1LUZA

Crystal structure of the k3l protein from vaccinia virus (wisconsin strain)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
FCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure and functional analysis of vaccinia virus K3L reveals molecular determinants for PKR subversion and substrate recognition.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Viral protein
molecule keywords Protein K3
total genus 18
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1luzA00
4A3KH 4MTNA 1KIXA 4H02A 1HNZL 2H5XA 3HOVH 3DM3A 5LMNW 4P74A 3S1RH 1VQLA 4JI0L 4YY3Q 4A3LH 1SFOH 4B3SQ 2F4VQ 1G51A 1X3FA 1Q86C 1D8LA 2JK8A 4NPSA 3PO2H 1IXRA 4MNOA 1HZAA 4A3MG 4B3RQ 1O7IA 3W1GA 1VQOA 3HOXG 1QUQB 3I2ZA 4DKAC 2I5MX 4DV0L 4A3DH 1NY4A 2XTIA 4YWMA 3S16H 3GTJH 4DV3Q 3H0GH 3CCEA 5LMNL 5J3BA 3U50C 4BBSH 2RHQB 4HIMA 3KDFB 3PV0A 4JI5L 1WI5A 4GN3B 3UE0A 3S2DH 1S72A 4OWTB 4AYBE 1YJNA 2UU9Q 3AQQA 1TWAH 4X65L 1IBLL 2E8GA 1HR0L 2Q2TA 4PZ8A 3VDYA 1PYBA 1EWIA 4HJ9A 4JOIC 4AQYQ 4NXML 3GTLH 4X66Q 1LTLA 3EBEA 4JI6Q 3I4MG 3I4NG 1YJWA 2N49A 1KQSA 3UDXA 3AYHB 4ME3A 4BA1I 1J5EQ 4A93H 1HNWL 1N8RC 1XNQQ 2VQEQ 4DR4L 5C44G 4DV2Q 3U58A 2ZJRA 3AFQA 3M85A 2PQAA 3PF5A 1QVCA 3K0XA 5M3MG 5AJ3Q 4LF9L 2VNUD 3F2BA 1SMXA 5IYDH 3ZJYC 4OX9L 2WAQE 1GM5A 1XMQQ 3M7NA 2F3IA 2OQKA 4UP8A 4GOPC 4LF8Q 4LF7Q 3HOUG 4BA2I 4JYAQ 1KD1C 1SRUA 3HKZG 4NB3A 4DR7L 1X65A 3HOVG 1VQNA 4DV5L 4GOPB 2C35B 2K5NA 4GKJL 2R7ZG 5C4XG 1PH3A 4YWLA 1RL2A 1UEBA 3S1QH 4J15A 2JA6G 2MFIA 3CCQA 4P71A 3L0OA 3F8TA 2Z0SA 4JI2Q 2K14A 4DV7L 5IP7G 2I5LX 1K73C 4YCVA 3TEHB 1IBKL 3RZDH 4A3GH 3BU2A 1HJPA 4RG1A 1E1OA 3OTOQ 1PH2A 5GROA 3RLFA 4DUYL 2OTLA 3KFUA 1FVIA 1ASYA 3ULLA 5IT9c 2QA4A 1SLJA 3UDFA 4DAMA 5IYBH 3S17H 3PUYA 4XIGS 3CCLA 5FJ8G 4A3EH 2HT1A 4IOAA 1HNZQ 4LF4Q 1HH2P 4L5RC 1Y1WG 3KF6B 4L5SA 4JI1Q 4QGUA 1UE7A 3FKIG 2ZM6Q 1HR0W 4JI4L 4DAYB 4HJ8A 4BBRG 2HHHQ 2WB1E 2NVYH 4X62Q 1VQFA 1RIPA 3STBC 4AIMA 1I6HH 5HGQA 2IY5B 2K52A 2ZJPA 4LFBQ 4PMWA 5HY6A 4HJ5A 1DGSA 1LYLA 3HFZB 1YIJA 1FGUA 4JI8Q 3CPWA 5IP9H 4IFDJ 4Y52H 5C3EG 2UXCQ 2IX0A 2LXJA 1W3SA 2E2IH 2WAQG 2E2HH 1UE6A 3EN2A 1XNRL 1CKMA 2R7DA 4JCVE 3TRZA 2BA0A 3STBD 3CD6A 3PSIA 4JI3L 2MO0A 2PI2E 2CFMA 5IE8A 4HIOA 4LUVA 1EYGA 4JV5L 1QVGA 3ER0A 4IPHA 3HOWG 4DV1L 3M3YH 4KHPL 1SE8A 4JI7Q 1NMFA 3ULJA 2DGYA 3K7AH 3K7UC 1PYSB 1YEZA 4DR6Q 3RNUA 2I0QA 4TQUS 1VQ9A 1WJJA 4QIWE 4YY3L 3CC2A 1S40A 3ERSX 1EQQA 1K8GA 1U5KA 3PF4A 3HOYG 3NENA 4JOIA 4AYBG 3T1HL 1N33L 4OX9Q 2UXDQ 2EQSA 2YTVA 2BH8A 5IYBG 1CSQA 1SN8A 4LF8L 1Q12A 1NJIC 4DR7Q 1B8AA 1A0IA 1VQIA 3J80i 4A3JH 5C4JH 4DK3C 1R9TH 2LXKA 4DV5Q 2K4KA 4WJ3M 1GKHA 1U0LA 2Q2UA 3EIVA 3UE1A 2N78A 1JJGA 1Z9FA 3RN5A 2ZJQA 2Q2HA 2UUBQ 2KHIA 1BVSA 5M3FG 1PH4A 4DR3L 2JA8G 1BBUA 1IL2A 1YHBA 3DLLA 2IT1A 4B3SL 2JEAI 1HR0Q 1G6PA 2PNHA 2VQFL 2Y0SE 4C3JH 1TWFH 2EIFA 5M5XH 1VQMA 4NXMQ 1AE2A 4L5TA 3E9HA 4LF6Q 3GTPH 1I3QH 4JI6L 3HKZE 2N3SA 1PH8A 3GTKH 4DR2L 1T9HA 1Q46A 3F1ZA 3TQYA 1EQRA 1YHQA 4HJ7A 3S1NH 1S3OA 4IJHA 4IPDA 4FDBA 2K75A 1HNXQ 4DV3L 1FJGQ 3G48A 1N34Q 2PQAB 3PUZA 2ZM6L 1Q7YC 5M3MH 1L2FA 1Q82C 2Y0SG 1PH5A 4X62L 3G4SA 4JYAL 1PVOA 1YVCA 5FLXc 4YWKA 2I5HA 4IPGA 1OXTA 1M1KC 3W1BA 2KCMA 1N36Q 3I7FA 4XTCS 4K0KL 1MJCA 2OQ0A 4X66L 3TS0A 1W2BA 1N32L 1IBML 2ES2A 1M90C 4OONA 5JEAJ 1LM0A 5IWAQ 1XMOL 2AHOB 3CW2C 5IP7H 4JI3Q 4A76A 1QUQA 4B3MQ 5BR8L 3RN2A 1XJVA 4DUYQ 4PZ6A 4A3CG 3RLOA 5M5YH 1XPRA 1Z47A 4IJLA 4QY7A 2E5LQ 2ASBA 4A3MH 2UUAQ 1YNXA 1KC8C 4DPGA 4LF4L 3RLNA 4LF7L 4A75A 2NZOA 4DUZL 1TWGH 1V43A 4AH6A 3ULPA 5LMUQ 4P72A 1Y1VH 4LNQA 1GD7A 4JC0A 4R4OA 4B3TL 4GKJQ 1VQEA 3CAMA 2KHJA 1EIFA 4PG3A 5LMNQ 1MJEA 3GTOH 3H3VI 1MKHA 5JJKA 3H0GG 1KAWA 4QJFA 1VQCA 4X64Q 3G6EA 1X54A 1VQBA 2JA6H 3W5OA 3BZKA 2Z6KC 3NBHB 4LFBL 1B7YB 2NVTH 4OWWB 1IBLQ 1KHIA 4LF5L 4GKKQ 2UXBQ 4GN4B 4JBWA 2UXCL 3OW2A 2HQLA 1JB7A 2A1AA 4C2MH 1CSPA 2B63H 1P8LA 5ELNA 4BY7H 1CUKA 1CKOA 1UWVA 3PIPA 1X9NA 1HNWQ 4IPCA 4DNIA 2FXQA 3I4NH 4GLXA 2MO1A 3KF6A 2MNAA 3E0EA 1QZHA 2DUDA 2AWNA 1ASZA 1XNQL 2JA7G 3TS2A 5GAGC 4JI1L 2VQFQ 2NVXH 2QGQA 3NELA 5C44H 3CF5A 1E7ZA 3AEVA 1VQJA 3AFPA 4JBJA 3T1YL 2D0OA 2CCZA 3FKIH 2HHHL 2UUCL 4POFA 5C0XI 1CKNA 2JEBI 3PIOA 4DR5Q 1GVPA 3J81i 1V9PA 4UP7A 1QVFA 4RMFA 4APVA 1VQ4A 3KYHC 4YHHL 1TWCH 1HNXL 4JBKA 1FJGL 2IX1A 4EQ5A 4JI8L 1QZGA 3HOZG 1XTDA 3CPFA 3CQZH 5C0XJ 4BXXH 5H1SE 1X3EA 4HIDA 4DV6Q 5FLMG 4JI0Q 1PH7A 4R4CA 1JJCB 2F4VL 3PO2G 2PMZE 1HZ9A 3CXCA 3CCJA 1JJ2A 3M9BA 3PGZA 1YI2A 5IY0A 1WYDA 3CMEA 4B3RL 3OTOL 4A4IA 4LFCL 2YTXA 3CCUA 2VS1A 4JBMA 3MXNB 3GD7A 3SGIA 3FP9A 3I55A 2JJQA 4DV4Q 1Y1WH 1I94Q 1I50H 2BA1A 2GN5A 4A3IH 1Q81C 1XMOQ 2B29A 1P16A 5FJ8H 4DR3Q 1NBWA 3OYYA 5GADC 4LFAL 5GAHC 4B3ML 5BR8Q 4KI0A 4WJ4A 2AKWB 2R7FA 4A3BG 2ZTDA 3S1MH 4DR1Q 2E5LL 5GAEC 2RCNA 2UU9L 3T1HQ 1PV4A 3PUVA 3U4ZA 3KJPA 2R7ZH 4BBSG 1KRTA 2VUMG 2UXDL 4X6AH 3S24A 1YHAA 2K50A 4NXNL 1L1OA 1A8VA 1VS0A 3PUXA 4DR2Q 1EFWA 4BY7G 4OO1G 1OXXK 2YYZA 2CKZB 3GTGH 1SROA 2CWAA 5ELOA 1K0RA 1I5FA 3A74A 4L5QA 4A93G 4B3TQ 5M5WH 4MZ9A 2JA7H 1VCIA 4A3JG 1KXLA 1J5EL 2JA5G 4A3GG 3K80C 4A3BH 5IYCH 1VQHA 2ZTCA 2ALYB 1YITA 1XNRQ 4P73A 4QQBX 2EXDA 2D0PA 1B70B 1X6OA 5IYDG 3GTQH 2K5VA 4R4IA 2ID0A 1FL0A 1WCMG 3KOJA 2QEXA 5E7NA 4C3IH 2VW9A 4YCUA 4LF5Q 2VL6A 4IFDI 3J80c 4GKKL 2R93H 1IYJB 4A3DG 4KHPQ 3JAMi 3A5ZB 2JA9A 2Z6KA 2JA5H 3D0FA 3CMAA 4LF6L 3J7A5 1N32Q 1L1OC 1K9MC 1HZBA 1LUZA 2JE6I 2B63G 2LSSA 3PO3H 4A3FH 4GNXB 1N9WA 2YTYA 2KBNA 3HOUH 4C3HH 3KF8B 1CKNB 4LUZA 3MEFA 1EUJA 3IRBA 4JI2L 1WCMH 4GLVB 3T1YQ 2IHFA 2R92H 2B3GA 4LW1A 5IP9G 3GTMH 2UUCQ 1X55A 1VQKA 4IFDG 4X65Q 2WFWA 2ATWA 4UP9A 5DLQE 2HIXA 3G71A 2RF4A 3GDEA 4UPAA 3WWVA 5C3EH 3HKSA 1V1QA 2YU9H 3K81C 3FHWA 2N8NA 3HOXH 1G291 1GO3E 3M4PA 3TREA 4OXPA 4P75A 1Y1VG 3RR5A 5K36G 1Y14B 1L0WA 3CC4A 1PH1A 2R92G 2VQEL 3I4OA 4R4QA 3U4VA 5FLMH 4DV2L 3GO5A 5IWAL 2VUMH 3CC7A 5AJ3L 1E3PA 1XPOA 2OCEA 4QL5A 5M3FH 3KDFA 4JI4Q 1NE3A 1PFSA 3CCRA 2OWOA 4JI5Q 2F52A 4LFCQ 4DV4L 2RHSB 1A63A 4KHZA 5C0XG 5JJIA 4GNXC 2JQOA 1D7QA 2VY3A 2UUAL 2BH2A 2L15A 5C4XH 3H15A 1J6QA 4A3IG 3BJUA 3H3VH 4GLAC 4LFAQ 4AQYL 4O2DA 3JC66 5LMUL 4IO9A 1K8AC 3Q8DA 1L1OB 3I56A 4JG2A 4OO1I 3E9IA 1VQPA 3L2PA 1N34L 3J7ZC 4DR1L 5JJLA 4X64L 3F2CA 1UE5A 2V1CC 4R1JA 3A5UA 1PA6A 2GVBA 4DR5L 2HIVA 5EAYA 4EX5A 1EOVA 1C0AA 1PH9A 4LWCA 3LGJA 1YJ9A 3PO3G 3PCOB 4A3FG 4LUOA 4A3EG 1X56A 4JI7L 2NVQH 1JT8A 1HZCA 1KRSA 3UDIA 1XMQL 2KCTA 1C7YA 3CCSA 1VQ5A 4DR6L 1BBWA 4DV0Q 1VQDA 4DV6L 1Q1EA 3J81j 1VQ6A 2VZAA 1XPUA 3CCVA 3A0JA 5IYCG 2A8VA 1OTCA 1VQ8A 3HOYH 3ICEA 2Q2IA 4Y7NH 3CP0A 4YCWA 1KL9A 3S2HH 3S14H 4POGA 4DV7Q 1VQAA 1SR3A 3L7ZC 4GOPA 1I94L 3M4OH 2R93G 4TVAB 1OXVA 4DK6C 3UDGA 1YBYA 1C9OA 1NTGA 1BKBA 4DUZQ 2WB1G 3I4MH 2PI2A 1NMGA 2NN6I 1K83H 2UUBL 2AMCB 2OTJA 1VQ7A 3F2DA 3HOZH 1Q8KA 4BY1G 3KLWA 4DR4Q 1K3RA 1YZ6A 2ZTEA 3S15H 2IHEA 4NXNQ 2A19A 4HJAA 3JAMc 4LF9Q 3HOWH 3PUWA 1E1TA 1MIUA 4GN5A 1UE1A 4ALPA 4BBRH 4JV5Q 4HIKA 4GNXA 2JA8H 2D62A 1VQGA 3BZCA 4IOCA 2UXBL 2R6GA 1X3GA 4A3CH 1E22A 4PZ7A 1AH9A 2NN6G 5GQOA 1PHJA 1EIYB 1Q1BA 2K5HA 4BY1H 1H95A 2XGTA 2CWPA 1IZ6A 3CCMA 3B6YA 1JE5A 4A3KG 2KENA 1JMCA 1N33Q 3J81c 1TWHH 4OWXB 1WOCA 4R4TA 1OXSC 3D31A 4O0AA 3KJOA 3K8AA 1IBKQ 4A3LG 4GS3A 2MQHA 1A62A 3M4QA 3NEMA 2CQOA 1WFQA 4BXXG 4KLKA 1AE3A 1OXUA 2WP8J 1N36L 3RZOH 1TXYA 2GVAA 2E2JH 4K0KQ 1PH6A 2NZHA 2AWOA 4DV1Q 4UY8C 4YHHQ 2YV5A 1E24A 1IBMQ 5JEAG
chains in the Genus database with same CATH superfamily
5D3DA 3IFDA 2H5XA 2F0WA 1I4PA 4JI0L 4YY3Q 1SFOH 4B3SQ 4NPSA 3DWQA 1JR0D 3NTHA 5CV8A 4ZUJA 4P2CB 1LTSD 5FOBB 2SDFA 2XTIA 2B2YA 3GTJH 1LTRD 3BYYB 3HOUB 1IW7C 3KDFB 4HTHA 2XRSD 2O5JC 2K33A 5C44B 2E8GA 1M8AA 4CBVA 1Y69U 4AQYQ 4NXML 4X66Q 3HOZB 4JI6Q 2N49A 2LS01 3EQLC 3I73A 1STHA 5LHY1 2D9UA 5C44G 4I7AA 3PF5A 1QVCA 5AJ3Q 1KTKA 3S2HB 5KYLA 1Y8PB 5CYUA 4DNTB 1GM5A 4YIJA 5A2QE 1HUNA 1U4PA 2OQKA 3HOUG 4GOPC 1SXTA 4X3TA 2PZUA 1SRUA 2R61A 1X65A 1VQNA 5C4XG 1TKWB 1SE2A 2PMZB 3L0OA 4JI2Q 4IZ8A 3TEHB 1IBKL 1JOQA 3RZDH 3BU2A 1HJPA 2MJ8A 3FVQA 3CRLC 3KFUA 1FVIA 4FVMA 4CKEA 3Q0AA 4A3EH 2HT1A 4K5XA 3MAQA 1O7ZA 4QGUA 5E4XA 2OXPA 1STYA 1WTXA 1C4QA 2JP1A 4FXGC 2WB1E 2NVYH 1QNUA 4Z9CB 4HJ5A 2BOSA 5FO8B 1QILA 1CQVA 1D5MC 1FNUA 2UXCQ 2DJGC 1QJOA 5EKKA 3EN2A 2B8GA 1IKMA 2AQ3B 3F2UA 4ZLTF 2CFMA 2EOTA 4IPHA 3GTMB 1TS2A 5BN3A 2XIWA 3M3YH 3S1NB 4CDCC 3R93A 4TQUS 2ICIA 4R9WA 1EQQA 1K8GA 1RODA 3PF4A 3HOWB 4BS9A 5I2YA 4RH6A 1O7YA 4OIJA 4RAUC 4IUNA 4LJZC 2BH8A 1CSQA 5EBDA 2A6EC 4IFDH 1SNOA 1B50A 1Z9FA 2A69C 5M3FB 1UAPA 2Q8RE 1H9RA 1PH4A 4DR3L 2JA8G 2HCCA 4CJ0B 2KHSA 3A7AB 3DLLA 2JEAI 1Q3LA 3OW7A 2PNHA 2VQFL 4BY1B 4C3JH 1VQMA 5M5XH 1AE2A 2E75C 3E9HA 3NQTA 4LF6Q 4LAAA 3CHBD 1PH8A 1G91A 1T9HA 1Q46A 3DWPA 1CI3M 1FD7D 3SK6A 4HJ7A 3S1NH 1AFPA 1S3OA 4IPDA 1FJGQ 1IL8A 3GV6A 1N34Q 3PUZA 4K5VA 1Q7YC 1Q82C 1PH5A 2XWBB 4X62L 4V0BA 4KKTA 3NQIA 3ND9A 3OMCA 4MN3A 3C46A 4JYAL 1PVOA 2YU9B 2BCOA 3W1BA 1PYWD 1MI2A 5EJWA 2KCMA 1HXYD 3L9AX 1N36Q 3GTGB 3I7FA 1H9SA 2EY6A 4HR7B 2L9HA 1A3VA 4OONA 1BOSA 1LM0A 4EQOA 3TSSA 2EY1A 2XRQD 5KGUA 1QUQA 4B3MQ 5BR8L 1XJVA 4DUYQ 4A3CG 5J1ZA 1CT1D 4IJLA 2E5LQ 2I46A 1JWUD 3OWEB 4RKLA 1Y1WB 2UUAQ 4N9PA 4A75A 2NZOA 1NNXA 4LNQA 3SXHA 1F9SA 4JC0A 4GKJQ 2Z1CA 2BE5D 4PG3A 5HURA 3GTOH 1JORA 3H3VI 1MKHA 1KAWA 3S16B 1VQCA 2JXMB 2O2LD 1FGBD 3G6EA 1X54A 4KTAA 5FLXL 2Z6KC 4UDUC 2LMCB 3D3RA 4LFBL 1KABA 4OWWB 5IIFA 3QB3A 