1LTID

Heat-labile enterotoxin (lt-i) complex with t-antigen
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT LABILE ENTEROTOXIN TYPE I
publication title Tumor marker disaccharide D-Gal-beta 1, 3-GalNAc complexed to heat-labile enterotoxin from Escherichia coli.
pubmed rcsb
source organism Escherichia coli
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ltiD00
3W2DA 1EU3A 1SE3A 1FNWA 4ZYSA 1ENFA 1PTOF 1LT4D 1BCPB 4BWGB 5I4DA 1CHQD 1RDPD 2ICIA 1B44D 3DWPA 2J4XA 1FNVA 1FNUA 1HA5A 1D5MC 1EFID 1LO5D 1JWUD 1SE4A 3EA6A 1BCPD 1L0XB 1TS2A 3EFXD 2NTTA 1D5ZC 1S5FD 1UUPA 1V1PB 3MFGA 1LTSD 1TS5A 3OWEB 1BCPF 1PYWD 5ELCA 1JWMD 1JWSD 2QILA 3V05A 1V1PA 1LTBD 2AQ1B 2WV6D 1EEID 1LTAD 2Z8LA 1FD7D 3DWQA 1LT5D 1JR0D 3DWAA 1CQVA 1ESFA 4DXFA 5FKAC 1TY0A 1CK1A 1PRTB 1T5XD 4OHJA 1S5CD 3R2IA 1SJHD 1PTOH 1EU4A 2XN9C 3BYYB 1I4PA 1PZKD 1JQYD 1D6EC 1PRTD 3R2TA 4RGMA 4RFBA 1KLUD 3BVZA 1ET9A 3TSSA 1SE2A 1LT3D 5D3IB 5ELFA 4RH6A 4RGTA 5ELEA 1STEA 2XNAC 5TSSA 1KTKA 2CHBD 4RCOA 1EWCA 1AN8A 1AW7A 3BVMA 1S5DD 2XRQD 1PTOC 1PRTF 1SXTA 5FK9C 1S5BD 1SEBD 2SEBD 1LT6D 2TSSA 2IPKD 1EEFD 1F77A 1XTCD 2QEJC 5D3DA 1S5ED 2XRSD 2IJ0A 1ET6A 1GOZA 1LTGD 1MD2D 1FGBD 1TS3A 1SJED 2R61A 1G8ZD 3BVGA 1LLRD 1UNSA 1I4QA 1B1ZA 2AQ2B 3KLSX 4RGNA 1LTTD 2RDGA 1BCPC 4UDUC 1JCKB 1DYQA 1DJRD 1SBBB 4K6LA 4RHSA 5ELBA 2O2LD 1CT1D 1V1OA 2NTSA 1CHPD 1LTRD 1TS4A 1KLGD 3MC0B 1BXTA 1LTID 1HQRD 1PZID 4RHRA 4DXGA 1M4VA 3GP7A 1D5XC 1TY2A 1RF2D 1HTLD 2AQ3B 1I4GA 3URYA 1PTOB 4Z9CB 4L6TB 1RD9D 1PRTC 3BZDB 1L0YB 4C56C 3R8BA 1I4HA 5ELDA 1I4RA 1RCVD 1XXGA 1PZJD 1I4XA 4O1NA 3SEBA 1PTOD 1HXYD 3O13A 4L63B 4TSSA 4RGOS 1QILA 2G9HD 2RDHA 3CHBD 3BYTB
chains in the Genus database with same CATH superfamily
1UE7A 2F0VA 3W2DA 1FNWA 2K52A 1SR3A 5KNBA 4IUTA 3CW2C 5LMUL 2IWHA 3GO5A 4LF7Q 4Y7NB 4JBKA 1Q86C 4EVOA 3EFXD 1H9RA 1Z47A 2A68C 2PNHA 3VDYA 1VMCA 4A3IG 2D2CC 4ZAIA 4OIKA 4YHHQ 3M3YH 2R93B 1IBML 1QG7A 5EPLA 1NNXA 3CD6A 3M9BA 3CPFA 2CW0C 2A69C 3L9AX 1VQGA 2BOSA 3HOVB 4JCVE 1IHZA 3KF8B 2J0TD 3EVQA 3L7ZC 3R2IA 2E2DC 4C3HG 1F9SA 1RL2A 3CC4A 4PV1C 4FF3A 1JQYD 4KN4C 4GNXC 4HCSA 5FOBB 5CYUA 4X6AH 2F1MA 1NMFA 3HOZB 4AH6A 4BA2I 1HHVA 2C35B 2CWPA 1KXLA 4ULLA 1P8LA 4TRDA 1C0AA 1S5BD 2SEBD 2ZXRA 2IPKD 4WJWA 1IL8A 3HOYG 4DR7L 1B3QA 1SMYD 2X6LA 3UDGA 1TWFB 1KRSA 3PCOB 1U4PA 4B3TQ 3VYRA 1YJNA 3ZJYC 1UNSA 4RGNA 1SN8A 1E24A 1ASYA 2KEDA 2HIXA 2HDLA 2O2LD 4UHVA 4R9WA 2F4VQ 2F0PA 5E4XA 4DR3L 1AEXA 2JSOA 1KLGD 1G2SA 2FINB 2IX3A 4B3SL 3JAMc 3I7FA 5EPJA 4GKKQ 1VQEA 2MJ8A 3M4OH 5C6AA 1TWGB 1W3SA 1NCVA 1KHIA 2KHSA 2E2HB 3GV3A 2R7ZG 3MXUA 1WTWA 4JK1C 5G3LD 1AFPA 1VF5C 3MWYW 4C2MH 1L0YB 3NQIA 2I5HA 1B7YB 4IQZA 3NEMA 2F03A 1PFBA 5G3LF 3H0GG 4H02A 1TWCH 4RGOS 3HOWG 3PIPA 3CCSA 3PF5A 1K8OA 3RLFA 2R92G 3NWSA 1HNZL 2OQKA 1VQ5A 1RDPD 2ICIA 4MNOA 3R93A 1EOTA 4DR5Q 4CDFC 2CKZB 2KVMA 4DV4L 3RZDB 3DMUA 3GTOH 2D0PA 2E2JH 4MZ9A 5ISRA 2VB3X 1X32A 3J81i 4A3MG 1WD0A 3WDNA 5C44B 1CFMA 5IIFA 1RODA 3VA5A 4CDEC 3D0FA 2EY2A 2FJ2A 1EY0A 3FP9A 5FLXL 3E3XA 2F0FA 1STBA 1HR0W 3PUZA 4QGUA 4JI8Q 2Q2TA 1PRTB 4A3CG 1SJHD 1F9RA 4A3IH 2PCFB 2V4DA 2DJFC 3J80c 1PRTD 3DEPA 3GTMH 1LUZA 3TSSA 1IBLL 4A93G 4LJZC 1B3AA 4QIWB 3I91A 3A8IE 1VQIA 2EJFC 3KF6B 1PRTF 3NPPA 3F2DA 4C3HH 4QL5A 1VCIA 2E74C 4HIMA 5M3FB 3S15B 3IFTA 1K8GA 2QEJC 1PV4A 1J5EQ 5DM63 2XRSD 1BUVT 4ALPA 4QUFA 1GOZA 3NXWA 2B2TA 4NMZA 4IURA 1WCMB 1EYDA 3BVGA 2JA8B 1N8RC 4IZ8A 2N88A 3KYHC 2NWGA 4UDUC 4BY7G 3CCEA 2PO4A 3TDQA 4APVA 2VY3A 2R93H 1J9OA 2E76C 3DM3A 3LX0A 3VA7A 4O2DA 4FF4A 5EBCA 2A5HA 2EY1A 3CCJA 3HOVH 4N8FA 1NMGA 4JI0Q 3CCQA 4JC0A 1GHKA 1U5KA 1W6JA 5C4HA 1TVXA 2VQFQ 1O78A 1EY9A 5LMNL 1X55A 4YWKA 1I6HH 4JVZA 4CKEA 3URYA 3CCRA 3HOZH 2KECA 2Q8TA 4YHHL 1I4HA 2K4KA 4A3FG 2EYOA 2B39A 4FF2A 3I4OA 1JOKA 1X3FA 4DUZQ 3H94A 3N52A 2EZVA 1JJGA 5DM73 2R7ZH 1VQCA 1TWFH 4ZYSA 4WJ3M 3K59A 1PFMA 1LT4D 3I4MB 4BWGB 2VQEL 1VQ6A 1TXYA 4R8NA 3FEWX 3HZXA 1AP0A 3DWPA 2QEXA 2JA5H 2NVTH 2HIVA 1HA5A 4HMJA 2MHVA 3IFDA 1IYJB 4IUUA 1L0XB 4AYBE 2DN8A 4A3LH 2OT2A 3P75A 1S5FD 3CU7A 1EY5A 1Z6HA 1W2BA 5COYA 2R92H 1HTPA 3Q6SA 1TS5A 2OF1A 5ELCA 4LFBQ 2PI2A 1YHBA 3WOEA 4QCLA 3TRZA 1EEID 1LTAD 3E9IA 1B9MA 1QVCA 3S2HH 3I4LA 1TWGH 4B3TL 1J8IA 4H44C 2KEEA 1T5XD 4JV5Q 3X3MA 2Z1CA 5K36G 4R4TA 5FO8B 4DR1Q 2ZJRA 1JE4A 2L12A 2F4VL 3D4DA 5FLMG 3GTGB 4LW1A 3D31A 1A62A 3OW7A 4RCOA 4GOPC 1CTMA 3W3AA 4QQBX 4OO1G 4I7AA 4HJ9A 5J1ZA 1IZ6A 2ZXOA 4LMQD 4QJFA 3NSWA 4IUPA 2XVSA 3I4NB 1FGBD 3VR6A 1EIFA 4X66Q 1FL0A 1OXXK 4A93H 1IXRA 3T53B 1LLRD 1PH1A 5M3MG 4JBMA 2PPBC 2Z4IA 2P5ZX 2UXBQ 4A3KB 5C0XJ 1FVIA 3OIQA 3I70A 2K75A 3BZKA 2HCCA 2NVXH 4LFAQ 4IUNA 5EKKA 5C0XG 1Q1BA 3KLSA 1EY8A 4IALA 4DR5L 1IYUA 4BY7H 5IGBA 2LXKA 1D7QA 1SAPA 1SNQA 2NBFA 1HR0Q 3I8ZA 1QCBD 3S17B 3NHHA 2PQAB 2F0WA 2CH4W 3BZDB 3RMHA 4G7HC 4R4CA 5DLQE 2JA7B 1DOKA 3QWNA 2AMCB 5BR8Q 1K9MC 3J7A5 5JJKA 3CHBD 3QR8A 4H0LC 4G4KA 3A56A 3GD7A 1BCPB 1X9NA 1SYFA 4P71A 3S1MB 2BCOA 4U68A 2K5QA 1HZAA 3Q8DA 4X3KA 4XYQA 4POFA 4CJ2C 3A5ZB 5M5YH 1BCPD 1BKBA 4KI0A 4N9TA 3PO2G 1YNJD 1E7ZA 4A75A 4KHPQ 5LL6X 4H7BA 2YU9B 2NVQH 3KDFA 3Q23A 3GTLB 4JI4Q 2N8NA 5IGFA 2RKSA 3I56A 1BCPF 4HMIA 2IL8A 1V1PA 3CF5A 4BXXG 4ZRZA 1KDAA 2Z8LA 1KDBA 4C3JB 1CQVA 4WORA 1TWAH 1SNDA 1GUOA 2C5CA 4Q5VA 1GVPA 3JC66 4DV2Q 4PZ6A 5GQOA 4LFCQ 3QG1A 1QE6A 4DV3Q 2B2WC 1STAA 5GAHC 3BVZA 4DV1L 3FKIB 2QW7A 1EYGA 3KOJA 4JI0L 1N32Q 3M4PA 4A3EG 4ZCKA 1DM0B 1N9WA 5I9OA 3C1FA 3T1YQ 3HOXB 5K36H 3I4MH 1PFSA 4OXPA 1SMXA 2R7DA 3K0YA 2K28A 1PHJA 2RHSB 3S1RB 4RKLA 5DAUA 4NB3A 2AQ2B 1DGSA 4OO1H 5J3BA 1I3QB 2Q2HA 1K28A 2Q2IA 5E7NA 1DJRD 1HNWL 4J8QA 1HFGA 1L1OB 1STGA 4FXDA 2A6EC 3PGZA 4WJ4A 3HOUH 3CQZH 4JI1Q 1PVOA 1HCZA 2EYLA 3G71A 5GROA 1IW7D 1SROA 1IBMQ 4A76A 1HTLD 4IOAA 3GTGH 5F2DA 4JI6Q 2L0CA 2K6AA 3GQBA 5LMNW 4YY3Q 5JOBA 5IP7G 2MNAA 4M8AA 4F87A 1X3GA 5C0XH 2ZJPA 1X6OA 3E6ZX 1HNXQ 2FFKB 1XMQQ 4CDDC 1EYCA 1HXYD 4MTNA 2B2UA 4IUQA 1VQDA 1SYBA 5JEAG 3CCVA 2NB0A 3SXHA 5C3XA 3NQTA 1A2TA 1BBUA 3OWFA 1K3BC 3TZUA 1SYEA 1IBKL 1K8MA 1HPCA 1VQHA 2IHFA 1TS2A 1I50B 5FO9B 4LAAA 2PNRC 4YCUA 4IJHA 2O4XA 4DV5L 1UEAB 3S1QB 3E9HA 2WV6D 3EROA 1QZHA 2QF7A 4JW0A 3STBC 2A6HC 5KNDA 2ASBA 4A3DB 1LT5D 2WFWA 4K5VA 3VR4A 4DXFA 3PO2H 3S17H 1FR3A 3U9SA 1J6QA 3ICEA 2E75C 4OELB 2UXBL 3RLOA 2VW9A 4BXXH 1Q90A 3CAMA 1VQLA 2B3GA 3HFZB 4LFAL 4XQQA 1PH3A 1YBYA 1KAWA 1SXTA 3OTOL 2F0EA 3NTHA 2L4NA 2WB1G 1CI3M 1XWEA 5I6YA 4V0BA 2L9HA 2F0TA 3SK5A 1G291 1K8AC 3TEHB 1CM9A 1MD2D 3Q0AA 1SJED 1A2UA 1NSNS 2G5DA 3CC2A 4ZUJA 2K33A 4C3IB 1LTLA 4F8MA 1GKHA 3FDTA 3KLSX 3JAMi 2YU9H 4OONA 3GTLH 5EJWA 4BBRB 4JI7Q 3ULLA 1JB7A 3GTQH 5BR8L 3NK9A 5BN4A 3F2UA 1GM5A 2BA1A 3PQIA 2K5WA 5IWAL 2BE5D 2BH2A 1VMPA 1XYIA 2FHTA 2B63G 2MQHA 4UP7A 4AYBB 2DUDA 3QOLA 2PMZB 2E2IB 4HJAA 5IGDA 4GLVB 3NE5B 5J39A 2JEBI 5CORA 1ZKOA 2WKDA 4KHPL 2F0IA 1I4GA 1YNND 4XTCS 3FKIH 1MSGA 2EQSA 5H1SE 2K32A 3U4VA 3TP5A 1X3PA 1UE5A 2Q8IB 4B3MQ 1IBLQ 4U673 5IP7H 4DV2L 2UXCL 4IN3A 4DV3L 2RVLA 1TIID 4N8X1 1R4QB 2B2TC 2F3VA 3T13A 5CV8A 3P20A 3UE1A 2EY6A 1H9SB 1JJCB 1S72A 5D14A 4A3JB 4L5SA 1N32L 3N6RA 3QO2A 2JA6B 3BJUA 5NUCA 4KJOA 4O42A 3T1YL 2KOLA 5KGUA 2D0OA 2QILA 2RCFA 4WFN3 5C4XB 1OXVA 2MFIA 3RZOB 1CUKA 2MPMA 3AFQA 3BYYB 4NPSA 2A8VA 1E1TA 2XWJB 4JOIA 3R2TA 4XYOA 3H15A 5LMNQ 2EIFA 4JI1L 5TSSA 4A3GG 3VR3A 5K5PA 4K8JA 1WOCA 1F77A 3J81E 4JI6L 4YY3L 4XQNA 5AFWA 2K01A 2R61A 1GD7A 5C4ZA 1SFOB 1MIUA 1EQRA 1HNXL 1XMQL 2B2YA 2LFNA 1OXSC 2VQEQ 1JORA 2A68D 1AZPA 2OQ0A 2F0DA 4I65A 1ZXTA 3S1QH 3ITPA 5KRUA 3HOYB 1V1OA 2WINB 2I46A 3A0JA 3A8JE 1LTRD 5EAYA 4JG2A 1RHPA 3UI2A 2CW0D 2A69D 4IJLA 4GNXB 3J7AF 2R93G 3CMEA 4PQXA 1PH2A 3K5LA 1BBWA 3HOVG 1F9QA 1V1QA 1NR4A 3S1NH 1MI2A 1A0IA 1RIPA 2F0LA 1A3UA 2B63H 4FP5D 1CZGA 5CV9A 1PZJD 1I4XA 3DXJC 1Y1VH 3BG3A 4KY5A 4DV0Q 5IGGA 3HOZG 3C2PA 2VL6A 3I90A 2UUBQ 1CHQD 4X3SA 2EYPA 1SYCA 1SE4A 3I3CA 2TMPA 2PW5A 2ZTEA 1PYBA 2NTTA 3H0GB 3U4ZA 3HOWB 4P72A 2JA5G 1YNXA 1R9TB 1JWSD 3RLNA 2HQLA 3OMGA 2E2IH 4A3LG 1FD7D 4GKJQ 2JQOA 1CKNB 1CK1A 3F1ZA 1G51A 4XIGS 4OWXB 4JI7L 1Q8IA 2IY5B 1ILPA 5KYIA 1TT2A 3G7LA 2ZJQA 2PZTA 1ET9A 4ZQ3A 4FDBA 4J1MA 4RH6A 1PH4A 4DAYA 1NBWA 2KBNA 1LACA 3D6CA 3RD4A 1W6KA 1II3A 1LT6D 3KBXA 1CA6A 1N34Q 3H91A 2GN5A 4LF4Q 3M7GA 3FRPB 2QDLA 2WACA 4F7XA 2JA6H 4A3GH 2K5NA 3H6MA 1VQKA 1WJJA 1SDFA 1JOOA 2RDGA 2I07B 1A63A 5IT9E 