4JYAQ

Crystal structures of pseudouridinilated stop codons with asls
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Unusual base pairing during the decoding of a stop codon by the ribosome.
pubmed doi rcsb
total genus 20
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jyaQ00
1KIXA 1XJVA 2VL6A 3HKZE 2B63G 1XMQQ 4DR2L 1BVSA 2YTYA 4YHHQ 3AFQA 3U58A 1HNZQ 1Y1WH 5IT9c 1Q81C 1V43A 2I5HA 3FHWA 4A3IG 1IL2A 3PO3H 5IYBG 1JB7A 2UXDL 3CPFA 2ATWA 1K8GA 1QZGA 1E24A 3J7A5 2UXCL 2EQSA 3KF8B 3PUWA 2VZAA 3Q8DA 4JI1L 1VCIA 3I7FA 5C44G 3ULPA 3CD6A 2KHJA 4X62Q 2JA8H 2V1CC 5C0XJ 1XMQL 1IBMQ 2MO0A 5GAGC 2R7ZG 1UE1A 1WCMG 2B29A 4QIWE 4DV1Q 4JI0Q 1Y14B 1PH6A 1HNZL 1VQGA 3GTQH 1A0IA 4UY8C 1KC8C 4IPCA 4P74A 4GLXA 2NVYH 5M5XH 3S24A 4DR1L 4PZ8A 4A75A 1HNWL 4POGA 1WJJA 5M5YH 1W3SA 4GLAC 4YY3L 4L5SA 3TS2A 4L5RC 1X65A 1VQNA 2B3GA 1L2FA 1YI2A 1TXYA 4YWLA 3GTJH 4DKAC 4QGUA 4A3EH 4A3KH 1YJWA 1YJ9A 4JI7L 1IZ6A 4HJ8A 2I0QA 4JI0L 1PH4A 1H95A 4GNXC 3IRBA 5FJ8G 2UUBQ 1CKNB 4LF4Q 2NVQH 3F2CA 4BXXG 3T1YL 2N49A 5K36G 4A3LG 3HKSA 4OX9Q 3EIVA 1NJIC 2JA7H 2OTJA 4X65Q 1QVCA 1GVPA 2JE6I 1KD1C 3ER0A 2OQ0A 4BBRH 3KF6B 5M3FH 3W5OA 4JBWA 1IBKQ 1VQ9A 3F2DA 3S2DH 1Q86C 1TWGH 2NN6I 1Z47A 2KCTA 4LW1A 2PNHA 5IP9H 2UUBL 1XMOL 3BJUA 2ID0A 4B3TL 4JI3Q 4LF4L 5IE8A 3S2HH 3F1ZA 2MQHA 1VQEA 1S72A 1M90C 3A74A 4HIOA 4OX9L 5LMNQ 1N33Q 4X65L 1PA6A 2HIXA 1CKOA 1EWIA 5ELOA 4K0KL 1Q46A 4JCVE 2L15A 1Q1BA 3BZCA 2PI2A 4KHPL 3HOXG 1E3PA 3PUYA 3UDIA 1TWHH 2FXQA 3GDEA 1J5EQ 4C3JH 3T1HL 2DUDA 1Q1EA 4APVA 1UWVA 5IWAQ 1HJPA 4PG3A 3S14H 5LMNL 1N33L 3J81j 3PO2H 1CSPA 3CPWA 2F3IA 3EBEA 3A0JA 4DK6C 1K3RA 1KRSA 2CFMA 3UDFA 5LMUQ 3GTGH 3HOYH 1Q8KA 1PHJA 1FL0A 1G291 1N36L 4A3EG 1WI5A 2VY3A 3CXCA 3KDFB 4LUVA 1J5EL 4DR6L 1C0AA 2JEBI 1SE8A 1FGUA 3HFZB 2ZJRA 2OCEA 2ALYB 3E0EA 3PIOA 1I94L 4Y7NH 2ZM6L 3SGIA 2VQEQ 1VQ8A 4LF7L 3KYHC 5IYBH 4JI6Q 1YHBA 3ULJA 4NB3A 5LMUL 4QQBX 3OTOQ 3L7ZC 4IJHA 1YIJA 1IBLQ 4BBRG 2I5MX 3B6YA 4A3JG 3PV0A 2PQAA 1I5FA 5DLQE 1NMFA 1YVCA 3I56A 5IP9G 1E7ZA 1WCMH 2RHSB 1XPRA 3AYHB 4JBKA 2ZJQA 4IPDA 1WFQA 2WP8J 3PCOB 1YJNA 4LFCQ 3CC2A 1X9NA 2OWOA 5JJKA 2K14A 1N32Q 1L1OC 1P16A 2KHIA 2QGQA 1HNWQ 1UEBA 2A19A 5FJ8H 4XIGS 4AYBE 3FKIG 4DR2Q 2NN6G 1RIPA 1I6HH 1C9OA 1OXSC 4BXXH 2LXKA 3M4QA 5M3MG 4JI4L 2EXDA 4A3LH 4LFCL 3G4SA 3PO2G 1GKHA 1N32L 1JJGA 4R4TA 1B8AA 4JG2A 4TQUS 5C0XG 2VS1A 1A62A 1NBWA 4X66L 3W1BA 1EQQA 2E5LL 3PUZA 1KHIA 3OW2A 4LF6L 1QZHA 2IX0A 2C35B 2AKWB 1RL2A 2GVBA 3NBHB 3M85A 4DR1Q 1B70B 1KRTA 3STBC 2BA0A 3TEHB 3JC66 5FLXc 1CUKA 4YY3Q 1Q82C 2KBNA 4LF5L 4GS3A 3H3VH 2D62A 4AQYQ 4O2DA 3MEFA 2NVTH 1X56A 2R92G 1D8LA 3ERSX 4DV2Q 1NY4A 3HOXH 2OTLA 4QY7A 2D0OA 3AFPA 1VQ6A 4JI7Q 3G6EA 1Q12A 3G48A 3CCSA 2RHQB 1E1OA 1OXXK 1PYSB 4JOIA 5HY6A 3PIPA 1NE3A 1XPOA 1YEZA 1L1OB 4DR3Q 2Z6KC 3CCMA 3T1YQ 1XTDA 1Z9FA 1GD7A 3PUVA 1VQMA 1OTCA 1CKNA 2UUCL 4AQYL 4OO1I 3GD7A 5LMNW 3CMAA 4LF8L 3D0FA 1NTGA 3K7AH 4DV2L 3HOZH 1X3GA 1KXLA 2IY5B 1TWAH 4BBSG 1YHQA 2YV5A 1UE7A 3S1RH 4WJ4A 5JJIA 1Y1VG 3ULLA 2RCNA 3F8TA 1XMOQ 1PH8A 3KF6A 2K4KA 4DV5Q 4HIDA 4DR3L 4B3TQ 2VQFL 4IFDI 1TWCH 4LUZA 1EQRA 2Q2UA 1AE2A 1N8RC 3CCJA 3L0OA 3U4VA 2QEXA 4NXMQ 2WB1G 4JV5L 4EX5A 4K0KQ 1AE3A 3KLWA 4A3JH 5E7NA 4BA1I 3UDGA 4KHPQ 1PV4A 4B3SL 3CF5A 2MNAA 3GTMH 2ZJPA 4DV5L 1QVGA 2ZTDA 3T1HQ 1K73C 2K5HA 2BA1A 2KCMA 3S1MH 1SN8A 3RZOH 4TVAB 4IO9A 1HR0L 2JQOA 2JJQA 3CC7A 3GO5A 1P8LA 2UU9Q 1VQ5A 3MXNB 4NXML 2Q2HA 2WB1E 1CSQA 1M1KC 3I4OA 2LSSA 4HJ7A 3KOJA 1VQ4A 1PVOA 1N36Q 4JBJA 4GNXA 4PZ6A 4A3GH 3D31A 1NMGA 3PGZA 4DR6Q 1S3OA 2KENA 3FKIH 4YCUA 1HNXL 3HOVG 4NPSA 2R93G 5C4XH 1OXTA 4FDBA 5M3MH 4GOPC 4OWTB 1U5KA 1L0WA 1I94Q 1XNRQ 5AJ3L 2ZM6Q 3E9IA 4JI5L 2UU9L 3ICEA 4J15A 5GAHC 1FVIA 1U0LA 4LF7Q 2VNUD 1LM0A 1SR3A 4YWKA 3HOZG 2UXBQ 1VQIA 1Q7YC 2ES2A 2R7DA 4DR7Q 1VQHA 1X54A 4L5TA 4GKKL 2HIVA 3GTOH 1EFWA 1XNRL 2AHOB 2IHFA 4LWCA 2CKZB 3J81i 2E2IH 4DR5L 3RN2A 1IYJB 2I5LX 2OQKA 1VQLA 4GKJQ 1YZ6A 1EYGA 4BY1H 2R92H 3K80C 4OO1G 2UXBL 3H15A 3A5UA 2AWOA 4KLKA 3M4PA 1TWFH 3M3YH 4DR7L 4JYAQ 4KHZA 3STBD 4GN3B 1QUQB 2RF4A 2ZTEA 4JI4Q 3J7ZC 4HJ9A 4R4CA 3RZDH 4RG1A 4IFDG 4R4OA 1K0RA 4GKJL 3NENA 3CC4A 4HJAA 2UUAQ 3HOUH 1A63A 4X64Q 3HOWG 3M9BA 2WFWA 4B3MQ 4GOPB 4R4QA 3A5ZB 1UE5A 3DLLA 4BBSH 3J80i 2Q2TA 4X66Q 4A3GG 5BR8L 1Y1VH 4JYAL 4PZ7A 4IPGA 4RMFA 4MNOA 2E5LQ 4LF6Q 4LF9Q 4OWWB 3CQZH 1OXUA 2XGTA 5C4XG 4QL5A 5IYDH 2ASBA 4JI8Q 2NZOA 4A3CH 2UUAL 1YITA 5C4JH 4LF5Q 4DV4L 4X64L 1PH3A 4IFDJ 4B3ML 3H0GG 4BY7G 1JJCB 2Q2IA 3VDYA 1JMCA 4GN4B 3UE0A 4AH6A 4IOAA 2F4VQ 2EIFA 1PYBA 3PUXA 5IY0A 2YTXA 4NXNQ 2MFIA 4LF9L 2VUMG 5GADC 4DV0L 1HH2P 1HZBA 1PFSA 2AWNA 4YCVA 4R4IA 4IOCA 2JA5G 4JI8L 4DV3L 3RLNA 4O0AA 1XNQQ 1SROA 3CAMA 4DK3C 4JI2L 4XTCS 4LFAL 2MO1A 4R1JA 3GTLH 1YHAA 3RR5A 3J80c 2UUCQ 4YWMA 1GM5A 5IP7G 4LF8Q 4BY1G 1OXVA 4A3DG 4C3IH 3GTPH 2E2HH 4DAMA 2NVXH 4ME3A 2F4VL 1KL9A 2AMCB 2YYZA 4B3RQ 4NXNL 1SFOH 4DUYQ 3E9HA 3K7UC 3HOVH 2R93H 2PMZE 1A8VA 3RLFA 1O7IA 1SLJA 1XNQL 2VQFQ 1MJEA 1VQ7A 3I4NG 4DAYB 3I4MH 2VW9A 4A3MG 1WYDA 1B7YB 4DR4L 1W2BA 4JV5Q 1I3QH 1WOCA 3KJPA 4DV7Q 2HT1A 4B3RL 3I55A 1CKMA 5GQOA 1BBWA 5EAYA 4DUYL 3RNUA 4B3SQ 1N34Q 1PH7A 1E22A 2NZHA 1K83H 1X55A 5FLMH 4YHHL 3CCQA 2WAQG 1AH9A 4A3CG 1HR0Q 5C3EH 1T9HA 1N9WA 3KJOA 1BKBA 1V1QA 3CCEA 1GO3E 3L2PA 4P72A 1MIUA 2ZTCA 5ELNA 4C2MH 5IYCH 4DV7L 4HIKA 4A3BG 1DGSA 3F2BA 2HQLA 3PF4A 3G71A 1PH1A 3TRZA 1N34L 1HZAA 1LUZA 1VQJA 2LXJA 4GN5A 3S1NH 1VQDA 4X62L 1HNXQ 2Z6KA 3RLOA 1IBML 2WAQE 4UP9A 4DV1L 2N8NA 4H02A 1EUJA 1IXRA 3EN2A 1VS0A 2K5NA 4POFA 4GLVB 5AJ3Q 3RN5A 4JI5Q 2XTIA 2YTVA 3HOWH 4IPHA 4L5QA 2E8GA 4DNIA 3TQYA 3W1GA 2JA6G 3AEVA 2JK8A 2H5XA 2DGYA 4UP7A 4ALPA 4KI0A 3S16H 3S1QH 1YNXA 2F52A 3I2ZA 3CW2C 5JJLA 1KAWA 4GKKQ 1V9PA 3KDFA 1VQPA 1VQBA 1LYLA 4UP8A 1PH9A 1Y1WG 1LTLA 1HZ9A 4UPAA 4DR5Q 2A8VA 3I4MG 4A93H 5GAEC 1VQCA 2GVAA 3H0GH 5JEAG 1VQFA 4P71A 3TREA 4BY7H 2HHHQ 3FP9A 3PO3G 4LFBQ 1BBUA 5C0XI 1G51A 1KQSA 1IBKL 2VUMH 4DUZQ 1X3FA 4P75A 2JA5H 3M4OH 2JA8G 2K50A 5HGQA 1X6OA 4JI3L 1YBYA 5M5WH 5FLMG 5IYDG 3HOUG 1HZCA 2GN5A 4LUOA 4DV6Q 3U4ZA 5C3EG 3CCUA 3WWVA 1K9MC 3BU2A 4HIMA 5IP7H 1ASYA 2BH2A 3PSIA 1QUQA 3UE1A 4C3HH 2HHHL 2CQOA 2Y0SG 3JAMi 2QA4A 5IYCG 4A3DH 3LGJA 4A3FH 4LFBL 2JA9A 5JEAJ 3K0XA 4GNXB 1SRUA 3NEMA 1K8AC 4DUZL 5BR8Q 1R9TH 1ASZA 3K8AA 3ZJYC 3CCLA 1QVFA 4GOPA 3OYYA 2K75A 3BZKA 2CCZA 4A3KG 1FJGQ 2B63H 2CWPA 2R7FA 4DV6L 4YCWA 4MZ9A 3I4NH 2IHEA 5IWAL 4OONA 1XPUA 4A3MH 2R6GA 1UE6A 4A3IH 3CP0A 2Y0SE 3U50C 4DV4Q 1PH2A 3GTKH 1EIYB 2JA7G 1VQKA 4LNQA 1I50H 2N78A 1JE5A 3S15H 4A4IA 2Z0SA 1J6QA 3K81C 4QJFA 4HJ5A 4P73A 5C44H 5M3FG 1FJGL 3J81c 4DV0Q 1EOVA 3DM3A 2R7ZH 1JT8A 4DV3Q 4AYBG 1SMXA 3JAMc 3CCRA 5H1SE 1EIFA 2IX1A 4JI2Q 2A1AA 4LFAQ 2VQEL 4A93G 2CWAA 4BA2I 4WJ3M 4JI6L 2PQAB 4IJLA 4A3BH 4X6AH 5GROA 4PMWA 1VQOA 3OTOL 4MTNA 3AQQA 3TS0A 3NELA 1IBLL 2BH8A 4EQ5A 1PH5A 1X3EA 1D7QA 3KFUA 1JJ2A 3PF5A 4A76A 2K52A 3HKZG 1MKHA 3CMEA 4OWXB 2PI2E 3UDXA 4JOIC 5J3BA 2JEAI 2D0PA 2K5VA 1E1TA 3CCVA 4JC0A 2IT1A 1L1OA 1C7YA 1HR0W 3H3VI 4DR4Q 4AIMA 4DPGA 3S17H 4JBMA 4A3FG 2UXDQ 2JA6H 1G6PA 2YU9H 2E2JH 1MJCA 3HOYG 4Y52H 1VQAA 4OXPA 2UXCQ 3M7NA 1S40A 4JI1Q 2N3SA
chains in the Genus database with same CATH superfamily
1KIXA 3HKZE 1IKLA 1BVSA 3J80L 2F0SA 1Q81C 4X3TA 4K5XA 1V43A 3IL8A 5DEHA 3BYYB 3TN2A 1IL2A 5A2QE 2I07B 5T1IA 3SK8A 1E24A 3J7A5 3KF8B 1NSNS 3H6MA 3PUWA 4JI1L 1VCIA 4OEMB 4X62Q 2V1CC 5C0XJ 1XMQL 1JORA 1IBMQ 5GAGC 1GUSA 5IYDH 1EY8A 1WCMG 4DV1Q 3GTQH 1PH6A 1HNZL 1A0IA 1KC8C 3P75A 5M5XH 1W3SA 4GLAC 1VQNA 2K03A 2Z4IA 2X6LA 1YJWA 1WTXA 1YJ9A 4HJ8A 1V1PA 3E6ZX 1EY4A 2NVQH 3PQIA 4BXXG 2B2YC 2XRQD 1I6VC 4OX9Q 4XT3B 3C2PA 1GVPA 2JE6I 1EU4A 4UHVA 5M3FH 3P1HA 1Q86C 1JC7A 1TWGH 1BCPC 3RD4A 3BJUA 4B3TL 5L37A 3J7AV 1SYFA 3A74A 4I7AA 1K3BC 4X65L 1X3PA 1TWCB 2ENBA 1EWIA 2BDNA 2L15A 1A2TA 1CFMA 3HS0C 3HOXG 3R8BA 3PUYA 3TZUA 1M4VA 2FXQA 4C3JH 3T1HL 2DUDA 2FJ2A 4GZYC 2WIIB 3KBGA 3IFTA 3J81j 1CSPA 3RZOB 1ET9A 1K3RA 5IGFA 5LMUQ 3HOYH 3K6OA 5I9OA 3MZ5A 1G291 3CXCA 2K01A 1J5EL 1WTHA 4DR6L 2QW7A 2ZJRA 3HFZB 3BDCA 2ALYB 2O5JC 4IQZA 4IALA 3FKIB 1U9RA 3SGIA 5FLXE 5C4XB 1STBA 3KYHC 5IYBH 4JI6Q 3BG3A 1AEXA 4BBRG 1IKMA 4KK7A 2PQAA 2M9VA 3ERQA 1DD2A 1NMFA 5IP9G 1E7ZA 2RHSB 3ZYYX 2B8FA 4ZKCB 1R4PB 3P7JA 4KTAA 2D9UA 2PMZB 1YJNA 2JA5B 5JJKA 1N32Q 3DEPA 3K5MA 1CZWA 4KJNA 2KHIA 2QGQA 1UEBA 5FJ8H 3ONAB 5CC4A 2NN6G 1RIPA 2J7ZA 3G7LA 1E2WA 4ZK9B 3OMCA 4A3MB 5C0XG 2F03A 1NBWA 4KD4A 2XRSD 3SR1A 2HDLA 3PUZA 4H0LC 3OW2A 3GP7A 2IX3A 2K5QA 4FF3A 1RL2A 3CRKC 1O7ZA 1B70B 3STBC 3TEHB 2M00A 4AQYQ 4O2DA 1BCPD 2R92G 5C4JB 1SNMA 2D0OA 3AFPA 3G6EA 3G48A 3CCSA 5HY6A 1E1OA 5IT9L 3PIPA 1XPOA 1YEZA 1L1OB 3A8IE 3CCMA 1GD7A 1BCPF 1DCZA 5EBDA 1CKNA 3G6JB 2EYOA 4LF8L 3D0FA 1NTGA 3SK5A 1KXLA 2H4OA 1DJRD 2MPMA 1EOTA 1SYEA 1UE7A 2EYLA 2YV5A 3TP5A 1YHQA 3M7GA 3S17B 3GTPB 4B3TQ 4DR3L 4RGOS 3CU7A 2VQFL 5EQ0A 2RQXA 4IFDI 1TWCH 1SYGA 5EBCA 1WD1A 4DK1A 1SSOA 2QEXA 2WB1G 4CJ2C 3I4MB 4H13C 2X6GA 5ELFA 4A3JH 2EVBA 5E7NA 3UDGA 1STYA 2HUGA 1PV4A 4B3SL 3I90A 2RA4A 1H9SB 5I2XA 3T1HQ 1EL0A 3RZOH 1QILA 4IO9A 1EY5A 1HR0L 3GO5A 2UU9Q 4NKLA 1AN8A 1ET6A 3MFGA 2OEOA 5C3EB 1GOZA 4XQNA 3DM1A 4HJ7A 2EY5A 3KOJA 2CHBD 1PFBA 4GNXA 1BNZA 3D31A 4DR6Q 1S3OA 2KENA 3FKIH 4NPSA 5KGUA 5C4XH 1DOLA 4FDBA 3MHBA 3NUCA 4OWTB 1U5KA 3SVMA 5AJ3L 5A2QL 4J15A 5GAHC 1U0LA 