4X65L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65L00
1IYJB 1DGSA 2WP8J 1MKHA 2GVAA 3S1RH 1EYGA 3HOZG 4J15A 1N8RC 2R7ZG 3UE1A 1K3RA 3CMAA 2VUMG 4BY1H 3J80c 4PZ8A 2R93H 2HHHL 2K5HA 1IBML 3E9IA 4A3LH 1VQCA 3BJUA 4C3HH 1VQIA 5EAYA 2VUMH 1FL0A 4JI3Q 4QL5A 2UXBQ 4JC0A 4OWTB 1I6HH 5HGQA 3J80i 1VQPA 4P72A 4B3TQ 4MZ9A 1OXVA 4JBJA 1TXYA 1YIJA 2NN6G 3F2BA 1N36L 3KFUA 1EQQA 3M4OH 3ULJA 3RLOA 5M3MG 3I4NH 1SROA 1ASZA 4OO1G 1VQBA 1IBMQ 4WJ3M 1Q7YC 1HNZQ 3D0FA 4L5RC 1XNQL 1BKBA 2VL6A 4YWMA 5IY0A 3I56A 3U50C 3OTOL 4TQUS 1EQRA 2KHIA 3HOXG 4DV1Q 3GTGH 2V1CC 2RHSB 5IP7H 3J81i 1M1KC 4GLXA 1JMCA 4XTCS 5C0XG 1JE5A 4X66L 1PVOA 2E2JH 4NXML 5C4JH 2RCNA 3GD7A 2C35B 2MFIA 5IP7G 1GD7A 1YJ9A 2ZM6L 3GTOH 4B3RL 4GN3B 1XMQQ 1EUJA 2Y0SG 1HZCA 3FKIH 1FGUA 1OXUA 2XTIA 4C3JH 4OONA 4DV5Q 2I0QA 4GOPA 1HNXL 3M7NA 3AFPA 4BY7H 4P73A 4JYAL 1PH2A 1E22A 2HIXA 2VS1A 1VQJA 2YTVA 2YYZA 3G6EA 3J7A5 4DV7L 2B3GA 4POGA 5HY6A 1QZHA 4NB3A 5IYCG 4LF4Q 2RF4A 3CMEA 3S14H 1TWHH 1YBYA 2D62A 1A62A 5C44G 3W5OA 4Y7NH 1WI5A 4FDBA 2WB1E 3KJPA 4HJ5A 4PZ7A 1X65A 2CKZB 1OXXK 2ID0A 4P75A 4OWXB 1VQLA 1HZ9A 3W1BA 4MTNA 1XMOL 3PF4A 2NZHA 1I5FA 2XGTA 2VZAA 4KHPL 5ELOA 3CC7A 2JK8A 4A3FG 3M85A 4YCUA 2R7ZH 2N78A 3TS0A 4DR6Q 1Y1VG 4X62L 4GNXB 1Y14B 4LF6L 4DR5L 1VQNA 2F4VL 3RR5A 1XMOQ 4BY1G 4DUYL 4A3IH 4JI4L 2UXCL 1Q8KA 2CWAA 1AH9A 2K4KA 3KF6A 4OXPA 1X55A 2IHFA 3S1NH 4GKJL 1HZAA 3MEFA 1XMQL 4EX5A 3GTJH 2OTLA 4LUOA 2ZM6Q 1G6PA 4HJAA 2R92H 3RZOH 3S15H 4DV6L 1SRUA 4YHHQ 2QEXA 3PUXA 2Q2IA 1TWAH 3DLLA 3ULLA 3T1HL 4A3IG 1KIXA 1IBLQ 1FJGQ 3H3VH 5M5WH 1B70B 4LUZA 4GS3A 1KRTA 3CC2A 4B3SL 1N34Q 1L1OA 3H0GG 3TQYA 3ZJYC 1YEZA 3B6YA 3KJOA 3PUYA 2EIFA 5GAGC 4DNIA 5M5YH 1Y1WH 1X3GA 4JI0L 3G48A 3S1QH 1VQHA 4APVA 1YHQA 1GKHA 3JC66 3CW2C 1X54A 2N8NA 3H0GH 4IPHA 3J7ZC 1GO3E 1P16A 4H02A 1CKMA 4HIMA 3GTLH 2L15A 4X66Q 3FHWA 2VW9A 4B3SQ 5LMNQ 1N33Q 1J5EQ 5IP9H 2UUAQ 1IZ6A 1TWFH 4C2MH 1BBUA 4JOIC 3VDYA 1BVSA 1NY4A 4AQYL 4IFDJ 3U4ZA 5BR8Q 4JBWA 2F4VQ 1VQFA 4L5QA 4JI1Q 5IWAL 4GOPB 4DV3Q 2UXDL 3PO2G 1QVFA 1MIUA 3AEVA 4A3GH 3OW2A 1L1OB 2NZOA 4XIGS 1K73C 1TWCH 4JI1L 4R1JA 4JV5L 5IYCH 4A93H 3PO2H 3STBC 1CSPA 4AQYQ 2H5XA 2PQAB 1PYBA 4JI3L 4A3GG 5IYBH 2JJQA 1TWGH 5IWAQ 3PUZA 4KHPQ 2HQLA 3E9HA 1N9WA 5GQOA 3BZKA 4DV0L 3RN5A 1N36Q 4OX9L 4LF7Q 1JJGA 3EIVA 3NBHB 4B3ML 2Z6KA 5IYBG 4BBSH 2BH8A 4LWCA 5C4XH 5E7NA 4R4CA 2YTYA 1P8LA 4HJ7A 3BZCA 4JI6L 4LFAL 2R7DA 3PGZA 1E24A 4TVAB 4HJ8A 4R4TA 4RG1A 2AHOB 1I94L 4BA2I 1X6OA 3CXCA 3RLFA 3ICEA 3GTPH 4JI5L 1KD1C 2PI2E 4JBKA 4JI8Q 3RN2A 3KF8B 4NXMQ 1HJPA 1QVCA 2QGQA 3HOYG 4O0AA 3PIOA 1PH1A 4DAYB 1CKNA 2JA6H 3L7ZC 2VQFL 1Q1BA 1HZBA 4LW1A 2RHQB 4A3FH 3GO5A 3KOJA 4DUZL 3CCMA 4B3RQ 4AH6A 4YCWA 1V9PA 4GOPC 1JJ2A 4IPDA 2JA8H 5AJ3L 1A63A 2OQ0A 1VQ7A 4HJ9A 4JI4Q 2E8GA 1K83H 2JA5G 3HOUG 1LYLA 2JA7G 3T1YL 2F52A 2WB1G 3GTMH 3K7UC 3L0OA 3Q8DA 3HOVH 2UU9Q 5GROA 2JA8G 4OX9Q 1IXRA 2R93G 4UP7A 4K0KQ 4AIMA 4YWLA 1W2BA 1VQGA 3S24A 2MQHA 2AWNA 2Q2HA 3M4PA 3DM3A 1KRSA 5C0XJ 4DR2Q 2YU9H 3JAMi 2NVTH 1N33L 3CP0A 4O2DA 3UE0A 1QVGA 4LF9L 4IJLA 1CKNB 4AYBE 2NVYH 5FJ8H 2K52A 3KYHC 1Y1WG 2A8VA 4JI7Q 1VQDA 4JI5Q 2IHEA 1LM0A 1YI2A 2AWOA 1NMGA 2IT1A 4DUYQ 4DR5Q 2ZJQA 4JYAQ 5FJ8G 1E1OA 2VNUD 4HIKA 3G4SA 1HNWQ 3UDGA 3I4MG 5JEAG 1HR0W 2OQKA 2VQFQ 3U4VA 4A93G 4ME3A 2JE6I 1J6QA 1KL9A 3BU2A 2PMZE 1EIFA 1LUZA 1K0RA 3K8AA 5LMNW 1SMXA 1U5KA 3UDXA 1PYSB 2NN6I 4HIDA 4KHZA 3I4MH 4DR4Q 5C3EH 2YTXA 4GLAC 2KENA 5H1SE 1C9OA 3CCLA 5JEAJ 1EOVA 4B3TL 2EQSA 1YHAA 2I5LX 2CQOA 4BXXG 1AE3A 3CPFA 1NMFA 5DLQE 3UDFA 1JJCB 2KCTA 1PH8A 3M3YH 4NPSA 5LMUL 1VQEA 4LFCQ 1WOCA 3PUVA 5IYDG 4KLKA 1HNZL 1WFQA 4UPAA 2K50A 4DV2L 4DR7Q 1RIPA 3PV0A 4OWWB 1WYDA 2UUCQ 4QIWE 2PQAA 1OTCA 2R7FA 4JI2Q 2MNAA 2WAQE 4LF9Q 4X62Q 4X64Q 4BBSG 1XNQQ 4GKJQ 3RZDH 5M5XH 1UEBA 1VQ4A 3CPWA 3HFZB 3CCEA 2HT1A 2D0OA 3L2PA 4UP9A 3GTQH 1KXLA 4POFA 3CF5A 2Z6KC 1W3SA 2ZJPA 2B29A 2PNHA 2IX0A 3J81j 4LF4L 1XTDA 4R4QA 3S17H 3CCUA 3AQQA 2Y0SE 4A3EG 4A3DH 3CAMA 3W1GA 5JJLA 4L5SA 3FP9A 4AYBG 1VQOA 5GAEC 1JT8A 3HOVG 1HH2P 2BH2A 4DR6L 1C0AA 4A3DG 3CD6A 5IT9c 2GVBA 5J3BA 1PV4A 2UUBL 2JA6G 1Z47A 2KHJA 5IE8A 4A3CG 1S40A 2VQEL 2WAQG 4QY7A 1M90C 1L1OC 2NVXH 2E5LL 1ASYA 5C0XI 2R92G 4IJHA 3HOUH 4DV7Q 4A3CH 4YWKA 4DR1Q 4JBMA 5C4XG 1VQKA 1VQAA 1CSQA 1X3EA 4DR3L 1WJJA 2UUCL 1Z9FA 2UUBQ 3S1MH 3PIPA 1X3FA 5K36G 1SR3A 4BBRG 1I3QH 1XPOA 1JB7A 2OTJA 1VCIA 3I2ZA 3NEMA 4YCVA 2B63G 4LNQA 4KI0A 2K5VA 1X9NA 1YJNA 1BBWA 4DR4L 4IOAA 4BBRH 2KBNA 3PO3G 1VQ9A 4IPCA 1OXSC 1N34L 1D8LA 1X56A 2I5MX 1NTGA 1S3OA 3KLWA 4PMWA 2IX1A 3M9BA 4EQ5A 4GKKL 3PO3H 4A3BH 1MJEA 2K75A 3TS2A 1B7YB 3J81c 1K8AC 4P71A 5JJIA 4LFBL 3AFQA 4DV1L 4A3BG 1WCMG 4R4IA 2KCMA 3CCVA 5LMUQ 2JQOA 3AYHB 1PH9A 3GTKH 5IYDH 1UE6A 4BA1I 2N3SA 1N32L 2QA4A 1YVCA 1SN8A 4DR7L 2UU9L 1O7IA 5C3EG 3TEHB 1Q12A 2JA9A 4DV3L 2UXDQ 3TREA 1E3PA 2ZTDA 4NXNL 3F2CA 2K5NA 3PUWA 4GNXC 1G291 1KQSA 1VQ8A 2DGYA 4DUZQ 1YZ6A 1KAWA 3FKIG 1J5EL 3EBEA 1CKOA 4GLVB 4JCVE 1GM5A 1XNRL 1HNXQ 2ZTEA 2EXDA 1Q46A 4UP8A 2ALYB 2NVQH 2CFMA 3PF5A 3KDFB 4LUVA 4A3JG 3RLNA 4X65Q 4QGUA 1YNXA 2LSSA 3HKZG 3KDFA 4A3MG 2LXKA 1NE3A 4PG3A 2E5LQ 4A76A 1YHBA 2MO0A 5C44H 1NBWA 3I7FA 1HR0L 1FJGL 4ALPA 3S16H 1D7QA 2VQEQ 4A3JH 4JI8L 4MNOA 1YITA 3H3VI 1PA6A 1XNRQ 4DR3Q 3CQZH 4DV4Q 3ULPA 3WWVA 3HOYH 4A3EH 2K14A 2I5HA 1S72A 1I94Q 1HR0Q 2DUDA 3HKSA 1K8GA 3F8TA 3OYYA 5FLMG 4LF6Q 1L2FA 3HOWH 4B3MQ 5M3FG 4UY8C 4L5TA 2JA5H 4YY3L 4LF8L 2JA7H 3ERSX 3T1YQ 3TRZA 1PH6A 1IBKQ 3OTOQ 1I50H 3HOZH 2B63H 1C7YA 3CCSA 1IL2A 2JEAI 2MO1A 2D0PA 2A1AA 3HOWG 1V1QA 2IY5B 1GVPA 2Q2TA 1T9HA 2PI2A 2E2HH 1QZGA 1KHIA 2AMCB 1UE1A 2HIVA 1IBLL 3K80C 4DPGA 4JI2L 4A3LG 1A8VA 2WFWA 3K81C 4Y52H 2BA1A 2GN5A 1PH7A 3CCJA 1YJWA 1QUQA 3PSIA 1FVIA 3MXNB 4IPGA 1KC8C 4LF5L 4A4IA 3H15A 4DK6C 1OXTA 3ER0A 1PHJA 1N32Q 4X65L 4DV5L 1UE7A 1NJIC 1AE2A 1WCMH 3STBD 1EWIA 1E7ZA 2HHHQ 4X6AH 3M4QA 4IFDG 2ZJRA 3NENA 3PCOB 5ELNA 4JG2A 3A0JA 3GDEA 3CCQA 5BR8L 3F2DA 3CC4A 1SLJA 5AJ3Q 4GNXA 1K9MC 4LF5Q 4R4OA 3HOXH 4LF7L 1U0LA 5IP9G 1A0IA 4YHHL 3JAMc 2ES2A 1CUKA 1VQ5A 3LGJA 1H95A 1LTLA 2N49A 4QJFA 4DR1L 1HNWL 4DR2L 5FLXc 2FXQA 2CCZA 5M3MH 3I4NG 1VQ6A 2A19A 4LFAQ 4IOCA 2AKWB 1SFOH 3CCRA 4JI6Q 2ASBA 4QQBX 1IBKL 4BXXH 4GN4B 4C3IH 1Q82C 2JEBI 1PH3A 4GN5A 1EFWA 2E2IH 1PFSA 4DAMA 1Q81C 4IO9A 2UXCQ 1UWVA 2LXJA 3NELA 4RMFA 5GADC 4A3KH 4HIOA 4JI7L 1V43A 1E1TA 1SE8A 2BA0A 1VQMA 3T1HQ 2CWPA 3K0XA 3F1ZA 1Q1EA 3A5ZB 4DV4L 4JOIA 4A75A 4DV6Q 1EIYB 3S2DH 2ZTCA 4A3KG 3RNUA 4DV2Q 2Q2UA 4GKKQ 4DK3C 4PZ6A 2F3IA 4IFDI 1XJVA 4A3MH 2UXBL 4JV5Q 4X64L 3EN2A 3A5UA 5FLMH 4BY7G 1UE5A 1RL2A 3A74A 1MJCA 3S2HH 5M3FH 4K0KL 3I4OA 4YY3Q 4LF8Q 4WJ4A 1VS0A 3K7AH 4LFBQ 2YV5A 4DKAC 2ATWA 1L0WA 1B8AA 1PH5A 2Z0SA 4JI0Q 1Y1VH 4LFCL 1R9TH 3KF6B 3SGIA 1PH4A 2R6GA 5JJKA 3U58A 2OCEA 3G71A 4DV0Q 1QUQB 1G51A 4NXNQ 2UUAL 3I55A 3HKZE 5GAHC 2VY3A 1XPRA 3D31A 5LMNL 1Q86C 1XPUA 4OO1I 3IRBA 3UDIA 4P74A 2OWOA 3E0EA
chains in the Genus database with same CATH superfamily
3NP8A 1BCPB 1TY2A 2WP8J 4WRDA 2BDOA 4J15A 2R7ZG 3AMUA 3CMAA 1D5ZC 2R93H 2HHHL 4A3LH 3R93A 3BJUA 2NN6H 5EAYA 3K57A 2Z1CA 2JA8B 2VUMH 2NB0A 4JC0A 1I6HH 3N52A 3J80i 4PNYA 4JBJA 1TXYA 3M4OH 1Q3LA 1JICA 5CBEE 3RLOA 3BDCA 2AQ3B 1XXGA 3QOLA 1DOMA 1G2SA 1HUNA 2A6EC 5EJWA 1EEID 4ZKCB 3GTGH 5IP7H 1EYAA 2AUJD 1M1KC 1DJRD 3I3CA 2CW0C 4XTCS 1JE5A 1PTOH 1SNDA 3QO2A 1K0SA 2RCNA 4FF2A 1GD7A 1LO5D 4I65A 2E2HB 1QNUA 5DM63 2EY6A 2Y0SG 2HDLA 1FGUA 2MP1A 1SYGA 4OONA 4DV5Q 3AFPA 5I6WA 2YTVA 5CC4A 1EY5A 2VS1A 3J7A5 2L5TA 2B2UA 4H13C 3NQIA 4POGA 4HEDA 5HY6A 1R4PB 3MC0B 3S14H 3QJYA 1PYWD 4J8QA 1LABA 2XWBB 4PZ7A 5ELBA 1X65A 2KCNA 4P75A 5C3WA 1EU3A 1VQLA 2QDBA 1CI3M 1XMOL 5HURA 2NZHA 1I5FA 1FD7D 2XGTA 4U673 3M85A 1PTOB 1VMPA 3DM1A 4YCUA 4EQOA 4HCEA 1SSOA 4DR6Q 4IN3A 2WIIB 1XMOQ 5IT9L 1Q8KA 1DYQA 4OXPA 3KF6A 2IHFA 2F0TA 4CKBA 1MSGA 1TS2A 1XMQL 4EX5A 1PDQA 3GTJH 3S17B 1LTTD 1G6PA 3DLLA 2EYFA 3PUXA 2A6ED 1TWAH 1WTRA 3T1HL 1FJGQ 2QEJC 1SMYD 5EPLA 1B70B 3D3RA 1CK1A 3CC2A 4B3SL 2NVXB 4K2LA 5CORA 5E4WC 1WTOA 3E0JA 1G6ZA 3G48A 4APVA 3JC66 3HOYB 1X54A 4OL7A 2G5DA 4RCOA 1HHVA 1P16A 1CKMA 1E2WA 4HIMA 1EYDA 2L15A 4KJNA 2VW9A 3D8GA 3HOVB 1F77A 1Y8PB 4K14A 1TWFH 2XNAC 4JOIC 3VDYA 3HOZB 1NY4A 2CVRA 1SDFA 3I4MB 3U4ZA 2F4VQ 1QVFA 1B9MA 3VA5A 1L1OB 3R3OA 2D9UA 3PIP3 4BBSB 3I70A 1JE4A 1II3A 4HR7B 3EA6A 3BVZA 3OMCA 2JJQA 1TWGH 4A3MB 5IWAQ 2PNRC 1EY4A 5DEHA 4DV0L 3RN5A 1F2LA 1D5MC 4K5WA 5M5YB 2BH8A 3GTQB 1IW7C 3EFXD 3BS1A 4IUVA 5ELDA 1P8LA 2VB2X 4LFAL 1E24A 3DMUA 4TVAB 1I94L 3CXCA 3RLFA 2ZT9C 5CV8A 5CV5A 3RUZA 5EBDA 3GQBA 4Q5VA 5A2QE 1PH1A 5ELEA 1UAPA 1Q1BA 4LW1A 2RHQB 2RBMA 3GO5A 4B3RQ 3RMHA 1AEXA 1B9NA 1JJ2A 3VYRA 1BQQT 4XXEA 2OQ0A 4K6DA 4JI4Q 1K83H 1MBYA 1EIHA 4FO2A 5JJZA 1X32A 4IURA 3T56B 2R93G 2Q8RE 4IUPA 4UP7A 4K0KQ 4AIMA 3AU7A 3M4PA 3DM3A 5C0XJ 1STNA 3ITPA 2OXPA 3JAMi 2XRQD 2J7ZA 4LF9L 1STAA 5D3DA 1WTQA 1GHJA 2IL8A 1JCKB 1S4ZA 4TSSA 3VA7A 3A7AB 2IHEA 1LM0A 2AWOA 1NMGA 3DWQA 1TWAB 1TR5A 4QUFA 4JYAQ 2LS01 3G4SA 3UDGA 2F03A 1BXTA 2I46A 1V1PB 2OQKA 1K28A 4A93G 1KL9A 3L3OC 5EKLA 3TP8A 1K0RA 4DA2A 5I4DA 2X6GA 4G7OC 2NN6I 4HIDA 4DR4Q 1JWUD 1WD0A 2SOBA 2RKSA 2YTXA 5A35A 1ZYRC 4L8JA 4UDUC 2CQOA 5DLQE 3SXHA 1NMFA 1SNQA 2SEBD 4NPSA 5LMUL 4TKOB 1M8AA 1HNZL 4UPAA 1PZJD 2PQAA 3M4OB 2F0UA 1SFOB 3J7AF 1F2YA 