1LTID

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltiD00
1PZID 1LO5D 1LT4D 2IJ0A 4O1NA 1KTKA 4RFBA 1V1OA 2XN9C 5TSSA 1PTOB 2CHBD 4RGOS 1FNUA 5I4DA 1CK1A 1V1PB 4RGNA 1FNWA 1D6EC 4C56C 2O2LD 1SEBD 3CHBD 3DWPA 1I4QA 1LTBD 4TSSA 1PZJD 1LLRD 1V1PA 2NTTA 3R8BA 2AQ3B 2QILA 3BVMA 2ICIA 1HXYD 5ELEA 2TSSA 2SEBD 5ELBA 1ENFA 1BXTA 1MD2D 1RCVD 3DWAA 1TS3A 3BVGA 1GOZA 1EFID 1XTCD 1I4RA 3O13A 3OWEB 1LTTD 1STEA 3DWQA 1D5MC 1JQYD 1SJHD 2R61A 1LT3D 1F77A 3BVZA 2NTSA 1JWMD 1LT6D 5ELCA 1EEFD 2XRQD 1SE3A 1JR0D 1RF2D 1SE4A 3MC0B 1HTLD 1BCPC 1XXGA 3SEBA 1TS2A 1HA5A 1D5ZC 1PTOF 1SBBB 1RD9D 4BWGB 1QILA 5FK9C 1ESFA 1FNVA 1PTOH 5ELDA 5D3DA 5FKAC 1LTRD 4DXFA 1I4HA 1ET6A 1LTGD 4RCOA 1KLUD 1I4GA 1CHPD 1LTAD 4Z9CB 1L0YB 2G9HD 2XNAC 1ET9A 1SE2A 4OHJA 2QEJC 3GP7A 1CQVA 3R2TA 1TY2A 2AQ2B 3BYYB 1CHQD 1UNSA 1T5XD 4RHRA 1TS5A 2RDHA 1RDPD 1PRTC 4RHSA 1D5XC 1EEID 3EFXD 4DXGA 1HQRD 1JWUD 1EU3A 1S5DD 1FD7D 2XRSD 4RGTA 1TY0A 1B1ZA 1KLGD 2AQ1B 4UDUC 1S5CD 2Z8LA 1AW7A 1BCPD 1EU4A 1PRTD 1S5ED 4L63B 4L6TB 3BYTB 1JWSD 1S5FD 1PZKD 1LTID 4RGMA 1PTOC 1LT5D 1LTSD 1M4VA 1DJRD 1FGBD 1I4XA 2IPKD 3EA6A 2RDGA 2WV6D 1UUPA 4K6LA 4ZYSA 1DYQA 3KLSX 3URYA 1SJED 2J4XA 1AN8A 1BCPB 1JCKB 1PRTB 1L0XB 1I4PA 1TS4A 3V05A 3W2DA 1CT1D 1G8ZD 5ELFA 1S5BD 3MFGA 5D3IB 1PTOD 1EWCA 3R2IA 1B44D 1PYWD 1SXTA 3BZDB 3TSSA 1BCPF 1PRTF 4RH6A
chains in the Genus database with same CATH superfamily
5NUCA 4YWKA 4J15A 1KTKA 1OTCA 2UUCQ 2JA7H 2K5VA 4PG3A 5KNBA 1II3A 1KC8C 4A3IH 3P20A 4BXXH 4DR7Q 1SEBD 3NHHA 1EY9A 3T16A 4S3SA 1BOSA 2JA5H 1SMYD 3VYTA 2EYPA 4DK6C 1R9TB 1VDZA 3G4SA 3KF6A 2R93H 1RTNA 1EQTA 1HXYD 4CDFC 3U9SA 2VZAA 4N8X1 1J5EQ 2L4NA 2L1BA 5K5PA 1IW7C 4A75A 1XTCD 2NVYH 3J81c 1D5MC 1Y1VG 2L12A 4A3GG 4YHHQ 1XPUA 3OW7A 1I6VC 1LTLA 1SNDA 1W6JA 2DJFC 4B9XA 3PF5A 2UUBL 1TWAH 3MC0B 1WTQA 4K2KA 3J81E 4PMWA 3K6OA 5CBAE 5ELNA 1YI2A 5EKIA 4QMGA 5CV9A 4ZKBB 1PTOH 1AFPA 4C3HB 5EPKA 1QWYA 3FMCA 1PH8A 2CW0D 3C1FA 1IL2A 1G6PA 3HKZE 2FMCA 1KD1C 4DR2Q 3HOVG 3HP3A 5GROA 4RHRA 2ZM6Q 1H9SA 4AYBB 3WWVA 3RR5A 2RKSA 4P73A 5C4HA 4KHPL 4DF7A 1FGUA 1SNOA 2A73B 1A6XA 2C5CA 3EFXD 1EQVA 4NMZA 3MFYA 1JORA 2PYKA 2KUMA 1TWFB 1NUCA 2RHSB 3I70A 4DV0L 1IBMQ 3M4PA 4BBSH 4A3EB 2XIWA 2Z8LA 1HZCA 2EYFA 1PZKD 1JC7A 4RGMA 4JOIA 1CKNA 1Y1WB 2D0PA 4KJNA 2E2IB 1PVOA 2RDGA 4KY6A 3TP7A 3VR5A 4QGUA 5FLXL 4RKLA 1XMQL 4FP5D 1QNUA 1Y69U 2LXJA 5LHY1 2MPMA 2JA8B 4FVMA 5FO7B 5I9PA 4ME5A 4A3DH 4B3TQ 1SFOB 1GO3E 5A35A 3BZDB 4BY1B 1PZID 3PIPA 3TEHB 4O1NA 5IYBH 3TBIB 3I91A 1JE5A 3SE0A 2A1AA 3PIP3 4A93G 3CCQA 1RJTA 1GUTA 2A19A 2EYHA 3CHBD 3SK6A 3J7AV 2B8GA 4IOAA 3B6YA 4P72A 4R4QA 2UXCQ 3G48A 2N8NA 3NQIA 3VR6A 3NUCA 5T1IA 5JEAJ 4C2MB 4GN3B 4X62L 1RCVD 3TP5A 4OGQC 3KDFA 2JA6H 1STEA 3T1HL 2PNHA 2R61A 4F87A 2V4DA 1F2ZA 2Q2UA 3CCSA 1EY4A 4OX9Q 1R9TH 1JB3A 1SYDA 3RLFA 1Q86C 1SE3A 2EZVA 3HOUB 2R6GA 5KNDA 4XQJA 2MO0A 4FXGC 4FF4A 3U4ZA 1VQJA 4H02A 1TQOA 3FKIG 4BA2I 3W1BA 4A4IA 2F4VQ 4HCEA 5BR8L 1WI5A 4K5XA 4A3MH 1B3AA 4JPBW 2KENA 4HCSA 4KTAA 1GUWA 3D0FA 1JB7A 1F2YA 2L9HA 4TKOB 3A8JE 1PH4A 2YTYA 3N6RA 3FHWA 1YNJC 2PMZE 4AH6A 3E0EA 2CQAA 1N9WA 4LF8Q 3HRZC 4C3HH 1I3QB 3FRPB 4B3MQ 3GTQH 1PRTC 1W2BA 4KD3A 1HZBA 1SNPA 3GD7A 1YHAA 1RL2A 4KHPQ 4LFCL 1N36Q 2JEBI 4A3KG 3D6WA 2PW7A 1A62A 1E22A 1SNMA 4MTKA 3LGJA 2Z0SA 4DNIA 1HJPA 5A2QE 1QJOA 1N33Q 5LL6S 2I46A 2WV6D 4HSVA 3URYA 3S2DH 3K5NA 1QNKA 4ALPA 4F88A 1VQ5A 2E2HH 4LW1A 2EDGA 4IUPA 2B2YA 4DGZA 3KF8B 1Y1WH 3IAYA 1BCPF 2F3VA 2E2IH 2BE5C 1O7IA 2XN9C 2DY8A 3K7AB 4RGOS 1GKHA 1C0AA 2JA8H 4WJWA 4ZK9B 2F0PA 4GLVB 1FNWA 4M1UB 1CZWA 2Z4HA 1PH7A 1WFQA 1SFOH 3M4OB 3RN5A 1LLRD 1JOOA 4K0KQ 2NB0A 3BVMA 1FR3A 2I5LX 1DM0B 2TSSA 1ENFA 4JW0A 2YYZA 4GN4B 4GN5A 1EWHA 1L0WA 1Z9FA 2IHFA 4R1JA 1CFMA 2RHQB 1BNZA 4B08A 4HJAA 2GVAA 3ERSX 4DKAC 4YWMA 4J6HA 3T1HQ 1XNRL 2K32A 1S40A 2JP1A 1HTLD 2RSOA 2HHHL 1PH9A 4C2MH 1YNNC 2BDNA 2B2VC 2DGYA 2PO4A 1RD9D 2EQSA 4LFAQ 4BWGB 3M4QA 1JJGA 2K1BA 1NR4A 2VY3A 5FK9C 1X3FA 1B9NA 3PO3G 3OWFA 1HQMC 4LF9Q 1U4LA 4NXNQ 4RCOA 2RA4A 3TN2A 4P71A 4ZRZA 2WKCA 5IWAQ 5I2XA 2VS1A 3AYHB 5C3EG 3KLSA 1KDAA 1Q81C 3S15B 1KDBA 3UDIA 5GQOA 1Y1VB 4A3GB 3EBEA 2BDOA 2Q8IB 2PCFB 4ID6A 1TIID 4HEDA 4WFN3 2D9UA 1VQBA 2AWOA 1FD7D 4IJLA 2WAQG 4DR1Q 1STYA 2WB1E 4LFCQ 5FOBB 1S5CD 4LF5L 1HR0L 1WD0A 4JI0Q 2DNCA 3HGBA 1I3QH 3V2TA 1GVPA 5J1ZA 1JJCB 3S1RB 3PV0A 1U0LA 1EY7A 2LS01 1X6OA 1ML0D 1WD1A 1MGSA 5JPNC 2MGSA 2NVTB 1PV4A 1I4PA 1A63A 1X54A 3HOVB 5ELFA 1JOKA 3R2IA 1E2VA 5E7NA 3CCLA 1NBWA 1CI3M 1MIUA 2B2VA 1LO5D 5M5XB 2Z6BA 3D4DA 3K80C 2L15A 1VQ7A 3K5OA 3A54A 4MTNA 5JJLA 4X65Q 2VW9A 3CCMA 1RKNA 3DXJC 1GUGA 1PH1A 4M8AA 5JJIA 1FL0A 2NTTA 2N49A 3ULJA 1OO9B 5AFWA 2B8FA 3K7AH 2KJXA 1HNWL 1K9MC 1K0RA 2K5HA 1VQFA 4ULLA 3R3OA 3HKSA 2J0TD 2PZWA 4JI2Q 1J9OA 1VF7A 4DR3L 1XWEA 4X3UA 1EZ6A 5T1GA 4RG1A 1SJHD 1CQFA 5LMNW 4JBWA 4MHEA 3T13A 3J81j 1DOMA 1DD2A 4DNRB 1B4OA 3E0JA 1K0SA 2UU9L 1XXGA 1TVXA 3NQTA 3IFDA 1PTOF 4U68A 4A93B 1SNCA 1T9HA 4A3CG 5JVG3 2K52A 2M00A 2SDFA 2HQLA 4I7AA 4L5QA 3HEJA 1JMCA 4MZ9A 3PUYA 5JVH3 3S1MB 5I2YA 1LACA 2K04A 1O78A 1UAPA 4Y7NB 3S17B 4CJ0B 1MKHA 4R4IA 1SMXA 1STGA 1HFNA 4DPGA 2L11A 5C4JB 1QVGA 3E9HA 1GXDC 5CV4A 1BVSA 5LMNQ 1HZ9A 4QUFA 1YJ9A 2EYMA 2NVXB 2LKVA 3PF4A 5CV8A 3CPFA 4FO2A 2ENBA 4IUVA 4K2LA 4UDUC 3S15H 3IKJA 1K8GA 1Y1VH 1B3QA 4A3GH 1UE1A 4OWTB 1LTID 4N9TA 4XQNA 1Q46A 4QF4A 3VR3A 5IODA 1T5EA 1A8VA 2KCCA 4HMJA 1PH2A 1ICFB 3NBHA 4JBMA 3HKZG 1L0XB 1E0BA 1CT1D 4KV6A 4QCLA 4KHVA 2ID0A 3Q6SA 3KUPA 4FF2A 3ER0A 2R7DA 3S1RH 5IYDH 1L1OC 4DV4L 4XTCS 3KYHC 2E76C 4V190 2NVTH 4BBRG 3BDCA 4KY7A 4GOPA 4A3KB 5IT9c 3HOVH 5EGTA 1GUSA 5D65A 5BN4A 5JJKA 1IBLQ 3NTHA 1E1TA 1PZJD 4CHTB 4PMCA 4JI1Q 5M5XH 4JG2A 5IGFA 3NE5B 4CDCC 2HT1A 4KLKA 4P75A 3MXNA 3K7UC 2EY2A 3NP8A 1N34Q 4OL7A 1VQEA 3DWQA 5EAYA 1NNXA 3UE0A 5GAEC 2UUAQ 3BVZA 2K75A 3M3YB 1Q3LA 1QOHA 4YY3L 4GKKQ 1LM0A 5FJ8G 1KAAA 1X3EA 1TS2A 1AE2A 2JJQA 1FJGL 4PZ7A 2B39A 3PQIA 1B50A 1EQRA 3VA5A 4IOCA 1C4QA 5FLMG 3ICEA 4A3BB 1B9MA 1I50B 2FMMA 3SK5A 2ZJPA 3CRLC 2PQAA 2HIXA 3DHQA 3CCRA 2XNAC 4IUTA 3T56B 1VQ6A 4A93H 3AMUA 3H3VC 5M3FG 3I3CA 3NEMA 4DN4M 5KGUA 1YHBA 3CD6A 2CCZA 1HNXL 1DONA 3S1MH 1D5XC 1EEID 1QZGA 3I4MB 3HOXG 3A8KE 1HQRD 2X6LA 2B63H 4ME3A 4Y7NH 2XRSD 1K73C 2RVLA 1F2MA 1Q1BA 4ODGA 4JYAL 2E8GA 3GTKB 3PO3B 3JAMi 2OQKA 2RBMA 3GTMB 2NVXH 3TP8A 1VQMA 3RLNA 2VNUD 1PRTB 1EYDA 1G8ZD 4DV2L 2B2TC 2GN5A 3C46A 3CRKC 2PPBC 3FP9A 5C44B 4G7OC 5DLQE 3D8GA 3FPPA 3OPOA 2VB3X 3EQLC 4LMQD 4DV4Q 5AJ3Q 3U50C 2WAQB 5E3FA 1ZYRD 3DWPA 5I9OA 2KVMA 1IYUA 4LF7L 2R7ZG 1VQHA 5CGKA 1VQAA 5IP9G 2XTIA 4PV1C 3Q0AA 3MXPA 1SSOA 4A3KH 4IQZA 2F4IA 4YWLA 5DEHA 3S16B 1GOZA 2L0CA 4IFDJ 1WTPA 1LTTD 5A2QL 5DAUA 4DU9A 4OONA 4UHVA 3I90A 4JI5L 3M7NA 1NY4A 1LT6D 2TMPA 3HOZG 2N88A 3ND8A 1S3OA 5CMDA 1H9MA 1AE3A 1SE4A 1BCPC 1IW7D 1CTMA 4C3IB 3PUVA 4OELB 4Q0FA 4DV1Q 4P2CB 1GHKA 5M3MG 1FNVA 1HCZA 3HOWB 2HDMA 4GKJL 5F2DA 1E1OA 2EXZA 3OSOA 4JOIC 5IGEA 2B2TA 3FDTA 2ALYB 2PW5A 1CM9A 1N32Q 4LF6Q 4Z9CB 1EIHA 3W1GA 4E6IA 3H09A 3OHXC 4IPGA 1U9RA 1TS5A 1CSQA 1KRTA 1CSPA 1QUQA 4DR6Q 4A3BH 1I50H 1F9PA 3GO5A 4JI6Q 4BY7G 4AQYL 1SRUA 4DV7L 2JK8A 4ZQ3A 1YEZA 1MJCA 5IP7G 4DR5Q 4LNQA 3I4NG 2VUMB 2QF7A 2JN4A 5E4XA 4CBVA 4JBKA 1KLGD 2AQ1B 1D2BA 1EY6A 1H95A 1SMYC 4GLXA 1KL9A 4CJ1B 4IFDH 3F8TA 5D14A 4G4KA 1A3UA 3I4MH 1HTPA 2B2UA 1UE5A 5IGCA 3J81i 4DUYL 4OXPA 1NTGA 2HD3A 3V05A 4CKEA 3T1YL 1NAPA 1AP0A 2ICEC 2IWHA 1JOQA 1STNA 3GTKH 3OIPA 4HJ8A 3PO3H 3PUZA 3TS2A 3F1ZA 3K5LA 2EIFA 3TSSA 1YITA 3PIOA 4BS9A 4NXML 2EYJA 1SAPA 1XPOA 3SK8A 1QE6A 4B3SL 1CZGA 1HUNA 5I4DA 1LUZA 4IN3A 1LABA 2OTLA 2WB1G 4KN7C 2K50A 4RGNA 3RMHA 2JEAI 1EIYB 1EFWA 2VL6A 2A74C 1J8IA 3D6CA 2CW0C 4TSSA 4XYOA 5C44H 3OTOL 4LF4Q 1PYSB 3HOYH 3TDQA 1G91A 1K83B 4OWXB 4LF7Q 3HKZB 3LWUA 5ELBA 1VQ8A 3OOCA 3BZCA 2F0HA 3T4AC 1LYLA 1IBKL 3S24A 5BN3A 2KBNA 3AQQA 3QJYA 5DNFA 3I7FA 3J80c 4G7ZC 2NTSA 4OO1H 3KFUA 4H7BA 3W3AA 3CAMA 2O5JC 2MNAA 2E2JH 2B2WA 4BBRB 1SE8A 4A3FB 1Q1EA 4XT1B 1KNAA 1EIGA 3J80E 3S16H 3GTLB 2A6EC 4JI3L 2HCIA 1I5FA 1Y8PB 1SNQA 2F0KA 3H94A 2CWPA 3QR8A 5D3DA 4GS3A 2OF1A 3VYRA 2XWJB 4NKLA 2F03A 2M2LA 3QO2A 5J39A 4C3IH 3NXWA 1YJNA 2FXQA 3H0GG 1H9KA 4FNFA 3TMEA 4PZ8A 4DAPA 3RZDB 3HOWH 1EY0A 2B2YC 3DEOA 2UUBQ 1BKBA 1PFSA 1AZQA 1DZ1A 2F0GA 1WCMG 1KDCA 1YNJD 