4X65L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65L00
4PG3A 1Q1BA 3B6YA 2OQ0A 5GROA 1HNZL 1TWCH 2EXDA 2F3IA 5IWAQ 3S15H 4IFDG 1KQSA 1HR0W 3GTJH 4DV4Q 2MQHA 5C0XJ 1M90C 2R7ZH 1RL2A 3AQQA 3D31A 3CXCA 1MIUA 2E2HH 3PF4A 2UU9Q 3EIVA 4LF8Q 1PH7A 1Y1VH 2WAQG 3G71A 3H3VI 1SRUA 4YHHL 5C3EG 2OQKA 4P74A 3S1QH 3DLLA 1NMFA 1VQLA 2JA6G 2CQOA 1WFQA 4OO1G 5AJ3L 1K0RA 2K5HA 3I2ZA 2N8NA 3TEHB 4DV7Q 4GOPA 4UY8C 1IL2A 4BBSH 4GLVB 3HKZE 3F8TA 1O7IA 2K75A 5DLQE 4IPDA 4LFAQ 3OW2A 3GTKH 4HIMA 2UXDL 2Q2IA 1XPRA 1PHJA 4A3CH 1AE3A 2ZM6Q 2IY5B 4DUZQ 1AH9A 1SN8A 2D0PA 4XIGS 4DR5L 3PUWA 1YJNA 1I50H 3AYHB 5M5WH 5M3MH 1YBYA 4LF5Q 4OX9L 4JI8Q 2PNHA 3CF5A 3HOVH 1KL9A 4MTNA 1PH5A 5C4JH 1Y1WG 2VQEQ 2NZHA 4MNOA 3U4ZA 1CSQA 1XNQQ 3I4OA 4EQ5A 4FDBA 4LF6L 1VQAA 5FLMG 1M1KC 4HJ5A 1TWFH 4A3FH 2UUCQ 4L5QA 3A74A 1WJJA 3CMAA 4LUVA 4X64Q 2HIVA 4KHPL 1CSPA 2KHIA 3UDGA 1K9MC 4UP9A 1D8LA 1VQFA 1X6OA 4JC0A 1PV4A 1ASYA 4DV3L 4X62L 4P73A 4RMFA 4IPHA 2JA5H 2YU9H 1FL0A 2F4VQ 4BY7G 5HY6A 1I3QH 5IY0A 2ID0A 3K0XA 3WWVA 4LF9L 3A0JA 2NN6I 5FJ8H 4BXXH 1OXXK 4P72A 3OTOQ 1K8GA 3PUZA 4DV1L 3U58A 5LMNL 4DR7L 5IYCG 1VQOA 2E5LQ 3HKSA 1CUKA 1PH8A 4UP8A 3KF8B 1EYGA 2L15A 4APVA 4JBWA 1WCMG 4UP7A 3KJOA 3J80i 2KBNA 4KHZA 2D62A 1FJGQ 4LUOA 1HZBA 2BA1A 4DK6C 1JMCA 1HNWL 1PFSA 2K5VA 1CKMA 4UPAA 1YHAA 1Z9FA 4BBRH 4DV5Q 1VQPA 3PV0A 2ZJPA 2HHHL 2KCTA 4B3SL 1Z47A 3NBHB 4YWLA 4A3EH 3PUVA 4A3BH 3PO3G 2K5NA 4DR6L 2GVBA 3E9IA 4WJ4A 4B3RQ 1EUJA 2DUDA 2YV5A 4NPSA 4NXNL 3ULLA 3CCEA 4R4CA 4DV6Q 4PZ8A 1MJEA 4POFA 2MNAA 1NMGA 1JT8A 1C9OA 4JOIA 4C3HH 4DPGA 3L2PA 1K8AC 4AIMA 4A3IG 1XMOQ 3CPFA 2VUMH 1EWIA 4DUYL 1YIJA 3GTLH 4DR2Q 2I5LX 1YNXA 2Q2HA 4A3LG 1VQJA 3T1YQ 3ERSX 4KI0A 5LMNW 2R93G 1GM5A 3CCMA 3F2DA 4B3TQ 4L5RC 4JYAL 4A3MG 3PCOB 2RF4A 1YZ6A 1SE8A 3RLFA 4DR1Q 4JI6Q 3HOWG 1UE5A 1HJPA 4DR3L 3BJUA 2JA6H 1Q12A 2VNUD 1N32Q 1A63A 4POGA 4JI7L 2NZOA 4LUZA 3T1HL 2R92G 2VZAA 3M4OH 2GVAA 1VQ8A 1B7YB 1WYDA 1HNZQ 4IOAA 4IJHA 4A3JG 4LF4L 2AMCB 3TREA 1PH2A 2NN6G 4A3GH 1T9HA 5JJIA 3AFQA 4OWTB 2QGQA 5IP7H 3PUYA 3RN2A 3I55A 1OXUA 1IBKL 3HOXH 2EIFA 4NXML 4IJLA 4YHHQ 1JJCB 1Y1WH 2CCZA 2Z6KC 5IYDG 3J7A5 5H1SE 1PYBA 3ICEA 1VQNA 1CKOA 1LTLA 5C0XG 2UXBL 3H0GG 3DM3A 3A5UA 5AJ3Q 5M5YH 1R9TH 3UDXA 2ATWA 4GN5A 4DV2L 2UUBL 2UXDQ 1E3PA 4GS3A 2Q2TA 4JV5L 4DV0L 4JOIC 4DR4L 4K0KL 3CC4A 4BA1I 1J5EQ 2QEXA 2CKZB 2JA8G 1MJCA 3CC7A 4B3ML 4DR5Q 1UE1A 4BY7H 4GNXB 5C4XG 4LF7L 1UE6A 3PO2G 4L5SA 2AWOA 1DGSA 3J80c 2MO1A 1XMQL 3HOZG 4JCVE 3IRBA 1YHQA 4BY1G 3M9BA 1RIPA 5JEAJ 3RN5A 1PH9A 4LF6Q 2BH2A 3UDFA 3OYYA 1N9WA 2N49A 3CC2A 1YJ9A 1Q46A 1WCMH 1VQ6A 3S1RH 3I4MG 2JEAI 1VQ5A 4KHPQ 2K50A 1XJVA 3S16H 3GTMH 3J7ZC 3D0FA 4KLKA 1PH6A 1UE7A 4DV3Q 4HJ7A 4LNQA 4DK3C 3AEVA 3HOYH 2IX0A 1GD7A 1Q7YC 1IBLL 2IHFA 3EN2A 4A4IA 1I94L 2OTJA 3K81C 4O0AA 4A3KG 1E1OA 1A8VA 4JBJA 4LFCL 5IWAL 4DV1Q 3GTQH 1X55A 1N33L 2FXQA 1Q81C 4DR7Q 2V1CC 1GO3E 4A3DG 1QUQB 4GNXA 3NEMA 4DAMA 2RCNA 4JI2Q 2ZJRA 2JE6I 3W5OA 4A3LH 2WFWA 3ER0A 1AE2A 1GKHA 1V43A 3PIPA 5IYBG 1HNWQ 1E24A 3JAMc 2HQLA 1JJ2A 2E2IH 5IP9H 2ES2A 3M3YH 1PVOA 3S1MH 3BZKA 1HNXL 2HHHQ 3G4SA 2IX1A 2MO0A 1GVPA 4A93G 2NVYH 4PMWA 5C44G 3M7NA 1EOVA 2BA0A 4JI1Q 3SGIA 4NB3A 2R7DA 3E0EA 4DR6Q 4YCVA 4PZ6A 3FP9A 4NXNQ 1OXSC 3KJPA 3RLNA 3U4VA 4HJAA 1EIYB 2R7ZG 1KHIA 3L7ZC 5M5XH 3RZDH 3TQYA 4OXPA 1QZGA 2R92H 2UXCL 1U0LA 1HH2P 4A76A 1P8LA 5JJLA 4DNIA 1LYLA 2AHOB 2ASBA 3G48A 1X3FA 3S24A 4EX5A 4DUYQ 1VQ4A 2Z6KA 4R4QA 1NBWA 3FHWA 3MEFA 1E1TA 1QUQA 4HIOA 2A19A 5M3FH 1I5FA 2K14A 1HR0Q 1SROA 3CCLA 2CFMA 1S3OA 1BKBA 5IYDH 4X64L 4R1JA 1IXRA 1PYSB 4R4IA 1VQCA 3M4PA 4DR3Q 4A3CG 2K4KA 4GKKQ 4JI3Q 4OWWB 2F4VL 3BU2A 3H15A 1SR3A 3PGZA 4X65L 3KOJA 4YWKA 5M3MG 3T1HQ 2UUAL 3J81i 4GNXC 4IFDI 3CMEA 3HOVG 4JI4L 3OTOL 1HZAA 4LF4Q 4QQBX 4DAYB 5C3EH 2JQOA 3BZCA 2KHJA 4X66L 4QGUA 1MKHA 1VQDA 3MXNB 3HOUG 3RR5A 4Y52H 1U5KA 2WP8J 1IBKQ 2B63G 1VQGA 4NXMQ 1WOCA 3RLOA 4A3FG 3KDFB 4AQYL 4QIWE 1YEZA 1BVSA 1B8AA 1LM0A 4AYBE 4ME3A 2ALYB 3CPWA 1FJGL 1QVFA 2UXBQ 4JI5L 1H95A 3K80C 1TXYA 1VQBA 2JA5G 1S72A 1UWVA 4GLAC 4DV5L 1Q8KA 2QA4A 3TS2A 3I4MH 2VW9A 3CQZH 2XTIA 2IT1A 4DR4Q 3K8AA 4J15A 1E7ZA 5GAHC 3W1BA 1UEBA 1KC8C 4IPCA 1HZ9A 5FJ8G 1QZHA 1IBML 4BXXG 5GAEC 4H02A 5BR8L 1ASZA 1EQQA 1J6QA 4LF7Q 3NENA 4GKJL 3ZJYC 1NE3A 5GAGC 1L0WA 1V1QA 3GTPH 1XNRL 5IE8A 4A3KH 4LFBL 1XMQQ 5FLMH 1IYJB 1Y14B 2RHSB 4DR2L 2JK8A 3M85A 2JJQA 2LXJA 4C3JH 3T1YL 2JA7G 1JB7A 2ZTCA 2VQFL 1N36L 2E2JH 1NY4A 2XGTA 1D7QA 2VS1A 1G291 2EQSA 2ZTEA 3I4NG 1SFOH 1EQRA 3KDFA 2LXKA 3GDEA 1N34L 4A3EG 2I0QA 3STBD 4OX9Q 4A3BG 2YTXA 5JEAG 1EFWA 1PH3A 1S40A 3W1GA 5LMUL 1TWHH 3GD7A 1TWAH 1YVCA 2AKWB 3RZOH 2Y0SE 5IYCH 5C44H 4A93H 1KRTA 2E8GA 4O2DA 4TQUS 5IT9c 1W2BA 1PH1A 2KCMA 2VUMG 4LFCQ 4A75A 3GO5A 1N33Q 4HJ8A 1HZCA 2D0OA 2JEBI 1X54A 2PQAB 5HGQA 3FKIG 3H3VH 4YY3L 3PSIA 2PI2E 1NJIC 1BBUA 1TWGH 1XPUA 4IFDJ 1YI2A 4IO9A 2WB1G 3U50C 4AYBG 4X62Q 3CAMA 3S14H 4JI0L 1G6PA 4DKAC 3PIOA 1QVCA 1VQHA 1VQ7A 1FGUA 4LF9Q 3PO3H 2Z0SA 3J81c 4C2MH 1C0AA 3LGJA 1HNXQ 1OXTA 5LMNQ 2PI2A 3NELA 4DV4L 2IHEA 4BA2I 1C7YA 1J5EL 2F52A 4PZ7A 2UU9L 1X56A 2OWOA 4LF8L 2NVQH 4Y7NH 2OTLA 2I5MX 2PMZE 4A3IH 2YYZA 4P75A 5FLXc 2NVXH 4A3GG 4QJFA 3AFPA 5IP7G 2UXCQ 2R93H 1YITA 4JI2L 3HOXG 1X9NA 4DV7L 3E9HA 2HIXA 4A3MH 1NTGA 2B29A 3PF5A 1K3RA 3HOWH 1A0IA 4B3SQ 2OCEA 4LFAL 3HOUH 1G51A 2PQAA 4JG2A 2ZM6L 2B63H 1L1OC 1KD1C 4DUZL 2NVTH 3I7FA 1K83H 4ALPA 4LWCA 3CCVA 1CKNB 3PUXA 3CP0A 4LF5L 4JBKA 4X6AH 4JI8L 3J81j 4XTCS 1OTCA 3KLWA 2K52A 4HJ9A 1Y1VG 2H5XA 3CW2C 3F2CA 2R6GA 3ULPA 4JBMA 1QVGA 2JA9A 1E22A 2Y0SG 4X65Q 4GN4B 1P16A 2MFIA 2VQEL 4A3JH 1K73C 4GLXA 1VS0A 1XNQL 2UUAQ 5ELNA 2ZJQA 1OXVA 3Q8DA 3CCQA 2LSSA 4JI4Q 4JYAQ 4OONA 3GTGH 1L2FA 2UUCL 4OWXB 4BBSG 4L5TA 1X65A 5J3BA 4QL5A 1JE5A 4X66Q 2AWNA 4YCWA 3STBC 3UE0A 4IOCA 3H0GH 4IPGA 4GOPC 5C0XI 1YJWA 4AQYQ 4AH6A 1YHBA 3S2HH 2JA7H 3EBEA 5EAYA 1PA6A 4JI7Q 3CCSA 3M4QA 4R4TA 4JI5Q 3JC66 1VQKA 3CCJA 3HOYG 3HKZG 3I4NH 1X3GA 2JA8H 1WI5A 3S1NH 3CCUA 1Q1EA 1X3EA 5C4XH 3HFZB 2CWAA 3K7AH 4JI1L 3PO2H 1CKNA 3F2BA 2E5LL 3G6EA 2GN5A 3TS0A 1IBMQ 3S17H 2KENA 5BR8Q 3HOZH 2WAQE 4OO1I 4QY7A 1W3SA 1Q82C 4GKJQ 4YWMA 2WB1E 4BY1H 2BH8A 2DGYA 1Q86C 1L1OB 1XNRQ 3KYHC 4LFBQ 1A62A 1EIFA 2N78A 4DV2Q 4HIKA 2VL6A 2UUBQ 1IZ6A 3RNUA 3KF6B 2HT1A 4K0KQ 3FKIH 2VQFQ 3CCRA 4DV0Q 1N36Q 4JV5Q 4GN3B 4LW1A 2Q2UA 4RG1A 1BBWA 2RHQB 1HR0L 5IP9G 1FVIA 4B3RL 2CWPA 4DV6L 4B3MQ 2C35B 2B3GA 2R7FA 4HIDA 4YCUA 4C3IH 1PH4A 1N34Q 5JJKA 3A5ZB 3TRZA 1VQEA 4GKKL 4TVAB 1VQIA 4JI3L 2I5HA 1XMOL 1KIXA 5LMUQ 1N8RC 3K7UC 3JAMi 2YTVA 5GQOA 3I56A 1VCIA 1SLJA 3CD6A 1XPOA 4A3DH 1KXLA 1VQ9A 1KRSA 3F1ZA 4GOPB 3ULJA 4B3TL 4P71A 2VY3A 1V9PA 1I6HH 3UE1A 4DR1L 4BBRG 5E7NA 4JI6L 5K36G 4YY3Q 1KAWA 4WJ3M 2A8VA 5IYBH 3VDYA 4MZ9A 1JJGA 3UDIA 3L0OA 4R4OA 3GTOH 5M3FG 2YTYA 5GADC 2N3SA 1N32L 1L1OA 3S2DH 1SMXA 4JI0Q 3KFUA 2A1AA 1B70B 1VQMA 2ZTDA 1IBLQ 1XTDA 3KF6A 1I94Q 5ELOA 1LUZA
chains in the Genus database with same CATH superfamily
2OQ0A 1H9KA 2F3IA 1HR0W 1RHPA 1YNJC 3D31A 2PMZB 3PF4A 4ZKBB 2IX3A 2F4IA 5T1GA 4MN3A 4P74A 2XSCA 1SDFA 3Q6SA 2F3WA 2MGSA 3I2ZA 4GOPA 1EY8A 3F8TA 1O7IA 1SJHD 4XXEA 2XIWA 3OW2A 3GTKH 3PMFA 2PNRC 1XPRA 2E2IB 1PTOC 2C5CA 1S5FD 2RA4A 4JI8Q 2OF1A 2PNHA 3HOVH 1KL9A 3RZDB 2VQEQ 5DM73 1DJRD 1VQAA 1SNQA 4UDUC 1V1PB 1TWFH 4BBRB 2UUCQ 1VF5C 4X64Q 2KHIA 3R93A 5I9OA 1D8LA 1VQFA 1X6OA 4X62L 4P73A 4DNTB 1GUTA 1I3QH 3Q0AA 1G6ZA 1AP0A 2NN6I 5FJ8H 3GTLB 3U58A 4DV1L 2TMPA 5IYCG 2DNEA 1STBA 4NP5A 2MUYA 1CT1D 3MEHA 3KF8B 2B2YA 1D1KA 2JA6B 1B9NA 4G7ZC 2CQAA 2HCCA 2KBNA 3C1FA 1TS2A 1HNWL 2BA1A 1JMCA 1PFSA 1CKMA 1PTOB 2SOBA 3HZXA 3RD4A 1SYDA 3TP5A 3UI2A 4DV5Q 1VQPA 2NTSA 3NBHB 4A3EH 2F0PA 3PO3G 2K5NA 1BDOA 1II3A 4B3RQ 1NSNS 3CQZB 3PQIA 4NPSA 4B9WA 3CCEA 4DV6Q 1Q3LA 3LX0A 4H7BA 3QIAA 5EBCA 1DZ1A 3D4DA 3L2PA 1Y1WB 1K8AC 1CTMA 4K5WA 1EWIA 1LT3D 4IUVA 3K59A 4DUYL 1YIJA 2Q2HA 3G6JB 4KHVA 4V0BA 1S4ZA 3T1YQ 2F0MA 2PO4A 5LMNW 2R93G 4B3TQ 4JYAL 3R2TA 5EBDA 3T56B 4C3JB 1B1ZA 1Y8PB 1SE8A 1Q12A 1SNDA 3WOFA 1N32Q 4J6HA 4POGA 4JI7L 1NNXA 2A68D 2VZAA 1IW7C 1Q8IA 5CBEE 1HNZQ 1TWAB 1H9SA 4A3JG 1GUOA 3TREA 5EKKA 2G9HD 2K5DA 3AFQA 3N52A 3OW7A 3ICEA 4WORA 4HSVA 4FYDA 3A5UA 5M5YH 1EU3A 3LWUA 1AZQA 2OXPA 4XQNA 2Q2TA 4K0KL 4DV0L 1J5EQ 1LTAD 1STYA 3A54A 1UE1A 4BY7H 3TZUA 1PDQA 4GNXB 4LF7L 3PO2G 1T5EA 2RBMA 1VDZA 1DGSA 1MSGA 3MC0B 3PIP3 1LT6D 3AB9A 3D4RA 3M9BA 1RIPA 5JEAJ 1PH9A 4A3MB 2BH2A 3CC2A 1LTRD 1YJ9A 1K8OA 1WCMH 1VQ6A 3I4MG 2JEAI 5J1ZA 2K50A 3S16H 3J7ZC 1J9OA 5C5MA 1UE7A 4HJ7A 3AEVA 3HOYH 4HMJA 5HGTA 3EN2A 2QW7A 1I94L 4DK1A 3NUCA 1A8VA 1F9PA 4O1NA 2V1CC 1GO3E 2I07B 3GTGB 2PW5A 4DAMA 1I4QA 2HDLA 1BCPD 3W5OA 1CA5A 3J7AF 2XNAC 1HXYD 1XWEA 2Z4HA 3S2HB 2F0KA 4E6IA 3M3YH 5IP9H 3S1MH 3BZKA 1HNXL 2HHHQ 3G4SA 1GVPA 3M7NA 4PMWA 1EOVA 4PZ6A 3U4VA 5C4XB 3K7AB 2R7ZG 5M5XH 1RKNA 3T4AC 1QZGA 2UXCL 5JJLA 2WINB 5KRUA 4K2KA 1F9QA 1X3FA 3VA7A 4BY1B 4RCNA 2Z6KA 3DWQA 4CKBA 3FHWA 4I7ZC 4XYOA 2A19A 2WIIB 4X64L 4R1JA 2EYHA 4DN4M 5TSSA 2K4KA 4JI3Q 3EJIA 1LT4D 4OWWB 1GXDC 3H15A 1PZID 1SR3A 1K28A 3KOJA 3QO2A 4I7AA 1LV9A 2J7ZA 3CMEA 4DAPA 2X69A 3U9OA 2RKSA 2HDMA 1XYIA 1VQDA 1WTOA 3GP7A 2ICEC 3RR5A 2K5QA 3QOJA 4A3FG 4MIUA 2E2DC 4QIWE 4ME3A 2ALYB 4JI5L 2BDNA 4BS9A 2EYMA 3TS2A 1IYUA 1Q8KA 2Z6BA 5C44B 3SK6A 3VR4A 4DV5L 4DR4Q 