1HUMA

Solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
b'APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA
publication title High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine(chemotactic)
total genus 10
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1humA00
2FMMA 4R8IA 1LV9A 1MI2A 2MGSA 1DONA 1IKLA 2KOLA 5EJWA 5EPLA 4ZKBB 3DM1A 1G6ZA 4IUVA 4IUPA 1GUWA 1VMCA 2FFKB 1U4PA 2JYOA 2B2TA 2BDNA 4X3TA 5CMDA 1WVLA 1DOMA 2HDMA 4ZKCB 2IL8A 2K1BA 4HAEA 5CBAE 2VXWA 3F2UA 1EL0A 1F9RA 1M8AA 1QG7A 5AFWA 1WTQA 4ZLTF 5E4WC 2L12A 2MPMA 4CJ1B 2X6LA 1X32A 1ILPA 2MP1A 4IUQA 5EPJA 3SVMA 1HRJA 2KECA 2X6GA 4ZK9B 4X3UA 3MTSA 5JJZA 2HCIA 1PFBA 1SSOA 1DOKA 1Q3LA 4HSVA 2X69A 1O80A 1PFNA 2NZ1D 2L4NA 1WD1A 2HCCA 1EQTA 1RHPA 1NR4A 4IURA 1F9SA 1WTOA 3I90A 2FINB 1BBXC 3KBXA 4U68A 5D65A 3Q6SA 4O42A 2RSNA 5EQ0A 1HHVA 3IL8A 1G2TA 4UAIA 1C8CA 1WTRA 1B53A 1S4ZA 1J9OA 1NCVA 1TVXA 2B2YC 2K04A 5T1IA 2NWGA 3FDTA 4IUTA 2MJ8A 1WTWA 1XX8A 1O7ZA 1NR2A 1E0BA 1QNKA 1CM9A 4RWSC 3TN2A 1ZXTA 5E4XA 2B2VC 3HP3A 1B2TA 3KUPA 1ESRA 3P7JA 3GV6A 4RAUC 4CJ2C 1HUNA 1JE4A 3D6WA 2EPBA 1EIHA 1NAPA 1PLFA 4QUFA 1RJTA 1U4RA 5COYA 5DNFA 1IL8A 2B2WC 1U4MA 1HFGA 2EOTA 1QE6A 1U4LA 2K28A 3LWEA 4DN4M 1HFNA 4OIKA 1PDQA 2K01A 4R9WA 2SDFA 1RODA 5D14A 2KEEA 2N88A 1F9PA 3DEOA 2B2UC 3H91A 5CBEE 1ML0D 1JICA 1BF4A 2L1BA 1G2SA 2J7ZA 3MWYW 3N52A 3UI2A 3TZDA 1B4OA 3ONAB 1WTPA 2L11A 4LMQD 2B2TC 3I8ZA 1PFMA 2RVLA 1EIGA 2KEDA 4HEDA 2KUMA 1WTXA 1KNAA 4RA8A 1F2LA 2DY8A 2RSOA 4IUUA 1DZ1A 5EKIA 1KNEA 2N55A 1RTOA 3I91A 2M2LA 1IKMA 3GV3A 1X3QA 1ICWA 2XIWA 1B3AA 2FJ2A 2FHTA 1BO0A 1O7YA 1DOLA 1HUMA 1VMPA 2R3ZA 2NYZD 3I3CA 2CVRA 3QO2A 4OIJA 4XT3B 5EPKA 2K05A 1CA6A 1AP0A 1B50A 2Q8RE 4XT1B 2DY7A 2EE1A 1MSHA 3R93A 1WD0A 3IFDA 2B2YA 4QUCA 2HDLA 5T1GA 1J8IA 2L9HA 3DEPA 1HA6A 5CORA 3FPUB 2JP1A 2B2VA 4MHEA 4NW2A 1AZQA 1F9QA 4X3KA 4X3SA 2RA4A 1G91A 1XYIA 2KVMA 1AZPA 1SDFA 1EOTA 1MSGA 2B2WA 1ILQA 1MGSA 1A15A 2D9UA 1X3PA 2H1EA 4XDXA 4MN3A 1RTNA 1WTVA 3G7LA 4ZAIA 2K03A 4CJ0B 4HCSA 2HUGA 2Q8TA 1SAPA 1CA5A 2B2UA 1BNZA
chains in the Genus database with same CATH superfamily
2VY3A 1FYCA 2K32A 4BBRB 1SXTA 4C1NI 2CH4A 3EVQA 1YBYA 3JAMi 2IL8A 5IGFA 4Q0FA 2YTXA 4IPHA 1BCPC 3FKIB 4CDDC 2Q2IA 1SR3A 3D6CA 2MPMA 4BS9A 4IUQA 1HRJA 3D8GA 4ZK9B 2HCIA 1EZ6A 2A69D 3IKJA 4MIUA 4K5XA 4IZ8A 4KK7A 3FKIH 3HOVB 1F9SA 4LFAQ 2Y0SG 2F0KA 1Q1EA 4C3JH 3S1QB 4I7ZC 2F0VA 1J9OA 5IGCA 3HOVH 5T1IA 2ALYB 2JEBI 2MQHA 1QVFA 4A3BH 3KUPA 3DXJC 4HIOA 4OWXB 3I73A 3D6WA 1OTCA 4C2MB 4QUFA 3S1QH 2QILA 4C3IB 2FXQA 4G7HC 1CQFA 1YNJC 2AQ3B 2ID0A 2CKZB 4AQYL 1N34L 3LWEA 4DN4M 2JA5G 1EQQA 2K5QA 4LF5L 1QILA 1PYWD 1AH9A 4C2MH 5ISRA 3WOEA 5DEHA 4C3IH 3B6YA 3VDYA 1LTAD 4DR7Q 1EIGA 3LGJA 4LF9Q 2NVQB 1PH9A 3C3LA 1SJHD 1B3QA 1FVIA 3R3OA 4JYAQ 2ZXPA 5I2XA 4WORA 1BO0A 4A3IG 1EY5A 3QO2A 3T4AC 2EE1A 1IBML 2I0QA 2NVQH 1VQ9A 1N8RC 4IPGA 1M4VA 5M3FH 4MHEA 2F0HA 2A74C 3EFXD 3J81E 4TRDA 3S15H 4KHZA 1MGSA 3A5UA 5M3MG 1V8QA 1LABA 4MN3A 3GTOB 3TP5A 1GUNA 3BDOA 1K0RA 1VQEA 4NMZA 2MUYA 1DONA 2EY6A 2NN6H 4DUYL 1NSNS 4XQJA 1Q8KA 4PV1C 3CCVA 1HZBA 5CV4A 1PH7A 4QB4A 3DWQA 4N8X1 3F1ZA 3GTOH 1LTSD 1XWEA 3ULPA 3OMGA 3CD6A 4DR4L 3I2ZA 4ULLA 1HR0L 3I55A 5HGQA 1F2YA 3TS0A 3D0FA 1EQRA 1GD7A 3OOCA 3H3VI 2E2DC 2VQEL 3GDEA 2NZ1D 5J3BA 1B70B 5LMNL 1SYBA 1RHPA 1WTOA 4BBSB 2D62A 4K5VA 3SEBA 1RKNA 2RHSB 2D0OA 4AIMA 1HHVA 3MC0B 3IL8A 4A76A 3RNUA 2Z8LA 4P71A 1FR3A 2ZM6Q 1D2BA 4IOCA 3H94A 2NWGA 3FDTA 3PO2H 5FJ8G 1O7ZA 5IGDA 4A3JH 2CH4W 3MEFA 2IPKD 4IJLA 3NEMA 4RG1A 1V1PB 3R2IA 5COYA 2F0GA 3T1HQ 1U4LA 1RL2A 4B3MQ 5ELOA 2PI2A 4K0KQ 4KKUA 2BE5D 3X3MA 4X64L 1BF4A 2B2UC 3CCSA 2WACA 1IW7C 1G2SA 2J7ZA 1P16A 3UI2A 1TU2B 3C1EA 4IFDJ 2HHHQ 5TSSA 4DR6Q 1XTCD 3OPOA 1VQOA 3V05A 3JC66 4IUUA 2R93B 4S3SA 1A3VA 2EJMA 1J5EQ 4DR3L 2M2LA 2NVYB 3K7AH 2IX3A 4PG3A 1DOLA 4JI1Q 3A8KE 1F2ZA 3HFZB 3CC2A 1K3BC 4N8FA 2R93H 2VS1A 1EIFA 4A3MG 5KEEA 1HA6A 3KDFA 4RGMA 4RGTA 3UDGA 1HTLD 4LK1C 4HJ7A 2L5TA 1SE3A 1PHJA 3MHBA 1QUQA 4LWCA 2A6HC 1XYIA 3H0GH 1VDZA 4GS3A 4LUVA 2A68C 1NMGA 4UP9A 3NHHA 4ZKBB 5EJWA 4HJ5A 4CDCC 1VQDA 3GTPH 1G6ZA 4TQUS 1SE2A 3HOYG 1Y1VG 1KDBA 2UXBL 3PO3B 1OXTA 2F1MA 4HAEA 2D5DA 4CGYB 3HOXH 2PZTA 2WIIB 1K9MC 1WTQA 5E4WC 4C3JG 1PH8A 3TRZA 2JA9A 1W6JA 5IP9H 1NUCA 2JA6G 4AQYQ 1N34Q 1AFPA 4N9TA 1HNWL 2B39A 1BR9A 3D4DA 4RHRA 3SK5A 1S40A 3PO3H 3K58A 4LF5Q 1OXSC 3TP6A 4IN3A 2EQSA 3KF6A 5C5MA 1JB3A 4RGNA 1PZID 1TY2A 3LX0A 4Z9CB 4O42A 1CHQD 3H15A 2JA7B 3K7UC 1TVXA 5C4ZA 4BY1B 3QR8A 4IFDH 1SYFA 5M5WB 5I9PA 1E0BA 1QNKA 4GOPC 1XNRL 1PRTD 4CHTB 2KJXA 4RAUC 3D4WA 1GUSA 2I07B 1IBMQ 4JI4L 3AFPA 2LS01 5J1ZA 1B1ZA 2DNEA 1B7YB 4UDUC 4FF2A 1OXXK 1FL0A 5M5WH 2HT1A 1JCKB 4O2DA 1IL2A 2QKIC 1JQYD 1SBBB 5M3FG 3KOJA 1EIYB 1HJPA 1CKNA 4DUYQ 1DZ1A 2WB1B 3P1HA 3BS1A 4AYBE 1X3QA 3CCEA 1D5ZC 3A7LA 1HUMA 2WINB 2UU9L 4DR4Q 5K36H 3NE5B 2B3GA 2DY7A 5BN5A 1MSHA 1HR0Q 2OQKA 4QUCA 1G51A 1ZKOA 2NBFA 4BXXG 3GP7A 4TKOB 2VQEQ 2KCCA 3BDLA 1FJGL 3Q0AA 4IFDI 3KJPA 1H95A 5LMNQ 4LFBL 4A3CH 5EKLA 1Z7TA 4A3EH 2A1AA 1ILQA 2ES2A 3C2PA 4YHHL 1RTNA 1ZYRC 1HZCA 3M3YH 2I5LX 2RBMA 3S14H 4RCNA 3X3NA 4G7OC 4R8IA 5I9OA 1JT8A 3RN2A 4B3SL 1II3A 1SE4A 5KNCA 3MZ5A 1JWMD 1MKHA 4HMJA 1E1TA 5FLXE 5AFWA 2ICIA 3OTOL 1VQMA 1IBKL 5CV5A 3NWTA 4A3DH 3NQTA 3MEHA 5G3LF 1UE6A 5JJZA 3PO2G 5ELNA 2X69A 5JOBA 4A4IA 4X64Q 5GROA 4A3JG 5I6YA 2L4NA 1WCMG 2R7ZG 4DAVA 4DK6C 1QZHA 1STHA 2FINB 2EYPA 3GTMB 4KTAA 2NVTB 1XPUA 2HD3A 3HOUG 5EQ0A 4KD4A 1G2TA 1U0LA 4XIGS 3NBHA 4DR3Q 1BBUA 3VA7A 1YZ6A 2K52A 1TWFB 3J80L 4HJ9A 2MJ8A 4RWSC 1NR2A 3RLOA 4JVZA 2ZTCA 5IOCA 3W2DA 2NVTH 3QOLA 3ULLA 2A5HA 2FMCA 3TMEA 1EFWA 2Z6KA 1IL8A 1TWHH 4KY5A 4KMUC 1TWFH 2K28A 5FLMG 1TIID 5C4JB 4HIDA 2ENBA 3STBC 2EYMA 3BYTB 4Y7NH 1CHPD 1XPRA 3HOZH 5E3FA 1B4OA 1DXMA 2OQ0A 4KY6A 5A2QL 1KNAA 2RSOA 1YIJA 3TSSA 4BA1I 3M9BA 5CYUA 5IT9L 3H0GG 2N55A 3U4VA 2UXBQ 2FHTA 1TWCB 3J81c 4APVA 4BY7H 4O0AA 3PIP3 1XXGA 2HDLA 1RCVD 1HNWQ 4EGVA 3I56A 2NB0A 4FYDA 4YY3L 4DAYA 2JA8B 4CDEC 1I4HA 2RA4A 2XN9C 2IJ0A 3U9OA 2XTIA 2PPBC 5IP9G 2H4OA 3K80C 1HNZL 1KTKA 4DK3C 5JVG3 3PUVA 1PTOF 3F2DA 4WJ3M 3ND8A 3HKSA 1XNRQ 2K1BA 3ERSX 5CBAE 1LT6D 3OSOA 1M8AA 4IUNA 4KI0A 4KJNA 1UWVA 4JI4Q 5C3WA 2L12A 3CQZB 1Q8IA 4DAPA 5EPJA 2IHEA 5K5PA 4I7AA 4IFDG 5CR3A 1STEA 4DNIA 3CU7A 4X3UA 5C3EH 2EXDA 4DXFA 3I4MB 2F0QA 1YNNC 3MXUA 4ILWA 1EU4A 3U58A 3I90A 4KV6A 4WRDA 4BWGB 3CQZH 4Q5VA 1EUJA 5C44H 3W1GA 2B8FA 1FNWA 3KBXA 2IX0A 1R9TB 3TDQA 5H1SE 3I4MH 4UPAA 3BG3A 4ZUIA 1BBWA 1KL9A 3TP8A 1X54A 1LACA 1C48A 1VQ7A 3EROA 4L6TB 5EBCA 1MD2D 2YU9B 3VYRA 1ZXTA 2UU9Q 2C9OA 4LF8L 3VYUA 2EPBA 4NP5A 2UXDL 1PTOC 4IPCA 5M3MB 1LT3D 4K2KA 3T51B 1BDOA 3A74A 3A54A 2O2LD 2AUKA 3VR4A 4R4TA 4KD3A 1FJGQ 2A6ED 4A3KB 1MJCA 4C3HB 4OIKA 1TS3A 3PIOA 2K01A 1Y1WH 1RODA 3RLFA 3H91A 4QL5A 2D2CC 3E9IA 3GTQB 4LFBQ 1EWIA 4NXNL 1FNVA 4XTCS 4YHHQ 2LXKA 4L5SA 1I6HB 3CXCA 3ITPA 4GKKL 2KUMA 3NENA 2BCOA 3MFYA 3RMHA 4V0BA 1PZJD 4B3SQ 3BZDB 3S2HH 4A3CG 4A3EG 4B3TL 3QWNA 2GA4B 4GNXC 2DJFC 1I3QB 4JOIC 2WP8J 2DN8A 3OTOQ 1IBKQ 2AMCB 4JI7L 2F0DA 4DU9A 5C6AA 4EQOA 1VQBA 1S3OA 2AWNA 3RN5A 2ZXRA 1O7LA 2NTSA 1G91A 3I4NB 1I3QH 2XRSD 1CFMA 1DJRD 1SMYC 1JJGA 4IOAA 1VS0A 1X3GA 2ZM6L 2NZOA 4A3DG 4UY8C 2LMCB 2RDHA 1SLJA 4DUZL 1K8GA 2LY7A 3HOWH 3DHQA 1ENCA 1LTRD 2XNAC 3DWPA 3I4NH 2M9VA 4CKEA 1VMCA 2OTLA 4LJZC 1LYLA 4HIMA 3S9WA 2ZXOA 3URYA 2D0PA 4DR2L 2E2IB 1STGA 3RZDH 2LXJA 3KDFB 4P73A 3K8AA 1KLGD 2QCPX 4ME3A 5CV9A 4CJ1B 2X6LA 1OXUA 2KECA 1QUQB 2PYKA 4DPGA 4L5RC 2X6GA 3AMUA 1S5DD 3OIQA 1C7YA 3M4OB 1D5MC 1WD1A 1PZKD 3NXWA 3PQIA 1PV4A 1GVPA 4U673 4DV7L 5JEAJ 4L5QA 1J5EL 3Q6SA 3QIAA 1JWSD 4A3MB 4JI1L 3JAML 3BJUA 2F0UA 3T1YL 3TN2A 4BBRH 2VZAA 1ESRA 2KCTA 3OW7A 4PZ6A 1ET6A 1BKBA 2AQ1B 1HH2P 1YJNA 2EYHA 1BCPD 4POGA 1VQLA 3RLNA 5C4XB 2B2WC 3KK7A 3E0JA 1TWGB 5FO8B 