5C4HA 4LF9Q 4GKJQ 4WFN3 3BYYB 2IW3A 4QUCA 3VYSA 1SNCA 3PQIA 4QMGA 1Z6HA 3CF5A 3PO2B 1C4QA 2Z6KC 1W3SA 5M3FB 2PNHA 4LF4L 2IX0A 1XTDA 4X3UA 3CCUA 4A3EG 3MFGA 3LX0A 3NQTA 1VQOA 4HAEA 2K28A 4ZCKA 5GAEC 2KUMA 1PV4A 2UUBL 1CQVA 1S40A 1KNEA 2A69D 4WJWA 2VQEL 2NVXH 2E5LL 5C0XI 3J81L 3HS0C 1XYIA 4YWKA 1NR4A 4X3KA 4A3CH 1VQAA 1CSQA 1U4MA 2E2JB 4DR3L 3S15B 2UUCL 3S1MH 3GTOB 1JB7A 4UHVA 2EPBA 3I2ZA 3NEMA 5M3MB 3JAME 4KI0A 2K5VA 2RSOA 1X9NA 4IOAA 1SAPA 1HTLD 4ZAIA 1OXSC 1D8LA 4DNRB 3Q0AA 1DCZA 1S3OA 4FF1A 4PMWA 3TP5A 2EJMA 1A6XA 4IUNA 2K75A 3TS2A 2XIWA 4U68A 2K5QA 4X3TA 2LFNA 4OIKA 3J81c 3KLSA 1RDPD 3KF8A 2WKDA 2K05A 2KCMA 1X3PA 2JQOA 1PH9A 1UE6A 1IYUA 1N32L 1SNMA 2UXDQ 2HQEA 2WACA 2IPKD 1LTAD 4GNXC 1G291 1KQSA 1VQ8A 5CMDA 4DUZQ 1YZ6A 3FKIG 1J5EL 3EBEA 3OIQA 4GLVB 4LMQD 2NYZD 1K8OA 2PPBC 4UP8A 1Q46A 2ALYB 2A68C 5C5MA 4ODGA 4QGUA 2LSSA 3EQLC 4A3EB 3I7FA 3S16H 1FJGL 1D7QA 1JOQA 3G7LA 1S5DD 4JI8L 3SR1A 1XNRQ 1SEBD 3CQZH 3ULPA 3WWVA 1K83B 1ENAA 1FR3A 1Y8NB 2DNEA 4HTHA 3FEWX 3OYYA 1I6HB 5M3FG 1SE3A 2MUYA 4J1MA 4LF8L 4A3FB 3ERSX 3T1YQ 4Z9CB 3HOZH 1ESFA 2B63H 2X69A 1IL2A 2JEAI 2MO1A 1QE6A 2A1AA 1LT3D 2IY5B 1GVPA 1KHIA 2AMCB 2A69C 1IBLL 4DPGA 4JI2L 2WFWA 2GN5A 3KBGA 1QUQA 1X3QA 1EY9A 1FVIA 3MXNB 4LF5L 3OWEB 2AUKA 1AZPA 3MXNA 5J1ZA 5AFWA 2G9HD 1MSHA 2CH4W 4EGVA 3STBD 3QWNA 2XRSD 5K5PA 3M4QA 3GDEA 1SYFA 5BR8L 3CC4A 1PFNA 4GNXA 5C3XA 4F8MA 1A0IA 1LT6D 3JAMc 1LV9A 1KNAA 5D3IB 1LTLA 4QJFA 1H9MA 2F0QA 4FXDA 4DR2L 5FLXc 2FXQA 1QCBD 4LFAQ 1JOOA 4BXXH 1Q82C 4RGOS 4C1NK 4GN5A 1STGA 3HRZC 2K01A 2PO4A 4C3JG 1UWVA 1PFBA 2RDHA 4CDCC 1OO9B 4RMFA 4HIOA 4JI7L 5E1FA 1G2TA 3P20A 4FF3A 4H44C 3F1ZA 2L9HA 3D4DA 4JOIA 3TP7A 4DV6Q 5I2YA 4RA8A 3RNUA 4DV2Q 3QB3A 4CDDC 1Y1VB 3FPPA 1XJVA 4X64L 4J6HA 3A5UA 3A74A 1TS4A 4V190 4K0KL 2O4XA 4I7ZC 4LFBQ 1H9KA 2H1EA 4DKAC 4JI0Q 4B08A 5IGCA 4C3IB 4DV0Q 4N9TA 2JP1A 3I55A 2VY3A 1XPRA 4OO1I 3E0EA 1IL8A 2EYMA 1DGSA 1FNUA 2GVAA 1V8QA 2F0DA 4RGTA 3S1RH 1EEFD 1B3AA 1HPCA 1JQYD 3UE1A 2VUMG 1LTID 4BY1H 4I7AA 1AN8A 4C3HH 3Q22A 2X6LA 1QILA 3K5NA 4QL5A 4EQPA 4N8FA 5HGQA 3BYTB 4CDEC 4MZ9A 1PZID 1HRJA 3KFUA 1N36L 3GV3A 1PFMA 5M3MG 1E2ZA 1KDCA 5D65A 1A3VA 2B2TC 4WJ3M 3O13A 1CT1D 1HNZQ 3D0FA 4DF7A 4L5RC 1BKBA 5IIFA 5IY0A 5C4JB 3NUCA 3C3LA 5IT9E 1LTRD 1ET6A 3HOXG 4DV1Q 1DZ1A 2K03A 2V1CC 2F0GA 5KRUA 2L1BA 2E2JH 3GTGB 3GD7A 1ICWA 5FKAC 1I3QB 1H9SB 3GTOH 1IHZA 4XYQA 1BR9A 1HZCA 3FKIH 2XTIA 5C3EB 4GOPA 4JYAL 1PH2A 3RZDB 2B3GA 1QZHA 4NB3A 4NW2A 2RF4A 2K32A 4LF4Q 1SMYC 1TWHH 4C3JB 1PRTD 3W5OA 2NVQB 1WI5A 2ID0A 2CKZB 4OWXB 1SYCA 2SNSA 4KKUA 3W1BA 4MTNA 1ENFA 4XT1B 4KHPL 3C1EA 4UAIA 1Y1VG 1VQNA 1Y14B 2C5CA 2CWAA 2H4OA 1S5ED 3S1NH 1HZAA 5EGTA 4L6TB 5M5WB 4DV6L 4YHHQ 2QEXA 4A93B 2Q2IA 1PMRA 3V96A 4A3IG 4DK0A 1MHWC 4L63B 3H0GG 3TQYA 4XYOA 3ZJYC 1B4OA 2JSOA 3KJOA 5M5YH 3Q6SA 1X3GA 4RFBA 1VQHA 1GKHA 1HCZA 4CJ1B 1LACA 3J7ZC 3H0GH 3MEHA 5KNBA 4DXFA 2CH4A 2F0PA 1N33Q 1J5EQ 2UUAQ 2E2IB 1IZ6A 3GTMB 1EZ8A 4C2MH 1BBUA 4IFDJ 3NXWA 2L4NA 4RKBA 4JBWA 4C56C 5IWAL 1LT5D 2UXDL 4FYDA 2CQAA 3OW2A 5C0XH 2ENBA 5BN3A 2OT2A 2WKCA 4AYBB 1CZWA 2K33A 1CSPA 1BDOA 3TMEA 4BY1B 5JOBA 1MGSA 3H3VC 4KY7A 3NTKA 4KD4A 4S3SA 5TSSA 2B2UC 4C1NI 1CTMA 1N9WA 5GQOA 3BZKA 4OX9L 4LF7Q 3GTKB 1JJGA 4LWCA 4HJ7A 4JI6L 4RG1A 4BA2I 2AHOB 1X6OA 1RKNA 4EQNA 2L12A 4DFAA 1K3BC 1KD1C 1A2TA 2PI2E 4N9PA 4NXMQ 3BG3A 4O0AA 1S5CD 1YNNC 1CKNA 4H0LC 2VQFL 3DEPA 2SNMA 3KOJA 2RA4A 4ME5A 4KD3A 4YCWA 3HOWB 2JA6B 2F3VA 1D6EC 4FF4A 3DEOA 1ET9A 1JR0D 2F52A 2WB1G 5IGBA 4XQNA 1SE4A 3Q8DA 2UU9Q 5GROA 5JAVA 4OX9Q 4R8IA 3S24A 4DR2Q 4HMJA 4KHVA 1A3UA 1H9JA 3CP0A 4O2DA 1CKNB 5FJ8H 1CZGA 2K52A 4IALA 3KYHC 3AB9A 1Y1WG 2A8VA 5F2DA 3H09A 4DUYQ 4DR5Q 2ZJQA 1D1IA 5FJ8G 1E1OA 4HIKA 5G3LF 3E5SA 1YNJC 4OEMB 5JEAG 1EY7A 5CR3A 3A8JE 2VQFQ 3U4VA 1S5BD 4ME3A 1J6QA 1EIFA 1B50A 5LMNW 1PYSB 5C3EH 1JOKA 1TU2B 2EQSA 1HA6A 2I5LX 4BXXG 1AE3A 3CPFA 1JJCB 2KCTA 1PH8A 1EWCA 1I4XA 1VQEA 4QCLA 1I4RA 1STYA 4DV2L 2B2VC 1RIPA 3PV0A 2DY7A 4NDXA 4ZK9B 3C2PA 1UNSA 4FP5D 2R7FA 4X62Q 2M00A 4X64Q 1O7LA 5CV6A 1E2VA 2XVSA 2QKIC 2D0OA 5CBAE 4JVZA 3J81j 4BBSH 4R4QA 3S14B 4NMZA 3J80L 4B9XA 5J22A 3W1GA 3S1NB 3K6OA 2B8FA 4AYBG 5KNDA 4EVOA 4CJ2C 1C0AA 3CD6A 5IT9c 2GVBA 3VR2A 1Z47A 4CBVA 5IE8A 3MVVA 4A3CG 4RKLA 2R92G 1ZEQX 4PMCA 3HOUH 5T1GA 4JBMA 2UUBQ 3J7AV 1D5XC 2Z8LA 2EYPA 1ZKOA 2B63G 1MD2D 4V0BA 4DR4L 1STEA 4IPCA 3KLWA 4H7BA 2IX1A 4EQ5A 1ESRA 1PLFA 1SNOA 2KOLA 4A3BH 1MJEA 3BDOA 1HQRD 3VR5A 2R92B 4PMBA 4A3BG 1G91A 4R4IA 5IYDH 4DGZA 1ENCA 2N3SA 2UU9L 2B39A 3UI2A 3TEHB 3V2TA 1Q12A 2FMMA 3TREA 1E3PA 3TDQA 4BWGB 2N55A 4NXNL 2K5NA 2WAQB 1PTOC 1KAWA 1VF5C 4JCVE 1XNRL 3TBIB 5CGKA 2NVQH 1U9RA 1BNZA 4A3MG 3HKZG 1B53A 4BS9A 4PG3A 4A76A 1HR0L 1QG7A 4NKLA 5NUCA 4MNOA 4A3JH 1YNND 3OIPA 3H3VI 4DV4Q 4A3EH 2JN4A 1EY6A 1I94Q 2J4XA 2O5IC 1AW7A 4K8IA 4IQZA 5EKKA 5K36H 1L2FA 4KKSA 2JA5H 3TSSA 1FYCA 1WTXA 3TRZA 3OTOQ 1I50H 1SE2A 2ZXPA 4KN7C 1EYCA 4CKCA 1EY8A 4K5VA 3W3AA 1F2MA 2Q8IB 5IODA 5CV9A 1GUGA 2HIVA 1UE1A 3MXPA 1QZGA 3K80C 1A8VA 4G7ZC 3PSIA 5KIXA 2ZXRA 1QJOA 1JC7A 1PHJA 1N32Q 4X65L 3KLRA 2G9DA 1WCMH 1EWIA 1V1OA 3VYTA 2HHHQ 4X6AH 2ZJRA 2HDMA 3NENA 3PCOB 1EU4A 3F2DA 3SVMA 5I9PA 5AJ3Q 1K9MC 4R4OA 1NSNS 1PXUA 4LF7L 1U0LA 3LWUA 1VQ5A 1HNWL 2CCZA 2MGSA 5M3MH 4IOCA 1SNPA 2AKWB 3A8KE 3ERQA 1IBKL 1M4VA 4GN4B 3R8BA 1PH3A 2EDGA 1WVLA 2EOTA 4IO9A 1RJTA 2UXCQ 4RH6A 2LXJA 2IWHA 5GADC 3MZ5A 3J7YW 3LWEA 3T1HQ 2CWPA 3K0XA 2SDFA 3A5ZB 5EBCA 2Q2UA 2RDFA 3A8IE 2F3IA 5BN5A 4JV5Q 3NBIA 2EJGC 5FLMH 3VR3A 1UE5A 1S5FD 1MJCA 3S2HH 4WJ4A 3K7AH 2WINB 1B8AA 3SK4A 1PH5A 5ELCA 3KF6B 3SGIA 3J81E 4ULLA 1PH4A 2B2VA 2OCEA 1QUQB 1WTHA 5GAHC 2B2WC 3D31A 5LMNL 1F9SA 1RTOA 1ILPA 3UDIA 4P74A 4DAPA 4A3JB 4IUQA 1TS3A 1MKHA 1EYGA 4C3HG 1N8RC 3S16B 1DONA 1K3RA 2DN8A 1NUCA 3J80c 4PZ8A 2PW7A 2K5HA 1IBML 3E9IA 3K5OA 2NWGA 1VQCA 1VQIA 3PMFA 4ID6A 1FL0A 4JI3Q 3D4RA 4OWTB 2LMCB 1JORA 1H9RA 4P72A 1VQPA 4B3TQ 3K7AB 2Z4IA 3F2BA 1YIJA 1EQQA 1RD9D 1D2BA 2B63B 3ZYYX 1ASZA 4OO1G 1VQBA 1E0BA 2VL6A 4YIJA 4YWMA 3I56A 1EQRA 2KHIA 3SK8A 5JEAH 2PZWA 4ZRZA 2JXMB 2RHSB 3SE0A 2AQ1B 4X66L 1PVOA 4MN3A 3T16A 4NXML 2C35B 2MFIA 4B3RL 1GUOA 3H0GB 1DXMA 1XMQQ 1B3QA 2K7VA 1OXUA 2A73B 3KBXA 2I0QA 5DNFA 5DM73 1HNXL 3M7NA 4P73A 1WD1A 1E22A 4QB4A 1F2ZA 1A62A 3MFYA 2A6HC 3KJPA 3M3YB 3BVMA 1OXXK 1HZ9A 2B8GA 1LLRD 4NP5A 5IGDA 5D14A 1I4GA 1PZKD 2JK8A 4A3FG 1EOTA 2R7ZH 2N78A 2F4VL 4ZYSA 4LF6L 1ILQA 1GXDC 3RR5A 1TWFB 4DUYL 5M5XB 2RSNA 3NWSA 4JI4L 2K5DA 2UXCL 3OPOA 1AH9A 3E6ZX 2K4KA 1X55A 2OTLA 2EYOA 1HQMC 4LUOA 4O42A 2R92H 3RZOH 3K5MA 3M7GA 3S15H 1KDBA 1CHPD 1SRUA 4B3TL 1SXTA 4CGYB 1WTWA 2WV6D 1CFMA 3H3VH 5M5WH 4LUZA 3DUZA 4GS3A 4MHEA 3H91A 1RHPA 1L1OA 3NTIA 1YEZA 3PUYA 2EIFA 5GAGC 4DNIA 3IAYA 4JI0L 3S1QH 4KJOA 3CW2C 3C1FA 2N8NA 4IPHA 1IKLA 1GO3E 2QF7A 4X66Q 5LL6X 3FHWA 3A56A 5IP9H 4A3DB 2B2YA 5FO8B 2NTTA 1U4PA 1F9PA 2JA7B 5BR8Q 2NTSA 2PW5A 2F0SA 5JPMC 4GOPB 4QF4A 3PO2G 4Q0FA 4XQQA 1MIUA 4FXKC 3AEVA 4A3GH 4C3IG 1BOSA 1QWYA 4R1JA 4JV5L 5IYCH 4A93H 3PO2H 4AQYQ 1Q8IA 2FHTA 2PQAB 3H94A 1PYBA 4JI3L 4A3GG 4KHPQ 3F2UA 3JAML 1T5EA 3E9HA 2VUMB 2EYHA 2Q8TA 1DD2A 3I72A 5IYBG 3OW7A 5E7NA 2YTYA 4ZKBB 1KLUD 1H9SA 2R7DA 2KHSA 3PGZA 4PV1C 3ICEA 1L0YB 3GTPH 4JI8Q 3CHBD 3MA2B 2JA6H 2A6HD 3L7ZC 3D4WA 3CCMA 1WTVA 4AH6A 1V9PA 4GOPC 5A2QL 4IPDA 1T5XD 2XN9C 3R2TA 2FJ2A 3TZUA 1VQ7A 2E8GA 2JA5G 1LYLA 3T1YL 1ONLA 1GHKA 3OHXC 3GTJB 2KEDA 1ZYRD 2ICIA 1IXRA 1TY0A 3SEBA 1VF7A 1VQGA 4A3IH 2Q2HA 1KRSA 3D6WA 4BBRB 4RWSC 4ZUIA 2NVTH 3UE0A 5I9OA 3MHBA 5KGUA 1VMCA 4KTAA 4TRDA 4JI7Q 2XSCA 2F0JA 4OO1H 1YI2A 2HUGA 2VNUD 4CJ0B 3QIAA 1HNWQ 3MXGA 3NE5B 1HR0W 4OIJA 4OELB 1RF2D 2JE6I 3BU2A 3A54A 2PMZE 1W6KA 1LUZA 1RCVD 4F88A 1SMXA 1U5KA 3P7JA 4KHZA 3I4MH 1Z7TA 2KENA 1C9OA 4KMUC 5JEAJ 3RZOB 1KDAA 5CV7A 5T1IA 3UDFA 4LFCQ 1WOCA 2Z9HA 3PUVA 5IYDG 2HD3A 4IUTA 3IFTA 3HP3A 1HFNA 5BN4A 2F0OA 1WYDA 2UUCQ 1OTCA 4JI2Q 2MNAA 2NUCA 2PZUA 3FVQA 4BBSG 1KABA 3RZDH 1SJED 3CPWA 3HFZB 3CCEA 3GTQH 1KXLA 4UP9A 1C8CA 4POFA 4JW0A 3NSWA 4A3DH 2RQXA 3AQQA 3FDTA 1W6JA 1QB5D 1K8MA 2R3ZA 1U4RA 5JPNC 1JT8A 3HOVG 1HH2P 3NPPA 4DR6L 4A3DG 5J3BA 1XWEA 4R9WA 4DXGA 2JYOA 1STBA 1RODA 1B44D 4K5XA 2F0KA 4FNFA 3X3MA 1XTCD 3S1RB 1J9OA 5C4XG 3IL8A 1X3EA 1WJJA 2CHBD 1Z9FA 1X3FA 4R8NA 1I3QH 1XPOA 2OTJA 1VCIA 1SJHD 4LNQA 2KJXA 1SYEA 1YJNA 4BBRH 2KBNA 2NVTB 1VQ9A 3S2DB 4IZ8A 2EVBA 1N34L 3I4NB 4F7XA 1X56A 1NTGA 4GKKL 3M9BA 3PO3H 2WB1B 5EPKA 1B7YB 3TZDA 5IGFA 1K8AC 4P71A 5I2XA 4LFBL 4DV1L 3CCVA 5LMUQ 4XDXA 3AYHB 3GTKH 1NAPA 1GUSA 1VDZA 4BA1I 2F3WA 3T13A 1YVCA 2QA4A 1O78A 1QNKA 2B2TA 4DV3L 5C5LA 2A5HA 2QDLA 1TT2A 2K04A 1UUPA 3F2CA 1HUMA 3T51B 4RGNA 2DGYA 3VYUA 4O1NA 1CKOA 1GM5A 1D1KA 1R4QB 2CFMA 1EFID 2NZ1D 3PF5A 1ICFB 1STHA 4A3JG 1TIID 4C2MB 3RLNA 4RAUC 3E3XA 1NE3A 4OGQC 1YHBA 2MO0A 4CKEA 4ALPA 2VQEQ 1YITA 1PA6A 3DHQA 1O80A 4M8AA 2I5HA 1J8IA 5IGGA 4WORA 1K8GA 3F8TA 1SYBA 5FLMG 4M1UB 3Q23A 4B3MQ 1IW7D 2TMPA 4KY6A 5KEEA 1PH6A 2ZXOA 1C7YA 2PYKA 1LTBD 2D0PA 3HOWG 5ISRA 1V1QA 2N88A 2PI2A 2KQ3A 4Y52H 4A3LG 3K81C 4KV6A 1PH7A 3CCJA 1GJXA 1U4LA 5EPJA 3S1QB 1I4QA 1ZXTA 1GUNA 4KKTA 4E6IA 1AZQA 4A4IA 3H15A 4DK6C 3ER0A 3OOCA 3MWYW 3M4YA 1AE2A 3P1HA 4DK1A 3IFDA 3LNNA 3ONAB 5ELNA 3CCQA 3IKJA 1SLJA 1WTPA 1TKWB 3HOXH 5IP9G 1CUKA 1EIGA 2BOSA 1TVXA 2N49A 1FNVA 