3K8AA 3W1BA 1DM0B 2PYKA 4BXXG 4IPCA 1QZHA 4DAVA 1DONA 1QNKA 1STHA 1ONLA 2B2WA 3ZJYC 3K5MA 5GAGC 4XDXA 1HA6A 1KAAA 5IE8A 1IYJB 3M85A 2JJQA 3T1YL 4LK1C 4S3SA 4R8NA 5KYLA 2XGTA 1K8MA 1GJXA 2FJ2A 2B2VC 2Z1CA 2CW0D 1EFWA 1BBXC 1CZWA 5LMUL 1TWHH 3I4LA 1YVCA 4A93H 1PZJD 3HOVB 4C3HG 2A6HC 5IT9c 1PH1A 2KCMA 1ZKOA 4LFCQ 2B8GA 3HOUB 1X54A 3FKIG 2B63B 2PI2E 1TWFB 5L37A 4TSSA 1BR9A 4HR7B 1BBUA 3GQBA 2F0DA 2V4DA 1D5XC 2IJ0A 3RUZA 1HUMA 3PIOA 3VR2A 1VQHA 1VQ7A 3J81c 5D14A 4C2MH 1I3QB 1GOZA 1JORA 4FF3A 2PI2A 1JE4A 3MWYW 3QWNA 3NP8A 1J5EL 2J0TD 2OWOA 2OTLA 4A3IH 2WKCA 1STGA 2NVXH 4A3GG 4FXKC 3C1EA 3D8GA 4WRDA 1YNND 3HOXG 3ONAB 1X9NA 3E9HA 1ZYRC 1NTGA 2B29A 1RJTA 3HOWH 4B3SQ 4LFAL 1PFBA 4JG2A 3I4NB 1L1OC 1CA6A 1FR3A 4DUZL 2NVTH 1K83H 1EY4A 4ALPA 2KA7A 4A3EB 2F0VA 4J1MA 4X6AH 4JBKA 1OTCA 2K52A 4RWSC 1V1OA 3DM1A 2Y0SG 2MFIA 1XNQL 1VS0A 3G7LA 1DD2A 3K57A 5K5PA 1G2TA 2KJXA 1JR0D 1VMCA 4X66Q 1JE5A 4ABNA 4CGYB 2J4XA 3STBC 4YCWA 4IOCA 4GOPC 3H0GH 4IPGA 1YJWA 4AQYQ 1YHBA 5EAYA 2EPBA 3JC66 3HKZG 1WI5A 1Q1EA 2WACA 4IUPA 5C3XA 2F3VA 2KENA 3F2UA 4OGQC 1HRJA 4ILWA 3K6OA 1JC7A 1F9RA 3KBGA 4QY7A 4YWMA 2WB1E 4GKJQ 3HEJA 1L1OB 3KYHC 3S2DB 1EIFA 2KEEA 1B3AA 2VQFQ 1N36Q 2LMCB 1BBWA 2RHQB 1EU4A 4B3MQ 2TSSA 3BYYB 1Y1VB 1VQEA 4JI3L 4ZQ3A 1XMOL 2L1BA 2QF7A 2WV6D 4A3DH 1KXLA 1VQ9A 4GOPB 4P2CB 1LTSD 1RTOA 3ULJA 2VY3A 2B2YC 1CQFA 4BBRG 5K36G 3JAML 1KAWA 4WJ3M 2A8VA 3FMCA 1JJGA 4R4OA 2YTYA 5G3LF 2EDGA 1A2TA 1QILA 2D9UA 3KFUA 1VQMA 3OOCA 4L6TB 1IBLQ 3HOYB 5ELOA 1LUZA 4PG3A 5GROA 1SFOH 4IFDG 3GTJH 3AU7A 1M90C 3KLSA 5C0XJ 1RL2A 1D5ZC 3QG1A 4G57A 1PH7A 4YHHL 3C46A 1TY0A 3S1QH 1DOKA 2JA6G 1S5DD 1WFQA 4OO1G 4X3KA 5AJ3L 1K0RA 2K5HA 1A3TA 3OWEB 1IL2A 4BBSH 5DLQE 2K75A 1B9MA 1MSHA 2Q2IA 4A3CH 3M3YB 2ZM6Q 3S1MB 4C56C 4N8FA 2DN8A 1SN8A 1YJNA 1B3QA 1U4MA 4LF5Q 1SMYC 4MTNA 1PH5A 5C4JH 2F0JA 4H0LC 1Y1WG 4IUQA 5KIXA 1CSQA 1SXTA 2CVRA 2KQ3A 3D6CA 4LF6L 4C3JG 1A3VA 3NQIA 2HIVA 1F2LA 4KHPL 1ZXTA 3UDGA 1HHVA 2PQEA 3Q24A 4IALA 4G7OC 4DV3L 4RMFA 2JA5H 2BE5C 1KDBA 3OHXC 1UEAB 5IY0A 1D2BA 2ID0A 5KNBA 3A0JA 2SDFA 4DR7L 4WFN3 1VQOA 5JPNC 4JBWA 4UP7A 1R4PB 5JPMC 1LABA 1HZBA 5COYA 3NE5B 2FMCA 4UPAA 3MHBA 1Z9FA 4B3SL 3PV0A 1SNPA 2RDGA 4YWLA 1SYEA 1AW7A 5JOBA 1H9SB 5ISRA 4DR6L 2GVBA 1EUJA 2YV5A 2F0NA 5KGUA 4PZ8A 4CJ0B 1NMGA 1JT8A 5CGKA 1BQQT 1NR2A 1SMYD 3SVMA 3BDCA 2DJFC 4DPGA 4AIMA 3CPFA 4A3LG 4DR2Q 3ERSX 4MHEA 1GM5A 4L5RC 4H13C 4A3MG 4YIJA 3OMCA 4DR1Q 2KCNA 1GUNA 1EOTA 3BJUA 1FGBD 5ELBA 1EY0A 4TRDA 3A8JE 4LUZA 3BG3A 3K5OA 1TWHB 1WYDA 4NKLA 5FLXL 3K5LA 4KD3A 4IJHA 3D3RA 4LF4L 2AMCB 1PH2A 2NN6G 3NSWA 1T9HA 4GZYC 2QGQA 1IBKL 2EIFA 4IJLA 1QNUA 5FOBB 2Z6KC 3CHBD 1CKOA 2UXBL 2XRQD 3UDXA 4GN5A 4C1NI 4KKTA 2UXDQ 5A35A 1JICA 4JOIC 3CC4A 1R4QB 4C2MB 4KY7A 3GTQB 2QEXA 1MJCA 3CC7A 4B3ML 4DR5Q 3H94A 5C4XG 2NWGA 2EJGC 2H1EA 1H9RA 4A3IB 3J80c 1XMQL 5E4WC 3SR1A 3IRBA 4X3SA 4BY1G 1GUWA 3RN5A 4QUFA 3DMUA 2N49A 3HOWB 4Q5VA 2NVYB 1EYAA 1UAPA 4V190 2NVTB 2EY1A 1DYQA 2R92B 1Q7YC 1IBLL 2IHFA 3J7YW 3IFDA 2OTJA 4RKBA 1E1OA 1X55A 2B2WC 2QEJC 1PXUA 3NEMA 2DNCA 1NUCA 4JI2Q 3T16A 4N8X1 2JE6I 2WFWA 2L9HA 1AE2A 2F0LA 3H0GB 2L4NA 3PIPA 5IYBG 2A68C 4RKLA 4FVMA 1ICWA 2HQLA 4NDXA 2ICIA 1I4HA 1MHWC 5C44G 3CKIB 4JI1Q 3SGIA 3I90A 2QILA 4NXNQ 1OXSC 4K14A 4HJAA 1EIYB 4KN7C 3L7ZC 3T51B 5DNFA 4OXPA 1EYDA 3VYTA 3OIQA 3DWPA 3S24A 4EX5A 4FF2A 4CJ1B 3MEFA 1JWSD 1QUQA 4HIOA 1G2SA 1SAPA 3EQLC 1I5FA 1SROA 3CCLA 1S3OA 4DR3Q 1VQCA 4QIWB 4XYQA 4KV6A 5HURA 2C9OA 2EVBA 4O42A 4X65L 4B9XA 2KHSA 5AFWA 4KJOA 3T1HQ 2UUAL 3J81i 1HTLD 1O78A 4GNXC 4A3KB 3C2PA 3GTPB 3HOVG 1D1IA 5KNCA 5IODA 4A3DB 4F88A 4DAYB 5C3EH 2R3ZA 4K5XA 3HOUG 3GV3A 2B63G 1B2TA 4NXMQ 1WOCA 3RLOA 4F8MA 1YEZA 1LM0A 1BO0A 1H95A 4G4KA 4OL7A 1EQVA 3I4MH 2VW9A 2XTIA 1SFOB 2IT1A 1UEBA 3HP3A 5FJ8G 3KLSX 5JAVA 1WTVA 4H02A 5BR8L 1BCPC 4RGTA 1ASZA 1O7ZA 4KJNA 2B39A 3Q22A 1NE3A 4XQJA 1L0WA 1V1QA 3MFYA 2B2TA 5FLMH 3QR8A 1Y14B 2NTTA 2NB0A 1SNCA 2RHSB 1RTNA 2JK8A 3HS0C 2LXJA 4DR2L 3N6RA 3JAME 2ZTCA 3IFTA 2E2JH 1NY4A 3MXNA 1O7YA 2K6AA 2SEBD 1G291 2ZTEA 3I4NG 4FNFA 3R3OA 1PRTF 3GDEA 1NAPA 4A3EG 1N34L 2YTXA 5JEAG 1H9JA 3A56A 4CDEC 1PH3A 1S40A 3QB3A 2B2UA 3V2TA 3RZOH 2Y0SE 1CFMA 1HCZA 5C4JB 1W2BA 2O5JC 2OT2A 3GO5A 1N33Q 1E2WA 4YY3L 2K28A 1NJIC 3KLRA 3H6MA 4DXFA 1XPUA 1YI2A 2XWBB 4IO9A 3S14H 4JI0L 3MAQA 1G6PA 1M8AA 2WKDA 2JA5B 1BCPB 1ESFA 5DM63 1RCVD 3I72A 3DUZA 3TZDA 1C7YA 2NVQH 4Y7NH 3I73A 2I5MX 2PMZE 3E6ZX 1Z6HA 4P75A 3AFPA 2PZTA 4ZK9B 2Q8TA 1WTXA 2JA7B 1JB3A 2K04A 3PF5A 1K3RA 2O4XA 1G51A 2PQAA 4ZRZA 5FO7B 4JW0A 2AQ3B 4OEMB 3PUXA 4JI8L 1HQRD 4XTCS 1UNSA 5IGFA 1Y1VG 4JBMA 3TMEA 3KUPA 1QVGA 1K73C 2VQEL 2ZJQA 3CCQA 3Q8DA 4JI4Q 2LSSA 1PMRA 4RCOA 1L2FA 2UUCL 2RSOA 3DWAA 4L5TA 4ZUJA 1X65A 1EZ6A 3SK4A 1STNA 2AWNA 3UE0A 4JI2L 2WB1B 4AYBB 2CW0C 3SK8A 1ET6A 4DA2A 1QWYA 4EVOA 1VQKA 3HOYG 3EFXD 3TDQA 1TT2A 5CV6A 1TKWB 5G3LD 2JA8H 5ELEA 1L0XB 1VMPA 2F0TA 2A69D 4IURA 1S5CD 4RFBA 4JI1L 1WD0A 1EIHA 1CKNA 4LJZC 4ME5A 3P1HA 2GN5A 2LFNA 1IBMQ 3S17H 3HOZH 3FVQA 4IUTA 5EJWA 1Q86C 1XNRQ 4LFBQ 1ET9A 4R9WA 1S5BD 4DV2Q 2EY5A 3K5NA 2PZUA 2HT1A 3ITPA 3FKIH 4JV5Q 4MTKA 5IP9G 4B3RL 1SYCA 4DV6L 1EEID 2B3GA 3EROA 4C3IH 2Z8LA 5JJKA 3A5ZB 2QKIC 4TVAB 1YNNC 5FLXE 4KD4A 2L12A 1M4VA 1EY7A 2YTVA 3CD6A 4DU9A 2VB3X 4ZKCB 1XPOA 2G9DA 3NTHA 1KRSA 3NBHA 4B3TL 1STAA 1LO5D 5EPKA 1QOHA 4M1UB 1V9PA 3L3OC 3GTKB 2SNSA 3GTOH 5GADC 1N32L 1RD9D 4ID6A 5I6YA 5EQ0A 1XTDA 3MTSA 1FNWA 1HNZL 2EXDA 1PTOF 1RODA 1QE6A 3S15H 2L5TA 5E1FA 4DV4Q 2MQHA 3NXWA 5IIFA 1MIUA 2E2HH 4KMUC 2UU9Q 3EIVA 4LF8Q 2WAQG 4PMBA 1SRUA 3CRLC 5CV8A 1UUPA 5CV7A 2OQKA 1RDPD 1NMFA 1VQLA 2M2LA 5C5LA 2CQOA 5CV4A 3H91A 3TEHB 4DV7Q 4UY8C 2N8NA 2A6ED 2MHVA 4GLVB 3DEOA 4HIMA 3A8IE 1AE3A 3PUWA 2NBFA 1I50H 5M5WH 5M3MH 1YBYA 4K8IA 1MI2A 3SHLA 3BDLA 3FPPA 2NZHA 4EQ5A 4FDBA 4X3UA 1M1KC 4HJ5A 3VYUA 4L5QA 1JOQA 1WJJA 3VA5A 4LUVA 4DF7A 4JC0A 4KY5A 1PV4A 1ESRA 2EZVA 2YU9H 1F2YA 5KEEA 3K0XA 3WWVA 4HTHA 5CR3A 1BUVT 1K8GA 3PUZA 3K58A 5EKIA 2F0GA 2E5LQ 3HKSA 1SJED 3TP8A 1PH8A 5C3EB 2L15A 4APVA 2JN4A 3J80i 2D62A 1FJGQ 4LUOA 4PMCA 1B53A 4R8IA 1D5MC 4BBRH 4B08A 2HHHL 2KCTA 3P20A 3PUVA 4A3BH 2Z4IA 4WJ4A 2DUDA 3ULLA 1F77A 1WVLA 2JP1A 1MJEA 4POFA 2EJMA 5IT9L 4A3IG 2VUMH 3GTLH 4IFDH 2I5LX 1C8CA 3QOLA 4KI0A 3CCMA 3DXJC 5M5YB 1GUSA 2K05A 3NPPA 4RGMA 1YZ6A 3V05A 3RLFA 5FK9C 4JI6Q 1F2ZA 3HOWG 1UE5A 4KY6A 1ENCA 2JA6H 4KK7A 4BY7B 2XVSA 2X6LA 2E75C 1BOSA 2MP1A 2LS01 2HD3A 2L11A 2E76C 2NZOA 4ODGA 2R92G 1WTPA 2GVAA 2EYOA 4BWGB 1B7YB 1VQ8A 3RZOB 1AZPA 5JJIA 5IP7H 1IKMA 1OXUA 3MVVA 1WCMB 1Y1WH 4IQZA 5IYDG 3J7A5 5H1SE 1PYBA 1VQNA 3S16B 5C0XG 3GV6A 3H0GG 3S14B 1R9TH 4DV2L 1CHQD 5C3WA 4GS3A 4JV5L 4DR4L 2ZXRA 4ZLTF 1A2UA 3IAYA 2XWJB 1W6JA 2KUMA 4Y7NB 4L5SA 3M4YA 2MO1A 1YHQA 4IN3A 3BVZA 3HG9A 1N9WA 1Q46A 5CV9A 3S1RH 1VQ5A 2DJGC 2EYLA 1XJVA 4EQPA 1EQTA 4LNQA 5M5XB 4RAUC 1GD7A 2PCFB 1E0BA 4A4IA 1Y69U 3IL8A 3DHQA 4A3KG 4JBJA 4LFCL 4DV1Q 5IGDA 1Q81C 1LLRD 2KECA 1A15A 3BZDB 2FFKB 4A3DG 1QUQB 4K6DA 1MGSA 2RCNA 4PQXA 1XTCD 4KN4C 2D5DA 3NK9A 2F03A 4A3LH 2F0OA 2F0HA 3ER0A 3EVQA 1V43A 1HNWQ 1E24A 4DNRB 4CBVA 1JJ2A 2ES2A 1PVOA 1KDAA 1SEBD 2IX1A 2MO0A 4H44C 1PFMA 2BA0A 4QF4A 4NB3A 2R7DA 2JA8B 4YCVA 3FP9A 3NHHA 4X3TA 3TQYA 3OPOA 5FKAC 3E0JA 3MXGA 3HOZB 2DY8A 2AHOB 4DNIA 1C4QA 1HPCA 2ASBA 4DUYQ 4XT3B 1VQ4A 4ZUIA 1NBWA 4DGZA 2BOSA 4F87A 2P5ZX 5M3FH 1HR0Q 2K14A 3TN2A 3FKIB 2CFMA 2VXWA 1BKBA 3ZYYX 2IPKD 4R4IA 1WTHA 4A3CG 3TP7A 1TVXA 3W3AA 4UHVA 4C3IB 3PGZA 1JOKA 2QCPX 4YWKA 1JCKB 1PRTD 4OHJA 1MBYA 4IFDI 1NR4A 4X66L 1MKHA 3MXNB 1SYGA 1ENFA 1U5KA 5LL6X 1VQGA 4AQYL 5KNDA 1PLFA 1QVFA 3SE0A 1S5ED 1FJGL 3GTOB 3K80C 4HCSA 2JA5G 1VQBA 4A93B 3MZ5A 4CKEA 1JWMD 5GAHC 3S15B 1HZ9A 1PZKD 1BF4A 5IGEA 3D4WA 1EQQA 4QCLA 1A3UA 4LF7Q 4GKJL 3VYSA 1FNUA 5M9OA 2IWHA 3TP6A 2JA7G 5CC4A 1TIID 2DY7A 2VQFL 1N36L 1KABA 1D7QA 2VS1A 4FF4A 3M7GA 3I91A 5FO8B 2EQSA 1QB5D 1EQRA 3KDFA 2LXKA 4OX9Q 1HTPA 1X3QA 1U4RA 1I50B 1EY5A 5M5WB 2NVXB 5M3MB 3I70A 2CH4W 2JXMB 3GD7A 4TKOB 2AKWB 5IYCH 1CQVA 5C44H 1IL8A 1JWUD 3BYTB 3C3LA 1F2MA 3DEPA 1LTID 2JYOA 1ILQA 1GHKA 1HZCA 2JEBI 2PQAB 5HGQA 3H3VH 4I65A 1TWGH 1K83B 2XN9C 3SXHA 4M8AA 2WB1G 4AYBG 3CAMA 4DKAC 3V96A 2YU9B 1FGUA 1EZ8A 4LF9Q 3PO3H 2MPMA 1HNXQ 1OXTA 2M9VA 1LTGD 3MXUA 5LMNQ 4BA2I 5I4DA 1QG7A 2F52A 1X56A 1IHZA 2YYZA 3NWSA 4N9PA 2UXCQ 3X3NA 2R93H 4J8QA 2XRSD 4DXGA 3FRPB 3T13A 4F7XA 2OCEA 5IGBA 1CK1A 1HUNA 3HOUH 2ZM6L 3LWEA 2B63H 1A6XA 2BCOA 3FPUB 1Y8NB 1HFGA 3FDTA 4LWCA 3CCVA 1CKNB 4A3BB 3CP0A 4LF5L 2EYFA 3J81j 1RF2D 3KLWA 4HJ9A 2B8FA 2H5XA 4JVZA 1L0YB 1E22A 1IYVA 3LNNA 4GN4B 1P16A 4A3JH 4K8JA 4HAEA 3ERQA 3J7AV 5CMDA 2VUMB 4OONA 4OWXB 1YNJD 2E74C 4FP5D 2QDLA 1EWHA 2EE1A 1SYFA 2SNMA 2EJFC 5I2YA 4IUUA 4JPBW 4FO2A 3EBEA 1PA6A 1I4RA 1F9SA 4JI5Q 1U4PA 4CKCA 1H9MA 3I4NH 1X3GA 3S1NH 1TQOA 3CCUA 1I4GA 5IT9E 1B50A 1AEXA 3HFZB 2CWAA 3J80L 3PO2H 5JEAH 3G6EA 1PTOD 1SE2A 2WAQE 2KCCA 1W3SA 2HUGA 3A7AB 2K03A 2BH8A 3CRKC 2ENBA 5E3FA 1JQYD 2N78A 1QCBD 4HIKA 2UUBQ 1IZ6A 1ML0D 3CCRA 1R9TB 3J81E 4GN3B 4LW1A 2Q2UA 4RG1A 3BVGA 3VR5A 1HR0L 1FVIA 2CWPA 3GTJB 4YCUA 1WTWA 2F0UA 1PH4A 2RDHA 1D6EC 1FYCA 4DFAA 1EIGA 2AQ2B 3S1QB 5LMUQ 3JAMi 1SLJA 4EQOA 1CHPD 4P71A 4BBSB 2QDBA 1I6HH 1LT5D 4DR1L 5J22A 4MZ9A 3S1RB 2N3SA 3MXPA 4DK0A 3S2DH 1SNMA 2A1AA 2ZTDA 3KF6A 