1LTID

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltiD00
5TSSA 1ET9A 1TY0A 1V1OA 1PRTC 1PZID 1UNSA 5ELBA 1V1PB 1FNUA 1F77A 4TSSA 1SJED 1TS3A 2RDHA 4DXGA 2QILA 2AQ2B 1AN8A 1LLRD 2Z8LA 4L63B 5FKAC 3R2IA 2SEBD 3BVMA 4BWGB 1XTCD 3BVZA 1LT3D 4L6TB 4RH6A 1ET6A 1L0YB 1TY2A 2WV6D 1LO5D 5D3IB 1QILA 2R61A 1D5ZC 2IJ0A 1CQVA 1S5FD 5ELFA 1LTAD 1PRTF 1TS2A 1G8ZD 1HA5A 2AQ1B 1FNVA 3BYTB 1PYWD 3SEBA 1S5DD 1PTOD 1RF2D 1ESFA 2NTTA 3W2DA 1CHQD 3BVGA 5I4DA 3O13A 5FK9C 1T5XD 2IPKD 1HXYD 1JR0D 1LT4D 1B1ZA 1TS5A 2O2LD 4RCOA 1HTLD 5D3DA 1JQYD 1BCPD 3KLSX 1I4XA 1I4RA 1PTOB 2NTSA 1XXGA 1PTOC 1CHPD 1D5MC 1EEFD 3R8BA 1LTGD 3BYYB 1SJHD 4OHJA 4RGTA 2TSSA 1BCPB 2XRQD 3V05A 1GOZA 3TSSA 1SE3A 4RHRA 1MD2D 1LTBD 1LTTD 1PZJD 1KLGD 4RGNA 4RHSA 1I4GA 1EWCA 1JWSD 1KLUD 1SBBB 1SEBD 3EFXD 4RGOS 1S5BD 3DWPA 1L0XB 3BZDB 1UUPA 1AW7A 1PTOF 1LTSD 3DWAA 1I4PA 3MC0B 2XNAC 1FGBD 1KTKA 1JWUD 3MFGA 4Z9CB 3URYA 1D5XC 1TS4A 2QEJC 1CK1A 2RDGA 1RDPD 1LT6D 2ICIA 3DWQA 1PRTD 4RGMA 1RCVD 1EU3A 1JWMD 1LTID 1RD9D 1SE2A 3CHBD 4C56C 1D6EC 2CHBD 2XRSD 1BCPC 1S5CD 1BXTA 1PZKD 4O1NA 2G9HD 2XN9C 4UDUC 1PRTB 1CT1D 1EFID 4K6LA 1EEID 1HQRD 1SE4A 1LTRD 1LT5D 1EU4A 2J4XA 1I4HA 4DXFA 1V1PA 3R2TA 3EA6A 1STEA 5ELDA 1PTOH 5ELEA 1DJRD 4ZYSA 3GP7A 5ELCA 1SXTA 1FNWA 1BCPF 1B44D 1S5ED 1FD7D 4RFBA 2AQ3B 1JCKB 1I4QA 1M4VA 3OWEB 1ENFA 1DYQA
chains in the Genus database with same CATH superfamily
4DUYQ 3PO3B 3AYHB 4J8QA 3G7LA 1H9SB 2DNEA 5HURA 1CFMA 1U4PA 3E6ZX 1MI2A 2RKSA 3CP0A 3TP8A 1A0IA 3HS0C 2RDHA 2QILA 3HKSA 2AQ2B 4DAMA 1DONA 4BA2I 2HCCA 2KJXA 5M3FB 5I9PA 2R93H 2UXDQ 1I94Q 3E0EA 2JA8G 3HOXB 3VYSA 3QIAA 3PQIA 4R4IA 5DNFA 1ZEQX 1Z6HA 2Q8IB 3RZOH 1KDCA 2ZM6L 2LS01 3C1FA 1HXYD 2O2LD 2KECA 3KLSX 2R7ZG 4A3MB 1XYIA 3V96A 4OX9Q 1BBWA 4FF4A 1W6KA 3CC2A 4JI2L 4LFCQ 3NPPA 2A6HD 4N8FA 1PDQA 1YBYA 5DM73 4K8IA 2JQOA 1AFPA 2ENBA 3H0GB 4ODGA 3J7AF 2SNSA 4LF4Q 4RGNA 1E2ZA 3Q23A 1O78A 1I3QH 2ZJPA 2B2TC 1IBLL 2H5XA 1SFOB 3M9BA 3WWVA 2G5DA 4GN3B 4OO1I 3HOYG 2BA1A 5COYA 3OYYA 1Q1EA 4J6HA 4OWTB 4L5RC 5IIFA 4NP5A 1T9HA 4UPAA 5GROA 1HR0L 4A3DH 2E2JH 3VR5A 4DR5L 2B2VA 2F0UA 3TMEA 1JOQA 3CQZH 1YITA 1SNMA 2EYPA 3JAML 2Q2IA 4N8X1 4M8AA 1PYBA 2NBFA 4DR7L 5C4XB 4JW0A 3H94A 2SDFA 3ULJA 1XJVA 4O2DA 5C5MA 2YTXA 2RHSB 1EY6A 1U0LA 5T1IA 1Y1WH 3ICEA 4A3EG 3NQTA 3C1EA 2B8FA 3G4SA 1EYGA 1DOKA 3KK7A 1B44D 2KCMA 4P72A 1JCKB 2Q8RE 3W5OA 3OWEB 4YCUA 1HNXQ 3OWFA 2WAQB 2PZUA 2XSCA 1F2MA 1STGA 2PW5A 2DUDA 1WTXA 4HN7A 4PV1C 3HP3A 4DGZA 2Y0SB 4DUYL 4LWCA 4MNOA 1NBWA 3C46A 4C3JG 4KN7C 1II3A 4KN4C 5M5YB 1STBA 1OXSC 2NZ1D 2PW7A 3N52A 3ZYYX 2NUCA 1J6QA 3CCRA 1I94L 5BR8Q 2CCZA 2L11A 2UXDL 5J3BA 4DUZQ 1GUWA 1TWFH 4KY6A 2EOTA 1EIHA 3S17H 5IGCA 3GTGB 2NVTB 4BBSH 2KBNA 1JQYD 2LXKA 3NTIA 2CVRA 1PTOB 2NTSA 3R8BA 1C0AA 2Z4HA 1KL9A 1BCPB 5M3FG 3IFDA 1VQEA 4AYBB 1HJPA 1XTDA 1LYLA 1LTBD 1LTTD 4B08A 3HOXG 4OX9L 1TWHB 2J7ZA 4LFCL 1KD1C 1STNA 5ELNA 1ICFB 1KRSA 5I6YA 2UXBQ 2EDGA 1NY4A 2NN6I 4ZRZA 3NENA 1UUPA 4LF4L 3NP8A 2UUCQ 3URYA 3RN2A 3GTMB 4HMIA 3GQBA 5E7NA 3Q0AA 4DV2Q 1ICWA 1LT6D 2JXMB 5IGFA 2K14A 3MXUA 3BS1A 4A3MG 1VQ7A 2Q2UA 1D1KA 2F1MA 4FDBA 1BXTA 1PZKD 3MEHA 4K5WA 2ES2A 1PRTB 1GD7A 1EFID 4OXPA 4A3EH 4A3FB 1EEID 1QNUA 5FLXc 4P71A 4OL7A 4DR1Q 4HEDA 5FO7B 2LY7A 3K57A 5IYDH 2R3ZA 4FXGC 4DXFA 4F8MA 1WFQA 1CQFA 3E5SA 1GVPA 2A68D 5KYLA 1V1QA 1SXTA 3STBD 4XQQA 3KJOA 1PH9A 2JA5H 4GKJQ 1PH4A 3HOWB 1VQCA 4FF3A 1FGUA 3TRZA 4CKBA 4HR7B 4XT3B 5AJ3Q 1BR9A 3QWNA 1PZID 3VYRA 2WFWA 1H9JA 1F77A 1I6VC 2HIVA 2KVMA 2XTIA 3BZCA 1HNXL 3SK6A 1CKMA 1QNKA 4KK7A 1EY0A 4BWGB 3H91A 1ZYRC 5C44G 5C4XG 4HSVA 4LFBQ 3I55A 1PMRA 3KLSA 2R61A 3DXJC 1K9MC 2F0HA 1D5ZC 2KA7A 3AMUA 1Q8IA 4L8JA 1EFWA 3I4NH 2HDMA 4K5VA 1RF2D 1EL0A 3G71A 4DPGA 1X55A 5CV6A 2IX0A 5BR8L 2QDLA 1WTHA 2BE5D 4NW2A 4GNXA 4DUZL 3HEJA 3I90A 1SYFA 2YTYA 1CKOA 2N78A 5GQOA 1YIJA 1IW7C 1VQKA 1C7YA 2IT1A 1YJ9A 2IY5B 1BF4A 3V05A 2Y0SG 1Q3LA 5GAHC 4RHRA 3PO2H 1EIGA 3RD4A 1W2BA 4A3GG 2NZOA 2Z6BA 1S5BD 4GNXB 1PTOF 3TP6A 4OO1H 4L5TA 4YWMA 1TXYA 5M5WB 1D7QA 4ULLA 2UXBL 3JC66 2VQFQ 3NELA 2UUCL 1J9OA 1GO3E 5IP9H 1KABA 1VQAA 4DV2L 4R8IA 1HCZA 2OEOA 5DM63 3JAMc 3TS0A 1L2FA 3K6OA 4AYBG 4RCNA 1X6OA 4R4OA 1V1PA 2E76C 3GO5A 3EA6A 2ZJQA 2SOBA 1M1KC 4A3BB 3GTKB 4ZKBB 2E2HB 4DR1L 3E9IA 2B29A 1P8LA 3W1GA 1VQBA 3GTPH 5C44H 4BBRH 4HJ9A 4PMWA 1U4MA 2R92B 4OEMB 1U5KA 1V1PB 4DV7Q 3S15B 3K5LA 4GKJL 3A8KE 1JJ2A 4JBKA 1LLRD 5IYCG 3BVMA 4A3FG 2LMCB 2WKCA 3BVZA 4QB4A 5AJ3L 4YCWA 2A73B 3M7NA 3RZDB 4H7BA 1FYCA 2I5MX 1CQVA 2LXJA 3DM1A 1Z7TA 1EQRA 3NSWA 1FNVA 4DV0Q 1L1OA 3S1RB 5I9OA 4LFBL 3FRPB 2WAQE 4P75A 2B2TA 5C0XI 1LUZA 3OMGA 1U9RA 3HOWG 3VR6A 3A7AB 3SE0A 2I5HA 5JPMC 5M5YH 4K0KQ 4A3GH 3L9AX 3GTLB 4QJFA 1HZAA 1WTRA 3FKIB 4QMGA 4V190 1Y8PB 3UDXA 1L1OB 1YNXA 1ESRA 4DV1Q 1EIYB 4RHSA 4LUVA 2F03A 1A3VA 1IL8A 2LKVA 4UY8C 2ALYB 2NVTH 5ISRA 1A8VA 1GUSA 2NN6H 3BZDB 4B3MQ 1LTSD 3F8TA 2RSNA 3MFGA 1UWVA 1Y1VH 1D5XC 2EPBA 4IZ8A 3CU7A 3GD7A 1NCVA 3S14H 3GV3A 1VQ9A 1Q12A 2ID0A 3CKIB 5CGKA 1TWHH 1MJEA 3TZDA 1QG7A 3I4MB 1BCPC 1Q82C 1SNQA 1PA6A 4BY1G 3MXNA 4GN4B 3CC4A 2VQFL 1KAWA 3TP5A 1E2VA 4X3SA 2K5NA 1I4HA 2A6ED 4KD4A 1DM0B 2XIWA 4DK6C 1U4LA 2FMMA 2B63G 3NK9A 3J7YW 3GTOH 3D6WA 4JBJA 2X6GA 3IRBA 2MP1A 1K8AC 1RKNA 3MXNB 5IYCH 1H9MA 4TSSA 1B9NA 1Q90A 4FF1A 2EYFA 1JC7A 3UE1A 1PRTC 4C2MB 1IKMA 2AHOB 3MTSA 4ILWA 1YI2A 2L12A 3P1HA 2F0OA 1BOSA 1SRUA 4ZCKA 4KHPQ 2KOLA 4YWKA 3CMAA 5CMDA 2QA4A 1S72A 3L2PA 4KI0A 2KHJA 4DV7L 3HOWH 5KIXA 1CSQA 2VZAA 2IJ0A 4JG2A 4A3BG 1RODA 1I6HH 4JI7Q 1FR3A 1RIPA 3S1QH 4PZ7A 3T13A 4CJ1B 1HHVA 4UP7A 1EQVA 1WI5A 1ESFA 3AB9A 2F0LA 1HFNA 3HOZG 1HUNA 3F1ZA 5CORA 1HFGA 3A7LA 4DV0L 2SNMA 5I6WA 2R92G 2AUKA 4JC0A 4P73A 2E2IH 3ER0A 1TWAH 4QY7A 5C0XG 1M90C 5J39A 1GOZA 1SE3A 1TWGH 1I50B 4A76A 4K0KL 2A6HC 1KLUD 2Q8TA 1CUKA 4LF5Q 1JOOA 4DV1L 4R4QA 3DWAA 3MC0B 4X62Q 4BY1H 2VL6A 3CPWA 2F3IA 2UXCQ 4JI5Q 3QR8A 3NTHA 3HOVH 5EKLA 4CDEC 2F0WA 3CHBD 1LACA 1D6EC 2CHBD 2F0TA 4B3ML 4Y7NH 3LWUA 5C6AA 4DNIA 2O5JC 1XPUA 2XN9C 2PPBC 4I7AA 2B63H 2YV5A 3SVMA 1NMGA 1UE7A 3FKIG 3OOCA 1ZKOA 4ABNA 1PH5A 3HG9A 1VQ6A 1NNXA 1K83B 2F0FA 3I7FA 2VB2X 3CCJA 1Q86C 5ELOA 4LW1A 2VY3A 5ELCA 2F0EA 3A54A 2ZT9C 3AQQA 5CV9A 4OONA 5DLQE 3S1NB 1IYVA 1K3RA 2K50A 4IN3A 2Z1CA 4ZAIA 5I2XA 1YHAA 2NWGA 2JA7B 1KDAA 3ND9A 3FVQA 2FMCA 3CCLA 4DU9A 2E2HH 1AE3A 1GXDC 4JI0Q 2OXPA 4TQUS 4X6AH 3RN5A 1MHWC 1GHJA 2VS1A 3PUVA 1NE3A 1LO5D 3GTQB 3KBGA 3A8JE 3HOZH 4YWLA 2GVAA 4KHPL 1HA5A 2UUBQ 2L15A 4CHTB 2R92H 3K7UC 1W6JA 2VB3X 3IAYA 1FVIA 1CHQD 5C0XH 2FINB 3O13A 4JI4Q 5FK9C 5A2QL 1TIID 4R9WA 4JI7L 4C3HG 4LUZA 4APVA 5M3MB 2A8VA 4CDCC 3M7GA 1UEAB 2BH2A 4C3IB 2K7VA 4FF2A 2MPMA 1WJJA 4LAAA 3TZUA 2A69C 1S40A 5C4JB 1ILPA 4O0AA 3DM3A 3DEPA 3MZ5A 2RA4A 1WCMH 5GAGC 1HZBA 2Q2TA 2JA6B 1SNCA 4DF7A 4LF7Q 1L0XB 1Z47A 2IHEA 5IT9E 4IOCA 1CZGA 5BN4A 1SN8A 1VQHA 3GTJB 4QL5A 1PFSA 1FGBD 1H95A 2ZXPA 4CKCA 5DAUA 2RDGA 3GTLH 1HQMC 4JVZA 3FKIH 4LF5L 2F0JA 1EU3A 1Q8KA 1N33Q 3S2DH 4ME5A 4DFAA 5JJKA 4X62L 1TWCH 2UXCL 1L1OC 4JI5L 1UAPA 4GLXA 4BY7B 1C4QA 1EU4A 2J4XA 4A3JB 4JOIC 1EQTA 3Q24A 1R4QB 4P74A 1YJWA 3M4QA 3KJPA 1K0RA 5KNBA 2C9OA 2JP1A 3MEFA 1J8IA 5C4HA 4PNYA 4LNQA 1FD7D 2K01A 2PNRC 3J80E 1LV9A 2A68C 2OWOA 3HOUB 1G2SA 3STBC 5IODA 5KNCA 1E22A 5C3EH 4AH6A 1WYDA 3D6CA 2O4XA 2F0DA 4CDDC 2PMZE 1SYCA 3M3YB 2WV6D 5D3IB 4ZUIA 1QILA 1HNZQ 2K6AA 4JYAQ 1K8GA 1E24A 1S5FD 5ELFA 4C3HH 4JI0L 3KUPA 3KLRA 5I2YA 2JA8H 1KAAA 1KDBA 2AKWB 2NVYH 3OPOA 2RCNA 1TR5A 1T5XD 2MUYA 4NMZA 5C0XJ 2HQEA 2B2YC 1HTLD 3BZKA 2A74C 2CW0D 3VYTA 3ND8A 2A19A 2UUBL 4GLVB 4LF6Q 5JVG3 3M4OB 3A5ZB 2CQOA 4KJNA 1R9TB 5KGUA 4JI4L 1SJHD 5LMNW 3P75A 3VR2A 1EYDA 5IOCA 1HPCA 3L0OA 2R7ZH 1N34Q 2MNAA 3UDFA 2NVXH 3X3MA 4Y52H 4HMJA 4N9TA 2E74C 3RLNA 2K4KA 1YEZA 4LK1C 4UP9A 4BA1I 3PO3G 1UE6A 2XNAC 2OF1A 4G7ZC 1RHPA 2K33A 2QEJC 3CRKC 2DJFC 2FJ2A 1N8RC 1RDPD 1XX8A 1Y8NB 4LF7L 3I2ZA 1X54A 3SGIA 3C2PA 4A3LG 1SE2A 3U9OA 2C35B 1QJOA 3NBHB 1ILQA 5EBDA 3RMHA 3U4ZA 2RBMA 3HOYH 2PO4A 1WVLA 4A3IB 3OSOA 4C3IG 2L4NA 2Z6KC 3A0JA 1TT2A 3AEVA 1N33L 1H9RA 5C3XA 2JEBI 3AFPA 5HGQA 4O42A 4MTNA 1JB7A 2JA6G 2X69A 4KLKA 3VR3A 4WJ3M 2KHSA 5HY6A 4ZK9B 1M8AA 2K52A 3K7AH 4JBWA 1S5ED 4Q0FA 1I4QA 3BDOA 3TQYA 1B50A 1SYEA 1F9SA 3I91A 4GS3A 2VQEQ 4RA8A 3NBIA 3ONAB 1XMOQ 4K2KA 4HIKA 