1LUZA

Crystal structure of the k3l protein from vaccinia virus (wisconsin strain)
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
FCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVNYKRMCRHQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein K3
publication title X-ray crystal structure and functional analysis of vaccinia virus K3L reveals molecular determinants for PKR subversion and substrate recognition.
pubmed doi rcsb
source organism Vaccinia virus
molecule tags Viral protein
total genus 18
structure length 85
sequence length 85
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1luzA00
5GAGC 2R93H 1KAWA 5IYDH 1Q8KA 1CKMA 3CCQA 4JI7Q 1KL9A 1E1TA 4LF4L 4DR5Q 3GTOH 3PO2G 4Y52H 1K83H 4XTCS 3HOZG 4IFDG 5GAHC 4OX9Q 2C35B 4P71A 1BBWA 4BXXH 2N8NA 4A3GG 2K50A 4YWKA 3S15H 3CPWA 4KI0A 4DR7L 4X62L 2AWOA 3UE0A 3FKIH 4EX5A 1XMOQ 4JI6L 2RF4A 2CWAA 2UXBL 3DM3A 1AE2A 2UUCQ 4DV0L 1X56A 4GNXC 3S16H 2HIVA 1OXTA 5BR8Q 4JYAL 4K0KQ 4JI7L 3Q8DA 4JI1Q 2RCNA 1TWGH 1Y14B 4DR5L 1Q81C 2BH2A 3H0GG 4NPSA 5ELOA 1SMXA 4GS3A 1MJEA 1WCMH 4OX9L 1UWVA 3KJOA 3E9IA 1EQQA 1N32L 4JI5Q 4NXMQ 4LUZA 2VQFQ 2QA4A 4LF7Q 2F3IA 4HJ9A 1NE3A 5FLXc 4A3MH 4JG2A 5M5XH 2FXQA 3I4MH 3CCRA 1YITA 2UUCL 1C9OA 2E8GA 2HIXA 4X66Q 4JV5Q 4BBSH 2OQ0A 3I2ZA 2F4VQ 2YYZA 4JI1L 3CC7A 1YJWA 2UXCQ 3AEVA 4LFAQ 1A62A 4DR1L 4KHPQ 2QGQA 2ID0A 3TQYA 4UY8C 3J81c 1FVIA 1QUQA 3CC4A 5JEAG 4DR6Q 3G48A 2Q2HA 4JI5L 3IRBA 3F1ZA 1I6HH 5HGQA 2IHFA 1VQ8A 4A3FH 4JBJA 1E3PA 1FL0A 5J3BA 4X66L 4JV5L 2WAQE 5FJ8G 4GOPA 3CCVA 1TWAH 3HKZE 2Z6KC 3PUYA 2VUMH 4A3BG 3CCLA 1WOCA 1J5EL 2ES2A 3HOYH 3HOXG 3PUZA 2MFIA 1EYGA 3MXNB 2E2IH 5IYCG 2EQSA 1VQCA 2OTLA 2DGYA 3STBD 3NELA 4LUOA 4A3JG 4A3IH 4IOCA 3PO3G 4DR6L 3RLFA 3I56A 3HOUG 1IBLQ 4BBRH 2Z0SA 5GQOA 3KFUA 1LTLA 4BY1H 3M4QA 1X6OA 1Y1VH 2EXDA 1YHQA 2BA1A 3M7NA 2WAQG 1HNWL 2B63H 1PH5A 4DV3Q 3HKZG 4GN5A 3GTJH 3RZOH 1PH7A 1L0WA 2MNAA 2L15A 1GO3E 1N8RC 3GTKH 1DGSA 3GO5A 5FLMH 1EIFA 3S2HH 3KF8B 1NTGA 4B3RL 1OXXK 3M4PA 3F2BA 4LF6Q 4DUZL 1FGUA 2XTIA 4B3TL 4YCVA 4QJFA 3PIPA 5GAEC 2CQOA 5LMNW 4C3JH 1VQ4A 2Q2UA 2NZHA 1VQIA 2KENA 3KYHC 3GTPH 3I55A 3CF5A 4O2DA 3D31A 3F2DA 3RR5A 4LF5Q 3SGIA 4LWCA 4OO1I 3S17H 1X54A 2VW9A 2IT1A 5ELNA 4BY7H 4LFBQ 4R1JA 4R4IA 4DV7L 3AFPA 3H15A 2NN6I 2I5MX 1VQOA 2JA5G 1K73C 1Y1WG 3H3VH 3CPFA 5AJ3Q 2Q2IA 4A75A 2I5LX 1CSQA 1I3QH 2JA8G 4YCWA 4KHZA 3S1MH 4DR4Q 2QEXA 1KIXA 1VS0A 2ZTEA 3EBEA 4A3KG 4AQYL 3BU2A 2MO1A 1FJGL 1T9HA 4IJHA 3RN2A 4GKKQ 4OO1G 3I4NG 1PH1A 1CUKA 3M9BA 3J7A5 3MEFA 4POGA 4IFDI 2KHJA 4LFBL 1Z9FA 4HJ7A 3J81i 5IE8A 1K8AC 3GTMH 1X55A 2UU9Q 5AJ3L 4GLXA 2CCZA 4GNXB 1QUQB 2AWNA 1HZCA 4YWMA 2ZM6L 3HOVH 3G71A 4B3SL 4LF9Q 5LMNQ 2B29A 2RHQB 2ATWA 4O0AA 3HOZH 3W1GA 4JI2Q 1XNQQ 1Q7YC 2YTXA 1ASZA 4LW1A 2OWOA 1SN8A 2D0PA 1K0RA 1QVCA 4GOPB 3VDYA 1TWFH 1X3FA 1G291 2AHOB 4TQUS 2ZJQA 2ASBA 3HOWG 5C44G 1JT8A 3T1YQ 1QZGA 4IOAA 3BZCA 1EFWA 1YI2A 2BH8A 2JJQA 3J80c 1L2FA 1IBKQ 1HNXQ 2UU9L 4GLAC 5M5WH 3U58A 1S40A 1QVFA 4DV2L 1WI5A 1N9WA 5DLQE 1KC8C 1HNZQ 4JI3L 1XTDA 3EN2A 5IP7H 1XMQL 2VQEQ 3D0FA 3I7FA 2B3GA 1AH9A 1YHAA 1YBYA 5IP9H 2E5LQ 4B3MQ 4JI2L 1S3OA 1I94L 2Q2TA 1YEZA 4DPGA 3T1HQ 4RMFA 3CMAA 3OYYA 5IWAQ 1S72A 1K8GA 3I4OA 4Y7NH 1C7YA 1CSPA 2IX0A 1C0AA 4ME3A 4DV6Q 4R4TA 2KCMA 3T1YL 3GTLH 3CCEA 1G6PA 4GLVB 3M85A 1TXYA 1IBKL 1HNXL 4A3LH 2IHEA 1UEBA 4GN4B 4OONA 4GOPC 2CWPA 2ZTCA 1V1QA 1EIYB 1TWHH 5C4XG 1HNZL 1V9PA 4GKJQ 3JAMc 4MZ9A 4OWWB 1I5FA 2R93G 2VQEL 3RZDH 1L1OC 2RHSB 2PNHA 3KOJA 5IYBG 1XMOL 3ER0A 2E5LL 5GROA 4B3ML 3UDXA 4X6AH 3UDIA 1GD7A 2CKZB 4MTNA 1XPOA 4K0KL 5BR8L 1HH2P 1IZ6A 5IWAL 5C0XJ 1A0IA 3K8AA 1VQ9A 3KDFA 1X3GA 3RLOA 4DKAC 1PH4A 4OWTB 3K81C 4BXXG 3NBHB 4DV6L 4A93H 3S1RH 4X65Q 5C3EH 3HFZB 3TS0A 1JB7A 3GTGH 1V43A 4TVAB 4J15A 2PI2A 1JE5A 4L5QA 3F2CA 3RLNA 1MJCA 2VQFL 4GN3B 4LF7L 4NXML 3PSIA 4PZ8A 3HOXH 2BA0A 2ZJPA 2YV5A 5IYCH 1CKNA 1PH6A 1KD1C 3S2DH 2A19A 4A4IA 1I94Q 4A3CH 4DV4Q 2LSSA 2F4VL 1WCMG 2F52A 3NENA 2I5HA 3M3YH 4LFAL 3PUWA 2UXCL 4X65L 4KHPL 1L1OA 1VQ5A 4DV5Q 2JA9A 1UE7A 4IPHA 1BKBA 1YHBA 1IBMQ 2DUDA 4JC0A 4A3MG 1LUZA 3I4MG 5JJIA 4JOIA 3FP9A 3S24A 4A3DH 1VQ7A 4BBSG 1Q82C 1H95A 5M3FG 4PZ6A 4DV4L 1JMCA 3H3VI 3J80i 4HJ8A 2CFMA 1G51A 1VQFA 1YJ9A 1EQRA 4OXPA 2GVBA 2JA7H 4JI8Q 3JC66 1Q1BA 1NBWA 4X64Q 1IBML 3L2PA 4DUYQ 1YIJA 1PH3A 2VY3A 4UP9A 3CD6A 2K52A 1IBLL 1D8LA 1MKHA 2K5NA 5M3MH 2VUMG 4YCUA 4L5TA 4DV3L 1VQJA 3U4ZA 3HOYG 3WWVA 1X9NA 3K80C 1N36Q 3G6EA 2NVYH 1J6QA 3OTOQ 4A3KH 1KXLA 3CCSA 3PV0A 1VQKA 4BA2I 4A3IG 4L5RC 3JAMi 2OCEA 4R4CA 4BBRG 1B70B 5EAYA 4A3EH 1K9MC 4XIGS 4JI0Q 3A0JA 4DUYL 1N34Q 4LF6L 3GDEA 4NB3A 4IPCA 2D0OA 2B63G 3OW2A 1VQPA 2JA6H 3ULLA 4HIDA 4DR2Q 1D7QA 4HIOA 1PH2A 1SFOH 2R92H 3NEMA 5LMUQ 1KQSA 2KHIA 3CAMA 4LF5L 2V1CC 1A63A 4P72A 3KDFB 1VQGA 1YJNA 2K14A 1UE5A 2R7ZH 2I0QA 2OQKA 3HKSA 4AYBE 2VNUD 4JI0L 2WB1E 1VQDA 1TWCH 1N34L 4HIKA 3PO2H 1BBUA 1OXVA 4PZ7A 4FDBA 1X3EA 4JBKA 4DR4L 4A76A 3TRZA 4DR2L 1Z47A 1PA6A 1OXUA 1JJ2A 1CKNB 4BY7G 4C2MH 4A3GH 1X65A 4IJLA 5M5YH 1OTCA 3K7AH 4L5SA 4DV1Q 4GKKL 2N78A 2K75A 1YZ6A 3PGZA 3EIVA 2JEBI 4DR3Q 5E7NA 2N49A 1L1OB 4DAYB 2AMCB 1LM0A 3CQZH 2WB1G 4HJ5A 1JJGA 1VQHA 1IXRA 1U0LA 3CXCA 4QGUA 4BA1I 4MNOA 2NVQH 4LF9L 5LMNL 3H0GH 4LNQA 1XNQL 2UUAQ 4X62Q 4WJ3M 2IX1A 2XGTA 1GVPA 5C4XH 3PF4A 3CCUA 2JQOA 1E22A 5HY6A 2UXDQ 1CKOA 4DV1L 1B8AA 4AIMA 4DV0Q 4IFDJ 3KF6A 4JYAQ 4QQBX 5IYBH 4UPAA 1XJVA 4DR3L 5C0XI 1Q46A 1NMFA 3HOVG 2K4KA 3UDGA 4LF8Q 3TEHB 2R6GA 2JE6I 3E9HA 5H1SE 2ZJRA 3M4OH 4IPGA 2YTYA 4IO9A 4R4QA 1N32Q 3BJUA 1RIPA 4KLKA 4DAMA 5IYDG 3K7UC 3CCMA 2VS1A 2E2JH 2A1AA 5C4JH 2UUAL 1VCIA 1NJIC 3FHWA 4LFCQ 1VQAA 2JEAI 3T1HL 2N3SA 1HR0W 2EIFA 3CC2A 4UP7A 3S1NH 2UXDL 4JOIC 1QVGA 2LXKA 1LYLA 1KRSA 4QL5A 4QY7A 3CMEA 3CP0A 3AFQA 5IP7G 4LF8L 5C0XG 5FJ8H 3GTQH 3ICEA 4DR1Q 3ERSX 2YTVA 1KRTA 3FKIG 1IYJB 1E24A 5IP9G 2ALYB 4A3BH 4GKJL 4YHHQ 3S1QH 1O7IA 1P16A 4JBWA 2D62A 1SLJA 1NY4A 3PIOA 4LFCL 3K0XA 4LUVA 1XNRQ 3W5OA 4A3JH 3PO3H 1UE6A 1UE1A 1YNXA 3HOUH 4A3LG 1WFQA 4JI4Q 1OXSC 3A5ZB 1HZ9A 1ASYA 5M3FH 2PQAA 2R7DA 2MO0A 1XPRA 1VQLA 4AH6A 1P8LA 5JEAJ 1R9TH 1J5EQ 1MIUA 4DK6C 2R7FA 2WP8J 3GD7A 1IL2A 4YHHL 4GNXA 3RNUA 1Q12A 2OTJA 1WJJA 1NMGA 1E1OA 1PH9A 1HJPA 2UUBQ 2KCTA 1XNRL 3DLLA 4RG1A 4H02A 3UE1A 4A93G 2NVTH 4OWXB 1HR0Q 1PYBA 4EQ5A 1HNWQ 3U4VA 4P75A 2K5VA 1PFSA 5C3EG 4YWLA 4JI4L 4ALPA 3AQQA 5K36G 4HJAA 5JJKA 2AKWB 3AYHB 4DK3C 1GKHA 1JJCB 2KBNA 2IY5B 4PMWA 4DV5L 3A74A 4YY3Q 3B6YA 4A3FG 4B3RQ 1SR3A 4IPDA 4WJ4A 1XPUA 1RL2A 3L0OA 4DUZQ 2JA5H 4B3TQ 1Y1WH 4HIMA 2HT1A 1B7YB 4A3CG 1KHIA 2UUBL 4JCVE 1N33Q 2NVXH 5GADC 4C3HH 1SE8A 3L7ZC 1VQBA 1PV4A 1HR0L 2JA8H 3KF6B 1I50H 1BVSA 3UDFA 3PCOB 1SROA 3J7ZC 1VQMA 2Y0SE 4JI8L 1Q1EA 4DV7Q 3TS2A 3CW2C 4PG3A 4A3DG 4YY3L 4X64L 1WYDA 2LXJA 4BY1G 2A8VA 3I4NH 1Y1VG 3W1BA 1EOVA 1K3RA 1PVOA 4POFA 2NZOA 3A5UA 2VZAA 2Z6KA 1AE3A 1U5KA 3LGJA 4JBMA 1N33L 1HZBA 2K5HA 2HHHQ 5FLMG 1VQEA 3KJPA 4AQYQ 1FJGQ 1E7ZA 2JA7G 1QZHA 1N36L 1W3SA 3BZKA 3J81j 3OTOL 2Y0SG 3KLWA 5JJLA 2PMZE 2WFWA 2YU9H 3STBC 1YVCA 1EUJA 1GM5A 3HOWH 1A8VA 5M3MG 5C44H 4APVA 2ZM6Q 2HQLA 2MQHA 3F8TA 4B3SQ 1Q86C 4NXNQ 1SRUA 2PI2E 4UP8A 1VQNA 3CCJA 5LMUL 3PF5A 2HHHL 1PYSB 3S14H 3ULPA 3RN5A 3ZJYC 1VQ6A 2GN5A 1EWIA 2ZTDA 2PQAB 3E0EA 4DNIA 4A3EG 4LF4Q 4R4OA 4AYBG 2VL6A 1HZAA 2JA6G 1M90C 1PH8A 2NN6G 2E2HH 3U50C 5IY0A 2R92G 3ULJA 4C3IH 4DV2Q 2H5XA 4P74A 3PUXA 2GVAA 1PHJA 4JI3Q 1M1KC 4P73A 4NXNL 1XMQQ 4DR7Q 1W2BA 5IT9c 4JI6Q 2R7ZG 3PUVA 3TREA 2UXBQ 3G4SA 4QIWE 2JK8A
chains in the Genus database with same CATH superfamily
5GAGC 2E2HB 2R93H 5IYDH 3P75A 4C3IB 3Q24A 4JI7Q 1KL9A 3GTOH 5KGUA 3HOZG 4XTCS 5CBEE 5TSSA 1WTQA 2C35B 4P71A 1BBWA 3TN2A 4OX9Q 4BXXH 2R93B 3A56A 3GTOB 4MTKA 5E4WC 4KI0A 2OT2A 2AWOA 1EY6A 5JAVA 1XMOQ 4JI6L 2RF4A 4DV0L 3S16H 2HIVA 5BR8Q 1H9SB 2RCNA 4DR5L 1Y14B 1B2TA 2BH2A 2G9HD 1MJEA 3KJOA 3S16B 1HQRD 2A6EC 2L0CA 5C3WA 4NKLA 1X3PA 2HIXA 4JV5Q 2NZ1D 3VR5A 3IL8A 3ERQA 2UXCQ 3AEVA 4FNFA 4LFAQ 5IOCA 1CA6A 1KDBA 4UY8C 3J81c 1FVIA 2QDBA 5FK9C 2C5CA 2EY5A 2PQEA 3G48A 4JI5L 5EKKA 1FYCA 3F1ZA 1I6HH 2L55A 5HGQA 5EBCA 4JBJA 5J3BA 1FL0A 5E4XA 4X66L 5FJ8G 3CCVA 1SDFA 4CDFC 4A3BG 2HDMA 3R3OA 1I6HB 2ES2A 3HOYH 1GXDC 3CKIB 2MFIA 1PZKD 4S3SA 4KJOA 5IYCG 2DGYA 2G9DA 4RGTA 4IOCA 3RLFA 3I56A 1EY0A 5E3FA 5GQOA 2KEEA 1LTLA 3HOYB 1IL8A 2FMCA 2B63H 5DAUA 4DV3Q 3GTJH 1PTOD 1N8RC 4CDEC 2HCIA 3U9OA 1PTOB 5D65A 3MWYW 2B63B 1OXXK 1BNZA 3GTJB 4YCVA 3PIPA 2NZHA 4BS9A 5IGFA 2Z9HA 3D31A 1TIID 3F2DA 4OO1I 3S17H 1I4QA 3N52A 5D14A 5ELNA 4BY7H 3V96A 3BVMA 2PPBC 4A75A 2SDFA 3S17B 2Z4IA 1I3QH 4YCWA 1HA6A 4BY7B 4M8AA 2ZTEA 1W6KA 3BU2A 2MO1A 1FJGL 3RN2A 3A8IE 1XYIA 3ND9A 3I4NG 1CUKA 1I3QB 1LLRD 2DY8A 3J81i 2UU9Q 3T56B 5AJ3L 2AWNA 5LMNQ 2B29A 2RHQB 4O0AA 5CV7A 2F0TA 2A6ED 1XNQQ 4PNYA 5EBDA 1EU4A 3J81E 2MGSA 1G291 3LWUA 2ASBA 3HOWG 1V1PA 1JT8A 4ULLA 1EFWA 3J80c 2JJQA 2DJFC 5M5WH 4DV2L 1HNZQ 3HP3A 4JI3L 5IP7H 1Q3LA 4DXGA 2B3GA 1RJTA 2E5LQ 4JI2L 1S3OA 1WTVA 1H9KA 5M5WB 1JB3A 2CH4A 2RVLA 3I4OA 3H6MA 3QIAA 5I6YA 3T1YL 2F0GA 3QB3A 1G6PA 3NK9A 4GOPC 2L1BA 1LTTD 3SXHA 5KNDA 1I5FA 5IYBG 3ER0A 3TP7A 1A15A 1FNUA 3UDIA 1GD7A 2F0SA 4MTNA 3K8AA 4HN7A 1D1IA 5BN3A 5M5XB 4CJ0B 1JE5A 3F2CA 1B4OA 3RLNA 1MJCA 4NXML 4HR7B 3DEOA 1VMCA 1C48A 1K0SA 1I4HA 4A4IA 2HDLA 2QDLA 4DV4Q 2LSSA 2F4VL 1WCMG 2IL8A 2F52A 3M3YH 2F0WA 1WTRA 4X65L 4IPHA 1U9RA 3R8BA 