4X65L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65L00
2QA4A 1PH8A 4JI3Q 1L2FA 1X55A 4JCVE 4YCUA 3AEVA 4LF8Q 4HJ5A 4OXPA 1IBKL 2UU9Q 3HOYG 1IXRA 4RG1A 4JV5L 3KOJA 4GNXA 1QUQB 5ELOA 5GROA 4DR2Q 1EWIA 1WOCA 1JE5A 3AFQA 3M4OH 4NXML 2HT1A 1VQDA 4NXNQ 3WWVA 1HR0W 1FVIA 2LXKA 4A3LG 2R7FA 4IPCA 2VNUD 1K73C 1HZ9A 2KCMA 5DLQE 4XTCS 4HIDA 2CKZB 2UXDL 3M4QA 4JBKA 3HOVH 1C9OA 1VQKA 3CC2A 1OXUA 1VQJA 4IFDI 4YWLA 4C3HH 3NELA 4JI7L 4ME3A 4PZ8A 4DV7L 2K52A 2D0PA 1GD7A 2ZTCA 1I94L 3UE0A 5M3FH 2UXBL 1Z47A 3K80C 1BVSA 4A3IH 1E24A 2JA5H 1HNZL 3CCRA 2ZTDA 1FGUA 2A19A 4HJ8A 3CXCA 4A3FG 5EAYA 2IHEA 3I4MG 1X9NA 2R93G 3RR5A 3Q8DA 1VQFA 1V9PA 3STBC 1K9MC 1EOVA 3S14H 4JI4Q 5M5XH 1NJIC 1PVOA 1VQ5A 4B3TQ 3RNUA 3PGZA 2GVAA 2ID0A 1NMGA 5HY6A 2Q2HA 1HR0L 2VQEL 2AHOB 4AH6A 2NVXH 3FHWA 2I5MX 1HJPA 3UDIA 4X65Q 2VQFQ 1MJEA 2N3SA 1SRUA 4IPHA 3PUZA 1BBUA 2YV5A 4NXNL 2WAQG 3RN2A 4BBSH 1XPUA 3GTKH 4C3JH 3I4NH 3KYHC 1U5KA 2KHJA 4TVAB 4GLXA 1C0AA 4A93H 5J3BA 1N32L 1BBWA 1NMFA 3S1MH 1A0IA 4LFAL 1NY4A 1Y1VH 5C4JH 2MO0A 4LWCA 3RZDH 3BZCA 3GTMH 3HOWH 1VQ9A 1MJCA 4X66L 3G4SA 2IX1A 4DR7Q 3AYHB 4DV5Q 4DR1Q 5IWAQ 4DV0Q 1JB7A 4BXXH 1VCIA 1UE5A 2WB1G 4IJLA 4YWMA 3J80i 3G71A 1X3EA 5M5YH 1SE8A 5LMNW 1YHAA 4OO1G 3W5OA 2VY3A 2B63G 3ULLA 3OW2A 3KF6B 1S72A 4DR4L 2VQEQ 2UUBL 1OXTA 4DV3L 4HIMA 1EQRA 3NEMA 2HQLA 4DR3L 2UUCL 3HFZB 4JI3L 4EX5A 1PH6A 1D7QA 3SGIA 4O2DA 4JI4L 1XPOA 1X3FA 1Y14B 4JI6Q 3G6EA 1W3SA 2ZJQA 3H3VH 4IFDG 1SN8A 3CCUA 2JEBI 2PNHA 5GADC 4HIOA 4A3JG 4LF9Q 3BJUA 2I5HA 1XPRA 4BY7H 1PH4A 4DV6L 2BA0A 3AQQA 2HIVA 3PF4A 4K0KL 2VL6A 3FKIG 3K8AA 5C0XJ 1MKHA 4DAYB 3RZOH 2B29A 4DR6Q 3HOUH 1UE7A 2EQSA 4EQ5A 4YHHQ 5C4XH 4LUOA 1S3OA 3PUWA 4GN3B 4TQUS 4P75A 4R4QA 4BY7G 1CKNB 2NVYH 2V1CC 1UWVA 4LUZA 1Y1WH 2XTIA 3PO2G 4DK3C 1QZHA 1K0RA 4DKAC 2RHQB 1Q81C 3CMEA 2D0OA 4DV3Q 1Y1WG 3PO2H 5IY0A 2E8GA 3NBHB 1V1QA 2YTYA 4NXMQ 1AH9A 4RMFA 3UDGA 4DR4Q 4GOPA 2ZTEA 2PMZE 2K5NA 1PH2A 1CSQA 2YTXA 2R7DA 4A3KH 4KLKA 1IBKQ 2KHIA 2UU9L 1XMOQ 4DV0L 1VQCA 3VDYA 4DR1L 4GOPB 1WCMG 4A3IG 3KDFA 2F52A 2Z6KA 5IYCG 1FJGL 1WI5A 4QIWE 2RF4A 2JEAI 4IFDJ 3KLWA 4AQYL 2EXDA 4PZ6A 1EYGA 1N33L 1VQ4A 4DV1Q 1AE2A 1YVCA 2R92G 1YEZA 4QL5A 3STBD 3I4MH 4B3RL 1AE3A 4P73A 3I2ZA 5GAGC 2JA8G 3CW2C 1GVPA 5FJ8G 5C3EG 4A3GH 1KXLA 3T1YQ 2A1AA 4DUZL 1VQLA 3GTOH 2FXQA 4OONA 1HZAA 2E5LL 3HOUG 2KCTA 3UDXA 4K0KQ 4KHZA 1W2BA 3FKIH 4LF7L 2K14A 4A3EG 3KF8B 4UY8C 1VS0A 1V43A 3CCMA 3KFUA 1EUJA 1VQHA 4HIKA 1MIUA 3CF5A 1N36Q 1KIXA 4KI0A 3HKZE 2XGTA 2HHHL 1X3GA 2YTVA 2Z0SA 4GKJQ 4YY3Q 1HNWQ 3CCEA 5LMNL 2KBNA 1S40A 3F2CA 3HOWG 4MNOA 4NB3A 3J7ZC 1TWCH 4UP8A 3UE1A 2QGQA 3T1HQ 4X62L 2JA9A 2Q2TA 4A3FH 4IJHA 1ASZA 2GN5A 1JMCA 1XNRQ 1A62A 4H02A 5LMUQ 3GO5A 1LM0A 1N8RC 3M85A 1PH7A 2NZOA 4JI1L 4X66Q 3CPWA 2OQ0A 4JI0Q 3KJPA 1HZCA 1KRSA 2JE6I 3PSIA 4LFAQ 1U0LA 3S1RH 2ZJPA 3CC7A 4LFBL 5AJ3L 2A8VA 1X54A 1VQAA 4IO9A 5FJ8H 2CWAA 1GM5A 3GDEA 3L0OA 3ULJA 4A75A 4P74A 1T9HA 1IBMQ 3OYYA 2VW9A 1VQNA 4BBSG 1BKBA 2R6GA 2NVTH 3TQYA 3D0FA 2BH8A 4X6AH 1I3QH 2VQFL 4X65L 1I5FA 3I4NG 1LUZA 4JI8Q 4GN5A 3CD6A 3J81j 1KRTA 1HH2P 1KQSA 2H5XA 3TREA 3CAMA 4LF8L 4QQBX 1E1OA 3H0GG 5M3MH 3PUVA 1HNXL 2ZM6L 1XTDA 1B8AA 2ASBA 5JJLA 3PUXA 4C3IH 1KL9A 1XMQQ 1KHIA 3TRZA 1OXVA 4YY3L 3H0GH 4L5TA 5M3MG 4A3EH 2UUAQ 4L5RC 3PO3G 1HNWL 1HNZQ 2NN6G 2Y0SE 3CQZH 1VQGA 1N9WA 3RLOA 3HKZG 1D8LA 5IE8A 4JI8L 5M3FG 4GKKQ 1WJJA 5BR8L 1C7YA 2JA8H 1YHBA 3BU2A 2VS1A 4OWTB 4LF6L 2HIXA 4JBJA 3PIOA 3CCJA 1EIFA 3S1QH 2UXDQ 3U4VA 1XNQQ 3CCLA 3CCQA 1HZBA 4GNXB 1H95A 1YJ9A 1YITA 1EQQA 1VQBA 4KHPL 3CPFA 1VQMA 1UE6A 2YYZA 1VQ8A 3TS0A 1Q82C 4LF4Q 4AIMA 3E9HA 2CWPA 4GNXC 1PYSB 1IBLL 4DR2L 3S16H 4A3LH 3EBEA 5IP9G 1Q86C 4NPSA 1K8GA 1PHJA 1WYDA 4C2MH 4JI5L 2F3IA 5HGQA 5IYBH 4A3GG 4BXXG 2I5LX 4OWWB 4JOIA 2K50A 2IHFA 2N8NA 4IOAA 2CFMA 4LFCL 1TXYA 3RLFA 4DAMA 2Q2UA 3HOZG 2PI2A 3S2HH 4UP7A 2OCEA 4O0AA 4BA1I 4DNIA 1M90C 1FL0A 2JK8A 3D31A 5LMNQ 2K75A 5C4XG 5C44G 4HJ9A 1XNQL 3L7ZC 2JJQA 1JJGA 4LF5Q 2D62A 1A8VA 5M5WH 3F2BA 2AWOA 5GAHC 4LF5L 5BR8Q 2UXCL 4POFA 1PH5A 4WJ3M 4JI2L 4HJ7A 4DUZQ 2E2JH 1CSPA 3J81i 4YCWA 4ALPA 2C35B 2BH2A 3A74A 1GO3E 2WP8J 5JEAJ 4GLVB 2MNAA 4LF9L 3GTGH 1M1KC 4AQYQ 2N49A 2R93H 1YNXA 1JJ2A 1SMXA 1N34L 1B70B 4B3SL 5IYCH 3DLLA 5IP7G 3U58A 1P8LA 4BY1G 4JYAL 1VQ7A 1I6HH 4A3CG 3TEHB 2LXJA 2IX0A 2B3GA 3CMAA 5C0XG 3GTLH 1CUKA 1KAWA 1QVCA 4DUYL 4Y7NH 3M3YH 3ULPA 1SROA 4LF4L 1Y1VG 4DPGA 3J7A5 1PV4A 4YWKA 5GQOA 4IPGA 1OXXK 4DV4Q 1VQPA 2AWNA 4B3ML 3CCSA 3H3VI 2NN6I 2ZJRA 3BZKA 4AYBG 1TWHH 3KF6A 3MXNB 2E2IH 3GTQH 4X64Q 4UPAA 4LFBQ 1RL2A 2CCZA 5IYDH 3A5ZB 4GLAC 4JG2A 1KD1C 2K5VA 1KC8C 3S17H 1L1OA 4JI1Q 1YJNA 1IBLQ 4DR6L 5FLMG 4DV2Q 4DR5Q 1PYBA 1Q46A 4GKKL 1EFWA 1K3RA 3HOYH 4A3DG 4A3KG 5C0XI 5LMUL 3GTJH 1CKMA 2UUAL 4P71A 3GTPH 4APVA 3PUYA 2QEXA 3HOXH 3M9BA 2R92H 1XMQL 1YJWA 1IYJB 2YU9H 3G48A 3T1HL 1SLJA 2PQAA 4MZ9A 1I50H 1YBYA 2VUMH 4A3BH 2UXCQ 1NTGA 1LTLA 2ZM6Q 4OX9Q 2JQOA 1HNXQ 2Y0SG 3E9IA 4B3TL 3ICEA 1E1TA 3PIPA 3HOZH 1QZGA 2LSSA 4AYBE 1N36L 3CC4A 1K83H 1TWFH 2Q2IA 4A76A 2F4VQ 2F4VL 2R7ZH 1CKNA 3W1BA 3F1ZA 4DK6C 1PH3A 3F8TA 4P72A 5IYBG 4LF7Q 2K5HA 5IP9H 5IWAL 1G6PA 4WJ4A 1JJCB 1LYLA 1X6OA 2MFIA 3RN5A 1E7ZA 1VQEA 3PCOB 2JA6H 2N78A 4DR7L 3T1YL 4LFCQ 4DV7Q 1J5EQ 4JI7Q 5GAEC 4QGUA 2OWOA 4QJFA 1Q7YC 3U4ZA 5IT9c 3CCVA 1PH9A 4B3RQ 2EIFA 1Q1BA 4OWXB 3TS2A 3JAMi 1X65A 4DV2L 4DR5L 2JA6G 3KDFB 1YI2A 4JI0L 5FLMH 2JA5G 1QVFA 1Q8KA 5E7NA 2AMCB 1XMOL 1OTCA 2VZAA 4X64L 4BA2I 1XNRL 2BA1A 2ATWA 3U50C 1Q12A 3J81c 1J5EL 4X62Q 1UE1A 4IPDA 2RHSB 4MTNA 4YCVA 1HR0Q 3M7NA 4DV4L 4JV5Q 2GVBA 3S15H 4LF6Q 1X56A 3K7AH 3J80c 1R9TH 4R4CA 2VUMG 1B7YB 1WCMH 1JT8A 4LUVA 4R4TA 4A4IA 2OQKA 3AFPA 2NZHA 4FDBA 3JC66 1SFOH 1CKOA 1E22A 2CQOA 3K0XA 2PI2E 3NENA 4L5QA 3IRBA 2WFWA 3LGJA 4JYAQ 4OO1I 1NE3A 3PO3H 1WFQA 1QVGA 4OX9L 3W1GA 5IP7H 3KJOA 1OXSC 1YZ6A 5H1SE 2RCNA 4XIGS 2AKWB 1I94Q 5IYDG 1VQ6A 4A3BG 5JJKA 4JC0A 4JOIC 1G291 3MEFA 3E0EA 3OTOL 3S24A 3B6YA 3K81C 1VQOA 2WB1E 4GKJL 2IY5B 2E2HH 4LNQA 1K8AC 4A93G 4IOCA 3A0JA 3K7UC 1A63A 3M4PA 1IZ6A 2K4KA 4JI2Q 4JI6L 2JA7H 3HKSA 4GS3A 3HOXG 4Y52H 1PFSA 4LW1A 1L0WA 3ZJYC 1J6QA 1PH1A 1FJGQ 3ERSX 2UUBQ 4GN4B 3S2DH 1TWGH 1IBML 1RIPA 2OTLA 4HJAA 1IL2A 4A3JH 2B63H 2DUDA 2MO1A 5FLXc 1ASYA 4B3MQ 5C44H 1YHQA 3I7FA 5AJ3Q 4POGA 4DV5L 3JAMc 1N33Q 5JEAG 1GKHA 1DGSA 4DUYQ 1Q1EA 2DGYA 4L5SA 4PMWA 3I55A 3DM3A 3CP0A 4A3MG 1VQIA 1Z9FA 1YIJA 1XJVA 3PF5A 2OTJA 1N32Q 4JI5Q 2KENA 4A3CH 4GOPC 1G51A 1O7IA 1L1OC 4A3MH 1N34Q 1EIYB 4B3SQ 2R7ZG 3PV0A 5K36G 4R4IA 3GD7A 1TWAH 3FP9A 3UDFA 4BBRH 4KHPQ 2Z6KC 2L15A 2HHHQ 3HOVG 4JBWA 1NBWA 4PZ7A 2JA7G 2ALYB 3I56A 3F2DA 2NVQH 1PA6A 1E3PA 3H15A 2I0QA 1P16A 3OTOQ 3ER0A 4PG3A 4BBRG 4DR3Q 1SR3A 4UP9A 3L2PA 2UUCQ 1L1OB 4YHHL 4A3DH 3RLNA 3EIVA 2E5LQ 4JBMA 4R1JA 4R4OA 2ES2A 5ELNA 3S1NH 4DV6Q 3I4OA 5C3EH 4J15A 4BY1H 5JJIA 2WAQE 2PQAB 2MQHA 1UEBA 4DV1L 2UXBQ 2IT1A 3A5UA 4QY7A 1QUQA 3EN2A
chains in the Genus database with same CATH superfamily
4JI3Q 2PZTA 3AEVA 4LF8Q 4V190 3ONAB 1IBKL 4AYBB 5ELOA 5GROA 1WOCA 1XTCD 3RMHA 1I4QA 2PZUA 3J81L 2KEDA 1GUGA 4A3LG 2FMMA 4QIWB 2VNUD 1K73C 2KCMA 2NVQB 3HOVH 5JPNC 1LTAD 5IGGA 4KKUA 1MHWC 3NELA 3K5OA 4I65A 5IGEA 4ME3A 3PIP3 1JOQA 4KKSA 5D14A 1EY5A 2UXBL 1E24A 1X32A 3CCRA 2ZTDA 4M8AA 1FGUA 2QW7A 3SHLA 1NJIC 2TSSA 2B2TA 2HDLA 1VQ5A 1NMGA 2JA7B 5HY6A 2Q2HA 4N8X1 2L11A 4FXKC 2F0VA 2NVXH 2AHOB 2BDOA 3UDIA 3NWSA 3SDZA 4X65Q 1MJEA 2N3SA 3G7LA 3I4LA 4IPHA 4RHRA 4X3UA 4NXNL 5C3EB 2JA5B 3TZUA 1XPUA 4C3JH 5L37A 2QDBA 1BBWA 3S1MH 5C4JH 4KKTA 1MJCA 3G4SA 4DR7Q 3KLRA 1JB3A 1JB7A 4BXXH 1SAPA 4IJLA 2F0HA 1SE8A 4EQOA 1D1KA 1DOLA 3X3MA 1S72A 2SOBA 1OXTA 1EQRA 4DR3L 4JI3L 3W3AA 4EX5A 1Y14B 4JI6Q 3G6EA 2ZJQA 5CV5A 3H3VH 4IFDG 4LF9Q 1MBYA 2M00A 1IW7C 5GADC 2FINB 1C8CA 3S2HH 4B08A 4DAYB 2B29A 1S3OA 3PUWA 1I4XA 4XT1B 4A3IB 5I6YA 2NVYH 2V1CC 4LUZA 5JVG3 2O2LD 5KNCA 1Y1WH 4DK3C 1QZHA 2RHQB 4TRDA 5CGKA 1AH9A 2BDNA 2E8GA 5IY0A 4DU9A 4RMFA 2NB0A 2K5NA 4A3KH 3K5MA 1WCMG 1FJGL 5IYCG 1BCPD 1PZKD 4IFDJ 3KLWA 1EYGA 3KLSA 4FF1A 3STBD 5FO8B 5I9OA 1KXLA 3I2ZA 4OL7A 4ILWA 5C3EG 1XX8A 3IFTA 3T1YQ 1LT3D 2FXQA 4OONA 1HZAA 4KHZA 1W2BA 3EA6A 2K14A 1AZQA 4DAVA 4H44C 5D3IB 3KF8B 1H9SB 3CCMA 4OEMB 1N36Q 2LS01 1JR0D 2HHHL 1X3GA 2Z0SA 4RCNA 4A3FB 5EJWA 1S40A 2EY6A 3T16A 3HOWG 4NB3A 3D4RA 3WDNA 1TWCH 1JORA 2JA9A 1DJRD 5EKIA 1QOHA 4K2KA 1A62A 5LMUQ 1PTOH 1LM0A 1TWHB 2K5WA 1O80A 4JI0Q 3KJPA 1ZXTA 1HZCA 2A8VA 4UDUC 4IO9A 1GM5A 2XIWA 5E4WC 3A55A 1B9NA 3GP7A 3GTKB 3H94A 1IBMQ 3OYYA 1MSGA 2O5IC 1X3QA 1BXTA 2D5DA 2F0QA 2FJ2A 2R6GA 4IN3A 1TU2B 2EDGA 2VQFL 1I5FA 1PTOF 2H5XA 2FMCA 1IHZA 4DNTB 1OO9B 1Q8IA 3LWEA 1HNXL 1XTDA 2A69D 2ASBA 4GZYC 5JJLA 1EY6A 1JE4A 1PDQA 3H0GH 2JP1A 3BYYB 5M3MG 2JA8B 4J6HA 1HNZQ 2NN6G 2Y0SE 3BVMA 4MIUA 3CQZH 5IGDA 1VMPA 5IE8A 4JI8L 5M3FG 4IUPA 1WJJA 2JXMB 1CFMA 3VR4A 2F0JA 2F0WA 2HIXA 2J7ZA 1BCPB 3PIOA 2EE1A 1YJ9A 1GUTA 3CPFA 4UHVA 1PTOB 2YYZA 1VQ8A 1PLFA 4LF4Q 1RCVD 4AIMA 3E9HA 1IBLL 3S16H 3D6CA 3GTPB 1K8GA 5LL6X 5I2YA 4C2MH 4JI5L 5IYBH 4CJ0B 4KTAA 1BCPC 5JPMC 2IHFA 4ZKBB 3NSWA 4CKCA 2CFMA 3RLFA 1TXYA 2IX3A 4B9WA 1RTOA 1PFBA 4BA1I 4IQZA 4DA2A 4DNIA 5LMNQ 2K75A 4LAAA 1STYA 4V0BA 1LTTD 2H1EA 5IOCA 2JJQA 1A8VA 5M5WH 4Y7NB 4NMZA 1A3UA 3J7AV 2UXCL 3NTIA 2GA4B 3I4MB 1D6EC 4HJ7A 4JI2L 4KY7A 