2UXCL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcL00
2VY3A 3S1MH 4A3MG 2C35B 4OONA 4DK3C 2MO0A 2JA5G 1X65A 2JEBI 4JI2Q 4BA1I 4BBRG 4B3SL 4GN4B 4JI2L 2PNHA 1CKOA 2Q2IA 4JOIC 1HZBA 3J80c 4HJAA 1HZCA 1BVSA 1I3QH 2ZTCA 4X64Q 1S72A 4POGA 4LFCQ 1WI5A 1PYBA 1TWCH 4JI8Q 4YHHQ 2FXQA 1UE1A 2N3SA 4YHHL 5AJ3Q 4HIMA 1JJ2A 2A8VA 4BY7G 3E9IA 1YITA 2I0QA 2BA0A 4JI7Q 3S16H 3CC4A 1P8LA 1VQHA 2K75A 1XPUA 2EIFA 2CWPA 3NEMA 3G71A 4ALPA 1XNQL 1TWAH 4DR7Q 1OTCA 1WCMH 1X55A 4P72A 1QVFA 5ELNA 4A3JH 1Q82C 1VQCA 3CPFA 2N78A 4J15A 1L2FA 4YCWA 3PO3G 1N8RC 3KJOA 1J5EL 2UUBL 3WWVA 3OYYA 1YZ6A 3RLFA 1V9PA 3F2DA 1PH1A 4DAYB 4EQ5A 1UE7A 2EQSA 1SRUA 4DV7Q 3RN2A 4YY3Q 2BH8A 1N33L 2F4VL 2I5LX 1GD7A 2UUAQ 3H0GG 1RIPA 4WJ4A 4AQYQ 1JMCA 4JBKA 3AEVA 2KENA 2MQHA 2ZM6L 2CKZB 2JA9A 3CP0A 4GKKL 3RZOH 1HNXL 4A3EH 3S2HH 2UUCQ 1YJ9A 2HT1A 3GTQH 4QQBX 4MTNA 1X3EA 1SN8A 4R4IA 5GQOA 4PMWA 4A75A 3PO2G 3KDFA 4LF7Q 1B8AA 2DGYA 3W5OA 5JEAG 1EQQA 1VQKA 1JJGA 2R7DA 3PUWA 4BY1G 4DPGA 5FJ8G 1XNRL 1O7IA 2A1AA 1IBLQ 1OXTA 1CKMA 2KCTA 1HNZQ 4BBSH 4YCUA 3DLLA 5IWAQ 1R9TH 4A93H 4DV3L 3CCMA 2YU9H 4DR6L 4PZ7A 2K52A 2GVAA 1EIFA 3HOYG 1FGUA 1KRSA 2MFIA 3ZJYC 2Q2HA 3RNUA 4BBRH 2VNUD 4GN5A 4A3BG 4O0AA 4YWKA 1YIJA 3U50C 3UDXA 1N34Q 3PV0A 5FLMH 1YHQA 2JEAI 3AFQA 4HJ8A 1C9OA 1K83H 3S24A 4L5TA 2Q2UA 3PUYA 1VQGA 2RF4A 3STBD 3CMAA 1NJIC 5C0XG 4IJHA 1KQSA 5IP9G 2NZOA 1Q1EA 3CPWA 2VQEQ 1A62A 2WB1E 2NVTH 4IJLA 3GDEA 3M4OH 3HOZH 4AYBG 3EIVA 4DV2L 5LMNW 3W1BA 1YJWA 1T9HA 4DR1L 1VQ8A 1X54A 2KBNA 4QL5A 3A5ZB 5GAGC 3U58A 4OX9L 3GD7A 2NVQH 2OQ0A 3ULJA 3UDGA 2YTVA 1PH4A 5GAEC 2ATWA 4LFAQ 1KXLA 2IY5B 1D8LA 1N34L 1VQJA 4DR2L 2JA8H 2UU9Q 3KOJA 4C2MH 4HIDA 1L1OC 4QY7A 5C0XJ 5IYDH 2KHJA 3F2CA 3TEHB 1HR0Q 2UXCQ 1GKHA 4B3MQ 4P71A 1CSQA 1TWFH 2CWAA 4YCVA 3CCQA 3CCRA 1MJCA 4GKKQ 4NXNL 3S15H 1QZGA 3AQQA 4AYBE 3ULPA 2ZTDA 1ASYA 3CC2A 2UXBL 2K5NA 3W1GA 3G6EA 4DV0Q 1ASZA 4LF7L 3KJPA 1G291 4DV6Q 1PH8A 2E2IH 5LMNQ 3PO3H 4LF6Q 1PH9A 3F2BA 2IX0A 1UWVA 2NVYH 4A3GH 1QVGA 1LYLA 2OCEA 1WCMG 1W2BA 2RHQB 3NELA 4JBJA 4QJFA 5C4JH 3H15A 2PMZE 4YY3L 1WFQA 5K36G 1PH2A 1KHIA 2RCNA 5ELOA 1PH5A 2NN6I 4X6AH 2VUMG 4IFDJ 2YTXA 1CUKA 3S14H 3F1ZA 4LWCA 4GOPB 1KD1C 3GTLH 2AWNA 4HIOA 4IPDA 3RN5A 4L5RC 1KL9A 1HNXQ 3J81j 4NXNQ 4DV5L 1CKNB 2YTYA 1VQ7A 3GTGH 4YWLA 1VQIA 3KLWA 4DV0L 3MEFA 5IYBG 4X62L 2OWOA 2MNAA 4X62Q 3RLOA 2HIVA 4GOPA 1XTDA 4DV2Q 4NB3A 1KIXA 1BBWA 2AKWB 4KHZA 2VQEL 1AE3A 2B63G 2Z0SA 1HZ9A 2B29A 4ME3A 3CCSA 4R4CA 5IP7G 1IBMQ 2IT1A 4DAMA 2PQAB 3T1HQ 4GS3A 3FKIH 1UE6A 1Y14B 3OTOQ 2LSSA 3IRBA 4UP8A 3TQYA 1VQ9A 4IFDG 1JT8A 3GO5A 2JE6I 4HIKA 5IE8A 4HJ9A 3A5UA 1JJCB 3HOWG 1VS0A 2YV5A 2B3GA 2K4KA 2YYZA 2AMCB 1HZAA 4JI1L 3PIPA 4DR3L 4BY1H 1Y1WH 3ER0A 3UDIA 5M5YH 4B3RL 2ZM6Q 2Y0SE 1K8AC 5E7NA 1E3PA 2ZJQA 4C3HH 3I7FA 4JI3L 4AQYL 2JJQA 4KLKA 1EUJA 1E22A 5HY6A 4JI7L 4KHPQ 2IX1A 5JJIA 4A3IH 1A8VA 3K8AA 4DV5Q 1HR0W 1U0LA 4A76A 1V43A 2E5LL 1IYJB 1VQEA 4O2DA 5IYBH 3J7ZC 2ZJRA 4A3FG 4A3FH 1VQ5A 2I5HA 2JA6H 1I94Q 4DV6L 2R93G 1FL0A 3E0EA 1Q12A 2F3IA 2N8NA 1I50H 4LFBL 3D0FA 2DUDA 4WJ3M 1QUQB 1GO3E 1X3FA 1UEBA 2BA1A 3ICEA 3CCEA 3I4MH 4JG2A 2VZAA 2NZHA 5IWAL 1YEZA 2K5VA 3JAMi 4DR2Q 3TREA 1NE3A 3HOWH 1MKHA 3CXCA 1SLJA 4LF9L 5H1SE 2AHOB 3CC7A 4LUOA 1XPRA 3CF5A 4DV1L 4JI4L 1VQDA 3I55A 1PA6A 4LF8Q 1Q46A 4R4QA 1Q81C 1EQRA 1VQBA 2KHIA 1U5KA 2R7ZH 4A3CG 1J6QA 3K81C 1W3SA 1YHAA 1SR3A 1XMQQ 3TS2A 4BXXH 4JV5L 4OO1I 2HHHL 4GOPC 4LUZA 1HNWL 3PGZA 3L2PA 2UXDL 3CAMA 2ASBA 1DGSA 4DUZQ 1IZ6A 4LF4Q 1FJGQ 1XNQQ 3I4MG 5J3BA 5C4XH 3RZDH 4RG1A 3JAMc 2NVXH 1Q1BA 4PZ8A 3NENA 4UPAA 5HGQA 1V1QA 2AWOA 1P16A 1Q7YC 5LMNL 1IBKL 1XNRQ 3PUXA 5C44H 1HH2P 3I56A 3HOVH 4JI0Q 5FJ8H 4DUYQ 2Q2TA 2XGTA 5C4XG 1XMOL 3M7NA 2D62A 3M3YH 3OTOL 2JA8G 1K0RA 5GROA 1KC8C 1BBUA 4PG3A 4DR5Q 2IHEA 1HJPA 1LM0A 3J81c 3GTMH 2Z6KC 3DM3A 3PUVA 2WAQG 2F52A 5M5XH 4GLXA 3OW2A 3M4PA 4JBWA 3SGIA 5JJKA 4B3ML 3HKSA 4DV4L 1N33Q 4A3DH 3L7ZC 4R1JA 2ALYB 4GNXC 1M90C 3K0XA 1JE5A 1Y1WG 1YHBA 5IYCH 5AJ3L 4DR4L 3KYHC 1LTLA 4QIWE 1NY4A 4AH6A 1EOVA 2IHFA 4C3IH 1VQLA 3T1YL 3T1YQ 2WB1G 3JC66 3J80i 3K7AH 1PVOA 1BKBA 4JYAL 1UE5A 2HQLA 5IT9c 2GN5A 5BR8Q 4IFDI 1Q86C 1OXXK 3I4NH 3D31A 4A3LH 2R92G 1N32L 3PF4A 1TXYA 5M3MH 1PYSB 4B3TL 2R93H 4B3TQ 1Z47A 4OXPA 3BZCA 2H5XA 4KI0A 4DV3Q 2UU9L 4B3SQ 4A3KH 5IY0A 3CCUA 4NPSA 1XMOQ 2MO1A 3PIOA 3PF5A 3GTJH 3G4SA 2L15A 1HR0L 2UXCL 1E1TA 4DR5L 3KFUA 2QGQA 3UE1A 2PI2E 4BY7H 3CCJA 3HOUH 1VQOA 4LF8L 3HFZB 4GKJL 1TWHH 5JJLA 4JI8L 5JEAJ 4KHPL 2ID0A 4MNOA 2PI2A 2VUMH 3I2ZA 1EIYB 2VQFQ 4LF5Q 1HNWQ 3LGJA 1VQ4A 3HOZG 1XJVA 3TS0A 2OTLA 3J7A5 4LF4L 1FJGL 2VL6A 3A0JA 1A63A 5IP9H 4A3EG 4DR7L 3CCLA 4LFBQ 4A3CH 5BR8L 5M3FG 3NBHB 4BXXG 3HOXG 4HJ5A 2K50A 4JYAQ 1GM5A 3S17H 1QZHA 2E8GA 2JQOA 5GADC 1CKNA 3EN2A 1C7YA 1N36L 3S2DH 1L1OB 4OX9Q 4Y52H 1PV4A 4YWMA 3T1HL 1PH7A 5M3FH 1N36Q 4GLVB 1MIUA 1A0IA 1Y1VH 3KF6B 2QEXA 2Z6KA 1K8GA 5DLQE 4DNIA 3M85A 2K5HA 3FHWA 4APVA 5C3EG 1N9WA 4UY8C 2OQKA 1H95A 3GTOH 1VCIA 2VW9A 4GNXA 4AIMA 4JI5Q 2Y0SG 1IXRA 3U4VA 2F4VQ 1VQMA 3K7UC 1G51A 1XMQL 2E2JH 2JA7H 2WP8J 4NXML 4JV5Q 4K0KL 2LXKA 1VQPA 3PO2H 1WYDA 2WFWA 2JA6G 1NMFA 4IOCA 2K14A 1WOCA 4IPCA 3UE0A 4GNXB 3J81i 2UUCL 1EWIA 1KRTA 3M4QA 2E5LQ 3EBEA 4A3IG 4JCVE 4IPGA 1FVIA 1D7QA 2R92H 1WJJA 1QVCA 4OWXB 3I4NG 5M3MG 4OWWB 1SMXA 3BU2A 1JB7A 4A3LG 1SE8A 4IPHA 4P74A 5C3EH 2NN6G 3S1NH 2N49A 4UP9A 1VQ6A 1I6HH 2ZTEA 1S3OA 1Y1VG 1IL2A 4DR6Q 1VQFA 3BZKA 2A19A 4JI6Q 1X6OA 2R7FA 2UUAL 3B6YA 3CD6A 1M1KC 1B70B 2ZJPA 4JBMA 1KAWA 2I5MX 3UDFA 1X3GA 3G48A 3KF6A 1PH6A 3U4ZA 1E7ZA 2WAQE 4QGUA 4A3DG 4K0KQ 4B3RQ 5FLXc 4JI5L 5FLMG 4XTCS 4X66L 2VQFL 4L5SA 3GTKH 5LMUQ 3RLNA 2HHHQ 3I4OA 2UXDQ 4JC0A 1EYGA 3KF8B 4LF5L 2D0OA 3MXNB 4MZ9A 3CW2C 4BBSG 3ERSX 1X9NA 4A93G 1C0AA 1E1OA 4X65L 1YJNA 3HOVG 3Q8DA 4LW1A 5C44G 1J5EQ 1OXVA 2UUBQ 4LNQA 4HJ7A 1Z9FA 3PCOB 1AE2A 2CQOA 4GLAC 3ULLA 4GN3B 4EX5A 1K73C 1XPOA 1L1OA 4JI0L 1K3RA 2D0PA 2V1CC 4A3KG 4JI6L 4C3JH 2XTIA 2JA5H 1PH3A 4A3MH 1SROA 4R4TA 2R7ZG 5GAHC 4JOIA 4JI1Q 1NTGA 4DR3Q 4L5QA 4A3GG 2GVBA 3RR5A 4GKJQ 4LFCL 2VS1A 4UP7A 2OTJA 1TWGH 1G6PA 2UXBQ 4A3BH 4NXMQ 1X56A 4DK6C 3BJUA 1K9MC 4DR4Q 1E24A 5IYCG 4POFA 2PQAA 3CCVA 1VQNA 1OXUA 1B7YB 2KCMA 4DUZL 4DR1Q 1IBML 3KDFB 4TVAB 1PHJA 4IO9A 1LUZA 1EFWA 3GTPH 5EAYA 3M9BA 3E9HA 2BH2A 3TRZA 1I5FA 4P75A 5IP7H 1N32Q 3HOUG 4A3JG 1Q8KA 5M5WH 2CFMA 2RHSB 4DUYL 5IYDG 4PZ6A 2LXJA 4LFAL 4IOAA 4XIGS 4DV7L 4TQUS 3CQZH 4FDBA 4LF9Q 1PFSA 1CSPA 3STBC 4P73A 1SFOH 4DV1Q 4JI4Q 3HOYH 4Y7NH 1L0WA 4X64L 4RMFA 2HIXA 3PSIA 3FP9A 2JA7G 3AYHB 3H0GH 4DV4Q 2E2HH 1AH9A 4R4OA 4JI3Q 4LUVA 1YNXA 3PUZA 5LMUL 4DKAC 3S1RH 1S40A 3K80C 1NBWA 4X66Q 3H3VI 4OO1G 1OXSC 1YBYA 3L0OA 4OWTB 1VQAA 1YVCA 4H02A 1QUQA 5C0XI 1YI2A 1I94L 2JK8A 3H3VH 4LF6L 3VDYA 2CCZA 3FKIG 2EXDA 1HNZL 2R6GA 4X65Q 3HKZG 2QA4A 1MJEA 1RL2A 3CMEA 1IBLL 3S1QH 1GVPA 3F8TA 2ES2A 3AFPA 2B63H 4BA2I 4A4IA 1IBKQ 3A74A 3HOXH 3HKZE 1NMGA
chains in the Genus database with same CATH superfamily
4DK3C 5EKLA 2JEBI 4BA1I 2LY7A 4GN4B 1CHQD 1CKOA 3J80c 3K5NA 1BVSA 2B2VC 1I3QH 2ZTCA 4POGA 1YNJD 1PYBA 4JI8Q 2FXQA 1UE1A 2AQ3B 5IGEA 2DJGC 3CC4A 2K75A 2EIFA 1ET9A 2EY2A 1PFNA 2N88A 1OTCA 1JWUD 1JCKB 1TS2A 1X55A 2NWGA 3OW7A 4A3JH 1VQCA 3D4WA 4YCWA 2UUBL 2VB2X 1V9PA 1PH1A 4EQ5A 1UE7A 3RUZA 5IGFA 2I5LX 4WJ4A 3H0GG 2KENA 2KHSA 3OIPA 1RF2D 4GKKL 3RZOH 1HNXL 5EPKA 4O1NA 3OHXC 3EA6A 3PO2G 1PFMA 3KDFA 4LF7Q 2DGYA 4IN3A 1TVXA 3PUWA 4HMJA 2B2YA 4NP5A 5FJ8G 3K5MA 1O7IA 4DFAA 1O80A 3QJYA 2WV6D 4YCUA 5IWAQ 3DLLA 4DV3L 1EIFA 2Q8IB 3FMCA 1FGUA 2VUMB 1D1KA 2Q2HA 4BBRH 4NMZA 1TWCB 1WVLA 5IT9E 4A3BG 1TWHB 2QKIC 3I4NB 3I3CA 3KLSA 4XQQA 1YHQA 5CBAE 1K83H 3S24A 3IKJA 4ID6A 3PUYA 3JAML 2F0NA 4OIKA 1KQSA 5IP9G 2NZOA 2QW7A 2XVSA 4F87A 2NVTH 1IW7C 4IJLA 3LWUA 3HOZH 4AYBG 3EIVA 4KKUA 5FLXE 1M8AA 3MFGA 1X54A 3N52A 2KBNA 3ONAB 3U58A 3QOLA 4K6LA 3UDGA 2RQXA 2A69D 5GAEC 2ZXRA 1KXLA 3M3YB 4FF3A 4KKSA 2HQEA 1TWFB 2K5DA 2NVTB 4A3EB 2KHJA 1HR0Q 1GKHA 2HDMA 1QNUA 1TS5A 4P71A 1F9RA 3TBIB 3HOZB 3CCQA 2BOSA 1FNWA 1S5DD 1A3VA 4NXNL 4DU9A 1QZGA 3ULPA 5D3DA 3CC2A 5NUCA 3G6EA 3KJPA 4CGYB 2R7ZB 4DNRB 1SSOA 1I6HB 3KBXA 1B53A 3F2BA 1D6EC 4CKCA 2NVYH 1LYLA 4K2LA 4JBJA 4KN7C 5K36G 1PH2A 1VF5C 1KHIA 2RCNA 5ELOA 1O7LA 2VUMG 1ONLA 1CUKA 1KABA 1GUGA 3VYUA 4B9WA 5HGTA 4ZAIA 3RN5A 2PO4A 4NXNQ 3CQZB 5L37A 2JN4A 4YWLA 5IYBG 3ITPA 3RLOA 2HIVA 1AEXA 1XTDA 3TMEA 1SMYC 2B63G 2K33A 2Z0SA 4XDXA 2JA8B 3T1HQ 4O42A 3A55A 2JA6B 3VR2A 5IT9L 3OTOQ 4IFDG 4UP8A 1VQ9A 2LS01 5CV8A 2WAQB 1KDCA 1ICFB 3A5UA 4C2MB 1HFNA 2F0VA 2F0IA 2EVBA 2K4KA 2YYZA 1HZAA 1PRTC 3UDIA 1EEID 4ZKBB 2Y0SE 3HOVB 4AQYL 5JJIA 4KLKA 5HY6A 4KHPQ 5BN5A 2WB1B 2EYPA 4A3IH 1A8VA 3K8AA 1STGA 2IJ0A 1V43A 2E5LL 4YIJA 2FMMA 4A3FH 1VQ5A 1H9SA 2I5HA 3NWTA 1I94Q 1U4PA 1JOQA 4EGVA 4DV6L 1Q8IA 3I8ZA 1LTSD 5I6YA 2F3IA 5IOCA 3D0FA 3TP5A 5KRUA 1X3FA 2O5IC 1NAPA 1UEBA 2BE5C 2BA1A 2J4XA 3S1QB 4PQXA 3JAMi 3TREA 3H6MA 1NE3A 3HOWH 1QB5D 2K1BA 1LO5D 2AHOB 2A68D 1EY4A 2KEEA 3EQLC 1Q46A 4R4QA 1EQRA 2R7ZH 2KHIA 1JR0D 1Z6HA 2RDGA 4JV5L 3FDTA 3HOXB 1DGSA 1B50A 4OO1H 1IZ6A 4LF4Q 5C4XH 2NVXH 4K5WA 4I7ZC 3NENA 5HGQA 1V1QA 2AWOA 2Q8TA 3S1MB 3SR1A 1JORA 3OOCA 2NTTA 2Q2TA 2XGTA 3K0YA 1XMOL 4DGZA 3M3YH 1JC7A 1K0RA 1BBUA 1BXTA 2KQ3A 1EZ6A 3DM3A 3PUVA 2WAQG 5JJKA 2IPKD 4JBWA 4A3DH 4GNXC 