4X65L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2014-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4x65L00
2PI2A 1XNQL 4JBWA 3CCQA 4NXNQ 2K52A 1Q81C 4DUYQ 3M4QA 5IP7G 4A3FG 4X62L 3PIPA 4DR4L 1CKMA 3M85A 3F2DA 3M7NA 3E9HA 4C3JH 5JJIA 1UE1A 4JI3L 1WCMG 2RHQB 1JB7A 1AE3A 4HIMA 1EIYB 1VQ4A 1IZ6A 3H0GH 4JI8Q 4A3EH 5IP9G 3M4OH 4APVA 2KCMA 2WFWA 3ULLA 1ASYA 2ZTCA 5M3FG 1XNRL 2HIXA 3KF8B 5LMUL 5HY6A 3CP0A 5M3MH 1QVCA 1EYGA 4YY3Q 1KAWA 4LF4L 3PCOB 5FJ8H 4DV7Q 4IJLA 2E5LL 2MFIA 4A93G 5IP7H 3FHWA 1EFWA 2PNHA 4IO9A 1VQPA 4GS3A 3J80i 2N3SA 2NVXH 4DV6L 4P75A 4YHHL 1LUZA 3K80C 3ULPA 1VQOA 1HR0Q 1VQEA 2ZM6L 1YJ9A 4DR2L 4DK6C 4JI4L 3PGZA 4IPHA 5M5YH 4JI6L 1D7QA 1BKBA 3F8TA 3U50C 4DV1Q 1FVIA 3T1YL 3I4OA 1YJNA 1WFQA 4A3JH 4BY1G 4HJAA 3KFUA 1UE6A 4YHHQ 4DV6Q 5E7NA 2N78A 4BBSH 2EIFA 4JG2A 1I5FA 1SFOH 4P73A 1FGUA 2JE6I 4IOCA 1WI5A 1PH4A 4IPDA 2JA9A 4DV7L 1PH8A 1L2FA 2Q2TA 4LF7L 4YY3L 4UY8C 4X65L 4DUZL 1HNWL 4IFDJ 4L5QA 1X55A 2LXKA 1C0AA 4C2MH 3OW2A 1Q46A 1Q1BA 5BR8L 4LF5L 3S1QH 3KF6B 1UEBA 1QUQB 2RF4A 4EX5A 2ATWA 1V9PA 2HHHQ 1C7YA 1O7IA 4QJFA 4B3MQ 4IPGA 2RHSB 3I4MH 1VS0A 4UP9A 3HOVH 5IWAL 4DR3Q 4C3HH 3HOXG 3CD6A 1S40A 3GD7A 4B3SQ 3U4VA 2Z6KC 4P74A 3CQZH 1E22A 4DV5L 4DR5Q 1HJPA 3T1HL 1EQRA 2JEAI 1GKHA 2MQHA 4NXNL 1WJJA 5IYCG 2B63H 5M3FH 3S16H 4X66Q 2UUAL 4POGA 2ZJPA 4R4IA 5HGQA 1VQBA 1CKOA 3KLWA 4XIGS 1Y1WH 1EWIA 2E8GA 4JYAL 4LFAQ 3A5UA 2B3GA 2VQEL 1LYLA 2I5MX 3K7AH 4A3DG 1YBYA 3CAMA 3HOVG 3BU2A 3UE1A 4KHPL 4OO1G 1A63A 2H5XA 2ZTDA 4ME3A 4Y7NH 3TS0A 3HKZE 2BH2A 2IY5B 1VCIA 2JJQA 3M9BA 3HKSA 2UUBQ 2YU9H 2VW9A 3CPWA 1YIJA 4QQBX 4LF6L 2UXDL 3I55A 2GVBA 2PQAB 1YNXA 1Z47A 3W1GA 3CF5A 1KC8C 2UUCL 4NXML 4DV5Q 4DR5L 3CC2A 2JA5H 4A3MH 1FL0A 1XPUA 4IJHA 5GAEC 4A3BG 4X64L 1V43A 1TWFH 1DGSA 4PG3A 3SGIA 2K5VA 1EQQA 1JE5A 3MXNB 5M5WH 4Y52H 2BH8A 2QEXA 3S14H 2HHHL 1HH2P 3W1BA 2KHIA 2I5LX 2R7FA 1PHJA 4A93H 5AJ3Q 5BR8Q 4LF5Q 3UDGA 3F2BA 1E3PA 2F52A 1G6PA 3OYYA 3H0GG 4HJ5A 2KHJA 1HZ9A 3CCLA 4LF8Q 2WP8J 3GTQH 1L1OA 3I4NH 1BBWA 1HZCA 2A19A 3G4SA 1HNZQ 2ALYB 4TQUS 2MNAA 4GOPA 1TWCH 3RNUA 1OTCA 4AYBG 1VQCA 4DV0L 4A3LH 1YHBA 2GN5A 2MO1A 3UDFA 2E2JH 3HOUH 1CSPA 2YTVA 2QA4A 3S1NH 1R9TH 3TQYA 1HR0W 4K0KQ 3HKZG 2IHFA 1PH2A 1X6OA 2K4KA 1L0WA 3GTLH 2EXDA 2DUDA 2R92G 1SE8A 3S1RH 2E2IH 4DNIA 2ZM6Q 1A0IA 1IBLL 3CCSA 1PH1A 4O2DA 1PYBA 3BZCA 3VDYA 2CWPA 1YHQA 4LF9Q 5M5XH 2R93G 1X3EA 4OX9Q 2HT1A 2B29A 2CQOA 1OXVA 3D0FA 4A3EG 2R7DA 1IBMQ 2UUBL 4KHPQ 3A0JA 2LSSA 3GO5A 4QGUA 1A8VA 1Q8KA 3J7A5 1Q12A 3J81c 4MNOA 4JI0L 4YWKA 3L7ZC 4JYAQ 3KJPA 4JI2Q 1Z9FA 4GLXA 3K0XA 1YI2A 2A8VA 4POFA 2VQEQ 3FKIH 1KXLA 5J3BA 2YTYA 1N34L 3K7UC 3PUVA 4AYBE 4JI7L 2JA8H 3S15H 2IX0A 4DV4Q 1M1KC 1GD7A 2V1CC 4MTNA 1PH9A 2JA6G 1VQIA 2AWNA 4DR6L 4FDBA 3W5OA 2VQFQ 4WJ4A 2Q2IA 4DV4L 2JA7H 2PQAA 4YCVA 1AE2A 4A3IG 2UXCQ 1IYJB 4R4CA 3GTJH 1KRTA 5C44H 4GNXA 1KHIA 2JK8A 3M4PA 2RCNA 3PO2G 1B7YB 1M90C 1KRSA 1PV4A 1N34Q 1FJGL 4BY1H 3GTKH 3RN2A 4JI2L 3GTMH 1N9WA 4MZ9A 3HOXH 1W2BA 5JJLA 1C9OA 3GTOH 1P16A 4JI0Q 1VQDA 1K0RA 3FP9A 3PUXA 1K73C 2Y0SE 2OQKA 3F1ZA 3ZJYC 3J81j 1IBKL 1VQ8A 3PO3G 5C0XI 4X65Q 1SR3A 4JBKA 4JV5Q 1G291 1YHAA 2JA6H 2NVTH 3B6YA 4JOIC 1X65A 4A76A 3BJUA 4WJ3M 4OX9L 1IBLQ 1JJGA 1E24A 2Q2UA 2QGQA 2HQLA 1S3OA 3ERSX 3PO2H 4GNXB 1NTGA 3G6EA 1CUKA 4DR2Q 3PF4A 4BY7H 1VQJA 4BBRH 2GVAA 3T1YQ 5EAYA 4DV1L 2K5NA 2JA7G 1Q86C 3H3VH 4K0KL 3TS2A 5H1SE 1JT8A 3EIVA 2UXBL 1UWVA 5C0XG 3JAMc 3UE0A 3HOYH 4A3GG 1QVGA 2E5LQ 3DLLA 1L1OB 3F2CA 1N36Q 2CFMA 2F3IA 5LMNW 1VQKA 2BA1A 3HOYG 2I0QA 4LF8L 5LMNQ 1HNZL 4A3GH 3FKIG 1IBKQ 1VQFA 1JMCA 3L0OA 1P8LA 4OO1I 5LMUQ 5IE8A 1XPOA 1UE7A 4X6AH 4BBSG 3D31A 1YJWA 4JI8L 2OTLA 2NVQH 1I94L 1LM0A 1XNRQ 3NENA 1EIFA 4JCVE 4AIMA 3J80c 3L2PA 1SN8A 3A5ZB 3PSIA 2AMCB 1Q82C 1QVFA 1VQMA 4QL5A 1L1OC 2R93H 1CKNB 4IFDI 4GN3B 2CWAA 4DR4Q 2PMZE 5FLMH 3CCVA 4B3TL 1VQ9A 4HJ9A 4DR1Q 2R7ZH 1VQAA 5ELNA 3KDFA 4X62Q 3J81i 4BA2I 4A3CG 1V1QA 4DPGA 2UUCQ 1E1TA 2R92H 4IOAA 3PUYA 4A3DH 4GKKQ 4A3BH 1MKHA 1TWGH 5FJ8G 1J6QA 2C35B 4A3IH 3RLFA 1VQ6A 4YCWA 2R6GA 1NMGA 3NELA 4R1JA 2FXQA 3KF6A 4JOIA 2D0OA 5IT9c 2ZJRA 4L5RC 3E0EA 3I4NG 1KL9A 5GROA 2YV5A 3U58A 4OWWB 4O0AA 1N33L 1B8AA 3GTGH 4GKKL 4X66L 4DAMA 3S1MH 3DM3A 5C44G 4HIKA 5C3EH 5IYDG 3J7ZC 1TXYA 4LF9L 1SLJA 1J5EQ 2VL6A 1MIUA 3CPFA 4JI1Q 1HNXL 3S2HH 4DR1L 4XTCS 1I50H 1VQ7A 2MO0A 3CC7A 4B3TQ 3AFQA 1JJCB 1X3FA 2K75A 4L5TA 4UPAA 1EUJA 4BXXG 1HZAA 2N49A 4B3ML 4B3SL 3HOZH 1X56A 5GAGC 5IWAQ 2VUMH 5ELOA 3RN5A 2KENA 1B70B 4LUZA 3RZOH 1H95A 4DV3Q 4TVAB 1RIPA 1I94Q 4HIOA 4OWXB 4GN4B 3UDXA 1GM5A 1AH9A 3TRZA 4LF7Q 4HJ7A 3I4MG 1NMFA 1NJIC 3RLNA 4DUZQ 4AQYL 1HNWQ 4DKAC 4OWTB 5M3MG 3KYHC 5LMNL 4GN5A 4A3LG 3KOJA 3HOWG 3UDIA 2OQ0A 4DK3C 1Y1WG 1Y1VH 4LFCQ 5IYCH 2PI2E 2YYZA 4OXPA 1N32L 1PH3A 1RL2A 3HOUG 2VS1A 1QZHA 1SRUA 1X54A 4UP7A 4A3KH 5GQOA 2UXBQ 2KCTA 3HFZB 2AKWB 1PA6A 5C4JH 4NXMQ 2AWOA 5C4XH 3A74A 2WB1G 3KJOA 1HR0L 1GO3E 4JC0A 1LTLA 3I56A 1QZGA 3OTOQ 1XMQQ 2UU9Q 3Q8DA 4LW1A 4PMWA 2IHEA 1ASZA 3AYHB 3ER0A 3AQQA 1N32Q 4JI5L 4JV5L 3WWVA 1EOVA 1BBUA 2ZTEA 4GOPB 3LGJA 2OWOA 4EQ5A 1K8AC 1PYSB 3G71A 1MJEA 4LF4Q 1Y1VG 2NVYH 4NB3A 4AH6A 2OCEA 1E1OA 2B63G 3S17H 1MJCA 1XMOQ 1D8LA 3CCRA 1FJGQ 1I3QH 3NEMA 3S2DH 1I6HH 3EBEA 4JI3Q 2VNUD 2JQOA 1A62A 2WAQG 1JJ2A 4DV3L 2UUAQ 1SMXA 2EQSA 2K5HA 2E2HH 2ZJQA 4L5SA 2VY3A 1UE5A 3PUZA 2D0PA 2A1AA 4GOPC 2UXCL 1OXSC 3MEFA 3KDFB 4HIDA 1VQHA 2VQFL 4A3KG 5IP9H 3CCEA 1WYDA 1PFSA 4DR6Q 4DUYL 1WOCA 1N8RC 3RLOA 5C4XG 2IX1A 4GLVB 2Y0SG 3K8AA 4DR3L 1U5KA 1XNQQ 1KIXA 1PVOA 4PZ8A 5GAHC 4PZ6A 1J5EL 4JBMA 4BBRG 2K14A 3U4ZA 4IFDG 4JI7Q 3K81C 1X3GA 5JJKA 2DGYA 3CCUA 5DLQE 3CXCA 4DR7L 1OXUA 3PV0A 1BVSA 2BA0A 4JBJA 2Z0SA 3CMAA 3CMEA 2OTJA 1K3RA 1XMOL 4LNQA 1NE3A 4A75A 1KQSA 3H15A 3STBD 1GVPA 4LWCA 1NBWA 4R4OA 1IBML 1VQNA 2I5HA 3I7FA 2CCZA 4A3JG 1KD1C 1K9MC 2CKZB 4UP8A 3STBC 3CC4A 1HZBA 5C0XJ 4QIWE 4JI5Q 4IPCA 1YITA 3ICEA 1XMQL 3JC66 4DV2Q 3OTOL 2UU9L 1K83H 4BA1I 4RMFA 3HOWH 2AHOB 1PH6A 1OXXK 5JEAJ 4JI4Q 4JI6Q 5IYBG 3RZDH 2JEBI 2NZOA 2YTXA 3GDEA 2VZAA 3S24A 4BY7G 4GKJL 4QY7A 3CCJA 1SROA 5FLXc 1XTDA 2XTIA 4P71A 1OXTA 2Z6KA 4DV0Q 4LFCL 4J15A 3AEVA 4A3CH 4R4QA 3GTPH 5IYDH 2F4VL 3AFPA 4GNXC 3CW2C 1K8GA 4A3MG 4DAYB 2XGTA 1U0LA 4AQYQ 3I2ZA 4A4IA 2NZHA 3HOZG 4YWMA 5AJ3L 3CCMA 4OONA 1PH5A 2NN6I 2F4VQ 3PUWA 4ALPA 3TEHB 2HIVA 4P72A 1VQLA 5IYBH 1N36L 2NN6G 4KLKA 4C3IH 5IY0A 2ASBA 1YVCA 1X9NA 2WAQE 1G51A 3BZKA 1PH7A 1IXRA 2N8NA 2ID0A 5K36G 4YCUA 5FLMG 3M3YH 4HJ8A 3PO3H 3ULJA 1S72A 1W3SA 2L15A 4R4TA 4YWLA 4X64Q 4GLAC 4NPSA 4LUVA 3RR5A 4DV2L 4GKJQ 2Q2HA 3PF5A 2R7ZG 5JEAG 4H02A 4LFBL 4RG1A 4LF6Q 2VUMG 2UXDQ 1T9HA 1XJVA 3EN2A 1WCMH 1TWHH 4KI0A 1Q1EA 4JI1L 1HNXQ 2ES2A 4BXXH 4B3RL 2LXJA 2D62A 3G48A 4KHZA 1YEZA 4A3FH 2WB1E 1E7ZA 1CSQA 1VQ5A 3JAMi 1N33Q 2KBNA 2K50A 2IT1A 5C3EG 1XPRA 3PIOA 1Q7YC 1NY4A 1IL2A 4DR7Q 1QUQA 3H3VI 2JA5G 3NBHB 3TREA 1CKNA 1VQGA 4LUOA 4LFAL 1Y14B 4B3RQ 1TWAH 3E9IA 1YZ6A 3IRBA 2JA8G 3T1HQ 4LFBQ 5GADC 4PZ7A
chains in the Genus database with same CATH superfamily
2PI2A 2E2JB 1G2SA 4OO1H 1JOKA 2NZ1D 4DUYQ 3M4QA 5IP7G 1SNOA 3F2DA 2EXZA 1UE1A 2SEBD 1VQ4A 1IZ6A 5G3LD 1HUNA 4JI8Q 3SK6A 2KCMA 2WFWA 4Q0FA 3ULLA 2ZTCA 3KF8B 2EOTA 1VMPA 3G7LA 4DGZA 3AB9A 5C4HA 4IJLA 4A93G 5EKIA 3VR6A 5IP7H 2PNHA 3A7AB 1X32A 3NQIA 4DF7A 4P75A 3DWPA 4YHHL 3K80C 2MJ8A 2NYZD 1VQOA 1YJ9A 2WACA 4NKLA 4JI6L 4BS9A 1SMYC 4ZRZA 3F8TA 5ELCA 4DV1Q 2N88A 3GP7A 1WFQA 4BY1G 1UE6A 4YHHQ 4CDCC 3H6MA 2G5DA 5A35A 2A6HC 1RF2D 2VB2X 2JA9A 4LF7L 4X65L 5IGEA 4IFDJ 1YNNC 2LXKA 1A3UA 4A3MB 4KTAA 4LF5L 2EVBA 1UEBA 1QUQB 1V9PA 1O7IA 2L4NA 2FINB 4B3MQ 2RHSB 3I4MH 4UP9A 3HOVH 4C3HH 4B3SQ 5CV9A 3U4VA 1NNXA 3E0JA 4DV5L 1K3BC 3SHLA 4PMBA 2MQHA 4X66Q 1WTHA 4POGA 1RHPA 4FNFA 5EPLA 4JYAL 2K5QA 1RD9D 1PXUA 2B3GA 4A3DG 1YBYA 3CAMA 5L37A 3HOVG 3MFGA 3UE1A 1S5ED 2J0TD 5IT9L 2BH2A 1RCVD 2JJQA 5JVG3 3HKSA 2YU9H 1B44D 4QQBX 5CBAE 1YNXA 1Z47A 1KC8C 2CW0C 1CQVA 3P7JA 1PMRA 1T5EA 4PG3A 1D5ZC 2WKDA 1JE5A 1GHKA 2B2UC 1FNVA 4Y52H 2QEXA 1O80A 2HHHL 1TWFB 4IURA 2HQEA 1EIHA 3BZDB 1PHJA 4A93H 5AJ3Q 4FO2A 1E3PA 3OYYA 3FVQA 3D6WA 3BVZA 1HZ9A 4LF8Q 1BBXC 1QNKA 3QOJA 1HNZQ 4GOPA 1TWCH 3RNUA 1VQCA 1SE2A 3UDFA 1SJED 1E2ZA 1R9TH 1HR0W 1M4VA 1TWCB 2HDLA 4FF1A 3NTIA 4XT1B 1IBLL 1PH1A 3VDYA 3OPOA 1L0YB 5I2YA 2HT1A 3MXPA 2LSSA 1EQVA 3J7AF 1SYFA 1H9MA 2E2DC 1GXDC 1QJOA 2HDMA 4JYAQ 3K0XA 4POFA 4CDEC 5J3BA 2YTYA 1HFNA 3E3XA 4AYBE 1MGSA 2V1CC 1TS4A 2PMZB 1GUWA 2VQFQ 4WJ4A 4DV4L 2J4XA 4YCVA 4A3IG 3NHHA 2UXCQ 1CM9A 3E5SA 3FEWX 5C44H 4GNXA 2BDOA 2F0QA 3PO2G 1B7YB 4Y7NB 4UDUC 1ICWA 1RTOA 3GTKH 3GTLB 2IJ0A 1N9WA 1W2BA 1C9OA 2PYKA 1P16A 3GTOH 1K0RA 3FP9A 3PUXA 3S1QB 3SR1A 1M8AA 3ZJYC 1PRTC 3J81j 1IBKL 1VQ8A 1SR3A 1G291 2NVYB 3QOLA 3BJUA 4WJ3M 2C5CA 4U68A 1E24A 2R3ZA 1JWSD 2HQLA 3PO2H 3FMCA 1QWYA 2B63B 1CUKA 2E2HB 3PF4A 1KNAA 1GHJA 2PW7A 4BY7H 3HOYB 1PRTB 2JA7G 4PQXA 5H1SE 3TS2A 1BXTA 3HOYH 2CFMA 5EPJA 1WD1A 1VQKA 4J6HA 1STAA 1HNZL 2E75C 5I6YA 1XPOA 5IE8A 1F9PA 4X6AH 2QKIC 4JI8L 3ITPA 1XNRQ 3NENA 4JCVE 3L2PA 3J80c 3OMGA 1SN8A 3PSIA 1QVFA 3GTOB 1VQMA 2A6ED 1LACA 1I4QA 2JYOA 2PMZE 3MXUA 5FLMH 3CCVA 1IL8A 2G9DA 2K33A 1RODA 3NUCA 4F7XA 4A3CG 2R92H 5E4XA 4GKKQ 5FJ8G 1TWGH 5D65A 4A3IH 3RLFA 2Z8LA 2B2YC 1NMGA 4R1JA 3S15B 2FXQA 3KF6A 1E2VA 4JOIA 5ISRA 5LL6X 3U58A 