2UXCL

Crystal structure of an extended trna anticodon stem loop in complex with its cognate mrna ucgu in the context of the thermus thermophilus 30s subunit.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Structures of Trnas with an Expanded Anticodon Loop in the Decoding Center of the 30S Ribosomal Subunit.
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uxcL00
1XPOA 3J7A5 3HOVG 2GVAA 1SR3A 1CKMA 2YU9H 2AMCB 4IJLA 1CKNA 2N78A 5BR8Q 3W1GA 3STBC 5IYCH 5LMNQ 1Y1WG 1L2FA 1VQ6A 2K5NA 4R4QA 4AYBG 4YY3Q 3PV0A 1X3FA 4DUZL 1HZCA 2ID0A 3JC66 5GAHC 2OTJA 3E9IA 1K8AC 3I4NG 1X6OA 4JBKA 4A3GH 3TQYA 4OX9L 1N33Q 1AE2A 1E3PA 1IZ6A 4P75A 1JJ2A 4JI7Q 4DR6L 3CC4A 1YVCA 5AJ3Q 5JEAG 4A3BH 5GROA 4EQ5A 4R1JA 2ZJPA 5C0XJ 5M3FG 4LNQA 1RIPA 1AE3A 1LTLA 1TWCH 4GLAC 1S3OA 4LFCL 4WJ3M 4LFAL 4NXML 2R93G 1XNQQ 1KXLA 1UWVA 4DR5Q 2PQAB 1E1TA 2R7FA 4KLKA 3RN5A 2ES2A 2AHOB 2HIVA 1VQFA 1ASZA 3CCLA 3HOVH 4GN5A 3GTJH 3CC7A 3CMAA 2MQHA 1BVSA 1BBUA 4DAYB 3OTOL 4JBWA 1Y1WH 4L5RC 2BH2A 2VNUD 2PQAA 4X6AH 2NVXH 3TRZA 1PH6A 3KJPA 2K52A 4DAMA 1IYJB 1NBWA 1BBWA 1V43A 4PG3A 4P71A 4B3MQ 3U4ZA 1S72A 4LF6L 3I4NH 1X3GA 4GOPB 4IJHA 2VL6A 4A3MG 5HGQA 4OONA 3S1RH 2ATWA 1B8AA 3M3YH 1HNXL 3S1NH 4YWKA 1SROA 3H3VH 2Z6KA 1VQ7A 4H02A 4OWXB 4A3FG 4DR7Q 1M1KC 3PCOB 4JV5L 3K7AH 5M3FH 2YYZA 4A3DG 4GOPA 1DGSA 1OXXK 2R7DA 4KHZA 2R92G 2LXJA 4A4IA 2R93H 3UDIA 2HIXA 1W3SA 2Z6KC 3K8AA 4HIMA 1PH4A 2E2IH 4IFDJ 1J5EL 2NZHA 4JOIC 1I6HH 3HFZB 2QEXA 2GN5A 3CD6A 1N34L 3ULLA 1H95A 3F8TA 3A0JA 3S17H 1TXYA 2ZTDA 4POGA 1IL2A 1E22A 1VQOA 2IX1A 3BJUA 1JT8A 5M5YH 4OX9Q 3J81j 3GTKH 2NVYH 4DR6Q 2AKWB 2HQLA 1VQGA 4PZ6A 3T1HQ 1KHIA 4DV7L 4PMWA 1TWGH 1UE7A 3HOYG 2RHSB 4P74A 2Q2HA 1VQ8A 3HKSA 4JI8L 1W2BA 3PO2G 3KLWA 3DLLA 4A3JG 2Y0SE 4LFCQ 4LFAQ 1MIUA 4NXMQ 4JI3L 3RR5A 3ULJA 4A3FH 1KD1C 5M3MH 3GTMH 3PUWA 2UUAL 2PMZE 3CQZH 3PUVA 1KIXA 2E2JH 4A76A 4A3DH 2JA5G 1PH2A 4LF8L 1N33L 2R92H 2UXBQ 3J80c 2DUDA 2JA9A 3CMEA 1K9MC 5AJ3L 2Q2UA 1HH2P 4NXNL 4HJ7A 1R9TH 3OTOQ 4OWTB 2GVBA 2Y0SG 3KYHC 3S14H 2BA0A 4BBSG 3CPFA 2OQ0A 3CCSA 2YTXA 1OXVA 3PSIA 2IHEA 4DV5L 1I3QH 4B3SL 2F4VL 3M85A 2N8NA 2CWPA 4A3EG 1XPUA 2E8GA 4JCVE 5IE8A 2UXCL 2ZJRA 3CCUA 1IBLL 2CFMA 1J6QA 2MFIA 1JMCA 5LMUL 1V9PA 1YJWA 3HOYH 2E5LQ 4UPAA 3PO2H 3GDEA 1XTDA 1WI5A 3CP0A 4A3JH 2YTVA 4JI5L 4BY1H 2KBNA 2B29A 1L1OB 4LUVA 2JQOA 2JK8A 2RCNA 3CW2C 3I7FA 3RLOA 3OYYA 1N36Q 2D0PA 2UUCQ 2ZJQA 1SMXA 5H1SE 4C3IH 2JA5H 2ALYB 5FJ8G 1N34Q 3KF8B 4PZ8A 3TEHB 4C3JH 4IO9A 5C0XI 3L0OA 1WFQA 3KDFB 2KHJA 1YZ6A 2ZTEA 4RG1A 1YITA 4BBSH 3GD7A 1L1OA 3BU2A 3AYHB 1PH8A 5IYDG 4DV4L 3PF4A 3MEFA 1IXRA 5C44G 4DV7Q 4ME3A 1XPRA 1K8GA 2FXQA 1AH9A 4A3EH 4JI8Q 2A1AA 1C7YA 3CC2A 4GNXB 4JG2A 3A5UA 2L15A 3PUZA 4JI3Q 2K50A 1VQIA 3B6YA 1XMOL 3CXCA 4B3RL 5IWAL 3JAMc 2UUAQ 5J3BA 4NB3A 1XNRL 3BZCA 3AFQA 4LF8Q 4BXXG 3UDFA 4GNXA 3T1HL 1OTCA 4NXNQ 3I55A 1VQ5A 4LUOA 3A74A 4XTCS 1UEBA 4HJAA 2NN6I 3KJOA 4YWLA 5FJ8H 2K4KA 2N49A 1HR0Q 3IRBA 4DV5Q 4B3SQ 3E0EA 2F52A 5FLMG 1EFWA 2F4VQ 5JJIA 3M4OH 4POFA 1VS0A 4DV2L 4JBJA 1X9NA 2C35B 1VQAA 1NMGA 2OQKA 1FL0A 5GQOA 3F1ZA 3ZJYC 4IFDI 2UXCQ 1YJ9A 1IBLQ 2UXBL 5IYDH 1KL9A 2PI2E 5C44H 4A3KG 5LMUQ 4KHPQ 1EOVA 3CF5A 4DUYL 1VQJA 2H5XA 3NEMA 1NMFA 2V1CC 1C0AA 2LSSA 3HOXG 2JA7G 1QVFA 4BA1I 1EYGA 1HZ9A 4JI5Q 3PF5A 3KFUA 4MTNA 3ICEA 1T9HA 1EQRA 5GADC 1NY4A 3NELA 3CCJA 3I4MG 1PVOA 3CCEA 1VQDA 1WJJA 1YHAA 2VQFQ 4IPGA 1QVGA 2E2HH 1XMQL 4TQUS 5EAYA 1G291 4O2DA 1VQHA 2Q2TA 3I2ZA 4BXXH 3DM3A 1D7QA 2CKZB 5M3MG 4UP9A 4IOCA 3GTLH 2E5LL 1OXSC 4R4IA 1E24A 4DV4Q 2B3GA 1QUQB 4DR2L 3K0XA 4OWWB 5IP7G 4LFBL 5FLMH 1N36L 2UUCL 1HNWL 1B7YB 3UE1A 2HT1A 3S1QH 3UDXA 1N8RC 4GOPC 1OXTA 2D62A 2I0QA 3S15H 4UP8A 5C3EG 5DLQE 4A3KH 1VQMA 1XMOQ 4B3RQ 4GN4B 1QUQA 5IWAQ 3ER0A 3RZOH 2VY3A 1XNRQ 3HOXH 2JA7H 3G48A 3HKZE 4JI0L 3CCRA 1ASYA 3HOUG 3K7UC 5E7NA 4AIMA 2CCZA 3I4MH 1KAWA 1CUKA 2VUMG 4UY8C 5C0XG 1K73C 2B63H 1O7IA 4BY1G 3J7ZC 4P72A 3T1YL 4L5SA 3VDYA 1K3RA 3J80i 3UE0A 1LM0A 3HKZG 1QVCA 4JC0A 1WCMG 4DV2Q 3K81C 4YCUA 2VW9A 3CCMA 1VQNA 1SE8A 5IT9c 1SLJA 1EIFA 1HJPA 1N9WA 5IP7H 1VQ9A 5C4JH 4DUYQ 3KF6B 4PZ7A 4ALPA 5IY0A 2UU9Q 5LMNW 4DV0L 4GKJL 4HIKA 2NVQH 2IY5B 3I4OA 1B70B 1HR0L 4JYAQ 1Q1BA 3LGJA 5C3EH 4DR3L 4GKKL 1PH5A 1WOCA 1PV4A 3Q8DA 3L2PA 3D31A 3RLNA 1CSQA 3KF6A 1X54A 1XMQQ 1PYSB 3J81i 3HOUH 4YCWA 4KHPL 2NN6G 4GN3B 2CQOA 1YHQA 4A93G 3L7ZC 2WP8J 5JEAJ 3H15A 4X62L 4B3TL 2VUMH 1K83H 4X65L 3FP9A 3MXNB 4DR2Q 3NBHB 1XJVA 4LFBQ 2IHFA 1I5FA 4IFDG 1HNWQ 1JE5A 3BZKA 2DGYA 1WCMH 1VQPA 2JJQA 4JI1L 2VQFL 1I94Q 2VZAA 1YNXA 4LF4L 4WJ4A 1Y14B 2MO1A 2IT1A 2K5VA 1IBML 3S16H 3PIPA 1N32Q 1GD7A 1UE5A 2YV5A 4LF9Q 1LYLA 4LWCA 2HHHL 4JI0Q 3HOWG 2PI2A 2A19A 1PYBA 1YJNA 1Z9FA 2ZTCA 4P73A 1S40A 4HIOA 1M90C 4IOAA 3G4SA 1Q12A 3JAMi 3H0GG 1L1OC 3KDFA 3TREA 4JI2L 4IPCA 4HIDA 1E1OA 2MNAA 3T1YQ 2AWOA 1HNZQ 4LF7L 1G51A 2EQSA 2F3IA 2ZM6Q 2KHIA 4J15A 4DV6L 3ULPA 4GLVB 1PFSA 4A93H 1QZHA 2JEBI 4NPSA 3S1MH 3KOJA 1X3EA 4QL5A 5IP9H 1YEZA 2UUBL 1U5KA 1GO3E 4JBMA 3RZDH 1KRSA 4R4CA 4A3IH 1GVPA 4FDBA 3PGZA 4YWMA 1PH7A 4DR1Q 4DK3C 4IPDA 4DV0Q 1EQQA 4GKJQ 3W5OA 2JA6G 1JJCB 5IYBG 2QA4A 1Q81C 2R6GA 4GNXC 4DR3Q 4GKKQ 3HOZH 1SFOH 4RMFA 1NE3A 3HOWH 4A3CG 1CSPA 1RL2A 3U58A 3S2DH 3CCQA 2VS1A 1FVIA 2MO0A 5ELOA 3RNUA 1QZGA 1TWHH 2K5HA 1VQCA 4B3TQ 3H0GH 4LF5Q 4X62Q 1YBYA 5K36G 4R4TA 4HJ5A 2UU9L 5ELNA 4DKAC 4X65Q 1VQ4A 4OO1I 4MNOA 4DV3L 1FJGL 4JYAL 4L5TA 3CPWA 4GLXA 3AFPA 2IX0A 4XIGS 1PH9A 1EIYB 3PO3G 4JI1Q 1PH3A 1EWIA 1NJIC 4LF4Q 4X66L 4JI6Q 2NZOA 1IBKL 3AEVA 4BA2I 2XGTA 2CWAA 1IBMQ 1VQEA 5FLXc 2A8VA 4AQYL 3M9BA 2HHHQ 3I56A 4DR4L 4K0KQ 2KCMA 1Q86C 1VQBA 4YCVA 2LXKA 2JA6H 2K14A 5IYBH 3ERSX 3PUYA 1A63A 1Q8KA 2OCEA 3FHWA 3GTPH 2AWNA 2VQEL 4KI0A 3CCVA 4JI2Q 3U4VA 3GTOH 3AQQA 2Q2IA 4R4OA 1Q7YC 4A3CH 1PA6A 3UDGA 1I94L 2EXDA 2UXDL 3F2DA 3WWVA 4LF7Q 1UE6A 5GAEC 2NVTH 1Y1VG 4DV6Q 4QJFA 3F2CA 1V1QA 2WB1E 1L0WA 4JI4Q 1YHBA 1TWAH 1N32L 3SGIA 2B63G 1MJCA 2XTIA 4LF9L 4DV1Q 1K0RA 1BKBA 4DK6C 4LUZA 4Y7NH 4JOIA 1VCIA 4DPGA 1X56A 3RN2A 2UUBQ 3S2HH 4TVAB 1A8VA 4X64L 4HJ8A 3PUXA 3PO3H 4IPHA 1MJEA 4Y52H 3GTQH 2WB1G 1GKHA 1HNZL 1HZAA 4BBRG 1E7ZA 3H3VI 4OXPA 2YTYA 2D0OA 1SRUA 1U0LA 1OXUA 1UE1A 2KCTA 3STBD 2ZM6L 3E9HA 1A0IA 3G6EA 4DUZQ 4C3HH 3TS2A 1MKHA 5C4XG 1TWFH 4AH6A 4A75A 2OWOA 4YHHL 3K80C 2PNHA 4C2MH 5GAGC 2JE6I 4MZ9A 1YIJA 4DR1L 1C9OA 1FGUA 5M5WH 4QGUA 5LMNL 5BR8L 4DV3Q 1P16A 1FJGQ 1SN8A 1WYDA 2RHQB 1Y1VH 4A3MH 1VQKA 4BY7G 2JEAI 4YY3L 2BH8A 5JJLA 2I5HA 4UP7A 3NENA 2K75A 4X66Q 4QY7A 4HJ9A 3FKIG 1IBKQ 4LW1A 1KQSA 3W1BA 4LF5L 4EX5A 4JI7L 2R7ZG 1EUJA 4AQYQ 5M5XH 4DR4Q 2I5LX 2EIFA 5IP9G 4O0AA 4BBRH 2JA8G 2KENA 4APVA 4A3LG 3F2BA 3U50C 2WFWA 1YI2A 4A3IG 2QGQA 4GS3A 1I50H 2BA1A 2Z0SA 2VQEQ 5C4XH 1HR0W 1VQLA 2RF4A 4QIWE 3GO5A 1XNQL 2UXDQ 1CKOA 1X65A 5IYCG 3M4PA 4DR5L 1PHJA 4JI6L 1Q82C 4LF6Q 4QQBX 3HOZG 2WAQE 1HNXQ 1Q46A 1NTGA 3RLFA 4OO1G 1KRTA 1Z47A 2I5MX 3M4QA 5JJKA 4K0KL 2OTLA 3G71A 4JV5Q 1HZBA 3EN2A 4BY7H 1Q1EA 3D0FA 4A3GG 1G6PA 1X55A 4X64Q 3GTGH 3J81c 1LUZA 1PH1A 1JB7A 4DNIA 1KC8C 3PIOA 2WAQG 3OW2A 4B3ML 4A3BG 1GM5A 3CAMA 1J5EQ 3EIVA 2N3SA 3FKIH 3A5ZB 3EBEA 4JI4L 2ASBA 1CKNB 1A62A 2R7ZH 1P8LA 4L5QA 4AYBE 1JJGA 4DV1L 4YHHQ 4DR7L 3M7NA 1D8LA 3TS0A 2JA8H 4A3LH 3S24A 5HY6A
chains in the Genus database with same CATH superfamily
1O80A 1JWSD 5M5XB 2YU9H 5LMNQ 5IYCH 1RD9D 4N8FA 4N8X1 4RGTA 4R4QA 4DAVA 5KNBA 2VB3X 1FNWA 1F77A 1I50B 2C5CA 5C4XB 3JC66 5J1ZA 2MPMA 4ZYSA 4DR6L 5AJ3Q 1RKNA 3QOJA 4A3BH 1GUNA 2ZJPA 4EQ5A 4R1JA 2Z4HA 3T16A 3PO2B 1EFID 1BCPF 3KBGA 1SNDA 3EA6A 2FJ2A 2R7FA 2JYOA 4HSVA 5C4ZA 2F0MA 3RN5A 4C3IB 1ASZA 2HIVA 1VQFA 3A54A 4GN5A 1BBUA 3OTOL 3FPUB 2BH2A 2JA8B 2VNUD 3EJIA 1PH6A 3MZ5A 1ZEQX 1IYJB 4DAMA 1X3QA 3NWTA 3U4ZA 2EYMA 4LF6L 3I4NH 5KGUA 4ABNA 5CV6A 4OIKA 1SROA 4HN7A 5CBAE 4H02A 4DR7Q 1RHPA 1M1KC 1GUTA 2RSNA 5M3FH 1ILQA 1OXXK 1PH4A 2E2IH 1F2ZA 4UDUC 5LHY1 1J5EL 3V96A 3OHXC 4JOIC 5ELDA 5C5LA 3F2UA 1I6HH 4XQJA 2X6LA 2LS01 1N34L 3ULLA 1H95A 1HXYD 3SK8A 1TXYA 2ZTDA 4B9WA 2KUMA 3W2DA 3MWYW 5M5YH 2NVYH 2AKWB 2L9HA 2IX3A 3GTJB 3HOYG 2Q2HA 3PO2G 4ODGA 3KLWA 4HR7B 3SVMA 2Y0SE 3DLLA 2F0DA 3RR5A 4RKLA 3ULJA 4A3FH 1CI3M 2UUAL 1BUVT 1JWUD 3PUVA 4ZK9B 4EVOA 3S1NB 4C3IG 2JA5G 1PH2A 4LF8L 3FMCA 4KKTA 5IGGA 5AJ3L 3S14H 3KYHC 3K7AB 4Q5VA 2BA0A 4C1NI 2LY7A 2CH4W 3CCSA 1TS4A 3M85A 1RJTA 4CHTB 1SYCA 2A68D 2WV6D 1K8OA 5IGDA 3H3VC 1YNJC 3HEJA 3Q24A 1WTPA 4BY1H 2KBNA 4KHVA 1HQRD 3OW7A 2D0PA 1FNUA 2ZJQA 4ZUIA 4K2LA 2B63B 5LL6S 1LTBD 3DXJC 4PZ8A 4C3JH 3HZXA 5M3MB 3L0OA 1BF4A 3GTMB 1CT1D 2KHJA 2EDGA 3GD7A 4A3DB 5IYDG 1GUSA 3HS0C 4DV7Q 1XPRA 2FXQA 4XYOA 2RDHA 1D6EC 2A1AA 1C7YA 5I9PA 3PUZA 5A2QE 1VQIA 4OL7A 4Q0FA 1U4MA 5BN5A 4CKBA 2OEOA 1TIID 1A3VA 1OTCA 3NTKA 5DNFA 4NXNQ 1VQ5A 4CGYB 4XTCS 4A3JB 5C3XA 4DV5Q 5FLMG 3MVVA 2F4VQ 4DV2L 2UXCQ 2AQ2B 1ZXTA 5GQOA 2HDLA 1IBLQ 1KL9A 1EOVA 3CF5A 2KJXA 4BBSB 2H5XA 2Y0SB 2IPKD 1QVFA 4BA1I 4JI5Q 3ND8A 3O13A 1T9HA 3NSWA 1LTGD 3BVGA 4KD3A 3NELA 1JQYD 2B63G 4IPGA 2E2HH 2Q2TA 1XMQL 4XQQA 2ICIA 1D7QA 3I2ZA 3MXUA 5M3MG 4UP9A 4IOCA 1WTHA 3PIO3 1OXSC 1E24A 4DV4Q 3VYUA 2B3GA 1NR2A 4FXKC 3KBXA 5IP7G 4ID6A 2HT1A 3G7LA 3S15H 2EY6A 1QILA 1XMOQ 2F0WA 4GN4B 5IWAQ 3RZOH 1XNRQ 3M4OB 3AB9A 1SSOA 3LX0A 2F0JA 3G48A 3HKZE 2DN8A 4DFAA 4K5VA 3GV6A 3WOFA 3I4MH 1CUKA 3J7ZC 2JP1A 4P72A 3VDYA 2QDLA 1LM0A 4JC0A 1TKWB 