2UXCL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcL00
1E22A 1I6HH 1JB7A 4DV0Q 1PYSB 2Q2TA 2XTIA 4LFAL 4KHPL 1YIJA 5IY0A 2UUCQ 1EWIA 3S2HH 1RIPA 1V43A 3AFPA 4BY7H 1JJ2A 2CWPA 2Z6KC 1W2BA 3STBC 1SFOH 3FKIG 1L2FA 4LW1A 4IPCA 3PUYA 4LF9L 1KC8C 2IY5B 3D31A 3I4NH 3OYYA 3S16H 1LTLA 4PZ6A 4OX9Q 4JBKA 4PG3A 1X65A 1UWVA 5FJ8H 1I94L 4LF6L 2WFWA 3H0GG 3DLLA 4POGA 2ASBA 1WYDA 4GKJQ 1HZCA 1RL2A 5C44H 3HOVH 1OXXK 1CKNB 1IBMQ 1NMGA 2CKZB 2IHEA 2F3IA 1IBLQ 3KLWA 3CCEA 1EFWA 2Y0SG 3F1ZA 3PO2G 4R4CA 2K5NA 1PH1A 5M3FH 2E5LQ 1OXVA 1X3FA 4DR4Q 4DV7Q 4JV5Q 1PVOA 2A1AA 4GLXA 4DV2L 2ES2A 4YCVA 2JA8H 4LF5L 1D7QA 1AE2A 4C3JH 4HIMA 1HR0W 1PFSA 1QVCA 2Z0SA 4BA1I 3U50C 1K73C 3HOZG 4LNQA 3S1RH 1VQ6A 1OXSC 3CAMA 1N36L 4A3BG 4A3JG 1VQ7A 1VQ5A 1VQDA 2UXCQ 4L5TA 4R4TA 1OXUA 1SN8A 2VZAA 4IPDA 4HJ5A 3UE1A 3CP0A 3K81C 1JMCA 1IBKL 2WB1G 2HHHL 3HKSA 5GQOA 3AEVA 3S15H 5JJKA 4R4QA 2MNAA 2AKWB 1N33L 1V1QA 1GVPA 4HIDA 1HNWQ 2A19A 3HFZB 4JI6Q 1M90C 1N9WA 2UUAQ 4IO9A 2K4KA 4LUVA 1VQ8A 2DUDA 1WCMH 3TRZA 3BZKA 3HOXG 4X62Q 3T1YQ 1K8AC 4DV1L 2R7FA 3CMEA 3KDFA 4TVAB 4NXNL 4JI3L 5IYBG 4JOIA 3J81j 2ATWA 4LFBL 1YHBA 2UU9L 3HOWG 2B63G 4BBRH 3PUVA 2YTYA 2D0OA 4OWTB 4IOCA 4DR3L 1VQKA 4DV5L 2GN5A 2OQKA 4LF8L 4R4OA 4HIKA 1HNXL 1NMFA 1X55A 4IPGA 1J6QA 1HH2P 3M4QA 1MJCA 1U0LA 5BR8Q 1Y1WG 1XPUA 1YHAA 3PO3G 4WJ3M 4LF7L 4EQ5A 1Q86C 2OQ0A 3PGZA 4JBJA 1KL9A 4PMWA 5LMUQ 1VQGA 4YWLA 3T1HQ 3EN2A 4DR2Q 4BXXG 5C0XJ 1XNRL 5FLMG 4OO1I 4X64Q 5C0XI 2VQEQ 2PQAB 3HOYG 3M4PA 1HR0L 1A63A 2E2IH 3L0OA 4DKAC 4GNXB 2N78A 2FXQA 3GTOH 1Q1EA 4DR7Q 5GAHC 4Y52H 3CC7A 4TQUS 1HJPA 1PH6A 3MXNB 5AJ3L 1VQFA 5C3EG 4QQBX 2QEXA 3TS0A 1QZHA 4B3SQ 2ID0A 4ME3A 3I55A 2ZJPA 4YHHQ 4B3MQ 1KRSA 4NXMQ 4A93H 4A3CH 5JJIA 2WAQG 1VQNA 1FJGL 3H15A 4B3RL 1KRTA 3KJPA 4JI0Q 3UDGA 5C4XH 5IP9H 2VUMG 1PA6A 1U5KA 1CSQA 2JA9A 1VQEA 3KF6B 3G71A 2UUBQ 1JJGA 1HNZQ 4GN5A 4IPHA 2RCNA 4IJLA 1Q1BA 1XJVA 2JJQA 2QA4A 5EAYA 3F2DA 1VQIA 1J5EL 2Q2IA 2QGQA 4BY1H 1TWGH 2ZTDA 1AH9A 4AYBE 4GNXC 3GTQH 4A3GH 5IYDH 4LUOA 2OTLA 4DV0L 2AWNA 2KCTA 3RLNA 3UDIA 1QUQA 5H1SE 3K7AH 2UUCL 1YNXA 2HIVA 1O7IA 4YCWA 5GROA 1KD1C 2K5VA 4JI4Q 3CCQA 4GKKQ 4HJ8A 1EUJA 3M7NA 4LUZA 1I5FA 4AH6A 4DR5Q 4JI2Q 3S2DH 4FDBA 2OTJA 3K0XA 1VQMA 1PH8A 3VDYA 1FGUA 4K0KQ 3PUXA 2PNHA 3RZDH 5IWAQ 1E3PA 2F52A 3FKIH 1Z9FA 4DV3Q 4A3IH 5IP7G 3K8AA 4B3TL 2NVTH 3GTGH 3CQZH 3S17H 1IBML 4X6AH 3PIOA 1IBLL 3WWVA 1QVGA 2E5LL 1Y1VH 1S3OA 4IJHA 4A3EG 4DV7L 2R92G 4BBSG 3H0GH 5JJLA 3PUZA 1G291 1CKMA 3G4SA 1PH4A 4NB3A 3J7ZC 2JEBI 1VQ9A 4DUZQ 2Q2UA 4MNOA 3I4MH 3GDEA 2R93G 4HIOA 5JEAJ 1SRUA 1YJWA 1YI2A 4O2DA 4UP9A 2BH2A 1I50H 1S40A 1VCIA 4GLAC 4X65L 3A5ZB 2VW9A 1M1KC 3S1QH 2UXCL 2JEAI 3BU2A 4ALPA 3M4OH 3U4ZA 4DPGA 2EIFA 2NN6I 1YJNA 2CFMA 2JE6I 2WB1E 3AYHB 4JYAL 4JI8Q 3F2BA 2UXDL 1MIUA 1WI5A 1OTCA 2E8GA 4A4IA 5C4JH 1NY4A 2ZTCA 4A3BH 1L1OA 2H5XA 2I0QA 4GOPA 4JI6L 2LXJA 1E24A 4DNIA 4A76A 2UUAL 3RR5A 4J15A 3PF5A 4POFA 4QGUA 1C9OA 3W1GA 2NVXH 1LYLA 4X62L 1XNQL 4KLKA 3CPWA 4GLVB 4DR6Q 1SMXA 3KF8B 3F2CA 4NPSA 3G48A 2PMZE 1XMOQ 5M3FG 4JI1L 3CCLA 1I3QH 1I94Q 2YTXA 2F4VL 2VQFQ 1A8VA 1C0AA 4YY3L 2Z6KA 3L2PA 3HOXH 5BR8L 2OCEA 5IYBH 1X54A 4JCVE 1K8GA 1JT8A 2E2JH 3CW2C 1KIXA 2JK8A 2B63H 2AWOA 3HOWH 5IT9c 4DV2Q 3GTMH 2PI2A 2VS1A 2VL6A 4JBWA 4DR2L 2K50A 3D0FA 4QL5A 4DUYQ 1JE5A 4HJ7A 2R7ZG 3UDXA 2VQEL 3B6YA 3PO3H 4A3FG 3A0JA 4P75A 1N36Q 2EQSA 1TWCH 2N3SA 1B70B 3BJUA 1K0RA 1B7YB 1NJIC 4DR7L 3PF4A 1GO3E 1MKHA 2IX0A 1EIYB 2KHJA 1Q82C 2ZJRA 1WCMG 4BXXH 1KQSA 1IBKQ 4LF4Q 3GTPH 2HHHQ 3CC2A 4NXML 2D0PA 4B3ML 3GD7A 3J7A5 3HOZH 4HJ9A 2ALYB 4RMFA 3RN5A 3HOYH 4P72A 1N33Q 1Y14B 1E7ZA 3ULPA 1VQHA 3ZJYC 3DM3A 3ICEA 2WP8J 3K80C 4JI0L 1GKHA 3CXCA 5C3EH 4C3HH 1G51A 3CC4A 4DR1L 1UE7A 2UUBL 3S14H 1HNZL 3PIPA 4DV1Q 2EXDA 3M9BA 3ERSX 4P74A 3W5OA 5M3MG 4A75A 3KYHC 3S1MH 1TWHH 1N34Q 4LFBQ 4IOAA 3PSIA 4UPAA 4GN3B 4YCUA 3GO5A 1GM5A 4JI5Q 4A3DG 3I2ZA 1VQAA 4UP8A 1XMQQ 2YV5A 3J81i 1CKNA 1QZGA 5M5WH 5E7NA 1MJEA 3PV0A 1PH9A 2VUMH 2D62A 2NZHA 2Q2HA 1IYJB 3FHWA 5GAEC 1JJCB 3OTOL 2ZM6L 3H3VH 1QVFA 4A3LH 4DV6Q 2HQLA 5J3BA 4BA2I 4IFDG 3S24A 4DAMA 3TQYA 3CPFA 4XIGS 4LF7Q 3W1BA 3KJOA 2KCMA 1YITA 4GOPB 2JA5G 5GAGC 4DV4Q 4JI7L 2B3GA 3S1NH 3UE0A 4GKKL 1IZ6A 2LXKA 3BZCA 4R4IA 1XNRQ 4GKJL 1BKBA 3LGJA 4A93G 4DR5L 1KXLA 4O0AA 5IYCG 4OWWB 3U58A 2BA0A 1IXRA 1HR0Q 4DK3C 4A3MH 1N32Q 4K0KL 4AQYQ 3HKZG 5M5XH 4DV3L 5C4XG 5IP9G 1WJJA 4AIMA 1PH3A 4OO1G 2MO1A 3CCJA 5LMNQ 2IHFA 5C0XG 1XPOA 3G6EA 4LFCQ 4OX9L 2UXBQ 1Q7YC 3KOJA 2JA7G 2R7DA 3KDFB 1KHIA 5IE8A 4PZ8A 4KI0A 4BY1G 1LM0A 1K83H 5ELOA 5IP7H 1N8RC 5IYDG 1VQOA 3HOUG 1AE3A 4GOPC 3FP9A 2MFIA 1EQRA 2JA6G 2Y0SE 2VNUD 2CQOA 1OXTA 2NVYH 4HJAA 4X66Q 1EYGA 2R92H 4JC0A 4BBSH 4DR4L 3NENA 3M3YH 2R93H 4MTNA 4AYBG 2YTVA 4JI8L 4A3KG 1P16A 2XGTA 1YZ6A 3EIVA 4LWCA 2N8NA 3RLFA 3J80i 3PO2H 1HZBA 1XPRA 4P71A 4UY8C 4BY7G 2L15A 1S72A 1XTDA 4A3IG 1CKOA 3Q8DA 1PH5A 1W3SA 1WOCA 2KHIA 3CD6A 1D8LA 2PQAA 1BBUA 3EBEA 1X6OA 1UE1A 1UE5A 3E9IA 3ER0A 4JOIC 3CCUA 1BBWA 3I4OA 4GNXA 1SLJA 3AQQA 4LFAQ 4DR6L 4A3JH 1XMOL 3I4NG 1Y1VG 4KHPQ 1HNWL 3K7UC 5FJ8G 4JI7Q 1X3EA 4XTCS 4EX5A 3STBD 2VQFL 3I4MG 1HZ9A 2VY3A 3TS2A 3J81c 2BH8A 3A5UA 4DK6C 4B3TQ 3HOVG 5C44G 1VQ4A 5FLXc 3T1YL 1FL0A 3UDFA 4LF9Q 1YEZA 1G6PA 1X9NA 4QJFA 4MZ9A 4OXPA 2BA1A 4LF6Q 1PV4A 1V9PA 3JAMi 4L5QA 2JA8G 3KF6A 3GTLH 2MO0A 4QY7A 4DUYL 1NE3A 5HY6A 2YU9H 4RG1A 1Q81C 2AHOB 4X65Q 5LMNW 1QUQB 4WJ4A 5LMUL 1E1OA 3TEHB 3T1HL 1T9HA 4LF5Q 4LF4L 4OWXB 1P8LA 4Y7NH 4JYAQ 3M85A 4X64L 4YWKA 2R7ZH 2CCZA 2UXDQ 1PYBA 4A3FH 5JEAG 4OONA 3MEFA 1WFQA 2RHSB 3TREA 1Y1WH 1YVCA 3A74A 3RNUA 3RZOH 2HIXA 4QIWE 5ELNA 1Q12A 1EIFA 5K36G 3E9HA 3NBHB 1K3RA 2OWOA 2I5HA 2NN6G 3AFQA 2K52A 4JBMA 5FLMH 4DAYB 1SR3A 4B3SL 1TXYA 1XNQQ 2R6GA 3H3VI 4IFDJ 1YBYA 4YHHL 4IFDI 3PUWA 2DGYA 2WAQE 3CMAA 1N34L 3L7ZC 2IX1A 1PH7A 1SROA 2MQHA 1NBWA 4JI1Q 1Q8KA 4JI5L 3CCMA 3OW2A 1XMQL 4JV5L 4BBRG 2RHQB 2F4VQ 2ZJQA 2AMCB 1C7YA 4YY3Q 1ASZA 4KHZA 1YJ9A 4DV6L 1X56A 1NTGA 5M3MH 3KFUA 4NXNQ 3J80c 4JI3Q 2B29A 1K9MC 2UU9Q 4DV4L 4A3DH 3IRBA 3F8TA 2CWAA 4DR3Q 1YHQA 4DV5Q 1EOVA 4GN4B 1X3GA 4JG2A 3RLOA 4C3IH 1VQJA 2IT1A 1HNXQ 1PH2A 4LF8Q 3PCOB 3GTJH 5DLQE 4APVA 3U4VA 1Z47A 1N32L 2PI2E 4AQYL 3HKZE 5M5YH 1L1OB 2V1CC 2JA5H 5GADC 1PHJA 3E0EA 1EQQA 4JI4L 2YYZA 2NZOA 1B8AA 2I5LX 2KENA 4PZ7A 4YWMA 5LMNL 3ULLA 2KBNA 1R9TH 4L5SA 5HGQA 4UP7A 4A3CG 5IYCH 4JI2L 4LFCL 2UXBL 1TWAH 1VQCA 1H95A 2E2HH 1Q46A 3CCVA 1LUZA 1VQBA 2GVAA 4C2MH 4GS3A 3ULJA 5IWAL 3JAMc 3CCSA 2JQOA 5AJ3Q 4L5RC 1L0WA 1UEBA 3CF5A 4DR1Q 3RN2A 4A3LG 4R1JA 2A8VA 1A0IA 2GVBA 2N49A 2NVQH 4X66L 2JA7H 1FJGQ 1VQLA 1VS0A 1A62A 2ZTEA 1CSPA 3CCRA 4B3RQ 2LSSA 4DUZL 1BVSA 1FVIA 3I56A 4P73A 1IL2A 4A3GG 2K75A 3OTOQ 3HOUH 2ZM6Q 1L1OC 1KAWA 1GD7A 3I7FA 2JA6H 1ASYA 1HZAA 4A3MG 1E1TA 3GTKH 2I5MX 4A3EH 1J5EQ 2RF4A 1SE8A 3NEMA 1CUKA 2K14A 3SGIA 3JC66 1UE6A 3NELA 1VQPA 2HT1A 2K5HA 1DGSA 4H02A 2C35B 1TWFH 4A3KH
chains in the Genus database with same CATH superfamily
1JWUD 1I6HH 2K32A 4LFAL 1PYSB 3T53B 3T51B 5IY0A 1K83B 2UUCQ 1RIPA 2Z6KC 1SFOH 3LWUA 4IPCA 3R2IA 4LF9L 4K8IA 1KC8C 4OIJA 1T5XD 1LTLA 2R93B 1HRJA 1I94L 4LF6L 2SOBA 2F0PA 3TP6A 1WYDA 1XWEA 3QJYA 1DD2A 1RL2A 3N6RA 5I9OA 2CKZB 2F3IA 1SE2A 3KLWA 3PO2G 3F1ZA 1PH1A 4DR4Q 5G3LF 4LF5L 1D7QA 2QDLA 1QILA 1EQTA 2Z0SA 1GUSA 1ICFB 3CAMA 4IUVA 4A3BG 4TSSA 1VQ5A 1U4LA 1GHJA 3I73A 1OXUA 1BQQT 1QB5D 5IGBA 4FP5D 3AEVA 3S15H 1G2TA 2MNAA 3BVZA 2AKWB 1V1QA 2MPMA 4HIDA 4R9WA 4JI6Q 1BBXC 4K6LA 5ELBA 2UUAQ 2K4KA 2DUDA 4X62Q 3J81j 5JPNC 4NP5A 5COYA 2R7ZB 4DR3L 4IOCA 2NWGA 1BXTA 1X55A 1J6QA 1HH2P 3PO3G 1MJCA 1I6VC 2B2YC 2MUYA 4JBJA 5I9PA 1KL9A 5LMUQ 1MSHA 1VQGA 1DOMA 4DR2Q 5C0XJ 4OELB 3ONAB 2PZWA 2PQAB 3HOYG 1V1OA 2Z4IA 1A63A 2E2IH 1RD9D 3L0OA 1L0XB 1PMRA 2PQEA 4Y52H 4K5WA 4TQUS 1PH6A 5M3MB 4QQBX 3TS0A 2ID0A 1A2UA 4B3MQ 4A93H 1DONA 1VQNA 1FJGL 4K14A 4C3IB 1GUWA 4B3RL 2CH4A 3KJPA 2N88A 3NK9A 2VUMG 3T56B 1PA6A 3T4AC 1CSQA 1VQEA 2UUBQ 1XYIA 2H4OA 3T16A 1HNZQ 1CA6A 4GN5A 3VR3A 2JJQA 5C4HA 3M7GA 3OWFA 1MI2A 3K58A 4F8MA 5IYDH 2E2HB 1CT1D 3UDIA 3SK8A 3GP7A 2HIVA 1O7IA 1B1ZA 1PYWD 4JI4Q 3CCQA 3NWTA 3BS1A 1EUJA 4JI2Q 3GTQB 1FGUA 1Z6HA 3SK5A 3HOUB 3PUXA 3Q0AA 5IWAQ 2F52A 4A3IH 4DV3Q 1Z9FA 2JA6B 3GTGH 3DM1A 3ND8A 1LT5D 1MSGA 3L3OC 1IBML 4IQZA 4E6IA 4RA8A 2MP1A 4ZK9B 4A3EG 4A3KB 4BBSG 3H0GH 1PTOB 1I6HB 2Z6BA 5E1FA 3S2DB 4HIOA 1YI2A 4EVOA 2B2VA 4GLAC 1SFOB 2J4XA 3CQZB 3BU2A 3EROA 2EYMA 3G6JB 1A3VA 3M4OH 2EIFA 1IW7C 1F2YA 2NN6I 3VR5A 2JE6I 4CDFC 3VYTA 5JPMC 1MIUA 2UXDL 2PPBC 4A4IA 5C4JH 1F2LA 5IT9E 5BN3A 4A76A 3RR5A 5LL6X 1GUTA 4ZCKA 1B53A 1LYLA 3SEBA 5CV9A 5I2YA 3F2CA 2PMZE 5M3FG 4ZQ3A 3QWNA 4HEDA 3WDNA 1NR4A 5KGUA 1EY8A 4YY3L 2Z6KA 4WJWA 3IFDA 2OCEA 4RGNA 2KEDA 3HOWH 2BDOA 5J22A 2B63H 3S15B 4IZ8A 1F9RA 4JBWA 3D0FA 4LK1C 3Q22A 1JE5A 1I3QB 2VQEL 1JE4A 2Z1CA 4DR7L 1PRTB 4HAEA 4O42A 1MKHA 2IX0A 1EIYB 1R4QB 3TMEA 2ZJRA 1LT6D 1WCMG 2K33A 2XWJB 3GTPH 4P72A 3ULPA 2PNRC 3WOEA 3E6ZX 1GUOA 4C1NI 3T13A 2ZXPA 2EYHA 5C3EH 4C3HH 2EXZA 2RDHA 4DV1Q 3W5OA 4LFBQ 3S1MH 4DF7A 1N34Q 4ZAIA 3PSIA 3GO5A 2D5DA 1T5EA 4A3DG 4JV5Q 1B9MA 2YV5A 3J81i 3HOYB 5E7NA 4G57A 1PH9A 5GAEC 1JJCB 2ZM6L 4LF7Q 3CPFA 4XIGS 3W1BA 5I6WA 4GOPB 3D4WA 4GKKL 1WVLA 1HA5A 4O0AA 4OWWB 4ZUIA 4K0KL 1ET6A 1O78A 2B2YA 2IJ0A 1BR9A 2ZXOA 2EJFC 2JXMB 