1LUZA

Crystal structure of the k3l protein from vaccinia virus (wisconsin strain)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
FCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure and functional analysis of vaccinia virus K3L reveals molecular determinants for PKR subversion and substrate recognition.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Viral protein
molecule keywords Protein K3
total genus 18
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1luzA00
3RZDH 4JOIA 3OW2A 1LUZA 1EQQA 4HJ8A 4IFDG 1JT8A 3GD7A 4GLVB 3RNUA 3MEFA 5GQOA 3CC7A 3S2DH 3CW2C 2NVTH 3DLLA 1E3PA 4OX9L 2K4KA 4YCWA 4DAYB 3U4VA 4LNQA 5M3FH 4JBKA 1QZGA 4A3CH 4IPDA 4IFDI 3KJOA 1S3OA 1X56A 1IBML 1Z9FA 4JBWA 2R7DA 1U0LA 3KDFB 3K7UC 3CQZH 4KHPQ 2PQAA 2K5VA 3DM3A 5C0XJ 4DV3L 3HOYG 4OO1G 5J3BA 3HKZE 2R7ZH 1K8GA 5IP7G 4DR5Q 4A3EH 2ES2A 2JA8G 3GTQH 1KD1C 1VQLA 4GNXA 2PI2E 1EFWA 4B3ML 4DV0Q 2JA5H 4LF9L 3B6YA 1I50H 4GKJQ 3S1NH 1SR3A 1FVIA 5IWAQ 4HJ9A 3CCRA 4A3GG 2A1AA 1SE8A 4AH6A 1E7ZA 2HHHL 1VQFA 4NB3A 4X64Q 4JI3Q 3KLWA 4LFBL 5C3EG 2RCNA 3T1HL 1OXUA 4HIKA 2WAQE 3NENA 3MXNB 1KL9A 4LF8Q 2N49A 2JA6G 4NXML 1WYDA 5LMNL 1EIFA 1Q7YC 5GROA 1WCMG 1VQ9A 4DV4Q 1VQNA 2ATWA 2Q2IA 1VQJA 5ELNA 2UUBQ 3GTLH 3K8AA 3TREA 5IP9G 2VNUD 4JYAL 2I5MX 4J15A 1Q81C 3UE0A 3I7FA 5FJ8G 4A75A 3IRBA 2WFWA 4A3KH 1UE6A 4DPGA 2K14A 4AYBG 3EBEA 4YHHL 1HR0L 2BH8A 4LF6L 5H1SE 2BH2A 3GTMH 1SN8A 2JQOA 2Z6KA 1VQGA 3I4NH 4IFDJ 3F2CA 3I2ZA 1XNQL 2WAQG 3J81c 4JBMA 4LFBQ 4DUZQ 4JI3L 4X64L 5BR8L 2B63H 4A3BH 5C0XI 4C3IH 2E5LL 1B7YB 3KJPA 2ZM6Q 2F4VQ 2IX0A 1J5EQ 2D62A 2LSSA 4LFCL 2HIVA 4PZ7A 4OX9Q 1RL2A 3NELA 4DV7L 2FXQA 3U50C 1GD7A 1E24A 3PF4A 2B3GA 4DUZL 2N8NA 1JB7A 3JC66 3UDXA 1SRUA 1C9OA 1K73C 4GN4B 1XMOQ 1A0IA 4KHZA 2UUAQ 2YTVA 4UPAA 1L1OC 4DR3L 1CKNA 4XTCS 4YY3L 4UP8A 4LF4L 1QUQA 5LMUL 2YTYA 1Y1WH 3KF6B 3PUWA 1N34L 2E2JH 3TQYA 2UUCQ 3EIVA 4OWXB 4GOPB 4TVAB 5FJ8H 1TWGH 1Y14B 4IPGA 4PZ6A 2JEAI 1K0RA 3UE1A 1XTDA 2VW9A 3I56A 3HOWG 3S2HH 1NMFA 4KLKA 5M3MG 2IHEA 3UDFA 1YHQA 4A93H 4DR7L 2PQAB 1HNXQ 3OTOL 4JOIC 4JI0Q 2AHOB 4IO9A 1JJGA 2GVAA 3AYHB 5EAYA 3D0FA 1VQPA 1NJIC 2Q2UA 4X6AH 1Q12A 4LUZA 3S17H 3AFPA 1CUKA 3NEMA 4QQBX 3S1RH 2WP8J 5IWAL 1X55A 2UUAL 3W1GA 4B3SL 4LF9Q 4FDBA 5M5YH 3I4OA 1N36Q 4A3LG 2DGYA 2V1CC 2IX1A 1KHIA 1VQOA 2Z6KC 1XPUA 1VQAA 1KRSA 1G51A 3L2PA 4DV5L 1IL2A 1X3GA 2KCMA 1EWIA 1XPRA 1N33Q 1VQ5A 2MQHA 4IOAA 1HR0Q 4A3MH 1C0AA 3PO3H 3RLFA 3FHWA 4DR2L 1IBLL 4GNXC 4AYBE 1XNRQ 4A3JG 4JYAQ 4O0AA 4NPSA 1A63A 3FKIH 3HOWH 2UUBL 1PH5A 1OXXK 3H15A 3F2BA 4HJ7A 1YITA 3PUYA 2KHIA 2ZTEA 1KAWA 2KENA 2AKWB 5FLMG 1N8RC 4B3SQ 3PO2G 2KBNA 4A3IG 2VQEL 1XMQL 1A8VA 4WJ4A 4LUOA 2R92G 1TWAH 5C4XG 5IYBH 1Q46A 3GTJH 5C44H 4MTNA 4DV2Q 3S1MH 4R4OA 1PVOA 1KQSA 3HOXG 1V1QA 4JI8L 2JA9A 4GKJL 4DV1Q 1ASYA 4P75A 2B29A 3M7NA 2UXCQ 5IYDH 3ZJYC 3GTGH 5M3FG 2I5LX 3CP0A 5IYCG 2QGQA 3ERSX 4OWTB 3A0JA 1YIJA 3I4MH 5C0XG 4A3DG 2LXKA 1HNZL 1V43A 1OXSC 5IP7H 3M4PA 5M5WH 4OO1I 3KF6A 4JC0A 4DV2L 4LF7Q 4P74A 1FJGQ 1CKNB 1IXRA 3HOYH 4L5SA 1PH7A 4BBSG 4POGA 1VS0A 4QGUA 4H02A 1U5KA 2EQSA 2ZTDA 2VQEQ 1XMQQ 2MFIA 2QA4A 3T1YL 1JE5A 4LUVA 4LF4Q 3S14H 4QIWE 3CCSA 2ZTCA 3M4QA 1VQBA 3FKIG 4B3TL 4BXXG 1C7YA 1VQ7A 4BBRH 2F3IA 1PH6A 3RLOA 2JA5G 1L0WA 3W1BA 4LWCA 1OTCA 2H5XA 5GADC 5GAEC 1L1OA 4EQ5A 2UXCL 2OTJA 2R92H 5K36G 1HZCA 2Q2HA 3E0EA 4JI8Q 4DKAC 2HQLA 4DR6Q 4A3FG 1QZHA 1MIUA 4DV4L 2YU9H 4GN3B 1G291 1KIXA 3H0GH 5BR8Q 1QVGA 3KYHC 4JI4Q 4HIMA 1Y1VG 3PSIA 4X66Q 3A5UA 2VUMH 3KDFA 1X6OA 4RG1A 1N32Q 1MJCA 4DUYQ 5AJ3Q 4LF6Q 2R93H 1BVSA 1GKHA 1HH2P 2VZAA 2A19A 4LFAQ 4B3TQ 1J5EL 3A5ZB 3CCVA 1O7IA 4DV6L 1GM5A 1WI5A 4HIDA 1IBLQ 4UY8C 2JK8A 4L5QA 1B8AA 4DR3Q 1VQKA 2WB1E 4LF8L 2YTXA 1VQDA 4DV5Q 1XJVA 1NE3A 1B70B 5IE8A 1H95A 4GN5A 3BZKA 3SGIA 1HNWL 2UXDL 1VCIA 1S72A 1K8AC 1VQIA 3CAMA 2RF4A 2CFMA 3I55A 1TWFH 3GO5A 2UUCL 4IJLA 4LFAL 4PZ8A 4JG2A 4DV0L 3CMAA 3J80c 3RLNA 3CPWA 4YWLA 1PH1A 3PGZA 1PYBA 3HKSA 1X3EA 2MNAA 4YY3Q 3RN5A 3HOVG 4R4TA 1R9TH 2ZJQA 1QUQB 1NY4A 3A74A 1AE2A 4X66L 3M9BA 4ALPA 3T1HQ 1UWVA 5LMNW 2WB1G 4JI0L 1XNQQ 3OTOQ 3GTOH 2OQKA 3GTPH 4X62L 4JI1L 1AE3A 4OWWB 4R4IA 2K75A 2K5NA 5IY0A 2ZJPA 4JI7Q 4WJ3M 2NVQH 2VQFL 2JA7G 1YEZA 3CCUA 4ME3A 1ASZA 4POFA 2L15A 3CXCA 1K9MC 3PO2H 4A3IH 3U58A 3J7A5 5GAGC 2CKZB 2R6GA 2XTIA 4C2MH 1HNWQ 3TEHB 2HIXA 4UP9A 5C3EH 4HJ5A 3G71A 4A3JH 1J6QA 4AIMA 2NZHA 4K0KL 1Q86C 1EYGA 2JA8H 1HZ9A 1LYLA 2VS1A 1E1TA 3BZCA 2YV5A 3PF5A 1DGSA 1M90C 1XNRL 4A4IA 2GVBA 1VQ4A 3AFQA 3NBHB 1SFOH 5IYDG 4DR2Q 1IYJB 5M5XH 4BA2I 1NMGA 1I6HH 1X54A 1N33L 1YI2A 3M85A 1GVPA 4PG3A 3EN2A 3PV0A 5DLQE 4LW1A 3HOZH 3ULPA 2NN6I 3HFZB 1EIYB 5C4XH 4BY1H 4KI0A 3CCEA 1YHBA 4DR4L 5JJKA 2D0PA 3BU2A 1UE7A 2ALYB 1QVFA 4PMWA 4JI1Q 1IBKL 5LMNQ 3S1QH 4A76A 1SMXA 2K50A 3J7ZC 3L7ZC 3U4ZA 4A3MG 1IZ6A 1PFSA 4DV3Q 4MZ9A 1YZ6A 4AQYL 4BY7G 4GOPC 3L0OA 2EIFA 2OCEA 4XIGS 5ELOA 3STBC 5FLMH 1HNXL 3J81i 2HHHQ 1GO3E 4JI6Q 3PIOA 4QJFA 4BXXH 2Y0SE 2CWPA 4IPCA 2DUDA 1JJ2A 3HOUH 4DR6L 2RHQB 2OWOA 2LXJA 1BBUA 1UE5A 2I5HA 1PH2A 2UU9L 4B3MQ 3VDYA 1PH3A 1MKHA 2D0OA 3CCQA 2OTLA 2E2HH 2KCTA 4EX5A 2GN5A 4OXPA 3G6EA 3H3VH 4DUYL 1K83H 5C44G 2OQ0A 3H0GG 5JEAG 4C3HH 1NTGA 3HOXH 5JJIA 1Y1WG 2KHJA 4DR1Q 1X3FA 2MO0A 4HIOA 1IBMQ 5E7NA 4R4CA 1IBKQ 4B3RQ 2NVXH 4RMFA 4YWKA 4DV7Q 4LF7L 1FJGL 2E2IH 3HOZG 2IY5B 2AWNA 1PH4A 2CCZA 1MJEA 4LFCQ 2R93G 4A3CG 1VQMA 3ULLA 1Q8KA 2I0QA 3RN2A 3M4OH 1D7QA 2PMZE 1Q1EA 1TXYA 1KRTA 1OXTA 1JMCA 4DR5L 1EQRA 1T9HA 3HKZG 1PH9A 3PO3G 2IT1A 1PV4A 3RZOH 3CMEA 1HZAA 1P8LA 4GKKQ 4C3JH 4A3EG 3PUXA 1CKMA 2BA0A 3TRZA 3F8TA 1AH9A 3GTKH 1SLJA 2C35B 3WWVA 2Q2TA 5GAHC 3K0XA 4P73A 4NXNL 4DR1L 1RIPA 1I3QH 2CQOA 1KXLA 1XPOA 1HZBA 4O2DA 4DV6Q 2IHFA 4JI2L 1WCMH 2UXBQ 3STBD 5JJLA 2JEBI 1VQHA 4GLAC 4DR7Q 3K80C 4JCVE 3J81j 3PUVA 4QL5A 4X62Q 1N32L 2N3SA 5HY6A 3ICEA 1PA6A 2JE6I 4HJAA 4GOPA 3CC4A 2JJQA 3CCMA 1Y1VH 3F2DA 4QY7A 5HGQA 1CSPA 1BKBA 2CWAA 2NVYH 2NZOA 1TWCH 3CD6A 1UEBA 3D31A 3F1ZA 5C4JH 1W2BA 2ASBA 3AEVA 4NXMQ 4GKKL 2EXDA 1X9NA 3K81C 4MNOA 1L2FA 2R7ZG 5IYBG 3G4SA 3H3VI 3PUZA 3G48A 1WFQA 2JA6H 3I4NG 2VL6A 1EUJA 1WOCA 3ER0A 1I94Q 2QEXA 1D8LA 1WJJA 4IOCA 1M1KC 1S40A 4DR4Q 2Y0SG 2UXBL 2NN6G 1PYSB 4JI2Q 5IP9H 3CF5A 1LTLA 1X65A 3T1YQ 1PHJA 4UP7A 2B63G 2BA1A 2E5LQ 3TS0A 4A3BG 4P71A 1VQ8A 2N78A 4BBRG 3OYYA 3E9IA 2AWOA 1BBWA 2PI2A 3AQQA 1Z47A 1L1OB 4JI5Q 4GS3A 4JBJA 1NBWA 3CC2A 4DK6C 1VQEA 4KHPL 1E22A 4R4QA 1LM0A 1PH8A 4BY1G 4GNXB 1I94L 3UDIA 3KF8B 1V9PA 2ID0A 1W3SA 5AJ3L 3W5OA 3S15H 4DNIA 2YYZA 4IJHA 3CCLA 4JV5Q 2A8VA 3ULJA 3HOVH 2RHSB 1QVCA 3J80i 2VQFQ 4JI5L 4A3KG 4BY7H 2K5HA 4OONA 5JEAJ 4DV1L 3E9HA 4JI4L 4L5RC 1N34Q 4Y7NH 3FP9A 2JA7H 1YJWA 1Q82C 1UE1A 1YNXA 1Q1BA 5LMUQ 4K0KQ 2VY3A 2ZJRA 4B3RL 4P72A 1FL0A 3PCOB 1YVCA 4YCVA 4BA1I 3I4MG 4A3DH 1HJPA 3HOUG 3M3YH 3LGJA 4JV5L 1EOVA 3Q8DA 4L5TA 2AMCB 1CSQA 1A62A 2K52A 3GDEA 2UXDQ 2Z0SA 4X65L 1K3RA 3BJUA 1P16A 4YWMA 1YJ9A 4LF5L 3S24A 3KOJA 1VQ6A 4IPHA 5FLXc 4A3FH 3JAMi 1G6PA 1FGUA 1CKOA 3K7AH 5IYCH 1OXVA 3UDGA 4APVA 4NXNQ 1N9WA 2F52A 3CCJA 1SROA 4Y52H 2XGTA 5M3MH 4A93G 4DAMA 4GLXA 4AQYQ 2PNHA 2MO1A 2E8GA 1JJCB 1YBYA 4TQUS 3PIPA 1HNZQ 4BBSH 1YHAA 4X65Q 2VUMG 3CPFA 4YHHQ 3KFUA 4YCUA 1HR0W 1I5FA 1N36L 1VQCA 4R1JA 1KC8C 2UU9Q 2R7FA 1E1OA 1TWHH 4LF5Q 4JI7L 5IT9c 2ZM6L 2F4VL 3TS2A 4A3GH 2HT1A 4JI6L 1YJNA 3JAMc 3S16H 3RR5A 4A3LH 1XMOL 4DK3C
chains in the Genus database with same CATH superfamily
4JOIA 1AFPA 5J39A 1LUZA 3GD7A 1A3TA 3RNUA 1KTKA 1XWEA 2PCFB 3DLLA 3X3NA 2K4KA 3BVZA 3FPUB 5EKKA 4QCLA 3BVGA 2IPKD 2M2LA 1Z9FA 3P20A 4DXFA 3MWYW 1I4QA 4DNRB 4KHPQ 2PQAA 5ELEA 5J3BA 2LY7A 2R7ZH 1D5XC 1G6ZA 3ERQA 2JA8G 2K7VA 1H9SA 1VQLA 1EFWA 4LF9L 4B3ML 2F0DA 1I50H 1SR3A 3NWSA 4HJ9A 3S1MB 3M4OB 4AH6A 1DOLA 4E6IA 4NB3A 1VMPA 1X3QA 2WAQE 3NENA 3MXNB 3C1EA 2N49A 4N8FA 5LMNL 1BDOA 4HMIA 4IN3A 5ELNA 2FMCA 3TREA 5IP9G 4ZKCB 2WAQB 1VF5C 3HG9A 3UE0A 2WFWA 4A3KH 1UE6A 4DPGA 3K5LA 1HR0L 2BH2A 1SN8A 1EU3A 1QG7A 3I4NH 3I2ZA 1RJTA 3TP8A 2LMCB 5FKAC 1F2ZA 5BR8L 4NMZA 2NVQB 5C0XI 5IOCA 4C3IH 1STEA 1J5EQ 1DONA 4FXKC 1U4RA 2LSSA 1OO9B 2HIVA 5BN4A 4PZ7A 4A3EB 1EWHA 3NELA 4N9PA 1WD0A 1E24A 2AUKA 1SRUA 3C1FA 1XMOQ 4EQPA 1EY9A 4LF4L 5ELBA 1NR4A 1Y1WH 2E2JH 3QO2A 3DEPA 1SMYC 1ONLA 1KNEA 2JN4A 2JEAI 1XTDA 3HOWG 1NMFA 4A93H 2IHEA 2XSCA 4I7ZC 4ZQ3A 2PO4A 4JOIC 1S5BD 3BVMA 1A15A 3H09A 2Q2UA 4X6AH 2MP1A 4XQQA 4C3IB 4IFDH 1PZJD 5JVG3 1CUKA 2K1BA 1XYIA 3S1RH 2WP8J 1X55A 2UUAL 3LNNA 4B3SL 4LF9Q 2XWJB 5K5PA 1HTPA 4BBSB 2DGYA 1F9SA 2Z1CA 2BE5C 1VQAA 1KRSA 4KJOA 1S5FD 1X3GA 2KCMA 1EWIA 5JOBA 4RGOS 1C0AA 4Q5VA 4A3JG 1CZGA 1Q3LA 2L0CA 2UUBL 1PH5A 4L6TB 5ELCA 3TDQA 1HPCA 2BCOA 2KENA 2ICEC 1WTXA 4LUOA 4EQOA 3GTJH 5C44H 4DV2Q 2NWGA 4R4OA 3I72A 4P75A 3TZUA 2FJ2A 1UEAB 1CM9A 1ICFB 3Q24A 2FFKB 3ERSX 1YIJA 3I4MH 2LXKA 3A7AB 2TMPA 1GUNA 1V43A 3G6JB 2KUMA 1AZQA 3I4LA 5M3FB 1PTOD 4G7OC 2A74C 1IXRA 3C2PA 4L5SA 4BBSG 4QGUA 2ZTDA 3S1QB 3S14H 2XN9C 2ZTCA 3FKIG 4BXXG 1C7YA 1VDZA 1TVXA 1VQ7A 4BBRH 2F3IA 2JA5G 3BZDB 4RGMA 5DEHA 3OIPA 1U9RA 4WJWA 1Y1VB 4EQ5A 3HS0C 5K36G 1HZCA 1I4GA 3QOLA 4DR6Q 1MIUA 2E2HB 1LT5D 3KYHC 5JAVA 1IW7D 2KJXA 1LO5D 4L63B 3A5UA 3KDFA 4ZRZA 4RG1A 1A2UA 4C3JG 3GV6A 5AJ3Q 4AYBB 4DFAA 4LF6Q 1BVSA 2A19A 3W3AA 2B2WC 4DV6L 2JA6B 4BY1B 3KLRA 1IBLQ 2KHSA 1B8AA 2F0UA 1VQKA 1A3UA 1ZEQX 3I3CA 3OOCA 4DV5Q 2IL8A 2B2TC 1H95A 2UXDL 