1K83B 4B3ML 5IGEA 4KY6A 4AQYQ 3GDEA 1XPUA 3NUCA 4LF9L 4LF5Q 2VUMB 1QUQA 4YCWA 1NJIC 1XPRA 3MEFA 3RZOH 1DONA 4XQJA 3KJPA 4KKTA 1C8CA 3AYHB 3DEOA 1GXDC 4CGYB 5EGTA 1XTDA 4CDCC 4Y7NH 1A8VA 2NVYB 2M2LA 1S4ZA 3JAML 1Q1EA 3OHXC 4R1JA 1HUMA 3R8BA 5A2QE 4DAPA 1TQOA 1WD1A 3SE0A 1BBXC 2B29A 1MKHA 3K0XA 1EWIA 2YV5A 4DV1Q 1U9RA 1MSHA 1EU3A 3VYSA 4DK3C 4OGQC 4IFDJ 5JAVA 3P1HA 1OXUA 4RKBA 2ZTCA 2X69A 4OL7A 2NUCA 3CKIB 3T16A 4UPAA 2IX1A 4MHEA 4IFDG 3AB9A 2NN6H 1WCMG 2HD3A 3MXNB 2HQEA 2JA8G 4PMWA 1GO3E 3MFGA 4HAEA 3L2PA 4DR2Q 4BBSB 3RR5A 2KJXA 4DAMA 5GAGC 3K6OA 5CMDA 1HNWQ 1YZ6A 4NDXA 2FMCA 2GVBA 5M5XB 1LV9A 3DWAA 3ULPA 4ZKCB 4MTKA 2EYHA 1TY0A 2C9OA 1PDQA 2L11A 4R4QA 3K5OA 1VQNA 2K04A 3I73A 2LY7A 3S14B 4RAUC 3KF8A 5E4WC 1V9PA 3K7AB 1Z9FA 2RSOA 2PMZE 1HUNA 3SVMA 1SE2A 1VDZA 3NBHB 2OEOA 2E8GA 1E0BA 1MHWC 5IP9H 3T4AC 5FK9C 1VQBA 4E6IA 4EQ5A 5J22A 2UXDL 3J80L 2B2UC 1M8AA 2E2HH 1E22A 2XIWA 4POGA 2QKIC 3HKZE 3PF4A 3I4MG 4B3RQ 3SHLA 2L15A 4K6LA 5CV6A 1IBKQ 1DOMA 4DV0L 2EYFA 1K3RA 4DV6Q 1O7IA 3TMEA 3K57A 1QNUA 2UUBL 1IKMA 2ID0A 4DV5Q 2A74C 1B70B 4OO1I 5M3MB 1TY2A 2AWNA 2DY8A 3RZDH 3HOUG 3GV6A 1X3EA 5D65A 4GOPB 3ULJA 1VQPA 5C44H 5C3EB 3S24A 1EUJA 2RCNA 4PG3A 3S2DB 3NELA 4K2LA 4O1NA 2NZ1D 3W1BA 4GKJL 1B2TA 1C4QA 4CKBA 1KL9A 2CVRA 3MA2B 1GUGA 1WYDA 3PO3B 3FMCA 4CKCA 2BA0A 1EZ8A 3J81c 4MIUA 3OTOQ 5E3FA 1LM0A 2KCNA 1FNVA 4B08A 5C0XI 3AEVA 1EFID 2Z4HA 1YHAA 1HZ9A 3I4NG 4JYAQ 1QVGA 2VUMH 5IYCH 2F0SA 5EKIA 1LTSD 1WFQA 1ENCA 3S15H 5M3FH 3TS2A 5IYDH 1Q3LA 2AQ1B 3AU7A 1NAPA 1N34L 2AKWB 4A3KG 2ES2A 1C7YA 4LF4L 1HQMC 5C4JB 3CCMA 2O5IC 3A55A 4IFDH 1KAAA 1WCMH 2JA8H 5IWAQ 1ZYRD 2WAQB 3GTPB 1JT8A 2OCEA 4Q0FA 4AQYL 4CJ1B 4L5TA 4LF5L 2WP8J 2N55A 4HIKA 4FF1A 5M5WB 3P7JA 1S3OA 1PTOC 4DNIA 1UEBA 2F0JA 2TSSA 2JA7G 1Q8KA 1DOLA 2EDGA 3KF6A 5D3DA 1UWVA 3ERQA 3S16B 4K0KQ 1I6VC 1R4PB 2D5DA 4GLXA 3UDFA 1A3VA 2EJGC 1BVSA 4FNFA 4KK7A 5FLXE 2E5LQ 1CQFA 2UXCQ 4QB4A 4ME3A 4KKUA 4ZKBB 4A3EB 4BBSH 1DYQA 1SBBB 2OXPA 3F2BA 4QY7A 1CT1D 1G2TA 2YTYA 2KCTA 3GTKB 4V190 1TS4A 4HSPA 4HJ5A 3CRKC 3BZCA 4GS3A 1HQRD 1VF7A 1PZID 1HRJA 2QA4A 3GP7A 2JP1A 1RF2D 1K73C 3NBIA 4YWMA 5DNFA 2GVAA 2VXWA 3MXGA 4P2CB 2EXZA 4DR2L 2NZHA 3K7UC 1RD9D 4HJ8A 4JOIC 1I94Q 5ELDA 2PQEA 1O7YA 1EL0A 2H5XA 1PLFA 2Y0SB 1AZQA 4BS9A 2HDMA 3FKIG 3KBGA 1K0SA 3BYTB 2RA4A 4TVAB 3TN2A 1WTQA 1YITA 3G48A 2SNMA 1EY6A 5JJZA 4IPDA 4K5WA 3IRBA 3GTJB 4G7OC 4HEDA 4CBVA 1JWUD 1GUNA 4UAIA 4JI5Q 5BN3A 2F4IA 2NYZD 3PIOA 2B2YC 4A3BB 2A6ED 5IT9c 2K14A 1CKMA 1FYCA 1SYDA 3OWEB 3M7NA 4P73A 1B50A 4DA2A 2ICEC 2M9VA 5HGQA 3H3VI 4LF6L 4LF8Q 3I4NH 3QJYA 1KIXA 1BDOA 5E1FA 2Z9HA 3BU2A 2DJGC 1SNCA 2F3WA 4OHJA 4B3RL 1ESRA 3X3NA 3BDCA 4UY8C 5C3EH 1VQ9A 2XWBB 3Q24A 1YJWA 1Y8OB 1DD2A 1O7ZA 2PZWA 2L1BA 4DV6L 4A3KH 4RFBA 1KLUD 1MJCA 3HEJA 4IPCA 5ELFA 2AWOA 4WRDA 5T1GA 3VR2A 1STEA 4ZK9B 2CHBD 1Y1WB 2I0QA 2ZT9C 3MXPA 5CV4A 1SEBD 4X64L 3E0EA 3M3YB 1KC8C 2F52A 4PMBA 1EY7A 1YJ9A 3D4RA 3F2CA 2D62A 1STYA 3QOJA 4UP8A 3OIPA 2K1BA 3J7AV 1I4QA 4RG1A 3SK8A 2VZAA 3OYYA 4LNQA 2AUJD 1JCKB 5IGCA 2JA7H 2WB1B 2X6GA 2VNUD 3H09A 5JJIA 2IHEA 1HH2P 2A19A 4KD4A 3K5NA 3LWEA 3STBD 1JC7A 2A6HD 2HHHL 4DAVA 2EXDA 3S1MH 1B9NA 1V8QA 5C5LA 4FO2A 4HR7B 4JYAL 2ATWA 1H95A 2KQ3A 1UE1A 5M5WH 1F9PA 1QZGA 3PMFA 2DNCA 1TWHB 3T56B 1N33L 2PQAA 2L55A 2JA9A 1A15A 1C48A 4C3JH 1D1IA 5FJ8H 3S16H 2B2VA 4DK0A 1H9JA 1NY4A 1ENFA 4DNTB 1NR2A 5I4DA 1LABA 1YI2A 1E2ZA 1FNUA 3L3OC 3NWTA 1Y1VG 1HA6A 1WI5A 2UUCQ 1VQ7A 1WTRA 2EOTA 4C3IG 1FGUA 1UUPA 3CC7A 3Q22A 3GTKH 5KNCA 2RHQB 4AIMA 4C2MB 1F2MA 1PYWD 3HOXH 4FXKC 1F2YA 1YHQA 1CA5A 1CSPA 4K0KL 3UDXA 3HKZB 1PA6A 3CP0A 1CKOA 1B4OA 1TWCB 2BDNA 4OWTB 3S1RH 4LF9Q 2E5LL 1H9KA 5HY6A 2DY7A 5JJLA 5T1IA 1S5CD 1EQVA 3H3VH 1I3QH 4AYBG 1XNRL 5I2YA 4K8IA 4BY1B 1QJOA 1OO9B 1D6EC 2LKVA 3WWVA 3GTOB 2E2JB 4RGTA 2ZM6L 2XNAC 1AW7A 1Q82C 1S5DD 5KIXA 3CPWA 3J80i 4O0AA 2F0GA 4JI3L 4NXNQ 3CMAA 1Z7TA 1ET6A 5KYLA 3FVQA 4GN3B 3PUYA 1AH9A 2Z6KA 3PUVA 4A3BH 1I94L 1V43A 4A3IB 3A7LA 2SDFA 1F2LA 5GADC 2JA6G 1L1OA 3C3LA 4P75A 3S9WA 1KRTA 4C3HB 2PYKA 5JPMC 4J6HA 2GA4B 4JI5L 5L37A 1D5XC 3G6EA 3TZDA 5C4XG 4S3SA 4EX5A 4X65Q 1I50H 4C1NI 2JJQA 1Y1WH 4X3TA 5CV7A 1T9HA 1TR5A 2F0OA 1XXGA 1PMRA 2WAQE 4LF8L 3PSIA 4QMGA 1XNQQ 4DK6C 4DN4M 4JI2L 2WKCA 3K80C 4A3DH 1JICA 3NTKA 3MEHA 4DV7Q 2K5HA 1C9OA 1SMYC 2PW7A 4K6DA 3MZ5A 3W5OA 1RTOA 3ONAB 2UXDQ 2V1CC 1JJ2A 4RCNA 2JE6I 2OTJA 3J7YW 5FLXc 3RN5A 4FXGC 1I6HB 1SYGA 1SRUA 1VQAA 2KA7A 1PH7A 2RF4A 3R3OA 2N78A 1EFWA 1VQ4A 2IW3A 3V05A 2MP1A 4TQUS 5HURA 3BDLA 1SNMA 5HGTA 3IKJA 2NN6G 1QB5D 2R7ZB 4C3IH 1D8LA 2NN6I 3CCLA 1GJXA 2HCIA 1PZKD 4BBRH 5C5MA 1VQ8A 1F2ZA 2SNSA 4NXMQ 2JA5B 2NVTB 1TWHH 1XPOA 4YCVA 2R3ZA 5CGKA 2CWAA 4DF7A 3A74A 1KTKA 3BVMA 3D4WA 2XRQD 2R92B 2H4OA 3I72A 1E2WA 2VS1A 1XTCD 4KTAA 4BA1I 1G91A 3SK6A 3S2HB 2KUMA 1MBYA 1EIYB 1TS3A 2Y0SE 5IP9G 2YYZA 4K2KA 2ZXPA 2F0UA 4A3MB 3E5SA 1BQQT 1O7LA 4F88A 2N49A 3MAQA 3ER0A 4RHSA 5IOCA 4DUYQ 1EQQA 1CHPD 1A6XA 4GN4B 4RHRA 5EPKA 4DXGA 1KD1C 3SK4A 2Z0SA 4YIJA 2UUCL 3ZYYX 4BY1H 3UDIA 3G6JB 4R4OA 4KD3A 4A93B 4A3JH 5I6WA 2K5VA 3TS0A 4Z9CB 1PRTC 4HIDA 3TBIB 1XJVA 1X54A 2CFMA 1WTOA 2DNEA 4P74A 3SEBA 3CXCA 2K50A 1Y69U 1VQOA 4IOCA 4TSSA 5C4XH 1N36L 2G9HD 1EOVA 2RDHA 5C44G 4QF4A 2NZOA 1STHA 1SE3A 2SOBA 3ERSX 2NVXB 4KV6A 1IYVA 1WTVA 3J7ZC 1Y14B 5I2XA 4BY7B 4L8JA 2MO1A 1QNKA 2QCPX 3MFYA 1GUWA 3D3RA 5JPNC 3KDFB 4DNRB 1YIJA 2JN4A 2F0NA 3T1HL 3IAYA 4KKSA 4JBWA 1V1PB 4KN7C 3EQLC 1HJPA 3SDZA 1H9SA 4RMFA 2EY5A 4X62Q 4NXNL 2UU9Q 4PMCA 4NP5A 1LTBD 3K81C 2EE1A 3U9OA 1KQSA 1ICFB 2WB1E 1JR0D 4DR6L 2KHJA 2VUMG 5IYCG 5FKAC 1SFOH 1FJGQ 5M3FG 1ASZA 5IYDG 2RBMA 1EU4A 3A8KE 4EQPA 5A35A 3PIO3 2XGTA 3RNUA 4A3FB 3KUPA 4ID6A 5M5YB 2YTXA 1YEZA 3HOYH 4RGMA 5AJ3Q 1CZWA 3HKSA 2XTIA 1AN8A 2NVQB 4IFDI 2FMMA 4J15A 1X3QA 1OXTA 3HP3A 2LS01 1VQFA 4NW2A 4KMUC 1S5ED 2RSNA 4LF7L 4X65L 4JBJA 3TQYA 1NUCA 4KHZA 5LL6S 1TWAB 3HS0C 5KEEA 2KCCA 1WTXA 1QOHA 1LTTD 4LUOA 1ML0D 4LUVA 1XNQL 4QUCA 2K03A 2CH4A 4DV7L 4OIJA 3MC0B 4XT1B 4BBSG 2RDFA 1G6PA 1M4VA 1AE2A 4IPGA 5IYBG 4LF6Q 2LMCB 1MJEA 2N3SA 4GNXA 4KLKA 3H0GH 3V96A 5GAEC 4I7ZC 3HOWH 1NTGA 2F0HA 1VQJA 1Y8NB 4C56C 4DK1A 4B9WA 3M85A 1R9TH 1EIHA 1WTHA 1M1KC 4ME5A 1PYSB 3NTIA 3PUXA 3HOUB 3CQZB 2F0QA 4DR4Q 4G7ZC 4DKAC 1K0RA 2DGYA 1DXMA 4A3MH 4OX9Q 2PZUA 4NXML 4X64Q 1P16A 3OPOA 3CCUA 3I55A 3K58A 3NENA 1A3TA 3DHQA 2D9UA 1G6ZA 4HJ7A 1RTNA 4EGVA 3HGBA 2H1EA 1TKWB 1KABA 4A3CH 2QGQA 4GKKL 1JWMD 1QWYA 4XXEA 1ONLA 1X65A 3RN2A 3DWQA 3U50C 2O5JC 1Q12A 4DFAA 2HHHQ 2K7VA 4DUYL 1I4PA 1CKNA 1HZCA 1HZBA 2EYMA 4DPGA 1K83H 3KLWA 2F3IA 3IL8A 4ODGA 3T51B 5IY0A 4LWCA 3UE0A 4GN5A 4NKLA 2XSCA 5C3EG 1O80A 1Q46A 1N33Q 2KENA 1XX8A 2B2VC 2CQOA 4KJNA 3QIAA 3OW2A 3RUZA 1B8AA 4G57A 2NVYH 4HCEA 1CSQA 1TU2B 2IT1A 1G8ZD 2Z6BA 3PO2B 1ZYRC 3PO3G 4ABNA 1SSOA 3C46A 1BCPC 5ELBA 1YNJC 3MTSA 4YWLA 2RQXA 4JI8L 3AQQA 1SNOA 3C1EA 1BXTA 1XMOQ 3TP8A 2KHIA 2PI2E 1LTID 4B9XA 2BDOA 2IX0A 2OTLA 1GHJA 4A3FH 2B8FA 5M9OA 1STNA 3E0JA 1MGSA 3A7AB 2G9DA 3VR5A 4RWSC 2CQAA 1PTOB 4X62L 1NE3A 4L6TB 2UUAQ 1D1KA 2UU9L 1KNAA 2BH8A 1U4LA 1GUSA 2WAQG 3W1GA 3TREA 3SR1A 1XNRQ 3K8AA 4IPHA 2B8GA 1RCVD 1H9MA 3OSOA 3KK7A 3L0OA 3PUWA 1PTOD 1J5EL 5IYBH 4L5RC 3GTQB 1JOQA 3A54A 3QB3A 3CRLC 3ND8A 5M5XH 5JVG3 1QILA 4GZYC 4PZ8A 2ZM6Q 1FJGL 1DZ1A 4K5XA 1EZ6A 1PTOF 2AUKA 2F0MA 2Q2UA 3S14H 1B44D 4JI3Q 2J4XA 4IUVA 5AJ3L 3K7AH 3EBEA 4C3JG 5FJ8G 1M90C 2Z6KC 2FXQA 3EA6A 5JVH3 1OTCA 3TP6A 4PZ7A 1Q7YC 1D5ZC 1ZEQX 3J81L 2MGSA 3B6YA 3A5UA 2EPBA 2K5DA 3H3VC 3MXNA 2OWOA 2VQFL 4LK1C 3JAME 5FLMH 1L1OC 5EQ0A 2JXMB 4ZUIA 2M00A 3AMUA 4HTHA 3D6WA 2EYJA 1IW7C 2ZTDA 1PH8A 2A73B 3HOXG 2Q8RE 4KHVA 1IL2A 1E2VA 3WOFA 1BO0A 1PFNA 5CR3A 1VQMA 5IODA 3KFUA 5LMUQ 4DUZL 1D2BA 1LT3D 3FPPA 5ELEA 1S40A 1SE8A 2R6GA 4DGZA 3J81j 2K05A 1EY4A 3LGJA 3NBHA 5CBAE 4DU9A 5DEHA 5M3MH 2Y0SG 3MVVA 4CJ0B 2KCMA 4HSVA 4JI2Q 5CC4A 2JEAI 4IO9A 2J7ZA 4X3UA 5IE8A 4LFBL 5I9PA 1SLJA 3S2DH 4FVMA 2WIIB 5JEAJ 4DR4L 4ILWA 4A3BG 4HN7A 5EBDA 3PO3H 1ICWA 4OX9L 3ND9A 4JV5L 4TKOB 1JE5A 4DR1L 1PH5A 4QIWE 1BNZA 4LUZA 4DR7Q 1QVFA 1BOSA 3V2TA 5C3WA 1GUTA 4EQOA 3FPUB 5LHY1 2AQ3B 3D8GA 3LWUA 3J80E 3VYTA 2L5TA 3EIVA 4GOPA 3OOCA 2R7FA 3PIP3 2QDBA 4MN3A 3O13A 1SNPA 1PH6A 4GLAC 3VYUA 5C4JH 3AFPA 1ILQA 1B53A 1IKLA 4X66L 5EKLA 3M4QA 3G4SA 1Y1WG 1LYLA 4DR3Q 1KNEA 3GTPH 2LXJA 4B3SQ 3MHBA 1PXUA 3I2ZA 4HIOA 2F0KA 2A1AA 1D5MC 5CBEE 3K5MA 1LO5D 4A3DG 1HFNA 3DLLA 1KDCA 4H13C 1VS0A 2JYOA 1Y8PB 3PV0A 3HRZC 3S1NB 2MUYA 3DUZA 2B63B 1EQTA 1BF4A 2LSSA 2JK8A 1PH9A 1E1OA 4ZLTF 1HR0L 2BE5C 2HUGA 1Y1VB 1ESFA 2CCZA 5IT9L 4XDXA 4XT3B 4EQNA 1PTOH 2XN9C 4UP9A 4KY7A 4OWWB 4A3EH 1L0WA 2HT1A 3M4OB 1U4MA 1HNZQ 2VB2X 4DAYB 4FYDA 3NP8A 1YNNC 2AHOB 1WVLA 1DCZA 3HG9A 4DV4Q 1JMCA 5D3IB 4Y52H 1EIGA 3EN2A 1XMOL 4PNYA 1EWCA 1UAPA 4R8IA 4BBRG 3KJOA 3M4YA 4N9PA 4A4IA 1EEFD 3F8TA 3BS1A 4M1UB 4K14A 2IJ0A 1LTGD 4R4IA 1N36Q 5A2QL 2YTVA 5BN5A 1I5FA 1RKNA 2UUAL 1L2FA 1B1ZA 4JI4L 1UE6A 1X56A 1QUQB 4C1NK 1RJTA 3SGIA 3OMCA 2ALYB 3T1HQ 1EYAA 2NTSA 4CHTB 2ENBA 4OEMB 3KLRA 5FO7B 1Q81C 5ELOA 3EJIA 4L5QA 1T5EA 4LFCL 3DM1A 2I5MX 4RA8A 1YVCA 3HKZG 3GTJH 1WTPA 3BDOA 2B2WA 4DR6Q 1E3PA 2I5LX 1BR9A 1JB3A 1U4RA 5CV5A 3TP7A 4A3GB 3U58A 5JEAH 1ENAA 5ELNA 4BY1G 1I4RA 2MO0A 3GTMB 1AE3A 1EWHA 1U0LA 4L63B 4A3JG 4JPBW 3LNNA 2EJMA 3FHWA 2EVBA
