4JYAQ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaQ00
5FJ8G 3GTPH 1V43A 3UE1A 3B6YA 2IT1A 1J6QA 3GTQH 1JT8A 3KDFB 2N3SA 2F52A 1Z9FA 5BR8L 2AWOA 5FLMH 3I55A 1PH1A 1VQLA 2E2HH 4DR1Q 3S1NH 4A3GG 1Y1VG 1TWGH 3J7ZC 4HJ7A 1VQ5A 1XPOA 1XMOL 3HOYH 1QVFA 1PVOA 4LUVA 4AH6A 3F2BA 1HNXL 3AFQA 4LFAQ 1X3EA 3TREA 3S2DH 3CCJA 1KL9A 4JI8Q 4JYAL 2UXCQ 1YHAA 1YJWA 3DM3A 3NENA 2K52A 4KI0A 3I56A 5M5YH 3GTGH 3Q8DA 4JI6L 2N78A 1ASYA 1IBMQ 5JJKA 1UE7A 1D7QA 3FP9A 2UUCQ 1YHBA 1K73C 3GO5A 4YWKA 4A3LH 3TRZA 4L5RC 3NELA 1Y14B 4JI3L 3CMAA 4DV3L 1N32L 4DV6Q 1PH5A 1NJIC 4DV5L 2ZJQA 3PIPA 1BVSA 2EXDA 2F3IA 2IHEA 1Q82C 5IWAL 3J7A5 4YCUA 3G48A 1YNXA 1PYBA 5C44G 2A19A 4DR2Q 2WFWA 3TEHB 2VL6A 2R93G 4GLXA 3K80C 1CKMA 1OXXK 1P16A 1Q1BA 5LMNW 4DV4Q 4DR4Q 3A74A 3T1YQ 3STBC 2CCZA 4JV5Q 4B3RL 1EQQA 1CSPA 2F4VL 2ASBA 2CWPA 1OXSC 3D31A 4GOPB 3M4OH 2IY5B 2BH8A 3I4NH 1A62A 4DV0Q 5C3EH 5FLXc 3HKZE 4LWCA 4YWLA 4AQYL 5IP9G 1PH3A 1UE5A 4GOPC 1IXRA 4GOPA 5JEAG 1N34L 4DAMA 4DK6C 2PMZE 1GKHA 5IT9c 1HJPA 3HKZG 1QVCA 1VQCA 4DV1Q 3HOUG 4B3RQ 3M4QA 4GNXB 4DR3Q 5JJIA 2WAQG 3H0GH 3H0GG 4DR4L 1CSQA 2R7FA 4X64L 3STBD 1KIXA 3HOZG 1QZHA 4IJLA 1L1OC 1U5KA 2CFMA 3I4MG 2N8NA 1MJEA 1PH6A 3VDYA 1X56A 2Y0SG 3FKIH 4IPDA 3PUWA 3CCUA 2B63G 3ZJYC 1EWIA 1KHIA 5C0XI 3GTLH 1BBUA 4JCVE 3TQYA 4DV5Q 4LW1A 3UE0A 4DUZL 4BXXH 1HNWL 1VQ9A 2H5XA 4QIWE 4C3IH 3CPFA 5M3MG 2GVAA 5IP7H 5HY6A 4FDBA 1KAWA 4DV1L 3RN5A 4X66Q 4JI4L 1XPUA 4OO1I 1VQJA 3HFZB 4BY1G 2OCEA 4JI5L 4A93G 2IX0A 4O2DA 4IOAA 3CCVA 1IBLQ 1CKNB 3M7NA 4AQYQ 1VS0A 3PO2H 2PI2A 4R4QA 3CQZH 1L0WA 2VNUD 2ZM6Q 3KDFA 4KHZA 4LFAL 5J3BA 1T9HA 3H3VI 2Q2IA 2K14A 2VY3A 4DK3C 4LF5Q 1L2FA 5FJ8H 2K5VA 1D8LA 4MTNA 2I5HA 4A3CH 4JV5L 1NMFA 5BR8Q 5EAYA 1C7YA 4BA2I 1N33Q 2B3GA 3ULJA 4BY7H 4HIDA 2KBNA 1XTDA 1KRTA 2BA1A 2PQAA 2AHOB 1KQSA 2E2IH 2D0OA 4B3TL 4A3JH 1I94L 2OTJA 4PG3A 1V1QA 3EIVA 1PHJA 4OX9Q 2JA6G 4A93H 1FJGL 4JBJA 2XTIA 4A4IA 2ALYB 3CXCA 1IL2A 4R4OA 3RLNA 5JEAJ 3PF5A 2I5MX 1SMXA 3AYHB 4DAYB 3KFUA 4BXXG 1HR0L 4MZ9A 1X65A 4YWMA 2VQEL 4P74A 3K7UC 4YY3Q 3DLLA 1L1OB 3MEFA 3W5OA 1XPRA 2OQ0A 4JI0Q 1YEZA 4A3CG 3RZOH 5IYBG 2Y0SE 2A8VA 3ICEA 4TVAB 4LF9Q 4GN3B 4IFDG 2MNAA 3M85A 4LUOA 3T1HL 1AE3A 3J81j 1HZAA 1Q1EA 1SN8A 3RLOA 2HIXA 3S2HH 1AH9A 1HNXQ 3ULLA 4GN5A 5C0XJ 5GAGC 3CCMA 3HOXH 1VQAA 5E7NA 5ELNA 5C3EG 1VQNA 4UPAA 2MO1A 3AQQA 4AYBG 1A0IA 3RN2A 4A3FH 3L0OA 2R7ZH 2JE6I 1N9WA 1PYSB 1MJCA 2ZM6L 2I0QA 2KCTA 4JBMA 2OWOA 2JA9A 3RZDH 4BBSG 1S40A 2VQFL 3M3YH 3S1QH 2UXBL 3G6EA 1VQMA 2AWNA 4JOIC 2ZJPA 3U50C 4DR7L 1I6HH 5ELOA 2HIVA 1PH8A 4WJ4A 2JEBI 4QL5A 1S72A 2R7ZG 4JI4Q 3BU2A 1VQEA 3GTJH 2NVXH 1GVPA 1Z47A 4A3EG 2R92G 1O7IA 1B7YB 2K75A 2E5LQ 1GO3E 2RHQB 2D62A 4LFBL 4A3KH 1YJNA 1I3QH 4X65L 2UUBQ 4GS3A 3U4ZA 1UEBA 4P72A 2ZTEA 1WOCA 2B63H 2I5LX 1SR3A 1JJ2A 4JI1L 4JBKA 4A3IH 4EQ5A 1PH7A 3S1RH 3F2CA 2C35B 3JAMc 4IFDI 1VQBA 1EIFA 2QA4A 1G51A 1X3FA 4LF6Q 1TWHH 2UXDQ 3KF6A 2KHIA 1G6PA 2JA8G 1VQOA 4RG1A 4X62L 4C2MH 3CC7A 4DR5L 1FVIA 2PNHA 3I7FA 2YTYA 1EFWA 1VQ7A 4LFCQ 4A3IG 3OTOL 2A1AA 1E1OA 1Q12A 1TWFH 4OWTB 1X55A 3PO2G 2JK8A 3KF6B 3PUZA 5JJLA 5IY0A 1YBYA 1I94Q 4YCWA 2K4KA 1EYGA 2Z6KA 2UUAQ 1NMGA 2D0PA 4J15A 1PH9A 1J5EQ 1JE5A 2JA5H 4BA1I 4IOCA 2MQHA 2NN6G 4JI8L 1K8AC 1IYJB 2JA7G 1SFOH 1IBKL 1TWAH 3PGZA 1XMOQ 3T1YL 1IBKQ 3KJOA 4BBRH 4HIOA 1PA6A 1LM0A 1M90C 1XMQL 4B3MQ 3SGIA 3HKSA 5M3FG 2HT1A 2NZHA 3CD6A 1XNQQ 3A5ZB 5K36G 2Z0SA 2KENA 3UDGA 2R6GA 4BBRG 1QUQA 3G71A 4LF9L 3PF4A 4H02A 4PZ8A 2PQAB 2NN6I 1KRSA 3J81i 4KLKA 5IWAQ 4DPGA 5IE8A 4A3DG 3ERSX 3CCEA 3WWVA 1EUJA 3JC66 4JG2A 3F8TA 2OQKA 3D0FA 4HIKA 4LF8L 3AEVA 5C4XG 5GQOA 1FL0A 4KHPQ 4GKKQ 2LXKA 4PMWA 3AFPA 1Q8KA 4GKKL 1CUKA 2VUMG 3NBHB 1VQDA 4L5QA 3HOVG 1GD7A 4LF8Q 3CP0A 5IYCH 4B3SL 2LSSA 3HOWH 5M3MH 4HJ5A 2CWAA 4A3JG 4PZ6A 1IZ6A 5GADC 5C0XG 4IO9A 1RIPA 4K0KQ 1OXTA 2GVBA 1Y1VH 5C4JH 4EX5A 2Q2TA 4IFDJ 4JI2L 4LFBQ 4OWXB 1XJVA 3S16H 2E5LL 3BJUA 2RCNA 4DUYL 5GAHC 3S15H 3GDEA 4YHHQ 1B70B 2JA8H 5LMNQ 3EBEA 4DR1L 4P75A 1VQPA 1H95A 1JJGA 2ZJRA 2HHHL 2YU9H 4LF7L 3CC4A 3W1BA 1SROA 2PI2E 4UP7A 4OXPA 5IP9H 1KXLA 2UXBQ 1E3PA 2MO0A 3IRBA 3GTOH 1LTLA 3I4NG 1WCMH 3K7AH 2WB1G 3H3VH 1VQGA 4C3JH 4ME3A 1PFSA 3EN2A 1BKBA 3KJPA 1I5FA 4X66L 1DGSA 1TWCH 1WFQA 2NZOA 3CMEA 4DV2Q 4A3MH 4A3KG 5IYDG 5IP7G 2JA5G 1R9TH 4LFCL 3U4VA 3UDFA 4DV4L 4JC0A 2NVQH 2R93H 1WI5A 4O0AA 1A8VA 1EOVA 2RHSB 5C44H 3GTKH 1Q46A 4JI0L 4LF4L 1M1KC 2LXJA 3KLWA 5IYDH 4YY3L 4X6AH 1RL2A 1E24A 4OONA 5M5XH 2DGYA 4RMFA 4X64Q 1HR0Q 4UP8A 1E22A 2ZTDA 1VQ4A 3JAMi 1Y1WH 5GAEC 4DKAC 1HNZQ 3K81C 3S24A 3KF8B 5HGQA 1QVGA 4GNXC 1VQ8A 2Z6KC 4DR7Q 2K5HA 2B29A 4NXNL 4QJFA 1EQRA 1GM5A 1OXUA 1YITA 2Q2HA 4NXNQ 3LGJA 2K5NA 1JB7A 3TS2A 4NPSA 1PV4A 2HHHQ 3PO3H 1VQFA 4JYAQ 3PIOA 2GN5A 1YVCA 2V1CC 1NTGA 4HJ8A 1HNZL 1WJJA 1EIYB 2UU9L 2K50A 4P71A 1VQHA 1X54A 1P8LA 3E9IA 2E8GA 2CQOA 1WYDA 3T1HQ 3HOVH 3GD7A 1PH2A 2ZTCA 3G4SA 3PSIA 4NB3A 4A3FG 4QQBX 4K0KL 1Q7YC 1QZGA 2OTLA 2QEXA 3HOYG 2KCMA 1E1TA 3CC2A 4R1JA 5DLQE 5M5WH 5FLMG 4ALPA 3KOJA 3FHWA 1HR0W 1G291 2MFIA 5AJ3L 4AIMA 4POGA 4HIMA 1YZ6A 3J80c 4A76A 4DR6L 4DV3Q 4JI3Q 5IYBH 1UE6A 4R4TA 3NEMA 3J81c 1AE2A 2VW9A 2WP8J 4DUZQ 3OW2A 2N49A 3ULPA 1JMCA 2JA7H 3L7ZC 4OO1G 4DV2L 2YV5A 2E2JH 3PUXA 4DV7Q 1HZCA 1VQ6A 5GROA 4DNIA 1A63A 3CCQA 1K9MC 2R7DA 1HZBA 1PH4A 1VQIA 3K0XA 4JOIA 4UP9A 4B3TQ 4UY8C 1NBWA 3CCSA 3U58A 1KD1C 1K3RA 1N32Q 1N33L 4LF7Q 1YIJA 3CAMA 1XMQQ 1NE3A 2KHJA 4B3ML 4LNQA 2VUMH 3GTMH 3KYHC 2VS1A 4YHHL 4LF5L 3A0JA 1NY4A 3I4MH 3RNUA 4AYBE 1K83H 3MXNB 3OYYA 4XTCS 3J80i 4JI2Q 1XNRL 3HOWG 4R4IA 1N34Q 1Q86C 1UWVA 3F2DA 3FKIG 2JA6H 4A3DH 2ES2A 1IBLL 1VQKA 1V9PA 1U0LA 3BZKA 2YYZA 3ER0A 3S1MH 4DV0L 2YTVA 1LUZA 1UE1A 4POFA 4B3SQ 4MNOA 4A3GH 4WJ3M 4JI5Q 1C9OA 2F4VQ 1HH2P 3M9BA 3PCOB 4PZ7A 4IPHA 4C3HH 3CW2C 4A3EH 1B8AA 1Y1WG 4JI7Q 4IPGA 2R92H 4QGUA 3A5UA 4A75A 2JJQA 1MKHA 1HNWQ 2BH2A 1QUQB 2Q2UA 4HJ9A 3M4PA 5LMUQ 5AJ3Q 2YTXA 1L1OA 2XGTA 4DR2L 4BY1H 4LF6L 3CF5A 2IX1A 5M3FH 3K8AA 1N36Q 1JJCB 2HQLA 4LF4Q 1I50H 1N36L 4JI1Q 4HJAA 3RR5A 4TQUS 4A3BG 2BA0A 1CKNA 1XNQL 1WCMG 3PUYA 4X65Q 2UUBL 1YI2A 3UDXA 1N8RC 1E7ZA 3UDIA 4APVA 1YHQA 1K8GA 3CCLA 3S17H 2UU9Q 2QGQA 2EQSA 2VZAA 4DR3L 1SLJA 1OXVA 3I4OA 2EIFA 4GN4B 5H1SE 1X9NA 3F1ZA 2FXQA 1IBML 4GKJL 4LUZA 3PV0A 2NVYH 4JBWA 1J5EL 1ASZA 1VCIA 4JI6Q 4NXML 2NVTH 2VQFQ 4NXMQ 2UUAL 2AMCB 1MIUA 2RF4A 4GLVB 3HOUH 3H15A 2UXCL 4GKJQ 3CCRA 1YJ9A 4L5TA 1XNRQ 3E0EA 4GLAC 5LMNL 1W2BA 2JQOA 3HOZH 3CPWA 3OTOQ 3L2PA 4DUYQ 3I2ZA 2ID0A 1Q81C 2DUDA 4DR5Q 5IYCG 4X62Q 1KC8C 1S3OA 1X3GA 2UXDL 1HZ9A 4QY7A 2JEAI 3PUVA 1FGUA 4A3BH 4P73A 1SE8A 1X6OA 3BZCA 1LYLA 1C0AA 3RLFA 2WB1E 4L5SA 3S14H 2AKWB 2CKZB 4IPCA 4YCVA 5C4XH 4IJHA 1TXYA 4XIGS 4DV7L 4A3MG 5LMUL 3W1GA 3PO3G 4A3LG 2L15A 2VQEQ 2ATWA 4OWWB 4DV6L 4Y52H 4R4CA 1BBWA 1SRUA 4KHPL 3E9HA 3HOXG 4JI7L 1K0RA 2IHFA 4DR6Q 1W3SA 4BY7G 3TS0A 4BBSH 1OTCA 1FJGQ 4GNXA 2WAQE 4Y7NH 2UUCL 4OX9L 1CKOA
chains in the Genus database with same CATH superfamily
3UE1A 4C1NI 1D2BA 3GP7A 2Z8LA 4CKEA 3SK4A 5C5MA 3KDFB 3H3VC 3K5LA 1JT8A 5FLMH 2K5QA 3I55A 2EYLA 3S1NH 4HJ7A 3A7AB 3D4DA 1XMOL 4A93B 1GUSA 3TP8A 5ELFA 4LUVA 4LFAQ 1H9RA 3CCJA 1B3QA 3NQTA 4R8NA 2UXCQ 1K0SA 1YHAA 2K28A 1YJWA 3DM3A 3NENA 1EFID 2K52A 1MSHA 2BE5C 1ASYA 3VA5A 2B2WC 3ERQA 3WOFA 1SFOB 2M00A 3TRZA 2L9HA 1JWMD 4L5RC 1A3VA 1B9NA 1N32L 2Z4HA 3CMAA 4LJZC 1VF5C 3PIPA 2ZJQA 3HGBA 1HCZA 1Q82C 2MUYA 2M9VA 5EBDA 3OHXC 4GLXA 2LS01 4HN7A 3VR2A 4DV4Q 3A74A 2Z4IA 4JV5Q 2RDFA 1OXSC 1FNWA 2B2UC 4XXEA 2Q8RE 1Q3LA 4LWCA 4YWLA 5IP9G 1PH3A 5EKIA 1UE5A 1IXRA 1V1PB 4GZYC 5DM73 1DOMA 2F0VA 3A7LA 3M4QA 2EY6A 1CFMA 2WAQG 2ICEC 3P1HA 4QF4A 3HOZG 4FXKC 2CFMA 4HR7B 2CW0C 1LT4D 1MJEA 3U9OA 2Y0SG 3I73A 1EL0A 1BQQT 1SEBD 5C0XI 3GTLH 5ELEA 4DV5Q 1NNXA 3CQZB 3MEHA 4DUZL 1G2TA 1HNWL 1LTBD 3TZDA 3RN5A 1G6ZA 3HFZB 1LV9A 2IX0A 3I90A 4ILWA 4E6IA 2FINB 3CCVA 1CKNB 4JK1C 4AQYQ 1VS0A 5C4JB 3PO2H 2PI2A 2F0MA 2VNUD 2ZM6Q 4KHZA 2Q2IA 1FD7D 4LF5Q 1L2FA 5FJ8H 4MTNA 1NMFA 5BR8Q 5EAYA 1RJTA 1EWHA 1IW7C 1XTCD 2BA1A 2CH4W 5IT9L 1D1KA 4PG3A 3DXJC 2JXMB 2B63B 1U4RA 4R4OA 1SMXA 2PYKA 4UHVA 4NDXA 3MXPA 3W2DA 5CMDA 3GTLB 2ICIA 4XT3B 4P74A 4G7OC 3K7UC 1JC7A 4OIJA 2EYHA 1T5XD 3KLSA 1KABA 1XPRA 1M4VA 1Q90A 3VYUA 5IYBG 2Y0SE 3R8BA 5JVG3 4C3IB 4TVAB 3ICEA 2A6EC 1I3QB 1TS2A 1AE3A 3J81j 4K6DA 2SEBD 3RLOA 3SHLA 3DEPA 4EGVA 5GAGC 2X6GA 3FPPA 5E7NA 4IUTA 3IKJA 1FYCA 2F0SA 3RN2A 2R7ZH 2SNSA 1N9WA 1PYSB 4JBMA 2JA9A 1KLGD 1EY9A 1FR3A 3S1QH 2AWNA 2ZJPA 4G57A 4U673 2WINB 4WJ4A 1WD1A 2A6ED 4JI4Q 1AP0A 4KK7A 4A3EG 1O7IA 2FFKB 1EZ6A 2D62A 2RHQB 3I72A 2WACA 4BS9A 1TU2B 1UEBA 1EU4A 3GTJB 2DNEA 2GA4B 2B2VA 2ZTEA 3VA7A 1GOZA 3S1RH 2R61A 1VQBA 3J81L 1G51A 1S5DD 2HCIA 1TWHH 4PV1C 1G6PA 3M3YB 4X62L 1D5XC 4C2MH 2QKIC 4FF4A 2A1AA 4TRDA 2JK8A 4RGNA 1LLRD 4YCWA 4RCNA 4J15A 1J5EQ 2K32A 5FOBB 2B2WA 4KMUC 4IOCA 5EGTA 1K8AC 4R9WA 2K05A 3R2TA 1XMOQ 1IBKQ 1LM0A 1NUCA 2WB1B 1XMQL 1BUVT 1LTRD 2L0CA 3KBXA 4XDXA 1DM0B 3A5ZB 4C2MB 5J22A 5K36G 3SDZA 3UDGA 2R6GA 4BBRG 4HSVA 3PF4A 4H02A 2NN6I 3PO3B 2E74C 5E1FA 4A3DG 1UUPA 3AEVA 1EUJA 5FO7B 2OQKA 4C3IG 5GQOA 5DAUA 4ME5A 4DAPA 1PLFA 3Q22A 5KNCA 3R93A 4G4KA 1UAPA 3NBHB 4L5QA 4KJOA 3HOVG 1GD7A 4ABNA 1MBYA 2B2YA 2B2UA 5IYCH 1BF4A 1MSGA 2C5CA 4HJ5A 4K0KQ 2GVBA 3NQIA 5C4JH 2Z6BA 2XN9C 3QB3A 1K8MA 