2YV5A 4K2KA 1WTQA 4GKKL 4A3GB 2TSSA 5C44G 2E2IB 2VL6A 1MIUA 4RHSA 3GTMB 1ILQA 3HOZB 1A2UA 5C3EB 4U673 1JJCB 4B3SL 3HOZH 1HXYD 3D4RA 1JICA 2F0HA 4TVAB 4ZYSA 1AH9A 2NBFA 3TRZA 2KA7A 4LAAA 4QB4A 4QCLA 2R92B 4AQYL 1AN8A 4OWTB 3HRZC 4IZ8A 1K0SA 1OO9B 3UDIA 2WKCA 4LFCQ 4DK3C 1Y1VH 5IYCH 4HN7A 5EQ0A 3P20A 1RL2A 1PH3A 4UP7A 2HCIA 3NBIA 3GTJB 2KCTA 4C3JG 1DOKA 4DU9A 5KNDA 2AWOA 3A74A 2WB1G 1O7YA 3KJOA 2VB3X 3KLSX 1GUTA 1JE4A 1SXTA 3AYHB 2F0JA 1EOVA 2ZTEA 5G3LF 1LTID 1MD2D 1PYSB 3G71A 4NB3A 2JA6B 1EQTA 2OCEA 2WINB 2F0SA 3RZOB 1UNSA 3NEMA 3OMCA 3NTKA 4JI3Q 3SK4A 2AUKA 2EQSA 2ZJQA 1ENFA 4OIKA 1UE5A 3PUZA 2UXCL 3A7LA 1OXSC 1PTOD 4HIDA 1VQHA 2VQFL 2ZXPA 5IP9H 1TY2A 1EWHA 4OHJA 4DUYL 5C4XG 1HQMC 4DR3L 2Y0SG 2X6GA 1PVOA 1JORA 4JBMA 3SDZA 4IFDG 1A3TA 1X3GA 3VA5A 5IT9E 2BA0A 2HUGA 5FK9C 4DAPA 3H15A 3STBD 1ZEQX 4R4OA 1NBWA 3HS0C 2I5HA 2IL8A 2MHVA 2CKZB 4QF4A 5I9OA 1CK1A 1F2ZA 3CC4A 2A73B 4RGMA 2DY7A 1XMQL 1SNMA 5DNFA 4C1NI 1EY4A 3HOWH 1OXXK 4JI4Q 5IYBG 3RZDH 1I4PA 2YTXA 2XTIA 4FYDA 3RZDB 3SK8A 3AEVA 3GTPH 4A3CH 2F4VL 5EKKA 2WAQB 4A3MG 2D2CC 4F87A 1F9QA 1U0LA 2FJ2A 3I2ZA 4A4IA 3TP7A 3V96A 2A68D 3D6CA 2PQEA 3G6JB 2PO4A 5AJ3L 1MHWC 2F4VQ 4ALPA 1HCZA 5CV5A 3FPUB 1SFOB 1J9OA 2NN6G 3A56A 4C3IH 1B3AA 3BZKA 1LTRD 4XQNA 3MXNA 1Y8NB 3L9AX 4YCUA 5FLMG 1TQOA 2A5HA 2RA4A 4R4TA 4X64Q 4GLAC 4HTHA 2EJMA 3PO3B 4DAVA 5KEEA 4RG1A 1ESFA 3C3LA 1ZYRC 2ES2A 4BXXH 1I6HB 2D62A 1KDCA 3EA6A 4KHZA 4NDXA 1YEZA 1ZYRD 1E7ZA 2D5DA 1CSQA 3JAML 3JAMi 5FO9B 1Q7YC 3NBHB 2BE5C 5D14A 3K6OA 3TP6A 1L0XB 2FFKB 3H91A 3K7AB 1O7LA 2F0WA 1QB5D 3CCQA 4NXNQ 2K52A 4A3FG 4DR4L 1CKMA 3M85A 2RDGA 1FNWA 4C3IB 4C3JH 4JI3L 2RHQB 4F88A 2B2WC 3M4OB 4ZUJA 5K5PA 3QG1A 4OL7A 3M4OH 4HSPA 4MIUA 5CV6A 3EFXD 4KN4C 2ENBA 4CDDC 3CP0A 1RJTA 2PW5A 3PCOB 2E5LL 2MFIA 4ULLA 3FHWA 1EFWA 1TKWB 4IO9A 4KMUC 1T5XD 5JEAH 1LT5D 4FXKC 1EYDA 5FLXE 4DK6C 4DR2L 1D7QA 1BKBA 1YJNA 1FVIA 5KYIA 1TWAB 4A3JH 1TS5A 4HJAA 3KFUA 1KNEA 4N9PA 4DV6Q 2EE1A 1B4OA 4BBSH 1CA5A 1H9RA 2B2YA 3NK9A 4A3JB 1FGUA 4DN4M 3I91A 4DV7L 1S5CD 3K0YA 3QO2A 5I6WA 4YY3L 1GUGA 4UY8C 1HNWL 1G91A 2KCCA 4YIJA 4L5QA 2M9VA 1C0AA 2KOLA 5EJWA 4G7HC 4KN7C 1EY0A 2HHHQ 1EU4A 1C7YA 4FF2A 4N9TA 5TSSA 2Z4HA 1U4PA 4IPGA 3R2TA 1SYEA 5IWAL 3HOXG 1S40A 3GD7A 2AUJD 2B2VA 2Z6KC 3I4MB 3CQZH 3K58A 3LNNA 2ZJPA 4R4IA 1G8ZD 1BDOA 2K28A 3GQBA 4LFAQ 1B50A 2VQEL 1LYLA 4EQOA 3OOCA 4ME3A 2ZTDA 3T56B 2F0DA 2IY5B 1VCIA 3M9BA 3ONAB 3K5NA 2UUBQ 1EOTA 3CPWA 4DNRB 4LF6L 3MHBA 4S3SA 3CF5A 2PCFB 2UUCL 2YU9B 1UEAB 4NXML 4DV5Q 5COYA 3CC2A 4XQJA 1PFNA 1FL0A 4A3BG 4IJHA 5GAEC 3FRPB 1DGSA 2K5VA 5DEHA 1EQQA 2F0LA 3QIAA 1KAAA 1SNPA 1I4RA 2BH8A 2KHIA 3RD4A 4O42A 4LF5Q 3UDGA 2CVRA 2F52A 4CGYB 1WTWA 4J8QA 3H0GG 5AFWA 4DFAA 2WP8J 3GTQH 3SE0A 3HOUB 1G2TA 2MNAA 3LWEA 4AYBG 4DV0L 1YHBA 2CW0D 3HOUH 4PV1C 1CSPA 1DONA 2QW7A 2IHFA 1PH2A 3GTLH 2K4KA 3TZDA 4WRDA 1Y69U 1G6ZA 4ZK9B 4O2DA 3BZCA 4C3HG 5C5MA 4CJ0B 4C2MB 2B29A 1EEID 1OXVA 2CQOA 2EYHA 4A3EG 1EYAA 2VUMB 3GO5A 3QR8A 1GOZA 1Q8KA 1B53A 3J81c 3J7YW 3K57A 3L7ZC 1K8OA 1EY8A 4GLXA 3OSOA 1YI2A 1BOSA 1QILA 3FKIH 2V4DA 3DXJC 4MHEA 1N34L 3PUVA 4H44C 4JI7L 3CHBD 3S15H 4DV4Q 4MTNA 1HA5A 4DR6L 1S4ZA 3HEJA 3CKIB 2Q2IA 4O1NA 4FXGC 1V1PB 1NR4A 2JK8A 1SDFA 1PFBA 2A6HD 2R61A 1I50B 3TN2A 3RN2A 3HOXH 1VQDA 3VYSA 2EJGC 3F1ZA 3OHXC 5NUCA 5C6AA 3VYUA 4JBKA 1XWEA 2F0VA 1A3VA 3B6YA 1Y8OB 2Z1CA 2K32A 4BWGB 2L5TA 1IBLQ 2XRSD 1JJGA 4UAIA 2QGQA 4DXGA 3ERSX 3HG9A 3G6EA 4GNXB 4BBRH 3I8ZA 3T1YQ 3FKIB 5KRUA 1H9SB 4QUFA 2UXBL 3JAMc 5J39A 1NR2A 2SNSA 4HMIA 3F2CA 1N36Q 1VMCA 2BA1A 2H4OA 4A3GH 2I0QA 4LF8L 5LMNQ 3L0OA 5LMUQ 2CHBD 1IKLA 3D31A 2Q8IB 2NVQH 3SVMA 1QG7A 2X69A 3A5ZB 2OT2A 1L1OC 3E6ZX 2E74C 1HTLD 3EQLC 1D5XC 5I2XA 3QWNA 1R4QB 4X62Q 4BA2I 3S14B 3V05A 1D1KA 4RKLA 4IOAA 4A93B 1V8QA 4ZLTF 3KLSA 3OWFA 4A3BH 2C35B 1VQ6A 1CFMA 1JOOA 2R6GA 3NELA 4IUVA 2EY1A 2D0OA 1CHQD 5IT9c 1LABA 3I4NG 2K5DA 1SJHD 5IODA 4O0AA 1B8AA 4X66L 2K05A 3C1FA 2O5IC 3BVGA 3S1MH 5DAUA 1V1OA 5IYDG 1C8CA 4LF9L 3VYTA 4JI1Q 4XT3B 4DR1L 4XTCS 1DD2A 3CC7A 2L55A 4BXXG 2N49A 2K5WA 3AU7A 4B3ML 3LX0A 2QDLA 5ELOA 4LUZA 2B2TC 3RZOH 1H95A 4DV3Q 1RIPA 4WJWA 3KK7A 1I94Q 4HIOA 4OWXB 3HOWB 1WCMB 4LF7Q 4HJ7A 1NMFA 4K5XA 5JJZA 1X3PA 5M3MG 3KYHC 5FO8B 3RMHA 1HRJA 2OQ0A 1Y1WG 1N32L 2KCNA 4A3KH 3X3NA 3HFZB 1TS2A 4H13C 3U9OA 1B2TA 2BE5D 1HR0L 4LMQD 1B1ZA 3GTKB 1ENAA 1ZKOA 3I56A 3OTOQ 3KLRA 2UU9Q 3Q8DA 1D1IA 4JI5L 4I7ZC 1BBUA 4EQ5A 2XIWA 4JVZA 2R93B 4OIJA 1K8AC 3KBGA 4WFN3 1Y1VG 2NVYH 3I73A 4L6TB 1E1OA 1K83B 2B63G 2P5ZX 1FJGQ 3S2DH 2EPBA 3EBEA 2JQOA 1JJ2A 2UUAQ 2F0EA 4H7BA 2K5HA 5J1ZA 2E2HH 1SSOA 2A68C 2VY3A 3GTPB 3MEFA 3BYYB 3KDFB 2N55A 3N6RA 1PYWD 3CU7A 4KY6A 1N8RC 4XQQA 2F0PA 1IW7C 3K8AA 1HTPA 1U5KA 2Z4IA 1J5EL 4PZ6A 4BBRG 2K14A 3U4ZA 1PZKD 5ELEA 3K81C 2DGYA 2EDGA 3R8BA 4QIWB 5DLQE 3CXCA 3P1HA 4JBJA 3CMEA 2OTJA 3I70A 1K3RA 1WVLA 1NE3A 4MTKA 4LNQA 5E4WC 4C3JB 2SNMA 1GVPA 4JK1C 1IBML 2IW3A 3I7FA 2PZWA 5F2DA 1LTSD 4UP8A 3STBC 2O5JC 1HZBA 3T51B 5C0XJ 1JC7A 4JI5Q 1VDZA 3EVQA 1DCZA 3NSWA 2UU9L 1KLGD 3JC66 3OTOL 1K83H 4BA1I 4RMFA 4LK1C 1PH6A 3NXWA 2JEBI 2NZOA 3HOVB 2VZAA 4BY7G 4GKJL 3CCJA 1SROA 5FLXc 3VYRA 3DWQA 4J15A 4R4QA 5IYDH 2QCPX 4KHVA 3OIQA 5LHY1 3CW2C 1K8GA 1IYVA 1CZWA 1PTOC 2XGTA 1BCPB 1O78A 1TY0A 1EYCA 3M4YA 2NB0A 3HOZG 4YWMA 1PH5A 4BBSB 3PUWA 2KEDA 2AQ3B 4XDXA 1I4XA 5IYBH 1Q8IA 5IY0A 2F03A 4X3UA 5JPMC 1IXRA 5K36G 3ULJA 5KYLA 4A76A 4JPBW 4NPSA 3RR5A 5E3FA 3PIP3 2AQ2B 2R7ZG 3Q24A 2UXDQ 3J81E 1T9HA 3S17B 1VF5C 1TWHH 1Q1EA 4JI1L 1YNJD 3Q23A 3G48A 3CRLC 2CQAA 3D8GA 1VQ5A 2F0UA 2KQ3A 2PZTA 5EBDA 5CYUA 4DR7Q 2JA5G 5M5YB 4K8IA 5FOBB 4UHVA 1TWAH 3M7GA 3E9IA 1O7ZA 2TMPA 2JA8G 1KLUD 1XNQL 1LTAD 3K5OA 3I3CA 4X62L 3PIPA 1F2MA 4CDFC 3M7NA 3E9HA 5JJIA 1E2WA 1ENCA 1J8IA 2KHSA 1WCMG 5EKLA 1IW7D 1AE3A 4A3EH 2OEOA 5LL6S 5IP9G 5M3MB 1AEXA 1ASYA 5M3FG 5HY6A 5M3MH 1FGBD 1QVCA 1EYGA 4LF4L 3VR3A 2MP1A 3W3AA 4IQZA 4V190 1W6KA 4RAUC 4X3SA 5KGUA 1JOQA 3J80i 2N3SA 3HGBA 2NVXH 1DM0B 2NUCA 3ULPA 2MPMA 1VQEA 3PGZA 5M5YH 2IPKD 3T1YL 3I4OA 5E7NA 4P73A 1TVXA 2JE6I 4IOCA 1XYIA 5KNBA 2Q2TA 1L2FA 1B9MA 3MEHA 2QF7A 3SK5A 5IGGA 4BY1B 1K8MA 2A6EC 4DUZL 2Z6BA 1X55A 1LT3D 3KF6B 4EX5A 2RF4A 2ATWA 1SNCA 2NVTB 1VS0A 3U9SA 5KNCA 3CD6A 2DN8A 4P74A 4DR5Q 1HJPA 2B8FA 3TSSA 1EQRA 3T1HL 1QE6A 1GKHA 2B63H 2JEAI 1WJJA 3A8JE 3SXHA 4CKBA 2UUAL 2LS01 5HGQA 1EIGA 2F0NA 3D4DA 3ZYYX 3KLWA 4K8JA 4NP5A 2E8GA 4ZKBB 1I4GA 2I5MX 1LTTD 3BU2A 4KHPL 2CH4W 3S1RB 4Y7NH 4GZYC 4HEDA 3HKZE 5JOBA 3Q6SA 1PRTD 5IOCA 1V1PA 1MI2A 3W1GA 1F9SA 4RCNA 4FP5D 1JWMD 2RDHA 1ICFB 2K03A 3PQIA 1XPUA 3NP8A 3SGIA 3NTHA 2F0OA 5E1FA 2EY6A 1C4QA 5BN3A 2EYPA 3W1BA 2R7FA 2EYOA 5BR8Q 1CI3M 2KHJA 4R8IA 3CCLA 2Y0SB 3O13A 2RSOA 1EFID 2XNAC 3I4NH 3G4SA 1JWUD 2L12A 1OTCA 2MO1A 2E2JH 2YTVA 1F2LA 1BCPC 3TQYA 4K0KQ 3HKZG 4C56C 1AZPA 2K6AA 2R92G 2NVQB 3S1RH 4DNIA 5EBCA 4CKEA 2HCCA 1A0IA 2ZM6Q 3DM1A 1PYBA 1YHQA 4LF9Q 2CWPA 5JPNC 4OX9Q 4FF3A 3D0FA 2R7DA 2UUBL 4KHPQ 4L63B 1A8VA 2JA5B 4MNOA 4JI0L 4YWKA 1Z9FA 5M5WB 2RVLA 4KKSA 2A8VA 2FMCA 2VQEQ 2JA8B 4ZAIA 2Q8TA 1KXLA 3FPPA 3J81L 3K7UC 1S5BD 3MVVA 4X3TA 5FLXL 1DOLA 1GD7A 2JA6G 2AWNA 1WTPA 1Z6HA 4FDBA 3W5OA 1SNDA 2F0IA 2JA7H 1AE2A 4CJ2C 1SYDA 4R4CA 2H1EA 1KRTA 1ESRA 4X3KA 2OF1A 3T4AC 2X6LA 1KRSA 4AYBB 4JI2L 3GTMH 1EY5A 3VA7A 2Y0SE 2OQKA 1PRTF 1IKMA 3PO3G 3HOXB 2L9HA 2RSNA 4JV5Q 1YHAA 4EVOA 3NE5B 2LKVA 1X65A 4K5WA 2Z9HA 4C3HB 4OX9L 2EY2A 1NTGA 4IALA 2JSOA 1B3QA 4DK0A 5EAYA 2K5NA 1Q86C 2M2LA 1JT8A 1UWVA 1Y1VB 2JP1A 1A6XA 2DNEA 1EL0A 3DLLA 1CHPD 4HCSA 3I72A 5LMNW 3HOYG 1SYBA 3S1NB 1JMCA 1VQFA 4OO1I 4XYQA 1UE7A 3SEBA 1YJWA 2OTLA 2G9HD 1CT1D 1KDBA 1LM0A 1E0BA 1EIFA 4AIMA 2QILA 3EJIA 4QL5A 1AW7A 4P2CB 2R93H 2EYLA 4IFDI 1U9RA 4B3TL 1GUSA 3LWUA 1LT6D 4HJ9A 4A3DB 3KDFA 1V1QA 4DPGA 1E1TA 1W6JA 3PUYA 3TDQA 4A3DH 2EY5A 3VR4A 1MKHA 2DY8A 2NTTA 2F0MA 3HZXA 1VF7A 2RDFA 2EZVA 4KD3A 3BYTB 2ZJRA 1STBA 1EU3A 4ZUIA 3VR2A 3GTGH 3MAQA 2B39A 3DM3A 4HIKA 3MZ5A 3J7ZC 2C9OA 1STHA 3GTGB 1HQRD 3CPFA 3S2HH 1VQ7A 1SEBD 5CORA 4B3TQ 1X3FA 2K75A 5ELBA 1EUJA 3H94A 1X56A 2SDFA 3BDOA 2KENA 4ODGA 1S5DD 3KUPA 2E76C 3UDXA 1GM5A 2B2WA 3I4MG 1LV9A 4DUZQ 4L8JA 4DKAC 4A3FB 3T16A 4EQNA 2LMCB 4RHRA 3EROA 5LMNL 4GN5A 3HKZB 3KOJA 2XWBB 4TKOB 5M9OA 4OELB 5C4JB 1SRUA 3IFTA 5GQOA 2UXBQ 1H9SA 5IGCA 2JN4A 4NXMQ 2XVSA 5C4XH 3DMUA 2EYMA 1GO3E 1LTLA 2I07B 1XMQQ 2IHEA 2KVMA 3ER0A 3AQQA 4JV5L 2OWOA 3LGJA 2QDBA 1U4MA 5D3DA 1LTBD 2RKSA 4LF4Q 2B2TA 4AH6A 5I9PA 1GUNA 1MJCA 3P75A 1I6HH 1HA6A 3PO2B 1F77A 5ELDA 1SMXA 4DK1A 4K14A 2WIIB 3BS1A 4CJ1B 3PMFA 3CCEA 1WYDA 3I4LA 3DEOA 1WOCA 2IX1A 4GLVB 1PLFA 1XNQQ 5IIFA 4PZ8A 5GAHC 4JI7Q 1HFGA 5JJKA 2D9UA 3CCUA 1TR5A 1WD0A 4K6LA 1BVSA 5T1GA 1LTGD 2Z0SA 2ZXOA 3NQTA 4LJZC 1KQSA 4V0BA 2F3WA 1VQNA 4DAYA 1KD1C 1K9MC 3BDLA 4A3EB 1D5MC 1TWHB 2B2VC 5K36H 4DV2Q 5DM63 5CGKA 5JEAJ 1CA6A 2LY7A 2WV6D 1PZJD 3S24A 1TWGB 4QY7A 1DZ1A 1XTDA 1XXGA 1JCKB 4P71A 2Z6KA 2BOSA 4K2LA 3AFPA 4QMGA 4IUPA 1ILPA 4G57A 1I6VC 5T1IA 4ILWA 2B2UA 4ZKCB 1LO5D 4IUNA 3CCMA 3L3OC 3NPPA 4P72A 5DM73 4KLKA 1PTOH 1X9NA 2WAQE 2PPBC 1G51A 1ET9A 1AFPA 3MXGA 1DOMA 2N8NA 3R3OA 3M3YH 2F0KA 1KDAA 4HJ8A 1S72A 1YNND 3H0GB 4YWLA 2L15A 4DV2L 4GKJQ 2L1BA 5C0XH 4Q5VA 3TP8A 3PF5A 1AP0A 2ZT9C 3OIPA 2VUMG 1WTVA 1Y8PB 1SYCA 1WCMH 3RUZA 1KABA 1QNUA 1I3QB 2LXJA 2RQXA 2WB1E 