1TS2A 3J81i 5EGTA 3IL8A 4RGTA 4C3HB 4GLVB 2MNAA 1JWMD 3U9OA 5EKLA 4O1NA 1WTPA 2N49A 2RDFA 1YNXA 4B3SL 1N34L 2CQAA 5IYCH 4CHTB 2F0NA 3J81E 1H9SA 1VQ7A 3CKIB 1C48A 1SJED 3MEHA 1KAWA 1LTRD 5FLXL 4Y7NH 4LF4L 1Y1VG 1CZGA 3A56A 1PV4A 1I50B 1EY0A 5GQOA 4IPGA 2EYPA 5IT9E 3ITPA 4K5VA 4G57A 1PTOD 2NN6I 4PV1C 5JVH3 4HAEA 2E2IH 3GTQH 4UPAA 3KUPA 3HOYB 2LKVA 4LFBQ 5IYDH 3A5ZB 4F87A 4JG2A 2K5VA 1L1OA 1YJNA 4DR6L 1D5ZC 4DR5Q 1K3RA 3SK8A 4P71A 3TP6A 1YNND 4APVA 5DM73 2QEXA 2WKDA 3G48A 1QCBD 4RGMA 1CM9A 1YBYA 2UXCQ 1EY8A 1NTGA 1LTLA 4OX9Q 1HNXQ 3HOXB 1XWEA 3HOZH 1DM0B 2PQEA 2LSSA 3Q6SA 3CC4A 4A76A 3GTQB 2F4VL 2E2IB 1Q90A 2EYJA 4DK6C 1PH3A 2XWBB 1TS5A 2K5HA 1HFGA 5IWAL 3DEOA 1G6PA 1M4VA 2R93B 2MFIA 4ZKCB 1QWYA 1VQEA 1GHJA 2CH4A 3PCOB 4E6IA 1J5EQ 4LK1C 4Z9CB 1PH9A 3CRLC 1Q1BA 4WJWA 1GXDC 2RA4A 4DR5L 3S17B 4KN7C 1CK1A 2Z6BA 2K33A 1PXUA 1SYCA 3I4NB 5JJZA 1BO0A 4KHVA 5E7NA 4HTHA 3J81c 1KAAA 2RKSA 4IPDA 5DAUA 1HR0Q 3I8ZA 3S15H 1HUMA 4LF6Q 1X56A 1R9TH 4R4CA 1WCMH 5JAVA 2K6AA 3A7LA 1JOKA 3PMFA 2NZHA 3JC66 5I4DA 1LV9A 5M3FB 1E22A 4L5QA 5EPKA 1STEA 2SNSA 1WFQA 1TIID 1OXSC 1YZ6A 3A8JE 5H1SE 1VQ6A 2MPMA 4A3BG 3OTOL 3K81C 1CZWA 1VQOA 2WB1E 1HFNA 2KCCA 4IOCA 3K7UC 1IZ6A 2K4KA 2KA7A 1FJGQ 1L0WA 3VYTA 2J0TD 1DOMA 3GV3A 1IW7D 1TWGH 1IBML 4RKLA 2F0OA 4HJAA 3TBIB 4OGQC 1STBA 1A3VA 3MVVA 1ASYA 1TWCB 1YHQA 1EL0A 5IGCA 2DNEA 1N33Q 4IUNA 5JEAG 1GKHA 4JW0A 4PMWA 2JA6B 3CP0A 4HCSA 3PF5A 1N32Q 2KENA 4GOPC 3X3NA 4C3JG 2PPBC 3PV0A 5K36G 1LTGD 4KHPQ 2B2TC 2HHHQ 3HOVG 2EY2A 1NBWA 1U4PA 3F2DA 2E74C 1GUNA 3AB9A 1PA6A 4RGOS 1E3PA 1P16A 3QJYA 4DR3Q 4HEDA 3L2PA 4FNFA 2R7ZB 1I6VC 4JBMA 3T51B 3P1HA 3S1NH 3I4OA 4HSPA 4J15A 3RZDB 4BY1H 5JJIA 2MQHA 1UEBA 2Z8LA 1QUQA 4KLKA 2F0SA 2PZWA 1HXYD 5E1FA 2XWJB 1IXRA 4RG1A 4JV5L 4XDXA 1DOKA 1EY4A 4NXML 3QIAA 3K57A 5BN3A 3S2HB 4IPCA 3Q23A 1GUSA 5DLQE 4FYDA 4QUFA 4JBKA 1C9OA 2IJ0A 1VQKA 3CC2A 1OXUA 4F8MA 2HDMA 4C3HH 4JI7L 4PZ8A 1I4HA 5C4JB 4DV7L 4JPBW 5FKAC 1BCPF 1I94L 4A3IH 3F2UA 2K28A 3MTSA 1IKLA 3MZ5A 2ZT9C 5HGTA 2G9HD 4N9PA 2A19A 5EPLA 2JSOA 1BDOA 3I4MG 3RR5A 3Q8DA 3VYSA 1K9MC 1SEBD 2LFNA 4B3TQ 3RNUA 2K1BA 3MXPA 4XT3B 3SK6A 1BF4A 3KBGA 4KN4C 4QCLA 1UNSA 1SRUA 3PUZA 1BBUA 2F0PA 3RN2A 2FFKB 1ONLA 3GTKH 3RZOB 4GLXA 1C0AA 3J80E 1NSNS 2RDGA 1II3A 3OWEB 1NMFA 1WTOA 4H13C 4LFAL 2EYOA 2MO0A 4LWCA 3HOWH 2IX1A 3AYHB 2DJGC 5CBEE 4DV5Q 4K14A 5IWAQ 1VCIA 1UE5A 2IW3A 3MHBA 3G71A 2ICIA 5LL6S 1ML0D 4N8FA 1PRTD 3ULLA 2R3ZA 3MXUA 2EOTA 4RH6A 2UUBL 4HIMA 3NEMA 2HQLA 5KYIA 2L55A 3SGIA 1XPOA 1XXGA 1W3SA 2DY7A 4DGZA 3NP8A 2PW5A 1EQVA 2E75C 3AQQA 3PF4A 2HIVA 5C0XJ 3K8AA 1G2TA 1B44D 4Q0FA 2L0CA 4DR6Q 3HOUH 1UE7A 2EQSA 4LUOA 3NWTA 1NCVA 4R4QA 4BY7G 3EQLC 3C1EA 1CKNB 2NZ1D 2JN4A 3URYA 1O7LA 1Q81C 3S15B 2D0OA 1PMRA 3BDLA 1G91A 3PO2H 3DWQA 2F1MA 1PH2A 3ND8A 4FO2A 4OO1H 1IBKQ 2NVXB 4DV0L 1VQCA 1ICWA 3DWAA 4GOPB 2F52A 2Z6KA 1PZID 1WI5A 1VMCA 2CHBD 2B2VC 2B2VA 4AQYL 2F4IA 1N33L 1YVCA 1YEZA 4QL5A 1AE3A 2B2YA 3CW2C 5FJ8G 4A3GH 2Z9HA 2A1AA 3H09A 3HOUG 2KCTA 1A2UA 4K0KQ 3FKIH 4DAPA 1BUVT 1TY2A 4IZ8A 4UY8C 2A69C 1RODA 3KFUA 1K28A 4HIKA 2SDFA 1MIUA 3CF5A 3A54A 1I6HB 1KIXA 4KI0A 4GKJQ 1LT4D 5ELBA 4YY3Q 3CCEA 1F9SA 4H7BA 4IURA 4FXDA 3F2CA 1F9PA 4MNOA 3T1HQ 2BCOA 1U4MA 4UP8A 2GN5A 2B63B 3BG3A 3GO5A 1RKNA 2TMPA 2XNAC 4A3MB 4JI1L 3CPWA 1WTXA 4ABNA 1EY9A 5I6WA 2F0GA 2JE6I 1U0LA 2DY8A 2MJ8A 5EQ0A 4LFBL 2F0MA 1W6JA 1JICA 5FJ8H 3GDEA 2FHTA 4A75A 1VF7A 4NP5A 2O5JC 4BBSG 4NDXA 4X6AH 3TQYA 1HQRD 3I4NG 1LUZA 2A6EC 4CBVA 3CD6A 1ENFA 1HH2P 3CAMA 4QQBX 2QEJC 1E1OA 3I72A 3MWYW 2HUGA 2N55A 1B8AA 5CYUA 1XMQQ 2C9OA 5A2QE 3MA2B 4YY3L 4L5TA 2UUAQ 2B8GA 1FNWA 1D8LA 3HKZG 1TT2A 5BR8L 1V1OA 1C7YA 1YHBA 3FDTA 1EU3A 3S1QH 3I91A 2UXDQ 1XNQQ 1F2ZA 1H95A 1WD1A 4QUCA 1VQMA 1UE6A 3IAYA 3TS0A 1ESFA 1Q82C 4TKOB 1S4ZA 2CWPA 4GNXC 2OXPA 5IP9G 4HCEA 2F3IA 4JVZA 3NQTA 4X3KA 4BXXG 4JOIA 4QB4A 3QOJA 2K50A 3R8BA 4BY7B 2N8NA 4ZLTF 4IOAA 3S14B 1LLRD 4UP7A 3J80L 2JK8A 2XRSD 1KDCA 2EY1A 1ET9A 2ENBA 1B4OA 1JWSD 4F7XA 1JJGA 1YNNC 2D62A 1T5EA 2AWOA 3F2BA 4ZK9B 2RVLA 3HKZB 5J1ZA 3EJIA 2B8FA 2Z1CA 1CSPA 2A73B 2P5ZX 1EEFD 2WP8J 1B50A 3GTGH 1QNKA 2C5CA 1WVLA 4CDFC 2YU9B 3I70A 1JJ2A 4HMIA 1P8LA 4KD3A 2IX0A 1CUKA 4DNRB 4CJ2C 5J22A 1QVCA 2WB1B 1WCMB 2NN6H 3ULPA 4L8JA 4RWSC 2D2CC 3HP3A 2DNCA 4DV4Q 1AW7A 2LMCB 1SNPA 1QNUA 2ZJRA 2AUKA 3KF6A 1TWFB 1A2TA 2KUMA 1KC8C 3OPOA 3S17H 1IBLQ 1ZYRC 2K32A 1EFWA 3HOYH 4A3KG 5LMUL 1B1ZA 3GTJH 2UUAL 3GTPH 1KNAA 3HOXH 2R92H 1YJWA 1PRTB 1V8QA 5KIXA 1SLJA 2PQAA 2EZVA 5DNFA 1LT5D 1L0YB 4L6TB 2ZM6Q 2Y0SG 5M5YB 1QZGA 4AYBE 2BE5C 3Q24A 3W1BA 2IWHA 3JAME 3HOUB 1X6OA 1LYLA 4HSVA 2M2LA 1LTBD 1D5XC 2QF7A 2N78A 3QOLA 4DR7L 1H9JA 3T1YL 5FLXE 2XVSA 4JI7Q 5GAEC 4QGUA 2OWOA 4QJFA 5IGBA 3U4ZA 1Q7YC 3CCVA 4J8QA 3VYUA 4OELB 3TS2A 3JAMi 2JA6G 3KDFB 1YI2A 4EQNA 1QVFA 1EWCA 2WAQB 1K83B 1H9RA 2BOSA 5CC4A 4ZUJA 1XNRL 3ZYYX 1Q12A 2CW0D 1J5EL 1YNJC 5KEEA 4MTNA 2RHSB 5NUCA 4EVOA 3K7AH 5KNBA 4IALA 1JT8A 3CU7A 2OQKA 3AFPA 1SYEA 5ELFA 3TZDA 4FDBA 1SFOH 2CQOA 3NENA 3K0XA 4OO1I 3LGJA 4OX9L 1K8OA 5IP7H 3FKIB 2AQ1B 3KJOA 4A3BB 5IYDG 4JOIC 1G291 3E0EA 1V1PA 3NTKA 2OEOA 4WFN3 2E2HH 1K8AC 3M4PA 3HKSA 1DONA 2Y0SB 5D65A 1PFSA 2EYMA 1ILQA 1PFNA 1IL2A 3SEBA 1JCKB 4A3JH 1E2WA 3TMEA 3DWPA 3M4YA 5TSSA 4XYOA 3HZXA 4POGA 2ZXPA 1AP0A 4DUYQ 1Q1EA 2DGYA 1VQIA 1XJVA 3R93A 4A3CH 3HEJA 1O7IA 3QG1A 1N34Q 2QDLA 1EIYB 4B3SQ 2R7ZG 4R4IA 3GD7A 1TWAH 1SMYC 3DEPA 2KQ3A 2L15A 1RTNA 2L9HA 4PZ7A 3I56A 4ULLA 1C4QA 3H15A 3V96A 3ER0A 3FPUB 4BBRG 3PO3B 3S1NB 4YHHL 1STAA 2ES2A 1K8MA 4DV6Q 2F0KA 1J8IA 2F0UA 1SE4A 1F9QA 1ESRA 2UXBQ 1LTID 2IT1A 3A5UA 3KBXA 1B53A 3J81j 2QA4A 1L2FA 1X55A 3FMCA 5IT9L 4YCUA 3MFGA 3GTJB 4OXPA 3QWNA 2UU9Q 3HOYG 4XYQA 3KOJA 4DR2Q 1EWIA 3NHHA 2DN8A 4G4KA 2L5TA 1AZPA 3AFQA 4ZCKA 2HT1A 1YNJD 3WWVA 1HR0W 1FVIA 2LXKA 4FP5D 2R7FA 1HZ9A 3H6MA 4XTCS 2CKZB 3K7AB 3M4QA 5T1GA 4HIDA 4ZYSA 1WD0A 1VQJA 3E0JA 4IFDI 4YWLA 4LMQD 3VR3A 2MP1A 1PRTC 2D0PA 1TS3A 2ZTCA 3UE0A 1RDPD 1EY7A 1Z47A 2JA5H 1BVSA 1FNVA 2F0DA 1HNZL 5ISRA 1WTHA 3TP7A 3MAQA 1EWHA 2V4DA 1E2VA 4CGYB 1X9NA 2R93G 1V9PA 3STBC 2K04A 4P2CB 1CT1D 4IUTA 5M5XH 4G7ZC 4R8IA 2GVAA 3SR1A 3S1RB 1LT6D 2I5MX 1HJPA 3GTGB 2VQFQ 2YV5A 2WAQG 2EYFA 2LY7A 4KY6A 4BBSH 4HR7B 4KD4A 4L63B 4EQPA 5C3WA 3I4NH 2A74C 4TVAB 4XQNA 1KDAA 4RA8A 3LNNA 3IKJA 3Q0AA 4C3IB 3JAML 1NY4A 1Y1VH 3GTMH 3RZDH 4BY1B 3BZCA 1O78A 3J7AF 1VQ9A 1I4PA 4DR1Q 4DV0Q 1IYVA 2WB1G 5LMNW 1X3EA 5M5YH 4OO1G 2VY3A 3OW2A 4DR4L 2RSNA 2VQEQ 3AMUA 2K5DA 2UUCL 2A68C 3HFZB 1PH6A 4JI4L 1X3FA 4K2LA 1SN8A 3CCUA 2JEBI 2PNHA 4A3JG 1HHVA 3BJUA 5C4XB 1PH4A 4DV6L 2BA0A 3FKIG 3D3RA 3RZOH 1MKHA 5CV7A 4EQ5A 4YHHQ 4GN3B 4OIKA 4M1UB 4TQUS 4DFAA 4P75A 3FPPA 3RUZA 3A8IE 4NKLA 1Z6HA 1QG7A 1UWVA 5I9PA 5FO9B 3PO2G 1K0RA 2Z4IA 1LO5D 3CMEA 4DV3Q 4NXMQ 3NBHB 1V1QA 3UDGA 5C6AA 2ZTEA 3HG9A 2F0IA 1CSQA 2YTXA 1ENAA 2KHIA 2KECA 3VDYA 2L12A 3ND9A 4QIWE 4FVMA 1R9TB 2EXDA 1ZYRD 3GV6A 5IGFA 4U673 5GAGC 1HTLD 5M3MB 2JA8G 5A2QL 1PYWD 1GJXA 1VQLA 2E5LL 2F0FA 4LF7L 4A3EG 1Y8PB 1S5DD 1VS0A 1EUJA 3HKZE 2Z4HA 5EBCA 2N88A 3DUZA 5C44B 3UI2A 2QGQA 4X62L 4ZRZA 2Q2TA 1HA6A 4IJHA 1I4GA 1I3QB 1RF2D 1ASZA 4JK1C 4K5XA 3N52A 1F2MA 4XQJA 5T1IA 1N8RC 1GHKA 2NZOA 1EYCA 1NUCA 2BE5D 1EFID 1KRSA 3PSIA 2PNRC 2F3WA 2ZJPA 3CC7A 1A15A 1SBBB 5AJ3L 4KV6A 3R2TA 4RHSA 2K01A 2K7VA 3L0OA 3SXHA 2Q8IB 1EOTA 1QILA 4P74A 5LHY1 2NBFA 3DHQA 1SE3A 3FEWX 3K5NA 4XQQA 2NVTH 2BH8A 1I3QH 4X65L 4G7HC 1KQSA 1KRTA 1F9RA 1JC7A 4FF3A 1R4QB 1DXMA 1PFMA 1TS4A 3H0GG 2EVBA 5M3MH 1Z7TA 3PUVA 3PUXA 1KL9A 2E2JB 1G8ZD 1KHIA 4F88A 3PIO3 3TRZA 3PO3G 1D1IA 1N9WA 4GKKQ 2NTSA 3L3OC 1O7ZA 2A5HA 4I7AA 4OWTB 4LF6L 4JBJA 3FRPB 3CCJA 1EIFA 1JWUD 1UEAB 3SK5A 3D6WA 3CCLA 1HZBA 3D4WA 1YITA 1EQQA 4KHPL 1VDZA 4ZQ3A 4KJOA 5JOBA 3OSOA 4DR2L 3EBEA 5ELCA 1SDFA 4OHJA 3HGBA 2RQXA 3QB3A 4OWWB 2RDHA 4RFBA 2OCEA 2QCPX 2EY5A 5ELDA 1MI2A 3D31A 4K8IA 2B39A 3K59A 5C44G 4HJ9A 2X6GA 1NAPA 1XNQL 1U4RA 1EYDA 1H9KA 4WRDA 1B2TA 4N9TA 1EQTA 5BR8Q 5CBAE 1KLGD 4K5WA 4FXGC 1PH5A 5C4HA 4DUZQ 2E2JH 3A74A 1STNA 4LF9L 3P75A 2KVMA 4AQYQ 2R93H 3OW7A 5EKKA 4K6LA 5M5XB 1I6HH 2XSCA 4A3CG 2LXJA 5BN5A 2G5DA 3GTLH 3ERQA 2EXZA 4DUYL 4LJZC 3CRKC 4PQXA 4DPGA 4KMUC 3MXNA 4YWKA 1EIGA 1LTSD 1OXXK 1VQPA 4B3ML 2E76C 4C3IG 1K0SA 3S1MB 1KLUD 3GQBA 4AYBG 3MXNB 5E4XA 1RL2A 2CCZA 2K05A 1BQQT 1KTKA 4GLAC 4JI1Q 5FLMG 4GKKL 1PYBA 1S5CD 3TP8A 2RCFA 5C0XI 2F03A 1CI3M 3M9BA 4IFDH 3HOWB 2YU9H 2NVYB 3T1HL 4MZ9A 1I50H 3A8KE 2JQOA 3E9IA 1SYGA 1E1TA 2X69A 3OWFA 3PIPA 1A3TA 3NXWA 1BBXC 1X3PA 2Q2IA 3DM1A 4EGVA 2F4VQ 2R7ZH 2O4XA 1WTWA 3F1ZA 4P72A 2HD3A 3K0YA 4BWGB 5CORA 4I7ZC 1ENCA 2Q8TA 1E7ZA 4ODGA 4RAUC 4B3RQ 3R2IA 3GTLB 4OWXB 1HCZA 4JI0L 5FLMH 2JA5G 1TKWB 4RGNA 1Q8KA 3BVZA 3I73A 1EEID 2AMCB 5COYA 4DK1A 2VZAA 1XMOL 2AUJD 2ATWA 3C1FA 4X62Q 2E2DC 2AQ2B 3U9SA 5DM63 4YCVA 3M7NA 4FF4A 2GVBA 1STHA 1CA6A 4KY5A 2I46A 5C4ZA 2VUMG 3M3YB 1SNDA 4A4IA 4DK0A 1IKMA 5I2XA 1ZEQX 3D4DA 3NE5B 3IRBA 4K6DA 3VR2A 3O13A 1STGA 1QVGA 2B2WA 3TDQA 1SFOB 1I94Q 2AKWB 3DMUA 5JJKA 4JC0A 2KOLA 3EFXD 1W6KA 3S24A 3B6YA 3OMGA 4GKJL 2IY5B 4A93G 1BOSA 4JI2Q 4DN4M 4GS3A 3HOXG 4Y52H 2EPBA 2NTTA 3ZJYC 1LABA 1H9MA 2WV6D 4GN4B 4MHEA 2UUBQ 2Q8RE 1RD9D 1RIPA 2OTLA 2DUDA 2MO1A 5FLXc 1ET6A 3BS1A 2K5QA 5C44H 3I7FA 1IYUA 5AJ3Q 4DV5L 3SK4A 3JAMc 1GUOA 