1H9MA 3NWTA 3J81L 1LTGD 4ID6A 3M3YB 4DAVA 1H95A 1NCVA 1Y8OB 4L8JA 3J80i 3NTHA 1V1PB 5I6WA 3RUZA 4OXPA 2JA7H 4K6LA 3PIP3 1STBA 2FMMA 2E76C 3CD6A 1PYWD 3W2DA 3BDCA 3CHBD 1D8LA 1MKHA 2JA7B 2VUMG 1HQMC 4L5TA 1VQJA 3WWVA 1X9NA 1XX8A 2F0LA 5ELCA 3S9WA 1N36Q 1CT1D 2NVYH 3OTOQ 1KXLA 1S5FD 3PV0A 1TKWB 4A3IG 2BDOA 2OF1A 1B44D 4R4CA 4KY6A 4FXKC 4A3EH 4OO1H 4XIGS 1H9JA 1DOLA 2K04A 3NTKA 2NVYB 4I7AA 3OW2A 3D6WA 3ULLA 5EGTA 3T4AC 1D7QA 4HIOA 1PH2A 2R92H 4JPBW 3NEMA 5J22A 1TS4A 4A3EB 3Q0AA 1A63A 2PMZB 5I4DA 1YJNA 4AYBB 5KIXA 1TS3A 5IGEA 2R92B 3HKSA 4J8QA 2EE1A 1TWCH 4HCSA 1N34L 1BBUA 4PZ7A 1X3EA 1EIHA 4A76A 3GTMB 1Z47A 1PA6A 4G7ZC 1JJ2A 1SJHD 4QB4A 4GKKL 3FPPA 1QILA 3K7AH 1TWCB 3NQIA 1W6JA 3HOZB 2JEBI 4N8X1 4XQNA 1VQHA 4RWSC 4U673 1KLGD 3K7AB 3FMCA 4QGUA 5EQ0A 1DZ1A 2K32A 2UUAQ 2XSCA 4X62Q 4WJ3M 3MXUA 1ICFB 1MD2D 2LKVA 2UXDQ 1CKOA 2OXPA 4C3IG 1Q46A 3UDGA 3TEHB 2PZTA 5E1FA 3J80L 3PQIA 4TSSA 4U68A 1O78A 1RIPA 1E2VA 3BJUA 3KBXA 5IYDG 2B2WC 4CKBA 3RMHA 3L9AX 1HR0W 4UP7A 1CHQD 3S1NH 1Z7TA 3VR3A 5FJ8H 4G7OC 2Z6BA 4YIJA 1GUNA 5IP9G 4OL7A 4A3BH 3S1NB 1LTBD 2Z1CA 1O7IA 2D62A 4RCOA 3PIOA 3K0XA 1K8MA 4X3KA 4A3BB 2MUYA 1NAPA 2K5QA 1WFQA 2K33A 4JI4Q 1ASYA 1A2TA 1CHPD 5JEAJ 1FR3A 5DM63 2B2WA 1RTNA 1X3QA 5LL6S 4DK6C 1B3QA 3GD7A 2ICIA 3RNUA 1MI2A 1XWEA 3P20A 1E1OA 5AFWA 1XNRL 1I4PA 3DLLA 4RG1A 4H02A 3I4LA 3U4VA 2K5VA 1JCKB 4ALPA 1DCZA 4HJAA 3AYHB 4KY5A 3TZUA 4PMWA 2NUCA 3IFDA 1ZXTA 3B6YA 5G3LD 2SNMA 4B3RQ 2XRSD 1SR3A 5I2YA 1CFMA 1II3A 1DOKA 1KHIA 3HG9A 2UUBL 1N33Q 4C3HH 3L7ZC 4ZLTF 1RHPA 3QWNA 4IUPA 2L11A 1SJED 5CC4A 3UDFA 3PCOB 2XVSA 1VQMA 4ZCKA 1JOQA 1Q1EA 2NWGA 4DV7Q 2F0VA 1F9SA 3CW2C 3TZDA 4C3HB 4H0LC 4X64L 1PZJD 3I4NH 3W1BA 1KDAA 1MSGA 3BG3A 2Z6KA 1AN8A 3LGJA 1U4MA 3VR6A 3I4NB 1V1OA 2HHHQ 1VQEA 1E7ZA 2N55A 3BZKA 3J7AF 1EYCA 1SNMA 4K2KA 2WFWA 4KMUC 2YU9H 3STBC 1EUJA 3HOWH 1A8VA 2LFNA 3FVQA 2MQHA 3F8TA 3RD4A 3DXJC 2PI2E 3CCJA 1QG7A 4QMGA 2K28A 2YU9B 1PYSB 3HOWB 3DHQA 4ZUIA 5T1IA 3ITPA 4DNIA 1MBYA 4R4OA 2DJGC 2VL6A 1SE3A 3ULJA 3MXNA 3PUXA 4P73A 4NXNL 3C2PA 1GUSA 2SEBD 1KAWA 1HRJA 2B2VC 3H94A 3BYYB 1CKMA 3CCQA 2CW0C 2KVMA 1SYDA 2PZWA 3PO2G 1B9NA 2HUGA 1K83H 1BQQT 1TS2A 3KBGA 3KF8A 2N8NA 3HGBA 5KRUA 3CU7A 1K83B 1SYGA 2UXBL 3DM3A 3EQLC 4GNXC 4RKBA 1K28A 1F9PA 2NTSA 3Q8DA 4JI7L 2I46A 3MC0B 4KK7A 1Q81C 3MA2B 5ELOA 2V4DA 2QW7A 1EEID 1WCMH 4OX9L 1UWVA 2L5TA 3BS1A 3SR1A 2Q8IB 1EQQA 2PCFB 3PIO3 5A2QL 2VQFQ 4KV6A 4HJ9A 1NE3A 1WCMB 1YITA 2VB2X 3D3RA 1A62A 4DR1L 2QGQA 4DN4M 2KCNA 1I6VC 4K5WA 2D9UA 2CVRA 2IHFA 3K5OA 3LX0A 1EIGA 1E3PA 2AQ2B 4JV5L 2GA4B 1TWAH 1ZYRC 3G7LA 2VUMH 4F7XA 1WOCA 1J5EL 1PTOF 3PUZA 1EYGA 3MXNB 2E2IH 2K05A 2EQSA 2OTLA 1TWAB 3NELA 4LUOA 3STBD 4A3IH 2VUMB 1IBLQ 2Z0SA 1SYCA 1YNJC 2M2LA 1BCPC 4BY1H 3KFUA 2A73B 2BA1A 1ESFA 1HNWL 1ET9A 1PH5A 2E2IB 1CQFA 1RF2D 4JK1C 1L0WA 4A3IB 1GO3E 1LACA 3GTKH 1DGSA 3FPUB 3OHXC 4BY1B 3NSWA 3S2HH 3KF8B 1XXGA 2PW5A 3M4PA 1BBXC 1E2WA 4LF6Q 2ZXRA 1WVLA 4EQPA 3GTKB 4KHVA 3S2HB 1NUCA 4LF5Q 3SGIA 3URYA 1D6EC 1PRTC 3NHHA 4IURA 4FF3A 1YNNC 4R1JA 1IKMA 4R4IA 3NBHA 3H15A 5ELEA 2CW0D 5BN5A 3EFXD 2I5LX 4WORA 1CM9A 2A74C 3S1MH 4DR4Q 1JWUD 1SXTA 1LTID 1HHVA 1EQTA 4V0BA 1D5XC 4OO1G 3J7A5 2DNCA 3M9BA 1KABA 4POGA 3KLSA 3S1MB 1Z9FA 1JQYD 2FFKB 4HJ7A 5IE8A 1FGBD 1SYFA 1JOKA 4GLXA 1SNCA 4GNXB 1EU3A 2F0FA 4RCNA 1ILQA 3IKJA 4B3SL 4Z9CB 3W1GA 2YTXA 3H09A 1QVCA 1NNXA 5CV6A 1TWFH 1X3FA 3G6JB 1STHA 1AP0A 1Y8PB 2ZJQA 4B9WA 2B2TC 1AEXA 3TP8A 2J0TD 2WKDA 1YI2A 1IBKQ 1HCZA 2UU9L 4GLAC 1S40A 1TWFB 1WI5A 4CGYB 1KC8C 1J8IA 1XTDA 3EN2A 1RCVD 2VQEQ 3I7FA 1AH9A 1YHAA 1YBYA 5IP9H 1I94L 4DA2A 2Q2TA 4DPGA 3T1HQ 4RMFA 1WTPA 2KHSA 2EJFC 3D4WA 4F8MA 4ME3A 5M9OA 3CCEA 1ZYRD 4GLVB 4ZYSA 1TXYA 2JYOA 4GN4B 2XWJB 2CWPA 2ZTCA 1SEBD 1V1QA 4LAAA 1EIYB 1HNZL 3SK5A 1V9PA 4GKJQ 3JAMc 4OWWB 3RZDH 2E5LL 2B2TA 3KLSX 2O5JC 3V2TA 5JEAH 1MHWC 1BCPD 1YNJD 4K0KL 1IZ6A 1X3GA 4DFAA 4OWTB 3K81C 4LK1C 3NBHB 1BCPB 5C4HA 2MPMA 3GTGH 4N9PA 1F9QA 2PI2A 1EZ8A 4LF7L 4GN3B 1S5BD 1VF5C 1D2BA 4PZ8A 3K59A 4K8IA 2BA0A 2F0UA 5KNBA 3J7AV 1KD1C 3GTGB 3S2DH 3MFGA 1Y69U 3C1EA 3NENA 3PUWA 4KHPL 3D8GA 1ZKOA 1PRTD 4DAYA 1VQ5A 2JA9A 3DWAA 1YNND 3S2DB 4A3MG 3I4MG 1PRTB 5JJIA 5A35A 3AU7A 3U9SA 4BBSG 2RQXA 2K1BA 3NE5B 2F3WA 2LMCB 4DV4L 3I3CA 1G51A 1VQFA 1WD0A 4QCLA 3OMGA 5L37A 2GVBA 2PO4A 2ZXOA 1B53A 1Q1BA 1F2YA 1QE6A 2B2YC 1TR5A 1CQVA 4RHRA 4UP9A 5D3IB 4KTAA 1MSHA 4RAUC 1F9RA 1L0YB 1EQVA 3A54A 3DWPA 3A8KE 3K80C 4A3KH 3CCSA 4L63B 3D4RA 3JAMi 2OCEA 4BBRG 1B70B 5EAYA 5FO9B 4C3HG 3I8ZA 4NB3A 2D0OA 3OIPA 4A3KB 1Q90A 4DR2Q 2Z8LA 1T5XD 1LTSD 2B2YA 4XYQA 2K14A 1UE5A 3SEBA 4IALA 2B2UA 1ONLA 2OQKA 2RDFA 4C3JG 2VNUD 3VYRA 2WB1E 4HIKA 3PO2H 4FDBA 4CKEA 3TRZA 4UDUC 1OXUA 3K57A 5CR3A 1OTCA 4L5SA 1IYVA 3PO2B 3I91A 2K75A 1D5ZC 3PGZA 4DR3Q 2J7ZA 2N49A 4DAYB 4J1MA 2WB1G 2LY7A 4C56C 1PXUA 4LF9L 4RGMA 1FNVA 4LNQA 2XWBB 5C4XH 2JQOA 1E22A 4XQQA 3SVMA 1B8AA 4WJWA 4DV0Q 4IFDJ 4UPAA 3HOVG 1NMFA 2K4KA 4IUNA 2JE6I 2XNAC 3E9HA 1VF7A 1K3BC 3BDOA 4IPGA 2YTYA 5C4XB 1BO0A 3K6OA 5BN4A 4KLKA 3K7UC 5F2DA 3CCMA 5C4JH 2UUAL 1NJIC 1B9MA 5COYA 4KKTA 3CC2A 2UXDL 2HQEA 1QVGA 1HTPA 5JOBA 4NDXA 5C4JB 3SK6A 3GTQH 3TDQA 2YTVA 1IYJB 1E24A 3AB9A 5CV9A 1SE4A 1P16A 2EYMA 4JBWA 3JAML 2DY7A 4ABNA 4LUVA 3GTQB 1UE6A 1R4QB 4XXEA 4A3LG 2DN8A 1OXSC 3A5ZB 2EJMA 5M3FH 1JICA 2R7DA 1VQLA 1P8LA 4IUTA 1UNSA 3GV3A 2F0NA 1TS5A 5M3FB 5G3LF 1D5MC 4A93G 4MHEA 2NVTH 2KCCA 4OWXB 2JP1A 5C3EG 1PFSA 2EJGC 4YWLA 4JI4L 2WV6D 5K36G 1JJCB 4DV5L 3A74A 4RH6A 3EA6A 4YY3Q 2NVTB 1H9RA 4OELB 1EYAA 4WJ4A 4F88A 1E2ZA 3J80E 4JCVE 2NVXH 1DOMA 5GADC 4DU9A 4DNRB 4X3SA 1GOZA 4L6TB 2Y0SE 4JI8L 3TS2A 2X6GA 2LS01 2NVXB 4ZUJA 4BY1G 4ZKCB 1U4PA 1PVOA 4POFA 2O5IC 3DUZA 4JBMA 1N33L 1NR2A 3TP5A 3KJPA 2MP1A 1FJGQ 1QZHA 4G57A 1W3SA 1LT4D 2Y0SG 5IGCA 2Q8TA 3VYSA 5C4ZA 3VR2A 5M3MG 2HQLA 5KYIA 3SK4A 1Q86C 1VQNA 5LMUL 2HHHL 1ENFA 4QF4A 3ULPA 1VMPA 3Q22A 3E0EA 4LF4Q 1QWYA 1QB5D 4CJ2C 3U50C 4DV2Q 2H5XA 1PHJA 2XRQD 4KKSA 1M1KC 4JI3Q 3BVGA 4DR7Q 5NUCA 4MN3A 1UEAB 5IT9c 2R7ZG 3PUVA 3PF4A 4QIWE 3T16A 5CORA 1Q8KA 1E1TA 3T13A 4Y52H 5FO8B 3R2TA 2H4OA 1A3UA 2QF7A 3R2IA 4C1NK 2FHTA 3I73A 4YWKA 3S15H 1TY0A 1Q8IA 3CPWA 2IW3A 1LABA 3UE0A 3FKIH 4XT1B 4EX5A 2UUCQ 1AE2A 4JYAL 2WKCA 2E75C 1HFGA 4ZQ3A 2D5DA 4J6HA 4JI1Q 4PMBA 3S15B 1TWGH 5ISRA 3FKIB 4NPSA 1EY5A 3E9IA 1N32L 1S5DD 4MIUA 4NXMQ 4Q5VA 1TWGB 2QA4A 4JVZA 2E2DC 5FLXc 4A3MH 4JG2A 3OPOA 2FXQA 3I4MH 3CCRA 4PQXA 2E8GA 2KEDA 4BBSH 5CMDA 3I2ZA 1CA5A 2F4VQ 2NBFA 2YYZA 3CC7A 1YJWA 1NSNS 3EROA 4A3MB 2ID0A 3I4MB 1GJXA 2BOSA 3TQYA 3BVZA 3I90A 4FP5D 4BBSB 5JEAG 1T5EA 2EDGA 4HEDA 5D3DA 4DR6Q 2Q2HA 2SNSA 1QCBD 4R9WA 3IRBA 3K5NA 1VQ8A 1CZWA 1G91A 3HKZE 4P2CB 2Z6KC 4R8NA 3NQTA 3KLRA 3C3LA 3A7AB 4A3JG 3PO3G 2QKIC 4BBRH 1QNUA 1GUTA 1X6OA 5JPMC 2EXDA 5J39A 5JVH3 3HKZG 4GN5A 2AQ3B 1TQOA 2L15A 4XYOA 4BBRB 5IT9E 1TVXA 3DM1A 3F2BA 2WACA 4DUZL 3SDZA 2XTIA 4B3TL 4QJFA 3WOEA 5GAEC 2CQOA 5LMNW 4C3JH 1M4VA 1UUPA 2KENA 3KYHC 4XDXA 2F0KA 3J7YW 1BDOA 4IQZA 3CF5A 4O2DA 4DNTB 4LWCA 3HRZC 3K58A 1X54A 5A2QE 2VW9A 4LFBQ 3MTSA 2KA7A 4C3JB 2I5MX 2JA5G 1FD7D 3CPFA 2K5DA 4DK1A 3TSSA 1CSQA 2JA8G 4KHZA 1KIXA 1VS0A 4KD4A 4A3KG 1ET6A 5HGTA 5KYLA 4AQYL 4GKKQ 3MEFA 2WB1B 2KHJA 5EJWA 1ILPA 1K8AC 2EPBA 1X55A 4YWMA 1HZCA 4OEMB 3T51B 3MXPA 2ZM6L 3HOVH 2ATWA 1Q7YC 1ASZA 1SN8A 2D0PA 1K0RA 3M4YA 3VDYA 3HOVB 5I9PA 4TQUS 4XQJA 1WTOA 3BZCA 1HNXQ 1L2FA 3QO2A 1QVFA 5DLQE 4Q0FA 3LNNA 1XMQL 2ENBA 3D0FA 4B3MQ 5IT9L 5EPLA 3CMAA 3OYYA 5IWAQ 5CBAE 1S72A 1K8GA 1C7YA 4ODGA 1F77A 1C0AA 4DV6Q 4R4TA 3GTLH 5I2XA 3E3XA 1BCPF 1IBKL 3E6ZX 1RTOA 2XN9C 4A3LH 1UEBA 1TWHH 1BR9A 5C4XG 2F0PA 4MZ9A 1AZQA 2VQEL 4IZ8A 4O42A 4PMCA 5FO7B 1L1OC 3GTLB 1XMOL 5GROA 1DXMA 2F0MA 1XPOA 1C8CA 5BR8L 1HH2P 5C0XJ 1TWHB 3KDFA 4DKAC 5IGGA 1DD2A 1ZEQX 3QR8A 4A93H 2RDHA 5C3EH 3HFZB 3TS0A 1G2TA 5K36H 1F2ZA 3M7GA 4EGVA 4L5QA 1PRTF 4K5XA 3PSIA 2KOLA 4A93B 3PMFA 3Q23A 3HOXH 3TBIB 5C3EB 5FLXL 2YV5A 1PH6A 2A19A 4EQNA 3AMUA 3OMCA 4ZK9B 2KECA 2UXCL 4LFAL 1JC7A 5C5LA 3HOXB 1L1OA 2VXWA 3NBIA 1YHBA 1IBMQ 2DUDA 1G8ZD 4JOIA 1Q82C 5M3FG 4PZ6A 1EY4A 1JMCA 2CFMA 2WINB 1BOSA 5EPJA 1EY8A 3JC66 1RODA 2G5DA 3A8JE 4X64Q 3L2PA 4DUYQ 1YIJA 4G7HC 1A6XA 2L12A 4X3UA 3MVVA 4H44C 2K5NA 2IWHA 5M3MH 4YCUA 4DV3L 2Y0SB 3DMUA 3G6EA 4BA2I 5M3MB 1GUGA 1X32A 1K9MC 4JI0Q 1ICWA 4K5VA 3K0YA 1VQPA 2A5HA 1J9OA 2JN4A 1KQSA 2KHIA 3GP7A 4HSVA 3OIQA 3KDFB 1VQGA 2PYKA 2R7ZH 1JE4A 3QOJA 2ZT9C 1QOHA 3QG1A 4AYBE 4EVOA 1VQDA 1OXVA 4ILWA 3TP6A 4JBKA 4KY7A 2R7ZB 4G4KA 2WIIB 3D4DA 4DR2L 4NW2A 4C2MH 1EOTA 4IJLA 1PLFA 2RCFA 5M5YH 4DV1Q 1KDCA 2N78A 5DNFA 4IUUA 3EIVA 5C3XA 5E7NA 1L1OB 2M9VA 1A2UA 1LM0A 2HD3A 4HJ5A 4C2MB 1JJGA 1IXRA 1PMRA 1DM0B 5M5YB 4WFN3 4V190 1I4GA 4H13C 5LMNL 4QIWB 1XNQL 1L0XB 1S5CD 1GVPA 3CCUA 3E5SA 3KF6A 1VDZA 1Y8NB 4DR3L 5C0XI 1BUVT 4LF8Q 2R6GA 4RGNA 5H1SE 2ZJRA 4IUVA 1SBBB 4DF7A 1KNAA 2SOBA 2F3VA 4F87A 2E2JH 2A1AA 3C1FA 4LFCQ 1EZ6A 1PFMA 1VCIA 1SNQA 3N6RA 4K6DA 2EIFA 1Z6HA 2F0IA 2NB0A 3RZDB 1KRSA 4QL5A 2C9OA 3CP0A 3AFQA 2E2JB 4DR1Q 2VB3X 3FKIG 2ALYB 5HURA 2NYZD 4YHHQ 2EYFA 3S1QH 1EYDA 1SLJA 4KN4C 1NY4A 1HUMA 5DEHA 1DYQA 1EY9A 2IJ0A 2X69A 3W5OA 4A3JH 3PO3H 1UE1A 1YNXA 3S1QB 3HZXA 2PQAA 3NXWA 5CYUA 1SMYC 3VYTA 1J5EQ 3OW7A 4A3JB 3PO3B 1O7LA 1IL2A 1Q12A 2I07B 1WJJA 1NMGA 1PH9A 3HKZB 3UE1A 1HR0Q 1PYBA 3VYUA 1HNWQ 3HS0C 4NP5A 3AQQA 2AKWB 4O1NA 4DK3C 