2EZVA 3H0GG 4HIOA 1VQGA 3TN2A 1KQSA 4BY7G 1O7YA 3Q8DA 1XNQQ 4IPDA 4A3JG 1PXUA 3CCVA 3KYHC 1EOVA 1CKNA 2PZTA 3OW7A 2EYLA 1IBMQ 2AWOA 1K28A 4UHVA 2Z0SA 3K80C 2Z4IA 1G8ZD 1NR2A 3ULPA 2F0GA 4LF8Q 4C3JH 4K2LA 1HNZL 1HNWQ 2CFMA 3RUZA 4JYAL 4DV4Q 2EYHA 2X6LA 3D0FA 3HOUG 1JICA 5IP7G 1EZ8A 5E3FA 2HUGA 1OXXK 3NUCA 5E1FA 3CF5A 5M9OA 2D0OA 2EXDA 2EY5A 1PHJA 3K81C 1PVOA 1CKNB 3BYYB 1QB5D 3S1MB 4RGTA 1VMCA 1EYCA 5D14A 4EQPA 4JBMA 1AE2A 2NB0A 3PO3H 4Q5VA 4IFDI 1PZJD 4A3KB 1KLGD 4LF6L 3FHWA 1EWCA 1STHA 3PIOA 1SBBB 2OTLA 1F2YA 2ATWA 1RTNA 4WFN3 3DWPA 3CMEA 2WAQG 5A35A 5M3FH 3R3OA 4U673 1N34L 4XIGS 3PUZA 1JWUD 4J1MA 3HOXH 4X64Q 4AIMA 4C3IH 4RG1A 3T1HQ 2NZHA 2F3VA 1EY4A 3QB3A 1SR3A 4A3CG 1S5CD 1B2TA 2EXZA 4A75A 3NE5B 1YNJD 5AFWA 1HQRD 3S16B 1X3FA 2JEAI 3NQIA 4A3MH 4A93B 1D1IA 2E5LQ 1JJGA 5ELDA 1B9MA 3CCEA 3KBXA 4EQ5A 1ENAA 1EWIA 1BCPF 2FHTA 3WOFA 1CA5A 3H0GH 1BO0A 4DR4Q 1Z9FA 2EQSA 4KV6A 3H09A 3CCSA 4JV5Q 2IX3A 4NXNQ 4BY7H 3CAMA 3E3XA 5TSSA 4ZKCB 2DJGC 2QDBA 1SFOH 4A3JH 5CBAE 1QZGA 4XYQA 4E6IA 1PH7A 4FVMA 3K5OA 4A3IG 1VQFA 2IL8A 4JCVE 1A2UA 2VQEL 5M5XB 3J81E 3TDQA 1XMOL 2YU9B 3VA7A 2KCNA 4G7HC 1E3PA 1LTAD 4OELB 5IP7H 1PRTF 1PH8A 1K0SA 2KEDA 4J15A 4NXMQ 3D4RA 1XNQL 2VUMB 3BYTB 1NTGA 2OQ0A 5C4XH 5EPLA 1BBXC 3K59A 4BS9A 3W2DA 1E0BA 3S2HB 1CI3M 1V8QA 3T1YQ 1JR0D 1IBML 2NVQB 4FXKC 1X32A 2IWHA 1MIUA 1VDZA 1ASYA 4LF8L 3C3LA 1XXGA 1PFMA 4KHVA 1LTLA 1HNWL 1AEXA 1KXLA 2ZXOA 2LFNA 1SYGA 4DV4L 1Q46A 2JK8A 4I7ZC 3PUYA 4QCLA 5LMUQ 4DA2A 1BDOA 4HCSA 2PZWA 3G6JB 1I4GA 4XQNA 3T56B 4MHEA 1E7ZA 5JAVA 3ERQA 2B8GA 3LWEA 3U4VA 3EFXD 5IY0A 4FYDA 4HJ7A 1JOKA 4L5QA 4JOIA 1F2ZA 4RWSC 3RLOA 2R93B 4IFDG 1TS4A 1WD1A 2K04A 5CV8A 2IX1A 1SLJA 4HIDA 2EYMA 1JWMD 4C56C 3EQLC 3IL8A 3SHLA 4X64L 2EJGC 3MFYA 3PMFA 3E0JA 3EJIA 3OIPA 3RZOB 3T1HL 3GTGH 1LTRD 3CCUA 3SK4A 4A3KG 1STEA 1PTOH 2MFIA 5ELEA 2O5IC 3P20A 4KJOA 3J80i 5IWAQ 1FNWA 3PIPA 2AQ3B 5JVH3 1M4VA 3IKJA 2E5LL 1G2TA 2CWAA 1AH9A 2M00A 2I46A 1TY0A 4XDXA 1IW7D 4OIJA 1JT8A 2N88A 1SJED 4DXGA 4DR4L 1OXUA 3I8ZA 3PF5A 3GTMH 2PMZB 4JV5L 2B2YA 4NXNL 1WTOA 4PZ6A 2H4OA 4X65Q 5HGTA 4RAUC 1NUCA 4K8JA 4YY3Q 5L37A 1Y69U 1Q7YC 4A93G 2KENA 4RKBA 1QUQA 2L1BA 4A3DB 2GVBA 2E2JB 4MIUA 3FMCA 4A3FH 1C48A 4IPHA 3CQZB 1VQ5A 2IW3A 5IT9L 5I4DA 3SK5A 3F2BA 2IPKD 2KUMA 4RCOA 1VQOA 1DD2A 3QJYA 2L9HA 4NXML 3UDGA 3M4PA 2R7FA 1Y1WB 2MHVA 1PH3A 3PIP3 2F0NA 1QUQB 5CV7A 1NSNS 3F2UA 4X3TA 1IBKQ 2XRQD 3GV6A 3T1YL 2K03A 2I5LX 2GA4B 3KOJA 1OXVA 2K28A 4NDXA 2JE6I 2Z6KA 2RQXA 2MGSA 3BDCA 1WTVA 4IQZA 4V0BA 1PH2A 5LMUL 3H15A 4JI3Q 2VUMG 3K5NA 4Z9CB 1S4ZA 2BH8A 1GKHA 3MXGA 1F9QA 3DWQA 3Q22A 3H6MA 4F87A 1G91A 3J80L 4A3KH 1UE5A 1Q1BA 1O7LA 3U50C 2F0IA 4HTHA 1AP0A 1VF7A 2N8NA 2C5CA 2K5WA 4UDUC 5EQ0A 3DLLA 1JE4A 3CCQA 2AUJD 2PYKA 2I07B 1VQLA 2JN4A 2KEEA 4G4KA 1VF5C 1TWFB 3S17B 4BBSB 5FOBB 3NWTA 1H9KA 1EYAA 2XWJB 4CJ2C 2P5ZX 4X3KA 4RFBA 1MSGA 1GUNA 1ENCA 1YNND 4WJ4A 2J0TD 2DY8A 3CXCA 4NKLA 2ZTCA 5FJ8G 1A2TA 4JI1Q 3T16A 5IWAL 5EJWA 1V1OA 4OGQC 1IL2A 2K1BA 3DUZA 4LFAQ 2PNHA 3UI2A 3F2DA 3EVQA 3WDNA 1NMFA 2F0VA 3LX0A 5FKAC 3HFZB 2SEBD 3CRLC 1STAA 4P2CB 2LSSA 5M5WH 3FP9A 5JJLA 1QOHA 4IPCA 1ET6A 3S24A 5E4WC 4PMCA 3K0YA 4UP8A 1DOLA 2JJQA 4WRDA 4X65L 1DGSA 3T51B 3EN2A 1S5DD 4A3EB 3MXPA 1PTOD 4YY3L 3BVGA 3I56A 3I4MG 4GZYC 3BJUA 1IYJB 1BCPD 3GTKH 4A3BH 5JEAG 2L0CA 2NYZD 4KD3A 1D5MC 1KRTA 2B2UA 2JA5B 4FNFA 1JMCA 4TVAB 4CDFC 5BN5A 3VA5A 1SYBA 4DN4M 1BBUA 2JSOA 4OWXB 3SXHA 3S15H 2QGQA 1IBKL 4A3DG 2M2LA 4KMUC 2KCCA 3HZXA 4HSPA 3I72A 3RNUA 2HDLA 1W3SA 2HIXA 1V9PA 1WTPA 1AZQA 1PRTD 3RZDH 4RGMA 3J7A5 3K0XA 2WB1E 1RD9D 4HJ8A 1SMYD 2XRSD 4JI3L 5IYBG 2G9HD 1Y1WG 5LMNQ 3S1RH 1YJNA 2VXWA 4K6LA 4C1NI 4G57A 1QZHA 3I4NB 3H3VC 1SROA 3RR5A 3OMCA 1L0WA 3QOJA 2H1EA 2R6GA 5FJ8H 2VNUD 2E8GA 1VQPA 2EY6A 2BOSA 3DHQA 4H0LC 1ENFA 4DK1A 5K5PA 1G291 1DYQA 2QW7A 2XVSA 3FEWX 1CZWA 2KQ3A 2BCOA 3KF8A 4EGVA 3PO2B 1YHQA 2AWNA 1UNSA 5ELBA 2F0PA 4H44C 1SYDA 2MJ8A 3L7ZC 2N49A 3J81i 2Z8LA 3R2IA 3HRZC 1XTCD 1B53A 4HCEA 4JI1L 1LT3D 2WINB 3UDIA 4DAPA 1RJTA 1FJGQ 4LFAL 4PQXA 5J22A 3AFQA 3HKZE 2EIFA 3I4MH 1DCZA 4LJZC 2BA0A 3DMUA 4ME3A 4BBSG 5EPJA 3KF8B 5JEAH 3OW2A 1PFNA 3L3OC 1B8AA 1X9NA 1HR0W 1JB3A 3J7AV 3N6RA 1BQQT 1PV4A 4IPGA 2B2WC 4IOAA 3CPFA 4KKSA 1LT4D 5D3DA 5IT9c 4AQYQ 1JE5A 1SAPA 3U58A 1AZPA 2GN5A 4DV6Q 5H1SE 5LL6S 4OHJA 3MA2B 2VW9A 3KLWA 3GDEA 4ZQ3A 1A63A 3OIQA 1D8LA 1VMPA 2DN8A 2PQEA 1SNPA 4C2MH 5NUCA 5LL6X 3GTPB 5K36G 5C44B 3SK8A 4BBRB 1UEBA 3T4AC 4TRDA 1EY7A 3G6EA 5IYBH 2KHIA 3BDLA 1CA6A 2F0QA 3QOLA 4LMQD 2QCPX 3TEHB 4DAYA 1DZ1A 2JA7G 2ZTDA 2F0SA 3WOEA 4H02A 1RCVD 5IYDG 4PG3A 1WTWA 4LF9Q 2Q2HA 1TVXA 1X65A 1A6XA 1VQIA 2BE5C 3D4DA 4QIWE 3FPUB 3J80c 3A74A 4FXDA 2PI2A 1U4RA 3NBHA 1CT1D 2K5VA 3RLFA 1V43A 1O80A 1N36Q 2JA5G 3LNNA 5GADC 4EX5A 2UU9Q 1E1OA 2WACA 1X3PA 4A4IA 4FP5D 5LMNL 4DAYB 4QUFA 4ZYSA 1YNJC 3J81L 2WKDA 4DNRB 4A3GB 4I65A 1G6PA 1I50H 3QO2A 2HCIA 2TMPA 1B3AA 2QF7A 1EOTA 5M3MG 3F2CA 3PCOB 1MKHA 1GJXA 1YHBA 1B7YB 4PZ8A 1ET9A 1RTOA 1KC8C 4DR2Q 5FLXE 3FDTA 3UE0A 3CCMA 5IGEA 1FNUA 1TS3A 3VR4A 1K73C 4IUNA 1VQ4A 1XPRA 2A69D 3VYUA 2D5DA 3NHHA 4KKUA 3I4NG 4L6TB 5KRUA 3KDFA 1Y1VB 4F88A 3S14B 4KY7A 4EVOA 4DK3C 1N32Q 4YHHQ 5CR3A 1G6ZA 1XNRQ 3I73A 3BU2A 5JEAJ 1XWEA 1FJGL 4NPSA 1K83H 2E2DC 3QG1A 1B1ZA 5A2QE 2YYZA 1IKLA 3PO2G 3KDFB 5KNDA 3S9WA 2RHQB 5K36H 3W1BA 5EKKA 1LTGD 4MZ9A 2V4DA 3S1NH 4DV3Q 3GTOB 4CJ0B 4AQYL 4OO1G 3A56A 1VQDA 4DV6L 4OIKA 2JA7H 4DNTB 3TBIB 2F0KA 4IJHA 3MWYW 1DXMA 1XMQQ 2RCFA 1I4PA 4EQOA 5IP9G 4RMFA 2MQHA 1EQQA 1Q81C 1MJCA 4H13C 1EY5A 2FFKB 5JOBA 4YCVA 3GTQH 2L5TA 3TP7A 1K8OA 1WD0A 3EROA 1EZ6A 3R93A 1HH2P 1F9PA 1QVFA 3NXWA 1I5FA 4XYOA 1F2LA 2MO0A 5IGGA 3D3RA 4DV5Q 1WOCA 1B70B 1GHKA 2DY7A 4R1JA 2WP8J 4K14A 2DNCA 5JJZA 1I6HB 4IO9A 3S1QB 2CH4A 1QVGA 1HZCA 1NJIC 4JI6Q 4LF9L 1LM0A 2IHFA 2M9VA 4A3LH 4G7OC 3KFUA 4KKTA 5M3MH 4GOPA 3GP7A 4B3SQ 4BBRG 1YZ6A 3M4YA 1P16A 2K5QA 1N36L 1VQJA 2KCTA 2MO1A 2B2UC 2E2IB 3HGBA 2UU9L 2D0PA 4X3UA 1TWAB 2DGYA 5C4JH 4UAIA 4CBVA 2B3GA 1MBYA 1TWGB 2FXQA 1R4PB 2UUAQ 1F9RA 2JA6H 3MAQA 4TKOB 5CC4A 3JAME 1YVCA 3GTJH 4GOPB 4XQJA 4L63B 1IYUA 2A5HA 5JJIA 4BXXG 4DR6Q 4QUCA 4QGUA 3CW2C 3J7ZC 4DR2L 4BY1B 1FL0A 1SNDA 1CM9A 3PUWA 3I3CA 1OO9B 1VQMA 1EY8A 3HOVB 2A6EC 1SNOA 3ERSX 4Y7NB 1PYSB 1S3OA 2RDFA 2N55A 2BDOA 3PIO3 1D2BA 2OCEA 2B63B 2K75A 3SEBA 2K5DA 2HT1A 3KF6A 5G3LF 2B39A 3D31A 1X3EA 4K5XA 3SR1A 3PF4A 1TS5A 1N32L 1BVSA 4YHHL 3MVVA 3U9SA 1XNRL 4GKKQ 4RKLA 3ULLA 2EVBA 1EEFD 2QEXA 4B3TQ 1A3TA 1VCIA 2TSSA 2NN6G 4JI8Q 3OTOQ 2PCFB 1KIXA 3HOUH 1MD2D 3K5MA 1Y1VG 3KF6B 1JWSD 1STYA 1KHIA 3PV0A 4DV3L 3A8IE 1A15A 4RGOS 4POFA 5GAEC 4HJAA 1A3UA 4HJ5A 5CYUA 1GUGA 1MGSA 4KY5A 2CH4W 4ZUJA 1NAPA 1HA6A 1KTKA 4DK0A 2XWBB 2WB1B 3M3YH 5EAYA 1ZXTA 2JA9A 3X3NA 2HHHQ 2I0QA 3A5UA 1O7IA 2HQLA 3I4LA 1XMQL 3T53B 3HOZB 5IGBA 1X3QA 3EBEA 5CV4A 1HZ9A 1K8MA 5EBCA 2D9UA 4X66Q 4NB3A 5LHY1 3I4OA 2Z9HA 1IXRA 4XT1B 1E2WA 1WTQA 4DV5L 5IE8A 4DR3Q 5FO9B 4A3CH 1TU2B 4JK1C 1B3QA 3K58A 4EQNA 4DAVA 3I70A 3M4OH 1J5EQ 2EYOA 1R9TH 1QWYA 4JI6L 3J81c 1ML0D 1SSOA 2B2VC 1PFBA 3H3VI 4B3SL 4BXXH 2EJMA 5CV5A 3W3AA 2EJFC 2YTVA 1ZYRD 1WCMB 1EY9A 2ASBA 1YNNC 2B2WA 1UE1A 2UUAL 4KHZA 3HKZB 1PLFA 4YIJA 2RSOA 2Y0SE 4U68A 4B3RQ 3G48A 2ZTEA 4CGYB 4JPBW 1X3GA 1RL2A 4GLAC 3S2DB 4DR6L 1TS2A 4A3IH 1HUMA 1TWCB 1PYWD 1Y14B 3OHXC 2PI2E 5FLMG 1I3QB 4MN3A 3EIVA 1EUJA 1G51A 5CBEE 5E4XA 3J81j 2K5HA 4IALA 1I4XA 3MHBA 1I4RA 2RVLA 1PTOC 2F4VQ 2K05A 1TQOA 1JORA 2V1CC 4IUUA 4IURA 3AU7A 4B9XA 3M85A 2OQKA 1BUVT 4GKKL 1EIFA 4IUVA 5JPNC 3NWSA 1X56A 4AYBE 1SE8A 3D8GA 5BN3A 4B3TL 1E1TA 4ID6A 3HOVG 4N9PA 4S3SA 4JI8L 5C5LA 1C9OA 1SEBD 3PSIA 3OTOL 1IHZA 3LGJA 2OTJA 5C3EB 3VDYA 1QCBD 3ZJYC 1TKWB 3B6YA 1GM5A 2ICIA 2AMCB 2RF4A 4QIWB 2QKIC 3SDZA 4F7XA 1LTID 1ONLA 2E75C 1QVCA 4O1NA 1GUOA 1O7ZA 4C3HB 4IFDH 1KNEA 4PMBA 2G9DA 2ZJRA 1ASZA 2HHHL 2JA8B 4IUPA 3IFTA 1SMYC 2NVYB 4ALPA 4GN5A 4MTKA 1C8CA 2PQAA 5C4ZA 3CD6A 4X66L 3S1MH 2OT2A 2A1AA 2EYJA 1DOMA 4HIMA 4CKEA 4DR3L 2WB1G 3K8AA 1MSHA 4L5SA 1EWHA 1HTPA 1NR4A 3CC7A 1J5EL 2R7ZB 1SDFA 1BKBA 5EPKA 2BDNA 2NVXB 1B4OA 5FO8B 1AN8A 2PQAB 1XPOA 4WORA 4B9WA 3PGZA 2EY1A 4QQBX 4RH6A 1L0YB 2L55A 1VS0A 3DEOA 1TY2A 5FLMH 3Q6SA 2ZM6Q 3V2TA 1IZ6A 4R4CA 1BNZA 1T5EA 1JJCB 3ITPA 1LABA 2HD3A 3E9HA 2R93G 4DKAC 4WJWA 1GUTA 2AQ1B 2JYOA 2R7DA 4K6DA 5DEHA 4IUTA 4JI2Q 3S16H 3HOYB 1PH6A 5T1GA 4C1NK 1CSPA 2NTTA 4B3RL 4A93H 3PUXA 4R8NA 2EE1A 4LUOA 4GOPC 2F0MA 1WCMG 5C3WA 1A62A 1VQNA 1CHPD 4R4TA 4QF4A 1IBLQ 1OXTA 3TREA 2ZXRA 4KTAA 2XGTA 3K7AB 3TSSA 5KEEA 3HKZG 2F4VL 1PH1A 4IJLA 5IGDA 2WIIB 1KNAA 1CTMA 3FPPA 2EY2A 4ZLTF 2D2CC 2N3SA 1HR0Q 1Y8OB 1AW7A 4OWWB 2ICEC 4DR5Q 4GNXC 5M5XH 5EGTA 4M1UB 1VQ8A 3A55A 4XXEA 1CK1A 4POGA 3NEMA 4IUQA 2YU9H 4DR7Q 1QE6A 2F52A 2CW0C 2F3WA 5G3LD 2VUMH 5FLXL 3TS2A 3S2HH 4C3JB 4IFDJ 1H9SA 1SE4A 1LT5D 3NTKA 2NVQH 2CKZB 2CWPA 5F2DA 3R2TA 5KYIA 3BG3A 3D4WA 5J1ZA 2F4IA 1DJRD 1SMXA 5EKIA 4HAEA 1HRJA 2CQAA 1OTCA 4XTCS 5C3EG 4FO2A 3JAMi 2D62A 3P7JA 1K3BC 3H3VH 1N9WA 2K32A 5D65A