1S5FD 1DM0B 4LF5L 2OEOA 2F0VA 1CA5A 4GN4B 1EQVA 1PTOD 2K01A 4BBSB 4BY7H 1JICA 1CSPA 1X9NA 1UWVA 2K05A 1HNWQ 2QF7A 2MO1A 1XNQL 1S5ED 3PIO3 3NELA 3CF5A 1A3UA 4A3MB 3AFPA 2D0OA 3HEJA 3JAML 4TSSA 4X3UA 3J81i 1QVFA 1BBXC 5I6WA 3NBHA 2B2VC 4JBKA 5BN5A 4BXXH 3E6ZX 5H1SE 1WTOA 5FO7B 1TY0A 4DXGA 1NR4A 3HGBA 1PH7A 5EPJA 2F4VL 3KK7A 3GTOB 2L4NA 1HZ9A 2EVBA 3CXCA 2B2WC 3CCJA 1JJ2A 1GUWA 3KF8A 2NBFA 2SNMA 4A4IA 3CCUA 1ZKOA 2VS1A 4M1UB 4JBMA 4A3GB 1ET9A 3SGIA 3FP9A 3I55A 1A6XA 2EPBA 2AQ2B 4RHRA 1TQOA 5FJ8H 2R7ZB 2AKWB 1SE4A 1BF4A 3S1MH 5GAEC 2I07B 2L55A 3T1HQ 1PV4A 2UU9L 2UXDL 2ZXRA 4BBSG 1G2TA 2VUMG 4NXNL 1SNDA 2F0KA 2F03A 2A73B 4DR2Q 3O13A 1D1KA 1S4ZA 4XYOA 1SROA 2PO4A 1K0RA 2RA4A 5NUCA 2JA7H 1B9NA 5T1GA 4OL7A 5IYCH 3VA7A 1K8MA 2ZTCA 2EYOA 1B2TA 4N8X1 3LWEA 4QQBX 1RF2D 2PYKA 5IYDG 1F9RA 2K5VA 4R4IA 1FYCA 4C3IH 4YCUA 2VL6A 3J80c 3CKIB 1JOKA 4KHPQ 2JA5H 2EDGA 3CMAA 1EY6A 1L1OC 1TWFB 1K9MC 2JE6I 2B63G 3PO3H 1TIID 2YTYA 4C3HH 3KF8B 1CKNB 4LUZA 1EUJA 3FMCA 3QOLA 1WCMH 4GLVB 4DF7A 3ZYYX 1U4MA 4OHJA 1X55A 2FHTA 2UUCQ 4UP9A 5DLQE 1EU3A 4C1NK 2RF4A 5I2XA 4UPAA 3WWVA 3G71A 2Z4IA 2F0LA 4C1NI 4LMQD 4RFBA 3M4PA 2JN4A 2KCNA 4A3IB 1PH1A 4DAVA 1SDFA 2IW3A 1K3BC 5ELEA 3NWSA 3CC7A 5AJ3L 1E3PA 1XPOA 2OCEA 3KDFA 4JI4Q 3SEBA 2F1MA 1NE3A 4C56C 1STGA 2J7ZA 2WACA 1K83B 2GA4B 3TP6A 1A63A 3MFGA 3H09A 5JJIA 4GNXC 3TMEA 1D7QA 3C1EA 1ENCA 5C4XH 5E1FA 4K5WA 2F0NA 3BJUA 3J80E 1D1IA 1KDAA 2L1BA 4L6TB 3JC66 4O2DA 4DGZA 5LMUL 2K1BA 3E9IA 1VQPA 3PO3B 2EY5A 5JJLA 2A6HD 4EQPA 3I90A 3I3CA 2GVBA 4DXFA 3SDZA 4NDXA 2PNRC 3CU7A 3D4WA 4CHTB 1RTNA 3PCOB 4LUOA 1X56A 2F0GA 3KLRA 3RMHA 1E2ZA 1KRSA 4JI7L 1PDQA 2KCTA 2O4XA 4DR6L 4DV0Q 3AMUA 1K28A 4C3JG 5K5PA 3KUPA 2Q2IA 3V05A 4DV7Q 5ISRA 4GOPA 3IFTA 1I94L 2K32A 2R93G 1J9OA 3QG1A 3UDGA 1YBYA 2PZWA 1C9OA 1RDPD 5CC4A 3EROA 1DXMA 5CGKA 1Z7TA 1SBBB 1I50B 3IL8A 2KOLA 2IHEA 5C0XH 3NHHA 3JAMc 3PUWA 4ALPA 1MIUA 1L0XB 1QWYA 1BCPC 3BZCA 4IOCA 5F2DA 2UXBL 1I3QB 5GQOA 1T5EA 2AQ1B 3T56B 1EIYB 5M3MB 1H95A 2CWPA 1RHPA 5DEHA 1XYIA 3L3OC 3CCMA 1YNNC 4CJ2C 2KENA 2PPBC 1WOCA 4O0AA 2NZ1D 4L63B 4B9WA 4A3LG 3NEMA 1WFQA 1AE3A 5FLXE 3BYTB 4OO1H 2CHBD 5M5WB 3GTQB 3CRKC 1SEBD 3I4OA 2RVLA 4FF3A 1SNQA 3U9OA 3S1MB 3H3VC 5JJZA 1D8LA 2JK8A 1DJRD 3A56A 1DZ1A 5KEEA 1X3PA 1HZAA 1EY9A 4MNOA 2KVMA 4LK1C 1VQOA 4XQNA 3HOXG 2JA7B 3SK5A 5JEAH 5DNFA 2BE5C 2B2VA 2I5MX 1KDBA 1RTOA 3KBGA 3H0GH 3CCEA 5LMNL 5M5YB 4BBSH 2EYFA 3OPOA 2RHQB 4HIMA 5G3LF 1S72A 4AYBE 5C4ZA 3BDCA 1YJNA 3J81E 3AQQA 2ZXOA 1IBLL 4IQZA 5CV4A 4PZ8A 3VDYA 1EWIA 4MHEA 4HJ9A 3GTLH 3EBEA 3RUZA 4C3HB 3I4MG 1YJWA 1KQSA 1RCVD 1J5EQ 1HFGA 1N8RC 3LWUA 2VQEQ 4DR4L 3TDQA 4QCLA 4KN4C 4LF9L 2PQAA 1SMYC 5M3MG 5IT9L 2L12A 4EQNA 5E4WC 2PQEA 1A2UA 2JA6B 5L37A 5KRUA 2A6ED 4UP8A 1TU2B 4BA2I 4HAEA 1PRTB 2DY8A 4EVOA 3HKZG 4DR7L 3K57A 4GKJL 5LL6X 2R7ZG 3F8TA 2Z0SA 1K73C 2B2TC 1AZQA 2NVQB 2I5LX 3OTOQ 1PH2A 5GROA 1LABA 3BG3A 2QCPX 4C2MB 1MBYA 4G7ZC 1ASYA 3UDFA 3TP7A 4DAMA 5IYBH 1EY0A 1HNZQ 1F77A 4IOAA 2B2UA 4WFN3 1DCZA 5JVG3 4L5SA 2B39A 3R2IA 1B44D 3S2DB 1ONLA 4K2LA 1O80A 1I6HH 1RIPA 5HGQA 4IUPA 4K8JA 2ZJPA 4PMWA 2XVSA 1LYLA 3M4OB 2K03A 3CPWA 1IYVA 1HPCA 4Y52H 1K8OA 3Q23A 2WAQG 2DY7A 2H1EA 2FINB 3T51B 3ND8A 3T13A 1KNAA 4JCVE 1MSHA 3STBD 3DM1A 1TY2A 4JW0A 5IE8A 1AEXA 4HIOA 1CFMA 1QVGA 5EBCA 3MXNA 2RCFA 1NMFA 3K7AH 3K7UC 1CQFA 3RNUA 2I0QA 5IGDA 1WJJA 4QIWE 4YY3L 1S40A 2EE1A 4FF2A 1TWGB 1GUGA 1EY4A 3NENA 3T1HL 1N33L 2UXDQ 4OX9Q 5IYBG 4LF8L 1SN8A 5ELFA 1IHZA 4QMGA 1VQIA 3J80i 4A3JH 1B3QA 1R9TH 4DV5Q 2Q2UA 3EIVA 1EYAA 1U9RA 4ME5A 2KHIA 3RZDB 2K04A 1BVSA 2M9VA 5COYA 1BBUA 4KMUC 2E2DC 1G6PA 2Y0SE 3QIAA 1F2LA 4JPBW 4NXMQ 4IUVA 3GTPH 1I3QH 4JI6L 3HKZE 2N3SA 3GTKH 5IT9E 4CDFC 1EEID 1H9KA 2K6AA 1YHQA 4FDBA 1WVLA 4NKLA 2ZM6L 3MEHA 1DYQA 1JOOA 3UI2A 1X32A 4CDEC 2IX3A 1SSOA 4UHVA 1D5XC 1EZ8A 4ZRZA 5FLXc 2Q8IB 3MTSA 2LY7A 5EKIA 3EA6A 2FMMA 4XTCS 4K0KL 3NP8A 2FFKB 4KN7C 3TS0A 3T16A 4MTKA 3BVGA 2FMCA 2WAQB 2B2YC 2AHOB 4JI3Q 4ILWA 4A76A 3RN2A 1XPRA 4QY7A 1F9QA 1UNSA 5CMDA 2NB0A 4DPGA 1HQRD 4DUZL 1EYCA 5LMUQ 1ESFA 4B3TL 5JJKA 1MJEA 2O5IC 2A74C 4F7XA 2F0OA 2JA6H 4ZCKA 3W5OA 5I9OA 1B7YB 3G7LA 2NVTH 1GXDC 4J1MA 4GKKQ 1LT4D 1W6JA 4JBWA 5J39A 2UXCL 3OSOA 2B63H 1CUKA 4IPCA 3EFXD 2G9HD 4CDDC 4GLXA 1STEA 4ABNA 3G6JB 3TS2A 1NUCA 1PLFA 2QGQA 3QR8A 1PTOF 1ML0D 4RKBA 1GVPA 2BDNA 3NK9A 3NPPA 4UP7A 4RMFA 1VQ4A 1WTHA 2M2LA 1HNXL 4JI8L 3CQZH 3V96A 1X3EA 4HIDA 2F0SA 5FLMG 4JI0Q 1WCMB 1JJCB 3PO2G 1SNMA 1XWEA 2PMZE 4C3HG 3K5LA 3CMEA 3BS1A 4LFCL 2YTXA 4QIWB 3GD7A 3P20A 2JJQA 2XSCA 3URYA 1I50H 4A3IH 1CTMA 1XMOQ 4DR3Q 1NBWA 3OYYA 1S5BD 2A6HC 4HN7A 5GAHC 1XXGA 4KI0A 2L11A 3DHQA 4PMCA 4S3SA 4WJ4A 2R7FA 2ZTDA 4DR1Q 2R7ZH 3U4ZA 1A2TA 3A8KE 1VS0A 4R8IA 2XWJB 1PTOB 3K5OA 4BY7G 1OXXK 1I5FA 4K8IA 4L5QA 2CQAA 5C4JB 4A3BH 5EQ0A 1YITA 2HDMA 1XNRQ 4P73A 2D0PA 2DN8A 1X6OA 3GTQH 3HOXB 1WCMG 2QEXA 5E7NA 2NUCA 1RJTA 2R93H 1LACA 3JAMi 1II3A 2JA9A 2Z6KA 4JK1C 1LUZA 5FKAC 2LSSA 4A3FH 4KY5A 5D65A 2KBNA 2JA8B 3P1HA 1STAA 1EU4A 3IRBA 4JI2L 3T1YQ 2IHFA 2B3GA 4LW1A 2HQEA 2QKIC 4K2KA 3QOJA 1VQKA 1VMCA 4KV6A 2ATWA 3QO2A 5A35A 3VR4A 3GDEA 2YU9H 5C3EH 1V1QA 2EYMA 2N8NA 1A15A 2F0EA 4P75A 3RR5A 1GJXA 2VQEL 1IW7D 1MD2D 1EWCA 5IWAL 1I4QA 2VUMH 4ZAIA 5M3FH 1JE4A 4JI5Q 2EJMA 2F52A 3BDOA 4DV4L 1G2SA 1BNZA 3TBIB 2JQOA 2VY3A 4C3JB 1OO9B 1ICWA 3TN2A 4OIKA 3VYTA 4LFAQ 4IO9A 3I56A 1L1OB 4JG2A 4OO1I 4K6DA 3L2PA 1H9JA 2TMPA 2QDBA 3F2CA 1UE5A 2QILA 2XNAC 5D14A 1KAAA 2HIVA 3BVZA 5EAYA 4LWCA 1HCZA 3LGJA 3PO3G 2H4OA 5JPNC 3PQIA 2NVQH 1JT8A 1HZCA 2RDHA 1XMQL 1C7YA 3S17B 3CCSA 1VQ6A 2EYJA 3C1FA 4B9XA 2A8VA 1EY7A 1OTCA 1VQ8A 2AUJD 1QG7A 2JYOA 3MXUA 2E2HB 2F0JA 2F0HA 5BN4A 4AYBB 3S2HH 3S14H 4POGA 4TVAB 1CA6A 4ZK9B 1SNCA 3GTPB 2QW7A 2NN6I 3QWNA 1K83H 2OTJA 2AMCB 1VQ7A 2RKSA 2MGSA 4R8NA 1BDOA 1Q8KA 5JAVA 1K3RA 2ZTEA 3S15H 5C4XB 4NXNQ 2A19A 3M3YB 1SAPA 3T53B 1UE1A 4A3FB 2JA8H 4FNFA 1X3GA 1LTBD 1PRTD 1H9MA 3FKIB 4BY1H 1KNEA 2F0PA 1PMRA 3HZXA 3J81L 3DWAA 1JE5A 1U4RA 3B6YA 1N33Q 3J81c 1TWHH 4OWXB 3D31A 3HP3A 3D8GA 1IBKQ 1A62A 4BXXG 2KUMA 2WP8J 2RQXA 1N36L 2GVAA 2E2JH 1PH6A 2AWOA 5CV6A 4DV1Q 3HG9A 4YHHQ 1KIXA 4H02A 3DM3A 1V1PB 5I6YA 3S1RH 1VQLA 3VA5A 3MXPA 5M5XB 1G51A 1X3FA 1Q86C 1EZ6A 2K5WA 1IXRA 4B3RQ 3W1GA 1QUQB 4IUQA 4DKAC 1WD1A 4A3DH 4YWMA 1KLGD 2J0TD 1KLUD 4FF1A 2EXZA 5J3BA 1JWSD 4HSPA 3PV0A 4GN3B 3S2DH 3J7YW 1B3AA 4X65L 2M00A 1HR0L 3I70A 4JOIC 4ZYSA 3I4NB 4PQXA 1LTLA 2ZT9C 5J22A 3I4NG 3VR3A 3SR1A 3UDXA 4ME3A 4BA1I 1HNWL 1XNQQ 4IN3A 1PXUA 2DJFC 1ILPA 5DM73 3U58A 4X3KA 3K0XA 2VNUD 5JPMC 1SYCA 2K28A 3F2BA 1SMXA 3ZJYC 3M7NA 1PFBA 1Y8OB 2NVYB 1KD1C 4GOPB 2C35B 1DOLA 1PH3A 1UEBA 3E0JA 3S1QH 4J15A 2JA6G 2Z4HA 4P71A 4DV7L 5IP7G 1HA6A 1O7LA 2X69A 4H0LC 1WTQA 1E1OA 3WDNA 3RLFA 4ULLA 1B1ZA 1S5DD 2C9OA 2OTLA 5FO9B 1R9TB 1SLJA 3MWYW 3PUYA 4LF4Q 1HH2P 1F9PA 1Y1WG 5CV5A 1SNPA 1JC7A 2K7VA 3NE5B 4IURA 4DAYB 4HJ8A 1CM9A 3OOCA 4KK7A 5KNCA 3C3LA 4JVZA 4X62Q 1VQFA 3STBC 2K52A 3TZDA 1R4QB 2WIIB 5HY6A 1HUMA 2SNSA 1YIJA 4JI8Q 3LX0A 5C3EG 2IX0A 1W3SA 2Z6BA 5ELCA 2E2HH 5LL6S 1UE6A 2WKDA 3TRZA 3PSIA 2MO0A 1ESRA 2PCFB 1GUTA 2Z8LA 3CQZB 4JV5L 1LTAD 1EYGA 2ZXPA 2PW7A 3Q24A 4KHPL 2F0UA 4FYDA 4J8QA 3ULJA 2DGYA 4K14A 2NTSA 1CK1A 3HS0C 1VQ9A 3H6MA 1QCBD 3KLSX 3CC2A 3ERSX 1U5KA 1SYGA 3VR6A 4AYBG 1T5XD 3A8JE 3FRPB 2YTVA 1DONA 1NJIC 1GUOA 5C3WA 4GZYC 1LT6D 4HCSA 1GKHA 4WJ3M 4KD3A 1ZYRD 2N78A 4IUTA 3UE1A 4I65A 4V190 2KEDA 2ZJQA 2Q2HA 2UUBQ 5M3FG 3NWTA 5EGTA 1WTVA 1IL2A 1YHBA 1PZKD 2IT1A 2Q8TA 5KNBA 4DA2A 2RDGA 2HDLA 1TWFH 1JWMD 4L5TA 2F0IA 4XQJA 5C4HA 3F1ZA 4XT1B 3TQYA 1EQRA 3KLSA 1E2VA 3RD4A 1LV9A 2KQ3A 4DV3L 2PQAB 5M3MH 2Y0SG 4RGMA 3FPUB 2LFNA 3ONAB 4A93B 1M1KC 2I5HA 2MHVA 2JSOA 2D2CC 3KBXA 5CV7A 1MJCA 1VF7A 4DK0A 3JAME 2CH4W 1W2BA 1N32L 2R3ZA 1IBML 3HKZB 1M90C 1WTRA 5IWAQ 1R4PB 1QOHA 3CW2C 5IP7H 3OIPA 3K5NA 2SEBD 1ILQA 2ASBA 3S15B 2NYZD 4PV1C 4A3MH 5EKLA 1YNXA 1RD9D 3RLNA 4LF7L 1TWGH 1V43A 3ULPA 1Y1VH 3I4MB 4R4OA 1EIFA 3H0GG 4RGNA 1GUSA 4HMJA 1C48A 1VQBA 4O42A 4MIUA 4CKBA 3BZKA 3NBHB 1PTOH 1I4HA 2UXBQ 4OELB 4K6LA 2MUYA 3OW2A 1PFMA 2HQLA 1JB7A 2A1AA 3MXGA 3PIPA 1CKOA 4A3BB 3W3AA 4DNIA 3GTLB 1EWHA 1IKLA 3KF6A 3E0EA 1ASZA 2DUDA 2AWNA 5DAUA 2JA7G 1UEAB 5GAGC 2NN6H 4QB4A 2PZTA 4JI1L 2VQFQ 2NVXH 3E5SA 1VQJA 4JBJA 3NXWA 4KY6A 2CCZA 5CBAE 2HHHL 2UUCL 4POFA 1BCPF 5C0XI 1CKNA 2JEBI 3PIOA 4DR5Q 1PRTF 1V9PA 4BBRB 2EY2A 4APVA 3KYHC 3SHLA 1TWCH 1FJGL 2IX1A 4EQ5A 1QZGA 4N8FA 3HOZG 3CPFA 4IALA 3S1QB 4DV6Q 1K0SA 1HHVA 1F2ZA 3FEWX 3V2TA 5IOCA 3P7JA 5CR3A 5IY0A 1WYDA 3DEOA 3PO2B 1ENAA 3MXNB 5I4DA 3A54A 2B2WA 1Q81C 2B29A 1P16A 4L8JA 3NSWA 5FK9C 4KHVA 4DAYA 4B3ML 5KNDA 5BR8Q 4A3BG 5E3FA 3HOVB 2E5LL 4O1NA 2RCNA 3ITPA 3D4DA 1M4VA 2NVXB 3S24A 4QUFA 1MSGA 3PUXA 1EFWA 4OO1G 3DXJC 2YYZA 2CKZB 1EY8A 3GTGH 2VB3X 2CWAA 5ELOA 3A74A 2J4XA 4MZ9A 1VCIA 4A3JG 1J5EL 2JA5G 2DNEA 3K80C 1LLRD 1SYDA 4RCOA 4A3GG 5C3XA 3VYUA 4X3SA 1VQHA 4QF4A 5IGCA 1ZYRC 5M9OA 2CW0C 2NTTA 1BXTA 2EZVA 1TR5A 4UAIA 1FL0A 4RHSA 4LF5Q 1GHJA 4Y7NB 4DNRB 4A3DG 3R8BA 3J7A5 3GP7A 1N9WA 3IAYA 3HOUH 3K7AB 3MEFA 1JQYD 5IP9G 5I9PA 4IFDG 1SYBA 4X65Q 3K0YA 2HIXA 2XN9C 4Q5VA 2KA7A 3K81C 3FHWA 3HOXH 1PRTC 1B4OA 3TREA 4ID6A 4OXPA 5K36G 1Y14B 3CC4A 1X3QA 3K58A 2R92G 1SYEA 1VMPA 1FNWA 1PFSA 5C5LA 4KHZA 5C0XG 3S9WA 2K5QA 2L15A 3H15A 2EYHA 1Q90A 1PTOC 2V4DA 2WV6D 4A3IG 3H3VH 4AQYL 