1VMPA 4KD3A 2PO4A 4YWKA 1G91A 3W3AA 1VQIA 4IUVA 3NQIA 1Y8OB 4DR7Q 4TSSA 3S16B 4GKKL 3S1QB 1JOQA 5KNDA 3RUZA 1F2MA 1PZID 2L12A 2AHOB 2IHFA 2F0KA 3RN2A 1YZ6A 2UXBL 1CQVA 5LL6S 3H15A 1SNCA 4R9WA 1RD9D 3H0GB 1K8MA 4KY5A 3GQBA 3STBD 2VUMB 1EQTA 4HJ9A 4DN4M 3NWSA 3CC4A 4J8QA 1A63A 3HOWG 3DLLA 1ENCA 1UE5A 3J7AF 3QG1A 1F2YA 4HAEA 4BWGB 4DA2A 4XXEA 1MSGA 4OWWB 2XGTA 1EY7A 1KTKA 2PZUA 1EZ6A 1PRTF 2XIWA 4CJ0B 2QKIC 4L6TB 1TS3A 1EQVA 3L3OC 5C4JH 4QIWB 4DV4L 4KY6A 4IFDJ 2RSNA 4BY7G 2F4VQ 3GTKB 1PYBA 1I50B 2YTXA 4NXNQ 1PFSA 4YCVA 2QCPX 5I2YA 1BOSA 5IGDA 3RLNA 1TIID 1K8OA 1SROA 3F2UA 4ZLTF 3PIO3 4LFAL 1WCMB 4R1JA 1Y8PB 3RR5A 3J80c 4FYDA 4H7BA 4LF8Q 3T4AC 3VR2A 3EQLC 1OXVA 3U9OA 3GTPH 2NUCA 4ME3A 4B3RQ 4ZQ3A 3FDTA 3E9HA 2NTSA 3RLFA 5EPJA 3T53B 2AUKA 3MXPA 4N8FA 2VQFQ 5FLXL 1MJEA 5CV5A 1WTVA 3I4MH 1LT5D 4DR4L 4P2CB 3KK7A 1W2BA 4DV7Q 5EAYA 4B3SQ 3OWEB 2PNRC 2JA6B 4MIUA 1PH7A 5D3DA 1HQRD 3I8ZA 2WAQG 1T5XD 5DNFA 1AH9A 1SJHD 5C3EH 1HR0Q 3M4YA 1BKBA 3D8GA 3CCEA 3OIPA 4OO1H 3L2PA 1MIUA 2ZTCA 3NHHA 4C2MH 4A3BG 1BQQT 1DGSA 3F2BA 2EY2A 1GUNA 2F0DA 2PCFB 1HZAA 1LUZA 5C4HA 2LXJA 4GN5A 4IUQA 3HOXB 2MHVA 5AJ3Q 3OWFA 4RHSA 4POFA 2EYFA 2K5WA 2XTIA 4IPHA 4DF7A 4C3IG 1EYAA 2J4XA 3AEVA 2JK8A 2H5XA 2M2LA 2NWGA 4ALPA 3S16H 3S1QH 4ABNA 3J81E 4GKKQ 1SEBD 1VQBA 1LYLA 4A3KB 4UP8A 1PH9A 1Y1WG 4UPAA 1HZ9A 3DMUA 3H0GH 3PO3G 2FHTA 1QE6A 1G51A 5DM73 1QG7A 4PV1C 2L5TA 2KJXA 2VUMH 2SNSA 4BBRB 2JA8G 5KRUA 1X6OA 4XYOA 3S2DB 5CV8A 3HOUG 2GN5A 4LUOA 4DV6Q 2ZXRA 1ASYA 4AYBB 1FGBD 3PSIA 2BH2A 2HHHL 4A3DH 2CQOA 2QA4A 5IYCG 3LGJA 5JEAJ 3K0XA 4KKUA 3NEMA 1PMRA 1KAAA 1BO0A 3IAYA 2CW0C 3OMGA 3Q0AA 4OONA 2KEEA 1UE6A 3BZDB 3CP0A 4DV4Q 3GTKH 1EWHA 1EIYB 2JA7G 1I50H 2KQ3A 1EIGA 1J6QA 3K81C 4QMGA 3QOJA 1LLRD 2XWJB 3GTGB 1EOVA 4ULLA 4WRDA 4ZUIA 2PW5A 5IODA 2IX1A 1PTOC 4LFAQ 2WV6D 2VQEL 2CWAA 4BA2I 2PQAB 1DXMA 5GROA 3OTOL 3AQQA 3NELA 5IIFA 1F9RA 1IBLL 2BH8A 4MTKA 4EQ5A 1EY0A 3KFUA 1SNOA 4TKOB 1STNA 3UDXA 2K5VA 1E1TA 4JC0A 1C7YA 1L1OA 1HR0W 3H3VI 4C3HG 5HGTA 4DR4Q 2JA6H 1G6PA 1DZ1A 3M7NA 1S40A 1CQFA 2VL6A 1LTBD 3TSSA 2EZVA 5IT9c 2I5HA 3D4DA 2AQ3B 2A6EC 4PMCA 2UXDL 4QUFA 1B50A 1JB3A 2EQSA 3Q8DA 3CD6A 2WB1B 3DUZA 2KHJA 3E5SA 3NSWA 2MO0A 2SOBA 1H9SA 1Y14B 3QR8A 4DR1L 3S24A 4A75A 2HQEA 3HG9A 4YY3L 3TS2A 1G8ZD 1X65A 3BS1A 2B3GA 2HCCA 3MXUA 4YWLA 4A3KH 4PNYA 4ZKBB 2L1BA 2UUBQ 1CKNB 4LF4Q 5KNCA 2B2TA 3F2CA 3T1YL 2N49A 5K36G 4A3LG 4CJ1B 1HUNA 1NJIC 1NNXA 1SE2A 2CW0D 3ER0A 4BBRH 5JOBA 3W5OA 1VQ9A 3F2DA 3S2DH 4DXGA 2NN6I 1Z47A 2KCTA 5IP9H 1TWAB 1XMOL 2ID0A 5FOBB 3S2HH 1S72A 4E6IA 1I4RA 4Q0FA 4OX9L 1LTAD 3NP8A 1PRTB 2QDLA 5LMNQ 1PA6A 1N33Q 4Q5VA 2EJFC 1Q46A 3WOFA 1CI3M 2F0WA 2PI2A 3V96A 4KHPL 1G2TA 1E3PA 1KLUD 1PTOD 1SYDA 4APVA 1UWVA 4G7ZC 3MEHA 1PZJD 2XNAC 3DWQA 3A0JA 3GTGH 1PTOF 1LT4D 1F77A 3TZDA 2K7VA 1N36L 4J6HA 1F2LA 4A3EG 2F0NA 1CTMA 2JEBI 1PYWD 3AB9A 1SMYC 3E0EA 2VQEQ 4DU9A 2PQEA 4LF7L 1A6XA 5KEEA 1YHBA 3ULJA 5LMUL 4QQBX 1NUCA 3OTOQ 4IJHA 5J22A 1IBLQ 3B6YA 2EXZA 4BY7B 1YVCA 3KLSX 2EJMA 1HFNA 2A6ED 4QUCA 2AQ1B 3OIQA 4LFCQ 2R61A 4KN4C 2OWOA 2K14A 5JVH3 4ME5A 3KBXA 1XYIA 1A3UA 2A19A 4XIGS 4IUNA 3SXHA 1OXSC 3TBIB 3M4QA 2EE1A 5M3MG 1R9TB 1HPCA 2EXDA 4JI4L 2RVLA 5ISRA 3OW7A 1N32L 4RWSC 4R4TA 3MFYA 5FK9C 2VS1A 3EFXD 4RCNA 3W1BA 1KHIA 2ICIA 1QZHA 2IX0A 4X3SA 2SEBD 3M85A 4DR1Q 3JC66 5JAVA 5FLXc 4YY3Q 1Q82C 4LF5L 4V0BA 5FO9B 1NY4A 4QY7A 2RHQB 4K6DA 1LTID 1NE3A 4HTHA 2Z6KC 4K2KA 3T1YQ 1I4PA 1W6JA 3PUVA 1OTCA 4AQYL 5FO8B 5LMNW 4M8AA 3D6CA 2IY5B 1FR3A 1TWAH 4BBSG 5JJIA 4WJ4A 3QWNA 1Y1VG 2A6HC 4C3IB 2NVXB 1XMOQ 4HIDA 4G57A 4V190 1MGSA 1HA6A 3HOVB 5I4DA 1N8RC 3CCJA 2KECA 3U4VA 1J9OA 4EQNA 3X3MA 4JV5L 2EY1A 1Y1WB 1AE3A 4BA1I 2F0JA 1EIHA 1RODA 4LAAA 4KHPQ 2LS01 1I3QB 1SMYD 4UDUC 2ZJPA 5FKAC 2ZTDA 1B9MA 2K5HA 1SN8A 2V4DA 4IUPA 4TVAB 2VXWA 2JQOA 3CC7A 1IYUA 1P8LA 1K83B 1I4HA 1STAA 1T5EA 2A74C 1SJED 2LSSA 2RKSA 2NYZD 1VQ4A 1PVOA 1N36Q 5M5YB 1LABA 3PGZA 1NMGA 1ML0D 2FFKB 1HNXL 4ZYSA 5I6WA 2B2YA 2R93G 1OXTA 3T51B 2Z1CA 4GOPC 1L0WA 5IGCA 1XNRQ 4RGTA 2UU9L 1RTOA 2F0OA 4LF7Q 5ELBA 2JP1A 1LM0A 1D2BA 2ES2A 2R7DA 1O80A 2WKDA 1V1OA 3Q22A 3MC0B 1VQHA 1C8CA 1SYBA 1RKNA 2HIVA 2K1BA 3DWPA 4LWCA 2CKZB 1IYJB 2I5LX 2OQKA 4GKJQ 1DOKA 2G5DA 2NBFA 3A5UA 2AWOA 1II3A 3M4PA 2F0GA 1H9RA 4DR7L 3NBIA 4JI4Q 3ND9A 1DONA 4RG1A 3NE5B 5M5WB 4HJAA 2UUAQ 2F4IA 2BOSA 2WFWA 3AU7A 3A5ZB 4C3HB 2JSOA 4A3GG 4EQPA 4L8JA 4PZ7A 4IPGA 1B53A 3K5OA 4JI8Q 4KV6A 3D6WA 4PMBA 1YITA 4LF5Q 3I4NB 2A6HD 2Q2IA 3VDYA 1JMCA 1F9QA 4GN4B 4IOAA 3PUXA 5IY0A 3T16A 5E4WC 2IPKD 5GADC 1QOHA 3FRPB 4R4IA 1STHA 4O0AA 3VA5A 4TRDA 1XNQQ 1A3VA 4F87A 2MO1A 5IP7G 2RCFA 3K58A 4C3IH 2F4VL 2NVXH 3R3OA 2YYZA 4NXNL 4DUYQ 3K7UC 3HOVH 2PMZE 3KLSA 1DOMA 1O7IA 1R4QB 1CZGA 1PXUA 4S3SA 2VW9A 1NAPA 4FNFA 4JV5Q 3FEWX 1I3QH 2HT1A 4B3RL 1Q8IA 5GQOA 1WTOA 5KYLA 1E22A 2NZHA 1K83H 1S5ED 2Z4HA 3KJOA 1N9WA 1O7LA 2F0TA 5IGGA 2E76C 4DV7L 5IYCH 1I4QA 1PH1A 3TRZA 1F2ZA 1HNXQ 3QO2A 2LFNA 1EYDA 4RH6A 4UP9A 2HCIA 1EUJA 4I65A 4IFDH 1VS0A 5E1FA 4B9WA 2YTVA 1WTRA 2NVYB 2F3WA 2E8GA 5EGTA 3TQYA 4DNIA 5CR3A 5CV9A 4KI0A 5C4ZA 1PDQA 5C6AA 4KKTA 3MWYW 2OXPA 1TY0A 2DY8A 3JAME 4A3EB 2K5DA 1EEFD 4UAIA 3VA7A 3QJYA 1TT2A 4NMZA 2O5IC 3TREA 4JPBW 4LFBQ 1ZXTA 2PW7A 1BBUA 1JQYD 4QCLA 1KQSA 1WTQA 1IBKL 4DUZQ 1JE4A 2JYOA 1AFPA 2JA5H 2PZWA 4IZ8A 3K5NA 4JI3L 5M5WH 5IYDG 3U4ZA 1K9MC 3CCUA 1BUVT 4HIMA 2O2LD 4EGVA 4WFN3 4C3HH 2Y0SG 3JAMi 2N55A 1VDZA 2KUMA 2TSSA 3K8AA 3ZJYC 3CCLA 1SNQA 2CCZA 3D3RA 2CWPA 4DV6L 4YCWA 5CYUA 4DK0A 2IHEA 3ND8A 3I4NH 1NCVA 1XPUA 4A3MH 2R6GA 4CDFC 3OSOA 1PH2A 5EKIA 4LNQA 3S14B 3HGBA 1GUWA 4QJFA 4IUUA 5M3FG 2Z8LA 3J81c 1SYCA 3DM3A 5C5LA 2E2DC 2VB3X 3CCRA 4A93G 2K6AA 3KLRA 1HRJA 3WDNA 1D5XC 4PMWA 5C3XA 3TS0A 5JVG3 4ZUJA 4RCOA 1DYQA 1TS2A 3C3LA 1FD7D 1JJ2A 2K52A 1OO9B 3HKZG 3CMEA 1TWFB 2PI2E 2XSCA 4JOIC 1UAPA 5K36H 1Y8NB 2IT1A 3S17H 2WKCA 5JPNC 4A3FG 4JBMA 3TDQA 3HOYG 3QIAA 3NXWA 2LY7A 4OXPA 2UXCQ 2N3SA 1HNWL 5KYIA 2EPBA 1F9PA 1Z6HA 2B63G 4IURA 4DR2L 2YTYA 1Y69U 3AFQA 3Q23A 3NTKA 5JEAH 4A3IG 1I6HB 3FHWA 4FVMA 1D1IA 2P5ZX 2B2WC 1YNNC 5IYBG 1JB7A 3CPFA 1IYVA 2ATWA 5J39A 3ULPA 2VZAA 2FMCA 3I7FA 1XXGA 2AUJD 2B2VA 2KA7A 4FXGC 3C1EA 4F7XA 2R7ZG 4QIWE 4JI0Q 1VQGA 1FNVA 4IPCA 4P74A 4GLXA 2NVYH 1D6EC 2A68C 4PZ8A 4POGA 4L5SA 4JW0A 4DKAC 4QGUA 4A3EH 2DNCA 3AMUA 2J0TD 2NVTB 2I0QA 1PH4A 1EEID 1E0BA 3IRBA 5FJ8G 1STEA 1XX8A 3OOCA 4DGZA 5JPMC 1KD1C 3A7LA 3VR4A 1B4OA 2OQ0A 4JBWA 1IBKQ 3K7AB 4LW1A 2BCOA 3KUPA 2PNHA 2UUBL 4LF4L 4JI3Q 4HCSA 5IE8A 4RKBA 3F1ZA 2MQHA 1VQEA 4HIOA 1I4GA 4WORA 4CGYB 1LTGD 2HIXA 1CKOA 3TP8A 3BZCA 3UDIA 2CVRA 1KLGD 1G6ZA 1HJPA 2B8GA 3S14H 5LMNL 1N33L 4K8IA 1B2TA 2K04A 2F3IA 3EBEA 4DK6C 2H1EA 3C1FA 2CFMA 3OPOA 3Q6SA 1PFNA 3P20A 3H09A 2MP1A 1PHJA 1PZKD 2VY3A 1GJXA 3NPPA 2F0HA 4RFBA 1SE8A 4FP5D 4A3GB 2DJFC 1C4QA 3PIOA 1I94L 3A7AB 2ZM6L 3BDOA 1BCPB 3R2TA 3TP7A 4NB3A 4EQOA 2I5MX 4A3JG 3PV0A 3EROA 3Q24A 5IGBA 1WCMH 1HQMC 4CDEC 3AYHB 2ZJQA 4IPDA 1YNND 3I72A 2PZTA 3PCOB 3GTOB 1B3AA 2E2IB 3OHXC 3DXJC 1L1OC 2Q8TA 5J1ZA 3A56A 1EYCA 1P16A 2R92B 1HNWQ 1U4LA 1TVXA 4YIJA 3JAML 4AYBE 2A68D 2K05A 3FKIG 4DR2Q 1I6HH 4BXXH 1S5DD 1BR9A 2LXKA 1LO5D 2EYHA 4ZCKA 2MUYA 4KKSA 4LFCL 1B3QA 3G4SA 3PO2G 1TR5A 1SXTA 3H94A 3RZDB 1B8AA 4TQUS 4K5WA 1I4XA 1A62A 2F0MA 5KNBA 3NTIA 2Z6BA 4RGNA 2GVBA 3MAQA 3MTSA 1WVLA 3CQZB 1KRTA 3H3VH 1CUKA 3T13A 1CT1D 2D62A 2IJ0A 4BS9A 1MHWC 4R8IA 1SNDA 2NVTH 1X56A 1D8LA 4DV2Q 3HOXH 4C56C 1Q12A 1KDBA 2B2UA 3I70A 2D5DA 1Z9FA 4LK1C 1IW7C 2F0QA 3HP3A 2B2TC 1J8IA 5ELCA 4FO2A 3K7AH 3QOLA 1X3GA 2LMCB 4KY7A 4DAPA 1KNAA 5TSSA 3ULLA 2E2HB 2RCNA 3F8TA 3KF6A 4DV5Q 1SFOB 2E2JB 2F0UA 2B39A 4LUZA 5D14A 1DM0B 2Q2UA 1AE2A 3L0OA 1AW7A 5F2DA 4NXMQ 4IUTA 4EX5A 3KLWA 4EVOA 1JOOA 2MNAA 1QVGA 2BA1A 4ZRZA 2JJQA 5ELEA 4CDCC 1VQ5A 3MXNB 2WB1E 4M1UB 3I4OA 4OIKA 1UEAB 4OL7A 4A3GH 3H91A 4PZ6A 3SE0A 2F0LA 2QILA 3CKIB 2L4NA 4RGMA 2NN6H 4YCUA 4FF1A 4HN7A 2MGSA 3S1NB 3SK4A 1I94Q 2ZM6Q 3E9IA 1FNUA 3HZXA 2VNUD 1SR3A 2NVQB 5C0XH 3HOZG 2JN4A 4X3KA 3HOWB 1JOKA 3CHBD 2DN8A 1CA5A 2RBMA 3LWEA 2F0PA 4ILWA 1X54A 4L5TA 1S4ZA 3GTOH 1LTSD 1XNRL 1GHJA 2E2IH 4DR5L 1NR4A 2SNMA 1VQLA 2RDHA 2R92H 4OO1G 4A93B 3FMCA 4KLKA 3BDLA 4JYAQ 1L0YB 1KNEA 4KHZA 5CV7A 5I6YA 4F88A 2LKVA 1TS4A 3N6RA 1EU3A 2RF4A 5D65A 3J7ZC 3M4OB 4R4CA 3RZDH 1LTRD 4R4OA 3HKZB 4GKJL 3NENA 2DJGC 4X64Q 1EY6A 4B3MQ 2VB2X 2Q2TA 2EJGC 4KHVA 3A8KE 1QCBD 4A3FB 4MNOA 3VYUA 2IWHA 4LF9Q 3CQZH 1OXUA 1HHVA 1IW7D 1PFMA 2ASBA 2NZOA 4G4KA 5ELDA 2B63B 2UUAL 1PH3A 4KJOA 5CV6A 3H0GG 3QB3A 2Q8RE 1JJCB 3IFDA 3NBHA 4A3IB 3EJIA 4AH6A 4OIJA 2MFIA 2VUMG 1IHZA 2A69C 4DV0L 1HH2P 1HZBA 1JICA 4O1NA 4JI8L 1WTWA 3CAMA 4XTCS 2R7ZB 2WAQB 1YHAA 4YWMA 4BY1G 4DNRB 4A3DG 4CKEA 2E2HH 1KL9A 2AMCB 4A3BB 1SFOH 1JWMD 4RA8A 2F0IA 1A8VA 1ESFA 1XNQL 1X32A 1HUMA 1STGA 2WACA 4DAYB 1S5CD 1H9JA 3KJPA 1XWEA 3BVGA 1CKMA 1ILQA 1BBWA 4DUYL 2O4XA 3RNUA 2KCNA 1N34Q 2KOLA 4YHHL 3CCQA 4A3CG 4LMQD 1V1QA 1GO3E 2F1MA 1ILPA 4P72A 3PF4A 3G71A 3PO3B 1SAPA 5CGKA 1VQJA 5CORA 3S1NH 1VQDA 2Z6KA 1TKWB 5FO7B 2RDGA 2WAQE 2EYMA 3BVMA 4H02A 2JA8B 4KMUC 3EN2A 1S5BD 3VR6A 1HTLD 3RN5A 3NQTA 3HOUB 3HOWH 1NR2A 3TMEA 2JA6G 2F52A 1KAWA 5EPKA 1VF5C 3PIP3 1UNSA 1V9PA 1VQPA 3GTJB 3LWUA 1E2VA 4DR5Q 2A8VA 4A93H 4BY7H 1B9NA 1PLFA 3FP9A 4NW2A 4RKLA 2JA7B 2NTTA 4OHJA 1EZ8A 2XN9C 3M4OH 