4X65L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65L00
4DV5Q 3HKSA 2ASBA 4YCWA 2N3SA 4QIWE 1HNZQ 3JC66 5IYCG 1PH6A 2Q2UA 4QGUA 3CCSA 1HZ9A 4LF9Q 3JAMc 3KLWA 1CKMA 3E9HA 4J15A 3A5UA 1K73C 1A0IA 1QZGA 2MFIA 3PSIA 5BR8L 1C9OA 4LFBL 4LFAL 3AYHB 3GDEA 5C3EH 4KLKA 3STBC 4L5SA 5BR8Q 3CW2C 2CFMA 1VQCA 2Q2IA 4LFBQ 4LFAQ 4ALPA 5JEAJ 4A3MH 3CAMA 1PH8A 4GN4B 3K7AH 1GO3E 1OXSC 2JK8A 1KRTA 2Y0SG 1PA6A 1VQ6A 3GTQH 4BBSG 1SR3A 1G291 4R4CA 4NPSA 2YV5A 1IYJB 1FVIA 2K5NA 4ME3A 5H1SE 3U58A 1JT8A 5K36G 4P71A 4DR5Q 4YWLA 4HJ7A 3CMAA 3CCEA 2VQEQ 4OWWB 3GTKH 5JEAG 2E8GA 4YHHL 3CCVA 4NXMQ 2WP8J 2I0QA 1VQ4A 1VQOA 3MEFA 4X62Q 2JA7H 2BH2A 1Y1WH 1VQ5A 1JE5A 1KAWA 3I2ZA 2AKWB 2NN6G 3I4MG 4GKJL 3EBEA 3S15H 5C44G 4A3FG 2ZTCA 3STBD 4GLXA 2UXCQ 3S14H 3ULLA 2MO1A 4GKJQ 1EFWA 2VW9A 3U4VA 2DUDA 3VDYA 4POFA 2CCZA 1I5FA 1Z9FA 4A3GG 1L1OA 1B70B 2E2IH 4A3EH 1ASZA 1YITA 4Y52H 4GNXC 2K5HA 2JEAI 1IXRA 3S1NH 4GOPC 1SFOH 4PG3A 4AIMA 1XNQL 2ATWA 3G71A 4JBKA 4UY8C 2FXQA 2YYZA 1PV4A 1LTLA 1Q12A 3GO5A 4KI0A 1HNWL 4JBJA 3D31A 4OWXB 1XNQQ 1UE5A 2BH8A 4JI8L 2OQKA 2C35B 2VL6A 4HIDA 1I94L 1X54A 1B8AA 1IZ6A 4UP8A 4BXXH 2PNHA 4P72A 4JI8Q 4UPAA 1CSPA 2B63G 2YTYA 4R4OA 1I6HH 4JI3Q 1I94Q 3F2DA 1UE1A 3RR5A 1RIPA 3RNUA 2LSSA 5GAGC 2UU9L 1C7YA 5IWAL 3KJPA 3W5OA 3LGJA 3SGIA 4RG1A 3WWVA 4C3HH 5IYDG 3F2BA 3T1HQ 2E2HH 2UU9Q 1VQLA 5IWAQ 3CCJA 1SE8A 1ASYA 4JI4L 2Z6KC 4P73A 2DGYA 3U50C 5C0XI 3DLLA 1JJ2A 2VZAA 1OXXK 2R7FA 4YCUA 1NMFA 3NBHB 5HGQA 1OXVA 5FLMG 5GADC 3J7ZC 2ZJQA 2JA8H 1SROA 4AYBG 4JI4Q 1D7QA 1E24A 2JE6I 5M3FG 3RZOH 2AHOB 2ID0A 3CC4A 3B6YA 1N34L 2K4KA 1HR0W 2OWOA 2HIXA 3ULPA 2Q2TA 4A3DG 1X55A 4EX5A 2Y0SE 4DV3Q 2Z6KA 2VUMH 3I4NH 2HQLA 2R7DA 2IX0A 2D0PA 5M5XH 4JBMA 3K80C 3RLFA 3PUXA 2UUAL 3PO3H 1Y1VG 2YTVA 1V9PA 4YY3Q 3CF5A 4DR2L 1A63A 1VQPA 2VNUD 1L1OB 1LYLA 4IJLA 1IBML 1YBYA 3S17H 1HZBA 4R1JA 3AQQA 2R7ZH 3KDFA 3UDIA 3S16H 1EYGA 5AJ3L 4A3CG 1J5EL 4KHZA 2UXDQ 1CUKA 2NZHA 3CMEA 1Q86C 1BBWA 4A4IA 5AJ3Q 5LMNW 3AEVA 3PF5A 4QQBX 1J5EQ 5JJLA 3TREA 1SN8A 1PHJA 1A8VA 2JA5H 1Z47A 4LUOA 2KBNA 1V1QA 2JJQA 4HJ5A 2VQFL 3ICEA 5GROA 2YU9H 1HZAA 3HKZG 4O2DA 5C4XH 2CWAA 4A3KH 4DV1L 1XPOA 4IPCA 2VQFQ 3CCMA 4DUYL 4MZ9A 1K9MC 4A3LG 1K8GA 1UWVA 1VQDA 2OQ0A 3BZCA 3TS0A 1HNXQ 1BKBA 3HOYG 1G6PA 3T1YL 2MO0A 1E7ZA 1HJPA 4DV1Q 4DUYQ 1N33L 1Q1EA 4EQ5A 2QEXA 3GTGH 3HOZH 4X64L 2ALYB 1WCMH 3A74A 3T1YQ 1KD1C 3CCLA 4JI5L 1IBKL 1N33Q 2B29A 4X64Q 3BZKA 4HJ9A 4QL5A 2E2JH 3NEMA 4JI5Q 1IBKQ 4PZ8A 5IP9H 4JI7L 5IYCH 2IHFA 3OYYA 1JMCA 3HOWH 4IPDA 2R93H 4LWCA 2R6GA 4JI7Q 5C0XJ 1EQRA 2Q2HA 2NVQH 2JEBI 5C4JH 4OO1G 4DV6L 4LF6L 3S1QH 5IT9c 1FJGL 3H15A 4HIOA 3A0JA 3I56A 4A3MG 1PH3A 3F2CA 3UDXA 1KC8C 3RLOA 4LF6Q 1JB7A 1FJGQ 2NZOA 5LMUL 5IY0A 2WB1G 3Q8DA 2EQSA 2AWOA 5C0XG 3K7UC 4A3IH 1HH2P 3L0OA 3G6EA 3MXNB 1XNRL 4PMWA 4YHHQ 3CCRA 2D0OA 5E7NA 5LMUQ 1S72A 4JYAL 3CXCA 1VQMA 4DAMA 4JBWA 4MTNA 3KDFB 4DV2L 1XNRQ 2F4VL 1M90C 4JYAQ 1E22A 1LM0A 1R9TH 4IOCA 4BY1H 2H5XA 1XMQL 3GTJH 1QVGA 2F4VQ 1CKOA 1P16A 4DV2Q 4DR3L 1W2BA 2JA7G 2JA6H 3M4QA 4C3IH 2MQHA 3HOVH 1XMQQ 4UP7A 4DR3Q 5DLQE 1XMOL 4DV0L 3PUVA 1P8LA 3DM3A 4HJAA 4C2MH 1L0WA 3EIVA 5C44H 4TQUS 4A93H 5IE8A 2WAQG 3H0GH 4POGA 4IPGA 1TWAH 1H95A 4XTCS 2D62A 2GN5A 1YHBA 3D0FA 3GTPH 1EWIA 1VQAA 3PUYA 2LXJA 1S40A 1JJGA 4A3EG 4R4IA 5IP7H 3ERSX 1VQGA 4B3TL 4GNXA 4X66L 2JA9A 3J81j 4WJ4A 1Q1BA 4JI6L 4GOPA 3ER0A 5IYBG 5GAEC 1HNWQ 3NELA 3CP0A 4B3TQ 3HKZE 4X66Q 3TS2A 2OCEA 3G48A 4OONA 1XPRA 4JI6Q 4GKKL 4QJFA 4B3ML 1OXTA 1GKHA 2N78A 4JCVE 4RMFA 2CWPA 1Q7YC 1NY4A 2MNAA 3PO2H 4GKKQ 3J81c 4B3MQ 3S2DH 3FKIH 5FJ8H 4BXXG 2B63H 5JJKA 1YNXA 4UP9A 1HR0L 3M4OH 4DR4L 1U0LA 1JJCB 1RL2A 4JG2A 1QVCA 3KOJA 1HR0Q 2R92H 4DR4Q 2UXBL 2AMCB 1YJNA 4H02A 1Y14B 3HOXH 1OTCA 1IBLL 4GN3B 4BA2I 1W3SA 1WYDA 4IJHA 4DK6C 4DV7L 1WI5A 5FLXc 1KQSA 2RF4A 4HJ8A 5HY6A 1FGUA 1N34Q 1IBLQ 3M7NA 4A3BG 5M5WH 4DV7Q 4BBRG 3RN5A 1B7YB 5GQOA 2QA4A 1PH5A 2HHHL 1G51A 4IOAA 4YWKA 4AH6A 3W1BA 2WB1E 2HHHQ 1C0AA 3BU2A 3KF6A 2VUMG 1KHIA 2UUAQ 1I50H 3I4NG 4DR1L 2VS1A 2ZTDA 4NB3A 2GVAA 3U4ZA 4L5QA 2ZJPA 5LMNL 1UEBA 2WFWA 1VQIA 3BJUA 4OXPA 1PYSB 4DUZL 2OTJA 1MIUA 4K0KL 3PCOB 2EIFA 1IBMQ 3PO3G 1EIFA 2UUBL 5LMNQ 4A3JH 3M85A 4DUZQ 4IO9A 1E3PA 3I7FA 1BBUA 1VS0A 2F3IA 1N36L 4LF4L 4BY7H 3S2HH 2UUBQ 4X6AH 4KHPL 3HOUH 2KHJA 3GTMH 1Q8KA 2R7ZG 1X65A 2BA1A 3UDFA 3OTOL 4GNXB 1N36Q 4LF4Q 3KF8B 4GOPB 1KIXA 1LUZA 4KHPQ 3KYHC 1VQHA 4FDBA 4LFCL 3OTOQ 3A5ZB 3OW2A 2K50A 2IX1A 2WAQE 1NTGA 1PH2A 1KL9A 4PZ7A 2I5LX 2JA5G 2ZJRA 4LFCQ 1CSQA 1K83H 3F8TA 4AQYL 1Q82C 1YEZA 1E1TA 5M3MH 4JI2L 5C4XG 4L5TA 4A3KG 4AQYQ 4OX9L 1TXYA 1TWHH 1E1OA 1YIJA 1EUJA 1WFQA 2Z0SA 4R4QA 2PI2E 1NBWA 4GLVB 1EOVA 4HIKA 3E0EA 1D8LA 2K14A 2IY5B 3J7A5 3HOZG 3NENA 2I5HA 1VQFA 1X3FA 3ZJYC 1WCMG 4A75A 1AH9A 1HNZL 4LUVA 2K5VA 4DK3C 2I5MX 1SMXA 4LF7L 1YZ6A 5C3EG 1EIYB 3J81i 4JOIC 5IP9G 4A3BH 3GD7A 2GVBA 1SLJA 3HOWG 2R93G 4LF7Q 2K52A 3G4SA 4DV6Q 3J80c 4B3RL 3TEHB 5JJIA 2KCTA 4R4TA 2KCMA 1XTDA 2F52A 5J3BA 1S3OA 4BBSH 2XGTA 4AYBE 3KF6B 1VQKA 2ES2A 1VQBA 4GLAC 3S1RH 2HT1A 4B3RQ 4JOIA 2B3GA 1AE3A 1QUQA 2V1CC 3H3VH 1I3QH 3KFUA 1HZCA 4DV4L 4BA1I 1YJWA 4A3IG 4DR5L 5ELNA 3CQZH 2VQEL 4DV4Q 2JQOA 3CC7A 1Y1WG 2N8NA 3UDGA 4K0KQ 4NXML 1KXLA 4X62L 3I4MH 4O0AA 2CQOA 3CPWA 1VQ8A 4BY1G 1IL2A 1FL0A 4A3FH 1XMOQ 2NVTH 4DV0Q 3F1ZA 2JA6G 1PH4A 1PVOA 1O7IA 3HOVG 3TRZA 3IRBA 1YI2A 1YHQA 3GTLH 2UXCL 3TQYA 3K0XA 1OXUA 1L1OC 2VY3A 4A3GH 4JV5L 1WOCA 3RLNA 3I55A 1U5KA 3PUZA 3AFQA 4OWTB 3KJOA 2PQAA 4YCVA 4A93G 3H0GG 4JV5Q 1X6OA 3CD6A 3FHWA 4LF5L 4DR7L 4A76A 3UE1A 5M5YH 4LF5Q 4DR7Q 4IFDI 1K8AC 5IP7G 1J6QA 3S24A 1TWFH 2AWNA 2XTIA 5GAHC 4JI1L 2KHIA 1WJJA 3W1GA 4DR6L 1K0RA 1AE2A 5IYBH 1QVFA 3CPFA 4JI1Q 4IPHA 1YHAA 1L2FA 3L7ZC 4DR6Q 2IT1A 2NVYH 1T9HA 2QGQA 1YJ9A 1VQ7A 3PO2G 1PH7A 4JI3L 4GS3A 3FKIG 2RHQB 5FJ8G 2NVXH 1N32L 3UE0A 3PIPA 5IYDH 2YTXA 4TVAB 1TWGH 1Q81C 2UXBQ 1QUQB 1CKNA 3ULJA 3HOUG 2KENA 1N32Q 3T1HL 2JA8G 1X9NA 4OO1I 5FLMH 1NJIC 3M3YH 3K8AA 2R92G 3PIOA 1NE3A 1VQEA 1MKHA 5M3FH 4GN5A 1XJVA 4YWMA 3JAMi 3HOXG 1GM5A 2CKZB 4X65L 3RN2A 3H3VI 4A3DH 3J80i 1A62A 1V43A 3M9BA 4X65Q 2PMZE 3S1MH 4DR2Q 4BBRH 1N9WA 4APVA 1Q46A 1K3RA 4LW1A 4XIGS 4DV3L 1X56A 2NN6I 4MNOA 3CCQA 3HFZB 4DR1Q 4NXNL 2RCNA 1QZHA 1Y1VH 1EQQA 3I4OA 2RHSB 2N49A 4P75A 4HIMA 1PYBA 3FP9A 1GD7A 2BA0A 4JI0L 1DGSA 3PF4A 4NXNQ 4DPGA 4YY3L 3K81C 2PQAB 1KRSA 2E5LL 1X3EA 1TWCH 4JI0Q 4DAYB 4LF8L 5ELOA 4A3CH 4A3JG 2UUCL 1PH9A 3CC2A 4L5RC 3PGZA 5EAYA 2E5LQ 4B3SL 1VQJA 1YVCA 2A1AA 4LF8Q 1MJEA 4BY7G 2UUCQ 1MJCA 3E9IA 2A8VA 2UXDL 4B3SQ 3GTOH 1PH1A 2LXKA 4C3JH 2ZM6L 1BVSA 3AFPA 1UE6A 3M4PA 4IFDJ 4QY7A 4DNIA 2IHEA 2L15A 1VQ9A 1UE7A 4JI2Q 2ZM6Q 4A3LH 4Y7NH 1M1KC 2OTLA 4WJ3M 4DKAC 1XPUA 3PV0A 3HOYH 4OX9Q 1NMGA 2K75A 1N8RC 5M3MG 1VCIA 1PFSA 4P74A 1VQNA 3EN2A 1GVPA 3PUWA 1X3GA 4JC0A 1HNXL 4DV5L 2ZTEA 1SRUA 2A19A 4IFDG 4LF9L 2PI2A 4PZ6A 3RZDH 3CCUA 1CKNB 2HIVA 3L2PA 4LNQA 4LUZA 2EXDA
chains in the Genus database with same CATH superfamily
4QIWE 1SNQA 1X3QA 4IALA 4QGUA 3KLWA 1CKMA 2NB0A 3E9HA 3AU7A 1QZGA 1RF2D 2Y0SB 4LFAL 2IPKD 2K6AA 5C3EH 4L5SA 4OO1H 3J81L 2CFMA 1CT1D 1VQCA 2J7ZA 4ALPA 4A3MH 3K7AH 1KABA 3GTQH 4BBSG 1DJRD 1STAA 4NPSA 1IYJB 1FVIA 4XT3B 5K36G 4YWLA 4HJ7A 1WD0A 1D5ZC 3S9WA 4OWWB 2B2TA 1JWSD 3GTKH 1NCVA 2Z8LA 2I0QA 2CQAA 1VQOA 2EY2A 3MEFA 2JA7H 5IT9E 1KAWA 2AKWB 2JYOA 1O7LA 4A3GB 3I4MG 3S15H 5C44G 2ZTCA 3L3OC 3H09A 3FPPA 4GKJQ 4DU9A 3TSSA 3O13A 3U4VA 2V4DA 5CC4A 2BE5C 2NUCA 2CCZA 1I5FA 1Z9FA 1B70B 1S4ZA 4OELB 2Z6BA 1QCBD 1ASZA 2JEAI 1IXRA 2RSNA 3S2DB 4IQZA 4PG3A 2ATWA 1PZJD 3G71A 3PIP3 3K57A 4JBKA 1AN8A 2EY1A 4JBJA 3K6OA 3QB3A 1X54A 4UP8A 2PNHA 4P72A 4JI8Q 1TWGB 1PDQA 4UPAA 2PQEA 4KD4A 1I94Q 3F2DA 3A55A 1UE1A 1STBA 1DOMA 5FO9B 5IGBA 2AQ3B 1IYVA 3LGJA 3NPPA 5IYDG 2RDGA 5D65A 2UU9Q 2JP1A 4P73A 5C0XI 5GADC 3NBHB 2ZJQA 2BDOA 1OXVA 2PW7A 3J7ZC 4AYBG 3V2TA 4F87A 1N34L 2K4KA 3FPUB 3J80L 4DAPA 1ENFA 2ICIA 3S2HB 4QCLA 2EVBA 1HQRD 5CBEE 2SEBD 2E2DC 3H6MA 1PZID 3RLFA 3DM1A 4YY3Q 4K14A 1E2ZA 3CHBD 1GUWA 4IJLA 2PZTA 4ZUJA 1IBML 4ABNA 3KDFA 4S3SA 3CU7A 4DXFA 4A3CG 1WTQA 2NZHA 1FNUA 4Y7NB 3AEVA 1W6KA 1EY9A 1V1QA 2VQFL 3ICEA 5GROA 4H7BA 2YU9H 1HZAA 2QDLA 3HKZG 1VF5C 1S5BD 4DV1L 1B2TA 3CCMA 4DUYL 1CQFA 2HCIA 1VQDA 3Q22A 3HOYG 1G6PA 2KEEA 3T1YL 3GTGH 4X64L 3KLSA 4G57A 1IBKL 2F0TA 2B29A 2R3ZA 3VR6A 4QL5A 4JI5Q 4RA8A 4A3MB 2K01A 3K7AB 3LWEA 2R6GA 3GTQB 1EQRA 2Q2HA 1JC7A 2NVQH 4H0LC 4DV6L 4CDCC 5HURA 1G2SA 3H15A 2K33A 1DYQA 3GTKB 1KC8C 3RLOA 1JB7A 1FJGQ 2NZOA 2EQSA 5C0XG 3K7UC 2JA7B 4L8JA 3CCRA 1S72A 5I6WA 4KY6A 4DAMA 2F0MA 3L9AX 3P1HA 2F4VL 4DV2L 3D4DA 3DUZA 4K5WA 4R8IA 1M90C 3S15B 4JYAQ 3BDCA 4BY1H 1XMQL 4K0KL 3M4QA 2MQHA 3NTIA 1H9SA 4DR3Q 1XMOL 3RD4A 3TP6A 4KTAA 3PUVA 1P8LA 4J1MA 4HJAA 3EIVA 4A93H 2KEDA 3H0GH 4IPGA 1H95A 4XTCS 2GN5A 3GTPH 1STYA 2H4OA 3PUYA 1JJGA 4A3EG 4R4IA 3WOFA 4X66L 1IKMA 4JI6L 3C1EA 3ER0A 3TP7A 5GAEC 1HNWQ 4IN3A 4B3TQ 3MWYW 4V190 3G48A 4OONA 4IUPA 3R3OA 1SE3A 1UAPA 4GKKL 1OXTA 2CWPA 1NY4A 2F1MA 3FKIH 1TS2A 4DR4L 1KNEA 4JG2A 2F0EA 2R92H 2FFKB 3OSOA 3NQIA 2AMCB 1EYDA 1Y14B 4H02A 4BA2I 5C3XA 3ERQA 4DK6C 1WYDA 4IJHA 1ONLA 5IIFA 4RGMA 2EY6A 2F0KA 5FLXc 4HJ8A 4A3BG 1IBLQ 3GV6A 1O78A 2QA4A 3M4YA 1X32A 3KLSX 1LTID 3OIQA 1QE6A 2C9OA 2WB1E 2AQ1B 1UEAB 3A7AB 3K5NA 3BU2A 4X3KA 2VUMG 