5IGEA 1K8AC 3Q8DA 3TP5A 1STBA 4ODGA 4PNYA 1N34L 3J7ZC 2IL8A 1SMYD 4X64L 2D5DA 1PA6A 1VDZA 1EOVA 1YJ9A 1GUNA 4A3EG 3UDIA 1TS4A 1DOMA 2B63B 1BBWA 1ZEQX 3J81j 2VZAA 5IYCG 1YNJD 3S1RB 1IBMQ 1Y8NB 3X3MA 3OMGA 4YCWA 4RA8A 2KEEA 1EIGA 3M4OH 1D5ZC 1EL0A 2B8FA 2F0MA 1HQMC 1NTGA 3M4YA 1Y1VB 2WB1G 3I4MH 3I4LA 1NMGA 1XTCD 3HOZH 3FDTA 4BY1G 3KLWA 4DR4Q 1YZ6A 1YNJC 2RDFA 4LF9Q 1LTTD 4JV5Q 4GN5A 4BBRH 1SJED 4HIKA 4ZUIA 4GNXA 3WOFA 2D62A 2R6GA 4XYQA 1E22A 4PZ7A 2NN6G 1PHJA 1BCPB 2K5HA 2XGTA 5ELDA 1PFNA 1TT2A 5D3IB 2N88A 5G3LD 4A3KG 1JMCA 4M8AA 1GHKA 1HTLD 1OXSC 4R4TA 3RZOB 2N55A 3K8AA 1I6HB 2MQHA 3M4QA 5T1IA 2CQOA 3A7LA 3MC0B 2CVRA 1OXUA 4G57A 1TXYA 4K0KQ 2NZHA 1IYUA 2YV5A 1E24A 4H7BA 4A3KH 4QUCA 4MTNA 1HNZL 3IKJA 3HOVH 5LMNW 4P74A 2AUKA 4A3LH 2F4VQ 4RGTA 3J7AV 1F2YA 1DOKA 3PO2H 4A3MG 1WTPA 2E2IB 2MPMA 1O7IA 4FXDA 5TSSA 4FP5D 3I2ZA 1A3TA 4XT3B 3MA2B 4DV0L 1NY4A 3S16H 1QNKA 4DV3Q 4FO2A 3U50C 4I7ZC 1CZGA 3UE0A 4JI5L 1WI5A 5HGTA 4OWTB 2L0CA 2UU9Q 3I72A 1SYFA 1TWAH 3P75A 3TP8A 1QB5D 2Q2TA 2WKCA 1PYBA 2MP1A 3D6CA 3AYHB 5EPKA 4Q0FA 4A93H 2ENBA 2EJFC 4DV2Q 1EEFD 2JA5B 1SE3A 2ZJRA 3AFQA 3M85A 3K5MA 1EYDA 3T4AC 4BWGB 5IYDH 4OX9L 2WAQE 1XMQQ 3A8IE 2F3IA 4KJOA 4JYAQ 2QDLA 4LF7Q 3GQBA 4LF8Q 3GTKB 1V1OA 4NB3A 4XDXA 3C2PA 3HOVG 4OEMB 1I4RA 4DV5L 2K5NA 1CZWA 1TWHB 3GV3A 4YWLA 1RL2A 4KKUA 1EFID 2MFIA 2QEJC 3CCQA 2NVTB 2K14A 3AB9A 4YCVA 4PMBA 2CH4A 1BR9A 1E2WA 3J80L 4A3GH 3VR2A 2E2JB 4RG1A 3A55A 4J6HA 4DUYL 1XX8A 4CJ1B 3ULLA 5IT9c 2QA4A 1LT5D 3S17H 4XIGS 3CCLA 5FJ8G 4HMIA 1Q8IA 4L5RC 3KF6B 3R2TA 4JI1Q 4EGVA 5IGGA 1UE7A 4XQQA 3FKIG 2ZM6Q 4TKOB 1HR0W 2SOBA 4JI4L 4BBRG 2HHHQ 4AIMA 2IY5B 1Z6HA 4DU9A 2A5HA 4H13C 4RGOS 4HSVA 4LFBQ 1BCPD 5IGBA 1DGSA 3HFZB 1FGUA 1SJHD 5IP9H 4IFDJ 2LXJA 4N9TA 2E2IH 2KJXA 1XNRL 3N52A 1CKMA 2R7DA 3NTKA 2BA0A 1HFNA 3CD6A 4JI3L 2PI2E 3WOEA 4LUVA 3ER0A 3HOWG 4DV1L 3VR5A 2Z9HA 1SE8A 1C8CA 3DMUA 1STNA 3SE0A 5DM63 4JI7Q 2ICEC 2VB2X 1PYSB 2EJGC 1YEZA 4DR6Q 2EYPA 3H0GB 3W2DA 2F3WA 2R93B 1RKNA 2B2TA 3HOYG 2R92B 4JOIA 3EJIA 4F88A 2EQSA 5KIXA 2C5CA 1Q12A 4G7HC 1VF5C 4DR7Q 1B8AA 1A0IA 1JB3A 5C4JH 1SFOB 4DK3C 2LXKA 2K4KA 1U0LA 2DNCA 1JJGA 3BZDB 3K6OA 3VYSA 3X3NA 3RN5A 1FNVA 1V1PA 4B3SL 1HR0Q 5C5MA 1TS5A 3M7GA 2EIFA 4U673 5JOBA 3DEPA 1S5CD 1WTWA 4DR2L 1TS3A 2NWGA 3E3XA 4IJHA 1U4LA 2K75A 1HNXQ 5CBEE 4IUUA 3G48A 4NW2A 3J7AF 4KKSA 1L2FA 1LO5D 1MGSA 3G4SA 4A3JB 1YVCA 4YWKA 4IPGA 1OXTA 3SK8A 4TRDA 2OQ0A 4X66L 1LTGD 2ES2A 1LT3D 1PZID 5IGFA 5JEAJ 1L0YB 3I91A 1XMOL 1ET6A 3MZ5A 1BQQT 1PZJD 3MFYA 4PZ6A 2E76C 1H9SB 5CORA 3RLOA 5M5YH 1Z47A 1WD0A 1KC8C 1ENFA 4LF4L 4AH6A 4P72A 1F2MA 5K36H 4H44C 1GD7A 1BUVT 1VQEA 2KHJA 3CAMA 5LMNQ 4QJFA 4X64Q 3Q22A 1ZXTA 1G6ZA 3SK4A 3Q6SA 4CKCA 4E6IA 1B53A 1TWAB 3H91A 1IBLQ 1KHIA 1G8ZD 1D6EC 4BY7B 2PW5A 4C2MH 1P8LA 5ELNA 1D2BA 4G4KA 4WRDA 5KYIA 2FXQA 3I4NH 3OIQA 2MNAA 1QZHA 4RWSC 2VUMB 3D6WA 2L5TA 5C44H 3AEVA 1E7ZA 4DFAA 3T1YL 2F0TA 3FKIH 2RSNA 4KD4A 1I4GA 4YHHL 4ZQ3A 5EPLA 4DN4M 1XTDA 5C0XJ 2IPKD 4R4CA 3I8ZA 5ELBA 3M9BA 3PGZA 1YI2A 4B3RL 3OTOL 1NAPA 1J8IA 1CHPD 1HRJA 3BDLA 4DV4Q 1I94Q 1Y1WH 1ICFB 2OT2A 2BA1A 2GN5A 2RSOA 1NCVA 5GADC 4LFAL 4ZKBB 2HD3A 2X6LA 4OGQC 2KCCA 2VXWA 3PUVA 3KJPA 4X6AH 1KRTA 2CW0D 1YHAA 2K50A 5AFWA 1L1OA 1A8VA 3OWFA 4DK1A 1CHQD 4A93G 4B3TQ 5M5WH 3D4RA 1AP0A 1KXLA 4WJWA 2Y0SB 3ERQA 2ALYB 2F3VA 1DD2A 2EXDA 2IWHA 1B70B 2ID0A 3KOJA 4GKKL 2VW9A 3K59A 4A3KB 1AZPA 4IFDI 1IYJB 4KY7A 3SVMA 1EIHA 1JCKB 3QJYA 1O78A 3A5ZB 4B08A 5IODA 3D0FA 4LF6L 1N32Q 1HZBA 4GNXB 3OHXC 1QE6A 3NBIA 3LNNA 1GOZA 2R92H 4C3IG 1HA5A 2A68D 3GTMH 1W6KA 2WFWA 4ZKCB 4WORA 3HKSA 3NUCA 1G291 1GO3E 4U68A 2EYLA 5JVH3 1Y1VG 1L0WA 4R4QA 4NP5A 3U4VA 5FLMH 4DV2L 3DUZA 3GO5A 1AW7A 1KDCA 2WB1B 1FR3A 4QL5A 4F8MA 2FJ2A 1NR2A 3CCRA 2OWOA 4LFCQ 2HCIA 2A68C 2B2UC 3BVMA 2RHSB 4XXEA 1I6VC 4FXKC 2UUAL 2BH2A 2RBMA 1MHWC 1J6QA 4GLAC 4FF4A 3TZUA 4A3EB 3PIP3 4DAPA 1BO0A 4DR1L 4HCEA 2K5DA 5C3EB 2V1CC 4R1JA 3A5UA 2WINB 3GTJB 3AU7A 4DR5L 1C0AA 2G5DA 2HUGA 4EX5A 1B9MA 1PH9A 4C3IB 4HEDA 3R3OA 1NSNS 3N6RA 4A3FG 5A2QL 1I4XA 1VQ5A 5C6AA 4DV6L 1VQDA 1Q1EA 1XPUA 3CCVA 3A0JA 1YNND 3HOYH 4KJNA 3ICEA 2E74C 4Y7NH 3CP0A 1KL9A 3PMFA 2KECA 2G9DA 1VQAA 1SR3A 2X6GA 3L7ZC 2F0FA 3VYRA 1OXVA 4DK6C 1EOTA 1TWCB 4RCNA 1BKBA 4DUZQ 1V8QA 2P5ZX 1AN8A 2F0QA 2PI2A 5CV9A 2UUBL 3HRZC 3F2DA 2BDOA 3EVQA 4HJAA 3U9SA 1LTID 3HOWH 1E1TA 4NMZA 1UUPA 2F0DA 1VQGA 4A3CH 1AH9A 1E0BA 2F4IA 1HTPA 4CGYB 1Q1BA 1IZ6A 3S14B 4A3DB 1EY5A 3HOYB 2TSSA 3MVVA 3KJOA 4GS3A 3NTIA 2IJ0A 4KLKA 3H94A 3RZOH 1EQTA 2A69D 3FPPA 2LKVA 3MHBA 4UY8C 2OF1A 4G7OC 1TVXA 4F87A 5JEAG
chains in the Genus database with same CATH topology
4A3KH 4MTNA 1KIXA 4H02A 1HNZL 2H5XA 3HOVH 3DM3A 5LMNW 4P74A 3S1RH 1VQLA 4JI0L 4YY3Q 4A3LH 1SFOH 4B3SQ 2F4VQ 1G51A 1X3FA 1Q86C 1D8LA 2JK8A 4NPSA 3PO2H 1IXRA 4MNOA 1HZAA 4A3MG 4B3RQ 1O7IA 3W1GA 1VQOA 3HOXG 1QUQB 3I2ZA 4DKAC 2I5MX 4DV0L 4A3DH 1NY4A 2XTIA 4YWMA 3S16H 3GTJH 4DV3Q 3H0GH 3CCEA 5LMNL 5J3BA 3U50C 4BBSH 2RHQB 4HIMA 3KDFB 3PV0A 4JI5L 1WI5A 4GN3B 3UE0A 3S2DH 1S72A 4OWTB 4AYBE 1YJNA 2UU9Q 3AQQA 1TWAH 4X65L 1IBLL 2E8GA 1HR0L 2Q2TA 4PZ8A 3VDYA 1PYBA 1EWIA 4HJ9A 4JOIC 4AQYQ 4NXML 3GTLH 4X66Q 1LTLA 3EBEA 4JI6Q 3I4MG 3I4NG 1YJWA 2N49A 1KQSA 3UDXA 3AYHB 4ME3A 4BA1I 1J5EQ 4A93H 1HNWL 1N8RC 1XNQQ 2VQEQ 4DR4L 5C44G 4DV2Q 3U58A 2ZJRA 3AFQA 3M85A 2PQAA 3PF5A 1QVCA 3K0XA 5M3MG 5AJ3Q 4LF9L 2VNUD 3F2BA 1SMXA 5IYDH 3ZJYC 4OX9L 2WAQE 1GM5A 1XMQQ 3M7NA 2F3IA 2OQKA 4UP8A 4GOPC 4LF8Q 4LF7Q 3HOUG 4BA2I 4JYAQ 1KD1C 1SRUA 3HKZG 4NB3A 4DR7L 1X65A 3HOVG 1VQNA 4DV5L 4GOPB 2C35B 2K5NA 4GKJL 2R7ZG 5C4XG 1PH3A 4YWLA 1RL2A 1UEBA 3S1QH 4J15A 2JA6G 2MFIA 3CCQA 4P71A 3L0OA 3F8TA 2Z0SA 4JI2Q 2K14A 4DV7L 5IP7G 2I5LX 1K73C 4YCVA 3TEHB 1IBKL 3RZDH 4A3GH 3BU2A 1HJPA 4RG1A 1E1OA 3OTOQ 1PH2A 5GROA 3RLFA 4DUYL 2OTLA 3KFUA 1FVIA 1ASYA 3ULLA 5IT9c 2QA4A 1SLJA 3UDFA 4DAMA 5IYBH 3S17H 3PUYA 4XIGS 3CCLA 5FJ8G 4A3EH 2HT1A 4IOAA 1HNZQ 4LF4Q 1HH2P 4L5RC 1Y1WG 3KF6B 4L5SA 4JI1Q 4QGUA 1UE7A 3FKIG 2ZM6Q 1HR0W 4JI4L 4DAYB 4HJ8A 4BBRG 2HHHQ 2WB1E 2NVYH 4X62Q 1VQFA 1RIPA 3STBC 4AIMA 1I6HH 5HGQA 2IY5B 2K52A 2ZJPA 4LFBQ 4PMWA 5HY6A 4HJ5A 1DGSA 1LYLA 3HFZB 1YIJA 1FGUA 4JI8Q 3CPWA 5IP9H 4IFDJ 4Y52H 5C3EG 2UXCQ 2IX0A 2LXJA 1W3SA 2E2IH 2WAQG 2E2HH 1UE6A 3EN2A 1XNRL 1CKMA 2R7DA 4JCVE 3TRZA 2BA0A 3STBD 3CD6A 3PSIA 4JI3L 2MO0A 2PI2E 2CFMA 5IE8A 4HIOA 4LUVA 1EYGA 4JV5L 1QVGA 3ER0A 4IPHA 3HOWG 4DV1L 3M3YH 4KHPL 1SE8A 4JI7Q 1NMFA 3ULJA 2DGYA 3K7AH 3K7UC 1PYSB 1YEZA 4DR6Q 3RNUA 2I0QA 4TQUS 1VQ9A 1WJJA 4QIWE 4YY3L 3CC2A 1S40A 3ERSX 1EQQA 1K8GA 1U5KA 3PF4A 3HOYG 3NENA 4JOIA 4AYBG 3T1HL 1N33L 4OX9Q 2UXDQ 2EQSA 2YTVA 2BH8A 5IYBG 1CSQA 1SN8A 4LF8L 1Q12A 1NJIC 4DR7Q 1B8AA 1A0IA 1VQIA 3J80i 4A3JH 5C4JH 4DK3C 1R9TH 2LXKA 4DV5Q 2K4KA 4WJ3M 1GKHA 1U0LA 2Q2UA 3EIVA 3UE1A 2N78A 1JJGA 1Z9FA 3RN5A 2ZJQA 2Q2HA 2UUBQ 2KHIA 1BVSA 5M3FG 1PH4A 4DR3L 2JA8G 1BBUA 1IL2A 1YHBA 3DLLA 2IT1A 4B3SL 2JEAI 1HR0Q 1G6PA 2PNHA 2VQFL 2Y0SE 4C3JH 1TWFH 2EIFA 5M5XH 1VQMA 4NXMQ 1AE2A 4L5TA 3E9HA 4LF6Q 3GTPH 1I3QH 4JI6L 3HKZE 2N3SA 1PH8A 3GTKH 4DR2L 1T9HA 1Q46A 3F1ZA 3TQYA 1EQRA 1YHQA 4HJ7A 3S1NH 1S3OA 4IJHA 4IPDA 4FDBA 2K75A 1HNXQ 4DV3L 1FJGQ 3G48A 1N34Q 2PQAB 3PUZA 2ZM6L 1Q7YC 5M3MH 1L2FA 1Q82C 2Y0SG 1PH5A 4X62L 3G4SA 4JYAL 1PVOA 1YVCA 5FLXc 4YWKA 2I5HA 4IPGA 1OXTA 1M1KC 3W1BA 2KCMA 1N36Q 3I7FA 4XTCS 4K0KL 1MJCA 2OQ0A 4X66L 3TS0A 1W2BA 1N32L 1IBML 2ES2A 1M90C 4OONA 5JEAJ 1LM0A 5IWAQ 1XMOL 2AHOB 3CW2C 5IP7H 4JI3Q 4A76A 1QUQA 4B3MQ 5BR8L 3RN2A 1XJVA 4DUYQ 4PZ6A 4A3CG 3RLOA 5M5YH 1XPRA 1Z47A 4IJLA 4QY7A 2E5LQ 2ASBA 4A3MH 2UUAQ 1YNXA 1KC8C 4DPGA 4LF4L 3RLNA 4LF7L 4A75A 2NZOA 4DUZL 1TWGH 1V43A 4AH6A 3ULPA 5LMUQ 4P72A 1Y1VH 4LNQA 1GD7A 4JC0A 4R4OA 4B3TL 4GKJQ 1VQEA 3CAMA 2KHJA 1EIFA 4PG3A 5LMNQ 1MJEA 3GTOH 3H3VI 1MKHA 5JJKA 3H0GG 1KAWA 4QJFA 1VQCA 4X64Q 3G6EA 1X54A 1VQBA 2JA6H 3W5OA 3BZKA 2Z6KC 3NBHB 4LFBL 1B7YB 2NVTH 4OWWB 1IBLQ 1KHIA 4LF5L 4GKKQ 2UXBQ 4GN4B 4JBWA 2UXCL 3OW2A 2HQLA 1JB7A 2A1AA 4C2MH 1CSPA 2B63H 1P8LA 5ELNA 4BY7H 1CUKA 1CKOA 1UWVA 3PIPA 1X9NA 1HNWQ 4IPCA 4DNIA 2FXQA 3I4NH 4GLXA 2MO1A 3KF6A 2MNAA 3E0EA 1QZHA 2DUDA 2AWNA 1ASZA 1XNQL 2JA7G 3TS2A 5GAGC 4JI1L 2VQFQ 2NVXH 2QGQA 3NELA 5C44H 3CF5A 1E7ZA 3AEVA 1VQJA 3AFPA 4JBJA 3T1YL 2D0OA 2CCZA 3FKIH 2HHHL 2UUCL 4POFA 5C0XI 1CKNA 2JEBI 3PIOA 4DR5Q 1GVPA 3J81i 1V9PA 4UP7A 1QVFA 4RMFA 4APVA 1VQ4A 3KYHC 4YHHL 1TWCH 1HNXL 4JBKA 1FJGL 2IX1A 4EQ5A 4JI8L 1QZGA 3HOZG 1XTDA 3CPFA 3CQZH 5C0XJ 4BXXH 5H1SE 1X3EA 4HIDA 4DV6Q 5FLMG 4JI0Q 1PH7A 4R4CA 1JJCB 2F4VL 3PO2G 2PMZE 1HZ9A 3CXCA 3CCJA 1JJ2A 3M9BA 3PGZA 1YI2A 5IY0A 1WYDA 3CMEA 4B3RL 3OTOL 4A4IA 4LFCL 2YTXA 3CCUA 2VS1A 4JBMA 3MXNB 3GD7A 3SGIA 3FP9A 3I55A 2JJQA 4DV4Q 1Y1WH 1I94Q 1I50H 2BA1A 2GN5A 4A3IH 1Q81C 1XMOQ 2B29A 1P16A 5FJ8H 4DR3Q 1NBWA 3OYYA 5GADC 4LFAL 5GAHC 4B3ML 5BR8Q 4KI0A 4WJ4A 2AKWB 2R7FA 4A3BG 2ZTDA 3S1MH 4DR1Q 2E5LL 5GAEC 2RCNA 2UU9L 3T1HQ 1PV4A 3PUVA 3U4ZA 3KJPA 2R7ZH 4BBSG 1KRTA 2VUMG 2UXDL 4X6AH 3S24A 1YHAA 2K50A 4NXNL 1L1OA 1A8VA 1VS0A 3PUXA 4DR2Q 1EFWA 4BY7G 4OO1G 1OXXK 2YYZA 2CKZB 3GTGH 1SROA 2CWAA 5ELOA 1K0RA 1I5FA 3A74A 4L5QA 4A93G 4B3TQ 5M5WH 4MZ9A 2JA7H 1VCIA 4A3JG 1KXLA 1J5EL 2JA5G 4A3GG 3K80C 4A3BH 5IYCH 1VQHA 2ZTCA 2ALYB 1YITA 1XNRQ 4P73A 4QQBX 2EXDA 2D0PA 1B70B 1X6OA 5IYDG 3GTQH 2K5VA 4R4IA 2ID0A 1FL0A 1WCMG 3KOJA 2QEXA 