1EIGA 1H9RA 1XPOA 1D5MC 5CBEE 1BF4A 4CKCA 3J81L 4LFCQ 3NBHA 1H9KA 2WV6D 4KI0A 4BY1G 4CJ1B 1N8RC 1SJHD 4A3MB 1VQOA 4KY5A 3U9SA 2ICIA 1CZGA 1OXTA 4HJAA 1C4QA 4DR4L 3VA7A 2DNEA 3EIVA 4LWCA 5IT9L 2N8NA 3CHBD 3IAYA 4UY8C 4BY7G 2JN4A 4U673 3Q8DA 5A35A 1W3SA 3CD6A 3MAQA 1NR2A 3I70A 2Q8IB 3CCUA 3H0GB 2Z8LA 3I4OA 3AQQA 4LFAQ 1DOLA 1XMOL 3I4NG 2N55A 4IUPA 1G91A 5FJ8G 2PZTA 3MXUA 2A74C 4EX5A 3STBD 2VY3A 3J81c 2BH8A 3MFYA 4RHRA 3NXWA 3TP8A 4LF9Q 3M4OB 1M8AA 4MZ9A 4LF6Q 3HOZB 1PV4A 3GTLH 4L5QA 1STGA 5C4JB 4H13C 4QY7A 3FDTA 1SNMA 1SNQA 4X65Q 3TN2A 1JCKB 5LMNW 5LMUL 5EKKA 4XT3B 1T9HA 1LT3D 4ZRZA 4LF5Q 4LF4L 2IWHA 5AFWA 3E3XA 5JEAG 2RHSB 4IUQA 1MBYA 1YVCA 5K5PA 3RNUA 4ZKBB 2YU9B 5K36G 1K3RA 3G7LA 1XNQQ 2I07B 3BYTB 1TVXA 2R6GA 3HOWB 2B63B 4G7HC 1PZKD 1EZ8A 3L7ZC 3HZXA 2MQHA 5FO8B 2AMCB 1WTXA 1QG7A 1C7YA 5C4ZA 1FNUA 5FOBB 1YJ9A 1X56A 3K5NA 4FF1A 1SDFA 2X69A 4V0BA 1U4MA 1K9MC 2F0SA 2VB2X 3NWSA 4DR3Q 4G7OC 4GN4B 1X3GA 2IT1A 2DY8A 2ZXRA 3D8GA 5C3EB 4C3HB 2V1CC 3E0EA 4JI4L 1LTID 2KENA 2MJ8A 1EFID 4JI2L 2UXBL 1VQCA 1YNJC 1AZPA 1KNAA 1LUZA 2GVAA 5IWAL 2LS01 3MVVA 1EQVA 2BCOA 1L0WA 1UEBA 2F0JA 3KF8A 3RN2A 5M5YB 3L9AX 4NMZA 1A0IA 2GVBA 2JA7H 1FJGQ 1WTOA 2B2TC 1VS0A 1CSPA 3U9OA 4B3RQ 2LSSA 3DHQA 1TWAB 4IN3A 4RCNA 4S3SA 1KAWA 1ASYA 1E1TA 2I5MX 5FO7B 3C3LA 4JI7Q 2P5ZX 3NEMA 1CUKA 2K14A 1VQPA 2HT1A 2LFNA 1DGSA 2C35B 1TWFH 4JK1C 4KHPL 1IKLA 1JJ2A 2CWPA 1W2BA 4ME5A 3FKIG 3V05A 5IIFA 3D31A 4PMBA 3S16H 4PG3A 1UWVA 1HPCA 2WFWA 1TS5A 1A15A 3NP8A 2EDGA 5KYIA 3HOVH 1OXXK 1IBMQ 2IHEA 2BE5C 3CCEA 2Y0SG 2K5NA 1X3FA 1KDCA 1CI3M 4GLXA 1JORA 3DMUA 4C3JH 4HIMA 1SNCA 2XVSA 3MHBA 4LNQA 2CW0C 2PW5A 4A3JG 2F0VA 1WTVA 1VQ7A 1VQDA 1CFMA 4PV1C 2JSOA 4BS9A 1SN8A 2VZAA 1W6JA 5CR3A 4HJ5A 5HURA 2RBMA 3CP0A 3K81C 4QUFA 2WB1G 5JJKA 2K04A 3BYYB 1JWSD 1B44D 4LMQD 3GTLB 3R93A 3HFZB 4KKSA 5CV5A 2SEBD 1D2BA 3TRZA 4KY7A 5FO9B 4R8IA 4FF2A 1PTOD 1K8AC 4DV1L 5EGTA 3CMEA 4NXNL 4LFBL 4JI3L 5IYBG 1YHBA 2R61A 2UU9L 2B8FA 5CV7A 3LX0A 1KLGD 2GN5A 2OQKA 4G7ZC 4R4OA 4HIKA 2KUMA 2EJGC 2B2UC 3TBIB 3M4QA 4IURA 3QO2A 1Y1WG 4DXGA 4LF7L 2NB0A 3P75A 1Q86C 5D3DA 5EKLA 4ZLTF 3NQTA 4YWLA 4BXXG 5FLMG 1RODA 4OO1I 4X64Q 5C0XI 1LT4D 2KQ3A 4Q5VA 2VQEQ 1ILPA 4DKAC 2N78A 3GTOH 4DR7Q 2O2LD 1JOKA 3CC7A 1FYCA 1HJPA 1DJRD 3MXNB 1VQFA 1A2TA 1NCVA 2KECA 4M1UB 4ME3A 2ZJPA 4YHHQ 4A3CH 5JJIA 2WAQG 5G3LD 4C56C 4KD4A 1I4HA 5FK9C 4HTHA 3SK6A 5IGDA 5IP9H 4OO1H 1U5KA 2JA9A 1II3A 1E2WA 5CGKA 1ENCA 5IGCA 2KHSA 4CKEA 5ELCA 2QDBA 1XJVA 1J5EL 4JVZA 2Q2IA 2QGQA 2ZTDA 4AYBE 4GNXC 3GTQH 1PRTD 2OTLA 4DV0L 2KCTA 1AW7A 2F0LA 5F2DA 5C4XB 1YNXA 1KD1C 2K5VA 3OIPA 5I2XA 4GKKQ 4HJ8A 2JA7B 3BDCA 1PTOH 4LUZA 4AH6A 5DEHA 1TWGB 3F2UA 4OHJA 3S2DH 1PH8A 3VDYA 2X6GA 4K0KQ 1C48A 3RZDH 4GKJL 1HHVA 5IP7G 3K8AA 3CQZH 4X6AH 3SR1A 1D6EC 4KY6A 1ZYRD 1X32A 2E5LL 4AYBB 1TWFB 2R92G 1HA6A 1G291 1CKMA 3G4SA 4NB3A 2Q2UA 3A7LA 2OT2A 1SRUA 2BH2A 4O2DA 4IALA 1SNPA 1QE6A 1VCIA 4X65L 3S1QH 3S17B 4ALPA 4QF4A 3S9WA 1JWMD 4ID6A 4UHVA 3U4ZA 4ZKCB 3GQBA 2B2TA 3S16B 1Y1VB 1SMYC 2WB1E 3F2BA 2E8GA 4A3BH 1NY4A 4DN4M 3I4MB 2H5XA 1GHKA 4KHVA 4GOPA 1WD0A 3HOVB 4J15A 1I50B 3QG1A 1F9SA 2D2CC 2NVXH 4G4KA 1XNQL 3CPWA 3KF8B 4IUNA 1XMOQ 4C3JB 3NTIA 1I3QH 5EBDA 2K1BA 2K5DA 2YTXA 3RMHA 4H0LC 1A8VA 1C0AA 3K0YA 3I8ZA 2F0KA 3CW2C 1KIXA 2JK8A 2AWOA 1K3BC 2VL6A 1FR3A 5KEEA 2JP1A 4IUTA 1ICWA 4XQNA 4HJ7A 3B6YA 3NTKA 4A3FG 3PO3H 2EQSA 1TWCH 1B70B 1K0RA 1EWCA 1B7YB 5LHY1 2EYJA 2A68C 1KQSA 1IBKQ 4LF4Q 1SNDA 2E2JB 3J7A5 1HFGA 4HJ9A 2ALYB 4X3SA 3HOYH 1N33Q 2PCFB 1Y14B 5CV6A 3ICEA 1JB3A 2WP8J 4RAUC 1GJXA 3K80C 4XYQA 1G51A 3FPPA 3CC4A 3N52A 4DK1A 2A6HC 3S14H 1HUMA 2AQ1B 3M9BA 4L8JA 1TWHH 4IOAA 4FYDA 1GM5A 1G2SA 1CKNA 1QZGA 2VUMH 3PV0A 4TKOB 1SYDA 1WTHA 2NZHA 2Q2HA 4A3LH 2K5QA 4K2KA 1QVFA 3GTOB 4DK0A 4BA2I 4IFDG 2KOLA 3S24A 3C46A 3TQYA 1WTWA 2KCMA 3IKJA 1YITA 2JA5G 4JI7L 5GAGC 3BDOA 3K59A 3BZCA 3NTHA 1XNRQ 2F1MA 1BKBA 2F3WA 3I4LA 4KTAA 1U4PA 4A93G 4RGOS 5I6YA 1XTCD 4A3MH 1PDQA 3HKZG 2M9VA 3TP5A 3FRPB 1IYVA 4AIMA 3CRLC 2Z4HA 2UXBQ 1Q7YC 3EVQA 4FVMA 3KOJA 5CV4A 1KHIA 2PYKA 4PZ8A 1LM0A 2CVRA 2WINB 5IYDG 1HXYD 1EYAA 3NHHA 3FP9A 1ESFA 1K0SA 2CQOA 3J81E 4BBSH 1EIHA 1BCPF 3NENA 2EZVA 3M3YH 1HFNA 4MTNA 2XGTA 3D6WA 3RZDB 4RHSA 1FNWA 3J80i 1J9OA 1HZBA 2WACA 2PO4A 1S72A 1XTDA 4A3IG 1CZWA 1JOOA 1BBUA 1X6OA 1UE1A 1UE5A 4RWSC 3HOZH 4DR6L 1PLFA 4GNXA 1VMPA 2L0CA 4KHPQ 3OPOA 1R4PB 3K7UC 2HCIA 3HP3A 2VQFL 3PO2B 4KN7C 4DK6C 3S1QB 1NSNS 5C44G 3M4YA 1BUVT 3Q23A 3UDFA 4MN3A 3D6CA 4CGYB 3DWPA 1X9NA 3KBGA 4OXPA 4FXGC 2BA1A 2JA8G 3KF6A 3VR6A 4A3BB 1S5ED 1KDBA 4DUYL 5IODA 1NE3A 2NYZD 5HY6A 4RH6A 2YU9H 1Q81C 1AFPA 1SYGA 3FPUB 4DXFA 1V8QA 2NVXB 1WTPA 3TEHB 2NUCA 1HQMC 4OWXB 1P8LA 4Y7NH 3M85A 4X64L 2CCZA 1PYBA 3VA5A 1A3UA 3OHXC 5ELNA 1EIFA 2L9HA 1PFBA 1SE3A 1D5ZC 2NN6G 3I72A 4JBMA 2PMZB 4DAYB 4IFDJ 4EQOA 4YHHL 5FKAC 4CDCC 3CMAA 1DOKA 4NDXA 3OMCA 1Q8KA 2DY7A 3DUZA 3CCMA 4BBRG 1AZQA 3PO3B 3AU7A 1TWCB 1ZXTA 2E75C 1ASZA 4KHZA 1LTBD 3C2PA 4DV6L 3KFUA 4NXNQ 5J39A 3J80c 4JI3Q 4WFN3 2B29A 2K7VA 4HCSA 2A69C 2UU9Q 1TS4A 4A3DH 4N8FA 3F8TA 2CWAA 1YHQA 3O13A 5BN5A 1EOVA 3EFXD 1VQJA 1LLRD 3PCOB 3OSOA 2FHTA 5DLQE 1Z47A 1S5BD 4EQPA 4AQYL 3HKZE 1FNVA 5M5YH 1YNNC 3S14B 1EQQA 2F0DA 4YWMA 2I5LX 4PZ7A 1TWHB 5LMNL 4V190 1FGBD 5HGQA 1ENFA 3FEWX 4UP7A 1TWAH 2VUMB 1H95A 3VR2A 2EE1A 3CCSA 3FMCA 2JQOA 2CQAA 4UAIA 1JICA 4L63B 3CF5A 4R1JA 3J7YW 2EYFA 4M8AA 1R9TB 2N49A 5ELEA 2F3VA 4X66L 1VQLA 2A6EC 1FVIA 1TU2B 2F0MA 2K75A 3A8IE 4A3GG 3DXJC 2Z9HA 3KBXA 3TZUA 4C2MB 5JJZA 2OF1A 3D4DA 3GTKH 1J5EQ 5EJWA 1F2MA 1SE8A 3NELA 3H3VC 5E4XA 1X3QA 4DV0Q 2XTIA 2F0QA 1YIJA 1HCZA 1PFMA 2A73B 1V43A 4BY7H 1D1IA 5CYUA 1BO0A 4LW1A 3OOCA 4A3EB 4BBSB 3TDQA 1O7ZA 1KAAA 4UDUC 3OYYA 3I4NH 3M3YB 4PZ6A 4OX9Q 4JBKA 1X65A 5FJ8H 3DLLA 3MXNA 4POGA 2MGSA 4XYOA 2ASBA 4GKJQ 1HZCA 3KUPA 1CKNB 2D9UA 1NMGA 4TRDA 2TMPA 4R4CA 2E5LQ 3PIP3 1OXVA 1PVOA 2A1AA 1I4XA 1AE2A 2EVBA 2PZUA 1HR0W 1QVCA 4K5XA 3U50C 1K73C 5IGGA 1EOTA 1OXSC 1Q3LA 1HTLD 5M9OA 2QCPX 3X3MA 1QOHA 3VR4A 1IW7D 1D1KA 4IPDA 1U4RA 1JMCA 1IBKL 5M3FB 4JPBW 5GQOA 5ELDA 5JEAH 4R4QA 1EEFD 3A8JE 1GVPA 1N33L 4EQNA 1I4RA 4KMUC 1M90C 1N9WA 5K36H 4IO9A 3DEOA 4PNYA 1EWHA 4X3UA 5D3IB 1LV9A 3HOXG 3IFTA 2R7FA 3MTSA 1NUCA 2G9HD 3NSWA 4Y7NB 1ESRA 1TS2A 1VQKA 2RSNA 4KN4C 2RSOA 4HSVA 4IPGA 5EBCA 1XPUA 1WD1A 1G6ZA 1YHAA 4WJ3M 4H7BA 1WCMB 3OWEB 2L5TA 3QOJA 5BN4A 3T1HQ 4F7XA 3CU7A 1XNRL 1LTAD 2O4XA 4XT1B 3A55A 1SYBA 2XSCA 3KK7A 4GNXB 4LAAA 1JQYD 2FXQA 4CKBA 5GAHC 5DNFA 2K05A 5KRUA 5AJ3L 3WOFA 2QEXA 4EGVA 2XIWA 4A3DB 1KRSA 2NZ1D 3FVQA 4H44C 3H15A 5C4XH 3DEPA 2ICEC 1VMCA 1XXGA 2C9OA 4Q0FA 3KF6B 3MFGA 3G71A 2RCFA 1JJGA 3SE0A 4IPHA 2XRQD 5EPLA 1CQVA 2RCNA 5EAYA 4NW2A 1TWGH 1S5CD 1D5XC 2AUKA 3W3AA 1EL0A 1F9QA 3KLSX 2FINB 4YCWA 5GROA 2F0GA 2HUGA 2Q8RE 4PQXA 2A5HA 3R2TA 1SNOA 2WIIB 1I5FA 1LO5D 4BY1B 4FDBA 4ZUJA 2OTJA 3K0XA 1VQMA 2NBFA 1SAPA 2PNHA 1J8IA 3R3OA 3FKIH 3S17H 2NVTH 5JAVA 1S5FD 3GTKB 4RCOA 1H9MA 1IBLL 3WWVA 4NKLA 5EPKA 1RTOA 1Y1VH 4X3TA 4DV7L 2A6ED 4DNTB 3BVGA 2F0IA 1VQ9A 4DUZQ 3I4MH 4MNOA 2R93G 1JOQA 3Q6SA 5JEAJ 5NUCA 4BY7B 1I50H 1S40A 3A5ZB 1H9JA 2UXCL 1VDZA 2JEAI 2DJFC 4DPGA 3I4NB 2CFMA 5C3XA 3AYHB 4FF3A 1WI5A 1OTCA 3K5MA 2ZTCA 3HEJA 2I0QA 2R3ZA 1E24A 4DNIA 2HD3A 3PF5A 4CDDC 4POFA 4QGUA 3W1GA 4DR6Q 3G48A 1BCPC 3OMGA 3CCLA 3ERQA 2VQFQ 5CMDA 4B9WA 1RJTA 5BR8L 3HGBA 5IYBH 2GA4B 1K8GA 2E2JH 4DV2Q 3GTMH 2VS1A 3RD4A 2K50A 1BNZA 1A6XA 4QL5A 4DUYQ 2F0HA 2R7ZG 3UDXA 2RVLA 3RUZA 3DWQA 4XQQA 1N36Q 2N3SA 5KNCA 1W6KA 3PF4A 1GO3E 3VYRA 2CH4W 2KHJA 3CKIB 1Q90A 5KNBA 2F0WA 4BXXH 3K6OA 1TR5A 2HHHQ 3CC2A 4NXML 3GD7A 4RMFA 2FMMA 2QW7A 2L4NA 1E7ZA 4YIJA 1VQHA 1PXUA 3DM3A 1AEXA 4JI0L 4X3KA 3BG3A 1I4PA 1BDOA 1UE7A 1LTGD 3PIPA 1ENAA 2KCCA 4P74A 5M3MG 4A75A 3KYHC 3K57A 3NBIA 3V2TA 1XX8A 4UPAA 4RKBA 2G5DA 1RHPA 2D62A 3FHWA 4C3IG 1IYJB 3H3VH 1DYQA 4DV6Q 1CA5A 2EY2A 2HQLA 5J3BA 3IL8A 1EY0A 1EY4A 2C5CA 4DU9A 1Y8OB 2B3GA 1SSOA 1I4GA 3UE0A 4R4IA 2LXKA 5HGTA 4K6DA 4OGQC 4DR5L 1TS3A 5IYCG 5M5WB 1IKMA 1HR0Q 4DK3C 5CORA 1EY6A 4GZYC 3K5LA 4AQYQ 1F9PA 1H9SA 5IP9G 2OXPA 4OO1G 1GUNA 2E2DC 1K28A 2MO1A 3CCJA 5C0XG 5LMNQ 3S1NB 2KCNA 4OX9L 1YNJD 2VXWA 2O5JC 2R7DA 4ILWA 4KJOA 4DAYA 4JW0A 5IP7H 2X6LA 3HOUG 1AE3A 4L6TB 1EQRA 4I7AA 2Y0SE 2JA6G 1PTOF 4ODGA 1EYGA 1B3QA 2R92H 4X66Q 1DZ1A 4DAVA 2YTVA 4JI8L 4OEMB 4A3KG 1U9RA 1P16A 3GV3A 1YZ6A 4I65A 3PO2H 3FKIB 2NVTB 4MIUA 4P71A 2L15A 1CKOA 1PH5A 1WOCA 1QNKA 4WORA 1UUPA 2NVYB 3E9IA 3EBEA 2VNUD 3ER0A 2F0NA 3P20A 4JOIC 1SLJA 2FMCA 4XTCS 1EY9A 1QJOA 2Y0SB 3A5UA 4B3TQ 5ISRA 3MEHA 5FLXc 2RQXA 3PMFA 5L37A 1TY2A 1V9PA 3JAMi 4A3JB 1KABA 3KLRA 3E5SA 2BE5D 5E3FA 4HCEA 2J7ZA 4K8JA 2WB1B 4KKUA 4WJ4A 3HG9A 3T1HL 2NTTA 4N9TA 3EA6A 3SVMA 4JYAQ 4YWKA 2CW0D 3J80E 2K5WA 4A3FH 4OONA 4KD3A 1WFQA 1PRTF 4HN7A 4XQJA 3J7AF 3A74A 2HIXA 1Q12A 2SNMA 2ENBA 2IW3A 4CDEC 2I5HA 3AFQA 1TXYA 3V96A 5ELFA 3JAML 3PUWA 3GTMB 1BCPD 2WAQE 4IFDI 4JI1Q 4JI5L 3BDLA 1XMQL 1UNSA 4FO2A 5E4WC 4B08A 2F4VQ 1Y1WB 2ZJQA 3EJIA 3RZOB 1UAPA 1Y69U 3TZDA 2EYOA 2G9DA 3VYUA 2SNSA 2QILA 2I46A 3PIO3 1M4VA 4DV4L 1GOZA 4HR7B 1PZJD 1NNXA 2BDNA 1EY7A 3KLSA 4JG2A 1EZ6A 3RLOA 1CQFA 3GTJH 1LABA 4IFDH 3QR8A 2B2WC 1N32L 2IL8A 3P1HA 1DM0B 1Q8IA 2JA5H 5GADC 1LTTD 3E0JA 4CBVA 2WAQB 1B8AA 1STBA 4FNFA 4RGMA 1R9TH 3ULLA 