3V05A 5D3DA 1LACA 1YIJA 1Z9FA 3HS0C 4JI5Q 1FYCA 3NK9A 1G51A 4R9WA 1L1OC 4A3MH 1F2LA 3TP5A 1F2YA 2H4OA 2Z6KC 3Q22A 1TY0A 3P7JA 4JBWA 2ALYB 3HOVB 3BVGA 2NVQH 3VR5A 3OIQA 2I0QA 2EYHA 4PG3A 2UUCQ 4UP9A 1L1OB 5C5MA 3EIVA 3M4OB 3E6ZX 2E5LQ 2QILA 2HQEA 4R4OA 1CHPD 2WAQE 4O42A 1SXTA 3V2TA 4A3GB 2R92B 4QY7A 2EJFC 1PH8A 1B9MA 1Y8NB 4JCVE 1TWGB 4HJ5A 4DAYA 3C2PA 3NPPA 1Q3LA 4ZAIA 1B3QA 4GNXA 1QUQB 3N6RA 1JE5A 3M4OH 1VQDA 4NXNQ 1HUNA 2B2UA 2EYLA 2SNMA 2CW0C 3R3OA 2UXDL 5AFWA 1ZKOA 1NNXA 1QE6A 1G2SA 1EIHA 1V1PB 3GTMB 2K52A 1GD7A 2PMZB 5M3FH 3K80C 3GTOB 2A68D 4HJ8A 3CXCA 4A3FG 5EAYA 1PRTF 2IHEA 3T13A 4HN7A 1VQFA 1PVOA 1EOVA 3LX0A 4JI4Q 3S14H 2WINB 4PMCA 1U9RA 3PGZA 2ID0A 2WKCA 1TWAB 1HR0L 1G6ZA 2VQEL 2AQ3B 2X6LA 4AH6A 3FHWA 1EU4A 2NVTB 2HCIA 3NBIA 2DJFC 4B9XA 1I4RA 1MGSA 4C1NI 3J7YW 3KYHC 1U5KA 1UAPA 2KHJA 1CA5A 5KRUA 4A93H 5J3BA 1N32L 2B2WC 3K6OA 1A0IA 2PYKA 4X66L 4PNYA 2KCNA 3E5SA 4YWMA 3J80i 2HCCA 1YHAA 2MHVA 3W5OA 2B63G 2I07B 3KF6B 1SJHD 1Y8OB 4DV3L 1XYIA 2JYOA 5BN4A 1D7QA 4O2DA 1CQVA 1SMYD 2F0TA 3PO2B 4C56C 1WTRA 4HIOA 2I5HA 1XPRA 4BY7H 4K0KL 2VL6A 4C2MB 4KK7A 3FVQA 2PCFB 4YIJA 1MSHA 5C4XH 4K8JA 3S9WA 1F77A 3MXGA 2XTIA 4DKAC 1DZ1A 3T56B 4ID6A 1A6XA 1Y1WG 3QO2A 4ME5A 2YTYA 4DR4Q 4GOPA 2PMZE 1J9OA 3I90A 2XN9C 2R7DA 5M5WB 1TQOA 3NUCA 2UU9L 1XMOQ 1HRJA 4DR1L 4RCOA 3KDFA 3LWUA 4A3IG 2RF4A 4QMGA 2JEAI 4PZ6A 3T53B 4DV1Q 1AE2A 1VQ4A 2R92G 2ZXRA 3I4MH 1AN8A 4B3RL 1CHQD 3BDCA 4P73A 1AEXA 3E3XA 1GVPA 4DUZL 3GTOH 2VXWA 3UDXA 1KNEA 1RJTA 5E3FA 2F3VA 1WTQA 3IFDA 2WIIB 1V43A 1VQHA 1WTVA 4BS9A 2XGTA 2YTVA 3TN2A 1HNWQ 3A7AB 2KBNA 5LMNL 4H0LC 3J7ZC 3UE1A 3C3LA 2EJMA 2K03A 4A3FH 3NTHA 1JMCA 1XNRQ 1SYBA 4H02A 3K5LA 1FGBD 3CQZB 3M85A 1PH7A 2L4NA 4X66Q 2OQ0A 3K58A 5CV4A 4LFAQ 5JEAH 1HPCA 3S1RH 3AU7A 1FNUA 1X54A 1VQAA 2E2HB 1PTOC 2J4XA 4X3TA 2CWAA 5G3LF 3ULJA 4U68A 5EBDA 1T9HA 4CKEA 3L9AX 4WORA 2L1BA 2VW9A 1VQNA 1BKBA 5K36H 1CTMA 2G9DA 2XRQD 3D0FA 2QKIC 4JI8Q 4GN5A 3TREA 1Y69U 4UAIA 4LF8L 1AFPA 3NQIA 2ZM6L 4C3IH 4C3HG 4CDDC 3VR6A 1TVXA 1OXVA 1HNWL 4A3EH 4L5RC 4CDCC 4KJNA 1VQGA 3RLOA 1R4PB 5KNDA 3H0GB 2JA8H 3BU2A 5ELEA 2VS1A 4IUQA 3OHXC 1RHPA 3U4VA 1KABA 1HTPA 3CCQA 4GNXB 1VQBA 3HRZC 5KGUA 3SE0A 4A3LH 1PYSB 5M9OA 1Q86C 4NPSA 1PHJA 1WYDA 5C5LA 5K5PA 5HGQA 4A3GG 2I5LX 1SNMA 4LFCL 4DAMA 2Q2UA 3HOZG 2PI2A 1U4LA 1SSOA 4O0AA 4ZUIA 3S1QB 1M90C 1S5ED 1FL0A 1DD2A 1GOZA 1EZ8A 5C4XG 2ZXOA 4A3JB 4PMBA 2RSOA 1L0XB 3L7ZC 1FR3A 3BYTB 5CV6A 4LF5Q 5GAHC 1TR5A 4LF5L 2F0EA 3CHBD 4IUVA 4POFA 5HURA 5A35A 4WJ3M 2SEBD 2M9VA 2A6HC 4A3EB 4YCWA 4ALPA 2C35B 3OIPA 3VA5A 2BH2A 2F0LA 1GO3E 5JEAJ 3VYRA 5C3XA 1QB5D 1M1KC 1CQFA 2RBMA 1SMXA 1B70B 3DLLA 5IP7G 3U58A 3S16B 4BY1G 4C3JB 1HQMC 3SVMA 4JYAL 3T4AC 3TEHB 2B3GA 3CMAA 5C0XG 3WOFA 5FO7B 3EROA 3M3YH 1SROA 2A6ED 4R8NA 1M8AA 3G6JB 3J7A5 1T5XD 2VUMB 2IPKD 2AWNA 3CCSA 4X3SA 3H3VI 1B3AA 3BZKA 5J39A 1TWHH 1JQYD 4X64Q 4A93B 4J1MA 3EVQA 1KD1C 1ICFB 4DV2Q 1Q46A 3WOEA 5G3LD 1SNOA 4A3DG 1CKMA 2VB2X 1S5BD 3PUYA 1VF5C 1XMQL 1IYJB 2VUMH 5CV9A 4A3BH 5CV8A 1DYQA 4MN3A 3QR8A 5EPJA 1EZ6A 4B3TL 3ICEA 1E0BA 3BDOA 3H3VC 2WACA 1N36L 5CR3A 1K83H 1TWFH 4NW2A 4Q5VA 1KDBA 1SNCA 1CKNA 3F8TA 5IYBG 4CDEC 4LF7Q 5IP9H 4WJ4A 1JJCB 3RN5A 2JA6H 1NR2A 4LFCQ 4DV7Q 3H91A 3D8GA 2NWGA 4MTKA 5IT9c 1K3BC 4IUUA 5IIFA 2OT2A 2VB3X 2KJXA 2EIFA 1X65A 2KHSA 4DV2L 4A3KB 1O7YA 1JOOA 4TSSA 1OTCA 2MUYA 4X64L 4BA2I 2BA1A 3U50C 2CVRA 1UE1A 1Y1WB 4JV5Q 2D9UA 4DV4L 1S5FD 2PO4A 3J80c 2MGSA 2NYZD 1B7YB 4BBRB 3I3CA 2B2YC 4LUVA 3KLSX 4R4TA 3RD4A 3W2DA 3VA7A 1PZJD 1ILPA 3DXJC 1CKOA 2OF1A 2PI2E 4JYAQ 2WFWA 1NE3A 3PQIA 3PO3H 1IL8A 4RKBA 2A6HD 3OOCA 3W1GA 5KYLA 2RCNA 4XIGS 4A3DB 1MD2D 3MEFA 3KF8A 4QF4A 4XXEA 1QJOA 4LNQA 5CMDA 3A0JA 1A63A 3MFYA 3C46A 4JI6L 2JA7H 3OMCA 4DF7A 4CJ1B 1NR4A 4LW1A 2PW7A 1PH1A 1J6QA 3M7GA 3ERSX 3S2DH 1SE2A 1UUPA 2ICEC 4C1NK 5IODA 4BBSB 1SNQA 2B63H 3HOZB 1BR9A 3BZDB 3MC0B 4DXFA 4B3MQ 1HA5A 1E2ZA 1EYAA 4HMJA 1Y1VB 1DGSA 4L5SA 4OIJA 3I55A 5C0XH 3DM3A 4A3MG 2OTJA 3P20A 2CH4W 4CKBA 1GUWA 3KK7A 4G7OC 3S2DB 2NUCA 2EJGC 1DCZA 3FP9A 3UDFA 4BBRH 2B2UC 2JA7G 1SYDA 1BNZA 5DEHA 4S3SA 1FD7D 3OTOQ 1SR3A 5FK9C 4FF2A 5F2DA 4A3DH 3RLNA 3TSSA 3NBHA 1SYFA 4R1JA 2IL8A 1D5MC 5ELNA 5C3EH 2KEEA 5FOBB 4DV1L 2PQAB 1D2BA 2R61A 4DXGA 3EN2A
chains in the Genus database with same CATH topology
2QA4A 1PH8A 4JI3Q 1L2FA 1X55A 4JCVE 4YCUA 3AEVA 4LF8Q 4HJ5A 4OXPA 1IBKL 2UU9Q 3HOYG 1IXRA 4RG1A 4JV5L 3KOJA 4GNXA 1QUQB 5ELOA 5GROA 4DR2Q 1EWIA 1WOCA 1JE5A 3AFQA 3M4OH 4NXML 2HT1A 1VQDA 4NXNQ 3WWVA 1HR0W 1FVIA 2LXKA 4A3LG 2R7FA 4IPCA 2VNUD 1K73C 1HZ9A 2KCMA 5DLQE 4XTCS 4HIDA 2CKZB 2UXDL 3M4QA 4JBKA 3HOVH 1C9OA 1VQKA 3CC2A 1OXUA 1VQJA 4IFDI 4YWLA 4C3HH 3NELA 4JI7L 4ME3A 4PZ8A 4DV7L 2K52A 2D0PA 1GD7A 2ZTCA 1I94L 3UE0A 5M3FH 2UXBL 1Z47A 3K80C 1BVSA 4A3IH 1E24A 2JA5H 1HNZL 3CCRA 2ZTDA 1FGUA 2A19A 4HJ8A 3CXCA 4A3FG 5EAYA 2IHEA 3I4MG 1X9NA 2R93G 3RR5A 3Q8DA 1VQFA 1V9PA 3STBC 1K9MC 1EOVA 3S14H 4JI4Q 5M5XH 1NJIC 1PVOA 1VQ5A 4B3TQ 3RNUA 3PGZA 2GVAA 2ID0A 1NMGA 5HY6A 2Q2HA 1HR0L 2VQEL 2AHOB 4AH6A 2NVXH 3FHWA 2I5MX 1HJPA 3UDIA 4X65Q 2VQFQ 1MJEA 2N3SA 1SRUA 4IPHA 3PUZA 1BBUA 2YV5A 4NXNL 2WAQG 3RN2A 4BBSH 1XPUA 3GTKH 4C3JH 3I4NH 3KYHC 1U5KA 2KHJA 4TVAB 4GLXA 1C0AA 4A93H 5J3BA 1N32L 1BBWA 1NMFA 3S1MH 1A0IA 4LFAL 1NY4A 1Y1VH 5C4JH 2MO0A 4LWCA 3RZDH 3BZCA 3GTMH 3HOWH 1VQ9A 1MJCA 4X66L 3G4SA 2IX1A 4DR7Q 3AYHB 4DV5Q 4DR1Q 5IWAQ 4DV0Q 1JB7A 4BXXH 1VCIA 1UE5A 2WB1G 4IJLA 4YWMA 3J80i 3G71A 1X3EA 5M5YH 1SE8A 5LMNW 1YHAA 4OO1G 3W5OA 2VY3A 2B63G 3ULLA 3OW2A 3KF6B 1S72A 4DR4L 2VQEQ 2UUBL 1OXTA 4DV3L 4HIMA 1EQRA 3NEMA 2HQLA 4DR3L 2UUCL 3HFZB 4JI3L 4EX5A 1PH6A 1D7QA 3SGIA 4O2DA 4JI4L 1XPOA 1X3FA 1Y14B 4JI6Q 3G6EA 1W3SA 2ZJQA 3H3VH 4IFDG 1SN8A 3CCUA 2JEBI 2PNHA 5GADC 4HIOA 4A3JG 4LF9Q 3BJUA 2I5HA 1XPRA 4BY7H 1PH4A 4DV6L 2BA0A 3AQQA 2HIVA 3PF4A 4K0KL 2VL6A 3FKIG 3K8AA 5C0XJ 1MKHA 4DAYB 3RZOH 2B29A 4DR6Q 3HOUH 1UE7A 2EQSA 4EQ5A 4YHHQ 5C4XH 4LUOA 1S3OA 3PUWA 4GN3B 4TQUS 4P75A 4R4QA 4BY7G 1CKNB 2NVYH 2V1CC 1UWVA 4LUZA 1Y1WH 2XTIA 3PO2G 4DK3C 1QZHA 1K0RA 4DKAC 2RHQB 1Q81C 3CMEA 2D0OA 4DV3Q 1Y1WG 3PO2H 5IY0A 2E8GA 3NBHB 1V1QA 2YTYA 4NXMQ 1AH9A 4RMFA 3UDGA 4DR4Q 4GOPA 2ZTEA 2PMZE 2K5NA 1PH2A 1CSQA 2YTXA 2R7DA 4A3KH 4KLKA 1IBKQ 2KHIA 2UU9L 1XMOQ 4DV0L 1VQCA 3VDYA 4DR1L 4GOPB 1WCMG 4A3IG 3KDFA 2F52A 2Z6KA 5IYCG 1FJGL 1WI5A 4QIWE 2RF4A 2JEAI 4IFDJ 3KLWA 4AQYL 2EXDA 4PZ6A 1EYGA 1N33L 1VQ4A 4DV1Q 1AE2A 1YVCA 2R92G 1YEZA 4QL5A 3STBD 3I4MH 4B3RL 1AE3A 4P73A 3I2ZA 5GAGC 2JA8G 3CW2C 1GVPA 5FJ8G 5C3EG 4A3GH 1KXLA 3T1YQ 2A1AA 4DUZL 1VQLA 3GTOH 2FXQA 4OONA 1HZAA 2E5LL 3HOUG 2KCTA 3UDXA 4K0KQ 4KHZA 1W2BA 3FKIH 4LF7L 2K14A 4A3EG 3KF8B 4UY8C 1VS0A 1V43A 3CCMA 3KFUA 1EUJA 1VQHA 4HIKA 1MIUA 3CF5A 1N36Q 1KIXA 4KI0A 3HKZE 2XGTA 2HHHL 1X3GA 2YTVA 2Z0SA 4GKJQ 4YY3Q 1HNWQ 3CCEA 5LMNL 2KBNA 1S40A 3F2CA 3HOWG 4MNOA 4NB3A 3J7ZC 1TWCH 4UP8A 3UE1A 2QGQA 3T1HQ 4X62L 2JA9A 2Q2TA 4A3FH 4IJHA 1ASZA 2GN5A 1JMCA 1XNRQ 1A62A 4H02A 5LMUQ 3GO5A 1LM0A 1N8RC 3M85A 1PH7A 2NZOA 4JI1L 4X66Q 3CPWA 2OQ0A 4JI0Q 3KJPA 1HZCA 1KRSA 2JE6I 3PSIA 4LFAQ 1U0LA 3S1RH 2ZJPA 3CC7A 4LFBL 5AJ3L 2A8VA 1X54A 1VQAA 4IO9A 5FJ8H 2CWAA 1GM5A 3GDEA 3L0OA 3ULJA 4A75A 4P74A 1T9HA 1IBMQ 3OYYA 2VW9A 1VQNA 4BBSG 1BKBA 2R6GA 2NVTH 3TQYA 3D0FA 2BH8A 4X6AH 1I3QH 2VQFL 4X65L 1I5FA 3I4NG 1LUZA 4JI8Q 4GN5A 3CD6A 3J81j 1KRTA 1HH2P 1KQSA 2H5XA 3TREA 3CAMA 4LF8L 4QQBX 1E1OA 3H0GG 5M3MH 3PUVA 1HNXL 2ZM6L 1XTDA 1B8AA 2ASBA 5JJLA 3PUXA 4C3IH 1KL9A 1XMQQ 1KHIA 3TRZA 1OXVA 4YY3L 3H0GH 4L5TA 5M3MG 4A3EH 2UUAQ 4L5RC 3PO3G 1HNWL 1HNZQ 2NN6G 2Y0SE 3CQZH 1VQGA 1N9WA 3RLOA 3HKZG 1D8LA 5IE8A 4JI8L 5M3FG 4GKKQ 1WJJA 5BR8L 1C7YA 2JA8H 1YHBA 3BU2A 2VS1A 4OWTB 4LF6L 2HIXA 4JBJA 3PIOA 3CCJA 1EIFA 3S1QH 2UXDQ 3U4VA 1XNQQ 3CCLA 3CCQA 1HZBA 4GNXB 1H95A 1YJ9A 1YITA 1EQQA 1VQBA 4KHPL 3CPFA 1VQMA 1UE6A 2YYZA 1VQ8A 3TS0A 1Q82C 4LF4Q 4AIMA 3E9HA 2CWPA 4GNXC 1PYSB 1IBLL 4DR2L 3S16H 4A3LH 3EBEA 5IP9G 1Q86C 4NPSA 1K8GA 1PHJA 1WYDA 4C2MH 4JI5L 2F3IA 5HGQA 5IYBH 4A3GG 4BXXG 2I5LX 4OWWB 4JOIA 2K50A 2IHFA 2N8NA 4IOAA 2CFMA 4LFCL 1TXYA 3RLFA 4DAMA 2Q2UA 3HOZG 2PI2A 3S2HH 4UP7A 2OCEA 4O0AA 4BA1I 4DNIA 1M90C 1FL0A 2JK8A 3D31A 5LMNQ 2K75A 5C4XG 5C44G 4HJ9A 1XNQL 3L7ZC 2JJQA 1JJGA 4LF5Q 2D62A 1A8VA 5M5WH 3F2BA 2AWOA 5GAHC 4LF5L 5BR8Q 2UXCL 4POFA 1PH5A 4WJ3M 4JI2L 4HJ7A 4DUZQ 2E2JH 1CSPA 3J81i 4YCWA 4ALPA 2C35B 2BH2A 3A74A 1GO3E 2WP8J 5JEAJ 4GLVB 2MNAA 4LF9L 3GTGH 1M1KC 4AQYQ 2N49A 2R93H 1YNXA 1JJ2A 1SMXA 1N34L 1B70B 4B3SL 5IYCH 3DLLA 5IP7G 3U58A 1P8LA 4BY1G 4JYAL 1VQ7A 1I6HH 4A3CG 3TEHB 2LXJA 2IX0A 2B3GA 3CMAA 5C0XG 3GTLH 1CUKA 1KAWA 1QVCA 4DUYL 4Y7NH 3M3YH 3ULPA 1SROA 4LF4L 1Y1VG 4DPGA 3J7A5 1PV4A 4YWKA 5GQOA 4IPGA 1OXXK 4DV4Q 1VQPA 2AWNA 4B3ML 3CCSA 3H3VI 2NN6I 2ZJRA 3BZKA 4AYBG 1TWHH 3KF6A 3MXNB 2E2IH 3GTQH 4X64Q 4UPAA 4LFBQ 1RL2A 2CCZA 5IYDH 3A5ZB 4GLAC 4JG2A 1KD1C 2K5VA 1KC8C 3S17H 1L1OA 4JI1Q 1YJNA 1IBLQ 4DR6L 5FLMG 4DV2Q 4DR5Q 1PYBA 1Q46A 4GKKL 1EFWA 1K3RA 3HOYH 4A3DG 4A3KG 5C0XI 5LMUL 3GTJH 1CKMA 2UUAL 4P71A 3GTPH 4APVA 3PUYA 2QEXA 3HOXH 3M9BA 2R92H 1XMQL 1YJWA 1IYJB 2YU9H 3G48A 3T1HL 1SLJA 2PQAA 4MZ9A 1I50H 1YBYA 2VUMH 4A3BH 2UXCQ 1NTGA 1LTLA 2ZM6Q 4OX9Q 2JQOA 1HNXQ 2Y0SG 3E9IA 4B3TL 3ICEA 1E1TA 3PIPA 3HOZH 1QZGA 2LSSA 4AYBE 1N36L 3CC4A 1K83H 