1VCIA 1K8AC 2QW7A 3CAMA 5CC4A 3QR8A 3VYSA 3I55A 2EE1A 4IJLA 4LFAL 4DV0L 3J80c 4KJNA 4C3HB 3PGZA 1X3EA 4ZUJA 2MNAA 4OEMB 3RN5A 4X66L 3M9BA 5EKIA 3T1HQ 1YNNC 3J80L 3OTOQ 3GTPH 1O7LA 5EKLA 1G91A 3NQIA 4LAAA 5IY0A 4J1MA 4X3SA 2RA4A 3S2HB 5EJWA 5DNFA 3LWEA 1PTOB 4P2CB 2L1BA 4ME3A 3VA7A 3PO2H 2HIXA 5C3EH 4A3JH 3G71A 1J6QA 3Q22A 4K0KL 1EYGA 4XT3B 2VS1A 1AN8A 1CQVA 3E3XA 2YV5A 1BQQT 1M90C 4OIKA 2A68D 1IYJB 3VR3A 1NMGA 3HOWB 3DUZA 3PO3B 4PG3A 3EN2A 2NN6I 4KI0A 1YHBA 5A2QL 1QVFA 1SNPA 4C3IG 2EY6A 1EL0A 2F0QA 3GV3A 4A3MG 4AQYL 2EIFA 2OCEA 4Q0FA 2D5DA 5CV8A 3STBC 2HHHQ 4K0KQ 2CWPA 4ZK9B 1JJ2A 2D9UA 3S1RB 1MKHA 2D0OA 1TS2A 2KOLA 2E2HH 3H3VH 1CFMA 2TSSA 2PMZB 3KBXA 1H9RA 3BS1A 1X3FA 3R3OA 3BYYB 1IBMQ 5E7NA 4YWKA 1JB3A 4DV7Q 2E2IH 4LFCQ 2E2IB 1VQMA 2WB1B 2I0QA 1D7QA 2PMZE 4HR7B 4A3IB 5M5WB 2E2JB 4XDXA 4R8IA 1OXTA 4BY7B 4KV6A 3PO3G 3S15B 3RUZA 3MTSA 2H1EA 1HZAA 1EY6A 1P8LA 5EPLA 1II3A 4C3JH 1C4QA 1SLJA 5GAHC 3TSSA 1RIPA 2NBFA 1V1PA 3PIP3 2PW5A 4FXGC 3STBD 4B9WA 4A3BB 3JAME 5KEEA 4DR7Q 3PUVA 3LWUA 2J7ZA 1D1IA 5HY6A 1V1PB 1FD7D 1EY4A 3CD6A 4A3MB 2ASBA 5C4JH 1W2BA 4K2KA 4NXMQ 1X9NA 2RQXA 2A68C 2CQAA 2R7ZG 5CYUA 3G48A 4BBRB 5LL6X 2VL6A 1WOCA 3I4NG 1QJOA 1M1KC 1S40A 4DR4Q 4A3JB 1PHJA 4JI2Q 3KK7A 4R8NA 4UP7A 4P71A 4F88A 1JCKB 3OWFA 2PI2A 5D65A 1VF7A 2HDMA 1Z47A 2ZXOA 3K57A 4X3UA 4JBJA 4R4QA 1YNND 1PH8A 4BY1G 1QOHA 3Q6SA 1WTWA 3MC0B 2IWHA 3CCLA 1ILPA 2KA7A 1PRTF 3HOVH 2RHSB 1QVCA 3J80i 4JI5L 2Z9HA 4A3KG 4BY7H 4DV1L 5JEAJ 4L5RC 4JI4L 4JK1C 4HAEA 1Q1BA 2KCCA 2ZJRA 4S3SA 2Z8LA 1FL0A 4P72A 3OWEB 3BDCA 2EXZA 4IUPA 3EA6A 2AMCB 2M9VA 5ELDA 2Z0SA 1GHKA 1K3RA 1VQ6A 1BF4A 2LKVA 3DM1A 4FO2A 5FLXc 1FGUA 1CKOA 2L12A 3K7AH 1OXVA 1PRTB 4NXNQ 3EFXD 1EIHA 1N9WA 5E4XA 1E2WA 3SK5A 4CDCC 2I46A 2PNHA 3LX0A 1JOKA 2VUMG 4YHHQ 5E1FA 3TZDA 1HR0W 2EPBA 1N36L 4DGZA 1RHPA 3NQTA 4R1JA 3S9WA 1KC8C 1XXGA 1E1OA 1QB5D 3J81L 3S17B 2ZM6L 5I6YA 4C3JB 3TS2A 4JI6L 4H44C 3JAMc 1JWSD 3D3RA 5FK9C 1EFID 3R2TA 1XMOL 1HCZA 1QZGA 5KNCA 2X6LA 3OW2A 1BXTA 3SE0A 2BDNA 2WINB 1EQQA 1BUVT 3H94A 4IFDG 1SJHD 4GLVB 5GQOA 3S2DH 2EYLA 5I4DA 4OX9L 2WV6D 3U4VA 5C3EB 1V1OA 4JBKA 1EEFD 1GOZA 1E2VA 4IFDI 3KJOA 1S3OA 3K7UC 1EY0A 1ET9A 1RKNA 5TSSA 2K5VA 3HOYG 4PQXA 4DV3L 1CHQD 3HKZE 1K8GA 2ES2A 2Q8IB 3GTQH 3QIAA 1KD1C 3I8ZA 2F0WA 4CJ0B 4JVZA 1UUPA 4JW0A 5IWAQ 5KRUA 3A54A 1BR9A 2HHHL 2RCNA 3OW7A 4LF8Q 1Q7YC 4UAIA 4DV4Q 1VQNA 2UUBQ 3GTLH 1J9OA 3K8AA 4JYAL 2EY1A 1UNSA 1K28A 5ELFA 2K14A 3SDZA 3EBEA 2K32A 2JQOA 2Z6KA 3L3OC 1XNQL 3J81c 2F0JA 1DJRD 1HQRD 1SNMA 2B63H 1MBYA 3X3MA 2E5LL 1IHZA 2ZM6Q 2IX0A 2ICIA 3K7AB 4IUNA 2D62A 2WKDA 4LMQD 3Q0AA 1RL2A 2FXQA 3U50C 1GUOA 3VA5A 2B2YC 2N8NA 3UDXA 1C9OA 3N6RA 4EVOA 1CK1A 2UUAQ 2PZWA 5T1IA 2YTVA 4UPAA 1L1OC 4DR3L 1CKNA 4UP8A 1XX8A 1QUQA 5LMUL 1HQMC 3AMUA 1HXYD 3PUWA 5KNBA 1KDAA 2UUCQ 2NVXB 4BWGB 4TVAB 5FJ8H 4ZKBB 5IT9E 3FEWX 4IPGA 1K0RA 1SEBD 1DYQA 1NCVA 1PFMA 4KLKA 1L0XB 3UDFA 2F0HA 1YHQA 4TKOB 3T13A 2PQAB 1HNXQ 5E3FA 3HOXB 2AHOB 3I4MB 1B3QA 3AYHB 5EAYA 5NUCA 2SNSA 4RCOA 4FNFA 2EJMA 4LUZA 3AFPA 1GUGA 4U68A 1B1ZA 2DY7A 3TP6A 5I2YA 1GUSA 1Y69U 2IX1A 1B50A 1AEXA 2HCCA 1XPUA 1IL2A 1SAPA 1J8IA 1PTOF 4K5XA 1XPRA 3T51B 3BG3A 1N33Q 1VQ5A 4IOAA 5AFWA 1HR0Q 1M8AA 1HFNA 4DR2L 2F0KA 4KY5A 1XNRQ 1DCZA 2E2DC 1KLGD 4JYAQ 4O0AA 2IJ0A 3WDNA 4FF1A 1OXXK 2L11A 3H15A 3DWPA 4GZYC 2DJGC 2R93B 1KAWA 1S5DD 3PO2G 1V8QA 1A8VA 1TWAH 4ODGA 5IYBH 3S1MH 4FYDA 1Y8NB 2XRSD 4DAVA 1GHJA 2SDFA 1ASYA 2JXMB 2B29A 1B4OA 1RDPD 1CT1D 1KNAA 2I5LX 5IYCG 1QILA 4OO1H 1QCBD 2AQ1B 1ILQA 5EGTA 1EYCA 3M4PA 1EZ6A 5M5WH 3EJIA 4OO1I 1R9TB 3ND8A 2OT2A 1RD9D 1GJXA 1PH7A 1K0SA 2MFIA 3M4QA 4B3TL 1ZYRD 5KNDA 1EZ8A 1I50B 2B2YA 2OXPA 3W1BA 1OTCA 2H5XA 3ITPA 4PMBA 4DAPA 5GAEC 2F0VA 4ZYSA 2R92H 2B2UA 4DN4M 2Q2HA 3E0EA 4JI8Q 4DKAC 3QG1A 2HQLA 4A3FG 2X69A 4GN3B 2J0TD 3NWTA 1QVGA 1O7ZA 4RHRA 2QEJC 4K8IA 1X6OA 2NB0A 1N32Q 1GKHA 2NUCA 1HH2P 4CGYB 2L9HA 1S4ZA 3FKIB 2VB2X 1WI5A 2XWBB 1ML0D 4WFN3 3MXGA 4UY8C 3KUPA 3EVQA 3M4YA 1WTRA 4XQNA 2YTXA 1XJVA 5T1GA 2KEEA 2DN8A 5IE8A 3BZKA 3SGIA 2L5TA 1TU2B 5JPMC 1VQIA 4C2MB 1KDBA 2RF4A 3OMCA 3HOYB 3GO5A 2UUCL 2DNEA 4PZ8A 4JG2A 2EYMA 3CMAA 4YWLA 4OIJA 1B44D 4R4TA 1R9TH 2XRQD 3G7LA 1NY4A 3A74A 3KLSX 2F0OA 4ALPA 1STNA 2OQKA 4NDXA 2PW7A 1JOOA 3OSOA 1CA5A 3NTHA 4WJ3M 3J7AF 1F77A 2NYZD 1YEZA 1PZID 1DOKA 2E75C 5CV9A 4YIJA 1K9MC 3HGBA 1TWAB 4HJ5A 5EPJA 4OHJA 5CV4A 4KD4A 1LYLA 2PQEA 5CR3A 1SFOH 3NBHB 5IGFA 4MIUA 4BA2I 1WTVA 4HCSA 1I6HH 3NPPA 1N33L 1YI2A 1GVPA 5DLQE 3HOZH 4LW1A 5DM63 4BY1H 1EOTA 4DR4L 1Z6HA 5M5XB 3BU2A 1MHWC 4PMWA 2B2VA 3S1QH 1SMXA 2K50A 3J7ZC 2K5WA 3U4ZA 1PFSA 4OL7A 4CJ2C 4RKBA 1HNXL 3C3LA 3NK9A 5FLMH 3J81i 4QJFA 2DUDA 3VYUA 1I4HA 4TSSA 4WORA 2OWOA 4XYQA 1BBUA 4F87A 3VDYA 1PH3A 3CCQA 4EX5A 5CORA 1SXTA 4K5WA 4R9WA 4DUYL 5C44G 3H0GG 4CKCA 5JEAG 4C3HH 2V4DA 3T4AC 1LACA 2CHBD 4FVMA 3V2TA 4RA8A 4B3RQ 2EYOA 1C48A 2IY5B 1SBBB 2AWNA 2HD3A 1PH4A 2R93G 5C4HA 5COYA 3M4OH 3RN2A 1TXYA 1WCMB 4B9XA 1JC7A 5IGGA 4DR5L 1EQRA 1PRTC 3RZOH 2G9HD 3GTKB 3IFDA 1AH9A 3GTKH 3WWVA 1O7YA 1SYBA 4P73A 1IYUA 1HZBA 4O2DA 2IHFA 1RTOA 3WOEA 1WCMH 4JI2L 2UXBQ 1JR0D 5JJLA 2JEBI 1VQHA 4GLAC 5K36H 3K80C 5CGKA 4X62Q 1N32L 1S5CD 2N3SA 3ICEA 1PA6A 1K3BC 4HJAA 4C1NI 4GOPA 2JJQA 1LLRD 5HGQA 2CWAA 2WKCA 1JWMD 3D31A 1BCPD 3AEVA 4MNOA 1L2FA 2O5IC 5IYBG 3G4SA 1PLFA 3OIQA 3PUZA 3SVMA 1WFQA 2KVMA 4L8JA 1GUTA 4RWSC 3P7JA 5FO7B 5M5YB 3CRKC 1PYSB 3BDOA 3CF5A 1X65A 2B63G 2BA1A 2ZXPA 2N78A 4BBRG 2AWOA 3NSWA 3AQQA 4O1NA 1TS4A 4H13C 1NBWA 3SEBA 5HGTA 3NP8A 4EQNA 3SR1A 4KHPL 3NBIA 1HTLD 4GNXB 5AJ3L 1W3SA 4DNIA 2YYZA 3D4DA 4K5VA 3NTKA 1I6HB 2A8VA 3ULJA 2EVBA 1RCVD 4OONA 2MGSA 3PMFA 2CW0D 2JA7H 1TT2A 1ZKOA 4A3DB 4F7XA 2VY3A 4B3RL 4QUCA 3PCOB 4YCVA 1YVCA 4BA1I 4A3DH 3HOUG 2K5DA 1LT3D 1EOVA 4L5TA 5FO8B 2O5JC 1A62A 3RMHA 4CJ1B 2UXDQ 4UHVA 2FMMA 1YJ9A 1AP0A 2DNCA 4LF5L 3S24A 3KOJA 1EIGA 4IPHA 3OHXC 3UDGA 2HQEA 1SYEA 2QCPX 2RDGA 2XGTA 5M3MH 3VYTA 4GLXA 2MO1A 1MGSA 3PIPA 3OMGA 1JJGA 1EYAA 5IGDA 2I07B 3K0YA 4DF7A 1WTOA 1K8MA 4Z9CB 5A35A 4KKTA 2A69D 2HT1A 3RR5A 1SNDA 3DEOA 4A3LH 1ENCA 4DK3C 3RZDH 3HEJA 3E5SA 1JT8A 4X3KA 3MEFA 2WACA 2NVTH 4RH6A 4YCWA 4DAYB 2NVTB 3M3YB 5M3FH 4Y7NB 2CW0C 1LTAD 1X56A 1IBML 2F0LA 2B8FA 3KDFB 1YNJD 3CQZH 2E76C 1HUMA 3GTQB 5C0XJ 2F03A 2YU9B 4OO1G 3A56A 2KQ3A 1MD2D 1O78A 3BYTB 4GNXA 3K5OA 4DV0Q 1W6JA 3B6YA 3S1NH 1FVIA 3CCRA 4A3GG 2A1AA 2PPBC 1SE8A 1B2TA 5EQ0A 1SE3A 1CI3M 3MXUA 1VQFA 2RDFA 4X64Q 4JI3Q 2K33A 2B39A 4LFBL 1JE4A 5C3EG 5F2DA 3T1HL 1OXUA 3U9SA 2XNAC 1KL9A 1LT6D 1AZPA 1U4PA 1PMRA 2RCFA 2AQ3B 4K2LA 4RHSA 5GROA 4CKBA 2Q2IA 1VQJA 2X6GA 3I7FA 4A75A 3S16B 4KKUA 3HP3A 1MI2A 3H91A 4AYBG 1F2MA 2Q8RE 4YHHL 3NTIA 2JA8B 1SYDA 3GTMH 2Z4IA 1HHVA 5C5LA 1CHPD 2WAQG 2NTTA 3FVQA 4LFBQ 4DXGA 2NN6H 4DUZQ 3CRLC 4A3BH 1BO0A 3KJPA 1R4QB 1A6XA 3D6CA 5G3LD 4DV7L 2R92B 3PF4A 1K73C 2CH4A 1A0IA 4KHZA 1STAA 1SFOB 4XTCS 4YY3L 1KAAA 2HUGA 1TQOA 5JPNC 3TQYA 2A73B 5J1ZA 3V96A 3EIVA 4GOPB 1TWGH 4PZ6A 1SYFA 3UE1A 5C3WA 1K83B 5M3MG 3K5NA 3I70A 2KEDA 3OTOL 4H7BA 5A2QE 4JI0Q 2A6HC 1SE2A 2GVAA 3AU7A 1VQPA 4N9TA 1NJIC 1O80A 1TIID 1Q12A 5FO9B 3S17H 1U4LA 3Q23A 4QQBX 1EU4A 3W1GA 5M5YH 3I91A 5DAUA 4C1NK 3I4OA 1N36Q 2B2TA 4A3LG 2EYFA 1CZWA 2V1CC 1KHIA 2Z6KC 4DV5L 1LTBD 3SHLA 1SYCA 2B2UC 3J80E 3RLFA 3FHWA 4HTHA 1IBLL 2A6ED 4AYBE 2AUJD 4HN7A 1DZ1A 1SNCA 1F9PA 2Y0SB 3TN2A 5J22A 1VMCA 1DM0B 1A63A 5C6AA 3FKIH 3HOWH 4TRDA 4OELB 1YITA 3PUYA 5I9OA 2KHIA 2ZTEA 4RGTA 5FLMG 2B2WA 1N8RC 2KBNA 2VQEL 1XMQL 4WJ4A 3MAQA 5C4XG 2B8GA 1WVLA 4MTNA 2G5DA 2ZXRA 1D5MC 1PVOA 1KQSA 3HOXG 2OF1A 2JA9A 4GKJL 4DV1Q 3PQIA 3ZJYC 2PZUA 2RSNA 2QGQA 1EQVA 4OWTB 3A0JA 3GTPB 4A3DG 3D4RA 2NTSA 5IP7H 3O13A 1NUCA 3DWQA 3KF6A 4LF7Q 1FJGQ 3HOYH 4BY7G 1CKNB 1HA6A 3DWAA 3R8BA 3DXJC 2MPMA 4ABNA 2VQEQ 1XMQQ 1I4XA 2ENBA 2QA4A 1JE5A 3V05A 5KIXA 3CCSA 1VQBA 3RZDB 4NP5A 3RLOA 1FNVA 4HCEA 3HOVB 4ZUIA 2EJFC 2P5ZX 3NE5B 1LV9A 1EY8A 1L1OA 2HCIA 2UXCL 1CTMA 2N88A 1QZHA 4DV4L 2F1MA 4QB4A 1G291 1KIXA 3H0GH 5JEAH 4FXDA 5BR8Q 3J7AV 4HIMA 1Y1VG 3SK6A 3VYRA 3U9OA 1U4MA 1JQYD 4QMGA 5ISRA 3A55A 2R93H 2VZAA 4LFAQ 4B3TQ 4IALA 3A5ZB 1A3VA 1O7IA 3CHBD 1IKLA 5I2XA 1GUWA 2VXWA 1SNQA 2F0MA 4DR3Q 2WB1E 4LF8L 4EGVA 1VQDA 1NE3A 1ZYRC 4GN5A 3JAML 1S72A 1TWFH 1ESFA 2DJFC 3RLNA 1PH1A 3K6OA 1PYBA 3HKSA 4YY3Q 4IUQA 4ZAIA 2ZJQA 1QUQB 3HRZC 5CV5A 5IGCA 1XNQQ 1UWVA 4JI0L 1HRJA 3GTOH 3GTOB 1AE3A 4R4IA 4JI7Q 2K5NA 2ZJPA 1QE6A 5CBEE 2QILA 2JA7G 3CCUA 3CXCA 1LT4D 4A3IH 3U58A 1HNWQ 5GAGC 2CKZB 2R6GA 1D6EC 4C2MH 5IGEA 4AIMA 2NZHA 3T53B 1HZ9A 4KD3A 1D1KA 1PFBA 1DGSA 4A4IA 1VQ4A 5IYDG 4DR2Q 4ME5A 1X54A 3ZYYX 4IUVA 3GTLB 3PV0A 5LHY1 3EROA 3J81E 2EYHA 4CHTB 4IZ8A 5C4XH 4ZCKA 4U673 4G7ZC 2HDLA 4K8JA 1UE7A 2ALYB 4JI1Q 5LMNQ 3UI2A 2KECA 2K05A 4KKSA 4XIGS 1KDCA 3P1HA 3PIOA 2Y0SE 4IPCA 4DR6L 1Y8OB 3HOUH 2RHQB 1B3AA 3IL8A 5LL6S 2K5QA 3A8IE 1UE5A 2I5HA 4B3MQ 1ENAA 3GP7A 2KCTA 3NXWA 1W6KA 2AQ2B 2GN5A 1B9NA 2F0PA 1TWCB 1STGA 5JJIA 1Y1WG 2L4NA 4HIOA 1IBKQ 2NVXH 4RMFA 4LF7L 1FJGL 2CCZA 4LJZC 1MJEA 1Q1EA 2F3WA 1KRTA 1T5EA 3KLSA 3A8KE 4IURA 3A8JE 3HKZG 1PH9A 2DY8A 2IT1A 5KYIA 1XTCD 3CMEA 1BNZA 4GKKQ 3TRZA 1CKMA 2BA0A 3F8TA 3DHQA 3K0XA 4NXNL 5BN3A 3N52A 1FYCA 3D4WA 2F0FA 1EQTA 5IT9L 1TKWB 4JCVE 4ULLA 4QL5A 3WOFA 2JE6I 2K03A 1HUNA 3CC4A 3CCMA 1BKBA 4IQZA 2NZOA 1TWCH 1TR5A 1UEBA 3F1ZA 4KMUC 3CKIB 1G8ZD 1SYGA 