4N9PA 4L5SA 2K6AA 1IYUA 2HQEA 1EYCA 1KDAA 2B2UA 5TSSA 3NPPA 3P7JA 4C2MH 1V1PA 4GS3A 3JAMc 5AJ3Q 5CC4A 4DR1Q 4A3LG 1F2ZA 2F4IA 2A8VA 2XNAC 3QB3A 1VF5C 1ONLA 1A62A 2ZTEA 1KTKA 1O7YA 4DUZL 1BVSA 3I56A 3SK4A 1IL2A 3OTOQ 3HRZC 1L1OC 1HZAA 4A3MG 1TQOA 4A3EH 2RF4A 3SGIA 3JC66 1UE6A 2OEOA 2K5HA 4H02A 2NVQB 5IGFA 1E22A 1JB7A 2PW7A 2Q2TA 3VYSA 4DA2A 1DCZA 2RDGA 1EWIA 3S2HH 3AFPA 2RA4A 5KNDA 3STBC 1L2FA 2R92B 1RTNA 3PUYA 1HUNA 4K5VA 2IY5B 1B50A 4P2CB 5CBAE 3X3NA 3D3RA 5D14A 3H0GG 2F0FA 5C44H 2KEEA 5A2QE 3NE5B 2EY5A 1IBLQ 1EFWA 4I7ZC 3MXGA 1MD2D 5M3FH 2KA7A 5DAUA 4DV7Q 3I3CA 4DV2L 2ES2A 4YCVA 1OO9B 2JA8H 5KYLA 1PFSA 1HTPA 4BA1I 3J80L 3ZYYX 3HOZG 3S1RH 1VQ6A 1A3TA 1N36L 1E2VA 2EOTA 2UXCQ 4J6HA 4KJNA 4L5TA 4R4TA 1SE4A 3I91A 3UE1A 3Q24A 1SMYD 4MHEA 1H9SB 3HKSA 5T1GA 2HHHL 1K8OA 1ZEQX 1HNWQ 4J1MA 1IHZA 2A19A 3DWAA 2NN6H 4LUVA 1VQ8A 1WCMH 3BZKA 1QNUA 3T1YQ 1EU3A 3KDFA 4TVAB 3SXHA 4JOIA 2ATWA 1QCBD 4DFAA 3HOWG 2B63G 4BBRH 3PUVA 2YTYA 2D0OA 4OWTB 4A3FB 3H94A 4DV5L 4FXDA 2XN9C 5CV8A 3SDZA 4LF8L 1Z7TA 2DN8A 1HNXL 1JR0D 1NMFA 1B3AA 5C6AA 5BR8Q 1U0LA 4EQ5A 2J0TD 2OQ0A 3PGZA 1STAA 4PMWA 2BOSA 3A8KE 3EN2A 1CK1A 2ZT9C 3M4PA 1HR0L 1Q1EA 4DGZA 2A68D 1Y8NB 1LACA 4LJZC 5C3EG 2B8GA 4C3HG 1QZHA 4B3SQ 3A7AB 3I55A 4Z9CB 4NXMQ 4ABNA 4KKTA 4CJ2C 2B39A 1AN8A 1KRTA 2L1BA 3GTJB 4JI0Q 3UDGA 2E2IB 2A6HD 2JA5B 5C5MA 4F88A 1K8MA 4IJLA 2VB3X 1Q1BA 2QA4A 3F2DA 1VQIA 2E76C 1I4QA 1FD7D 4A93B 1STEA 1AH9A 4BY1H 3MZ5A 4MTKA 4A3GH 4LUOA 5EQ0A 3HKZB 2AWNA 3RLNA 2RDFA 1QUQA 5H1SE 3K7AH 2UUCL 1JC7A 4ZYSA 2V4DA 1EY5A 1F77A 1AP0A 3TP7A 3M7NA 4DR5Q 1DXMA 3K5OA 1G8ZD 3HS0C 5C5LA 3SHLA 2B2WA 4R8NA 1L0YB 2L55A 1E3PA 4B3TL 3NUCA 2LY7A 5A2QL 2TSSA 1B4OA 3PIOA 3ITPA 1QVGA 2F0OA 1SBBB 3BVMA 2WKCA 1S3OA 4IJHA 5JJLA 3PUZA 1PH4A 3C1FA 2FFKB 3J7ZC 2JEBI 3GDEA 1BCPB 2QEJC 2RKSA 4RFBA 1YJWA 4UP9A 3S2HB 2DNCA 1EU4A 1SXTA 5JOBA 4A3IB 3GTGB 1M1KC 2VW9A 4RGTA 5DM63 4QCLA 4O1NA 5IOCA 1YJNA 4JYAL 4JI8Q 3H6MA 4HMIA 1L1OA 1O80A 4JI6L 4BWGB 3D4RA 2HCCA 2LXJA 5C44B 2UUAL 2AUJD 1C9OA 1SYEA 4J8QA 4QUCA 5C3WA 1V1PB 4X62L 4KLKA 1C8CA 4GLVB 1PTOC 2LMCB 1SMXA 2JA8B 4NPSA 2O5IC 4K2LA 5JVH3 4JI1L 3MXPA 1I94Q 2KJXA 3S1RB 2F4VL 4QB4A 1ML0D 3L2PA 3HOXH 1ET9A 1B2TA 4KK7A 1STNA 1X54A 4JCVE 1JT8A 3MWYW 4KV6A 5IT9c 2PI2A 4WRDA 4DR2L 2NTSA 5LL6S 3A0JA 4P75A 4DAPA 3BJUA 1NJIC 1X3PA 2E74C 1SEBD 2EY1A 4XXEA 1Q82C 3OW7A 1BOSA 1IL8A 2K01A 2M00A 2D0PA 4B3ML 1STYA 3RN5A 4BBRB 2FJ2A 3ZJYC 3QIAA 1CHPD 1GKHA 3CXCA 4DR1L 5DM73 3URYA 2UUBL 4OIKA 1Y8PB 1HNZL 2EXDA 1S5DD 3ERSX 4RKLA 3LNNA 2F03A 3GTPB 1RDPD 4FXKC 4GN3B 4YCUA 4JI5Q 3I2ZA 1VQAA 2F0UA 2JYOA 1GUGA 4UP8A 1XMQQ 1MJEA 5M5WH 4C1NK 3OTOL 1KNEA 4XDXA 1PRTC 4DAMA 4B9XA 2A69D 3KJOA 3S1NH 4DV4Q 1IZ6A 3S1MB 5I4DA 5IGEA 1ZKOA 3LGJA 1KXLA 3J7AV 3U58A 2BA0A 1IXRA 1N32Q 3W2DA 1YNND 2F0TA 4IUUA 1EYDA 4OL7A 5M5XH 4DV3L 5C4XG 1CTMA 1WJJA 1PH3A 1LTSD 2IHFA 1O7LA 3G6EA 1ZYRC 2DJGC 1LTRD 2JA7G 4A3GB 3KDFB 5IE8A 2QF7A 1WTRA 1K83H 2EYPA 2L12A 3K7AB 5ELOA 4CHTB 4GOPC 2MFIA 4CJ0B 4N8X1 1CM9A 2NVYH 1SYFA 4JC0A 1ILQA 5FLXE 2R93H 1E2ZA 4AYBG 1WTQA 1SJED 1S4ZA 5EKIA 3RLFA 2IPKD 1XPRA 2M2LA 3UI2A 2KHIA 1D8LA 2PQAA 3R8BA 1KLUD 1BBWA 1HQRD 2AQ3B 4A3JH 1HNWL 1Y1VG 3LWEA 1X3EA 3TS2A 1MGSA 2CHBD 1QWYA 3I4MG 1HZ9A 1RKNA 3HOVG 1VQ4A 3T1YL 1FL0A 2WKDA 2XRSD 3GV6A 4PMCA 1YEZA 1STHA 3NQIA 1G6PA 2XWBB 4QJFA 2AQ2B 3PQIA 2QKIC 4U68A 2MO0A 4C3JG 3MC0B 5JVG3 3A56A 4DNRB 4RG1A 2AHOB 1B9NA 1GXDC 2IX3A 1CHQD 1PFNA 1E0BA 1QUQB 1E1OA 1TY0A 5D65A 1RCVD 2R7ZH 2UXDQ 3MA2B 3TREA 3MEFA 3AMUA 4QMGA 1Y1WH 2L11A 3RZOH 4QIWE 3HOXB 1TIID 3E9HA 3NBHB 2OWOA 2K52A 2K03A 4F87A 1RF2D 5FLMH 4B3SL 1SR3A 2Q8TA 3H3VI 1YBYA 2EYLA 1TT2A 2DGYA 2IX1A 1N34L 1PH7A 1SROA 1NBWA 3OW2A 4JV5L 2HDMA 2RHQB 4HMJA 3H09A 3C1EA 2HDLA 4YY3Q 3AB9A 1UEAB 1NTGA 1PZID 5M3MH 3ND9A 3JAME 3IRBA 4DV5Q 4ULLA 4C3IH 4QIWB 4LF8Q 1HNXQ 1PH2A 2K28A 4APVA 3U4VA 5EPJA 2PI2E 3TSSA 1L1OB 1PHJA 2YYZA 2NZOA 3EQLC 5T1IA 2KBNA 4A3CG 5IYCH 5J1ZA 4LFCL 2SDFA 2E2HH 3A54A 1Q46A 1VF7A 2H1EA 3CCVA 1VQBA 3ULJA 1MHWC 4L5RC 4HSPA 2B2VC 1EEID 3H91A 5C0XH 3CRKC 1TKWB 2NVQH 1SYCA 2F0EA 2KVMA 5FLXL 3CCRA 3OIQA 2EY6A 3I90A 4P73A 3HOUH 2ZM6Q 1NAPA 1GD7A 4FF4A 3I7FA 2JA6H 5M5XB 2EPBA 2EJMA 2MHVA 3QOLA 3BZDB 5KIXA 2LKVA 4A3KH
chains in the Genus database with same CATH topology
1E22A 1I6HH 1JB7A 4DV0Q 1PYSB 2Q2TA 2XTIA 4LFAL 4KHPL 1YIJA 5IY0A 2UUCQ 1EWIA 3S2HH 1RIPA 1V43A 3AFPA 4BY7H 1JJ2A 2CWPA 2Z6KC 1W2BA 3STBC 1SFOH 3FKIG 1L2FA 4LW1A 4IPCA 3PUYA 4LF9L 1KC8C 2IY5B 3D31A 3I4NH 3OYYA 3S16H 1LTLA 4PZ6A 4OX9Q 4JBKA 4PG3A 1X65A 1UWVA 5FJ8H 1I94L 4LF6L 2WFWA 3H0GG 3DLLA 4POGA 2ASBA 1WYDA 4GKJQ 1HZCA 1RL2A 5C44H 3HOVH 1OXXK 1CKNB 1IBMQ 1NMGA 2CKZB 2IHEA 2F3IA 1IBLQ 3KLWA 3CCEA 1EFWA 2Y0SG 3F1ZA 3PO2G 4R4CA 2K5NA 1PH1A 5M3FH 2E5LQ 1OXVA 1X3FA 4DR4Q 4DV7Q 4JV5Q 1PVOA 2A1AA 4GLXA 4DV2L 2ES2A 4YCVA 2JA8H 4LF5L 1D7QA 1AE2A 4C3JH 4HIMA 1HR0W 1PFSA 1QVCA 2Z0SA 4BA1I 3U50C 1K73C 3HOZG 4LNQA 3S1RH 1VQ6A 1OXSC 3CAMA 1N36L 4A3BG 4A3JG 1VQ7A 1VQ5A 1VQDA 2UXCQ 4L5TA 4R4TA 1OXUA 1SN8A 2VZAA 4IPDA 4HJ5A 3UE1A 3CP0A 3K81C 1JMCA 1IBKL 2WB1G 2HHHL 3HKSA 5GQOA 3AEVA 3S15H 5JJKA 4R4QA 2MNAA 2AKWB 1N33L 1V1QA 1GVPA 4HIDA 1HNWQ 2A19A 3HFZB 4JI6Q 1M90C 1N9WA 2UUAQ 4IO9A 2K4KA 4LUVA 1VQ8A 2DUDA 1WCMH 3TRZA 3BZKA 3HOXG 4X62Q 3T1YQ 1K8AC 4DV1L 2R7FA 3CMEA 3KDFA 4TVAB 4NXNL 4JI3L 5IYBG 4JOIA 3J81j 2ATWA 4LFBL 1YHBA 2UU9L 3HOWG 2B63G 4BBRH 3PUVA 2YTYA 2D0OA 4OWTB 4IOCA 4DR3L 1VQKA 4DV5L 2GN5A 2OQKA 4LF8L 4R4OA 4HIKA 1HNXL 1NMFA 1X55A 4IPGA 1J6QA 1HH2P 3M4QA 1MJCA 1U0LA 5BR8Q 1Y1WG 1XPUA 1YHAA 3PO3G 4WJ3M 4LF7L 4EQ5A 1Q86C 2OQ0A 3PGZA 4JBJA 1KL9A 4PMWA 5LMUQ 1VQGA 4YWLA 3T1HQ 3EN2A 4DR2Q 4BXXG 5C0XJ 1XNRL 5FLMG 4OO1I 4X64Q 5C0XI 2VQEQ 2PQAB 3HOYG 3M4PA 1HR0L 1A63A 2E2IH 3L0OA 4DKAC 4GNXB 2N78A 2FXQA 3GTOH 1Q1EA 4DR7Q 5GAHC 4Y52H 3CC7A 4TQUS 1HJPA 1PH6A 3MXNB 5AJ3L 1VQFA 5C3EG 4QQBX 2QEXA 3TS0A 1QZHA 4B3SQ 2ID0A 4ME3A 3I55A 2ZJPA 4YHHQ 4B3MQ 1KRSA 4NXMQ 4A93H 4A3CH 5JJIA 2WAQG 1VQNA 1FJGL 3H15A 4B3RL 1KRTA 3KJPA 4JI0Q 3UDGA 5C4XH 5IP9H 2VUMG 1PA6A 1U5KA 1CSQA 2JA9A 1VQEA 3KF6B 3G71A 2UUBQ 1JJGA 1HNZQ 4GN5A 4IPHA 2RCNA 4IJLA 1Q1BA 1XJVA 2JJQA 2QA4A 5EAYA 3F2DA 1VQIA 1J5EL 2Q2IA 2QGQA 4BY1H 1TWGH 2ZTDA 1AH9A 4AYBE 4GNXC 3GTQH 4A3GH 5IYDH 4LUOA 2OTLA 4DV0L 2AWNA 2KCTA 3RLNA 3UDIA 1QUQA 5H1SE 3K7AH 2UUCL 1YNXA 2HIVA 1O7IA 4YCWA 5GROA 1KD1C 2K5VA 4JI4Q 3CCQA 4GKKQ 4HJ8A 1EUJA 3M7NA 4LUZA 1I5FA 4AH6A 4DR5Q 4JI2Q 3S2DH 4FDBA 2OTJA 3K0XA 1VQMA 1PH8A 3VDYA 1FGUA 4K0KQ 3PUXA 2PNHA 3RZDH 5IWAQ 1E3PA 2F52A 3FKIH 1Z9FA 4DV3Q 4A3IH 5IP7G 3K8AA 4B3TL 2NVTH 3GTGH 3CQZH 3S17H 1IBML 4X6AH 3PIOA 1IBLL 3WWVA 1QVGA 2E5LL 1Y1VH 1S3OA 4IJHA 4A3EG 4DV7L 2R92G 4BBSG 3H0GH 5JJLA 3PUZA 1G291 1CKMA 3G4SA 1PH4A 4NB3A 3J7ZC 2JEBI 1VQ9A 4DUZQ 2Q2UA 4MNOA 3I4MH 3GDEA 2R93G 4HIOA 5JEAJ 1SRUA 1YJWA 1YI2A 4O2DA 4UP9A 2BH2A 1I50H 1S40A 1VCIA 4GLAC 4X65L 3A5ZB 2VW9A 1M1KC 3S1QH 2UXCL 2JEAI 3BU2A 4ALPA 3M4OH 3U4ZA 4DPGA 2EIFA 2NN6I 1YJNA 2CFMA 2JE6I 2WB1E 3AYHB 4JYAL 4JI8Q 3F2BA 2UXDL 1MIUA 1WI5A 1OTCA 2E8GA 4A4IA 5C4JH 1NY4A 2ZTCA 4A3BH 1L1OA 2H5XA 2I0QA 4GOPA 4JI6L 2LXJA 1E24A 4DNIA 4A76A 2UUAL 3RR5A 4J15A 3PF5A 4POFA 4QGUA 1C9OA 3W1GA 2NVXH 1LYLA 4X62L 1XNQL 4KLKA 3CPWA 4GLVB 4DR6Q 1SMXA 3KF8B 3F2CA 4NPSA 3G48A 2PMZE 1XMOQ 5M3FG 4JI1L 3CCLA 1I3QH 1I94Q 2YTXA 2F4VL 2VQFQ 1A8VA 1C0AA 4YY3L 2Z6KA 3L2PA 3HOXH 5BR8L 2OCEA 5IYBH 1X54A 4JCVE 1K8GA 1JT8A 2E2JH 3CW2C 1KIXA 2JK8A 2B63H 2AWOA 3HOWH 5IT9c 4DV2Q 3GTMH 2PI2A 2VS1A 2VL6A 4JBWA 4DR2L 2K50A 3D0FA 4QL5A 4DUYQ 1JE5A 4HJ7A 2R7ZG 3UDXA 2VQEL 3B6YA 3PO3H 4A3FG 3A0JA 4P75A 1N36Q 2EQSA 1TWCH 2N3SA 1B70B 3BJUA 1K0RA 1B7YB 1NJIC 4DR7L 3PF4A 1GO3E 1MKHA 2IX0A 1EIYB 2KHJA 1Q82C 2ZJRA 1WCMG 4BXXH 1KQSA 1IBKQ 4LF4Q 3GTPH 2HHHQ 3CC2A 4NXML 2D0PA 4B3ML 3GD7A 3J7A5 3HOZH 4HJ9A 2ALYB 4RMFA 3RN5A 3HOYH 4P72A 1N33Q 1Y14B 1E7ZA 3ULPA 1VQHA 3ZJYC 3DM3A 3ICEA 2WP8J 3K80C 4JI0L 1GKHA 3CXCA 5C3EH 4C3HH 1G51A 3CC4A 4DR1L 1UE7A 2UUBL 3S14H 1HNZL 3PIPA 4DV1Q 2EXDA 3M9BA 3ERSX 4P74A 3W5OA 5M3MG 4A75A 3KYHC 3S1MH 1TWHH 1N34Q 4LFBQ 4IOAA 3PSIA 4UPAA 4GN3B 4YCUA 3GO5A 1GM5A 4JI5Q 4A3DG 3I2ZA 1VQAA 4UP8A 1XMQQ 2YV5A 3J81i 1CKNA 1QZGA 5M5WH 5E7NA 1MJEA 3PV0A 1PH9A 2VUMH 2D62A 2NZHA 2Q2HA 1IYJB 3FHWA 5GAEC 1JJCB 3OTOL 2ZM6L 3H3VH 1QVFA 4A3LH 4DV6Q 2HQLA 5J3BA 4BA2I 4IFDG 3S24A 4DAMA 3TQYA 3CPFA 4XIGS 4LF7Q 3W1BA 3KJOA 2KCMA 1YITA 4GOPB 2JA5G 5GAGC 4DV4Q 4JI7L 2B3GA 3S1NH 3UE0A 4GKKL 1IZ6A 2LXKA 3BZCA 4R4IA 1XNRQ 4GKJL 1BKBA 3LGJA 4A93G 4DR5L 1KXLA 4O0AA 5IYCG 4OWWB 3U58A 2BA0A 1IXRA 1HR0Q 4DK3C 4A3MH 1N32Q 4K0KL 4AQYQ 3HKZG 5M5XH 4DV3L 5C4XG 5IP9G 1WJJA 4AIMA 1PH3A 4OO1G 2MO1A 3CCJA 5LMNQ 2IHFA 5C0XG 1XPOA 3G6EA 4LFCQ 4OX9L 2UXBQ 1Q7YC 3KOJA 2JA7G 2R7DA 3KDFB 1KHIA 5IE8A 4PZ8A 4KI0A 4BY1G 1LM0A 1K83H 5ELOA 5IP7H 1N8RC 5IYDG 1VQOA 3HOUG 1AE3A 4GOPC 3FP9A 2MFIA 1EQRA 2JA6G 2Y0SE 2VNUD 2CQOA 1OXTA 2NVYH 4HJAA 4X66Q 1EYGA 2R92H 4JC0A 4BBSH 4DR4L 3NENA 3M3YH 2R93H 4MTNA 4AYBG 2YTVA 4JI8L 4A3KG 1P16A 2XGTA 1YZ6A 3EIVA 4LWCA 2N8NA 3RLFA 3J80i 3PO2H 1HZBA 1XPRA 4P71A 4UY8C 4BY7G 2L15A 1S72A 1XTDA 4A3IG 1CKOA 3Q8DA 1PH5A 1W3SA 1WOCA 2KHIA 3CD6A 1D8LA 2PQAA 1BBUA 3EBEA 1X6OA 1UE1A 1UE5A 3E9IA 3ER0A 4JOIC 3CCUA 1BBWA 3I4OA 4GNXA 1SLJA 3AQQA 