2UUAQ 4LK1C 4DR1L 2ZTDA 2X6GA 4DR2Q 2DN8A 3U4ZA 4DNRB 3BJUA 3PCOB 5NUCA 4G4KA 3PO3G 2F0OA 5LMNQ 1K8MA 4IO9A 1BBUA 3VA5A 2F3IA 2F4IA 4KHPL 2R7ZG 3OTOL 4GNXB 4GZYC 2Z4IA 4LF4Q 2YU9B 3KF8B 1DM0B 4FDBA 3OW2A 4C1NK 2WAQE 3EQLC 2K5WA 3K5MA 1B44D 3C3LA 1K83H 1RJTA 2ICEC 2ZXOA 4FVMA 5C4XG 2X69A 4OX9L 1TS4A 4RKLA 3SE0A 4CJ1B 1E1OA 3SDZA 3AMUA 1CK1A 1UNSA 4R4QA 4GLVB 4HIKA 1SNCA 1G6ZA 2VXWA 3HOZG 1VQFA 4HAEA 5AFWA 2NVQB 2HQEA 4KKTA 5C3EG 1EIYB 2GVBA 2R93G 2K52A 3BVZA 3G4SA 5JVG3 4K8IA 4BBSH 4AYBE 3D6CA 3KF6B 1VQKA 3S1RH 3A8KE 5K36H 1AE3A 1ET6A 2V1CC 4FP5D 3H3VH 1I3QH 5IOCA 4BS9A 3R2TA 2RBMA 4BY1B 4N8FA 3NTHA 4A3IG 1SNMA 3CQZH 2RVLA 3BZDB 2R61A 4X3UA 3I4MH 3CPWA 4A93B 3H0GB 5D14A 4DV0Q 1F9RA 1SFOB 2JA6G 4C3IG 2A6ED 1WTXA 4CBVA 2EZVA 5KRUA 1YHQA 3TQYA 1U5KA 3PUZA 2PQAA 4YCVA 1LT3D 3ITPA 4HSVA 4LF5L 1FNWA 5DM63 5M5YH 4DR7Q 4P2CB 4RGNA 5IP7G 3DWPA 4TKOB 1LT4D 4DR6L 3FKIB 1QVFA 2OEOA 4Q5VA 3L7ZC 4KN4C 3HOUB 1NSNS 1T9HA 2QGQA 1K0SA 4KMUC 2F03A 2JA8B 1VQ7A 2R92B 2RHQB 5FJ8G 2NVXH 3UE0A 2PCFB 3PIPA 5IYDH 1ILPA 4XYQA 2UXBQ 3ULJA 2K04A 1N32Q 1ML0D 3M3YH 3K8AA 3G6JB 1NE3A 5M9OA 3GP7A 1D6EC 4GN5A 1TS5A 1IYUA 1A3UA 4XQJA 5J39A 2JXMB 5I9PA 3QOLA 4XQNA 5ELCA 2PMZE 3S1MH 1QG7A 1N9WA 2M9VA 1A15A 4LW1A 2NN6I 3CCQA 1QZHA 4HIMA 3MFGA 4G7OC 5LHY1 3PF4A 4F8MA 3VYRA 1DZ1A 4YY3L 2MGSA 2E5LL 1TVXA 1TWCH 4JI0Q 3P7JA 4M1UB 2XIWA 4IUQA 4A3CH 4A3JG 2JN4A 3H91A 4B3SL 3MXNA 1BCPD 1MJEA 1K83B 3SHLA 1PH1A 1B3QA 2LXKA 1BVSA 4CDEC 1UE6A 1BO0A 4DKAC 1XPUA 2BOSA 3HOYH 1NMGA 4HCSA 5M3MG 1PFSA 2OT2A 4JC0A 2ZTEA 4DNTB 1SSOA 3OMCA 3NTKA 4LNQA 1HUNA 3D3RA 5CV4A 3KBXA 3HKSA 4DV5Q 4YCWA 2B39A 5E4WC 3R93A 1Y8NB 1HNZQ 1BBXC 4LF9Q 1LTTD 4J15A 3NQTA 1RCVD 4K5VA 1A0IA 2MFIA 4BBSB 1RTOA 1C9OA 2Z1CA 1ENAA 3S1RB 2B2YA 3BYTB 5BR8Q 3CW2C 3MXGA 1BCPB 1STGA 4LFBQ 1I3QB 3CAMA 2D2CC 1PA6A 5C0XH 5KIXA 1MSHA 3CQZB 1G291 1EIGA 2XWJB 2MJ8A 5H1SE 2K5NA 1JT8A 2QCPX 3I4MB 5C44B 3CCVA 2JSOA 3NXWA 4NXMQ 2WP8J 1VQ4A 3A8JE 4OGQC 5BN3A 1Y1WH 3MC0B 3I2ZA 2NN6G 1QOHA 5CGKA 5C6AA 1MD2D 4A3FG 2G9DA 3STBD 2UXCQ 4GLXA 1SEBD 3QO2A 3FMCA 2VW9A 2L1BA 5M5YB 3K58A 1LACA 2E2IH 4A3EH 4YIJA 4KV6A 4GNXC 2K5HA 2CHBD 2MHVA 2F0FA 2TMPA 1XWEA 3E5SA 3FVQA 3KBGA 4AIMA 2IWHA 2FXQA 1SXTA 1Q12A 2B8GA 3GO5A 5DNFA 1HNWL 4OWXB 1XNQQ 2BH8A 4O42A 2OQKA 2DNEA 1B8AA 2NVXB 5CV6A 1RDPD 5DEHA 1LT6D 1I6HH 4JI3Q 3OWFA 1B53A 4FNFA 5IGFA 3RR5A 1RIPA 2WKDA 3M3YB 1SNOA 4AYBB 1CHQD 3KJPA 3W5OA 4DFAA 2E2HH 1HA6A 3T1HQ 1FR3A 1VQLA 5IWAQ 3CCJA 1SE8A 4JI4L 2Z6KC 1JJ2A 3DLLA 2VZAA 4YCUA 3HP3A 4A3BH 3S1MB 5FLMG 2EJGC 2F0WA 1I4RA 1E24A 5M3FG 4FYDA 3CC4A 1XYIA 2OWOA 5COYA 1X55A 4DV3Q 2VUMH 4EGVA 5J1ZA 4K5XA 4K2LA 4HMIA 1TWCB 4JBMA 2E74C 3PUXA 1DOLA 2UUAL 3PO3H 1PMRA 1Y1VG 4DR2L 3TBIB 2F0HA 1VQPA 2VNUD 3K5LA 3QG1A 1PLFA 3G7LA 1YBYA 1HZBA 2R7ZH 3S16H 1EYGA 2BDNA 3HKZB 3SK4A 1CUKA 1BBWA 4A4IA 5AJ3Q 4B08A 2HUGA 3PF5A 4QQBX 1J5EQ 3HOYB 1SN8A 2EDGA 1PHJA 2KBNA 2RKSA 2JJQA 4HJ5A 3D6WA 5C4XH 5I2YA 3AB9A 2CWAA 1XPOA 1K8GA 3TS0A 2MO0A 1LTGD 3IKJA 3I91A 1LV9A 1G8ZD 3HOZH 2FMMA 3CCLA 1QWYA 1B9MA 1DOKA 1N33Q 3KUPA 4NP5A 4WORA 2AUKA 4HJ9A 1C48A 3NEMA 4RGOS 2R93H 2DJGC 1HRJA 2KUMA 4JI7Q 1QNUA 5C0XJ 1T5XD 1I4QA 2JEBI 3D4WA 3VA7A 2QW7A 3PMFA 2PMZB 1DONA 3BYYB 5IT9c 2GA4B 1TQOA 3P75A 2A6EC 3BS1A 1PH3A 3UDXA 4LF6Q 5LMUL 3T13A 2WB1G 4L63B 4A3IH 4PMWA 4BWGB 4YHHQ 3P20A 5E7NA 1AFPA 3KDFB 1XNRQ 4IUTA 1R9TH 4IOCA 1QVGA 2F0JA 2WIIB 1STNA 2JA6H 4C3IH 4JW0A 4UP7A 3I70A 5DLQE 4DV0L 2E2IB 1LTBD 4A3EB 3DM3A 5ELBA 3BDLA 4TQUS 3HRZC 2WAQG 4HEDA 1TWAH 1YHBA 1VDZA 2Z9HA 1EWIA 4X3TA 2WACA 2LXJA 5IP7H 3ERSX 1WD1A 3J7AF 3J81j 4WJ4A 4KD3A 2RQXA 4L6TB 1Q1BA 4GOPA 1D1IA 1DXMA 5DM73 4C56C 5CV7A 1I6HB 3TS2A 2OCEA 1RODA 2RSOA 5EPKA 1ESFA 1WVLA 4QJFA 4B3ML 1GKHA 2N78A 4TRDA 2B2VC 2B2UA 4FF2A 3J81c 2E2HB 2NZ1D 4BXXG 5FJ8H 3EJIA 2DY8A 2B63H 1HR0L 3M4OH 4X3SA 4A3BB 4KJNA 1SMYD 1GHKA 2UXBL 3DMUA 5A35A 5K5PA 3J81E 1AP0A 4KY7A 3JAML 1OTCA 2RA4A 1W3SA 4DV7L 2VUMB 1TIID 2RF4A 3M7NA 1BCPC 3N6RA 5GQOA 1PH5A 4IOAA 5L37A 4YWKA 3PO3B 2CW0D 1H9SB 5EPLA 1C0AA 2HHHQ 5EKIA 3I4NG 1GUTA 1XTCD 5I2XA 2GVAA 4K8JA 2R7ZB 3GTOB 1PYSB 3S16B 1MIUA 1SYDA 1TR5A 4A3JH 3M85A 4DUZQ 1E2VA 1E3PA 1F2YA 1QILA 2UUBQ 1X65A 1N36Q 5C4XB 1LUZA 2O2LD 4QF4A 1NR2A 1SYGA 1V1PA 2K32A 2DJFC 2JA5G 4LFCQ 1CSQA 4AQYL 5JVH3 4UHVA 5M3MH 3SVMA 3HOZB 3QWNA 3BDOA 1PXUA 1TWHH 1YIJA 1WFQA 4EQOA 5C3EB 1EEID 2K5QA 4K6LA 4PV1C 1D8LA 2K14A 1W6JA 1JWMD 2IY5B 2R93B 1GJXA 3K59A 5F2DA 1XX8A 4KHVA 1WCMG 1AH9A 1HNZL 2OXPA 4DK3C 1BCPF 4LF7L 1YZ6A 4O1NA 3J81i 4JOIC 5IP9G 2A6HD 1AW7A 3SR1A 3J80c 4R4TA 1XTDA 4A3IB 4FO2A 1VQBA 4B3RQ 3C46A 1HFGA 1YNJC 3MEHA 3JAME 5JAVA 1V8QA 3J80E 1HZCA 4DV4L 1R9TB 2I07B 2JA6B 1D1KA 4C3IB 1IL8A 1Y1WG 4NXML 1I6VC 1B1ZA 2AQ2B 2NN6H 3MVVA 3N52A 4WRDA 4O0AA 3Q23A 1VQ8A 2A69C 4A3FH 2NVTH 1TWAB 3TRZA 3HS0C 2F0VA 1KLUD 1YI2A 2UXCL 3GTLH 1OXUA 3A56A 1U9RA 5J22A 3VYTA 4JV5Q 1X6OA 1L0XB 4IZ8A 3UE1A 4QIWB 1LTSD 4CDFC 4IFDI 4N9TA 3S24A 1TWFH 2EXZA 2XTIA 5JPNC 2KHIA 1EY4A 3CRLC 5BN5A 1AE2A 2Q8TA 3CPFA 4JI1Q 1YHAA 5KYLA 3M4OB 1NR4A 3MHBA 1PFBA 2B2WA 3GV3A 2ZXRA 4JI3L 4GS3A 2HDLA 2LS01 5KNBA 2ENBA 2G9HD 2YTXA 4TVAB 2L9HA 4H44C 1CKNA 3T1HL 1X9NA 4OO1I 5FLMH 3X3NA 1MKHA 5M3FH 4RH6A 3JAMi 3HOXG 3J80i 3NE5B 2QF7A 1PRTD 2L55A 1V43A 4RCNA 4X65Q 3R2IA 4BBRH 4CGYB 1K3RA 4XIGS 2L5TA 4DV3L 2H1EA 2KJXA 3NSWA 4MNOA 2XWBB 4A3JB 1MSGA 1Y1VH 2KCNA 1EQQA 2RHSB 3F2UA 4P75A 1PYBA 4K2KA 1GD7A 4XQQA 4IUUA 3T51B 1DGSA 4NXNQ 3VYUA 3K81C 2PQAB 2K5DA 1X3EA 4R8NA 4ZUIA 3SK6A 1B4OA 4L5RC 3PGZA 2EYMA 4LF8Q 1EY5A 4RGTA 2UUCQ 1IW7D 4NKLA 2A8VA 5M3MB 3GTGB 2K28A 2I46A 2ZM6L 3M4PA 1TWHB 2IHEA 3T4AC 1A6XA 2IJ0A 2L15A 3QJYA 4ME5A 4WJ3M 1TY2A 1QB5D 2K75A 2K7VA 2LY7A 1N8RC 3I4LA 3PUWA 4FF1A 2A19A 4IFDG 2PI2A 4CKEA 3RZDH 3CCUA 4RCOA 3L2PA 2HCCA 2ASBA 2N3SA 1CI3M 3CCSA 2N88A 2F0GA 3TP5A 1K73C 3C1FA 1SYCA 3PSIA 3AYHB 3GDEA 3IL8A 4KLKA 4G7ZC 2Q2IA 3MTSA 2RDFA 4LFAQ 1PH8A 3CRKC 2J0TD 4GN4B 1FNVA 1GO3E 1OXSC 1U4PA 2JK8A 4G7HC 1TT2A 2CH4W 4P71A 5A2QL 2VQEQ 5JEAG 4YHHL 4A3FB 2NVTB 3IFDA 5KNCA 3GTPB 3SEBA 5ELDA 3GTLB 1F2LA 4N9PA 1EEFD 4GKJL 4JK1C 2J4XA 4B9WA 3S14H 1STEA 3ULLA 1QJOA 2DUDA 3VDYA 1L1OA 1V1OA 1TWFB 3VR4A 2NTTA 3K0YA 1YITA 4DXGA 4CDDC 1PFNA 2D5DA 3OHXC 1SMYC 4HR7B 2C5CA 5IGEA 1PV4A 1LTLA 3HZXA 4KI0A 1VMPA 4JI8L 4FXDA 4HIDA 1I94L 3DWQA 5CORA 3DXJC 4BXXH 2A68D 2QEJC 1ZYRD 2B63G 1CSPA 1BNZA 5I4DA 5C3WA 2CW0C 1B3AA 1FGBD 3VYSA 2KHSA 3RNUA 5GAGC 2UU9L 4HCEA 1C7YA 2ZT9C 1RKNA 2F0LA 5M3FB 2CH4A 3SGIA 4RG1A 1EWCA 2PZUA 3KK7A 1SYEA 3U50C 2OTJA 1HTLD 1NMFA 1S5FD 4BBRB 5CBAE 2PPBC 3VR2A 2AHOB 3B6YA 5DAUA 1Y1VB 1HR0W 2FINB 4A3DG 3ULPA 2Q2TA 3T53B 4EX5A 1JOQA 2Y0SE 2Z6KA 3I4NH 3OIPA 2PO4A 2HQLA 4MN3A 2R7DA 2IX0A 4OHJA 4OIKA 3A8IE 5FKAC 4F7XA 1ET9A 3W3AA 4I65A 5T1GA 3QOJA 5EKKA 2YTVA 2F0IA 3CF5A 1EY6A 5EQ0A 4DGZA 4R1JA 3AQQA 3UDIA 1E2WA 2IL8A 1Q86C 2EYPA 1HFNA 5JJLA 2F0QA 3TREA 2JA5H 1CQVA 4C3JG 1HPCA 1WTHA 2A6HC 3J7AV 3TDQA 4IPCA 2VQFQ 3RZDB 3LWUA 1GUGA 2FHTA 1HNXQ 3BZCA 4DV1Q 1E7ZA 1EY7A 1HJPA 4DUYQ 1D5MC 1Q1EA 1DD2A 4EQ5A 2QEXA 2ALYB 3BVMA 1WCMH 3T1YQ 4PMCA 1KD1C 4JI5L 4UAIA 3T16A 4X64Q 1T5EA 3EA6A 5IP9H 1IBKQ 1FD7D 5IYCH 1FYCA 1JMCA 4LWCA 3W2DA 2DNCA 2WB1B 3VR3A 3V05A 4HSPA 5KGUA 2WKCA 4I7ZC 5C4JH 1JICA 1FJGL 3A0JA 3I56A 1SYBA 2XRSD 4RHRA 3F2CA 4J8QA 2E75C 3KLRA 4ZKCB 5IY0A 4EVOA 3NBIA 3G6EA 2D0OA 4JYAL 3CXCA 4JBWA 4EQPA 2PYKA 1K8OA 1E22A 2XVSA 1LM0A 2H5XA 2WAQB 1EY8A 2F4VQ 4DV2Q 4DR3L 3S14B 3TZUA 5FO8B 4PMBA 1HUMA 3DWAA 1XMQQ 4ODGA 5I9OA 4M8AA 4FXKC 4C2MH 1F2ZA 4WJWA 3TMEA 5IE8A 4POGA 1BOSA 2D62A 2F3VA 3D0FA 1VQAA 1O80A 3MAQA 1S40A 1VQGA 4B3TL 1HA5A 1ENCA 3RMHA 1HCZA 4XYOA 1F9QA 3NELA 4X66Q 1XPRA 4JI6Q 1D2BA 3D4RA 4JCVE 3I3CA 2MUYA 5BN4A 2DY7A 5KNDA 4GKKQ 3S2DH 4QUCA 5CV9A 3NHHA 5JJKA 1YNXA 4UP9A 4ZRZA 1U0LA 2RCFA 5JOBA 1U4MA 3BVGA 1JJCB 1K28A 1RL2A 3SK5A 1SJED 4DR4Q 4C3HG 1PTOH 3HOXH 1IBLL 1WI5A 3I4NB 1KQSA 5HY6A 1VMCA 3I72A 5M5WH 4BBRG 3RN5A 1B7YB 1CTMA 1G51A 1IW7C 3VR5A 2B8FA 2VB3X 1F9SA 1SNPA 1I50H 1KDCA 2L4NA 1WTVA 2VS1A 4NB3A 1JORA 2ZJPA 4ZQ3A 5LMNL 1UEBA 2WFWA 1VQIA 3FRPB 4ID6A 4OXPA 2EIFA 1EIFA 1SAPA 3MXPA 3I7FA 4LF4L 3QIAA 3QR8A 3S2HH 2JA5B 1AZQA 1Q8KA 4ZKBB 5FK9C 4GOPB 1KIXA 1NAPA 4KHPQ 3KYHC 1VQHA 1J8IA 3OTOQ 3A5ZB 1PRTF 3DHQA 1NTGA 1PH2A 2IX1A 1KL9A 4I7AA 2I5LX 2ZJRA 2O5IC 5C4ZA 4E6IA 1WCMB 1KDBA 1BDOA 4L5TA 4A3KG 4HN7A 4IFDH 2Z0SA 3M7GA 2EYOA 2PI2E 1EIHA 1NBWA 2K05A 1EOVA 2KECA 1DCZA 3NENA 2HDMA 4QB4A 3ZJYC 1AZPA 2WV6D 4LUVA 2K5VA 1SJHD 5C4JB 1SMXA 2B2YC 3E0JA 3HOWG 1SLJA 3SK8A 5JJIA 2EYJA 4CKBA 2F52A 2HT1A 3NUCA 1Y1WB 2KA7A 4JOIA 1QUQA 2SNMA 1J9OA 3OOCA 3LX0A 3EVQA 3KFUA 5JEAH 3E3XA 4BA1I 2N55A 1YJWA 1EZ8A 3NP8A 4QMGA 2VQEL 2JQOA 3CC7A 3UDGA 4ZAIA 5C5MA 2A73B 4DA2A 2EOTA 1KXLA 4C2MB 1PTOD 2XN9C 3HGBA 1IL2A 3U9OA 3BG3A 1CA6A 3F1ZA 1PVOA 3TZDA 3HOVG 1V1PB 1ZXTA 1L0YB 2K1BA 4OL7A 4RKBA 2A68C 3RLNA 3I55A 1ZYRC 3IFTA 4ULLA 3AFQA 1BXTA 2X6LA 4DAYA 3FHWA 3CD6A 4DR7L 2FJ2A 5EGTA 4LF5Q 4OEMB 1TY0A 2EYFA 2F0UA 5CV8A 1CHPD 3J7YW 5CV5A 5CMDA 1OO9B 5IYBH 1L2FA 4DR6Q 2IT1A 1MHWC 2NVYH 5FO7B 3FEWX 4NW2A 3PO2G 1PH7A 1PTOB 3HOXB 1N32L 1Q81C 3Q6SA 1JWUD 1GHJA 5M5WB 1NJIC 3H3VC 1Q90A 1VQEA 3FDTA 4A3DH 1GUSA 2VB2X 2SOBA 1I50B 4ZK9B 4DAVA 5D3IB 1R4QB 3C2PA 4APVA 1Q46A 3HFZB 2RCNA 