3D3RA 3U9SA 4YCUA 2VW9A 5IT9c 1HJPA 2RBMA 3NWSA 4QMGA 1TQOA 4IUVA 1W6KA 3GTLB 3KF6B 2F1MA 2UU9Q 5IY0A 4P2CB 4DF7A 3CKIB 1C48A 1Q1BA 3T56B 5C3EH 4DR3L 3OIQA 3V05A 3BVZA 3D31A 1EIGA 3KF6A 1X54A 3J81i 4YCWA 1YHQA 4ZKBB 1XX8A 2WP8J 4ILWA 5FLXE 3NP8A 2DGYA 4JI1L 1STEA 1YNXA 4LF4L 5LL6X 2MO1A 2IT1A 5C6AA 5JOBA 4MHEA 1SYDA 3I90A 1LYLA 2HHHL 4U673 2MHVA 2EY1A 1YJNA 1Z9FA 1S40A 1M90C 4HMJA 1Q12A 2B8FA 3T1YQ 2MNAA 4LF7L 5D14A 1Y1VB 2KHIA 1D5XC 1IL8A 2K04A 1NAPA 4GLVB 4I7ZC 1MD2D 1H9MA 4KK7A 3S1MH 5BN4A 2E75C 1X3EA 2UUBL 3RZDH 1TY0A 3C2PA 3PGZA 1RCVD 4DK3C 4IPDA 4DV0Q 5JPNC 1GXDC 1EQQA 2JA6G 4GKJQ 1QCBD 1Q81C 2R6GA 3A7LA 4CJ2C 4DK1A 3TP5A 3T53B 1SFOH 4RH6A 3HOZH 1KLUD 1PTOB 4UHVA 1CSPA 3ND9A 3U58A 2EYLA 4G4KA 2AQ3B 2CW0D 2EE1A 4B3TQ 4R4TA 2UU9L 5ELNA 1WTRA 1G8ZD 4X65Q 1CHPD 1ICWA 1FJGL 1EY4A 3MXPA 2IX0A 4OHJA 3JAML 1D1KA 1ET6A 3DHQA 1Z6HA 1PH3A 2ZT9C 3R2TA 2EVBA 1IBKL 3TP6A 5FLXc 2A8VA 4AQYL 2G5DA 5CV4A 4K0KQ 2KCMA 4YCVA 2LXKA 2QF7A 3ERSX 2WINB 3GTPH 2RA4A 3FHWA 1A3UA 2G9DA 1D5ZC 4A3IB 3IL8A 3X3MA 4EQPA 2EYJA 2IL8A 2YU9B 4A3CH 1PA6A 3F2DA 1UE6A 1Y1VG 4QJFA 1FYCA 3F2CA 2RCFA 4FF4A 1L0WA 4XDXA 5K36H 1CQFA 1LTID 1PRTD 1U4RA 3S2DB 4DPGA 1ESRA 3S2HH 4TVAB 1A8VA 4X64L 5KNCA 4LAAA 4HJ8A 4FXGC 2WAQB 2IJ0A 4H13C 2FMCA 1C4QA 4OXPA 4L5RC 1UE1A 3E9HA 5G3LD 4CBVA 3TS2A 4AH6A 4A75A 2H1EA 5KRUA 1H9SB 1EY9A 1EU4A 2F0VA 2BDNA 4MZ9A 5J22A 2DNEA 4OEMB 2LMCB 4QGUA 1UEAB 4IALA 2E74C 4RWSC 1H9SA 1WYDA 4BY7G 1EEID 1VQKA 2JEAI 2SNMA 4EQNA 2B2VA 2F0HA 1V8QA 3M7GA 3NENA 3I4NB 1B4OA 4X66Q 1LACA 3FKIG 5KIXA 4LW1A 2B2WA 3OMGA 4EGVA 4EX5A 1IW7D 4JI7L 4DR4Q 2I5LX 2EIFA 4HTHA 5IP9G 4BBRH 4ZLTF 2Q8TA 3U50C 2BE5C 5E3FA 4A3IG 1YI2A 4KKUA 4GS3A 1HR0W 2RF4A 3EVQA 1F9PA 1XNQL 5IYCG 3M4PA 4X3SA 1Q46A 1NTGA 4K8JA 5CC4A 4OO1G 2E76C 2EY2A 4K0KL 3AMUA 4JV5Q 3EN2A 1ENFA 1SDFA 3D0FA 1X55A 1LUZA 2QKIC 1KC8C 3SDZA 3D4WA 2WAQG 3HGBA 4A3BG 1GM5A 4U68A 4A3MB 3EBEA 4NDXA 1A62A 1CKNB 2F0KA 2R7ZH 1GOZA 1JJGA 2Q8IB 2FINB 1D8LA 3TS0A 4A3LH 3S24A 5HY6A 2OTJA 1XPOA 1CKMA 3GP7A 2AMCB 2SNSA 1CKNA 4KKSA 5BR8Q 2ZXPA 2QEJC 3STBC 4HMIA 2K5NA 3LNNA 1HZCA 2MP1A 1SNCA 5GAHC 3E9IA 3I4NG 1EQTA 2NTTA 1PFBA 4JBKA 2XN9C 1DCZA 4A3GH 1N33Q 1AE2A 5FO8B 3DWAA 5M3FG 1STAA 2KCCA 4JPBW 1CA6A 1KXLA 1PTOC 3P1HA 5CYUA 3BS1A 1E1TA 4RFBA 1I4HA 5I6YA 1GUWA 3GV3A 3MC0B 3E3XA 3CCLA 3UI2A 4N9PA 2P5ZX 1Y1WH 3CMAA 1BVSA 2NVXH 3TRZA 1V43A 2ZXRA 4P71A 3TP8A 1X3GA 4GOPB 4A3MG 5HGQA 4OONA 3FVQA 4HCEA 3S1RH 3M3YH 2PNRC 4YWKA 4OGQC 4ZQ3A 2F3VA 1ZYRD 1VQ7A 4OWXB 4A3FG 3NTHA 4JV5L 4WORA 4DN4M 2BDOA 1PZKD 4GOPA 1M4VA 2Z6KC 1W3SA 3K5OA 1EWHA 5ELCA 2QEXA 1TWCB 2EJGC 3VR3A 1QE6A 2A6HC 3FPPA 3F8TA 1MBYA 5JAVA 1AZPA 1EQVA 3BJUA 3Q23A 1PDQA 4G7HC 1QNUA 3TZUA 4DR6Q 2RQXA 2HQLA 4K6DA 2RDGA 1ZKOA 1TWGH 1O7ZA 1SAPA 3HKSA 1W2BA 1VF7A 3PUWA 1KIXA 4A76A 3SEBA 2R92H 1N33L 2B2VC 2JA9A 5F2DA 4C3JG 4B08A 2Q2UA 1R9TH 4HJ7A 3OTOQ 1E2VA 4OWTB 1I4PA 4FYDA 1PTOF 2B2WC 3CPFA 2OQ0A 4F8MA 1OXVA 1QWYA 4B3SL 1I3QH 2PZWA 5C3WA 3V2TA 4JCVE 2B2UA 2ZJRA 1B9MA 3S15B 4ZUJA 3FEWX 2CFMA 2MFIA 1JMCA 5HURA 2PZTA 1XTDA 2KOLA 2F0UA 1JCKB 2YTVA 2ENBA 3FDTA 2B29A 5COYA 1WTOA 1J5EQ 2JK8A 3I7FA 3RLOA 2UUCQ 2TMPA 2L1BA 4DXFA 1AW7A 1S5FD 1N34Q 2NYZD 2ZXOA 3D4DA 5C0XI 3KDFB 3CQZB 1T5EA 3AYHB 3BU2A 5DAUA 1PH8A 1ENAA 3PF4A 3MEFA 1IXRA 2MJ8A 1EEFD 4ME3A 4A3EH 4C1NK 4FO2A 4JG2A 3S9WA 4B3RL 2UUAQ 3OWEB 5J3BA 3QR8A 4LF8Q 3MFYA 3MA2B 4FVMA 3J81L 2VXWA 3HOYB 4LUOA 5D3DA 1UEBA 1U9RA 2NN6I 3KJOA 3VR6A 5FJ8H 2N49A 3D6WA 5JJIA 3SR1A 2F0OA 4POFA 1VS0A 1EIYB 2OQKA 1VQAA 1FL0A 2JA5B 4IFDI 1YJ9A 2PI2E 3K5MA 4DUYL 1BCPD 3NEMA 1NMFA 1K3BC 1EYGA 3KFUA 3OSOA 5I2YA 3VA5A 3ICEA 2K32A 2A68C 1EQRA 5GADC 3I4MG 1GUGA 1PVOA 3CCEA 4BXXH 4O2DA 1TR5A 4L6TB 2K1BA 4HEDA 3NE5B 1O7LA 4DR2L 4OWWB 4G7ZC 2IW3A 2UUCL 1B7YB 3UE1A 3S1QH 3UDXA 4GOPC 1HUMA 2I0QA 1STBA 4UP8A 5D65A 5DLQE 5C3EG 4A3KH 3RMHA 2VY3A 3VYSA 3HOXH 2JA7H 4JI0L 4IUQA 1HCZA 2N55A 1BR9A 1Y69U 4UY8C 1EU3A 1O7YA 1ILPA 2D5DA 4CDFC 4L5SA 1K3RA 2M00A 2L12A 4DV2Q 3K81C 3DWPA 1SE8A 1BNZA 5EGTA 3H6MA 1ICFB 5C4JH 1KNEA 3A56A 4PZ7A 3BZDB 4TKOB 4HIKA 2NVQH 2IY5B 3H09A 3K5LA 4JYAQ 3L3OC 1J8IA 2J7ZA 1PV4A 1H9JA 3L2PA 1MSHA 2B2YA 2F4IA 2PYKA 4M1UB 1XMQQ 1PYSB 1NCVA 2M2LA 3HOUH 4GN3B 2CQOA 2H4OA 3L7ZC 3H15A 2VUMH 2B2UC 1K83H 5C0XH 1O78A 3MXNB 3C1FA 1XJVA 3SHLA 3BZKA 1WCMH 1VQPA 5IGCA 1I94Q 2VZAA 3HRZC 5IT9L 3J80L 2K5VA 3MXNA 5KYLA 1IYVA 1IBML 5IOCA 3PIPA 2PW7A 1GD7A 2YV5A 2PI2A 2A74C 4P73A 4HIOA 4WJWA 3G4SA 5ELFA 2GA4B 2EYOA 5EPKA 4CKEA 4ZKCB 2HD3A 4R8NA 1LTAD 2AWOA 2DJGC 3TBIB 1G51A 2D2CC 2A73B 4J15A 2NN6H 1EY6A 4A93H 1QZHA 4NPSA 1F2YA 4JBMA 4IFDH 4WFN3 1GVPA 4YWMA 4DR1Q 2L4NA 2F0TA 3W5OA 4DK0A 1JJCB 2QA4A 4DR3Q 4RMFA 1NE3A 3HOWH 4A3CG 3Q6SA 5T1GA 1RL2A 1CK1A 3RNUA 1QZGA 3R8BA 1G2SA 1TWHH 1VQCA 4LF5Q 3S16B 1YBYA 5K36G 5NUCA 4XQNA 5KNDA 4DKAC 1VQ4A 4MNOA 2F0EA 1DM0B 4JYAL 4GLXA 5FO9B 3CRLC 3I72A 1PH9A 2D9UA 4JI1Q 1EWIA 4LF4Q 2X69A 4JI6Q 4BA2I 2XGTA 4KMUC 1EL0A 3BG3A 3M9BA 2HHHQ 1VQBA 1DOMA 2K14A 1JOOA 2OCEA 4O1NA 4KTAA 2AWNA 3DUZA 1YNJD 3AQQA 3D6CA 2Q2IA 4R4OA 2UXDL 1I94L 3QO2A 4IN3A 3WWVA 4LF7Q 4J8QA 3Q22A 3KK7A 1YHBA 1TWAH 3SGIA 1DONA 1K0RA 4LUZA 4LJZC 4Y7NH 2UUBQ 3RN2A 2L55A 1I4GA 1DD2A 3PUXA 3PO3H 4Y52H 1HZAA 5AFWA 1E7ZA 4BBRG 2D0OA 2K5WA 4Z9CB 2Z9HA 3G6EA 4DUZQ 1A0IA 1PZJD 1TU2B 4OIJA 1MKHA 2EPBA 4C2MH 1RODA 2JE6I 1YIJA 4DR1L 1C9OA 4RGNA 5M5WH 1SXTA 2JA6B 4JVZA 4KY5A 1SN8A 2RHQB 4PQXA 1FJGQ 3H91A 4YY3L 2F03A 3GTOB 2DJFC 1STNA 3KLSA 2K75A 2NVTB 1IBKQ 3W1BA 2PCFB 3NQIA 4LF5L 2R7ZG 4AQYQ 4RGOS 5M5XH 2B2YC 1VMCA 1WTQA 4V0BA 1YNND 4PMCA 4O0AA 1AEXA 1J9OA 4APVA 4A3LG 3F2BA 2WFWA 4I7AA 2QGQA 1I50H 2PQEA 2Z0SA 1HA6A 5C4XH 2KHSA 4QCLA 3GO5A 1CKOA 1PHJA 3VA7A 4DR5L 4JI6L 1Q82C 2WAQE 1LO5D 1HNXQ 4S3SA 3RLFA 3D4RA 1CM9A 1KRTA 1Z47A 3WOEA 3LWEA 3M4QA 5JJKA 2OTLA 2R3ZA 3DEPA 1Q1EA 1JR0D 4F88A 4A3GG 1SYFA 1G6PA 4X64Q 1WTVA 2PW5A 1PH1A 1SJED 2B2TA 1BDOA 4B3ML 3CAMA 4MN3A 5M9OA 3C3LA 3BYYB 1SJHD 3OOCA 1CHQD 4L5QA 3A8KE 2KQ3A 4NP5A 2JA8H 1KDCA 3MHBA 2R92B 5FKAC 1SMYD 2GVAA 3M4YA 3OPOA 4IJLA 1Y1WG 2N78A 3ITPA 1AP0A 1L2FA 1VQ6A 4AYBG 4H0LC 4ZAIA 4DUZL 1KABA 4ULLA 1K8AC 1X6OA 2AUKA 1TY2A 3E6ZX 4CDCC 2LFNA 3TQYA 4OX9L 1IZ6A 4JI7Q 4MTKA 1YVCA 2K33A 1AFPA 4HCSA 4LNQA 4BY7B 1RIPA 3HG9A 3GTGB 2WKDA 1S3OA 4GLAC 1XWEA 4LFCL 4LFAL 4NXML 3NQTA 4WJ3M 1HUNA 3I70A 1XNQQ 3FKIB 3VR5A 4JW0A 1G2TA 1IW7C 2ES2A 2AHOB 3HOVH 2IWHA 3GTJH 1WVLA 4DAYB 2HDMA 3I8ZA 2FMMA 4FNFA 2K52A 5EBDA 2PMZB 4PG3A 3CHBD 1S72A 3PIP3 2ATWA 2VL6A 5CV9A 4A3EB 3Q0AA 1B8AA 4DAYA 1HNXL 3S1NH 1NSNS 3NPPA 2Z6KA 3TZDA 4K14A 5JEAH 3IAYA 3PCOB 1EYDA 3K7AH 3R93A 2R61A 2R7DA 4KHZA 2R92G 2R93H 3UDIA 2HIXA 4HIMA 4A3BB 1B2TA 1B9NA 3C1EA 3HFZB 2GN5A 1TVXA 3CD6A 3A0JA 3S17H 1E22A 1VQOA 1STGA 2IX1A 1JT8A 3J81j 1IYUA 1G91A 2A6ED 3JAME 4PZ6A 3T1HQ 1I4XA 1UE7A 2RHSB 4P74A 2QDBA 3NUCA 3VR4A 4JI8L 1JOQA 4JI3L 5BN3A 2F0PA 2HCIA 5M3MH 5HGTA 3GTMH 3DMUA 2E2JH 4A3DH 2A69C 3A7AB 1DZ1A 1FNVA 2DUDA 3KLRA 2CH4A 4HAEA 5M3FB 1QNKA 2XVSA 5EQ0A 2YTXA 4KJNA 3PSIA 2E2IB 2IHEA 2PPBC 4A3EG 2CWPA 5E4WC 4BWGB 1I6HB 2E8GA 1PFMA 5LMUL 1V9PA 1F9QA 1DOLA 1HQMC 5EPLA 1YJWA 2KEDA 5M5YB 3HOXB 3GDEA 2NVYB 3CP0A 4A3JH 1L1OB 4LUVA 2JQOA 3CW2C 1V1OA 4R8IA 1SMXA 1V1PB 1ZYRC 2ALYB 3TSSA 5IGEA 2SEBD 5FJ8G 2B2TC 1CZWA 4IO9A 4A3FB 4RG1A 2ZTEA 4BBSH 1FR3A 1YITA 1L1OA 4F87A 1SYGA 2F0GA 3VYRA 3GQBA 5CV5A 2XIWA 4DA2A 1V1PA 1B3AA 4DNTB 2RDFA 1A6XA 1K8GA 1PLFA 5C4JB 3S14B 1AH9A 5K5PA 3CC2A 5CORA 4GNXB 3A5UA 2K50A 1IKLA 3B6YA 1XTCD 1EYCA 3JAMc 3K59A 3AFQA 4FF2A 4XXEA 1JE4A 4BXXG 4GNXA 3T1HL 3I55A 1SNPA 3A74A 4HJAA 3QOLA 1QG7A 2KVMA 4YWLA 2K4KA 4BY1B 3IFDA 1HR0Q 3IRBA 4B3SQ 3E0EA 2F52A 2MGSA 1EFWA 3M4OH 4J1MA 3TN2A 1X9NA 2C9OA 2K28A 2C35B 3PMFA 1VQNA 3F1ZA 5EPJA 4C3JB 5C44H 5EKLA 4A3KG 2BOSA 1VQJA 2V1CC 3HOXG 2KECA 2JA7G 3L9AX 2NWGA 4MTNA 4TRDA 3SE0A 1EOTA 3R3OA 5CBEE 5KEEA 3CCJA 2BE5D 1VQDA 3P20A 1WJJA 1YHAA 1QVGA 4K5XA 5EAYA 3K0YA 5ELBA 3DM3A 4K8IA 5E1FA 4A93B 3GTLH 4J6HA 1FGBD 3E5SA 5IODA 2I07B 1QUQB 4K2KA 3K0XA 4LFBL 1HNWL 3P75A 5IGBA 1N8RC 1X32A 4C56C 5EBCA 2D62A 1VQMA 3J7YW 4B3RQ 1QUQA 1II3A 3ER0A 3I3CA 3U9OA 3CCRA 3C46A 1ASYA 3HOUG 1BXTA 4N9TA 1DOKA 5C4HA 4DNRB 3A8JE 2CCZA 2VUMG 3NHHA 5C0XG 4BY1G 4XT1B 1QVCA 3CU7A 1WCMG 4RA8A 1JWMD 2E2HB 1SLJA 1EIFA 4DUYQ 1W6JA 5IIFA 4ALPA 5LMNW 3D8GA 5DM63 1HR0L 1U4PA 3LGJA 4GKKL 1WOCA 3R2IA 3Q8DA 1RTOA 2DNCA 4XYQA 1PTOD 1BCPC 3N52A 2NN6G 4TSSA 2SDFA 3RZOB 4A93G 1LTTD 4X62L 2EYHA 1FD7D 3FP9A 4DR2Q 3NBHB 4IFDG 1CQVA 1JE5A 3IFTA 1PTOH 1B44D 2JJQA 3I4MB 3MAQA 1G6ZA 1SYBA 4CKCA 1KTKA 3TMEA 1Y14B 2XSCA 4CDDC 3NTIA 1B3QA 4RHSA 3NBHA 1OO9B 2ICEC 4LF9Q 2NB0A 4JI0Q 3HOWG 1BO0A 2A19A 4RHRA 2ZTCA 1SNQA 3JAMi 1L1OC 3KDFA 3TREA 1Y8NB 4IPCA 4JI2L 5JJZA 1AN8A 4HIDA 1E1OA 1HNZQ 2HUGA 1HFNA 2F3IA 5C3EB 4DV6L 3T51B 4KY7A 2A6HD 3KOJA 2Z6BA 5IP9H 1EYAA 1U5KA 1GO3E 5JVG3 1QB5D 2F0SA 1TS3A 4A3IH 1Q3LA 1A2TA 2AUJD 4FF3A 1ESFA 2WB1B 4KY6A 4GNXC 3CRKC 4OO1H 3WDNA 3BYTB 1AZQA 4MIUA 5CMDA 5EJWA 3S2DH 3CCQA 1BQQT 5JPMC 2L11A 4IURA 1FVIA 5ELOA 2Z4IA 1ML0D 1SE4A 2CVRA 3H0GH 4HJ5A 1STYA 4DV3L 4L5TA 3CPWA 3AFPA 3DEOA 1WTWA 3PO3G 2F0QA 4RGMA 2BCOA 4ME5A 1L0XB 2RVLA 1UUPA 4R9WA 1NJIC 2NZOA 3HP3A 4YIJA 1DYQA 4LMQD 5ISRA 1IBMQ 1VQEA 1R4PB 1S5CD 4CJ1B 3I56A 3S1MB 1Q86C 5IYBH 1A63A 1VDZA 3RZDB 4RAUC 3QWNA 