3H3VI 3FMCA 1TWHB 2Q8TA 4CBVA 2JA6H 1F9QA 4DAYA 1EUJA 2QEXA 1G2SA 4IOCA 4RCNA 4PV1C 2Y0SG 2UXBL 2NN6G 4A3BG 2E5LQ 3TS0A 1VQ8A 1D5ZC 2SNMA 1L1OB 4B08A 4GS3A 3CC2A 1QNKA 3D8GA 4DK6C 5EBDA 4C56C 1E22A 1LM0A 2F0GA 1M4VA 1I94L 1PZKD 1V9PA 2ID0A 4NKLA 3W5OA 3S15H 3R93A 4IJHA 4JV5Q 2VNUD 5EPKA 2VQFQ 3H6MA 2K5HA 2IX3A 4KTAA 4KY6A 1N34Q 1TS5A 1H9JA 2M00A 3HZXA 2F0IA 3MHBA 2GA4B 1HJPA 4DNTB 1SE4A 3M3YH 4IUUA 3LGJA 5CV7A 3Q8DA 1ET6A 1CSQA 3GDEA 2IW3A 3VR5A 3BJUA 2F4IA 4YWMA 1TY2A 1FGBD 3JAMi 4PMCA 4APVA 2F52A 5FLXL 1SROA 4Y52H 3IAYA 4MN3A 1LTGD 2E8GA 1JJCB 1YBYA 4TQUS 1HNZQ 4BBSH 1H9MA 4X65Q 3CPFA 2OEOA 2UU9Q 2R7FA 1WTPA 1TWHH 3TP7A 3ONAB 2SEBD 4JI7L 5IT9c 2F4VL 4N8X1 3S16H 5C4JB 1CQFA 1ENFA 1F9RA 5I9PA 4V190 5C5MA 4HJ8A 1I6VC 2R61A 1HA5A 3CC7A 2C5CA 3CW2C 1T5XD 3S14B 1E3PA 3F2UA 1L0YB 4LNQA 2PYKA 1X3PA 5E4WC 4WRDA 4PNYA 2JA5B 4DK0A 4A3CH 4IPDA 4KY7A 4JBWA 2R7DA 3MFYA 1U0LA 3DM3A 2K04A 2BOSA 3E0JA 1S5ED 5IP7G 4DR5Q 4A3EH 2RVLA 3P75A 3HOUB 2PI2E 2K28A 2JA5H 1Q8IA 5FOBB 4GKJQ 3GTJB 2RKSA 4MTKA 5HURA 3ND9A 1E7ZA 1TWGB 5C3XA 4FF4A 5IIFA 2FHTA 2K01A 4DA2A 3KLWA 3MVVA 5C0XH 4HIKA 1PFNA 1WD1A 2C9OA 2JA6G 4NXML 1HFGA 1WYDA 2JP1A 1A2TA 1EIFA 3FDTA 1WCMG 1VQ9A 2ATWA 1KLUD 2A6EC 1QNUA 2I5MX 4J15A 1Q81C 2NZ1D 5FJ8G 3IRBA 4IUTA 3BDLA 2BH8A 1EY5A 5H1SE 4LF6L 3T16A 5JJZA 1VQGA 4IFDJ 1G2TA 3F2CA 4JBMA 2CVRA 5CBAE 2MUYA 4JI3L 4X64L 2RDHA 1CA6A 1SNOA 3OPOA 3I4NB 1LTSD 3HKZB 1B7YB 2F4VQ 1STBA 5FLXE 4FF3A 1I3QB 1TY0A 4LFCL 1SDFA 1C8CA 4OX9Q 1LTRD 3FPPA 4H0LC 2FINB 1GD7A 2A6HD 2B3GA 1NSNS 4DUZL 3QWNA 1JB7A 3JC66 4GN4B 1BBXC 1JOQA 4C3HG 1EY7A 5G3LF 1JORA 2YTYA 3KF6B 1N34L 4KN7C 3FRPB 2F3VA 2ZT9C 4OWXB 1Y14B 1Y1WB 4V0BA 5KYLA 2VW9A 4RAUC 3I56A 3S2HH 4DR7L 2VB3X 4XT1B 1ZXTA 3IKJA 4IO9A 4QF4A 3D0FA 5D3DA 4DU9A 2BDOA 2EY2A 3MA2B 3NEMA 5IWAL 4FDBA 3PO2B 1D2BA 2QDBA 2EYPA 1VQOA 2PZTA 3KF8A 4KN4C 4BS9A 3L2PA 1G51A 1EWCA 1K8OA 4G7HC 2MQHA 4A3MH 3PO3H 4GNXC 3I73A 2MHVA 4NPSA 2J4XA 1IKMA 1JWUD 4HJ7A 3F2BA 3I90A 2AKWB 5I6WA 4B3SQ 5KGUA 4A3IG 3TMEA 2QDLA 2R92G 4HSPA 1Q46A 4CDFC 3H0GB 1V1QA 4JI8L 2F0EA 3M7NA 2UXCQ 5IYDH 3GTGH 5M3FG 1B9MA 3CP0A 3SXHA 4A3FB 3SK8A 5C0XG 1BCPF 1YNJC 1HNZL 1OXSC 2KCNA 3VR2A 5BN5A 2RBMA 4JC0A 4DV2L 1TWFB 4P74A 4POGA 2B2VC 1VS0A 3AB9A 4H02A 1U5KA 2EQSA 3S2DB 3W2DA 2LFNA 3T1YL 4LF4Q 4LUVA 1GXDC 3J7YW 4QIWE 3GTMB 2EDGA 5C4XB 1PH6A 1LTID 3NUCA 1L0WA 4LWCA 1B53A 5GADC 1BCPB 2A69C 2OTJA 2NVYB 2YU9H 2O4XA 1IYVA 4JI4Q 1STHA 3PSIA 4X66Q 2VUMH 5IGBA 1PTOH 4G57A 2K6AA 1MJCA 2F0SA 3K59A 4DUYQ 1Z7TA 1IW7C 5D3IB 1MSGA 1PDQA 1LTTD 1J5EL 3CCVA 2EY5A 4QUFA 1GM5A 4HIDA 2JK8A 4L5QA 4I65A 2F0TA 4KHVA 4FP5D 4M8AA 4RKLA 4HSVA 1B70B 3QOJA 1HNWL 3DMUA 3K58A 2WIIB 2XIWA 1EYDA 2CFMA 2R3ZA 1PTOC 3CPWA 3S1NB 2O2LD 4I7AA 3HOVG 3VR6A 1DD2A 1AE2A 5D14A 5LMNW 2WB1G 3VR4A 1NR2A 4X62L 4JI1L 4ID6A 4K14A 4OWWB 3E6ZX 1NAPA 2K75A 4HEDA 4A93B 2NVQH 3M7GA 2VQFL 4XYOA 1MSHA 1ASZA 2G9DA 4POFA 2L15A 1Y8PB 3MZ5A 3J7A5 2XTIA 3TEHB 4UP9A 4K6DA 1DXMA 3TBIB 1Q86C 2JA8H 1E1TA 3BZCA 3PF5A 1XNRL 2GVBA 3AFQA 1NNXA 2SOBA 5M5XH 1BCPC 3M85A 2Z4HA 3MEHA 4UDUC 3HFZB 5M9OA 3ULPA 1EIYB 5JJKA 3CCEA 4J8QA 2D0PA 3SK4A 1IBKL 2EYJA 1R4PB 1BOSA 2BE5D 4A76A 3L7ZC 1IZ6A 1FR3A 3R2IA 1ICWA 4DV3Q 4MZ9A 1YZ6A 4FF2A 4GOPC 3L0OA 5ELOA 1DOMA 4BXXH 1GO3E 4JI6Q 5M3MB 4ZLTF 2LXJA 1PH2A 2UU9L 2JYOA 2PNRC 4LK1C 2OTLA 2EJGC 3G6EA 4OXPA 4J6HA 4G4KA 4RFBA 3D6WA 1PRTD 3L9AX 4NW2A 1K83H 5DM73 2OQ0A 4M1UB 1NTGA 4K6LA 3HOXH 2KHJA 4DR1Q 4HMJA 2MO0A 4R4CA 4O42A 1SMYD 3HOZG 1H9SB 3A7LA 4A3CG 3ULLA 1Q8KA 4DK1A 4A3KB 2H4OA 1JMCA 1T9HA 1PV4A 4JPBW 1F2LA 1Q90A 4A3GB 1PXUA 4A3EG 3PUXA 5C4ZA 3QJYA 2N55A 2C35B 2Q2TA 3GTGB 3CQZB 4QIWB 3RZOB 1KXLA 4DR1L 5C44B 1I3QH 2CQOA 1XPOA 4DV6Q 3C46A 5L37A 2B63B 1UAPA 1X32A 1FNWA 2JSOA 3J81j 3T56B 4ILWA 1IL8A 4CDDC 1H9KA 2R7ZB 1Y1VH 3F2DA 3NBHA 4QY7A 1CSPA 2NVYH 1I4RA 3QB3A 4GKKL 5CV6A 2A5HA 2EXDA 3CU7A 3K81C 1PYWD 3ER0A 4CKEA 2CH4W 1I94Q 1D8LA 1TS3A 1WJJA 1E2ZA 3MFGA 5IP9H 3URYA 1LTLA 4RGNA 3T1YQ 1WTQA 1F2YA 3MXNA 4MHEA 5CMDA 2VUMB 3OYYA 3E9IA 1BBWA 1STYA 4JI5Q 1WTHA 1VQEA 2XVSA 4OGQC 4XQJA 3UDIA 3KF8B 3TP5A 3HOZB 1RF2D 3MXPA 2L55A 3E9HA 4Y7NH 3FP9A 2F0NA 1EEID 5JVH3 1UE1A 1YNXA 1YJWA 1Q82C 5LMUQ 5IODA 1SJED 3IFTA 3I4MG 4CDEC 1QWYA 4JV5L 3PIO3 2E74C 3NHHA 2K52A 2Z6BA 1SSOA 4X65L 1FNUA 1P16A 1ESRA 1I4PA 3RD4A 4X3TA 2LS01 4A3FH 1G6PA 5IYCH 2QF7A 2EZVA 2D2CC 3CCJA 1E0BA 4A93G 4XXEA 1JICA 4DAMA 4KK7A 5EBCA 4AQYQ 2EOTA 2JA7B 1RTNA 2QKIC 1YHAA 3KFUA 1AW7A 4YCUA 1LABA 1I5FA 4F8MA 1VQCA 1KABA 3K5MA 3GQBA 3EQLC 4LF5Q 4A3GH 3KBGA 1RODA 1YJNA 2MJ8A 3H3VC 2RSOA
chains in the Genus database with same CATH topology
3RZDH 4JOIA 3OW2A 1LUZA 1EQQA 4HJ8A 4IFDG 1JT8A 3GD7A 4GLVB 3RNUA 3MEFA 5GQOA 3CC7A 3S2DH 3CW2C 2NVTH 3DLLA 1E3PA 4OX9L 2K4KA 4YCWA 4DAYB 3U4VA 4LNQA 5M3FH 4JBKA 1QZGA 4A3CH 4IPDA 4IFDI 3KJOA 1S3OA 1X56A 1IBML 1Z9FA 4JBWA 2R7DA 1U0LA 3KDFB 3K7UC 3CQZH 4KHPQ 2PQAA 2K5VA 3DM3A 5C0XJ 4DV3L 3HOYG 4OO1G 5J3BA 3HKZE 2R7ZH 1K8GA 5IP7G 4DR5Q 4A3EH 2ES2A 2JA8G 3GTQH 1KD1C 1VQLA 4GNXA 2PI2E 1EFWA 4B3ML 4DV0Q 2JA5H 4LF9L 3B6YA 1I50H 4GKJQ 3S1NH 1SR3A 1FVIA 5IWAQ 4HJ9A 3CCRA 4A3GG 2A1AA 1SE8A 4AH6A 1E7ZA 2HHHL 1VQFA 4NB3A 4X64Q 4JI3Q 3KLWA 4LFBL 5C3EG 2RCNA 3T1HL 1OXUA 4HIKA 2WAQE 3NENA 3MXNB 1KL9A 4LF8Q 2N49A 2JA6G 4NXML 1WYDA 5LMNL 1EIFA 1Q7YC 5GROA 1WCMG 1VQ9A 4DV4Q 1VQNA 2ATWA 2Q2IA 1VQJA 5ELNA 2UUBQ 3GTLH 3K8AA 3TREA 5IP9G 2VNUD 4JYAL 2I5MX 4J15A 1Q81C 3UE0A 3I7FA 5FJ8G 4A75A 3IRBA 2WFWA 4A3KH 1UE6A 4DPGA 2K14A 4AYBG 3EBEA 4YHHL 1HR0L 2BH8A 4LF6L 5H1SE 2BH2A 3GTMH 1SN8A 2JQOA 2Z6KA 1VQGA 3I4NH 4IFDJ 3F2CA 3I2ZA 1XNQL 2WAQG 3J81c 4JBMA 4LFBQ 4DUZQ 4JI3L 4X64L 5BR8L 2B63H 4A3BH 5C0XI 4C3IH 2E5LL 1B7YB 3KJPA 2ZM6Q 2F4VQ 2IX0A 1J5EQ 2D62A 2LSSA 4LFCL 2HIVA 4PZ7A 4OX9Q 1RL2A 3NELA 4DV7L 2FXQA 3U50C 1GD7A 1E24A 3PF4A 2B3GA 4DUZL 2N8NA 1JB7A 3JC66 3UDXA 1SRUA 1C9OA 1K73C 4GN4B 1XMOQ 1A0IA 4KHZA 2UUAQ 2YTVA 4UPAA 1L1OC 4DR3L 1CKNA 4XTCS 4YY3L 4UP8A 4LF4L 1QUQA 5LMUL 2YTYA 1Y1WH 3KF6B 3PUWA 1N34L 2E2JH 3TQYA 2UUCQ 3EIVA 4OWXB 4GOPB 4TVAB 5FJ8H 1TWGH 1Y14B 4IPGA 4PZ6A 2JEAI 1K0RA 3UE1A 1XTDA 2VW9A 3I56A 3HOWG 3S2HH 1NMFA 4KLKA 5M3MG 2IHEA 3UDFA 1YHQA 4A93H 4DR7L 2PQAB 1HNXQ 3OTOL 4JOIC 4JI0Q 2AHOB 4IO9A 1JJGA 2GVAA 3AYHB 5EAYA 3D0FA 1VQPA 1NJIC 2Q2UA 4X6AH 1Q12A 4LUZA 3S17H 3AFPA 1CUKA 3NEMA 4QQBX 3S1RH 2WP8J 5IWAL 1X55A 2UUAL 3W1GA 4B3SL 4LF9Q 4FDBA 5M5YH 3I4OA 1N36Q 4A3LG 2DGYA 2V1CC 2IX1A 1KHIA 1VQOA 2Z6KC 1XPUA 1VQAA 1KRSA 1G51A 3L2PA 4DV5L 1IL2A 1X3GA 2KCMA 1EWIA 1XPRA 1N33Q 1VQ5A 2MQHA 4IOAA 1HR0Q 4A3MH 1C0AA 3PO3H 3RLFA 3FHWA 4DR2L 1IBLL 4GNXC 4AYBE 1XNRQ 4A3JG 4JYAQ 4O0AA 4NPSA 1A63A 3FKIH 3HOWH 2UUBL 1PH5A 1OXXK 3H15A 3F2BA 4HJ7A 1YITA 3PUYA 2KHIA 2ZTEA 1KAWA 2KENA 2AKWB 5FLMG 1N8RC 4B3SQ 3PO2G 2KBNA 4A3IG 2VQEL 1XMQL 1A8VA 4WJ4A 4LUOA 2R92G 1TWAH 5C4XG 5IYBH 1Q46A 3GTJH 5C44H 4MTNA 4DV2Q 3S1MH 4R4OA 1PVOA 1KQSA 3HOXG 1V1QA 4JI8L 2JA9A 4GKJL 4DV1Q 1ASYA 4P75A 2B29A 3M7NA 2UXCQ 5IYDH 3ZJYC 3GTGH 5M3FG 2I5LX 3CP0A 5IYCG 2QGQA 3ERSX 4OWTB 3A0JA 1YIJA 3I4MH 5C0XG 4A3DG 2LXKA 1HNZL 1V43A 1OXSC 5IP7H 3M4PA 5M5WH 4OO1I 3KF6A 4JC0A 4DV2L 4LF7Q 4P74A 1FJGQ 1CKNB 1IXRA 3HOYH 4L5SA 1PH7A 4BBSG 4POGA 1VS0A 4QGUA 4H02A 1U5KA 2EQSA 2ZTDA 2VQEQ 1XMQQ 2MFIA 2QA4A 3T1YL 1JE5A 4LUVA 4LF4Q 3S14H 4QIWE 3CCSA 2ZTCA 3M4QA 1VQBA 3FKIG 4B3TL 4BXXG 1C7YA 1VQ7A 4BBRH 2F3IA 1PH6A 3RLOA 2JA5G 1L0WA 3W1BA 4LWCA 1OTCA 2H5XA 5GADC 5GAEC 1L1OA 4EQ5A 2UXCL 2OTJA 2R92H 5K36G 1HZCA 2Q2HA 3E0EA 4JI8Q 4DKAC 2HQLA 4DR6Q 4A3FG 1QZHA 1MIUA 4DV4L 2YU9H 4GN3B 1G291 1KIXA 3H0GH 5BR8Q 1QVGA 3KYHC 4JI4Q 4HIMA 1Y1VG 3PSIA 4X66Q 3A5UA 2VUMH 3KDFA 1X6OA 4RG1A 1N32Q 1MJCA 4DUYQ 5AJ3Q 4LF6Q 2R93H 1BVSA 1GKHA 1HH2P 2VZAA 2A19A 4LFAQ 4B3TQ 1J5EL 3A5ZB 3CCVA 1O7IA 4DV6L 1GM5A 1WI5A 4HIDA 1IBLQ 4UY8C 2JK8A 4L5QA 1B8AA 4DR3Q 1VQKA 2WB1E 4LF8L 2YTXA 1VQDA 4DV5Q 1XJVA 1NE3A 1B70B 5IE8A 1H95A 4GN5A 3BZKA 3SGIA 1HNWL 2UXDL 1VCIA 1S72A 1K8AC 1VQIA 3CAMA 2RF4A 2CFMA 3I55A 1TWFH 3GO5A 2UUCL 4IJLA 4LFAL 4PZ8A 4JG2A 4DV0L 3CMAA 3J80c 3RLNA 3CPWA 4YWLA 1PH1A 3PGZA 1PYBA 3HKSA 1X3EA 2MNAA 4YY3Q 3RN5A 3HOVG 4R4TA 1R9TH 2ZJQA 1QUQB 1NY4A 3A74A 1AE2A 4X66L 3M9BA 4ALPA 3T1HQ 1UWVA 5LMNW 2WB1G 4JI0L 1XNQQ 3OTOQ 3GTOH 2OQKA 3GTPH 4X62L 4JI1L 1AE3A 4OWWB 4R4IA 2K75A 2K5NA 5IY0A 2ZJPA 4JI7Q 4WJ3M 2NVQH 2VQFL 2JA7G 1YEZA 3CCUA 4ME3A 1ASZA 4POFA 2L15A 3CXCA 1K9MC 3PO2H 4A3IH 3U58A 3J7A5 5GAGC 2CKZB 2R6GA 2XTIA 4C2MH 1HNWQ 3TEHB 2HIXA 4UP9A 5C3EH 4HJ5A 3G71A 4A3JH 1J6QA 4AIMA 2NZHA 4K0KL 1Q86C 1EYGA 2JA8H 1HZ9A 1LYLA 2VS1A 1E1TA 3BZCA 2YV5A 3PF5A 1DGSA 1M90C 1XNRL 4A4IA 2GVBA 1VQ4A 3AFQA 3NBHB 1SFOH 5IYDG 4DR2Q 1IYJB 5M5XH 4BA2I 1NMGA 1I6HH 1X54A 1N33L 1YI2A 3M85A 1GVPA 4PG3A 3EN2A 3PV0A 5DLQE 4LW1A 3HOZH 3ULPA 2NN6I 3HFZB 1EIYB 5C4XH 4BY1H 4KI0A 3CCEA 1YHBA 4DR4L 5JJKA 2D0PA 3BU2A 1UE7A 2ALYB 1QVFA 4PMWA 4JI1Q 1IBKL 5LMNQ 3S1QH 4A76A 1SMXA 2K50A 3J7ZC 3L7ZC 3U4ZA 4A3MG 1IZ6A 1PFSA 4DV3Q 4MZ9A 1YZ6A 4AQYL 4BY7G 4GOPC 3L0OA 2EIFA 2OCEA 4XIGS 5ELOA 3STBC 5FLMH 1HNXL 3J81i 2HHHQ 1GO3E 4JI6Q 3PIOA 4QJFA 4BXXH 2Y0SE 2CWPA 4IPCA 2DUDA 1JJ2A 3HOUH 4DR6L 2RHQB 2OWOA 2LXJA 1BBUA 1UE5A 2I5HA 1PH2A 2UU9L 4B3MQ 3VDYA 1PH3A 1MKHA 2D0OA 3CCQA 2OTLA 2E2HH 2KCTA 4EX5A 2GN5A 4OXPA 3G6EA 3H3VH 4DUYL 1K83H 5C44G 2OQ0A 3H0GG 5JEAG 4C3HH 1NTGA 3HOXH 