1HPCA 3VA5A 1IYUA 4IPDA 1XPUA 3L0OA 2B2UC 2JA5H 3KK7A 4A3CG 4HIMA 3IAYA 2QILA 2FINB 5K5PA 1PTOH 1VQBA 2JA8H 3KF6B 1I50H 2KUMA 1BVSA 1SROA 2ICEC 1K8OA 2JA5B 1U4RA 1LO5D 4FF2A 3BDLA 1SAPA 4PG3A 3BZDB 4A3DG 4YY3L 2JA8B 1I50B 1K3RA 5EKLA 3P1HA 1U5KA 3CRLC 4M1UB 3H3VI 2AUKA 1N36L 3J81j 3JAME 3OTOL 2J4XA 1I4RA 1PFNA 1LT3D 1KLUD 4APVA 1QJOA 1WTHA 2OEOA 4B3SQ 2L4NA 4UP8A 4CBVA 3OSOA 2PW7A 3S14H 3RN5A 3ZJYC 1VQ6A 2GN5A 2K03A 2PQAB 2O4XA 3K5LA 4FF1A 1SSOA 2JA6G 2NN6G 3WOFA 1KNEA 3S14B 5IY0A 5IODA 4P74A 2GVAA 4JI6Q 4OHJA 1I94Q 3G4SA 3H91A 3A7LA 1GUWA 4LF4L 4DR5Q 2F0OA 2B39A 4IFDG 5GAHC 1ENCA 1AZPA 3H3VC 3X3MA 1SMYD 3MAQA 2TMPA 1D1KA 4A3GG 2K50A 2Q8RE 5C0XH 3C46A 4DR7L 4X62L 4RGOS 1GHJA 3Q6SA 1GUOA 2CWAA 1X56A 1OXTA 4FO2A 4K0KQ 4TRDA 2EVBA 4FXDA 1STAA 4OGQC 3H0GG 1SMXA 4GS3A 5LHY1 4HMJA 2K6AA 4IN3A 4JI5Q 4LUZA 4LF7Q 1E0BA 2F3IA 1B50A 5ELBA 5M5XH 3L3OC 4ME5A 2UUCL 1C9OA 4X66Q 2OQ0A 2IX3A 1O7YA 2Z4HA 4JI1L 2CQAA 1B1ZA 3A55A 4KHPQ 1CI3M 5CGKA 3D6CA 1QUQA 4HTHA 3CC4A 1PDQA 4CKCA 2B8FA 2QCPX 4A3FH 1FNWA 2WAQE 1CTMA 4GOPA 5KNCA 3PUYA 1RD9D 3KUPA 3CCLA 3NTIA 4A3FB 1TT2A 2RKSA 3NUCA 3HOXG 1VQCA 1GHKA 2ZXPA 1EEFD 4DR6L 1CK1A 3HOUG 3M4QA 3M7NA 1Y1VH 1YHQA 2WAQG 1AFPA 3HEJA 1EWHA 4DAPA 4K8JA 5CV4A 1A3VA 3RZOH 1PH7A 2MNAA 2IPKD 2R3ZA 3GO5A 5FLMH 1EIFA 2BE5C 1Y1VB 1HTLD 3UI2A 1NTGA 1KAAA 4B3RL 2EYHA 3RZOB 1FGUA 3SHLA 1SYEA 1WD1A 3SK8A 4KN7C 1VQ4A 2Q2UA 1VQIA 3GTPH 3P7JA 3I55A 4ZAIA 3RR5A 3ZYYX 3FDTA 2MJ8A 1V8QA 2IT1A 4DV7L 3AFPA 2NN6I 1VQOA 2F0DA 1Y1WG 1K73C 3GTPB 3H3VH 5AJ3Q 1STGA 2Q2IA 1PFBA 2EYJA 1LTRD 5C5MA 5ELDA 3TMEA 4HSPA 4OIKA 2QEXA 3E0JA 3MXGA 3EBEA 1AW7A 1T9HA 2A68C 4IJHA 1PH1A 4IFDI 2EZVA 4LFBL 2EYLA 3GTMH 1TU2B 1XTCD 4H7BA 2CCZA 1O7ZA 1QUQB 4CDCC 2EYOA 3SE0A 3G71A 4LF9Q 1CZGA 3HOZH 3O13A 3OWFA 3NPPA 4JI2Q 1C4QA 4KJNA 4LW1A 2OWOA 4R8IA 4GOPB 2O2LD 2F0HA 1IKLA 2AHOB 5ELFA 5C44G 3T1YQ 1QZGA 4IOAA 2K01A 2BH8A 3VA7A 3U58A 1N9WA 3MEHA 2E74C 4FVMA 5EPKA 4QUFA 1RKNA 1YEZA 1JWMD 4Y7NH 4CJ1B 1CSPA 2IX0A 5LL6X 2F0QA 2KCMA 5IIFA 3QJYA 1HNXL 3M85A 2F0EA 2IHEA 4OONA 4HCEA 4UHVA 5T1GA 5DM73 1PZID 4Y7NB 2R61A 2N88A 2R93G 5EKIA 2JSOA 2PNHA 2RHSB 3KOJA 4B3ML 4X6AH 3UDXA 2CKZB 5IWAL 1A0IA 1VQ9A 2F4IA 3RLOA 1PH4A 2PNRC 1O80A 4BXXG 4DV6L 3S1RH 4X65Q 1JB7A 1V43A 4TVAB 4RKLA 4J15A 2BE5D 1IW7C 2VQFL 3S1RB 2M00A 2ZJPA 5IYCH 1CKNA 3QOLA 4CDDC 4A3CH 2TSSA 3MZ5A 2BCOA 1U4LA 4KKUA 2A69C 2I5HA 2RDGA 4C1NI 4DV5Q 1UE7A 1BKBA 4JC0A 1LUZA 3FP9A 2BDNA 3S24A 4A3DH 2NTTA 1VQ7A 1G6ZA 1ESRA 4QUCA 2A6HC 1HFNA 4HJ8A 4K2LA 2F0JA 1YJ9A 2A68D 5JVG3 1EQRA 2KQ3A 4A3DB 5FKAC 4JI8Q 3WDNA 2FJ2A 4I65A 1OO9B 1NBWA 1KTKA 2EOTA 1IBML 3CRKC 1PH3A 2VY3A 2K52A 1IBLL 1RDPD 2H1EA 3DEPA 2AUJD 3IFTA 3U4ZA 3HOYG 3FEWX 2RSOA 4BWGB 4I7ZC 1J6QA 1VQKA 3EVQA 4L5RC 4RHSA 2F03A 4E6IA 3A0JA 4DUYL 1N34Q 4LF6L 1SNDA 3NWSA 3GDEA 4IPCA 2B63G 3MFYA 2XIWA 2JA6H 4HIDA 2NN6H 2EY2A 4RA8A 1SFOH 3I72A 2CH4W 5LMUQ 3CAMA 4LF5L 2V1CC 1SYBA 4K14A 4P72A 2MHVA 4WRDA 2JA6B 2I0QA 3VR4A 3T53B 5FLXE 1HUNA 1SFOB 4JI0L 4DGZA 1JOOA 3GV6A 4IFDH 4DR4L 4B9XA 5JPNC 1EL0A 1CKNB 5J1ZA 4BY7G 4A3GH 1EFID 1X65A 1TY2A 4OIJA 1YZ6A 2RA4A 1STEA 3FRPB 2AMCB 3CQZH 2HCCA 1IHZA 4FXGC 4A3GB 1U0LA 3CXCA 1DJRD 1SNPA 4FYDA 4BA1I 4MNOA 4TKOB 2NVQH 3H0GH 4CHTB 3V05A 4ZKBB 4B08A 4X3TA 1IW7D 3CQZB 2IX1A 2XGTA 2JXMB 5CV8A 5HY6A 4DV1L 1NR4A 4AIMA 3X3NA 2NVQB 1A3TA 4NMZA 3ONAB 5IYBH 1XJVA 4JYAQ 3H0GB 4QQBX 3ND8A 1JWSD 2A69D 3M4OH 3GQBA 4IO9A 4R4QA 1N32Q 2D2CC 4DAMA 1I4XA 1LV9A 2VS1A 3FHWA 2JEAI 1VQAA 4GZYC 3M4OB 3T1HL 2CHBD 2N3SA 4JOIC 2LXKA 1UAPA 1LYLA 2A6HD 4QY7A 3CMEA 1BF4A 5IP7G 4LF8L 5C0XG 1ENAA 3ICEA 3ERSX 1KRTA 2K7VA 4GKJL 2B2VA 1LT6D 2EY1A 4LFCL 1XNRQ 3W3AA 5JJZA 2PZUA 4JW0A 1QNKA 1S5ED 3HOUH 2L9HA 5IGBA 1HZ9A 2K5WA 5CV5A 4FF4A 2MO0A 1XPRA 1HA5A 4AH6A 5I9OA 1R9TH 2QEJC 1MIUA 1LT5D 1STYA 2R7FA 2WP8J 2EY6A 3HOUB 2X6LA 4UAIA 4YHHL 4GNXA 2OTJA 3BYTB 2WAQB 1HJPA 2UUBQ 2KCTA 2KJXA 1R9TB 1STNA 1LTAD 2RBMA 4LMQD 3DWQA 4EQ5A 4LJZC 4P75A 1DONA 1R4PB 4HAEA 1B3AA 5C6AA 5JJKA 1GKHA 2KBNA 2IY5B 1S4ZA 4A3FG 1SE2A 1RL2A 4DUZQ 2HT1A 4B3TQ 1Y1WH 1B7YB 1EWCA 2B8GA 4HMIA 1SE8A 4DK0A 1HR0L 1WTWA 1PV4A 3F2UA 3J7ZC 1WTXA 3K5MA 1Y1WB 1H9SA 1ML0D 1M8AA 2A8VA 1WYDA 2LXJA 4IUQA 1Y1VG 3OWEB 4KD3A 1EOVA 2NZOA 3A5UA 1AE3A 2VZAA 3NP8A 3OOCA 1HZBA 2K5HA 2P5ZX 3R93A 4N8FA 5FLMG 4AQYQ 2JA7G 1JR0D 2RSNA 1G2SA 4DXFA 5IGDA 3KLWA 5JJLA 5KEEA 2AQ1B 2PMZE 3EJIA 4N9TA 5FOBB 1YVCA 1HXYD 1GM5A 5C44H 2ZM6Q 4PV1C 4NXNQ 1SRUA 1BXTA 3PF5A 4EQOA 1PTOC 5C44B 1F2LA 2ZTDA 1EWIA 2EXZA 4A3EG 4RFBA 4AYBG 3MHBA 1HZAA 1MGSA 1M90C 1PH8A 2E2HH 1JORA 1F2MA 2R92G 4ZRZA 4C3IH 1SNOA 2DNEA 2EYPA 1XMQQ 1W2BA 2F1MA 3LWEA 3I70A 1EY7A 4XT3B 3TREA 2UXBQ 2JK8A
chains in the Genus database with same CATH topology
5GAGC 2R93H 1KAWA 5IYDH 1Q8KA 1CKMA 3CCQA 4JI7Q 1KL9A 1E1TA 4LF4L 4DR5Q 3GTOH 3PO2G 4Y52H 1K83H 4XTCS 3HOZG 4IFDG 5GAHC 4OX9Q 2C35B 4P71A 1BBWA 4BXXH 2N8NA 4A3GG 2K50A 4YWKA 3S15H 3CPWA 4KI0A 4DR7L 4X62L 2AWOA 3UE0A 3FKIH 4EX5A 1XMOQ 4JI6L 2RF4A 2CWAA 2UXBL 3DM3A 1AE2A 2UUCQ 4DV0L 1X56A 4GNXC 3S16H 2HIVA 1OXTA 5BR8Q 4JYAL 4K0KQ 4JI7L 3Q8DA 4JI1Q 2RCNA 1TWGH 1Y14B 4DR5L 1Q81C 2BH2A 3H0GG 4NPSA 5ELOA 1SMXA 4GS3A 1MJEA 1WCMH 4OX9L 1UWVA 3KJOA 3E9IA 1EQQA 1N32L 4JI5Q 4NXMQ 4LUZA 2VQFQ 2QA4A 4LF7Q 2F3IA 4HJ9A 1NE3A 5FLXc 4A3MH 4JG2A 5M5XH 2FXQA 3I4MH 3CCRA 1YITA 2UUCL 1C9OA 2E8GA 2HIXA 4X66Q 4JV5Q 4BBSH 2OQ0A 3I2ZA 2F4VQ 2YYZA 4JI1L 3CC7A 1YJWA 2UXCQ 3AEVA 4LFAQ 1A62A 4DR1L 4KHPQ 2QGQA 2ID0A 3TQYA 4UY8C 3J81c 1FVIA 1QUQA 3CC4A 5JEAG 4DR6Q 3G48A 2Q2HA 4JI5L 3IRBA 3F1ZA 1I6HH 5HGQA 2IHFA 1VQ8A 4A3FH 4JBJA 1E3PA 1FL0A 5J3BA 4X66L 4JV5L 2WAQE 5FJ8G 4GOPA 3CCVA 1TWAH 3HKZE 2Z6KC 3PUYA 2VUMH 4A3BG 3CCLA 1WOCA 1J5EL 2ES2A 3HOYH 3HOXG 3PUZA 2MFIA 1EYGA 3MXNB 2E2IH 5IYCG 2EQSA 1VQCA 2OTLA 2DGYA 3STBD 3NELA 4LUOA 4A3JG 4A3IH 4IOCA 3PO3G 4DR6L 3RLFA 3I56A 3HOUG 1IBLQ 4BBRH 2Z0SA 5GQOA 3KFUA 1LTLA 4BY1H 3M4QA 1X6OA 1Y1VH 2EXDA 1YHQA 2BA1A 3M7NA 2WAQG 1HNWL 2B63H 1PH5A 4DV3Q 3HKZG 4GN5A 3GTJH 3RZOH 1PH7A 1L0WA 2MNAA 2L15A 1GO3E 1N8RC 3GTKH 1DGSA 3GO5A 5FLMH 1EIFA 3S2HH 3KF8B 1NTGA 4B3RL 1OXXK 3M4PA 3F2BA 4LF6Q 4DUZL 1FGUA 2XTIA 4B3TL 4YCVA 4QJFA 3PIPA 5GAEC 2CQOA 5LMNW 4C3JH 1VQ4A 2Q2UA 2NZHA 1VQIA 2KENA 3KYHC 3GTPH 3I55A 3CF5A 4O2DA 3D31A 3F2DA 3RR5A 4LF5Q 3SGIA 4LWCA 4OO1I 3S17H 1X54A 2VW9A 2IT1A 5ELNA 4BY7H 4LFBQ 4R1JA 4R4IA 4DV7L 3AFPA 3H15A 2NN6I 2I5MX 1VQOA 2JA5G 1K73C 1Y1WG 3H3VH 3CPFA 5AJ3Q 2Q2IA 4A75A 2I5LX 1CSQA 1I3QH 2JA8G 4YCWA 4KHZA 3S1MH 4DR4Q 2QEXA 1KIXA 1VS0A 2ZTEA 3EBEA 4A3KG 4AQYL 3BU2A 2MO1A 1FJGL 1T9HA 4IJHA 3RN2A 4GKKQ 4OO1G 3I4NG 1PH1A 1CUKA 3M9BA 3J7A5 3MEFA 4POGA 4IFDI 2KHJA 4LFBL 1Z9FA 4HJ7A 3J81i 5IE8A 1K8AC 3GTMH 1X55A 2UU9Q 5AJ3L 4GLXA 2CCZA 4GNXB 1QUQB 2AWNA 1HZCA 4YWMA 2ZM6L 3HOVH 3G71A 4B3SL 4LF9Q 5LMNQ 2B29A 2RHQB 2ATWA 4O0AA 3HOZH 3W1GA 4JI2Q 1XNQQ 1Q7YC 2YTXA 1ASZA 4LW1A 2OWOA 1SN8A 2D0PA 1K0RA 1QVCA 4GOPB 3VDYA 1TWFH 1X3FA 1G291 2AHOB 4TQUS 2ZJQA 2ASBA 3HOWG 5C44G 1JT8A 3T1YQ 1QZGA 4IOAA 3BZCA 1EFWA 1YI2A 2BH8A 2JJQA 3J80c 1L2FA 1IBKQ 1HNXQ 2UU9L 4GLAC 5M5WH 3U58A 1S40A 1QVFA 4DV2L 1WI5A 1N9WA 5DLQE 1KC8C 1HNZQ 4JI3L 1XTDA 3EN2A 5IP7H 1XMQL 2VQEQ 3D0FA 3I7FA 2B3GA 1AH9A 1YHAA 1YBYA 5IP9H 2E5LQ 4B3MQ 4JI2L 1S3OA 1I94L 2Q2TA 1YEZA 4DPGA 3T1HQ 4RMFA 3CMAA 3OYYA 5IWAQ 1S72A 1K8GA 3I4OA 4Y7NH 1C7YA 1CSPA 2IX0A 1C0AA 4ME3A 4DV6Q 4R4TA 2KCMA 3T1YL 3GTLH 3CCEA 1G6PA 4GLVB 3M85A 1TXYA 1IBKL 1HNXL 4A3LH 2IHEA 1UEBA 4GN4B 4OONA 4GOPC 2CWPA 2ZTCA 1V1QA 1EIYB 1TWHH 5C4XG 1HNZL 1V9PA 4GKJQ 3JAMc 4MZ9A 4OWWB 1I5FA 2R93G 2VQEL 3RZDH 1L1OC 2RHSB 2PNHA 3KOJA 5IYBG 1XMOL 3ER0A 2E5LL 5GROA 4B3ML 3UDXA 4X6AH 3UDIA 1GD7A 2CKZB 4MTNA 1XPOA 4K0KL 5BR8L 1HH2P 1IZ6A 5IWAL 5C0XJ 1A0IA 3K8AA 1VQ9A 3KDFA 1X3GA 3RLOA 4DKAC 1PH4A 4OWTB 3K81C 4BXXG 3NBHB 4DV6L 4A93H 3S1RH 4X65Q 5C3EH 3HFZB 3TS0A 1JB7A 3GTGH 1V43A 4TVAB 4J15A 2PI2A 1JE5A 4L5QA 3F2CA 3RLNA 1MJCA 2VQFL 4GN3B 4LF7L 4NXML 3PSIA 4PZ8A 3HOXH 2BA0A 2ZJPA 2YV5A 5IYCH 1CKNA 1PH6A 1KD1C 3S2DH 2A19A 4A4IA 1I94Q 4A3CH 4DV4Q 2LSSA 2F4VL 1WCMG 2F52A 3NENA 2I5HA 3M3YH 4LFAL 3PUWA 2UXCL 4X65L 4KHPL 1L1OA 1VQ5A 4DV5Q 2JA9A 1UE7A 4IPHA 1BKBA 1YHBA 1IBMQ 2DUDA 4JC0A 4A3MG 1LUZA 3I4MG 5JJIA 4JOIA 3FP9A 3S24A 4A3DH 1VQ7A 4BBSG 1Q82C 1H95A 5M3FG 4PZ6A 4DV4L 1JMCA 3H3VI 3J80i 4HJ8A 2CFMA 1G51A 1VQFA 1YJ9A 1EQRA 4OXPA 2GVBA 2JA7H 4JI8Q 3JC66 1Q1BA 1NBWA 4X64Q 1IBML 3L2PA 4DUYQ 1YIJA 1PH3A 2VY3A 4UP9A 3CD6A 2K52A 1IBLL 1D8LA 1MKHA 2K5NA 5M3MH 2VUMG 4YCUA 4L5TA 4DV3L 1VQJA 3U4ZA 3HOYG 3WWVA 1X9NA 3K80C 1N36Q 3G6EA 2NVYH 1J6QA 3OTOQ 4A3KH 1KXLA 3CCSA 3PV0A 1VQKA 4BA2I 4A3IG 4L5RC 3JAMi 2OCEA 4R4CA 4BBRG 1B70B 5EAYA 4A3EH 1K9MC 4XIGS 4JI0Q 3A0JA 4DUYL 1N34Q 4LF6L 3GDEA 4NB3A 4IPCA 2D0OA 2B63G 3OW2A 1VQPA 2JA6H 3ULLA 4HIDA 4DR2Q 1D7QA 4HIOA 1PH2A 1SFOH 2R92H 3NEMA 5LMUQ 1KQSA 2KHIA 3CAMA 4LF5L 2V1CC 1A63A 4P72A 3KDFB 1VQGA 1YJNA 2K14A 1UE5A 2R7ZH 2I0QA 2OQKA 3HKSA 4AYBE 2VNUD 4JI0L 2WB1E 1VQDA 1TWCH 1N34L 4HIKA 3PO2H 1BBUA 1OXVA 4PZ7A 4FDBA 1X3EA 4JBKA 4DR4L 4A76A 3TRZA 4DR2L 1Z47A 1PA6A 1OXUA 1JJ2A 1CKNB 4BY7G 4C2MH 4A3GH 1X65A 4IJLA 5M5YH 1OTCA 3K7AH 4L5SA 4DV1Q 4GKKL 2N78A 2K75A 1YZ6A 3PGZA 3EIVA 2JEBI 4DR3Q 5E7NA 2N49A 1L1OB 4DAYB 2AMCB 1LM0A 3CQZH 2WB1G 4HJ5A 1JJGA 1VQHA 1IXRA 1U0LA 3CXCA 4QGUA 4BA1I 4MNOA 2NVQH 4LF9L 5LMNL 3H0GH 4LNQA 