1LUZA

Crystal structure of the k3l protein from vaccinia virus (wisconsin strain)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
FCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Protein K3
publication title X-ray crystal structure and functional analysis of vaccinia virus K3L reveals molecular determinants for PKR subversion and substrate recognition.
pubmed doi rcsb
source organism Vaccinia virus
total genus 18
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1luzA00
1W3SA 5IYCH 3GTQH 3CCSA 1IBLQ 1GO3E 4DUYL 4JI7Q 4A3KH 1WI5A 1YI2A 4BY1H 3M3YH 3F2DA 4DV4L 1KAWA 5IP9H 1XPRA 2GVBA 3M9BA 3HOUH 4OO1I 1VCIA 4GN5A 1N8RC 1N34Q 2R7DA 3HKZE 4QIWE 4UP7A 1PHJA 3HOZH 4BY7H 4GN4B 4K0KL 1OXXK 5C4XG 1K0RA 3AFPA 2K14A 3GTPH 4XTCS 4NXML 1D7QA 2JA7G 2Q2IA 4JI0L 4MNOA 1IBMQ 1VQGA 4FDBA 3CPFA 4JOIC 4DV5L 2VUMG 1ASZA 1NY4A 4DV7Q 2AWOA 4DV0Q 2XTIA 2ALYB 3L0OA 1NTGA 4LW1A 4DNIA 5GAEC 4AH6A 1VQIA 4JI5L 3PCOB 3G6EA 1XPUA 1C9OA 5EAYA 1PH2A 2B63G 5GROA 1WFQA 5C0XG 4A3IG 4YHHL 1B7YB 1N9WA 3J7ZC 1YHBA 3T1YQ 1JMCA 3I4MG 1VQJA 1X3FA 4LF4Q 1UE5A 3PIPA 3TEHB 3IRBA 3E9IA 2A8VA 1EIYB 5JJIA 4IPDA 2XGTA 4IPGA 4YWLA 5FLMG 1A62A 4X62Q 2CKZB 1IBLL 2OTJA 4JI7L 3GDEA 2AWNA 2HHHL 2BH8A 4LFCQ 3HFZB 1B70B 5FJ8H 3H0GG 1M90C 1S3OA 2JA9A 2V1CC 3PUVA 4NB3A 4DK3C 3I2ZA 1VQOA 1Q81C 1N34L 1KXLA 1RIPA 1V9PA 2LXJA 4A3EH 2NZOA 2Z6KA 4LFBL 2QGQA 3ICEA 1KRTA 4DR7Q 1B8AA 2N3SA 2WAQE 4C3HH 1IBML 2YV5A 1YEZA 1PH8A 2MFIA 3CCEA 4EQ5A 3HKSA 1CKMA 4R1JA 2R7ZG 4DV0L 1FVIA 5IWAQ 2JEBI 2L15A 3FKIG 2LSSA 4R4TA 4UP9A 2K52A 3A5UA 5C4XH 5LMUQ 4A3EG 1YZ6A 4O0AA 1QZHA 1TWHH 3STBC 4P71A 2JA7H 1HJPA 4X64Q 3PSIA 3KJPA 5GADC 4L5TA 2H5XA 1PA6A 4H02A 3BZKA 1EWIA 3T1YL 4JG2A 1YHAA 4P74A 4R4QA 4OWXB 5GAHC 2OTLA 4LF4L 3FP9A 1M1KC 1QVFA 1V1QA 2KCMA 2I5HA 3I56A 3CMAA 4DR2Q 3U4VA 1KD1C 3OYYA 3WWVA 2ZJRA 3TS2A 4X62L 2QEXA 1TWCH 1I5FA 4A3KG 2K75A 4LF7Q 2B63H 2E8GA 4LFCL 1YBYA 4GS3A 4A3IH 1OXUA 1QUQB 2VQEQ 3I4MH 3S24A 5JEAJ 5M3MG 4R4OA 1T9HA 2B3GA 4DUZQ 2WFWA 3L2PA 1WJJA 1XTDA 4JBJA 5J3BA 1PYBA 4OWTB 4LF8Q 3CAMA 3AFQA 4YY3Q 3S1RH 4NPSA 1VQBA 5FLMH 4DR7L 1G291 2JJQA 3ULJA 4A4IA 1HR0W 5GQOA 1YJWA 3H0GH 3KOJA 3ULPA 4LUZA 1YJNA 1YVCA 4HJ5A 4AQYQ 1PH3A 5LMUL 3S15H 4KHPQ 1Q82C 1PVOA 1CKNB 3G48A 2MO1A 4ME3A 4AYBE 4X64L 2AKWB 4OX9L 2R92H 1VQLA 2NVTH 3M4PA 1L1OB 3S17H 3F8TA 2VZAA 4L5RC 2HIVA 2N78A 4GOPB 2I0QA 2UUCQ 2R7ZH 1K3RA 3LGJA 3FKIH 1IZ6A 5JEAG 3A74A 4OXPA 3GD7A 4MTNA 1NMGA 1S40A 4JI6Q 4LF7L 1U0LA 4LUVA 4IPCA 3A0JA 3K7AH 1TXYA 1UE1A 2PI2A 2ZM6Q 1UWVA 4DR1Q 1XNRL 2VQEL 4QL5A 4WJ4A 2UUBQ 4JI3L 3M85A 4DV3Q 2F3IA 2DGYA 2Z0SA 4LF8L 2NN6I 2YYZA 2EXDA 3RN2A 1Q1BA 4YY3L 4LWCA 3J80i 4A3JG 1IXRA 3UDGA 1E7ZA 1VQFA 1LYLA 3BU2A 4GLXA 4LFAQ 4GLAC 1FJGL 2BA0A 4X6AH 1VQHA 5M3MH 4OO1G 1VQ8A 3B6YA 1EQRA 2AMCB 4LNQA 1EQQA 2PQAB 1W2BA 2YU9H 2JEAI 4AQYL 1WYDA 3RR5A 2D0PA 2UU9Q 4KHPL 3HOXG 3TRZA 4IPHA 1YITA 4A76A 4DV2Q 1PH7A 4A3CG 4GNXC 3RLNA 3CMEA 2BA1A 1HR0L 3KFUA 2CFMA 1KIXA 1G51A 1KL9A 3NENA 2QA4A 5M3FH 2CCZA 4P72A 3S2DH 1CKOA 1K9MC 2UUCL 1X3GA 3HKZG 3H15A 1G6PA 1PH5A 2KENA 1JT8A 3JAMc 1N36Q 1OXTA 2ZTDA 3VDYA 1K8GA 2K5HA 4JI6L 2N8NA 3KF8B 5DLQE 1Y1WG 1VQKA 2D62A 2ZM6L 4YWMA 4GLVB 4DR1L 2E2HH 2UXCQ 2GVAA 4LF6Q 2IHFA 2UUBL 1X55A 3UE1A 3AEVA 4GN3B 3PO2H 4DV3L 1L2FA 5HGQA 3CD6A 2FXQA 2C35B 4GNXB 4A3BG 4HJAA 2GN5A 4RG1A 3I4OA 2UXCL 3CCUA 2YTXA 1LM0A 3K81C 3BZCA 1N33Q 3M7NA 2F52A 2WB1E 1VQ5A 2UUAQ 2R93G 2D0OA 1XMOQ 1SR3A 1JJ2A 4JBMA 4NXNQ 4B3SQ 5AJ3Q 4IFDJ 5JJLA 4L5SA 3GTKH 1UE7A 1XNQQ 2RHQB 4JYAQ 3TS0A 3CCJA 3S14H 1MJCA 4A3JH 4HJ8A 3MEFA 2OCEA 5BR8Q 1LUZA 4X66Q 2R92G 4DR6Q 2KHIA 5H1SE 1EIFA 3TQYA 3PIOA 3CCLA 1RL2A 3S1QH 4JOIA 4YCVA 4DV7L 5K36G 1PV4A 4P75A 1EYGA 1SE8A 3I55A 1WOCA 3GTJH 3PO3G 4A75A 4A3MG 2PI2E 1A0IA 3NEMA 3HOXH 3DLLA 1N36L 3W5OA 4JI2Q 2ID0A 3UDFA 4BBSG 5GAGC 2WAQG 4A3CH 1HZBA 3BJUA 4POGA 3KF6B 3CC2A 3ER0A 4DR4Q 4C3JH 1CUKA 4DV6Q 4LF6L 3F1ZA 3UDXA 4A93G 1Q12A 1IBKQ 4Y52H 5C44G 1UE6A 2ATWA 3J81i 2RHSB 1K83H 4IFDG 1X3EA 2HQLA 2Y0SE 3G4SA 3KDFA 4DR5Q 1K73C 1TWGH 1N33L 1UEBA 3HOWG 1C7YA 1Y1WH 2UUAL 5FLXc 1XMOL 2F4VQ 4NXNL 4B3SL 4B3RQ 2VNUD 2K5NA 1Y1VG 3E9HA 1VQ6A 4IO9A 3PF4A 3NELA 3J7A5 4JYAL 1PH9A 1L1OC 3ULLA 5IYDG 4X65Q 4JCVE 2NZHA 2Q2UA 3RNUA 4A3BH 2K4KA 4JI1Q 4JI8Q 4GOPC 1Q86C 2UXBQ 5BR8L 4X66L 4DR6L 5IE8A 2KBNA 5M5YH 1AE2A 4A3LG 2R93H 1YIJA 2E5LQ 1HNXQ 5M3FG 4R4IA 1AE3A 4QQBX 3UE0A 3W1GA 3CCVA 1E22A 5IWAL 1CSQA 4GKJQ 2RCNA 2ZTCA 2YTYA 5IY0A 1ASYA 3CQZH 4HJ9A 4P73A 1VQPA 4JI2L 4PMWA 4HJ7A 4JBKA 3D31A 2PNHA 1BVSA 4DV6L 4DAYB 3E0EA 4JV5Q 5ELOA 2RF4A 1FGUA 1X54A 3W1BA 4IJHA 1IBKL 3PO2G 3S1MH 3CW2C 1XPOA 3PO3H 4A3MH 4DR2L 3H3VH 2R6GA 3U58A 2VS1A 4QGUA 1WCMG 4QJFA 2MO0A 3CPWA 2R7FA 4B3MQ 4PZ8A 5LMNQ 4PZ6A 1I94Q 4AYBG 1VQ7A 2NVQH 4BBSH 2A1AA 3J81j 2VQFQ 4MZ9A 2OQ0A 1VQ9A 1YNXA 2NVYH 3CP0A 1E3PA 4B3RL 3PUYA 1LTLA 4A93H 1TWFH 2OWOA 4A3GG 4DKAC 1CKNA 4DUZL 4HIDA 4APVA 2Q2HA 5C44H 4LF9Q 4X65L 1NE3A 1P16A 3L7ZC 1KC8C 1PH6A 1KRSA 5IP7G 4JI1L 4JI8L 2UXBL 4KHZA 4KI0A 1VQMA 3PV0A 3HOWH 3CF5A 4GOPA 1HZ9A 2IX1A 2E5LL 1HNXL 3UDIA 3M4QA 3F2CA 4ALPA 1Y1VH 1OXSC 1SN8A 3OTOQ 3CXCA 4B3TQ 1HNWQ 2JE6I 1VQ4A 4BA1I 4DAMA 4GKJL 3DM3A 5IYDH 3CC7A 3GTLH 1X56A 4DK6C 3PUZA 4A3LH 4JC0A 3CCRA 3KJOA 2CWPA 1KQSA 1AH9A 1HNZQ 4JV5L 1I6HH 1HZCA 4LF5Q 1JJGA 4DV1Q 1NMFA 3F2BA 2JA5G 1A8VA 3RN5A 2K50A 2HHHQ 3AYHB 1QVCA 2I5LX 4DR3Q 1SMXA 1C0AA 3CCQA 1GKHA 3T1HQ 4B3ML 1BBUA 5LMNL 1I94L 2DUDA 2VQFL 2PQAA 3OW2A 3EIVA 2E2IH 3KLWA 2Z6KC 3J80c 4LFBQ 1VQCA 3D0FA 3PUXA 1E24A 1SLJA 4LF9L 2IX0A 4C2MH 4WJ3M 4UY8C 1E1OA 1WCMH 1O7IA 1I50H 1X6OA 4IJLA 3S1NH 1X9NA 1J5EQ 1DGSA 2A19A 4LFAL 1N32Q 1SRUA 1HZAA 1Z47A 2JA8G 4B3TL 3FHWA 3OTOL 4A3GH 1HNWL 4BBRG 5HY6A 3GO5A 1SFOH 2UU9L 4R4CA 3HOVH 2VY3A 5C0XI 3A5ZB 2N49A 5IP7H 3EN2A 1EFWA 4A3DH 1D8LA 2LXKA 1XJVA 3PGZA 1JB7A 2I5MX 2WB1G 4DV2L 1OXVA 4J15A 1BBWA 1NBWA 3S16H 4GNXA 3PUWA 4TQUS 2ES2A 1HNZL 4PG3A 3HOYG 4LF5L 1EOVA 1X65A 4DV1L 4EX5A 4DR3L 2ASBA 3M4OH 1Z9FA 4YCWA 3T1HL 5M5XH 3PF5A 3K80C 2IT1A 5C4JH 4JI4Q 4UPAA 1Q7YC 3GTOH 2UXDQ 1K8AC 4GKKQ 2ZJQA 1Y14B 1L0WA 1PH1A 2VW9A 4OWWB 1R9TH 2MQHA 1YHQA 1J6QA 2EIFA 5IYBG 4DPGA 2JA5H 4HIKA 3K8AA 1VQEA 2HIXA 3EBEA 4UP8A 3RZDH 5C3EG 4BXXG 1V43A 2CWAA 3KDFB 1IL2A 1H95A 1VQAA 3GTGH 4PZ7A 1J5EL 1GM5A 4YWKA 4A3FG 1N32L 1U5KA 5AJ3L 1S72A 3STBD 3H3VI 2BH2A 3I4NG 1XNQL 5ELNA 1XMQQ 3RZOH 2ZJPA 2KCTA 1BKBA 2JA6G 1MKHA 4OX9Q 3MXNB 2E2JH 2Y0SG 3KF6A 2VUMH 4OONA 1Q46A 1Q8KA 4IOAA 1QZGA 3JC66 1MIUA 4XIGS 3RLFA 1PYSB 4JBWA 1GVPA 2JA8H 4IFDI 3ERSX 3K0XA 5IYCG 2HT1A 1PFSA 1FL0A 5IT9c 4BBRH 2IHEA 4BY1G 4AIMA 4HIOA 1QVGA 5E7NA 1XNRQ 3KYHC 5LMNW 1QUQA 5IP9G 4TVAB 2JK8A 4YCUA 4LUOA 3HOUG 4JI3Q 4JI4L 3HOZG 1JJCB 2CQOA 3J81c 3GTMH 4BY7G 2UXDL 4DR4L 3AQQA 4Y7NH 4GKKL 2AHOB 3HOYH 4HIMA 1Q1EA 2Q2TA 4DUYQ 3S2HH 1KHIA 4IOCA 4QY7A 1VQNA 4DV4Q 4DR5L 1GD7A 3I7FA 1FJGQ 3K7UC 2NVXH 1E1TA 1I3QH 1HH2P 2VL6A 1YJ9A 2F4VL 4O2DA 4K0KQ 1VS0A 2KHJA 1VQDA 2ZTEA 1XMQL 2K5VA 3CCMA 1CSPA 4NXMQ 2IY5B 1IYJB 4JI0Q 2NN6G 3SGIA 5IYBH 3HOVG 4A3DG 1L1OA 4DV5Q 1HR0Q 5C3EH 4BXXH 1JE5A 2PMZE 3ZJYC 1PH4A 1P8LA 4KLKA 3U4ZA 4A3FH 1EUJA 3TREA 3G71A 4JI5Q 3RLOA 1MJEA 3I4NH 1TWAH 3Q8DA 2EQSA 5JJKA 2YTVA 3U50C 2JA6H 1SROA 2B29A 2WP8J 3NBHB 1NJIC 4YHHQ 5FJ8G 3JAMi 3CC4A 2JQOA 2OQKA 1OTCA 4BA2I 4POFA 4RMFA 2MNAA 5C0XJ 5M5WH 1A63A 4C3IH 4L5QA
chains in the Genus database with same CATH superfamily
1W3SA 5IYCH 3HOUB 3FVQA 4JI7Q 4A3KH 1WI5A 5EJWA 4BY1H 3UI2A 4BY7B 3D6WA 4DV4L 1IL8A 5KIXA 3GTPB 3ITPA 3M9BA 4ABNA 4FXDA 3DHQA 1T5XD 1N34Q 1DOMA 4DK0A 4K0KL 1OXXK 2A68D 3I8ZA 4XTCS 4RA8A 1QILA 2EYJA 2MPMA 2Q2IA 4MTKA 4MNOA 3CPFA 4JOIC 1LTRD 4DV5L 1ASZA 1NY4A 4DV7Q 5DNFA 1VF5C 2XTIA 3TMEA 5ELDA 4ILWA 4AH6A 1EQTA 3PCOB 1WTVA 1G8ZD 3HP3A 1C9OA 3I73A 1HA5A 1ESFA 1WFQA 5GROA 5C0XG 4A3IG 1HFGA 3T1YQ 2A6HC 1X3FA 1NR4A 3IRBA 3NUCA 5JJIA 1IBLL 2CKZB 4QMGA 2RBMA 4A3JB 1Q90A 5COYA 1EEFD 2Z8LA 4J1MA 5M9OA 1CZWA 1RIPA 3TZDA 4WRDA 1QWYA 2Z6KA 3ICEA 4DR7Q 1KRTA 2WAQE 3MHBA 2CH4A 1B3AA 1K28A 5C4XB 2C9OA 1FR3A 1FVIA 2PNRC 2JEBI 4UP9A 4X64Q 4L5TA 1EWIA 1XXGA 2OT2A 1TWCB 1M1KC 2KCMA 3I56A 5CV6A 4DR2Q 3WOFA 4X3SA 2P5ZX 3BYYB 2ZJRA 2QEXA 4A3KG 1STEA 2NTSA 4KHVA 2VXWA 1QUQB 3S1RB 5M3MG 4R4OA 3IAYA 5KNDA 2B39A 2K33A 3CAMA 1GJXA 1AN8A 3H0GB 4YY3Q 4NPSA 2XIWA 1CQVA 1SNOA 2JJQA 3ULJA 5FO8B 1YJWA 1GUNA 3KOJA 1HA6A 3ULPA 2L0CA 2K5QA 5DEHA 3TP7A 4KHPQ 5LMUL 2NVTB 5ELEA 3FKIB 1JWUD 4L5RC 2VZAA 1EYAA 3SDZA 2HIVA 2N78A 4GOPB 1FYCA 4KV6A 4KJOA 4KKUA 1F9RA 2F0SA 4K5VA 3A0JA 3IFDA 1UE1A 1SNDA 2KEDA 4JI3L 2Z0SA 2DGYA 1KNEA 1I4QA 3UDGA 4L63B 3Q22A 3L3OC 5C3WA 2Z1CA 4OO1G 5E4XA 3DWPA 1EWHA 3RR5A 2F0GA 1Q8IA 1BXTA 3S2DB 3TRZA 1PRTB 2K6AA 1YITA 1K8MA 2B2VC 5TSSA 3CMEA 2BA1A 1BBXC 5HURA 4C3JG 1UAPA 1K9MC 1LLRD 1PMRA 3H15A 2KENA 2E76C 3HRZC 4H0LC 2ZTDA 2K7VA 5C6AA 2K5HA 1XYIA 3QB3A 5DLQE 4DFAA 1F2LA 4DR1L 2E2HH 2UXCQ 5CBEE 2IHFA 2UUBL 3R2TA 1CT1D 1L2FA 1BCPD 5E3FA 4B08A 4A3BG 2GN5A 4RG1A 5JEAH 1LM0A 2EYLA 2WB1E 1STYA 2AQ1B 4XYOA 4IFDJ 4NXNQ 3GTKH 5KNCA 1XNQQ 1TVXA 2ZXRA 2F0FA 2ICIA 5EPLA 1EY5A 3V05A 4A3JH 2OCEA 2KHIA 3GTJB 2F0QA 4ZKBB 4V190 2F4IA 3CCLA 1RL2A 4TRDA 2B2WC 1EYGA 2ZT9C 3Q24A 3NBIA 3VYRA 3PO3G 2FMCA 3H09A 1A0IA 3DLLA 1Y8OB 4BBSG 2WAQG 3LWEA 1EY0A 2XN9C 1EY4A 2ZXPA 1K83B 3D8GA 3F1ZA 4Y52H 1AEXA 5I9PA 3NK9A 2Y0SE 5LHY1 