1SAPA 5CMDA 5KIXA 5CV7A 2NWGA 2K50A 1D2BA 3D4WA 5C3EG 1XPRA 1RTNA 1IL2A 3MWYW 4KKTA 3H3VI 3TREA 4LUOA 4LFAL 3URYA 2F0TA 1Y14B 4FVMA 3IRBA 3T1HQ 4N8FA 2K01A 1F9RA 4JBWA 1Q81C 3DHQA 1BO0A 4I65A 1JB7A 2DJFC 4HIMA 1X3QA 5HGTA 1EIYB 3VR5A 3H0GH 4K5VA 4IFDH 4APVA 4DA2A 1XNRL 4B9WA 3NBHA 2HIXA 5LMUL 4YY3Q 1KAWA 5FJ8H 4DV7Q 1STNA 2XSCA 2RCFA 2CH4A 4RH6A 1VQPA 4GS3A 4R8NA 5C5LA 5JVH3 3MC0B 2J7ZA 4DV6L 1LUZA 1HR0Q 2ZM6L 4JI4L 4IPHA 3I4NB 4I7AA 2NVXB 3U50C 3H3VC 2GA4B 1WTRA 2N78A 3V2TA 2EIFA 4JG2A 1I5FA 3R93A 5IGDA 1SFOH 1KTKA 2WB1B 5C44B 1WI5A 1PH4A 4IPDA 1U4LA 1PH8A 1FNUA 1A15A 4C2MH 2A69D 3OW2A 1Q46A 4N8X1 1K28A 1Q1BA 3CRKC 5BR8L 3S1QH 3WOEA 2O4XA 4QJFA 4DR3Q 3F2UA 2K7VA 1NCVA 2EJFC 5M3FB 3TMEA 1E22A 4CKCA 1S5FD 1NSNS 2BDNA 1RKNA 4NXNL 5IYCG 3S16H 5M3FH 1Y1WB 3NWTA 1VQBA 3DUZA 3S16B 1CKOA 1LT4D 4XIGS 1Y1WH 1EWIA 1AZQA 3D3RA 3A5UA 2JA7B 2B8GA 4KJOA 3K7AH 1U4RA 4OO1G 1A63A 2H5XA 3TS0A 2F0GA 4JW0A 5I4DA 2DJGC 2VW9A 1YIJA 4CBVA 2UXDL 3I55A 2GVBA 3J80L 2PQAB 3QJYA 1CTMA 4HAEA 3OW7A 4DR5L 1STEA 2JA5H 4A3MH 1SYGA 2BCOA 1BQQT 1II3A 4X64L 1V43A 1TWFH 1GJXA 1BNZA 3MXNB 1I4HA 4RA8A 4TSSA 4RGTA 5M5WH 1SE3A 3S14H 2DNCA 1HH2P 2I5LX 5EGTA 2KEEA 3TZUA 3F2BA 4A3BB 1G6PA 4HJ5A 4A3IB 5FKAC 1L1OA 3IFDA 1BBWA 1C48A 1HZCA 1QCBD 2A19A 2ALYB 4RKBA 1FYCA 4TQUS 1R9TB 4A3LH 1STGA 2GN5A 2QA4A 3S1NH 3PIO3 1TU2B 1HPCA 2EYFA 3BVMA 2XN9C 1TIID 1X6OA 1H9JA 1L0WA 1Q90A 2EXDA 2DUDA 4H0LC 1SE8A 2E2IH 1B9NA 3CCSA 4ZQ3A 2R93G 5M5XH 5JAVA 1X3EA 3KF8A 1XTCD 1IBMQ 1JB3A 3A0JA 4QGUA 4KKUA 1SMYD 1Q12A 3J7A5 3X3MA 4FXDA 3JAME 4FF4A 2FHTA 3KJPA 4JI2Q 1H9KA 2VXWA 2KJXA 1STYA 3A54A 1EWCA 2JA8H 5J22A 2IX0A 1CQFA 1M1KC 1PH9A 4RGNA 1VQIA 2L0CA 4G7OC 2PQAA 4A3KB 2NN6H 3S1MB 1IYJB 3GTJH 2KUMA 3DWAA 4IUUA 1KHIA 3M4PA 2RCNA 1EY7A 1M90C 1N34Q 1PV4A 1FJGL 3R2IA 4BY1H 4C3IG 4MZ9A 5JJLA 4G4KA 1PDQA 2ICIA 2KECA 4JI0Q 5CC4A 2SOBA 1K73C 1SNQA 2PZUA 3IL8A 1DYQA 5C0XI 4MN3A 4X65Q 5M5XB 3A8IE 3OWEB 2O2LD 4ZCKA 2JA6H 2NVTH 1JQYD 4JOIC 1SE4A 4BY7B 3A8KE 3CQZB 2Q2UA 1S3OA 3FDTA 4DR2Q 1VQJA 2GVAA 1EY6A 4DV1L 4K0KL 4C1NK 1UUPA 2EYJA 3H3VH 3EIVA 1PFMA 5C0XG 3GTQB 3UE0A 4A3GG 5ELFA 1QVGA 2L11A 2E5LQ 2F1MA 1L1OB 4WORA 2F3IA 4B08A 4ME5A 3TP5A 1GUOA 3FKIG 4IUTA 5C4XB 4IUQA 1IBKQ 3K59A 1P8LA 1PZID 2MGSA 5C3XA 3BDCA 2Q8RE 1I94L 1CZGA 3N52A 4NMZA 2ZXRA 4KD4A 1Q82C 2AMCB 3HP3A 1LLRD 2IWHA 5IGFA 1CKNB 2R7ZB 4GN3B 2CWAA 1Z7TA 4DR4Q 4KV6A 4Z9CB 1VQ9A 1FR3A 4DR1Q 2R7ZH 1VQAA 1RDPD 5ELNA 3J81i 5HURA 2UUCQ 1A2TA 2ICEC 1WTXA 2XRQD 1J6QA 1ML0D 4YCWA 1IHZA 3NWSA 1YNJC 3A55A 2M00A 3H09A 4IN3A 5IGBA 4OEMB 5A2QL 4L5RC 3E0EA 1KL9A 5GROA 3K5MA 4B9XA 4OWWB 4ID6A 3MA2B 1N33L 1IYUA 1MSHA 4DAMA 1FD7D 1BCPD 4EGVA 5C3EH 1TXYA 1SLJA 5CV4A 3C1EA 1J5EQ 1HNXL 1BF4A 1DJRD 1I50H 2MO0A 3AFQA 4RWSC 4UPAA 4L5TA 1HZAA 3MFYA 4HR7B 5CV8A 5GAGC 5IWAQ 1DXMA 2VUMH 3RN5A 2LFNA 1B70B 4ABNA 3Q22A 4HCEA 1EZ8A 2A74C 4OGQC 4GN4B 2F3VA 4RFBA 3Q0AA 1SBBB 3RLNA 1NJIC 1HNWQ 3DEPA 5BN4A 4QUCA 5C3WA 4E6IA 4A3LG 3HOWG 1UAPA 2PI2E 2YYZA 4OXPA 3HOUG 2VS1A 2PNRC 1QZHA 1X54A 4CHTB 2AKWB 1PA6A 3ERQA 5C4JH 2I46A 1BR9A 2F4IA 1NUCA 4M1UB 2JXMB 4JC0A 4NW2A 3IAYA 1QZGA 1WTOA 4LW1A 1EEFD 4PMWA 1ASZA 1N32Q 3J7AV 4PMCA 3WWVA 5C4ZA 3GV3A 4GOPB 1HUMA 4EQPA 1MJEA 3C46A 2IX3A 4KJNA 1TS3A 3TBIB 3S17H 3AMUA 1XMOQ 1D8LA 3CCRA 1I3QH 2VNUD 3I90A 1HHVA 1A62A 2WAQG 4DV3L 4L5SA 2D0PA 2A1AA 4BBRB 4GOPC 4A3KG 4M8AA 4HMJA 3J80E 3ND8A 1PFSA 4DR6Q 1XX8A 4R9WA 1ZXTA 2F0FA 3RLOA 5BN5A 1KIXA 1EZ6A 3WDNA 1QOHA 1EY9A 2FMMA 4KY5A 4DNTB 2HD3A 4DR7L 1OXUA 3PV0A 3CMAA 2AQ1B 1XMOL 4A75A 3M3YB 3WOFA 4LWCA 2QEJC 2CCZA 5FO7B 2OXPA 4A3JG 3QB3A 2NTSA 5EPKA 4QIWE 4IPCA 1YITA 3ICEA 2AHOB 4JI6Q 1F2YA 2XWJB 3KBXA 5D3IB 3GDEA 3K5LA 5CBEE 1JR0D 4KY7A 3T13A 1OXTA 4DV0Q 4LFCL 4F8MA 2K04A 3S9WA 4GNXC 4DAYB 1PTOF 3C2PA 4AQYQ 1TT2A 2NZHA 3MTSA 3W2DA 4HSVA 4OONA 2NN6I 2RBMA 4KK7A 3ND9A 3TEHB 2HIVA 1VQLA 1N36L 3S2HB 4TRDA 2ASBA 1YVCA 1ONLA 1PH7A 1Q3LA 2ID0A 4DXFA 4J1MA 3PO3H 2A69C 1PTOB 4PNYA 1BUVT 1BCPF 1W3SA 4BBSG 4RGOS 3BG3A 4LUVA 2Q2HA 3T53B 5JEAG 4H02A 4LFBL 4LF6Q 4RCOA 2K1BA 4XXEA 3EN2A 1XJVA 4KI0A 1HNXQ 1MBYA 2MUYA 4B3RL 3S2DB 5CR3A 4A3FH 1D6EC 1MSGA 1N33Q 2KBNA 1R4PB 2IT1A 4K6DA 3PIOA 1NAPA 1NY4A 1QUQA 1ET6A 4G7ZC 1CKNA 1VQGA 5A2QE 3GV6A 3IKJA 4B3RQ 4XYOA 3UI2A 1YZ6A 4LFBQ 5GADC 4PZ7A
chains in the Genus database with same CATH topology
2PI2A 1XNQL 4JBWA 3CCQA 4NXNQ 2K52A 1Q81C 4DUYQ 3M4QA 5IP7G 4A3FG 4X62L 3PIPA 4DR4L 1CKMA 3M85A 3F2DA 3M7NA 3E9HA 4C3JH 5JJIA 1UE1A 4JI3L 1WCMG 2RHQB 1JB7A 1AE3A 4HIMA 1EIYB 1VQ4A 1IZ6A 3H0GH 4JI8Q 4A3EH 5IP9G 3M4OH 4APVA 2KCMA 2WFWA 3ULLA 1ASYA 2ZTCA 5M3FG 1XNRL 2HIXA 3KF8B 5LMUL 5HY6A 3CP0A 5M3MH 1QVCA 1EYGA 4YY3Q 1KAWA 4LF4L 3PCOB 5FJ8H 4DV7Q 4IJLA 2E5LL 2MFIA 4A93G 5IP7H 3FHWA 1EFWA 2PNHA 4IO9A 1VQPA 4GS3A 3J80i 2N3SA 2NVXH 4DV6L 4P75A 4YHHL 1LUZA 3K80C 3ULPA 1VQOA 1HR0Q 1VQEA 2ZM6L 1YJ9A 4DR2L 4DK6C 4JI4L 3PGZA 4IPHA 5M5YH 4JI6L 1D7QA 1BKBA 3F8TA 3U50C 4DV1Q 1FVIA 3T1YL 3I4OA 1YJNA 1WFQA 4A3JH 4BY1G 4HJAA 3KFUA 1UE6A 4YHHQ 4DV6Q 5E7NA 2N78A 4BBSH 2EIFA 4JG2A 1I5FA 1SFOH 4P73A 1FGUA 2JE6I 4IOCA 1WI5A 1PH4A 4IPDA 2JA9A 4DV7L 1PH8A 1L2FA 2Q2TA 4LF7L 4YY3L 4UY8C 4X65L 4DUZL 1HNWL 4IFDJ 4L5QA 1X55A 2LXKA 1C0AA 4C2MH 3OW2A 1Q46A 1Q1BA 5BR8L 4LF5L 3S1QH 3KF6B 1UEBA 1QUQB 2RF4A 4EX5A 2ATWA 1V9PA 2HHHQ 1C7YA 1O7IA 4QJFA 4B3MQ 4IPGA 2RHSB 3I4MH 1VS0A 4UP9A 3HOVH 5IWAL 4DR3Q 4C3HH 3HOXG 3CD6A 1S40A 3GD7A 4B3SQ 3U4VA 2Z6KC 4P74A 3CQZH 1E22A 4DV5L 4DR5Q 1HJPA 3T1HL 1EQRA 2JEAI 1GKHA 2MQHA 4NXNL 1WJJA 5IYCG 2B63H 5M3FH 3S16H 4X66Q 2UUAL 4POGA 2ZJPA 4R4IA 5HGQA 1VQBA 1CKOA 3KLWA 4XIGS 1Y1WH 1EWIA 2E8GA 4JYAL 4LFAQ 3A5UA 2B3GA 2VQEL 1LYLA 2I5MX 3K7AH 4A3DG 1YBYA 3CAMA 3HOVG 3BU2A 3UE1A 4KHPL 4OO1G 1A63A 2H5XA 2ZTDA 4ME3A 4Y7NH 3TS0A 3HKZE 2BH2A 2IY5B 1VCIA 2JJQA 3M9BA 3HKSA 2UUBQ 2YU9H 2VW9A 3CPWA 1YIJA 4QQBX 4LF6L 2UXDL 3I55A 2GVBA 2PQAB 1YNXA 1Z47A 3W1GA 3CF5A 1KC8C 2UUCL 4NXML 4DV5Q 4DR5L 3CC2A 2JA5H 4A3MH 1FL0A 1XPUA 4IJHA 5GAEC 4A3BG 4X64L 1V43A 1TWFH 1DGSA 4PG3A 3SGIA 2K5VA 1EQQA 1JE5A 3MXNB 5M5WH 4Y52H 2BH8A 2QEXA 3S14H 2HHHL 1HH2P 3W1BA 2KHIA 2I5LX 2R7FA 1PHJA 4A93H 5AJ3Q 5BR8Q 4LF5Q 3UDGA 3F2BA 1E3PA 2F52A 1G6PA 3OYYA 3H0GG 4HJ5A 2KHJA 1HZ9A 3CCLA 4LF8Q 2WP8J 3GTQH 1L1OA 3I4NH 1BBWA 1HZCA 2A19A 3G4SA 1HNZQ 2ALYB 4TQUS 2MNAA 4GOPA 1TWCH 3RNUA 1OTCA 4AYBG 1VQCA 4DV0L 4A3LH 1YHBA 2GN5A 2MO1A 3UDFA 2E2JH 3HOUH 1CSPA 2YTVA 2QA4A 3S1NH 1R9TH 3TQYA 1HR0W 4K0KQ 3HKZG 2IHFA 1PH2A 1X6OA 2K4KA 1L0WA 3GTLH 2EXDA 2DUDA 2R92G 1SE8A 3S1RH 2E2IH 4DNIA 2ZM6Q 1A0IA 1IBLL 3CCSA 1PH1A 4O2DA 1PYBA 3BZCA 3VDYA 2CWPA 1YHQA 4LF9Q 5M5XH 2R93G 1X3EA 4OX9Q 2HT1A 2B29A 2CQOA 1OXVA 3D0FA 4A3EG 2R7DA 1IBMQ 2UUBL 4KHPQ 3A0JA 2LSSA 3GO5A 4QGUA 1A8VA 1Q8KA 3J7A5 1Q12A 3J81c 4MNOA 4JI0L 4YWKA 3L7ZC 4JYAQ 3KJPA 4JI2Q 1Z9FA 4GLXA 3K0XA 1YI2A 2A8VA 4POFA 2VQEQ 3FKIH 1KXLA 5J3BA 2YTYA 1N34L 3K7UC 3PUVA 4AYBE 4JI7L 2JA8H 3S15H 2IX0A 4DV4Q 1M1KC 1GD7A 2V1CC 4MTNA 1PH9A 2JA6G 1VQIA 2AWNA 4DR6L 4FDBA 3W5OA 2VQFQ 4WJ4A 2Q2IA 4DV4L 2JA7H 2PQAA 4YCVA 1AE2A 4A3IG 2UXCQ 1IYJB 4R4CA 3GTJH 1KRTA 5C44H 4GNXA 1KHIA 2JK8A 3M4PA 2RCNA 3PO2G 1B7YB 1M90C 1KRSA 1PV4A 1N34Q 1FJGL 4BY1H 3GTKH 3RN2A 4JI2L 3GTMH 1N9WA 4MZ9A 3HOXH 1W2BA 5JJLA 1C9OA 3GTOH 1P16A 4JI0Q 1VQDA 1K0RA 3FP9A 3PUXA 1K73C 2Y0SE 2OQKA 3F1ZA 3ZJYC 3J81j 1IBKL 1VQ8A 3PO3G 5C0XI 4X65Q 1SR3A 4JBKA 4JV5Q 1G291 1YHAA 2JA6H 2NVTH 3B6YA 4JOIC 1X65A 4A76A 3BJUA 4WJ3M 4OX9L 1IBLQ 1JJGA 1E24A 2Q2UA 2QGQA 2HQLA 1S3OA 3ERSX 3PO2H 4GNXB 1NTGA 3G6EA 1CUKA 4DR2Q 3PF4A 4BY7H 1VQJA 4BBRH 2GVAA 3T1YQ 5EAYA 4DV1L 2K5NA 2JA7G 1Q86C 3H3VH 4K0KL 3TS2A 5H1SE 1JT8A 3EIVA 2UXBL 1UWVA 5C0XG 3JAMc 3UE0A 3HOYH 4A3GG 1QVGA 2E5LQ 3DLLA 1L1OB 3F2CA 1N36Q 2CFMA 2F3IA 5LMNW 1VQKA 2BA1A 3HOYG 2I0QA 4LF8L 5LMNQ 1HNZL 4A3GH 3FKIG 1IBKQ 1VQFA 1JMCA 3L0OA 1P8LA 4OO1I 5LMUQ 5IE8A 1XPOA 1UE7A 4X6AH 4BBSG 3D31A 1YJWA 4JI8L 2OTLA 2NVQH 1I94L 1LM0A 1XNRQ 3NENA 1EIFA 4JCVE 4AIMA 3J80c 3L2PA 1SN8A 3A5ZB 3PSIA 2AMCB 1Q82C 1QVFA 1VQMA 4QL5A 1L1OC 2R93H 1CKNB 4IFDI 4GN3B 2CWAA 4DR4Q 2PMZE 5FLMH 3CCVA 4B3TL 1VQ9A 4HJ9A 4DR1Q 2R7ZH 1VQAA 5ELNA 3KDFA 4X62Q 3J81i 4BA2I 4A3CG 1V1QA 4DPGA 2UUCQ 1E1TA 2R92H 4IOAA 3PUYA 4A3DH 4GKKQ 4A3BH 1MKHA 1TWGH 5FJ8G 1J6QA 2C35B 4A3IH 3RLFA 1VQ6A 4YCWA 2R6GA 1NMGA 3NELA 4R1JA 2FXQA 3KF6A 4JOIA 2D0OA 5IT9c 2ZJRA 4L5RC 3E0EA 3I4NG 1KL9A 5GROA 2YV5A 3U58A 4OWWB 4O0AA 1N33L 1B8AA 3GTGH 4GKKL 4X66L 4DAMA 3S1MH 3DM3A 5C44G 4HIKA 5C3EH 5IYDG 3J7ZC 1TXYA 4LF9L 1SLJA 1J5EQ 2VL6A 1MIUA 3CPFA 4JI1Q 1HNXL 3S2HH 4DR1L 4XTCS 1I50H 1VQ7A 2MO0A 3CC7A 4B3TQ 3AFQA 1JJCB 1X3FA 2K75A 4L5TA 4UPAA 1EUJA 4BXXG 1HZAA 2N49A 4B3ML 4B3SL 3HOZH 1X56A 5GAGC 5IWAQ 2VUMH 5ELOA 3RN5A 2KENA 1B70B 4LUZA 3RZOH 1H95A 4DV3Q 4TVAB 1RIPA 1I94Q 4HIOA 4OWXB 4GN4B 3UDXA 1GM5A 1AH9A 3TRZA 4LF7Q 4HJ7A 3I4MG 1NMFA 1NJIC 3RLNA 4DUZQ 4AQYL 1HNWQ 4DKAC 4OWTB 5M3MG 3KYHC 5LMNL 4GN5A 4A3LG 3KOJA 3HOWG 3UDIA 2OQ0A 4DK3C 1Y1WG 1Y1VH 4LFCQ 5IYCH 2PI2E 2YYZA 4OXPA 1N32L 1PH3A 1RL2A 3HOUG 2VS1A 1QZHA 1SRUA 1X54A 4UP7A 4A3KH 5GQOA 2UXBQ 2KCTA 3HFZB 2AKWB 1PA6A 5C4JH 4NXMQ 2AWOA 5C4XH 3A74A 2WB1G 3KJOA 1HR0L 1GO3E 4JC0A 1LTLA 3I56A 1QZGA 3OTOQ 1XMQQ 2UU9Q 3Q8DA 4LW1A 4PMWA 2IHEA 1ASZA 3AYHB 3ER0A 3AQQA 1N32Q 4JI5L 4JV5L 3WWVA 1EOVA 