1XNQL 2UUAQ 4X62Q 4WJ3M 2IX1A 2XGTA 1GVPA 5C4XH 3PF4A 3CCUA 2JQOA 1E22A 5HY6A 2UXDQ 1CKOA 4DV1L 1B8AA 4AIMA 4DV0Q 4IFDJ 3KF6A 4JYAQ 4QQBX 5IYBH 4UPAA 1XJVA 4DR3L 5C0XI 1Q46A 1NMFA 3HOVG 2K4KA 3UDGA 4LF8Q 3TEHB 2R6GA 2JE6I 3E9HA 5H1SE 2ZJRA 3M4OH 4IPGA 2YTYA 4IO9A 4R4QA 1N32Q 3BJUA 1RIPA 4KLKA 4DAMA 5IYDG 3K7UC 3CCMA 2VS1A 2E2JH 2A1AA 5C4JH 2UUAL 1VCIA 1NJIC 3FHWA 4LFCQ 1VQAA 2JEAI 3T1HL 2N3SA 1HR0W 2EIFA 3CC2A 4UP7A 3S1NH 2UXDL 4JOIC 1QVGA 2LXKA 1LYLA 1KRSA 4QL5A 4QY7A 3CMEA 3CP0A 3AFQA 5IP7G 4LF8L 5C0XG 5FJ8H 3GTQH 3ICEA 4DR1Q 3ERSX 2YTVA 1KRTA 3FKIG 1IYJB 1E24A 5IP9G 2ALYB 4A3BH 4GKJL 4YHHQ 3S1QH 1O7IA 1P16A 4JBWA 2D62A 1SLJA 1NY4A 3PIOA 4LFCL 3K0XA 4LUVA 1XNRQ 3W5OA 4A3JH 3PO3H 1UE6A 1UE1A 1YNXA 3HOUH 4A3LG 1WFQA 4JI4Q 1OXSC 3A5ZB 1HZ9A 1ASYA 5M3FH 2PQAA 2R7DA 2MO0A 1XPRA 1VQLA 4AH6A 1P8LA 5JEAJ 1R9TH 1J5EQ 1MIUA 4DK6C 2R7FA 2WP8J 3GD7A 1IL2A 4YHHL 4GNXA 3RNUA 1Q12A 2OTJA 1WJJA 1NMGA 1E1OA 1PH9A 1HJPA 2UUBQ 2KCTA 1XNRL 3DLLA 4RG1A 4H02A 3UE1A 4A93G 2NVTH 4OWXB 1HR0Q 1PYBA 4EQ5A 1HNWQ 3U4VA 4P75A 2K5VA 1PFSA 5C3EG 4YWLA 4JI4L 4ALPA 3AQQA 5K36G 4HJAA 5JJKA 2AKWB 3AYHB 4DK3C 1GKHA 1JJCB 2KBNA 2IY5B 4PMWA 4DV5L 3A74A 4YY3Q 3B6YA 4A3FG 4B3RQ 1SR3A 4IPDA 4WJ4A 1XPUA 1RL2A 3L0OA 4DUZQ 2JA5H 4B3TQ 1Y1WH 4HIMA 2HT1A 1B7YB 4A3CG 1KHIA 2UUBL 4JCVE 1N33Q 2NVXH 5GADC 4C3HH 1SE8A 3L7ZC 1VQBA 1PV4A 1HR0L 2JA8H 3KF6B 1I50H 1BVSA 3UDFA 3PCOB 1SROA 3J7ZC 1VQMA 2Y0SE 4JI8L 1Q1EA 4DV7Q 3TS2A 3CW2C 4PG3A 4A3DG 4YY3L 4X64L 1WYDA 2LXJA 4BY1G 2A8VA 3I4NH 1Y1VG 3W1BA 1EOVA 1K3RA 1PVOA 4POFA 2NZOA 3A5UA 2VZAA 2Z6KA 1AE3A 1U5KA 3LGJA 4JBMA 1N33L 1HZBA 2K5HA 2HHHQ 5FLMG 1VQEA 3KJPA 4AQYQ 1FJGQ 1E7ZA 2JA7G 1QZHA 1N36L 1W3SA 3BZKA 3J81j 3OTOL 2Y0SG 3KLWA 5JJLA 2PMZE 2WFWA 2YU9H 3STBC 1YVCA 1EUJA 1GM5A 3HOWH 1A8VA 5M3MG 5C44H 4APVA 2ZM6Q 2HQLA 2MQHA 3F8TA 4B3SQ 1Q86C 4NXNQ 1SRUA 2PI2E 4UP8A 1VQNA 3CCJA 5LMUL 3PF5A 2HHHL 1PYSB 3S14H 3ULPA 3RN5A 3ZJYC 1VQ6A 2GN5A 1EWIA 2ZTDA 2PQAB 3E0EA 4DNIA 4A3EG 4LF4Q 4R4OA 4AYBG 2VL6A 1HZAA 2JA6G 1M90C 1PH8A 2NN6G 2E2HH 3U50C 5IY0A 2R92G 3ULJA 4C3IH 4DV2Q 2H5XA 4P74A 3PUXA 2GVAA 1PHJA 4JI3Q 1M1KC 4P73A 4NXNL 1XMQQ 4DR7Q 1W2BA 5IT9c 4JI6Q 2R7ZG 3PUVA 3TREA 2UXBQ 3G4SA 4QIWE 2JK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG C;  2R93 H;  1KAW A;  5IYD H;  1Q8K A;  1CKM A;  3CCQ A;  4JI7 Q;  1KL9 A;  1E1T A;  4LF4 L;  4DR5 Q;  3GTO H;  3PO2 G;  4Y52 H;  1K83 H;  4XTC S;  3HOZ G;  4IFD G;  5GAH C;  4OX9 Q;  2C35 B;  4P71 A;  1BBW A;  4BXX H;  2N8N A;  4A3G G;  2K50 A;  4YWK A;  3S15 H;  3CPW A;  4KI0 A;  4DR7 L;  4X62 L;  2AWO A;  3UE0 A;  3FKI H;  4EX5 A;  1XMO Q;  4JI6 L;  2RF4 A;  2CWA A;  2UXB L;  3DM3 A;  1AE2 A;  2UUC Q;  4DV0 L;  1X56 A;  4GNX C;  3S16 H;  2HIV A;  1OXT A;  5BR8 Q;  4JYA L;  4K0K Q;  4JI7 L;  3Q8D A;  4JI1 Q;  2RCN A;  1TWG H;  1Y14 B;  4DR5 L;  1Q81 C;  2BH2 A;  3H0G G;  4NPS A;  5ELO A;  1SMX A;  4GS3 A;  1MJE A;  1WCM H;  4OX9 L;  1UWV A;  3KJO A;  3E9I A;  1EQQ A;  1N32 L;  4JI5 Q;  4NXM Q;  4LUZ A;  2VQF Q;  2QA4 A;  4LF7 Q;  2F3I A;  4HJ9 A;  1NE3 A;  5FLX c;  4A3M H;  4JG2 A;  5M5X H;  2FXQ A;  3I4M H;  3CCR A;  1YIT A;  2UUC L;  1C9O A;  2E8G A;  2HIX A;  4X66 Q;  4JV5 Q;  4BBS H;  2OQ0 A;  3I2Z A;  2F4V Q;  2YYZ A;  4JI1 L;  3CC7 A;  1YJW A;  2UXC Q;  3AEV A;  4LFA Q;  1A62 A;  4DR1 L;  4KHP Q;  2QGQ A;  2ID0 A;  3TQY A;  4UY8 C;  3J81 c;  1FVI A;  1QUQ A;  3CC4 A;  5JEA G;  4DR6 Q;  3G48 A;  2Q2H A;  4JI5 L;  3IRB A;  3F1Z A;  1I6H H;  5HGQ A;  2IHF A;  1VQ8 A;  4A3F H;  4JBJ A;  1E3P A;  1FL0 A;  5J3B A;  4X66 L;  4JV5 L;  2WAQ E;  5FJ8 G;  4GOP A;  3CCV A;  1TWA H;  3HKZ E;  2Z6K C;  3PUY A;  2VUM H;  4A3B G;  3CCL A;  1WOC A;  1J5E L;  2ES2 A;  3HOY H;  3HOX G;  3PUZ A;  2MFI A;  1EYG A;  3MXN B;  2E2I H;  5IYC G;  2EQS A;  1VQC A;  2OTL A;  2DGY A;  3STB D;  3NEL A;  4LUO A;  4A3J G;  4A3I H;  4IOC A;  3PO3 G;  4DR6 L;  3RLF A;  3I56 A;  3HOU G;  1IBL Q;  4BBR H;  2Z0S A;  5GQO A;  3KFU A;  1LTL A;  4BY1 H;  3M4Q A;  1X6O A;  1Y1V H;  2EXD A;  1YHQ A;  2BA1 A;  3M7N A;  2WAQ G;  1HNW L;  2B63 H;  1PH5 A;  4DV3 Q;  3HKZ G;  4GN5 A;  3GTJ H;  3RZO H;  1PH7 A;  1L0W A;  2MNA A;  2L15 A;  1GO3 E;  1N8R C;  3GTK H;  1DGS A;  3GO5 A;  5FLM H;  1EIF A;  3S2H H;  3KF8 B;  1NTG A;  4B3R L;  1OXX K;  3M4P A;  3F2B A;  4LF6 Q;  4DUZ L;  1FGU A;  2XTI A;  4B3T L;  4YCV A;  4QJF A;  3PIP A;  5GAE C;  2CQO A;  5LMN W;  4C3J H;  1VQ4 A;  2Q2U A;  2NZH A;  1VQI A;  2KEN A;  3KYH C;  3GTP H;  3I55 A;  3CF5 A;  4O2D A;  3D31 A;  3F2D A;  3RR5 A;  4LF5 Q;  3SGI A;  4LWC A;  4OO1 I;  3S17 H;  1X54 A;  2VW9 A;  2IT1 A;  5ELN A;  4BY7 H;  4LFB Q;  4R1J A;  4R4I A;  4DV7 L;  3AFP A;  3H15 A;  2NN6 I;  2I5M X;  1VQO A;  2JA5 G;  1K73 C;  1Y1W G;  3H3V H;  3CPF A;  5AJ3 Q;  2Q2I A;  4A75 A;  2I5L X;  1CSQ A;  1I3Q H;  2JA8 G;  4YCW A;  4KHZ A;  3S1M H;  4DR4 Q;  2QEX A;  1KIX A;  1VS0 A;  2ZTE A;  3EBE A;  4A3K G;  4AQY L;  3BU2 A;  2MO1 A;  1FJG L;  1T9H A;  4IJH A;  3RN2 A;  4GKK Q;  4OO1 G;  3I4N G;  1PH1 A;  1CUK A;  3M9B A;  3J7A 5;  3MEF A;  4POG A;  4IFD I;  2KHJ A;  4LFB L;  1Z9F A;  4HJ7 A;  3J81 i;  5IE8 A;  1K8A C;  3GTM H;  1X55 A;  2UU9 Q;  5AJ3 L;  4GLX A;  2CCZ A;  4GNX B;  1QUQ B;  2AWN A;  1HZC A;  4YWM A;  2ZM6 L;  3HOV H;  3G71 A;  4B3S L;  4LF9 Q;  5LMN Q;  2B29 A;  2RHQ B;  2ATW A;  4O0A A;  3HOZ H;  3W1G A;  4JI2 Q;  1XNQ Q;  1Q7Y C;  2YTX A;  1ASZ A;  4LW1 A;  2OWO A;  1SN8 A;  2D0P A;  1K0R A;  1QVC A;  4GOP B;  3VDY A;  1TWF H;  1X3F A;  1G29 1;  2AHO B;  4TQU S;  2ZJQ A;  2ASB A;  3HOW G;  5C44 G;  1JT8 A;  3T1Y Q;  1QZG A;  4IOA A;  3BZC A;  1EFW A;  1YI2 A;  2BH8 A;  2JJQ A;  3J80 c;  1L2F A;  1IBK Q;  1HNX Q;  2UU9 L;  4GLA C;  5M5W H;  3U58 A;  1S40 A;  1QVF A;  4DV2 L;  1WI5 A;  1N9W A;  5DLQ E;  1KC8 C;  1HNZ Q;  4JI3 L;  1XTD A;  3EN2 A;  5IP7 H;  1XMQ L;  2VQE Q;  3D0F A;  3I7F A;  2B3G A;  1AH9 A;  1YHA A;  1YBY A;  5IP9 H;  2E5L Q;  4B3M Q;  4JI2 L;  1S3O A;  1I94 L;  2Q2T A;  1YEZ A;  4DPG A;  3T1H Q;  4RMF A;  3CMA A;  3OYY A;  5IWA Q;  1S72 A;  1K8G A;  3I4O A;  4Y7N H;  1C7Y A;  1CSP A;  2IX0 A;  1C0A A;  4ME3 A;  4DV6 Q;  4R4T A;  2KCM A;  3T1Y L;  3GTL H;  3CCE A;  1G6P A;  4GLV B;  3M85 A;  1TXY A;  1IBK L;  1HNX L;  4A3L H;  2IHE A;  1UEB A;  4GN4 B;  4OON A;  4GOP C;  2CWP A;  2ZTC A;  1V1Q A;  1EIY B;  1TWH H;  5C4X G;  1HNZ L;  1V9P A;  4GKJ Q;  3JAM c;  4MZ9 A;  4OWW B;  1I5F A;  2R93 G;  2VQE L;  3RZD H;  1L1O C;  2RHS B;  2PNH A;  3KOJ A;  5IYB G;  1XMO L;  3ER0 A;  2E5L L;  5GRO A;  4B3M L;  3UDX A;  4X6A H;  3UDI A;  1GD7 A;  2CKZ B;  4MTN A;  1XPO A;  4K0K L;  5BR8 L;  1HH2 P;  1IZ6 A;  5IWA L;  5C0X J;  1A0I A;  3K8A A;  1VQ9 A;  3KDF A;  1X3G A;  3RLO A;  4DKA C;  1PH4 A;  4OWT B;  3K81 C;  4BXX G;  3NBH B;  4DV6 L;  4A93 H;  3S1R H;  4X65 Q;  5C3E H;  3HFZ B;  3TS0 A;  1JB7 A;  3GTG H;  1V43 A;  4TVA B;  4J15 A;  2PI2 A;  1JE5 A;  4L5Q A;  3F2C A;  3RLN A;  1MJC A;  2VQF L;  4GN3 B;  4LF7 L;  4NXM L;  3PSI A;  4PZ8 A;  3HOX H;  2BA0 A;  2ZJP A;  2YV5 A;  5IYC H;  1CKN A;  1PH6 A;  1KD1 C;  3S2D H;  2A19 A;  4A4I A;  1I94 Q;  4A3C H;  4DV4 Q;  2LSS A;  2F4V L;  1WCM G;  2F52 A;  3NEN A;  2I5H A;  3M3Y H;  4LFA L;  3PUW A;  2UXC L;  4X65 L;  4KHP L;  1L1O A;  1VQ5 A;  4DV5 Q;  2JA9 A;  1UE7 A;  4IPH A;  1BKB A;  1YHB A;  1IBM Q;  2DUD A;  4JC0 A;  4A3M G;  1LUZ A;  3I4M G;  5JJI A;  4JOI A;  3FP9 A;  3S24 A;  4A3D H;  1VQ7 A;  4BBS G;  1Q82 C;  1H95 A;  5M3F G;  4PZ6 A;  4DV4 L;  1JMC A;  3H3V I;  3J80 i;  4HJ8 A;  2CFM A;  1G51 A;  1VQF A;  1YJ9 A;  1EQR A;  4OXP A;  2GVB A;  2JA7 H;  4JI8 Q;  3JC6 6;  1Q1B A;  1NBW A;  4X64 Q;  1IBM L;  3L2P A;  4DUY Q;  1YIJ A;  1PH3 A;  2VY3 A;  4UP9 A;  3CD6 A;  2K52 A;  1IBL L;  1D8L A;  1MKH A;  2K5N A;  5M3M H;  2VUM G;  4YCU A;  4L5T A;  4DV3 L;  1VQJ A;  3U4Z A;  3HOY G;  3WWV A;  1X9N A;  3K80 C;  1N36 Q;  3G6E A;  2NVY H;  1J6Q A;  3OTO Q;  4A3K H;  1KXL A;  3CCS A;  3PV0 A;  1VQK A;  4BA2 I;  4A3I G;  4L5R C;  3JAM i;  2OCE A;  4R4C A;  4BBR G;  1B70 B;  5EAY A;  4A3E H;  1K9M C;  4XIG S;  4JI0 Q;  3A0J A;  4DUY L;  1N34 Q;  4LF6 L;  3GDE A;  4NB3 A;  4IPC A;  2D0O A;  2B63 G;  3OW2 A;  1VQP A;  2JA6 H;  3ULL A;  4HID A;  4DR2 Q;  1D7Q A;  4HIO A;  1PH2 A;  1SFO H;  2R92 H;  3NEM A;  5LMU Q;  1KQS A;  2KHI A;  3CAM A;  4LF5 L;  2V1C C;  1A63 A;  4P72 A;  3KDF B;  1VQG A;  1YJN A;  2K14 A;  1UE5 A;  2R7Z H;  2I0Q A;  2OQK A;  3HKS A;  4AYB E;  2VNU D;  4JI0 L;  2WB1 E;  1VQD A;  1TWC H;  1N34 L;  4HIK A;  3PO2 H;  1BBU A;  1OXV A;  4PZ7 A;  4FDB A;  1X3E A;  4JBK A;  4DR4 L;  4A76 A;  3TRZ A;  4DR2 L;  1Z47 A;  1PA6 A;  1OXU A;  1JJ2 A;  1CKN B;  4BY7 G;  4C2M H;  4A3G H;  1X65 A;  4IJL A;  5M5Y H;  1OTC A;  3K7A H;  4L5S A;  4DV1 Q;  4GKK L;  2N78 A;  2K75 A;  1YZ6 A;  3PGZ A;  3EIV A;  2JEB I;  4DR3 Q;  5E7N A;  2N49 A;  1L1O B;  4DAY B;  2AMC B;  1LM0 A;  3CQZ H;  2WB1 G;  4HJ5 A;  1JJG A;  1VQH A;  1IXR A;  1U0L A;  3CXC A;  4QGU A;  4BA1 I;  4MNO A;  2NVQ H;  4LF9 L;  5LMN L;  3H0G H;  4LNQ A;  1XNQ L;  2UUA Q;  4X62 Q;  4WJ3 M;  2IX1 A;  2XGT A;  1GVP A;  5C4X H;  3PF4 A;  3CCU A;  2JQO A;  1E22 A;  5HY6 A;  2UXD Q;  1CKO A;  4DV1 L;  1B8A A;  4AIM A;  