chains in the Genus database with same CATH topology
3PO3B 4J8QA 3G7LA 1H9SB 2DNEA 5HURA 1CFMA 1U4PA 3E6ZX 1MI2A 2RKSA 3TP8A 3HS0C 2RDHA 2QILA 1DONA 2AQ2B 4BA2I 2HCCA 2KJXA 5M3FB 5I9PA 3HOXB 3VYSA 3QIAA 5DNFA 1ZEQX 1Z6HA 2Q8IB 1KDCA 2LS01 3C1FA 1HXYD 2O2LD 2KECA 3KLSX 4A3MB 1XYIA 3V96A 4FF4A 1W6KA 3NPPA 2A6HD 1PDQA 5DM73 4K8IA 1AFPA 2ENBA 3H0GB 4ODGA 3J7AF 2SNSA 4RGNA 1E2ZA 3Q23A 1O78A 2B2TC 1SFOB 4OO1I 2BA1A 5COYA 1Q1EA 4J6HA 5IIFA 4NP5A 3VR5A 2B2VA 2F0UA 3TMEA 1JOQA 1SNMA 2EYPA 3JAML 4M8AA 2NBFA 5C4XB 3H94A 2SDFA 5C5MA 1EY6A 5T1IA 3NQTA 3C1EA 2B8FA 1DOKA 3KK7A 1B44D 1JCKB 2Q8RE 3OWEB 3OWFA 2WAQB 2PZUA 2XSCA 1F2MA 1STGA 2PW5A 1WTXA 4HN7A 4PV1C 3HP3A 4DGZA 2Y0SB 3C46A 4C3JG 4KN7C 1II3A 4KN4C 5M5YB 1STBA 1OXSC 2NZ1D 2PW7A 3N52A 3ZYYX 2NUCA 2L11A 1GUWA 4KY6A 2EOTA 1EIHA 2NVTB 5IGCA 3GTGB 1JQYD 3NTIA 2CVRA 1PTOB 2NTSA 3R8BA 2Z4HA 1BCPB 3IFDA 4AYBB 1LTBD 1LTTD 4B08A 1TWHB 2J7ZA 1STNA 5I6YA 2EDGA 2NN6I 4ZRZA 1UUPA 3GTMB 3NP8A 3URYA 4HMIA 3GQBA 3Q0AA 1ICWA 1LT6D 2JXMB 5IGFA 3BS1A 3MXUA 1D1KA 2F1MA 1BXTA 1PZKD 3MEHA 4K5WA 1PRTB 1EFID 4A3FB 1EEID 1QNUA 4OL7A 4HEDA 5FO7B 2LY7A 3K57A 2R3ZA 4FXGC 4DXFA 4F8MA 1CQFA 3E5SA 2A68D 5KYLA 1SXTA 4XQQA 3HOWB 4FF3A 4CKBA 4HR7B 4XT3B 1BR9A 3QWNA 1PZID 3VYRA 1H9JA 1F77A 1I6VC 2KVMA 3SK6A 1QNKA 4KK7A 1EY0A 4BWGB 3H91A 1ZYRC 4HSVA 1PMRA 3KLSA 2R61A 3DXJC 2F0HA 1D5ZC 2KA7A 3AMUA 1Q8IA 4L8JA 2HDMA 4K5VA 1RF2D 1EL0A 5CV6A 2IX0A 4NW2A 2BE5D 3HEJA 3I90A 1SYFA 1IW7C 2IT1A 1BF4A 3V05A 1Q3LA 4RHRA 1EIGA 3RD4A 1S5BD 1PTOF 3TP6A 4OO1H 5M5WB 4ULLA 1J9OA 1KABA 4R8IA 1HCZA 2OEOA 5DM63 3K6OA 4RCNA 1V1PA 2E76C 3GO5A 3EA6A 2SOBA 4A3BB 3GTKB 4ZKBB 2E2HB 4PMWA 1U4MA 2R92B 1V1PB 3S15B 3K5LA 3A8KE 1LLRD 3BVMA 2LMCB 2WKCA 3BVZA 4QB4A 2A73B 3M7NA 3RZDB 4H7BA 1FYCA 1CQVA 3DM1A 1Z7TA 3NSWA 1FNVA 3S1RB 5I9OA 3FRPB 5C0XI 2B2TA 3OMGA 1U9RA 3VR6A 3A7AB 3SE0A 5JPMC 3L9AX 3GTLB 1WTRA 3FKIB 4QMGA 4V190 1Y8PB 1ESRA 4RHSA 2F03A 1A3VA 1IL8A 2LKVA 5ISRA 1GUSA 2NN6H 3BZDB 1LTSD 2RSNA 3MFGA 1D5XC 2EPBA 4IZ8A 3CU7A 3GD7A 1NCVA 3GV3A 1Q12A 2ID0A 3CKIB 5CGKA 3I4MB 3TZDA 1QG7A 1BCPC 1SNQA 3MXNA 3TP5A 1E2VA 4X3SA 1I4HA 2A6ED 4KD4A 1DM0B 2XIWA 1U4LA 2FMMA 3NK9A 3J7YW 3D6WA 2X6GA 2MP1A 1RKNA 1H9MA 4TSSA 1B9NA 1Q90A 4FF1A 2EYFA 1JC7A 1PRTC 4C2MB 1IKMA 3MTSA 4ILWA 2L12A 3P1HA 2F0OA 1BOSA 2KOLA 5CMDA 4KI0A 5KIXA 2IJ0A 1RODA 1FR3A 3T13A 4CJ1B 1HHVA 1EQVA 1ESFA 3AB9A 2F0LA 1HFNA 1HUNA 5CORA 1HFGA 3A7LA 2SNMA 5I6WA 2AUKA 5C0XG 5J39A 1GOZA 1SE3A 1I50B 2A6HC 1KLUD 2Q8TA 1JOOA 3DWAA 3MC0B 3NTHA 5EKLA 2F0WA 3CHBD 1LACA 1D6EC 2CHBD 2F0TA 3LWUA 5C6AA 2O5JC 2XN9C 2PPBC 3SVMA 3OOCA 1ZKOA 4ABNA 3HG9A 1K83B 2F0FA 2VB2X 5ELCA 2F0EA 3A54A 2ZT9C 5CV9A 3S1NB 1IYVA 4IN3A 2Z1CA 4ZAIA 5I2XA 2JA7B 2NWGA 1KDAA 3ND9A 3FVQA 2FMCA 4DU9A 1GXDC 2OXPA 4TQUS 1GHJA 3PUVA 1LO5D 3GTQB 3KBGA 3A8JE 1HA5A 4CHTB 1W6JA 2VB3X 3IAYA 1CHQD 5C0XH 2FINB 3O13A 5FK9C 5A2QL 1TIID 4R9WA 4C3HG 5M3MB 3M7GA 1UEAB 4C3IB 2K7VA 4FF2A 2MPMA 4LAAA 3TZUA 2A69C 5C4JB 1ILPA 3DEPA 3MZ5A 2RA4A 2JA6B 1SNCA 4DF7A 1L0XB 1Z47A 5IT9E 1CZGA 5BN4A 3GTJB 1FGBD 2ZXPA 4CKCA 5DAUA 2RDGA 1HQMC 2F0JA 1EU3A 4ME5A 4DFAA 1UAPA 4BY7B 1C4QA 1EU4A 2J4XA 4A3JB 1EQTA 3Q24A 1R4QB 5KNBA 2C9OA 2JP1A 1J8IA 5C4HA 4PNYA 1FD7D 2K01A 2PNRC 3J80E 1LV9A 2A68C 3HOUB 1G2SA 5KNCA 5IODA 3D6CA 2O4XA 2F0DA 1SYCA 3M3YB 2WV6D 5D3IB 4ZUIA 1QILA 2K6AA 1S5FD 5ELFA 3KUPA 3KLRA 5I2YA 1KAAA 1KDBA 3OPOA 1TR5A 1T5XD 2MUYA 4NMZA 5C0XJ 2B2YC 2CW0D 1HTLD 2A74C 2HQEA 3VYTA 3ND8A 5JVG3 3M4OB 4KJNA 1R9TB 5KGUA 1SJHD 3P75A 3VR2A 1EYDA 5IOCA 1HPCA 3X3MA 4HMJA 4N9TA 2E74C 4LK1C 4BA1I 2XNAC 2OF1A 4G7ZC 1RHPA 2K33A 2QEJC 3CRKC 2FJ2A 1RDPD 1XX8A 1Y8NB 3C2PA 1SE2A 3U9OA 1QJOA 1ILQA 5EBDA 3RMHA 2RBMA 2PO4A 1WVLA 4A3IB 3OSOA 4C3IG 2L4NA 1TT2A 1H9RA 5C3XA 2JEBI 4O42A 2X69A 3VR3A 2KHSA 4ZK9B 1M8AA 4JBWA 1S5ED 4Q0FA 1I4QA 3BDOA 1B50A 1SYEA 1F9SA 3I91A 4RA8A 3NBIA 3ONAB 4K2KA 2EZVA 3TN2A 1O7YA 1PXUA 2PZTA 3OW7A 2EYLA 2AWOA 2Z4IA 1G8ZD 1NR2A 2F0GA 4K2LA 3RUZA 2EYHA 2X6LA 1JICA 1EZ8A 5E3FA 2HUGA 1OXXK 3NUCA 5E1FA 5M9OA 2EY5A 3BYYB 1QB5D 3S1MB 4RGTA 1VMCA 1EYCA 5D14A 4EQPA 2NB0A 4Q5VA 4IFDI 1PZJD 4A3KB 1KLGD 1EWCA 1STHA 1SBBB 1F2YA 1RTNA 4WFN3 3DWPA 5A35A 3R3OA 4U673 4XIGS 3PUZA 1JWUD 4J1MA 2F3VA 1EY4A 3QB3A 1S5CD 1B2TA 2EXZA 3NE5B 1YNJD 5AFWA 1HQRD 3S16B 2JEAI 3NQIA 4A93B 1D1IA 5ELDA 1B9MA 3KBXA 1ENAA 1BCPF 2FHTA 3WOFA 1CA5A 1BO0A 4KV6A 3H09A 2IX3A 5TSSA 4ZKCB 2QDBA 5CBAE 4XYQA 4E6IA 4FVMA 3K5OA 2IL8A 1A2UA 5M5XB 3J81E 3TDQA 2YU9B 3VA7A 2KCNA 4G7HC 1LTAD 1PRTF 2KEDA 3D4RA 2VUMB 3BYTB 5EPLA 1BBXC 3K59A 4BS9A 3W2DA 1E0BA 3S2HB 1CI3M 1V8QA 1JR0D 2NVQB 4FXKC 1X32A 2IWHA 1VDZA 3C3LA 1XXGA 1PFMA 4KHVA 1AEXA 2ZXOA 2LFNA 1SYGA 4I7ZC 3PUYA 4QCLA 4DA2A 1BDOA 4HCSA 2PZWA 3G6JB 1I4GA 4XQNA 3T56B 4MHEA 5JAVA 3ERQA 2B8GA 3LWEA 3EFXD 4FYDA 1JOKA 1F2ZA 4RWSC 2R93B 4IFDG 1TS4A 1WD1A 2K04A 5CV8A 2IX1A 2EYMA 1JWMD 4C56C 3EQLC 3IL8A 3SHLA 2EJGC 3MFYA 3PMFA 3E0JA 3EJIA 3OIPA 3RZOB 1LTRD 3SK4A 1STEA 1PTOH 5ELEA 2O5IC 3P20A 4KJOA 1FNWA 2AQ3B 5JVH3 1M4VA 3IKJA 1G2TA 2M00A 2I46A 1TY0A 4XDXA 1IW7D 4OIJA 2N88A 1SJED 4DXGA 1OXUA 3I8ZA 2PMZB 2B2YA 1WTOA 2H4OA 5HGTA 4RAUC 1NUCA 4K8JA 1Y69U 4RKBA 2L1BA 4A3DB 2E2JB 4MIUA 3FMCA 1C48A 3CQZB 2IW3A 5IT9L 5I4DA 3SK5A 2IPKD 2KUMA 4RCOA 1DD2A 3QJYA 2L9HA 1Y1WB 2MHVA 3PIP3 2F0NA 5CV7A 1NSNS 3F2UA 4X3TA 2XRQD 3GV6A 2K03A 2GA4B 1OXVA 2K28A 4NDXA 2JE6I 2RQXA 2MGSA 3BDCA 1WTVA 4IQZA 4V0BA 3K5NA 4Z9CB 1S4ZA 3MXGA 1F9QA 3DWQA 3Q22A 3H6MA 4F87A 1G91A 3J80L 1Q1BA 1O7LA 1AP0A 2F0IA 4HTHA 1VF7A 2C5CA 2K5WA 4UDUC 5EQ0A 1JE4A 2AUJD 2PYKA 2I07B 2KEEA 4G4KA 1VF5C 1TWFB 3S17B 4BBSB 5FOBB 3NWTA 1H9KA 1EYAA 2XWJB 4CJ2C 4X3KA 4RFBA 1MSGA 1GUNA 1ENCA 1YNND 2J0TD 2DY8A 4NKLA 1A2TA 3T16A 5EJWA 1V1OA 4OGQC 2K1BA 3DUZA 3UI2A 3EVQA 3WDNA 2F0VA 3LX0A 5FKAC 2SEBD 3CRLC 1STAA 4P2CB 1QOHA 1ET6A 5E4WC 4PMCA 3K0YA 1DOLA 4WRDA 3T51B 1S5DD 4A3EB 3MXPA 1PTOD 3BVGA 4GZYC 1BCPD 5JEAG 2L0CA 2NYZD 4KD3A 1D5MC 2B2UA 2JA5B 4FNFA 5BN5A 3VA5A 1SYBA 4DN4M 2JSOA 3SXHA 2M2LA 4KMUC 2KCCA 3HZXA 4HSPA 3I72A 2HDLA 1WTPA 1AZQA 1PRTD 4RGMA 1RD9D 1SMYD 2XRSD 2G9HD 2VXWA 4K6LA 4C1NI 4G57A 3I4NB 3H3VC 3OMCA 3QOJA 2H1EA 2R6GA 2VNUD 2EY6A 2BOSA 3DHQA 4H0LC 1ENFA 4DK1A 5K5PA 1G291 1DYQA 2XVSA 3FEWX 1CZWA 2KQ3A 2BCOA 3KF8A 4EGVA 3PO2B 2AWNA 1UNSA 5ELBA 2F0PA 4H44C 1SYDA 2MJ8A 3L7ZC 2Z8LA 3R2IA 3HRZC 1XTCD 1B53A 4HCEA 1LT3D 2WINB 4DAPA 1RJTA 4PQXA 5J22A 1DCZA 4LJZC 2BA0A 3DMUA 5EPJA 5JEAH 1PFNA 3L3OC 1JB3A 3J7AV 3N6RA 1BQQT 2B2WC 4KKSA 5D3DA 1LT4D 1SAPA 1AZPA 5LL6S 4OHJA 3MA2B 4ZQ3A 3OIQA 1VMPA 2DN8A 2PQEA 1SNPA 5NUCA 5LL6X 3GTPB 5K36G 5C44B 3SK8A 4BBRB 3T4AC 4TRDA 1EY7A 1CA6A 3BDLA 2F0QA 3QOLA 4LMQD 2QCPX 4DAYA 1DZ1A 2F0SA 3WOEA 1RCVD 1WTWA 1TVXA 1A6XA 2BE5C 3D4DA 3FPUB 4FXDA 1U4RA 3NBHA 1CT1D 3RLFA 1V43A 1O80A 3LNNA 2WACA 1X3PA 4FP5D 4QUFA 4ZYSA 1YNJC 3J81L 2WKDA 4DNRB 4A3GB 4I65A 3QO2A 2HCIA 2TMPA 1B3AA 2QF7A 1EOTA 1GJXA 1ET9A 1RTOA 5FLXE 3FDTA 5IGEA 1FNUA 1TS3A 3VR4A 4IUNA 2A69D 3VYUA 2D5DA 3NHHA 4KKUA 4L6TB 5KRUA 1Y1VB 4F88A 3S14B 4KY7A 4EVOA 5CR3A 1G6ZA 3I73A 5JEAJ 1XWEA 2E2DC 3QG1A 1B1ZA 5A2QE 2YYZA 1IKLA 5KNDA 3S9WA 5K36H 5EKKA 1LTGD 2V4DA 3GTOB 4CJ0B 4OO1G 3A56A 4OIKA 4DNTB 3TBIB 2F0KA 3MWYW 1DXMA 1I4PA 4EQOA 4H13C 1EY5A 2FFKB 5JOBA 2L5TA 3TP7A 1K8OA 1WD0A 3EROA 1EZ6A 3R93A 1F9PA 3NXWA 4XYOA 5IGGA 1F2LA 3D3RA 1GHKA 2DY7A 2WP8J 4K14A 2DNCA 5JJZA 1I6HB 3S1QB 2M9VA 4G7OC 4KKTA 3GP7A 3M4YA 2K5QA 2B2UC 2E2IB 3HGBA 4X3UA 1TWAB 4UAIA 4CBVA 1MBYA 1TWGB 1R4PB 1F9RA 3MAQA 4TKOB 5CC4A 3JAME 4XQJA 