chains in the Genus database with same CATH topology
3W2DA 2F0VA 1FNWA 5KNBA 4IUTA 2IWHA 3GO5A 4Y7NB 4EVOA 3EFXD 1H9RA 1Z47A 2A68C 1VMCA 2D2CC 4ZAIA 4OIKA 2R93B 1QG7A 5EPLA 2CW0C 2A69C 3L9AX 2BOSA 3HOVB 1IHZA 2J0TD 3EVQA 3L7ZC 3R2IA 2E2DC 4C3HG 1F9SA 4FF3A 4PV1C 1JQYD 4KN4C 4HCSA 5FOBB 5CYUA 2F1MA 4BA2I 3HOZB 1HHVA 4ULLA 4TRDA 1S5BD 2SEBD 2ZXRA 2IPKD 4WJWA 1IL8A 1SMYD 2X6LA 1TWFB 1U4PA 3VYRA 1UNSA 4RGNA 2KEDA 2HDLA 2O2LD 4R9WA 2F0PA 5E4XA 1AEXA 2JSOA 1KLGD 1G2SA 2FINB 2IX3A 5EPJA 2MJ8A 5C6AA 1TWGB 1NCVA 2KHSA 2E2HB 3GV3A 3MXUA 1WTWA 4JK1C 5G3LD 1AFPA 1VF5C 3MWYW 1L0YB 3NQIA 4IQZA 2F03A 1PFBA 5G3LF 4RGOS 1K8OA 3RLFA 3NWSA 1RDPD 2ICIA 3R93A 1EOTA 2KVMA 3RZDB 3DMUA 5ISRA 2VB3X 1X32A 1WD0A 3WDNA 5C44B 1CFMA 5IIFA 1RODA 3VA5A 2EY2A 2FJ2A 1EY0A 5FLXL 2F0FA 1STBA 3PUZA 1PRTB 1SJHD 1F9RA 2PCFB 2V4DA 1PRTD 3DEPA 3TSSA 4LJZC 1B3AA 4QIWB 3I91A 3A8IE 3NPPA 2EJFC 1PRTF 1VCIA 2E74C 3S15B 5M3FB 3IFTA 2QEJC 5DM63 2XRSD 1BUVT 4QUFA 1GOZA 3NXWA 2B2TA 4NMZA 4IURA 1WCMB 1EYDA 3BVGA 2JA8B 4IZ8A 2N88A 2NWGA 4UDUC 2PO4A 3TDQA 1J9OA 2E76C 3LX0A 3VA7A 4FF4A 5EBCA 2A5HA 2EY1A 1GHKA 1W6JA 5C4HA 1TVXA 1O78A 1EY9A 4CKEA 3URYA 2KECA 2Q8TA 1I4HA 2EYOA 2B39A 4FF2A 1JOKA 3H94A 3N52A 2EZVA 5DM73 4ZYSA 3K59A 1PFMA 1LT4D 3I4MB 4BWGB 4R8NA 3FEWX 3HZXA 1AP0A 3DWPA 1HA5A 4HMJA 2MHVA 3IFDA 4IUUA 1L0XB 2DN8A 2OT2A 3P75A 1S5FD 3CU7A 1EY5A 1Z6HA 5COYA 1HTPA 3Q6SA 1TS5A 2OF1A 5ELCA 3WOEA 4QCLA 1EEID 1LTAD 1B9MA 3I4LA 1J8IA 4H44C 2KEEA 1T5XD 3X3MA 2Z1CA 5K36G 5FO8B 1JE4A 2L12A 3D4DA 3GTGB 3D31A 3OW7A 4RCOA 1CTMA 3W3AA 4OO1G 5J1ZA 2ZXOA 4LMQD 3NSWA 4IUPA 2XVSA 3I4NB 1FGBD 3VR6A 1OXXK 3T53B 1LLRD 2PPBC 2Z4IA 4A3KB 5C0XJ 3OIQA 3I70A 2HCCA 4IUNA 5EKKA 5C0XG 1Q1BA 3KLSA 1EY8A 4IALA 1IYUA 5IGBA 1SAPA 1SNQA 2NBFA 3I8ZA 1QCBD 3S17B 3NHHA 2F0WA 3BZDB 3RMHA 4G7HC 2JA7B 1DOKA 3QWNA 3CHBD 4H0LC 4G4KA 3A56A 3GD7A 1BCPB 1SYFA 3S1MB 2BCOA 4U68A 2K5QA 4X3KA 4XYQA 4CJ2C 1BCPD 4KI0A 4N9TA 1YNJD 5LL6X 4H7BA 2YU9B 3GTLB 3Q23A 5IGFA 2RKSA 1BCPF 4HMIA 2IL8A 1V1PA 4ZRZA 1KDAA 2Z8LA 1KDBA 4C3JB 1CQVA 4WORA 1SNDA 1GUOA 2C5CA 4Q5VA 3QG1A 1QE6A 2B2WC 1STAA 3BVZA 3FKIB 1DM0B 5I9OA 3C1FA 3HOXB 5K36H 3K0YA 2K28A 3S1RB 4RKLA 5DAUA 2AQ2B 4OO1H 1I3QB 1DJRD 4J8QA 1HFGA 1STGA 4FXDA 2A6EC 1HCZA 2EYLA 1IW7D 1HTLD 5F2DA 2L0CA 2K6AA 3GQBA 5JOBA 4M8AA 4F87A 5C0XH 3E6ZX 2FFKB 1EYCA 1HXYD 2B2UA 4IUQA 1SYBA 5JEAG 2NB0A 3SXHA 5C3XA 3NQTA 1A2TA 3OWFA 3TZUA 1SYEA 1K8MA 1HPCA 1TS2A 1I50B 5FO9B 4LAAA 2PNRC 2O4XA 1UEAB 3S1QB 3EROA 2WV6D 2QF7A 2A6HC 5KNDA 4A3DB 1LT5D 4K5VA 3VR4A 4DXFA 1FR3A 3U9SA 2E75C 1Q90A 4XQQA 1SXTA 2F0EA 3NTHA 2L4NA 1CI3M 1XWEA 5I6YA 4V0BA 2L9HA 2F0TA 3SK5A 1G291 1CM9A 1MD2D 3Q0AA 1SJED 1A2UA 1NSNS 4ZUJA 2K33A 4C3IB 4F8MA 3FDTA 3KLSX 5EJWA 4BBRB 3NK9A 5BN4A 3F2UA 2BA1A 2K5WA 2BE5D 1VMPA 1XYIA 2FHTA 4AYBB 3QOLA 2PMZB 2E2IB 5IGDA 3NE5B 5J39A 2JEBI 5CORA 1ZKOA 2WKDA 2F0IA 1I4GA 1YNND 4XTCS 1MSGA 2K32A 3TP5A 1X3PA 2Q8IB 4U673 4IN3A 2RVLA 1TIID 1R4QB 2B2TC 2F3VA 3T13A 5CV8A 3P20A 2EY6A 1H9SB 5D14A 4A3JB 3N6RA 3QO2A 2JA6B 5NUCA 4KJOA 4O42A 2KOLA 5KGUA 2QILA 4WFN3 5C4XB 1OXVA 3RZOB 2MPMA 3BYYB 2XWJB 3R2TA 4XYOA 5TSSA 3VR3A 5K5PA 4K8JA 1F77A 3J81E 4XQNA 5AFWA 2K01A 2R61A 5C4ZA 1SFOB 2B2YA 2LFNA 1OXSC 1JORA 2A68D 1AZPA 2F0DA 4I65A 1ZXTA 3ITPA 5KRUA 3HOYB 1V1OA 2WINB 2I46A 3A8JE 1LTRD 1RHPA 3UI2A 2CW0D 2A69D 3J7AF 4PQXA 3K5LA 1F9QA 1NR4A 1MI2A 2F0LA 1A3UA 4FP5D 1CZGA 5CV9A 1PZJD 1I4XA 3DXJC 4KY5A 3BG3A 5IGGA 3C2PA 3I90A 1CHQD 4X3SA 2EYPA 1SYCA 1SE4A 3I3CA 2TMPA 2PW5A 2NTTA 3H0GB 3HOWB 1R9TB 1JWSD 3OMGA 1FD7D 1CK1A 4XIGS 1Q8IA 1ILPA 5KYIA 1TT2A 3G7LA 2PZTA 1ET9A 4ZQ3A 4J1MA 4RH6A 4DAYA 1LACA 3D6CA 3RD4A 1W6KA 1II3A 1LT6D 3KBXA 1CA6A 3H91A 3M7GA 3FRPB 4F7XA 2WACA 3H6MA 2RDGA 1SDFA 1JOOA 2I07B 5IT9E 1K83B 5IGEA 4KY6A 3NUCA 2VUMB 1DONA 4XQJA 4KKTA 1C8CA 3DEOA 1GXDC 4CGYB 5EGTA 2NVYB 2M2LA 1S4ZA 3JAML 1Q1EA 3OHXC 1HUMA 3R8BA 5A2QE 4DAPA 1TQOA 1WD1A 3SE0A 1BBXC 1U9RA 1MSHA 1EU3A 3VYSA 4OGQC 4IFDJ 5JAVA 1OXUA 3P1HA 4RKBA 2X69A 4OL7A 2NUCA 3CKIB 3T16A 2IX1A 4MHEA 4IFDG 2NN6H 3AB9A 2HQEA 4PMWA 3MFGA 4HAEA 4BBSB 2KJXA 3K6OA 5CMDA 4NDXA 2FMCA 5M5XB 1LV9A 3DWAA 4ZKCB 2EYHA 1TY0A 2C9OA 1PDQA 2L11A 3K5OA 2K04A 3I73A 2LY7A 3S14B 4RAUC 3KF8A 5E4WC 3K7AB 2RSOA 1HUNA 3SVMA 1SE2A 1VDZA 2OEOA 1E0BA 3T4AC 5FK9C 4E6IA 5J22A 3J80L 2B2UC 1M8AA 2XIWA 2QKIC 3SHLA 4K6LA 5CV6A 1DOMA 2EYFA 3TMEA 3K57A 1QNUA 1IKMA 2ID0A 2A74C 4OO1I 5M3MB 1TY2A 2AWNA 2DY8A 3GV6A 5D65A 5C3EB 3S2DB 4K2LA 4O1NA 2NZ1D 1B2TA 1C4QA 4CKBA 2CVRA 3MA2B 1GUGA 3PO3B 3FMCA 4CKCA 2BA0A 1EZ8A 4MIUA 5E3FA 2KCNA 1FNVA 4B08A 5C0XI 1EFID 2Z4HA 2F0SA 5EKIA 1LTSD 1ENCA 1Q3LA 2AQ1B 3AU7A 1NAPA 1HQMC 5C4JB 2O5IC 3A55A 4IFDH 1KAAA 1ZYRD 2WAQB 3GTPB 4Q0FA 4CJ1B 2WP8J 2N55A 4FF1A 5M5WB 3P7JA 1PTOC 2F0JA 2TSSA 1DOLA 2EDGA 5D3DA 3ERQA 3S16B 1I6VC 1R4PB 2D5DA 1A3VA 2EJGC 4FNFA 4KK7A 5FLXE 1CQFA 4QB4A 4KKUA 4ZKBB 4A3EB 1DYQA 1SBBB 2OXPA 1CT1D 1G2TA 3GTKB 4V190 1TS4A 4HSPA 3CRKC 1HQRD 1VF7A 1PZID 1HRJA 3GP7A 2JP1A 1RF2D 3NBIA 5DNFA 2VXWA 3MXGA 4P2CB 2EXZA 1RD9D 5ELDA 2PQEA 1O7YA 1EL0A 1PLFA 2Y0SB 1AZQA 4BS9A 2HDMA 3KBGA 3BYTB 2RA4A 3TN2A 1WTQA 2SNMA 1EY6A 5JJZA 4K5WA 3GTJB 4G7OC 4HEDA 4CBVA 1JWUD 1GUNA 4UAIA 5BN3A 2F4IA 2NYZD 2B2YC 4A3BB 2A6ED 1FYCA 1SYDA 3OWEB 3M7NA 1B50A 4DA2A 2ICEC 2M9VA 3QJYA 1BDOA 5E1FA 1SNCA 2F3WA 4OHJA 1ESRA 3X3NA 3BDCA 2XWBB 3Q24A 1DD2A 1Y8OB 1O7ZA 2PZWA 2L1BA 4RFBA 1KLUD 3HEJA 5ELFA 2AWOA 4WRDA 5T1GA 3VR2A 1STEA 4ZK9B 2CHBD 1Y1WB 2ZT9C 3MXPA 5CV4A 1SEBD 3M3YB 4PMBA 1EY7A 3D4RA 2D62A 1STYA 3QOJA 3OIPA 2K1BA 3J7AV 1I4QA 3SK8A 2AUJD 1JCKB 5IGCA 2WB1B 2X6GA 2VNUD 3H09A 4KD4A 3K5NA 3LWEA 1JC7A 2A6HD 4DAVA 1B9NA 1V8QA 5C5LA 4FO2A 4HR7B 2KQ3A 1F9PA 3PMFA 2DNCA 1TWHB 3T56B 2L55A 1A15A 1C48A 1D1IA 2B2VA 4DK0A 1H9JA 1ENFA 4DNTB 1NR2A 5I4DA 1LABA 1E2ZA 1FNUA 3L3OC 3NWTA 1HA6A 1WTRA 2EOTA 4C3IG 1UUPA 3Q22A 5KNCA 4C2MB 1F2MA 1PYWD 4FXKC 1F2YA 1CA5A 3HKZB 2BDNA 1B4OA 1TWCB 1H9KA 2DY7A 5T1IA 1S5CD 1EQVA 5I2YA 4K8IA 4BY1B 1QJOA 1OO9B 1D6EC 2LKVA 3GTOB 2E2JB 4RGTA 2XNAC 1AW7A 1S5DD 5KIXA 2F0GA 1Z7TA 1ET6A 5KYLA 3FVQA 3PUYA 3PUVA 1V43A 4A3IB 3A7LA 2SDFA 1F2LA 3C3LA 3S9WA 4C3HB 2PYKA 5JPMC 4J6HA 2GA4B 1D5XC 3TZDA 4S3SA 4C1NI 4X3TA 5CV7A 1TR5A 2F0OA 1XXGA 1PMRA 4QMGA 4DN4M 2WKCA 1JICA 3NTKA 3MEHA 1SMYC 2PW7A 4K6DA 3MZ5A 1RTOA 3ONAB 4RCNA 2JE6I 3J7YW 4FXGC 1I6HB 1SYGA 2KA7A 3R3OA 2IW3A 3V05A 2MP1A 4TQUS 5HURA 3BDLA 1SNMA 5HGTA 3IKJA 2NN6G 1QB5D 2R7ZB 2NN6I 1GJXA 2HCIA 1PZKD 5C5MA 1F2ZA 2SNSA 2JA5B 2NVTB 5CGKA 2R3ZA 4DF7A 1KTKA 3BVMA 3D4WA 2XRQD 2R92B 2H4OA 3I72A 1E2WA 4KTAA 1XTCD 4BA1I 1G91A 3SK6A 3S2HB 2KUMA 1MBYA 1TS3A 2YYZA 4K2KA 2ZXPA 2F0UA 4A3MB 3E5SA 1BQQT 1O7LA 4F88A 3MAQA 4RHSA 5IOCA 1CHPD 1A6XA 4RHRA 5EPKA 4DXGA 3SK4A 4YIJA 3ZYYX 3G6JB 4KD3A 4A93B 5I6WA 4Z9CB 1PRTC 3TBIB 1WTOA 2DNEA 3SEBA 1Y69U 4TSSA 2G9HD 2RDHA 4QF4A 1STHA 1SE3A 2SOBA 2NVXB 4KV6A 1IYVA 1WTVA 5I2XA 4BY7B 4L8JA 1QNKA 2QCPX 3MFYA 1GUWA 3D3RA 5JPNC 4DNRB 2F0NA 3IAYA 4KKSA 4JBWA 1V1PB 4KN7C 3EQLC 3SDZA 1H9SA 2EY5A 4PMCA 4NP5A 1LTBD 2EE1A 3U9OA 1JR0D 5FKAC 2RBMA 1EU4A 3A8KE 4EQPA 5A35A 3PIO3 4A3FB 3KUPA 4ID6A 5M5YB 4RGMA 1CZWA 1AN8A 2NVQB 4IFDI 2FMMA 1X3QA 1OXTA 3HP3A 2LS01 4NW2A 4KMUC 1S5ED 2RSNA 1NUCA 4KHZA 5LL6S 1TWAB 3HS0C 5KEEA 2KCCA 1WTXA 1QOHA 1LTTD 1ML0D 4QUCA 2K03A 4OIJA 3MC0B 4XT1B 2RDFA 