5FLXL 4LFBQ 2A68C 2FMMA 3BJUA 3GDEA 4YHHQ 1B70B 3C1FA 3G7LA 4P75A 2F0WA 1TWGB 3HOYB 1BBXC 2YU9H 3MAQA 4QCLA 1XYIA 1E2ZA 1PFMA 5IOCA 1BO0A 1E3PA 4DXFA 4ZKCB 3I4NG 1KAAA 3K7AH 3H3VH 1VQGA 1PFSA 1YNJD 2E2DC 4MN3A 1I5FA 3CMEA 4A3KG 1TWCH 3PO3H 4A3LH 1G91A 2H1EA 3U4VA 4RHRA 2PQEA 4PMBA 4RKLA 3I8ZA 3GTKH 2M2LA 1IL8A 2LXJA 5IYDH 5CGKA 1TT2A 1RL2A 3KF8A 3NTKA 2LFNA 2F0GA 3EA6A 5M5XB 1I4HA 2ZTDA 5JPNC 4DKAC 2AQ3B 3AB9A 2V4DA 3S14B 4L63B 4DR7Q 1LT6D 1VMCA 4NXNL 1W6KA 3NE5B 2JA7B 2Z9HA 2K5NA 3TS2A 3U9SA 1STEA 4NPSA 2R92B 1VQFA 3ND9A 3PIOA 1YVCA 1WVLA 2QCPX 1QCBD 4Y7NB 4HJ8A 1HNZL 2UU9L 2K50A 3TSSA 2CQOA 3T1HQ 3HOVH 1PH2A 2ZTCA 2K01A 3G4SA 3D4RA 4N8FA 4A3FG 2NVXB 2KECA 2WIIB 1Q7YC 1WTWA 1QZGA 2QEXA 3SE0A 3MZ5A 1E1TA 4ALPA 5FLMG 2JA8B 3KOJA 1F9SA 3FHWA 4M8AA 1HR0W 2J7ZA 2MFIA 5AJ3L 3RD4A 1YZ6A 4HIMA 1AZPA 1N32Q 1CQFA 3BDCA 1KDCA 2VW9A 1GHJA 2RDGA 3FEWX 3PUXA 2G9HD 4DNIA 3CCQA 4A3GB 4KKTA 1MI2A 3H94A 1PH4A 3HOVB 1SYGA 1KD1C 4N8X1 2F03A 1TS3A 1YIJA 2KEEA 3GTPB 4DXGA 1Q8IA 2KHJA 5CC4A 3GTMH 3Q23A 5M5WB 3I4MH 1NY4A 4BBSB 3RNUA 3BG3A 4XTCS 1RTNA 3JAME 1ZYRC 1STAA 4JI2Q 1N34Q 1Q86C 3F2DA 4A3DH 2EJFC 2ES2A 3BDOA 3ER0A 1I6VC 3NBIA 1LUZA 4A3GH 4C1NK 1TWAB 5C5LA 1Y1WG 4C3HH 1PZKD 4IPHA 4A3EH 5EPLA 4A75A 5ELBA 1MKHA 5K36H 1L1OA 4BY1H 3CF5A 1RHPA 3K8AA 3TMEA 1JJCB 1O78A 1B1ZA 1A2UA 4HJAA 3RR5A 3NP8A 2QDBA 4RGMA 4I7AA 4JPBW 5KIXA 2JA6B 1YI2A 1N8RC 2KOLA 1CK1A 1YHQA 1TWHB 3UDIA 3TP6A 3CCLA 3BVZA 4C3HG 2QGQA 1WD0A 1JE4A 1OXVA 4FF2A 1HFGA 4GN4B 1F9RA 4GKJL 1GUOA 3NTIA 4F8MA 4JBWA 1PTOB 1EYCA 1ESFA 4NXMQ 2AMCB 1MIUA 4GLVB 3HOUH 3H15A 1YJ9A 2FJ2A 3NBHA 5LMNL 4HCSA 1S5ED 5CV6A 3OTOQ 1ZKOA 4DUYQ 1HXYD 2F0OA 2DUDA 1JR0D 1S3OA 1HZ9A 4BY7B 2A6HC 3W3AA 5T1IA 3KBGA 1SE8A 5M3MB 1ESRA 1L0YB 5KYIA 3S14H 2AKWB 1YNND 2CKZB 4IPCA 3C46A 3LX0A 5C4XH 1TXYA 1NSNS 4A3BB 1S5CD 2K7VA 1SNCA 4DV6L 4Y52H 1SRUA 1RDPD 3E3XA 3E9HA 3HOXG 2MJ8A 4CJ0B 2WAQE 4Y7NH 1CKOA 3T13A 1SMYC 5FJ8G 3KUPA 3HOUB 5F2DA 3B6YA 1X32A 2IT1A 3SEBA 4A3KB 1U9RA 3BDLA 1H9SB 1YNNC 2N3SA 2VXWA 1ZXTA 1Z9FA 4KY5A 2AWOA 4LK1C 1PH1A 1VQLA 2E2HH 4DR1Q 5FK9C 2J0TD 2KEDA 1B44D 4OIKA 1X3EA 3S2DH 4N9TA 3SK5A 2IW3A 4AYBB 2MGSA 3OSOA 3GTGH 2HCCA 1IBMQ 2VB2X 1YHBA 1K73C 1RCVD 2TMPA 3FVQA 5EPKA 4JI3L 4DV6Q 1PH5A 1CHPD 1WTVA 4KD3A 3M4OB 3J7A5 3GTKB 1YNXA 5C44G 4DR2Q 3TEHB 2F0EA 2NN6H 3K80C 1P16A 5LMNW 1HRJA 3T1YQ 2CCZA 4B3RL 1HHVA 3FKIB 2F4VL 3D31A 5CV5A 4KHVA 5I9OA 2J4XA 2B8GA 2BH8A 2A73B 4RGOS 1A62A 3L9AX 5C6AA 3VYTA 2F0NA 4GOPA 2KJXA 2PMZE 5IT9c 3HKZG 1DOLA 1LACA 1VQCA 4K5VA 5BN5A 3PQIA 3H0GH 4DR4L 1CSQA 1BCPB 1KIXA 2QW7A 3S1QB 1PRTC 3D4WA 5I2XA 3QWNA 1RD9D 4NMZA 4ZLTF 1C48A 3TQYA 1SBBB 4FF3A 4LW1A 1STNA 4C3IH 5IP7H 4FDBA 1XPUA 4A93G 1EY6A 4BY1G 1I4XA 2OCEA 1UEAB 4O2DA 3TDQA 5JPMC 3DWAA 4FXDA 2PCFB 4KD4A 2VY3A 3CRKC 4A3CH 2K5VA 1D8LA 2I5HA 5JJZA 1DOKA 2SOBA 5I6YA 4BY7H 5EBCA 1KRTA 2AHOB 1VMPA 4V0BA 5EQ0A 4C3HB 1ET6A 1WTHA 4A3JH 1V1QA 4OX9Q 4RFBA 4A93H 4JBJA 2XTIA 3CXCA 5E4XA 3RLNA 3K57A 3KFUA 3NHHA 1HR0L 1X65A 4X3UA 4YY3Q 3DLLA 1EWCA 3MEFA 1SDFA 1ENFA 3W5OA 4IUUA 4JI0Q 4A3CG 4EVOA 4IFDG 3T1HL 1HZAA 1SN8A 2HIXA 3NSWA 3ULLA 5C0XJ 1PRTF 1VQNA 2ZXOA 2E2JB 3AQQA 4A3FH 3M7GA 2JE6I 1MJCA 2VQFL 3SK8A 3G6EA 1F2ZA 3U50C 2VB3X 4DR7L 1F9PA 5ELOA 2HIVA 3IFTA 2XRSD 2NVXH 2A74C 3CD6A 2K75A 1I3QH 1II3A 3MXUA 3K5NA 4RAUC 4JI1L 1SYEA 3F2CA 2C35B 4IFDI 1A2TA 2QA4A 4BWGB 2F0JA 2K03A 1SSOA 4RG1A 3BVGA 4RCOA 1Z6HA 3CC7A 4A3IG 3OTOL 1TWFH 4M1UB 1X55A 1BCPF 5JJLA 4K5WA 5IY0A 2CHBD 5KNDA 1WTPA 2K4KA 3IL8A 1NMGA 1CI3M 2A5HA 4BA1I 2K6AA 2NN6G 4JI8L 3RZOB 2A69D 3J7AV 2JA7G 4ZK9B 1L0XB 4BBRH 4B3MQ 3HKSA 3HOXB 2HT1A 2NZHA 3IAYA 2Z0SA 2CVRA 4LF9L 1QUQA 3PMFA 4XT1B 5C3EB 4EQOA 2EXZA 4PZ8A 1ENCA 1GUNA 3J81i 5IWAQ 4JW0A 4DPGA 4TSSA 3CCEA 3JC66 2NZ1D 3F8TA 3MC0B 5E4WC 3BYYB 4EQPA 1SXTA 1I4QA 3RZDB 1TQOA 3HZXA 4DAYA 5IGFA 4DAVA 2VUMG 4IZ8A 1VQDA 3CP0A 2PZWA 4ZCKA 3V96A 3NTHA 5C0XH 4DFAA 3VR6A 1Y1VH 3D8GA 1QILA 5FO8B 5EJWA 4JI2L 4OWXB 2PNRC 2WV6D 2RCNA 5GAHC 3S15H 1GXDC 2JA8H 4OEMB 1EZ8A 1JJGA 2HHHL 3CHBD 1EU3A 4UP7A 2F1MA 5IP9H 1TS5A 4HSPA 3GTOH 1K8OA 1LTAD 1PTOD 2WB1G 2IJ0A 4C3JH 1Y8PB 4OHJA 3EN2A 1BKBA 3GTMB 4X66L 1DGSA 1STBA 4DV4L 2HQEA 4O0AA 3K59A 4FYDA 1A8VA 2XSCA 4LMQD 1Z7TA 3SK6A 4JI0L 2Z1CA 2E76C 4YY3L 3F2UA 4IUQA 2FMCA 2F0LA 5ELCA 2DGYA 3HEJA 4RMFA 4X64Q 1HR0Q 1AEXA 1E22A 1VQ4A 2F3WA 3JAMi 1AN8A 1Y1WH 1HNZQ 4A3FB 3S24A 1QVGA 2IPKD 4GNXC 1VQ8A 3RUZA 1WTXA 2Z6KC 5A2QL 2B29A 4CGYB 2EY1A 1TY0A 2G5DA 4QJFA 1GM5A 1OXUA 3K0YA 4NXNQ 3LGJA 1JB7A 1PV4A 2HHHQ 4A3EB 2V1CC 3P20A 3TZUA 1BCPD 1NTGA 1STGA 2XRQD 4DA2A 2XVSA 3E9IA 1X54A 2E8GA 4DNTB 3EVQA 2RQXA 2NWGA 4QQBX 1HUMA 3J81E 1NCVA 2L4NA 5DLQE 2OEOA 1WTOA 3DHQA 3TP7A 3J80c 2RSNA 4R4TA 3NEMA 2WP8J 2JA7H 2N49A 4G7ZC 2KHSA 3DMUA 1PYWD 2YV5A 3OWEB 1VQ6A 1A63A 3A56A 1F2LA 3QIAA 4UY8C 3K0XA 3CCSA 3U58A 1YNJC 4O1NA 3HKZB 4B3ML 1NE3A 4KTAA 3O13A 3KYHC 4LF5L 4YHHL 4WJWA 2NTSA 4XYOA 3A0JA 4AYBE 1K83H 3J80i 5E3FA 4A3IB 1XNRL 3HOWG 4CJ2C 3S1MB 2C9OA 1IW7D 3R3OA 2EY5A 4KN4C 2LMCB 1LT3D 2O5IC 1U0LA 2YYZA 4K5XA 2YTVA 3NWTA 1UE1A 1MHWC 1V1OA 2CQAA 3FDTA 4ZQ3A 2F4VQ 3OW7A 1S5BD 2X6LA 1HH2P 2I07B 3PO2G 3CW2C 4JI7Q 2PZTA 5DM63 2Q2UA 2WAQB 1EQTA 2XGTA 4DR2L 2IX1A 5M3FH 1N36Q 4LF4Q 5NUCA 4JI1Q 2DN8A 4L8JA 3PO2B 2L1BA 1WCMG 3UDXA 1EQVA 1E7ZA 1K8GA 3S17H 1TY2A 1JOOA 2PPBC 2EQSA 2VZAA 1EY0A 2OXPA 1XXGA 3F1ZA 2FXQA 1IBML 2E2HB 1J5EL 1ASZA 5IIFA 2VQFQ 1V8QA 2RF4A 4OELB 4NKLA 5I6WA 4L5TA 1PTOC 2EVBA 1ML0D 4GLAC 3HOZH 1FGBD 2BOSA 2ID0A 3MXGA 3N6RA 4X62Q 4MIUA 1TVXA 2RKSA 3H91A 3T51B 3PUVA 1HTLD 1X6OA 1JB3A 3BZCA 4DK1A 1LYLA 3RLFA 2WB1E 1KDBA 1WTRA 3PO3G 2SDFA 4A3LG 3HRZC 5LMUL 2L15A 4OWWB 2Y0SB 1PTOH 5COYA 3K58A 2DNCA 3VR3A 4KHPL 3SVMA 4DR6Q 1DYQA 4BY7G 3GQBA 1SYCA 3C3LA 4OX9L 4KV6A 1B53A 1R4PB 2R3ZA 5EPJA 1B50A 3GTPH 5D3DA 1CT1D 5ELDA 3GTQH 2XWBB 2HUGA 2F52A 4A3GG 1R4QB 4IFDH 5JJKA 1VQ5A 1TWGH 1CQVA 2JSOA 3J7ZC 1XPOA 1DJRD 3HOYH 1STYA 1PVOA 1BCPC 3S1RB 3LWUA 3F2BA 3S15B 3TREA 1KL9A 1DONA 4KI0A 3Q8DA 1U4PA 1U4LA 3FP9A 4QUFA 1XWEA 4DF7A 1FNUA 2D2CC 5CBEE 5KYLA 3S2HB 1NR2A 3KK7A 1Y14B 4DV3L 3I91A 1BVSA 1SYDA 5BN4A 3X3NA 5IWAL 3TN2A 1H9KA 1HQMC 4F7XA 3G48A 3TP5A 5G3LF 1O7LA 1PXUA 3D6CA 1I4RA 2KCCA 2B2TA 1OXXK 4DR4Q 2A68D 3ONAB 2O5JC 3STBC 1ONLA 1EQQA 1K3BC 2XIWA 2ASBA 4N9PA 4GOPB 2IY5B 5IGDA 3S16B 3IFDA 1JQYD 4AQYL 3HKZE 1N34L 4DAMA 2WKDA 1HJPA 5K5PA 2NUCA 3DUZA 4IUPA 4ZAIA 4B3RQ 4GNXB 2EYJA 3H0GG 4A3JB 1F77A 3STBD 1BXTA 4IJLA 4FF1A 1TR5A 1EEFD 3R2IA 1X56A 3EQLC 3FKIH 4G7HC 3I4LA 3CCUA 5DEHA 2B63G 1KHIA 4JCVE 3S1NB 1NR4A 2DY7A 2O4XA 2H5XA 4QIWE 5M3MG 2MP1A 1RODA 1KAWA 1CM9A 1VQJA 2B2YC 1LTTD 1O80A 3SR1A 5LHY1 4J6HA 4OGQC 3CQZH 1CA5A 2LY7A 2IWHA 2K14A 4JV5L 3J7YW 3PIO3 1C7YA 4BA2I 1N33Q 2B3GA 1SE3A 3ULJA 1F9QA 4HIDA 4DN4M 2KBNA 1XTDA 1KNAA 4NW2A 2DJGC 2P5ZX 2K5DA 3RMHA 2JA6G 3GTOB 4A4IA 2ALYB 5BN3A 5JEAJ 4QMGA 3PF5A 4DAYB 4FVMA 4MZ9A 4YWMA 2ZT9C 1H9MA 4WRDA 1L1OB 4QB4A 3H09A 2KQ3A 2OQ0A 5CV7A 1SJHD 3RZOH 2A8VA 1HTPA 1TS4A 4RWSC 1J9OA 4LUOA 1PZJD 3M85A 1Q1EA 3S2HH 5FLXE 1C4QA 1B4OA 4GN5A 3CCMA 4ID6A 1HA5A 3HOXH 1A6XA 1VQAA 5ELNA 2D9UA 4BBRB 4UPAA 2MO1A 2ZXRA 1A0IA 3L0OA 2KCTA 3RZDH 4BBSG 4XQJA 4XQQA 1S40A 4RKBA 1VQMA 4JOIC 5CYUA 2BCOA 1I6HH 3H0GB 1PH8A 2JEBI 4IQZA 5HURA 5KGUA 3I70A 1VQEA 2DJFC 2PW7A 1Z47A 5EKLA 3GTJH 1AFPA 1B7YB 3QG1A 4FP5D 4CHTB 4LFBL 2NVQB 1YJNA 3H6MA 4IALA 2RVLA 1GJXA 4GS3A 3L3OC 1CA6A 1KDAA 3LWEA 2F4IA 4P72A 1SR3A 5L37A 4EQ5A 2HDMA 2K33A 5KNBA 2B8FA 1EIFA 2UXDQ 3C2PA 2KHIA 2JA8G 3I7FA 2PNHA 1A3TA 2YTYA 1EFWA 1VQ7A 1I4GA 2ENBA 4H44C 1E1OA 1Q12A 4OWTB 3KF6B 1D5ZC 5I4DA 1YBYA 1I94Q 2NYZD 5JEAH 2UUAQ 5AFWA 5C3WA 2D0PA 3BYTB 1JE5A 4K6LA 1SFOH 1IBKL 1TWAH 3PGZA 1H9JA 3T1YL 3KJOA 3DEOA 1M90C 1D5MC 1SE4A 1B3AA 2BE5D 1ENAA 4A3MB 4CJ1B 4MTKA 4J1MA 1WCMB 3WWVA 3Q0AA 4JG2A 4LF8L 1SNQA 4K2KA 1FL0A 4KHPQ 3SXHA 2LXKA 3A8KE 4GKKQ 4PMWA 3AFPA 2FHTA 1E2WA 1QG7A 3D6WA 3KLRA 3HG9A 5M3MH 2CWAA 5CV4A 1IZ6A 5C0XG 1RF2D 2Q2TA 1ILQA 4FO2A 4IFDJ 3S16H 5C4XB 1CZGA 4CBVA 1EYAA 3EBEA 4DR1L 1VQPA 3CC4A 2PZUA 1SROA 2SNMA 1LTLA 1WCMH 3S9WA 1OO9B 4ME3A 4HTHA 4A3MH 2JA5G 2F0HA 3N52A 5IYDG 1R9TH 4LFCL 3UDFA 4JC0A 4HEDA 2EOTA 2IX3A 2R93H 2RHSB 5C44H 4IUNA 1Q46A 2F0IA 1UNSA 4LF4L 1M1KC 3KLWA 1EYDA 4OONA 5M5XH 1SNPA 3E0JA 4UP8A 5GAEC 2TSSA 2IL8A 1KNEA 3HOWB 4RA8A 3GTGB 2K5HA 4B9XA 1EQRA 4JYAQ 2AUJD 1WJJA 4IN3A 4IURA 1EIYB 4P71A 4PNYA 1VQHA 1P8LA 4Q5VA 1WYDA 4K2LA 5IODA 3K6OA 4NB3A 1PRTD 2EPBA 1SYFA 3PSIA 5I2YA 4K0KL 3E5SA 3HOYG 2OTLA 2KCMA 3CC2A 1MD2D 3OIPA 4R1JA 4H13C 3T4AC 1TIID 4POGA 1LTSD 5TSSA 4DV3Q 1HNWQ 1I4PA 4DUZQ 3ULPA 4OO1G 3L7ZC 4DV2L 1ZEQX 1F2YA 4DV7Q 3J7AF 3GV3A 3HOZB 1K9MC 2R7DA 1MGSA 4ZUJA 1HZBA 4B3TQ 1NBWA 4TKOB 1JORA 1K3RA 4LF7Q 4R8IA 5LL6S 1XMQQ 5KRUA 1T5EA 1SYBA 4K14A 4PMCA 4LNQA 2VS1A 3OYYA 1IYUA 4R4IA 3OPOA 4HCEA 4KKSA 2AQ2B 2QF7A 1IBLL 4UDUC 1V9PA 4OL7A 1DD2A 1JOQA 3MXNA 4POFA 5CBAE 5J39A 2X69A 4B3SQ 4MNOA 4JI5Q 1C9OA 2HD3A 4MHEA 2XNAC 4EQNA 1WTQA 4IPGA 4QGUA 4KN7C 3MVVA 2JJQA 3EFXD 3S2DB 5FO9B 2BH2A 1QUQB 2OF1A 5AJ3Q 2YTXA 5LMUQ 4IUVA 2F3VA 3LNNA 5A35A 3HS0C 4BY1B 3KLSX 1I50H 1J8IA 4TQUS 1ICFB 4DU9A 2BA0A 1CKNA 1XNQL 4ZYSA 1D6EC 2UU9Q 4FNFA 4DR3L 4KKUA 1O7YA 4H0LC 2EIFA 5H1SE 1HQRD 1X9NA 5CV8A 4H7BA 4LUZA 3CRLC 2O2LD 2NVYH 