5JJIA 1Y1WG 2KHJA 4DR1Q 1X3FA 2MO0A 4HIOA 1IBMQ 5E7NA 4R4CA 1IBKQ 4B3RQ 2NVXH 4RMFA 4YWKA 4DV7Q 4LF7L 1FJGL 2E2IH 3HOZG 2IY5B 2AWNA 1PH4A 2CCZA 1MJEA 4LFCQ 2R93G 4A3CG 1VQMA 3ULLA 1Q8KA 2I0QA 3RN2A 3M4OH 1D7QA 2PMZE 1Q1EA 1TXYA 1KRTA 1OXTA 1JMCA 4DR5L 1EQRA 1T9HA 3HKZG 1PH9A 3PO3G 2IT1A 1PV4A 3RZOH 3CMEA 1HZAA 1P8LA 4GKKQ 4C3JH 4A3EG 3PUXA 1CKMA 2BA0A 3TRZA 3F8TA 1AH9A 3GTKH 1SLJA 2C35B 3WWVA 2Q2TA 5GAHC 3K0XA 4P73A 4NXNL 4DR1L 1RIPA 1I3QH 2CQOA 1KXLA 1XPOA 1HZBA 4O2DA 4DV6Q 2IHFA 4JI2L 1WCMH 2UXBQ 3STBD 5JJLA 2JEBI 1VQHA 4GLAC 4DR7Q 3K80C 4JCVE 3J81j 3PUVA 4QL5A 4X62Q 1N32L 2N3SA 5HY6A 3ICEA 1PA6A 2JE6I 4HJAA 4GOPA 3CC4A 2JJQA 3CCMA 1Y1VH 3F2DA 4QY7A 5HGQA 1CSPA 1BKBA 2CWAA 2NVYH 2NZOA 1TWCH 3CD6A 1UEBA 3D31A 3F1ZA 5C4JH 1W2BA 2ASBA 3AEVA 4NXMQ 4GKKL 2EXDA 1X9NA 3K81C 4MNOA 1L2FA 2R7ZG 5IYBG 3G4SA 3H3VI 3PUZA 3G48A 1WFQA 2JA6H 3I4NG 2VL6A 1EUJA 1WOCA 3ER0A 1I94Q 2QEXA 1D8LA 1WJJA 4IOCA 1M1KC 1S40A 4DR4Q 2Y0SG 2UXBL 2NN6G 1PYSB 4JI2Q 5IP9H 3CF5A 1LTLA 1X65A 3T1YQ 1PHJA 4UP7A 2B63G 2BA1A 2E5LQ 3TS0A 4A3BG 4P71A 1VQ8A 2N78A 4BBRG 3OYYA 3E9IA 2AWOA 1BBWA 2PI2A 3AQQA 1Z47A 1L1OB 4JI5Q 4GS3A 4JBJA 1NBWA 3CC2A 4DK6C 1VQEA 4KHPL 1E22A 4R4QA 1LM0A 1PH8A 4BY1G 4GNXB 1I94L 3UDIA 3KF8B 1V9PA 2ID0A 1W3SA 5AJ3L 3W5OA 3S15H 4DNIA 2YYZA 4IJHA 3CCLA 4JV5Q 2A8VA 3ULJA 3HOVH 2RHSB 1QVCA 3J80i 2VQFQ 4JI5L 4A3KG 4BY7H 2K5HA 4OONA 5JEAJ 4DV1L 3E9HA 4JI4L 4L5RC 1N34Q 4Y7NH 3FP9A 2JA7H 1YJWA 1Q82C 1UE1A 1YNXA 1Q1BA 5LMUQ 4K0KQ 2VY3A 2ZJRA 4B3RL 4P72A 1FL0A 3PCOB 1YVCA 4YCVA 4BA1I 3I4MG 4A3DH 1HJPA 3HOUG 3M3YH 3LGJA 4JV5L 1EOVA 3Q8DA 4L5TA 2AMCB 1CSQA 1A62A 2K52A 3GDEA 2UXDQ 2Z0SA 4X65L 1K3RA 3BJUA 1P16A 4YWMA 1YJ9A 4LF5L 3S24A 3KOJA 1VQ6A 4IPHA 5FLXc 4A3FH 3JAMi 1G6PA 1FGUA 1CKOA 3K7AH 5IYCH 1OXVA 3UDGA 4APVA 4NXNQ 1N9WA 2F52A 3CCJA 1SROA 4Y52H 2XGTA 5M3MH 4A93G 4DAMA 4GLXA 4AQYQ 2PNHA 2MO1A 2E8GA 1JJCB 1YBYA 4TQUS 3PIPA 1HNZQ 4BBSH 1YHAA 4X65Q 2VUMG 3CPFA 4YHHQ 3KFUA 4YCUA 1HR0W 1I5FA 1N36L 1VQCA 4R1JA 1KC8C 2UU9Q 2R7FA 1E1OA 1TWHH 4LF5Q 4JI7L 5IT9c 2ZM6L 2F4VL 3TS2A 4A3GH 2HT1A 4JI6L 1YJNA 3JAMc 3S16H 3RR5A 4A3LH 1XMOL 4DK3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD H;  4JOI A;  3OW2 A;  1LUZ A;  1EQQ A;  4HJ8 A;  4IFD G;  1JT8 A;  3GD7 A;  4GLV B;  3RNU A;  3MEF A;  5GQO A;  3CC7 A;  3S2D H;  3CW2 C;  2NVT H;  3DLL A;  1E3P A;  4OX9 L;  2K4K A;  4YCW A;  4DAY B;  3U4V A;  4LNQ A;  5M3F H;  4JBK A;  1QZG A;  4A3C H;  4IPD A;  4IFD I;  3KJO A;  1S3O A;  1X56 A;  1IBM L;  1Z9F A;  4JBW A;  2R7D A;  1U0L A;  3KDF B;  3K7U C;  3CQZ H;  4KHP Q;  2PQA A;  2K5V A;  3DM3 A;  5C0X J;  4DV3 L;  3HOY G;  4OO1 G;  5J3B A;  3HKZ E;  2R7Z H;  1K8G A;  5IP7 G;  4DR5 Q;  4A3E H;  2ES2 A;  2JA8 G;  3GTQ H;  1KD1 C;  1VQL A;  4GNX A;  2PI2 E;  1EFW A;  4B3M L;  4DV0 Q;  2JA5 H;  4LF9 L;  3B6Y A;  1I50 H;  4GKJ Q;  3S1N H;  1SR3 A;  1FVI A;  5IWA Q;  4HJ9 A;  3CCR A;  4A3G G;  2A1A A;  1SE8 A;  4AH6 A;  1E7Z A;  2HHH L;  1VQF A;  4NB3 A;  4X64 Q;  4JI3 Q;  3KLW A;  4LFB L;  5C3E G;  2RCN A;  3T1H L;  1OXU A;  4HIK A;  2WAQ E;  3NEN A;  3MXN B;  1KL9 A;  4LF8 Q;  2N49 A;  2JA6 G;  4NXM L;  1WYD A;  5LMN L;  1EIF A;  1Q7Y C;  5GRO A;  1WCM G;  1VQ9 A;  4DV4 Q;  1VQN A;  2ATW A;  2Q2I A;  1VQJ A;  5ELN A;  2UUB Q;  3GTL H;  3K8A A;  3TRE A;  5IP9 G;  2VNU D;  4JYA L;  2I5M X;  4J15 A;  1Q81 C;  3UE0 A;  3I7F A;  5FJ8 G;  4A75 A;  3IRB A;  2WFW A;  4A3K H;  1UE6 A;  4DPG A;  2K14 A;  4AYB G;  3EBE A;  4YHH L;  1HR0 L;  2BH8 A;  4LF6 L;  5H1S E;  2BH2 A;  3GTM H;  1SN8 A;  2JQO A;  2Z6K A;  1VQG A;  3I4N H;  4IFD J;  3F2C A;  3I2Z A;  1XNQ L;  2WAQ G;  3J81 c;  4JBM A;  4LFB Q;  4DUZ Q;  4JI3 L;  4X64 L;  5BR8 L;  2B63 H;  4A3B H;  5C0X I;  4C3I H;  2E5L L;  1B7Y B;  3KJP A;  2ZM6 Q;  2F4V Q;  2IX0 A;  1J5E Q;  2D62 A;  2LSS A;  4LFC L;  2HIV A;  4PZ7 A;  4OX9 Q;  1RL2 A;  3NEL A;  4DV7 L;  2FXQ A;  3U50 C;  1GD7 A;  1E24 A;  3PF4 A;  2B3G A;  4DUZ L;  2N8N A;  1JB7 A;  3JC6 6;  3UDX A;  1SRU A;  1C9O A;  1K73 C;  4GN4 B;  1XMO Q;  1A0I A;  4KHZ A;  2UUA Q;  2YTV A;  4UPA A;  1L1O C;  4DR3 L;  1CKN A;  4XTC S;  4YY3 L;  4UP8 A;  4LF4 L;  1QUQ A;  5LMU L;  2YTY A;  1Y1W H;  3KF6 B;  3PUW A;  1N34 L;  2E2J H;  3TQY A;  2UUC Q;  3EIV A;  4OWX B;  4GOP B;  4TVA B;  5FJ8 H;  1TWG H;  1Y14 B;  4IPG A;  4PZ6 A;  2JEA I;  1K0R A;  3UE1 A;  1XTD A;  2VW9 A;  3I56 A;  3HOW G;  3S2H H;  1NMF A;  4KLK A;  5M3M G;  2IHE A;  3UDF A;  1YHQ A;  4A93 H;  4DR7 L;  2PQA B;  1HNX Q;  3OTO L;  4JOI C;  4JI0 Q;  2AHO B;  4IO9 A;  1JJG A;  2GVA A;  3AYH B;  5EAY A;  3D0F A;  1VQP A;  1NJI C;  2Q2U A;  4X6A H;  1Q12 A;  4LUZ A;  3S17 H;  3AFP A;  1CUK A;  3NEM A;  4QQB X;  3S1R H;  2WP8 J;  5IWA L;  1X55 A;  2UUA L;  3W1G A;  4B3S L;  4LF9 Q;  4FDB A;  5M5Y H;  3I4O A;  1N36 Q;  4A3L G;  2DGY A;  2V1C C;  2IX1 A;  1KHI A;  1VQO A;  2Z6K C;  1XPU A;  1VQA A;  1KRS A;  1G51 A;  3L2P A;  4DV5 L;  1IL2 A;  1X3G A;  2KCM A;  1EWI A;  1XPR A;  1N33 Q;  1VQ5 A;  2MQH A;  4IOA A;  1HR0 Q;  4A3M H;  1C0A A;  3PO3 H;  3RLF A;  3FHW A;  4DR2 L;  1IBL L;  4GNX C;  4AYB E;  1XNR Q;  4A3J G;  4JYA Q;  4O0A A;  4NPS A;  1A63 A;  3FKI H;  3HOW H;  2UUB L;  1PH5 A;  1OXX K;  3H15 A;  3F2B A;  4HJ7 A;  1YIT A;  3PUY A;  2KHI A;  2ZTE A;  1KAW A;  2KEN A;  2AKW B;  5FLM G;  1N8R C;  4B3S Q;  3PO2 G;  2KBN A;  4A3I G;  2VQE L;  1XMQ L;  1A8V A;  4WJ4 A;  4LUO A;  2R92 G;  1TWA H;  5C4X G;  5IYB H;  1Q46 A;  3GTJ H;  5C44 H;  4MTN A;  4DV2 Q;  3S1M H;  4R4O A;  1PVO A;  1KQS A;  3HOX G;  1V1Q A;  4JI8 L;  2JA9 A;  4GKJ L;  4DV1 Q;  1ASY A;  4P75 A;  2B29 A;  3M7N A;  2UXC Q;  5IYD H;  3ZJY C;  3GTG H;  5M3F G;  2I5L X;  3CP0 A;  5IYC G;  2QGQ A;  3ERS X;  4OWT B;  3A0J A;  1YIJ A;  3I4M H;  5C0X G;  4A3D G;  2LXK A;  1HNZ L;  1V43 A;  1OXS C;  5IP7 H;  3M4P A;  5M5W H;  4OO1 I;  3KF6 A;  4JC0 A;  4DV2 L;  4LF7 Q;  4P74 A;  1FJG Q;  1CKN B;  1IXR A;  3HOY H;  4L5S A;  1PH7 A;  4BBS G;  4POG A;  1VS0 A;  4QGU A;  4H02 A;  1U5K A;  2EQS A;  2ZTD A;  2VQE Q;  1XMQ Q;  2MFI A;  2QA4 A;  3T1Y L;  1JE5 A;  4LUV A;  4LF4 Q;  3S14 H;  4QIW E;  3CCS A;  2ZTC A;  3M4Q A;  1VQB A;  3FKI G;  4B3T L;  4BXX G;  1C7Y A;  1VQ7 A;  4BBR H;  2F3I A;  1PH6 A;  3RLO A;  2JA5 G;  1L0W A;  3W1B A;  4LWC A;  1OTC A;  2H5X A;  5GAD C;  5GAE C;  1L1O A;  4EQ5 A;  2UXC L;  2OTJ A;  2R92 H;  5K36 G;  1HZC A;  2Q2H A;  3E0E A;  4JI8 Q;  4DKA C;  2HQL A;  4DR6 Q;  4A3F G;  1QZH A;  1MIU A;  4DV4 L;  2YU9 H;  4GN3 B;  1G29 1;  1KIX A;  3H0G H;  5BR8 Q;  1QVG A;  3KYH C;  4JI4 Q;  4HIM A;  1Y1V G;  3PSI A;  4X66 Q;  3A5U A;  2VUM H;  3KDF A;  1X6O A;  4RG1 A;  1N32 Q;  1MJC A;  4DUY Q;  5AJ3 Q;  4LF6 Q;  2R93 H;  1BVS A;  1GKH A;  1HH2 P;  2VZA A;  2A19 A;  4LFA Q;  4B3T Q;  1J5E L;  3A5Z B;  3CCV A;  1O7I A;  4DV6 L;  1GM5 A;  1WI5 A;  4HID A;  1IBL Q;  4UY8 C;  2JK8 A;  4L5Q A;  1B8A A;  4DR3 Q;  1VQK A;  2WB1 E;  4LF8 L;  2YTX A;  1VQD A;  4DV5 Q;  1XJV A;  1NE3 A;  1B70 B;  5IE8 A;  1H95 A;  4GN5 A;  3BZK A;  3SGI A;  1HNW L;  2UXD L;  1VCI A;  1S72 A;  1K8A C;  1VQI A;  3CAM A;  2RF4 A;  2CFM A;  3I55 A;  1TWF H;  3GO5 A;  2UUC L;  4IJL A;  4LFA L;  4PZ8 A;  4JG2 A;  4DV0 L;  3CMA A;  3J80 c;  3RLN A;  3CPW A;  4YWL A;  1PH1 A;  3PGZ A;  1PYB A;  3HKS A;  1X3E A;  2MNA A;  4YY3 Q;  3RN5 A;  3HOV G;  4R4T A;  1R9T H;  2ZJQ A;  1QUQ B;  1NY4 A;  3A74 A;  1AE2 A;  4X66 L;  3M9B A;  4ALP A;  3T1H Q;  1UWV A;  5LMN W;  2WB1 G;  4JI0 L;  1XNQ Q;  3OTO Q;  3GTO H;  2OQK A;  3GTP H;  4X62 L;  4JI1 L;  1AE3 A;  4OWW B;  4R4I A;  2K75 A;  2K5N A;  5IY0 A;  2ZJP A;  4JI7 Q;  4WJ3 M;  2NVQ H;  2VQF L;  2JA7 G;  1YEZ A;  3CCU A;  4ME3 A;  1ASZ A;  4POF A;  2L15 A;  3CXC A;  1K9M C;  3PO2 H;  4A3I H;  3U58 A;  3J7A 5;  5GAG C;  2CKZ B;  2R6G A;  2XTI A;  4C2M H;  1HNW Q;  3TEH B;  2HIX A;  4UP9 A;  5C3E H;  4HJ5 A;  3G71 A;  4A3J H;  1J6Q A;  4AIM A;  2NZH A;  4K0K L;  1Q86 C;  1EYG A;  2JA8 H;  1HZ9 A;  1LYL A;  2VS1 A;  1E1T A;  3BZC A;  2YV5 A;  3PF5 A;  1DGS A;  1M90 C;  1XNR L;  4A4I A;  2GVB A;  1VQ4 A;  3AFQ A;  3NBH B;  1SFO H;  5IYD G;  4DR2 Q;  1IYJ B;  5M5X H;  4BA2 I;  1NMG A;  1I6H H;  1X54 A;  1N33 L;  1YI2 A;  3M85 A;  1GVP A;  4PG3 A;  3EN2 A;  3PV0 A;  5DLQ E;  4LW1 A;  3HOZ H;  3ULP A;  2NN6 I;  3HFZ B;  1EIY B;  5C4X H;  4BY1 H;  4KI0 A;  3CCE A;  1YHB A;  4DR4 L;  5JJK A;  2D0P A;  3BU2 A;  1UE7 A;  2ALY B;  1QVF A;  4PMW A;  4JI1 Q;  1IBK L;  5LMN Q;  3S1Q H;  4A76 A;  1SMX A;  2K50 A;  3J7Z C;  3L7Z C;  3U4Z A;  4A3M G;  1IZ6 A;  1PFS A;  4DV3 Q;  4MZ9 A;  1YZ6 A;  4AQY L;  4BY7 G;  4GOP C;  3L0O A;  2EIF A;  2OCE A;  4XIG S;  5ELO A;  3STB C;  5FLM H;  1HNX L;  3J81 i;  2HHH Q;  1GO3 E;  4JI6 Q;  3PIO A;  4QJF A;  4BXX H;  2Y0S E;  2CWP A;  4IPC A;  2DUD A;  1JJ2 A;  3HOU H;  4DR6 L;  2RHQ B;  2OWO A;  2LXJ A;  1BBU A;  1UE5 A;  2I5H A;  1PH2 A;  2UU9 L;  4B3M Q;  3VDY A;  1PH3 A;  1MKH A;  2D0O A;  3CCQ A;  2OTL A;  2E2H H;  2KCT A;  4EX5 A;  2GN5 A;  4OXP A;  3G6E A;  3H3V H;  4DUY L;  1K83 H;  5C44 G;  2OQ0 A;  3H0G G;  5JEA G;  4C3H H;  1NTG A;  3HOX H;  5JJI A;  1Y1W G;  2KHJ A;  4DR1 Q;  1X3F A;  2MO0 A;  4HIO A;  1IBM Q;  5E7N A;  4R4C A;  1IBK Q;  