  3HOY H;  3ULP A;  3S1R B;  3HOZ B;  4G57 A;  3J7Z C;  4KN4 C;  1MBY A;  4X6A H;  4AQY L;  2DY7 A;  5JEA G;  4JI5 Q;  1R9T H;  4APV A;  1EWC A;  3BZD B;  2HDL A;  3J80 c;  3X3M A;  4KK7 A;  1LTB D;  2F4V Q;  1IXR A;  1O80 A;  1SRU A;  3RLN A;  4CDE C;  5DEH A;  1O7Y A;  3NQT A;  4GLA C;  2EY2 A;  1SYF A;  1J9O A;  3TP7 A;  4WJW A;  3D4R A;  3TRZ A;  2DUD A;  4X66 L;  1J8I A;  1W6K A;  2A74 C;  2GVA A;  1ENC A;  4DXG A;  2L5T A;  4LUO A;  1A15 A;  2VS1 A;  3KF8 A;  1PFN A;  1EIF A;  3GTQ H;  1UE6 A;  3L0O A;  3QOL A;  1MJE A;  5EJW A;  4DV3 L;  2N49 A;  4DV0 L;  3KBX A;  1CM9 A;  3PSI A;  4K8J A;  4DAP A;  1Y8P B;  3J80 L;  3M85 A;  1P16 A;  3KDF A;  3HFZ B;  4OXP A;  1VQI A;  2QIL A;  4MTK A;  3A5U A;  3HOY G;  1HRJ A;  3VR4 A;  1B9N A;  4JI7 Q;  3J80 E;  3MHB A;  5FJ8 H;  2KA7 A;  1QUQ A;  2FFK B;  2Z6B A;  3KLS A;  4LJZ C;  4B3R Q;  4PMB A;  2A8V A;  5C3E G;  4IFD G;  1JB3 A;  2KUM A;  3QIA A;  2PQA A;  3VR2 A;  3JAM i;  5IOC A;  4LFC L;  3LX0 A;  4P74 A;  1S40 A;  2E2J H;  3I4N G;  1GHK A;  1CZW A;  1RDP D;  3ERQ A;  1B4O A;  1EEF D;  4ILW A;  1LV9 A;  1RKN A;  5GAE C;  2F3W A;  4RAU C;  4DA2 A;  2QEJ C;  5H1S E;  1CA6 A;  2E2I H;  2A73 B;  1AE3 A;  3I70 A;  3R93 A;  1BR9 A;  3RLO A;  1XYI A;  5ELD A;  3BG3 A;  2N3S A;  2ASB A;  5IP7 H;  5IYB H;  1R9T B;  4UY8 C;  2JEA I;  4EX5 A;  3K5M A;  2L15 A;  1GM5 A;  1IKM A;  4OEM B;  4X3T A;  4BXX H;  5M9O A;  1EYC A;  1ESF A;  2RQX A;  2JXM B;  2PPB C;  2KOL A;  4A3B G;  1PVO A;  1U9R A;  2Q8I B;  1RIP A;  3LWU A;  3FPU B;  2F0F A;  1A8V A;  2LFN A;  3STB C;  4BBS G;  5J3B A;  3OIP A;  1OTC A;  3AMU A;  2WP8 J;  1K8M A;  1IW7 C;  4IUP A;  4JW0 A;  4CJ1 B;  1J5E Q;  2K5H A;  1T9H A;  4HIK A;  1S5C D;  2H4O A;  3QB3 A;  4H02 A;  4IUQ A;  2BH2 A;  3PUZ A;  4B08 A;  2PZT A;  3GP7 A;  1Z7T A;  4PG3 A;  4LF6 L;  2B63 G;  1OXX K;  4A3I H;  3UDG A;  1M1K C;  3BVZ A;  2AHO B;  5GAG C;  2WFW A;  5M3F G;  3CQZ B;  2B2T A;  4IO9 A;  1KNE A;  5CC4 A;  1NR4 A;  3TP8 A;  1G8Z D;  3BJU A;  1V1P A;  3IFT A;  4ALP A;  3GTO B;  1X55 A;  2DN8 A;  3U50 C;  3T4A C;  4EQN A;  4JI8 L;  4MZ9 A;  2RA4 A;  2HCC A;  2K5Q A;  3D4D A;  1I50 H;  1C4Q A;  4C3H G;  3PIP 3;  3PO3 H;  1EY8 A;  1Q82 C;  1JJG A;  2KHJ A;  1UEB A;  3K5L A;  1PRT D;  3EFX D;  2RDH A;  4JI4 L;  2RSN A;  3FKI G;  4EVO A;  4KJN A;  1HUM A;  3M9B A;  4YY3 L;  3MXN B;  3R8B A;  4K2L A;  3EA6 A;  4GKJ L;  5ELC A;  5EAY A;  4LF5 L;  1FJG L;  4C3J B;  3A55 A;  4QQB X;  1I6H B;  4J8Q A;  3H0G G;  1LT3 D;  3PQI A;  3T51 B;  1F9R A;  4FYD A;  1E7Z A;  1F9Q A;  5GAD C;  1KQS A;  3OMG A;  5EPK A;  3DM1 A;  4RGO S;  5LMN Q;  2MO1 A;  2A6E D;  3TQY A;  4KI0 A;  3E0E A;  2IL8 A;  1F2Y A;  5IYC H;  3LNN A;  4DN4 M;  3PMF A;  2JA5 H;  4ZK9 B;  3RR5 A;  3I4M G;  1IYJ B;  1Y8N B;  4EQP A;  3ERO A;  4QB4 A;  4A3E G;  5A2Q E;  3TRE A;  4PNY A;  4CJ2 C;  1IBL Q;  5C4J H;  4JPB W;  1EQR A;  1U5K A;  2EXD A;  1VF5 C;  2NVX B;  