2X6GA 2VQEL 1Q7YC 1H9RA 3UDGA 3I4LA 3OIPA 1B53A 2M9VA 3J81E 3HOZB 2L0CA 1V1QA 1SFOB 5I9OA 4JI4Q 2O4XA 2K6AA 1MJCA 2XTIA 3QG1A 4LF9L 1BKBA 2F0LA 1EWCA 1X56A 4L8JA 1B1ZA 2OT2A 4H44C 4E6IA 4IPHA 1PZID 3GTQH 1DXMA 2HCCA 1GKHA 1PYWD 1EY5A 1LV9A 2WB1G 1HNZL 3H3VI 1MHWC 2YTYA 1SRUA 1U0LA 2KCTA 2NBFA 4C3HH 1LT5D 5C4XG 1TWFH 2OWOA 4YHHL 3K80C 2PNHA 4HSPA 2QW7A 3HOVB 1FGUA 1S4ZA 1EZ8A 5LMNL 1F2MA 5C5MA 4A3MH 3GTPB 1S5BD 2BH8A 1SBBB 5JJLA 3URYA 3OMCA 2I5HA 4UP7A 1Q8IA 2EZVA 1EY0A 5I4DA 5A2QL 1EUJA 3QB3A 3K6OA 2RSOA 3S2HB 1K8MA 1TS2A 2JA8G 2HQEA 3P7JA 1HA5A 2KEEA 4O42A 2R93B 4QIWE 2UXDQ 4QQBX 1EZ6A 4PNYA 5FK9C 3HOZG 1PRTB 2Z1CA 1GUOA 2B39A 2WKCA 3S17B 2QCPX 1HZBA 1A3TA 1RTNA 2QILA 3J81c 1R4QB 3OW2A 3A55A 3EIVA 1HPCA 4L63B 4JI4L 2ASBA 1P8LA 4AYBE 4DR7L 3T4AC 3M7NA 1CZGA 2E2JB 1EY7A 3J7A5 3HOVG 1NUCA 1SR3A 3W1GA 4X3TA 4BBRB 4M8AA 4YY3Q 3PV0A 1X3FA 3QJYA 1IKMA 2ID0A 2F0IA 4QUCA 3SK5A 1E3PA 4NMZA 1LT3D 4P75A 1JJ2A 3CC4A 1E0BA 3J7AF 2XWBB 5E4XA 5JEAG 5GROA 5C0XJ 5IT9E 3J80E 1AE3A 2K5DA 1LTLA 1TWCH 2R93G 4BS9A 2EYPA 1UWVA 4DR5Q 2PQAB 3TDQA 2A5HA 4KLKA 3RD4A 2R7ZB 1YNNC 1BBXC 3CC7A 2MQHA 3BVMA 1E2ZA 4JBWA 2PQAA 4X6AH 3KJPA 1NBWA 1BBWA 1VF5C 1E2WA 4B3MQ 4K6LA 4IJHA 1STHA 3DWQA 3H3VH 4DAPA 2LKVA 2EYFA 3ZYYX 1LTRD 2YYZA 4A3DG 2XNAC 4QIWB 1DGSA 4A3GB 2LXJA 1MSGA 4IUUA 4A4IA 4IFDJ 3K8AA 2NZHA 4KN7C 5CV7A 5FLXL 1JC7A 4POGA 2OXPA 4I65A 3KLSX 3PQIA 1IL2A 4OX9Q 3GTKH 1SMYC 1VQGA 4G57A 5C44B 1KHIA 4DV7L 4PMWA 1Y1WB 5JVH3 1MI2A 1F9SA 1UNSA 1VQ8A 4AYBB 2NVXB 4A3JG 4LFCQ 4LFAQ 1MIUA 4NXMQ 2O5IC 1KD1C 2NTSA 2PMZE 3CQZH 2CW0C 3S1RB 3M3YB 1ONLA 2UXBQ 3J80c 3CMEA 1K9MC 2F0FA 1HH2P 4NXNL 1HRJA 4BBSG 2GVBA 2Y0SG 3ERQA 4F7XA 3I73A 1UAPA 4GZYC 1WD1A 5D3IB 4DV5L 2F4VL 2N8NA 1XPUA 2UXCL 5IE8A 1HTLD 1SNOA 2VB2X 3CCUA 1IBLL 1J6QA 3HOYH 1I4RA 2E5LQ 1GHJA 4UPAA 3PO2H 1WI5A 1JB3A 1XXGA 4JI5L 4XT3B 1TWGB 3EFXD 2RCNA 1N36Q 3ONAB 3OYYA 3K57A 1MGSA 5H1SE 4C3IH 2JA5H 1QJOA 1PRTC 3KF8B 4IUNA 3TEHB 1WFQA 1YZ6A 5I6WA 3QIAA 4RKBA 1QOHA 4RCOA 1KDAA 4DV4L 2J4XA 3SK6A 1D2BA 5C44G 5FO7B 4KV6A 1R9TB 1KNAA 3KF8A 2KCNA 1A15A 4JI8Q 2L15A 4JI3Q 1XMOL 4FF1A 3CXCA 1I3QB 5IWAL 3EROA 4NB3A 1XNRL 3BZCA 5A35A 2A6EC 3UDFA 5DEHA 1F2LA 2F3WA 4QUFA 2CHBD 4CDEC 1BOSA 2SOBA 1LT6D 3HKZB 4OELB 1SE3A 2K01A 1Q90A 4JBJA 1NMGA 3ZJYC 5IYDH 2UXBL 3BDCA 1PXUA 2K7VA 5LMUQ 3FRPB 4KHPQ 1K28A 2K03A 5IGFA 4RCNA 1C0AA 2LSSA 1HZ9A 3PF5A 2NUCA 1I6VC 1NY4A 1RF2D 4ZRZA 4G7OC 2DY7A 2VQFQ 4X3UA 4IUPA 4TQUS 1G291 1VQHA 3A8IE 3I91A 2CKZB 2FFKB 5EKIA 4DXGA 1JOKA 2G9HD 2E5LL 4R4IA 3BDOA 4PV1C 1HHVA 1PRTF 5FLMH 4KD4A 1N36L 2JSOA 1WD0A 1OXTA 3MEHA 4V190 1JICA 4H7BA 1LABA 2K5QA 5G3LF 4B9XA 3K7UC 5E7NA 4AIMA 3X3NA 2DY8A 3H0GB 1KAWA 4QB4A 3NK9A 1Z7TA 3VR2A 1K73C 2B63H 1O7IA 2KA7A 3T1YL 3UE0A 3J80i 1GHKA 3HKZG 1HFGA 3CCMA 1BCPB 3BDLA 3G6JB 1N9WA 5IP7H 1VQ9A 2EY5A 2XRQD 3MXGA 5T1IA 1ET9A 5DM73 2TSSA 4DV0L 4GKJL 2XRSD 1LTSD 2CQAA 1B70B 1PMRA 3I4OA 2B8GA 4EQOA 1PH5A 3VYTA 1EIHA 1F9RA 3S1QB 2WACA 3EQLC 4PMBA 2J0TD 3RLNA 1CSQA 4X3KA 1CA5A 1H9KA 3RUZA 4A3KB 4KHPL 1CFMA 3KUPA 5JEAJ 4B3TL 2JA7B 2E2DC 4X65L 1HTPA 2MUYA 4LFBQ 2K05A 1I4QA 2IHFA 1I5FA 1HNWQ 4IQZA 1M8AA 2VQFL 3GTQB 4WJ4A 1LT4D 1CTMA 3NBIA 2EJMA 3S16H 4C3HB 1TS5A 4FXDA 1N32Q 1TWFB 1UE5A 2NZ1D 4LWCA 1PYBA 2O2LD 4IOAA 2WIIB 3H0GG 1NNXA 2NVQB 1L0YB 2EQSA 3ULPA 2ZM6Q 1PFSA 2JEBI 1T5XD 3W3AA 1S5DD 4JK1C 5CV8A 2EOTA 4QL5A 4IZ8A 1YEZA 3HOUB 1WTXA 1Y8OB 3MTSA 1KRSA 5TSSA 4R4CA 4FDBA 1SNMA 1PH7A 2VUMB 1IHZA 1K83B 5IYBG 4FP5D 3H94A 4GKKQ 1VMPA 1WCMB 3TP7A 5CGKA 5CR3A 1K0SA 3K58A 2VS1A 2MO0A 4NW2A 1D5MC 1GJXA 2K5HA 4X62Q 2A69D 3DM1A 4OO1I 1Y8PB 2JN4A 1SEBD 4XIGS 3MFGA 4UAIA 1LLRD 2Q8RE 4K5WA 4X66L 3K5NA 2RKSA 3AEVA 2CWAA 2EXZA 4C3HG 2FHTA 4KJOA 4DR4L 2JA6H 1TT2A 3PUYA 1Q8KA 5L37A 4WRDA 4KI0A 3CCVA 4JI2Q 1KDBA 3U4VA 3GTOH 3LWUA 2EXDA 1D1IA 1U4LA 2F0NA 5GAEC 2NVTH 2AQ1B 3SK4A 4DV6Q 1X3PA 2L5TA 2WB1E 1N32L 3HOWB 4DV1Q 3AU7A 3NXWA 4DK6C 2PZUA 4JOIA 1VCIA 4DGZA 2N88A 1TWHB 5ELEA 1ENCA 1EY8A 1MJEA 1SE2A 1KLGD 4LK1C 2ZM6L 3STBD 1OXUA 4IUTA 1JORA 2OF1A 1PFNA 5EKKA 2Z8LA 5GAGC 2V4DA 3OWFA 2XWJB 1DJRD 1KAAA 4CJ0B 5BR8L 4DV3Q 1P16A 1Y1VH 3J7AV 2PO4A 4DU9A 3E0JA 1XYIA 4QY7A 4HJ9A 1A2UA 1KQSA 4NKLA 1TWAB 2JXMB 5KYIA 4Y7NB 4ZCKA 2KENA 4QF4A 5J39A 2I46A 2BA1A 2VQEQ 1S5ED 1VQLA 3PO3B 3SXHA 1X65A 4LF6Q 1SYEA 1RDPD 5I2XA 2EJFC 2I5MX 3IKJA 3G71A 3N6RA 4C2MB 1B50A 4BY7H 4KN4C 3GTKB 2O5JC 3GTGH 1JB7A 4DNIA 3PIOA 1NR4A 5M5WB 2N3SA 3FKIH 3A5ZB 1C8CA 4DV1L 4YHHQ 5FOBB 3T13A
chains in the Genus database with same CATH topology
1XPOA 3J7A5 3HOVG 2GVAA 1SR3A 1CKMA 2YU9H 2AMCB 4IJLA 1CKNA 2N78A 5BR8Q 3W1GA 3STBC 5IYCH 5LMNQ 1Y1WG 1L2FA 1VQ6A 2K5NA 4R4QA 4AYBG 4YY3Q 3PV0A 1X3FA 4DUZL 1HZCA 2ID0A 3JC66 5GAHC 2OTJA 3E9IA 1K8AC 3I4NG 1X6OA 4JBKA 4A3GH 3TQYA 4OX9L 1N33Q 1AE2A 1E3PA 1IZ6A 4P75A 1JJ2A 4JI7Q 4DR6L 3CC4A 1YVCA 5AJ3Q 5JEAG 4A3BH 5GROA 4EQ5A 4R1JA 2ZJPA 5C0XJ 5M3FG 4LNQA 1RIPA 1AE3A 1LTLA 1TWCH 4GLAC 1S3OA 4LFCL 4WJ3M 4LFAL 4NXML 2R93G 1XNQQ 1KXLA 1UWVA 4DR5Q 2PQAB 1E1TA 2R7FA 4KLKA 3RN5A 2ES2A 2AHOB 2HIVA 1VQFA 1ASZA 3CCLA 3HOVH 4GN5A 3GTJH 3CC7A 3CMAA 2MQHA 1BVSA 1BBUA 4DAYB 3OTOL 4JBWA 1Y1WH 4L5RC 2BH2A 2VNUD 2PQAA 4X6AH 2NVXH 3TRZA 1PH6A 3KJPA 2K52A 4DAMA 1IYJB 1NBWA 1BBWA 1V43A 4PG3A 4P71A 4B3MQ 3U4ZA 1S72A 4LF6L 3I4NH 1X3GA 4GOPB 4IJHA 2VL6A 4A3MG 5HGQA 4OONA 3S1RH 2ATWA 1B8AA 3M3YH 1HNXL 3S1NH 4YWKA 1SROA 3H3VH 2Z6KA 1VQ7A 4H02A 4OWXB 4A3FG 4DR7Q 1M1KC 3PCOB 4JV5L 3K7AH 5M3FH 2YYZA 4A3DG 4GOPA 1DGSA 1OXXK 2R7DA 4KHZA 2R92G 2LXJA 4A4IA 2R93H 3UDIA 2HIXA 1W3SA 2Z6KC 3K8AA 4HIMA 1PH4A 2E2IH 4IFDJ 1J5EL 2NZHA 4JOIC 1I6HH 3HFZB 2QEXA 2GN5A 3CD6A 1N34L 3ULLA 1H95A 3F8TA 3A0JA 3S17H 1TXYA 2ZTDA 4POGA 1IL2A 1E22A 1VQOA 2IX1A 3BJUA 1JT8A 5M5YH 4OX9Q 3J81j 3GTKH 2NVYH 4DR6Q 2AKWB 2HQLA 1VQGA 4PZ6A 3T1HQ 1KHIA 4DV7L 4PMWA 1TWGH 1UE7A 3HOYG 2RHSB 4P74A 2Q2HA 1VQ8A 3HKSA 4JI8L 1W2BA 3PO2G 3KLWA 3DLLA 4A3JG 2Y0SE 4LFCQ 4LFAQ 1MIUA 4NXMQ 4JI3L 3RR5A 3ULJA 4A3FH 1KD1C 5M3MH 3GTMH 3PUWA 2UUAL 2PMZE 3CQZH 3PUVA 1KIXA 2E2JH 4A76A 4A3DH 2JA5G 1PH2A 4LF8L 1N33L 2R92H 2UXBQ 3J80c 2DUDA 2JA9A 3CMEA 1K9MC 5AJ3L 2Q2UA 1HH2P 4NXNL 4HJ7A 1R9TH 3OTOQ 4OWTB 2GVBA 2Y0SG 3KYHC 3S14H 2BA0A 4BBSG 3CPFA 2OQ0A 3CCSA 2YTXA 1OXVA 3PSIA 2IHEA 4DV5L 1I3QH 4B3SL 2F4VL 3M85A 2N8NA 2CWPA 4A3EG 1XPUA 2E8GA 4JCVE 5IE8A 2UXCL 2ZJRA 3CCUA 1IBLL 2CFMA 1J6QA 2MFIA 1JMCA 5LMUL 1V9PA 1YJWA 3HOYH 2E5LQ 4UPAA 3PO2H 3GDEA 1XTDA 1WI5A 3CP0A 4A3JH 2YTVA 4JI5L 4BY1H 2KBNA 2B29A 1L1OB 4LUVA 2JQOA 2JK8A 2RCNA 3CW2C 3I7FA 3RLOA 3OYYA 1N36Q 2D0PA 2UUCQ 2ZJQA 1SMXA 5H1SE 4C3IH 2JA5H 2ALYB 5FJ8G 1N34Q 3KF8B 4PZ8A 3TEHB 4C3JH 4IO9A 5C0XI 3L0OA 1WFQA 3KDFB 2KHJA 1YZ6A 2ZTEA 4RG1A 1YITA 4BBSH 3GD7A 1L1OA 3BU2A 3AYHB 1PH8A 5IYDG 4DV4L 3PF4A 3MEFA 1IXRA 5C44G 4DV7Q 4ME3A 1XPRA 1K8GA 2FXQA 1AH9A 4A3EH 4JI8Q 2A1AA 1C7YA 3CC2A 4GNXB 4JG2A 3A5UA 2L15A 3PUZA 4JI3Q 2K50A 1VQIA 3B6YA 1XMOL 3CXCA 4B3RL 5IWAL 3JAMc 2UUAQ 5J3BA 4NB3A 1XNRL 3BZCA 3AFQA 4LF8Q 4BXXG 3UDFA 4GNXA 3T1HL 1OTCA 4NXNQ 3I55A 1VQ5A 4LUOA 3A74A 4XTCS 1UEBA 4HJAA 2NN6I 3KJOA 4YWLA 5FJ8H 2K4KA 2N49A 1HR0Q 3IRBA 4DV5Q 4B3SQ 3E0EA 2F52A 5FLMG 1EFWA 2F4VQ 5JJIA 3M4OH 4POFA 1VS0A 4DV2L 4JBJA 1X9NA 2C35B 1VQAA 1NMGA 2OQKA 1FL0A 5GQOA 3F1ZA 3ZJYC 4IFDI 2UXCQ 1YJ9A 1IBLQ 2UXBL 5IYDH 1KL9A 2PI2E 5C44H 4A3KG 5LMUQ 4KHPQ 1EOVA 3CF5A 4DUYL 1VQJA 2H5XA 3NEMA 1NMFA 2V1CC 1C0AA 2LSSA 3HOXG 2JA7G 1QVFA 4BA1I 1EYGA 1HZ9A 4JI5Q 3PF5A 3KFUA 4MTNA 3ICEA 1T9HA 1EQRA 5GADC 1NY4A 3NELA 3CCJA 3I4MG 1PVOA 3CCEA 1VQDA 1WJJA 1YHAA 2VQFQ 4IPGA 1QVGA 2E2HH 1XMQL 4TQUS 5EAYA 1G291 4O2DA 1VQHA 2Q2TA 3I2ZA 4BXXH 3DM3A 1D7QA 2CKZB 5M3MG 4UP9A 4IOCA 3GTLH 2E5LL 1OXSC 4R4IA 1E24A 4DV4Q 2B3GA 1QUQB 4DR2L 3K0XA 4OWWB 5IP7G 4LFBL 5FLMH 1N36L 2UUCL 1HNWL 1B7YB 3UE1A 2HT1A 3S1QH 3UDXA 1N8RC 4GOPC 1OXTA 2D62A 2I0QA 3S15H 4UP8A 5C3EG 5DLQE 4A3KH 1VQMA 1XMOQ 4B3RQ 4GN4B 1QUQA 5IWAQ 3ER0A 3RZOH 2VY3A 1XNRQ 3HOXH 2JA7H 3G48A 3HKZE 4JI0L 3CCRA 1ASYA 3HOUG 3K7UC 5E7NA 4AIMA 2CCZA 3I4MH 1KAWA 1CUKA 2VUMG 4UY8C 5C0XG 1K73C 2B63H 1O7IA 4BY1G 3J7ZC 4P72A 3T1YL 4L5SA 3VDYA 1K3RA 3J80i 3UE0A 1LM0A 3HKZG 1QVCA 4JC0A 1WCMG 4DV2Q 3K81C 4YCUA 2VW9A 3CCMA 1VQNA 1SE8A 5IT9c 1SLJA 1EIFA 1HJPA 1N9WA 5IP7H 1VQ9A 5C4JH 4DUYQ 3KF6B 4PZ7A 4ALPA 5IY0A 2UU9Q 5LMNW 4DV0L 4GKJL 4HIKA 2NVQH 2IY5B 3I4OA 1B70B 1HR0L 4JYAQ 1Q1BA 3LGJA 5C3EH 4DR3L 4GKKL 1PH5A 1WOCA 1PV4A 3Q8DA 3L2PA 3D31A 3RLNA 1CSQA 3KF6A 1X54A 1XMQQ 1PYSB 3J81i 3HOUH 4YCWA 4KHPL 2NN6G 4GN3B 2CQOA 1YHQA 4A93G 3L7ZC 2WP8J 5JEAJ 3H15A 4X62L 4B3TL 2VUMH 1K83H 4X65L 3FP9A 3MXNB 4DR2Q 3NBHB 1XJVA 4LFBQ 2IHFA 1I5FA 4IFDG 1HNWQ 1JE5A 3BZKA 2DGYA 1WCMH 1VQPA 2JJQA 4JI1L 2VQFL 1I94Q 2VZAA 1YNXA 4LF4L 4WJ4A 1Y14B 2MO1A 2IT1A 2K5VA 1IBML 3S16H 3PIPA 1N32Q 1GD7A 1UE5A 2YV5A 4LF9Q 1LYLA 4LWCA 2HHHL 4JI0Q 3HOWG 2PI2A 2A19A 1PYBA 1YJNA 1Z9FA 2ZTCA 4P73A 1S40A 4HIOA 1M90C 4IOAA 3G4SA 1Q12A 3JAMi 3H0GG 1L1OC 3KDFA 3TREA 4JI2L 4IPCA 4HIDA 1E1OA 2MNAA 3T1YQ 2AWOA 1HNZQ 4LF7L 1G51A 2EQSA 2F3IA 2ZM6Q 2KHIA 4J15A 4DV6L 3ULPA 4GLVB 1PFSA 4A93H 1QZHA 2JEBI 4NPSA 3S1MH 3KOJA 1X3EA 4QL5A 5IP9H 1YEZA 2UUBL 1U5KA 1GO3E 4JBMA 3RZDH 1KRSA 4R4CA 4A3IH 1GVPA 4FDBA 3PGZA 4YWMA 1PH7A 4DR1Q 4DK3C 4IPDA 4DV0Q 1EQQA 4GKJQ 3W5OA 2JA6G 1JJCB 5IYBG 2QA4A 1Q81C 2R6GA 4GNXC 4DR3Q 