3Q8DA 2AHOB 4RGTA 4P74A 4X6AH 3QOLA 4RWSC 3QIAA 4NW2A 3D4RA 3SK4A 2L55A 1PRTD 1WTRA 2ZXRA 1PTOC 1W3SA 3U58A 4KKTA 3T53B 2A6HD 3NENA 3K0YA 3IFTA 1SJED 3QOJA 5HURA 1A3TA 1AN8A 2A69C 1Q8IA 5IE8A 2VUMH 4F8MA 3W2DA 1ZEQX 4HSPA 1F9QA 1EQQA 5M3FB 2RCNA 1NMGA 1F9RA 1ONLA 2K28A 2X6GA 3A56A 3HG9A 4QL5A 4UP7A 1XPRA 4KHZA 2IX0A 2L5TA 2F0DA 1GD7A 2GA4B 4X66L 3ZJYC 1QG7A 4DV0Q 4B3SQ 2EXDA 3P7JA 2K7VA 4IFDI 5CC4A 2MHVA 2OEOA 1EYAA 1I4QA 1TWFH 4JI8L 1OXVA 1V1PA 3VYUA 2AQ3B 4YIJA 4A3EH 3S14B 1XMQQ 1KABA 2EJMA 2PMZB 4UPAA 1BXTA 3FEWX 1EFID 1I4RA 3H91A 1WTOA 4GNXC 5C5LA 2E74C 2E5LL 2ZTEA 1EWIA 3AU7A 4L5SA 2MUYA 1EEFD 1K83H 5I6WA 1X3PA 3I4OA 3ERQA 3EROA 5JPMC 3ZYYX 4WORA 3I72A 3KJPA 2JA5G 3MXUA 3S9WA 4BY1H 5M5YB 3CCUA 2PZTA 4DAYA 1MHWC 1TR5A 1C7YA 5M5WB 2UXBL 2J7ZA 2R7ZB 1LV9A 5CORA 4A3FH 1ET9A 4X62Q 1GM5A 4FXKC 1C48A 4DK3C 3CKIB 3GTLH 1KRSA 2UXDL 1HNZL 2SNMA 3K57A 4TVAB 5IGBA 1X65A 1XMOL 1RDPD 1SDFA 1VQDA 4OO1I 3MEHA 5G3LD 3MHBA 3HOZB 4AIMA 5JAVA 4DXGA 2OT2A 4N8FA 4K8JA 5ELOA 4MIUA 1PXUA 2KEEA 3RZDH 3CQZB 3TS0A 5BR8Q 2N55A 1R4QB 3HZXA 2NWGA 3HOUH 4R8NA 1G2TA 1V1QA 2IW3A 1AEXA 3EA6A 1HRJA 2FINB 2VB2X 4DFAA 4K6LA 4Y52H 2EYOA 2F0MA 3A7LA 4LWCA 4DV5L 4GNXA 1XTDA 2IX1A 1MSGA 2PZUA 4IALA 1STBA 2A68C 4X3TA 4BY7B 4QIWE 4YCWA 5IYCH 5K36H 3NBIA 3HS0C 5FLXc 5C5MA 1PFMA 4UY8C 3JAML 1Z7TA 1IL8A 3I4NB 3DUZA 2VXWA 2ATWA 1BBWA 1UEAB 5ISRA 3SVMA 5M3FH 4OIKA 4IUUA 3KF6B 2KECA 4B3RL 2O2LD 1EUJA 2KHSA 5FLXE 2QDBA 2LY7A 3DM1A 1Z47A 5HY6A 2EY6A 4YCUA 4JI8Q 4A3DG 3SHLA 2QCPX 4DUZL 3MXGA 1IHZA 2JXMB 1G2SA 3CCEA 5EKLA 4WRDA 5IYBG 3E5SA 1H9RA 1ILQA 3RZOB 1VQIA 1F2LA 2D0OA 4U673 3ONAB 4R9WA 2AUKA 2Z1CA 3BDOA 2Y0SG 2R3ZA 1PH6A 2XRQD 4DR4L 1D7QA 3ND9A 2NZ1D 2ZT9C 3S14H 2K4KA 3GTOB 3FVQA 4A3LG 1JE4A 2WB1B 4LFBL 2QW7A 3C1EA 2QEXA 3WDNA 4CKCA 5CBEE 1LTAD 1I4GA 2F1MA 4R4OA 4XIGS 2JA6G 1H9SB 4L8JA 3M4OH 2VQEL 2QEJC 4IZ8A 5C0XH 3GP7A 2KCNA 5M5YH 3U4VA 3UDFA 2R7FA 4KY5A 4J8QA 5M5WH 1PHJA 1XNRQ 1A3VA 2HHHQ 1BBXC 2RDFA 4UAIA 1VQ4A 1J6QA 4GOPC 1CKNB 4A3JG 2YU9B 3RD4A 1B1ZA 4KN4C 1HR0W 1A0IA 4A3MG 5KIXA 1SYBA 2MO1A 1JWSD 4HJ7A 2F0VA 2F0OA 4JI7L 1M4VA 1YBYA 3T51B 1CKOA 2FFKB 3F2UA 1YZ6A 2F0SA 3TZUA 1XYIA 2ASBA 1JCKB 3CQZH 3H0GB 3DMUA 1Q90A 1ENAA 3PGZA 3A55A 5C6AA 3W5OA 5JEAG 1PRTF 3D3RA 3OMCA 1WCMB 3STBC 4RFBA 3FKIB 3UI2A 4AYBG 1TWGB 2CHBD 3PCOB 1FNUA 1P16A 4TQUS 1OXTA 4LF5Q 2LFNA 3PUXA 1CK1A 1HR0Q 1FYCA 3L3OC 4C1NI 4JBJA 3TZDA 4C56C 1M8AA 3J81L 2AWNA 1DCZA 4BY7H 4DNTB 2NN6G 5J22A 2CVRA 4X64L 3KDFB 4HIOA 1Y1WG 2B3GA 3BVGA 1R4PB 2K01A 1JQYD 1PLFA 2WIIB 2JA8G 3WOEA 1SYCA 5LMUL 3I55A 3NTIA 4IPCA 3SEBA 4DR4Q 1K8OA 1B8AA 4NDXA 4DK0A 4L5RC 5EJWA 1HA5A 3TQYA 3K59A 5IOCA 3RZOH 5IT9E 1U4RA 3BJUA 1QVFA 1RHPA 3A5UA 3GTOH 1HNWQ 2D62A 3QB3A 1L0YB 1KAWA 4HIMA 1SE2A 3NSWA 1B53A 4JC0A 1SYGA 3PSIA 3MVVA 2E2DC 4MN3A 4DR3Q 3BYYB 2XWBB 4EQNA 1UNSA 2JA9A 2XSCA 1JICA 4DA2A 1VQKA 2CH4W 1XNQL 1O7LA 3MZ5A 1M90C 2YTXA 2UU9Q 2JSOA 4FXDA 4RA8A 2RCFA 4EQ5A 3ULPA 1UEBA 1KIXA 2UUCL 2C35B 2JA5B 1E24A 1O80A 1EU4A 2K5NA 5EBDA 3C3LA 2AMCB 4DR7L 3MAQA 4H44C 4PZ6A 1PH3A 3MA2B 1MSHA 2BA0A 1K8AC 5EKKA 2AKWB 5G3LF 4ZYSA 4JI7Q 5C0XI 4XYQA 2YU9H 2HUGA 4JK1C 4CDDC 1CUKA 1J5EL 1WTHA 4QB4A 5C4XG 1CA6A 1CA5A 3S17H 3KOJA 1LT4D 1NSNS 1X55A 2F52A 4YHHL 5TSSA 1PTOB 5C4JH 4FYDA 3KF8A 5GADC 5JOBA 1UWVA 3H0GH 3SDZA 4PNYA 4EVOA 1K28A 1G6ZA 1SROA 5FO9B 4OWWB 2JE6I 4ZCKA 1LTBD 4QQBX 3U9OA 3CPWA 3CCVA 2PNRC 1W6KA 1WCMH 3FKIH 3AEVA 5C3EB 1TWGH 2QDLA 3BG3A 1PFBA 4H0LC 2MQHA 4ZLTF 2BA1A 3DWAA 3DM3A 3I8ZA 3O13A 5JJZA 3K5MA 4DR2L 3OWEB 1WJJA 2Y0SE 2F3WA 2G5DA 3QG1A 2ZM6L 1LT3D 4EGVA 4IURA 2VQFL 1N8RC 1E2WA 5CYUA 5EPJA 1TU2B 3SXHA 4IUQA 2F0IA 1WYDA 4O0AA 3VDYA 1D1KA 1JR0D 1RF2D 4ABNA 1AZPA 1EYGA 4C1NK 2MJ8A 4Q5VA 5J3BA 3CU7A 1YVCA 1SBBB 3VR4A 4BA1I 1IBML 3C2PA 3S1NB 3TRZA 2QA4A 3KBXA 1LTRD 1ET6A 2B2UC 1VQGA 1NR2A 3OW2A 1K3BC 3H15A 1CQVA 5KYLA 1CHQD 3K58A 1QZHA 1T5XD 1IZ6A 4XQQA 4DV3L 4L5TA 4YY3Q 4B3TL 3X3MA 3EVQA 2Q8RE 1G51A 1FJGQ 1OXXK 2XVSA 1WOCA 1JWUD 1ZYRC 3PO2G 4WJ3M 4R8IA 3M3YH 2F0NA 3GDEA 1WVLA 1QCBD 3S2HB 4EQPA 4K8IA 4HN7A 4G57A 2JA6B 2UXCL 1ICWA 1GJXA 1CKMA 1RIPA 4I65A 2HCCA 4XDXA 1DOKA 1AH9A 1SXTA 3P75A 1HNXQ 1PH5A 1F9SA 1Y8OB 5GAGC 4AYBE 4LUZA 4OX9L 2B2WC 4A3JB 1X3QA 1BDOA 1NE3A 1HZAA 2NZOA 3OIQA 4JYAQ 1HUMA 4HAEA 4A3MB 2R92G 4R4CA 2DN8A 1DXMA 3EN2A 2EVBA 1SYFA 1Z6HA 2F4VL 2F0UA 1A15A 2PI2A 2I0QA 4IO9A 2YTVA 1E3PA 3J7A5 4ZKCB 2JYOA 4DV2Q 2BH2A 3GTQB 2MFIA 5IYDG 3GTMH 2FHTA 1TS3A 3FPUB 3CXCA 1Q8KA 2SOBA 4LF8L 1XX8A 3PIO3 4IPDA 5ELCA 5IIFA 2G9DA 4B3ML 2ZXPA 5C3XA 5C3EH 2VQFQ 3GTGB 4HR7B 4H13C 3CW2C 1N36L 2F0TA 1BF4A 3AFPA 3S2DB 2NZHA 3E6ZX 2E2HB 1I6HB 1KXLA 1EZ8A 4RCNA 3UE1A 1KLUD 3MTSA 1N33L 5C3WA 1EL0A 4ZUIA 1TWCB 2CKZB 2A6ED 1X3GA 1IYJB 1EOVA 1SLJA 3S1NH 4JI5Q 2ZTDA 3K8AA 2RQXA 4JV5L 4RHSA 4C3JG 4DV3Q 3QWNA 1EY8A 3KLWA 2IY5B 3SR1A 1IXRA 1YNXA 4K6DA 3CMAA 3EIVA 4KK7A 3L2PA 1GUNA 4L63B 2IHEA 4GKJQ 2NVQB 3NBHB 3LWEA 1LT5D 4CDEC 1UUPA 4QUCA 5L37A 4A3LH 3J7AF 4K0KL 4X3SA 4RMFA 2Z9HA 1BR9A 1TS4A 3NWSA 3J80i 3NK9A 3G6EA 1Y14B 4V0BA 1ASYA 1P8LA 1PTOD 2BOSA 3S2HH 4GOPB 1UE7A 2B63G 1STHA 1DGSA 4AQYQ 4DV7Q 2A69D 3RNUA 3WOFA 4K14A 2AUJD 2K33A 2EY1A 2X69A 2F0FA 3EJIA 2I5HA 2HDLA 2N3SA 1FVIA 1C9OA 1X56A 1D6EC 3LX0A 4LFAL 1GUOA 4MNOA 4B9WA 3K0XA 3MXNB 3CCJA 4YCVA 4DUYQ 4LF9L 4A3CH 4LAAA 4NXNL 1PMRA 2K5DA 4KKSA 4IJHA 3T1YQ 4A3JH 3E3XA 1EY5A 1RODA 2P5ZX 5IWAL 5C4XB 3HOXB 1MBYA 2FJ2A 5H1SE 4NXMQ 4IUNA 3M4YA 1QB5D 4HIDA 2EOTA 3G6JB 4DAMA 3CP0A 2KA7A 3KJOA 4KKUA 1U4PA 1I94L 2N78A 1VQ9A 2BE5D 3KK7A 1NCVA 3SGIA 1D5ZC 2H1EA 2F0EA 2IL8A 2PQAB 2Q2HA 2A6HC 2KCMA 1ESFA 4DR1L 3OTOQ 2OTJA 5HGTA 5JEAH 2YV5A 4JI0L 1L1OB 4EQOA 3I56A 4O42A 1LTGD 3GTGH 1OXSC 1NMFA 2IX3A 2JA7G 2KHJA 1IBKQ 4N9PA 2EJFC 3CC4A 1ASZA 4A3IG 4BXXG 2K03A 4OEMB 1PYBA 4J1MA 1WTXA 1I6HH 4F7XA 2NN6H 1V8QA 1KQSA 2DJGC 4JV5Q 2R93G 5KYIA 1TWCH 3NELA 5FO8B 4JI3Q 5KRUA 4KJOA 1STAA 1S5ED 1YNND 3BYTB 4BBRH 4X65L 1O7ZA 3IRBA 3A7AB 1VF5C 1D8LA 1DYQA 3KLSX 4A3BG 5CV6A 1X32A 5IT9L 5D3IB 3NPPA 2NVQH 1PYWD 4JI2L 3CC2A 2KCTA 2OCEA 3M7GA 1K3RA 2IJ0A 1B2TA 3X3NA 4IFDG 1EYCA 1E2ZA 5M3MB 2B29A 3DLLA 3PO2B 1H9JA 4HMIA 1VCIA 1VQLA 2ZJRA 4XT3B 3I4MG 2A68D 3AFQA 2QGQA 1D1IA 5FJ8H 3IL8A 1ILPA 2RF4A 2WINB 3GTJB 5FLMH 3BS1A 4ZAIA 1ESRA 5C4ZA 2KQ3A 4TRDA 3TP6A 1MD2D 1TT2A 4BBSG 2Q2TA 1EOTA 5CV5A 3F2DA 5C0XJ 1U4MA 1K8MA 5LMNL 4X66Q 3KBGA 3CF5A 4KMUC 4ZUJA 5C44G 3M9BA 1I94Q 2R92B 3GV6A 3GQBA 1U5KA 2Z6KC 3HOYG 2PI2E 4UP8A 5KEEA 5C4XH 1HHVA 1A2TA 3HOXH 4JCVE 3I4LA 5FKAC 1XJVA 2C9OA 1I4HA 3D4WA 3E9IA 4CJ2C 4QJFA 3BU2A 4RAUC 1QUQB 3A5ZB 5GAHC 2DNEA 4I7ZC 1HA6A 4A76A 4OO1G 2WP8J 1EIFA 5LL6X 1TY2A 1Y8NB 4HJ9A 3I73A 2DUDA 2K05A 1Q7YC 4FF3A 2E5LQ 3RUZA 1VS0A 4QIWB 2NBFA 3J7YW 1BBUA 1TWHB 2Q2IA 4CKBA 5IGGA 2KEDA 2GVBA 1B7YB 5E1FA 5CV7A 4RKBA 1AW7A 4CGYB 2F0WA 3GTPB 2UXBQ 4C3IG 4XXEA 2EY5A 3N52A 2NUCA 1IBLL 4EX5A 1DJRD 2IPKD 1VQNA 2CWAA 4JI1L 1G291 5HGQA 2J4XA 3HOWG 1BCPB 4OIJA 2UXDQ 1HNZQ 2I07B 2D2CC 1YIJA 3L7ZC 3MFGA 1XMOQ 2R7ZH 1DOLA 2MP1A 2CH4A 3NTKA 5IP9H 1N34L 3MWYW 2NN6I 4C3JB 4RH6A 2UUAL 1TKWB 4DK1A 2O4XA 3ITPA 2Z6KA 4FDBA 1S4ZA 2I5MX 4GKKL 1HFGA 2WFWA 4LK1C 1BQQT 4KI0A 3HOZH 1VQOA 2OQ0A 1E7ZA 3A8IE 3STBD 2VUMG 4C3HG 3UDGA 1HH2P 4K5VA 3R93A 2K5QA 3M85A 3R8BA 4DV5Q 5M3MH 3VR2A 3PO2H 2SEBD 4HTHA 1X9NA 2K14A 3H3VH 3JC66 4DV6L 1BO0A 2ES2A 2BH8A 2B63B 3KLRA 4LUVA 1JWMD 5CR3A 3K81C 3GTJH 3OYYA 4DAVA 3G71A 2F0QA 5COYA 2KOLA 1KHIA 2EE1A 2F0LA 2HIVA 4LJZC 2HQEA 4B3RQ 4KD4A 4A3EG 2A8VA 1QILA 1PA6A 3L9AX 1ZXTA 1UE6A 3S1QB 4O2DA 5ELDA 5IP7H 1WTVA 3I4NH 2K6AA 4DXFA 1V9PA 2D5DA 4GLAC 1CHPD 2EJGC 4PQXA 3V96A 4DUZQ 1C8CA 4LUOA 2Q8TA 5DM63 4OHJA 1L2FA 3VYSA 2OXPA 4JVZA 2R92H 4JI4L 4FF1A 3CMEA 5IGDA 4WJ4A 4HIKA 4BY1G 1YJWA 1PFNA 1Q82C 2IT1A 4POGA 4LFBQ 1IYVA 1M1KC 1S5DD 3F2CA 1O7YA 5AJ3L 5DM73 1YHQA 4L6TB 4A3FG 5M9OA 1VQCA 3BDLA 2A5HA 5E4WC 2Z4IA 1LTSD 1SYEA 1TWHH 1I4XA 1QVCA 3UDXA 4QY7A 2V1CC 5EQ0A 2VQEQ 3DEPA 4X3KA 3GV3A 3VA7A 2JA7B 3G7LA 1BUVT 3H6MA 4PMBA 1ENCA 2DY7A 3Q24A 1S72A 4A3IB 3F2BA 1SR3A 1EWCA 3PUWA 3GTPH 2H5XA 5I6YA 5KNCA 3CC7A 3P1HA 4HJ5A 1VMCA 1V1OA 3PMFA 2R93B 3HOUG 2LXKA 2PQEA 1V1PB 3HFZB 4DV1L 2NVYB 2ZXOA 1VMPA 2ZTCA 2SNSA 2EPBA 1KNEA 4C3JH 3J80L 5EBCA 1TXYA 3A74A 3RN2A 3NWTA 1A2UA 2QILA 3TREA 3Q23A 3JAMc 1N32L 1IKLA 2ICIA 1TWAB 2XGTA 5ELEA 4LF6L 5IYCG 4GZYC 3LNNA 5K36G 2LSSA 1WTWA 1L1OA 4DV6Q 1F77A 4DR6L 3JAME 3OMGA 2LMCB 1PDQA 4JI6L 1B70B 2BCOA 4DAYB 2QKIC 1MJEA 2WACA 4NP5A 2F3IA 4DR5L 3ULLA 2WAQE 1OXUA 4X64Q 2WKDA 1Q12A 1JT8A 2G9HD 2O5IC 2F0JA 3MEFA 4ILWA 3H3VI 3R2TA 1VQPA 2AQ2B 4UP9A 4BBSB 3L0OA 1SN8A 3BZKA 2E75C 2OWOA 2RDHA 1IKMA 1HPCA 3S1QH 2M9VA 4JI4Q 5EPLA 5LMUQ 2EYLA 2H4OA 4POFA 2JQOA 4K5WA 5BN5A 2CQOA 2RSNA 1NJIC 2CFMA 1EU3A 3AB9A 1TY0A 3I2ZA 3HOYB 1MI2A 1BCPD 3RLOA 4A3DB 1S5FD 4G7HC 2NYZD 4GNXB 5C0XG 1FGBD 4APVA 2K5WA 4LF4L 1V43A 3A0JA 1ZKOA 4NB3A 3Q22A 2ZJQA 1S5BD 1RTOA 2KHIA 2E2JB 2Y0SB 3D31A 4NPSA 4IPHA 1B44D 1GHJA 5IY0A 4R4TA 3J7ZC 1JJ2A 1XNQQ