4GOP A;  3KUP A;  4R4O A;  1NE3 A;  4M1U B;  3MZ5 A;  3QOJ A;  4I65 A;  1DGS A;  2WIN B;  4ZKC B;  3TP5 A;  5FO9 B;  2ICI A;  1QNK A;  1F2Z A;  2EOT A;  2GA4 B;  1PH1 A;  2BH8 A;  3OPO A;  3HOX H;  1TVX A;  3F1Z A;  4PV1 C;  2B63 B;  3AQQ A;  4BY7 B;  3OW2 A;  4C3J H;  1JJC B;  5IWA Q;  4MTN A;  5IT9 E;  2X6G A;  2L0C A;  4OON A;  1P8L A;  1XNQ Q;  1N36 Q;  3DEO A;  1SNO A;  1STH A;  5IGE A;  4A3C G;  4HJ7 A;  5LMU L;  1OXT A;  3KLR A;  4A3G B;  2QDL A;  1K9M C;  4DV0 Q;  5GQO A;  1UE5 A;  1LM0 A;  3TBI B;  2B2W C;  3HKZ B;  1Y1W B;  4ZAI A;  4OO1 I;  2K33 A;  3OTO Q;  5LMN W;  4HAE A;  5L37 A;  1LYL A;  4DK3 C;  4GN5 A;  2F0D A;  3VA7 A;  1IHZ A;  1H9M A;  1JMC A;  3KBG A;  4V19 0;  3HOW B;  5KYI A;  3PO2 H;  1MGS A;  4RCN A;  3GTG H;  3ND8 A;  5CGK A;  2I5L X;  1N32 Q;  5ELN A;  4A3M B;  1RL2 A;  1NCV A;  3HEJ A;  5HGQ A;  5C44 B;  4KHP L;  2XVS A;  5IT9 c;  1DM0 B;  5DNF A;  4ZLT F;  3M7N A;  4WJ4 A;  4HJ9 A;  1LTS D;  5K5P A;  4ZKB B;  3DWA A;  3ICE A;  1SMX A;  2OT2 A;  4KKS A;  1XXG A;  1VMC A;  1UEA B;  2NN6 I;  5M3M B;  2JSO A;  1A6X A;  2R7D A;  4DK1 A;  1GXD C;  4JI0 L;  1HPC A;  2R93 G;  1JOR A;  1IBM L;  2Y0S E;  3M3Y H;  1VCI A;  2MQH A;  2EJF C;  2R92 B;  1AW7 A;  1D8L A;  2OEO A;  3SE0 A;  3CHB D;  1PTO H;  3F2U A;  3W3A A;  1PTO B;  3P75 A;  4CDD C;  4B3T Q;  4LFC Q;  5C3E H;  1NBW A;  3K0X A;  1E2W A;  2A69 C;  1F9S A;  3GTP B;  5AFW A;  1BBU A;  1D5Z C;  1TY0 A;  3TME A;  3Q22 A;  3J7A 5;  2K5V A;  3GTM B;  1N34 L;  3ULL A;  4DV6 Q;  4HCS A;  4HR7 B;  3MXG A;  4DV3 Q;  4IAL A;  3L3O C;  3J7A V;  5D3D A;  1HNX L;  4TRD A;  4DV7 Q;  1IYU A;  5CBE E;  5K36 H;  3NTH A;  4H7B A;  3F2C A;  1S3O A;  2NN6 H;  4KD3 A;  1ENA A;  3MA2 B;  3CCV A;  2C5C A;  5C5L A;  1C9O A;  5DM6 3;  4A3D G;  1Z9F A;  3HOZ G;  5IP9 G;  1E2Z A;  4YHH L;  2K5D A;  1IKL A;  4N9P A;  4TVA B;  3NP8 A;  5FLX L;  2KEC A;  5KEE A;  1NAP A;  1SE8 A;  1E2V A;  1R4P B;  1KAA A;  4WRD A;  5JOB A;  4JI3 Q;  3CD6 A;  1SND A;  1YNX A;  1GUN A;  2F0S A;  1SNP A;  2EYO A;  2JK8 A;  2AMC B;  5CV4 A;  5KNB A;  1SNM A;  1V1O A;  2F0Q A;  2ALY B;  3PUY A;  5COR A;  1HJP A;  1C8C A;  2F0G A;  3R2I A;  4A3D H;  2YYZ A;  3RN5 A;  2R7Z B;  1TWC H;  2E2H B;  2IPK D;  4FP5 D;  5HY6 A;  3URY A;  1HNW Q;  1G91 A;  2HHH L;  5CMD A;  4X65 L;  2VQF Q;  4KHV A;  1PRT F;  4DV1 Q;  1T5X D;  2FJ2 A;  2EYL A;  1JWU D;  4QJF A;  4P75 A;  1K0R A;  1Q1B A;  4GS3 A;  5T1G A;  2KED A;  3QG1 A;  1K3R A;  1AP0 A;  3NBI A;  3TZU A;  1VQC A;  2RVL A;  3SXH A;  2EYH A;  3D6W A;  1B1Z A;  1PXU A;  2A19 A;  5CV6 A;  1FYC A;  1CQF A;  1S5F D;  2G5D A;  2RHQ B;  5AJ3 L;  1VQN A;  1YVC A;  3H3V H;  1WI5 A;  4K2K A;  1ROD A;  1CA5 A;  4JI3 L;  2JA9 A;  1DZ1 A;  1YNJ D;  1KAW A;  3OSO A;  2CHB D;  2QCP X;  4DK6 C;  5M3M H;  3UDF A;  2VUM G;  2F0N A;  4OWW B;  2L1B A;  5I4D A;  3TS2 A;  4YWM A;  1SMY D;  1ET6 A;  2D5D A;  3BDC A;  3S16 H;  5E3F A;  1CT1 D;  3T1H