1M4VA 2LMCB 3V96A 4I7ZC 2F0HA 1Y8NB 4C56C 4DK1A 4B9WA 3M85A 1EIHA 4ME5A 3NTIA 3PUXA 3HOUB 3CQZB 2F0QA 4G7ZC 1DXMA 2PZUA 3OPOA 3K58A 1A3TA 3DHQA 2D9UA 1G6ZA 1RTNA 4EGVA 3HGBA 2H1EA 1TKWB 1KABA 1JWMD 1QWYA 4XXEA 1ONLA 3DWQA 2O5JC 1Q12A 4DFAA 2K7VA 1I4PA 2EYMA 3IL8A 4ODGA 3T51B 4NKLA 2XSCA 1O80A 1XX8A 2B2VC 4KJNA 3QIAA 3RUZA 4G57A 4HCEA 1TU2B 2IT1A 1G8ZD 3PO2B 1ZYRC 4ABNA 1SSOA 3C46A 1BCPC 5ELBA 1YNJC 3MTSA 2RQXA 3C1EA 1SNOA 1BXTA 3TP8A 1LTID 4B9XA 2BDOA 2IX0A 1GHJA 2B8FA 5M9OA 1STNA 3E0JA 1MGSA 3A7AB 2G9DA 3VR5A 4RWSC 2CQAA 1PTOB 4L6TB 1D1KA 1KNAA 1U4LA 1GUSA 3SR1A 2B8GA 1RCVD 1H9MA 3OSOA 3KK7A 3GTQB 3PUWA 1PTOD 1JOQA 3A54A 3QB3A 3CRLC 3ND8A 5JVG3 1QILA 4GZYC 1DZ1A 4K5XA 1EZ6A 1PTOF 2AUKA 2F0MA 1B44D 2J4XA 4IUVA 4C3JG 3EA6A 5JVH3 3TP6A 1D5ZC 1ZEQX 3J81L 2MGSA 2EPBA 2K5DA 3H3VC 3MXNA 4LK1C 3JAME 5EQ0A 2JXMB 4ZUIA 2M00A 3AMUA 4HTHA 3D6WA 2EYJA 1IW7C 2A73B 2Q8RE 4KHVA 1E2VA 3WOFA 1BO0A 1PFNA 5CR3A 5IODA 1D2BA 1LT3D 3FPPA 5ELEA 2R6GA 4DGZA 2K05A 1EY4A 3NBHA 5CBAE 4DU9A 5DEHA 3MVVA 4CJ0B 4HSVA 5CC4A 2JEAI 2J7ZA 4X3UA 5I9PA 4FVMA 2WIIB 5JEAJ 4ILWA 4HN7A 5EBDA 1ICWA 3ND9A 4TKOB 1BNZA 1BOSA 3V2TA 5C3WA 1GUTA 4EQOA 3FPUB 5LHY1 2AQ3B 3D8GA 3LWUA 3J80E 3VYTA 2L5TA 3OOCA 3PIP3 2QDBA 4MN3A 3O13A 1SNPA 3VYUA 1ILQA 1B53A 1IKLA 5EKLA 1KNEA 3MHBA 1PXUA 2F0KA 1D5MC 5CBEE 3K5MA 1LO5D 1HFNA 1KDCA 4H13C 2JYOA 1Y8PB 3PV0A 3HRZC 3S1NB 2MUYA 3DUZA 2B63B 1EQTA 1BF4A 4ZLTF 2BE5C 2HUGA 1Y1VB 1ESFA 5IT9L 4XDXA 4XT3B 4EQNA 1PTOH 2XN9C 4KY7A 3M4OB 1U4MA 2VB2X 4FYDA 1YNNC 3NP8A 1WVLA 1DCZA 3HG9A 5D3IB 1EIGA 4PNYA 1EWCA 1UAPA 4R8IA 3M4YA 4N9PA 1EEFD 3BS1A 4M1UB 4K14A 2IJ0A 1LTGD 5A2QL 5BN5A 1RKNA 1B1ZA 4C1NK 1RJTA 3OMCA 1EYAA 2NTSA 4CHTB 2ENBA 3KLRA 5FO7B 3EJIA 1T5EA 3DM1A 4RA8A 1WTPA 3BDOA 2B2WA 1BR9A 1JB3A 1U4RA 5CV5A 3TP7A 4A3GB 5JEAH 1ENAA 1I4RA 3GTMB 1EWHA 4L63B 3LNNA 2EJMA 2EVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W2D A;  1EU3 A;  1SE3 A;  1FNW A;  4ZYS A;  1ENF A;  1PTO F;  1LT4 D;  1BCP B;  4BWG B;  5I4D A;  1CHQ D;  1RDP D;  2ICI A;  1B44 D;  3DWP A;  2J4X A;  1FNV A;  1FNU A;  1HA5 A;  1D5M C;  1EFI D;  1LO5 D;  1JWU D;  1SE4 A;  3EA6 A;  1BCP D;  1L0X B;  1TS2 A;  3EFX D;  2NTT A;  1D5Z C;  1S5F D;  1UUP A;  1V1P B;  3MFG A;  1LTS D;  1TS5 A;  3OWE B;  1BCP F;  1PYW D;  5ELC A;  1JWM D;  1JWS D;  2QIL A;  3V05 A;  1V1P A;  1LTB D;  2AQ1 B;  2WV6 D;  1EEI D;  1LTA D;  2Z8L A;  1FD7 D;  3DWQ A;  1LT5 D;  1JR0 D;  3DWA A;  1CQV A;  1ESF A;  4DXF A;  5FKA C;  1TY0 A;  1CK1 A;  1PRT B;  1T5X D;  4OHJ A;  1S5C D;  3R2I A;  1SJH D;  1PTO H;  1EU4 A;  2XN9 C;  3BYY B;  1I4P A;  1PZK D;  1JQY D;  1D6E C;  1PRT D;  3R2T A;  4RGM A;  4RFB A;  1KLU D;  3BVZ A;  1ET9 A;  3TSS A;  1SE2 A;  1LT3 D;  5D3I B;  5ELF A;  4RH6 A;  4RGT A;  5ELE A;  1STE A;  2XNA C;  5TSS A;  1KTK A;  2CHB D;  4RCO A;  1EWC A;  1AN8 A;  1AW7 A;  3BVM A;  1S5D D;  2XRQ D;  1PTO C;  1PRT F;  1SXT A;  5FK9 C;  1S5B D;  1SEB D;  2SEB D;  1LT6 D;  2TSS A;  2IPK D;  1EEF D;  1F77 A;  1XTC D;  2QEJ C;  5D3D A;  1S5E D;  2XRS D;  2IJ0 A;  1ET6 A;  1GOZ A;  1LTG D;  1MD2 D;  1FGB D;  1TS3 A;  1SJE D;  2R61 A;  1G8Z D;  3BVG A;  1LLR D;  1UNS A;  1I4Q A;  1B1Z A;  2AQ2 B;  3KLS X;  4RGN A;  1LTT D;  2RDG A;  1BCP C;  4UDU C;  1JCK B;  1DYQ A;  1DJR D;  1SBB B;  4K6L A;  4RHS A;  5ELB A;  2O2L D;  1CT1 D;  1V1O A;  2NTS A;  1CHP D;  1LTR D;  1TS4 A;  1KLG D;  3MC0 B;  1BXT A;  1LTI D;  1HQR D;  1PZI D;  4RHR A;  4DXG A;  1M4V A;  3GP7 A;  1D5X C;  1TY2 A;  1RF2 D;  1HTL D;  2AQ3 B;  1I4G A;  3URY A;  1PTO B;  4Z9C B;  4L6T B;  1RD9 D;  1PRT C;  3BZD B;  1L0Y B;  4C56 C;  3R8B A;  1I4H A;  5ELD A;  1I4R A;  1RCV D;  1XXG A;  1PZJ D;  1I4X A;  4O1N A;  3SEB A;  1PTO D;  1HXY D;  3O13 A;  4L63 B;  4TSS A;  4RGO S;  1QIL A;  2G9H D;  2RDH A;  3CHB D;  3BYT B; 
#chains in the Genus database with same CATH topology
 1UE7 A;  2F0V A;  3W2D A;  1FNW A;  2K52 A;  1SR3 A;  5KNB A;  4IUT A;  3CW2 C;  5LMU L;  2IWH A;  3GO5 A;  4LF7 Q;  4Y7N B;  4JBK A;  1Q86 C;  4EVO A;  3EFX D;  1H9R A;  1Z47 A;  2A68 C;  2PNH A;  3VDY A;  1VMC A;  4A3I G;  2D2C C;  4ZAI A;  4OIK A;  4YHH Q;  3M3Y H;  2R93 B;  1IBM L;  1QG7 A;  5EPL A;  1NNX A;  3CD6 A;  3M9B A;  3CPF A;  2CW0 C;  2A69 C;  3L9A X;  1VQG A;  2BOS A;  3HOV B;  4JCV E;  1IHZ A;  3KF8 B;  2J0T D;  3EVQ A;  3L7Z C;  3R2I A;  2E2D C;  4C3H G;  1F9S A;  1RL2 A;  3CC4 A;  4PV1 C;  4FF3 A;  1JQY D;  4KN4 C;  4GNX C;  4HCS A;  5FOB B;  5CYU A;  4X6A H;  2F1M A;  1NMF A;  3HOZ B;  4AH6 A;  4BA2 I;  1HHV A;  2C35 B;  2CWP A;  1KXL A;  4ULL A;  1P8L A;  4TRD A;  1C0A A;  1S5B D;  2SEB D;  2ZXR A;  2IPK D;  4WJW A;  1IL8 A;  3HOY G;  4DR7 L;  1B3Q A;  1SMY D;  2X6L A;  3UDG A;  1TWF B;  1KRS A;  3PCO B;  1U4P A;  4B3T Q;  3VYR A;  1YJN A;  3ZJY C;  1UNS A;  4RGN A;  1SN8 A;  1E24 A;  1ASY A;  2KED A;  2HIX A;  2HDL A;  2O2L D;  4UHV A;  4R9W A;  2F4V Q;  2F0P A;  5E4X A;  4DR3 L;  1AEX A;  2JSO A;  1KLG D;  1G2S A;  2FIN B;  2IX3 A;  4B3S L;  3JAM c;  3I7F A;  5EPJ A;  4GKK Q;  1VQE A;  2MJ8 A;  3M4O H;  5C6A A;  1TWG B;  1W3S A;  1NCV A;  1KHI A;  2KHS A;  2E2H B;  3GV3 A;  2R7Z G;  3MXU A;  1WTW A;  4JK1 C;  5G3L D;  1AFP A;  1VF5 C;  3MWY W;  4C2M H;  1L0Y B;  3NQI A;  2I5H A;  1B7Y B;  4IQZ A;  3NEM A;  2F03 A;  1PFB A;  5G3L F;  3H0G G;  4H02 A;  1TWC H;  4RGO S;  3HOW G;  3PIP A;  3CCS A;  3PF5 A;  1K8O A;  3RLF A;  2R92 G;  3NWS A;  1HNZ L;  2OQK A;  1VQ5 A;  1RDP D;  2ICI A;  4MNO A;  3R93 A;  1EOT A;  4DR5 Q;  4CDF C;  2CKZ B;  2KVM A;  4DV4 L;  3RZD B;  3DMU A;  3GTO H;  2D0P A;  2E2J H;  4MZ9 A;  5ISR A;  2VB3 X;  1X32 A;  3J81 i;  4A3M G;  1WD0 A;  3WDN A;  5C44 B;  1CFM A;  5IIF A;  1ROD A;  3VA5 A;  4CDE C;  3D0F A;  2EY2 A;  2FJ2 A;  1EY0 A;  3FP9 A;  5FLX L;  3E3X A;  2F0F A;  1STB A;  1HR0 W;  3PUZ A;  4QGU A;  4JI8 Q;  2Q2T A;  1PRT B;  4A3C G;  1SJH D;  1F9R A;  4A3I H;  2PCF B;  2V4D A;  2DJF C;  3J80 c;  1PRT D;  3DEP A;  3GTM H;  1LUZ A;  3TSS A;  1IBL L;  4A93 G;  4LJZ C;  1B3A A;  4QIW B;  3I91 A;  3A8I E;  1VQI A;  2EJF C;  3KF6 B;  1PRT F;  3NPP A;  3F2D A;  4C3H H;  4QL5 A;  1VCI A;  2E74 C;  4HIM A;  5M3F B;  3S15 B;  3IFT A;  1K8G A;  2QEJ C;  1PV4 A;  1J5E Q;  5DM6 3;  2XRS D;  1BUV T;  4ALP A;  4QUF A;  1GOZ A;  3NXW A;  2B2T A;  4NMZ A;  4IUR A;  1WCM B;  1EYD A;  3BVG A;  2JA8 B;  1N8R C;  4IZ8 A;  2N88 A;  3KYH C;  2NWG A;  4UDU C;  4BY7 G;  3CCE A;  2PO4 A;  3TDQ A;  4APV A;  2VY3 A;  2R93 H;  1J9O A;  2E76 C;  3DM3 A;  3LX0 A;  3VA7 A;  4O2D A;  4FF4 A;  5EBC A;  2A5H A;  2EY1 A;  3CCJ A;  3HOV H;  4N8F A;  1NMG A;  4JI0 Q;  3CCQ A;  4JC0 A;  1GHK A;  1U5K A;  1W6J A;  5C4H A;  1TVX A;  2VQF Q;  1O78 A;  1EY9 A;  5LMN L;  1X55 A;  4YWK A;  1I6H H;  4JVZ A;  4CKE A;  3URY A;  3CCR A;  3HOZ H;  2KEC A;  2Q8T A;  4YHH L;  1I4H A;  2K4K A;  4A3F G;  2EYO A;  2B39 A;  4FF2 A;  3I4O A;  1JOK A;  1X3F A;  4DUZ Q;  3H94 A;  3N52 A;  2EZV A;  1JJG A;  5DM7 3;  2R7Z H;  1VQC A;  1TWF H;  4ZYS A;  4WJ3 M;  3K59 A;  1PFM A;  1LT4 D;  3I4M B;  4BWG B;  2VQE L;  1VQ6 A;  1TXY A;  4R8N A;  3FEW X;  3HZX A;  1AP0 A;  3DWP A;  2QEX A;  2JA5 H;  2NVT H;  2HIV A;  1HA5 A;  4HMJ A;  2MHV A;  3IFD A;  1IYJ B;  4IUU A;  1L0X B;  4AYB E;  2DN8 A;  4A3L H;  2OT2 A;  3P75 A;  1S5F D;  3CU7 A;  1EY5 A;  1Z6H A;  1W2B A;  5COY A;  2R92 H;  1HTP A;  3Q6S A;  1TS5 A;  2OF1 A;  5ELC A;  4LFB Q;  2PI2 A;  1YHB A;  3WOE A;  4QCL A;  3TRZ A;  1EEI D;  1LTA D;  3E9I A;  1B9M A;  1QVC A;  3S2H H;  3I4L A;  1TWG H;  4B3T L;  1J8I A;  4H44 C;  2KEE A;  1T5X D;  4JV5 Q;  3X3M A;  2Z1C A;  5K36 G;  4R4T A;  5FO8 B;  4DR1 Q;  2ZJR A;  1JE4 A;  2L12 A;  2F4V L;  3D4D A;  5FLM G;  3GTG B;  4LW1 A;  3D31 A;  1A62 A;  3OW7 A;  4RCO A;  4GOP C;  1CTM A;  3W3A A;  4QQB X;  4OO1 G;  4I7A A;  4HJ9 A;  5J1Z A;  1IZ6 A;  2ZXO A;  4LMQ D;  4QJF A;  3NSW A;  4IUP A;  2XVS A;  3I4N B;  1FGB D;  3VR6 A;  1EIF A;  4X66 Q;  1FL0 A;  1OXX K;  4A93 H;  1IXR A;  3T53 B;  1LLR D;  1PH1 A;  5M3M G;  4JBM A;  2PPB C;  2Z4I A;  2P5Z X;  2UXB Q;  4A3K B;  5C0X J;  1FVI A;  3OIQ A;  3I70 A;  2K75 A;  3BZK A;  2HCC A;  2NVX H;  4LFA Q;  4IUN A;  5EKK A;  5C0X G;  1Q1B A;  3KLS A;  