4DR5Q 1N33L 5D3DA 2EYHA 2G9HD 3Q0AA 2F4VQ 4KY7A 4B3SL 4K8IA 4KK7A 4LK1C 2K5NA 2VNUD 1VQ6A 1SMYD 1B4OA 2R93B 1LT6D 3ZYYX 1PH9A 2I07B 4JCVE 4JI1Q 4GOPC 1Q86C 2JN4A 5BR8L 1KNAA 2PQEA 1XTCD 4F8MA 1AE3A 3UE0A 4HMIA 4XT1B 1E22A 5JJZA 5IWAL 4GKJQ 3FEWX 2RCNA 2ZTCA 1ASYA 3CQZH 4HJ7A 4IUTA 4PNYA 5HGTA 3P1HA 3C1FA 2PNHA 1SYCA 4DV6L 4CJ0B 4DAYB 3W1BA 1X54A 3OIPA 1YNNC 3CW2C 4PMCA 1QCBD 4A3MH 1SE2A 1STHA 2VS1A 4B3MQ 4HTHA 4PZ8A 4PZ6A 1NR2A 4LJZC 2A1AA 3VR2A 1SYGA 2MHVA 1LO5D 2OQ0A 4MZ9A 3J81j 2NVYH 2VQFQ 3EVQA 1VQ9A 2IWHA 3PUYA 4LAAA 1PRTC 4HIDA 2Q2HA 5C44H 4LF9Q 1E2ZA 2IL8A 3EROA 1NE3A 3FDTA 4X65L 5CC4A 4R8IA 1PH6A 4JI8L 4CHTB 3QG1A 5I9OA 1VQMA 3HOWH 1R4QB 3SK4A 4ALPA 1S5DD 2Q8RE 3M4QA 1Y1VH 1OXSC 1SN8A 4B3TQ 2JE6I 5I6YA 1SNCA 2EJGC 4I65A 3GTLH 3NPPA 4DK6C 1PFMA 2DNCA 2L9HA 1F2YA 4UHVA 1M4VA 3TP6A 2TSSA 5A2QL 1PTOD 4DV1Q 4ZLTF 1ENFA 3F2BA 3RN5A 2I5LX 3T53B 1ZYRC 3T1HQ 3FPPA 5LMNL 2N55A 1TQOA 2PQAA 1MI2A 1X3QA 2Z6KC 2C5CA 2Z4IA 4ULLA 3S1NB 1ILQA 2QILA 1A15A 1QE6A 4UY8C 1WCMH 1X6OA 3HG9A 1N32Q 4BBRG 2B2YC 2O5JC 3S16B 2EDGA 4R4CA 2VY3A 1PTOH 5C0XI 3K5OA 5IP7H 2F0LA 3EN2A 3HOVH 4A3DH 1XJVA 1JB7A 1MGSA 1IKMA 2I5MX 2WB1G 3TP8A 4J15A 1BBWA 1B50A 3OSOA 4GNXA 3M4OB 2ES2A 4EQNA 1JOOA 3U9SA 3ND8A 3DEPA 2WACA 5M5XH 2IT1A 4JI4Q 4V0BA 5IT9E 3C46A 1K8AC 4GKKQ 2ZJQA 1Y14B 2VW9A 5CGKA 1O7ZA 3GTGB 1J6QA 2L5TA 2JA5H 4DPGA 4NDXA 3A56A 1KLGD 3RZDH 1H9SA 4BXXG 2B2TA 1V43A 2B2UA 5IGBA 1WTWA 1J5EL 4A3FG 2I46A 3H3VI 4RHSA 5ELNA 5IGDA 2RKSA 2ZJPA 3KLSA 2JA6G 2Y0SG 3KF6A 1ILPA 4Z9CB 1QNUA 1MIUA 4XIGS 1EFID 4JBWA 2GA4B 4IFDI 3K0XA 2HT1A 1BOSA 5IT9c 1A2TA 1FNWA 4AIMA 4HIOA 1QVGA 4HN7A 3KYHC 5LMNW 5EKKA 1TS2A 4TVAB 1O80A 4JI3Q 3HOZG 2CQOA 2BE5D 4L8JA 2AHOB 3NXWA 1S5ED 2Q2TA 1W6KA 1KHIA 1EU4A 4QUCA 1VQNA 3I7FA 1W6JA 3VR6A 4NMZA 3MEHA 2HD3A 2ZTEA 4PMBA 1CSPA 2IY5B 1IYJB 1EWCA 3JAML 4JI0Q 3HOVG 4A3DG 3I4NB 1L1OA 5C3EH 2PMZE 2JSOA 5C4ZA 4XQJA 4KLKA 2A6ED 2FJ2A 3HEJA 4JI5Q 5IGEA 5E1FA 2EQSA 5JJKA 1YNJD 4IZ8A 1OTCA 4Q0FA 1E2VA 4A3KB 1QJOA 4BY1B 2WV6D 4RMFA 1A63A 4C3IH 4A3EG 4KMUC 3CCSA 5CBAE 1GO3E 1NAPA 2HDLA 4DUYL 1YI2A 3M3YH 1EZ8A 1WTOA 1EY8A 5IP9H 2GVBA 4OO1I 1VCIA 4GN5A 3HKZE 4QB4A 2RA4A 5IGCA 2K14A 4NXML 4DAPA 2JA7G 5D14A 4FDBA 2KOLA 1L0YB 2RVLA 3QIAA 1MD2D 4DV0Q 2ALYB 4FF1A 1VQIA 1PXUA 2CQAA 1V8QA 1XPUA 4ZYSA 3FRPB 4KY6A 2B63G 1BDOA 1B7YB 1N9WA 1JMCA 1YHBA 3I4MG 1EOTA 4LF4Q 3PIPA 2EPBA 4RGTA 1F9QA 4IPDA 4ZCKA 4YWLA 1A62A 4X62Q 3E5SA 2A69D 1F9SA 1CQFA 3GDEA 2AWNA 4JVZA 2F0WA 2BH8A 4WJWA 4F7XA 4LFCQ 5FJ8H 1S3OA 2JA9A 2V1CC 3DWAA 4DK3C 3EQLC 1KXLA 1V9PA 3I72A 4LFBL 2QGQA 3K5LA 2N3SA 4C3HH 2NB0A 1IBML 2YV5A 2K1BA 1YEZA 4EQ5A 3HKSA 4RFBA 2R7ZG 4IURA 4K5XA 5IWAQ 2LSSA 4JK1C 3A5UA 4O0AA 1EEID 1TWHH 4P71A 4UDUC 3LX0A 3IFTA 1PA6A 4H02A 1SNQA 5T1GA 4R4QA 2OTLA 1QVFA 3P75A 1V1QA 3OHXC 3U4VA 1B44D 4KKTA 3TS2A 2MP1A 3R8BA 1I5FA 3I91A 2K75A 2IPKD 2K04A 5C0XH 4A3IH 4A3BB 1OXUA 3S24A 3TBIB 2B3GA 3J7YW 3MFYA 4JBJA 4OWTB 5ELCA 3AFQA 1G291 3C2PA 2PO4A 4A4IA 1SNPA 1KDBA 4CKCA 5LL6S 1D2BA 3MA2B 4DAVA 3I90A 4HJ5A 1H9JA 4AQYQ 2IJ0A 1U4PA 1CKNB 4ME3A 2O2LD 3EFXD 1L1OB 2F3WA 1DXMA 3M4PA 3S17H 2UUCQ 4ZAIA 3NTHA 1IZ6A 3T56B 3S9WA 1U9RA 2CW0C 4OXPA 1S40A 4LF7L 1LTBD 1I6VC 3K7AH 2ZM6Q 4RCOA 2VQEL 4QL5A 4O42A 4DK1A 1HUMA 3M85A 4DV3Q 4LF8L 1AP0A 1B53A 2L55A 1EQVA 2NN6I 3J80i 5C4HA 1SJHD 1E7ZA 2LS01 4C3HG 4GLXA 4JW0A 2PW5A 1D6EC 5T1IA 2BA0A 1SE3A 5M3MH 4X6AH 2K03A 1EQRA 1EQQA 2YU9H 2E74C 2J0TD 3NBHA 3HOXG 1ML0D 1HFNA 2D5DA 4IPHA 4A76A 1PH7A 4A3CG 4GNXC 2CFMA 1G51A 1KL9A 2LY7A 3NENA 2CCZA 1BF4A 3HKZG 3W2DA 1G6PA 1JT8A 2E2HB 2MJ8A 1D5ZC 3VDYA 4QF4A 1K8GA 4JI6L 2N8NA 3KF8B 4XDXA 1Y1WG 1VQKA 2K32A 1JCKB 1FGBD 4GLVB 2SNSA 4LF6Q 3UE1A 1AW7A 3CD6A 2K01A 4HJAA 2B2TC 2BDNA 1DOKA 3I4OA 3GTKB 3BZCA 2F52A 1VQ5A 2UUAQ 1GOZA 4B9XA 4L5SA 3M7GA 4R8NA 2RHQB 4CBVA 5FLXE 1HTLD 4HJ8A 3MEFA 4TKOB 4DR6Q 1JE4A 1SXTA 2NBFA 3PIOA 2XWBB 3S1QH 4RGOS 1DD2A 3J81L 5K36G 2B8GA 3NQIA 4OO1H 1SE8A 1SSOA 5CV7A 2FINB 2PI2E 1N36L 4JI2Q 3UDFA 4CGYB 4QIWB 1H9KA 1CK1A 3BJUA 3CC2A 3ER0A 4A93G 4C3JH 2Z9HA 3UDXA 5J39A 1Q12A 1IBKQ 1UE6A 1DONA 3K0YA 1GUGA 4IFDG 1X3EA 3G4SA 4N8FA 4ZUJA 1K73C 1TWGH 1C7YA 5FLXc 1XMOL 1B2TA 4B3RQ 4IO9A 4MIUA 5K5PA 3J7A5 4JYAL 1GUOA 3MXNA 3VYTA 1L1OC 5IYDG 4A3BH 4BA2I 2K4KA 4X66L 5IE8A 5M5YH 1E0BA 3GV3A 2E5LQ 1HNXQ 3CQZB 1Y8NB 4X3TA 4G7OC 1CSQA 4H13C 1KDAA 1PYWD 2KUMA 3GTMB 2YTYA 4HJ9A 1VQPA 1GUWA 3GV6A 1C4QA 4XQNA 4A3MB 3D31A 3SVMA 1JOKA 1BVSA 3PQIA 2RF4A 1FGUA 3DMUA 3ERQA 1XPOA 3PO3H 2NVYB 2R6GA 1RJTA 4QGUA 5EKIA 1BUVT 4BBSH 4YIJA 2KEEA 5C44B 4CKBA 3CP0A 1MSGA 3I70A 1TWFH 4A3GG 4DUZL 3HOWB 1TU2B 4APVA 5CMDA 2EY2A 5EPJA 5BN4A 1LTSD 2M2LA 1Y1VB 2UXBL 4KHZA 2VB3X 3J80E 3PV0A 1HZ9A 2IX1A 4RGMA 2Y0SB 3GTLB 1HNWQ 1CZGA 3LWUA 4DAMA 1MBYA 3SK5A 2EY1A 2HCIA 1X56A 1HRJA 3PUZA 3KBXA 4C56C 4QUFA 3K5NA 3CCRA 3KJOA 1KQSA 1HNZQ 4LMQD 4JV5L 1HZCA 4LF5Q 1A8VA 3K59A 1CFMA 4DR3Q 1C0AA 1A3VA 3CCQA 1I94L 1ICFB 3EIVA 3IL8A 4RKBA 1WCMB 3J80c 3DUZA 4LFBQ 1VQCA 3PUXA 5JVG3 4C2MH 3KLSX 4WJ3M 1K0SA 3NSWA 4G7ZC 1O7IA 1DGSA 3HOVB 1PTOB 1RODA 4A3DB 1I4PA 2JA8G 2E75C 1CHQD 1SNMA 3OTOL 2XRSD 1EYDA 3BZDB 1SFOH 2NN6H 2UU9L 3X3NA 3A5ZB 1EFWA 1G91A 2LXKA 3PGZA 1CA5A 1STNA 4DV2L 4JPBW 1NBWA 3PUWA 1V1PA 5M5XB 3HOYG 2QEJC 1EOVA 1X65A 3M4YA 1Z9FA 3PF5A 4N8X1 2OEOA 2JA5B 2IW3A 3RZDB 2RSNA 1EL0A 1PH1A 3BDLA 2MQHA 1YHQA 5IYBG 1WTHA 1Q3LA 2HIXA 4UP8A 2QKIC 1Y69U 1U5KA 3STBD 3SK8A 1SDFA 2BCOA 2DY7A 3RZOH 1SMYC 3MXNB 4RH6A 2VUMH 1EU3A 1GVPA 2KQ3A 2ENBA 1AZPA 1PFSA 4BBRH 1KDCA 2JK8A 4GZYC 3HOUG 5G3LF 3GTMH 4BY7G 2UXDL 5KYLA 3AMUA 4DR4L 1HTPA 3R2IA 4DV4Q 3NTKA 5IGGA 2NVXH 1E1TA 1J9OA 4K0KQ 1PZKD 5C5MA 5C3EB 1JQYD 1XMQL 3CCMA 2FHTA 2NN6G 4DV5Q 4BXXH 1EIGA 3ZJYC 5KRUA 4A3FH 3U4ZA 1D5XC 4ID6A 3TREA 2Z4HA 1MJEA 2YTVA 5J1ZA 2JA6H 4FO2A 2B29A 4C3IB 3CC4A 1HQMC 2XRQD 3M3YB 2MNAA 3CCUA 2ASBA 5M5WH 2OF1A 2FFKB 2TMPA 1IBLQ 1JWSD 2EYFA 1PTOC 1XPRA 2K28A 5A35A 3HOZH 3OMGA 5C4XG 1D1KA 3VR4A 3OPOA 1K0RA 3GP7A 4J8QA 4PQXA 1LTTD 1VQGA 2VUMG 1RF2D 1U4LA 3P20A 3L0OA 1NTGA 1SYEA 5GAEC 2PCFB 2RDFA 4HMJA 3E0JA 3G6EA 1WTQA 1H9MA 1CA6A 1G2TA 3CHBD 4UAIA 4YHHL 3J7ZC 1VQJA 3MZ5A 5NUCA 1U4MA 2A8VA 3D6CA 2AQ3B 2XGTA 4IPGA 1SJED 1TT2A 5FLMG 2PMZB 2OTJA 4JI7L 4PV1C 3G6JB 3HFZB 3H0GG 1M90C 4NB3A 4C3HB 1VQOA 1N34L 1LT3D 2LXJA 5JAVA 4A3EH 2F0UA 4C1NK 1ZEQX 2M9VA 1DZ1A 3NE5B 4HAEA 5IGFA 3CCEA 1TWHB 4KY5A 3OWFA 4R1JA 1O7YA 2L15A 3FKIG 1PV4A 1Z6HA 1CTMA 2K52A 5LMUQ 1YZ6A 1ZXTA 1HUNA 2JA7H 1HJPA 3L9AX 1QG7A 2H5XA 3BZKA 1GHJA 3T1YL 4JG2A 1YHAA 2WINB 4P74A 3BVMA 4OWXB 1GHKA 1FD7D 1IW7D 3FP9A 2KHSA 3CMAA 1B1ZA 4A3IB 1KABA 4RCNA 4L6TB 3OYYA 4CKEA 2BDOA 2L11A 2B63H 3DEOA 2F0MA 1YBYA 3RMHA 1NNXA 5JEAJ 3I4MH 1L0XB 2F0NA 4DUZQ 2EOTA 1WJJA 1XTDA 4ZRZA 2L12A 5CYUA 1VQBA 4DR7L 2F0PA 1B9MA 1HR0W 3NWTA 3TP5A 4XXEA 4LUZA 1YJNA 3QWNA 1PRTF 2X6GA 3S15H 1ZKOA 2BOSA 1TS3A 3S17B 1Q82C 4AYBE 4KN7C 4X64L 2R92H 2AKWB 4OX9L 5FK9C 3SE0A 3F8TA 2R7ZH 1K3RA 1C8CA 3K7AB 1X3PA 4H44C 3A74A 2F0IA 4MTNA 1NMGA 1U0LA 1YNJC 2K5WA 4IPCA 4LUVA 1TXYA 4DR1Q 2PI2A 3BS1A 1VF7A 4OHJA 4WJ4A 2UUBQ 2EXDA 4I7AA 4YY3L 5M3MB 2VB2X 1IXRA 5C3XA 1F9PA 2KECA 1LYLA 1TY2A 2F0OA 3BDCA 3BU2A 2YU9B 4GLAC 2AMCB 2HDMA 2QF7A 2PQAB 3NTIA 2JEAI 2UU9Q 4KHPL 2D0PA 2JYOA 4DV2Q 1EY7A 1KIXA 1LTID 4OIJA 5LL6X 2QA4A 5M3FH 3S2HH 5FKAC 4P72A 1CKOA 3H6MA 5EGTA 1LTGD 4RHRA 1OXTA 3CRLC 3I4LA 2D62A 3D4DA 4YWMA 1X55A 3AEVA 4IUPA 3PO2H 5HGQA 1LT5D 2FXQA 2C35B 4EQPA 4GNXB 2G5DA 1VMPA 2UXCL 2YTXA 1N33Q 4C1NI 2A69C 2D0OA 2R93G 4B3SQ 1I4GA 5JJLA 1ONLA 3WDNA 5IT9L 3S1QB 3S14H 5BR8Q 2R92G 1TS4A 4HCSA 5ELBA 2B2VA 1H9SB 2DJGC 4P75A 3CRKC 3I55A 1WOCA 4RKLA 2RDGA 3HOXH 1E2WA 4C3JB 3W5OA 2ID0A 5GAGC 1WTPA 4A3CH 1SYDA 2EXZA 2PYKA 3KF6B 1OO9B 4DR4Q 1GUTA 2ZXOA 1CUKA 3O13A 3QO2A 3RD4A 1TWGB 4RWSC 3T13A 4DV6Q 2ATWA 1SYFA 4DN4M 4DU9A 5D3IB 3A8KE 1H9RA 1Y1WH 5DM63 4NXNL 1EY9A 2V4DA 3E9HA 2F3VA 2M00A 4BS9A 5M5YB 2D9UA 1DM0B 4CDFC 3H3VC 4EQOA 3ULLA 1M8AA 5JPMC 4X65Q 5IIFA 4K14A 2Q2UA 3RNUA 4JI8Q 2SEBD 2KBNA 4A3LG 4ZUIA 1YIJA 4HEDA 4M1UB 5I6WA 1U4RA 5M3FG 1WD0A 4QQBX 3W1GA 2NUCA 3CCVA 2LFNA 1FNUA 4FNFA 1B3QA 3K58A 3PO3B 4JBKA 1X32A 5K36H 4BBSB 4TSSA 3PO2G 1S5CD 2WAQB 3PMFA 4IJHA 3S1MH 3A7LA 1HPCA 3H3VH 5E4WC 3U58A 4MHEA 1TWFB 3CPWA 1KAAA 2NVQH 5LMNQ 4AYBG 3R3OA 1YNXA 1LTLA 4A93H 2A5HA 5EQ0A 4CDCC 4FF4A 1P16A 1BR9A 4IFDH 4JI1L 2WKCA 2DJFC 3MAQA 2EJMA 4KI0A 4GOPA 2DNEA 1XX8A 1G2SA 3UDIA 3F2CA 2F0HA 1VQ4A 4GKJL 3DM3A 3KK7A 5IYDH 2A68C 4N9TA 2ICEC 3CC7A 1ET6A 4H7BA 2K5DA 4Q5VA 5KGUA 4FF2A 1I6HH 1EIHA 5CV9A 1JJGA 2A73B 1NMFA 2K50A 1QVCA 3AYHB 4OL7A 4E6IA 4B3ML 3MFGA 2VQFL 4C2MB 3OW2A 2E2IH 1T5EA 3RUZA 3J7AV 3D0FA 4LF9L 2IX0A 2Q8IB 2B2UC 1I50H 1PDQA 1WTXA 3LNNA 1X9NA 3K5MA 4IUNA 3SEBA 2A19A 1SFOB 1J5EQ 4LFAL 1HZAA 1Z47A 4B3TL 3FHWA 4A3GH 1WVLA 2DY8A 2A6HD 2N49A 3ONAB 1D8LA 5CR3A 5FO9B 3D4WA 1BCPB 1STAA 1HQRD 4G7HC 3BVGA 4DV1L 1ENCA 4NKLA 4EX5A 1BQQT 3T1HL 1TR5A 3K80C 4XYQA 5C4JH 3GTOH 1K3BC 5F2DA 1L0WA 2EZVA 4OWWB 1IHZA 3QR8A 4HIKA 2EYOA 3EBEA 3F2UA 3RZOB 3BDOA 1TIID 1H95A 5CV4A 4PZ7A 1GM5A 1AFPA 4YWKA 1N32L 5AJ3L 1Y8PB 1TKWB 1S72A 3I4NG 2VUMB 2J4XA 1B9NA 2KCTA 3G7LA 1MKHA 4OX9Q 2B2YA 2E2JH 2SOBA 1Q46A 1Q8KA 2HUGA 5C5LA 3URYA 3IKJA 4BBRB 4IOAA 3JC66 1CI3M 1PYSB 2AQ2B 2JA8H 5IOCA 3ERSX 5IYCG 5JOBA 2WB1B 2IHEA 4BY1G 5DAUA 5E7NA 1S5BD 