4A3JB 1YBYA 5FLMG 3E3XA 1G2SA 1Q90A 3WWVA 3VYSA 4CKBA 1QUQA 3UE1A 4LFBL 4ID6A 2OF1A 4A3FH 2A69D 2R3ZA 3FVQA 1ZKOA 4H44C 1K8AC 4DUZL 4DFAA 5A35A 1R9TH 1QVFA 4GOPA 3OYYA 1FJGQ 3A55A 4A3KG 2B63H 2D2CC 2R7FA 5C3WA 5IWAL 1TWHB 1U4RA 4A3IH 2FINB 1X3QA 1JE5A 2Z0SA 3PO2B 3K0YA 3RMHA 4DV0Q 4MN3A 4XYQA 2R7ZH 3EA6A 4DXFA 4K6LA 5C5MA 1JT8A 3GV3A 2BE5C 4AYBG 3JAMc 1BDOA 5H1SE 1EIFA 3R93A 2A1AA 1B44D 1ENFA 2GA4B 3LX0A 4WJ3M 3HRZC 4IJLA 4A3BH 4X6AH 1VQOA 4Y7NB 4MTNA 4L63B 5DAUA 2KEDA 1PH5A 2IL8A 2F0FA 1X3EA 1D7QA 1BF4A 1SE4A 4A76A 1MKHA 5CBAE 5K5PA 5J3BA 2JEAI 1KABA 3R2IA 4DPGA 4FXKC 1GUGA 1H9KA 3TP6A 2F0VA 3GV6A 1KDAA 3I73A 4Y52H 1VQAA 2SDFA 4JI1Q 1XJVA 1XMQQ 4YHHQ 3U58A 4MHEA 1HNZQ 1Y1WH 2X69A 1RJTA 3PO3H 1K8GA 1B1ZA 1QZGA 2UXCL 1PTOB 5C44G 2KHSA 1PRTC 2JA8H 1AP0A 2E75C 1WTPA 1UE1A 3HOUH 2B29A 4UY8C 5EKKA 2F3VA 1WJJA 5M5YH 1M8AA 2HDMA 4L5RC 1QNKA 3MXNA 1L2FA 1YI2A 3W2DA 1TXYA 3GTJH 4JI7L 1IZ6A 1BBXC 4JI0L 1H95A 4GNXC 2EYJA 4C1NK 3HKSA 4X3UA 1TU2B 3EIVA 2JA7H 2OTJA 4X65Q 1QVCA 4R8NA 3NK9A 3K57A 3KF6B 1F9SA 5DM63 3HOZB 2PYKA 3NTHA 3S1RB 1RHPA 4RHRA 4DNTB 1KDCA 1M90C 1TQOA 1ICFB 1QWYA 3T56B 4FXDA 5ELOA 4K0KL 4JCVE 3BYTB 3ITPA 1Q1BA 2BE5D 4C2MB 1TWHH 3GDEA 3VYTA 1J5EQ 3V05A 3GTMB 1Q1EA 5IOCA 5IWAQ 4PG3A 5G3LD 1HA5A 3S1MB 3PO2H 3CRLC 3CPWA 3UI2A 1KRSA 3UDFA 3DEOA 4K2LA 4K14A 1RTNA 1Q8KA 1FL0A 2ZXOA 1WI5A 3KDFB 4LUVA 5G3LF 3X3NA 2L9HA 1C0AA 4G7HC 1FGUA 2OCEA 2A5HA 5T1GA 4Y7NH 1VQ8A 5M3MB 4CBVA 4N9TA 5E4XA 3L7ZC 1YIJA 4F8MA 5DLQE 1I5FA 4U673 2WINB 3I56A 1XPRA 4WJWA 4JBKA 3A8JE 1WFQA 4NP5A 2WP8J 3BVZA 4LJZC 1IL8A 1TY2A 5EKLA 3CC2A 2QF7A 1X9NA 1PRTD 3VR3A 2EOTA 3S9WA 2C5CA 4BY1B 4A3DB 3SHLA 3SK6A 4C3JG 3M3YB 1C9OA 2XWBB 1HXYD 4A3LH 3MA2B 5BN4A 3FPPA 1YNJC 1GKHA 1PTOH 3I3CA 4DAYA 1JJGA 4JG2A 2MJ8A 4X66L 1EQQA 1AZQA 2E5LL 4BBSB 4LF6L 4C1NI 3KF8A 1Y1VB 2C35B 2AKWB 1LV9A 2B2VC 3NBHB 3MVVA 2BA0A 5COYA 2KBNA 4GS3A 3MEFA 3K5LA 1WD0A 3ERSX 2OTLA 1VMCA 2EYPA 1VQ6A 4JI7Q 4IN3A 1JR0D 4NDXA 1OXXK 1PYSB 2G9HD 4JOIA 4DR3Q 1XTCD 1XTDA 4KN7C 2PPBC 1VQMA 2UUCL 4OO1I 3GD7A 2Z9HA 3CMAA 2CH4A 3E0JA 4DV2L 3GTLB 3HOZH 4JK1C 3S1RH 2K33A 3K59A 4N8X1 1PH8A 2K4KA 1ZYRC 4HSPA 5CMDA 2R93B 1EQRA 2B2WA 1U4MA 4HEDA 4JVZA 5D3IB 4XQQA 3DHQA 5I9PA 2EDGA 4K0KQ 2ICEC 3CF5A 3GTMH 1A2UA 3U9SA 4DV5L 1K73C 5HURA 2KCMA 1LT3D 3S1MH 1HFGA 1SBBB 4NXML 2Q2HA 2KCCA 1EY9A 2DNEA 1CSQA 1M1KC 1CHPD 1V1PB 3HOVG 5M3MH 4FF4A 4U68A 2RDFA 5E3FA 4JI5L 3ICEA 1FVIA 4HR7B 3WOEA 2K32A 2UXBQ 1Q7YC 3HEJA 1D1KA 4J1MA 2L55A 3I4LA 1YNJD 1A15A 1EFWA 1SDFA 3J81i 3J80E 3IKJA 1EYGA 4BY1H 3S2HB 3K80C 2JXMB 1MBYA 1TWFH 3M3YH 5IGEA 4GN3B 1V8QA 1QUQB 2ZTEA 1U4PA 2ZT9C 4G7OC 1QB5D 1JWSD 1O78A 1RCVD 1K0RA 5AFWA 3SEBA 4IFDG 3D4RA 1GUOA 1CHQD 5EPLA 3M9BA 4HMJA 4GOPB 4R4QA 4BBSH 3J80i 4B08A 2F0EA 4X66Q 4JYAL 5BR8L 1Y1VH 4RMFA 1ZEQX 3PMFA 2E5LQ 1UUPA 2TMPA 4I7ZC 4LF6Q 1ONLA 5C4XG 4QL5A 1SNPA 1L0XB 1CK1A 5JJZA 4A3CH 4X64L 4B3ML 3O13A 3UE0A 1ZYRD 2EIFA 4QF4A 3S15B 4QB4A 4LF9L 1O7YA 3FPUB 4IOCA 2AWNA 2JA5G 3VR5A 5C44B 4DV3L 1ICWA 2E74C 2B2UC 4DK3C 2BDOA 2G9DA 4JI2L 3GTLH 2UUCQ 3URYA 2FMMA 1GM5A 2AQ2B 4ZAIA 5M9OA 4HSVA 4DAMA 2HD3A 1GXDC 2R93H 4XQJA 1HCZA 3C46A 1SLJA 1K0SA 1VQ7A 3I4NG 4A3MG 1WYDA 1B7YB 1AZPA 1WOCA 1Q3LA 3I55A 5KIXA 4OELB 1LT6D 1JWUD 1K28A 2YU9B 3A54A 4N9PA 1X55A 5FLMH 5LHY1 2OT2A 1T9HA 1CM9A 4RAUC 1QJOA 4HIKA 1GHKA 5ELNA 2HQLA 2RSOA 1N34L 4HMIA 4X62L 1FYCA 1GUTA 3DWAA 3RLOA 4CKCA 3SDZA 1IBML 5CBEE 4DV1L 2N8NA 2NB0A 1IXRA 4XT1B 2K5NA 4JI5Q 4GLVB 3GTQB 4DAVA 1LTTD 4L5QA 5M5XB 4ODGA 2Y0SB 3W1GA 2DGYA 3EVQA 4UP7A 1YNXA 3I2ZA 3CW2C 5JJLA 2L0CA 3KDFA 4K8JA 3I4MG 1LTLA 2QDBA 5GAEC 1VQCA 2GVAA 3D4WA 5JEAG 1VQFA 4P71A 1W6KA 2HHHQ 3N52A 4Z9CB 5C0XI 1MSHA 1ENAA 3VYRA 1X3FA 4O42A 4P75A 2K50A 4OGQC 5HGQA 5M3FB 1HZCA 2EY6A 1TWGB 5C3EG 3BU2A 5IP7H 1A3TA 2I46A 5BN3A 1HTPA 2JA9A 4XDXA 4GNXB 1JCKB 1BXTA 1SRUA 2K28A 5BR8Q 1ASZA 2KVMA 1RF2D 2A73B 2CH4W 2K75A 3BZKA 1TS5A 4K5VA 2CQAA 4MZ9A 5IT9E 1E2ZA 2XVSA 5NUCA 5EJWA 2C9OA 4C3JB 2Y0SE 3U50C 3LNNA 1VQKA 3S15H 2N78A 4A4IA 4HJ5A 1MD2D 1MI2A 4P73A 3NWTA 5C44H 1FJGL 3HOYB 1Z7TA 1VF7A 4PQXA 4DV3Q 3I91A 1SE3A 1SMXA 4CHTB 5BN5A 4JI2Q 1EFID 5LL6X 1QNUA 2N88A 4JI6L 1C48A 1ESRA 1S5FD 2QEJC 3V2TA 1D5ZC 3L9AX 1LACA 1EWCA 3J81L 3PF5A 3MXGA 2L11A 1CA6A 4OWXB 1H9MA 1FNWA 3H3VC 2D0PA 2IW3A 4HCEA 5CV4A 1RDPD 4CDDC 3CCVA 4FF2A 2NZ1D 2Q8IB 4AIMA 3J7YW 2UXDQ 2YU9H 2E2JH 1MJCA 2ZXPA 1D5MC 4B9XA 4JBJA 2DY7A
chains in the Genus database with same CATH topology
1KIXA 1XJVA 2VL6A 3HKZE 2B63G 1XMQQ 4DR2L 1BVSA 2YTYA 4YHHQ 3AFQA 3U58A 1HNZQ 1Y1WH 5IT9c 1Q81C 1V43A 2I5HA 3FHWA 4A3IG 1IL2A 3PO3H 5IYBG 1JB7A 2UXDL 3CPFA 2ATWA 1K8GA 1QZGA 1E24A 3J7A5 2UXCL 2EQSA 3KF8B 3PUWA 2VZAA 3Q8DA 4JI1L 1VCIA 3I7FA 5C44G 3ULPA 3CD6A 2KHJA 4X62Q 2JA8H 2V1CC 5C0XJ 1XMQL 1IBMQ 2MO0A 5GAGC 2R7ZG 1UE1A 1WCMG 2B29A 4QIWE 4DV1Q 4JI0Q 1Y14B 1PH6A 1HNZL 1VQGA 3GTQH 1A0IA 4UY8C 1KC8C 4IPCA 4P74A 4GLXA 2NVYH 5M5XH 3S24A 4DR1L 4PZ8A 4A75A 1HNWL 4POGA 1WJJA 5M5YH 1W3SA 4GLAC 4YY3L 4L5SA 3TS2A 4L5RC 1X65A 1VQNA 2B3GA 1L2FA 1YI2A 1TXYA 4YWLA 3GTJH 4DKAC 4QGUA 4A3EH 4A3KH 1YJWA 1YJ9A 4JI7L 1IZ6A 4HJ8A 2I0QA 4JI0L 1PH4A 1H95A 4GNXC 3IRBA 5FJ8G 2UUBQ 1CKNB 4LF4Q 2NVQH 3F2CA 4BXXG 3T1YL 2N49A 5K36G 4A3LG 3HKSA 4OX9Q 3EIVA 1NJIC 2JA7H 2OTJA 4X65Q 1QVCA 1GVPA 2JE6I 1KD1C 3ER0A 2OQ0A 4BBRH 3KF6B 5M3FH 3W5OA 4JBWA 1IBKQ 1VQ9A 3F2DA 3S2DH 1Q86C 1TWGH 2NN6I 1Z47A 2KCTA 4LW1A 2PNHA 5IP9H 2UUBL 1XMOL 3BJUA 2ID0A 4B3TL 4JI3Q 4LF4L 5IE8A 3S2HH 3F1ZA 2MQHA 1VQEA 1S72A 1M90C 3A74A 4HIOA 4OX9L 5LMNQ 1N33Q 4X65L 1PA6A 2HIXA 1CKOA 1EWIA 5ELOA 4K0KL 1Q46A 4JCVE 2L15A 1Q1BA 3BZCA 2PI2A 4KHPL 3HOXG 1E3PA 3PUYA 3UDIA 1TWHH 2FXQA 3GDEA 1J5EQ 4C3JH 3T1HL 2DUDA 1Q1EA 4APVA 1UWVA 5IWAQ 1HJPA 4PG3A 3S14H 5LMNL 1N33L 3J81j 3PO2H 1CSPA 3CPWA 2F3IA 3EBEA 3A0JA 4DK6C 1K3RA 1KRSA 2CFMA 3UDFA 5LMUQ 3GTGH 3HOYH 1Q8KA 1PHJA 1FL0A 1G291 1N36L 4A3EG 1WI5A 2VY3A 3CXCA 3KDFB 4LUVA 1J5EL 4DR6L 1C0AA 2JEBI 1SE8A 1FGUA 3HFZB 2ZJRA 2OCEA 2ALYB 3E0EA 3PIOA 1I94L 4Y7NH 2ZM6L 3SGIA 2VQEQ 1VQ8A 4LF7L 3KYHC 5IYBH 4JI6Q 1YHBA 3ULJA 4NB3A 5LMUL 4QQBX 3OTOQ 3L7ZC 4IJHA 1YIJA 1IBLQ 4BBRG 2I5MX 3B6YA 4A3JG 3PV0A 2PQAA 1I5FA 5DLQE 1NMFA 1YVCA 3I56A 5IP9G 1E7ZA 1WCMH 2RHSB 1XPRA 3AYHB 4JBKA 2ZJQA 4IPDA 1WFQA 2WP8J 3PCOB 1YJNA 4LFCQ 3CC2A 1X9NA 2OWOA 5JJKA 2K14A 1N32Q 1L1OC 1P16A 2KHIA 2QGQA 1HNWQ 1UEBA 2A19A 5FJ8H 4XIGS 4AYBE 3FKIG 4DR2Q 2NN6G 1RIPA 1I6HH 1C9OA 1OXSC 4BXXH 2LXKA 3M4QA 5M3MG 4JI4L 2EXDA 4A3LH 4LFCL 3G4SA 3PO2G 1GKHA 1N32L 1JJGA 4R4TA 1B8AA 4JG2A 4TQUS 5C0XG 2VS1A 1A62A 1NBWA 4X66L 3W1BA 1EQQA 2E5LL 3PUZA 1KHIA 3OW2A 4LF6L 1QZHA 2IX0A 2C35B 2AKWB 1RL2A 2GVBA 3NBHB 3M85A 4DR1Q 1B70B 1KRTA 3STBC 2BA0A 3TEHB 3JC66 5FLXc 1CUKA 4YY3Q 1Q82C 2KBNA 4LF5L 4GS3A 3H3VH 2D62A 4AQYQ 4O2DA 3MEFA 2NVTH 1X56A 2R92G 1D8LA 3ERSX 4DV2Q 1NY4A 3HOXH 2OTLA 4QY7A 2D0OA 3AFPA 1VQ6A 4JI7Q 3G6EA 1Q12A 3G48A 3CCSA 2RHQB 1E1OA 1OXXK 1PYSB 4JOIA 5HY6A 3PIPA 1NE3A 1XPOA 1YEZA 1L1OB 4DR3Q 2Z6KC 3CCMA 3T1YQ 1XTDA 1Z9FA 1GD7A 3PUVA 1VQMA 1OTCA 1CKNA 2UUCL 4AQYL 4OO1I 3GD7A 5LMNW 3CMAA 4LF8L 3D0FA 1NTGA 3K7AH 4DV2L 3HOZH 1X3GA 1KXLA 2IY5B 1TWAH 4BBSG 1YHQA 2YV5A 1UE7A 3S1RH 4WJ4A 5JJIA 1Y1VG 3ULLA 2RCNA 3F8TA 1XMOQ 1PH8A 3KF6A 2K4KA 4DV5Q 4HIDA 4DR3L 4B3TQ 2VQFL 4IFDI 1TWCH 4LUZA 1EQRA 2Q2UA 1AE2A 1N8RC 3CCJA 3L0OA 3U4VA 2QEXA 4NXMQ 2WB1G 4JV5L 4EX5A 4K0KQ 1AE3A 3KLWA 4A3JH 5E7NA 4BA1I 3UDGA 4KHPQ 1PV4A 4B3SL 3CF5A 2MNAA 3GTMH 2ZJPA 4DV5L 1QVGA 2ZTDA 3T1HQ 1K73C 2K5HA 2BA1A 2KCMA 3S1MH 1SN8A 3RZOH 4TVAB 4IO9A 1HR0L 2JQOA 2JJQA 3CC7A 3GO5A 1P8LA 2UU9Q 1VQ5A 3MXNB 4NXML 2Q2HA 2WB1E 1CSQA 1M1KC 3I4OA 2LSSA 4HJ7A 3KOJA 1VQ4A 1PVOA 1N36Q 4JBJA 4GNXA 4PZ6A 4A3GH 3D31A 1NMGA 3PGZA 4DR6Q 1S3OA 2KENA 3FKIH 4YCUA 1HNXL 3HOVG 4NPSA 2R93G 5C4XH 1OXTA 4FDBA 5M3MH 4GOPC 4OWTB 1U5KA 1L0WA 1I94Q 1XNRQ 5AJ3L 2ZM6Q 3E9IA 4JI5L 2UU9L 3ICEA 4J15A 5GAHC 1FVIA 1U0LA 4LF7Q 2VNUD 1LM0A 1SR3A 4YWKA 3HOZG 2UXBQ 1VQIA 1Q7YC 2ES2A 2R7DA 4DR7Q 1VQHA 1X54A 4L5TA 4GKKL 2HIVA 3GTOH 1EFWA 1XNRL 2AHOB 2IHFA 4LWCA 2CKZB 3J81i 2E2IH 4DR5L 3RN2A 1IYJB 2I5LX 2OQKA 1VQLA 4GKJQ 1YZ6A 1EYGA 4BY1H 2R92H 3K80C 4OO1G 2UXBL 3H15A 3A5UA 2AWOA 4KLKA 3M4PA 1TWFH 3M3YH 4DR7L 4JYAQ 4KHZA 3STBD 4GN3B 1QUQB 2RF4A 2ZTEA 4JI4Q 3J7ZC 4HJ9A 4R4CA 3RZDH 4RG1A 4IFDG 4R4OA 1K0RA 4GKJL 3NENA 3CC4A 4HJAA 2UUAQ 3HOUH 1A63A 4X64Q 3HOWG 3M9BA 2WFWA 4B3MQ 4GOPB 4R4QA 3A5ZB 1UE5A 3DLLA 4BBSH 3J80i 2Q2TA 4X66Q 4A3GG 5BR8L 1Y1VH 4JYAL 4PZ7A 4IPGA 4RMFA 4MNOA 2E5LQ 4LF6Q 4LF9Q 4OWWB 3CQZH 1OXUA 2XGTA 5C4XG 4QL5A 5IYDH 2ASBA 4JI8Q 2NZOA 4A3CH 2UUAL 1YITA 5C4JH 4LF5Q 4DV4L 4X64L 1PH3A 4IFDJ 4B3ML 3H0GG 4BY7G 1JJCB 2Q2IA 3VDYA 1JMCA 4GN4B 3UE0A 4AH6A 4IOAA 2F4VQ 2EIFA 1PYBA 3PUXA 5IY0A 2YTXA 4NXNQ 2MFIA 4LF9L 2VUMG 5GADC 4DV0L 1HH2P 1HZBA 1PFSA 2AWNA 4YCVA 4R4IA 4IOCA 2JA5G 4JI8L 4DV3L 3RLNA 4O0AA 1XNQQ 1SROA 3CAMA 4DK3C 4JI2L 4XTCS 4LFAL 2MO1A 4R1JA 3GTLH 1YHAA 3RR5A 3J80c 2UUCQ 4YWMA 1GM5A 5IP7G 4LF8Q 4BY1G 1OXVA 4A3DG 4C3IH 3GTPH 2E2HH 4DAMA 2NVXH 4ME3A 2F4VL 1KL9A 2AMCB 2YYZA 4B3RQ 4NXNL 1SFOH 4DUYQ 3E9HA 3K7UC 3HOVH 2R93H 2PMZE 1A8VA 3RLFA 1O7IA 1SLJA 1XNQL 2VQFQ 1MJEA 1VQ7A 3I4NG 4DAYB 3I4MH 2VW9A 4A3MG 1WYDA 1B7YB 4DR4L 1W2BA 4JV5Q 1I3QH 1WOCA 3KJPA 4DV7Q 2HT1A 4B3RL 3I55A 1CKMA 5GQOA 1BBWA 5EAYA 