2NVTH 4B9WA 2R93B 5CV9A 2UXCL 3CCRA 4O42A 1VDZA 4K8IA 2JQOA 1X3PA 2L5TA 3DWPA 1Q81C 4DR5Q 2PO4A 1PRTB 1KC8C 4KY7A 4X3KA 4CDCC 2AUKA 4QY7A 2JEAI 4A3BH 2K5WA 4P73A 3A54A 5IGCA 1C0AA 4XQNA 3EJIA 4FXGC 1A15A 4YCVA 4DGZA 4IJHA 4XIGS 4DV7L 2CH4A 4KY6A 5T1GA 1GHKA 4QIWB 2EJMA 3QOJA 1BBWA 4JI7L 1K0RA 1W3SA 4BBSH 1JWSD 1OTCA 2JN4A 2PW5A 4GNXA 2UUCL 1TWCB 1X3QA 2F0UA 1JWUD 2AQ1B 2KUMA 1V43A 3WOEA 2ZXPA 1J6QA 1HPCA 1E2VA 2L11A 2NVYB 5BR8L 1GUTA 1XX8A 1Y1VG 2A69C 1G2SA 1PZID 2EDGA 1QVFA 4S3SA 3JAML 4AH6A 1HNXL 3AFQA 4JYAL 3EROA 4JI8Q 1QJOA 3OMGA 3V05A 1EY4A 3I56A 5M5YH 4JI6L 2N78A 1UE7A 1Y8NB 1D7QA 2UUCQ 3GO5A 5D3IB 4YWKA 2RSOA 3NELA 3NUCA 1NJIC 4DV5L 5IGEA 2EXDA 2F3IA 2IHEA 1AZQA 1LO5D 1S4ZA 3QR8A 3NK9A 2R7ZB 4YCUA 4CKBA 1PYBA 2A19A 2QEJC 3ND8A 2WFWA 3A55A 1BR9A 2B2TC 2VL6A 2R93G 3UI2A 1B2TA 2LKVA 1CKMA 1Q1BA 1CSPA 5D65A 1Y8OB 4RH6A 2CWPA 5IT9E 3M4OH 2NB0A 2I46A 5FKAC 3I4NH 4DV0Q 5C3EH 1JICA 1EY7A 3VR4A 5FLXc 5IGGA 4GOPC 5JEAG 4DK6C 1GKHA 1DXMA 1QVCA 1IKLA 3URYA 1CTMA 1EY5A 4DV1Q 1PFNA 3HOUG 4DR3Q 2F0TA 4ZKBB 5JJIA 2EYFA 2R7FA 4X64L 1QZHA 1L1OC 4C56C 1U5KA 1M8AA 1EIHA 3I4MG 2N8NA 1IYVA 1PH6A 3VDYA 4J8QA 4IPDA 3PUWA 2WKCA 3ZJYC 1EWIA 1HFNA 4JVZA 1BBUA 4A3DB 3UE0A 4BXXH 1ET9A 1VQ9A 1GUGA 3CPFA 2GVAA 1KLUD 5HY6A 3QO2A 4DV1L 3I4MB 4X66Q 4JI4L 3AMUA 4OO1I 4JI5L 4DNRB 2MPMA 4IOAA 1LTID 3P7JA 1IBLQ 3M7NA 4F88A 1DZ1A 4R4QA 1L0WA 1HUNA 3KDFA 4LFAL 4C3JG 5J3BA 1T9HA 3H3VI 1U4MA 3BZDB 4NP5A 4DK3C 1PMRA 1SE2A 1TWFB 1I6HB 4WORA 1KQSA 2E2IH 2RA4A 2PQAA 3G6JB 2D0OA 4B3TL 1I94L 2OTJA 3EIVA 1PHJA 1IKMA 1FJGL 1IL2A 2F0DA 2KVMA 5C44B 2I5MX 3AYHB 4U68A 4BXXG 1S5FD 3VR5A 2VQEL 1E0BA 4ULLA 1V1PA 4I65A 2KA7A 2VUMB 2B2VC 4HMIA 1O7ZA 3MHBA 1YEZA 2H4OA 4LF9Q 4GN3B 2MNAA 1AH9A 1SNOA 1HNXQ 2F0FA 1LT5D 5C3EG 1I50B 4ZRZA 4AYBG 1PDQA 2ZM6L 1F2MA 2I0QA 1QE6A 2OWOA 5M5YB 3M3YH 1KTKA 5JVH3 4X3TA 2UXBL 2JYOA 4DK0A 1Y1VB 1SNMA 4YIJA 3I3CA 2XWJB 3P75A 4QL5A 4WFN3 1S72A 2R7ZG 5JOBA 5HGTA 3BU2A 2L55A 1GVPA 2R92G 2E5LQ 1GO3E 4XYQA 1QNKA 4A3KH 4X65L 1BDOA 2UUBQ 2A6HD 3U4ZA 1FNVA 1ICWA 1WOCA 2B63H 2I5LX 1JJ2A 4JBKA 2HDLA 2BDNA 1K83B 4K8JA 4A3IH 1DCZA 1PH7A 3JAMc 1X3FA 4LF6Q 2EYPA 3KF6A 3OOCA 3MFGA 1D1IA 3J80E 2F0QA 1VQOA 1BNZA 4DR5L 1FVIA 3T16A 4LFCQ 2EE1A 2RBMA 3PUZA 1SMYD 5M3FB 3FRPB 1EYGA 2Z6KA 1PH9A 4RHSA 2JA5H 2MQHA 5DNFA 1IYJB 5IGBA 4HIOA 1PA6A 4I7ZC 3SGIA 5M3FG 2EZVA 1XNQQ 2KENA 4CDDC 3G71A 2PQAB 2K04A 4CDEC 1KRSA 1SJED 4KLKA 5IE8A 3D3RA 3ERSX 3NWSA 4Q0FA 5C4XG 1SNDA 3D0FA 2DY8A 4HIKA 3Q24A 2KCNA 1B9MA 4HAEA 2OT2A 2MHVA 1Q8KA 4GKKL 1CUKA 2NTTA 5J1ZA 1NAPA 4LF8Q 4B3SL 2LSSA 3HOWH 1EOTA 1RKNA 2F0KA 4A3JG 4PZ6A 3OMCA 4B08A 5GADC 4IO9A 1RIPA 5M9OA 2JA5B 1OXTA 1LTGD 4EX5A 3MTSA 4X3SA 1XJVA 2E5LL 4DUYL 1JCKB 3FPUB 5LMNQ 1ILPA 1H95A 2ZJRA 3CKIB 4LF7L 1PFBA 3W1BA 2PI2E 3K5OA 4OXPA 5G3LD 3T56B 1KXLA 2UXBQ 2MO0A 3IRBA 1W6JA 1HA6A 4Z9CB 3ITPA 3E6ZX 3QJYA 4UAIA 3KJPA 1WFQA 2NZOA 4DV2Q 4C3JB 5EKKA 5IP7G 3GTQB 2NVQH 1WI5A 4V190 1EOVA 1ZYRD 3T53B 3WDNA 3NXWA 3PIP3 1BOSA 1Y1WB 2E75C 4X6AH 1E24A 3MA2B 2BDOA 1H9SA 3ZYYX 1G8ZD 4PQXA 3K81C 3KF8B 5HGQA 1SAPA 2PMZB 3TBIB 3CU7A 1YITA 2Q2HA 2G9DA 1QNUA 2QILA 2GN5A 1C8CA 5C4HA 3VYRA 1QB5D 2D5DA 1QOHA 3AU7A 3GD7A 3NPPA 5KEEA 2YU9B 1K28A 1EEID 1PTOF 5M5WH 4ODGA 5CORA 3MWYW 1G291 3BVMA 4AIMA 5JAVA 5C3XA 4A76A 4DR6L 2E2IB 4JI3Q 5IYBH 1UE6A 3K5MA 1AW7A 3J81c 1AE2A 3OW2A 1JMCA 4HMJA 2E2JH 1HZCA 2EYMA 1A3UA 2RDHA 5GROA 2EY2A 2NBFA 1QWYA 1STHA 1VQIA 4JOIA 4UP9A 4L6TB 1GUWA 2EYOA 1TKWB 1EIGA 1N33L 3CAMA 2B39A 3I4NB 4P2CB 2VUMH 3A8JE 3FMCA 3BS1A 3MXNB 2JP1A 1UWVA 3J80L 3FKIG 3OIQA 2JA6H 1VQKA 3S1MH 3BZKA 4OO1H 1VF7A 3X3MA 4DV0L 1R9TB 5D14A 4WJ3M 3M9BA 4PZ7A 3PCOB 2Q8TA 3C1EA 2R92H 1B8AA 3A5UA 3V2TA 2RCFA 5LL6X 1JOKA 4HJ9A 3M4PA 4LF6L 2CW0D 3GV6A 2HQLA 3HP3A 1N36L 3OWFA 4ZUIA 5C4ZA 4A3BG 2QDLA 4F87A 3PUYA 4X65Q 2UUBL 5I9PA 4APVA 2L12A 3M4YA 5ISRA 1SLJA 3I4OA 2EJGC 3QOLA 5A2QE 3S17B 3PV0A 4NXML 4JI6Q 1VCIA 4RGTA 1EY8A 4LAAA 5CR3A 2UUAL 4GKJQ 1CHQD 1XNRQ 3E0EA 1W2BA 3CPWA 3L2PA 4KJNA 3I2ZA 2N88A 3K7AB 3Q6SA 5IYCG 3DWQA 1CZWA 3MFYA 1X3GA 2F0PA 2N55A 2UXDL 1LABA 1FGUA 1RTOA 1Y69U 4L5SA 4CKCA 4A3MG 3W1GA 2VQEQ 2ATWA 2K1BA 2NVTB 3DM1A 4R4CA 2IHFA 3TS0A 2Q8IB 4CDFC 4QUCA 3VYSA 3A8IE 1FJGQ 1IHZA
chains in the Genus database with same CATH topology
5FJ8G 3GTPH 1V43A 3UE1A 3B6YA 2IT1A 1J6QA 3GTQH 1JT8A 3KDFB 2N3SA 2F52A 1Z9FA 5BR8L 2AWOA 5FLMH 3I55A 1PH1A 1VQLA 2E2HH 4DR1Q 3S1NH 4A3GG 1Y1VG 1TWGH 3J7ZC 4HJ7A 1VQ5A 1XPOA 1XMOL 3HOYH 1QVFA 1PVOA 4LUVA 4AH6A 3F2BA 1HNXL 3AFQA 4LFAQ 1X3EA 3TREA 3S2DH 3CCJA 1KL9A 4JI8Q 4JYAL 2UXCQ 1YHAA 1YJWA 3DM3A 3NENA 2K52A 4KI0A 3I56A 5M5YH 3GTGH 3Q8DA 4JI6L 2N78A 1ASYA 1IBMQ 5JJKA 1UE7A 1D7QA 3FP9A 2UUCQ 1YHBA 1K73C 3GO5A 4YWKA 4A3LH 3TRZA 4L5RC 3NELA 1Y14B 4JI3L 3CMAA 4DV3L 1N32L 4DV6Q 1PH5A 1NJIC 4DV5L 2ZJQA 3PIPA 1BVSA 2EXDA 2F3IA 2IHEA 1Q82C 5IWAL 3J7A5 4YCUA 3G48A 1YNXA 1PYBA 5C44G 2A19A 4DR2Q 2WFWA 3TEHB 2VL6A 2R93G 4GLXA 3K80C 1CKMA 1OXXK 1P16A 1Q1BA 5LMNW 4DV4Q 4DR4Q 3A74A 3T1YQ 3STBC 2CCZA 4JV5Q 4B3RL 1EQQA 1CSPA 2F4VL 2ASBA 2CWPA 1OXSC 3D31A 4GOPB 3M4OH 2IY5B 2BH8A 3I4NH 1A62A 4DV0Q 5C3EH 5FLXc 3HKZE 4LWCA 4YWLA 4AQYL 5IP9G 1PH3A 1UE5A 4GOPC 1IXRA 4GOPA 5JEAG 1N34L 4DAMA 4DK6C 2PMZE 1GKHA 5IT9c 1HJPA 3HKZG 1QVCA 1VQCA 4DV1Q 3HOUG 4B3RQ 3M4QA 4GNXB 4DR3Q 5JJIA 2WAQG 3H0GH 3H0GG 4DR4L 1CSQA 2R7FA 4X64L 3STBD 1KIXA 3HOZG 1QZHA 4IJLA 1L1OC 1U5KA 2CFMA 3I4MG 2N8NA 1MJEA 1PH6A 3VDYA 1X56A 2Y0SG 3FKIH 4IPDA 3PUWA 3CCUA 2B63G 3ZJYC 1EWIA 1KHIA 5C0XI 3GTLH 1BBUA 4JCVE 3TQYA 4DV5Q 4LW1A 3UE0A 4DUZL 4BXXH 1HNWL 1VQ9A 2H5XA 4QIWE 4C3IH 3CPFA 5M3MG 2GVAA 5IP7H 5HY6A 4FDBA 1KAWA 4DV1L 3RN5A 4X66Q 4JI4L 1XPUA 4OO1I 1VQJA 3HFZB 4BY1G 2OCEA 4JI5L 4A93G 2IX0A 4O2DA 4IOAA 3CCVA 1IBLQ 1CKNB 3M7NA 4AQYQ 1VS0A 3PO2H 2PI2A 4R4QA 3CQZH 1L0WA 2VNUD 2ZM6Q 3KDFA 4KHZA 4LFAL 5J3BA 1T9HA 3H3VI 2Q2IA 2K14A 2VY3A 4DK3C 4LF5Q 1L2FA 5FJ8H 2K5VA 1D8LA 4MTNA 2I5HA 4A3CH 4JV5L 1NMFA 5BR8Q 5EAYA 1C7YA 4BA2I 1N33Q 2B3GA 3ULJA 4BY7H 4HIDA 2KBNA 1XTDA 1KRTA 2BA1A 2PQAA 2AHOB 1KQSA 2E2IH 2D0OA 4B3TL 4A3JH 1I94L 2OTJA 4PG3A 1V1QA 3EIVA 1PHJA 4OX9Q 2JA6G 4A93H 1FJGL 4JBJA 2XTIA 4A4IA 2ALYB 3CXCA 1IL2A 4R4OA 3RLNA 5JEAJ 3PF5A 2I5MX 1SMXA 3AYHB 4DAYB 3KFUA 4BXXG 1HR0L 4MZ9A 1X65A 4YWMA 2VQEL 4P74A 3K7UC 4YY3Q 3DLLA 1L1OB 3MEFA 3W5OA 1XPRA 2OQ0A 4JI0Q 1YEZA 4A3CG 3RZOH 5IYBG 2Y0SE 2A8VA 3ICEA 4TVAB 4LF9Q 4GN3B 4IFDG 2MNAA 3M85A 4LUOA 3T1HL 1AE3A 3J81j 1HZAA 1Q1EA 1SN8A 3RLOA 2HIXA 3S2HH 1AH9A 1HNXQ 3ULLA 4GN5A 5C0XJ 5GAGC 3CCMA 3HOXH 1VQAA 5E7NA 5ELNA 5C3EG 1VQNA 4UPAA 2MO1A 3AQQA 4AYBG 1A0IA 3RN2A 4A3FH 3L0OA 2R7ZH 2JE6I 1N9WA 1PYSB 1MJCA 2ZM6L 2I0QA 2KCTA 4JBMA 2OWOA 2JA9A 3RZDH 4BBSG 1S40A 2VQFL 3M3YH 3S1QH 2UXBL 3G6EA 1VQMA 2AWNA 4JOIC 2ZJPA 3U50C 4DR7L 1I6HH 5ELOA 2HIVA 1PH8A 4WJ4A 2JEBI 4QL5A 1S72A 2R7ZG 4JI4Q 3BU2A 1VQEA 3GTJH 2NVXH 1GVPA 1Z47A 4A3EG 2R92G 1O7IA 1B7YB 2K75A 2E5LQ 1GO3E 2RHQB 2D62A 4LFBL 4A3KH 1YJNA 1I3QH 4X65L 2UUBQ 4GS3A 3U4ZA 1UEBA 4P72A 2ZTEA 1WOCA 2B63H 2I5LX 1SR3A 1JJ2A 4JI1L 4JBKA 4A3IH 4EQ5A 1PH7A 3S1RH 3F2CA 2C35B 3JAMc 4IFDI 1VQBA 1EIFA 2QA4A 1G51A 1X3FA 4LF6Q 1TWHH 2UXDQ 3KF6A 2KHIA 1G6PA 2JA8G 1VQOA 4RG1A 4X62L 4C2MH 3CC7A 4DR5L 1FVIA 2PNHA 3I7FA 2YTYA 1EFWA 1VQ7A 4LFCQ 4A3IG 3OTOL 2A1AA 1E1OA 1Q12A 1TWFH 4OWTB 1X55A 3PO2G 2JK8A 3KF6B 3PUZA 5JJLA 5IY0A 1YBYA 1I94Q 4YCWA 2K4KA 1EYGA 2Z6KA 2UUAQ 1NMGA 2D0PA 4J15A 1PH9A 1J5EQ 1JE5A 2JA5H 4BA1I 4IOCA 2MQHA 2NN6G 4JI8L 1K8AC 1IYJB 2JA7G 1SFOH 1IBKL 1TWAH 3PGZA 1XMOQ 3T1YL 1IBKQ 3KJOA 4BBRH 4HIOA 1PA6A 1LM0A 1M90C 1XMQL 4B3MQ 3SGIA 3HKSA 5M3FG 2HT1A 2NZHA 3CD6A 1XNQQ 3A5ZB 5K36G 2Z0SA 2KENA 3UDGA 2R6GA 4BBRG 1QUQA 3G71A 4LF9L 3PF4A 4H02A 4PZ8A 2PQAB 2NN6I 1KRSA 3J81i 4KLKA 5IWAQ 4DPGA 5IE8A 4A3DG 3ERSX 3CCEA 3WWVA 1EUJA 3JC66 4JG2A 3F8TA 2OQKA 3D0FA 4HIKA 4LF8L 3AEVA 5C4XG 5GQOA 1FL0A 4KHPQ 4GKKQ 2LXKA 4PMWA 3AFPA 1Q8KA 4GKKL 1CUKA 2VUMG 3NBHB 1VQDA 4L5QA 3HOVG 1GD7A 4LF8Q 3CP0A 5IYCH 4B3SL 2LSSA 3HOWH 5M3MH 4HJ5A 2CWAA 4A3JG 4PZ6A 1IZ6A 5GADC 5C0XG 4IO9A 1RIPA 4K0KQ 1OXTA 2GVBA 1Y1VH 5C4JH 4EX5A 2Q2TA 4IFDJ 4JI2L 4LFBQ 4OWXB 1XJVA 3S16H 2E5LL 3BJUA 2RCNA 4DUYL 5GAHC 3S15H 3GDEA 4YHHQ 1B70B 2JA8H 5LMNQ 3EBEA 4DR1L 4P75A 1VQPA 1H95A 1JJGA 2ZJRA 2HHHL 2YU9H 4LF7L 3CC4A 3W1BA 1SROA 2PI2E 4UP7A 4OXPA 5IP9H 1KXLA 2UXBQ 1E3PA 2MO0A 3IRBA 3GTOH 1LTLA 3I4NG 1WCMH 3K7AH 2WB1G 3H3VH 1VQGA 4C3JH 4ME3A 1PFSA 3EN2A 1BKBA 3KJPA 1I5FA 4X66L 1DGSA 1TWCH 1WFQA 2NZOA 3CMEA 4DV2Q 4A3MH 4A3KG 5IYDG 5IP7G 2JA5G 1R9TH 4LFCL 3U4VA 3UDFA 4DV4L 4JC0A 2NVQH 2R93H 1WI5A 4O0AA 1A8VA 1EOVA 2RHSB 5C44H 3GTKH 1Q46A 4JI0L 4LF4L 1M1KC 2LXJA 3KLWA 5IYDH 4YY3L 4X6AH 1RL2A 1E24A 4OONA 5M5XH 2DGYA 4RMFA 4X64Q 1HR0Q 4UP8A 1E22A 2ZTDA 1VQ4A 3JAMi 1Y1WH 5GAEC 4DKAC 1HNZQ 3K81C 3S24A 3KF8B 5HGQA 1QVGA 4GNXC 1VQ8A 2Z6KC 4DR7Q 2K5HA 2B29A 4NXNL 4QJFA 1EQRA 1GM5A 1OXUA 1YITA 2Q2HA 4NXNQ 3LGJA 2K5NA 1JB7A 3TS2A 4NPSA 1PV4A 2HHHQ 3PO3H 1VQFA 4JYAQ 3PIOA 2GN5A 1YVCA 2V1CC 1NTGA 4HJ8A 1HNZL 1WJJA 1EIYB 2UU9L 2K50A 4P71A 1VQHA 1X54A 1P8LA 3E9IA 2E8GA 2CQOA 1WYDA 3T1HQ 3HOVH 3GD7A 1PH2A 2ZTCA 3G4SA 3PSIA 4NB3A 4A3FG 4QQBX 4K0KL 1Q7YC 1QZGA 2OTLA 2QEXA 3HOYG 2KCMA 1E1TA 3CC2A 4R1JA 5DLQE 5M5WH 5FLMG 4ALPA 3KOJA 3FHWA 1HR0W 