4B3R Q;  2NVX H;  4RMF A;  4YWK A;  4DV7 Q;  4LF7 L;  1FJG L;  2E2I H;  3HOZ G;  2IY5 B;  2AWN A;  1PH4 A;  2CCZ A;  1MJE A;  4LFC Q;  2R93 G;  4A3C G;  1VQM A;  3ULL A;  1Q8K A;  2I0Q A;  3RN2 A;  3M4O H;  1D7Q A;  2PMZ E;  1Q1E A;  1TXY A;  1KRT A;  1OXT A;  1JMC A;  4DR5 L;  1EQR A;  1T9H A;  3HKZ G;  1PH9 A;  3PO3 G;  2IT1 A;  1PV4 A;  3RZO H;  3CME A;  1HZA A;  1P8L A;  4GKK Q;  4C3J H;  4A3E G;  3PUX A;  1CKM A;  2BA0 A;  3TRZ A;  3F8T A;  1AH9 A;  3GTK H;  1SLJ A;  2C35 B;  3WWV A;  2Q2T A;  5GAH C;  3K0X A;  4P73 A;  4NXN L;  4DR1 L;  1RIP A;  1I3Q H;  2CQO A;  1KXL A;  1XPO A;  1HZB A;  4O2D A;  4DV6 Q;  2IHF A;  4JI2 L;  1WCM H;  2UXB Q;  3STB D;  5JJL A;  2JEB I;  1VQH A;  4GLA C;  4DR7 Q;  3K80 C;  4JCV E;  3J81 j;  3PUV A;  4QL5 A;  4X62 Q;  1N32 L;  2N3S A;  5HY6 A;  3ICE A;  1PA6 A;  2JE6 I;  4HJA A;  4GOP A;  3CC4 A;  2JJQ A;  3CCM A;  1Y1V H;  3F2D A;  4QY7 A;  5HGQ A;  1CSP A;  1BKB A;  2CWA A;  2NVY H;  2NZO A;  1TWC H;  3CD6 A;  1UEB A;  3D31 A;  3F1Z A;  5C4J H;  1W2B A;  2ASB A;  3AEV A;  4NXM Q;  4GKK L;  2EXD A;  1X9N A;  3K81 C;  4MNO A;  1L2F A;  2R7Z G;  5IYB G;  3G4S A;  3H3V I;  3PUZ A;  3G48 A;  1WFQ A;  2JA6 H;  3I4N G;  2VL6 A;  1EUJ A;  1WOC A;  3ER0 A;  1I94 Q;  2QEX A;  1D8L A;  1WJJ A;  4IOC A;  1M1K C;  1S40 A;  4DR4 Q;  2Y0S G;  2UXB L;  2NN6 G;  1PYS B;  4JI2 Q;  5IP9 H;  3CF5 A;  1LTL A;  1X65 A;  3T1Y Q;  1PHJ A;  4UP7 A;  2B63 G;  2BA1 A;  2E5L Q;  3TS0 A;  4A3B G;  4P71 A;  1VQ8 A;  2N78 A;  4BBR G;  3OYY A;  3E9I A;  2AWO A;  1BBW A;  2PI2 A;  3AQQ A;  1Z47 A;  1L1O B;  4JI5 Q;  4GS3 A;  4JBJ A;  1NBW A;  3CC2 A;  4DK6 C;  1VQE A;  4KHP L;  1E22 A;  4R4Q A;  1LM0 A;  1PH8 A;  4BY1 G;  4GNX B;  1I94 L;  3UDI A;  3KF8 B;  1V9P A;  2ID0 A;  1W3S A;  5AJ3 L;  3W5O A;  3S15 H;  4DNI A;  2YYZ A;  4IJH A;  3CCL A;  4JV5 Q;  2A8V A;  3ULJ A;  3HOV H;  2RHS B;  1QVC A;  3J80 i;  2VQF Q;  4JI5 L;  4A3K G;  4BY7 H;  2K5H A;  4OON A;  5JEA J;  4DV1 L;  3E9H A;  4JI4 L;  4L5R C;  1N34 Q;  4Y7N H;  3FP9 A;  2JA7 H;  1YJW A;  1Q82 C;  1UE1 A;  1YNX A;  1Q1B A;  5LMU Q;  4K0K Q;  2VY3 A;  2ZJR A;  4B3R L;  4P72 A;  1FL0 A;  3PCO B;  1YVC A;  4YCV A;  4BA1 I;  3I4M G;  4A3D H;  1HJP A;  3HOU G;  3M3Y H;  3LGJ A;  4JV5 L;  1EOV A;  3Q8D A;  4L5T A;  2AMC B;  1CSQ A;  1A62 A;  2K52 A;  3GDE A;  2UXD Q;  2Z0S A;  4X65 L;  1K3R A;  3BJU A;  1P16 A;  4YWM A;  1YJ9 A;  4LF5 L;  3S24 A;  3KOJ A;  1VQ6 A;  4IPH A;  5FLX c;  4A3F H;  3JAM i;  1G6P A;  1FGU A;  1CKO A;  3K7A H;  5IYC H;  1OXV A;  3UDG A;  4APV A;  4NXN Q;  1N9W A;  2F52 A;  3CCJ A;  1SRO A;  4Y52 H;  2XGT A;  5M3M H;  4A93 G;  4DAM A;  4GLX A;  4AQY Q;  2PNH A;  2MO1 A;  2E8G A;  1JJC B;  1YBY A;  4TQU S;  3PIP A;  1HNZ Q;  4BBS H;  1YHA A;  4X65 Q;  2VUM G;  3CPF A;  4YHH Q;  3KFU A;  4YCU A;  1HR0 W;  1I5F A;  1N36 L;  1VQC A;  4R1J A;  1KC8 C;  2UU9 Q;  2R7F A;  1E1O A;  1TWH H;  4LF5 Q;  4JI7 L;  5IT9 c;  2ZM6 L;  2F4V L;  3TS2 A;  4A3G H;  2HT1 A;  4JI6 L;  1YJN A;  3JAM c;  3S16 H;  3RR5 A;  4A3L H;  1XMO L;  4DK3 C; 
#chains in the Genus database with same CATH topology
 4JOI A;  1AFP A;  5J39 A;  1LUZ A;  3GD7 A;  1A3T A;  3RNU A;  1KTK A;  1XWE A;  2PCF B;  3DLL A;  3X3N A;  2K4K A;  3BVZ A;  3FPU B;  5EKK A;  4QCL A;  3BVG A;  2IPK D;  2M2L A;  1Z9F A;  3P20 A;  4DXF A;  3MWY W;  1I4Q A;  4DNR B;  4KHP Q;  2PQA A;  5ELE A;  5J3B A;  2LY7 A;  2R7Z H;  1D5X C;  1G6Z A;  3ERQ A;  2JA8 G;  2K7V A;  1H9S A;  1VQL A;  1EFW A;  4LF9 L;  4B3M L;  2F0D A;  1I50 H;  1SR3 A;  3NWS A;  4HJ9 A;  3S1M B;  3M4O B;  4AH6 A;  1DOL A;  4E6I A;  4NB3 A;  1VMP A;  1X3Q A;  2WAQ E;  3NEN A;  3MXN B;  3C1E A;  2N49 A;  4N8F A;  5LMN L;  1BDO A;  4HMI A;  4IN3 A;  5ELN A;  2FMC A;  3TRE A;  5IP9 G;  4ZKC B;  2WAQ B;  1VF5 C;  3HG9 A;  3UE0 A;  2WFW A;  4A3K H;  1UE6 A;  4DPG A;  3K5L A;  1HR0 L;  2BH2 A;  1SN8 A;  1EU3 A;  1QG7 A;  3I4N H;  3I2Z A;  1RJT A;  3TP8 A;  2LMC B;  5FKA C;  1F2Z A;  5BR8 L;  4NMZ A;  2NVQ B;  5C0X I;  5IOC A;  4C3I H;  1STE A;  1J5E Q;  1DON A;  4FXK C;  1U4R A;  2LSS A;  1OO9 B;  2HIV A;  5BN4 A;  4PZ7 A;  4A3E B;  1EWH A;  3NEL A;  4N9P A;  1WD0 A;  1E24 A;  2AUK A;  1SRU A;  3C1F A;  1XMO Q;  4EQP A;  1EY9 A;  4LF4 L;  5ELB A;  1NR4 A;  1Y1W H;  2E2J H;  3QO2 A;  3DEP A;  1SMY C;  1ONL A;  1KNE A;  2JN4 A;  2JEA I;  1XTD A;  3HOW G;  1NMF A;  4A93 H;  2IHE A;  2XSC A;  4I7Z C;  4ZQ3 A;  2PO4 A;  4JOI C;  1S5B D;  3BVM A;  1A15 A;  3H09 A;  2Q2U A;  4X6A H;  2MP1 A;  4XQQ A;  4C3I B;  4IFD H;  1PZJ D;  5JVG 3;  1CUK A;  2K1B A;  1XYI A;  3S1R H;  2WP8 J;  1X55 A;  2UUA L;  3LNN A;  4B3S L;  4LF9 Q;  2XWJ B;  5K5P A;  1HTP A;  4BBS B;  2DGY A;  1F9S A;  2Z1C A;  2BE5 C;  1VQA A;  1KRS A;  4KJO A;  1S5F D;  1X3G A;  2KCM A;  1EWI A;  5JOB A;  4RGO S;  1C0A A;  4Q5V A;  4A3J G;  1CZG A;  1Q3L A;  2L0C A;  2UUB L;  1PH5 A;  4L6T B;  5ELC A;  3TDQ A;  1HPC A;  2BCO A;  2KEN A;  2ICE C;  1WTX A;  4LUO A;  4EQO A;  3GTJ H;  5C44 H;  4DV2 Q;  2NWG A;  4R4O A;  3I72 A;  4P75 A;  3TZU A;  2FJ2 A;  1UEA B;  1CM9 A;  1ICF B;  3Q24 A;  2FFK B;  3ERS X;  1YIJ A;  3I4M H;  2LXK A;  3A7A B;  2TMP A;  1GUN A;  1V43 A;  3G6J B;  2KUM A;  1AZQ A;  3I4L A;  5M3F B;  1PTO D;  4G7O C;  2A74 C;  1IXR A;  3C2P A;  4L5S A;  4BBS G;  4QGU A;  2ZTD A;  3S1Q B;  3S14 H;  2XN9 C;  2ZTC A;  3FKI G;  4BXX G;  1C7Y A;  1VDZ A;  1TVX A;  1VQ7 A;  4BBR H;  2F3I A;  2JA5 G;  3BZD B;  4RGM A;  5DEH A;  3OIP A;  1U9R A;  4WJW A;  1Y1V B;  4EQ5 A;  3HS0 C;  5K36 G;  1HZC A;  1I4G A;  3QOL A;  4DR6 Q;  1MIU A;  2E2H B;  1LT5 D;  3KYH C;  5JAV A;  1IW7 D;  2KJX A;  1LO5 D;  4L63 B;  3A5U A;  3KDF A;  4ZRZ A;  4RG1 A;  1A2U A;  4C3J G;  3GV6 A;  5AJ3 Q;  4AYB B;  4DFA A;  4LF6 Q;  1BVS A;  2A19 A;  3W3A A;  2B2W C;  4DV6 L;  2JA6 B;  4BY1 B;  3KLR A;  1IBL Q;  2KHS A;  1B8A A;  2F0U A;  1VQK A;  1A3U A;  1ZEQ X;  3I3C A;  3OOC A;  4DV5 Q;  2IL8 A;  2B2T C;  1H95 A;  2UXD L;  1VCI A;  1K8A C;  2QW7 A;  3CAM A;  5CC4 A;  3QR8 A;  3VYS A;  3I55 A;  2EE1 A;  4IJL A;  4LFA L;  4DV0 L;  3J80 c;  4KJN A;  4C3H B;  3PGZ A;  1X3E A;  4ZUJ A;  2MNA A;  4OEM B;  3RN5 A;  4X66 L;  3M9B A;  5EKI A;  3T1H Q;  1YNN C;  3J80 L;  3OTO Q;  3GTP H;  1O7L A;  5EKL A;  1G91 A;  3NQI A;  4LAA A;  5IY0 A;  4J1M A;  4X3S A;  2RA4 A;  3S2H B;  5EJW A;  5DNF A;  3LWE A;  1PTO B;  4P2C B;  2L1B A;  4ME3 A;  3VA7 A;  3PO2 H;  2HIX A;  5C3E H;  4A3J H;  3G71 A;  1J6Q A;  3Q22 A;  4K0K L;  1EYG A;  4XT3 B;  2VS1 A;  1AN8 A;  1CQV A;  3E3X A;  2YV5 A;  1BQQ T;  1M90 C;  4OIK A;  2A68 D;  1IYJ B;  3VR3 A;  1NMG A;  3HOW B;  3DUZ A;  3PO3 B;  4PG3 A;  3EN2 A;  2NN6 I;  4KI0 A;  1YHB A;  5A2Q L;  1QVF A;  1SNP A;  4C3I G;  2EY6 A;  1EL0 A;  2F0Q A;  3GV3 A;  4A3M G;  4AQY L;  2EIF A;  2OCE A;  4Q0F A;  2D5D A;  5CV8 A;  3STB C;  2HHH Q;  4K0K Q;  2CWP A;  4ZK9 B;  1JJ2 A;  2D9U A;  3S1R B;  1MKH A;  2D0O A;  1TS2 A;  2KOL A;  2E2H H;  3H3V H;  1CFM A;  2TSS A;  2PMZ B;  3KBX A;  1H9R A;  3BS1 A;  1X3F A;  3R3O A;  3BYY B;  1IBM Q;  5E7N A;  4YWK A;  1JB3 A;  4DV7 Q;  2E2I H;  4LFC Q;  2E2I B;  1VQM A;  2WB1 B;  2I0Q A;  1D7Q A;  2PMZ E;  4HR7 B;  4A3I B;  5M5W B;  2E2J B;  4XDX A;  4R8I A;  1OXT A;  4BY7 B;  4KV6 A;  3PO3 G;  3S15 B;  3RUZ A;  3MTS A;  2H1E A;  1HZA A;  1EY6 A;  1P8L A;  5EPL A;  1II3 A;  4C3J H;  1C4Q A;  1SLJ A;  5GAH C;  3TSS A;  1RIP A;  2NBF A;  1V1P A;  3PIP 3;  2PW5 A;  4FXG C;  3STB D;  4B9W A;  4A3B B;  3JAM E;  5KEE A;  4DR7 Q;  3PUV A;  3LWU A;  2J7Z A;  1D1I A;  5HY6 A;  1V1P B;  1FD7 D;  1EY4 A;  3CD6 A;  4A3M B;  2ASB A;  5C4J H;  1W2B A;  4K2K A;  4NXM Q;  1X9N A;  2RQX A;  2A68 C;  2CQA A;  2R7Z G;  5CYU A;  3G48 A;  4BBR B;  5LL6 X;  2VL6 A;  1WOC A;  3I4N G;  1QJO A;  1M1K C;  1S40 A;  4DR4 Q;  4A3J B;  1PHJ A;  4JI2 Q;  3KK7 A;  4R8N A;  4UP7 A;  4P71 A;  4F88 A;  1JCK B;  3OWF A;  2PI2 A;  5D65 A;  1VF7 A;  2HDM A;  1Z47 A;  2ZXO A;  3K57 A;  4X3U A;  4JBJ A;  4R4Q A;  1YNN D;  1PH8 A;  4BY1 G;  1QOH A;  3Q6S A;  1WTW A;  3MC0 B;  2IWH A;  3CCL A;  1ILP A;  2KA7 A;  1PRT F;  3HOV H;  2RHS B;  1QVC A;  3J80 i;  4JI5 L;  2Z9H A;  4A3K G;  4BY7 H;  4DV1 L;  5JEA J;  4L5R C;  4JI4 L;  4JK1 C;  4HAE A;  1Q1B A;  2KCC A;  2ZJR A;  4S3S A;  2Z8L A;  1FL0 A;  4P72 A;  3OWE B;  3BDC A;  2EXZ A;  4IUP A;  3EA6 A;  2AMC B;  2M9V A;  5ELD A;  2Z0S A;  1GHK A;  1K3R A;  1VQ6 A;  1BF4 A;  2LKV A;  3DM1 A;  4FO2 A;  5FLX c;  1FGU A;  1CKO A;  2L12 A;  3K7A H;  1OXV A;  1PRT B;  4NXN Q;  3EFX D;  1EIH A;  1N9W A;  5E4X A;  1E2W A;  3SK5 A;  4CDC C;  2I46 A;  2PNH A;  3LX0 A;  1JOK A;  2VUM G;  4YHH Q;  5E1F A;  3TZD A;  1HR0 W;  2EPB A;  1N36 L;  4DGZ A;  1RHP A;  3NQT A;  4R1J A;  3S9W A;  1KC8 C;  1XXG A;  1E1O A;  1QB5 D;  3J81 L;  3S17 B;  2ZM6 L;  5I6Y A;  4C3J B;  3TS2 A;  4JI6 L;  4H44 C;  3JAM c;  1JWS D;  3D3R A;  5FK9 C;  1EFI D;  3R2T A;  1XMO L;  1HCZ A;  1QZG A;  5KNC A;  2X6L A;  3OW2 A;  1BXT A;  3SE0 A;  2BDN A;  2WIN B;  1EQQ A;  1BUV T;  3H94 A;  4IFD G;  1SJH D;  4GLV B;  5GQO A;  3S2D H;  2EYL A;  5I4D A;  4OX9 L;  2WV6 D;  3U4V A;  5C3E B;  1V1O A;  4JBK A;  1EEF D;  1GOZ A;  1E2V A;  4IFD I;  3KJO