2A19A 2ASBA 4QQBX 4C3IH 1CQFA 1MI2A 1NCVA 2JEBI 2P5ZX 2R61A 4A3IB 5C4XB 3NELA 4A3BB 2KECA 5IGEA 4K2KA 4A3KH 2K6AA 2L11A 4A75A 2RDGA 3S2DH 3OMGA 2ZTCA 4A3KG 4GKKQ 4PZ6A 2UXBL 3PO3B 2HCIA 3HOXB 3EN2A 5M3FH 3NK9A 3CRLC 4HCSA 4LF8Q 2YV5A 2Z0SA 1Y1VH 1GUWA 2QILA 3A55A 2R6GA 2GA4B 3G71A 3K58A 3MTSA 1G51A 2UUAL 1NR2A 3IRBA 4G57A 5C4XH 1IYJB 3S9WA 3HGBA 5COYA 3HOZG 5LHY1 1YNJD 3QG1A 4ZQ3A 3DWPA 5E3FA 4K6LA 5J39A 1F9QA 2F0LA 2NVYB 3QR8A 2UXBQ 1CHQD 1EWHA 1OXVA 1A2UA 2NN6G 2IX3A 3ULJA 3OSOA 3I4NH 1SROA 3EVQA 1IBMQ 3I73A 1Q7YC 2E2DC 1XNQL 3MAQA 2E75C 2FMCA 2F0WA 3U50C 3OTOL 4TQUS 3SK5A 1B2TA 4LJZC 1JWSD 3EROA 2F0MA 1Q90A 3J81i 3URYA 4QIWB 2L55A 2Z4HA 4CDFC 4GLXA 1JMCA 5C0XG 4LAAA 5C4JH 4DAVA 4DNTB 5IP7G 1YJ9A 4ILWA 2ZM6L 5CV4A 2F0EA 4GN3B 1L0XB 2EY2A 3L9AX 1EUJA 2O2LD 1EY0A 4C3JH 4XT3B 3Q24A 4BY7H 4GZYC 3FMCA 4OHJA 2HIXA 1VQJA 2YYZA 3G6EA 4DV7L 2K1BA 5IYCG 1BO0A 3CMEA 1YBYA 2D62A 3S1MB 5C44G 4Y7NH 4FDBA 2WB1E 4HJ5A 1Y69U 1LTSD 5JVG3 5HGTA 1B1ZA 3PF4A 2VZAA 1KTKA 5ELOA 3CC7A 1FGBD 2BE5D 2VXWA 3TS0A 4X62L 5FLXL 4GNXB 4DR5L 4BY1G 2F0IA 3NWTA 3EJIA 2A68D 4GKJL 3MEFA 1BBXC 1IYVA 2ZM6Q 2F0VA 4HJAA 1BF4A 2B2WA 4KN4C 1KIXA 1IBLQ 5CYUA 3ULLA 3S2HB 1TWCB 3GTPB 3U9SA 1HXYD 5C44B 3T53B 1KRTA 2EJFC 1N34Q 2VB3X 2IJ0A 3B6YA 5G3LD 1Y1WH 3WOEA 4X3SA 3NBHA 1HTPA 2F4IA 1YHQA 3CQZB 2MHVA 4IFDH 4H02A 2EZVA 1LT4D 3GTLH 1PTOD 4B3SQ 5LMNQ 3RD4A 3KUPA 4DN4M 1BVSA 4B9WA 3A7LA 4AQYL 1TWHB 5KYLA 1JWMD 1VQFA 4L5QA 4JI1Q 4DV3Q 2K5WA 3FRPB 2NZOA 4XIGS 1K73C 1TWCH 4JI1L 3STBC 1V1PA 2H5XA 3WDNA 2D5DA 5IYBH 3KLSX 3PUZA 2HQLA 3J80E 4HSPA 1N36Q 3QOJA 3EIVA 3NBHB 4BY7B 4B3ML 1KLGD 2Z6KA 5C4ZA 2MPMA 2KVMA 2EYJA 4R4CA 3BZCA 3I8ZA 4HJ8A 4R4TA 1HFGA 3H6MA 3TP6A 2EXZA 4JI5L 2E76C 4JBKA 1HA5A 3RN2A 3KF8B 1HJPA 1CM9A 1QVCA 2QGQA 1Y1WB 3HOYG 3PIOA 4DAYB 2C9OA 4DU9A 1HZBA 4A3FH 4DUZL 3ND8A 2JA8H 5AJ3L 1A63A 4JPBW 5KNCA 1BUVT 4HJ9A 3HOUG 3GTMH 2JA7G 2A74C 3K7UC 2O5JC 3L0OA 3DXJC 3HOVH 2JA8G 1TWGB 3NHHA 4HSVA 2QW7A 2QCPX 4YWLA 1W2BA 2D2CC 1DOKA 2MQHA 2AWNA 2YU9H 2LKVA 3CRKC 1N33L 2R7ZB 1QVGA 4A3GB 2EYLA 4IJLA 4AYBE 2NVYH 4LK1C 5EKIA 1VQDA 4JI5Q 2DJFC 5FO9B 2F0NA 2IT1A 4IUUA 1G8ZD 1TQOA 4K8JA 3I4MG 3NTHA 1RTNA 3KK7A 2HCCA 2M9VA 4KK7A 3K8AA 1O7ZA 3BZDB 3UDXA 3WOFA 2PQEA 4GLAC 1TS5A 5H1SE 3CCLA 4RHSA 1EOVA 1YHAA 1Y8OB 3K5LA 3I90A 1XX8A 2EE1A 3M3YH 1I4HA 2V4DA 4KLKA 1WFQA 2K50A 4DR7Q 4OWWB 4QIWE 3W2DA 2FFKB 1CA6A 1EQVA 2WAQE 3R2IA 1GOZA 5M9OA 1I4PA 4MTKA 1XNQQ 2F0HA 5M5XH 1UEBA 1VQ4A 2HT1A 4RCNA 3L2PA 3VR6A 4XQJA 2YU9B 2ZJPA 2B29A 3S17H 2Y0SE 4A3KB 2KCCA 5E4XA 2BE5C 3CAMA 5JJLA 4L5SA 3FP9A 3CKIB 2BH2A 3I91A 3GP7A 5FLXE 2JA6G 4CHTB 4PQXA 1DM0B 4F87A 2KHJA 3GV6A 2BCOA 4G4KA 1NNXA 1BCPD 2WAQG 4JK1C 4QY7A 1M90C 1L1OC 3V05A 1ASYA 2Z6BA 4IJHA 4DV7Q 1WCMB 4DR1Q 1VQKA 5FO7B 5FK9C 3K0YA 2OEOA 3MXUA 2M2LA 5I6YA 3PIPA 5K36G 1SR3A 4BBRG 1UEAB 2EY5A 2DNCA 3GTLB 4HN7A 3HZXA 3HG9A 1I6VC 4YCVA 1BBWA 3PO3G 3DWAA 3FKIB 2R93B 2I5MX 3VR4A 1SYDA 2JA5B 1QOHA 2PZTA 1PRTB 5JJIA 3AFQA 1WCMG 3SDZA 4FXGC 5JVH3 2KEEA 1SN8A 4DR7L 1O7IA 5C3EG 1LTGD 2CW0D 2JA9A 1EQTA 2ZTDA 3PUWA 1CA5A 1HNXQ 2OF1A 2ZTEA 2NBFA 2KA7A 2EXDA 4Y7NB 3X3NA 3KDFB 4LUVA 5EQ0A 4X65Q 1YNXA 3KDFA 2LXKA 3SHLA 2E5LQ 5C44H 2J0TD 1NBWA 5KYIA 4HMIA 3BVGA 4DR3Q 3HOYH 5L37A 2K14A 2TSSA 3D6CA 1S72A 1GUTA 3OWFA 2E74C 2RCFA 1HR0Q 2DUDA 3HKSA 1AP0A 3T4AC 4P2CB 4LF6Q 3HOWH 1ML0D 3U9OA 4L5TA 4UY8C 1KAAA 4ZUJA 4YY3L 2JA7H 1IBKQ 4ABNA 3CCSA 4MIUA 5DAUA 5C6AA 2Q2TA 1T9HA 2DJGC 2E2HH 1BCPC 5IOCA 1BCPF 2F1MA 1IKMA 2BA1A 2F0FA 1YJWA 3P75A 4IPGA 1KC8C 1OXTA 1C48A 1A3TA 4DAYA 2PMZB 4DV5L 1PRTC 1UE7A 3FPUB 2AQ2B 1NJIC 1F9RA 1E7ZA 2L0CA 4RHRA 4IFDG 4JG2A 3A0JA 1PRTF 3PIO3 2I07B 4LF5Q 3HEJA 2ES2A 4YHHL 3LGJA 2Y0SB 1H95A 2XWJB 1EZ6A 4DR1L 3ND9A 4C3HB 3I4NG 1VQ6A 1SFOH 4JI6Q 3CCRA 2ICEC 3N6RA 3BDLA 4N8X1 1EFWA 2E2IH 1PFSA 4DAMA 1EL0A 1Q81C 4G7HC 2MJ8A 1AFPA 1V43A 1E1TA 1SE8A 2BA0A 2LY7A 1VQMA 1I50B 1Q1EA 4DV4L 3SK6A 3HKZB 1EIYB 2B2YC 4KY5A 3K59A 2FINB 1A15A 3TN2A 1R9TB 4DK3C 4IFDI 4RGMA 4A3MH 3G6JB 4FVMA 3I4LA 4BY7G 1RL2A 3CU7A 3I4OA 2RVLA 4YY3Q 1VS0A 4ZLTF 2ATWA 1L0WA 1SBBB 1FNWA 4LFCL 1R9TH 3HOUB 5JJKA 3C46A 2PCFB 3U58A 2EY1A 1DOLA 4NXNQ 1O7YA 1PTOF 1JB3A 2BDNA 3HKZE 5LL6S 1Q86C 1XPUA 2DY8A 5FOBB 5ELFA 2OWOA
chains in the Genus database with same CATH topology
1IYJB 1DGSA 2WP8J 1MKHA 2GVAA 3S1RH 1EYGA 3HOZG 4J15A 1N8RC 2R7ZG 3UE1A 1K3RA 3CMAA 2VUMG 4BY1H 3J80c 4PZ8A 2R93H 2HHHL 2K5HA 1IBML 3E9IA 4A3LH 1VQCA 3BJUA 4C3HH 1VQIA 5EAYA 2VUMH 1FL0A 4JI3Q 4QL5A 2UXBQ 4JC0A 4OWTB 1I6HH 5HGQA 3J80i 1VQPA 4P72A 4B3TQ 4MZ9A 1OXVA 4JBJA 1TXYA 1YIJA 2NN6G 3F2BA 1N36L 3KFUA 1EQQA 3M4OH 3ULJA 3RLOA 5M3MG 3I4NH 1SROA 1ASZA 4OO1G 1VQBA 1IBMQ 4WJ3M 1Q7YC 1HNZQ 3D0FA 4L5RC 1XNQL 1BKBA 2VL6A 4YWMA 5IY0A 3I56A 3U50C 3OTOL 4TQUS 1EQRA 2KHIA 3HOXG 4DV1Q 3GTGH 2V1CC 2RHSB 5IP7H 3J81i 1M1KC 4GLXA 1JMCA 4XTCS 5C0XG 1JE5A 4X66L 1PVOA 2E2JH 4NXML 5C4JH 2RCNA 3GD7A 2C35B 2MFIA 5IP7G 1GD7A 1YJ9A 2ZM6L 3GTOH 4B3RL 4GN3B 1XMQQ 1EUJA 2Y0SG 1HZCA 3FKIH 1FGUA 1OXUA 2XTIA 4C3JH 4OONA 4DV5Q 2I0QA 4GOPA 1HNXL 3M7NA 3AFPA 4BY7H 4P73A 4JYAL 1PH2A 1E22A 2HIXA 2VS1A 1VQJA 2YTVA 2YYZA 3G6EA 3J7A5 4DV7L 2B3GA 4POGA 5HY6A 1QZHA 4NB3A 5IYCG 4LF4Q 2RF4A 3CMEA 3S14H 1TWHH 1YBYA 2D62A 1A62A 5C44G 3W5OA 4Y7NH 1WI5A 4FDBA 2WB1E 3KJPA 4HJ5A 4PZ7A 1X65A 2CKZB 1OXXK 2ID0A 4P75A 4OWXB 1VQLA 1HZ9A 3W1BA 4MTNA 1XMOL 3PF4A 2NZHA 1I5FA 2XGTA 2VZAA 4KHPL 5ELOA 3CC7A 2JK8A 4A3FG 3M85A 4YCUA 2R7ZH 2N78A 3TS0A 4DR6Q 1Y1VG 4X62L 4GNXB 1Y14B 4LF6L 4DR5L 1VQNA 2F4VL 3RR5A 1XMOQ 4BY1G 4DUYL 4A3IH 4JI4L 2UXCL 1Q8KA 2CWAA 1AH9A 2K4KA 3KF6A 4OXPA 1X55A 2IHFA 3S1NH 4GKJL 1HZAA 3MEFA 1XMQL 4EX5A 3GTJH 2OTLA 4LUOA 2ZM6Q 1G6PA 4HJAA 2R92H 3RZOH 3S15H 4DV6L 1SRUA 4YHHQ 2QEXA 3PUXA 2Q2IA 1TWAH 3DLLA 3ULLA 3T1HL 4A3IG 1KIXA 1IBLQ 1FJGQ 3H3VH 5M5WH 1B70B 4LUZA 4GS3A 1KRTA 3CC2A 4B3SL 1N34Q 1L1OA 3H0GG 3TQYA 3ZJYC 1YEZA 3B6YA 3KJOA 3PUYA 2EIFA 5GAGC 4DNIA 5M5YH 1Y1WH 1X3GA 4JI0L 3G48A 3S1QH 1VQHA 4APVA 1YHQA 1GKHA 3JC66 3CW2C 1X54A 2N8NA 3H0GH 4IPHA 3J7ZC 1GO3E 1P16A 4H02A 1CKMA 4HIMA 3GTLH 2L15A 4X66Q 3FHWA 2VW9A 4B3SQ 5LMNQ 1N33Q 1J5EQ 5IP9H 2UUAQ 1IZ6A 1TWFH 4C2MH 1BBUA 4JOIC 3VDYA 1BVSA 1NY4A 4AQYL 4IFDJ 3U4ZA 5BR8Q 4JBWA 2F4VQ 1VQFA 4L5QA 4JI1Q 5IWAL 4GOPB 4DV3Q 2UXDL 3PO2G 1QVFA 1MIUA 3AEVA 4A3GH 3OW2A 1L1OB 2NZOA 4XIGS 1K73C 1TWCH 4JI1L 4R1JA 4JV5L 5IYCH 4A93H 3PO2H 3STBC 1CSPA 4AQYQ 2H5XA 2PQAB 1PYBA 4JI3L 4A3GG 5IYBH 2JJQA 1TWGH 5IWAQ 3PUZA 4KHPQ 2HQLA 3E9HA 1N9WA 5GQOA 3BZKA 4DV0L 3RN5A 1N36Q 4OX9L 4LF7Q 1JJGA 3EIVA 3NBHB 4B3ML 2Z6KA 5IYBG 4BBSH 2BH8A 4LWCA 5C4XH 5E7NA 4R4CA 2YTYA 1P8LA 4HJ7A 3BZCA 4JI6L 4LFAL 2R7DA 3PGZA 1E24A 4TVAB 4HJ8A 4R4TA 4RG1A 2AHOB 1I94L 4BA2I 1X6OA 3CXCA 3RLFA 3ICEA 3GTPH 4JI5L 1KD1C 2PI2E 4JBKA 4JI8Q 3RN2A 3KF8B 4NXMQ 1HJPA 1QVCA 2QGQA 3HOYG 4O0AA 3PIOA 1PH1A 4DAYB 1CKNA 2JA6H 3L7ZC 2VQFL 1Q1BA 1HZBA 4LW1A 2RHQB 4A3FH 3GO5A 3KOJA 4DUZL 3CCMA 4B3RQ 4AH6A 4YCWA 1V9PA 4GOPC 1JJ2A 4IPDA 2JA8H 5AJ3L 1A63A 2OQ0A 1VQ7A 4HJ9A 4JI4Q 2E8GA 1K83H 2JA5G 3HOUG 1LYLA 2JA7G 3T1YL 2F52A 2WB1G 3GTMH 3K7UC 3L0OA 3Q8DA 3HOVH 2UU9Q 5GROA 2JA8G 4OX9Q 1IXRA 2R93G 4UP7A 4K0KQ 4AIMA 4YWLA 1W2BA 1VQGA 3S24A 2MQHA 2AWNA 2Q2HA 3M4PA 3DM3A 1KRSA 5C0XJ 4DR2Q 2YU9H 3JAMi 2NVTH 1N33L 3CP0A 4O2DA 3UE0A 1QVGA 4LF9L 4IJLA 1CKNB 4AYBE 2NVYH 5FJ8H 2K52A 3KYHC 1Y1WG 2A8VA 4JI7Q 1VQDA 4JI5Q 2IHEA 1LM0A 1YI2A 2AWOA 1NMGA 2IT1A 4DUYQ 4DR5Q 2ZJQA 4JYAQ 5FJ8G 1E1OA 2VNUD 4HIKA 3G4SA 1HNWQ 3UDGA 3I4MG 5JEAG 1HR0W 2OQKA 2VQFQ 3U4VA 4A93G 4ME3A 2JE6I 1J6QA 1KL9A 3BU2A 2PMZE 1EIFA 1LUZA 1K0RA 3K8AA 5LMNW 1SMXA 1U5KA 3UDXA 1PYSB 2NN6I 4HIDA 4KHZA 3I4MH 4DR4Q 5C3EH 2YTXA 4GLAC 2KENA 5H1SE 1C9OA 3CCLA 5JEAJ 1EOVA 4B3TL 2EQSA 1YHAA 2I5LX 2CQOA 4BXXG 1AE3A 3CPFA 1NMFA 5DLQE 3UDFA 1JJCB 2KCTA 1PH8A 3M3YH 4NPSA 5LMUL 1VQEA 4LFCQ 1WOCA 3PUVA 5IYDG 4KLKA 1HNZL 1WFQA 4UPAA 2K50A 4DV2L 4DR7Q 1RIPA 3PV0A 4OWWB 1WYDA 2UUCQ 4QIWE 2PQAA 1OTCA 2R7FA 4JI2Q 2MNAA 2WAQE 4LF9Q 4X62Q 4X64Q 4BBSG 1XNQQ 4GKJQ 3RZDH 5M5XH 1UEBA 1VQ4A 3CPWA 3HFZB 3CCEA 2HT1A 2D0OA 3L2PA 4UP9A 3GTQH 1KXLA 4POFA 3CF5A 2Z6KC 1W3SA 2ZJPA 2B29A 2PNHA 2IX0A 3J81j 4LF4L 1XTDA 4R4QA 3S17H 3CCUA 3AQQA 2Y0SE 4A3EG 4A3DH 3CAMA 3W1GA 5JJLA 4L5SA 3FP9A 4AYBG 1VQOA 5GAEC 1JT8A 3HOVG 1HH2P 2BH2A 4DR6L 1C0AA 4A3DG 3CD6A 5IT9c 2GVBA 5J3BA 1PV4A 2UUBL 2JA6G 1Z47A 2KHJA 5IE8A 4A3CG 1S40A 2VQEL 2WAQG 4QY7A 1M90C 1L1OC 2NVXH 2E5LL 1ASYA 5C0XI 2R92G 4IJHA 3HOUH 4DV7Q 4A3CH 4YWKA 4DR1Q 4JBMA 5C4XG 1VQKA 1VQAA 1CSQA 1X3EA 4DR3L 1WJJA 2UUCL 1Z9FA 2UUBQ 3S1MH 3PIPA 1X3FA 5K36G 1SR3A 4BBRG 1I3QH 1XPOA 1JB7A 2OTJA 1VCIA 3I2ZA 3NEMA 4YCVA 2B63G 4LNQA 4KI0A 2K5VA 1X9NA 1YJNA 1BBWA 4DR4L 4IOAA 4BBRH 2KBNA 3PO3G 1VQ9A 4IPCA 1OXSC 1N34L 1D8LA 1X56A 2I5MX 1NTGA 1S3OA 3KLWA 4PMWA 2IX1A 3M9BA 4EQ5A 4GKKL 3PO3H 4A3BH 1MJEA 2K75A 3TS2A 1B7YB 3J81c 1K8AC 4P71A 5JJIA 4LFBL 3AFQA 4DV1L 4A3BG 1WCMG 4R4IA 2KCMA 3CCVA 5LMUQ 2JQOA 3AYHB 1PH9A 3GTKH 5IYDH 1UE6A 4BA1I 2N3SA 1N32L 2QA4A 1YVCA 1SN8A 4DR7L 2UU9L 1O7IA 5C3EG 3TEHB 1Q12A 2JA9A 4DV3L 2UXDQ 3TREA 1E3PA 2ZTDA 4NXNL 3F2CA 2K5NA 3PUWA 4GNXC 1G291 1KQSA 1VQ8A 2DGYA 4DUZQ 1YZ6A 1KAWA 3FKIG 1J5EL 3EBEA 1CKOA 4GLVB 4JCVE 1GM5A 1XNRL 1HNXQ 2ZTEA 2EXDA 1Q46A 4UP8A 2ALYB 2NVQH 2CFMA 