chains in the Genus database with same CATH topology
5NUCA 1KTKA 5KNBA 1II3A 3P20A 1SEBD 3NHHA 1EY9A 3T16A 4S3SA 1BOSA 1SMYD 3VYTA 2EYPA 1R9TB 1VDZA 1RTNA 1EQTA 1HXYD 3U9SA 2L4NA 2L1BA 5K5PA 1IW7C 1XTCD 1D5MC 2L12A 3OW7A 1I6VC 1SNDA 1W6JA 4B9XA 3MC0B 1WTQA 4K2KA 3J81E 4PMWA 3K6OA 5CBAE 5EKIA 4QMGA 5CV9A 4ZKBB 1PTOH 1AFPA 4C3HB 5EPKA 1QWYA 3FMCA 2CW0D 3C1FA 2FMCA 3HP3A 4RHRA 1H9SA 4AYBB 2RKSA 5C4HA 4DF7A 1SNOA 2A73B 1A6XA 2C5CA 3EFXD 1EQVA 4NMZA 3MFYA 1JORA 2PYKA 2KUMA 1TWFB 1NUCA 3I70A 4A3EB 2XIWA 2Z8LA 2EYFA 1PZKD 1JC7A 4RGMA 1Y1WB 4KJNA 2E2IB 2RDGA 4KY6A 3TP7A 3VR5A 5FLXL 4RKLA 4FP5D 1QNUA 1Y69U 5LHY1 2MPMA 2JA8B 4FVMA 5FO7B 5I9PA 4ME5A 1SFOB 5A35A 3BZDB 4BY1B 1PZID 4O1NA 3TBIB 3I91A 3SE0A 3PIP3 1RJTA 1GUTA 2EYHA 3CHBD 3SK6A 3J7AV 2B8GA 3NQIA 3VR6A 3NUCA 5T1IA 5JEAJ 4C2MB 1RCVD 3TP5A 4OGQC 1STEA 2R61A 4F87A 2V4DA 1F2ZA 1EY4A 1JB3A 1SYDA 3RLFA 1SE3A 2EZVA 3HOUB 2R6GA 5KNDA 4XQJA 4FXGC 4FF4A 1TQOA 4BA2I 4HCEA 4K5XA 1B3AA 4HCSA 4KTAA 1GUWA 1F2YA 2L9HA 4TKOB 3A8JE 3N6RA 1YNJC 2CQAA 3HRZC 1I3QB 3FRPB 1PRTC 4KD3A 1SNPA 3GD7A 2JEBI 3D6WA 2PW7A 1SNMA 5A2QE 1QJOA 5LL6S 2I46A 2WV6D 4HSVA 3URYA 3K5NA 1QNKA 4F88A 2EDGA 4IUPA 2B2YA 4DGZA 3IAYA 1BCPF 2F3VA 2BE5C 2XN9C 2DY8A 3K7AB 4RGOS 4WJWA 4ZK9B 2F0PA 4M1UB 1FNWA 1CZWA 2Z4HA 3M4OB 1LLRD 1JOOA 2NB0A 3BVMA 1FR3A 1DM0B 2TSSA 1ENFA 2YYZA 1EWHA 1CFMA 1BNZA 4B08A 4J6HA 2K32A 2JP1A 1HTLD 2RSOA 1YNNC 2BDNA 2B2VC 2PO4A 1RD9D 4BWGB 2K1BA 1NR4A 5FK9C 1B9NA 3OWFA 1HQMC 1U4LA 4RCOA 2RA4A 3TN2A 4ZRZA 2WKCA 5I2XA 3KLSA 1KDAA 3S15B 1KDBA 1Y1VB 4A3GB 2BDOA 2Q8IB 2PCFB 4ID6A 1TIID 4HEDA 4WFN3 2D9UA 2AWOA 1FD7D 1STYA 5FOBB 1S5CD 1WD0A 2DNCA 3HGBA 3V2TA 5J1ZA 3S1RB 3PV0A 1EY7A 2LS01 1ML0D 1WD1A 1MGSA 5JPNC 2MGSA 2NVTB 1I4PA 3HOVB 5ELFA 1JOKA 3R2IA 1E2VA 1CI3M 2B2VA 1LO5D 5M5XB 3D4DA 3K5OA 3A54A 1RKNA 3DXJC 1GUGA 4M8AA 2NTTA 1OO9B 5AFWA 2B8FA 2KJXA 4ULLA 3R3OA 2J0TD 2PZWA 1J9OA 1VF7A 1XWEA 4X3UA 1EZ6A 5T1GA 1SJHD 1CQFA 4JBWA 4MHEA 3T13A 1DOMA 1DD2A 4DNRB 1B4OA 3E0JA 1XXGA 1TVXA 3NQTA 3IFDA 1PTOF 4U68A 4A93B 1SNCA 5JVG3 2M00A 2SDFA 3HEJA 3PUYA 5JVH3 3S1MB 5I2YA 1LACA 2K04A 1O78A 1UAPA 4Y7NB 3S17B 4CJ0B 1STGA 1HFNA 5C4JB 2L11A 1GXDC 5CV4A 4QUFA 2EYMA 2NVXB 2LKVA 5CV8A 4FO2A 2ENBA 4IUVA 4K2LA 4UDUC 3IKJA 1LTID 4N9TA 4XQNA 3VR3A 4QF4A 5IODA 1T5EA 2KCCA 4HMJA 3NBHA 1L0XB 1E0BA 1CT1D 4KV6A 4QCLA 4KHVA 2ID0A 3Q6SA 3KUPA 4FF2A 4XTCS 2E76C 4V190 3BDCA 4KY7A 4A3KB 5EGTA 1GUSA 5D65A 5BN4A 3NTHA 1PZJD 4CHTB 4PMCA 5IGFA 3NE5B 3MXNA 2EY2A 3NP8A 4OL7A 3DWQA 3BVZA 3M3YB 1Q3LA 1QOHA 1KAAA 1TS2A 2B39A 1B50A 3VA5A 1C4QA 4A3BB 1B9MA 1I50B 2FMMA 3SK5A 3CRLC 3DHQA 2XNAC 4IUTA 3T56B 3AMUA 3H3VC 3I3CA 4DN4M 5KGUA 1DONA 1D5XC 1EEID 3I4MB 3A8KE 1HQRD 2X6LA 2XRSD 2RVLA 1F2MA 1Q1BA 4ODGA 3GTKB 3PO3B 2RBMA 3GTMB 3TP8A 2VNUD 1PRTB 1EYDA 1G8ZD 2B2TC 3C46A 3CRKC 2PPBC 5C44B 4G7OC 3D8GA 3FPPA 3OPOA 2VB3X 3EQLC 4LMQD 2WAQB 5E3FA 1ZYRD 3DWPA 5I9OA 2KVMA 1IYUA 5CGKA 4PV1C 3Q0AA 3MXPA 1SSOA 4IQZA 2F4IA 5DEHA 3S16B 1GOZA 2L0CA 4IFDJ 1WTPA 1LTTD 5A2QL 5DAUA 4DU9A 3I90A 3M7NA 1LT6D 2TMPA 2N88A 3ND8A 5CMDA 1H9MA 1SE4A 1BCPC 1IW7D 1CTMA 4C3IB 3PUVA 4Q0FA 4P2CB 1GHKA 1FNVA 1HCZA 3HOWB 2HDMA 5F2DA 2EXZA 3OSOA 5IGEA 2B2TA 3FDTA 2PW5A 1CM9A 4Z9CB 1EIHA 4E6IA 3H09A 3OHXC 1U9RA 1TS5A 1F9PA 3GO5A 4ZQ3A 2VUMB 2QF7A 5E4XA 4CBVA 1KLGD 2AQ1B 1D2BA 1EY6A 1SMYC 4CJ1B 4IFDH 5D14A 4G4KA 1A3UA 1HTPA 2B2UA 5IGCA 3V05A 4CKEA 1AP0A 1NAPA 1JOQA 2ICEC 2IWHA 1STNA 3OIPA 3PUZA 3K5LA 3TSSA 4BS9A 2EYJA 1SAPA 3SK8A 1QE6A 1CZGA 1HUNA 5I4DA 4IN3A 1LABA 4KN7C 4RGNA 3RMHA 2JEAI 2A74C 1J8IA 3D6CA 2CW0C 4TSSA 4XYOA 3TDQA 1G91A 1K83B 3HKZB 3LWUA 5ELBA 3OOCA 2F0HA 3T4AC 5BN3A 5DNFA 3QJYA 4G7ZC 2NTSA 4OO1H 4H7BA 3W3AA 2O5JC 2B2WA 4BBRB 4A3FB 1Q1EA 4XT1B 1KNAA 1EIGA 3J80E 3GTLB 2A6EC 2HCIA 1Y8PB 1SNQA 2F0KA 3H94A 5D3DA 2OF1A 3VYRA 2XWJB 4NKLA 2F03A 2M2LA 3QO2A 5J39A 3NXWA 4FNFA 1H9KA 4DAPA 3TMEA 3RZDB 1EY0A 2B2YC 3DEOA 1AZQA 1DZ1A 2F0GA 1KDCA 1YNJD 4RGTA 3QOLA 4RWSC 3QIAA 4NW2A 3D4RA 3SK4A 2L55A 1PRTD 1WTRA 2ZXRA 1PTOC 4KKTA 3T53B 2A6HD 3K0YA 3IFTA 1SJED 5HURA 3QOJA 1A3TA 1AN8A 2A69C 1Q8IA 4F8MA 3W2DA 1ZEQX 4HSPA 1F9QA 5M3FB 1F9RA 1ONLA 2K28A 2X6GA 3A56A 3HG9A 4KHZA 2IX0A 2L5TA 2F0DA 2GA4B 1QG7A 3P7JA 2K7VA 4IFDI 5CC4A 2MHVA 2OEOA 1EYAA 1I4QA 1OXVA 1V1PA 3VYUA 2AQ3B 4YIJA 3S14B 1KABA 2EJMA 2PMZB 1BXTA 3FEWX 1EFID 1I4RA 3H91A 1WTOA 5C5LA 2E74C 3AU7A 2MUYA 1EEFD 5I6WA 1X3PA 3ERQA 3EROA 5JPMC 3ZYYX 4WORA 3I72A 3MXUA 3S9WA 5M5YB 2PZTA 4DAYA 1TR5A 5M5WB 2J7ZA 2R7ZB 1LV9A 5CORA 1ET9A 4FXKC 1C48A 3CKIB 2SNMA 3K57A 5IGBA 1RDPD 1SDFA 4OO1I 3MEHA 5G3LD 3MHBA 3HOZB 5JAVA 4DXGA 2OT2A 4K8JA 4MIUA 1PXUA 2KEEA 3CQZB 2N55A 1R4QB 3HZXA 2NWGA 4R8NA 1G2TA 2IW3A 1AEXA 3EA6A 1HRJA 2FINB 2VB2X 4DFAA 4K6LA 2EYOA 2F0MA 3A7LA 2IX1A 1MSGA 2PZUA 4IALA 1STBA 2A68C 4X3TA 4BY7B 5K36H 3NBIA 3HS0C 5C5MA 1PFMA 3JAML 1Z7TA 1IL8A 3I4NB 3DUZA 2VXWA 1UEAB 5ISRA 3SVMA 4OIKA 4IUUA 2KECA 2O2LD 2KHSA 5FLXE 2QDBA 2LY7A 3DM1A 1Z47A 2EY6A 3SHLA 2QCPX 3MXGA 1IHZA 2JXMB 1G2SA 5EKLA 4WRDA 3E5SA 1H9RA 1ILQA 3RZOB 1F2LA 4U673 3ONAB 4R9WA 2AUKA 2Z1CA 3BDOA 2R3ZA 2XRQD 3ND9A 2NZ1D 2ZT9C 3GTOB 3FVQA 1JE4A 2WB1B 3C1EA 3WDNA 4CKCA 5CBEE 1LTAD 1I4GA 2F1MA 4XIGS 1H9SB 4L8JA 2QEJC 4IZ8A 5C0XH 3GP7A 2KCNA 4KY5A 4J8QA 1A3VA 1BBXC 2RDFA 4UAIA 2YU9B 3RD4A 1B1ZA 4KN4C 5KIXA 1SYBA 1JWSD 2F0VA 2F0OA 1M4VA 3T51B 2FFKB 3F2UA 1XYIA 2F0SA 3TZUA 1JCKB 3H0GB 3DMUA 1Q90A 1ENAA 3A55A 5C6AA 5JEAG 1PRTF 3D3RA 3OMCA 1WCMB 4RFBA 3FKIB 3UI2A 1TWGB 2CHBD 1FNUA 4TQUS 1OXTA 2LFNA 3PUXA 1CK1A 1FYCA 3L3OC 4C1NI 3TZDA 4C56C 1M8AA 3J81L 2AWNA 1DCZA 4DNTB 2NN6G 5J22A 2CVRA 3BVGA 1R4PB 2K01A 1JQYD 1PLFA 2WIIB 3WOEA 1SYCA 3NTIA 3SEBA 1K8OA 4NDXA 4DK0A 5EJWA 1HA5A 3K59A 5IOCA 5IT9E 1U4RA 1RHPA 2D62A 3QB3A 1L0YB 1SE2A 3NSWA 1B53A 1SYGA 3MVVA 2E2DC 4MN3A 3BYYB 2XWBB 4EQNA 1UNSA 2XSCA 1JICA 4DA2A 1O7LA 3MZ5A 2JSOA 4FXDA 4RA8A 2JA5B 1O80A 1EU4A 5EBDA 3C3LA 3MAQA 4H44C 3MA2B 1MSHA 2BA0A 5EKKA 4ZYSA 5G3LF 5C0XI 4XYQA 2HUGA 4JK1C 4QB4A 1CA6A 1CA5A 1LT4D 1NSNS 5TSSA 1PTOB 4FYDA 3KF8A 5JOBA 3SDZA 4PNYA 4EVOA 1G6ZA 5FO9B 2JE6I 1LTBD 3U9OA 2PNRC 1W6KA 5C3EB 3BG3A 1PFBA 4H0LC 4ZLTF 2BA1A 3DWAA 5JJZA 3I8ZA 3O13A 3K5MA 3OWEB 2F3WA 3QG1A 1LT3D 4EGVA 4IURA 1E2WA 5CYUA 5EPJA 1TU2B 3SXHA 4IUQA 2F0IA 1D1KA 1JR0D 1RF2D 4ABNA 1AZPA 4C1NK 2MJ8A 4Q5VA 3CU7A 3VR4A 1SBBB 4BA1I 3C2PA 3S1NB 3KBXA 1LTRD 1ET6A 2B2UC 1NR2A 1CQVA 5KYLA 1CHQD 3K58A 1T5XD 4XQQA 3X3MA 3EVQA 2Q8RE 1OXXK 2XVSA 1JWUD 1ZYRC 4R8IA 2F0NA 1WVLA 1QCBD 3S2HB 4EQPA 4K8IA 4HN7A 4G57A 2JA6B 1ICWA 1GJXA 4I65A 2HCCA 4XDXA 1DOKA 1SXTA 3P75A 1F9SA 1Y8OB 2B2WC 4A3JB 1X3QA 1BDOA 3OIQA 1HUMA 4HAEA 4A3MB 2DN8A 1DXMA 2EVBA 1SYFA 1Z6HA 2F0UA 1A15A 4ZKCB 2JYOA 3GTQB 2FHTA 1TS3A 3FPUB 2SOBA 1XX8A 3PIO3 5ELCA 5IIFA 2G9DA 2ZXPA 5C3XA 3GTGB 4HR7B 4H13C 2F0TA 1BF4A 3S2DB 3E6ZX 2E2HB 1I6HB 1EZ8A 4RCNA 1KLUD 3MTSA 5C3WA 1EL0A 4ZUIA 1TWCB 2A6ED 2RQXA 4RHSA 4C3JG 3QWNA 1EY8A 3SR1A 4K6DA 4KK7A 1GUNA 4L63B 2NVQB 3LWEA 1LT5D 1UUPA 4QUCA 3J7AF 4X3SA 1BR9A 1TS4A 3NWSA 3NK9A 4V0BA 1PTOD 2BOSA 1STHA 2A69D 3WOFA 4K14A 2AUJD 2K33A 2EY1A 2X69A 2F0FA 3EJIA 2HDLA 1D6EC 3LX0A 1GUOA 4B9WA 4LAAA 1PMRA 2K5DA 4KKSA 1EY5A 1RODA 5C4XB 3HOXB 1MBYA 2FJ2A 4IUNA 3M4YA 1QB5D 2EOTA 3G6JB 2KA7A 4KKUA 1U4PA 2BE5D 3KK7A 1NCVA 1D5ZC 2H1EA 2F0EA 2IL8A 2A6HC 1ESFA 5HGTA 5JEAH 4EQOA 4O42A 1LTGD 1OXSC 2IX3A 4N9PA 2EJFC 2K03A 4J1MA 1WTXA 4F7XA 2NN6H 1V8QA 5KYIA 5FO8B 5KRUA 4KJOA 1STAA 1S5ED 1YNND 3BYTB 1O7ZA 3A7AB 1VF5C 1DYQA 3KLSX 5CV6A 1X32A 5IT9L 5D3IB 3NPPA 