1EY8 A;  4IAL A;  4DR5 L;  1IYU A;  4BY7 H;  5IGB A;  2LXK A;  1D7Q A;  1SAP A;  1SNQ A;  2NBF A;  1HR0 Q;  3I8Z A;  1QCB D;  3S17 B;  3NHH A;  2PQA B;  2F0W A;  2CH4 W;  3BZD B;  3RMH A;  4G7H C;  4R4C A;  5DLQ E;  2JA7 B;  1DOK A;  3QWN A;  2AMC B;  5BR8 Q;  1K9M C;  3J7A 5;  5JJK A;  3CHB D;  3QR8 A;  4H0L C;  4G4K A;  3A56 A;  3GD7 A;  1BCP B;  1X9N A;  1SYF A;  4P71 A;  3S1M B;  2BCO A;  4U68 A;  2K5Q A;  1HZA A;  3Q8D A;  4X3K A;  4XYQ A;  4POF A;  4CJ2 C;  3A5Z B;  5M5Y H;  1BCP D;  1BKB A;  4KI0 A;  4N9T A;  3PO2 G;  1YNJ D;  1E7Z A;  4A75 A;  4KHP Q;  5LL6 X;  4H7B A;  2YU9 B;  2NVQ H;  3KDF A;  3Q23 A;  3GTL B;  4JI4 Q;  2N8N A;  5IGF A;  2RKS A;  3I56 A;  1BCP F;  4HMI A;  2IL8 A;  1V1P A;  3CF5 A;  4BXX G;  4ZRZ A;  1KDA A;  2Z8L A;  1KDB A;  4C3J B;  1CQV A;  4WOR A;  1TWA H;  1SND A;  1GUO A;  2C5C A;  4Q5V A;  1GVP A;  3JC6 6;  4DV2 Q;  4PZ6 A;  5GQO A;  4LFC Q;  3QG1 A;  1QE6 A;  4DV3 Q;  2B2W C;  1STA A;  5GAH C;  3BVZ A;  4DV1 L;  3FKI B;  2QW7 A;  1EYG A;  3KOJ A;  4JI0 L;  1N32 Q;  3M4P A;  4A3E G;  4ZCK A;  1DM0 B;  1N9W A;  5I9O A;  3C1F A;  3T1Y Q;  3HOX B;  5K36 H;  3I4M H;  1PFS A;  4OXP A;  1SMX A;  2R7D A;  3K0Y A;  2K28 A;  1PHJ A;  2RHS B;  3S1R B;  4RKL A;  5DAU A;  4NB3 A;  2AQ2 B;  1DGS A;  4OO1 H;  5J3B A;  1I3Q B;  2Q2H A;  1K28 A;  2Q2I A;  5E7N A;  1DJR D;  1HNW L;  4J8Q A;  1HFG A;  1L1O B;  1STG A;  4FXD A;  2A6E C;  3PGZ A;  4WJ4 A;  3HOU H;  3CQZ H;  4JI1 Q;  1PVO A;  1HCZ A;  2EYL A;  3G71 A;  5GRO A;  1IW7 D;  1SRO A;  1IBM Q;  4A76 A;  1HTL D;  4IOA A;  3GTG H;  5F2D A;  4JI6 Q;  2L0C A;  2K6A A;  3GQB A;  5LMN W;  4YY3 Q;  5JOB A;  5IP7 G;  2MNA A;  4M8A A;  4F87 A;  1X3G A;  5C0X H;  2ZJP A;  1X6O A;  3E6Z X;  1HNX Q;  2FFK B;  1XMQ Q;  4CDD C;  1EYC A;  1HXY D;  4MTN A;  2B2U A;  4IUQ A;  1VQD A;  1SYB A;  5JEA G;  3CCV A;  2NB0 A;  3SXH A;  5C3X A;  3NQT A;  1A2T A;  1BBU A;  3OWF A;  1K3B C;  3TZU A;  1SYE A;  1IBK L;  1K8M A;  1HPC A;  1VQH A;  2IHF A;  1TS2 A;  1I50 B;  5FO9 B;  4LAA A;  2PNR C;  4YCU A;  4IJH A;  2O4X A;  4DV5 L;  1UEA B;  3S1Q B;  3E9H A;  2WV6 D;  3ERO A;  1QZH A;  2QF7 A;  4JW0 A;  3STB C;  2A6H C;  5KND A;  2ASB A;  4A3D B;  1LT5 D;  2WFW A;  4K5V A;  3VR4 A;  4DXF A;  3PO2 H;  3S17 H;  1FR3 A;  3U9S A;  1J6Q A;  3ICE A;  2E75 C;  4OEL B;  2UXB L;  3RLO A;  2VW9 A;  4BXX H;  1Q90 A;  3CAM A;  1VQL A;  2B3G A;  3HFZ B;  4LFA L;  4XQQ A;  1PH3 A;  1YBY A;  1KAW A;  1SXT A;  3OTO L;  2F0E A;  3NTH A;  2L4N A;  2WB1 G;  1CI3 M;  1XWE A;  5I6Y A;  4V0B A;  2L9H A;  2F0T A;  3SK5 A;  1G29 1;  1K8A C;  3TEH B;  1CM9 A;  1MD2 D;  3Q0A A;  1SJE D;  1A2U A;  1NSN S;  2G5D A;  3CC2 A;  4ZUJ A;  2K33 A;  4C3I B;  1LTL A;  4F8M A;  1GKH A;  3FDT A;  3KLS X;  3JAM i;  2YU9 H;  4OON A;  3GTL H;  5EJW A;  4BBR B;  4JI7 Q;  3ULL A;  1JB7 A;  3GTQ H;  5BR8 L;  3NK9 A;  5BN4 A;  3F2U A;  1GM5 A;  2BA1 A;  3PQI A;  2K5W A;  5IWA L;  2BE5 D;  2BH2 A;  1VMP A;  1XYI A;  2FHT A;  2B63 G;  2MQH A;  4UP7 A;  4AYB B;  2DUD A;  3QOL A;  2PMZ B;  2E2I B;  4HJA A;  5IGD A;  4GLV B;  3NE5 B;  5J39 A;  2JEB I;  5COR A;  1ZKO A;  2WKD A;  4KHP L;  2F0I A;  1I4G A;  1YNN D;  4XTC S;  3FKI H;  1MSG A;  2EQS A;  5H1S E;  2K32 A;  3U4V A;  3TP5 A;  1X3P A;  1UE5 A;  2Q8I B;  4B3M Q;  1IBL Q;  4U67 3;  5IP7 H;  4DV2 L;  2UXC L;  4IN3 A;  4DV3 L;  2RVL A;  1TII D;  4N8X 1;  1R4Q B;  2B2T C;  2F3V A;  3T13 A;  5CV8 A;  3P20 A;  3UE1 A;  2EY6 A;  1H9S B;  1JJC B;  1S72 A;  5D14 A;  4A3J B;  4L5S A;  1N32 L;  3N6R A;  3QO2 A;  2JA6 B;  3BJU A;  5NUC A;  4KJO A;  4O42 A;  3T1Y L;  2KOL A;  5KGU A;  2D0O A;  2QIL A;  2RCF A;  4WFN 3;  5C4X B;  1OXV A;  2MFI A;  3RZO B;  1CUK A;  2MPM A;  3AFQ A;  3BYY B;  4NPS A;  2A8V A;  1E1T A;  2XWJ B;  4JOI A;  3R2T A;  4XYO A;  3H15 A;  5LMN Q;  2EIF A;  4JI1 L;  5TSS A;  4A3G G;  3VR3 A;  5K5P A;  4K8J A;  1WOC A;  1F77 A;  3J81 E;  4JI6 L;  4YY3 L;  4XQN A;  5AFW A;  2K01 A;  2R61 A;  1GD7 A;  5C4Z A;  1SFO B;  1MIU A;  1EQR A;  1HNX L;  1XMQ L;  2B2Y A;  2LFN A;  1OXS C;  2VQE Q;  1JOR A;  2A68 D;  1AZP A;  2OQ0 A;  2F0D A;  4I65 A;  1ZXT A;  3S1Q H;  3ITP A;  5KRU A;  3HOY B;  1V1O A;  2WIN B;  2I46 A;  3A0J A;  3A8J E;  1LTR D;  5EAY A;  4JG2 A;  1RHP A;  3UI2 A;  2CW0 D;  2A69 D;  4IJL A;  4GNX B;  3J7A F;  2R93 G;  3CME A;  4PQX A;  1PH2 A;  3K5L A;  1BBW A;  3HOV G;  1F9Q A;  1V1Q A;  1NR4 A;  3S1N H;  1MI2 A;  1A0I A;  1RIP A;  2F0L A;  1A3U A;  2B63 H;  4FP5 D;  1CZG A;  5CV9 A;  1PZJ D;  1I4X A;  3DXJ C;  1Y1V H;  3BG3 A;  4KY5 A;  4DV0 Q;  5IGG A;  3HOZ G;  3C2P A;  2VL6 A;  3I90 A;  2UUB Q;  1CHQ D;  4X3S A;  2EYP A;  1SYC A;  1SE4 A;  3I3C A;  2TMP A;  2PW5 A;  2ZTE A;  1PYB A;  2NTT A;  3H0G B;  3U4Z A;  3HOW B;  4P72 A;  2JA5 G;  1YNX A;  1R9T B;  1JWS D;  3RLN A;  2HQL A;  3OMG A;  2E2I H;  4A3L G;  1FD7 D;  4GKJ Q;  2JQO A;  1CKN B;  1CK1 A;  3F1Z A;  1G51 A;  4XIG S;  4OWX B;  4JI7 L;  1Q8I A;  2IY5 B;  1ILP A;  5KYI A;  1TT2 A;  3G7L A;  2ZJQ A;  2PZT A;  1ET9 A;  4ZQ3 A;  4FDB A;  4J1M A;  4RH6 A;  1PH4 A;  4DAY A;  1NBW A;  2KBN A;  1LAC A;  3D6C A;  3RD4 A;  1W6K A;  1II3 A;  1LT6 D;  3KBX A;  1CA6 A;  1N34 Q;  3H91 A;  2GN5 A;  4LF4 Q;  3M7G A;  3FRP B;  2QDL A;  2WAC A;  4F7X A;  2JA6 H;  4A3G H;  2K5N A;  3H6M A;  1VQK A;  1WJJ A;  1SDF A;  1JOO A;  2RDG A;  2I07 B;  1A63 A;  5IT9 E;  1K83 B;  4B3M L;  5IGE A;  4KY6 A;  4AQY Q;  3GDE A;  1XPU A;  3NUC A;  4LF9 L;  4LF5 Q;  2VUM B;  1QUQ A;  4YCW A;  1NJI C;  1XPR A;  3MEF A;  3RZO H;  1DON A;  4XQJ A;  3KJP A;  4KKT A;  1C8C A;  3AYH B;  3DEO A;  1GXD C;  4CGY B;  5EGT A;  1XTD A;  4CDC C;  4Y7N H;  1A8V A;  2NVY B;  2M2L A;  1S4Z A;  3JAM L;  1Q1E A;  3OHX C;  4R1J A;  1HUM A;  3R8B A;  5A2Q E;  4DAP A;  1TQO A;  1WD1 A;  3SE0 A;  1BBX C;  2B29 A;  1MKH A;  3K0X A;  1EWI A;  2YV5 A;  4DV1 Q;  1U9R A;  1MSH A;  1EU3 A;  3VYS A;  4DK3 C;  4OGQ C;  4IFD J;  5JAV A;  3P1H A;  1OXU A;  4RKB A;  2ZTC A;  2X69 A;  4OL7 A;  2NUC A;  3CKI B;  3T16 A;  4UPA A;  2IX1 A;  4MHE A;  4IFD G;  3AB9 A;  2NN6 H;  1WCM G;  2HD3 A;  3MXN B;  2HQE A;  2JA8 G;  4PMW A;  1GO3 E;  3MFG A;  4HAE A;  3L2P A;  4DR2 Q;  4BBS B;  3RR5 A;  2KJX A;  4DAM A;  5GAG C;  3K6O A;  5CMD A;  1HNW Q;  1YZ6 A;  4NDX A;  2FMC A;  2GVB A;  5M5X B;  1LV9 A;  3DWA A;  3ULP A;  4ZKC B;  4MTK A;  2EYH A;  1TY0 A;  2C9O A;  1PDQ A;  2L11 A;  4R4Q A;  3K5O A;  1VQN A;  2K04 A;  3I73 A;  2LY7 A;  3S14 B;  4RAU C;  3KF8 A;  5E4W C;  1V9P A;  3K7A B;  1Z9F A;  2RSO A;  2PMZ E;  1HUN A;  3SVM A;  1SE2 A;  1VDZ A;  3NBH B;  2OEO A;  2E8G A;  1E0B A;  1MHW C;  5IP9 H;  3T4A C;  5FK9 C;  1VQB A;  4E6I A;  4EQ5 A;  5J22 A;  2UXD L;  3J80 L;  2B2U C;  1M8A A;  2E2H H;  1E22 A;  2XIW A;  4POG A;  2QKI C;  3HKZ E;  3PF4 A;  3I4M G;  4B3R Q;  3SHL A;  2L15 A;  4K6L A;  5CV6 A;  1IBK Q;  1DOM A;  4DV0 L;  2EYF A;  1K3R A;  4DV6 Q;  1O7I A;  3TME A;  3K57 A;  1QNU A;  2UUB L;  1IKM A;  2ID0 A;  4DV5 Q;  2A74 C;  1B70 B;  4OO1 I;  5M3M B;  1TY2 A;  2AWN A;  2DY8 A;  3RZD H;  3HOU G;  3GV6 A;  1X3E A;  5D65 A;  4GOP B;  3ULJ A;  1VQP A;  5C44 H;  5C3E B;  3S24 A;  1EUJ A;  2RCN A;  4PG3 A;  3S2D B;  3NEL A;  4K2L A;  4O1N A;  2NZ1 D;  3W1B A;  4GKJ L;  1B2T A;  1C4Q A;  4CKB A;  1KL9 A;  2CVR A;  3MA2 B;  1GUG A;  1WYD A;  3PO3 B;  3FMC A;  4CKC A;  2BA0 A;  1EZ8 A;  3J81 c;  4MIU A;  3OTO Q;  5E3F A;  1LM0 A;  2KCN A;  1FNV A;  4B08 A;  5C0X I;  3AEV A;  1EFI D;  2Z4H A;  1YHA A;  1HZ9 A;  3I4N G;  4JYA Q;  1QVG A;  2VUM H;  5IYC H;  2F0S A;  5EKI A;  1LTS D;  1WFQ A;  1ENC A;  3S15 H;  5M3F H;  3TS2 A;  5IYD H;  1Q3L A;  2AQ1 B;  3AU7 A;  1NAP A;  1N34 L;  2AKW B;  4A3K G;  2ES2 A;  1C7Y A;  4LF4 L;  1HQM C;  5C4J B;  3CCM A;  2O5I C;  3A55 A;  4IFD H;  1KAA A;  1WCM H;  2JA8 H;  5IWA Q;  1ZYR D;  2WAQ B;  3GTP B;  1JT8 A;  2OCE A;  4Q0F A;  4AQY L;  4CJ1 B;  4L5T A;  4LF5 L;  2WP8 J;  2N55 A;  4HIK A;  4FF1 A;  5M5W B;  3P7J A;  1S3O A;  1PTO C;  4DNI A;  1UEB A;  2F0J A;  2TSS A;  2JA7 G;  1Q8K A;  1DOL A;  2EDG A;  3KF6 A;  5D3D A;  1UWV A;  3ERQ A;  3S16 B;  4K0K Q;  1I6V C;  1R4P B;  2D5D A;  4GLX A;  3UDF A;  1A3V A;  2EJG C;  1BVS