3VR5A 3KF6B 1FGBD 4YY3Q 2PW7A 4BY7G 5M5XB 2A69C 3CPWA 4PMCA 1E2ZA 5IYDG 2AHOB 2K4KA 1OXVA 1YITA 1EY7A 4FNFA 1TWGH 1HNZQ 3W1BA 2L15A 1MHWC 3PCOB 4HR7B 1NTGA 5IGEA 1L0YB 5M5XH 3NTKA 4DNTB 1C9OA 2BH2A 2KCMA 1B50A 2KHIA 1L0XB 1U9RA 3GTKB 1SE8A 4OONA 4LFCL 3EA6A 3FPUB 1Y8NB 2B2VA 3PSIA 1L1OC 3KLSX 2G9DA 1QZGA 2KQ3A 4JI0Q 4YWMA 1QJOA 3CP0A 1LTBD 1MSGA 3GTKH 1ET9A 2IW3A 1D1KA 4QF4A 3S16B 1EYDA 1CKNB 3A5ZB 2QEJC 4NKLA 5C3EG 1CK1A 3ERQA 4AYBG 5EPLA 4NPSA 4C1NK 2FFKB 2B2TA 5JEAH 3OHXC 4L63B 3MXGA 5C44G 4LF8Q 4ZYSA 1JC7A 2UXDQ 4EQ5A 5FO7B 3OYYA 4A93G 1FGUA 4G4KA 5KNBA 2KA7A 1W3SA 1CZGA 1HXYD 3NP8A 1ASZA 4GN3B 1PFNA 2C35B 1SMXA 2AKWB 2QW7A 5BR8L 4NXNQ 3S2DB 1UE1A 1V1QA 1VQ5A 3P20A 4AH6A 2RF4A 5FK9C 4GKKQ 1TT2A 1JJCB 1IYUA 1VQNA 2F3IA 3K81C 4QQBX 5IODA 1HZAA 1Y8OB 1TR5A 2K04A 4B3TQ 3GTGB 1ASYA 1VQJA 1N36L 1PH5A 1PTOB 1H9SA 4B08A 1EIHA 4OX9L 2VNUD 4JI7Q 2XRQD 1IYVA 2JEAI 2CWPA 1U4MA 2EOTA 3GTGH 3PMFA 1F9PA 1WTHA 1PTOH 2L1BA 1A62A 4R8NA 5JPNC 2WB1E 3ONAB 1WTPA 2NUCA 5E1FA 3NBHB 4DUZQ 4BBSH 1TS5A 3A8JE 2KEDA 1WYDA 2AWOA 3AEVA 5EKIA 2VB2X 1KRSA 1SYGA 3GTJB 4GNXB 4CJ2C 4DR2Q 1CA6A 2NN6I 5FO9B 3EJIA 4PNYA 3CMEA 3HOWG 1WCMB 2P5ZX 3PIPA 2B2YA 3K0YA 4DKAC 2EYLA 2F0WA 1AZQA 1I50B 4DXGA 3J7ZC 5KGUA 4OWWB 4MTNA 3FPPA 2ZJRA 2BE5C 1XTDA 1Q1BA 1T5XD 3NTHA 1R4PB 2D9UA 3KLWA 4DV7Q 1IW7D 4TSSA 1G6PA 3ER0A 5C3XA 1S5ED 4E6IA 2E74C 1YHBA 3UE0A 1SROA 4I65A 4GN4B 1KIXA 3T1YQ 1Y69U 2R7FA 3MA2B 1DOMA 3F2UA 2NVYH 1EEID 2N49A 3AFQA 2YV5A 4MNOA 4DAYB 4OO1H 3DM3A 5IYBH 4DR5L 5C0XJ 1C0AA 3GQBA 2O4XA 4HSVA 2JQOA 4JG2A 2Z9HA 4P2CB 1EQTA 1ESFA 2A6HD 5D3IB 1BBXC 2IX1A 5D65A 3FKIG 2BA1A 3I4LA 5GADC 3IAYA 3QOJA 1PRTF 2K5WA 5FOBB 4R4QA 1D8LA 1ENAA 3NBIA 5ELCA 1CT1D 3D4RA 5JJKA 2DJGC 3HP3A 2RHQB 3J80E 3HOVG 1QNUA 4IQZA 3K5NA 2DNCA 1HCZA 2J4XA 2F0IA 2NTTA 2Q2UA 4LFCQ 1KAAA 1YHAA 2K5HA 4A3BG 2VB3X 4FF4A 1RF2D 1EOVA 3FEWX 3J81i 2R6GA 3FRPB 4R9WA 3F2BA 1S5FD 1O78A 1VF5C 2EVBA 3S1RB 4PQXA 1SNCA 2SNSA 2B63B 2QDLA 1KDAA 1QVCA 4QIWB 1X65A 4HEDA 1XNQL 4RA8A 1D1IA 1V1OA 3E0EA 5HGTA 4RHSA 4C3IG 4F87A 3BVZA 3T16A 5A2QE 3GV3A 4P75A 2BA0A 2Y0SE 3J7A5 3GV6A 1X9NA 1IYJB 4JI5L 5IT9E 1O7YA 2R3ZA 1E24A 2PQAA 2JA7H 2NYZD 4BY1H 1DM0B 3WWVA 1I5FA 3K57A 3BZKA 3TZUA 4LUZA 1L1OB 1JOQA 5JEAG 2N78A 3ND9A 2R92B 1LT4D 5BR8Q 1HQRD 1I6VC 1LLRD 1NE3A 4B9WA 1TWAB 4ZAIA 2K03A 4KLKA 2Q8TA 1SAPA 1CSPA 4J6HA 5EGTA 5C0XH 3S1MB 2PNRC 5I6WA 4WJ4A 1PFSA 1IKLA 3S17B 1VQ6A 5GAGC 4A3FB 3OW2A 3SK6A 2UUBL 2IHFA 4N9PA 2NN6G 3PF5A 4ZKCB 1TWAH 3VYTA 1N36Q 1JOOA 2F0LA 4H44C 2F0FA 1GHKA 1PH1A 4OX9Q 3CCMA 1SRUA 2K7VA 4A3FH 1V43A 3TQYA 3NSWA 3MXPA 1KC8C 1O80A 3C1FA 4A3GB 3I72A 3S1NB 2RCNA 4YCUA 3HKZB 2O5IC 3VYSA 3CRLC 1EU3A 2IT1A 4M8AA 3T13A 3F2CA 3BU2A 3KLSA 1LT5D 2OF1A 1KRTA 3ZJYC 1QCBD 1D5XC 4IUTA 3E5SA 5GQOA 1GO3E 3S1NH 4LF6L 3SXHA 1Q86C 5EKKA 1IHZA 1X3FA 1PLFA 4B9XA 5C0XI 4CKBA 2GVAA 1VQ8A 1GUGA 2BH8A 4IO9A 4GLAC 3BVMA 5IIFA 4H7BA 1GM5A 3E3XA 1AE2A 3GD7A 1I4RA 2E75C 2QGQA 2WAQB 1PH6A 2L11A 1K83B 3KLRA 3CCUA 1SJED 3GTMH 1SN8A 1K73C 5JPMC 2PI2E 2VUMB 4IUPA 3UDXA 4OIJA 1VMPA 1F77A 1KDCA 1AP0A 1WD0A 2KCNA 2F0TA 2MFIA 2JXMB 2QEXA 3ZYYX 4ZCKA 4C56C 4DR5Q 4ABNA 5CV8A 1VQHA 3AQQA 2R93G 4X3KA 1BOSA 2VUMH 1BUVT 4F88A 1GUOA 1Q90A 1Z6HA 4TVAB 4O1NA 4XYQA 3C46A 1B9NA 2XSCA 3I70A 5C4JH 4JI2L 3STBD 2H1EA 2E2HB 1I94L 1TQOA 1Y14B 1ONLA 1X6OA 2FMMA 3K5MA 1LV9A 1CZWA 3L9AX 2KOLA 2EXZA 2PW5A 3A55A 4XYOA 2QDBA 2OCEA 1HPCA 5I4DA 3DMUA 2Q2HA 2EY5A 2J0TD 2Y0SB 1UUPA 1YEZA 2CQOA 2HDMA 3OMCA 2NVXB 1NNXA 4FXKC 4K8IA 1PH4A 2ZTEA 3R2TA 2N3SA 2UUAL 3HS0C 1TWCH 3RR5A 3IRBA 1X32A 1HNXL 2MP1A 2EDGA 4KKSA 2I5HA 4QJFA 3HOXG 4DV3L 3V2TA 1QVGA 4FDBA 1PH2A 1PFBA 1DOKA 4KHPL 3L7ZC 4IURA 5KIXA 5KNDA 3PO3G 2JE6I 2JA8H 1AW7A 3H3VC 1A8VA 1XNQQ 2RQXA 2JA5B 1XJVA 5GAEC 1PH3A 5ELEA 1DYQA 4JI5Q 1CM9A 1JR0D 3JAME 4CKCA 2KBNA 3K5OA 2K5VA 3H09A 2JA5H 2CW0D 1PMRA 1A3TA 1EEFD 4FXDA 4JI0L 3G71A 3CPFA 4DAMA 4JW0A 2M00A 4X65L 1JORA 2JA7G 2I5MX 5D14A 4A3IB 3DEOA 3O13A 4EQNA 1ML0D 5EAYA 4BY1G 3MWYW 2PQEA 3G6JB 1DCZA 4J8QA 3A56A 4RCOA 1YNND 4UP7A 4OEMB 4PMWA 2L55A 2WV6D 2DY8A 4A93B 3H6MA 4A3IH 4LAAA 1R9TH 4FXGC 4JK1C 5IYCH 2UUCL 2UUBQ 2PCFB 3CCQA 1H9SB 2XIWA 2Z1CA 1JJ2A 4LNQA 1MBYA 1PRTB 1UNSA 4JBJA 4PZ7A 3V96A 5C0XG 3BYYB 2YU9H 5IY0A 4KN4C 5K36G 4IALA 1SFOB 1TS2A 3P75A 1YVCA 1LTGD 4YWKA 5M3MH 2XVSA 4LF4L 3MXNA 3E6ZX 4A3KH 4C3HH 1X3PA 2K14A 2F52A 2G5DA 3GTQH 2HUGA 3BVGA 5BN4A 2VQFL 3SHLA 1GHJA 1I6HH 1WJJA 1RDPD 4FP5D 2CHBD 2Z6KC 3KJOA 1IXRA 1WVLA 4K6DA 4LF6Q 4L8JA 2VXWA 4IPDA 2JN4A 3RZOB 1N32L 2Z4IA 2EY1A 1O7IA 2YTYA 4CBVA 1EWCA 5KRUA 2V4DA 1N33L 2JJQA 3RZOH 2O5JC 1I4GA 4JI3L 4HN7A 2SEBD 1SMYD 3HGBA 3G4SA 2Q2TA 3J80c 4ID6A 2N8NA 4OXPA 4XXEA 1WTRA 1B53A 1QOHA 1D6EC 3K0XA 1XX8A 1BCPF 4L5TA 5C5LA 1B2TA 4X6AH 4BA2I 2VW9A 1I4PA 4UP8A 1HUNA 1JE4A 1NY4A 2F0JA 2TMPA 1VQKA 2E2IH 1F2MA 1U4RA 1P8LA 2ZJPA 1HFGA 1H9KA 4HJAA 4WJWA 3Q22A 2ZT9C 3Q23A 3SDZA 1VQIA 5F2DA 2CWAA 3I7FA 4RMFA 4JI2Q 3HZXA 3CC7A 3M4OH 3GO5A 1XMOL 1IZ6A 1YI2A 1I94Q 3OWFA 1PFMA 4CDFC 3SK4A 2V1CC 4K6LA 3VR2A 3HOZG 4K5WA 3EBEA 1NMFA 4HMIA 1H9MA 2EJGC 1ICWA 2MO1A 4A3MH 3TZDA 2VL6A 1T9HA 2E5LL 1A0IA 3LNNA 4DV6L 2UUAQ 1MIUA 3MFGA 1I4XA 5T1GA 5C4HA 4HSPA 4KJOA 4JI8L 4DV1L 1HNXQ 1EY0A 4DV3Q 4R4CA 4J15A 3A8IE 1VQFA 5KYLA 3L0OA 3HOYB 2JK8A 1GKHA 1Y1VB 4KHPQ 2AUJD 1KLUD 4J1MA 5C4XH 2JSOA 1KQSA 1AZPA 5CC4A 5IGBA 2PNHA 1H9RA 1A15A 1H9JA 1EWHA 3I4OA 2A8VA 1EZ8A 4C3JB 4GLVB 4HCSA 2HIXA 2JA6B 1A2UA 2B2UA 3HOYH 1Y1VH 5NUCA 1CQVA 1HQMC 4IUVA 1KXLA 3KFUA 4A3BB 2PQAB 3J7AF 2F3VA 1U4PA 4A3LH 4V190 3G6EA 2JA8G 1WI5A 1RIPA 2JA6H 1QG7A 2PZWA 1STYA 3W3AA 4DK0A 1CSQA 3M7NA 1JWUD 1G291 1YNJD 3NELA 4P74A 4GZYC 3K6OA 4H0LC 4X65Q 2ZTDA 1XMQQ 2NZHA 3M85A 4X66L 5IP7H 4XQNA 5FLXc 1YHQA 4RGOS 2CCZA 3KF8A 2MNAA 2R7DA 3M4PA 4U68A 1WFQA 2A19A 3KYHC 2F0NA 3NTIA 1J6QA 5GAHC 4UAIA 3S16H 1VQ4A 2UUCQ 3I4MG 3RUZA 4DGZA 3H3VH 2GN5A 5IWAL 1I4QA 5CV7A 1R4QB 5DAUA 5M3FB 1SNDA 1RJTA 1D7QA 2IY5B 3S15B 1QE6A 5IYCG 1IBLQ 1EY6A 4GKJL 4QIWE 1Q81C 5CBEE 4LF4Q 3NWSA 1A63A 1SYDA 2YYZA 4DV2L 3K5LA 3CCLA 1UE7A 4F7XA 3QB3A 4MZ9A 5D3DA 1Y1WG 1SNOA 1M90C 1HA5A 3L3OC 3FMCA 1CI3M 1LTLA 1TY0A 2RVLA 4LMQD 3S2DH 2VQFQ 2TSSA 5DM63 1A6XA 2XWJB 3RD4A 1SNPA 3DWAA 5ELBA 3CRKC 1WOCA 5CV6A 4HCEA 3PUWA 4A3KG 4C3HG 4Y52H 1BVSA 4OHJA 1B3AA 4RH6A 4BXXH 5JAVA 1QB5D 2PMZB 3DUZA 1STAA 1N32Q 2LKVA 2L9HA 1FNUA 4KHVA 4GOPA 3IFTA 1LO5D 2ZJQA 1N9WA 1EY4A 3Q8DA 1F9QA 5FKAC 1N33Q 4YWLA 3TS2A 2OXPA 4YCVA 1Q82C 2C5CA 3BZCA 4ZQ3A 4JI3Q 1OO9B 3HG9A 4B3RL 1LTTD 4XT1B 3PO2B 3CAMA 3FP9A 3J7YW 1S72A 2SOBA 1G8ZD 4A3JB 1JOKA 1CKOA 2R7ZB 2BDNA 3I4NG 1L2FA 3PGZA 3GTJH 3HOUB 1X3EA 4ZLTF 4NXML 3TREA 1JB7A 4FF3A 2KENA 3CC4A 2F0PA 1WCMH 3M4QA 3QJYA 2F4VQ 2R7ZH 4OL7A 3MAQA 4NB3A 5AJ3L 1DGSA 1TKWB 1STBA 1AN8A 2CFMA 2G9HD 3HKZE 2E2JB 2HCCA 3HOUH 1NR4A 1I50H 3OIPA 3MVVA 1PYBA 5M5YB 3KBGA 3PIO3 3FHWA 3U4ZA 1XMOQ 3JAMc 4WFN3 2RSNA 3W5OA 5ELDA 3K7AB 1PXUA 2K5NA 1EYCA 1K28A 4R4OA 2F0EA 2E2JH 3E9HA 3J7AV 1ENFA 4PZ8A 4OWTB 1KHIA 5M5YH 1M1KC 1W2BA 2B2VC 3TEHB 2E5LQ 3P7JA 1K0SA 4DV6Q 1SYCA 3HEJA 5FLMH 3G48A 4JI8Q 4DV1Q 2K33A 4BBRG 2Z6BA 1X56A 4ZUJA 2Q8IB 2RDFA 2KHJA 5HURA 3H0GB 3N6RA 1BQQT 2WAQE 3WDNA 2I46A 1VQAA 1EFID 2A68D 1SNQA 2K75A 4DV4L 1FD7D 3SGIA 3PUXA 3GTLB 1PA6A 1GUTA 4JBKA 3GTPB 3M4YA 2B2TC 3I8ZA 4K2LA 4RKBA 3UE1A 5C4XG 3CCJA 3HOXB 3CCRA 1QWYA 4G7ZC 3GTLH 1U5KA 4KN7C 2B29A 3CHBD 4ALPA 2K05A 4QCLA 2K5DA 3U9SA 4YIJA 1NJIC 4LW1A 1BCPB 3DEPA 3J81L 4RFBA 4H13C 5CORA 4LF7L 2RKSA 2SNMA 4A3LG 4DF7A 1EY9A 4DNRB 1JE5A 4X66Q 2F0MA 4OO1I 4JBMA 5LMUL 3S1RH 3Q24A 1CA5A 1Q12A 5J39A 2B63H 5IP7G 1PRTC 4RKLA 5CMDA 2WFWA 4FF1A 3LWUA 4JBWA 4GLXA 4DV5L 3VR6A 5IWAQ 4ME5A 3ULJA 2YTVA 4JV5L 3A7AB 3MXNB 4JC0A 3HRZC 2HQEA 4GKJQ 3MTSA 3L2PA 1HTPA 3CW2C 3SR1A 5LL6X 3DLLA 3CKIB 4DV2Q 