5DEHA 4FXDA 3BDOA 1Q1BA 3B6YA 1TWCH 2N55A 5IWAQ 1E2ZA 5C6AA 1KQSA 2R7ZH 1O80A 2LKVA 3SK5A 3AQQA 3CXCA 2L0CA 4K6LA 1VF7A 1Y1VH 3G71A 3H3VI 1TY2A 4OIJA 2EY6A 5EPJA 5C3EG 2K32A 3DLLA 5E4XA 1SSOA 2K33A 3L9AX 3HKZE 2UXDL 4IPDA 2A69C 4LFAQ 1PHJA 2IY5B 4LMQD 4DUZQ 1AH9A 2D0PA 5C4HA 4XIGS 4DR5L 5FO9B 1I6VC 3AYHB 1EEFD 4OX9L 1HA5A 3CF5A 5LHY1 2LY7A 4CDFC 4K2LA 4MNOA 3U4ZA 2Q8IB 1XNQQ 3I4OA 1OO9B 1IW7D 1I4XA 2GA4B 2K1BA 5FLMG 1SYBA 4A3FH 4CHTB 3A74A 3CMAA 1CSPA 1K9MC 5M3FB 1FD7D 4UP9A 1ASYA 2RSNA 5I6WA 2OEOA 2F4VQ 4IPHA 4BY7G 1FL0A 3TSSA 5HY6A 3NQTA 1I4PA 3R8BA 5LL6S 5EGTA 2A73B 4LAAA 4LF9L 4BXXH 1OXXK 4P72A 3OTOQ 1G8ZD 1ICFB 5JVH3 5LMNL 5DAUA 1AN8A 2IL8A 1CUKA 4UP8A 4U673 1EYGA 1WCMG 3KJOA 4KHZA 4FF1A 4DK6C 1E2VA 1V8QA 2K5VA 3ND8A 1YHAA 1KLGD 1LACA 1V1PA 1MD2D 3H3VC 2ZJPA 3TBIB 1Y8OB 1Z47A 2X6GA 3E9IA 4NXNL 4HMIA 4R4CA 3NTIA 2BDOA 2MNAA 1ILPA 1C9OA 4JOIA 4C3HH 4RA8A 1HQMC 1B4OA 1PYWD 3IKJA 1XMOQ 2A6EC 1YNXA 4XT1B 1VQJA 3U9SA 3F2DA 3PCOB 2FINB 2RF4A 3KF8A 5CORA 2HQEA 1HJPA 4DR3L 3NWTA 4WJWA 3RMHA 2VNUD 1A63A 3O13A 3T1HL 3M4OH 4IOAA 1HFNA 5ELCA 2Z9HA 4A3GH 1WD1A 4OWTB 3PUYA 3RN2A 2K01A 3I55A 1EL0A 3HOXH 4NXML 4YHHQ 1JJCB 1NCVA 2CCZA 1LTLA 1TWGB 3AMUA 3DM3A 2ATWA 5AJ3Q 2O5IC 4OIKA 1BXTA 2UUBL 5A2QL 1TS4A 1E3PA 4DAYA 3PO3B 3E5SA 4BA1I 2CKZB 2JA8G 3P7JA 1KTKA 2PW7A 1UE6A 2R61A 1EFID 2AWOA 3BVMA 4NW2A 1BNZA 3HOZG 4JCVE 2R93B 3R2IA 4LF6Q 4G7HC 2AUKA 3P75A 5EKLA 3OYYA 3UDFA 3VYRA 4PV1C 3OIPA 3D6WA 1CI3M 2AUJD 4KHPQ 4ZAIA 4XQQA 1SE4A 3GTMH 1XX8A 3D0FA 4KLKA 1PH6A 4DV3Q 4DK3C 5KYIA 2K5WA 2IX0A 2EXZA 2KOLA 3QJYA 4C3IG 2I46A 4IUNA 3KBXA 3K81C 2F0QA 2Q8RE 4O0AA 4A3JB 3GTQH 5IWAL 5ELFA 4C1NK 4ZYSA 2FXQA 5D3DA 1N33L 4DR7Q 3SDZA 2JSOA 4GNXA 1KLUD 1TS5A 2ZJRA 1AFPA 1GKHA 1EY6A 4JK1C 3JAMc 4EGVA 2E2IH 1SE3A 2AQ1B 4A93G 2NVYH 4L8JA 3A55A 3E3XA 1XXGA 3HGBA 3S1NB 3E0EA 4DR6Q 1QJOA 3MA2B 2F0FA 5C4ZA 3RLNA 3S9WA 3KJPA 1J8IA 1KHIA 4OELB 3PO2B 3RZDH 2R92H 1U0LA 1HH2P 4A76A 1P8LA 3WDNA 1LYLA 3G48A 1K0SA 2F0WA 4UAIA 1T5XD 1U9RA 3T53B 1G91A 4R4QA 1FNVA 5K36H 3URYA 2A6HD 1E1TA 1CZGA 1X32A 3I4MB 5IYDH 1Q90A 3OWFA 1IXRA 1PYSB 4NMZA 3M4PA 5C0XH 3OSOA 4ULLA 4RHRA 4GKKQ 5F2DA 2F4VL 5JVG3 3BU2A 4EQNA 1KNAA 5M3MG 3J80E 3VR6A 1U4LA 3EA6A 4JI4L 2ZXPA 3OTOL 1BCPF 1HZAA 4LF4Q 4QQBX 2JQOA 3BZCA 2E2JB 2KHJA 4QGUA 1DOMA 1STEA 3KK7A 3J81L 3WOEA 1I6HB 1IBKQ 2WP8J 4OO1H 4Y52H 5BN4A 3KDFB 4PNYA 3NTKA 5EPLA 1PTOH 1BVSA 1B8AA 4AYBE 4CDCC 3CPWA 5BN5A 2UXBQ 1TXYA 1ZYRD 1S72A 1UWVA 4GLAC 5JJZA 2QA4A 4RGOS 3CQZH 1TS3A 3FEWX 1E7ZA 1TWCB 2CH4A 4J15A 1KC8C 2EYPA 1IBML 2R7ZB 5GAEC 4U68A 1J6QA 1ENAA 3NENA 3GTPH 2L55A 1XNRL 4LFBL 2KVMA 4A3KH 1ZEQX 3A8KE 1XMQQ 4HCEA 3PIO3 4C3JH 3BS1A 1JB7A 4QB4A 5I2XA 4KTAA 4KKUA 1CM9A 2A5HA 2I0QA 2NVQB 2NUCA 3STBD 4A3BG 5IGCA 3W1GA 2F0EA 3K0YA 1TWAH 1KRTA 2E8GA 4O2DA 4TQUS 3ND9A 5D3IB 2VUMG 4A75A 4HJ8A 2D0OA 2H4OA 3PSIA 5ELDA 2IW3A 4A3FB 3CU7A 4IFDJ 4X62Q 3U50C 1GUGA 4RHSA 4HN7A 1PRTC 2F1MA 1QVCA 4RH6A 2RCFA 3X3MA 2Z0SA 1WTQA 1C0AA 2EOTA 3LGJA 2EYJA 3NELA 4DV4L 2IHEA 2F0IA 2UU9L 4PZ7A 1SNOA 4LF8L 1X3PA 2B2TC 1JOOA 4CJ2C 5I9PA 5FLXc 3VR3A 4QJFA 4HEDA 1DCZA 5IP7G 1YITA 4FXGC 1TU2B 5BN3A 4DV7L 4A3MH 2HIXA 2D2CC 1A0IA 2FMMA 2O2LD 2RDFA 1KD1C 3H09A 3I7FA 1Z7TA 2B2UC 3Q23A 1EWCA 1EYCA 1LTTD 3S17B 1GHJA 2KEDA 3CW2C 3F2CA 3ULPA 2R6GA 2JA9A 4X65Q 2N88A 4Q0FA 4C3HB 4GLXA 2UUAQ 2RQXA 2NN6H 2ZXOA 5ELNA 4N9TA 3W2DA 1OXVA 4JYAQ 1DXMA 5CYUA 4HSPA 3GTGH 4CDDC 4BBSG 5J3BA 1PRTB 5J39A 4QL5A 3I8ZA 2WAQB 1O7LA 5C0XI 2F0SA 2CHBD 4AH6A 3S2HH 2A74C 2JA7H 4JI7Q 4L63B 3CCSA 2B2VA 3M4QA 4R4TA 1WTRA 3NBIA 2G5DA 3CCJA 2HCIA 1C48A 5IOCA 1K3BC 3HRZC 3M4OB 1X3EA 5C4XH 3K7AH 5IGGA 1B44D 3F2BA 5CBAE 2E5LL 5T1IA 3TS0A 3A7LA 2EY2A 4A3GB 1TR5A 5BR8Q 4OO1I 1Q82C 4BY1H 3MFGA 3HOXB 2DGYA 1LTBD 2FHTA 1A62A 2K7VA 2VL6A 3RNUA 3KF6B 4K0KQ 2MJ8A 4DV0Q 1KDCA 4QMGA 2C35B 2R7FA 2M00A 5NUCA 4HIDA 2E2HB 1N34Q 3TRZA 1IKLA 4GKKL 1EY9A 1VQIA 5CV5A 2Y0SB 4IZ8A 2I5HA 1KIXA 4KKSA 2BE5D 1PFNA 3K7UC 1N8RC 5GQOA 3I56A 1VCIA 1KNEA 3F1ZA 3I3CA 1W6KA 2RVLA 1SBBB 2VB2X 3OMGA 4QUCA 3UE1A 2NZ1D 2NYZD 5E7NA 4K5VA 4JI6L 2PZWA 4ZCKA 5D65A 4YY3Q 4RGNA 5IYBH 3VDYA 2PPBC 3UDIA 4Z9CB 5M3FG 1L1OA 5A2QE 1SMXA 4JI0Q 1DOLA 3GTMB 1B70B 2ZT9C 3L0OA 3SEBA 1I94Q 3HKZB
chains in the Genus database with same CATH topology
4PG3A 1Q1BA 3B6YA 2OQ0A 5GROA 1HNZL 1TWCH 2EXDA 2F3IA 5IWAQ 3S15H 4IFDG 1KQSA 1HR0W 3GTJH 4DV4Q 2MQHA 5C0XJ 1M90C 2R7ZH 1RL2A 3AQQA 3D31A 3CXCA 1MIUA 2E2HH 3PF4A 2UU9Q 3EIVA 4LF8Q 1PH7A 1Y1VH 2WAQG 3G71A 3H3VI 1SRUA 4YHHL 5C3EG 2OQKA 4P74A 3S1QH 3DLLA 1NMFA 1VQLA 2JA6G 2CQOA 1WFQA 4OO1G 5AJ3L 1K0RA 2K5HA 3I2ZA 2N8NA 3TEHB 4DV7Q 4GOPA 4UY8C 1IL2A 4BBSH 4GLVB 3HKZE 3F8TA 1O7IA 2K75A 5DLQE 4IPDA 4LFAQ 3OW2A 3GTKH 4HIMA 2UXDL 2Q2IA 1XPRA 1PHJA 4A3CH 1AE3A 2ZM6Q 2IY5B 4DUZQ 1AH9A 1SN8A 2D0PA 4XIGS 4DR5L 3PUWA 1YJNA 1I50H 3AYHB 5M5WH 5M3MH 1YBYA 4LF5Q 4OX9L 4JI8Q 2PNHA 3CF5A 3HOVH 1KL9A 4MTNA 1PH5A 5C4JH 1Y1WG 2VQEQ 2NZHA 4MNOA 3U4ZA 1CSQA 1XNQQ 3I4OA 4EQ5A 4FDBA 4LF6L 1VQAA 5FLMG 1M1KC 4HJ5A 1TWFH 4A3FH 2UUCQ 4L5QA 3A74A 1WJJA 3CMAA 4LUVA 4X64Q 2HIVA 4KHPL 1CSPA 2KHIA 3UDGA 1K9MC 4UP9A 1D8LA 1VQFA 1X6OA 4JC0A 1PV4A 1ASYA 4DV3L 4X62L 4P73A 4RMFA 4IPHA 2JA5H 2YU9H 1FL0A 2F4VQ 4BY7G 5HY6A 1I3QH 5IY0A 2ID0A 3K0XA 3WWVA 4LF9L 3A0JA 2NN6I 5FJ8H 4BXXH 1OXXK 4P72A 3OTOQ 1K8GA 3PUZA 4DV1L 3U58A 5LMNL 4DR7L 5IYCG 1VQOA 2E5LQ 3HKSA 1CUKA 1PH8A 4UP8A 3KF8B 1EYGA 2L15A 4APVA 4JBWA 1WCMG 4UP7A 3KJOA 3J80i 2KBNA 4KHZA 2D62A 1FJGQ 4LUOA 1HZBA 2BA1A 4DK6C 1JMCA 1HNWL 1PFSA 2K5VA 1CKMA 4UPAA 1YHAA 1Z9FA 4BBRH 4DV5Q 1VQPA 3PV0A 2ZJPA 2HHHL 2KCTA 4B3SL 1Z47A 3NBHB 4YWLA 4A3EH 3PUVA 4A3BH 3PO3G 2K5NA 4DR6L 2GVBA 3E9IA 4WJ4A 4B3RQ 1EUJA 2DUDA 2YV5A 4NPSA 4NXNL 3ULLA 3CCEA 4R4CA 4DV6Q 4PZ8A 1MJEA 4POFA 2MNAA 1NMGA 1JT8A 1C9OA 4JOIA 4C3HH 4DPGA 3L2PA 1K8AC 4AIMA 4A3IG 1XMOQ 3CPFA 2VUMH 1EWIA 4DUYL 1YIJA 3GTLH 4DR2Q 2I5LX 1YNXA 2Q2HA 4A3LG 1VQJA 3T1YQ 3ERSX 4KI0A 5LMNW 2R93G 1GM5A 3CCMA 3F2DA 4B3TQ 4L5RC 4JYAL 4A3MG 3PCOB 2RF4A 1YZ6A 1SE8A 3RLFA 4DR1Q 4JI6Q 3HOWG 1UE5A 1HJPA 4DR3L 3BJUA 2JA6H 1Q12A 2VNUD 1N32Q 1A63A 4POGA 4JI7L 2NZOA 4LUZA 3T1HL 2R92G 2VZAA 3M4OH 2GVAA 1VQ8A 1B7YB 1WYDA 1HNZQ 4IOAA 4IJHA 4A3JG 4LF4L 2AMCB 3TREA 1PH2A 2NN6G 4A3GH 1T9HA 5JJIA 3AFQA 4OWTB 2QGQA 5IP7H 3PUYA 3RN2A 3I55A 1OXUA 1IBKL 3HOXH 2EIFA 4NXML 4IJLA 4YHHQ 1JJCB 1Y1WH 2CCZA 2Z6KC 5IYDG 3J7A5 5H1SE 1PYBA 3ICEA 1VQNA 1CKOA 1LTLA 5C0XG 2UXBL 3H0GG 3DM3A 3A5UA 5AJ3Q 5M5YH 1R9TH 3UDXA 2ATWA 4GN5A 4DV2L 2UUBL 2UXDQ 1E3PA 4GS3A 2Q2TA 4JV5L 4DV0L 4JOIC 4DR4L 4K0KL 3CC4A 4BA1I 1J5EQ 2QEXA 2CKZB 2JA8G 1MJCA 3CC7A 4B3ML 4DR5Q 1UE1A 4BY7H 4GNXB 5C4XG 4LF7L 1UE6A 3PO2G 4L5SA 2AWOA 1DGSA 3J80c 2MO1A 1XMQL 3HOZG 4JCVE 3IRBA 1YHQA 4BY1G 3M9BA 1RIPA 5JEAJ 3RN5A 1PH9A 4LF6Q 2BH2A 3UDFA 3OYYA 1N9WA 2N49A 3CC2A 1YJ9A 1Q46A 1WCMH 1VQ6A 3S1RH 3I4MG 2JEAI 1VQ5A 4KHPQ 2K50A 1XJVA 3S16H 3GTMH 3J7ZC 3D0FA 4KLKA 1PH6A 1UE7A 4DV3Q 4HJ7A 4LNQA 4DK3C 3AEVA 3HOYH 2IX0A 1GD7A 1Q7YC 1IBLL 2IHFA 3EN2A 4A4IA 1I94L 2OTJA 3K81C 4O0AA 4A3KG 1E1OA 1A8VA 4JBJA 4LFCL 5IWAL 4DV1Q 3GTQH 1X55A 1N33L 2FXQA 1Q81C 4DR7Q 2V1CC 1GO3E 4A3DG 1QUQB 4GNXA 3NEMA 4DAMA 2RCNA 4JI2Q 2ZJRA 2JE6I 3W5OA 4A3LH 2WFWA 3ER0A 1AE2A 1GKHA 1V43A 3PIPA 5IYBG 1HNWQ 1E24A 3JAMc 2HQLA 1JJ2A 2E2IH 5IP9H 2ES2A 3M3YH 1PVOA 3S1MH 3BZKA 1HNXL 2HHHQ 3G4SA 2IX1A 2MO0A 1GVPA 4A93G 2NVYH 4PMWA 5C44G 3M7NA 1EOVA 2BA0A 4JI1Q 3SGIA 4NB3A 2R7DA 3E0EA 4DR6Q 4YCVA 4PZ6A 3FP9A 4NXNQ 1OXSC 3KJPA 3RLNA 3U4VA 4HJAA 1EIYB 2R7ZG 1KHIA 3L7ZC 5M5XH 3RZDH 3TQYA 4OXPA 1QZGA 2R92H 2UXCL 1U0LA 1HH2P 4A76A 1P8LA 5JJLA 4DNIA 1LYLA 2AHOB 2ASBA 3G48A 1X3FA 3S24A 4EX5A 4DUYQ 1VQ4A 2Z6KA 4R4QA 1NBWA 3FHWA 3MEFA 1E1TA 1QUQA 4HIOA 2A19A 5M3FH 1I5FA 2K14A 1HR0Q 1SROA 3CCLA 2CFMA 1S3OA 1BKBA 5IYDH 4X64L 4R1JA 1IXRA 1PYSB 4R4IA 1VQCA 3M4PA 4DR3Q 4A3CG 2K4KA 4GKKQ 4JI3Q 4OWWB 2F4VL 3BU2A 3H15A 1SR3A 3PGZA 4X65L 3KOJA 4YWKA 5M3MG 3T1HQ 2UUAL 3J81i 4GNXC 4IFDI 3CMEA 3HOVG 4JI4L 3OTOL 1HZAA 4LF4Q 4QQBX 4DAYB 5C3EH 2JQOA 3BZCA 2KHJA 4X66L 4QGUA 1MKHA 1VQDA 3MXNB 3HOUG 3RR5A 4Y52H 1U5KA 2WP8J 1IBKQ 2B63G 1VQGA 4NXMQ 1WOCA 3RLOA 4A3FG 3KDFB 4AQYL 4QIWE 1YEZA 1BVSA 1B8AA 1LM0A 4AYBE 4ME3A 2ALYB 3CPWA 1FJGL 1QVFA 2UXBQ 4JI5L 1H95A 3K80C 1TXYA 1VQBA 2JA5G 1S72A 1UWVA 4GLAC 4DV5L 1Q8KA 2QA4A 3TS2A 3I4MH 2VW9A 3CQZH 2XTIA 2IT1A 4DR4Q 3K8AA 4J15A 1E7ZA 5GAHC 3W1BA 1UEBA 1KC8C 4IPCA 1HZ9A 5FJ8G 1QZHA 1IBML 4BXXG 5GAEC 4H02A 5BR8L 1ASZA 1EQQA 1J6QA 4LF7Q 3NENA 4GKJL 3ZJYC 1NE3A 5GAGC 1L0WA 1V1QA 3GTPH 1XNRL 5IE8A 4A3KH 4LFBL 1XMQQ 5FLMH 1IYJB 1Y14B 2RHSB 4DR2L 2JK8A 3M85A 2JJQA 2LXJA 4C3JH 3T1YL 2JA7G 1JB7A 2ZTCA 2VQFL 1N36L 2E2JH 1NY4A 2XGTA 1D7QA 2VS1A 1G291 2EQSA 2ZTEA 3I4NG 1SFOH 1EQRA 3KDFA 2LXKA 3GDEA 1N34L 4A3EG 2I0QA 3STBD 4OX9Q 4A3BG 2YTXA 5JEAG 1EFWA 1PH3A 1S40A 3W1GA 5LMUL 1TWHH 3GD7A 1TWAH 1YVCA 2AKWB 3RZOH 2Y0SE 5IYCH 5C44H 4A93H 1KRTA 2E8GA 4O2DA 4TQUS 5IT9c 1W2BA 1PH1A 2KCMA 2VUMG 4LFCQ 4A75A 3GO5A 1N33Q 4HJ8A 1HZCA 2D0OA 2JEBI 1X54A 2PQAB 5HGQA 3FKIG 3H3VH 4YY3L 3PSIA 2PI2E 1NJIC 1BBUA 1TWGH 1XPUA 4IFDJ 1YI2A 4IO9A 2WB1G 3U50C 4AYBG 4X62Q 3CAMA 3S14H 4JI0L 1G6PA 4DKAC 3PIOA 1QVCA 1VQHA 1VQ7A 1FGUA 4LF9Q 3PO3H 2Z0SA 3J81c 4C2MH 1C0AA 3LGJA 1HNXQ 1OXTA 5LMNQ 