4LFAQ 4DR6L 4A3JH 1XMOL 3I4NG 1Y1VG 4KHPQ 1HNWL 3K7UC 5FJ8G 4JI7Q 1X3EA 4XTCS 4EX5A 3STBD 2VQFL 3I4MG 1HZ9A 2VY3A 3TS2A 3J81c 2BH8A 3A5UA 4DK6C 4B3TQ 3HOVG 5C44G 1VQ4A 5FLXc 3T1YL 1FL0A 3UDFA 4LF9Q 1YEZA 1G6PA 1X9NA 4QJFA 4MZ9A 4OXPA 2BA1A 4LF6Q 1PV4A 1V9PA 3JAMi 4L5QA 2JA8G 3KF6A 3GTLH 2MO0A 4QY7A 4DUYL 1NE3A 5HY6A 2YU9H 4RG1A 1Q81C 2AHOB 4X65Q 5LMNW 1QUQB 4WJ4A 5LMUL 1E1OA 3TEHB 3T1HL 1T9HA 4LF5Q 4LF4L 4OWXB 1P8LA 4Y7NH 4JYAQ 3M85A 4X64L 4YWKA 2R7ZH 2CCZA 2UXDQ 1PYBA 4A3FH 5JEAG 4OONA 3MEFA 1WFQA 2RHSB 3TREA 1Y1WH 1YVCA 3A74A 3RNUA 3RZOH 2HIXA 4QIWE 5ELNA 1Q12A 1EIFA 5K36G 3E9HA 3NBHB 1K3RA 2OWOA 2I5HA 2NN6G 3AFQA 2K52A 4JBMA 5FLMH 4DAYB 1SR3A 4B3SL 1TXYA 1XNQQ 2R6GA 3H3VI 4IFDJ 1YBYA 4YHHL 4IFDI 3PUWA 2DGYA 2WAQE 3CMAA 1N34L 3L7ZC 2IX1A 1PH7A 1SROA 2MQHA 1NBWA 4JI1Q 1Q8KA 4JI5L 3CCMA 3OW2A 1XMQL 4JV5L 4BBRG 2RHQB 2F4VQ 2ZJQA 2AMCB 1C7YA 4YY3Q 1ASZA 4KHZA 1YJ9A 4DV6L 1X56A 1NTGA 5M3MH 3KFUA 4NXNQ 3J80c 4JI3Q 2B29A 1K9MC 2UU9Q 4DV4L 4A3DH 3IRBA 3F8TA 2CWAA 4DR3Q 1YHQA 4DV5Q 1EOVA 4GN4B 1X3GA 4JG2A 3RLOA 4C3IH 1VQJA 2IT1A 1HNXQ 1PH2A 4LF8Q 3PCOB 3GTJH 5DLQE 4APVA 3U4VA 1Z47A 1N32L 2PI2E 4AQYL 3HKZE 5M5YH 1L1OB 2V1CC 2JA5H 5GADC 1PHJA 3E0EA 1EQQA 4JI4L 2YYZA 2NZOA 1B8AA 2I5LX 2KENA 4PZ7A 4YWMA 5LMNL 3ULLA 2KBNA 1R9TH 4L5SA 5HGQA 4UP7A 4A3CG 5IYCH 4JI2L 4LFCL 2UXBL 1TWAH 1VQCA 1H95A 2E2HH 1Q46A 3CCVA 1LUZA 1VQBA 2GVAA 4C2MH 4GS3A 3ULJA 5IWAL 3JAMc 3CCSA 2JQOA 5AJ3Q 4L5RC 1L0WA 1UEBA 3CF5A 4DR1Q 3RN2A 4A3LG 4R1JA 2A8VA 1A0IA 2GVBA 2N49A 2NVQH 4X66L 2JA7H 1FJGQ 1VQLA 1VS0A 1A62A 2ZTEA 1CSPA 3CCRA 4B3RQ 2LSSA 4DUZL 1BVSA 1FVIA 3I56A 4P73A 1IL2A 4A3GG 2K75A 3OTOQ 3HOUH 2ZM6Q 1L1OC 1KAWA 1GD7A 3I7FA 2JA6H 1ASYA 1HZAA 4A3MG 1E1TA 3GTKH 2I5MX 4A3EH 1J5EQ 2RF4A 1SE8A 3NEMA 1CUKA 2K14A 3SGIA 3JC66 1UE6A 3NELA 1VQPA 2HT1A 2K5HA 1DGSA 4H02A 2C35B 1TWFH 4A3KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E22 A;  1I6H H;  1JB7 A;  4DV0 Q;  1PYS B;  2Q2T A;  2XTI A;  4LFA L;  4KHP L;  1YIJ A;  5IY0 A;  2UUC Q;  1EWI A;  3S2H H;  1RIP A;  1V43 A;  3AFP A;  4BY7 H;  1JJ2 A;  2CWP A;  2Z6K C;  1W2B A;  3STB C;  1SFO H;  3FKI G;  1L2F A;  4LW1 A;  4IPC A;  3PUY A;  4LF9 L;  1KC8 C;  2IY5 B;  3D31 A;  3I4N H;  3OYY A;  3S16 H;  1LTL A;  4PZ6 A;  4OX9 Q;  4JBK A;  4PG3 A;  1X65 A;  1UWV A;  5FJ8 H;  1I94 L;  4LF6 L;  2WFW A;  3H0G G;  3DLL A;  4POG A;  2ASB A;  1WYD A;  4GKJ Q;  1HZC A;  1RL2 A;  5C44 H;  3HOV H;  1OXX K;  1CKN B;  1IBM Q;  1NMG A;  2CKZ B;  2IHE A;  2F3I A;  1IBL Q;  3KLW A;  3CCE A;  1EFW A;  2Y0S G;  3F1Z A;  3PO2 G;  4R4C A;  2K5N A;  1PH1 A;  5M3F H;  2E5L Q;  1OXV A;  1X3F A;  4DR4 Q;  4DV7 Q;  4JV5 Q;  1PVO A;  2A1A A;  4GLX A;  4DV2 L;  2ES2 A;  4YCV A;  2JA8 H;  4LF5 L;  1D7Q A;  1AE2 A;  4C3J H;  4HIM A;  1HR0 W;  1PFS A;  1QVC A;  2Z0S A;  4BA1 I;  3U50 C;  1K73 C;  3HOZ G;  4LNQ A;  3S1R H;  1VQ6 A;  1OXS C;  3CAM A;  1N36 L;  4A3B G;  4A3J G;  1VQ7 A;  1VQ5 A;  1VQD A;  2UXC Q;  4L5T A;  4R4T A;  1OXU A;  1SN8 A;  2VZA A;  4IPD A;  4HJ5 A;  3UE1 A;  3CP0 A;  3K81 C;  1JMC A;  1IBK L;  2WB1 G;  2HHH L;  3HKS A;  5GQO A;  3AEV A;  3S15 H;  5JJK A;  4R4Q A;  2MNA A;  2AKW B;  1N33 L;  1V1Q A;  1GVP A;  4HID A;  1HNW Q;  2A19 A;  3HFZ B;  4JI6 Q;  1M90 C;  1N9W A;  2UUA Q;  4IO9 A;  2K4K A;  4LUV A;  1VQ8 A;  2DUD A;  1WCM H;  3TRZ A;  3BZK A;  3HOX G;  4X62 Q;  3T1Y Q;  1K8A C;  4DV1 L;  2R7F A;  3CME A;  3KDF A;  4TVA B;  4NXN L;  4JI3 L;  5IYB G;  4JOI A;  3J81 j;  2ATW A;  4LFB L;  1YHB A;  2UU9 L;  3HOW G;  2B63 G;  4BBR H;  3PUV A;  2YTY A;  2D0O A;  4OWT B;  4IOC A;  4DR3 L;  1VQK A;  4DV5 L;  2GN5 A;  2OQK A;  4LF8 L;  4R4O A;  4HIK A;  1HNX L;  1NMF A;  1X55 A;  4IPG A;  1J6Q A;  1HH2 P;  3M4Q A;  1MJC A;  1U0L A;  5BR8 Q;  1Y1W G;  1XPU A;  1YHA A;  3PO3 G;  4WJ3 M;  4LF7 L;  4EQ5 A;  1Q86 C;  2OQ0 A;  3PGZ A;  4JBJ A;  1KL9 A;  4PMW A;  5LMU Q;  1VQG A;  4YWL A;  3T1H Q;  3EN2 A;  4DR2 Q;  4BXX G;  5C0X J;  1XNR L;  5FLM G;  4OO1 I;  4X64 Q;  5C0X I;  2VQE Q;  2PQA B;  3HOY G;  3M4P A;  1HR0 L;  1A63 A;  2E2I H;  3L0O A;  4DKA C;  4GNX B;  2N78 A;  2FXQ A;  3GTO H;  1Q1E A;  4DR7 Q;  5GAH C;  4Y52 H;  3CC7 A;  4TQU S;  1HJP A;  1PH6 A;  3MXN B;  5AJ3 L;  1VQF A;  5C3E G;  4QQB X;  2QEX A;  3TS0 A;  1QZH A;  4B3S Q;  2ID0 A;  4ME3 A;  3I55 A;  2ZJP A;  4YHH Q;  4B3M Q;  1KRS A;  4NXM Q;  4A93 H;  4A3C H;  5JJI A;  2WAQ G;  1VQN A;  1FJG L;  3H15 A;  4B3R L;  1KRT A;  3KJP A;  4JI0 Q;  3UDG A;  5C4X H;  5IP9 H;  2VUM G;  1PA6 A;  1U5K A;  1CSQ A;  2JA9 A;  1VQE A;  3KF6 B;  3G71 A;  2UUB Q;  1JJG A;  1HNZ Q;  4GN5 A;  4IPH A;  2RCN A;  4IJL A;  1Q1B A;  1XJV A;  2JJQ A;  2QA4 A;  5EAY A;  3F2D A;  1VQI A;  1J5E L;  2Q2I A;  2QGQ A;  4BY1 H;  1TWG H;  2ZTD A;  1AH9 A;  4AYB E;  4GNX C;  3GTQ H;  4A3G H;  5IYD H;  4LUO A;  2OTL A;  4DV0 L;  2AWN A;  2KCT A;  3RLN A;  3UDI A;  1QUQ A;  5H1S E;  3K7A H;  2UUC L;  1YNX A;  2HIV A;  1O7I A;  4YCW A;  5GRO A;  1KD1 C;  2K5V A;  4JI4 Q;  3CCQ A;  4GKK Q;  4HJ8 A;  1EUJ A;  3M7N A;  4LUZ A;  1I5F A;  4AH6 A;  4DR5 Q;  4JI2 Q;  3S2D H;  4FDB A;  2OTJ A;  3K0X A;  1VQM A;  1PH8 A;  3VDY A;  1FGU A;  4K0K Q;  3PUX A;  2PNH A;  3RZD H;  5IWA Q;  1E3P A;  2F52 A;  3FKI H;  1Z9F A;  4DV3 Q;  4A3I H;  5IP7 G;  3K8A A;  4B3T L;  2NVT H;  3GTG H;  3CQZ H;  3S17 H;  1IBM L;  4X6A H;  3PIO A;  1IBL L;  3WWV A;  1QVG A;  2E5L L;  1Y1V H;  1S3O A;  4IJH A;  4A3E G;  4DV7 L;  2R92 G;  4BBS G;  3H0G H;  5JJL A;  3PUZ A;  1G29 1;  1CKM A;  3G4S A;  1PH4 A;  4NB3 A;  3J7Z C;  2JEB I;  1VQ9 A;  4DUZ Q;  2Q2U A;  4MNO A;  3I4M H;  3GDE A;  2R93 G;  4HIO A;  5JEA J;  1SRU A;  1YJW A;  1YI2 A;  4O2D A;  4UP9 A;  2BH2 A;  1I50 H;  1S40 A;  1VCI A;  4GLA C;  4X65 L;  3A5Z B;  2VW9 A;  1M1K C;  3S1Q H;  2UXC L;  2JEA I;  3BU2 A;  4ALP A;  3M4O H;  3U4Z A;  4DPG A;  2EIF A;  2NN6 I;  1YJN A;  2CFM A;  2JE6 I;  2WB1 E;  3AYH B;  4JYA L;  4JI8 Q;  3F2B A;  2UXD L;  1MIU A;  1WI5 A;  1OTC A;  2E8G A;  4A4I A;  5C4J H;  1NY4 A;  2ZTC A;  4A3B H;  1L1O A;  2H5X A;  2I0Q A;  4GOP A;  4JI6 L;  2LXJ A;  1E24 A;  4DNI A;  4A76 A;  2UUA L;  3RR5 A;  4J15 A;  3PF5 A;  4POF A;  4QGU A;  1C9O A;  3W1G A;  2NVX H;  1LYL A;  4X62 L;  1XNQ L;  4KLK A;  3CPW A;  4GLV B;  4DR6 Q;  1SMX A;  3KF8 B;  3F2C A;  4NPS A;  3G48 A;  2PMZ E;  1XMO Q;  5M3F G;  4JI1 L;  3CCL A;  1I3Q H;  1I94 Q;  2YTX A;  2F4V L;  2VQF Q;  1A8V A;  1C0A A;  4YY3 L;  2Z6K A;  3L2P A;  3HOX H;  5BR8 L;  2OCE A;  5IYB H;  1X54 A;  4JCV E;  1K8G A;  1JT8 A;  2E2J H;  3CW2 C;  1KIX A;  2JK8 A;  2B63 H;  2AWO A;  3HOW H;  5IT9 c;  4DV2 Q;  3GTM H;  2PI2 A;  2VS1 A;  2VL6 A;  4JBW A;  4DR2 L;  2K50 A;  3D0F A;  4QL5 A;  4DUY Q;  1JE5 A;  4HJ7 A;  2R7Z G;  3UDX A;  2VQE L;  3B6Y A;  3PO3 H;  4A3F G;  3A0J A;  4P75 A;  1N36 Q;  2EQS A;  1TWC H;  2N3S A;  1B70 B;  3BJU A;  1K0R A;  1B7Y B;  1NJI C;  4DR7 L;  3PF4 A;  1GO3 E;  1MKH A;  2IX0 A;  1EIY B;  2KHJ A;  1Q82 C;  2ZJR A;  1WCM G;  4BXX H;  1KQS A;  1IBK Q;  4LF4 Q;  3GTP H;  2HHH Q;  3CC2 A;  4NXM L;  2D0P A;  4B3M L;  3GD7 A;  3J7A 5;  3HOZ H;  4HJ9 A;  2ALY B;  4RMF A;  3RN5 A;  3HOY H;  4P72 A;  1N33 Q;  1Y14 B;  1E7Z A;  3ULP A;  1VQH A;  3ZJY C;  3DM3 A;  3ICE A;  2WP8 J;  3K80 C;  4JI0 L;  1GKH A;  3CXC A;  5C3E H;  4C3H H;  1G51 A;  3CC4 A;  4DR1 L;  1UE7 A;  2UUB L;  3S14 H;  1HNZ L;  3PIP A;  4DV1 Q;  2EXD A;  3M9B A;  3ERS X;  4P74 A;  3W5O A;  5M3M G;  4A75 A;  3KYH C;  3S1M H;  1TWH H;  1N34 Q;  4LFB Q;  4IOA A;  3PSI A;  4UPA A;  4GN3 B;  4YCU A;  3GO5 A;  1GM5 A;  4JI5 Q;  4A3D G;  3I2Z A;  1VQA A;  4UP8 A;  1XMQ Q;  2YV5 A;  3J81 i;  1CKN A;  1QZG A;  5M5W H;  5E7N A;  1MJE A;  3PV0 A;  1PH9 A;  2VUM H;  2D62 A;  2NZH A;  2Q2H A;  1IYJ B;  3FHW A;  5GAE C;  1JJC B;  3OTO L;  2ZM6 L;  3H3V H;  1QVF A;  4A3L H;  4DV6 Q;  2HQL A;  5J3B A;  4BA2 I;  4IFD G;  3S24 A;  4DAM A;  3TQY A;  3CPF A;  4XIG S;  4LF7 Q;  3W1B A;  3KJO A;  2KCM A;  1YIT A;  4GOP B;  2JA5 G;  5GAG C;  4DV4 Q;  4JI7 L;  2B3G A;  3S1N H;  3UE0 A;  4GKK L;  1IZ6 A;  2LXK A;  3BZC A;  4R4I A;  1XNR Q;  4GKJ L;  1BKB A;  3LGJ A;  4A93 G;  4DR5 L;  1KXL A;  4O0A A;  5IYC G;  4OWW B;  3U58 A;  2BA0 A;  1IXR A;  1HR0 Q;  4DK3 C;  4A3M H;  1N32 Q;  4K0K L;  4AQY Q;  3HKZ G;  5M5X H;  4DV3 L;  5C4X G;  5IP9 G;  1WJJ A;  4AIM A;  1PH3 A;  4OO1 G;  2MO1 A;  3CCJ A;  5LMN Q;  2IHF A;  5C0X G;  1XPO A;  3G6E A;  4LFC Q;  4OX9 L;  2UXB Q;  1Q7Y C;  3KOJ A;  2JA7 G;  2R7D A;  3KDF B;  1KHI A;  5IE8 A;  4PZ8 A;  4KI0 A;  4BY1 G;  1LM0 A;  1K83 H;  5ELO A;  5IP7 H;  1N8R C;  5IYD G;  1VQO A;  3HOU G;  1AE3 A;  4GOP C;  3FP9 A;  2MFI A;  1EQR A;  2JA6 G;  2Y0S E;  2VNU D;  2CQO A;  1OXT A;  2NVY H;  4HJA A;  4X66 Q;  1EYG A;  2R92 H;  4JC0 A;  4BBS H;  4DR4 L;  3NEN A;  3M3Y H;  2R93 H;  4MTN A;  4AYB G;  2YTV A;  4JI8 L;  4A3K G;  1P16 A;  2XGT A;  1YZ6 A;  3EIV A;  4LWC A;  2N8N A;  3RLF A;  3J80 i;  3PO2 H;  1HZB A;  1XPR A;  4P71 A;  4UY8 C;  4BY7 G;  2L15 A;  1S72 A;  1XTD A;  4A3I G;  1CKO A;  3Q8D A;  1PH5 A;  1W3S A;  1WOC A;  2KHI A;  3CD6 A;  1D8L A;  2PQA A;  1BBU A;  3EBE A;  1X6O A;  1UE1 A;  1UE5 