1BBUA 2ZTEA 4GOPB 3LGJA 2OWOA 4EQ5A 1K8AC 1PYSB 3G71A 1MJEA 4LF4Q 1Y1VG 2NVYH 4NB3A 4AH6A 2OCEA 1E1OA 2B63G 3S17H 1MJCA 1XMOQ 1D8LA 3CCRA 1FJGQ 1I3QH 3NEMA 3S2DH 1I6HH 3EBEA 4JI3Q 2VNUD 2JQOA 1A62A 2WAQG 1JJ2A 4DV3L 2UUAQ 1SMXA 2EQSA 2K5HA 2E2HH 2ZJQA 4L5SA 2VY3A 1UE5A 3PUZA 2D0PA 2A1AA 4GOPC 2UXCL 1OXSC 3MEFA 3KDFB 4HIDA 1VQHA 2VQFL 4A3KG 5IP9H 3CCEA 1WYDA 1PFSA 4DR6Q 4DUYL 1WOCA 1N8RC 3RLOA 5C4XG 2IX1A 4GLVB 2Y0SG 3K8AA 4DR3L 1U5KA 1XNQQ 1KIXA 1PVOA 4PZ8A 5GAHC 4PZ6A 1J5EL 4JBMA 4BBRG 2K14A 3U4ZA 4IFDG 4JI7Q 3K81C 1X3GA 5JJKA 2DGYA 3CCUA 5DLQE 3CXCA 4DR7L 1OXUA 3PV0A 1BVSA 2BA0A 4JBJA 2Z0SA 3CMAA 3CMEA 2OTJA 1K3RA 1XMOL 4LNQA 1NE3A 4A75A 1KQSA 3H15A 3STBD 1GVPA 4LWCA 1NBWA 4R4OA 1IBML 1VQNA 2I5HA 3I7FA 2CCZA 4A3JG 1KD1C 1K9MC 2CKZB 4UP8A 3STBC 3CC4A 1HZBA 5C0XJ 4QIWE 4JI5Q 4IPCA 1YITA 3ICEA 1XMQL 3JC66 4DV2Q 3OTOL 2UU9L 1K83H 4BA1I 4RMFA 3HOWH 2AHOB 1PH6A 1OXXK 5JEAJ 4JI4Q 4JI6Q 5IYBG 3RZDH 2JEBI 2NZOA 2YTXA 3GDEA 2VZAA 3S24A 4BY7G 4GKJL 4QY7A 3CCJA 1SROA 5FLXc 1XTDA 2XTIA 4P71A 1OXTA 2Z6KA 4DV0Q 4LFCL 4J15A 3AEVA 4A3CH 4R4QA 3GTPH 5IYDH 2F4VL 3AFPA 4GNXC 3CW2C 1K8GA 4A3MG 4DAYB 2XGTA 1U0LA 4AQYQ 3I2ZA 4A4IA 2NZHA 3HOZG 4YWMA 5AJ3L 3CCMA 4OONA 1PH5A 2NN6I 2F4VQ 3PUWA 4ALPA 3TEHB 2HIVA 4P72A 1VQLA 5IYBH 1N36L 2NN6G 4KLKA 4C3IH 5IY0A 2ASBA 1YVCA 1X9NA 2WAQE 1G51A 3BZKA 1PH7A 1IXRA 2N8NA 2ID0A 5K36G 4YCUA 5FLMG 3M3YH 4HJ8A 3PO3H 3ULJA 1S72A 1W3SA 2L15A 4R4TA 4YWLA 4X64Q 4GLAC 4NPSA 4LUVA 3RR5A 4DV2L 4GKJQ 2Q2HA 3PF5A 2R7ZG 5JEAG 4H02A 4LFBL 4RG1A 4LF6Q 2VUMG 2UXDQ 1T9HA 1XJVA 3EN2A 1WCMH 1TWHH 4KI0A 1Q1EA 4JI1L 1HNXQ 2ES2A 4BXXH 4B3RL 2LXJA 2D62A 3G48A 4KHZA 1YEZA 4A3FH 2WB1E 1E7ZA 1CSQA 1VQ5A 3JAMi 1N33Q 2KBNA 2K50A 2IT1A 5C3EG 1XPRA 3PIOA 1Q7YC 1NY4A 1IL2A 4DR7Q 1QUQA 3H3VI 2JA5G 3NBHB 3TREA 1CKNA 1VQGA 4LUOA 4LFAL 1Y14B 4B3RQ 1TWAH 3E9IA 1YZ6A 3IRBA 2JA8G 3T1HQ 4LFBQ 5GADC 4PZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 A;  1XNQ L;  4JBW A;  3CCQ A;  4NXN Q;  2K52 A;  1Q81 C;  4DUY Q;  3M4Q A;  5IP7 G;  4A3F G;  4X62 L;  3PIP A;  4DR4 L;  1CKM A;  3M85 A;  3F2D A;  3M7N A;  3E9H A;  4C3J H;  5JJI A;  1UE1 A;  4JI3 L;  1WCM G;  2RHQ B;  1JB7 A;  1AE3 A;  4HIM A;  1EIY B;  1VQ4 A;  1IZ6 A;  3H0G H;  4JI8 Q;  4A3E H;  5IP9 G;  3M4O H;  4APV A;  2KCM A;  2WFW A;  3ULL A;  1ASY A;  2ZTC A;  5M3F G;  1XNR L;  2HIX A;  3KF8 B;  5LMU L;  5HY6 A;  3CP0 A;  5M3M H;  1QVC A;  1EYG A;  4YY3 Q;  1KAW A;  4LF4 L;  3PCO B;  5FJ8 H;  4DV7 Q;  4IJL A;  2E5L L;  2MFI A;  4A93 G;  5IP7 H;  3FHW A;  1EFW A;  2PNH A;  4IO9 A;  1VQP A;  4GS3 A;  3J80 i;  2N3S A;  2NVX H;  4DV6 L;  4P75 A;  4YHH L;  1LUZ A;  3K80 C;  3ULP A;  1VQO A;  1HR0 Q;  1VQE A;  2ZM6 L;  1YJ9 A;  4DR2 L;  4DK6 C;  4JI4 L;  3PGZ A;  4IPH A;  5M5Y H;  4JI6 L;  1D7Q A;  1BKB A;  3F8T A;  3U50 C;  4DV1 Q;  1FVI A;  3T1Y L;  3I4O A;  1YJN A;  1WFQ A;  4A3J H;  4BY1 G;  4HJA A;  3KFU A;  1UE6 A;  4YHH Q;  4DV6 Q;  5E7N A;  2N78 A;  4BBS H;  2EIF A;  4JG2 A;  1I5F A;  1SFO H;  4P73 A;  1FGU A;  2JE6 I;  4IOC A;  1WI5 A;  1PH4 A;  4IPD A;  2JA9 A;  4DV7 L;  1PH8 A;  1L2F A;  2Q2T A;  4LF7 L;  4YY3 L;  4UY8 C;  4X65 L;  4DUZ L;  1HNW L;  4IFD J;  4L5Q A;  1X55 A;  2LXK A;  1C0A A;  4C2M H;  3OW2 A;  1Q46 A;  1Q1B A;  5BR8 L;  4LF5 L;  3S1Q H;  3KF6 B;  1UEB A;  1QUQ B;  2RF4 A;  4EX5 A;  2ATW A;  1V9P A;  2HHH Q;  1C7Y A;  1O7I A;  4QJF A;  4B3M Q;  4IPG A;  2RHS B;  3I4M H;  1VS0 A;  4UP9 A;  3HOV H;  5IWA L;  4DR3 Q;  4C3H H;  3HOX G;  3CD6 A;  1S40 A;  3GD7 A;  4B3S Q;  3U4V A;  2Z6K C;  4P74 A;  3CQZ H;  1E22 A;  4DV5 L;  4DR5 Q;  1HJP A;  3T1H L;  1EQR A;  2JEA I;  1GKH A;  2MQH A;  4NXN L;  1WJJ A;  5IYC G;  2B63 H;  5M3F H;  3S16 H;  4X66 Q;  2UUA L;  4POG A;  2ZJP A;  4R4I A;  5HGQ A;  1VQB A;  1CKO A;  3KLW A;  4XIG S;  1Y1W H;  1EWI A;  2E8G A;  4JYA L;  4LFA Q;  3A5U A;  2B3G A;  2VQE L;  1LYL A;  2I5M X;  3K7A H;  4A3D G;  1YBY A;  3CAM A;  3HOV G;  3BU2 A;  3UE1 A;  4KHP L;  4OO1 G;  1A63 A;  2H5X A;  2ZTD A;  4ME3 A;  4Y7N H;  3TS0 A;  3HKZ E;  2BH2 A;  2IY5 B;  1VCI A;  2JJQ A;  3M9B A;  3HKS A;  2UUB Q;  2YU9 H;  2VW9 A;  3CPW A;  1YIJ A;  4QQB X;  4LF6 L;  2UXD L;  3I55 A;  2GVB A;  2PQA B;  1YNX A;  1Z47 A;  3W1G A;  3CF5 A;  1KC8 C;  2UUC L;  4NXM L;  4DV5 Q;  4DR5 L;  3CC2 A;  2JA5 H;  4A3M H;  1FL0 A;  1XPU A;  4IJH A;  5GAE C;  4A3B G;  4X64 L;  1V43 A;  1TWF H;  1DGS A;  4PG3 A;  3SGI A;  2K5V A;  1EQQ A;  1JE5 A;  3MXN B;  5M5W H;  4Y52 H;  2BH8 A;  2QEX A;  3S14 H;  2HHH L;  1HH2 P;  3W1B A;  2KHI A;  2I5L X;  2R7F A;  1PHJ A;  4A93 H;  5AJ3 Q;  5BR8 Q;  4LF5 Q;  3UDG A;  3F2B A;  1E3P A;  2F52 A;  1G6P A;  3OYY A;  3H0G G;  4HJ5 A;  2KHJ A;  1HZ9 A;  3CCL A;  4LF8 Q;  2WP8 J;  3GTQ H;  1L1O A;  3I4N H;  1BBW A;  1HZC A;  2A19 A;  3G4S A;  1HNZ Q;  2ALY B;  4TQU S;  2MNA A;  4GOP A;  1TWC H;  3RNU A;  1OTC A;  4AYB G;  1VQC A;  4DV0 L;  4A3L H;  1YHB A;  2GN5 A;  2MO1 A;  3UDF A;  2E2J H;  3HOU H;  1CSP A;  2YTV A;  2QA4 A;  3S1N H;  1R9T H;  3TQY A;  1HR0 W;  4K0K Q;  3HKZ G;  2IHF A;  1PH2 A;  1X6O A;  2K4K A;  1L0W A;  3GTL H;  2EXD A;  2DUD A;  2R92 G;  1SE8 A;  3S1R H;  2E2I H;  4DNI A;  2ZM6 Q;  1A0I A;  1IBL L;  3CCS A;  1PH1 A;  4O2D A;  1PYB A;  3BZC A;  3VDY A;  2CWP A;  1YHQ A;  4LF9 Q;  5M5X H;  2R93 G;  1X3E A;  4OX9 Q;  2HT1 A;  2B29 A;  2CQO A;  1OXV A;  3D0F A;  4A3E G;  2R7D A;  1IBM Q;  2UUB L;  4KHP Q;  3A0J A;  2LSS A;  3GO5 A;  4QGU A;  1A8V A;  1Q8K A;  3J7A 5;  1Q12 A;  3J81 c;  4MNO A;  4JI0 L;  4YWK A;  3L7Z C;  4JYA Q;  3KJP A;  4JI2 Q;  1Z9F A;  4GLX A;  3K0X A;  1YI2 A;  2A8V A;  4POF A;  2VQE Q;  3FKI H;  1KXL A;  5J3B A;  2YTY A;  1N34 L;  3K7U C;  3PUV A;  4AYB E;  4JI7 L;  2JA8 H;  3S15 H;  2IX0 A;  4DV4 Q;  1M1K C;  1GD7 A;  2V1C C;  4MTN A;  1PH9 A;  2JA6 G;  1VQI A;  2AWN A;  4DR6 L;  4FDB A;  3W5O A;  2VQF Q;  4WJ4 A;  2Q2I A;  4DV4 L;  2JA7 H;  2PQA A;  4YCV A;  1AE2 A;  4A3I G;  2UXC Q;  1IYJ B;  4R4C A;  3GTJ H;  1KRT A;  5C44 H;  4GNX A;  1KHI A;  2JK8 A;  3M4P A;  2RCN A;  3PO2 G;  1B7Y B;  1M90 C;  1KRS A;  1PV4 A;  1N34 Q;  1FJG L;  4BY1 H;  3GTK H;  3RN2 A;  4JI2 L;  3GTM H;  1N9W A;  4MZ9 A;  3HOX H;  1W2B A;  5JJL A;  1C9O A;  3GTO H;  1P16 A;  4JI0 Q;  1VQD A;  1K0R A;  3FP9 A;  3PUX A;  1K73 C;  2Y0S E;  2OQK A;  3F1Z A;  3ZJY C;  3J81 j;  1IBK L;  1VQ8 A;  3PO3 G;  5C0X I;  4X65 Q;  1SR3 A;  4JBK A;  4JV5 Q;  1G29 1;  1YHA A;  2JA6 H;  2NVT H;  3B6Y A;  4JOI C;  1X65 A;  4A76 A;  3BJU A;  4WJ3 M;  4OX9 L;  1IBL Q;  1JJG A;  1E24 A;  2Q2U A;  2QGQ A;  2HQL A;  1S3O A;  3ERS X;  3PO2 H;  4GNX B;  1NTG A;  3G6E A;  1CUK A;  4DR2 Q;  3PF4 A;  4BY7 H;  1VQJ A;  4BBR H;  2GVA A;  3T1Y Q;  5EAY A;  4DV1 L;  2K5N A;  2JA7 G;  1Q86 C;  3H3V H;  4K0K L;  3TS2 A;  5H1S E;  1JT8 A;  3EIV A;  2UXB L;  1UWV A;  5C0X G;  3JAM c;  3UE0 A;  3HOY H;  4A3G G;  1QVG A;  2E5L Q;  3DLL A;  1L1O B;  3F2C A;  1N36 Q;  2CFM A;  2F3I A;  5LMN W;  1VQK A;  2BA1 A;  3HOY G;  2I0Q A;  4LF8 L;  5LMN Q;  1HNZ L;  4A3G H;  3FKI G;  1IBK Q;  1VQF A;  1JMC A;  3L0O A;  1P8L A;  4OO1 I;  5LMU Q;  5IE8 A;  1XPO A;  1UE7 A;  4X6A H;  4BBS G;  3D31 A;  1YJW A;  4JI8 L;  2OTL A;  2NVQ H;  1I94 L;  1LM0 A;  1XNR Q;  3NEN A;  1EIF A;  4JCV E;  4AIM A;  3J80 c;  3L2P A;  1SN8 A;  3A5Z B;  3PSI A;  2AMC B;  1Q82 C;  1QVF A;  1VQM A;  4QL5 A;  1L1O C;  2R93 H;  1CKN B;  4IFD I;  4GN3 B;  2CWA A;  4DR4 Q;  2PMZ E;  5FLM H;  3CCV A;  4B3T L;  1VQ9 A;  4HJ9 A;  4DR1 Q;  2R7Z H;  1VQA A;  5ELN A;  3KDF A;  4X62 Q;  3J81 i;  4BA2 I;  4A3C G;  1V1Q A;  4DPG A;  2UUC Q;  1E1T A;  2R92 H;  4IOA A;  3PUY A;  4A3D H;  4GKK Q;  4A3B H;  1MKH A;  1TWG H;  5FJ8 G;  1J6Q A;  2C35 B;  4A3I H;  3RLF A;  1VQ6 A;  4YCW A;  2R6G A;  1NMG A;  3NEL A;  4R1J A;  2FXQ A;  3KF6 A;  4JOI A;  2D0O A;  5IT9 c;  2ZJR A;  4L5R C;  3E0E A;  3I4N G;  1KL9 A;  5GRO A;  2YV5 A;  3U58 A;  4OWW B;  4O0A A;  1N33 L;  1B8A A;  3GTG H;  4GKK L;  4X66 L;  4DAM A;  3S1M H;  3DM3 A;  5C44 G;  4HIK A;  5C3E H;  5IYD G;  3J7Z C;  1TXY A;  4LF9 L;  1SLJ A;  1J5E Q;  2VL6 A;  1MIU A;  3CPF A;  4JI1 Q;  1HNX L;  3S2H H;  4DR1 L;  4XTC S;  1I50 H;  1VQ7 A;  2MO0 A;  3CC7 A;  4B3T Q;  3AFQ A;  1JJC B;  1X3F A;  2K75 A;  4L5T A;  4UPA A;  1EUJ A;  4BXX G;  1HZA A;  2N49 A;  4B3M L;  4B3S L;  3HOZ H;  1X56 A;  5GAG C;  5IWA Q;  2VUM H;  5ELO A;  3RN5 A;  2KEN A;  1B70 B;  4LUZ A;  3RZO H;  1H95 A;  4DV3 Q;  4TVA B;  1RIP A;  1I94 Q;  4HIO A;  4OWX B;  4GN4 B;  3UDX A;  1GM5 A;  1AH9 A;  3TRZ A;  4LF7 Q;  4HJ7 A;  3I4M G;  1NMF A;  1NJI C;  3RLN A;  4DUZ Q;  4AQY L;  1HNW Q;  4DKA C;  4OWT B;  5M3M G;  3KYH C;  5LMN L;  4GN5 A;  4A3L G;  3KOJ A;  3HOW G;  3UDI A;  2OQ0 A;  4DK3 C;  1Y1W G;  1Y1V H;  4LFC Q;  5IYC H;  2PI2 E;  2YYZ A;  4OXP A;  1N32 L;  1PH3 A;  1RL2 A;  3HOU G;  2VS1 A;  1QZH A;  1SRU A;  1X54 A;  4UP7 A;  4A3K H;  5GQO A;  2UXB Q;  2KCT A;  3HFZ B;  2AKW B;  1PA6 A;  5C4J H;  4NXM Q;  2AWO A;  5C4X H;  3A74 A;  2WB1 G;  3KJO A;  1HR0 L;  1GO3 E;  4JC0 A;  1LTL A;  3I56 A;  1QZG A;  3OTO Q;  1XMQ Q;  2UU9 Q;  3Q8D A;  4LW1 A;  4PMW A;  2IHE A;  1ASZ A;  3AYH B;  3ER0 