4GKKQ 3HOZH 1SFOH 4RMFA 1NE3A 3HOWH 4A3CG 1CSPA 1RL2A 3U58A 3S2DH 3CCQA 2VS1A 1FVIA 2MO0A 5ELOA 3RNUA 1QZGA 1TWHH 2K5HA 1VQCA 4B3TQ 3H0GH 4LF5Q 4X62Q 1YBYA 5K36G 4R4TA 4HJ5A 2UU9L 5ELNA 4DKAC 4X65Q 1VQ4A 4OO1I 4MNOA 4DV3L 1FJGL 4JYAL 4L5TA 3CPWA 4GLXA 3AFPA 2IX0A 4XIGS 1PH9A 1EIYB 3PO3G 4JI1Q 1PH3A 1EWIA 1NJIC 4LF4Q 4X66L 4JI6Q 2NZOA 1IBKL 3AEVA 4BA2I 2XGTA 2CWAA 1IBMQ 1VQEA 5FLXc 2A8VA 4AQYL 3M9BA 2HHHQ 3I56A 4DR4L 4K0KQ 2KCMA 1Q86C 1VQBA 4YCVA 2LXKA 2JA6H 2K14A 5IYBH 3ERSX 3PUYA 1A63A 1Q8KA 2OCEA 3FHWA 3GTPH 2AWNA 2VQEL 4KI0A 3CCVA 4JI2Q 3U4VA 3GTOH 3AQQA 2Q2IA 4R4OA 1Q7YC 4A3CH 1PA6A 3UDGA 1I94L 2EXDA 2UXDL 3F2DA 3WWVA 4LF7Q 1UE6A 5GAEC 2NVTH 1Y1VG 4DV6Q 4QJFA 3F2CA 1V1QA 2WB1E 1L0WA 4JI4Q 1YHBA 1TWAH 1N32L 3SGIA 2B63G 1MJCA 2XTIA 4LF9L 4DV1Q 1K0RA 1BKBA 4DK6C 4LUZA 4Y7NH 4JOIA 1VCIA 4DPGA 1X56A 3RN2A 2UUBQ 3S2HH 4TVAB 1A8VA 4X64L 4HJ8A 3PUXA 3PO3H 4IPHA 1MJEA 4Y52H 3GTQH 2WB1G 1GKHA 1HNZL 1HZAA 4BBRG 1E7ZA 3H3VI 4OXPA 2YTYA 2D0OA 1SRUA 1U0LA 1OXUA 1UE1A 2KCTA 3STBD 2ZM6L 3E9HA 1A0IA 3G6EA 4DUZQ 4C3HH 3TS2A 1MKHA 5C4XG 1TWFH 4AH6A 4A75A 2OWOA 4YHHL 3K80C 2PNHA 4C2MH 5GAGC 2JE6I 4MZ9A 1YIJA 4DR1L 1C9OA 1FGUA 5M5WH 4QGUA 5LMNL 5BR8L 4DV3Q 1P16A 1FJGQ 1SN8A 1WYDA 2RHQB 1Y1VH 4A3MH 1VQKA 4BY7G 2JEAI 4YY3L 2BH8A 5JJLA 2I5HA 4UP7A 3NENA 2K75A 4X66Q 4QY7A 4HJ9A 3FKIG 1IBKQ 4LW1A 1KQSA 3W1BA 4LF5L 4EX5A 4JI7L 2R7ZG 1EUJA 4AQYQ 5M5XH 4DR4Q 2I5LX 2EIFA 5IP9G 4O0AA 4BBRH 2JA8G 2KENA 4APVA 4A3LG 3F2BA 3U50C 2WFWA 1YI2A 4A3IG 2QGQA 4GS3A 1I50H 2BA1A 2Z0SA 2VQEQ 5C4XH 1HR0W 1VQLA 2RF4A 4QIWE 3GO5A 1XNQL 2UXDQ 1CKOA 1X65A 5IYCG 3M4PA 4DR5L 1PHJA 4JI6L 1Q82C 4LF6Q 4QQBX 3HOZG 2WAQE 1HNXQ 1Q46A 1NTGA 3RLFA 4OO1G 1KRTA 1Z47A 2I5MX 3M4QA 5JJKA 4K0KL 2OTLA 3G71A 4JV5Q 1HZBA 3EN2A 4BY7H 1Q1EA 3D0FA 4A3GG 1G6PA 1X55A 4X64Q 3GTGH 3J81c 1LUZA 1PH1A 1JB7A 4DNIA 1KC8C 3PIOA 2WAQG 3OW2A 4B3ML 4A3BG 1GM5A 3CAMA 1J5EQ 3EIVA 2N3SA 3FKIH 3A5ZB 3EBEA 4JI4L 2ASBA 1CKNB 1A62A 2R7ZH 1P8LA 4L5QA 4AYBE 1JJGA 4DV1L 4YHHQ 4DR7L 3M7NA 1D8LA 3TS0A 2JA8H 4A3LH 3S24A 5HY6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPO A;  3J7A 5;  3HOV G;  2GVA A;  1SR3 A;  1CKM A;  2YU9 H;  2AMC B;  4IJL A;  1CKN A;  2N78 A;  5BR8 Q;  3W1G A;  3STB C;  5IYC H;  5LMN Q;  1Y1W G;  1L2F A;  1VQ6 A;  2K5N A;  4R4Q A;  4AYB G;  4YY3 Q;  3PV0 A;  1X3F A;  4DUZ L;  1HZC A;  2ID0 A;  3JC6 6;  5GAH C;  2OTJ A;  3E9I A;  1K8A C;  3I4N G;  1X6O A;  4JBK A;  4A3G H;  3TQY A;  4OX9 L;  1N33 Q;  1AE2 A;  1E3P A;  1IZ6 A;  4P75 A;  1JJ2 A;  4JI7 Q;  4DR6 L;  3CC4 A;  1YVC A;  5AJ3 Q;  5JEA G;  4A3B H;  5GRO A;  4EQ5 A;  4R1J A;  2ZJP A;  5C0X J;  5M3F G;  4LNQ A;  1RIP A;  1AE3 A;  1LTL A;  1TWC H;  4GLA C;  1S3O A;  4LFC L;  4WJ3 M;  4LFA L;  4NXM L;  2R93 G;  1XNQ Q;  1KXL A;  1UWV A;  4DR5 Q;  2PQA B;  1E1T A;  2R7F A;  4KLK A;  3RN5 A;  2ES2 A;  2AHO B;  2HIV A;  1VQF A;  1ASZ A;  3CCL A;  3HOV H;  4GN5 A;  3GTJ H;  3CC7 A;  3CMA A;  2MQH A;  1BVS A;  1BBU A;  4DAY B;  3OTO L;  4JBW A;  1Y1W H;  4L5R C;  2BH2 A;  2VNU D;  2PQA A;  4X6A H;  2NVX H;  3TRZ A;  1PH6 A;  3KJP A;  2K52 A;  4DAM A;  1IYJ B;  1NBW A;  1BBW A;  1V43 A;  4PG3 A;  4P71 A;  4B3M Q;  3U4Z A;  1S72 A;  4LF6 L;  3I4N H;  1X3G A;  4GOP B;  4IJH A;  2VL6 A;  4A3M G;  5HGQ A;  4OON A;  3S1R H;  2ATW A;  1B8A A;  3M3Y H;  1HNX L;  3S1N H;  4YWK A;  1SRO A;  3H3V H;  2Z6K A;  1VQ7 A;  4H02 A;  4OWX B;  4A3F G;  4DR7 Q;  1M1K C;  3PCO B;  4JV5 L;  3K7A H;  5M3F H;  2YYZ A;  4A3D G;  4GOP A;  1DGS A;  1OXX K;  2R7D A;  4KHZ A;  2R92 G;  2LXJ A;  4A4I A;  2R93 H;  3UDI A;  2HIX A;  1W3S A;  2Z6K C;  3K8A A;  4HIM A;  1PH4 A;  2E2I H;  4IFD J;  1J5E L;  2NZH A;  4JOI C;  1I6H H;  3HFZ B;  2QEX A;  2GN5 A;  3CD6 A;  1N34 L;  3ULL A;  1H95 A;  3F8T A;  3A0J A;  3S17 H;  1TXY A;  2ZTD A;  4POG A;  1IL2 A;  1E22 A;  1VQO A;  2IX1 A;  3BJU A;  1JT8 A;  5M5Y H;  4OX9 Q;  3J81 j;  3GTK H;  2NVY H;  4DR6 Q;  2AKW B;  2HQL A;  1VQG A;  4PZ6 A;  3T1H Q;  1KHI A;  4DV7 L;  4PMW A;  1TWG H;  1UE7 A;  3HOY G;  2RHS B;  4P74 A;  2Q2H A;  1VQ8 A;  3HKS A;  4JI8 L;  1W2B A;  3PO2 G;  3KLW A;  3DLL A;  4A3J G;  2Y0S E;  4LFC Q;  4LFA Q;  1MIU A;  4NXM Q;  4JI3 L;  3RR5 A;  3ULJ A;  4A3F H;  1KD1 C;  5M3M H;  3GTM H;  3PUW A;  2UUA L;  2PMZ E;  3CQZ H;  3PUV A;  1KIX A;  2E2J H;  4A76 A;  4A3D H;  2JA5 G;  1PH2 A;  4LF8 L;  1N33 L;  2R92 H;  2UXB Q;  3J80 c;  2DUD A;  2JA9 A;  3CME A;  1K9M C;  5AJ3 L;  2Q2U A;  1HH2 P;  4NXN L;  4HJ7 A;  1R9T H;  3OTO Q;  4OWT B;  2GVB A;  2Y0S G;  3KYH C;  3S14 H;  2BA0 A;  4BBS G;  3CPF A;  2OQ0 A;  3CCS A;  2YTX A;  1OXV A;  3PSI A;  2IHE A;  4DV5 L;  1I3Q H;  4B3S L;  2F4V L;  3M85 A;  2N8N A;  2CWP A;  4A3E G;  1XPU A;  2E8G A;  4JCV E;  5IE8 A;  2UXC L;  2ZJR A;  3CCU A;  1IBL L;  2CFM A;  1J6Q A;  2MFI A;  1JMC A;  5LMU L;  1V9P A;  1YJW A;  3HOY H;  2E5L Q;  4UPA A;  3PO2 H;  3GDE A;  1XTD A;  1WI5 A;  3CP0 A;  4A3J H;  2YTV A;  4JI5 L;  4BY1 H;  2KBN A;  2B29 A;  1L1O B;  4LUV A;  2JQO A;  2JK8 A;  2RCN A;  3CW2 C;  3I7F A;  3RLO A;  3OYY A;  1N36 Q;  2D0P A;  2UUC Q;  2ZJQ A;  1SMX A;  5H1S E;  4C3I H;  2JA5 H;  2ALY B;  5FJ8 G;  1N34 Q;  3KF8 B;  4PZ8 A;  3TEH B;  4C3J H;  4IO9 A;  5C0X I;  3L0O A;  1WFQ A;  3KDF B;  2KHJ A;  1YZ6 A;  2ZTE A;  4RG1 A;  1YIT A;  4BBS H;  3GD7 A;  1L1O A;  3BU2 A;  3AYH B;  1PH8 A;  5IYD G;  4DV4 L;  3PF4 A;  3MEF A;  1IXR A;  5C44 G;  4DV7 Q;  4ME3 A;  1XPR A;  1K8G A;  2FXQ A;  1AH9 A;  4A3E H;  4JI8 Q;  2A1A A;  1C7Y A;  3CC2 A;  4GNX B;  4JG2 A;  3A5U A;  2L15 A;  3PUZ A;  4JI3 Q;  2K50 A;  1VQI A;  3B6Y A;  1XMO L;  3CXC A;  4B3R L;  5IWA L;  3JAM c;  2UUA Q;  5J3B A;  4NB3 A;  1XNR L;  3BZC A;  3AFQ A;  4LF8 Q;  4BXX G;  3UDF A;  4GNX A;  3T1H L;  1OTC A;  4NXN Q;  3I55 A;  1VQ5 A;  4LUO A;  3A74 A;  4XTC S;  1UEB A;  4HJA A;  2NN6 I;  3KJO A;  4YWL A;  5FJ8 H;  2K4K A;  2N49 A;  1HR0 Q;  3IRB A;  4DV5 Q;  4B3S Q;  3E0E A;  2F52 A;  5FLM G;  1EFW A;  2F4V Q;  5JJI A;  3M4O H;  4POF A;  1VS0 A;  4DV2 L;  4JBJ A;  1X9N A;  2C35 B;  1VQA A;  1NMG A;  2OQK A;  1FL0 A;  5GQO A;  3F1Z A;  3ZJY C;  4IFD I;  2UXC Q;  1YJ9 A;  1IBL Q;  2UXB L;  5IYD H;  1KL9 A;  2PI2 E;  5C44 H;  4A3K G;  5LMU Q;  4KHP Q;  1EOV A;  3CF5 A;  4DUY L;  1VQJ A;  2H5X A;  3NEM A;  1NMF A;  2V1C C;  1C0A A;  2LSS A;  3HOX G;  2JA7 G;  1QVF A;  4BA1 I;  1EYG A;  1HZ9 A;  4JI5 Q;  3PF5 A;  3KFU A;  4MTN A;  3ICE A;  1T9H A;  1EQR A;  5GAD C;  1NY4 A;  3NEL A;  3CCJ A;  3I4M G;  1PVO A;  3CCE A;  1VQD A;  1WJJ A;  1YHA A;  2VQF Q;  4IPG A;  1QVG A;  2E2H H;  1XMQ L;  4TQU S;  5EAY A;  1G29 1;  4O2D A;  1VQH A;  2Q2T A;  3I2Z A;  4BXX H;  3DM3 A;  1D7Q A;  2CKZ B;  5M3M G;  4UP9 A;  4IOC A;  3GTL H;  2E5L L;  1OXS C;  4R4I A;  1E24 A;  4DV4 Q;  2B3G A;  1QUQ B;  4DR2 L;  3K0X A;  4OWW B;  5IP7 G;  4LFB L;  5FLM H;  1N36 L;  2UUC L;  1HNW L;  1B7Y B;  3UE1 A;  2HT1 A;  3S1Q H;  3UDX A;  1N8R C;  4GOP C;  1OXT A;  2D62 A;  2I0Q A;  3S15 H;  4UP8 A;  5C3E G;  5DLQ E;  4A3K H;  1VQM A;  1XMO Q;  4B3R Q;  4GN4 B;  1QUQ A;  5IWA Q;  3ER0 A;  3RZO H;  2VY3 A;  1XNR Q;  3HOX H;  2JA7 H;  3G48 A;  3HKZ E;  4JI0 L;  3CCR A;  1ASY A;  3HOU G;  3K7U C;  5E7N A;  4AIM A;  2CCZ A;  3I4M H;  1KAW A;  1CUK A;  2VUM G;  4UY8 C;  5C0X G;  1K73 C;  2B63 H;  1O7I A;  4BY1 G;  3J7Z C;  4P72 A;  3T1Y L;  4L5S A;  3VDY A;  1K3R A;  3J80 i;  3UE0 A;  1LM0 A;  3HKZ G;  1QVC A;  4JC0 A;  1WCM G;  4DV2 Q;  3K81 C;  4YCU A;  2VW9 A;  3CCM A;  1VQN A;  1SE8 A;  5IT9 c;  1SLJ A;  1EIF A;  1HJP A;  1N9W A;  5IP7 H;  1VQ9 A;  5C4J H;  4DUY Q;  3KF6 B;  4PZ7 A;  4ALP A;  5IY0 A;  2UU9 Q;  5LMN W;  4DV0 L;  4GKJ L;  4HIK A;  2NVQ H;  2IY5 B;  3I4O A;  1B70 B;  1HR0 L;  4JYA Q;  1Q1B A;  3LGJ A;  5C3E H;  4DR3 L;  4GKK L;  1PH5 A;  1WOC A;  1PV4 A;  3Q8D A;  3L2P A;  3D31 A;  3RLN A;  1CSQ A;  3KF6 A;  1X54 A;  1XMQ Q;  1PYS B;  3J81 i;  3HOU H;  4YCW A;  4KHP L;  2NN6 G;  4GN3 B;  2CQO A;  1YHQ A;  4A93 G;  3L7Z C;  2WP8 J;  5JEA J;  3H15 A;  4X62 L;  4B3T L;  2VUM H;  1K83 H;  4X65 L;  3FP9 A;  3MXN B;  4DR2 Q;  3NBH B;  1XJV A;  4LFB Q;  2IHF A;  1I5F A;  4IFD G;  1HNW Q;  1JE5 A;  3BZK A;  2DGY A;  1WCM H;  1VQP A;  2JJQ A;  4JI1 L;  2VQF L;  1I94 Q;  2VZA A;  1YNX A;  4LF4 L;  4WJ4 A;  1Y14 B;  2MO1 A;  2IT1 A;  2K5V A;  1IBM L;  3S16 H;  3PIP A;  1N32 Q;  1GD7 A;  1UE5 A;  2YV5 A;  4LF9 Q;  1LYL A;  4LWC A;  2HHH L;  4JI0 Q;  3HOW G;  2PI2 A;  2A19 A;  1PYB A;  1YJN A;  1Z9F A;  2ZTC A;  4P73 A;  1S40 A;  4HIO A;  1M90 C;  4IOA A;  3G4S A;  1Q12 A;  3JAM i;  3H0G G;  1L1O C;  3KDF A;  3TRE A;  4JI2 L;  4IPC A;  4HID A;  1E1O A;  2MNA A;  3T1Y Q;  2AWO A;  1HNZ Q;  4LF7 L;  1G51 A;  2EQS A;  2F3I A;  2ZM6 Q;  2KHI A;  4J15 A;  4DV6 L;  3ULP A;  4GLV B;  1PFS A;  4A93 H;  1QZH A;  2JEB I;  4NPS A;  3S1M H;  3KOJ A;  1X3E A;  4QL5 A;  5IP9 H;  1YEZ A;  2UUB L;  1U5K A;  1GO3 E;  4JBM A;  3RZD H;  1KRS A;  4R4C A;  4A3I H;  1GVP A;  4FDB A;  3PGZ A;  4YWM A;  1PH7 A;  4DR1 Q;  4DK3 C;  4IPD A;  4DV0 Q;  1EQQ A;  4GKJ Q;  3W5O A;  2JA6 G;  1JJC B;  5IYB G;  2QA4 A;  1Q81 C;  2R6G A;  4GNX C;  4DR3 Q;  4GKK Q;  3HOZ H;  1SFO H;  4RMF A;  1NE3 A;  3HOW