Q;  4DAY A;  1I6H H;  3I91 A;  2AKW B;  4YCV A;  4L5R C;  4GZY C;  2F4V L;  2N55 A;  3HOU B;  1DYQ A;  2B39 A;  2KCC A;  2N88 A;  5J39 A;  1ASZ A;  3M7G A;  3ITP A;  1ONL A;  1A3V A;  4KY6 A;  3SK5 A;  1EY6 A;  1KLG D;  3AFP A;  2R93 H;  3G48 A;  1SJE D;  2WV6 D;  4XYO A;  3P20 A;  4FXK C;  4XT1 B;  2WAQ B;  4RMF A;  3STB D;  1XNR Q;  2SEB D;  5M5W H;  1H9J A;  3I8Z A;  3M4O B;  1RCV D;  2NWG A;  3NSW A;  2JA6 B;  3A74 A;  2JA6 H;  1EUJ A;  4X3U A;  4DUZ Q;  1V8Q A;  2YTY A;  3PO2 G;  2R6G A;  4K6L A;  3EVQ A;  5EPL A;  4KD4 A;  1K8G A;  4L6T B;  5ELB A;  3NUC A;  1U0L A;  3PUW A;  1BKB A;  2A1A A;  3UE0 A;  4IPH A;  4BBR G;  4QUF A;  1STE A;  4OWX B;  3KF6 A;  2JA7 G;  4OO1 G;  2EY5 A;  3J7A F;  1QWY A;  5COY A;  1KNA A;  3UE1 A;  3CC4 A;  4N8X 1;  4X3K A;  4LNQ A;  3K58 A;  4LFA L;  2JEB I;  5DM7 3;  2O4X A;  1CSQ A;  1LAC A;  1J6Q A;  3C3L A;  1VQJ A;  1B8A A;  4IPC A;  4Y7N B;  2MO0 A;  4A3L H;  2EY6 A;  5EBD A;  4OX9 L;  4V0B A;  3HZX A;  1PTO D;  4R4I A;  1BO0 A;  2EQS A;  1MHW C;  4R8N A;  1K28 A;  4GKK Q;  5ELE A;  1V1P B;  3HOV B;  2F4I A;  3CCL A;  2WAQ E;  4IUR A;  4IFD J;  2F0H A;  1EFW A;  4LWC A;  4XYQ A;  5A35 A;  4Y7N H;  5C4X G;  1ESR A;  2BE5 D;  4CDF C;  4DF7 A;  1X9N A;  1VQH A;  1X3Q A;  4RA8 A;  4JV5 Q;  1BCP F;  2HIV A;  5FO7 B;  1HA5 A;  1JR0 D;  2KCT A;  4AIM A;  3KFU A;  4BBS H;  1XPU A;  1WFQ A;  2IY5 B;  1TWH H;  2A68 D;  4JCV E;  1XNR L;  2CVR A;  3I73 A;  1IBM Q;  4DV6 L;  1STG A;  2ENB A;  1HUN A;  2EYP A;  2F0U A;  5JVG 3;  1L1O B;  4MIU A;  4EQO A;  1WTR A;  3B6Y A;  2E2J B;  3CF5 A;  1Y1W H;  3VA5 A;  2Z1C A;  3BZK A;  1HNX Q;  2XGT A;  2CWP A;  5IGD A;  1CI3 M;  3H0G H;  3DLL A;  3DEP A;  1I5F A;  1QZG A;  1NUC A;  3PUX A;  1VQD A;  2D0O A;  1JOQ A;  2PI2 E;  2B8G A;  4JI2 Q;  1C7Y A;  4TSS A;  2ATW A;  4JI4 Q;  1X6O A;  1TII D;  4YCU A;  3ER0 A;  2B2Y A;  1QNU A;  4EQ5 A;  4C3J G;  2F0V A;  4A3G H;  4R4Q A;  4B3S Q;  1RTN A;  2HD3 A;  4L5T A;  1EYG A;  4DUZ L;  3WWV A;  2N78 A;  1C48 A;  1HCZ A;  1R4Q B;  3A8I E;  3HOX B;  2PMZ B;  2RBM A;  4UHV A;  1HZ9 A;  1Q81 C;  2IJ0 A;  3JC6 6;  1KDB A;  4S3S A;  2AQ3 B;  3PCO B;  2CCZ A;  1L2F A;  5EQ0 A;  4DUY L;  2L4N A;  4C3H H;  2K4K A;  5BR8 Q;  2KEE A;  2QGQ A;  3AU7 A;  1PH2 A;  3C1F A;  4A3K H;  4O2D A;  3HOV H;  4DR1 L;  4LF4 Q;  4NXN L;  1BUV T;  2IWH A;  3T16 A;  1X32 A;  4X65 Q;  2VQF L;  1HFN A;  1B44 D;  3S2D B;  1JIC A;  2I46 A;  4DV1 L;  3NTK A;  5G3L D;  3OWF A;  1VQM A;  1AZQ A;  1STN A;  2ZTE A;  1N33 Q;  1XWE A;  3W2D A;  1D2B A;  1K83 B;  5JJI A;  4LF9 Q;  1E1T A;  5J1Z A;  5I2Y A;  3KOJ A;  4ABN A;  5ISR A;  4OEL B;  3HOU G;  3F8T A;  3PF5 A;  4B3R L;  3K0Y A;  2G9D A;  4XQJ A;  3PF4 A;  1FNU A;  1VQE A;  1HNW L;  2VUM B;  4DGZ A;  5IT9 L;  4JOI C;  2X6L A;  1L1O A;  3FHW A;  3NXW A;  4IUV A;  4IFD I;  1FNW A;  2K04 A;  1PYB A;  1YIJ A;  5ELO A;  4CKC A;  2AWN A;  3RLF A;  3BYY B;  2MFI A;  2PMZ E;  