5EBDA 3PUYA 1Y8PB 2R92H 4DR1L 2ICEC 3OWEB 3T56B 4DFAA 2Z0SA 5DLQE 2B2YC 3S1MH 4OELB 1WTWA 4X62L 3SE0A 3S17H 1CKMA 2WKCA 2HIVA 5BN3A 1E2VA 1LM0A 4DK1A 5JJLA 4A3EB 4YCWA 1VCIA 1YNXA 2N88A 5IE8A 3M3YB 1BXTA 3S14B 1SEBD 1GJXA 1ZYRD 1V9PA 3T53B 4B3RQ 2OWOA 1VF7A 4A3GH 3QG1A 4KY7A 2OT2A 5LL6S 1F2LA 3UDIA 2BOSA 1TS4A 1B9MA 4BBSG 3I91A 3J81j 4PMBA 1A3UA 2FJ2A 1WTXA 2RCFA 2PZUA 1RD9D 3I3CA 3WOFA 2LSSA 5EPKA 4A3DB 3AYHB 2Q8RE 1EYGA 1KAWA 4NXMQ 4XQQA 2HQLA 1PYSB 3NUCA 1X55A 5AJ3Q 2XGTA 4X3SA 2KVMA 2B8GA 2E8GA 2AQ2B 1K8AC 4HJ8A 3NK9A 1SNMA 1MI2A 3D3RA 5J22A 2F03A 2OEOA 3DM1A 2UXCL 2F0OA 3D31A 1K83H 1C4QA 1DD2A 4EX5A 4X3TA 1GOZA 1HZ9A 1B8AA 1TWHB 4JI6L 3J80i 3FVQA 1F9RA 1EL0A 1Q7YC 1UEBA 2BDOA 5M9OA 2EYJA 1ILPA 1TXYA 2LFNA 4GNXA 1VQCA 1LTID 1V1PA 4Y7NB 4JOIA 4DV0L 1Q3LA 5L37A 3HOZB 2EYFA 4DV4Q 2QF7A 4OO1G 2EY2A 2KHSA 5G3LD 5IYBG 1SYEA 4IJHA 3AU7A 3NQIA 2ATWA 3PV0A 3UDFA 4M1UB 3PUZA 1AE3A 3AB9A 4G57A 2E2HH 1C8CA 2EIFA 4BY7B 4GN5A 1E3PA 4DA2A 1NCVA 1ICFB 4R4IA 1K8OA 3M7GA 4QGUA 4JCVE 1NAPA 2NVXH 5DNFA 1K3RA 4LF7Q 1UE5A 1YJWA 1HFNA 1E2WA 5IYDH 2KEEA 3KF8B 2A73B 1L0WA 1JICA 3TBIB 3NPPA 2MHVA 1EYAA 4LFAL 4EVOA 5LMUQ 5KYIA 1YJ9A 4F8MA 4POFA 3K59A 1RTOA 1UAPA 1IKMA 2RDGA 1AEXA 1MJEA 4XT3B 1GXDC 4DV5Q 2CVRA 3BDCA 1S5BD 3S24A 3R93A 2EZVA 4K14A 5C3EB 2B63G 4JV5Q 1Z9FA 4AYBB 1XMQL 1J8IA 3VA5A 4A75A 2CW0C 4MTKA 4FO2A 4LUOA 2IWHA 4K8JA 4EQPA 1Q46A 5C44B 1EOTA 2B2WA 3TP7A 2MO0A 1WTVA 3G7LA 1UEAB 1KD1C 4DR7L 4DR1Q 5JJIA 4FVMA 2Z4HA 2MGSA 4LF9L 1GUWA 3U50C 1XPOA 2PO4A 1E22A 4JYAL 2ASBA 5FLXL 2JYOA 4X62Q 4A93H 5E7NA 2R92G 2WKDA 4UHVA 1PTOD 1IBLL 4GOPB 3PF4A 2E76C 1Z47A 1S5CD 2WB1G 2A6EC 1Y1WB 1LUZA 3SVMA 2EJFC 3EIVA 4QMGA 1SSOA 2DGYA 2H5XA 2R61A 1EY8A 1SFOH 4A3FG 2XWBB 4HIKA 5ELFA 4R1JA 1L1OA 5JVH3 2OTJA 3R8BA 3S2HB 1A2TA 2F3WA 3ICEA 1HR0W 1CTMA 1S4ZA 2F4IA 2L0CA 1E1OA 1STNA 1T5EA 5E4XA 5HY6A 3CMAA 4NDXA 4A3GG 5LMNW 1PVOA 1KABA 1B44D 3HKZG 1EQVA 1NBWA 2K50A 4OGQC 1PDQA 3F8TA 2SDFA 4ODGA 1K8MA 2EYOA 3N52A 3CF5A 3HOWB 5FJ8H 1VQPA 3VR3A 1VQGA 2DUDA 2K6AA 2PMZE 1KNEA 2UXCQ 5IGGA 3RZDB 4ZRZA 4KKTA 5LHY1 4JI6Q 3SK8A 2GVBA 2F4VL 1CUKA 2WAQG 3IFDA 3EN2A 3A0JA 4H02A 5I2YA 3T1HL 2JP1A 5DM73 4NW2A 4B3ML 4K0KL 2QA4A 4DV0Q 3EQLC 1ZEQX 5IT9c 2F0SA 4P72A 1W6KA 1SDFA 5A35A 2VUMG 2HHHL 4XDXA 5CGKA 4DR6L 4HTHA 4CJ0B 1E7ZA 4JPBW 2CQAA 1JMCA 1BNZA 4QY7A
chains in the Genus database with same CATH topology
1FYCA 2K32A 4BBRB 1SXTA 4C1NI 3EVQA 2IL8A 5IGFA 4Q0FA 1BCPC 3FKIB 3D6CA 2MPMA 4BS9A 4IUQA 1HRJA 3D8GA 4ZK9B 2HCIA 1EZ6A 2A69D 3IKJA 4MIUA 4K5XA 4IZ8A 4KK7A 3HOVB 1F9SA 2F0KA 1Q1EA 3S1QB 4I7ZC 2F0VA 1J9OA 5IGCA 5T1IA 2JEBI 3KUPA 3DXJC 3I73A 3D6WA 4C2MB 4QUFA 2QILA 4C3IB 4G7HC 1CQFA 1YNJC 2AQ3B 2ID0A 3LWEA 4DN4M 2K5QA 1QILA 1PYWD 5ISRA 3WOEA 5DEHA 1LTAD 1EIGA 2NVQB 3C3LA 1SJHD 3R3OA 2ZXPA 5I2XA 4WORA 1BO0A 1EY5A 3QO2A 3T4AC 2EE1A 1M4VA 4MHEA 2F0HA 2A74C 3EFXD 3J81E 4TRDA 4KHZA 1MGSA 1V8QA 1LABA 4MN3A 3GTOB 3TP5A 1GUNA 3BDOA 4NMZA 2MUYA 1DONA 2EY6A 2NN6H 1NSNS 4XQJA 4PV1C 5CV4A 4QB4A 3DWQA 1LTSD 1XWEA 3OMGA 4ULLA 1F2YA 3OOCA 2E2DC 2NZ1D 1SYBA 1RHPA 1WTOA 4BBSB 2D62A 4K5VA 3SEBA 1RKNA 1HHVA 3MC0B 3IL8A 2Z8LA 1D2BA 1FR3A 3H94A 2NWGA 3FDTA 1O7ZA 5IGDA 2IPKD 1V1PB 3R2IA 5COYA 2F0GA 1U4LA 4KKUA 2BE5D 3X3MA 1BF4A 2B2UC 2WACA 1IW7C 1G2SA 2J7ZA 3UI2A 1TU2B 3C1EA 4IFDJ 5TSSA 1XTCD 3OPOA 3V05A 4IUUA 2R93B 4S3SA 1A3VA 2EJMA 2M2LA 2NVYB 2IX3A 1DOLA 3A8KE 1F2ZA 5KEEA 1HA6A 4RGMA 4RGTA 1HTLD 4LK1C 2L5TA 1SE3A 3MHBA 2A6HC 1XYIA 1VDZA 2A68C 3NHHA 4ZKBB 5EJWA 1G6ZA 4TQUS 1SE2A 1KDBA 3PO3B 1OXTA 2F1MA 4HAEA 2D5DA 4CGYB 2PZTA 2WIIB 1WTQA 5E4WC 4C3JG 1W6JA 1NUCA 1AFPA 4N9TA 2B39A 1BR9A 3D4DA 4RHRA 3SK5A 3K58A 1OXSC 3TP6A 4IN3A 5C5MA 1JB3A 4RGNA 1PZID 1TY2A 3LX0A 4Z9CB 4O42A 1CHQD 2JA7B 1TVXA 5C4ZA 4BY1B 4IFDH 1SYFA 5M5WB 5I9PA 1E0BA 1QNKA 1PRTD 4CHTB 2KJXA 4RAUC 3D4WA 1GUSA 2I07B 2LS01 5J1ZA 1B1ZA 2DNEA 4UDUC 4FF2A 1OXXK 1JCKB 2QKIC 1JQYD 1SBBB 1DZ1A 2WB1B 3P1HA 3BS1A 1X3QA 1D5ZC 3A7LA 1HUMA 2WINB 5K36H 3NE5B 5BN5A 2DY7A 1MSHA 4QUCA 1ZKOA 2NBFA 3GP7A 4TKOB 2KCCA 3BDLA 3Q0AA 4IFDI 5EKLA 1Z7TA 1ILQA 3C2PA 1RTNA 1ZYRC 2RBMA 4RCNA 3X3NA 4G7OC 4R8IA 5I9OA 1II3A 1SE4A 5KNCA 3MZ5A 1JWMD 4HMJA 5FLXE 5AFWA 2ICIA 5CV5A 3NWTA 3NQTA 3MEHA 5G3LF 5JJZA 2X69A 5JOBA 5I6YA 2L4NA 4DAVA 1STHA 2FINB 2EYPA 3GTMB 4KTAA 2NVTB 5EQ0A 4KD4A 1G2TA 4XIGS 3NBHA 3VA7A 1TWFB 3J80L 2MJ8A 4RWSC 1NR2A 5IOCA 3W2DA 3QOLA 2A5HA 2FMCA 3TMEA 1IL8A 4KY5A 4KMUC 2K28A 1TIID 5C4JB 2ENBA 2EYMA 3BYTB 1CHPD 5E3FA 1B4OA 1DXMA 4KY6A 5A2QL 1KNAA 2RSOA 3TSSA 4BA1I 5CYUA 5IT9L 2N55A 2FHTA 1TWCB 3PIP3 1XXGA 2HDLA 1RCVD 4EGVA 2NB0A 4FYDA 4DAYA 2JA8B 1I4HA 2RA4A 2XN9C 2IJ0A 3U9OA 2PPBC 2H4OA 1KTKA 5JVG3 3PUVA 1PTOF 3ND8A 2K1BA 5CBAE 1LT6D 3OSOA 1M8AA 4IUNA 4KI0A 4KJNA 5C3WA 2L12A 3CQZB 1Q8IA 4DAPA 5EPJA 5K5PA 4IFDG 5CR3A 1STEA 3CU7A 4X3UA 4DXFA 3I4MB 2F0QA 1YNNC 3MXUA 4ILWA 1EU4A 3I90A 4KV6A 4WRDA 4BWGB 4Q5VA 1R9TB 2B8FA 1FNWA 3KBXA 2IX0A 3TDQA 4ZUIA 3BG3A 3TP8A 1LACA 1C48A 3EROA 4L6TB 5EBCA 1MD2D 2YU9B 3VYRA 1ZXTA 2C9OA 3VYUA 2EPBA 4NP5A 1PTOC 5M3MB 1LT3D 4K2KA 3T51B 1BDOA 3A54A 2O2LD 2AUKA 3VR4A 4KD3A 2A6ED 4A3KB 4C3HB 4OIKA 1TS3A 2K01A 1RODA 3RLFA 3H91A 2D2CC 3GTQB 1FNVA 4XTCS 1I6HB 3ITPA 2KUMA 2BCOA 3MFYA 3RMHA 4V0BA 1PZJD 3BZDB 3QWNA 2GA4B 1I3QB 2WP8J 2DN8A 2F0DA 4DU9A 5C6AA 4EQOA 2AWNA 2ZXRA 1O7LA 2NTSA 1G91A 3I4NB 2XRSD 1CFMA 1DJRD 1SMYC 2LMCB 2RDHA 2LY7A 3DHQA 1ENCA 1LTRD 2XNAC 3DWPA 2M9VA 4CKEA 1VMCA 4LJZC 3S9WA 2ZXOA 3URYA 2E2IB 1STGA 1KLGD 2QCPX 5CV9A 4CJ1B 2X6LA 1OXUA 2KECA 2PYKA 2X6GA 3AMUA 1S5DD 3OIQA 3M4OB 1D5MC 1WD1A 1PZKD 3NXWA 4U673 5JEAJ 3Q6SA 3QIAA 1JWSD 4A3MB 3JAML 2F0UA 3TN2A 1ESRA 3OW7A 1ET6A 2AQ1B 2EYHA 1BCPD 5C4XB 2B2WC 3KK7A 3E0JA 1TWGB 5FO8B 3VR5A 1FGBD 2PW7A 5M5XB 2A69C 4PMCA 1E2ZA 1OXVA 1EY7A 4FNFA 4HR7B 5IGEA 1L0YB 3NTKA 4DNTB 1B50A 1L0XB 1U9RA 3GTKB 3EA6A 3FPUB 1Y8NB 2B2VA 3KLSX 2G9DA 2KQ3A 1QJOA 1LTBD 1MSGA 1ET9A 2IW3A 1D1KA 4QF4A 3S16B 1EYDA 2QEJC 4NKLA 1CK1A 3ERQA 5EPLA 4C1NK 2FFKB 2B2TA 5JEAH 3OHXC 4L63B 3MXGA 4ZYSA 1JC7A 5FO7B 4G4KA 5KNBA 2KA7A 1CZGA 1HXYD 3NP8A 1PFNA 3S2DB 3P20A 5FK9C 1TT2A 1IYUA 5IODA 1Y8OB 1TR5A 2K04A 3GTGB 1PTOB 1H9SA 4B08A 1EIHA 2VNUD 2XRQD 1IYVA 2JEAI 1U4MA 2EOTA 3PMFA 1F9PA 1PTOH 2L1BA 4R8NA 5JPNC 3ONAB 1WTPA 2NUCA 5E1FA 1TS5A 3A8JE 2KEDA 2AWOA 5EKIA 2VB2X 1SYGA 3GTJB 4CJ2C 1CA6A 2NN6I 5FO9B 3EJIA 4PNYA 1WCMB 2B2YA 3K0YA 2EYLA 2F0WA 1AZQA 1I50B 4DXGA 5KGUA 3FPPA 2BE5C 1Q1BA 1T5XD 3NTHA 1R4PB 2D9UA 1IW7D 4TSSA 5C3XA 1S5ED 4E6IA 2E74C 4I65A 1Y69U 3MA2B 1DOMA 3F2UA 1EEID 4OO1H 5C0XJ 3GQBA 2O4XA 4HSVA 4P2CB 1EQTA 1ESFA 2A6HD 5D3IB 1BBXC 2IX1A 5D65A 2BA1A 3I4LA 3IAYA 3QOJA 1PRTF 2K5WA 5FOBB 1ENAA 3NBIA 5ELCA 1CT1D 3D4RA 3HP3A 3J80E 1QNUA 4IQZA 3K5NA 2DNCA 1HCZA 2J4XA 2F0IA 2NTTA 1KAAA 2VB3X 4FF4A 1RF2D 3FEWX 2R6GA 3FRPB 4R9WA 1S5FD 1O78A 1VF5C 2EVBA 3S1RB 4PQXA 1SNCA 2SNSA 2B63B 1KDAA 4QIWB 4HEDA 4RA8A 1D1IA 1V1OA 5HGTA 4C3IG 4RHSA 4F87A 3BVZA 3T16A 5A2QE 3GV3A 2BA0A 3GV6A 5IT9E 1O7YA 2R3ZA 2NYZD 1DM0B 3K57A 3TZUA 1JOQA 5JEAG 3ND9A 2R92B 1LT4D 1HQRD 1I6VC 1LLRD 4B9WA 1TWAB 4ZAIA 2K03A 2Q8TA 1SAPA 5C0XH 5EGTA 4J6HA 3S1MB 2PNRC 5I6WA 1IKLA 3S17B 4A3FB 3SK6A 4N9PA 2NN6G 4ZKCB 3VYTA 1JOOA 2F0LA 4H44C 2F0FA 1GHKA 2K7VA 1V43A 3NSWA 3MXPA 1O80A 3C1FA 4A3GB 3I72A 3S1NB 2O5IC 3HKZB 3VYSA 3CRLC 1EU3A 2IT1A 4M8AA 3T13A 3KLSA 1LT5D 2OF1A 1QCBD 1D5XC 4IUTA 3E5SA 3SXHA 5EKKA 1IHZA 1PLFA 4B9XA 5C0XI 4CKBA 1GUGA 3BVMA 5IIFA 4H7BA 3GD7A 1I4RA 2E75C 2WAQB 2L11A 1K83B 3KLRA 1SJED 5JPMC 2VUMB 4IUPA 4OIJA 1VMPA 1F77A 1KDCA 1AP0A 1WD0A 2KCNA 2F0TA 2JXMB 3ZYYX 4C56C 4ABNA 5CV8A 4X3KA 1BOSA 1BUVT 4F88A 1GUOA 1Q90A 1Z6HA 4O1NA 4XYQA 3C46A 1B9NA 2XSCA 3I70A 2H1EA 2E2HB 1TQOA 1ONLA 2FMMA 3K5MA 1LV9A 1CZWA 3L9AX 2KOLA 2EXZA 2PW5A 3A55A 4XYOA 2QDBA 1HPCA 5I4DA 