H;  4A3C G;  1CSP A;  1RL2 A;  3U58 A;  3S2D H;  3CCQ A;  2VS1 A;  1FVI A;  2MO0 A;  5ELO A;  3RNU A;  1QZG A;  1TWH H;  2K5H A;  1VQC A;  4B3T Q;  3H0G H;  4LF5 Q;  4X62 Q;  1YBY A;  5K36 G;  4R4T A;  4HJ5 A;  2UU9 L;  5ELN A;  4DKA C;  4X65 Q;  1VQ4 A;  4OO1 I;  4MNO A;  4DV3 L;  1FJG L;  4JYA L;  4L5T A;  3CPW A;  4GLX A;  3AFP A;  2IX0 A;  4XIG S;  1PH9 A;  1EIY B;  3PO3 G;  4JI1 Q;  1PH3 A;  1EWI A;  1NJI C;  4LF4 Q;  4X66 L;  4JI6 Q;  2NZO A;  1IBK L;  3AEV A;  4BA2 I;  2XGT A;  2CWA A;  1IBM Q;  1VQE A;  5FLX c;  2A8V A;  4AQY L;  3M9B A;  2HHH Q;  3I56 A;  4DR4 L;  4K0K Q;  2KCM A;  1Q86 C;  1VQB A;  4YCV A;  2LXK A;  2JA6 H;  2K14 A;  5IYB H;  3ERS X;  3PUY A;  1A63 A;  1Q8K A;  2OCE A;  3FHW A;  3GTP H;  2AWN A;  2VQE L;  4KI0 A;  3CCV A;  4JI2 Q;  3U4V A;  3GTO H;  3AQQ A;  2Q2I A;  4R4O A;  1Q7Y C;  4A3C H;  1PA6 A;  3UDG A;  1I94 L;  2EXD A;  2UXD L;  3F2D A;  3WWV A;  4LF7 Q;  1UE6 A;  5GAE C;  2NVT H;  1Y1V G;  4DV6 Q;  4QJF A;  3F2C A;  1V1Q A;  2WB1 E;  1L0W A;  4JI4 Q;  1YHB A;  1TWA H;  1N32 L;  3SGI A;  2B63 G;  1MJC A;  2XTI A;  4LF9 L;  4DV1 Q;  1K0R A;  1BKB A;  4DK6 C;  4LUZ A;  4Y7N H;  4JOI A;  1VCI A;  4DPG A;  1X56 A;  3RN2 A;  2UUB Q;  3S2H H;  4TVA B;  1A8V A;  4X64 L;  4HJ8 A;  3PUX A;  3PO3 H;  4IPH A;  1MJE A;  4Y52 H;  3GTQ H;  2WB1 G;  1GKH A;  1HNZ L;  1HZA A;  4BBR G;  1E7Z A;  3H3V I;  4OXP A;  2YTY A;  2D0O A;  1SRU A;  1U0L A;  1OXU A;  1UE1 A;  2KCT A;  3STB D;  2ZM6 L;  3E9H A;  1A0I A;  3G6E A;  4DUZ Q;  4C3H H;  3TS2 A;  1MKH A;  5C4X G;  1TWF H;  4AH6 A;  4A75 A;  2OWO A;  4YHH L;  3K80 C;  2PNH A;  4C2M H;  5GAG C;  2JE6 I;  4MZ9 A;  1YIJ A;  4DR1 L;  1C9O A;  1FGU A;  5M5W H;  4QGU A;  5LMN L;  5BR8 L;  4DV3 Q;  1P16 A;  1FJG Q;  1SN8 A;  1WYD A;  2RHQ B;  1Y1V H;  4A3M H;  1VQK A;  4BY7 G;  2JEA I;  4YY3 L;  2BH8 A;  5JJL A;  2I5H A;  4UP7 A;  3NEN A;  2K75 A;  4X66 Q;  4QY7 A;  4HJ9 A;  3FKI G;  1IBK Q;  4LW1 A;  1KQS A;  3W1B A;  4LF5 L;  4EX5 A;  4JI7 L;  2R7Z G;  1EUJ A;  4AQY Q;  5M5X H;  4DR4 Q;  2I5L X;  2EIF A;  5IP9 G;  4O0A A;  4BBR H;  2JA8 G;  2KEN A;  4APV A;  4A3L G;  3F2B A;  3U50 C;  2WFW A;  1YI2 A;  4A3I G;  2QGQ A;  4GS3 A;  1I50 H;  2BA1 A;  2Z0S A;  2VQE Q;  5C4X H;  1HR0 W;  1VQL A;  2RF4 A;  4QIW E;  3GO5 A;  1XNQ L;  2UXD Q;  1CKO A;  1X65 A;  5IYC G;  3M4P A;  4DR5 L;  1PHJ A;  4JI6 L;  1Q82 C;  4LF6 Q;  4QQB X;  3HOZ G;  2WAQ E;  1HNX Q;  1Q46 A;  1NTG A;  3RLF A;  4OO1 G;  1KRT A;  1Z47 A;  2I5M X;  3M4Q A;  5JJK A;  4K0K L;  2OTL A;  3G71 A;  4JV5 Q;  1HZB A;  3EN2 A;  4BY7 H;  1Q1E A;  3D0F A;  4A3G G;  1G6P A;  1X55 A;  4X64 Q;  3GTG H;  3J81 c;  1LUZ A;  1PH1 A;  1JB7 A;  4DNI A;  1KC8 C;  3PIO A;  2WAQ G;  3OW2 A;  4B3M L;  4A3B G;  1GM5 A;  3CAM A;  1J5E Q;  3EIV A;  2N3S A;  3FKI H;  3A5Z B;  3EBE A;  4JI4 L;  2ASB A;  1CKN B;  1A62 A;  2R7Z H;  1P8L A;  4L5Q A;  4AYB E;  1JJG A;  4DV1 L;  4YHH Q;  4DR7 L;  3M7N A;  1D8L A;  3TS0 A;  2JA8 H;  4A3L H;  3S24 A;  5HY6 A; 
#chains in the Genus database with same CATH topology
 1O80 A;  1JWS D;  5M5X B;  2YU9 H;  5LMN Q;  5IYC H;  1RD9 D;  4N8F A;  4N8X 1;  4RGT A;  4R4Q A;  4DAV A;  5KNB A;  2VB3 X;  1FNW A;  1F77 A;  1I50 B;  2C5C A;  5C4X B;  3JC6 6;  5J1Z A;  2MPM A;  4ZYS A;  4DR6 L;  5AJ3 Q;  1RKN A;  3QOJ A;  4A3B H;  1GUN A;  2ZJP A;  4EQ5 A;  4R1J A;  2Z4H A;  3T16 A;  3PO2 B;  1EFI D;  1BCP F;  3KBG A;  1SND A;  3EA6 A;  2FJ2 A;  2R7F A;  2JYO A;  4HSV A;  5C4Z A;  2F0M A;  3RN5 A;  4C3I B;  1ASZ A;  2HIV A;  1VQF A;  3A54 A;  4GN5 A;  1BBU A;  3OTO L;  3FPU B;  2BH2 A;  2JA8 B;  2VNU D;  3EJI A;  1PH6 A;  3MZ5 A;  1ZEQ X;  1IYJ B;  4DAM A;  1X3Q A;  3NWT A;  3U4Z A;  2EYM A;  4LF6 L;  3I4N H;  5KGU A;  4ABN A;  5CV6 A;  4OIK A;  1SRO A;  4HN7 A;  5CBA E;  4H02 A;  4DR7 Q;  1RHP A;  1M1K C;  1GUT A;  2RSN A;  5M3F H;  1ILQ A;  1OXX K;  1PH4 A;  2E2I H;  1F2Z A;  4UDU C;  5LHY 1;  1J5E L;  3V96 A;  3OHX C;  4JOI C;  5ELD A;  5C5L A;  3F2U A;  1I6H H;  4XQJ A;  2X6L A;  2LS0 1;  1N34 L;  3ULL A;  1H95 A;  1HXY D;  3SK8 A;  1TXY A;  2ZTD A;  4B9W A;  2KUM A;  3W2D A;  3MWY W;  5M5Y H;  2NVY H;  2AKW B;  2L9H A;  2IX3 A;  3GTJ B;  3HOY G;  2Q2H A;  3PO2 G;  4ODG A;  3KLW A;  4HR7 B;  3SVM A;  2Y0S E;  3DLL A;  2F0D A;  3RR5 A;  4RKL A;  3ULJ A;  4A3F H;  1CI3 M;  2UUA L;  1BUV T;  1JWU D;  3PUV A;  4ZK9 B;  4EVO A;  3S1N B;  4C3I G;  2JA5 G;  1PH2 A;  4LF8 L;  3FMC A;  4KKT A;  5IGG A;  5AJ3 L;  3S14 H;  3KYH C;  3K7A B;  4Q5V A;  2BA0 A;  4C1N I;  2LY7 A;  2CH4 W;  3CCS A;  1TS4 A;  3M85 A;  1RJT A;  4CHT B;  1SYC A;  2A68 D;  2WV6 D;  1K8O A;  5IGD A;  3H3V C;  1YNJ C;  3HEJ A;  3Q24 A;  1WTP A;  4BY1 H;  2KBN A;  4KHV A;  1HQR D;  3OW7 A;  2D0P A;  1FNU A;  2ZJQ A;  4ZUI A;  4K2L A;  2B63 B;  5LL6 S;  1LTB D;  3DXJ C;  4PZ8 A;  4C3J H;  3HZX A;  5M3M B;  3L0O A;  1BF4 A;  3GTM B;  1CT1 D;  2KHJ A;  2EDG A;  3GD7 A;  4A3D B;  5IYD G;  1GUS A;  3HS0 C;  4DV7 Q;  1XPR A;  2FXQ A;  4XYO A;  2RDH A;  1D6E C;  2A1A A;  1C7Y A;  5I9P A;  3PUZ A;  5A2Q E;  1VQI A;  4OL7 A;  4Q0F A;  1U4M A;  5BN5 A;  4CKB A;  2OEO A;  1TII D;  1A3V A;  1OTC A;  3NTK A;  5DNF A;  4NXN Q;  1VQ5 A;  4CGY B;  4XTC S;  4A3J B;  5C3X A;  4DV5 Q;  5FLM G;  3MVV A;  2F4V Q;  4DV2 L;  2UXC Q;  2AQ2 B;  1ZXT A;  5GQO A;  2HDL A;  1IBL Q;  1KL9 A;  1EOV A;  3CF5 A;  2KJX A;  4BBS B;  2H5X A;  2Y0S B;  2IPK D;  1QVF A;  4BA1 I;  4JI5 Q;  3ND8 A;  3O13 A;  1T9H A;  3NSW A;  1LTG D;  3BVG A;  4KD3 A;  3NEL A;  1JQY D;  2B63 G;  4IPG A;  2E2H H;  2Q2T A;  1XMQ L;  4XQQ A;  2ICI A;  1D7Q A;  3I2Z A;  3MXU A;  5M3M G;  4UP9 A;  4IOC A;  1WTH A;  3PIO 3;  1OXS C;  1E24 A;  4DV4 Q;  3VYU A;  2B3G A;  1NR2 A;  4FXK C;  3KBX A;  5IP7 G;  4ID6 A;  2HT1 A;  3G7L A;  3S15 H;  2EY6 A;  1QIL A;  1XMO Q;  2F0W A;  4GN4 B;  5IWA Q;  3RZO H;  1XNR Q;  3M4O B;  3AB9 A;  1SSO A;  3LX0 A;  2F0J A;  3G48 A;  3HKZ E;  2DN8 A;  4DFA A;  4K5V A;  3GV6 A;  3WOF A;  3I4M H;  1CUK A;  3J7Z C;  2JP1 A;  4P72 A;  3VDY A;  2QDL A;  1LM0 A;  4JC0 A;  1TKW B;  3D3R A;  3U9S A;  4YCU A;  2VW9 A;  5IT9 c;  1HJP A;  2RBM A;  3NWS A;  4QMG A;  1TQO A;  4IUV A;  1W6K A;  3GTL B;  3KF6 B;  2F1M A;  2UU9 Q;  5IY0 A;  4P2C B;  4DF7 A;  3CKI B;  1C48 A;  1Q1B A;  3T56 B;  5C3E H;  4DR3 L;  3OIQ A;  3V05 A;  3BVZ A;  3D31 A;  1EIG A;  3KF6 A;  1X54 A;  3J81 i;  4YCW A;  1YHQ A;  4ZKB B;  1XX8 A;  2WP8 J;  4ILW A;  5FLX E;  3NP8 A;  2DGY A;  4JI1 L;  1STE A;  1YNX A;  4LF4 L;  5LL6 X;  2MO1 A;  2IT1 A;  5C6A A;  5JOB A;  4MHE A;  1SYD A;  3I90 A;  1LYL A;  2HHH L;  4U67 3;  2MHV A;  2EY1 A;  1YJN A;  1Z9F A;  1S40 A;  1M90 C;  4HMJ A;  1Q12 A;  2B8F A;  3T1Y Q;  2MNA A;  4LF7 L;  5D14 A;  1Y1V B;  2KHI A;  1D5X C;  1IL8 A;  2K04 A;  1NAP A;  4GLV B;  4I7Z C;  1MD2 D;  1H9M A;  4KK7 A;  3S1M H;  5BN4 A;  2E75 C;  1X3E A;  2UUB L;  3RZD H;  1TY0 A;  3C2P A;  3PGZ A;  1RCV D;  4DK3 C;  4IPD A;  4DV0 Q;  5JPN C;  1GXD C;  1EQQ A;  2JA6 G;  4GKJ Q;  1QCB D;  1Q81 C;  2R6G A;  3A7L A;  4CJ2 C;  4DK1 A;  3TP5 A;  3T53 B;  1SFO H;  4RH6 A;  3HOZ H;  1KLU D;  1PTO B;  4UHV A;  1CSP A;  3ND9 A;  3U58 A;  2EYL A;  4G4K A;  2AQ3 B;  2CW0 D;  2EE1 A;  4B3T Q;  4R4T A;  2UU9 L;  5ELN A;  1WTR A;  1G8Z D;  4X65 Q;  1CHP D;  1ICW A;  1FJG L;  1EY4 A;  3MXP A;  2IX0 A;  4OHJ A;  3JAM L;  1D1K A;  1ET6 A;  3DHQ A;  1Z6H A;  1PH3 A;  2ZT9 C;  3R2T A;  2EVB A;  1IBK L;  3TP6 A;  5FLX c;  2A8V A;  4AQY L;  2G5D A;  5CV4 A;  4K0K Q;  2KCM A;  4YCV A;  2LXK A;  2QF7 A;  3ERS X;  2WIN B;  3GTP H;  2RA4 A;  3FHW A;  1A3U A;  2G9D A;  1D5Z C;  4A3I B;  3IL8 A;  3X3M A;  4EQP A;  2EYJ A;  2IL8 A;  2YU9 B;  4A3C H;  1PA6 A;  3F2D A;  1UE6 A;  1Y1V G;  4QJF A;  1FYC A;  3F2C A;  2RCF A;  4FF4 A;  1L0W A;  4XDX A;  5K36 H;  1CQF A;  1LTI D;  1PRT D;  1U4R A;  3S2D B;  4DPG A;  1ESR A;  3S2H H;  4TVA B;  1A8V A;  4X64 L;  5KNC A;  4LAA A;  4HJ8 A;  4FXG C;  2WAQ B;  2IJ0 A;  4H13 C;  2FMC A;  1C4Q A;  4OXP A;  4L5R C;  1UE1 A;  3E9H A;  5G3L D;  4CBV A;  3TS2 A;  4AH6 A;  4A75 A;  2H1E A;  5KRU A;  1H9S B;  1EY9 A;  1EU4 A;  2F0V A;  2BDN A;  4MZ9 A;  5J22 A;  2DNE A;  4OEM B;  2LMC B;  4QGU A;  1UEA B;  4IAL A;  2E74 C;  4RWS C;  1H9S A;  1WYD A;  4BY7 G;  1EEI D;  1VQK A;  2JEA I;  2SNM A;  4EQN A;  2B2V A;  2F0H A;  1V8Q A;  3M7G A;  3NEN A;  3I4N B;  1B4O A;  4X66 Q;  1LAC A;  3FKI G;  5KIX A;  4LW1 A;  2B2W A;  3OMG A;  4EGV A;  4EX5 A;  1IW7 D;  4JI7 L;  4DR4 Q;  2I5L X;  2EIF A;  4HTH A;  5IP9 G;  4BBR H;  4ZLT F;  2Q8T A;  3U50 C;  2BE5 C;  5E3F A;  4A3I G;  1YI2 A;  4KKU A;  4GS3 A;  1HR0 W;  2RF4 A;  3EVQ A;  1F9P A;  1XNQ L;  5IYC G;  3M4P A;  4X3S A;  1Q46 A;  1NTG A;  4K8J A;  5CC4 A;  4OO1 G;  2E76 C;  2EY2 A;  4K0K L;  3AMU A;  4JV5 Q;  3EN2 A;  1ENF A;  1SDF A;  3D0F A;  1X55 A;  1LUZ A;  2QKI C;  1KC8 C;  3SDZ A;  3D4W A;  2WAQ G;  3HGB A;  4A3B G;  1GM5 A;  4U68 A;  4A3M B;  3EBE A;  4NDX A;  1A62 A;  1CKN B;  2F0K A;  2R7Z H;  1GOZ A;  1JJG A;  2Q8I B;  2FIN B;  1D8L A;  3TS0 A;  4A3L H;  3S24 A;  5HY6 A;  2OTJ A;  1XPO A;  1CKM A;  3GP7 A;  2AMC B;  2SNS A;  1CKN A;  4KKS A;  5BR8 Q;  2ZXP A;  2QEJ C;  