1X3E A;  4GNX B;  1MKH A;  3RZD B;  3CC2 A;  1AE2 A;  2O5I C;  3RZO H;  3FDT A;  2R3Z A;  3TN2 A;  1LTG D;  4QMG A;  2LXJ A;  5HGT A;  3C46 A;  4PZ8 A;  4HMI A;  4A3J H;  1WYD A;  3SR1 A;  3JAM E;  2QF7 A;  2A6H D;  3VYS A;  1CKM A;  1LTI D;  2HHH Q;  5FLM H;  4OIJ A;  5M5X B;  1MJC A;  1CHQ D;  1JE5 A;  3QWN A;  2WKD A;  2QEX A;  3UDX A;  1YJN A;  2MJ8 A;  1STB A;  4O1N A;  5JEA J;  2H1E A;  4QIW B;  3V05 A;  1BVS A;  1EFI D;  3OYY A;  2K01 A;  1ZEQ X;  4KTA A;  3HOX G;  4GLX A;  5C3W A;  4KMU C;  3S2H H;  1TWA B;  3GTM H;  1YI2 A;  2O2L D;  1SBB B;  2RSO A;  1IZ6 A;  2CH4 A;  4RG1 A;  3S17 H;  5D14 A;  1NSN S;  1JB7 A;  1PH6 A;  2GVB A;  2EYM A;  1EQV A;  2M2L A;  2D0P A;  1EEI D;  4HIM A;  1HZC A;  3M4Y A;  1JT8 A;  2Y0S G;  3H09 A;  4Q0F A;  2AQ1 B;  1EQT A;  2LY7 A;  1NMF A;  2Z4H A;  2ZXR A;  3J81 j;  4L8J A;  2OF1 A;  2HQL A;  4JBK A;  2UXD L;  2JA5 B;  2GN5 A;  3NE5 B;  5AJ3 Q;  5C0X H;  1LTA D;  4FF4 A;  5BN5 A;  2A69 D;  1EOT A;  4BY1 G;  5GAH C;  2RKS A;  1XMQ L;  4J6H A;  1SFO B;  2CW0 D;  3KDF B;  4CKE A;  1PH7 A;  3MFG A;  2B3G A;  4LF7 Q;  1FNV A;  2SNM A;  4RHR A;  2V4D A;  1Q46 A;  4GN4 B;  5C4X B;  1SYG A;  3A8J E;  4PZ7 A;  3KF8 B;  2VW9 A;  1WOC A;  1MSG A;  1Q90 A;  4QIW E;  1A2T A;  4J15 A;  4DKA C;  3S17 B;  4IFD H;  3VYR A;  5I2X A;  4DU9 A;  4DR4 L;  1SSO A;  4R4T A;  4FXG C;  2MUY A;  2R7Z H;  5TSS A;  1WCM G;  3WDN A;  1W3S A;  3HKZ G;  2BDN A;  3OOC A;  5JPM C;  4DR2 Q;  1YNN C;  3CPW A;  1VQF A;  1YHB A;  2UXB Q;  1BBX C;  1A2U A;  2EVB A;  1JOO A;  3R2T A;  3CKI B;  4DV4 L;  1Q7Y C;  5IWA L;  1O7L A;  1FJG Q;  3JAM c;  5IP9 H;  1NR2 A;  1YNJ C;  4RHS A;  3CQZ H;  5T1I A;  3GTQ B;  4R4C A;  1AN8 A;  2QDB A;  3NQI A;  4C2M B;  4NXM L;  1GVP A;  1M4V A;  3A0J A;  3CME A;  1K8A C;  4LF8 L;  4OX9 Q;  3K7A H;  3GD7 A;  3GTJ B;  1SYB A;  4AQY Q;  3FVQ A;  2ZTC A;  4IUU A;  2SOB A;  2XRS D;  1S72 A;  3DM3 A;  3OTO L;  5FLX E;  3RUZ A;  1F2M A;  1VQB A;  3FPP A;  2E5L Q;  4HSV A;  1EQQ A;  1ICF B;  2XN9 C;  3G6J B;  4XQN A;  2AQ2 B;  3T1Y L;  1HHV A;  1D6E C;  1KAB A;  4A3E B;  4KLK A;  3I56 A;  1QZH A;  3TP6 A;  1GKH A;  2K5W A;  4JI7 L;  3P1H A;  3Q8D A;  2IX0 A;  1DOM A;  5C4Z A;  3CRL C;  4DFA A;  4DR1 Q;  3A7A B;  3J81 E;  1LTL A;  3FP9 A;  4GKK L;  1O7Z A;  1YBY A;  1KDC A;  1SE3 A;  4C1N I;  1FGB D;  2PNH A;  4HTH A;  2AWO A;  2VNU D;  1STA A;  1EYA A;  2KCN A;  3BU2 A;  1MI2 A;  2EE1 A;  2TMP A;  3OWE B;  2L9H A;  1N33 L;  4I7A A;  5JJK A;  1DCZ A;  3QJY A;  3ZJY C;  3J7Y W;  3K80 C;  2B29 A;  1XMQ Q;  1V1Q A;  2F0K A;  2JP1 A;  4JI0 Q;  1CSP A;  1PTO C;  1BQQ T;  4JBJ A;  4DAM A;  1K83 H;  4BBR B;  3T13 A;  1I4P A;  1IW7 D;  1JE4 A;  1PMR A;  2JJQ A;  5EKK A;  2FMC A;  4LF4 L;  1SE2 A;  2DNE A;  1CKN B;  1B70 B;  4P72 A;  3PO2 B;  2E74 C;  3E3X A;  3NEM A;  1CKN A;  4ID6 A;  3CRK C;  3H3V I;  4NXM Q;  1YZ6 A;  3GTJ H;  4YCW A;  5JAV A;  2B8F A;  3NEN A;  1CFM A;  