1G291 2MFIA 5AJ3L 4AIMA 4POGA 4HIMA 1YZ6A 3J80c 4A76A 4DR6L 4DV3Q 4JI3Q 5IYBH 1UE6A 4R4TA 3NEMA 3J81c 1AE2A 2VW9A 2WP8J 4DUZQ 3OW2A 2N49A 3ULPA 1JMCA 2JA7H 3L7ZC 4OO1G 4DV2L 2YV5A 2E2JH 3PUXA 4DV7Q 1HZCA 1VQ6A 5GROA 4DNIA 1A63A 3CCQA 1K9MC 2R7DA 1HZBA 1PH4A 1VQIA 3K0XA 4JOIA 4UP9A 4B3TQ 4UY8C 1NBWA 3CCSA 3U58A 1KD1C 1K3RA 1N32Q 1N33L 4LF7Q 1YIJA 3CAMA 1XMQQ 1NE3A 2KHJA 4B3ML 4LNQA 2VUMH 3GTMH 3KYHC 2VS1A 4YHHL 4LF5L 3A0JA 1NY4A 3I4MH 3RNUA 4AYBE 1K83H 3MXNB 3OYYA 4XTCS 3J80i 4JI2Q 1XNRL 3HOWG 4R4IA 1N34Q 1Q86C 1UWVA 3F2DA 3FKIG 2JA6H 4A3DH 2ES2A 1IBLL 1VQKA 1V9PA 1U0LA 3BZKA 2YYZA 3ER0A 3S1MH 4DV0L 2YTVA 1LUZA 1UE1A 4POFA 4B3SQ 4MNOA 4A3GH 4WJ3M 4JI5Q 1C9OA 2F4VQ 1HH2P 3M9BA 3PCOB 4PZ7A 4IPHA 4C3HH 3CW2C 4A3EH 1B8AA 1Y1WG 4JI7Q 4IPGA 2R92H 4QGUA 3A5UA 4A75A 2JJQA 1MKHA 1HNWQ 2BH2A 1QUQB 2Q2UA 4HJ9A 3M4PA 5LMUQ 5AJ3Q 2YTXA 1L1OA 2XGTA 4DR2L 4BY1H 4LF6L 3CF5A 2IX1A 5M3FH 3K8AA 1N36Q 1JJCB 2HQLA 4LF4Q 1I50H 1N36L 4JI1Q 4HJAA 3RR5A 4TQUS 4A3BG 2BA0A 1CKNA 1XNQL 1WCMG 3PUYA 4X65Q 2UUBL 1YI2A 3UDXA 1N8RC 1E7ZA 3UDIA 4APVA 1YHQA 1K8GA 3CCLA 3S17H 2UU9Q 2QGQA 2EQSA 2VZAA 4DR3L 1SLJA 1OXVA 3I4OA 2EIFA 4GN4B 5H1SE 1X9NA 3F1ZA 2FXQA 1IBML 4GKJL 4LUZA 3PV0A 2NVYH 4JBWA 1J5EL 1ASZA 1VCIA 4JI6Q 4NXML 2NVTH 2VQFQ 4NXMQ 2UUAL 2AMCB 1MIUA 2RF4A 4GLVB 3HOUH 3H15A 2UXCL 4GKJQ 3CCRA 1YJ9A 4L5TA 1XNRQ 3E0EA 4GLAC 5LMNL 1W2BA 2JQOA 3HOZH 3CPWA 3OTOQ 3L2PA 4DUYQ 3I2ZA 2ID0A 1Q81C 2DUDA 4DR5Q 5IYCG 4X62Q 1KC8C 1S3OA 1X3GA 2UXDL 1HZ9A 4QY7A 2JEAI 3PUVA 1FGUA 4A3BH 4P73A 1SE8A 1X6OA 3BZCA 1LYLA 1C0AA 3RLFA 2WB1E 4L5SA 3S14H 2AKWB 2CKZB 4IPCA 4YCVA 5C4XH 4IJHA 1TXYA 4XIGS 4DV7L 4A3MG 5LMUL 3W1GA 3PO3G 4A3LG 2L15A 2VQEQ 2ATWA 4OWWB 4DV6L 4Y52H 4R4CA 1BBWA 1SRUA 4KHPL 3E9HA 3HOXG 4JI7L 1K0RA 2IHFA 4DR6Q 1W3SA 4BY7G 3TS0A 4BBSH 1OTCA 1FJGQ 4GNXA 2WAQE 4Y7NH 2UUCL 4OX9L 1CKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJ8 G;  3GTP H;  1V43 A;  3UE1 A;  3B6Y A;  2IT1 A;  1J6Q A;  3GTQ H;  1JT8 A;  3KDF B;  2N3S A;  2F52 A;  1Z9F A;  5BR8 L;  2AWO A;  5FLM H;  3I55 A;  1PH1 A;  1VQL A;  2E2H H;  4DR1 Q;  3S1N H;  4A3G G;  1Y1V G;  1TWG H;  3J7Z C;  4HJ7 A;  1VQ5 A;  1XPO A;  1XMO L;  3HOY H;  1QVF A;  1PVO A;  4LUV A;  4AH6 A;  3F2B A;  1HNX L;  3AFQ A;  4LFA Q;  1X3E A;  3TRE A;  3S2D H;  3CCJ A;  1KL9 A;  4JI8 Q;  4JYA L;  2UXC Q;  1YHA A;  1YJW A;  3DM3 A;  3NEN A;  2K52 A;  4KI0 A;  3I56 A;  5M5Y H;  3GTG H;  3Q8D A;  4JI6 L;  2N78 A;  1ASY A;  1IBM Q;  5JJK A;  1UE7 A;  1D7Q A;  3FP9 A;  2UUC Q;  1YHB A;  1K73 C;  3GO5 A;  4YWK A;  4A3L H;  3TRZ A;  4L5R C;  3NEL A;  1Y14 B;  4JI3 L;  3CMA A;  4DV3 L;  1N32 L;  4DV6 Q;  1PH5 A;  1NJI C;  4DV5 L;  2ZJQ A;  3PIP A;  1BVS A;  2EXD A;  2F3I A;  2IHE A;  1Q82 C;  5IWA L;  3J7A 5;  4YCU A;  3G48 A;  1YNX A;  1PYB A;  5C44 G;  2A19 A;  4DR2 Q;  2WFW A;  3TEH B;  2VL6 A;  2R93 G;  4GLX A;  3K80 C;  1CKM A;  1OXX K;  1P16 A;  1Q1B A;  5LMN W;  4DV4 Q;  4DR4 Q;  3A74 A;  3T1Y Q;  3STB C;  2CCZ A;  4JV5 Q;  4B3R L;  1EQQ A;  1CSP A;  2F4V L;  2ASB A;  2CWP A;  1OXS C;  3D31 A;  4GOP B;  3M4O H;  2IY5 B;  2BH8 A;  3I4N H;  1A62 A;  4DV0 Q;  5C3E H;  5FLX c;  3HKZ E;  4LWC A;  4YWL A;  4AQY L;  5IP9 G;  1PH3 A;  1UE5 A;  4GOP C;  1IXR A;  4GOP A;  5JEA G;  1N34 L;  4DAM A;  4DK6 C;  2PMZ E;  1GKH A;  5IT9 c;  1HJP A;  3HKZ G;  1QVC A;  1VQC A;  4DV1 Q;  3HOU G;  4B3R Q;  3M4Q A;  4GNX B;  4DR3 Q;  5JJI A;  2WAQ G;  3H0G H;  3H0G G;  4DR4 L;  1CSQ A;  2R7F A;  4X64 L;  3STB D;  1KIX A;  3HOZ G;  1QZH A;  4IJL A;  1L1O C;  1U5K A;  2CFM A;  3I4M G;  2N8N A;  1MJE A;  1PH6 A;  3VDY A;  1X56 A;  2Y0S G;  3FKI H;  4IPD A;  3PUW A;  3CCU A;  2B63 G;  3ZJY C;  1EWI A;  1KHI A;  5C0X I;  3GTL H;  1BBU A;  4JCV E;  3TQY A;  4DV5 Q;  4LW1 A;  3UE0 A;  4DUZ L;  4BXX H;  1HNW L;  1VQ9 A;  2H5X A;  4QIW E;  4C3I H;  3CPF A;  5M3M G;  2GVA A;  5IP7 H;  5HY6 A;  4FDB A;  1KAW A;  4DV1 L;  3RN5 A;  4X66 Q;  4JI4 L;  1XPU A;  4OO1 I;  1VQJ A;  3HFZ B;  4BY1 G;  2OCE A;  4JI5 L;  4A93 G;  2IX0 A;  4O2D A;  4IOA A;  3CCV A;  1IBL Q;  1CKN B;  3M7N A;  4AQY Q;  1VS0 A;  3PO2 H;  2PI2 A;  4R4Q A;  3CQZ H;  1L0W A;  2VNU D;  2ZM6 Q;  3KDF A;  4KHZ A;  4LFA L;  5J3B A;  1T9H A;  3H3V I;  2Q2I A;  2K14 A;  2VY3 A;  4DK3 C;  4LF5 Q;  1L2F A;  5FJ8 H;  2K5V A;  1D8L A;  4MTN A;  2I5H A;  4A3C H;  4JV5 L;  1NMF A;  5BR8 Q;  5EAY A;  1C7Y A;  4BA2 I;  1N33 Q;  2B3G A;  3ULJ A;  4BY7 H;  4HID A;  2KBN A;  1XTD A;  1KRT A;  2BA1 A;  2PQA A;  2AHO B;  1KQS A;  2E2I H;  2D0O A;  4B3T L;  4A3J H;  1I94 L;  2OTJ A;  4PG3 A;  1V1Q A;  3EIV A;  1PHJ A;  4OX9 Q;  2JA6 G;  4A93 H;  1FJG L;  4JBJ A;  2XTI A;  4A4I A;  2ALY B;  3CXC A;  1IL2 A;  4R4O A;  3RLN A;  5JEA J;  3PF5 A;  2I5M X;  1SMX A;  3AYH B;  4DAY B;  3KFU A;  4BXX G;  1HR0 L;  4MZ9 A;  1X65 A;  4YWM A;  2VQE L;  4P74 A;  3K7U C;  4YY3 Q;  3DLL A;  1L1O B;  3MEF A;  3W5O A;  1XPR A;  2OQ0 A;  4JI0 Q;  1YEZ A;  4A3C G;  3RZO H;  5IYB G;  2Y0S E;  2A8V A;  3ICE A;  4TVA B;  4LF9 Q;  4GN3 B;  4IFD G;  2MNA A;  3M85 A;  4LUO A;  3T1H L;  1AE3 A;  3J81 j;  1HZA A;  1Q1E A;  1SN8 A;  3RLO A;  2HIX A;  3S2H H;  1AH9 A;  1HNX Q;  3ULL A;  4GN5 A;  5C0X J;  5GAG C;  3CCM A;  3HOX H;  1VQA A;  5E7N A;  5ELN A;  5C3E G;  1VQN A;  4UPA A;  2MO1 A;  3AQQ A;  4AYB G;  1A0I A;  3RN2 A;  4A3F H;  3L0O A;  2R7Z H;  2JE6 I;  1N9W A;  1PYS B;  1MJC A;  2ZM6 L;  2I0Q A;  2KCT A;  4JBM A;  2OWO A;  2JA9 A;  3RZD H;  4BBS G;  1S40 A;  2VQF L;  3M3Y H;  3S1Q H;  2UXB L;  3G6E A;  1VQM A;  2AWN A;  4JOI C;  2ZJP A;  3U50 C;  4DR7 L;  1I6H H;  5ELO A;  2HIV A;  1PH8 A;  4WJ4 A;  2JEB I;  4QL5 A;  1S72 A;  2R7Z G;  4JI4 Q;  3BU2 A;  1VQE A;  3GTJ H;  2NVX H;  1GVP A;  1Z47 A;  4A3E G;  2R92 G;  1O7I A;  1B7Y B;  2K75 A;  2E5L Q;  1GO3 E;  2RHQ B;  2D62 A;  4LFB L;  4A3K H;  1YJN A;  1I3Q H;  4X65 L;  2UUB Q;  4GS3 A;  3U4Z A;  1UEB A;  4P72 A;  2ZTE A;  1WOC A;  2B63 H;  2I5L X;  1SR3 A;  1JJ2 A;  4JI1 L;  4JBK A;  4A3I H;  4EQ5 A;  1PH7 A;  3S1R H;  3F2C A;  2C35 B;  3JAM c;  4IFD I;  1VQB A;  1EIF A;  2QA4 A;  1G51 A;  1X3F A;  4LF6 Q;  1TWH H;  2UXD Q;  3KF6 A;  2KHI A;  1G6P A;  2JA8 G;  1VQO A;  4RG1 A;  4X62 L;  4C2M H;  3CC7 A;  4DR5 L;  1FVI A;  2PNH A;  3I7F A;  2YTY A;  1EFW A;  1VQ7 A;  4LFC Q;  4A3I G;  3OTO L;  2A1A A;  1E1O A;  1Q12 A;  1TWF H;  4OWT B;  1X55 A;  3PO2 G;  2JK8 A;  3KF6 B;  3PUZ A;  5JJL A;  5IY0 A;  1YBY A;  1I94 Q;  4YCW A;  2K4K A;  1EYG A;  2Z6K A;  2UUA Q;  1NMG A;  2D0P A;  4J15 A;  1PH9 A;  1J5E Q;  1JE5 A;  2JA5 H;  4BA1 I;  4IOC A;  2MQH A;  2NN6 G;  4JI8 L;  1K8A C;  1IYJ B;  2JA7 G;  1SFO H;  1IBK L;  1TWA H;  3PGZ A;  1XMO Q;  3T1Y L;  1IBK Q;  3KJO A;  4BBR H;  4HIO A;  1PA6 A;  1LM0 A;  1M90 C;  1XMQ L;  4B3M Q;  3SGI A;  3HKS A;  5M3F G;  2HT1 A;  2NZH A;  3CD6 A;  1XNQ Q;  3A5Z B;  5K36 G;  2Z0S A;  2KEN A;  3UDG A;  2R6G A;  4BBR G;  1QUQ A;  3G71 A;  4LF9 L;  3PF4 A;  4H02 A;  4PZ8 A;  2PQA B;  2NN6 I;  1KRS A;  3J81 i;  4KLK A;  5IWA Q;  4DPG A;  5IE8 A;  4A3D G;  3ERS X;  3CCE A;  3WWV A;  1EUJ A;  3JC6 6;  4JG2 A;  3F8T A;  2OQK A;  3D0F A;  4HIK A;  4LF8 L;  3AEV A;  5C4X G;  5GQO A;  1FL0 A;  4KHP Q;  4GKK Q;  2LXK A;  4PMW A;  3AFP A;  1Q8K A;  4GKK L;  1CUK A;  2VUM G;  3NBH B;  1VQD A;  4L5Q A;  3HOV G;  1GD7 A;  4LF8 Q;  3CP0 A;  5IYC H;  4B3S L;  2LSS A;  3HOW H;  5M3M H;  4HJ5 A;  2CWA A;  4A3J G;  4PZ6 A;  1IZ6 A;  5GAD C;  5C0X G;  4IO9 A;  1RIP A;  4K0K Q;  1OXT A;  2GVB A;  1Y1V H;  5C4J H;  4EX5 A;  2Q2T A;  4IFD J;  4JI2 L;  4LFB Q;  4OWX B;  1XJV A;  3S16 H;  2E5L L;  3BJU A;  2RCN A;  4DUY L;  5GAH C;  3S15 H;  3GDE A;  4YHH Q;  1B70 B;  2JA8 H;  5LMN Q;  3EBE A;  4DR1 L;  4P75 A;  1VQP A;  1H95 A;  1JJG A;  2ZJR A;  2HHH L;  2YU9 H;  4LF7 L;  3CC4 A;  3W1B A;  1SRO A;  2PI2 E;  4UP7 A;  4OXP A;  5IP9 H;  1KXL A;  2UXB Q;  1E3P A;  2MO0 A;  3IRB A;  3GTO H;  1LTL A;  3I4N G;  1WCM H;  3K7A H;  2WB1 G;  3H3V H;  1VQG A;  4C3J H;  4ME3 A;  1PFS A;  3EN2 A;  1BKB A;  3KJP A;  1I5F A;  4X66 L;  1DGS A;  1TWC H;  1WFQ A;  2NZO A;  3CME A;  4DV2 Q;  4A3M H;  4A3K G;  5IYD G;  5IP7 G;  2JA5 G;  1R9T H;  4LFC L;  3U4V A;  3UDF A;  4DV4 L;  4JC0 A;  2NVQ H;  2R93 H;  1WI5 A;  4O0A A;  1A8V A;  1EOV A;  2RHS B;  5C44 H;  3GTK H;  1Q46 A;  4JI0 L;  4LF4 L;  1M1K C;  2LXJ A;  3KLW A;  5IYD H;  4YY3 L;  4X6A H;  1RL2 A;  1E24 A;  4OON A;  5M5X H;  2DGY A;  4RMF A;  4X64 Q;  1HR0 Q;  4UP8 A;  1E22 A;  2ZTD A;  1VQ4 A;  3JAM i;  1Y1W H;  5GAE C;  4DKA C;  1HNZ Q;  3K81 C;  3S24 A;  3KF8 B;  5HGQ A;  1QVG A;  4GNX C;  1VQ8 A;  2Z6K C;  4DR7 Q;  2K5H A;  2B29 A;  4NXN L;  4QJF A;  1EQR A;  1GM5 A;  1OXU A;  1YIT A;  2Q2H A;  4NXN Q;  3LGJ A;  2K5N A;  1JB7 A;  3TS2 A;  4NPS A;  1PV4 A;  2HHH Q;  3PO3 H;  1VQF A;  4JYA Q;  3PIO A;  2GN5 A;  1YVC A;  2V1C C;  1NTG A;  4HJ8 A;  1HNZ L;  1WJJ A;  1EIY B;  2UU9 L;  2K50 A;  4P71 A;  1VQH A;  1X54 A;  1P8L A;  3E9I A;  2E8G A;  2CQO A;  1WYD A;  3T1H Q;  3HOV H;  3GD7 A;  1PH2 A;  2ZTC A;  3G4S A;  3PSI A;  4NB3 A;  4A3F G;  4QQB X;  4K0K L;  1Q7Y C;  1QZG A;  2OTL A;  2QEX A;  3HOY G;  2KCM A;  1E1T A;  