4DUYL 3RNUA 4B3SQ 1N34Q 1PH7A 1E22A 2NZHA 1K83H 1X55A 5FLMH 4YHHL 3CCQA 2WAQG 1AH9A 4A3CG 1HR0Q 5C3EH 1T9HA 1N9WA 3KJOA 1BKBA 1V1QA 3CCEA 1GO3E 3L2PA 4P72A 1MIUA 2ZTCA 5ELNA 4C2MH 5IYCH 4DV7L 4HIKA 4A3BG 1DGSA 3F2BA 2HQLA 3PF4A 3G71A 1PH1A 3TRZA 1N34L 1HZAA 1LUZA 1VQJA 2LXJA 4GN5A 3S1NH 1VQDA 4X62L 1HNXQ 2Z6KA 3RLOA 1IBML 2WAQE 4UP9A 4DV1L 2N8NA 4H02A 1EUJA 1IXRA 3EN2A 1VS0A 2K5NA 4POFA 4GLVB 5AJ3Q 3RN5A 4JI5Q 2XTIA 2YTVA 3HOWH 4IPHA 4L5QA 2E8GA 4DNIA 3TQYA 3W1GA 2JA6G 3AEVA 2JK8A 2H5XA 2DGYA 4UP7A 4ALPA 4KI0A 3S16H 3S1QH 1YNXA 2F52A 3I2ZA 3CW2C 5JJLA 1KAWA 4GKKQ 1V9PA 3KDFA 1VQPA 1VQBA 1LYLA 4UP8A 1PH9A 1Y1WG 1LTLA 1HZ9A 4UPAA 4DR5Q 2A8VA 3I4MG 4A93H 5GAEC 1VQCA 2GVAA 3H0GH 5JEAG 1VQFA 4P71A 3TREA 4BY7H 2HHHQ 3FP9A 3PO3G 4LFBQ 1BBUA 5C0XI 1G51A 1KQSA 1IBKL 2VUMH 4DUZQ 1X3FA 4P75A 2JA5H 3M4OH 2JA8G 2K50A 5HGQA 1X6OA 4JI3L 1YBYA 5M5WH 5FLMG 5IYDG 3HOUG 1HZCA 2GN5A 4LUOA 4DV6Q 3U4ZA 5C3EG 3CCUA 3WWVA 1K9MC 3BU2A 4HIMA 5IP7H 1ASYA 2BH2A 3PSIA 1QUQA 3UE1A 4C3HH 2HHHL 2CQOA 2Y0SG 3JAMi 2QA4A 5IYCG 4A3DH 3LGJA 4A3FH 4LFBL 2JA9A 5JEAJ 3K0XA 4GNXB 1SRUA 3NEMA 1K8AC 4DUZL 5BR8Q 1R9TH 1ASZA 3K8AA 3ZJYC 3CCLA 1QVFA 4GOPA 3OYYA 2K75A 3BZKA 2CCZA 4A3KG 1FJGQ 2B63H 2CWPA 2R7FA 4DV6L 4YCWA 4MZ9A 3I4NH 2IHEA 5IWAL 4OONA 1XPUA 4A3MH 2R6GA 1UE6A 4A3IH 3CP0A 2Y0SE 3U50C 4DV4Q 1PH2A 3GTKH 1EIYB 2JA7G 1VQKA 4LNQA 1I50H 2N78A 1JE5A 3S15H 4A4IA 2Z0SA 1J6QA 3K81C 4QJFA 4HJ5A 4P73A 5C44H 5M3FG 1FJGL 3J81c 4DV0Q 1EOVA 3DM3A 2R7ZH 1JT8A 4DV3Q 4AYBG 1SMXA 3JAMc 3CCRA 5H1SE 1EIFA 2IX1A 4JI2Q 2A1AA 4LFAQ 2VQEL 4A93G 2CWAA 4BA2I 4WJ3M 4JI6L 2PQAB 4IJLA 4A3BH 4X6AH 5GROA 4PMWA 1VQOA 3OTOL 4MTNA 3AQQA 3TS0A 3NELA 1IBLL 2BH8A 4EQ5A 1PH5A 1X3EA 1D7QA 3KFUA 1JJ2A 3PF5A 4A76A 2K52A 3HKZG 1MKHA 3CMEA 4OWXB 2PI2E 3UDXA 4JOIC 5J3BA 2JEAI 2D0PA 2K5VA 1E1TA 3CCVA 4JC0A 2IT1A 1L1OA 1C7YA 1HR0W 3H3VI 4DR4Q 4AIMA 4DPGA 3S17H 4JBMA 4A3FG 2UXDQ 2JA6H 1G6PA 2YU9H 2E2JH 1MJCA 3HOYG 4Y52H 1VQAA 4OXPA 2UXCQ 3M7NA 1S40A 4JI1Q 2N3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIX A;  1XJV A;  2VL6 A;  3HKZ E;  2B63 G;  1XMQ Q;  4DR2 L;  1BVS A;  2YTY A;  4YHH Q;  3AFQ A;  3U58 A;  1HNZ Q;  1Y1W H;  5IT9 c;  1Q81 C;  1V43 A;  2I5H A;  3FHW A;  4A3I G;  1IL2 A;  3PO3 H;  5IYB G;  1JB7 A;  2UXD L;  3CPF A;  2ATW A;  1K8G A;  1QZG A;  1E24 A;  3J7A 5;  2UXC L;  2EQS A;  3KF8 B;  3PUW A;  2VZA A;  3Q8D A;  4JI1 L;  1VCI A;  3I7F A;  5C44 G;  3ULP A;  3CD6 A;  2KHJ A;  4X62 Q;  2JA8 H;  2V1C C;  5C0X J;  1XMQ L;  1IBM Q;  2MO0 A;  5GAG C;  2R7Z G;  1UE1 A;  1WCM G;  2B29 A;  4QIW E;  4DV1 Q;  4JI0 Q;  1Y14 B;  1PH6 A;  1HNZ L;  1VQG A;  3GTQ H;  1A0I A;  4UY8 C;  1KC8 C;  4IPC A;  4P74 A;  4GLX A;  2NVY H;  5M5X H;  3S24 A;  4DR1 L;  4PZ8 A;  4A75 A;  1HNW L;  4POG A;  1WJJ A;  5M5Y H;  1W3S A;  4GLA C;  4YY3 L;  4L5S A;  3TS2 A;  4L5R C;  1X65 A;  1VQN A;  2B3G A;  1L2F A;  1YI2 A;  1TXY A;  4YWL A;  3GTJ H;  4DKA C;  4QGU A;  4A3E H;  4A3K H;  1YJW A;  1YJ9 A;  4JI7 L;  1IZ6 A;  4HJ8 A;  2I0Q A;  4JI0 L;  1PH4 A;  1H95 A;  4GNX C;  3IRB A;  5FJ8 G;  2UUB Q;  1CKN B;  4LF4 Q;  2NVQ H;  3F2C A;  4BXX G;  3T1Y L;  2N49 A;  5K36 G;  4A3L G;  3HKS A;  4OX9 Q;  3EIV A;  1NJI C;  2JA7 H;  2OTJ A;  4X65 Q;  1QVC A;  1GVP A;  2JE6 I;  1KD1 C;  3ER0 A;  2OQ0 A;  4BBR H;  3KF6 B;  5M3F H;  3W5O A;  4JBW A;  1IBK Q;  1VQ9 A;  3F2D A;  3S2D H;  1Q86 C;  1TWG H;  2NN6 I;  1Z47 A;  2KCT A;  4LW1 A;  2PNH A;  5IP9 H;  2UUB L;  1XMO L;  3BJU A;  2ID0 A;  4B3T L;  4JI3 Q;  4LF4 L;  5IE8 A;  3S2H H;  3F1Z A;  2MQH A;  1VQE A;  1S72 A;  1M90 C;  3A74 A;  4HIO A;  4OX9 L;  5LMN Q;  1N33 Q;  4X65 L;  1PA6 A;  2HIX A;  1CKO A;  1EWI A;  5ELO A;  4K0K L;  1Q46 A;  4JCV E;  2L15 A;  1Q1B A;  3BZC A;  2PI2 A;  4KHP L;  3HOX G;  1E3P A;  3PUY A;  3UDI A;  1TWH H;  2FXQ A;  3GDE A;  1J5E Q;  4C3J H;  3T1H L;  2DUD A;  1Q1E A;  4APV A;  1UWV A;  5IWA Q;  1HJP A;  4PG3 A;  3S14 H;  5LMN L;  1N33 L;  3J81 j;  3PO2 H;  1CSP A;  3CPW A;  2F3I A;  3EBE A;  3A0J A;  4DK6 C;  1K3R A;  1KRS A;  2CFM A;  3UDF A;  5LMU Q;  3GTG H;  3HOY H;  1Q8K A;  1PHJ A;  1FL0 A;  1G29 1;  1N36 L;  4A3E G;  1WI5 A;  2VY3 A;  3CXC A;  3KDF B;  4LUV A;  1J5E L;  4DR6 L;  1C0A A;  2JEB I;  1SE8 A;  1FGU A;  3HFZ B;  2ZJR A;  2OCE A;  2ALY B;  3E0E A;  3PIO A;  1I94 L;  4Y7N H;  2ZM6 L;  3SGI A;  2VQE Q;  1VQ8 A;  4LF7 L;  3KYH C;  5IYB H;  4JI6 Q;  1YHB A;  3ULJ A;  4NB3 A;  5LMU L;  4QQB X;  3OTO Q;  3L7Z C;  4IJH A;  1YIJ A;  1IBL Q;  4BBR G;  2I5M X;  3B6Y A;  4A3J G;  3PV0 A;  2PQA A;  1I5F A;  5DLQ E;  1NMF A;  1YVC A;  3I56 A;  5IP9 G;  1E7Z A;  1WCM H;  2RHS B;  1XPR A;  3AYH B;  4JBK A;  2ZJQ A;  4IPD A;  1WFQ A;  2WP8 J;  3PCO B;  1YJN A;  4LFC Q;  3CC2 A;  1X9N A;  2OWO A;  5JJK A;  2K14 A;  1N32 Q;  1L1O C;  1P16 A;  2KHI A;  2QGQ A;  1HNW Q;  1UEB A;  2A19 A;  5FJ8 H;  4XIG S;  4AYB E;  3FKI G;  4DR2 Q;  2NN6 G;  1RIP A;  1I6H H;  1C9O A;  1OXS C;  4BXX H;  2LXK A;  3M4Q A;  5M3M G;  4JI4 L;  2EXD A;  4A3L H;  4LFC L;  3G4S A;  3PO2 G;  1GKH A;  1N32 L;  1JJG A;  4R4T A;  1B8A A;  4JG2 A;  4TQU S;  5C0X G;  2VS1 A;  1A62 A;  1NBW A;  4X66 L;  3W1B A;  1EQQ A;  2E5L L;  3PUZ A;  1KHI A;  3OW2 A;  4LF6 L;  1QZH A;  2IX0 A;  2C35 B;  2AKW B;  1RL2 A;  2GVB A;  3NBH B;  3M85 A;  4DR1 Q;  1B70 B;  1KRT A;  3STB C;  2BA0 A;  3TEH B;  3JC6 6;  5FLX c;  1CUK A;  4YY3 Q;  1Q82 C;  2KBN A;  4LF5 L;  4GS3 A;  3H3V H;  2D62 A;  4AQY Q;  4O2D A;  3MEF A;  2NVT H;  1X56 A;  2R92 G;  1D8L A;  3ERS X;  4DV2 Q;  1NY4 A;  3HOX H;  2OTL A;  4QY7 A;  2D0O A;  3AFP A;  1VQ6 A;  4JI7 Q;  3G6E A;  1Q12 A;  3G48 A;  3CCS A;  2RHQ B;  1E1O A;  1OXX K;  1PYS B;  4JOI A;  5HY6 A;  3PIP A;  1NE3 A;  1XPO A;  1YEZ A;  1L1O B;  4DR3 Q;  2Z6K C;  3CCM A;  3T1Y Q;  1XTD A;  1Z9F A;  1GD7 A;  3PUV A;  1VQM A;  1OTC A;  1CKN A;  2UUC L;  4AQY L;  4OO1 I;  3GD7 A;  5LMN W;  3CMA A;  4LF8 L;  3D0F A;  1NTG A;  3K7A H;  4DV2 L;  3HOZ H;  1X3G A;  1KXL A;  2IY5 B;  1TWA H;  4BBS G;  1YHQ A;  2YV5 A;  1UE7 A;  3S1R H;  4WJ4 A;  5JJI A;  1Y1V G;  3ULL A;  2RCN A;  3F8T A;  1XMO Q;  1PH8 A;  3KF6 A;  2K4K A;  4DV5 Q;  4HID A;  4DR3 L;  4B3T Q;  2VQF L;  4IFD I;  1TWC H;  4LUZ A;  1EQR A;  2Q2U A;  1AE2 A;  1N8R C;  3CCJ A;  3L0O A;  3U4V A;  2QEX A;  4NXM Q;  2WB1 G;  4JV5 L;  4EX5 A;  4K0K Q;  1AE3 A;  3KLW A;  4A3J H;  5E7N A;  4BA1 I;  3UDG A;  4KHP Q;  1PV4 A;  4B3S L;  3CF5 A;  2MNA A;  3GTM H;  2ZJP A;  4DV5 L;  1QVG A;  2ZTD A;  3T1H Q;  1K73 C;  2K5H A;  2BA1 A;  2KCM A;  3S1M H;  1SN8 A;  3RZO H;  4TVA B;  4IO9 A;  1HR0 L;  2JQO A;  2JJQ A;  3CC7 A;  3GO5 A;  1P8L A;  2UU9 Q;  1VQ5 A;  3MXN B;  4NXM L;  2Q2H A;  2WB1 E;  1CSQ A;  1M1K C;  3I4O A;  2LSS A;  4HJ7 A;  3KOJ A;  1VQ4 A;  1PVO A;  1N36 Q;  4JBJ A;  4GNX A;  4PZ6 A;  4A3G H;  3D31 A;  1NMG A;  3PGZ A;  4DR6 Q;  1S3O A;  2KEN A;  3FKI H;  4YCU A;  1HNX L;  3HOV G;  4NPS A;  2R93 G;  5C4X H;  1OXT A;  4FDB A;  5M3M H;  4GOP C;  4OWT B;  1U5K A;  1L0W A;  1I94 Q;  1XNR Q;  5AJ3 L;  2ZM6 Q;  3E9I A;  4JI5 L;  2UU9 L;  3ICE A;  4J15 A;  5GAH C;  1FVI A;  1U0L A;  4LF7 Q;  2VNU D;  1LM0 A;  1SR3 A;  4YWK A;  3HOZ G;  2UXB Q;  1VQI A;  1Q7Y C;  2ES2 A;  2R7D A;  4DR7 Q;  1VQH A;  1X54 A;  4L5T A;  4GKK L;  2HIV A;  3GTO H;  1EFW A;  1XNR L;  2AHO B;  2IHF A;  4LWC A;  2CKZ B;  3J81 i;  2E2I H;  4DR5 L;  3RN2 A;  1IYJ B;  2I5L X;  2OQK A;  1VQL A;  4GKJ Q;  1YZ6 A;  1EYG A;  4BY1 H;  2R92 H;  3K80 C;  4OO1 G;  2UXB L;  3H15 A;  3A5U A;  2AWO A;  4KLK A;  3M4P A;  1TWF H;  3M3Y H;  4DR7 L;  4JYA Q;  4KHZ A;  3STB D;  4GN3 B;  1QUQ B;  2RF4 A;  2ZTE A;  4JI4 Q;  3J7Z C;  4HJ9 A;  4R4C A;  3RZD H;  4RG1 A;  4IFD G;  4R4O A;  1K0R A;  4GKJ L;  3NEN A;  3CC4 A;  4HJA A;  2UUA Q;  3HOU H;  1A63 A;  4X64 Q;  3HOW G;  3M9B A;  2WFW A;  4B3M Q;  4GOP B;  4R4Q A;  3A5Z B;  1UE5 A;  3DLL A;  4BBS H;  3J80 i;  2Q2T A;  4X66 Q;  4A3G G;  5BR8 L;  1Y1V H;  4JYA L;  4PZ7 A;  4IPG A;  4RMF A;  4MNO A;  2E5L Q;  4LF6 Q;  4LF9 Q;  4OWW B;  3CQZ H;  1OXU A;  2XGT A;  5C4X G;  4QL5 A;  5IYD H;  2ASB A;  4JI8 Q;  2NZO A;  4A3C H;  2UUA L;  1YIT A;  5C4J H;  4LF5 Q;  4DV4 L;  4X64 L;  1PH3 A;  4IFD J;  4B3M L;  3H0G G;  4BY7 G;  1JJC B;  2Q2I A;  3VDY A;  1JMC A;  4GN4 B;  3UE0 A;  4AH6 A;  4IOA A;  2F4V Q;  2EIF A;  1PYB A;  3PUX A;  5IY0 A;  2YTX A;  4NXN Q;  2MFI A;  4LF9 L;  2VUM G;  5GAD C;  4DV0 L;  1HH2 P;  1HZB A;  1PFS A;  2AWN A;  4YCV A;  4R4I A;  4IOC A;  2JA5 G;  4JI8 L;  4DV3 L;  3RLN A;  4O0A A;  1XNQ Q;  1SRO A;  3CAM A;  4DK3 C;  4JI2 L;  4XTC S;  4LFA L;  2MO1 A;  4R1J A;  3GTL H;  1YHA A;  3RR5 A;  3J80 c;  2UUC Q;  4YWM A;  1GM5 A;  5IP7 G;  4LF8 Q;  4BY1 G;  1OXV A;  4A3D G;  4C3I H;  3GTP H;  2E2H H;  4DAM A;  2NVX H;  4ME3 A;  2F4V L;  1KL9 A;  2AMC B;  2YYZ A;  4B3R Q;  4NXN L;  1SFO H;  4DUY Q;  3E9H A;  3K7U C;  3HOV H;  2R93 H;  2PMZ E;  1A8V A;  3RLF A;  1O7I A;  1SLJ A;  1XNQ L;  2VQF Q;  1MJE A;  1VQ7 A;  3I4N G;  4DAY B;  3I4M H;  2VW9 A;  4A3M G;  1WYD A;  1B7Y B;  4DR4 L;  1W2B A;  4JV5 Q;  1I3Q H;  1WOC A;  3KJP A;  4DV7 Q;  2HT1 A;  4B3R L;  3I55 A;  1CKM A;  5GQO A;  1BBW A;  5EAY A;  4DUY L;  3RNU