4HCEA 1CM9A 4JI4L 2X69A 2AUKA 3AQQA 4Y7NH 4GKKL 4FYDA 2QCPX 3HOYH 2NVXB 4HIMA 1Q1EA 4DUYQ 1DCZA 3A7AB 4QY7A 1RDPD 3T16A 3K7UC 4F87A 1I3QH 1HH2P 2VL6A 3KLRA 4O2DA 2KHJA 1DYQA 1EYCA 1RHPA 2K5VA 4NXMQ 4IUVA 3BVZA 4A3FB 3SGIA 5IYBH 5G3LD 1JORA 2J7ZA 5CV8A 1JR0D 5I4DA 4DAYA 1PH4A 2JA6B 5D65A 1EUJA 4DA2A 1TWAH 3Q8DA 3TSSA 1DJRD 4RGNA 2F0KA 1SROA 5M5WB 3NBHB 1NJIC 3JAMi 4OELB 3VYSA 4HSPA 3VR5A 5C0XJ 4L5QA 3GTQH 3OIQA 2B8FA 3KUPA 3HOZB 2F03A 3HGBA 3F2DA 1KAWA 3BG3A 3HOUH 2QDBA 1N8RC 1STGA 2K05A 5J22A 2R7DA 4QIWE 4UP7A 1PHJA 4BY7H 4GN4B 3AFPA 3HS0C 3GTPH 4KKSA 2EE1A 1D7QA 4IUUA 4JI0L 1IBMQ 1BCPC 1K8OA 2SDFA 3BYTB 3N6RA 5A2QE 1RD9D 1FNVA 2AWOA 4DNIA 4LW1A 4X3KA 4JI5L 5KNBA 1QNKA 1TY0A 1LT4D 1BO0A 2KCNA 5EAYA 3TZUA 1WTRA 1PH2A 5FLXL 1UE5A 3TEHB 2KCCA 3E9IA 3CKIB 1EIYB 5CV5A 5EKLA 1SEBD 1BNZA 4CDDC 3FMCA 2Q8TA 2H4OA 2HHHL 4A3EB 1B70B 1HCZA 3PUVA 3T4AC 1G6ZA 1F77A 3I2ZA 1Q81C 4DGZA 1RKNA 2NZOA 2L4NA 5EPKA 1B8AA 1LABA 2XNAC 2EY6A 1PH8A 2MFIA 1MHWC 1CKMA 3SR1A 3H94A 2JA7B 4DV0L 1LTAD 4R4TA 5C4XH 1QZHA 3STBC 2A74C 3PSIA 3KJPA 5GADC 2CVRA 4ZQ3A 1HXYD 2KJXA 5GAHC 2FMMA 4LF4L 2RDHA 2B63B 2I5HA 3PIP3 2SNMA 1KD1C 3I4MB 3WWVA 4X62L 1TWCH 4LF7Q 2E8GA 3MC0B 4LFCL 4GS3A 2VQEQ 2G9DA 2LMCB 2MUYA 1T9HA 3X3MA 4F88A 2WFWA 3L2PA 4LF8Q 5J3BA 4XQQA 1PYBA 3TDQA 1JWMD 3S1RH 4B9WA 5FLMH 1S4ZA 4ZK9B 2WIIB 3S15B 4KJNA 5GQOA 1C48A 3H0GH 2R92B 1YVCA 1PH3A 1PVOA 3G48A 2PZWA 2MO1A 2R7ZB 5AFWA 1RTOA 1VQLA 2NVTH 4ZKCB 2I0QA 5FO7B 1YNND 5I2YA 3J80L 3VA7A 3LGJA 3FKIH 1Z7TA 3T51B 5EBDA 5JEAG 4JI6Q 3GD7A 4NP5A 5DM73 4IALA 1XNRL 4K6DA 1UWVA 1PRTD 2R3ZA 3D4RA 4R9WA 3JAME 3FPUB 2F3IA 3W3AA 2YYZA 3RN2A 1Q1BA 2XVSA 3E6ZX 4LWCA 4A3JG 4P2CB 4K2KA 2E2DC 3AU7A 1VQFA 3WOEA 4LFAQ 2PPBC 1FJGL 1VQHA 4EGVA 3B6YA 3ND9A 1VQ8A 4LNQA 3OOCA 1W2BA 2CHBD 1WYDA 4AQYL 1A3UA 1LV9A 4HSVA 3S2HB 1BCPF 5M3FB 1D5MC 3J7AF 3RLNA 1ET9A 3KFUA 1HR0L 3R93A 2OXPA 3EJIA 5IODA 3S2DH 4IN3A 1NCVA 3C1EA 4S3SA 1X3GA 2UUCL 2JP1A 2AUJD 1D1IA 1ZYRD 3EA6A 1PH5A 3JAMc 1N36Q 3CU7A 3PO2B 2QDLA 3QOLA 4O1NA 2ZM6L 3MXPA 2GVAA 4K8JA 4GN3B 4DV3L 1STBA 4AYBB 4FP5D 1I4HA 2HQEA 3MVVA 1V1PB 4OEMB 3K81C 3M7NA 2NYZD 1XMOQ 4CJ1B 1SR3A 1JJ2A 4JBMA 4KTAA 5AJ3Q 3S14B 1A3TA 3DXJC 2F0TA 1II3A 1UE7A 4FXGC 4JYAQ 1EY6A 3TS0A 3CCJA 1MJCA 2F1MA 1LUZA 4X66Q 5H1SE 2O4XA 1EIFA 3TQYA 1GUSA 3HOXB 1NUCA 4JOIA 4YCVA 4DV7L 1KTKA 3GTJH 1TS5A 2PZTA 2F0EA 4A75A 4A3MG 3NEMA 1EZ6A 2QW7A 1R9TB 3HKZB 4N9PA 1HZBA 2PZUA 4POGA 4LF6L 3K6OA 4MN3A 1Y1WB 5C44G 1DOLA 1IW7C 3J81i 2RHSB 1K83H 2HQLA 3KDFA 1UEBA 3HOWG 5FOBB 3SK6A 2UUAL 3N52A 1Y1VG 3U9OA 1O78A 3PF4A 3NELA 2LKVA 2BE5C 4U68A 2EYPA 2NZHA 1ESRA 2UXBQ 2F0VA 4I7ZC 3VR3A 4DR6L 3V2TA 1AE2A 2R93H 3A8IE 5KYIA 4R4IA 1SE4A 1AZQA 3PIO3 3OW7A 3A55A 3VA5A 1PFBA 5IY0A 2KA7A 3AB9A 4P73A 4JI2L 1PLFA 3H91A 4PMWA 1IYVA 2L1BA 3S1MB 4OIKA 4IQZA 1S5FD 4JV5Q 3E0EA 2NVQB 5ELOA 3MXUA 1JC7A 3DWQA 1IBKL 4CDEC 2A6EC 2KVMA 2NTTA 4DR2L 4A93B 1WCMG 4QJFA 2MO0A 2R7FA 2X6LA 1VQ7A 1I94Q 1E3PA 4B3RL 3KBGA 2OWOA 1VMCA 3GQBA 4DKAC 2EYMA 1CKNA 1PZJD 2N88A 3L7ZC 3K57A 1UEAB 4J6HA 4KD3A 1KC8C 1KRSA 1PTOF 5BN5A 5IP7G 5ELFA 4OGQC 1JOQA 1SBBB 4K6LA 3CF5A 3TN2A 2E5LL 1A6XA 1HNXL 1ICWA 3CXCA 3OTOQ 3NP8A 2JXMB 4BA1I 1MSHA 2F0DA 4CJ2C 2WKDA 1I6HB 4A3LH 4JC0A 5L37A 1SYBA 3A8JE 2CWPA 4WFN3 4K5WA 1AH9A 1PZID 3P7JA 2JA5G 3QJYA 1SAPA 4DF7A 2HHHQ 1IYUA 2E2IB 1SMXA 1GKHA 1BBUA 3HZXA 1CHPD 2DUDA 4DXFA 3KLWA 3SHLA 2XWJB 1I50B 3Q6SA 1WD1A 3NQTA 4EVOA 1E24A 1SLJA 2XSCA 1E1OA 4A3GB 2EJFC 4IJLA 3S1NH 3E3XA 3QOJA 2F0JA 4DNRB 1SRUA 1R4PB 3NHHA 1HNWL 5HY6A 3GO5A 3KF8A 5EBCA 4XT3B 1A2UA 4FF3A 1JICA 4WORA 4QCLA 3OMCA 1OXVA 3S16H 4TQUS 1HNZL 2O5IC 4PG3A 5I2XA 4LF5L 5C4JB 4NW2A 3GTOB 3VYUA 4DR3L 3M4OH 4YCWA 2RQXA 5KEEA 3C3LA 1J8IA 4UPAA 1Q7YC 4IUQA 1JB3A 2UXDQ 2NZ1D 4FVMA 1R9TH 5JPNC 2EIFA 2CH4W 3D3RA 3K8AA 3J81E 1VQEA 5C3EG 3KDFB 2CWAA 1IL2A 1GXDC 1VQAA 3V96A 3GTGH 4DXGA 2RCFA 1QB5D 2E2JB 2BH2A 4ODGA 1XNQL 1XMQQ 1BKBA 1HHVA 1RTNA 2JA8B 4OONA 1F2ZA 5BN3A 3MWYW 1QZGA 3RLFA 4C3IG 1QOHA 1FL0A 2B2WA 4HR7B 4M8AA 1XNRQ 1QUQA 1UNSA 2EVBA 5IP9G 2IX3A 5ISRA 4YCUA 4U673 4LUOA 4Y7NB 1I4XA 2D2CC 3HOYB 1JJCB 3I3CA 3J81c 3SXHA 5JVH3 1KLUD 1UUPA 2EY5A 1I3QB 5CORA 1NSNS 2HCCA 3A54A 2R61A 4IOCA 2H1EA 1GD7A 1XWEA 2NWGA 4DR5L 1FJGQ 1RCVD 1YJ9A 1V1OA 2F4VL 4ME5A 1VDZA 1VS0A 3MXGA 4KD4A 1VQDA 2RSOA 4BWGB 4K2LA 2DN8A 3MTSA 1HR0Q 1TWAB 1JE5A 1I4RA 4KN4C 1F2MA 2PW7A 1IKLA 1ENAA 1P8LA 4DNTB 4G57A 3G71A 1O7LA 3RLOA 3I4NH 2CW0D 3NWSA 3U50C 4FXKC 2WP8J 1LACA 4RAUC 4YHHQ 5FJ8G 1PFNA 2MGSA 2JQOA 2Z6BA 3GTQB 2OQKA 3DM1A 4POFA 3OWEB 4G4KA 3Q23A 4X3UA
chains in the Genus database with same CATH topology
1W3SA 5IYCH 3GTQH 3CCSA 1IBLQ 1GO3E 4DUYL 4JI7Q 4A3KH 1WI5A 1YI2A 4BY1H 3M3YH 3F2DA 4DV4L 1KAWA 5IP9H 1XPRA 2GVBA 3M9BA 3HOUH 4OO1I 1VCIA 4GN5A 1N8RC 1N34Q 2R7DA 3HKZE 4QIWE 4UP7A 1PHJA 3HOZH 4BY7H 4GN4B 4K0KL 1OXXK 5C4XG 1K0RA 3AFPA 2K14A 3GTPH 4XTCS 4NXML 1D7QA 2JA7G 2Q2IA 4JI0L 4MNOA 1IBMQ 1VQGA 4FDBA 3CPFA 4JOIC 4DV5L 2VUMG 1ASZA 1NY4A 4DV7Q 2AWOA 4DV0Q 2XTIA 2ALYB 3L0OA 1NTGA 4LW1A 4DNIA 5GAEC 4AH6A 1VQIA 4JI5L 3PCOB 3G6EA 1XPUA 1C9OA 5EAYA 1PH2A 2B63G 5GROA 1WFQA 5C0XG 4A3IG 4YHHL 1B7YB 1N9WA 3J7ZC 1YHBA 3T1YQ 1JMCA 3I4MG 1VQJA 1X3FA 4LF4Q 1UE5A 3PIPA 3TEHB 3IRBA 3E9IA 2A8VA 1EIYB 5JJIA 4IPDA 2XGTA 4IPGA 4YWLA 5FLMG 1A62A 4X62Q 2CKZB 1IBLL 2OTJA 4JI7L 3GDEA 2AWNA 2HHHL 2BH8A 4LFCQ 3HFZB 1B70B 5FJ8H 3H0GG 1M90C 1S3OA 2JA9A 2V1CC 3PUVA 4NB3A 4DK3C 3I2ZA 1VQOA 1Q81C 1N34L 1KXLA 1RIPA 1V9PA 2LXJA 4A3EH 2NZOA 2Z6KA 4LFBL 2QGQA 3ICEA 1KRTA 4DR7Q 1B8AA 2N3SA 2WAQE 4C3HH 1IBML 2YV5A 1YEZA 1PH8A 2MFIA 3CCEA 4EQ5A 3HKSA 1CKMA 4R1JA 2R7ZG 4DV0L 1FVIA 5IWAQ 2JEBI 2L15A 3FKIG 2LSSA 4R4TA 4UP9A 2K52A 3A5UA 5C4XH 5LMUQ 4A3EG 1YZ6A 4O0AA 1QZHA 1TWHH 3STBC 4P71A 2JA7H 1HJPA 4X64Q 3PSIA 3KJPA 5GADC 4L5TA 2H5XA 1PA6A 4H02A 3BZKA 1EWIA 3T1YL 4JG2A 1YHAA 4P74A 4R4QA 4OWXB 5GAHC 2OTLA 4LF4L 3FP9A 1M1KC 1QVFA 1V1QA 2KCMA 2I5HA 3I56A 3CMAA 4DR2Q 3U4VA 1KD1C 3OYYA 3WWVA 2ZJRA 3TS2A 4X62L 2QEXA 1TWCH 1I5FA 4A3KG 2K75A 4LF7Q 2B63H 2E8GA 4LFCL 1YBYA 4GS3A 4A3IH 1OXUA 1QUQB 2VQEQ 3I4MH 3S24A 5JEAJ 5M3MG 4R4OA 1T9HA 2B3GA 4DUZQ 2WFWA 3L2PA 1WJJA 1XTDA 4JBJA 5J3BA 1PYBA 4OWTB 4LF8Q 3CAMA 3AFQA 4YY3Q 3S1RH 4NPSA 1VQBA 5FLMH 4DR7L 1G291 2JJQA 3ULJA 4A4IA 1HR0W 5GQOA 1YJWA 3H0GH 3KOJA 3ULPA 4LUZA 1YJNA 1YVCA 4HJ5A 4AQYQ 1PH3A 5LMUL 3S15H 4KHPQ 1Q82C 1PVOA 1CKNB 3G48A 2MO1A 4ME3A 4AYBE 4X64L 2AKWB 4OX9L 2R92H 1VQLA 2NVTH 3M4PA 1L1OB 3S17H 3F8TA 2VZAA 4L5RC 2HIVA 2N78A 4GOPB 2I0QA 2UUCQ 2R7ZH 1K3RA 3LGJA 3FKIH 1IZ6A 5JEAG 3A74A 4OXPA 3GD7A 4MTNA 1NMGA 1S40A 4JI6Q 4LF7L 1U0LA 4LUVA 4IPCA 3A0JA 3K7AH 1TXYA 1UE1A 2PI2A 2ZM6Q 1UWVA 4DR1Q 1XNRL 2VQEL 4QL5A 4WJ4A 2UUBQ 4JI3L 3M85A 4DV3Q 2F3IA 2DGYA 2Z0SA 4LF8L 2NN6I 2YYZA 2EXDA 3RN2A 1Q1BA 4YY3L 4LWCA 3J80i 4A3JG 1IXRA 3UDGA 1E7ZA 1VQFA 1LYLA 3BU2A 4GLXA 4LFAQ 4GLAC 1FJGL 2BA0A 4X6AH 1VQHA 5M3MH 4OO1G 1VQ8A 3B6YA 1EQRA 2AMCB 4LNQA 1EQQA 2PQAB 1W2BA 2YU9H 2JEAI 4AQYL 1WYDA 3RR5A 2D0PA 2UU9Q 4KHPL 3HOXG 3TRZA 4IPHA 1YITA 4A76A 4DV2Q 1PH7A 4A3CG 4GNXC 3RLNA 3CMEA 2BA1A 1HR0L 3KFUA 2CFMA 1KIXA 1G51A 1KL9A 3NENA 2QA4A 5M3FH 2CCZA 4P72A 3S2DH 1CKOA 1K9MC 2UUCL 1X3GA 3HKZG 3H15A 1G6PA 1PH5A 2KENA 1JT8A 3JAMc 1N36Q 1OXTA 2ZTDA 3VDYA 1K8GA 2K5HA 4JI6L 2N8NA 3KF8B 5DLQE 1Y1WG 1VQKA 2D62A 2ZM6L 4YWMA 4GLVB 4DR1L 2E2HH 2UXCQ 2GVAA 4LF6Q 2IHFA 2UUBL 1X55A 3UE1A 3AEVA 4GN3B 3PO2H 4DV3L 1L2FA 5HGQA 3CD6A 2FXQA 2C35B 4GNXB 4A3BG 4HJAA 2GN5A 4RG1A 3I4OA 2UXCL 3CCUA 2YTXA 1LM0A 3K81C 3BZCA 1N33Q 3M7NA 2F52A 2WB1E 1VQ5A 2UUAQ 2R93G 2D0OA 1XMOQ 1SR3A 1JJ2A 4JBMA 4NXNQ 4B3SQ 5AJ3Q 4IFDJ 5JJLA 4L5SA 3GTKH 1UE7A 1XNQQ 2RHQB 4JYAQ 3TS0A 3CCJA 3S14H 1MJCA 4A3JH 4HJ8A 3MEFA 2OCEA 5BR8Q 1LUZA 4X66Q 2R92G 4DR6Q 2KHIA 5H1SE 1EIFA 3TQYA 3PIOA 3CCLA 1RL2A 3S1QH 4JOIA 4YCVA 4DV7L 5K36G 1PV4A 4P75A 1EYGA 1SE8A 3I55A 1WOCA 3GTJH 3PO3G 4A75A 4A3MG 2PI2E 1A0IA 3NEMA 3HOXH 3DLLA 1N36L 3W5OA 4JI2Q 2ID0A 3UDFA 4BBSG 5GAGC 2WAQG 4A3CH 1HZBA 3BJUA 4POGA 3KF6B 3CC2A 3ER0A 4DR4Q 4C3JH 1CUKA 4DV6Q 4LF6L 3F1ZA 3UDXA 4A93G 1Q12A 1IBKQ 4Y52H 5C44G 1UE6A 2ATWA 3J81i 2RHSB 1K83H 4IFDG 1X3EA 2HQLA 2Y0SE 3G4SA 3KDFA 4DR5Q 1K73C 1TWGH 1N33L 1UEBA 3HOWG 1C7YA 1Y1WH 2UUAL 5FLXc 1XMOL 2F4VQ 4NXNL 4B3SL 4B3RQ 2VNUD 2K5NA 1Y1VG 3E9HA 1VQ6A 4IO9A 3PF4A 3NELA 3J7A5 4JYAL 1PH9A 1L1OC 3ULLA 5IYDG 4X65Q 4JCVE 2NZHA 2Q2UA 3RNUA 4A3BH 2K4KA 4JI1Q 4JI8Q 4GOPC 1Q86C 2UXBQ 5BR8L 4X66L 4DR6L 5IE8A 2KBNA 5M5YH 1AE2A 4A3LG 2R93H 1YIJA 2E5LQ 1HNXQ 5M3FG 4R4IA 1AE3A 4QQBX 3UE0A 3W1GA 3CCVA 1E22A 5IWAL 1CSQA 4GKJQ 2RCNA 2ZTCA 2YTYA 5IY0A 1ASYA 3CQZH 4HJ9A 4P73A 1VQPA 4JI2L 4PMWA 4HJ7A 4JBKA 3D31A 2PNHA 1BVSA 4DV6L 4DAYB 3E0EA 4JV5Q 5ELOA 2RF4A 1FGUA 1X54A 3W1BA 4IJHA 1IBKL 3PO2G 3S1MH 3CW2C 1XPOA 3PO3H 4A3MH 4DR2L 3H3VH 2R6GA 3U58A 2VS1A 4QGUA 1WCMG 4QJFA 2MO0A 3CPWA 2R7FA 4B3MQ 4PZ8A 5LMNQ 4PZ6A 1I94Q 4AYBG 1VQ7A 2NVQH 4BBSH 2A1AA 3J81j 2VQFQ 4MZ9A 2OQ0A 1VQ9A 1YNXA 2NVYH 3CP0A 1E3PA 4B3RL 3PUYA 1LTLA 4A93H 1TWFH 2OWOA 4A3GG 4DKAC 1CKNA 4DUZL 4HIDA 4APVA 2Q2HA 5C44H 4LF9Q 4X65L 1NE3A 1P16A 3L7ZC 1KC8C 1PH6A 1KRSA 5IP7G 4JI1L 4JI8L 2UXBL 4KHZA 4KI0A 1VQMA 3PV0A 3HOWH 3CF5A 4GOPA 1HZ9A 2IX1A 2E5LL 1HNXL 3UDIA 3M4QA 3F2CA 4ALPA 1Y1VH 1OXSC 1SN8A 3OTOQ 3CXCA 4B3TQ 1HNWQ 2JE6I 1VQ4A 4BA1I 4DAMA 4GKJL 3DM3A 