A;  4FNF A;  4KK7 A;  5FLX E;  2E5L Q;  1CQF A;  2UXC Q;  4QB4 A;  4ME3 A;  4KKU A;  4ZKB B;  4A3E B;  4BBS H;  1DYQ A;  1SBB B;  2OXP A;  3F2B A;  4QY7 A;  1CT1 D;  1G2T A;  2YTY A;  2KCT A;  3GTK B;  4V19 0;  1TS4 A;  4HSP A;  4HJ5 A;  3CRK C;  3BZC A;  4GS3 A;  1HQR D;  1VF7 A;  1PZI D;  1HRJ A;  2QA4 A;  3GP7 A;  2JP1 A;  1RF2 D;  1K73 C;  3NBI A;  4YWM A;  5DNF A;  2GVA A;  2VXW A;  3MXG A;  4P2C B;  2EXZ A;  4DR2 L;  2NZH A;  3K7U C;  1RD9 D;  4HJ8 A;  4JOI C;  1I94 Q;  5ELD A;  2PQE A;  1O7Y A;  1EL0 A;  2H5X A;  1PLF A;  2Y0S B;  1AZQ A;  4BS9 A;  2HDM A;  3FKI G;  3KBG A;  1K0S A;  3BYT B;  2RA4 A;  4TVA B;  3TN2 A;  1WTQ A;  1YIT A;  3G48 A;  2SNM A;  1EY6 A;  5JJZ A;  4IPD A;  4K5W A;  3IRB A;  3GTJ B;  4G7O C;  4HED A;  4CBV A;  1JWU D;  1GUN A;  4UAI A;  4JI5 Q;  5BN3 A;  2F4I A;  2NYZ D;  3PIO A;  2B2Y C;  4A3B B;  2A6E D;  5IT9 c;  2K14 A;  1CKM A;  1FYC A;  1SYD A;  3OWE B;  3M7N A;  4P73 A;  1B50 A;  4DA2 A;  2ICE C;  2M9V A;  5HGQ A;  3H3V I;  4LF6 L;  4LF8 Q;  3I4N H;  3QJY A;  1KIX A;  1BDO A;  5E1F A;  2Z9H A;  3BU2 A;  2DJG C;  1SNC A;  2F3W A;  4OHJ A;  4B3R L;  1ESR A;  3X3N A;  3BDC A;  4UY8 C;  5C3E H;  1VQ9 A;  2XWB B;  3Q24 A;  1YJW A;  1Y8O B;  1DD2 A;  1O7Z A;  2PZW A;  2L1B A;  4DV6 L;  4A3K H;  4RFB A;  1KLU D;  1MJC A;  3HEJ A;  4IPC A;  5ELF A;  2AWO A;  4WRD A;  5T1G A;  3VR2 A;  1STE A;  4ZK9 B;  2CHB D;  1Y1W B;  2I0Q A;  2ZT9 C;  3MXP A;  5CV4 A;  1SEB D;  4X64 L;  3E0E A;  3M3Y B;  1KC8 C;  2F52 A;  4PMB A;  1EY7 A;  1YJ9 A;  3D4R A;  3F2C A;  2D62 A;  1STY A;  3QOJ A;  4UP8 A;  3OIP A;  2K1B A;  3J7A V;  1I4Q A;  4RG1 A;  3SK8 A;  2VZA A;  3OYY A;  4LNQ A;  2AUJ D;  1JCK B;  5IGC A;  2JA7 H;  2WB1 B;  2X6G A;  2VNU D;  3H09 A;  5JJI A;  2IHE A;  1HH2 P;  2A19 A;  4KD4 A;  3K5N A;  3LWE A;  3STB D;  1JC7 A;  2A6H D;  2HHH L;  4DAV A;  2EXD A;  3S1M H;  1B9N A;  1V8Q A;  5C5L A;  4FO2 A;  4HR7 B;  4JYA L;  2ATW A;  1H95 A;  2KQ3 A;  1UE1 A;  5M5W H;  1F9P A;  1QZG A;  3PMF A;  2DNC A;  1TWH B;  3T56 B;  1N33 L;  2PQA A;  2L55 A;  2JA9 A;  1A15 A;  1C48 A;  4C3J H;  1D1I A;  5FJ8 H;  3S16 H;  2B2V A;  4DK0 A;  1H9J A;  1NY4 A;  1ENF A;  4DNT B;  1NR2 A;  5I4D A;  1LAB A;  1YI2 A;  1E2Z A;  1FNU A;  3L3O C;  3NWT A;  1Y1V G;  1HA6 A;  1WI5 A;  2UUC Q;  1VQ7 A;  1WTR A;  2EOT A;  4C3I G;  1FGU A;  1UUP A;  3CC7 A;  3Q22 A;  3GTK H;  5KNC A;  2RHQ B;  4AIM A;  4C2M B;  1F2M A;  1PYW D;  3HOX H;  4FXK C;  1F2Y A;  1YHQ A;  1CA5 A;  1CSP A;  4K0K L;  3UDX A;  3HKZ B;  1PA6 A;  3CP0 A;  1CKO A;  1B4O A;  1TWC B;  2BDN A;  4OWT B;  3S1R H;  4LF9 Q;  2E5L L;  1H9K A;  5HY6 A;  2DY7 A;  5JJL A;  5T1I A;  1S5C D;  1EQV A;  3H3V H;  1I3Q H;  4AYB G;  1XNR L;  5I2Y A;  4K8I A;  4BY1 B;  1QJO A;  1OO9 B;  1D6E C;  2LKV A;  3WWV A;  3GTO B;  2E2J B;  4RGT A;  2ZM6 L;  2XNA C;  1AW7 A;  1Q82 C;  1S5D D;  5KIX A;  3CPW A;  3J80 i;  4O0A A;  2F0G A;  4JI3 L;  4NXN Q;  3CMA A;  1Z7T A;  1ET6 A;  5KYL A;  3FVQ A;  4GN3 B;  3PUY A;  1AH9 A;  2Z6K A;  3PUV A;  4A3B H;  1I94 L;  1V43 A;  4A3I B;  3A7L A;  2SDF A;  1F2L A;  5GAD C;  2JA6 G;  1L1O A;  3C3L A;  4P75 A;  3S9W A;  1KRT A;  4C3H B;  2PYK A;  5JPM C;  4J6H A;  2GA4 B;  4JI5 L;  5L37 A;  1D5X C;  3G6E A;  3TZD A;  5C4X G;  4S3S A;  4EX5 A;  4X65 Q;  1I50 H;  4C1N I;  2JJQ A;  1Y1W H;  4X3T A;  5CV7 A;  1T9H A;  1TR5 A;  2F0O A;  1XXG A;  1PMR A;  2WAQ E;  4LF8 L;  3PSI A;  4QMG A;  1XNQ Q;  4DK6 C;  4DN4 M;  4JI2 L;  2WKC A;  3K80 C;  4A3D H;  1JIC A;  3NTK A;  3MEH A;  4DV7 Q;  2K5H A;  1C9O A;  1SMY C;  2PW7 A;  4K6D A;  3MZ5 A;  3W5O A;  1RTO A;  3ONA B;  2UXD Q;  2V1C C;  1JJ2 A;  4RCN A;  2JE6 I;  2OTJ A;  3J7Y W;  5FLX c;  3RN5 A;  4FXG C;  1I6H B;  1SYG A;  1SRU A;  1VQA A;  2KA7 A;  1PH7 A;  2RF4 A;  3R3O A;  2N78 A;  1EFW A;  1VQ4 A;  2IW3 A;  3V05 A;  2MP1 A;  4TQU S;  5HUR A;  3BDL A;  1SNM A;  5HGT A;  3IKJ A;  2NN6 G;  1QB5 D;  2R7Z B;  4C3I H;  1D8L A;  2NN6 I;  3CCL A;  1GJX A;  2HCI A;  1PZK D;  4BBR H;  5C5M A;  1VQ8 A;  1F2Z A;  2SNS A;  4NXM Q;  2JA5 B;  2NVT B;  1TWH H;  1XPO A;  4YCV A;  2R3Z A;  5CGK A;  2CWA A;  4DF7 A;  3A74 A;  1KTK A;  3BVM A;  3D4W A;  2XRQ D;  2R92 B;  2H4O A;  3I72 A;  1E2W A;  2VS1 A;  1XTC D;  4KTA A;  4BA1 I;  1G91 A;  3SK6 A;  3S2H B;  2KUM A;  1MBY A;  1EIY B;  1TS3 A;  2Y0S E;  5IP9 G;  2YYZ A;  4K2K A;  2ZXP A;  2F0U A;  4A3M B;  3E5S A;  1BQQ T;  1O7L A;  4F88 A;  2N49 A;  3MAQ A;  3ER0 A;  4RHS A;  5IOC A;  4DUY Q;  1EQQ A;  1CHP D;  1A6X A;  4GN4 B;  4RHR A;  5EPK A;  4DXG A;  1KD1 C;  3SK4 A;  2Z0S A;  4YIJ A;  2UUC L;  3ZYY X;  4BY1 H;  3UDI A;  3G6J B;  4R4O A;  4KD3 A;  4A93 B;  4A3J H;  5I6W A;  2K5V A;  3TS0 A;  4Z9C B;  1PRT C;  4HID A;  3TBI B;  1XJV A;  1X54 A;  2CFM A;  1WTO A;  2DNE A;  4P74 A;  3SEB A;  3CXC A;  2K50 A;  1Y69 U;  1VQO A;  4IOC A;  4TSS A;  5C4X H;  1N36 L;  2G9H D;  1EOV A;  2RDH A;  5C44 G;  4QF4 A;  2NZO A;  1STH A;  1SE3 A;  2SOB A;  3ERS X;  2NVX B;  4KV6 A;  1IYV A;  1WTV A;  3J7Z C;  1Y14 B;  5I2X A;  4BY7 B;  4L8J A;  2MO1 A;  1QNK A;  2QCP X;  3MFY A;  1GUW A;  3D3R A;  5JPN C;  3KDF B;  4DNR B;  1YIJ A;  2JN4 A;  2F0N A;  3T1H L;  3IAY A;  4KKS A;  4JBW A;  1V1P B;  4KN7 C;  3EQL C;  1HJP A;  3SDZ A;  1H9S A;  4RMF A;  2EY5 A;  4X62 Q;  4NXN L;  2UU9 Q;  4PMC A;  4NP5 A;  1LTB D;  3K81 C;  2EE1 A;  3U9O A;  1KQS A;  1ICF B;  2WB1 E;  1JR0 D;  4DR6 L;  2KHJ A;  2VUM G;  5IYC G;  5FKA C;  1SFO H;  1FJG Q;  5M3F G;  1ASZ A;  5IYD G;  2RBM A;  1EU4 A;  3A8K E;  4EQP A;  5A35 A;  3PIO 3;  2XGT A;  3RNU A;  4A3F B;  3KUP A;  4ID6 A;  5M5Y B;  2YTX A;  1YEZ A;  3HOY H;  4RGM A;  5AJ3 Q;  1CZW A;  3HKS A;  2XTI A;  1AN8 A;  2NVQ B;  4IFD I;  2FMM A;  4J15 A;  1X3Q A;  1OXT A;  3HP3 A;  2LS0 1;  1VQF A;  4NW2 A;  4KMU C;  1S5E D;  2RSN A;  4LF7 L;  4X65 L;  4JBJ A;  3TQY A;  1NUC A;  4KHZ A;  5LL6 S;  1TWA B;  3HS0 C;  5KEE A;  2KCC A;  1WTX A;  1QOH A;  1LTT D;  4LUO A;  1ML0 D;  4LUV A;  1XNQ L;  4QUC A;  2K03 A;  2CH4 A;  4DV7 L;  4OIJ A;  3MC0 B;  4XT1 B;  4BBS G;  2RDF A;  1G6P A;  1M4V A;  1AE2 A;  4IPG A;  5IYB G;  4LF6 Q;  2LMC B;  1MJE A;  2N3S A;  4GNX A;  4KLK A;  3H0G H;  3V96 A;  5GAE C;  4I7Z C;  3HOW H;  1NTG A;  2F0H A;  1VQJ A;  1Y8N B;  4C56 C;  4DK1 A;  4B9W A;  3M85 A;  1R9T H;  1EIH A;  1WTH A;  1M1K C;  4ME5 A;  1PYS B;  3NTI A;  3PUX A;  3HOU B;  3CQZ B;  2F0Q A;  4DR4 Q;  4G7Z C;  4DKA C;  1K0R A;  2DGY A;  1DXM A;  4A3M H;  4OX9 Q;  2PZU A;  4NXM L;  4X64 Q;  1P16 A;  3OPO A;  3CCU A;  3I55 A;  3K58 A;  3NEN A;  1A3T A;  3DHQ A;  2D9U A;  1G6Z A;  4HJ7 A;  1RTN A;  4EGV A;  3HGB A;  2H1E A;  1TKW B;  1KAB A;  4A3C H;  2QGQ A;  4GKK L;  1JWM D;  1QWY A;  4XXE A;  1ONL A;  1X65 A;  3RN2 A;  3DWQ A;  3U50 C;  2O5J C;  1Q12 A;  4DFA A;  2HHH Q;  2K7V A;  4DUY L;  1I4P A;  1CKN A;  1HZC A;  1HZB A;  2EYM A;  4DPG A;  1K83 H;  3KLW A;  2F3I A;  3IL8 A;  4ODG A;  3T51 B;  5IY0 A;  4LWC A;  3UE0 A;  4GN5 A;  4NKL A;  2XSC A;  5C3E G;  1O80 A;  1Q46 A;  1N33 Q;  2KEN A;  1XX8 A;  2B2V C;  2CQO A;  4KJN A;  3QIA A;  3OW2 A;  3RUZ A;  1B8A A;  4G57 A;  2NVY H;  4HCE A;  1CSQ A;  1TU2 B;  2IT1 A;  1G8Z D;  2Z6B A;  3PO2 B;  1ZYR C;  3PO3 G;  4ABN A;  1SSO A;  3C46 A;  1BCP C;  5ELB A;  1YNJ C;  3MTS A;  4YWL A;  2RQX A;  4JI8 L;  3AQQ A;  1SNO A;  3C1E A;  1BXT A;  1XMO Q;  3TP8 A;  2KHI A;  2PI2 E;  1LTI D;  4B9X A;  2BDO A;  2IX0 A;  2OTL A;  1GHJ A;  4A3F H;  2B8F A;  5M9O A;  1STN A;  3E0J A;  1MGS A;  3A7A B;  2G9D A;  3VR5 A;  4RWS C;  2CQA A;  1PTO B;  4X62 L;  1NE3 A;  4L6T B;  2UUA Q;  1D1K A;  2UU9 L;  1KNA A;  2BH8 A;  1U4L A;  1GUS A;  2WAQ G;  3W1G A;  3TRE A;  3SR1 A;  1XNR Q;  3K8A A;  4IPH A;  2B8G A;  1RCV D;  1H9M A;  3OSO A;  3KK7 A;  3L0O A;  3PUW A;  1PTO D;  1J5E L;  5IYB H;  4L5R C;  3GTQ B;  1JOQ A;  3A54 A;  3QB3 A;  3CRL C;  3ND8 A;  5M5X H;  5JVG 3;  1QIL A;  4GZY C;  4PZ8 A;  2ZM6 Q;  1FJG L;  1DZ1 A;  4K5X A;  1EZ6 A;  1PTO F;  2AUK A;  2F0M A;  2Q2U A;  3S14 H;  1B44 D;  4JI3 Q;  2J4X A;  4IUV A;  5AJ3 L;  3K7A H;  3EBE A;  4C3J G;  5FJ8 G;  1M90 C;  2Z6K C;  2FXQ A;  3EA6 A;  5JVH 3;  1OTC A;  3TP6 A;  4PZ7 A;  1Q7Y C;  