2R61 A;  2HCI A;  1KRS A;  2XTI A;  5KRU A;  5C44 H;  1I3Q B;  3J81 c;  1UE1 A;  4BA2 I;  1GUW A;  2UXC L;  4K6D A;  2I0Q A;  3GQB A;  4JC0 A;  2JA5 G;  2B2W A;  3S1N B;  2Q8R E;  2NN6 G;  3I4L A;  1O7I A;  2K75 A;  2PI2 A;  4AYB B;  4C3I G;  1SAP A;  1ZYR D;  3D6C A;  3GDE A;  3T53 B;  4K5X A;  3K57 A;  1KL9 A;  3QR8 A;  1CZG A;  2J7Z A;  4G7H C;  4FNF A;  1SE4 A;  2EJG C;  1X65 A;  1MSH A;  1WTQ A;  1LO5 D;  3NWS A;  3CP0 A;  3I7F A;  5IGG A;  3DUZ A;  1B2T A;  3EQL C;  3M4Q A;  2UUB Q;  2XWB B;  3Q6S A;  1HZB A;  4BBS B;  4YHH Q;  3MEF A;  2JA8 H;  3MXU A;  4R9W A;  1H9K A;  4RGM A;  1VQA A;  3K8A A;  4Y52 H;  1HH2 P;  2K6A A;  4CDC C;  4DXF A;  1YJW A;  1KIX A;  3J81 L;  5I6W A;  4IOC A;  3ND9 A;  5IIF A;  1VF7 A;  1SYD A;  3U4V A;  3KLS X;  5C4J B;  2IX3 A;  3H94 A;  2A68 C;  1HR0 L;  5CV5 A;  1HA6 A;  3K5O A;  4U67 3;  1M90 C;  4HJ5 A;  1WVL A;  4HN7 A;  5C5M A;  1NNX A;  3CAM A;  3H6M A;  5IYC G;  4RGT A;  1VDZ A;  3BS1 A;  5M5Y H;  2DNC A;  4NP5 A;  4L5Q A;  3S24 A;  4A3M G;  3E9H A;  2XNA C;  4POF A;  2NBF A;  2RCN A;  4KHZ A;  2CH4 W;  2FHT A;  1XTD A;  2NTT A;  4ZYS A;  1BNZ A;  3EIV A;  4A4I A;  1DON A;  1YIT A;  4XIG S;  4UP7 A;  1PH4 A;  1TWG B;  1L0Y B;  1EU3 A;  2NZO A;  1EYD A;  2KCM A;  3IL8 A;  3KK7 A;  4GNX C;  5FKA C;  2ZXO A;  1DD2 A;  1B7Y B;  3S15 B;  1GUO A;  1CQV A;  2K32 A;  2OQ0 A;  4LF5 Q;  3BVG A;  4G4K A;  4BWG B;  4A3B H;  5JVH 3;  3FKI H;  1GJX A;  1CK1 A;  3I55 A;  4DR6 Q;  1EU4 A;  3RNU A;  3UI2 A;  3C1E A;  4LFB L;  4A3D B;  3DHQ A;  4OHJ A;  1UWV A;  3MVV A;  2UUA L;  4BXX G;  4A3F H;  3EBE A;  5IOD A;  1VQ5 A;  2UXC Q; 
#chains in the Genus database with same CATH homology
 5M3F G;  2CWP A;  4GOP B;  4IO9 A;  3H0G H;  3DLL A;  1YJ9 A;  5IYB G;  4X62 L;  1FL0 A;  1KRT A;  1FVI A;  1I5F A;  3D0F A;  1QZG A;  3PUX A;  5M5X H;  1VQD A;  3BJU A;  4TQU S;  2D0O A;  2PI2 E;  4ALP A;  4JI2 Q;  1C7Y A;  1X55 A;  2ATW A;  3U50 C;  3PO3 G;  4JI4 Q;  4JI8 L;  1X6O A;  3CC7 A;  4YCU A;  3ER0 A;  4MZ9 A;  4DR4 Q;  4EQ5 A;  1I50 H;  5FLM G;  4A3C H;  4X62 Q;  3J81 i;  3PO3 H;  2R92 G;  3GTL H;  1PFS A;  1HR0 Q;  4A3G H;  4R4Q A;  4B3S Q;  4L5T A;  1N36 L;  1EYG A;  5K36 G;  4DUZ L;  1Q82 C;  3WWV A;  1G6P A;  2N78 A;  1JJG A;  3HOV G;  2KHJ A;  1UEB A;  3S14 H;  2UU9 L;  5C0X G;  1N9W A;  4POG A;  4JI4 L;  3FKI G;  4L5S A;  1HZ9 A;  2YTX A;  3NEL A;  2RHS B;  3T1H L;  1Q81 C;  1VQ9 A;  3JC6 6;  4DR5 L;  1G51 A;  3CCS A;  3M9B A;  4YY3 L;  1OXV A;  3MXN B;  3PCO B;  4MNO A;  1L2F A;  3TEH B;  2CCZ A;  1EIY B;  4GKJ L;  4A3I G;  4DUY L;  4PZ6 A;  3CXC A;  3F2B A;  4DR3 Q;  3W1B A;  1Y1W G;  5EAY A;  4LF5 L;  2VL6 A;  1Q8K A;  4C3H H;  1FJG L;  2K14 A;  2K4K A;  4GN3 B;  1NMG A;  2LXK A;  4OWT B;  5BR8 Q;  1SR3 A;  2QGQ A;  4QQB X;  3H0G G;  1PH2 A;  1PH8 A;  4A3K H;  4O2D A;  4QGU A;  4DR1 L;  4LF4 Q;  3HOV H;  1E7Z A;  1X3G A;  3ULJ A;  1VQ5 A;  4NXN L;  1XNQ L;  5IYD H;  4LF6 Q;  5GAD C;  1KQS A;  2YU9 H;  4X65 Q;  2VQF L;  1OXU A;  2VY3 A;  2QA4 A;  4DV1 L;  5LMN Q;  3HKZ E;  2MO1 A;  1VQG A;  4YWL A;  1E3P A;  4B3T L;  3TQY A;  1VQM A;  4KI0 A;  2ZTE A;  3E0E A;  5IYC H;  1N33 Q;  5JJI A;  3H15 A;  4LF9 Q;  2JA5 H;  1E1T A;  3RR5 A;  3PIP A;  3S1R H;  3I4M G;  1WJJ A;  1IYJ B;  3KOJ A;  2ZJQ A;  1NY4 A;  4A3E G;  4IPG A;  3TRE A;  3HOU G;  3F8T A;  1IBL Q;  3PF5 A;  4B3R L;  2I5H A;  5C4J H;  1CKO A;  4A3E H;  1EQR A;  1VQO A;  1U5K A;  2EXD A;  4XTC S;  3PIO A;  3ERS X;  4GOP C;  4IPD A;  4R4O A;  4GOP A;  1NE3 A;  3W5O A;  2Q2T A;  4A3G G;  3PF4 A;  3S1Q H;  1DGS A;  1VQE A;  4NB3 A;  1YHQ A;  1HNW L;  2V1C C;  5JJL A;  4JOI A;  1GO3 E;  3LGJ A;  1IBL L;  1OXS C;  4JOI C;  1PH1 A;  1L1O A;  1SN8 A;  2BH8 A;  3FHW A;  1PV4 A;  3HOX H;  2R7F A;  2DGY A;  2Z6K C;  3F1Z A;  3HOW H;  4IFD I;  2Q2U A;  4BY1 H;  1PYB A;  3AQQ A;  5ELO A;  1YIJ A;  4JI2 L;  2AWN A;  2Q2I A;  3RLF A;  3UDI A;  1GD7 A;  3OW2 A;  2MFI A;  3PGZ A;  1JJC B;  2PMZ E;  1X3E A;  4C3J H;  5IWA Q;  1MKH A;  4GNX B;  3CC2 A;  1AE2 A;  4MTN A;  3G71 A;  3RZO H;  1VS0 A;  2CQO A;  4QY7 A;  1Y1V G;  4DNI A;  4OON A;  2LXJ A;  4UPA A;  2JA7 H;  4PZ8 A;  1P8L A;  1XNQ Q;  4A3J H;  1N36 Q;  3CPF A;  1WYD A;  4LFB Q;  3GO5 A;  2JQO A;  5C44 G;  1CKM A;  2HHH Q;  5FLM H;  4A3C G;  3SGI A;  5DLQ E;  1MJC A;  1QVC A;  4HJ7 A;  2YV5 A;  5LMU L;  2UUC Q;  4A93 G;  2OWO A;  1OXT A;  3KYH C;  4JBM A;  1JE5 A;  1K9M C;  2QEX A;  4DV0 Q;  3UDX A;  1YJN A;  5GQO A;  1UE5 A;  2NVT H;  1LM0 A;  5JEA J;  4OO1 I;  4UP9 A;  1XPO A;  2OQK A;  5C0X J;  3OTO Q;  5LMN W;  3HOU H;  4BY7 G;  1EOV A;  1NJI C;  1BVS A;  3OYY A;  4FDB A;  5LMU Q;  1LYL A;  1N8R C;  4DV7 L;  4DK3 C;  4DR7 L;  4GN5 A;  2UUB L;  3HOX G;  4JI1 Q;  4GLX A;  1KC8 C;  1JMC A;  2B63 H;  2JA8 G;  3S2H H;  4X66 Q;  3PO2 H;  3GTM H;  1YI2 A;  4DPG A;  3U4Z A;  3GTG H;  1IZ6 A;  1KHI A;  3S15 H;  4RG1 A;  2NVQ H;  2JE6 I;  2I5L X;  5M3F H;  5ELN A;  4A76 A;  1RL2 A;  4HJ8 A;  1HNZ Q;  2IX1 A;  3S17 H;  1N34 Q;  1N32 Q;  4B3M Q;  2Q2H A;  2F52 A;  1JB7 A;  4LF9 L;  2PQA B;  1PH6 A;  5HGQ A;  2GVB A;  3G4S A;  4KHP L;  1YHA A;  1VQ7 A;  4DR5 Q;  5IT9 c;  4BBR H;  2D0P A;  3KLW A;  2ZJP A;  4HIM A;  2D62 A;  5E7N A;  1IBK Q;  1HZC A;  4HJ9 A;  3M7N A;  2Y0S G;  4BY7 H;  4WJ4 A;  3G6E A;  1JT8 A;  4JI6 L;  1NMF A;  1MIU A;  5IY0 A;  3ICE A;  4A3F G;  1SMX A;  3EN2 A;  4PMW A;  5FJ8 G;  1Y1V H;  3M4P A;  3J81 j;  2R92 H;  3CCR A;  2NN6 I;  1SRO A;  4DV5 L;  2HQL A;  2R7D A;  4JBK A;  2VUM H;  2RF4 A;  2UXD L;  3J80 i;  4LF7 L;  1KD1 C;  4JI0 L;  4K0K L;  4X64 Q;  4YWK A;  2GN5 A;  2R93 G;  1VQ6 A;  5AJ3 Q;  1IBM L;  2Y0S E;  5C4X H;  3M3Y H;  4BY1 G;  5GAH C;  1XMQ L;  1VQL A;  1QVG A;  1VCI A;  4ME3 A;  1PYS B;  2E5L L;  3HOZ H;  3CCU A;  1TWG H;  2MQH A;  1X54 A;  2OCE A;  5IYD G;  2BA1 A;  1D8L A;  3KDF B;  1PH7 A;  2MNA A;  3F2D A;  3CCJ A;  2B3G A;  4LFC