3DMUA 2EY5A 2J0TD 2Y0SB 1UUPA 2HDMA 3OMCA 2NVXB 4FXKC 4K8IA 3R2TA 3HS0C 1X32A 2MP1A 2EDGA 4KKSA 3V2TA 1PFBA 1DOKA 3L7ZC 4IURA 5KIXA 5KNDA 2JE6I 1AW7A 3H3VC 2RQXA 2JA5B 5ELEA 1DYQA 1CM9A 1JR0D 3JAME 4CKCA 3K5OA 3H09A 2CW0D 1PMRA 1A3TA 1EEFD 4FXDA 2M00A 1JORA 5D14A 4A3IB 3DEOA 3O13A 4EQNA 1ML0D 3MWYW 2PQEA 3G6JB 1DCZA 4J8QA 3A56A 4RCOA 1YNND 4PMWA 2L55A 2WV6D 2DY8A 4A93B 3H6MA 4LAAA 4FXGC 4JK1C 2PCFB 1H9SB 2XIWA 2Z1CA 1MBYA 1PRTB 1UNSA 3V96A 5C0XG 3BYYB 4KN4C 5K36G 4IALA 1SFOB 1TS2A 3P75A 1LTGD 2XVSA 3MXNA 3E6ZX 1X3PA 2HUGA 3BVGA 5BN4A 3SHLA 1GHJA 1RDPD 4FP5D 2CHBD 1WVLA 4K6DA 4L8JA 2VXWA 3RZOB 2Z4IA 2EY1A 4CBVA 1EWCA 5KRUA 2V4DA 2O5JC 1I4GA 4HN7A 2SEBD 1SMYD 3HGBA 4ID6A 4XXEA 1WTRA 1B53A 1QOHA 1D6EC 1XX8A 1BCPF 5C5LA 1B2TA 4BA2I 1I4PA 1HUNA 1JE4A 2F0JA 2TMPA 1F2MA 1U4RA 1HFGA 1H9KA 4WJWA 3Q22A 2ZT9C 3Q23A 3SDZA 5F2DA 3HZXA 3GO5A 3OWFA 1PFMA 3SK4A 4K6LA 3VR2A 4K5WA 4HMIA 1H9MA 2EJGC 1ICWA 3TZDA 3LNNA 3MFGA 1I4XA 5T1GA 5C4HA 4HSPA 4KJOA 1EY0A 3A8IE 5KYLA 3HOYB 1Y1VB 2AUJD 1KLUD 4J1MA 2JSOA 1AZPA 5CC4A 5IGBA 1H9RA 1A15A 1H9JA 1EWHA 4C3JB 1EZ8A 4HCSA 2JA6B 1A2UA 2B2UA 5NUCA 1CQVA 1HQMC 4IUVA 4A3BB 3J7AF 2F3VA 1U4PA 4V190 1QG7A 2PZWA 1STYA 3W3AA 4DK0A 3M7NA 1JWUD 1G291 1YNJD 4GZYC 3K6OA 4H0LC 3M85A 4XQNA 4RGOS 3KF8A 4U68A 2F0NA 3NTIA 4UAIA 3RUZA 4DGZA 1I4QA 5CV7A 1R4QB 5DAUA 5M3FB 1SNDA 1RJTA 3S15B 1QE6A 1EY6A 5CBEE 3NWSA 1SYDA 2YYZA 3K5LA 4F7XA 3QB3A 5D3DA 1SNOA 1HA5A 3L3OC 3FMCA 1CI3M 4LMQD 1TY0A 2RVLA 2TSSA 5DM63 1A6XA 2XWJB 3RD4A 1SNPA 3DWAA 5ELBA 3CRKC 5CV6A 4HCEA 3PUWA 4C3HG 4OHJA 1B3AA 4RH6A 5JAVA 1QB5D 2PMZB 3DUZA 1STAA 2LKVA 2L9HA 1FNUA 4KHVA 3IFTA 1LO5D 1EY4A 1F9QA 5FKAC 2OXPA 2C5CA 4ZQ3A 1OO9B 3HG9A 1LTTD 4XT1B 3PO2B 3J7YW 2SOBA 1G8ZD 4A3JB 1JOKA 2R7ZB 2BDNA 3HOUB 4ZLTF 4FF3A 2F0PA 3QJYA 4OL7A 3MAQA 1TKWB 1STBA 1AN8A 2E2JB 2G9HD 2HCCA 1NR4A 3OIPA 3MVVA 5M5YB 3KBGA 3PIO3 4WFN3 2RSNA 5ELDA 3K7AB 1PXUA 1EYCA 2F0EA 3J7AV 1ENFA 2B2VC 3P7JA 1SYCA 3HEJA 2K33A 4ZUJA 2Q8IB 2RDFA 5HURA 3H0GB 3N6RA 1BQQT 3WDNA 2I46A 1EFID 2A68D 1SNQA 1FD7D 3PUXA 3GTLB 1GUTA 3GTPB 3M4YA 2B2TC 3I8ZA 4K2LA 4RKBA 3HOXB 1QWYA 4G7ZC 4KN7C 3CHBD 2K05A 4QCLA 2K5DA 3U9SA 4YIJA 1BCPB 3DEPA 3J81L 4RFBA 4H13C 5CORA 2RKSA 2SNMA 4DF7A 1EY9A 4DNRB 2F0MA 4OO1I 3Q24A 1CA5A 1Q12A 5J39A 1PRTC 4RKLA 5CMDA 4FF1A 3LWUA 4JBWA 3VR6A 4ME5A 3A7AB 3HRZC 2HQEA 3MTSA 1HTPA 3SR1A 5LL6X 3CKIB 5EBDA 3PUYA 1Y8PB 2ICEC 3OWEB 3T56B 4DFAA 2B2YC 1WTWA 3SE0A 2WKCA 5BN3A 1E2VA 4DK1A 4A3EB 1VCIA 2N88A 3M3YB 1BXTA 3S14B 1SEBD 1GJXA 1ZYRD 3T53B 1VF7A 3QG1A 4KY7A 2OT2A 5LL6S 1F2LA 2BOSA 1TS4A 1B9MA 3I91A 4PMBA 1A3UA 2FJ2A 1WTXA 2PZUA 1RD9D 3I3CA 3WOFA 4A3DB 5EPKA 2Q8RE 4XQQA 3NUCA 4X3SA 2KVMA 2B8GA 2AQ2B 3NK9A 1SNMA 1MI2A 3D3RA 5J22A 2F03A 2OEOA 3DM1A 2F0OA 3D31A 1C4QA 1DD2A 4X3TA 1GOZA 1TWHB 1EL0A 3FVQA 1F9RA 2BDOA 5M9OA 2EYJA 1ILPA 2LFNA 1LTID 1V1PA 4Y7NB 1Q3LA 3HOZB 2EYFA 2QF7A 4OO1G 2EY2A 2KHSA 5G3LD 1SYEA 3AU7A 3NQIA 3PV0A 4M1UB 3PUZA 4G57A 3AB9A 1C8CA 4BY7B 4DA2A 1NCVA 1K8OA 3M7GA 1NAPA 5DNFA 1HFNA 1E2WA 2KEEA 2A73B 1JICA 3TBIB 3NPPA 2MHVA 1EYAA 4EVOA 5KYIA 4F8MA 3K59A 1RTOA 1UAPA 1IKMA 2RDGA 1AEXA 4XT3B 1GXDC 2CVRA 3BDCA 1S5BD 3R93A 2EZVA 4K14A 5C3EB 4AYBB 1J8IA 3VA5A 2CW0C 4FO2A 2IWHA 4K8JA 4EQPA 5C44B 1EOTA 2B2WA 3TP7A 1WTVA 3G7LA 1UEAB 4FVMA 2Z4HA 2MGSA 1GUWA 2PO4A 5FLXL 2JYOA 2WKDA 1PTOD 2E76C 1Z47A 1S5CD 2A6EC 1Y1WB 3SVMA 2EJFC 4QMGA 1SSOA 2R61A 1EY8A 2XWBB 5ELFA 5JVH3 3R8BA 3S2HB 1A2TA 2F3WA 1CTMA 1S4ZA 2F4IA 2L0CA 1STNA 1T5EA 5E4XA 4NDXA 1KABA 1B44D 1EQVA 4OGQC 1PDQA 2SDFA 4ODGA 1K8MA 2EYOA 3N52A 3HOWB 3VR3A 2K6AA 1KNEA 5IGGA 3RZDB 4ZRZA 4KKTA 5LHY1 3SK8A 3IFDA 5I2YA 2JP1A 5DM73 4NW2A 3EQLC 1ZEQX 2F0SA 1W6KA 1SDFA 5A35A 4XDXA 5CGKA 4HTHA 4CJ0B 2CQAA 1BNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FMM A;  4R8I A;  1LV9 A;  1MI2 A;  2MGS A;  1DON A;  1IKL A;  2KOL A;  5EJW A;  5EPL A;  4ZKB B;  3DM1 A;  1G6Z A;  4IUV A;  4IUP A;  1GUW A;  1VMC A;  2FFK B;  1U4P A;  2JYO A;  2B2T A;  2BDN A;  4X3T A;  5CMD A;  1WVL A;  1DOM A;  2HDM A;  4ZKC B;  2IL8 A;  2K1B A;  4HAE A;  5CBA E;  2VXW A;  3F2U A;  1EL0 A;  1F9R A;  1M8A A;  1QG7 A;  5AFW A;  1WTQ A;  4ZLT F;  5E4W C;  2L12 A;  2MPM A;  4CJ1 B;  2X6L A;  1X32 A;  1ILP A;  2MP1 A;  4IUQ A;  5EPJ A;  3SVM A;  1HRJ A;  2KEC A;  2X6G A;  4ZK9 B;  4X3U A;  3MTS A;  5JJZ A;  2HCI A;  1PFB A;  1SSO A;  1DOK A;  1Q3L A;  4HSV A;  2X69 A;  1O80 A;  1PFN A;  2NZ1 D;  2L4N A;  1WD1 A;  2HCC A;  1EQT A;  1RHP A;  1NR4 A;  4IUR A;  1F9S A;  1WTO A;  3I90 A;  2FIN B;  1BBX C;  3KBX A;  4U68 A;  5D65 A;  3Q6S A;  4O42 A;  2RSN A;  5EQ0 A;  1HHV A;  3IL8 A;  1G2T A;  4UAI A;  1C8C A;  1WTR A;  1B53 A;  1S4Z A;  1J9O A;  1NCV A;  1TVX A;  2B2Y C;  2K04 A;  5T1I A;  2NWG A;  3FDT A;  4IUT A;  2MJ8 A;  1WTW A;  1XX8 A;  1O7Z A;  1NR2 A;  1E0B A;  1QNK A;  1CM9 A;  4RWS C;  3TN2 A;  1ZXT A;  5E4X A;  2B2V C;  3HP3 A;  1B2T A;  3KUP A;  1ESR A;  3P7J A;  3GV6 A;  4RAU C;  4CJ2 C;  1HUN A;  1JE4 A;  3D6W A;  2EPB A;  1EIH A;  1NAP A;  1PLF A;  4QUF A;  1RJT A;  1U4R A;  5COY A;  5DNF A;  1IL8 A;  2B2W C;  1U4M A;  1HFG A;  2EOT A;  1QE6 A;  1U4L A;  2K28 A;  3LWE A;  4DN4 M;  1HFN A;  4OIK A;  1PDQ A;  2K01 A;  4R9W A;  2SDF A;  1ROD A;  5D14 A;  2KEE A;  2N88 A;  1F9P A;  3DEO A;  2B2U C;  3H91 A;  5CBE E;  1ML0 D;  1JIC A;  1BF4 A;  2L1B A;  1G2S A;  2J7Z A;  3MWY W;  3N52 A;  3UI2 A;  3TZD A;  1B4O A;  3ONA B;  1WTP A;  2L11 A;  4LMQ D;  2B2T C;  3I8Z A;  1PFM A;  2RVL A;  1EIG A;  2KED A;  4HED A;  2KUM A;  1WTX A;  1KNA A;  4RA8 A;  1F2L A;  2DY8 A;  2RSO A;  4IUU A;  1DZ1 A;  5EKI A;  1KNE A;  2N55 A;  1RTO A;  3I91 A;  2M2L A;  1IKM A;  3GV3 A;  1X3Q A;  1ICW A;  2XIW A;  1B3A A;  2FJ2 A;  2FHT A;  1BO0 A;  1O7Y A;  1DOL A;  1HUM A;  1VMP A;  2R3Z A;  2NYZ D;  3I3C A;  2CVR A;  3QO2 A;  4OIJ A;  4XT3 B;  5EPK A;  2K05 A;  1CA6 A;  1AP0 A;  1B50 A;  2Q8R E;  4XT1 B;  2DY7 A;  2EE1 A;  1MSH A;  3R93 A;  1WD0 A;  3IFD A;  2B2Y A;  4QUC A;  2HDL A;  5T1G A;  1J8I A;  2L9H A;  3DEP A;  1HA6 A;  5COR A;  3FPU B;  2JP1 A;  2B2V A;  4MHE A;  4NW2 A;  1AZQ A;  1F9Q A;  4X3K A;  4X3S A;  2RA4 A;  1G91 A;  1XYI A;  2KVM A;  1AZP A;  1SDF A;  1EOT A;  1MSG A;  2B2W A;  1ILQ A;  1MGS A;  1A15 A;  2D9U A;  1X3P A;  2H1E A;  4XDX A;  4MN3 A;  1RTN A;  1WTV A;  3G7L A;  4ZAI A;  2K03 A;  4CJ0 B;  4HCS A;  2HUG A;  2Q8T A;  1SAP A;  1CA5 A;  2B2U A;  1BNZ A; 
#chains in the Genus database with same CATH topology
 2VY3 A;  1FYC A;  2K32 A;  4BBR B;  1SXT A;  4C1N I;  2CH4 A;  3EVQ A;  1YBY A;  3JAM i;  2IL8 A;  5IGF A;  4Q0F A;  2YTX A;  4IPH A;  1BCP C;  3FKI B;  4CDD C;  2Q2I A;  1SR3 A;  3D6C A;  2MPM A;  4BS9 A;  4IUQ A;  1HRJ A;  3D8G A;  4ZK9 B;  2HCI A;  1EZ6 A;  2A69 D;  3IKJ A;  4MIU A;  4K5X A;  4IZ8 A;  4KK7 A;  3FKI H;  3HOV B;  1F9S A;  4LFA Q;  2Y0S G;  2F0K A;  1Q1E A;  4C3J H;  3S1Q B;  4I7Z C;  2F0V A;  1J9O A;  5IGC A;  3HOV H;  5T1I A;  2ALY B;  2JEB I;  2MQH A;  1QVF A;  4A3B H;  3KUP A;  3DXJ C;  4HIO A;  4OWX B;  3I73 A;  3D6W A;  1OTC A;  4C2M B;  4QUF A;  3S1Q H;  2QIL A;  4C3I B;  2FXQ A;  4G7H C;  1CQF A;  1YNJ C;  2AQ3 B;  2ID0 A;  2CKZ B;  4AQY L;  1N34 L;  3LWE A;  4DN4 M;  2JA5 G;  1EQQ A;  2K5Q A;  4LF5 L;  1QIL A;  1PYW D;  1AH9 A;  4C2M H;  5ISR A;  3WOE A;  5DEH A;  4C3I H;  3B6Y A;  3VDY A;  1LTA D;  4DR7 Q;  1EIG A;  3LGJ A;  4LF9 Q;  2NVQ B;  1PH9 A;  3C3L A;  1SJH D;  1B3Q A;  1FVI A;  3R3O A;  4JYA Q;  2ZXP A;  5I2X A;  4WOR A;  1BO0 A;  4A3I G;  1EY5 A;  3QO2 A;  3T4A C;  2EE1 A;  1IBM L;  2I0Q A;  2NVQ H;  1VQ9 A;  1N8R C;  4IPG A;  1M4V A;  5M3F H;  4MHE A;  2F0H A;  2A74 C;  3EFX D;  3J81 E;  4TRD A;  3S15 H;  4KHZ A;  1MGS A;  3A5U A;  5M3M