3STB C;  4HMI A;  2K5N A;  3LNN A;  1HZC A;  2MP1 A;  1SNC A;  5GAH C;  3E9I A;  3I4N G;  1EQT A;  2NTT A;  1PFB A;  4JBK A;  2XN9 C;  1DCZ A;  4A3G H;  1N33 Q;  1AE2 A;  5FO8 B;  3DWA A;  5M3F G;  1STA A;  2KCC A;  4JPB W;  1CA6 A;  1KXL A;  1PTO C;  3P1H A;  5CYU A;  3BS1 A;  1E1T A;  4RFB A;  1I4H A;  5I6Y A;  1GUW A;  3GV3 A;  3MC0 B;  3E3X A;  3CCL A;  3UI2 A;  4N9P A;  2P5Z X;  1Y1W H;  3CMA A;  1BVS A;  2NVX H;  3TRZ A;  1V43 A;  2ZXR A;  4P71 A;  3TP8 A;  1X3G A;  4GOP B;  4A3M G;  5HGQ A;  4OON A;  3FVQ A;  4HCE A;  3S1R H;  3M3Y H;  2PNR C;  4YWK A;  4OGQ C;  4ZQ3 A;  2F3V A;  1ZYR D;  1VQ7 A;  4OWX B;  4A3F G;  3NTH A;  4JV5 L;  4WOR A;  4DN4 M;  2BDO A;  1PZK D;  4GOP A;  1M4V A;  2Z6K C;  1W3S A;  3K5O A;  1EWH A;  5ELC A;  2QEX A;  1TWC B;  2EJG C;  3VR3 A;  1QE6 A;  2A6H C;  3FPP A;  3F8T A;  1MBY A;  5JAV A;  1AZP A;  1EQV A;  3BJU A;  3Q23 A;  1PDQ A;  4G7H C;  1QNU A;  3TZU A;  4DR6 Q;  2RQX A;  2HQL A;  4K6D A;  2RDG A;  1ZKO A;  1TWG H;  1O7Z A;  1SAP A;  3HKS A;  1W2B A;  1VF7 A;  3PUW A;  1KIX A;  4A76 A;  3SEB A;  2R92 H;  1N33 L;  2B2V C;  2JA9 A;  5F2D A;  4C3J G;  4B08 A;  2Q2U A;  1R9T H;  4HJ7 A;  3OTO Q;  1E2V A;  4OWT B;  1I4P A;  4FYD A;  1PTO F;  2B2W C;  3CPF A;  2OQ0 A;  4F8M A;  1OXV A;  1QWY A;  4B3S L;  1I3Q H;  2PZW A;  5C3W A;  3V2T A;  4JCV E;  2B2U A;  2ZJR A;  1B9M A;  3S15 B;  4ZUJ A;  3FEW X;  2CFM A;  2MFI A;  1JMC A;  5HUR A;  2PZT A;  1XTD A;  2KOL A;  2F0U A;  1JCK B;  2YTV A;  2ENB A;  3FDT A;  2B29 A;  5COY A;  1WTO A;  1J5E Q;  2JK8 A;  3I7F A;  3RLO A;  2UUC Q;  2TMP A;  2L1B A;  4DXF A;  1AW7 A;  1S5F D;  1N34 Q;  2NYZ D;  2ZXO A;  3D4D A;  5C0X I;  3KDF B;  3CQZ B;  1T5E A;  3AYH B;  3BU2 A;  5DAU A;  1PH8 A;  1ENA A;  3PF4 A;  3MEF A;  1IXR A;  2MJ8 A;  1EEF D;  4ME3 A;  4A3E H;  4C1N K;  4FO2 A;  4JG2 A;  3S9W A;  4B3R L;  2UUA Q;  3OWE B;  5J3B A;  3QR8 A;  4LF8 Q;  3MFY A;  3MA2 B;  4FVM A;  3J81 L;  2VXW A;  3HOY B;  4LUO A;  5D3D A;  1UEB A;  1U9R A;  2NN6 I;  3KJO A;  3VR6 A;  5FJ8 H;  2N49 A;  3D6W A;  5JJI A;  3SR1 A;  2F0O A;  4POF A;  1VS0 A;  1EIY B;  2OQK A;  1VQA A;  1FL0 A;  2JA5 B;  4IFD I;  1YJ9 A;  2PI2 E;  3K5M A;  4DUY L;  1BCP D;  3NEM A;  1NMF A;  1K3B C;  1EYG A;  3KFU A;  3OSO A;  5I2Y A;  3VA5 A;  3ICE A;  2K32 A;  2A68 C;  1EQR A;  5GAD C;  3I4M G;  1GUG A;  1PVO A;  3CCE A;  4BXX H;  4O2D A;  1TR5 A;  4L6T B;  2K1B A;  4HED A;  3NE5 B;  1O7L A;  4DR2 L;  4OWW B;  4G7Z C;  2IW3 A;  2UUC L;  1B7Y B;  3UE1 A;  3S1Q H;  3UDX A;  4GOP C;  1HUM A;  2I0Q A;  1STB A;  4UP8 A;  5D65 A;  5DLQ E;  5C3E G;  4A3K H;  3RMH A;  2VY3 A;  3VYS A;  3HOX H;  2JA7 H;  4JI0 L;  4IUQ A;  1HCZ A;  2N55 A;  1BR9 A;  1Y69 U;  4UY8 C;  1EU3 A;  1O7Y A;  1ILP A;  2D5D A;  4CDF C;  4L5S A;  1K3R A;  2M00 A;  2L12 A;  4DV2 Q;  3K81 C;  3DWP A;  1SE8 A;  1BNZ A;  5EGT A;  3H6M A;  1ICF B;  5C4J H;  1KNE A;  3A56 A;  4PZ7 A;  3BZD B;  4TKO B;  4HIK A;  2NVQ H;  2IY5 B;  3H09 A;  3K5L A;  4JYA Q;  3L3O C;  1J8I A;  2J7Z A;  1PV4 A;  1H9J A;  3L2P A;  1MSH A;  2B2Y A;  2F4I A;  2PYK A;  4M1U B;  1XMQ Q;  1PYS B;  1NCV A;  2M2L A;  3HOU H;  4GN3 B;  2CQO A;  2H4O A;  3L7Z C;  3H15 A;  2VUM H;  2B2U C;  1K83 H;  5C0X H;  1O78 A;  3MXN B;  3C1F A;  1XJV A;  3SHL A;  3BZK A;  1WCM H;  1VQP A;  5IGC A;  1I94 Q;  2VZA A;  3HRZ C;  5IT9 L;  3J80 L;  2K5V A;  3MXN A;  5KYL A;  1IYV A;  1IBM L;  5IOC A;  3PIP A;  2PW7 A;  1GD7 A;  2YV5 A;  2PI2 A;  2A74 C;  4P73 A;  4HIO A;  4WJW A;  3G4S A;  5ELF A;  2GA4 B;  2EYO A;  5EPK A;  4CKE A;  4ZKC B;  2HD3 A;  4R8N A;  1LTA D;  2AWO A;  2DJG C;  3TBI B;  1G51 A;  2D2C C;  2A73 B;  4J15 A;  2NN6 H;  1EY6 A;  4A93 H;  1QZH A;  4NPS A;  1F2Y A;  4JBM A;  4IFD H;  4WFN 3;  1GVP A;  4YWM A;  4DR1 Q;  2L4N A;  2F0T A;  3W5O A;  4DK0 A;  1JJC B;  2QA4 A;  4DR3 Q;  4RMF A;  1NE3 A;  3HOW H;  4A3C G;  3Q6S A;  5T1G A;  1RL2 A;  1CK1 A;  3RNU A;  1QZG A;  3R8B A;  1G2S A;  1TWH H;  1VQC A;  4LF5 Q;  3S16 B;  1YBY A;  5K36 G;  5NUC A;  4XQN A;  5KND A;  4DKA C;  1VQ4 A;  4MNO A;  2F0E A;  1DM0 B;  4JYA L;  4GLX A;  5FO9 B;  3CRL C;  3I72 A;  1PH9 A;  2D9U A;  4JI1 Q;  1EWI A;  4LF4 Q;  2X69 A;  4JI6 Q;  4BA2 I;  2XGT A;  4KMU C;  1EL0 A;  3BG3 A;  3M9B A;  2HHH Q;  1VQB A;  1DOM A;  2K14 A;  1JOO A;  2OCE A;  4O1N A;  4KTA A;  2AWN A;  3DUZ A;  1YNJ D;  3AQQ A;  3D6C A;  2Q2I A;  4R4O A;  2UXD L;  1I94 L;  3QO2 A;  4IN3 A;  3WWV A;  4LF7 Q;  4J8Q A;  3Q22 A;  3KK7 A;  1YHB A;  1TWA H;  3SGI A;  1DON A;  1K0R A;  4LUZ A;  4LJZ C;  4Y7N H;  2UUB Q;  3RN2 A;  2L55 A;  1I4G A;  1DD2 A;  3PUX A;  3PO3 H;  4Y52 H;  1HZA A;  5AFW A;  1E7Z A;  4BBR G;  2D0O A;  2K5W A;  4Z9C B;  2Z9H A;  3G6E A;  4DUZ Q;  1A0I A;  1PZJ D;  1TU2 B;  4OIJ A;  1MKH A;  2EPB A;  4C2M H;  1ROD A;  2JE6 I;  1YIJ A;  4DR1 L;  1C9O A;  4RGN A;  5M5W H;  1SXT A;  2JA6 B;  4JVZ A;  4KY5 A;  1SN8 A;  2RHQ B;  4PQX A;  1FJG Q;  3H91 A;  4YY3 L;  2F03 A;  3GTO B;  2DJF C;  1STN A;  3KLS A;  2K75 A;  2NVT B;  1IBK Q;  3W1B A;  2PCF B;  3NQI A;  4LF5 L;  2R7Z G;  4AQY Q;  4RGO S;  5M5X H;  2B2Y C;  1VMC A;  1WTQ A;  4V0B A;  1YNN D;  4PMC A;  4O0A A;  1AEX A;  1J9O A;  4APV A;  4A3L G;  3F2B A;  2WFW A;  4I7A A;  2QGQ A;  1I50 H;  2PQE A;  2Z0S A;  1HA6 A;  5C4X H;  2KHS A;  4QCL A;  3GO5 A;  1CKO A;  1PHJ A;  3VA7 A;  4DR5 L;  4JI6 L;  1Q82 C;  2WAQ E;  1LO5 D;  1HNX Q;  4S3S A;  3RLF A;  3D4R A;  1CM9 A;  1KRT A;  1Z47 A;  3WOE A;  3LWE A;  3M4Q A;  5JJK A;  2OTL A;  2R3Z A;  3DEP A;  1Q1E A;  1JR0 D;  4F88 A;  4A3G G;  1SYF A;  1G6P A;  4X64 Q;  1WTV A;  2PW5 A;  1PH1 A;  1SJE D;  2B2T A;  1BDO A;  4B3M L;  3CAM A;  4MN3 A;  5M9O A;  3C3L A;  3BYY B;  1SJH D;  3OOC A;  1CHQ D;  4L5Q A;  3A8K E;  2KQ3 A;  4NP5 A;  2JA8 H;  1KDC A;  3MHB A;  2R92 B;  5FKA C;  1SMY D;  2GVA A;  3M4Y A;  3OPO A;  4IJL A;  1Y1W G;  2N78 A;  3ITP A;  1AP0 A;  1L2F A;  1VQ6 A;  4AYB G;  4H0L C;  4ZAI A;  4DUZ L;  1KAB A;  4ULL A;  1K8A C;  1X6O A;  2AUK A;  1TY2 A;  3E6Z X;  4CDC C;  2LFN A;  3TQY A;  4OX9 L;  1IZ6 A;  4JI7 Q;  4MTK A;  1YVC A;  2K33 A;  1AFP A;  4HCS A;  4LNQ A;  4BY7 B;  1RIP A;  3HG9 A;  3GTG B;  2WKD A;  1S3O A;  4GLA C;  1XWE A;  4LFC L;  4LFA L;  4NXM L;  3NQT A;  4WJ3 M;  1HUN A;  3I70 A;  1XNQ Q;  3FKI B;  3VR5 A;  4JW0 A;  1G2T A;  1IW7 C;  2ES2 A;  2AHO B;  3HOV H;  2IWH A;  3GTJ H;  1WVL A;  4DAY B;  2HDM A;  3I8Z A;  2FMM A;  4FNF A;  2K52 A;  5EBD A;  2PMZ B;  4PG3 A;  3CHB D;  1S72 A;  3PIP 3;  2ATW A;  2VL6 A;  5CV9 A;  4A3E B;  3Q0A A;  1B8A A;  4DAY A;  1HNX L;  3S1N H;  1NSN S;  3NPP A;  2Z6K A;  3TZD A;  4K14 A;  5JEA H;  3IAY A;  3PCO B;  1EYD A;  3K7A H;  3R93 A;  2R61 A;  2R7D A;  4KHZ A;  2R92 G;  2R93 H;  3UDI A;  2HIX A;  4HIM A;  4A3B B;  1B2T A;  1B9N A;  3C1E A;  3HFZ B;  2GN5 A;  1TVX A;  3CD6 A;  3A0J A;  3S17 H;  1E22 A;  1VQO A;  1STG A;  2IX1 A;  1JT8 A;  3J81 j;  1IYU A;  1G91 A;  2A6E D;  3JAM E;  4PZ6 A;  3T1H Q;  1I4X A;  1UE7 A;  2RHS B;  4P74 A;  2QDB A;  3NUC A;  3VR4 A;  4JI8 L;  1JOQ A;  4JI3 L;  5BN3 A;  2F0P A;  2HCI A;  5M3M H;  5HGT A;  3GTM H;  3DMU A;  2E2J H;  4A3D H;  2A69 C;  3A7A B;  1DZ1 A;  1FNV A;  2DUD A;  3KLR A;  2CH4 A;  4HAE A;  5M3F B;  1QNK A;  2XVS A;  5EQ0 A;  2YTX A;  4KJN A;  3PSI A;  2E2I B;  2IHE A;  2PPB C;  4A3E G;  2CWP A;  5E4W C;  4BWG B;  1I6H B;  2E8G A;  1PFM A;  5LMU L;  1V9P A;  1F9Q A;  1DOL A;  1HQM C;  5EPL A;  1YJW A;  2KED A;  5M5Y B;  3HOX B;  3GDE A;  2NVY B;  3CP0 A;  4A3J H;  1L1O B;  4LUV A;  2JQO A;  3CW2 C;  1V1O A;  4R8I A;  1SMX A;  1V1P B;  1ZYR C;  2ALY B;  3TSS A;  5IGE A;  2SEB D;  5FJ8 G;  2B2T C;  1CZW A;  4IO9 A;  4A3F B;  4RG1 A;  2ZTE A;  4BBS H;  1FR3 A;  1YIT A;  1L1O A;  4F87 A;  1SYG A;  2F0G A;  3VYR A;  3GQB A;  5CV5 A;  2XIW A;  4DA2 A;  1V1P A;  1B3A A;  4DNT B;  2RDF A;  1A6X A;  1K8G A;  1PLF A;  5C4J B;  3S14 B;  1AH9 A;  5K5P A;  3CC2 A;  5COR A;  4GNX B;  3A5U A;  2K50 A;  1IKL A;  3B6Y A;  1XTC D;  1EYC A;  3JAM c;  3K59 A;  3AFQ A;  4FF2 A;  4XXE A;  1JE4 A;  4BXX G;  4GNX A;  3T1H L;  3I55 A;  1SNP A;  3A74 A;  4HJA A;  3QOL A;  1QG7 A;  2KVM A;  4YWL A;  2K4K A;  4BY1 B;  3IFD A;  1HR0 Q;  3IRB A;  4B3S Q;  3E0E A;  2F52 A;  2MGS A;  1EFW A;  3M4O H;  4J1M A;  3TN2 A;  1X9N A;  2C9O A;  2K28 A;  2C35 B;  3PMF A;  1VQN A;  3F1Z A;  5EPJ A;  4C3J B;  5C44 H;  5EKL A;  4A3K G;  2BOS A;  1VQJ A;  2V1C C;  3HOX G;  2KEC A;  2JA7 G;  3L9A X;  2NWG A;  4MTN A;  4TRD A;  3SE0 A;  1EOT A;  3R3O A;  5CBE E;  5KEE A;  3CCJ A;  2BE5 D;  1VQD A;  3P20 A;  1WJJ A;  1YHA A;  1QVG A;  4K5X A;  5EAY A;  3K0Y A;  5ELB A;  3DM3 A;  4K8I A;  5E1F A;  4A93 B;  3GTL H;  4J6H A;  1FGB D;  3E5S A;  5IOD A;  2I07 B;  1QUQ B;  4K2K A;  3K0X A;  4LFB L;  1HNW L;  3P75 A;  5IGB A;  1N8R C;  1X32 A;  4C56 C;  5EBC A;  2D62 A;  1VQM A;  3J7Y W;  4B3R Q;  1QUQ A;  1II3 A;  3ER0 A;  3I3C A;  3U9O A;  3CCR A;  3C46 A;  1ASY A;  3HOU G;  1BXT A;  4N9T A;  1DOK A;  5C4H A;  4DNR B;  3A8J E;  2CCZ A;  2VUM G;  3NHH A;  5C0X G;  4BY1 G;  4XT1 B;  1QVC A;  3CU7 A;  1WCM G;  4RA8 A;  1JWM D;  2E2H B;  1SLJ A;  1EIF A;  4DUY Q;  1W6J A;  5IIF A;  