1D5Z C;  1ZEQ X;  3J81 L;  2MGS A;  3B6Y A;  3A5U A;  2EPB A;  2K5D A;  3H3V C;  3MXN A;  2OWO A;  2VQF L;  4LK1 C;  3JAM E;  5FLM H;  1L1O C;  5EQ0 A;  2JXM B;  4ZUI A;  2M00 A;  3AMU A;  4HTH A;  3D6W A;  2EYJ A;  1IW7 C;  2ZTD A;  1PH8 A;  2A73 B;  3HOX G;  2Q8R E;  4KHV A;  1IL2 A;  1E2V A;  3WOF A;  1BO0 A;  1PFN A;  5CR3 A;  1VQM A;  5IOD A;  3KFU A;  5LMU Q;  4DUZ L;  1D2B A;  1LT3 D;  3FPP A;  5ELE A;  1S40 A;  1SE8 A;  2R6G A;  4DGZ A;  3J81 j;  2K05 A;  1EY4 A;  3LGJ A;  3NBH A;  5CBA E;  4DU9 A;  5DEH A;  5M3M H;  2Y0S G;  3MVV A;  4CJ0 B;  2KCM A;  4HSV A;  4JI2 Q;  5CC4 A;  2JEA I;  4IO9 A;  2J7Z A;  4X3U A;  5IE8 A;  4LFB L;  5I9P A;  1SLJ A;  3S2D H;  4FVM A;  2WII B;  5JEA J;  4DR4 L;  4ILW A;  4A3B G;  4HN7 A;  5EBD A;  3PO3 H;  1ICW A;  4OX9 L;  3ND9 A;  4JV5 L;  4TKO B;  1JE5 A;  4DR1 L;  1PH5 A;  4QIW E;  1BNZ A;  4LUZ A;  4DR7 Q;  1QVF A;  1BOS A;  3V2T A;  5C3W A;  1GUT A;  4EQO A;  3FPU B;  5LHY 1;  2AQ3 B;  3D8G A;  3LWU A;  3J80 E;  3VYT A;  2L5T A;  3EIV A;  4GOP A;  3OOC A;  2R7F A;  3PIP 3;  2QDB A;  4MN3 A;  3O13 A;  1SNP A;  1PH6 A;  4GLA C;  3VYU A;  5C4J H;  3AFP A;  1ILQ A;  1B53 A;  1IKL A;  4X66 L;  5EKL A;  3M4Q A;  3G4S A;  1Y1W G;  1LYL A;  4DR3 Q;  1KNE A;  3GTP H;  2LXJ A;  4B3S Q;  3MHB A;  1PXU A;  3I2Z A;  4HIO A;  2F0K A;  2A1A A;  1D5M C;  5CBE E;  3K5M A;  1LO5 D;  4A3D G;  1HFN A;  3DLL A;  1KDC A;  4H13 C;  1VS0 A;  2JYO A;  1Y8P B;  3PV0 A;  3HRZ C;  3S1N B;  2MUY A;  3DUZ A;  2B63 B;  1EQT A;  1BF4 A;  2LSS A;  2JK8 A;  1PH9 A;  1E1O A;  4ZLT F;  1HR0 L;  2BE5 C;  2HUG A;  1Y1V B;  1ESF A;  2CCZ A;  5IT9 L;  4XDX A;  4XT3 B;  4EQN A;  1PTO H;  2XN9 C;  4UP9 A;  4KY7 A;  4OWW B;  4A3E H;  1L0W A;  2HT1 A;  3M4O B;  1U4M A;  1HNZ Q;  2VB2 X;  4DAY B;  4FYD A;  3NP8 A;  1YNN C;  2AHO B;  1WVL A;  1DCZ A;  3HG9 A;  4DV4 Q;  1JMC A;  5D3I B;  4Y52 H;  1EIG A;  3EN2 A;  1XMO L;  4PNY A;  1EWC A;  1UAP A;  4R8I A;  4BBR G;  3KJO A;  3M4Y A;  4N9P A;  4A4I A;  1EEF D;  3F8T A;  3BS1 A;  4M1U B;  4K14 A;  2IJ0 A;  1LTG D;  4R4I A;  1N36 Q;  5A2Q L;  2YTV A;  5BN5 A;  1I5F A;  1RKN A;  2UUA L;  1L2F A;  1B1Z A;  4JI4 L;  1UE6 A;  1X56 A;  1QUQ B;  4C1N K;  1RJT A;  3SGI A;  3OMC A;  2ALY B;  3T1H Q;  1EYA A;  2NTS A;  4CHT B;  2ENB A;  4OEM B;  3KLR A;  5FO7 B;  1Q81 C;  5ELO A;  3EJI A;  4L5Q A;  1T5E A;  4LFC L;  3DM1 A;  2I5M X;  4RA8 A;  1YVC A;  3HKZ G;  3GTJ H;  1WTP A;  3BDO A;  2B2W A;  4DR6 Q;  1E3P A;  2I5L X;  1BR9 A;  1JB3 A;  1U4R A;  5CV5 A;  3TP7 A;  4A3G B;  3U58 A;  5JEA H;  1ENA A;  5ELN A;  4BY1 G;  1I4R A;  2MO0 A;  3GTM B;  1AE3 A;  1EWH A;  1U0L A;  4L63 B;  4A3J G;  4JPB W;  3LNN A;  2EJM A;  3FHW A;  2EVB A; 
#chains in the Genus database with same CATH homology
 3W2D A;  2F0V A;  1FNW A;  5KNB A;  4IUT A;  2IWH A;  3GO5 A;  4Y7N B;  4EVO A;  3EFX D;  1H9R A;  1Z47 A;  2A68 C;  1VMC A;  2D2C C;  4ZAI A;  4OIK A;  2R93 B;  1QG7 A;  5EPL A;  2CW0 C;  2A69 C;  3L9A X;  2BOS A;  3HOV B;  1IHZ A;  2J0T D;  3EVQ A;  3L7Z C;  3R2I A;  2E2D C;  4C3H G;  1F9S A;  4FF3 A;  4PV1 C;  1JQY D;  4KN4 C;  4HCS A;  5FOB B;  5CYU A;  2F1M A;  4BA2 I;  3HOZ B;  1HHV A;  4ULL A;  4TRD A;  1S5B D;  2SEB D;  2ZXR A;  2IPK D;  4WJW A;  1IL8 A;  1SMY D;  2X6L A;  1TWF B;  1U4P A;  3VYR A;  1UNS A;  4RGN A;  2KED A;  2HDL A;  2O2L D;  4R9W A;  2F0P A;  5E4X A;  1AEX A;  2JSO A;  1KLG D;  1G2S A;  2FIN B;  2IX3 A;  5EPJ A;  2MJ8 A;  5C6A A;  1TWG B;  1NCV A;  2KHS A;  2E2H B;  3GV3 A;  3MXU A;  1WTW A;  4JK1 C;  5G3L D;  1AFP A;  1VF5 C;  3MWY W;  1L0Y B;  3NQI A;  4IQZ A;  2F03 A;  1PFB A;  5G3L F;  4RGO S;  1K8O A;  3RLF A;  3NWS A;  1RDP D;  2ICI A;  3R93 A;  1EOT A;  2KVM A;  3RZD B;  3DMU A;  5ISR A;  2VB3 X;  1X32 A;  1WD0 A;  3WDN A;  5C44 B;  1CFM A;  5IIF A;  1ROD A;  3VA5 A;  2EY2 A;  2FJ2 A;  1EY0 A;  5FLX L;  2F0F A;  1STB A;  3PUZ A;  1PRT B;  1SJH D;  1F9R A;  2PCF B;  2V4D A;  1PRT D;  3DEP A;  3TSS A;  4LJZ C;  1B3A A;  4QIW B;  3I91 A;  3A8I E;  3NPP A;  2EJF C;  1PRT F;  1VCI A;  2E74 C;  3S15 B;  5M3F B;  3IFT A;  2QEJ C;  5DM6 3;  2XRS D;  1BUV T;  4QUF A;  1GOZ A;  3NXW A;  2B2T A;  4NMZ A;  4IUR A;  1WCM B;  1EYD A;  3BVG A;  2JA8 B;  4IZ8 A;  2N88 A;  2NWG A;  4UDU C;  2PO4 A;  3TDQ A;  1J9O A;  2E76 C;  3LX0 A;  3VA7 A;  4FF4 A;  5EBC A;  2A5H A;  2EY1 A;  1GHK A;  1W6J A;  5C4H A;  1TVX A;  1O78 A;  1EY9 A;  4CKE A;  3URY A;  2KEC A;  2Q8T A;  1I4H A;  2EYO A;  2B39 A;  4FF2 A;  1JOK A;  3H94 A;  3N52 A;  2EZV A;  5DM7 3;  4ZYS A;  3K59 A;  1PFM A;  1LT4 D;  3I4M B;  4BWG B;  4R8N A;  3FEW X;  3HZX A;  1AP0 A;  3DWP A;  1HA5 A;  4HMJ A;  2MHV A;  3IFD A;  4IUU A;  1L0X B;  2DN8 A;  2OT2 A;  3P75 A;  1S5F D;  3CU7 A;  1EY5 A;  1Z6H A;  5COY A;  1HTP A;  3Q6S A;  1TS5 A;  2OF1 A;  5ELC A;  3WOE A;  4QCL A;  1EEI D;  1LTA D;  1B9M A;  3I4L A;  1J8I A;  4H44 C;  2KEE A;  1T5X D;  3X3M A;  2Z1C A;  5K36 G;  5FO8 B;  1JE4 A;  2L12 A;  3D4D A;  3GTG B;  3D31 A;  3OW7 A;  4RCO A;  1CTM A;  3W3A A;  4OO1 G;  5J1Z A;  2ZXO A;  4LMQ D;  3NSW A;  4IUP A;  2XVS A;  3I4N B;  1FGB D;  3VR6 A;  1OXX K;  3T53 B;  1LLR D;  2PPB C;  2Z4I A;  4A3K B;  5C0X J;  3OIQ A;  3I70 A;  2HCC A;  4IUN A;  5EKK A;  5C0X G;  1Q1B A;  3KLS A;  1EY8 A;  4IAL A;  1IYU A;  5IGB A;  1SAP A;  1SNQ A;  2NBF A;  3I8Z A;  1QCB D;  3S17 B;  3NHH A;  2F0W A;  3BZD B;  3RMH A;  4G7H C;  2JA7 B;  1DOK A;  3QWN A;  3CHB D;  4H0L C;  4G4K A;  3A56 A;  3GD7 A;  1BCP B;  1SYF A;  3S1M B;  2BCO A;  4U68 A;  2K5Q A;  4X3K A;  4XYQ A;  4CJ2 C;  1BCP D;  4KI0 A;  4N9T A;  1YNJ D;  5LL6 X;  4H7B A;  2YU9 B;  3GTL B;  3Q23 A;  5IGF A;  2RKS A;  1BCP F;  4HMI A;  2IL8 A;  1V1P A;  4ZRZ A;  1KDA A;  2Z8L A;  1KDB A;  4C3J B;  1CQV A;  4WOR A;  1SND A;  1GUO A;  2C5C A;  4Q5V A;  3QG1 A;  1QE6 A;  2B2W C;  1STA A;  3BVZ A;  3FKI B;  1DM0 B;  5I9O A;  3C1F A;  3HOX B;  5K36 H;  3K0Y A;  2K28 A;  3S1R B;  4RKL A;  5DAU A;  2AQ2 B;  4OO1 H;  1I3Q B;  1DJR D;  4J8Q A;  1HFG A;  1STG A;  4FXD A;  2A6E C;  1HCZ A;  2EYL A;  1IW7 D;  1HTL D;  5F2D A;  2L0C A;  2K6A A;  3GQB A;  5JOB A;  4M8A A;  4F87 A;  5C0X H;  3E6Z X;  2FFK B;  1EYC A;  1HXY D;  2B2U A;  4IUQ A;  1SYB A;  5JEA G;  2NB0 A;  3SXH A;  5C3X A;  3NQT A;  1A2T A;  3OWF A;  3TZU A;  1SYE A;  1K8M A;  1HPC A;  1TS2 A;  1I50 B;  5FO9 B;  4LAA A;  2PNR C;  2O4X A;  1UEA B;  3S1Q B;  3ERO A;  2WV6 D;  2QF7 A;  2A6H C;  5KND A;  4A3D B;  1LT5 D;  4K5V A;  3VR4 A;  4DXF A;  1FR3 A;  3U9S A;  2E75 C;  1Q90 A;  4XQQ A;  1SXT A;  2F0E A;  3NTH A;  2L4N A;  1CI3 M;  1XWE A;  5I6Y A;  4V0B A;  2L9H A;  2F0T A;  3SK5 A;  1G29 1;  1CM9 A;  1MD2 D;  3Q0A A;  1SJE D;  1A2U A;  1NSN S;  4ZUJ A;  2K33 A;  4C3I B;  4F8M A;  3FDT A;  3KLS X;  5EJW A;  4BBR B;  3NK9 A;  5BN4 A;  3F2U A;  2BA1 A;  2K5W A;  2BE5 D;  1VMP A;  1XYI A;  2FHT A;  4AYB B;  3QOL A;  2PMZ B;  2E2I B;  5IGD A;  3NE5 B;  5J39 A;  2JEB I;  5COR A;  1ZKO A;  2WKD A;  2F0I A;  1I4G A;  1YNN D;  4XTC S;  1MSG A;  2K32 A;  3TP5 A;  1X3P A;  2Q8I B;  4U67 3;  4IN3 A;  2RVL A;  1TII D;  1R4Q B;  2B2T C;  2F3V A;  3T13 A;  5CV8 A;  3P20 A;  2EY6 A;  1H9S B;  5D14 A;  4A3J B;  3N6R A;  3QO2 A;  2JA6 B;  5NUC A;  4KJO A;  4O42 A;  2KOL A;  5KGU A;  2QIL A;  4WFN 3;  5C4X B;  1OXV A;  3RZO B;  2MPM A;  3BYY B;  2XWJ B;  3R2T A;  4XYO A;  5TSS A;  3VR3 A;  5K5P A;  4K8J A;  1F77 A;  3J81 E;  4XQN A;  5AFW A;  2K01 A;  2R61 A;  5C4Z A;  1SFO B;  2B2Y A;  2LFN A;  1OXS C;  1JOR A;  2A68 D;  1AZP A;  2F0D A;  4I65 A;  1ZXT A;  3ITP A;  5KRU A;  3HOY B;  1V1O A;  2WIN B;  2I46 A;  3A8J E;  1LTR D;  1RHP A;  3UI2 A;  2CW0 D;  2A69 D;  3J7A F;  4PQX A;  3K5L A;  1F9Q A;  1NR4 A;  1MI2 A;  2F0L A;  1A3U A;  4FP5 D;  1CZG A;  5CV9 A;  1PZJ D;  1I4X A;  3DXJ C;  4KY5 A;  3BG3 A;  5IGG A;  3C2P A;  3I90 A;  1CHQ D;  4X3S A;  2EYP A;  1SYC A;  1SE4 A;  3I3C A;  2TMP A;  2PW5 A;  2NTT A;  3H0G B;  3HOW B;  1R9T B;  1JWS D;  3OMG A;  1FD7 D;  1CK1 A;  4XIG S;  1Q8I A;  1ILP A;  5KYI A;  1TT2 A;  3G7L A;  2PZT A;  1ET9 A;  4ZQ3 A;  4J1M A;  4RH6 A;  4DAY A;  1LAC A;  3D6C A;  3RD4 A;  1W6K A;  1II3 A;  1LT6 D;  3KBX A;  1CA6 A;  