4X65L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65L00
1WCMH 2A19A 1X65A 3T1HL 2NVXH 5GQOA 4Y7NH 3KDFB 2VQFQ 3HKZG 1PA6A 4A75A 1SFOH 2RHQB 4JOIC 1YEZA 5M5YH 1XNQL 4BA1I 1RIPA 3TEHB 1PYSB 4GKJQ 3E9HA 5FJ8H 3S1RH 1IYJB 1HZAA 4GLAC 2E2JH 1IL2A 3CCJA 1Z9FA 4DAYB 4L5TA 5IYDG 1WYDA 3H3VH 3F8TA 4LF6Q 3UE0A 1C0AA 1JMCA 4IPGA 1G6PA 1B7YB 1VQEA 3EBEA 4P72A 1UWVA 2VL6A 3K81C 3M85A 3I7FA 4GLXA 2N3SA 3GTJH 1VQMA 1K8AC 4UP8A 3G71A 4C3JH 1CUKA 1E7ZA 4KHZA 3UDXA 4HIOA 1KL9A 3MEFA 1Q82C 4LF7L 1XPUA 1I5FA 3I4NG 4BBSG 4BBRH 1HNZQ 2R93G 3NENA 3T1HQ 2IY5B 3J80i 4QJFA 3I4OA 3WWVA 1L1OA 1VQ6A 1Q1BA 1XNQQ 4C3HH 2JA7G 4B3SL 5JJKA 1AH9A 2HT1A 4JI1L 3TQYA 4IFDJ 1GKHA 3LGJA 4HIDA 2RF4A 1PH5A 2ZJRA 3PUZA 2IX0A 1S40A 4GKKL 1CKNA 1Q12A 2N8NA 2JA5G 3I4NH 4BBSH 2R93H 3S2HH 1EYGA 1LTLA 1IBLL 2UUCL 2ASBA 3G4SA 2RHSB 2AHOB 2CFMA 5IYCG 2NVYH 4LF7Q 2ZTCA 4R1JA 2JA7H 4DAMA 4DV0L 2IHFA 1X54A 2PI2A 2Z0SA 3SGIA 2Q2TA 2BH2A 2H5XA 2R92G 4JI1Q 3L2PA 4YCWA 1ASZA 4OWWB 2Y0SG 2ZM6L 4GKKQ 2K14A 3U4ZA 1XMQL 3CCVA 3CXCA 2K50A 1Q81C 3CAMA 4LWCA 4IPHA 4LW1A 4A3DG 4UP7A 5DLQE 3ULPA 4JOIA 1XMOQ 2L15A 1IBLQ 4DV4L 3RR5A 1TWCH 1I94Q 3PV0A 1KD1C 2WFWA 2YV5A 1HZCA 1X55A 4HIMA 2E2HH 4JG2A 4OXPA 2KCMA 4NPSA 3W1GA 1VQCA 4GOPB 1XPOA 4DV0Q 2R92H 2AMCB 4MNOA 3CC7A 1BVSA 1OXTA 4OWTB 1N8RC 2JA6G 2Q2IA 4A3DH 4XTCS 2JJQA 4O2DA 2XGTA 1CSPA 5C0XJ 3E9IA 5JJIA 1U0LA 1X3EA 3H0GG 1KRSA 2IHEA 3GTQH 2VS1A 3CP0A 1E3PA 1N9WA 4A3FG 1PH1A 4DKAC 2CCZA 5ELNA 1CKOA 4A3EH 4DV4Q 3RLOA 1HNXL 1GO3E 1YHBA 1E1OA 1SN8A 2ID0A 2JA6H 2K5NA 2R7ZG 3CPFA 4P73A 3H15A 1KHIA 1B70B 4GLVB 3S1NH 3S2DH 3UE1A 4A3GG 4JYAQ 4LFBL 5IT9c 4OX9Q 1WOCA 1VQ7A 5M5XH 5J3BA 4JV5L 4LUOA 3GD7A 4AYBE 1M1KC 3PO2H 3HKZE 4B3RL 4QIWE 4IO9A 3AEVA 2MO0A 4X6AH 3UDFA 2EIFA 1I3QH 1YZ6A 2JE6I 4BXXG 1AE3A 2A1AA 3JAMc 4WJ3M 2N78A 1YHAA 5IWAQ 3A5ZB 3K8AA 1W2BA 1NY4A 1HNXQ 3PUYA 1Q46A 2I5LX 2VQFL 4ALPA 1X3FA 3OTOL 1PH7A 4JI0L 3PCOB 5IP9G 2KCTA 4GKJL 1PYBA 1V9PA 4GN3B 4OONA 4LFBQ 5C4XG 1J6QA 4BXXH 2B3GA 4A3JG 2A8VA 4AQYL 3B6YA 4A3CG 2Q2UA 3CCMA 4JBKA 4L5RC 4B3RQ 1K8GA 1JB7A 2HHHL 1EOVA 3S14H 4DR6L 4P75A 1NTGA 2KBNA 3RZOH 1IBML 2KHIA 1JJGA 3GO5A 3S1QH 3OYYA 4PMWA 3I4MH 2F3IA 4DV1L 2JQOA 4TQUS 5K36G 4GN4B 1X9NA 1VQ9A 3OTOQ 4DV3L 5C3EG 4B3MQ 1IBKL 4JI0Q 4KHPL 4JC0A 4MZ9A 2JEAI 1IZ6A 3TS0A 1G291 5M3FG 2F52A 2K5HA 1HH2P 1FJGL 1I6HH 3HKSA 3KF8B 4DV7L 2KENA 1PVOA 1OXUA 2MNAA 3L7ZC 5GAHC 4AQYQ 3CC2A 4GNXA 1HR0Q 2HHHQ 4DR6Q 1FL0A 3DM3A 4BY7G 4KI0A 3PGZA 3PUVA 4LUZA 3J80c 4DR7L 5FLXc 5C3EH 3KF6B 1OXSC 1IBMQ 4LF8L 2ZJPA 2YYZA 3RN2A 1PH2A 1YJWA 1C7YA 3PF4A 5M3FH 4DV1Q 2JA9A 1TWHH 1QVGA 5IYDH 3NELA 1A0IA 1PFSA 1E1TA 4DV3Q 2I5HA 4KHPQ 1IBKQ 1VQIA 1QZHA 1H95A 2OTLA 4X66Q 4X64L 1S72A 4L5SA 2BH8A 1TWAH 3F1ZA 4JI2L 1FJGQ 4BY7H 4EX5A 4DV7Q 1PH8A 4JI5L 2UXBL 3J7A5 2K52A 1XMOL 3HOVG 3OW2A 2ATWA 1VQGA 4AIMA 3M4QA 1NMGA 2PNHA 4R4QA 4NXNL 3CMEA 1I94L 5C0XI 3RNUA 4YWKA 4DR7Q 4GNXB 4LF8Q 2E8GA 1L2FA 2GVBA 4IFDG 4O0AA 1IXRA 4IJLA 2KHJA 1KXLA 3K80C 4IPDA 1WFQA 4B3TL 1NMFA 4R4CA 2ZJQA 4YCUA 5E7NA 5IE8A 5HY6A 3I55A 2VQEL 2JA5H 3HOXG 2I0QA 2R6GA 4HJ5A 4NXML 1N36L 3Q8DA 4X64Q 3J81i 4QQBX 1L1OB 4WJ4A 4LF4L 4JI2Q 1XPRA 1Y1WG 5IYCH 4JI5Q 3HOWG 2EXDA 3NBHB 3S16H 3GTGH 1MIUA 2UXBQ 4Y52H 5M5WH 4A3MG 1SROA 4K0KL 1CKNB 1A8VA 1EQRA 4R4TA 2E5LL 1SMXA 1Q1EA 4NXNQ 1TWGH 5GAGC 2D0PA 4QY7A 4MTNA 4HJ7A 2UU9L 5AJ3L 1K3RA 3D0FA 4P74A 2UUBL 3HOXH 3U58A 1DGSA 3CC4A 1K83H 3A74A 1PH9A 4JYAL 3TRZA 2CWPA 1YIJA 4B3TQ 4OX9L 2K5VA 3S15H 4PZ7A 3W1BA 4DK6C 2VQEQ 4PG3A 4JI8L 1MJEA 2WB1G 3FKIG 3KJOA 1YVCA 4HIKA 1N36Q 4LF9Q 4NXMQ 3CD6A 2PQAA 1ASYA 1G51A 2F4VL 4LF4Q 2R7FA 1X3GA 1EQQA 4JBWA 4HJ8A 4NB3A 4YHHL 5IWAL 1SE8A 1D8LA 3PF5A 4K0KQ 2WP8J 2UXDL 4YWLA 1YJNA 4XIGS 4BY1G 2E5LQ 2JA8G 3HOUG 3S17H 1CSQA 2UUAL 2UU9Q 5AJ3Q 1FGUA 3RLFA 2UUBQ 2LSSA 4A3LG 3FKIH 5M3MG 2Z6KC 3H0GH 2QGQA 4POFA 4X65L 3AYHB 2QA4A 1YITA 3DLLA 3CCEA 4JI8Q 4A3FH 3H3VI 2CWAA 2VZAA 3J7ZC 2ALYB 2DUDA 3ZJYC 3M3YH 2F4VQ 2R7ZH 1EIYB 5GROA 2AKWB 4FDBA 2PQAB 4YHHQ 2B29A 4LFAL 4A3GH 4IPCA 5LMNL 2UXDQ 3CCUA 2LXJA 3G48A 4GN5A 3M4PA 4DUYL 1JT8A 4GS3A 2UUAQ 4B3ML 4L5QA 4IJHA 2ZTEA 1CKMA 3A5UA 3A0JA 1SRUA 1VQKA 2VUMG 3CQZH 4LUVA 3VDYA 2YU9H 5IY0A 3K0XA 4X65Q 4DNIA 1BBUA 5IP7G 3M4OH 5JEAJ 3E0EA 1UE6A 4P71A 1V1QA 1X56A 4J15A 1HR0L 1U5KA 1E22A 3BU2A 3TREA 4YWMA 4QGUA 2K75A 3HOZG 3EN2A 3KDFA 5IP9H 4X62L 2VY3A 4LFAQ 5LMNQ 3NEMA 5C4XH 1Y1VG 4DUYQ 3ULJA 2MO1A 1VQBA 4R4OA 1P8LA 4DR5L 2DGYA 3PIPA 4IOCA 4GOPC 4A3JH 1WCMG 3G6EA 4KLKA 4A3CH 3GTOH 4X66L 3M9BA 2LXKA 1K73C 1KQSA 2FXQA 3PUWA 3CCLA 1TXYA 3GTLH 2Q2HA 1S3OA 5FJ8G 3BJUA 1VQLA 3PO3G 3GTKH 4A3IG 1YBYA 1X6OA 2NZOA 4HJ9A 1PH3A 4POGA 4PZ8A 3I56A 1AE2A 4DR1L 1Y1VH 1EIFA 4RMFA 1EWIA 1GM5A 2Z6KA 4X62Q 2Y0SE 2NN6I 1J5EQ 4AYBG 3GTPH 4LFCL 2AWOA 1HZBA 3FHWA 1HJPA 2OQKA 5EAYA 3U50C 3UDIA 3F2DA 1PV4A 4DR5Q 3CCQA 4JI6L 4BBRG 2V1CC 2VUMH 3M7NA 5BR8L 3PO3H 3CF5A 3KFUA 4A3IH 3ULLA 3D31A 3AFPA 3J81j 1Z47A 1TWFH 1QUQA 1WJJA 2K4KA 3CMAA 2HQLA 2HIVA 1NBWA 3RLNA 4DUZL 3K7UC 2NZHA 1YNXA 2GN5A 1RL2A 2ZTDA 1JJ2A 2WAQG 2OTJA 1KRTA 3STBC 5LMUQ 4HJAA 4DR1Q 4A3KG 4UY8C 2WB1E 1K9MC 3EIVA 3STBD 1KC8C 3JC66 3KJPA 3F2BA 1Y14B 2GVAA 3GTMH 3PSIA 1VQ4A 3KYHC 4APVA 2OWOA 4JI7L 4LFCQ 4ME3A 1VQ5A 1Q8KA 2UXCL 3CCSA 3J81c 1BBWA 1SLJA 1UEBA 2YTXA 4OWXB 3CPWA 4JI6Q 3CCRA 2IX1A 5ELOA 1OXVA 1Q7YC 2R7DA 1A62A 3BZKA 4QL5A 5BR8Q 4LF9L 1MJCA 1NE3A 4EQ5A 3HOVH 5IYBG 3F2CA 4JI4L 2IT1A 4TVAB 4A3KH 1UE1A 3BZCA 4DUZQ 1XJVA 1VCIA 2HIXA 1P16A 1LUZA 2I5MX 1N33L 1QUQB 4A93G 1UE5A 4GOPA 1D7QA 2BA1A 1JJCB 2OQ0A 3UDGA 4A76A 5GADC 4OO1I 3RZDH 3ICEA 5LMNW 1T9HA 1VQHA 1VQNA 3S1MH 2D0OA 4JI7Q 4DK3C 5IYBH 5JJLA 4DR4L 1YI2A 5FLMG 2NN6G 2YTVA 3T1YL 1GVPA 2UXCQ 1Y1WH 3HOWH 1KIXA 4B3SQ 1MKHA 1GD7A 4A3MH 1VQAA 1Q86C 4A93H 3K7AH 1VQ8A 4DV6L 2ES2A 4JI4Q 1LYLA 1VS0A 3KLWA 1HR0W 1JE5A 2MQHA 2UUCQ 4YY3L 2JEBI 1N33Q 1WI5A 1M90C 1W3SA 2D62A 1R9TH 1PH4A 5FLMH 1XNRL 2OCEA 3AQQA 3PIOA 4A3EG 1OTCA 2B63G 2PMZE 5C0XG 4DV5L 1N34L 4PZ6A 5GAEC 4BA2I 3HFZB 5C4JH 1PH6A 3T1YQ 4DR4Q 4JBMA 1YJ9A 3TS2A 4DV2L 2NVTH 1HZ9A 2AWNA 5C44G 2C35B 2ZM6Q 4LNQA 4R4IA 1I50H 1VQFA 1XMQQ 4BY1H 3FP9A 4DV6Q 5H1SE 2JA8H 3HOUH 3KOJA 4AH6A 2N49A 3MXNB 3PO2G 1VQDA 4C2MH 4A3LH 1B8AA 4JBJA 3RN5A 4YY3Q 2B63H 4A3BG 1OXXK 5M3MH 1XNRQ 4GNXC 4IOAA 1QVCA 3AFQA 4OO1G 5C44H 4A4IA 4C3IH 4DV5Q 1N34Q 3S24A 4LF5L 2CQOA 3L0OA 4JI3L 3PUXA 1HNWL 4DV2Q 1QZGA 4A3BH 1N32L 2VNUD 1L1OC 1VQJA 1UE7A 2MFIA 4DR3L 3W5OA 3HOYG 4DR2L 1SR3A 4DPGA 3I2ZA 5HGQA 1YHQA 4UPAA 2XTIA 1J5EL 3JAMi 3ER0A 1QVFA 2JK8A 3ERSX 1EFWA 1VQPA 2PI2E 3GDEA 2YTYA 5JEAG 2EQSA 2RCNA 1C9OA 5IP7H 1PHJA 1VQOA 2WAQE 3I4MG 3U4VA 2VW9A 4RG1A 2NVQH 2BA0A 4H02A 4LF5Q 4YCVA 3CW2C 4LF6L 3HOZH 4JCVE 1L0WA 4JI3Q 1NJIC 3HOYH 1BKBA 1O7IA 4JV5Q 1K0RA 1FVIA 1HNWQ 3KF6A 1N32Q 2CKZB 1V43A 1E24A 2E2IH 1A63A 3IRBA 4IFDI 4UP9A 4DR3Q 5LMUL 1LM0A 2QEXA 1KAWA 1XTDA 4DR2Q 1HNZL 1EUJA
chains in the Genus database with same CATH superfamily
1WCMH 1J8IA 1LTAD 5JAVA 1GHKA 4Y7NH 3KDFB 3HKZG 4C3JG 4JOIC 5M3MB 1S5BD 5EBCA 1PYSB 4GKJQ 2B39A 1HZAA 4U68A 2E2JH 4DAYB 4L5TA 3H3VH 3F8TA 3CQZB 3J7AV 1G6PA 1B7YB 3K81C 3M4OB 2CH4W 2A5HA 1E7ZA 3UDXA 3MEFA 4LF7L 2R93G 1TVXA 2N55A 1HTPA 3WWVA 5C4XB 5CGKA 2JA7G 4H44C 2ZT9C 1LTTD 3TQYA 1GKHA 4NP5A 4HIDA 1PH5A 1S40A 2IX0A 2H4OA 1GUWA 1Q12A 4UAIA 4XYOA 2JA5G 4BBSH 1ZEQX 2ASBA 3J80E 1SYBA 3FVQA 2RHSB 4P2CB 2AHOB 5KIXA 4R1JA 4WRDA 4DAMA 5JVH3 1FNUA 4DV0L 5JPNC 1KLUD 3DUZA 5KYIA 2PI2A 2H5XA 3NTIA 1ASZA 2F0JA 1I4GA 4OWWB 5I2YA 3PO3B 4A3IB 4OIJA 1Q81C 2F0OA 3CXCA 4K8JA 4IPHA 4CJ2C 1XMOQ 1ONLA 1IBLQ 4DV4L 1LTBD 1F77A 3P1HA 1AN8A 3PV0A 2WFWA 4N9TA 4JK1C 4HIMA 4JG2A 1VQCA 1KNEA 1XPOA 2R92H 1Y8OB 2AMCB 1D1KA 3CC7A 2KEDA 1NUCA 5C3WA 3MZ5A 3CKIB 4O2DA 2B8GA 2CH4A 1SE2A 5C0XJ 1U0LA 2Z8LA 4MTKA 3L3OC 2VS1A 3CP0A 4G4KA 1E3PA 1N9WA 4I7AA 3T51B 4A3EH 1YHBA 1E1OA 5TSSA 4FNFA 4P73A 2Z1CA 3S2DH 3OWEB 3RZDB 4UHVA 3S1MB 4LFBL 4R9WA 4KD4A 4HMIA 4H13C 3PO2H 3HOWB 2PZTA 1A3UA 1GUGA 1SYDA 2RQXA 4IO9A 1PZID 3K7AB 2F0PA 1YZ6A 4WJ3M 2N78A 4K5XA 3GV6A 1W2BA 4G7OC 2BDNA 4CDCC 3OTOL 4DXGA 4DAPA 2K32A 1PYBA 5T1GA 3TP6A 4RKLA 2EYPA 2B2UA 4OONA 1W6JA 3H09A 2EZVA 2WIIB 1JOQA 2KJXA 4BXXH 2A8VA 4Q0FA 5G3LD 4JBKA 4DR6L 1NTGA 2KBNA 2KHIA 2PYKA 3GO5A 1C8CA 4PMWA 4DV1L 1HPCA 1I4QA 3T56B 2JEAI 3D4RA 1U9RA 5C44B 1HH2P 3HKSA 3HEJA 3L7ZC 1JQYD 2Q8RE 2SNMA 4EQNA 1WTXA 1RDPD 3OW7A 4BY7G 4DR7L 5M3FH 1TWHH 3K59A 1PFSA 1VQIA 2ICIA 1H95A 4X66Q 5K5PA 1S72A 1EY4A 3F1ZA 4KHVA 3T16A 4EX5A 2NVQB 1PH8A 2O5JC 2HQEA 3OW2A 1VQGA 3M4QA 1NMGA 2PNHA 4NXNL 1TY2A 3MXGA 4LF8Q 2E8GA 4O0AA 2KHJA 1AFPA 1WCMB 3K80C 5T1IA 1WFQA 4K8IA 1XTCD 4Y7NB 2EJFC 5IE8A 3J81i 3A8IE 4J1MA 2E2JB 2EY5A 3S9WA 1JORA 4JI2Q 1HFNA 4JI5Q 3S16H 2UXBQ 4ID6A 1BUVT 5M5WH 3GP7A 4R4TA 4HJ7A 2D0PA 2K6AA 1PXUA 5AJ3L 3D0FA 3U58A 4JYAL 3WDNA 4FXKC 4B3TQ 2KA7A 2TSSA 3W1BA 4DK6C 2VQEQ 3K6OA 2OEOA 4PG3A 4LF9Q 3MXNA 1SNCA 5KNBA 2F4VL 2L4NA 3OIPA 4JBWA 1M8AA 4BBSB 5CYUA 1SE8A 2XWBB 3S17H 4BY1G 1FGUA 3RLFA 2KECA 3E0JA 3M4YA 2QDBA 2Z6KC 3H0GH 2K5DA 2I46A 4POFA 1K8MA 3AYHB 1YITA 4V190 3CCEA 4JI8Q 4LAAA 3AMUA 2VZAA 3M3YH 2R7ZH 4NW2A 3IKJA 3VA5A 4UDUC 4A3GH 1O80A 2UXDQ 2LXJA 4X3SA 5E4WC 3M4PA 4DUYL 1PFNA 3C1EA 3M7GA 4B3ML 3A5UA 3MFYA 4ZRZA 1SRUA 2OXPA 2R92B 5CV7A 1NNXA 