1AEXA 2F0PA 3I8ZA 4JI0L 4DPGA 1KRSA 5E4XA 1I4PA 4IUNA 5ELOA 1LTRD 1M8AA 3CC2A 2E5LQ 5EAYA 2A1AA 1YVCA 4BY7G 1MJCA 1PFMA 4B3SQ 4C1NI 4C3JH 1H9KA 1H9JA 1GOZA 2F3WA 1O7ZA 4IFDJ 1KLGD 4N8X1 1VQ9A 4JI2Q 5IODA 1ICWA 1NNXA 1VCIA 1HNXL 1GVPA 1R4PB 1X3GA 4DV5L 4FF3A 4LF9L 2O5JC 3URYA 2EJFC 4J6HA 1CKNB 1EL0A 4LUZA 1ICFB 2Q2UA 3JC66 5IYCG 1PH6A 1HZ9A 3JAMc 3A5UA 4KK7A 2PNRC 1YNND 5BR8L 2G5DA 5IGGA 4LFBL 3STBC 3K5OA 5JEAJ 2B2TC 1EY0A 4EQNA 1KRTA 1VQ6A 2Y0SG 1SR3A 4R4CA 3ONAB 2EPBA 2YV5A 4ME3A 3U58A 3NK9A 4DR5Q 3CMAA 2KQ3A 2F0NA 3CCEA 3NBHA 2E8GA 1F9PA 5FLXL 4RWSC 5CR3A 5EBCA 2EYHA 4X62Q 2BH2A 1VQ5A 2NWGA 1JE5A 1GUNA 3EBEA 4CHTB 3MZ5A 2EE1A 3WDNA 5EJWA 4CJ2C 2MO1A 4IURA 1EFWA 1RTNA 1U4LA 1EWHA 1PZKD 4JPBW 1O7YA 4POFA 2OF1A 4A3GG 4Y52H 4IUVA 4FF4A 3S1NH 4GOPC 1SFOH 1SBBB 4LAAA 2KCCA 3MXUA 1XNQL 2B63B 1WTWA 2NVYB 4UY8C 1TU2B 2YYZA 4V0BA 3D31A 1CA5A 5E3FA 1U4RA 1UE5A 3ND8A 3X3MA 2B2UC 2C35B 2VL6A 5G3LD 1IZ6A 1EU3A 1HXYD 4CJ0B 3PIO3 4NDXA 1F77A 1WTPA 2YTYA 4R4OA 2RDHA 5T1IA 1XXGA 2LSSA 1S5DD 5IWAL 3F2BA 3WWVA 4C3HH 4A3DB 1SYFA 2PZWA 1ASYA 1LTAD 2DGYA 3HOUH 1OXXK 2R7FA 1ZEQX 2NYZD 5HGQA 2JA8H 2SNSA 1SDFA 1SROA 4F88A 4JI4Q 1D7QA 1KNAA 2JE6I 3RZOH 2ID0A 4U68A 2LMCB 2HIXA 1M4VA 1G2TA 1LT5D 2D0PA 5M5XH 3PQIA 3K80C 1GXDC 3E6ZX 1V9PA 1B50A 1A63A 1C8CA 5FLXE 2O4XA 1L1OB 1LYLA 1SE4A 3S17H 4RHSA 4TSSA 1EYAA 4C3JB 2MP1A 5AJ3L 2L11A 4KHZA 5JJZA 1J5EL 2XSCA 1I4XA 3R8BA 2UXDQ 3CMEA 1KTKA 5EKLA 5LMNW 1A8VA 1Z47A 4LUOA 1PRTB 3IAYA 4O2DA 4B9XA 1EZ6A 4A3KH 3OMGA 1K9MC 4MZ9A 4A3LG 1UWVA 2OQ0A 2XRQD 1Y69U 1QNKA 1BKBA 1JQYD 1N33L 1CM9A 4KN7C 3A74A 1A2TA 1WTOA 1II3A 2KOLA 3BZKA 1MGSA 2E2JH 4XDXA 4JI7L 4PZ8A 1JE4A 2IHFA 3OYYA 3HOWH 4IPDA 2HIVA 1PTOC 4OO1G 4LF6L 3S1QH 3I90A 5EBDA 2E76C 4HIOA 4A3MG 1X3PA 3Q8DA 3TP8A 3HG9A 2AWOA 1HH2P 3L0OA 3MXNB 1XNRL 5TSSA 5LMUQ 1VQMA 4MTNA 5IGDA 2QKIC 5HGTA 4OIJA 2D9UA 3GTJH 1VF7A 1CKOA 1P16A 4DK1A 1W2BA 4MTKA 2JA7G 4U673 3HOVH 3DEOA 1I4GA 4CKCA 3EFXD 1L0WA 2FMCA 5C44H 3S1NB 4Q0FA 3EROA 4NMZA 2NTSA 4KY5A 3U9SA 3NWSA 4KKSA 5KYIA 4GNXA 2JA9A 3KF8A 1A3TA 1NUCA 1ZKOA 2PW5A 5IGCA 1IKLA 5IYBG 3OW7A 1KAAA 3CP0A 3HKZE 2Q8IB 1Z6HA 3HEJA 1F2MA 2B2WC 1PTOF 4RMFA 5C4HA 4WFN3 1Q7YC 1JOKA 4ZCKA 1H9MA 2MNAA 3PO2H 2BE5D 4MIUA 4C3HB 4B3MQ 4ILWA 1LO5D 2IW3A 1IHZA 4ZYSA 3RZOB 1QVCA 3KOJA 1HR0Q 5LL6X 1TKWB 1HHVA 1EU4A 1YJNA 4GN3B 2Z4HA 1JOOA 1N34Q 2HD3A 1FGUA 5M5XB 4DV7Q 1I4HA 2HHHL 3H94A 4JVZA 4AH6A 1E0BA 5A2QE 5LL6S 3W1BA 2MPMA 2NBFA 3KF6A 5ELEA 1KHIA 3S17B 5FOBB 4L5QA 1A2UA 4DUZL 1CZGA 1IBMQ 4H13C 3RUZA 3LNNA 4K6DA 2UUBL 1N36L 1VS0A 2L12A 4BY7H 1PYWD 4X6AH 2QDBA 2WINB 2KHJA 3GTMH 2BA1A 2KVMA 3ND9A 3UDFA 4A3KB 5C5LA 2EY5A 4LFCL 3WOEA 1D5XC 5KEEA 2K50A 2F0SA 1YNNC 4PZ7A 2P5ZX 1SNDA 3F8TA 3NWTA 1Q82C 1YEZA 1E1TA 1RD9D 4JI2L 2CVRA 3Q0AA 4AQYQ 1LABA 1TXYA 3TN2A 1EUJA 3UI2A 2E2JB 1TS3A 2A74C 3Q24A 3E0EA 2LFNA 2IX3A 3HOWB 3CKIB 3T56B 3J7A5 2I5HA 1X3FA 4ZLTF 4A75A 3A7LA 1Z7TA 2I5MX 1HTPA 3S1QB 1BR9A 1JCKB 3SXHA 3GQBA 3GD7A 4LF7Q 4DV6Q 4B3RL 3TEHB 1JB3A 2KCTA 1ESRA 2KCMA 5E1FA 5J3BA 1S3OA 2XGTA 2ES2A 1C4QA 1RHPA 4GLAC 2B3GA 2M00A 2A5HA 5EPJA 1GUOA 3GTJB 4PNYA 4XT1B 2ZXPA 2Q8RE 4DR5L 5ELNA 3HOVB 4DV4Q 5I6YA 2N8NA 1B9NA 4K0KQ 4X62L 5ELFA 2CQOA 1Q3LA 4BY1G 1FL0A 1XMOQ 2SDFA 1PH4A 1O7IA 4MHEA 3IRBA 2EJMA 1H9RA 3K0XA 1L1OC 2VY3A 4A3GH 4JV5L 1WOCA 1UUPA 4OWTB 3KJOA 4A93G 1YNJD 3H0GG 4A76A 2QILA 1STHA 2XNAC 1EFID 1EQVA 1K8AC 4Z9CB 1J6QA 2AWNA 5GAHC 4JI1L 1PRTC 1WJJA 4PQXA 3PO2B 3W1GA 1K0RA 5JPMC 1BQQT 4KKUA 2LKVA 4IPHA 2A69D 1YJ9A 1CFMA 1HQMC 4UDUC 1MI2A 1ILQA 2B2VA 4XXEA 3FKIG 3MA2B 4QUFA 3V96A 2L0CA 1SE2A 1BUVT 4LJZC 1TWGH 1QUQB 1EQTA 4DK0A 3HOUG 4R9WA 2KENA 2F0DA 2JA8G 1EYCA 2EYLA 2R92G 3PIOA 2M2LA 4DF7A 5ISRA 4YWMA 1XJVA 3H3VI 1GM5A 2CKZB 4X65L 3MFYA 3RN2A 4RAUC 2AUJD 1A62A 3M9BA 1CZWA 5IT9L 1JR0D 1LLRD 5G3LF 1X56A 4DR1Q 4NXNL 1MBYA 5D3DA 3I4OA 2N49A 4HMJA 3FP9A 1WTRA 4BY7B 2BA0A 3A54A 4FXGC 1S5CD 3GTMB 3I73A 3DEPA 1Y8PB 4DAYB 1Y8OB 4LF8L 2TSSA 2UUCL 1PH9A 1VQJA 1K3BC 1KDAA 4LMQD 4DN4M 3E9IA 2UXDL 3OWEB 4HTHA 5CYUA 3GTOH 4KJOA 3AFPA 2BCOA 1G91A 4QY7A 4DNIA 1S5ED 1UE7A 2ZM6Q 4A3LH 4Y7NH 1M1KC 2OTLA 3PV0A 4OX9Q 3D8GA 1VQNA 4P74A 4RFBA 1A3VA 2K03A 3EN2A 1BF4A 1SRUA 4PZ6A 3ZYYX 1Q8IA 1EOTA 3OPOA 2EXDA
chains in the Genus database with same CATH topology
4DV5Q 3HKSA 2ASBA 4YCWA 2N3SA 4QIWE 1HNZQ 3JC66 5IYCG 1PH6A 2Q2UA 4QGUA 3CCSA 1HZ9A 4LF9Q 3JAMc 3KLWA 1CKMA 3E9HA 4J15A 3A5UA 1K73C 1A0IA 1QZGA 2MFIA 3PSIA 5BR8L 1C9OA 4LFBL 4LFAL 3AYHB 3GDEA 5C3EH 4KLKA 3STBC 4L5SA 5BR8Q 3CW2C 2CFMA 1VQCA 2Q2IA 4LFBQ 4LFAQ 4ALPA 5JEAJ 4A3MH 3CAMA 1PH8A 4GN4B 3K7AH 1GO3E 1OXSC 2JK8A 1KRTA 2Y0SG 1PA6A 1VQ6A 3GTQH 4BBSG 1SR3A 1G291 4R4CA 4NPSA 2YV5A 1IYJB 1FVIA 2K5NA 4ME3A 5H1SE 3U58A 1JT8A 5K36G 4P71A 4DR5Q 4YWLA 4HJ7A 3CMAA 3CCEA 2VQEQ 4OWWB 3GTKH 5JEAG 2E8GA 4YHHL 3CCVA 4NXMQ 2WP8J 2I0QA 1VQ4A 1VQOA 3MEFA 4X62Q 2JA7H 2BH2A 1Y1WH 1VQ5A 1JE5A 1KAWA 3I2ZA 2AKWB 2NN6G 3I4MG 4GKJL 3EBEA 3S15H 5C44G 4A3FG 2ZTCA 3STBD 4GLXA 2UXCQ 3S14H 3ULLA 2MO1A 4GKJQ 1EFWA 2VW9A 3U4VA 2DUDA 3VDYA 4POFA 2CCZA 1I5FA 1Z9FA 4A3GG 1L1OA 1B70B 2E2IH 4A3EH 1ASZA 1YITA 4Y52H 4GNXC 2K5HA 2JEAI 1IXRA 3S1NH 4GOPC 1SFOH 4PG3A 4AIMA 1XNQL 2ATWA 3G71A 4JBKA 4UY8C 2FXQA 2YYZA 1PV4A 1LTLA 1Q12A 3GO5A 4KI0A 1HNWL 4JBJA 3D31A 4OWXB 1XNQQ 1UE5A 2BH8A 4JI8L 2OQKA 2C35B 2VL6A 4HIDA 1I94L 1X54A 1B8AA 1IZ6A 4UP8A 4BXXH 2PNHA 4P72A 4JI8Q 4UPAA 1CSPA 2B63G 2YTYA 4R4OA 1I6HH 4JI3Q 1I94Q 3F2DA 1UE1A 3RR5A 1RIPA 3RNUA 2LSSA 5GAGC 2UU9L 1C7YA 5IWAL 3KJPA 3W5OA 3LGJA 3SGIA 4RG1A 3WWVA 4C3HH 5IYDG 3F2BA 3T1HQ 2E2HH 2UU9Q 1VQLA 5IWAQ 3CCJA 1SE8A 1ASYA 4JI4L 2Z6KC 4P73A 2DGYA 3U50C 5C0XI 3DLLA 1JJ2A 2VZAA 1OXXK 2R7FA 4YCUA 1NMFA 3NBHB 5HGQA 1OXVA 5FLMG 5GADC 3J7ZC 2ZJQA 2JA8H 1SROA 4AYBG 4JI4Q 1D7QA 1E24A 2JE6I 5M3FG 3RZOH 2AHOB 2ID0A 3CC4A 3B6YA 1N34L 2K4KA 1HR0W 2OWOA 2HIXA 3ULPA 2Q2TA 4A3DG 1X55A 4EX5A 2Y0SE 4DV3Q 2Z6KA 2VUMH 3I4NH 2HQLA 2R7DA 2IX0A 2D0PA 5M5XH 4JBMA 3K80C 3RLFA 3PUXA 2UUAL 3PO3H 1Y1VG 2YTVA 1V9PA 4YY3Q 3CF5A 4DR2L 1A63A 1VQPA 2VNUD 1L1OB 1LYLA 4IJLA 1IBML 1YBYA 3S17H 1HZBA 4R1JA 3AQQA 2R7ZH 3KDFA 3UDIA 3S16H 1EYGA 5AJ3L 4A3CG 1J5EL 4KHZA 2UXDQ 1CUKA 2NZHA 3CMEA 1Q86C 1BBWA 4A4IA 5AJ3Q 5LMNW 3AEVA 3PF5A 4QQBX 1J5EQ 5JJLA 3TREA 1SN8A 1PHJA 1A8VA 2JA5H 1Z47A 4LUOA 2KBNA 1V1QA 2JJQA 4HJ5A 2VQFL 3ICEA 5GROA 2YU9H 1HZAA 3HKZG 4O2DA 5C4XH 2CWAA 4A3KH 4DV1L 1XPOA 4IPCA 2VQFQ 3CCMA 4DUYL 4MZ9A 1K9MC 4A3LG 1K8GA 1UWVA 1VQDA 2OQ0A 3BZCA 3TS0A 1HNXQ 1BKBA 3HOYG 1G6PA 3T1YL 2MO0A 1E7ZA 1HJPA 4DV1Q 4DUYQ 1N33L 1Q1EA 4EQ5A 2QEXA 3GTGH 3HOZH 4X64L 2ALYB 1WCMH 3A74A 3T1YQ 1KD1C 3CCLA 4JI5L 1IBKL 1N33Q 2B29A 4X64Q 3BZKA 4HJ9A 4QL5A 2E2JH 3NEMA 4JI5Q 1IBKQ 4PZ8A 5IP9H 4JI7L 5IYCH 2IHFA 3OYYA 1JMCA 3HOWH 4IPDA 2R93H 4LWCA 2R6GA 4JI7Q 5C0XJ 1EQRA 2Q2HA 2NVQH 2JEBI 5C4JH 4OO1G 4DV6L 4LF6L 3S1QH 5IT9c 1FJGL 3H15A 4HIOA 3A0JA 3I56A 4A3MG 1PH3A 3F2CA 3UDXA 1KC8C 3RLOA 4LF6Q 1JB7A 1FJGQ 2NZOA 5LMUL 5IY0A 2WB1G 3Q8DA 2EQSA 2AWOA 5C0XG 3K7UC 4A3IH 1HH2P 3L0OA 3G6EA 3MXNB 1XNRL 4PMWA 4YHHQ 3CCRA 2D0OA 5E7NA 5LMUQ 1S72A 4JYAL 3CXCA 1VQMA 4DAMA 4JBWA 4MTNA 3KDFB 4DV2L 1XNRQ 2F4VL 1M90C 4JYAQ 1E22A 1LM0A 1R9TH 4IOCA 4BY1H 2H5XA 1XMQL 3GTJH 1QVGA 2F4VQ 1CKOA 1P16A 4DV2Q 4DR3L 1W2BA 2JA7G 2JA6H 3M4QA 4C3IH 2MQHA 3HOVH 1XMQQ 4UP7A 4DR3Q 5DLQE 1XMOL 4DV0L 3PUVA 1P8LA 3DM3A 4HJAA 4C2MH 1L0WA 3EIVA 5C44H 4TQUS 4A93H 5IE8A 2WAQG 3H0GH 4POGA 4IPGA 1TWAH 1H95A 4XTCS 2D62A 2GN5A 1YHBA 3D0FA 3GTPH 1EWIA 1VQAA 3PUYA 2LXJA 1S40A 1JJGA 4A3EG 4R4IA 5IP7H 3ERSX 1VQGA 4B3TL 4GNXA 4X66L 2JA9A 3J81j 4WJ4A 1Q1BA 4JI6L 4GOPA 3ER0A 5IYBG 5GAEC 1HNWQ 3NELA 3CP0A 4B3TQ 3HKZE 4X66Q 3TS2A 2OCEA 3G48A 4OONA 1XPRA 4JI6Q 4GKKL 4QJFA 4B3ML 1OXTA 1GKHA 2N78A 4JCVE 4RMFA 2CWPA 1Q7YC 1NY4A 2MNAA 3PO2H 4GKKQ 3J81c 4B3MQ 3S2DH 3FKIH 5FJ8H 4BXXG 2B63H 5JJKA 1YNXA 4UP9A 1HR0L 3M4OH 4DR4L 1U0LA 1JJCB 1RL2A 4JG2A 1QVCA 3KOJA 1HR0Q 2R92H 4DR4Q 2UXBL 2AMCB 1YJNA 4H02A 1Y14B 3HOXH 1OTCA 1IBLL 4GN3B 4BA2I 1W3SA 1WYDA 4IJHA 4DK6C 4DV7L 1WI5A 5FLXc 1KQSA 2RF4A 4HJ8A 5HY6A 1FGUA 1N34Q 1IBLQ 3M7NA 4A3BG 5M5WH 4DV7Q 4BBRG 3RN5A 1B7YB 5GQOA 2QA4A 1PH5A 2HHHL 1G51A 4IOAA 4YWKA 4AH6A 3W1BA 2WB1E 2HHHQ 1C0AA 3BU2A 3KF6A 2VUMG 1KHIA 2UUAQ 1I50H 3I4NG 4DR1L 2VS1A 2ZTDA 4NB3A 2GVAA 3U4ZA 4L5QA 2ZJPA 5LMNL 1UEBA 2WFWA 1VQIA 3BJUA 4OXPA 1PYSB 4DUZL 2OTJA 1MIUA 4K0KL 3PCOB 2EIFA 1IBMQ 3PO3G 1EIFA 2UUBL 5LMNQ 4A3JH 3M85A 4DUZQ 4IO9A 1E3PA 3I7FA 1BBUA 1VS0A 2F3IA 1N36L 4LF4L 4BY7H 3S2HH 2UUBQ 4X6AH 4KHPL 3HOUH 2KHJA 3GTMH 1Q8KA 2R7ZG 1X65A 2BA1A 3UDFA 3OTOL 4GNXB 1N36Q 4LF4Q 3KF8B 4GOPB 1KIXA 1LUZA 4KHPQ 3KYHC 1VQHA 4FDBA 4LFCL 3OTOQ 3A5ZB 3OW2A 2K50A 2IX1A 2WAQE 1NTGA 1PH2A 1KL9A 4PZ7A 2I5LX 2JA5G 2ZJRA 4LFCQ 1CSQA 1K83H 3F8TA 4AQYL 1Q82C 1YEZA 1E1TA 5M3MH 4JI2L 5C4XG 4L5TA 4A3KG 4AQYQ 4OX9L 1TXYA 1TWHH 1E1OA 1YIJA 1EUJA 1WFQA 2Z0SA 4R4QA 2PI2E 1NBWA 4GLVB 1EOVA 4HIKA 3E0EA 1D8LA 2K14A 2IY5B 3J7A5 3HOZG 3NENA 2I5HA 1VQFA 1X3FA 3ZJYC 1WCMG 4A75A 1AH9A 1HNZL 4LUVA 2K5VA 4DK3C 2I5MX 1SMXA 4LF7L 1YZ6A 5C3EG 1EIYB 3J81i 4JOIC 5IP9G 4A3BH 3GD7A 2GVBA 1SLJA 3HOWG 2R93G 4LF7Q 2K52A 3G4SA 4DV6Q 3J80c 4B3RL 3TEHB 5JJIA 2KCTA 4R4TA 2KCMA 1XTDA 2F52A 5J3BA 1S3OA 4BBSH 2XGTA 4AYBE 3KF6B 1VQKA 2ES2A 1VQBA 