4L63B 1IYUA 2A5HA 4QUCA 4BY1B 1SNDA 1CM9A 3PUWA 3I3CA 1OO9B 1EY8A 3HOVB 2A6EC 1SNOA 4Y7NB 2RDFA 2N55A 2BDOA 3PIO3 1D2BA 2B63B 3SEBA 2K5DA 5G3LF 2B39A 3D31A 4K5XA 3SR1A 1TS5A 3MVVA 3U9SA 4RKLA 2EVBA 1EEFD 1A3TA 1VCIA 2TSSA 2NN6G 2PCFB 1MD2D 3K5MA 1JWSD 1STYA 3PV0A 3A8IE 1A15A 4RGOS 1A3UA 5CYUA 1GUGA 1MGSA 4KY5A 4ZUJA 1NAPA 1HA6A 1KTKA 4DK0A 2XWBB 2WB1B 3X3NA 1ZXTA 3I4LA 3T53B 3HOZB 5IGBA 1X3QA 5CV4A 1K8MA 5EBCA 2D9UA 5LHY1 4XT1B 1E2WA 1WTQA 5FO9B 1TU2B 4JK1C 3K58A 4EQNA 4DAVA 3I70A 2EYOA 1QWYA 1ML0D 1SSOA 2B2VC 1PFBA 2EJMA 5CV5A 3W3AA 2EJFC 1ZYRD 1WCMB 1EY9A 1YNNC 2B2WA 4KHZA 3HKZB 1PLFA 4YIJA 2RSOA 4U68A 4CGYB 3S2DB 1TS2A 1HUMA 1TWCB 1PYWD 3OHXC 1I3QB 4MN3A 5CBEE 5E4XA 4IALA 1I4XA 3MHBA 1I4RA 2RVLA 1PTOC 2K05A 1TQOA 1JORA 4IUUA 4IURA 3AU7A 4B9XA 3M85A 1BUVT 4IUVA 5JPNC 3NWSA 5BN3A 3D8GA 4ID6A 4N9PA 4S3SA 5C5LA 1SEBD 1IHZA 5C3EB 1QCBD 1TKWB 2ICIA 4QIWB 2QKIC 3SDZA 4F7XA 1LTID 1ONLA 2E75C 4O1NA 1GUOA 1O7ZA 4C3HB 4IFDH 1KNEA 4PMBA 2G9DA 2JA8B 4IUPA 3IFTA 1SMYC 2NVYB 1C8CA 5C4ZA 2OT2A 2EYJA 1DOMA 4CKEA 1MSHA 1EWHA 1HTPA 1NR4A 2R7ZB 1SDFA 5EPKA 2BDNA 2NVXB 1B4OA 5FO8B 1AN8A 4WORA 4B9WA 2EY1A 4RH6A 1L0YB 2L55A 3DEOA 1TY2A 3Q6SA 3V2TA 1BNZA 1T5EA 3ITPA 1LABA 4WJWA 1GUTA 2AQ1B 2JYOA 4K6DA 5DEHA 4IUTA 3HOYB 5T1GA 4C1NK 2NTTA 3PUXA 4R8NA 2EE1A 2F0MA 5C3WA 1CHPD 4QF4A 1OXTA 2ZXRA 4KTAA 3K7AB 3TSSA 5KEEA 5IGDA 2WIIB 1KNAA 1CTMA 3FPPA 2EY2A 4ZLTF 2D2CC 1Y8OB 1AW7A 2ICEC 5EGTA 4M1UB 3A55A 4XXEA 1CK1A 4IUQA 1QE6A 2CW0C 2F3WA 5G3LD 5FLXL 4C3JB 4IFDJ 1H9SA 1SE4A 1LT5D 3NTKA 5F2DA 3R2TA 5KYIA 3BG3A 5J1ZA 3D4WA 2F4IA 1DJRD 5EKIA 4HAEA 1HRJA 2CQAA 4XTCS 4FO2A 2D62A 3P7JA 2K32A 5D65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TSS A;  1ET9 A;  1TY0 A;  1V1O A;  1PRT C;  1PZI D;  1UNS A;  5ELB A;  1V1P B;  1FNU A;  1F77 A;  4TSS A;  1SJE D;  1TS3 A;  2RDH A;  4DXG A;  2QIL A;  2AQ2 B;  1AN8 A;  1LLR D;  2Z8L A;  4L63 B;  5FKA C;  3R2I A;  2SEB D;  3BVM A;  4BWG B;  1XTC D;  3BVZ A;  1LT3 D;  4L6T B;  4RH6 A;  1ET6 A;  1L0Y B;  1TY2 A;  2WV6 D;  1LO5 D;  5D3I B;  1QIL A;  2R61 A;  1D5Z C;  2IJ0 A;  1CQV A;  1S5F D;  5ELF A;  1LTA D;  1PRT F;  1TS2 A;  1G8Z D;  1HA5 A;  2AQ1 B;  1FNV A;  3BYT B;  1PYW D;  3SEB A;  1S5D D;  1PTO D;  1RF2 D;  1ESF A;  2NTT A;  3W2D A;  1CHQ D;  3BVG A;  5I4D A;  3O13 A;  5FK9 C;  1T5X D;  2IPK D;  1HXY D;  1JR0 D;  1LT4 D;  1B1Z A;  1TS5 A;  2O2L D;  4RCO A;  1HTL D;  5D3D A;  1JQY D;  1BCP D;  3KLS X;  1I4X A;  1I4R A;  1PTO B;  2NTS A;  1XXG A;  1PTO C;  1CHP D;  1D5M C;  1EEF D;  3R8B A;  1LTG D;  3BYY B;  1SJH D;  4OHJ A;  4RGT A;  2TSS A;  1BCP B;  2XRQ D;  3V05 A;  1GOZ A;  3TSS A;  1SE3 A;  4RHR A;  1MD2 D;  1LTB D;  1LTT D;  1PZJ D;  1KLG D;  4RGN A;  4RHS A;  1I4G A;  1EWC A;  1JWS D;  1KLU D;  1SBB B;  1SEB D;  3EFX D;  4RGO S;  1S5B D;  3DWP A;  1L0X B;  3BZD B;  1UUP A;  1AW7 A;  1PTO F;  1LTS D;  3DWA A;  1I4P A;  3MC0 B;  2XNA C;  1FGB D;  1KTK A;  1JWU D;  3MFG A;  4Z9C B;  3URY A;  1D5X C;  1TS4 A;  2QEJ C;  1CK1 A;  2RDG A;  1RDP D;  1LT6 D;  2ICI A;  3DWQ A;  1PRT D;  4RGM A;  1RCV D;  1EU3 A;  1JWM D;  1LTI D;  1RD9 D;  1SE2 A;  3CHB D;  4C56 C;  1D6E C;  2CHB D;  2XRS D;  1BCP C;  1S5C D;  1BXT A;  1PZK D;  4O1N A;  2G9H D;  2XN9 C;  4UDU C;  1PRT B;  1CT1 D;  1EFI D;  4K6L A;  1EEI D;  1HQR D;  1SE4 A;  1LTR D;  1LT5 D;  1EU4 A;  2J4X A;  1I4H A;  4DXF A;  1V1P A;  3R2T A;  3EA6 A;  1STE A;  5ELD A;  1PTO H;  5ELE A;  1DJR D;  4ZYS A;  3GP7 A;  5ELC A;  1SXT A;  1FNW A;  1BCP F;  1B44 D;  1S5E D;  1FD7 D;  4RFB A;  2AQ3 B;  1JCK B;  1I4Q A;  1M4V A;  3OWE B;  1ENF A;  1DYQ A; 
#chains in the Genus database with same CATH topology
 4DUY Q;  3PO3 B;  3AYH B;  4J8Q A;  3G7L A;  1H9S B;  2DNE A;  5HUR A;  1CFM A;  1U4P A;  3E6Z X;  1MI2 A;  2RKS A;  3CP0 A;  3TP8 A;  1A0I A;  3HS0 C;  2RDH A;  2QIL A;  3HKS A;  2AQ2 B;  4DAM A;  1DON A;  4BA2 I;  2HCC A;  2KJX A;  5M3F B;  5I9P A;  2R93 H;  2UXD Q;  1I94 Q;  3E0E A;  2JA8 G;  3HOX B;  3VYS A;  3QIA A;  3PQI A;  4R4I A;  5DNF A;  1ZEQ X;  1Z6H A;  2Q8I B;  3RZO H;  1KDC A;  2ZM6 L;  2LS0 1;  3C1F A;  1HXY D;  2O2L D;  2KEC A;  3KLS X;  2R7Z G;  4A3M B;  1XYI A;  3V96 A;  4OX9 Q;  1BBW A;  4FF4 A;  1W6K A;  3CC2 A;  4JI2 L;  4LFC Q;  3NPP A;  2A6H D;  4N8F A;  1PDQ A;  1YBY A;  5DM7 3;  4K8I A;  2JQO A;  1AFP A;  2ENB A;  3H0G B;  4ODG A;  3J7A F;  2SNS A;  4LF4 Q;  4RGN A;  1E2Z A;  3Q23 A;  1O78 A;  1I3Q H;  2ZJP A;  2B2T C;  1IBL L;  2H5X A;  1SFO B;  3M9B A;  3WWV A;  2G5D A;  4GN3 B;  4OO1 I;  3HOY G;  2BA1 A;  5COY A;  3OYY A;  1Q1E A;  4J6H A;  4OWT B;  4L5R C;  5IIF A;  4NP5 A;  1T9H A;  4UPA A;  5GRO A;  1HR0 L;  4A3D H;  2E2J H;  3VR5 A;  4DR5 L;  2B2V A;  2F0U A;  3TME A;  1JOQ A;  3CQZ H;  1YIT A;  1SNM A;  2EYP A;  3JAM L;  2Q2I A;  4N8X 1;  4M8A A;  1PYB A;  2NBF A;  4DR7 L;  5C4X B;  4JW0 A;  3H94 A;  2SDF A;  3ULJ A;  1XJV A;  4O2D A;  5C5M A;  2YTX A;  2RHS B;  1EY6 A;  1U0L A;  5T1I A;  1Y1W H;  3ICE A;  4A3E G;  3NQT A;  3C1E A;  2B8F A;  3G4S A;  1EYG A;  1DOK A;  3KK7 A;  1B44 D;  2KCM A;  4P72 A;  1JCK B;  2Q8R E;  3W5O A;  3OWE B;  4YCU A;  1HNX Q;  3OWF A;  2WAQ B;  2PZU A;  2XSC A;  1F2M A;  1STG A;  2PW5 A;  2DUD A;  1WTX A;  4HN7 A;  4PV1 C;  3HP3 A;  4DGZ A;  2Y0S B;  4DUY L;  4LWC A;  4MNO A;  1NBW A;  3C46 A;  4C3J G;  4KN7 C;  1II3 A;  4KN4 C;  5M5Y B;  1STB A;  1OXS C;  2NZ1 D;  2PW7 A;  3N52 A;  3ZYY X;  2NUC A;  1J6Q A;  3CCR A;  1I94 L;  5BR8 Q;  2CCZ A;  2L11 A;  2UXD L;  5J3B A;  4DUZ Q;  1GUW A;  1TWF H;  4KY6 A;  2EOT A;  1EIH A;  3S17 H;  5IGC A;  3GTG B;  2NVT B;  4BBS H;  2KBN A;  1JQY D;  2LXK A;  3NTI A;  2CVR A;  1PTO B;  2NTS A;  3R8B A;  1C0A A;  2Z4H A;  1KL9 A;  1BCP B;  5M3F G;  3IFD A;  1VQE A;  4AYB B;  1HJP A;  1XTD A;  1LYL A;  1LTB D;  1LTT D;  4B08 A;  3HOX G;  4OX9 L;  1TWH B;  2J7Z A;  4LFC L;  1KD1 C;  1STN A;  5ELN A;  1ICF B;  1KRS A;  5I6Y A;  2UXB Q;  2EDG A;  1NY4 A;  2NN6 I;  4ZRZ A;  3NEN A;  1UUP A;  4LF4 L;  3NP8 A;  2UUC Q;  3URY A;  3RN2 A;  3GTM B;  4HMI A;  3GQB A;  5E7N A;  3Q0A A;  4DV2 Q;  1ICW A;  1LT6 D;  2JXM B;  5IGF A;  2K14 A;  3MXU A;  3BS1 A;  4A3M G;  1VQ7 A;  2Q2U A;  1D1K A;  2F1M A;  4FDB A;  1BXT A;  1PZK D;  3MEH A;  4K5W A;  2ES2 A;  1PRT B;  1GD7 A;  1EFI D;  4OXP A;  4A3E H;  4A3F B;  1EEI D;  1QNU A;  5FLX c;  4P71 A;  4OL7 A;  4DR1 Q;  4HED A;  5FO7 B;  2LY7 A;  3K57 A;  5IYD H;  2R3Z A;  4FXG C;  4DXF A;  4F8M A;  1WFQ A;  1CQF A;  3E5S A;  1GVP A;  2A68 D;  5KYL A;  1V1Q A;  1SXT A;  3STB D;  4XQQ A;  3KJO A;  1PH9 A;  2JA5 H;  4GKJ Q;  1PH4 A;  3HOW B;  1VQC A;  4FF3 A;  1FGU A;  3TRZ A;  4CKB A;  4HR7 B;  4XT3 B;  5AJ3 Q;  1BR9 A;  3QWN A;  1PZI D;  3VYR A;  2WFW A;  1H9J A;  1F77 A;  1I6V C;  2HIV A;  2KVM A;  2XTI A;  3BZC A;  1HNX L;  3SK6 A;  1CKM A;  1QNK A;  4KK7 A;  1EY0 A;  4BWG B;  3H91 A;  1ZYR C;  5C44 G;  5C4X G;  4HSV A;  4LFB Q;  3I55 A;  1PMR A;  3KLS A;  2R61 A;  3DXJ C;  1K9M C;  2F0H A;  1D5Z C;  2KA7 A;  3AMU A;  1Q8I A;  4L8J A;  1EFW A;  3I4N H;  2HDM A;  4K5V A;  1RF2 D;  1EL0 A;  3G71 A;  4DPG A;  1X55 A;  5CV6 A;  2IX0 A;  5BR8 L;  2QDL A;  1WTH A;  2BE5 D;  4NW2 A;  4GNX A;  4DUZ L;  3HEJ A;  3I90 A;  1SYF A;  2YTY A;  1CKO A;  2N78 A;  5GQO A;  1YIJ A;  1IW7 C;  1VQK A;  1C7Y A;  2IT1 A;  1YJ9 A;  2IY5 B;  1BF4 A;  3V05 A;  2Y0S G;  1Q3L A;  5GAH C;  4RHR A;  3PO2 H;  1EIG A;  3RD4 A;  1W2B A;  4A3G G;  2NZO A;  2Z6B A;  1S5B D;  4GNX B;  1PTO F;  3TP6 A;  4OO1 H;  4L5T A;  4YWM A;  1TXY A;  5M5W B;  1D7Q A;  4ULL A;  2UXB L;  3JC6 6;  2VQF Q;  3NEL A;  2UUC L;  1J9O A;  1GO3 E;  5IP9 H;  1KAB A;  1VQA A;  4DV2 L;  4R8I A;  1HCZ A;  2OEO A;  5DM6 3;  3JAM c;  3TS0 A;  1L2F A;  3K6O A;  4AYB G;  4RCN A;  1X6O A;  4R4O A;  1V1P A;  2E76 C;  3GO5 A;  3EA6 A;  2ZJQ A;  2SOB A;  1M1K C;  4A3B B;  3GTK B;  4ZKB B;  2E2H B;  4DR1 L;  3E9I A;  2B29 A;  1P8L A;  3W1G A;  1VQB A;  3GTP H;  5C44 H;  4BBR H;  4HJ9 A;  4PMW A;  1U4M A;  2R92 B;  4OEM B;  1U5K A;  1V1P B;  4DV7 Q;  3S15 B;  3K5L A;  4GKJ L;  3A8K E;  1JJ2 A;  4JBK A;  1LLR D;  5IYC G;  3BVM A;  4A3F G;  2LMC B;  2WKC A;  3BVZ A;  