3H91 A;  3M7G A;  3FRP B;  4F7X A;  2WAC A;  3H6M A;  2RDG A;  1SDF A;  1JOO A;  2I07 B;  5IT9 E;  1K83 B;  5IGE A;  4KY6 A;  3NUC A;  2VUM B;  1DON A;  4XQJ A;  4KKT A;  1C8C A;  3DEO A;  1GXD C;  4CGY B;  5EGT A;  2NVY B;  2M2L A;  1S4Z A;  3JAM L;  1Q1E A;  3OHX C;  1HUM A;  3R8B A;  5A2Q E;  4DAP A;  1TQO A;  1WD1 A;  3SE0 A;  1BBX C;  1U9R A;  1MSH A;  1EU3 A;  3VYS A;  4OGQ C;  4IFD J;  5JAV A;  1OXU A;  3P1H A;  4RKB A;  2X69 A;  4OL7 A;  2NUC A;  3CKI B;  3T16 A;  2IX1 A;  4MHE A;  4IFD G;  2NN6 H;  3AB9 A;  2HQE A;  4PMW A;  3MFG A;  4HAE A;  4BBS B;  2KJX A;  3K6O A;  5CMD A;  4NDX A;  2FMC A;  5M5X B;  1LV9 A;  3DWA A;  4ZKC B;  2EYH A;  1TY0 A;  2C9O A;  1PDQ A;  2L11 A;  3K5O A;  2K04 A;  3I73 A;  2LY7 A;  3S14 B;  4RAU C;  3KF8 A;  5E4W C;  3K7A B;  2RSO A;  1HUN A;  3SVM A;  1SE2 A;  1VDZ A;  2OEO A;  1E0B A;  3T4A C;  5FK9 C;  4E6I A;  5J22 A;  3J80 L;  2B2U C;  1M8A A;  2XIW A;  2QKI C;  3SHL A;  4K6L A;  5CV6 A;  1DOM A;  2EYF A;  3TME A;  3K57 A;  1QNU A;  1IKM A;  2ID0 A;  2A74 C;  4OO1 I;  5M3M B;  1TY2 A;  2AWN A;  2DY8 A;  3GV6 A;  5D65 A;  5C3E B;  3S2D B;  4K2L A;  4O1N A;  2NZ1 D;  1B2T A;  1C4Q A;  4CKB A;  2CVR A;  3MA2 B;  1GUG A;  3PO3 B;  3FMC A;  4CKC A;  2BA0 A;  1EZ8 A;  4MIU A;  5E3F A;  2KCN A;  1FNV A;  4B08 A;  5C0X I;  1EFI D;  2Z4H A;  2F0S A;  5EKI A;  1LTS D;  1ENC A;  1Q3L A;  2AQ1 B;  3AU7 A;  1NAP A;  1HQM C;  5C4J B;  2O5I C;  3A55 A;  4IFD H;  1KAA A;  1ZYR D;  2WAQ B;  3GTP B;  4Q0F A;  4CJ1 B;  2WP8 J;  2N55 A;  4FF1 A;  5M5W B;  3P7J A;  1PTO C;  2F0J A;  2TSS A;  1DOL A;  2EDG A;  5D3D A;  3ERQ A;  3S16 B;  1I6V C;  1R4P B;  2D5D A;  1A3V A;  2EJG C;  4FNF A;  4KK7 A;  5FLX E;  1CQF A;  4QB4 A;  4KKU A;  4ZKB B;  4A3E B;  1DYQ A;  1SBB B;  2OXP A;  1CT1 D;  1G2T A;  3GTK B;  4V19 0;  1TS4 A;  4HSP A;  3CRK C;  1HQR D;  1VF7 A;  1PZI D;  1HRJ A;  3GP7 A;  2JP1 A;  1RF2 D;  3NBI A;  5DNF A;  2VXW A;  3MXG A;  4P2C B;  2EXZ A;  1RD9 D;  5ELD A;  2PQE A;  1O7Y A;  1EL0 A;  1PLF A;  2Y0S B;  1AZQ A;  4BS9 A;  2HDM A;  3KBG A;  3BYT B;  2RA4 A;  3TN2 A;  1WTQ A;  2SNM A;  1EY6 A;  5JJZ A;  4K5W A;  3GTJ B;  4G7O C;  4HED A;  4CBV A;  1JWU D;  1GUN A;  4UAI A;  5BN3 A;  2F4I A;  2NYZ D;  2B2Y C;  4A3B B;  2A6E D;  1FYC A;  1SYD A;  3OWE B;  3M7N A;  1B50 A;  4DA2 A;  2ICE C;  2M9V A;  3QJY A;  1BDO A;  5E1F A;  1SNC A;  2F3W A;  4OHJ A;  1ESR A;  3X3N A;  3BDC A;  2XWB B;  3Q24 A;  1DD2 A;  1Y8O B;  1O7Z A;  2PZW A;  2L1B A;  4RFB A;  1KLU D;  3HEJ A;  5ELF A;  2AWO A;  4WRD A;  5T1G A;  3VR2 A;  1STE A;  4ZK9 B;  2CHB D;  1Y1W B;  2ZT9 C;  3MXP A;  5CV4 A;  1SEB D;  3M3Y B;  4PMB A;  1EY7 A;  3D4R A;  2D62 A;  1STY A;  3QOJ A;  3OIP A;  2K1B A;  3J7A V;  1I4Q A;  3SK8 A;  2AUJ D;  1JCK B;  5IGC A;  2WB1 B;  2X6G A;  2VNU D;  3H09 A;  4KD4 A;  3K5N A;  3LWE A;  1JC7 A;  2A6H D;  4DAV A;  1B9N A;  1V8Q A;  5C5L A;  4FO2 A;  4HR7 B;  2KQ3 A;  1F9P A;  3PMF A;  2DNC A;  1TWH B;  3T56 B;  2L55 A;  1A15 A;  1C48 A;  1D1I A;  2B2V A;  4DK0 A;  1H9J A;  1ENF A;  4DNT B;  1NR2 A;  5I4D A;  1LAB A;  1E2Z A;  1FNU A;  3L3O C;  3NWT A;  1HA6 A;  1WTR A;  2EOT A;  4C3I G;  1UUP A;  3Q22 A;  5KNC A;  4C2M B;  1F2M A;  1PYW D;  4FXK C;  1F2Y A;  1CA5 A;  3HKZ B;  2BDN A;  1B4O A;  1TWC B;  1H9K A;  2DY7 A;  5T1I A;  1S5C D;  1EQV A;  5I2Y A;  4K8I A;  4BY1 B;  1QJO A;  1OO9 B;  1D6E C;  2LKV A;  3GTO B;  2E2J B;  4RGT A;  2XNA C;  1AW7 A;  1S5D D;  5KIX A;  2F0G A;  1Z7T A;  1ET6 A;  5KYL A;  3FVQ A;  3PUY A;  3PUV A;  1V43 A;  4A3I B;  3A7L A;  2SDF A;  1F2L A;  3C3L A;  3S9W A;  4C3H B;  2PYK A;  5JPM C;  4J6H A;  2GA4 B;  1D5X C;  3TZD A;  4S3S A;  4C1N I;  4X3T A;  5CV7 A;  1TR5 A;  2F0O A;  1XXG A;  1PMR A;  4QMG A;  4DN4 M;  2WKC A;  1JIC A;  3NTK A;  3MEH A;  1SMY C;  2PW7 A;  4K6D A;  3MZ5 A;  1RTO A;  3ONA B;  4RCN A;  2JE6 I;  3J7Y W;  4FXG C;  1I6H B;  1SYG A;  2KA7 A;  3R3O A;  2IW3 A;  3V05 A;  2MP1 A;  4TQU S;  5HUR A;  3BDL A;  1SNM A;  5HGT A;  3IKJ A;  2NN6 G;  1QB5 D;  2R7Z B;  2NN6 I;  1GJX A;  2HCI A;  1PZK D;  5C5M A;  1F2Z A;  2SNS A;  2JA5 B;  2NVT B;  5CGK A;  2R3Z A;  4DF7 A;  1KTK A;  3BVM A;  3D4W A;  2XRQ D;  2R92 B;  2H4O A;  3I72 A;  1E2W A;  4KTA A;  1XTC D;  4BA1 I;  1G91 A;  3SK6 A;  3S2H B;  2KUM A;  1MBY A;  1TS3 A;  2YYZ A;  4K2K A;  2ZXP A;  2F0U A;  4A3M B;  3E5S A;  1BQQ T;  1O7L A;  4F88 A;  3MAQ A;  4RHS A;  5IOC A;  1CHP D;  1A6X A;  4RHR A;  5EPK A;  4DXG A;  3SK4 A;  4YIJ A;  3ZYY X;  3G6J B;  4KD3 A;  4A93 B;  5I6W A;  4Z9C B;  1PRT C;  3TBI B;  1WTO A;  2DNE A;  3SEB A;  1Y69 U;  4TSS A;  2G9H D;  2RDH A;  4QF4 A;  1STH A;  1SE3 A;  2SOB A;  2NVX B;  4KV6 A;  1IYV A;  1WTV A;  5I2X A;  4BY7 B;  4L8J A;  1QNK A;  2QCP X;  3MFY A;  1GUW A;  3D3R A;  5JPN C;  4DNR B;  2F0N A;  3IAY A;  4KKS A;  4JBW A;  1V1P B;  4KN7 C;  3EQL C;  3SDZ A;  1H9S A;  2EY5 A;  4PMC A;  4NP5 A;  1LTB D;  2EE1 A;  3U9O A;  1JR0 D;  5FKA C;  2RBM A;  1EU4 A;  3A8K E;  4EQP A;  5A35 A;  3PIO 3;  4A3F B;  3KUP A;  4ID6 A;  5M5Y B;  4RGM A;  1CZW A;  1AN8 A;  2NVQ B;  4IFD I;  2FMM A;  1X3Q A;  1OXT A;  3HP3 A;  2LS0 1;  4NW2 A;  4KMU C;  1S5E D;  2RSN A;  1NUC A;  4KHZ A;  5LL6 S;  1TWA B;  3HS0 C;  5KEE A;  2KCC A;  1WTX A;  1QOH A;  1LTT D;  1ML0 D;  4QUC A;  2K03 A;  4OIJ A;  3MC0 B;  4XT1 B;  2RDF A;  1M4V A;  2LMC B;  3V96 A;  4I7Z C;  2F0H A;  1Y8N B;  4C56 C;  4DK1 A;  4B9W A;  3M85 A;  1EIH A;  4ME5 A;  3NTI A;  3PUX A;  3HOU B;  3CQZ B;  2F0Q A;  4G7Z C;  1DXM A;  2PZU A;  3OPO A;  3K58 A;  1A3T A;  3DHQ A;  2D9U A;  1G6Z A;  1RTN A;  4EGV A;  3HGB A;  2H1E A;  1TKW B;  1KAB A;  1JWM D;  1QWY A;  4XXE A;  1ONL A;  3DWQ A;  2O5J C;  1Q12 A;  4DFA A;  2K7V A;  1I4P A;  2EYM A;  3IL8 A;  4ODG A;  3T51 B;  4NKL A;  2XSC A;  1O80 A;  1XX8 A;  2B2V C;  4KJN A;  3QIA A;  3RUZ A;  4G57 A;  4HCE A;  1TU2 B;  2IT1 A;  1G8Z D;  3PO2 B;  1ZYR C;  4ABN A;  1SSO A;  3C46 A;  1BCP C;  5ELB A;  1YNJ C;  3MTS A;  2RQX A;  3C1E A;  1SNO A;  1BXT A;  3TP8 A;  1LTI D;  4B9X A;  2BDO A;  2IX0 A;  1GHJ A;  2B8F A;  5M9O A;  1STN A;  3E0J A;  1MGS A;  3A7A B;  2G9D A;  3VR5 A;  4RWS C;  2CQA A;  1PTO B;  4L6T B;  1D1K A;  1KNA A;  1U4L A;  1GUS A;  3SR1 A;  2B8G A;  1RCV D;  1H9M A;  3OSO A;  3KK7 A;  3GTQ B;  3PUW A;  1PTO D;  1JOQ A;  3A54 A;  3QB3 A;  3CRL C;  3ND8 A;  5JVG 3;  1QIL A;  4GZY C;  1DZ1 A;  4K5X A;  1EZ6 A;  1PTO F;  2AUK A;  2F0M A;  1B44 D;  2J4X A;  4IUV A;  4C3J G;  3EA6 A;  5JVH 3;  3TP6 A;  1D5Z C;  1ZEQ X;  3J81 L;  2MGS A;  2EPB A;  2K5D A;  3H3V C;  3MXN A;  4LK1 C;  3JAM E;  5EQ0 A;  2JXM B;  4ZUI A;  2M00 A;  3AMU A;  4HTH A;  3D6W A;  2EYJ A;  1IW7 C;  2A73 B;  2Q8R E;  4KHV A;  1E2V A;  3WOF A;  1BO0 A;  1PFN A;  5CR3 A;  5IOD A;  1D2B A;  1LT3 D;  3FPP A;  5ELE A;  2R6G A;  4DGZ A;  2K05 A;  1EY4 A;  3NBH A;  5CBA E;  4DU9 A;  5DEH A;  3MVV A;  4CJ0 B;  4HSV A;  5CC4 A;  2JEA I;  2J7Z A;  4X3U A;  5I9P A;  4FVM A;  2WII B;  5JEA J;  4ILW A;  4HN7 A;  5EBD A;  1ICW A;  3ND9 A;  4TKO B;  1BNZ A;  1BOS A;  3V2T A;  5C3W A;  1GUT A;  4EQO A;  3FPU B;  5LHY 1;  2AQ3 B;  3D8G A;  3LWU A;  3J80 E;  3VYT A;  2L5T A;  3OOC A;  3PIP 3;  2QDB A;  4MN3 A;  3O13 A;  1SNP A;  3VYU A;  1ILQ A;  1B53 A;  1IKL A;  5EKL A;  1KNE A;  3MHB A;  1PXU A;  2F0K A;  1D5M C;  5CBE E;  3K5M A;  1LO5 D;  1HFN A;  1KDC A;  4H13 C;  2JYO A;  1Y8P B;  3PV0 A;  3HRZ C;  3S1N B;  2MUY A;  3DUZ A;  2B63 B;  1EQT A;  1BF4 A;  4ZLT F;  2BE5 C;  2HUG A;  1Y1V B;  1ESF A;  5IT9 L;  4XDX A;  4XT3 B;  4EQN A;  1PTO H;  2XN9 C;  4KY7 A;  3M4O B;  1U4M A;  2VB2 X;  4FYD A;  1YNN C;  3NP8 A;  1WVL A;  1DCZ A;  3HG9 A;  5D3I B;  1EIG A;  4PNY A;  1EWC A;  1UAP A;  4R8I A;  3M4Y A;  4N9P A;  1EEF D;  3BS1 A;  4M1U B;  4K14 A;  2IJ0 A;  1LTG D;  5A2Q L;  5BN5 A;  1RKN A;  1B1Z A;  4C1N K;  1RJT A;  3OMC A;  1EYA A;  2NTS A;  4CHT B;  2ENB A;  3KLR A;  5FO7 B;  3EJI A;  1T5E A;  3DM1 A;  4RA8 A;  1WTP A;  3BDO A;  2B2W A;  1BR9 A;  1JB3 A;  1U4R A;  5CV5 A;  3TP7 A;  4A3G B;  5JEA H;  1ENA A;  1I4R A;  3GTM B;  1EWH A;  4L63 B;  3LNN A;  2EJM A;  2EVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...