A;  3AQQ A;  1N32 Q;  4JI5 L;  4JV5 L;  3WWV A;  1EOV A;  1BBU A;  2ZTE A;  4GOP B;  3LGJ A;  2OWO A;  4EQ5 A;  1K8A C;  1PYS B;  3G71 A;  1MJE A;  4LF4 Q;  1Y1V G;  2NVY H;  4NB3 A;  4AH6 A;  2OCE A;  1E1O A;  2B63 G;  3S17 H;  1MJC A;  1XMO Q;  1D8L A;  3CCR A;  1FJG Q;  1I3Q H;  3NEM A;  3S2D H;  1I6H H;  3EBE A;  4JI3 Q;  2VNU D;  2JQO A;  1A62 A;  2WAQ G;  1JJ2 A;  4DV3 L;  2UUA Q;  1SMX A;  2EQS A;  2K5H A;  2E2H H;  2ZJQ A;  4L5S A;  2VY3 A;  1UE5 A;  3PUZ A;  2D0P A;  2A1A A;  4GOP C;  2UXC L;  1OXS C;  3MEF A;  3KDF B;  4HID A;  1VQH A;  2VQF L;  4A3K G;  5IP9 H;  3CCE A;  1WYD A;  1PFS A;  4DR6 Q;  4DUY L;  1WOC A;  1N8R C;  3RLO A;  5C4X G;  2IX1 A;  4GLV B;  2Y0S G;  3K8A A;  4DR3 L;  1U5K A;  1XNQ Q;  1KIX A;  1PVO A;  4PZ8 A;  5GAH C;  4PZ6 A;  1J5E L;  4JBM A;  4BBR G;  2K14 A;  3U4Z A;  4IFD G;  4JI7 Q;  3K81 C;  1X3G A;  5JJK A;  2DGY A;  3CCU A;  5DLQ E;  3CXC A;  4DR7 L;  1OXU A;  3PV0 A;  1BVS A;  2BA0 A;  4JBJ A;  2Z0S A;  3CMA A;  3CME A;  2OTJ A;  1K3R A;  1XMO L;  4LNQ A;  1NE3 A;  4A75 A;  1KQS A;  3H15 A;  3STB D;  1GVP A;  4LWC A;  1NBW A;  4R4O A;  1IBM L;  1VQN A;  2I5H A;  3I7F A;  2CCZ A;  4A3J G;  1KD1 C;  1K9M C;  2CKZ B;  4UP8 A;  3STB C;  3CC4 A;  1HZB A;  5C0X J;  4QIW E;  4JI5 Q;  4IPC A;  1YIT A;  3ICE A;  1XMQ L;  3JC6 6;  4DV2 Q;  3OTO L;  2UU9 L;  1K83 H;  4BA1 I;  4RMF A;  3HOW H;  2AHO B;  1PH6 A;  1OXX K;  5JEA J;  4JI4 Q;  4JI6 Q;  5IYB G;  3RZD H;  2JEB I;  2NZO A;  2YTX A;  3GDE A;  2VZA A;  3S24 A;  4BY7 G;  4GKJ L;  4QY7 A;  3CCJ A;  1SRO A;  5FLX c;  1XTD A;  2XTI A;  4P71 A;  1OXT A;  2Z6K A;  4DV0 Q;  4LFC L;  4J15 A;  3AEV A;  4A3C H;  4R4Q A;  3GTP H;  5IYD H;  2F4V L;  3AFP A;  4GNX C;  3CW2 C;  1K8G A;  4A3M G;  4DAY B;  2XGT A;  1U0L A;  4AQY Q;  3I2Z A;  4A4I A;  2NZH A;  3HOZ G;  4YWM A;  5AJ3 L;  3CCM A;  4OON A;  1PH5 A;  2NN6 I;  2F4V Q;  3PUW A;  4ALP A;  3TEH B;  2HIV A;  4P72 A;  1VQL A;  5IYB H;  1N36 L;  2NN6 G;  4KLK A;  4C3I H;  5IY0 A;  2ASB A;  1YVC A;  1X9N A;  2WAQ E;  1G51 A;  3BZK A;  1PH7 A;  1IXR A;  2N8N A;  2ID0 A;  5K36 G;  4YCU A;  5FLM G;  3M3Y H;  4HJ8 A;  3PO3 H;  3ULJ A;  1S72 A;  1W3S A;  2L15 A;  4R4T A;  4YWL A;  4X64 Q;  4GLA C;  4NPS A;  4LUV A;  3RR5 A;  4DV2 L;  4GKJ Q;  2Q2H A;  3PF5 A;  2R7Z G;  5JEA G;  4H02 A;  4LFB L;  4RG1 A;  4LF6 Q;  2VUM G;  2UXD Q;  1T9H A;  1XJV A;  3EN2 A;  1WCM H;  1TWH H;  4KI0 A;  1Q1E A;  4JI1 L;  1HNX Q;  2ES2 A;  4BXX H;  4B3R L;  2LXJ A;  2D62 A;  3G48 A;  4KHZ A;  1YEZ A;  4A3F H;  2WB1 E;  1E7Z A;  1CSQ A;  1VQ5 A;  3JAM i;  1N33 Q;  2KBN A;  2K50 A;  2IT1 A;  5C3E G;  1XPR A;  3PIO A;  1Q7Y C;  1NY4 A;  1IL2 A;  4DR7 Q;  1QUQ A;  3H3V I;  2JA5 G;  3NBH B;  3TRE A;  1CKN A;  1VQG A;  4LUO A;  4LFA L;  1Y14 B;  4B3R Q;  1TWA H;  3E9I A;  1YZ6 A;  3IRB A;  2JA8 G;  3T1H Q;  4LFB Q;  5GAD C;  4PZ7 A; 
#chains in the Genus database with same CATH topology
 2PI2 A;  2E2J B;  1G2S A;  4OO1 H;  1JOK A;  2NZ1 D;  4DUY Q;  3M4Q A;  5IP7 G;  1SNO A;  3F2D A;  2EXZ A;  1UE1 A;  2SEB D;  1VQ4 A;  1IZ6 A;  5G3L D;  1HUN A;  4JI8 Q;  3SK6 A;  2KCM A;  2WFW A;  4Q0F A;  3ULL A;  2ZTC A;  3KF8 B;  2EOT A;  1VMP A;  3G7L A;  4DGZ A;  3AB9 A;  5C4H A;  4IJL A;  4A93 G;  5EKI A;  3VR6 A;  5IP7 H;  2PNH A;  3A7A B;  1X32 A;  3NQI A;  4DF7 A;  4P75 A;  3DWP A;  4YHH L;  3K80 C;  2MJ8 A;  2NYZ D;  1VQO A;  1YJ9 A;  2WAC A;  4NKL A;  4JI6 L;  4BS9 A;  1SMY C;  4ZRZ A;  3F8T A;  5ELC A;  4DV1 Q;  2N88 A;  3GP7 A;  1WFQ A;  4BY1 G;  1UE6 A;  4YHH Q;  4CDC C;  3H6M A;  2G5D A;  5A35 A;  2A6H C;  1RF2 D;  2VB2 X;  2JA9 A;  4LF7 L;  4X65 L;  5IGE A;  4IFD J;  1YNN C;  2LXK A;  1A3U A;  4A3M B;  4KTA A;  4LF5 L;  2EVB A;  1UEB A;  1QUQ B;  1V9P A;  1O7I A;  2L4N A;  2FIN B;  4B3M Q;  2RHS B;  3I4M H;  4UP9 A;  3HOV H;  4C3H H;  4B3S Q;  5CV9 A;  3U4V A;  1NNX A;  3E0J A;  4DV5 L;  1K3B C;  3SHL A;  4PMB A;  2MQH A;  4X66 Q;  1WTH A;  4POG A;  1RHP A;  4FNF A;  5EPL A;  4JYA L;  2K5Q A;  1RD9 D;  1PXU A;  2B3G A;  4A3D G;  1YBY A;  3CAM A;  5L37 A;  3HOV G;  3MFG A;  3UE1 A;  1S5E D;  2J0T D;  5IT9 L;  2BH2 A;  1RCV D;  2JJQ A;  5JVG 3;  3HKS A;  2YU9 H;  1B44 D;  4QQB X;  5CBA E;  1YNX A;  1Z47 A;  1KC8 C;  2CW0 C;  1CQV A;  3P7J A;  1PMR A;  1T5E A;  4PG3 A;  1D5Z C;  2WKD A;  1JE5 A;  1GHK A;  2B2U C;  1FNV A;  4Y52 H;  2QEX A;  1O80 A;  2HHH L;  1TWF B;  4IUR A;  2HQE A;  1EIH A;  3BZD B;  1PHJ A;  4A93 H;  5AJ3 Q;  4FO2 A;  1E3P A;  3OYY A;  3FVQ A;  3D6W A;  3BVZ A;  1HZ9 A;  4LF8 Q;  1BBX C;  1QNK A;  3QOJ A;  1HNZ Q;  4GOP A;  1TWC H;  3RNU A;  1VQC A;  1SE2 A;  3UDF A;  1SJE D;  1E2Z A;  1R9T H;  1HR0 W;  1M4V A;  1TWC B;  2HDL A;  4FF1 A;  3NTI A;  4XT1 B;  1IBL L;  1PH1 A;  3VDY A;  3OPO A;  1L0Y B;  5I2Y A;  2HT1 A;  3MXP A;  2LSS A;  1EQV A;  3J7A F;  1SYF A;  1H9M A;  2E2D C;  1GXD C;  1QJO A;  2HDM A;  4JYA Q;  3K0X A;  4POF A;  4CDE C;  5J3B A;  2YTY A;  1HFN A;  3E3X A;  4AYB E;  1MGS A;  2V1C C;  1TS4 A;  2PMZ B;  1GUW A;  2VQF Q;  4WJ4 A;  4DV4 L;  2J4X A;  4YCV A;  4A3I G;  3NHH A;  2UXC Q;  1CM9 A;  3E5S A;  3FEW X;  5C44 H;  4GNX A;  2BDO A;  2F0Q A;  3PO2 G;  1B7Y B;  4Y7N B;  4UDU C;  1ICW A;  1RTO A;  3GTK H;  3GTL B;  2IJ0 A;  1N9W A;  1W2B A;  1C9O A;  2PYK A;  1P16 A;  3GTO H;  1K0R A;  3FP9 A;  3PUX A;  3S1Q B;  3SR1 A;  1M8A A;  3ZJY C;  1PRT C;  3J81 j;  1IBK L;  1VQ8 A;  1SR3 A;  1G29 1;  2NVY B;  3QOL A;  3BJU A;  4WJ3 M;  2C5C A;  4U68 A;  1E24 A;  2R3Z A;  1JWS D;  2HQL A;  3PO2 H;  3FMC A;  1QWY A;  2B63 B;  1CUK A;  2E2H B;  3PF4 A;  1KNA A;  1GHJ A;  2PW7 A;  4BY7 H;  3HOY B;  1PRT B;  2JA7 G;  4PQX A;  5H1S E;  3TS2 A;  1BXT A;  3HOY H;  2CFM A;  5EPJ A;  1WD1 A;  1VQK A;  4J6H A;  1STA A;  1HNZ L;  2E75 C;  5I6Y A;  1XPO A;  5IE8 A;  1F9P A;  4X6A H;  2QKI C;  4JI8 L;  3ITP A;  1XNR Q;  3NEN A;  4JCV E;  3L2P A;  3J80 c;  3OMG A;  1SN8 A;  3PSI A;  1QVF A;  3GTO B;  1VQM A;  2A6E D;  1LAC A;  1I4Q A;  2JYO A;  2PMZ E;  3MXU A;  5FLM H;  3CCV A;  1IL8 A;  2G9D A;  2K33 A;  1ROD A;  3NUC A;  4F7X A;  4A3C G;  2R92 H;  5E4X A;  4GKK Q;  5FJ8 G;  1TWG H;  5D65 A;  4A3I H;  3RLF A;  2Z8L A;  2B2Y C;  1NMG A;  4R1J A;  3S15 B;  2FXQ A;  3KF6 A;  1E2V A;  4JOI A;  5ISR A;  5LL6 X;  3U58 A;  2YV5 A;  4K2K A;  1WTQ A;  4GKK L;  4A3G B;  2TSS A;  5C44 G;  2E2I B;  2VL6 A;  1MIU A;  4RHS A;  3GTM B;  1ILQ A;  3HOZ B;  1A2U A;  5C3E B;  4U67 3;  1JJC B;  4B3S L;  3HOZ H;  1HXY D;  3D4R A;  1JIC A;  2F0H A;  4TVA B;  4ZYS A;  1AH9 A;  2NBF A;  3TRZ A;  2KA7 A;  4LAA A;  4QB4 A;  4QCL A;  2R92 B;  4AQY L;  1AN8 A;  4OWT B;  3HRZ C;  4IZ8 A;  1K0S A;  1OO9 B;  3UDI A;  2WKC A;  4LFC Q;  4DK3 C;  1Y1V H;  5IYC H;  4HN7 A;  5EQ0 A;  3P20 A;  1RL2 A;  1PH3 A;  4UP7 A;  2HCI A;  3NBI A;  3GTJ B;  2KCT A;  4C3J G;  1DOK A;  4DU9 A;  5KND A;  2AWO A;  3A74 A;  2WB1 G;  1O7Y A;  3KJO A;  2VB3 X;  3KLS X;  1GUT A;  1JE4 A;  1SXT A;  3AYH B;  2F0J A;  1EOV A;  2ZTE A;  5G3L F;  1LTI D;  1MD2 D;  1PYS B;  3G71 A;  4NB3 A;  2JA6 B;  1EQT A;  2OCE A;  2WIN B;  2F0S A;  3RZO B;  1UNS A;  3NEM A;  3OMC A;  3NTK A;  4JI3 Q;  3SK4 A;  2AUK A;  2EQS A;  2ZJQ A;  1ENF A;  4OIK A;  1UE5 A;  3PUZ A;  2UXC L;  3A7L A;  1OXS C;  1PTO D;  4HID A;  1VQH A;  2VQF L;  2ZXP A;  5IP9 H;  1TY2 A;  1EWH A;  4OHJ A;  4DUY L;  5C4X G;  1HQM C;  4DR3 L;  2Y0S G;  2X6G A;  1PVO A;  1JOR A;  4JBM A;  3SDZ A;  4IFD G;  1A3T A;  1X3G A;  3VA5 A;  5IT9 E;  2BA0 A;  2HUG A;  5FK9 C;  4DAP A;  3H15 A;  3STB D;  1ZEQ X;  4R4O A;  1NBW A;  3HS0 C;  2I5H A;  2IL8 A;  2MHV A;  2CKZ B;  4QF4 A;  5I9O A;  1CK1 A;  1F2Z A;  3CC4 A;  2A73 B;  4RGM A;  2DY7 A;  1XMQ L;  1SNM A;  5DNF A;  4C1N I;  1EY4 A;  3HOW H;  1OXX K;  4JI4 Q;  5IYB G;  3RZD H;  1I4P A;  2YTX A;  2XTI A;  4FYD A;  3RZD B;  3SK8 A;  3AEV A;  3GTP H;  4A3C H;  2F4V L;  5EKK A;  2WAQ B;  4A3M G;  2D2C C;  4F87 A;  1F9Q A;  1U0L A;  2FJ2 A;  3I2Z A;  4A4I A;  3TP7 A;  3V96 A;  2A68 D;  3D6C A;  2PQE A;  3G6J B;  2PO4 A;  5AJ3 L;  1MHW C;  2F4V Q;  4ALP A;  1HCZ A;  5CV5 A;  3FPU B;  1SFO B;  1J9O A;  2NN6 G;  3A56 A;  4C3I H;  1B3A A;  3BZK A;  1LTR D;  4XQN A;  3MXN A;  1Y8N B;  3L9A X;  4YCU A;  5FLM G;  1TQO A;  2A5H A;  2RA4 A;  4R4T A;  4X64 Q;  4GLA C;  4HTH A;  2EJM A;  3PO3 B;  4DAV A;  5KEE A;  4RG1 A;  1ESF A;  3C3L A;  1ZYR C;  2ES2 A;  4BXX H;  1I6H B;  2D62 A;  1KDC A;  3EA6 A;  4KHZ A;  4NDX A;  1YEZ A;  1ZYR D;  1E7Z A;  2D5D A;  1CSQ A;  3JAM L;  3JAM i;  5FO9 B;  1Q7Y C;  3NBH B;  2BE5 C;  5D14 A;  3K6O A;  3TP6 A;  1L0X B;  2FFK B;  3H91 A;  3K7A B;  1O7L A;  2F0W A;  1QB5 D;  3CCQ A;  4NXN Q;  2K52 A;  4A3F G;  4DR4 L;  1CKM A;  3M85 A;  2RDG A;  1FNW A;  4C3I B;  4C3J H;  4JI3 L;  2RHQ B;  4F88 A;  2B2W C;  3M4O B;  4ZUJ A;  5K5P A;  3QG1 A;  4OL7 A;  3M4O H;  4HSP A;  4MIU A;  5CV6 A;  3EFX D;  4KN4 C;  2ENB A;  4CDD C;  3CP0 A;  1RJT A;  2PW5 A;  3PCO B;  2E5L L;  2MFI A;  4ULL A;  3FHW A;  1EFW A;  1TKW B;  4IO9 A;  4KMU C;  1T5X D;  5JEA H;  1LT5 D;  4FXK C;  1EYD A;  5FLX E;  4DK6 C;  4DR2 L;  1D7Q A;  1BKB A;  1YJN A;  1FVI A;  5KYI A;  1TWA B;  4A3J