5IYDH 3CC7A 3GTLH 1X56A 4DK6C 3PUZA 4A3LH 4JC0A 3CCRA 3KJOA 2CWPA 1KQSA 1AH9A 1HNZQ 4JV5L 1I6HH 1HZCA 4LF5Q 1JJGA 4DV1Q 1NMFA 3F2BA 2JA5G 1A8VA 3RN5A 2K50A 2HHHQ 3AYHB 1QVCA 2I5LX 4DR3Q 1SMXA 1C0AA 3CCQA 1GKHA 3T1HQ 4B3ML 1BBUA 5LMNL 1I94L 2DUDA 2VQFL 2PQAA 3OW2A 3EIVA 2E2IH 3KLWA 2Z6KC 3J80c 4LFBQ 1VQCA 3D0FA 3PUXA 1E24A 1SLJA 4LF9L 2IX0A 4C2MH 4WJ3M 4UY8C 1E1OA 1WCMH 1O7IA 1I50H 1X6OA 4IJLA 3S1NH 1X9NA 1J5EQ 1DGSA 2A19A 4LFAL 1N32Q 1SRUA 1HZAA 1Z47A 2JA8G 4B3TL 3FHWA 3OTOL 4A3GH 1HNWL 4BBRG 5HY6A 3GO5A 1SFOH 2UU9L 4R4CA 3HOVH 2VY3A 5C0XI 3A5ZB 2N49A 5IP7H 3EN2A 1EFWA 4A3DH 1D8LA 2LXKA 1XJVA 3PGZA 1JB7A 2I5MX 2WB1G 4DV2L 1OXVA 4J15A 1BBWA 1NBWA 3S16H 4GNXA 3PUWA 4TQUS 2ES2A 1HNZL 4PG3A 3HOYG 4LF5L 1EOVA 1X65A 4DV1L 4EX5A 4DR3L 2ASBA 3M4OH 1Z9FA 4YCWA 3T1HL 5M5XH 3PF5A 3K80C 2IT1A 5C4JH 4JI4Q 4UPAA 1Q7YC 3GTOH 2UXDQ 1K8AC 4GKKQ 2ZJQA 1Y14B 1L0WA 1PH1A 2VW9A 4OWWB 1R9TH 2MQHA 1YHQA 1J6QA 2EIFA 5IYBG 4DPGA 2JA5H 4HIKA 3K8AA 1VQEA 2HIXA 3EBEA 4UP8A 3RZDH 5C3EG 4BXXG 1V43A 2CWAA 3KDFB 1IL2A 1H95A 1VQAA 3GTGH 4PZ7A 1J5EL 1GM5A 4YWKA 4A3FG 1N32L 1U5KA 5AJ3L 1S72A 3STBD 3H3VI 2BH2A 3I4NG 1XNQL 5ELNA 1XMQQ 3RZOH 2ZJPA 2KCTA 1BKBA 2JA6G 1MKHA 4OX9Q 3MXNB 2E2JH 2Y0SG 3KF6A 2VUMH 4OONA 1Q46A 1Q8KA 4IOAA 1QZGA 3JC66 1MIUA 4XIGS 3RLFA 1PYSB 4JBWA 1GVPA 2JA8H 4IFDI 3ERSX 3K0XA 5IYCG 2HT1A 1PFSA 1FL0A 5IT9c 4BBRH 2IHEA 4BY1G 4AIMA 4HIOA 1QVGA 5E7NA 1XNRQ 3KYHC 5LMNW 1QUQA 5IP9G 4TVAB 2JK8A 4YCUA 4LUOA 3HOUG 4JI3Q 4JI4L 3HOZG 1JJCB 2CQOA 3J81c 3GTMH 4BY7G 2UXDL 4DR4L 3AQQA 4Y7NH 4GKKL 2AHOB 3HOYH 4HIMA 1Q1EA 2Q2TA 4DUYQ 3S2HH 1KHIA 4IOCA 4QY7A 1VQNA 4DV4Q 4DR5L 1GD7A 3I7FA 1FJGQ 3K7UC 2NVXH 1E1TA 1I3QH 1HH2P 2VL6A 1YJ9A 2F4VL 4O2DA 4K0KQ 1VS0A 2KHJA 1VQDA 2ZTEA 1XMQL 2K5VA 3CCMA 1CSPA 4NXMQ 2IY5B 1IYJB 4JI0Q 2NN6G 3SGIA 5IYBH 3HOVG 4A3DG 1L1OA 4DV5Q 1HR0Q 5C3EH 4BXXH 1JE5A 2PMZE 3ZJYC 1PH4A 1P8LA 4KLKA 3U4ZA 4A3FH 1EUJA 3TREA 3G71A 4JI5Q 3RLOA 1MJEA 3I4NH 1TWAH 3Q8DA 2EQSA 5JJKA 2YTVA 3U50C 2JA6H 1SROA 2B29A 2WP8J 3NBHB 1NJIC 4YHHQ 5FJ8G 3JAMi 3CC4A 2JQOA 2OQKA 1OTCA 4BA2I 4POFA 4RMFA 2MNAA 5C0XJ 5M5WH 1A63A 4C3IH 4L5QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3S A;  5IYC H;  3GTQ H;  3CCS A;  1IBL Q;  1GO3 E;  4DUY L;  4JI7 Q;  4A3K H;  1WI5 A;  1YI2 A;  4BY1 H;  3M3Y H;  3F2D A;  4DV4 L;  1KAW A;  5IP9 H;  1XPR A;  2GVB A;  3M9B A;  3HOU H;  4OO1 I;  1VCI A;  4GN5 A;  1N8R C;  1N34 Q;  2R7D A;  3HKZ E;  4QIW E;  4UP7 A;  1PHJ A;  3HOZ H;  4BY7 H;  4GN4 B;  4K0K L;  1OXX K;  5C4X G;  1K0R A;  3AFP A;  2K14 A;  3GTP H;  4XTC S;  4NXM L;  1D7Q A;  2JA7 G;  2Q2I A;  4JI0 L;  4MNO A;  1IBM Q;  1VQG A;  4FDB A;  3CPF A;  4JOI C;  4DV5 L;  2VUM G;  1ASZ A;  1NY4 A;  4DV7 Q;  2AWO A;  4DV0 Q;  2XTI A;  2ALY B;  3L0O A;  1NTG A;  4LW1 A;  4DNI A;  5GAE C;  4AH6 A;  1VQI A;  4JI5 L;  3PCO B;  3G6E A;  1XPU A;  1C9O A;  5EAY A;  1PH2 A;  2B63 G;  5GRO A;  1WFQ A;  5C0X G;  4A3I G;  4YHH L;  1B7Y B;  1N9W A;  3J7Z C;  1YHB A;  3T1Y Q;  1JMC A;  3I4M G;  1VQJ A;  1X3F A;  4LF4 Q;  1UE5 A;  3PIP A;  3TEH B;  3IRB A;  3E9I A;  2A8V A;  1EIY B;  5JJI A;  4IPD A;  2XGT A;  4IPG A;  4YWL A;  5FLM G;  1A62 A;  4X62 Q;  2CKZ B;  1IBL L;  2OTJ A;  4JI7 L;  3GDE A;  2AWN A;  2HHH L;  2BH8 A;  4LFC Q;  3HFZ B;  1B70 B;  5FJ8 H;  3H0G G;  1M90 C;  1S3O A;  2JA9 A;  2V1C C;  3PUV A;  4NB3 A;  4DK3 C;  3I2Z A;  1VQO A;  1Q81 C;  1N34 L;  1KXL A;  1RIP A;  1V9P A;  2LXJ A;  4A3E H;  2NZO A;  2Z6K A;  4LFB L;  2QGQ A;  3ICE A;  1KRT A;  4DR7 Q;  1B8A A;  2N3S A;  2WAQ E;  4C3H H;  1IBM L;  2YV5 A;  1YEZ A;  1PH8 A;  2MFI A;  3CCE A;  4EQ5 A;  3HKS A;  1CKM A;  4R1J A;  2R7Z G;  4DV0 L;  1FVI A;  5IWA Q;  2JEB I;  2L15 A;  3FKI G;  2LSS A;  4R4T A;  4UP9 A;  2K52 A;  3A5U A;  5C4X H;  5LMU Q;  4A3E G;  1YZ6 A;  4O0A A;  1QZH A;  1TWH H;  3STB C;  4P71 A;  2JA7 H;  1HJP A;  4X64 Q;  3PSI A;  3KJP A;  5GAD C;  4L5T A;  2H5X A;  1PA6 A;  4H02 A;  3BZK A;  1EWI A;  3T1Y L;  4JG2 A;  1YHA A;  4P74 A;  4R4Q A;  4OWX B;  5GAH C;  2OTL A;  4LF4 L;  3FP9 A;  1M1K C;  1QVF A;  1V1Q A;  2KCM A;  2I5H A;  3I56 A;  3CMA A;  4DR2 Q;  3U4V A;  1KD1 C;  3OYY A;  3WWV A;  2ZJR A;  3TS2 A;  4X62 L;  2QEX A;  1TWC H;  1I5F A;  4A3K G;  2K75 A;  4LF7 Q;  2B63 H;  2E8G A;  4LFC L;  1YBY A;  4GS3 A;  4A3I H;  1OXU A;  1QUQ B;  2VQE Q;  3I4M H;  3S24 A;  5JEA J;  5M3M G;  4R4O A;  1T9H A;  2B3G A;  4DUZ Q;  2WFW A;  3L2P A;  1WJJ A;  1XTD A;  4JBJ A;  5J3B A;  1PYB A;  4OWT B;  4LF8 Q;  3CAM A;  3AFQ A;  4YY3 Q;  3S1R H;  4NPS A;  1VQB A;  5FLM H;  4DR7 L;  1G29 1;  2JJQ A;  3ULJ A;  4A4I A;  1HR0 W;  5GQO A;  1YJW A;  3H0G H;  3KOJ A;  3ULP A;  4LUZ A;  1YJN A;  1YVC A;  4HJ5 A;  4AQY Q;  1PH3 A;  5LMU L;  3S15 H;  4KHP Q;  1Q82 C;  1PVO A;  1CKN B;  3G48 A;  2MO1 A;  4ME3 A;  4AYB E;  4X64 L;  2AKW B;  4OX9 L;  2R92 H;  1VQL A;  2NVT H;  3M4P A;  1L1O B;  3S17 H;  3F8T A;  2VZA A;  4L5R C;  2HIV A;  2N78 A;  4GOP B;  2I0Q A;  2UUC Q;  2R7Z H;  1K3R A;  3LGJ A;  3FKI H;  1IZ6 A;  5JEA G;  3A74 A;  4OXP A;  3GD7 A;  4MTN A;  1NMG A;  1S40 A;  4JI6 Q;  4LF7 L;  1U0L A;  4LUV A;  4IPC A;  3A0J A;  3K7A H;  1TXY A;  1UE1 A;  2PI2 A;  2ZM6 Q;  1UWV A;  4DR1 Q;  1XNR L;  2VQE L;  4QL5 A;  4WJ4 A;  2UUB Q;  4JI3 L;  3M85 A;  4DV3 Q;  2F3I A;  2DGY A;  2Z0S A;  4LF8 L;  2NN6 I;  2YYZ A;  2EXD A;  3RN2 A;  1Q1B A;  4YY3 L;  4LWC A;  3J80 i;  4A3J G;  1IXR A;  3UDG A;  1E7Z A;  1VQF A;  1LYL A;  3BU2 A;  4GLX A;  4LFA Q;  4GLA C;  1FJG L;  2BA0 A;  4X6A H;  1VQH A;  5M3M H;  4OO1 G;  1VQ8 A;  3B6Y A;  1EQR A;  2AMC B;  4LNQ A;  1EQQ A;  2PQA B;  1W2B A;  2YU9 H;  2JEA I;  4AQY L;  1WYD A;  3RR5 A;  2D0P A;  2UU9 Q;  4KHP L;  3HOX G;  3TRZ A;  4IPH A;  1YIT A;  4A76 A;  4DV2 Q;  1PH7 A;  4A3C G;  4GNX C;  3RLN A;  3CME A;  2BA1 A;  1HR0 L;  3KFU A;  2CFM A;  1KIX A;  1G51 A;  1KL9 A;  3NEN A;  2QA4 A;  5M3F H;  2CCZ A;  4P72 A;  3S2D H;  1CKO A;  1K9M C;  2UUC L;  1X3G A;  3HKZ G;  3H15 A;  1G6P A;  1PH5 A;  2KEN A;  1JT8 A;  3JAM c;  1N36 Q;  1OXT A;  2ZTD A;  3VDY A;  1K8G A;  2K5H A;  4JI6 L;  2N8N A;  3KF8 B;  5DLQ E;  1Y1W G;  1VQK A;  2D62 A;  2ZM6 L;  4YWM A;  4GLV B;  4DR1 L;  2E2H H;  2UXC Q;  2GVA A;  4LF6 Q;  2IHF A;  2UUB L;  1X55 A;  3UE1 A;  3AEV A;  4GN3 B;  3PO2 H;  4DV3 L;  1L2F A;  5HGQ A;  3CD6 A;  2FXQ A;  2C35 B;  4GNX B;  4A3B G;  4HJA A;  2GN5 A;  4RG1 A;  3I4O A;  2UXC L;  3CCU A;  2YTX A;  1LM0 A;  3K81 C;  3BZC A;  1N33 Q;  3M7N A;  2F52 A;  2WB1 E;  1VQ5 A;  2UUA Q;  2R93 G;  2D0O A;  1XMO Q;  1SR3 A;  1JJ2 A;  4JBM A;  4NXN Q;  4B3S Q;  5AJ3 Q;  4IFD J;  5JJL A;  4L5S A;  3GTK H;  1UE7 A;  1XNQ Q;  2RHQ B;  4JYA Q;  3TS0 A;  3CCJ A;  3S14 H;  1MJC A;  4A3J H;  4HJ8 A;  3MEF A;  2OCE A;  5BR8 Q;  1LUZ A;  4X66 Q;  2R92 G;  4DR6 Q;  2KHI A;  5H1S E;  1EIF A;  3TQY A;  3PIO A;  3CCL A;  1RL2 A;  3S1Q H;  4JOI A;  4YCV A;  4DV7 L;  5K36 G;  1PV4 A;  4P75 A;  1EYG A;  1SE8 A;  3I55 A;  1WOC A;  3GTJ H;  3PO3 G;  4A75 A;  4A3M G;  2PI2 E;  1A0I A;  3NEM A;  3HOX H;  3DLL A;  1N36 L;  3W5O A;  4JI2 Q;  2ID0 A;  3UDF A;  4BBS G;  5GAG C;  2WAQ G;  4A3C H;  1HZB A;  3BJU A;  4POG A;  3KF6 B;  3CC2 A;  3ER0 A;  4DR4 Q;  4C3J H;  1CUK A;  4DV6 Q;  4LF6 L;  3F1Z A;  3UDX A;  4A93 G;  1Q12 A;  1IBK Q;  4Y52 H;  5C44 G;  1UE6 A;  2ATW A;  3J81 i;  2RHS B;  1K83 H;  4IFD G;  1X3E A;  2HQL A;  2Y0S E;  3G4S A;  3KDF A;  4DR5 Q;  1K73 C;  1TWG H;  1N33 L;  1UEB A;  3HOW G;  1C7Y A;  1Y1W H;  2UUA L;  5FLX c;  1XMO L;  2F4V Q;  4NXN L;  4B3S L;  4B3R Q;  2VNU D;  2K5N A;  1Y1V G;  3E9H A;  1VQ6 A;  4IO9 A;  3PF4 A;  3NEL A;  3J7A 5;  4JYA L;  1PH9 A;  1L1O C;  3ULL A;  5IYD G;  4X65 Q;  4JCV E;  2NZH A;  2Q2U A;  3RNU A;  4A3B H;  2K4K A;  4JI1 Q;  4JI8 Q;  4GOP C;  1Q86 C;  2UXB Q;  5BR8 L;  4X66 L;  4DR6 L;  5IE8 A;  2KBN A;  5M5Y H;  1AE2 A;  4A3L G;  2R93 H;  1YIJ A;  2E5L Q;  1HNX Q;  5M3F G;  4R4I A;  1AE3 A;  4QQB X;  3UE0 A;  3W1G A;  3CCV A;  1E22 A;  5IWA L;  1CSQ A;  4GKJ Q;  2RCN A;  2ZTC A;  2YTY A;  5IY0 A;  1ASY A;  3CQZ H;  4HJ9 A;  4P73 A;  1VQP A;  4JI2 L;  4PMW A;  4HJ7 A;  4JBK A;  3D31 A;  2PNH A;  1BVS A;  4DV6 L;  4DAY B;  3E0E A;  4JV5 Q;  5ELO A;  2RF4 A;  1FGU A;  1X54 A;  3W1B A;  4IJH A;  1IBK L;  3PO2 G;  3S1M H;  3CW2 C;  1XPO A;  3PO3 H;  4A3M H;  4DR2 L;  3H3V H;  2R6G A;  3U58 A;  2VS1 A;  4QGU A;  1WCM G;  4QJF A;  2MO0 A;  3CPW A;  2R7F A;  4B3M Q;  4PZ8 A;  5LMN Q;  4PZ6 A;  1I94 Q;  4AYB G;  1VQ7 A;  2NVQ H;  4BBS H;  2A1A A;  3J81 j;  2VQF Q;  4MZ9 A;  2OQ0 A;  1VQ9 A;  1YNX A;  2NVY H;  3CP0 A;  1E3P A;  4B3R L;  3PUY A;  1LTL A;  4A93 H;  1TWF H;  2OWO A;  4A3G G;  4DKA C;  1CKN A;  4DUZ L;  4HID A;  4APV A;  2Q2H A;  5C44 H;  4LF9 Q;  4X65 L;  1NE3 A;  1P16 A;  3L7Z C;  1KC8 C;  1PH6 A;  1KRS A;  5IP7 G;  4JI1 L;  4JI8 L;  2UXB L;  4KHZ A;  4KI0 A;  1VQM A;  3PV0 A;  3HOW H;  3CF5 A;  4GOP A;  1HZ9 A;  2IX1 A;  2E5L L;  1HNX L;  3UDI A;  3M4Q A;  3F2C A;  4ALP A;  1Y1V H;  1OXS C;  1SN8 A;  3OTO Q;  3CXC A;  4B3T Q;  1HNW Q;  2JE6 I;  1VQ4 A;  4BA1 I;  4DAM A;  4GKJ L;  3DM3 A;  5IYD H;  3CC7 A;  3GTL H;  1X56 A;  4DK6 C;  3PUZ A;  4A3L H;  4JC0 A;  3CCR A;  3KJO A;  2CWP A;  