2PI2A 3NELA 4DV4L 2IHEA 4BA2I 1C7YA 1J5EL 2F52A 4PZ7A 2UU9L 1X56A 2OWOA 4LF8L 2NVQH 4Y7NH 2OTLA 2I5MX 2PMZE 4A3IH 2YYZA 4P75A 5FLXc 2NVXH 4A3GG 4QJFA 3AFPA 5IP7G 2UXCQ 2R93H 1YITA 4JI2L 3HOXG 1X9NA 4DV7L 3E9HA 2HIXA 4A3MH 1NTGA 2B29A 3PF5A 1K3RA 3HOWH 1A0IA 4B3SQ 2OCEA 4LFAL 3HOUH 1G51A 2PQAA 4JG2A 2ZM6L 2B63H 1L1OC 1KD1C 4DUZL 2NVTH 3I7FA 1K83H 4ALPA 4LWCA 3CCVA 1CKNB 3PUXA 3CP0A 4LF5L 4JBKA 4X6AH 4JI8L 3J81j 4XTCS 1OTCA 3KLWA 2K52A 4HJ9A 1Y1VG 2H5XA 3CW2C 3F2CA 2R6GA 3ULPA 4JBMA 1QVGA 2JA9A 1E22A 2Y0SG 4X65Q 4GN4B 1P16A 2MFIA 2VQEL 4A3JH 1K73C 4GLXA 1VS0A 1XNQL 2UUAQ 5ELNA 2ZJQA 1OXVA 3Q8DA 3CCQA 2LSSA 4JI4Q 4JYAQ 4OONA 3GTGH 1L2FA 2UUCL 4OWXB 4BBSG 4L5TA 1X65A 5J3BA 4QL5A 1JE5A 4X66Q 2AWNA 4YCWA 3STBC 3UE0A 4IOCA 3H0GH 4IPGA 4GOPC 5C0XI 1YJWA 4AQYQ 4AH6A 1YHBA 3S2HH 2JA7H 3EBEA 5EAYA 1PA6A 4JI7Q 3CCSA 3M4QA 4R4TA 4JI5Q 3JC66 1VQKA 3CCJA 3HOYG 3HKZG 3I4NH 1X3GA 2JA8H 1WI5A 3S1NH 3CCUA 1Q1EA 1X3EA 5C4XH 3HFZB 2CWAA 3K7AH 4JI1L 3PO2H 1CKNA 3F2BA 2E5LL 3G6EA 2GN5A 3TS0A 1IBMQ 3S17H 2KENA 5BR8Q 3HOZH 2WAQE 4OO1I 4QY7A 1W3SA 1Q82C 4GKJQ 4YWMA 2WB1E 4BY1H 2BH8A 2DGYA 1Q86C 1L1OB 1XNRQ 3KYHC 4LFBQ 1A62A 1EIFA 2N78A 4DV2Q 4HIKA 2VL6A 2UUBQ 1IZ6A 3RNUA 3KF6B 2HT1A 4K0KQ 3FKIH 2VQFQ 3CCRA 4DV0Q 1N36Q 4JV5Q 4GN3B 4LW1A 2Q2UA 4RG1A 1BBWA 2RHQB 1HR0L 5IP9G 1FVIA 4B3RL 2CWPA 4DV6L 4B3MQ 2C35B 2B3GA 2R7FA 4HIDA 4YCUA 4C3IH 1PH4A 1N34Q 5JJKA 3A5ZB 3TRZA 1VQEA 4GKKL 4TVAB 1VQIA 4JI3L 2I5HA 1XMOL 1KIXA 5LMUQ 1N8RC 3K7UC 3JAMi 2YTVA 5GQOA 3I56A 1VCIA 1SLJA 3CD6A 1XPOA 4A3DH 1KXLA 1VQ9A 1KRSA 3F1ZA 4GOPB 3ULJA 4B3TL 4P71A 2VY3A 1V9PA 1I6HH 3UE1A 4DR1L 4BBRG 5E7NA 4JI6L 5K36G 4YY3Q 1KAWA 4WJ3M 2A8VA 5IYBH 3VDYA 4MZ9A 1JJGA 3UDIA 3L0OA 4R4OA 3GTOH 5M3FG 2YTYA 5GADC 2N3SA 1N32L 1L1OA 3S2DH 1SMXA 4JI0Q 3KFUA 2A1AA 1B70B 1VQMA 2ZTDA 1IBLQ 1XTDA 3KF6A 1I94Q 5ELOA 1LUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PG3 A;  1Q1B A;  3B6Y A;  2OQ0 A;  5GRO A;  1HNZ L;  1TWC H;  2EXD A;  2F3I A;  5IWA Q;  3S15 H;  4IFD G;  1KQS A;  1HR0 W;  3GTJ H;  4DV4 Q;  2MQH A;  5C0X J;  1M90 C;  2R7Z H;  1RL2 A;  3AQQ A;  3D31 A;  3CXC A;  1MIU A;  2E2H H;  3PF4 A;  2UU9 Q;  3EIV A;  4LF8 Q;  1PH7 A;  1Y1V H;  2WAQ G;  3G71 A;  3H3V I;  1SRU A;  4YHH L;  5C3E G;  2OQK A;  4P74 A;  3S1Q H;  3DLL A;  1NMF A;  1VQL A;  2JA6 G;  2CQO A;  1WFQ A;  4OO1 G;  5AJ3 L;  1K0R A;  2K5H A;  3I2Z A;  2N8N A;  3TEH B;  4DV7 Q;  4GOP A;  4UY8 C;  1IL2 A;  4BBS H;  4GLV B;  3HKZ E;  3F8T A;  1O7I A;  2K75 A;  5DLQ E;  4IPD A;  4LFA Q;  3OW2 A;  3GTK H;  4HIM A;  2UXD L;  2Q2I A;  1XPR A;  1PHJ A;  4A3C H;  1AE3 A;  2ZM6 Q;  2IY5 B;  4DUZ Q;  1AH9 A;  1SN8 A;  2D0P A;  4XIG S;  4DR5 L;  3PUW A;  1YJN A;  1I50 H;  3AYH B;  5M5W H;  5M3M H;  1YBY A;  4LF5 Q;  4OX9 L;  4JI8 Q;  2PNH A;  3CF5 A;  3HOV H;  1KL9 A;  4MTN A;  1PH5 A;  5C4J H;  1Y1W G;  2VQE Q;  2NZH A;  4MNO A;  3U4Z A;  1CSQ A;  1XNQ Q;  3I4O A;  4EQ5 A;  4FDB A;  4LF6 L;  1VQA A;  5FLM G;  1M1K C;  4HJ5 A;  1TWF H;  4A3F H;  2UUC Q;  4L5Q A;  3A74 A;  1WJJ A;  3CMA A;  4LUV A;  4X64 Q;  2HIV A;  4KHP L;  1CSP A;  2KHI A;  3UDG A;  1K9M C;  4UP9 A;  1D8L A;  1VQF A;  1X6O A;  4JC0 A;  1PV4 A;  1ASY A;  4DV3 L;  4X62 L;  4P73 A;  4RMF A;  4IPH A;  2JA5 H;  2YU9 H;  1FL0 A;  2F4V Q;  4BY7 G;  5HY6 A;  1I3Q H;  5IY0 A;  2ID0 A;  3K0X A;  3WWV A;  4LF9 L;  3A0J A;  2NN6 I;  5FJ8 H;  4BXX H;  1OXX K;  4P72 A;  3OTO Q;  1K8G A;  3PUZ A;  4DV1 L;  3U58 A;  5LMN L;  4DR7 L;  5IYC G;  1VQO A;  2E5L Q;  3HKS A;  1CUK A;  1PH8 A;  4UP8 A;  3KF8 B;  1EYG A;  2L15 A;  4APV A;  4JBW A;  1WCM G;  4UP7 A;  3KJO A;  3J80 i;  2KBN A;  4KHZ A;  2D62 A;  1FJG Q;  4LUO A;  1HZB A;  2BA1 A;  4DK6 C;  1JMC A;  1HNW L;  1PFS A;  2K5V A;  1CKM A;  4UPA A;  1YHA A;  1Z9F A;  4BBR H;  4DV5 Q;  1VQP A;  3PV0 A;  2ZJP A;  2HHH L;  2KCT A;  4B3S L;  1Z47 A;  3NBH B;  4YWL A;  4A3E H;  3PUV A;  4A3B H;  3PO3 G;  2K5N A;  4DR6 L;  2GVB A;  3E9I A;  4WJ4 A;  4B3R Q;  1EUJ A;  2DUD A;  2YV5 A;  4NPS A;  4NXN L;  3ULL A;  3CCE A;  4R4C A;  4DV6 Q;  4PZ8 A;  1MJE A;  4POF A;  2MNA A;  1NMG A;  1JT8 A;  1C9O A;  4JOI A;  4C3H H;  4DPG A;  3L2P A;  1K8A C;  4AIM A;  4A3I G;  1XMO Q;  3CPF A;  2VUM H;  1EWI A;  4DUY L;  1YIJ A;  3GTL H;  4DR2 Q;  2I5L X;  1YNX A;  2Q2H A;  4A3L G;  1VQJ A;  3T1Y Q;  3ERS X;  4KI0 A;  5LMN W;  2R93 G;  1GM5 A;  3CCM A;  3F2D A;  4B3T Q;  4L5R C;  4JYA L;  4A3M G;  3PCO B;  2RF4 A;  1YZ6 A;  1SE8 A;  3RLF A;  4DR1 Q;  4JI6 Q;  3HOW G;  1UE5 A;  1HJP A;  4DR3 L;  3BJU A;  2JA6 H;  1Q12 A;  2VNU D;  1N32 Q;  1A63 A;  4POG A;  4JI7 L;  2NZO A;  4LUZ A;  3T1H L;  2R92 G;  2VZA A;  3M4O H;  2GVA A;  1VQ8 A;  1B7Y B;  1WYD A;  1HNZ Q;  4IOA A;  4IJH A;  4A3J G;  4LF4 L;  2AMC B;  3TRE A;  1PH2 A;  2NN6 G;  4A3G H;  1T9H A;  5JJI A;  3AFQ A;  4OWT B;  2QGQ A;  5IP7 H;  3PUY A;  3RN2 A;  3I55 A;  1OXU A;  1IBK L;  3HOX H;  2EIF A;  4NXM L;  4IJL A;  4YHH Q;  1JJC B;  1Y1W H;  2CCZ A;  2Z6K C;  5IYD G;  3J7A 5;  5H1S E;  1PYB A;  3ICE A;  1VQN A;  1CKO A;  1LTL A;  5C0X G;  2UXB L;  3H0G G;  3DM3 A;  3A5U A;  5AJ3 Q;  5M5Y H;  1R9T H;  3UDX A;  2ATW A;  4GN5 A;  4DV2 L;  2UUB L;  2UXD Q;  1E3P A;  4GS3 A;  2Q2T A;  4JV5 L;  4DV0 L;  4JOI C;  4DR4 L;  4K0K L;  3CC4 A;  4BA1 I;  1J5E Q;  2QEX A;  2CKZ B;  2JA8 G;  1MJC A;  3CC7 A;  4B3M L;  4DR5 Q;  1UE1 A;  4BY7 H;  4GNX B;  5C4X G;  4LF7 L;  1UE6 A;  3PO2 G;  4L5S A;  2AWO A;  1DGS A;  3J80 c;  2MO1 A;  1XMQ L;  3HOZ G;  4JCV E;  3IRB A;  1YHQ A;  4BY1 G;  3M9B A;  1RIP A;  5JEA J;  3RN5 A;  1PH9 A;  4LF6 Q;  2BH2 A;  3UDF A;  3OYY A;  1N9W A;  2N49 A;  3CC2 A;  1YJ9 A;  1Q46 A;  1WCM H;  1VQ6 A;  3S1R H;  3I4M G;  2JEA I;  1VQ5 A;  4KHP Q;  2K50 A;  1XJV A;  3S16 H;  3GTM H;  3J7Z C;  3D0F A;  4KLK A;  1PH6 A;  1UE7 A;  4DV3 Q;  4HJ7 A;  4LNQ A;  4DK3 C;  3AEV A;  3HOY H;  2IX0 A;  1GD7 A;  1Q7Y C;  1IBL L;  2IHF A;  3EN2 A;  4A4I A;  1I94 L;  2OTJ A;  3K81 C;  4O0A A;  4A3K G;  1E1O A;  1A8V A;  4JBJ A;  4LFC L;  5IWA L;  4DV1 Q;  3GTQ H;  1X55 A;  1N33 L;  2FXQ A;  1Q81 C;  4DR7 Q;  2V1C C;  1GO3 E;  4A3D G;  1QUQ B;  4GNX A;  3NEM A;  4DAM A;  2RCN A;  4JI2 Q;  2ZJR A;  2JE6 I;  3W5O A;  4A3L H;  2WFW A;  3ER0 A;  1AE2 A;  1GKH A;  1V43 A;  3PIP A;  5IYB G;  1HNW Q;  1E24 A;  3JAM c;  2HQL A;  1JJ2 A;  2E2I H;  5IP9 H;  2ES2 A;  3M3Y H;  1PVO A;  3S1M H;  3BZK A;  1HNX L;  2HHH Q;  3G4S A;  2IX1 A;  2MO0 A;  1GVP A;  4A93 G;  2NVY H;  4PMW A;  5C44 G;  3M7N A;  1EOV A;  2BA0 A;  4JI1 Q;  3SGI A;  4NB3 A;  2R7D A;  3E0E A;  4DR6 Q;  4YCV A;  4PZ6 A;  3FP9 A;  4NXN Q;  1OXS C;  3KJP A;  3RLN A;  3U4V A;  4HJA A;  1EIY B;  2R7Z G;  1KHI A;  3L7Z C;  5M5X H;  3RZD H;  3TQY A;  4OXP A;  1QZG A;  2R92 H;  2UXC L;  1U0L A;  1HH2 P;  4A76 A;  1P8L A;  5JJL A;  4DNI A;  1LYL A;  2AHO B;  2ASB A;  3G48 A;  1X3F A;  3S24 A;  4EX5 A;  4DUY Q;  1VQ4 A;  2Z6K A;  4R4Q A;  1NBW A;  3FHW A;  3MEF A;  1E1T A;  1QUQ A;  4HIO A;  2A19 A;  5M3F H;  1I5F A;  2K14 A;  1HR0 Q;  1SRO A;  3CCL A;  2CFM A;  1S3O A;  1BKB A;  5IYD H;  4X64 L;  4R1J A;  1IXR A;  1PYS B;  4R4I A;  1VQC A;  3M4P A;  4DR3 Q;  4A3C G;  2K4K A;  4GKK Q;  4JI3 Q;  4OWW B;  2F4V L;  3BU2 A;  3H15 A;  1SR3 A;  3PGZ A;  4X65 L;  3KOJ A;  4YWK A;  5M3M G;  3T1H Q;  2UUA L;  3J81 i;  4GNX C;  4IFD I;  3CME A;  3HOV G;  4JI4 L;  3OTO L;  1HZA A;  4LF4 Q;  4QQB X;  4DAY B;  5C3E H;  2JQO A;  3BZC A;  2KHJ A;  4X66 L;  4QGU A;  1MKH A;  1VQD A;  3MXN B;  3HOU G;  3RR5 A;  4Y52 H;  1U5K A;  2WP8 J;  1IBK Q;  2B63 G;  1VQG A;  4NXM Q;  1WOC A;  3RLO A;  4A3F G;  3KDF B;  4AQY L;  4QIW E;  1YEZ A;  1BVS A;  1B8A A;  1LM0 A;  4AYB E;  4ME3 A;  2ALY B;  3CPW A;  1FJG L;  1QVF A;  2UXB Q;  4JI5 L;  1H95 A;  3K80 C;  1TXY A;  1VQB A;  2JA5 G;  1S72 A;  1UWV A;  4GLA C;  4DV5 L;  1Q8K A;  2QA4 A;  3TS2 A;  3I4M H;  2VW9 A;  3CQZ H;  2XTI A;  2IT1 A;  4DR4 Q;  3K8A A;  4J15 A;  1E7Z A;  5GAH C;  3W1B A;  1UEB A;  1KC8 C;  4IPC A;  1HZ9 A;  5FJ8 G;  1QZH A;  1IBM L;  4BXX G;  5GAE C;  4H02 A;  5BR8 L;  1ASZ A;  1EQQ A;  1J6Q A;  4LF7 Q;  3NEN A;  4GKJ L;  3ZJY C;  1NE3 A;  5GAG C;  1L0W A;  1V1Q A;  3GTP H;  1XNR L;  5IE8 A;  4A3K H;  4LFB L;  1XMQ Q;  5FLM H;  1IYJ B;  1Y14 B;  2RHS B;  4DR2 L;  2JK8 A;  3M85 A;  2JJQ A;  2LXJ A;  4C3J H;  3T1Y L;  2JA7 G;  1JB7 A;  2ZTC A;  2VQF L;  1N36 L;  2E2J H;  1NY4 A;  2XGT A;  1D7Q A;  2VS1 A;  1G29 1;  2EQS A;  2ZTE A;  3I4N G;  1SFO H;  1EQR A;  3KDF A;  2LXK A;  3GDE A;  1N34 L;  4A3E G;  2I0Q A;  3STB D;  4OX9 Q;  4A3B G;  2YTX A;  5JEA G;  1EFW A;  1PH3 A;  1S40 A;  3W1G A;  5LMU L;  1TWH H;  3GD7 A;  1TWA H;  1YVC A;  2AKW B;  3RZO H;  2Y0S E;  5IYC H;  5C44 H;  4A93 H;  1KRT A;  2E8G A;  4O2D A;  4TQU S;  5IT9 c;  1W2B A;  1PH1 A;  2KCM A;  2VUM G;  4LFC Q;  4A75 A;  3GO5 A;  1N33 Q;  4HJ8 A;  1HZC A;  2D0O A;  2JEB I;  1X54 A;  2PQA B;  5HGQ A;  3FKI G;  3H3V H;  4YY3 L;  3PSI A;  2PI2 E;  1NJI C;  1BBU A;  1TWG H;  1XPU A;  4IFD J;  1YI2 A;  4IO9 A;  2WB1 G;  3U50 C;  4AYB G;  4X62 Q;  3CAM A;  3S14 H;  4JI0 L;  1G6P A;  4DKA C;  3PIO A;  1QVC A;  1VQH A;  1VQ7 A;  1FGU A;  4LF9 