A;  3E9I A;  3ER0 A;  4JOI C;  3CCU A;  1BBW A;  3I4O A;  4GNX A;  1SLJ A;  3AQQ A;  4LFA Q;  4DR6 L;  4A3J H;  1XMO L;  3I4N G;  1Y1V G;  4KHP Q;  1HNW L;  3K7U C;  5FJ8 G;  4JI7 Q;  1X3E A;  4XTC S;  4EX5 A;  3STB D;  2VQF L;  3I4M G;  1HZ9 A;  2VY3 A;  3TS2 A;  3J81 c;  2BH8 A;  3A5U A;  4DK6 C;  4B3T Q;  3HOV G;  5C44 G;  1VQ4 A;  5FLX c;  3T1Y L;  1FL0 A;  3UDF A;  4LF9 Q;  1YEZ A;  1G6P A;  1X9N A;  4QJF A;  4MZ9 A;  4OXP A;  2BA1 A;  4LF6 Q;  1PV4 A;  1V9P A;  3JAM i;  4L5Q A;  2JA8 G;  3KF6 A;  3GTL H;  2MO0 A;  4QY7 A;  4DUY L;  1NE3 A;  5HY6 A;  2YU9 H;  4RG1 A;  1Q81 C;  2AHO B;  4X65 Q;  5LMN W;  1QUQ B;  4WJ4 A;  5LMU L;  1E1O A;  3TEH B;  3T1H L;  1T9H A;  4LF5 Q;  4LF4 L;  4OWX B;  1P8L A;  4Y7N H;  4JYA Q;  3M85 A;  4X64 L;  4YWK A;  2R7Z H;  2CCZ A;  2UXD Q;  1PYB A;  4A3F H;  5JEA G;  4OON A;  3MEF A;  1WFQ A;  2RHS B;  3TRE A;  1Y1W H;  1YVC A;  3A74 A;  3RNU A;  3RZO H;  2HIX A;  4QIW E;  5ELN A;  1Q12 A;  1EIF A;  5K36 G;  3E9H A;  3NBH B;  1K3R A;  2OWO A;  2I5H A;  2NN6 G;  3AFQ A;  2K52 A;  4JBM A;  5FLM H;  4DAY B;  1SR3 A;  4B3S L;  1TXY A;  1XNQ Q;  2R6G A;  3H3V I;  4IFD J;  1YBY A;  4YHH L;  4IFD I;  3PUW A;  2DGY A;  2WAQ E;  3CMA A;  1N34 L;  3L7Z C;  2IX1 A;  1PH7 A;  1SRO A;  2MQH A;  1NBW A;  4JI1 Q;  1Q8K A;  4JI5 L;  3CCM A;  3OW2 A;  1XMQ L;  4JV5 L;  4BBR G;  2RHQ B;  2F4V Q;  2ZJQ A;  2AMC B;  1C7Y A;  4YY3 Q;  1ASZ A;  4KHZ A;  1YJ9 A;  4DV6 L;  1X56 A;  1NTG A;  5M3M H;  3KFU A;  4NXN Q;  3J80 c;  4JI3 Q;  2B29 A;  1K9M C;  2UU9 Q;  4DV4 L;  4A3D H;  3IRB A;  3F8T A;  2CWA A;  4DR3 Q;  1YHQ A;  4DV5 Q;  1EOV A;  4GN4 B;  1X3G A;  4JG2 A;  3RLO A;  4C3I H;  1VQJ A;  2IT1 A;  1HNX Q;  1PH2 A;  4LF8 Q;  3PCO B;  3GTJ H;  5DLQ E;  4APV A;  3U4V A;  1Z47 A;  1N32 L;  2PI2 E;  4AQY L;  3HKZ E;  5M5Y H;  1L1O B;  2V1C C;  2JA5 H;  5GAD C;  1PHJ A;  3E0E A;  1EQQ A;  4JI4 L;  2YYZ A;  2NZO A;  1B8A A;  2I5L X;  2KEN A;  4PZ7 A;  4YWM A;  5LMN L;  3ULL A;  2KBN A;  1R9T H;  4L5S A;  5HGQ A;  4UP7 A;  4A3C G;  5IYC H;  4JI2 L;  4LFC L;  2UXB L;  1TWA H;  1VQC A;  1H95 A;  2E2H H;  1Q46 A;  3CCV A;  1LUZ A;  1VQB A;  2GVA A;  4C2M H;  4GS3 A;  3ULJ A;  5IWA L;  3JAM c;  3CCS A;  2JQO A;  5AJ3 Q;  4L5R C;  1L0W A;  1UEB A;  3CF5 A;  4DR1 Q;  3RN2 A;  4A3L G;  4R1J A;  2A8V A;  1A0I A;  2GVB A;  2N49 A;  2NVQ H;  4X66 L;  2JA7 H;  1FJG Q;  1VQL A;  1VS0 A;  1A62 A;  2ZTE A;  1CSP A;  3CCR A;  4B3R Q;  2LSS A;  4DUZ L;  1BVS A;  1FVI A;  3I56 A;  4P73 A;  1IL2 A;  4A3G G;  2K75 A;  3OTO Q;  3HOU H;  2ZM6 Q;  1L1O C;  1KAW A;  1GD7 A;  3I7F A;  2JA6 H;  1ASY A;  1HZA A;  4A3M G;  1E1T A;  3GTK H;  2I5M X;  4A3E H;  1J5E Q;  2RF4 A;  1SE8 A;  3NEM A;  1CUK A;  2K14 A;  3SGI A;  3JC6 6;  1UE6 A;  3NEL A;  1VQP A;  2HT1 A;  2K5H A;  1DGS A;  4H02 A;  2C35 B;  1TWF H;  4A3K H; 
#chains in the Genus database with same CATH topology
 1JWU D;  1I6H H;  2K32 A;  4LFA L;  1PYS B;  3T53 B;  3T51 B;  5IY0 A;  1K83 B;  2UUC Q;  1RIP A;  2Z6K C;  1SFO H;  3LWU A;  4IPC A;  3R2I A;  4LF9 L;  4K8I A;  1KC8 C;  4OIJ A;  1T5X D;  1LTL A;  2R93 B;  1HRJ A;  1I94 L;  4LF6 L;  2SOB A;  2F0P A;  3TP6 A;  1WYD A;  1XWE A;  3QJY A;  1DD2 A;  1RL2 A;  3N6R A;  5I9O A;  2CKZ B;  2F3I A;  1SE2 A;  3KLW A;  3PO2 G;  3F1Z A;  1PH1 A;  4DR4 Q;  5G3L F;  4LF5 L;  1D7Q A;  2QDL A;  1QIL A;  1EQT A;  2Z0S A;  1GUS A;  1ICF B;  3CAM A;  4IUV A;  4A3B G;  4TSS A;  1VQ5 A;  1U4L A;  1GHJ A;  3I73 A;  1OXU A;  1BQQ T;  1QB5 D;  5IGB A;  4FP5 D;  3AEV A;  3S15 H;  1G2T A;  2MNA A;  3BVZ A;  2AKW B;  1V1Q A;  2MPM A;  4HID A;  4R9W A;  4JI6 Q;  1BBX C;  4K6L A;  5ELB A;  2UUA Q;  2K4K A;  2DUD A;  4X62 Q;  3J81 j;  5JPN C;  4NP5 A;  5COY A;  2R7Z B;  4DR3 L;  4IOC A;  2NWG A;  1BXT A;  1X55 A;  1J6Q A;  1HH2 P;  3PO3 G;  1MJC A;  1I6V C;  2B2Y C;  2MUY A;  4JBJ A;  5I9P A;  1KL9 A;  5LMU Q;  1MSH A;  1VQG A;  1DOM A;  4DR2 Q;  5C0X J;  4OEL B;  3ONA B;  2PZW A;  2PQA B;  3HOY G;  1V1O A;  2Z4I A;  1A63 A;  2E2I H;  1RD9 D;  3L0O A;  1L0X B;  1PMR A;  2PQE A;  4Y52 H;  4K5W A;  4TQU S;  1PH6 A;  5M3M B;  4QQB X;  3TS0 A;  2ID0 A;  1A2U A;  4B3M Q;  4A93 H;  1DON A;  1VQN A;  1FJG L;  4K14 A;  4C3I B;  1GUW A;  4B3R L;  2CH4 A;  3KJP A;  2N88 A;  3NK9 A;  2VUM G;  3T56 B;  1PA6 A;  3T4A C;  1CSQ A;  1VQE A;  2UUB Q;  1XYI A;  2H4O A;  3T16 A;  1HNZ Q;  1CA6 A;  4GN5 A;  3VR3 A;  2JJQ A;  5C4H A;  3M7G A;  3OWF A;  1MI2 A;  3K58 A;  4F8M A;  5IYD H;  2E2H B;  1CT1 D;  3UDI A;  3SK8 A;  3GP7 A;  2HIV A;  1O7I A;  1B1Z A;  1PYW D;  4JI4 Q;  3CCQ A;  3NWT A;  3BS1 A;  1EUJ A;  4JI2 Q;  3GTQ B;  1FGU A;  1Z6H A;  3SK5 A;  3HOU B;  3PUX A;  3Q0A A;  5IWA Q;  2F52 A;  4A3I H;  4DV3 Q;  1Z9F A;  2JA6 B;  3GTG H;  3DM1 A;  3ND8 A;  1LT5 D;  1MSG A;  3L3O C;  1IBM L;  4IQZ A;  4E6I A;  4RA8 A;  2MP1 A;  4ZK9 B;  4A3E G;  4A3K B;  4BBS G;  3H0G H;  1PTO B;  1I6H B;  2Z6B A;  5E1F A;  3S2D B;  4HIO A;  1YI2 A;  4EVO A;  2B2V A;  4GLA C;  1SFO B;  2J4X A;  3CQZ B;  3BU2 A;  3ERO A;  2EYM A;  3G6J B;  1A3V A;  3M4O H;  2EIF A;  1IW7 C;  1F2Y A;  2NN6 I;  3VR5 A;  2JE6 I;  4CDF C;  3VYT A;  5JPM C;  1MIU A;  2UXD L;  2PPB C;  4A4I A;  5C4J H;  1F2L A;  5IT9 E;  5BN3 A;  4A76 A;  3RR5 A;  5LL6 X;  1GUT A;  4ZCK A;  1B53 A;  1LYL A;  3SEB A;  5CV9 A;  5I2Y A;  3F2C A;  2PMZ E;  5M3F G;  4ZQ3 A;  3QWN A;  4HED A;  3WDN A;  1NR4 A;  5KGU A;  1EY8 A;  4YY3 L;  2Z6K A;  4WJW A;  3IFD A;  2OCE A;  4RGN A;  2KED A;  3HOW H;  2BDO A;  5J22 A;  2B63 H;  3S15 B;  4IZ8 A;  1F9R A;  4JBW A;  3D0F A;  4LK1 C;  3Q22 A;  1JE5 A;  1I3Q B;  2VQE L;  1JE4 A;  2Z1C A;  4DR7 L;  1PRT B;  4HAE A;  4O42 A;  1MKH A;  2IX0 A;  1EIY B;  1R4Q B;  3TME A;  2ZJR A;  1LT6 D;  1WCM G;  2K33 A;  2XWJ B;  3GTP H;  4P72 A;  3ULP A;  2PNR C;  3WOE A;  3E6Z X;  1GUO A;  4C1N I;  3T13 A;  2ZXP A;  2EYH A;  5C3E H;  4C3H H;  2EXZ A;  2RDH A;  4DV1 Q;  3W5O A;  4LFB Q;  3S1M H;  4DF7 A;  1N34 Q;  4ZAI A;  3PSI A;  3GO5 A;  2D5D A;  1T5E A;  4A3D G;  4JV5 Q;  1B9M A;  2YV5 A;  3J81 i;  3HOY B;  5E7N A;  4G57 A;  1PH9 A;  5GAE C;  1JJC B;  2ZM6 L;  4LF7 Q;  3CPF A;  4XIG S;  3W1B A;  5I6W A;  4GOP B;  3D4W A;  4GKK L;  1WVL A;  1HA5 A;  4O0A A;  4OWW B;  4ZUI A;  4K0K L;  1ET6 A;  1O78 A;  2B2Y A;  2IJ0 A;  1BR9 A;  2ZXO A;  2EJF C;  2JXM B;  1EIG A;  1H9R A;  1XPO A;  1D5M C;  5CBE E;  1BF4 A;  4CKC A;  3J81 L;  4LFC Q;  3NBH A;  1H9K A;  2WV6 D;  4KI0 A;  4BY1 G;  4CJ1 B;  1N8R C;  1SJH D;  4A3M B;  1VQO A;  4KY5 A;  3U9S A;  2ICI A;  1CZG A;  1OXT A;  4HJA A;  1C4Q A;  4DR4 L;  3VA7 A;  2DNE A;  3EIV A;  4LWC A;  5IT9 L;  2N8N A;  3CHB D;  3IAY A;  4UY8 C;  4BY7 G;  2JN4 A;  4U67 3;  3Q8D A;  5A35 A;  1W3S A;  3CD6 A;  3MAQ A;  1NR2 A;  3I70 A;  2Q8I B;  3CCU A;  3H0G B;  2Z8L A;  3I4O A;  3AQQ A;  4LFA Q;  1DOL A;  1XMO L;  3I4N G;  2N55 A;  4IUP A;  1G91 A;  5FJ8 G;  2PZT A;  3MXU A;  2A74 C;  4EX5 A;  3STB D;  2VY3 A;  3J81 c;  2BH8 A;  3MFY A;  4RHR A;  3NXW A;  3TP8 A;  4LF9 Q;  3M4O B;  1M8A A;  4MZ9 A;  4LF6 Q;  3HOZ B;  1PV4 A;  3GTL H;  4L5Q A;  1STG A;  5C4J B;  4H13 C;  4QY7 A;  3FDT A;  1SNM A;  1SNQ A;  4X65 Q;  3TN2 A;  1JCK B;  5LMN W;  5LMU L;  5EKK A;  4XT3 B;  1T9H A;  1LT3 D;  4ZRZ A;  4LF5 Q;  4LF4 L;  2IWH A;  5AFW A;  3E3X A;  5JEA G;  2RHS B;  4IUQ A;  1MBY A;  1YVC A;  5K5P A;  3RNU A;  4ZKB B;  2YU9 B;  5K36 G;  1K3R A;  3G7L A;  1XNQ Q;  2I07 B;  3BYT B;  1TVX A;  2R6G A;  3HOW B;  2B63 B;  4G7H C;  1PZK D;  1EZ8 A;  3L7Z C;  3HZX A;  2MQH A;  5FO8 B;  2AMC B;  1WTX A;  1QG7 A;  1C7Y A;  5C4Z A;  1FNU A;  5FOB B;  1YJ9 A;  1X56 A;  3K5N A;  4FF1 A;  1SDF A;  2X69 A;  4V0B A;  1U4M A;  1K9M C;  2F0S A;  2VB2 X;  3NWS A;  4DR3 Q;  4G7O C;  4GN4 B;  1X3G A;  2IT1 A;  2DY8 A;  2ZXR A;  3D8G A;  5C3E B;  4C3H B;  2V1C C;  3E0E A;  4JI4 L;  1LTI D;  2KEN A;  2MJ8 A;  1EFI D;  4JI2 L;  2UXB L;  1VQC A;  1YNJ C;  1AZP A;  1KNA A;  1LUZ A;  2GVA A;  5IWA L;  2LS0 1;  3MVV A;  1EQV A;  2BCO A;  1L0W A;  1UEB A;  2F0J A;  3KF8 A;  3RN2 A;  5M5Y B;  3L9A X;  4NMZ A;  1A0I A;  2GVB A;  2JA7 H;  1FJG Q;  1WTO A;  2B2T C;  1VS0 A;  1CSP A;  3U9O A;  4B3R Q;  2LSS A;  3DHQ A;  1TWA B;  4IN3 A;  4RCN A;  4S3S A;  1KAW A;  1ASY A;  1E1T A;  2I5M X;  5FO7 B;  3C3L A;  4JI7 Q;  2P5Z X;  3NEM A;  1CUK A;  2K14 A;  1VQP A;  2HT1 A;  2LFN A;  1DGS A;  2C35 B;  1TWF H;  4JK1 C;  4KHP L;  1IKL A;  1JJ2 A;  2CWP A;  1W2B A;  4ME5 A;  3FKI G;  3V05 A;  5IIF A;  3D31 A;  4PMB A;  3S16 H;  4PG3 A;  1UWV A;  1HPC A;  2WFW A;  1TS5 A;  1A15 A;  3NP8 A;  2EDG A;  5KYI A;  3HOV H;  1OXX K;  1IBM Q;  2IHE A;  2BE5 C;  3CCE A;  2Y0S G;  2K5N A;  1X3F A;  1KDC A;  1CI3 M;  4GLX A;  1JOR A;  3DMU A;  4C3J H;  4HIM A;  1SNC A;  2XVS A;  3MHB A;  4LNQ A;  2CW0 C;  2PW5 A;  4A3J G;  2F0V A;  1WTV A;  1VQ7 A;  1VQD A;  1CFM A;  4PV1 C;  2JSO A;  4BS9 A;  1SN8 A;  2VZA A;  1W6J A;  5CR3 A;  4HJ5 A;  5HUR A;  2RBM A;  3CP0 A;  3K81 C;  4QUF A;  2WB1 G;  5JJK A;  2K04 A;  3BYY B;  1JWS D;  1B44 D;  4LMQ D;  3GTL B;  3R93 A;  3HFZ B;  4KKS A;  5CV5 A;  2SEB D;  1D2B A;  3TRZ A;  4KY7 A;  5FO9 B;  