4DV0 Q;  4IFD J;  3KF6 A;  4JYA Q;  4QQB X;  5IYB H;  4UPA A;  1XJV A;  4DR3 L;  5C0X I;  1Q46 A;  1NMF A;  3HOV G;  2K4K A;  3UDG A;  4LF8 Q;  3TEH B;  2R6G A;  2JE6 I;  3E9H A;  5H1S E;  2ZJR A;  3M4O H;  4IPG A;  2YTY A;  4IO9 A;  4R4Q A;  1N32 Q;  3BJU A;  1RIP A;  4KLK A;  4DAM A;  5IYD G;  3K7U C;  3CCM A;  2VS1 A;  2E2J H;  2A1A A;  5C4J H;  2UUA L;  1VCI A;  1NJI C;  3FHW A;  4LFC Q;  1VQA A;  2JEA I;  3T1H L;  2N3S A;  1HR0 W;  2EIF A;  3CC2 A;  4UP7 A;  3S1N H;  2UXD L;  4JOI C;  1QVG A;  2LXK A;  1LYL A;  1KRS A;  4QL5 A;  4QY7 A;  3CME A;  3CP0 A;  3AFQ A;  5IP7 G;  4LF8 L;  5C0X G;  5FJ8 H;  3GTQ H;  3ICE A;  4DR1 Q;  3ERS X;  2YTV A;  1KRT A;  3FKI G;  1IYJ B;  1E24 A;  5IP9 G;  2ALY B;  4A3B H;  4GKJ L;  4YHH Q;  3S1Q H;  1O7I A;  1P16 A;  4JBW A;  2D62 A;  1SLJ A;  1NY4 A;  3PIO A;  4LFC L;  3K0X A;  4LUV A;  1XNR Q;  3W5O A;  4A3J H;  3PO3 H;  1UE6 A;  1UE1 A;  1YNX A;  3HOU H;  4A3L G;  1WFQ A;  4JI4 Q;  1OXS C;  3A5Z B;  1HZ9 A;  1ASY A;  5M3F H;  2PQA A;  2R7D A;  2MO0 A;  1XPR A;  1VQL A;  4AH6 A;  1P8L A;  5JEA J;  1R9T H;  1J5E Q;  1MIU A;  4DK6 C;  2R7F A;  2WP8 J;  3GD7 A;  1IL2 A;  4YHH L;  4GNX A;  3RNU A;  1Q12 A;  2OTJ A;  1WJJ A;  1NMG A;  1E1O A;  1PH9 A;  1HJP A;  2UUB Q;  2KCT A;  1XNR L;  3DLL A;  4RG1 A;  4H02 A;  3UE1 A;  4A93 G;  2NVT H;  4OWX B;  1HR0 Q;  1PYB A;  4EQ5 A;  1HNW Q;  3U4V A;  4P75 A;  2K5V A;  1PFS A;  5C3E G;  4YWL A;  4JI4 L;  4ALP A;  3AQQ A;  5K36 G;  4HJA A;  5JJK A;  2AKW B;  3AYH B;  4DK3 C;  1GKH A;  1JJC B;  2KBN A;  2IY5 B;  4PMW A;  4DV5 L;  3A74 A;  4YY3 Q;  3B6Y A;  4A3F G;  4B3R Q;  1SR3 A;  4IPD A;  4WJ4 A;  1XPU A;  1RL2 A;  3L0O A;  4DUZ Q;  2JA5 H;  4B3T Q;  1Y1W H;  4HIM A;  2HT1 A;  1B7Y B;  4A3C G;  1KHI A;  2UUB L;  4JCV E;  1N33 Q;  2NVX H;  5GAD C;  4C3H H;  1SE8 A;  3L7Z C;  1VQB A;  1PV4 A;  1HR0 L;  2JA8 H;  3KF6 B;  1I50 H;  1BVS A;  3UDF A;  3PCO B;  1SRO A;  3J7Z C;  1VQM A;  2Y0S E;  4JI8 L;  1Q1E A;  4DV7 Q;  3TS2 A;  3CW2 C;  4PG3 A;  4A3D G;  4YY3 L;  4X64 L;  1WYD A;  2LXJ A;  4BY1 G;  2A8V A;  3I4N H;  1Y1V G;  3W1B A;  1EOV A;  1K3R A;  1PVO A;  4POF A;  2NZO A;  3A5U A;  2VZA A;  2Z6K A;  1AE3 A;  1U5K A;  3LGJ A;  4JBM A;  1N33 L;  1HZB A;  2K5H A;  2HHH Q;  5FLM G;  1VQE A;  3KJP A;  4AQY Q;  1FJG Q;  1E7Z A;  2JA7 G;  1QZH A;  1N36 L;  1W3S A;  3BZK A;  3J81 j;  3OTO L;  2Y0S G;  3KLW A;  5JJL A;  2PMZ E;  2WFW A;  2YU9 H;  3STB C;  1YVC A;  1EUJ A;  1GM5 A;  3HOW H;  1A8V A;  5M3M G;  5C44 H;  4APV A;  2ZM6 Q;  2HQL A;  2MQH A;  3F8T A;  4B3S Q;  1Q86 C;  4NXN Q;  1SRU A;  2PI2 E;  4UP8 A;  1VQN A;  3CCJ A;  5LMU L;  3PF5 A;  2HHH L;  1PYS B;  3S14 H;  3ULP A;  3RN5 A;  3ZJY C;  1VQ6 A;  2GN5 A;  1EWI A;  2ZTD A;  2PQA B;  3E0E A;  4DNI A;  4A3E G;  4LF4 Q;  4R4O A;  4AYB G;  2VL6 A;  1HZA A;  2JA6 G;  1M90 C;  1PH8 A;  2NN6 G;  2E2H H;  3U50 C;  5IY0 A;  2R92 G;  3ULJ A;  4C3I H;  4DV2 Q;  2H5X A;  4P74 A;  3PUX A;  2GVA A;  1PHJ A;  4JI3 Q;  1M1K C;  4P73 A;  4NXN L;  1XMQ Q;  4DR7 Q;  1W2B A;  5IT9 c;  4JI6 Q;  2R7Z G;  3PUV A;  3TRE A;  2UXB Q;  3G4S A;  4QIW E;  2JK8 A; 
#chains in the Genus database with same CATH topology
 5GAG C;  2E2H B;  2R93 H;  5IYD H;  3P75 A;  4C3I B;  3Q24 A;  4JI7 Q;  1KL9 A;  3GTO H;  5KGU A;  3HOZ G;  4XTC S;  5CBE E;  5TSS A;  1WTQ A;  2C35 B;  4P71 A;  1BBW A;  3TN2 A;  4OX9 Q;  4BXX H;  2R93 B;  3A56 A;  3GTO B;  4MTK A;  5E4W C;  4KI0 A;  2OT2 A;  2AWO A;  1EY6 A;  5JAV A;  1XMO Q;  4JI6 L;  2RF4 A;  4DV0 L;  3S16 H;  2HIV A;  5BR8 Q;  1H9S B;  2RCN A;  4DR5 L;  1Y14 B;  1B2T A;  2BH2 A;  2G9H D;  1MJE A;  3KJO A;  3S16 B;  1HQR D;  2A6E C;  2L0C A;  5C3W A;  4NKL A;  1X3P A;  2HIX A;  4JV5 Q;  2NZ1 D;  3VR5 A;  3IL8 A;  3ERQ A;  2UXC Q;  3AEV A;  4FNF A;  4LFA Q;  5IOC A;  1CA6 A;  1KDB A;  4UY8 C;  3J81 c;  1FVI A;  2QDB A;  5FK9 C;  2C5C A;  2EY5 A;  2PQE A;  3G48 A;  4JI5 L;  5EKK A;  1FYC A;  3F1Z A;  1I6H H;  2L55 A;  5HGQ A;  5EBC A;  4JBJ A;  5J3B A;  1FL0 A;  5E4X A;  4X66 L;  5FJ8 G;  3CCV A;  1SDF A;  4CDF C;  4A3B G;  2HDM A;  3R3O A;  1I6H B;  2ES2 A;  3HOY H;  1GXD C;  3CKI B;  2MFI A;  1PZK D;  4S3S A;  4KJO A;  5IYC G;  2DGY A;  2G9D A;  4RGT A;  4IOC A;  3RLF A;  3I56 A;  1EY0 A;  5E3F A;  5GQO A;  2KEE A;  1LTL A;  3HOY B;  1IL8 A;  2FMC A;  2B63 H;  5DAU A;  4DV3 Q;  3GTJ H;  1PTO D;  1N8R C;  4CDE C;  2HCI A;  3U9O A;  1PTO B;  5D65 A;  3MWY W;  2B63 B;  1OXX K;  1BNZ A;  3GTJ B;  4YCV A;  3PIP A;  2NZH A;  4BS9 A;  5IGF A;  2Z9H A;  3D31 A;  1TII D;  3F2D A;  4OO1 I;  3S17 H;  1I4Q A;  3N52 A;  5D14 A;  5ELN A;  4BY7 H;  3V96 A;  3BVM A;  2PPB C;  4A75 A;  2SDF A;  3S17 B;  2Z4I A;  1I3Q H;  4YCW A;  1HA6 A;  4BY7 B;  4M8A A;  2ZTE A;  1W6K A;  3BU2 A;  2MO1 A;  1FJG L;  3RN2 A;  3A8I E;  1XYI A;  3ND9 A;  3I4N G;  1CUK A;  1I3Q B;  1LLR D;  2DY8 A;  3J81 i;  2UU9 Q;  3T56 B;  5AJ3 L;  2AWN A;  5LMN Q;  2B29 A;  2RHQ B;  4O0A A;  5CV7 A;  2F0T A;  2A6E D;  1XNQ Q;  4PNY A;  5EBD A;  1EU4 A;  3J81 E;  2MGS A;  1G29 1;  3LWU A;  2ASB A;  3HOW G;  1V1P A;  1JT8 A;  4ULL A;  1EFW A;  3J80 c;  2JJQ A;  2DJF C;  5M5W H;  4DV2 L;  1HNZ Q;  3HP3 A;  4JI3 L;  5IP7 H;  1Q3L A;  4DXG A;  2B3G A;  1RJT A;  2E5L Q;  4JI2 L;  1S3O A;  1WTV A;  1H9K A;  5M5W B;  1JB3 A;  2CH4 A;  2RVL A;  3I4O A;  3H6M A;  3QIA A;  5I6Y A;  3T1Y L;  2F0G A;  3QB3 A;  1G6P A;  3NK9 A;  4GOP C;  2L1B A;  1LTT D;  3SXH A;  5KND A;  1I5F A;  5IYB G;  3ER0 A;  3TP7 A;  1A15 A;  1FNU A;  3UDI A;  1GD7 A;  2F0S A;  4MTN A;  3K8A A;  4HN7 A;  1D1I A;  5BN3 A;  5M5X B;  4CJ0 B;  1JE5 A;  3F2C A;  1B4O A;  3RLN A;  1MJC A;  4NXM L;  4HR7 B;  3DEO A;  1VMC A;  1C48 A;  1K0S A;  1I4H A;  4A4I A;  2HDL A;  2QDL A;  4DV4 Q;  2LSS A;  2F4V L;  1WCM G;  2IL8 A;  2F52 A;  3M3Y H;  2F0W A;  1WTR A;  4X65 L;  4IPH A;  1U9R A;  3R8B A;  1H9M A;  3NWT A;  3J81 L;  1LTG D;  4ID6 A;  3M3Y B;  4DAV A;  1H95 A;  1NCV A;  1Y8O B;  4L8J A;  3J80 i;  3NTH A;  1V1P B;  5I6W A;  3RUZ A;  4OXP A;  2JA7 H;  4K6L A;  3PIP 3;  1STB A;  2FMM A;  2E76 C;  3CD6 A;  1PYW D;  3W2D A;  3BDC A;  3CHB D;  1D8L A;  1MKH A;  2JA7 B;  2VUM G;  1HQM C;  4L5T A;  1VQJ A;  3WWV A;  1X9N A;  1XX8 A;  2F0L A;  5ELC A;  3S9W A;  1N36 Q;  1CT1 D;  2NVY H;  3OTO Q;  1KXL A;  1S5F D;  3PV0 A;  1TKW B;  4A3I G;  2BDO A;  2OF1 A;  1B44 D;  4R4C A;  4KY6 A;  4FXK C;  4A3E H;  4OO1 H;  4XIG S;  1H9J A;  1DOL A;  2K04 A;  3NTK A;  2NVY B;  4I7A A;  3OW2 A;  3D6W A;  3ULL A;  5EGT A;  3T4A C;  1D7Q A;  4HIO A;  1PH2 A;  2R92 H;  4JPB W;  3NEM A;  5J22 A;  1TS4 A;  4A3E B;  3Q0A A;  1A63 A;  2PMZ B;  5I4D A;  1YJN A;  4AYB B;  5KIX A;  1TS3 A;  5IGE A;  2R92 B;  3HKS A;  4J8Q A;  2EE1 A;  1TWC H;  4HCS A;  1N34 L;  1BBU A;  4PZ7 A;  1X3E A;  1EIH A;  4A76 A;  3GTM B;  1Z47 A;  1PA6 A;  4G7Z C;  1JJ2 A;  1SJH D;  4QB4 A;  4GKK L;  3FPP A;  1QIL A;  3K7A H;  1TWC B;  3NQI A;  1W6J A;  3HOZ B;  2JEB I;  4N8X 1;  4XQN A;  1VQH A;  4RWS C;  4U67 3;  1KLG D;  3K7A B;  3FMC A;  4QGU A;  5EQ0 A;  1DZ1 A;  2K32 A;  2UUA Q;  2XSC A;  4X62 Q;  4WJ3 M;  3MXU A;  1ICF B;  1MD2 D;  2LKV A;  2UXD Q;  1CKO A;  2OXP A;  4C3I G;  1Q46 A;  3UDG A;  3TEH B;  2PZT A;  5E1F A;  3J80 L;  3PQI A;  4TSS A;  4U68 A;  1O78 A;  1RIP A;  1E2V A;  3BJU A;  3KBX A;  5IYD G;  2B2W C;  4CKB A;  3RMH A;  3L9A X;  1HR0 W;  4UP7 A;  1CHQ D;  3S1N H;  1Z7T A;  3VR3 A;  5FJ8 H;  4G7O C;  2Z6B A;  4YIJ A;  1GUN A;  5IP9 G;  4OL7 A;  4A3B H;  3S1N B;  1LTB D;  2Z1C A;  1O7I A;  2D62 A;  4RCO A;  3PIO A;  3K0X A;  1K8M A;  4X3K A;  4A3B B;  2MUY A;  1NAP A;  2K5Q A;  1WFQ A;  2K33 A;  4JI4 Q;  1ASY A;  1A2T A;  1CHP D;  5JEA J;  1FR3 A;  5DM6 3;  2B2W A;  1RTN A;  1X3Q A;  5LL6 S;  4DK6 C;  1B3Q A;  3GD7 A;  2ICI A;  3RNU A;  1MI2 A;  1XWE A;  3P20 A;  1E1O A;  5AFW A;  1XNR L;  1I4P A;  3DLL A;  4RG1 A;  4H02 A;  3I4L A;  3U4V A;  2K5V A;  1JCK B;  4ALP A;  1DCZ A;  4HJA A;  3AYH B;  4KY5 A;  3TZU A;  4PMW A;  2NUC A;  3IFD A;  1ZXT A;  3B6Y A;  5G3L D;  2SNM A;  4B3R Q;  2XRS D;  1SR3 A;  5I2Y A;  1CFM A;  1II3 A;  1DOK A;  1KHI A;  3HG9 A;  2UUB L;  1N33 Q;  4C3H H;  3L7Z C;  4ZLT F;  1RHP A;  3QWN A;  4IUP A;  2L11 A;  1SJE D;  5CC4 A;  3UDF A;  3PCO B;  2XVS A;  1VQM A;  4ZCK A;  1JOQ A;  1Q1E A;  2NWG A;  4DV7 Q;  2F0V A;  1F9S A;  3CW2 C;  3TZD A;  4C3H B;  4H0L C;  4X64 L;  1PZJ D;  3I4N H;  3W1B A;  1KDA A;  1MSG A;  3BG3 A;  2Z6K A;  1AN8 A;  3LGJ A;  1U4M A;  3VR6 A;  3I4N B;  1V1O A;  2HHH Q;  1VQE A;  1E7Z A;  2N55 A;  3BZK A;  3J7A F;  1EYC A;  1SNM A;  4K2K A;  2WFW A;  4KMU C;  2YU9 H;  3STB C;  1EUJ A;  3HOW H;  1A8V A;  2LFN A;  3FVQ A;  2MQH A;  3F8T A;  3RD4 A;  3DXJ C;  2PI2 E;  3CCJ A;  1QG7 A;  4QMG A;  2K28 A;  2YU9 B;  1PYS B;  3HOW B;  3DHQ A;  4ZUI A;  5T1I A;  3ITP A;  4DNI A;  1MBY A;  4R4O A;  2DJG C;  2VL6 A;  1SE3 A;  3ULJ A;  3MXN A;  3PUX A;  4P73 A;  4NXN L;  3C2P A;  1GUS A;  2SEB D;  1KAW A;  1HRJ A;  2B2V C;  3H94 A;  3BYY B;  1CKM A;  3CCQ A;  2CW0 C;  2KVM A;  1SYD A;  2PZW A;  3PO2 G;  1B9N A;  2HUG A;  1K83 H;  1BQQ T;  1TS2 A;  3KBG A;  3KF8 A;  2N8N A;  3HGB A;  5KRU A;  3CU7 A;  1K83 B;  1SYG A;  2UXB L;  3DM3 A;  