Q;  3PO3 H;  2Z0S A;  3J81 c;  4C2M H;  1C0A A;  3LGJ A;  1HNX Q;  1OXT A;  5LMN Q;  2PI2 A;  3NEL A;  4DV4 L;  2IHE A;  4BA2 I;  1C7Y A;  1J5E L;  2F52 A;  4PZ7 A;  2UU9 L;  1X56 A;  2OWO A;  4LF8 L;  2NVQ H;  4Y7N H;  2OTL A;  2I5M X;  2PMZ E;  4A3I H;  2YYZ A;  4P75 A;  5FLX c;  2NVX H;  4A3G G;  4QJF A;  3AFP A;  5IP7 G;  2UXC Q;  2R93 H;  1YIT A;  4JI2 L;  3HOX G;  1X9N A;  4DV7 L;  3E9H A;  2HIX A;  4A3M H;  1NTG A;  2B29 A;  3PF5 A;  1K3R A;  3HOW H;  1A0I A;  4B3S Q;  2OCE A;  4LFA L;  3HOU H;  1G51 A;  2PQA A;  4JG2 A;  2ZM6 L;  2B63 H;  1L1O C;  1KD1 C;  4DUZ L;  2NVT H;  3I7F A;  1K83 H;  4ALP A;  4LWC A;  3CCV A;  1CKN B;  3PUX A;  3CP0 A;  4LF5 L;  4JBK A;  4X6A H;  4JI8 L;  3J81 j;  4XTC S;  1OTC A;  3KLW A;  2K52 A;  4HJ9 A;  1Y1V G;  2H5X A;  3CW2 C;  3F2C A;  2R6G A;  3ULP A;  4JBM A;  1QVG A;  2JA9 A;  1E22 A;  2Y0S G;  4X65 Q;  4GN4 B;  1P16 A;  2MFI A;  2VQE L;  4A3J H;  1K73 C;  4GLX A;  1VS0 A;  1XNQ L;  2UUA Q;  5ELN A;  2ZJQ A;  1OXV A;  3Q8D A;  3CCQ A;  2LSS A;  4JI4 Q;  4JYA Q;  4OON A;  3GTG H;  1L2F A;  2UUC L;  4OWX B;  4BBS G;  4L5T A;  1X65 A;  5J3B A;  4QL5 A;  1JE5 A;  4X66 Q;  2AWN A;  4YCW A;  3STB C;  3UE0 A;  4IOC A;  3H0G H;  4IPG A;  4GOP C;  5C0X I;  1YJW A;  4AQY Q;  4AH6 A;  1YHB A;  3S2H H;  2JA7 H;  3EBE A;  5EAY A;  1PA6 A;  4JI7 Q;  3CCS A;  3M4Q A;  4R4T A;  4JI5 Q;  3JC6 6;  1VQK A;  3CCJ A;  3HOY G;  3HKZ G;  3I4N H;  1X3G A;  2JA8 H;  1WI5 A;  3S1N H;  3CCU A;  1Q1E A;  1X3E A;  5C4X H;  3HFZ B;  2CWA A;  3K7A H;  4JI1 L;  3PO2 H;  1CKN A;  3F2B A;  2E5L L;  3G6E A;  2GN5 A;  3TS0 A;  1IBM Q;  3S17 H;  2KEN A;  5BR8 Q;  3HOZ H;  2WAQ E;  4OO1 I;  4QY7 A;  1W3S A;  1Q82 C;  4GKJ Q;  4YWM A;  2WB1 E;  4BY1 H;  2BH8 A;  2DGY A;  1Q86 C;  1L1O B;  1XNR Q;  3KYH C;  4LFB Q;  1A62 A;  1EIF A;  2N78 A;  4DV2 Q;  4HIK A;  2VL6 A;  2UUB Q;  1IZ6 A;  3RNU A;  3KF6 B;  2HT1 A;  4K0K Q;  3FKI H;  2VQF Q;  3CCR A;  4DV0 Q;  1N36 Q;  4JV5 Q;  4GN3 B;  4LW1 A;  2Q2U A;  4RG1 A;  1BBW A;  2RHQ B;  1HR0 L;  5IP9 G;  1FVI A;  4B3R L;  2CWP A;  4DV6 L;  4B3M Q;  2C35 B;  2B3G A;  2R7F A;  4HID A;  4YCU A;  4C3I H;  1PH4 A;  1N34 Q;  5JJK A;  3A5Z B;  3TRZ A;  1VQE A;  4GKK L;  4TVA B;  1VQI A;  4JI3 L;  2I5H A;  1XMO L;  1KIX A;  5LMU Q;  1N8R C;  3K7U C;  3JAM i;  2YTV A;  5GQO A;  3I56 A;  1VCI A;  1SLJ A;  3CD6 A;  1XPO A;  4A3D H;  1KXL A;  1VQ9 A;  1KRS A;  3F1Z A;  4GOP B;  3ULJ A;  4B3T L;  4P71 A;  2VY3 A;  1V9P A;  1I6H H;  3UE1 A;  4DR1 L;  4BBR G;  5E7N A;  4JI6 L;  5K36 G;  4YY3 Q;  1KAW A;  4WJ3 M;  2A8V A;  5IYB H;  3VDY A;  4MZ9 A;  1JJG A;  3UDI A;  3L0O A;  4R4O A;  3GTO H;  5M3F G;  2YTY A;  5GAD C;  2N3S A;  1N32 L;  1L1O A;  3S2D H;  1SMX A;  4JI0 Q;  3KFU A;  2A1A A;  1B70 B;  1VQM A;  2ZTD A;  1IBL Q;  1XTD A;  3KF6 A;  1I94 Q;  5ELO A;  1LUZ A; 
#chains in the Genus database with same CATH topology
 2OQ0 A;  1H9K A;  2F3I A;  1HR0 W;  1RHP A;  1YNJ C;  3D31 A;  2PMZ B;  3PF4 A;  4ZKB B;  2IX3 A;  2F4I A;  5T1G A;  4MN3 A;  4P74 A;  2XSC A;  1SDF A;  3Q6S A;  2F3W A;  2MGS A;  3I2Z A;  4GOP A;  1EY8 A;  3F8T A;  1O7I A;  1SJH D;  4XXE A;  2XIW A;  3OW2 A;  3GTK H;  3PMF A;  2PNR C;  1XPR A;  2E2I B;  1PTO C;  2C5C A;  1S5F D;  2RA4 A;  4JI8 Q;  2OF1 A;  2PNH A;  3HOV H;  1KL9 A;  3RZD B;  2VQE Q;  5DM7 3;  1DJR D;  1VQA A;  1SNQ A;  4UDU C;  1V1P B;  1TWF H;  4BBR B;  2UUC Q;  1VF5 C;  4X64 Q;  2KHI A;  3R93 A;  5I9O A;  1D8L A;  1VQF A;  1X6O A;  4X62 L;  4P73 A;  4DNT B;  1GUT A;  1I3Q H;  3Q0A A;  1G6Z A;  1AP0 A;  2NN6 I;  5FJ8 H;  3GTL B;  3U58 A;  4DV1 L;  2TMP A;  5IYC G;  2DNE A;  1STB A;  4NP5 A;  2MUY A;  1CT1 D;  3MEH A;  3KF8 B;  2B2Y A;  1D1K A;  2JA6 B;  1B9N A;  4G7Z C;  2CQA A;  2HCC A;  2KBN A;  3C1F A;  1TS2 A;  1HNW L;  2BA1 A;  1JMC A;  1PFS A;  1CKM A;  1PTO B;  2SOB A;  3HZX A;  3RD4 A;  1SYD A;  3TP5 A;  3UI2 A;  4DV5 Q;  1VQP A;  2NTS A;  3NBH B;  4A3E H;  2F0P A;  3PO3 G;  2K5N A;  1BDO A;  1II3 A;  4B3R Q;  1NSN S;  3CQZ B;  3PQI A;  4NPS A;  4B9W A;  3CCE A;  4DV6 Q;  1Q3L A;  3LX0 A;  4H7B A;  3QIA A;  5EBC A;  1DZ1 A;  3D4D A;  3L2P A;  1Y1W B;  1K8A C;  1CTM A;  4K5W A;  1EWI A;  1LT3 D;  4IUV A;  3K59 A;  4DUY L;  1YIJ A;  2Q2H A;  3G6J B;  4KHV A;  4V0B A;  1S4Z A;  3T1Y Q;  2F0M A;  2PO4 A;  5LMN W;  2R93 G;  4B3T Q;  4JYA L;  3R2T A;  5EBD A;  3T56 B;  4C3J B;  1B1Z A;  1Y8P B;  1SE8 A;  1Q12 A;  1SND A;  3WOF A;  1N32 Q;  4J6H A;  4POG A;  4JI7 L;  1NNX A;  2A68 D;  2VZA A;  1IW7 C;  1Q8I A;  5CBE E;  1HNZ Q;  1TWA B;  1H9S A;  4A3J G;  1GUO A;  3TRE A;  5EKK A;  2G9H D;  2K5D A;  3AFQ A;  3N52 A;  3OW7 A;  3ICE A;  4WOR A;  4HSV A;  4FYD A;  3A5U A;  5M5Y H;  1EU3 A;  3LWU A;  1AZQ A;  2OXP A;  4XQN A;  2Q2T A;  4K0K L;  4DV0 L;  1J5E Q;  1LTA D;  1STY A;  3A54 A;  1UE1 A;  4BY7 H;  3TZU A;  1PDQ A;  4GNX B;  4LF7 L;  3PO2 G;  1T5E A;  2RBM A;  1VDZ A;  1DGS A;  1MSG A;  3MC0 B;  3PIP 3;  1LT6 D;  3AB9 A;  3D4R A;  3M9B A;  1RIP A;  5JEA J;  1PH9 A;  4A3M B;  2BH2 A;  3CC2 A;  1LTR D;  1YJ9 A;  1K8O A;  1WCM H;  1VQ6 A;  3I4M G;  2JEA I;  5J1Z A;  2K50 A;  3S16 H;  3J7Z C;  1J9O A;  5C5M A;  1UE7 A;  4HJ7 A;  3AEV A;  3HOY H;  4HMJ A;  5HGT A;  3EN2 A;  2QW7 A;  1I94 L;  4DK1 A;  3NUC A;  1A8V A;  1F9P A;  4O1N A;  2V1C C;  1GO3 E;  2I07 B;  3GTG B;  2PW5 A;  4DAM A;  1I4Q A;  2HDL A;  1BCP D;  3W5O A;  1CA5 A;  3J7A F;  2XNA C;  1HXY D;  1XWE A;  2Z4H A;  3S2H B;  2F0K A;  4E6I A;  3M3Y H;  5IP9 H;  3S1M H;  3BZK A;  1HNX L;  2HHH Q;  3G4S A;  1GVP A;  3M7N A;  4PMW A;  1EOV A;  4PZ6 A;  3U4V A;  5C4X B;  3K7A B;  2R7Z G;  5M5X H;  1RKN A;  3T4A C;  1QZG A;  2UXC L;  5JJL A;  2WIN B;  5KRU A;  4K2K A;  1F9Q A;  1X3F A;  3VA7 A;  4BY1 B;  4RCN A;  2Z6K A;  3DWQ A;  4CKB A;  3FHW A;  4I7Z C;  4XYO A;  2A19 A;  2WII B;  4X64 L;  4R1J A;  2EYH A;  4DN4 M;  5TSS A;  2K4K A;  4JI3 Q;  3EJI A;  1LT4 D;  4OWW B;  1GXD C;  3H15 A;  1PZI D;  1SR3 A;  1K28 A;  3KOJ A;  3QO2 A;  4I7A A;  1LV9 A;  2J7Z A;  3CME A;  4DAP A;  2X69 A;  3U9O A;  2RKS A;  2HDM A;  1XYI A;  1VQD A;  1WTO A;  3GP7 A;  2ICE C;  3RR5 A;  2K5Q A;  3QOJ A;  4A3F G;  4MIU A;  2E2D C;  4QIW E;  4ME3 A;  2ALY B;  4JI5 L;  2BDN A;  4BS9 A;  2EYM A;  3TS2 A;  1IYU A;  1Q8K A;  2Z6B A;  5C44 B;  3SK6 A;  3VR4 A;  4DV5 L;  4DR4 Q;  3K8A A;  3W1B A;  1DM0 B;  2PYK A;  4BXX G;  4IPC A;  1QZH A;  4DAV A;  1DON A;  1QNK A;  1STH A;  1ONL A;  2B2W A;  3ZJY C;  3K5M A;  5GAG C;  4XDX A;  1HA6 A;  1KAA A;  5IE8 A;  1IYJ B;  3M85 A;  2JJQ A;  3T1Y L;  4LK1 C;  4S3S A;  4R8N A;  5KYL A;  2XGT A;  1K8M A;  1GJX A;  2FJ2 A;  2B2V C;  2Z1C A;  2CW0 D;  1EFW A;  1BBX C;  1CZW A;  5LMU L;  1TWH H;  3I4L A;  1YVC A;  4A93 H;  1PZJ D;  3HOV B;  4C3H G;  2A6H C;  5IT9 c;  1PH1 A;  2KCM A;  1ZKO A;  4LFC Q;  2B8G A;  3HOU B;  1X54 A;  3FKI G;  2B63 B;  2PI2 E;  1TWF B;  5L37 A;  4TSS A;  1BR9 A;  4HR7 B;  1BBU A;  3GQB A;  2F0D A;  2V4D A;  1D5X C;  2IJ0 A;  3RUZ A;  1HUM A;  3PIO A;  3VR2 A;  1VQH A;  1VQ7 A;  3J81 c;  5D14 A;  4C2M H;  1I3Q B;  1GOZ A;  1JOR A;  4FF3 A;  2PI2 A;  1JE4 A;  3MWY W;  3QWN A;  3NP8 A;  1J5E L;  2J0T D;  2OWO A;  2OTL A;  4A3I H;  2WKC A;  1STG A;  2NVX H;  4A3G G;  4FXK C;  3C1E A;  3D8G A;  4WRD A;  1YNN D;  3HOX G;  3ONA B;  1X9N A;  3E9H A;  1ZYR C;  1NTG A;  2B29 A;  1RJT A;  3HOW H;  4B3S Q;  4LFA L;  1PFB A;  4JG2 A;  3I4N B;  1L1O C;  1CA6 A;  1FR3 A;  4DUZ L;  2NVT H;  1K83 H;  1EY4 A;  4ALP A;  2KA7 A;  4A3E B;  2F0V A;  4J1M A;  4X6A H;  4JBK A;  1OTC A;  2K52 A;  4RWS C;  1V1O A;  3DM1 A;  2Y0S G;  2MFI A;  1XNQ L;  1VS0 A;  3G7L A;  1DD2 A;  3K57 A;  5K5P A;  1G2T A;  2KJX A;  1JR0 D;  1VMC A;  4X66 Q;  1JE5 A;  4ABN A;  4CGY B;  2J4X A;  3STB C;  4YCW A;  4IOC A;  4GOP C;  3H0G H;  4IPG A;  1YJW A;  4AQY Q;  1YHB A;  5EAY A;  2EPB A;  3JC6 6;  3HKZ G;  1WI5 A;  1Q1E A;  2WAC A;  4IUP A;  5C3X A;  2F3V A;  2KEN A;  3F2U A;  4OGQ C;  1HRJ A;  4ILW A;  3K6O A;  1JC7 A;  1F9R A;  3KBG A;  4QY7 A;  4YWM A;  2WB1 E;  4GKJ Q;  3HEJ A;  1L1O B;  3KYH C;  3S2D B;  1EIF A;  2KEE A;  1B3A A;  2VQF Q;  1N36 Q;  2LMC B;  1BBW A;  2RHQ B;  1EU4 A;  4B3M Q;  2TSS A;  3BYY B;  1Y1V B;  1VQE A;  4JI3 L;  4ZQ3 A;  1XMO L;  2L1B A;  2QF7 A;  2WV6 D;  4A3D H;  1KXL A;  1VQ9 A;  4GOP B;  4P2C B;  1LTS D;  1RTO A;  3ULJ A;  2VY3 A;  2B2Y C;  1CQF A;  4BBR G;  5K36 G;  3JAM L;  1KAW A;  4WJ3 M;  2A8V A;  3FMC A;  1JJG A;  4R4O A;  2YTY A;  5G3L F;  2EDG A;  1A2T A;  1QIL A;  2D9U A;  3KFU A;  1VQM A;  3OOC A;  4L6T B;  1IBL Q;  3HOY B;  5ELO A;  1LUZ A;  4PG3 A;  5GRO A;  1SFO H;  4IFD G;  3GTJ H;  3AU7 A;  1M90 C;  3KLS A;  5C0X J;  1RL2 A;  1D5Z C;  3QG1 A;  4G57 A;  1PH7 A;  4YHH L;  3C46 A;  1TY0 A;  3S1Q H;  1DOK A;  2JA6 G;  1S5D D;  1WFQ A;  4OO1 G;  4X3K A;  5AJ3 L;  1K0R A;  2K5H A;  1A3T A;  3OWE B;  1IL2 A;  4BBS H;  5DLQ E;  2K75 A;  1B9M A;  1MSH A;  2Q2I A;  4A3C H;  3M3Y B;  2ZM6 Q;  3S1M B;  4C56 C;  4N8F A;  2DN8 A;  1SN8 A;  1YJN A;  1B3Q A;  1U4M A;  4LF5 Q;  1SMY C;  4MTN A;  1PH5 A;  5C4J H;  2F0J A;  4H0L C;  1Y1W G;  4IUQ A;  5KIX A;  1CSQ A;  