4R8I A;  4FF2 A;  1PTO D;  1K8A C;  4DV1 L;  5EGT A;  3CME A;  4NXN L;  4LFB L;  4JI3 L;  5IYB G;  1YHB A;  2R61 A;  2UU9 L;  2B8F A;  5CV7 A;  3LX0 A;  1KLG D;  2GN5 A;  2OQK A;  4G7Z C;  4R4O A;  4HIK A;  2KUM A;  2EJG C;  2B2U C;  3TBI B;  3M4Q A;  4IUR A;  3QO2 A;  1Y1W G;  4DXG A;  4LF7 L;  2NB0 A;  3P75 A;  1Q86 C;  5D3D A;  5EKL A;  4ZLT F;  3NQT A;  4YWL A;  4BXX G;  5FLM G;  1ROD A;  4OO1 I;  4X64 Q;  5C0X I;  1LT4 D;  2KQ3 A;  4Q5V A;  2VQE Q;  1ILP A;  4DKA C;  2N78 A;  3GTO H;  4DR7 Q;  2O2L D;  1JOK A;  3CC7 A;  1FYC A;  1HJP A;  1DJR D;  3MXN B;  1VQF A;  1A2T A;  1NCV A;  2KEC A;  4M1U B;  4ME3 A;  2ZJP A;  4YHH Q;  4A3C H;  5JJI A;  2WAQ G;  5G3L D;  4C56 C;  4KD4 A;  1I4H A;  5FK9 C;  4HTH A;  3SK6 A;  5IGD A;  5IP9 H;  4OO1 H;  1U5K A;  2JA9 A;  1II3 A;  1E2W A;  5CGK A;  1ENC A;  5IGC A;  2KHS A;  4CKE A;  5ELC A;  2QDB A;  1XJV A;  1J5E L;  4JVZ A;  2Q2I A;  2QGQ A;  2ZTD A;  4AYB E;  4GNX C;  3GTQ H;  1PRT D;  2OTL A;  4DV0 L;  2KCT A;  1AW7 A;  2F0L A;  5F2D A;  5C4X B;  1YNX A;  1KD1 C;  2K5V A;  3OIP A;  5I2X A;  4GKK Q;  4HJ8 A;  2JA7 B;  3BDC A;  1PTO H;  4LUZ A;  4AH6 A;  5DEH A;  1TWG B;  3F2U A;  4OHJ A;  3S2D H;  1PH8 A;  3VDY A;  2X6G A;  4K0K Q;  1C48 A;  3RZD H;  4GKJ L;  1HHV A;  5IP7 G;  3K8A A;  3CQZ H;  4X6A H;  3SR1 A;  1D6E C;  4KY6 A;  1ZYR D;  1X32 A;  2E5L L;  4AYB B;  1TWF B;  2R92 G;  1HA6 A;  1G29 1;  1CKM A;  3G4S A;  4NB3 A;  2Q2U A;  3A7L A;  2OT2 A;  1SRU A;  2BH2 A;  4O2D A;  4IAL A;  1SNP A;  1QE6 A;  1VCI A;  4X65 L;  3S1Q H;  3S17 B;  4ALP A;  4QF4 A;  3S9W A;  1JWM D;  4ID6 A;  4UHV A;  3U4Z A;  4ZKC B;  3GQB A;  2B2T A;  3S16 B;  1Y1V B;  1SMY C;  2WB1 E;  3F2B A;  2E8G A;  4A3B H;  1NY4 A;  4DN4 M;  3I4M B;  2H5X A;  1GHK A;  4KHV A;  4GOP A;  1WD0 A;  3HOV B;  4J15 A;  1I50 B;  3QG1 A;  1F9S A;  2D2C C;  2NVX H;  4G4K A;  1XNQ L;  3CPW A;  3KF8 B;  4IUN A;  1XMO Q;  4C3J B;  3NTI A;  1I3Q H;  5EBD A;  2K1B A;  2K5D A;  2YTX A;  3RMH A;  4H0L C;  1A8V A;  1C0A A;  3K0Y A;  3I8Z A;  2F0K A;  3CW2 C;  1KIX A;  2JK8 A;  2AWO A;  1K3B C;  2VL6 A;  1FR3 A;  5KEE A;  2JP1 A;  4IUT A;  1ICW A;  4XQN A;  4HJ7 A;  3B6Y A;  3NTK A;  4A3F G;  3PO3 H;  2EQS A;  1TWC H;  1B70 B;  1K0R A;  1EWC A;  1B7Y B;  5LHY 1;  2EYJ A;  2A68 C;  1KQS A;  1IBK Q;  4LF4 Q;  1SND A;  2E2J B;  3J7A 5;  1HFG A;  4HJ9 A;  2ALY B;  4X3S A;  3HOY H;  1N33 Q;  2PCF B;  1Y14 B;  5CV6 A;  3ICE A;  1JB3 A;  2WP8 J;  4RAU C;  1GJX A;  3K80 C;  4XYQ A;  1G51 A;  3FPP A;  3CC4 A;  3N52 A;  4DK1 A;  2A6H C;  3S14 H;  1HUM A;  2AQ1 B;  3M9B A;  4L8J A;  1TWH H;  4IOA A;  4FYD A;  1GM5 A;  1G2S A;  1CKN A;  1QZG A;  2VUM H;  3PV0 A;  4TKO B;  1SYD A;  1WTH A;  2NZH A;  2Q2H A;  4A3L H;  2K5Q A;  4K2K A;  1QVF A;  3GTO B;  4DK0 A;  4BA2 I;  4IFD G;  2KOL A;  3S24 A;  3C46 A;  3TQY A;  1WTW A;  2KCM A;  3IKJ A;  1YIT A;  2JA5 G;  4JI7 L;  5GAG C;  3BDO A;  3K59 A;  3BZC A;  3NTH A;  1XNR Q;  2F1M A;  1BKB A;  2F3W A;  3I4L A;  4KTA A;  1U4P A;  4A93 G;  4RGO S;  5I6Y A;  1XTC D;  4A3M H;  1PDQ A;  3HKZ G;  2M9V A;  3TP5 A;  3FRP B;  1IYV A;  4AIM A;  3CRL C;  2Z4H A;  2UXB Q;  1Q7Y C;  3EVQ A;  4FVM A;  3KOJ A;  5CV4 A;  1KHI A;  2PYK A;  4PZ8 A;  1LM0 A;  2CVR A;  2WIN B;  5IYD G;  1HXY D;  1EYA A;  3NHH A;  3FP9 A;  1ESF A;  1K0S A;  2CQO A;  3J81 E;  4BBS H;  1EIH A;  1BCP F;  3NEN A;  2EZV A;  3M3Y H;  1HFN A;  4MTN A;  2XGT A;  3D6W A;  3RZD B;  4RHS A;  1FNW A;  3J80 i;  1J9O A;  1HZB A;  2WAC A;  2PO4 A;  1S72 A;  1XTD A;  4A3I G;  1CZW A;  1JOO A;  1BBU A;  1X6O A;  1UE1 A;  1UE5 A;  4RWS C;  3HOZ H;  4DR6 L;  1PLF A;  4GNX A;  1VMP A;  2L0C A;  4KHP Q;  3OPO A;  1R4P B;  3K7U C;  2HCI A;  3HP3 A;  2VQF L;  3PO2 B;  4KN7 C;  4DK6 C;  3S1Q B;  1NSN S;  5C44 G;  3M4Y A;  1BUV T;  3Q23 A;  3UDF A;  4MN3 A;  3D6C A;  4CGY B;  3DWP A;  1X9N A;  3KBG A;  4OXP A;  4FXG C;  2BA1 A;  2JA8 G;  3KF6 A;  3VR6 A;  4A3B B;  1S5E D;  1KDB A;  4DUY L;  5IOD A;  1NE3 A;  2NYZ D;  5HY6 A;  4RH6 A;  2YU9 H;  1Q81 C;  1AFP A;  1SYG A;  3FPU B;  4DXF A;  1V8Q A;  2NVX B;  1WTP A;  3TEH B;  2NUC A;  1HQM C;  4OWX B;  1P8L A;  4Y7N H;  3M85 A;  4X64 L;  2CCZ A;  1PYB A;  3VA5 A;  1A3U A;  3OHX C;  5ELN A;  1EIF A;  2L9H A;  1PFB A;  1SE3 A;  1D5Z C;  2NN6 G;  3I72 A;  4JBM A;  2PMZ B;  4DAY B;  4IFD J;  4EQO A;  4YHH L;  5FKA C;  4CDC C;  3CMA A;  1DOK A;  4NDX A;  3OMC A;  1Q8K A;  2DY7 A;  3DUZ A;  3CCM A;  4BBR G;  1AZQ A;  3PO3 B;  3AU7 A;  1TWC B;  1ZXT A;  2E75 C;  1ASZ A;  4KHZ A;  1LTB D;  3C2P A;  4DV6 L;  3KFU A;  4NXN Q;  5J39 A;  3J80 c;  4JI3 Q;  4WFN 3;  2B29 A;  2K7V A;  4HCS A;  2A69 C;  2UU9 Q;  1TS4 A;  4A3D H;  4N8F A;  3F8T A;  2CWA A;  1YHQ A;  3O13 A;  5BN5 A;  1EOV A;  3EFX D;  1VQJ A;  1LLR D;  3PCO B;  3OSO A;  2FHT A;  5DLQ E;  1Z47 A;  1S5B D;  4EQP A;  4AQY L;  3HKZ E;  1FNV A;  5M5Y H;  1YNN C;  3S14 B;  1EQQ A;  2F0D A;  4YWM A;  2I5L X;  4PZ7 A;  1TWH B;  5LMN L;  4V19 0;  1FGB D;  5HGQ A;  1ENF A;  3FEW X;  4UP7 A;  1TWA H;  2VUM B;  1H95 A;  3VR2 A;  2EE1 A;  3CCS A;  3FMC A;  2JQO A;  2CQA A;  4UAI A;  1JIC A;  4L63 B;  3CF5 A;  4R1J A;  3J7Y W;  2EYF A;  4M8A A;  1R9T B;  2N49 A;  5ELE A;  2F3V A;  4X66 L;  1VQL A;  2A6E C;  1FVI A;  1TU2 B;  2F0M A;  2K75 A;  3A8I E;  4A3G G;  3DXJ C;  2Z9H A;  3KBX A;  3TZU A;  4C2M B;  5JJZ A;  2OF1 A;  3D4D A;  3GTK H;  1J5E Q;  5EJW A;  1F2M A;  1SE8 A;  3NEL A;  3H3V C;  5E4X A;  1X3Q A;  4DV0 Q;  2XTI A;  2F0Q A;  1YIJ A;  1HCZ A;  1PFM A;  2A73 B;  1V43 A;  4BY7 H;  1D1I A;  5CYU A;  1BO0 A;  4LW1 A;  3OOC A;  4A3E B;  4BBS B;  3TDQ A;  1O7Z A;  1KAA A;  4UDU C;  3OYY A;  3I4N H;  3M3Y B;  4PZ6 A;  4OX9 Q;  4JBK A;  1X65 A;  5FJ8 H;  3DLL A;  3MXN A;  4POG A;  2MGS A;  4XYO A;  2ASB A;  4GKJ Q;  1HZC A;  3KUP A;  1CKN B;  2D9U A;  1NMG A;  4TRD A;  2TMP A;  4R4C A;  2E5L Q;  3PIP 3;  1OXV A;  1PVO A;  2A1A A;  1I4X A;  1AE2 A;  2EVB A;  2PZU A;  1HR0 W;  1QVC A;  4K5X A;  3U50 C;  1K73 C;  5IGG A;  1EOT A;  1OXS C;  1Q3L A;  1HTL D;  5M9O A;  2QCP X;  3X3M A;  1QOH A;  3VR4 A;  1IW7 D;  1D1K A;  4IPD A;  1U4R A;  1JMC A;  1IBK L;  5M3F B;  4JPB W;  5GQO A;  5ELD A;  5JEA H;  4R4Q A;  1EEF D;  3A8J E;  1GVP A;  1N33 L;  4EQN A;  1I4R A;  4KMU C;  1M90 C;  1N9W A;  5K36 H;  4IO9 A;  3DEO A;  4PNY A;  1EWH A;  4X3U A;  5D3I B;  1LV9 A;  3HOX G;  3IFT A;  2R7F A;  3MTS A;  1NUC A;  2G9H D;  3NSW A;  4Y7N B;  1ESR A;  1TS2 A;  1VQK A;  2RSN A;  4KN4 C;  2RSO A;  4HSV A;  4IPG A;  5EBC A;  1XPU A;  1WD1 A;  1G6Z A;  1YHA A;  4WJ3 M;  4H7B A;  1WCM B;  3OWE B;  2L5T A;  3QOJ A;  5BN4 A;  3T1H Q;  4F7X A;  3CU7 A;  1XNR L;  1LTA D;  2O4X A;  4XT1 B;  3A55 A;  1SYB A;  2XSC A;  3KK7 A;  4GNX B;  4LAA A;  1JQY D;  2FXQ A;  4CKB A;  5GAH C;  5DNF A;  2K05 A;  5KRU A;  5AJ3 L;  3WOF A;  2QEX A;  4EGV A;  2XIW A;  4A3D B;  1KRS A;  2NZ1 D;  3FVQ A;  4H44 C;  3H15 A;  5C4X H;  3DEP A;  2ICE C;  1VMC A;  1XXG A;  2C9O A;  4Q0F A;  3KF6 B;  3MFG A;  3G71 A;  2RCF A;  1JJG A;  3SE0 A;  4IPH A;  2XRQ D;  5EPL A;  1CQV A;  2RCN A;  5EAY A;  4NW2 A;  1TWG H;  1S5C D;  1D5X C;  2AUK A;  3W3A A;  1EL0 A;  1F9Q A;  3KLS X;  2FIN B;  4YCW A;  5GRO A;  2F0G A;  2HUG A;  2Q8R E;  4PQX A;  2A5H A;  3R2T A;  1SNO A;  2WII B;  1I5F A;  1LO5 D;  4BY1 B;  4FDB A;  4ZUJ A;  2OTJ A;  3K0X A;  1VQM A;  2NBF A;  1SAP A;  2PNH A;  1J8I A;  3R3O A;  3FKI H;  3S17 H;  2NVT H;  5JAV A;  1S5F D;  3GTK B;  4RCO A;  1H9M A;  1IBL L;  3WWV A;  4NKL A;  5EPK A;  1RTO A;  1Y1V H;  4X3T A;  4DV7 L;  2A6E D;  4DNT B;  3BVG A;  2F0I A;  1VQ9 A;  4DUZ Q;  3I4M H;  4MNO A;  2R93 G;  1JOQ A;  3Q6S A;  5JEA J;  5NUC A;  4BY7 B;  1I50 H;  1S40 A;  3A5Z B;  1H9J A;  2UXC L;  1VDZ A;  2JEA I;  2DJF C;  4DPG A;  3I4N B;  2CFM A;  5C3X A;  3AYH B;  4FF3 A;  1WI5 A;  1OTC A;  3K5M A;  2ZTC A;  3HEJ A;  2I0Q A;  2R3Z A;  1E24 A;  4DNI A;  2HD3 A;  3PF5 A;  4CDD C;  4POF A;  4QGU A;  3W1G A;  4DR6 Q;  3G48 A;  1BCP C;  3OMG A;  3CCL A;  3ERQ A;  2VQF Q;  5CMD A;  4B9W A;  1RJT A;  5BR8 L;  3HGB A;  5IYB H;  2GA4 B;  1K8G A;  2E2J H;  4DV2 Q;  3GTM H;  2VS1 A;  3RD4 A;  2K50 A;  1BNZ A;  1A6X A;  4QL5 A;  4DUY Q;  2F0H A;  2R7Z G;  3UDX A;  2RVL A;  3RUZ A;  3DWQ A;  4XQQ A;  1N36 Q;  2N3S A;  5KNC A;  1W6K A;  3PF4 A;  1GO3 E;  3VYR A;  2CH4 W;  2KHJ A;  3CKI B;  1Q90 A;  5KNB A;  2F0W A;  4BXX H;  3K6O A;  1TR5 A;  2HHH Q;  3CC2 A;  4NXM L;  3GD7 A;  4RMF A;  2FMM A;  2QW7 A;  2L4N A;  1E7Z A;  4YIJ A;  1VQH A;  1PXU A;  3DM3 A;  1AEX A;  4JI0 L;  4X3K A;  3BG3 A;  1I4P A;  1BDO A;  1UE7 A;  1LTG D;  3PIP A;  1ENA A;  2KCC A;  4P74 A;  5M3M G;  4A75 A;  3KYH C;  3K57 A;  3NBI A;  3V2T A;  1XX8 A;  4UPA A;  4RKB A;  2G5D A;  1RHP A;  2D62 A;  3FHW A;  4C3I G;  1IYJ B;  3H3V H;  1DYQ A;  4DV6 Q;  1CA5 A;  2EY2 A;  2HQL A;  5J3B A;  3IL8 A;  1EY0 A;  1EY4 A;  2C5C A;  4DU9 A;  1Y8O B;  2B3G A;  1SSO A;  1I4G A;  3UE0 A;  4R4I A;  2LXK A;  5HGT A;  4K6D A;  4OGQ C;  4DR5 L;  1TS3 A;  5IYC G;  5M5W B;  1IKM A;  1HR0 Q;  4DK3 C;  5COR A;  1EY6 A;  4GZY C;  3K5L A;  4AQY Q;  1F9P A;  1H9S A;  5IP9 G;  2OXP