4GLAC 3S1RH 2HT1A 4B3RQ 4JOIA 2B3GA 1AE3A 1QUQA 2V1CC 3H3VH 1I3QH 3KFUA 1HZCA 4DV4L 4BA1I 1YJWA 4A3IG 4DR5L 5ELNA 3CQZH 2VQEL 4DV4Q 2JQOA 3CC7A 1Y1WG 2N8NA 3UDGA 4K0KQ 4NXML 1KXLA 4X62L 3I4MH 4O0AA 2CQOA 3CPWA 1VQ8A 4BY1G 1IL2A 1FL0A 4A3FH 1XMOQ 2NVTH 4DV0Q 3F1ZA 2JA6G 1PH4A 1PVOA 1O7IA 3HOVG 3TRZA 3IRBA 1YI2A 1YHQA 3GTLH 2UXCL 3TQYA 3K0XA 1OXUA 1L1OC 2VY3A 4A3GH 4JV5L 1WOCA 3RLNA 3I55A 1U5KA 3PUZA 3AFQA 4OWTB 3KJOA 2PQAA 4YCVA 4A93G 3H0GG 4JV5Q 1X6OA 3CD6A 3FHWA 4LF5L 4DR7L 4A76A 3UE1A 5M5YH 4LF5Q 4DR7Q 4IFDI 1K8AC 5IP7G 1J6QA 3S24A 1TWFH 2AWNA 2XTIA 5GAHC 4JI1L 2KHIA 1WJJA 3W1GA 4DR6L 1K0RA 1AE2A 5IYBH 1QVFA 3CPFA 4JI1Q 4IPHA 1YHAA 1L2FA 3L7ZC 4DR6Q 2IT1A 2NVYH 1T9HA 2QGQA 1YJ9A 1VQ7A 3PO2G 1PH7A 4JI3L 4GS3A 3FKIG 2RHQB 5FJ8G 2NVXH 1N32L 3UE0A 3PIPA 5IYDH 2YTXA 4TVAB 1TWGH 1Q81C 2UXBQ 1QUQB 1CKNA 3ULJA 3HOUG 2KENA 1N32Q 3T1HL 2JA8G 1X9NA 4OO1I 5FLMH 1NJIC 3M3YH 3K8AA 2R92G 3PIOA 1NE3A 1VQEA 1MKHA 5M3FH 4GN5A 1XJVA 4YWMA 3JAMi 3HOXG 1GM5A 2CKZB 4X65L 3RN2A 3H3VI 4A3DH 3J80i 1A62A 1V43A 3M9BA 4X65Q 2PMZE 3S1MH 4DR2Q 4BBRH 1N9WA 4APVA 1Q46A 1K3RA 4LW1A 4XIGS 4DV3L 1X56A 2NN6I 4MNOA 3CCQA 3HFZB 4DR1Q 4NXNL 2RCNA 1QZHA 1Y1VH 1EQQA 3I4OA 2RHSB 2N49A 4P75A 4HIMA 1PYBA 3FP9A 1GD7A 2BA0A 4JI0L 1DGSA 3PF4A 4NXNQ 4DPGA 4YY3L 3K81C 2PQAB 1KRSA 2E5LL 1X3EA 1TWCH 4JI0Q 4DAYB 4LF8L 5ELOA 4A3CH 4A3JG 2UUCL 1PH9A 3CC2A 4L5RC 3PGZA 5EAYA 2E5LQ 4B3SL 1VQJA 1YVCA 2A1AA 4LF8Q 1MJEA 4BY7G 2UUCQ 1MJCA 3E9IA 2A8VA 2UXDL 4B3SQ 3GTOH 1PH1A 2LXKA 4C3JH 2ZM6L 1BVSA 3AFPA 1UE6A 3M4PA 4IFDJ 4QY7A 4DNIA 2IHEA 2L15A 1VQ9A 1UE7A 4JI2Q 2ZM6Q 4A3LH 4Y7NH 1M1KC 2OTLA 4WJ3M 4DKAC 1XPUA 3PV0A 3HOYH 4OX9Q 1NMGA 2K75A 1N8RC 5M3MG 1VCIA 1PFSA 4P74A 1VQNA 3EN2A 1GVPA 3PUWA 1X3GA 4JC0A 1HNXL 4DV5L 2ZTEA 1SRUA 2A19A 4IFDG 4LF9L 2PI2A 4PZ6A 3RZDH 3CCUA 1CKNB 2HIVA 3L2PA 4LNQA 4LUZA 2EXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV5 Q;  3HKS A;  2ASB A;  4YCW A;  2N3S A;  4QIW E;  1HNZ Q;  3JC6 6;  5IYC G;  1PH6 A;  2Q2U A;  4QGU A;  3CCS A;  1HZ9 A;  4LF9 Q;  3JAM c;  3KLW A;  1CKM A;  3E9H A;  4J15 A;  3A5U A;  1K73 C;  1A0I A;  1QZG A;  2MFI A;  3PSI A;  5BR8 L;  1C9O A;  4LFB L;  4LFA L;  3AYH B;  3GDE A;  5C3E H;  4KLK A;  3STB C;  4L5S A;  5BR8 Q;  3CW2 C;  2CFM A;  1VQC A;  2Q2I A;  4LFB Q;  4LFA Q;  4ALP A;  5JEA J;  4A3M H;  3CAM A;  1PH8 A;  4GN4 B;  3K7A H;  1GO3 E;  1OXS C;  2JK8 A;  1KRT A;  2Y0S G;  1PA6 A;  1VQ6 A;  3GTQ H;  4BBS G;  1SR3 A;  1G29 1;  4R4C A;  4NPS A;  2YV5 A;  1IYJ B;  1FVI A;  2K5N A;  4ME3 A;  5H1S E;  3U58 A;  1JT8 A;  5K36 G;  4P71 A;  4DR5 Q;  4YWL A;  4HJ7 A;  3CMA A;  3CCE A;  2VQE Q;  4OWW B;  3GTK H;  5JEA G;  2E8G A;  4YHH L;  3CCV A;  4NXM Q;  2WP8 J;  2I0Q A;  1VQ4 A;  1VQO A;  3MEF A;  4X62 Q;  2JA7 H;  2BH2 A;  1Y1W H;  1VQ5 A;  1JE5 A;  1KAW A;  3I2Z A;  2AKW B;  2NN6 G;  3I4M G;  4GKJ L;  3EBE A;  3S15 H;  5C44 G;  4A3F G;  2ZTC A;  3STB D;  4GLX A;  2UXC Q;  3S14 H;  3ULL A;  2MO1 A;  4GKJ Q;  1EFW A;  2VW9 A;  3U4V A;  2DUD A;  3VDY A;  4POF A;  2CCZ A;  1I5F A;  1Z9F A;  4A3G G;  1L1O A;  1B70 B;  2E2I H;  4A3E H;  1ASZ A;  1YIT A;  4Y52 H;  4GNX C;  2K5H A;  2JEA I;  1IXR A;  3S1N H;  4GOP C;  1SFO H;  4PG3 A;  4AIM A;  1XNQ L;  2ATW A;  3G71 A;  4JBK A;  4UY8 C;  2FXQ A;  2YYZ A;  1PV4 A;  1LTL A;  1Q12 A;  3GO5 A;  4KI0 A;  1HNW L;  4JBJ A;  3D31 A;  4OWX B;  1XNQ Q;  1UE5 A;  2BH8 A;  4JI8 L;  2OQK A;  2C35 B;  2VL6 A;  4HID A;  1I94 L;  1X54 A;  1B8A A;  1IZ6 A;  4UP8 A;  4BXX H;  2PNH A;  4P72 A;  4JI8 Q;  4UPA A;  1CSP A;  2B63 G;  2YTY A;  4R4O A;  1I6H H;  4JI3 Q;  1I94 Q;  3F2D A;  1UE1 A;  3RR5 A;  1RIP A;  3RNU A;  2LSS A;  5GAG C;  2UU9 L;  1C7Y A;  5IWA L;  3KJP A;  3W5O A;  3LGJ A;  3SGI A;  4RG1 A;  3WWV A;  4C3H H;  5IYD G;  3F2B A;  3T1H Q;  2E2H H;  2UU9 Q;  1VQL A;  5IWA Q;  3CCJ A;  1SE8 A;  1ASY A;  4JI4 L;  2Z6K C;  4P73 A;  2DGY A;  3U50 C;  5C0X I;  3DLL A;  1JJ2 A;  2VZA A;  1OXX K;  2R7F A;  4YCU A;  1NMF A;  3NBH B;  5HGQ A;  1OXV A;  5FLM G;  5GAD C;  3J7Z C;  2ZJQ A;  2JA8 H;  1SRO A;  4AYB G;  4JI4 Q;  1D7Q A;  1E24 A;  2JE6 I;  5M3F G;  3RZO H;  2AHO B;  2ID0 A;  3CC4 A;  3B6Y A;  1N34 L;  2K4K A;  1HR0 W;  2OWO A;  2HIX A;  3ULP A;  2Q2T A;  4A3D G;  1X55 A;  4EX5 A;  2Y0S E;  4DV3 Q;  2Z6K A;  2VUM H;  3I4N H;  2HQL A;  2R7D A;  2IX0 A;  2D0P A;  5M5X H;  4JBM A;  3K80 C;  3RLF A;  3PUX A;  2UUA L;  3PO3 H;  1Y1V G;  2YTV A;  1V9P A;  4YY3 Q;  3CF5 A;  4DR2 L;  1A63 A;  1VQP A;  2VNU D;  1L1O B;  1LYL A;  4IJL A;  1IBM L;  1YBY A;  3S17 H;  1HZB A;  4R1J A;  3AQQ A;  2R7Z H;  3KDF A;  3UDI A;  3S16 H;  1EYG A;  5AJ3 L;  4A3C G;  1J5E L;  4KHZ A;  2UXD Q;  1CUK A;  2NZH A;  3CME A;  1Q86 C;  1BBW A;  4A4I A;  5AJ3 Q;  5LMN W;  3AEV A;  3PF5 A;  4QQB X;  1J5E Q;  5JJL A;  3TRE A;  1SN8 A;  1PHJ A;  1A8V A;  2JA5 H;  1Z47 A;  4LUO A;  2KBN A;  1V1Q A;  2JJQ A;  4HJ5 A;  2VQF L;  3ICE A;  5GRO A;  2YU9 H;  1HZA A;  3HKZ G;  4O2D A;  5C4X H;  2CWA A;  4A3K H;  4DV1 L;  1XPO A;  4IPC A;  2VQF Q;  3CCM A;  4DUY L;  4MZ9 A;  1K9M C;  4A3L G;  1K8G A;  1UWV A;  1VQD A;  2OQ0 A;  3BZC A;  3TS0 A;  1HNX Q;  1BKB A;  3HOY G;  1G6P A;  3T1Y L;  2MO0 A;  1E7Z A;  1HJP A;  4DV1 Q;  4DUY Q;  1N33 L;  1Q1E A;  4EQ5 A;  2QEX A;  3GTG H;  3HOZ H;  4X64 L;  2ALY B;  1WCM H;  3A74 A;  3T1Y Q;  1KD1 C;  3CCL A;  4JI5 L;  1IBK L;  1N33 Q;  2B29 A;  4X64 Q;  3BZK A;  4HJ9 A;  4QL5 A;  2E2J H;  3NEM A;  4JI5 Q;  1IBK Q;  4PZ8 A;  5IP9 H;  4JI7 L;  5IYC H;  2IHF A;  3OYY A;  1JMC A;  3HOW H;  4IPD A;  2R93 H;  4LWC A;  2R6G A;  4JI7 Q;  5C0X J;  1EQR A;  2Q2H A;  2NVQ H;  2JEB I;  5C4J H;  4OO1 G;  4DV6 L;  4LF6 L;  3S1Q H;  5IT9 c;  1FJG L;  3H15 A;  4HIO A;  3A0J A;  3I56 A;  4A3M G;  1PH3 A;  3F2C A;  3UDX A;  1KC8 C;  3RLO A;  4LF6 Q;  1JB7 A;  1FJG Q;  2NZO A;  5LMU L;  5IY0 A;  2WB1 G;  3Q8D A;  2EQS A;  2AWO A;  5C0X G;  3K7U C;  4A3I H;  1HH2 P;  3L0O A;  3G6E A;  3MXN B;  1XNR L;  4PMW A;  4YHH Q;  3CCR A;  2D0O A;  5E7N A;  5LMU Q;  1S72 A;  4JYA L;  3CXC A;  1VQM A;  4DAM A;  4JBW A;  4MTN A;  3KDF B;  4DV2 L;  1XNR Q;  2F4V L;  1M90 C;  4JYA Q;  1E22 A;  1LM0 A;  1R9T H;  4IOC A;  4BY1 H;  2H5X A;  1XMQ L;  3GTJ H;  1QVG A;  2F4V Q;  1CKO A;  1P16 A;  4DV2 Q;  4DR3 L;  1W2B A;  2JA7 G;  2JA6 H;  3M4Q A;  4C3I H;  2MQH A;  3HOV H;  1XMQ Q;  4UP7 A;  4DR3 Q;  5DLQ E;  1XMO L;  4DV0 L;  3PUV A;  1P8L A;  3DM3 A;  4HJA A;  4C2M H;  1L0W A;  3EIV A;  5C44 H;  4TQU S;  4A93 H;  5IE8 A;  2WAQ G;  3H0G H;  4POG A;  4IPG A;  1TWA H;  1H95 A;  4XTC S;  2D62 A;  2GN5 A;  1YHB A;  3D0F A;  3GTP H;  1EWI A;  1VQA A;  3PUY A;  2LXJ A;  1S40 A;  1JJG A;  4A3E G;  4R4I A;  5IP7 H;  3ERS X;  1VQG A;  4B3T L;  4GNX A;  4X66 L;  2JA9 A;  3J81 j;  4WJ4 A;  1Q1B A;  4JI6 L;  4GOP A;  3ER0 A;  5IYB G;  5GAE C;  1HNW Q;  3NEL A;  3CP0 A;  4B3T Q;  3HKZ E;  4X66 Q;  3TS2 A;  2OCE A;  3G48 A;  4OON A;  1XPR A;  4JI6 Q;  4GKK L;  4QJF A;  4B3M L;  1OXT A;  1GKH A;  2N78 A;  4JCV E;  4RMF A;  2CWP A;  1Q7Y C;  1NY4 A;  2MNA A;  3PO2 H;  4GKK Q;  3J81 c;  4B3M Q;  3S2D H;  3FKI H;  5FJ8 H;  4BXX G;  2B63 H;  5JJK A;  1YNX A;  4UP9 A;  1HR0 L;  3M4O H;  4DR4 L;  1U0L A;  1JJC B;  1RL2 A;  4JG2 A;  1QVC A;  3KOJ A;  1HR0 Q;  2R92 H;  4DR4 Q;  2UXB L;  2AMC B;  1YJN A;  4H02 A;  1Y14 B;  3HOX H;  1OTC A;  1IBL L;  4GN3 B;  4BA2 I;  1W3S A;  1WYD A;  4IJH A;  4DK6 C;  4DV7 L;  1WI5 A;  5FLX c;  1KQS A;  2RF4 A;  4HJ8 A;  5HY6 A;  1FGU A;  1N34 Q;  1IBL Q;  3M7N A;  4A3B G;  5M5W H;  4DV7 Q;  4BBR G;  3RN5 A;  1B7Y B;  5GQO A;  2QA4 A;  1PH5 A;  2HHH L;  1G51 A;  4IOA A;  4YWK A;  4AH6 A;  3W1B A;  2WB1 E;  2HHH Q;  1C0A A;  3BU2 A;  3KF6 A;  2VUM G;  1KHI A;  2UUA Q;  1I50 H;  3I4N G;  4DR1 L;  2VS1 A;  2ZTD A;  4NB3 A;  2GVA A;  3U4Z A;  4L5Q A;  2ZJP A;  5LMN L;  1UEB A;  2WFW A;  1VQI A;  3BJU A;  4OXP A;  1PYS B;  4DUZ L;  2OTJ A;  1MIU A;  4K0K L;  3PCO B;  2EIF A;  1IBM Q;  3PO3 G;  1EIF A;  2UUB L;  5LMN Q;  4A3J H;  3M85 A;  4DUZ Q;  4IO9 A;  1E3P A;  3I7F A;  1BBU A;  1VS0 A;  2F3I A;  1N36 L;  4LF4 L;  4BY7 H;  3S2H H;  2UUB Q;  4X6A H;  4KHP L;  3HOU H;  2KHJ A;  3GTM H;  1Q8K A;  2R7Z G;  1X65 A;  2BA1 A;  3UDF A;  3OTO L;  4GNX B;  1N36 Q;  4LF4 Q;  3KF8 B;  4GOP B;  1KIX A;  1LUZ A;  4KHP Q;  3KYH C;  1VQH A;  4FDB A;  4LFC L;  3OTO Q;  3A5Z B;  3OW2 A;  2K50 A;  2IX1 A;  2WAQ E;  1NTG A;  1PH2 A;  1KL9 A;  4PZ7 A;  2I5L X;  2JA5 G;  2ZJR A;  4LFC Q;  1CSQ A;  1K83 H;  3F8T A;  4AQY L;  1Q82 C;  1YEZ A;  1E1T A;  5M3M H;  4JI2 L;  5C4X G;  4L5T A;  4A3K G;  4AQY Q;  4OX9 L;  1TXY A;  1TWH H;  1E1O A;  1YIJ A;  1EUJ A;  1WFQ A;  2Z0S A;  4R4Q A;  2PI2 E;  1NBW A;  4GLV B;  1EOV A;  4HIK A;  3E0E A;  1D8L A;  2K14 A;  2IY5 B;  3J7A 5;  3HOZ G;  3NEN A;  2I5H A;  1VQF A;  1X3F A;  3ZJY C;  1WCM G;  4A75 A;  1AH9 A;  1HNZ L;  4LUV A;  2K5V A;  4DK3 C;  2I5M X;  1SMX A;  4LF7 L;  1YZ6 A;  5C3E G;  1EIY B;  3J81 i;  4JOI C;  5IP9 G;  4A3B H;  3GD7 A;  2GVB A;  1SLJ A;  3HOW G;  2R93 G;  4LF7 Q;  2K52 A;  3G4S A;  4DV6 Q;  3J80 c;  4B3R L;  3TEH B;  5JJI A;  2KCT A;  4R4T A;  2KCM A;  1XTD A;  2F52 