G;  1V8Q A;  1LAB A;  4MN3 A;  3GTO B;  3TP5 A;  1GUN A;  3BDO A;  1K0R A;  1VQE A;  4NMZ A;  2MUY A;  1DON A;  2EY6 A;  2NN6 H;  4DUY L;  1NSN S;  4XQJ A;  1Q8K A;  4PV1 C;  3CCV A;  1HZB A;  5CV4 A;  1PH7 A;  4QB4 A;  3DWQ A;  4N8X 1;  3F1Z A;  3GTO H;  1LTS D;  1XWE A;  3ULP A;  3OMG A;  3CD6 A;  4DR4 L;  3I2Z A;  4ULL A;  1HR0 L;  3I55 A;  5HGQ A;  1F2Y A;  3TS0 A;  3D0F A;  1EQR A;  1GD7 A;  3OOC A;  3H3V I;  2E2D C;  2VQE L;  3GDE A;  2NZ1 D;  5J3B A;  1B70 B;  5LMN L;  1SYB A;  1RHP A;  1WTO A;  4BBS B;  2D62 A;  4K5V A;  3SEB A;  1RKN A;  2RHS B;  2D0O A;  4AIM A;  1HHV A;  3MC0 B;  3IL8 A;  4A76 A;  3RNU A;  2Z8L A;  4P71 A;  1FR3 A;  2ZM6 Q;  1D2B A;  4IOC A;  3H94 A;  2NWG A;  3FDT A;  3PO2 H;  5FJ8 G;  1O7Z A;  5IGD A;  4A3J H;  2CH4 W;  3MEF A;  2IPK D;  4IJL A;  3NEM A;  4RG1 A;  1V1P B;  3R2I A;  5COY A;  2F0G A;  3T1H Q;  1U4L A;  1RL2 A;  4B3M Q;  5ELO A;  2PI2 A;  4K0K Q;  4KKU A;  2BE5 D;  3X3M A;  4X64 L;  1BF4 A;  2B2U C;  3CCS A;  2WAC A;  1IW7 C;  1G2S A;  2J7Z A;  1P16 A;  3UI2 A;  1TU2 B;  3C1E A;  4IFD J;  2HHH Q;  5TSS A;  4DR6 Q;  1XTC D;  3OPO A;  1VQO A;  3V05 A;  3JC6 6;  4IUU A;  2R93 B;  4S3S A;  1A3V A;  2EJM A;  1J5E Q;  4DR3 L;  2M2L A;  2NVY B;  3K7A H;  2IX3 A;  4PG3 A;  1DOL A;  4JI1 Q;  3A8K E;  1F2Z A;  3HFZ B;  3CC2 A;  1K3B C;  4N8F A;  2R93 H;  2VS1 A;  1EIF A;  4A3M G;  5KEE A;  1HA6 A;  3KDF A;  4RGM A;  4RGT A;  3UDG A;  1HTL D;  4LK1 C;  4HJ7 A;  2L5T A;  1SE3 A;  1PHJ A;  3MHB A;  1QUQ A;  4LWC A;  2A6H C;  1XYI A;  3H0G H;  1VDZ A;  4GS3 A;  4LUV A;  2A68 C;  1NMG A;  4UP9 A;  3NHH A;  4ZKB B;  5EJW A;  4HJ5 A;  4CDC C;  1VQD A;  3GTP H;  1G6Z A;  4TQU S;  1SE2 A;  3HOY G;  1Y1V G;  1KDB A;  2UXB L;  3PO3 B;  1OXT A;  2F1M A;  4HAE A;  2D5D A;  4CGY B;  3HOX H;  2PZT A;  2WII B;  1K9M C;  1WTQ A;  5E4W C;  4C3J G;  1PH8 A;  3TRZ A;  2JA9 A;  1W6J A;  5IP9 H;  1NUC A;  2JA6 G;  4AQY Q;  1N34 Q;  1AFP A;  4N9T A;  1HNW L;  2B39 A;  1BR9 A;  3D4D A;  4RHR A;  3SK5 A;  1S40 A;  3PO3 H;  3K58 A;  4LF5 Q;  1OXS C;  3TP6 A;  4IN3 A;  2EQS A;  3KF6 A;  5C5M A;  1JB3 A;  4RGN A;  1PZI D;  1TY2 A;  3LX0 A;  4Z9C B;  4O42 A;  1CHQ D;  3H15 A;  2JA7 B;  3K7U C;  1TVX A;  5C4Z A;  4BY1 B;  3QR8 A;  4IFD H;  1SYF A;  5M5W B;  5I9P A;  1E0B A;  1QNK A;  4GOP C;  1XNR L;  1PRT D;  4CHT B;  2KJX A;  4RAU C;  3D4W A;  1GUS A;  2I07 B;  1IBM Q;  4JI4 L;  3AFP A;  2LS0 1;  5J1Z A;  1B1Z A;  2DNE A;  1B7Y B;  4UDU C;  4FF2 A;  1OXX K;  1FL0 A;  5M5W H;  2HT1 A;  1JCK B;  4O2D A;  1IL2 A;  2QKI C;  1JQY D;  1SBB B;  5M3F G;  3KOJ A;  1EIY B;  1HJP A;  1CKN A;  4DUY Q;  1DZ1 A;  2WB1 B;  3P1H A;  3BS1 A;  4AYB E;  1X3Q A;  3CCE A;  1D5Z C;  3A7L A;  1HUM A;  2WIN B;  2UU9 L;  4DR4 Q;  5K36 H;  3NE5 B;  2B3G A;  2DY7 A;  5BN5 A;  1MSH A;  1HR0 Q;  2OQK A;  4QUC A;  1G51 A;  1ZKO A;  2NBF A;  4BXX G;  3GP7 A;  4TKO B;  2VQE Q;  2KCC A;  3BDL A;  1FJG L;  3Q0A A;  4IFD I;  3KJP A;  1H95 A;  5LMN Q;  4LFB L;  4A3C H;  5EKL A;  1Z7T A;  4A3E H;  2A1A A;  1ILQ A;  2ES2 A;  3C2P A;  4YHH L;  1RTN A;  1ZYR C;  1HZC A;  3M3Y H;  2I5L X;  2RBM A;  3S14 H;  4RCN A;  3X3N A;  4G7O C;  4R8I A;  5I9O A;  1JT8 A;  3RN2 A;  4B3S L;  1II3 A;  1SE4 A;  5KNC A;  3MZ5 A;  1JWM D;  1MKH A;  4HMJ A;  1E1T A;  5FLX E;  5AFW A;  2ICI A;  3OTO L;  1VQM A;  1IBK L;  5CV5 A;  3NWT A;  4A3D H;  3NQT A;  3MEH A;  5G3L F;  1UE6 A;  5JJZ A;  3PO2 G;  5ELN A;  2X69 A;  5JOB A;  4A4I A;  4X64 Q;  5GRO A;  4A3J G;  5I6Y A;  2L4N A;  1WCM G;  2R7Z G;  4DAV A;  4DK6 C;  1QZH A;  1STH A;  2FIN B;  2EYP A;  3GTM B;  4KTA A;  2NVT B;  1XPU A;  2HD3 A;  3HOU G;  5EQ0 A;  4KD4 A;  1G2T A;  1U0L A;  4XIG S;  3NBH A;  4DR3 Q;  1BBU A;  3VA7 A;  1YZ6 A;  2K52 A;  1TWF B;  3J80 L;  4HJ9 A;  2MJ8 A;  4RWS C;  1NR2 A;  3RLO A;  4JVZ A;  2ZTC A;  5IOC A;  3W2D A;  2NVT H;  3QOL A;  3ULL A;  2A5H A;  2FMC A;  3TME A;  1EFW A;  2Z6K A;  1IL8 A;  1TWH H;  4KY5 A;  4KMU C;  1TWF H;  2K28 A;  5FLM G;  1TII D;  5C4J B;  4HID A;  2ENB A;  3STB C;  2EYM A;  3BYT B;  4Y7N H;  1CHP D;  1XPR A;  3HOZ H;  5E3F A;  1B4O A;  1DXM A;  2OQ0 A;  4KY6 A;  5A2Q L;  1KNA A;  2RSO A;  1YIJ A;  3TSS A;  4BA1 I;  3M9B A;  5CYU A;  5IT9 L;  3H0G G;  2N55 A;  3U4V A;  2UXB Q;  2FHT A;  1TWC B;  3J81 c;  4APV A;  4BY7 H;  4O0A A;  3PIP 3;  1XXG A;  2HDL A;  1RCV D;  1HNW Q;  4EGV A;  3I56 A;  2NB0 A;  4FYD A;  4YY3 L;  4DAY A;  2JA8 B;  4CDE C;  1I4H A;  2RA4 A;  2XN9 C;  2IJ0 A;  3U9O A;  2XTI A;  2PPB C;  5IP9 G;  2H4O A;  3K80 C;  1HNZ L;  1KTK A;  4DK3 C;  5JVG 3;  3PUV A;  1PTO F;  3F2D A;  4WJ3 M;  3ND8 A;  3HKS A;  1XNR Q;  2K1B A;  3ERS X;  5CBA E;  1LT6 D;  3OSO A;  1M8A A;  4IUN A;  4KI0 A;  4KJN A;  1UWV A;  4JI4 Q;  5C3W A;  2L12 A;  3CQZ B;  1Q8I A;  4DAP A;  5EPJ A;  2IHE A;  5K5P A;  4I7A A;  4IFD G;  5CR3 A;  1STE A;  4DNI A;  3CU7 A;  4X3U A;  5C3E H;  2EXD A;  4DXF A;  3I4M B;  2F0Q A;  1YNN C;  3MXU A;  4ILW A;  1EU4 A;  3U58 A;  3I90 A;  4KV6 A;  4WRD A;  4BWG B;  3CQZ H;  4Q5V A;  1EUJ A;  5C44 H;  3W1G A;  2B8F A;  1FNW A;  3KBX A;  2IX0 A;  1R9T B;  3TDQ A;  5H1S E;  3I4M H;  4UPA A;  3BG3 A;  4ZUI A;  1BBW A;  1KL9 A;  3TP8 A;  1X54 A;  1LAC A;  1C48 A;  1VQ7 A;  3ERO A;  4L6T B;  5EBC A;  1MD2 D;  2YU9 B;  3VYR A;  1ZXT A;  2UU9 Q;  2C9O A;  4LF8 L;  3VYU A;  2EPB A;  4NP5 A;  2UXD L;  1PTO C;  4IPC A;  5M3M B;  1LT3 D;  4K2K A;  3T51 B;  1BDO A;  3A74 A;  3A54 A;  2O2L D;  2AUK A;  3VR4 A;  4R4T A;  4KD3 A;  1FJG Q;  2A6E D;  4A3K B;  1MJC A;  4C3H B;  4OIK A;  1TS3 A;  3PIO A;  2K01 A;  1Y1W H;  1ROD A;  3RLF A;  3H91 A;  4QL5 A;  2D2C C;  3E9I A;  3GTQ B;  4LFB Q;  1EWI A;  4NXN L;  1FNV A;  4XTC S;  4YHH Q;  2LXK A;  4L5S A;  1I6H B;  3CXC A;  3ITP A;  4GKK L;  2KUM A;  3NEN A;  2BCO A;  3MFY A;  3RMH A;  4V0B A;  1PZJ D;  4B3S Q;  3BZD B;  3S2H H;  4A3C G;  4A3E G;  4B3T L;  3QWN A;  2GA4 B;  4GNX C;  2DJF C;  1I3Q B;  4JOI C;  2WP8 J;  2DN8 A;  3OTO Q;  1IBK Q;  2AMC B;  4JI7 L;  2F0D A;  4DU9 A;  5C6A A;  4EQO A;  1VQB A;  1S3O A;  2AWN A;  3RN5 A;  2ZXR A;  1O7L A;  2NTS A;  1G91 A;  3I4N B;  1I3Q H;  2XRS D;  1CFM A;  1DJR D;  1SMY C;  1JJG A;  4IOA A;  1VS0 A;  1X3G A;  2ZM6 L;  2NZO A;  4A3D G;  4UY8 C;  2LMC B;  2RDH A;  1SLJ A;  4DUZ L;  1K8G A;  2LY7 A;  3HOW H;  3DHQ A;  1ENC A;  1LTR D;  2XNA C;  3DWP A;  3I4N H;  2M9V A;  4CKE A;  1VMC A;  2OTL A;  4LJZ C;  1LYL A;  4HIM A;  3S9W A;  2ZXO A;  3URY A;  2D0P A;  4DR2 L;  2E2I B;  1STG A;  3RZD H;  2LXJ A;  3KDF B;  4P73 A;  3K8A A;  1KLG D;  2QCP X;  4ME3 A;  5CV9 A;  4CJ1 B;  2X6L A;  1OXU A;  2KEC A;  1QUQ B;  2PYK A;  4DPG A;  4L5R C;  2X6G A;  3AMU A;  1S5D D;  3OIQ A;  1C7Y A;  3M4O B;  1D5M C;  1WD1 A;  1PZK D;  3NXW A;  3PQI A;  1PV4 A;  1GVP A;  4U67 3;  4DV7 L;  5JEA J;  4L5Q A;  1J5E L;  3Q6S A;  3QIA A;  1JWS D;  4A3M B;  4JI1 L;  3JAM L;  3BJU A;  2F0U A;  3T1Y L;  3TN2 A;  4BBR H;  2VZA A;  1ESR A;  2KCT A;  3OW7 A;  4PZ6 A;  1ET6 A;  1BKB A;  2AQ1 B;  1HH2 P;  1YJN A;  2EYH A;  1BCP D;  4POG A;  1VQL A;  3RLN A;  5C4X B;  2B2W C;  3KK7 A;  3E0J A;  1TWG B;  5FO8 B;  3VR5 A;  3KF6 B;  1FGB D;  4YY3 Q;  2PW7 A;  4BY7 G;  5M5X B;  2A69 C;  3CPW A;  4PMC A;  1E2Z A;  5IYD G;  2AHO B;  2K4K A;  1OXV A;  1YIT A;  1EY7 A;  4FNF A;  1TWG H;  1HNZ Q;  3W1B A;  2L15 A;  1MHW C;  3PCO B;  4HR7 B;  1NTG A;  5IGE A;  1L0Y B;  5M5X H;  3NTK A;  4DNT B;  1C9O A;  2BH2 A;  2KCM A;  1B50 A;  2KHI A;  1L0X B;  1U9R A;  3GTK B;  1SE8 A;  4OON A;  4LFC L;  3EA6 A;  3FPU B;  1Y8N B;  2B2V A;  3PSI A;  1L1O C;  3KLS X;  2G9D A;  1QZG A;  2KQ3 A;  4JI0 Q;  4YWM A;  1QJO A;  3CP0 A;  1LTB D;  1MSG A;  3GTK H;  1ET9 A;  2IW3 A;  