A;  4B3S Q;  1N34 Q;  1PH7 A;  1E22 A;  2NZH A;  1K83 H;  1X55 A;  5FLM H;  4YHH L;  3CCQ A;  2WAQ G;  1AH9 A;  4A3C G;  1HR0 Q;  5C3E H;  1T9H A;  1N9W A;  3KJO A;  1BKB A;  1V1Q A;  3CCE A;  1GO3 E;  3L2P A;  4P72 A;  1MIU A;  2ZTC A;  5ELN A;  4C2M H;  5IYC H;  4DV7 L;  4HIK A;  4A3B G;  1DGS A;  3F2B A;  2HQL A;  3PF4 A;  3G71 A;  1PH1 A;  3TRZ A;  1N34 L;  1HZA A;  1LUZ A;  1VQJ A;  2LXJ A;  4GN5 A;  3S1N H;  1VQD A;  4X62 L;  1HNX Q;  2Z6K A;  3RLO A;  1IBM L;  2WAQ E;  4UP9 A;  4DV1 L;  2N8N A;  4H02 A;  1EUJ A;  1IXR A;  3EN2 A;  1VS0 A;  2K5N A;  4POF A;  4GLV B;  5AJ3 Q;  3RN5 A;  4JI5 Q;  2XTI A;  2YTV A;  3HOW H;  4IPH A;  4L5Q A;  2E8G A;  4DNI A;  3TQY A;  3W1G A;  2JA6 G;  3AEV A;  2JK8 A;  2H5X A;  2DGY A;  4UP7 A;  4ALP A;  4KI0 A;  3S16 H;  3S1Q H;  1YNX A;  2F52 A;  3I2Z A;  3CW2 C;  5JJL A;  1KAW A;  4GKK Q;  1V9P A;  3KDF A;  1VQP A;  1VQB A;  1LYL A;  4UP8 A;  1PH9 A;  1Y1W G;  1LTL A;  1HZ9 A;  4UPA A;  4DR5 Q;  2A8V A;  3I4M G;  4A93 H;  5GAE C;  1VQC A;  2GVA A;  3H0G H;  5JEA G;  1VQF A;  4P71 A;  3TRE A;  4BY7 H;  2HHH Q;  3FP9 A;  3PO3 G;  4LFB Q;  1BBU A;  5C0X I;  1G51 A;  1KQS A;  1IBK L;  2VUM H;  4DUZ Q;  1X3F A;  4P75 A;  2JA5 H;  3M4O H;  2JA8 G;  2K50 A;  5HGQ A;  1X6O A;  4JI3 L;  1YBY A;  5M5W H;  5FLM G;  5IYD G;  3HOU G;  1HZC A;  2GN5 A;  4LUO A;  4DV6 Q;  3U4Z A;  5C3E G;  3CCU A;  3WWV A;  1K9M C;  3BU2 A;  4HIM A;  5IP7 H;  1ASY A;  2BH2 A;  3PSI A;  1QUQ A;  3UE1 A;  4C3H H;  2HHH L;  2CQO A;  2Y0S G;  3JAM i;  2QA4 A;  5IYC G;  4A3D H;  3LGJ A;  4A3F H;  4LFB L;  2JA9 A;  5JEA J;  3K0X A;  4GNX B;  1SRU A;  3NEM A;  1K8A C;  4DUZ L;  5BR8 Q;  1R9T H;  1ASZ A;  3K8A A;  3ZJY C;  3CCL A;  1QVF A;  4GOP A;  3OYY A;  2K75 A;  3BZK A;  2CCZ A;  4A3K G;  1FJG Q;  2B63 H;  2CWP A;  2R7F A;  4DV6 L;  4YCW A;  4MZ9 A;  3I4N H;  2IHE A;  5IWA L;  4OON A;  1XPU A;  4A3M H;  2R6G A;  1UE6 A;  4A3I H;  3CP0 A;  2Y0S E;  3U50 C;  4DV4 Q;  1PH2 A;  3GTK H;  1EIY B;  2JA7 G;  1VQK A;  4LNQ A;  1I50 H;  2N78 A;  1JE5 A;  3S15 H;  4A4I A;  2Z0S A;  1J6Q A;  3K81 C;  4QJF A;  4HJ5 A;  4P73 A;  5C44 H;  5M3F G;  1FJG L;  3J81 c;  4DV0 Q;  1EOV A;  3DM3 A;  2R7Z H;  1JT8 A;  4DV3 Q;  4AYB G;  1SMX A;  3JAM c;  3CCR A;  5H1S E;  1EIF A;  2IX1 A;  4JI2 Q;  2A1A A;  4LFA Q;  2VQE L;  4A93 G;  2CWA A;  4BA2 I;  4WJ3 M;  4JI6 L;  2PQA B;  4IJL A;  4A3B H;  4X6A H;  5GRO A;  4PMW A;  1VQO A;  3OTO L;  4MTN A;  3AQQ A;  3TS0 A;  3NEL A;  1IBL L;  2BH8 A;  4EQ5 A;  1PH5 A;  1X3E A;  1D7Q A;  3KFU A;  1JJ2 A;  3PF5 A;  4A76 A;  2K52 A;  3HKZ G;  1MKH A;  3CME A;  4OWX B;  2PI2 E;  3UDX A;  4JOI C;  5J3B A;  2JEA I;  2D0P A;  2K5V A;  1E1T A;  3CCV A;  4JC0 A;  2IT1 A;  1L1O A;  1C7Y A;  1HR0 W;  3H3V I;  4DR4 Q;  4AIM A;  4DPG A;  3S17 H;  4JBM A;  4A3F G;  2UXD Q;  2JA6 H;  1G6P A;  2YU9 H;  2E2J H;  1MJC A;  3HOY G;  4Y52 H;  1VQA A;  4OXP A;  2UXC Q;  3M7N A;  1S40 A;  4JI1 Q;  2N3S A; 
#chains in the Genus database with same CATH topology
 1KIX A;  3HKZ E;  1IKL A;  1BVS A;  3J80 L;  2F0S A;  1Q81 C;  4X3T A;  4K5X A;  1V43 A;  3IL8 A;  5DEH A;  3BYY B;  3TN2 A;  1IL2 A;  5A2Q E;  2I07 B;  5T1I A;  3SK8 A;  1E24 A;  3J7A 5;  3KF8 B;  1NSN S;  3H6M A;  3PUW A;  4JI1 L;  1VCI A;  4OEM B;  4X62 Q;  2V1C C;  5C0X J;  1XMQ L;  1JOR A;  1IBM Q;  5GAG C;  1GUS A;  5IYD H;  1EY8 A;  1WCM G;  4DV1 Q;  3GTQ H;  1PH6 A;  1HNZ L;  1A0I A;  1KC8 C;  3P75 A;  5M5X H;  1W3S A;  4GLA C;  1VQN A;  2K03 A;  2Z4I A;  2X6L A;  1YJW A;  1WTX A;  1YJ9 A;  4HJ8 A;  1V1P A;  3E6Z X;  1EY4 A;  2NVQ H;  3PQI A;  4BXX G;  2B2Y C;  2XRQ D;  1I6V C;  4OX9 Q;  4XT3 B;  3C2P A;  1GVP A;  2JE6 I;  1EU4 A;  4UHV A;  5M3F H;  3P1H A;  1Q86 C;  1JC7 A;  1TWG H;  1BCP C;  3RD4 A;  3BJU A;  4B3T L;  5L37 A;  3J7A V;  1SYF A;  3A74 A;  4I7A A;  1K3B C;  4X65 L;  1X3P A;  1TWC B;  2ENB A;  1EWI A;  2BDN A;  2L15 A;  1A2T A;  1CFM A;  3HS0 C;  3HOX G;  3R8B A;  3PUY A;  3TZU A;  1M4V A;  2FXQ A;  4C3J H;  3T1H L;  2DUD A;  2FJ2 A;  4GZY C;  2WII B;  3KBG A;  3IFT A;  3J81 j;  1CSP A;  3RZO B;  1ET9 A;  1K3R A;  5IGF A;  5LMU Q;  3HOY H;  3K6O A;  5I9O A;  3MZ5 A;  1G29 1;  3CXC A;  2K01 A;  1J5E L;  1WTH A;  4DR6 L;  2QW7 A;  2ZJR A;  3HFZ B;  3BDC A;  2ALY B;  2O5J C;  4IQZ A;  4IAL A;  3FKI B;  1U9R A;  3SGI A;  5FLX E;  5C4X B;  1STB A;  3KYH C;  5IYB H;  4JI6 Q;  3BG3 A;  1AEX A;  4BBR G;  1IKM A;  4KK7 A;  2PQA A;  2M9V A;  3ERQ A;  1DD2 A;  1NMF A;  5IP9 G;  1E7Z A;  2RHS B;  3ZYY X;  2B8F A;  4ZKC B;  1R4P B;  3P7J A;  4KTA A;  2D9U A;  2PMZ B;  1YJN A;  2JA5 B;  5JJK A;  1N32 Q;  3DEP A;  3K5M A;  1CZW A;  4KJN A;  2KHI A;  2QGQ A;  1UEB A;  5FJ8 H;  3ONA B;  5CC4 A;  2NN6 G;  1RIP A;  2J7Z A;  3G7L A;  1E2W A;  4ZK9 B;  3OMC A;  4A3M B;  5C0X G;  2F03 A;  1NBW A;  4KD4 A;  2XRS D;  3SR1 A;  2HDL A;  3PUZ A;  4H0L C;  3OW2 A;  3GP7 A;  2IX3 A;  2K5Q A;  4FF3 A;  1RL2 A;  3CRK C;  1O7Z A;  1B70 B;  3STB C;  3TEH B;  2M00 A;  4AQY Q;  4O2D A;  1BCP D;  2R92 G;  5C4J B;  1SNM A;  2D0O A;  3AFP A;  3G6E A;  3G48 A;  3CCS A;  5HY6 A;  1E1O A;  5IT9 L;  3PIP A;  1XPO A;  1YEZ A;  1L1O B;  3A8I E;  3CCM A;  1GD7 A;  1BCP F;  1DCZ A;  5EBD A;  1CKN A;  3G6J B;  2EYO A;  4LF8 L;  3D0F A;  1NTG A;  3SK5 A;  1KXL A;  2H4O A;  1DJR D;  2MPM A;  1EOT A;  1SYE A;  1UE7 A;  2EYL A;  2YV5 A;  3TP5 A;  1YHQ A;  3M7G A;  3S17 B;  3GTP B;  4B3T Q;  4DR3 L;  4RGO S;  3CU7 A;  2VQF L;  5EQ0 A;  2RQX A;  4IFD I;  1TWC H;  1SYG A;  5EBC A;  1WD1 A;  4DK1 A;  1SSO A;  2QEX A;  2WB1 G;  4CJ2 C;  3I4M B;  4H13 C;  2X6G A;  5ELF A;  4A3J H;  2EVB A;  5E7N A;  3UDG A;  1STY A;  2HUG A;  1PV4 A;  4B3S L;  3I90 A;  2RA4 A;  1H9S B;  5I2X A;  3T1H Q;  1EL0 A;  3RZO H;  1QIL A;  4IO9 A;  1EY5 A;  1HR0 L;  3GO5 A;  2UU9 Q;  4NKL A;  1AN8 A;  1ET6 A;  3MFG A;  2OEO A;  5C3E B;  1GOZ A;  4XQN A;  3DM1 A;  4HJ7 A;  2EY5 A;  3KOJ A;  2CHB D;  1PFB A;  4GNX A;  1BNZ A;  3D31 A;  4DR6 Q;  1S3O A;  2KEN A;  3FKI H;  4NPS A;  5KGU A;  5C4X H;  1DOL A;  4FDB A;  3MHB A;  3NUC A;  4OWT B;  1U5K A;  3SVM A;  5AJ3 L;  5A2Q L;  4J15 A;  5GAH C;  1U0L A;  1VMP A;  4KD3 A;  2PO4 A;  4YWK A;  1G91 A;  3W3A A;  1VQI A;  4IUV A;  3NQI A;  1Y8O B;  4DR7 Q;  4TSS A;  3S16 B;  4GKK L;  3S1Q B;  1JOQ A;  5KND A;  3RUZ A;  1F2M A;  1PZI D;  2L12 A;  2AHO B;  2IHF A;  2F0K A;  3RN2 A;  1YZ6 A;  2UXB L;  1CQV A;  5LL6 S;  3H15 A;  1SNC A;  4R9W A;  1RD9 D;  3H0G B;  1K8M A;  4KY5 A;  3GQB A;  3STB D;  2VUM B;  1EQT A;  4HJ9 A;  4DN4 M;  3NWS A;  3CC4 A;  4J8Q A;  1A63 A;  3HOW G;  3DLL A;  1ENC A;  1UE5 A;  3J7A F;  3QG1 A;  1F2Y A;  4HAE A;  4BWG B;  4DA2 A;  4XXE A;  1MSG A;  4OWW B;  2XGT A;  1EY7 A;  1KTK A;  2PZU A;  1EZ6 A;  1PRT F;  2XIW A;  4CJ0 B;  2QKI C;  4L6T B;  1TS3 A;  1EQV A;  3L3O C;  5C4J H;  4QIW B;  4DV4 L;  4KY6 A;  4IFD J;  2RSN A;  4BY7 G;  2F4V Q;  3GTK B;  1PYB A;  1I50 B;  2YTX A;  4NXN Q;  1PFS A;  4YCV A;  2QCP X;  5I2Y A;  1BOS A;  5IGD A;  3RLN A;  1TII D;  1K8O A;  1SRO A;  3F2U A;  4ZLT F;  3PIO 3;  4LFA L;  1WCM B;  4R1J A;  1Y8P B;  3RR5 A;  3J80 c;  4FYD A;  4H7B A;  4LF8 Q;  3T4A C;  3VR2 A;  3EQL C;  1OXV A;  3U9O A;  3GTP H;  2NUC A;  4ME3 A;  4B3R Q;  4ZQ3 A;  3FDT A;  3E9H A;  2NTS A;  3RLF A;  5EPJ A;  3T53 B;  2AUK A;  3MXP A;  4N8F A;  2VQF Q;  5FLX L;  1MJE A;  5CV5 A;  1WTV A;  3I4M H;  1LT5 D;  4DR4 L;  4P2C B;  3KK7 A;  1W2B A;  4DV7 Q;  5EAY A;  4B3S Q;  3OWE B;  2PNR C;  2JA6 B;  4MIU A;  1PH7 A;  5D3D A;  1HQR D;  3I8Z A;  2WAQ G;  1T5X D;  5DNF A;  1AH9 A;  1SJH D;  5C3E H;  1HR0 Q;  3M4Y A;  1BKB A;  3D8G A;  3CCE A;  3OIP A;  4OO1 H;  3L2P A;  1MIU A;  2ZTC A;  3NHH A;  4C2M H;  4A3B G;  1BQQ T;  1DGS A;  3F2B A;  2EY2 A;  1GUN A;  2F0D A;  2PCF B;  1HZA A;  1LUZ A;  5C4H A;  2LXJ A;  4GN5 A;  4IUQ A;  3HOX B;  2MHV A;  5AJ3 Q;  3OWF A;  4RHS A;  4POF A;  2EYF A;  2K5W A;  2XTI A;  4IPH A;  4DF7 A;  4C3I G;  1EYA A;  2J4X A;  3AEV A;  2JK8 A;  2H5X A;  2M2L A;  2NWG A;  4ALP A;  3S16 H;  3S1Q H;  4ABN A;  3J81 E;  4GKK Q;  1SEB D;  1VQB A;  1LYL A;  4A3K B;  4UP8 A;  1PH9 A;  1Y1W G;  4UPA A;  1HZ9 A;  3DMU A;  3H0G H;  3PO3 G;  2FHT A;  1QE6 A;  1G51 A;  5DM7 3;  1QG7 A;  4PV1 C;  2L5T A;  2KJX A;  2VUM H;  2SNS A;  4BBR B;  2JA8 G;  5KRU A;  1X6O A;  4XYO A;  3S2D B;  5CV8 A;  3HOU G;  2GN5 A;  4LUO A;  4DV6 Q;  2ZXR A;  1ASY A;  4AYB B;  1FGB D;  3PSI A;  2BH2 A;  2HHH L;  4A3D H;  2CQO A;  2QA4 A;  5IYC G;  3LGJ A;  5JEA J;  3K0X A;  4KKU A;  3NEM A;  1PMR A;  1KAA A;  1BO0 A;  3IAY A;  2CW0 C;  3OMG A;  3Q0A A;  4OON A;  2KEE A;  1UE6 A;  3BZD B;  3CP0 A;  4DV4 Q;  3GTK H;  1EWH A;  1EIY B;  2JA7 G;  1I50 H;  2KQ3 A;  1EIG A;  1J6Q A;  3K81 C;  4QMG A;  3QOJ A;  1LLR D;  2XWJ B;  3GTG B;  1EOV A;  4ULL A;  4WRD A;  4ZUI A;  2PW5 A;  5IOD A;  2IX1 A;  1PTO C;  4LFA Q;  2WV6 D;  2VQE L;  2CWA A;  4BA2 I;  2PQA B;  1DXM A;  5GRO A;  3OTO L;  3AQQ A;  3NEL A;  5IIF A;  1F9R A;  1IBL L;  2BH8 A;  4MTK A;  4EQ5 A;  1EY0 A;  3KFU A;  1SNO A;  4TKO B;  1STN A;  3UDX A;  2K5V A;  1E1T A;  4JC0 A;  1C7Y A;  1L1O A;  1HR0 W;  3H3V I;  4C3H G;  5HGT A;  4DR4 Q;  