3EQL C;  4GNX C;  4RKB A;  1K28 A;  1F9P A;  2NTS A;  3Q8D A;  4JI7 L;  2I46 A;  3MC0 B;  4KK7 A;  1Q81 C;  3MA2 B;  5ELO A;  2V4D A;  2QW7 A;  1EEI D;  1WCM H;  4OX9 L;  1UWV A;  2L5T A;  3BS1 A;  3SR1 A;  2Q8I B;  1EQQ A;  2PCF B;  3PIO 3;  5A2Q L;  2VQF Q;  4KV6 A;  4HJ9 A;  1NE3 A;  1WCM B;  1YIT A;  2VB2 X;  3D3R A;  1A62 A;  4DR1 L;  2QGQ A;  4DN4 M;  2KCN A;  1I6V C;  4K5W A;  2D9U A;  2CVR A;  2IHF A;  3K5O A;  3LX0 A;  1EIG A;  1E3P A;  2AQ2 B;  4JV5 L;  2GA4 B;  1TWA H;  1ZYR C;  3G7L A;  2VUM H;  4F7X A;  1WOC A;  1J5E L;  1PTO F;  3PUZ A;  1EYG A;  3MXN B;  2E2I H;  2K05 A;  2EQS A;  2OTL A;  1TWA B;  3NEL A;  4LUO A;  3STB D;  4A3I H;  2VUM B;  1IBL Q;  2Z0S A;  1SYC A;  1YNJ C;  2M2L A;  1BCP C;  4BY1 H;  3KFU A;  2A73 B;  2BA1 A;  1ESF A;  1HNW L;  1ET9 A;  1PH5 A;  2E2I B;  1CQF A;  1RF2 D;  4JK1 C;  1L0W A;  4A3I B;  1GO3 E;  1LAC A;  3GTK H;  1DGS A;  3FPU B;  3OHX C;  4BY1 B;  3NSW A;  3S2H H;  3KF8 B;  1XXG A;  2PW5 A;  3M4P A;  1BBX C;  1E2W A;  4LF6 Q;  2ZXR A;  1WVL A;  4EQP A;  3GTK B;  4KHV A;  3S2H B;  1NUC A;  4LF5 Q;  3SGI A;  3URY A;  1D6E C;  1PRT C;  3NHH A;  4IUR A;  4FF3 A;  1YNN C;  4R1J A;  1IKM A;  4R4I A;  3NBH A;  3H15 A;  5ELE A;  2CW0 D;  5BN5 A;  3EFX D;  2I5L X;  4WOR A;  1CM9 A;  2A74 C;  3S1M H;  4DR4 Q;  1JWU D;  1SXT A;  1LTI D;  1HHV A;  1EQT A;  4V0B A;  1D5X C;  4OO1 G;  3J7A 5;  2DNC A;  3M9B A;  1KAB A;  4POG A;  3KLS A;  3S1M B;  1Z9F A;  1JQY D;  2FFK B;  4HJ7 A;  5IE8 A;  1FGB D;  1SYF A;  1JOK A;  4GLX A;  1SNC A;  4GNX B;  1EU3 A;  2F0F A;  4RCN A;  1ILQ A;  3IKJ A;  4B3S L;  4Z9C B;  3W1G A;  2YTX A;  3H09 A;  1QVC A;  1NNX A;  5CV6 A;  1TWF H;  1X3F A;  3G6J B;  1STH A;  1AP0 A;  1Y8P B;  2ZJQ A;  4B9W A;  2B2T C;  1AEX A;  3TP8 A;  2J0T D;  2WKD A;  1YI2 A;  1IBK Q;  1HCZ A;  2UU9 L;  4GLA C;  1S40 A;  1TWF B;  1WI5 A;  4CGY B;  1KC8 C;  1J8I A;  1XTD A;  3EN2 A;  1RCV D;  2VQE Q;  3I7F A;  1AH9 A;  1YHA A;  1YBY A;  5IP9 H;  1I94 L;  4DA2 A;  2Q2T A;  4DPG A;  3T1H Q;  4RMF A;  1WTP A;  2KHS A;  2EJF C;  3D4W A;  4F8M A;  4ME3 A;  5M9O A;  3CCE A;  1ZYR D;  4GLV B;  4ZYS A;  1TXY A;  2JYO A;  4GN4 B;  2XWJ B;  2CWP A;  2ZTC A;  1SEB D;  1V1Q A;  4LAA A;  1EIY B;  1HNZ L;  3SK5 A;  1V9P A;  4GKJ Q;  3JAM c;  4OWW B;  3RZD H;  2E5L L;  2B2T A;  3KLS X;  2O5J C;  3V2T A;  5JEA H;  1MHW C;  1BCP D;  1YNJ D;  4K0K L;  1IZ6 A;  1X3G A;  4DFA A;  4OWT B;  3K81 C;  4LK1 C;  3NBH B;  1BCP B;  5C4H A;  2MPM A;  3GTG H;  4N9P A;  1F9Q A;  2PI2 A;  1EZ8 A;  4LF7 L;  4GN3 B;  1S5B D;  1VF5 C;  1D2B A;  4PZ8 A;  3K59 A;  4K8I A;  2BA0 A;  2F0U A;  5KNB A;  3J7A V;  1KD1 C;  3GTG B;  3S2D H;  3MFG A;  1Y69 U;  3C1E A;  3NEN A;  3PUW A;  4KHP L;  3D8G A;  1ZKO A;  1PRT D;  4DAY A;  1VQ5 A;  2JA9 A;  3DWA A;  1YNN D;  3S2D B;  4A3M G;  3I4M G;  1PRT B;  5JJI A;  5A35 A;  3AU7 A;  3U9S A;  4BBS G;  2RQX A;  2K1B A;  3NE5 B;  2F3W A;  2LMC B;  4DV4 L;  3I3C A;  1G51 A;  1VQF A;  1WD0 A;  4QCL A;  3OMG A;  5L37 A;  2GVB A;  2PO4 A;  2ZXO A;  1B53 A;  1Q1B A;  1F2Y A;  1QE6 A;  2B2Y C;  1TR5 A;  1CQV A;  4RHR A;  4UP9 A;  5D3I B;  4KTA A;  1MSH A;  4RAU C;  1F9R A;  1L0Y B;  1EQV A;  3A54 A;  3DWP A;  3A8K E;  3K80 C;  4A3K H;  3CCS A;  4L63 B;  3D4R A;  3JAM i;  2OCE A;  4BBR G;  1B70 B;  5EAY A;  5FO9 B;  4C3H G;  3I8Z A;  4NB3 A;  2D0O A;  3OIP A;  4A3K B;  1Q90 A;  4DR2 Q;  2Z8L A;  1T5X D;  1LTS D;  2B2Y A;  4XYQ A;  2K14 A;  1UE5 A;  3SEB A;  4IAL A;  2B2U A;  1ONL A;  2OQK A;  2RDF A;  4C3J G;  2VNU D;  3VYR A;  2WB1 E;  4HIK A;  3PO2 H;  4FDB A;  4CKE A;  3TRZ A;  4UDU C;  1OXU A;  3K57 A;  5CR3 A;  1OTC A;  4L5S A;  1IYV A;  3PO2 B;  3I91 A;  2K75 A;  1D5Z C;  3PGZ A;  4DR3 Q;  2J7Z A;  2N49 A;  4DAY B;  4J1M A;  2WB1 G;  2LY7 A;  4C56 C;  1PXU A;  4LF9 L;  4RGM A;  1FNV A;  4LNQ A;  2XWB B;  5C4X H;  2JQO A;  1E22 A;  4XQQ A;  3SVM A;  1B8A A;  4WJW A;  4DV0 Q;  4IFD J;  4UPA A;  3HOV G;  1NMF A;  2K4K A;  4IUN A;  2JE6 I;  2XNA C;  3E9H A;  1VF7 A;  1K3B C;  3BDO A;  4IPG A;  2YTY A;  5C4X B;  1BO0 A;  3K6O A;  5BN4 A;  4KLK A;  3K7U C;  5F2D A;  3CCM A;  5C4J H;  2UUA L;  1NJI C;  1B9M A;  5COY A;  4KKT A;  3CC2 A;  2UXD L;  2HQE A;  1QVG A;  1HTP A;  5JOB A;  4NDX A;  5C4J B;  3SK6 A;  3GTQ H;  3TDQ A;  2YTV A;  1IYJ B;  1E24 A;  3AB9 A;  5CV9 A;  1SE4 A;  1P16 A;  2EYM A;  4JBW A;  3JAM L;  2DY7 A;  4ABN A;  4LUV A;  3GTQ B;  1UE6 A;  1R4Q B;  4XXE A;  4A3L G;  2DN8 A;  1OXS C;  3A5Z B;  2EJM A;  5M3F H;  1JIC A;  2R7D A;  1VQL A;  1P8L A;  4IUT A;  1UNS A;  3GV3 A;  2F0N A;  1TS5 A;  5M3F B;  5G3L F;  1D5M C;  4A93 G;  4MHE A;  2NVT H;  2KCC A;  4OWX B;  2JP1 A;  5C3E G;  1PFS A;  2EJG C;  4YWL A;  4JI4 L;  2WV6 D;  5K36 G;  1JJC B;  4DV5 L;  3A74 A;  4RH6 A;  3EA6 A;  4YY3 Q;  2NVT B;  1H9R A;  4OEL B;  1EYA A;  4WJ4 A;  4F88 A;  1E2Z A;  3J80 E;  4JCV E;  2NVX H;  1DOM A;  5GAD C;  4DU9 A;  4DNR B;  4X3S A;  1GOZ A;  4L6T B;  2Y0S E;  4JI8 L;  3TS2 A;  2X6G A;  2LS0 1;  2NVX B;  4ZUJ A;  4BY1 G;  4ZKC B;  1U4P A;  1PVO A;  4POF A;  2O5I C;  3DUZ A;  4JBM A;  1N33 L;  1NR2 A;  3TP5 A;  3KJP A;  2MP1 A;  1FJG Q;  1QZH A;  4G57 A;  1W3S A;  1LT4 D;  2Y0S G;  5IGC A;  2Q8T A;  3VYS A;  5C4Z A;  3VR2 A;  5M3M G;  2HQL A;  5KYI A;  3SK4 A;  1Q86 C;  1VQN A;  5LMU L;  2HHH L;  1ENF A;  4QF4 A;  3ULP A;  1VMP A;  3Q22 A;  3E0E A;  4LF4 Q;  1QWY A;  1QB5 D;  4CJ2 C;  3U50 C;  4DV2 Q;  2H5X A;  1PHJ A;  2XRQ D;  4KKS A;  1M1K C;  4JI3 Q;  3BVG A;  4DR7 Q;  5NUC A;  4MN3 A;  1UEA B;  5IT9 c;  2R7Z G;  3PUV A;  3PF4 A;  4QIW E;  3T16 A;  5COR A;  1Q8K A;  1E1T A;  3T13 A;  4Y52 H;  5FO8 B;  3R2T A;  2H4O A;  1A3U A;  2QF7 A;  3R2I A;  4C1N K;  2FHT A;  3I73 A;  4YWK A;  3S15 H;  1TY0 A;  1Q8I A;  3CPW A;  2IW3 A;  1LAB A;  3UE0 A;  3FKI H;  4XT1 B;  4EX5 A;  2UUC Q;  1AE2 A;  4JYA L;  2WKC A;  2E75 C;  1HFG A;  4ZQ3 A;  2D5D A;  4J6H A;  4JI1 Q;  4PMB A;  3S15 B;  1TWG H;  5ISR A;  3FKI B;  4NPS A;  1EY5 A;  3E9I A;  1N32 L;  1S5D D;  4MIU A;  4NXM Q;  4Q5V A;  1TWG B;  2QA4 A;  4JVZ A;  2E2D C;  5FLX c;  4A3M H;  4JG2 A;  3OPO A;  2FXQ A;  3I4M H;  3CCR A;  4PQX A;  2E8G A;  2KED A;  4BBS H;  5CMD A;  3I2Z A;  1CA5 A;  2F4V Q;  2NBF A;  2YYZ A;  3CC7 A;  1YJW A;  1NSN S;  3ERO A;  4A3M B;  2ID0 A;  3I4M B;  1GJX A;  2BOS A;  3TQY A;  3BVZ A;  3I90 A;  4FP5 D;  4BBS B;  5JEA G;  1T5E A;  2EDG A;  4HED A;  5D3D A;  4DR6 Q;  2Q2H A;  2SNS A;  1QCB D;  4R9W A;  3IRB A;  3K5N A;  1VQ8 A;  1CZW A;  1G91 A;  3HKZ E;  4P2C B;  2Z6K C;  4R8N A;  3NQT A;  3KLR A;  3C3L A;  3A7A B;  4A3J G;  3PO3 G;  2QKI C;  4BBR H;  1QNU A;  1GUT A;  1X6O A;  5JPM C;  2EXD A;  5J39 A;  5JVH 3;  3HKZ G;  4GN5 A;  2AQ3 B;  1TQO A;  2L15 A;  4XYO A;  4BBR B;  5IT9 E;  1TVX A;  3DM1 A;  3F2B A;  2WAC A;  4DUZ L;  3SDZ A;  2XTI A;  4B3T L;  4QJF A;  3WOE A;  5GAE C;  2CQO A;  5LMN W;  4C3J H;  1M4V A;  1UUP A;  2KEN A;  3KYH C;  4XDX A;  2F0K A;  3J7Y W;  1BDO A;  4IQZ A;  3CF5 A;  4O2D A;  4DNT B;  4LWC A;  3HRZ C;  3K58 A;  1X54 A;  5A2Q E;  2VW9 A;  4LFB Q;  3MTS A;  2KA7 A;  4C3J B;  2I5M X;  2JA5 G;  1FD7 D;  3CPF A;  2K5D A;  4DK1 A;  3TSS A;  1CSQ A;  2JA8 G;  4KHZ A;  1KIX A;  1VS0 A;  4KD4 A;  4A3K G;  1ET6 A;  5HGT A;  5KYL A;  4AQY L;  4GKK Q;  3MEF A;  2WB1 B;  2KHJ A;  5EJW A;  1ILP A;  1K8A C;  2EPB A;  1X55 A;  4YWM A;  1HZC A;  4OEM B;  3T51 B;  3MXP A;  2ZM6 L;  3HOV H;  2ATW A;  1Q7Y C;  1ASZ A;  1SN8 A;  2D0P A;  1K0R A;  3M4Y A;  3VDY A;  3HOV B;  5I9P A;  4TQU S;  4XQJ A;  1WTO A;  3BZC A;  1HNX Q;  1L2F A;  3QO2 A;  1QVF A;  5DLQ E;  4Q0F A;  3LNN A;  1XMQ L;  2ENB A;  3D0F A;  4B3M Q;  5IT9 L;  5EPL A;  3CMA A;  3OYY A;  5IWA Q;  5CBA E;  1S72 A;  1K8G A;  1C7Y A;  4ODG A;  1F77 A;  1C0A A;  4DV6 Q;  4R4T A;  3GTL H;  5I2X A;  3E3X A;  1BCP F;  1IBK L;  3E6Z X;  1RTO A;  2XN9 C;  4A3L H;  1UEB A;  1TWH H;  1BR9 A;  5C4X G;  2F0P A;  4MZ9 A;  1AZQ A;  2VQE L;  4IZ8 A;  4O42 A;  4PMC A;  5FO7 B;  1L1O C;  3GTL B;  1XMO L;  5GRO A;  1DXM A;  2F0M A;  1XPO A;  1C8C A;  5BR8 L;  1HH2 P;  5C0X J;  1TWH B;  3KDF A;  4DKA C;  5IGG A;  1DD2 A;  1ZEQ X;  3QR8 A;  4A93 H;  2RDH A;  5C3E H;  3HFZ B;  3TS0 A;  1G2T A;  5K36 H;  1F2Z A;  3M7G A;  4EGV A;  4L5Q A;  1PRT F;  4K5X A;  3PSI A;  2KOL A;  4A93 B;  3PMF A;  3Q23 A;  3HOX H;  3TBI B;  5C3E B;  5FLX L;  2YV5 A;  1PH6 A;  2A19 A;  4EQN A;  3AMU A;  3OMC A;  4ZK9 B;  2KEC A;  2UXC L;  4LFA L;  1JC7 A;  5C5L A;  3HOX B;  1L1O A;  2VXW A;  3NBI A;  1YHB A;  1IBM Q;  2DUD A;  1G8Z D;  4JOI A;  1Q82 C;  5M3F G;  4PZ6 A;  1EY4 A;  1JMC A;  2CFM A;  2WIN B;  1BOS A;  5EPJ A;  1EY8 A;  3JC6 6;  1ROD A;  2G5D A;  3A8J E;  4X64 Q;  3L2P A;  4DUY Q;  1YIJ A;  4G7H C;  1A6X A;  2L12 A;  4X3U A;  3MVV A;  4H44 C;  2K5N A;  2IWH A;  5M3M H;  4YCU A;  4DV3 L;  2Y0S B;  3DMU A;  3G6E A;  4BA2 I;  5M3M B;  1GUG A;  1X32 A;  1K9M C;  4JI0 Q;  1ICW A;  4K5V A;  3K0Y A;  1VQP A;  2A5H A;  1J9O A;  2JN4 A;  1KQS A;  2KHI A;  3GP7 A;  4HSV A;  3OIQ A;  3KDF B;  1VQG A;  2PYK A;  2R7Z H;  1JE4 A;  3QOJ A;  2ZT9 C;  1QOH A;  3QG1 A;  4AYB E;  4EVO A;  1VQD A;  1OXV A;  4ILW A;  3TP6 A;  4JBK A;  4KY7 A;  2R7Z B;  4G4K A;  2WII