4QB4 A;  5AJ3 L;  4YCW A;  2A73 B;  3M7N A;  3RZD B;  4H7B A;  1FYC A;  2I5M X;  1CQV A;  2LXJ A;  3DM1 A;  1Z7T A;  1EQR A;  3NSW A;  1FNV A;  4DV0 Q;  1L1O A;  3S1R B;  5I9O A;  4LFB L;  3FRP B;  2WAQ E;  4P75 A;  2B2T A;  5C0X I;  1LUZ A;  3OMG A;  1U9R A;  3HOW G;  3VR6 A;  3A7A B;  3SE0 A;  2I5H A;  5JPM C;  5M5Y H;  4K0K Q;  4A3G H;  3L9A X;  3GTL B;  4QJF A;  1HZA A;  1WTR A;  3FKI B;  4QMG A;  4V19 0;  1Y8P B;  3UDX A;  1L1O B;  1YNX A;  1ESR A;  4DV1 Q;  1EIY B;  4RHS A;  4LUV A;  2F03 A;  1A3V A;  1IL8 A;  2LKV A;  4UY8 C;  2ALY B;  2NVT H;  5ISR A;  1A8V A;  1GUS A;  2NN6 H;  3BZD B;  4B3M Q;  1LTS D;  3F8T A;  2RSN A;  3MFG A;  1UWV A;  1Y1V H;  1D5X C;  2EPB A;  4IZ8 A;  3CU7 A;  3GD7 A;  1NCV A;  3S14 H;  3GV3 A;  1VQ9 A;  1Q12 A;  2ID0 A;  3CKI B;  5CGK A;  1TWH H;  1MJE A;  3TZD A;  1QG7 A;  3I4M B;  1BCP C;  1Q82 C;  1SNQ A;  1PA6 A;  4BY1 G;  3MXN A;  4GN4 B;  3CC4 A;  2VQF L;  1KAW A;  3TP5 A;  1E2V A;  4X3S A;  2K5N A;  1I4H A;  2A6E D;  4KD4 A;  1DM0 B;  2XIW A;  4DK6 C;  1U4L A;  2FMM A;  2B63 G;  3NK9 A;  3J7Y W;  3GTO H;  3D6W A;  4JBJ A;  2X6G A;  3IRB A;  2MP1 A;  1K8A C;  1RKN A;  3MXN B;  5IYC H;  1H9M A;  4TSS A;  1B9N A;  1Q90 A;  4FF1 A;  2EYF A;  1JC7 A;  3UE1 A;  1PRT C;  4C2M B;  1IKM A;  2AHO B;  3MTS A;  4ILW A;  1YI2 A;  2L12 A;  3P1H A;  2F0O A;  1BOS A;  1SRU A;  4ZCK A;  4KHP Q;  2KOL A;  4YWK A;  3CMA A;  5CMD A;  2QA4 A;  1S72 A;  3L2P A;  4KI0 A;  2KHJ A;  4DV7 L;  3HOW H;  5KIX A;  1CSQ A;  2VZA A;  2IJ0 A;  4JG2 A;  4A3B G;  1ROD A;  1I6H H;  4JI7 Q;  1FR3 A;  1RIP A;  3S1Q H;  4PZ7 A;  3T13 A;  4CJ1 B;  1HHV A;  4UP7 A;  1EQV A;  1WI5 A;  1ESF A;  3AB9 A;  2F0L A;  1HFN A;  3HOZ G;  1HUN A;  3F1Z A;  5COR A;  1HFG A;  3A7L A;  4DV0 L;  2SNM A;  5I6W A;  2R92 G;  2AUK A;  4JC0 A;  4P73 A;  2E2I H;  3ER0 A;  1TWA H;  4QY7 A;  5C0X G;  1M90 C;  5J39 A;  1GOZ A;  1SE3 A;  1TWG H;  1I50 B;  4A76 A;  4K0K L;  2A6H C;  1KLU D;  2Q8T A;  1CUK A;  4LF5 Q;  1JOO A;  4DV1 L;  4R4Q A;  3DWA A;  3MC0 B;  4X62 Q;  4BY1 H;  2VL6 A;  3CPW A;  2F3I A;  2UXC Q;  4JI5 Q;  3QR8 A;  3NTH A;  3HOV H;  5EKL A;  4CDE C;  2F0W A;  3CHB D;  1LAC A;  1D6E C;  2CHB D;  2F0T A;  4B3M L;  4Y7N H;  3LWU A;  5C6A A;  4DNI A;  2O5J C;  1XPU A;  2XN9 C;  2PPB C;  4I7A A;  2B63 H;  2YV5 A;  3SVM A;  1NMG A;  1UE7 A;  3FKI G;  3OOC A;  1ZKO A;  4ABN A;  1PH5 A;  3HG9 A;  1VQ6 A;  1NNX A;  1K83 B;  2F0F A;  3I7F A;  2VB2 X;  3CCJ A;  1Q86 C;  5ELO A;  4LW1 A;  2VY3 A;  5ELC A;  2F0E A;  3A54 A;  2ZT9 C;  3AQQ A;  5CV9 A;  4OON A;  5DLQ E;  3S1N B;  1IYV A;  1K3R A;  2K50 A;  4IN3 A;  2Z1C A;  4ZAI A;  5I2X A;  1YHA A;  2NWG A;  2JA7 B;  1KDA A;  3ND9 A;  3FVQ A;  2FMC A;  3CCL A;  4DU9 A;  2E2H H;  1AE3 A;  1GXD C;  4JI0 Q;  2OXP A;  4TQU S;  4X6A H;  3RN5 A;  1MHW C;  1GHJ A;  2VS1 A;  3PUV A;  1NE3 A;  1LO5 D;  3GTQ B;  3KBG A;  3A8J E;  3HOZ H;  4YWL A;  2GVA A;  4KHP L;  1HA5 A;  2UUB Q;  2L15 A;  4CHT B;  2R92 H;  3K7U C;  1W6J A;  2VB3 X;  3IAY A;  1FVI A;  1CHQ D;  5C0X H;  2FIN B;  3O13 A;  4JI4 Q;  5FK9 C;  5A2Q L;  1TII D;  4R9W A;  4JI7 L;  4C3H G;  4LUZ A;  4APV A;  5M3M B;  2A8V A;  4CDC C;  3M7G A;  1UEA B;  2BH2 A;  4C3I B;  2K7V A;  4FF2 A;  2MPM A;  1WJJ A;  4LAA A;  3TZU A;  2A69 C;  1S40 A;  5C4J B;  1ILP A;  4O0A A;  3DM3 A;  3DEP A;  3MZ5 A;  2RA4 A;  1WCM H;  5GAG C;  1HZB A;  2Q2T A;  2JA6 B;  1SNC A;  4DF7 A;  4LF7 Q;  1L0X B;  1Z47 A;  2IHE A;  5IT9 E;  4IOC A;  1CZG A;  5BN4 A;  1SN8 A;  1VQH A;  3GTJ B;  4QL5 A;  1PFS A;  1FGB D;  1H95 A;  2ZXP A;  4CKC A;  5DAU A;  2RDG A;  3GTL H;  1HQM C;  4JVZ A;  3FKI H;  4LF5 L;  2F0J A;  1EU3 A;  1Q8K A;  1N33 Q;  3S2D H;  4ME5 A;  4DFA A;  5JJK A;  4X62 L;  1TWC H;  2UXC L;  1L1O C;  4JI5 L;  1UAP A;  4GLX A;  4BY7 B;  1C4Q A;  1EU4 A;  2J4X A;  4A3J B;  4JOI C;  1EQT A;  3Q24 A;  1R4Q B;  4P74 A;  1YJW A;  3M4Q A;  3KJP A;  1K0R A;  5KNB A;  2C9O A;  2JP1 A;  3MEF A;  1J8I A;  5C4H A;  4PNY A;  4LNQ A;  1FD7 D;  2K01 A;  2PNR C;  3J80 E;  1LV9 A;  2A68 C;  2OWO A;  3HOU B;  1G2S A;  3STB C;  5IOD A;  5KNC A;  1E22 A;  5C3E H;  4AH6 A;  1WYD A;  3D6C A;  2O4X A;  2F0D A;  4CDD C;  2PMZ E;  1SYC A;  3M3Y B;  2WV6 D;  5D3I B;  4ZUI A;  1QIL A;  1HNZ Q;  2K6A A;  4JYA Q;  1K8G A;  1E24 A;  1S5F D;  5ELF A;  4C3H H;  4JI0 L;  3KUP A;  3KLR A;  5I2Y A;  2JA8 H;  1KAA A;  1KDB A;  2AKW B;  2NVY H;  3OPO A;  2RCN A;  1TR5 A;  1T5X D;  2MUY A;  4NMZ A;  5C0X J;  2HQE A;  2B2Y C;  1HTL D;  3BZK A;  2A74 C;  2CW0 D;  3VYT A;  3ND8 A;  2A19 A;  2UUB L;  4GLV B;  4LF6 Q;  5JVG 3;  3M4O B;  3A5Z B;  2CQO A;  4KJN A;  1R9T B;  5KGU A;  4JI4 L;  1SJH D;  5LMN W;  3P75 A;  3VR2 A;  1EYD A;  5IOC A;  1HPC A;  3L0O A;  2R7Z H;  1N34 Q;  2MNA A;  3UDF A;  2NVX H;  3X3M A;  4Y52 H;  4HMJ A;  4N9T A;  2E74 C;  3RLN A;  2K4K A;  1YEZ A;  4LK1 C;  4UP9 A;  4BA1 I;  3PO3 G;  1UE6 A;  2XNA C;  2OF1 A;  4G7Z C;  1RHP A;  2K33 A;  2QEJ C;  3CRK C;  2DJF C;  2FJ2 A;  1N8R C;  1RDP D;  1XX8 A;  1Y8N B;  4LF7 L;  3I2Z A;  1X54 A;  3SGI A;  3C2P A;  4A3L G;  1SE2 A;  3U9O A;  2C35 B;  1QJO A;  3NBH B;  1ILQ A;  5EBD A;  3RMH A;  3U4Z A;  2RBM A;  3HOY H;  2PO4 A;  1WVL A;  4A3I B;  3OSO A;  4C3I G;  2L4N A;  2Z6K C;  3A0J A;  1TT2 A;  3AEV A;  1N33 L;  1H9R A;  5C3X A;  2JEB I;  3AFP A;  5HGQ A;  4O42 A;  4MTN A;  1JB7 A;  2JA6 G;  2X69 A;  4KLK A;  3VR3 A;  4WJ3 M;  2KHS A;  5HY6 A;  4ZK9 B;  1M8A A;  2K52 A;  3K7A H;  4JBW A;  1S5E D;  4Q0F A;  1I4Q A;  3BDO A;  3TQY A;  1B50 A;  1SYE A;  1F9S A;  3I91 A;  4GS3 A;  2VQE Q;  4RA8 A;  3NBI A;  3ONA B;  1XMO Q;  4K2K A;  4HIK A;  2EZV A;  3H0G G;  4HIO A;  1VQG A;  3TN2 A;  1KQS A;  4BY7 G;  1O7Y A;  3Q8D A;  1XNQ Q;  4IPD A;  4A3J G;  1PXU A;  3CCV A;  3KYH C;  1EOV A;  1CKN A;  2PZT A;  3OW7 A;  2EYL A;  1IBM Q;  2AWO A;  1K28 A;  4UHV A;  2Z0S A;  3K80 C;  2Z4I A;  1G8Z D;  1NR2 A;  3ULP A;  2F0G A;  4LF8 Q;  4C3J H;  4K2L A;  1HNZ L;  1HNW Q;  2CFM A;  3RUZ A;  4JYA L;  4DV4 Q;  2EYH A;  2X6L A;  3D0F A;  3HOU G;  1JIC A;  5IP7 G;  1EZ8 A;  5E3F A;  2HUG A;  1OXX K;  3NUC A;  5E1F A;  3CF5 A;  5M9O A;  2D0O A;  2EXD A;  2EY5 A;  1PHJ A;  3K81 C;  1PVO A;  1CKN B;  3BYY B;  1QB5 D;  3S1M B;  4RGT A;  1VMC A;  1EYC A;  5D14 A;  4EQP A;  4JBM A;  1AE2 A;  2NB0 A;  3PO3 H;  4Q5V A;  4IFD I;  1PZJ D;  4A3K B;  1KLG D;  4LF6 L;  3FHW A;  1EWC A;  1STH A;  3PIO A;  1SBB B;  2OTL A;  1F2Y A;  2ATW A;  1RTN A;  4WFN 3;  3DWP A;  3CME A;  2WAQ G;  5A35 A;  5M3F H;  3R3O A;  4U67 3;  1N34 L;  4XIG S;  3PUZ A;  1JWU D;  4J1M A;  3HOX H;  4X64 Q;  4AIM A;  4C3I H;  4RG1 A;  3T1H Q;  2NZH A;  2F3V A;  1EY4 A;  3QB3 A;  1SR3 A;  4A3C G;  1S5C D;  1B2T A;  2EXZ A;  4A75 A;  3NE5 B;  1YNJ D;  5AFW A;  1HQR D;  3S16 B;  1X3F A;  2JEA I;  3NQI A;  4A3M H;  4A93 B;  1D1I A;  2E5L Q;  1JJG A;  5ELD A;  1B9M A;  3CCE A;  3KBX A;  4EQ5 A;  1ENA A;  1EWI A;  1BCP F;  2FHT A;  3WOF A;  1CA5 A;  3H0G H;  1BO0 A;  4DR4 Q;  1Z9F A;  2EQS A;  4KV6 A;  3H09 A;  3CCS A;  4JV5 Q;  2IX3 A;  4NXN Q;  4BY7 H;  3CAM A;  3E3X A;  5TSS A;  4ZKC B;  2DJG C;  2QDB A;  1SFO H;  4A3J H;  5CBA E;  1QZG A;  4XYQ A;  4E6I A;  1PH7 A;  4FVM A;  3K5O A;  4A3I G;  1VQF A;  2IL8 A;  4JCV E;  1A2U A;  2VQE L;  5M5X B;  3J81 E;  3TDQ A;  1XMO L;  2YU9 B;  3VA7 A;  2KCN A;  4G7H C;  1E3P A;  1LTA D;  4OEL B;  5IP7 H;  1PRT F;  1PH8 A;  1K0S A;  2KED A;  4J15 A;  4NXM Q;  3D4R A;  1XNQ L;  2VUM B;  3BYT B;  1NTG A;  2OQ0 A;  5C4X H;  5EPL A;  1BBX C;  3K59 A;  4BS9 A;  3W2D A;  1E0B A;  3S2H B;  1CI3 M;  1V8Q A;  3T1Y Q;  1JR0 D;  1IBM L;  2NVQ B;  4FXK C;  1X32 A;  2IWH A;  1MIU A;  1VDZ A;  1ASY A;  4LF8 L;  3C3L A;  1XXG A;  1PFM A;  4KHV A;  1LTL A;  1HNW L;  1AEX A;  1KXL A;  2ZXO A;  2LFN A;  1SYG A;  4DV4 L;  1Q46 A;  2JK8 A;  4I7Z C;  3PUY A;  4QCL A;  5LMU Q;  4DA2 A;  1BDO A;  4HCS A;  2PZW A;  3G6J B;  1I4G A;  4XQN A;  3T56 B;  4MHE A;  1E7Z A;  5JAV A;  3ERQ A;  2B8G A;  3LWE A;  3U4V A;  3EFX D;  5IY0 A;  4FYD A;  4HJ7 A;  1JOK A;  4L5Q A;  4JOI A;  1F2Z A;  4RWS C;  3RLO A;  2R93 B;  4IFD G;  1TS4 A;  1WD1 A;  2K04 A;  