2JA6 H;  1G6P A;  1DZ1 A;  3M7N A;  1S40 A;  1CQF A;  2VL6 A;  1LTB D;  3TSS A;  2EZV A;  5IT9 c;  2I5H A;  3D4D A;  2AQ3 B;  2A6E C;  4PMC A;  2UXD L;  4QUF A;  1B50 A;  1JB3 A;  2EQS A;  3Q8D A;  3CD6 A;  2WB1 B;  3DUZ A;  2KHJ A;  3E5S A;  3NSW A;  2MO0 A;  2SOB A;  1H9S A;  1Y14 B;  3QR8 A;  4DR1 L;  3S24 A;  4A75 A;  2HQE A;  3HG9 A;  4YY3 L;  3TS2 A;  1G8Z D;  1X65 A;  3BS1 A;  2B3G A;  2HCC A;  3MXU A;  4YWL A;  4A3K H;  4PNY A;  4ZKB B;  2L1B A;  2UUB Q;  1CKN B;  4LF4 Q;  5KNC A;  2B2T A;  3F2C A;  3T1Y L;  2N49 A;  5K36 G;  4A3L G;  4CJ1 B;  1HUN A;  1NJI C;  1NNX A;  1SE2 A;  2CW0 D;  3ER0 A;  4BBR H;  5JOB A;  3W5O A;  1VQ9 A;  3F2D A;  3S2D H;  4DXG A;  2NN6 I;  1Z47 A;  2KCT A;  5IP9 H;  1TWA B;  1XMO L;  2ID0 A;  5FOB B;  3S2H H;  1S72 A;  4E6I A;  1I4R A;  4Q0F A;  4OX9 L;  1LTA D;  3NP8 A;  1PRT B;  2QDL A;  5LMN Q;  1PA6 A;  1N33 Q;  4Q5V A;  2EJF C;  1Q46 A;  3WOF A;  1CI3 M;  2F0W A;  2PI2 A;  3V96 A;  4KHP L;  1G2T A;  1E3P A;  1KLU D;  1PTO D;  1SYD A;  4APV A;  1UWV A;  4G7Z C;  3MEH A;  1PZJ D;  2XNA C;  3DWQ A;  3A0J A;  3GTG H;  1PTO F;  1LT4 D;  1F77 A;  3TZD A;  2K7V A;  1N36 L;  4J6H A;  1F2L A;  4A3E G;  2F0N A;  1CTM A;  2JEB I;  1PYW D;  3AB9 A;  1SMY C;  3E0E A;  2VQE Q;  4DU9 A;  2PQE A;  4LF7 L;  1A6X A;  5KEE A;  1YHB A;  3ULJ A;  5LMU L;  4QQB X;  1NUC A;  3OTO Q;  4IJH A;  5J22 A;  1IBL Q;  3B6Y A;  2EXZ A;  4BY7 B;  1YVC A;  3KLS X;  2EJM A;  1HFN A;  2A6E D;  4QUC A;  2AQ1 B;  3OIQ A;  4LFC Q;  2R61 A;  4KN4 C;  2OWO A;  2K14 A;  5JVH 3;  4ME5 A;  3KBX A;  1XYI A;  1A3U A;  2A19 A;  4XIG S;  4IUN A;  3SXH A;  1OXS C;  3TBI B;  3M4Q A;  2EE1 A;  5M3M G;  1R9T B;  1HPC A;  2EXD A;  4JI4 L;  2RVL A;  5ISR A;  3OW7 A;  1N32 L;  4RWS C;  4R4T A;  3MFY A;  5FK9 C;  2VS1 A;  3EFX D;  4RCN A;  3W1B A;  1KHI A;  2ICI A;  1QZH A;  2IX0 A;  4X3S A;  2SEB D;  3M85 A;  4DR1 Q;  3JC6 6;  5JAV A;  5FLX c;  4YY3 Q;  1Q82 C;  4LF5 L;  4V0B A;  5FO9 B;  1NY4 A;  4QY7 A;  2RHQ B;  4K6D A;  1LTI D;  1NE3 A;  4HTH A;  2Z6K C;  4K2K A;  3T1Y Q;  1I4P A;  1W6J A;  3PUV A;  1OTC A;  4AQY L;  5FO8 B;  5LMN W;  4M8A A;  3D6C A;  2IY5 B;  1FR3 A;  1TWA H;  4BBS G;  5JJI A;  4WJ4 A;  3QWN A;  1Y1V G;  2A6H C;  4C3I B;  2NVX B;  1XMO Q;  4HID A;  4G57 A;  4V19 0;  1MGS A;  1HA6 A;  3HOV B;  5I4D A;  1N8R C;  3CCJ A;  2KEC A;  3U4V A;  1J9O A;  4EQN A;  3X3M A;  4JV5 L;  2EY1 A;  1Y1W B;  1AE3 A;  4BA1 I;  2F0J A;  1EIH A;  1ROD A;  4LAA A;  4KHP Q;  2LS0 1;  1I3Q B;  1SMY D;  4UDU C;  2ZJP A;  5FKA C;  2ZTD A;  1B9M A;  2K5H A;  1SN8 A;  2V4D A;  4IUP A;  4TVA B;  2VXW A;  2JQO A;  3CC7 A;  1IYU A;  1P8L A;  1K83 B;  1I4H A;  1STA A;  1T5E A;  2A74 C;  1SJE D;  2LSS A;  2RKS A;  2NYZ D;  1VQ4 A;  1PVO A;  1N36 Q;  5M5Y B;  1LAB A;  3PGZ A;  1NMG A;  1ML0 D;  2FFK B;  1HNX L;  4ZYS A;  5I6W A;  2B2Y A;  2R93 G;  1OXT A;  3T51 B;  2Z1C A;  4GOP C;  1L0W A;  5IGC A;  1XNR Q;  4RGT A;  2UU9 L;  1RTO A;  2F0O A;  4LF7 Q;  5ELB A;  2JP1 A;  1LM0 A;  1D2B A;  2ES2 A;  2R7D A;  1O80 A;  2WKD A;  1V1O A;  3Q22 A;  3MC0 B;  1VQH A;  1C8C A;  1SYB A;  1RKN A;  2HIV A;  2K1B A;  3DWP A;  4LWC A;  2CKZ B;  1IYJ B;  2I5L X;  2OQK A;  4GKJ Q;  1DOK A;  2G5D A;  2NBF A;  3A5U A;  2AWO A;  1II3 A;  3M4P A;  2F0G A;  1H9R A;  4DR7 L;  3NBI A;  4JI4 Q;  3ND9 A;  1DON A;  4RG1 A;  3NE5 B;  5M5W B;  4HJA A;  2UUA Q;  2F4I A;  2BOS A;  2WFW A;  3AU7 A;  3A5Z B;  4C3H B;  2JSO A;  4A3G G;  4EQP A;  4L8J A;  4PZ7 A;  4IPG A;  1B53 A;  3K5O A;  4JI8 Q;  4KV6 A;  3D6W A;  4PMB A;  1YIT A;  4LF5 Q;  3I4N B;  2A6H D;  2Q2I A;  3VDY A;  1JMC A;  1F9Q A;  4GN4 B;  4IOA A;  3PUX A;  5IY0 A;  3T16 A;  5E4W C;  2IPK D;  5GAD C;  1QOH A;  3FRP B;  4R4I A;  1STH A;  4O0A A;  3VA5 A;  4TRD A;  1XNQ Q;  1A3V A;  4F87 A;  2MO1 A;  5IP7 G;  2RCF A;  3K58 A;  4C3I H;  2F4V L;  2NVX H;  3R3O A;  2YYZ A;  4NXN L;  4DUY Q;  3K7U C;  3HOV H;  2PMZ E;  3KLS A;  1DOM A;  1O7I A;  1R4Q B;  1CZG A;  1PXU A;  4S3S A;  2VW9 A;  1NAP A;  4FNF A;  4JV5 Q;  3FEW X;  1I3Q H;  2HT1 A;  4B3R L;  1Q8I A;  5GQO A;  1WTO A;  5KYL A;  1E22 A;  2NZH A;  1K83 H;  1S5E D;  2Z4H A;  3KJO A;  1N9W A;  1O7L A;  2F0T A;  5IGG A;  2E76 C;  4DV7 L;  5IYC H;  1I4Q A;  1PH1 A;  3TRZ A;  1F2Z A;  1HNX Q;  3QO2 A;  2LFN A;  1EYD A;  4RH6 A;  4UP9 A;  2HCI A;  1EUJ A;  4I65 A;  4IFD H;  1VS0 A;  5E1F A;  4B9W A;  2YTV A;  1WTR A;  2NVY B;  2F3W A;  2E8G A;  5EGT A;  3TQY A;  4DNI A;  5CR3 A;  5CV9 A;  4KI0 A;  5C4Z A;  1PDQ A;  5C6A A;  4KKT A;  3MWY W;  2OXP A;  1TY0 A;  2DY8 A;  3JAM E;  4A3E B;  2K5D A;  1EEF D;  4UAI A;  3VA7 A;  3QJY A;  1TT2 A;  4NMZ A;  2O5I C;  3TRE A;  4JPB W;  4LFB Q;  1ZXT A;  2PW7 A;  1BBU A;  1JQY D;  4QCL A;  1KQS A;  1WTQ A;  1IBK L;  4DUZ Q;  1JE4 A;  2JYO A;  1AFP A;  2JA5 H;  2PZW A;  4IZ8 A;  3K5N A;  4JI3 L;  5M5W H;  5IYD G;  3U4Z A;  1K9M C;  3CCU A;  1BUV T;  4HIM A;  2O2L D;  4EGV A;  4WFN 3;  4C3H H;  2Y0S G;  3JAM i;  2N55 A;  1VDZ A;  2KUM A;  2TSS A;  3K8A A;  3ZJY C;  3CCL A;  1SNQ A;  2CCZ A;  3D3R A;  2CWP A;  4DV6 L;  4YCW A;  5CYU A;  4DK0 A;  2IHE A;  3ND8 A;  3I4N H;  1NCV A;  1XPU A;  4A3M H;  2R6G A;  4CDF C;  3OSO A;  1PH2 A;  5EKI A;  4LNQ A;  3S14 B;  3HGB A;  1GUW A;  4QJF A;  4IUU A;  5M3F G;  2Z8L A;  3J81 c;  1SYC A;  3DM3 A;  5C5L A;  2E2D C;  2VB3 X;  3CCR A;  4A93 G;  2K6A A;  3KLR A;  1HRJ A;  3WDN A;  1D5X C;  4PMW A;  5C3X A;  3TS0 A;  5JVG 3;  4ZUJ A;  4RCO A;  1DYQ A;  1TS2 A;  3C3L A;  1FD7 D;  1JJ2 A;  2K52 A;  1OO9 B;  3HKZ G;  3CME A;  1TWF B;  2PI2 E;  2XSC A;  4JOI C;  1UAP A;  5K36 H;  1Y8N B;  2IT1 A;  3S17 H;  2WKC A;  5JPN C;  4A3F G;  4JBM A;  3TDQ A;  3HOY G;  3QIA A;  3NXW A;  2LY7 A;  4OXP A;  2UXC Q;  2N3S A;  1HNW L;  5KYI A;  2EPB A;  1F9P A;  1Z6H A;  2B63 G;  4IUR A;  4DR2 L;  2YTY A;  1Y69 U;  3AFQ A;  3Q23 A;  3NTK A;  5JEA H;  4A3I G;  1I6H B;  3FHW A;  4FVM A;  1D1I A;  2P5Z X;  2B2W C;  1YNN C;  5IYB G;  1JB7 A;  3CPF A;  1IYV A;  2ATW A;  5J39 A;  3ULP A;  2VZA A;  2FMC A;  3I7F A;  1XXG A;  2AUJ D;  2B2V A;  2KA7 A;  4FXG C;  3C1E A;  4F7X A;  2R7Z G;  4QIW E;  4JI0 Q;  1VQG A;  1FNV A;  4IPC A;  4P74 A;  4GLX A;  2NVY H;  1D6E C;  2A68 C;  4PZ8 A;  4POG A;  4L5S A;  4JW0 A;  4DKA C;  4QGU A;  4A3E H;  2DNC A;  3AMU A;  2J0T D;  2NVT B;  2I0Q A;  1PH4 A;  1EEI D;  1E0B A;  3IRB A;  5FJ8 G;  1STE A;  1XX8 A;  3OOC A;  4DGZ A;  5JPM C;  1KD1 C;  3A7L A;  3VR4 A;  1B4O A;  2OQ0 A;  4JBW A;  1IBK Q;  3K7A B;  4LW1 A;  2BCO A;  3KUP A;  2PNH A;  2UUB L;  4LF4 L;  4JI3 Q;  4HCS A;  5IE8 A;  4RKB A;  3F1Z A;  2MQH A;  1VQE A;  4HIO A;  1I4G A;  4WOR A;  4CGY B;  1LTG D;  2HIX A;  1CKO A;  3TP8 A;  3BZC A;  3UDI A;  2CVR A;  1KLG D;  1G6Z A;  1HJP A;  2B8G A;  3S14 H;  5LMN L;  1N33 L;  4K8I A;  1B2T A;  2K04 A;  2F3I A;  3EBE A;  4DK6 C;  2H1E A;  3C1F A;  2CFM A;  3OPO A;  3Q6S A;  1PFN A;  3P20 A;  3H09 A;  2MP1 A;  1PHJ A;  1PZK D;  2VY3 A;  1GJX A;  3NPP A;  2F0H A;  4RFB A;  1SE8 A;  4FP5 D;  4A3G B;  2DJF C;  1C4Q A;  3PIO A;  1I94 L;  3A7A B;  2ZM6 L;  3BDO A;  1BCP B;  3R2T A;  3TP7 A;  4NB3 A;  4EQO A;  2I5M X;  4A3J G;  3PV0 A;  3ERO A;  3Q24 A;  5IGB A;  1WCM H;  1HQM C;  4CDE C;  3AYH B;  2ZJQ A;  4IPD A;  1YNN D;  3I72 A;  2PZT A;  3PCO B;  3GTO B;  1B3A A;  2E2I B;  3OHX C;  3DXJ C;  1L1O C;  2Q8T A;  5J1Z A;  3A56 A;  1EYC A;  1P16 A;  2R92 B;  1HNW Q;  1U4L A;  1TVX A;  4YIJ A;  3JAM L;  4AYB E;  2A68 D;  2K05 A;  3FKI G;  4DR2 Q;  1I6H H;  4BXX H;  1S5D D;  1BR9 A;  2LXK A;  1LO5 D;  2EYH A;  4ZCK A;  2MUY A;  4KKS A;  4LFC L;  1B3Q A;  3G4S A;  3PO2 G;  1TR5 A;  1SXT A;  3H94 A;  3RZD B;  1B8A A;  4TQU S;  4K5W A;  1I4X A;  1A62 A;  2F0M A;  5KNB A;  3NTI A;  2Z6B A;  4RGN A;  2GVB A;  3MAQ A;  3MTS A;  1WVL A;  3CQZ B;  1KRT A;  3H3V H;  1CUK A;  3T13 A;  1CT1 D;  2D62 A;  2IJ0 A;  4BS9 A;  1MHW C;  4R8I A;  1SND A;  2NVT H;  1X56 A;  1D8L A;  4DV2 Q;  3HOX H;  4C56 C;  1Q12 A;  1KDB A;  2B2U A;  3I70 A;  2D5D A;  1Z9F A;  4LK1 C;  1IW7 C;  2F0Q A;  3HP3 A;  2B2T C;  1J8I A;  5ELC A;  4FO2 A;  3K7A H;  3QOL A;  1X3G A;  2LMC B;  4KY7 A;  4DAP A;  1KNA A;  5TSS A;  3ULL A;  2E2H B;  2RCN A;  3F8T A;  3KF6 A;  4DV5 Q;  1SFO B;  2E2J B;  2F0U A;  2B39 A;  4LUZ A;  5D14 A;  1DM0 B;  2Q2U A;  1AE2 A;  3L0O A;  1AW7 A;  5F2D A;  4NXM Q;  4IUT A;  4EX5 A;  3KLW A;  4EVO A;  1JOO A;  2MNA A;  1QVG A;  2BA1 A;  4ZRZ A;  2JJQ A;  5ELE A;  4CDC C;  1VQ5 A;  3MXN B;  2WB1 E;  4M1U B;  3I4O A;  4OIK A;  1UEA B;  4OL7 A;  4A3G H;  3H91 A;  4PZ6 A;  3SE0 A;  2F0L A;  2QIL A;  3CKI B;  2L4N A;  4RGM A;  2NN6 H;  4YCU A;  4FF1 A;  4HN7 A;  2MGS A;  3S1N B;  3SK4 A;  1I94 Q;  2ZM6 Q;  3E9I A;  1FNU A;  3HZX A;  2VNU D;  1SR3 A;  2NVQ B;  5C0X H;  3HOZ G;  2JN4 A;  4X3K A;  3HOW B;  1JOK A;  3CHB D;  2DN8 A;  1CA5 A;  2RBM A;  3LWE A;  2F0P A;  4ILW A;  1X54 A;  4L5T A;  1S4Z A;  3GTO H;  1LTS D;  1XNR L;  1GHJ A;  2E2I H;  4DR5 L;  1NR4 A;  2SNM A;  1VQL A;  2RDH A;  2R92 H;  4OO1 G;  4A93 B;  3FMC A;  4KLK A;  3BDL A;  4JYA Q;  1L0Y B;  1KNE A;  4KHZ A;  5CV7 A;  5I6Y A;  4F88 A;  2LKV A;  1TS4 A;  3N6R A;  1EU3 