5E7NA 4C3IH 2VW9A 4YCUA 4LF5Q 2VL6A 4IFDI 3J80c 4GKKL 2R93H 1IYJB 4A3DG 4KHPQ 3JAMi 3A5ZB 2JA9A 2Z6KA 2JA5H 3D0FA 3CMAA 4LF6L 3J7A5 1N32Q 1L1OC 1K9MC 1HZBA 1LUZA 2JE6I 2B63G 2LSSA 3PO3H 4A3FH 4GNXB 1N9WA 2YTYA 2KBNA 3HOUH 4C3HH 3KF8B 1CKNB 4LUZA 3MEFA 1EUJA 3IRBA 4JI2L 1WCMH 4GLVB 3T1YQ 2IHFA 2R92H 2B3GA 4LW1A 5IP9G 3GTMH 2UUCQ 1X55A 1VQKA 4IFDG 4X65Q 2WFWA 2ATWA 4UP9A 5DLQE 2HIXA 3G71A 2RF4A 3GDEA 4UPAA 3WWVA 5C3EH 3HKSA 1V1QA 2YU9H 3K81C 3FHWA 2N8NA 3HOXH 1G291 1GO3E 3M4PA 3TREA 4OXPA 4P75A 1Y1VG 3RR5A 5K36G 1Y14B 1L0WA 3CC4A 1PH1A 2R92G 2VQEL 3I4OA 4R4QA 3U4VA 5FLMH 4DV2L 3GO5A 5IWAL 2VUMH 3CC7A 5AJ3L 1E3PA 1XPOA 2OCEA 4QL5A 5M3FH 3KDFA 4JI4Q 1NE3A 1PFSA 3CCRA 2OWOA 4JI5Q 2F52A 4LFCQ 4DV4L 2RHSB 1A63A 4KHZA 5C0XG 5JJIA 4GNXC 2JQOA 1D7QA 2VY3A 2UUAL 2BH2A 2L15A 5C4XH 3H15A 1J6QA 4A3IG 3BJUA 3H3VH 4GLAC 4LFAQ 4AQYL 4O2DA 3JC66 5LMUL 4IO9A 1K8AC 3Q8DA 1L1OB 3I56A 4JG2A 4OO1I 3E9IA 1VQPA 3L2PA 1N34L 3J7ZC 4DR1L 5JJLA 4X64L 3F2CA 1UE5A 2V1CC 4R1JA 3A5UA 1PA6A 2GVBA 4DR5L 2HIVA 5EAYA 4EX5A 1EOVA 1C0AA 1PH9A 4LWCA 3LGJA 1YJ9A 3PO3G 3PCOB 4A3FG 4LUOA 4A3EG 1X56A 4JI7L 2NVQH 1JT8A 1HZCA 1KRSA 3UDIA 1XMQL 2KCTA 1C7YA 3CCSA 1VQ5A 4DR6L 1BBWA 4DV0Q 1VQDA 4DV6L 1Q1EA 3J81j 1VQ6A 2VZAA 1XPUA 3CCVA 3A0JA 5IYCG 2A8VA 1OTCA 1VQ8A 3HOYH 3ICEA 2Q2IA 4Y7NH 3CP0A 4YCWA 1KL9A 3S2HH 3S14H 4POGA 4DV7Q 1VQAA 1SR3A 3L7ZC 4GOPA 1I94L 3M4OH 2R93G 4TVAB 1OXVA 4DK6C 3UDGA 1YBYA 1C9OA 1NTGA 1BKBA 4DUZQ 2WB1G 3I4MH 2PI2A 1NMGA 2NN6I 1K83H 2UUBL 2AMCB 2OTJA 1VQ7A 3F2DA 3HOZH 1Q8KA 4BY1G 3KLWA 4DR4Q 1K3RA 1YZ6A 2ZTEA 3S15H 2IHEA 4NXNQ 2A19A 4HJAA 3JAMc 4LF9Q 3HOWH 3PUWA 1E1TA 1MIUA 4GN5A 1UE1A 4ALPA 4BBRH 4JV5Q 4HIKA 4GNXA 2JA8H 2D62A 1VQGA 3BZCA 4IOCA 2UXBL 2R6GA 1X3GA 4A3CH 1E22A 4PZ7A 1AH9A 2NN6G 5GQOA 1PHJA 1EIYB 1Q1BA 2K5HA 4BY1H 1H95A 2XGTA 2CWPA 1IZ6A 3CCMA 3B6YA 1JE5A 4A3KG 2KENA 1JMCA 1N33Q 3J81c 1TWHH 4OWXB 1WOCA 4R4TA 1OXSC 3D31A 4O0AA 3KJOA 3K8AA 1IBKQ 4A3LG 4GS3A 2MQHA 1A62A 3M4QA 3NEMA 2CQOA 1WFQA 4BXXG 4KLKA 1AE3A 1OXUA 2WP8J 1N36L 3RZOH 1TXYA 2GVAA 2E2JH 4K0KQ 1PH6A 2NZHA 2AWOA 4DV1Q 4UY8C 4YHHQ 2YV5A 1E24A 1IBMQ 5JEAG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K H;  4MTN A;  1KIX A;  4H02 A;  1HNZ L;  2H5X A;  3HOV H;  3DM3 A;  5LMN W;  4P74 A;  3S1R H;  1VQL A;  4JI0 L;  4YY3 Q;  4A3L H;  1SFO H;  4B3S Q;  2F4V Q;  1G51 A;  1X3F A;  1Q86 C;  1D8L A;  2JK8 A;  4NPS A;  3PO2 H;  1IXR A;  4MNO A;  1HZA A;  4A3M G;  4B3R Q;  1O7I A;  3W1G A;  1VQO A;  3HOX G;  1QUQ B;  3I2Z A;  4DKA C;  2I5M X;  4DV0 L;  4A3D H;  1NY4 A;  2XTI A;  4YWM A;  3S16 H;  3GTJ H;  4DV3 Q;  3H0G H;  3CCE A;  5LMN L;  5J3B A;  3U50 C;  4BBS H;  2RHQ B;  4HIM A;  3KDF B;  3PV0 A;  4JI5 L;  1WI5 A;  4GN3 B;  3UE0 A;  3S2D H;  1S72 A;  4OWT B;  4AYB E;  1YJN A;  2UU9 Q;  3AQQ A;  1TWA H;  4X65 L;  1IBL L;  2E8G A;  1HR0 L;  2Q2T A;  4PZ8 A;  3VDY A;  1PYB A;  1EWI A;  4HJ9 A;  4JOI C;  4AQY Q;  4NXM L;  3GTL H;  4X66 Q;  1LTL A;  3EBE A;  4JI6 Q;  3I4M G;  3I4N G;  1YJW A;  2N49 A;  1KQS A;  3UDX A;  3AYH B;  4ME3 A;  4BA1 I;  1J5E Q;  4A93 H;  1HNW L;  1N8R C;  1XNQ Q;  2VQE Q;  4DR4 L;  5C44 G;  4DV2 Q;  3U58 A;  2ZJR A;  3AFQ A;  3M85 A;  2PQA A;  3PF5 A;  1QVC A;  3K0X A;  5M3M G;  5AJ3 Q;  4LF9 L;  2VNU D;  3F2B A;  1SMX A;  5IYD H;  3ZJY C;  4OX9 L;  2WAQ E;  1GM5 A;  1XMQ Q;  3M7N A;  2F3I A;  2OQK A;  4UP8 A;  4GOP C;  4LF8 Q;  4LF7 Q;  3HOU G;  4BA2 I;  4JYA Q;  1KD1 C;  1SRU A;  3HKZ G;  4NB3 A;  4DR7 L;  1X65 A;  3HOV G;  1VQN A;  4DV5 L;  4GOP B;  2C35 B;  2K5N A;  4GKJ L;  2R7Z G;  5C4X G;  1PH3 A;  4YWL A;  1RL2 A;  1UEB A;  3S1Q H;  4J15 A;  2JA6 G;  2MFI A;  3CCQ A;  4P71 A;  3L0O A;  3F8T A;  2Z0S A;  4JI2 Q;  2K14 A;  4DV7 L;  5IP7 G;  2I5L X;  1K73 C;  4YCV A;  3TEH B;  1IBK L;  3RZD H;  4A3G H;  3BU2 A;  1HJP A;  4RG1 A;  1E1O A;  3OTO Q;  1PH2 A;  5GRO A;  3RLF A;  4DUY L;  2OTL A;  3KFU A;  1FVI A;  1ASY A;  3ULL A;  5IT9 c;  2QA4 A;  1SLJ A;  3UDF A;  4DAM A;  5IYB H;  3S17 H;  3PUY A;  4XIG S;  3CCL A;  5FJ8 G;  4A3E H;  2HT1 A;  4IOA A;  1HNZ Q;  4LF4 Q;  1HH2 P;  4L5R C;  1Y1W G;  3KF6 B;  4L5S A;  4JI1 Q;  4QGU A;  1UE7 A;  3FKI G;  2ZM6 Q;  1HR0 W;  4JI4 L;  4DAY B;  4HJ8 A;  4BBR G;  2HHH Q;  2WB1 E;  2NVY H;  4X62 Q;  1VQF A;  1RIP A;  3STB C;  4AIM A;  1I6H H;  5HGQ A;  2IY5 B;  2K52 A;  2ZJP A;  4LFB Q;  4PMW A;  5HY6 A;  4HJ5 A;  1DGS A;  1LYL A;  3HFZ B;  1YIJ A;  1FGU A;  4JI8 Q;  3CPW A;  5IP9 H;  4IFD J;  4Y52 H;  5C3E G;  2UXC Q;  2IX0 A;  2LXJ A;  1W3S A;  2E2I H;  2WAQ G;  2E2H H;  1UE6 A;  3EN2 A;  1XNR L;  1CKM A;  2R7D A;  4JCV E;  3TRZ A;  2BA0 A;  3STB D;  3CD6 A;  3PSI A;  4JI3 L;  2MO0 A;  2PI2 E;  2CFM A;  5IE8 A;  4HIO A;  4LUV A;  1EYG A;  4JV5 L;  1QVG A;  3ER0 A;  4IPH A;  3HOW G;  4DV1 L;  3M3Y H;  4KHP L;  1SE8 A;  4JI7 Q;  1NMF A;  3ULJ A;  2DGY A;  3K7A H;  3K7U C;  1PYS B;  1YEZ A;  4DR6 Q;  3RNU A;  2I0Q A;  4TQU S;  1VQ9 A;  1WJJ A;  4QIW E;  4YY3 L;  3CC2 A;  1S40 A;  3ERS X;  1EQQ A;  1K8G A;  1U5K A;  3PF4 A;  3HOY G;  3NEN A;  4JOI A;  4AYB G;  3T1H L;  1N33 L;  4OX9 Q;  2UXD Q;  2EQS A;  2YTV A;  2BH8 A;  5IYB G;  1CSQ A;  1SN8 A;  4LF8 L;  1Q12 A;  1NJI C;  4DR7 Q;  1B8A A;  1A0I A;  1VQI A;  3J80 i;  4A3J H;  5C4J H;  4DK3 C;  1R9T H;  2LXK A;  4DV5 Q;  2K4K A;  4WJ3 M;  1GKH A;  1U0L A;  2Q2U A;  3EIV A;  3UE1 A;  2N78 A;  1JJG A;  1Z9F A;  3RN5 A;  2ZJQ A;  2Q2H A;  2UUB Q;  2KHI A;  1BVS A;  5M3F G;  1PH4 A;  4DR3 L;  2JA8 G;  1BBU A;  1IL2 A;  1YHB A;  3DLL A;  2IT1 A;  4B3S L;  2JEA I;  1HR0 Q;  1G6P A;  2PNH A;  2VQF L;  2Y0S E;  4C3J H;  1TWF H;  2EIF A;  5M5X H;  1VQM A;  4NXM Q;  1AE2 A;  4L5T A;  3E9H A;  4LF6 Q;  3GTP H;  1I3Q H;  4JI6 L;  3HKZ E;  2N3S A;  1PH8 A;  3GTK H;  4DR2 L;  1T9H A;  1Q46 A;  3F1Z A;  3TQY A;  1EQR A;  1YHQ A;  4HJ7 A;  3S1N H;  1S3O A;  4IJH A;  4IPD A;  4FDB A;  2K75 A;  1HNX Q;  4DV3 L;  1FJG Q;  3G48 A;  1N34 Q;  2PQA B;  3PUZ A;  2ZM6 L;  1Q7Y C;  5M3M H;  1L2F A;  1Q82 C;  2Y0S G;  1PH5 A;  4X62 L;  3G4S A;  4JYA L;  1PVO A;  1YVC A;  5FLX c;  4YWK A;  2I5H A;  4IPG A;  1OXT A;  1M1K C;  3W1B A;  2KCM A;  1N36 Q;  3I7F A;  4XTC S;  4K0K L;  1MJC A;  2OQ0 A;  4X66 L;  3TS0 A;  1W2B A;  1N32 L;  1IBM L;  2ES2 A;  1M90 C;  4OON A;  5JEA J;  1LM0 A;  5IWA Q;  1XMO L;  2AHO B;  3CW2 C;  5IP7 H;  4JI3 Q;  4A76 A;  1QUQ A;  4B3M Q;  5BR8 L;  3RN2 A;  1XJV A;  4DUY Q;  4PZ6 A;  4A3C G;  3RLO A;  5M5Y H;  1XPR A;  1Z47 A;  4IJL A;  4QY7 A;  2E5L Q;  2ASB A;  4A3M H;  2UUA Q;  1YNX A;  1KC8 C;  4DPG A;  4LF4 L;  3RLN A;  4LF7 L;  4A75 A;  2NZO A;  4DUZ L;  1TWG H;  1V43 A;  4AH6 A;  3ULP A;  5LMU Q;  4P72 A;  1Y1V H;  4LNQ A;  1GD7 A;  4JC0 A;  4R4O A;  4B3T L;  4GKJ Q;  1VQE A;  3CAM A;  2KHJ A;  1EIF A;  4PG3 A;  5LMN Q;  1MJE A;  3GTO H;  3H3V I;  1MKH A;  5JJK A;  3H0G G;  1KAW A;  4QJF A;  1VQC A;  4X64 Q;  3G6E A;  1X54 A;  1VQB A;  2JA6 H;  3W5O A;  3BZK A;  2Z6K C;  3NBH B;  4LFB L;  1B7Y B;  2NVT H;  4OWW B;  1IBL Q;  1KHI A;  4LF5 L;  4GKK Q;  2UXB Q;  4GN4 B;  4JBW A;  2UXC L;  3OW2 A;  2HQL A;  1JB7 A;  2A1A A;  4C2M H;  1CSP A;  2B63 H;  1P8L A;  5ELN A;  4BY7 H;  1CUK A;  1CKO A;  1UWV A;  3PIP A;  1X9N A;  1HNW Q;  4IPC A;  4DNI A;  2FXQ A;  3I4N H;  4GLX A;  2MO1 A;  3KF6 A;  2MNA A;  3E0E A;  1QZH A;  2DUD A;  2AWN A;  1ASZ A;  1XNQ L;  2JA7 G;  3TS2 A;  5GAG C;  4JI1 L;  2VQF Q;  2NVX H;  2QGQ A;  3NEL A;  5C44 H;  3CF5 A;  1E7Z A;  3AEV A;  1VQJ A;  3AFP A;  4JBJ A;  3T1Y L;  2D0O A;  2CCZ A;  3FKI H;  2HHH L;  2UUC L;  4POF A;  5C0X I;  1CKN A;  2JEB I;  3PIO A;  4DR5 Q;  1GVP A;  3J81 i;  1V9P A;  4UP7 A;  1QVF A;  4RMF A;  4APV A;  1VQ4 A;  3KYH C;  4YHH L;  1TWC H;  1HNX L;  4JBK A;  1FJG L;  2IX1 A;  4EQ5 A;  4JI8 L;  1QZG A;  3HOZ G;  1XTD A;  3CPF A;  3CQZ H;  5C0X J;  4BXX H;  5H1S E;  1X3E A;  4HID A;  4DV6 Q;  5FLM G;  4JI0 Q;  1PH7 A;  4R4C A;  1JJC B;  2F4V L;  3PO2 G;  2PMZ E;  1HZ9 A;  3CXC A;  3CCJ A;  1JJ2 A;  3M9B A;  3PGZ A;  1YI2 A;  5IY0 A;  1WYD A;  3CME A;  4B3R L;  3OTO L;  4A4I A;  4LFC L;  2YTX A;  3CCU A;  2VS1 A;  4JBM A;  3MXN B;  3GD7 A;  3SGI A;  3FP9 A;  3I55 A;  2JJQ A;  4DV4 Q;  1Y1W H;  1I94 Q;  1I50 H;  2BA1 A;  2GN5 A;  4A3I H;  1Q81 C;  1XMO Q;  2B29 A;  1P16 A;  5FJ8 H;  4DR3 Q;  1NBW A;  3OYY A;  5GAD C;  4LFA L;  5GAH C;  4B3M L;  5BR8 Q;  4KI0 A;  4WJ4 A;  2AKW B;  2R7F A;  4A3B G;  2ZTD A;  3S1M H;  4DR1 Q;  2E5L L;  5GAE C;  2RCN A;  2UU9 L;  3T1H Q;  1PV4 A;  3PUV A;  3U4Z A;  3KJP A;  2R7Z H;  4BBS G;  1KRT A;  2VUM G;  2UXD L;  4X6A H;  3S24 A;  1YHA A;  2K50 A;  4NXN L;  1L1O A;  1A8V A;  1VS0 A;  3PUX A;  4DR2 Q;  1EFW A;  4BY7 G;  4OO1 G;  1OXX K;  2YYZ A;  2CKZ B;  3GTG H;  1SRO A;  2CWA A;  5ELO A;  1K0R A;  1I5F A;  3A74 A;  4L5Q A;  4A93 G;  4B3T Q;  5M5W H;  4MZ9 A;  2JA7 H;  1VCI A;  4A3J G;  1KXL A;  1J5E L;  2JA5 G;  4A3G G;  3K80 C;  4A3B H;  5IYC H;  1VQH A;  2ZTC A;  2ALY B;  1YIT A;  1XNR Q;  4P73 A;  4QQB X;  2EXD A;  2D0P A;  1B70 B;  1X6O A;  5IYD G;  3GTQ H;  2K5V A;  4R4I A;  2ID0 A;  1FL0 A;  1WCM G;  3KOJ A;  2QEX A;  5E7N A;  4C3I H;  2VW9 A;  4YCU A;  4LF5 Q;  2VL6 A;  4IFD I;  3J80 c;  4GKK L;  2R93 H;  1IYJ B;  