3CC2 A;  4R1J A;  5DLQ E;  5M5W H;  5FLM G;  4ALP A;  3KOJ A;  3FHW A;  1HR0 W;  1G29 1;  2MFI A;  5AJ3 L;  4AIM A;  4POG A;  4HIM A;  1YZ6 A;  3J80 c;  4A76 A;  4DR6 L;  4DV3 Q;  4JI3 Q;  5IYB H;  1UE6 A;  4R4T A;  3NEM A;  3J81 c;  1AE2 A;  2VW9 A;  2WP8 J;  4DUZ Q;  3OW2 A;  2N49 A;  3ULP A;  1JMC A;  2JA7 H;  3L7Z C;  4OO1 G;  4DV2 L;  2YV5 A;  2E2J H;  3PUX A;  4DV7 Q;  1HZC A;  1VQ6 A;  5GRO A;  4DNI A;  1A63 A;  3CCQ A;  1K9M C;  2R7D A;  1HZB A;  1PH4 A;  1VQI A;  3K0X A;  4JOI A;  4UP9 A;  4B3T Q;  4UY8 C;  1NBW A;  3CCS A;  3U58 A;  1KD1 C;  1K3R A;  1N32 Q;  1N33 L;  4LF7 Q;  1YIJ A;  3CAM A;  1XMQ Q;  1NE3 A;  2KHJ A;  4B3M L;  4LNQ A;  2VUM H;  3GTM H;  3KYH C;  2VS1 A;  4YHH L;  4LF5 L;  3A0J A;  1NY4 A;  3I4M H;  3RNU A;  4AYB E;  1K83 H;  3MXN B;  3OYY A;  4XTC S;  3J80 i;  4JI2 Q;  1XNR L;  3HOW G;  4R4I A;  1N34 Q;  1Q86 C;  1UWV A;  3F2D A;  3FKI G;  2JA6 H;  4A3D H;  2ES2 A;  1IBL L;  1VQK A;  1V9P A;  1U0L A;  3BZK A;  2YYZ A;  3ER0 A;  3S1M H;  4DV0 L;  2YTV A;  1LUZ A;  1UE1 A;  4POF A;  4B3S Q;  4MNO A;  4A3G H;  4WJ3 M;  4JI5 Q;  1C9O A;  2F4V Q;  1HH2 P;  3M9B A;  3PCO B;  4PZ7 A;  4IPH A;  4C3H H;  3CW2 C;  4A3E H;  1B8A A;  1Y1W G;  4JI7 Q;  4IPG A;  2R92 H;  4QGU A;  3A5U A;  4A75 A;  2JJQ A;  1MKH A;  1HNW Q;  2BH2 A;  1QUQ B;  2Q2U A;  4HJ9 A;  3M4P A;  5LMU Q;  5AJ3 Q;  2YTX A;  1L1O A;  2XGT A;  4DR2 L;  4BY1 H;  4LF6 L;  3CF5 A;  2IX1 A;  5M3F H;  3K8A A;  1N36 Q;  1JJC B;  2HQL A;  4LF4 Q;  1I50 H;  1N36 L;  4JI1 Q;  4HJA A;  3RR5 A;  4TQU S;  4A3B G;  2BA0 A;  1CKN A;  1XNQ L;  1WCM G;  3PUY A;  4X65 Q;  2UUB L;  1YI2 A;  3UDX A;  1N8R C;  1E7Z A;  3UDI A;  4APV A;  1YHQ A;  1K8G A;  3CCL A;  3S17 H;  2UU9 Q;  2QGQ A;  2EQS A;  2VZA A;  4DR3 L;  1SLJ A;  1OXV A;  3I4O A;  2EIF A;  4GN4 B;  5H1S E;  1X9N A;  3F1Z A;  2FXQ A;  1IBM L;  4GKJ L;  4LUZ A;  3PV0 A;  2NVY H;  4JBW A;  1J5E L;  1ASZ A;  1VCI A;  4JI6 Q;  4NXM L;  2NVT H;  2VQF Q;  4NXM Q;  2UUA L;  2AMC B;  1MIU A;  2RF4 A;  4GLV B;  3HOU H;  3H15 A;  2UXC L;  4GKJ Q;  3CCR A;  1YJ9 A;  4L5T A;  1XNR Q;  3E0E A;  4GLA C;  5LMN L;  1W2B A;  2JQO A;  3HOZ H;  3CPW A;  3OTO Q;  3L2P A;  4DUY Q;  3I2Z A;  2ID0 A;  1Q81 C;  2DUD A;  4DR5 Q;  5IYC G;  4X62 Q;  1KC8 C;  1S3O A;  1X3G A;  2UXD L;  1HZ9 A;  4QY7 A;  2JEA I;  3PUV A;  1FGU A;  4A3B H;  4P73 A;  1SE8 A;  1X6O A;  3BZC A;  1LYL A;  1C0A A;  3RLF A;  2WB1 E;  4L5S A;  3S14 H;  2AKW B;  2CKZ B;  4IPC A;  4YCV A;  5C4X H;  4IJH A;  1TXY A;  4XIG S;  4DV7 L;  4A3M G;  5LMU L;  3W1G A;  3PO3 G;  4A3L G;  2L15 A;  2VQE Q;  2ATW A;  4OWW B;  4DV6 L;  4Y52 H;  4R4C A;  1BBW A;  1SRU A;  4KHP L;  3E9H A;  3HOX G;  4JI7 L;  1K0R A;  2IHF A;  4DR6 Q;  1W3S A;  4BY7 G;  3TS0 A;  4BBS H;  1OTC A;  1FJG Q;  4GNX A;  2WAQ E;  4Y7N H;  2UUC L;  4OX9 L;  1CKO A; 
#chains in the Genus database with same CATH topology
 3UE1 A;  4C1N I;  1D2B A;  3GP7 A;  2Z8L A;  4CKE A;  3SK4 A;  5C5M A;  3KDF B;  3H3V C;  3K5L A;  1JT8 A;  5FLM H;  2K5Q A;  3I55 A;  2EYL A;  3S1N H;  4HJ7 A;  3A7A B;  3D4D A;  1XMO L;  4A93 B;  1GUS A;  3TP8 A;  5ELF A;  4LUV A;  4LFA Q;  1H9R A;  3CCJ A;  1B3Q A;  3NQT A;  4R8N A;  2UXC Q;  1K0S A;  1YHA A;  2K28 A;  1YJW A;  3DM3 A;  3NEN A;  1EFI D;  2K52 A;  1MSH A;  2BE5 C;  1ASY A;  3VA5 A;  2B2W C;  3ERQ A;  3WOF A;  1SFO B;  2M00 A;  3TRZ A;  2L9H A;  1JWM D;  4L5R C;  1A3V A;  1B9N A;  1N32 L;  2Z4H A;  3CMA A;  4LJZ C;  1VF5 C;  3PIP A;  2ZJQ A;  3HGB A;  1HCZ A;  1Q82 C;  2MUY A;  2M9V A;  5EBD A;  3OHX C;  4GLX A;  2LS0 1;  4HN7 A;  3VR2 A;  4DV4 Q;  3A74 A;  2Z4I A;  4JV5 Q;  2RDF A;  1OXS C;  1FNW A;  2B2U C;  4XXE A;  2Q8R E;  1Q3L A;  4LWC A;  4YWL A;  5IP9 G;  1PH3 A;  5EKI A;  1UE5 A;  1IXR A;  1V1P B;  4GZY C;  5DM7 3;  1DOM A;  2F0V A;  3A7L A;  3M4Q A;  2EY6 A;  1CFM A;  2WAQ G;  2ICE C;  3P1H A;  4QF4 A;  3HOZ G;  4FXK C;  2CFM A;  4HR7 B;  2CW0 C;  1LT4 D;  1MJE A;  3U9O A;  2Y0S G;  3I73 A;  1EL0 A;  1BQQ T;  1SEB D;  5C0X I;  3GTL H;  5ELE A;  4DV5 Q;  1NNX A;  3CQZ B;  3MEH A;  4DUZ L;  1G2T A;  1HNW L;  1LTB D;  3TZD A;  3RN5 A;  1G6Z A;  3HFZ B;  1LV9 A;  2IX0 A;  3I90 A;  4ILW A;  4E6I A;  2FIN B;  3CCV A;  1CKN B;  4JK1 C;  4AQY Q;  1VS0 A;  5C4J B;  3PO2 H;  2PI2 A;  2F0M A;  2VNU D;  2ZM6 Q;  4KHZ A;  2Q2I A;  1FD7 D;  4LF5 Q;  1L2F A;  5FJ8 H;  4MTN A;  1NMF A;  5BR8 Q;  5EAY A;  1RJT A;  1EWH A;  1IW7 C;  1XTC D;  2BA1 A;  2CH4 W;  5IT9 L;  1D1K A;  4PG3 A;  3DXJ C;  2JXM B;  2B63 B;  1U4R A;  4R4O A;  1SMX A;  2PYK A;  4UHV A;  4NDX A;  3MXP A;  3W2D A;  5CMD A;  3GTL B;  2ICI A;  4XT3 B;  4P74 A;  4G7O C;  3K7U C;  1JC7 A;  4OIJ A;  2EYH A;  1T5X D;  3KLS A;  1KAB A;  1XPR A;  1M4V A;  1Q90 A;  3VYU A;  5IYB G;  2Y0S E;  3R8B A;  5JVG 3;  4C3I B;  4TVA B;  3ICE A;  2A6E C;  1I3Q B;  1TS2 A;  1AE3 A;  3J81 j;  4K6D A;  2SEB D;  3RLO A;  3SHL A;  3DEP A;  4EGV A;  5GAG C;  2X6G A;  3FPP A;  5E7N A;  4IUT A;  3IKJ A;  1FYC A;  2F0S A;  3RN2 A;  2R7Z H;  2SNS A;  1N9W A;  1PYS B;  4JBM A;  2JA9 A;  1KLG D;  1EY9 A;  1FR3 A;  3S1Q H;  2AWN A;  2ZJP A;  4G57 A;  4U67 3;  2WIN B;  4WJ4 A;  1WD1 A;  2A6E D;  4JI4 Q;  1AP0 A;  4KK7 A;  4A3E G;  1O7I A;  2FFK B;  1EZ6 A;  2D62 A;  2RHQ B;  3I72 A;  2WAC A;  4BS9 A;  1TU2 B;  1UEB A;  1EU4 A;  3GTJ B;  2DNE A;  2GA4 B;  2B2V A;  2ZTE A;  3VA7 A;  1GOZ A;  3S1R H;  2R61 A;  1VQB A;  3J81 L;  1G51 A;  1S5D D;  2HCI A;  1TWH H;  4PV1 C;  1G6P A;  3M3Y B;  4X62 L;  1D5X C;  4C2M H;  2QKI C;  4FF4 A;  2A1A A;  4TRD A;  2JK8 A;  4RGN A;  1LLR D;  4YCW A;  4RCN A;  4J15 A;  1J5E Q;  2K32 A;  5FOB B;  2B2W A;  4KMU C;  4IOC A;  5EGT A;  1K8A C;  4R9W A;  2K05 A;  3R2T A;  1XMO Q;  1IBK Q;  1LM0 A;  1NUC A;  2WB1 B;  1XMQ L;  1BUV T;  1LTR D;  2L0C A;  3KBX A;  4XDX A;  1DM0 B;  3A5Z B;  4C2M B;  5J22 A;  5K36 G;  3SDZ A;  3UDG A;  2R6G A;  4BBR G;  4HSV A;  3PF4 A;  4H02 A;  2NN6 I;  3PO3 B;  2E74 C;  5E1F A;  4A3D G;  1UUP A;  3AEV A;  1EUJ A;  5FO7 B;  2OQK A;  4C3I G;  5GQO A;  5DAU A;  4ME5 A;  4DAP A;  1PLF A;  3Q22 A;  5KNC A;  3R93 A;  4G4K A;  1UAP A;  3NBH B;  4L5Q A;  4KJO A;  3HOV G;  1GD7 A;  4ABN A;  1MBY A;  2B2Y A;  2B2U A;  5IYC H;  1BF4 A;  1MSG A;  2C5C A;  4HJ5 A;  4K0K Q;  2GVB A;  3NQI A;  5C4J H;  2Z6B A;  2XN9 C;  3QB3 A;  1K8M A;  5FLX L;  4LFB Q;  2A68 C;  2FMM A;  3BJU A;  3GDE A;  4YHH Q;  1B70 B;  3C1F A;  3G7L A;  4P75 A;  2F0W A;  1TWG B;  3HOY B;  1BBX C;  2YU9 H;  3MAQ A;  4QCL A;  1XYI A;  1E2Z A;  1PFM A;  5IOC A;  1BO0 A;  1E3P A;  4DXF A;  4ZKC B;  3I4N G;  1KAA A;  3K7A H;  3H3V H;  1VQG A;  1PFS A;  1YNJ D;  2E2D C;  4MN3 A;  1I5F A;  3CME A;  4A3K G;  1TWC H;  3PO3 H;  4A3L H;  1G91 A;  2H1E A;  3U4V A;  4RHR A;  2PQE A;  4PMB A;  4RKL A;  3I8Z A;  3GTK H;  2M2L A;  1IL8 A;  2LXJ A;  5IYD H;  5CGK A;  1TT2 A;  1RL2 A;  3KF8 A;  3NTK A;  2LFN A;  2F0G A;  3EA6 A;  5M5X B;  1I4H A;  2ZTD A;  5JPN C;  4DKA C;  2AQ3 B;  3AB9 A;  2V4D A;  3S14 B;  4L63 B;  4DR7 Q;  1LT6 D;  1VMC A;  4NXN L;  1W6K A;  3NE5 B;  2JA7 B;  2Z9H A;  2K5N A;  3TS2 A;  3U9S A;  1STE A;  4NPS A;  2R92 B;  1VQF A;  3ND9 A;  3PIO A;  1YVC A;  1WVL A;  2QCP X;  1QCB D;  4Y7N B;  4HJ8 A;  1HNZ L;  2UU9 L;  2K50 A;  3TSS A;  2CQO A;  3T1H Q;  3HOV H;  1PH2 A;  2ZTC A;  2K01 A;  3G4S A;  3D4R A;  4N8F A;  4A3F G;  2NVX B;  2KEC A;  2WII B;  1Q7Y C;  1WTW A;  1QZG A;  2QEX A;  3SE0 A;  3MZ5 A;  1E1T A;  4ALP A;  5FLM G;  2JA8 B;  3KOJ A;  1F9S A;  3FHW A;  4M8A A;  1HR0 W;  2J7Z A;  2MFI A;  5AJ3 L;  3RD4 A;  1YZ6 A;  4HIM A;  1AZP A;  1N32 Q;  1CQF A;  3BDC A;  1KDC A;  2VW9 A;  1GHJ A;  2RDG A;  3FEW X;  3PUX A;  2G9H D;  4DNI A;  3CCQ A;  4A3G B;  4KKT A;  1MI2 A;  3H94 A;  1PH4 A;  3HOV B;  1SYG A;  1KD1 C;  4N8X 1;  2F03 A;  1TS3 A;  1YIJ A;  2KEE A;  3GTP B;  4DXG A;  1Q8I A;  2KHJ A;  5CC4 A;  3GTM H;  3Q23 A;  5M5W B;  3I4M H;  1NY4 A;  4BBS B;  3RNU A;  3BG3 A;  4XTC S;  1RTN A;  3JAM E;  1ZYR C;  1STA A;  4JI2 Q;  1N34 Q;  1Q86 C;  3F2D A;  4A3D H;  2EJF C;  2ES2 A;  3BDO A;  3ER0 A;  1I6V C;  3NBI A;  1LUZ A;  4A3G H;  4C1N K;  1TWA B;  5C5L A;  1Y1W G;  4C3H H;  1PZK D;  4IPH A;  4A3E H;  5EPL A;  4A75 A;  5ELB A;  1MKH A;  5K36 H;  1L1O A;  4BY1 H;  3CF5 A;  1RHP A;  3K8A A;  3TME A;  1JJC B;  1O78 A;  1B1Z A;  1A2U A;  4HJA A;  3RR5 A;  3NP8 A;  2QDB A;  4RGM A;  4I7A A;  4JPB W;  5KIX A;  2JA6 B;  1YI2 A;  1N8R C;  2KOL A;  1CK1 A;  1YHQ A;  1TWH B;  3UDI A;  3TP6 A;  3CCL A;  3BVZ A;  4C3H G;  2QGQ A;  1WD0 A;  1JE4 A;  1OXV A;  4FF2 A;  1HFG A;  4GN4 B;  1F9R A;  4GKJ L;  1GUO A;  3NTI A;  4F8M A;  4JBW A;  1PTO B;  1EYC A;  1ESF A;  4NXM Q;  2AMC B;  1MIU A;  4GLV B;  3HOU H;  3H15 A;  1YJ9 A;  2FJ2 A;  3NBH A;  5LMN L;  4HCS A;  1S5E D;  5CV6 A;  3OTO Q;  1ZKO A;  4DUY Q;  1HXY D;  2F0O A;  2DUD A;  1JR0 D;  1S3O A;  1HZ9 A;  4BY7 B;  2A6H C;  3W3A A;  5T1I A;  3KBG A;  1SE8 A;  5M3M B;  1ESR A;  1L0Y B;  5KYI A;  3S14 H;  2AKW B;  1YNN D;  2CKZ B;  4IPC A;  3C46 A;  3LX0 A;  5C4X H;  1TXY A;  1NSN S;  4A3B B;  1S5C D;  2K7V A;  1SNC A;  4DV6 L;  4Y52 H;  1SRU A;  1RDP D;  