1PYWD 3M7GA 2IJ0A 1B2TA 3X3NA 4IFDG 1EYCA 1E2ZA 5M3MB 3PO2B 1H9JA 4HMIA 1VCIA 4XT3B 2A68D 1D1IA 3IL8A 1ILPA 2WINB 3GTJB 3BS1A 4ZAIA 1ESRA 5C4ZA 2KQ3A 4TRDA 3TP6A 1MD2D 1TT2A 1EOTA 5CV5A 5C0XJ 1U4MA 1K8MA 3KBGA 4KMUC 4ZUJA 2R92B 3GV6A 3GQBA 5KEEA 1HHVA 1A2TA 3I4LA 5FKAC 2C9OA 1I4HA 3D4WA 4CJ2C 4RAUC 2DNEA 4I7ZC 1HA6A 4OO1G 2WP8J 5LL6X 1TY2A 1Y8NB 3I73A 2K05A 4FF3A 3RUZA 4QIWB 2NBFA 3J7YW 1TWHB 4CKBA 5IGGA 2KEDA 5E1FA 5CV7A 4RKBA 1AW7A 4CGYB 2F0WA 3GTPB 4C3IG 4XXEA 2EY5A 3N52A 2NUCA 1DJRD 2IPKD 1G291 2J4XA 1BCPB 4OIJA 2I07B 2D2CC 3L7ZC 3MFGA 1DOLA 2MP1A 3NTKA 3MWYW 2NN6I 4C3JB 4RH6A 1TKWB 4DK1A 2O4XA 3ITPA 1S4ZA 1HFGA 4LK1C 1BQQT 4KI0A 3A8IE 4C3HG 4K5VA 3R93A 2K5QA 3M85A 3R8BA 3VR2A 2SEBD 4HTHA 1BO0A 2B63B 3KLRA 1JWMD 5CR3A 4DAVA 2F0QA 5COYA 2KOLA 2EE1A 2F0LA 4LJZC 2HQEA 4KD4A 1QILA 3L9AX 1ZXTA 3S1QB 5ELDA 1WTVA 2K6AA 4DXFA 2D5DA 1CHPD 2EJGC 4PQXA 3V96A 1C8CA 2Q8TA 5DM63 4OHJA 3VYSA 2OXPA 4FF1A 5IGDA 1PFNA 2IT1A 1IYVA 1S5DD 1O7YA 5DM73 4L6TB 5M9OA 3BDLA 2A5HA 5E4WC 2Z4IA 1LTSD 1SYEA 1I4XA 5EQ0A 3DEPA 4X3KA 3GV3A 3VA7A 2JA7B 3G7LA 1BUVT 3H6MA 4PMBA 1ENCA 2DY7A 3Q24A 4A3IB 1EWCA 3PUWA 5I6YA 5KNCA 3P1HA 1VMCA 1V1OA 3PMFA 2R93B 2PQEA 1V1PB 2NVYB 2ZXOA 1VMPA 2SNSA 2EPBA 1KNEA 3J80L 5EBCA 3NWTA 1A2UA 2QILA 3Q23A 1IKLA 2ICIA 1TWAB 5ELEA 4GZYC 3LNNA 5K36G 1WTWA 1F77A 3JAME 3OMGA 2LMCB 1PDQA 2BCOA 2QKIC 2WACA 4NP5A 1OXUA 2WKDA 1Q12A 2G9HD 2O5IC 2F0JA 4ILWA 3R2TA 2AQ2B 4BBSB 2E75C 2RDHA 1IKMA 1HPCA 2M9VA 5EPLA 2EYLA 2H4OA 4K5WA 5BN5A 2RSNA 1EU3A 3AB9A 1TY0A 3HOYB 1MI2A 1BCPD 4A3DB 1S5FD 4G7HC 2NYZD 5C0XG 1FGBD 2K5WA 1V43A 1ZKOA 3Q22A 1S5BD 1RTOA 2E2JB 2Y0SB 3D31A 1B44D 1GHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PZI D;  1LO5 D;  1LT4 D;  2IJ0 A;  4O1N A;  1KTK A;  4RFB A;  1V1O A;  2XN9 C;  5TSS A;  1PTO B;  2CHB D;  4RGO S;  1FNU A;  5I4D A;  1CK1 A;  1V1P B;  4RGN A;  1FNW A;  1D6E C;  4C56 C;  2O2L D;  1SEB D;  3CHB D;  3DWP A;  1I4Q A;  1LTB D;  4TSS A;  1PZJ D;  1LLR D;  1V1P A;  2NTT A;  3R8B A;  2AQ3 B;  2QIL A;  3BVM A;  2ICI A;  1HXY D;  5ELE A;  2TSS A;  2SEB D;  5ELB A;  1ENF A;  1BXT A;  1MD2 D;  1RCV D;  3DWA A;  1TS3 A;  3BVG A;  1GOZ A;  1EFI D;  1XTC D;  1I4R A;  3O13 A;  3OWE B;  1LTT D;  1STE A;  3DWQ A;  1D5M C;  1JQY D;  1SJH D;  2R61 A;  1LT3 D;  1F77 A;  3BVZ A;  2NTS A;  1JWM D;  1LT6 D;  5ELC A;  1EEF D;  2XRQ D;  1SE3 A;  1JR0 D;  1RF2 D;  1SE4 A;  3MC0 B;  1HTL D;  1BCP C;  1XXG A;  3SEB A;  1TS2 A;  1HA5 A;  1D5Z C;  1PTO F;  1SBB B;  1RD9 D;  4BWG B;  1QIL A;  5FK9 C;  1ESF A;  1FNV A;  1PTO H;  5ELD A;  5D3D A;  5FKA C;  1LTR D;  4DXF A;  1I4H A;  1ET6 A;  1LTG D;  4RCO A;  1KLU D;  1I4G A;  1CHP D;  1LTA D;  4Z9C B;  1L0Y B;  2G9H D;  2XNA C;  1ET9 A;  1SE2 A;  4OHJ A;  2QEJ C;  3GP7 A;  1CQV A;  3R2T A;  1TY2 A;  2AQ2 B;  3BYY B;  1CHQ D;  1UNS A;  1T5X D;  4RHR A;  1TS5 A;  2RDH A;  1RDP D;  1PRT C;  4RHS A;  1D5X C;  1EEI D;  3EFX D;  4DXG A;  1HQR D;  1JWU D;  1EU3 A;  1S5D D;  1FD7 D;  2XRS D;  4RGT A;  1TY0 A;  1B1Z A;  1KLG D;  2AQ1 B;  4UDU C;  1S5C D;  2Z8L A;  1AW7 A;  1BCP D;  1EU4 A;  1PRT D;  1S5E D;  4L63 B;  4L6T B;  3BYT B;  1JWS D;  1S5F D;  1PZK D;  1LTI D;  4RGM A;  1PTO C;  1LT5 D;  1LTS D;  1M4V A;  1DJR D;  1FGB D;  1I4X A;  2IPK D;  3EA6 A;  2RDG A;  2WV6 D;  1UUP A;  4K6L A;  4ZYS A;  1DYQ A;  3KLS X;  3URY A;  1SJE D;  2J4X A;  1AN8 A;  1BCP B;  1JCK B;  1PRT B;  1L0X B;  1I4P A;  1TS4 A;  3V05 A;  3W2D A;  1CT1 D;  1G8Z D;  5ELF A;  1S5B D;  3MFG A;  5D3I B;  1PTO D;  1EWC A;  3R2I A;  1B44 D;  1PYW D;  1SXT A;  3BZD B;  3TSS A;  1BCP F;  1PRT F;  4RH6 A; 
#chains in the Genus database with same CATH topology
 5NUC A;  4YWK A;  4J15 A;  1KTK A;  1OTC A;  2UUC Q;  2JA7 H;  2K5V A;  4PG3 A;  5KNB A;  1II3 A;  1KC8 C;  4A3I H;  3P20 A;  4BXX H;  4DR7 Q;  1SEB D;  3NHH A;  1EY9 A;  3T16 A;  4S3S A;  1BOS A;  2JA5 H;  1SMY D;  3VYT A;  2EYP A;  4DK6 C;  1R9T B;  1VDZ A;  3G4S A;  3KF6 A;  2R93 H;  1RTN A;  1EQT A;  1HXY D;  4CDF C;  3U9S A;  2VZA A;  4N8X 1;  1J5E Q;  2L4N A;  2L1B A;  5K5P A;  1IW7 C;  4A75 A;  1XTC D;  2NVY H;  3J81 c;  1D5M C;  1Y1V G;  2L12 A;  4A3G G;  4YHH Q;  1XPU A;  3OW7 A;  1I6V C;  1LTL A;  1SND A;  1W6J A;  2DJF C;  4B9X A;  3PF5 A;  2UUB L;  1TWA H;  3MC0 B;  1WTQ A;  4K2K A;  3J81 E;  4PMW A;  3K6O A;  5CBA E;  5ELN A;  1YI2 A;  5EKI A;  4QMG A;  5CV9 A;  4ZKB B;  1PTO H;  1AFP A;  4C3H B;  5EPK A;  1QWY A;  3FMC A;  1PH8 A;  2CW0 D;  3C1F A;  1IL2 A;  1G6P A;  3HKZ E;  2FMC A;  1KD1 C;  4DR2 Q;  3HOV G;  3HP3 A;  5GRO A;  4RHR A;  2ZM6 Q;  1H9S A;  4AYB B;  3WWV A;  3RR5 A;  2RKS A;  4P73 A;  5C4H A;  4KHP L;  4DF7 A;  1FGU A;  1SNO A;  2A73 B;  1A6X A;  2C5C A;  3EFX D;  1EQV A;  4NMZ A;  3MFY A;  1JOR A;  2PYK A;  2KUM A;  1TWF B;  1NUC A;  2RHS B;  3I70 A;  4DV0 L;  1IBM Q;  3M4P A;  4BBS H;  4A3E B;  2XIW A;  2Z8L A;  1HZC A;  2EYF A;  1PZK D;  1JC7 A;  4RGM A;  4JOI A;  1CKN A;  1Y1W B;  2D0P A;  4KJN A;  2E2I B;  1PVO A;  2RDG A;  4KY6 A;  3TP7 A;  3VR5 A;  4QGU A;  5FLX L;  4RKL A;  1XMQ L;  4FP5 D;  1QNU A;  1Y69 U;  2LXJ A;  5LHY 1;  2MPM A;  2JA8 B;  4FVM A;  5FO7 B;  5I9P A;  4ME5 A;  4A3D H;  4B3T Q;  1SFO B;  1GO3 E;  5A35 A;  3BZD B;  4BY1 B;  1PZI D;  3PIP A;  3TEH B;  4O1N A;  5IYB H;  3TBI B;  3I91 A;  1JE5 A;  3SE0 A;  2A1A A;  3PIP 3;  4A93 G;  3CCQ A;  1RJT A;  1GUT A;  2A19 A;  2EYH A;  3CHB D;  3SK6 A;  3J7A V;  2B8G A;  4IOA A;  3B6Y A;  4P72 A;  4R4Q A;  2UXC Q;  3G48 A;  2N8N A;  3NQI A;  3VR6 A;  3NUC A;  5T1I A;  5JEA J;  4C2M B;  4GN3 B;  4X62 L;  1RCV D;  3TP5 A;  4OGQ C;  3KDF A;  2JA6 H;  1STE A;  3T1H L;  2PNH A;  2R61 A;  4F87 A;  2V4D A;  1F2Z A;  2Q2U A;  3CCS A;  1EY4 A;  4OX9 Q;  1R9T H;  1JB3 A;  1SYD A;  3RLF A;  1Q86 C;  1SE3 A;  2EZV A;  3HOU B;  2R6G A;  5KND A;  4XQJ A;  2MO0 A;  4FXG C;  4FF4 A;  3U4Z A;  1VQJ A;  4H02 A;  1TQO A;  3FKI G;  4BA2 I;  3W1B A;  4A4I A;  2F4V Q;  4HCE A;  5BR8 L;  1WI5 A;  4K5X A;  4A3M H;  1B3A A;  4JPB W;  2KEN A;  4HCS A;  4KTA A;  1GUW A;  3D0F A;  1JB7 A;  1F2Y A;  2L9H A;  4TKO B;  3A8J E;  1PH4 A;  2YTY A;  3N6R A;  3FHW A;  1YNJ C;  2PMZ E;  4AH6 A;  3E0E A;  2CQA A;  1N9W A;  4LF8 Q;  3HRZ C;  4C3H H;  1I3Q B;  3FRP B;  4B3M Q;  3GTQ H;  1PRT C;  1W2B A;  4KD3 A;  1HZB A;  1SNP A;  3GD7 A;  1YHA A;  1RL2 A;  4KHP Q;  4LFC L;  1N36 Q;  2JEB I;  4A3K G;  3D6W A;  2PW7 A;  1A62 A;  1E22 A;  1SNM A;  4MTK A;  3LGJ A;  2Z0S A;  4DNI A;  1HJP A;  5A2Q E;  1QJO A;  1N33 Q;  5LL6 S;  2I46 A;  2WV6 D;  4HSV A;  3URY A;  3S2D H;  3K5N A;  1QNK A;  4ALP A;  4F88 A;  1VQ5 A;  2E2H H;  4LW1 A;  2EDG A;  4IUP A;  2B2Y A;  4DGZ A;  3KF8 B;  1Y1W H;  3IAY A;  1BCP F;  2F3V A;  2E2I H;  2BE5 C;  1O7I A;  2XN9 C;  2DY8 A;  3K7A B;  4RGO S;  1GKH A;  1C0A A;  2JA8 H;  4WJW A;  4ZK9 B;  2F0P A;  4GLV B;  1FNW A;  4M1U B;  1CZW A;  2Z4H A;  1PH7 A;  1WFQ A;  1SFO H;  3M4O B;  3RN5 A;  1LLR D;  1JOO A;  4K0K Q;  2NB0 A;  3BVM A;  1FR3 A;  2I5L X;  1DM0 B;  2TSS A;  1ENF A;  4JW0 A;  2YYZ A;  4GN4 B;  4GN5 A;  1EWH A;  1L0W A;  1Z9F A;  2IHF A;  4R1J A;  1CFM A;  2RHQ B;  1BNZ A;  4B08 A;  4HJA A;  2GVA A;  3ERS X;  4DKA C;  4YWM A;  4J6H A;  3T1H Q;  1XNR L;  2K32 A;  1S40 A;  2JP1 A;  1HTL D;  2RSO A;  2HHH L;  1PH9 A;  4C2M H;  1YNN C;  2BDN A;  2B2V C;  2DGY A;  2PO4 A;  1RD9 D;  2EQS A;  4LFA Q;  4BWG B;  3M4Q A;  1JJG A;  2K1B A;  1NR4 A;  2VY3 A;  5FK9 C;  1X3F A;  1B9N A;  3PO3 G;  3OWF A;  1HQM C;  4LF9 Q;  1U4L A;  4NXN Q;  4RCO A;  2RA4 A;  3TN2 A;  4P71 A;  4ZRZ A;  2WKC A;  5IWA Q;  5I2X A;  2VS1 A;  3AYH B;  5C3E G;  3KLS A;  1KDA A;  1Q81 C;  3S15 B;  1KDB A;  3UDI A;  5GQO A;  1Y1V B;  4A3G B;  3EBE A;  2BDO A;  2Q8I B;  2PCF B;  4ID6 A;  1TII D;  4HED A;  4WFN 3;  2D9U A;  1VQB A;  2AWO A;  1FD7 D;  4IJL A;  2WAQ G;  4DR1 Q;  1STY A;  2WB1 E;  4LFC Q;  5FOB B;  1S5C D;  4LF5 L;  1HR0 L;  1WD0 A;  4JI0 Q;  2DNC A;  3HGB A;  1I3Q H;  3V2T A;  1GVP A;  5J1Z A;  1JJC B;  3S1R B;  3PV0 A;  1U0L A;  1EY7 A;  2LS0 1;  1X6O A;  1ML0 D;  1WD1 A;  1MGS A;  5JPN C;  2MGS A;  2NVT B;  1PV4 A;  1I4P A;  1A63 A;  1X54 A;  3HOV B;  5ELF A;  