H;  1TS5 A;  4HJA A;  3KFU A;  1KNE A;  4N9P A;  4DV6 Q;  2EE1 A;  1B4O A;  4BBS H;  1CA5 A;  1H9R A;  2B2Y A;  3NK9 A;  4A3J B;  1FGU A;  4DN4 M;  3I91 A;  4DV7 L;  1S5C D;  3K0Y A;  3QO2 A;  5I6W A;  4YY3 L;  1GUG A;  4UY8 C;  1HNW L;  1G91 A;  2KCC A;  4YIJ A;  4L5Q A;  2M9V A;  1C0A A;  2KOL A;  5EJW A;  4G7H C;  4KN7 C;  1EY0 A;  2HHH Q;  1EU4 A;  1C7Y A;  4FF2 A;  4N9T A;  5TSS A;  2Z4H A;  1U4P A;  4IPG A;  3R2T A;  1SYE A;  5IWA L;  3HOX G;  1S40 A;  3GD7 A;  2AUJ D;  2B2V A;  2Z6K C;  3I4M B;  3CQZ H;  3K58 A;  3LNN A;  2ZJP A;  4R4I A;  1G8Z D;  1BDO A;  2K28 A;  3GQB A;  4LFA Q;  1B50 A;  2VQE L;  1LYL A;  4EQO A;  3OOC A;  4ME3 A;  2ZTD A;  3T56 B;  2F0D A;  2IY5 B;  1VCI A;  3M9B A;  3ONA B;  3K5N A;  2UUB Q;  1EOT A;  3CPW A;  4DNR B;  4LF6 L;  3MHB A;  4S3S A;  3CF5 A;  2PCF B;  2UUC L;  2YU9 B;  1UEA B;  4NXM L;  4DV5 Q;  5COY A;  3CC2 A;  4XQJ A;  1PFN A;  1FL0 A;  4A3B G;  4IJH A;  5GAE C;  3FRP B;  1DGS A;  2K5V A;  5DEH A;  1EQQ A;  2F0L A;  3QIA A;  1KAA A;  1SNP A;  1I4R A;  2BH8 A;  2KHI A;  3RD4 A;  4O42 A;  4LF5 Q;  3UDG A;  2CVR A;  2F52 A;  4CGY B;  1WTW A;  4J8Q A;  3H0G G;  5AFW A;  4DFA A;  2WP8 J;  3GTQ H;  3SE0 A;  3HOU B;  1G2T A;  2MNA A;  3LWE A;  4AYB G;  4DV0 L;  1YHB A;  2CW0 D;  3HOU H;  4PV1 C;  1CSP A;  1DON A;  2QW7 A;  2IHF A;  1PH2 A;  3GTL H;  2K4K A;  3TZD A;  4WRD A;  1Y69 U;  1G6Z A;  4ZK9 B;  4O2D A;  3BZC A;  4C3H G;  5C5M A;  4CJ0 B;  4C2M B;  2B29 A;  1EEI D;  1OXV A;  2CQO A;  2EYH A;  4A3E G;  1EYA A;  2VUM B;  3GO5 A;  3QR8 A;  1GOZ A;  1Q8K A;  1B53 A;  3J81 c;  3J7Y W;  3K57 A;  3L7Z C;  1K8O A;  1EY8 A;  4GLX A;  3OSO A;  1YI2 A;  1BOS A;  1QIL A;  3FKI H;  2V4D A;  3DXJ C;  4MHE A;  1N34 L;  3PUV A;  4H44 C;  4JI7 L;  3CHB D;  3S15 H;  4DV4 Q;  4MTN A;  1HA5 A;  4DR6 L;  1S4Z A;  3HEJ A;  3CKI B;  2Q2I A;  4O1N A;  4FXG C;  1V1P B;  1NR4 A;  2JK8 A;  1SDF A;  1PFB A;  2A6H D;  2R61 A;  1I50 B;  3TN2 A;  3RN2 A;  3HOX H;  1VQD A;  3VYS A;  2EJG C;  3F1Z A;  3OHX C;  5NUC A;  5C6A A;  3VYU A;  4JBK A;  1XWE A;  2F0V A;  1A3V A;  3B6Y A;  1Y8O B;  2Z1C A;  2K32 A;  4BWG B;  2L5T A;  1IBL Q;  2XRS D;  1JJG A;  4UAI A;  2QGQ A;  4DXG A;  3ERS X;  3HG9 A;  3G6E A;  4GNX B;  4BBR H;  3I8Z A;  3T1Y Q;  3FKI B;  5KRU A;  1H9S B;  4QUF A;  2UXB L;  3JAM c;  5J39 A;  1NR2 A;  2SNS A;  4HMI A;  3F2C A;  1N36 Q;  1VMC A;  2BA1 A;  2H4O A;  4A3G H;  2I0Q A;  4LF8 L;  5LMN Q;  3L0O A;  5LMU Q;  2CHB D;  1IKL A;  3D31 A;  2Q8I B;  2NVQ H;  3SVM A;  1QG7 A;  2X69 A;  3A5Z B;  2OT2 A;  1L1O C;  3E6Z X;  2E74 C;  1HTL D;  3EQL C;  1D5X C;  5I2X A;  3QWN A;  1R4Q B;  4X62 Q;  4BA2 I;  3S14 B;  3V05 A;  1D1K A;  4RKL A;  4IOA A;  4A93 B;  1V8Q A;  4ZLT F;  3KLS A;  3OWF A;  4A3B H;  2C35 B;  1VQ6 A;  1CFM A;  1JOO A;  2R6G A;  3NEL A;  4IUV A;  2EY1 A;  2D0O A;  1CHQ D;  5IT9 c;  1LAB A;  3I4N G;  2K5D A;  1SJH D;  5IOD A;  4O0A A;  1B8A A;  4X66 L;  2K05 A;  3C1F A;  2O5I C;  3BVG A;  3S1M H;  5DAU A;  1V1O A;  5IYD G;  1C8C A;  4LF9 L;  3VYT A;  4JI1 Q;  4XT3 B;  4DR1 L;  4XTC S;  1DD2 A;  3CC7 A;  2L55 A;  4BXX G;  2N49 A;  2K5W A;  3AU7 A;  4B3M L;  3LX0 A;  2QDL A;  5ELO A;  4LUZ A;  2B2T C;  3RZO H;  1H95 A;  4DV3 Q;  1RIP A;  4WJW A;  3KK7 A;  1I94 Q;  4HIO A;  4OWX B;  3HOW B;  1WCM B;  4LF7 Q;  4HJ7 A;  1NMF A;  4K5X A;  5JJZ A;  1X3P A;  5M3M G;  3KYH C;  5FO8 B;  3RMH A;  1HRJ A;  2OQ0 A;  1Y1W G;  1N32 L;  2KCN A;  4A3K H;  3X3N A;  3HFZ B;  1TS2 A;  4H13 C;  3U9O A;  1B2T A;  2BE5 D;  1HR0 L;  4LMQ D;  1B1Z A;  3GTK B;  1ENA A;  1ZKO A;  3I56 A;  3OTO Q;  3KLR A;  2UU9 Q;  3Q8D A;  1D1I A;  4JI5 L;  4I7Z C;  1BBU A;  4EQ5 A;  2XIW A;  4JVZ A;  2R93 B;  4OIJ A;  1K8A C;  3KBG A;  4WFN 3;  1Y1V G;  2NVY H;  3I73 A;  4L6T B;  1E1O A;  1K83 B;  2B63 G;  2P5Z X;  1FJG Q;  3S2D H;  2EPB A;  3EBE A;  2JQO A;  1JJ2 A;  2UUA Q;  2F0E A;  4H7B A;  2K5H A;  5J1Z A;  2E2H H;  1SSO A;  2A68 C;  2VY3 A;  3GTP B;  3MEF A;  3BYY B;  3KDF B;  2N55 A;  3N6R A;  1PYW D;  3CU7 A;  4KY6 A;  1N8R C;  4XQQ A;  2F0P A;  1IW7 C;  3K8A A;  1HTP A;  1U5K A;  2Z4I A;  1J5E L;  4PZ6 A;  4BBR G;  2K14 A;  3U4Z A;  1PZK D;  5ELE A;  3K81 C;  2DGY A;  2EDG A;  3R8B A;  4QIW B;  5DLQ E;  3CXC A;  3P1H A;  4JBJ A;  3CME A;  2OTJ A;  3I70 A;  1K3R A;  1WVL A;  1NE3 A;  4MTK A;  4LNQ A;  5E4W C;  4C3J B;  2SNM A;  1GVP A;  4JK1 C;  1IBM L;  2IW3 A;  3I7F A;  2PZW A;  5F2D A;  1LTS D;  4UP8 A;  3STB C;  2O5J C;  1HZB A;  3T51 B;  5C0X J;  1JC7 A;  4JI5 Q;  1VDZ A;  3EVQ A;  1DCZ A;  3NSW A;  2UU9 L;  1KLG D;  3JC6 6;  3OTO L;  1K83 H;  4BA1 I;  4RMF A;  4LK1 C;  1PH6 A;  3NXW A;  2JEB I;  2NZO A;  3HOV B;  2VZA A;  4BY7 G;  4GKJ L;  3CCJ A;  1SRO A;  5FLX c;  3VYR A;  3DWQ A;  4J15 A;  4R4Q A;  5IYD H;  2QCP X;  4KHV A;  3OIQ A;  5LHY 1;  3CW2 C;  1K8G A;  1IYV A;  1CZW A;  1PTO C;  2XGT A;  1BCP B;  1O78 A;  1TY0 A;  1EYC A;  3M4Y A;  2NB0 A;  3HOZ G;  4YWM A;  1PH5 A;  4BBS B;  3PUW A;  2KED A;  2AQ3 B;  4XDX A;  1I4X A;  5IYB H;  1Q8I A;  5IY0 A;  2F03 A;  4X3U A;  5JPM C;  1IXR A;  5K36 G;  3ULJ A;  5KYL A;  4A76 A;  4JPB W;  4NPS A;  3RR5 A;  5E3F A;  3PIP 3;  2AQ2 B;  2R7Z G;  3Q24 A;  2UXD Q;  3J81 E;  1T9H A;  3S17 B;  1VF5 C;  1TWH H;  1Q1E A;  4JI1 L;  1YNJ D;  3Q23 A;  3G48 A;  3CRL C;  2CQA A;  3D8G A;  1VQ5 A;  2F0U A;  2KQ3 A;  2PZT A;  5EBD A;  5CYU A;  4DR7 Q;  2JA5 G;  5M5Y B;  4K8I A;  5FOB B;  4UHV A;  1TWA H;  3M7G A;  3E9I A;  1O7Z A;  2TMP A;  2JA8 G;  1KLU D;  1XNQ L;  1LTA D;  3K5O A;  3I3C A;  4X62 L;  3PIP A;  1F2M A;  4CDF C;  3M7N A;  3E9H A;  5JJI A;  1E2W A;  1ENC A;  1J8I A;  2KHS A;  1WCM G;  5EKL A;  1IW7 D;  1AE3 A;  4A3E H;  2OEO A;  5LL6 S;  5IP9 G;  5M3M B;  1AEX A;  1ASY A;  5M3F G;  5HY6 A;  5M3M H;  1FGB D;  1QVC A;  1EYG A;  4LF4 L;  3VR3 A;  2MP1 A;  3W3A A;  4IQZ A;  4V19 0;  1W6K A;  4RAU C;  4X3S A;  5KGU A;  1JOQ A;  3J80 i;  2N3S A;  3HGB A;  2NVX H;  1DM0 B;  2NUC A;  3ULP A;  2MPM A;  1VQE A;  3PGZ A;  5M5Y H;  2IPK D;  3T1Y L;  3I4O A;  5E7N A;  4P73 A;  1TVX A;  2JE6 I;  4IOC A;  1XYI A;  5KNB A;  2Q2T A;  1L2F A;  1B9M A;  3MEH A;  2QF7 A;  3SK5 A;  5IGG A;  4BY1 B;  1K8M A;  2A6E C;  4DUZ L;  2Z6B A;  1X55 A;  1LT3 D;  3KF6 B;  4EX5 A;  2RF4 A;  2ATW A;  1SNC A;  2NVT B;  1VS0 A;  3U9S A;  5KNC A;  3CD6 A;  2DN8 A;  4P74 A;  4DR5 Q;  1HJP A;  2B8F A;  3TSS A;  1EQR A;  3T1H L;  1QE6 A;  1GKH A;  2B63 H;  2JEA I;  1WJJ A;  3A8J E;  3SXH A;  4CKB A;  2UUA L;  2LS0 1;  5HGQ A;  1EIG A;  2F0N A;  3D4D A;  3ZYY X;  3KLW A;  4K8J A;  4NP5 A;  2E8G A;  4ZKB B;  1I4G A;  2I5M X;  1LTT D;  3BU2 A;  4KHP L;  2CH4 W;  3S1R B;  4Y7N H;  4GZY C;  4HED A;  3HKZ E;  5JOB A;  3Q6S A;  1PRT D;  5IOC A;  1V1P A;  1MI2 A;  3W1G A;  1F9S A;  4RCN A;  4FP5 D;  1JWM D;  2RDH A;  1ICF B;  2K03 A;  3PQI A;  1XPU A;  3NP8 A;  3SGI A;  3NTH A;  2F0O A;  5E1F A;  2EY6 A;  1C4Q A;  5BN3 A;  2EYP A;  3W1B A;  2R7F A;  2EYO A;  5BR8 Q;  1CI3 M;  2KHJ A;  4R8I A;  3CCL A;  2Y0S B;  3O13 A;  2RSO A;  1EFI D;  2XNA C;  3I4N H;  3G4S A;  1JWU D;  2L12 A;  1OTC A;  2MO1 A;  2E2J H;  2YTV A;  1F2L A;  1BCP C;  3TQY A;  4K0K Q;  3HKZ G;  4C56 C;  1AZP A;  2K6A A;  2R92 G;  2NVQ B;  3S1R H;  4DNI A;  5EBC A;  4CKE A;  2HCC A;  1A0I A;  2ZM6 Q;  3DM1 A;  1PYB A;  1YHQ A;  4LF9 Q;  2CWP A;  5JPN C;  4OX9 Q;  4FF3 A;  3D0F A;  2R7D A;  2UUB L;  4KHP Q;  4L63 B;  1A8V A;  2JA5 B;  4MNO A;  4JI0 L;  4YWK A;  1Z9F A;  5M5W B;  2RVL A;  4KKS A;  2A8V A;  2FMC A;  2VQE Q;  2JA8 B;  4ZAI A;  2Q8T A;  1KXL A;  3FPP A;  3J81 L;  3K7U C;  1S5B D;  3MVV A;  4X3T A;  5FLX L;  1DOL A;  1GD7 A;  2JA6 G;  2AWN A;  1WTP A;  1Z6H A;  4FDB A;  3W5O A;  1SND A;  2F0I A;  2JA7 H;  1AE2 A;  4CJ2 C;  1SYD A;  4R4C A;  2H1E A;  1KRT A;  1ESR A;  4X3K A;  2OF1 A;  3T4A C;  2X6L A;  1KRS A;  4AYB B;  4JI2 L;  3GTM H;  1EY5 A;  3VA7 A;  2Y0S E;  2OQK A;  1PRT F;  1IKM A;  3PO3 G;  3HOX B;  2L9H A;  2RSN A;  4JV5 Q;  1YHA A;  4EVO A;  3NE5 B;  2LKV A;  1X65 A;  4K5W A;  2Z9H A;  4C3H B;  4OX9 L;  2EY2 A;  1NTG A;  4IAL A;  2JSO A;  1B3Q A;  4DK0 A;  5EAY A;  2K5N A;  1Q86 C;  2M2L A;  1JT8 A;  1UWV A;  1Y1V B;  2JP1 A;  1A6X A;  2DNE A;  1EL0 A;  3DLL A;  1CHP D;  4HCS A;  3I72 A;  5LMN W;  3HOY G;  1SYB A;  3S1N B;  1JMC A;  1VQF A;  4OO1 I;  4XYQ A;  1UE7 A;  3SEB A;  1YJW A;  2OTL A;  2G9H D;  1CT1 D;  1KDB A;  1LM0 A;  1E0B A;  1EIF A;  4AIM A;  2QIL A;  3EJI A;  4QL5 A;  1AW7 A;  4P2C B;  2R93 H;  2EYL A;  4IFD I;  1U9R A;  4B3T L;  1GUS A;  3LWU A;  1LT6 D;  4HJ9 A;  4A3D B;  3KDF A;  1V1Q A;  4DPG A;  1E1T A;  1W6J A;  3PUY A;  3TDQ A;  4A3D H;  2EY5 A;  3VR4 A;  1MKH A;  2DY8 A;  2NTT A;  2F0M A;  3HZX A;  1VF7 A;  2RDF A;  2EZV A;  4KD3 A;  3BYT B;  2ZJR A;  1STB A;  1EU3 A;  4ZUI A;  3VR2 A;  3GTG H;  3MAQ A;  2B39 A;  3DM3 A;  4HIK A;  3MZ5 A;  3J7Z C;  2C9O A;  1STH A;  3GTG B;  1HQR D;  3CPF A;  3S2H H;  1VQ7 A;  1SEB D;  5COR A;  4B3T Q;  1X3F A;  2K75 A;  5ELB A;  1EUJ A;  3H94 A;  1X56 A;  2SDF A;  3BDO A;  2KEN A;  4ODG A;  1S5D D;  3KUP A;  2E76 C;  3UDX A;  1GM5 A;  2B2W A;  3I4M G;  1LV9 A;  4DUZ Q;  