2CW0C 1HR0L 2KCCA 3VYTA 1E2WA 4RH6A 5IP9H 1TQOA 4LFAQ 4A3EB 1Y1VG 2IJ0A 1B3AA 4CDDC 4CJ1B 3PIPA 4IOCA 4A3JH 3G6EA 3S2DB 1K3BC 1KDCA 2LXKA 3PQIA 4DFAA 3KK7A 1S3OA 3GTKH 3PO2B 1YBYA 4YIJA 1ILQA 1Q3LA 3IFDA 3I56A 4ZUIA 4IQZA 1B9MA 2NN6I 4IUNA 4KKTA 4AYBG 3U50C 3F2DA 1H9SB 1QILA 3SK5A 1CHPD 4DR5Q 4BBRG 1EEID 5BR8L 2F0SA 3AFPA 4OIKA 4DU9A 3J81j 1Z47A 2MHVA 2L5TA 4C3HG 1NBWA 2RSOA 3RLNA 5A2QL 2RDFA 4R8NA 4WFN3 4HJAA 2G9HD 2LS01 1SBBB 3STBD 2F0QA 3JC66 3F2BA 1B1ZA 1Y14B 3RMHA 2F3WA 3BDOA 3KYHC 4LFCQ 3Q23A 2C9OA 2PO4A 2E75C 4ME3A 2UXCL 2MP1A 1SLJA 3J81c 4JI6Q 3PIP3 3VR6A 1MJCA 4RFBA 1PFBA 3F2CA 5DM73 4JI4L 4A3KH 1STEA 2L12A 2PCFB 2HIXA 2XVSA 1P16A 3K58A 2I5MX 1N33L 1CI3M 4GOPA 2A6HC 2MGSA 1JR0D 2OQ0A 3CRKC 3ICEA 5DNFA 1LO5D 4DK3C 1YNND 5M3FB 4DR4L 4R8IA 1TWHB 1SYCA 3G7LA 1KIXA 3TN2A 4A3MH 4A93H 1STAA 3A55A 5CMDA 2NWGA 1PZKD 4DGZA 1WTPA 2JEBI 1KABA 4NDXA 3Q22A 1W3SA 2C5CA 2RBMA 4J6HA 1OTCA 2B63G 2PMZE 4PZ6A 4K14A 3QO2A 5C4JH 1E0BA 1IYVA 4JBMA 3TS2A 2A6ED 4C3IG 1WTWA 3MVVA 4K6LA 5FO7B 1O7LA 3NHHA 3HOVB 1AEXA 4DV6Q 5H1SE 4B9XA 3S16B 4A3BG 5C0XH 5M5WB 2G5DA 5M3MH 4DF7A 1XNRQ 3LNNA 1TR5A 2K04A 3P20A 4WJWA 4L63B 4OO1G 2QILA 4DV5Q 2PNRC 1HNWL 4DV2Q 1GUNA 4ZKCB 1N32L 1ZYRC 3LWEA 1LT3D 1BCPD 2FMMA 2XIWA 2MFIA 1WTRA 4DPGA 2K1BA 5A35A 4UPAA 2XTIA 4CHTB 1QVFA 1EFWA 3ERSX 3S17B 2CQAA 4TSSA 5JEAG 3FDTA 4I7ZC 1ESFA 3I91A 2BA0A 1PRTB 4JCVE 3HOYH 3TP8A 1BKBA 2CKZB 1V43A 3SK4A 2E2IH 1EL0A 1LM0A 3SE0A 1KAWA 2A68D 2JA8B 5KEEA 3M3YB 2R7ZB 1HNZL 3J7AF 3K5OA 3OMGA 2RA4A 4A3GB 1LT4D 2ZXOA 1QNUA 1QG7A 4GLAC 5BN3A 5IYDG 1EWHA 4LF6Q 1C0AA 3VR4A 1TY0A 1SYEA 3M85A 1UWVA 2VL6A 3ZYYX 3I7FA 2N3SA 2X69A 1K8AC 3G71A 4C3JH 1Q82C 1GOZA 1R4QB 1YNJC 3T1HQ 1AZQA 4QJFA 1L1OA 2SOBA 1PMRA 1Q1BA 1XNQQ 1VQ6A 2VUMB 4ZQ3A 5I9OA 5CV5A 4JI1L 4IFDJ 3LGJA 4A3JB 3KLSX 2ZJRA 1A3VA 1I4RA 5CC4A 2PMZB 2BE5D 2R93H 3S2HH 1WD0A 1FD7D 5FLXE 3GTKB 3SK6A 3AU7A 1QB5D 2JA7H 2HD3A 1Y8PB 4RCOA 4CBVA 1X54A 2Z0SA 5M5YB 4FVMA 5ISRA 4YCWA 3QWNA 2ZM6L 4GKKQ 1XX8A 1ENAA 3U4ZA 3CCVA 2K50A 2B2UC 4UP7A 5DLQE 4LJZC 2L15A 3KBXA 3GTJB 1X55A 4NPSA 5C5MA 4MNOA 4X3KA 4OWTB 2Q2IA 4TRDA 4NMZA 4E6IA 1MHWC 4XTCS 1LTSD 2F1MA 3FEWX 2F0WA 2F0FA 3ERQA 1X3EA 1DOMA 1S5ED 2MUYA 2FFKB 4K5VA 2CCZA 4A3KB 1BF4A 1CKOA 3IFTA 1AP0A 1C4QA 2ID0A 2K5NA 1MD2D 2NVYB 3UE1A 5D65A 4JYAQ 5A2QE 1WOCA 4IZ8A 2J7ZA 4LUOA 3GD7A 5FO9B 3HKZE 4B3RL 5DM63 2PQEA 4RGTA 1QNKA 4A3MB 4A93B 4QIWE 3AEVA 2EIFA 2JE6I 1AE3A 3I8ZA 3VA7A 3K8AA 1HNXQ 2JP1A 1JOKA 2VXWA 1X3FA 4G57A 4JI0L 3PCOB 3C1FA 2KCTA 3DWPA 2E2HB 1K8OA 2A69C 3EJIA 5C4XG 1SMYD 1GUOA 4A3CG 4L5RC 2TMPA 3CCMA 2PW5A 1K8GA 3S14H 3KBGA 4P75A 4DK0A 2WACA 1IBML 1FGBD 1JJGA 4K2LA 3S1QH 2JSOA 3OYYA 3NTHA 2F3IA 1HRJA 4TQUS 5K36G 1X9NA 1ENFA 3SDZA 1VQ9A 3ONAB 4B3MQ 1IW7D 4JC0A 4MZ9A 4O1NA 4RHSA 1HA5A 1G291 5COYA 2F52A 4QUCA 3KF8B 3J7YW 1PVOA 2MNAA 4AQYQ 3CC2A 1NR2A 3L9AX 1HR0Q 4QUFA 2HHHQ 3D6WA 5HURA 2OT2A 3DM3A 4PMBA 1OXSC 4XXEA 2ZJPA 3GQBA 1YJWA 4XDXA 1PH2A 3PF4A 1WD1A 1QVGA 4DV3Q 2P5ZX 4KHPQ 1IBKQ 5D14A 2OTLA 4CKBA 4X64L 4KKSA 4QB4A 5KYLA 1TWAH 1FJGQ 4BY7H 2F0UA 4DV7Q 3K5MA 1AZPA 5EJWA 3HOYB 1I4HA 5C4ZA 5IGDA 4R4QA 2E2IB 2H1EA 4CKCA 4KMUC 1L2FA 5EKKA 1IXRA 1A15A 1S5DD 1F2MA 4EQPA 1VMPA 1NMFA 4R4CA 2Z9HA 2L11A 5E7NA 1G2TA 3HOXG 2I0QA 2R6GA 4NXML 1RJTA 1DJRD 3Q8DA 3D8GA 4LF4L 2Q8IB 1I6HB 1Y1WG 5IYCH 3HOWG 4O42A 4DXFA 1EYDA 4Y52H 1ZKOA 5CBEE 4K0KL 3NE5B 1EY7A 1X3PA 1SMXA 1Q1EA 1TWGH 4QY7A 3HKZB 4C3JB 2PZUA 3CC4A 4XQJA 3U9OA 3TRZA 4OX9L 2K5VA 3ND9A 2WB1G 1N36Q 2CVRA 4IUPA 1EQQA 4RGNA 1K0SA 1VF7A 4YHHL 5IWAL 2PW7A 1D8LA 4HEDA 2R93B 3S2HB 2E5LQ 3HOUG 2UU9Q 2UUBQ 5EBDA 3E5SA 2JA7B 2NUCA 2KHSA 1Q90A 5LHY1 4X65L 4QCLA 4Q5VA 1OO9B 4A3FH 1SJHD 2B2VA 3J7ZC 2DUDA 3NTKA 2B2YA 2X6GA 3NQTA 4HAEA 1EQTA 2B29A 1PTOC 5IGCA 4GN5A 1JT8A 4GS3A 2UUAQ 2NBFA 1CKMA 2ZTEA 1VQKA 1Y69U 4LUVA 1SDFA 4J8QA 5AFWA 5IY0A 5ELDA 5IP7G 4X3TA 4ZK9B 1V1OA 4J15A 2F0LA 1E22A 3Q0AA 4CJ0B 1ICFB 3HOZG 2K75A 1HFGA 2MJ8A 2PZWA 2AUJD 5CV4A 4X62L 5LMNQ 2AQ2B 1BNZA 1TKWB 2DGYA 4GOPC 1WCMG 4PQXA 3GTOH 1RTOA 5LL6X 1B9NA 2HDLA 1STYA 1E2VA 3CCLA 4XYQA 5KRUA 1GXDC 4XQQA 1SNDA 1VQLA 1X6OA 1PTOH 4HJ9A 4DR1L 1Y1VH 1EIFA 4RMFA 1EWIA 1VMCA 5ELCA 4CDFC 3C3LA 2Y0SE 1O7ZA 2OQKA 5EAYA 2F0KA 3CCQA 1Y8NB 3H91A 3BYYB 2Z4IA 2F0IA 1MBYA 3M7NA 3U9SA 2EYMA 3ULLA 3D31A 1WJJA 1QUQA 3CMAA 1X32A 1PTOF 2NZHA 4RHRA 4RCNA 5I2XA 2JYOA 2WAQG 3S14B 2BCOA 4UY8C 3TP5A 3EIVA 2GVAA 4LK1C 4JI7L 3S1QB 1QCBD 1VQ5A 1KXLA 1BBWA 1UEBA 1CA6A 3T4AC 1OXVA 2SEBD 2R7DA 3HGBA 3HOVH 2Q8TA 1PRTC 3W2DA 4DUZQ 1XJVA 4IFDH 1QUQB 2RKSA 3UDGA 4A76A 4OO1I 2F0VA 5DEHA 1T9HA 1VQNA 3T13A 5JJLA 4MHEA 1YI2A 3T1YL 1GVPA 2F3VA 3URYA 4FYDA 1MKHA 4IUQA 5I9PA 1Q86C 1RODA 1CZWA 4U673 1VQ8A 2ES2A 1TWAB 3A7LA 2WKDA 4BY7B 2MQHA 1WI5A 2D62A 1ICWA 1R9TH 1EIGA 2KUMA 2OCEA 3FPPA 3I4LA 1JE4A 3PIOA 4A3EG 3NQIA 2QKIC 2JN4A 4BWGB 1F9RA 3LWUA 3IAYA 2NVTH 1LTGD 1HZ9A 1UUPA 2ZM6Q 1M4VA 2JA8H 3KOJA 3MXNB 3PO2G 1U4MA 5IGFA 4C2MH 4A3LH 1B8AA 3RN5A 4YY3Q 2B63H 1ET9A 2DNEA 3NK9A 5FLXL 4KN7C 4GNXC 1TWGB 1TS2A 1PRTF 4HN7A 4H7BA 4A4IA 4C3IH 3QIAA 1N34Q 2L9HA 1FR3A 4LF5L 1PDQA 2Y0SB 4OL7A 3TZUA 4JI3L 1KAAA 3PUXA 1GUTA 4A3BH 2VNUD 1U4RA 3EQLC 1L1OC 2GA4B 3W5OA 4K5WA 4F8MA 2HCCA 4DAVA 1STBA 3JAMi 3ER0A 1CQFA 3C2PA 2VUMH 5FKAC 4B9WA 3T53B 2EQSA 1VQOA 3TP7A 4CKEA 2NTTA 1IYUA 2AUKA 3NXWA 4RG1A 4H02A 2IL8A 1G6ZA 1XYIA 2OF1A 1FVIA 3KF6A 4A3FB 1CHQD 4UP9A 4DR3Q 1CTMA 5LMUL 2EXZA 4DR2Q 3MA2B 2A19A 3NP8A 1RF2D 2NVXH 5GQOA 1PA6A 4A75A 1SFOH 2RHQB 5M5YH 3V2TA 5FJ8H 3S1RH 1IYJB 1WYDA 3ND8A 3UE0A 1JMCA 4IPGA 1DOKA 1S4ZA 3EBEA 2O2LD 4P72A 4GLXA 3GTJH 1PLFA 1SE3A 1Z7TA 4KHZA 1XPUA 1HA6A 1I5FA 4KKUA 3I4NG 5IIFA 2B8FA 3NENA 3J80i 1DZ1A 1EY5A 1F2LA 4B3SL 1AH9A 1PYWD 2K33A 3GTOB 1CKNA 4RWSC 2N8NA 2RDHA 1EYGA 1DOLA 1IBLL 2EDGA 4RGOS 3OWFA 1H9KA 1PTOB 2FINB 2VB2X 2NVYH 1IL8A 1FYCA 1Y1VB 4ZCKA 4LF7Q 3VR5A 3HZXA 3EVQA 4OEMB 5FK9C 1BCPB 3L2PA 1QE6A 4ZKBB 3CAMA 3FPUB 4LWCA 5KGUA 4A3DG 2F0GA 2B2WC 3RR5A 4ZUJA 1KD1C 1CA5A 2YV5A 2NN6H 1JB3A 2E2HH 4OXPA 3VYUA 3W1GA 4GOPB 4HTHA 4DV0Q 1N8RC 2JA6G 2ICEC 2BDOA 2O4XA 2JJQA 1D1IA 2XGTA 2K28A 3E9IA 3EFXD 3H0GG 3A8KE 1B4OA 3GTQH 1PH1A 2VB3X 2NB0A 5ELNA 4DV4Q 4FO2A 2R7ZG 5D3IB 1ILPA 1CZGA 5E3FA 4N8FA 3H15A 1KHIA 4RKBA 1RHPA 4A3GG 5IT9c 4OX9Q 1MSGA 3SR1A 4ZAIA 1BR9A 2J4XA 4X6AH 2MO0A 1KTKA 3UDFA 4XQNA 2V4DA 1I4XA 2A1AA 4QMGA 1QOHA 3JAMc 1YHAA 5IWAQ 4IUTA 3N52A 3R3OA 1Q46A 2I5LX 1EQVA 3D6CA 2VQFL 1WTQA 2EJGC 1PH7A 5IP9G 1R9TB 4KY5A 1WVLA 1CK1A 1EU4A 3CRLC 4GN3B 4PNYA 4LFBQ 3RD4A 3A56A 3I3CA 4K6DA 3RUZA 4A3JG 3EA6A 3MFGA 3BVZA 2NVTB 2DJGC 1EOVA 1I6VC 3RZOH 5C4HA 4C2MB 3I4MH 2B63B 4KN4C 2XNAC 4GN4B 3C46A 3OTOQ 5C3EG 4F7XA 1IZ6A 2XSCA 2NZ1D 2ENBA 2K5HA 4C3IB 1I6HH 1ESRA 2KENA 3W3AA 1OXUA 5M5XB 5GAHC 4GNXA 2IX3A 4A3BB 4DR6Q 1FL0A 5K36H 3PGZA 3PUVA 4LUZA 3J80c 3G6JB 4LF8L 4H0LC 3DMUA 4DV1Q 2JA9A 3BG3A 3NELA 2I5HA 5FO8B 1QZHA 1V8QA 3DHQA 3VYSA 4JI2L 1KNAA 4JI5L 2UXBL 3J7A5 1WTOA 2K52A 3AB9A 1LT5D 2ATWA 4AIMA 1I94L 1BQQT 3CMEA 3BZDB 3RNUA 4YWKA 4DR7Q 4GNXB 2B2VC 2EVBA 4FF4A 5G3LF 2XRSD 2B2YC 4G7HC 1LACA 4B3TL 2O5IC 2E2DC 2EYHA 2NVXB 1HUMA 1SFOB 5HY6A 3I55A 2VQEL 2JA5H 2WV6D 4HJ5A 3S1RB 3IL8A 1L1OB 1STNA 3OIQA 4WJ4A 1ZXTA 2LKVA 1XPRA 1EOTA 2EY6A 3GTGH 2B2TA 4A3MG 3VR2A 3I70A 2MPMA 1ENCA 4NXNQ 1TS5A 5GAGC 1E2ZA 4MTNA 3HOXH 1DGSA 3I90A 3J81E 1K83H 3A74A 1PH9A 2LY7A 1F9PA 2RCFA 4JI8L 5CBAE 3FKIG 1EWCA 3KJOA 1HCZA 3K5LA 3CD6A 2PQAA 2RVLA 2R7FA 2SDFA 4HJ8A 3QOLA 2WP8J 2UXDL 4YWLA 1YJNA 4XIGS 1GJXA 1CSQA 2L1BA 3MTSA 5AJ3Q 2LSSA 1AW7A 4HMJA 4RA8A 5M3MG 5EPJA 2QGQA 2QA4A 1RKNA 2HCIA 1HQRD 3DLLA 3H3VI 3D3RA 2CWAA 3HS0C 4IUUA 2F4VQ 1B44D 1SE4A 1CQVA 2R3ZA 3CHBD 3FMCA 2KQ3A 4DA2A 2AKWB 4FDBA 2PQAB 5C5LA 1UNSA 5IODA 4LFAL 3CCUA 4HR7B 2CHBD 3R93A 5IGGA 2F4IA 4C1NI 3KLRA 3WOFA 2EYFA 2WINB 3A0JA 1SYFA 1LTRD 5BN4A 2YU9H 3BDLA 3K0XA 2B2WA 1BBUA 1ML0D 5JEAJ 3E0EA 1UE6A 4HSPA 2EPBA 1JC7A 1W6KA 1TT2A 1U5KA 4M8AA 2CW0D 3SXHA 3TREA 4QF4A 4YWMA 4QGUA 3EN2A 3KDFA 5C3XA 3GTQB 5NUCA 1EZ6A 4DUYQ 1VQBA 4DR5L 1P8LA 1JWMD 4OHJA 4F87A 4KLKA 4KJNA 2RSNA 1STHA 1DCZA 2FXQA 2L55A 5KNDA 3GTLH 3PO3G 4A3IG 3QB3A 2NZOA 1PH3A 4PZ8A 1AE2A 1STGA 2RDGA 5I4DA 3GTPH 4LFCL 1NAPA 1HZBA 1HJPA 1ET6A 1XWEA 3UDIA 5HGTA 1EU3A 3E6ZX 4JI6L 2V1CC 1B2TA 4X3UA 4ULLA 3KFUA 3Q6SA 1HUNA 3A8JE 1TWFH 2K4KA 3K7UC 1IKLA 2GN5A 1RL2A 2ZTDA 1JJ2A 1KRTA 3STBC 5LMUQ 2R61A 3BDCA 3HP3A 3BVMA 4CGYB 4EVOA 5C6AA 2WB1E 1K9MC 3RZOB 2QW7A 3KJPA 2DN8A 3BS1A 3GTMH 3PSIA 4IALA 4B08A 4APVA 2OWOA 3VYRA 1Q8KA 2ZXPA 3CCSA 3I4MB 2WKCA 2YTXA 3CPWA 1F2ZA 5ELOA 1Q7YC 1A62A 2IPKD 5BR8Q 4EQ5A 1F2YA 5LL6S 5IYBG 5CV8A 2EY1A 3OMCA 2IT1A 1UE1A 3BZCA 1II3A 4ZLTF 1T5EA 4EGVA 2KCNA 1G91A 4DNTB 1UE5A 2BA1A 4OGQC 5J39A 2DY8A 2A6HD 5E1FA 5LMNW 1VQHA 1YNNC 4QIWB 4K2KA 2D0OA 3O13A 2UXCQ 5FLMG 2FJ2A 2K01A 4B3SQ 2K7VA 4TKOB 1GD7A 1NR4A 1VQAA 2L0CA 4DV6L 4JI4Q 5EPKA 4C56C 1LYLA 1VS0A 3KLWA 4KY6A 1S5CD 2M00A 1N33Q 1XNRL 5F2DA 3AQQA 3V96A 4DV5L 5GAEC 2A6EC 4DR4Q 3MEHA 4PV1C 4DV2L 2AWNA 2JA5B 5C44G 2QDLA 4LNQA 2NYZD 4R4IA 4BY1H 1I4PA 3FP9A 1LV9A 4AH6A 2N49A 1VQDA 4JBJA 3GTGB 1OXXK 2ZXRA 4IOAA 4G7ZC 1QVCA 5EKLA 3MWYW 3HOXB 2LFNA 4FF3A 1B3QA 4ZYSA 1K83B 1SXTA 4FF1A 3S24A 1SNMA 1H9JA 3L0OA 4L6TB 4ILWA 2EYJA 1BCPC 1QZGA 1Y1WB 3QR8A 5JPMC 