A;  5J3B A;  1S3O A;  4BBS H;  2XGT A;  4AYB E;  3KF6 B;  1VQK A;  2ES2 A;  1VQB A;  4GLA C;  3S1R H;  2HT1 A;  4B3R Q;  4JOI A;  2B3G A;  1AE3 A;  1QUQ A;  2V1C C;  3H3V H;  1I3Q H;  3KFU A;  1HZC A;  4DV4 L;  4BA1 I;  1YJW A;  4A3I G;  4DR5 L;  5ELN A;  3CQZ H;  2VQE L;  4DV4 Q;  2JQO A;  3CC7 A;  1Y1W G;  2N8N A;  3UDG A;  4K0K Q;  4NXM L;  1KXL A;  4X62 L;  3I4M H;  4O0A A;  2CQO A;  3CPW A;  1VQ8 A;  4BY1 G;  1IL2 A;  1FL0 A;  4A3F H;  1XMO Q;  2NVT H;  4DV0 Q;  3F1Z A;  2JA6 G;  1PH4 A;  1PVO A;  1O7I A;  3HOV G;  3TRZ A;  3IRB A;  1YI2 A;  1YHQ A;  3GTL H;  2UXC L;  3TQY A;  3K0X A;  1OXU A;  1L1O C;  2VY3 A;  4A3G H;  4JV5 L;  1WOC A;  3RLN A;  3I55 A;  1U5K A;  3PUZ A;  3AFQ A;  4OWT B;  3KJO A;  2PQA A;  4YCV A;  4A93 G;  3H0G G;  4JV5 Q;  1X6O A;  3CD6 A;  3FHW A;  4LF5 L;  4DR7 L;  4A76 A;  3UE1 A;  5M5Y H;  4LF5 Q;  4DR7 Q;  4IFD I;  1K8A C;  5IP7 G;  1J6Q A;  3S24 A;  1TWF H;  2AWN A;  2XTI A;  5GAH C;  4JI1 L;  2KHI A;  1WJJ A;  3W1G A;  4DR6 L;  1K0R A;  1AE2 A;  5IYB H;  1QVF A;  3CPF A;  4JI1 Q;  4IPH A;  1YHA A;  1L2F A;  3L7Z C;  4DR6 Q;  2IT1 A;  2NVY H;  1T9H A;  2QGQ A;  1YJ9 A;  1VQ7 A;  3PO2 G;  1PH7 A;  4JI3 L;  4GS3 A;  3FKI G;  2RHQ B;  5FJ8 G;  2NVX H;  1N32 L;  3UE0 A;  3PIP A;  5IYD H;  2YTX A;  4TVA B;  1TWG H;  1Q81 C;  2UXB Q;  1QUQ B;  1CKN A;  3ULJ A;  3HOU G;  2KEN A;  1N32 Q;  3T1H L;  2JA8 G;  1X9N A;  4OO1 I;  5FLM H;  1NJI C;  3M3Y H;  3K8A A;  2R92 G;  3PIO A;  1NE3 A;  1VQE A;  1MKH A;  5M3F H;  4GN5 A;  1XJV A;  4YWM A;  3JAM i;  3HOX G;  1GM5 A;  2CKZ B;  4X65 L;  3RN2 A;  3H3V I;  4A3D H;  3J80 i;  1A62 A;  1V43 A;  3M9B A;  4X65 Q;  2PMZ E;  3S1M H;  4DR2 Q;  4BBR H;  1N9W A;  4APV A;  1Q46 A;  1K3R A;  4LW1 A;  4XIG S;  4DV3 L;  1X56 A;  2NN6 I;  4MNO A;  3CCQ A;  3HFZ B;  4DR1 Q;  4NXN L;  2RCN A;  1QZH A;  1Y1V H;  1EQQ A;  3I4O A;  2RHS B;  2N49 A;  4P75 A;  4HIM A;  1PYB A;  3FP9 A;  1GD7 A;  2BA0 A;  4JI0 L;  1DGS A;  3PF4 A;  4NXN Q;  4DPG A;  4YY3 L;  3K81 C;  2PQA B;  1KRS A;  2E5L L;  1X3E A;  1TWC H;  4JI0 Q;  4DAY B;  4LF8 L;  5ELO A;  4A3C H;  4A3J G;  2UUC L;  1PH9 A;  3CC2 A;  4L5R C;  3PGZ A;  5EAY A;  2E5L Q;  4B3S L;  1VQJ A;  1YVC A;  2A1A A;  4LF8 Q;  1MJE A;  4BY7 G;  2UUC Q;  1MJC A;  3E9I A;  2A8V A;  2UXD L;  4B3S Q;  3GTO H;  1PH1 A;  2LXK A;  4C3J H;  2ZM6 L;  1BVS A;  3AFP A;  1UE6 A;  3M4P A;  4IFD J;  4QY7 A;  4DNI A;  2IHE A;  2L15 A;  1VQ9 A;  1UE7 A;  4JI2 Q;  2ZM6 Q;  4A3L H;  4Y7N H;  1M1K C;  2OTL A;  4WJ3 M;  4DKA C;  1XPU A;  3PV0 A;  3HOY H;  4OX9 Q;  1NMG A;  2K75 A;  1N8R C;  5M3M G;  1VCI A;  1PFS A;  4P74 A;  1VQN A;  3EN2 A;  1GVP A;  3PUW A;  1X3G A;  4JC0 A;  1HNX L;  4DV5 L;  2ZTE A;  1SRU A;  2A19 A;  4IFD G;  4LF9 L;  2PI2 A;  4PZ6 A;  3RZD H;  3CCU A;  1CKN B;  2HIV A;  3L2P A;  4LNQ A;  4LUZ A;  2EXD A; 
#chains in the Genus database with same CATH topology
 4QIW E;  1SNQ A;  1X3Q A;  4IAL A;  4QGU A;  3KLW A;  1CKM A;  2NB0 A;  3E9H A;  3AU7 A;  1QZG A;  1RF2 D;  2Y0S B;  4LFA L;  2IPK D;  2K6A A;  5C3E H;  4L5S A;  4OO1 H;  3J81 L;  2CFM A;  1CT1 D;  1VQC A;  2J7Z A;  4ALP A;  4A3M H;  3K7A H;  1KAB A;  3GTQ H;  4BBS G;  1DJR D;  1STA A;  4NPS A;  1IYJ B;  1FVI A;  4XT3 B;  5K36 G;  4YWL A;  4HJ7 A;  1WD0 A;  1D5Z C;  3S9W A;  4OWW B;  2B2T A;  1JWS D;  3GTK H;  1NCV A;  2Z8L A;  2I0Q A;  2CQA A;  1VQO A;  2EY2 A;  3MEF A;  2JA7 H;  5IT9 E;  1KAW A;  2AKW B;  2JYO A;  1O7L A;  4A3G B;  3I4M G;  3S15 H;  5C44 G;  2ZTC A;  3L3O C;  3H09 A;  3FPP A;  4GKJ Q;  4DU9 A;  3TSS A;  3O13 A;  3U4V A;  2V4D A;  5CC4 A;  2BE5 C;  2NUC A;  2CCZ A;  1I5F A;  1Z9F A;  1B70 B;  1S4Z A;  4OEL B;  2Z6B A;  1QCB D;  1ASZ A;  2JEA I;  1IXR A;  2RSN A;  3S2D B;  4IQZ A;  4PG3 A;  2ATW A;  1PZJ D;  3G71 A;  3PIP 3;  3K57 A;  4JBK A;  1AN8 A;  2EY1 A;  4JBJ A;  3K6O A;  3QB3 A;  1X54 A;  4UP8 A;  2PNH A;  4P72 A;  4JI8 Q;  1TWG B;  1PDQ A;  4UPA A;  2PQE A;  4KD4 A;  1I94 Q;  3F2D A;  3A55 A;  1UE1 A;  1STB A;  1DOM A;  5FO9 B;  5IGB A;  2AQ3 B;  1IYV A;  3LGJ A;  3NPP A;  5IYD G;  2RDG A;  5D65 A;  2UU9 Q;  2JP1 A;  4P73 A;  5C0X I;  5GAD C;  3NBH B;  2ZJQ A;  2BDO A;  1OXV A;  2PW7 A;  3J7Z C;  4AYB G;  3V2T A;  4F87 A;  1N34 L;  2K4K A;  3FPU B;  3J80 L;  4DAP A;  1ENF A;  2ICI A;  3S2H B;  4QCL A;  2EVB A;  1HQR D;  5CBE E;  2SEB D;  2E2D C;  3H6M A;  1PZI D;  3RLF A;  3DM1 A;  4YY3 Q;  4K14 A;  1E2Z A;  3CHB D;  1GUW A;  4IJL A;  2PZT A;  4ZUJ A;  1IBM L;  4ABN A;  3KDF A;  4S3S A;  3CU7 A;  4DXF A;  4A3C G;  1WTQ A;  2NZH A;  1FNU A;  4Y7N B;  3AEV A;  1W6K A;  1EY9 A;  1V1Q A;  2VQF L;  3ICE A;  5GRO A;  4H7B A;  2YU9 H;  1HZA A;  2QDL A;  3HKZ G;  1VF5 C;  1S5B D;  4DV1 L;  1B2T A;  3CCM A;  4DUY L;  1CQF A;  2HCI A;  1VQD A;  3Q22 A;  3HOY G;  1G6P A;  2KEE A;  3T1Y L;  3GTG H;  4X64 L;  3KLS A;  4G57 A;  1IBK L;  2F0T A;  2B29 A;  2R3Z A;  3VR6 A;  4QL5 A;  4JI5 Q;  4RA8 A;  4A3M B;  2K01 A;  3K7A B;  3LWE A;  2R6G A;  3GTQ B;  1EQR A;  2Q2H A;  1JC7 A;  2NVQ H;  4H0L C;  4DV6 L;  4CDC C;  5HUR A;  1G2S A;  3H15 A;  2K33 A;  1DYQ A;  3GTK B;  1KC8 C;  3RLO A;  1JB7 A;  1FJG Q;  2NZO A;  2EQS A;  5C0X G;  3K7U C;  2JA7 B;  4L8J A;  3CCR A;  1S72 A;  5I6W A;  4KY6 A;  4DAM A;  2F0M A;  3L9A X;  3P1H A;  2F4V L;  4DV2 L;  3D4D A;  3DUZ A;  4K5W A;  4R8I A;  1M90 C;  3S15 B;  4JYA Q;  3BDC A;  4BY1 H;  1XMQ L;  4K0K L;  3M4Q A;  2MQH A;  3NTI A;  1H9S A;  4DR3 Q;  1XMO L;  3RD4 A;  3TP6 A;  4KTA A;  3PUV A;  1P8L A;  4J1M A;  4HJA A;  3EIV A;  4A93 H;  2KED A;  3H0G H;  4IPG A;  1H95 A;  4XTC S;  2GN5 A;  3GTP H;  1STY A;  2H4O A;  3PUY A;  1JJG A;  4A3E G;  4R4I A;  3WOF A;  4X66 L;  1IKM A;  4JI6 L;  3C1E A;  3ER0 A;  3TP7 A;  5GAE C;  1HNW Q;  4IN3 A;  4B3T Q;  3MWY W;  4V19 0;  3G48 A;  4OON A;  4IUP A;  3R3O A;  1SE3 A;  1UAP A;  4GKK L;  1OXT A;  2CWP A;  1NY4 A;  2F1M A;  3FKI H;  1TS2 A;  4DR4 L;  1KNE A;  4JG2 A;  2F0E A;  2R92 H;  2FFK B;  3OSO A;  3NQI A;  2AMC B;  1EYD A;  1Y14 B;  4H02 A;  4BA2 I;  5C3X A;  3ERQ A;  4DK6 C;  1WYD A;  4IJH A;  1ONL A;  5IIF A;  4RGM A;  2EY6 A;  2F0K A;  5FLX c;  4HJ8 A;  4A3B G;  1IBL Q;  3GV6 A;  1O78 A;  2QA4 A;  3M4Y A;  1X32 A;  3KLS X;  1LTI D;  3OIQ A;  1QE6 A;  2C9O A;  2WB1 E;  2AQ1 B;  1UEA B;  3A7A B;  3K5N A;  3BU2 A;  4X3K A;  2VUM G;  2UUA Q;  4LK1 C;  4DR1 L;  2ZTD A;  2X6G A;  4DR2 Q;  2DN8 A;  3U4Z A;  4DNR B;  3BJU A;  3PCO B;  5NUC A;  4G4K A;  3PO3 G;  2F0O A;  5LMN Q;  1K8M A;  4IO9 A;  1BBU A;  3VA5 A;  2F3I A;  2F4I A;  4KHP L;  2R7Z G;  3OTO L;  4GNX B;  4GZY C;  2Z4I A;  4LF4 Q;  2YU9 B;  3KF8 B;  1DM0 B;  4FDB A;  3OW2 A;  4C1N K;  2WAQ E;  3EQL C;  2K5W A;  3K5M A;  1B44 D;  3C3L A;  1K83 H;  1RJT A;  2ICE C;  2ZXO A;  4FVM A;  5C4X G;  2X69 A;  4OX9 L;  1TS4 A;  4RKL A;  3SE0 A;  4CJ1 B;  1E1O A;  3SDZ A;  3AMU A;  1CK1 A;  1UNS A;  4R4Q A;  4GLV B;  4HIK A;  1SNC A;  1G6Z A;  2VXW A;  3HOZ G;  1VQF A;  4HAE A;  5AFW A;  2NVQ B;  2HQE A;  4KKT A;  5C3E G;  1EIY B;  2GVB A;  2R93 G;  2K52 A;  3BVZ A;  3G4S A;  5JVG 3;  4K8I A;  4BBS H;  4AYB E;  3D6C A;  3KF6 B;  1VQK A;  3S1R H;  3A8K E;  5K36 H;  1AE3 A;  1ET6 A;  2V1C C;  4FP5 D;  3H3V H;  1I3Q H;  5IOC A;  4BS9 A;  3R2T A;  2RBM A;  4BY1 B;  4N8F A;  3NTH A;  4A3I G;  1SNM A;  3CQZ H;  2RVL A;  3BZD B;  2R61 A;  4X3U A;  3I4M H;  3CPW A;  4A93 B;  3H0G B;  5D14 A;  4DV0 Q;  1F9R A;  1SFO B;  2JA6 G;  4C3I G;  2A6E D;  1WTX A;  4CBV A;  2EZV A;  5KRU A;  1YHQ A;  3TQY A;  1U5K A;  3PUZ A;  2PQA A;  4YCV A;  1LT3 D;  3ITP A;  4HSV A;  4LF5 L;  1FNW A;  5DM6 3;  5M5Y H;  4DR7 Q;  4P2C B;  4RGN A;  5IP7 G;  3DWP A;  4TKO B;  1LT4 D;  4DR6 L;  3FKI B;  1QVF A;  2OEO A;  4Q5V A;  3L7Z C;  4KN4 C;  3HOU B;  1NSN S;  1T9H A;  2QGQ A;  1K0S A;  4KMU C;  2F03 A;  2JA8 B;  1VQ7 A;  2R92 B;  2RHQ B;  5FJ8 G;  2NVX H;  3UE0 A;  2PCF B;  3PIP A;  5IYD H;  1ILP A;  4XYQ A;  2UXB Q;  3ULJ A;  2K04 A;  1N32 Q;  1ML0 D;  3M3Y H;  3K8A A;  3G6J B;  1NE3 A;  5M9O A;  3GP7 A;  1D6E C;  4GN5 A;  1TS5 A;  1IYU A;  1A3U A;  4XQJ A;  5J39 A;  2JXM B;  5I9P A;  3QOL A;  4XQN A;  5ELC A;  2PMZ E;  3S1M H;  1QG7 A;  1N9W A;  2M9V A;  1A15 A;  4LW1 A;  2NN6 I;  3CCQ A;  1QZH A;  4HIM A;  3MFG A;  4G7O C;  5LHY 1;  3PF4 A;  4F8M A;  3VYR A;  1DZ1 A;  4YY3 L;  2MGS A;  2E5L L;  1TVX A;  1TWC H;  4JI0 Q;  3P7J A;  4M1U B;  2XIW A;  4IUQ A;  4A3C H;  4A3J G;  2JN4 A;  3H91 A;  4B3S L;  3MXN A;  1BCP D;  1MJE A;  1K83 B;  3SHL A;  1PH1 A;  1B3Q A;  2LXK A;  1BVS A;  4CDE C;  1UE6 A;  1BO0 A;  4DKA C;  1XPU A;  2BOS A;  3HOY H;  1NMG A;  4HCS A;  5M3M G;  1PFS A;  2OT2 A;  4JC0 A;  2ZTE A;  4DNT B;  1SSO A;  3OMC A;  3NTK A;  4LNQ A;  1HUN A;  3D3R A;  5CV4 A;  3KBX A;  3HKS A;  4DV5 Q;  4YCW A;  2B39 A;  5E4W C;  3R93 A;  1Y8N B;  1HNZ Q;  1BBX C;  4LF9 Q;  1LTT D;  4J15 A;  3NQT A;  1RCV D;  4K5V A;  1A0I A;  2MFI A;  4BBS B;  1RTO A;  1C9O A;  2Z1C A;  1ENA A;  3S1R B;  2B2Y A;  3BYT B;  5BR8 Q;  3CW2 C;  3MXG A;  1BCP B;  1STG A;  4LFB Q;  1I3Q B;  3CAM A;  2D2C C;  1PA6 A;  5C0X H;  5KIX A;  1MSH A;  3CQZ B;  1G29 1;  1EIG A;  2XWJ B;  