A;  2RF4 A;  5D65 A;  3J7Z C;  3M4O B;  4R4C A;  3RZD H;  1LTR D;  4R4O A;  3HKZ B;  4GKJ L;  3NEN A;  2DJG C;  4X64 Q;  1EY6 A;  4B3M Q;  2VB2 X;  2Q2T A;  2EJG C;  4KHV A;  3A8K E;  1QCB D;  4A3F B;  4MNO A;  3VYU A;  2IWH A;  4LF9 Q;  3CQZ H;  1OXU A;  1HHV A;  1IW7 D;  1PFM A;  2ASB A;  2NZO A;  4G4K A;  5ELD A;  2B63 B;  2UUA L;  1PH3 A;  4KJO A;  5CV6 A;  3H0G G;  3QB3 A;  2Q8R E;  1JJC B;  3IFD A;  3NBH A;  4A3I B;  3EJI A;  4AH6 A;  4OIJ A;  2MFI A;  2VUM G;  1IHZ A;  2A69 C;  4DV0 L;  1HH2 P;  1HZB A;  1JIC A;  4O1N A;  4JI8 L;  1WTW A;  3CAM A;  4XTC S;  2R7Z B;  2WAQ B;  1YHA A;  4YWM A;  4BY1 G;  4DNR B;  4A3D G;  4CKE A;  2E2H H;  1KL9 A;  2AMC B;  4A3B B;  1SFO H;  1JWM D;  4RA8 A;  2F0I A;  1A8V A;  1ESF A;  1XNQ L;  1X32 A;  1HUM A;  1STG A;  2WAC A;  4DAY B;  1S5C D;  1H9J A;  3KJP A;  1XWE A;  3BVG A;  1CKM A;  1ILQ A;  1BBW A;  4DUY L;  2O4X A;  3RNU A;  2KCN A;  1N34 Q;  2KOL A;  4YHH L;  3CCQ A;  4A3C G;  4LMQ D;  1V1Q A;  1GO3 E;  2F1M A;  1ILP A;  4P72 A;  3PF4 A;  3G71 A;  3PO3 B;  1SAP A;  5CGK A;  1VQJ A;  5COR A;  3S1N H;  1VQD A;  2Z6K A;  1TKW B;  5FO7 B;  2RDG A;  2WAQ E;  2EYM A;  3BVM A;  4H02 A;  2JA8 B;  4KMU C;  3EN2 A;  1S5B D;  3VR6 A;  1HTL D;  3RN5 A;  3NQT A;  3HOU B;  3HOW H;  1NR2 A;  3TME A;  2JA6 G;  2F52 A;  1KAW A;  5EPK A;  1VF5 C;  3PIP 3;  1UNS A;  1V9P A;  1VQP A;  3GTJ B;  3LWU A;  1E2V A;  4DR5 Q;  2A8V A;  4A93 H;  4BY7 H;  1B9N A;  1PLF A;  3FP9 A;  4NW2 A;  4RKL A;  2JA7 B;  2NTT A;  4OHJ A;  1EZ8 A;  2XN9 C;  3M4O H;  4A3J B;  1YBY A;  5FLM G;  3E3X A;  1G2S A;  1Q90 A;  3WWV A;  3VYS A;  4CKB A;  1QUQ A;  3UE1 A;  4LFB L;  4ID6 A;  2OF1 A;  4A3F H;  2A69 D;  2R3Z A;  3FVQ A;  1ZKO A;  4H44 C;  1K8A C;  4DUZ L;  4DFA A;  5A35 A;  1R9T H;  1QVF A;  4GOP A;  3OYY A;  1FJG Q;  3A55 A;  4A3K G;  2B63 H;  2D2C C;  2R7F A;  5C3W A;  5IWA L;  1TWH B;  1U4R A;  4A3I H;  2FIN B;  1X3Q A;  1JE5 A;  2Z0S A;  3PO2 B;  3K0Y A;  3RMH A;  4DV0 Q;  4MN3 A;  4XYQ A;  2R7Z H;  3EA6 A;  4DXF A;  4K6L A;  5C5M A;  1JT8 A;  3GV3 A;  2BE5 C;  4AYB G;  3JAM c;  1BDO A;  5H1S E;  1EIF A;  3R93 A;  2A1A A;  1B44 D;  1ENF A;  2GA4 B;  3LX0 A;  4WJ3 M;  3HRZ C;  4IJL A;  4A3B H;  4X6A H;  1VQO A;  4Y7N B;  4MTN A;  4L63 B;  5DAU A;  2KED A;  1PH5 A;  2IL8 A;  2F0F A;  1X3E A;  1D7Q A;  1BF4 A;  1SE4 A;  4A76 A;  1MKH A;  5CBA E;  5K5P A;  5J3B A;  2JEA I;  1KAB A;  3R2I A;  4DPG A;  4FXK C;  1GUG A;  1H9K A;  3TP6 A;  2F0V A;  3GV6 A;  1KDA A;  3I73 A;  4Y52 H;  1VQA A;  2SDF A;  4JI1 Q;  1XJV A;  1XMQ Q;  4YHH Q;  3U58 A;  4MHE A;  1HNZ Q;  1Y1W H;  2X69 A;  1RJT A;  3PO3 H;  1K8G A;  1B1Z A;  1QZG A;  2UXC L;  1PTO B;  5C44 G;  2KHS A;  1PRT C;  2JA8 H;  1AP0 A;  2E75 C;  1WTP A;  1UE1 A;  3HOU H;  2B29 A;  4UY8 C;  5EKK A;  2F3V A;  1WJJ A;  5M5Y H;  1M8A A;  2HDM A;  4L5R C;  1QNK A;  3MXN A;  1L2F A;  1YI2 A;  3W2D A;  1TXY A;  3GTJ H;  4JI7 L;  1IZ6 A;  1BBX C;  4JI0 L;  1H95 A;  4GNX C;  2EYJ A;  4C1N K;  3HKS A;  4X3U A;  1TU2 B;  3EIV A;  2JA7 H;  2OTJ A;  4X65 Q;  1QVC A;  4R8N A;  3NK9 A;  3K57 A;  3KF6 B;  1F9S A;  5DM6 3;  3HOZ B;  2PYK A;  3NTH A;  3S1R B;  1RHP A;  4RHR A;  4DNT B;  1KDC A;  1M90 C;  1TQO A;  1ICF B;  1QWY A;  3T56 B;  4FXD A;  5ELO A;  4K0K L;  4JCV E;  3BYT B;  3ITP A;  1Q1B A;  2BE5 D;  4C2M B;  1TWH H;  3GDE A;  3VYT A;  1J5E Q;  3V05 A;  3GTM B;  1Q1E A;  5IOC A;  5IWA Q;  4PG3 A;  5G3L D;  1HA5 A;  3S1M B;  3PO2 H;  3CRL C;  3CPW A;  3UI2 A;  1KRS A;  3UDF A;  3DEO A;  4K2L A;  4K14 A;  1RTN A;  1Q8K A;  1FL0 A;  2ZXO A;  1WI5 A;  3KDF B;  4LUV A;  5G3L F;  3X3N A;  2L9H A;  1C0A A;  4G7H C;  1FGU A;  2OCE A;  2A5H A;  5T1G A;  4Y7N H;  1VQ8 A;  5M3M B;  4CBV A;  4N9T A;  5E4X A;  3L7Z C;  1YIJ A;  4F8M A;  5DLQ E;  1I5F A;  4U67 3;  2WIN B;  3I56 A;  1XPR A;  4WJW A;  4JBK A;  3A8J E;  1WFQ A;  4NP5 A;  2WP8 J;  3BVZ A;  4LJZ C;  1IL8 A;  1TY2 A;  5EKL A;  3CC2 A;  2QF7 A;  1X9N A;  1PRT D;  3VR3 A;  2EOT A;  3S9W A;  2C5C A;  4BY1 B;  4A3D B;  3SHL A;  3SK6 A;  4C3J G;  3M3Y B;  1C9O A;  2XWB B;  1HXY D;  4A3L H;  3MA2 B;  5BN4 A;  3FPP A;  1YNJ C;  1GKH A;  1PTO H;  3I3C A;  4DAY A;  1JJG A;  4JG2 A;  2MJ8 A;  4X66 L;  1EQQ A;  1AZQ A;  2E5L L;  4BBS B;  4LF6 L;  4C1N I;  3KF8 A;  1Y1V B;  2C35 B;  2AKW B;  1LV9 A;  2B2V C;  3NBH B;  3MVV A;  2BA0 A;  5COY A;  2KBN A;  4GS3 A;  3MEF A;  3K5L A;  1WD0 A;  3ERS X;  2OTL A;  1VMC A;  2EYP A;  1VQ6 A;  4JI7 Q;  4IN3 A;  1JR0 D;  4NDX A;  1OXX K;  1PYS B;  2G9H D;  4JOI A;  4DR3 Q;  1XTC D;  1XTD A;  4KN7 C;  2PPB C;  1VQM A;  2UUC L;  4OO1 I;  3GD7 A;  2Z9H A;  3CMA A;  2CH4 A;  3E0J A;  4DV2 L;  3GTL B;  3HOZ H;  4JK1 C;  3S1R H;  2K33 A;  3K59 A;  4N8X 1;  1PH8 A;  2K4K A;  1ZYR C;  4HSP A;  5CMD A;  2R93 B;  1EQR A;  2B2W A;  1U4M A;  4HED A;  4JVZ A;  5D3I B;  4XQQ A;  3DHQ A;  5I9P A;  2EDG A;  4K0K Q;  2ICE C;  3CF5 A;  3GTM H;  1A2U A;  3U9S A;  4DV5 L;  1K73 C;  5HUR A;  2KCM A;  1LT3 D;  3S1M H;  1HFG A;  1SBB B;  4NXM L;  2Q2H A;  2KCC A;  1EY9 A;  2DNE A;  1CSQ A;  1M1K C;  1CHP D;  1V1P B;  3HOV G;  5M3M H;  4FF4 A;  4U68 A;  2RDF A;  5E3F A;  4JI5 L;  3ICE A;  1FVI A;  4HR7 B;  3WOE A;  2K32 A;  2UXB Q;  1Q7Y C;  3HEJ A;  1D1K A;  4J1M A;  2L55 A;  3I4L A;  1YNJ D;  1A15 A;  1EFW A;  1SDF A;  3J81 i;  3J80 E;  3IKJ A;  1EYG A;  4BY1 H;  3S2H B;  3K80 C;  2JXM B;  1MBY A;  1TWF H;  3M3Y H;  5IGE A;  4GN3 B;  1V8Q A;  1QUQ B;  2ZTE A;  1U4P A;  2ZT9 C;  4G7O C;  1QB5 D;  1JWS D;  1O78 A;  1RCV D;  1K0R A;  5AFW A;  3SEB A;  4IFD G;  3D4R A;  1GUO A;  1CHQ D;  5EPL A;  3M9B A;  4HMJ A;  4GOP B;  4R4Q A;  4BBS H;  3J80 i;  4B08 A;  2F0E A;  4X66 Q;  4JYA L;  5BR8 L;  1Y1V H;  4RMF A;  1ZEQ X;  3PMF A;  2E5L Q;  1UUP A;  2TMP A;  4I7Z C;  4LF6 Q;  1ONL A;  5C4X G;  4QL5 A;  1SNP A;  1L0X B;  1CK1 A;  5JJZ A;  4A3C H;  4X64 L;  4B3M L;  3O13 A;  3UE0 A;  1ZYR D;  2EIF A;  4QF4 A;  3S15 B;  4QB4 A;  4LF9 L;  1O7Y A;  3FPU B;  4IOC A;  2AWN A;  2JA5 G;  3VR5 A;  5C44 B;  4DV3 L;  1ICW A;  2E74 C;  2B2U C;  4DK3 C;  2BDO A;  2G9D A;  4JI2 L;  3GTL H;  2UUC Q;  3URY A;  2FMM A;  1GM5 A;  2AQ2 B;  4ZAI A;  5M9O A;  4HSV A;  4DAM A;  2HD3 A;  1GXD C;  2R93 H;  4XQJ A;  1HCZ A;  3C46 A;  1SLJ A;  1K0S A;  1VQ7 A;  3I4N G;  4A3M G;  1WYD A;  1B7Y B;  1AZP A;  1WOC A;  1Q3L A;  3I55 A;  5KIX A;  4OEL B;  1LT6 D;  1JWU D;  1K28 A;  2YU9 B;  3A54 A;  4N9P A;  1X55 A;  5FLM H;  5LHY 1;  2OT2 A;  1T9H A;  1CM9 A;  4RAU C;  1QJO A;  4HIK A;  1GHK A;  5ELN A;  2HQL A;  2RSO A;  1N34 L;  4HMI A;  4X62 L;  1FYC A;  1GUT A;  3DWA A;  3RLO A;  4CKC A;  3SDZ A;  1IBM L;  5CBE E;  4DV1 L;  2N8N A;  2NB0 A;  1IXR A;  4XT1 B;  2K5N A;  4JI5 Q;  4GLV B;  3GTQ B;  4DAV A;  1LTT D;  4L5Q A;  5M5X B;  4ODG A;  2Y0S B;  3W1G A;  2DGY A;  3EVQ A;  4UP7 A;  1YNX A;  3I2Z A;  3CW2 C;  5JJL A;  2L0C A;  3KDF A;  4K8J A;  3I4M G;  1LTL A;  2QDB A;  5GAE C;  1VQC A;  2GVA A;  3D4W A;  5JEA G;  1VQF A;  4P71 A;  1W6K A;  2HHH Q;  3N52 A;  4Z9C B;  5C0X I;  1MSH A;  1ENA A;  3VYR A;  1X3F A;  4O42 A;  4P75 A;  2K50 A;  4OGQ C;  5HGQ A;  5M3F B;  1HZC A;  2EY6 A;  1TWG B;  5C3E G;  3BU2 A;  5IP7 H;  1A3T A;  2I46 A;  5BN3 A;  1HTP A;  2JA9 A;  4XDX A;  4GNX B;  1JCK B;  1BXT A;  1SRU A;  2K28 A;  5BR8 Q;  1ASZ A;  2KVM A;  1RF2 D;  2A73 B;  2CH4 W;  2K75 A;  3BZK A;  1TS5 A;  4K5V A;  2CQA A;  4MZ9 A;  5IT9 E;  1E2Z A;  2XVS A;  5NUC A;  5EJW A;  2C9O A;  4C3J B;  2Y0S E;  3U50 C;  3LNN A;  1VQK A;  3S15 H;  2N78 A;  4A4I A;  4HJ5 A;  1MD2 D;  1MI2 A;  4P73 A;  3NWT A;  5C44 H;  1FJG L;  3HOY B;  1Z7T A;  1VF7 A;  4PQX A;  4DV3 Q;  3I91 A;  1SE3 A;  1SMX A;  4CHT B;  5BN5 A;  4JI2 Q;  1EFI D;  5LL6 X;  1QNU A;  2N88 A;  4JI6 L;  1C48 A;  1ESR A;  1S5F D;  2QEJ C;  3V2T A;  1D5Z C;  3L9A X;  1LAC A;  1EWC A;  3J81 L;  3PF5 A;  3MXG A;  2L11 A;  1CA6 A;  4OWX B;  1H9M A;  1FNW A;  3H3V C;  2D0P A;  2IW3 A;  4HCE A;  5CV4 A;  1RDP D;  4CDD C;  3CCV A;  4FF2 A;  2NZ1 D;  2Q8I B;  4AIM A;  3J7Y W;  2UXD Q;  2YU9 H;  2E2J H;  1MJC A;  2ZXP A;  1D5M C;  4B9X A;  4JBJ A;  2DY7 A; 
#chains in the Genus database with same CATH homology