4L8J A;  4DKA C;  4A3F B;  3T16 A;  4EQN A;  2LMC B;  4RHR A;  3ERO A;  5LMN L;  4GN5 A;  3HKZ B;  3KOJ A;  2XWB B;  4TKO B;  5M9O A;  4OEL B;  5C4J B;  1SRU A;  3IFT A;  5GQO A;  2UXB Q;  1H9S A;  5IGC A;  2JN4 A;  4NXM Q;  2XVS A;  5C4X H;  3DMU A;  2EYM A;  1GO3 E;  1LTL A;  2I07 B;  1XMQ Q;  2IHE A;  2KVM A;  3ER0 A;  3AQQ A;  4JV5 L;  2OWO A;  3LGJ A;  2QDB A;  1U4M A;  5D3D A;  1LTB D;  2RKS A;  4LF4 Q;  2B2T A;  4AH6 A;  5I9P A;  1GUN A;  1MJC A;  3P75 A;  1I6H H;  1HA6 A;  3PO2 B;  1F77 A;  5ELD A;  1SMX A;  4DK1 A;  4K14 A;  2WII B;  3BS1 A;  4CJ1 B;  3PMF A;  3CCE A;  1WYD A;  3I4L A;  3DEO A;  1WOC A;  2IX1 A;  4GLV B;  1PLF A;  1XNQ Q;  5IIF A;  4PZ8 A;  5GAH C;  4JI7 Q;  1HFG A;  5JJK A;  2D9U A;  3CCU A;  1TR5 A;  1WD0 A;  4K6L A;  1BVS A;  5T1G A;  1LTG D;  2Z0S A;  2ZXO A;  3NQT A;  4LJZ C;  1KQS A;  4V0B A;  2F3W A;  1VQN A;  4DAY A;  1KD1 C;  1K9M C;  3BDL A;  4A3E B;  1D5M C;  1TWH B;  2B2V C;  5K36 H;  4DV2 Q;  5DM6 3;  5CGK A;  5JEA J;  1CA6 A;  2LY7 A;  2WV6 D;  1PZJ D;  3S24 A;  1TWG B;  4QY7 A;  1DZ1 A;  1XTD A;  1XXG A;  1JCK B;  4P71 A;  2Z6K A;  2BOS A;  4K2L A;  3AFP A;  4QMG A;  4IUP A;  1ILP A;  4G57 A;  1I6V C;  5T1I A;  4ILW A;  2B2U A;  4ZKC B;  1LO5 D;  4IUN A;  3CCM A;  3L3O C;  3NPP A;  4P72 A;  5DM7 3;  4KLK A;  1PTO H;  1X9N A;  2WAQ E;  2PPB C;  1G51 A;  1ET9 A;  1AFP A;  3MXG A;  1DOM A;  2N8N A;  3R3O A;  3M3Y H;  2F0K A;  1KDA A;  4HJ8 A;  1S72 A;  1YNN D;  3H0G B;  4YWL A;  2L15 A;  4DV2 L;  4GKJ Q;  2L1B A;  5C0X H;  4Q5V A;  3TP8 A;  3PF5 A;  1AP0 A;  2ZT9 C;  3OIP A;  2VUM G;  1WTV A;  1Y8P B;  1SYC A;  1WCM H;  3RUZ A;  1KAB A;  1QNU A;  1I3Q B;  2LXJ A;  2RQX A;  2WB1 E;  1SAP A;  5CMD A;  5KIX A;  5CV7 A;  2NWG A;  2K50 A;  1D2B A;  3D4W A;  5C3E G;  1XPR A;  1RTN A;  1IL2 A;  3MWY W;  4KKT A;  3H3V I;  3TRE A;  4LUO A;  4LFA L;  3URY A;  2F0T A;  1Y14 B;  4FVM A;  3IRB A;  3T1H Q;  4N8F A;  2K01 A;  1F9R A;  4JBW A;  1Q81 C;  3DHQ A;  1BO0 A;  4I65 A;  1JB7 A;  2DJF C;  4HIM A;  1X3Q A;  5HGT A;  1EIY B;  3VR5 A;  3H0G H;  4K5V A;  4IFD H;  4APV A;  4DA2 A;  1XNR L;  4B9W A;  3NBH A;  2HIX A;  5LMU L;  4YY3 Q;  1KAW A;  5FJ8 H;  4DV7 Q;  1STN A;  2XSC A;  2RCF A;  2CH4 A;  4RH6 A;  1VQP A;  4GS3 A;  4R8N A;  5C5L A;  5JVH 3;  3MC0 B;  2J7Z A;  4DV6 L;  1LUZ A;  1HR0 Q;  2ZM6 L;  4JI4 L;  4IPH A;  3I4N B;  4I7A A;  2NVX B;  3U50 C;  3H3V C;  2GA4 B;  1WTR A;  2N78 A;  3V2T A;  2EIF A;  4JG2 A;  1I5F A;  3R93 A;  5IGD A;  1SFO H;  1KTK A;  2WB1 B;  5C44 B;  1WI5 A;  1PH4 A;  4IPD A;  1U4L A;  1PH8 A;  1FNU A;  1A15 A;  4C2M H;  2A69 D;  3OW2 A;  1Q46 A;  4N8X 1;  1K28 A;  1Q1B A;  3CRK C;  5BR8 L;  3S1Q H;  3WOE A;  2O4X A;  4QJF A;  4DR3 Q;  3F2U A;  2K7V A;  1NCV A;  2EJF C;  5M3F B;  3TME A;  1E22 A;  4CKC A;  1S5F D;  1NSN S;  2BDN A;  1RKN A;  4NXN L;  5IYC G;  3S16 H;  5M3F H;  1Y1W B;  3NWT A;  1VQB A;  3DUZ A;  3S16 B;  1CKO A;  1LT4 D;  4XIG S;  1Y1W H;  1EWI A;  1AZQ A;  3D3R A;  3A5U A;  2JA7 B;  2B8G A;  4KJO A;  3K7A H;  1U4R A;  4OO1 G;  1A63 A;  2H5X A;  3TS0 A;  2F0G A;  4JW0 A;  5I4D A;  2DJG C;  2VW9 A;  1YIJ A;  4CBV A;  2UXD L;  3I55 A;  2GVB A;  3J80 L;  2PQA B;  3QJY A;  1CTM A;  4HAE A;  3OW7 A;  4DR5 L;  1STE A;  2JA5 H;  4A3M H;  1SYG A;  2BCO A;  1BQQ T;  1II3 A;  4X64 L;  1V43 A;  1TWF H;  1GJX A;  1BNZ A;  3MXN B;  1I4H A;  4RA8 A;  4TSS A;  4RGT A;  5M5W H;  1SE3 A;  3S14 H;  2DNC A;  1HH2 P;  2I5L X;  5EGT A;  2KEE A;  3TZU A;  3F2B A;  4A3B B;  1G6P A;  4HJ5 A;  4A3I B;  5FKA C;  1L1O A;  3IFD A;  1BBW A;  1C48 A;  1HZC A;  1QCB D;  2A19 A;  2ALY B;  4RKB A;  1FYC A;  4TQU S;  1R9T B;  4A3L H;  1STG A;  2GN5 A;  2QA4 A;  3S1N H;  3PIO 3;  1TU2 B;  1HPC A;  2EYF A;  3BVM A;  2XN9 C;  1TII D;  1X6O A;  1H9J A;  1L0W A;  1Q90 A;  2EXD A;  2DUD A;  4H0L C;  1SE8 A;  2E2I H;  1B9N A;  3CCS A;  4ZQ3 A;  2R93 G;  5M5X H;  5JAV A;  1X3E A;  3KF8 A;  1XTC D;  1IBM Q;  1JB3 A;  3A0J A;  4QGU A;  4KKU A;  1SMY D;  1Q12 A;  3J7A 5;  3X3M A;  4FXD A;  3JAM E;  4FF4 A;  2FHT A;  3KJP A;  4JI2 Q;  1H9K A;  2VXW A;  2KJX A;  1STY A;  3A54 A;  1EWC A;  2JA8 H;  5J22 A;  2IX0 A;  1CQF A;  1M1K C;  1PH9 A;  4RGN A;  1VQI A;  2L0C A;  4G7O C;  2PQA A;  4A3K B;  2NN6 H;  3S1M B;  1IYJ B;  3GTJ H;  2KUM A;  3DWA A;  4IUU A;  1KHI A;  3M4P A;  2RCN A;  1EY7 A;  1M90 C;  1N34 Q;  1PV4 A;  1FJG L;  3R2I A;  4BY1 H;  4C3I G;  4MZ9 A;  5JJL A;  4G4K A;  1PDQ A;  2ICI A;  2KEC A;  4JI0 Q;  5CC4 A;  2SOB A;  1K73 C;  1SNQ A;  2PZU A;  3IL8 A;  1DYQ A;  5C0X I;  4MN3 A;  4X65 Q;  5M5X B;  3A8I E;  3OWE B;  2O2L D;  4ZCK A;  2JA6 H;  2NVT H;  1JQY D;  4JOI C;  1SE4 A;  4BY7 B;  3A8K E;  3CQZ B;  2Q2U A;  1S3O A;  3FDT A;  4DR2 Q;  1VQJ A;  2GVA A;  1EY6 A;  4DV1 L;  4K0K L;  4C1N K;  1UUP A;  2EYJ A;  3H3V H;  3EIV A;  1PFM A;  5C0X G;  3GTQ B;  3UE0 A;  4A3G G;  5ELF A;  1QVG A;  2L11 A;  2E5L Q;  2F1M A;  1L1O B;  4WOR A;  2F3I A;  4B08 A;  4ME5 A;  3TP5 A;  1GUO A;  3FKI G;  4IUT A;  5C4X B;  4IUQ A;  1IBK Q;  3K59 A;  1P8L A;  1PZI D;  2MGS A;  5C3X A;  3BDC A;  2Q8R E;  1I94 L;  1CZG A;  3N52 A;  4NMZ A;  2ZXR A;  4KD4 A;  1Q82 C;  2AMC B;  3HP3 A;  1LLR D;  2IWH A;  5IGF A;  1CKN B;  2R7Z B;  4GN3 B;  2CWA A;  1Z7T A;  4DR4 Q;  4KV6 A;  4Z9C B;  1VQ9 A;  1FR3 A;  4DR1 Q;  2R7Z H;  1VQA A;  1RDP D;  5ELN A;  3J81 i;  5HUR A;  2UUC Q;  1A2T A;  2ICE C;  1WTX A;  2XRQ D;  1J6Q A;  1ML0 D;  4YCW A;  1IHZ A;  3NWS A;  1YNJ C;  3A55 A;  2M00 A;  3H09 A;  4IN3 A;  5IGB A;  4OEM B;  5A2Q L;  4L5R C;  3E0E A;  1KL9 A;  5GRO A;  3K5M A;  4B9X A;  4OWW B;  4ID6 A;  3MA2 B;  1N33 L;  1IYU A;  1MSH A;  4DAM A;  1FD7 D;  1BCP D;  4EGV A;  5C3E H;  1TXY A;  1SLJ A;  5CV4 A;  3C1E A;  1J5E Q;  1HNX L;  1BF4 A;  1DJR D;  1I50 H;  2MO0 A;  3AFQ A;  4RWS C;  4UPA A;  4L5T A;  1HZA A;  3MFY A;  4HR7 B;  5CV8 A;  5GAG C;  5IWA Q;  1DXM A;  2VUM H;  3RN5 A;  2LFN A;  1B70 B;  4ABN A;  3Q22 A;  4HCE A;  1EZ8 A;  2A74 C;  4OGQ C;  4GN4 B;  2F3V A;  4RFB A;  3Q0A A;  1SBB B;  3RLN A;  1NJI C;  1HNW Q;  3DEP A;  5BN4 A;  4QUC A;  5C3W A;  4E6I A;  4A3L G;  3HOW G;  1UAP A;  2PI2 E;  2YYZ A;  4OXP A;  3HOU G;  2VS1 A;  2PNR C;  1QZH A;  1X54 A;  4CHT B;  2AKW B;  1PA6 A;  3ERQ A;  5C4J H;  2I46 A;  1BR9 A;  2F4I A;  1NUC A;  4M1U B;  2JXM B;  4JC0 A;  4NW2 A;  3IAY A;  1QZG A;  1WTO A;  4LW1 A;  1EEF D;  4PMW A;  1ASZ A;  1N32 Q;  3J7A V;  4PMC A;  3WWV A;  5C4Z A;  3GV3 A;  4GOP B;  1HUM A;  4EQP A;  1MJE A;  3C46 A;  2IX3 A;  4KJN A;  1TS3 A;  3TBI B;  3S17 H;  3AMU A;  1XMO Q;  1D8L A;  3CCR A;  1I3Q H;  2VNU D;  3I90 A;  1HHV A;  1A62 A;  2WAQ G;  4DV3 L;  4L5S A;  2D0P A;  2A1A A;  4BBR B;  4GOP C;  4A3K G;  4M8A A;  4HMJ A;  3J80 E;  3ND8 A;  1PFS A;  4DR6 Q;  1XX8 A;  4R9W A;  1ZXT A;  2F0F A;  3RLO A;  5BN5 A;  1KIX A;  1EZ6 A;  3WDN A;  1QOH A;  1EY9 A;  2FMM A;  4KY5 A;  4DNT B;  2HD3 A;  4DR7 L;  1OXU A;  3PV0 A;  3CMA A;  2AQ1 B;  1XMO L;  4A75 A;  3M3Y B;  3WOF A;  4LWC A;  2QEJ C;  2CCZ A;  5FO7 B;  2OXP A;  4A3J G;  3QB3 A;  2NTS A;  5EPK A;  4QIW E;  4IPC A;  1YIT A;  3ICE A;  2AHO B;  4JI6 Q;  1F2Y A;  2XWJ B;  3KBX A;  5D3I B;  3GDE A;  3K5L A;  5CBE E;  1JR0 D;  4KY7 A;  3T13 A;  1OXT A;  4DV0 Q;  4LFC L;  4F8M A;  2K04 A;  3S9W A;  4GNX C;  4DAY B;  1PTO F;  3C2P A;  4AQY Q;  1TT2 A;  2NZH A;  3MTS A;  3W2D A;  4HSV A;  4OON A;  2NN6 I;  2RBM A;  4KK7 A;  3ND9 A;  3TEH B;  2HIV A;  1VQL A;  1N36 L;  3S2H B;  4TRD A;  2ASB A;  1YVC A;  1ONL A;  1PH7 A;  1Q3L A;  2ID0 A;  4DXF A;  4J1M A;  3PO3 H;  2A69 C;  1PTO B;  4PNY A;  1BUV T;  1BCP F;  1W3S A;  4BBS G;  4RGO S;  3BG3 A;  4LUV A;  2Q2H A;  3T53 B;  5JEA G;  4H02 A;  4LFB L;  4LF6 Q;  4RCO A;  2K1B A;  4XXE A;  3EN2 A;  1XJV A;  4KI0 A;  1HNX Q;  1MBY A;  2MUY A;  4B3R L;  3S2D B;  5CR3 A;  4A3F H;  1D6E C;  1MSG A;  1N33 Q;  2KBN A;  1R4P B;  2IT1 A;  4K6D A;  3PIO A;  1NAP A;  1NY4 A;  1QUQ A;  1ET6 A;  4G7Z C;  1CKN A;  1VQG A;  5A2Q E;  3GV6 A;  3IKJ A;  4B3R Q;  4XYO A;  3UI2 A;  1YZ6 A;  4LFB Q;  5GAD C;  4PZ7 A; 
#chains in the Genus database with same CATH homology