A;  4OO1 G;  1GUN A;  2E2D C;  1K28 A;  2MO1 A;  3CCJ A;  5C0X G;  5LMN Q;  3S1N B;  2KCN A;  4OX9 L;  1YNJ D;  2VXW A;  2O5J C;  2R7D A;  4ILW A;  4KJO A;  4DAY A;  4JW0 A;  5IP7 H;  2X6L A;  3HOU G;  1AE3 A;  4L6T B;  1EQR A;  4I7A A;  2Y0S E;  2JA6 G;  1PTO F;  4ODG A;  1EYG A;  1B3Q A;  2R92 H;  4X66 Q;  1DZ1 A;  4DAV A;  2YTV A;  4JI8 L;  4OEM B;  4A3K G;  1U9R A;  1P16 A;  3GV3 A;  1YZ6 A;  4I65 A;  3PO2 H;  3FKI B;  2NVT B;  4MIU A;  4P71 A;  2L15 A;  1CKO A;  1PH5 A;  1WOC A;  1QNK A;  4WOR A;  1UUP A;  2NVY B;  3E9I A;  3EBE A;  2VNU D;  3ER0 A;  2F0N A;  3P20 A;  4JOI C;  1SLJ A;  2FMC A;  4XTC S;  1EY9 A;  1QJO A;  2Y0S B;  3A5U A;  4B3T Q;  5ISR A;  3MEH A;  5FLX c;  2RQX A;  3PMF A;  5L37 A;  1TY2 A;  1V9P A;  3JAM i;  4A3J B;  1KAB A;  3KLR A;  3E5S A;  2BE5 D;  5E3F A;  4HCE A;  2J7Z A;  4K8J A;  2WB1 B;  4KKU A;  4WJ4 A;  3HG9 A;  3T1H L;  2NTT A;  4N9T A;  3EA6 A;  3SVM A;  4JYA Q;  4YWK A;  2CW0 D;  3J80 E;  2K5W A;  4A3F H;  4OON A;  4KD3 A;  1WFQ A;  1PRT F;  4HN7 A;  4XQJ A;  3J7A F;  3A74 A;  2HIX A;  1Q12 A;  2SNM A;  2ENB A;  2IW3 A;  4CDE C;  2I5H A;  3AFQ A;  1TXY A;  3V96 A;  5ELF A;  3JAM L;  3PUW A;  3GTM B;  1BCP D;  2WAQ E;  4IFD I;  4JI1 Q;  4JI5 L;  3BDL A;  1XMQ L;  1UNS A;  4FO2 A;  5E4W C;  4B08 A;  2F4V Q;  1Y1W B;  2ZJQ A;  3EJI A;  3RZO B;  1UAP A;  1Y69 U;  3TZD A;  2EYO A;  2G9D A;  3VYU A;  2SNS A;  2QIL A;  2I46 A;  3PIO 3;  1M4V A;  4DV4 L;  1GOZ A;  4HR7 B;  1PZJ D;  1NNX A;  2BDN A;  1EY7 A;  3KLS A;  4JG2 A;  1EZ6 A;  3RLO A;  1CQF A;  3GTJ H;  1LAB A;  4IFD H;  3QR8 A;  2B2W C;  1N32 L;  2IL8 A;  3P1H A;  1DM0 B;  1Q8I A;  2JA5 H;  5GAD C;  1LTT D;  3E0J A;  4CBV A;  2WAQ B;  1B8A A;  1STB A;  4FNF A;  4RGM A;  1R9T H;  3ULL A;  4N9P A;  4L5S A;  2K6A A;  1IYU A;  2HQE A;  1EYC A;  1KDA A;  2B2U A;  5TSS A;  3NPP A;  3P7J A;  4C2M H;  1V1P A;  4GS3 A;  3JAM c;  5AJ3 Q;  5CC4 A;  4DR1 Q;  4A3L G;  1F2Z A;  2F4I A;  2A8V A;  2XNA C;  3QB3 A;  1VF5 C;  1ONL A;  1A62 A;  2ZTE A;  1KTK A;  1O7Y A;  4DUZ L;  1BVS A;  3I56 A;  3SK4 A;  1IL2 A;  3OTO Q;  3HRZ C;  1L1O C;  1HZA A;  4A3M G;  1TQO A;  4A3E H;  2RF4 A;  3SGI A;  3JC6 6;  1UE6 A;  2OEO A;  2K5H A;  4H02 A;  2NVQ B;  5IGF A;  1E22 A;  1JB7 A;  2PW7 A;  2Q2T A;  3VYS A;  4DA2 A;  1DCZ A;  2RDG A;  1EWI A;  3S2H H;  3AFP A;  2RA4 A;  5KND A;  3STB C;  1L2F A;  2R92 B;  1RTN A;  3PUY A;  1HUN A;  4K5V A;  2IY5 B;  1B50 A;  4P2C B;  5CBA E;  3X3N A;  3D3R A;  5D14 A;  3H0G G;  2F0F A;  5C44 H;  2KEE A;  5A2Q E;  3NE5 B;  2EY5 A;  1IBL Q;  1EFW A;  4I7Z C;  3MXG A;  1MD2 D;  5M3F H;  2KA7 A;  5DAU A;  4DV7 Q;  3I3C A;  4DV2 L;  2ES2 A;  4YCV A;  1OO9 B;  2JA8 H;  5KYL A;  1PFS A;  1HTP A;  4BA1 I;  3J80 L;  3ZYY X;  3HOZ G;  3S1R H;  1VQ6 A;  1A3T A;  1N36 L;  1E2V A;  2EOT A;  2UXC Q;  4J6H A;  4KJN A;  4L5T A;  4R4T A;  1SE4 A;  3I91 A;  3UE1 A;  3Q24 A;  1SMY D;  4MHE A;  1H9S B;  3HKS A;  5T1G A;  2HHH L;  1K8O A;  1ZEQ X;  1HNW Q;  4J1M A;  1IHZ A;  2A19 A;  3DWA A;  2NN6 H;  4LUV A;  1VQ8 A;  1WCM H;  3BZK A;  1QNU A;  3T1Y Q;  1EU3 A;  3KDF A;  4TVA B;  3SXH A;  4JOI A;  2ATW A;  1QCB D;  4DFA A;  3HOW G;  2B63 G;  4BBR H;  3PUV A;  2YTY A;  2D0O A;  4OWT B;  4A3F B;  3H94 A;  4DV5 L;  4FXD A;  2XN9 C;  5CV8 A;  3SDZ A;  4LF8 L;  1Z7T A;  2DN8 A;  1HNX L;  1JR0 D;  1NMF A;  1B3A A;  5C6A A;  5BR8 Q;  1U0L A;  4EQ5 A;  2J0T D;  2OQ0 A;  3PGZ A;  1STA A;  4PMW A;  2BOS A;  3A8K E;  3EN2 A;  1CK1 A;  2ZT9 C;  3M4P A;  1HR0 L;  1Q1E A;  4DGZ A;  2A68 D;  1Y8N B;  1LAC A;  4LJZ C;  5C3E G;  2B8G A;  4C3H G;  1QZH A;  4B3S Q;  3A7A B;  3I55 A;  4Z9C B;  4NXM Q;  4ABN A;  4KKT A;  4CJ2 C;  2B39 A;  1AN8 A;  1KRT A;  2L1B A;  3GTJ B;  4JI0 Q;  3UDG A;  2E2I B;  2A6H D;  2JA5 B;  5C5M A;  4F88 A;  1K8M A;  4IJL A;  2VB3 X;  1Q1B A;  2QA4 A;  3F2D A;  1VQI A;  2E76 C;  1I4Q A;  1FD7 D;  4A93 B;  1STE A;  1AH9 A;  4BY1 H;  3MZ5 A;  4MTK A;  4A3G H;  4LUO A;  5EQ0 A;  3HKZ B;  2AWN A;  3RLN A;  2RDF A;  1QUQ A;  5H1S E;  3K7A H;  2UUC L;  1JC7 A;  4ZYS A;  2V4D A;  1EY5 A;  1F77 A;  1AP0 A;  3TP7 A;  3M7N A;  4DR5 Q;  1DXM A;  3K5O A;  1G8Z D;  3HS0 C;  5C5L A;  3SHL A;  2B2W A;  4R8N A;  1L0Y B;  2L55 A;  1E3P A;  4B3T L;  3NUC A;  2LY7 A;  5A2Q L;  2TSS A;  1B4O A;  3PIO A;  3ITP A;  1QVG A;  2F0O A;  1SBB B;  3BVM A;  2WKC A;  1S3O A;  4IJH A;  5JJL A;  3PUZ A;  1PH4 A;  3C1F A;  2FFK B;  3J7Z C;  2JEB I;  3GDE A;  1BCP B;  2QEJ C;  2RKS A;  4RFB A;  1YJW A;  4UP9 A;  3S2H B;  2DNC A;  1EU4 A;  1SXT A;  5JOB A;  4A3I B;  3GTG B;  1M1K C;  2VW9 A;  4RGT A;  5DM6 3;  4QCL A;  4O1N A;  5IOC A;  1YJN A;  4JYA L;  4JI8 Q;  3H6M A;  4HMI A;  1L1O A;  1O80 A;  4JI6 L;  4BWG B;  3D4R A;  2HCC A;  2LXJ A;  5C44 B;  2UUA L;  2AUJ D;  1C9O A;  1SYE A;  4J8Q A;  4QUC A;  5C3W A;  1V1P B;  4X62 L;  4KLK A;  1C8C A;  4GLV B;  1PTO C;  2LMC B;  1SMX A;  2JA8 B;  4NPS A;  2O5I C;  4K2L A;  5JVH 3;  4JI1 L;  3MXP A;  1I94 Q;  2KJX A;  3S1R B;  2F4V L;  4QB4 A;  1ML0 D;  3L2P A;  3HOX H;  1ET9 A;  1B2T A;  4KK7 A;  1STN A;  1X54 A;  4JCV E;  1JT8 A;  3MWY W;  4KV6 A;  5IT9 c;  2PI2 A;  4WRD A;  4DR2 L;  2NTS A;  5LL6 S;  3A0J A;  4P75 A;  4DAP A;  3BJU A;  1NJI C;  1X3P A;  2E74 C;  1SEB D;  2EY1 A;  4XXE A;  1Q82 C;  3OW7 A;  1BOS A;  1IL8 A;  2K01 A;  2M00 A;  2D0P A;  4B3M L;  1STY A;  3RN5 A;  4BBR B;  2FJ2 A;  3ZJY C;  3QIA A;  1CHP D;  1GKH A;  3CXC A;  4DR1 L;  5DM7 3;  3URY A;  2UUB L;  4OIK A;  1Y8P B;  1HNZ L;  2EXD A;  1S5D D;  3ERS X;  4RKL A;  3LNN A;  2F03 A;  3GTP B;  1RDP D;  4FXK C;  4GN3 B;  4YCU A;  4JI5 Q;  3I2Z A;  1VQA A;  2F0U A;  2JYO A;  1GUG A;  4UP8 A;  1XMQ Q;  1MJE A;  5M5W H;  4C1N K;  3OTO L;  1KNE A;  4XDX A;  1PRT C;  4DAM A;  4B9X A;  2A69 D;  3KJO A;  3S1N H;  4DV4 Q;  1IZ6 A;  3S1M B;  5I4D A;  5IGE A;  1ZKO A;  3LGJ A;  1KXL A;  3J7A V;  3U58 A;  2BA0 A;  1IXR A;  1N32 Q;  3W2D A;  1YNN D;  2F0T A;  4IUU A;  1EYD A;  4OL7 A;  5M5X H;  4DV3 L;  5C4X G;  1CTM A;  1WJJ A;  1PH3 A;  1LTS D;  2IHF A;  1O7L A;  3G6E A;  1ZYR C;  2DJG C;  1LTR D;  2JA7 G;  4A3G B;  3KDF B;  5IE8 A;  2QF7 A;  1WTR A;  1K83 H;  2EYP A;  2L12 A;  3K7A B;  5ELO A;  4CHT B;  4GOP C;  2MFI A;  4CJ0 B;  4N8X 1;  1CM9 A;  2NVY H;  1SYF A;  4JC0 A;  1ILQ A;  5FLX E;  2R93 H;  1E2Z A;  4AYB G;  1WTQ A;  1SJE D;  1S4Z A;  5EKI A;  3RLF A;  2IPK D;  1XPR A;  2M2L A;  3UI2 A;  2KHI A;  1D8L A;  2PQA A;  3R8B A;  1KLU D;  1BBW A;  1HQR D;  2AQ3 B;  4A3J H;  1HNW L;  1Y1V G;  3LWE A;  1X3E A;  3TS2 A;  1MGS A;  2CHB D;  1QWY A;  3I4M G;  1HZ9 A;  1RKN A;  3HOV G;  1VQ4 A;  3T1Y L;  1FL0 A;  2WKD A;  2XRS D;  3GV6 A;  4PMC A;  1YEZ A;  1STH A;  3NQI A;  1G6P A;  2XWB B;  4QJF A;  2AQ2 B;  3PQI A;  2QKI C;  4U68 A;  2MO0 A;  4C3J G;  3MC0 B;  5JVG 3;  3A56 A;  4DNR B;  4RG1 A;  2AHO B;  1B9N A;  1GXD C;  2IX3 A;  1CHQ D;  1PFN A;  1E0B A;  1QUQ B;  1E1O A;  1TY0 A;  5D65 A;  1RCV D;  2R7Z H;  2UXD Q;  3MA2 B;  3TRE A;  3MEF A;  3AMU A;  4QMG A;  1Y1W H;  2L11 A;  3RZO H;  4QIW E;  3HOX B;  1TII D;  3E9H A;  3NBH B;  2OWO A;  2K52 A;  2K03 A;  4F87 A;  1RF2 D;  5FLM H;  4B3S L;  1SR3 A;  2Q8T A;  3H3V I;  1YBY A;  2EYL A;  1TT2 A;  2DGY A;  2IX1 A;  1N34 L;  1PH7 A;  1SRO A;  1NBW A;  3OW2 A;  4JV5 L;  2HDM A;  2RHQ B;  4HMJ A;  3H09 A;  3C1E A;  2HDL A;  4YY3 Q;  3AB9 A;  1UEA B;  1NTG A;  1PZI D;  5M3M H;  3ND9 A;  3JAM E;  3IRB A;  4DV5 Q;  4ULL A;  4C3I H;  4QIW B;  4LF8 Q;  1HNX Q;  1PH2 A;  2K28 A;  4APV A;  3U4V A;  5EPJ A;  2PI2 E;  3TSS A;  1L1O B;  1PHJ A;  2YYZ A;  2NZO A;  3EQL C;  5T1I A;  2KBN A;  4A3C G;  5IYC H;  5J1Z A;  4LFC L;  2SDF A;  2E2H H;  3A54 A;  1Q46 A;  1VF7 A;  2H1E A;  3CCV A;  1VQB A;  3ULJ A;  1MHW C;  4L5R C;  4HSP A;  2B2V C;  1EEI D;  3H91 A;  5C0X H;  3CRK C;  1TKW B;  2NVQ H;  1SYC A;  2F0E A;  2KVM A;  5FLX L;  3CCR A;  3OIQ A;  2EY6 A;  3I90 A;  4P73 A;  3HOU H;  2ZM6 Q;  1NAP A;  1GD7 A;  4FF4 A;  3I7F A;  2JA6 H;  5M5X B;  2EPB A;  2EJM A;  2MHV A;  3QOL A;  3BZD B;  5KIX A;  2LKV A;  4A3K H; 
#chains in the Genus database with same CATH homology