1D1K A;  4QF4 A;  3S16 B;  1EYD A;  1CKN B;  3A5Z B;  2QEJ C;  4NKL A;  5C3E G;  1CK1 A;  3ERQ A;  4AYB G;  5EPL A;  4NPS A;  4C1N K;  2FFK B;  2B2T A;  5JEA H;  3OHX C;  4L63 B;  3MXG A;  5C44 G;  4LF8 Q;  4ZYS A;  1JC7 A;  2UXD Q;  4EQ5 A;  5FO7 B;  3OYY A;  4A93 G;  1FGU A;  4G4K A;  5KNB A;  2KA7 A;  1W3S A;  1CZG A;  1HXY D;  3NP8 A;  1ASZ A;  4GN3 B;  1PFN A;  2C35 B;  1SMX A;  2AKW B;  2QW7 A;  5BR8 L;  4NXN Q;  3S2D B;  1UE1 A;  1V1Q A;  1VQ5 A;  3P20 A;  4AH6 A;  2RF4 A;  5FK9 C;  4GKK Q;  1TT2 A;  1JJC B;  1IYU A;  1VQN A;  2F3I A;  3K81 C;  4QQB X;  5IOD A;  1HZA A;  1Y8O B;  1TR5 A;  2K04 A;  4B3T Q;  3GTG B;  1ASY A;  1VQJ A;  1N36 L;  1PH5 A;  1PTO B;  1H9S A;  4B08 A;  1EIH A;  4OX9 L;  2VNU D;  4JI7 Q;  2XRQ D;  1IYV A;  2JEA I;  2CWP A;  1U4M A;  2EOT A;  3GTG H;  3PMF A;  1F9P A;  1WTH A;  1PTO H;  2L1B A;  1A62 A;  4R8N A;  5JPN C;  2WB1 E;  3ONA B;  1WTP A;  2NUC A;  5E1F A;  3NBH B;  4DUZ Q;  4BBS H;  1TS5 A;  3A8J E;  2KED A;  1WYD A;  2AWO A;  3AEV A;  5EKI A;  2VB2 X;  1KRS A;  1SYG A;  3GTJ B;  4GNX B;  4CJ2 C;  4DR2 Q;  1CA6 A;  2NN6 I;  5FO9 B;  3EJI A;  4PNY A;  3CME A;  3HOW G;  1WCM B;  2P5Z X;  3PIP A;  2B2Y A;  3K0Y A;  4DKA C;  2EYL A;  2F0W A;  1AZQ A;  1I50 B;  4DXG A;  3J7Z C;  5KGU A;  4OWW B;  4MTN A;  3FPP A;  2ZJR A;  2BE5 C;  1XTD A;  1Q1B A;  1T5X D;  3NTH A;  1R4P B;  2D9U A;  3KLW A;  4DV7 Q;  1IW7 D;  4TSS A;  1G6P A;  3ER0 A;  5C3X A;  1S5E D;  4E6I A;  2E74 C;  1YHB A;  3UE0 A;  1SRO A;  4I65 A;  4GN4 B;  1KIX A;  3T1Y Q;  1Y69 U;  2R7F A;  3MA2 B;  1DOM A;  3F2U A;  2NVY H;  1EEI D;  2N49 A;  3AFQ A;  2YV5 A;  4MNO A;  4DAY B;  4OO1 H;  3DM3 A;  5IYB H;  4DR5 L;  5C0X J;  1C0A A;  3GQB A;  2O4X A;  4HSV A;  2JQO A;  4JG2 A;  2Z9H A;  4P2C B;  1EQT A;  1ESF A;  2A6H D;  5D3I B;  1BBX C;  2IX1 A;  5D65 A;  3FKI G;  2BA1 A;  3I4L A;  5GAD C;  3IAY A;  3QOJ A;  1PRT F;  2K5W A;  5FOB B;  4R4Q A;  1D8L A;  1ENA A;  3NBI A;  5ELC A;  1CT1 D;  3D4R A;  5JJK A;  2DJG C;  3HP3 A;  2RHQ B;  3J80 E;  3HOV G;  1QNU A;  4IQZ A;  3K5N A;  2DNC A;  1HCZ A;  2J4X A;  2F0I A;  2NTT A;  2Q2U A;  4LFC Q;  1KAA A;  1YHA A;  2K5H A;  4A3B G;  2VB3 X;  4FF4 A;  1RF2 D;  1EOV A;  3FEW X;  3J81 i;  2R6G A;  3FRP B;  4R9W A;  3F2B A;  1S5F D;  1O78 A;  1VF5 C;  2EVB A;  3S1R B;  4PQX A;  1SNC A;  2SNS A;  2B63 B;  2QDL A;  1KDA A;  1QVC A;  4QIW B;  1X65 A;  4HED A;  1XNQ L;  4RA8 A;  1D1I A;  1V1O A;  3E0E A;  5HGT A;  4RHS A;  4C3I G;  4F87 A;  3BVZ A;  3T16 A;  5A2Q E;  3GV3 A;  4P75 A;  2BA0 A;  2Y0S E;  3J7A 5;  3GV6 A;  1X9N A;  1IYJ B;  4JI5 L;  5IT9 E;  1O7Y A;  2R3Z A;  1E24 A;  2PQA A;  2JA7 H;  2NYZ D;  4BY1 H;  1DM0 B;  3WWV A;  1I5F A;  3K57 A;  3BZK A;  3TZU A;  4LUZ A;  1L1O B;  1JOQ A;  5JEA G;  2N78 A;  3ND9 A;  2R92 B;  1LT4 D;  5BR8 Q;  1HQR D;  1I6V C;  1LLR D;  1NE3 A;  4B9W A;  1TWA B;  4ZAI A;  2K03 A;  4KLK A;  2Q8T A;  1SAP A;  1CSP A;  4J6H A;  5EGT A;  5C0X H;  3S1M B;  2PNR C;  5I6W A;  4WJ4 A;  1PFS A;  1IKL A;  3S17 B;  1VQ6 A;  5GAG C;  4A3F B;  3OW2 A;  3SK6 A;  2UUB L;  2IHF A;  4N9P A;  2NN6 G;  3PF5 A;  4ZKC B;  1TWA H;  3VYT A;  1N36 Q;  1JOO A;  2F0L A;  4H44 C;  2F0F A;  1GHK A;  1PH1 A;  4OX9 Q;  3CCM A;  1SRU A;  2K7V A;  4A3F H;  1V43 A;  3TQY A;  3NSW A;  3MXP A;  1KC8 C;  1O80 A;  3C1F A;  4A3G B;  3I72 A;  3S1N B;  2RCN A;  4YCU A;  3HKZ B;  2O5I C;  3VYS A;  3CRL C;  1EU3 A;  2IT1 A;  4M8A A;  3T13 A;  3F2C A;  3BU2 A;  3KLS A;  1LT5 D;  2OF1 A;  1KRT A;  3ZJY C;  1QCB D;  1D5X C;  4IUT A;  3E5S A;  5GQO A;  1GO3 E;  3S1N H;  4LF6 L;  3SXH A;  1Q86 C;  5EKK A;  1IHZ A;  1X3F A;  1PLF A;  4B9X A;  5C0X I;  4CKB A;  2GVA A;  1VQ8 A;  1GUG A;  2BH8 A;  4IO9 A;  4GLA C;  3BVM A;  5IIF A;  4H7B A;  1GM5 A;  3E3X A;  1AE2 A;  3GD7 A;  1I4R A;  2E75 C;  2QGQ A;  2WAQ B;  1PH6 A;  2L11 A;  1K83 B;  3KLR A;  3CCU A;  1SJE D;  3GTM H;  1SN8 A;  1K73 C;  5JPM C;  2PI2 E;  2VUM B;  4IUP A;  3UDX A;  4OIJ A;  1VMP A;  1F77 A;  1KDC A;  1AP0 A;  1WD0 A;  2KCN A;  2F0T A;  2MFI A;  2JXM B;  2QEX A;  3ZYY X;  4ZCK A;  4C56 C;  4DR5 Q;  4ABN A;  5CV8 A;  1VQH A;  3AQQ A;  2R93 G;  4X3K A;  1BOS A;  2VUM H;  1BUV T;  4F88 A;  1GUO A;  1Q90 A;  1Z6H A;  4TVA B;  4O1N A;  4XYQ A;  3C46 A;  1B9N A;  2XSC A;  3I70 A;  5C4J H;  4JI2 L;  3STB D;  2H1E A;  2E2H B;  1I94 L;  1TQO A;  1Y14 B;  1ONL A;  1X6O A;  2FMM A;  3K5M A;  1LV9 A;  1CZW A;  3L9A X;  2KOL A;  2EXZ A;  2PW5 A;  3A55 A;  4XYO A;  2QDB A;  2OCE A;  1HPC A;  5I4D A;  3DMU A;  2Q2H A;  2EY5 A;  2J0T D;  2Y0S B;  1UUP A;  1YEZ A;  2CQO A;  2HDM A;  3OMC A;  2NVX B;  1NNX A;  4FXK C;  4K8I A;  1PH4 A;  2ZTE A;  3R2T A;  2N3S A;  2UUA L;  3HS0 C;  1TWC H;  3RR5 A;  3IRB A;  1X32 A;  1HNX L;  2MP1 A;  2EDG A;  4KKS A;  2I5H A;  4QJF A;  3HOX G;  4DV3 L;  3V2T A;  1QVG A;  4FDB A;  1PH2 A;  1PFB A;  1DOK A;  4KHP L;  3L7Z C;  4IUR A;  5KIX A;  5KND A;  3PO3 G;  2JE6 I;  2JA8 H;  1AW7 A;  3H3V C;  1A8V A;  1XNQ Q;  2RQX A;  2JA5 B;  1XJV A;  5GAE C;  1PH3 A;  5ELE A;  1DYQ A;  4JI5 Q;  1CM9 A;  1JR0 D;  3JAM E;  4CKC A;  2KBN A;  3K5O A;  2K5V A;  3H09 A;  2JA5 H;  2CW0 D;  1PMR A;  1A3T A;  1EEF D;  4FXD A;  4JI0 L;  3G71 A;  3CPF A;  4DAM A;  4JW0 A;  2M00 A;  4X65 L;  1JOR A;  2JA7 G;  2I5M X;  5D14 A;  4A3I B;  3DEO A;  3O13 A;  4EQN A;  1ML0 D;  5EAY A;  4BY1 G;  3MWY W;  2PQE A;  3G6J B;  1DCZ A;  4J8Q A;  3A56 A;  4RCO A;  1YNN D;  4UP7 A;  4OEM B;  4PMW A;  2L55 A;  2WV6 D;  2DY8 A;  4A93 B;  3H6M A;  4A3I H;  4LAA A;  1R9T H;  4FXG C;  4JK1 C;  5IYC H;  2UUC L;  2UUB Q;  2PCF B;  3CCQ A;  1H9S B;  2XIW A;  2Z1C A;  1JJ2 A;  4LNQ A;  1MBY A;  1PRT B;  1UNS A;  4JBJ A;  4PZ7 A;  3V96 A;  5C0X G;  3BYY B;  2YU9 H;  5IY0 A;  4KN4 C;  5K36 G;  4IAL A;  1SFO B;  1TS2 A;  3P75 A;  1YVC A;  1LTG D;  4YWK A;  5M3M H;  2XVS A;  4LF4 L;  3MXN A;  3E6Z X;  4A3K H;  4C3H H;  1X3P A;  2K14 A;  2F52 A;  2G5D A;  3GTQ H;  2HUG A;  3BVG A;  5BN4 A;  2VQF L;  3SHL A;  1GHJ A;  1I6H H;  1WJJ A;  1RDP D;  4FP5 D;  2CHB D;  2Z6K C;  3KJO A;  1IXR A;  1WVL A;  4K6D A;  4LF6 Q;  4L8J A;  2VXW A;  4IPD A;  2JN4 A;  3RZO B;  1N32 L;  2Z4I A;  2EY1 A;  1O7I A;  2YTY A;  4CBV A;  1EWC A;  5KRU A;  2V4D A;  1N33 L;  2JJQ A;  3RZO H;  2O5J C;  1I4G A;  4JI3 L;  4HN7 A;  2SEB D;  1SMY D;  3HGB A;  3G4S A;  2Q2T A;  3J80 c;  4ID6 A;  2N8N A;  4OXP A;  4XXE A;  1WTR A;  1B53 A;  1QOH A;  1D6E C;  3K0X A;  1XX8 A;  1BCP F;  4L5T A;  5C5L A;  1B2T A;  4X6A H;  4BA2 I;  2VW9 A;  1I4P A;  4UP8 A;  1HUN A;  1JE4 A;  1NY4 A;  2F0J A;  2TMP A;  1VQK A;  2E2I H;  1F2M A;  1U4R A;  1P8L A;  2ZJP A;  1HFG A;  1H9K A;  4HJA A;  4WJW A;  3Q22 A;  2ZT9 C;  3Q23 A;  3SDZ A;  1VQI A;  5F2D A;  2CWA A;  3I7F A;  4RMF A;  4JI2 Q;  3HZX A;  3CC7 A;  3M4O H;  3GO5 A;  1XMO L;  1IZ6 A;  1YI2 A;  1I94 Q;  3OWF A;  1PFM A;  4CDF C;  3SK4 A;  2V1C C;  4K6L A;  3VR2 A;  3HOZ G;  4K5W A;  3EBE A;  1NMF A;  4HMI A;  1H9M A;  2EJG C;  1ICW A;  2MO1 A;  4A3M H;  3TZD A;  2VL6 A;  1T9H A;  2E5L L;  1A0I A;  3LNN A;  4DV6 L;  2UUA Q;  1MIU A;  3MFG A;  1I4X A;  5T1G A;  5C4H A;  4HSP A;  4KJO A;  4JI8 L;  4DV1 L;  1HNX Q;  1EY0 A;  4DV3 Q;  4R4C A;  4J15 A;  3A8I E;  1VQF A;  5KYL A;  3L0O A;  3HOY B;  2JK8 A;  1GKH A;  1Y1V B;  4KHP Q;  2AUJ D;  1KLU D;  4J1M A;  5C4X H;  2JSO A;  1KQS A;  1AZP A;  5CC4 A;  5IGB A;  2PNH A;  1H9R A;  1A15 A;  1H9J A;  1EWH A;  3I4O A;  2A8V A;  1EZ8 A;  4C3J B;  4GLV B;  4HCS A;  2HIX A;  2JA6 B;  1A2U A;  2B2U A;  3HOY H;  1Y1V H;  5NUC A;  1CQV A;  1HQM C;  4IUV A;  1KXL A;  3KFU A;  4A3B B;  2PQA B;  3J7A F;  2F3V A;  1U4P A;  4A3L H;  4V19 0;  3G6E A;  2JA8 G;  1WI5 A;  