4FXDA 1GHJA 4FP5D 1ZYRD 1SR3A 2IWHA 3TMEA 1YHQA 1J5EL 2LMCB 4S3SA 2RCNA 1C9OA 1MSHA 2WAQE 2VW9A 1VDZA 2WB1B 4C1NK 3MC0B 3CW2C 3MAQA 4LF6L 1JICA 1NJIC 1HNWQ 1O7IA 1K0RA 4ODGA 1N32Q 2A68C 1E24A 4IFDI 2QEXA 1I50B 3HOUB 3NWSA 2Z4HA 1X65A 4IUVA 3T1HL 2A73B 1G8ZD 1SNQA 3TZDA 2VQFQ 5JVG3 1YEZA 3PMFA 5IGBA 4BA1I 1RIPA 1XNQL 3TEHB 3E9HA 1IL2A 2JXMB 2SNSA 3ITPA 3CCJA 1Z9FA 1NCVA 1CM9A 2FMCA 3P7JA 2X6LA 2YU9B 1VQEA 1Q8IA 1VQMA 3DEOA 1SEBD 4UP8A 1EY6A 1CUKA 4OELB 3D4DA 4HIOA 1B50A 1KL9A 4BBSG 1HQMC 4BBRH 1HNZQ 2IY5B 1BCPF 3KLSA 3I4OA 1EY8A 1YNJD 4N9PA 4KY7A 4C3HH 5IGEA 5JJKA 2HT1A 4KTAA 2HDMA 2RF4A 4RAUC 2BE5C 3PUZA 4EQOA 4GKKL 3I4NH 3HOZB 3GTLB 1LTLA 2UUCL 2F0NA 3LX0A 3G4SA 1HXYD 5EGTA 2CFMA 5IYCG 1JCKB 2ZTCA 1R4PB 2DNCA 4KK7A 1EY0A 2IHFA 4IURA 3GTPB 3SGIA 1KDAA 5E4XA 1HTLD 2Q2TA 2BH2A 2R92G 4JI1Q 3TDQA 1A2UA 2Y0SG 2K14A 1XMQL 1TWFB 3H94A 4LW1A 3K57A 1SJED 3HRZC 2KEEA 4JOIA 3ULPA 3NWTA 4PMCA 1JWSD 1TWCH 1I94Q 3E3XA 1O78A 3SHLA 1HZCA 1PFMA 2HUGA 2KCMA 3NUCA 1DXMA 1BVSA 1OXTA 4BS9A 3GTMB 1V1PA 3TBIB 4A3DH 2G9DA 1BBXC 3MXPA 1CSPA 5JJIA 1G2SA 3SEBA 2WAQB 1KRSA 4JPBW 2IHEA 4A3FG 4DKAC 3RLOA 1HNXL 1GO3E 1TIID 1SN8A 2JA6H 1BO0A 1J9OA 5I6YA 3CPFA 3S1NH 1B70B 4GLVB 2D5DA 5CV6A 5J22A 1VQ7A 5M5XH 5J3BA 5EQ0A 4JV5L 1M1KC 4KD3A 4AYBE 1V1PB 5IOCA 4BXXG 3F2UA 1I3QH 2F0TA 3A5ZB 4OO1H 1NY4A 3PUYA 1FNWA 4ALPA 1X3QA 3PIO3 4GKJL 5EKIA 1V9PA 3N6RA 4Z9CB 2FHTA 3J81L 1SMYC 2A69D 3HG9A 1J6QA 2B3GA 4AQYL 3B6YA 3P75A 2K5QA 2Q2UA 2XN9C 4B3RQ 1JB7A 2HHHL 5JOBA 4I65A 3DXJC 5JEAH 4BY1B 1H9SA 1IW7C 2JQOA 5L37A 3K5NA 2B2TC 4DV3L 4JI0Q 4KHPL 1IBKL 3TS0A 5M3FG 3SVMA 1RCVD 2F0DA 1FJGL 2QCPX 2K5WA 4DV7L 3FRPB 2AQ1B 3WOEA 4KI0A 5FLXc 5C3EH 3KF6B 1IBMQ 2YYZA 3RN2A 1C7YA 2XRQD 4HCEA 5IYDH 1TS3A 1A0IA 2E76C 1E1TA 1D5MC 1GUSA 3NBHA 4L5SA 2BH8A 1XXGA 2PPBC 4XT1B 1QJOA 2D2CC 3UI2A 5ELFA 4IN3A 2BOSA 1XMOL 3HOVG 1F9QA 5CORA 3X3NA 5C0XI 2K05A 4IFDG 2GVBA 4IJLA 4KV6A 2K03A 3OOCA 4KJOA 4IPDA 1C48A 2ZJQA 4YCUA 3MXUA 1N36L 5IT9L 4X64Q 2KVMA 5J1ZA 4QQBX 2EY2A 4JW0A 3DWAA 2EXDA 3NBHB 1SNOA 1MIUA 4WORA 2XWJB 1SROA 4LMQD 1CKNB 2EYLA 1A8VA 1EQRA 1CFMA 4DNRB 2E5LL 3JAML 4AYBB 2UU9L 1K3RA 4P74A 2UUBL 2AQ3B 3Q24A 1BXTA 4BBRB 4MIUA 4V0BA 1A2TA 2CWPA 1YIJA 2EE1A 3S15H 4PZ7A 2M9VA 4C3HB 1MJEA 4NXMQ 2DJFC 1YVCA 4HIKA 1NSNS 1ASYA 1G51A 4LF4Q 1X3GA 2F0EA 4RGMA 1KDBA 1SSOA 4NB3A 3I4NB 4K0KQ 3PF5A 2M2LA 2JA8G 3A7AB 2UUAL 4A3LG 1EEFD 1LTID 3FKIH 3OPOA 1EZ8A 4ME5A 3EROA 1D5XC 1RTNA 1O7YA 1WTVA 4HSVA 2ALYB 3OSOA 4N8X1 3ZJYC 1EIYB 5GROA 4YHHQ 5CV9A 1DYQA 4IPCA 5LMNL 3J80L 3G48A 1TWCB 3GV3A 2DY7A 4L5QA 1PTOD 4IJHA 1DONA 5I6WA 3CQZH 3VDYA 2VUMG 4X65Q 4DNIA 3M4OH 3KUPA 3H6MA 1L0XB 1B53A 4A3DB 4P71A 1WTHA 1V1QA 1CT1D 1X56A 3BU2A 1MGSA 3QOJA 3I72A 1DM0B 2VY3A 4CDEC 3NEMA 1S5FD 5C4XH 3ULJA 2JA6B 2MO1A 4R4OA 1BOSA 1VF5C 4A3CH 3S1NB 4X66L 3M9BA 2J0TD 1K73C 1KQSA 1LT6D 3H0GB 3PUWA 1TXYA 2Q2HA 1KLGD 2N88A 5FJ8G 3BJUA 2IW3A 1EY9A 4POGA 1GM5A 1I3QB 2Z6KA 5ELBA 4X62Q 3NPPA 1A3TA 3QJYA 1J5EQ 3R2IA 2AWOA 3VR3A 1EIHA 3FHWA 4MN3A 1PV4A 1D6EC 1H9MA 3PO3H 2F0HA 3CF5A 3I73A 4A3IH 2HQLA 2HIVA 4DUZL 1Z6HA 3DWQA 3R2TA 5BN5A 3X3MA 1YNXA 2QEJC 3DEPA 1SNPA 2OTJA 4JVZA 4DR1Q 1A6XA 1EYAA 2QF7A 4A3KG 4F88A 1EFID 1FNVA 1KC8C 1VQ4A 1IHZA 5DAUA 4XT3B 4OWXB 5EPLA 2IX1A 3CCRA 3NBIA 3BZKA 4QL5A 4LF9L 3BVGA 1NE3A 1SYGA 1JWUD 1SAPA 5JJZA 2I07B 3V05A 4TVAB 1MI2A 1D5ZC 1VCIA 1PRTD 1LABA 1LUZA 4L8JA 4A93G 1D7QA 1JJCB 5GADC 1LLRD 3RZDH 1JOOA 5C3EB 2A74C 3S1MH 3MHBA 4JI7Q 5IYBH 1T5XD 2NN6G 2YTVA 1BDOA 1Y1WH 3HOWH 3SK8A 3A54A 4GZYC 4DK1A 3K7AH 1UEAB 1HR0W 3K0YA 1JE5A 2UUCQ 4YY3L 1DD2A 1M90C 1PH4A 5FLMH 1QWYA 1H9RA 5C0XG 1N34L 4BA2I 3HFZB 3TSSA 1PH6A 2F03A 3OHXC 4M1UB 3T1YQ 3BYTB 2F0MA 1YJ9A 1UAPA 2EOTA 2NTSA 2C35B 2EYOA 1I50H 1VQFA 2D9UA 1XMQQ 1IKMA 3HOUH 4FXGC 1D2BA 4HCSA 2Z6BA 1TS4A 3QG1A 5CR3A 1PZJD 5ELEA 3CU7A 1RD9D 3AFQA 5M9OA 5C44H 2CQOA 3S15B 1K28A 5FOBB 1TU2B 3NSWA 5D3DA 1VQJA 1UE7A 4DR3L 3H3VC 3HOYG 4DR2L 4DN4M 5KNCA 3I2ZA 2KOLA 5HGQA 1U4LA 4ABNA 2JK8A 1VQPA 2PI2E 3GDEA 2YTYA 4DAYA 1PHJA 5IP7H 5IT9E 3KF8A 2E74C 2EJMA 4NKLA 3I4MG 3U4VA 3D4WA 3FKIB 2NVQH 4LF5Q 4YCVA 3HOZH 5C4JB 1L0WA 4JI3Q 4JV5Q 3DM1A 1HHVA 4FF2A 3JAME 1A63A 3IRBA 1F9SA 3R8BA 1XTDA 1U4PA 1L0YB 1EUJA 1EYCA
chains in the Genus database with same CATH topology
1WCMH 2A19A 1X65A 3T1HL 2NVXH 5GQOA 4Y7NH 3KDFB 2VQFQ 3HKZG 1PA6A 4A75A 1SFOH 2RHQB 4JOIC 1YEZA 5M5YH 1XNQL 4BA1I 1RIPA 3TEHB 1PYSB 4GKJQ 3E9HA 5FJ8H 3S1RH 1IYJB 1HZAA 4GLAC 2E2JH 1IL2A 3CCJA 1Z9FA 4DAYB 4L5TA 5IYDG 1WYDA 3H3VH 3F8TA 4LF6Q 3UE0A 1C0AA 1JMCA 4IPGA 1G6PA 1B7YB 1VQEA 3EBEA 4P72A 1UWVA 2VL6A 3K81C 3M85A 3I7FA 4GLXA 2N3SA 3GTJH 1VQMA 1K8AC 4UP8A 3G71A 4C3JH 1CUKA 1E7ZA 4KHZA 3UDXA 4HIOA 1KL9A 3MEFA 1Q82C 4LF7L 1XPUA 1I5FA 3I4NG 4BBSG 4BBRH 1HNZQ 2R93G 3NENA 3T1HQ 2IY5B 3J80i 4QJFA 3I4OA 3WWVA 1L1OA 1VQ6A 1Q1BA 1XNQQ 4C3HH 2JA7G 4B3SL 5JJKA 1AH9A 2HT1A 4JI1L 3TQYA 4IFDJ 1GKHA 3LGJA 4HIDA 2RF4A 1PH5A 2ZJRA 3PUZA 2IX0A 1S40A 4GKKL 1CKNA 1Q12A 2N8NA 2JA5G 3I4NH 4BBSH 2R93H 3S2HH 1EYGA 1LTLA 1IBLL 2UUCL 2ASBA 3G4SA 2RHSB 2AHOB 2CFMA 5IYCG 2NVYH 4LF7Q 2ZTCA 4R1JA 2JA7H 4DAMA 4DV0L 2IHFA 1X54A 2PI2A 2Z0SA 3SGIA 2Q2TA 2BH2A 2H5XA 2R92G 4JI1Q 3L2PA 4YCWA 1ASZA 4OWWB 2Y0SG 2ZM6L 4GKKQ 2K14A 3U4ZA 1XMQL 3CCVA 3CXCA 2K50A 1Q81C 3CAMA 4LWCA 4IPHA 4LW1A 4A3DG 4UP7A 5DLQE 3ULPA 4JOIA 1XMOQ 2L15A 1IBLQ 4DV4L 3RR5A 1TWCH 1I94Q 3PV0A 1KD1C 2WFWA 2YV5A 1HZCA 1X55A 4HIMA 2E2HH 4JG2A 4OXPA 2KCMA 4NPSA 3W1GA 1VQCA 4GOPB 1XPOA 4DV0Q 2R92H 2AMCB 4MNOA 3CC7A 1BVSA 1OXTA 4OWTB 1N8RC 2JA6G 2Q2IA 4A3DH 4XTCS 2JJQA 4O2DA 2XGTA 1CSPA 5C0XJ 3E9IA 5JJIA 1U0LA 1X3EA 3H0GG 1KRSA 2IHEA 3GTQH 2VS1A 3CP0A 1E3PA 1N9WA 4A3FG 1PH1A 4DKAC 2CCZA 5ELNA 1CKOA 4A3EH 4DV4Q 3RLOA 1HNXL 1GO3E 1YHBA 1E1OA 1SN8A 2ID0A 2JA6H 2K5NA 2R7ZG 3CPFA 4P73A 3H15A 1KHIA 1B70B 4GLVB 3S1NH 3S2DH 3UE1A 4A3GG 4JYAQ 4LFBL 5IT9c 4OX9Q 1WOCA 1VQ7A 5M5XH 5J3BA 4JV5L 4LUOA 3GD7A 4AYBE 1M1KC 3PO2H 3HKZE 4B3RL 4QIWE 4IO9A 3AEVA 2MO0A 4X6AH 3UDFA 2EIFA 1I3QH 1YZ6A 2JE6I 4BXXG 1AE3A 2A1AA 3JAMc 4WJ3M 2N78A 1YHAA 5IWAQ 3A5ZB 3K8AA 1W2BA 1NY4A 1HNXQ 3PUYA 1Q46A 2I5LX 2VQFL 4ALPA 1X3FA 3OTOL 1PH7A 4JI0L 3PCOB 5IP9G 2KCTA 4GKJL 1PYBA 1V9PA 4GN3B 4OONA 4LFBQ 5C4XG 1J6QA 4BXXH 2B3GA 4A3JG 2A8VA 4AQYL 3B6YA 4A3CG 2Q2UA 3CCMA 4JBKA 4L5RC 4B3RQ 1K8GA 1JB7A 2HHHL 1EOVA 3S14H 4DR6L 4P75A 1NTGA 2KBNA 3RZOH 1IBML 2KHIA 1JJGA 3GO5A 3S1QH 3OYYA 4PMWA 3I4MH 2F3IA 4DV1L 2JQOA 4TQUS 5K36G 4GN4B 1X9NA 1VQ9A 3OTOQ 4DV3L 5C3EG 4B3MQ 1IBKL 4JI0Q 4KHPL 4JC0A 4MZ9A 2JEAI 1IZ6A 3TS0A 1G291 5M3FG 2F52A 2K5HA 1HH2P 1FJGL 1I6HH 3HKSA 3KF8B 4DV7L 2KENA 1PVOA 1OXUA 2MNAA 3L7ZC 5GAHC 4AQYQ 3CC2A 4GNXA 1HR0Q 2HHHQ 4DR6Q 1FL0A 3DM3A 4BY7G 4KI0A 3PGZA 3PUVA 4LUZA 3J80c 4DR7L 5FLXc 5C3EH 3KF6B 1OXSC 1IBMQ 4LF8L 2ZJPA 2YYZA 3RN2A 1PH2A 1YJWA 1C7YA 3PF4A 5M3FH 4DV1Q 2JA9A 1TWHH 1QVGA 5IYDH 3NELA 1A0IA 1PFSA 1E1TA 4DV3Q 2I5HA 4KHPQ 1IBKQ 1VQIA 1QZHA 1H95A 2OTLA 4X66Q 4X64L 1S72A 4L5SA 2BH8A 1TWAH 3F1ZA 4JI2L 1FJGQ 4BY7H 4EX5A 4DV7Q 1PH8A 4JI5L 2UXBL 3J7A5 2K52A 1XMOL 3HOVG 3OW2A 2ATWA 1VQGA 4AIMA 3M4QA 1NMGA 2PNHA 4R4QA 4NXNL 3CMEA 1I94L 5C0XI 3RNUA 4YWKA 4DR7Q 4GNXB 4LF8Q 2E8GA 1L2FA 2GVBA 4IFDG 4O0AA 1IXRA 4IJLA 2KHJA 1KXLA 3K80C 4IPDA 1WFQA 4B3TL 1NMFA 4R4CA 2ZJQA 4YCUA 5E7NA 5IE8A 5HY6A 3I55A 2VQEL 2JA5H 3HOXG 2I0QA 2R6GA 4HJ5A 4NXML 1N36L 3Q8DA 4X64Q 3J81i 4QQBX 1L1OB 4WJ4A 4LF4L 4JI2Q 1XPRA 1Y1WG 5IYCH 4JI5Q 3HOWG 2EXDA 3NBHB 3S16H 3GTGH 1MIUA 2UXBQ 4Y52H 5M5WH 4A3MG 1SROA 4K0KL 1CKNB 1A8VA 1EQRA 4R4TA 2E5LL 1SMXA 1Q1EA 4NXNQ 1TWGH 5GAGC 2D0PA 4QY7A 4MTNA 4HJ7A 2UU9L 5AJ3L 1K3RA 3D0FA 4P74A 2UUBL 3HOXH 3U58A 1DGSA 3CC4A 1K83H 3A74A 1PH9A 4JYAL 3TRZA 2CWPA 1YIJA 4B3TQ 4OX9L 2K5VA 3S15H 4PZ7A 3W1BA 4DK6C 2VQEQ 4PG3A 4JI8L 1MJEA 2WB1G 3FKIG 3KJOA 1YVCA 4HIKA 1N36Q 4LF9Q 4NXMQ 3CD6A 2PQAA 1ASYA 1G51A 2F4VL 4LF4Q 2R7FA 1X3GA 1EQQA 4JBWA 4HJ8A 4NB3A 4YHHL 5IWAL 1SE8A 1D8LA 3PF5A 4K0KQ 2WP8J 2UXDL 4YWLA 1YJNA 4XIGS 4BY1G 2E5LQ 2JA8G 3HOUG 3S17H 1CSQA 2UUAL 2UU9Q 5AJ3Q 1FGUA 3RLFA 2UUBQ 2LSSA 4A3LG 3FKIH 5M3MG 2Z6KC 3H0GH 2QGQA 4POFA 4X65L 3AYHB 2QA4A 1YITA 3DLLA 3CCEA 4JI8Q 4A3FH 3H3VI 2CWAA 2VZAA 3J7ZC 2ALYB 2DUDA 3ZJYC 3M3YH 2F4VQ 2R7ZH 1EIYB 5GROA 2AKWB 4FDBA 2PQAB 4YHHQ 2B29A 4LFAL 4A3GH 4IPCA 5LMNL 2UXDQ 3CCUA 2LXJA 3G48A 4GN5A 3M4PA 4DUYL 1JT8A 4GS3A 2UUAQ 4B3ML 4L5QA 4IJHA 2ZTEA 1CKMA 3A5UA 3A0JA 1SRUA 1VQKA 2VUMG 3CQZH 4LUVA 3VDYA 2YU9H 5IY0A 3K0XA 4X65Q 4DNIA 1BBUA 5IP7G 3M4OH 5JEAJ 3E0EA 1UE6A 4P71A 1V1QA 1X56A 4J15A 1HR0L 1U5KA 1E22A 3BU2A 3TREA 4YWMA 4QGUA 2K75A 3HOZG 3EN2A 3KDFA 5IP9H 4X62L 2VY3A 4LFAQ 5LMNQ 3NEMA 5C4XH 1Y1VG 4DUYQ 3ULJA 2MO1A 1VQBA 4R4OA 1P8LA 4DR5L 2DGYA 3PIPA 4IOCA 4GOPC 4A3JH 1WCMG 3G6EA 4KLKA 4A3CH 3GTOH 4X66L 3M9BA 2LXKA 1K73C 1KQSA 2FXQA 3PUWA 3CCLA 1TXYA 3GTLH 2Q2HA 1S3OA 5FJ8G 3BJUA 1VQLA 3PO3G 3GTKH 4A3IG 1YBYA 1X6OA 2NZOA 4HJ9A 1PH3A 4POGA 4PZ8A 3I56A 1AE2A 4DR1L 1Y1VH 1EIFA 4RMFA 1EWIA 1GM5A 2Z6KA 4X62Q 2Y0SE 2NN6I 1J5EQ 4AYBG 3GTPH 4LFCL 2AWOA 1HZBA 3FHWA 1HJPA 2OQKA 5EAYA 3U50C 3UDIA 3F2DA 1PV4A 4DR5Q 3CCQA 4JI6L 4BBRG 2V1CC 2VUMH 3M7NA 5BR8L 3PO3H 3CF5A 3KFUA 4A3IH 3ULLA 3D31A 3AFPA 3J81j 1Z47A 1TWFH 1QUQA 1WJJA 2K4KA 3CMAA 2HQLA 2HIVA 1NBWA 3RLNA 4DUZL 3K7UC 