1TWFH 2Q2IA 4A76A 2F4VQ 2F4VL 2R7ZH 1CKNA 3W1BA 3F1ZA 4DK6C 1PH3A 3F8TA 4P72A 5IYBG 4LF7Q 2K5HA 5IP9H 5IWAL 1G6PA 4WJ4A 1JJCB 1LYLA 1X6OA 2MFIA 3RN5A 1E7ZA 1VQEA 3PCOB 2JA6H 2N78A 4DR7L 3T1YL 4LFCQ 4DV7Q 1J5EQ 4JI7Q 5GAEC 4QGUA 2OWOA 4QJFA 1Q7YC 3U4ZA 5IT9c 3CCVA 1PH9A 4B3RQ 2EIFA 1Q1BA 4OWXB 3TS2A 3JAMi 1X65A 4DV2L 4DR5L 2JA6G 3KDFB 1YI2A 4JI0L 5FLMH 2JA5G 1QVFA 1Q8KA 5E7NA 2AMCB 1XMOL 1OTCA 2VZAA 4X64L 4BA2I 1XNRL 2BA1A 2ATWA 3U50C 1Q12A 3J81c 1J5EL 4X62Q 1UE1A 4IPDA 2RHSB 4MTNA 4YCVA 1HR0Q 3M7NA 4DV4L 4JV5Q 2GVBA 3S15H 4LF6Q 1X56A 3K7AH 3J80c 1R9TH 4R4CA 2VUMG 1B7YB 1WCMH 1JT8A 4LUVA 4R4TA 4A4IA 2OQKA 3AFPA 2NZHA 4FDBA 3JC66 1SFOH 1CKOA 1E22A 2CQOA 3K0XA 2PI2E 3NENA 4L5QA 3IRBA 2WFWA 3LGJA 4JYAQ 4OO1I 1NE3A 3PO3H 1WFQA 1QVGA 4OX9L 3W1GA 5IP7H 3KJOA 1OXSC 1YZ6A 5H1SE 2RCNA 4XIGS 2AKWB 1I94Q 5IYDG 1VQ6A 4A3BG 5JJKA 4JC0A 4JOIC 1G291 3MEFA 3E0EA 3OTOL 3S24A 3B6YA 3K81C 1VQOA 2WB1E 4GKJL 2IY5B 2E2HH 4LNQA 1K8AC 4A93G 4IOCA 3A0JA 3K7UC 1A63A 3M4PA 1IZ6A 2K4KA 4JI2Q 4JI6L 2JA7H 3HKSA 4GS3A 3HOXG 4Y52H 1PFSA 4LW1A 1L0WA 3ZJYC 1J6QA 1PH1A 1FJGQ 3ERSX 2UUBQ 4GN4B 3S2DH 1TWGH 1IBML 1RIPA 2OTLA 4HJAA 1IL2A 4A3JH 2B63H 2DUDA 2MO1A 5FLXc 1ASYA 4B3MQ 5C44H 1YHQA 3I7FA 5AJ3Q 4POGA 4DV5L 3JAMc 1N33Q 5JEAG 1GKHA 1DGSA 4DUYQ 1Q1EA 2DGYA 4L5SA 4PMWA 3I55A 3DM3A 3CP0A 4A3MG 1VQIA 1Z9FA 1YIJA 1XJVA 3PF5A 2OTJA 1N32Q 4JI5Q 2KENA 4A3CH 4GOPC 1G51A 1O7IA 1L1OC 4A3MH 1N34Q 1EIYB 4B3SQ 2R7ZG 3PV0A 5K36G 4R4IA 3GD7A 1TWAH 3FP9A 3UDFA 4BBRH 4KHPQ 2Z6KC 2L15A 2HHHQ 3HOVG 4JBWA 1NBWA 4PZ7A 2JA7G 2ALYB 3I56A 3F2DA 2NVQH 1PA6A 1E3PA 3H15A 2I0QA 1P16A 3OTOQ 3ER0A 4PG3A 4BBRG 4DR3Q 1SR3A 4UP9A 3L2PA 2UUCQ 1L1OB 4YHHL 4A3DH 3RLNA 3EIVA 2E5LQ 4JBMA 4R1JA 4R4OA 2ES2A 5ELNA 3S1NH 4DV6Q 3I4OA 5C3EH 4J15A 4BY1H 5JJIA 2WAQE 2PQAB 2MQHA 1UEBA 4DV1L 2UXBQ 2IT1A 3A5UA 4QY7A 1QUQA 3EN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 A;  1PH8 A;  4JI3 Q;  1L2F A;  1X55 A;  4JCV E;  4YCU A;  3AEV A;  4LF8 Q;  4HJ5 A;  4OXP A;  1IBK L;  2UU9 Q;  3HOY G;  1IXR A;  4RG1 A;  4JV5 L;  3KOJ A;  4GNX A;  1QUQ B;  5ELO A;  5GRO A;  4DR2 Q;  1EWI A;  1WOC A;  1JE5 A;  3AFQ A;  3M4O H;  4NXM L;  2HT1 A;  1VQD A;  4NXN Q;  3WWV A;  1HR0 W;  1FVI A;  2LXK A;  4A3L G;  2R7F A;  4IPC A;  2VNU D;  1K73 C;  1HZ9 A;  2KCM A;  5DLQ E;  4XTC S;  4HID A;  2CKZ B;  2UXD L;  3M4Q A;  4JBK A;  3HOV H;  1C9O A;  1VQK A;  3CC2 A;  1OXU A;  1VQJ A;  4IFD I;  4YWL A;  4C3H H;  3NEL A;  4JI7 L;  4ME3 A;  4PZ8 A;  4DV7 L;  2K52 A;  2D0P A;  1GD7 A;  2ZTC A;  1I94 L;  3UE0 A;  5M3F H;  2UXB L;  1Z47 A;  3K80 C;  1BVS A;  4A3I H;  1E24 A;  2JA5 H;  1HNZ L;  3CCR A;  2ZTD A;  1FGU A;  2A19 A;  4HJ8 A;  3CXC A;  4A3F G;  5EAY A;  2IHE A;  3I4M G;  1X9N A;  2R93 G;  3RR5 A;  3Q8D A;  1VQF A;  1V9P A;  3STB C;  1K9M C;  1EOV A;  3S14 H;  4JI4 Q;  5M5X H;  1NJI C;  1PVO A;  1VQ5 A;  4B3T Q;  3RNU A;  3PGZ A;  2GVA A;  2ID0 A;  1NMG A;  5HY6 A;  2Q2H A;  1HR0 L;  2VQE L;  2AHO B;  4AH6 A;  2NVX H;  3FHW A;  2I5M X;  1HJP A;  3UDI A;  4X65 Q;  2VQF Q;  1MJE A;  2N3S A;  1SRU A;  4IPH A;  3PUZ A;  1BBU A;  2YV5 A;  4NXN L;  2WAQ G;  3RN2 A;  4BBS H;  1XPU A;  3GTK H;  4C3J H;  3I4N H;  3KYH C;  1U5K A;  2KHJ A;  4TVA B;  4GLX A;  1C0A A;  4A93 H;  5J3B A;  1N32 L;  1BBW A;  1NMF A;  3S1M H;  1A0I A;  4LFA L;  1NY4 A;  1Y1V H;  5C4J H;  2MO0 A;  4LWC A;  3RZD H;  3BZC A;  3GTM H;  3HOW H;  1VQ9 A;  1MJC A;  4X66 L;  3G4S A;  2IX1 A;  4DR7 Q;  3AYH B;  4DV5 Q;  4DR1 Q;  5IWA Q;  4DV0 Q;  1JB7 A;  4BXX H;  1VCI A;  1UE5 A;  2WB1 G;  4IJL A;  4YWM A;  3J80 i;  3G71 A;  1X3E A;  5M5Y H;  1SE8 A;  5LMN W;  1YHA A;  4OO1 G;  3W5O A;  2VY3 A;  2B63 G;  3ULL A;  3OW2 A;  3KF6 B;  1S72 A;  4DR4 L;  2VQE Q;  2UUB L;  1OXT A;  4DV3 L;  4HIM A;  1EQR A;  3NEM A;  2HQL A;  4DR3 L;  2UUC L;  3HFZ B;  4JI3 L;  4EX5 A;  1PH6 A;  1D7Q A;  3SGI A;  4O2D A;  4JI4 L;  1XPO A;  1X3F A;  1Y14 B;  4JI6 Q;  3G6E A;  1W3S A;  2ZJQ A;  3H3V H;  4IFD G;  1SN8 A;  3CCU A;  2JEB I;  2PNH A;  5GAD C;  4HIO A;  4A3J G;  4LF9 Q;  3BJU A;  2I5H A;  1XPR A;  4BY7 H;  1PH4 A;  4DV6 L;  2BA0 A;  3AQQ A;  2HIV A;  3PF4 A;  4K0K L;  2VL6 A;  3FKI G;  3K8A A;  5C0X J;  1MKH A;  4DAY B;  3RZO H;  2B29 A;  4DR6 Q;  3HOU H;  1UE7 A;  2EQS A;  4EQ5 A;  4YHH Q;  5C4X H;  4LUO A;  1S3O A;  3PUW A;  4GN3 B;  4TQU S;  4P75 A;  4R4Q A;  4BY7 G;  1CKN B;  2NVY H;  2V1C C;  1UWV A;  4LUZ A;  1Y1W H;  2XTI A;  3PO2 G;  4DK3 C;  1QZH A;  1K0R A;  4DKA C;  2RHQ B;  1Q81 C;  3CME A;  2D0O A;  4DV3 Q;  1Y1W G;  3PO2 H;  5IY0 A;  2E8G A;  3NBH B;  1V1Q A;  2YTY A;  4NXM Q;  1AH9 A;  4RMF A;  3UDG A;  4DR4 Q;  4GOP A;  2ZTE A;  2PMZ E;  2K5N A;  1PH2 A;  1CSQ A;  2YTX A;  2R7D A;  4A3K H;  4KLK A;  1IBK Q;  2KHI A;  2UU9 L;  1XMO Q;  4DV0 L;  1VQC A;  3VDY A;  4DR1 L;  4GOP B;  1WCM G;  4A3I G;  3KDF A;  2F52 A;  2Z6K A;  5IYC G;  1FJG L;  1WI5 A;  4QIW E;  2RF4 A;  2JEA I;  4IFD J;  3KLW A;  4AQY L;  2EXD A;  4PZ6 A;  1EYG A;  1N33 L;  1VQ4 A;  4DV1 Q;  1AE2 A;  1YVC A;  2R92 G;  1YEZ A;  4QL5 A;  3STB D;  3I4M H;  4B3R L;  1AE3 A;  4P73 A;  3I2Z A;  5GAG C;  2JA8 G;  3CW2 C;  1GVP A;  5FJ8 G;  5C3E G;  4A3G H;  1KXL A;  3T1Y Q;  2A1A A;  4DUZ L;  1VQL A;  3GTO H;  2FXQ A;  4OON A;  1HZA A;  2E5L L;  3HOU G;  2KCT A;  3UDX A;  4K0K Q;  4KHZ A;  1W2B A;  3FKI H;  4LF7 L;  2K14 A;  4A3E G;  3KF8 B;  4UY8 C;  1VS0 A;  1V43 A;  3CCM A;  3KFU A;  1EUJ A;  1VQH A;  4HIK A;  1MIU A;  3CF5 A;  1N36 Q;  1KIX A;  4KI0 A;  3HKZ E;  2XGT A;  2HHH L;  1X3G A;  2YTV A;  2Z0S A;  4GKJ Q;  4YY3 Q;  1HNW Q;  3CCE A;  5LMN L;  2KBN A;  1S40 A;  3F2C A;  3HOW G;  4MNO A;  4NB3 A;  3J7Z C;  1TWC H;  4UP8 A;  3UE1 A;  2QGQ A;  3T1H Q;  4X62 L;  2JA9 A;  2Q2T A;  4A3F H;  4IJH A;  1ASZ A;  2GN5 A;  1JMC A;  1XNR Q;  1A62 A;  4H02 A;  5LMU Q;  3GO5 A;  1LM0 A;  1N8R C;  3M85 A;  1PH7 A;  2NZO A;  4JI1 L;  4X66 Q;  3CPW A;  2OQ0 A;  4JI0 Q;  3KJP A;  1HZC A;  1KRS A;  2JE6 I;  3PSI A;  4LFA Q;  1U0L A;  3S1R H;  2ZJP A;  3CC7 A;  4LFB L;  5AJ3 L;  2A8V A;  1X54 A;  1VQA A;  4IO9 A;  5FJ8 H;  2CWA A;  1GM5 A;  3GDE A;  3L0O A;  3ULJ A;  4A75 A;  4P74 A;  1T9H A;  1IBM Q;  3OYY A;  2VW9 A;  1VQN A;  4BBS G;  1BKB A;  2R6G A;  2NVT H;  3TQY A;  3D0F A;  2BH8 A;  4X6A H;  1I3Q H;  2VQF L;  4X65 L;  1I5F A;  3I4N G;  1LUZ A;  4JI8 Q;  4GN5 A;  3CD6 A;  3J81 j;  1KRT A;  1HH2 P;  1KQS A;  2H5X A;  3TRE A;  3CAM A;  4LF8 L;  4QQB X;  1E1O A;  3H0G G;  5M3M H;  3PUV A;  1HNX L;  2ZM6 L;  1XTD A;  1B8A A;  2ASB A;  5JJL A;  3PUX A;  4C3I H;  1KL9 A;  1XMQ Q;  1KHI A;  3TRZ A;  1OXV A;  4YY3 L;  3H0G H;  4L5T A;  5M3M G;  4A3E H;  2UUA Q;  4L5R C;  3PO3 G;  1HNW L;  1HNZ Q;  2NN6 G;  2Y0S E;  3CQZ H;  1VQG A;  1N9W A;  3RLO A;  3HKZ G;  1D8L A;  5IE8 A;  4JI8 L;  5M3F G;  4GKK Q;  1WJJ A;  5BR8 L;  1C7Y A;  2JA8 H;  1YHB A;  3BU2 A;  2VS1 A;  4OWT B;  4LF6 L;  2HIX A;  4JBJ A;  3PIO A;  3CCJ A;  1EIF A;  3S1Q H;  2UXD Q;  3U4V A;  1XNQ Q;  3CCL A;  3CCQ A;  1HZB A;  4GNX B;  1H95 A;  1YJ9 A;  1YIT A;  1EQQ A;  1VQB A;  4KHP L;  3CPF A;  1VQM A;  1UE6 A;  2YYZ A;  1VQ8 A;  3TS0 A;  1Q82 C;  4LF4 Q;  4AIM A;  3E9H A;  2CWP A;  4GNX C;  1PYS B;  1IBL L;  4DR2 L;  3S16 H;  4A3L H;  3EBE A;  5IP9 G;  1Q86 C;  4NPS A;  1K8G A;  1PHJ A;  1WYD A;  4C2M H;  4JI5 L;  2F3I A;  5HGQ A;  5IYB H;  4A3G G;  4BXX G;  2I5L X;  4OWW B;  4JOI A;  2K50 A;  2IHF A;  2N8N A;  4IOA A;  2CFM A;  4LFC L;  1TXY A;  3RLF A;  4DAM A;  2Q2U A;  3HOZ G;  2PI2 A;  3S2H H;  4UP7 A;  2OCE A;  4O0A A;  4BA1 I;  4DNI A;  1M90 C;  1FL0 A;  2JK8 A;  3D31 A;  5LMN Q;  2K75 A;  5C4X G;  5C44 G;  4HJ9 A;  1XNQ L;  3L7Z C;  2JJQ A;  1JJG A;  4LF5 Q;  2D62 A;  1A8V A;  5M5W H;  3F2B A;  2AWO A;  5GAH C;  4LF5 L;  5BR8 Q;  2UXC L;  4POF A;  1PH5 A;  4WJ3 M;  4JI2 L;  4HJ7 A;  4DUZ Q;  2E2J H;  1CSP A;  3J81 i;  4YCW A;  4ALP A;  2C35 B;  2BH2 A;  3A74 A;  1GO3 E;  2WP8 J;  5JEA J;  4GLV B;  2MNA A;  4LF9 L;  3GTG H;  1M1K C;  4AQY Q;  2N49 A;  2R93 H;  1YNX A;  1JJ2 A;  1SMX A;  1N34 L;  1B70 B;  4B3S L;  5IYC H;  3DLL A;  5IP7 G;  3U58 A;  1P8L A;  4BY1 G;  4JYA L;  1VQ7 A;  1I6H H;  4A3C G;  3TEH B;  2LXJ A;  2IX0 A;  2B3G A;  3CMA A;  5C0X G;  3GTL H;  1CUK A;  1KAW A;  1QVC A;  4DUY L;  4Y7N H;  3M3Y H;  3ULP A;  1SRO A;  4LF4 L;  1Y1V G;  4DPG A;  3J7A 5;  1PV4 A;  4YWK A;  5GQO A;  4IPG A;  1OXX K;  4DV4 Q;  1VQP A;  2AWN A;  4B3M L;  3CCS A;  3H3V I;  2NN6 I;  2ZJR A;  3BZK A;  4AYB G;  1TWH H;  3KF6 A;  3MXN B;  2E2I H;  3GTQ H;  4X64 Q;  4UPA A;  4LFB Q;  1RL2 A;  2CCZ A;  5IYD H;  3A5Z B;  4GLA C;  4JG2 A;  1KD1 C;  2K5V A;  1KC8 C;  3S17 H;  1L1O A;  4JI1 Q;  1YJN A;  1IBL Q;  4DR6 L;  5FLM G;  4DV2 Q;  4DR5 Q;  1PYB A;  1Q46 A;  4GKK L;  1EFW A;  1K3R A;  3HOY H;  4A3D G;  4A3K G;  5C0X I;  5LMU L;  3GTJ H;  1CKM A;  2UUA L;  4P71 A;  3GTP H;  4APV A;  3PUY A;  2QEX A;  3HOX H;  3M9B A;  2R92 H;  1XMQ L;  1YJW A;  1IYJ B;  2YU9 H;  3G48 A;  3T1H L;  1SLJ A;  2PQA A;  4MZ9 A;  1I50 H;  1YBY A;  2VUM H;  4A3B H;  2UXC Q;  1NTG A;  1LTL A;  2ZM6 Q;  4OX9 Q;  2JQO A;  1HNX Q;  2Y0S G;  3E9I A;  4B3T L;  3ICE A;  