1JE5A 1DD2A 1YHBA 5IYCH 3DWPA 4DR4L 4QIWE 4C1NK 2EJFC 4AH6A 3IAYA 4A3BB 2F4IA 2L5TA 4HEDA 3BDOA 2EYMA 2WB1G 3J80i 4IFDH 1PVOA 1BKBA 1HCZA 1UE5A 1CQVA 1Y8PB 5BR8Q 1Q86C 3JAME 1S5BD 1CA6A 3I4NH 3D31A 3E0JA 3DEPA 1TXYA 5M3MH 4B3TQ 3D6CA 4OXPA 5FO9B 3MC0B 4DV3Q 2UU9L 5M9OA 1PRTB 3CCUA 4NPSA 1UNSA 2L11A 2L15A 1HR0L 1DOKA 4IQZA 2XSCA 1GUOA 3HOUH 1VQOA 1TWAB 4LF8L 2PMZB 4JI8L 5JEAJ 5EGTA 2F0DA 4MNOA 3QO2A 2L12A 1EIYB 1DYQA 2O4XA 1HNWQ 2RDHA 1GJXA 1PLFA 1XJVA 1FJGL 1H9SB 1D5MC 1HA5A 3CCLA 4A3CH 4JYAQ 3P75A 1I4QA 2F3VA 5GADC 4Y52H 4V0BA 2G9DA 1N36Q 1BOSA 3KK7A 4DAPA 1WD1A 5E4WC 2SDFA 1FNVA 4U673 5J1ZA 4XYQA 3M85A 4UY8C 1BUVT 3GTOH 4RH6A 4GNXA 4AIMA 2Y0SG 1IXRA 2JA7H 3GP7A 3TSSA 4K0KL 2LXKA 2V4DA 1NMFA 1TIID 2K14A 1EIHA 4IPCA 4HR7B 3UE0A 5ELEA 1HHVA 3NE5B 2XN9C 4IPGA 4OWXB 4H7BA 3I4NG 4JW0A 1CA5A 3BU2A 4A3LG 4EQOA 4ZKCB 1DXMA 4P74A 4KTAA 1E2WA 5I6WA 3S1NH 2N49A 1VQ6A 4XT3B 1I6HH 1MI2A 1Y8NB 4X3TA 3SK4A 3W2DA 4DR6Q 1SNMA 2NBFA 1X6OA 2PYKA 3BYYB 4FVMA 1F77A 1X3GA 1PH6A 1NSNS 4K0KQ 2WAQE 4QGUA 5C4HA 5FLXc 2J7ZA 4XTCS 4L5SA 2EJGC 3I4OA 1SE3A 5DM63 4K5XA 5JJZA 3RD4A 1IYUA 2DN8A 2NB0A 1TS4A 3Q8DA 5CV6A 1J5EQ 1OXVA 1AE2A 3EJIA 3ULLA 1STYA 1WTWA 1C4QA 2L4NA 1K73C 5K36H 2V1CC 4A3KG 2BE5D 2XTIA 1LTAD 2DY7A 1KNEA 4N8FA 4R4TA 3GTPB 1NTGA 3MA2B 1TY0A 2F0SA 3AB9A 2OTJA 1BCPB 1JWMD 2Y0SB 1MSHA 4DK6C 4C3HB 3G6JB 1B7YB 4DR1Q 1A2UA 1K3BC 1EFWA 2F0JA 3V96A 3P7JA 1I5FA 1II3A 2B2UA 3HOUG 1Q8KA 5M5WH 2RHSB 2PPBC 1A15A 4PZ6A 5IYDG 2ICEC 1WTXA 1T5XD 1HA6A 4DV7L 3RZDB 3A54A 1GUNA 4LF9Q 1CSPA 4RMFA 3AYHB 5F2DA 4DV4Q 2KA7A 1AH9A 4FXKC 2B8GA 1YNXA 5LMUL 1S40A 3K80C 4X66Q 4Q0FA 1KDBA 1JICA 1D1IA 1PXUA 1I94L 3NQTA 4LF6L 2F0KA 1MHWC 1LT4D 1E2VA 5C0XH 2R6GA 3PIO3 2EJMA 4NKLA 3TDQA 3CMEA 2E2IB 4X3KA 1S5FD 2B63H 3SEBA 3HKZE 4IZ8A 1NMGA 3S1MH 4ULLA 3I4LA 2C35B 2HUGA 2MO0A 4BBRG 3MTSA 4JI2L 1RCVD 2Q2IA 4A3KB 2CH4W 2RBMA 3K7AB 3CU7A 1SNPA 2VXWA 1S72A 2K03A 1BCPF 4YHHQ 1TWCH 4HIMA 2A8VA 4YHHL 3DMUA 5FOBB 2BDNA 3E9IA 1YITA 2I0QA 2NUCA 4JI7Q 3S16H 1VF7A 1VQHA 2CWPA 3NEMA 2M2LA 1WCMH 4P72A 3TP6A 2SEBD 2N78A 1WTQA 4PNYA 3PO3G 2SOBA 4RGTA 3MEHA 4RHSA 3MVVA 3MHBA 2A69C 2M00A 5EPLA 3QWNA 4QB4A 2K6AA 2BH8A 1N33L 1EY6A 2UUAQ 2F4VL 1RIPA 2E2DC 2MJ8A 3Q24A 4AQYQ 4A3IB 3TZUA 4JBKA 2MQHA 3AEVA 2ZM6L 2CKZB 4K5VA 2XNAC 3KBGA 1A3UA 1S5ED 1AZQA 4A3EH 4OL7A 3GTQH 2WINB 1X3EA 1SN8A 4A75A 1ZXTA 1B8AA 1JJGA 2R7DA 4DPGA 1XNRL 2A1AA 1OXTA 2HCCA 3H09A 4BBSH 5LL6S 2YU9H 3CCMA 2K52A 3H94A 2GVAA 2MFIA 1IHZA 3RNUA 5IGCA 3D4DA 4O0AA 4YWKA 1YIJA 5FLMH 4HJ8A 1C9OA 4L63B 2Q2UA 4K8IA 3STBD 2RF4A 4A93B 3BVMA 5C0XG 4IJHA 2A73B 4QMGA 1IYVA 1K28A 2WB1E 3M4OH 3GDEA 4KK7A 1YJWA 1T9HA 1VQ8A 5KNCA 5GAGC 1WTHA 1EWHA 4H44C 4OX9L 1RDPD 2OQ0A 3ULJA 3NP8A 5JVG3 1HQRD 1G8ZD 3K6OA 1Y69U 3C3LA 2IY5B 1N34L 3ND8A 3M4OB 4C2MH 3SDZA 1L1OC 1B3QA 4C3IB 3VR4A 3F2CA 3TEHB 2UXCQ 5I9OA 5A2QE 5AFWA 4A3JB 3T13A 3J81L 1I6VC 4AYBE 1YNJC 2NVQB 4LF7L 4DV6Q 4R8NA 3GTOB 1PH8A 3K57A 1HRJA 2E2IH 5LMNQ 4NDXA 3PO3H 1EWCA 4IURA 2F0GA 4A3GH 1QVGA 2HCIA 1W2BA 2RHQB 1NR4A 1S4ZA 3UI2A 5C4JH 3HZXA 1QJOA 1PH5A 1H9JA 1X3QA 3HOUB 2QDBA 4QUCA 2AWNA 3SHLA 1HNXQ 1PDQA 3ND9A 1ZEQX 3DWAA 1VQIA 4X62L 4DXGA 2OWOA 2E2HB 4X62Q 4MN3A 1G2SA 2AKWB 5C6AA 2VQEL 4I7AA 3BG3A 4DAMA 3QIAA 3FKIH 1EFID 3IRBA 5DNFA 3H3VC 4BY7B 5IE8A 2KCNA 1JJCB 3BYTB 1B3AA 1HTPA 5IODA 2AMCB 2RDFA 4DR3L 1V8QA 1B1ZA 1CT1D 3R8BA 3ER0A 5M5YH 4JK1C 1KNAA 1K8AC 2ZJQA 1E3PA 2IL8A 3I7FA 2KCCA 4JI3L 4XT1B 1E22A 1TU2B 3QOJA 1I50B 3R2IA 4DV5Q 1U0LA 3HG9A 2ZJRA 3J7ZC 3U9OA 1DJRD 4FF4A 2R93G 1FL0A 1LTBD 2DUDA 1QUQB 5EQ0A 5CV9A 2FJ2A 4JG2A 4DR2Q 4BBSB 3CXCA 1SLJA 5EKIA 1XPRA 2E76C 3A8IE 3J80E 4DAYA 3KLSX 1LABA 1VQBA 4DAVA 1J6QA 3IL8A 4BXXH 2HHHL 1HNWL 1XX8A 3PGZA 3CAMA 2K32A 5J3BA 3RZDH 4RG1A 2A74C 1Q1BA 3PO2B 3I90A 2RSOA 2GA4B 3D3RA 4CDEC 3PUXA 3HOVH 5FJ8H 2QCPX 5IGBA 5C4XG 3M7NA 2D62A 3DEOA 2JA8G 5C5LA 1BCPD 5GROA 4PG3A 4DR5Q 1HJPA 1C8CA 1LM0A 2MHVA 2F52A 4GLXA 4B3ML 3HKSA 3L7ZC 3FVQA 1M90C 4K14A 3NBHA 1CM9A 1EY9A 4KN4C 1EOVA 2IHFA 2RVLA 3X3MA 1VQLA 1LT3D 3LX0A 1G2TA 3K7AH 4JYAL 1EU4A 2QDLA 2HQLA 2B2WA 1ENCA 3J7YW 4IFDI 4AYBB 4A3LH 2X6GA 2H4OA 4RCOA 2F03A 2SNMA 2R93H 2B2TC 4KD3A 1I4RA 3BZCA 5M5YB 1XMOQ 2K05A 5C3WA 3FEWX 2MO1A 1LTID 3PF5A 3G4SA 2K5QA 1E1TA 3DWQA 3U9SA 3UE1A 3CCJA 2N55A 1Q90A 1U4MA 1TWHH 4KHPL 3K5LA 2IWHA 1WTPA 2JXMB 2VUMH 4MIUA 1VQ4A 3HOZG 2LFNA 1WCMB 1A63A 4G4KA 3A0JA 5EPJA 4Z9CB 4DR7L 1SYFA 1PRTF 2IW3A 3NPPA 3NBHB 5M3FG 3HOXG 2K50A 3S17H 4QUFA 1HXYD 2JQOA 3GV3A 4OX9Q 1PV4A 4YWMA 3T1HL 1MIUA 1Y1VH 2KEDA 3K5OA 1U9RA 2QEXA 1PZID 2K5HA 3FHWA 3MFYA 4HSPA 1ENFA 2G9HD 2OQKA 3SK8A 5CV5A 3U4VA 4JV5Q 1QILA 4NXML 3S14B 1VQPA 5CMDA 1H9RA 1WOCA 2UUCL 3H0GB 2B2WC 1KRTA 3M4QA 2L0CA 3EBEA 4A3IG 4JCVE 2R92H 5T1GA 5BN3A 4OWWB 4IUPA 1SMXA 3FPUB 1K83B 3M4YA 4UP9A 1S3OA 1IL2A 2A19A 5IIFA 3B6YA 3CD6A 5FO7B 3BZDB 4ZYSA 4JI5L 5FLMG 4DNTB 2VQFL 3GTKH 1U4LA 3RLNA 1PRTD 1RD9D 2L55A 3FKIB 3MXPA 1EYGA 4FF1A 1XTCD 3Q23A 3MXNB 4MZ9A 1B2TA 3DUZA 3ERSX 3DM1A 5T1IA 4N9PA 3ZYYX 1C0AA 5D65A 4X65L 1EU3A 4EX5A 2EYJA 1F9PA 4IUVA 4PMBA 1XPOA 1L1OA 4BWGB 1K3RA 5CORA 3NTIA 2MUYA 1SROA 3GTLB 4JOIA 4DR3Q 3J7AF 1IL8A 2F0UA 2B2VA 3RR5A 4GKJQ 4CKEA 1K8MA 1R4QB 4ABNA 1G6PA 2UXBQ 1HUMA 1QG7A 4NXMQ 1X56A 1K9MC 3OMGA 4DR4Q 1VQNA 1OXUA 4RFBA 4F8MA 4DUZL 4IO9A 1LT5D 1LUZA 5G3LF 3E9HA 2I07B 1N32Q 4A3JG 3HP3A 5ELBA 1TQOA 3R93A 4DUYL 2LXJA 1Y1WB 3CQZH 3STBC 4KY7A 1SFOH 2ZXPA 1L0WA 1Z7TA 2CW0C 3GTMB 3H0GH 3CHBD 1FYCA 4R4OA 4P2CB 1H9MA 4JI3Q 1TT2A 4LUVA 3S1RH 4DKAC 1Y8OB 1NBWA 2D9UA 2R61A 4OWTB 2G5DA 1RTOA 1B9NA 1F2YA 1QUQA 4MHEA 1YI2A 1NR2A 3HOWB 3VDYA 1BQQT 2CCZA 3FKIG 1HNZL 1MJEA 4I65A 1GVPA 3F8TA 1PZJD 3AFPA 3I70A 1IBKQ 1KLUD 1EUJA 2E74C 4HJ5A 5LL6X 5ELCA 3RZOB 4A3MG 4OONA 1G91A 1X65A 1NUCA 3MZ5A 1STEA 4UDUC 5BN4A 4JOIC 3GV6A 1HZCA 4HJAA 2M9VA 4ODGA 1WI5A 1W6KA 2N3SA 2Z4HA 5AJ3Q 1JJ2A 4A3FB 1I4XA 3TZDA 3I91A 2PCFB 2BA0A 4OIJA 1P8LA 3OWEB 2PZWA 1IKLA 3MXUA 5JPNC 4Y7NB 5CC4A 2CVRA 3S15B 2KECA 3CPFA 4J15A 5LHY1 4ZLTF 1Q82C 4QIWB 1DZ1A 1N8RC 3KJOA 3WWVA 1YZ6A 2CW0D 2HDLA 1PMRA 5D14A 3RLFA 2JP1A 2IX3A 2R93B 1SRUA 4YY3Q 1TY2A 2MPMA 1F2ZA 1FNUA 3G7LA 2B8FA 2RSNA 1CK1A 2BDOA 1PYWD 1ZKOA 2JA9A 1ICWA 3CP0A 4XYOA 1A3TA 3S2HH 5C3XA 2UUCQ 4Q5VA 1YJ9A 4MTNA 4PMWA 4R4IA 1GXDC 5IGGA 3W5OA 1GHKA 1VQKA 4ILWA 1WTRA 4BY1G 4IUQA 1ILQA 1HNZQ 1O78A 4A93H 2L1BA 4A3DB 3S16B 1SEBD 2XWBB 3ZJYC 4WFN3 2F0WA 4ME5A 2KJXA 2PQEA 3UDXA 2NVYB 1LT6D 4FO2A 3AFQA 3K58A 1D5ZC 1VQGA 3CMAA 1NJIC 1SE2A 5C44B 1JQYD 4EQPA 1Q1EA 3EVQA 3CPWA 1A62A 4FYDA 5E3FA 3T53B 3W1BA 4DR1L 4QL5A 2NVQH 2PW7A 2YTVA 4X3SA 2ATWA 2EY6A 3I72A 3PO3B 1D8LA 4RGNA 4DR2L 3EROA 2UU9Q 2JA8H 3KOJA 4KMUC 1SE4A 5IYDH 3NK9A 4FP5D 1SYGA 1AFPA 1CFMA 2A6HD 4YCVA 2X6LA 1ASYA 2K5NA 1ASZA 4LJZC 1G291 1L0XB 4LF6Q 3DHQA 2ZT9C 4OEMB 2OCEA 1VMPA 2JA7B 1W6JA 1LLRD 3WOEA 1XXGA 3SE0A 3J80L 1D5XC 1EY7A 2PMZE 1WFQA 2NN6I 4X6AH 4IFDJ 5J22A 3S2HB 3F1ZA 4LWCA 3VA5A 2XIWA 1KD1C 4L5RC 1KL9A 3J81j 4DV5L 2YTYA 1VQ7A 3MEFA 1G6ZA 1A6XA 2MNAA 4GOPA 4DV2Q 4KD4A 1KIXA 1STAA 4KHZA 2DY8A 1AE3A 2FHTA 1SJHD 2WKCA 4ME3A 3CCSA 1F9SA 2NZ1D 4R4CA 1IBMQ 2IT1A 2Z6BA 3AU7A 3K59A 1STHA 4S3SA 1LTRD 1QOHA 4GS3A 2KVMA 2AUKA 5ISRA 1R4PB 1DOLA 3GO5A 4HIKA 4HJ9A 1TWGB 3HOWG 2YV5A 5D3IB 4U68A 3BDCA 4B3RL 4BS9A 4BY1H 3HOYG 3KUPA 2PZUA 3P20A 2C9OA 1C48A 1SNCA 1HR0W 1SDFA 3S9WA 4O2DA 5DAUA 5K5PA 1UAPA 1K0SA 5FKAC 1VMCA 4HTHA 1NCVA 4NW2A 1IKMA 3Q0AA 5EKKA 2VZAA 2NZHA 1TKWB 1YEZA 2K5VA 5H1SE 3F2UA 2KOLA 4LUOA 2EY5A 2X69A 4DV1L 4JI4L 3I55A 1PA6A 3OPOA 3IFTA 1U5KA 1RKNA 3HS0C 4A3CG 2D5DA 3K81C 1SR3A 4B9XA 2PZTA 5M5XB 3GTKB 2UXDL 4GOPC 4LUZA 3L2PA 1KTKA 2QEJC 4DUZQ 1ILPA 1XNQQ 3I4MG 2ZXOA 2EPBA 3JAMc 1Q7YC 1P16A 4UHVA 1XNRQ 2Q8RE 5C44H 4JI0Q 2A6EC 5JEAH 4DUYQ 5TSSA 1KC8C 2IHEA 3M7GA 3J81c 1LV9A 5M5XH 4KJOA 2EYOA 2EXZA 1ZYRC 1QNKA 2ALYB 3GTJB 5HURA 2RKSA 2EYLA 5AJ3L 2FINB 4RAUC 1LTLA 3A8JE 3URYA 1NY4A 4C3IH 3SVMA 5M3MB 1JE4A 1SNOA 3WDNA 1SNDA 3R2TA 4R8IA 1H9KA 3Q22A 2K5WA 5I2YA 2EYHA 5KYLA 3PF4A 1GUTA 4B3TL 1Z47A 3FPPA 3LWEA 5COYA 1SFOB 4A3KH 3E3XA 3PIOA 3GTJH 2F3WA 4RHRA 2DNEA 4RKLA 4DR5L 2QGQA 3KFUA 2PI2E 1PFBA 3E6ZX 5CR3A 3HFZB 3KLRA 5JJLA 1RTNA 3PIP3 3NWSA 3J7AV 2WACA 5JAVA 2DJFC 2VQFQ 4LF5Q 5EBCA 3LGJA 2YU9B 3J7A5 2VL6A 2TSSA 2PW5A 4LFBQ 5BR8L 1F9QA 2TMPA 2EDGA 4M8AA 1GM5A 4HCSA 4G57A 1CKNA 1HFGA 3EN2A 1C7YA 2R3ZA 4ZUIA 1L1OB 1N36L 3S2DH 5M3FH 3NUCA 1SNQA 2B39A 1A0IA 1PTOC 1K8GA 1B4OA 5DLQE 4FXDA 1V1PA 5KYIA 4APVA 1F2MA 1N9WA 1H95A 1VCIA 4JI5Q 2F4VQ 5EJWA 1VQMA 3K7UC 1G51A 1XMQL 3TN2A 3PO2H 2JA6G 4ZUJA 2B2YC 1CI3M 3W3AA 3CRKC 4WJWA 1FVIA 2AUJD 2Z9HA 4F7XA 2SNSA 5M3MG 4DF7A 3A56A 1JB7A 1YNNC 1BR9A 2MGSA 3SK5A 5C3EH 2NN6G 2B2UC 3MWYW 1I4HA 1Y1VG 1JOKA 1CQFA 1VQFA 3CRLC 4KY6A 2XRQD 4JI6Q 3OSOA 2Z4IA 1BNZA 4GZYC 2O2LD 1B70B 1O7YA 3G48A 3NHHA 4FNFA 4A3DG 4OGQC 1T5EA 4X66L 5C4JB 1WTOA 4RWSC 4ZRZA 1MBYA 2UXDQ 4L6TB 4LF5L 2K04A 3BDLA 4K8JA 4EVOA 1V1OA 1LACA 3WOFA 4A93G 1KLGD 1YJNA 3C46A 2F0TA 5C5MA 5C44G 4LNQA 5J39A 4HJ7A 3PCOB 2L9HA 2CQOA 4QCLA 4GN3B 3L9AX 1EQTA 4RA8A 2D0PA 4JI6L 1PH3A 1DONA 1EY5A 4B08A 4LK1C 1X32A 4K6DA 3GTQB 5EBDA 4UP7A 4DA2A 3C1EA 1SXTA 4JPBW 4C3IG 1E24A 2P5ZX 2KCMA 4TVAB 1PHJA 1MSGA 1AP0A 3QB3A 3M9BA 2LMCB 5A2QL 4P75A 3X3NA 2CFMA 4LFAL 