3PF5A 3KDFB 4LUVA 4A3JG 3RLNA 4X65Q 4QGUA 1YNXA 2LSSA 3HKZG 3KDFA 4A3MG 2LXKA 1NE3A 4PG3A 2E5LQ 4A76A 1YHBA 2MO0A 5C44H 1NBWA 3I7FA 1HR0L 1FJGL 4ALPA 3S16H 1D7QA 2VQEQ 4A3JH 4JI8L 4MNOA 1YITA 3H3VI 1PA6A 1XNRQ 4DR3Q 3CQZH 4DV4Q 3ULPA 3WWVA 3HOYH 4A3EH 2K14A 2I5HA 1S72A 1I94Q 1HR0Q 2DUDA 3HKSA 1K8GA 3F8TA 3OYYA 5FLMG 4LF6Q 1L2FA 3HOWH 4B3MQ 5M3FG 4UY8C 4L5TA 2JA5H 4YY3L 4LF8L 2JA7H 3ERSX 3T1YQ 3TRZA 1PH6A 1IBKQ 3OTOQ 1I50H 3HOZH 2B63H 1C7YA 3CCSA 1IL2A 2JEAI 2MO1A 2D0PA 2A1AA 3HOWG 1V1QA 2IY5B 1GVPA 2Q2TA 1T9HA 2PI2A 2E2HH 1QZGA 1KHIA 2AMCB 1UE1A 2HIVA 1IBLL 3K80C 4DPGA 4JI2L 4A3LG 1A8VA 2WFWA 3K81C 4Y52H 2BA1A 2GN5A 1PH7A 3CCJA 1YJWA 1QUQA 3PSIA 1FVIA 3MXNB 4IPGA 1KC8C 4LF5L 4A4IA 3H15A 4DK6C 1OXTA 3ER0A 1PHJA 1N32Q 4X65L 4DV5L 1UE7A 1NJIC 1AE2A 1WCMH 3STBD 1EWIA 1E7ZA 2HHHQ 4X6AH 3M4QA 4IFDG 2ZJRA 3NENA 3PCOB 5ELNA 4JG2A 3A0JA 3GDEA 3CCQA 5BR8L 3F2DA 3CC4A 1SLJA 5AJ3Q 4GNXA 1K9MC 4LF5Q 4R4OA 3HOXH 4LF7L 1U0LA 5IP9G 1A0IA 4YHHL 3JAMc 2ES2A 1CUKA 1VQ5A 3LGJA 1H95A 1LTLA 2N49A 4QJFA 4DR1L 1HNWL 4DR2L 5FLXc 2FXQA 2CCZA 5M3MH 3I4NG 1VQ6A 2A19A 4LFAQ 4IOCA 2AKWB 1SFOH 3CCRA 4JI6Q 2ASBA 4QQBX 1IBKL 4BXXH 4GN4B 4C3IH 1Q82C 2JEBI 1PH3A 4GN5A 1EFWA 2E2IH 1PFSA 4DAMA 1Q81C 4IO9A 2UXCQ 1UWVA 2LXJA 3NELA 4RMFA 5GADC 4A3KH 4HIOA 4JI7L 1V43A 1E1TA 1SE8A 2BA0A 1VQMA 3T1HQ 2CWPA 3K0XA 3F1ZA 1Q1EA 3A5ZB 4DV4L 4JOIA 4A75A 4DV6Q 1EIYB 3S2DH 2ZTCA 4A3KG 3RNUA 4DV2Q 2Q2UA 4GKKQ 4DK3C 4PZ6A 2F3IA 4IFDI 1XJVA 4A3MH 2UXBL 4JV5Q 4X64L 3EN2A 3A5UA 5FLMH 4BY7G 1UE5A 1RL2A 3A74A 1MJCA 3S2HH 5M3FH 4K0KL 3I4OA 4YY3Q 4LF8Q 4WJ4A 1VS0A 3K7AH 4LFBQ 2YV5A 4DKAC 2ATWA 1L0WA 1B8AA 1PH5A 2Z0SA 4JI0Q 1Y1VH 4LFCL 1R9TH 3KF6B 3SGIA 1PH4A 2R6GA 5JJKA 3U58A 2OCEA 3G71A 4DV0Q 1QUQB 1G51A 4NXNQ 2UUAL 3I55A 3HKZE 5GAHC 2VY3A 1XPRA 3D31A 5LMNL 1Q86C 1XPUA 4OO1I 3IRBA 3UDIA 4P74A 2OWOA 3E0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYJ B;  1DGS A;  2WP8 J;  1MKH A;  2GVA A;  3S1R H;  1EYG A;  3HOZ G;  4J15 A;  1N8R C;  2R7Z G;  3UE1 A;  1K3R A;  3CMA A;  2VUM G;  4BY1 H;  3J80 c;  4PZ8 A;  2R93 H;  2HHH L;  2K5H A;  1IBM L;  3E9I A;  4A3L H;  1VQC A;  3BJU A;  4C3H H;  1VQI A;  5EAY A;  2VUM H;  1FL0 A;  4JI3 Q;  4QL5 A;  2UXB Q;  4JC0 A;  4OWT B;  1I6H H;  5HGQ A;  3J80 i;  1VQP A;  4P72 A;  4B3T Q;  4MZ9 A;  1OXV A;  4JBJ A;  1TXY A;  1YIJ A;  2NN6 G;  3F2B A;  1N36 L;  3KFU A;  1EQQ A;  3M4O H;  3ULJ A;  3RLO A;  5M3M G;  3I4N H;  1SRO A;  1ASZ A;  4OO1 G;  1VQB A;  1IBM Q;  4WJ3 M;  1Q7Y C;  1HNZ Q;  3D0F A;  4L5R C;  1XNQ L;  1BKB A;  2VL6 A;  4YWM A;  5IY0 A;  3I56 A;  3U50 C;  3OTO L;  4TQU S;  1EQR A;  2KHI A;  3HOX G;  4DV1 Q;  3GTG H;  2V1C C;  2RHS B;  5IP7 H;  3J81 i;  1M1K C;  4GLX A;  1JMC A;  4XTC S;  5C0X G;  1JE5 A;  4X66 L;  1PVO A;  2E2J H;  4NXM L;  5C4J H;  2RCN A;  3GD7 A;  2C35 B;  2MFI A;  5IP7 G;  1GD7 A;  1YJ9 A;  2ZM6 L;  3GTO H;  4B3R L;  4GN3 B;  1XMQ Q;  1EUJ A;  2Y0S G;  1HZC A;  3FKI H;  1FGU A;  1OXU A;  2XTI A;  4C3J H;  4OON A;  4DV5 Q;  2I0Q A;  4GOP A;  1HNX L;  3M7N A;  3AFP A;  4BY7 H;  4P73 A;  4JYA L;  1PH2 A;  1E22 A;  2HIX A;  2VS1 A;  1VQJ A;  2YTV A;  2YYZ A;  3G6E A;  3J7A 5;  4DV7 L;  2B3G A;  4POG A;  5HY6 A;  1QZH A;  4NB3 A;  5IYC G;  4LF4 Q;  2RF4 A;  3CME A;  3S14 H;  1TWH H;  1YBY A;  2D62 A;  1A62 A;  5C44 G;  3W5O A;  4Y7N H;  1WI5 A;  4FDB A;  2WB1 E;  3KJP A;  4HJ5 A;  4PZ7 A;  1X65 A;  2CKZ B;  1OXX K;  2ID0 A;  4P75 A;  4OWX B;  1VQL A;  1HZ9 A;  3W1B A;  4MTN A;  1XMO L;  3PF4 A;  2NZH A;  1I5F A;  2XGT A;  2VZA A;  4KHP L;  5ELO A;  3CC7 A;  2JK8 A;  4A3F G;  3M85 A;  4YCU A;  2R7Z H;  2N78 A;  3TS0 A;  4DR6 Q;  1Y1V G;  4X62 L;  4GNX B;  1Y14 B;  4LF6 L;  4DR5 L;  1VQN A;  2F4V L;  3RR5 A;  1XMO Q;  4BY1 G;  4DUY L;  4A3I H;  4JI4 L;  2UXC L;  1Q8K A;  2CWA A;  1AH9 A;  2K4K A;  3KF6 A;  4OXP A;  1X55 A;  2IHF A;  3S1N H;  4GKJ L;  1HZA A;  3MEF A;  1XMQ L;  4EX5 A;  3GTJ H;  2OTL A;  4LUO A;  2ZM6 Q;  1G6P A;  4HJA A;  2R92 H;  3RZO H;  3S15 H;  4DV6 L;  1SRU A;  4YHH Q;  2QEX A;  3PUX A;  2Q2I A;  1TWA H;  3DLL A;  3ULL A;  3T1H L;  4A3I G;  1KIX A;  1IBL Q;  1FJG Q;  3H3V H;  5M5W H;  1B70 B;  4LUZ A;  4GS3 A;  1KRT A;  3CC2 A;  4B3S L;  1N34 Q;  1L1O A;  3H0G G;  3TQY A;  3ZJY C;  1YEZ A;  3B6Y A;  3KJO A;  3PUY A;  2EIF A;  5GAG C;  4DNI A;  5M5Y H;  1Y1W H;  1X3G A;  4JI0 L;  3G48 A;  3S1Q H;  1VQH A;  4APV A;  1YHQ A;  1GKH A;  3JC6 6;  3CW2 C;  1X54 A;  2N8N A;  3H0G H;  4IPH A;  3J7Z C;  1GO3 E;  1P16 A;  4H02 A;  1CKM A;  4HIM A;  3GTL H;  2L15 A;  4X66 Q;  3FHW A;  2VW9 A;  4B3S Q;  5LMN Q;  1N33 Q;  1J5E Q;  5IP9 H;  2UUA Q;  1IZ6 A;  1TWF H;  4C2M H;  1BBU A;  4JOI C;  3VDY A;  1BVS A;  1NY4 A;  4AQY L;  4IFD J;  3U4Z A;  5BR8 Q;  4JBW A;  2F4V Q;  1VQF A;  4L5Q A;  4JI1 Q;  5IWA L;  4GOP B;  4DV3 Q;  2UXD L;  3PO2 G;  1QVF A;  1MIU A;  3AEV A;  4A3G H;  3OW2 A;  1L1O B;  2NZO A;  4XIG S;  1K73 C;  1TWC H;  4JI1 L;  4R1J A;  4JV5 L;  5IYC H;  4A93 H;  3PO2 H;  3STB C;  1CSP A;  4AQY Q;  2H5X A;  2PQA B;  1PYB A;  4JI3 L;  4A3G G;  5IYB H;  2JJQ A;  1TWG H;  5IWA Q;  3PUZ A;  4KHP Q;  2HQL A;  3E9H A;  1N9W A;  5GQO A;  3BZK A;  4DV0 L;  3RN5 A;  1N36 Q;  4OX9 L;  4LF7 Q;  1JJG A;  3EIV A;  3NBH B;  4B3M L;  2Z6K A;  5IYB G;  4BBS H;  2BH8 A;  4LWC A;  5C4X H;  5E7N A;  4R4C A;  2YTY A;  1P8L A;  4HJ7 A;  3BZC A;  4JI6 L;  4LFA L;  2R7D A;  3PGZ A;  1E24 A;  4TVA B;  4HJ8 A;  4R4T A;  4RG1 A;  2AHO B;  1I94 L;  4BA2 I;  1X6O A;  3CXC A;  3RLF A;  3ICE A;  3GTP H;  4JI5 L;  1KD1 C;  2PI2 E;  4JBK A;  4JI8 Q;  3RN2 A;  3KF8 B;  4NXM Q;  1HJP A;  1QVC A;  2QGQ A;  3HOY G;  4O0A A;  3PIO A;  1PH1 A;  4DAY B;  1CKN A;  2JA6 H;  3L7Z C;  2VQF L;  1Q1B A;  1HZB A;  4LW1 A;  2RHQ B;  4A3F H;  3GO5 A;  3KOJ A;  4DUZ L;  3CCM A;  4B3R Q;  4AH6 A;  4YCW A;  1V9P A;  4GOP C;  1JJ2 A;  4IPD A;  2JA8 H;  5AJ3 L;  1A63 A;  2OQ0 A;  1VQ7 A;  4HJ9 A;  4JI4 Q;  2E8G A;  1K83 H;  2JA5 G;  3HOU G;  1LYL A;  2JA7 G;  3T1Y L;  2F52 A;  2WB1 G;  3GTM H;  3K7U C;  3L0O A;  3Q8D A;  3HOV H;  2UU9 Q;  5GRO A;  2JA8 G;  4OX9 Q;  1IXR A;  2R93 G;  4UP7 A;  4K0K Q;  4AIM A;  4YWL A;  1W2B A;  1VQG A;  3S24 A;  2MQH A;  2AWN A;  2Q2H A;  3M4P A;  3DM3 A;  1KRS A;  5C0X J;  4DR2 Q;  2YU9 H;  3JAM i;  2NVT H;  1N33 L;  3CP0 A;  4O2D A;  3UE0 A;  1QVG A;  4LF9 L;  4IJL A;  1CKN B;  4AYB E;  2NVY H;  5FJ8 H;  2K52 A;  3KYH C;  1Y1W G;  2A8V A;  4JI7 Q;  1VQD A;  4JI5 Q;  2IHE A;  1LM0 A;  1YI2 A;  2AWO A;  1NMG A;  2IT1 A;  4DUY Q;  4DR5 Q;  2ZJQ A;  4JYA Q;  5FJ8 G;  1E1O A;  2VNU D;  4HIK A;  3G4S A;  1HNW Q;  3UDG A;  3I4M G;  5JEA G;  1HR0 W;  2OQK A;  2VQF Q;  3U4V A;  4A93 G;  4ME3 A;  2JE6 I;  1J6Q A;  1KL9 A;  3BU2 A;  2PMZ E;  1EIF A;  1LUZ A;  1K0R A;  3K8A A;  5LMN W;  1SMX A;  1U5K A;  3UDX A;  1PYS B;  2NN6 I;  4HID A;  4KHZ A;  3I4M H;  4DR4 Q;  5C3E H;  2YTX A;  4GLA C;  2KEN A;  5H1S E;  1C9O A;  3CCL A;  5JEA J;  1EOV A;  4B3T L;  2EQS A;  1YHA A;  2I5L X;  2CQO A;  4BXX G;  1AE3 A;  3CPF A;  1NMF A;  5DLQ E;  3UDF A;  1JJC B;  2KCT A;  1PH8 A;  3M3Y H;  4NPS A;  5LMU L;  1VQE A;  4LFC Q;  1WOC A;  3PUV A;  5IYD G;  4KLK A;  1HNZ L;  1WFQ A;  4UPA A;  2K50 A;  4DV2 L;  4DR7 Q;  1RIP A;  3PV0 A;  4OWW B;  1WYD A;  2UUC Q;  4QIW E;  2PQA A;  1OTC A;  2R7F A;  4JI2 Q;  2MNA A;  2WAQ E;  4LF9 Q;  4X62 Q;  4X64 Q;  4BBS G;  1XNQ Q;  4GKJ Q;  3RZD H;  5M5X H;  1UEB A;  1VQ4 A;  3CPW A;  3HFZ B;  3CCE A;  2HT1 A;  2D0O A;  3L2P A;  4UP9 A;  3GTQ H;  1KXL A;  4POF A;  3CF5 A;  2Z6K C;  1W3S A;  2ZJP A;  2B29 A;  2PNH A;  2IX0 A;  3J81 j;  4LF4 L;  1XTD A;  4R4Q A;  3S17 H;  3CCU A;  3AQQ A;  2Y0S E;  4A3E G;  4A3D H;  3CAM A;  3W1G A;  5JJL A;  4L5S A;  3FP9 A;  4AYB G;  1VQO A;  5GAE C;  1JT8 A;  3HOV G;  1HH2 P;  2BH2 A;  4DR6 L;  1C0A A;  4A3D G;  3CD6 A;  5IT9 c;  2GVB A;  5J3B A;  1PV4 A;  2UUB L;  2JA6 G;  1Z47 A;  2KHJ A;  5IE8 A;  4A3C G;  1S40 A;  2VQE L;  2WAQ G;  4QY7 A;  1M90 C;  1L1O C;  2NVX H;  2E5L L;  1ASY A;  5C0X I;  2R92 G;  4IJH A;  3HOU H;  4DV7 Q;  4A3C H;  4YWK A;  4DR1 Q;  4JBM A;  5C4X G;  1VQK A;  1VQA A;  1CSQ A;  1X3E A;  4DR3 L;  1WJJ A;  2UUC L;  1Z9F A;  2UUB Q;  3S1M H;  3PIP A;  1X3F A;  5K36 G;  1SR3 A;  4BBR G;  1I3Q H;  1XPO A;  1JB7 A;  2OTJ A;  1VCI A;  3I2Z A;  3NEM A;  4YCV A;  2B63 G;  4LNQ A;  4KI0 A;  2K5V A;  1X9N A;  1YJN A;  1BBW A;  4DR4 L;  4IOA A;  4BBR H;  2KBN A;  3PO3 G;  1VQ9 A;  4IPC A;  1OXS C;  1N34 L;  1D8L A;  1X56 A;  2I5M X;  1NTG A;  1S3O A;  3KLW A;  4PMW A;  2IX1 A;  3M9B A;  4EQ5 A;  4GKK L;  3PO3 H;  4A3B H;  1MJE A;  2K75 A;  3TS2 A;  1B7Y B;  3J81 c;  1K8A C;  4P71 A;  5JJI A;  4LFB L;  3AFQ A;  4DV1 L;  4A3B G;  1WCM G;  4R4I A;  2KCM A;  3CCV A;  5LMU Q;  2JQO A;  3AYH B;  1PH9 A;  3GTK H;  5IYD H;  1UE6 A;  4BA1 I;  2N3S A;  1N32 L;  2QA4 A;  1YVC A;  1SN8 A;  4DR7 L;  2UU9 L;  1O7I A;  5C3E G;  3TEH B;  1Q12 A;  2JA9 A;  4DV3 L;  2UXD Q;  3TRE A;  1E3P A;  2ZTD A;  4NXN L;  3F2C A;  2K5N A;  3PUW A;  4GNX C;  1G29 1;  1KQS A;  1VQ8 A;  2DGY A;  4DUZ Q;  1YZ6 A;  1KAW A;  3FKI G;  1J5E L;  3EBE A;  1CKO A;  4GLV B;  4JCV E;  1GM5 