5CV8 A;  2IX1 A;  1SLJ A;  4HID A;  2EYM A;  1JWM D;  4C56 C;  3EQL C;  3IL8 A;  3SHL A;  4X64 L;  2EJG C;  3MFY A;  3PMF A;  3E0J A;  3EJI A;  3OIP A;  3RZO B;  3T1H L;  3GTG H;  1LTR D;  3CCU A;  3SK4 A;  4A3K G;  1STE A;  1PTO H;  2MFI A;  5ELE A;  2O5I C;  3P20 A;  4KJO A;  3J80 i;  5IWA Q;  1FNW A;  3PIP A;  2AQ3 B;  5JVH 3;  1M4V A;  3IKJ A;  2E5L L;  1G2T A;  2CWA A;  1AH9 A;  2M00 A;  2I46 A;  1TY0 A;  4XDX A;  1IW7 D;  4OIJ A;  1JT8 A;  2N88 A;  1SJE D;  4DXG A;  4DR4 L;  1OXU A;  3I8Z A;  3PF5 A;  3GTM H;  2PMZ B;  4JV5 L;  2B2Y A;  4NXN L;  1WTO A;  4PZ6 A;  2H4O A;  4X65 Q;  5HGT A;  4RAU C;  1NUC A;  4K8J A;  4YY3 Q;  5L37 A;  1Y69 U;  1Q7Y C;  4A93 G;  2KEN A;  4RKB A;  1QUQ A;  2L1B A;  4A3D B;  2GVB A;  2E2J B;  4MIU A;  3FMC A;  4A3F H;  1C48 A;  4IPH A;  3CQZ B;  1VQ5 A;  2IW3 A;  5IT9 L;  5I4D A;  3SK5 A;  3F2B A;  2IPK D;  2KUM A;  4RCO A;  1VQO A;  1DD2 A;  3QJY A;  2L9H A;  4NXM L;  3UDG A;  3M4P A;  2R7F A;  1Y1W B;  2MHV A;  1PH3 A;  3PIP 3;  2F0N A;  1QUQ B;  5CV7 A;  1NSN S;  3F2U A;  4X3T A;  1IBK Q;  2XRQ D;  3GV6 A;  3T1Y L;  2K03 A;  2I5L X;  2GA4 B;  3KOJ A;  1OXV A;  2K28 A;  4NDX A;  2JE6 I;  2Z6K A;  2RQX A;  2MGS A;  3BDC A;  1WTV A;  4IQZ A;  4V0B A;  1PH2 A;  5LMU L;  3H15 A;  4JI3 Q;  2VUM G;  3K5N A;  4Z9C B;  1S4Z A;  2BH8 A;  1GKH A;  3MXG A;  1F9Q A;  3DWQ A;  3Q22 A;  3H6M A;  4F87 A;  1G91 A;  3J80 L;  4A3K H;  1UE5 A;  1Q1B A;  1O7L A;  3U50 C;  2F0I A;  4HTH A;  1AP0 A;  1VF7 A;  2N8N A;  2C5C A;  2K5W A;  4UDU C;  5EQ0 A;  3DLL A;  1JE4 A;  3CCQ A;  2AUJ D;  2PYK A;  2I07 B;  1VQL A;  2JN4 A;  2KEE A;  4G4K A;  1VF5 C;  1TWF B;  3S17 B;  4BBS B;  5FOB B;  3NWT A;  1H9K A;  1EYA A;  2XWJ B;  4CJ2 C;  2P5Z X;  4X3K A;  4RFB A;  1MSG A;  1GUN A;  1ENC A;  1YNN D;  4WJ4 A;  2J0T D;  2DY8 A;  3CXC A;  4NKL A;  2ZTC A;  5FJ8 G;  1A2T A;  4JI1 Q;  3T16 A;  5IWA L;  5EJW A;  1V1O A;  4OGQ C;  1IL2 A;  2K1B A;  3DUZ A;  4LFA Q;  2PNH A;  3UI2 A;  3F2D A;  3EVQ A;  3WDN A;  1NMF A;  2F0V A;  3LX0 A;  5FKA C;  3HFZ B;  2SEB D;  3CRL C;  1STA A;  4P2C B;  2LSS A;  5M5W H;  3FP9 A;  5JJL A;  1QOH A;  4IPC A;  1ET6 A;  3S24 A;  5E4W C;  4PMC A;  3K0Y A;  4UP8 A;  1DOL A;  2JJQ A;  4WRD A;  4X65 L;  1DGS A;  3T51 B;  3EN2 A;  1S5D D;  4A3E B;  3MXP A;  1PTO D;  4YY3 L;  3BVG A;  3I56 A;  3I4M G;  4GZY C;  3BJU A;  1IYJ B;  1BCP D;  3GTK H;  4A3B H;  5JEA G;  2L0C A;  2NYZ D;  4KD3 A;  1D5M C;  1KRT A;  2B2U A;  2JA5 B;  4FNF A;  1JMC A;  4TVA B;  4CDF C;  5BN5 A;  3VA5 A;  1SYB A;  4DN4 M;  1BBU A;  2JSO A;  4OWX B;  3SXH A;  3S15 H;  2QGQ A;  1IBK L;  4A3D G;  2M2L A;  4KMU C;  2KCC A;  3HZX A;  4HSP A;  3I72 A;  3RNU A;  2HDL A;  1W3S A;  2HIX A;  1V9P A;  1WTP A;  1AZQ A;  1PRT D;  3RZD H;  4RGM A;  3J7A 5;  3K0X A;  2WB1 E;  1RD9 D;  4HJ8 A;  1SMY D;  2XRS D;  4JI3 L;  5IYB G;  2G9H D;  1Y1W G;  5LMN Q;  3S1R H;  1YJN A;  2VXW A;  4K6L A;  4C1N I;  4G57 A;  1QZH A;  3I4N B;  3H3V C;  1SRO A;  3RR5 A;  3OMC A;  1L0W A;  3QOJ A;  2H1E A;  2R6G A;  5FJ8 H;  2VNU D;  2E8G A;  1VQP A;  2EY6 A;  2BOS A;  3DHQ A;  4H0L C;  1ENF A;  4DK1 A;  5K5P A;  1G29 1;  1DYQ A;  2QW7 A;  2XVS A;  3FEW X;  1CZW A;  2KQ3 A;  2BCO A;  3KF8 A;  4EGV A;  3PO2 B;  1YHQ A;  2AWN A;  1UNS A;  5ELB A;  2F0P A;  4H44 C;  1SYD A;  2MJ8 A;  3L7Z C;  2N49 A;  3J81 i;  2Z8L A;  3R2I A;  3HRZ C;  1XTC D;  1B53 A;  4HCE A;  4JI1 L;  1LT3 D;  2WIN B;  3UDI A;  4DAP A;  1RJT A;  1FJG Q;  4LFA L;  4PQX A;  5J22 A;  3AFQ A;  3HKZ E;  2EIF A;  3I4M H;  1DCZ A;  4LJZ C;  2BA0 A;  3DMU A;  4ME3 A;  4BBS G;  5EPJ A;  3KF8 B;  5JEA H;  3OW2 A;  1PFN A;  3L3O C;  1B8A A;  1X9N A;  1HR0 W;  1JB3 A;  3J7A V;  3N6R A;  1BQQ T;  1PV4 A;  4IPG A;  2B2W C;  4IOA A;  3CPF A;  4KKS A;  1LT4 D;  5D3D A;  5IT9 c;  4AQY Q;  1JE5 A;  1SAP A;  3U58 A;  1AZP A;  2GN5 A;  4DV6 Q;  5H1S E;  5LL6 S;  4OHJ A;  3MA2 B;  2VW9 A;  3KLW A;  3GDE A;  4ZQ3 A;  1A63 A;  3OIQ A;  1D8L A;  1VMP A;  2DN8 A;  2PQE A;  1SNP A;  4C2M H;  5NUC A;  5LL6 X;  3GTP B;  5K36 G;  5C44 B;  3SK8 A;  4BBR B;  1UEB A;  3T4A C;  4TRD A;  1EY7 A;  3G6E A;  5IYB H;  2KHI A;  3BDL A;  1CA6 A;  2F0Q A;  3QOL A;  4LMQ D;  2QCP X;  3TEH B;  4DAY A;  1DZ1 A;  2JA7 G;  2ZTD A;  2F0S A;  3WOE A;  4H02 A;  1RCV D;  5IYD G;  4PG3 A;  1WTW A;  4LF9 Q;  2Q2H A;  1TVX A;  1X65 A;  1A6X A;  1VQI A;  2BE5 C;  3D4D A;  4QIW E;  3FPU B;  3J80 c;  3A74 A;  4FXD A;  2PI2 A;  1U4R A;  3NBH A;  1CT1 D;  2K5V A;  3RLF A;  1V43 A;  1O80 A;  1N36 Q;  2JA5 G;  3LNN A;  5GAD C;  4EX5 A;  2UU9 Q;  1E1O A;  2WAC A;  1X3P A;  4A4I A;  4FP5 D;  5LMN L;  4DAY B;  4QUF A;  4ZYS A;  1YNJ C;  3J81 L;  2WKD A;  4DNR B;  4A3G B;  4I65 A;  1G6P A;  1I50 H;  3QO2 A;  2HCI A;  2TMP A;  1B3A A;  2QF7 A;  1EOT A;  5M3M G;  3F2C A;  3PCO B;  1MKH A;  1GJX A;  1YHB A;  1B7Y B;  4PZ8 A;  1ET9 A;  1RTO A;  1KC8 C;  4DR2 Q;  5FLX E;  3FDT A;  3UE0 A;  3CCM A;  5IGE A;  1FNU A;  1TS3 A;  3VR4 A;  1K73 C;  4IUN A;  1VQ4 A;  1XPR A;  2A69 D;  3VYU A;  2D5D A;  3NHH A;  4KKU A;  3I4N G;  4L6T B;  5KRU A;  3KDF A;  1Y1V B;  4F88 A;  3S14 B;  4KY7 A;  4EVO A;  4DK3 C;  1N32 Q;  4YHH Q;  5CR3 A;  1G6Z A;  1XNR Q;  3I73 A;  3BU2 A;  5JEA J;  1XWE A;  1FJG L;  4NPS A;  1K83 H;  2E2D C;  3QG1 A;  1B1Z A;  5A2Q E;  2YYZ A;  1IKL A;  3PO2 G;  3KDF B;  5KND A;  3S9W A;  2RHQ B;  5K36 H;  3W1B A;  5EKK A;  1LTG D;  4MZ9 A;  2V4D A;  3S1N H;  4DV3 Q;  3GTO B;  4CJ0 B;  4AQY L;  4OO1 G;  3A56 A;  1VQD A;  4DV6 L;  4OIK A;  2JA7 H;  4DNT B;  3TBI B;  2F0K A;  4IJH A;  3MWY W;  1DXM A;  1XMQ Q;  2RCF A;  1I4P A;  4EQO A;  5IP9 G;  4RMF A;  2MQH A;  1EQQ A;  1Q81 C;  1MJC A;  4H13 C;  1EY5 A;  2FFK B;  5JOB A;  4YCV A;  3GTQ H;  2L5T A;  3TP7 A;  1K8O A;  1WD0 A;  3ERO A;  1EZ6 A;  3R93 A;  1HH2 P;  1F9P A;  1QVF A;  3NXW A;  1I5F A;  4XYO A;  1F2L A;  2MO0 A;  5IGG A;  3D3R A;  4DV5 Q;  1WOC A;  1B70 B;  1GHK A;  2DY7 A;  4R1J A;  2WP8 J;  4K14 A;  2DNC A;  5JJZ A;  1I6H B;  4IO9 A;  3S1Q B;  2CH4 A;  1QVG A;  1HZC A;  1NJI C;  4JI6 Q;  4LF9 L;  1LM0 A;  2IHF A;  2M9V A;  4A3L H;  4G7O C;  3KFU A;  4KKT A;  5M3M H;  4GOP A;  3GP7 A;  4B3S Q;  4BBR G;  1YZ6 A;  3M4Y A;  1P16 A;  2K5Q A;  1N36 L;  1VQJ A;  2KCT A;  2MO1 A;  2B2U C;  2E2I B;  3HGB A;  2UU9 L;  2D0P A;  4X3U A;  1TWA B;  2DGY A;  5C4J H;  4UAI A;  4CBV A;  2B3G A;  1MBY A;  1TWG B;  2FXQ A;  1R4P B;  2UUA Q;  1F9R A;  2JA6 H;  3MAQ A;  4TKO B;  5CC4 A;  3JAM E;  1YVC A;  3GTJ H;  4GOP B;  4XQJ A;  4L63 B;  1IYU A;  2A5H A;  5JJI A;  4BXX G;  4DR6 Q;  4QUC A;  4QGU A;  3CW2 C;  3J7Z C;  4DR2 L;  4BY1 B;  1FL0 A;  1SND A;  1CM9 A;  3PUW A;  3I3C A;  1OO9 B;  1VQM A;  1EY8 A;  3HOV B;  2A6E C;  1SNO A;  3ERS X;  4Y7N B;  1PYS B;  1S3O A;  2RDF A;  2N55 A;  2BDO A;  3PIO 3;  1D2B A;  2OCE A;  2B63 B;  2K75 A;  3SEB A;  2K5D A;  2HT1 A;  3KF6 A;  5G3L F;  2B39 A;  3D31 A;  1X3E A;  4K5X A;  3SR1 A;  3PF4 A;  1TS5 A;  1N32 L;  1BVS A;  4YHH L;  3MVV A;  3U9S A;  1XNR L;  4GKK Q;  4RKL A;  3ULL A;  2EVB A;  1EEF D;  2QEX A;  4B3T Q;  1A3T A;  1VCI A;  2TSS A;  2NN6 G;  4JI8 Q;  3OTO Q;  2PCF B;  1KIX A;  3HOU H;  1MD2 D;  3K5M A;  1Y1V G;  3KF6 B;  1JWS D;  1STY A;  1KHI A;  3PV0 A;  4DV3 L;  3A8I E;  1A15 A;  4RGO S;  4POF A;  5GAE C;  4HJA A;  1A3U A;  4HJ5 A;  5CYU A;  1GUG A;  1MGS A;  4KY5 A;  2CH4 W;  4ZUJ A;  1NAP A;  1HA6 A;  1KTK A;  4DK0 A;  2XWB B;  2WB1 B;  3M3Y H;  5EAY A;  1ZXT A;  2JA9 A;  3X3N A;  2HHH Q;  2I0Q A;  3A5U A;  1O7I A;  2HQL A;  3I4L A;  1XMQ L;  3T53 B;  3HOZ B;  5IGB A;  1X3Q A;  3EBE A;  5CV4 A;  1HZ9 A;  1K8M A;  5EBC A;  2D9U A;  4X66 Q;  4NB3 A;  5LHY 1;  3I4O A;  2Z9H A;  1IXR A;  4XT1 B;  1E2W A;  1WTQ A;  4DV5 L;  5IE8 A;  4DR3 Q;  5FO9 B;  4A3C H;  1TU2 B;  4JK1 C;  1B3Q A;  3K58 A;  4EQN A;  4DAV A;  3I70 A;  3M4O H;  1J5E Q;  2EYO A;  1R9T H;  1QWY A;  4JI6 L;  3J81 c;  1ML0 D;  1SSO A;  2B2V C;  1PFB A;  3H3V I;  4B3S L;  4BXX H;  2EJM A;  5CV5 A;  3W3A A;  2EJF C;  2YTV A;  1ZYR D;  1WCM B;  1EY9 A;  2ASB A;  1YNN C;  2B2W A;  1UE1 A;  2UUA L;  4KHZ A;  3HKZ B;  1PLF A;  4YIJ A;  2RSO A;  2Y0S E;  4U68 