1KQS A;  1AH9 A;  1HNZ Q;  4JV5 L;  1I6H H;  1HZC A;  4LF5 Q;  1JJG A;  4DV1 Q;  1NMF A;  3F2B A;  2JA5 G;  1A8V A;  3RN5 A;  2K50 A;  2HHH Q;  3AYH B;  1QVC A;  2I5L X;  4DR3 Q;  1SMX A;  1C0A A;  3CCQ A;  1GKH A;  3T1H Q;  4B3M L;  1BBU A;  5LMN L;  1I94 L;  2DUD A;  2VQF L;  2PQA A;  3OW2 A;  3EIV A;  2E2I H;  3KLW A;  2Z6K C;  3J80 c;  4LFB Q;  1VQC A;  3D0F A;  3PUX A;  1E24 A;  1SLJ A;  4LF9 L;  2IX0 A;  4C2M H;  4WJ3 M;  4UY8 C;  1E1O A;  1WCM H;  1O7I A;  1I50 H;  1X6O A;  4IJL A;  3S1N H;  1X9N A;  1J5E Q;  1DGS A;  2A19 A;  4LFA L;  1N32 Q;  1SRU A;  1HZA A;  1Z47 A;  2JA8 G;  4B3T L;  3FHW A;  3OTO L;  4A3G H;  1HNW L;  4BBR G;  5HY6 A;  3GO5 A;  1SFO H;  2UU9 L;  4R4C A;  3HOV H;  2VY3 A;  5C0X I;  3A5Z B;  2N49 A;  5IP7 H;  3EN2 A;  1EFW A;  4A3D H;  1D8L A;  2LXK A;  1XJV A;  3PGZ A;  1JB7 A;  2I5M X;  2WB1 G;  4DV2 L;  1OXV A;  4J15 A;  1BBW A;  1NBW A;  3S16 H;  4GNX A;  3PUW A;  4TQU S;  2ES2 A;  1HNZ L;  4PG3 A;  3HOY G;  4LF5 L;  1EOV A;  1X65 A;  4DV1 L;  4EX5 A;  4DR3 L;  2ASB A;  3M4O H;  1Z9F A;  4YCW A;  3T1H L;  5M5X H;  3PF5 A;  3K80 C;  2IT1 A;  5C4J H;  4JI4 Q;  4UPA A;  1Q7Y C;  3GTO H;  2UXD Q;  1K8A C;  4GKK Q;  2ZJQ A;  1Y14 B;  1L0W A;  1PH1 A;  2VW9 A;  4OWW B;  1R9T H;  2MQH A;  1YHQ A;  1J6Q A;  2EIF A;  5IYB G;  4DPG A;  2JA5 H;  4HIK A;  3K8A A;  1VQE A;  2HIX A;  3EBE A;  4UP8 A;  3RZD H;  5C3E G;  4BXX G;  1V43 A;  2CWA A;  3KDF B;  1IL2 A;  1H95 A;  1VQA A;  3GTG H;  4PZ7 A;  1J5E L;  1GM5 A;  4YWK A;  4A3F G;  1N32 L;  1U5K A;  5AJ3 L;  1S72 A;  3STB D;  3H3V I;  2BH2 A;  3I4N G;  1XNQ L;  5ELN A;  1XMQ Q;  3RZO H;  2ZJP A;  2KCT A;  1BKB A;  2JA6 G;  1MKH A;  4OX9 Q;  3MXN B;  2E2J H;  2Y0S G;  3KF6 A;  2VUM H;  4OON A;  1Q46 A;  1Q8K A;  4IOA A;  1QZG A;  3JC6 6;  1MIU A;  4XIG S;  3RLF A;  1PYS B;  4JBW A;  1GVP A;  2JA8 H;  4IFD I;  3ERS X;  3K0X A;  5IYC G;  2HT1 A;  1PFS A;  1FL0 A;  5IT9 c;  4BBR H;  2IHE A;  4BY1 G;  4AIM A;  4HIO A;  1QVG A;  5E7N A;  1XNR Q;  3KYH C;  5LMN W;  1QUQ A;  5IP9 G;  4TVA B;  2JK8 A;  4YCU A;  4LUO A;  3HOU G;  4JI3 Q;  4JI4 L;  3HOZ G;  1JJC B;  2CQO A;  3J81 c;  3GTM H;  4BY7 G;  2UXD L;  4DR4 L;  3AQQ A;  4Y7N H;  4GKK L;  2AHO B;  3HOY H;  4HIM A;  1Q1E A;  2Q2T A;  4DUY Q;  3S2H H;  1KHI A;  4IOC A;  4QY7 A;  1VQN A;  4DV4 Q;  4DR5 L;  1GD7 A;  3I7F A;  1FJG Q;  3K7U C;  2NVX H;  1E1T A;  1I3Q H;  1HH2 P;  2VL6 A;  1YJ9 A;  2F4V L;  4O2D A;  4K0K Q;  1VS0 A;  2KHJ A;  1VQD A;  2ZTE A;  1XMQ L;  2K5V A;  3CCM A;  1CSP A;  4NXM Q;  2IY5 B;  1IYJ B;  4JI0 Q;  2NN6 G;  3SGI A;  5IYB H;  3HOV G;  4A3D G;  1L1O A;  4DV5 Q;  1HR0 Q;  5C3E H;  4BXX H;  1JE5 A;  2PMZ E;  3ZJY C;  1PH4 A;  1P8L A;  4KLK A;  3U4Z A;  4A3F H;  1EUJ A;  3TRE A;  3G71 A;  4JI5 Q;  3RLO A;  1MJE A;  3I4N H;  1TWA H;  3Q8D A;  2EQS A;  5JJK A;  2YTV A;  3U50 C;  2JA6 H;  1SRO A;  2B29 A;  2WP8 J;  3NBH B;  1NJI C;  4YHH Q;  5FJ8 G;  3JAM i;  3CC4 A;  2JQO A;  2OQK A;  1OTC A;  4BA2 I;  4POF A;  4RMF A;  2MNA A;  5C0X J;  5M5W H;  1A63 A;  4C3I H;  4L5Q A; 
#chains in the Genus database with same CATH topology
 1W3S A;  5IYC H;  3HOU B;  3FVQ A;  4JI7 Q;  4A3K H;  1WI5 A;  5EJW A;  4BY1 H;  3UI2 A;  4BY7 B;  3D6W A;  4DV4 L;  1IL8 A;  5KIX A;  3GTP B;  3ITP A;  3M9B A;  4ABN A;  4FXD A;  3DHQ A;  1T5X D;  1N34 Q;  1DOM A;  4DK0 A;  4K0K L;  1OXX K;  2A68 D;  3I8Z A;  4XTC S;  4RA8 A;  1QIL A;  2EYJ A;  2MPM A;  2Q2I A;  4MTK A;  4MNO A;  3CPF A;  4JOI C;  1LTR D;  4DV5 L;  1ASZ A;  1NY4 A;  4DV7 Q;  5DNF A;  1VF5 C;  2XTI A;  3TME A;  5ELD A;  4ILW A;  4AH6 A;  1EQT A;  3PCO B;  1WTV A;  1G8Z D;  3HP3 A;  1C9O A;  3I73 A;  1HA5 A;  1ESF A;  1WFQ A;  5GRO A;  5C0X G;  4A3I G;  1HFG A;  3T1Y Q;  2A6H C;  1X3F A;  1NR4 A;  3IRB A;  3NUC A;  5JJI A;  1IBL L;  2CKZ B;  4QMG A;  2RBM A;  4A3J B;  1Q90 A;  5COY A;  1EEF D;  2Z8L A;  4J1M A;  5M9O A;  1CZW A;  1RIP A;  3TZD A;  4WRD A;  1QWY A;  2Z6K A;  3ICE A;  4DR7 Q;  1KRT A;  2WAQ E;  3MHB A;  2CH4 A;  1B3A A;  1K28 A;  5C4X B;  2C9O A;  1FR3 A;  1FVI A;  2PNR C;  2JEB I;  4UP9 A;  4X64 Q;  4L5T A;  1EWI A;  1XXG A;  2OT2 A;  1TWC B;  1M1K C;  2KCM A;  3I56 A;  5CV6 A;  4DR2 Q;  3WOF A;  4X3S A;  2P5Z X;  3BYY B;  2ZJR A;  2QEX A;  4A3K G;  1STE A;  2NTS A;  4KHV A;  2VXW A;  1QUQ B;  3S1R B;  5M3M G;  4R4O A;  3IAY A;  5KND A;  2B39 A;  2K33 A;  3CAM A;  1GJX A;  1AN8 A;  3H0G B;  4YY3 Q;  4NPS A;  2XIW A;  1CQV A;  1SNO A;  2JJQ A;  3ULJ A;  5FO8 B;  1YJW A;  1GUN A;  3KOJ A;  1HA6 A;  3ULP A;  2L0C A;  2K5Q A;  5DEH A;  3TP7 A;  4KHP Q;  5LMU L;  2NVT B;  5ELE A;  3FKI B;  1JWU D;  4L5R C;  2VZA A;  1EYA A;  3SDZ A;  2HIV A;  2N78 A;  4GOP B;  1FYC A;  4KV6 A;  4KJO A;  4KKU A;  1F9R A;  2F0S A;  4K5V A;  3A0J A;  3IFD A;  1UE1 A;  1SND A;  2KED A;  4JI3 L;  2Z0S A;  2DGY A;  1KNE A;  1I4Q A;  3UDG A;  4L63 B;  3Q22 A;  3L3O C;  5C3W A;  2Z1C A;  4OO1 G;  5E4X A;  3DWP A;  1EWH A;  3RR5 A;  2F0G A;  1Q8I A;  1BXT A;  3S2D B;  3TRZ A;  1PRT B;  2K6A A;  1YIT A;  1K8M A;  2B2V C;  5TSS A;  3CME A;  2BA1 A;  1BBX C;  5HUR A;  4C3J G;  1UAP A;  1K9M C;  1LLR D;  1PMR A;  3H15 A;  2KEN A;  2E76 C;  3HRZ C;  4H0L C;  2ZTD A;  2K7V A;  5C6A A;  2K5H A;  1XYI A;  3QB3 A;  5DLQ E;  4DFA A;  1F2L A;  4DR1 L;  2E2H H;  2UXC Q;  5CBE E;  2IHF A;  2UUB L;  3R2T A;  1CT1 D;  1L2F A;  1BCP D;  5E3F A;  4B08 A;  4A3B G;  2GN5 A;  4RG1 A;  5JEA H;  1LM0 A;  2EYL A;  2WB1 E;  1STY A;  2AQ1 B;  4XYO A;  4IFD J;  4NXN Q;  3GTK H;  5KNC A;  1XNQ Q;  1TVX A;  2ZXR A;  2F0F A;  2ICI A;  5EPL A;  1EY5 A;  3V05 A;  4A3J H;  2OCE A;  2KHI A;  3GTJ B;  2F0Q A;  4ZKB B;  4V19 0;  2F4I A;  3CCL A;  1RL2 A;  4TRD A;  2B2W C;  1EYG A;  2ZT9 C;  3Q24 A;  3NBI A;  3VYR A;  3PO3 G;  2FMC A;  3H09 A;  1A0I A;  3DLL A;  1Y8O B;  4BBS G;  2WAQ G;  3LWE A;  1EY0 A;  2XN9 C;  1EY4 A;  2ZXP A;  1K83 B;  3D8G A;  3F1Z A;  4Y52 H;  1AEX A;  5I9P A;  3NK9 A;  2Y0S E;  5LHY 1;  4DR5 Q;  1N33 L;  5D3D A;  2EYH A;  2G9H D;  3Q0A A;  2F4V Q;  4KY7 A;  4B3S L;  4K8I A;  4KK7 A;  4LK1 C;  2K5N A;  2VNU D;  1VQ6 A;  1SMY D;  1B4O A;  2R93 B;  1LT6 D;  3ZYY X;  1PH9 A;  2I07 B;  4JCV E;  4JI1 Q;  4GOP C;  1Q86 C;  2JN4 A;  5BR8 L;  1KNA A;  2PQE A;  1XTC D;  4F8M A;  1AE3 A;  3UE0 A;  4HMI A;  4XT1 B;  1E22 A;  5JJZ A;  5IWA L;  4GKJ Q;  3FEW X;  2RCN A;  2ZTC A;  1ASY A;  3CQZ H;  4HJ7 A;  4IUT A;  4PNY A;  5HGT A;  3P1H A;  3C1F A;  2PNH A;  1SYC A;  4DV6 L;  4CJ0 B;  4DAY B;  3W1B A;  1X54 A;  3OIP A;  1YNN C;  3CW2 C;  4PMC A;  1QCB D;  4A3M H;  1SE2 A;  1STH A;  2VS1 A;  4B3M Q;  4HTH A;  4PZ8 A;  4PZ6 A;  1NR2 A;  4LJZ C;  2A1A A;  3VR2 A;  1SYG A;  2MHV A;  1LO5 D;  2OQ0 A;  4MZ9 A;  3J81 j;  2NVY H;  2VQF Q;  3EVQ A;  1VQ9 A;  2IWH A;  3PUY A;  4LAA A;  1PRT C;  4HID A;  2Q2H A;  5C44 H;  4LF9 Q;  1E2Z A;  2IL8 A;  3ERO A;  1NE3 A;  3FDT A;  4X65 L;  5CC4 A;  4R8I A;  1PH6 A;  4JI8 L;  4CHT B;  3QG1 A;  5I9O A;  1VQM A;  3HOW H;  1R4Q B;  3SK4 A;  4ALP A;  1S5D D;  2Q8R E;  3M4Q A;  1Y1V H;  1OXS C;  1SN8 A;  4B3T Q;  2JE6 I;  5I6Y A;  1SNC A;  2EJG C;  4I65 A;  3GTL H;  3NPP A;  4DK6 C;  1PFM A;  2DNC A;  2L9H A;  1F2Y A;  4UHV A;  1M4V A;  3TP6 A;  2TSS A;  5A2Q L;  1PTO D;  4DV1 Q;  4ZLT F;  1ENF A;  3F2B A;  3RN5 A;  2I5L X;  3T53 B;  1ZYR C;  3T1H Q;  3FPP A;  5LMN L;  2N55 A;  1TQO A;  2PQA A;  1MI2 A;  1X3Q A;  2Z6K C;  2C5C A;  2Z4I A;  4ULL A;  3S1N B;  1ILQ A;  2QIL A;  1A15 A;  1QE6 A;  4UY8 C;  1WCM H;  1X6O A;  3HG9 A;  1N32 Q;  4BBR G;  2B2Y C;  2O5J C;  3S16 B;  2EDG A;  4R4C A;  2VY3 A;  1PTO H;  5C0X I;  3K5O A;  5IP7 H;  2F0L A;  3EN2 A;  3HOV H;  4A3D H;  1XJV A;  1JB7 A;  1MGS A;  1IKM A;  2I5M X;  2WB1 G;  3TP8 A;  4J15 A;  1BBW A;  1B50 A;  3OSO A;  4GNX A;  3M4O B;  2ES2 A;  4EQN A;  1JOO A;  3U9S A;  3ND8 A;  3DEP A;  2WAC A;  5M5X H;  2IT1 A;  4JI4 Q;  4V0B A;  5IT9 E;  3C46 A;  1K8A C;  4GKK Q;  2ZJQ A;  1Y14 B;  2VW9 A;  5CGK A;  1O7Z A;  3GTG B;  1J6Q A;  2L5T A;  2JA5 H;  4DPG A;  4NDX A;  3A56 A;  1KLG D;  3RZD H;  1H9S A;  4BXX G;  2B2T A;  1V43 A;  2B2U A;  5IGB A;  1WTW A;  1J5E L;  4A3F G;  2I46 A;  3H3V I;  4RHS A;  5ELN A;  5IGD A;  2RKS A;  2ZJP A;  3KLS A;  2JA6 G;  2Y0S G;  3KF6 A;  1ILP A;  4Z9C B;  1QNU A;  1MIU A;  4XIG S;  1EFI D;  4JBW A;  2GA4 B;  4IFD I;  3K0X A;  2HT1 A;  1BOS A;  5IT9 c;  1A2T A;  1FNW A;  4AIM A;  4HIO A;  1QVG A;  4HN7 A;  3KYH C;  5LMN W;  5EKK A;  1TS2 A;  4TVA B;  1O80 A;  4JI3 Q;  3HOZ G;  2CQO A;  2BE5 D;  4L8J A;  2AHO B;  3NXW A;  1S5E D;  2Q2T A;  1W6K A;  1KHI A;  1EU4 A;  4QUC A;  1VQN A;  3I7F A;  1W6J A;  3VR6 A;  4NMZ A;  3MEH A;  2HD3 A;  2ZTE A;  4PMB A;  1CSP A;  2IY5 B;  1IYJ B;  1EWC A;  3JAM L;  4JI0 Q;  3HOV G;  4A3D G;  3I4N B;  1L1O A;  5C3E H;  2PMZ E;  2JSO A;  5C4Z A;  4XQJ A;  4KLK A;  2A6E D;  2FJ2 A;  3HEJ A;  4JI5 Q;  5IGE A;  5E1F A;  2EQS A;  5JJK A;  1YNJ D;  4IZ8 A;  1OTC A;  4Q0F A;  1E2V A;  4A3K B;  1QJO A;  4BY1 B;  2WV6 D;  4RMF A;  1A63 A;  4C3I H;  4A3E G;  4KMU C;  3CCS A;  5CBA E;  1GO3 E;  1NAP A;  2HDL A;  4DUY L;  1YI2 A;  3M3Y H;  1EZ8 A;  1WTO A;  1EY8 A;  5IP9 H;  2GVB A;  4OO1 I;  1VCI A;  4GN5 