2MJ8 A;  5H1S E;  2K5N A;  1JT8 A;  2QCP X;  3I4M B;  5C44 B;  3CCV A;  2JSO A;  3NXW A;  4NXM Q;  2WP8 J;  1VQ4 A;  3A8J E;  4OGQ C;  5BN3 A;  1Y1W H;  3MC0 B;  3I2Z A;  2NN6 G;  1QOH A;  5CGK A;  5C6A A;  1MD2 D;  4A3F G;  2G9D A;  3STB D;  2UXC Q;  4GLX A;  1SEB D;  3QO2 A;  3FMC A;  2VW9 A;  2L1B A;  5M5Y B;  3K58 A;  1LAC A;  2E2I H;  4A3E H;  4YIJ A;  4KV6 A;  4GNX C;  2K5H A;  2CHB D;  2MHV A;  2F0F A;  2TMP A;  1XWE A;  3E5S A;  3FVQ A;  3KBG A;  4AIM A;  2IWH A;  2FXQ A;  1SXT A;  1Q12 A;  2B8G A;  3GO5 A;  5DNF A;  1HNW L;  4OWX B;  1XNQ Q;  2BH8 A;  4O42 A;  2OQK A;  2DNE A;  1B8A A;  2NVX B;  5CV6 A;  1RDP D;  5DEH A;  1LT6 D;  1I6H H;  4JI3 Q;  3OWF A;  1B53 A;  4FNF A;  5IGF A;  3RR5 A;  1RIP A;  2WKD A;  3M3Y B;  1SNO A;  4AYB B;  1CHQ D;  3KJP A;  3W5O A;  4DFA A;  2E2H H;  1HA6 A;  3T1H Q;  1FR3 A;  1VQL A;  5IWA Q;  3CCJ A;  1SE8 A;  4JI4 L;  2Z6K C;  1JJ2 A;  3DLL A;  2VZA A;  4YCU A;  3HP3 A;  4A3B H;  3S1M B;  5FLM G;  2EJG C;  2F0W A;  1I4R A;  1E24 A;  5M3F G;  4FYD A;  3CC4 A;  1XYI A;  2OWO A;  5COY A;  1X55 A;  4DV3 Q;  2VUM H;  4EGV A;  5J1Z A;  4K5X A;  4K2L A;  4HMI A;  1TWC B;  4JBM A;  2E74 C;  3PUX A;  1DOL A;  2UUA L;  3PO3 H;  1PMR A;  1Y1V G;  4DR2 L;  3TBI B;  2F0H A;  1VQP A;  2VNU D;  3K5L A;  3QG1 A;  1PLF A;  3G7L A;  1YBY A;  1HZB A;  2R7Z H;  3S16 H;  1EYG A;  2BDN A;  3HKZ B;  3SK4 A;  1CUK A;  1BBW A;  4A4I A;  5AJ3 Q;  4B08 A;  2HUG A;  3PF5 A;  4QQB X;  1J5E Q;  3HOY B;  1SN8 A;  2EDG A;  1PHJ A;  2KBN A;  2RKS A;  2JJQ A;  4HJ5 A;  3D6W A;  5C4X H;  5I2Y A;  3AB9 A;  2CWA A;  1XPO A;  1K8G A;  3TS0 A;  2MO0 A;  1LTG D;  3IKJ A;  3I91 A;  1LV9 A;  1G8Z D;  3HOZ H;  2FMM A;  3CCL A;  1QWY A;  1B9M A;  1DOK A;  1N33 Q;  3KUP A;  4NP5 A;  4WOR A;  2AUK A;  4HJ9 A;  1C48 A;  3NEM A;  4RGO S;  2R93 H;  2DJG C;  1HRJ A;  2KUM A;  4JI7 Q;  1QNU A;  5C0X J;  1T5X D;  1I4Q A;  2JEB I;  3D4W A;  3VA7 A;  2QW7 A;  3PMF A;  2PMZ B;  1DON A;  3BYY B;  5IT9 c;  2GA4 B;  1TQO A;  3P75 A;  2A6E C;  3BS1 A;  1PH3 A;  3UDX A;  4LF6 Q;  5LMU L;  3T13 A;  2WB1 G;  4L63 B;  4A3I H;  4PMW A;  4BWG B;  4YHH Q;  3P20 A;  5E7N A;  1AFP A;  3KDF B;  1XNR Q;  4IUT A;  1R9T H;  4IOC A;  1QVG A;  2F0J A;  2WII B;  1STN A;  2JA6 H;  4C3I H;  4JW0 A;  4UP7 A;  3I70 A;  5DLQ E;  4DV0 L;  2E2I B;  1LTB D;  4A3E B;  3DM3 A;  5ELB A;  3BDL A;  4TQU S;  3HRZ C;  2WAQ G;  4HED A;  1TWA H;  1YHB A;  1VDZ A;  2Z9H A;  1EWI A;  4X3T A;  2WAC A;  2LXJ A;  5IP7 H;  3ERS X;  1WD1 A;  3J7A F;  3J81 j;  4WJ4 A;  4KD3 A;  2RQX A;  4L6T B;  1Q1B A;  4GOP A;  1D1I A;  1DXM A;  5DM7 3;  4C56 C;  5CV7 A;  1I6H B;  3TS2 A;  2OCE A;  1ROD A;  2RSO A;  5EPK A;  1ESF A;  1WVL A;  4QJF A;  4B3M L;  1GKH A;  2N78 A;  4TRD A;  2B2V C;  2B2U A;  4FF2 A;  3J81 c;  2E2H B;  2NZ1 D;  4BXX G;  5FJ8 H;  3EJI A;  2DY8 A;  2B63 H;  1HR0 L;  3M4O H;  4X3S A;  4A3B B;  4KJN A;  1SMY D;  1GHK A;  2UXB L;  3DMU A;  5A35 A;  5K5P A;  3J81 E;  1AP0 A;  4KY7 A;  3JAM L;  1OTC A;  2RA4 A;  1W3S A;  4DV7 L;  2VUM B;  1TII D;  2RF4 A;  3M7N A;  1BCP C;  3N6R A;  5GQO A;  1PH5 A;  4IOA A;  5L37 A;  4YWK A;  3PO3 B;  2CW0 D;  1H9S B;  5EPL A;  1C0A A;  2HHH Q;  5EKI A;  3I4N G;  1GUT A;  1XTC D;  5I2X A;  2GVA A;  4K8J A;  2R7Z B;  3GTO B;  1PYS B;  3S16 B;  1MIU A;  1SYD A;  1TR5 A;  4A3J H;  3M85 A;  4DUZ Q;  1E2V A;  1E3P A;  1F2Y A;  1QIL A;  2UUB Q;  1X65 A;  1N36 Q;  5C4X B;  1LUZ A;  2O2L D;  4QF4 A;  1NR2 A;  1SYG A;  1V1P A;  2K32 A;  2DJF C;  2JA5 G;  4LFC Q;  1CSQ A;  4AQY L;  5JVH 3;  4UHV A;  5M3M H;  3SVM A;  3HOZ B;  3QWN A;  3BDO A;  1PXU A;  1TWH H;  1YIJ A;  1WFQ A;  4EQO A;  5C3E B;  1EEI D;  2K5Q A;  4K6L A;  4PV1 C;  1D8L A;  2K14 A;  1W6J A;  1JWM D;  2IY5 B;  2R93 B;  1GJX A;  3K59 A;  5F2D A;  1XX8 A;  4KHV A;  1WCM G;  1AH9 A;  1HNZ L;  2OXP A;  4DK3 C;  1BCP F;  4LF7 L;  1YZ6 A;  4O1N A;  3J81 i;  4JOI C;  5IP9 G;  2A6H D;  1AW7 A;  3SR1 A;  3J80 c;  4R4T A;  1XTD A;  4A3I B;  4FO2 A;  1VQB A;  4B3R Q;  3C46 A;  1HFG A;  1YNJ C;  3MEH A;  3JAM E;  5JAV A;  1V8Q A;  3J80 E;  1HZC A;  4DV4 L;  1R9T B;  2I07 B;  2JA6 B;  1D1K A;  4C3I B;  1IL8 A;  1Y1W G;  4NXM L;  1I6V C;  1B1Z A;  2AQ2 B;  2NN6 H;  3MVV A;  3N52 A;  4WRD A;  4O0A A;  3Q23 A;  1VQ8 A;  2A69 C;  4A3F H;  2NVT H;  1TWA B;  3TRZ A;  3HS0 C;  2F0V A;  1KLU D;  1YI2 A;  2UXC L;  3GTL H;  1OXU A;  3A56 A;  1U9R A;  5J22 A;  3VYT A;  4JV5 Q;  1X6O A;  1L0X B;  4IZ8 A;  3UE1 A;  4QIW B;  1LTS D;  4CDF C;  4IFD I;  4N9T A;  3S24 A;  1TWF H;  2EXZ A;  2XTI A;  5JPN C;  2KHI A;  1EY4 A;  3CRL C;  5BN5 A;  1AE2 A;  2Q8T A;  3CPF A;  4JI1 Q;  1YHA A;  5KYL A;  3M4O B;  1NR4 A;  3MHB A;  1PFB A;  2B2W A;  3GV3 A;  2ZXR A;  4JI3 L;  4GS3 A;  2HDL A;  2LS0 1;  5KNB A;  2ENB A;  2G9H D;  2YTX A;  4TVA B;  2L9H A;  4H44 C;  1CKN A;  3T1H L;  1X9N A;  4OO1 I;  5FLM H;  3X3N A;  1MKH A;  5M3F H;  4RH6 A;  3JAM i;  3HOX G;  3J80 i;  3NE5 B;  2QF7 A;  1PRT D;  2L55 A;  1V43 A;  4RCN A;  4X65 Q;  3R2I A;  4BBR H;  4CGY B;  1K3R A;  4XIG S;  2L5T A;  4DV3 L;  2H1E A;  2KJX A;  3NSW A;  4MNO A;  2XWB B;  4A3J B;  1MSG A;  1Y1V H;  2KCN A;  1EQQ A;  2RHS B;  3F2U A;  4P75 A;  1PYB A;  4K2K A;  1GD7 A;  4XQQ A;  4IUU A;  3T51 B;  1DGS A;  4NXN Q;  3VYU A;  3K81 C;  2PQA B;  2K5D A;  1X3E A;  4R8N A;  4ZUI A;  3SK6 A;  1B4O A;  4L5R C;  3PGZ A;  2EYM A;  4LF8 Q;  1EY5 A;  4RGT A;  2UUC Q;  1IW7 D;  4NKL A;  2A8V A;  5M3M B;  3GTG B;  2K28 A;  2I46 A;  2ZM6 L;  3M4P A;  1TWH B;  2IHE A;  3T4A C;  1A6X A;  2IJ0 A;  2L15 A;  3QJY A;  4ME5 A;  4WJ3 M;  1TY2 A;  1QB5 D;  2K75 A;  2K7V A;  2LY7 A;  1N8R C;  3I4L A;  3PUW A;  4FF1 A;  2A19 A;  4IFD G;  2PI2 A;  4CKE A;  3RZD H;  3CCU A;  4RCO A;  3L2P A;  2HCC A;  2ASB A;  2N3S A;  1CI3 M;  3CCS A;  2N88 A;  2F0G A;  3TP5 A;  1K73 C;  3C1F A;  1SYC A;  3PSI A;  3AYH B;  3GDE A;  3IL8 A;  4KLK A;  4G7Z C;  2Q2I A;  3MTS A;  2RDF A;  4LFA Q;  1PH8 A;  3CRK C;  2J0T D;  4GN4 B;  1FNV A;  1GO3 E;  1OXS C;  1U4P A;  2JK8 A;  4G7H C;  1TT2 A;  2CH4 W;  4P71 A;  5A2Q L;  2VQE Q;  5JEA G;  4YHH L;  4A3F B;  2NVT B;  3IFD A;  5KNC A;  3GTP B;  3SEB A;  5ELD A;  3GTL B;  1F2L A;  4N9P A;  1EEF D;  4GKJ L;  4JK1 C;  2J4X A;  4B9W A;  3S14 H;  1STE A;  3ULL A;  1QJO A;  2DUD A;  3VDY A;  1L1O A;  1V1O A;  1TWF B;  3VR4 A;  2NTT A;  3K0Y A;  1YIT A;  4DXG A;  4CDD C;  1PFN A;  2D5D A;  3OHX C;  1SMY C;  4HR7 B;  2C5C A;  5IGE A;  1PV4 A;  1LTL A;  3HZX A;  4KI0 A;  1VMP A;  4JI8 L;  4FXD A;  4HID A;  1I94 L;  3DWQ A;  5COR A;  3DXJ C;  4BXX H;  2A68 D;  2QEJ C;  1ZYR D;  2B63 G;  1CSP A;  1BNZ A;  5I4D A;  5C3W A;  2CW0 C;  1B3A A;  1FGB D;  3VYS A;  2KHS A;  3RNU A;  5GAG C;  2UU9 L;  4HCE A;  1C7Y A;  2ZT9 C;  1RKN A;  2F0L A;  5M3F B;  2CH4 A;  3SGI A;  4RG1 A;  1EWC A;  2PZU A;  3KK7 A;  1SYE A;  3U50 C;  2OTJ A;  1HTL D;  1NMF A;  1S5F D;  4BBR B;  5CBA E;  2PPB C;  3VR2 A;  2AHO B;  3B6Y A;  5DAU A;  1Y1V B;  1HR0 W;  2FIN B;  4A3D G;  3ULP A;  2Q2T A;  3T53 B;  4EX5 A;  1JOQ A;  2Y0S E;  2Z6K A;  3I4N H;  3OIP A;  2PO4 A;  2HQL A;  4MN3 A;  2R7D A;  2IX0 A;  4OHJ A;  4OIK A;  3A8I E;  5FKA C;  4F7X A;  1ET9 A;  3W3A A;  4I65 A;  5T1G A;  3QOJ A;  5EKK A;  2YTV A;  2F0I A;  3CF5 A;  1EY6 A;  5EQ0 A;  4DGZ A;  4R1J A;  3AQQ A;  3UDI A;  1E2W A;  2IL8 A;  1Q86 C;  2EYP A;  1HFN A;  5JJL A;  2F0Q A;  3TRE A;  2JA5 H;  1CQV A;  4C3J G;  1HPC A;  1WTH A;  2A6H C;  3J7A V;  3TDQ A;  4IPC A;  2VQF Q;  3RZD B;  3LWU A;  1GUG A;  2FHT A;  1HNX Q;  3BZC A;  4DV1 Q;  1E7Z A;  1EY7 A;  1HJP A;  4DUY Q;  1D5M C;  1Q1E A;  1DD2 A;  4EQ5 A;  2QEX A;  2ALY B;  3BVM A;  1WCM H;  3T1Y Q;  4PMC A;  1KD1 C;  4JI5 L;  4UAI A;  3T16 A;  4X64 Q;  1T5E A;  3EA6 A;  5IP9 H;  1IBK Q;  1FD7 D;  5IYC H;  1FYC A;  1JMC A;  4LWC A;  3W2D A;  2DNC A;  2WB1 B;  3VR3 A;  3V05 A;  4HSP A;  5KGU A;  2WKC A;  4I7Z C;  5C4J H;  1JIC A;  1FJG L;  3A0J A;  3I56 A;  1SYB A;  2XRS D;  4RHR A;  3F2C A;  4J8Q A;  2E75 C;  3KLR A;  4ZKC B;  5IY0 A;  4EVO A;  3NBI A;  3G6E A;  2D0O A;  4JYA L;  3CXC A;  4JBW A;  4EQP A;  2PYK A;  1K8O A;  1E22 A;  2XVS A;  1LM0 A;  2H5X A;  2WAQ B;  1EY8 A;  2F4V Q;  4DV2 Q;  4DR3 L;  3S14 B;  3TZU A;  5FO8 B;  4PMB A;  1HUM A;  3DWA A;  1XMQ Q;  4ODG A;  5I9O A;  4M8A A;  4FXK C;  4C2M H;  1F2Z A;  4WJW A;  3TME A;  5IE8 A;  4POG A;  1BOS A;  2D62 A;  2F3V A;  3D0F A;  1VQA A;  1O80 A;  3MAQ A;  1S40 A;  1VQG A;  4B3T L;  1HA5 A;  1ENC A;  3RMH A;  1HCZ A;  4XYO A;  1F9Q A;  3NEL A;  4X66 Q;  1XPR A;  4JI6 Q;  1D2B A;  3D4R A;  4JCV E;  3I3C A;  2MUY A;  5BN4 A;  2DY7 A;  5KND A;  4GKK Q;  3S2D H;  4QUC A;  5CV9 A;  3NHH A;  5JJK A;  1YNX A;  4UP9 A;  4ZRZ A;  1U0L A;  2RCF A;  5JOB A;  1U4M A;  3BVG A;  1JJC B;  1K28 A;  1RL2 A;  3SK5 A;  1SJE D;  4DR4 Q;  4C3H G;  1PTO H;  3HOX H;  1IBL L;  1WI5 A;  3I4N B;  1KQS A;  5HY6 A;  1VMC A;  3I72 A;  5M5W H;  4BBR G;  3RN5 A;  1B7Y B;  1CTM A;  1G51 A;  1IW7 C;  3VR5 A;  2B8F A;  2VB3 X;  1F9S A;  1SNP A;  1I50 H;  1KDC A;  2L4N A;  1WTV A;  2VS1 A;  4NB3 A;  1JOR A;  2ZJP A;  4ZQ3 A;  5LMN L;  1UEB A;  2WFW