A;  4B3R Q;  3G48 A;  2ZTE A;  4CGY B;  4JPB W;  1X3G A;  1RL2 A;  4GLA C;  3S2D B;  4DR6 L;  1TS2 A;  4A3I H;  1HUM A;  1TWC B;  1PYW D;  1Y14 B;  3OHX C;  2PI2 E;  5FLM G;  1I3Q B;  4MN3 A;  3EIV A;  1EUJ A;  1G51 A;  5CBE E;  5E4X A;  3J81 j;  2K5H A;  4IAL A;  1I4X A;  3MHB A;  1I4R A;  2RVL A;  1PTO C;  2F4V Q;  2K05 A;  1TQO A;  1JOR A;  2V1C C;  4IUU A;  4IUR A;  3AU7 A;  4B9X A;  3M85 A;  2OQK A;  1BUV T;  4GKK L;  1EIF A;  4IUV A;  5JPN C;  3NWS A;  1X56 A;  4AYB E;  1SE8 A;  3D8G A;  5BN3 A;  4B3T L;  1E1T A;  4ID6 A;  3HOV G;  4N9P A;  4S3S A;  4JI8 L;  5C5L A;  1C9O A;  1SEB D;  3PSI A;  3OTO L;  1IHZ A;  3LGJ A;  2OTJ A;  5C3E B;  3VDY A;  1QCB D;  3ZJY C;  1TKW B;  3B6Y A;  1GM5 A;  2ICI A;  2AMC B;  2RF4 A;  4QIW B;  2QKI C;  3SDZ A;  4F7X A;  1LTI D;  1ONL A;  2E75 C;  1QVC A;  4O1N A;  1GUO A;  1O7Z A;  4C3H B;  4IFD H;  1KNE A;  4PMB A;  2G9D A;  2ZJR A;  1ASZ A;  2HHH L;  2JA8 B;  4IUP A;  3IFT A;  1SMY C;  2NVY B;  4ALP A;  4GN5 A;  4MTK A;  1C8C A;  2PQA A;  5C4Z A;  3CD6 A;  4X66 L;  3S1M H;  2OT2 A;  2A1A A;  2EYJ A;  1DOM A;  4HIM A;  4CKE A;  4DR3 L;  2WB1 G;  3K8A A;  1MSH A;  4L5S A;  1EWH A;  1HTP A;  1NR4 A;  3CC7 A;  1J5E L;  2R7Z B;  1SDF A;  1BKB A;  5EPK A;  2BDN A;  2NVX B;  1B4O A;  5FO8 B;  1AN8 A;  2PQA B;  1XPO A;  4WOR A;  4B9W A;  3PGZ A;  2EY1 A;  4QQB X;  4RH6 A;  1L0Y B;  2L55 A;  1VS0 A;  3DEO A;  1TY2 A;  5FLM H;  3Q6S A;  2ZM6 Q;  3V2T A;  1IZ6 A;  4R4C A;  1BNZ A;  1T5E A;  1JJC B;  3ITP A;  1LAB A;  2HD3 A;  3E9H A;  2R93 G;  4DKA C;  4WJW A;  1GUT A;  2AQ1 B;  2JYO A;  2R7D A;  4K6D A;  5DEH A;  4IUT A;  4JI2 Q;  3S16 H;  3HOY B;  1PH6 A;  5T1G A;  4C1N K;  1CSP A;  2NTT A;  4B3R L;  4A93 H;  3PUX A;  4R8N A;  2EE1 A;  4LUO A;  4GOP C;  2F0M A;  1WCM G;  5C3W A;  1A62 A;  1VQN A;  1CHP D;  4R4T A;  4QF4 A;  1IBL Q;  1OXT A;  3TRE A;  2ZXR A;  4KTA A;  2XGT A;  3K7A B;  3TSS A;  5KEE A;  3HKZ G;  2F4V L;  1PH1 A;  4IJL A;  5IGD A;  2WII B;  1KNA A;  1CTM A;  3FPP A;  2EY2 A;  4ZLT F;  2D2C C;  2N3S A;  1HR0 Q;  1Y8O B;  1AW7 A;  4OWW B;  2ICE C;  4DR5 Q;  4GNX C;  5M5X H;  5EGT A;  4M1U B;  1VQ8 A;  3A55 A;  4XXE A;  1CK1 A;  4POG A;  3NEM A;  4IUQ A;  2YU9 H;  4DR7 Q;  1QE6 A;  2F52 A;  2CW0 C;  2F3W A;  5G3L D;  2VUM H;  5FLX L;  3TS2 A;  3S2H H;  4C3J B;  4IFD J;  1H9S A;  1SE4 A;  1LT5 D;  3NTK A;  2NVQ H;  2CKZ B;  2CWP A;  5F2D A;  3R2T A;  5KYI A;  3BG3 A;  3D4W A;  5J1Z A;  2F4I A;  1DJR D;  1SMX A;  5EKI A;  4HAE A;  1HRJ A;  2CQA A;  1OTC A;  4XTC S;  5C3E G;  4FO2 A;  3JAM i;  2D62 A;  3P7J A;  1K3B C;  3H3V H;  1N9W A;  2K32 A;  5D65 A; 
#chains in the Genus database with same CATH homology
 3PO3 B;  4J8Q A;  3G7L A;  1H9S B;  2DNE A;  5HUR A;  1CFM A;  1U4P A;  3E6Z X;  1MI2 A;  2RKS A;  3TP8 A;  3HS0 C;  2RDH A;  2QIL A;  1DON A;  2AQ2 B;  4BA2 I;  2HCC A;  2KJX A;  5M3F B;  5I9P A;  3HOX B;  3VYS A;  3QIA A;  5DNF A;  1ZEQ X;  1Z6H A;  2Q8I B;  1KDC A;  2LS0 1;  3C1F A;  1HXY D;  2O2L D;  2KEC A;  3KLS X;  4A3M B;  1XYI A;  3V96 A;  4FF4 A;  1W6K A;  3NPP A;  2A6H D;  1PDQ A;  5DM7 3;  4K8I A;  1AFP A;  2ENB A;  3H0G B;  4ODG A;  3J7A F;  2SNS A;  4RGN A;  1E2Z A;  3Q23 A;  1O78 A;  2B2T C;  1SFO B;  4OO1 I;  2BA1 A;  5COY A;  1Q1E A;  4J6H A;  5IIF A;  4NP5 A;  3VR5 A;  2B2V A;  2F0U A;  3TME A;  1JOQ A;  1SNM A;  2EYP A;  3JAM L;  4M8A A;  2NBF A;  5C4X B;  3H94 A;  2SDF A;  5C5M A;  1EY6 A;  5T1I A;  3NQT A;  3C1E A;  2B8F A;  1DOK A;  3KK7 A;  1B44 D;  1JCK B;  2Q8R E;  3OWE B;  3OWF A;  2WAQ B;  2PZU A;  2XSC A;  1F2M A;  1STG A;  2PW5 A;  1WTX A;  4HN7 A;  4PV1 C;  3HP3 A;  4DGZ A;  2Y0S B;  3C46 A;  4C3J G;  4KN7 C;  1II3 A;  4KN4 C;  5M5Y B;  1STB A;  1OXS C;  2NZ1 D;  2PW7 A;  3N52 A;  3ZYY X;  2NUC A;  2L11 A;  1GUW A;  4KY6 A;  2EOT A;  1EIH A;  2NVT B;  5IGC A;  3GTG B;  1JQY D;  3NTI A;  2CVR A;  1PTO B;  2NTS A;  3R8B A;  2Z4H A;  1BCP B;  3IFD A;  4AYB B;  1LTB D;  1LTT D;  4B08 A;  1TWH B;  2J7Z A;  1STN A;  5I6Y A;  2EDG A;  2NN6 I;  4ZRZ A;  1UUP A;  3GTM B;  3NP8 A;  3URY A;  4HMI A;  3GQB A;  3Q0A A;  1ICW A;  1LT6 D;  2JXM B;  5IGF A;  3BS1 A;  3MXU A;  1D1K A;  2F1M A;  1BXT A;  1PZK D;  3MEH A;  4K5W A;  1PRT B;  1EFI D;  4A3F B;  1EEI D;  1QNU A;  4OL7 A;  4HED A;  5FO7 B;  2LY7 A;  3K57 A;  2R3Z A;  4FXG C;  4DXF A;  4F8M A;  1CQF A;  3E5S A;  2A68 D;  5KYL A;  1SXT A;  4XQQ A;  3HOW B;  4FF3 A;  4CKB A;  4HR7 B;  4XT3 B;  1BR9 A;  3QWN A;  1PZI D;  3VYR A;  1H9J A;  1F77 A;  1I6V C;  2KVM A;  3SK6 A;  1QNK A;  4KK7 A;  1EY0 A;  4BWG B;  3H91 A;  1ZYR C;  4HSV A;  1PMR A;  3KLS A;  2R61 A;  3DXJ C;  2F0H A;  1D5Z C;  2KA7 A;  3AMU A;  1Q8I A;  4L8J A;  2HDM A;  4K5V A;  1RF2 D;  1EL0 A;  5CV6 A;  2IX0 A;  4NW2 A;  2BE5 D;  3HEJ A;  3I90 A;  1SYF A;  1IW7 C;  2IT1 A;  1BF4 A;  3V05 A;  1Q3L A;  4RHR A;  1EIG A;  3RD4 A;  1S5B D;  1PTO F;  3TP6 A;  4OO1 H;  5M5W B;  4ULL A;  1J9O A;  1KAB A;  4R8I A;  1HCZ A;  2OEO A;  5DM6 3;  3K6O A;  4RCN A;  1V1P A;  2E76 C;  3GO5 A;  3EA6 A;  2SOB A;  4A3B B;  3GTK B;  4ZKB B;  2E2H B;  4PMW A;  1U4M A;  2R92 B;  1V1P B;  3S15 B;  3K5L A;  3A8K E;  1LLR D;  3BVM A;  2LMC B;  2WKC A;  3BVZ A;  4QB4 A;  2A73 B;  3M7N A;  3RZD B;  4H7B A;  1FYC A;  1CQV A;  3DM1 A;  1Z7T A;  3NSW A;  1FNV A;  3S1R B;  5I9O A;  3FRP B;  5C0X I;  2B2T A;  3OMG A;  1U9R A;  3VR6 A;  3A7A B;  3SE0 A;  5JPM C;  3L9A X;  3GTL B;  1WTR A;  3FKI B;  4QMG A;  4V19 0;  1Y8P B;  1ESR A;  4RHS A;  2F03 A;  1A3V A;  1IL8 A;  2LKV A;  5ISR A;  1GUS A;  2NN6 H;  3BZD B;  1LTS D;  2RSN A;  3MFG A;  1D5X C;  2EPB A;  4IZ8 A;  3CU7 A;  3GD7 A;  1NCV A;  3GV3 A;  1Q12 A;  2ID0 A;  3CKI B;  5CGK A;  3I4M B;  3TZD A;  1QG7 A;  1BCP C;  1SNQ A;  3MXN A;  3TP5 A;  1E2V A;  4X3S A;  1I4H A;  2A6E D;  4KD4 A;  1DM0 B;  2XIW A;  1U4L A;  2FMM A;  3NK9 A;  3J7Y W;  3D6W A;  2X6G A;  2MP1 A;  1RKN A;  1H9M A;  4TSS A;  1B9N A;  1Q90 A;  4FF1 A;  2EYF A;  1JC7 A;  1PRT C;  4C2M B;  1IKM A;  3MTS A;  4ILW A;  2L12 A;  3P1H A;  2F0O A;  1BOS A;  2KOL A;  5CMD A;  4KI0 A;  5KIX A;  2IJ0 A;  1ROD A;  1FR3 A;  3T13 A;  4CJ1 B;  1HHV A;  1EQV A;  1ESF A;  3AB9 A;  2F0L A;  1HFN A;  1HUN A;  5COR A;  1HFG A;  3A7L A;  2SNM A;  5I6W A;  2AUK A;  5C0X G;  5J39 A;  1GOZ A;  1SE3 A;  1I50 B;  2A6H C;  1KLU D;  2Q8T A;  1JOO A;  3DWA A;  3MC0 B;  3NTH A;  5EKL A;  2F0W A;  3CHB D;  1LAC A;  1D6E C;  2CHB D;  2F0T A;  3LWU A;  5C6A A;  2O5J C;  2XN9 C;  2PPB C;  3SVM A;  3OOC A;  1ZKO A;  4ABN A;  3HG9 A;  1K83 B;  2F0F A;  2VB2 X;  5ELC A;  2F0E A;  3A54 A;  2ZT9 C;  5CV9 A;  3S1N B;  1IYV A;  4IN3 A;  2Z1C A;  4ZAI A;  5I2X A;  2JA7 B;  2NWG A;  1KDA A;  3ND9 A;  3FVQ A;  2FMC A;  4DU9 A;  1GXD C;  2OXP A;  4TQU S;  1GHJ A;  3PUV A;  1LO5 D;  3GTQ B;  3KBG A;  3A8J E;  1HA5 A;  4CHT B;  1W6J A;  2VB3 X;  3IAY A;  1CHQ D;  5C0X H;  2FIN B;  3O13 A;  5FK9 C;  5A2Q L;  1TII D;  4R9W A;  4C3H G;  5M3M B;  3M7G A;  1UEA B;  4C3I B;  2K7V A;  4FF2 A;  2MPM A;  4LAA A;  3TZU A;  2A69 C;  5C4J B;  1ILP A;  3DEP A;  3MZ5 A;  2RA4 A;  2JA6 B;  1SNC A;  4DF7 A;  1L0X B;  1Z47 A;  5IT9 E;  1CZG A;  5BN4 A;  3GTJ B;  1FGB D;  2ZXP A;  4CKC A;  5DAU A;  2RDG A;  1HQM C;  2F0J A;  1EU3 A;  4ME5 A;  4DFA A;  1UAP A;  4BY7 B;  1C4Q A;  1EU4 A;  2J4X A;  4A3J B;  1EQT A;  3Q24 A;  1R4Q B;  5KNB A;  2C9O A;  2JP1 A;  1J8I A;  5C4H A;  4PNY A;  1FD7 D;  2K01 A;  2PNR C;  3J80 E;  1LV9 A;  2A68 C;  3HOU B;  1G2S A;  5KNC A;  5IOD A;  3D6C A;  2O4X A;  2F0D A;  1SYC A;  3M3Y B;  2WV6 D;  5D3I B;  4ZUI A;  1QIL A;  2K6A A;  1S5F D;  5ELF A;  3KUP A;  3KLR A;  5I2Y A;  1KAA A;  1KDB A;  3OPO A;  1TR5 A;  1T5X D;  2MUY A;  4NMZ A;  5C0X J;  2B2Y C;  2CW0 D;  1HTL D;  2A74 C;  2HQE A;  3VYT A;  3ND8 A;  5JVG 3;  3M4O B;  4KJN A;  1R9T B;  5KGU A;  1SJH D;  3P75 A;  3VR2 A;  1EYD A;  5IOC A;  1HPC A;  3X3M A;  4HMJ A;  4N9T A;  2E74 C;  4LK1 C;  4BA1 I;  2XNA C;  2OF1 A;  4G7Z C;  1RHP A;  2K33 A;  2QEJ C;  3CRK C;  2FJ2 A;  1RDP D;  1XX8 A;  1Y8N B;  3C2P A;  1SE2 A;  3U9O A;  1QJO A;  1ILQ A;  5EBD A;  3RMH A;  2RBM A;  2PO4 A;  1WVL A;  4A3I