1SXT A;  2CVR A;  2KQ3 A;  3D6C A;  4LF6 L;  4C3J G;  1A3V A;  3NQI A;  2HIV A;  1F2L A;  4KHP L;  1ZXT A;  3UDG A;  1HHV A;  2PQE A;  3Q24 A;  4IAL A;  4G7O C;  4DV3 L;  4RMF A;  2JA5 H;  2BE5 C;  1KDB A;  3OHX C;  1UEA B;  5IY0 A;  1D2B A;  2ID0 A;  5KNB A;  3A0J A;  2SDF A;  4DR7 L;  4WFN 3;  1VQO A;  5JPN C;  4JBW A;  4UP7 A;  1R4P B;  5JPM C;  1LAB A;  1HZB A;  5COY A;  3NE5 B;  2FMC A;  4UPA A;  3MHB A;  1Z9F A;  4B3S L;  3PV0 A;  1SNP A;  2RDG A;  4YWL A;  1SYE A;  1AW7 A;  5JOB A;  1H9S B;  5ISR A;  4DR6 L;  2GVB A;  1EUJ A;  2YV5 A;  2F0N A;  5KGU A;  4PZ8 A;  4CJ0 B;  1NMG A;  1JT8 A;  5CGK A;  1BQQ T;  1NR2 A;  1SMY D;  3SVM A;  3BDC A;  2DJF C;  4DPG A;  4AIM A;  3CPF A;  4A3L G;  4DR2 Q;  3ERS X;  4MHE A;  1GM5 A;  4L5R C;  4H13 C;  4A3M G;  4YIJ A;  3OMC A;  4DR1 Q;  2KCN A;  1GUN A;  1EOT A;  3BJU A;  1FGB D;  5ELB A;  1EY0 A;  4TRD A;  3A8J E;  4LUZ A;  3BG3 A;  3K5O A;  1TWH B;  1WYD A;  4NKL A;  5FLX L;  3K5L A;  4KD3 A;  4IJH A;  3D3R A;  4LF4 L;  2AMC B;  1PH2 A;  2NN6 G;  3NSW A;  1T9H A;  4GZY C;  2QGQ A;  1IBK L;  2EIF A;  4IJL A;  1QNU A;  5FOB B;  2Z6K C;  3CHB D;  1CKO A;  2UXB L;  2XRQ D;  3UDX A;  4GN5 A;  4C1N I;  4KKT A;  2UXD Q;  5A35 A;  1JIC A;  4JOI C;  3CC4 A;  1R4Q B;  4C2M B;  4KY7 A;  3GTQ B;  2QEX A;  1MJC A;  3CC7 A;  4B3M L;  4DR5 Q;  3H94 A;  5C4X G;  2NWG A;  2EJG C;  2H1E A;  1H9R A;  4A3I B;  3J80 c;  1XMQ L;  5E4W C;  3SR1 A;  3IRB A;  4X3S A;  4BY1 G;  1GUW A;  3RN5 A;  4QUF A;  3DMU A;  2N49 A;  3HOW B;  4Q5V A;  2NVY B;  1EYA A;  1UAP A;  4V19 0;  2NVT B;  2EY1 A;  1DYQ A;  2R92 B;  1Q7Y C;  1IBL L;  2IHF A;  3J7Y W;  3IFD A;  2OTJ A;  4RKB A;  1E1O A;  1X55 A;  2B2W C;  2QEJ C;  1PXU A;  3NEM A;  2DNC A;  1NUC A;  4JI2 Q;  3T16 A;  4N8X 1;  2JE6 I;  2WFW A;  2L9H A;  1AE2 A;  2F0L A;  3H0G B;  2L4N A;  3PIP A;  5IYB G;  2A68 C;  4RKL A;  4FVM A;  1ICW A;  2HQL A;  4NDX A;  2ICI A;  1I4H A;  1MHW C;  5C44 G;  3CKI B;  4JI1 Q;  3SGI A;  3I90 A;  2QIL A;  4NXN Q;  1OXS C;  4K14 A;  4HJA A;  1EIY B;  4KN7 C;  3L7Z C;  3T51 B;  5DNF A;  4OXP A;  1EYD A;  3VYT A;  3OIQ A;  3DWP A;  3S24 A;  4EX5 A;  4FF2 A;  4CJ1 B;  3MEF A;  1JWS D;  1QUQ A;  4HIO A;  1G2S A;  1SAP A;  3EQL C;  1I5F A;  1SRO A;  3CCL A;  1S3O A;  4DR3 Q;  1VQC A;  4QIW B;  4XYQ A;  4KV6 A;  5HUR A;  2C9O A;  2EVB A;  4O42 A;  4X65 L;  4B9X A;  2KHS A;  5AFW A;  4KJO A;  3T1H Q;  2UUA L;  3J81 i;  1HTL D;  1O78 A;  4GNX C;  4A3K B;  3C2P A;  3GTP B;  3HOV G;  1D1I A;  5KNC A;  5IOD A;  4A3D B;  4F88 A;  4DAY B;  5C3E H;  2R3Z A;  4K5X A;  3HOU G;  3GV3 A;  2B63 G;  1B2T A;  4NXM Q;  1WOC A;  3RLO A;  4F8M A;  1YEZ A;  1LM0 A;  1BO0 A;  1H95 A;  4G4K A;  4OL7 A;  1EQV A;  3I4M H;  2VW9 A;  2XTI A;  1SFO B;  2IT1 A;  1UEB A;  3HP3 A;  5FJ8 G;  3KLS X;  5JAV A;  1WTV A;  4H02 A;  5BR8 L;  1BCP C;  4RGT A;  1ASZ A;  1O7Z A;  4KJN A;  2B39 A;  3Q22 A;  1NE3 A;  4XQJ A;  1L0W A;  1V1Q A;  3MFY A;  2B2T A;  5FLM H;  3QR8 A;  1Y14 B;  2NTT A;  2NB0 A;  1SNC A;  2RHS B;  1RTN A;  2JK8 A;  3HS0 C;  2LXJ A;  4DR2 L;  3N6R A;  3JAM E;  2ZTC A;  3IFT A;  2E2J H;  1NY4 A;  3MXN A;  1O7Y A;  2K6A A;  2SEB D;  1G29 1;  2ZTE A;  3I4N G;  4FNF A;  3R3O A;  1PRT F;  3GDE A;  1NAP A;  4A3E G;  1N34 L;  2YTX A;  5JEA G;  1H9J A;  3A56 A;  4CDE C;  1PH3 A;  1S40 A;  3QB3 A;  2B2U A;  3V2T A;  3RZO H;  2Y0S E;  1CFM A;  1HCZ A;  5C4J B;  1W2B A;  2O5J C;  2OT2 A;  3GO5 A;  1N33 Q;  1E2W A;  4YY3 L;  2K28 A;  1NJI C;  3KLR A;  3H6M A;  4DXF A;  1XPU A;  1YI2 A;  2XWB B;  4IO9 A;  3S14 H;  4JI0 L;  3MAQ A;  1G6P A;  1M8A A;  2WKD A;  2JA5 B;  1BCP B;  1ESF A;  5DM6 3;  1RCV D;  3I72 A;  3DUZ A;  3TZD A;  1C7Y A;  2NVQ H;  4Y7N H;  3I73 A;  2I5M X;  2PMZ E;  3E6Z X;  1Z6H A;  4P75 A;  3AFP A;  2PZT A;  4ZK9 B;  2Q8T A;  1WTX A;  2JA7 B;  1JB3 A;  2K04 A;  3PF5 A;  1K3R A;  2O4X A;  1G51 A;  2PQA A;  4ZRZ A;  5FO7 B;  4JW0 A;  2AQ3 B;  4OEM B;  3PUX A;  4JI8 L;  1HQR D;  4XTC S;  1UNS A;  5IGF A;  1Y1V G;  4JBM A;  3TME A;  3KUP A;  1QVG A;  1K73 C;  2VQE L;  2ZJQ A;  3CCQ A;  3Q8D A;  4JI4 Q;  2LSS A;  1PMR A;  4RCO A;  1L2F A;  2UUC L;  2RSO A;  3DWA A;  4L5T A;  4ZUJ A;  1X65 A;  1EZ6 A;  3SK4 A;  1STN A;  2AWN A;  3UE0 A;  4JI2 L;  2WB1 B;  4AYB B;  2CW0 C;  3SK8 A;  1ET6 A;  4DA2 A;  1QWY A;  4EVO A;  1VQK A;  3HOY G;  3EFX D;  3TDQ A;  1TT2 A;  5CV6 A;  1TKW B;  5G3L D;  2JA8 H;  5ELE A;  1L0X B;  1VMP A;  2F0T A;  2A69 D;  4IUR A;  1S5C D;  4RFB A;  4JI1 L;  1WD0 A;  1EIH A;  1CKN A;  4LJZ C;  4ME5 A;  3P1H A;  2GN5 A;  2LFN A;  1IBM Q;  3S17 H;  3HOZ H;  3FVQ A;  4IUT A;  5EJW A;  1Q86 C;  1XNR Q;  4LFB Q;  1ET9 A;  4R9W A;  1S5B D;  4DV2 Q;  2EY5 A;  3K5N A;  2PZU A;  2HT1 A;  3ITP A;  3FKI H;  4JV5 Q;  4MTK A;  5IP9 G;  4B3R L;  1SYC A;  4DV6 L;  1EEI D;  2B3G A;  3ERO A;  4C3I H;  2Z8L A;  5JJK A;  3A5Z B;  2QKI C;  4TVA B;  1YNN C;  5FLX E;  4KD4 A;  2L12 A;  1M4V A;  1EY7 A;  2YTV A;  3CD6 A;  4DU9 A;  2VB3 X;  4ZKC B;  1XPO A;  2G9D A;  3NTH A;  1KRS A;  3NBH A;  4B3T L;  1STA A;  1LO5 D;  5EPK A;  1QOH A;  4M1U B;  1V9P A;  3L3O C;  3GTK B;  2SNS A;  3GTO H;  5GAD C;  1N32 L;  1RD9 D;  4ID6 A;  5I6Y A;  5EQ0 A;  1XTD A;  3MTS A;  1FNW A;  1HNZ L;  2EXD A;  1PTO F;  1ROD A;  1QE6 A;  3S15 H;  2L5T A;  5E1F A;  4DV4 Q;  2MQH A;  3NXW A;  5IIF A;  1MIU A;  2E2H H;  4KMU C;  2UU9 Q;  3EIV A;  4LF8 Q;  2WAQ G;  4PMB A;  1SRU A;  3CRL C;  5CV8 A;  1UUP A;  5CV7 A;  2OQK A;  1RDP D;  1NMF A;  1VQL A;  2M2L A;  5C5L A;  2CQO A;  5CV4 A;  3H91 A;  3TEH B;  4DV7 Q;  4UY8 C;  2N8N A;  2A6E D;  2MHV A;  4GLV B;  3DEO A;  4HIM A;  3A8I E;  1AE3 A;  3PUW A;  2NBF A;  1I50 H;  5M5W H;  5M3M H;  1YBY A;  4K8I A;  1MI2 A;  3SHL A;  3BDL A;  3FPP A;  2NZH A;  4EQ5 A;  4FDB A;  4X3U A;  1M1K C;  4HJ5 A;  3VYU A;  4L5Q A;  1JOQ A;  1WJJ A;  3VA5 A;  4LUV A;  4DF7 A;  4JC0 A;  4KY5 A;  1PV4 A;  1ESR A;  2EZV A;  2YU9 H;  1F2Y A;  5KEE A;  3K0X A;  3WWV A;  4HTH A;  5CR3 A;  1BUV T;  1K8G A;  3PUZ A;  3K58 A;  5EKI A;  2F0G A;  2E5L Q;  3HKS A;  1SJE D;  3TP8 A;  1PH8 A;  5C3E B;  2L15 A;  4APV A;  2JN4 A;  3J80 i;  2D62 A;  1FJG Q;  4LUO A;  4PMC A;  1B53 A;  4R8I A;  1D5M C;  4BBR H;  4B08 A;  2HHH L;  2KCT A;  3P20 A;  3PUV A;  4A3B H;  2Z4I A;  4WJ4 A;  2DUD A;  3ULL A;  1F77 A;  1WVL A;  2JP1 A;  1MJE A;  4POF A;  2EJM A;  5IT9 L;  4A3I G;  2VUM H;  3GTL H;  4IFD H;  2I5L X;  1C8C A;  3QOL A;  4KI0 A;  3CCM A;  3DXJ C;  5M5Y B;  1GUS A;  2K05 A;  3NPP A;  4RGM A;  1YZ6 A;  3V05 A;  3RLF A;  5FK9 C;  4JI6 Q;  1F2Z A;  3HOW G;  1UE5 A;  4KY6 A;  1ENC A;  2JA6 H;  4KK7 A;  4BY7 B;  2XVS A;  2X6L A;  2E75 C;  1BOS A;  2MP1 A;  2LS0 1;  2HD3 A;  2L11 A;  2E76 C;  2NZO A;  4ODG A;  2R92 G;  1WTP A;  2GVA A;  2EYO A;  4BWG B;  1B7Y B;  1VQ8 A;  3RZO B;  1AZP A;  5JJI A;  5IP7 H;  1IKM A;  1OXU A;  3MVV A;  1WCM B;  1Y1W H;  4IQZ A;  5IYD G;  3J7A 5;  5H1S E;  1PYB A;  1VQN A;  3S16 B;  5C0X G;  3GV6 A;  3H0G G;  3S14 B;  1R9T H;  4DV2 L;  1CHQ D;  5C3W A;  4GS3 A;  4JV5 L;  4DR4 L;  2ZXR A;  4ZLT F;  1A2U A;  3IAY A;  2XWJ B;  1W6J A;  2KUM A;  4Y7N B;  4L5S A;  3M4Y A;  2MO1 A;  1YHQ A;  4IN3 A;  3BVZ A;  3HG9 A;  1N9W A;  1Q46 A;  5CV9 A;  3S1R H;  1VQ5 A;  2DJG C;  2EYL A;  1XJV A;  4EQP A;  1EQT A;  4LNQ A;  5M5X B;  4RAU C;  1GD7 A;  2PCF B;  1E0B A;  4A4I A;  1Y69 U;  3IL8 A;  3DHQ A;  4A3K G;  4JBJ A;  4LFC L;  4DV1 Q;  5IGD A;  1Q81 C;  1LLR D;  2KEC A;  1A15 A;  3BZD B;  2FFK B;  4A3D G;  1QUQ B;  4K6D A;  1MGS A;  2RCN A;  4PQX A;  1XTC D;  4KN4 C;  2D5D A;  3NK9 A;  2F03 A;  4A3L H;  2F0O A;  2F0H A;  3ER0 A;  3EVQ A;  1V43 A;  1HNW Q;  1E24 A;  4DNR B;  4CBV A;  1JJ2 A;  2ES2 A;  1PVO A;  1KDA A;  1SEB D;  2IX1 A;  2MO0 A;  4H44 C;  1PFM A;  2BA0 A;  4QF4 A;  4NB3 A;  2R7D A;  2JA8 B;  4YCV A;  3FP9 A;  3NHH A;  4X3T A;  3TQY A;  3OPO A;  5FKA C;  3E0J A;  3MXG A;  3HOZ B;  2DY8 A;  2AHO B;  4DNI A;  1C4Q A;  1HPC A;  2ASB A;  4DUY Q;  4XT3 B;  1VQ4 A;  4ZUI A;  1NBW A;  4DGZ A;  2BOS A;  4F87 A;  2P5Z X;  5M3F H;  1HR0 Q;  2K14 A;  3TN2 A;  3FKI B;  2CFM A;  2VXW A;  1BKB A;  3ZYY X;  2IPK D;  4R4I A;  1WTH A;  4A3C G;  3TP7 A;  1TVX A;  3W3A A;  4UHV A;  4C3I B;  3PGZ A;  1JOK A;  2QCP X;  4YWK A;  1JCK B;  1PRT D;  4OHJ A;  1MBY A;  4IFD I;  1NR4 A;  4X66 L;  1MKH A;  3MXN B;  1SYG A;  1ENF A;  1U5K A;  5LL6 X;  1VQG A;  4AQY L;  5KND A;  1PLF A;  1QVF A;  3SE0 A;  1S5E D;  1FJG L;  3GTO B;  3K80 C;  4HCS A;  2JA5 G;  1VQB A;  4A93 B;  3MZ5 A;  4CKE A;  1JWM D;  5GAH C;  3S15 B;  1HZ9 A;  1PZK D;  1BF4 A;  5IGE A;  3D4W A;  1EQQ A;  4QCL A;  1A3U A;  4LF7 Q;  4GKJ L;  3VYS A;  1FNU A;  5M9O A;  2IWH A;  3TP6 A;  2JA7 G;  5CC4 A;  1TII D;  2DY7 A;  2VQF L;  1N36 L;  1KAB A;  1D7Q A;  2VS1 A;  4FF4 A;  3M7G A;  3I91 A;  5FO8 B;  2EQS A;  1QB5 D;  1EQR A;  3KDF A;  2LXK A;  4OX9 Q;  1HTP A;  1X3Q A;  1U4R A;  1I50 B;  1EY5 A;  5M5W B;  2NVX B;  5M3M B;  3I70 A;  2CH4 W;  2JXM B;  3GD7 A;  4TKO B;  2AKW B;  5IYC H;  1CQV A;  5C44 H;  1IL8 A;  1JWU D;  3BYT B;  3C3L A;  1F2M A;  3DEP A;  1LTI D;  2JYO A;  1ILQ A;  1GHK A;  1HZC