A;  1VQI A;  3FRP B;  4ID6 A;  4OXP A;  2EIF A;  1EIF A;  1SAP A;  3MXP A;  3I7F A;  4LF4 L;  3QIA A;  3QR8 A;  3S2H H;  2JA5 B;  1AZQ A;  1Q8K A;  4ZKB B;  5FK9 C;  4GOP B;  1KIX A;  1NAP A;  4KHP Q;  3KYH C;  1VQH A;  1J8I A;  3OTO Q;  3A5Z B;  1PRT F;  3DHQ A;  1NTG A;  1PH2 A;  2IX1 A;  1KL9 A;  4I7A A;  2I5L X;  2ZJR A;  2O5I C;  5C4Z A;  4E6I A;  1WCM B;  1KDB A;  1BDO A;  4L5T A;  4A3K G;  4HN7 A;  4IFD H;  2Z0S A;  3M7G A;  2EYO A;  2PI2 E;  1EIH A;  1NBW A;  2K05 A;  1EOV A;  2KEC A;  1DCZ A;  3NEN A;  2HDM A;  4QB4 A;  3ZJY C;  1AZP A;  2WV6 D;  4LUV A;  2K5V A;  1SJH D;  5C4J B;  1SMX A;  2B2Y C;  3E0J A;  3HOW G;  1SLJ A;  3SK8 A;  5JJI A;  2EYJ A;  4CKB A;  2F52 A;  2HT1 A;  3NUC A;  1Y1W B;  2KA7 A;  4JOI A;  1QUQ A;  2SNM A;  1J9O A;  3OOC A;  3LX0 A;  3EVQ A;  3KFU A;  5JEA H;  3E3X A;  4BA1 I;  2N55 A;  1YJW A;  1EZ8 A;  3NP8 A;  4QMG A;  2VQE L;  2JQO A;  3CC7 A;  3UDG A;  4ZAI A;  5C5M A;  2A73 B;  4DA2 A;  2EOT A;  1KXL A;  4C2M B;  1PTO D;  2XN9 C;  3HGB A;  1IL2 A;  3U9O A;  3BG3 A;  1CA6 A;  3F1Z A;  1PVO A;  3TZD A;  3HOV G;  1V1P B;  1ZXT A;  1L0Y B;  2K1B A;  4OL7 A;  4RKB A;  2A68 C;  3RLN A;  3I55 A;  1ZYR C;  3IFT A;  4ULL A;  3AFQ A;  1BXT A;  2X6L A;  4DAY A;  3FHW A;  3CD6 A;  4DR7 L;  2FJ2 A;  5EGT A;  4LF5 Q;  4OEM B;  1TY0 A;  2EYF A;  2F0U A;  5CV8 A;  1CHP D;  3J7Y W;  5CV5 A;  5CMD A;  1OO9 B;  5IYB H;  1L2F A;  4DR6 Q;  2IT1 A;  1MHW C;  2NVY H;  5FO7 B;  3FEW X;  4NW2 A;  3PO2 G;  1PH7 A;  1PTO B;  3HOX B;  1N32 L;  1Q81 C;  3Q6S A;  1JWU D;  1GHJ A;  5M5W B;  1NJI C;  3H3V C;  1Q90 A;  1VQE A;  3FDT A;  4A3D H;  1GUS A;  2VB2 X;  2SOB A;  1I50 B;  4ZK9 B;  4DAV A;  5D3I B;  1R4Q B;  3C2P A;  4APV A;  1Q46 A;  3HFZ B;  2RCN A;  1AEX A;  2F0P A;  3I8Z A;  4JI0 L;  4DPG A;  1KRS A;  5E4X A;  1I4P A;  4IUN A;  5ELO A;  1LTR D;  1M8A A;  3CC2 A;  2E5L Q;  5EAY A;  2A1A A;  1YVC A;  4BY7 G;  1MJC A;  1PFM A;  4B3S Q;  4C1N I;  4C3J H;  1H9K A;  1H9J A;  1GOZ A;  2F3W A;  1O7Z A;  4IFD J;  1KLG D;  4N8X 1;  1VQ9 A;  4JI2 Q;  5IOD A;  1ICW A;  1NNX A;  1VCI A;  1HNX L;  1GVP A;  1R4P B;  1X3G A;  4DV5 L;  4FF3 A;  4LF9 L;  2O5J C;  3URY A;  2EJF C;  4J6H A;  1CKN B;  1EL0 A;  4LUZ A;  1ICF B;  2Q2U A;  3JC6 6;  5IYC G;  1PH6 A;  1HZ9 A;  3JAM c;  3A5U A;  4KK7 A;  2PNR C;  1YNN D;  5BR8 L;  2G5D A;  5IGG A;  4LFB L;  3STB C;  3K5O A;  5JEA J;  2B2T C;  1EY0 A;  4EQN A;  1KRT A;  1VQ6 A;  2Y0S G;  1SR3 A;  4R4C A;  3ONA B;  2EPB A;  2YV5 A;  4ME3 A;  3U58 A;  3NK9 A;  4DR5 Q;  3CMA A;  2KQ3 A;  2F0N A;  3CCE A;  3NBH A;  2E8G A;  1F9P A;  5FLX L;  4RWS C;  5CR3 A;  5EBC A;  2EYH A;  4X62 Q;  2BH2 A;  1VQ5 A;  2NWG A;  1JE5 A;  1GUN A;  3EBE A;  4CHT B;  3MZ5 A;  2EE1 A;  3WDN A;  5EJW A;  4CJ2 C;  2MO1 A;  4IUR A;  1EFW A;  1RTN A;  1U4L A;  1EWH A;  1PZK D;  4JPB W;  1O7Y A;  4POF A;  2OF1 A;  4A3G G;  4Y52 H;  4IUV A;  4FF4 A;  3S1N H;  4GOP C;  1SFO H;  1SBB B;  4LAA A;  2KCC A;  3MXU A;  1XNQ L;  2B63 B;  1WTW A;  2NVY B;  4UY8 C;  1TU2 B;  2YYZ A;  4V0B A;  3D31 A;  1CA5 A;  5E3F A;  1U4R A;  1UE5 A;  3ND8 A;  3X3M A;  2B2U C;  2C35 B;  2VL6 A;  5G3L D;  1IZ6 A;  1EU3 A;  1HXY D;  4CJ0 B;  3PIO 3;  4NDX A;  1F77 A;  1WTP A;  2YTY A;  4R4O A;  2RDH A;  5T1I A;  1XXG A;  2LSS A;  1S5D D;  5IWA L;  3F2B A;  3WWV A;  4C3H H;  4A3D B;  1SYF A;  2PZW A;  1ASY A;  1LTA D;  2DGY A;  3HOU H;  1OXX K;  2R7F A;  1ZEQ X;  2NYZ D;  5HGQ A;  2JA8 H;  2SNS A;  1SDF A;  1SRO A;  4F88 A;  4JI4 Q;  1D7Q A;  1KNA A;  2JE6 I;  3RZO H;  2ID0 A;  4U68 A;  2LMC B;  2HIX A;  1M4V A;  1G2T A;  1LT5 D;  2D0P A;  5M5X H;  3PQI A;  3K80 C;  1GXD C;  3E6Z X;  1V9P A;  1B50 A;  1A63 A;  1C8C A;  5FLX E;  2O4X A;  1L1O B;  1LYL A;  1SE4 A;  3S17 H;  4RHS A;  4TSS A;  1EYA A;  4C3J B;  2MP1 A;  5AJ3 L;  2L11 A;  4KHZ A;  5JJZ A;  1J5E L;  2XSC A;  1I4X A;  3R8B A;  2UXD Q;  3CME A;  1KTK A;  5EKL A;  5LMN W;  1A8V A;  1Z47 A;  4LUO A;  1PRT B;  3IAY A;  4O2D A;  4B9X A;  1EZ6 A;  4A3K H;  3OMG A;  1K9M C;  4MZ9 A;  4A3L G;  1UWV A;  2OQ0 A;  2XRQ D;  1Y69 U;  1QNK A;  1BKB A;  1JQY D;  1N33 L;  1CM9 A;  4KN7 C;  3A74 A;  1A2T A;  1WTO A;  1II3 A;  2KOL A;  3BZK A;  1MGS A;  2E2J H;  4XDX A;  4JI7 L;  4PZ8 A;  1JE4 A;  2IHF A;  3OYY A;  3HOW H;  4IPD A;  2HIV A;  1PTO C;  4OO1 G;  4LF6 L;  3S1Q H;  3I90 A;  5EBD A;  2E76 C;  4HIO A;  4A3M G;  1X3P A;  3Q8D A;  3TP8 A;  3HG9 A;  2AWO A;  1HH2 P;  3L0O A;  3MXN B;  1XNR L;  5TSS A;  5LMU Q;  1VQM A;  4MTN A;  5IGD A;  2QKI C;  5HGT A;  4OIJ A;  2D9U A;  3GTJ H;  1VF7 A;  1CKO A;  1P16 A;  4DK1 A;  1W2B A;  4MTK A;  2JA7 G;  4U67 3;  3HOV H;  3DEO A;  1I4G A;  4CKC A;  3EFX D;  1L0W A;  2FMC A;  5C44 H;  3S1N B;  4Q0F A;  3ERO A;  4NMZ A;  2NTS A;  4KY5 A;  3U9S A;  3NWS A;  4KKS A;  5KYI A;  4GNX A;  2JA9 A;  3KF8 A;  1A3T A;  1NUC A;  1ZKO A;  2PW5 A;  5IGC A;  1IKL A;  5IYB G;  3OW7 A;  1KAA A;  3CP0 A;  3HKZ E;  2Q8I B;  1Z6H A;  3HEJ A;  1F2M A;  2B2W C;  1PTO F;  4RMF A;  5C4H A;  4WFN 3;  1Q7Y C;  1JOK A;  4ZCK A;  1H9M A;  2MNA A;  3PO2 H;  2BE5 D;  4MIU A;  4C3H B;  4B3M Q;  4ILW A;  1LO5 D;  2IW3 A;  1IHZ A;  4ZYS A;  3RZO B;  1QVC A;  3KOJ A;  1HR0 Q;  5LL6 X;  1TKW B;  1HHV A;  1EU4 A;  1YJN A;  4GN3 B;  2Z4H A;  1JOO A;  1N34 Q;  2HD3 A;  1FGU A;  5M5X B;  4DV7 Q;  1I4H A;  2HHH L;  3H94 A;  4JVZ A;  4AH6 A;  1E0B A;  5A2Q E;  5LL6 S;  3W1B A;  2MPM A;  2NBF A;  3KF6 A;  5ELE A;  1KHI A;  3S17 B;  5FOB B;  4L5Q A;  1A2U A;  4DUZ L;  1CZG A;  1IBM Q;  4H13 C;  3RUZ A;  3LNN A;  4K6D A;  2UUB L;  1N36 L;  1VS0 A;  2L12 A;  4BY7 H;  1PYW D;  4X6A H;  2QDB A;  2WIN B;  2KHJ A;  3GTM H;  2BA1 A;  2KVM A;  3ND9 A;  3UDF A;  4A3K B;  5C5L A;  2EY5 A;  4LFC L;  3WOE A;  1D5X C;  5KEE A;  2K50 A;  2F0S A;  1YNN C;  4PZ7 A;  2P5Z X;  1SND A;  3F8T A;  3NWT A;  1Q82 C;  1YEZ A;  1E1T A;  1RD9 D;  4JI2 L;  2CVR A;  3Q0A A;  4AQY Q;  1LAB A;  1TXY A;  3TN2 A;  1EUJ A;  3UI2 A;  2E2J B;  1TS3 A;  2A74 C;  3Q24 A;  3E0E A;  2LFN A;  2IX3 A;  3HOW B;  3CKI B;  3T56 B;  3J7A 5;  2I5H A;  1X3F A;  4ZLT F;  4A75 A;  3A7L A;  1Z7T A;  2I5M X;  1HTP A;  3S1Q B;  1BR9 A;  1JCK B;  3SXH A;  3GQB A;  3GD7 A;  4LF7 Q;  4DV6 Q;  4B3R L;  3TEH B;  1JB3 A;  2KCT A;  1ESR A;  2KCM A;  5E1F A;  5J3B A;  1S3O A;  2XGT A;  2ES2 A;  1C4Q A;  1RHP A;  4GLA C;  2B3G A;  2M00 A;  2A5H A;  5EPJ A;  1GUO A;  3GTJ B;  4PNY A;  4XT1 B;  2ZXP A;  2Q8R E;  4DR5 L;  5ELN A;  3HOV B;  4DV4 Q;  5I6Y A;  2N8N A;  1B9N A;  4K0K Q;  4X62 L;  5ELF A;  2CQO A;  1Q3L A;  4BY1 G;  1FL0 A;  1XMO Q;  2SDF A;  1PH4 A;  1O7I A;  4MHE A;  3IRB A;  2EJM A;  1H9R A;  3K0X A;  1L1O C;  2VY3 A;  4A3G H;  4JV5 L;  1WOC A;  1UUP A;  4OWT B;  3KJO A;  4A93 G;  1YNJ D;  3H0G G;  4A76 A;  2QIL A;  1STH A;  2XNA C;  1EFI D;  1EQV A;  1K8A C;  4Z9C B;  1J6Q A;  2AWN A;  5GAH C;  4JI1 L;  1PRT C;  1WJJ A;  4PQX A;  3PO2 B;  3W1G A;  1K0R A;  5JPM C;  1BQQ T;  4KKU A;  2LKV A;  4IPH A;  2A69 D;  1YJ9 A;  1CFM A;  1HQM C;  4UDU C;  1MI2 A;  1ILQ A;  2B2V A;  4XXE A;  3FKI G;  3MA2 B;  4QUF A;  3V96 A;  2L0C A;  1SE2 A;  1BUV T;  4LJZ C;  1TWG H;  1QUQ B;  1EQT A;  4DK0 A;  3HOU G;  4R9W A;  2KEN A;  2F0D A;  2JA8 G;  1EYC A;  2EYL A;  2R92 G;  3PIO A;  2M2L A;  4DF7 A;  5ISR A;  4YWM A;  1XJV A;  3H3V I;  1GM5 A;  2CKZ B;  4X65 L;  3MFY A;  3RN2 A;  4RAU C;  2AUJ D;  1A62 A;  3M9B A;  1CZW A;  5IT9 L;  1JR0 D;  1LLR D;  5G3L F;  1X56 A;  4DR1 Q;  4NXN L;  1MBY A;  5D3D A;  3I4O A;  2N49 A;  4HMJ A;  3FP9 A;  1WTR A;  4BY7 B;  2BA0 A;  3A54 A;  4FXG C;  1S5C D;  3GTM B;  3I73 A;  3DEP A;  1Y8P B;  4DAY B;  1Y8O B;  4LF8 L;  2TSS A;  2UUC L;  1PH9 A;  1VQJ A;  1K3B C;  1KDA A;  4LMQ D;  4DN4 M;  3E9I A;  2UXD L;  3OWE B;  4HTH A;  5CYU A;  3GTO H;  4KJO A;  3AFP A;  2BCO A;  1G91 A;  4QY7 A;  4DNI A;  1S5E D;  1UE7 A;  2ZM6 Q;  4A3L H;  4Y7N H;  1M1K C;  2OTL A;  3PV0 A;  4OX9 Q;  3D8G A;  1VQN A;  4P74 A;  4RFB A;  1A3V A;  2K03 A;  3EN2 A;  1BF4 A;  1SRU A;  4PZ6 A;  3ZYY X;  1Q8I A;  1EOT A;  3OPO A;  2EXD A; 
#chains in the Genus database with same CATH homology