A;  1XNR L;  1HNX Q;  2ZTE A;  2EXD A;  1Q46 A;  4UP8 A;  2ALY B;  2NVQ H;  2CFM A;  3PF5 A;  3KDF B;  4LUV A;  4A3J G;  3RLN A;  4X65 Q;  4QGU A;  1YNX A;  2LSS A;  3HKZ G;  3KDF A;  4A3M G;  2LXK A;  1NE3 A;  4PG3 A;  2E5L Q;  4A76 A;  1YHB A;  2MO0 A;  5C44 H;  1NBW A;  3I7F A;  1HR0 L;  1FJG L;  4ALP A;  3S16 H;  1D7Q A;  2VQE Q;  4A3J H;  4JI8 L;  4MNO A;  1YIT A;  3H3V I;  1PA6 A;  1XNR Q;  4DR3 Q;  3CQZ H;  4DV4 Q;  3ULP A;  3WWV A;  3HOY H;  4A3E H;  2K14 A;  2I5H A;  1S72 A;  1I94 Q;  1HR0 Q;  2DUD A;  3HKS A;  1K8G A;  3F8T A;  3OYY A;  5FLM G;  4LF6 Q;  1L2F A;  3HOW H;  4B3M Q;  5M3F G;  4UY8 C;  4L5T A;  2JA5 H;  4YY3 L;  4LF8 L;  2JA7 H;  3ERS X;  3T1Y Q;  3TRZ A;  1PH6 A;  1IBK Q;  3OTO Q;  1I50 H;  3HOZ H;  2B63 H;  1C7Y A;  3CCS A;  1IL2 A;  2JEA I;  2MO1 A;  2D0P A;  2A1A A;  3HOW G;  1V1Q A;  2IY5 B;  1GVP A;  2Q2T A;  1T9H A;  2PI2 A;  2E2H H;  1QZG A;  1KHI A;  2AMC B;  1UE1 A;  2HIV A;  1IBL L;  3K80 C;  4DPG A;  4JI2 L;  4A3L G;  1A8V A;  2WFW A;  3K81 C;  4Y52 H;  2BA1 A;  2GN5 A;  1PH7 A;  3CCJ A;  1YJW A;  1QUQ A;  3PSI A;  1FVI A;  3MXN B;  4IPG A;  1KC8 C;  4LF5 L;  4A4I A;  3H15 A;  4DK6 C;  1OXT A;  3ER0 A;  1PHJ A;  1N32 Q;  4X65 L;  4DV5 L;  1UE7 A;  1NJI C;  1AE2 A;  1WCM H;  3STB D;  1EWI A;  1E7Z A;  2HHH Q;  4X6A H;  3M4Q A;  4IFD G;  2ZJR A;  3NEN A;  3PCO B;  5ELN A;  4JG2 A;  3A0J A;  3GDE A;  3CCQ A;  5BR8 L;  3F2D A;  3CC4 A;  1SLJ A;  5AJ3 Q;  4GNX A;  1K9M C;  4LF5 Q;  4R4O A;  3HOX H;  4LF7 L;  1U0L A;  5IP9 G;  1A0I A;  4YHH L;  3JAM c;  2ES2 A;  1CUK A;  1VQ5 A;  3LGJ A;  1H95 A;  1LTL A;  2N49 A;  4QJF A;  4DR1 L;  1HNW L;  4DR2 L;  5FLX c;  2FXQ A;  2CCZ A;  5M3M H;  3I4N G;  1VQ6 A;  2A19 A;  4LFA Q;  4IOC A;  2AKW B;  1SFO H;  3CCR A;  4JI6 Q;  2ASB A;  4QQB X;  1IBK L;  4BXX H;  4GN4 B;  4C3I H;  1Q82 C;  2JEB I;  1PH3 A;  4GN5 A;  1EFW A;  2E2I H;  1PFS A;  4DAM A;  1Q81 C;  4IO9 A;  2UXC Q;  1UWV A;  2LXJ A;  3NEL A;  4RMF A;  5GAD C;  4A3K H;  4HIO A;  4JI7 L;  1V43 A;  1E1T A;  1SE8 A;  2BA0 A;  1VQM A;  3T1H Q;  2CWP A;  3K0X A;  3F1Z A;  1Q1E A;  3A5Z B;  4DV4 L;  4JOI A;  4A75 A;  4DV6 Q;  1EIY B;  3S2D H;  2ZTC A;  4A3K G;  3RNU A;  4DV2 Q;  2Q2U A;  4GKK Q;  4DK3 C;  4PZ6 A;  2F3I A;  4IFD I;  1XJV A;  4A3M H;  2UXB L;  4JV5 Q;  4X64 L;  3EN2 A;  3A5U A;  5FLM H;  4BY7 G;  1UE5 A;  1RL2 A;  3A74 A;  1MJC A;  3S2H H;  5M3F H;  4K0K L;  3I4O A;  4YY3 Q;  4LF8 Q;  4WJ4 A;  1VS0 A;  3K7A H;  4LFB Q;  2YV5 A;  4DKA C;  2ATW A;  1L0W A;  1B8A A;  1PH5 A;  2Z0S A;  4JI0 Q;  1Y1V H;  4LFC L;  1R9T H;  3KF6 B;  3SGI A;  1PH4 A;  2R6G A;  5JJK A;  3U58 A;  2OCE A;  3G71 A;  4DV0 Q;  1QUQ B;  1G51 A;  4NXN Q;  2UUA L;  3I55 A;  3HKZ E;  5GAH C;  2VY3 A;  1XPR A;  3D31 A;  5LMN L;  1Q86 C;  1XPU A;  4OO1 I;  3IRB A;  3UDI A;  4P74 A;  2OWO A;  3E0E A; 
#chains in the Genus database with same CATH topology
 3NP8 A;  1BCP B;  1TY2 A;  2WP8 J;  4WRD A;  2BDO A;  4J15 A;  2R7Z G;  3AMU A;  3CMA A;  1D5Z C;  2R93 H;  2HHH L;  4A3L H;  3R93 A;  3BJU A;  2NN6 H;  5EAY A;  3K57 A;  2Z1C A;  2JA8 B;  2VUM H;  2NB0 A;  4JC0 A;  1I6H H;  3N52 A;  3J80 i;  4PNY A;  4JBJ A;  1TXY A;  3M4O H;  1Q3L A;  1JIC A;  5CBE E;  3RLO A;  3BDC A;  2AQ3 B;  1XXG A;  3QOL A;  1DOM A;  1G2S A;  1HUN A;  2A6E C;  5EJW A;  1EEI D;  4ZKC B;  3GTG H;  5IP7 H;  1EYA A;  2AUJ D;  1M1K C;  1DJR D;  3I3C A;  2CW0 C;  4XTC S;  1JE5 A;  1PTO H;  1SND A;  3QO2 A;  1K0S A;  2RCN A;  4FF2 A;  1GD7 A;  1LO5 D;  4I65 A;  2E2H B;  1QNU A;  5DM6 3;  2EY6 A;  2Y0S G;  2HDL A;  1FGU A;  2MP1 A;  1SYG A;  4OON A;  4DV5 Q;  3AFP A;  5I6W A;  2YTV A;  5CC4 A;  1EY5 A;  2VS1 A;  3J7A 5;  2L5T A;  2B2U A;  4H13 C;  3NQI A;  4POG A;  4HED A;  5HY6 A;  1R4P B;  3MC0 B;  3S14 H;  3QJY A;  1PYW D;  4J8Q A;  1LAB A;  2XWB B;  4PZ7 A;  5ELB A;  1X65 A;  2KCN A;  4P75 A;  5C3W A;  1EU3 A;  1VQL A;  2QDB A;  1CI3 M;  1XMO L;  5HUR A;  2NZH A;  1I5F A;  1FD7 D;  2XGT A;  4U67 3;  3M85 A;  1PTO B;  1VMP A;  3DM1 A;  4YCU A;  4EQO A;  4HCE A;  1SSO A;  4DR6 Q;  4IN3 A;  2WII B;  1XMO Q;  5IT9 L;  1Q8K A;  1DYQ A;  4OXP A;  3KF6 A;  2IHF A;  2F0T A;  4CKB A;  1MSG A;  1TS2 A;  1XMQ L;  4EX5 A;  1PDQ A;  3GTJ H;  3S17 B;  1LTT D;  1G6P A;  3DLL A;  2EYF A;  3PUX A;  2A6E D;  1TWA H;  1WTR A;  3T1H L;  1FJG Q;  2QEJ C;  1SMY D;  5EPL A;  1B70 B;  3D3R A;  1CK1 A;  3CC2 A;  4B3S L;  2NVX B;  4K2L A;  5COR A;  5E4W C;  1WTO A;  3E0J A;  1G6Z A;  3G48 A;  4APV A;  3JC6 6;  3HOY B;  1X54 A;  4OL7 A;  2G5D A;  4RCO A;  1HHV A;  1P16 A;  1CKM A;  1E2W A;  4HIM A;  1EYD A;  2L15 A;  4KJN A;  2VW9 A;  3D8G A;  3HOV B;  1F77 A;  1Y8P B;  4K14 A;  1TWF H;  2XNA C;  4JOI C;  3VDY A;  3HOZ B;  1NY4 A;  2CVR A;  1SDF A;  3I4M B;  3U4Z A;  2F4V Q;  1QVF A;  1B9M A;  3VA5 A;  1L1O B;  3R3O A;  2D9U A;  3PIP 3;  4BBS B;  3I70 A;  1JE4 A;  1II3 A;  4HR7 B;  3EA6 A;  3BVZ A;  3OMC A;  2JJQ A;  1TWG H;  4A3M B;  5IWA Q;  2PNR C;  1EY4 A;  5DEH A;  4DV0 L;  3RN5 A;  1F2L A;  1D5M C;  4K5W A;  5M5Y B;  2BH8 A;  3GTQ B;  1IW7 C;  3EFX D;  3BS1 A;  4IUV A;  5ELD A;  1P8L A;  2VB2 X;  4LFA L;  1E24 A;  3DMU A;  4TVA B;  1I94 L;  3CXC A;  3RLF A;  2ZT9 C;  5CV8 A;  5CV5 A;  3RUZ A;  5EBD A;  3GQB A;  4Q5V A;  5A2Q E;  1PH1 A;  5ELE A;  1UAP A;  1Q1B A;  4LW1 A;  2RHQ B;  2RBM A;  3GO5 A;  4B3R Q;  3RMH A;  1AEX A;  1B9N A;  1JJ2 A;  3VYR A;  1BQQ T;  4XXE A;  2OQ0 A;  4K6D A;  4JI4 Q;  1K83 H;  1MBY A;  1EIH A;  4FO2 A;  5JJZ A;  1X32 A;  4IUR A;  3T56 B;  2R93 G;  2Q8R E;  4IUP A;  4UP7 A;  4K0K Q;  4AIM A;  3AU7 A;  3M4P A;  3DM3 A;  5C0X J;  1STN A;  3ITP A;  2OXP A;  3JAM i;  2XRQ D;  2J7Z A;  4LF9 L;  1STA A;  5D3D A;  1WTQ A;  1GHJ A;  2IL8 A;  1JCK B;  1S4Z A;  4TSS A;  3VA7 A;  3A7A B;  2IHE A;  1LM0 A;  2AWO A;  1NMG A;  3DWQ A;  1TWA B;  1TR5 A;  4QUF A;  4JYA Q;  2LS0 1;  3G4S A;  3UDG A;  2F03 A;  1BXT A;  2I46 A;  1V1P B;  2OQK A;  1K28 A;  4A93 G;  1KL9 A;  3L3O C;  5EKL A;  3TP8 A;  1K0R A;  4DA2 A;  5I4D A;  2X6G A;  4G7O C;  2NN6 I;  4HID A;  4DR4 Q;  1JWU D;  1WD0 A;  2SOB A;  2RKS A;  2YTX A;  5A35 A;  1ZYR C;  4L8J A;  4UDU C;  2CQO A;  5DLQ E;  3SXH A;  1NMF A;  1SNQ A;  2SEB D;  4NPS A;  5LMU L;  4TKO B;  1M8A A;  1HNZ L;  4UPA A;  1PZJ D;  2PQA A;  3M4O B;  2F0U A;  1SFO B;  3J7A F;  1F2Y A;  5C4H A;  4LF9 Q;  4GKJ Q;  4WFN 3;  3BYY B;  2IW3 A;  4QUC A;  3VYS A;  1SNC A;  3PQI A;  4QMG A;  1Z6H A;  3CF5 A;  3PO2 B;  1C4Q A;  2Z6K C;  1W3S A;  5M3F B;  2PNH A;  4LF4 L;  2IX0 A;  1XTD A;  4X3U A;  3CCU A;  4A3E G;  3MFG A;  3LX0 A;  3NQT A;  1VQO A;  4HAE A;  2K28 A;  4ZCK A;  5GAE C;  2KUM A;  1PV4 A;  2UUB L;  1CQV A;  1S40 A;  1KNE A;  2A69 D;  4WJW A;  2VQE L;  2NVX H;  2E5L L;  5C0X I;  3J81 L;  3HS0 C;  1XYI A;  4YWK A;  1NR4 A;  4X3K A;  4A3C H;  1VQA A;  1CSQ A;  1U4M A;  2E2J B;  4DR3 L;  3S15 B;  2UUC L;  3S1M H;  3GTO B;  1JB7 A;  4UHV A;  2EPB A;  3I2Z A;  3NEM A;  5M3M B;  3JAM E;  4KI0 A;  2K5V A;  2RSO A;  1X9N A;  4IOA A;  1SAP A;  1HTL D;  4ZAI A;  1OXS C;  1D8L A;  4DNR B;  3Q0A A;  1DCZ A;  1S3O A;  4FF1 A;  4PMW A;  3TP5 A;  2EJM A;  1A6X A;  4IUN A;  2K75 A;  3TS2 A;  2XIW A;  4U68 A;  2K5Q A;  4X3T A;  2LFN A;  4OIK A;  3J81 c;  3KLS A;  1RDP D;  3KF8 A;  2WKD A;  2K05 A;  2KCM A;  1X3P A;  2JQO A;  1PH9 A;  1UE6 A;  1IYU A;  1N32 L;  1SNM A;  2UXD Q;  2HQE A;  2WAC A;  2IPK D;  1LTA D;  4GNX C;  1G29 1;  1KQS A;  1VQ8 A;  5CMD A;  4DUZ Q;  1YZ6 A;  3FKI G;  1J5E L;  3EBE A;  3OIQ A;  4GLV B;  4LMQ D;  2NYZ D;  1K8O A;  2PPB C;  4UP8 A;  1Q46 A;  2ALY B;  2A68 C;  5C5M A;  4ODG A;  4QGU A;  2LSS A;  3EQL C;  4A3E B;  3I7F A;  3S16 H;  1FJG L;  1D7Q A;  1JOQ A;  3G7L A;  1S5D D;  4JI8 L;  3SR1 A;  1XNR Q;  1SEB D;  3CQZ H;  3ULP A;  3WWV A;  1K83 B;  1ENA A;  1FR3 A;  1Y8N B;  2DNE A;  4HTH A;  3FEW X;  3OYY A;  1I6H B;  5M3F G;  1SE3 A;  2MUY A;  4J1M A;  4LF8 L;  4A3F B;  3ERS X;  3T1Y Q;  4Z9C B;  3HOZ H;  1ESF A;  2B63 H;  2X69 A;  1IL2 A;  2JEA I;  2MO1 A;  1QE6 A;  2A1A A;  1LT3 D;  2IY5 B;  1GVP A;  1KHI A;  2AMC B;  2A69 C;  1IBL L;  4DPG A;  4JI2 L;  2WFW A;  2GN5 A;  3KBG A;  1QUQ A;  1X3Q A;  1EY9 A;  1FVI A;  3MXN B;  4LF5 L;  3OWE B;  2AUK A;  1AZP A;  3MXN A;  5J1Z A;  5AFW A;  2G9H D;  1MSH A;  2CH4 W;  4EGV A;  3STB D;  3QWN A;  2XRS D;  5K5P A;  3M4Q A;  3GDE A;  1SYF A;  5BR8 L;  3CC4 A;  1PFN A;  4GNX A;  5C3X A;  4F8M A;  1A0I A;  1LT6 D;  3JAM c;  1LV9 A;  1KNA A;  5D3I B;  1LTL A;  4QJF A;  1H9M A;  2F0Q A;  4FXD A;  4DR2 L;  5FLX c;  2FXQ A;  1QCB D;  4LFA Q;  1JOO A;  4BXX H;  1Q82 C;  4RGO S;  4C1N K;  4GN5 A;  1STG A;  3HRZ C;  2K01 A;  2PO4 A;  4C3J G;  1UWV A;  1PFB A;  2RDH A;  4CDC C;  1OO9 B;  4RMF A;  4HIO A;  4JI7 L;  5E1F A;  1G2T A;  3P20 A;  4FF3 A;  4H44 C;  3F1Z A;  2L9H A;  3D4D A;  4JOI A;  3TP7 A;  4DV6 Q;  5I2Y A;  4RA8 A;  3RNU A;  4DV2 Q;  3QB3 A;  4CDD C;  1Y1V B;  3FPP A;  1XJV A;  4X64 L;  4J6H A;  3A5U A;  3A74 A;  1TS4 A;  4V19 0;  4K0K L;  2O4X A;  4I7Z C;  4LFB Q;  1H9K A;  2H1E A;  4DKA C;  4JI0 Q;  4B08 A;  5IGC A;  4C3I B;  4DV0 Q;  4N9T A;  2JP1 A;  3I55 A;  