A;  3HKZ E;  4QB4 A;  2RA4 A;  5IGC A;  2K14 A;  4NXM L;  4DAP A;  2JA7 G;  5D14 A;  4FDB A;  2KOL A;  1L0Y B;  2RVL A;  3QIA A;  1MD2 D;  4DV0 Q;  2ALY B;  4FF1 A;  1VQI A;  1PXU A;  2CQA A;  1V8Q A;  1XPU A;  4ZYS A;  3FRP B;  4KY6 A;  2B63 G;  1BDO A;  1B7Y B;  1N9W A;  1JMC A;  1YHB A;  3I4M G;  1EOT A;  4LF4 Q;  3PIP A;  2EPB A;  4RGT A;  1F9Q A;  4IPD A;  4ZCK A;  4YWL A;  1A62 A;  4X62 Q;  3E5S A;  2A69 D;  1F9S A;  1CQF A;  3GDE A;  2AWN A;  4JVZ A;  2F0W A;  2BH8 A;  4WJW A;  4F7X A;  4LFC Q;  5FJ8 H;  1S3O A;  2JA9 A;  2V1C C;  3DWA A;  4DK3 C;  3EQL C;  1KXL A;  1V9P A;  3I72 A;  4LFB L;  2QGQ A;  3K5L A;  2N3S A;  4C3H H;  2NB0 A;  1IBM L;  2YV5 A;  2K1B A;  1YEZ A;  4EQ5 A;  3HKS A;  4RFB A;  2R7Z G;  4IUR A;  4K5X A;  5IWA Q;  2LSS A;  4JK1 C;  3A5U A;  4O0A A;  1EEI D;  1TWH H;  4P71 A;  4UDU C;  3LX0 A;  3IFT A;  1PA6 A;  4H02 A;  1SNQ A;  5T1G A;  4R4Q A;  2OTL A;  1QVF A;  3P75 A;  1V1Q A;  3OHX C;  3U4V A;  1B44 D;  4KKT A;  3TS2 A;  2MP1 A;  3R8B A;  1I5F A;  3I91 A;  2K75 A;  2IPK D;  2K04 A;  5C0X H;  4A3I H;  4A3B B;  1OXU A;  3S24 A;  3TBI B;  2B3G A;  3J7Y W;  3MFY A;  4JBJ A;  4OWT B;  5ELC A;  3AFQ A;  1G29 1;  3C2P A;  2PO4 A;  4A4I A;  1SNP A;  1KDB A;  4CKC A;  5LL6 S;  1D2B A;  3MA2 B;  4DAV A;  3I90 A;  4HJ5 A;  1H9J A;  4AQY Q;  2IJ0 A;  1U4P A;  1CKN B;  4ME3 A;  2O2L D;  3EFX D;  1L1O B;  2F3W A;  1DXM A;  3M4P A;  3S17 H;  2UUC Q;  4ZAI A;  3NTH A;  1IZ6 A;  3T56 B;  3S9W A;  1U9R A;  2CW0 C;  4OXP A;  1S40 A;  4LF7 L;  1LTB D;  1I6V C;  3K7A H;  2ZM6 Q;  4RCO A;  2VQE L;  4QL5 A;  4O42 A;  4DK1 A;  1HUM A;  3M85 A;  4DV3 Q;  4LF8 L;  1AP0 A;  1B53 A;  2L55 A;  1EQV A;  2NN6 I;  3J80 i;  5C4H A;  1SJH D;  1E7Z A;  2LS0 1;  4C3H G;  4GLX A;  4JW0 A;  2PW5 A;  1D6E C;  5T1I A;  2BA0 A;  1SE3 A;  5M3M H;  4X6A H;  2K03 A;  1EQR A;  1EQQ A;  2YU9 H;  2E74 C;  2J0T D;  3NBH A;  3HOX G;  1ML0 D;  1HFN A;  2D5D A;  4IPH A;  4A76 A;  1PH7 A;  4A3C G;  4GNX C;  2CFM A;  1G51 A;  1KL9 A;  2LY7 A;  3NEN A;  2CCZ A;  1BF4 A;  3HKZ G;  3W2D A;  1G6P A;  1JT8 A;  2E2H B;  2MJ8 A;  1D5Z C;  3VDY A;  4QF4 A;  1K8G A;  4JI6 L;  2N8N A;  3KF8 B;  4XDX A;  1Y1W G;  1VQK A;  2K32 A;  1JCK B;  1FGB D;  4GLV B;  2SNS A;  4LF6 Q;  3UE1 A;  1AW7 A;  3CD6 A;  2K01 A;  4HJA A;  2B2T C;  2BDN A;  1DOK A;  3I4O A;  3GTK B;  3BZC A;  2F52 A;  1VQ5 A;  2UUA Q;  1GOZ A;  4B9X A;  4L5S A;  3M7G A;  4R8N A;  2RHQ B;  4CBV A;  5FLX E;  1HTL D;  4HJ8 A;  3MEF A;  4TKO B;  4DR6 Q;  1JE4 A;  1SXT A;  2NBF A;  3PIO A;  2XWB B;  3S1Q H;  4RGO S;  1DD2 A;  3J81 L;  5K36 G;  2B8G A;  3NQI A;  4OO1 H;  1SE8 A;  1SSO A;  5CV7 A;  2FIN B;  2PI2 E;  1N36 L;  4JI2 Q;  3UDF A;  4CGY B;  4QIW B;  1H9K A;  1CK1 A;  3BJU A;  3CC2 A;  3ER0 A;  4A93 G;  4C3J H;  2Z9H A;  3UDX A;  5J39 A;  1Q12 A;  1IBK Q;  1UE6 A;  1DON A;  3K0Y A;  1GUG A;  4IFD G;  1X3E A;  3G4S A;  4N8F A;  4ZUJ A;  1K73 C;  1TWG H;  1C7Y A;  5FLX c;  1XMO L;  1B2T A;  4B3R Q;  4IO9 A;  4MIU A;  5K5P A;  3J7A 5;  4JYA L;  1GUO A;  3MXN A;  3VYT A;  1L1O C;  5IYD G;  4A3B H;  4BA2 I;  2K4K A;  4X66 L;  5IE8 A;  5M5Y H;  1E0B A;  3GV3 A;  2E5L Q;  1HNX Q;  3CQZ B;  1Y8N B;  4X3T A;  4G7O C;  1CSQ A;  4H13 C;  1KDA A;  1PYW D;  2KUM A;  3GTM B;  2YTY A;  4HJ9 A;  1VQP A;  1GUW A;  3GV6 A;  1C4Q A;  4XQN A;  4A3M B;  3D31 A;  3SVM A;  1JOK A;  1BVS A;  3PQI A;  2RF4 A;  1FGU A;  3DMU A;  3ERQ A;  1XPO A;  3PO3 H;  2NVY B;  2R6G A;  1RJT A;  4QGU A;  5EKI A;  1BUV T;  4BBS H;  4YIJ A;  2KEE A;  5C44 B;  4CKB A;  3CP0 A;  1MSG A;  3I70 A;  1TWF H;  4A3G G;  4DUZ L;  3HOW B;  1TU2 B;  4APV A;  5CMD A;  2EY2 A;  5EPJ A;  5BN4 A;  1LTS D;  2M2L A;  1Y1V B;  2UXB L;  4KHZ A;  2VB3 X;  3J80 E;  3PV0 A;  1HZ9 A;  2IX1 A;  4RGM A;  2Y0S B;  3GTL B;  1HNW Q;  1CZG A;  3LWU A;  4DAM A;  1MBY A;  3SK5 A;  2EY1 A;  2HCI A;  1X56 A;  1HRJ A;  3PUZ A;  3KBX A;  4C56 C;  4QUF A;  3K5N A;  3CCR A;  3KJO A;  1KQS A;  1HNZ Q;  4LMQ D;  4JV5 L;  1HZC A;  4LF5 Q;  1A8V A;  3K59 A;  1CFM A;  4DR3 Q;  1C0A A;  1A3V A;  3CCQ A;  1I94 L;  1ICF B;  3EIV A;  3IL8 A;  4RKB A;  1WCM B;  3J80 c;  3DUZ A;  4LFB Q;  1VQC A;  3PUX A;  5JVG 3;  4C2M H;  3KLS X;  4WJ3 M;  1K0S A;  3NSW A;  4G7Z C;  1O7I A;  1DGS A;  3HOV B;  1PTO B;  1ROD A;  4A3D B;  1I4P A;  2JA8 G;  2E75 C;  1CHQ D;  1SNM A;  3OTO L;  2XRS D;  1EYD A;  3BZD B;  1SFO H;  2NN6 H;  2UU9 L;  3X3N A;  3A5Z B;  1EFW A;  1G91 A;  2LXK A;  3PGZ A;  1CA5 A;  1STN A;  4DV2 L;  4JPB W;  1NBW A;  3PUW A;  1V1P A;  5M5X B;  3HOY G;  2QEJ C;  1EOV A;  1X65 A;  3M4Y A;  1Z9F A;  3PF5 A;  4N8X 1;  2OEO A;  2JA5 B;  2IW3 A;  3RZD B;  2RSN A;  1EL0 A;  1PH1 A;  3BDL A;  2MQH A;  1YHQ A;  5IYB G;  1WTH A;  1Q3L A;  2HIX A;  4UP8 A;  2QKI C;  1Y69 U;  1U5K A;  3STB D;  3SK8 A;  1SDF A;  2BCO A;  2DY7 A;  3RZO H;  1SMY C;  3MXN B;  4RH6 A;  2VUM H;  1EU3 A;  1GVP A;  2KQ3 A;  2ENB A;  1AZP A;  1PFS A;  4BBR H;  1KDC A;  2JK8 A;  4GZY C;  3HOU G;  5G3L F;  3GTM H;  4BY7 G;  2UXD L;  5KYL A;  3AMU A;  4DR4 L;  1HTP A;  3R2I A;  4DV4 Q;  3NTK A;  5IGG A;  2NVX H;  1E1T A;  1J9O A;  4K0K Q;  1PZK D;  5C5M A;  5C3E B;  1JQY D;  1XMQ L;  3CCM A;  2FHT A;  2NN6 G;  4DV5 Q;  4BXX H;  1EIG A;  3ZJY C;  5KRU A;  4A3F H;  3U4Z A;  1D5X C;  4ID6 A;  3TRE A;  2Z4H A;  1MJE A;  2YTV A;  5J1Z A;  2JA6 H;  4FO2 A;  2B29 A;  4C3I B;  3CC4 A;  1HQM C;  2XRQ D;  3M3Y B;  2MNA A;  3CCU A;  2ASB A;  5M5W H;  2OF1 A;  2FFK B;  2TMP A;  1IBL Q;  1JWS D;  2EYF A;  1PTO C;  1XPR A;  2K28 A;  5A35 A;  3HOZ H;  3OMG A;  5C4X G;  1D1K A;  3VR4 A;  3OPO A;  1K0R A;  3GP7 A;  4J8Q A;  4PQX A;  1LTT D;  1VQG A;  2VUM G;  1RF2 D;  1U4L A;  3P20 A;  3L0O A;  1NTG A;  1SYE A;  5GAE C;  2PCF B;  2RDF A;  4HMJ A;  3E0J A;  3G6E A;  1WTQ A;  1H9M A;  1CA6 A;  1G2T A;  3CHB D;  4UAI A;  4YHH L;  3J7Z C;  1VQJ A;  3MZ5 A;  5NUC A;  1U4M A;  2A8V A;  3D6C A;  2AQ3 B;  2XGT A;  4IPG A;  1SJE D;  1TT2 A;  5FLM G;  2PMZ B;  2OTJ A;  4JI7 L;  4PV1 C;  3G6J B;  3HFZ B;  3H0G G;  1M90 C;  4NB3 A;  4C3H B;  1VQO A;  1N34 L;  1LT3 D;  2LXJ A;  5JAV A;  4A3E H;  2F0U A;  4C1N K;  1ZEQ X;  2M9V A;  1DZ1 A;  3NE5 B;  4HAE A;  5IGF A;  3CCE A;  1TWH B;  4KY5 A;  3OWF A;  4R1J A;  1O7Y A;  2L15 A;  3FKI G;  1PV4 A;  1Z6H A;  1CTM A;  2K52 A;  5LMU Q;  1YZ6 A;  1ZXT A;  1HUN A;  2JA7 H;  1HJP A;  3L9A X;  1QG7 A;  2H5X A;  3BZK A;  1GHJ A;  3T1Y L;  4JG2 A;  1YHA A;  2WIN B;  4P74 A;  3BVM A;  4OWX B;  1GHK A;  1FD7 D;  1IW7 D;  3FP9 A;  2KHS A;  3CMA A;  1B1Z A;  4A3I B;  1KAB A;  4RCN A;  4L6T B;  3OYY A;  4CKE A;  2BDO A;  2L11 A;  2B63 H;  3DEO A;  2F0M A;  1YBY A;  3RMH A;  1NNX A;  5JEA J;  3I4M H;  1L0X B;  2F0N A;  4DUZ Q;  2EOT A;  1WJJ A;  1XTD A;  4ZRZ A;  2L12 A;  5CYU A;  1VQB A;  4DR7 L;  2F0P A;  1B9M A;  1HR0 W;  3NWT A;  3TP5 A;  4XXE A;  4LUZ A;  1YJN A;  3QWN A;  1PRT F;  2X6G A;  3S15 H;  1ZKO A;  2BOS A;  1TS3 A;  3S17 B;  1Q82 C;  4AYB E;  4KN7 C;  4X64 L;  2R92 H;  2AKW B;  4OX9 L;  5FK9 C;  3SE0 A;  3F8T A;  2R7Z H;  1K3R A;  1C8C A;  3K7A B;  1X3P A;  4H44 C;  3A74 A;  2F0I A;  4MTN A;  1NMG A;  1U0L A;  1YNJ C;  2K5W A;  4IPC A;  4LUV A;  1TXY A;  4DR1 Q;  2PI2 A;  3BS1 A;  1VF7 A;  4OHJ A;  4WJ4 A;  2UUB Q;  2EXD A;  4I7A A;  4YY3 L;  5M3M B;  2VB2 X;  1IXR A;  5C3X A;  1F9P A;  2KEC A;  1LYL A;  1TY2 A;  2F0O A;  3BDC A;  3BU2 A;  2YU9 B;  4GLA C;  2AMC B;  2HDM A;  2QF7 A;  2PQA B;  3NTI A;  2JEA I;  2UU9 Q;  4KHP L;  2D0P A;  2JYO A;  4DV2 Q;  1EY7 A;  1KIX A;  1LTI D;  4OIJ A;  5LL6 X;  2QA4 A;  5M3F H;  3S2H H;  5FKA C;  4P72 A;  1CKO A;  3H6M A;  5EGT A;  1LTG D;  4RHR A;  1OXT A;  3CRL C;  3I4L A;  2D62 A;  3D4D A;  4YWM A;  1X55 A;  3AEV A;  4IUP A;  3PO2 H;  5HGQ A;  1LT5 D;  2FXQ A;  2C35 B;  4EQP A;  4GNX B;  2G5D A;  1VMP A;  2UXC L;  2YTX A;  1N33 Q;  4C1N I;  2A69 C;  2D0O A;  2R93 G;  4B3S Q;  1I4G A;  5JJL A;  1ONL A;  3WDN A;  5IT9 L;  3S1Q B;  3S14 H;  5BR8 Q;  2R92 G;  1TS4 A;  4HCS A;  5ELB A;  2B2V A;  1H9S B;  2DJG C;  4P75 A;  3CRK C;  3I55 A;  1WOC A;  4RKL A;  2RDG A;  3HOX H;  1E2W A;  4C3J B;  3W5O A;  2ID0 A;  5GAG C;  1WTP A;  4A3C H;  1SYD A;  2EXZ A;  2PYK A;  3KF6 B;  1OO9 B;  4DR4 Q;  1GUT A;  2ZXO A;  1CUK A;  3O13 A;  3QO2 A;  3RD4 A;  1TWG B;  4RWS C;  3T13 A;  4DV6 Q;  2ATW A;  1SYF A;  4DN4 M;  4DU9 A;  5D3I B;  3A8K E;  1H9R A;  1Y1W H;  5DM6 3;  4NXN L;  1EY9 A;  2V4D A;  3E9H A;  2F3V A;  2M00 A;  4BS9 A;  5M5Y B;  2D9U A;  1DM0 B;  4CDF C;  3H3V C;  4EQO A;  3ULL A;  1M8A A;  5JPM C;  4X65 Q;  5IIF A;  4K14 A;  2Q2U A;  3RNU A;  4JI8 Q;  2SEB D;  2KBN A;  4A3L G;  4ZUI A;  1YIJ A;  4HED A;  4M1U B;  5I6W A;  1U4R A;  5M3F G;  1WD0 A;  4QQB X;  3W1G A;  2NUC A;  3CCV A;  2LFN A;  1FNU A;  4FNF A;  1B3Q A;  3K58 A;  3PO3 B;  4JBK A;  1X32 A;  5K36 H;  4BBS B;  4TSS A;  3PO2 G;  1S5C D;  2WAQ B;  3PMF A;  4IJH A;  3S1M H;  3A7L A;  1HPC A;  3H3V H;  5E4W C;  3U58 A;  4MHE A;  1TWF B;  3CPW A;  1KAA A;  2NVQ H;  5LMN Q;  4AYB G;  3R3O A;  1YNX A;  1LTL A;  4A93 H;  2A5H A;  5EQ0 A;  4CDC C;  4FF4 A;  1P16 A;  1BR9 A;  4IFD H;  4JI1 L;  2WKC A;  2DJF C;  3MAQ A;  2EJM A;  4KI0 A;  4GOP A;  