1RIP A;  2JA6 H;  1QG7 A;  2PZW A;  1STY A;  3W3A A;  4DK0 A;  1CSQ A;  3M7N A;  1JWU D;  1G29 1;  1YNJ D;  3NEL A;  4P74 A;  4GZY C;  3K6O A;  4H0L C;  4X65 Q;  2ZTD A;  1XMQ Q;  2NZH A;  3M85 A;  4X66 L;  5IP7 H;  4XQN A;  5FLX c;  1YHQ A;  4RGO S;  2CCZ A;  3KF8 A;  2MNA A;  2R7D A;  3M4P A;  4U68 A;  1WFQ A;  2A19 A;  3KYH C;  2F0N A;  3NTI A;  1J6Q A;  5GAH C;  4UAI A;  3S16 H;  1VQ4 A;  2UUC Q;  3I4M G;  3RUZ A;  4DGZ A;  3H3V H;  2GN5 A;  5IWA L;  1I4Q A;  5CV7 A;  1R4Q B;  5DAU A;  5M3F B;  1SND A;  1RJT A;  1D7Q A;  2IY5 B;  3S15 B;  1QE6 A;  5IYC G;  1IBL Q;  1EY6 A;  4GKJ L;  4QIW E;  1Q81 C;  5CBE E;  4LF4 Q;  3NWS A;  1A63 A;  1SYD A;  2YYZ A;  4DV2 L;  3K5L A;  3CCL A;  1UE7 A;  4F7X A;  3QB3 A;  4MZ9 A;  5D3D A;  1Y1W G;  1SNO A;  1M90 C;  1HA5 A;  3L3O C;  3FMC A;  1CI3 M;  1LTL A;  1TY0 A;  2RVL A;  4LMQ D;  3S2D H;  2VQF Q;  2TSS A;  5DM6 3;  1A6X A;  2XWJ B;  3RD4 A;  1SNP A;  3DWA A;  5ELB A;  3CRK C;  1WOC A;  5CV6 A;  4HCE A;  3PUW A;  4A3K G;  4C3H G;  4Y52 H;  1BVS A;  4OHJ A;  1B3A A;  4RH6 A;  4BXX H;  5JAV A;  1QB5 D;  2PMZ B;  3DUZ A;  1STA A;  1N32 Q;  2LKV A;  2L9H A;  1FNU A;  4KHV A;  4GOP A;  3IFT A;  1LO5 D;  2ZJQ A;  1N9W A;  1EY4 A;  3Q8D A;  1F9Q A;  5FKA C;  1N33 Q;  4YWL A;  3TS2 A;  2OXP A;  4YCV A;  1Q82 C;  2C5C A;  3BZC A;  4ZQ3 A;  4JI3 Q;  1OO9 B;  3HG9 A;  4B3R L;  1LTT D;  4XT1 B;  3PO2 B;  3CAM A;  3FP9 A;  3J7Y W;  1S72 A;  2SOB A;  1G8Z D;  4A3J B;  1JOK A;  1CKO A;  2R7Z B;  2BDN A;  3I4N G;  1L2F A;  3PGZ A;  3GTJ H;  3HOU B;  1X3E A;  4ZLT F;  4NXM L;  3TRE A;  1JB7 A;  4FF3 A;  2KEN A;  3CC4 A;  2F0P A;  1WCM H;  3M4Q A;  3QJY A;  2F4V Q;  2R7Z H;  4OL7 A;  3MAQ A;  4NB3 A;  5AJ3 L;  1DGS A;  1TKW B;  1STB A;  1AN8 A;  2CFM A;  2G9H D;  3HKZ E;  2E2J B;  2HCC A;  3HOU H;  1NR4 A;  1I50 H;  3OIP A;  3MVV A;  1PYB A;  5M5Y B;  3KBG A;  3PIO 3;  3FHW A;  3U4Z A;  1XMO Q;  3JAM c;  4WFN 3;  2RSN A;  3W5O A;  5ELD A;  3K7A B;  1PXU A;  2K5N A;  1EYC A;  1K28 A;  4R4O A;  2F0E A;  2E2J H;  3E9H A;  3J7A V;  1ENF A;  4PZ8 A;  4OWT B;  1KHI A;  5M5Y H;  1M1K C;  1W2B A;  2B2V C;  3TEH B;  2E5L Q;  3P7J A;  1K0S A;  4DV6 Q;  1SYC A;  3HEJ A;  5FLM H;  3G48 A;  4JI8 Q;  4DV1 Q;  2K33 A;  4BBR G;  2Z6B A;  1X56 A;  4ZUJ A;  2Q8I B;  2RDF A;  2KHJ A;  5HUR A;  3H0G B;  3N6R A;  1BQQ T;  2WAQ E;  3WDN A;  2I46 A;  1VQA A;  1EFI D;  2A68 D;  1SNQ A;  2K75 A;  4DV4 L;  1FD7 D;  3SGI A;  3PUX A;  3GTL B;  1PA6 A;  1GUT A;  4JBK A;  3GTP B;  3M4Y A;  2B2T C;  3I8Z A;  4K2L A;  4RKB A;  3UE1 A;  5C4X G;  3CCJ A;  3HOX B;  3CCR A;  1QWY A;  4G7Z C;  3GTL H;  1U5K A;  4KN7 C;  2B29 A;  3CHB D;  4ALP A;  2K05 A;  4QCL A;  2K5D A;  3U9S A;  4YIJ A;  1NJI C;  4LW1 A;  1BCP B;  3DEP A;  3J81 L;  4RFB A;  4H13 C;  5COR A;  4LF7 L;  2RKS A;  2SNM A;  4A3L G;  4DF7 A;  1EY9 A;  4DNR B;  1JE5 A;  4X66 Q;  2F0M A;  4OO1 I;  4JBM A;  5LMU L;  3S1R H;  3Q24 A;  1CA5 A;  1Q12 A;  5J39 A;  2B63 H;  5IP7 G;  1PRT C;  4RKL A;  5CMD A;  2WFW A;  4FF1 A;  3LWU A;  4JBW A;  4GLX A;  4DV5 L;  3VR6 A;  5IWA Q;  4ME5 A;  3ULJ A;  2YTV A;  4JV5 L;  3A7A B;  3MXN B;  4JC0 A;  3HRZ C;  2HQE A;  4GKJ Q;  3MTS A;  3L2P A;  1HTP A;  3CW2 C;  3SR1 A;  5LL6 X;  3DLL A;  3CKI B;  4DV2 Q;  5EBD A;  3PUY A;  1Y8P B;  2R92 H;  4DR1 L;  2ICE C;  3OWE B;  3T56 B;  4DFA A;  2Z0S A;  5DLQ E;  2B2Y C;  3S1M H;  4OEL B;  1WTW A;  4X62 L;  3SE0 A;  3S17 H;  1CKM A;  2WKC A;  2HIV A;  5BN3 A;  1E2V A;  1LM0 A;  4DK1 A;  5JJL A;  4A3E B;  4YCW A;  1VCI A;  1YNX A;  2N88 A;  5IE8 A;  3M3Y B;  1BXT A;  3S14 B;  1SEB D;  1GJX A;  1ZYR D;  1V9P A;  3T53 B;  4B3R Q;  2OWO A;  1VF7 A;  4A3G H;  3QG1 A;  4KY7 A;  2OT2 A;  5LL6 S;  1F2L A;  3UDI A;  2BOS A;  1TS4 A;  1B9M A;  4BBS G;  3I91 A;  3J81 j;  4PMB A;  1A3U A;  2FJ2 A;  1WTX A;  2RCF A;  2PZU A;  1RD9 D;  3I3C A;  3WOF A;  2LSS A;  5EPK A;  4A3D B;  3AYH B;  2Q8R E;  1EYG A;  1KAW A;  4NXM Q;  4XQQ A;  2HQL A;  1PYS B;  3NUC A;  1X55 A;  5AJ3 Q;  2XGT A;  4X3S A;  2KVM A;  2B8G A;  2E8G A;  2AQ2 B;  1K8A C;  4HJ8 A;  3NK9 A;  1SNM A;  1MI2 A;  3D3R A;  5J22 A;  2F03 A;  2OEO A;  3DM1 A;  2UXC L;  2F0O A;  3D31 A;  1K83 H;  1C4Q A;  1DD2 A;  4EX5 A;  4X3T A;  1GOZ A;  1HZ9 A;  1B8A A;  1TWH B;  4JI6 L;  3J80 i;  3FVQ A;  1F9R A;  1EL0 A;  1Q7Y C;  1UEB A;  2BDO A;  5M9O A;  2EYJ A;  1ILP A;  1TXY A;  2LFN A;  4GNX A;  1VQC A;  1LTI D;  1V1P A;  4Y7N B;  4JOI A;  4DV0 L;  1Q3L A;  5L37 A;  3HOZ B;  2EYF A;  4DV4 Q;  2QF7 A;  4OO1 G;  2EY2 A;  2KHS A;  5G3L D;  5IYB G;  1SYE A;  4IJH A;  3AU7 A;  3NQI A;  2ATW A;  3PV0 A;  3UDF A;  4M1U B;  3PUZ A;  1AE3 A;  3AB9 A;  4G57 A;  2E2H H;  1C8C A;  2EIF A;  4BY7 B;  4GN5 A;  1E3P A;  4DA2 A;  1NCV A;  1ICF B;  4R4I A;  1K8O A;  3M7G A;  4QGU A;  4JCV E;  1NAP A;  2NVX H;  5DNF A;  1K3R A;  4LF7 Q;  1UE5 A;  1YJW A;  1HFN A;  1E2W A;  5IYD H;  2KEE A;  3KF8 B;  2A73 B;  1L0W A;  1JIC A;  3TBI B;  3NPP A;  2MHV A;  1EYA A;  4LFA L;  4EVO A;  5LMU Q;  5KYI A;  1YJ9 A;  4F8M A;  4POF A;  3K59 A;  1RTO A;  1UAP A;  1IKM A;  2RDG A;  1AEX A;  1MJE A;  4XT3 B;  1GXD C;  4DV5 Q;  2CVR A;  3BDC A;  1S5B D;  3S24 A;  3R93 A;  2EZV A;  4K14 A;  5C3E B;  2B63 G;  4JV5 Q;  1Z9F A;  4AYB B;  1XMQ L;  1J8I A;  3VA5 A;  4A75 A;  2CW0 C;  4MTK A;  4FO2 A;  4LUO A;  2IWH A;  4K8J A;  4EQP A;  1Q46 A;  5C44 B;  1EOT A;  2B2W A;  3TP7 A;  2MO0 A;  1WTV A;  3G7L A;  1UEA B;  1KD1 C;  4DR7 L;  4DR1 Q;  5JJI A;  4FVM A;  2Z4H A;  2MGS A;  4LF9 L;  1GUW A;  3U50 C;  1XPO A;  2PO4 A;  1E22 A;  4JYA L;  2ASB A;  5FLX L;  2JYO A;  4X62 Q;  4A93 H;  5E7N A;  2R92 G;  2WKD A;  4UHV A;  1PTO D;  1IBL L;  4GOP B;  3PF4 A;  2E76 C;  1Z47 A;  1S5C D;  2WB1 G;  2A6E C;  1Y1W B;  1LUZ A;  3SVM A;  2EJF C;  3EIV A;  4QMG A;  1SSO A;  2DGY A;  2H5X A;  2R61 A;  1EY8 A;  1SFO H;  4A3F G;  2XWB B;  4HIK A;  5ELF A;  4R1J A;  1L1O A;  5JVH 3;  2OTJ A;  3R8B A;  3S2H B;  1A2T A;  2F3W A;  3ICE A;  1HR0 W;  1CTM A;  1S4Z A;  2F4I A;  2L0C A;  1E1O A;  1STN A;  1T5E A;  5E4X A;  5HY6 A;  3CMA A;  4NDX A;  4A3G G;  5LMN W;  1PVO A;  1KAB A;  1B44 D;  3HKZ G;  1EQV A;  1NBW A;  2K50 A;  4OGQ C;  1PDQ A;  3F8T A;  2SDF A;  4ODG A;  1K8M A;  2EYO A;  3N52 A;  3CF5 A;  3HOW B;  5FJ8 H;  1VQP A;  3VR3 A;  1VQG A;  2DUD A;  2K6A A;  2PMZ E;  1KNE A;  2UXC Q;  5IGG A;  3RZD B;  4ZRZ A;  4KKT A;  5LHY 1;  4JI6 Q;  3SK8 A;  2GVB A;  2F4V L;  1CUK A;  2WAQ G;  3IFD A;  3EN2 A;  3A0J A;  4H02 A;  5I2Y A;  3T1H L;  2JP1 A;  5DM7 3;  4NW2 A;  4B3M L;  4K0K L;  2QA4 A;  4DV0 Q;  3EQL C;  1ZEQ X;  5IT9 c;  2F0S A;  4P72 A;  1W6K A;  1SDF A;  5A35 A;  2VUM G;  2HHH L;  4XDX A;  5CGK A;  4DR6 L;  4HTH A;  4CJ0 B;  1E7Z A;  4JPB W;  2CQA A;  1JMC A;  1BNZ A;  4QY7 A; 
#chains in the Genus database with same CATH homology