2VY3 A;  1XPR A;  4OO1 I;  3E0E A;  1IL8 A;  2EYM A;  1DGS A;  1FNU A;  2GVA A;  1V8Q A;  2F0D A;  4RGT A;  3S1R H;  1EEF D;  1B3A A;  1HPC A;  1JQY D;  3UE1 A;  2VUM G;  1LTI D;  4BY1 H;  4I7A A;  1AN8 A;  4C3H H;  3Q22 A;  2X6L A;  1QIL A;  3K5N A;  4QL5 A;  4EQP A;  4N8F A;  5HGQ A;  3BYT B;  4CDE C;  4MZ9 A;  1PZI D;  1HRJ A;  3KFU A;  1N36 L;  3GV3 A;  1PFM A;  5M3M G;  1E2Z A;  1KDC A;  5D65 A;  1A3V A;  2B2T C;  4WJ3 M;  3O13 A;  1CT1 D;  1HNZ Q;  3D0F A;  4DF7 A;  4L5R C;  1BKB A;  5IIF A;  5IY0 A;  5C4J B;  3NUC A;  3C3L A;  5IT9 E;  1LTR D;  1ET6 A;  3HOX G;  4DV1 Q;  1DZ1 A;  2K03 A;  2V1C C;  2F0G A;  5KRU A;  2L1B A;  2E2J H;  3GTG B;  3GD7 A;  1ICW A;  5FKA C;  1I3Q B;  1H9S B;  3GTO H;  1IHZ A;  4XYQ A;  1BR9 A;  1HZC A;  3FKI H;  2XTI A;  5C3E B;  4GOP A;  4JYA L;  1PH2 A;  3RZD B;  2B3G A;  1QZH A;  4NB3 A;  4NW2 A;  2RF4 A;  2K32 A;  4LF4 Q;  1SMY C;  1TWH H;  4C3J B;  1PRT D;  3W5O A;  2NVQ B;  1WI5 A;  2ID0 A;  2CKZ B;  4OWX B;  1SYC A;  2SNS A;  4KKU A;  3W1B A;  4MTN A;  1ENF A;  4XT1 B;  4KHP L;  3C1E A;  4UAI A;  1Y1V G;  1VQN A;  1Y14 B;  2C5C A;  2CWA A;  2H4O A;  1S5E D;  3S1N H;  1HZA A;  5EGT A;  4L6T B;  5M5W B;  4DV6 L;  4YHH Q;  2QEX A;  4A93 B;  2Q2I A;  1PMR A;  3V96 A;  4A3I G;  4DK0 A;  1MHW C;  4L63 B;  3H0G G;  3TQY A;  4XYO A;  3ZJY C;  1B4O A;  2JSO A;  3KJO A;  5M5Y H;  3Q6S A;  1X3G A;  4RFB A;  1VQH A;  1GKH A;  1HCZ A;  4CJ1 B;  1LAC A;  3J7Z C;  3H0G H;  3MEH A;  5KNB A;  4DXF A;  2CH4 A;  2F0P A;  1N33 Q;  1J5E Q;  2UUA Q;  2E2I B;  1IZ6 A;  3GTM B;  1EZ8 A;  4C2M H;  1BBU A;  4IFD J;  3NXW A;  2L4N A;  4RKB A;  4JBW A;  4C56 C;  5IWA L;  1LT5 D;  2UXD L;  4FYD A;  2CQA A;  3OW2 A;  5C0X H;  2ENB A;  5BN3 A;  2OT2 A;  2WKC A;  4AYB B;  1CZW A;  2K33 A;  1CSP A;  1BDO A;  3TME A;  4BY1 B;  5JOB A;  1MGS A;  3H3V C;  4KY7 A;  3NTK A;  4KD4 A;  4S3S A;  5TSS A;  2B2U C;  4C1N I;  1CTM A;  1N9W A;  5GQO A;  3BZK A;  4OX9 L;  4LF7 Q;  3GTK B;  1JJG A;  4LWC A;  4HJ7 A;  4JI6 L;  4RG1 A;  4BA2 I;  2AHO B;  1X6O A;  1RKN A;  4EQN A;  2L12 A;  4DFA A;  1K3B C;  1KD1 C;  1A2T A;  2PI2 E;  4N9P A;  4NXM Q;  3BG3 A;  4O0A A;  1S5C D;  1YNN C;  1CKN A;  4H0L C;  2VQF L;  3DEP A;  2SNM A;  3KOJ A;  2RA4 A;  4ME5 A;  4KD3 A;  4YCW A;  3HOW B;  2JA6 B;  2F3V A;  1D6E C;  4FF4 A;  3DEO A;  1ET9 A;  1JR0 D;  2F52 A;  2WB1 G;  5IGB A;  4XQN A;  1SE4 A;  3Q8D A;  2UU9 Q;  5GRO A;  5JAV A;  4OX9 Q;  4R8I A;  3S24 A;  4DR2 Q;  4HMJ A;  4KHV A;  1A3U A;  1H9J A;  3CP0 A;  4O2D A;  1CKN B;  5FJ8 H;  1CZG A;  2K52 A;  4IAL A;  3KYH C;  3AB9 A;  1Y1W G;  2A8V A;  5F2D A;  3H09 A;  4DUY Q;  4DR5 Q;  2ZJQ A;  1D1I A;  5FJ8 G;  1E1O A;  4HIK A;  5G3L F;  3E5S A;  1YNJ C;  4OEM B;  5JEA G;  1EY7 A;  5CR3 A;  3A8J E;  2VQF Q;  3U4V A;  1S5B D;  4ME3 A;  1J6Q A;  1EIF A;  1B50 A;  5LMN W;  1PYS B;  5C3E H;  1JOK A;  1TU2 B;  2EQS A;  1HA6 A;  2I5L X;  4BXX G;  1AE3 A;  3CPF A;  1JJC B;  2KCT A;  1PH8 A;  1EWC A;  1I4X A;  1VQE A;  4QCL A;  1I4R A;  1STY A;  4DV2 L;  2B2V C;  1RIP A;  3PV0 A;  2DY7 A;  4NDX A;  4ZK9 B;  3C2P A;  1UNS A;  4FP5 D;  2R7F A;  4X62 Q;  2M00 A;  4X64 Q;  1O7L A;  5CV6 A;  1E2V A;  2XVS A;  2QKI C;  2D0O A;  5CBA E;  4JVZ A;  3J81 j;  4BBS H;  4R4Q A;  3S14 B;  4NMZ A;  3J80 L;  4B9X A;  5J22 A;  3W1G A;  3S1N B;  3K6O A;  2B8F A;  4AYB G;  5KND A;  4EVO A;  4CJ2 C;  1C0A A;  3CD6 A;  5IT9 c;  2GVB A;  3VR2 A;  1Z47 A;  4CBV A;  5IE8 A;  3MVV A;  4A3C G;  4RKL A;  2R92 G;  1ZEQ X;  4PMC A;  3HOU H;  5T1G A;  4JBM A;  2UUB Q;  3J7A V;  1D5X C;  2Z8L A;  2EYP A;  1ZKO A;  2B63 G;  1MD2 D;  4V0B A;  4DR4 L;  1STE A;  4IPC A;  3KLW A;  4H7B A;  2IX1 A;  4EQ5 A;  1ESR A;  1PLF A;  1SNO A;  2KOL A;  4A3B H;  1MJE A;  3BDO A;  1HQR D;  3VR5 A;  2R92 B;  4PMB A;  4A3B G;  1G91 A;  4R4I A;  5IYD H;  4DGZ A;  1ENC A;  2N3S A;  2UU9 L;  2B39 A;  3UI2 A;  3TEH B;  3V2T A;  1Q12 A;  2FMM A;  3TRE A;  1E3P A;  3TDQ A;  4BWG B;  2N55 A;  4NXN L;  2K5N A;  2WAQ B;  1PTO C;  1KAW A;  1VF5 C;  4JCV E;  1XNR L;  3TBI B;  5CGK A;  2NVQ H;  1U9R A;  1BNZ A;  4A3M G;  3HKZ G;  1B53 A;  4BS9 A;  4PG3 A;  4A76 A;  1HR0 L;  1QG7 A;  4NKL A;  5NUC A;  4MNO A;  4A3J H;  1YNN D;  3OIP A;  3H3V I;  4DV4 Q;  4A3E H;  2JN4 A;  1EY6 A;  1I94 Q;  2J4X A;  2O5I C;  1AW7 A;  4K8I A;  4IQZ A;  5EKK A;  5K36 H;  1L2F A;  4KKS A;  2JA5 H;  3TSS A;  1FYC A;  1WTX A;  3TRZ A;  3OTO Q;  1I50 H;  1SE2 A;  2ZXP A;  4KN7 C;  1EYC A;  4CKC A;  1EY8 A;  4K5V A;  3W3A A;  1F2M A;  2Q8I B;  5IOD A;  5CV9 A;  1GUG A;  2HIV A;  1UE1 A;  3MXP A;  1QZG A;  3K80 C;  1A8V A;  4G7Z C;  3PSI A;  5KIX A;  2ZXR A;  1QJO A;  1JC7 A;  1PHJ A;  1N32 Q;  4X65 L;  3KLR A;  2G9D A;  1WCM H;  1EWI A;  1V1O A;  3VYT A;  2HHH Q;  4X6A H;  2ZJR A;  2HDM A;  3NEN A;  3PCO B;  1EU4 A;  3F2D A;  3SVM A;  5I9P A;  5AJ3 Q;  1K9M C;  4R4O A;  1NSN S;  1PXU A;  4LF7 L;  1U0L A;  3LWU A;  1VQ5 A;  1HNW L;  2CCZ A;  2MGS A;  5M3M H;  4IOC A;  1SNP A;  2AKW B;  3A8K E;  3ERQ A;  1IBK L;  1M4V A;  4GN4 B;  3R8B A;  1PH3 A;  2EDG A;  1WVL A;  2EOT A;  4IO9 A;  1RJT A;  2UXC Q;  4RH6 A;  2LXJ A;  2IWH A;  5GAD C;  3MZ5 A;  3J7Y W;  3LWE A;  3T1H Q;  2CWP A;  3K0X A;  2SDF A;  3A5Z B;  5EBC A;  2Q2U A;  2RDF A;  3A8I E;  2F3I A;  5BN5 A;  4JV5 Q;  3NBI A;  2EJG C;  5FLM H;  3VR3 A;  1UE5 A;  1S5F D;  1MJC A;  3S2H H;  4WJ4 A;  3K7A H;  2WIN B;  1B8A A;  3SK4 A;  1PH5 A;  5ELC A;  3KF6 B;  3SGI A;  3J81 E;  4ULL A;  1PH4 A;  2B2V A;  2OCE A;  1QUQ B;  1WTH A;  5GAH C;  2B2W C;  3D31 A;  5LMN L;  1F9S A;  1RTO A;  1ILP A;  3UDI A;  4P74 A;  4DAP A;  4A3J B;  4IUQ A;  1TS3 A;  1MKH A;  1EYG A;  4C3H G;  1N8R C;  3S16 B;  1DON A;  1K3R A;  2DN8 A;  1NUC A;  3J80 c;  4PZ8 A;  2PW7 A;  2K5H A;  1IBM L;  3E9I A;  3K5O A;  2NWG A;  1VQC A;  1VQI A;  3PMF A;  4ID6 A;  1FL0 A;  4JI3 Q;  3D4R A;  4OWT B;  2LMC B;  1JOR A;  1H9R A;  4P72 A;  1VQP A;  4B3T Q;  3K7A B;  2Z4I A;  3F2B A;  1YIJ A;  1EQQ A;  1RD9 D;  1D2B A;  2B63 B;  3ZYY X;  1ASZ A;  4OO1 G;  1VQB A;  1E0B A;  2VL6 A;  4YIJ A;  4YWM A;  3I56 A;  1EQR A;  2KHI A;  3SK8 A;  5JEA H;  2PZW A;  4ZRZ A;  2JXM B;  2RHS B;  3SE0 A;  2AQ1 B;  4X66 L;  1PVO A;  4MN3 A;  3T16 A;  4NXM L;  2C35 B;  2MFI A;  4B3R L;  1GUO A;  3H0G B;  1DXM A;  1XMQ Q;  1B3Q A;  2K7V A;  1OXU A;  2A73 B;  3KBX A;  2I0Q A;  5DNF A;  5DM7 3;  1HNX L;  3M7N A;  4P73 A;  1WD1 A;  1E22 A;  4QB4 A;  1F2Z A;  1A62 A;  3MFY A;  2A6H C;  3KJP A;  3M3Y B;  3BVM A;  1OXX K;  1HZ9 A;  2B8G A;  1LLR D;  4NP5 A;  5IGD A;  5D14 A;  1I4G A;  1PZK D;  2JK8 A;  4A3F G;  1EOT A;  2R7Z H;  2N78 A;  2F4V L;  4ZYS A;  4LF6 L;  1ILQ A;  1GXD C;  3RR5 A;  1TWF B;  4DUY L;  5M5X B;  2RSN A;  3NWS A;  4JI4 L;  2K5D A;  2UXC L;  3OPO A;  1AH9 A;  3E6Z X;  2K4K A;  1X55 A;  2OTL A;  2EYO A;  1HQM C;  4LUO A;  4O42 A;  2R92 H;  3RZO H;  3K5M A;  3M7G A;  3S15 H;  1KDB A;  1CHP D;  1SRU A;  4B3T L;  1SXT A;  4CGY B;  1WTW A;  2WV6 D;  1CFM A;  3H3V H;  5M5W H;  4LUZ A;  3DUZ A;  4GS3 A;  4MHE A;  3H91 A;  1RHP A;  1L1O A;  3NTI A;  1YEZ A;  3PUY A;  2EIF A;  5GAG C;  4DNI A;  3IAY A;  4JI0 L;  3S1Q H;  4KJO A;  3CW2 C;  3C1F A;  2N8N A;  4IPH A;  1IKL A;  1GO3 E;  2QF7 A;  4X66 Q;  5LL6 X;  3FHW A;  3A56 A;  5IP9 H;  4A3D B;  2B2Y A;  5FO8 B;  2NTT A;  1U4P A;  1F9P A;  2JA7 B;  5BR8 Q;  2NTS A;  2PW5 A;  2F0S A;  5JPM C;  4GOP B;  4QF4 A;  3PO2 G;  4Q0F A;  4XQQ A;  1MIU A;  4FXK C;  3AEV A;  4A3G H;  4C3I G;  1BOS A;  1QWY A;  4R1J A;  4JV5 L;  5IYC H;  4A93 H;  3PO2 H;  4AQY Q;  1Q8I A;  2FHT A;  2PQA B;  3H94 A;  1PYB A;  4JI3 L;  4A3G G;  4KHP Q;  3F2U A;  3JAM L;  1T5E A;  3E9H A;  2VUM B;  2EYH A;  2Q8T A;  1DD2 A;  3I72 A;  5IYB G;  3OW7 A;  5E7N A;  2YTY A;  4ZKB B;  1KLU D;  1H9S A;  2R7D A;  2KHS A;  3PGZ A;  4PV1 C;  3ICE A;  1L0Y B;  3GTP H;  4JI8 Q;  3CHB D;  3MA2 B;  2JA6 H;  2A6H D;  3L7Z C;  3D4W A;  3CCM A;  1WTV A;  4AH6 A;  1V9P A;  4GOP C;  5A2Q L;  4IPD A;  1T5X D;  2XN9 C;  3R2T A;  2FJ2 A;  3TZU A;  1VQ7 A;  2E8G A;  2JA5 G;  1LYL A;  3T1Y L;  1ONL A;  1GHK A;  3OHX C;  3GTJ B;  2KED A;  1ZYR D;  2ICI A;  1IXR A;  1TY0 A;  3SEB A;  1VF7 A;  1VQG A;  4A3I H;  2Q2H A;  1KRS A;  3D6W A;  4BBR B;  4RWS C;  4ZUI A;  2NVT H;  3UE0 A;  5I9O A;  3MHB A;  5KGU A;  1VMC A;  4KTA A;  4TRD A;  4JI7 Q;  2XSC A;  2F0J A;  4OO1 H;  1YI2 A;  2HUG A;  2VNU D;  4CJ0 B;  3QIA A;  1HNW Q;  3MXG A;  3NE5 B;  1HR0 W;  4OIJ A;  4OEL B;  1RF2 D;  2JE6 I;  3BU2 A;  3A54 A;  2PMZ E;  1W6K A;  1LUZ A;  1RCV D;  4F88 A;  1SMX A;  1U5K A;  3P7J A;  4KHZ A;  3I4M H;  1Z7T A;  2KEN A;  1C9O A;  4KMU C;  5JEA J;  3RZO B;  1KDA A;  5CV7 A;  5T1I A;  3UDF A;  4LFC Q;  1WOC A;  2Z9H A;  3PUV A;  5IYD G;  2HD3 A;  4IUT A;  3IFT A;  3HP3 A;  1HFN A;  5BN4 A;  2F0O A;  1WYD A;  2UUC Q;  1OTC A;  4JI2 Q;  2MNA A;  2NUC A;  2PZU A;  3FVQ A;  4BBS G;  1KAB A;  3RZD H;  1SJE D;  3CPW A;  3HFZ B;  3CCE A;  3GTQ H;  1KXL A;  4UP9 A;  1C8C A;  4POF A;  4JW0 A;  3NSW A;  4A3D H;  2RQX A;  3AQQ A;  3FDT A;  1W6J A;  1QB5 D;  1K8M A;  2R3Z A;  1U4R A;  5JPN C;  1JT8 A;  3HOV G;  1HH2 