2DNE A;  1XX8 A;  1G2S A;  3UDI A;  3F2C A;  2F0H A;  1VQ4 A;  4GKJ L;  3DM3 A;  3KK7 A;  5IYD H;  2A68 C;  4N9T A;  2ICE C;  3CC7 A;  1ET6 A;  4H7B A;  2K5D A;  4Q5V A;  5KGU A;  4FF2 A;  1I6H H;  1EIH A;  5CV9 A;  1JJG A;  2A73 B;  1NMF A;  2K50 A;  1QVC A;  3AYH B;  4OL7 A;  4E6I A;  4B3M L;  3MFG A;  2VQF L;  4C2M B;  3OW2 A;  2E2I H;  1T5E A;  3RUZ A;  3J7A V;  3D0F A;  4LF9 L;  2IX0 A;  2Q8I B;  2B2U C;  1I50 H;  1PDQ A;  1WTX A;  3LNN A;  1X9N A;  3K5M A;  4IUN A;  3SEB A;  2A19 A;  1SFO B;  1J5E Q;  4LFA L;  1HZA A;  1Z47 A;  4B3T L;  3FHW A;  4A3G H;  1WVL A;  2DY8 A;  2A6H D;  2N49 A;  3ONA B;  1D8L A;  5CR3 A;  5FO9 B;  3D4W A;  1BCP B;  1STA A;  1HQR D;  4G7H C;  3BVG A;  4DV1 L;  1ENC A;  4NKL A;  4EX5 A;  1BQQ T;  3T1H L;  1TR5 A;  3K80 C;  4XYQ A;  5C4J H;  3GTO H;  1K3B C;  5F2D A;  1L0W A;  2EZV A;  4OWW B;  1IHZ A;  3QR8 A;  4HIK A;  2EYO A;  3EBE A;  3F2U A;  3RZO B;  3BDO A;  1TII D;  1H95 A;  5CV4 A;  4PZ7 A;  1GM5 A;  1AFP A;  4YWK A;  1N32 L;  5AJ3 L;  1Y8P B;  1TKW B;  1S72 A;  3I4N G;  2VUM B;  2J4X A;  1B9N A;  2KCT A;  3G7L A;  1MKH A;  4OX9 Q;  2B2Y A;  2E2J H;  2SOB A;  1Q46 A;  1Q8K A;  2HUG A;  5C5L A;  3URY A;  3IKJ A;  4BBR B;  4IOA A;  3JC6 6;  1CI3 M;  1PYS B;  2AQ2 B;  2JA8 H;  5IOC A;  3ERS X;  5IYC G;  5JOB A;  2WB1 B;  2IHE A;  4BY1 G;  5DAU A;  5E7N A;  1S5B D;  4HCE A;  1CM9 A;  4JI4 L;  2X69 A;  2AUK A;  3AQQ A;  4Y7N H;  4GKK L;  4FYD A;  2QCP X;  3HOY H;  2NVX B;  4HIM A;  1Q1E A;  4DUY Q;  1DCZ A;  3A7A B;  4QY7 A;  1RDP D;  3T16 A;  3K7U C;  4F87 A;  1I3Q H;  1HH2 P;  2VL6 A;  3KLR A;  4O2D A;  2KHJ A;  1DYQ A;  1EYC A;  1RHP A;  2K5V A;  4NXM Q;  4IUV A;  3BVZ A;  4A3F B;  3SGI A;  5IYB H;  5G3L D;  1JOR A;  2J7Z A;  5CV8 A;  1JR0 D;  5I4D A;  4DAY A;  1PH4 A;  2JA6 B;  5D65 A;  1EUJ A;  4DA2 A;  1TWA H;  3Q8D A;  3TSS A;  1DJR D;  4RGN A;  2F0K A;  1SRO A;  5M5W B;  3NBH B;  1NJI C;  3JAM i;  4OEL B;  3VYS A;  4HSP A;  3VR5 A;  5C0X J;  4L5Q A;  3GTQ H;  3OIQ A;  2B8F A;  3KUP A;  3HOZ B;  2F03 A;  3HGB A;  3F2D A;  1KAW A;  3BG3 A;  3HOU H;  2QDB A;  1N8R C;  1STG A;  2K05 A;  5J22 A;  2R7D A;  4QIW E;  4UP7 A;  1PHJ A;  4BY7 H;  4GN4 B;  3AFP A;  3HS0 C;  3GTP H;  4KKS A;  2EE1 A;  1D7Q A;  4IUU A;  4JI0 L;  1IBM Q;  1BCP C;  1K8O A;  2SDF A;  3BYT B;  3N6R A;  5A2Q E;  1RD9 D;  1FNV A;  2AWO A;  4DNI A;  4LW1 A;  4X3K A;  4JI5 L;  5KNB A;  1QNK A;  1TY0 A;  1LT4 D;  1BO0 A;  2KCN A;  5EAY A;  3TZU A;  1WTR A;  1PH2 A;  5FLX L;  1UE5 A;  3TEH B;  2KCC A;  3E9I A;  3CKI B;  1EIY B;  5CV5 A;  5EKL A;  1SEB D;  1BNZ A;  4CDD C;  3FMC A;  2Q8T A;  2H4O A;  2HHH L;  4A3E B;  1B70 B;  1HCZ A;  3PUV A;  3T4A C;  1G6Z A;  1F77 A;  3I2Z A;  1Q81 C;  4DGZ A;  1RKN A;  2NZO A;  2L4N A;  5EPK A;  1B8A A;  1LAB A;  2XNA C;  2EY6 A;  1PH8 A;  2MFI A;  1MHW C;  1CKM A;  3SR1 A;  3H94 A;  2JA7 B;  4DV0 L;  1LTA D;  4R4T A;  5C4X H;  1QZH A;  3STB C;  2A74 C;  3PSI A;  3KJP A;  5GAD C;  2CVR A;  4ZQ3 A;  1HXY D;  2KJX A;  5GAH C;  2FMM A;  4LF4 L;  2RDH A;  2B63 B;  2I5H A;  3PIP 3;  2SNM A;  1KD1 C;  3I4M B;  3WWV A;  4X62 L;  1TWC H;  4LF7 Q;  2E8G A;  3MC0 B;  4LFC L;  4GS3 A;  2VQE Q;  2G9D A;  2LMC B;  2MUY A;  1T9H A;  3X3M A;  4F88 A;  2WFW A;  3L2P A;  4LF8 Q;  5J3B A;  4XQQ A;  1PYB A;  3TDQ A;  1JWM D;  3S1R H;  4B9W A;  5FLM H;  1S4Z A;  4ZK9 B;  2WII B;  3S15 B;  4KJN A;  5GQO A;  1C48 A;  3H0G H;  2R92 B;  1YVC A;  1PH3 A;  1PVO A;  3G48 A;  2PZW A;  2MO1 A;  2R7Z B;  5AFW A;  1RTO A;  1VQL A;  2NVT H;  4ZKC B;  2I0Q A;  5FO7 B;  1YNN D;  5I2Y A;  3J80 L;  3VA7 A;  3LGJ A;  3FKI H;  1Z7T A;  3T51 B;  5EBD A;  5JEA G;  4JI6 Q;  3GD7 A;  4NP5 A;  5DM7 3;  4IAL A;  1XNR L;  4K6D A;  1UWV A;  1PRT D;  2R3Z A;  3D4R A;  4R9W A;  3JAM E;  3FPU B;  2F3I A;  3W3A A;  2YYZ A;  3RN2 A;  1Q1B A;  2XVS A;  3E6Z X;  4LWC A;  4A3J G;  4P2C B;  4K2K A;  2E2D C;  3AU7 A;  1VQF A;  3WOE A;  4LFA Q;  2PPB C;  1FJG L;  1VQH A;  4EGV A;  3B6Y A;  3ND9 A;  1VQ8 A;  4LNQ A;  3OOC A;  1W2B A;  2CHB D;  1WYD A;  4AQY L;  1A3U A;  1LV9 A;  4HSV A;  3S2H B;  1BCP F;  5M3F B;  1D5M C;  3J7A F;  3RLN A;  1ET9 A;  3KFU A;  1HR0 L;  3R93 A;  2OXP A;  3EJI A;  5IOD A;  3S2D H;  4IN3 A;  1NCV A;  3C1E A;  4S3S A;  1X3G A;  2UUC L;  2JP1 A;  2AUJ D;  1D1I A;  1ZYR D;  3EA6 A;  1PH5 A;  3JAM c;  1N36 Q;  3CU7 A;  3PO2 B;  2QDL A;  3QOL A;  4O1N A;  2ZM6 L;  3MXP A;  2GVA A;  4K8J A;  4GN3 B;  4DV3 L;  1STB A;  4AYB B;  4FP5 D;  1I4H A;  2HQE A;  3MVV A;  1V1P B;  4OEM B;  3K81 C;  3M7N A;  2NYZ D;  1XMO Q;  4CJ1 B;  1SR3 A;  1JJ2 A;  4JBM A;  4KTA A;  5AJ3 Q;  3S14 B;  1A3T A;  3DXJ C;  2F0T A;  1II3 A;  1UE7 A;  4FXG C;  4JYA Q;  1EY6 A;  3TS0 A;  3CCJ A;  1MJC A;  2F1M A;  1LUZ A;  4X66 Q;  5H1S E;  2O4X A;  1EIF A;  3TQY A;  1GUS A;  3HOX B;  1NUC A;  4JOI A;  4YCV A;  4DV7 L;  1KTK A;  3GTJ H;  1TS5 A;  2PZT A;  2F0E A;  4A75 A;  4A3M G;  3NEM A;  1EZ6 A;  2QW7 A;  1R9T B;  3HKZ B;  4N9P A;  1HZB A;  2PZU A;  4POG A;  4LF6 L;  3K6O A;  4MN3 A;  1Y1W B;  5C44 G;  1DOL A;  1IW7 C;  3J81 i;  2RHS B;  1K83 H;  2HQL A;  3KDF A;  1UEB A;  3HOW G;  5FOB B;  3SK6 A;  2UUA L;  3N52 A;  1Y1V G;  3U9O A;  1O78 A;  3PF4 A;  3NEL A;  2LKV A;  2BE5 C;  4U68 A;  2EYP A;  2NZH A;  1ESR A;  2UXB Q;  2F0V A;  4I7Z C;  3VR3 A;  4DR6 L;  3V2T A;  1AE2 A;  2R93 H;  3A8I E;  5KYI A;  4R4I A;  1SE4 A;  1AZQ A;  3PIO 3;  3OW7 A;  3A55 A;  3VA5 A;  1PFB A;  5IY0 A;  2KA7 A;  3AB9 A;  4P73 A;  4JI2 L;  1PLF A;  3H91 A;  4PMW A;  1IYV A;  2L1B A;  3S1M B;  4OIK A;  4IQZ A;  1S5F D;  4JV5 Q;  3E0E A;  2NVQ B;  5ELO A;  3MXU A;  1JC7 A;  3DWQ A;  1IBK L;  4CDE C;  2A6E C;  2KVM A;  2NTT A;  4DR2 L;  4A93 B;  1WCM G;  4QJF A;  2MO0 A;  2R7F A;  2X6L A;  1VQ7 A;  1I94 Q;  1E3P A;  4B3R L;  3KBG A;  2OWO A;  1VMC A;  3GQB A;  4DKA C;  2EYM A;  1CKN A;  1PZJ D;  2N88 A;  3L7Z C;  3K57 A;  1UEA B;  4J6H A;  4KD3 A;  1KC8 C;  1KRS A;  1PTO F;  5BN5 A;  5IP7 G;  5ELF A;  4OGQ C;  1JOQ A;  1SBB B;  4K6L A;  3CF5 A;  3TN2 A;  2E5L L;  1A6X A;  1HNX L;  1ICW A;  3CXC A;  3OTO Q;  3NP8 A;  2JXM B;  4BA1 I;  1MSH A;  2F0D A;  4CJ2 C;  2WKD A;  1I6H B;  4A3L H;  4JC0 A;  5L37 A;  1SYB A;  3A8J E;  2CWP A;  4WFN 3;  4K5W A;  1AH9 A;  1PZI D;  3P7J A;  2JA5 G;  3QJY A;  1SAP A;  4DF7 A;  2HHH Q;  1IYU A;  2E2I B;  1SMX A;  1GKH A;  1BBU A;  3HZX A;  1CHP D;  2DUD A;  4DXF A;  3KLW A;  3SHL A;  2XWJ B;  1I50 B;  3Q6S A;  1WD1 A;  3NQT A;  4EVO A;  1E24 A;  1SLJ A;  2XSC A;  1E1O A;  4A3G B;  2EJF C;  4IJL A;  3S1N H;  3E3X A;  3QOJ A;  2F0J A;  4DNR B;  1SRU A;  1R4P B;  3NHH A;  1HNW L;  5HY6 A;  3GO5 A;  3KF8 A;  5EBC A;  4XT3 B;  1A2U A;  4FF3 A;  1JIC A;  4WOR A;  4QCL A;  3OMC A;  1OXV A;  3S16 H;  4TQU S;  1HNZ L;  2O5I C;  4PG3 A;  5I2X A;  4LF5 L;  5C4J B;  4NW2 A;  3GTO B;  3VYU A;  4DR3 L;  3M4O H;  4YCW A;  2RQX A;  5KEE A;  3C3L A;  1J8I A;  4UPA A;  1Q7Y C;  4IUQ A;  1JB3 A;  2UXD Q;  2NZ1 D;  4FVM A;  1R9T H;  5JPN C;  2EIF A;  2CH4 W;  3D3R A;  3K8A A;  3J81 E;  1VQE A;  5C3E G;  3KDF B;  2CWA A;  1IL2 A;  1GXD C;  1VQA A;  3V96 A;  3GTG H;  4DXG A;  2RCF A;  1QB5 D;  2E2J B;  2BH2 A;  4ODG A;  1XNQ L;  1XMQ Q;  1BKB A;  1HHV A;  1RTN A;  2JA8 B;  4OON A;  1F2Z A;  5BN3 A;  3MWY W;  1QZG A;  3RLF A;  4C3I G;  1QOH A;  1FL0 A;  2B2W A;  4HR7 B;  4M8A A;  1XNR Q;  1QUQ A;  1UNS A;  2EVB A;  5IP9 G;  2IX3 A;  5ISR A;  4YCU A;  4U67 3;  4LUO A;  4Y7N B;  1I4X A;  2D2C C;  3HOY B;  1JJC B;  3I3C A;  3J81 c;  3SXH A;  5JVH 3;  1KLU D;  1UUP A;  2EY5 A;  1I3Q B;  5COR A;  1NSN S;  2HCC A;  3A54 A;  2R61 A;  4IOC A;  2H1E A;  1GD7 A;  1XWE A;  2NWG A;  4DR5 L;  1FJG Q;  1RCV D;  1YJ9 A;  1V1O A;  2F4V L;  4ME5 A;  1VDZ A;  1VS0 A;  3MXG A;  4KD4 A;  1VQD A;  2RSO A;  4BWG B;  4K2L A;  2DN8 A;  3MTS A;  1HR0 Q;  1TWA B;  1JE5 A;  1I4R A;  4KN4 C;  1F2M A;  2PW7 A;  1IKL A;  1ENA A;  1P8L A;  4DNT B;  4G57 A;  3G71 A;  1O7L A;  3RLO A;  3I4N H;  2CW0 D;  3NWS A;  3U50 C;  4FXK C;  2WP8 J;  1LAC A;  4RAU C;  4YHH Q;  5FJ8 G;  1PFN A;  2MGS A;  2JQO A;  2Z6B A;  3GTQ B;  2OQK A;  3DM1 A;  4POF A;  3OWE B;  4G4K A;  3Q23 A;  4X3U A; 
#chains in the Genus database with same CATH homology