1E1T A;  3PIP A;  3HOZ H;  1QZG A;  2LSS A;  4AYB E;  1N36 L;  3CC4 A;  1K83 H;  1TWF H;  2Q2I A;  4A76 A;  2F4V Q;  2F4V L;  2R7Z H;  1CKN A;  3W1B A;  3F1Z A;  4DK6 C;  1PH3 A;  3F8T A;  4P72 A;  5IYB G;  4LF7 Q;  2K5H A;  5IP9 H;  5IWA L;  1G6P A;  4WJ4 A;  1JJC B;  1LYL A;  1X6O A;  2MFI A;  3RN5 A;  1E7Z A;  1VQE A;  3PCO B;  2JA6 H;  2N78 A;  4DR7 L;  3T1Y L;  4LFC Q;  4DV7 Q;  1J5E Q;  4JI7 Q;  5GAE C;  4QGU A;  2OWO A;  4QJF A;  1Q7Y C;  3U4Z A;  5IT9 c;  3CCV A;  1PH9 A;  4B3R Q;  2EIF A;  1Q1B A;  4OWX B;  3TS2 A;  3JAM i;  1X65 A;  4DV2 L;  4DR5 L;  2JA6 G;  3KDF B;  1YI2 A;  4JI0 L;  5FLM H;  2JA5 G;  1QVF A;  1Q8K A;  5E7N A;  2AMC B;  1XMO L;  1OTC A;  2VZA A;  4X64 L;  4BA2 I;  1XNR L;  2BA1 A;  2ATW A;  3U50 C;  1Q12 A;  3J81 c;  1J5E L;  4X62 Q;  1UE1 A;  4IPD A;  2RHS B;  4MTN A;  4YCV A;  1HR0 Q;  3M7N A;  4DV4 L;  4JV5 Q;  2GVB A;  3S15 H;  4LF6 Q;  1X56 A;  3K7A H;  3J80 c;  1R9T H;  4R4C A;  2VUM G;  1B7Y B;  1WCM H;  1JT8 A;  4LUV A;  4R4T A;  4A4I A;  2OQK A;  3AFP A;  2NZH A;  4FDB A;  3JC6 6;  1SFO H;  1CKO A;  1E22 A;  2CQO A;  3K0X A;  2PI2 E;  3NEN A;  4L5Q A;  3IRB A;  2WFW A;  3LGJ A;  4JYA Q;  4OO1 I;  1NE3 A;  3PO3 H;  1WFQ A;  1QVG A;  4OX9 L;  3W1G A;  5IP7 H;  3KJO A;  1OXS C;  1YZ6 A;  5H1S E;  2RCN A;  4XIG S;  2AKW B;  1I94 Q;  5IYD G;  1VQ6 A;  4A3B G;  5JJK A;  4JC0 A;  4JOI C;  1G29 1;  3MEF A;  3E0E A;  3OTO L;  3S24 A;  3B6Y A;  3K81 C;  1VQO A;  2WB1 E;  4GKJ L;  2IY5 B;  2E2H H;  4LNQ A;  1K8A C;  4A93 G;  4IOC A;  3A0J A;  3K7U C;  1A63 A;  3M4P A;  1IZ6 A;  2K4K A;  4JI2 Q;  4JI6 L;  2JA7 H;  3HKS A;  4GS3 A;  3HOX G;  4Y52 H;  1PFS A;  4LW1 A;  1L0W A;  3ZJY C;  1J6Q A;  1PH1 A;  1FJG Q;  3ERS X;  2UUB Q;  4GN4 B;  3S2D H;  1TWG H;  1IBM L;  1RIP A;  2OTL A;  4HJA A;  1IL2 A;  4A3J H;  2B63 H;  2DUD A;  2MO1 A;  5FLX c;  1ASY A;  4B3M Q;  5C44 H;  1YHQ A;  3I7F A;  5AJ3 Q;  4POG A;  4DV5 L;  3JAM c;  1N33 Q;  5JEA G;  1GKH A;  1DGS A;  4DUY Q;  1Q1E A;  2DGY A;  4L5S A;  4PMW A;  3I55 A;  3DM3 A;  3CP0 A;  4A3M G;  1VQI A;  1Z9F A;  1YIJ A;  1XJV A;  3PF5 A;  2OTJ A;  1N32 Q;  4JI5 Q;  2KEN A;  4A3C H;  4GOP C;  1G51 A;  1O7I A;  1L1O C;  4A3M H;  1N34 Q;  1EIY B;  4B3S Q;  2R7Z G;  3PV0 A;  5K36 G;  4R4I A;  3GD7 A;  1TWA H;  3FP9 A;  3UDF A;  4BBR H;  4KHP Q;  2Z6K C;  2L15 A;  2HHH Q;  3HOV G;  4JBW A;  1NBW A;  4PZ7 A;  2JA7 G;  2ALY B;  3I56 A;  3F2D A;  2NVQ H;  1PA6 A;  1E3P A;  3H15 A;  2I0Q A;  1P16 A;  3OTO Q;  3ER0 A;  4PG3 A;  4BBR G;  4DR3 Q;  1SR3 A;  4UP9 A;  3L2P A;  2UUC Q;  1L1O B;  4YHH L;  4A3D H;  3RLN A;  3EIV A;  2E5L Q;  4JBM A;  4R1J A;  4R4O A;  2ES2 A;  5ELN A;  3S1N H;  4DV6 Q;  3I4O A;  5C3E H;  4J15 A;  4BY1 H;  5JJI A;  2WAQ E;  2PQA B;  2MQH A;  1UEB A;  4DV1 L;  2UXB Q;  2IT1 A;  3A5U A;  4QY7 A;  1QUQ A;  3EN2 A; 
#chains in the Genus database with same CATH topology
 4JI3 Q;  2PZT A;  3AEV A;  4LF8 Q;  4V19 0;  3ONA B;  1IBK L;  4AYB B;  5ELO A;  5GRO A;  1WOC A;  1XTC D;  3RMH A;  1I4Q A;  2PZU A;  3J81 L;  2KED A;  1GUG A;  4A3L G;  2FMM A;  4QIW B;  2VNU D;  1K73 C;  2KCM A;  2NVQ B;  3HOV H;  5JPN C;  1LTA D;  5IGG A;  4KKU A;  1MHW C;  3NEL A;  3K5O A;  4I65 A;  5IGE A;  4ME3 A;  3PIP 3;  1JOQ A;  4KKS A;  5D14 A;  1EY5 A;  2UXB L;  1E24 A;  1X32 A;  3CCR A;  2ZTD A;  4M8A A;  1FGU A;  2QW7 A;  3SHL A;  1NJI C;  2TSS A;  2B2T A;  2HDL A;  1VQ5 A;  1NMG A;  2JA7 B;  5HY6 A;  2Q2H A;  4N8X 1;  2L11 A;  4FXK C;  2F0V A;  2NVX H;  2AHO B;  2BDO A;  3UDI A;  3NWS A;  3SDZ A;  4X65 Q;  1MJE A;  2N3S A;  3G7L A;  3I4L A;  4IPH A;  4RHR A;  4X3U A;  4NXN L;  5C3E B;  2JA5 B;  3TZU A;  1XPU A;  4C3J H;  5L37 A;  2QDB A;  1BBW A;  3S1M H;  5C4J H;  4KKT A;  1MJC A;  3G4S A;  4DR7 Q;  3KLR A;  1JB3 A;  1JB7 A;  4BXX H;  1SAP A;  4IJL A;  2F0H A;  1SE8 A;  4EQO A;  1D1K A;  1DOL A;  3X3M A;  1S72 A;  2SOB A;  1OXT A;  1EQR A;  4DR3 L;  4JI3 L;  3W3A A;  4EX5 A;  1Y14 B;  4JI6 Q;  3G6E A;  2ZJQ A;  5CV5 A;  3H3V H;  4IFD G;  4LF9 Q;  1MBY A;  2M00 A;  1IW7 C;  5GAD C;  2FIN B;  1C8C A;  3S2H H;  4B08 A;  4DAY B;  2B29 A;  1S3O A;  3PUW A;  1I4X A;  4XT1 B;  4A3I B;  5I6Y A;  2NVY H;  2V1C C;  4LUZ A;  5JVG 3;  2O2L D;  5KNC A;  1Y1W H;  4DK3 C;  1QZH A;  2RHQ B;  4TRD A;  5CGK A;  1AH9 A;  2BDN A;  2E8G A;  5IY0 A;  4DU9 A;  4RMF A;  2NB0 A;  2K5N A;  4A3K H;  3K5M A;  1WCM G;  1FJG L;  5IYC G;  1BCP D;  1PZK D;  4IFD J;  3KLW A;  1EYG A;  3KLS A;  4FF1 A;  3STB D;  5FO8 B;  5I9O A;  1KXL A;  3I2Z A;  4OL7 A;  4ILW A;  5C3E G;  1XX8 A;  3IFT A;  3T1Y Q;  1LT3 D;  2FXQ A;  4OON A;  1HZA A;  4KHZ A;  1W2B A;  3EA6 A;  2K14 A;  1AZQ A;  4DAV A;  4H44 C;  5D3I B;  3KF8 B;  1H9S B;  3CCM A;  4OEM B;  1N36 Q;  2LS0 1;  1JR0 D;  2HHH L;  1X3G A;  2Z0S A;  4RCN A;  4A3F B;  5EJW A;  1S40 A;  2EY6 A;  3T16 A;  3HOW G;  4NB3 A;  3D4R A;  3WDN A;  1TWC H;  1JOR A;  2JA9 A;  1DJR D;  5EKI A;  1QOH A;  4K2K A;  1A62 A;  5LMU Q;  1PTO H;  1LM0 A;  1TWH B;  2K5W A;  1O80 A;  4JI0 Q;  3KJP A;  1ZXT A;  1HZC A;  2A8V A;  4UDU C;  4IO9 A;  1GM5 A;  2XIW A;  5E4W C;  3A55 A;  1B9N A;  3GP7 A;  3GTK B;  3H94 A;  1IBM Q;  3OYY A;  1MSG A;  2O5I C;  1X3Q A;  1BXT A;  2D5D A;  2F0Q A;  2FJ2 A;  2R6G A;  4IN3 A;  1TU2 B;  2EDG A;  2VQF L;  1I5F A;  1PTO F;  2H5X A;  2FMC A;  1IHZ A;  4DNT B;  1OO9 B;  1Q8I A;  3LWE A;  1HNX L;  1XTD A;  2A69 D;  2ASB A;  4GZY C;  5JJL A;  1EY6 A;  1JE4 A;  1PDQ A;  3H0G H;  2JP1 A;  3BYY B;  5M3M G;  2JA8 B;  4J6H A;  1HNZ Q;  2NN6 G;  2Y0S E;  3BVM A;  4MIU A;  3CQZ H;  5IGD A;  1VMP A;  5IE8 A;  4JI8 L;  5M3F G;  4IUP A;  1WJJ A;  2JXM B;  1CFM A;  3VR4 A;  2F0J A;  2F0W A;  2HIX A;  2J7Z A;  1BCP B;  3PIO A;  2EE1 A;  1YJ9 A;  1GUT A;  3CPF A;  4UHV A;  1PTO B;  2YYZ A;  1VQ8 A;  1PLF A;  4LF4 Q;  1RCV D;  4AIM A;  3E9H A;  1IBL L;  3S16 H;  3D6C A;  3GTP B;  1K8G A;  5LL6 X;  5I2Y A;  4C2M H;  4JI5 L;  5IYB H;  4CJ0 B;  4KTA A;  1BCP C;  5JPM C;  2IHF A;  4ZKB B;  3NSW A;  4CKC A;  2CFM A;  3RLF A;  1TXY A;  2IX3 A;  4B9W A;  1RTO A;  1PFB A;  4BA1 I;  4IQZ A;  4DA2 A;  4DNI A;  5LMN Q;  2K75 A;  4LAA A;  1STY A;  4V0B A;  1LTT D;  2H1E A;  5IOC A;  2JJQ A;  1A8V A;  5M5W H;  4Y7N B;  4NMZ A;  1A3U A;  3J7A V;  2UXC L;  3NTI A;  2GA4 B;  3I4M B;  1D6E C;  4HJ7 A;  4JI2 L;  4KY7 A;  1TS2 A;  3J81 i;  5EGT A;  3IL8 A;  4RGT A;  4C3H B;  4GLV B;  2MNA A;  1JWM D;  3U9O A;  5EKL A;  4O1N A;  1WTP A;  2N49 A;  2RDF A;  1YNX A;  4B3S L;  1N34 L;  2CQA A;  5IYC H;  4CHT B;  2F0N A;  3J81 E;  1H9S A;  1VQ7 A;  3CKI B;  1C48 A;  1SJE D;  3MEH A;  1KAW A;  1LTR D;  5FLX L;  4Y7N H;  4LF4 L;  1Y1V G;  1CZG A;  3A56 A;  1PV4 A;  1I50 B;  1EY0 A;  5GQO A;  4IPG A;  2EYP A;  5IT9 E;  3ITP A;  4K5V A;  4G57 A;  1PTO D;  2NN6 I;  4PV1 C;  5JVH 3;  4HAE A;  2E2I H;  3GTQ H;  4UPA A;  3KUP A;  3HOY B;  2LKV A;  4LFB Q;  5IYD H;  3A5Z B;  4F87 A;  4JG2 A;  2K5V A;  1L1O A;  1YJN A;  4DR6 L;  1D5Z C;  4DR5 Q;  1K3R A;  3SK8 A;  4P71 A;  3TP6 A;  1YNN D;  4APV A;  5DM7 3;  2QEX A;  2WKD A;  3G48 A;  1QCB D;  4RGM A;  1CM9 A;  1YBY A;  2UXC Q;  1EY8 A;  1NTG A;  1LTL A;  4OX9 Q;  1HNX Q;  3HOX B;  1XWE A;  3HOZ H;  1DM0 B;  2PQE A;  2LSS A;  3Q6S A;  3CC4 A;  4A76 A;  3GTQ B;  2F4V L;  2E2I B;  1Q90 A;  2EYJ A;  4DK6 C;  1PH3 A;  2XWB B;  1TS5 A;  2K5H A;  1HFG A;  5IWA L;  3DEO A;  1G6P A;  1M4V A;  2R93 B;  2MFI A;  4ZKC B;  1QWY A;  1VQE A;  1GHJ A;  2CH4 A;  3PCO B;  4E6I A;  1J5E Q;  4LK1 C;  4Z9C B;  1PH9 A;  3CRL C;  1Q1B A;  4WJW A;  1GXD C;  2RA4 A;  4DR5 L;  3S17 B;  4KN7 C;  1CK1 A;  2Z6B A;  2K33 A;  1PXU A;  1SYC A;  3I4N B;  5JJZ A;  1BO0 A;  4KHV A;  5E7N A;  4HTH A;  3J81 c;  1KAA A;  2RKS A;  4IPD A;  5DAU A;  1HR0 Q;  3I8Z A;  3S15 H;  1HUM A;  4LF6 Q;  1X56 A;  1R9T H;  4R4C A;  1WCM H;  5JAV A;  2K6A A;  3A7L A;  1JOK A;  3PMF A;  2NZH A;  3JC6 6;  5I4D A;  1LV9 A;  5M3F B;  1E22 A;  4L5Q A;  5EPK A;  1STE A;  2SNS A;  1WFQ A;  1TII D;  1OXS C;  1YZ6 A;  3A8J E;  5H1S E;  1VQ6 A;  2MPM A;  4A3B G;  3OTO L;  3K81 C;  1CZW A;  1VQO A;  2WB1 E;  1HFN A;  2KCC A;  4IOC A;  3K7U C;  1IZ6 A;  2K4K A;  2KA7 A;  1FJG Q;  1L0W A;  3VYT A;  2J0T D;  1DOM A;  3GV3 A;  1IW7 D;  1TWG H;  1IBM L;  4RKL A;  2F0O A;  4HJA A;  3TBI B;  4OGQ C;  1STB A;  1A3V A;  3MVV A;  1ASY A;  1TWC B;  1YHQ A;  1EL0 A;  5IGC A;  2DNE A;  1N33 Q;  4IUN A;  5JEA G;  1GKH A;  4JW0 A;  4PMW A;  2JA6 B;  3CP0 A;  4HCS A;  3PF5 A;  1N32 Q;  2KEN A;  4GOP C;  3X3N A;  4C3J G;  2PPB C;  3PV0 A;  5K36 G;  1LTG D;  4KHP Q;  2B2T C;  2HHH Q;  3HOV G;  2EY2 A;  1NBW A;  1U4P A;  3F2D A;  2E74 C;  1GUN A;  3AB9 A;  1PA6 A;  4RGO S;  1E3P A;  1P16 A;  3QJY A;  4DR3 Q;  4HED A;  3L2P A;  4FNF A;  2R7Z B;  1I6V C;  4JBM A;  3T51 B;  3P1H A;  3S1N H;  3I4O A;  4HSP A;  4J15 A;  3RZD B;  4BY1 H;  5JJI A;  2MQH A;  1UEB A;  2Z8L A;  1QUQ A;  4KLK A;  2F0S A;  2PZW A;  1HXY D;  5E1F A;  2XWJ B;  1IXR A;  4RG1 A;  4JV5 L;  4XDX A;  1DOK A;  1EY4 A;  4NXM L;  3QIA A;  3K57 A;  5BN3 A;  3S2H B;  4IPC A;  3Q23 A;  1GUS A;  5DLQ E;  4FYD A;  4QUF A;  4JBK A;  1C9O A;  2IJ0 A;  