2NZHA 1YNXA 2GN5A 1RL2A 2ZTDA 1JJ2A 2WAQG 2OTJA 1KRTA 3STBC 5LMUQ 4HJAA 4DR1Q 4A3KG 4UY8C 2WB1E 1K9MC 3EIVA 3STBD 1KC8C 3JC66 3KJPA 3F2BA 1Y14B 2GVAA 3GTMH 3PSIA 1VQ4A 3KYHC 4APVA 2OWOA 4JI7L 4LFCQ 4ME3A 1VQ5A 1Q8KA 2UXCL 3CCSA 3J81c 1BBWA 1SLJA 1UEBA 2YTXA 4OWXB 3CPWA 4JI6Q 3CCRA 2IX1A 5ELOA 1OXVA 1Q7YC 2R7DA 1A62A 3BZKA 4QL5A 5BR8Q 4LF9L 1MJCA 1NE3A 4EQ5A 3HOVH 5IYBG 3F2CA 4JI4L 2IT1A 4TVAB 4A3KH 1UE1A 3BZCA 4DUZQ 1XJVA 1VCIA 2HIXA 1P16A 1LUZA 2I5MX 1N33L 1QUQB 4A93G 1UE5A 4GOPA 1D7QA 2BA1A 1JJCB 2OQ0A 3UDGA 4A76A 5GADC 4OO1I 3RZDH 3ICEA 5LMNW 1T9HA 1VQHA 1VQNA 3S1MH 2D0OA 4JI7Q 4DK3C 5IYBH 5JJLA 4DR4L 1YI2A 5FLMG 2NN6G 2YTVA 3T1YL 1GVPA 2UXCQ 1Y1WH 3HOWH 1KIXA 4B3SQ 1MKHA 1GD7A 4A3MH 1VQAA 1Q86C 4A93H 3K7AH 1VQ8A 4DV6L 2ES2A 4JI4Q 1LYLA 1VS0A 3KLWA 1HR0W 1JE5A 2MQHA 2UUCQ 4YY3L 2JEBI 1N33Q 1WI5A 1M90C 1W3SA 2D62A 1R9TH 1PH4A 5FLMH 1XNRL 2OCEA 3AQQA 3PIOA 4A3EG 1OTCA 2B63G 2PMZE 5C0XG 4DV5L 1N34L 4PZ6A 5GAEC 4BA2I 3HFZB 5C4JH 1PH6A 3T1YQ 4DR4Q 4JBMA 1YJ9A 3TS2A 4DV2L 2NVTH 1HZ9A 2AWNA 5C44G 2C35B 2ZM6Q 4LNQA 4R4IA 1I50H 1VQFA 1XMQQ 4BY1H 3FP9A 4DV6Q 5H1SE 2JA8H 3HOUH 3KOJA 4AH6A 2N49A 3MXNB 3PO2G 1VQDA 4C2MH 4A3LH 1B8AA 4JBJA 3RN5A 4YY3Q 2B63H 4A3BG 1OXXK 5M3MH 1XNRQ 4GNXC 4IOAA 1QVCA 3AFQA 4OO1G 5C44H 4A4IA 4C3IH 4DV5Q 1N34Q 3S24A 4LF5L 2CQOA 3L0OA 4JI3L 3PUXA 1HNWL 4DV2Q 1QZGA 4A3BH 1N32L 2VNUD 1L1OC 1VQJA 1UE7A 2MFIA 4DR3L 3W5OA 3HOYG 4DR2L 1SR3A 4DPGA 3I2ZA 5HGQA 1YHQA 4UPAA 2XTIA 1J5EL 3JAMi 3ER0A 1QVFA 2JK8A 3ERSX 1EFWA 1VQPA 2PI2E 3GDEA 2YTYA 5JEAG 2EQSA 2RCNA 1C9OA 5IP7H 1PHJA 1VQOA 2WAQE 3I4MG 3U4VA 2VW9A 4RG1A 2NVQH 2BA0A 4H02A 4LF5Q 4YCVA 3CW2C 4LF6L 3HOZH 4JCVE 1L0WA 4JI3Q 1NJIC 3HOYH 1BKBA 1O7IA 4JV5Q 1K0RA 1FVIA 1HNWQ 3KF6A 1N32Q 2CKZB 1V43A 1E24A 2E2IH 1A63A 3IRBA 4IFDI 4UP9A 4DR3Q 5LMUL 1LM0A 2QEXA 1KAWA 1XTDA 4DR2Q 1HNZL 1EUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WCM H;  2A19 A;  1X65 A;  3T1H L;  2NVX H;  5GQO A;  4Y7N H;  3KDF B;  2VQF Q;  3HKZ G;  1PA6 A;  4A75 A;  1SFO H;  2RHQ B;  4JOI C;  1YEZ A;  5M5Y H;  1XNQ L;  4BA1 I;  1RIP A;  3TEH B;  1PYS B;  4GKJ Q;  3E9H A;  5FJ8 H;  3S1R H;  1IYJ B;  1HZA A;  4GLA C;  2E2J H;  1IL2 A;  3CCJ A;  1Z9F A;  4DAY B;  4L5T A;  5IYD G;  1WYD A;  3H3V H;  3F8T A;  4LF6 Q;  3UE0 A;  1C0A A;  1JMC A;  4IPG A;  1G6P A;  1B7Y B;  1VQE A;  3EBE A;  4P72 A;  1UWV A;  2VL6 A;  3K81 C;  3M85 A;  3I7F A;  4GLX A;  2N3S A;  3GTJ H;  1VQM A;  1K8A C;  4UP8 A;  3G71 A;  4C3J H;  1CUK A;  1E7Z A;  4KHZ A;  3UDX A;  4HIO A;  1KL9 A;  3MEF A;  1Q82 C;  4LF7 L;  1XPU A;  1I5F A;  3I4N G;  4BBS G;  4BBR H;  1HNZ Q;  2R93 G;  3NEN A;  3T1H Q;  2IY5 B;  3J80 i;  4QJF A;  3I4O A;  3WWV A;  1L1O A;  1VQ6 A;  1Q1B A;  1XNQ Q;  4C3H H;  2JA7 G;  4B3S L;  5JJK A;  1AH9 A;  2HT1 A;  4JI1 L;  3TQY A;  4IFD J;  1GKH A;  3LGJ A;  4HID A;  2RF4 A;  1PH5 A;  2ZJR A;  3PUZ A;  2IX0 A;  1S40 A;  4GKK L;  1CKN A;  1Q12 A;  2N8N A;  2JA5 G;  3I4N H;  4BBS H;  2R93 H;  3S2H H;  1EYG A;  1LTL A;  1IBL L;  2UUC L;  2ASB A;  3G4S A;  2RHS B;  2AHO B;  2CFM A;  5IYC G;  2NVY H;  4LF7 Q;  2ZTC A;  4R1J A;  2JA7 H;  4DAM A;  4DV0 L;  2IHF A;  1X54 A;  2PI2 A;  2Z0S A;  3SGI A;  2Q2T A;  2BH2 A;  2H5X A;  2R92 G;  4JI1 Q;  3L2P A;  4YCW A;  1ASZ A;  4OWW B;  2Y0S G;  2ZM6 L;  4GKK Q;  2K14 A;  3U4Z A;  1XMQ L;  3CCV A;  3CXC A;  2K50 A;  1Q81 C;  3CAM A;  4LWC A;  4IPH A;  4LW1 A;  4A3D G;  4UP7 A;  5DLQ E;  3ULP A;  4JOI A;  1XMO Q;  2L15 A;  1IBL Q;  4DV4 L;  3RR5 A;  1TWC H;  1I94 Q;  3PV0 A;  1KD1 C;  2WFW A;  2YV5 A;  1HZC A;  1X55 A;  4HIM A;  2E2H H;  4JG2 A;  4OXP A;  2KCM A;  4NPS A;  3W1G A;  1VQC A;  4GOP B;  1XPO A;  4DV0 Q;  2R92 H;  2AMC B;  4MNO A;  3CC7 A;  1BVS A;  1OXT A;  4OWT B;  1N8R C;  2JA6 G;  2Q2I A;  4A3D H;  4XTC S;  2JJQ A;  4O2D A;  2XGT A;  1CSP A;  5C0X J;  3E9I A;  5JJI A;  1U0L A;  1X3E A;  3H0G G;  1KRS A;  2IHE A;  3GTQ H;  2VS1 A;  3CP0 A;  1E3P A;  1N9W A;  4A3F G;  1PH1 A;  4DKA C;  2CCZ A;  5ELN A;  1CKO A;  4A3E H;  4DV4 Q;  3RLO A;  1HNX L;  1GO3 E;  1YHB A;  1E1O A;  1SN8 A;  2ID0 A;  2JA6 H;  2K5N A;  2R7Z G;  3CPF A;  4P73 A;  3H15 A;  1KHI A;  1B70 B;  4GLV B;  3S1N H;  3S2D H;  3UE1 A;  4A3G G;  4JYA Q;  4LFB L;  5IT9 c;  4OX9 Q;  1WOC A;  1VQ7 A;  5M5X H;  5J3B A;  4JV5 L;  4LUO A;  3GD7 A;  4AYB E;  1M1K C;  3PO2 H;  3HKZ E;  4B3R L;  4QIW E;  4IO9 A;  3AEV A;  2MO0 A;  4X6A H;  3UDF A;  2EIF A;  1I3Q H;  1YZ6 A;  2JE6 I;  4BXX G;  1AE3 A;  2A1A A;  3JAM c;  4WJ3 M;  2N78 A;  1YHA A;  5IWA Q;  3A5Z B;  3K8A A;  1W2B A;  1NY4 A;  1HNX Q;  3PUY A;  1Q46 A;  2I5L X;  2VQF L;  4ALP A;  1X3F A;  3OTO L;  1PH7 A;  4JI0 L;  3PCO B;  5IP9 G;  2KCT A;  4GKJ L;  1PYB A;  1V9P A;  4GN3 B;  4OON A;  4LFB Q;  5C4X G;  1J6Q A;  4BXX H;  2B3G A;  4A3J G;  2A8V A;  4AQY L;  3B6Y A;  4A3C G;  2Q2U A;  3CCM A;  4JBK A;  4L5R C;  4B3R Q;  1K8G A;  1JB7 A;  2HHH L;  1EOV A;  3S14 H;  4DR6 L;  4P75 A;  1NTG A;  2KBN A;  3RZO H;  1IBM L;  2KHI A;  1JJG A;  3GO5 A;  3S1Q H;  3OYY A;  4PMW A;  3I4M H;  2F3I A;  4DV1 L;  2JQO A;  4TQU S;  5K36 G;  4GN4 B;  1X9N A;  1VQ9 A;  3OTO Q;  4DV3 L;  5C3E G;  4B3M Q;  1IBK L;  4JI0 Q;  4KHP L;  4JC0 A;  4MZ9 A;  2JEA I;  1IZ6 A;  3TS0 A;  1G29 1;  5M3F G;  2F52 A;  2K5H A;  1HH2 P;  1FJG L;  1I6H H;  3HKS A;  3KF8 B;  4DV7 L;  2KEN A;  1PVO A;  1OXU A;  2MNA A;  3L7Z C;  5GAH C;  4AQY Q;  3CC2 A;  4GNX A;  1HR0 Q;  2HHH Q;  4DR6 Q;  1FL0 A;  3DM3 A;  4BY7 G;  4KI0 A;  3PGZ A;  3PUV A;  4LUZ A;  3J80 c;  4DR7 L;  5FLX c;  5C3E H;  3KF6 B;  1OXS C;  1IBM Q;  4LF8 L;  2ZJP A;  2YYZ A;  3RN2 A;  1PH2 A;  1YJW A;  1C7Y A;  3PF4 A;  5M3F H;  4DV1 Q;  2JA9 A;  1TWH H;  1QVG A;  5IYD H;  3NEL A;  1A0I A;  1PFS A;  1E1T A;  4DV3 Q;  2I5H A;  4KHP Q;  1IBK Q;  1VQI A;  1QZH A;  1H95 A;  2OTL A;  4X66 Q;  4X64 L;  1S72 A;  4L5S A;  2BH8 A;  1TWA H;  3F1Z A;  4JI2 L;  1FJG Q;  4BY7 H;  4EX5 A;  4DV7 Q;  1PH8 A;  4JI5 L;  2UXB L;  3J7A 5;  2K52 A;  1XMO L;  3HOV G;  3OW2 A;  2ATW A;  1VQG A;  4AIM A;  3M4Q A;  1NMG A;  2PNH A;  4R4Q A;  4NXN L;  3CME A;  1I94 L;  5C0X I;  3RNU A;  4YWK A;  4DR7 Q;  4GNX B;  4LF8 Q;  2E8G A;  1L2F A;  2GVB A;  4IFD G;  4O0A A;  1IXR A;  4IJL A;  2KHJ A;  1KXL A;  3K80 C;  4IPD A;  1WFQ A;  4B3T L;  1NMF A;  4R4C A;  2ZJQ A;  4YCU A;  5E7N A;  5IE8 A;  5HY6 A;  3I55 A;  2VQE L;  2JA5 H;  3HOX G;  2I0Q A;  2R6G A;  4HJ5 A;  4NXM L;  1N36 L;  3Q8D A;  4X64 Q;  3J81 i;  4QQB X;  1L1O B;  4WJ4 A;  4LF4 L;  4JI2 Q;  1XPR A;  1Y1W G;  5IYC H;  4JI5 Q;  3HOW G;  2EXD A;  3NBH B;  3S16 H;  3GTG H;  1MIU A;  2UXB Q;  4Y52 H;  5M5W H;  4A3M G;  1SRO A;  4K0K L;  1CKN B;  1A8V A;  1EQR A;  4R4T A;  2E5L L;  1SMX A;  1Q1E A;  4NXN Q;  1TWG H;  5GAG C;  2D0P A;  4QY7 A;  4MTN A;  4HJ7 A;  2UU9 L;  5AJ3 L;  1K3R A;  3D0F A;  4P74 A;  2UUB L;  3HOX H;  3U58 A;  1DGS A;  3CC4 A;  1K83 H;  3A74 A;  1PH9 A;  4JYA L;  3TRZ A;  2CWP A;  1YIJ A;  4B3T Q;  4OX9 L;  2K5V A;  3S15 H;  4PZ7 A;  3W1B A;  4DK6 C;  2VQE Q;  4PG3 A;  4JI8 L;  1MJE A;  2WB1 G;  3FKI G;  3KJO A;  1YVC A;  4HIK A;  1N36 Q;  4LF9 Q;  4NXM Q;  3CD6 A;  2PQA A;  1ASY A;  1G51 A;  2F4V L;  4LF4 Q;  2R7F A;  1X3G A;  1EQQ A;  4JBW A;  4HJ8 A;  4NB3 A;  4YHH L;  5IWA L;  1SE8 A;  1D8L A;  3PF5 A;  4K0K Q;  2WP8 J;  2UXD L;  4YWL A;  1YJN A;  4XIG S;  4BY1 G;  2E5L Q;  2JA8 G;  3HOU G;  3S17 H;  1CSQ A;  2UUA L;  2UU9 Q;  5AJ3 Q;  1FGU A;  3RLF A;  2UUB Q;  2LSS A;  4A3L G;  3FKI H;  5M3M G;  2Z6K C;  3H0G H;  2QGQ A;  4POF A;  4X65 L;  3AYH B;  2QA4 A;  1YIT A;  3DLL A;  3CCE A;  4JI8 Q;  4A3F H;  3H3V I;  2CWA A;  2VZA A;  3J7Z C;  2ALY B;  2DUD A;  3ZJY C;  3M3Y H;  2F4V Q;  2R7Z H;  1EIY B;  5GRO A;  2AKW B;  4FDB A;  2PQA B;  4YHH Q;  2B29 A;  4LFA L;  4A3G H;  4IPC A;  5LMN L;  2UXD Q;  3CCU A;  2LXJ A;  3G48 A;  4GN5 A;  3M4P A;  4DUY L;  1JT8 A;  4GS3 A;  2UUA Q;  4B3M L;  4L5Q A;  4IJH A;  2ZTE A;  1CKM A;  3A5U A;  3A0J A;  1SRU A;  1VQK A;  2VUM G;  3CQZ H;  4LUV A;  3VDY A;  2YU9 H;  5IY0 A;  3K0X A;  4X65 Q;  4DNI A;  1BBU A;  5IP7 G;  3M4O H;  5JEA J;  3E0E A;  1UE6 A;  4P71 A;  1V1Q A;  1X56 A;  4J15 A;  1HR0 L;  1U5K A;  1E22 A;  3BU2 A;  3TRE A;  4YWM A;  4QGU A;  2K75 A;  3HOZ G;  3EN2 A;  3KDF A;  5IP9 H;  4X62 L;  2VY3 A;  4LFA Q;  5LMN Q;  3NEM A;  5C4X H;  1Y1V G;  4DUY Q;  3ULJ A;  2MO1 A;  1VQB A;  4R4O A;  1P8L A;  4DR5 L;  2DGY A;  3PIP A;  4IOC A;  4GOP C;  4A3J H;  1WCM G;  3G6E A;  4KLK A;  4A3C H;  3GTO H;  4X66 L;  3M9B A;  2LXK A;  1K73 C;  1KQS A;  2FXQ A;  3PUW A;  3CCL A;  1TXY A;  3GTL H;  2Q2H A;  1S3O A;  5FJ8 G;  3BJU A;  1VQL A;  3PO3 G;  3GTK H;  4A3I G;  1YBY A;  1X6O A;  2NZO A;  4HJ9 A;  1PH3 A;  4POG A;  4PZ8 A;  3I56 A;  1AE2 A;  4DR1 L;  1Y1V H;  1EIF A;  4RMF A;  1EWI A;  1GM5 A;  2Z6K A;  4X62 Q;  2Y0S E;  2NN6 I;  1J5E Q;  4AYB G;  3GTP H;  4LFC L;  2AWO A;  1HZB A;  3FHW A;  1HJP A;  2OQK A;  5EAY A;  3U50 C;  3UDI A;  3F2D A;  1PV4 A;  4DR5 Q;  3CCQ A;  4JI6 L;  4BBR G;  2V1C C;  2VUM H;  3M7N A;  5BR8 L;  3PO3 H;  3CF5 A;  3KFU A;  4A3I H;  3ULL A;  3D31 A;  3AFP A;  3J81 j;  1Z47 A;  1TWF H;  1QUQ A;  1WJJ A;  2K4K A;  3CMA A;  2HQL A;  2HIV A;  1NBW A;  3RLN A;  4DUZ L;  3K7U C;  2NZH A;  1YNX A;  2GN5 A;  1RL2 A;  2ZTD A;  1JJ2 A;  2WAQ G;  2OTJ A;  1KRT A;  3STB C;  5LMU Q;  4HJA A;  4DR1 Q;  4A3K G;  4UY8 C;  2WB1 E;  1K9M C;  3EIV A;  3STB D;  1KC8 C;  3JC6 6;  3KJP A;  3F2B A;  1Y14 B;  2GVA A;  3GTM H;  3PSI A;  1VQ4 A;  3KYH C;  4APV A;  2OWO A;  4JI7 L;  4LFC Q;  4ME3 A;  1VQ5 A;  1Q8K A;  2UXC L;  3CCS A;  3J81 c;  1BBW A;  1SLJ A;  1UEB A;  2YTX A;  4OWX B;  3CPW A;  4JI6 Q;  3CCR A;  2IX1 A;  5ELO A;  1OXV A;  1Q7Y C;  2R7D A;  1A62 A;  3BZK A;  4QL5 A;  5BR8 Q;  4LF9 L;  1MJC A;  1NE3 A;  4EQ5 A;  3HOV H;  5IYB G;  3F2C A;  4JI4 L;  2IT1 A;  4TVA B;  4A3K H;  1UE1 A;  3BZC A;  4DUZ Q;  1XJV A;  1VCI A;  2HIX A;  1P16 A;  1LUZ A;  2I5M X;  1N33 L;  1QUQ B;  4A93 G;  1UE5 A;  4GOP A;  1D7Q A;  2BA1 A;  1JJC B;  2OQ0 A;  3UDG A;  4A76 A;  5GAD C;  4OO1 I;  3RZD H;  3ICE A;  5LMN W;  1T9H A;  1VQH A;  1VQN A;  3S1M H;  2D0O A;  4JI7 Q;  4DK3 C;  5IYB H;  5JJL A;  4DR4 L;  1YI2 A;  5FLM G;  2NN6 G;  2YTV A;  3T1Y L;  1GVP A;  2UXC Q;  1Y1W H;  3HOW H;  1KIX A;  4B3S Q;  1MKH A;  1GD7 A;  4A3M H;  1VQA A;  1Q86 C;  4A93 H;  3K7A H;  1VQ8 A;  4DV6 L;  2ES2 A;  4JI4 Q;  1LYL A;  1VS0 A;  3KLW A;  1HR0 W;  1JE5 A;  2MQH A;  2UUC Q;  4YY3 L;  2JEB I;  1N33 Q;  1WI5 A;  1M90 C;  1W3S A;  2D62 A;  1R9T H;  1PH4 A;  5FLM H;  1XNR L;  2OCE A;  3AQQ A;  3PIO A;  4A3E G;  1OTC A;  2B63 G;  2PMZ E;  5C0X G;  4DV5 L;  1N34 L;  4PZ6 A;  5GAE C;  4BA2 I;  3HFZ B;  5C4J H;  1PH6 A;  3T1Y Q;  4DR4 Q;  4JBM A;  1YJ9 A;  3TS2 A;  4DV2 L;  2NVT H;  1HZ9 A;  2AWN A;  5C44 G;  2C35 B;  2ZM6 Q;  4LNQ A;  4R4I A;  1I50 H;  1VQF A;  1XMQ Q;  4BY1 H;  3FP9 A;  4DV6 Q;  5H1S E;  2JA8 H;  3HOU H;  3KOJ A;  4AH6 A;  2N49 A;  3MXN B;  3PO2 G;  1VQD A;  4C2M H;  4A3L H;  1B8A A;  4JBJ A;  3RN5 A;  4YY3 Q;  2B63 H;  4A3B G;  1OXX K;  5M3M H;  1XNR Q;  4GNX C;  4IOA A;  1QVC A;  3AFQ A;  4OO1 G;  5C44 H;  4A4I A;  4C3I H;  4DV5 Q;  1N34 Q;  3S24 A;  4LF5 L;  2CQO A;  3L0O A;  4JI3 L;  3PUX A;  1HNW L;  4DV2 Q;  1QZG A;  4A3B H;  1N32 L;  2VNU D;  1L1O C;  1VQJ A;  1UE7 A;  2MFI A;  4DR3 L;  3W5O A;  3HOY G;  4DR2 L;  1SR3 A;  4DPG A;  3I2Z A;  5HGQ A;  1YHQ A;  4UPA A;  2XTI A;  1J5E L;  3JAM i;  3ER0 A;  1QVF A;  2JK8 A;  3ERS X;  1EFW A;  1VQP A;  2PI2 E;  3GDE A;  2YTY A;  5JEA G;  2EQS A;  2RCN A;  1C9O A;  5IP7 H;  1PHJ A;  1VQO A;  2WAQ E;  3I4M G;  3U4V A;  2VW9 A;  4RG1 A;  2NVQ H;  2BA0 A;  4H02 A;  4LF5 Q;  4YCV A;  3CW2 C;  4LF6 L;  3HOZ H;  4JCV E;  1L0W A;  4JI3 Q;  1NJI C;  3HOY H;  1BKB A;  1O7I A;  4JV5 Q;  1K0R A;  1FVI A;  1HNW Q;  3KF6 A;  1N32 Q;  2CKZ B;  1V43 A;  1E24 A;  2E2I H;  1A63 A;  3IRB A;  4IFD I;  4UP9 A;  4DR3 Q;  5LMU L;  1LM0 A;  2QEX A;  1KAW A;  1XTD A;  4DR2 Q;  1HNZ L;  1EUJ A; 
#chains in the Genus database with same CATH topology
 1WCM H;  1J8I A;  1LTA D;  5JAV A;  1GHK A;  4Y7N H;  3KDF B;  3HKZ G;  4C3J G;  4JOI C;  5M3M B;  1S5B D;  5EBC A;  1PYS B;  4GKJ Q;  2B39 A;  1HZA A;  4U68 A;  2E2J H;  4DAY B;  4L5T A;  3H3V H;  3F8T A;  3CQZ B;  3J7A V;  1G6P A;  1B7Y B;  3K81 C;  3M4O B;  2CH4 W;  2A5H A;  1E7Z A;  3UDX A;  3MEF A;  4LF7 L;  2R93 G;  1TVX A;  2N55 A;  1HTP A;  3WWV A;  5C4X B;  5CGK A;  2JA7 G;  4H44 C;  2ZT9 C;  1LTT D;  3TQY A;  1GKH A;  4NP5 A;  4HID A;  1PH5 A;  1S40 A;  2IX0 A;  2H4O A;  1GUW A;  1Q12 A;  4UAI A;  4XYO A;  2JA5 G;  4BBS H;  1ZEQ X;  2ASB A;  3J80 E;  1SYB A;  3FVQ A;  2RHS B;  4P2C B;  2AHO B;  5KIX A;  4R1J A;  4WRD A;  4DAM A;  5JVH 3;  1FNU A;  4DV0 L;  5JPN C;  1KLU D;  3DUZ A;  5KYI A;  2PI2 A;  2H5X A;  3NTI A;  1ASZ A;  2F0J A;  1I4G A;  4OWW B;  5I2Y A;  3PO3 B;  4A3I B;  4OIJ A;  1Q81 C;  2F0O A;  3CXC A;  4K8J A;  4IPH A;  4CJ2 C;  1XMO Q;  1ONL A;  1IBL Q;  4DV4 L;  1LTB D;  1F77 A;  3P1H A;  1AN8 A;  3PV0 A;  2WFW A;  4N9T A;  4JK1 C;  4HIM A;  4JG2 A;  1VQC A;  1KNE A;  1XPO A;  2R92 H;  1Y8O B;  2AMC B;  1D1K A;  3CC7 A;  2KED A;  1NUC A;  5C3W A;  3MZ5 A;  3CKI B;  4O2D A;  2B8G A;  2CH4 A;  1SE2 A;  5C0X J;  1U0L A;  2Z8L A;  4MTK A;  3L3O C;  2VS1 A;  3CP0 A;  4G4K A;  1E3P A;  1N9W A;  4I7A A;  3T51 B;  4A3E H;  1YHB A;  1E1O A;  5TSS A;  4FNF A;  4P73 A;  2Z1C A;  3S2D H;  3OWE B;  3RZD B;  4UHV A;  3S1M B;  4LFB L;  4R9W A;  4KD4 A;  4HMI A;  4H13 C;  3PO2 H;  3HOW B;  2PZT A;  1A3U A;  1GUG A;  1SYD A;  2RQX A;  4IO9 A;  1PZI D;  3K7A B;  2F0P A;  1YZ6 A;  4WJ3 M;  2N78 A;  4K5X A;  3GV6 A;  1W2B A;  4G7O C;  2BDN A;  4CDC C;  3OTO L;  4DXG A;  4DAP A;  2K32 A;  1PYB A;  5T1G A;  3TP6 A;  4RKL A;  2EYP A;  2B2U A;  4OON A;  1W6J A;  3H09 A;  2EZV A;  2WII B;  1JOQ A;  2KJX A;  4BXX H;  2A8V A;  4Q0F A;  5G3L D;  4JBK A;  4DR6 L;  1NTG A;  2KBN A;  2KHI A;  2PYK A;  3GO5 A;  1C8C A;  4PMW A;  4DV1 L;  1HPC A;  1I4Q A;  3T56 B;  2JEA I;  3D4R A;  1U9R A;  5C44 B;  1HH2 P;  3HKS A;  3HEJ A;  3L7Z C;  1JQY D;  2Q8R E;  2SNM A;  4EQN A;  1WTX A;  1RDP D;  3OW7 A;  4BY7 G;  4DR7 L;  5M3F H;  1TWH H;  3K59 A;  1PFS A;  1VQI A;  2ICI A;  1H95 A;  4X66 Q;  5K5P A;  1S72 A;  1EY4 A;  3F1Z A;  4KHV A;  3T16 A;  4EX5 A;  2NVQ B;  1PH8 A;  2O5J C;  2HQE A;  3OW2 A;  1VQG A;  3M4Q A;  1NMG A;  2PNH A;  4NXN L;  1TY2 A;  3MXG A;  4LF8 Q;  2E8G A;  4O0A A;  2KHJ A;  1AFP A;  1WCM B;  3K80 C;  5T1I A;  1WFQ A;  4K8I A;  1XTC D;  4Y7N B;  2EJF C;  5IE8 A;  3J81 i;  3A8I E;  4J1M A;  2E2J B;  2EY5 A;  3S9W A;  1JOR A;  4JI2 Q;  1HFN A;  4JI5 Q;  3S16 H;  2UXB Q;  4ID6 A;  1BUV T;  5M5W H;  3GP7 A;  4R4T A;  4HJ7 A;  2D0P A;  2K6A A;  1PXU A;  5AJ3 L;  3D0F A;  3U58 A;  4JYA L;  3WDN A;  4FXK C;  4B3T Q;  2KA7 A;  2TSS A;  3W1B A;  4DK6 C;  2VQE Q;  3K6O A;  2OEO A;  4PG3 A;  4LF9 Q;  3MXN A;  1SNC A;  5KNB A;  2F4V L;  2L4N A;  3OIP A;  4JBW A;  1M8A A;  4BBS B;  5CYU A;  1SE8 A;  2XWB B;  3S17 H;  4BY1 G;  1FGU A;  3RLF A;  2KEC A;  3E0J A;  3M4Y A;  2QDB A;  2Z6K C;  3H0G H;  2K5D A;  2I46 A;  4POF A;  1K8M A;  3AYH B;  1YIT A;  4V19 0;  3CCE A;  4JI8 Q;  4LAA A;  3AMU A;  2VZA A;  3M3Y H;  2R7Z H;  4NW2 A;  3IKJ A;  3VA5 A;  4UDU C;  4A3G H;  1O80 A;  2UXD Q;  2LXJ A;  4X3S A;  5E4W C;  3M4P A;  4DUY L;  1PFN A;  3C1E A;  3M7G A;  4B3M L;  3A5U A;  3MFY A;  4ZRZ A;  1SRU A;  2OXP A;  2R92 B;  5CV7 A;  1NNX A;  2CW0 C;  1HR0 L;  2KCC A;  3VYT A;  1E2W A;  4RH6 A;  5IP9 H;  1TQO A;  4LFA Q;  4A3E B;  1Y1V G;  2IJ0 A;  1B3A A;  4CDD C;  4CJ1 B;  3PIP A;  4IOC A;  4A3J H;  3G6E A;  3S2D B;  1K3B C;  1KDC A;  2LXK A;  3PQI A;  4DFA A;  3KK7 A;  1S3O A;  3GTK H;  3PO2 B;  1YBY A;  4YIJ A;  1ILQ A;  1Q3L A;  3IFD A;  3I56 A;  4ZUI A;  4IQZ A;  1B9M A;  2NN6 I;  4IUN A;  4KKT A;  4AYB G;  3U50 C;  3F2D A;  1H9S B;  1QIL A;  3SK5 A;  1CHP D;  4DR5 Q;  4BBR G;  1EEI D;  5BR8 L;  2F0S A;  3AFP A;  4OIK A;  4DU9 A;  3J81 j;  1Z47 A;  2MHV A;  2L5T A;  4C3H G;  1NBW A;  2RSO A;  3RLN A;  5A2Q L;  2RDF A;  4R8N A;  4WFN 3;  4HJA A;  2G9H D;  2LS0 1;  1SBB B;  3STB D;  2F0Q A;  3JC6 6;  3F2B A;  1B1Z A;  1Y14 B;  3RMH A;  2F3W A;  3BDO A;  3KYH C;  4LFC Q;  3Q23 A;  2C9O A;  2PO4 A;  2E75 C;  4ME3 A;  2UXC L;  2MP1 A;  1SLJ A;  3J81 c;  4JI6 Q;  3PIP 3;  3VR6 A;  1MJC A;  4RFB A;  1PFB A;  3F2C A;  5DM7 3;  4JI4 L;  4A3K H;  1STE A;  2L12 A;  2PCF B;  2HIX A;  2XVS A;  1P16 A;  3K58 A;  2I5M X;  1N33 L;  1CI3 M;  4GOP A;  2A6H C;  2MGS A;  1JR0 D;  2OQ0 A;  3CRK C;  3ICE A;  5DNF A;  1LO5 D;  4DK3 C;  1YNN D;  5M3F B;  4DR4 L;  4R8I A;  1TWH B;  1SYC A;  3G7L A;  1KIX A;  3TN2 A;  4A3M H;  4A93 H;  1STA A;  3A55 A;  5CMD A;  2NWG A;  1PZK D;  4DGZ A;  1WTP A;  2JEB I;  1KAB A;  4NDX A;  3Q22 A;  1W3S A;  2C5C A;  2RBM A;  4J6H A;  1OTC A;  2B63 G;  2PMZ E;  4PZ6 A;  4K14 A;  3QO2 A;  5C4J H;  1E0B A;  1IYV A;  4JBM A;  3TS2 A;  2A6E D;  4C3I G;  1WTW A;  3MVV A;  4K6L A;  5FO7 B;  1O7L A;  3NHH A;  3HOV B;  1AEX A;  4DV6 Q;  5H1S E;  4B9X A;  3S16 B;  4A3B G;  5C0X H;  5M5W B;  2G5D A;  5M3M H;  4DF7 A;  1XNR Q;  3LNN A;  1TR5 A;  2K04 A;  3P20 A;  4WJW A;  4L63 B;  4OO1 G;  2QIL A;  4DV5 Q;  2PNR C;  1HNW L;  4DV2 Q;  1GUN A;  4ZKC B;  1N32 L;  1ZYR C;  3LWE A;  1LT3 D;  1BCP D;  2FMM A;  2XIW A;  2MFI A;  1WTR A;  4DPG A;  2K1B A;  5A35 A;  4UPA A;  2XTI A;  4CHT B;  1QVF A;  1EFW A;  3ERS X;  3S17 B;  2CQA A;  4TSS A;  5JEA G;  3FDT A;  4I7Z C;  1ESF A;  3I91 A;  2BA0 A;  1PRT B;  4JCV E;  3HOY H;  3TP8 A;  1BKB A;  2CKZ B;  1V43 A;  3SK4 A;  2E2I H;  1EL0 A;  1LM0 A;  3SE0 A;  1KAW A;  2A68 D;  2JA8 B;  5KEE A;  3M3Y B;  2R7Z B;  1HNZ L;  3J7A F;  3K5O A;  3OMG A;  2RA4 A;  4A3G B;  1LT4 D;  2ZXO A;  1QNU A;  1QG7 A;  4GLA C;  5BN3 A;  5IYD G;  1EWH A;  4LF6 Q;  1C0A A;  3VR4 A;  1TY0 A;  1SYE A;  3M85 A;  1UWV A;  2VL6 A;  3ZYY X;  3I7F A;  2N3S A;  2X69 A;  1K8A C;  3G71 A;  4C3J H;  1Q82 C;  1GOZ A;  1R4Q B;  1YNJ C;  3T1H Q;  1AZQ A;  4QJF A;  1L1O A;  2SOB A;  1PMR A;  1Q1B A;  1XNQ Q;  1VQ6 A;  2VUM B;  4ZQ3 A;  5I9O A;  5CV5 A;  4JI1 L;  4IFD J;  3LGJ A;  4A3J B;  3KLS X;  2ZJR A;  1A3V A;  1I4R A;  5CC4 A;  2PMZ B;  2BE5 D;  2R93 H;  3S2H H;  1WD0 A;  