Q;  4B3T Q;  5C3E H;  4LF7 Q;  1K73 C;  2JA6 G;  1NBW A;  2K5N A;  4GLV B;  2E2H H;  2IT1 A;  3K0X A;  2UU9 Q;  1Q12 A;  2LSS A;  1XMO L;  1Q46 A;  4GN4 B;  4R1J A;  2IHF A;  1BBW A;  1BBU A;  3KF8 B;  4PZ7 A;  2N8N A;  2VW9 A;  1WOC A;  4A3L G;  4IJL A;  3AYH B;  4QIW E;  1A63 A;  4J15 A;  4DKA C;  3L2P A;  2KBN A;  1Q1E A;  4DR4 L;  2Z6K A;  4HIO A;  2K5V A;  3J7A 5;  1N34 L;  3ULL A;  4DV6 Q;  3I4N H;  1TXY A;  4R4T A;  1J5E L;  4P73 A;  3KJP A;  2R7Z H;  4KHP Q;  1WCM G;  4C3I H;  1IL2 A;  4DV3 Q;  1W3S A;  3A5Z B;  3HKZ G;  4DR2 Q;  3CPW A;  5LMN L;  1D7Q A;  3I2Z A;  4DV7 Q;  1VQF A;  1HNX L;  4DR7 Q;  1C0A A;  1YHB A;  2WB1 E;  3PUV A;  1V9P A;  3GTO H;  2UXB Q;  4JI5 L;  2UUA Q;  4JI1 L;  2WB1 G;  4DV4 L;  3CCQ A;  1Q7Y C;  2YTV A;  1S3O A;  5IWA L;  3F2C A;  2BA0 A;  1FJG Q;  3JAM c;  1FGU A;  1EWI A;  5IP9 H;  5BR8 L;  2F3I A;  1A0I A;  1W2B A;  3CCV A;  3CQZ H;  4AYB G;  4B3M L;  2Z0S A;  2ZTD A;  3AFQ A;  4JI8 Q;  4R4C A;  1C9O A;  4A3D G;  1Z9F A;  4QL5 A;  4NXM L;  3AEV A;  1Q86 C;  1GVP A;  3GTK H;  3VDY A;  3HOZ G;  5IP9 G;  3A0J A;  4JV5 L;  3CME A;  1K8A C;  4LF8 L;  4YHH L;  4OX9 Q;  3NBH B;  4TVA B;  3K7A H;  3TS0 A;  2UUC L;  3GD7 A;  4C2M H;  1LUZ A;  3RZD H;  1SE8 A;  3I4M H;  2VQE Q;  4AQY Q;  4JI3 Q;  3CD6 A;  2ZTC A;  1XJV A;  2ZM6 L;  4LUZ A;  1YNX A;  1G29 1;  1S72 A;  4B3S L;  3HKS A;  2K52 A;  2K50 A;  3DM3 A;  2VZA A;  2JK8 A;  2AMC B;  2CWA A;  4LFA Q;  3OTO L;  3KF6 B;  4NPS A;  4GKJ Q;  2NVY H;  4WJ3 M;  2ALY B;  4DR3 L;  3PUY A;  1XPR A;  1HJP A;  1VQB A;  2E5L Q;  2OTJ A;  1EQQ A;  1X56 A;  1L1O C;  1HZA A;  2FXQ A;  4A3D H;  1N32 L;  4YY3 Q;  4A3K G;  3T1Y L;  2YYZ A;  4IOA A;  2ID0 A;  3RN5 A;  3S1M H;  5M3M G;  1QUQ B;  1TWC H;  4KLK A;  3I56 A;  1QZH A;  5HY6 A;  4AYB E;  1HNW Q;  1UE7 A;  1E22 A;  1GKH A;  4X65 L;  2VQF Q;  2HHH L;  4JI7 L;  3Q8D A;  3RN2 A;  1V43 A;  2IX0 A;  4DV1 Q;  1XMO Q;  4JI6 Q;  4DR1 Q;  3CCE A;  1LTL A;  4DR6 L;  4UP8 A;  3FP9 A;  2UXB L;  4GKK L;  4QJF A;  4P75 A;  1YBY A;  1SLJ A;  1K0R A;  1Q1B A;  2C35 B;  4GS3 A;  2PNH A;  3KJO A;  4HID A;  2AWO A;  1VQK A;  3K7U C;  1K3R A;  3GTP H;  2VNU D;  2CKZ B;  1VQC A;  3BU2 A;  1QVF A;  4A3J G;  3S2D H;  2KEN A;  1N33 L;  4DV2 Q;  5JJK A;  3ZJY C;  3K80 C;  4JBW A;  2B29 A;  1XMQ Q;  1V1Q A;  2IHE A;  2A19 A;  3HOY H;  4JI0 Q;  3ULP A;  2RHQ B;  3K81 C;  5IP7 G;  5AJ3 L;  1YVC A;  1I94 Q;  1CSP A;  4DAM A;  1VQ4 A;  4JBJ A;  1VQN A;  3H3V H;  1WI5 A;  1K83 H;  3J7Z C;  4IJH A;  1Z47 A;  2OTL A;  4X6A H;  4JI3 L;  2VQE L;  5JEA G;  4AQY L;  2JA9 A;  4JI5 Q;  1R9T H;  4APV A;  1ASY A;  2JJQ A;  1PH9 A;  1KAW A;  4DAY B;  3J80 c;  2F4V Q;  4LF4 L;  1IXR A;  4DK6 C;  5M3M H;  1CKN B;  1L0W A;  3UDF A;  1VQ8 A;  2VUM G;  3W1G A;  1B70 B;  1SRU A;  4OWW B;  3RLN A;  4P72 A;  3PV0 A;  4YWM A;  3TS2 A;  1TWA H;  1CKN A;  3NEM A;  4GLA C;  1HR0 W;  2EIF A;  3S16 H;  3H3V I;  4NXM Q;  3T1H Q;  1I6H H;  3TRZ A;  1YZ6 A;  3GTJ H;  4YCW A;  2AKW B;  2DUD A;  3NEN A;  4YCV A;  4L5R C;  4LW1 A;  4X66 L;  1KRS A;  2F4V L;  2GVA A;  2XTI A;  2ZJR A;  5C44 H;  3J81 c;  3IRB A;  1UE1 A;  4BA1 I;  4BA2 I;  1ASZ A;  2UXC L;  4K0K Q;  4JYA L;  4LUO A;  2I0Q A;  4JC0 A;  2VS1 A;  2JA5 G;  4P71 A;  2ZM6 Q;  2CFM A;  1EIF A;  3GTQ H;  1UE6 A;  3L0O A;  2NN6 G;  3AFP A;  2R93 H;  3G48 A;  3U58 A;  1MJE A;  1O7I A;  2K75 A;  2N49 A;  2PI2 A;  4DV3 L;  1WCM H;  2H5X A;  3D31 A;  4DV0 L;  3CMA A;  3PSI A;  1IBK L;  4RMF A;  3STB D;  1XNR Q;  5M5W H;  3M85 A;  3GDE A;  3S1N H;  1KL9 A;  1P16 A;  3KDF A;  4DV2 L;  3HFZ B;  4A93 H;  4OXP A;  1VQI A;  3A74 A;  2JA6 H;  3A5U A;  3M4O H;  1EUJ A;  3HOY G;  4DUZ Q;  2YTY A;  1E1O A;  3PO2 G;  2R6G A;  1X3F A;  4X64 L;  5GRO A;  1A62 A;  1X65 A;  4JI7 Q;  5FJ8 H;  3HOW G;  1QUQ A;  4B3R Q;  3CP0 A;  3I7F A;  5IE8 A;  1K8G A;  1E24 A;  2UUB Q;  3M4Q A;  2A8V A;  1KXL A;  1HZB A;  5C3E G;  4IFD G;  2WAQ G;  4YHH Q;  3PUW A;  1U0L A;  1BKB A;  2A1A A;  2PQA A;  3MEF A;  3UE0 A;  3JAM i;  4IPH A;  4BBR G;  2JA8 H;  4LFC L;  1S40 A;  4P74 A;  2E2J H;  1VQA A;  4OWX B;  3K8A A;  3I4N G;  3KF6 A;  4Y52 H;  1PA6 A;  1HH2 P;  1I3Q H;  2JA7 G;  4OO1 G;  5FLX c;  1YJW A;  1KIX A;  1YEZ A;  4IOC A;  5C0X I;  3UE1 A;  3CC4 A;  2HIX A;  4LNQ A;  5GAE C;  1Y14 B;  3E9I A;  3U4V A;  4LFA L;  5H1S E;  2JEB I;  3CW2 C;  2E2I H;  1HR0 L;  4DV4 Q;  2HT1 A;  4DV5 Q;  4AH6 A;  1AE3 A;  2UXD Q;  4HJA A;  1CSQ A;  3RLO A;  1M90 C;  1J6Q A;  4JYA Q;  4HJ5 A;  1VQJ A;  1B8A A;  2N3S A;  3CCM A;  1SFO H;  2ASB A;  4IPC A;  5IP7 H;  3CAM A;  5IYB H;  5IYC G;  4UY8 C;  2JEA I;  4EX5 A;  2MO0 A;  1JJ2 A;  5M5Y H;  1TWF H;  4A3L H;  2L15 A;  1GM5 A;  2KHI A;  4L5Q A;  4DR2 L;  4OX9 L;  3S24 A;  4BXX H;  2NVX H;  4A3M G;  3E9H A;  4R4I A;  4POF A;  3L7Z C;  4DUY Q;  2RCN A;  4KHZ A;  3BZC A;  1H95 A;  1XTD A;  2NZH A;  2EQS A;  4GKK Q;  3EIV A;  4A4I A;  1YIT A;  2E8G A;  4XIG S;  3CCL A;  4UP7 A;  2WAQ E;  1PH4 A;  4A3B G;  1PVO A;  4IFD J;  2NZO A;  4NXN Q;  1RIP A;  1EFW A;  2KCM A;  4JG2 A;  4LWC A;  1PH3 A;  1A8V A;  1VQP A;  1I94 L;  4Y7N H;  3STB C;  4BBS G;  5C4X G;  5J3B A;  4GNX C;  1OTC A;  2WP8 J;  1X9N A;  1VQH A;  2ES2 A;  4JV5 Q;  1B7Y B;  2HIV A;  3T1Y Q;  1NTG A;  4LF8 Q;  2KCT A;  4AIM A;  3KFU A;  1J5E Q;  2K5H A;  1T9H A;  1WFQ A;  4HIK A;  1XPU A;  4BBS H;  1TWH H;  4JCV E;  2IY5 B;  4GNX A;  1CUK A;  2I5M X;  2OQ0 A;  3I4O A;  1XNR L;  4H02 A;  4LF5 Q;  2BH2 A;  4O0A A;  1PH5 A;  3PUZ A;  4LUV A;  1HNZ L;  4A3B H;  1IBM Q;  4DV6 L;  3FKI H;  4A75 A;  3I55 A;  4DR6 Q;  1PHJ A;  1L1O B;  1AH9 A;  3RNU A;  2R7Z G;  4PG3 A;  4LF6 L;  2UUA L;  4LFB L;  1UWV A;  2B63 G;  3B6Y A;  1OXX K;  3CF5 A;  4A3I H;  3UDG A;  1Y1W H;  1M1K C;  4BXX G;  4A3F H;  3EBE A;  4A3M H;  2AHO B;  3BZK A;  1HNX Q;  5GAG C;  2UXC Q;  2XGT A;  2WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...