4ALP A;  5LMN W;  3D8G A;  5DM6 3;  1HR0 L;  1U4P A;  3LGJ A;  4GKK L;  1WOC A;  3R2I A;  3Q8D A;  1RTO A;  2DNC A;  4XYQ A;  1PTO D;  1BCP C;  3N52 A;  2NN6 G;  4TSS A;  2SDF A;  3RZO B;  4A93 G;  1LTT D;  4X62 L;  2EYH A;  1FD7 D;  3FP9 A;  4DR2 Q;  3NBH B;  4IFD G;  1CQV A;  1JE5 A;  3IFT A;  1PTO H;  1B44 D;  2JJQ A;  3I4M B;  3MAQ A;  1G6Z A;  1SYB A;  4CKC A;  1KTK A;  3TME A;  1Y14 B;  2XSC A;  4CDD C;  3NTI A;  1B3Q A;  4RHS A;  3NBH A;  1OO9 B;  2ICE C;  4LF9 Q;  2NB0 A;  4JI0 Q;  3HOW G;  1BO0 A;  2A19 A;  4RHR A;  2ZTC A;  1SNQ A;  3JAM i;  1L1O C;  3KDF A;  3TRE A;  1Y8N B;  4IPC A;  4JI2 L;  5JJZ A;  1AN8 A;  4HID A;  1E1O A;  1HNZ Q;  2HUG A;  1HFN A;  2F3I A;  5C3E B;  4DV6 L;  3T51 B;  4KY7 A;  2A6H D;  3KOJ A;  2Z6B A;  5IP9 H;  1EYA A;  1U5K A;  1GO3 E;  5JVG 3;  1QB5 D;  2F0S A;  1TS3 A;  4A3I H;  1Q3L A;  1A2T A;  2AUJ D;  4FF3 A;  1ESF A;  2WB1 B;  4KY6 A;  4GNX C;  3CRK C;  4OO1 H;  3WDN A;  3BYT B;  1AZQ A;  4MIU A;  5CMD A;  5EJW A;  3S2D H;  3CCQ A;  1BQQ T;  5JPM C;  2L11 A;  4IUR A;  1FVI A;  5ELO A;  2Z4I A;  1ML0 D;  1SE4 A;  2CVR A;  3H0G H;  4HJ5 A;  1STY A;  4DV3 L;  4L5T A;  3CPW A;  3AFP A;  3DEO A;  1WTW A;  3PO3 G;  2F0Q A;  4RGM A;  2BCO A;  4ME5 A;  1L0X B;  2RVL A;  1UUP A;  4R9W A;  1NJI C;  2NZO A;  3HP3 A;  4YIJ A;  1DYQ A;  4LMQ D;  5ISR A;  1IBM Q;  1VQE A;  1R4P B;  1S5C D;  4CJ1 B;  3I56 A;  3S1M B;  1Q86 C;  5IYB H;  1A63 A;  1VDZ A;  3RZD B;  4RAU C;  3QWN A;  2X6G A;  2VQE L;  1Q7Y C;  1H9R A;  3UDG A;  3I4L A;  3OIP A;  1B53 A;  2M9V A;  3J81 E;  3HOZ B;  2L0C A;  1V1Q A;  1SFO B;  5I9O A;  4JI4 Q;  2O4X A;  2K6A A;  1MJC A;  2XTI A;  3QG1 A;  4LF9 L;  1BKB A;  2F0L A;  1EWC A;  1X56 A;  4L8J A;  1B1Z A;  2OT2 A;  4H44 C;  4E6I A;  4IPH A;  1PZI D;  3GTQ H;  1DXM A;  2HCC A;  1GKH A;  1PYW D;  1EY5 A;  1LV9 A;  2WB1 G;  1HNZ L;  3H3V I;  1MHW C;  2YTY A;  1SRU A;  1U0L A;  2KCT A;  2NBF A;  4C3H H;  1LT5 D;  5C4X G;  1TWF H;  2OWO A;  4YHH L;  3K80 C;  2PNH A;  4HSP A;  2QW7 A;  3HOV B;  1FGU A;  1S4Z A;  1EZ8 A;  5LMN L;  1F2M A;  5C5M A;  4A3M H;  3GTP B;  1S5B D;  2BH8 A;  1SBB B;  5JJL A;  3URY A;  3OMC A;  2I5H A;  4UP7 A;  1Q8I A;  2EZV A;  1EY0 A;  5I4D A;  5A2Q L;  1EUJ A;  3QB3 A;  3K6O A;  2RSO A;  3S2H B;  1K8M A;  1TS2 A;  2JA8 G;  2HQE A;  3P7J A;  1HA5 A;  2KEE A;  4O42 A;  2R93 B;  4QIW E;  2UXD Q;  4QQB X;  1EZ6 A;  4PNY A;  5FK9 C;  3HOZ G;  1PRT B;  2Z1C A;  1GUO A;  2B39 A;  2WKC A;  3S17 B;  2QCP X;  1HZB A;  1A3T A;  1RTN A;  2QIL A;  3J81 c;  1R4Q B;  3OW2 A;  3A55 A;  3EIV A;  1HPC A;  4L63 B;  4JI4 L;  2ASB A;  1P8L A;  4AYB E;  4DR7 L;  3T4A C;  3M7N A;  1CZG A;  2E2J B;  1EY7 A;  3J7A 5;  3HOV G;  1NUC A;  1SR3 A;  3W1G A;  4X3T A;  4BBR B;  4M8A A;  4YY3 Q;  3PV0 A;  1X3F A;  3QJY A;  1IKM A;  2ID0 A;  2F0I A;  4QUC A;  3SK5 A;  1E3P A;  4NMZ A;  1LT3 D;  4P75 A;  1JJ2 A;  3CC4 A;  1E0B A;  3J7A F;  2XWB B;  5E4X A;  5JEA G;  5GRO A;  5C0X J;  5IT9 E;  3J80 E;  1AE3 A;  2K5D A;  1LTL A;  1TWC H;  2R93 G;  4BS9 A;  2EYP A;  1UWV A;  4DR5 Q;  2PQA B;  3TDQ A;  2A5H A;  4KLK A;  3RD4 A;  2R7Z B;  1YNN C;  1BBX C;  3CC7 A;  2MQH A;  3BVM A;  1E2Z A;  4JBW A;  2PQA A;  4X6A H;  3KJP A;  1NBW A;  1BBW A;  1VF5 C;  1E2W A;  4B3M Q;  4K6L A;  4IJH A;  1STH A;  3DWQ A;  3H3V H;  4DAP A;  2LKV A;  2EYF A;  3ZYY X;  1LTR D;  2YYZ A;  4A3D G;  2XNA C;  4QIW B;  1DGS A;  4A3G B;  2LXJ A;  1MSG A;  4IUU A;  4A4I A;  4IFD J;  3K8A A;  2NZH A;  4KN7 C;  5CV7 A;  5FLX L;  1JC7 A;  4POG A;  2OXP A;  4I65 A;  3KLS X;  3PQI A;  1IL2 A;  4OX9 Q;  3GTK H;  1SMY C;  1VQG A;  4G57 A;  5C44 B;  1KHI A;  4DV7 L;  4PMW A;  1Y1W B;  5JVH 3;  1MI2 A;  1F9S A;  1UNS A;  1VQ8 A;  4AYB B;  2NVX B;  4A3J G;  4LFC Q;  4LFA Q;  1MIU A;  4NXM Q;  2O5I C;  1KD1 C;  2NTS A;  2PMZ E;  3CQZ H;  2CW0 C;  3S1R B;  3M3Y B;  1ONL A;  2UXB Q;  3J80 c;  3CME A;  1K9M C;  2F0F A;  1HH2 P;  4NXN L;  1HRJ A;  4BBS G;  2GVB A;  2Y0S G;  3ERQ A;  4F7X A;  3I73 A;  1UAP A;  4GZY C;  1WD1 A;  5D3I B;  4DV5 L;  2F4V L;  2N8N A;  1XPU A;  2UXC L;  5IE8 A;  1HTL D;  1SNO A;  2VB2 X;  3CCU A;  1IBL L;  1J6Q A;  3HOY H;  1I4R A;  2E5L Q;  1GHJ A;  4UPA A;  3PO2 H;  1WI5 A;  1JB3 A;  1XXG A;  4JI5 L;  4XT3 B;  1TWG B;  3EFX D;  2RCN A;  1N36 Q;  3ONA B;  3OYY A;  3K57 A;  1MGS A;  5H1S E;  4C3I H;  2JA5 H;  1QJO A;  1PRT C;  3KF8 B;  4IUN A;  3TEH B;  1WFQ A;  1YZ6 A;  5I6W A;  3QIA A;  4RKB A;  1QOH A;  4RCO A;  1KDA A;  4DV4 L;  2J4X A;  3SK6 A;  1D2B A;  5C44 G;  5FO7 B;  4KV6 A;  1R9T B;  1KNA A;  3KF8 A;  2KCN A;  1A15 A;  4JI8 Q;  2L15 A;  4JI3 Q;  1XMO L;  4FF1 A;  3CXC A;  1I3Q B;  5IWA L;  3ERO A;  4NB3 A;  1XNR L;  3BZC A;  5A35 A;  2A6E C;  3UDF A;  5DEH A;  1F2L A;  2F3W A;  4QUF A;  2CHB D;  4CDE C;  1BOS A;  2SOB A;  1LT6 D;  3HKZ B;  4OEL B;  1SE3 A;  2K01 A;  1Q90 A;  4JBJ A;  1NMG A;  3ZJY C;  5IYD H;  2UXB L;  3BDC A;  1PXU A;  2K7V A;  5LMU Q;  3FRP B;  4KHP Q;  1K28 A;  2K03 A;  5IGF A;  4RCN A;  1C0A A;  2LSS A;  1HZ9 A;  3PF5 A;  2NUC A;  1I6V C;  1NY4 A;  1RF2 D;  4ZRZ A;  4G7O C;  2DY7 A;  2VQF Q;  4X3U A;  4IUP A;  4TQU S;  1G29 1;  1VQH A;  3A8I E;  3I91 A;  2CKZ B;  2FFK B;  5EKI A;  4DXG A;  1JOK A;  2G9H D;  2E5L L;  4R4I A;  3BDO A;  4PV1 C;  1HHV A;  1PRT F;  5FLM H;  4KD4 A;  1N36 L;  2JSO A;  1WD0 A;  1OXT A;  3MEH A;  4V19 0;  1JIC A;  4H7B A;  1LAB A;  2K5Q A;  5G3L F;  4B9X A;  3K7U C;  5E7N A;  4AIM A;  3X3N A;  2DY8 A;  3H0G B;  1KAW A;  4QB4 A;  3NK9 A;  1Z7T A;  3VR2 A;  1K73 C;  2B63 H;  1O7I A;  2KA7 A;  3T1Y L;  3UE0 A;  3J80 i;  1GHK A;  3HKZ G;  1HFG A;  3CCM A;  1BCP B;  3BDL A;  3G6J B;  1N9W A;  5IP7 H;  1VQ9 A;  2EY5 A;  2XRQ D;  3MXG A;  5T1I A;  1ET9 A;  5DM7 3;  2TSS A;  4DV0 L;  4GKJ L;  2XRS D;  1LTS D;  2CQA A;  1B70 B;  1PMR A;  3I4O A;  2B8G A;  4EQO A;  1PH5 A;  3VYT A;  1EIH A;  1F9R A;  3S1Q B;  2WAC A;  3EQL C;  4PMB A;  2J0T D;  3RLN A;  1CSQ A;  4X3K A;  1CA5 A;  1H9K A;  3RUZ A;  4A3K B;  4KHP L;  1CFM A;  3KUP A;  5JEA J;  4B3T L;  2JA7 B;  2E2D C;  4X65 L;  1HTP A;  2MUY A;  4LFB Q;  2K05 A;  1I4Q A;  2IHF A;  1I5F A;  1HNW Q;  4IQZ A;  1M8A A;  2VQF L;  3GTQ B;  4WJ4 A;  1LT4 D;  1CTM A;  3NBI A;  2EJM A;  3S16 H;  4C3H B;  1TS5 A;  4FXD A;  1N32 Q;  1TWF B;  1UE5 A;  2NZ1 D;  4LWC A;  1PYB A;  2O2L D;  4IOA A;  2WII B;  3H0G G;  1NNX A;  2NVQ B;  1L0Y B;  2EQS A;  3ULP A;  2ZM6 Q;  1PFS A;  2JEB I;  1T5X D;  3W3A A;  1S5D D;  4JK1 C;  5CV8 A;  2EOT A;  4QL5 A;  4IZ8 A;  1YEZ A;  3HOU B;  1WTX A;  1Y8O B;  3MTS A;  1KRS A;  5TSS A;  4R4C A;  4FDB A;  1SNM A;  1PH7 A;  2VUM B;  1IHZ A;  1K83 B;  5IYB G;  4FP5 D;  3H94 A;  4GKK Q;  1VMP A;  1WCM B;  3TP7 A;  5CGK A;  5CR3 A;  1K0S A;  3K58 A;  2VS1 A;  2MO0 A;  4NW2 A;  1D5M C;  1GJX A;  2K5H A;  4X62 Q;  2A69 D;  3DM1 A;  4OO1 I;  1Y8P B;  2JN4 A;  1SEB D;  4XIG S;  3MFG A;  4UAI A;  1LLR D;  2Q8R E;  4K5W A;  4X66 L;  3K5N A;  2RKS A;  3AEV A;  2CWA A;  2EXZ A;  4C3H G;  2FHT A;  4KJO A;  4DR4 L;  2JA6 H;  1TT2 A;  3PUY A;  1Q8K A;  5L37 A;  4WRD A;  4KI0 A;  3CCV A;  4JI2 Q;  1KDB A;  3U4V A;  3GTO H;  3LWU A;  2EXD A;  1D1I A;  1U4L A;  2F0N A;  5GAE C;  2NVT H;  2AQ1 B;  3SK4 A;  4DV6 Q;  1X3P A;  2L5T A;  2WB1 E;  1N32 L;  3HOW B;  4DV1 Q;  3AU7 A;  3NXW A;  4DK6 C;  2PZU A;  4JOI A;  1VCI A;  4DGZ A;  2N88 A;  1TWH B;  5ELE A;  1ENC A;  1EY8 A;  1MJE A;  1SE2 A;  1KLG D;  4LK1 C;  2ZM6 L;  3STB D;  1OXU A;  4IUT A;  1JOR A;  2OF1 A;  1PFN A;  5EKK A;  2Z8L A;  5GAG C;  2V4D A;  3OWF A;  2XWJ B;  1DJR D;  1KAA A;  4CJ0 B;  5BR8 L;  4DV3 Q;  1P16 A;  1Y1V H;  3J7A V;  2PO4 A;  4DU9 A;  3E0J A;  1XYI A;  4QY7 A;  4HJ9 A;  1A2U A;  1KQS A;  4NKL A;  1TWA B;  2JXM B;  5KYI A;  4Y7N B;  4ZCK A;  2KEN A;  4QF4 A;  5J39 A;  2I46 A;  2BA1 A;  2VQE Q;  1S5E D;  1VQL A;  3PO3 B;  3SXH A;  1X65 A;  4LF6 Q;  1SYE A;  1RDP D;  5I2X A;  2EJF C;  2I5M X;  3IKJ A;  3G71 A;  3N6R A;  4C2M B;  1B50 A;  4BY7 H;  4KN4 C;  3GTK B;  2O5J C;  3GTG H;  1JB7 A;  4DNI A;  3PIO A;  1NR4 A;  5M5W B;  2N3S A;  3FKI H;  3A5Z B;  1C8C A;  4DV1 L;  4YHH Q;  5FOB B;  3T13 A; 
#chains in the Genus database with same CATH homology