1JOK A;  3R2I A;  1E2V A;  5E7N A;  3CCL A;  1NBW A;  1CI3 M;  1MIU A;  2B2V A;  1LO5 D;  5M5X B;  2Z6B A;  3D4D A;  3K80 C;  2L15 A;  1VQ7 A;  3K5O A;  3A54 A;  4MTN A;  5JJL A;  4X65 Q;  2VW9 A;  3CCM A;  1RKN A;  3DXJ C;  1GUG A;  1PH1 A;  4M8A A;  5JJI A;  1FL0 A;  2NTT A;  2N49 A;  3ULJ A;  1OO9 B;  5AFW A;  2B8F A;  3K7A H;  2KJX A;  1HNW L;  1K9M C;  1K0R A;  2K5H A;  1VQF A;  4ULL A;  3R3O A;  3HKS A;  2J0T D;  2PZW A;  4JI2 Q;  1J9O A;  1VF7 A;  4DR3 L;  1XWE A;  4X3U A;  1EZ6 A;  5T1G A;  4RG1 A;  1SJH D;  1CQF A;  5LMN W;  4JBW A;  4MHE A;  3T13 A;  3J81 j;  1DOM A;  1DD2 A;  4DNR B;  1B4O A;  3E0J A;  1K0S A;  2UU9 L;  1XXG A;  1TVX A;  3NQT A;  3IFD A;  1PTO F;  4U68 A;  4A93 B;  1SNC A;  1T9H A;  4A3C G;  5JVG 3;  2K52 A;  2M00 A;  2SDF A;  2HQL A;  4I7A A;  4L5Q A;  3HEJ A;  1JMC A;  4MZ9 A;  3PUY A;  5JVH 3;  3S1M B;  5I2Y A;  1LAC A;  2K04 A;  1O78 A;  1UAP A;  4Y7N B;  3S17 B;  4CJ0 B;  1MKH A;  4R4I A;  1SMX A;  1STG A;  1HFN A;  4DPG A;  2L11 A;  5C4J B;  1QVG A;  3E9H A;  1GXD C;  5CV4 A;  1BVS A;  5LMN Q;  1HZ9 A;  4QUF A;  1YJ9 A;  2EYM A;  2NVX B;  2LKV A;  3PF4 A;  5CV8 A;  3CPF A;  4FO2 A;  2ENB A;  4IUV A;  4K2L A;  4UDU C;  3S15 H;  3IKJ A;  1K8G A;  1Y1V H;  1B3Q A;  4A3G H;  1UE1 A;  4OWT B;  1LTI D;  4N9T A;  4XQN A;  1Q46 A;  4QF4 A;  3VR3 A;  5IOD A;  1T5E A;  1A8V A;  2KCC A;  4HMJ A;  1PH2 A;  1ICF B;  3NBH A;  4JBM A;  3HKZ G;  1L0X B;  1E0B A;  1CT1 D;  4KV6 A;  4QCL A;  4KHV A;  2ID0 A;  3Q6S A;  3KUP A;  4FF2 A;  3ER0 A;  2R7D A;  3S1R H;  5IYD H;  1L1O C;  4DV4 L;  4XTC S;  3KYH C;  2E76 C;  4V19 0;  2NVT H;  4BBR G;  3BDC A;  4KY7 A;  4GOP A;  4A3K B;  5IT9 c;  3HOV H;  5EGT A;  1GUS A;  5D65 A;  5BN4 A;  5JJK A;  1IBL Q;  3NTH A;  1E1T A;  1PZJ D;  4CHT B;  4PMC A;  4JI1 Q;  5M5X H;  4JG2 A;  5IGF A;  3NE5 B;  4CDC C;  2HT1 A;  4KLK A;  4P75 A;  3MXN A;  3K7U C;  2EY2 A;  3NP8 A;  1N34 Q;  4OL7 A;  1VQE A;  3DWQ A;  5EAY A;  1NNX A;  3UE0 A;  5GAE C;  2UUA Q;  3BVZ A;  2K75 A;  3M3Y B;  1Q3L A;  1QOH A;  4YY3 L;  4GKK Q;  1LM0 A;  5FJ8 G;  1KAA A;  1X3E A;  1TS2 A;  1AE2 A;  2JJQ A;  1FJG L;  4PZ7 A;  2B39 A;  3PQI A;  1B50 A;  1EQR A;  3VA5 A;  4IOC A;  1C4Q A;  5FLM G;  3ICE A;  4A3B B;  1B9M A;  1I50 B;  2FMM A;  3SK5 A;  2ZJP A;  3CRL C;  2PQA A;  2HIX A;  3DHQ A;  3CCR A;  2XNA C;  4IUT A;  3T56 B;  1VQ6 A;  4A93 H;  3AMU A;  3H3V C;  5M3F G;  3I3C A;  3NEM A;  4DN4 M;  5KGU A;  1YHB A;  3CD6 A;  2CCZ A;  1HNX L;  1DON A;  3S1M H;  1D5X C;  1EEI D;  1QZG A;  3I4M B;  3HOX G;  3A8K E;  1HQR D;  2X6L A;  2B63 H;  4ME3 A;  4Y7N H;  2XRS D;  1K73 C;  2RVL A;  1F2M A;  1Q1B A;  4ODG A;  4JYA L;  2E8G A;  3GTK B;  3PO3 B;  3JAM i;  2OQK A;  2RBM A;  3GTM B;  2NVX H;  3TP8 A;  1VQM A;  3RLN A;  2VNU D;  1PRT B;  1EYD A;  1G8Z D;  4DV2 L;  2B2T C;  2GN5 A;  3C46 A;  3CRK C;  2PPB C;  3FP9 A;  5C44 B;  4G7O C;  5DLQ E;  3D8G A;  3FPP A;  3OPO A;  2VB3 X;  3EQL C;  4LMQ D;  4DV4 Q;  5AJ3 Q;  3U50 C;  2WAQ B;  5E3F A;  1ZYR D;  3DWP A;  5I9O A;  2KVM A;  1IYU A;  4LF7 L;  2R7Z G;  1VQH A;  5CGK A;  1VQA A;  5IP9 G;  2XTI A;  4PV1 C;  3Q0A A;  3MXP A;  1SSO A;  4A3K H;  4IQZ A;  2F4I A;  4YWL A;  5DEH A;  3S16 B;  1GOZ A;  2L0C A;  4IFD J;  1WTP A;  1LTT D;  5A2Q L;  5DAU A;  4DU9 A;  4OON A;  4UHV A;  3I90 A;  4JI5 L;  3M7N A;  1NY4 A;  1LT6 D;  2TMP A;  3HOZ G;  2N88 A;  3ND8 A;  1S3O A;  5CMD A;  1H9M A;  1AE3 A;  1SE4 A;  1BCP C;  1IW7 D;  1CTM A;  4C3I B;  3PUV A;  4OEL B;  4Q0F A;  4DV1 Q;  4P2C B;  1GHK A;  5M3M G;  1FNV A;  1HCZ A;  3HOW B;  2HDM A;  4GKJ L;  5F2D A;  1E1O A;  2EXZ A;  3OSO A;  4JOI C;  5IGE A;  2B2T A;  3FDT A;  2ALY B;  2PW5 A;  1CM9 A;  1N32 Q;  4LF6 Q;  4Z9C B;  1EIH A;  3W1G A;  4E6I A;  3H09 A;  3OHX C;  4IPG A;  1U9R A;  1TS5 A;  1CSQ A;  1KRT A;  1CSP A;  1QUQ A;  4DR6 Q;  4A3B H;  1I50 H;  1F9P A;  3GO5 A;  4JI6 Q;  4BY7 G;  4AQY L;  1SRU A;  4DV7 L;  2JK8 A;  4ZQ3 A;  1YEZ A;  1MJC A;  5IP7 G;  4DR5 Q;  4LNQ A;  3I4N G;  2VUM B;  2QF7 A;  2JN4 A;  5E4X A;  4CBV A;  4JBK A;  1KLG D;  2AQ1 B;  1D2B A;  1EY6 A;  1H95 A;  1SMY C;  4GLX A;  1KL9 A;  4CJ1 B;  4IFD H;  3F8T A;  5D14 A;  4G4K A;  1A3U A;  3I4M H;  1HTP A;  2B2U A;  1UE5 A;  5IGC A;  3J81 i;  4DUY L;  4OXP A;  1NTG A;  2HD3 A;  3V05 A;  4CKE A;  3T1Y L;  1NAP A;  1AP0 A;  2ICE C;  2IWH A;  1JOQ A;  1STN A;  3GTK H;  3OIP A;  4HJ8 A;  3PO3 H;  3PUZ A;  3TS2 A;  3F1Z A;  3K5L A;  2EIF A;  3TSS A;  1YIT A;  3PIO A;  4BS9 A;  4NXM L;  2EYJ A;  1SAP A;  1XPO A;  3SK8 A;  1QE6 A;  4B3S L;  1CZG A;  1HUN A;  5I4D A;  1LUZ A;  4IN3 A;  1LAB A;  2OTL A;  2WB1 G;  4KN7 C;  2K50 A;  4RGN A;  3RMH A;  2JEA I;  1EIY B;  1EFW A;  2VL6 A;  2A74 C;  1J8I A;  3D6C A;  2CW0 C;  4TSS A;  4XYO A;  5C44 H;  3OTO L;  4LF4 Q;  1PYS B;  3HOY H;  3TDQ A;  1G91 A;  1K83 B;  4OWX B;  4LF7 Q;  3HKZ B;  3LWU A;  5ELB A;  1VQ8 A;  3OOC A;  3BZC A;  2F0H A;  3T4A C;  1LYL A;  1IBK L;  3S24 A;  5BN3 A;  2KBN A;  3AQQ A;  3QJY A;  5DNF A;  3I7F A;  3J80 c;  4G7Z C;  2NTS A;  4OO1 H;  3KFU A;  4H7B A;  3W3A A;  3CAM A;  2O5J C;  2MNA A;  2E2J H;  2B2W A;  4BBR B;  1SE8 A;  4A3F B;  1Q1E A;  4XT1 B;  1KNA A;  1EIG A;  3J80 E;  3S16 H;  3GTL B;  2A6E C;  4JI3 L;  2HCI A;  1I5F A;  1Y8P B;  1SNQ A;  2F0K A;  3H94 A;  2CWP A;  3QR8 A;  5D3D A;  4GS3 A;  2OF1 A;  3VYR A;  2XWJ B;  4NKL A;  2F03 A;  2M2L A;  3QO2 A;  5J39 A;  4C3I H;  3NXW A;  1YJN A;  2FXQ A;  3H0G G;  1H9K A;  4FNF A;  3TME A;  4PZ8 A;  4DAP A;  3RZD B;  3HOW H;  1EY0 A;  2B2Y C;  3DEO A;  2UUB Q;  1BKB A;  1PFS A;  1AZQ A;  1DZ1 A;  2F0G A;  1WCM G;  1KDC A;  1YNJ D;  3Q8D A;  2AHO B;  4RGT A;  4P74 A;  4X6A H;  3QOL A;  4RWS C;  3QIA A;  4NW2 A;  3D4R A;  3SK4 A;  2L55 A;  1PRT D;  1WTR A;  2ZXR A;  1PTO C;  1W3S A;  3U58 A;  4KKT A;  3T53 B;  2A6H D;  3NEN A;  3K0Y A;  3IFT A;  1SJE D;  3QOJ A;  5HUR A;  1A3T A;  1AN8 A;  2A69 C;  1Q8I A;  5IE8 A;  2VUM H;  4F8M A;  3W2D A;  1ZEQ X;  4HSP A;  1F9Q A;  1EQQ A;  5M3F B;  2RCN A;  1NMG A;  1F9R A;  1ONL A;  2K28 A;  2X6G A;  3A56 A;  3HG9 A;  4QL5 A;  4UP7 A;  1XPR A;  4KHZ A;  2IX0 A;  2L5T A;  2F0D A;  1GD7 A;  2GA4 B;  4X66 L;  3ZJY C;  1QG7 A;  4DV0 Q;  4B3S Q;  2EXD A;  3P7J A;  2K7V A;  4IFD I;  5CC4 A;  2MHV A;  2OEO A;  1EYA A;  1I4Q A;  1TWF H;  4JI8 L;  1OXV A;  1V1P A;  3VYU A;  2AQ3 B;  4YIJ A;  4A3E H;  3S14 B;  1XMQ Q;  1KAB A;  2EJM A;  2PMZ B;  4UPA A;  1BXT A;  3FEW X;  1EFI D;  1I4R A;  3H91 A;  1WTO A;  4GNX C;  5C5L A;  2E74 C;  2E5L L;  2ZTE A;  1EWI A;  3AU7 A;  4L5S A;  2MUY A;  1EEF D;  1K83 H;  5I6W A;  1X3P A;  3I4O A;  3ERQ A;  3ERO A;  5JPM C;  3ZYY X;  4WOR A;  3I72 A;  3KJP A;  2JA5 G;  3MXU A;  3S9W A;  4BY1 H;  5M5Y B;  3CCU A;  2PZT A;  4DAY A;  1MHW C;  1TR5 A;  1C7Y A;  5M5W B;  2UXB L;  2J7Z A;  2R7Z B;  1LV9 A;  5COR A;  4A3F H;  1ET9 A;  4X62 Q;  1GM5 A;  4FXK C;  1C48 A;  4DK3 C;  3CKI B;  3GTL H;  1KRS A;  2UXD L;  1HNZ L;  2SNM A;  3K57 A;  4TVA B;  5IGB A;  1X65 A;  1XMO L;  1RDP D;  1SDF A;  1VQD A;  4OO1 I;  3MEH A;  5G3L D;  3MHB A;  3HOZ B;  4AIM A;  5JAV A;  4DXG A;  2OT2 A;  4N8F A;  4K8J A;  5ELO A;  4MIU A;  1PXU A;  2KEE A;  3RZD H;  3CQZ B;  3TS0 A;  5BR8 Q;  2N55 A;  1R4Q B;  3HZX A;  2NWG A;  3HOU H;  4R8N A;  1G2T A;  1V1Q A;  2IW3 A;  1AEX A;  3EA6 A;  1HRJ A;  2FIN B;  2VB2 X;  4DFA A;  4K6L A;  4Y52 H;  2EYO A;  2F0M A;  3A7L A;  4LWC A;  4DV5 L;  4GNX A;  1XTD A;  2IX1 A;  1MSG A;  2PZU A;  4IAL A;  1STB A;  2A68 C;  4X3T A;  4BY7 B;  4QIW E;  4YCW A;  5IYC H;  5K36 H;  3NBI A;  3HS0 C;  5FLX c;  5C5M A;  1PFM A;  4UY8 C;  3JAM L;  1Z7T A;  1IL8 A;  3I4N B;  3DUZ A;  2VXW A;  2ATW A;  1BBW A;  1UEA B;  5ISR A;  3SVM A;  5M3F H;  4OIK A;  4IUU A;  3KF6 B;  2KEC A;  4B3R L;  2O2L D;  1EUJ A;  2KHS A;  5FLX E;  2QDB A;  2LY7 A;  3DM1 A;  1Z47 A;  5HY6 A;  2EY6 A;  4YCU A;  4JI8 Q;  4A3D G;  3SHL A;  2QCP X;  4DUZ L;  3MXG A;  1IHZ A;  2JXM B;  1G2S A;  3CCE A;  5EKL A;  4WRD A;  5IYB G;  3E5S A;  1H9R A;  1ILQ A;  3RZO B;  1VQI A;  1F2L A;  2D0O A;  4U67 3;  3ONA B;  4R9W A;  2AUK A;  2Z1C A;  3BDO A;  2Y0S G;  2R3Z A;  