1VQK A;  3CC2 A;  1OXU A;  4F8M A;  2HDM A;  4C3H H;  4JI7 L;  4PZ8 A;  1I4H A;  5C4J B;  4DV7 L;  4JPB W;  5FKA C;  1BCP F;  1I94 L;  4A3I H;  3F2U A;  2K28 A;  3MTS A;  1IKL A;  3MZ5 A;  2ZT9 C;  5HGT A;  2G9H D;  4N9P A;  2A19 A;  5EPL A;  2JSO A;  1BDO A;  3I4M G;  3RR5 A;  3Q8D A;  3VYS A;  1K9M C;  1SEB D;  2LFN A;  4B3T Q;  3RNU A;  2K1B A;  3MXP A;  4XT3 B;  3SK6 A;  1BF4 A;  3KBG A;  4KN4 C;  4QCL A;  1UNS A;  1SRU A;  3PUZ A;  1BBU A;  2F0P A;  3RN2 A;  2FFK B;  1ONL A;  3GTK H;  3RZO B;  4GLX A;  1C0A A;  3J80 E;  1NSN S;  2RDG A;  1II3 A;  3OWE B;  1NMF A;  1WTO A;  4H13 C;  4LFA L;  2EYO A;  2MO0 A;  4LWC A;  3HOW H;  2IX1 A;  3AYH B;  2DJG C;  5CBE E;  4DV5 Q;  4K14 A;  5IWA Q;  1VCI A;  1UE5 A;  2IW3 A;  3MHB A;  3G71 A;  2ICI A;  5LL6 S;  1ML0 D;  4N8F A;  1PRT D;  3ULL A;  2R3Z A;  3MXU A;  2EOT A;  4RH6 A;  2UUB L;  4HIM A;  3NEM A;  2HQL A;  5KYI A;  2L55 A;  3SGI A;  1XPO A;  1XXG A;  1W3S A;  2DY7 A;  4DGZ A;  3NP8 A;  2PW5 A;  1EQV A;  2E75 C;  3AQQ A;  3PF4 A;  2HIV A;  5C0X J;  3K8A A;  1G2T A;  1B44 D;  4Q0F A;  2L0C A;  4DR6 Q;  3HOU H;  1UE7 A;  2EQS A;  4LUO A;  3NWT A;  1NCV A;  4R4Q A;  4BY7 G;  3EQL C;  3C1E A;  1CKN B;  2NZ1 D;  2JN4 A;  3URY A;  1O7L A;  1Q81 C;  3S15 B;  2D0O A;  1PMR A;  3BDL A;  1G91 A;  3PO2 H;  3DWQ A;  2F1M A;  1PH2 A;  3ND8 A;  4FO2 A;  4OO1 H;  1IBK Q;  2NVX B;  4DV0 L;  1VQC A;  1ICW A;  3DWA A;  4GOP B;  2F52 A;  2Z6K A;  1PZI D;  1WI5 A;  1VMC A;  2CHB D;  2B2V C;  2B2V A;  4AQY L;  2F4I A;  1N33 L;  1YVC A;  1YEZ A;  4QL5 A;  1AE3 A;  2B2Y A;  3CW2 C;  5FJ8 G;  4A3G H;  2Z9H A;  2A1A A;  3H09 A;  3HOU G;  2KCT A;  1A2U A;  4K0K Q;  3FKI H;  4DAP A;  1BUV T;  1TY2 A;  4IZ8 A;  4UY8 C;  2A69 C;  1ROD A;  3KFU A;  1K28 A;  4HIK A;  2SDF A;  1MIU A;  3CF5 A;  3A54 A;  1I6H B;  1KIX A;  4KI0 A;  4GKJ Q;  1LT4 D;  5ELB A;  4YY3 Q;  3CCE A;  1F9S A;  4H7B A;  4IUR A;  4FXD A;  3F2C A;  1F9P A;  4MNO A;  3T1H Q;  2BCO A;  1U4M A;  4UP8 A;  2GN5 A;  2B63 B;  3BG3 A;  3GO5 A;  1RKN A;  2TMP A;  2XNA C;  4A3M B;  4JI1 L;  3CPW A;  1WTX A;  4ABN A;  1EY9 A;  5I6W A;  2F0G A;  2JE6 I;  1U0L A;  2DY8 A;  2MJ8 A;  5EQ0 A;  4LFB L;  2F0M A;  1W6J A;  1JIC A;  5FJ8 H;  3GDE A;  2FHT A;  4A75 A;  1VF7 A;  4NP5 A;  2O5J C;  4BBS G;  4NDX A;  4X6A H;  3TQY A;  1HQR D;  3I4N G;  1LUZ A;  2A6E C;  4CBV A;  3CD6 A;  1ENF A;  1HH2 P;  3CAM A;  4QQB X;  2QEJ C;  1E1O A;  3I72 A;  3MWY W;  2HUG A;  2N55 A;  1B8A A;  5CYU A;  1XMQ Q;  2C9O A;  5A2Q E;  3MA2 B;  4YY3 L;  4L5T A;  2UUA Q;  2B8G A;  1FNW A;  1D8L A;  3HKZ G;  1TT2 A;  5BR8 L;  1V1O A;  1C7Y A;  1YHB A;  3FDT A;  1EU3 A;  3S1Q H;  3I91 A;  2UXD Q;  1XNQ Q;  1F2Z A;  1H95 A;  1WD1 A;  4QUC A;  1VQM A;  1UE6 A;  3IAY A;  3TS0 A;  1ESF A;  1Q82 C;  4TKO B;  1S4Z A;  2CWP A;  4GNX C;  2OXP A;  5IP9 G;  4HCE A;  2F3I A;  4JVZ A;  3NQT A;  4X3K A;  4BXX G;  4JOI A;  4QB4 A;  3QOJ A;  2K50 A;  3R8B A;  4BY7 B;  2N8N A;  4ZLT F;  4IOA A;  3S14 B;  1LLR D;  4UP7 A;  3J80 L;  2JK8 A;  2XRS D;  1KDC A;  2EY1 A;  1ET9 A;  2ENB A;  1B4O A;  1JWS D;  4F7X A;  1JJG A;  1YNN C;  2D62 A;  1T5E A;  2AWO A;  3F2B A;  4ZK9 B;  2RVL A;  3HKZ B;  5J1Z A;  3EJI A;  2B8F A;  2Z1C A;  1CSP A;  2A73 B;  2P5Z X;  1EEF D;  2WP8 J;  1B50 A;  3GTG H;  1QNK A;  2C5C A;  1WVL A;  4CDF C;  2YU9 B;  3I70 A;  1JJ2 A;  4HMI A;  1P8L A;  4KD3 A;  2IX0 A;  1CUK A;  4DNR B;  4CJ2 C;  5J22 A;  1QVC A;  2WB1 B;  1WCM B;  2NN6 H;  3ULP A;  4L8J A;  4RWS C;  2D2C C;  3HP3 A;  2DNC A;  4DV4 Q;  1AW7 A;  2LMC B;  1SNP A;  1QNU A;  2ZJR A;  2AUK A;  3KF6 A;  1TWF B;  1A2T A;  2KUM A;  1KC8 C;  3OPO A;  3S17 H;  1IBL Q;  1ZYR C;  2K32 A;  1EFW A;  3HOY H;  4A3K G;  5LMU L;  1B1Z A;  3GTJ H;  2UUA L;  3GTP H;  1KNA A;  3HOX H;  2R92 H;  1YJW A;  1PRT B;  1V8Q A;  5KIX A;  1SLJ A;  2PQA A;  2EZV A;  5DNF A;  1LT5 D;  1L0Y B;  4L6T B;  2ZM6 Q;  2Y0S G;  5M5Y B;  1QZG A;  4AYB E;  2BE5 C;  3Q24 A;  3W1B A;  2IWH A;  3JAM E;  3HOU B;  1X6O A;  1LYL A;  4HSV A;  2M2L A;  1LTB D;  1D5X C;  2QF7 A;  2N78 A;  3QOL A;  4DR7 L;  1H9J A;  3T1Y L;  5FLX E;  2XVS A;  4JI7 Q;  5GAE C;  4QGU A;  2OWO A;  4QJF A;  5IGB A;  3U4Z A;  1Q7Y C;  3CCV A;  4J8Q A;  3VYU A;  4OEL B;  3TS2 A;  3JAM i;  2JA6 G;  3KDF B;  1YI2 A;  4EQN A;  1QVF A;  1EWC A;  2WAQ B;  1K83 B;  1H9R A;  2BOS A;  5CC4 A;  4ZUJ A;  1XNR L;  3ZYY X;  1Q12 A;  2CW0 D;  1J5E L;  1YNJ C;  5KEE A;  4MTN A;  2RHS B;  5NUC A;  4EVO A;  3K7A H;  5KNB A;  4IAL A;  1JT8 A;  3CU7 A;  2OQK A;  3AFP A;  1SYE A;  5ELF A;  3TZD A;  4FDB A;  1SFO H;  2CQO A;  3NEN A;  3K0X A;  4OO1 I;  3LGJ A;  4OX9 L;  1K8O A;  5IP7 H;  3FKI B;  2AQ1 B;  3KJO A;  4A3B B;  5IYD G;  4JOI C;  1G29 1;  3E0E A;  1V1P A;  3NTK A;  2OEO A;  4WFN 3;  2E2H H;  1K8A C;  3M4P A;  3HKS A;  1DON A;  2Y0S B;  5D65 A;  1PFS A;  2EYM A;  1ILQ A;  1PFN A;  1IL2 A;  3SEB A;  1JCK B;  4A3J H;  1E2W A;  3TME A;  3DWP A;  3M4Y A;  5TSS A;  4XYO A;  3HZX A;  4POG A;  2ZXP A;  1AP0 A;  4DUY Q;  1Q1E A;  2DGY A;  1VQI A;  1XJV A;  3R93 A;  4A3C H;  3HEJ A;  1O7I A;  3QG1 A;  1N34 Q;  2QDL A;  1EIY B;  4B3S Q;  2R7Z G;  4R4I A;  3GD7 A;  1TWA H;  1SMY C;  3DEP A;  2KQ3 A;  2L15 A;  1RTN A;  2L9H A;  4PZ7 A;  3I56 A;  4ULL A;  1C4Q A;  3H15 A;  3V96 A;  3ER0 A;  3FPU B;  4BBR G;  3PO3 B;  3S1N B;  4YHH L;  1STA A;  2ES2 A;  1K8M A;  4DV6 Q;  2F0K A;  1J8I A;  2F0U A;  1SE4 A;  1F9Q A;  1ESR A;  2UXB Q;  1LTI D;  2IT1 A;  3A5U A;  3KBX A;  1B53 A;  3J81 j;  2QA4 A;  1L2F A;  1X55 A;  3FMC A;  5IT9 L;  4YCU A;  3MFG A;  3GTJ B;  4OXP A;  3QWN A;  2UU9 Q;  3HOY G;  4XYQ A;  3KOJ A;  4DR2 Q;  1EWI A;  3NHH A;  2DN8 A;  4G4K A;  2L5T A;  1AZP A;  3AFQ A;  4ZCK A;  2HT1 A;  1YNJ D;  3WWV A;  1HR0 W;  1FVI A;  2LXK A;  4FP5 D;  2R7F A;  1HZ9 A;  3H6M A;  4XTC S;  2CKZ B;  3K7A B;  3M4Q A;  5T1G A;  4HID A;  4ZYS A;  1WD0 A;  1VQJ A;  3E0J A;  4IFD I;  4YWL A;  4LMQ D;  3VR3 A;  2MP1 A;  1PRT C;  2D0P A;  1TS3 A;  2ZTC A;  3UE0 A;  1RDP D;  1EY7 A;  1Z47 A;  2JA5 H;  1BVS A;  1FNV A;  2F0D A;  1HNZ L;  5ISR A;  1WTH A;  3TP7 A;  3MAQ A;  1EWH A;  2V4D A;  1E2V A;  4CGY B;  1X9N A;  2R93 G;  1V9P A;  3STB C;  2K04 A;  4P2C B;  1CT1 D;  4IUT A;  5M5X H;  4G7Z C;  4R8I A;  2GVA A;  3SR1 A;  3S1R B;  1LT6 D;  2I5M X;  1HJP A;  3GTG B;  2VQF Q;  2YV5 A;  2WAQ G;  2EYF A;  2LY7 A;  4KY6 A;  4BBS H;  4HR7 B;  4KD4 A;  4L63 B;  4EQP A;  5C3W A;  3I4N H;  2A74 C;  4TVA B;  4XQN A;  1KDA A;  4RA8 A;  3LNN A;  3IKJ A;  3Q0A A;  4C3I B;  3JAM L;  1NY4 A;  1Y1V H;  3GTM H;  3RZD H;  4BY1 B;  3BZC A;  1O78 A;  3J7A F;  1VQ9 A;  1I4P A;  4DR1 Q;  4DV0 Q;  1IYV A;  2WB1 G;  5LMN W;  1X3E A;  5M5Y H;  4OO1 G;  2VY3 A;  3OW2 A;  4DR4 L;  2RSN A;  2VQE Q;  3AMU A;  2K5D A;  2UUC L;  2A68 C;  3HFZ B;  1PH6 A;  4JI4 L;  1X3F A;  4K2L A;  1SN8 A;  3CCU A;  2JEB I;  2PNH A;  4A3J G;  1HHV A;  3BJU A;  5C4X B;  1PH4 A;  4DV6 L;  2BA0 A;  3FKI G;  3D3R A;  3RZO H;  1MKH A;  5CV7 A;  4EQ5 A;  4YHH Q;  4GN3 B;  4OIK A;  4M1U B;  4TQU S;  4DFA A;  4P75 A;  3FPP A;  3RUZ A;  3A8I E;  4NKL A;  1Z6H A;  1QG7 A;  1UWV A;  5I9P A;  5FO9 B;  3PO2 G;  1K0R A;  2Z4I A;  1LO5 D;  3CME A;  4DV3 Q;  4NXM Q;  3NBH B;  1V1Q A;  3UDG A;  5C6A A;  2ZTE A;  3HG9 A;  2F0I A;  1CSQ A;  2YTX A;  1ENA A;  2KHI A;  2KEC A;  3VDY A;  2L12 A;  3ND9 A;  4QIW E;  4FVM A;  1R9T B;  2EXD A;  1ZYR D;  3GV6 A;  5IGF A;  4U67 3;  5GAG C;  1HTL D;  5M3M B;  2JA8 G;  5A2Q L;  1PYW D;  1GJX A;  1VQL A;  2E5L L;  2F0F A;  4LF7 L;  4A3E G;  1Y8P B;  1S5D D;  1VS0 A;  1EUJ A;  3HKZ E;  2Z4H A;  5EBC A;  2N88 A;  3DUZ A;  5C44 B;  3UI2 A;  2QGQ A;  4X62 L;  4ZRZ A;  2Q2T A;  1HA6 A;  4IJH A;  1I4G A;  1I3Q B;  1RF2 D;  1ASZ A;  4JK1 C;  4K5X A;  3N52 A;  1F2M A;  4XQJ A;  5T1I A;  1N8R C;  1GHK A;  2NZO A;  1EYC A;  1NUC A;  2BE5 D;  1EFI D;  1KRS A;  3PSI A;  2PNR C;  2F3W A;  2ZJP A;  3CC7 A;  1A15 A;  1SBB B;  5AJ3 L;  4KV6 A;  3R2T A;  4RHS A;  2K01 A;  2K7V A;  3L0O A;  3SXH A;  2Q8I B;  1EOT A;  1QIL A;  4P74 A;  5LHY 1;  2NBF A;  3DHQ A;  1SE3 A;  3FEW X;  3K5N A;  4XQQ A;  2NVT H;  2BH8 A;  1I3Q H;  4X65 L;  4G7H C;  1KQS A;  1KRT A;  1F9R A;  1JC7 A;  4FF3 A;  1R4Q B;  1DXM A;  1PFM A;  1TS4 A;  3H0G G;  2EVB A;  5M3M H;  1Z7T A;  3PUV A;  3PUX A;  1KL9 A;  2E2J B;  1G8Z D;  1KHI A;  4F88 A;  3PIO 3;  3TRZ A;  3PO3 G;  1D1I A;  1N9W A;  4GKK Q;  2NTS A;  3L3O C;  1O7Z A;  2A5H A;  4I7A A;  4OWT B;  4LF6 L;  4JBJ A;  3FRP B;  3CCJ A;  1EIF A;  1JWU D;  1UEA B;  3SK5 A;  3D6W A;  3CCL A;  1HZB A;  3D4W A;  1YIT A;  1EQQ A;  4KHP L;  1VDZ A;  4ZQ3 A;  4KJO A;  5JOB A;  3OSO A;  4DR2 L;  3EBE A;  5ELC A;  1SDF A;  4OHJ A;  3HGB A;  2RQX A;  3QB3 A;  4OWW B;  2RDH A;  4RFB A;  2OCE A;  2QCP X;  2EY5 A;  5ELD A;  1MI2 A;  3D31 A;  4K8I A;  2B39 A;  3K59 A;  5C44 G;  4HJ9 A;  2X6G A;  1NAP A;  1XNQ L;  1U4R A;  1EYD A;  1H9K A;  4WRD A;  1B2T A;  4N9T A;  1EQT A;  5BR8 Q;  5CBA E;  1KLG D;  4K5W A;  4FXG C;  1PH5 A;  5C4H A;  4DUZ Q;  2E2J H;  3A74 A;  1STN A;  4LF9 L;  3P75 A;  2KVM A;  4AQY Q;  2R93 H;  3OW7 A;  5EKK A;  4K6L A;  5M5X