A;  1S3O A;  3K7U C;  1EY0 A;  1ET9 A;  1RKN A;  5TSS A;  2K5V A;  3HOY G;  4PQX A;  4DV3 L;  1CHQ D;  3HKZ E;  1K8G A;  2ES2 A;  2Q8I B;  3GTQ H;  3QIA A;  1KD1 C;  3I8Z A;  2F0W A;  4CJ0 B;  4JVZ A;  1UUP A;  4JW0 A;  5IWA Q;  5KRU A;  3A54 A;  1BR9 A;  2HHH L;  2RCN A;  3OW7 A;  4LF8 Q;  1Q7Y C;  4UAI A;  4DV4 Q;  1VQN A;  2UUB Q;  3GTL H;  1J9O A;  3K8A A;  4JYA L;  2EY1 A;  1UNS A;  1K28 A;  5ELF A;  2K14 A;  3SDZ A;  3EBE A;  2K32 A;  2JQO A;  2Z6K A;  3L3O C;  1XNQ L;  3J81 c;  2F0J A;  1DJR D;  1HQR D;  1SNM A;  2B63 H;  1MBY A;  3X3M A;  2E5L L;  1IHZ A;  2ZM6 Q;  2IX0 A;  2ICI A;  3K7A B;  4IUN A;  2D62 A;  2WKD A;  4LMQ D;  3Q0A A;  1RL2 A;  2FXQ A;  3U50 C;  1GUO A;  3VA5 A;  2B2Y C;  2N8N A;  3UDX A;  1C9O A;  3N6R A;  4EVO A;  1CK1 A;  2UUA Q;  2PZW A;  5T1I A;  2YTV A;  4UPA A;  1L1O C;  4DR3 L;  1CKN A;  4UP8 A;  1XX8 A;  1QUQ A;  5LMU L;  1HQM C;  3AMU A;  1HXY D;  3PUW A;  5KNB A;  1KDA A;  2UUC Q;  2NVX B;  4BWG B;  4TVA B;  5FJ8 H;  4ZKB B;  5IT9 E;  3FEW X;  4IPG A;  1K0R A;  1SEB D;  1DYQ A;  1NCV A;  1PFM A;  4KLK A;  1L0X B;  3UDF A;  2F0H A;  1YHQ A;  4TKO B;  3T13 A;  2PQA B;  1HNX Q;  5E3F A;  3HOX B;  2AHO B;  3I4M B;  1B3Q A;  3AYH B;  5EAY A;  5NUC A;  2SNS A;  4RCO A;  4FNF A;  2EJM A;  4LUZ A;  3AFP A;  1GUG A;  4U68 A;  1B1Z A;  2DY7 A;  3TP6 A;  5I2Y A;  1GUS A;  1Y69 U;  2IX1 A;  1B50 A;  1AEX A;  2HCC A;  1XPU A;  1IL2 A;  1SAP A;  1J8I A;  1PTO F;  4K5X A;  1XPR A;  3T51 B;  3BG3 A;  1N33 Q;  1VQ5 A;  4IOA A;  5AFW A;  1HR0 Q;  1M8A A;  1HFN A;  4DR2 L;  2F0K A;  4KY5 A;  1XNR Q;  1DCZ A;  2E2D C;  1KLG D;  4JYA Q;  4O0A A;  2IJ0 A;  3WDN A;  4FF1 A;  1OXX K;  2L11 A;  3H15 A;  3DWP A;  4GZY C;  2DJG C;  2R93 B;  1KAW A;  1S5D D;  3PO2 G;  1V8Q A;  1A8V A;  1TWA H;  4ODG A;  5IYB H;  3S1M H;  4FYD A;  1Y8N B;  2XRS D;  4DAV A;  1GHJ A;  2SDF A;  1ASY A;  2JXM B;  2B29 A;  1B4O A;  1RDP D;  1CT1 D;  1KNA A;  2I5L X;  5IYC G;  1QIL A;  4OO1 H;  1QCB D;  2AQ1 B;  1ILQ A;  5EGT A;  1EYC A;  3M4P A;  1EZ6 A;  5M5W H;  3EJI A;  4OO1 I;  1R9T B;  3ND8 A;  2OT2 A;  1RD9 D;  1GJX A;  1PH7 A;  1K0S A;  2MFI A;  3M4Q A;  4B3T L;  1ZYR D;  5KND A;  1EZ8 A;  1I50 B;  2B2Y A;  2OXP A;  3W1B A;  1OTC A;  2H5X A;  3ITP A;  4PMB A;  4DAP A;  5GAE C;  2F0V A;  4ZYS A;  2R92 H;  2B2U A;  4DN4 M;  2Q2H A;  3E0E A;  4JI8 Q;  4DKA C;  3QG1 A;  2HQL A;  4A3F G;  2X69 A;  4GN3 B;  2J0T D;  3NWT A;  1QVG A;  1O7Z A;  4RHR A;  2QEJ C;  4K8I A;  1X6O A;  2NB0 A;  1N32 Q;  1GKH A;  2NUC A;  1HH2 P;  4CGY B;  2L9H A;  1S4Z A;  3FKI B;  2VB2 X;  1WI5 A;  2XWB B;  1ML0 D;  4WFN 3;  3MXG A;  4UY8 C;  3KUP A;  3EVQ A;  3M4Y A;  1WTR A;  4XQN A;  2YTX A;  1XJV A;  5T1G A;  2KEE A;  2DN8 A;  5IE8 A;  3BZK A;  3SGI A;  2L5T A;  1TU2 B;  5JPM C;  1VQI A;  4C2M B;  1KDB A;  2RF4 A;  3OMC A;  3HOY B;  3GO5 A;  2UUC L;  2DNE A;  4PZ8 A;  4JG2 A;  2EYM A;  3CMA A;  4YWL A;  4OIJ A;  1B44 D;  4R4T A;  1R9T H;  2XRQ D;  3G7L A;  1NY4 A;  3A74 A;  3KLS X;  2F0O A;  4ALP A;  1STN A;  2OQK A;  4NDX A;  2PW7 A;  1JOO A;  3OSO A;  1CA5 A;  3NTH A;  4WJ3 M;  3J7A F;  1F77 A;  2NYZ D;  1YEZ A;  1PZI D;  1DOK A;  2E75 C;  5CV9 A;  4YIJ A;  1K9M C;  3HGB A;  1TWA B;  4HJ5 A;  5EPJ A;  4OHJ A;  5CV4 A;  4KD4 A;  1LYL A;  2PQE A;  5CR3 A;  1SFO H;  3NBH B;  5IGF A;  4MIU A;  4BA2 I;  1WTV A;  4HCS A;  1I6H H;  3NPP A;  1N33 L;  1YI2 A;  1GVP A;  5DLQ E;  3HOZ H;  4LW1 A;  5DM6 3;  4BY1 H;  1EOT A;  4DR4 L;  1Z6H A;  5M5X B;  3BU2 A;  1MHW C;  4PMW A;  2B2V A;  3S1Q H;  1SMX A;  2K50 A;  3J7Z C;  2K5W A;  3U4Z A;  1PFS A;  4OL7 A;  4CJ2 C;  4RKB A;  1HNX L;  3C3L A;  3NK9 A;  5FLM H;  3J81 i;  4QJF A;  2DUD A;  3VYU A;  1I4H A;  4TSS A;  4WOR A;  2OWO A;  4XYQ A;  1BBU A;  4F87 A;  3VDY A;  1PH3 A;  3CCQ A;  4EX5 A;  5COR A;  1SXT A;  4K5W A;  4R9W A;  4DUY L;  5C44 G;  3H0G G;  4CKC A;  5JEA G;  4C3H H;  2V4D A;  3T4A C;  1LAC A;  2CHB D;  4FVM A;  3V2T A;  4RA8 A;  4B3R Q;  2EYO A;  1C48 A;  2IY5 B;  1SBB B;  2AWN A;  2HD3 A;  1PH4 A;  2R93 G;  5C4H A;  5COY A;  3M4O H;  3RN2 A;  1TXY A;  1WCM B;  4B9X A;  1JC7 A;  5IGG A;  4DR5 L;  1EQR A;  1PRT C;  3RZO H;  2G9H D;  3GTK B;  3IFD A;  1AH9 A;  3GTK H;  3WWV A;  1O7Y A;  1SYB A;  4P73 A;  1IYU A;  1HZB A;  4O2D A;  2IHF A;  1RTO A;  3WOE A;  1WCM H;  4JI2 L;  2UXB Q;  1JR0 D;  5JJL A;  2JEB I;  1VQH A;  4GLA C;  5K36 H;  3K80 C;  5CGK A;  4X62 Q;  1N32 L;  1S5C D;  2N3S A;  3ICE A;  1PA6 A;  1K3B C;  4HJA A;  4C1N I;  4GOP A;  2JJQ A;  1LLR D;  5HGQ A;  2CWA A;  2WKC A;  1JWM D;  3D31 A;  1BCP D;  3AEV A;  4MNO A;  1L2F A;  2O5I C;  5IYB G;  3G4S A;  1PLF A;  3OIQ A;  3PUZ A;  3SVM A;  1WFQ A;  2KVM A;  4L8J A;  1GUT A;  4RWS C;  3P7J A;  5FO7 B;  5M5Y B;  3CRK C;  1PYS B;  3BDO A;  3CF5 A;  1X65 A;  2B63 G;  2BA1 A;  2ZXP A;  2N78 A;  4BBR G;  2AWO A;  3NSW A;  3AQQ A;  4O1N A;  1TS4 A;  4H13 C;  1NBW A;  3SEB A;  5HGT A;  3NP8 A;  4EQN A;  3SR1 A;  4KHP L;  3NBI A;  1HTL D;  4GNX B;  5AJ3 L;  1W3S A;  4DNI A;  2YYZ A;  3D4D A;  4K5V A;  3NTK A;  1I6H B;  2A8V A;  3ULJ A;  2EVB A;  1RCV D;  4OON A;  2MGS A;  3PMF A;  2CW0 D;  2JA7 H;  1TT2 A;  1ZKO A;  4A3D B;  4F7X A;  2VY3 A;  4B3R L;  4QUC A;  3PCO B;  4YCV A;  1YVC A;  4BA1 I;  4A3D H;  3HOU G;  2K5D A;  1LT3 D;  1EOV A;  4L5T A;  5FO8 B;  2O5J C;  1A62 A;  3RMH A;  4CJ1 B;  2UXD Q;  4UHV A;  2FMM A;  1YJ9 A;  1AP0 A;  2DNC A;  4LF5 L;  3S24 A;  3KOJ A;  1EIG A;  4IPH A;  3OHX C;  3UDG A;  2HQE A;  1SYE A;  2QCP X;  2RDG A;  2XGT A;  5M3M H;  3VYT A;  4GLX A;  2MO1 A;  1MGS A;  3PIP A;  3OMG A;  1JJG A;  1EYA A;  5IGD A;  2I07 B;  3K0Y A;  4DF7 A;  1WTO A;  1K8M A;  4Z9C B;  5A35 A;  4KKT A;  2A69 D;  2HT1 A;  3RR5 A;  1SND A;  3DEO A;  4A3L H;  1ENC A;  4DK3 C;  3RZD H;  3HEJ A;  3E5S A;  1JT8 A;  4X3K A;  3MEF A;  2WAC A;  2NVT H;  4RH6 A;  4YCW A;  4DAY B;  2NVT B;  3M3Y B;  5M3F H;  4Y7N B;  2CW0 C;  1LTA D;  1X56 A;  1IBM L;  2F0L A;  2B8F A;  3KDF B;  1YNJ D;  3CQZ H;  2E76 C;  1HUM A;  3GTQ B;  5C0X J;  2F03 A;  2YU9 B;  4OO1 G;  3A56 A;  2KQ3 A;  1MD2 D;  1O78 A;  3BYT B;  4GNX A;  3K5O A;  4DV0 Q;  1W6J A;  3B6Y A;  3S1N H;  1FVI A;  3CCR A;  4A3G G;  2A1A A;  2PPB C;  1SE8 A;  1B2T A;  5EQ0 A;  1SE3 A;  1CI3 M;  3MXU A;  1VQF A;  2RDF A;  4X64 Q;  4JI3 Q;  2K33 A;  2B39 A;  4LFB L;  1JE4 A;  5C3E G;  5F2D A;  3T1H L;  1OXU A;  3U9S A;  2XNA C;  1KL9 A;  1LT6 D;  1AZP A;  1U4P A;  1PMR A;  2RCF A;  2AQ3 B;  4K2L A;  4RHS A;  5GRO A;  4CKB A;  2Q2I A;  1VQJ A;  2X6G A;  3I7F A;  4A75 A;  3S16 B;  4KKU A;  3HP3 A;  1MI2 A;  3H91 A;  4AYB G;  1F2M A;  2Q8R E;  4YHH L;  3NTI A;  2JA8 B;  1SYD A;  3GTM H;  2Z4I A;  1HHV A;  5C5L A;  1CHP D;  2WAQ G;  2NTT A;  3FVQ A;  4LFB Q;  4DXG A;  2NN6 H;  4DUZ Q;  3CRL C;  4A3B H;  1BO0 A;  3KJP A;  1R4Q B;  1A6X A;  3D6C A;  5G3L D;  4DV7 L;  2R92 B;  3PF4 A;  1K73 C;  2CH4 A;  1A0I A;  4KHZ A;  1STA A;  1SFO B;  4XTC S;  4YY3 L;  1KAA A;  2HUG A;  1TQO A;  5JPN C;  3TQY A;  2A73 B;  5J1Z A;  3V96 A;  3EIV A;  4GOP B;  1TWG H;  4PZ6 A;  1SYF A;  3UE1 A;  5C3W A;  1K83 B;  5M3M G;  3K5N A;  3I70 A;  2KED A;  3OTO L;  4H7B A;  5A2Q E;  4JI0 Q;  2A6H C;  1SE2 A;  2GVA A;  3AU7 A;  1VQP A;  4N9T A;  1NJI C;  1O80 A;  1TII D;  1Q12 A;  5FO9 B;  3S17 H;  1U4L A;  3Q23 A;  4QQB X;  1EU4 A;  3W1G A;  5M5Y H;  3I91 A;  5DAU A;  4C1N K;  3I4O A;  1N36 Q;  2B2T A;  4A3L G;  2EYF A;  1CZW A;  2V1C C;  1KHI A;  2Z6K C;  4DV5 L;  1LTB D;  3SHL A;  1SYC A;  2B2U C;  3J80 E;  3RLF A;  3FHW A;  4HTH A;  1IBL L;  2A6E D;  4AYB E;  2AUJ D;  4HN7 A;  1DZ1 A;  1SNC A;  1F9P A;  2Y0S B;  3TN2 A;  5J22 A;  1VMC A;  1DM0 B;  1A63 A;  5C6A A;  3FKI H;  3HOW H;  4TRD A;  4OEL B;  1YIT A;  3PUY A;  5I9O A;  2KHI A;  2ZTE A;  4RGT A;  5FLM G;  2B2W A;  1N8R C;  2KBN A;  2VQE L;  1XMQ L;  4WJ4 A;  3MAQ A;  5C4X G;  2B8G A;  1WVL A;  4MTN A;  2G5D A;  2ZXR A;  1D5M C;  1PVO A;  1KQS A;  3HOX G;  2OF1 A;  2JA9 A;  4GKJ L;  4DV1 Q;  3PQI A;  3ZJY C;  2PZU A;  2RSN A;  2QGQ A;  1EQV A;  4OWT B;  3A0J A;  3GTP B;  4A3D G;  3D4R A;  2NTS A;  5IP7 H;  3O13 A;  1NUC A;  3DWQ A;  3KF6 A;  4LF7 Q;  1FJG Q;  3HOY H;  4BY7 G;  1CKN B;  1HA6 A;  3DWA A;  3R8B A;  3DXJ C;  2MPM A;  4ABN A;  2VQE Q;  1XMQ Q;  1I4X A;  2ENB A;  2QA4 A;  1JE5 A;  3V05 A;  5KIX A;  3CCS A;  1VQB A;  3RZD B;  4NP5 A;  3RLO A;  1FNV A;  4HCE A;  3HOV B;  4ZUI A;  2EJF C;  2P5Z X;  3NE5 B;  1LV9 A;  1EY8 A;  1L1O A;  2HCI A;  2UXC L;  1CTM A;  2N88 A;  1QZH A;  4DV4 L;  2F1M A;  4QB4 A;  1G29 1;  1KIX A;  3H0G H;  5JEA H;  4FXD A;  5BR8 Q;  3J7A V;  4HIM A;  1Y1V G;  3SK6 A;  3VYR A;  3U9O A;  1U4M A;  1JQY D;  4QMG A;  5ISR A;  3A55 A;  2R93 H;  2VZA A;  4LFA Q;  4B3T Q;  4IAL A;  3A5Z B;  1A3V A;  1O7I A;  3CHB D;  1IKL A;  5I2X A;  1GUW A;  2VXW A;  1SNQ A;  2F0M A;  4DR3 Q;  2WB1 E;  4LF8 L;  4EGV A;  1VQD A;  1NE3 A;  1ZYR C;  4GN5 A;  3JAM L;  1S72 A;  1TWF H;  1ESF A;  2DJF C;  3RLN A;  1PH1 A;  3K6O A;  1PYB A;  3HKS A;  4YY3 Q;  4IUQ A;  4ZAI A;  2ZJQ A;  1QUQ B;  3HRZ C;  5CV5 A;  5IGC A;  1XNQ Q;  1UWV A;  4JI0 L;  1HRJ A;  3GTO H;  3GTO B;  1AE3 A;  4R4I A;  4JI7 Q;  2K5N A;  2ZJP A;  