4A3D G;  4KHP Q;  3JAM i;  3A5Z B;  2JA9 A;  2Z6K A;  2JA5 H;  3D0F A;  3CMA A;  4LF6 L;  3J7A 5;  1N32 Q;  1L1O C;  1K9M C;  1HZB A;  1LUZ A;  2JE6 I;  2B63 G;  2LSS A;  3PO3 H;  4A3F H;  4GNX B;  1N9W A;  2YTY A;  2KBN A;  3HOU H;  4C3H H;  3KF8 B;  1CKN B;  4LUZ A;  3MEF A;  1EUJ A;  3IRB A;  4JI2 L;  1WCM H;  4GLV B;  3T1Y Q;  2IHF A;  2R92 H;  2B3G A;  4LW1 A;  5IP9 G;  3GTM H;  2UUC Q;  1X55 A;  1VQK A;  4IFD G;  4X65 Q;  2WFW A;  2ATW A;  4UP9 A;  5DLQ E;  2HIX A;  3G71 A;  2RF4 A;  3GDE A;  4UPA A;  3WWV A;  5C3E H;  3HKS A;  1V1Q A;  2YU9 H;  3K81 C;  3FHW A;  2N8N A;  3HOX H;  1G29 1;  1GO3 E;  3M4P A;  3TRE A;  4OXP A;  4P75 A;  1Y1V G;  3RR5 A;  5K36 G;  1Y14 B;  1L0W A;  3CC4 A;  1PH1 A;  2R92 G;  2VQE L;  3I4O A;  4R4Q A;  3U4V A;  5FLM H;  4DV2 L;  3GO5 A;  5IWA L;  2VUM H;  3CC7 A;  5AJ3 L;  1E3P A;  1XPO A;  2OCE A;  4QL5 A;  5M3F H;  3KDF A;  4JI4 Q;  1NE3 A;  1PFS A;  3CCR A;  2OWO A;  4JI5 Q;  2F52 A;  4LFC Q;  4DV4 L;  2RHS B;  1A63 A;  4KHZ A;  5C0X G;  5JJI A;  4GNX C;  2JQO A;  1D7Q A;  2VY3 A;  2UUA L;  2BH2 A;  2L15 A;  5C4X H;  3H15 A;  1J6Q A;  4A3I G;  3BJU A;  3H3V H;  4GLA C;  4LFA Q;  4AQY L;  4O2D A;  3JC6 6;  5LMU L;  4IO9 A;  1K8A C;  3Q8D A;  1L1O B;  3I56 A;  4JG2 A;  4OO1 I;  3E9I A;  1VQP A;  3L2P A;  1N34 L;  3J7Z C;  4DR1 L;  5JJL A;  4X64 L;  3F2C A;  1UE5 A;  2V1C C;  4R1J A;  3A5U A;  1PA6 A;  2GVB A;  4DR5 L;  2HIV A;  5EAY A;  4EX5 A;  1EOV A;  1C0A A;  1PH9 A;  4LWC A;  3LGJ A;  1YJ9 A;  3PO3 G;  3PCO B;  4A3F G;  4LUO A;  4A3E G;  1X56 A;  4JI7 L;  2NVQ H;  1JT8 A;  1HZC A;  1KRS A;  3UDI A;  1XMQ L;  2KCT A;  1C7Y A;  3CCS A;  1VQ5 A;  4DR6 L;  1BBW A;  4DV0 Q;  1VQD A;  4DV6 L;  1Q1E A;  3J81 j;  1VQ6 A;  2VZA A;  1XPU A;  3CCV A;  3A0J A;  5IYC G;  2A8V A;  1OTC A;  1VQ8 A;  3HOY H;  3ICE A;  2Q2I A;  4Y7N H;  3CP0 A;  4YCW A;  1KL9 A;  3S2H H;  3S14 H;  4POG A;  4DV7 Q;  1VQA A;  1SR3 A;  3L7Z C;  4GOP A;  1I94 L;  3M4O H;  2R93 G;  4TVA B;  1OXV A;  4DK6 C;  3UDG A;  1YBY A;  1C9O A;  1NTG A;  1BKB A;  4DUZ Q;  2WB1 G;  3I4M H;  2PI2 A;  1NMG A;  2NN6 I;  1K83 H;  2UUB L;  2AMC B;  2OTJ A;  1VQ7 A;  3F2D A;  3HOZ H;  1Q8K A;  4BY1 G;  3KLW A;  4DR4 Q;  1K3R A;  1YZ6 A;  2ZTE A;  3S15 H;  2IHE A;  4NXN Q;  2A19 A;  4HJA A;  3JAM c;  4LF9 Q;  3HOW H;  3PUW A;  1E1T A;  1MIU A;  4GN5 A;  1UE1 A;  4ALP A;  4BBR H;  4JV5 Q;  4HIK A;  4GNX A;  2JA8 H;  2D62 A;  1VQG A;  3BZC A;  4IOC A;  2UXB L;  2R6G A;  1X3G A;  4A3C H;  1E22 A;  4PZ7 A;  1AH9 A;  2NN6 G;  5GQO A;  1PHJ A;  1EIY B;  1Q1B A;  2K5H A;  4BY1 H;  1H95 A;  2XGT A;  2CWP A;  1IZ6 A;  3CCM A;  3B6Y A;  1JE5 A;  4A3K G;  2KEN A;  1JMC A;  1N33 Q;  3J81 c;  1TWH H;  4OWX B;  1WOC A;  4R4T A;  1OXS C;  3D31 A;  4O0A A;  3KJO A;  3K8A A;  1IBK Q;  4A3L G;  4GS3 A;  2MQH A;  1A62 A;  3M4Q A;  3NEM A;  2CQO A;  1WFQ A;  4BXX G;  4KLK A;  1AE3 A;  1OXU A;  2WP8 J;  1N36 L;  3RZO H;  1TXY A;  2GVA A;  2E2J H;  4K0K Q;  1PH6 A;  2NZH A;  2AWO A;  4DV1 Q;  4UY8 C;  4YHH Q;  2YV5 A;  1E24 A;  1IBM Q;  5JEA G; 
#chains in the Genus database with same CATH topology
 5D3D A;  3IFD A;  2H5X A;  2F0W A;  1I4P A;  4JI0 L;  4YY3 Q;  1SFO H;  4B3S Q;  4NPS A;  3DWQ A;  1JR0 D;  3NTH A;  5CV8 A;  4ZUJ A;  4P2C B;  1LTS D;  5FOB B;  2SDF A;  2XTI A;  2B2Y A;  3GTJ H;  1LTR D;  3BYY B;  3HOU B;  1IW7 C;  3KDF B;  4HTH A;  2XRS D;  2O5J C;  2K33 A;  5C44 B;  2E8G A;  1M8A A;  4CBV A;  1Y69 U;  4AQY Q;  4NXM L;  4X66 Q;  3HOZ B;  4JI6 Q;  2N49 A;  2LS0 1;  3EQL C;  3I73 A;  1STH A;  5LHY 1;  2D9U A;  5C44 G;  4I7A A;  3PF5 A;  1QVC A;  5AJ3 Q;  1KTK A;  3S2H B;  5KYL A;  1Y8P B;  5CYU A;  4DNT B;  1GM5 A;  4YIJ A;  5A2Q E;  1HUN A;  1U4P A;  2OQK A;  3HOU G;  4GOP C;  1SXT A;  4X3T A;  2PZU A;  1SRU A;  2R61 A;  1X65 A;  1VQN A;  5C4X G;  1TKW B;  1SE2 A;  2PMZ B;  3L0O A;  4JI2 Q;  4IZ8 A;  3TEH B;  1IBK L;  1JOQ A;  3RZD H;  3BU2 A;  1HJP A;  2MJ8 A;  3FVQ A;  3CRL C;  3KFU A;  1FVI A;  4FVM A;  4CKE A;  3Q0A A;  4A3E H;  2HT1 A;  4K5X A;  3MAQ A;  1O7Z A;  4QGU A;  5E4X A;  2OXP A;  1STY A;  1WTX A;  1C4Q A;  2JP1 A;  4FXG C;  2WB1 E;  2NVY H;  1QNU A;  4Z9C B;  4HJ5 A;  2BOS A;  5FO8 B;  1QIL A;  1CQV A;  1D5M C;  1FNU A;  2UXC Q;  2DJG C;  1QJO A;  5EKK A;  3EN2 A;  2B8G A;  1IKM A;  2AQ3 B;  3F2U A;  4ZLT F;  2CFM A;  2EOT A;  4IPH A;  3GTM B;  1TS2 A;  5BN3 A;  2XIW A;  3M3Y H;  3S1N B;  4CDC C;  3R93 A;  4TQU S;  2ICI A;  4R9W A;  1EQQ A;  1K8G A;  1ROD A;  3PF4 A;  3HOW B;  4BS9 A;  5I2Y A;  4RH6 A;  1O7Y A;  4OIJ A;  4RAU C;  4IUN A;  4LJZ C;  2BH8 A;  1CSQ A;  5EBD A;  2A6E C;  4IFD H;  1SNO A;  1B50 A;  1Z9F A;  2A69 C;  5M3F B;  1UAP A;  2Q8R E;  1H9R A;  1PH4 A;  4DR3 L;  2JA8 G;  2HCC A;  4CJ0 B;  2KHS A;  3A7A B;  3DLL A;  2JEA I;  1Q3L A;  3OW7 A;  2PNH A;  2VQF L;  4BY1 B;  4C3J H;  1VQM A;  5M5X H;  1AE2 A;  2E75 C;  3E9H A;  3NQT A;  4LF6 Q;  4LAA A;  3CHB D;  1PH8 A;  1G91 A;  1T9H A;  1Q46 A;  3DWP A;  1CI3 M;  1FD7 D;  3SK6 A;  4HJ7 A;  3S1N H;  1AFP A;  1S3O A;  4IPD A;  1FJG Q;  1IL8 A;  3GV6 A;  1N34 Q;  3PUZ A;  4K5V A;  1Q7Y C;  1Q82 C;  1PH5 A;  2XWB B;  4X62 L;  4V0B A;  4KKT A;  3NQI A;  3ND9 A;  3OMC A;  4MN3 A;  3C46 A;  4JYA L;  1PVO A;  2YU9 B;  2BCO A;  3W1B A;  1PYW D;  1MI2 A;  5EJW A;  2KCM A;  1HXY D;  3L9A X;  1N36 Q;  3GTG B;  3I7F A;  1H9S A;  2EY6 A;  4HR7 B;  2L9H A;  1A3V A;  4OON A;  1BOS A;  1LM0 A;  4EQO A;  3TSS A;  2EY1 A;  2XRQ D;  5KGU A;  1QUQ A;  4B3M Q;  5BR8 L;  1XJV A;  4DUY Q;  4A3C G;  5J1Z A;  1CT1 D;  4IJL A;  2E5L Q;  2I46 A;  1JWU D;  3OWE B;  4RKL A;  1Y1W B;  2UUA Q;  4N9P A;  4A75 A;  2NZO A;  1NNX A;  4LNQ A;  3SXH A;  1F9S A;  4JC0 A;  4GKJ Q;  2Z1C A;  2BE5 D;  4PG3 A;  5HUR A;  3GTO H;  1JOR A;  3H3V I;  1MKH A;  1KAW A;  3S16 B;  1VQC A;  2JXM B;  2O2L D;  1FGB D;  3G6E A;  1X54 A;  4KTA A;  5FLX L;  2Z6K C;  4UDU C;  2LMC B;  3D3R A;  4LFB L;  1KAB A;  4OWW B;  5IIF A;  3QB3 A;  1S5F D;  1DM0 B;  4LF5 L;  2OEO A;  2F0V A;  1CA5 A;  4GN4 B;  1EQV A;  1PTO D;  2K01 A;  4BBS B;  4BY7 H;  1JIC A;  1CSP A;  1X9N A;  1UWV A;  2K05 A;  1HNW Q;  2QF7 A;  2MO1 A;  1XNQ L;  1S5E D;  3PIO 3;  3NEL A;  3CF5 A;  1A3U A;  4A3M B;  3AFP A;  2D0O A;  3HEJ A;  3JAM L;  4TSS A;  4X3U A;  3J81 i;  1QVF A;  1BBX C;  5I6W A;  3NBH A;  2B2V C;  4JBK A;  5BN5 A;  4BXX H;  3E6Z X;  5H1S E;  1WTO A;  5FO7 B;  1TY0 A;  4DXG A;  1NR4 A;  3HGB A;  1PH7 A;  5EPJ A;  2F4V L;  3KK7 A;  3GTO B;  2L4N A;  1HZ9 A;  2EVB A;  3CXC A;  2B2W C;  3CCJ A;  1JJ2 A;  1GUW A;  3KF8 A;  2NBF A;  2SNM A;  4A4I A;  3CCU A;  1ZKO A;  2VS1 A;  4M1U B;  4JBM A;  4A3G B;  1ET9 A;  3SGI A;  3FP9 A;  3I55 A;  1A6X A;  2EPB A;  2AQ2 B;  4RHR A;  1TQO A;  5FJ8 H;  2R7Z B;  2AKW B;  1SE4 A;  1BF4 A;  3S1M H;  5GAE C;  2I07 B;  2L55 A;  3T1H Q;  1PV4 A;  2UU9 L;  2UXD L;  2ZXR A;  4BBS G;  1G2T A;  2VUM G;  4NXN L;  1SND A;  2F0K A;  2F03 A;  2A73 B;  4DR2 Q;  3O13 A;  1D1K A;  1S4Z A;  4XYO A;  1SRO A;  2PO4 A;  1K0R A;  2RA4 A;  5NUC A;  2JA7 H;  1B9N A;  5T1G A;  4OL7 A;  5IYC H;  3VA7 A;  1K8M A;  2ZTC A;  2EYO A;  1B2T A;  4N8X 1;  3LWE A;  4QQB X;  1RF2 D;  2PYK A;  5IYD G;  1F9R A;  2K5V A;  4R4I A;  1FYC A;  4C3I H;  4YCU A;  2VL6 A;  3J80 c;  3CKI B;  1JOK A;  4KHP Q;  2JA5 H;  2EDG A;  3CMA A;  1EY6 A;  1L1O C;  1TWF B;  1K9M C;  2JE6 I;  2B63 G;  3PO3 H;  1TII D;  2YTY A;  4C3H H;  3KF8 B;  1CKN B;  4LUZ A;  1EUJ A;  3FMC A;  3QOL A;  1WCM H;  4GLV B;  4DF7 A;  3ZYY X;  1U4M A;  4OHJ A;  1X55 A;  2FHT A;  2UUC Q;  4UP9 A;  5DLQ E;  1EU3 A;  4C1N K;  2RF4 A;  5I2X A;  4UPA A;  3WWV A;  3G71 A;  2Z4I A;  2F0L A;  4C1N I;  4LMQ D;  4RFB A;  3M4P A;  2JN4 A;  2KCN A;  4A3I B;  1PH1 A;  4DAV A;  1SDF A;  2IW3 A;  1K3B C;  5ELE A;  3NWS A;  3CC7 A;  5AJ3 L;  1E3P A;  1XPO A;  2OCE A;  3KDF A;  4JI4 Q;  3SEB A;  2F1M A;  1NE3 A;  4C56 C;  1STG A;  2J7Z A;  2WAC A;  1K83 B;  2GA4 B;  3TP6 A;  1A63 A;  3MFG A;  3H09 A;  5JJI A;  4GNX C;  3TME A;  1D7Q A;  3C1E A;  1ENC A;  5C4X H;  5E1F A;  4K5W A;  2F0N A;  3BJU A;  3J80 E;  1D1I A;  1KDA A;  2L1B A;  4L6T B;  3JC6 6;  4O2D A;  4DGZ A;  5LMU L;  2K1B A;  3E9I A;  1VQP A;  3PO3 B;  2EY5 A;  5JJL A;  2A6H D;  4EQP A;  3I90 A;  3I3C A;  2GVB A;  4DXF A;  3SDZ A;  4NDX A;  2PNR C;  3CU7 A;  3D4W A;  4CHT B;  1RTN A;  3PCO B;  4LUO A;  1X56 A;  2F0G A;  3KLR A;  3RMH A;  1E2Z A;  1KRS A;  4JI7 L;  1PDQ A;  2KCT A;  2O4X A;  4DR6 L;  4DV0 Q;  3AMU A;  1K28 A;  4C3J G;  5K5P A;  3KUP A;  2Q2I A;  3V05 A;  4DV7 Q;  5ISR A;  4GOP A;  3IFT A;  1I94 L;  2K32 A;  2R93 G;  1J9O A;  3QG1 A;  3UDG A;  1YBY A;  2PZW A;  1C9O A;  1RDP D;  5CC4 A;  3ERO A;  1DXM A;  5CGK A;  1Z7T A;  1SBB B;  1I50 B;  3IL8 A;  2KOL A;  2IHE A;  5C0X H;  3NHH A;  3JAM c;  3PUW A;  4ALP A;  1MIU A;  1L0X B;  1QWY A;  1BCP C;  3BZC A;  4IOC A;  5F2D A;  2UXB L;  1I3Q B;  5GQO A;  1T5E A;  2AQ1 B;  3T56 B;  1EIY B;  5M3M B;  1H95 A;  2CWP A;  1RHP A;  5DEH A;  1XYI A;  3L3O C;  3CCM A;  1YNN C;  4CJ2 C;  2KEN A;  2PPB C;  1WOC A;  4O0A A;  2NZ1 D;  4L63 B;  4B9W A;  4A3L G;  3NEM A;  1WFQ A;  1AE3 A;  5FLX E;  3BYT B;  4OO1 H;  2CHB D;  5M5W B;  3GTQ B;  3CRK C;  1SEB D;  3I4O A;  2RVL A;  4FF3 A;  1SNQ A;  3U9O A;  3S1M B;  3H3V C;  5JJZ A;  1D8L A;  2JK8 A;  1DJR D;  3A56 A;  1DZ1 A;  5KEE A;  1X3P A;  1HZA A;  1EY9 A;  4MNO A;  2KVM A;  4LK1 C;  1VQO A;  4XQN A;  3HOX G;  2JA7 B;  3SK5 A;  5JEA H;  5DNF A;  2BE5 C;  2B2V A;  2I5M X;  1KDB A;  1RTO A;  3KBG A;  3H0G H;  3CCE A;  5LMN L;  5M5Y B;  4BBS H;  2EYF A;  3OPO A;  2RHQ B;  4HIM A;  5G3L F;  1S72 A;  4AYB E;  5C4Z A;  3BDC A;  1YJN A;  3J81 E;  3AQQ A;  2ZXO A;  1IBL L;  4IQZ A;  5CV4 A;  4PZ8 A;  3VDY A;  1EWI A;  4MHE A;  4HJ9 A;  3GTL H;  3EBE A;  3RUZ A;  4C3H B;  3I4M G;  1YJW A;  1KQS A;  1RCV D;  1J5E Q;  1HFG A;  1N8R C;  3LWU A;  2VQE Q;  4DR4 L;  3TDQ A;  4QCL A;  4KN4 C;  4LF9 L;  2PQA A;  1SMY C;  5M3M G;  5IT9 L;  2L12 A;  4EQN A;  5E4W C;  2PQE A;  1A2U A;  2JA6 B;  5L37 A;  5KRU A;  2A6E D;  4UP8 A;  1TU2 B;  4BA2 I;  4HAE A;  1PRT B;  2DY8 A;  4EVO A;  3HKZ G;  4DR7 L;  3K57 A;  4GKJ L;  5LL6 X;  2R7Z G;  3F8T A;  2Z0S A;  1K73 C;  2B2T C;  1AZQ A;  2NVQ B;  2I5L X;  3OTO Q;  1PH2 A;  5GRO A;  1LAB A;  3BG3 A;  2QCP X;  4C2M B;  1MBY A;  4G7Z C;  1ASY A;  3UDF A;  3TP7 A;  4DAM A;  5IYB H;  1EY0 A;  1HNZ Q;  1F77 A;  4IOA A;  2B2U A;  4WFN 3;  1DCZ A;  5JVG 3;  4L5S A;  2B39 A;  3R2I A;  1B44 D;  3S2D B;  1ONL A;  4K2L A;  1O80 A;  1I6H H;  1RIP A;  5HGQ A;  4IUP A;  4K8J A;  2ZJP A;  4PMW A;  2XVS A;  1LYL A;  3M4O B;  2K03 A;  3CPW A;  1IYV A;  1HPC A;  4Y52 H;  1K8O A;  3Q23 A;  2WAQ G;  2DY7 A;  2H1E A;  2FIN B;  3T51 B;  3ND8 A;  3T13 A;  1KNA A;  4JCV E;  1MSH A;  3STB D;  3DM1 A;  1TY2 A;  4JW0 A;  5IE8 A;  1AEX A;  4HIO A;  1CFM A;  1QVG A;  5EBC A;  3MXN A;  2RCF A;  1NMF A;  3K7A H;  3K7U C;  1CQF A;  3RNU A;  2I0Q A;  5IGD A;  1WJJ A;  4QIW E;  4YY3 L;  1S40 A;  2EE1 A;  4FF2 A;  1TWG B;  1GUG A;  1EY4 A;  3NEN A;  3T1H L;  1N33 L;  2UXD Q;  4OX9 Q;  5IYB G;  4LF8 L;  1SN8 A;  5ELF A;  1IHZ A;  4QMG A;  1VQI A;  3J80 i;  4A3J H;  1B3Q A;  1R9T H;  4DV5 Q;  2Q2U A;  3EIV A;  1EYA A;  1U9R A;  4ME5 A;  2KHI A;  3RZD B;  2K04 A;  1BVS A;  2M9V A;  5COY A;  1BBU A;  4KMU C;  2E2D C;  1G6P A;  2Y0S E;  3QIA A;  1F2L A;  4JPB W;  4NXM Q;  4IUV A;  3GTP H;  1I3Q H;  4JI6 L;  3HKZ E;  2N3S A;  3GTK H;  5IT9 E;  4CDF C;  1EEI D;  1H9K A;  2K6A A;  1YHQ A;  4FDB A;  1WVL A;  4NKL A;  2ZM6 L;  3MEH A;  1DYQ A;  1JOO A;  3UI2 A;  1X32 A;  4CDE C;  2IX3 A;  1SSO A;  4UHV A;  1D5X C;  1EZ8 A;  4ZRZ A;  5FLX c;  2Q8I B;  3MTS A;  2LY7 A;  5EKI A;  3EA6 A;  2FMM A;  4XTC S;  4K0K L;  3NP8 A;  2FFK B;  4KN7 C;  3TS0 A;  3T16 A;  4MTK A;  3BVG A;  2FMC A;  2WAQ B;  2B2Y C;  2AHO B;  4JI3 Q;  4ILW A;  4A76 A;  3RN2 A;  1XPR A;  4QY7 A;  1F9Q A;  1UNS A;  5CMD A;  2NB0 A;  4DPG A;  1HQR D;  4DUZ L;  1EYC A;  5LMU Q;  1ESF A;  4B3T L;  5JJK A;  1MJE A;  2O5I C;  2A74 C;  4F7X A;  2F0O A;  2JA6 H;  4ZCK A;  3W5O A;  5I9O A;  1B7Y B;  3G7L A;  2NVT H;  1GXD C;  4J1M A;  4GKK Q;  1LT4 D;  1W6J A;  4JBW A;  5J39 A;  2UXC L;  3OSO A;  2B63 H;  1CUK A;  4IPC A;  3EFX D;  2G9H D;  4CDD C;  4GLX A;  1STE A;  4ABN A;  3G6J B;  3TS2 A;  1NUC A;  1PLF A;  2QGQ A;  3QR8 A;  1PTO F;  1ML0 D;  4RKB A;  1GVP A;  2BDN A;  3NK9 A;  3NPP A;  4UP7 A;  4RMF A;  1VQ4 A;  1WTH A;  2M2L A;  1HNX L;  4JI8 L;  3CQZ H;  3V96 A;  1X3E A;  4HID A;  2F0S A;  5FLM G;  4JI0 Q;  1WCM B;  1JJC B;  3PO2 G;  1SNM A;  1XWE A;  2PMZ E;  4C3H G;  3K5L A;  3CME A;  3BS1 A;  4LFC L;  2YTX A;  4QIW B;  3GD7 A;  3P20 A;  2JJQ A;  2XSC A;  3URY A;  1I50 H;  4A3I H;  1CTM A;  1XMO Q;  4DR3 Q;  1NBW A;  3OYY A;  1S5B D;  2A6H C;  4HN7 A;  5GAH C;  1XXG A;  4KI0 A;  2L11 A;  3DHQ A;  4PMC A;  4S3S A;  4WJ4 A;  2R7F A;  2ZTD A;  4DR1 Q;  2R7Z H;  3U4Z A;  1A2T A;  3A8K E;  1VS0 A;  4R8I A;  2XWJ B;  1PTO B;  3K5O A;  4BY7 G;  1OXX K;  1I5F A;  4K8I A;  4L5Q A;  2CQA A;  5C4J B;  4A3B H;  5EQ0 A;  1YIT A;  2HDM A;  1XNR Q;  4P73 A;  2D0P A;  2DN8 A;  1X6O A;  3GTQ H;  3HOX B;  1WCM G;  2QEX A;  5E7N A;  2NUC A;  1RJT A;  2R93 H;  1LAC A;  3JAM i;  1II3 A;  2JA9 A;  2Z6K A;  4JK1 C;  1LUZ A;  5FKA C;  2LSS A;  4A3F H;  4KY5 A;  5D65 A;  2KBN A;  2JA8 B;  3P1H A;  1STA A;  1EU4 A;  3IRB A;  4JI2 L;  3T1Y Q;  2IHF A;  2B3G A;  4LW1 A;  2HQE A;  2QKI C;  4K2K A;  3QOJ A;  1VQK A;  1VMC A;  4KV6 A;  2ATW A;  3QO2 A;  5A35 A;  3VR4 A;  3GDE A;  2YU9 H;  5C3E H;  1V1Q A;  2EYM A;  2N8N A;  1A15 A;  2F0E A;  4P75 A;  3RR5 A;  1GJX A;  2VQE L;  1IW7 D;  1MD2 D;  1EWC A;  5IWA L;  1I4Q A;  2VUM H;  4ZAI A;  5M3F H;  1JE4 A;  4JI5 Q;  2EJM A;  2F52 A;  3BDO A;  4DV4 L;  1G2S A;  1BNZ A;  3TBI B;  2JQO A;  2VY3 A;  4C3J B;  1OO9 B;  1ICW A;  3TN2 A;  4OIK A;  3VYT A;  4LFA Q;  4IO9 A;  3I56 A;  1L1O B;  4JG2 A;  4OO1 I;  4K6D A;  3L2P A;  1H9J A;  2TMP A;  2QDB A;  3F2C A;  1UE5 A;  2QIL A;  2XNA C;  5D14 A;  1KAA A;  2HIV A;  3BVZ A;  5EAY A;  4LWC A;  1HCZ A;  3LGJ A;  3PO3 G;  2H4O A;  5JPN C;  3PQI A;  2NVQ H;  1JT8 A;  1HZC A;  2RDH A;  1XMQ L;  1C7Y A;  3S17 B;  3CCS A;  1VQ6 A;  2EYJ A;  3C1F A;  4B9X A;  2A8V A;  1EY7 A;  1OTC A;  1VQ8 A;  2AUJ D;  1QG7 A;  2JYO A;  3MXU A;  2E2H B;  2F0J A;  2F0H A;  5BN4 A;  4AYB B;  3S2H H;  3S14 H;  4POG A;  4TVA B;  1CA6 A;  4ZK9 B;  1SNC A;  3GTP B;  2QW7 A;  2NN6 I;  3QWN A;  1K83 H;  2OTJ A;  2AMC B;  1VQ7 A;  2RKS A;  2MGS A;  4R8N A;  1BDO A;  1Q8K A;  5JAV A;  1K3R A;  2ZTE A;  3S15 H;  5C4X B;  4NXN Q;  2A19 A;  3M3Y B;  1SAP A;  3T53 B;  1UE1 A;  4A3F B;  2JA8 H;  4FNF A;  1X3G A;  1LTB D;  1PRT D;  1H9M A;  3FKI B;  4BY1 H;  1KNE A;  2F0P A;  1PMR A;  3HZX A;  3J81 L;  3DWA A;  1JE5 A;  1U4R A;  3B6Y A;  1N33 Q;  3J81 c;  1TWH H;  4OWX B;  3D31 A;  3HP3 A;  3D8G A;  1IBK Q;  1A62 A;  4BXX G;  2KUM A;  2WP8 J;  2RQX A;  1N36 L;  2GVA A;  2E2J H;  1PH6 A;  2AWO A;  5CV6 A;  4DV1 Q;  3HG9 A;  4YHH Q;  1KIX A;  4H02 A;  3DM3 A;  1V1P B;  5I6Y A;  3S1R H;  1VQL A;  3VA5 A;  3MXP A;  5M5X B;  1G51 A;  1X3F A;  1Q86 C;  1EZ6 A;  2K5W A;  1IXR A;  4B3R Q;  3W1G A;  1QUQ B;  4IUQ A;  4DKA C;  1WD1 A;  4A3D H;  4YWM A;  1KLG D;  2J0T D;  1KLU D;  4FF1 A;  2EXZ A;  5J3B A;  1JWS D;  4HSP A;  3PV0 A;  4GN3 B;  3S2D H;  3J7Y W;  1B3A A;  4X65 L;  2M00 A;  1HR0 L;  3I70 A;  4JOI C;  4ZYS A;  3I4N B;  4PQX A;  1LTL A;  2ZT9 C;  5J22 A;  3I4N G;  3VR3 A;  3SR1 A;  3UDX A;  4ME3 A;  4BA1 I;  1HNW L;  1XNQ Q;  4IN3 A;  1PXU A;  2DJF C;  1ILP A;  5DM7 3;  3U58 A;  4X3K A;  3K0X A;  2VNU D;  5JPM C;  1SYC A;  2K28 A;  3F2B A;  1SMX A;  3ZJY C;  3M7N A;  1PFB A;  1Y8O B;  2NVY B;  1KD1 C;  4GOP B;  2C35 B;  1DOL A;  1PH3 A;  1UEB A;  3E0J A;  3S1Q H;  4J15 A;  2JA6 G;  2Z4H A;  4P71 A;  4DV7 L;  5IP7 G;  1HA6 A;  1O7L A;  2X69 A;  4H0L C;  1WTQ A;  1E1O A;  3WDN A;  3RLF A;  4ULL A;  1B1Z A;  1S5D D;  2C9O A;  2OTL A;  5FO9 B;  1R9T B;  1SLJ A;  3MWY W;  3PUY A;  4LF4 Q;  1HH2 P;  1F9P A;  1Y1W G;  5CV5 A;  1SNP A;  1JC7 A;  2K7V A;  3NE5 B;  4IUR A;  4DAY B;  4HJ8 A;  1CM9 A;  3OOC A;  4KK7 A;  5KNC A;  3C3L A;  4JVZ A;  4X62 Q;  1VQF A;  3STB C;  2K52 A;  3TZD A;  1R4Q B;  2WII B;  5HY6 A;  1HUM A;  2SNS A;  1YIJ A;  4JI8 Q;  3LX0 A;  5C3E G;  2IX0 A;  1W3S A;  2Z6B A;  5ELC A;  2E2H H;  5LL6 S;  1UE6 A;  2WKD A;  3TRZ A;  3PSI A;  2MO0 A;  1ESR A;  2PCF B;  1GUT A;  2Z8L A;  3CQZ B;  4JV5 L;  1LTA D;  1EYG A;  2ZXP A;  2PW7 A;  3Q24 A;  4KHP L;  2F0U A;  4FYD A;  4J8Q A;  3ULJ A;  2DGY A;  4K14 A;  2NTS A;  1CK1 A;  3HS0 C;  1VQ9 A;  3H6M A;  1QCB D;  3KLS X;  3CC2 A;  3ERS X;  1U5K A;  1SYG A;  3VR6 A;  4AYB G;  1T5X D;  3A8J E;  3FRP B;  2YTV A;  1DON A;  1NJI C;  1GUO A;  5C3W A;  4GZY C;  1LT6 D;  4HCS A;  1GKH A;  4WJ3 M;  4KD3 A;  1ZYR D;  2N78 A;  4IUT A;  3UE1 A;  4I65 A;  4V19 0;  2KED A;  2ZJQ A;  2Q2H A;  2UUB Q;  5M3F G;  3NWT A;  5EGT A;  1WTV A;  1IL2 A;  1YHB A;  1PZK D;  2IT1 A;  2Q8T A;  5KNB A;  4DA2 A;  2RDG A;  2HDL A;  1TWF H;  1JWM D;  4L5T A;  2F0I A;  4XQJ A;  5C4H A;  3F1Z A;  4XT1 B;  3TQY A;  1EQR A;  3KLS A;  1E2V A;  3RD4 A;  1LV9 A;  2KQ3 A;  4DV3 L;  2PQA B;  5M3M H;  2Y0S G;  4RGM A;  3FPU B;  2LFN A;  3ONA B;  4A93 B;  1M1K C;  2I5H A;  2MHV A;  2JSO A;  2D2C C;  3KBX A;  5CV7 A;  1MJC A;  1VF7 A;  4DK0 A;  3JAM E;  2CH4 W;  1W2B A;  1N32 L;  2R3Z A;  1IBM L;  3HKZ B;  1M90 C;  1WTR A;  5IWA Q;  1R4P B;  1QOH A;  3CW2 C;  5IP7 H;  3OIP A;  3K5N A;  2SEB D;  1ILQ A;  2ASB A;  3S15 B;  2NYZ D;  4PV1 C;  4A3M H;  5EKL A;  1YNX A;  1RD9 D;  3RLN A;  4LF7 L;  1TWG H;  1V43 A;  3ULP A;  1Y1V H;  3I4M B;  4R4O A;  1EIF A;  3H0G G;  4RGN A;  1GUS A;  4HMJ A;  1C48 A;  1VQB A;  4O42 A;  4MIU A;  4CKB A;  3BZK A;  3NBH B;  1PTO H;  1I4H A;  2UXB Q;  4OEL B;  4K6L A;  2MUY A;  3OW2 A;  1PFM A;  2HQL A;  1JB7 A;  2A1A A;  3MXG A;  3PIP A;  1CKO A;  4A3B B;  3W3A A;  4DNI A;  3GTL B;  1EWH A;  1IKL A;  3KF6 A;  3E0E A;  1ASZ A;  2DUD A;  2AWN A;  5DAU A;  2JA7 G;  1UEA B;  5GAG C;  2NN6 H;  4QB4 A;  2PZT A;  4JI1 L;  2VQF Q;  2NVX H;  3E5S A;  1VQJ A;  4JBJ A;  3NXW A;  4KY6 A;  2CCZ A;  5CBA E;  2HHH L;  2UUC L;  4POF A;  1BCP F;  5C0X I;  1CKN A;  2JEB I;  3PIO A;  4DR5 Q;  1PRT F;  1V9P A;  4BBR B;  2EY2 A;  4APV A;  3KYH C;  3SHL A;  1TWC H;  