 1W3S A;  5IYC H;  3GTQ H;  3CCS A;  1IBL Q;  1GO3 E;  4DUY L;  4JI7 Q;  4A3K H;  1WI5 A;  1YI2 A;  4BY1 H;  3M3Y H;  3F2D A;  4DV4 L;  1KAW A;  5IP9 H;  1XPR A;  2GVB A;  3M9B A;  3HOU H;  4OO1 I;  1VCI A;  4GN5 A;  1N8R C;  1N34 Q;  2R7D A;  3HKZ E;  4QIW E;  4UP7 A;  1PHJ A;  3HOZ H;  4BY7 H;  4GN4 B;  4K0K L;  1OXX K;  5C4X G;  1K0R A;  3AFP A;  2K14 A;  3GTP H;  4XTC S;  4NXM L;  1D7Q A;  2JA7 G;  2Q2I A;  4JI0 L;  4MNO A;  1IBM Q;  1VQG A;  4FDB A;  3CPF A;  4JOI C;  4DV5 L;  2VUM G;  1ASZ A;  1NY4 A;  4DV7 Q;  2AWO A;  4DV0 Q;  2XTI A;  2ALY B;  3L0O A;  1NTG A;  4LW1 A;  4DNI A;  5GAE C;  4AH6 A;  1VQI A;  4JI5 L;  3PCO B;  3G6E A;  1XPU A;  1C9O A;  5EAY A;  1PH2 A;  2B63 G;  5GRO A;  1WFQ A;  5C0X G;  4A3I G;  4YHH L;  1B7Y B;  1N9W A;  3J7Z C;  1YHB A;  3T1Y Q;  1JMC A;  3I4M G;  1VQJ A;  1X3F A;  4LF4 Q;  1UE5 A;  3PIP A;  3TEH B;  3IRB A;  3E9I A;  2A8V A;  1EIY B;  5JJI A;  4IPD A;  2XGT A;  4IPG A;  4YWL A;  5FLM G;  1A62 A;  4X62 Q;  2CKZ B;  1IBL L;  2OTJ A;  4JI7 L;  3GDE A;  2AWN A;  2HHH L;  2BH8 A;  4LFC Q;  3HFZ B;  1B70 B;  5FJ8 H;  3H0G G;  1M90 C;  1S3O A;  2JA9 A;  2V1C C;  3PUV A;  4NB3 A;  4DK3 C;  3I2Z A;  1VQO A;  1Q81 C;  1N34 L;  1KXL A;  1RIP A;  1V9P A;  2LXJ A;  4A3E H;  2NZO A;  2Z6K A;  4LFB L;  2QGQ A;  3ICE A;  1KRT A;  4DR7 Q;  1B8A A;  2N3S A;  2WAQ E;  4C3H H;  1IBM L;  2YV5 A;  1YEZ A;  1PH8 A;  2MFI A;  3CCE A;  4EQ5 A;  3HKS A;  1CKM A;  4R1J A;  2R7Z G;  4DV0 L;  1FVI A;  5IWA Q;  2JEB I;  2L15 A;  3FKI G;  2LSS A;  4R4T A;  4UP9 A;  2K52 A;  3A5U A;  5C4X H;  5LMU Q;  4A3E G;  1YZ6 A;  4O0A A;  1QZH A;  1TWH H;  3STB C;  4P71 A;  2JA7 H;  1HJP A;  4X64 Q;  3PSI A;  3KJP A;  5GAD C;  4L5T A;  2H5X A;  1PA6 A;  4H02 A;  3BZK A;  1EWI A;  3T1Y L;  4JG2 A;  1YHA A;  4P74 A;  4R4Q A;  4OWX B;  5GAH C;  2OTL A;  4LF4 L;  3FP9 A;  1M1K C;  1QVF A;  1V1Q A;  2KCM A;  2I5H A;  3I56 A;  3CMA A;  4DR2 Q;  3U4V A;  1KD1 C;  3OYY A;  3WWV A;  2ZJR A;  3TS2 A;  4X62 L;  2QEX A;  1TWC H;  1I5F A;  4A3K G;  2K75 A;  4LF7 Q;  2B63 H;  2E8G A;  4LFC L;  1YBY A;  4GS3 A;  4A3I H;  1OXU A;  1QUQ B;  2VQE Q;  3I4M H;  3S24 A;  5JEA J;  5M3M G;  4R4O A;  1T9H A;  2B3G A;  4DUZ Q;  2WFW A;  3L2P A;  1WJJ A;  1XTD A;  4JBJ A;  5J3B A;  1PYB A;  4OWT B;  4LF8 Q;  3CAM A;  3AFQ A;  4YY3 Q;  3S1R H;  4NPS A;  1VQB A;  5FLM H;  4DR7 L;  1G29 1;  2JJQ A;  3ULJ A;  4A4I A;  1HR0 W;  5GQO A;  1YJW A;  3H0G H;  3KOJ A;  3ULP A;  4LUZ A;  1YJN A;  1YVC A;  4HJ5 A;  4AQY Q;  1PH3 A;  5LMU L;  3S15 H;  4KHP Q;  1Q82 C;  1PVO A;  1CKN B;  3G48 A;  2MO1 A;  4ME3 A;  4AYB E;  4X64 L;  2AKW B;  4OX9 L;  2R92 H;  1VQL A;  2NVT H;  3M4P A;  1L1O B;  3S17 H;  3F8T A;  2VZA A;  4L5R C;  2HIV A;  2N78 A;  4GOP B;  2I0Q A;  2UUC Q;  2R7Z H;  1K3R A;  3LGJ A;  3FKI H;  1IZ6 A;  5JEA G;  3A74 A;  4OXP A;  3GD7 A;  4MTN A;  1NMG A;  1S40 A;  4JI6 Q;  4LF7 L;  1U0L A;  4LUV A;  4IPC A;  3A0J A;  3K7A H;  1TXY A;  1UE1 A;  2PI2 A;  2ZM6 Q;  1UWV A;  4DR1 Q;  1XNR L;  2VQE L;  4QL5 A;  4WJ4 A;  2UUB Q;  4JI3 L;  3M85 A;  4DV3 Q;  2F3I A;  2DGY A;  2Z0S A;  4LF8 L;  2NN6 I;  2YYZ A;  2EXD A;  3RN2 A;  1Q1B A;  4YY3 L;  4LWC A;  3J80 i;  4A3J G;  1IXR A;  3UDG A;  1E7Z A;  1VQF A;  1LYL A;  3BU2 A;  4GLX A;  4LFA Q;  4GLA C;  1FJG L;  2BA0 A;  4X6A H;  1VQH A;  5M3M H;  4OO1 G;  1VQ8 A;  3B6Y A;  1EQR A;  2AMC B;  4LNQ A;  1EQQ A;  2PQA B;  1W2B A;  2YU9 H;  2JEA I;  4AQY L;  1WYD A;  3RR5 A;  2D0P A;  2UU9 Q;  4KHP L;  3HOX G;  3TRZ A;  4IPH A;  1YIT A;  4A76 A;  4DV2 Q;  1PH7 A;  4A3C G;  4GNX C;  3RLN A;  3CME A;  2BA1 A;  1HR0 L;  3KFU A;  2CFM A;  1KIX A;  1G51 A;  1KL9 A;  3NEN A;  2QA4 A;  5M3F H;  2CCZ A;  4P72 A;  3S2D H;  1CKO A;  1K9M C;  2UUC L;  1X3G A;  3HKZ G;  3H15 A;  1G6P A;  1PH5 A;  2KEN A;  1JT8 A;  3JAM c;  1N36 Q;  1OXT A;  2ZTD A;  3VDY A;  1K8G A;  2K5H A;  4JI6 L;  2N8N A;  3KF8 B;  5DLQ E;  1Y1W G;  1VQK A;  2D62 A;  2ZM6 L;  4YWM A;  4GLV B;  4DR1 L;  2E2H H;  2UXC Q;  2GVA A;  4LF6 Q;  2IHF A;  2UUB L;  1X55 A;  3UE1 A;  3AEV A;  4GN3 B;  3PO2 H;  4DV3 L;  1L2F A;  5HGQ A;  3CD6 A;  2FXQ A;  2C35 B;  4GNX B;  4A3B G;  4HJA A;  2GN5 A;  4RG1 A;  3I4O A;  2UXC L;  3CCU A;  2YTX A;  1LM0 A;  3K81 C;  3BZC A;  1N33 Q;  3M7N A;  2F52 A;  2WB1 E;  1VQ5 A;  2UUA Q;  2R93 G;  2D0O A;  1XMO Q;  1SR3 A;  1JJ2 A;  4JBM A;  4NXN Q;  4B3S Q;  5AJ3 Q;  4IFD J;  5JJL A;  4L5S A;  3GTK H;  1UE7 A;  1XNQ Q;  2RHQ B;  4JYA Q;  3TS0 A;  3CCJ A;  3S14 H;  1MJC A;  4A3J H;  4HJ8 A;  3MEF A;  2OCE A;  5BR8 Q;  1LUZ A;  4X66 Q;  2R92 G;  4DR6 Q;  2KHI A;  5H1S E;  1EIF A;  3TQY A;  3PIO A;  3CCL A;  1RL2 A;  3S1Q H;  4JOI A;  4YCV A;  4DV7 L;  5K36 G;  1PV4 A;  4P75 A;  1EYG A;  1SE8 A;  3I55 A;  1WOC A;  3GTJ H;  3PO3 G;  4A75 A;  4A3M G;  2PI2 E;  1A0I A;  3NEM A;  3HOX H;  3DLL A;  1N36 L;  3W5O A;  4JI2 Q;  2ID0 A;  3UDF A;  4BBS G;  5GAG C;  2WAQ G;  4A3C H;  1HZB A;  3BJU A;  4POG A;  3KF6 B;  3CC2 A;  3ER0 A;  4DR4 Q;  4C3J H;  1CUK A;  4DV6 Q;  4LF6 L;  3F1Z A;  3UDX A;  4A93 G;  1Q12 A;  1IBK Q;  4Y52 H;  5C44 G;  1UE6 A;  2ATW A;  3J81 i;  2RHS B;  1K83 H;  4IFD G;  1X3E A;  2HQL A;  2Y0S E;  3G4S A;  3KDF A;  4DR5 Q;  1K73 C;  1TWG H;  1N33 L;  1UEB A;  3HOW G;  1C7Y A;  1Y1W H;  2UUA L;  5FLX c;  1XMO L;  2F4V Q;  4NXN L;  4B3S L;  4B3R Q;  2VNU D;  2K5N A;  1Y1V G;  3E9H A;  1VQ6 A;  4IO9 A;  3PF4 A;  3NEL A;  3J7A 5;  4JYA L;  1PH9 A;  1L1O C;  3ULL A;  5IYD G;  4X65 Q;  4JCV E;  2NZH A;  2Q2U A;  3RNU A;  4A3B H;  2K4K A;  4JI1 Q;  4JI8 Q;  4GOP C;  1Q86 C;  2UXB Q;  5BR8 L;  4X66 L;  4DR6 L;  5IE8 A;  2KBN A;  5M5Y H;  1AE2 A;  4A3L G;  2R93 H;  1YIJ A;  2E5L Q;  1HNX Q;  5M3F G;  4R4I A;  1AE3 A;  4QQB X;  3UE0 A;  3W1G A;  3CCV A;  1E22 A;  5IWA L;  1CSQ A;  4GKJ Q;  2RCN A;  2ZTC A;  2YTY A;  5IY0 A;  1ASY A;  3CQZ H;  4HJ9 A;  4P73 A;  1VQP A;  4JI2 L;  4PMW A;  4HJ7 A;  4JBK A;  3D31 A;  2PNH A;  1BVS A;  4DV6 L;  4DAY B;  3E0E A;  4JV5 Q;  5ELO A;  2RF4 A;  1FGU A;  1X54 A;  3W1B A;  4IJH A;  1IBK L;  3PO2 G;  3S1M H;  3CW2 C;  1XPO A;  3PO3 H;  4A3M H;  4DR2 L;  3H3V H;  2R6G A;  3U58 A;  2VS1 A;  4QGU A;  1WCM G;  4QJF A;  2MO0 A;  3CPW A;  2R7F A;  4B3M Q;  4PZ8 A;  5LMN Q;  4PZ6 A;  1I94 Q;  4AYB G;  1VQ7 A;  2NVQ H;  4BBS H;  2A1A A;  3J81 j;  2VQF Q;  4MZ9 A;  2OQ0 A;  1VQ9 A;  1YNX A;  2NVY H;  3CP0 A;  1E3P A;  4B3R L;  3PUY A;  1LTL A;  4A93 H;  1TWF H;  2OWO A;  4A3G G;  4DKA C;  1CKN A;  4DUZ L;  4HID A;  4APV A;  2Q2H A;  5C44 H;  4LF9 Q;  4X65 L;  1NE3 A;  1P16 A;  3L7Z C;  1KC8 C;  1PH6 A;  1KRS A;  5IP7 G;  4JI1 L;  4JI8 L;  2UXB L;  4KHZ A;  4KI0 A;  1VQM A;  3PV0 A;  3HOW H;  3CF5 A;  4GOP A;  1HZ9 A;  2IX1 A;  2E5L L;  1HNX L;  3UDI A;  3M4Q A;  3F2C A;  4ALP A;  1Y1V H;  1OXS C;  1SN8 A;  3OTO Q;  3CXC A;  4B3T Q;  1HNW Q;  2JE6 I;  1VQ4 A;  4BA1 I;  4DAM A;  4GKJ L;  3DM3 A;  5IYD H;  3CC7 A;  3GTL H;  1X56 A;  4DK6 C;  3PUZ A;  4A3L H;  4JC0 A;  3CCR A;  3KJO A;  2CWP A;  1KQS A;  1AH9 A;  1HNZ Q;  4JV5 L;  1I6H H;  1HZC A;  4LF5 Q;  1JJG A;  4DV1 Q;  1NMF A;  3F2B A;  2JA5 G;  1A8V A;  3RN5 A;  2K50 A;  2HHH Q;  3AYH B;  1QVC A;  2I5L X;  4DR3 Q;  1SMX A;  1C0A A;  3CCQ A;  1GKH A;  3T1H Q;  4B3M L;  1BBU A;  5LMN L;  1I94 L;  2DUD A;  2VQF L;  2PQA A;  3OW2 A;  3EIV A;  2E2I H;  3KLW A;  2Z6K C;  3J80 c;  4LFB Q;  1VQC A;  3D0F A;  3PUX A;  1E24 A;  1SLJ A;  4LF9 L;  2IX0 A;  4C2M H;  4WJ3 M;  4UY8 C;  1E1O A;  1WCM H;  1O7I A;  1I50 H;  1X6O A;  4IJL A;  3S1N H;  1X9N A;  1J5E Q;  1DGS A;  2A19 A;  4LFA L;  1N32 Q;  1SRU A;  1HZA A;  1Z47 A;  2JA8 G;  4B3T L;  3FHW A;  3OTO L;  4A3G H;  1HNW L;  4BBR G;  5HY6 A;  3GO5 A;  1SFO H;  2UU9 L;  4R4C A;  3HOV H;  2VY3 A;  5C0X I;  3A5Z B;  2N49 A;  5IP7 H;  3EN2 A;  1EFW A;  4A3D H;  1D8L A;  2LXK A;  1XJV A;  3PGZ A;  1JB7 A;  2I5M X;  2WB1 G;  4DV2 L;  1OXV A;  4J15 A;  1BBW A;  1NBW A;  3S16 H;  4GNX A;  3PUW A;  4TQU S;  2ES2 A;  1HNZ L;  4PG3 A;  3HOY G;  4LF5 L;  1EOV A;  1X65 A;  4DV1 L;  4EX5 A;  4DR3 L;  2ASB A;  3M4O H;  1Z9F A;  4YCW A;  3T1H L;  5M5X H;  3PF5 A;  3K80 C;  2IT1 A;  5C4J H;  4JI4 Q;  4UPA A;  1Q7Y C;  3GTO H;  2UXD Q;  1K8A C;  4GKK Q;  2ZJQ A;  1Y14 B;  1L0W A;  1PH1 A;  2VW9 A;  4OWW B;  1R9T H;  2MQH A;  1YHQ A;  1J6Q A;  2EIF A;  5IYB G;  4DPG A;  2JA5 H;  4HIK A;  3K8A A;  1VQE A;  2HIX A;  3EBE A;  4UP8 A;  3RZD H;  5C3E G;  4BXX G;  1V43 A;  2CWA A;  3KDF B;  1IL2 A;  1H95 A;  1VQA A;  3GTG H;  4PZ7 A;  1J5E L;  1GM5 A;  4YWK A;  4A3F G;  1N32 L;  1U5K A;  5AJ3 L;  1S72 A;  3STB D;  3H3V I;  2BH2 A;  3I4N G;  1XNQ L;  5ELN A;  1XMQ Q;  3RZO H;  2ZJP A;  2KCT A;  1BKB A;  2JA6 G;  1MKH A;  4OX9 Q;  3MXN B;  2E2J H;  2Y0S G;  3KF6 A;  2VUM H;  4OON A;  1Q46 A;  1Q8K A;  4IOA A;  1QZG A;  3JC6 6;  1MIU A;  4XIG S;  3RLF A;  1PYS B;  4JBW A;  1GVP A;  2JA8 H;  4IFD I;  3ERS X;  3K0X A;  5IYC G;  2HT1 A;  1PFS A;  1FL0 A;  5IT9 c;  4BBR H;  2IHE A;  4BY1 G;  4AIM A;  4HIO A;  1QVG A;  5E7N A;  1XNR Q;  3KYH C;  5LMN W;  1QUQ A;  5IP9 G;  4TVA B;  2JK8 A;  4YCU A;  4LUO A;  3HOU G;  4JI3 Q;  4JI4 L;  3HOZ G;  1JJC B;  2CQO A;  3J81 c;  3GTM H;  4BY7 G;  2UXD L;  4DR4 L;  3AQQ A;  4Y7N H;  4GKK L;  2AHO B;  3HOY H;  4HIM A;  1Q1E A;  2Q2T A;  4DUY Q;  3S2H H;  1KHI A;  4IOC A;  4QY7 A;  1VQN A;  4DV4 Q;  4DR5 L;  1GD7 A;  3I7F A;  1FJG Q;  3K7U C;  2NVX H;  1E1T A;  1I3Q H;  1HH2 P;  2VL6 A;  1YJ9 A;  2F4V L;  4O2D A;  4K0K Q;  1VS0 A;  2KHJ A;  1VQD A;  2ZTE A;  1XMQ L;  2K5V A;  3CCM A;  1CSP A;  4NXM Q;  2IY5 B;  1IYJ B;  4JI0 Q;  2NN6 G;  3SGI A;  5IYB H;  3HOV G;  4A3D G;  1L1O A;  4DV5 Q;  1HR0 Q;  5C3E H;  4BXX H;  1JE5 A;  2PMZ E;  3ZJY C;  1PH4 A;  1P8L A;  4KLK A;  3U4Z A;  4A3F H;  1EUJ A;  3TRE A;  3G71 A;  4JI5 Q;  3RLO A;  1MJE A;  3I4N H;  1TWA H;  3Q8D A;  2EQS A;  5JJK A;  2YTV A;  3U50 C;  2JA6 H;  1SRO A;  2B29 A;  2WP8 J;  3NBH B;  1NJI C;  4YHH Q;  5FJ8 G;  3JAM i;  3CC4 A;  2JQO A;  2OQK A;  1OTC A;  4BA2 I;  4POF A;  4RMF A;  2MNA A;  5C0X J;  5M5W H;  1A63 A;  4C3I H;  4L5Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...