1FD7 D;  5FLX E;  3GTK B;  3SK6 A;  3AU7 A;  1QB5 D;  2JA7 H;  2HD3 A;  1Y8P B;  4RCO A;  4CBV A;  1X54 A;  2Z0S A;  5M5Y B;  4FVM A;  5ISR A;  4YCW A;  3QWN A;  2ZM6 L;  4GKK Q;  1XX8 A;  1ENA A;  3U4Z A;  3CCV A;  2K50 A;  2B2U C;  4UP7 A;  5DLQ E;  4LJZ C;  2L15 A;  3KBX A;  3GTJ B;  1X55 A;  4NPS A;  5C5M A;  4MNO A;  4X3K A;  4OWT B;  2Q2I A;  4TRD A;  4NMZ A;  4E6I A;  1MHW C;  4XTC S;  1LTS D;  2F1M A;  3FEW X;  2F0W A;  2F0F A;  3ERQ A;  1X3E A;  1DOM A;  1S5E D;  2MUY A;  2FFK B;  4K5V A;  2CCZ A;  4A3K B;  1BF4 A;  1CKO A;  3IFT A;  1AP0 A;  1C4Q A;  2ID0 A;  2K5N A;  1MD2 D;  2NVY B;  3UE1 A;  5D65 A;  4JYA Q;  5A2Q E;  1WOC A;  4IZ8 A;  2J7Z A;  4LUO A;  3GD7 A;  5FO9 B;  3HKZ E;  4B3R L;  5DM6 3;  2PQE A;  4RGT A;  1QNK A;  4A3M B;  4A93 B;  4QIW E;  3AEV A;  2EIF A;  2JE6 I;  1AE3 A;  3I8Z A;  3VA7 A;  3K8A A;  1HNX Q;  2JP1 A;  1JOK A;  2VXW A;  1X3F A;  4G57 A;  4JI0 L;  3PCO B;  3C1F A;  2KCT A;  3DWP A;  2E2H B;  1K8O A;  2A69 C;  3EJI A;  5C4X G;  1SMY D;  1GUO A;  4A3C G;  4L5R C;  2TMP A;  3CCM A;  2PW5 A;  1K8G A;  3S14 H;  3KBG A;  4P75 A;  4DK0 A;  2WAC A;  1IBM L;  1FGB D;  1JJG A;  4K2L A;  3S1Q H;  2JSO A;  3OYY A;  3NTH A;  2F3I A;  1HRJ A;  4TQU S;  5K36 G;  1X9N A;  1ENF A;  3SDZ A;  1VQ9 A;  3ONA B;  4B3M Q;  1IW7 D;  4JC0 A;  4MZ9 A;  4O1N A;  4RHS A;  1HA5 A;  1G29 1;  5COY A;  2F52 A;  4QUC A;  3KF8 B;  3J7Y W;  1PVO A;  2MNA A;  4AQY Q;  3CC2 A;  1NR2 A;  3L9A X;  1HR0 Q;  4QUF A;  2HHH Q;  3D6W A;  5HUR A;  2OT2 A;  3DM3 A;  4PMB A;  1OXS C;  4XXE A;  2ZJP A;  3GQB A;  1YJW A;  4XDX A;  1PH2 A;  3PF4 A;  1WD1 A;  1QVG A;  4DV3 Q;  2P5Z X;  4KHP Q;  1IBK Q;  5D14 A;  2OTL A;  4CKB A;  4X64 L;  4KKS A;  4QB4 A;  5KYL A;  1TWA H;  1FJG Q;  4BY7 H;  2F0U A;  4DV7 Q;  3K5M A;  1AZP A;  5EJW A;  3HOY B;  1I4H A;  5C4Z A;  5IGD A;  4R4Q A;  2E2I B;  2H1E A;  4CKC A;  4KMU C;  1L2F A;  5EKK A;  1IXR A;  1A15 A;  1S5D D;  1F2M A;  4EQP A;  1VMP A;  1NMF A;  4R4C A;  2Z9H A;  2L11 A;  5E7N A;  1G2T A;  3HOX G;  2I0Q A;  2R6G A;  4NXM L;  1RJT A;  1DJR D;  3Q8D A;  3D8G A;  4LF4 L;  2Q8I B;  1I6H B;  1Y1W G;  5IYC H;  3HOW G;  4O42 A;  4DXF A;  1EYD A;  4Y52 H;  1ZKO A;  5CBE E;  4K0K L;  3NE5 B;  1EY7 A;  1X3P A;  1SMX A;  1Q1E A;  1TWG H;  4QY7 A;  3HKZ B;  4C3J B;  2PZU A;  3CC4 A;  4XQJ A;  3U9O A;  3TRZ A;  4OX9 L;  2K5V A;  3ND9 A;  2WB1 G;  1N36 Q;  2CVR A;  4IUP A;  1EQQ A;  4RGN A;  1K0S A;  1VF7 A;  4YHH L;  5IWA L;  2PW7 A;  1D8L A;  4HED A;  2R93 B;  3S2H B;  2E5L Q;  3HOU G;  2UU9 Q;  2UUB Q;  5EBD A;  3E5S A;  2JA7 B;  2NUC A;  2KHS A;  1Q90 A;  5LHY 1;  4X65 L;  4QCL A;  4Q5V A;  1OO9 B;  4A3F H;  1SJH D;  2B2V A;  3J7Z C;  2DUD A;  3NTK A;  2B2Y A;  2X6G A;  3NQT A;  4HAE A;  1EQT A;  2B29 A;  1PTO C;  5IGC A;  4GN5 A;  1JT8 A;  4GS3 A;  2UUA Q;  2NBF A;  1CKM A;  2ZTE A;  1VQK A;  1Y69 U;  4LUV A;  1SDF A;  4J8Q A;  5AFW A;  5IY0 A;  5ELD A;  5IP7 G;  4X3T A;  4ZK9 B;  1V1O A;  4J15 A;  2F0L A;  1E22 A;  3Q0A A;  4CJ0 B;  1ICF B;  3HOZ G;  2K75 A;  1HFG A;  2MJ8 A;  2PZW A;  2AUJ D;  5CV4 A;  4X62 L;  5LMN Q;  2AQ2 B;  1BNZ A;  1TKW B;  2DGY A;  4GOP C;  1WCM G;  4PQX A;  3GTO H;  1RTO A;  5LL6 X;  1B9N A;  2HDL A;  1STY A;  1E2V A;  3CCL A;  4XYQ A;  5KRU A;  1GXD C;  4XQQ A;  1SND A;  1VQL A;  1X6O A;  1PTO H;  4HJ9 A;  4DR1 L;  1Y1V H;  1EIF A;  4RMF A;  1EWI A;  1VMC A;  5ELC A;  4CDF C;  3C3L A;  2Y0S E;  1O7Z A;  2OQK A;  5EAY A;  2F0K A;  3CCQ A;  1Y8N B;  3H91 A;  3BYY B;  2Z4I A;  2F0I A;  1MBY A;  3M7N A;  3U9S A;  2EYM A;  3ULL A;  3D31 A;  1WJJ A;  1QUQ A;  3CMA A;  1X32 A;  1PTO F;  2NZH A;  4RHR A;  4RCN A;  5I2X A;  2JYO A;  2WAQ G;  3S14 B;  2BCO A;  4UY8 C;  3TP5 A;  3EIV A;  2GVA A;  4LK1 C;  4JI7 L;  3S1Q B;  1QCB D;  1VQ5 A;  1KXL A;  1BBW A;  1UEB A;  1CA6 A;  3T4A C;  1OXV A;  2SEB D;  2R7D A;  3HGB A;  3HOV H;  2Q8T A;  1PRT C;  3W2D A;  4DUZ Q;  1XJV A;  4IFD H;  1QUQ B;  2RKS A;  3UDG A;  4A76 A;  4OO1 I;  2F0V A;  5DEH A;  1T9H A;  1VQN A;  3T13 A;  5JJL A;  4MHE A;  1YI2 A;  3T1Y L;  1GVP A;  2F3V A;  3URY A;  4FYD A;  1MKH A;  4IUQ A;  5I9P A;  1Q86 C;  1ROD A;  1CZW A;  4U67 3;  1VQ8 A;  2ES2 A;  1TWA B;  3A7L A;  2WKD A;  4BY7 B;  2MQH A;  1WI5 A;  2D62 A;  1ICW A;  1R9T H;  1EIG A;  2KUM A;  2OCE A;  3FPP A;  3I4L A;  1JE4 A;  3PIO A;  4A3E G;  3NQI A;  2QKI C;  2JN4 A;  4BWG B;  1F9R A;  3LWU A;  3IAY A;  2NVT H;  1LTG D;  1HZ9 A;  1UUP A;  2ZM6 Q;  1M4V A;  2JA8 H;  3KOJ A;  3MXN B;  3PO2 G;  1U4M A;  5IGF A;  4C2M H;  4A3L H;  1B8A A;  3RN5 A;  4YY3 Q;  2B63 H;  1ET9 A;  2DNE A;  3NK9 A;  5FLX L;  4KN7 C;  4GNX C;  1TWG B;  1TS2 A;  1PRT F;  4HN7 A;  4H7B A;  4A4I A;  4C3I H;  3QIA A;  1N34 Q;  2L9H A;  1FR3 A;  4LF5 L;  1PDQ A;  2Y0S B;  4OL7 A;  3TZU A;  4JI3 L;  1KAA A;  3PUX A;  1GUT A;  4A3B H;  2VNU D;  1U4R A;  3EQL C;  1L1O C;  2GA4 B;  3W5O A;  4K5W A;  4F8M A;  2HCC A;  4DAV A;  1STB A;  3JAM i;  3ER0 A;  1CQF A;  3C2P A;  2VUM H;  5FKA C;  4B9W A;  3T53 B;  2EQS A;  1VQO A;  3TP7 A;  4CKE A;  2NTT A;  1IYU A;  2AUK A;  3NXW A;  4RG1 A;  4H02 A;  2IL8 A;  1G6Z A;  1XYI A;  2OF1 A;  1FVI A;  3KF6 A;  4A3F B;  1CHQ D;  4UP9 A;  4DR3 Q;  1CTM A;  5LMU L;  2EXZ A;  4DR2 Q;  3MA2 B;  2A19 A;  3NP8 A;  1RF2 D;  2NVX H;  5GQO A;  1PA6 A;  4A75 A;  1SFO H;  2RHQ B;  5M5Y H;  3V2T A;  5FJ8 H;  3S1R H;  1IYJ B;  1WYD A;  3ND8 A;  3UE0 A;  1JMC A;  4IPG A;  1DOK A;  1S4Z A;  3EBE A;  2O2L D;  4P72 A;  4GLX A;  3GTJ H;  1PLF A;  1SE3 A;  1Z7T A;  4KHZ A;  1XPU A;  1HA6 A;  1I5F A;  4KKU A;  3I4N G;  5IIF A;  2B8F A;  3NEN A;  3J80 i;  1DZ1 A;  1EY5 A;  1F2L A;  4B3S L;  1AH9 A;  1PYW D;  2K33 A;  3GTO B;  1CKN A;  4RWS C;  2N8N A;  2RDH A;  1EYG A;  1DOL A;  1IBL L;  2EDG A;  4RGO S;  3OWF A;  1H9K A;  1PTO B;  2FIN B;  2VB2 X;  2NVY H;  1IL8 A;  1FYC A;  1Y1V B;  4ZCK A;  4LF7 Q;  3VR5 A;  3HZX A;  3EVQ A;  4OEM B;  5FK9 C;  1BCP B;  3L2P A;  1QE6 A;  4ZKB B;  3CAM A;  3FPU B;  4LWC A;  5KGU A;  4A3D G;  2F0G A;  2B2W C;  3RR5 A;  4ZUJ A;  1KD1 C;  1CA5 A;  2YV5 A;  2NN6 H;  1JB3 A;  2E2H H;  4OXP A;  3VYU A;  3W1G A;  4GOP B;  4HTH A;  4DV0 Q;  1N8R C;  2JA6 G;  2ICE C;  2BDO A;  2O4X A;  2JJQ A;  1D1I A;  2XGT A;  2K28 A;  3E9I A;  3EFX D;  3H0G G;  3A8K E;  1B4O A;  3GTQ H;  1PH1 A;  2VB3 X;  2NB0 A;  5ELN A;  4DV4 Q;  4FO2 A;  2R7Z G;  5D3I B;  1ILP A;  1CZG A;  5E3F A;  4N8F A;  3H15 A;  1KHI A;  4RKB A;  1RHP A;  4A3G G;  5IT9 c;  4OX9 Q;  1MSG A;  3SR1 A;  4ZAI A;  1BR9 A;  2J4X A;  4X6A H;  2MO0 A;  1KTK A;  3UDF A;  4XQN A;  2V4D A;  1I4X A;  2A1A A;  4QMG A;  1QOH A;  3JAM c;  1YHA A;  5IWA Q;  4IUT A;  3N52 A;  3R3O A;  1Q46 A;  2I5L X;  1EQV A;  3D6C A;  2VQF L;  1WTQ A;  2EJG C;  1PH7 A;  5IP9 G;  1R9T B;  4KY5 A;  1WVL A;  1CK1 A;  1EU4 A;  3CRL C;  4GN3 B;  4PNY A;  4LFB Q;  3RD4 A;  3A56 A;  3I3C A;  4K6D A;  3RUZ A;  4A3J G;  3EA6 A;  3MFG A;  3BVZ A;  2NVT B;  2DJG C;  1EOV A;  1I6V C;  3RZO H;  5C4H A;  4C2M B;  3I4M H;  2B63 B;  4KN4 C;  2XNA C;  4GN4 B;  3C46 A;  3OTO Q;  5C3E G;  4F7X A;  1IZ6 A;  2XSC A;  2NZ1 D;  2ENB A;  2K5H A;  4C3I B;  1I6H H;  1ESR A;  2KEN A;  3W3A A;  1OXU A;  5M5X B;  5GAH C;  4GNX A;  2IX3 A;  4A3B B;  4DR6 Q;  1FL0 A;  5K36 H;  3PGZ A;  3PUV A;  4LUZ A;  3J80 c;  3G6J B;  4LF8 L;  4H0L C;  3DMU A;  4DV1 Q;  2JA9 A;  3BG3 A;  3NEL A;  2I5H A;  5FO8 B;  1QZH A;  1V8Q A;  3DHQ A;  3VYS A;  4JI2 L;  1KNA A;  4JI5 L;  2UXB L;  3J7A 5;  1WTO A;  2K52 A;  3AB9 A;  1LT5 D;  2ATW A;  4AIM A;  1I94 L;  1BQQ T;  3CME A;  3BZD B;  3RNU A;  4YWK A;  4DR7 Q;  4GNX B;  2B2V C;  2EVB A;  4FF4 A;  5G3L F;  2XRS D;  2B2Y C;  4G7H C;  1LAC A;  4B3T L;  2O5I C;  2E2D C;  2EYH A;  2NVX B;  1HUM A;  1SFO B;  5HY6 A;  3I55 A;  2VQE L;  2JA5 H;  2WV6 D;  4HJ5 A;  3S1R B;  3IL8 A;  1L1O B;  1STN A;  3OIQ A;  4WJ4 A;  1ZXT A;  2LKV A;  1XPR A;  1EOT A;  2EY6 A;  3GTG H;  2B2T A;  4A3M G;  3VR2 A;  3I70 A;  2MPM A;  1ENC A;  4NXN Q;  1TS5 A;  5GAG C;  1E2Z A;  4MTN A;  3HOX H;  1DGS A;  3I90 A;  3J81 E;  1K83 H;  3A74 A;  1PH9 A;  2LY7 A;  1F9P A;  2RCF A;  4JI8 L;  5CBA E;  3FKI G;  1EWC A;  3KJO A;  1HCZ A;  3K5L A;  3CD6 A;  2PQA A;  2RVL A;  2R7F A;  2SDF A;  4HJ8 A;  3QOL A;  2WP8 J;  2UXD L;  4YWL A;  1YJN A;  4XIG S;  1GJX A;  1CSQ A;  2L1B A;  3MTS A;  5AJ3 Q;  2LSS A;  1AW7 A;  4HMJ A;  4RA8 A;  5M3M G;  5EPJ A;  2QGQ A;  2QA4 A;  1RKN A;  2HCI A;  1HQR D;  3DLL A;  3H3V I;  3D3R A;  2CWA A;  3HS0 C;  4IUU A;  2F4V Q;  1B44 D;  1SE4 A;  1CQV A;  2R3Z A;  3CHB D;  3FMC A;  2KQ3 A;  4DA2 A;  2AKW B;  4FDB A;  2PQA B;  5C5L A;  1UNS A;  5IOD A;  4LFA L;  3CCU A;  4HR7 B;  2CHB D;  3R93 A;  5IGG A;  2F4I A;  4C1N I;  3KLR A;  3WOF A;  2EYF A;  2WIN B;  3A0J A;  1SYF A;  1LTR D;  5BN4 A;  2YU9 H;  3BDL A;  3K0X A;  2B2W A;  1BBU A;  1ML0 D;  5JEA J;  3E0E A;  1UE6 A;  4HSP A;  2EPB A;  1JC7 A;  1W6K A;  1TT2 A;  1U5K A;  4M8A A;  2CW0 D;  3SXH A;  3TRE A;  4QF4 A;  4YWM A;  4QGU A;  3EN2 A;  3KDF A;  5C3X A;  3GTQ B;  5NUC A;  1EZ6 A;  4DUY Q;  1VQB A;  4DR5 L;  1P8L A;  1JWM D;  4OHJ A;  4F87 A;  4KLK A;  4KJN