P;  3NPP A;  4DR6 L;  4A3D G;  5J3B A;  1XWE A;  4R9W A;  4DXG A;  2JYO A;  1STB A;  1ROD A;  1B44 D;  4K5X A;  2F0K A;  4FNF A;  3X3M A;  1XTC D;  3S1R B;  1J9O A;  5C4X G;  3IL8 A;  1X3E A;  1WJJ A;  2CHB D;  1Z9F A;  1X3F A;  4R8N A;  1I3Q H;  1XPO A;  2OTJ A;  1VCI A;  1SJH D;  4LNQ A;  2KJX A;  1SYE A;  1YJN A;  4BBR H;  2KBN A;  2NVT B;  1VQ9 A;  3S2D B;  4IZ8 A;  2EVB A;  1N34 L;  3I4N B;  4F7X A;  1X56 A;  1NTG A;  4GKK L;  3M9B A;  3PO3 H;  2WB1 B;  5EPK A;  1B7Y B;  3TZD A;  5IGF A;  1K8A C;  4P71 A;  5I2X A;  4LFB L;  4DV1 L;  3CCV A;  5LMU Q;  4XDX A;  3AYH B;  3GTK H;  1NAP A;  1GUS A;  1VDZ A;  4BA1 I;  2F3W A;  3T13 A;  1YVC A;  2QA4 A;  1O78 A;  1QNK A;  2B2T A;  4DV3 L;  5C5L A;  2A5H A;  2QDL A;  1TT2 A;  2K04 A;  1UUP A;  3F2C A;  1HUM A;  3T51 B;  4RGN A;  2DGY A;  3VYU A;  4O1N A;  1CKO A;  1GM5 A;  1D1K A;  1R4Q B;  2CFM A;  1EFI D;  2NZ1 D;  3PF5 A;  1ICF B;  1STH A;  4A3J G;  1TII D;  4C2M B;  3RLN A;  4RAU C;  3E3X A;  1NE3 A;  4OGQ C;  1YHB A;  2MO0 A;  4CKE A;  4ALP A;  2VQE Q;  1YIT A;  1PA6 A;  3DHQ A;  1O80 A;  4M8A A;  2I5H A;  1J8I A;  5IGG A;  4WOR A;  1K8G A;  3F8T A;  1SYB A;  5FLM G;  4M1U B;  3Q23 A;  4B3M Q;  1IW7 D;  2TMP A;  4KY6 A;  5KEE A;  1PH6 A;  2ZXO A;  1C7Y A;  2PYK A;  1LTB D;  2D0P A;  3HOW G;  5ISR A;  1V1Q A;  2N88 A;  2PI2 A;  2KQ3 A;  4Y52 H;  4A3L G;  3K81 C;  4KV6 A;  1PH7 A;  3CCJ A;  1GJX A;  1U4L A;  5EPJ A;  3S1Q B;  1I4Q A;  1ZXT A;  1GUN A;  4KKT A;  4E6I A;  1AZQ A;  4A4I A;  3H15 A;  4DK6 C;  3ER0 A;  3OOC A;  3MWY W;  3M4Y A;  1AE2 A;  3P1H A;  4DK1 A;  3IFD A;  3LNN A;  3ONA B;  5ELN A;  3CCQ A;  3IKJ A;  1SLJ A;  1WTP A;  1TKW B;  3HOX H;  5IP9 G;  1CUK A;  1EIG A;  2BOS A;  1TVX A;  2N49 A;  1FNV A;  2A19 A;  2ASB A;  4QQB X;  4C3I H;  1CQF A;  1MI2 A;  1NCV A;  2JEB I;  2P5Z X;  2R61 A;  4A3I B;  5C4X B;  3NEL A;  4A3B B;  2KEC A;  5IGE A;  4K2K A;  4A3K H;  2K6A A;  2L11 A;  4A75 A;  2RDG A;  3S2D H;  3OMG A;  2ZTC A;  4A3K G;  4GKK Q;  4PZ6 A;  2UXB L;  3PO3 B;  2HCI A;  3HOX B;  3EN2 A;  5M3F H;  3NK9 A;  3CRL C;  4HCS A;  4LF8 Q;  2YV5 A;  2Z0S A;  1Y1V H;  1GUW A;  2QIL A;  3A55 A;  2R6G A;  2GA4 B;  3G71 A;  3K58 A;  3MTS A;  1G51 A;  2UUA L;  1NR2 A;  3IRB A;  4G57 A;  5C4X H;  1IYJ B;  3S9W A;  3HGB A;  5COY A;  3HOZ G;  5LHY 1;  1YNJ D;  3QG1 A;  4ZQ3 A;  3DWP A;  5E3F A;  4K6L A;  5J39 A;  1F9Q A;  2F0L A;  2NVY B;  3QR8 A;  2UXB Q;  1CHQ D;  1EWH A;  1OXV A;  1A2U A;  2NN6 G;  2IX3 A;  3ULJ A;  3OSO A;  3I4N H;  1SRO A;  3EVQ A;  1IBM Q;  3I73 A;  1Q7Y C;  2E2D C;  1XNQ L;  3MAQ A;  2E75 C;  2FMC A;  2F0W A;  3U50 C;  3OTO L;  4TQU S;  3SK5 A;  1B2T A;  4LJZ C;  1JWS D;  3ERO A;  2F0M A;  1Q90 A;  3J81 i;  3URY A;  4QIW B;  2L55 A;  2Z4H A;  4CDF C;  4GLX A;  1JMC A;  5C0X G;  4LAA A;  5C4J H;  4DAV A;  4DNT B;  5IP7 G;  1YJ9 A;  4ILW A;  2ZM6 L;  5CV4 A;  2F0E A;  4GN3 B;  1L0X B;  2EY2 A;  3L9A X;  1EUJ A;  2O2L D;  1EY0 A;  4C3J H;  4XT3 B;  3Q24 A;  4BY7 H;  4GZY C;  3FMC A;  4OHJ A;  2HIX A;  1VQJ A;  2YYZ A;  3G6E A;  4DV7 L;  2K1B A;  5IYC G;  1BO0 A;  3CME A;  1YBY A;  2D62 A;  3S1M B;  5C44 G;  4Y7N H;  4FDB A;  2WB1 E;  4HJ5 A;  1Y69 U;  1LTS D;  5JVG 3;  5HGT A;  1B1Z A;  3PF4 A;  2VZA A;  1KTK A;  5ELO A;  3CC7 A;  1FGB D;  2BE5 D;  2VXW A;  3TS0 A;  4X62 L;  5FLX L;  4GNX B;  4DR5 L;  4BY1 G;  2F0I A;  3NWT A;  3EJI A;  2A68 D;  4GKJ L;  3MEF A;  1BBX C;  1IYV A;  2ZM6 Q;  2F0V A;  4HJA A;  1BF4 A;  2B2W A;  4KN4 C;  1KIX A;  1IBL Q;  5CYU A;  3ULL A;  3S2H B;  1TWC B;  3GTP B;  3U9S A;  1HXY D;  5C44 B;  3T53 B;  1KRT A;  2EJF C;  1N34 Q;  2VB3 X;  2IJ0 A;  3B6Y A;  5G3L D;  1Y1W H;  3WOE A;  4X3S A;  3NBH A;  1HTP A;  2F4I A;  1YHQ A;  3CQZ B;  2MHV A;  4IFD H;  4H02 A;  2EZV A;  1LT4 D;  3GTL H;  1PTO D;  4B3S Q;  5LMN Q;  3RD4 A;  3KUP A;  4DN4 M;  1BVS A;  4B9W A;  3A7L A;  4AQY L;  1TWH B;  5KYL A;  1JWM D;  1VQF A;  4L5Q A;  4JI1 Q;  4DV3 Q;  2K5W A;  3FRP B;  2NZO A;  4XIG S;  1K73 C;  1TWC H;  4JI1 L;  3STB C;  1V1P A;  2H5X A;  3WDN A;  2D5D A;  5IYB H;  3KLS X;  3PUZ A;  2HQL A;  3J80 E;  4HSP A;  1N36 Q;  3QOJ A;  3EIV A;  3NBH B;  4BY7 B;  4B3M L;  1KLG D;  2Z6K A;  5C4Z A;  2MPM A;  2KVM A;  2EYJ A;  4R4C A;  3BZC A;  3I8Z A;  4HJ8 A;  4R4T A;  1HFG A;  3H6M A;  3TP6 A;  2EXZ A;  4JI5 L;  2E76 C;  4JBK A;  1HA5 A;  3RN2 A;  3KF8 B;  1HJP A;  1CM9 A;  1QVC A;  2QGQ A;  1Y1W B;  3HOY G;  3PIO A;  4DAY B;  2C9O A;  4DU9 A;  1HZB A;  4A3F H;  4DUZ L;  3ND8 A;  2JA8 H;  5AJ3 L;  1A63 A;  4JPB W;  5KNC A;  1BUV T;  4HJ9 A;  3HOU G;  3GTM H;  2JA7 G;  2A74 C;  3K7U C;  2O5J C;  3L0O A;  3DXJ C;  3HOV H;  2JA8 G;  1TWG B;  3NHH A;  4HSV A;  2QW7 A;  2QCP X;  4YWL A;  1W2B A;  2D2C C;  1DOK A;  2MQH A;  2AWN A;  2YU9 H;  2LKV A;  3CRK C;  1N33 L;  2R7Z B;  1QVG A;  4A3G B;  2EYL A;  4IJL A;  4AYB E;  2NVY H;  4LK1 C;  5EKI A;  1VQD A;  4JI5 Q;  2DJF C;  5FO9 B;  2F0N A;  2IT1 A;  4IUU A;  1G8Z D;  1TQO A;  4K8J A;  3I4M G;  3NTH A;  1RTN A;  3KK7 A;  2HCC A;  2M9V A;  4KK7 A;  3K8A A;  1O7Z A;  3BZD B;  3UDX A;  3WOF A;  2PQE A;  4GLA C;  1TS5 A;  5H1S E;  3CCL A;  4RHS A;  1EOV A;  1YHA A;  1Y8O B;  3K5L A;  3I90 A;  1XX8 A;  2EE1 A;  3M3Y H;  1I4H A;  2V4D A;  4KLK A;  1WFQ A;  2K50 A;  4DR7 Q;  4OWW B;  4QIW E;  3W2D A;  2FFK B;  1CA6 A;  1EQV A;  2WAQ E;  3R2I A;  1GOZ A;  5M9O A;  1I4P A;  4MTK A;  1XNQ Q;  2F0H A;  5M5X H;  1UEB A;  1VQ4 A;  2HT1 A;  4RCN A;  3L2P A;  3VR6 A;  4XQJ A;  2YU9 B;  2ZJP A;  2B29 A;  3S17 H;  2Y0S E;  4A3K B;  2KCC A;  5E4X A;  2BE5 C;  3CAM A;  5JJL A;  4L5S A;  3FP9 A;  3CKI B;  2BH2 A;  3I91 A;  3GP7 A;  5FLX E;  2JA6 G;  4CHT B;  4PQX A;  1DM0 B;  4F87 A;  2KHJ A;  3GV6 A;  2BCO A;  4G4K A;  1NNX A;  1BCP D;  2WAQ G;  4JK1 C;  4QY7 A;  1M90 C;  1L1O C;  3V05 A;  1ASY A;  2Z6B A;  4IJH A;  4DV7 Q;  1WCM B;  4DR1 Q;  1VQK A;  5FO7 B;  5FK9 C;  3K0Y A;  2OEO A;  3MXU A;  2M2L A;  5I6Y A;  3PIP A;  5K36 G;  1SR3 A;  4BBR G;  1UEA B;  2EY5 A;  2DNC A;  3GTL B;  4HN7 A;  3HZX A;  3HG9 A;  1I6V C;  4YCV A;  1BBW A;  3PO3 G;  3DWA A;  3FKI B;  2R93 B;  2I5M X;  3VR4 A;  1SYD A;  2JA5 B;  1QOH A;  2PZT A;  1PRT B;  5JJI A;  3AFQ A;  1WCM G;  3SDZ A;  4FXG C;  5JVH 3;  2KEE A;  1SN8 A;  4DR7 L;  1O7I A;  5C3E G;  1LTG D;  2CW0 D;  2JA9 A;  1EQT A;  2ZTD A;  3PUW A;  1CA5 A;  1HNX Q;  2OF1 A;  2ZTE A;  2NBF A;  2KA7 A;  2EXD A;  4Y7N B;  3X3N A;  3KDF B;  4LUV A;  5EQ0 A;  4X65 Q;  1YNX A;  3KDF A;  2LXK A;  3SHL A;  2E5L Q;  5C44 H;  2J0T D;  1NBW A;  5KYI A;  4HMI A;  3BVG A;  4DR3 Q;  3HOY H;  5L37 A;  2K14 A;  2TSS A;  3D6C A;  1S72 A;  1GUT A;  3OWF A;  2E74 C;  2RCF A;  1HR0 Q;  2DUD A;  3HKS A;  1AP0 A;  3T4A C;  4P2C B;  4LF6 Q;  3HOW H;  1ML0 D;  3U9O A;  4L5T A;  4UY8 C;  1KAA A;  4ZUJ A;  4YY3 L;  2JA7 H;  1IBK Q;  4ABN A;  3CCS A;  4MIU A;  5DAU A;  5C6A A;  2Q2T A;  1T9H A;  2DJG C;  2E2H H;  1BCP C;  5IOC A;  1BCP F;  2F1M A;  1IKM A;  2BA1 A;  2F0F A;  1YJW A;  3P75 A;  4IPG A;  1KC8 C;  1OXT A;  1C48 A;  1A3T A;  4DAY A;  2PMZ B;  4DV5 L;  1PRT C;  1UE7 A;  3FPU B;  2AQ2 B;  1NJI C;  1F9R A;  1E7Z A;  2L0C A;  4RHR A;  4IFD G;  4JG2 A;  3A0J A;  1PRT F;  3PIO 3;  2I07 B;  4LF5 Q;  3HEJ A;  2ES2 A;  4YHH L;  3LGJ A;  2Y0S B;  1H95 A;  2XWJ B;  1EZ6 A;  4DR1 L;  3ND9 A;  4C3H B;  3I4N G;  1VQ6 A;  1SFO H;  4JI6 Q;  3CCR A;  2ICE C;  3N6R A;  3BDL A;  4N8X 1;  1EFW A;  2E2I H;  1PFS A;  4DAM A;  1EL0 A;  1Q81 C;  4G7H C;  2MJ8 A;  1AFP A;  1V43 A;  1E1T A;  1SE8 A;  2BA0 A;  2LY7 A;  1VQM A;  1I50 B;  1Q1E A;  4DV4 L;  3SK6 A;  3HKZ B;  1EIY B;  2B2Y C;  4KY5 A;  3K59 A;  2FIN B;  1A15 A;  3TN2 A;  1R9T B;  4DK3 C;  4IFD I;  4RGM A;  4A3M H;  3G6J B;  4FVM A;  3I4L A;  4BY7 G;  1RL2 A;  3CU7 A;  3I4O A;  2RVL A;  4YY3 Q;  1VS0 A;  4ZLT F;  2ATW A;  1L0W A;  1SBB B;  1FNW A;  4LFC L;  1R9T H;  3HOU B;  5JJK A;  3C46 A;  2PCF B;  3U58 A;  2EY1 A;  1DOL A;  4NXN Q;  1O7Y A;  1PTO F;  1JB3 A;  2BDN A;  3HKZ E;  5LL6 S;  1Q86 C;  1XPU A;  2DY8 A;  5FOB B;  5ELF A;  2OWO A; 
#chains in the Genus database with same CATH homology