B;  1I6H H;  2XSC A;  4A3C G;  2LXJ A;  5BN5 A;  2G5D A;  3GTL H;  3ERQ A;  2EXZ A;  4DUY L;  4LJZ C;  3CRK C;  4PQX A;  4DPG A;  4KMU C;  3MXN A;  4YWK A;  1EIG A;  1LTS D;  1OXX K;  1VQP A;  4B3M L;  2E76 C;  4C3I G;  1K0S A;  3S1M B;  1KLU D;  3GQB A;  4AYB G;  3MXN B;  5E4X A;  1RL2 A;  2CCZ A;  2K05 A;  1BQQ T;  1KTK A;  4GLA C;  4JI1 Q;  5FLM G;  4GKK L;  1PYB A;  1S5C D;  3TP8 A;  2RCF A;  5C0X I;  2F03 A;  1CI3 M;  3M9B A;  4IFD H;  3HOW B;  2YU9 H;  2NVY B;  3T1H L;  4MZ9 A;  1I50 H;  3A8K E;  2JQO A;  3E9I A;  1SYG A;  1E1T A;  2X69 A;  3OWF A;  3PIP A;  1A3T A;  3NXW A;  1BBX C;  1X3P A;  2Q2I A;  3DM1 A;  4EGV A;  2F4V Q;  2R7Z H;  2O4X A;  1WTW A;  3F1Z A;  4P72 A;  2HD3 A;  3K0Y A;  4BWG B;  5COR A;  4I7Z C;  1ENC A;  2Q8T A;  1E7Z A;  4ODG A;  4RAU C;  4B3R Q;  3R2I A;  3GTL B;  4OWX B;  1HCZ A;  4JI0 L;  5FLM H;  2JA5 G;  1TKW B;  4RGN A;  1Q8K A;  3BVZ A;  3I73 A;  1EEI D;  2AMC B;  5COY A;  4DK1 A;  2VZA A;  1XMO L;  2AUJ D;  2ATW A;  3C1F A;  4X62 Q;  2E2D C;  2AQ2 B;  3U9S A;  5DM6 3;  4YCV A;  3M7N A;  4FF4 A;  2GVB A;  1STH A;  1CA6 A;  4KY5 A;  2I46 A;  5C4Z A;  2VUM G;  3M3Y B;  1SND A;  4A4I A;  4DK0 A;  1IKM A;  5I2X A;  1ZEQ X;  3D4D A;  3NE5 B;  3IRB A;  4K6D A;  3VR2 A;  3O13 A;  1STG A;  1QVG A;  2B2W A;  3TDQ A;  1SFO B;  1I94 Q;  2AKW B;  3DMU A;  5JJK A;  4JC0 A;  2KOL A;  3EFX D;  1W6K A;  3S24 A;  3B6Y A;  3OMG A;  4GKJ L;  2IY5 B;  4A93 G;  1BOS A;  4JI2 Q;  4DN4 M;  4GS3 A;  3HOX G;  4Y52 H;  2EPB A;  2NTT A;  3ZJY C;  1LAB A;  1H9M A;  2WV6 D;  4GN4 B;  4MHE A;  2UUB Q;  2Q8R E;  1RD9 D;  1RIP A;  2OTL A;  2DUD A;  2MO1 A;  5FLX c;  1ET6 A;  3BS1 A;  2K5Q A;  5C44 H;  3I7F A;  1IYU A;  5AJ3 Q;  4DV5 L;  3SK4 A;  3JAM c;  1GUO A;  3V05 A;  5D3D A;  1LAC A;  1YIJ A;  1Z9F A;  3HS0 C;  4JI5 Q;  1FYC A;  3NK9 A;  1G51 A;  4R9W A;  1L1O C;  4A3M H;  1F2L A;  3TP5 A;  1F2Y A;  2H4O A;  2Z6K C;  3Q22 A;  1TY0 A;  3P7J A;  4JBW A;  2ALY B;  3HOV B;  3BVG A;  2NVQ H;  3VR5 A;  3OIQ A;  2I0Q A;  2EYH A;  4PG3 A;  2UUC Q;  4UP9 A;  1L1O B;  5C5M A;  3EIV A;  3M4O B;  3E6Z X;  2E5L Q;  2QIL A;  2HQE A;  4R4O A;  1CHP D;  2WAQ E;  4O42 A;  1SXT A;  3V2T A;  4A3G B;  2R92 B;  4QY7 A;  2EJF C;  1PH8 A;  1B9M A;  1Y8N B;  4JCV E;  1TWG B;  4HJ5 A;  4DAY A;  3C2P A;  3NPP A;  1Q3L A;  4ZAI A;  1B3Q A;  4GNX A;  1QUQ B;  3N6R A;  1JE5 A;  3M4O H;  1VQD A;  4NXN Q;  1HUN A;  2B2U A;  2EYL A;  2SNM A;  2CW0 C;  3R3O A;  2UXD L;  5AFW A;  1ZKO A;  1NNX A;  1QE6 A;  1G2S A;  1EIH A;  1V1P B;  3GTM B;  2K52 A;  1GD7 A;  2PMZ B;  5M3F H;  3K80 C;  3GTO B;  2A68 D;  4HJ8 A;  3CXC A;  4A3F G;  5EAY A;  1PRT F;  2IHE A;  3T13 A;  4HN7 A;  1VQF A;  1PVO A;  1EOV A;  3LX0 A;  4JI4 Q;  3S14 H;  2WIN B;  4PMC A;  1U9R A;  3PGZ A;  2ID0 A;  2WKC A;  1TWA B;  1HR0 L;  1G6Z A;  2VQE L;  2AQ3 B;  2X6L A;  4AH6 A;  3FHW A;  1EU4 A;  2NVT B;  2HCI A;  3NBI A;  2DJF C;  4B9X A;  1I4R A;  1MGS A;  4C1N I;  3J7Y W;  3KYH C;  1U5K A;  1UAP A;  2KHJ A;  1CA5 A;  5KRU A;  4A93 H;  5J3B A;  1N32 L;  2B2W C;  3K6O A;  1A0I A;  2PYK A;  4X66 L;  4PNY A;  2KCN A;  3E5S A;  4YWM A;  3J80 i;  2HCC A;  1YHA A;  2MHV A;  3W5O A;  2B63 G;  2I07 B;  3KF6 B;  1SJH D;  1Y8O B;  4DV3 L;  1XYI A;  2JYO A;  5BN4 A;  1D7Q A;  4O2D A;  1CQV A;  1SMY D;  2F0T A;  3PO2 B;  4C56 C;  1WTR A;  4HIO A;  2I5H A;  1XPR A;  4BY7 H;  4K0K L;  2VL6 A;  4C2M B;  4KK7 A;  3FVQ A;  2PCF B;  4YIJ A;  1MSH A;  5C4X H;  4K8J A;  3S9W A;  1F77 A;  3MXG A;  2XTI A;  4DKA C;  1DZ1 A;  3T56 B;  4ID6 A;  1A6X A;  1Y1W G;  3QO2 A;  4ME5 A;  2YTY A;  4DR4 Q;  4GOP A;  2PMZ E;  1J9O A;  3I90 A;  2XN9 C;  2R7D A;  5M5W B;  1TQO A;  3NUC A;  2UU9 L;  1XMO Q;  1HRJ A;  4DR1 L;  4RCO A;  3KDF A;  3LWU A;  4A3I G;  2RF4 A;  4QMG A;  2JEA I;  4PZ6 A;  3T53 B;  4DV1 Q;  1AE2 A;  1VQ4 A;  2R92 G;  2ZXR A;  3I4M H;  1AN8 A;  4B3R L;  1CHQ D;  3BDC A;  4P73 A;  1AEX A;  3E3X A;  1GVP A;  4DUZ L;  3GTO H;  2VXW A;  3UDX A;  1KNE A;  1RJT A;  5E3F A;  2F3V A;  1WTQ A;  3IFD A;  2WII B;  1V43 A;  1VQH A;  1WTV A;  4BS9 A;  2XGT A;  2YTV A;  3TN2 A;  1HNW Q;  3A7A B;  2KBN A;  5LMN L;  4H0L C;  3J7Z C;  3UE1 A;  3C3L A;  2EJM A;  2K03 A;  4A3F H;  3NTH A;  1JMC A;  1XNR Q;  1SYB A;  4H02 A;  3K5L A;  1FGB D;  3CQZ B;  3M85 A;  1PH7 A;  2L4N A;  4X66 Q;  2OQ0 A;  3K58 A;  5CV4 A;  4LFA Q;  5JEA H;  1HPC A;  3S1R H;  3AU7 A;  1FNU A;  1X54 A;  1VQA A;  2E2H B;  1PTO C;  2J4X A;  4X3T A;  2CWA A;  5G3L F;  3ULJ A;  4U68 A;  5EBD A;  1T9H A;  4CKE A;  3L9A X;  4WOR A;  2L1B A;  2VW9 A;  1VQN A;  1BKB A;  5K36 H;  1CTM A;  2G9D A;  2XRQ D;  3D0F A;  2QKI C;  4JI8 Q;  4GN5 A;  3TRE A;  1Y69 U;  4UAI A;  4LF8 L;  1AFP A;  3NQI A;  2ZM6 L;  4C3I H;  4C3H G;  4CDD C;  3VR6 A;  1TVX A;  1OXV A;  1HNW L;  4A3E H;  4L5R C;  4CDC C;  4KJN A;  1VQG A;  3RLO A;  1R4P B;  5KND A;  3H0G B;  2JA8 H;  3BU2 A;  5ELE A;  2VS1 A;  4IUQ A;  3OHX C;  1RHP A;  3U4V A;  1KAB A;  1HTP A;  3CCQ A;  4GNX B;  1VQB A;  3HRZ C;  5KGU A;  3SE0 A;  4A3L H;  1PYS B;  5M9O A;  1Q86 C;  4NPS A;  1PHJ A;  1WYD A;  5C5L A;  5K5P A;  5HGQ A;  4A3G G;  2I5L X;  1SNM A;  4LFC L;  4DAM A;  2Q2U A;  3HOZ G;  2PI2 A;  1U4L A;  1SSO A;  4O0A A;  4ZUI A;  3S1Q B;  1M90 C;  1S5E D;  1FL0 A;  1DD2 A;  1GOZ A;  1EZ8 A;  5C4X G;  2ZXO A;  4A3J B;  4PMB A;  2RSO A;  1L0X B;  3L7Z C;  1FR3 A;  3BYT B;  5CV6 A;  4LF5 Q;  5GAH C;  1TR5 A;  4LF5 L;  2F0E A;  3CHB D;  4IUV A;  4POF A;  5HUR A;  5A35 A;  4WJ3 M;  2SEB D;  2M9V A;  2A6H C;  4A3E B;  4YCW A;  4ALP A;  2C35 B;  3OIP A;  3VA5 A;  2BH2 A;  2F0L A;  1GO3 E;  5JEA J;  3VYR A;  5C3X A;  1QB5 D;  1M1K C;  1CQF A;  2RBM A;  1SMX A;  1B70 B;  3DLL A;  5IP7 G;  3U58 A;  3S16 B;  4BY1 G;  4C3J B;  1HQM C;  3SVM A;  4JYA L;  3T4A C;  3TEH B;  2B3G A;  3CMA A;  5C0X G;  3WOF A;  5FO7 B;  3ERO A;  3M3Y H;  1SRO A;  2A6E D;  4R8N A;  1M8A A;  3G6J B;  3J7A 5;  1T5X D;  2VUM B;  2IPK D;  2AWN A;  3CCS A;  4X3S A;  3H3V I;  1B3A A;  3BZK A;  5J39 A;  1TWH H;  1JQY D;  4X64 Q;  4A93 B;  4J1M A;  3EVQ A;  1KD1 C;  1ICF B;  4DV2 Q;  1Q46 A;  3WOE A;  5G3L D;  1SNO A;  4A3D G;  1CKM A;  2VB2 X;  1S5B D;  3PUY A;  1VF5 C;  1XMQ L;  1IYJ B;  2VUM H;  5CV9 A;  4A3B H;  5CV8 A;  1DYQ A;  4MN3 A;  3QR8 A;  5EPJ A;  1EZ6 A;  4B3T L;  3ICE A;  1E0B A;  3BDO A;  3H3V C;  2WAC A;  1N36 L;  5CR3 A;  1K83 H;  1TWF H;  4NW2 A;  4Q5V A;  1KDB A;  1SNC A;  1CKN A;  3F8T A;  5IYB G;  4CDE C;  4LF7 Q;  5IP9 H;  4WJ4 A;  1JJC B;  3RN5 A;  2JA6 H;  1NR2 A;  4LFC Q;  4DV7 Q;  3H91 A;  3D8G A;  2NWG A;  4MTK A;  5IT9 c;  1K3B C;  4IUU A;  5IIF A;  2OT2 A;  2VB3 X;  2KJX A;  2EIF A;  1X65 A;  2KHS A;  4DV2 L;  4A3K B;  1O7Y A;  1JOO A;  4TSS A;  1OTC A;  2MUY A;  4X64 L;  4BA2 I;  2BA1 A;  3U50 C;  2CVR A;  1UE1 A;  1Y1W B;  4JV5 Q;  2D9U A;  4DV4 L;  1S5F D;  2PO4 A;  3J80 c;  2MGS A;  2NYZ D;  1B7Y B;  4BBR B;  3I3C A;  2B2Y C;  4LUV A;  3KLS X;  4R4T A;  3RD4 A;  3W2D A;  3VA7 A;  1PZJ D;  1ILP A;  3DXJ C;  1CKO A;  2OF1 A;  2PI2 E;  4JYA Q;  2WFW A;  1NE3 A;  3PQI A;  3PO3 H;  1IL8 A;  4RKB A;  2A6H D;  3OOC A;  3W1G A;  5KYL A;  2RCN A;  4XIG S;  4A3D B;  1MD2 D;  3MEF A;  3KF8 A;  4QF4 A;  4XXE A;  1QJO A;  4LNQ A;  5CMD A;  3A0J A;  1A63 A;  3MFY A;  3C46 A;  4JI6 L;  2JA7 H;  3OMC A;  4DF7 A;  4CJ1 B;  1NR4 A;  4LW1 A;  2PW7 A;  1PH1 A;  1J6Q A;  3M7G A;  3ERS X;  3S2D H;  1SE2 A;  1UUP A;  2ICE C;  4C1N K;  5IOD A;  4BBS B;  1SNQ A;  2B63 H;  3HOZ B;  1BR9 A;  3BZD B;  3MC0 B;  4DXF A;  4B3M Q;  1HA5 A;  1E2Z A;  1EYA A;  4HMJ A;  1Y1V B;  1DGS A;  4L5S A;  4OIJ A;  3I55 A;  5C0X H;  3DM3 A;  4A3M G;  2OTJ A;  3P20 A;  2CH4 W;  4CKB A;  1GUW A;  3KK7 A;  4G7O C;  3S2D B;  2NUC A;  2EJG C;  1DCZ A;  3FP9 A;  3UDF A;  4BBR H;  2B2U C;  2JA7 G;  1SYD A;  1BNZ A;  5DEH A;  4S3S A;  1FD7 D;  3OTO Q;  1SR3 A;  5FK9 C;  4FF2 A;  5F2D A;  4A3D H;  3RLN A;  3TSS A;  3NBH A;  1SYF A;  4R1J A;  2IL8 A;  1D5M C;  5ELN A;  5C3E H;  2KEE A;  5FOB B;  4DV1 L;  2PQA B;  1D2B A;  2R61 A;  4DXG A;  3EN2 A; 
#chains in the Genus database with same CATH homology