 2PI2 A;  1XNQ L;  4JBW A;  3CCQ A;  4NXN Q;  2K52 A;  1Q81 C;  4DUY Q;  3M4Q A;  5IP7 G;  4A3F G;  4X62 L;  3PIP A;  4DR4 L;  1CKM A;  3M85 A;  3F2D A;  3M7N A;  3E9H A;  4C3J H;  5JJI A;  1UE1 A;  4JI3 L;  1WCM G;  2RHQ B;  1JB7 A;  1AE3 A;  4HIM A;  1EIY B;  1VQ4 A;  1IZ6 A;  3H0G H;  4JI8 Q;  4A3E H;  5IP9 G;  3M4O H;  4APV A;  2KCM A;  2WFW A;  3ULL A;  1ASY A;  2ZTC A;  5M3F G;  1XNR L;  2HIX A;  3KF8 B;  5LMU L;  5HY6 A;  3CP0 A;  5M3M H;  1QVC A;  1EYG A;  4YY3 Q;  1KAW A;  4LF4 L;  3PCO B;  5FJ8 H;  4DV7 Q;  4IJL A;  2E5L L;  2MFI A;  4A93 G;  5IP7 H;  3FHW A;  1EFW A;  2PNH A;  4IO9 A;  1VQP A;  4GS3 A;  3J80 i;  2N3S A;  2NVX H;  4DV6 L;  4P75 A;  4YHH L;  1LUZ A;  3K80 C;  3ULP A;  1VQO A;  1HR0 Q;  1VQE A;  2ZM6 L;  1YJ9 A;  4DR2 L;  4DK6 C;  4JI4 L;  3PGZ A;  4IPH A;  5M5Y H;  4JI6 L;  1D7Q A;  1BKB A;  3F8T A;  3U50 C;  4DV1 Q;  1FVI A;  3T1Y L;  3I4O A;  1YJN A;  1WFQ A;  4A3J H;  4BY1 G;  4HJA A;  3KFU A;  1UE6 A;  4YHH Q;  4DV6 Q;  5E7N A;  2N78 A;  4BBS H;  2EIF A;  4JG2 A;  1I5F A;  1SFO H;  4P73 A;  1FGU A;  2JE6 I;  4IOC A;  1WI5 A;  1PH4 A;  4IPD A;  2JA9 A;  4DV7 L;  1PH8 A;  1L2F A;  2Q2T A;  4LF7 L;  4YY3 L;  4UY8 C;  4X65 L;  4DUZ L;  1HNW L;  4IFD J;  4L5Q A;  1X55 A;  2LXK A;  1C0A A;  4C2M H;  3OW2 A;  1Q46 A;  1Q1B A;  5BR8 L;  4LF5 L;  3S1Q H;  3KF6 B;  1UEB A;  1QUQ B;  2RF4 A;  4EX5 A;  2ATW A;  1V9P A;  2HHH Q;  1C7Y A;  1O7I A;  4QJF A;  4B3M Q;  4IPG A;  2RHS B;  3I4M H;  1VS0 A;  4UP9 A;  3HOV H;  5IWA L;  4DR3 Q;  4C3H H;  3HOX G;  3CD6 A;  1S40 A;  3GD7 A;  4B3S Q;  3U4V A;  2Z6K C;  4P74 A;  3CQZ H;  1E22 A;  4DV5 L;  4DR5 Q;  1HJP A;  3T1H L;  1EQR A;  2JEA I;  1GKH A;  2MQH A;  4NXN L;  1WJJ A;  5IYC G;  2B63 H;  5M3F H;  3S16 H;  4X66 Q;  2UUA L;  4POG A;  2ZJP A;  4R4I A;  5HGQ A;  1VQB A;  1CKO A;  3KLW A;  4XIG S;  1Y1W H;  1EWI A;  2E8G A;  4JYA L;  4LFA Q;  3A5U A;  2B3G A;  2VQE L;  1LYL A;  2I5M X;  3K7A H;  4A3D G;  1YBY A;  3CAM A;  3HOV G;  3BU2 A;  3UE1 A;  4KHP L;  4OO1 G;  1A63 A;  2H5X A;  2ZTD A;  4ME3 A;  4Y7N H;  3TS0 A;  3HKZ E;  2BH2 A;  2IY5 B;  1VCI A;  2JJQ A;  3M9B A;  3HKS A;  2UUB Q;  2YU9 H;  2VW9 A;  3CPW A;  1YIJ A;  4QQB X;  4LF6 L;  2UXD L;  3I55 A;  2GVB A;  2PQA B;  1YNX A;  1Z47 A;  3W1G A;  3CF5 A;  1KC8 C;  2UUC L;  4NXM L;  4DV5 Q;  4DR5 L;  3CC2 A;  2JA5 H;  4A3M H;  1FL0 A;  1XPU A;  4IJH A;  5GAE C;  4A3B G;  4X64 L;  1V43 A;  1TWF H;  1DGS A;  4PG3 A;  3SGI A;  2K5V A;  1EQQ A;  1JE5 A;  3MXN B;  5M5W H;  4Y52 H;  2BH8 A;  2QEX A;  3S14 H;  2HHH L;  1HH2 P;  3W1B A;  2KHI A;  2I5L X;  2R7F A;  1PHJ A;  4A93 H;  5AJ3 Q;  5BR8 Q;  4LF5 Q;  3UDG A;  3F2B A;  1E3P A;  2F52 A;  1G6P A;  3OYY A;  3H0G G;  4HJ5 A;  2KHJ A;  1HZ9 A;  3CCL A;  4LF8 Q;  2WP8 J;  3GTQ H;  1L1O A;  3I4N H;  1BBW A;  1HZC A;  2A19 A;  3G4S A;  1HNZ Q;  2ALY B;  4TQU S;  2MNA A;  4GOP A;  1TWC H;  3RNU A;  1OTC A;  4AYB G;  1VQC A;  4DV0 L;  4A3L H;  1YHB A;  2GN5 A;  2MO1 A;  3UDF A;  2E2J H;  3HOU H;  1CSP A;  2YTV A;  2QA4 A;  3S1N H;  1R9T H;  3TQY A;  1HR0 W;  4K0K Q;  3HKZ G;  2IHF A;  1PH2 A;  1X6O A;  2K4K A;  1L0W A;  3GTL H;  2EXD A;  2DUD A;  2R92 G;  1SE8 A;  3S1R H;  2E2I H;  4DNI A;  2ZM6 Q;  1A0I A;  1IBL L;  3CCS A;  1PH1 A;  4O2D A;  1PYB A;  3BZC A;  3VDY A;  2CWP A;  1YHQ A;  4LF9 Q;  5M5X H;  2R93 G;  1X3E A;  4OX9 Q;  2HT1 A;  2B29 A;  2CQO A;  1OXV A;  3D0F A;  4A3E G;  2R7D A;  1IBM Q;  2UUB L;  4KHP Q;  3A0J A;  2LSS A;  3GO5 A;  4QGU A;  1A8V A;  1Q8K A;  3J7A 5;  1Q12 A;  3J81 c;  4MNO A;  4JI0 L;  4YWK A;  3L7Z C;  4JYA Q;  3KJP A;  4JI2 Q;  1Z9F A;  4GLX A;  3K0X A;  1YI2 A;  2A8V A;  4POF A;  2VQE Q;  3FKI H;  1KXL A;  5J3B A;  2YTY A;  1N34 L;  3K7U C;  3PUV A;  4AYB E;  4JI7 L;  2JA8 H;  3S15 H;  2IX0 A;  4DV4 Q;  1M1K C;  1GD7 A;  2V1C C;  4MTN A;  1PH9 A;  2JA6 G;  1VQI A;  2AWN A;  4DR6 L;  4FDB A;  3W5O A;  2VQF Q;  4WJ4 A;  2Q2I A;  4DV4 L;  2JA7 H;  2PQA A;  4YCV A;  1AE2 A;  4A3I G;  2UXC Q;  1IYJ B;  4R4C A;  3GTJ H;  1KRT A;  5C44 H;  4GNX A;  1KHI A;  2JK8 A;  3M4P A;  2RCN A;  3PO2 G;  1B7Y B;  1M90 C;  1KRS A;  1PV4 A;  1N34 Q;  1FJG L;  4BY1 H;  3GTK H;  3RN2 A;  4JI2 L;  3GTM H;  1N9W A;  4MZ9 A;  3HOX H;  1W2B A;  5JJL A;  1C9O A;  3GTO H;  1P16 A;  4JI0 Q;  1VQD A;  1K0R A;  3FP9 A;  3PUX A;  1K73 C;  2Y0S E;  2OQK A;  3F1Z A;  3ZJY C;  3J81 j;  1IBK L;  1VQ8 A;  3PO3 G;  5C0X I;  4X65 Q;  1SR3 A;  4JBK A;  4JV5 Q;  1G29 1;  1YHA A;  2JA6 H;  2NVT H;  3B6Y A;  4JOI C;  1X65 A;  4A76 A;  3BJU A;  4WJ3 M;  4OX9 L;  1IBL Q;  1JJG A;  1E24 A;  2Q2U A;  2QGQ A;  2HQL A;  1S3O A;  3ERS X;  3PO2 H;  4GNX B;  1NTG A;  3G6E A;  1CUK A;  4DR2 Q;  3PF4 A;  4BY7 H;  1VQJ A;  4BBR H;  2GVA A;  3T1Y Q;  5EAY A;  4DV1 L;  2K5N A;  2JA7 G;  1Q86 C;  3H3V H;  4K0K L;  3TS2 A;  5H1S E;  1JT8 A;  3EIV A;  2UXB L;  1UWV A;  5C0X G;  3JAM c;  3UE0 A;  3HOY H;  4A3G G;  1QVG A;  2E5L Q;  3DLL A;  1L1O B;  3F2C A;  1N36 Q;  2CFM A;  2F3I A;  5LMN W;  1VQK A;  2BA1 A;  3HOY G;  2I0Q A;  4LF8 L;  5LMN Q;  1HNZ L;  4A3G H;  3FKI G;  1IBK Q;  1VQF A;  1JMC A;  3L0O A;  1P8L A;  4OO1 I;  5LMU Q;  5IE8 A;  1XPO A;  1UE7 A;  4X6A H;  4BBS G;  3D31 A;  1YJW A;  4JI8 L;  2OTL A;  2NVQ H;  1I94 L;  1LM0 A;  1XNR Q;  3NEN A;  1EIF A;  4JCV E;  4AIM A;  3J80 c;  3L2P A;  1SN8 A;  3A5Z B;  3PSI A;  2AMC B;  1Q82 C;  1QVF A;  1VQM A;  4QL5 A;  1L1O C;  2R93 H;  1CKN B;  4IFD I;  4GN3 B;  2CWA A;  4DR4 Q;  2PMZ E;  5FLM H;  3CCV A;  4B3T L;  1VQ9 A;  4HJ9 A;  4DR1 Q;  2R7Z H;  1VQA A;  5ELN A;  3KDF A;  4X62 Q;  3J81 i;  4BA2 I;  4A3C G;  1V1Q A;  4DPG A;  2UUC Q;  1E1T A;  2R92 H;  4IOA A;  3PUY A;  4A3D H;  4GKK Q;  4A3B H;  1MKH A;  1TWG H;  5FJ8 G;  1J6Q A;  2C35 B;  4A3I H;  3RLF A;  1VQ6 A;  4YCW A;  2R6G A;  1NMG A;  3NEL A;  4R1J A;  2FXQ A;  3KF6 A;  4JOI A;  2D0O A;  5IT9 c;  2ZJR A;  4L5R C;  3E0E A;  3I4N G;  1KL9 A;  5GRO A;  2YV5 A;  3U58 A;  4OWW B;  4O0A A;  1N33 L;  1B8A A;  3GTG H;  4GKK L;  4X66 L;  4DAM A;  3S1M H;  3DM3 A;  5C44 G;  4HIK A;  5C3E H;  5IYD G;  3J7Z C;  1TXY A;  4LF9 L;  1SLJ A;  1J5E Q;  2VL6 A;  1MIU A;  3CPF A;  4JI1 Q;  1HNX L;  3S2H H;  4DR1 L;  4XTC S;  1I50 H;  1VQ7 A;  2MO0 A;  3CC7 A;  4B3T Q;  3AFQ A;  1JJC B;  1X3F A;  2K75 A;  4L5T A;  4UPA A;  1EUJ A;  4BXX G;  1HZA A;  2N49 A;  4B3M L;  4B3S L;  3HOZ H;  1X56 A;  5GAG C;  5IWA Q;  2VUM H;  5ELO A;  3RN5 A;  2KEN A;  1B70 B;  4LUZ A;  3RZO H;  1H95 A;  4DV3 Q;  4TVA B;  1RIP A;  1I94 Q;  4HIO A;  4OWX B;  4GN4 B;  3UDX A;  1GM5 A;  1AH9 A;  3TRZ A;  4LF7 Q;  4HJ7 A;  3I4M G;  1NMF A;  1NJI C;  3RLN A;  4DUZ Q;  4AQY L;  1HNW Q;  4DKA C;  4OWT B;  5M3M G;  3KYH C;  5LMN L;  4GN5 A;  4A3L G;  3KOJ A;  3HOW G;  3UDI A;  2OQ0 A;  4DK3 C;  1Y1W G;  1Y1V H;  4LFC Q;  5IYC H;  2PI2 E;  2YYZ A;  4OXP A;  1N32 L;  1PH3 A;  1RL2 A;  3HOU G;  2VS1 A;  1QZH A;  1SRU A;  1X54 A;  4UP7 A;  4A3K H;  5GQO A;  2UXB Q;  2KCT A;  3HFZ B;  2AKW B;  1PA6 A;  5C4J H;  4NXM Q;  2AWO A;  5C4X H;  3A74 A;  2WB1 G;  3KJO A;  1HR0 L;  1GO3 E;  4JC0 A;  1LTL A;  3I56 A;  1QZG A;  3OTO Q;  1XMQ Q;  2UU9 Q;  3Q8D A;  4LW1 A;  4PMW A;  2IHE A;  1ASZ A;  3AYH B;  3ER0 A;  3AQQ A;  1N32 Q;  4JI5 L;  4JV5 L;  3WWV A;  1EOV A;  1BBU A;  2ZTE A;  4GOP B;  3LGJ A;  2OWO A;  4EQ5 A;  1K8A C;  1PYS B;  3G71 A;  1MJE A;  4LF4 Q;  1Y1V G;  2NVY H;  4NB3 A;  4AH6 A;  2OCE A;  1E1O A;  2B63 G;  3S17 H;  1MJC A;  1XMO Q;  1D8L A;  3CCR A;  1FJG Q;  1I3Q H;  3NEM A;  3S2D H;  1I6H H;  3EBE A;  4JI3 Q;  2VNU D;  2JQO A;  1A62 A;  2WAQ G;  1JJ2 A;  4DV3 L;  2UUA Q;  1SMX A;  2EQS A;  2K5H A;  2E2H H;  2ZJQ A;  4L5S A;  2VY3 A;  1UE5 A;  3PUZ A;  2D0P A;  2A1A A;  4GOP C;  2UXC L;  1OXS C;  3MEF A;  3KDF B;  4HID A;  1VQH A;  2VQF L;  4A3K G;  5IP9 H;  3CCE A;  1WYD A;  1PFS A;  4DR6 Q;  4DUY L;  1WOC A;  1N8R C;  3RLO A;  5C4X G;  2IX1 A;  4GLV B;  2Y0S G;  3K8A A;  4DR3 L;  1U5K A;  1XNQ Q;  1KIX A;  1PVO A;  4PZ8 A;  5GAH C;  4PZ6 A;  1J5E L;  4JBM A;  4BBR G;  2K14 A;  3U4Z A;  4IFD G;  4JI7 Q;  3K81 C;  1X3G A;  5JJK A;  2DGY A;  3CCU A;  5DLQ E;  3CXC A;  4DR7 L;  1OXU A;  3PV0 A;  1BVS A;  2BA0 A;  4JBJ A;  2Z0S A;  3CMA A;  3CME A;  2OTJ A;  1K3R A;  1XMO L;  4LNQ A;  1NE3 A;  4A75 A;  1KQS A;  3H15 A;  3STB D;  1GVP A;  4LWC A;  1NBW A;  4R4O A;  1IBM L;  1VQN A;  2I5H A;  3I7F A;  2CCZ A;  4A3J G;  1KD1 C;  1K9M C;  2CKZ B;  4UP8 A;  3STB C;  3CC4 A;  1HZB A;  5C0X J;  4QIW E;  4JI5 Q;  4IPC A;  1YIT A;  3ICE A;  1XMQ L;  3JC6 6;  4DV2 Q;  3OTO L;  2UU9 L;  1K83 H;  4BA1 I;  4RMF A;  3HOW H;  2AHO B;  1PH6 A;  1OXX K;  5JEA J;  4JI4 Q;  4JI6 Q;  5IYB G;  3RZD H;  2JEB I;  2NZO A;  2YTX A;  3GDE A;  2VZA A;  3S24 A;  4BY7 G;  4GKJ L;  4QY7 A;  3CCJ A;  1SRO A;  5FLX c;  1XTD A;  2XTI A;  4P71 A;  1OXT A;  2Z6K A;  4DV0 Q;  4LFC L;  4J15 A;  3AEV A;  4A3C H;  4R4Q A;  3GTP H;  5IYD H;  2F4V L;  3AFP A;  4GNX C;  3CW2 C;  1K8G A;  4A3M G;  4DAY B;  2XGT A;  1U0L A;  4AQY Q;  3I2Z A;  4A4I A;  2NZH A;  3HOZ G;  4YWM A;  5AJ3 L;  3CCM A;  4OON A;  1PH5 A;  2NN6 I;  2F4V Q;  3PUW A;  4ALP A;  3TEH B;  2HIV A;  4P72 A;  1VQL A;  5IYB H;  1N36 L;  2NN6 G;  4KLK A;  4C3I H;  5IY0 A;  2ASB A;  1YVC A;  1X9N A;  2WAQ E;  1G51 A;  3BZK A;  1PH7 A;  1IXR A;  2N8N A;  2ID0 A;  5K36 G;  4YCU A;  5FLM G;  3M3Y H;  4HJ8 A;  3PO3 H;  3ULJ A;  1S72 A;  1W3S A;  2L15 A;  4R4T A;  4YWL A;  4X64 Q;  4GLA C;  4NPS A;  4LUV A;  3RR5 A;  4DV2 L;  4GKJ Q;  2Q2H A;  3PF5 A;  2R7Z G;  5JEA G;  4H02 A;  4LFB L;  4RG1 A;  4LF6 Q;  2VUM G;  2UXD Q;  1T9H A;  1XJV A;  3EN2 A;  1WCM H;  1TWH H;  4KI0 A;  1Q1E A;  4JI1 L;  1HNX Q;  2ES2 A;  4BXX H;  4B3R L;  2LXJ A;  2D62 A;  3G48 A;  4KHZ A;  1YEZ A;  4A3F H;  2WB1 E;  1E7Z A;  1CSQ A;  1VQ5 A;  3JAM i;  1N33 Q;  2KBN A;  2K50 A;  2IT1 A;  5C3E G;  1XPR A;  3PIO A;  1Q7Y C;  1NY4 A;  1IL2 A;  4DR7 Q;  1QUQ A;  3H3V I;  2JA5 G;  3NBH B;  3TRE A;  1CKN A;  1VQG A;  4LUO A;  4LFA L;  1Y14 B;  4B3R Q;  1TWA H;  3E9I A;  1YZ6 A;  3IRB A;  2JA8 G;  3T1H Q;  4LFB Q;  5GAD C;  4PZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...