3E3X A;  3E9H A;  3HOX G;  2MJ8 A;  4CJ0 B;  2WAQ E;  4Y7N H;  1CKO A;  3T13 A;  1SMY C;  5FJ8 G;  3KUP A;  3HOU B;  5F2D A;  3B6Y A;  1X32 A;  2IT1 A;  3SEB A;  4A3K B;  1U9R A;  3BDL A;  1H9S B;  1YNN C;  2N3S A;  2VXW A;  1ZXT A;  1Z9F A;  4KY5 A;  2AWO A;  4LK1 C;  1PH1 A;  1VQL A;  2E2H H;  4DR1 Q;  5FK9 C;  2J0T D;  2KED A;  1B44 D;  4OIK A;  1X3E A;  3S2D H;  4N9T A;  3SK5 A;  2IW3 A;  4AYB B;  2MGS A;  3OSO A;  3GTG H;  2HCC A;  1IBM Q;  2VB2 X;  1YHB A;  1K73 C;  1RCV D;  2TMP A;  3FVQ A;  5EPK A;  4JI3 L;  4DV6 Q;  1PH5 A;  1CHP D;  1WTV A;  4KD3 A;  3M4O B;  3J7A 5;  3GTK B;  1YNX A;  5C44 G;  4DR2 Q;  3TEH B;  2F0E A;  2NN6 H;  3K80 C;  1P16 A;  5LMN W;  1HRJ A;  3T1Y Q;  2CCZ A;  4B3R L;  1HHV A;  3FKI B;  2F4V L;  3D31 A;  5CV5 A;  4KHV A;  5I9O A;  2J4X A;  2B8G A;  2BH8 A;  2A73 B;  4RGO S;  1A62 A;  3L9A X;  5C6A A;  3VYT A;  2F0N A;  4GOP A;  2KJX A;  2PMZ E;  5IT9 c;  3HKZ G;  1DOL A;  1LAC A;  1VQC A;  4K5V A;  5BN5 A;  3PQI A;  3H0G H;  4DR4 L;  1CSQ A;  1BCP B;  1KIX A;  2QW7 A;  3S1Q B;  1PRT C;  3D4W A;  5I2X A;  3QWN A;  1RD9 D;  4NMZ A;  4ZLT F;  1C48 A;  3TQY A;  1SBB B;  4FF3 A;  4LW1 A;  1STN A;  4C3I H;  5IP7 H;  4FDB A;  1XPU A;  4A93 G;  1EY6 A;  4BY1 G;  1I4X A;  2OCE A;  1UEA B;  4O2D A;  3TDQ A;  5JPM C;  3DWA A;  4FXD A;  2PCF B;  4KD4 A;  2VY3 A;  3CRK C;  4A3C H;  2K5V A;  1D8L A;  2I5H A;  5JJZ A;  1DOK A;  2SOB A;  5I6Y A;  4BY7 H;  5EBC A;  1KRT A;  2AHO B;  1VMP A;  4V0B A;  5EQ0 A;  4C3H B;  1ET6 A;  1WTH A;  4A3J H;  1V1Q A;  4OX9 Q;  4RFB A;  4A93 H;  4JBJ A;  2XTI A;  3CXC A;  5E4X A;  3RLN A;  3K57 A;  3KFU A;  3NHH A;  1HR0 L;  1X65 A;  4X3U A;  4YY3 Q;  3DLL A;  1EWC A;  3MEF A;  1SDF A;  1ENF A;  3W5O A;  4IUU A;  4JI0 Q;  4A3C G;  4EVO A;  4IFD G;  3T1H L;  1HZA A;  1SN8 A;  2HIX A;  3NSW A;  3ULL A;  5C0X J;  1PRT F;  1VQN A;  2ZXO A;  2E2J B;  3AQQ A;  4A3F H;  3M7G A;  2JE6 I;  1MJC A;  2VQF L;  3SK8 A;  3G6E A;  1F2Z A;  3U50 C;  2VB3 X;  4DR7 L;  1F9P A;  5ELO A;  2HIV A;  3IFT A;  2XRS D;  2NVX H;  2A74 C;  3CD6 A;  2K75 A;  1I3Q H;  1II3 A;  3MXU A;  3K5N A;  4RAU C;  4JI1 L;  1SYE A;  3F2C A;  2C35 B;  4IFD I;  1A2T A;  2QA4 A;  4BWG B;  2F0J A;  2K03 A;  1SSO A;  4RG1 A;  3BVG A;  4RCO A;  1Z6H A;  3CC7 A;  4A3I G;  3OTO L;  1TWF H;  4M1U B;  1X55 A;  1BCP F;  5JJL A;  4K5W A;  5IY0 A;  2CHB D;  5KND A;  1WTP A;  2K4K A;  3IL8 A;  1NMG A;  1CI3 M;  2A5H A;  4BA1 I;  2K6A A;  2NN6 G;  4JI8 L;  3RZO B;  2A69 D;  3J7A V;  2JA7 G;  4ZK9 B;  1L0X B;  4BBR H;  4B3M Q;  3HKS A;  3HOX B;  2HT1 A;  2NZH A;  3IAY A;  2Z0S A;  2CVR A;  4LF9 L;  1QUQ A;  3PMF A;  4XT1 B;  5C3E B;  4EQO A;  2EXZ A;  4PZ8 A;  1ENC A;  1GUN A;  3J81 i;  5IWA Q;  4JW0 A;  4DPG A;  4TSS A;  3CCE A;  3JC6 6;  2NZ1 D;  3F8T A;  3MC0 B;  5E4W C;  3BYY B;  4EQP A;  1SXT A;  1I4Q A;  3RZD B;  1TQO A;  3HZX A;  4DAY A;  5IGF A;  4DAV A;  2VUM G;  4IZ8 A;  1VQD A;  3CP0 A;  2PZW A;  4ZCK A;  3V96 A;  3NTH A;  5C0X H;  4DFA A;  3VR6 A;  1Y1V H;  3D8G A;  1QIL A;  5FO8 B;  5EJW A;  4JI2 L;  4OWX B;  2PNR C;  2WV6 D;  2RCN A;  5GAH C;  3S15 H;  1GXD C;  2JA8 H;  4OEM B;  1EZ8 A;  1JJG A;  2HHH L;  3CHB D;  1EU3 A;  4UP7 A;  2F1M A;  5IP9 H;  1TS5 A;  4HSP A;  3GTO H;  1K8O A;  1LTA D;  1PTO D;  2WB1 G;  2IJ0 A;  4C3J H;  1Y8P B;  4OHJ A;  3EN2 A;  1BKB A;  3GTM B;  4X66 L;  1DGS A;  1STB A;  4DV4 L;  2HQE A;  4O0A A;  3K59 A;  4FYD A;  1A8V A;  2XSC A;  4LMQ D;  1Z7T A;  3SK6 A;  4JI0 L;  2Z1C A;  2E76 C;  4YY3 L;  3F2U A;  4IUQ A;  2FMC A;  2F0L A;  5ELC A;  2DGY A;  3HEJ A;  4RMF A;  4X64 Q;  1HR0 Q;  1AEX A;  1E22 A;  1VQ4 A;  2F3W A;  3JAM i;  1AN8 A;  1Y1W H;  1HNZ Q;  4A3F B;  3S24 A;  1QVG A;  2IPK D;  4GNX C;  1VQ8 A;  3RUZ A;  1WTX A;  2Z6K C;  5A2Q L;  2B29 A;  4CGY B;  2EY1 A;  1TY0 A;  2G5D A;  4QJF A;  1GM5 A;  1OXU A;  3K0Y A;  4NXN Q;  3LGJ A;  1JB7 A;  1PV4 A;  2HHH Q;  4A3E B;  2V1C C;  3P20 A;  3TZU A;  1BCP D;  1NTG A;  1STG A;  2XRQ D;  4DA2 A;  2XVS A;  3E9I A;  1X54 A;  2E8G A;  4DNT B;  3EVQ A;  2RQX A;  2NWG A;  4QQB X;  1HUM A;  3J81 E;  1NCV A;  2L4N A;  5DLQ E;  2OEO A;  1WTO A;  3DHQ A;  3TP7 A;  3J80 c;  2RSN A;  4R4T A;  3NEM A;  2WP8 J;  2JA7 H;  2N49 A;  4G7Z C;  2KHS A;  3DMU A;  1PYW D;  2YV5 A;  3OWE B;  1VQ6 A;  1A63 A;  3A56 A;  1F2L A;  3QIA A;  4UY8 C;  3K0X A;  3CCS A;  3U58 A;  1YNJ C;  4O1N A;  3HKZ B;  4B3M L;  1NE3 A;  4KTA A;  3O13 A;  3KYH C;  4LF5 L;  4YHH L;  4WJW A;  2NTS A;  4XYO A;  3A0J A;  4AYB E;  1K83 H;  3J80 i;  5E3F A;  4A3I B;  1XNR L;  3HOW G;  4CJ2 C;  3S1M B;  2C9O A;  1IW7 D;  3R3O A;  2EY5 A;  4KN4 C;  2LMC B;  1LT3 D;  2O5I C;  1U0L A;  2YYZ A;  4K5X A;  2YTV A;  3NWT A;  1UE1 A;  1MHW C;  1V1O A;  2CQA A;  3FDT A;  4ZQ3 A;  2F4V Q;  3OW7 A;  1S5B D;  2X6L A;  1HH2 P;  2I07 B;  3PO2 G;  3CW2 C;  4JI7 Q;  2PZT A;  5DM6 3;  2Q2U A;  2WAQ B;  1EQT A;  2XGT A;  4DR2 L;  2IX1 A;  5M3F H;  1N36 Q;  4LF4 Q;  5NUC A;  4JI1 Q;  2DN8 A;  4L8J A;  3PO2 B;  2L1B A;  1WCM G;  3UDX A;  1EQV A;  1E7Z A;  1K8G A;  3S17 H;  1TY2 A;  1JOO A;  2PPB C;  2EQS A;  2VZA A;  1EY0 A;  2OXP A;  1XXG A;  3F1Z A;  2FXQ A;  1IBM L;  2E2H B;  1J5E L;  1ASZ A;  5IIF A;  2VQF Q;  1V8Q A;  2RF4 A;  4OEL B;  4NKL A;  5I6W A;  4L5T A;  1PTO C;  2EVB A;  1ML0 D;  4GLA C;  3HOZ H;  1FGB D;  2BOS A;  2ID0 A;  3MXG A;  3N6R A;  4X62 Q;  4MIU A;  1TVX A;  2RKS A;  3H91 A;  3T51 B;  3PUV A;  1HTL D;  1X6O A;  1JB3 A;  3BZC A;  4DK1 A;  1LYL A;  3RLF A;  2WB1 E;  1KDB A;  1WTR A;  3PO3 G;  2SDF A;  4A3L G;  3HRZ C;  5LMU L;  2L15 A;  4OWW B;  2Y0S B;  1PTO H;  5COY A;  3K58 A;  2DNC A;  3VR3 A;  4KHP L;  3SVM A;  4DR6 Q;  1DYQ A;  4BY7 G;  3GQB A;  1SYC A;  3C3L A;  4OX9 L;  4KV6 A;  1B53 A;  1R4P B;  2R3Z A;  5EPJ A;  1B50 A;  3GTP H;  5D3D A;  1CT1 D;  5ELD A;  3GTQ H;  2XWB B;  2HUG A;  2F52 A;  4A3G G;  1R4Q B;  4IFD H;  5JJK A;  1VQ5 A;  1TWG H;  1CQV A;  2JSO A;  3J7Z C;  1XPO A;  1DJR D;  3HOY H;  1STY A;  1PVO A;  1BCP C;  3S1R B;  3LWU A;  3F2B A;  3S15 B;  3TRE A;  1KL9 A;  1DON A;  4KI0 A;  3Q8D A;  1U4P A;  1U4L A;  3FP9 A;  4QUF A;  1XWE A;  4DF7 A;  1FNU A;  2D2C C;  5CBE E;  5KYL A;  3S2H B;  1NR2 A;  3KK7 A;  1Y14 B;  4DV3 L;  3I91 A;  1BVS A;  1SYD A;  5BN4 A;  3X3N A;  5IWA L;  3TN2 A;  1H9K A;  1HQM C;  4F7X A;  3G48 A;  3TP5 A;  5G3L F;  1O7L A;  1PXU A;  3D6C A;  1I4R A;  2KCC A;  2B2T A;  1OXX K;  4DR4 Q;  2A68 D;  3ONA B;  2O5J C;  3STB C;  1ONL A;  1EQQ A;  1K3B C;  2XIW A;  2ASB A;  4N9P A;  4GOP B;  2IY5 B;  5IGD A;  3S16 B;  3IFD A;  1JQY D;  4AQY L;  3HKZ E;  1N34 L;  4DAM A;  2WKD A;  1HJP A;  5K5P A;  2NUC A;  3DUZ A;  4IUP A;  4ZAI A;  4B3R Q;  4GNX B;  2EYJ A;  3H0G G;  4A3J B;  1F77 A;  3STB D;  1BXT A;  4IJL A;  4FF1 A;  1TR5 A;  1EEF D;  3R2I A;  1X56 A;  3EQL C;  3FKI H;  4G7H C;  3I4L A;  3CCU A;  5DEH A;  2B63 G;  1KHI A;  4JCV E;  3S1N B;  1NR4 A;  2DY7 A;  2O4X A;  2H5X A;  4QIW E;  5M3M G;  2MP1 A;  1ROD A;  1KAW A;  1CM9 A;  1VQJ A;  2B2Y C;  1LTT D;  1O80 A;  3SR1 A;  5LHY 1;  4J6H A;  4OGQ C;  3CQZ H;  1CA5 A;  2LY7 A;  2IWH A;  2K14 A;  4JV5 L;  3J7Y W;  3PIO 3;  1C7Y A;  4BA2 I;  1N33 Q;  2B3G A;  1SE3 A;  3ULJ A;  1F9Q A;  4HID A;  4DN4 M;  2KBN A;  1XTD A;  1KNA A;  4NW2 A;  2DJG C;  2P5Z X;  2K5D A;  3RMH A;  2JA6 G;  3GTO B;  4A4I A;  2ALY B;  5BN3 A;  5JEA J;  4QMG A;  3PF5 A;  4DAY B;  4FVM A;  4MZ9 A;  4YWM A;  2ZT9 C;  1H9M A;  4WRD A;  1L1O B;  4QB4 A;  3H09 A;  2KQ3 A;  2OQ0 A;  5CV7 A;  1SJH D;  3RZO H;  2A8V A;  1HTP A;  1TS4 A;  4RWS C;  1J9O A;  4LUO A;  1PZJ D;  3M85 A;  1Q1E A;  3S2H H;  5FLX E;  1C4Q A;  1B4O A;  4GN5 A;  3CCM A;  4ID6 A;  1HA5 A;  3HOX H;  1A6X A;  1VQA A;  5ELN A;  2D9U A;  4BBR B;  4UPA A;  2MO1 A;  2ZXR A;  1A0I A;  3L0O A;  2KCT A;  3RZD H;  4BBS G;  4XQJ A;  4XQQ A;  1S40 A;  4RKB A;  1VQM A;  4JOI C;  5CYU A;  2BCO A;  1I6H H;  3H0G B;  1PH8 A;  2JEB I;  4IQZ A;  5HUR A;  5KGU A;  3I70 A;  1VQE A;  2DJF C;  2PW7 A;  1Z47 A;  5EKL A;  3GTJ H;  1AFP A;  1B7Y B;  3QG1 A;  4FP5 D;  4CHT B;  4LFB L;  2NVQ B;  1YJN A;  3H6M A;  4IAL A;  2RVL A;  1GJX A;  4GS3 A;  3L3O C;  1CA6 A;  1KDA A;  3LWE A;  2F4I A;  4P72 A;  1SR3 A;  5L37 A;  4EQ5 A;  2HDM A;  2K33 A;  5KNB A;  2B8F A;  1EIF A;  2UXD Q;  3C2P A;  2KHI A;  2JA8 G;  3I7F A;  2PNH A;  1A3T A;  2YTY A;  1EFW A;  1VQ7 A;  1I4G A;  2ENB A;  4H44 C;  1E1O A;  1Q12 A;  4OWT B;  3KF6 B;  1D5Z C;  5I4D A;  1YBY A;  1I94 Q;  2NYZ D;  5JEA H;  2UUA Q;  5AFW A;  5C3W A;  2D0P A;  3BYT B;  1JE5 A;  4K6L A;  1SFO H;  1IBK L;  1TWA H;  3PGZ A;  1H9J A;  3T1Y L;  3KJO A;  3DEO A;  1M90 C;  1D5M C;  1SE4 A;  1B3A A;  2BE5 D;  1ENA A;  4A3M B;  4CJ1 B;  4MTK A;  4J1M A;  1WCM B;  3WWV A;  3Q0A A;  4JG2 A;  4LF8 L;  1SNQ A;  4K2K A;  1FL0 A;  4KHP Q;  3SXH A;  2LXK A;  3A8K E;  4GKK Q;  4PMW A;  3AFP A;  2FHT A;  1E2W A;  1QG7 A;  3D6W A;  3KLR A;  3HG9 A;  5M3M H;  2CWA A;  5CV4 A;  1IZ6 A;  5C0X G;  1RF2 D;  2Q2T A;  1ILQ A;  4FO2 A;  4IFD J;  3S16 H;  5C4X B;  1CZG A;  4CBV A;  1EYA A;  3EBE A;  4DR1 L;  1VQP A;  3CC4 A;  2PZU A;  1SRO A;  2SNM A;  1LTL