A;  2RSN A;  1STH A;  1DCZ A;  2FXQ A;  2L55 A;  5KND A;  3GTL H;  3PO3 G;  4A3I G;  3QB3 A;  2NZO A;  1PH3 A;  4PZ8 A;  1AE2 A;  1STG A;  2RDG A;  5I4D A;  3GTP H;  4LFC L;  1NAP A;  1HZB A;  1HJP A;  1ET6 A;  1XWE A;  3UDI A;  5HGT A;  1EU3 A;  3E6Z X;  4JI6 L;  2V1C C;  1B2T A;  4X3U A;  4ULL A;  3KFU A;  3Q6S A;  1HUN A;  3A8J E;  1TWF H;  2K4K A;  3K7U C;  1IKL A;  2GN5 A;  1RL2 A;  2ZTD A;  1JJ2 A;  1KRT A;  3STB C;  5LMU Q;  2R61 A;  3BDC A;  3HP3 A;  3BVM A;  4CGY B;  4EVO A;  5C6A A;  2WB1 E;  1K9M C;  3RZO B;  2QW7 A;  3KJP A;  2DN8 A;  3BS1 A;  3GTM H;  3PSI A;  4IAL A;  4B08 A;  4APV A;  2OWO A;  3VYR A;  1Q8K A;  2ZXP A;  3CCS A;  3I4M B;  2WKC A;  2YTX A;  3CPW A;  1F2Z A;  5ELO A;  1Q7Y C;  1A62 A;  2IPK D;  5BR8 Q;  4EQ5 A;  1F2Y A;  5LL6 S;  5IYB G;  5CV8 A;  2EY1 A;  3OMC A;  2IT1 A;  1UE1 A;  3BZC A;  1II3 A;  4ZLT F;  1T5E A;  4EGV A;  2KCN A;  1G91 A;  4DNT B;  1UE5 A;  2BA1 A;  4OGQ C;  5J39 A;  2DY8 A;  2A6H D;  5E1F A;  5LMN W;  1VQH A;  1YNN C;  4QIW B;  4K2K A;  2D0O A;  3O13 A;  2UXC Q;  5FLM G;  2FJ2 A;  2K01 A;  4B3S Q;  2K7V A;  4TKO B;  1GD7 A;  1NR4 A;  1VQA A;  2L0C A;  4DV6 L;  4JI4 Q;  5EPK A;  4C56 C;  1LYL A;  1VS0 A;  3KLW A;  4KY6 A;  1S5C D;  2M00 A;  1N33 Q;  1XNR L;  5F2D A;  3AQQ A;  3V96 A;  4DV5 L;  5GAE C;  2A6E C;  4DR4 Q;  3MEH A;  4PV1 C;  4DV2 L;  2AWN A;  2JA5 B;  5C44 G;  2QDL A;  4LNQ A;  2NYZ D;  4R4I A;  4BY1 H;  1I4P A;  3FP9 A;  1LV9 A;  4AH6 A;  2N49 A;  1VQD A;  4JBJ A;  3GTG B;  1OXX K;  2ZXR A;  4IOA A;  4G7Z C;  1QVC A;  5EKL A;  3MWY W;  3HOX B;  2LFN A;  4FF3 A;  1B3Q A;  4ZYS A;  1K83 B;  1SXT A;  4FF1 A;  3S24 A;  1SNM A;  1H9J A;  3L0O A;  4L6T B;  4ILW A;  2EYJ A;  1BCP C;  1QZG A;  1Y1W B;  3QR8 A;  5JPM C;  4FXD A;  1GHJ A;  4FP5 D;  1ZYR D;  1SR3 A;  2IWH A;  3TME A;  1YHQ A;  1J5E L;  2LMC B;  4S3S A;  2RCN A;  1C9O A;  1MSH A;  2WAQ E;  2VW9 A;  1VDZ A;  2WB1 B;  4C1N K;  3MC0 B;  3CW2 C;  3MAQ A;  4LF6 L;  1JIC A;  1NJI C;  1HNW Q;  1O7I A;  1K0R A;  4ODG A;  1N32 Q;  2A68 C;  1E24 A;  4IFD I;  2QEX A;  1I50 B;  3HOU B;  3NWS A;  2Z4H A;  1X65 A;  4IUV A;  3T1H L;  2A73 B;  1G8Z D;  1SNQ A;  3TZD A;  2VQF Q;  5JVG 3;  1YEZ A;  3PMF A;  5IGB A;  4BA1 I;  1RIP A;  1XNQ L;  3TEH B;  3E9H A;  1IL2 A;  2JXM B;  2SNS A;  3ITP A;  3CCJ A;  1Z9F A;  1NCV A;  1CM9 A;  2FMC A;  3P7J A;  2X6L A;  2YU9 B;  1VQE A;  1Q8I A;  1VQM A;  3DEO A;  1SEB D;  4UP8 A;  1EY6 A;  1CUK A;  4OEL B;  3D4D A;  4HIO A;  1B50 A;  1KL9 A;  4BBS G;  1HQM C;  4BBR H;  1HNZ Q;  2IY5 B;  1BCP F;  3KLS A;  3I4O A;  1EY8 A;  1YNJ D;  4N9P A;  4KY7 A;  4C3H H;  5IGE A;  5JJK A;  2HT1 A;  4KTA A;  2HDM A;  2RF4 A;  4RAU C;  2BE5 C;  3PUZ A;  4EQO A;  4GKK L;  3I4N H;  3HOZ B;  3GTL B;  1LTL A;  2UUC L;  2F0N A;  3LX0 A;  3G4S A;  1HXY D;  5EGT A;  2CFM A;  5IYC G;  1JCK B;  2ZTC A;  1R4P B;  2DNC A;  4KK7 A;  1EY0 A;  2IHF A;  4IUR A;  3GTP B;  3SGI A;  1KDA A;  5E4X A;  1HTL D;  2Q2T A;  2BH2 A;  2R92 G;  4JI1 Q;  3TDQ A;  1A2U A;  2Y0S G;  2K14 A;  1XMQ L;  1TWF B;  3H94 A;  4LW1 A;  3K57 A;  1SJE D;  3HRZ C;  2KEE A;  4JOI A;  3ULP A;  3NWT A;  4PMC A;  1JWS D;  1TWC H;  1I94 Q;  3E3X A;  1O78 A;  3SHL A;  1HZC A;  1PFM A;  2HUG A;  2KCM A;  3NUC A;  1DXM A;  1BVS A;  1OXT A;  4BS9 A;  3GTM B;  1V1P A;  3TBI B;  4A3D H;  2G9D A;  1BBX C;  3MXP A;  1CSP A;  5JJI A;  1G2S A;  3SEB A;  2WAQ B;  1KRS A;  4JPB W;  2IHE A;  4A3F G;  4DKA C;  3RLO A;  1HNX L;  1GO3 E;  1TII D;  1SN8 A;  2JA6 H;  1BO0 A;  1J9O A;  5I6Y A;  3CPF A;  3S1N H;  1B70 B;  4GLV B;  2D5D A;  5CV6 A;  5J22 A;  1VQ7 A;  5M5X H;  5J3B A;  5EQ0 A;  4JV5 L;  1M1K C;  4KD3 A;  4AYB E;  1V1P B;  5IOC A;  4BXX G;  3F2U A;  1I3Q H;  2F0T A;  3A5Z B;  4OO1 H;  1NY4 A;  3PUY A;  1FNW A;  4ALP A;  1X3Q A;  3PIO 3;  4GKJ L;  5EKI A;  1V9P A;  3N6R A;  4Z9C B;  2FHT A;  3J81 L;  1SMY C;  2A69 D;  3HG9 A;  1J6Q A;  2B3G A;  4AQY L;  3B6Y A;  3P75 A;  2K5Q A;  2Q2U A;  2XN9 C;  4B3R Q;  1JB7 A;  2HHH L;  5JOB A;  4I65 A;  3DXJ C;  5JEA H;  4BY1 B;  1H9S A;  1IW7 C;  2JQO A;  5L37 A;  3K5N A;  2B2T C;  4DV3 L;  4JI0 Q;  4KHP L;  1IBK L;  3TS0 A;  5M3F G;  3SVM A;  1RCV D;  2F0D A;  1FJG L;  2QCP X;  2K5W A;  4DV7 L;  3FRP B;  2AQ1 B;  3WOE A;  4KI0 A;  5FLX c;  5C3E H;  3KF6 B;  1IBM Q;  2YYZ A;  3RN2 A;  1C7Y A;  2XRQ D;  4HCE A;  5IYD H;  1TS3 A;  1A0I A;  2E76 C;  1E1T A;  1D5M C;  1GUS A;  3NBH A;  4L5S A;  2BH8 A;  1XXG A;  2PPB C;  4XT1 B;  1QJO A;  2D2C C;  3UI2 A;  5ELF A;  4IN3 A;  2BOS A;  1XMO L;  3HOV G;  1F9Q A;  5COR A;  3X3N A;  5C0X I;  2K05 A;  4IFD G;  2GVB A;  4IJL A;  4KV6 A;  2K03 A;  3OOC A;  4KJO A;  4IPD A;  1C48 A;  2ZJQ A;  4YCU A;  3MXU A;  1N36 L;  5IT9 L;  4X64 Q;  2KVM A;  5J1Z A;  4QQB X;  2EY2 A;  4JW0 A;  3DWA A;  2EXD A;  3NBH B;  1SNO A;  1MIU A;  4WOR A;  2XWJ B;  1SRO A;  4LMQ D;  1CKN B;  2EYL A;  1A8V A;  1EQR A;  1CFM A;  4DNR B;  2E5L L;  3JAM L;  4AYB B;  2UU9 L;  1K3R A;  4P74 A;  2UUB L;  2AQ3 B;  3Q24 A;  1BXT A;  4BBR B;  4MIU A;  4V0B A;  1A2T A;  2CWP A;  1YIJ A;  2EE1 A;  3S15 H;  4PZ7 A;  2M9V A;  4C3H B;  1MJE A;  4NXM Q;  2DJF C;  1YVC A;  4HIK A;  1NSN S;  1ASY A;  1G51 A;  4LF4 Q;  1X3G A;  2F0E A;  4RGM A;  1KDB A;  1SSO A;  4NB3 A;  3I4N B;  4K0K Q;  3PF5 A;  2M2L A;  2JA8 G;  3A7A B;  2UUA L;  4A3L G;  1EEF D;  1LTI D;  3FKI H;  3OPO A;  1EZ8 A;  4ME5 A;  3ERO A;  1D5X C;  1RTN A;  1O7Y A;  1WTV A;  4HSV A;  2ALY B;  3OSO A;  4N8X 1;  3ZJY C;  1EIY B;  5GRO A;  4YHH Q;  5CV9 A;  1DYQ A;  4IPC A;  5LMN L;  3J80 L;  3G48 A;  1TWC B;  3GV3 A;  2DY7 A;  4L5Q A;  1PTO D;  4IJH A;  1DON A;  5I6W A;  3CQZ H;  3VDY A;  2VUM G;  4X65 Q;  4DNI A;  3M4O H;  3KUP A;  3H6M A;  1L0X B;  1B53 A;  4A3D B;  4P71 A;  1WTH A;  1V1Q A;  1CT1 D;  1X56 A;  3BU2 A;  1MGS A;  3QOJ A;  3I72 A;  1DM0 B;  2VY3 A;  4CDE C;  3NEM A;  1S5F D;  5C4X H;  3ULJ A;  2JA6 B;  2MO1 A;  4R4O A;  1BOS A;  1VF5 C;  4A3C H;  3S1N B;  4X66 L;  3M9B A;  2J0T D;  1K73 C;  1KQS A;  1LT6 D;  3H0G B;  3PUW A;  1TXY A;  2Q2H A;  1KLG D;  2N88 A;  5FJ8 G;  3BJU A;  2IW3 A;  1EY9 A;  4POG A;  1GM5 A;  1I3Q B;  2Z6K A;  5ELB A;  4X62 Q;  3NPP A;  1A3T A;  3QJY A;  1J5E Q;  3R2I A;  2AWO A;  3VR3 A;  1EIH A;  3FHW A;  4MN3 A;  1PV4 A;  1D6E C;  1H9M A;  3PO3 H;  2F0H A;  3CF5 A;  3I73 A;  4A3I H;  2HQL A;  2HIV A;  4DUZ L;  1Z6H A;  3DWQ A;  3R2T A;  5BN5 A;  3X3M A;  1YNX A;  2QEJ C;  3DEP A;  1SNP A;  2OTJ A;  4JVZ A;  4DR1 Q;  1A6X A;  1EYA A;  2QF7 A;  4A3K G;  4F88 A;  1EFI D;  1FNV A;  1KC8 C;  1VQ4 A;  1IHZ A;  5DAU A;  4XT3 B;  4OWX B;  5EPL A;  2IX1 A;  3CCR A;  3NBI A;  3BZK A;  4QL5 A;  4LF9 L;  3BVG A;  1NE3 A;  1SYG A;  1JWU D;  1SAP A;  5JJZ A;  2I07 B;  3V05 A;  4TVA B;  1MI2 A;  1D5Z C;  1VCI A;  1PRT D;  1LAB A;  1LUZ A;  4L8J A;  4A93 G;  1D7Q A;  1JJC B;  5GAD C;  1LLR D;  3RZD H;  1JOO A;  5C3E B;  2A74 C;  3S1M H;  3MHB A;  4JI7 Q;  5IYB H;  1T5X D;  2NN6 G;  2YTV A;  1BDO A;  1Y1W H;  3HOW H;  3SK8 A;  3A54 A;  4GZY C;  4DK1 A;  3K7A H;  1UEA B;  1HR0 W;  3K0Y A;  1JE5 A;  2UUC Q;  4YY3 L;  1DD2 A;  1M90 C;  1PH4 A;  5FLM H;  1QWY A;  1H9R A;  5C0X G;  1N34 L;  4BA2 I;  3HFZ B;  3TSS A;  1PH6 A;  2F03 A;  3OHX C;  4M1U B;  3T1Y Q;  3BYT B;  2F0M A;  1YJ9 A;  1UAP A;  2EOT A;  2NTS A;  2C35 B;  2EYO A;  1I50 H;  1VQF A;  2D9U A;  1XMQ Q;  1IKM A;  3HOU H;  4FXG C;  1D2B A;  4HCS A;  2Z6B A;  1TS4 A;  3QG1 A;  5CR3 A;  1PZJ D;  5ELE A;  3CU7 A;  1RD9 D;  3AFQ A;  5M9O A;  5C44 H;  2CQO A;  3S15 B;  1K28 A;  5FOB B;  1TU2 B;  3NSW A;  5D3D A;  1VQJ A;  1UE7 A;  4DR3 L;  3H3V C;  3HOY G;  4DR2 L;  4DN4 M;  5KNC A;  3I2Z A;  2KOL A;  5HGQ A;  1U4L A;  4ABN A;  2JK8 A;  1VQP A;  2PI2 E;  3GDE A;  2YTY A;  4DAY A;  1PHJ A;  5IP7 H;  5IT9 E;  3KF8 A;  2E74 C;  2EJM A;  4NKL A;  3I4M G;  3U4V A;  3D4W A;  3FKI B;  2NVQ H;  4LF5 Q;  4YCV A;  3HOZ H;  5C4J B;  1L0W A;  4JI3 Q;  4JV5 Q;  3DM1 A;  1HHV A;  4FF2 A;  3JAM E;  1A63 A;  3IRB A;  1F9S A;  3R8B A;  1XTD A;  1U4P A;  1L0Y B;  1EUJ A;  1EYC A; 
#chains in the Genus database with same CATH homology