4V190 4IOAA 4XIGS 3T16A 2I46A 2F1MA 1PFSA 2CHBD 4P73A 1PZKD 5KNBA 3HOYH 5KGUA 4G7HC 5A35A 4QF4A 3PSIA 3FP9A 2JA7G 3EFXD 4TRDA 1L0YB 2E2HH 4KY5A 4CJ0B 3PUZA 1OXSC 1YBYA 3NTHA 1YVCA 5FK9C 1I4GA 2A5HA 3N6RA 3H3VH 1GUSA 1K8OA 5C4ZA 4X65Q 3HKZG 3MAQA 2QA4A 3PMFA 1M4VA 3OIQA 1SAPA 4A4IA 3A74A 3HOXH 2F0MA 2VY3A 3T51B 4C3JG 2JA5G 4JI2Q 4B3SL 1ET6A 2PNHA 1EZ8A 1HZBA 5G3LD 2QILA 4CJ2C 3BVGA 3T56B 4X64Q 4LFCQ 2O5JC 4BY7G 2AQ2B 3HEJA 4X3UA 1VDZA 3MXGA 1CZWA 2HD3A 1XPUA 1QCBD 2A6HC 4EQNA 2NTSA 2ENBA 3G71A 4E6IA 4ALPA 1XNQL 1TWAH 4DR7Q 1QVFA 2F0QA 1I3QB 5ELNA 3OMCA 1L2FA 5C3EB 4XQNA 5KNDA 1J5EL 1AZPA 3OYYA 1UUPA 3F2DA 5JOBA 4DAYB 4OHJA 1U4RA 2EQSA 4PV1C 4DV7Q 3RN2A 1V1PB 1HQMC 1MD2D 4HSVA 3VR3A 1GD7A 2WKDA 3OWFA 1EL0A 3BS1A 1JMCA 1RJTA 5I2XA 1D2BA 3D8GA 3DXJC 2K28A 2HT1A 4QQBX 5GQOA 4RGOS 2F0PA 5JEAG 3I73A 1EQQA 4JVZA 4DK0A 3J81E 1IBLQ 1CKMA 2KCTA 4KHVA 1R9TH 4DR6L 4PZ7A 4CDFC 3NQIA 3I4MB 1CHPD 3AMUA 1KRSA 2VNUD 1TS3A 4GN5A 3U50C 1N34Q 3PV0A 1PTOH 4IALA 4C3JB 2JA5B 1QWYA 2JEAI 2EZVA 2BCOA 3S1NB 4L5TA 4IUUA 3S17B 4CBVA 1SYEA 3ERQA 2VQEQ 1B44D 4DV2L 5LMNW 4RCNA 3A5ZB 3GD7A 3VYRA 3H91A 5KEEA 5ELDA 1PH4A 4LFAQ 1VQJA 2NYZD 4HIDA 3HRZC 3T4AC 4QY7A 5C0XJ 4C3HG 1F2LA 4B3MQ 2KUMA 3S2DB 1CSQA 1TWFH 2CWAA 3CCRA 1MJCA 4GKKQ 2J0TD 1CZGA 3S15H 3AQQA 2UXBL 2ZTDA 5M3FB 3W1GA 4DV0Q 1PH9A 2E75C 2IX0A 1UWVA 4IUTA 2JYOA 1EYCA 1WCMG 3NELA 4QJFA 3H15A 4YY3L 3NSWA 5I9PA 2F0LA 1EY0A 1NNXA 2YTXA 1JWSD 3S14H 1EY8A 4GOPB 3GTLH 4HIOA 4IPDA 1CKNB 3GTGH 3KLWA 4DV0L 2RA4A 1HUNA 1SYBA 3NBIA 4NB3A 1BBWA 1HZ9A 2B29A 5IP7G 1EYAA 2EY1A 4HN7A 3P1HA 2PQAB 3V2TA 1UE6A 1Y14B 2LSSA 1FGBD 2K7VA 3TQYA 1JT8A 3TP8A 1MGSA 2JE6I 1SBBB 1VS0A 2B3GA 4JI1L 3PIPA 3HKZB 1Y1WH 3GTGB 2ZM6Q 1XWEA 3MXNA 1B9MA 5E7NA 1WD0A 4C3HH 4JI7L 2JJQA 2IX1A 4A76A 5CYUA 1IYJB 1VQEA 4LMQD 3VR6A 5IYBH 1STNA 4A3FG 1FR3A 2JA6H 2CH4A 4RKBA 1EEFD 3E0EA 1Q12A 2N8NA 3Q6SA 1I50H 3E5SA 4LFBL 4WJ3M 4IUNA 1CTMA 1E2ZA 1GO3E 4A3GB 2OXPA 4UAIA 1TR5A 1YNND 4ZQ3A 1STBA 2ICIA 3HGBA 3ICEA 3CCEA 2DNCA 3I4MH 5IWAL 3QG1A 3QR8A 1MKHA 4LF9L 1A2TA 1BO0A 3CC7A 3CF5A 1VQDA 2Z1CA 2WIIB 4LF8Q 1Q81C 3FRPB 3SK6A 1W3SA 1YHAA 1XMQQ 4HMIA 3TS2A 4OO1I 4KJNA 3O13A 4HAEA 1UEAB 4TSSA 2ASBA 1J8IA 4CDCC 1FJGQ 1PTOD 4K2KA 4PZ8A 4N9TA 4UPAA 1LTTD 1IBKL 5LMNL 4F88A 1HH2P 3I56A 4BY1B 3R3OA 5JPMC 2FMCA 2F0OA 3OTOL 2OF1A 2A68C 1SYDA 3GTMH 2Z6KC 2AQ1B 1ML0D 1AN8A 3M4PA 3SGIA 4PMCA 3OW2A 1N33Q 4DV4L 5ELFA 4R1JA 3K0XA 1Y1WG 3KYHC 2F0EA 5CV7A 5FLXL 3T1YL 3KF8A 3T1YQ 4C1NI 3JC66 5IT9c 1O7ZA 2GN5A 2FFKB 1OXXK 1LTGD 1SJED 5JVH3 2R92G 1N32L 1OO9B 4J8QA 1PYSB 1SYCA 2H5XA 4KI0A 4B3SQ 5IY0A 2UXCL 4G7ZC 2F0HA 5FO8B 1ESFA 4BY7H 2JSOA 3C1FA 4L8JA 4GKJL 4H0LC 2ID0A 4A3MB 1Q3LA 1KAAA 2PI2A 4CHTB 3I2ZA 1ZYRD 5IGDA 4XQJA 3D4RA 4WORA 3LNNA 1EOTA 3TS0A 1SMYD 2OTLA 4LF4L 5IP9H 4A3EG 2E2JB 1FD7D 2RCFA 2EYFA 4BXXG 1S5CD 4FF2A 1GHJA 1QZHA 2E8GA 2A6ED 1X3PA 1GOZA 3TP7A 5E1FA 3BVZA 4CJ1B 1PH7A 1RHPA 4GLVB 4ZCKA 3KF6B 2EE1A 2Z6KA 4DNIA 2MP1A 2OT2A 1XYIA 5C3EG 4HCEA 1DCZA 1EYDA 2VW9A 1R9TB 2EOTA 4R9WA 5CGKA 2E2JH 2WP8J 4CDDC 3A7AB 4FXGC 4XXEA 1WYDA 2WFWA 4IOCA 4DN4M 3PQIA 4J1MA 5DEHA 4GNXB 3J81i 1DM0B 1EWIA 2PNRC 2E5LQ 1PTOF 1D7QA 4G7OC 3NXWA 1WJJA 1QVCA 2H1EA 2OEOA 3C2PA 3IFDA 3D6WA 1JB3A 5KIXA 1HTLD 1SE8A 2B2TA 4IPHA 1BCPC 1I4PA 4CKBA 4DXFA 5DM73 2ZTEA 2R92B 3BZKA 5CV4A 2R7FA 5CBEE 2UUAL 2B63B 1M1KC 2NN6H 2ZJPA 4JBMA 1KAWA 2I5MX 3UDFA 3A7LA 3KF6A 2XWJB 3U4ZA 1E7ZA 4B3RQ 3SXHA 1WTVA 5M5WB 5LMUQ 1HPCA 3HOYB 4MTKA 2HHHQ 1EQVA 4JC0A 3KF8B 2D2CC 2D0OA 1IW7D 3CW2C 4BBSG 1ENAA 1X9NA 3A8KE 1E1OA 3VR5A 3HOVG 4LW1A 2UUBQ 1Z9FA 4GLAC 4BBRB 4LAAA 2C5CA 4JI0L 1EIGA 1RODA 1PTOB 4C3JH 1QE6A 4DK1A 3NTKA 2JA5H 4A3MH 2K01A 3V05A 2R7ZG 5GAHC 4OELB 4M1UB 4ZK9B 2CQAA 4JI1Q 4A3GG 4L5QA 1BDOA 2GVBA 4LFCL 2LKVA 2VS1A 1TWGH 3VA7A 4A3BH 1KDAA 1JOOA 4WRDA 3BJUA 3VYTA 4TKOB 4C56C 5IYCG 3CCVA 4POFA 2PQAA 1IBML 4KKTA 3KDFB 1J9OA 2XRSD 4J6HA 3GTPH 2QF7A 5EAYA 3VYSA 2BH2A 3TRZA 1BBXC 5IP7H 4RGMA 4H13C 1GUWA 4TQUS 2VB3X 1BF4A 2NVXB 5C4XB 4FDBA 1AW7A 3GQBA 3L3OC 5I4DA 1Y1VB 4DV1Q 4JI4Q 4Y7NH 4X64L 2HIXA 4KV6A 3CKIB 2F0FA 1DOMA 3RMHA 4N8X1 3H3VI 4OO1G 3L0OA 1VQAA 4H02A 5C0XI 2JK8A 5E4XA 2EXDA 3S1RB 3S1QH 1RL2A 1IBLL 1E0BA 2ES2A 1ESRA 4BA2I 2Z8LA
chains in the Genus database with same CATH topology
2VY3A 3S1MH 4A3MG 2C35B 4OONA 4DK3C 2MO0A 2JA5G 1X65A 2JEBI 4JI2Q 4BA1I 4BBRG 4B3SL 4GN4B 4JI2L 2PNHA 1CKOA 2Q2IA 4JOIC 1HZBA 3J80c 4HJAA 1HZCA 1BVSA 1I3QH 2ZTCA 4X64Q 1S72A 4POGA 4LFCQ 1WI5A 1PYBA 1TWCH 4JI8Q 4YHHQ 2FXQA 1UE1A 2N3SA 4YHHL 5AJ3Q 4HIMA 1JJ2A 2A8VA 4BY7G 3E9IA 1YITA 2I0QA 2BA0A 4JI7Q 3S16H 3CC4A 1P8LA 1VQHA 2K75A 1XPUA 2EIFA 2CWPA 3NEMA 3G71A 4ALPA 1XNQL 1TWAH 4DR7Q 1OTCA 1WCMH 1X55A 4P72A 1QVFA 5ELNA 4A3JH 1Q82C 1VQCA 3CPFA 2N78A 4J15A 1L2FA 4YCWA 3PO3G 1N8RC 3KJOA 1J5EL 2UUBL 3WWVA 3OYYA 1YZ6A 3RLFA 1V9PA 3F2DA 1PH1A 4DAYB 4EQ5A 1UE7A 2EQSA 1SRUA 4DV7Q 3RN2A 4YY3Q 2BH8A 1N33L 2F4VL 2I5LX 1GD7A 2UUAQ 3H0GG 1RIPA 4WJ4A 4AQYQ 1JMCA 4JBKA 3AEVA 2KENA 2MQHA 2ZM6L 2CKZB 2JA9A 3CP0A 4GKKL 3RZOH 1HNXL 4A3EH 3S2HH 2UUCQ 1YJ9A 2HT1A 3GTQH 4QQBX 4MTNA 1X3EA 1SN8A 4R4IA 5GQOA 4PMWA 4A75A 3PO2G 3KDFA 4LF7Q 1B8AA 2DGYA 3W5OA 5JEAG 1EQQA 1VQKA 1JJGA 2R7DA 3PUWA 4BY1G 4DPGA 5FJ8G 1XNRL 1O7IA 2A1AA 1IBLQ 1OXTA 1CKMA 2KCTA 1HNZQ 4BBSH 4YCUA 3DLLA 5IWAQ 1R9TH 4A93H 4DV3L 3CCMA 2YU9H 4DR6L 4PZ7A 2K52A 2GVAA 1EIFA 3HOYG 1FGUA 1KRSA 2MFIA 3ZJYC 2Q2HA 3RNUA 4BBRH 2VNUD 4GN5A 4A3BG 4O0AA 4YWKA 1YIJA 3U50C 3UDXA 1N34Q 3PV0A 5FLMH 1YHQA 2JEAI 3AFQA 4HJ8A 1C9OA 1K83H 3S24A 4L5TA 2Q2UA 3PUYA 1VQGA 2RF4A 3STBD 3CMAA 1NJIC 5C0XG 4IJHA 1KQSA 5IP9G 2NZOA 1Q1EA 3CPWA 2VQEQ 1A62A 2WB1E 2NVTH 4IJLA 3GDEA 3M4OH 3HOZH 4AYBG 3EIVA 4DV2L 5LMNW 3W1BA 1YJWA 1T9HA 4DR1L 1VQ8A 1X54A 2KBNA 4QL5A 3A5ZB 5GAGC 3U58A 4OX9L 3GD7A 2NVQH 2OQ0A 3ULJA 3UDGA 2YTVA 1PH4A 5GAEC 2ATWA 4LFAQ 1KXLA 2IY5B 1D8LA 1N34L 1VQJA 4DR2L 2JA8H 2UU9Q 3KOJA 4C2MH 4HIDA 1L1OC 4QY7A 5C0XJ 5IYDH 2KHJA 3F2CA 3TEHB 1HR0Q 2UXCQ 1GKHA 4B3MQ 4P71A 1CSQA 1TWFH 2CWAA 4YCVA 3CCQA 3CCRA 1MJCA 4GKKQ 4NXNL 3S15H 1QZGA 3AQQA 4AYBE 3ULPA 2ZTDA 1ASYA 3CC2A 2UXBL 2K5NA 3W1GA 3G6EA 4DV0Q 1ASZA 4LF7L 3KJPA 1G291 4DV6Q 1PH8A 2E2IH 5LMNQ 3PO3H 4LF6Q 1PH9A 3F2BA 2IX0A 1UWVA 2NVYH 4A3GH 1QVGA 1LYLA 2OCEA 1WCMG 1W2BA 2RHQB 3NELA 4JBJA 4QJFA 5C4JH 3H15A 2PMZE 4YY3L 1WFQA 5K36G 1PH2A 1KHIA 2RCNA 5ELOA 1PH5A 2NN6I 4X6AH 2VUMG 4IFDJ 2YTXA 1CUKA 3S14H 3F1ZA 4LWCA 4GOPB 1KD1C 3GTLH 2AWNA 4HIOA 4IPDA 3RN5A 4L5RC 1KL9A 1HNXQ 3J81j 4NXNQ 4DV5L 1CKNB 2YTYA 1VQ7A 3GTGH 4YWLA 1VQIA 3KLWA 4DV0L 3MEFA 5IYBG 4X62L 2OWOA 2MNAA 4X62Q 3RLOA 2HIVA 4GOPA 1XTDA 4DV2Q 4NB3A 1KIXA 1BBWA 2AKWB 4KHZA 2VQEL 1AE3A 2B63G 2Z0SA 1HZ9A 2B29A 4ME3A 3CCSA 4R4CA 5IP7G 1IBMQ 2IT1A 4DAMA 2PQAB 3T1HQ 4GS3A 3FKIH 1UE6A 1Y14B 3OTOQ 2LSSA 3IRBA 4UP8A 3TQYA 1VQ9A 4IFDG 1JT8A 3GO5A 2JE6I 4HIKA 5IE8A 4HJ9A 3A5UA 1JJCB 3HOWG 1VS0A 2YV5A 2B3GA 2K4KA 2YYZA 2AMCB 1HZAA 4JI1L 3PIPA 4DR3L 4BY1H 1Y1WH 3ER0A 3UDIA 5M5YH 4B3RL 2ZM6Q 2Y0SE 1K8AC 5E7NA 1E3PA 2ZJQA 4C3HH 3I7FA 4JI3L 4AQYL 2JJQA 4KLKA 1EUJA 1E22A 5HY6A 4JI7L 4KHPQ 2IX1A 5JJIA 4A3IH 1A8VA 3K8AA 4DV5Q 1HR0W 1U0LA 4A76A 1V43A 2E5LL 1IYJB 1VQEA 4O2DA 5IYBH 3J7ZC 2ZJRA 4A3FG 4A3FH 1VQ5A 2I5HA 2JA6H 1I94Q 4DV6L 2R93G 1FL0A 3E0EA 1Q12A 2F3IA 2N8NA 1I50H 4LFBL 3D0FA 2DUDA 4WJ3M 1QUQB 1GO3E 1X3FA 1UEBA 2BA1A 3ICEA 3CCEA 3I4MH 4JG2A 2VZAA 2NZHA 5IWAL 1YEZA 2K5VA 3JAMi 4DR2Q 3TREA 1NE3A 3HOWH 1MKHA 3CXCA 1SLJA 4LF9L 5H1SE 2AHOB 3CC7A 4LUOA 1XPRA 3CF5A 4DV1L 4JI4L 1VQDA 3I55A 1PA6A 4LF8Q 1Q46A 4R4QA 1Q81C 1EQRA 1VQBA 2KHIA 1U5KA 2R7ZH 4A3CG 1J6QA 3K81C 1W3SA 1YHAA 1SR3A 1XMQQ 3TS2A 4BXXH 4JV5L 4OO1I 2HHHL 4GOPC 4LUZA 1HNWL 3PGZA 3L2PA 2UXDL 3CAMA 2ASBA 1DGSA 4DUZQ 1IZ6A 4LF4Q 1FJGQ 1XNQQ 3I4MG 5J3BA 5C4XH 3RZDH 4RG1A 3JAMc 2NVXH 1Q1BA 4PZ8A 3NENA 4UPAA 5HGQA 1V1QA 2AWOA 1P16A 1Q7YC 5LMNL 1IBKL 1XNRQ 3PUXA 5C44H 1HH2P 3I56A 3HOVH 4JI0Q 5FJ8H 4DUYQ 2Q2TA 2XGTA 5C4XG 1XMOL 3M7NA 2D62A 3M3YH 3OTOL 2JA8G 1K0RA 5GROA 1KC8C 1BBUA 4PG3A 4DR5Q 2IHEA 1HJPA 1LM0A 3J81c 3GTMH 2Z6KC 3DM3A 3PUVA 2WAQG 2F52A 5M5XH 4GLXA 3OW2A 3M4PA 4JBWA 3SGIA 5JJKA 4B3ML 3HKSA 4DV4L 1N33Q 4A3DH 3L7ZC 4R1JA 2ALYB 4GNXC 1M90C 3K0XA 1JE5A 1Y1WG 1YHBA 5IYCH 5AJ3L 4DR4L 3KYHC 1LTLA 4QIWE 1NY4A 4AH6A 1EOVA 2IHFA 4C3IH 1VQLA 3T1YL 3T1YQ 2WB1G 3JC66 3J80i 3K7AH 1PVOA 1BKBA 4JYAL 1UE5A 2HQLA 5IT9c 2GN5A 5BR8Q 4IFDI 1Q86C 1OXXK 3I4NH 3D31A 4A3LH 2R92G 1N32L 3PF4A 1TXYA 5M3MH 1PYSB 4B3TL 2R93H 4B3TQ 1Z47A 4OXPA 3BZCA 2H5XA 4KI0A 4DV3Q 2UU9L 4B3SQ 4A3KH 5IY0A 3CCUA 4NPSA 1XMOQ 2MO1A 3PIOA 3PF5A 3GTJH 3G4SA 2L15A 1HR0L 2UXCL 1E1TA 4DR5L 3KFUA 2QGQA 3UE1A 2PI2E 4BY7H 3CCJA 3HOUH 1VQOA 4LF8L 3HFZB 4GKJL 1TWHH 5JJLA 4JI8L 5JEAJ 4KHPL 2ID0A 4MNOA 2PI2A 2VUMH 3I2ZA 1EIYB 2VQFQ 4LF5Q 1HNWQ 3LGJA 1VQ4A 3HOZG 1XJVA 3TS0A 2OTLA 3J7A5 4LF4L 1FJGL 2VL6A 3A0JA 1A63A 5IP9H 4A3EG 4DR7L 3CCLA 4LFBQ 4A3CH 5BR8L 5M3FG 3NBHB 4BXXG 3HOXG 4HJ5A 2K50A 4JYAQ 1GM5A 3S17H 1QZHA 2E8GA 2JQOA 5GADC 1CKNA 3EN2A 1C7YA 1N36L 3S2DH 1L1OB 4OX9Q 4Y52H 1PV4A 4YWMA 3T1HL 1PH7A 5M3FH 1N36Q 4GLVB 1MIUA 1A0IA 1Y1VH 3KF6B 2QEXA 2Z6KA 1K8GA 5DLQE 4DNIA 3M85A 2K5HA 3FHWA 4APVA 5C3EG 1N9WA 4UY8C 2OQKA 1H95A 3GTOH 1VCIA 2VW9A 4GNXA 4AIMA 4JI5Q 2Y0SG 1IXRA 3U4VA 2F4VQ 