A;  2JEB I;  2PQA B;  5HGQ A;  3H3V H;  4I65 A;  1TWG H;  1K83 B;  2XN9 C;  3SXH A;  4M8A A;  2WB1 G;  4AYB G;  3CAM A;  4DKA C;  3V96 A;  2YU9 B;  1FGU A;  1EZ8 A;  4LF9 Q;  3PO3 H;  2MPM A;  1HNX Q;  1OXT A;  2M9V A;  1LTG D;  3MXU A;  5LMN Q;  4BA2 I;  5I4D A;  1QG7 A;  2F52 A;  1X56 A;  1IHZ A;  2YYZ A;  3NWS A;  4N9P A;  2UXC Q;  3X3N A;  2R93 H;  4J8Q A;  2XRS D;  4DXG A;  3FRP B;  3T13 A;  4F7X A;  2OCE A;  5IGB A;  1CK1 A;  1HUN A;  3HOU H;  2ZM6 L;  3LWE A;  2B63 H;  1A6X A;  2BCO A;  3FPU B;  1Y8N B;  1HFG A;  3FDT A;  4LWC A;  3CCV A;  1CKN B;  4A3B B;  3CP0 A;  4LF5 L;  2EYF A;  3J81 j;  1RF2 D;  3KLW A;  4HJ9 A;  2B8F A;  2H5X A;  4JVZ A;  1L0Y B;  1E22 A;  1IYV A;  3LNN A;  4GN4 B;  1P16 A;  4A3J H;  4K8J A;  4HAE A;  3ERQ A;  3J7A V;  5CMD A;  2VUM B;  4OON A;  4OWX B;  1YNJ D;  2E74 C;  4FP5 D;  2QDL A;  1EWH A;  2EE1 A;  1SYF A;  2SNM A;  2EJF C;  5I2Y A;  4IUU A;  4JPB W;  4FO2 A;  3EBE A;  1PA6 A;  1I4R A;  1F9S A;  4JI5 Q;  1U4P A;  4CKC A;  1H9M A;  3I4N H;  1X3G A;  3S1N H;  1TQO A;  3CCU A;  1I4G A;  5IT9 E;  1B50 A;  1AEX A;  3HFZ B;  2CWA A;  3J80 L;  3PO2 H;  5JEA H;  3G6E A;  1PTO D;  1SE2 A;  2WAQ E;  2KCC A;  1W3S A;  2HUG A;  3A7A B;  2K03 A;  2BH8 A;  3CRK C;  2ENB A;  5E3F A;  1JQY D;  2N78 A;  1QCB D;  4HIK A;  2UUB Q;  1IZ6 A;  1ML0 D;  3CCR A;  1R9T B;  3J81 E;  4GN3 B;  4LW1 A;  2Q2U A;  4RG1 A;  3BVG A;  3VR5 A;  1HR0 L;  1FVI A;  2CWP A;  3GTJ B;  4YCU A;  1WTW A;  2F0U A;  1PH4 A;  2RDH A;  1D6E C;  1FYC A;  4DFA A;  1EIG A;  2AQ2 B;  3S1Q B;  5LMU Q;  3JAM i;  1SLJ A;  4EQO A;  1CHP D;  4P71 A;  4BBS B;  2QDB A;  1I6H H;  1LT5 D;  4DR1 L;  5J22 A;  4MZ9 A;  3S1R B;  2N3S A;  3MXP A;  4DK0 A;  3S2D H;  1SNM A;  2A1A A;  2ZTD A;  3KF6 A;  5DEH A;  4FXD A;  3BDO A;  1Q1B A;  3B6Y A;  1TWC H;  2N55 A;  5IWA Q;  1E2Z A;  5C6A A;  1KQS A;  2R7Z H;  1O80 A;  2LKV A;  3SK5 A;  3AQQ A;  3CXC A;  2L0C A;  4K6L A;  1VF7 A;  1Y1V H;  3G71 A;  3H3V I;  1TY2 A;  4OIJ A;  2EY6 A;  5EPJ A;  5C3E G;  2K32 A;  3DLL A;  5E4X A;  1SSO A;  2K33 A;  3L9A X;  3HKZ E;  2UXD L;  4IPD A;  2A69 C;  4LFA Q;  1PHJ A;  2IY5 B;  4LMQ D;  4DUZ Q;  1AH9 A;  2D0P A;  5C4H A;  4XIG S;  4DR5 L;  5FO9 B;  1I6V C;  3AYH B;  1EEF D;  4OX9 L;  1HA5 A;  3CF5 A;  5LHY 1;  2LY7 A;  4CDF C;  4K2L A;  4MNO A;  3U4Z A;  2Q8I B;  1XNQ Q;  3I4O A;  1OO9 B;  1IW7 D;  1I4X A;  2GA4 B;  2K1B A;  5FLM G;  1SYB A;  4A3F H;  4CHT B;  3A74 A;  3CMA A;  1CSP A;  1K9M C;  5M3F B;  1FD7 D;  4UP9 A;  1ASY A;  2RSN A;  5I6W A;  2OEO A;  2F4V Q;  4IPH A;  4BY7 G;  1FL0 A;  3TSS A;  5HY6 A;  3NQT A;  1I4P A;  3R8B A;  5LL6 S;  5EGT A;  2A73 B;  4LAA A;  4LF9 L;  4BXX H;  1OXX K;  4P72 A;  3OTO Q;  1G8Z D;  1ICF B;  5JVH 3;  5LMN L;  5DAU A;  1AN8 A;  2IL8 A;  1CUK A;  4UP8 A;  4U67 3;  1EYG A;  1WCM G;  3KJO A;  4KHZ A;  4FF1 A;  4DK6 C;  1E2V A;  1V8Q A;  2K5V A;  3ND8 A;  1YHA A;  1KLG D;  1LAC A;  1V1P A;  1MD2 D;  3H3V C;  2ZJP A;  3TBI B;  1Y8O B;  1Z47 A;  2X6G A;  3E9I A;  4NXN L;  4HMI A;  4R4C A;  3NTI A;  2BDO A;  2MNA A;  1ILP A;  1C9O A;  4JOI A;  4C3H H;  4RA8 A;  1HQM C;  1B4O A;  1PYW D;  3IKJ A;  1XMO Q;  2A6E C;  1YNX A;  4XT1 B;  1VQJ A;  3U9S A;  3F2D A;  3PCO B;  2FIN B;  2RF4 A;  3KF8 A;  5COR A;  2HQE A;  1HJP A;  4DR3 L;  3NWT A;  4WJW A;  3RMH A;  2VNU D;  1A63 A;  3O13 A;  3T1H L;  3M4O H;  4IOA A;  1HFN A;  5ELC A;  2Z9H A;  4A3G H;  1WD1 A;  4OWT B;  3PUY A;  3RN2 A;  2K01 A;  3I55 A;  1EL0 A;  3HOX H;  4NXM L;  4YHH Q;  1JJC B;  1NCV A;  2CCZ A;  1LTL A;  1TWG B;  3AMU A;  3DM3 A;  2ATW A;  5AJ3 Q;  2O5I C;  4OIK A;  1BXT A;  2UUB L;  5A2Q L;  1TS4 A;  1E3P A;  4DAY A;  3PO3 B;  3E5S A;  4BA1 I;  2CKZ B;  2JA8 G;  3P7J A;  1KTK A;  2PW7 A;  1UE6 A;  2R61 A;  1EFI D;  2AWO A;  3BVM A;  4NW2 A;  1BNZ A;  3HOZ G;  4JCV E;  2R93 B;  3R2I A;  4LF6 Q;  4G7H C;  2AUK A;  3P75 A;  5EKL A;  3OYY A;  3UDF A;  3VYR A;  4PV1 C;  3OIP A;  3D6W A;  1CI3 M;  2AUJ D;  4KHP Q;  4ZAI A;  4XQQ A;  1SE4 A;  3GTM H;  1XX8 A;  3D0F A;  4KLK A;  1PH6 A;  4DV3 Q;  4DK3 C;  5KYI A;  2K5W A;  2IX0 A;  2EXZ A;  2KOL A;  3QJY A;  4C3I G;  2I46 A;  4IUN A;  3KBX A;  3K81 C;  2F0Q A;  2Q8R E;  4O0A A;  4A3J B;  3GTQ H;  5IWA L;  5ELF A;  4C1N K;  4ZYS A;  2FXQ A;  5D3D A;  1N33 L;  4DR7 Q;  3SDZ A;  2JSO A;  4GNX A;  1KLU D;  1TS5 A;  2ZJR A;  1AFP A;  1GKH A;  1EY6 A;  4JK1 C;  3JAM c;  4EGV A;  2E2I H;  1SE3 A;  2AQ1 B;  4A93 G;  2NVY H;  4L8J A;  3A55 A;  3E3X A;  1XXG A;  3HGB A;  3S1N B;  3E0E A;  4DR6 Q;  1QJO A;  3MA2 B;  2F0F A;  5C4Z A;  3RLN A;  3S9W A;  3KJP A;  1J8I A;  1KHI A;  4OEL B;  3PO2 B;  3RZD H;  2R92 H;  1U0L A;  1HH2 P;  4A76 A;  1P8L A;  3WDN A;  1LYL A;  3G48 A;  1K0S A;  2F0W A;  4UAI A;  1T5X D;  1U9R A;  3T53 B;  1G91 A;  4R4Q A;  1FNV A;  5K36 H;  3URY A;  2A6H D;  1E1T A;  1CZG A;  1X32 A;  3I4M B;  5IYD H;  1Q90 A;  3OWF A;  1IXR A;  1PYS B;  4NMZ A;  3M4P A;  5C0X H;  3OSO A;  4ULL A;  4RHR A;  4GKK Q;  5F2D A;  2F4V L;  5JVG 3;  3BU2 A;  4EQN A;  1KNA A;  5M3M G;  3J80 E;  3VR6 A;  1U4L A;  3EA6 A;  4JI4 L;  2ZXP A;  3OTO L;  1BCP F;  1HZA A;  4LF4 Q;  4QQB X;  2JQO A;  3BZC A;  2E2J B;  2KHJ A;  4QGU A;  1DOM A;  1STE A;  3KK7 A;  3J81 L;  3WOE A;  1I6H B;  1IBK Q;  2WP8 J;  4OO1 H;  4Y52 H;  5BN4 A;  3KDF B;  4PNY A;  3NTK A;  5EPL A;  1PTO H;  1BVS A;  1B8A A;  4AYB E;  4CDC C;  3CPW A;  5BN5 A;  2UXB Q;  1TXY A;  1ZYR D;  1S72 A;  1UWV A;  4GLA C;  5JJZ A;  2QA4 A;  4RGO S;  3CQZ H;  1TS3 A;  3FEW X;  1E7Z A;  1TWC B;  2CH4 A;  4J15 A;  1KC8 C;  2EYP A;  1IBM L;  2R7Z B;  5GAE C;  4U68 A;  1J6Q A;  1ENA A;  3NEN A;  3GTP H;  2L55 A;  1XNR L;  4LFB L;  2KVM A;  4A3K H;  1ZEQ X;  3A8K E;  1XMQ Q;  4HCE A;  3PIO 3;  4C3J H;  3BS1 A;  1JB7 A;  4QB4 A;  5I2X A;  4KTA A;  4KKU A;  1CM9 A;  2A5H A;  2I0Q A;  2NVQ B;  2NUC A;  3STB D;  4A3B G;  5IGC A;  3W1G A;  2F0E A;  3K0Y A;  1TWA H;  1KRT A;  2E8G A;  4O2D A;  4TQU S;  3ND9 A;  5D3I B;  2VUM G;  4A75 A;  4HJ8 A;  2D0O A;  2H4O A;  3PSI A;  5ELD A;  2IW3 A;  4A3F B;  3CU7 A;  4IFD J;  4X62 Q;  3U50 C;  1GUG A;  4RHS A;  4HN7 A;  1PRT C;  2F1M A;  1QVC A;  4RH6 A;  2RCF A;  3X3M A;  2Z0S A;  1WTQ A;  1C0A A;  2EOT A;  3LGJ A;  2EYJ A;  3NEL A;  4DV4 L;  2IHE A;  2F0I A;  2UU9 L;  4PZ7 A;  1SNO A;  4LF8 L;  1X3P A;  2B2T C;  1JOO A;  4CJ2 C;  5I9P A;  5FLX c;  3VR3 A;  4QJF A;  4HED A;  1DCZ A;  5IP7 G;  1YIT A;  4FXG C;  1TU2 B;  5BN3 A;  4DV7 L;  4A3M H;  2HIX A;  2D2C C;  1A0I A;  2FMM A;  2O2L D;  2RDF A;  1KD1 C;  3H09 A;  3I7F A;  1Z7T A;  2B2U C;  3Q23 A;  1EWC A;  1EYC A;  1LTT D;  3S17 B;  1GHJ A;  2KED A;  3CW2 C;  3F2C A;  3ULP A;  2R6G A;  2JA9 A;  4X65 Q;  2N88 A;  4Q0F A;  4C3H B;  4GLX A;  2UUA Q;  2RQX A;  2NN6 H;  2ZXO A;  5ELN A;  4N9T A;  3W2D A;  1OXV A;  4JYA Q;  1DXM A;  5CYU A;  4HSP A;  3GTG H;  4CDD C;  4BBS G;  5J3B A;  1PRT B;  5J39 A;  4QL5 A;  3I8Z A;  2WAQ B;  1O7L A;  5C0X I;  2F0S A;  2CHB D;  4AH6 A;  3S2H H;  2A74 C;  2JA7 H;  4JI7 Q;  4L63 B;  3CCS A;  2B2V A;  3M4Q A;  4R4T A;  1WTR A;  3NBI A;  2G5D A;  3CCJ A;  2HCI A;  1C48 A;  5IOC A;  1K3B C;  3HRZ C;  3M4O B;  1X3E A;  5C4X H;  3K7A H;  5IGG A;  1B44 D;  3F2B A;  5CBA E;  2E5L L;  5T1I A;  3TS0 A;  3A7L A;  2EY2 A;  4A3G B;  1TR5 A;  5BR8 Q;  4OO1 I;  1Q82 C;  4BY1 H;  3MFG A;  3HOX B;  2DGY A;  1LTB D;  2FHT A;  1A62 A;  2K7V A;  2VL6 A;  3RNU A;  3KF6 B;  4K0K Q;  2MJ8 A;  4DV0 Q;  1KDC A;  4QMG A;  2C35 B;  2R7F A;  2M00 A;  5NUC A;  4HID A;  2E2H B;  1N34 Q;  3TRZ A;  1IKL A;  4GKK L;  1EY9 A;  1VQI A;  5CV5 A;  2Y0S B;  4IZ8 A;  2I5H A;  1KIX A;  4KKS A;  2BE5 D;  1PFN A;  3K7U C;  1N8R C;  5GQO A;  3I56 A;  1VCI A;  1KNE A;  3F1Z A;  3I3C A;  1W6K A;  2RVL A;  1SBB B;  2VB2 X;  3OMG A;  4QUC A;  3UE1 A;  2NZ1 D;  2NYZ D;  5E7N A;  4K5V A;  4JI6 L;  2PZW A;  4ZCK A;  5D65 A;  4YY3 Q;  4RGN A;  5IYB H;  3VDY A;  2PPB C;  3UDI A;  4Z9C B;  5M3F G;  1L1O A;  5A2Q E;  1SMX A;  4JI0 Q;  1DOL A;  3GTM B;  1B70 B;  2ZT9 C;  3L0O A;  3SEB A;  1I94 Q;  3HKZ B; 
#chains in the Genus database with same CATH homology