1QE6 A;  5CBE E;  2QIL A;  2JA7 G;  3CCU A;  3CXC A;  1LT4 D;  4A3I H;  3U58 A;  1HNW Q;  5GAG C;  2CKZ B;  2R6G A;  1D6E C;  4C2M H;  5IGE A;  4AIM A;  2NZH A;  3T53 B;  1HZ9 A;  4KD3 A;  1D1K A;  1PFB A;  1DGS A;  4A4I A;  1VQ4 A;  5IYD G;  4DR2 Q;  4ME5 A;  1X54 A;  3ZYY X;  4IUV A;  3GTL B;  3PV0 A;  5LHY 1;  3ERO A;  3J81 E;  2EYH A;  4CHT B;  4IZ8 A;  5C4X H;  4ZCK A;  4U67 3;  4G7Z C;  2HDL A;  4K8J A;  1UE7 A;  2ALY B;  4JI1 Q;  5LMN Q;  3UI2 A;  2KEC A;  2K05 A;  4KKS A;  4XIG S;  1KDC A;  3P1H A;  3PIO A;  2Y0S E;  4IPC A;  4DR6 L;  1Y8O B;  3HOU H;  2RHQ B;  1B3A A;  3IL8 A;  5LL6 S;  2K5Q A;  3A8I E;  1UE5 A;  2I5H A;  4B3M Q;  1ENA A;  3GP7 A;  2KCT A;  3NXW A;  1W6K A;  2AQ2 B;  2GN5 A;  1B9N A;  2F0P A;  1TWC B;  1STG A;  5JJI A;  1Y1W G;  2L4N A;  4HIO A;  1IBK Q;  2NVX H;  4RMF A;  4LF7 L;  1FJG L;  2CCZ A;  4LJZ C;  1MJE A;  1Q1E A;  2F3W A;  1KRT A;  1T5E A;  3KLS A;  3A8K E;  4IUR A;  3A8J E;  3HKZ G;  1PH9 A;  2DY8 A;  2IT1 A;  5KYI A;  1XTC D;  3CME A;  1BNZ A;  4GKK Q;  3TRZ A;  1CKM A;  2BA0 A;  3F8T A;  3DHQ A;  3K0X A;  4NXN L;  5BN3 A;  3N52 A;  1FYC A;  3D4W A;  2F0F A;  1EQT A;  5IT9 L;  1TKW B;  4JCV E;  4ULL A;  4QL5 A;  3WOF A;  2JE6 I;  2K03 A;  1HUN A;  3CC4 A;  3CCM A;  1BKB A;  4IQZ A;  2NZO A;  1TWC H;  1TR5 A;  1UEB A;  3F1Z A;  4KMU C;  3CKI B;  1G8Z D;  1SYG A;  3H3V I;  3FMC A;  1TWH B;  2Q8T A;  4CBV A;  2JA6 H;  1F9Q A;  4DAY A;  1EUJ A;  2QEX A;  1G2S A;  4IOC A;  4RCN A;  4PV1 C;  2Y0S G;  2UXB L;  2NN6 G;  4A3B G;  2E5L Q;  3TS0 A;  1VQ8 A;  1D5Z C;  2SNM A;  1L1O B;  4B08 A;  4GS3 A;  3CC2 A;  1QNK A;  3D8G A;  4DK6 C;  5EBD A;  4C56 C;  1E22 A;  1LM0 A;  2F0G A;  1M4V A;  1I94 L;  1PZK D;  1V9P A;  2ID0 A;  4NKL A;  3W5O A;  3S15 H;  3R93 A;  4IJH A;  4JV5 Q;  2VNU D;  5EPK A;  2VQF Q;  3H6M A;  2K5H A;  2IX3 A;  4KTA A;  4KY6 A;  1N34 Q;  1TS5 A;  1H9J A;  2M00 A;  3HZX A;  2F0I A;  3MHB A;  2GA4 B;  1HJP A;  4DNT B;  1SE4 A;  3M3Y H;  4IUU A;  3LGJ A;  5CV7 A;  3Q8D A;  1ET6 A;  1CSQ A;  3GDE A;  2IW3 A;  3VR5 A;  3BJU A;  2F4I A;  4YWM A;  1TY2 A;  1FGB D;  3JAM i;  4PMC A;  4APV A;  2F52 A;  5FLX L;  1SRO A;  4Y52 H;  3IAY A;  4MN3 A;  1LTG D;  2E8G A;  1JJC B;  1YBY A;  4TQU S;  1HNZ Q;  4BBS H;  1H9M A;  4X65 Q;  3CPF A;  2OEO A;  2UU9 Q;  2R7F A;  1WTP A;  1TWH H;  3TP7 A;  3ONA B;  2SEB D;  4JI7 L;  5IT9 c;  2F4V L;  4N8X 1;  3S16 H;  5C4J B;  1CQF A;  1ENF A;  1F9R A;  5I9P A;  4V19 0;  5C5M A;  4HJ8 A;  1I6V C;  2R61 A;  1HA5 A;  3CC7 A;  2C5C A;  3CW2 C;  1T5X D;  3S14 B;  1E3P A;  3F2U A;  1L0Y B;  4LNQ A;  2PYK A;  1X3P A;  5E4W C;  4WRD A;  4PNY A;  2JA5 B;  4DK0 A;  4A3C H;  4IPD A;  4KY7 A;  4JBW A;  2R7D A;  3MFY A;  1U0L A;  3DM3 A;  2K04 A;  2BOS A;  3E0J A;  1S5E D;  5IP7 G;  4DR5 Q;  4A3E H;  2RVL A;  3P75 A;  3HOU B;  2PI2 E;  2K28 A;  2JA5 H;  1Q8I A;  5FOB B;  4GKJ Q;  3GTJ B;  2RKS A;  4MTK A;  5HUR A;  3ND9 A;  1E7Z A;  1TWG B;  5C3X A;  4FF4 A;  5IIF A;  2FHT A;  2K01 A;  4DA2 A;  3KLW A;  3MVV A;  5C0X H;  4HIK A;  1PFN A;  1WD1 A;  2C9O A;  2JA6 G;  4NXM L;  1HFG A;  1WYD A;  2JP1 A;  1A2T A;  1EIF A;  3FDT A;  1WCM G;  1VQ9 A;  2ATW A;  1KLU D;  2A6E C;  1QNU A;  2I5M X;  4J15 A;  1Q81 C;  2NZ1 D;  5FJ8 G;  3IRB A;  4IUT A;  3BDL A;  2BH8 A;  1EY5 A;  5H1S E;  4LF6 L;  3T16 A;  5JJZ A;  1VQG A;  4IFD J;  1G2T A;  3F2C A;  4JBM A;  2CVR A;  5CBA E;  2MUY A;  4JI3 L;  4X64 L;  2RDH A;  1CA6 A;  1SNO A;  3OPO A;  3I4N B;  1LTS D;  3HKZ B;  1B7Y B;  2F4V Q;  1STB A;  5FLX E;  4FF3 A;  1I3Q B;  1TY0 A;  4LFC L;  1SDF A;  1C8C A;  4OX9 Q;  1LTR D;  3FPP A;  4H0L C;  2FIN B;  1GD7 A;  2A6H D;  2B3G A;  1NSN S;  4DUZ L;  3QWN A;  1JB7 A;  3JC6 6;  4GN4 B;  1BBX C;  1JOQ A;  4C3H G;  1EY7 A;  5G3L F;  1JOR A;  2YTY A;  3KF6 B;  1N34 L;  4KN7 C;  3FRP B;  2F3V A;  2ZT9 C;  4OWX B;  1Y14 B;  1Y1W B;  4V0B A;  5KYL A;  2VW9 A;  4RAU C;  3I56 A;  3S2H H;  4DR7 L;  2VB3 X;  4XT1 B;  1ZXT A;  3IKJ A;  4IO9 A;  4QF4 A;  3D0F A;  5D3D A;  4DU9 A;  2BDO A;  2EY2 A;  3MA2 B;  3NEM A;  5IWA L;  4FDB A;  3PO2 B;  1D2B A;  2QDB A;  2EYP A;  1VQO A;  2PZT A;  3KF8 A;  4KN4 C;  4BS9 A;  3L2P A;  1G51 A;  1EWC A;  1K8O A;  4G7H C;  2MQH A;  4A3M H;  3PO3 H;  4GNX C;  3I73 A;  2MHV A;  4NPS A;  2J4X A;  1IKM A;  1JWU D;  4HJ7 A;  3F2B A;  3I90 A;  2AKW B;  5I6W A;  4B3S Q;  5KGU A;  4A3I G;  3TME A;  2QDL A;  2R92 G;  4HSP A;  1Q46 A;  4CDF C;  3H0G B;  1V1Q A;  4JI8 L;  2F0E A;  3M7N A;  2UXC Q;  5IYD H;  3GTG H;  5M3F G;  1B9M A;  3CP0 A;  3SXH A;  4A3F B;  3SK8 A;  5C0X G;  1BCP F;  1YNJ C;  1HNZ L;  1OXS C;  2KCN A;  3VR2 A;  5BN5 A;  2RBM A;  4JC0 A;  4DV2 L;  1TWF B;  4P74 A;  4POG A;  2B2V C;  1VS0 A;  3AB9 A;  4H02 A;  1U5K A;  2EQS A;  3S2D B;  3W2D A;  2LFN A;  3T1Y L;  4LF4 Q;  4LUV A;  1GXD C;  3J7Y W;  4QIW E;  3GTM B;  2EDG A;  5C4X B;  1PH6 A;  1LTI D;  3NUC A;  1L0W A;  4LWC A;  1B53 A;  5GAD C;  1BCP B;  2A69 C;  2OTJ A;  2NVY B;  2YU9 H;  2O4X A;  1IYV A;  4JI4 Q;  1STH A;  3PSI A;  4X66 Q;  2VUM H;  5IGB A;  1PTO H;  4G57 A;  2K6A A;  1MJC A;  2F0S A;  3K59 A;  4DUY Q;  1Z7T A;  1IW7 C;  5D3I B;  1MSG A;  1PDQ A;  1LTT D;  1J5E L;  3CCV A;  2EY5 A;  4QUF A;  1GM5 A;  4HID A;  2JK8 A;  4L5Q A;  4I65 A;  2F0T A;  4KHV A;  4FP5 D;  4M8A A;  4RKL A;  4HSV A;  1B70 B;  3QOJ A;  1HNW L;  3DMU A;  3K58 A;  2WII B;  2XIW A;  1EYD A;  2CFM A;  2R3Z A;  1PTO C;  3CPW A;  3S1N B;  2O2L D;  4I7A A;  3HOV G;  3VR6 A;  1DD2 A;  1AE2 A;  5D14 A;  5LMN W;  2WB1 G;  3VR4 A;  1NR2 A;  4X62 L;  4JI1 L;  4ID6 A;  4K14 A;  4OWW B;  3E6Z X;  1NAP A;  2K75 A;  4HED A;  4A93 B;  2NVQ H;  3M7G A;  2VQF L;  4XYO A;  1MSH A;  1ASZ A;  2G9D A;  4POF A;  2L15 A;  1Y8P B;  3MZ5 A;  3J7A 5;  2XTI A;  3TEH B;  4UP9 A;  4K6D A;  1DXM A;  3TBI B;  1Q86 C;  2JA8 H;  1E1T A;  3BZC A;  3PF5 A;  1XNR L;  2GVB A;  3AFQ A;  1NNX A;  2SOB A;  5M5X H;  1BCP C;  3M85 A;  2Z4H A;  3MEH A;  4UDU C;  3HFZ B;  5M9O A;  3ULP A;  1EIY B;  5JJK A;  3CCE A;  4J8Q A;  2D0P A;  3SK4 A;  1IBK L;  2EYJ A;  1R4P B;  1BOS A;  2BE5 D;  4A76 A;  3L7Z C;  1IZ6 A;  1FR3 A;  3R2I A;  1ICW A;  4DV3 Q;  4MZ9 A;  1YZ6 A;  4FF2 A;  4GOP C;  3L0O A;  5ELO A;  1DOM A;  4BXX H;  1GO3 E;  4JI6 Q;  5M3M B;  4ZLT F;  2LXJ A;  1PH2 A;  2UU9 L;  2JYO A;  2PNR C;  4LK1 C;  2OTL A;  2EJG C;  3G6E A;  4OXP A;  4J6H A;  4G4K A;  4RFB A;  3D6W A;  1PRT D;  3L9A X;  4NW2 A;  1K83 H;  5DM7 3;  2OQ0 A;  4M1U B;  1NTG A;  4K6L A;  3HOX H;  2KHJ A;  4DR1 Q;  4HMJ A;  2MO0 A;  4R4C A;  4O42 A;  1SMY D;  3HOZ G;  1H9S B;  3A7L A;  4A3C G;  3ULL A;  1Q8K A;  4DK1 A;  4A3K B;  2H4O A;  1JMC A;  1T9H A;  1PV4 A;  4JPB W;  1F2L A;  1Q90 A;  4A3G B;  1PXU A;  4A3E G;  3PUX A;  5C4Z A;  3QJY A;  2N55 A;  2C35 B;  2Q2T A;  3GTG B;  3CQZ B;  4QIW B;  3RZO B;  1KXL A;  4DR1 L;  5C44 B;  1I3Q H;  2CQO A;  1XPO A;  4DV6 Q;  3C46 A;  5L37 A;  2B63 B;  1UAP A;  1X32 A;  1FNW A;  2JSO A;  3J81 j;  3T56 B;  4ILW A;  1IL8 A;  4CDD C;  1H9K A;  2R7Z B;  1Y1V H;  3F2D A;  3NBH A;  4QY7 A;  1CSP A;  2NVY H;  1I4R A;  3QB3 A;  4GKK L;  5CV6 A;  2A5H A;  2EXD A;  3CU7 A;  3K81 C;  1PYW D;  3ER0 A;  4CKE A;  2CH4 W;  1I94 Q;  1D8L A;  1TS3 A;  1WJJ A;  1E2Z A;  3MFG A;  5IP9 H;  3URY A;  1LTL A;  4RGN A;  3T1Y Q;  1WTQ A;  1F2Y A;  3MXN A;  4MHE A;  5CMD A;  2VUM B;  3OYY A;  3E9I A;  1BBW A;  1STY A;  4JI5 Q;  1WTH A;  1VQE A;  2XVS A;  4OGQ C;  4XQJ A;  3UDI A;  3KF8 B;  3TP5 A;  3HOZ B;  1RF2 D;  3MXP A;  2L55 A;  3E9H A;  4Y7N H;  3FP9 A;  2F0N A;  1EEI D;  5JVH 3;  1UE1 A;  1YNX A;  1YJW A;  1Q82 C;  5LMU Q;  5IOD A;  1SJE D;  3IFT A;  3I4M G;  4CDE C;  1QWY A;  4JV5 L;  3PIO 3;  2E74 C;  3NHH A;  2K52 A;  2Z6B A;  1SSO A;  4X65 L;  1FNU A;  1P16 A;  1ESR A;  1I4P A;  3RD4 A;  4X3T A;  2LS0 1;  4A3F H;  1G6P A;  5IYC H;  2QF7 A;  2EZV A;  2D2C C;  3CCJ A;  1E0B A;  4A93 G;  4XXE A;  1JIC A;  4DAM A;  4KK7 A;  5EBC A;  4AQY Q;  2EOT A;  2JA7 B;  1RTN A;  2QKI C;  1YHA A;  3KFU A;  1AW7 A;  4YCU A;  1LAB A;  1I5F A;  4F8M A;  1VQC A;  1KAB A;  3K5M A;  3GQB A;  3EQL C;  4LF5 Q;  4A3G H;  3KBG A;  1ROD A;  1YJN A;  2MJ8 A;  3H3V C;  2RSO A; 
#chains in the Genus database with same CATH homology