 2QA4 A;  1PH8 A;  4JI3 Q;  1L2F A;  1X55 A;  4JCV E;  4YCU A;  3AEV A;  4LF8 Q;  4HJ5 A;  4OXP A;  1IBK L;  2UU9 Q;  3HOY G;  1IXR A;  4RG1 A;  4JV5 L;  3KOJ A;  4GNX A;  1QUQ B;  5ELO A;  5GRO A;  4DR2 Q;  1EWI A;  1WOC A;  1JE5 A;  3AFQ A;  3M4O H;  4NXM L;  2HT1 A;  1VQD A;  4NXN Q;  3WWV A;  1HR0 W;  1FVI A;  2LXK A;  4A3L G;  2R7F A;  4IPC A;  2VNU D;  1K73 C;  1HZ9 A;  2KCM A;  5DLQ E;  4XTC S;  4HID A;  2CKZ B;  2UXD L;  3M4Q A;  4JBK A;  3HOV H;  1C9O A;  1VQK A;  3CC2 A;  1OXU A;  1VQJ A;  4IFD I;  4YWL A;  4C3H H;  3NEL A;  4JI7 L;  4ME3 A;  4PZ8 A;  4DV7 L;  2K52 A;  2D0P A;  1GD7 A;  2ZTC A;  1I94 L;  3UE0 A;  5M3F H;  2UXB L;  1Z47 A;  3K80 C;  1BVS A;  4A3I H;  1E24 A;  2JA5 H;  1HNZ L;  3CCR A;  2ZTD A;  1FGU A;  2A19 A;  4HJ8 A;  3CXC A;  4A3F G;  5EAY A;  2IHE A;  3I4M G;  1X9N A;  2R93 G;  3RR5 A;  3Q8D A;  1VQF A;  1V9P A;  3STB C;  1K9M C;  1EOV A;  3S14 H;  4JI4 Q;  5M5X H;  1NJI C;  1PVO A;  1VQ5 A;  4B3T Q;  3RNU A;  3PGZ A;  2GVA A;  2ID0 A;  1NMG A;  5HY6 A;  2Q2H A;  1HR0 L;  2VQE L;  2AHO B;  4AH6 A;  2NVX H;  3FHW A;  2I5M X;  1HJP A;  3UDI A;  4X65 Q;  2VQF Q;  1MJE A;  2N3S A;  1SRU A;  4IPH A;  3PUZ A;  1BBU A;  2YV5 A;  4NXN L;  2WAQ G;  3RN2 A;  4BBS H;  1XPU A;  3GTK H;  4C3J H;  3I4N H;  3KYH C;  1U5K A;  2KHJ A;  4TVA B;  4GLX A;  1C0A A;  4A93 H;  5J3B A;  1N32 L;  1BBW A;  1NMF A;  3S1M H;  1A0I A;  4LFA L;  1NY4 A;  1Y1V H;  5C4J H;  2MO0 A;  4LWC A;  3RZD H;  3BZC A;  3GTM H;  3HOW H;  1VQ9 A;  1MJC A;  4X66 L;  3G4S A;  2IX1 A;  4DR7 Q;  3AYH B;  4DV5 Q;  4DR1 Q;  5IWA Q;  4DV0 Q;  1JB7 A;  4BXX H;  1VCI A;  1UE5 A;  2WB1 G;  4IJL A;  4YWM A;  3J80 i;  3G71 A;  1X3E A;  5M5Y H;  1SE8 A;  5LMN W;  1YHA A;  4OO1 G;  3W5O A;  2VY3 A;  2B63 G;  3ULL A;  3OW2 A;  3KF6 B;  1S72 A;  4DR4 L;  2VQE Q;  2UUB L;  1OXT A;  4DV3 L;  4HIM A;  1EQR A;  3NEM A;  2HQL A;  4DR3 L;  2UUC L;  3HFZ B;  4JI3 L;  4EX5 A;  1PH6 A;  1D7Q A;  3SGI A;  4O2D A;  4JI4 L;  1XPO A;  1X3F A;  1Y14 B;  4JI6 Q;  3G6E A;  1W3S A;  2ZJQ A;  3H3V H;  4IFD G;  1SN8 A;  3CCU A;  2JEB I;  2PNH A;  5GAD C;  4HIO A;  4A3J G;  4LF9 Q;  3BJU A;  2I5H A;  1XPR A;  4BY7 H;  1PH4 A;  4DV6 L;  2BA0 A;  3AQQ A;  2HIV A;  3PF4 A;  4K0K L;  2VL6 A;  3FKI G;  3K8A A;  5C0X J;  1MKH A;  4DAY B;  3RZO H;  2B29 A;  4DR6 Q;  3HOU H;  1UE7 A;  2EQS A;  4EQ5 A;  4YHH Q;  5C4X H;  4LUO A;  1S3O A;  3PUW A;  4GN3 B;  4TQU S;  4P75 A;  4R4Q A;  4BY7 G;  1CKN B;  2NVY H;  2V1C C;  1UWV A;  4LUZ A;  1Y1W H;  2XTI A;  3PO2 G;  4DK3 C;  1QZH A;  1K0R A;  4DKA C;  2RHQ B;  1Q81 C;  3CME A;  2D0O A;  4DV3 Q;  1Y1W G;  3PO2 H;  5IY0 A;  2E8G A;  3NBH B;  1V1Q A;  2YTY A;  4NXM Q;  1AH9 A;  4RMF A;  3UDG A;  4DR4 Q;  4GOP A;  2ZTE A;  2PMZ E;  2K5N A;  1PH2 A;  1CSQ A;  2YTX A;  2R7D A;  4A3K H;  4KLK A;  1IBK Q;  2KHI A;  2UU9 L;  1XMO Q;  4DV0 L;  1VQC A;  3VDY A;  4DR1 L;  4GOP B;  1WCM G;  4A3I G;  3KDF A;  2F52 A;  2Z6K A;  5IYC G;  1FJG L;  1WI5 A;  4QIW E;  2RF4 A;  2JEA I;  4IFD J;  3KLW A;  4AQY L;  2EXD A;  4PZ6 A;  1EYG A;  1N33 L;  1VQ4 A;  4DV1 Q;  1AE2 A;  1YVC A;  2R92 G;  1YEZ A;  4QL5 A;  3STB D;  3I4M H;  4B3R L;  1AE3 A;  4P73 A;  3I2Z A;  5GAG C;  2JA8 G;  3CW2 C;  1GVP A;  5FJ8 G;  5C3E G;  4A3G H;  1KXL A;  3T1Y Q;  2A1A A;  4DUZ L;  1VQL A;  3GTO H;  2FXQ A;  4OON A;  1HZA A;  2E5L L;  3HOU G;  2KCT A;  3UDX A;  4K0K Q;  4KHZ A;  1W2B A;  3FKI H;  4LF7 L;  2K14 A;  4A3E G;  3KF8 B;  4UY8 C;  1VS0 A;  1V43 A;  3CCM A;  3KFU A;  1EUJ A;  1VQH A;  4HIK A;  1MIU A;  3CF5 A;  1N36 Q;  1KIX A;  4KI0 A;  3HKZ E;  2XGT A;  2HHH L;  1X3G A;  2YTV A;  2Z0S A;  4GKJ Q;  4YY3 Q;  1HNW Q;  3CCE A;  5LMN L;  2KBN A;  1S40 A;  3F2C A;  3HOW G;  4MNO A;  4NB3 A;  3J7Z C;  1TWC H;  4UP8 A;  3UE1 A;  2QGQ A;  3T1H Q;  4X62 L;  2JA9 A;  2Q2T A;  4A3F H;  4IJH A;  1ASZ A;  2GN5 A;  1JMC A;  1XNR Q;  1A62 A;  4H02 A;  5LMU Q;  3GO5 A;  1LM0 A;  1N8R C;  3M85 A;  1PH7 A;  2NZO A;  4JI1 L;  4X66 Q;  3CPW A;  2OQ0 A;  4JI0 Q;  3KJP A;  1HZC A;  1KRS A;  2JE6 I;  3PSI A;  4LFA Q;  1U0L A;  3S1R H;  2ZJP A;  3CC7 A;  4LFB L;  5AJ3 L;  2A8V A;  1X54 A;  1VQA A;  4IO9 A;  5FJ8 H;  2CWA A;  1GM5 A;  3GDE A;  3L0O A;  3ULJ A;  4A75 A;  4P74 A;  1T9H A;  1IBM Q;  3OYY A;  2VW9 A;  1VQN A;  4BBS G;  1BKB A;  2R6G A;  2NVT H;  3TQY A;  3D0F A;  2BH8 A;  4X6A H;  1I3Q H;  2VQF L;  4X65 L;  1I5F A;  3I4N G;  1LUZ A;  4JI8 Q;  4GN5 A;  3CD6 A;  3J81 j;  1KRT A;  1HH2 P;  1KQS A;  2H5X A;  3TRE A;  3CAM A;  4LF8 L;  4QQB X;  1E1O A;  3H0G G;  5M3M H;  3PUV A;  1HNX L;  2ZM6 L;  1XTD A;  1B8A A;  2ASB A;  5JJL A;  3PUX A;  4C3I H;  1KL9 A;  1XMQ Q;  1KHI A;  3TRZ A;  1OXV A;  4YY3 L;  3H0G H;  4L5T A;  5M3M G;  4A3E H;  2UUA Q;  4L5R C;  3PO3 G;  1HNW L;  1HNZ Q;  2NN6 G;  2Y0S E;  3CQZ H;  1VQG A;  1N9W A;  3RLO A;  3HKZ G;  1D8L A;  5IE8 A;  4JI8 L;  5M3F G;  4GKK Q;  1WJJ A;  5BR8 L;  1C7Y A;  2JA8 H;  1YHB A;  3BU2 A;  2VS1 A;  4OWT B;  4LF6 L;  2HIX A;  4JBJ A;  3PIO A;  3CCJ A;  1EIF A;  3S1Q H;  2UXD Q;  3U4V A;  1XNQ Q;  3CCL A;  3CCQ A;  1HZB A;  4GNX B;  1H95 A;  1YJ9 A;  1YIT A;  1EQQ A;  1VQB A;  4KHP L;  3CPF A;  1VQM A;  1UE6 A;  2YYZ A;  1VQ8 A;  3TS0 A;  1Q82 C;  4LF4 Q;  4AIM A;  3E9H A;  2CWP A;  4GNX C;  1PYS B;  1IBL L;  4DR2 L;  3S16 H;  4A3L H;  3EBE A;  5IP9 G;  1Q86 C;  4NPS A;  1K8G A;  1PHJ A;  1WYD A;  4C2M H;  4JI5 L;  2F3I A;  5HGQ A;  5IYB H;  4A3G G;  4BXX G;  2I5L X;  4OWW B;  4JOI A;  2K50 A;  2IHF A;  2N8N A;  4IOA A;  2CFM A;  4LFC L;  1TXY A;  3RLF A;  4DAM A;  2Q2U A;  3HOZ G;  2PI2 A;  3S2H H;  4UP7 A;  2OCE A;  4O0A A;  4BA1 I;  4DNI A;  1M90 C;  1FL0 A;  2JK8 A;  3D31 A;  5LMN Q;  2K75 A;  5C4X G;  5C44 G;  4HJ9 A;  1XNQ L;  3L7Z C;  2JJQ A;  1JJG A;  4LF5 Q;  2D62 A;  1A8V A;  5M5W H;  3F2B A;  2AWO A;  5GAH C;  4LF5 L;  5BR8 Q;  2UXC L;  4POF A;  1PH5 A;  4WJ3 M;  4JI2 L;  4HJ7 A;  4DUZ Q;  2E2J H;  1CSP A;  3J81 i;  4YCW A;  4ALP A;  2C35 B;  2BH2 A;  3A74 A;  1GO3 E;  2WP8 J;  5JEA J;  4GLV B;  2MNA A;  4LF9 L;  3GTG H;  1M1K C;  4AQY Q;  2N49 A;  2R93 H;  1YNX A;  1JJ2 A;  1SMX A;  1N34 L;  1B70 B;  4B3S L;  5IYC H;  3DLL A;  5IP7 G;  3U58 A;  1P8L A;  4BY1 G;  4JYA L;  1VQ7 A;  1I6H H;  4A3C G;  3TEH B;  2LXJ A;  2IX0 A;  2B3G A;  3CMA A;  5C0X G;  3GTL H;  1CUK A;  1KAW A;  1QVC A;  4DUY L;  4Y7N H;  3M3Y H;  3ULP A;  1SRO A;  4LF4 L;  1Y1V G;  4DPG A;  3J7A 5;  1PV4 A;  4YWK A;  5GQO A;  4IPG A;  1OXX K;  4DV4 Q;  1VQP A;  2AWN A;  4B3M L;  3CCS A;  3H3V I;  2NN6 I;  2ZJR A;  3BZK A;  4AYB G;  1TWH H;  3KF6 A;  3MXN B;  2E2I H;  3GTQ H;  4X64 Q;  4UPA A;  4LFB Q;  1RL2 A;  2CCZ A;  5IYD H;  3A5Z B;  4GLA C;  4JG2 A;  1KD1 C;  2K5V A;  1KC8 C;  3S17 H;  1L1O A;  4JI1 Q;  1YJN A;  1IBL Q;  4DR6 L;  5FLM G;  4DV2 Q;  4DR5 Q;  1PYB A;  1Q46 A;  4GKK L;  1EFW A;  1K3R A;  3HOY H;  4A3D G;  4A3K G;  5C0X I;  5LMU L;  3GTJ H;  1CKM A;  2UUA L;  4P71 A;  3GTP H;  4APV A;  3PUY A;  2QEX A;  3HOX H;  3M9B A;  2R92 H;  1XMQ L;  1YJW A;  1IYJ B;  2YU9 H;  3G48 A;  3T1H L;  1SLJ A;  2PQA A;  4MZ9 A;  1I50 H;  1YBY A;  2VUM H;  4A3B H;  2UXC Q;  1NTG A;  1LTL A;  2ZM6 Q;  4OX9 Q;  2JQO A;  1HNX Q;  2Y0S G;  3E9I A;  4B3T L;  3ICE A;  1E1T A;  3PIP A;  3HOZ H;  1QZG A;  2LSS A;  4AYB E;  1N36 L;  3CC4 A;  1K83 H;  1TWF H;  2Q2I A;  4A76 A;  2F4V Q;  2F4V L;  2R7Z H;  1CKN A;  3W1B A;  3F1Z A;  4DK6 C;  1PH3 A;  3F8T A;  4P72 A;  5IYB G;  4LF7 Q;  2K5H A;  5IP9 H;  5IWA L;  1G6P A;  4WJ4 A;  1JJC B;  1LYL A;  1X6O A;  2MFI A;  3RN5 A;  1E7Z A;  1VQE A;  3PCO B;  2JA6 H;  2N78 A;  4DR7 L;  3T1Y L;  4LFC Q;  4DV7 Q;  1J5E Q;  4JI7 Q;  5GAE C;  4QGU A;  2OWO A;  4QJF A;  1Q7Y C;  3U4Z A;  5IT9 c;  3CCV A;  1PH9 A;  4B3R Q;  2EIF A;  1Q1B A;  4OWX B;  3TS2 A;  3JAM i;  1X65 A;  4DV2 L;  4DR5 L;  2JA6 G;  3KDF B;  1YI2 A;  4JI0 L;  5FLM H;  2JA5 G;  1QVF A;  1Q8K A;  5E7N A;  2AMC B;  1XMO L;  1OTC A;  2VZA A;  4X64 L;  4BA2 I;  1XNR L;  2BA1 A;  2ATW A;  3U50 C;  1Q12 A;  3J81 c;  1J5E L;  4X62 Q;  1UE1 A;  4IPD A;  2RHS B;  4MTN A;  4YCV A;  1HR0 Q;  3M7N A;  4DV4 L;  4JV5 Q;  2GVB A;  3S15 H;  4LF6 Q;  1X56 A;  3K7A H;  3J80 c;  1R9T H;  4R4C A;  2VUM G;  1B7Y B;  1WCM H;  1JT8 A;  4LUV A;  4R4T A;  4A4I A;  2OQK A;  3AFP A;  2NZH A;  4FDB A;  3JC6 6;  1SFO H;  1CKO A;  1E22 A;  2CQO A;  3K0X A;  2PI2 E;  3NEN A;  4L5Q A;  3IRB A;  2WFW A;  3LGJ A;  4JYA Q;  4OO1 I;  1NE3 A;  3PO3 H;  1WFQ A;  1QVG A;  4OX9 L;  3W1G A;  5IP7 H;  3KJO A;  1OXS C;  1YZ6 A;  5H1S E;  2RCN A;  4XIG S;  2AKW B;  1I94 Q;  5IYD G;  1VQ6 A;  4A3B G;  5JJK A;  4JC0 A;  4JOI C;  1G29 1;  3MEF A;  3E0E A;  3OTO L;  3S24 A;  3B6Y A;  3K81 C;  1VQO A;  2WB1 E;  4GKJ L;  2IY5 B;  2E2H H;  4LNQ A;  1K8A C;  4A93 G;  4IOC A;  3A0J A;  3K7U C;  1A63 A;  3M4P A;  1IZ6 A;  2K4K A;  4JI2 Q;  4JI6 L;  2JA7 H;  3HKS A;  4GS3 A;  3HOX G;  4Y52 H;  1PFS A;  4LW1 A;  1L0W A;  3ZJY C;  1J6Q A;  1PH1 A;  1FJG Q;  3ERS X;  2UUB Q;  4GN4 B;  3S2D H;  1TWG H;  1IBM L;  1RIP A;  2OTL A;  4HJA A;  1IL2 A;  4A3J H;  2B63 H;  2DUD A;  2MO1 A;  5FLX c;  1ASY A;  4B3M Q;  5C44 H;  1YHQ A;  3I7F A;  5AJ3 Q;  4POG A;  4DV5 L;  3JAM c;  1N33 Q;  5JEA G;  1GKH A;  1DGS A;  4DUY Q;  1Q1E A;  2DGY A;  4L5S A;  4PMW A;  3I55 A;  3DM3 A;  3CP0 A;  4A3M G;  1VQI A;  1Z9F A;  1YIJ A;  1XJV A;  3PF5 A;  2OTJ A;  1N32 Q;  4JI5 Q;  2KEN A;  4A3C H;  4GOP C;  1G51 A;  1O7I A;  1L1O C;  4A3M H;  1N34 Q;  1EIY B;  4B3S Q;  2R7Z G;  3PV0 A;  5K36 G;  4R4I A;  3GD7 A;  1TWA H;  3FP9 A;  3UDF A;  4BBR H;  4KHP Q;  2Z6K C;  2L15 A;  2HHH Q;  3HOV G;  4JBW A;  1NBW A;  4PZ7 A;  2JA7 G;  2ALY B;  3I56 A;  3F2D A;  2NVQ H;  1PA6 A;  1E3P A;  3H15 A;  2I0Q A;  1P16 A;  3OTO Q;  3ER0 A;  4PG3 A;  4BBR G;  4DR3 Q;  1SR3 A;  4UP9 A;  3L2P A;  2UUC Q;  1L1O B;  4YHH L;  4A3D H;  3RLN A;  3EIV A;  2E5L Q;  4JBM A;  4R1J A;  4R4O A;  2ES2 A;  5ELN A;  3S1N H;  4DV6 Q;  3I4O A;  5C3E H;  4J15 A;  4BY1 H;  5JJI A;  2WAQ E;  2PQA B;  2MQH A;  1UEB A;  4DV1 L;  2UXB Q;  2IT1 A;  3A5U A;  4QY7 A;  1QUQ A;  3EN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...