1VQMA 3K7UC 1G51A 1XMQL 2E2JH 2JA7H 2WP8J 4NXML 4JV5Q 4K0KL 2LXKA 1VQPA 3PO2H 1WYDA 2WFWA 2JA6G 1NMFA 4IOCA 2K14A 1WOCA 4IPCA 3UE0A 4GNXB 3J81i 2UUCL 1EWIA 1KRTA 3M4QA 2E5LQ 3EBEA 4A3IG 4JCVE 4IPGA 1FVIA 1D7QA 2R92H 1WJJA 1QVCA 4OWXB 3I4NG 5M3MG 4OWWB 1SMXA 3BU2A 1JB7A 4A3LG 1SE8A 4IPHA 4P74A 5C3EH 2NN6G 3S1NH 2N49A 4UP9A 1VQ6A 1I6HH 2ZTEA 1S3OA 1Y1VG 1IL2A 4DR6Q 1VQFA 3BZKA 2A19A 4JI6Q 1X6OA 2R7FA 2UUAL 3B6YA 3CD6A 1M1KC 1B70B 2ZJPA 4JBMA 1KAWA 2I5MX 3UDFA 1X3GA 3G48A 3KF6A 1PH6A 3U4ZA 1E7ZA 2WAQE 4QGUA 4A3DG 4K0KQ 4B3RQ 5FLXc 4JI5L 5FLMG 4XTCS 4X66L 2VQFL 4L5SA 3GTKH 5LMUQ 3RLNA 2HHHQ 3I4OA 2UXDQ 4JC0A 1EYGA 3KF8B 4LF5L 2D0OA 3MXNB 4MZ9A 3CW2C 4BBSG 3ERSX 1X9NA 4A93G 1C0AA 1E1OA 4X65L 1YJNA 3HOVG 3Q8DA 4LW1A 5C44G 1J5EQ 1OXVA 2UUBQ 4LNQA 4HJ7A 1Z9FA 3PCOB 1AE2A 2CQOA 4GLAC 3ULLA 4GN3B 4EX5A 1K73C 1XPOA 1L1OA 4JI0L 1K3RA 2D0PA 2V1CC 4A3KG 4JI6L 4C3JH 2XTIA 2JA5H 1PH3A 4A3MH 1SROA 4R4TA 2R7ZG 5GAHC 4JOIA 4JI1Q 1NTGA 4DR3Q 4L5QA 4A3GG 2GVBA 3RR5A 4GKJQ 4LFCL 2VS1A 4UP7A 2OTJA 1TWGH 1G6PA 2UXBQ 4A3BH 4NXMQ 1X56A 4DK6C 3BJUA 1K9MC 4DR4Q 1E24A 5IYCG 4POFA 2PQAA 3CCVA 1VQNA 1OXUA 1B7YB 2KCMA 4DUZL 4DR1Q 1IBML 3KDFB 4TVAB 1PHJA 4IO9A 1LUZA 1EFWA 3GTPH 5EAYA 3M9BA 3E9HA 2BH2A 3TRZA 1I5FA 4P75A 5IP7H 1N32Q 3HOUG 4A3JG 1Q8KA 5M5WH 2CFMA 2RHSB 4DUYL 5IYDG 4PZ6A 2LXJA 4LFAL 4IOAA 4XIGS 4DV7L 4TQUS 3CQZH 4FDBA 4LF9Q 1PFSA 1CSPA 3STBC 4P73A 1SFOH 4DV1Q 4JI4Q 3HOYH 4Y7NH 1L0WA 4X64L 4RMFA 2HIXA 3PSIA 3FP9A 2JA7G 3AYHB 3H0GH 4DV4Q 2E2HH 1AH9A 4R4OA 4JI3Q 4LUVA 1YNXA 3PUZA 5LMUL 4DKAC 3S1RH 1S40A 3K80C 1NBWA 4X66Q 3H3VI 4OO1G 1OXSC 1YBYA 3L0OA 4OWTB 1VQAA 1YVCA 4H02A 1QUQA 5C0XI 1YI2A 1I94L 2JK8A 3H3VH 4LF6L 3VDYA 2CCZA 3FKIG 2EXDA 1HNZL 2R6GA 4X65Q 3HKZG 2QA4A 1MJEA 1RL2A 3CMEA 1IBLL 3S1QH 1GVPA 3F8TA 2ES2A 3AFPA 2B63H 4BA2I 4A4IA 1IBKQ 3A74A 3HOXH 3HKZE 1NMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VY3 A;  3S1M H;  4A3M G;  2C35 B;  4OON A;  4DK3 C;  2MO0 A;  2JA5 G;  1X65 A;  2JEB I;  4JI2 Q;  4BA1 I;  4BBR G;  4B3S L;  4GN4 B;  4JI2 L;  2PNH A;  1CKO A;  2Q2I A;  4JOI C;  1HZB A;  3J80 c;  4HJA A;  1HZC A;  1BVS A;  1I3Q H;  2ZTC A;  4X64 Q;  1S72 A;  4POG A;  4LFC Q;  1WI5 A;  1PYB A;  1TWC H;  4JI8 Q;  4YHH Q;  2FXQ A;  1UE1 A;  2N3S A;  4YHH L;  5AJ3 Q;  4HIM A;  1JJ2 A;  2A8V A;  4BY7 G;  3E9I A;  1YIT A;  2I0Q A;  2BA0 A;  4JI7 Q;  3S16 H;  3CC4 A;  1P8L A;  1VQH A;  2K75 A;  1XPU A;  2EIF A;  2CWP A;  3NEM A;  3G71 A;  4ALP A;  1XNQ L;  1TWA H;  4DR7 Q;  1OTC A;  1WCM H;  1X55 A;  4P72 A;  1QVF A;  5ELN A;  4A3J H;  1Q82 C;  1VQC A;  3CPF A;  2N78 A;  4J15 A;  1L2F A;  4YCW A;  3PO3 G;  1N8R C;  3KJO A;  1J5E L;  2UUB L;  3WWV A;  3OYY A;  1YZ6 A;  3RLF A;  1V9P A;  3F2D A;  1PH1 A;  4DAY B;  4EQ5 A;  1UE7 A;  2EQS A;  1SRU A;  4DV7 Q;  3RN2 A;  4YY3 Q;  2BH8 A;  1N33 L;  2F4V L;  2I5L X;  1GD7 A;  2UUA Q;  3H0G G;  1RIP A;  4WJ4 A;  4AQY Q;  1JMC A;  4JBK A;  3AEV A;  2KEN A;  2MQH A;  2ZM6 L;  2CKZ B;  2JA9 A;  3CP0 A;  4GKK L;  3RZO H;  1HNX L;  4A3E H;  3S2H H;  2UUC Q;  1YJ9 A;  2HT1 A;  3GTQ H;  4QQB X;  4MTN A;  1X3E A;  1SN8 A;  4R4I A;  5GQO A;  4PMW A;  4A75 A;  3PO2 G;  3KDF A;  4LF7 Q;  1B8A A;  2DGY A;  3W5O A;  5JEA G;  1EQQ A;  1VQK A;  1JJG A;  2R7D A;  3PUW A;  4BY1 G;  4DPG A;  5FJ8 G;  1XNR L;  1O7I A;  2A1A A;  1IBL Q;  1OXT A;  1CKM A;  2KCT A;  1HNZ Q;  4BBS H;  4YCU A;  3DLL A;  5IWA Q;  1R9T H;  4A93 H;  4DV3 L;  3CCM A;  2YU9 H;  4DR6 L;  4PZ7 A;  2K52 A;  2GVA A;  1EIF A;  3HOY G;  1FGU A;  1KRS A;  2MFI A;  3ZJY C;  2Q2H A;  3RNU A;  4BBR H;  2VNU D;  4GN5 A;  4A3B G;  4O0A A;  4YWK A;  1YIJ A;  3U50 C;  3UDX A;  1N34 Q;  3PV0 A;  5FLM H;  1YHQ A;  2JEA I;  3AFQ A;  4HJ8 A;  1C9O A;  1K83 H;  3S24 A;  4L5T A;  2Q2U A;  3PUY A;  1VQG A;  2RF4 A;  3STB D;  3CMA A;  1NJI C;  5C0X G;  4IJH A;  1KQS A;  5IP9 G;  2NZO A;  1Q1E A;  3CPW A;  2VQE Q;  1A62 A;  2WB1 E;  2NVT H;  4IJL A;  3GDE A;  3M4O H;  3HOZ H;  4AYB G;  3EIV A;  4DV2 L;  5LMN W;  3W1B A;  1YJW A;  1T9H A;  4DR1 L;  1VQ8 A;  1X54 A;  2KBN A;  4QL5 A;  3A5Z B;  5GAG C;  3U58 A;  4OX9 L;  3GD7 A;  2NVQ H;  2OQ0 A;  3ULJ A;  3UDG A;  2YTV A;  1PH4 A;  5GAE C;  2ATW A;  4LFA Q;  1KXL A;  2IY5 B;  1D8L A;  1N34 L;  1VQJ A;  4DR2 L;  2JA8 H;  2UU9 Q;  3KOJ A;  4C2M H;  4HID A;  1L1O C;  4QY7 A;  5C0X J;  5IYD H;  2KHJ A;  3F2C A;  3TEH B;  1HR0 Q;  2UXC Q;  1GKH A;  4B3M Q;  4P71 A;  1CSQ A;  1TWF H;  2CWA A;  4YCV A;  3CCQ A;  3CCR A;  1MJC A;  4GKK Q;  4NXN L;  3S15 H;  1QZG A;  3AQQ A;  4AYB E;  3ULP A;  2ZTD A;  1ASY A;  3CC2 A;  2UXB L;  2K5N A;  3W1G A;  3G6E A;  4DV0 Q;  1ASZ A;  4LF7 L;  3KJP A;  1G29 1;  4DV6 Q;  1PH8 A;  2E2I H;  5LMN Q;  3PO3 H;  4LF6 Q;  1PH9 A;  3F2B A;  2IX0 A;  1UWV A;  2NVY H;  4A3G H;  1QVG A;  1LYL A;  2OCE A;  1WCM G;  1W2B A;  2RHQ B;  3NEL A;  4JBJ A;  4QJF A;  5C4J H;  3H15 A;  2PMZ E;  4YY3 L;  1WFQ A;  5K36 G;  1PH2 A;  1KHI A;  2RCN A;  5ELO A;  1PH5 A;  2NN6 I;  4X6A H;  2VUM G;  4IFD J;  2YTX A;  1CUK A;  3S14 H;  3F1Z A;  4LWC A;  4GOP B;  1KD1 C;  3GTL H;  2AWN A;  4HIO A;  4IPD A;  3RN5 A;  4L5R C;  1KL9 A;  1HNX Q;  3J81 j;  4NXN Q;  4DV5 L;  1CKN B;  2YTY A;  1VQ7 A;  3GTG H;  4YWL A;  1VQI A;  3KLW A;  4DV0 L;  3MEF A;  5IYB G;  4X62 L;  2OWO A;  2MNA A;  4X62 Q;  3RLO A;  2HIV A;  4GOP A;  1XTD A;  4DV2 Q;  4NB3 A;  1KIX A;  1BBW A;  2AKW B;  4KHZ A;  2VQE L;  1AE3 A;  2B63 G;  2Z0S A;  1HZ9 A;  2B29 A;  4ME3 A;  3CCS A;  4R4C A;  5IP7 G;  1IBM Q;  2IT1 A;  4DAM A;  2PQA B;  3T1H Q;  4GS3 A;  3FKI H;  1UE6 A;  1Y14 B;  3OTO Q;  2LSS A;  3IRB A;  4UP8 A;  3TQY A;  1VQ9 A;  4IFD G;  1JT8 A;  3GO5 A;  2JE6 I;  4HIK A;  5IE8 A;  4HJ9 A;  3A5U A;  1JJC B;  3HOW G;  1VS0 A;  2YV5 A;  2B3G A;  2K4K A;  2YYZ A;  2AMC B;  1HZA A;  4JI1 L;  3PIP A;  4DR3 L;  4BY1 H;  1Y1W H;  3ER0 A;  3UDI A;  5M5Y H;  4B3R L;  2ZM6 Q;  2Y0S E;  1K8A C;  5E7N A;  1E3P A;  2ZJQ A;  4C3H H;  3I7F A;  4JI3 L;  4AQY L;  2JJQ A;  4KLK A;  1EUJ A;  1E22 A;  5HY6 A;  4JI7 L;  4KHP Q;  2IX1 A;  5JJI A;  4A3I H;  1A8V A;  3K8A A;  4DV5 Q;  1HR0 W;  1U0L A;  4A76 A;  1V43 A;  2E5L L;  1IYJ B;  1VQE A;  4O2D A;  5IYB H;  3J7Z C;  2ZJR A;  4A3F G;  4A3F H;  1VQ5 A;  2I5H A;  2JA6 H;  1I94 Q;  4DV6 L;  2R93 G;  1FL0 A;  3E0E A;  1Q12 A;  2F3I A;  2N8N A;  1I50 H;  4LFB L;  3D0F A;  2DUD A;  4WJ3 M;  1QUQ B;  1GO3 E;  1X3F A;  1UEB A;  2BA1 A;  3ICE A;  3CCE A;  3I4M H;  4JG2 A;  2VZA A;  2NZH A;  5IWA L;  1YEZ A;  2K5V A;  3JAM i;  4DR2 Q;  3TRE A;  1NE3 A;  3HOW H;  1MKH A;  3CXC A;  1SLJ A;  4LF9 L;  5H1S E;  2AHO B;  3CC7 A;  4LUO A;  1XPR A;  3CF5 A;  4DV1 L;  4JI4 L;  1VQD A;  3I55 A;  1PA6 A;  4LF8 Q;  1Q46 A;  4R4Q A;  1Q81 C;  1EQR A;  1VQB A;  2KHI A;  1U5K A;  2R7Z H;  4A3C G;  1J6Q A;  3K81 C;  1W3S A;  1YHA A;  1SR3 A;  1XMQ Q;  3TS2 A;  4BXX H;  4JV5 L;  4OO1 I;  2HHH L;  4GOP C;  4LUZ A;  1HNW L;  3PGZ A;  3L2P A;  2UXD L;  3CAM A;  2ASB A;  1DGS A;  4DUZ Q;  1IZ6 A;  4LF4 Q;  1FJG Q;  1XNQ Q;  3I4M G;  5J3B A;  5C4X H;  3RZD H;  4RG1 A;  3JAM c;  2NVX H;  1Q1B A;  4PZ8 A;  3NEN A;  4UPA A;  5HGQ A;  1V1Q A;  2AWO A;  1P16 A;  1Q7Y C;  5LMN L;  1IBK L;  1XNR Q;  3PUX A;  5C44 H;  1HH2 P;  3I56 A;  3HOV H;  4JI0 Q;  5FJ8 H;  4DUY Q;  2Q2T A;  2XGT A;  5C4X G;  1XMO L;  3M7N A;  2D62 A;  3M3Y H;  3OTO L;  2JA8 G;  1K0R A;  5GRO A;  1KC8 C;  1BBU A;  4PG3 A;  4DR5 Q;  2IHE A;  1HJP A;  1LM0 A;  3J81 c;  3GTM H;  2Z6K C;  3DM3 A;  3PUV A;  2WAQ G;  2F52 A;  5M5X H;  4GLX A;  3OW2 A;  3M4P A;  4JBW A;  3SGI A;  5JJK A;  4B3M L;  3HKS A;  4DV4 L;  1N33 Q;  4A3D H;  3L7Z C;  4R1J A;  2ALY B;  4GNX C;  1M90 C;  3K0X A;  1JE5 A;  1Y1W G;  1YHB A;  5IYC H;  5AJ3 L;  4DR4 L;  3KYH C;  1LTL A;  4QIW E;  1NY4 A;  4AH6 A;  1EOV A;  2IHF A;  4C3I H;  1VQL A;  3T1Y L;  3T1Y Q;  2WB1 G;  3JC6 6;  3J80 i;  3K7A H;  1PVO A;  1BKB A;  4JYA L;  1UE5 A;  2HQL A;  5IT9 c;  2GN5 A;  5BR8 Q;  4IFD I;  1Q86 C;  1OXX K;  3I4N H;  3D31 A;  4A3L H;  2R92 G;  1N32 L;  3PF4 A;  1TXY A;  5M3M H;  1PYS B;  4B3T L;  2R93 H;  4B3T Q;  1Z47 A;  4OXP A;  3BZC A;  2H5X A;  4KI0 A;  4DV3 Q;  2UU9 L;  4B3S Q;  4A3K H;  5IY0 A;  3CCU A;  4NPS A;  1XMO Q;  2MO1 A;  3PIO A;  3PF5 A;  3GTJ H;  3G4S A;  2L15 A;  1HR0 L;  2UXC L;  1E1T A;  4DR5 L;  3KFU A;  2QGQ A;  3UE1 A;  2PI2 E;  4BY7 H;  3CCJ A;  3HOU H;  1VQO A;  4LF8 L;  3HFZ B;  4GKJ L;  1TWH H;  5JJL A;  4JI8 L;  5JEA J;  4KHP L;  2ID0 A;  4MNO A;  2PI2 A;  2VUM H;  3I2Z A;  1EIY B;  2VQF Q;  4LF5 Q;  1HNW Q;  3LGJ A;  1VQ4 A;  3HOZ G;  1XJV A;  3TS0 A;  2OTL A;  3J7A 5;  4LF4 L;  1FJG L;  2VL6 A;  3A0J A;  1A63 A;  5IP9 H;  4A3E G;  4DR7 L;  3CCL A;  4LFB Q;  4A3C H;  5BR8 L;  5M3F G;  3NBH B;  4BXX G;  3HOX G;  4HJ5 A;  2K50 A;  4JYA Q;  1GM5 A;  3S17 H;  1QZH A;  2E8G A;  2JQO A;  5GAD C;  1CKN A;  3EN2 A;  1C7Y A;  1N36 L;  3S2D H;  1L1O B;  4OX9 Q;  4Y52 H;  1PV4 A;  4YWM A;  3T1H L;  1PH7 A;  5M3F H;  1N36 Q;  4GLV B;  1MIU A;  1A0I A;  1Y1V H;  3KF6 B;  2QEX A;  2Z6K A;  1K8G A;  5DLQ E;  4DNI A;  3M85 A;  2K5H A;  3FHW A;  4APV A;  5C3E G;  1N9W A;  4UY8 C;  2OQK A;  1H95 A;  3GTO