 4PG3 A;  1Q1B A;  3B6Y A;  2OQ0 A;  5GRO A;  1HNZ L;  1TWC H;  2EXD A;  2F3I A;  5IWA Q;  3S15 H;  4IFD G;  1KQS A;  1HR0 W;  3GTJ H;  4DV4 Q;  2MQH A;  5C0X J;  1M90 C;  2R7Z H;  1RL2 A;  3AQQ A;  3D31 A;  3CXC A;  1MIU A;  2E2H H;  3PF4 A;  2UU9 Q;  3EIV A;  4LF8 Q;  1PH7 A;  1Y1V H;  2WAQ G;  3G71 A;  3H3V I;  1SRU A;  4YHH L;  5C3E G;  2OQK A;  4P74 A;  3S1Q H;  3DLL A;  1NMF A;  1VQL A;  2JA6 G;  2CQO A;  1WFQ A;  4OO1 G;  5AJ3 L;  1K0R A;  2K5H A;  3I2Z A;  2N8N A;  3TEH B;  4DV7 Q;  4GOP A;  4UY8 C;  1IL2 A;  4BBS H;  4GLV B;  3HKZ E;  3F8T A;  1O7I A;  2K75 A;  5DLQ E;  4IPD A;  4LFA Q;  3OW2 A;  3GTK H;  4HIM A;  2UXD L;  2Q2I A;  1XPR A;  1PHJ A;  4A3C H;  1AE3 A;  2ZM6 Q;  2IY5 B;  4DUZ Q;  1AH9 A;  1SN8 A;  2D0P A;  4XIG S;  4DR5 L;  3PUW A;  1YJN A;  1I50 H;  3AYH B;  5M5W H;  5M3M H;  1YBY A;  4LF5 Q;  4OX9 L;  4JI8 Q;  2PNH A;  3CF5 A;  3HOV H;  1KL9 A;  4MTN A;  1PH5 A;  5C4J H;  1Y1W G;  2VQE Q;  2NZH A;  4MNO A;  3U4Z A;  1CSQ A;  1XNQ Q;  3I4O A;  4EQ5 A;  4FDB A;  4LF6 L;  1VQA A;  5FLM G;  1M1K C;  4HJ5 A;  1TWF H;  4A3F H;  2UUC Q;  4L5Q A;  3A74 A;  1WJJ A;  3CMA A;  4LUV A;  4X64 Q;  2HIV A;  4KHP L;  1CSP A;  2KHI A;  3UDG A;  1K9M C;  4UP9 A;  1D8L A;  1VQF A;  1X6O A;  4JC0 A;  1PV4 A;  1ASY A;  4DV3 L;  4X62 L;  4P73 A;  4RMF A;  4IPH A;  2JA5 H;  2YU9 H;  1FL0 A;  2F4V Q;  4BY7 G;  5HY6 A;  1I3Q H;  5IY0 A;  2ID0 A;  3K0X A;  3WWV A;  4LF9 L;  3A0J A;  2NN6 I;  5FJ8 H;  4BXX H;  1OXX K;  4P72 A;  3OTO Q;  1K8G A;  3PUZ A;  4DV1 L;  3U58 A;  5LMN L;  4DR7 L;  5IYC G;  1VQO A;  2E5L Q;  3HKS A;  1CUK A;  1PH8 A;  4UP8 A;  3KF8 B;  1EYG A;  2L15 A;  4APV A;  4JBW A;  1WCM G;  4UP7 A;  3KJO A;  3J80 i;  2KBN A;  4KHZ A;  2D62 A;  1FJG Q;  4LUO A;  1HZB A;  2BA1 A;  4DK6 C;  1JMC A;  1HNW L;  1PFS A;  2K5V A;  1CKM A;  4UPA A;  1YHA A;  1Z9F A;  4BBR H;  4DV5 Q;  1VQP A;  3PV0 A;  2ZJP A;  2HHH L;  2KCT A;  4B3S L;  1Z47 A;  3NBH B;  4YWL A;  4A3E H;  3PUV A;  4A3B H;  3PO3 G;  2K5N A;  4DR6 L;  2GVB A;  3E9I A;  4WJ4 A;  4B3R Q;  1EUJ A;  2DUD A;  2YV5 A;  4NPS A;  4NXN L;  3ULL A;  3CCE A;  4R4C A;  4DV6 Q;  4PZ8 A;  1MJE A;  4POF A;  2MNA A;  1NMG A;  1JT8 A;  1C9O A;  4JOI A;  4C3H H;  4DPG A;  3L2P A;  1K8A C;  4AIM A;  4A3I G;  1XMO Q;  3CPF A;  2VUM H;  1EWI A;  4DUY L;  1YIJ A;  3GTL H;  4DR2 Q;  2I5L X;  1YNX A;  2Q2H A;  4A3L G;  1VQJ A;  3T1Y Q;  3ERS X;  4KI0 A;  5LMN W;  2R93 G;  1GM5 A;  3CCM A;  3F2D A;  4B3T Q;  4L5R C;  4JYA L;  4A3M G;  3PCO B;  2RF4 A;  1YZ6 A;  1SE8 A;  3RLF A;  4DR1 Q;  4JI6 Q;  3HOW G;  1UE5 A;  1HJP A;  4DR3 L;  3BJU A;  2JA6 H;  1Q12 A;  2VNU D;  1N32 Q;  1A63 A;  4POG A;  4JI7 L;  2NZO A;  4LUZ A;  3T1H L;  2R92 G;  2VZA A;  3M4O H;  2GVA A;  1VQ8 A;  1B7Y B;  1WYD A;  1HNZ Q;  4IOA A;  4IJH A;  4A3J G;  4LF4 L;  2AMC B;  3TRE A;  1PH2 A;  2NN6 G;  4A3G H;  1T9H A;  5JJI A;  3AFQ A;  4OWT B;  2QGQ A;  5IP7 H;  3PUY A;  3RN2 A;  3I55 A;  1OXU A;  1IBK L;  3HOX H;  2EIF A;  4NXM L;  4IJL A;  4YHH Q;  1JJC B;  1Y1W H;  2CCZ A;  2Z6K C;  5IYD G;  3J7A 5;  5H1S E;  1PYB A;  3ICE A;  1VQN A;  1CKO A;  1LTL A;  5C0X G;  2UXB L;  3H0G G;  3DM3 A;  3A5U A;  5AJ3 Q;  5M5Y H;  1R9T H;  3UDX A;  2ATW A;  4GN5 A;  4DV2 L;  2UUB L;  2UXD Q;  1E3P A;  4GS3 A;  2Q2T A;  4JV5 L;  4DV0 L;  4JOI C;  4DR4 L;  4K0K L;  3CC4 A;  4BA1 I;  1J5E Q;  2QEX A;  2CKZ B;  2JA8 G;  1MJC A;  3CC7 A;  4B3M L;  4DR5 Q;  1UE1 A;  4BY7 H;  4GNX B;  5C4X G;  4LF7 L;  1UE6 A;  3PO2 G;  4L5S A;  2AWO A;  1DGS A;  3J80 c;  2MO1 A;  1XMQ L;  3HOZ G;  4JCV E;  3IRB A;  1YHQ A;  4BY1 G;  3M9B A;  1RIP A;  5JEA J;  3RN5 A;  1PH9 A;  4LF6 Q;  2BH2 A;  3UDF A;  3OYY A;  1N9W A;  2N49 A;  3CC2 A;  1YJ9 A;  1Q46 A;  1WCM H;  1VQ6 A;  3S1R H;  3I4M G;  2JEA I;  1VQ5 A;  4KHP Q;  2K50 A;  1XJV A;  3S16 H;  3GTM H;  3J7Z C;  3D0F A;  4KLK A;  1PH6 A;  1UE7 A;  4DV3 Q;  4HJ7 A;  4LNQ A;  4DK3 C;  3AEV A;  3HOY H;  2IX0 A;  1GD7 A;  1Q7Y C;  1IBL L;  2IHF A;  3EN2 A;  4A4I A;  1I94 L;  2OTJ A;  3K81 C;  4O0A A;  4A3K G;  1E1O A;  1A8V A;  4JBJ A;  4LFC L;  5IWA L;  4DV1 Q;  3GTQ H;  1X55 A;  1N33 L;  2FXQ A;  1Q81 C;  4DR7 Q;  2V1C C;  1GO3 E;  4A3D G;  1QUQ B;  4GNX A;  3NEM A;  4DAM A;  2RCN A;  4JI2 Q;  2ZJR A;  2JE6 I;  3W5O A;  4A3L H;  2WFW A;  3ER0 A;  1AE2 A;  1GKH A;  1V43 A;  3PIP A;  5IYB G;  1HNW Q;  1E24 A;  3JAM c;  2HQL A;  1JJ2 A;  2E2I H;  5IP9 H;  2ES2 A;  3M3Y H;  1PVO A;  3S1M H;  3BZK A;  1HNX L;  2HHH Q;  3G4S A;  2IX1 A;  2MO0 A;  1GVP A;  4A93 G;  2NVY H;  4PMW A;  5C44 G;  3M7N A;  1EOV A;  2BA0 A;  4JI1 Q;  3SGI A;  4NB3 A;  2R7D A;  3E0E A;  4DR6 Q;  4YCV A;  4PZ6 A;  3FP9 A;  4NXN Q;  1OXS C;  3KJP A;  3RLN A;  3U4V A;  4HJA A;  1EIY B;  2R7Z G;  1KHI A;  3L7Z C;  5M5X H;  3RZD H;  3TQY A;  4OXP A;  1QZG A;  2R92 H;  2UXC L;  1U0L A;  1HH2 P;  4A76 A;  1P8L A;  5JJL A;  4DNI A;  1LYL A;  2AHO B;  2ASB A;  3G48 A;  1X3F A;  3S24 A;  4EX5 A;  4DUY Q;  1VQ4 A;  2Z6K A;  4R4Q A;  1NBW A;  3FHW A;  3MEF A;  1E1T A;  1QUQ A;  4HIO A;  2A19 A;  5M3F H;  1I5F A;  2K14 A;  1HR0 Q;  1SRO A;  3CCL A;  2CFM A;  1S3O A;  1BKB A;  5IYD H;  4X64 L;  4R1J A;  1IXR A;  1PYS B;  4R4I A;  1VQC A;  3M4P A;  4DR3 Q;  4A3C G;  2K4K A;  4GKK Q;  4JI3 Q;  4OWW B;  2F4V L;  3BU2 A;  3H15 A;  1SR3 A;  3PGZ A;  4X65 L;  3KOJ A;  4YWK A;  5M3M G;  3T1H Q;  2UUA L;  3J81 i;  4GNX C;  4IFD I;  3CME A;  3HOV G;  4JI4 L;  3OTO L;  1HZA A;  4LF4 Q;  4QQB X;  4DAY B;  5C3E H;  2JQO A;  3BZC A;  2KHJ A;  4X66 L;  4QGU A;  1MKH A;  1VQD A;  3MXN B;  3HOU G;  3RR5 A;  4Y52 H;  1U5K A;  2WP8 J;  1IBK Q;  2B63 G;  1VQG A;  4NXM Q;  1WOC A;  3RLO A;  4A3F G;  3KDF B;  4AQY L;  4QIW E;  1YEZ A;  1BVS A;  1B8A A;  1LM0 A;  4AYB E;  4ME3 A;  2ALY B;  3CPW A;  1FJG L;  1QVF A;  2UXB Q;  4JI5 L;  1H95 A;  3K80 C;  1TXY A;  1VQB A;  2JA5 G;  1S72 A;  1UWV A;  4GLA C;  4DV5 L;  1Q8K A;  2QA4 A;  3TS2 A;  3I4M H;  2VW9 A;  3CQZ H;  2XTI A;  2IT1 A;  4DR4 Q;  3K8A A;  4J15 A;  1E7Z A;  5GAH C;  3W1B A;  1UEB A;  1KC8 C;  4IPC A;  1HZ9 A;  5FJ8 G;  1QZH A;  1IBM L;  4BXX G;  5GAE C;  4H02 A;  5BR8 L;  1ASZ A;  1EQQ A;  1J6Q A;  4LF7 Q;  3NEN A;  4GKJ L;  3ZJY C;  1NE3 A;  5GAG C;  1L0W A;  1V1Q A;  3GTP H;  1XNR L;  5IE8 A;  4A3K H;  4LFB L;  1XMQ Q;  5FLM H;  1IYJ B;  1Y14 B;  2RHS B;  4DR2 L;  2JK8 A;  3M85 A;  2JJQ A;  2LXJ A;  4C3J H;  3T1Y L;  2JA7 G;  1JB7 A;  2ZTC A;  2VQF L;  1N36 L;  2E2J H;  1NY4 A;  2XGT A;  1D7Q A;  2VS1 A;  1G29 1;  2EQS A;  2ZTE A;  3I4N G;  1SFO H;  1EQR A;  3KDF A;  2LXK A;  3GDE A;  1N34 L;  4A3E G;  2I0Q A;  3STB D;  4OX9 Q;  4A3B G;  2YTX A;  5JEA G;  1EFW A;  1PH3 A;  1S40 A;  3W1G A;  5LMU L;  1TWH H;  3GD7 A;  1TWA H;  1YVC A;  2AKW B;  3RZO H;  2Y0S E;  5IYC H;  5C44 H;  4A93 H;  1KRT A;  2E8G A;  4O2D A;  4TQU S;  5IT9 c;  1W2B A;  1PH1 A;  2KCM A;  2VUM G;  4LFC Q;  4A75 A;  3GO5 A;  1N33 Q;  4HJ8 A;  1HZC A;  2D0O A;  2JEB I;  1X54 A;  2PQA B;  5HGQ A;  3FKI G;  3H3V H;  4YY3 L;  3PSI A;  2PI2 E;  1NJI C;  1BBU A;  1TWG H;  1XPU A;  4IFD J;  1YI2 A;  4IO9 A;  2WB1 G;  3U50 C;  4AYB G;  4X62 Q;  3CAM A;  3S14 H;  4JI0 L;  1G6P A;  4DKA C;  3PIO A;  1QVC A;  1VQH A;  1VQ7 A;  1FGU A;  4LF9 Q;  3PO3 H;  2Z0S A;  3J81 c;  4C2M H;  1C0A A;  3LGJ A;  1HNX Q;  1OXT A;  5LMN Q;  2PI2 A;  3NEL A;  4DV4 L;  2IHE A;  4BA2 I;  1C7Y A;  1J5E L;  2F52 A;  4PZ7 A;  2UU9 L;  1X56 A;  2OWO A;  4LF8 L;  2NVQ H;  4Y7N H;  2OTL A;  2I5M X;  2PMZ E;  4A3I H;  2YYZ A;  4P75 A;  5FLX c;  2NVX H;  4A3G G;  4QJF A;  3AFP A;  5IP7 G;  2UXC Q;  2R93 H;  1YIT A;  4JI2 L;  3HOX G;  1X9N A;  4DV7 L;  3E9H A;  2HIX A;  4A3M H;  1NTG A;  2B29 A;  3PF5 A;  1K3R A;  3HOW H;  1A0I A;  4B3S Q;  2OCE A;  4LFA L;  3HOU H;  1G51 A;  2PQA A;  4JG2 A;  2ZM6 L;  2B63 H;  1L1O C;  1KD1 C;  4DUZ L;  2NVT H;  3I7F A;  1K83 H;  4ALP A;  4LWC A;  3CCV A;  1CKN B;  3PUX A;  3CP0 A;  4LF5 L;  4JBK A;  4X6A H;  4JI8 L;  3J81 j;  4XTC S;  1OTC A;  3KLW A;  2K52 A;  4HJ9 A;  1Y1V G;  2H5X A;  3CW2 C;  3F2C A;  2R6G A;  3ULP A;  4JBM A;  1QVG A;  2JA9 A;  1E22 A;  2Y0S G;  4X65 Q;  4GN4 B;  1P16 A;  2MFI A;  2VQE L;  4A3J H;  1K73 C;  4GLX A;  1VS0 A;  1XNQ L;  2UUA Q;  5ELN A;  2ZJQ A;  1OXV A;  3Q8D A;  3CCQ A;  2LSS A;  4JI4 Q;  4JYA Q;  4OON A;  3GTG H;  1L2F A;  2UUC L;  4OWX B;  4BBS G;  4L5T A;  1X65 A;  5J3B A;  4QL5 A;  1JE5 A;  4X66 Q;  2AWN A;  4YCW A;  3STB C;  3UE0 A;  4IOC A;  3H0G H;  4IPG A;  4GOP C;  5C0X I;  1YJW A;  4AQY Q;  4AH6 A;  1YHB A;  3S2H H;  2JA7 H;  3EBE A;  5EAY A;  1PA6 A;  4JI7 Q;  3CCS A;  3M4Q A;  4R4T A;  4JI5 Q;  3JC6 6;  1VQK A;  3CCJ A;  3HOY G;  3HKZ G;  3I4N H;  1X3G A;  2JA8 H;  1WI5 A;  3S1N H;  3CCU A;  1Q1E A;  1X3E A;  5C4X H;  3HFZ B;  2CWA A;  3K7A H;  4JI1 L;  3PO2 H;  1CKN A;  3F2B A;  2E5L L;  3G6E A;  2GN5 A;  3TS0 A;  1IBM Q;  3S17 H;  2KEN A;  5BR8 Q;  3HOZ H;  2WAQ E;  4OO1 I;  4QY7 A;  1W3S A;  1Q82 C;  4GKJ Q;  4YWM A;  2WB1 E;  4BY1 H;  2BH8 A;  2DGY A;  1Q86 C;  1L1O B;  1XNR Q;  3KYH C;  4LFB Q;  1A62 A;  1EIF A;  2N78 A;  4DV2 Q;  4HIK A;  2VL6 A;  2UUB Q;  1IZ6 A;  3RNU A;  3KF6 B;  2HT1 A;  4K0K Q;  3FKI H;  2VQF Q;  3CCR A;  4DV0 Q;  1N36 Q;  4JV5 Q;  4GN3 B;  4LW1 A;  2Q2U A;  4RG1 A;  1BBW A;  2RHQ B;  1HR0 L;  5IP9 G;  1FVI A;  4B3R L;  2CWP A;  4DV6 L;  4B3M Q;  2C35 B;  2B3G A;  2R7F A;  4HID A;  4YCU A;  4C3I H;  1PH4 A;  1N34 Q;  5JJK A;  3A5Z B;  3TRZ A;  1VQE A;  4GKK L;  4TVA B;  1VQI A;  4JI3 L;  2I5H A;  1XMO L;  1KIX A;  5LMU Q;  1N8R C;  3K7U C;  3JAM i;  2YTV A;  5GQO A;  3I56 A;  1VCI A;  1SLJ A;  3CD6 A;  1XPO A;  4A3D H;  1KXL A;  1VQ9 A;  1KRS A;  3F1Z A;  4GOP B;  3ULJ A;  4B3T L;  4P71 A;  2VY3 A;  1V9P A;  1I6H H;  3UE1 A;  4DR1 L;  4BBR G;  5E7N A;  4JI6 L;  5K36 G;  4YY3 Q;  1KAW A;  4WJ3 M;  2A8V A;  5IYB H;  3VDY A;  4MZ9 A;  1JJG A;  3UDI A;  3L0O A;  4R4O A;  3GTO H;  5M3F G;  2YTY A;  5GAD C;  2N3S A;  1N32 L;  1L1O A;  3S2D H;  1SMX A;  4JI0 Q;  3KFU A;  2A1A A;  1B70 B;  1VQM A;  2ZTD A;  1IBL Q;  1XTD A;  3KF6 A;  1I94 Q;  5ELO A;  1LUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...