 1KIX A;  1XJV A;  2VL6 A;  3HKZ E;  2B63 G;  1XMQ Q;  4DR2 L;  1BVS A;  2YTY A;  4YHH Q;  3AFQ A;  3U58 A;  1HNZ Q;  1Y1W H;  5IT9 c;  1Q81 C;  1V43 A;  2I5H A;  3FHW A;  4A3I G;  1IL2 A;  3PO3 H;  5IYB G;  1JB7 A;  2UXD L;  3CPF A;  2ATW A;  1K8G A;  1QZG A;  1E24 A;  3J7A 5;  2UXC L;  2EQS A;  3KF8 B;  3PUW A;  2VZA A;  3Q8D A;  4JI1 L;  1VCI A;  3I7F A;  5C44 G;  3ULP A;  3CD6 A;  2KHJ A;  4X62 Q;  2JA8 H;  2V1C C;  5C0X J;  1XMQ L;  1IBM Q;  2MO0 A;  5GAG C;  2R7Z G;  1UE1 A;  1WCM G;  2B29 A;  4QIW E;  4DV1 Q;  4JI0 Q;  1Y14 B;  1PH6 A;  1HNZ L;  1VQG A;  3GTQ H;  1A0I A;  4UY8 C;  1KC8 C;  4IPC A;  4P74 A;  4GLX A;  2NVY H;  5M5X H;  3S24 A;  4DR1 L;  4PZ8 A;  4A75 A;  1HNW L;  4POG A;  1WJJ A;  5M5Y H;  1W3S A;  4GLA C;  4YY3 L;  4L5S A;  3TS2 A;  4L5R C;  1X65 A;  1VQN A;  2B3G A;  1L2F A;  1YI2 A;  1TXY A;  4YWL A;  3GTJ H;  4DKA C;  4QGU A;  4A3E H;  4A3K H;  1YJW A;  1YJ9 A;  4JI7 L;  1IZ6 A;  4HJ8 A;  2I0Q A;  4JI0 L;  1PH4 A;  1H95 A;  4GNX C;  3IRB A;  5FJ8 G;  2UUB Q;  1CKN B;  4LF4 Q;  2NVQ H;  3F2C A;  4BXX G;  3T1Y L;  2N49 A;  5K36 G;  4A3L G;  3HKS A;  4OX9 Q;  3EIV A;  1NJI C;  2JA7 H;  2OTJ A;  4X65 Q;  1QVC A;  1GVP A;  2JE6 I;  1KD1 C;  3ER0 A;  2OQ0 A;  4BBR H;  3KF6 B;  5M3F H;  3W5O A;  4JBW A;  1IBK Q;  1VQ9 A;  3F2D A;  3S2D H;  1Q86 C;  1TWG H;  2NN6 I;  1Z47 A;  2KCT A;  4LW1 A;  2PNH A;  5IP9 H;  2UUB L;  1XMO L;  3BJU A;  2ID0 A;  4B3T L;  4JI3 Q;  4LF4 L;  5IE8 A;  3S2H H;  3F1Z A;  2MQH A;  1VQE A;  1S72 A;  1M90 C;  3A74 A;  4HIO A;  4OX9 L;  5LMN Q;  1N33 Q;  4X65 L;  1PA6 A;  2HIX A;  1CKO A;  1EWI A;  5ELO A;  4K0K L;  1Q46 A;  4JCV E;  2L15 A;  1Q1B A;  3BZC A;  2PI2 A;  4KHP L;  3HOX G;  1E3P A;  3PUY A;  3UDI A;  1TWH H;  2FXQ A;  3GDE A;  1J5E Q;  4C3J H;  3T1H L;  2DUD A;  1Q1E A;  4APV A;  1UWV A;  5IWA Q;  1HJP A;  4PG3 A;  3S14 H;  5LMN L;  1N33 L;  3J81 j;  3PO2 H;  1CSP A;  3CPW A;  2F3I A;  3EBE A;  3A0J A;  4DK6 C;  1K3R A;  1KRS A;  2CFM A;  3UDF A;  5LMU Q;  3GTG H;  3HOY H;  1Q8K A;  1PHJ A;  1FL0 A;  1G29 1;  1N36 L;  4A3E G;  1WI5 A;  2VY3 A;  3CXC A;  3KDF B;  4LUV A;  1J5E L;  4DR6 L;  1C0A A;  2JEB I;  1SE8 A;  1FGU A;  3HFZ B;  2ZJR A;  2OCE A;  2ALY B;  3E0E A;  3PIO A;  1I94 L;  4Y7N H;  2ZM6 L;  3SGI A;  2VQE Q;  1VQ8 A;  4LF7 L;  3KYH C;  5IYB H;  4JI6 Q;  1YHB A;  3ULJ A;  4NB3 A;  5LMU L;  4QQB X;  3OTO Q;  3L7Z C;  4IJH A;  1YIJ A;  1IBL Q;  4BBR G;  2I5M X;  3B6Y A;  4A3J G;  3PV0 A;  2PQA A;  1I5F A;  5DLQ E;  1NMF A;  1YVC A;  3I56 A;  5IP9 G;  1E7Z A;  1WCM H;  2RHS B;  1XPR A;  3AYH B;  4JBK A;  2ZJQ A;  4IPD A;  1WFQ A;  2WP8 J;  3PCO B;  1YJN A;  4LFC Q;  3CC2 A;  1X9N A;  2OWO A;  5JJK A;  2K14 A;  1N32 Q;  1L1O C;  1P16 A;  2KHI A;  2QGQ A;  1HNW Q;  1UEB A;  2A19 A;  5FJ8 H;  4XIG S;  4AYB E;  3FKI G;  4DR2 Q;  2NN6 G;  1RIP A;  1I6H H;  1C9O A;  1OXS C;  4BXX H;  2LXK A;  3M4Q A;  5M3M G;  4JI4 L;  2EXD A;  4A3L H;  4LFC L;  3G4S A;  3PO2 G;  1GKH A;  1N32 L;  1JJG A;  4R4T A;  1B8A A;  4JG2 A;  4TQU S;  5C0X G;  2VS1 A;  1A62 A;  1NBW A;  4X66 L;  3W1B A;  1EQQ A;  2E5L L;  3PUZ A;  1KHI A;  3OW2 A;  4LF6 L;  1QZH A;  2IX0 A;  2C35 B;  2AKW B;  1RL2 A;  2GVB A;  3NBH B;  3M85 A;  4DR1 Q;  1B70 B;  1KRT A;  3STB C;  2BA0 A;  3TEH B;  3JC6 6;  5FLX c;  1CUK A;  4YY3 Q;  1Q82 C;  2KBN A;  4LF5 L;  4GS3 A;  3H3V H;  2D62 A;  4AQY Q;  4O2D A;  3MEF A;  2NVT H;  1X56 A;  2R92 G;  1D8L A;  3ERS X;  4DV2 Q;  1NY4 A;  3HOX H;  2OTL A;  4QY7 A;  2D0O A;  3AFP A;  1VQ6 A;  4JI7 Q;  3G6E A;  1Q12 A;  3G48 A;  3CCS A;  2RHQ B;  1E1O A;  1OXX K;  1PYS B;  4JOI A;  5HY6 A;  3PIP A;  1NE3 A;  1XPO A;  1YEZ A;  1L1O B;  4DR3 Q;  2Z6K C;  3CCM A;  3T1Y Q;  1XTD A;  1Z9F A;  1GD7 A;  3PUV A;  1VQM A;  1OTC A;  1CKN A;  2UUC L;  4AQY L;  4OO1 I;  3GD7 A;  5LMN W;  3CMA A;  4LF8 L;  3D0F A;  1NTG A;  3K7A H;  4DV2 L;  3HOZ H;  1X3G A;  1KXL A;  2IY5 B;  1TWA H;  4BBS G;  1YHQ A;  2YV5 A;  1UE7 A;  3S1R H;  4WJ4 A;  5JJI A;  1Y1V G;  3ULL A;  2RCN A;  3F8T A;  1XMO Q;  1PH8 A;  3KF6 A;  2K4K A;  4DV5 Q;  4HID A;  4DR3 L;  4B3T Q;  2VQF L;  4IFD I;  1TWC H;  4LUZ A;  1EQR A;  2Q2U A;  1AE2 A;  1N8R C;  3CCJ A;  3L0O A;  3U4V A;  2QEX A;  4NXM Q;  2WB1 G;  4JV5 L;  4EX5 A;  4K0K Q;  1AE3 A;  3KLW A;  4A3J H;  5E7N A;  4BA1 I;  3UDG A;  4KHP Q;  1PV4 A;  4B3S L;  3CF5 A;  2MNA A;  3GTM H;  2ZJP A;  4DV5 L;  1QVG A;  2ZTD A;  3T1H Q;  1K73 C;  2K5H A;  2BA1 A;  2KCM A;  3S1M H;  1SN8 A;  3RZO H;  4TVA B;  4IO9 A;  1HR0 L;  2JQO A;  2JJQ A;  3CC7 A;  3GO5 A;  1P8L A;  2UU9 Q;  1VQ5 A;  3MXN B;  4NXM L;  2Q2H A;  2WB1 E;  1CSQ A;  1M1K C;  3I4O A;  2LSS A;  4HJ7 A;  3KOJ A;  1VQ4 A;  1PVO A;  1N36 Q;  4JBJ A;  4GNX A;  4PZ6 A;  4A3G H;  3D31 A;  1NMG A;  3PGZ A;  4DR6 Q;  1S3O A;  2KEN A;  3FKI H;  4YCU A;  1HNX L;  3HOV G;  4NPS A;  2R93 G;  5C4X H;  1OXT A;  4FDB A;  5M3M H;  4GOP C;  4OWT B;  1U5K A;  1L0W A;  1I94 Q;  1XNR Q;  5AJ3 L;  2ZM6 Q;  3E9I A;  4JI5 L;  2UU9 L;  3ICE A;  4J15 A;  5GAH C;  1FVI A;  1U0L A;  4LF7 Q;  2VNU D;  1LM0 A;  1SR3 A;  4YWK A;  3HOZ G;  2UXB Q;  1VQI A;  1Q7Y C;  2ES2 A;  2R7D A;  4DR7 Q;  1VQH A;  1X54 A;  4L5T A;  4GKK L;  2HIV A;  3GTO H;  1EFW A;  1XNR L;  2AHO B;  2IHF A;  4LWC A;  2CKZ B;  3J81 i;  2E2I H;  4DR5 L;  3RN2 A;  1IYJ B;  2I5L X;  2OQK A;  1VQL A;  4GKJ Q;  1YZ6 A;  1EYG A;  4BY1 H;  2R92 H;  3K80 C;  4OO1 G;  2UXB L;  3H15 A;  3A5U A;  2AWO A;  4KLK A;  3M4P A;  1TWF H;  3M3Y H;  4DR7 L;  4JYA Q;  4KHZ A;  3STB D;  4GN3 B;  1QUQ B;  2RF4 A;  2ZTE A;  4JI4 Q;  3J7Z C;  4HJ9 A;  4R4C A;  3RZD H;  4RG1 A;  4IFD G;  4R4O A;  1K0R A;  4GKJ L;  3NEN A;  3CC4 A;  4HJA A;  2UUA Q;  3HOU H;  1A63 A;  4X64 Q;  3HOW G;  3M9B A;  2WFW A;  4B3M Q;  4GOP B;  4R4Q A;  3A5Z B;  1UE5 A;  3DLL A;  4BBS H;  3J80 i;  2Q2T A;  4X66 Q;  4A3G G;  5BR8 L;  1Y1V H;  4JYA L;  4PZ7 A;  4IPG A;  4RMF A;  4MNO A;  2E5L Q;  4LF6 Q;  4LF9 Q;  4OWW B;  3CQZ H;  1OXU A;  2XGT A;  5C4X G;  4QL5 A;  5IYD H;  2ASB A;  4JI8 Q;  2NZO A;  4A3C H;  2UUA L;  1YIT A;  5C4J H;  4LF5 Q;  4DV4 L;  4X64 L;  1PH3 A;  4IFD J;  4B3M L;  3H0G G;  4BY7 G;  1JJC B;  2Q2I A;  3VDY A;  1JMC A;  4GN4 B;  3UE0 A;  4AH6 A;  4IOA A;  2F4V Q;  2EIF A;  1PYB A;  3PUX A;  5IY0 A;  2YTX A;  4NXN Q;  2MFI A;  4LF9 L;  2VUM G;  5GAD C;  4DV0 L;  1HH2 P;  1HZB A;  1PFS A;  2AWN A;  4YCV A;  4R4I A;  4IOC A;  2JA5 G;  4JI8 L;  4DV3 L;  3RLN A;  4O0A A;  1XNQ Q;  1SRO A;  3CAM A;  4DK3 C;  4JI2 L;  4XTC S;  4LFA L;  2MO1 A;  4R1J A;  3GTL H;  1YHA A;  3RR5 A;  3J80 c;  2UUC Q;  4YWM A;  1GM5 A;  5IP7 G;  4LF8 Q;  4BY1 G;  1OXV A;  4A3D G;  4C3I H;  3GTP H;  2E2H H;  4DAM A;  2NVX H;  4ME3 A;  2F4V L;  1KL9 A;  2AMC B;  2YYZ A;  4B3R Q;  4NXN L;  1SFO H;  4DUY Q;  3E9H A;  3K7U C;  3HOV H;  2R93 H;  2PMZ E;  1A8V A;  3RLF A;  1O7I A;  1SLJ A;  1XNQ L;  2VQF Q;  1MJE A;  1VQ7 A;  3I4N G;  4DAY B;  3I4M H;  2VW9 A;  4A3M G;  1WYD A;  1B7Y B;  4DR4 L;  1W2B A;  4JV5 Q;  1I3Q H;  1WOC A;  3KJP A;  4DV7 Q;  2HT1 A;  4B3R L;  3I55 A;  1CKM A;  5GQO A;  1BBW A;  5EAY A;  4DUY L;  3RNU A;  4B3S Q;  1N34 Q;  1PH7 A;  1E22 A;  2NZH A;  1K83 H;  1X55 A;  5FLM H;  4YHH L;  3CCQ A;  2WAQ G;  1AH9 A;  4A3C G;  1HR0 Q;  5C3E H;  1T9H A;  1N9W A;  3KJO A;  1BKB A;  1V1Q A;  3CCE A;  1GO3 E;  3L2P A;  4P72 A;  1MIU A;  2ZTC A;  5ELN A;  4C2M H;  5IYC H;  4DV7 L;  4HIK A;  4A3B G;  1DGS A;  3F2B A;  2HQL A;  3PF4 A;  3G71 A;  1PH1 A;  3TRZ A;  1N34 L;  1HZA A;  1LUZ A;  1VQJ A;  2LXJ A;  4GN5 A;  3S1N H;  1VQD A;  4X62 L;  1HNX Q;  2Z6K A;  3RLO A;  1IBM L;  2WAQ E;  4UP9 A;  4DV1 L;  2N8N A;  4H02 A;  1EUJ A;  1IXR A;  3EN2 A;  1VS0 A;  2K5N A;  4POF A;  4GLV B;  5AJ3 Q;  3RN5 A;  4JI5 Q;  2XTI A;  2YTV A;  3HOW H;  4IPH A;  4L5Q A;  2E8G A;  4DNI A;  3TQY A;  3W1G A;  2JA6 G;  3AEV A;  2JK8 A;  2H5X A;  2DGY A;  4UP7 A;  4ALP A;  4KI0 A;  3S16 H;  3S1Q H;  1YNX A;  2F52 A;  3I2Z A;  3CW2 C;  5JJL A;  1KAW A;  4GKK Q;  1V9P A;  3KDF A;  1VQP A;  1VQB A;  1LYL A;  4UP8 A;  1PH9 A;  1Y1W G;  1LTL A;  1HZ9 A;  4UPA A;  4DR5 Q;  2A8V A;  3I4M G;  4A93 H;  5GAE C;  1VQC A;  2GVA A;  3H0G H;  5JEA G;  1VQF A;  4P71 A;  3TRE A;  4BY7 H;  2HHH Q;  3FP9 A;  3PO3 G;  4LFB Q;  1BBU A;  5C0X I;  1G51 A;  1KQS A;  1IBK L;  2VUM H;  4DUZ Q;  1X3F A;  4P75 A;  2JA5 H;  3M4O H;  2JA8 G;  2K50 A;  5HGQ A;  1X6O A;  4JI3 L;  1YBY A;  5M5W H;  5FLM G;  5IYD G;  3HOU G;  1HZC A;  2GN5 A;  4LUO A;  4DV6 Q;  3U4Z A;  5C3E G;  3CCU A;  3WWV A;  1K9M C;  3BU2 A;  4HIM A;  5IP7 H;  1ASY A;  2BH2 A;  3PSI A;  1QUQ A;  3UE1 A;  4C3H H;  2HHH L;  2CQO A;  2Y0S G;  3JAM i;  2QA4 A;  5IYC G;  4A3D H;  3LGJ A;  4A3F H;  4LFB L;  2JA9 A;  5JEA J;  3K0X A;  4GNX B;  1SRU A;  3NEM A;  1K8A C;  4DUZ L;  5BR8 Q;  1R9T H;  1ASZ A;  3K8A A;  3ZJY C;  3CCL A;  1QVF A;  4GOP A;  3OYY A;  2K75 A;  3BZK A;  2CCZ A;  4A3K G;  1FJG Q;  2B63 H;  2CWP A;  2R7F A;  4DV6 L;  4YCW A;  4MZ9 A;  3I4N H;  2IHE A;  5IWA L;  4OON A;  1XPU A;  4A3M H;  2R6G A;  1UE6 A;  4A3I H;  3CP0 A;  2Y0S E;  3U50 C;  4DV4 Q;  1PH2 A;  3GTK H;  1EIY B;  2JA7 G;  1VQK A;  4LNQ A;  1I50 H;  2N78 A;  1JE5 A;  3S15 H;  4A4I A;  2Z0S A;  1J6Q A;  3K81 C;  4QJF A;  4HJ5 A;  4P73 A;  5C44 H;  5M3F G;  1FJG L;  3J81 c;  4DV0 Q;  1EOV A;  3DM3 A;  2R7Z H;  1JT8 A;  4DV3 Q;  4AYB G;  1SMX A;  3JAM c;  3CCR A;  5H1S E;  1EIF A;  2IX1 A;  4JI2 Q;  2A1A A;  4LFA Q;  2VQE L;  4A93 G;  2CWA A;  4BA2 I;  4WJ3 M;  4JI6 L;  2PQA B;  4IJL A;  4A3B H;  4X6A H;  5GRO A;  4PMW A;  1VQO A;  3OTO L;  4MTN A;  3AQQ A;  3TS0 A;  3NEL A;  1IBL L;  2BH8 A;  4EQ5 A;  1PH5 A;  1X3E A;  1D7Q A;  3KFU A;  1JJ2 A;  3PF5 A;  4A76 A;  2K52 A;  3HKZ G;  1MKH A;  3CME A;  4OWX B;  2PI2 E;  3UDX A;  4JOI C;  5J3B A;  2JEA I;  2D0P A;  2K5V A;  1E1T A;  3CCV A;  4JC0 A;  2IT1 A;  1L1O A;  1C7Y A;  1HR0 W;  3H3V I;  4DR4 Q;  4AIM A;  4DPG A;  3S17 H;  4JBM A;  4A3F G;  2UXD Q;  2JA6 H;  1G6P A;  2YU9 H;  2E2J H;  1MJC A;  3HOY G;  4Y52 H;  1VQA A;  4OXP A;  2UXC Q;  3M7N A;  1S40 A;  4JI1 Q;  2N3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...