H;  1VCI A;  2VW9 A;  4GNX A;  4AIM A;  4JI5 Q;  2Y0S G;  1IXR A;  3U4V A;  2F4V Q;  1VQM A;  3K7U C;  1G51 A;  1XMQ L;  2E2J H;  2JA7 H;  2WP8 J;  4NXM L;  4JV5 Q;  4K0K L;  2LXK A;  1VQP A;  3PO2 H;  1WYD A;  2WFW A;  2JA6 G;  1NMF A;  4IOC A;  2K14 A;  1WOC A;  4IPC A;  3UE0 A;  4GNX B;  3J81 i;  2UUC L;  1EWI A;  1KRT A;  3M4Q A;  2E5L Q;  3EBE A;  4A3I G;  4JCV E;  4IPG A;  1FVI A;  1D7Q A;  2R92 H;  1WJJ A;  1QVC A;  4OWX B;  3I4N G;  5M3M G;  4OWW B;  1SMX A;  3BU2 A;  1JB7 A;  4A3L G;  1SE8 A;  4IPH A;  4P74 A;  5C3E H;  2NN6 G;  3S1N H;  2N49 A;  4UP9 A;  1VQ6 A;  1I6H H;  2ZTE A;  1S3O A;  1Y1V G;  1IL2 A;  4DR6 Q;  1VQF A;  3BZK A;  2A19 A;  4JI6 Q;  1X6O A;  2R7F A;  2UUA L;  3B6Y A;  3CD6 A;  1M1K C;  1B70 B;  2ZJP A;  4JBM A;  1KAW A;  2I5M X;  3UDF A;  1X3G A;  3G48 A;  3KF6 A;  1PH6 A;  3U4Z A;  1E7Z A;  2WAQ E;  4QGU A;  4A3D G;  4K0K Q;  4B3R Q;  5FLX c;  4JI5 L;  5FLM G;  4XTC S;  4X66 L;  2VQF L;  4L5S A;  3GTK H;  5LMU Q;  3RLN A;  2HHH Q;  3I4O A;  2UXD Q;  4JC0 A;  1EYG A;  3KF8 B;  4LF5 L;  2D0O A;  3MXN B;  4MZ9 A;  3CW2 C;  4BBS G;  3ERS X;  1X9N A;  4A93 G;  1C0A A;  1E1O A;  4X65 L;  1YJN A;  3HOV G;  3Q8D A;  4LW1 A;  5C44 G;  1J5E Q;  1OXV A;  2UUB Q;  4LNQ A;  4HJ7 A;  1Z9F A;  3PCO B;  1AE2 A;  2CQO A;  4GLA C;  3ULL A;  4GN3 B;  4EX5 A;  1K73 C;  1XPO A;  1L1O A;  4JI0 L;  1K3R A;  2D0P A;  2V1C C;  4A3K G;  4JI6 L;  4C3J H;  2XTI A;  2JA5 H;  1PH3 A;  4A3M H;  1SRO A;  4R4T A;  2R7Z G;  5GAH C;  4JOI A;  4JI1 Q;  1NTG A;  4DR3 Q;  4L5Q A;  4A3G G;  2GVB A;  3RR5 A;  4GKJ Q;  4LFC L;  2VS1 A;  4UP7 A;  2OTJ A;  1TWG H;  1G6P A;  2UXB Q;  4A3B H;  4NXM Q;  1X56 A;  4DK6 C;  3BJU A;  1K9M C;  4DR4 Q;  1E24 A;  5IYC G;  4POF A;  2PQA A;  3CCV A;  1VQN A;  1OXU A;  1B7Y B;  2KCM A;  4DUZ L;  4DR1 Q;  1IBM L;  3KDF B;  4TVA B;  1PHJ A;  4IO9 A;  1LUZ A;  1EFW A;  3GTP H;  5EAY A;  3M9B A;  3E9H A;  2BH2 A;  3TRZ A;  1I5F A;  4P75 A;  5IP7 H;  1N32 Q;  3HOU G;  4A3J G;  1Q8K A;  5M5W H;  2CFM A;  2RHS B;  4DUY L;  5IYD G;  4PZ6 A;  2LXJ A;  4LFA L;  4IOA A;  4XIG S;  4DV7 L;  4TQU S;  3CQZ H;  4FDB A;  4LF9 Q;  1PFS A;  1CSP A;  3STB C;  4P73 A;  1SFO H;  4DV1 Q;  4JI4 Q;  3HOY H;  4Y7N H;  1L0W A;  4X64 L;  4RMF A;  2HIX A;  3PSI A;  3FP9 A;  2JA7 G;  3AYH B;  3H0G H;  4DV4 Q;  2E2H H;  1AH9 A;  4R4O A;  4JI3 Q;  4LUV A;  1YNX A;  3PUZ A;  5LMU L;  4DKA C;  3S1R H;  1S40 A;  3K80 C;  1NBW A;  4X66 Q;  3H3V I;  4OO1 G;  1OXS C;  1YBY A;  3L0O A;  4OWT B;  1VQA A;  1YVC A;  4H02 A;  1QUQ A;  5C0X I;  1YI2 A;  1I94 L;  2JK8 A;  3H3V H;  4LF6 L;  3VDY A;  2CCZ A;  3FKI G;  2EXD A;  1HNZ L;  2R6G A;  4X65 Q;  3HKZ G;  2QA4 A;  1MJE A;  1RL2 A;  3CME A;  1IBL L;  3S1Q H;  1GVP A;  3F8T A;  2ES2 A;  3AFP A;  2B63 H;  4BA2 I;  4A4I A;  1IBK Q;  3A74 A;  3HOX H;  3HKZ E;  1NMG A; 
#chains in the Genus database with same CATH topology
 4DK3 C;  5EKL A;  2JEB I;  4BA1 I;  2LY7 A;  4GN4 B;  1CHQ D;  1CKO A;  3J80 c;  3K5N A;  1BVS A;  2B2V C;  1I3Q H;  2ZTC A;  4POG A;  1YNJ D;  1PYB A;  4JI8 Q;  2FXQ A;  1UE1 A;  2AQ3 B;  5IGE A;  2DJG C;  3CC4 A;  2K75 A;  2EIF A;  1ET9 A;  2EY2 A;  1PFN A;  2N88 A;  1OTC A;  1JWU D;  1JCK B;  1TS2 A;  1X55 A;  2NWG A;  3OW7 A;  4A3J H;  1VQC A;  3D4W A;  4YCW A;  2UUB L;  2VB2 X;  1V9P A;  1PH1 A;  4EQ5 A;  1UE7 A;  3RUZ A;  5IGF A;  2I5L X;  4WJ4 A;  3H0G G;  2KEN A;  2KHS A;  3OIP A;  1RF2 D;  4GKK L;  3RZO H;  1HNX L;  5EPK A;  4O1N A;  3OHX C;  3EA6 A;  3PO2 G;  1PFM A;  3KDF A;  4LF7 Q;  2DGY A;  4IN3 A;  1TVX A;  3PUW A;  4HMJ A;  2B2Y A;  4NP5 A;  5FJ8 G;  3K5M A;  1O7I A;  4DFA A;  1O80 A;  3QJY A;  2WV6 D;  4YCU A;  5IWA Q;  3DLL A;  4DV3 L;  1EIF A;  2Q8I B;  3FMC A;  1FGU A;  2VUM B;  1D1K A;  2Q2H A;  4BBR H;  4NMZ A;  1TWC B;  1WVL A;  5IT9 E;  4A3B G;  1TWH B;  2QKI C;  3I4N B;  3I3C A;  3KLS A;  4XQQ A;  1YHQ A;  5CBA E;  1K83 H;  3S24 A;  3IKJ A;  4ID6 A;  3PUY A;  3JAM L;  2F0N A;  4OIK A;  1KQS A;  5IP9 G;  2NZO A;  2QW7 A;  2XVS A;  4F87 A;  2NVT H;  1IW7 C;  4IJL A;  3LWU A;  3HOZ H;  4AYB G;  3EIV A;  4KKU A;  5FLX E;  1M8A A;  3MFG A;  1X54 A;  3N52 A;  2KBN A;  3ONA B;  3U58 A;  3QOL A;  4K6L A;  3UDG A;  2RQX A;  2A69 D;  5GAE C;  2ZXR A;  1KXL A;  3M3Y B;  4FF3 A;  4KKS A;  2HQE A;  1TWF B;  2K5D A;  2NVT B;  4A3E B;  2KHJ A;  1HR0 Q;  1GKH A;  2HDM A;  1QNU A;  1TS5 A;  4P71 A;  1F9R A;  3TBI B;  3HOZ B;  3CCQ A;  2BOS A;  1FNW A;  1S5D D;  1A3V A;  4NXN L;  4DU9 A;  1QZG A;  3ULP A;  5D3D A;  3CC2 A;  5NUC A;  3G6E A;  3KJP A;  4CGY B;  2R7Z B;  4DNR B;  1SSO A;  1I6H B;  3KBX A;  1B53 A;  3F2B A;  1D6E C;  4CKC A;  2NVY H;  1LYL A;  4K2L A;  4JBJ A;  4KN7 C;  5K36 G;  1PH2 A;  1VF5 C;  1KHI A;  2RCN A;  5ELO A;  1O7L A;  2VUM G;  1ONL A;  1CUK A;  1KAB A;  1GUG A;  3VYU A;  4B9W A;  5HGT A;  4ZAI A;  3RN5 A;  2PO4 A;  4NXN Q;  3CQZ B;  5L37 A;  2JN4 A;  4YWL A;  5IYB G;  3ITP A;  3RLO A;  2HIV A;  1AEX A;  1XTD A;  3TME A;  1SMY C;  2B63 G;  2K33 A;  2Z0S A;  4XDX A;  2JA8 B;  3T1H Q;  4O42 A;  3A55 A;  2JA6 B;  3VR2 A;  5IT9 L;  3OTO Q;  4IFD G;  4UP8 A;  1VQ9 A;  2LS0 1;  5CV8 A;  2WAQ B;  1KDC A;  1ICF B;  3A5U A;  4C2M B;  1HFN A;  2F0V A;  2F0I A;  2EVB A;  2K4K A;  2YYZ A;  1HZA A;  1PRT C;  3UDI A;  1EEI D;  4ZKB B;  2Y0S E;  3HOV B;  4AQY L;  5JJI A;  4KLK A;  5HY6 A;  4KHP Q;  5BN5 A;  2WB1 B;  2EYP A;  4A3I H;  1A8V A;  3K8A A;  1STG A;  2IJ0 A;  1V43 A;  2E5L L;  4YIJ A;  2FMM A;  4A3F H;  1VQ5 A;  1H9S A;  2I5H A;  3NWT A;  1I94 Q;  1U4P A;  1JOQ A;  4EGV A;  4DV6 L;  1Q8I A;  3I8Z A;  1LTS D;  5I6Y A;  2F3I A;  5IOC A;  3D0F A;  3TP5 A;  5KRU A;  1X3F A;  2O5I C;  1NAP A;  1UEB A;  2BE5 C;  2BA1 A;  2J4X A;  3S1Q B;  4PQX A;  3JAM i;  3TRE A;  3H6M A;  1NE3 A;  3HOW H;  1QB5 D;  2K1B A;  1LO5 D;  2AHO B;  2A68 D;  1EY4 A;  2KEE A;  3EQL C;  1Q46 A;  4R4Q A;  1EQR A;  2R7Z H;  2KHI A;  1JR0 D;  1Z6H A;  2RDG A;  4JV5 L;  3FDT A;  3HOX B;  1DGS A;  1B50 A;  4OO1 H;  1IZ6 A;  4LF4 Q;  5C4X H;  2NVX H;  4K5W A;  4I7Z C;  3NEN A;  5HGQ A;  1V1Q A;  2AWO A;  2Q8T A;  3S1M B;  3SR1 A;  1JOR A;  3OOC A;  2NTT A;  2Q2T A;  2XGT A;  3K0Y A;  1XMO L;  4DGZ A;  3M3Y H;  1JC7 A;  1K0R A;  1BBU A;  1BXT A;  2KQ3 A;  1EZ6 A;  3DM3 A;  3PUV A;  2WAQ G;  5JJK A;  2IPK D;  4JBW A;  4A3D H;  4GNX C;  1JE5 A;  1DD2 A;  1YHB A;  5IYC H;  3DWP A;  4DR4 L;  4QIW E;  4C1N K;  2EJF C;  4AH6 A;  3IAY A;  4A3B B;  2F4I A;  2L5T A;  4HED A;  3BDO A;  2EYM A;  2WB1 G;  3J80 i;  4IFD H;  1PVO A;  1BKB A;  1HCZ A;  1UE5 A;  1CQV A;  1Y8P B;  5BR8 Q;  1Q86 C;  3JAM E;  1S5B D;  1CA6 A;  3I4N H;  3D31 A;  3E0J A;  3DEP A;  1TXY A;  5M3M H;  4B3T Q;  3D6C A;  4OXP A;  5FO9 B;  3MC0 B;  4DV3 Q;  2UU9 L;  5M9O A;  1PRT B;  3CCU A;  4NPS A;  1UNS A;  2L11 A;  2L15 A;  1HR0 L;  1DOK A;  4IQZ A;  2XSC A;  1GUO A;  3HOU H;  1VQO A;  1TWA B;  4LF8 L;  2PMZ B;  4JI8 L;  5JEA J;  5EGT A;  2F0D A;  4MNO A;  3QO2 A;  2L12 A;  1EIY B;  1DYQ A;  2O4X A;  1HNW Q;  2RDH A;  1GJX A;  1PLF A;  1XJV A;  1FJG L;  1H9S B;  1D5M C;  1HA5 A;  3CCL A;  4A3C H;  4JYA Q;  3P75 A;  1I4Q A;  2F3V A;  5GAD C;  4Y52 H;  4V0B A;  2G9D A;  1N36 Q;  1BOS A;  3KK7 A;  4DAP A;  1WD1 A;  5E4W C;  2SDF A;  1FNV A;  4U67 3;  5J1Z A;  4XYQ A;  3M85 A;  4UY8 C;  1BUV T;  3GTO H;  4RH6 A;  4GNX A;  4AIM A;  2Y0S G;  1IXR A;  2JA7 H;  3GP7 A;  3TSS A;  4K0K L;  2LXK A;  2V4D A;  1NMF A;  1TII D;  2K14 A;  1EIH A;  4IPC A;  4HR7 B;  3UE0 A;  5ELE A;  1HHV A;  3NE5 B;  2XN9 C;  4IPG A;  4OWX B;  4H7B A;  3I4N G;  4JW0 A;  1CA5 A;  3BU2 A;  4A3L G;  4EQO A;  4ZKC B;  1DXM A;  4P74 A;  4KTA A;  1E2W A;  5I6W A;  3S1N H;  2N49 A;  1VQ6 A;  4XT3 B;  1I6H H;  1MI2 A;  1Y8N B;  4X3T A;  3SK4 A;  3W2D A;  4DR6 Q;  1SNM A;  2NBF A;  1X6O A;  2PYK A;  3BYY B;  4FVM A;  1F77 A;  1X3G A;  1PH6 A;  1NSN S;  4K0K Q;  2WAQ E;  4QGU A;  5C4H A;  5FLX c;  2J7Z A;  4XTC S;  4L5S A;  2EJG C;  3I4O A;  1SE3 A;  5DM6 3;  4K5X A;  5JJZ A;  3RD4 A;  1IYU A;  2DN8 A;  2NB0 A;  1TS4 A;  3Q8D A;  5CV6 A;  1J5E Q;  1OXV A;  1AE2 A;  3EJI A;  3ULL A;  1STY A;  1WTW A;  1C4Q A;  2L4N A;  1K73 C;  5K36 H;  2V1C C;  4A3K G;  2BE5 D;  2XTI A;  1LTA D;  2DY7 A;  1KNE A;  4N8F A;  4R4T A;  3GTP B;  1NTG A;  3MA2 B;  1TY0 A;  2F0S A;  3AB9 A;  2OTJ A;  1BCP B;  1JWM D;  2Y0S B;  1MSH A;  4DK6 C;  4C3H B;  3G6J B;  1B7Y B;  4DR1 Q;  1A2U A;  1K3B C;  1EFW A;  2F0J A;  3V96 A;  3P7J A;  1I5F A;  1II3 A;  2B2U A;  3HOU G;  1Q8K A;  5M5W H;  2RHS B;  2PPB C;  1A15 A;  4PZ6 A;  5IYD G;  2ICE C;  1WTX A;  1T5X D;  1HA6 A;  4DV7 L;  3RZD B;  3A54 A;  1GUN A;  4LF9 Q;  1CSP A;  4RMF A;  3AYH B;  5F2D A;  4DV4 Q;  2KA7 A;  1AH9 A;  4FXK C;  2B8G A;  1YNX A;  5LMU L;  1S40 A;  3K80 C;  4X66 Q;  4Q0F A;  1KDB A;  1JIC A;  1D1I A;  1PXU A;  1I94 L;  3NQT A;  4LF6 L;  2F0K A;  1MHW C;  1LT4 D;  1E2V A;  5C0X H;  2R6G A;  3PIO 3;  2EJM A;  4NKL A;  3TDQ A;  3CME A;  2E2I B;  4X3K A;  1S5F D;  2B63 H;  3SEB A;  3HKZ E;  4IZ8 A;  1NMG A;  3S1M H;  4ULL A;  3I4L A;  2C35 B;  2HUG A;  2MO0 A;  4BBR G;  3MTS A;  4JI2 L;  1RCV D;  2Q2I A;  4A3K B;  