 4DV5 Q;  3HKS A;  2ASB A;  4YCW A;  2N3S A;  4QIW E;  1HNZ Q;  3JC6 6;  5IYC G;  1PH6 A;  2Q2U A;  4QGU A;  3CCS A;  1HZ9 A;  4LF9 Q;  3JAM c;  3KLW A;  1CKM A;  3E9H A;  4J15 A;  3A5U A;  1K73 C;  1A0I A;  1QZG A;  2MFI A;  3PSI A;  5BR8 L;  1C9O A;  4LFB L;  4LFA L;  3AYH B;  3GDE A;  5C3E H;  4KLK A;  3STB C;  4L5S A;  5BR8 Q;  3CW2 C;  2CFM A;  1VQC A;  2Q2I A;  4LFB Q;  4LFA Q;  4ALP A;  5JEA J;  4A3M H;  3CAM A;  1PH8 A;  4GN4 B;  3K7A H;  1GO3 E;  1OXS C;  2JK8 A;  1KRT A;  2Y0S G;  1PA6 A;  1VQ6 A;  3GTQ H;  4BBS G;  1SR3 A;  1G29 1;  4R4C A;  4NPS A;  2YV5 A;  1IYJ B;  1FVI A;  2K5N A;  4ME3 A;  5H1S E;  3U58 A;  1JT8 A;  5K36 G;  4P71 A;  4DR5 Q;  4YWL A;  4HJ7 A;  3CMA A;  3CCE A;  2VQE Q;  4OWW B;  3GTK H;  5JEA G;  2E8G A;  4YHH L;  3CCV A;  4NXM Q;  2WP8 J;  2I0Q A;  1VQ4 A;  1VQO A;  3MEF A;  4X62 Q;  2JA7 H;  2BH2 A;  1Y1W H;  1VQ5 A;  1JE5 A;  1KAW A;  3I2Z A;  2AKW B;  2NN6 G;  3I4M G;  4GKJ L;  3EBE A;  3S15 H;  5C44 G;  4A3F G;  2ZTC A;  3STB D;  4GLX A;  2UXC Q;  3S14 H;  3ULL A;  2MO1 A;  4GKJ Q;  1EFW A;  2VW9 A;  3U4V A;  2DUD A;  3VDY A;  4POF A;  2CCZ A;  1I5F A;  1Z9F A;  4A3G G;  1L1O A;  1B70 B;  2E2I H;  4A3E H;  1ASZ A;  1YIT A;  4Y52 H;  4GNX C;  2K5H A;  2JEA I;  1IXR A;  3S1N H;  4GOP C;  1SFO H;  4PG3 A;  4AIM A;  1XNQ L;  2ATW A;  3G71 A;  4JBK A;  4UY8 C;  2FXQ A;  2YYZ A;  1PV4 A;  1LTL A;  1Q12 A;  3GO5 A;  4KI0 A;  1HNW L;  4JBJ A;  3D31 A;  4OWX B;  1XNQ Q;  1UE5 A;  2BH8 A;  4JI8 L;  2OQK A;  2C35 B;  2VL6 A;  4HID A;  1I94 L;  1X54 A;  1B8A A;  1IZ6 A;  4UP8 A;  4BXX H;  2PNH A;  4P72 A;  4JI8 Q;  4UPA A;  1CSP A;  2B63 G;  2YTY A;  4R4O A;  1I6H H;  4JI3 Q;  1I94 Q;  3F2D A;  1UE1 A;  3RR5 A;  1RIP A;  3RNU A;  2LSS A;  5GAG C;  2UU9 L;  1C7Y A;  5IWA L;  3KJP A;  3W5O A;  3LGJ A;  3SGI A;  4RG1 A;  3WWV A;  4C3H H;  5IYD G;  3F2B A;  3T1H Q;  2E2H H;  2UU9 Q;  1VQL A;  5IWA Q;  3CCJ A;  1SE8 A;  1ASY A;  4JI4 L;  2Z6K C;  4P73 A;  2DGY A;  3U50 C;  5C0X I;  3DLL A;  1JJ2 A;  2VZA A;  1OXX K;  2R7F A;  4YCU A;  1NMF A;  3NBH B;  5HGQ A;  1OXV A;  5FLM G;  5GAD C;  3J7Z C;  2ZJQ A;  2JA8 H;  1SRO A;  4AYB G;  4JI4 Q;  1D7Q A;  1E24 A;  2JE6 I;  5M3F G;  3RZO H;  2AHO B;  2ID0 A;  3CC4 A;  3B6Y A;  1N34 L;  2K4K A;  1HR0 W;  2OWO A;  2HIX A;  3ULP A;  2Q2T A;  4A3D G;  1X55 A;  4EX5 A;  2Y0S E;  4DV3 Q;  2Z6K A;  2VUM H;  3I4N H;  2HQL A;  2R7D A;  2IX0 A;  2D0P A;  5M5X H;  4JBM A;  3K80 C;  3RLF A;  3PUX A;  2UUA L;  3PO3 H;  1Y1V G;  2YTV A;  1V9P A;  4YY3 Q;  3CF5 A;  4DR2 L;  1A63 A;  1VQP A;  2VNU D;  1L1O B;  1LYL A;  4IJL A;  1IBM L;  1YBY A;  3S17 H;  1HZB A;  4R1J A;  3AQQ A;  2R7Z H;  3KDF A;  3UDI A;  3S16 H;  1EYG A;  5AJ3 L;  4A3C G;  1J5E L;  4KHZ A;  2UXD Q;  1CUK A;  2NZH A;  3CME A;  1Q86 C;  1BBW A;  4A4I A;  5AJ3 Q;  5LMN W;  3AEV A;  3PF5 A;  4QQB X;  1J5E Q;  5JJL A;  3TRE A;  1SN8 A;  1PHJ A;  1A8V A;  2JA5 H;  1Z47 A;  4LUO A;  2KBN A;  1V1Q A;  2JJQ A;  4HJ5 A;  2VQF L;  3ICE A;  5GRO A;  2YU9 H;  1HZA A;  3HKZ G;  4O2D A;  5C4X H;  2CWA A;  4A3K H;  4DV1 L;  1XPO A;  4IPC A;  2VQF Q;  3CCM A;  4DUY L;  4MZ9 A;  1K9M C;  4A3L G;  1K8G A;  1UWV A;  1VQD A;  2OQ0 A;  3BZC A;  3TS0 A;  1HNX Q;  1BKB A;  3HOY G;  1G6P A;  3T1Y L;  2MO0 A;  1E7Z A;  1HJP A;  4DV1 Q;  4DUY Q;  1N33 L;  1Q1E A;  4EQ5 A;  2QEX A;  3GTG H;  3HOZ H;  4X64 L;  2ALY B;  1WCM H;  3A74 A;  3T1Y Q;  1KD1 C;  3CCL A;  4JI5 L;  1IBK L;  1N33 Q;  2B29 A;  4X64 Q;  3BZK A;  4HJ9 A;  4QL5 A;  2E2J H;  3NEM A;  4JI5 Q;  1IBK Q;  4PZ8 A;  5IP9 H;  4JI7 L;  5IYC H;  2IHF A;  3OYY A;  1JMC A;  3HOW H;  4IPD A;  2R93 H;  4LWC A;  2R6G A;  4JI7 Q;  5C0X J;  1EQR A;  2Q2H A;  2NVQ H;  2JEB I;  5C4J H;  4OO1 G;  4DV6 L;  4LF6 L;  3S1Q H;  5IT9 c;  1FJG L;  3H15 A;  4HIO A;  3A0J A;  3I56 A;  4A3M G;  1PH3 A;  3F2C A;  3UDX A;  1KC8 C;  3RLO A;  4LF6 Q;  1JB7 A;  1FJG Q;  2NZO A;  5LMU L;  5IY0 A;  2WB1 G;  3Q8D A;  2EQS A;  2AWO A;  5C0X G;  3K7U C;  4A3I H;  1HH2 P;  3L0O A;  3G6E A;  3MXN B;  1XNR L;  4PMW A;  4YHH Q;  3CCR A;  2D0O A;  5E7N A;  5LMU Q;  1S72 A;  4JYA L;  3CXC A;  1VQM A;  4DAM A;  4JBW A;  4MTN A;  3KDF B;  4DV2 L;  1XNR Q;  2F4V L;  1M90 C;  4JYA Q;  1E22 A;  1LM0 A;  1R9T H;  4IOC A;  4BY1 H;  2H5X A;  1XMQ L;  3GTJ H;  1QVG A;  2F4V Q;  1CKO A;  1P16 A;  4DV2 Q;  4DR3 L;  1W2B A;  2JA7 G;  2JA6 H;  3M4Q A;  4C3I H;  2MQH A;  3HOV H;  1XMQ Q;  4UP7 A;  4DR3 Q;  5DLQ E;  1XMO L;  4DV0 L;  3PUV A;  1P8L A;  3DM3 A;  4HJA A;  4C2M H;  1L0W A;  3EIV A;  5C44 H;  4TQU S;  4A93 H;  5IE8 A;  2WAQ G;  3H0G H;  4POG A;  4IPG A;  1TWA H;  1H95 A;  4XTC S;  2D62 A;  2GN5 A;  1YHB A;  3D0F A;  3GTP H;  1EWI A;  1VQA A;  3PUY A;  2LXJ A;  1S40 A;  1JJG A;  4A3E G;  4R4I A;  5IP7 H;  3ERS X;  1VQG A;  4B3T L;  4GNX A;  4X66 L;  2JA9 A;  3J81 j;  4WJ4 A;  1Q1B A;  4JI6 L;  4GOP A;  3ER0 A;  5IYB G;  5GAE C;  1HNW Q;  3NEL A;  3CP0 A;  4B3T Q;  3HKZ E;  4X66 Q;  3TS2 A;  2OCE A;  3G48 A;  4OON A;  1XPR A;  4JI6 Q;  4GKK L;  4QJF A;  4B3M L;  1OXT A;  1GKH A;  2N78 A;  4JCV E;  4RMF A;  2CWP A;  1Q7Y C;  1NY4 A;  2MNA A;  3PO2 H;  4GKK Q;  3J81 c;  4B3M Q;  3S2D H;  3FKI H;  5FJ8 H;  4BXX G;  2B63 H;  5JJK A;  1YNX A;  4UP9 A;  1HR0 L;  3M4O H;  4DR4 L;  1U0L A;  1JJC B;  1RL2 A;  4JG2 A;  1QVC A;  3KOJ A;  1HR0 Q;  2R92 H;  4DR4 Q;  2UXB L;  2AMC B;  1YJN A;  4H02 A;  1Y14 B;  3HOX H;  1OTC A;  1IBL L;  4GN3 B;  4BA2 I;  1W3S A;  1WYD A;  4IJH A;  4DK6 C;  4DV7 L;  1WI5 A;  5FLX c;  1KQS A;  2RF4 A;  4HJ8 A;  5HY6 A;  1FGU A;  1N34 Q;  1IBL Q;  3M7N A;  4A3B G;  5M5W H;  4DV7 Q;  4BBR G;  3RN5 A;  1B7Y B;  5GQO A;  2QA4 A;  1PH5 A;  2HHH L;  1G51 A;  4IOA A;  4YWK A;  4AH6 A;  3W1B A;  2WB1 E;  2HHH Q;  1C0A A;  3BU2 A;  3KF6 A;  2VUM G;  1KHI A;  2UUA Q;  1I50 H;  3I4N G;  4DR1 L;  2VS1 A;  2ZTD A;  4NB3 A;  2GVA A;  3U4Z A;  4L5Q A;  2ZJP A;  5LMN L;  1UEB A;  2WFW A;  1VQI A;  3BJU A;  4OXP A;  1PYS B;  4DUZ L;  2OTJ A;  1MIU A;  4K0K L;  3PCO B;  2EIF A;  1IBM Q;  3PO3 G;  1EIF A;  2UUB L;  5LMN Q;  4A3J H;  3M85 A;  4DUZ Q;  4IO9 A;  1E3P A;  3I7F A;  1BBU A;  1VS0 A;  2F3I A;  1N36 L;  4LF4 L;  4BY7 H;  3S2H H;  2UUB Q;  4X6A H;  4KHP L;  3HOU H;  2KHJ A;  3GTM H;  1Q8K A;  2R7Z G;  1X65 A;  2BA1 A;  3UDF A;  3OTO L;  4GNX B;  1N36 Q;  4LF4 Q;  3KF8 B;  4GOP B;  1KIX A;  1LUZ A;  4KHP Q;  3KYH C;  1VQH A;  4FDB A;  4LFC L;  3OTO Q;  3A5Z B;  3OW2 A;  2K50 A;  2IX1 A;  2WAQ E;  1NTG A;  1PH2 A;  1KL9 A;  4PZ7 A;  2I5L X;  2JA5 G;  2ZJR A;  4LFC Q;  1CSQ A;  1K83 H;  3F8T A;  4AQY L;  1Q82 C;  1YEZ A;  1E1T A;  5M3M H;  4JI2 L;  5C4X G;  4L5T A;  4A3K G;  4AQY Q;  4OX9 L;  1TXY A;  1TWH H;  1E1O A;  1YIJ A;  1EUJ A;  1WFQ A;  2Z0S A;  4R4Q A;  2PI2 E;  1NBW A;  4GLV B;  1EOV A;  4HIK A;  3E0E A;  1D8L A;  2K14 A;  2IY5 B;  3J7A 5;  3HOZ G;  3NEN A;  2I5H A;  1VQF A;  1X3F A;  3ZJY C;  1WCM G;  4A75 A;  1AH9 A;  1HNZ L;  4LUV A;  2K5V A;  4DK3 C;  2I5M X;  1SMX A;  4LF7 L;  1YZ6 A;  5C3E G;  1EIY B;  3J81 i;  4JOI C;  5IP9 G;  4A3B H;  3GD7 A;  2GVB A;  1SLJ A;  3HOW G;  2R93 G;  4LF7 Q;  2K52 A;  3G4S A;  4DV6 Q;  3J80 c;  4B3R L;  3TEH B;  5JJI A;  2KCT A;  4R4T A;  2KCM A;  1XTD A;  2F52 A;  5J3B A;  1S3O A;  4BBS H;  2XGT A;  4AYB E;  3KF6 B;  1VQK A;  2ES2 A;  1VQB A;  4GLA C;  3S1R H;  2HT1 A;  4B3R Q;  4JOI A;  2B3G A;  1AE3 A;  1QUQ A;  2V1C C;  3H3V H;  1I3Q H;  3KFU A;  1HZC A;  4DV4 L;  4BA1 I;  1YJW A;  4A3I G;  4DR5 L;  5ELN A;  3CQZ H;  2VQE L;  4DV4 Q;  2JQO A;  3CC7 A;  1Y1W G;  2N8N A;  3UDG A;  4K0K Q;  4NXM L;  1KXL A;  4X62 L;  3I4M H;  4O0A A;  2CQO A;  3CPW A;  1VQ8 A;  4BY1 G;  1IL2 A;  1FL0 A;  4A3F H;  1XMO Q;  2NVT H;  4DV0 Q;  3F1Z A;  2JA6 G;  1PH4 A;  1PVO A;  1O7I A;  3HOV G;  3TRZ A;  3IRB A;  1YI2 A;  1YHQ A;  3GTL H;  2UXC L;  3TQY A;  3K0X A;  1OXU A;  1L1O C;  2VY3 A;  4A3G H;  4JV5 L;  1WOC A;  3RLN A;  3I55 A;  1U5K A;  3PUZ A;  3AFQ A;  4OWT B;  3KJO A;  2PQA A;  4YCV A;  4A93 G;  3H0G G;  4JV5 Q;  1X6O A;  3CD6 A;  3FHW A;  4LF5 L;  4DR7 L;  4A76 A;  3UE1 A;  5M5Y H;  4LF5 Q;  4DR7 Q;  4IFD I;  1K8A C;  5IP7 G;  1J6Q A;  3S24 A;  1TWF H;  2AWN A;  2XTI A;  5GAH C;  4JI1 L;  2KHI A;  1WJJ A;  3W1G A;  4DR6 L;  1K0R A;  1AE2 A;  5IYB H;  1QVF A;  3CPF A;  4JI1 Q;  4IPH A;  1YHA A;  1L2F A;  3L7Z C;  4DR6 Q;  2IT1 A;  2NVY H;  1T9H A;  2QGQ A;  1YJ9 A;  1VQ7 A;  3PO2 G;  1PH7 A;  4JI3 L;  4GS3 A;  3FKI G;  2RHQ B;  5FJ8 G;  2NVX H;  1N32 L;  3UE0 A;  3PIP A;  5IYD H;  2YTX A;  4TVA B;  1TWG H;  1Q81 C;  2UXB Q;  1QUQ B;  1CKN A;  3ULJ A;  3HOU G;  2KEN A;  1N32 Q;  3T1H L;  2JA8 G;  1X9N A;  4OO1 I;  5FLM H;  1NJI C;  3M3Y H;  3K8A A;  2R92 G;  3PIO A;  1NE3 A;  1VQE A;  1MKH A;  5M3F H;  4GN5 A;  1XJV A;  4YWM A;  3JAM i;  3HOX G;  1GM5 A;  2CKZ B;  4X65 L;  3RN2 A;  3H3V I;  4A3D H;  3J80 i;  1A62 A;  1V43 A;  3M9B A;  4X65 Q;  2PMZ E;  3S1M H;  4DR2 Q;  4BBR H;  1N9W A;  4APV A;  1Q46 A;  1K3R A;  4LW1 A;  4XIG S;  4DV3 L;  1X56 A;  2NN6 I;  4MNO A;  3CCQ A;  3HFZ B;  4DR1 Q;  4NXN L;  2RCN A;  1QZH A;  1Y1V H;  1EQQ A;  3I4O A;  2RHS B;  2N49 A;  4P75 A;  4HIM A;  1PYB A;  3FP9 A;  1GD7 A;  2BA0 A;  4JI0 L;  1DGS A;  3PF4 A;  4NXN Q;  4DPG A;  4YY3 L;  3K81 C;  2PQA B;  1KRS A;  2E5L L;  1X3E A;  1TWC H;  4JI0 Q;  4DAY B;  4LF8 L;  5ELO A;  4A3C H;  4A3J G;  2UUC L;  1PH9 A;  3CC2 A;  4L5R C;  3PGZ A;  5EAY A;  2E5L Q;  4B3S L;  1VQJ A;  1YVC A;  2A1A A;  4LF8 Q;  1MJE A;  4BY7 G;  2UUC Q;  1MJC A;  3E9I A;  2A8V A;  2UXD L;  4B3S Q;  3GTO H;  1PH1 A;  2LXK A;  4C3J H;  2ZM6 L;  1BVS A;  3AFP A;  1UE6 A;  3M4P A;  4IFD J;  4QY7 A;  4DNI A;  2IHE A;  2L15 A;  1VQ9 A;  1UE7 A;  4JI2 Q;  2ZM6 Q;  4A3L H;  4Y7N H;  1M1K C;  2OTL A;  4WJ3 M;  4DKA C;  1XPU A;  3PV0 A;  3HOY H;  4OX9 Q;  1NMG A;  2K75 A;  1N8R C;  5M3M G;  1VCI A;  1PFS A;  4P74 A;  1VQN A;  3EN2 A;  1GVP A;  3PUW A;  1X3G A;  4JC0 A;  1HNX L;  4DV5 L;  2ZTE A;  1SRU A;  2A19 A;  4IFD G;  4LF9 L;  2PI2 A;  4PZ6 A;  3RZD H;  3CCU A;  1CKN B;  2HIV A;  3L2P A;  4LNQ A;  4LUZ A;  2EXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...