1PH6 A;  2XRQ D;  4DR4 L;  1D7Q A;  3ND9 A;  2NZ1 D;  2ZT9 C;  3S14 H;  2K4K A;  3GTO B;  3FVQ A;  4A3L G;  1JE4 A;  2WB1 B;  4LFB L;  2QW7 A;  3C1E A;  2QEX A;  3WDN A;  4CKC A;  5CBE E;  1LTA D;  1I4G A;  2F1M A;  4R4O A;  4XIG S;  2JA6 G;  1H9S B;  4L8J A;  3M4O H;  2VQE L;  2QEJ C;  4IZ8 A;  5C0X H;  3GP7 A;  2KCN A;  5M5Y H;  3U4V A;  3UDF A;  2R7F A;  4KY5 A;  4J8Q A;  5M5W H;  1PHJ A;  1XNR Q;  1A3V A;  2HHH Q;  1BBX C;  2RDF A;  4UAI A;  1VQ4 A;  1J6Q A;  4GOP C;  1CKN B;  4A3J G;  2YU9 B;  3RD4 A;  1B1Z A;  4KN4 C;  1HR0 W;  1A0I A;  4A3M G;  5KIX A;  1SYB A;  2MO1 A;  1JWS D;  4HJ7 A;  2F0V A;  2F0O A;  4JI7 L;  1M4V A;  1YBY A;  3T51 B;  1CKO A;  2FFK B;  3F2U A;  1YZ6 A;  2F0S A;  3TZU A;  1XYI A;  2ASB A;  1JCK B;  3CQZ H;  3H0G B;  3DMU A;  1Q90 A;  1ENA A;  3PGZ A;  3A55 A;  5C6A A;  3W5O A;  5JEA G;  1PRT F;  3D3R A;  3OMC A;  1WCM B;  3STB C;  4RFB A;  3FKI B;  3UI2 A;  4AYB G;  1TWG B;  2CHB D;  3PCO B;  1FNU A;  1P16 A;  4TQU S;  1OXT A;  4LF5 Q;  2LFN A;  3PUX A;  1CK1 A;  1HR0 Q;  1FYC A;  3L3O C;  4C1N I;  4JBJ A;  3TZD A;  4C56 C;  1M8A A;  3J81 L;  2AWN A;  1DCZ A;  4BY7 H;  4DNT B;  2NN6 G;  5J22 A;  2CVR A;  4X64 L;  3KDF B;  4HIO A;  1Y1W G;  2B3G A;  3BVG A;  1R4P B;  2K01 A;  1JQY D;  1PLF A;  2WII B;  2JA8 G;  3WOE A;  1SYC A;  5LMU L;  3I55 A;  3NTI A;  4IPC A;  3SEB A;  4DR4 Q;  1K8O A;  1B8A A;  4NDX A;  4DK0 A;  4L5R C;  5EJW A;  1HA5 A;  3TQY A;  3K59 A;  5IOC A;  3RZO H;  5IT9 E;  1U4R A;  3BJU A;  1QVF A;  1RHP A;  3A5U A;  3GTO H;  1HNW Q;  2D62 A;  3QB3 A;  1L0Y B;  1KAW A;  4HIM A;  1SE2 A;  3NSW A;  1B53 A;  4JC0 A;  1SYG A;  3PSI A;  3MVV A;  2E2D C;  4MN3 A;  4DR3 Q;  3BYY B;  2XWB B;  4EQN A;  1UNS A;  2JA9 A;  2XSC A;  1JIC A;  4DA2 A;  1VQK A;  2CH4 W;  1XNQ L;  1O7L A;  3MZ5 A;  1M90 C;  2YTX A;  2UU9 Q;  2JSO A;  4FXD A;  4RA8 A;  2RCF A;  4EQ5 A;  3ULP A;  1UEB A;  1KIX A;  2UUC L;  2C35 B;  2JA5 B;  1E24 A;  1O80 A;  1EU4 A;  2K5N A;  5EBD A;  3C3L A;  2AMC B;  4DR7 L;  3MAQ A;  4H44 C;  4PZ6 A;  1PH3 A;  3MA2 B;  1MSH A;  2BA0 A;  1K8A C;  5EKK A;  2AKW B;  5G3L F;  4ZYS A;  4JI7 Q;  5C0X I;  4XYQ A;  2YU9 H;  2HUG A;  4JK1 C;  4CDD C;  1CUK A;  1J5E L;  1WTH A;  4QB4 A;  5C4X G;  1CA6 A;  1CA5 A;  3S17 H;  3KOJ A;  1LT4 D;  1NSN S;  1X55 A;  2F52 A;  4YHH L;  5TSS A;  1PTO B;  5C4J H;  4FYD A;  3KF8 A;  5GAD C;  5JOB A;  1UWV A;  3H0G H;  3SDZ A;  4PNY A;  4EVO A;  1K28 A;  1G6Z A;  1SRO A;  5FO9 B;  4OWW B;  2JE6 I;  4ZCK A;  1LTB D;  4QQB X;  3U9O A;  3CPW A;  3CCV A;  2PNR C;  1W6K A;  1WCM H;  3FKI H;  3AEV A;  5C3E B;  1TWG H;  2QDL A;  3BG3 A;  1PFB A;  4H0L C;  2MQH A;  4ZLT F;  2BA1 A;  3DWA A;  3DM3 A;  3I8Z A;  3O13 A;  5JJZ A;  3K5M A;  4DR2 L;  3OWE B;  1WJJ A;  2Y0S E;  2F3W A;  2G5D A;  3QG1 A;  2ZM6 L;  1LT3 D;  4EGV A;  4IUR A;  2VQF L;  1N8R C;  1E2W A;  5CYU A;  5EPJ A;  1TU2 B;  3SXH A;  4IUQ A;  2F0I A;  1WYD A;  4O0A A;  3VDY A;  1D1K A;  1JR0 D;  1RF2 D;  4ABN A;  1AZP A;  1EYG A;  4C1N K;  2MJ8 A;  4Q5V A;  5J3B A;  3CU7 A;  1YVC A;  1SBB B;  3VR4 A;  4BA1 I;  1IBM L;  3C2P A;  3S1N B;  3TRZ A;  2QA4 A;  3KBX A;  1LTR D;  1ET6 A;  2B2U C;  1VQG A;  1NR2 A;  3OW2 A;  1K3B C;  3H15 A;  1CQV A;  5KYL A;  1CHQ D;  3K58 A;  1QZH A;  1T5X D;  1IZ6 A;  4XQQ A;  4DV3 L;  4L5T A;  4YY3 Q;  4B3T L;  3X3M A;  3EVQ A;  2Q8R E;  1G51 A;  1FJG Q;  1OXX K;  2XVS A;  1WOC A;  1JWU D;  1ZYR C;  3PO2 G;  4WJ3 M;  4R8I A;  3M3Y H;  2F0N A;  3GDE A;  1WVL A;  1QCB D;  3S2H B;  4EQP A;  4K8I A;  4HN7 A;  4G57 A;  2JA6 B;  2UXC L;  1ICW A;  1GJX A;  1CKM A;  1RIP A;  4I65 A;  2HCC A;  4XDX A;  1DOK A;  1AH9 A;  1SXT A;  3P75 A;  1HNX Q;  1PH5 A;  1F9S A;  1Y8O B;  5GAG C;  4AYB E;  4LUZ A;  4OX9 L;  2B2W C;  4A3J B;  1X3Q A;  1BDO A;  1NE3 A;  1HZA A;  2NZO A;  3OIQ A;  4JYA Q;  1HUM A;  4HAE A;  4A3M B;  2R92 G;  4R4C A;  2DN8 A;  1DXM A;  3EN2 A;  2EVB A;  1SYF A;  1Z6H A;  2F4V L;  2F0U A;  1A15 A;  2PI2 A;  2I0Q A;  4IO9 A;  2YTV A;  1E3P A;  3J7A 5;  4ZKC B;  2JYO A;  4DV2 Q;  2BH2 A;  3GTQ B;  2MFI A;  5IYD G;  3GTM H;  2FHT A;  1TS3 A;  3FPU B;  3CXC A;  1Q8K A;  2SOB A;  4LF8 L;  1XX8 A;  3PIO 3;  4IPD A;  5ELC A;  5IIF A;  2G9D A;  4B3M L;  2ZXP A;  5C3X A;  5C3E H;  2VQF Q;  3GTG B;  4HR7 B;  4H13 C;  3CW2 C;  1N36 L;  2F0T A;  1BF4 A;  3AFP A;  3S2D B;  2NZH A;  3E6Z X;  2E2H B;  1I6H B;  1KXL A;  1EZ8 A;  4RCN A;  3UE1 A;  1KLU D;  3MTS A;  1N33 L;  5C3W A;  1EL0 A;  4ZUI A;  1TWC B;  2CKZ B;  2A6E D;  1X3G A;  1IYJ B;  1EOV A;  1SLJ A;  3S1N H;  4JI5 Q;  2ZTD A;  3K8A A;  2RQX A;  4JV5 L;  4RHS A;  4C3J G;  4DV3 Q;  3QWN A;  1EY8 A;  3KLW A;  2IY5 B;  3SR1 A;  1IXR A;  1YNX A;  4K6D A;  3CMA A;  3EIV A;  4KK7 A;  3L2P A;  1GUN A;  4L63 B;  2IHE A;  4GKJ Q;  2NVQ B;  3NBH B;  3LWE A;  1LT5 D;  4CDE C;  1UUP A;  4QUC A;  5L37 A;  4A3L H;  3J7A F;  4K0K L;  4X3S A;  4RMF A;  2Z9H A;  1BR9 A;  1TS4 A;  3NWS A;  3J80 i;  3NK9 A;  3G6E A;  1Y14 B;  4V0B A;  1ASY A;  1P8L A;  1PTO D;  2BOS A;  3S2H H;  4GOP B;  1UE7 A;  2B63 G;  1STH A;  1DGS A;  4AQY Q;  4DV7 Q;  2A69 D;  3RNU A;  3WOF A;  4K14 A;  2AUJ D;  2K33 A;  2EY1 A;  2X69 A;  2F0F A;  3EJI A;  2I5H A;  2HDL A;  2N3S A;  1FVI A;  1C9O A;  1X56 A;  1D6E C;  3LX0 A;  4LFA L;  1GUO A;  4MNO A;  4B9W A;  3K0X A;  3MXN B;  3CCJ A;  4YCV A;  4DUY Q;  4LF9 L;  4A3C H;  4LAA A;  4NXN L;  1PMR A;  2K5D A;  4KKS A;  4IJH A;  3T1Y Q;  4A3J H;  3E3X A;  1EY5 A;  1ROD A;  2P5Z X;  5IWA L;  5C4X B;  3HOX B;  1MBY A;  2FJ2 A;  5H1S E;  4NXM Q;  4IUN A;  3M4Y A;  1QB5 D;  4HID A;  2EOT A;  3G6J B;  4DAM A;  3CP0 A;  2KA7 A;  3KJO A;  4KKU A;  1U4P A;  1I94 L;  2N78 A;  1VQ9 A;  2BE5 D;  3KK7 A;  1NCV A;  3SGI A;  1D5Z C;  2H1E A;  2F0E A;  2IL8 A;  2PQA B;  2Q2H A;  2A6H C;  2KCM A;  1ESF A;  4DR1 L;  3OTO Q;  2OTJ A;  5HGT A;  5JEA H;  2YV5 A;  4JI0 L;  1L1O B;  4EQO A;  3I56 A;  4O42 A;  1LTG D;  3GTG H;  1OXS C;  1NMF A;  2IX3 A;  2JA7 G;  2KHJ A;  1IBK Q;  4N9P A;  2EJF C;  3CC4 A;  1ASZ A;  4A3I G;  4BXX G;  2K03 A;  4OEM B;  1PYB A;  4J1M A;  1WTX A;  1I6H H;  4F7X A;  2NN6 H;  1V8Q A;  1KQS A;  2DJG C;  4JV5 Q;  2R93 G;  5KYI A;  1TWC H;  3NEL A;  5FO8 B;  4JI3 Q;  5KRU A;  4KJO A;  1STA A;  1S5E D;  1YNN D;  3BYT B;  4BBR H;  4X65 L;  1O7Z A;  3IRB A;  3A7A B;  1VF5 C;  1D8L A;  1DYQ A;  3KLS X;  4A3B G;  5CV6 A;  1X32 A;  5IT9 L;  5D3I B;  3NPP A;  2NVQ H;  1PYW D;  4JI2 L;  3CC2 A;  2KCT A;  2OCE A;  3M7G A;  1K3R A;  2IJ0 A;  1B2T A;  3X3N A;  4IFD G;  1EYC A;  1E2Z A;  5M3M B;  2B29 A;  3DLL A;  3PO2 B;  1H9J A;  4HMI A;  1VCI A;  1VQL A;  2ZJR A;  4XT3 B;  3I4M G;  2A68 D;  3AFQ A;  2QGQ A;  1D1I A;  5FJ8 H;  3IL8 A;  1ILP A;  2RF4 A;  2WIN B;  3GTJ B;  5FLM H;  3BS1 A;  4ZAI A;  1ESR A;  5C4Z A;  2KQ3 A;  4TRD A;  3TP6 A;  1MD2 D;  1TT2 A;  4BBS G;  2Q2T A;  1EOT A;  5CV5 A;  3F2D A;  5C0X J;  1U4M A;  1K8M A;  5LMN L;  4X66 Q;  3KBG A;  3CF5 A;  4KMU C;  4ZUJ A;  5C44 G;  3M9B A;  1I94 Q;  2R92 B;  3GV6 A;  3GQB A;  1U5K A;  2Z6K C;  3HOY G;  2PI2 E;  4UP8 A;  5KEE A;  5C4X H;  1HHV A;  1A2T A;  3HOX H;  4JCV E;  3I4L A;  5FKA C;  1XJV A;  2C9O A;  1I4H A;  3D4W A;  3E9I A;  4CJ2 C;  4QJF A;  3BU2 A;  4RAU C;  1QUQ B;  3A5Z B;  5GAH C;  2DNE A;  4I7Z C;  1HA6 A;  4A76 A;  4OO1 G;  2WP8 J;  1EIF A;  5LL6 X;  1TY2 A;  1Y8N B;  4HJ9 A;  3I73 A;  2DUD A;  2K05 A;  1Q7Y C;  4FF3 A;  2E5L Q;  3RUZ A;  1VS0 A;  4QIW B;  2NBF A;  3J7Y W;  1BBU A;  1TWH B;  2Q2I A;  4CKB A;  5IGG A;  2KED A;  2GVB A;  1B7Y B;  5E1F A;  5CV7 A;  4RKB A;  1AW7 A;  4CGY B;  2F0W A;  3GTP B;  2UXB Q;  4C3I G;  4XXE A;  2EY5 A;  3N52 A;  2NUC A;  1IBL L;  4EX5 A;  1DJR D;  2IPK D;  1VQN A;  2CWA A;  4JI1 L;  1G29 1;  5HGQ A;  2J4X A;  3HOW G;  1BCP B;  4OIJ A;  2UXD Q;  1HNZ Q;  2I07 B;  2D2C C;  1YIJ A;  3L7Z C;  3MFG A;  1XMO Q;  2R7Z H;  1DOL A;  2MP1 A;  2CH4 A;  3NTK A;  5IP9 H;  1N34 L;  3MWY W;  2NN6 I;  4C3J B;  4RH6 A;  2UUA L;  1TKW B;  4DK1 A;  2O4X A;  3ITP A;  2Z6K A;  4FDB A;  1S4Z A;  2I5M X;  4GKK L;  1HFG A;  2WFW A;  4LK1 C;  1BQQ T;  4KI0 A;  3HOZ H;  1VQO A;  2OQ0 A;  1E7Z A;  3A8I