2CH4 W;  2RBM A;  3K7A B;  3CU7 A;  1SNP A;  2VXW A;  1S72 A;  2K03 A;  1BCP F;  4YHH Q;  1TWC H;  4HIM A;  2A8V A;  4YHH L;  3DMU A;  5FOB B;  2BDN A;  3E9I A;  1YIT A;  2I0Q A;  2NUC A;  4JI7 Q;  3S16 H;  1VF7 A;  1VQH A;  2CWP A;  3NEM A;  2M2L A;  1WCM H;  4P72 A;  3TP6 A;  2SEB D;  2N78 A;  1WTQ A;  4PNY A;  3PO3 G;  2SOB A;  4RGT A;  3MEH A;  4RHS A;  3MVV A;  3MHB A;  2A69 C;  2M00 A;  5EPL A;  3QWN A;  4QB4 A;  2K6A A;  2BH8 A;  1N33 L;  1EY6 A;  2UUA Q;  2F4V L;  1RIP A;  2E2D C;  2MJ8 A;  3Q24 A;  4AQY Q;  4A3I B;  3TZU A;  4JBK A;  2MQH A;  3AEV A;  2ZM6 L;  2CKZ B;  4K5V A;  2XNA C;  3KBG A;  1A3U A;  1S5E D;  1AZQ A;  4A3E H;  4OL7 A;  3GTQ H;  2WIN B;  1X3E A;  1SN8 A;  4A75 A;  1ZXT A;  1B8A A;  1JJG A;  2R7D A;  4DPG A;  1XNR L;  2A1A A;  1OXT A;  2HCC A;  3H09 A;  4BBS H;  5LL6 S;  2YU9 H;  3CCM A;  2K52 A;  3H94 A;  2GVA A;  2MFI A;  1IHZ A;  3RNU A;  5IGC A;  3D4D A;  4O0A A;  4YWK A;  1YIJ A;  5FLM H;  4HJ8 A;  1C9O A;  4L63 B;  2Q2U A;  4K8I A;  3STB D;  2RF4 A;  4A93 B;  3BVM A;  5C0X G;  4IJH A;  2A73 B;  4QMG A;  1IYV A;  1K28 A;  2WB1 E;  3M4O H;  3GDE A;  4KK7 A;  1YJW A;  1T9H A;  1VQ8 A;  5KNC A;  5GAG C;  1WTH A;  1EWH A;  4H44 C;  4OX9 L;  1RDP D;  2OQ0 A;  3ULJ A;  3NP8 A;  5JVG 3;  1HQR D;  1G8Z D;  3K6O A;  1Y69 U;  3C3L A;  2IY5 B;  1N34 L;  3ND8 A;  3M4O B;  4C2M H;  3SDZ A;  1L1O C;  1B3Q A;  4C3I B;  3VR4 A;  3F2C A;  3TEH B;  2UXC Q;  5I9O A;  5A2Q E;  5AFW A;  4A3J B;  3T13 A;  3J81 L;  1I6V C;  4AYB E;  1YNJ C;  2NVQ B;  4LF7 L;  4DV6 Q;  4R8N A;  3GTO B;  1PH8 A;  3K57 A;  1HRJ A;  2E2I H;  5LMN Q;  4NDX A;  3PO3 H;  1EWC A;  4IUR A;  2F0G A;  4A3G H;  1QVG A;  2HCI A;  1W2B A;  2RHQ B;  1NR4 A;  1S4Z A;  3UI2 A;  5C4J H;  3HZX A;  1QJO A;  1PH5 A;  1H9J A;  1X3Q A;  3HOU B;  2QDB A;  4QUC A;  2AWN A;  3SHL A;  1HNX Q;  1PDQ A;  3ND9 A;  1ZEQ X;  3DWA A;  1VQI A;  4X62 L;  4DXG A;  2OWO A;  2E2H B;  4X62 Q;  4MN3 A;  1G2S A;  2AKW B;  5C6A A;  2VQE L;  4I7A A;  3BG3 A;  4DAM A;  3QIA A;  3FKI H;  1EFI D;  3IRB A;  5DNF A;  3H3V C;  4BY7 B;  5IE8 A;  2KCN A;  1JJC B;  3BYT B;  1B3A A;  1HTP A;  5IOD A;  2AMC B;  2RDF A;  4DR3 L;  1V8Q A;  1B1Z A;  1CT1 D;  3R8B A;  3ER0 A;  5M5Y H;  4JK1 C;  1KNA A;  1K8A C;  2ZJQ A;  1E3P A;  2IL8 A;  3I7F A;  2KCC A;  4JI3 L;  4XT1 B;  1E22 A;  1TU2 B;  3QOJ A;  1I50 B;  3R2I A;  4DV5 Q;  1U0L A;  3HG9 A;  2ZJR A;  3J7Z C;  3U9O A;  1DJR D;  4FF4 A;  2R93 G;  1FL0 A;  1LTB D;  2DUD A;  1QUQ B;  5EQ0 A;  5CV9 A;  2FJ2 A;  4JG2 A;  4DR2 Q;  4BBS B;  3CXC A;  1SLJ A;  5EKI A;  1XPR A;  2E76 C;  3A8I E;  3J80 E;  4DAY A;  3KLS X;  1LAB A;  1VQB A;  4DAV A;  1J6Q A;  3IL8 A;  4BXX H;  2HHH L;  1HNW L;  1XX8 A;  3PGZ A;  3CAM A;  2K32 A;  5J3B A;  3RZD H;  4RG1 A;  2A74 C;  1Q1B A;  3PO2 B;  3I90 A;  2RSO A;  2GA4 B;  3D3R A;  4CDE C;  3PUX A;  3HOV H;  5FJ8 H;  2QCP X;  5IGB A;  5C4X G;  3M7N A;  2D62 A;  3DEO A;  2JA8 G;  5C5L A;  1BCP D;  5GRO A;  4PG3 A;  4DR5 Q;  1HJP A;  1C8C A;  1LM0 A;  2MHV A;  2F52 A;  4GLX A;  4B3M L;  3HKS A;  3L7Z C;  3FVQ A;  1M90 C;  4K14 A;  3NBH A;  1CM9 A;  1EY9 A;  4KN4 C;  1EOV A;  2IHF A;  2RVL A;  3X3M A;  1VQL A;  1LT3 D;  3LX0 A;  1G2T A;  3K7A H;  4JYA L;  1EU4 A;  2QDL A;  2HQL A;  2B2W A;  1ENC A;  3J7Y W;  4IFD I;  4AYB B;  4A3L H;  2X6G A;  2H4O A;  4RCO A;  2F03 A;  2SNM A;  2R93 H;  2B2T C;  4KD3 A;  1I4R A;  3BZC A;  5M5Y B;  1XMO Q;  2K05 A;  5C3W A;  3FEW X;  2MO1 A;  1LTI D;  3PF5 A;  3G4S A;  2K5Q A;  1E1T A;  3DWQ A;  3U9S A;  3UE1 A;  3CCJ A;  2N55 A;  1Q90 A;  1U4M A;  1TWH H;  4KHP L;  3K5L A;  2IWH A;  1WTP A;  2JXM B;  2VUM H;  4MIU A;  1VQ4 A;  3HOZ G;  2LFN A;  1WCM B;  1A63 A;  4G4K A;  3A0J A;  5EPJ A;  4Z9C B;  4DR7 L;  1SYF A;  1PRT F;  2IW3 A;  3NPP A;  3NBH B;  5M3F G;  3HOX G;  2K50 A;  3S17 H;  4QUF A;  1HXY D;  2JQO A;  3GV3 A;  4OX9 Q;  1PV4 A;  4YWM A;  3T1H L;  1MIU A;  1Y1V H;  2KED A;  3K5O A;  1U9R A;  2QEX A;  1PZI D;  2K5H A;  3FHW A;  3MFY A;  4HSP A;  1ENF A;  2G9H D;  2OQK A;  3SK8 A;  5CV5 A;  3U4V A;  4JV5 Q;  1QIL A;  4NXM L;  3S14 B;  1VQP A;  5CMD A;  1H9R A;  1WOC A;  2UUC L;  3H0G B;  2B2W C;  1KRT A;  3M4Q A;  2L0C A;  3EBE A;  4A3I G;  4JCV E;  2R92 H;  5T1G A;  5BN3 A;  4OWW B;  4IUP A;  1SMX A;  3FPU B;  1K83 B;  3M4Y A;  4UP9 A;  1S3O A;  1IL2 A;  2A19 A;  5IIF A;  3B6Y A;  3CD6 A;  5FO7 B;  3BZD B;  4ZYS A;  4JI5 L;  5FLM G;  4DNT B;  2VQF L;  3GTK H;  1U4L A;  3RLN A;  1PRT D;  1RD9 D;  2L55 A;  3FKI B;  3MXP A;  1EYG A;  4FF1 A;  1XTC D;  3Q23 A;  3MXN B;  4MZ9 A;  1B2T A;  3DUZ A;  3ERS X;  3DM1 A;  5T1I A;  4N9P A;  3ZYY X;  1C0A A;  5D65 A;  4X65 L;  1EU3 A;  4EX5 A;  2EYJ A;  1F9P A;  4IUV A;  4PMB A;  1XPO A;  1L1O A;  4BWG B;  1K3R A;  5COR A;  3NTI A;  2MUY A;  1SRO A;  3GTL B;  4JOI A;  4DR3 Q;  3J7A F;  1IL8 A;  2F0U A;  2B2V A;  3RR5 A;  4GKJ Q;  4CKE A;  1K8M A;  1R4Q B;  4ABN A;  1G6P A;  2UXB Q;  1HUM A;  1QG7 A;  4NXM Q;  1X56 A;  1K9M C;  3OMG A;  4DR4 Q;  1VQN A;  1OXU A;  4RFB A;  4F8M A;  4DUZ L;  4IO9 A;  1LT5 D;  1LUZ A;  5G3L F;  3E9H A;  2I07 B;  1N32 Q;  4A3J G;  3HP3 A;  5ELB A;  1TQO A;  3R93 A;  4DUY L;  2LXJ A;  1Y1W B;  3CQZ H;  3STB C;  4KY7 A;  1SFO H;  2ZXP A;  1L0W A;  1Z7T A;  2CW0 C;  3GTM B;  3H0G H;  3CHB D;  1FYC A;  4R4O A;  4P2C B;  1H9M A;  4JI3 Q;  1TT2 A;  4LUV A;  3S1R H;  4DKA C;  1Y8O B;  1NBW A;  2D9U A;  2R61 A;  4OWT B;  2G5D A;  1RTO A;  1B9N A;  1F2Y A;  1QUQ A;  4MHE A;  1YI2 A;  1NR2 A;  3HOW B;  3VDY A;  1BQQ T;  2CCZ A;  3FKI G;  1HNZ L;  1MJE A;  4I65 A;  1GVP A;  3F8T A;  1PZJ D;  3AFP A;  3I70 A;  1IBK Q;  1KLU D;  1EUJ A;  2E74 C;  4HJ5 A;  5LL6 X;  5ELC A;  3RZO B;  4A3M G;  4OON A;  1G91 A;  1X65 A;  1NUC A;  3MZ5 A;  1STE A;  4UDU C;  5BN4 A;  4JOI C;  3GV6 A;  1HZC A;  4HJA A;  2M9V A;  4ODG A;  1WI5 A;  1W6K A;  2N3S A;  2Z4H A;  5AJ3 Q;  1JJ2 A;  4A3F B;  1I4X A;  3TZD A;  3I91 A;  2PCF B;  2BA0 A;  4OIJ A;  1P8L A;  3OWE B;  2PZW A;  1IKL A;  3MXU A;  5JPN C;  4Y7N B;  5CC4 A;  2CVR A;  3S15 B;  2KEC A;  3CPF A;  4J15 A;  5LHY 1;  4ZLT F;  1Q82 C;  4QIW B;  1DZ1 A;  1N8R C;  3KJO A;  3WWV A;  1YZ6 A;  2CW0 D;  2HDL A;  1PMR A;  5D14 A;  3RLF A;  2JP1 A;  2IX3 A;  2R93 B;  1SRU A;  4YY3 Q;  1TY2 A;  2MPM A;  1F2Z A;  1FNU A;  3G7L A;  2B8F A;  2RSN A;  1CK1 A;  2BDO A;  1PYW D;  1ZKO A;  2JA9 A;  1ICW A;  3CP0 A;  4XYO A;  1A3T A;  3S2H H;  5C3X A;  2UUC Q;  4Q5V A;  1YJ9 A;  4MTN A;  4PMW A;  4R4I A;  1GXD C;  5IGG A;  3W5O A;  1GHK A;  1VQK A;  4ILW A;  1WTR A;  4BY1 G;  4IUQ A;  1ILQ A;  1HNZ Q;  1O78 A;  4A93 H;  2L1B A;  4A3D B;  3S16 B;  1SEB D;  2XWB B;  3ZJY C;  4WFN 3;  2F0W A;  4ME5 A;  2KJX A;  2PQE A;  3UDX A;  2NVY B;  1LT6 D;  4FO2 A;  3AFQ A;  3K58 A;  1D5Z C;  1VQG A;  3CMA A;  1NJI C;  1SE2 A;  5C44 B;  1JQY D;  4EQP A;  1Q1E A;  3EVQ A;  3CPW A;  1A62 A;  4FYD A;  5E3F A;  3T53 B;  3W1B A;  4DR1 L;  4QL5 A;  2NVQ H;  2PW7 A;  2YTV A;  4X3S A;  2ATW A;  2EY6 A;  3I72 A;  3PO3 B;  1D8L A;  4RGN A;  4DR2 L;  3ERO A;  2UU9 Q;  2JA8 H;  3KOJ A;  4KMU C;  1SE4 A;  5IYD H;  3NK9 A;  4FP5 D;  1SYG A;  1AFP A;  1CFM A;  2A6H D;  4YCV A;  2X6L A;  1ASY A;  2K5N A;  1ASZ A;  4LJZ C;  1G29 1;  1L0X B;  4LF6 Q;  3DHQ A;  2ZT9 C;  4OEM B;  2OCE A;  1VMP A;  2JA7 B;  1W6J A;  1LLR D;  3WOE A;  1XXG A;  3SE0 A;  3J80 L;  1D5X C;  1EY7 A;  2PMZ E;  1WFQ A;  2NN6 I;  4X6A H;  4IFD J;  5J22 A;  3S2H B;  3F1Z A;  4LWC A;  3VA5 A;  2XIW A;  1KD1 C;  4L5R C;  1KL9 A;  3J81 j;  4DV5 L;  2YTY A;  1VQ7 A;  3MEF A;  1G6Z A;  1A6X A;  2MNA A;  4GOP A;  4DV2 Q;  4KD4 A;  1KIX A;  1STA A;  4KHZ A;  2DY8 A;  1AE3 A;  2FHT A;  1SJH D;  2WKC A;  4ME3 A;  3CCS A;  1F9S A;  2NZ1 D;  4R4C A;  1IBM Q;  2IT1 A;  2Z6B A;  3AU7 A;  3K59 A;  1STH A;  4S3S A;  1LTR D;  1QOH A;  4GS3 A;  2KVM A;  2AUK A;  5ISR A;  1R4P B;  1DOL A;  3GO5 A;  4HIK A;  4HJ9 A;  1TWG B;  3HOW G;  2YV5 A;  5D3I B;  4U68 A;  3BDC A;  4B3R L;  4BS9 A;  4BY1 H;  3HOY G;  3KUP A;  2PZU A;  3P20 A;  2C9O A;  1C48 A;  1SNC A;  1HR0 W;  1SDF A;  3S9W A;  4O2D A;  5DAU A;  5K5P A;  1UAP A;  1K0S A;  5FKA C;  1VMC A;  4HTH A;  1NCV A;  4NW2 A;  1IKM A;  3Q0A A;  5EKK A;  2VZA A;  2NZH A;  1TKW B;  1YEZ A;  2K5V A;  5H1S E;  3F2U A;  2KOL A;  4LUO A;  2EY5 A;  2X69 A;  4DV1 L;  4JI4 L;  3I55 A;  1PA6 A;  3OPO A;  3IFT A;  1U5K A;  1RKN A;  3HS0 C;  4A3C G;  2D5D A;  3K81 C;  1SR3 A;  4B9X A;  2PZT A;  5M5X B;  3GTK B;  2UXD L;  4GOP C;  4LUZ A;  3L2P A;  1KTK A;  2QEJ C;  4DUZ Q;  1ILP A;  1XNQ Q;  3I4M G;  2ZXO A;  2EPB A;  3JAM c;  1Q7Y C;  1P16 A;  4UHV A;  1XNR Q;  2Q8R E;  5C44 H;  4JI0 Q;  2A6E C;  5JEA H;  4DUY Q;  5TSS A;  1KC8 C;  2IHE A;  3M7G A;  3J81 c;  1LV9 A;  5M5X H;  4KJO A;  2EYO A;  2EXZ A;  1ZYR C;  1QNK A;  2ALY B;  3GTJ B;  5HUR A;  2RKS A;  2EYL A;  5AJ3 L;  2FIN B;  4RAU C;  1LTL A;  3A8J E;  3URY A;  1NY4 A;  4C3I H;  3SVM A;  5M3M B;  1JE4 A;  1SNO A;  3WDN A;  1SND A;  3R2T A;  4R8I A;  1H9K A;  3Q22 A;  2K5W A;  5I2Y A;  2EYH A;  5KYL A;  3PF4 A;  1GUT A;  4B3T L;  1Z47 A;  3FPP A;  3LWE A;  5COY A;  1SFO B;  4A3K