1FJG L;  2IX1 A;  4EQ5 A;  1QZG A;  4N8F A;  3HOZ G;  3CPF A;  4IAL A;  3S1Q B;  4DV6 Q;  1K0S A;  1HHV A;  1F2Z A;  3FEW X;  3V2T A;  5IOC A;  3P7J A;  5CR3 A;  5IY0 A;  1WYD A;  3DEO A;  3PO2 B;  1ENA A;  3MXN B;  5I4D A;  3A54 A;  2B2W A;  1Q81 C;  2B29 A;  1P16 A;  4L8J A;  3NSW A;  5FK9 C;  4KHV A;  4DAY A;  4B3M L;  5KND A;  5BR8 Q;  4A3B G;  5E3F A;  3HOV B;  2E5L L;  4O1N A;  2RCN A;  3ITP A;  3D4D A;  1M4V A;  2NVX B;  3S24 A;  4QUF A;  1MSG A;  3PUX A;  1EFW A;  4OO1 G;  3DXJ C;  2YYZ A;  2CKZ B;  1EY8 A;  3GTG H;  2VB3 X;  2CWA A;  5ELO A;  3A74 A;  2J4X A;  4MZ9 A;  1VCI A;  4A3J G;  1J5E L;  2JA5 G;  2DNE A;  3K80 C;  1LLR D;  1SYD A;  4RCO A;  4A3G G;  5C3X A;  3VYU A;  4X3S A;  1VQH A;  4QF4 A;  5IGC A;  1ZYR C;  5M9O A;  2CW0 C;  2NTT A;  1BXT A;  2EZV A;  1TR5 A;  4UAI A;  1FL0 A;  4RHS A;  4LF5 Q;  1GHJ A;  4Y7N B;  4DNR B;  4A3D G;  3R8B A;  3J7A 5;  3GP7 A;  1N9W A;  3IAY A;  3HOU H;  3K7A B;  3MEF A;  1JQY D;  5IP9 G;  5I9P A;  4IFD G;  1SYB A;  4X65 Q;  3K0Y A;  2HIX A;  2XN9 C;  4Q5V A;  2KA7 A;  3K81 C;  3FHW A;  3HOX H;  1PRT C;  1B4O A;  3TRE A;  4ID6 A;  4OXP A;  5K36 G;  1Y14 B;  3CC4 A;  1X3Q A;  3K58 A;  2R92 G;  1SYE A;  1VMP A;  1FNW A;  1PFS A;  5C5L A;  4KHZ A;  5C0X G;  3S9W A;  2K5Q A;  2L15 A;  3H15 A;  2EYH A;  1Q90 A;  1PTO C;  2V4D A;  2WV6 D;  4A3I G;  3H3V H;  4AQY L;  5IGE A;  1K8A C;  3Q8D A;  3TP5 A;  1STB A;  4ODG A;  4PNY A;  1N34 L;  3J7Z C;  2IL8 A;  1SMY D;  4X64 L;  2D5D A;  1PA6 A;  1VDZ A;  1EOV A;  1YJ9 A;  1GUN A;  4A3E G;  3UDI A;  1TS4 A;  1DOM A;  2B63 B;  1BBW A;  1ZEQ X;  3J81 j;  2VZA A;  5IYC G;  1YNJ D;  3S1R B;  1IBM Q;  1Y8N B;  3X3M A;  3OMG A;  4YCW A;  4RA8 A;  2KEE A;  1EIG A;  3M4O H;  1D5Z C;  1EL0 A;  2B8F A;  2F0M A;  1HQM C;  1NTG A;  3M4Y A;  1Y1V B;  2WB1 G;  3I4M H;  3I4L A;  1NMG A;  1XTC D;  3HOZ H;  3FDT A;  4BY1 G;  3KLW A;  4DR4 Q;  1YZ6 A;  1YNJ C;  2RDF A;  4LF9 Q;  1LTT D;  4JV5 Q;  4GN5 A;  4BBR H;  1SJE D;  4HIK A;  4ZUI A;  4GNX A;  3WOF A;  2D62 A;  2R6G A;  4XYQ A;  1E22 A;  4PZ7 A;  2NN6 G;  1PHJ A;  1BCP B;  2K5H A;  2XGT A;  5ELD A;  1PFN A;  1TT2 A;  5D3I B;  2N88 A;  5G3L D;  4A3K G;  1JMC A;  4M8A A;  1GHK A;  1HTL D;  1OXS C;  4R4T A;  3RZO B;  2N55 A;  3K8A A;  1I6H B;  2MQH A;  3M4Q A;  5T1I A;  2CQO A;  3A7L A;  3MC0 B;  2CVR A;  1OXU A;  4G57 A;  1TXY A;  4K0K Q;  2NZH A;  1IYU A;  2YV5 A;  1E24 A;  4H7B A;  4A3K H;  4QUC A;  4MTN A;  1HNZ L;  3IKJ A;  3HOV H;  5LMN W;  4P74 A;  2AUK A;  4A3L H;  2F4V Q;  4RGT A;  3J7A V;  1F2Y A;  1DOK A;  3PO2 H;  4A3M G;  1WTP A;  2E2I B;  2MPM A;  1O7I A;  4FXD A;  5TSS A;  4FP5 D;  3I2Z A;  1A3T A;  4XT3 B;  3MA2 B;  4DV0 L;  1NY4 A;  3S16 H;  1QNK A;  4DV3 Q;  4FO2 A;  3U50 C;  4I7Z C;  1CZG A;  3UE0 A;  4JI5 L;  1WI5 A;  5HGT A;  4OWT B;  2L0C A;  2UU9 Q;  3I72 A;  1SYF A;  1TWA H;  3P75 A;  3TP8 A;  1QB5 D;  2Q2T A;  2WKC A;  1PYB A;  2MP1 A;  3D6C A;  3AYH B;  5EPK A;  4Q0F A;  4A93 H;  2ENB A;  2EJF C;  4DV2 Q;  1EEF D;  2JA5 B;  1SE3 A;  2ZJR A;  3AFQ A;  3M85 A;  3K5M A;  1EYD A;  3T4A C;  4BWG B;  5IYD H;  4OX9 L;  2WAQ E;  1XMQ Q;  3A8I E;  2F3I A;  4KJO A;  4JYA Q;  2QDL A;  4LF7 Q;  3GQB A;  4LF8 Q;  3GTK B;  1V1O A;  4NB3 A;  4XDX A;  3C2P A;  3HOV G;  4OEM B;  1I4R A;  4DV5 L;  2K5N A;  1CZW A;  1TWH B;  3GV3 A;  4YWL A;  1RL2 A;  4KKU A;  1EFI D;  2MFI A;  2QEJ C;  3CCQ A;  2NVT B;  2K14 A;  3AB9 A;  4YCV A;  4PMB A;  2CH4 A;  1BR9 A;  1E2W A;  3J80 L;  4A3G H;  3VR2 A;  2E2J B;  4RG1 A;  3A55 A;  4J6H A;  4DUY L;  1XX8 A;  4CJ1 B;  3ULL A;  5IT9 c;  2QA4 A;  1LT5 D;  3S17 H;  4XIG S;  3CCL A;  5FJ8 G;  4HMI A;  1Q8I A;  4L5R C;  3KF6 B;  3R2T A;  4JI1 Q;  4EGV A;  5IGG A;  1UE7 A;  4XQQ A;  3FKI G;  2ZM6 Q;  4TKO B;  1HR0 W;  2SOB A;  4JI4 L;  4BBR G;  2HHH Q;  4AIM A;  2IY5 B;  1Z6H A;  4DU9 A;  2A5H A;  4H13 C;  4RGO S;  4HSV A;  4LFB Q;  1BCP D;  5IGB A;  1DGS A;  3HFZ B;  1FGU A;  1SJH D;  5IP9 H;  4IFD J;  2LXJ A;  4N9T A;  2E2I H;  2KJX A;  1XNR L;  3N52 A;  1CKM A;  2R7D A;  3NTK A;  2BA0 A;  1HFN A;  3CD6 A;  4JI3 L;  2PI2 E;  3WOE A;  4LUV A;  3ER0 A;  3HOW G;  4DV1 L;  3VR5 A;  2Z9H A;  1SE8 A;  1C8C A;  3DMU A;  1STN A;  3SE0 A;  5DM6 3;  4JI7 Q;  2ICE C;  2VB2 X;  1PYS B;  2EJG C;  1YEZ A;  4DR6 Q;  2EYP A;  3H0G B;  3W2D A;  2F3W A;  2R93 B;  1RKN A;  2B2T A;  3HOY G;  2R92 B;  4JOI A;  3EJI A;  4F88 A;  2EQS A;  5KIX A;  2C5C A;  1Q12 A;  4G7H C;  1VF5 C;  4DR7 Q;  1B8A A;  1A0I A;  1JB3 A;  5C4J H;  1SFO B;  4DK3 C;  2LXK A;  2K4K A;  1U0L A;  2DNC A;  1JJG A;  3BZD B;  3K6O A;  3VYS A;  3X3N A;  3RN5 A;  1FNV A;  1V1P A;  4B3S L;  1HR0 Q;  5C5M A;  1TS5 A;  3M7G A;  2EIF A;  4U67 3;  5JOB A;  3DEP A;  1S5C D;  1WTW A;  4DR2 L;  1TS3 A;  2NWG A;  3E3X A;  4IJH A;  1U4L A;  2K75 A;  1HNX Q;  5CBE E;  4IUU A;  3G48 A;  4NW2 A;  3J7A F;  4KKS A;  1L2F A;  1LO5 D;  1MGS A;  3G4S A;  4A3J B;  1YVC A;  4YWK A;  4IPG A;  1OXT A;  3SK8 A;  4TRD A;  2OQ0 A;  4X66 L;  1LTG D;  2ES2 A;  1LT3 D;  1PZI D;  5IGF A;  5JEA J;  1L0Y B;  3I91 A;  1XMO L;  1ET6 A;  3MZ5 A;  1BQQ T;  1PZJ D;  3MFY A;  4PZ6 A;  2E76 C;  1H9S B;  5COR A;  3RLO A;  5M5Y H;  1Z47 A;  1WD0 A;  1KC8 C;  1ENF A;  4LF4 L;  4AH6 A;  4P72 A;  1F2M A;  5K36 H;  4H44 C;  1GD7 A;  1BUV T;  1VQE A;  2KHJ A;  3CAM A;  5LMN Q;  4QJF A;  4X64 Q;  3Q22 A;  1ZXT A;  1G6Z A;  3SK4 A;  3Q6S A;  4CKC A;  4E6I A;  1B53 A;  1TWA B;  3H91 A;  1IBL Q;  1KHI A;  1G8Z D;  1D6E C;  4BY7 B;  2PW5 A;  4C2M H;  1P8L A;  5ELN A;  1D2B A;  4G4K A;  4WRD A;  5KYI A;  2FXQ A;  3I4N H;  3OIQ A;  2MNA A;  1QZH A;  4RWS C;  2VUM B;  3D6W A;  2L5T A;  5C44 H;  3AEV A;  1E7Z A;  4DFA A;  3T1Y L;  2F0T A;  3FKI H;  2RSN A;  4KD4 A;  1I4G A;  4YHH L;  4ZQ3 A;  5EPL A;  4DN4 M;  1XTD A;  5C0X J;  2IPK D;  4R4C A;  3I8Z A;  5ELB A;  3M9B A;  3PGZ A;  1YI2 A;  4B3R L;  3OTO L;  1NAP A;  1J8I A;  1CHP D;  1HRJ A;  3BDL A;  4DV4 Q;  1I94 Q;  1Y1W H;  1ICF B;  2OT2 A;  2BA1 A;  2GN5 A;  2RSO A;  1NCV A;  5GAD C;  4LFA L;  4ZKB B;  2HD3 A;  2X6L A;  4OGQ C;  2KCC A;  2VXW A;  3PUV A;  3KJP A;  4X6A H;  1KRT A;  2CW0 D;  1YHA A;  2K50 A;  5AFW A;  1L1O A;  1A8V A;  3OWF A;  4DK1 A;  1CHQ D;  4A93 G;  4B3T Q;  5M5W H;  3D4R A;  1AP0 A;  1KXL A;  4WJW A;  2Y0S B;  3ERQ A;  2ALY B;  2F3V A;  1DD2 A;  2EXD A;  2IWH A;  1B70 B;  2ID0 A;  3KOJ A;  4GKK L;  2VW9 A;  3K59 A;  4A3K B;  1AZP A;  4IFD I;  1IYJ B;  4KY7 A;  3SVM A;  1EIH A;  1JCK B;  3QJY A;  1O78 A;  3A5Z B;  4B08 A;  5IOD A;  3D0F A;  4LF6 L;  1N32 Q;  1HZB A;  4GNX B;  3OHX C;  1QE6 A;  3NBI A;  3LNN A;  1GOZ A;  2R92 H;  4C3I G;  1HA5 A;  2A68 D;  3GTM H;  1W6K A;  2WFW A;  4ZKC B;  4WOR A;  3HKS A;  3NUC A;  1G29 1;  1GO3 E;  4U68 A;  2EYL A;  5JVH 3;  1Y1V G;  1L0W A;  4R4Q A;  4NP5 A;  3U4V A;  5FLM H;  4DV2 L;  3DUZ A;  3GO5 A;  1AW7 A;  1KDC A;  2WB1 B;  1FR3 A;  4QL5 A;  4F8M A;  2FJ2 A;  1NR2 A;  3CCR A;  2OWO A;  4LFC Q;  2HCI A;  2A68 C;  2B2U C;  3BVM A;  2RHS B;  4XXE A;  1I6V C;  4FXK C;  2UUA L;  2BH2 A;  2RBM A;  1MHW C;  1J6Q A;  4GLA C;  4FF4 A;  3TZU A;  4A3E B;  3PIP 3;  4DAP A;  1BO0 A;  4DR1 L;  4HCE A;  2K5D A;  5C3E B;  2V1C C;  4R1J A;  3A5U A;  2WIN B;  3GTJ B;  3AU7 A;  4DR5 L;  1C0A A;  2G5D A;  2HUG A;  4EX5 A;  1B9M A;  1PH9 A;  4C3I B;  4HED A;  3R3O A;  1NSN S;  3N6R A;  4A3F G;  5A2Q L;  1I4X A;  1VQ5 A;  5C6A A;  4DV6 L;  1VQD A;  1Q1E A;  1XPU A;  3CCV A;  3A0J A;  1YNN D;  3HOY H;  4KJN A;  3ICE A;  2E74 C;  4Y7N H;  3CP0 A;  1KL9 A;  3PMF A;  2KEC A;  2G9D A;  1VQA A;  1SR3 A;  2X6G A;  3L7Z C;  2F0F A;  3VYR A;  1OXV A;  4DK6 C;  1EOT A;  1TWC B;  4RCN A;  1BKB A;  4DUZ Q;  1V8Q A;  2P5Z X;  1AN8 A;  2F0Q A;  2PI2 A;  5CV9 A;  2UUB L;  3HRZ C;  3F2D A;  2BDO A;  3EVQ A;  4HJA A;  3U9S A;  1LTI D;  3HOW H;  1E1T A;  4NMZ A;  1UUP A;  2F0D A;  1VQG A;  4A3C H;  1AH9 A;  1E0B A;  2F4I A;  1HTP A;  4CGY B;  1Q1B A;  1IZ6 A;  3S14 B;  4A3D B;  1EY5 A;  3HOY B;  2TSS A;  3MVV A;  3KJO A;  4GS3 A;  3NTI A;  2IJ0 A;  4KLK A;  3H94 A;  3RZO H;  1EQT A;  2A69 D;  3FPP A;  2LKV A;  3MHB A;  4UY8 C;  2OF1 A;  4G7O C;  1TVX A;  4F87 A;  5JEA G; 
#chains in the Genus database with same CATH homology