A;  1WCM H;  3S9W A;  1OO9 B;  4ME3 A;  4HTH A;  4A3M H;  2JA5 G;  2F0H A;  3N52 A;  5IYD G;  1R9T H;  4LFC L;  3UDF A;  4JC0 A;  4HED A;  2EOT A;  2IX3 A;  2R93 H;  2RHS B;  5C44 H;  4IUN A;  1Q46 A;  2F0I A;  1UNS A;  4LF4 L;  1M1K C;  3KLW A;  1EYD A;  4OON A;  5M5X H;  1SNP A;  3E0J A;  4UP8 A;  5GAE C;  2TSS A;  2IL8 A;  1KNE A;  3HOW B;  4RA8 A;  3GTG B;  2K5H A;  4B9X A;  1EQR A;  4JYA Q;  2AUJ D;  1WJJ A;  4IN3 A;  4IUR A;  1EIY B;  4P71 A;  4PNY A;  1VQH A;  1P8L A;  4Q5V A;  1WYD A;  4K2L A;  5IOD A;  3K6O A;  4NB3 A;  1PRT D;  2EPB A;  1SYF A;  3PSI A;  5I2Y A;  4K0K L;  3E5S A;  3HOY G;  2OTL A;  2KCM A;  3CC2 A;  1MD2 D;  3OIP A;  4R1J A;  4H13 C;  3T4A C;  1TII D;  4POG A;  1LTS D;  5TSS A;  4DV3 Q;  1HNW Q;  1I4P A;  4DUZ Q;  3ULP A;  4OO1 G;  3L7Z C;  4DV2 L;  1ZEQ X;  1F2Y A;  4DV7 Q;  3J7A F;  3GV3 A;  3HOZ B;  1K9M C;  2R7D A;  1MGS A;  4ZUJ A;  1HZB A;  4B3T Q;  1NBW A;  4TKO B;  1JOR A;  1K3R A;  4LF7 Q;  4R8I A;  5LL6 S;  1XMQ Q;  5KRU A;  1T5E A;  1SYB A;  4K14 A;  4PMC A;  4LNQ A;  2VS1 A;  3OYY A;  1IYU A;  4R4I A;  3OPO A;  4HCE A;  4KKS A;  2AQ2 B;  2QF7 A;  1IBL L;  4UDU C;  1V9P A;  4OL7 A;  1DD2 A;  1JOQ A;  3MXN A;  4POF A;  5CBA E;  5J39 A;  2X69 A;  4B3S Q;  4MNO A;  4JI5 Q;  1C9O A;  2HD3 A;  4MHE A;  2XNA C;  4EQN A;  1WTQ A;  4IPG A;  4QGU A;  4KN7 C;  3MVV A;  2JJQ A;  3EFX D;  3S2D B;  5FO9 B;  2BH2 A;  1QUQ B;  2OF1 A;  5AJ3 Q;  2YTX A;  5LMU Q;  4IUV A;  2F3V A;  3LNN A;  5A35 A;  3HS0 C;  4BY1 B;  3KLS X;  1I50 H;  1J8I A;  4TQU S;  1ICF B;  4DU9 A;  2BA0 A;  1CKN A;  1XNQ L;  4ZYS A;  1D6E C;  2UU9 Q;  4FNF A;  4DR3 L;  4KKU A;  1O7Y A;  4H0L C;  2EIF A;  5H1S E;  1HQR D;  1X9N A;  5CV8 A;  4H7B A;  4LUZ A;  3CRL C;  2O2L D;  2NVY H;  2NVT H;  4B9W A;  2R93 B;  5CV9 A;  2UXC L;  3CCR A;  4O42 A;  1VDZ A;  4K8I A;  2JQO A;  1X3P A;  2L5T A;  3DWP A;  1Q81 C;  4DR5 Q;  2PO4 A;  1PRT B;  1KC8 C;  4KY7 A;  4X3K A;  4CDC C;  2AUK A;  4QY7 A;  2JEA I;  4A3B H;  2K5W A;  4P73 A;  3A54 A;  5IGC A;  1C0A A;  4XQN A;  3EJI A;  4FXG C;  1A15 A;  4YCV A;  4DGZ A;  4IJH A;  4XIG S;  4DV7 L;  2CH4 A;  4KY6 A;  5T1G A;  1GHK A;  4QIW B;  2EJM A;  3QOJ A;  1BBW A;  4JI7 L;  1K0R A;  1W3S A;  4BBS H;  1JWS D;  1OTC A;  2JN4 A;  2PW5 A;  4GNX A;  2UUC L;  1TWC B;  1X3Q A;  2F0U A;  1JWU D;  2AQ1 B;  2KUM A;  1V43 A;  3WOE A;  2ZXP A;  1J6Q A;  1HPC A;  1E2V A;  2L11 A;  2NVY B;  5BR8 L;  1GUT A;  1XX8 A;  1Y1V G;  2A69 C;  1G2S A;  1PZI D;  2EDG A;  1QVF A;  4S3S A;  3JAM L;  4AH6 A;  1HNX L;  3AFQ A;  4JYA L;  3ERO A;  4JI8 Q;  1QJO A;  3OMG A;  3V05 A;  1EY4 A;  3I56 A;  5M5Y H;  4JI6 L;  2N78 A;  1UE7 A;  1Y8N B;  1D7Q A;  2UUC Q;  3GO5 A;  5D3I B;  4YWK A;  2RSO A;  3NEL A;  3NUC A;  1NJI C;  4DV5 L;  5IGE A;  2EXD A;  2F3I A;  2IHE A;  1AZQ A;  1LO5 D;  1S4Z A;  3QR8 A;  3NK9 A;  2R7Z B;  4YCU A;  4CKB A;  1PYB A;  2A19 A;  2QEJ C;  3ND8 A;  2WFW A;  3A55 A;  1BR9 A;  2B2T C;  2VL6 A;  2R93 G;  3UI2 A;  1B2T A;  2LKV A;  1CKM A;  1Q1B A;  1CSP A;  5D65 A;  1Y8O B;  4RH6 A;  2CWP A;  5IT9 E;  3M4O H;  2NB0 A;  2I46 A;  5FKA C;  3I4N H;  4DV0 Q;  5C3E H;  1JIC A;  1EY7 A;  3VR4 A;  5FLX c;  5IGG A;  4GOP C;  5JEA G;  4DK6 C;  1GKH A;  1DXM A;  1QVC A;  1IKL A;  3URY A;  1CTM A;  1EY5 A;  4DV1 Q;  1PFN A;  3HOU G;  4DR3 Q;  2F0T A;  4ZKB B;  5JJI A;  2EYF A;  2R7F A;  4X64 L;  1QZH A;  1L1O C;  4C56 C;  1U5K A;  1M8A A;  1EIH A;  3I4M G;  2N8N A;  1IYV A;  1PH6 A;  3VDY A;  4J8Q A;  4IPD A;  3PUW A;  2WKC A;  3ZJY C;  1EWI A;  1HFN A;  4JVZ A;  1BBU A;  4A3D B;  3UE0 A;  4BXX H;  1ET9 A;  1VQ9 A;  1GUG A;  3CPF A;  2GVA A;  1KLU D;  5HY6 A;  3QO2 A;  4DV1 L;  3I4M B;  4X66 Q;  4JI4 L;  3AMU A;  4OO1 I;  4JI5 L;  4DNR B;  2MPM A;  4IOA A;  1LTI D;  3P7J A;  1IBL Q;  3M7N A;  4F88 A;  1DZ1 A;  4R4Q A;  1L0W A;  1HUN A;  3KDF A;  4LFA L;  4C3J G;  5J3B A;  1T9H A;  3H3V I;  1U4M A;  3BZD B;  4NP5 A;  4DK3 C;  1PMR A;  1SE2 A;  1TWF B;  1I6H B;  4WOR A;  1KQS A;  2E2I H;  2RA4 A;  2PQA A;  3G6J B;  2D0O A;  4B3T L;  1I94 L;  2OTJ A;  3EIV A;  1PHJ A;  1IKM A;  1FJG L;  1IL2 A;  2F0D A;  2KVM A;  5C44 B;  2I5M X;  3AYH B;  4U68 A;  4BXX G;  1S5F D;  3VR5 A;  2VQE L;  1E0B A;  4ULL A;  1V1P A;  4I65 A;  2KA7 A;  2VUM B;  2B2V C;  4HMI A;  1O7Z A;  3MHB A;  1YEZ A;  2H4O A;  4LF9 Q;  4GN3 B;  2MNA A;  1AH9 A;  1SNO A;  1HNX Q;  2F0F A;  1LT5 D;  5C3E G;  1I50 B;  4ZRZ A;  4AYB G;  1PDQ A;  2ZM6 L;  1F2M A;  2I0Q A;  1QE6 A;  2OWO A;  5M5Y B;  3M3Y H;  1KTK A;  5JVH 3;  4X3T A;  2UXB L;  2JYO A;  4DK0 A;  1Y1V B;  1SNM A;  4YIJ A;  3I3C A;  2XWJ B;  3P75 A;  4QL5 A;  4WFN 3;  1S72 A;  2R7Z G;  5JOB A;  5HGT A;  3BU2 A;  2L55 A;  1GVP A;  2R92 G;  2E5L Q;  1GO3 E;  4XYQ A;  1QNK A;  4A3K H;  4X65 L;  1BDO A;  2UUB Q;  2A6H D;  3U4Z A;  1FNV A;  1ICW A;  1WOC A;  2B63 H;  2I5L X;  1JJ2 A;  4JBK A;  2HDL A;  2BDN A;  1K83 B;  4K8J A;  4A3I H;  1DCZ A;  1PH7 A;  3JAM c;  1X3F A;  4LF6 Q;  2EYP A;  3KF6 A;  3OOC A;  3MFG A;  1D1I A;  3J80 E;  2F0Q A;  1VQO A;  1BNZ A;  4DR5 L;  1FVI A;  3T16 A;  4LFC Q;  2EE1 A;  2RBM A;  3PUZ A;  1SMY D;  5M3F B;  3FRP B;  1EYG A;  2Z6K A;  1PH9 A;  4RHS A;  2JA5 H;  2MQH A;  5DNF A;  1IYJ B;  5IGB A;  4HIO A;  1PA6 A;  4I7Z C;  3SGI A;  5M3F G;  2EZV A;  1XNQ Q;  2KEN A;  4CDD C;  3G71 A;  2PQA B;  2K04 A;  4CDE C;  1KRS A;  1SJE D;  4KLK A;  5IE8 A;  3D3R A;  3ERS X;  3NWS A;  4Q0F A;  5C4X G;  1SND A;  3D0F A;  2DY8 A;  4HIK A;  3Q24 A;  2KCN A;  1B9M A;  4HAE A;  2OT2 A;  2MHV A;  1Q8K A;  4GKK L;  1CUK A;  2NTT A;  5J1Z A;  1NAP A;  4LF8 Q;  4B3S L;  2LSS A;  3HOW H;  1EOT A;  1RKN A;  2F0K A;  4A3J G;  4PZ6 A;  3OMC A;  4B08 A;  5GAD C;  4IO9 A;  1RIP A;  5M9O A;  2JA5 B;  1OXT A;  1LTG D;  4EX5 A;  3MTS A;  4X3S A;  1XJV A;  2E5L L;  4DUY L;  1JCK B;  3FPU B;  5LMN Q;  1ILP A;  1H95 A;  2ZJR A;  3CKI B;  4LF7 L;  1PFB A;  3W1B A;  2PI2 E;  3K5O A;  4OXP A;  5G3L D;  3T56 B;  1KXL A;  2UXB Q;  2MO0 A;  3IRB A;  1W6J A;  1HA6 A;  4Z9C B;  3ITP A;  3E6Z X;  3QJY A;  4UAI A;  3KJP A;  1WFQ A;  2NZO A;  4DV2 Q;  4C3J B;  5EKK A;  5IP7 G;  3GTQ B;  2NVQ H;  1WI5 A;  4V19 0;  1EOV A;  1ZYR D;  3T53 B;  3WDN A;  3NXW A;  3PIP 3;  1BOS A;  1Y1W B;  2E75 C;  4X6A H;  1E24 A;  3MA2 B;  2BDO A;  1H9S A;  3ZYY X;  1G8Z D;  4PQX A;  3K81 C;  3KF8 B;  5HGQ A;  1SAP A;  2PMZ B;  3TBI B;  3CU7 A;  1YIT A;  2Q2H A;  2G9D A;  1QNU A;  2QIL A;  2GN5 A;  1C8C A;  5C4H A;  3VYR A;  1QB5 D;  2D5D A;  1QOH A;  3AU7 A;  3GD7 A;  3NPP A;  5KEE A;  2YU9 B;  1K28 A;  1EEI D;  1PTO F;  5M5W H;  4ODG A;  5COR A;  3MWY W;  1G29 1;  3BVM A;  4AIM A;  5JAV A;  5C3X A;  4A76 A;  4DR6 L;  2E2I B;  4JI3 Q;  5IYB H;  1UE6 A;  3K5M A;  1AW7 A;  3J81 c;  1AE2 A;  3OW2 A;  1JMC A;  4HMJ A;  2E2J H;  1HZC A;  2EYM A;  1A3U A;  2RDH A;  5GRO A;  2EY2 A;  2NBF A;  1QWY A;  1STH A;  1VQI A;  4JOI A;  4UP9 A;  4L6T B;  1GUW A;  2EYO A;  1TKW B;  1EIG A;  1N33 L;  3CAM A;  2B39 A;  3I4N B;  4P2C B;  2VUM H;  3A8J E;  3FMC A;  3BS1 A;  3MXN B;  2JP1 A;  1UWV A;  3J80 L;  3FKI G;  3OIQ A;  2JA6 H;  1VQK A;  3S1M H;  3BZK A;  4OO1 H;  1VF7 A;  3X3M A;  4DV0 L;  1R9T B;  5D14 A;  4WJ3 M;  3M9B A;  4PZ7 A;  3PCO B;  2Q8T A;  3C1E A;  2R92 H;  1B8A A;  3A5U A;  3V2T A;  2RCF A;  5LL6 X;  1JOK A;  4HJ9 A;  3M4P A;  4LF6 L;  2CW0 D;  3GV6 A;  2HQL A;  3HP3 A;  1N36 L;  3OWF A;  4ZUI A;  5C4Z A;  4A3B G;  2QDL A;  4F87 A;  3PUY A;  4X65 Q;  2UUB L;  5I9P A;  4APV A;  2L12 A;  3M4Y A;  5ISR A;  1SLJ A;  3I4O A;  2EJG C;  3QOL A;  5A2Q E;  3S17 B;  3PV0 A;  4NXM L;  4JI6 Q;  1VCI A;  4RGT A;  1EY8 A;  4LAA A;  5CR3 A;  2UUA L;  4GKJ Q;  1CHQ D;  1XNR Q;  3E0E A;  1W2B A;  3CPW A;  3L2P A;  4KJN A;  3I2Z A;  2N88 A;  3K7A B;  3Q6S A;  5IYC G;  3DWQ A;  1CZW A;  3MFY A;  1X3G A;  2F0P A;  2N55 A;  2UXD L;  1LAB A;  1FGU A;  1RTO A;  1Y69 U;  4L5S A;  4CKC A;  4A3M G;  3W1G A;  2VQE Q;  2ATW A;  2K1B A;  2NVT B;  3DM1 A;  4R4C A;  2IHF A;  3TS0 A;  2Q8I B;  4CDF C;  4QUC A;  3VYS A;  3A8I E;  1FJG Q;  1IHZ A; 
#chains in the Genus database with same CATH homology