H;  3E3X A;  3PIO A;  3GTJ H;  2F3W A;  4RHR A;  2DNE A;  4RKL A;  4DR5 L;  2QGQ A;  3KFU A;  2PI2 E;  1PFB A;  3E6Z X;  5CR3 A;  3HFZ B;  3KLR A;  5JJL A;  1RTN A;  3PIP 3;  3NWS A;  3J7A V;  2WAC A;  5JAV A;  2DJF C;  2VQF Q;  4LF5 Q;  5EBC A;  3LGJ A;  2YU9 B;  3J7A 5;  2VL6 A;  2TSS A;  2PW5 A;  4LFB Q;  5BR8 L;  1F9Q A;  2TMP A;  2EDG A;  4M8A A;  1GM5 A;  4HCS A;  4G57 A;  1CKN A;  1HFG A;  3EN2 A;  1C7Y A;  2R3Z A;  4ZUI A;  1L1O B;  1N36 L;  3S2D H;  5M3F H;  3NUC A;  1SNQ A;  2B39 A;  1A0I A;  1PTO C;  1K8G A;  1B4O A;  5DLQ E;  4FXD A;  1V1P A;  5KYI A;  4APV A;  1F2M A;  1N9W A;  1H95 A;  1VCI A;  4JI5 Q;  2F4V Q;  5EJW A;  1VQM A;  3K7U C;  1G51 A;  1XMQ L;  3TN2 A;  3PO2 H;  2JA6 G;  4ZUJ A;  2B2Y C;  1CI3 M;  3W3A A;  3CRK C;  4WJW A;  1FVI A;  2AUJ D;  2Z9H A;  4F7X A;  2SNS A;  5M3M G;  4DF7 A;  3A56 A;  1JB7 A;  1YNN C;  1BR9 A;  2MGS A;  3SK5 A;  5C3E H;  2NN6 G;  2B2U C;  3MWY W;  1I4H A;  1Y1V G;  1JOK A;  1CQF A;  1VQF A;  3CRL C;  4KY6 A;  2XRQ D;  4JI6 Q;  3OSO A;  2Z4I A;  1BNZ A;  4GZY C;  2O2L D;  1B70 B;  1O7Y A;  3G48 A;  3NHH A;  4FNF A;  4A3D G;  4OGQ C;  1T5E A;  4X66 L;  5C4J B;  1WTO A;  4RWS C;  4ZRZ A;  1MBY A;  2UXD Q;  4L6T B;  4LF5 L;  2K04 A;  3BDL A;  4K8J A;  4EVO A;  1V1O A;  1LAC A;  3WOF A;  4A93 G;  1KLG D;  1YJN A;  3C46 A;  2F0T A;  5C5M A;  5C44 G;  4LNQ A;  5J39 A;  4HJ7 A;  3PCO B;  2L9H A;  2CQO A;  4QCL A;  4GN3 B;  3L9A X;  1EQT A;  4RA8 A;  2D0P A;  4JI6 L;  1PH3 A;  1DON A;  1EY5 A;  4B08 A;  4LK1 C;  1X32 A;  4K6D A;  3GTQ B;  5EBD A;  4UP7 A;  4DA2 A;  3C1E A;  1SXT A;  4JPB W;  4C3I G;  1E24 A;  2P5Z X;  2KCM A;  4TVA B;  1PHJ A;  1MSG A;  1AP0 A;  3QB3 A;  3M9B A;  2LMC B;  5A2Q L;  4P75 A;  3X3N A;  2CFM A;  4LFA L;  4V19 0;  4IOA A;  4XIG S;  3T16 A;  2I46 A;  2F1M A;  1PFS A;  2CHB D;  4P73 A;  1PZK D;  5KNB A;  3HOY H;  5KGU A;  4G7H C;  5A35 A;  4QF4 A;  3PSI A;  3FP9 A;  2JA7 G;  3EFX D;  4TRD A;  1L0Y B;  2E2H H;  4KY5 A;  4CJ0 B;  3PUZ A;  1OXS C;  1YBY A;  3NTH A;  1YVC A;  5FK9 C;  1I4G A;  2A5H A;  3N6R A;  3H3V H;  1GUS A;  1K8O A;  5C4Z A;  4X65 Q;  3HKZ G;  3MAQ A;  2QA4 A;  3PMF A;  1M4V A;  3OIQ A;  1SAP A;  4A4I A;  3A74 A;  3HOX H;  2F0M A;  2VY3 A;  3T51 B;  4C3J G;  2JA5 G;  4JI2 Q;  4B3S L;  1ET6 A;  2PNH A;  1EZ8 A;  1HZB A;  5G3L D;  2QIL A;  4CJ2 C;  3BVG A;  3T56 B;  4X64 Q;  4LFC Q;  2O5J C;  4BY7 G;  2AQ2 B;  3HEJ A;  4X3U A;  1VDZ A;  3MXG A;  1CZW A;  2HD3 A;  1XPU A;  1QCB D;  2A6H C;  4EQN A;  2NTS A;  2ENB A;  3G71 A;  4E6I A;  4ALP A;  1XNQ L;  1TWA H;  4DR7 Q;  1QVF A;  2F0Q A;  1I3Q B;  5ELN A;  3OMC A;  1L2F A;  5C3E B;  4XQN A;  5KND A;  1J5E L;  1AZP A;  3OYY A;  1UUP A;  3F2D A;  5JOB A;  4DAY B;  4OHJ A;  1U4R A;  2EQS A;  4PV1 C;  4DV7 Q;  3RN2 A;  1V1P B;  1HQM C;  1MD2 D;  4HSV A;  3VR3 A;  1GD7 A;  2WKD A;  3OWF A;  1EL0 A;  3BS1 A;  1JMC A;  1RJT A;  5I2X A;  1D2B A;  3D8G A;  3DXJ C;  2K28 A;  2HT1 A;  4QQB X;  5GQO A;  4RGO S;  2F0P A;  5JEA G;  3I73 A;  1EQQ A;  4JVZ A;  4DK0 A;  3J81 E;  1IBL Q;  1CKM A;  2KCT A;  4KHV A;  1R9T H;  4DR6 L;  4PZ7 A;  4CDF C;  3NQI A;  3I4M B;  1CHP D;  3AMU A;  1KRS A;  2VNU D;  1TS3 A;  4GN5 A;  3U50 C;  1N34 Q;  3PV0 A;  1PTO H;  4IAL A;  4C3J B;  2JA5 B;  1QWY A;  2JEA I;  2EZV A;  2BCO A;  3S1N B;  4L5T A;  4IUU A;  3S17 B;  4CBV A;  1SYE A;  3ERQ A;  2VQE Q;  1B44 D;  4DV2 L;  5LMN W;  4RCN A;  3A5Z B;  3GD7 A;  3VYR A;  3H91 A;  5KEE A;  5ELD A;  1PH4 A;  4LFA Q;  1VQJ A;  2NYZ D;  4HID A;  3HRZ C;  3T4A C;  4QY7 A;  5C0X J;  4C3H G;  1F2L A;  4B3M Q;  2KUM A;  3S2D B;  1CSQ A;  1TWF H;  2CWA A;  3CCR A;  1MJC A;  4GKK Q;  2J0T D;  1CZG A;  3S15 H;  3AQQ A;  2UXB L;  2ZTD A;  5M3F B;  3W1G A;  4DV0 Q;  1PH9 A;  2E75 C;  2IX0 A;  1UWV A;  4IUT A;  2JYO A;  1EYC A;  1WCM G;  3NEL A;  4QJF A;  3H15 A;  4YY3 L;  3NSW A;  5I9P A;  2F0L A;  1EY0 A;  1NNX A;  2YTX A;  1JWS D;  3S14 H;  1EY8 A;  4GOP B;  3GTL H;  4HIO A;  4IPD A;  1CKN B;  3GTG H;  3KLW A;  4DV0 L;  2RA4 A;  1HUN A;  1SYB A;  3NBI A;  4NB3 A;  1BBW A;  1HZ9 A;  2B29 A;  5IP7 G;  1EYA A;  2EY1 A;  4HN7 A;  3P1H A;  2PQA B;  3V2T A;  1UE6 A;  1Y14 B;  2LSS A;  1FGB D;  2K7V A;  3TQY A;  1JT8 A;  3TP8 A;  1MGS A;  2JE6 I;  1SBB B;  1VS0 A;  2B3G A;  4JI1 L;  3PIP A;  3HKZ B;  1Y1W H;  3GTG B;  2ZM6 Q;  1XWE A;  3MXN A;  1B9M A;  5E7N A;  1WD0 A;  4C3H H;  4JI7 L;  2JJQ A;  2IX1 A;  4A76 A;  5CYU A;  1IYJ B;  1VQE A;  4LMQ D;  3VR6 A;  5IYB H;  1STN A;  4A3F G;  1FR3 A;  2JA6 H;  2CH4 A;  4RKB A;  1EEF D;  3E0E A;  1Q12 A;  2N8N A;  3Q6S A;  1I50 H;  3E5S A;  4LFB L;  4WJ3 M;  4IUN A;  1CTM A;  1E2Z A;  1GO3 E;  4A3G B;  2OXP A;  4UAI A;  1TR5 A;  1YNN D;  4ZQ3 A;  1STB A;  2ICI A;  3HGB A;  3ICE A;  3CCE A;  2DNC A;  3I4M H;  5IWA L;  3QG1 A;  3QR8 A;  1MKH A;  4LF9 L;  1A2T A;  1BO0 A;  3CC7 A;  3CF5 A;  1VQD A;  2Z1C A;  2WII B;  4LF8 Q;  1Q81 C;  3FRP B;  3SK6 A;  1W3S A;  1YHA A;  1XMQ Q;  4HMI A;  3TS2 A;  4OO1 I;  4KJN A;  3O13 A;  4HAE A;  1UEA B;  4TSS A;  2ASB A;  1J8I A;  4CDC C;  1FJG Q;  1PTO D;  4K2K A;  4PZ8 A;  4N9T A;  4UPA A;  1LTT D;  1IBK L;  5LMN L;  4F88 A;  1HH2 P;  3I56 A;  4BY1 B;  3R3O A;  5JPM C;  2FMC A;  2F0O A;  3OTO L;  2OF1 A;  2A68 C;  1SYD A;  3GTM H;  2Z6K C;  2AQ1 B;  1ML0 D;  1AN8 A;  3M4P A;  3SGI A;  4PMC A;  3OW2 A;  1N33 Q;  4DV4 L;  5ELF A;  4R1J A;  3K0X A;  1Y1W G;  3KYH C;  2F0E A;  5CV7 A;  5FLX L;  3T1Y L;  3KF8 A;  3T1Y Q;  4C1N I;  3JC6 6;  5IT9 c;  1O7Z A;  2GN5 A;  2FFK B;  1OXX K;  1LTG D;  1SJE D;  5JVH 3;  2R92 G;  1N32 L;  1OO9 B;  4J8Q A;  1PYS B;  1SYC A;  2H5X A;  4KI0 A;  4B3S Q;  5IY0 A;  2UXC L;  4G7Z C;  2F0H A;  5FO8 B;  1ESF A;  4BY7 H;  2JSO A;  3C1F A;  4L8J A;  4GKJ L;  4H0L C;  2ID0 A;  4A3M B;  1Q3L A;  1KAA A;  2PI2 A;  4CHT B;  3I2Z A;  1ZYR D;  5IGD A;  4XQJ A;  3D4R A;  4WOR A;  3LNN A;  1EOT A;  3TS0 A;  1SMY D;  2OTL A;  4LF4 L;  5IP9 H;  4A3E G;  2E2J B;  1FD7 D;  2RCF A;  2EYF A;  4BXX G;  1S5C D;  4FF2 A;  1GHJ A;  1QZH A;  2E8G A;  2A6E D;  1X3P A;  1GOZ A;  3TP7 A;  5E1F A;  3BVZ A;  4CJ1 B;  1PH7 A;  1RHP A;  4GLV B;  4ZCK A;  3KF6 B;  2EE1 A;  2Z6K A;  4DNI A;  2MP1 A;  2OT2 A;  1XYI A;  5C3E G;  4HCE A;  1DCZ A;  1EYD A;  2VW9 A;  1R9T B;  2EOT A;  4R9W A;  5CGK A;  2E2J H;  2WP8 J;  4CDD C;  3A7A B;  4FXG C;  4XXE A;  1WYD A;  2WFW A;  4IOC A;  4DN4 M;  3PQI A;  4J1M A;  5DEH A;  4GNX B;  3J81 i;  1DM0 B;  1EWI A;  2PNR C;  2E5L Q;  1PTO F;  1D7Q A;  4G7O C;  3NXW A;  1WJJ A;  1QVC A;  2H1E A;  2OEO A;  3C2P A;  3IFD A;  3D6W A;  1JB3 A;  5KIX A;  1HTL D;  1SE8 A;  2B2T A;  4IPH A;  1BCP C;  1I4P A;  4CKB A;  4DXF A;  5DM7 3;  2ZTE A;  2R92 B;  3BZK A;  5CV4 A;  2R7F A;  5CBE E;  2UUA L;  2B63 B;  1M1K C;  2NN6 H;  2ZJP A;  4JBM A;  1KAW A;  2I5M X;  3UDF A;  3A7L A;  3KF6 A;  2XWJ B;  3U4Z A;  1E7Z A;  4B3R Q;  3SXH A;  1WTV A;  5M5W B;  5LMU Q;  1HPC A;  3HOY B;  4MTK A;  2HHH Q;  1EQV A;  4JC0 A;  3KF8 B;  2D2C C;  2D0O A;  1IW7 D;  3CW2 C;  4BBS G;  1ENA A;  1X9N A;  3A8K E;  1E1O A;  3VR5 A;  3HOV G;  4LW1 A;  2UUB Q;  1Z9F A;  4GLA C;  4BBR B;  4LAA A;  2C5C A;  4JI0 L;  1EIG A;  1ROD A;  1PTO B;  4C3J H;  1QE6 A;  4DK1 A;  3NTK A;  2JA5 H;  4A3M H;  2K01 A;  3V05 A;  2R7Z G;  5GAH C;  4OEL B;  4M1U B;  4ZK9 B;  2CQA A;  4JI1 Q;  4A3G G;  4L5Q A;  1BDO A;  2GVB A;  4LFC L;  2LKV A;  2VS1 A;  1TWG H;  3VA7 A;  4A3B H;  1KDA A;  1JOO A;  4WRD A;  3BJU A;  3VYT A;  4TKO B;  4C56 C;  5IYC G;  3CCV A;  4POF A;  2PQA A;  1IBM L;  4KKT A;  3KDF B;  1J9O A;  2XRS D;  4J6H A;  3GTP H;  2QF7 A;  5EAY A;  3VYS A;  2BH2 A;  3TRZ A;  1BBX C;  5IP7 H;  4RGM A;  4H13 C;  1GUW A;  4TQU S;  2VB3 X;  1BF4 A;  2NVX B;  5C4X B;  4FDB A;  1AW7 A;  3GQB A;  3L3O C;  5I4D A;  1Y1V B;  4DV1 Q;  4JI4 Q;  4Y7N H;  4X64 L;  2HIX A;  4KV6 A;  3CKI B;  2F0F A;  1DOM A;  3RMH A;  4N8X 1;  3H3V I;  4OO1 G;  3L0O A;  1VQA A;  4H02 A;  5C0X I;  2JK8 A;  5E4X A;  2EXD A;  3S1R B;  3S1Q H;  1RL2 A;  1IBL L;  1E0B A;  2ES2 A;  1ESR A;  4BA2 I;  2Z8L A; 
#chains in the Genus database with same CATH homology