 4A3K H;  4MTN A;  1KIX A;  4H02 A;  1HNZ L;  2H5X A;  3HOV H;  3DM3 A;  5LMN W;  4P74 A;  3S1R H;  1VQL A;  4JI0 L;  4YY3 Q;  4A3L H;  1SFO H;  4B3S Q;  2F4V Q;  1G51 A;  1X3F A;  1Q86 C;  1D8L A;  2JK8 A;  4NPS A;  3PO2 H;  1IXR A;  4MNO A;  1HZA A;  4A3M G;  4B3R Q;  1O7I A;  3W1G A;  1VQO A;  3HOX G;  1QUQ B;  3I2Z A;  4DKA C;  2I5M X;  4DV0 L;  4A3D H;  1NY4 A;  2XTI A;  4YWM A;  3S16 H;  3GTJ H;  4DV3 Q;  3H0G H;  3CCE A;  5LMN L;  5J3B A;  3U50 C;  4BBS H;  2RHQ B;  4HIM A;  3KDF B;  3PV0 A;  4JI5 L;  1WI5 A;  4GN3 B;  3UE0 A;  3S2D H;  1S72 A;  4OWT B;  4AYB E;  1YJN A;  2UU9 Q;  3AQQ A;  1TWA H;  4X65 L;  1IBL L;  2E8G A;  1HR0 L;  2Q2T A;  4PZ8 A;  3VDY A;  1PYB A;  1EWI A;  4HJ9 A;  4JOI C;  4AQY Q;  4NXM L;  3GTL H;  4X66 Q;  1LTL A;  3EBE A;  4JI6 Q;  3I4M G;  3I4N G;  1YJW A;  2N49 A;  1KQS A;  3UDX A;  3AYH B;  4ME3 A;  4BA1 I;  1J5E Q;  4A93 H;  1HNW L;  1N8R C;  1XNQ Q;  2VQE Q;  4DR4 L;  5C44 G;  4DV2 Q;  3U58 A;  2ZJR A;  3AFQ A;  3M85 A;  2PQA A;  3PF5 A;  1QVC A;  3K0X A;  5M3M G;  5AJ3 Q;  4LF9 L;  2VNU D;  3F2B A;  1SMX A;  5IYD H;  3ZJY C;  4OX9 L;  2WAQ E;  1GM5 A;  1XMQ Q;  3M7N A;  2F3I A;  2OQK A;  4UP8 A;  4GOP C;  4LF8 Q;  4LF7 Q;  3HOU G;  4BA2 I;  4JYA Q;  1KD1 C;  1SRU A;  3HKZ G;  4NB3 A;  4DR7 L;  1X65 A;  3HOV G;  1VQN A;  4DV5 L;  4GOP B;  2C35 B;  2K5N A;  4GKJ L;  2R7Z G;  5C4X G;  1PH3 A;  4YWL A;  1RL2 A;  1UEB A;  3S1Q H;  4J15 A;  2JA6 G;  2MFI A;  3CCQ A;  4P71 A;  3L0O A;  3F8T A;  2Z0S A;  4JI2 Q;  2K14 A;  4DV7 L;  5IP7 G;  2I5L X;  1K73 C;  4YCV A;  3TEH B;  1IBK L;  3RZD H;  4A3G H;  3BU2 A;  1HJP A;  4RG1 A;  1E1O A;  3OTO Q;  1PH2 A;  5GRO A;  3RLF A;  4DUY L;  2OTL A;  3KFU A;  1FVI A;  1ASY A;  3ULL A;  5IT9 c;  2QA4 A;  1SLJ A;  3UDF A;  4DAM A;  5IYB H;  3S17 H;  3PUY A;  4XIG S;  3CCL A;  5FJ8 G;  4A3E H;  2HT1 A;  4IOA A;  1HNZ Q;  4LF4 Q;  1HH2 P;  4L5R C;  1Y1W G;  3KF6 B;  4L5S A;  4JI1 Q;  4QGU A;  1UE7 A;  3FKI G;  2ZM6 Q;  1HR0 W;  4JI4 L;  4DAY B;  4HJ8 A;  4BBR G;  2HHH Q;  2WB1 E;  2NVY H;  4X62 Q;  1VQF A;  1RIP A;  3STB C;  4AIM A;  1I6H H;  5HGQ A;  2IY5 B;  2K52 A;  2ZJP A;  4LFB Q;  4PMW A;  5HY6 A;  4HJ5 A;  1DGS A;  1LYL A;  3HFZ B;  1YIJ A;  1FGU A;  4JI8 Q;  3CPW A;  5IP9 H;  4IFD J;  4Y52 H;  5C3E G;  2UXC Q;  2IX0 A;  2LXJ A;  1W3S A;  2E2I H;  2WAQ G;  2E2H H;  1UE6 A;  3EN2 A;  1XNR L;  1CKM A;  2R7D A;  4JCV E;  3TRZ A;  2BA0 A;  3STB D;  3CD6 A;  3PSI A;  4JI3 L;  2MO0 A;  2PI2 E;  2CFM A;  5IE8 A;  4HIO A;  4LUV A;  1EYG A;  4JV5 L;  1QVG A;  3ER0 A;  4IPH A;  3HOW G;  4DV1 L;  3M3Y H;  4KHP L;  1SE8 A;  4JI7 Q;  1NMF A;  3ULJ A;  2DGY A;  3K7A H;  3K7U C;  1PYS B;  1YEZ A;  4DR6 Q;  3RNU A;  2I0Q A;  4TQU S;  1VQ9 A;  1WJJ A;  4QIW E;  4YY3 L;  3CC2 A;  1S40 A;  3ERS X;  1EQQ A;  1K8G A;  1U5K A;  3PF4 A;  3HOY G;  3NEN A;  4JOI A;  4AYB G;  3T1H L;  1N33 L;  4OX9 Q;  2UXD Q;  2EQS A;  2YTV A;  2BH8 A;  5IYB G;  1CSQ A;  1SN8 A;  4LF8 L;  1Q12 A;  1NJI C;  4DR7 Q;  1B8A A;  1A0I A;  1VQI A;  3J80 i;  4A3J H;  5C4J H;  4DK3 C;  1R9T H;  2LXK A;  4DV5 Q;  2K4K A;  4WJ3 M;  1GKH A;  1U0L A;  2Q2U A;  3EIV A;  3UE1 A;  2N78 A;  1JJG A;  1Z9F A;  3RN5 A;  2ZJQ A;  2Q2H A;  2UUB Q;  2KHI A;  1BVS A;  5M3F G;  1PH4 A;  4DR3 L;  2JA8 G;  1BBU A;  1IL2 A;  1YHB A;  3DLL A;  2IT1 A;  4B3S L;  2JEA I;  1HR0 Q;  1G6P A;  2PNH A;  2VQF L;  2Y0S E;  4C3J H;  1TWF H;  2EIF A;  5M5X H;  1VQM A;  4NXM Q;  1AE2 A;  4L5T A;  3E9H A;  4LF6 Q;  3GTP H;  1I3Q H;  4JI6 L;  3HKZ E;  2N3S A;  1PH8 A;  3GTK H;  4DR2 L;  1T9H A;  1Q46 A;  3F1Z A;  3TQY A;  1EQR A;  1YHQ A;  4HJ7 A;  3S1N H;  1S3O A;  4IJH A;  4IPD A;  4FDB A;  2K75 A;  1HNX Q;  4DV3 L;  1FJG Q;  3G48 A;  1N34 Q;  2PQA B;  3PUZ A;  2ZM6 L;  1Q7Y C;  5M3M H;  1L2F A;  1Q82 C;  2Y0S G;  1PH5 A;  4X62 L;  3G4S A;  4JYA L;  1PVO A;  1YVC A;  5FLX c;  4YWK A;  2I5H A;  4IPG A;  1OXT A;  1M1K C;  3W1B A;  2KCM A;  1N36 Q;  3I7F A;  4XTC S;  4K0K L;  1MJC A;  2OQ0 A;  4X66 L;  3TS0 A;  1W2B A;  1N32 L;  1IBM L;  2ES2 A;  1M90 C;  4OON A;  5JEA J;  1LM0 A;  5IWA Q;  1XMO L;  2AHO B;  3CW2 C;  5IP7 H;  4JI3 Q;  4A76 A;  1QUQ A;  4B3M Q;  5BR8 L;  3RN2 A;  1XJV A;  4DUY Q;  4PZ6 A;  4A3C G;  3RLO A;  5M5Y H;  1XPR A;  1Z47 A;  4IJL A;  4QY7 A;  2E5L Q;  2ASB A;  4A3M H;  2UUA Q;  1YNX A;  1KC8 C;  4DPG A;  4LF4 L;  3RLN A;  4LF7 L;  4A75 A;  2NZO A;  4DUZ L;  1TWG H;  1V43 A;  4AH6 A;  3ULP A;  5LMU Q;  4P72 A;  1Y1V H;  4LNQ A;  1GD7 A;  4JC0 A;  4R4O A;  4B3T L;  4GKJ Q;  1VQE A;  3CAM A;  2KHJ A;  1EIF A;  4PG3 A;  5LMN Q;  1MJE A;  3GTO H;  3H3V I;  1MKH A;  5JJK A;  3H0G G;  1KAW A;  4QJF A;  1VQC A;  4X64 Q;  3G6E A;  1X54 A;  1VQB A;  2JA6 H;  3W5O A;  3BZK A;  2Z6K C;  3NBH B;  4LFB L;  1B7Y B;  2NVT H;  4OWW B;  1IBL Q;  1KHI A;  4LF5 L;  4GKK Q;  2UXB Q;  4GN4 B;  4JBW A;  2UXC L;  3OW2 A;  2HQL A;  1JB7 A;  2A1A A;  4C2M H;  1CSP A;  2B63 H;  1P8L A;  5ELN A;  4BY7 H;  1CUK A;  1CKO A;  1UWV A;  3PIP A;  1X9N A;  1HNW Q;  4IPC A;  4DNI A;  2FXQ A;  3I4N H;  4GLX A;  2MO1 A;  3KF6 A;  2MNA A;  3E0E A;  1QZH A;  2DUD A;  2AWN A;  1ASZ A;  1XNQ L;  2JA7 G;  3TS2 A;  5GAG C;  4JI1 L;  2VQF Q;  2NVX H;  2QGQ A;  3NEL A;  5C44 H;  3CF5 A;  1E7Z A;  3AEV A;  1VQJ A;  3AFP A;  4JBJ A;  3T1Y L;  2D0O A;  2CCZ A;  3FKI H;  2HHH L;  2UUC L;  4POF A;  5C0X I;  1CKN A;  2JEB I;  3PIO A;  4DR5 Q;  1GVP A;  3J81 i;  1V9P A;  4UP7 A;  1QVF A;  4RMF A;  4APV A;  1VQ4 A;  3KYH C;  4YHH L;  1TWC H;  1HNX L;  4JBK A;  1FJG L;  2IX1 A;  4EQ5 A;  4JI8 L;  1QZG A;  3HOZ G;  1XTD A;  3CPF A;  3CQZ H;  5C0X J;  4BXX H;  5H1S E;  1X3E A;  4HID A;  4DV6 Q;  5FLM G;  4JI0 Q;  1PH7 A;  4R4C A;  1JJC B;  2F4V L;  3PO2 G;  2PMZ E;  1HZ9 A;  3CXC A;  3CCJ A;  1JJ2 A;  3M9B A;  3PGZ A;  1YI2 A;  5IY0 A;  1WYD A;  3CME A;  4B3R L;  3OTO L;  4A4I A;  4LFC L;  2YTX A;  3CCU A;  2VS1 A;  4JBM A;  3MXN B;  3GD7 A;  3SGI A;  3FP9 A;  3I55 A;  2JJQ A;  4DV4 Q;  1Y1W H;  1I94 Q;  1I50 H;  2BA1 A;  2GN5 A;  4A3I H;  1Q81 C;  1XMO Q;  2B29 A;  1P16 A;  5FJ8 H;  4DR3 Q;  1NBW A;  3OYY A;  5GAD C;  4LFA L;  5GAH C;  4B3M L;  5BR8 Q;  4KI0 A;  4WJ4 A;  2AKW B;  2R7F A;  4A3B G;  2ZTD A;  3S1M H;  4DR1 Q;  2E5L L;  5GAE C;  2RCN A;  2UU9 L;  3T1H Q;  1PV4 A;  3PUV A;  3U4Z A;  3KJP A;  2R7Z H;  4BBS G;  1KRT A;  2VUM G;  2UXD L;  4X6A H;  3S24 A;  1YHA A;  2K50 A;  4NXN L;  1L1O A;  1A8V A;  1VS0 A;  3PUX A;  4DR2 Q;  1EFW A;  4BY7 G;  4OO1 G;  1OXX K;  2YYZ A;  2CKZ B;  3GTG H;  1SRO A;  2CWA A;  5ELO A;  1K0R A;  1I5F A;  3A74 A;  4L5Q A;  4A93 G;  4B3T Q;  5M5W H;  4MZ9 A;  2JA7 H;  1VCI A;  4A3J G;  1KXL A;  1J5E L;  2JA5 G;  4A3G G;  3K80 C;  4A3B H;  5IYC H;  1VQH A;  2ZTC A;  2ALY B;  1YIT A;  1XNR Q;  4P73 A;  4QQB X;  2EXD A;  2D0P A;  1B70 B;  1X6O A;  5IYD G;  3GTQ H;  2K5V A;  4R4I A;  2ID0 A;  1FL0 A;  1WCM G;  3KOJ A;  2QEX A;  5E7N A;  4C3I H;  2VW9 A;  4YCU A;  4LF5 Q;  2VL6 A;  4IFD I;  3J80 c;  4GKK L;  2R93 H;  1IYJ B;  4A3D G;  4KHP Q;  3JAM i;  3A5Z B;  2JA9 A;  2Z6K A;  2JA5 H;  3D0F A;  3CMA A;  4LF6 L;  3J7A 5;  1N32 Q;  1L1O C;  1K9M C;  1HZB A;  1LUZ A;  2JE6 I;  2B63 G;  2LSS A;  3PO3 H;  4A3F H;  4GNX B;  1N9W A;  2YTY A;  2KBN A;  3HOU H;  4C3H H;  3KF8 B;  1CKN B;  4LUZ A;  3MEF A;  1EUJ A;  3IRB A;  4JI2 L;  1WCM H;  4GLV B;  3T1Y Q;  2IHF A;  2R92 H;  2B3G A;  4LW1 A;  5IP9 G;  3GTM H;  2UUC Q;  1X55 A;  1VQK A;  4IFD G;  4X65 Q;  2WFW A;  2ATW A;  4UP9 A;  5DLQ E;  2HIX A;  3G71 A;  2RF4 A;  3GDE A;  4UPA A;  3WWV A;  5C3E H;  3HKS A;  1V1Q A;  2YU9 H;  3K81 C;  3FHW A;  2N8N A;  3HOX H;  1G29 1;  1GO3 E;  3M4P A;  3TRE A;  4OXP A;  4P75 A;  1Y1V G;  3RR5 A;  5K36 G;  1Y14 B;  1L0W A;  3CC4 A;  1PH1 A;  2R92 G;  2VQE L;  3I4O A;  4R4Q A;  3U4V A;  5FLM H;  4DV2 L;  3GO5 A;  5IWA L;  2VUM H;  3CC7 A;  5AJ3 L;  1E3P A;  1XPO A;  2OCE A;  4QL5 A;  5M3F H;  3KDF A;  4JI4 Q;  1NE3 A;  1PFS A;  3CCR A;  2OWO A;  4JI5 Q;  2F52 A;  4LFC Q;  4DV4 L;  2RHS B;  1A63 A;  4KHZ A;  5C0X G;  5JJI A;  4GNX C;  2JQO A;  1D7Q A;  2VY3 A;  2UUA L;  2BH2 A;  2L15 A;  5C4X H;  3H15 A;  1J6Q A;  4A3I G;  3BJU A;  3H3V H;  4GLA C;  4LFA Q;  4AQY L;  4O2D A;  3JC6 6;  5LMU L;  4IO9 A;  1K8A C;  3Q8D A;  1L1O B;  3I56 A;  4JG2 A;  4OO1 I;  3E9I A;  1VQP A;  3L2P A;  1N34 L;  3J7Z C;  4DR1 L;  5JJL A;  4X64 L;  3F2C A;  1UE5 A;  2V1C C;  4R1J A;  3A5U A;  1PA6 A;  2GVB A;  4DR5 L;  2HIV A;  5EAY A;  4EX5 A;  1EOV A;  1C0A A;  1PH9 A;  4LWC A;  3LGJ A;  1YJ9 A;  3PO3 G;  3PCO B;  4A3F G;  4LUO A;  4A3E G;  1X56 A;  4JI7 L;  2NVQ H;  1JT8 A;  1HZC A;  1KRS A;  3UDI A;  1XMQ L;  2KCT A;  1C7Y A;  3CCS A;  1VQ5 A;  4DR6 L;  1BBW A;  4DV0 Q;  1VQD A;  4DV6 L;  1Q1E A;  3J81 j;  1VQ6 A;  2VZA A;  1XPU A;  3CCV A;  3A0J A;  5IYC G;  2A8V A;  1OTC A;  1VQ8 A;  3HOY H;  3ICE A;  2Q2I A;  4Y7N H;  3CP0 A;  4YCW A;  1KL9 A;  3S2H H;  3S14 H;  4POG A;  4DV7 Q;  1VQA A;  1SR3 A;  3L7Z C;  4GOP A;  1I94 L;  3M4O H;  2R93 G;  4TVA B;  1OXV A;  4DK6 C;  3UDG A;  1YBY A;  1C9O A;  1NTG A;  1BKB A;  4DUZ Q;  2WB1 G;  3I4M H;  2PI2 A;  1NMG A;  2NN6 I;  1K83 H;  2UUB L;  2AMC B;  2OTJ A;  1VQ7 A;  3F2D A;  3HOZ H;  1Q8K A;  4BY1 G;  3KLW A;  4DR4 Q;  1K3R A;  1YZ6 A;  2ZTE A;  3S15 H;  2IHE A;  4NXN Q;  2A19 A;  4HJA A;  3JAM c;  4LF9 Q;  3HOW H;  3PUW A;  1E1T A;  1MIU A;  4GN5 A;  1UE1 A;  4ALP A;  4BBR H;  4JV5 Q;  4HIK A;  4GNX A;  2JA8 H;  2D62 A;  1VQG A;  3BZC A;  4IOC A;  2UXB L;  2R6G A;  1X3G A;  4A3C H;  1E22 A;  4PZ7 A;  1AH9 A;  2NN6 G;  5GQO A;  1PHJ A;  1EIY B;  1Q1B A;  2K5H A;  4BY1 H;  1H95 A;  2XGT A;  2CWP A;  1IZ6 A;  3CCM A;  3B6Y A;  1JE5 A;  4A3K G;  2KEN A;  1JMC A;  1N33 Q;  3J81 c;  1TWH H;  4OWX B;  1WOC A;  4R4T A;  1OXS C;  3D31 A;  4O0A A;  3KJO A;  3K8A A;  1IBK Q;  4A3L G;  4GS3 A;  2MQH A;  1A62 A;  3M4Q A;  3NEM A;  2CQO A;  1WFQ A;  4BXX G;  4KLK A;  1AE3 A;  1OXU A;  2WP8 J;  1N36 L;  3RZO H;  1TXY A;  2GVA A;  2E2J H;  4K0K Q;  1PH6 A;  2NZH A;  2AWO A;  4DV1 Q;  4UY8 C;  4YHH Q;  2YV5 A;  1E24 A;  1IBM Q;  5JEA G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...