 1WCM H;  2A19 A;  1X65 A;  3T1H L;  2NVX H;  5GQO A;  4Y7N H;  3KDF B;  2VQF Q;  3HKZ G;  1PA6 A;  4A75 A;  1SFO H;  2RHQ B;  4JOI C;  1YEZ A;  5M5Y H;  1XNQ L;  4BA1 I;  1RIP A;  3TEH B;  1PYS B;  4GKJ Q;  3E9H A;  5FJ8 H;  3S1R H;  1IYJ B;  1HZA A;  4GLA C;  2E2J H;  1IL2 A;  3CCJ A;  1Z9F A;  4DAY B;  4L5T A;  5IYD G;  1WYD A;  3H3V H;  3F8T A;  4LF6 Q;  3UE0 A;  1C0A A;  1JMC A;  4IPG A;  1G6P A;  1B7Y B;  1VQE A;  3EBE A;  4P72 A;  1UWV A;  2VL6 A;  3K81 C;  3M85 A;  3I7F A;  4GLX A;  2N3S A;  3GTJ H;  1VQM A;  1K8A C;  4UP8 A;  3G71 A;  4C3J H;  1CUK A;  1E7Z A;  4KHZ A;  3UDX A;  4HIO A;  1KL9 A;  3MEF A;  1Q82 C;  4LF7 L;  1XPU A;  1I5F A;  3I4N G;  4BBS G;  4BBR H;  1HNZ Q;  2R93 G;  3NEN A;  3T1H Q;  2IY5 B;  3J80 i;  4QJF A;  3I4O A;  3WWV A;  1L1O A;  1VQ6 A;  1Q1B A;  1XNQ Q;  4C3H H;  2JA7 G;  4B3S L;  5JJK A;  1AH9 A;  2HT1 A;  4JI1 L;  3TQY A;  4IFD J;  1GKH A;  3LGJ A;  4HID A;  2RF4 A;  1PH5 A;  2ZJR A;  3PUZ A;  2IX0 A;  1S40 A;  4GKK L;  1CKN A;  1Q12 A;  2N8N A;  2JA5 G;  3I4N H;  4BBS H;  2R93 H;  3S2H H;  1EYG A;  1LTL A;  1IBL L;  2UUC L;  2ASB A;  3G4S A;  2RHS B;  2AHO B;  2CFM A;  5IYC G;  2NVY H;  4LF7 Q;  2ZTC A;  4R1J A;  2JA7 H;  4DAM A;  4DV0 L;  2IHF A;  1X54 A;  2PI2 A;  2Z0S A;  3SGI A;  2Q2T A;  2BH2 A;  2H5X A;  2R92 G;  4JI1 Q;  3L2P A;  4YCW A;  1ASZ A;  4OWW B;  2Y0S G;  2ZM6 L;  4GKK Q;  2K14 A;  3U4Z A;  1XMQ L;  3CCV A;  3CXC A;  2K50 A;  1Q81 C;  3CAM A;  4LWC A;  4IPH A;  4LW1 A;  4A3D G;  4UP7 A;  5DLQ E;  3ULP A;  4JOI A;  1XMO Q;  2L15 A;  1IBL Q;  4DV4 L;  3RR5 A;  1TWC H;  1I94 Q;  3PV0 A;  1KD1 C;  2WFW A;  2YV5 A;  1HZC A;  1X55 A;  4HIM A;  2E2H H;  4JG2 A;  4OXP A;  2KCM A;  4NPS A;  3W1G A;  1VQC A;  4GOP B;  1XPO A;  4DV0 Q;  2R92 H;  2AMC B;  4MNO A;  3CC7 A;  1BVS A;  1OXT A;  4OWT B;  1N8R C;  2JA6 G;  2Q2I A;  4A3D H;  4XTC S;  2JJQ A;  4O2D A;  2XGT A;  1CSP A;  5C0X J;  3E9I A;  5JJI A;  1U0L A;  1X3E A;  3H0G G;  1KRS A;  2IHE A;  3GTQ H;  2VS1 A;  3CP0 A;  1E3P A;  1N9W A;  4A3F G;  1PH1 A;  4DKA C;  2CCZ A;  5ELN A;  1CKO A;  4A3E H;  4DV4 Q;  3RLO A;  1HNX L;  1GO3 E;  1YHB A;  1E1O A;  1SN8 A;  2ID0 A;  2JA6 H;  2K5N A;  2R7Z G;  3CPF A;  4P73 A;  3H15 A;  1KHI A;  1B70 B;  4GLV B;  3S1N H;  3S2D H;  3UE1 A;  4A3G G;  4JYA Q;  4LFB L;  5IT9 c;  4OX9 Q;  1WOC A;  1VQ7 A;  5M5X H;  5J3B A;  4JV5 L;  4LUO A;  3GD7 A;  4AYB E;  1M1K C;  3PO2 H;  3HKZ E;  4B3R L;  4QIW E;  4IO9 A;  3AEV A;  2MO0 A;  4X6A H;  3UDF A;  2EIF A;  1I3Q H;  1YZ6 A;  2JE6 I;  4BXX G;  1AE3 A;  2A1A A;  3JAM c;  4WJ3 M;  2N78 A;  1YHA A;  5IWA Q;  3A5Z B;  3K8A A;  1W2B A;  1NY4 A;  1HNX Q;  3PUY A;  1Q46 A;  2I5L X;  2VQF L;  4ALP A;  1X3F A;  3OTO L;  1PH7 A;  4JI0 L;  3PCO B;  5IP9 G;  2KCT A;  4GKJ L;  1PYB A;  1V9P A;  4GN3 B;  4OON A;  4LFB Q;  5C4X G;  1J6Q A;  4BXX H;  2B3G A;  4A3J G;  2A8V A;  4AQY L;  3B6Y A;  4A3C G;  2Q2U A;  3CCM A;  4JBK A;  4L5R C;  4B3R Q;  1K8G A;  1JB7 A;  2HHH L;  1EOV A;  3S14 H;  4DR6 L;  4P75 A;  1NTG A;  2KBN A;  3RZO H;  1IBM L;  2KHI A;  1JJG A;  3GO5 A;  3S1Q H;  3OYY A;  4PMW A;  3I4M H;  2F3I A;  4DV1 L;  2JQO A;  4TQU S;  5K36 G;  4GN4 B;  1X9N A;  1VQ9 A;  3OTO Q;  4DV3 L;  5C3E G;  4B3M Q;  1IBK L;  4JI0 Q;  4KHP L;  4JC0 A;  4MZ9 A;  2JEA I;  1IZ6 A;  3TS0 A;  1G29 1;  5M3F G;  2F52 A;  2K5H A;  1HH2 P;  1FJG L;  1I6H H;  3HKS A;  3KF8 B;  4DV7 L;  2KEN A;  1PVO A;  1OXU A;  2MNA A;  3L7Z C;  5GAH C;  4AQY Q;  3CC2 A;  4GNX A;  1HR0 Q;  2HHH Q;  4DR6 Q;  1FL0 A;  3DM3 A;  4BY7 G;  4KI0 A;  3PGZ A;  3PUV A;  4LUZ A;  3J80 c;  4DR7 L;  5FLX c;  5C3E H;  3KF6 B;  1OXS C;  1IBM Q;  4LF8 L;  2ZJP A;  2YYZ A;  3RN2 A;  1PH2 A;  1YJW A;  1C7Y A;  3PF4 A;  5M3F H;  4DV1 Q;  2JA9 A;  1TWH H;  1QVG A;  5IYD H;  3NEL A;  1A0I A;  1PFS A;  1E1T A;  4DV3 Q;  2I5H A;  4KHP Q;  1IBK Q;  1VQI A;  1QZH A;  1H95 A;  2OTL A;  4X66 Q;  4X64 L;  1S72 A;  4L5S A;  2BH8 A;  1TWA H;  3F1Z A;  4JI2 L;  1FJG Q;  4BY7 H;  4EX5 A;  4DV7 Q;  1PH8 A;  4JI5 L;  2UXB L;  3J7A 5;  2K52 A;  1XMO L;  3HOV G;  3OW2 A;  2ATW A;  1VQG A;  4AIM A;  3M4Q A;  1NMG A;  2PNH A;  4R4Q A;  4NXN L;  3CME A;  1I94 L;  5C0X I;  3RNU A;  4YWK A;  4DR7 Q;  4GNX B;  4LF8 Q;  2E8G A;  1L2F A;  2GVB A;  4IFD G;  4O0A A;  1IXR A;  4IJL A;  2KHJ A;  1KXL A;  3K80 C;  4IPD A;  1WFQ A;  4B3T L;  1NMF A;  4R4C A;  2ZJQ A;  4YCU A;  5E7N A;  5IE8 A;  5HY6 A;  3I55 A;  2VQE L;  2JA5 H;  3HOX G;  2I0Q A;  2R6G A;  4HJ5 A;  4NXM L;  1N36 L;  3Q8D A;  4X64 Q;  3J81 i;  4QQB X;  1L1O B;  4WJ4 A;  4LF4 L;  4JI2 Q;  1XPR A;  1Y1W G;  5IYC H;  4JI5 Q;  3HOW G;  2EXD A;  3NBH B;  3S16 H;  3GTG H;  1MIU A;  2UXB Q;  4Y52 H;  5M5W H;  4A3M G;  1SRO A;  4K0K L;  1CKN B;  1A8V A;  1EQR A;  4R4T A;  2E5L L;  1SMX A;  1Q1E A;  4NXN Q;  1TWG H;  5GAG C;  2D0P A;  4QY7 A;  4MTN A;  4HJ7 A;  2UU9 L;  5AJ3 L;  1K3R A;  3D0F A;  4P74 A;  2UUB L;  3HOX H;  3U58 A;  1DGS A;  3CC4 A;  1K83 H;  3A74 A;  1PH9 A;  4JYA L;  3TRZ A;  2CWP A;  1YIJ A;  4B3T Q;  4OX9 L;  2K5V A;  3S15 H;  4PZ7 A;  3W1B A;  4DK6 C;  2VQE Q;  4PG3 A;  4JI8 L;  1MJE A;  2WB1 G;  3FKI G;  3KJO A;  1YVC A;  4HIK A;  1N36 Q;  4LF9 Q;  4NXM Q;  3CD6 A;  2PQA A;  1ASY A;  1G51 A;  2F4V L;  4LF4 Q;  2R7F A;  1X3G A;  1EQQ A;  4JBW A;  4HJ8 A;  4NB3 A;  4YHH L;  5IWA L;  1SE8 A;  1D8L A;  3PF5 A;  4K0K Q;  2WP8 J;  2UXD L;  4YWL A;  1YJN A;  4XIG S;  4BY1 G;  2E5L Q;  2JA8 G;  3HOU G;  3S17 H;  1CSQ A;  2UUA L;  2UU9 Q;  5AJ3 Q;  1FGU A;  3RLF A;  2UUB Q;  2LSS A;  4A3L G;  3FKI H;  5M3M G;  2Z6K C;  3H0G H;  2QGQ A;  4POF A;  4X65 L;  3AYH B;  2QA4 A;  1YIT A;  3DLL A;  3CCE A;  4JI8 Q;  4A3F H;  3H3V I;  2CWA A;  2VZA A;  3J7Z C;  2ALY B;  2DUD A;  3ZJY C;  3M3Y H;  2F4V Q;  2R7Z H;  1EIY B;  5GRO A;  2AKW B;  4FDB A;  2PQA B;  4YHH Q;  2B29 A;  4LFA L;  4A3G H;  4IPC A;  5LMN L;  2UXD Q;  3CCU A;  2LXJ A;  3G48 A;  4GN5 A;  3M4P A;  4DUY L;  1JT8 A;  4GS3 A;  2UUA Q;  4B3M L;  4L5Q A;  4IJH A;  2ZTE A;  1CKM A;  3A5U A;  3A0J A;  1SRU A;  1VQK A;  2VUM G;  3CQZ H;  4LUV A;  3VDY A;  2YU9 H;  5IY0 A;  3K0X A;  4X65 Q;  4DNI A;  1BBU A;  5IP7 G;  3M4O H;  5JEA J;  3E0E A;  1UE6 A;  4P71 A;  1V1Q A;  1X56 A;  4J15 A;  1HR0 L;  1U5K A;  1E22 A;  3BU2 A;  3TRE A;  4YWM A;  4QGU A;  2K75 A;  3HOZ G;  3EN2 A;  3KDF A;  5IP9 H;  4X62 L;  2VY3 A;  4LFA Q;  5LMN Q;  3NEM A;  5C4X H;  1Y1V G;  4DUY Q;  3ULJ A;  2MO1 A;  1VQB A;  4R4O A;  1P8L A;  4DR5 L;  2DGY A;  3PIP A;  4IOC A;  4GOP C;  4A3J H;  1WCM G;  3G6E A;  4KLK A;  4A3C H;  3GTO H;  4X66 L;  3M9B A;  2LXK A;  1K73 C;  1KQS A;  2FXQ A;  3PUW A;  3CCL A;  1TXY A;  3GTL H;  2Q2H A;  1S3O A;  5FJ8 G;  3BJU A;  1VQL A;  3PO3 G;  3GTK H;  4A3I G;  1YBY A;  1X6O A;  2NZO A;  4HJ9 A;  1PH3 A;  4POG A;  4PZ8 A;  3I56 A;  1AE2 A;  4DR1 L;  1Y1V H;  1EIF A;  4RMF A;  1EWI A;  1GM5 A;  2Z6K A;  4X62 Q;  2Y0S E;  2NN6 I;  1J5E Q;  4AYB G;  3GTP H;  4LFC L;  2AWO A;  1HZB A;  3FHW A;  1HJP A;  2OQK A;  5EAY A;  3U50 C;  3UDI A;  3F2D A;  1PV4 A;  4DR5 Q;  3CCQ A;  4JI6 L;  4BBR G;  2V1C C;  2VUM H;  3M7N A;  5BR8 L;  3PO3 H;  3CF5 A;  3KFU A;  4A3I H;  3ULL A;  3D31 A;  3AFP A;  3J81 j;  1Z47 A;  1TWF H;  1QUQ A;  1WJJ A;  2K4K A;  3CMA A;  2HQL A;  2HIV A;  1NBW A;  3RLN A;  4DUZ L;  3K7U C;  2NZH A;  1YNX A;  2GN5 A;  1RL2 A;  2ZTD A;  1JJ2 A;  2WAQ G;  2OTJ A;  1KRT A;  3STB C;  5LMU Q;  4HJA A;  4DR1 Q;  4A3K G;  4UY8 C;  2WB1 E;  1K9M C;  3EIV A;  3STB D;  1KC8 C;  3JC6 6;  3KJP A;  3F2B A;  1Y14 B;  2GVA A;  3GTM H;  3PSI A;  1VQ4 A;  3KYH C;  4APV A;  2OWO A;  4JI7 L;  4LFC Q;  4ME3 A;  1VQ5 A;  1Q8K A;  2UXC L;  3CCS A;  3J81 c;  1BBW A;  1SLJ A;  1UEB A;  2YTX A;  4OWX B;  3CPW A;  4JI6 Q;  3CCR A;  2IX1 A;  5ELO A;  1OXV A;  1Q7Y C;  2R7D A;  1A62 A;  3BZK A;  4QL5 A;  5BR8 Q;  4LF9 L;  1MJC A;  1NE3 A;  4EQ5 A;  3HOV H;  5IYB G;  3F2C A;  4JI4 L;  2IT1 A;  4TVA B;  4A3K H;  1UE1 A;  3BZC A;  4DUZ Q;  1XJV A;  1VCI A;  2HIX A;  1P16 A;  1LUZ A;  2I5M X;  1N33 L;  1QUQ B;  4A93 G;  1UE5 A;  4GOP A;  1D7Q A;  2BA1 A;  1JJC B;  2OQ0 A;  3UDG A;  4A76 A;  5GAD C;  4OO1 I;  3RZD H;  3ICE A;  5LMN W;  1T9H A;  1VQH A;  1VQN A;  3S1M H;  2D0O A;  4JI7 Q;  4DK3 C;  5IYB H;  5JJL A;  4DR4 L;  1YI2 A;  5FLM G;  2NN6 G;  2YTV A;  3T1Y L;  1GVP A;  2UXC Q;  1Y1W H;  3HOW H;  1KIX A;  4B3S Q;  1MKH A;  1GD7 A;  4A3M H;  1VQA A;  1Q86 C;  4A93 H;  3K7A H;  1VQ8 A;  4DV6 L;  2ES2 A;  4JI4 Q;  1LYL A;  1VS0 A;  3KLW A;  1HR0 W;  1JE5 A;  2MQH A;  2UUC Q;  4YY3 L;  2JEB I;  1N33 Q;  1WI5 A;  1M90 C;  1W3S A;  2D62 A;  1R9T H;  1PH4 A;  5FLM H;  1XNR L;  2OCE A;  3AQQ A;  3PIO A;  4A3E G;  1OTC A;  2B63 G;  2PMZ E;  5C0X G;  4DV5 L;  1N34 L;  4PZ6 A;  5GAE C;  4BA2 I;  3HFZ B;  5C4J H;  1PH6 A;  3T1Y Q;  4DR4 Q;  4JBM A;  1YJ9 A;  3TS2 A;  4DV2 L;  2NVT H;  1HZ9 A;  2AWN A;  5C44 G;  2C35 B;  2ZM6 Q;  4LNQ A;  4R4I A;  1I50 H;  1VQF A;  1XMQ Q;  4BY1 H;  3FP9 A;  4DV6 Q;  5H1S E;  2JA8 H;  3HOU H;  3KOJ A;  4AH6 A;  2N49 A;  3MXN B;  3PO2 G;  1VQD A;  4C2M H;  4A3L H;  1B8A A;  4JBJ A;  3RN5 A;  4YY3 Q;  2B63 H;  4A3B G;  1OXX K;  5M3M H;  1XNR Q;  4GNX C;  4IOA A;  1QVC A;  3AFQ A;  4OO1 G;  5C44 H;  4A4I A;  4C3I H;  4DV5 Q;  1N34 Q;  3S24 A;  4LF5 L;  2CQO A;  3L0O A;  4JI3 L;  3PUX A;  1HNW L;  4DV2 Q;  1QZG A;  4A3B H;  1N32 L;  2VNU D;  1L1O C;  1VQJ A;  1UE7 A;  2MFI A;  4DR3 L;  3W5O A;  3HOY G;  4DR2 L;  1SR3 A;  4DPG A;  3I2Z A;  5HGQ A;  1YHQ A;  4UPA A;  2XTI A;  1J5E L;  3JAM i;  3ER0 A;  1QVF A;  2JK8 A;  3ERS X;  1EFW A;  1VQP A;  2PI2 E;  3GDE A;  2YTY A;  5JEA G;  2EQS A;  2RCN A;  1C9O A;  5IP7 H;  1PHJ A;  1VQO A;  2WAQ E;  3I4M G;  3U4V A;  2VW9 A;  4RG1 A;  2NVQ H;  2BA0 A;  4H02 A;  4LF5 Q;  4YCV A;  3CW2 C;  4LF6 L;  3HOZ H;  4JCV E;  1L0W A;  4JI3 Q;  1NJI C;  3HOY H;  1BKB A;  1O7I A;  4JV5 Q;  1K0R A;  1FVI A;  1HNW Q;  3KF6 A;  1N32 Q;  2CKZ B;  1V43 A;  1E24 A;  2E2I H;  1A63 A;  3IRB A;  4IFD I;  4UP9 A;  4DR3 Q;  5LMU L;  1LM0 A;  2QEX A;  1KAW A;  1XTD A;  4DR2 Q;  1HNZ L;  1EUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...