 3RZD H;  4JOI A;  3OW2 A;  1LUZ A;  1EQQ A;  4HJ8 A;  4IFD G;  1JT8 A;  3GD7 A;  4GLV B;  3RNU A;  3MEF A;  5GQO A;  3CC7 A;  3S2D H;  3CW2 C;  2NVT H;  3DLL A;  1E3P A;  4OX9 L;  2K4K A;  4YCW A;  4DAY B;  3U4V A;  4LNQ A;  5M3F H;  4JBK A;  1QZG A;  4A3C H;  4IPD A;  4IFD I;  3KJO A;  1S3O A;  1X56 A;  1IBM L;  1Z9F A;  4JBW A;  2R7D A;  1U0L A;  3KDF B;  3K7U C;  3CQZ H;  4KHP Q;  2PQA A;  2K5V A;  3DM3 A;  5C0X J;  4DV3 L;  3HOY G;  4OO1 G;  5J3B A;  3HKZ E;  2R7Z H;  1K8G A;  5IP7 G;  4DR5 Q;  4A3E H;  2ES2 A;  2JA8 G;  3GTQ H;  1KD1 C;  1VQL A;  4GNX A;  2PI2 E;  1EFW A;  4B3M L;  4DV0 Q;  2JA5 H;  4LF9 L;  3B6Y A;  1I50 H;  4GKJ Q;  3S1N H;  1SR3 A;  1FVI A;  5IWA Q;  4HJ9 A;  3CCR A;  4A3G G;  2A1A A;  1SE8 A;  4AH6 A;  1E7Z A;  2HHH L;  1VQF A;  4NB3 A;  4X64 Q;  4JI3 Q;  3KLW A;  4LFB L;  5C3E G;  2RCN A;  3T1H L;  1OXU A;  4HIK A;  2WAQ E;  3NEN A;  3MXN B;  1KL9 A;  4LF8 Q;  2N49 A;  2JA6 G;  4NXM L;  1WYD A;  5LMN L;  1EIF A;  1Q7Y C;  5GRO A;  1WCM G;  1VQ9 A;  4DV4 Q;  1VQN A;  2ATW A;  2Q2I A;  1VQJ A;  5ELN A;  2UUB Q;  3GTL H;  3K8A A;  3TRE A;  5IP9 G;  2VNU D;  4JYA L;  2I5M X;  4J15 A;  1Q81 C;  3UE0 A;  3I7F A;  5FJ8 G;  4A75 A;  3IRB A;  2WFW A;  4A3K H;  1UE6 A;  4DPG A;  2K14 A;  4AYB G;  3EBE A;  4YHH L;  1HR0 L;  2BH8 A;  4LF6 L;  5H1S E;  2BH2 A;  3GTM H;  1SN8 A;  2JQO A;  2Z6K A;  1VQG A;  3I4N H;  4IFD J;  3F2C A;  3I2Z A;  1XNQ L;  2WAQ G;  3J81 c;  4JBM A;  4LFB Q;  4DUZ Q;  4JI3 L;  4X64 L;  5BR8 L;  2B63 H;  4A3B H;  5C0X I;  4C3I H;  2E5L L;  1B7Y B;  3KJP A;  2ZM6 Q;  2F4V Q;  2IX0 A;  1J5E Q;  2D62 A;  2LSS A;  4LFC L;  2HIV A;  4PZ7 A;  4OX9 Q;  1RL2 A;  3NEL A;  4DV7 L;  2FXQ A;  3U50 C;  1GD7 A;  1E24 A;  3PF4 A;  2B3G A;  4DUZ L;  2N8N A;  1JB7 A;  3JC6 6;  3UDX A;  1SRU A;  1C9O A;  1K73 C;  4GN4 B;  1XMO Q;  1A0I A;  4KHZ A;  2UUA Q;  2YTV A;  4UPA A;  1L1O C;  4DR3 L;  1CKN A;  4XTC S;  4YY3 L;  4UP8 A;  4LF4 L;  1QUQ A;  5LMU L;  2YTY A;  1Y1W H;  3KF6 B;  3PUW A;  1N34 L;  2E2J H;  3TQY A;  2UUC Q;  3EIV A;  4OWX B;  4GOP B;  4TVA B;  5FJ8 H;  1TWG H;  1Y14 B;  4IPG A;  4PZ6 A;  2JEA I;  1K0R A;  3UE1 A;  1XTD A;  2VW9 A;  3I56 A;  3HOW G;  3S2H H;  1NMF A;  4KLK A;  5M3M G;  2IHE A;  3UDF A;  1YHQ A;  4A93 H;  4DR7 L;  2PQA B;  1HNX Q;  3OTO L;  4JOI C;  4JI0 Q;  2AHO B;  4IO9 A;  1JJG A;  2GVA A;  3AYH B;  5EAY A;  3D0F A;  1VQP A;  1NJI C;  2Q2U A;  4X6A H;  1Q12 A;  4LUZ A;  3S17 H;  3AFP A;  1CUK A;  3NEM A;  4QQB X;  3S1R H;  2WP8 J;  5IWA L;  1X55 A;  2UUA L;  3W1G A;  4B3S L;  4LF9 Q;  4FDB A;  5M5Y H;  3I4O A;  1N36 Q;  4A3L G;  2DGY A;  2V1C C;  2IX1 A;  1KHI A;  1VQO A;  2Z6K C;  1XPU A;  1VQA A;  1KRS A;  1G51 A;  3L2P A;  4DV5 L;  1IL2 A;  1X3G A;  2KCM A;  1EWI A;  1XPR A;  1N33 Q;  1VQ5 A;  2MQH A;  4IOA A;  1HR0 Q;  4A3M H;  1C0A A;  3PO3 H;  3RLF A;  3FHW A;  4DR2 L;  1IBL L;  4GNX C;  4AYB E;  1XNR Q;  4A3J G;  4JYA Q;  4O0A A;  4NPS A;  1A63 A;  3FKI H;  3HOW H;  2UUB L;  1PH5 A;  1OXX K;  3H15 A;  3F2B A;  4HJ7 A;  1YIT A;  3PUY A;  2KHI A;  2ZTE A;  1KAW A;  2KEN A;  2AKW B;  5FLM G;  1N8R C;  4B3S Q;  3PO2 G;  2KBN A;  4A3I G;  2VQE L;  1XMQ L;  1A8V A;  4WJ4 A;  4LUO A;  2R92 G;  1TWA H;  5C4X G;  5IYB H;  1Q46 A;  3GTJ H;  5C44 H;  4MTN A;  4DV2 Q;  3S1M H;  4R4O A;  1PVO A;  1KQS A;  3HOX G;  1V1Q A;  4JI8 L;  2JA9 A;  4GKJ L;  4DV1 Q;  1ASY A;  4P75 A;  2B29 A;  3M7N A;  2UXC Q;  5IYD H;  3ZJY C;  3GTG H;  5M3F G;  2I5L X;  3CP0 A;  5IYC G;  2QGQ A;  3ERS X;  4OWT B;  3A0J A;  1YIJ A;  3I4M H;  5C0X G;  4A3D G;  2LXK A;  1HNZ L;  1V43 A;  1OXS C;  5IP7 H;  3M4P A;  5M5W H;  4OO1 I;  3KF6 A;  4JC0 A;  4DV2 L;  4LF7 Q;  4P74 A;  1FJG Q;  1CKN B;  1IXR A;  3HOY H;  4L5S A;  1PH7 A;  4BBS G;  4POG A;  1VS0 A;  4QGU A;  4H02 A;  1U5K A;  2EQS A;  2ZTD A;  2VQE Q;  1XMQ Q;  2MFI A;  2QA4 A;  3T1Y L;  1JE5 A;  4LUV A;  4LF4 Q;  3S14 H;  4QIW E;  3CCS A;  2ZTC A;  3M4Q A;  1VQB A;  3FKI G;  4B3T L;  4BXX G;  1C7Y A;  1VQ7 A;  4BBR H;  2F3I A;  1PH6 A;  3RLO A;  2JA5 G;  1L0W A;  3W1B A;  4LWC A;  1OTC A;  2H5X A;  5GAD C;  5GAE C;  1L1O A;  4EQ5 A;  2UXC L;  2OTJ A;  2R92 H;  5K36 G;  1HZC A;  2Q2H A;  3E0E A;  4JI8 Q;  4DKA C;  2HQL A;  4DR6 Q;  4A3F G;  1QZH A;  1MIU A;  4DV4 L;  2YU9 H;  4GN3 B;  1G29 1;  1KIX A;  3H0G H;  5BR8 Q;  1QVG A;  3KYH C;  4JI4 Q;  4HIM A;  1Y1V G;  3PSI A;  4X66 Q;  3A5U A;  2VUM H;  3KDF A;  1X6O A;  4RG1 A;  1N32 Q;  1MJC A;  4DUY Q;  5AJ3 Q;  4LF6 Q;  2R93 H;  1BVS A;  1GKH A;  1HH2 P;  2VZA A;  2A19 A;  4LFA Q;  4B3T Q;  1J5E L;  3A5Z B;  3CCV A;  1O7I A;  4DV6 L;  1GM5 A;  1WI5 A;  4HID A;  1IBL Q;  4UY8 C;  2JK8 A;  4L5Q A;  1B8A A;  4DR3 Q;  1VQK A;  2WB1 E;  4LF8 L;  2YTX A;  1VQD A;  4DV5 Q;  1XJV A;  1NE3 A;  1B70 B;  5IE8 A;  1H95 A;  4GN5 A;  3BZK A;  3SGI A;  1HNW L;  2UXD L;  1VCI A;  1S72 A;  1K8A C;  1VQI A;  3CAM A;  2RF4 A;  2CFM A;  3I55 A;  1TWF H;  3GO5 A;  2UUC L;  4IJL A;  4LFA L;  4PZ8 A;  4JG2 A;  4DV0 L;  3CMA A;  3J80 c;  3RLN A;  3CPW A;  4YWL A;  1PH1 A;  3PGZ A;  1PYB A;  3HKS A;  1X3E A;  2MNA A;  4YY3 Q;  3RN5 A;  3HOV G;  4R4T A;  1R9T H;  2ZJQ A;  1QUQ B;  1NY4 A;  3A74 A;  1AE2 A;  4X66 L;  3M9B A;  4ALP A;  3T1H Q;  1UWV A;  5LMN W;  2WB1 G;  4JI0 L;  1XNQ Q;  3OTO Q;  3GTO H;  2OQK A;  3GTP H;  4X62 L;  4JI1 L;  1AE3 A;  4OWW B;  4R4I A;  2K75 A;  2K5N A;  5IY0 A;  2ZJP A;  4JI7 Q;  4WJ3 M;  2NVQ H;  2VQF L;  2JA7 G;  1YEZ A;  3CCU A;  4ME3 A;  1ASZ A;  4POF A;  2L15 A;  3CXC A;  1K9M C;  3PO2 H;  4A3I H;  3U58 A;  3J7A 5;  5GAG C;  2CKZ B;  2R6G A;  2XTI A;  4C2M H;  1HNW Q;  3TEH B;  2HIX A;  4UP9 A;  5C3E H;  4HJ5 A;  3G71 A;  4A3J H;  1J6Q A;  4AIM A;  2NZH A;  4K0K L;  1Q86 C;  1EYG A;  2JA8 H;  1HZ9 A;  1LYL A;  2VS1 A;  1E1T A;  3BZC A;  2YV5 A;  3PF5 A;  1DGS A;  1M90 C;  1XNR L;  4A4I A;  2GVB A;  1VQ4 A;  3AFQ A;  3NBH B;  1SFO H;  5IYD G;  4DR2 Q;  1IYJ B;  5M5X H;  4BA2 I;  1NMG A;  1I6H H;  1X54 A;  1N33 L;  1YI2 A;  3M85 A;  1GVP A;  4PG3 A;  3EN2 A;  3PV0 A;  5DLQ E;  4LW1 A;  3HOZ H;  3ULP A;  2NN6 I;  3HFZ B;  1EIY B;  5C4X H;  4BY1 H;  4KI0 A;  3CCE A;  1YHB A;  4DR4 L;  5JJK A;  2D0P A;  3BU2 A;  1UE7 A;  2ALY B;  1QVF A;  4PMW A;  4JI1 Q;  1IBK L;  5LMN Q;  3S1Q H;  4A76 A;  1SMX A;  2K50 A;  3J7Z C;  3L7Z C;  3U4Z A;  4A3M G;  1IZ6 A;  1PFS A;  4DV3 Q;  4MZ9 A;  1YZ6 A;  4AQY L;  4BY7 G;  4GOP C;  3L0O A;  2EIF A;  2OCE A;  4XIG S;  5ELO A;  3STB C;  5FLM H;  1HNX L;  3J81 i;  2HHH Q;  1GO3 E;  4JI6 Q;  3PIO A;  4QJF A;  4BXX H;  2Y0S E;  2CWP A;  4IPC A;  2DUD A;  1JJ2 A;  3HOU H;  4DR6 L;  2RHQ B;  2OWO A;  2LXJ A;  1BBU A;  1UE5 A;  2I5H A;  1PH2 A;  2UU9 L;  4B3M Q;  3VDY A;  1PH3 A;  1MKH A;  2D0O A;  3CCQ A;  2OTL A;  2E2H H;  2KCT A;  4EX5 A;  2GN5 A;  4OXP A;  3G6E A;  3H3V H;  4DUY L;  1K83 H;  5C44 G;  2OQ0 A;  3H0G G;  5JEA G;  4C3H H;  1NTG A;  3HOX H;  5JJI A;  1Y1W G;  2KHJ A;  4DR1 Q;  1X3F A;  2MO0 A;  4HIO A;  1IBM Q;  5E7N A;  4R4C A;  1IBK Q;  4B3R Q;  2NVX H;  4RMF A;  4YWK A;  4DV7 Q;  4LF7 L;  1FJG L;  2E2I H;  3HOZ G;  2IY5 B;  2AWN A;  1PH4 A;  2CCZ A;  1MJE A;  4LFC Q;  2R93 G;  4A3C G;  1VQM A;  3ULL A;  1Q8K A;  2I0Q A;  3RN2 A;  3M4O H;  1D7Q A;  2PMZ E;  1Q1E A;  1TXY A;  1KRT A;  1OXT A;  1JMC A;  4DR5 L;  1EQR A;  1T9H A;  3HKZ G;  1PH9 A;  3PO3 G;  2IT1 A;  1PV4 A;  3RZO H;  3CME A;  1HZA A;  1P8L A;  4GKK Q;  4C3J H;  4A3E G;  3PUX A;  1CKM A;  2BA0 A;  3TRZ A;  3F8T A;  1AH9 A;  3GTK H;  1SLJ A;  2C35 B;  3WWV A;  2Q2T A;  5GAH C;  3K0X A;  4P73 A;  4NXN L;  4DR1 L;  1RIP A;  1I3Q H;  2CQO A;  1KXL A;  1XPO A;  1HZB A;  4O2D A;  4DV6 Q;  2IHF A;  4JI2 L;  1WCM H;  2UXB Q;  3STB D;  5JJL A;  2JEB I;  1VQH A;  4GLA C;  4DR7 Q;  3K80 C;  4JCV E;  3J81 j;  3PUV A;  4QL5 A;  4X62 Q;  1N32 L;  2N3S A;  5HY6 A;  3ICE A;  1PA6 A;  2JE6 I;  4HJA A;  4GOP A;  3CC4 A;  2JJQ A;  3CCM A;  1Y1V H;  3F2D A;  4QY7 A;  5HGQ A;  1CSP A;  1BKB A;  2CWA A;  2NVY H;  2NZO A;  1TWC H;  3CD6 A;  1UEB A;  3D31 A;  3F1Z A;  5C4J H;  1W2B A;  2ASB A;  3AEV A;  4NXM Q;  4GKK L;  2EXD A;  1X9N A;  3K81 C;  4MNO A;  1L2F A;  2R7Z G;  5IYB G;  3G4S A;  3H3V I;  3PUZ A;  3G48 A;  1WFQ A;  2JA6 H;  3I4N G;  2VL6 A;  1EUJ A;  1WOC A;  3ER0 A;  1I94 Q;  2QEX A;  1D8L A;  1WJJ A;  4IOC A;  1M1K C;  1S40 A;  4DR4 Q;  2Y0S G;  2UXB L;  2NN6 G;  1PYS B;  4JI2 Q;  5IP9 H;  3CF5 A;  1LTL A;  1X65 A;  3T1Y Q;  1PHJ A;  4UP7 A;  2B63 G;  2BA1 A;  2E5L Q;  3TS0 A;  4A3B G;  4P71 A;  1VQ8 A;  2N78 A;  4BBR G;  3OYY A;  3E9I A;  2AWO A;  1BBW A;  2PI2 A;  3AQQ A;  1Z47 A;  1L1O B;  4JI5 Q;  4GS3 A;  4JBJ A;  1NBW A;  3CC2 A;  4DK6 C;  1VQE A;  4KHP L;  1E22 A;  4R4Q A;  1LM0 A;  1PH8 A;  4BY1 G;  4GNX B;  1I94 L;  3UDI A;  3KF8 B;  1V9P A;  2ID0 A;  1W3S A;  5AJ3 L;  3W5O A;  3S15 H;  4DNI A;  2YYZ A;  4IJH A;  3CCL A;  4JV5 Q;  2A8V A;  3ULJ A;  3HOV H;  2RHS B;  1QVC A;  3J80 i;  2VQF Q;  4JI5 L;  4A3K G;  4BY7 H;  2K5H A;  4OON A;  5JEA J;  4DV1 L;  3E9H A;  4JI4 L;  4L5R C;  1N34 Q;  4Y7N H;  3FP9 A;  2JA7 H;  1YJW A;  1Q82 C;  1UE1 A;  1YNX A;  1Q1B A;  5LMU Q;  4K0K Q;  2VY3 A;  2ZJR A;  4B3R L;  4P72 A;  1FL0 A;  3PCO B;  1YVC A;  4YCV A;  4BA1 I;  3I4M G;  4A3D H;  1HJP A;  3HOU G;  3M3Y H;  3LGJ A;  4JV5 L;  1EOV A;  3Q8D A;  4L5T A;  2AMC B;  1CSQ A;  1A62 A;  2K52 A;  3GDE A;  2UXD Q;  2Z0S A;  4X65 L;  1K3R A;  3BJU A;  1P16 A;  4YWM A;  1YJ9 A;  4LF5 L;  3S24 A;  3KOJ A;  1VQ6 A;  4IPH A;  5FLX c;  4A3F H;  3JAM i;  1G6P A;  1FGU A;  1CKO A;  3K7A H;  5IYC H;  1OXV A;  3UDG A;  4APV A;  4NXN Q;  1N9W A;  2F52 A;  3CCJ A;  1SRO A;  4Y52 H;  2XGT A;  5M3M H;  4A93 G;  4DAM A;  4GLX A;  4AQY Q;  2PNH A;  2MO1 A;  2E8G A;  1JJC B;  1YBY A;  4TQU S;  3PIP A;  1HNZ Q;  4BBS H;  1YHA A;  4X65 Q;  2VUM G;  3CPF A;  4YHH Q;  3KFU A;  4YCU A;  1HR0 W;  1I5F A;  1N36 L;  1VQC A;  4R1J A;  1KC8 C;  2UU9 Q;  2R7F A;  1E1O A;  1TWH H;  4LF5 Q;  4JI7 L;  5IT9 c;  2ZM6 L;  2F4V L;  3TS2 A;  4A3G H;  2HT1 A;  4JI6 L;  1YJN A;  3JAM c;  3S16 H;  3RR5 A;  4A3L H;  1XMO L;  4DK3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...