E;  3STB D;  2VUM G;  4C3H G;  3UDG A;  1HH2 P;  4K5V A;  3R93 A;  2K5Q A;  3M85 A;  3R8B A;  4DV5 Q;  5M3M H;  3VR2 A;  3PO2 H;  2SEB D;  4HTH A;  1X9N A;  2K14 A;  3H3V H;  3JC6 6;  4DV6 L;  1BO0 A;  2ES2 A;  2BH8 A;  2B63 B;  3KLR A;  4LUV A;  1JWM D;  5CR3 A;  3K81 C;  3GTJ H;  3OYY A;  4DAV A;  3G71 A;  2F0Q A;  5COY A;  2KOL A;  1KHI A;  2EE1 A;  2F0L A;  2HIV A;  4LJZ C;  2HQE A;  4B3R Q;  4KD4 A;  4A3E G;  2A8V A;  1QIL A;  1PA6 A;  3L9A X;  1ZXT A;  1UE6 A;  3S1Q B;  4O2D A;  5ELD A;  5IP7 H;  1WTV A;  3I4N H;  2K6A A;  4DXF A;  1V9P A;  2D5D A;  4GLA C;  1CHP D;  2EJG C;  4PQX A;  3V96 A;  4DUZ Q;  1C8C A;  4LUO A;  2Q8T A;  5DM6 3;  4OHJ A;  1L2F A;  3VYS A;  2OXP A;  4JVZ A;  2R92 H;  4JI4 L;  4FF1 A;  3CME A;  5IGD A;  4WJ4 A;  4HIK A;  4BY1 G;  1YJW A;  1PFN A;  1Q82 C;  2IT1 A;  4POG A;  4LFB Q;  1IYV A;  1M1K C;  1S5D D;  3F2C A;  1O7Y A;  5AJ3 L;  5DM7 3;  1YHQ A;  4L6T B;  4A3F G;  5M9O A;  1VQC A;  3BDL A;  2A5H A;  5E4W C;  2Z4I A;  1LTS D;  1SYE A;  1TWH H;  1I4X A;  1QVC A;  3UDX A;  4QY7 A;  2V1C C;  5EQ0 A;  2VQE Q;  3DEP A;  4X3K A;  3GV3 A;  3VA7 A;  2JA7 B;  3G7L A;  1BUV T;  3H6M A;  4PMB A;  1ENC A;  2DY7 A;  3Q24 A;  1S72 A;  4A3I B;  3F2B A;  1SR3 A;  1EWC A;  3PUW A;  3GTP H;  2H5X A;  5I6Y A;  5KNC A;  3CC7 A;  3P1H A;  4HJ5 A;  1VMC A;  1V1O A;  3PMF A;  2R93 B;  3HOU G;  2LXK A;  2PQE A;  1V1P B;  3HFZ B;  4DV1 L;  2NVY B;  2ZXO A;  1VMP A;  2ZTC A;  2SNS A;  2EPB A;  1KNE A;  4C3J H;  3J80 L;  5EBC A;  1TXY A;  3A74 A;  3RN2 A;  3NWT A;  1A2U A;  2QIL A;  3TRE A;  3Q23 A;  3JAM c;  1N32 L;  1IKL A;  2ICI A;  1TWA B;  2XGT A;  5ELE A;  4LF6 L;  5IYC G;  4GZY C;  3LNN A;  5K36 G;  2LSS A;  1WTW A;  1L1O A;  4DV6 Q;  1F77 A;  4DR6 L;  3JAM E;  3OMG A;  2LMC B;  1PDQ A;  4JI6 L;  1B70 B;  2BCO A;  4DAY B;  2QKI C;  1MJE A;  2WAC A;  4NP5 A;  2F3I A;  4DR5 L;  3ULL A;  2WAQ E;  1OXU A;  4X64 Q;  2WKD A;  1Q12 A;  1JT8 A;  2G9H D;  2O5I C;  2F0J A;  3MEF A;  4ILW A;  3H3V I;  3R2T A;  1VQP A;  2AQ2 B;  4UP9 A;  4BBS B;  3L0O A;  1SN8 A;  3BZK A;  2E75 C;  2OWO A;  2RDH A;  1IKM A;  1HPC A;  3S1Q H;  2M9V A;  4JI4 Q;  5EPL A;  5LMU Q;  2EYL A;  2H4O A;  4POF A;  2JQO A;  4K5W A;  5BN5 A;  2CQO A;  2RSN A;  1NJI C;  2CFM A;  1EU3 A;  3AB9 A;  1TY0 A;  3I2Z A;  3HOY B;  1MI2 A;  1BCP D;  3RLO A;  4A3D B;  1S5F D;  4G7H C;  2NYZ D;  4GNX B;  5C0X G;  1FGB D;  4APV A;  2K5W A;  4LF4 L;  1V43 A;  3A0J A;  1ZKO A;  4NB3 A;  3Q22 A;  2ZJQ A;  1S5B D;  1RTO A;  2KHI A;  2E2J B;  2Y0S B;  3D31 A;  4NPS A;  4IPH A;  1B44 D;  1GHJ A;  5IY0 A;  4R4T A;  3J7Z C;  1JJ2 A;  1XNQ Q; 
#chains in the Genus database with same CATH homology
 5NUC A;  1KTK A;  5KNB A;  1II3 A;  3P20 A;  1SEB D;  3NHH A;  1EY9 A;  3T16 A;  4S3S A;  1BOS A;  1SMY D;  3VYT A;  2EYP A;  1R9T B;  1VDZ A;  1RTN A;  1EQT A;  1HXY D;  3U9S A;  2L4N A;  2L1B A;  5K5P A;  1IW7 C;  1XTC D;  1D5M C;  2L12 A;  3OW7 A;  1I6V C;  1SND A;  1W6J A;  4B9X A;  3MC0 B;  1WTQ A;  4K2K A;  3J81 E;  4PMW A;  3K6O A;  5CBA E;  5EKI A;  4QMG A;  5CV9 A;  4ZKB B;  1PTO H;  1AFP A;  4C3H B;  5EPK A;  1QWY A;  3FMC A;  2CW0 D;  3C1F A;  2FMC A;  3HP3 A;  4RHR A;  1H9S A;  4AYB B;  2RKS A;  5C4H A;  4DF7 A;  1SNO A;  2A73 B;  1A6X A;  2C5C A;  3EFX D;  1EQV A;  4NMZ A;  3MFY A;  1JOR A;  2PYK A;  2KUM A;  1TWF B;  1NUC A;  3I70 A;  4A3E B;  2XIW A;  2Z8L A;  2EYF A;  1PZK D;  1JC7 A;  4RGM A;  1Y1W B;  4KJN A;  2E2I B;  2RDG A;  4KY6 A;  3TP7 A;  3VR5 A;  5FLX L;  4RKL A;  4FP5 D;  1QNU A;  1Y69 U;  5LHY 1;  2MPM A;  2JA8 B;  4FVM A;  5FO7 B;  5I9P A;  4ME5 A;  1SFO B;  5A35 A;  3BZD B;  4BY1 B;  1PZI D;  4O1N A;  3TBI B;  3I91 A;  3SE0 A;  3PIP 3;  1RJT A;  1GUT A;  2EYH A;  3CHB D;  3SK6 A;  3J7A V;  2B8G A;  3NQI A;  3VR6 A;  3NUC A;  5T1I A;  5JEA J;  4C2M B;  1RCV D;  3TP5 A;  4OGQ C;  1STE A;  2R61 A;  4F87 A;  2V4D A;  1F2Z A;  1EY4 A;  1JB3 A;  1SYD A;  3RLF A;  1SE3 A;  2EZV A;  3HOU B;  2R6G A;  5KND A;  4XQJ A;  4FXG C;  4FF4 A;  1TQO A;  4BA2 I;  4HCE A;  4K5X A;  1B3A A;  4HCS A;  4KTA A;  1GUW A;  1F2Y A;  2L9H A;  4TKO B;  3A8J E;  3N6R A;  1YNJ C;  2CQA A;  3HRZ C;  1I3Q B;  3FRP B;  1PRT C;  4KD3 A;  1SNP A;  3GD7 A;  2JEB I;  3D6W A;  2PW7 A;  1SNM A;  5A2Q E;  1QJO A;  5LL6 S;  2I46 A;  2WV6 D;  4HSV A;  3URY A;  3K5N A;  1QNK A;  4F88 A;  2EDG A;  4IUP A;  2B2Y A;  4DGZ A;  3IAY A;  1BCP F;  2F3V A;  2BE5 C;  2XN9 C;  2DY8 A;  3K7A B;  4RGO S;  4WJW A;  4ZK9 B;  2F0P A;  4M1U B;  1FNW A;  1CZW A;  2Z4H A;  3M4O B;  1LLR D;  1JOO A;  2NB0 A;  3BVM A;  1FR3 A;  1DM0 B;  2TSS A;  1ENF A;  2YYZ A;  1EWH A;  1CFM A;  1BNZ A;  4B08 A;  4J6H A;  2K32 A;  2JP1 A;  1HTL D;  2RSO A;  1YNN C;  2BDN A;  2B2V C;  2PO4 A;  1RD9 D;  4BWG B;  2K1B A;  1NR4 A;  5FK9 C;  1B9N A;  3OWF A;  1HQM C;  1U4L A;  4RCO A;  2RA4 A;  3TN2 A;  4ZRZ A;  2WKC A;  5I2X A;  3KLS A;  1KDA A;  3S15 B;  1KDB A;  1Y1V B;  4A3G B;  2BDO A;  2Q8I B;  2PCF B;  4ID6 A;  1TII D;  4HED A;  4WFN 3;  2D9U A;  2AWO A;  1FD7 D;  1STY A;  5FOB B;  1S5C D;  1WD0 A;  2DNC A;  3HGB A;  3V2T A;  5J1Z A;  3S1R B;  3PV0 A;  1EY7 A;  2LS0 1;  1ML0 D;  1WD1 A;  1MGS A;  5JPN C;  2MGS A;  2NVT B;  1I4P A;  3HOV B;  5ELF A;  1JOK A;  3R2I A;  1E2V A;  1CI3 M;  2B2V A;  1LO5 D;  5M5X B;  3D4D A;  3K5O A;  3A54 A;  1RKN A;  3DXJ C;  1GUG A;  4M8A A;  2NTT A;  1OO9 B;  5AFW A;  2B8F A;  2KJX A;  4ULL A;  3R3O A;  2J0T D;  2PZW A;  1J9O A;  1VF7 A;  1XWE A;  4X3U A;  1EZ6 A;  5T1G A;  1SJH D;  1CQF A;  4JBW A;  4MHE A;  3T13 A;  1DOM A;  1DD2 A;  4DNR B;  1B4O A;  3E0J A;  1XXG A;  1TVX A;  3NQT A;  3IFD A;  1PTO F;  4U68 A;  4A93 B;  1SNC A;  5JVG 3;  2M00 A;  2SDF A;  3HEJ A;  3PUY A;  5JVH 3;  3S1M B;  5I2Y A;  1LAC A;  2K04 A;  1O78 A;  1UAP A;  4Y7N B;  3S17 B;  4CJ0 B;  1STG A;  1HFN A;  5C4J B;  2L11 A;  1GXD C;  5CV4 A;  4QUF A;  2EYM A;  2NVX B;  2LKV A;  5CV8 A;  4FO2 A;  2ENB A;  4IUV A;  4K2L A;  4UDU C;  3IKJ A;  1LTI D;  4N9T A;  4XQN A;  3VR3 A;  4QF4 A;  5IOD A;  1T5E A;  2KCC A;  4HMJ A;  3NBH A;  1L0X B;  1E0B A;  1CT1 D;  4KV6 A;  4QCL A;  4KHV A;  2ID0 A;  3Q6S A;  3KUP A;  4FF2 A;  4XTC S;  2E76 C;  4V19 0;  3BDC A;  4KY7 A;  4A3K B;  5EGT A;  1GUS A;  5D65 A;  5BN4 A;  3NTH A;  1PZJ D;  4CHT B;  4PMC A;  5IGF A;  3NE5 B;  3MXN A;  2EY2 A;  3NP8 A;  4OL7 A;  3DWQ A;  3BVZ A;  3M3Y B;  1Q3L A;  1QOH A;  1KAA A;  1TS2 A;  2B39 A;  1B50 A;  3VA5 A;  1C4Q A;  4A3B B;  1B9M A;  1I50 B;  2FMM A;  3SK5 A;  3CRL C;  3DHQ A;  2XNA C;  4IUT A;  3T56 B;  3AMU A;  3H3V C;  3I3C A;  4DN4 M;  5KGU A;  1DON A;  1D5X C;  1EEI D;  3I4M B;  3A8K E;  1HQR D;  2X6L A;  2XRS D;  2RVL A;  1F2M A;  1Q1B A;  4ODG A;  3GTK B;  3PO3 B;  2RBM A;  3GTM B;  3TP8 A;  2VNU D;  1PRT B;  1EYD A;  1G8Z D;  2B2T C;  3C46 A;  3CRK C;  2PPB C;  5C44 B;  4G7O C;  3D8G A;  3FPP A;  3OPO A;  2VB3 X;  3EQL C;  4LMQ D;  2WAQ B;  5E3F A;  1ZYR D;  3DWP A;  5I9O A;  2KVM A;  1IYU A;  5CGK A;  4PV1 C;  3Q0A A;  3MXP A;  1SSO A;  4IQZ A;  2F4I A;  5DEH A;  3S16 B;  1GOZ A;  2L0C A;  4IFD J;  1WTP A;  1LTT D;  5A2Q L;  5DAU A;  4DU9 A;  3I90 A;  3M7N A;  1LT6 D;  2TMP A;  2N88 A;  3ND8 A;  5CMD A;  1H9M A;  1SE4 A;  1BCP C;  1IW7 D;  1CTM A;  4C3I B;  3PUV A;  4Q0F A;  4P2C B;  1GHK A;  1FNV A;  1HCZ A;  3HOW B;  2HDM A;  5F2D A;  2EXZ A;  3OSO A;  5IGE A;  2B2T A;  3FDT A;  2PW5 A;  1CM9 A;  4Z9C B;  1EIH A;  4E6I A;  3H09 A;  3OHX C;  1U9R A;  1TS5 A;  1F9P A;  3GO5 A;  4ZQ3 A;  2VUM B;  2QF7 A;  5E4X A;  4CBV A;  1KLG D;  2AQ1 B;  1D2B A;  1EY6 A;  1SMY C;  4CJ1 B;  4IFD H;  5D14 A;  4G4K A;  1A3U A;  1HTP A;  2B2U A;  5IGC A;  3V05 A;  4CKE A;  1AP0 A;  1NAP A;  1JOQ A;  2ICE C;  2IWH A;  1STN A;  3OIP A;  3PUZ A;  3K5L A;  3TSS A;  4BS9 A;  2EYJ A;  1SAP A;  3SK8 A;  1QE6 A;  1CZG A;  1HUN A;  5I4D A;  4IN3 A;  1LAB A;  4KN7 C;  4RGN A;  3RMH A;  2JEA I;  2A74 C;  1J8I A;  3D6C A;  2CW0 C;  4TSS A;  4XYO A;  3TDQ A;  1G91 A;  1K83 B;  3HKZ B;  3LWU A;  5ELB A;  3OOC A;  2F0H A;  3T4A C;  5BN3 A;  5DNF A;  3QJY A;  4G7Z C;  2NTS A;  4OO1 H;  4H7B A;  3W3A A;  2O5J C;  2B2W A;  4BBR