 1E22 A;  1I6H H;  1JB7 A;  4DV0 Q;  1PYS B;  2Q2T A;  2XTI A;  4LFA L;  4KHP L;  1YIJ A;  5IY0 A;  2UUC Q;  1EWI A;  3S2H H;  1RIP A;  1V43 A;  3AFP A;  4BY7 H;  1JJ2 A;  2CWP A;  2Z6K C;  1W2B A;  3STB C;  1SFO H;  3FKI G;  1L2F A;  4LW1 A;  4IPC A;  3PUY A;  4LF9 L;  1KC8 C;  2IY5 B;  3D31 A;  3I4N H;  3OYY A;  3S16 H;  1LTL A;  4PZ6 A;  4OX9 Q;  4JBK A;  4PG3 A;  1X65 A;  1UWV A;  5FJ8 H;  1I94 L;  4LF6 L;  2WFW A;  3H0G G;  3DLL A;  4POG A;  2ASB A;  1WYD A;  4GKJ Q;  1HZC A;  1RL2 A;  5C44 H;  3HOV H;  1OXX K;  1CKN B;  1IBM Q;  1NMG A;  2CKZ B;  2IHE A;  2F3I A;  1IBL Q;  3KLW A;  3CCE A;  1EFW A;  2Y0S G;  3F1Z A;  3PO2 G;  4R4C A;  2K5N A;  1PH1 A;  5M3F H;  2E5L Q;  1OXV A;  1X3F A;  4DR4 Q;  4DV7 Q;  4JV5 Q;  1PVO A;  2A1A A;  4GLX A;  4DV2 L;  2ES2 A;  4YCV A;  2JA8 H;  4LF5 L;  1D7Q A;  1AE2 A;  4C3J H;  4HIM A;  1HR0 W;  1PFS A;  1QVC A;  2Z0S A;  4BA1 I;  3U50 C;  1K73 C;  3HOZ G;  4LNQ A;  3S1R H;  1VQ6 A;  1OXS C;  3CAM A;  1N36 L;  4A3B G;  4A3J G;  1VQ7 A;  1VQ5 A;  1VQD A;  2UXC Q;  4L5T A;  4R4T A;  1OXU A;  1SN8 A;  2VZA A;  4IPD A;  4HJ5 A;  3UE1 A;  3CP0 A;  3K81 C;  1JMC A;  1IBK L;  2WB1 G;  2HHH L;  3HKS A;  5GQO A;  3AEV A;  3S15 H;  5JJK A;  4R4Q A;  2MNA A;  2AKW B;  1N33 L;  1V1Q A;  1GVP A;  4HID A;  1HNW Q;  2A19 A;  3HFZ B;  4JI6 Q;  1M90 C;  1N9W A;  2UUA Q;  4IO9 A;  2K4K A;  4LUV A;  1VQ8 A;  2DUD A;  1WCM H;  3TRZ A;  3BZK A;  3HOX G;  4X62 Q;  3T1Y Q;  1K8A C;  4DV1 L;  2R7F A;  3CME A;  3KDF A;  4TVA B;  4NXN L;  4JI3 L;  5IYB G;  4JOI A;  3J81 j;  2ATW A;  4LFB L;  1YHB A;  2UU9 L;  3HOW G;  2B63 G;  4BBR H;  3PUV A;  2YTY A;  2D0O A;  4OWT B;  4IOC A;  4DR3 L;  1VQK A;  4DV5 L;  2GN5 A;  2OQK A;  4LF8 L;  4R4O A;  4HIK A;  1HNX L;  1NMF A;  1X55 A;  4IPG A;  1J6Q A;  1HH2 P;  3M4Q A;  1MJC A;  1U0L A;  5BR8 Q;  1Y1W G;  1XPU A;  1YHA A;  3PO3 G;  4WJ3 M;  4LF7 L;  4EQ5 A;  1Q86 C;  2OQ0 A;  3PGZ A;  4JBJ A;  1KL9 A;  4PMW A;  5LMU Q;  1VQG A;  4YWL A;  3T1H Q;  3EN2 A;  4DR2 Q;  4BXX G;  5C0X J;  1XNR L;  5FLM G;  4OO1 I;  4X64 Q;  5C0X I;  2VQE Q;  2PQA B;  3HOY G;  3M4P A;  1HR0 L;  1A63 A;  2E2I H;  3L0O A;  4DKA C;  4GNX B;  2N78 A;  2FXQ A;  3GTO H;  1Q1E A;  4DR7 Q;  5GAH C;  4Y52 H;  3CC7 A;  4TQU S;  1HJP A;  1PH6 A;  3MXN B;  5AJ3 L;  1VQF A;  5C3E G;  4QQB X;  2QEX A;  3TS0 A;  1QZH A;  4B3S Q;  2ID0 A;  4ME3 A;  3I55 A;  2ZJP A;  4YHH Q;  4B3M Q;  1KRS A;  4NXM Q;  4A93 H;  4A3C H;  5JJI A;  2WAQ G;  1VQN A;  1FJG L;  3H15 A;  4B3R L;  1KRT A;  3KJP A;  4JI0 Q;  3UDG A;  5C4X H;  5IP9 H;  2VUM G;  1PA6 A;  1U5K A;  1CSQ A;  2JA9 A;  1VQE A;  3KF6 B;  3G71 A;  2UUB Q;  1JJG A;  1HNZ Q;  4GN5 A;  4IPH A;  2RCN A;  4IJL A;  1Q1B A;  1XJV A;  2JJQ A;  2QA4 A;  5EAY A;  3F2D A;  1VQI A;  1J5E L;  2Q2I A;  2QGQ A;  4BY1 H;  1TWG H;  2ZTD A;  1AH9 A;  4AYB E;  4GNX C;  3GTQ H;  4A3G H;  5IYD H;  4LUO A;  2OTL A;  4DV0 L;  2AWN A;  2KCT A;  3RLN A;  3UDI A;  1QUQ A;  5H1S E;  3K7A H;  2UUC L;  1YNX A;  2HIV A;  1O7I A;  4YCW A;  5GRO A;  1KD1 C;  2K5V A;  4JI4 Q;  3CCQ A;  4GKK Q;  4HJ8 A;  1EUJ A;  3M7N A;  4LUZ A;  1I5F A;  4AH6 A;  4DR5 Q;  4JI2 Q;  3S2D H;  4FDB A;  2OTJ A;  3K0X A;  1VQM A;  1PH8 A;  3VDY A;  1FGU A;  4K0K Q;  3PUX A;  2PNH A;  3RZD H;  5IWA Q;  1E3P A;  2F52 A;  3FKI H;  1Z9F A;  4DV3 Q;  4A3I H;  5IP7 G;  3K8A A;  4B3T L;  2NVT H;  3GTG H;  3CQZ H;  3S17 H;  1IBM L;  4X6A H;  3PIO A;  1IBL L;  3WWV A;  1QVG A;  2E5L L;  1Y1V H;  1S3O A;  4IJH A;  4A3E G;  4DV7 L;  2R92 G;  4BBS G;  3H0G H;  5JJL A;  3PUZ A;  1G29 1;  1CKM A;  3G4S A;  1PH4 A;  4NB3 A;  3J7Z C;  2JEB I;  1VQ9 A;  4DUZ Q;  2Q2U A;  4MNO A;  3I4M H;  3GDE A;  2R93 G;  4HIO A;  5JEA J;  1SRU A;  1YJW A;  1YI2 A;  4O2D A;  4UP9 A;  2BH2 A;  1I50 H;  1S40 A;  1VCI A;  4GLA C;  4X65 L;  3A5Z B;  2VW9 A;  1M1K C;  3S1Q H;  2UXC L;  2JEA I;  3BU2 A;  4ALP A;  3M4O H;  3U4Z A;  4DPG A;  2EIF A;  2NN6 I;  1YJN A;  2CFM A;  2JE6 I;  2WB1 E;  3AYH B;  4JYA L;  4JI8 Q;  3F2B A;  2UXD L;  1MIU A;  1WI5 A;  1OTC A;  2E8G A;  4A4I A;  5C4J H;  1NY4 A;  2ZTC A;  4A3B H;  1L1O A;  2H5X A;  2I0Q A;  4GOP A;  4JI6 L;  2LXJ A;  1E24 A;  4DNI A;  4A76 A;  2UUA L;  3RR5 A;  4J15 A;  3PF5 A;  4POF A;  4QGU A;  1C9O A;  3W1G A;  2NVX H;  1LYL A;  4X62 L;  1XNQ L;  4KLK A;  3CPW A;  4GLV B;  4DR6 Q;  1SMX A;  3KF8 B;  3F2C A;  4NPS A;  3G48 A;  2PMZ E;  1XMO Q;  5M3F G;  4JI1 L;  3CCL A;  1I3Q H;  1I94 Q;  2YTX A;  2F4V L;  2VQF Q;  1A8V A;  1C0A A;  4YY3 L;  2Z6K A;  3L2P A;  3HOX H;  5BR8 L;  2OCE A;  5IYB H;  1X54 A;  4JCV E;  1K8G A;  1JT8 A;  2E2J H;  3CW2 C;  1KIX A;  2JK8 A;  2B63 H;  2AWO A;  3HOW H;  5IT9 c;  4DV2 Q;  3GTM H;  2PI2 A;  2VS1 A;  2VL6 A;  4JBW A;  4DR2 L;  2K50 A;  3D0F A;  4QL5 A;  4DUY Q;  1JE5 A;  4HJ7 A;  2R7Z G;  3UDX A;  2VQE L;  3B6Y A;  3PO3 H;  4A3F G;  3A0J A;  4P75 A;  1N36 Q;  2EQS A;  1TWC H;  2N3S A;  1B70 B;  3BJU A;  1K0R A;  1B7Y B;  1NJI C;  4DR7 L;  3PF4 A;  1GO3 E;  1MKH A;  2IX0 A;  1EIY B;  2KHJ A;  1Q82 C;  2ZJR A;  1WCM G;  4BXX H;  1KQS A;  1IBK Q;  4LF4 Q;  3GTP H;  2HHH Q;  3CC2 A;  4NXM L;  2D0P A;  4B3M L;  3GD7 A;  3J7A 5;  3HOZ H;  4HJ9 A;  2ALY B;  4RMF A;  3RN5 A;  3HOY H;  4P72 A;  1N33 Q;  1Y14 B;  1E7Z A;  3ULP A;  1VQH A;  3ZJY C;  3DM3 A;  3ICE A;  2WP8 J;  3K80 C;  4JI0 L;  1GKH A;  3CXC A;  5C3E H;  4C3H H;  1G51 A;  3CC4 A;  4DR1 L;  1UE7 A;  2UUB L;  3S14 H;  1HNZ L;  3PIP A;  4DV1 Q;  2EXD A;  3M9B A;  3ERS X;  4P74 A;  3W5O A;  5M3M G;  4A75 A;  3KYH C;  3S1M H;  1TWH H;  1N34 Q;  4LFB Q;  4IOA A;  3PSI A;  4UPA A;  4GN3 B;  4YCU A;  3GO5 A;  1GM5 A;  4JI5 Q;  4A3D G;  3I2Z A;  1VQA A;  4UP8 A;  1XMQ Q;  2YV5 A;  3J81 i;  1CKN A;  1QZG A;  5M5W H;  5E7N A;  1MJE A;  3PV0 A;  1PH9 A;  2VUM H;  2D62 A;  2NZH A;  2Q2H A;  1IYJ B;  3FHW A;  5GAE C;  1JJC B;  3OTO L;  2ZM6 L;  3H3V H;  1QVF A;  4A3L H;  4DV6 Q;  2HQL A;  5J3B A;  4BA2 I;  4IFD G;  3S24 A;  4DAM A;  3TQY A;  3CPF A;  4XIG S;  4LF7 Q;  3W1B A;  3KJO A;  2KCM A;  1YIT A;  4GOP B;  2JA5 G;  5GAG C;  4DV4 Q;  4JI7 L;  2B3G A;  3S1N H;  3UE0 A;  4GKK L;  1IZ6 A;  2LXK A;  3BZC A;  4R4I A;  1XNR Q;  4GKJ L;  1BKB A;  3LGJ A;  4A93 G;  4DR5 L;  1KXL A;  4O0A A;  5IYC G;  4OWW B;  3U58 A;  2BA0 A;  1IXR A;  1HR0 Q;  4DK3 C;  4A3M H;  1N32 Q;  4K0K L;  4AQY Q;  3HKZ G;  5M5X H;  4DV3 L;  5C4X G;  5IP9 G;  1WJJ A;  4AIM A;  1PH3 A;  4OO1 G;  2MO1 A;  3CCJ A;  5LMN Q;  2IHF A;  5C0X G;  1XPO A;  3G6E A;  4LFC Q;  4OX9 L;  2UXB Q;  1Q7Y C;  3KOJ A;  2JA7 G;  2R7D A;  3KDF B;  1KHI A;  5IE8 A;  4PZ8 A;  4KI0 A;  4BY1 G;  1LM0 A;  1K83 H;  5ELO A;  5IP7 H;  1N8R C;  5IYD G;  1VQO A;  3HOU G;  1AE3 A;  4GOP C;  3FP9 A;  2MFI A;  1EQR A;  2JA6 G;  2Y0S E;  2VNU D;  2CQO A;  1OXT A;  2NVY H;  4HJA A;  4X66 Q;  1EYG A;  2R92 H;  4JC0 A;  4BBS H;  4DR4 L;  3NEN A;  3M3Y H;  2R93 H;  4MTN A;  4AYB G;  2YTV A;  4JI8 L;  4A3K G;  1P16 A;  2XGT A;  1YZ6 A;  3EIV A;  4LWC A;  2N8N A;  3RLF A;  3J80 i;  3PO2 H;  1HZB A;  1XPR A;  4P71 A;  4UY8 C;  4BY7 G;  2L15 A;  1S72 A;  1XTD A;  4A3I G;  1CKO A;  3Q8D A;  1PH5 A;  1W3S A;  1WOC A;  2KHI A;  3CD6 A;  1D8L A;  2PQA A;  1BBU A;  3EBE A;  1X6O A;  1UE1 A;  1UE5 A;  3E9I A;  3ER0 A;  4JOI C;  3CCU A;  1BBW A;  3I4O A;  4GNX A;  1SLJ A;  3AQQ A;  4LFA Q;  4DR6 L;  4A3J H;  1XMO L;  3I4N G;  1Y1V G;  4KHP Q;  1HNW L;  3K7U C;  5FJ8 G;  4JI7 Q;  1X3E A;  4XTC S;  4EX5 A;  3STB D;  2VQF L;  3I4M G;  1HZ9 A;  2VY3 A;  3TS2 A;  3J81 c;  2BH8 A;  3A5U A;  4DK6 C;  4B3T Q;  3HOV G;  5C44 G;  1VQ4 A;  5FLX c;  3T1Y L;  1FL0 A;  3UDF A;  4LF9 Q;  1YEZ A;  1G6P A;  1X9N A;  4QJF A;  4MZ9 A;  4OXP A;  2BA1 A;  4LF6 Q;  1PV4 A;  1V9P A;  3JAM i;  4L5Q A;  2JA8 G;  3KF6 A;  3GTL H;  2MO0 A;  4QY7 A;  4DUY L;  1NE3 A;  5HY6 A;  2YU9 H;  4RG1 A;  1Q81 C;  2AHO B;  4X65 Q;  5LMN W;  1QUQ B;  4WJ4 A;  5LMU L;  1E1O A;  3TEH B;  3T1H L;  1T9H A;  4LF5 Q;  4LF4 L;  4OWX B;  1P8L A;  4Y7N H;  4JYA Q;  3M85 A;  4X64 L;  4YWK A;  2R7Z H;  2CCZ A;  2UXD Q;  1PYB A;  4A3F H;  5JEA G;  4OON A;  3MEF A;  1WFQ A;  2RHS B;  3TRE A;  1Y1W H;  1YVC A;  3A74 A;  3RNU A;  3RZO H;  2HIX A;  4QIW E;  5ELN A;  1Q12 A;  1EIF A;  5K36 G;  3E9H A;  3NBH B;  1K3R A;  2OWO A;  2I5H A;  2NN6 G;  3AFQ A;  2K52 A;  4JBM A;  5FLM H;  4DAY B;  1SR3 A;  4B3S L;  1TXY A;  1XNQ Q;  2R6G A;  3H3V I;  4IFD J;  1YBY A;  4YHH L;  4IFD I;  3PUW A;  2DGY A;  2WAQ E;  3CMA A;  1N34 L;  3L7Z C;  2IX1 A;  1PH7 A;  1SRO A;  2MQH A;  1NBW A;  4JI1 Q;  1Q8K A;  4JI5 L;  3CCM A;  3OW2 A;  1XMQ L;  4JV5 L;  4BBR G;  2RHQ B;  2F4V Q;  2ZJQ A;  2AMC B;  1C7Y A;  4YY3 Q;  1ASZ A;  4KHZ A;  1YJ9 A;  4DV6 L;  1X56 A;  1NTG A;  5M3M H;  3KFU A;  4NXN Q;  3J80 c;  4JI3 Q;  2B29 A;  1K9M C;  2UU9 Q;  4DV4 L;  4A3D H;  3IRB A;  3F8T A;  2CWA A;  4DR3 Q;  1YHQ A;  4DV5 Q;  1EOV A;  4GN4 B;  1X3G A;  4JG2 A;  3RLO A;  4C3I H;  1VQJ A;  2IT1 A;  1HNX Q;  1PH2 A;  4LF8 Q;  3PCO B;  3GTJ H;  5DLQ E;  4APV A;  3U4V A;  1Z47 A;  1N32 L;  2PI2 E;  4AQY L;  3HKZ E;  5M5Y H;  1L1O B;  2V1C C;  2JA5 H;  5GAD C;  1PHJ A;  3E0E A;  1EQQ A;  4JI4 L;  2YYZ A;  2NZO A;  1B8A A;  2I5L X;  2KEN A;  4PZ7 A;  4YWM A;  5LMN L;  3ULL A;  2KBN A;  1R9T H;  4L5S A;  5HGQ A;  4UP7 A;  4A3C G;  5IYC H;  4JI2 L;  4LFC L;  2UXB L;  1TWA H;  1VQC A;  1H95 A;  2E2H H;  1Q46 A;  3CCV A;  1LUZ A;  1VQB A;  2GVA A;  4C2M H;  4GS3 A;  3ULJ A;  5IWA L;  3JAM c;  3CCS A;  2JQO A;  5AJ3 Q;  4L5R C;  1L0W A;  1UEB A;  3CF5 A;  4DR1 Q;  3RN2 A;  4A3L G;  4R1J A;  2A8V A;  1A0I A;  2GVB A;  2N49 A;  2NVQ H;  4X66 L;  2JA7 H;  1FJG Q;  1VQL A;  1VS0 A;  1A62 A;  2ZTE A;  1CSP A;  3CCR A;  4B3R Q;  2LSS A;  4DUZ L;  1BVS A;  1FVI A;  3I56 A;  4P73 A;  1IL2 A;  4A3G G;  2K75 A;  3OTO Q;  3HOU H;  2ZM6 Q;  1L1O C;  1KAW A;  1GD7 A;  3I7F A;  2JA6 H;  1ASY A;  1HZA A;  4A3M G;  1E1T A;  3GTK H;  2I5M X;  4A3E H;  1J5E Q;  2RF4 A;  1SE8 A;  3NEM A;  1CUK A;  2K14 A;  3SGI A;  3JC6 6;  1UE6 A;  3NEL A;  1VQP A;  2HT1 A;  2K5H A;  1DGS A;  4H02 A;  2C35 B;  1TWF H;  4A3K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...