 2VY3 A;  3S1M H;  4A3M G;  2C35 B;  4OON A;  4DK3 C;  2MO0 A;  2JA5 G;  1X65 A;  2JEB I;  4JI2 Q;  4BA1 I;  4BBR G;  4B3S L;  4GN4 B;  4JI2 L;  2PNH A;  1CKO A;  2Q2I A;  4JOI C;  1HZB A;  3J80 c;  4HJA A;  1HZC A;  1BVS A;  1I3Q H;  2ZTC A;  4X64 Q;  1S72 A;  4POG A;  4LFC Q;  1WI5 A;  1PYB A;  1TWC H;  4JI8 Q;  4YHH Q;  2FXQ A;  1UE1 A;  2N3S A;  4YHH L;  5AJ3 Q;  4HIM A;  1JJ2 A;  2A8V A;  4BY7 G;  3E9I A;  1YIT A;  2I0Q A;  2BA0 A;  4JI7 Q;  3S16 H;  3CC4 A;  1P8L A;  1VQH A;  2K75 A;  1XPU A;  2EIF A;  2CWP A;  3NEM A;  3G71 A;  4ALP A;  1XNQ L;  1TWA H;  4DR7 Q;  1OTC A;  1WCM H;  1X55 A;  4P72 A;  1QVF A;  5ELN A;  4A3J H;  1Q82 C;  1VQC A;  3CPF A;  2N78 A;  4J15 A;  1L2F A;  4YCW A;  3PO3 G;  1N8R C;  3KJO A;  1J5E L;  2UUB L;  3WWV A;  3OYY A;  1YZ6 A;  3RLF A;  1V9P A;  3F2D A;  1PH1 A;  4DAY B;  4EQ5 A;  1UE7 A;  2EQS A;  1SRU A;  4DV7 Q;  3RN2 A;  4YY3 Q;  2BH8 A;  1N33 L;  2F4V L;  2I5L X;  1GD7 A;  2UUA Q;  3H0G G;  1RIP A;  4WJ4 A;  4AQY Q;  1JMC A;  4JBK A;  3AEV A;  2KEN A;  2MQH A;  2ZM6 L;  2CKZ B;  2JA9 A;  3CP0 A;  4GKK L;  3RZO H;  1HNX L;  4A3E H;  3S2H H;  2UUC Q;  1YJ9 A;  2HT1 A;  3GTQ H;  4QQB X;  4MTN A;  1X3E A;  1SN8 A;  4R4I A;  5GQO A;  4PMW A;  4A75 A;  3PO2 G;  3KDF A;  4LF7 Q;  1B8A A;  2DGY A;  3W5O A;  5JEA G;  1EQQ A;  1VQK A;  1JJG A;  2R7D A;  3PUW A;  4BY1 G;  4DPG A;  5FJ8 G;  1XNR L;  1O7I A;  2A1A A;  1IBL Q;  1OXT A;  1CKM A;  2KCT A;  1HNZ Q;  4BBS H;  4YCU A;  3DLL A;  5IWA Q;  1R9T H;  4A93 H;  4DV3 L;  3CCM A;  2YU9 H;  4DR6 L;  4PZ7 A;  2K52 A;  2GVA A;  1EIF A;  3HOY G;  1FGU A;  1KRS A;  2MFI A;  3ZJY C;  2Q2H A;  3RNU A;  4BBR H;  2VNU D;  4GN5 A;  4A3B G;  4O0A A;  4YWK A;  1YIJ A;  3U50 C;  3UDX A;  1N34 Q;  3PV0 A;  5FLM H;  1YHQ A;  2JEA I;  3AFQ A;  4HJ8 A;  1C9O A;  1K83 H;  3S24 A;  4L5T A;  2Q2U A;  3PUY A;  1VQG A;  2RF4 A;  3STB D;  3CMA A;  1NJI C;  5C0X G;  4IJH A;  1KQS A;  5IP9 G;  2NZO A;  1Q1E A;  3CPW A;  2VQE Q;  1A62 A;  2WB1 E;  2NVT H;  4IJL A;  3GDE A;  3M4O H;  3HOZ H;  4AYB G;  3EIV A;  4DV2 L;  5LMN W;  3W1B A;  1YJW A;  1T9H A;  4DR1 L;  1VQ8 A;  1X54 A;  2KBN A;  4QL5 A;  3A5Z B;  5GAG C;  3U58 A;  4OX9 L;  3GD7 A;  2NVQ H;  2OQ0 A;  3ULJ A;  3UDG A;  2YTV A;  1PH4 A;  5GAE C;  2ATW A;  4LFA Q;  1KXL A;  2IY5 B;  1D8L A;  1N34 L;  1VQJ A;  4DR2 L;  2JA8 H;  2UU9 Q;  3KOJ A;  4C2M H;  4HID A;  1L1O C;  4QY7 A;  5C0X J;  5IYD H;  2KHJ A;  3F2C A;  3TEH B;  1HR0 Q;  2UXC Q;  1GKH A;  4B3M Q;  4P71 A;  1CSQ A;  1TWF H;  2CWA A;  4YCV A;  3CCQ A;  3CCR A;  1MJC A;  4GKK Q;  4NXN L;  3S15 H;  1QZG A;  3AQQ A;  4AYB E;  3ULP A;  2ZTD A;  1ASY A;  3CC2 A;  2UXB L;  2K5N A;  3W1G A;  3G6E A;  4DV0 Q;  1ASZ A;  4LF7 L;  3KJP A;  1G29 1;  4DV6 Q;  1PH8 A;  2E2I H;  5LMN Q;  3PO3 H;  4LF6 Q;  1PH9 A;  3F2B A;  2IX0 A;  1UWV A;  2NVY H;  4A3G H;  1QVG A;  1LYL A;  2OCE A;  1WCM G;  1W2B A;  2RHQ B;  3NEL A;  4JBJ A;  4QJF A;  5C4J H;  3H15 A;  2PMZ E;  4YY3 L;  1WFQ A;  5K36 G;  1PH2 A;  1KHI A;  2RCN A;  5ELO A;  1PH5 A;  2NN6 I;  4X6A H;  2VUM G;  4IFD J;  2YTX A;  1CUK A;  3S14 H;  3F1Z A;  4LWC A;  4GOP B;  1KD1 C;  3GTL H;  2AWN A;  4HIO A;  4IPD A;  3RN5 A;  4L5R C;  1KL9 A;  1HNX Q;  3J81 j;  4NXN Q;  4DV5 L;  1CKN B;  2YTY A;  1VQ7 A;  3GTG H;  4YWL A;  1VQI A;  3KLW A;  4DV0 L;  3MEF A;  5IYB G;  4X62 L;  2OWO A;  2MNA A;  4X62 Q;  3RLO A;  2HIV A;  4GOP A;  1XTD A;  4DV2 Q;  4NB3 A;  1KIX A;  1BBW A;  2AKW B;  4KHZ A;  2VQE L;  1AE3 A;  2B63 G;  2Z0S A;  1HZ9 A;  2B29 A;  4ME3 A;  3CCS A;  4R4C A;  5IP7 G;  1IBM Q;  2IT1 A;  4DAM A;  2PQA B;  3T1H Q;  4GS3 A;  3FKI H;  1UE6 A;  1Y14 B;  3OTO Q;  2LSS A;  3IRB A;  4UP8 A;  3TQY A;  1VQ9 A;  4IFD G;  1JT8 A;  3GO5 A;  2JE6 I;  4HIK A;  5IE8 A;  4HJ9 A;  3A5U A;  1JJC B;  3HOW G;  1VS0 A;  2YV5 A;  2B3G A;  2K4K A;  2YYZ A;  2AMC B;  1HZA A;  4JI1 L;  3PIP A;  4DR3 L;  4BY1 H;  1Y1W H;  3ER0 A;  3UDI A;  5M5Y H;  4B3R L;  2ZM6 Q;  2Y0S E;  1K8A C;  5E7N A;  1E3P A;  2ZJQ A;  4C3H H;  3I7F A;  4JI3 L;  4AQY L;  2JJQ A;  4KLK A;  1EUJ A;  1E22 A;  5HY6 A;  4JI7 L;  4KHP Q;  2IX1 A;  5JJI A;  4A3I H;  1A8V A;  3K8A A;  4DV5 Q;  1HR0 W;  1U0L A;  4A76 A;  1V43 A;  2E5L L;  1IYJ B;  1VQE A;  4O2D A;  5IYB H;  3J7Z C;  2ZJR A;  4A3F G;  4A3F H;  1VQ5 A;  2I5H A;  2JA6 H;  1I94 Q;  4DV6 L;  2R93 G;  1FL0 A;  3E0E A;  1Q12 A;  2F3I A;  2N8N A;  1I50 H;  4LFB L;  3D0F A;  2DUD A;  4WJ3 M;  1QUQ B;  1GO3 E;  1X3F A;  1UEB A;  2BA1 A;  3ICE A;  3CCE A;  3I4M H;  4JG2 A;  2VZA A;  2NZH A;  5IWA L;  1YEZ A;  2K5V A;  3JAM i;  4DR2 Q;  3TRE A;  1NE3 A;  3HOW H;  1MKH A;  3CXC A;  1SLJ A;  4LF9 L;  5H1S E;  2AHO B;  3CC7 A;  4LUO A;  1XPR A;  3CF5 A;  4DV1 L;  4JI4 L;  1VQD A;  3I55 A;  1PA6 A;  4LF8 Q;  1Q46 A;  4R4Q A;  1Q81 C;  1EQR A;  1VQB A;  2KHI A;  1U5K A;  2R7Z H;  4A3C G;  1J6Q A;  3K81 C;  1W3S A;  1YHA A;  1SR3 A;  1XMQ Q;  3TS2 A;  4BXX H;  4JV5 L;  4OO1 I;  2HHH L;  4GOP C;  4LUZ A;  1HNW L;  3PGZ A;  3L2P A;  2UXD L;  3CAM A;  2ASB A;  1DGS A;  4DUZ Q;  1IZ6 A;  4LF4 Q;  1FJG Q;  1XNQ Q;  3I4M G;  5J3B A;  5C4X H;  3RZD H;  4RG1 A;  3JAM c;  2NVX H;  1Q1B A;  4PZ8 A;  3NEN A;  4UPA A;  5HGQ A;  1V1Q A;  2AWO A;  1P16 A;  1Q7Y C;  5LMN L;  1IBK L;  1XNR Q;  3PUX A;  5C44 H;  1HH2 P;  3I56 A;  3HOV H;  4JI0 Q;  5FJ8 H;  4DUY Q;  2Q2T A;  2XGT A;  5C4X G;  1XMO L;  3M7N A;  2D62 A;  3M3Y H;  3OTO L;  2JA8 G;  1K0R A;  5GRO A;  1KC8 C;  1BBU A;  4PG3 A;  4DR5 Q;  2IHE A;  1HJP A;  1LM0 A;  3J81 c;  3GTM H;  2Z6K C;  3DM3 A;  3PUV A;  2WAQ G;  2F52 A;  5M5X H;  4GLX A;  3OW2 A;  3M4P A;  4JBW A;  3SGI A;  5JJK A;  4B3M L;  3HKS A;  4DV4 L;  1N33 Q;  4A3D H;  3L7Z C;  4R1J A;  2ALY B;  4GNX C;  1M90 C;  3K0X A;  1JE5 A;  1Y1W G;  1YHB A;  5IYC H;  5AJ3 L;  4DR4 L;  3KYH C;  1LTL A;  4QIW E;  1NY4 A;  4AH6 A;  1EOV A;  2IHF A;  4C3I H;  1VQL A;  3T1Y L;  3T1Y Q;  2WB1 G;  3JC6 6;  3J80 i;  3K7A H;  1PVO A;  1BKB A;  4JYA L;  1UE5 A;  2HQL A;  5IT9 c;  2GN5 A;  5BR8 Q;  4IFD I;  1Q86 C;  1OXX K;  3I4N H;  3D31 A;  4A3L H;  2R92 G;  1N32 L;  3PF4 A;  1TXY A;  5M3M H;  1PYS B;  4B3T L;  2R93 H;  4B3T Q;  1Z47 A;  4OXP A;  3BZC A;  2H5X A;  4KI0 A;  4DV3 Q;  2UU9 L;  4B3S Q;  4A3K H;  5IY0 A;  3CCU A;  4NPS A;  1XMO Q;  2MO1 A;  3PIO A;  3PF5 A;  3GTJ H;  3G4S A;  2L15 A;  1HR0 L;  2UXC L;  1E1T A;  4DR5 L;  3KFU A;  2QGQ A;  3UE1 A;  2PI2 E;  4BY7 H;  3CCJ A;  3HOU H;  1VQO A;  4LF8 L;  3HFZ B;  4GKJ L;  1TWH H;  5JJL A;  4JI8 L;  5JEA J;  4KHP L;  2ID0 A;  4MNO A;  2PI2 A;  2VUM H;  3I2Z A;  1EIY B;  2VQF Q;  4LF5 Q;  1HNW Q;  3LGJ A;  1VQ4 A;  3HOZ G;  1XJV A;  3TS0 A;  2OTL A;  3J7A 5;  4LF4 L;  1FJG L;  2VL6 A;  3A0J A;  1A63 A;  5IP9 H;  4A3E G;  4DR7 L;  3CCL A;  4LFB Q;  4A3C H;  5BR8 L;  5M3F G;  3NBH B;  4BXX G;  3HOX G;  4HJ5 A;  2K50 A;  4JYA Q;  1GM5 A;  3S17 H;  1QZH A;  2E8G A;  2JQO A;  5GAD C;  1CKN A;  3EN2 A;  1C7Y A;  1N36 L;  3S2D H;  1L1O B;  4OX9 Q;  4Y52 H;  1PV4 A;  4YWM A;  3T1H L;  1PH7 A;  5M3F H;  1N36 Q;  4GLV B;  1MIU A;  1A0I A;  1Y1V H;  3KF6 B;  2QEX A;  2Z6K A;  1K8G A;  5DLQ E;  4DNI A;  3M85 A;  2K5H A;  3FHW A;  4APV A;  5C3E G;  1N9W A;  4UY8 C;  2OQK A;  1H95 A;  3GTO H;  1VCI A;  2VW9 A;  4GNX A;  4AIM A;  4JI5 Q;  2Y0S G;  1IXR A;  3U4V A;  2F4V Q;  1VQM A;  3K7U C;  1G51 A;  1XMQ L;  2E2J H;  2JA7 H;  2WP8 J;  4NXM L;  4JV5 Q;  4K0K L;  2LXK A;  1VQP A;  3PO2 H;  1WYD A;  2WFW A;  2JA6 G;  1NMF A;  4IOC A;  2K14 A;  1WOC A;  4IPC A;  3UE0 A;  4GNX B;  3J81 i;  2UUC L;  1EWI A;  1KRT A;  3M4Q A;  2E5L Q;  3EBE A;  4A3I G;  4JCV E;  4IPG A;  1FVI A;  1D7Q A;  2R92 H;  1WJJ A;  1QVC A;  4OWX B;  3I4N G;  5M3M G;  4OWW B;  1SMX A;  3BU2 A;  1JB7 A;  4A3L G;  1SE8 A;  4IPH A;  4P74 A;  5C3E H;  2NN6 G;  3S1N H;  2N49 A;  4UP9 A;  1VQ6 A;  1I6H H;  2ZTE A;  1S3O A;  1Y1V G;  1IL2 A;  4DR6 Q;  1VQF A;  3BZK A;  2A19 A;  4JI6 Q;  1X6O A;  2R7F A;  2UUA L;  3B6Y A;  3CD6 A;  1M1K C;  1B70 B;  2ZJP A;  4JBM A;  1KAW A;  2I5M X;  3UDF A;  1X3G A;  3G48 A;  3KF6 A;  1PH6 A;  3U4Z A;  1E7Z A;  2WAQ E;  4QGU A;  4A3D G;  4K0K Q;  4B3R Q;  5FLX c;  4JI5 L;  5FLM G;  4XTC S;  4X66 L;  2VQF L;  4L5S A;  3GTK H;  5LMU Q;  3RLN A;  2HHH Q;  3I4O A;  2UXD Q;  4JC0 A;  1EYG A;  3KF8 B;  4LF5 L;  2D0O A;  3MXN B;  4MZ9 A;  3CW2 C;  4BBS G;  3ERS X;  1X9N A;  4A93 G;  1C0A A;  1E1O A;  4X65 L;  1YJN A;  3HOV G;  3Q8D A;  4LW1 A;  5C44 G;  1J5E Q;  1OXV A;  2UUB Q;  4LNQ A;  4HJ7 A;  1Z9F A;  3PCO B;  1AE2 A;  2CQO A;  4GLA C;  3ULL A;  4GN3 B;  4EX5 A;  1K73 C;  1XPO A;  1L1O A;  4JI0 L;  1K3R A;  2D0P A;  2V1C C;  4A3K G;  4JI6 L;  4C3J H;  2XTI A;  2JA5 H;  1PH3 A;  4A3M H;  1SRO A;  4R4T A;  2R7Z G;  5GAH C;  4JOI A;  4JI1 Q;  1NTG A;  4DR3 Q;  4L5Q A;  4A3G G;  2GVB A;  3RR5 A;  4GKJ Q;  4LFC L;  2VS1 A;  4UP7 A;  2OTJ A;  1TWG H;  1G6P A;  2UXB Q;  4A3B H;  4NXM Q;  1X56 A;  4DK6 C;  3BJU A;  1K9M C;  4DR4 Q;  1E24 A;  5IYC G;  4POF A;  2PQA A;  3CCV A;  1VQN A;  1OXU A;  1B7Y B;  2KCM A;  4DUZ L;  4DR1 Q;  1IBM L;  3KDF B;  4TVA B;  1PHJ A;  4IO9 A;  1LUZ A;  1EFW A;  3GTP H;  5EAY A;  3M9B A;  3E9H A;  2BH2 A;  3TRZ A;  1I5F A;  4P75 A;  5IP7 H;  1N32 Q;  3HOU G;  4A3J G;  1Q8K A;  5M5W H;  2CFM A;  2RHS B;  4DUY L;  5IYD G;  4PZ6 A;  2LXJ A;  4LFA L;  4IOA A;  4XIG S;  4DV7 L;  4TQU S;  3CQZ H;  4FDB A;  4LF9 Q;  1PFS A;  1CSP A;  3STB C;  4P73 A;  1SFO H;  4DV1 Q;  4JI4 Q;  3HOY H;  4Y7N H;  1L0W A;  4X64 L;  4RMF A;  2HIX A;  3PSI A;  3FP9 A;  2JA7 G;  3AYH B;  3H0G H;  4DV4 Q;  2E2H H;  1AH9 A;  4R4O A;  4JI3 Q;  4LUV A;  1YNX A;  3PUZ A;  5LMU L;  4DKA C;  3S1R H;  1S40 A;  3K80 C;  1NBW A;  4X66 Q;  3H3V I;  4OO1 G;  1OXS C;  1YBY A;  3L0O A;  4OWT B;  1VQA A;  1YVC A;  4H02 A;  1QUQ A;  5C0X I;  1YI2 A;  1I94 L;  2JK8 A;  3H3V H;  4LF6 L;  3VDY A;  2CCZ A;  3FKI G;  2EXD A;  1HNZ L;  2R6G A;  4X65 Q;  3HKZ G;  2QA4 A;  1MJE A;  1RL2 A;  3CME A;  1IBL L;  3S1Q H;  1GVP A;  3F8T A;  2ES2 A;  3AFP A;  2B63 H;  4BA2 I;  4A4I A;  1IBK Q;  3A74 A;  3HOX H;  3HKZ E;  1NMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...