 5FJ8 G;  3GTP H;  1V43 A;  3UE1 A;  3B6Y A;  2IT1 A;  1J6Q A;  3GTQ H;  1JT8 A;  3KDF B;  2N3S A;  2F52 A;  1Z9F A;  5BR8 L;  2AWO A;  5FLM H;  3I55 A;  1PH1 A;  1VQL A;  2E2H H;  4DR1 Q;  3S1N H;  4A3G G;  1Y1V G;  1TWG H;  3J7Z C;  4HJ7 A;  1VQ5 A;  1XPO A;  1XMO L;  3HOY H;  1QVF A;  1PVO A;  4LUV A;  4AH6 A;  3F2B A;  1HNX L;  3AFQ A;  4LFA Q;  1X3E A;  3TRE A;  3S2D H;  3CCJ A;  1KL9 A;  4JI8 Q;  4JYA L;  2UXC Q;  1YHA A;  1YJW A;  3DM3 A;  3NEN A;  2K52 A;  4KI0 A;  3I56 A;  5M5Y H;  3GTG H;  3Q8D A;  4JI6 L;  2N78 A;  1ASY A;  1IBM Q;  5JJK A;  1UE7 A;  1D7Q A;  3FP9 A;  2UUC Q;  1YHB A;  1K73 C;  3GO5 A;  4YWK A;  4A3L H;  3TRZ A;  4L5R C;  3NEL A;  1Y14 B;  4JI3 L;  3CMA A;  4DV3 L;  1N32 L;  4DV6 Q;  1PH5 A;  1NJI C;  4DV5 L;  2ZJQ A;  3PIP A;  1BVS A;  2EXD A;  2F3I A;  2IHE A;  1Q82 C;  5IWA L;  3J7A 5;  4YCU A;  3G48 A;  1YNX A;  1PYB A;  5C44 G;  2A19 A;  4DR2 Q;  2WFW A;  3TEH B;  2VL6 A;  2R93 G;  4GLX A;  3K80 C;  1CKM A;  1OXX K;  1P16 A;  1Q1B A;  5LMN W;  4DV4 Q;  4DR4 Q;  3A74 A;  3T1Y Q;  3STB C;  2CCZ A;  4JV5 Q;  4B3R L;  1EQQ A;  1CSP A;  2F4V L;  2ASB A;  2CWP A;  1OXS C;  3D31 A;  4GOP B;  3M4O H;  2IY5 B;  2BH8 A;  3I4N H;  1A62 A;  4DV0 Q;  5C3E H;  5FLX c;  3HKZ E;  4LWC A;  4YWL A;  4AQY L;  5IP9 G;  1PH3 A;  1UE5 A;  4GOP C;  1IXR A;  4GOP A;  5JEA G;  1N34 L;  4DAM A;  4DK6 C;  2PMZ E;  1GKH A;  5IT9 c;  1HJP A;  3HKZ G;  1QVC A;  1VQC A;  4DV1 Q;  3HOU G;  4B3R Q;  3M4Q A;  4GNX B;  4DR3 Q;  5JJI A;  2WAQ G;  3H0G H;  3H0G G;  4DR4 L;  1CSQ A;  2R7F A;  4X64 L;  3STB D;  1KIX A;  3HOZ G;  1QZH A;  4IJL A;  1L1O C;  1U5K A;  2CFM A;  3I4M G;  2N8N A;  1MJE A;  1PH6 A;  3VDY A;  1X56 A;  2Y0S G;  3FKI H;  4IPD A;  3PUW A;  3CCU A;  2B63 G;  3ZJY C;  1EWI A;  1KHI A;  5C0X I;  3GTL H;  1BBU A;  4JCV E;  3TQY A;  4DV5 Q;  4LW1 A;  3UE0 A;  4DUZ L;  4BXX H;  1HNW L;  1VQ9 A;  2H5X A;  4QIW E;  4C3I H;  3CPF A;  5M3M G;  2GVA A;  5IP7 H;  5HY6 A;  4FDB A;  1KAW A;  4DV1 L;  3RN5 A;  4X66 Q;  4JI4 L;  1XPU A;  4OO1 I;  1VQJ A;  3HFZ B;  4BY1 G;  2OCE A;  4JI5 L;  4A93 G;  2IX0 A;  4O2D A;  4IOA A;  3CCV A;  1IBL Q;  1CKN B;  3M7N A;  4AQY Q;  1VS0 A;  3PO2 H;  2PI2 A;  4R4Q A;  3CQZ H;  1L0W A;  2VNU D;  2ZM6 Q;  3KDF A;  4KHZ A;  4LFA L;  5J3B A;  1T9H A;  3H3V I;  2Q2I A;  2K14 A;  2VY3 A;  4DK3 C;  4LF5 Q;  1L2F A;  5FJ8 H;  2K5V A;  1D8L A;  4MTN A;  2I5H A;  4A3C H;  4JV5 L;  1NMF A;  5BR8 Q;  5EAY A;  1C7Y A;  4BA2 I;  1N33 Q;  2B3G A;  3ULJ A;  4BY7 H;  4HID A;  2KBN A;  1XTD A;  1KRT A;  2BA1 A;  2PQA A;  2AHO B;  1KQS A;  2E2I H;  2D0O A;  4B3T L;  4A3J H;  1I94 L;  2OTJ A;  4PG3 A;  1V1Q A;  3EIV A;  1PHJ A;  4OX9 Q;  2JA6 G;  4A93 H;  1FJG L;  4JBJ A;  2XTI A;  4A4I A;  2ALY B;  3CXC A;  1IL2 A;  4R4O A;  3RLN A;  5JEA J;  3PF5 A;  2I5M X;  1SMX A;  3AYH B;  4DAY B;  3KFU A;  4BXX G;  1HR0 L;  4MZ9 A;  1X65 A;  4YWM A;  2VQE L;  4P74 A;  3K7U C;  4YY3 Q;  3DLL A;  1L1O B;  3MEF A;  3W5O A;  1XPR A;  2OQ0 A;  4JI0 Q;  1YEZ A;  4A3C G;  3RZO H;  5IYB G;  2Y0S E;  2A8V A;  3ICE A;  4TVA B;  4LF9 Q;  4GN3 B;  4IFD G;  2MNA A;  3M85 A;  4LUO A;  3T1H L;  1AE3 A;  3J81 j;  1HZA A;  1Q1E A;  1SN8 A;  3RLO A;  2HIX A;  3S2H H;  1AH9 A;  1HNX Q;  3ULL A;  4GN5 A;  5C0X J;  5GAG C;  3CCM A;  3HOX H;  1VQA A;  5E7N A;  5ELN A;  5C3E G;  1VQN A;  4UPA A;  2MO1 A;  3AQQ A;  4AYB G;  1A0I A;  3RN2 A;  4A3F H;  3L0O A;  2R7Z H;  2JE6 I;  1N9W A;  1PYS B;  1MJC A;  2ZM6 L;  2I0Q A;  2KCT A;  4JBM A;  2OWO A;  2JA9 A;  3RZD H;  4BBS G;  1S40 A;  2VQF L;  3M3Y H;  3S1Q H;  2UXB L;  3G6E A;  1VQM A;  2AWN A;  4JOI C;  2ZJP A;  3U50 C;  4DR7 L;  1I6H H;  5ELO A;  2HIV A;  1PH8 A;  4WJ4 A;  2JEB I;  4QL5 A;  1S72 A;  2R7Z G;  4JI4 Q;  3BU2 A;  1VQE A;  3GTJ H;  2NVX H;  1GVP A;  1Z47 A;  4A3E G;  2R92 G;  1O7I A;  1B7Y B;  2K75 A;  2E5L Q;  1GO3 E;  2RHQ B;  2D62 A;  4LFB L;  4A3K H;  1YJN A;  1I3Q H;  4X65 L;  2UUB Q;  4GS3 A;  3U4Z A;  1UEB A;  4P72 A;  2ZTE A;  1WOC A;  2B63 H;  2I5L X;  1SR3 A;  1JJ2 A;  4JI1 L;  4JBK A;  4A3I H;  4EQ5 A;  1PH7 A;  3S1R H;  3F2C A;  2C35 B;  3JAM c;  4IFD I;  1VQB A;  1EIF A;  2QA4 A;  1G51 A;  1X3F A;  4LF6 Q;  1TWH H;  2UXD Q;  3KF6 A;  2KHI A;  1G6P A;  2JA8 G;  1VQO A;  4RG1 A;  4X62 L;  4C2M H;  3CC7 A;  4DR5 L;  1FVI A;  2PNH A;  3I7F A;  2YTY A;  1EFW A;  1VQ7 A;  4LFC Q;  4A3I G;  3OTO L;  2A1A A;  1E1O A;  1Q12 A;  1TWF H;  4OWT B;  1X55 A;  3PO2 G;  2JK8 A;  3KF6 B;  3PUZ A;  5JJL A;  5IY0 A;  1YBY A;  1I94 Q;  4YCW A;  2K4K A;  1EYG A;  2Z6K A;  2UUA Q;  1NMG A;  2D0P A;  4J15 A;  1PH9 A;  1J5E Q;  1JE5 A;  2JA5 H;  4BA1 I;  4IOC A;  2MQH A;  2NN6 G;  4JI8 L;  1K8A C;  1IYJ B;  2JA7 G;  1SFO H;  1IBK L;  1TWA H;  3PGZ A;  1XMO Q;  3T1Y L;  1IBK Q;  3KJO A;  4BBR H;  4HIO A;  1PA6 A;  1LM0 A;  1M90 C;  1XMQ L;  4B3M Q;  3SGI A;  3HKS A;  5M3F G;  2HT1 A;  2NZH A;  3CD6 A;  1XNQ Q;  3A5Z B;  5K36 G;  2Z0S A;  2KEN A;  3UDG A;  2R6G A;  4BBR G;  1QUQ A;  3G71 A;  4LF9 L;  3PF4 A;  4H02 A;  4PZ8 A;  2PQA B;  2NN6 I;  1KRS A;  3J81 i;  4KLK A;  5IWA Q;  4DPG A;  5IE8 A;  4A3D G;  3ERS X;  3CCE A;  3WWV A;  1EUJ A;  3JC6 6;  4JG2 A;  3F8T A;  2OQK A;  3D0F A;  4HIK A;  4LF8 L;  3AEV A;  5C4X G;  5GQO A;  1FL0 A;  4KHP Q;  4GKK Q;  2LXK A;  4PMW A;  3AFP A;  1Q8K A;  4GKK L;  1CUK A;  2VUM G;  3NBH B;  1VQD A;  4L5Q A;  3HOV G;  1GD7 A;  4LF8 Q;  3CP0 A;  5IYC H;  4B3S L;  2LSS A;  3HOW H;  5M3M H;  4HJ5 A;  2CWA A;  4A3J G;  4PZ6 A;  1IZ6 A;  5GAD C;  5C0X G;  4IO9 A;  1RIP A;  4K0K Q;  1OXT A;  2GVB A;  1Y1V H;  5C4J H;  4EX5 A;  2Q2T A;  4IFD J;  4JI2 L;  4LFB Q;  4OWX B;  1XJV A;  3S16 H;  2E5L L;  3BJU A;  2RCN A;  4DUY L;  5GAH C;  3S15 H;  3GDE A;  4YHH Q;  1B70 B;  2JA8 H;  5LMN Q;  3EBE A;  4DR1 L;  4P75 A;  1VQP A;  1H95 A;  1JJG A;  2ZJR A;  2HHH L;  2YU9 H;  4LF7 L;  3CC4 A;  3W1B A;  1SRO A;  2PI2 E;  4UP7 A;  4OXP A;  5IP9 H;  1KXL A;  2UXB Q;  1E3P A;  2MO0 A;  3IRB A;  3GTO H;  1LTL A;  3I4N G;  1WCM H;  3K7A H;  2WB1 G;  3H3V H;  1VQG A;  4C3J H;  4ME3 A;  1PFS A;  3EN2 A;  1BKB A;  3KJP A;  1I5F A;  4X66 L;  1DGS A;  1TWC H;  1WFQ A;  2NZO A;  3CME A;  4DV2 Q;  4A3M H;  4A3K G;  5IYD G;  5IP7 G;  2JA5 G;  1R9T H;  4LFC L;  3U4V A;  3UDF A;  4DV4 L;  4JC0 A;  2NVQ H;  2R93 H;  1WI5 A;  4O0A A;  1A8V A;  1EOV A;  2RHS B;  5C44 H;  3GTK H;  1Q46 A;  4JI0 L;  4LF4 L;  1M1K C;  2LXJ A;  3KLW A;  5IYD H;  4YY3 L;  4X6A H;  1RL2 A;  1E24 A;  4OON A;  5M5X H;  2DGY A;  4RMF A;  4X64 Q;  1HR0 Q;  4UP8 A;  1E22 A;  2ZTD A;  1VQ4 A;  3JAM i;  1Y1W H;  5GAE C;  4DKA C;  1HNZ Q;  3K81 C;  3S24 A;  3KF8 B;  5HGQ A;  1QVG A;  4GNX C;  1VQ8 A;  2Z6K C;  4DR7 Q;  2K5H A;  2B29 A;  4NXN L;  4QJF A;  1EQR A;  1GM5 A;  1OXU A;  1YIT A;  2Q2H A;  4NXN Q;  3LGJ A;  2K5N A;  1JB7 A;  3TS2 A;  4NPS A;  1PV4 A;  2HHH Q;  3PO3 H;  1VQF A;  4JYA Q;  3PIO A;  2GN5 A;  1YVC A;  2V1C C;  1NTG A;  4HJ8 A;  1HNZ L;  1WJJ A;  1EIY B;  2UU9 L;  2K50 A;  4P71 A;  1VQH A;  1X54 A;  1P8L A;  3E9I A;  2E8G A;  2CQO A;  1WYD A;  3T1H Q;  3HOV H;  3GD7 A;  1PH2 A;  2ZTC A;  3G4S A;  3PSI A;  4NB3 A;  4A3F G;  4QQB X;  4K0K L;  1Q7Y C;  1QZG A;  2OTL A;  2QEX A;  3HOY G;  2KCM A;  1E1T A;  3CC2 A;  4R1J A;  5DLQ E;  5M5W H;  5FLM G;  4ALP A;  3KOJ A;  3FHW A;  1HR0 W;  1G29 1;  2MFI A;  5AJ3 L;  4AIM A;  4POG A;  4HIM A;  1YZ6 A;  3J80 c;  4A76 A;  4DR6 L;  4DV3 Q;  4JI3 Q;  5IYB H;  1UE6 A;  4R4T A;  3NEM A;  3J81 c;  1AE2 A;  2VW9 A;  2WP8 J;  4DUZ Q;  3OW2 A;  2N49 A;  3ULP A;  1JMC A;  2JA7 H;  3L7Z C;  4OO1 G;  4DV2 L;  2YV5 A;  2E2J H;  3PUX A;  4DV7 Q;  1HZC A;  1VQ6 A;  5GRO A;  4DNI A;  1A63 A;  3CCQ A;  1K9M C;  2R7D A;  1HZB A;  1PH4 A;  1VQI A;  3K0X A;  4JOI A;  4UP9 A;  4B3T Q;  4UY8 C;  1NBW A;  3CCS A;  3U58 A;  1KD1 C;  1K3R A;  1N32 Q;  1N33 L;  4LF7 Q;  1YIJ A;  3CAM A;  1XMQ Q;  1NE3 A;  2KHJ A;  4B3M L;  4LNQ A;  2VUM H;  3GTM H;  3KYH C;  2VS1 A;  4YHH L;  4LF5 L;  3A0J A;  1NY4 A;  3I4M H;  3RNU A;  4AYB E;  1K83 H;  3MXN B;  3OYY A;  4XTC S;  3J80 i;  4JI2 Q;  1XNR L;  3HOW G;  4R4I A;  1N34 Q;  1Q86 C;  1UWV A;  3F2D A;  3FKI G;  2JA6 H;  4A3D H;  2ES2 A;  1IBL L;  1VQK A;  1V9P A;  1U0L A;  3BZK A;  2YYZ A;  3ER0 A;  3S1M H;  4DV0 L;  2YTV A;  1LUZ A;  1UE1 A;  4POF A;  4B3S Q;  4MNO A;  4A3G H;  4WJ3 M;  4JI5 Q;  1C9O A;  2F4V Q;  1HH2 P;  3M9B A;  3PCO B;  4PZ7 A;  4IPH A;  4C3H H;  3CW2 C;  4A3E H;  1B8A A;  1Y1W G;  4JI7 Q;  4IPG A;  2R92 H;  4QGU A;  3A5U A;  4A75 A;  2JJQ A;  1MKH A;  1HNW Q;  2BH2 A;  1QUQ B;  2Q2U A;  4HJ9 A;  3M4P A;  5LMU Q;  5AJ3 Q;  2YTX A;  1L1O A;  2XGT A;  4DR2 L;  4BY1 H;  4LF6 L;  3CF5 A;  2IX1 A;  5M3F H;  3K8A A;  1N36 Q;  1JJC B;  2HQL A;  4LF4 Q;  1I50 H;  1N36 L;  4JI1 Q;  4HJA A;  3RR5 A;  4TQU S;  4A3B G;  2BA0 A;  1CKN A;  1XNQ L;  1WCM G;  3PUY A;  4X65 Q;  2UUB L;  1YI2 A;  3UDX A;  1N8R C;  1E7Z A;  3UDI A;  4APV A;  1YHQ A;  1K8G A;  3CCL A;  3S17 H;  2UU9 Q;  2QGQ A;  2EQS A;  2VZA A;  4DR3 L;  1SLJ A;  1OXV A;  3I4O A;  2EIF A;  4GN4 B;  5H1S E;  1X9N A;  3F1Z A;  2FXQ A;  1IBM L;  4GKJ L;  4LUZ A;  3PV0 A;  2NVY H;  4JBW A;  1J5E L;  1ASZ A;  1VCI A;  4JI6 Q;  4NXM L;  2NVT H;  2VQF Q;  4NXM Q;  2UUA L;  2AMC B;  1MIU A;  2RF4 A;  4GLV B;  3HOU H;  3H15 A;  2UXC L;  4GKJ Q;  3CCR A;  1YJ9 A;  4L5T A;  1XNR Q;  3E0E A;  4GLA C;  5LMN L;  1W2B A;  2JQO A;  3HOZ H;  3CPW A;  3OTO Q;  3L2P A;  4DUY Q;  3I2Z A;  2ID0 A;  1Q81 C;  2DUD A;  4DR5 Q;  5IYC G;  4X62 Q;  1KC8 C;  1S3O A;  1X3G A;  2UXD L;  1HZ9 A;  4QY7 A;  2JEA I;  3PUV A;  1FGU A;  4A3B H;  4P73 A;  1SE8 A;  1X6O A;  3BZC A;  1LYL A;  1C0A A;  3RLF A;  2WB1 E;  4L5S A;  3S14 H;  2AKW B;  2CKZ B;  4IPC A;  4YCV A;  5C4X H;  4IJH A;  1TXY A;  4XIG S;  4DV7 L;  4A3M G;  5LMU L;  3W1G A;  3PO3 G;  4A3L G;  2L15 A;  2VQE Q;  2ATW A;  4OWW B;  4DV6 L;  4Y52 H;  4R4C A;  1BBW A;  1SRU A;  4KHP L;  3E9H A;  3HOX G;  4JI7 L;  1K0R A;  2IHF A;  4DR6 Q;  1W3S A;  4BY7 G;  3TS0 A;  4BBS H;  1OTC A;  1FJG Q;  4GNX A;  2WAQ E;  4Y7N H;  2UUC L;  4OX9 L;  1CKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...