B;  3D4D A;  4DR2 L;  4NW2 A;  4C2M H;  1EOT A;  4IJL A;  1PLF A;  2RCF A;  5M5Y H;  4DV1 Q;  1KDC A;  2N78 A;  5DNF A;  4IUU A;  3EIV A;  5C3X A;  5E7N A;  1L1O B;  2M9V A;  1A2U A;  1LM0 A;  2HD3 A;  4HJ5 A;  4C2M B;  1JJG A;  1IXR A;  1PMR A;  1DM0 B;  5M5Y B;  4WFN 3;  4V19 0;  1I4G A;  4H13 C;  5LMN L;  4QIW B;  1XNQ L;  1L0X B;  1S5C D;  1GVP A;  3CCU A;  3E5S A;  3KF6 A;  1VDZ A;  1Y8N B;  4DR3 L;  5C0X I;  1BUV T;  4LF8 Q;  2R6G A;  4RGN A;  5H1S E;  2ZJR A;  4IUV A;  1SBB B;  4DF7 A;  1KNA A;  2SOB A;  2F3V A;  4F87 A;  2E2J H;  2A1A A;  3C1F A;  4LFC Q;  1EZ6 A;  1PFM A;  1VCI A;  1SNQ A;  3N6R A;  4K6D A;  2EIF A;  1Z6H A;  2F0I A;  2NB0 A;  3RZD B;  1KRS A;  4QL5 A;  2C9O A;  3CP0 A;  3AFQ A;  2E2J B;  4DR1 Q;  2VB3 X;  3FKI G;  2ALY B;  5HUR A;  2NYZ D;  4YHH Q;  2EYF A;  3S1Q H;  1EYD A;  1SLJ A;  4KN4 C;  1NY4 A;  1HUM A;  5DEH A;  1DYQ A;  1EY9 A;  2IJ0 A;  2X69 A;  3W5O A;  4A3J H;  3PO3 H;  1UE1 A;  1YNX A;  3S1Q B;  3HZX A;  2PQA A;  3NXW A;  5CYU A;  1SMY C;  3VYT A;  1J5E Q;  3OW7 A;  4A3J B;  3PO3 B;  1O7L A;  1IL2 A;  1Q12 A;  2I07 B;  1WJJ A;  1NMG A;  1PH9 A;  3HKZ B;  3UE1 A;  1HR0 Q;  1PYB A;  3VYU A;  1HNW Q;  3HS0 C;  4NP5 A;  3AQQ A;  2AKW B;  4O1N A;  4DK3 C;  1HPC A;  3VA5 A;  1IYU A;  4IPD A;  1XPU A;  3L0O A;  2B2U C;  2JA5 H;  3KK7 A;  4A3C G;  4HIM A;  3IAY A;  2QIL A;  2FIN B;  5K5P A;  1PTO H;  1VQB A;  2JA8 H;  3KF6 B;  1I50 H;  2KUM A;  1BVS A;  1SRO A;  2ICE C;  1K8O A;  2JA5 B;  1U4R A;  1LO5 D;  4FF2 A;  3BDL A;  1SAP A;  4PG3 A;  3BZD B;  4A3D G;  4YY3 L;  2JA8 B;  1I50 B;  1K3R A;  5EKL A;  3P1H A;  1U5K A;  3CRL C;  4M1U B;  3H3V I;  2AUK A;  1N36 L;  3J81 j;  3JAM E;  3OTO L;  2J4X A;  1I4R A;  1PFN A;  1LT3 D;  1KLU D;  4APV A;  1QJO A;  1WTH A;  2OEO A;  4B3S Q;  2L4N A;  4UP8 A;  4CBV A;  3OSO A;  2PW7 A;  3S14 H;  3RN5 A;  3ZJY C;  1VQ6 A;  2GN5 A;  2K03 A;  2PQA B;  2O4X A;  3K5L A;  4FF1 A;  1SSO A;  2JA6 G;  2NN6 G;  3WOF A;  1KNE A;  3S14 B;  5IY0 A;  5IOD A;  4P74 A;  2GVA A;  4JI6 Q;  4OHJ A;  1I94 Q;  3G4S A;  3H91 A;  3A7L A;  1GUW A;  4LF4 L;  4DR5 Q;  2F0O A;  2B39 A;  4IFD G;  5GAH C;  1ENC A;  1AZP A;  3H3V C;  3X3M A;  1SMY D;  3MAQ A;  2TMP A;  1D1K A;  4A3G G;  2K50 A;  2Q8R E;  5C0X H;  3C46 A;  4DR7 L;  4X62 L;  4RGO S;  1GHJ A;  3Q6S A;  1GUO A;  2CWA A;  1X56 A;  1OXT A;  4FO2 A;  4K0K Q;  4TRD A;  2EVB A;  4FXD A;  1STA A;  4OGQ C;  3H0G G;  1SMX A;  4GS3 A;  5LHY 1;  4HMJ A;  2K6A A;  4IN3 A;  4JI5 Q;  4LUZ A;  4LF7 Q;  1E0B A;  2F3I A;  1B50 A;  5ELB A;  5M5X H;  3L3O C;  4ME5 A;  2UUC L;  1C9O A;  4X66 Q;  2OQ0 A;  2IX3 A;  1O7Y A;  2Z4H A;  4JI1 L;  2CQA A;  1B1Z A;  3A55 A;  4KHP Q;  1CI3 M;  5CGK A;  3D6C A;  1QUQ A;  4HTH A;  3CC4 A;  1PDQ A;  4CKC A;  2B8F A;  2QCP X;  4A3F H;  1FNW A;  2WAQ E;  1CTM A;  4GOP A;  5KNC A;  3PUY A;  1RD9 D;  3KUP A;  3CCL A;  3NTI A;  4A3F B;  1TT2 A;  2RKS A;  3NUC A;  3HOX G;  1VQC A;  1GHK A;  2ZXP A;  1EEF D;  4DR6 L;  1CK1 A;  3HOU G;  3M4Q A;  3M7N A;  1Y1V H;  1YHQ A;  2WAQ G;  1AFP A;  3HEJ A;  1EWH A;  4DAP A;  4K8J A;  5CV4 A;  1A3V A;  3RZO H;  1PH7 A;  2MNA A;  2IPK D;  2R3Z A;  3GO5 A;  5FLM H;  1EIF A;  2BE5 C;  1Y1V B;  1HTL D;  3UI2 A;  1NTG A;  1KAA A;  4B3R L;  2EYH A;  3RZO B;  1FGU A;  3SHL A;  1SYE A;  1WD1 A;  3SK8 A;  4KN7 C;  1VQ4 A;  2Q2U A;  1VQI A;  3GTP H;  3P7J A;  3I55 A;  4ZAI A;  3RR5 A;  3ZYY X;  3FDT A;  2MJ8 A;  1V8Q A;  2IT1 A;  4DV7 L;  3AFP A;  2NN6 I;  1VQO A;  2F0D A;  1Y1W G;  1K73 C;  3GTP B;  3H3V H;  5AJ3 Q;  1STG A;  2Q2I A;  1PFB A;  2EYJ A;  1LTR D;  5C5M A;  5ELD A;  3TME A;  4HSP A;  4OIK A;  2QEX A;  3E0J A;  3MXG A;  3EBE A;  1AW7 A;  1T9H A;  2A68 C;  4IJH A;  1PH1 A;  4IFD I;  2EZV A;  4LFB L;  2EYL A;  3GTM H;  1TU2 B;  1XTC D;  4H7B A;  2CCZ A;  1O7Z A;  1QUQ B;  4CDC C;  2EYO A;  3SE0 A;  3G71 A;  4LF9 Q;  1CZG A;  3HOZ H;  3O13 A;  3OWF A;  3NPP A;  4JI2 Q;  1C4Q A;  4KJN A;  4LW1 A;  2OWO A;  4R8I A;  4GOP B;  2O2L D;  2F0H A;  1IKL A;  2AHO B;  5ELF A;  5C44 G;  3T1Y Q;  1QZG A;  4IOA A;  2K01 A;  2BH8 A;  3VA7 A;  3U58 A;  1N9W A;  3MEH A;  2E74 C;  4FVM A;  5EPK A;  4QUF A;  1RKN A;  1YEZ A;  1JWM D;  4Y7N H;  4CJ1 B;  1CSP A;  2IX0 A;  5LL6 X;  2F0Q A;  2KCM A;  5IIF A;  3QJY A;  1HNX L;  3M85 A;  2F0E A;  2IHE A;  4OON A;  4HCE A;  4UHV A;  5T1G A;  5DM7 3;  1PZI D;  4Y7N B;  2R61 A;  2N88 A;  2R93 G;  5EKI A;  2JSO A;  2PNH A;  2RHS B;  3KOJ A;  4B3M L;  4X6A H;  3UDX A;  2CKZ B;  5IWA L;  1A0I A;  1VQ9 A;  2F4I A;  3RLO A;  1PH4 A;  2PNR C;  1O80 A;  4BXX G;  4DV6 L;  3S1R H;  4X65 Q;  1JB7 A;  1V43 A;  4TVA B;  4RKL A;  4J15 A;  2BE5 D;  1IW7 C;  2VQF L;  3S1R B;  2M00 A;  2ZJP A;  5IYC H;  1CKN A;  3QOL A;  4CDD C;  4A3C H;  2TSS A;  3MZ5 A;  2BCO A;  1U4L A;  4KKU A;  2A69 C;  2I5H A;  2RDG A;  4C1N I;  4DV5 Q;  1UE7 A;  1BKB A;  4JC0 A;  1LUZ A;  3FP9 A;  2BDN A;  3S24 A;  4A3D H;  2NTT A;  1VQ7 A;  1G6Z A;  1ESR A;  4QUC A;  2A6H C;  1HFN A;  4HJ8 A;  4K2L A;  2F0J A;  1YJ9 A;  2A68 D;  5JVG 3;  1EQR A;  2KQ3 A;  4A3D B;  5FKA C;  4JI8 Q;  3WDN A;  2FJ2 A;  4I65 A;  1OO9 B;  1NBW A;  1KTK A;  2EOT A;  1IBM L;  3CRK C;  1PH3 A;  2VY3 A;  2K52 A;  1IBL L;  1RDP D;  2H1E A;  3DEP A;  2AUJ D;  3IFT A;  3U4Z A;  3HOY G;  3FEW X;  2RSO A;  4BWG B;  4I7Z C;  1J6Q A;  1VQK A;  3EVQ A;  4L5R C;  4RHS A;  2F03 A;  4E6I A;  3A0J A;  4DUY L;  1N34 Q;  4LF6 L;  1SND A;  3NWS A;  3GDE A;  4IPC A;  2B63 G;  3MFY A;  2XIW A;  2JA6 H;  4HID A;  2NN6 H;  2EY2 A;  4RA8 A;  1SFO H;  3I72 A;  2CH4 W;  5LMU Q;  3CAM A;  4LF5 L;  2V1C C;  1SYB A;  4K14 A;  4P72 A;  2MHV A;  4WRD A;  2JA6 B;  2I0Q A;  3VR4 A;  3T53 B;  5FLX E;  1HUN A;  1SFO B;  4JI0 L;  4DGZ A;  1JOO A;  3GV6 A;  4IFD H;  4DR4 L;  4B9X A;  5JPN C;  1EL0 A;  1CKN B;  5J1Z A;  4BY7 G;  4A3G H;  1EFI D;  1X65 A;  1TY2 A;  4OIJ A;  1YZ6 A;  2RA4 A;  1STE A;  3FRP B;  2AMC B;  3CQZ H;  2HCC A;  1IHZ A;  4FXG C;  4A3G B;  1U0L A;  3CXC A;  1DJR D;  1SNP A;  4FYD A;  4BA1 I;  4MNO A;  4TKO B;  2NVQ H;  3H0G H;  4CHT B;  3V05 A;  4ZKB B;  4B08 A;  4X3T A;  1IW7 D;  3CQZ B;  2IX1 A;  2XGT A;  2JXM B;  5CV8 A;  5HY6 A;  4DV1 L;  1NR4 A;  4AIM A;  3X3N A;  2NVQ B;  1A3T A;  4NMZ A;  3ONA B;  5IYB H;  1XJV A;  4JYA Q;  3H0G B;  4QQB X;  3ND8 A;  1JWS D;  2A69 D;  3M4O H;  3GQB A;  4IO9 A;  4R4Q A;  1N32 Q;  2D2C C;  4DAM A;  1I4X A;  1LV9 A;  2VS1 A;  3FHW A;  2JEA I;  1VQA A;  4GZY C;  3M4O B;  3T1H L;  2CHB D;  2N3S A;  4JOI C;  2LXK A;  1UAP A;  1LYL A;  2A6H D;  4QY7 A;  3CME A;  1BF4 A;  5IP7 G;  4LF8 L;  5C0X G;  1ENA A;  3ICE A;  3ERS X;  1KRT A;  2K7V A;  4GKJ L;  2B2V A;  1LT6 D;  2EY1 A;  4LFC L;  1XNR Q;  3W3A A;  5JJZ A;  2PZU A;  4JW0 A;  1QNK A;  1S5E D;  3HOU H;  2L9H A;  5IGB A;  1HZ9 A;  2K5W A;  5CV5 A;  4FF4 A;  2MO0 A;  1XPR A;  1HA5 A;  4AH6 A;  5I9O A;  1R9T H;  2QEJ C;  1MIU A;  1LT5 D;  1STY A;  2R7F A;  2WP8 J;  2EY6 A;  3HOU B;  2X6L A;  4UAI A;  4YHH L;  4GNX A;  2OTJ A;  3BYT B;  2WAQ B;  1HJP A;  2UUB Q;  2KCT A;  2KJX A;  1R9T B;  1STN A;  1LTA D;  2RBM A;  4LMQ D;  3DWQ A;  4EQ5 A;  4LJZ C;  4P75 A;  1DON A;  1R4P B;  4HAE A;  1B3A A;  5C6A A;  5JJK A;  1GKH A;  2KBN A;  2IY5 B;  1S4Z A;  4A3F G;  1SE2 A;  1RL2 A;  4DUZ Q;  2HT1 A;  4B3T Q;  1Y1W H;  1B7Y B;  1EWC A;  2B8G A;  4HMI A;  1SE8 A;  4DK0 A;  1HR0 L;  1WTW A;  1PV4 A;  3F2U A;  3J7Z C;  1WTX A;  3K5M A;  1Y1W B;  1H9S A;  1ML0 D;  1M8A A;  2A8V A;  1WYD A;  2LXJ A;  4IUQ A;  1Y1V G;  3OWE B;  4KD3 A;  1EOV A;  2NZO A;  3A5U A;  1AE3 A;  2VZA A;  3NP8 A;  3OOC A;  1HZB A;  2K5H A;  2P5Z X;  3R93 A;  4N8F A;  5FLM G;  4AQY Q;  2JA7 G;  1JR0 D;  2RSN A;  1G2S A;  4DXF A;  5IGD A;  3KLW A;  5JJL A;  5KEE A;  2AQ1 B;  2PMZ E;  3EJI A;  4N9T A;  5FOB B;  1YVC A;  1HXY D;  1GM5 A;  5C44 H;  2ZM6 Q;  4PV1 C;  4NXN Q;  1SRU A;  1BXT A;  3PF5 A;  4EQO A;  1PTO C;  5C44 B;  1F2L A;  2ZTD A;  1EWI A;  2EXZ A;  4A3E G;  4RFB A;  4AYB G;  3MHB A;  1HZA A;  1MGS A;  1M90 C;  1PH8 A;  2E2H H;  1JOR A;  1F2M A;  2R92 G;  4ZRZ A;  4C3I H;  1SNO A;  2DNE A;  2EYP A;  1XMQ Q;  1W2B A;  2F1M A;  3LWE A;  3I70 A;  1EY7 A;  4XT3 B;  3TRE A;  2UXB Q;  2JK8 A; 
#chains in the Genus database with same CATH homology