B;  4A3F B;  1Q1E A;  4XT1 B;  1KNA A;  1EIG A;  3J80 E;  3GTL B;  2A6E C;  2HCI A;  1Y8P B;  1SNQ A;  2F0K A;  3H94 A;  5D3D A;  2OF1 A;  3VYR A;  2XWJ B;  4NKL A;  2F03 A;  2M2L A;  3QO2 A;  5J39 A;  3NXW A;  4FNF A;  1H9K A;  4DAP A;  3TME A;  3RZD B;  1EY0 A;  2B2Y C;  3DEO A;  1AZQ A;  1DZ1 A;  2F0G A;  1KDC A;  1YNJ D;  4RGT A;  3QOL A;  4RWS C;  3QIA A;  4NW2 A;  3D4R A;  3SK4 A;  2L55 A;  1PRT D;  1WTR A;  2ZXR A;  1PTO C;  4KKT A;  3T53 B;  2A6H D;  3K0Y A;  3IFT A;  1SJE D;  5HUR A;  3QOJ A;  1A3T A;  1AN8 A;  2A69 C;  1Q8I A;  4F8M A;  3W2D A;  1ZEQ X;  4HSP A;  1F9Q A;  5M3F B;  1F9R A;  1ONL A;  2K28 A;  2X6G A;  3A56 A;  3HG9 A;  4KHZ A;  2IX0 A;  2L5T A;  2F0D A;  2GA4 B;  1QG7 A;  3P7J A;  2K7V A;  4IFD I;  5CC4 A;  2MHV A;  2OEO A;  1EYA A;  1I4Q A;  1OXV A;  1V1P A;  3VYU A;  2AQ3 B;  4YIJ A;  3S14 B;  1KAB A;  2EJM A;  2PMZ B;  1BXT A;  3FEW X;  1EFI D;  1I4R A;  3H91 A;  1WTO A;  5C5L A;  2E74 C;  3AU7 A;  2MUY A;  1EEF D;  5I6W A;  1X3P A;  3ERQ A;  3ERO A;  5JPM C;  3ZYY X;  4WOR A;  3I72 A;  3MXU A;  3S9W A;  5M5Y B;  2PZT A;  4DAY A;  1TR5 A;  5M5W B;  2J7Z A;  2R7Z B;  1LV9 A;  5COR A;  1ET9 A;  4FXK C;  1C48 A;  3CKI B;  2SNM A;  3K57 A;  5IGB A;  1RDP D;  1SDF A;  4OO1 I;  3MEH A;  5G3L D;  3MHB A;  3HOZ B;  5JAV A;  4DXG A;  2OT2 A;  4K8J A;  4MIU A;  1PXU A;  2KEE A;  3CQZ B;  2N55 A;  1R4Q B;  3HZX A;  2NWG A;  4R8N A;  1G2T A;  2IW3 A;  1AEX A;  3EA6 A;  1HRJ A;  2FIN B;  2VB2 X;  4DFA A;  4K6L A;  2EYO A;  2F0M A;  3A7L A;  2IX1 A;  1MSG A;  2PZU A;  4IAL A;  1STB A;  2A68 C;  4X3T A;  4BY7 B;  5K36 H;  3NBI A;  3HS0 C;  5C5M A;  1PFM A;  3JAM L;  1Z7T A;  1IL8 A;  3I4N B;  3DUZ A;  2VXW A;  1UEA B;  5ISR A;  3SVM A;  4OIK A;  4IUU A;  2KEC A;  2O2L D;  2KHS A;  5FLX E;  2QDB A;  2LY7 A;  3DM1 A;  1Z47 A;  2EY6 A;  3SHL A;  2QCP X;  3MXG A;  1IHZ A;  2JXM B;  1G2S A;  5EKL A;  4WRD A;  3E5S A;  1H9R A;  1ILQ A;  3RZO B;  1F2L A;  4U67 3;  3ONA B;  4R9W A;  2AUK A;  2Z1C A;  3BDO A;  2R3Z A;  2XRQ D;  3ND9 A;  2NZ1 D;  2ZT9 C;  3GTO B;  3FVQ A;  1JE4 A;  2WB1 B;  3C1E A;  3WDN A;  4CKC A;  5CBE E;  1LTA D;  1I4G A;  2F1M A;  4XIG S;  1H9S B;  4L8J A;  2QEJ C;  4IZ8 A;  5C0X H;  3GP7 A;  2KCN A;  4KY5 A;  4J8Q A;  1A3V A;  1BBX C;  2RDF A;  4UAI A;  2YU9 B;  3RD4 A;  1B1Z A;  4KN4 C;  5KIX A;  1SYB A;  1JWS D;  2F0V A;  2F0O A;  1M4V A;  3T51 B;  2FFK B;  3F2U A;  1XYI A;  2F0S A;  3TZU A;  1JCK B;  3H0G B;  3DMU A;  1Q90 A;  1ENA A;  3A55 A;  5C6A A;  5JEA G;  1PRT F;  3D3R A;  3OMC A;  1WCM B;  4RFB A;  3FKI B;  3UI2 A;  1TWG B;  2CHB D;  1FNU A;  4TQU S;  1OXT A;  2LFN A;  3PUX A;  1CK1 A;  1FYC A;  3L3O C;  4C1N I;  3TZD A;  4C56 C;  1M8A A;  3J81 L;  2AWN A;  1DCZ A;  4DNT B;  2NN6 G;  5J22 A;  2CVR A;  3BVG A;  1R4P B;  2K01 A;  1JQY D;  1PLF A;  2WII B;  3WOE A;  1SYC A;  3NTI A;  3SEB A;  1K8O A;  4NDX A;  4DK0 A;  5EJW A;  1HA5 A;  3K59 A;  5IOC A;  5IT9 E;  1U4R A;  1RHP A;  2D62 A;  3QB3 A;  1L0Y B;  1SE2 A;  3NSW A;  1B53 A;  1SYG A;  3MVV A;  2E2D C;  4MN3 A;  3BYY B;  2XWB B;  4EQN A;  1UNS A;  2XSC A;  1JIC A;  4DA2 A;  1O7L A;  3MZ5 A;  2JSO A;  4FXD A;  4RA8 A;  2JA5 B;  1O80 A;  1EU4 A;  5EBD A;  3C3L A;  3MAQ A;  4H44 C;  3MA2 B;  1MSH A;  2BA0 A;  5EKK A;  4ZYS A;  5G3L F;  5C0X I;  4XYQ A;  2HUG A;  4JK1 C;  4QB4 A;  1CA6 A;  1CA5 A;  1LT4 D;  1NSN S;  5TSS A;  1PTO B;  4FYD A;  3KF8 A;  5JOB A;  3SDZ A;  4PNY A;  4EVO A;  1G6Z A;  5FO9 B;  2JE6 I;  1LTB D;  3U9O A;  2PNR C;  1W6K A;  5C3E B;  3BG3 A;  1PFB A;  4H0L C;  4ZLT F;  2BA1 A;  3DWA A;  5JJZ A;  3I8Z A;  3O13 A;  3K5M A;  3OWE B;  2F3W A;  3QG1 A;  1LT3 D;  4EGV A;  4IUR A;  1E2W A;  5CYU A;  5EPJ A;  1TU2 B;  3SXH A;  4IUQ A;  2F0I A;  1D1K A;  1JR0 D;  1RF2 D;  4ABN A;  1AZP A;  4C1N K;  2MJ8 A;  4Q5V A;  3CU7 A;  3VR4 A;  1SBB B;  4BA1 I;  3C2P A;  3S1N B;  3KBX A;  1LTR D;  1ET6 A;  2B2U C;  1NR2 A;  1CQV A;  5KYL A;  1CHQ D;  3K58 A;  1T5X D;  4XQQ A;  3X3M A;  3EVQ A;  2Q8R E;  1OXX K;  2XVS A;  1JWU D;  1ZYR C;  4R8I A;  2F0N A;  1WVL A;  1QCB D;  3S2H B;  4EQP A;  4K8I A;  4HN7 A;  4G57 A;  2JA6 B;  1ICW A;  1GJX A;  4I65 A;  2HCC A;  4XDX A;  1DOK A;  1SXT A;  3P75 A;  1F9S A;  1Y8O B;  2B2W C;  4A3J B;  1X3Q A;  1BDO A;  3OIQ A;  1HUM A;  4HAE A;  4A3M B;  2DN8 A;  1DXM A;  2EVB A;  1SYF A;  1Z6H A;  2F0U A;  1A15 A;  4ZKC B;  2JYO A;  3GTQ B;  2FHT A;  1TS3 A;  3FPU B;  2SOB A;  1XX8 A;  3PIO 3;  5ELC A;  5IIF A;  2G9D A;  2ZXP A;  5C3X A;  3GTG B;  4HR7 B;  4H13 C;  2F0T A;  1BF4 A;  3S2D B;  3E6Z X;  2E2H B;  1I6H B;  1EZ8 A;  4RCN A;  1KLU D;  3MTS A;  5C3W A;  1EL0 A;  4ZUI A;  1TWC B;  2A6E D;  2RQX A;  4RHS A;  4C3J G;  3QWN A;  1EY8 A;  3SR1 A;  4K6D A;  4KK7 A;  1GUN A;  4L63 B;  2NVQ B;  3LWE A;  1LT5 D;  1UUP A;  4QUC A;  3J7A F;  4X3S A;  1BR9 A;  1TS4 A;  3NWS A;  3NK9 A;  4V0B A;  1PTO D;  2BOS A;  1STH A;  2A69 D;  3WOF A;  4K14 A;  2AUJ D;  2K33 A;  2EY1 A;  2X69 A;  2F0F A;  3EJI A;  2HDL A;  1D6E C;  3LX0 A;  1GUO A;  4B9W A;  4LAA A;  1PMR A;  2K5D A;  4KKS A;  1EY5 A;  1ROD A;  5C4X B;  3HOX B;  1MBY A;  2FJ2 A;  4IUN A;  3M4Y A;  1QB5 D;  2EOT A;  3G6J B;  2KA7 A;  4KKU A;  1U4P A;  2BE5 D;  3KK7 A;  1NCV A;  1D5Z C;  2H1E A;  2F0E A;  2IL8 A;  2A6H C;  1ESF A;  5HGT A;  5JEA H;  4EQO A;  4O42 A;  1LTG D;  1OXS C;  2IX3 A;  4N9P A;  2EJF C;  2K03 A;  4J1M A;  1WTX A;  4F7X A;  2NN6 H;  1V8Q A;  5KYI A;  5FO8 B;  5KRU A;  4KJO A;  1STA A;  1S5E D;  1YNN D;  3BYT B;  1O7Z A;  3A7A B;  1VF5 C;  1DYQ A;  3KLS X;  5CV6 A;  1X32 A;  5IT9 L;  5D3I B;  3NPP A;  1PYW D;  3M7G A;  2IJ0 A;  1B2T A;  3X3N A;  4IFD G;  1EYC A;  1E2Z A;  5M3M B;  3PO2 B;  1H9J A;  4HMI A;  1VCI A;  4XT3 B;  2A68 D;  1D1I A;  3IL8 A;  1ILP A;  2WIN B;  3GTJ B;  3BS1 A;  4ZAI A;  1ESR A;  5C4Z A;  2KQ3 A;  4TRD A;  3TP6 A;  1MD2 D;  1TT2 A;  1EOT A;  5CV5 A;  5C0X J;  1U4M A;  1K8M A;  3KBG A;  4KMU C;  4ZUJ A;  2R92 B;  3GV6 A;  3GQB A;  5KEE A;  1HHV A;  1A2T A;  3I4L A;  5FKA C;  2C9O A;  1I4H A;  3D4W A;  4CJ2 C;  4RAU C;  2DNE A;  4I7Z C;  1HA6 A;  4OO1 G;  2WP8 J;  5LL6 X;  1TY2 A;  1Y8N B;  3I73 A;  2K05 A;  4FF3 A;  3RUZ A;  4QIW B;  2NBF A;  3J7Y W;  1TWH B;  4CKB A;  5IGG A;  2KED A;  5E1F A;  5CV7 A;  4RKB A;  1AW7 A;  4CGY B;  2F0W A;  3GTP B;  4C3I G;  4XXE A;  2EY5 A;  3N52 A;  2NUC A;  1DJR D;  2IPK D;  1G29 1;  2J4X A;  1BCP B;  4OIJ A;  2I07 B;  2D2C C;  3L7Z C;  3MFG A;  1DOL A;  2MP1 A;  3NTK A;  3MWY W;  2NN6 I;  4C3J B;  4RH6 A;  1TKW B;  4DK1 A;  2O4X A;  3ITP A;  1S4Z A;  1HFG A;  4LK1 C;  1BQQ T;  4KI0 A;  3A8I E;  4C3H G;  4K5V A;  3R93 A;  2K5Q A;  3M85 A;  3R8B A;  3VR2 A;  2SEB D;  4HTH A;  1BO0 A;  2B63 B;  3KLR A;  1JWM D;  5CR3 A;  4DAV A;  2F0Q A;  5COY A;  2KOL A;  2EE1 A;  2F0L A;  4LJZ C;  2HQE A;  4KD4 A;  1QIL A;  3L9A X;  1ZXT A;  3S1Q B;  5ELD A;  1WTV A;  2K6A A;  4DXF A;  2D5D A;  1CHP D;  2EJG C;  4PQX A;  3V96 A;  1C8C A;  2Q8T A;  5DM6 3;  4OHJ A;  3VYS A;  2OXP A;  4FF1 A;  5IGD A;  1PFN A;  2IT1 A;  1IYV A;  1S5D D;  1O7Y A;  5DM7 3;  4L6T B;  5M9O A;  3BDL A;  2A5H A;  5E4W C;  2Z4I A;  1LTS D;  1SYE A;  1I4X A;  5EQ0 A;  3DEP A;  4X3K A;  3GV3 A;  3VA7 A;  2JA7 B;  3G7L A;  1BUV T;  3H6M A;  4PMB A;  1ENC A;  2DY7 A;  3Q24 A;  4A3I B;  1EWC A;  3PUW A;  5I6Y A;  5KNC A;  3P1H A;  1VMC A;  1V1O A;  3PMF A;  2R93 B;  2PQE A;  1V1P B;  2NVY B;  2ZXO A;  1VMP A;  2SNS A;  2EPB A;  1KNE A;  3J80 L;  5EBC A;  3NWT A;  1A2U A;  2QIL A;  3Q23 A;  1IKL A;  2ICI A;  1TWA B;  5ELE A;  4GZY C;  3LNN A;  5K36 G;  1WTW A;  1F77 A;  3JAM E;  3OMG A;  2LMC B;  1PDQ A;  2BCO A;  2QKI C;  2WAC A;  4NP5 A;  1OXU A;  2WKD A;  1Q12 A;  2G9H D;  2O5I C;  2F0J A;  4ILW A;  3R2T A;  2AQ2 B;  4BBS B;  2E75 C;  2RDH A;  1IKM A;  1HPC A;  2M9V A;  5EPL A;  2EYL A;  2H4O A;  4K5W A;  5BN5 A;  2RSN A;  1EU3 A;  3AB9 A;  1TY0 A;  3HOY B;  1MI2 A;  1BCP D;  4A3D B;  1S5F D;  4G7H C;  2NYZ D;  5C0X G;  1FGB D;  2K5W A;  1V43 A;  1ZKO A;  3Q22 A;  1S5B D;  1RTO A;  2E2J B;  2Y0S B;  3D31 A;  1B44 D;  1GHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...