 1XPO A;  3J7A 5;  3HOV G;  2GVA A;  1SR3 A;  1CKM A;  2YU9 H;  2AMC B;  4IJL A;  1CKN A;  2N78 A;  5BR8 Q;  3W1G A;  3STB C;  5IYC H;  5LMN Q;  1Y1W G;  1L2F A;  1VQ6 A;  2K5N A;  4R4Q A;  4AYB G;  4YY3 Q;  3PV0 A;  1X3F A;  4DUZ L;  1HZC A;  2ID0 A;  3JC6 6;  5GAH C;  2OTJ A;  3E9I A;  1K8A C;  3I4N G;  1X6O A;  4JBK A;  4A3G H;  3TQY A;  4OX9 L;  1N33 Q;  1AE2 A;  1E3P A;  1IZ6 A;  4P75 A;  1JJ2 A;  4JI7 Q;  4DR6 L;  3CC4 A;  1YVC A;  5AJ3 Q;  5JEA G;  4A3B H;  5GRO A;  4EQ5 A;  4R1J A;  2ZJP A;  5C0X J;  5M3F G;  4LNQ A;  1RIP A;  1AE3 A;  1LTL A;  1TWC H;  4GLA C;  1S3O A;  4LFC L;  4WJ3 M;  4LFA L;  4NXM L;  2R93 G;  1XNQ Q;  1KXL A;  1UWV A;  4DR5 Q;  2PQA B;  1E1T A;  2R7F A;  4KLK A;  3RN5 A;  2ES2 A;  2AHO B;  2HIV A;  1VQF A;  1ASZ A;  3CCL A;  3HOV H;  4GN5 A;  3GTJ H;  3CC7 A;  3CMA A;  2MQH A;  1BVS A;  1BBU A;  4DAY B;  3OTO L;  4JBW A;  1Y1W H;  4L5R C;  2BH2 A;  2VNU D;  2PQA A;  4X6A H;  2NVX H;  3TRZ A;  1PH6 A;  3KJP A;  2K52 A;  4DAM A;  1IYJ B;  1NBW A;  1BBW A;  1V43 A;  4PG3 A;  4P71 A;  4B3M Q;  3U4Z A;  1S72 A;  4LF6 L;  3I4N H;  1X3G A;  4GOP B;  4IJH A;  2VL6 A;  4A3M G;  5HGQ A;  4OON A;  3S1R H;  2ATW A;  1B8A A;  3M3Y H;  1HNX L;  3S1N H;  4YWK A;  1SRO A;  3H3V H;  2Z6K A;  1VQ7 A;  4H02 A;  4OWX B;  4A3F G;  4DR7 Q;  1M1K C;  3PCO B;  4JV5 L;  3K7A H;  5M3F H;  2YYZ A;  4A3D G;  4GOP A;  1DGS A;  1OXX K;  2R7D A;  4KHZ A;  2R92 G;  2LXJ A;  4A4I A;  2R93 H;  3UDI A;  2HIX A;  1W3S A;  2Z6K C;  3K8A A;  4HIM A;  1PH4 A;  2E2I H;  4IFD J;  1J5E L;  2NZH A;  4JOI C;  1I6H H;  3HFZ B;  2QEX A;  2GN5 A;  3CD6 A;  1N34 L;  3ULL A;  1H95 A;  3F8T A;  3A0J A;  3S17 H;  1TXY A;  2ZTD A;  4POG A;  1IL2 A;  1E22 A;  1VQO A;  2IX1 A;  3BJU A;  1JT8 A;  5M5Y H;  4OX9 Q;  3J81 j;  3GTK H;  2NVY H;  4DR6 Q;  2AKW B;  2HQL A;  1VQG A;  4PZ6 A;  3T1H Q;  1KHI A;  4DV7 L;  4PMW A;  1TWG H;  1UE7 A;  3HOY G;  2RHS B;  4P74 A;  2Q2H A;  1VQ8 A;  3HKS A;  4JI8 L;  1W2B A;  3PO2 G;  3KLW A;  3DLL A;  4A3J G;  2Y0S E;  4LFC Q;  4LFA Q;  1MIU A;  4NXM Q;  4JI3 L;  3RR5 A;  3ULJ A;  4A3F H;  1KD1 C;  5M3M H;  3GTM H;  3PUW A;  2UUA L;  2PMZ E;  3CQZ H;  3PUV A;  1KIX A;  2E2J H;  4A76 A;  4A3D H;  2JA5 G;  1PH2 A;  4LF8 L;  1N33 L;  2R92 H;  2UXB Q;  3J80 c;  2DUD A;  2JA9 A;  3CME A;  1K9M C;  5AJ3 L;  2Q2U A;  1HH2 P;  4NXN L;  4HJ7 A;  1R9T H;  3OTO Q;  4OWT B;  2GVB A;  2Y0S G;  3KYH C;  3S14 H;  2BA0 A;  4BBS G;  3CPF A;  2OQ0 A;  3CCS A;  2YTX A;  1OXV A;  3PSI A;  2IHE A;  4DV5 L;  1I3Q H;  4B3S L;  2F4V L;  3M85 A;  2N8N A;  2CWP A;  4A3E G;  1XPU A;  2E8G A;  4JCV E;  5IE8 A;  2UXC L;  2ZJR A;  3CCU A;  1IBL L;  2CFM A;  1J6Q A;  2MFI A;  1JMC A;  5LMU L;  1V9P A;  1YJW A;  3HOY H;  2E5L Q;  4UPA A;  3PO2 H;  3GDE A;  1XTD A;  1WI5 A;  3CP0 A;  4A3J H;  2YTV A;  4JI5 L;  4BY1 H;  2KBN A;  2B29 A;  1L1O B;  4LUV A;  2JQO A;  2JK8 A;  2RCN A;  3CW2 C;  3I7F A;  3RLO A;  3OYY A;  1N36 Q;  2D0P A;  2UUC Q;  2ZJQ A;  1SMX A;  5H1S E;  4C3I H;  2JA5 H;  2ALY B;  5FJ8 G;  1N34 Q;  3KF8 B;  4PZ8 A;  3TEH B;  4C3J H;  4IO9 A;  5C0X I;  3L0O A;  1WFQ A;  3KDF B;  2KHJ A;  1YZ6 A;  2ZTE A;  4RG1 A;  1YIT A;  4BBS H;  3GD7 A;  1L1O A;  3BU2 A;  3AYH B;  1PH8 A;  5IYD G;  4DV4 L;  3PF4 A;  3MEF A;  1IXR A;  5C44 G;  4DV7 Q;  4ME3 A;  1XPR A;  1K8G A;  2FXQ A;  1AH9 A;  4A3E H;  4JI8 Q;  2A1A A;  1C7Y A;  3CC2 A;  4GNX B;  4JG2 A;  3A5U A;  2L15 A;  3PUZ A;  4JI3 Q;  2K50 A;  1VQI A;  3B6Y A;  1XMO L;  3CXC A;  4B3R L;  5IWA L;  3JAM c;  2UUA Q;  5J3B A;  4NB3 A;  1XNR L;  3BZC A;  3AFQ A;  4LF8 Q;  4BXX G;  3UDF A;  4GNX A;  3T1H L;  1OTC A;  4NXN Q;  3I55 A;  1VQ5 A;  4LUO A;  3A74 A;  4XTC S;  1UEB A;  4HJA A;  2NN6 I;  3KJO A;  4YWL A;  5FJ8 H;  2K4K A;  2N49 A;  1HR0 Q;  3IRB A;  4DV5 Q;  4B3S Q;  3E0E A;  2F52 A;  5FLM G;  1EFW A;  2F4V Q;  5JJI A;  3M4O H;  4POF A;  1VS0 A;  4DV2 L;  4JBJ A;  1X9N A;  2C35 B;  1VQA A;  1NMG A;  2OQK A;  1FL0 A;  5GQO A;  3F1Z A;  3ZJY C;  4IFD I;  2UXC Q;  1YJ9 A;  1IBL Q;  2UXB L;  5IYD H;  1KL9 A;  2PI2 E;  5C44 H;  4A3K G;  5LMU Q;  4KHP Q;  1EOV A;  3CF5 A;  4DUY L;  1VQJ A;  2H5X A;  3NEM A;  1NMF A;  2V1C C;  1C0A A;  2LSS A;  3HOX G;  2JA7 G;  1QVF A;  4BA1 I;  1EYG A;  1HZ9 A;  4JI5 Q;  3PF5 A;  3KFU A;  4MTN A;  3ICE A;  1T9H A;  1EQR A;  5GAD C;  1NY4 A;  3NEL A;  3CCJ A;  3I4M G;  1PVO A;  3CCE A;  1VQD A;  1WJJ A;  1YHA A;  2VQF Q;  4IPG A;  1QVG A;  2E2H H;  1XMQ L;  4TQU S;  5EAY A;  1G29 1;  4O2D A;  1VQH A;  2Q2T A;  3I2Z A;  4BXX H;  3DM3 A;  1D7Q A;  2CKZ B;  5M3M G;  4UP9 A;  4IOC A;  3GTL H;  2E5L L;  1OXS C;  4R4I A;  1E24 A;  4DV4 Q;  2B3G A;  1QUQ B;  4DR2 L;  3K0X A;  4OWW B;  5IP7 G;  4LFB L;  5FLM H;  1N36 L;  2UUC L;  1HNW L;  1B7Y B;  3UE1 A;  2HT1 A;  3S1Q H;  3UDX A;  1N8R C;  4GOP C;  1OXT A;  2D62 A;  2I0Q A;  3S15 H;  4UP8 A;  5C3E G;  5DLQ E;  4A3K H;  1VQM A;  1XMO Q;  4B3R Q;  4GN4 B;  1QUQ A;  5IWA Q;  3ER0 A;  3RZO H;  2VY3 A;  1XNR Q;  3HOX H;  2JA7 H;  3G48 A;  3HKZ E;  4JI0 L;  3CCR A;  1ASY A;  3HOU G;  3K7U C;  5E7N A;  4AIM A;  2CCZ A;  3I4M H;  1KAW A;  1CUK A;  2VUM G;  4UY8 C;  5C0X G;  1K73 C;  2B63 H;  1O7I A;  4BY1 G;  3J7Z C;  4P72 A;  3T1Y L;  4L5S A;  3VDY A;  1K3R A;  3J80 i;  3UE0 A;  1LM0 A;  3HKZ G;  1QVC A;  4JC0 A;  1WCM G;  4DV2 Q;  3K81 C;  4YCU A;  2VW9 A;  3CCM A;  1VQN A;  1SE8 A;  5IT9 c;  1SLJ A;  1EIF A;  1HJP A;  1N9W A;  5IP7 H;  1VQ9 A;  5C4J H;  4DUY Q;  3KF6 B;  4PZ7 A;  4ALP A;  5IY0 A;  2UU9 Q;  5LMN W;  4DV0 L;  4GKJ L;  4HIK A;  2NVQ H;  2IY5 B;  3I4O A;  1B70 B;  1HR0 L;  4JYA Q;  1Q1B A;  3LGJ A;  5C3E H;  4DR3 L;  4GKK L;  1PH5 A;  1WOC A;  1PV4 A;  3Q8D A;  3L2P A;  3D31 A;  3RLN A;  1CSQ A;  3KF6 A;  1X54 A;  1XMQ Q;  1PYS B;  3J81 i;  3HOU H;  4YCW A;  4KHP L;  2NN6 G;  4GN3 B;  2CQO A;  1YHQ A;  4A93 G;  3L7Z C;  2WP8 J;  5JEA J;  3H15 A;  4X62 L;  4B3T L;  2VUM H;  1K83 H;  4X65 L;  3FP9 A;  3MXN B;  4DR2 Q;  3NBH B;  1XJV A;  4LFB Q;  2IHF A;  1I5F A;  4IFD G;  1HNW Q;  1JE5 A;  3BZK A;  2DGY A;  1WCM H;  1VQP A;  2JJQ A;  4JI1 L;  2VQF L;  1I94 Q;  2VZA A;  1YNX A;  4LF4 L;  4WJ4 A;  1Y14 B;  2MO1 A;  2IT1 A;  2K5V A;  1IBM L;  3S16 H;  3PIP A;  1N32 Q;  1GD7 A;  1UE5 A;  2YV5 A;  4LF9 Q;  1LYL A;  4LWC A;  2HHH L;  4JI0 Q;  3HOW G;  2PI2 A;  2A19 A;  1PYB A;  1YJN A;  1Z9F A;  2ZTC A;  4P73 A;  1S40 A;  4HIO A;  1M90 C;  4IOA A;  3G4S A;  1Q12 A;  3JAM i;  3H0G G;  1L1O C;  3KDF A;  3TRE A;  4JI2 L;  4IPC A;  4HID A;  1E1O A;  2MNA A;  3T1Y Q;  2AWO A;  1HNZ Q;  4LF7 L;  1G51 A;  2EQS A;  2F3I A;  2ZM6 Q;  2KHI A;  4J15 A;  4DV6 L;  3ULP A;  4GLV B;  1PFS A;  4A93 H;  1QZH A;  2JEB I;  4NPS A;  3S1M H;  3KOJ A;  1X3E A;  4QL5 A;  5IP9 H;  1YEZ A;  2UUB L;  1U5K A;  1GO3 E;  4JBM A;  3RZD H;  1KRS A;  4R4C A;  4A3I H;  1GVP A;  4FDB A;  3PGZ A;  4YWM A;  1PH7 A;  4DR1 Q;  4DK3 C;  4IPD A;  4DV0 Q;  1EQQ A;  4GKJ Q;  3W5O A;  2JA6 G;  1JJC B;  5IYB G;  2QA4 A;  1Q81 C;  2R6G A;  4GNX C;  4DR3 Q;  4GKK Q;  3HOZ H;  1SFO H;  4RMF A;  1NE3 A;  3HOW H;  4A3C G;  1CSP A;  1RL2 A;  3U58 A;  3S2D H;  3CCQ A;  2VS1 A;  1FVI A;  2MO0 A;  5ELO A;  3RNU A;  1QZG A;  1TWH H;  2K5H A;  1VQC A;  4B3T Q;  3H0G H;  4LF5 Q;  4X62 Q;  1YBY A;  5K36 G;  4R4T A;  4HJ5 A;  2UU9 L;  5ELN A;  4DKA C;  4X65 Q;  1VQ4 A;  4OO1 I;  4MNO A;  4DV3 L;  1FJG L;  4JYA L;  4L5T A;  3CPW A;  4GLX A;  3AFP A;  2IX0 A;  4XIG S;  1PH9 A;  1EIY B;  3PO3 G;  4JI1 Q;  1PH3 A;  1EWI A;  1NJI C;  4LF4 Q;  4X66 L;  4JI6 Q;  2NZO A;  1IBK L;  3AEV A;  4BA2 I;  2XGT A;  2CWA A;  1IBM Q;  1VQE A;  5FLX c;  2A8V A;  4AQY L;  3M9B A;  2HHH Q;  3I56 A;  4DR4 L;  4K0K Q;  2KCM A;  1Q86 C;  1VQB A;  4YCV A;  2LXK A;  2JA6 H;  2K14 A;  5IYB H;  3ERS X;  3PUY A;  1A63 A;  1Q8K A;  2OCE A;  3FHW A;  3GTP H;  2AWN A;  2VQE L;  4KI0 A;  3CCV A;  4JI2 Q;  3U4V A;  3GTO H;  3AQQ A;  2Q2I A;  4R4O A;  1Q7Y C;  4A3C H;  1PA6 A;  3UDG A;  1I94 L;  2EXD A;  2UXD L;  3F2D A;  3WWV A;  4LF7 Q;  1UE6 A;  5GAE C;  2NVT H;  1Y1V G;  4DV6 Q;  4QJF A;  3F2C A;  1V1Q A;  2WB1 E;  1L0W A;  4JI4 Q;  1YHB A;  1TWA H;  1N32 L;  3SGI A;  2B63 G;  1MJC A;  2XTI A;  4LF9 L;  4DV1 Q;  1K0R A;  1BKB A;  4DK6 C;  4LUZ A;  4Y7N H;  4JOI A;  1VCI A;  4DPG A;  1X56 A;  3RN2 A;  2UUB Q;  3S2H H;  4TVA B;  1A8V A;  4X64 L;  4HJ8 A;  3PUX A;  3PO3 H;  4IPH A;  1MJE A;  4Y52 H;  3GTQ H;  2WB1 G;  1GKH A;  1HNZ L;  1HZA A;  4BBR G;  1E7Z A;  3H3V I;  4OXP A;  2YTY A;  2D0O A;  1SRU A;  1U0L A;  1OXU A;  1UE1 A;  2KCT A;  3STB D;  2ZM6 L;  3E9H A;  1A0I A;  3G6E A;  4DUZ Q;  4C3H H;  3TS2 A;  1MKH A;  5C4X G;  1TWF H;  4AH6 A;  4A75 A;  2OWO A;  4YHH L;  3K80 C;  2PNH A;  4C2M H;  5GAG C;  2JE6 I;  4MZ9 A;  1YIJ A;  4DR1 L;  1C9O A;  1FGU A;  5M5W H;  4QGU A;  5LMN L;  5BR8 L;  4DV3 Q;  1P16 A;  1FJG Q;  1SN8 A;  1WYD A;  2RHQ B;  1Y1V H;  4A3M H;  1VQK A;  4BY7 G;  2JEA I;  4YY3 L;  2BH8 A;  5JJL A;  2I5H A;  4UP7 A;  3NEN A;  2K75 A;  4X66 Q;  4QY7 A;  4HJ9 A;  3FKI G;  1IBK Q;  4LW1 A;  1KQS A;  3W1B A;  4LF5 L;  4EX5 A;  4JI7 L;  2R7Z G;  1EUJ A;  4AQY Q;  5M5X H;  4DR4 Q;  2I5L X;  2EIF A;  5IP9 G;  4O0A A;  4BBR H;  2JA8 G;  2KEN A;  4APV A;  4A3L G;  3F2B A;  3U50 C;  2WFW A;  1YI2 A;  4A3I G;  2QGQ A;  4GS3 A;  1I50 H;  2BA1 A;  2Z0S A;  2VQE Q;  5C4X H;  1HR0 W;  1VQL A;  2RF4 A;  4QIW E;  3GO5 A;  1XNQ L;  2UXD Q;  1CKO A;  1X65 A;  5IYC G;  3M4P A;  4DR5 L;  1PHJ A;  4JI6 L;  1Q82 C;  4LF6 Q;  4QQB X;  3HOZ G;  2WAQ E;  1HNX Q;  1Q46 A;  1NTG A;  3RLF A;  4OO1 G;  1KRT A;  1Z47 A;  2I5M X;  3M4Q A;  5JJK A;  4K0K L;  2OTL A;  3G71 A;  4JV5 Q;  1HZB A;  3EN2 A;  4BY7 H;  1Q1E A;  3D0F A;  4A3G G;  1G6P A;  1X55 A;  4X64 Q;  3GTG H;  3J81 c;  1LUZ A;  1PH1 A;  1JB7 A;  4DNI A;  1KC8 C;  3PIO A;  2WAQ G;  3OW2 A;  4B3M L;  4A3B G;  1GM5 A;  3CAM A;  1J5E Q;  3EIV A;  2N3S A;  3FKI H;  3A5Z B;  3EBE A;  4JI4 L;  2ASB A;  1CKN B;  1A62 A;  2R7Z H;  1P8L A;  4L5Q A;  4AYB E;  1JJG A;  4DV1 L;  4YHH Q;  4DR7 L;  3M7N A;  1D8L A;  3TS0 A;  2JA8 H;  4A3L H;  3S24 A;  5HY6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...