 5GAG C;  2R93 H;  1KAW A;  5IYD H;  1Q8K A;  1CKM A;  3CCQ A;  4JI7 Q;  1KL9 A;  1E1T A;  4LF4 L;  4DR5 Q;  3GTO H;  3PO2 G;  4Y52 H;  1K83 H;  4XTC S;  3HOZ G;  4IFD G;  5GAH C;  4OX9 Q;  2C35 B;  4P71 A;  1BBW A;  4BXX H;  2N8N A;  4A3G G;  2K50 A;  4YWK A;  3S15 H;  3CPW A;  4KI0 A;  4DR7 L;  4X62 L;  2AWO A;  3UE0 A;  3FKI H;  4EX5 A;  1XMO Q;  4JI6 L;  2RF4 A;  2CWA A;  2UXB L;  3DM3 A;  1AE2 A;  2UUC Q;  4DV0 L;  1X56 A;  4GNX C;  3S16 H;  2HIV A;  1OXT A;  5BR8 Q;  4JYA L;  4K0K Q;  4JI7 L;  3Q8D A;  4JI1 Q;  2RCN A;  1TWG H;  1Y14 B;  4DR5 L;  1Q81 C;  2BH2 A;  3H0G G;  4NPS A;  5ELO A;  1SMX A;  4GS3 A;  1MJE A;  1WCM H;  4OX9 L;  1UWV A;  3KJO A;  3E9I A;  1EQQ A;  1N32 L;  4JI5 Q;  4NXM Q;  4LUZ A;  2VQF Q;  2QA4 A;  4LF7 Q;  2F3I A;  4HJ9 A;  1NE3 A;  5FLX c;  4A3M H;  4JG2 A;  5M5X H;  2FXQ A;  3I4M H;  3CCR A;  1YIT A;  2UUC L;  1C9O A;  2E8G A;  2HIX A;  4X66 Q;  4JV5 Q;  4BBS H;  2OQ0 A;  3I2Z A;  2F4V Q;  2YYZ A;  4JI1 L;  3CC7 A;  1YJW A;  2UXC Q;  3AEV A;  4LFA Q;  1A62 A;  4DR1 L;  4KHP Q;  2QGQ A;  2ID0 A;  3TQY A;  4UY8 C;  3J81 c;  1FVI A;  1QUQ A;  3CC4 A;  5JEA G;  4DR6 Q;  3G48 A;  2Q2H A;  4JI5 L;  3IRB A;  3F1Z A;  1I6H H;  5HGQ A;  2IHF A;  1VQ8 A;  4A3F H;  4JBJ A;  1E3P A;  1FL0 A;  5J3B A;  4X66 L;  4JV5 L;  2WAQ E;  5FJ8 G;  4GOP A;  3CCV A;  1TWA H;  3HKZ E;  2Z6K C;  3PUY A;  2VUM H;  4A3B G;  3CCL A;  1WOC A;  1J5E L;  2ES2 A;  3HOY H;  3HOX G;  3PUZ A;  2MFI A;  1EYG A;  3MXN B;  2E2I H;  5IYC G;  2EQS A;  1VQC A;  2OTL A;  2DGY A;  3STB D;  3NEL A;  4LUO A;  4A3J G;  4A3I H;  4IOC A;  3PO3 G;  4DR6 L;  3RLF A;  3I56 A;  3HOU G;  1IBL Q;  4BBR H;  2Z0S A;  5GQO A;  3KFU A;  1LTL A;  4BY1 H;  3M4Q A;  1X6O A;  1Y1V H;  2EXD A;  1YHQ A;  2BA1 A;  3M7N A;  2WAQ G;  1HNW L;  2B63 H;  1PH5 A;  4DV3 Q;  3HKZ G;  4GN5 A;  3GTJ H;  3RZO H;  1PH7 A;  1L0W A;  2MNA A;  2L15 A;  1GO3 E;  1N8R C;  3GTK H;  1DGS A;  3GO5 A;  5FLM H;  1EIF A;  3S2H H;  3KF8 B;  1NTG A;  4B3R L;  1OXX K;  3M4P A;  3F2B A;  4LF6 Q;  4DUZ L;  1FGU A;  2XTI A;  4B3T L;  4YCV A;  4QJF A;  3PIP A;  5GAE C;  2CQO A;  5LMN W;  4C3J H;  1VQ4 A;  2Q2U A;  2NZH A;  1VQI A;  2KEN A;  3KYH C;  3GTP H;  3I55 A;  3CF5 A;  4O2D A;  3D31 A;  3F2D A;  3RR5 A;  4LF5 Q;  3SGI A;  4LWC A;  4OO1 I;  3S17 H;  1X54 A;  2VW9 A;  2IT1 A;  5ELN A;  4BY7 H;  4LFB Q;  4R1J A;  4R4I A;  4DV7 L;  3AFP A;  3H15 A;  2NN6 I;  2I5M X;  1VQO A;  2JA5 G;  1K73 C;  1Y1W G;  3H3V H;  3CPF A;  5AJ3 Q;  2Q2I A;  4A75 A;  2I5L X;  1CSQ A;  1I3Q H;  2JA8 G;  4YCW A;  4KHZ A;  3S1M H;  4DR4 Q;  2QEX A;  1KIX A;  1VS0 A;  2ZTE A;  3EBE A;  4A3K G;  4AQY L;  3BU2 A;  2MO1 A;  1FJG L;  1T9H A;  4IJH A;  3RN2 A;  4GKK Q;  4OO1 G;  3I4N G;  1PH1 A;  1CUK A;  3M9B A;  3J7A 5;  3MEF A;  4POG A;  4IFD I;  2KHJ A;  4LFB L;  1Z9F A;  4HJ7 A;  3J81 i;  5IE8 A;  1K8A C;  3GTM H;  1X55 A;  2UU9 Q;  5AJ3 L;  4GLX A;  2CCZ A;  4GNX B;  1QUQ B;  2AWN A;  1HZC A;  4YWM A;  2ZM6 L;  3HOV H;  3G71 A;  4B3S L;  4LF9 Q;  5LMN Q;  2B29 A;  2RHQ B;  2ATW A;  4O0A A;  3HOZ H;  3W1G A;  4JI2 Q;  1XNQ Q;  1Q7Y C;  2YTX A;  1ASZ A;  4LW1 A;  2OWO A;  1SN8 A;  2D0P A;  1K0R A;  1QVC A;  4GOP B;  3VDY A;  1TWF H;  1X3F A;  1G29 1;  2AHO B;  4TQU S;  2ZJQ A;  2ASB A;  3HOW G;  5C44 G;  1JT8 A;  3T1Y Q;  1QZG A;  4IOA A;  3BZC A;  1EFW A;  1YI2 A;  2BH8 A;  2JJQ A;  3J80 c;  1L2F A;  1IBK Q;  1HNX Q;  2UU9 L;  4GLA C;  5M5W H;  3U58 A;  1S40 A;  1QVF A;  4DV2 L;  1WI5 A;  1N9W A;  5DLQ E;  1KC8 C;  1HNZ Q;  4JI3 L;  1XTD A;  3EN2 A;  5IP7 H;  1XMQ L;  2VQE Q;  3D0F A;  3I7F A;  2B3G A;  1AH9 A;  1YHA A;  1YBY A;  5IP9 H;  2E5L Q;  4B3M Q;  4JI2 L;  1S3O A;  1I94 L;  2Q2T A;  1YEZ A;  4DPG A;  3T1H Q;  4RMF A;  3CMA A;  3OYY A;  5IWA Q;  1S72 A;  1K8G A;  3I4O A;  4Y7N H;  1C7Y A;  1CSP A;  2IX0 A;  1C0A A;  4ME3 A;  4DV6 Q;  4R4T A;  2KCM A;  3T1Y L;  3GTL H;  3CCE A;  1G6P A;  4GLV B;  3M85 A;  1TXY A;  1IBK L;  1HNX L;  4A3L H;  2IHE A;  1UEB A;  4GN4 B;  4OON A;  4GOP C;  2CWP A;  2ZTC A;  1V1Q A;  1EIY B;  1TWH H;  5C4X G;  1HNZ L;  1V9P A;  4GKJ Q;  3JAM c;  4MZ9 A;  4OWW B;  1I5F A;  2R93 G;  2VQE L;  3RZD H;  1L1O C;  2RHS B;  2PNH A;  3KOJ A;  5IYB G;  1XMO L;  3ER0 A;  2E5L L;  5GRO A;  4B3M L;  3UDX A;  4X6A H;  3UDI A;  1GD7 A;  2CKZ B;  4MTN A;  1XPO A;  4K0K L;  5BR8 L;  1HH2 P;  1IZ6 A;  5IWA L;  5C0X J;  1A0I A;  3K8A A;  1VQ9 A;  3KDF A;  1X3G A;  3RLO A;  4DKA C;  1PH4 A;  4OWT B;  3K81 C;  4BXX G;  3NBH B;  4DV6 L;  4A93 H;  3S1R H;  4X65 Q;  5C3E H;  3HFZ B;  3TS0 A;  1JB7 A;  3GTG H;  1V43 A;  4TVA B;  4J15 A;  2PI2 A;  1JE5 A;  4L5Q A;  3F2C A;  3RLN A;  1MJC A;  2VQF L;  4GN3 B;  4LF7 L;  4NXM L;  3PSI A;  4PZ8 A;  3HOX H;  2BA0 A;  2ZJP A;  2YV5 A;  5IYC H;  1CKN A;  1PH6 A;  1KD1 C;  3S2D H;  2A19 A;  4A4I A;  1I94 Q;  4A3C H;  4DV4 Q;  2LSS A;  2F4V L;  1WCM G;  2F52 A;  3NEN A;  2I5H A;  3M3Y H;  4LFA L;  3PUW A;  2UXC L;  4X65 L;  4KHP L;  1L1O A;  1VQ5 A;  4DV5 Q;  2JA9 A;  1UE7 A;  4IPH A;  1BKB A;  1YHB A;  1IBM Q;  2DUD A;  4JC0 A;  4A3M G;  1LUZ A;  3I4M G;  5JJI A;  4JOI A;  3FP9 A;  3S24 A;  4A3D H;  1VQ7 A;  4BBS G;  1Q82 C;  1H95 A;  5M3F G;  4PZ6 A;  4DV4 L;  1JMC A;  3H3V I;  3J80 i;  4HJ8 A;  2CFM A;  1G51 A;  1VQF A;  1YJ9 A;  1EQR A;  4OXP A;  2GVB A;  2JA7 H;  4JI8 Q;  3JC6 6;  1Q1B A;  1NBW A;  4X64 Q;  1IBM L;  3L2P A;  4DUY Q;  1YIJ A;  1PH3 A;  2VY3 A;  4UP9 A;  3CD6 A;  2K52 A;  1IBL L;  1D8L A;  1MKH A;  2K5N A;  5M3M H;  2VUM G;  4YCU A;  4L5T A;  4DV3 L;  1VQJ A;  3U4Z A;  3HOY G;  3WWV A;  1X9N A;  3K80 C;  1N36 Q;  3G6E A;  2NVY H;  1J6Q A;  3OTO Q;  4A3K H;  1KXL A;  3CCS A;  3PV0 A;  1VQK A;  4BA2 I;  4A3I G;  4L5R C;  3JAM i;  2OCE A;  4R4C A;  4BBR G;  1B70 B;  5EAY A;  4A3E H;  1K9M C;  4XIG S;  4JI0 Q;  3A0J A;  4DUY L;  1N34 Q;  4LF6 L;  3GDE A;  4NB3 A;  4IPC A;  2D0O A;  2B63 G;  3OW2 A;  1VQP A;  2JA6 H;  3ULL A;  4HID A;  4DR2 Q;  1D7Q A;  4HIO A;  1PH2 A;  1SFO H;  2R92 H;  3NEM A;  5LMU Q;  1KQS A;  2KHI A;  3CAM A;  4LF5 L;  2V1C C;  1A63 A;  4P72 A;  3KDF B;  1VQG A;  1YJN A;  2K14 A;  1UE5 A;  2R7Z H;  2I0Q A;  2OQK A;  3HKS A;  4AYB E;  2VNU D;  4JI0 L;  2WB1 E;  1VQD A;  1TWC H;  1N34 L;  4HIK A;  3PO2 H;  1BBU A;  1OXV A;  4PZ7 A;  4FDB A;  1X3E A;  4JBK A;  4DR4 L;  4A76 A;  3TRZ A;  4DR2 L;  1Z47 A;  1PA6 A;  1OXU A;  1JJ2 A;  1CKN B;  4BY7 G;  4C2M H;  4A3G H;  1X65 A;  4IJL A;  5M5Y H;  1OTC A;  3K7A H;  4L5S A;  4DV1 Q;  4GKK L;  2N78 A;  2K75 A;  1YZ6 A;  3PGZ A;  3EIV A;  2JEB I;  4DR3 Q;  5E7N A;  2N49 A;  1L1O B;  4DAY B;  2AMC B;  1LM0 A;  3CQZ H;  2WB1 G;  4HJ5 A;  1JJG A;  1VQH A;  1IXR A;  1U0L A;  3CXC A;  4QGU A;  4BA1 I;  4MNO A;  2NVQ H;  4LF9 L;  5LMN L;  3H0G H;  4LNQ A;  1XNQ L;  2UUA Q;  4X62 Q;  4WJ3 M;  2IX1 A;  2XGT A;  1GVP A;  5C4X H;  3PF4 A;  3CCU A;  2JQO A;  1E22 A;  5HY6 A;  2UXD Q;  1CKO A;  4DV1 L;  1B8A A;  4AIM A;  4DV0 Q;  4IFD J;  3KF6 A;  4JYA Q;  4QQB X;  5IYB H;  4UPA A;  1XJV A;  4DR3 L;  5C0X I;  1Q46 A;  1NMF A;  3HOV G;  2K4K A;  3UDG A;  4LF8 Q;  3TEH B;  2R6G A;  2JE6 I;  3E9H A;  5H1S E;  2ZJR A;  3M4O H;  4IPG A;  2YTY A;  4IO9 A;  4R4Q A;  1N32 Q;  3BJU A;  1RIP A;  4KLK A;  4DAM A;  5IYD G;  3K7U C;  3CCM A;  2VS1 A;  2E2J H;  2A1A A;  5C4J H;  2UUA L;  1VCI A;  1NJI C;  3FHW A;  4LFC Q;  1VQA A;  2JEA I;  3T1H L;  2N3S A;  1HR0 W;  2EIF A;  3CC2 A;  4UP7 A;  3S1N H;  2UXD L;  4JOI C;  1QVG A;  2LXK A;  1LYL A;  1KRS A;  4QL5 A;  4QY7 A;  3CME A;  3CP0 A;  3AFQ A;  5IP7 G;  4LF8 L;  5C0X G;  5FJ8 H;  3GTQ H;  3ICE A;  4DR1 Q;  3ERS X;  2YTV A;  1KRT A;  3FKI G;  1IYJ B;  1E24 A;  5IP9 G;  2ALY B;  4A3B H;  4GKJ L;  4YHH Q;  3S1Q H;  1O7I A;  1P16 A;  4JBW A;  2D62 A;  1SLJ A;  1NY4 A;  3PIO A;  4LFC L;  3K0X A;  4LUV A;  1XNR Q;  3W5O A;  4A3J H;  3PO3 H;  1UE6 A;  1UE1 A;  1YNX A;  3HOU H;  4A3L G;  1WFQ A;  4JI4 Q;  1OXS C;  3A5Z B;  1HZ9 A;  1ASY A;  5M3F H;  2PQA A;  2R7D A;  2MO0 A;  1XPR A;  1VQL A;  4AH6 A;  1P8L A;  5JEA J;  1R9T H;  1J5E Q;  1MIU A;  4DK6 C;  2R7F A;  2WP8 J;  3GD7 A;  1IL2 A;  4YHH L;  4GNX A;  3RNU A;  1Q12 A;  2OTJ A;  1WJJ A;  1NMG A;  1E1O A;  1PH9 A;  1HJP A;  2UUB Q;  2KCT A;  1XNR L;  3DLL A;  4RG1 A;  4H02 A;  3UE1 A;  4A93 G;  2NVT H;  4OWX B;  1HR0 Q;  1PYB A;  4EQ5 A;  1HNW Q;  3U4V A;  4P75 A;  2K5V A;  1PFS A;  5C3E G;  4YWL A;  4JI4 L;  4ALP A;  3AQQ A;  5K36 G;  4HJA A;  5JJK A;  2AKW B;  3AYH B;  4DK3 C;  1GKH A;  1JJC B;  2KBN A;  2IY5 B;  4PMW A;  4DV5 L;  3A74 A;  4YY3 Q;  3B6Y A;  4A3F G;  4B3R Q;  1SR3 A;  4IPD A;  4WJ4 A;  1XPU A;  1RL2 A;  3L0O A;  4DUZ Q;  2JA5 H;  4B3T Q;  1Y1W H;  4HIM A;  2HT1 A;  1B7Y B;  4A3C G;  1KHI A;  2UUB L;  4JCV E;  1N33 Q;  2NVX H;  5GAD C;  4C3H H;  1SE8 A;  3L7Z C;  1VQB A;  1PV4 A;  1HR0 L;  2JA8 H;  3KF6 B;  1I50 H;  1BVS A;  3UDF A;  3PCO B;  1SRO A;  3J7Z C;  1VQM A;  2Y0S E;  4JI8 L;  1Q1E A;  4DV7 Q;  3TS2 A;  3CW2 C;  4PG3 A;  4A3D G;  4YY3 L;  4X64 L;  1WYD A;  2LXJ A;  4BY1 G;  2A8V A;  3I4N H;  1Y1V G;  3W1B A;  1EOV A;  1K3R A;  1PVO A;  4POF A;  2NZO A;  3A5U A;  2VZA A;  2Z6K A;  1AE3 A;  1U5K A;  3LGJ A;  4JBM A;  1N33 L;  1HZB A;  2K5H A;  2HHH Q;  5FLM G;  1VQE A;  3KJP A;  4AQY Q;  1FJG Q;  1E7Z A;  2JA7 G;  1QZH A;  1N36 L;  1W3S A;  3BZK A;  3J81 j;  3OTO L;  2Y0S G;  3KLW A;  5JJL A;  2PMZ E;  2WFW A;  2YU9 H;  3STB C;  1YVC A;  1EUJ A;  1GM5 A;  3HOW H;  1A8V A;  5M3M G;  5C44 H;  4APV A;  2ZM6 Q;  2HQL A;  2MQH A;  3F8T A;  4B3S Q;  1Q86 C;  4NXN Q;  1SRU A;  2PI2 E;  4UP8 A;  1VQN A;  3CCJ A;  5LMU L;  3PF5 A;  2HHH L;  1PYS B;  3S14 H;  3ULP A;  3RN5 A;  3ZJY C;  1VQ6 A;  2GN5 A;  1EWI A;  2ZTD A;  2PQA B;  3E0E A;  4DNI A;  4A3E G;  4LF4 Q;  4R4O A;  4AYB G;  2VL6 A;  1HZA A;  2JA6 G;  1M90 C;  1PH8 A;  2NN6 G;  2E2H H;  3U50 C;  5IY0 A;  2R92 G;  3ULJ A;  4C3I H;  4DV2 Q;  2H5X A;  4P74 A;  3PUX A;  2GVA A;  1PHJ A;  4JI3 Q;  1M1K C;  4P73 A;  4NXN L;  1XMQ Q;  4DR7 Q;  1W2B A;  5IT9 c;  4JI6 Q;  2R7Z G;  3PUV A;  3TRE A;  2UXB Q;  3G4S A;  4QIW E;  2JK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...