 1IYJ B;  1DGS A;  2WP8 J;  1MKH A;  2GVA A;  3S1R H;  1EYG A;  3HOZ G;  4J15 A;  1N8R C;  2R7Z G;  3UE1 A;  1K3R A;  3CMA A;  2VUM G;  4BY1 H;  3J80 c;  4PZ8 A;  2R93 H;  2HHH L;  2K5H A;  1IBM L;  3E9I A;  4A3L H;  1VQC A;  3BJU A;  4C3H H;  1VQI A;  5EAY A;  2VUM H;  1FL0 A;  4JI3 Q;  4QL5 A;  2UXB Q;  4JC0 A;  4OWT B;  1I6H H;  5HGQ A;  3J80 i;  1VQP A;  4P72 A;  4B3T Q;  4MZ9 A;  1OXV A;  4JBJ A;  1TXY A;  1YIJ A;  2NN6 G;  3F2B A;  1N36 L;  3KFU A;  1EQQ A;  3M4O H;  3ULJ A;  3RLO A;  5M3M G;  3I4N H;  1SRO A;  1ASZ A;  4OO1 G;  1VQB A;  1IBM Q;  4WJ3 M;  1Q7Y C;  1HNZ Q;  3D0F A;  4L5R C;  1XNQ L;  1BKB A;  2VL6 A;  4YWM A;  5IY0 A;  3I56 A;  3U50 C;  3OTO L;  4TQU S;  1EQR A;  2KHI A;  3HOX G;  4DV1 Q;  3GTG H;  2V1C C;  2RHS B;  5IP7 H;  3J81 i;  1M1K C;  4GLX A;  1JMC A;  4XTC S;  5C0X G;  1JE5 A;  4X66 L;  1PVO A;  2E2J H;  4NXM L;  5C4J H;  2RCN A;  3GD7 A;  2C35 B;  2MFI A;  5IP7 G;  1GD7 A;  1YJ9 A;  2ZM6 L;  3GTO H;  4B3R L;  4GN3 B;  1XMQ Q;  1EUJ A;  2Y0S G;  1HZC A;  3FKI H;  1FGU A;  1OXU A;  2XTI A;  4C3J H;  4OON A;  4DV5 Q;  2I0Q A;  4GOP A;  1HNX L;  3M7N A;  3AFP A;  4BY7 H;  4P73 A;  4JYA L;  1PH2 A;  1E22 A;  2HIX A;  2VS1 A;  1VQJ A;  2YTV A;  2YYZ A;  3G6E A;  3J7A 5;  4DV7 L;  2B3G A;  4POG A;  5HY6 A;  1QZH A;  4NB3 A;  5IYC G;  4LF4 Q;  2RF4 A;  3CME A;  3S14 H;  1TWH H;  1YBY A;  2D62 A;  1A62 A;  5C44 G;  3W5O A;  4Y7N H;  1WI5 A;  4FDB A;  2WB1 E;  3KJP A;  4HJ5 A;  4PZ7 A;  1X65 A;  2CKZ B;  1OXX K;  2ID0 A;  4P75 A;  4OWX B;  1VQL A;  1HZ9 A;  3W1B A;  4MTN A;  1XMO L;  3PF4 A;  2NZH A;  1I5F A;  2XGT A;  2VZA A;  4KHP L;  5ELO A;  3CC7 A;  2JK8 A;  4A3F G;  3M85 A;  4YCU A;  2R7Z H;  2N78 A;  3TS0 A;  4DR6 Q;  1Y1V G;  4X62 L;  4GNX B;  1Y14 B;  4LF6 L;  4DR5 L;  1VQN A;  2F4V L;  3RR5 A;  1XMO Q;  4BY1 G;  4DUY L;  4A3I H;  4JI4 L;  2UXC L;  1Q8K A;  2CWA A;  1AH9 A;  2K4K A;  3KF6 A;  4OXP A;  1X55 A;  2IHF A;  3S1N H;  4GKJ L;  1HZA A;  3MEF A;  1XMQ L;  4EX5 A;  3GTJ H;  2OTL A;  4LUO A;  2ZM6 Q;  1G6P A;  4HJA A;  2R92 H;  3RZO H;  3S15 H;  4DV6 L;  1SRU A;  4YHH Q;  2QEX A;  3PUX A;  2Q2I A;  1TWA H;  3DLL A;  3ULL A;  3T1H L;  4A3I G;  1KIX A;  1IBL Q;  1FJG Q;  3H3V H;  5M5W H;  1B70 B;  4LUZ A;  4GS3 A;  1KRT A;  3CC2 A;  4B3S L;  1N34 Q;  1L1O A;  3H0G G;  3TQY A;  3ZJY C;  1YEZ A;  3B6Y A;  3KJO A;  3PUY A;  2EIF A;  5GAG C;  4DNI A;  5M5Y H;  1Y1W H;  1X3G A;  4JI0 L;  3G48 A;  3S1Q H;  1VQH A;  4APV A;  1YHQ A;  1GKH A;  3JC6 6;  3CW2 C;  1X54 A;  2N8N A;  3H0G H;  4IPH A;  3J7Z C;  1GO3 E;  1P16 A;  4H02 A;  1CKM A;  4HIM A;  3GTL H;  2L15 A;  4X66 Q;  3FHW A;  2VW9 A;  4B3S Q;  5LMN Q;  1N33 Q;  1J5E Q;  5IP9 H;  2UUA Q;  1IZ6 A;  1TWF H;  4C2M H;  1BBU A;  4JOI C;  3VDY A;  1BVS A;  1NY4 A;  4AQY L;  4IFD J;  3U4Z A;  5BR8 Q;  4JBW A;  2F4V Q;  1VQF A;  4L5Q A;  4JI1 Q;  5IWA L;  4GOP B;  4DV3 Q;  2UXD L;  3PO2 G;  1QVF A;  1MIU A;  3AEV A;  4A3G H;  3OW2 A;  1L1O B;  2NZO A;  4XIG S;  1K73 C;  1TWC H;  4JI1 L;  4R1J A;  4JV5 L;  5IYC H;  4A93 H;  3PO2 H;  3STB C;  1CSP A;  4AQY Q;  2H5X A;  2PQA B;  1PYB A;  4JI3 L;  4A3G G;  5IYB H;  2JJQ A;  1TWG H;  5IWA Q;  3PUZ A;  4KHP Q;  2HQL A;  3E9H A;  1N9W A;  5GQO A;  3BZK A;  4DV0 L;  3RN5 A;  1N36 Q;  4OX9 L;  4LF7 Q;  1JJG A;  3EIV A;  3NBH B;  4B3M L;  2Z6K A;  5IYB G;  4BBS H;  2BH8 A;  4LWC A;  5C4X H;  5E7N A;  4R4C A;  2YTY A;  1P8L A;  4HJ7 A;  3BZC A;  4JI6 L;  4LFA L;  2R7D A;  3PGZ A;  1E24 A;  4TVA B;  4HJ8 A;  4R4T A;  4RG1 A;  2AHO B;  1I94 L;  4BA2 I;  1X6O A;  3CXC A;  3RLF A;  3ICE A;  3GTP H;  4JI5 L;  1KD1 C;  2PI2 E;  4JBK A;  4JI8 Q;  3RN2 A;  3KF8 B;  4NXM Q;  1HJP A;  1QVC A;  2QGQ A;  3HOY G;  4O0A A;  3PIO A;  1PH1 A;  4DAY B;  1CKN A;  2JA6 H;  3L7Z C;  2VQF L;  1Q1B A;  1HZB A;  4LW1 A;  2RHQ B;  4A3F H;  3GO5 A;  3KOJ A;  4DUZ L;  3CCM A;  4B3R Q;  4AH6 A;  4YCW A;  1V9P A;  4GOP C;  1JJ2 A;  4IPD A;  2JA8 H;  5AJ3 L;  1A63 A;  2OQ0 A;  1VQ7 A;  4HJ9 A;  4JI4 Q;  2E8G A;  1K83 H;  2JA5 G;  3HOU G;  1LYL A;  2JA7 G;  3T1Y L;  2F52 A;  2WB1 G;  3GTM H;  3K7U C;  3L0O A;  3Q8D A;  3HOV H;  2UU9 Q;  5GRO A;  2JA8 G;  4OX9 Q;  1IXR A;  2R93 G;  4UP7 A;  4K0K Q;  4AIM A;  4YWL A;  1W2B A;  1VQG A;  3S24 A;  2MQH A;  2AWN A;  2Q2H A;  3M4P A;  3DM3 A;  1KRS A;  5C0X J;  4DR2 Q;  2YU9 H;  3JAM i;  2NVT H;  1N33 L;  3CP0 A;  4O2D A;  3UE0 A;  1QVG A;  4LF9 L;  4IJL A;  1CKN B;  4AYB E;  2NVY H;  5FJ8 H;  2K52 A;  3KYH C;  1Y1W G;  2A8V A;  4JI7 Q;  1VQD A;  4JI5 Q;  2IHE A;  1LM0 A;  1YI2 A;  2AWO A;  1NMG A;  2IT1 A;  4DUY Q;  4DR5 Q;  2ZJQ A;  4JYA Q;  5FJ8 G;  1E1O A;  2VNU D;  4HIK A;  3G4S A;  1HNW Q;  3UDG A;  3I4M G;  5JEA G;  1HR0 W;  2OQK A;  2VQF Q;  3U4V A;  4A93 G;  4ME3 A;  2JE6 I;  1J6Q A;  1KL9 A;  3BU2 A;  2PMZ E;  1EIF A;  1LUZ A;  1K0R A;  3K8A A;  5LMN W;  1SMX A;  1U5K A;  3UDX A;  1PYS B;  2NN6 I;  4HID A;  4KHZ A;  3I4M H;  4DR4 Q;  5C3E H;  2YTX A;  4GLA C;  2KEN A;  5H1S E;  1C9O A;  3CCL A;  5JEA J;  1EOV A;  4B3T L;  2EQS A;  1YHA A;  2I5L X;  2CQO A;  4BXX G;  1AE3 A;  3CPF A;  1NMF A;  5DLQ E;  3UDF A;  1JJC B;  2KCT A;  1PH8 A;  3M3Y H;  4NPS A;  5LMU L;  1VQE A;  4LFC Q;  1WOC A;  3PUV A;  5IYD G;  4KLK A;  1HNZ L;  1WFQ A;  4UPA A;  2K50 A;  4DV2 L;  4DR7 Q;  1RIP A;  3PV0 A;  4OWW B;  1WYD A;  2UUC Q;  4QIW E;  2PQA A;  1OTC A;  2R7F A;  4JI2 Q;  2MNA A;  2WAQ E;  4LF9 Q;  4X62 Q;  4X64 Q;  4BBS G;  1XNQ Q;  4GKJ Q;  3RZD H;  5M5X H;  1UEB A;  1VQ4 A;  3CPW A;  3HFZ B;  3CCE A;  2HT1 A;  2D0O A;  3L2P A;  4UP9 A;  3GTQ H;  1KXL A;  4POF A;  3CF5 A;  2Z6K C;  1W3S A;  2ZJP A;  2B29 A;  2PNH A;  2IX0 A;  3J81 j;  4LF4 L;  1XTD A;  4R4Q A;  3S17 H;  3CCU A;  3AQQ A;  2Y0S E;  4A3E G;  4A3D H;  3CAM A;  3W1G A;  5JJL A;  4L5S A;  3FP9 A;  4AYB G;  1VQO A;  5GAE C;  1JT8 A;  3HOV G;  1HH2 P;  2BH2 A;  4DR6 L;  1C0A A;  4A3D G;  3CD6 A;  5IT9 c;  2GVB A;  5J3B A;  1PV4 A;  2UUB L;  2JA6 G;  1Z47 A;  2KHJ A;  5IE8 A;  4A3C G;  1S40 A;  2VQE L;  2WAQ G;  4QY7 A;  1M90 C;  1L1O C;  2NVX H;  2E5L L;  1ASY A;  5C0X I;  2R92 G;  4IJH A;  3HOU H;  4DV7 Q;  4A3C H;  4YWK A;  4DR1 Q;  4JBM A;  5C4X G;  1VQK A;  1VQA A;  1CSQ A;  1X3E A;  4DR3 L;  1WJJ A;  2UUC L;  1Z9F A;  2UUB Q;  3S1M H;  3PIP A;  1X3F A;  5K36 G;  1SR3 A;  4BBR G;  1I3Q H;  1XPO A;  1JB7 A;  2OTJ A;  1VCI A;  3I2Z A;  3NEM A;  4YCV A;  2B63 G;  4LNQ A;  4KI0 A;  2K5V A;  1X9N A;  1YJN A;  1BBW A;  4DR4 L;  4IOA A;  4BBR H;  2KBN A;  3PO3 G;  1VQ9 A;  4IPC A;  1OXS C;  1N34 L;  1D8L A;  1X56 A;  2I5M X;  1NTG A;  1S3O A;  3KLW A;  4PMW A;  2IX1 A;  3M9B A;  4EQ5 A;  4GKK L;  3PO3 H;  4A3B H;  1MJE A;  2K75 A;  3TS2 A;  1B7Y B;  3J81 c;  1K8A C;  4P71 A;  5JJI A;  4LFB L;  3AFQ A;  4DV1 L;  4A3B G;  1WCM G;  4R4I A;  2KCM A;  3CCV A;  5LMU Q;  2JQO A;  3AYH B;  1PH9 A;  3GTK H;  5IYD H;  1UE6 A;  4BA1 I;  2N3S A;  1N32 L;  2QA4 A;  1YVC A;  1SN8 A;  4DR7 L;  2UU9 L;  1O7I A;  5C3E G;  3TEH B;  1Q12 A;  2JA9 A;  4DV3 L;  2UXD Q;  3TRE A;  1E3P A;  2ZTD A;  4NXN L;  3F2C A;  2K5N A;  3PUW A;  4GNX C;  1G29 1;  1KQS A;  1VQ8 A;  2DGY A;  4DUZ Q;  1YZ6 A;  1KAW A;  3FKI G;  1J5E L;  3EBE A;  1CKO A;  4GLV B;  4JCV E;  1GM5 A;  1XNR L;  1HNX Q;  2ZTE A;  2EXD A;  1Q46 A;  4UP8 A;  2ALY B;  2NVQ H;  2CFM A;  3PF5 A;  3KDF B;  4LUV A;  4A3J G;  3RLN A;  4X65 Q;  4QGU A;  1YNX A;  2LSS A;  3HKZ G;  3KDF A;  4A3M G;  2LXK A;  1NE3 A;  4PG3 A;  2E5L Q;  4A76 A;  1YHB A;  2MO0 A;  5C44 H;  1NBW A;  3I7F A;  1HR0 L;  1FJG L;  4ALP A;  3S16 H;  1D7Q A;  2VQE Q;  4A3J H;  4JI8 L;  4MNO A;  1YIT A;  3H3V I;  1PA6 A;  1XNR Q;  4DR3 Q;  3CQZ H;  4DV4 Q;  3ULP A;  3WWV A;  3HOY H;  4A3E H;  2K14 A;  2I5H A;  1S72 A;  1I94 Q;  1HR0 Q;  2DUD A;  3HKS A;  1K8G A;  3F8T A;  3OYY A;  5FLM G;  4LF6 Q;  1L2F A;  3HOW H;  4B3M Q;  5M3F G;  4UY8 C;  4L5T A;  2JA5 H;  4YY3 L;  4LF8 L;  2JA7 H;  3ERS X;  3T1Y Q;  3TRZ A;  1PH6 A;  1IBK Q;  3OTO Q;  1I50 H;  3HOZ H;  2B63 H;  1C7Y A;  3CCS A;  1IL2 A;  2JEA I;  2MO1 A;  2D0P A;  2A1A A;  3HOW G;  1V1Q A;  2IY5 B;  1GVP A;  2Q2T A;  1T9H A;  2PI2 A;  2E2H H;  1QZG A;  1KHI A;  2AMC B;  1UE1 A;  2HIV A;  1IBL L;  3K80 C;  4DPG A;  4JI2 L;  4A3L G;  1A8V A;  2WFW A;  3K81 C;  4Y52 H;  2BA1 A;  2GN5 A;  1PH7 A;  3CCJ A;  1YJW A;  1QUQ A;  3PSI A;  1FVI A;  3MXN B;  4IPG A;  1KC8 C;  4LF5 L;  4A4I A;  3H15 A;  4DK6 C;  1OXT A;  3ER0 A;  1PHJ A;  1N32 Q;  4X65 L;  4DV5 L;  1UE7 A;  1NJI C;  1AE2 A;  1WCM H;  3STB D;  1EWI A;  1E7Z A;  2HHH Q;  4X6A H;  3M4Q A;  4IFD G;  2ZJR A;  3NEN A;  3PCO B;  5ELN A;  4JG2 A;  3A0J A;  3GDE A;  3CCQ A;  5BR8 L;  3F2D A;  3CC4 A;  1SLJ A;  5AJ3 Q;  4GNX A;  1K9M C;  4LF5 Q;  4R4O A;  3HOX H;  4LF7 L;  1U0L A;  5IP9 G;  1A0I A;  4YHH L;  3JAM c;  2ES2 A;  1CUK A;  1VQ5 A;  3LGJ A;  1H95 A;  1LTL A;  2N49 A;  4QJF A;  4DR1 L;  1HNW L;  4DR2 L;  5FLX c;  2FXQ A;  2CCZ A;  5M3M H;  3I4N G;  1VQ6 A;  2A19 A;  4LFA Q;  4IOC A;  2AKW B;  1SFO H;  3CCR A;  4JI6 Q;  2ASB A;  4QQB X;  1IBK L;  4BXX H;  4GN4 B;  4C3I H;  1Q82 C;  2JEB I;  1PH3 A;  4GN5 A;  1EFW A;  2E2I H;  1PFS A;  4DAM A;  1Q81 C;  4IO9 A;  2UXC Q;  1UWV A;  2LXJ A;  3NEL A;  4RMF A;  5GAD C;  4A3K H;  4HIO A;  4JI7 L;  1V43 A;  1E1T A;  1SE8 A;  2BA0 A;  1VQM A;  3T1H Q;  2CWP A;  3K0X A;  3F1Z A;  1Q1E A;  3A5Z B;  4DV4 L;  4JOI A;  4A75 A;  4DV6 Q;  1EIY B;  3S2D H;  2ZTC A;  4A3K G;  3RNU A;  4DV2 Q;  2Q2U A;  4GKK Q;  4DK3 C;  4PZ6 A;  2F3I A;  4IFD I;  1XJV A;  4A3M H;  2UXB L;  4JV5 Q;  4X64 L;  3EN2 A;  3A5U A;  5FLM H;  4BY7 G;  1UE5 A;  1RL2 A;  3A74 A;  1MJC A;  3S2H H;  5M3F H;  4K0K L;  3I4O A;  4YY3 Q;  4LF8 Q;  4WJ4 A;  1VS0 A;  3K7A H;  4LFB Q;  2YV5 A;  4DKA C;  2ATW A;  1L0W A;  1B8A A;  1PH5 A;  2Z0S A;  4JI0 Q;  1Y1V H;  4LFC L;  1R9T H;  3KF6 B;  3SGI A;  1PH4 A;  2R6G A;  5JJK A;  3U58 A;  2OCE A;  3G71 A;  4DV0 Q;  1QUQ B;  1G51 A;  4NXN Q;  2UUA L;  3I55 A;  3HKZ E;  5GAH C;  2VY3 A;  1XPR A;  3D31 A;  5LMN L;  1Q86 C;  1XPU A;  4OO1 I;  3IRB A;  3UDI A;  4P74 A;  2OWO A;  3E0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...