B;  3OSO A;  4C3I G;  2L4N A;  1TT2 A;  1H9R A;  5C3X A;  2JEB I;  4O42 A;  2X69 A;  3VR3 A;  2KHS A;  4ZK9 B;  1M8A A;  4JBW A;  1S5E D;  4Q0F A;  1I4Q A;  3BDO A;  1B50 A;  1SYE A;  1F9S A;  3I91 A;  4RA8 A;  3NBI A;  3ONA B;  4K2K A;  2EZV A;  3TN2 A;  1O7Y A;  1PXU A;  2PZT A;  3OW7 A;  2EYL A;  2AWO A;  2Z4I A;  1G8Z D;  1NR2 A;  2F0G A;  4K2L A;  3RUZ A;  2EYH A;  2X6L A;  1JIC A;  1EZ8 A;  5E3F A;  2HUG A;  1OXX K;  3NUC A;  5E1F A;  5M9O A;  2EY5 A;  3BYY B;  1QB5 D;  3S1M B;  4RGT A;  1VMC A;  1EYC A;  5D14 A;  4EQP A;  2NB0 A;  4Q5V A;  4IFD I;  1PZJ D;  4A3K B;  1KLG D;  1EWC A;  1STH A;  1SBB B;  1F2Y A;  1RTN A;  4WFN 3;  3DWP A;  5A35 A;  3R3O A;  4U67 3;  4XIG S;  3PUZ A;  1JWU D;  4J1M A;  2F3V A;  1EY4 A;  3QB3 A;  1S5C D;  1B2T A;  2EXZ A;  3NE5 B;  1YNJ D;  5AFW A;  1HQR D;  3S16 B;  2JEA I;  3NQI A;  4A93 B;  1D1I A;  5ELD A;  1B9M A;  3KBX A;  1ENA A;  1BCP F;  2FHT A;  3WOF A;  1CA5 A;  1BO0 A;  4KV6 A;  3H09 A;  2IX3 A;  5TSS A;  4ZKC B;  2QDB A;  5CBA E;  4XYQ A;  4E6I A;  4FVM A;  3K5O A;  2IL8 A;  1A2U A;  5M5X B;  3J81 E;  3TDQ A;  2YU9 B;  3VA7 A;  2KCN A;  4G7H C;  1LTA D;  1PRT F;  2KED A;  3D4R A;  2VUM B;  3BYT B;  5EPL A;  1BBX C;  3K59 A;  4BS9 A;  3W2D A;  1E0B A;  3S2H B;  1CI3 M;  1V8Q A;  1JR0 D;  2NVQ B;  4FXK C;  1X32 A;  2IWH A;  1VDZ A;  3C3L A;  1XXG A;  1PFM A;  4KHV A;  1AEX A;  2ZXO A;  2LFN A;  1SYG A;  4I7Z C;  3PUY A;  4QCL A;  4DA2 A;  1BDO A;  4HCS A;  2PZW A;  3G6J B;  1I4G A;  4XQN A;  3T56 B;  4MHE A;  5JAV A;  3ERQ A;  2B8G A;  3LWE A;  3EFX D;  4FYD A;  1JOK A;  1F2Z A;  4RWS C;  2R93 B;  4IFD G;  1TS4 A;  1WD1 A;  2K04 A;  5CV8 A;  2IX1 A;  2EYM A;  1JWM D;  4C56 C;  3EQL C;  3IL8 A;  3SHL A;  2EJG C;  3MFY A;  3PMF A;  3E0J A;  3EJI A;  3OIP A;  3RZO B;  1LTR D;  3SK4 A;  1STE A;  1PTO H;  5ELE A;  2O5I C;  3P20 A;  4KJO A;  1FNW A;  2AQ3 B;  5JVH 3;  1M4V A;  3IKJ A;  1G2T A;  2M00 A;  2I46 A;  1TY0 A;  4XDX A;  1IW7 D;  4OIJ A;  2N88 A;  1SJE D;  4DXG A;  1OXU A;  3I8Z A;  2PMZ B;  2B2Y A;  1WTO A;  2H4O A;  5HGT A;  4RAU C;  1NUC A;  4K8J A;  1Y69 U;  4RKB A;  2L1B A;  4A3D B;  2E2J B;  4MIU A;  3FMC A;  1C48 A;  3CQZ B;  2IW3 A;  5IT9 L;  5I4D A;  3SK5 A;  2IPK D;  2KUM A;  4RCO A;  1DD2 A;  3QJY A;  2L9H A;  1Y1W B;  2MHV A;  3PIP 3;  2F0N A;  5CV7 A;  1NSN S;  3F2U A;  4X3T A;  2XRQ D;  3GV6 A;  2K03 A;  2GA4 B;  1OXV A;  2K28 A;  4NDX A;  2JE6 I;  2RQX A;  2MGS A;  3BDC A;  1WTV A;  4IQZ A;  4V0B A;  3K5N A;  4Z9C B;  1S4Z A;  3MXG A;  1F9Q A;  3DWQ A;  3Q22 A;  3H6M A;  4F87 A;  1G91 A;  3J80 L;  1Q1B A;  1O7L A;  1AP0 A;  2F0I A;  4HTH A;  1VF7 A;  2C5C A;  2K5W A;  4UDU C;  5EQ0 A;  1JE4 A;  2AUJ D;  2PYK A;  2I07 B;  2KEE A;  4G4K A;  1VF5 C;  1TWF B;  3S17 B;  4BBS B;  5FOB B;  3NWT A;  1H9K A;  1EYA A;  2XWJ B;  4CJ2 C;  4X3K A;  4RFB A;  1MSG A;  1GUN A;  1ENC A;  1YNN D;  2J0T D;  2DY8 A;  4NKL A;  1A2T A;  3T16 A;  5EJW A;  1V1O A;  4OGQ C;  2K1B A;  3DUZ A;  3UI2 A;  3EVQ A;  3WDN A;  2F0V A;  3LX0 A;  5FKA C;  2SEB D;  3CRL C;  1STA A;  4P2C B;  1QOH A;  1ET6 A;  5E4W C;  4PMC A;  3K0Y A;  1DOL A;  4WRD A;  3T51 B;  1S5D D;  4A3E B;  3MXP A;  1PTO D;  3BVG A;  4GZY C;  1BCP D;  5JEA G;  2L0C A;  2NYZ D;  4KD3 A;  1D5M C;  2B2U A;  2JA5 B;  4FNF A;  5BN5 A;  3VA5 A;  1SYB A;  4DN4 M;  2JSO A;  3SXH A;  2M2L A;  4KMU C;  2KCC A;  3HZX A;  4HSP A;  3I72 A;  2HDL A;  1WTP A;  1AZQ A;  1PRT D;  4RGM A;  1RD9 D;  1SMY D;  2XRS D;  2G9H D;  2VXW A;  4K6L A;  4C1N I;  4G57 A;  3I4N B;  3H3V C;  3OMC A;  3QOJ A;  2H1E A;  2R6G A;  2VNU D;  2EY6 A;  2BOS A;  3DHQ A;  4H0L C;  1ENF A;  4DK1 A;  5K5P A;  1G29 1;  1DYQ A;  2XVS A;  3FEW X;  1CZW A;  2KQ3 A;  2BCO A;  3KF8 A;  4EGV A;  3PO2 B;  2AWN A;  1UNS A;  5ELB A;  2F0P A;  4H44 C;  1SYD A;  2MJ8 A;  3L7Z C;  2Z8L A;  3R2I A;  3HRZ C;  1XTC D;  1B53 A;  4HCE A;  1LT3 D;  2WIN B;  4DAP A;  1RJT A;  4PQX A;  5J22 A;  1DCZ A;  4LJZ C;  2BA0 A;  3DMU A;  5EPJ A;  5JEA H;  1PFN A;  3L3O C;  1JB3 A;  3J7A V;  3N6R A;  1BQQ T;  2B2W C;  4KKS A;  5D3D A;  1LT4 D;  1SAP A;  1AZP A;  5LL6 S;  4OHJ A;  3MA2 B;  4ZQ3 A;  3OIQ A;  1VMP A;  2DN8 A;  2PQE A;  1SNP A;  5NUC A;  5LL6 X;  3GTP B;  5K36 G;  5C44 B;  3SK8 A;  4BBR B;  3T4A C;  4TRD A;  1EY7 A;  1CA6 A;  3BDL A;  2F0Q A;  3QOL A;  4LMQ D;  2QCP X;  4DAY A;  1DZ1 A;  2F0S A;  3WOE A;  1RCV D;  1WTW A;  1TVX A;  1A6X A;  2BE5 C;  3D4D A;  3FPU B;  4FXD A;  1U4R A;  3NBH A;  1CT1 D;  3RLF A;  1V43 A;  1O80 A;  3LNN A;  2WAC A;  1X3P A;  4FP5 D;  4QUF A;  4ZYS A;  1YNJ C;  3J81 L;  2WKD A;  4DNR B;  4A3G B;  4I65 A;  3QO2 A;  2HCI A;  2TMP A;  1B3A A;  2QF7 A;  1EOT A;  1GJX A;  1ET9 A;  1RTO A;  5FLX E;  3FDT A;  5IGE A;  1FNU A;  1TS3 A;  3VR4 A;  4IUN A;  2A69 D;  3VYU A;  2D5D A;  3NHH A;  4KKU A;  4L6T B;  5KRU A;  1Y1V B;  4F88 A;  3S14 B;  4KY7 A;  4EVO A;  5CR3 A;  1G6Z A;  3I73 A;  5JEA J;  1XWE A;  2E2D C;  3QG1 A;  1B1Z A;  5A2Q E;  2YYZ A;  1IKL A;  5KND A;  3S9W A;  5K36 H;  5EKK A;  1LTG D;  2V4D A;  3GTO B;  4CJ0 B;  4OO1 G;  3A56 A;  4OIK A;  4DNT B;  3TBI B;  2F0K A;  3MWY W;  1DXM A;  1I4P A;  4EQO A;  4H13 C;  1EY5 A;  2FFK B;  5JOB A;  2L5T A;  3TP7 A;  1K8O A;  1WD0 A;  3ERO A;  1EZ6 A;  3R93 A;  1F9P A;  3NXW A;  4XYO A;  5IGG A;  1F2L A;  3D3R A;  1GHK A;  2DY7 A;  2WP8 J;  4K14 A;  2DNC A;  5JJZ A;  1I6H B;  3S1Q B;  2M9V A;  4G7O C;  4KKT A;  3GP7 A;  3M4Y A;  2K5Q A;  2B2U C;  2E2I B;  3HGB A;  4X3U A;  1TWA B;  4UAI A;  4CBV A;  1MBY A;  1TWG B;  1R4P B;  1F9R A;  3MAQ A;  4TKO B;  5CC4 A;  3JAM E;  4XQJ A;  4L63 B;  1IYU A;  2A5H A;  4QUC A;  4BY1 B;  1SND A;  1CM9 A;  3PUW A;  3I3C A;  1OO9 B;  1EY8 A;  3HOV B;  2A6E C;  1SNO A;  4Y7N B;  2RDF A;  2N55 A;  2BDO A;  3PIO 3;  1D2B A;  2B63 B;  3SEB A;  2K5D A;  5G3L F;  2B39 A;  3D31 A;  4K5X A;  3SR1 A;  1TS5 A;  3MVV A;  3U9S A;  4RKL A;  2EVB A;  1EEF D;  1A3T A;  1VCI A;  2TSS A;  2NN6 G;  2PCF B;  1MD2 D;  3K5M A;  1JWS D;  1STY A;  3PV0 A;  3A8I E;  1A15 A;  4RGO S;  1A3U A;  5CYU A;  1GUG A;  1MGS A;  4KY5 A;  4ZUJ A;  1NAP A;  1HA6 A;  1KTK A;  4DK0 A;  2XWB B;  2WB1 B;  3X3N A;  1ZXT A;  3I4L A;  3T53 B;  3HOZ B;  5IGB A;  1X3Q A;  5CV4 A;  1K8M A;  5EBC A;  2D9U A;  5LHY 1;  4XT1 B;  1E2W A;  1WTQ A;  5FO9 B;  1TU2 B;  4JK1 C;  3K58 A;  4EQN A;  4DAV A;  3I70 A;  2EYO A;  1QWY A;  1ML0 D;  1SSO A;  2B2V C;  1PFB A;  2EJM A;  5CV5 A;  3W3A A;  2EJF C;  1ZYR D;  1WCM B;  1EY9 A;  1YNN C;  2B2W A;  4KHZ A;  3HKZ B;  1PLF A;  4YIJ A;  2RSO A;  4U68 A;  4CGY B;  3S2D B;  1TS2 A;  1HUM A;  1TWC B;  1PYW D;  3OHX C;  1I3Q B;  4MN3 A;  5CBE E;  5E4X A;  4IAL A;  1I4X A;  3MHB A;  1I4R A;  2RVL A;  1PTO C;  2K05 A;  1TQO A;  1JOR A;  4IUU A;  4IUR A;  3AU7 A;  4B9X A;  3M85 A;  1BUV T;  4IUV A;  5JPN C;  3NWS A;  5BN3 A;  3D8G A;  4ID6 A;  4N9P A;  4S3S A;  5C5L A;  1SEB D;  1IHZ A;  5C3E B;  1QCB D;  1TKW B;  2ICI A;  4QIW B;  2QKI C;  3SDZ A;  4F7X A;  1LTI D;  1ONL A;  2E75 C;  4O1N A;  1GUO A;  1O7Z A;  4C3H B;  4IFD H;  1KNE A;  4PMB A;  2G9D A;  2JA8 B;  4IUP A;  3IFT A;  1SMY C;  2NVY B;  1C8C A;  5C4Z A;  2OT2 A;  2EYJ A;  1DOM A;  4CKE A;  1MSH A;  1EWH A;  1HTP A;  1NR4 A;  2R7Z B;  1SDF A;  5EPK A;  2BDN A;  2NVX B;  1B4O A;  5FO8 B;  1AN8 A;  4WOR A;  4B9W A;  2EY1 A;  4RH6 A;  1L0Y B;  2L55 A;  3DEO A;  1TY2 A;  3Q6S A;  3V2T A;  1BNZ A;  1T5E A;  3ITP A;  1LAB A;  4WJW A;  1GUT A;  2AQ1 B;  2JYO A;  4K6D A;  5DEH A;  4IUT A;  3HOY B;  5T1G A;  4C1N K;  2NTT A;  3PUX A;  4R8N A;  2EE1 A;  2F0M A;  5C3W A;  1CHP D;  4QF4 A;  1OXT A;  2ZXR A;  4KTA A;  3K7A B;  3TSS A;  5KEE A;  5IGD A;  2WII B;  1KNA A;  1CTM A;  3FPP A;  2EY2 A;  4ZLT F;  2D2C C;  1Y8O B;  1AW7 A;  2ICE C;  5EGT A;  4M1U B;  3A55 A;  4XXE A;  1CK1 A;  4IUQ A;  1QE6 A;  2CW0 C;  2F3W A;  5G3L D;  5FLX L;  4C3J B;  4IFD J;  1H9S A;  1SE4 A;  1LT5 D;  3NTK A;  5F2D A;  3R2T A;  5KYI A;  3BG3 A;  5J1Z A;  3D4W A;  2F4I A;  1DJR D;  5EKI A;  4HAE A;  1HRJ A;  2CQA A;  4XTC S;  4FO2 A;  2D62 A;  3P7J A;  2K32 A;  5D65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...