 1FYC A;  2K32 A;  4BBR B;  1SXT A;  4C1N I;  3EVQ A;  2IL8 A;  5IGF A;  4Q0F A;  1BCP C;  3FKI B;  3D6C A;  2MPM A;  4BS9 A;  4IUQ A;  1HRJ A;  3D8G A;  4ZK9 B;  2HCI A;  1EZ6 A;  2A69 D;  3IKJ A;  4MIU A;  4K5X A;  4IZ8 A;  4KK7 A;  3HOV B;  1F9S A;  2F0K A;  1Q1E A;  3S1Q B;  4I7Z C;  2F0V A;  1J9O A;  5IGC A;  5T1I A;  2JEB I;  3KUP A;  3DXJ C;  3I73 A;  3D6W A;  4C2M B;  4QUF A;  2QIL A;  4C3I B;  4G7H C;  1CQF A;  1YNJ C;  2AQ3 B;  2ID0 A;  3LWE A;  4DN4 M;  2K5Q A;  1QIL A;  1PYW D;  5ISR A;  3WOE A;  5DEH A;  1LTA D;  1EIG A;  2NVQ B;  3C3L A;  1SJH D;  3R3O A;  2ZXP A;  5I2X A;  4WOR A;  1BO0 A;  1EY5 A;  3QO2 A;  3T4A C;  2EE1 A;  1M4V A;  4MHE A;  2F0H A;  2A74 C;  3EFX D;  3J81 E;  4TRD A;  4KHZ A;  1MGS A;  1V8Q A;  1LAB A;  4MN3 A;  3GTO B;  3TP5 A;  1GUN A;  3BDO A;  4NMZ A;  2MUY A;  1DON A;  2EY6 A;  2NN6 H;  1NSN S;  4XQJ A;  4PV1 C;  5CV4 A;  4QB4 A;  3DWQ A;  1LTS D;  1XWE A;  3OMG A;  4ULL A;  1F2Y A;  3OOC A;  2E2D C;  2NZ1 D;  1SYB A;  1RHP A;  1WTO A;  4BBS B;  2D62 A;  4K5V A;  3SEB A;  1RKN A;  1HHV A;  3MC0 B;  3IL8 A;  2Z8L A;  1D2B A;  1FR3 A;  3H94 A;  2NWG A;  3FDT A;  1O7Z A;  5IGD A;  2IPK D;  1V1P B;  3R2I A;  5COY A;  2F0G A;  1U4L A;  4KKU A;  2BE5 D;  3X3M A;  1BF4 A;  2B2U C;  2WAC A;  1IW7 C;  1G2S A;  2J7Z A;  3UI2 A;  1TU2 B;  3C1E A;  4IFD J;  5TSS A;  1XTC D;  3OPO A;  3V05 A;  4IUU A;  2R93 B;  4S3S A;  1A3V A;  2EJM A;  2M2L A;  2NVY B;  2IX3 A;  1DOL A;  3A8K E;  1F2Z A;  5KEE A;  1HA6 A;  4RGM A;  4RGT A;  1HTL D;  4LK1 C;  2L5T A;  1SE3 A;  3MHB A;  2A6H C;  1XYI A;  1VDZ A;  2A68 C;  3NHH A;  4ZKB B;  5EJW A;  1G6Z A;  4TQU S;  1SE2 A;  1KDB A;  3PO3 B;  1OXT A;  2F1M A;  4HAE A;  2D5D A;  4CGY B;  2PZT A;  2WII B;  1WTQ A;  5E4W C;  4C3J G;  1W6J A;  1NUC A;  1AFP A;  4N9T A;  2B39 A;  1BR9 A;  3D4D A;  4RHR A;  3SK5 A;  3K58 A;  1OXS C;  3TP6 A;  4IN3 A;  5C5M A;  1JB3 A;  4RGN A;  1PZI D;  1TY2 A;  3LX0 A;  4Z9C B;  4O42 A;  1CHQ D;  2JA7 B;  1TVX A;  5C4Z A;  4BY1 B;  4IFD H;  1SYF A;  5M5W B;  5I9P A;  1E0B A;  1QNK A;  1PRT D;  4CHT B;  2KJX A;  4RAU C;  3D4W A;  1GUS A;  2I07 B;  2LS0 1;  5J1Z A;  1B1Z A;  2DNE A;  4UDU C;  4FF2 A;  1OXX K;  1JCK B;  2QKI C;  1JQY D;  1SBB B;  1DZ1 A;  2WB1 B;  3P1H A;  3BS1 A;  1X3Q A;  1D5Z C;  3A7L A;  1HUM A;  2WIN B;  5K36 H;  3NE5 B;  5BN5 A;  2DY7 A;  1MSH A;  4QUC A;  1ZKO A;  2NBF A;  3GP7 A;  4TKO B;  2KCC A;  3BDL A;  3Q0A A;  4IFD I;  5EKL A;  1Z7T A;  1ILQ A;  3C2P A;  1RTN A;  1ZYR C;  2RBM A;  4RCN A;  3X3N A;  4G7O C;  4R8I A;  5I9O A;  1II3 A;  1SE4 A;  5KNC A;  3MZ5 A;  1JWM D;  4HMJ A;  5FLX E;  5AFW A;  2ICI A;  5CV5 A;  3NWT A;  3NQT A;  3MEH A;  5G3L F;  5JJZ A;  2X69 A;  5JOB A;  5I6Y A;  2L4N A;  4DAV A;  1STH A;  2FIN B;  2EYP A;  3GTM B;  4KTA A;  2NVT B;  5EQ0 A;  4KD4 A;  1G2T A;  4XIG S;  3NBH A;  3VA7 A;  1TWF B;  3J80 L;  2MJ8 A;  4RWS C;  1NR2 A;  5IOC A;  3W2D A;  3QOL A;  2A5H A;  2FMC A;  3TME A;  1IL8 A;  4KY5 A;  4KMU C;  2K28 A;  1TII D;  5C4J B;  2ENB A;  2EYM A;  3BYT B;  1CHP D;  5E3F A;  1B4O A;  1DXM A;  4KY6 A;  5A2Q L;  1KNA A;  2RSO A;  3TSS A;  4BA1 I;  5CYU A;  5IT9 L;  2N55 A;  2FHT A;  1TWC B;  3PIP 3;  1XXG A;  2HDL A;  1RCV D;  4EGV A;  2NB0 A;  4FYD A;  4DAY A;  2JA8 B;  1I4H A;  2RA4 A;  2XN9 C;  2IJ0 A;  3U9O A;  2PPB C;  2H4O A;  1KTK A;  5JVG 3;  3PUV A;  1PTO F;  3ND8 A;  2K1B A;  5CBA E;  1LT6 D;  3OSO A;  1M8A A;  4IUN A;  4KI0 A;  4KJN A;  5C3W A;  2L12 A;  3CQZ B;  1Q8I A;  4DAP A;  5EPJ A;  5K5P A;  4IFD G;  5CR3 A;  1STE A;  3CU7 A;  4X3U A;  4DXF A;  3I4M B;  2F0Q A;  1YNN C;  3MXU A;  4ILW A;  1EU4 A;  3I90 A;  4KV6 A;  4WRD A;  4BWG B;  4Q5V A;  1R9T B;  2B8F A;  1FNW A;  3KBX A;  2IX0 A;  3TDQ A;  4ZUI A;  3BG3 A;  3TP8 A;  1LAC A;  1C48 A;  3ERO A;  4L6T B;  5EBC A;  1MD2 D;  2YU9 B;  3VYR A;  1ZXT A;  2C9O A;  3VYU A;  2EPB A;  4NP5 A;  1PTO C;  5M3M B;  1LT3 D;  4K2K A;  3T51 B;  1BDO A;  3A54 A;  2O2L D;  2AUK A;  3VR4 A;  4KD3 A;  2A6E D;  4A3K B;  4C3H B;  4OIK A;  1TS3 A;  2K01 A;  1ROD A;  3RLF A;  3H91 A;  2D2C C;  3GTQ B;  1FNV A;  4XTC S;  1I6H B;  3ITP A;  2KUM A;  2BCO A;  3MFY A;  3RMH A;  4V0B A;  1PZJ D;  3BZD B;  3QWN A;  2GA4 B;  1I3Q B;  2WP8 J;  2DN8 A;  2F0D A;  4DU9 A;  5C6A A;  4EQO A;  2AWN A;  2ZXR A;  1O7L A;  2NTS A;  1G91 A;  3I4N B;  2XRS D;  1CFM A;  1DJR D;  1SMY C;  2LMC B;  2RDH A;  2LY7 A;  3DHQ A;  1ENC A;  1LTR D;  2XNA C;  3DWP A;  2M9V A;  4CKE A;  1VMC A;  4LJZ C;  3S9W A;  2ZXO A;  3URY A;  2E2I B;  1STG A;  1KLG D;  2QCP X;  5CV9 A;  4CJ1 B;  2X6L A;  1OXU A;  2KEC A;  2PYK A;  2X6G A;  3AMU A;  1S5D D;  3OIQ A;  3M4O B;  1D5M C;  1WD1 A;  1PZK D;  3NXW A;  4U67 3;  5JEA J;  3Q6S A;  3QIA A;  1JWS D;  4A3M B;  3JAM L;  2F0U A;  3TN2 A;  1ESR A;  3OW7 A;  1ET6 A;  2AQ1 B;  2EYH A;  1BCP D;  5C4X B;  2B2W C;  3KK7 A;  3E0J A;  1TWG B;  5FO8 B;  3VR5 A;  1FGB D;  2PW7 A;  5M5X B;  2A69 C;  4PMC A;  1E2Z A;  1OXV A;  1EY7 A;  4FNF A;  4HR7 B;  5IGE A;  1L0Y B;  3NTK A;  4DNT B;  1B50 A;  1L0X B;  1U9R A;  3GTK B;  3EA6 A;  3FPU B;  1Y8N B;  2B2V A;  3KLS X;  2G9D A;  2KQ3 A;  1QJO A;  1LTB D;  1MSG A;  1ET9 A;  2IW3 A;  1D1K A;  4QF4 A;  3S16 B;  1EYD A;  2QEJ C;  4NKL A;  1CK1 A;  3ERQ A;  5EPL A;  4C1N K;  2FFK B;  2B2T A;  5JEA H;  3OHX C;  4L63 B;  3MXG A;  4ZYS A;  1JC7 A;  5FO7 B;  4G4K A;  5KNB A;  2KA7 A;  1CZG A;  1HXY D;  3NP8 A;  1PFN A;  3S2D B;  3P20 A;  5FK9 C;  1TT2 A;  1IYU A;  5IOD A;  1Y8O B;  1TR5 A;  2K04 A;  3GTG B;  1PTO B;  1H9S A;  4B08 A;  1EIH A;  2VNU D;  2XRQ D;  1IYV A;  2JEA I;  1U4M A;  2EOT A;  3PMF A;  1F9P A;  1PTO H;  2L1B A;  4R8N A;  5JPN C;  3ONA B;  1WTP A;  2NUC A;  5E1F A;  1TS5 A;  3A8J E;  2KED A;  2AWO A;  5EKI A;  2VB2 X;  1SYG A;  3GTJ B;  4CJ2 C;  1CA6 A;  2NN6 I;  5FO9 B;  3EJI A;  4PNY A;  1WCM B;  2B2Y A;  3K0Y A;  2EYL A;  2F0W A;  1AZQ A;  1I50 B;  4DXG A;  5KGU A;  3FPP A;  2BE5 C;  1Q1B A;  1T5X D;  3NTH A;  1R4P B;  2D9U A;  1IW7 D;  4TSS A;  5C3X A;  1S5E D;  4E6I A;  2E74 C;  4I65 A;  1Y69 U;  3MA2 B;  1DOM A;  3F2U A;  1EEI D;  4OO1 H;  5C0X J;  3GQB A;  2O4X A;  4HSV A;  4P2C B;  1EQT A;  1ESF A;  2A6H D;  5D3I B;  1BBX C;  2IX1 A;  5D65 A;  2BA1 A;  3I4L A;  3IAY A;  3QOJ A;  1PRT F;  2K5W A;  5FOB B;  1ENA A;  3NBI A;  5ELC A;  1CT1 D;  3D4R A;  3HP3 A;  3J80 E;  1QNU A;  4IQZ A;  3K5N A;  2DNC A;  1HCZ A;  2J4X A;  2F0I A;  2NTT A;  1KAA A;  2VB3 X;  4FF4 A;  1RF2 D;  3FEW X;  2R6G A;  3FRP B;  4R9W A;  1S5F D;  1O78 A;  1VF5 C;  2EVB A;  3S1R B;  4PQX A;  1SNC A;  2SNS A;  2B63 B;  1KDA A;  4QIW B;  4HED A;  4RA8 A;  1D1I A;  1V1O A;  5HGT A;  4C3I G;  4RHS A;  4F87 A;  3BVZ A;  3T16 A;  5A2Q E;  3GV3 A;  2BA0 A;  3GV6 A;  5IT9 E;  1O7Y A;  2R3Z A;  2NYZ D;  1DM0 B;  3K57 A;  3TZU A;  1JOQ A;  5JEA G;  3ND9 A;  2R92 B;  1LT4 D;  1HQR D;  1I6V C;  1LLR D;  4B9W A;  1TWA B;  4ZAI A;  2K03 A;  2Q8T A;  1SAP A;  5C0X H;  5EGT A;  4J6H A;  3S1M B;  2PNR C;  5I6W A;  1IKL A;  3S17 B;  4A3F B;  3SK6 A;  4N9P A;  2NN6 G;  4ZKC B;  3VYT A;  1JOO A;  2F0L A;  4H44 C;  2F0F A;  1GHK A;  2K7V A;  1V43 A;  3NSW A;  3MXP A;  1O80 A;  3C1F A;  4A3G B;  3I72 A;  3S1N B;  2O5I C;  3HKZ B;  3VYS A;  3CRL C;  1EU3 A;  2IT1 A;  4M8A A;  3T13 A;  3KLS A;  1LT5 D;  2OF1 A;  1QCB D;  1D5X C;  4IUT A;  3E5S A;  3SXH A;  5EKK A;  1IHZ A;  1PLF A;  4B9X A;  5C0X I;  4CKB A;  1GUG A;  3BVM A;  5IIF A;  4H7B A;  3GD7 A;  1I4R A;  2E75 C;  2WAQ B;  2L11 A;  1K83 B;  3KLR A;  1SJE D;  5JPM C;  2VUM B;  4IUP A;  4OIJ A;  1VMP A;  1F77 A;  1KDC A;  1AP0 A;  1WD0 A;  2KCN A;  2F0T A;  2JXM B;  3ZYY X;  4C56 C;  4ABN A;  5CV8 A;  4X3K A;  1BOS A;  1BUV T;  4F88 A;  1GUO A;  1Q90 A;  1Z6H A;  4O1N A;  4XYQ A;  3C46 A;  1B9N A;  2XSC A;  3I70 A;  2H1E A;  2E2H B;  1TQO A;  1ONL A;  2FMM A;  3K5M A;  1LV9 A;  1CZW A;  3L9A X;  2KOL A;  2EXZ A;  2PW5 A;  3A55 A;  4XYO A;  2QDB A;  1HPC A;  5I4D A;  3DMU A;  2EY5 A;  2J0T D;  2Y0S B;  1UUP A;  2HDM A;  3OMC A;  2NVX B;  4FXK C;  4K8I A;  3R2T A;  3HS0 C;  1X32 A;  2MP1 A;  2EDG A;  4KKS A;  3V2T A;  1PFB A;  1DOK A;  3L7Z C;  4IUR A;  5KIX A;  5KND A;  2JE6 I;  1AW7 A;  3H3V C;  2RQX A;  2JA5 B;  5ELE A;  1DYQ A;  1CM9 A;  1JR0 D;  3JAM E;  4CKC A;  3K5O A;  3H09 A;  2CW0 D;  1PMR A;  1A3T A;  1EEF D;  4FXD A;  2M00 A;  1JOR A;  5D14 A;  4A3I B;  3DEO A;  3O13 A;  4EQN A;  1ML0 D;  3MWY W;  2PQE A;  3G6J B;  1DCZ A;  4J8Q A;  3A56 A;  4RCO A;  1YNN D;  4PMW A;  2L55 A;  2WV6 D;  2DY8 A;  4A93 B;  3H6M A;  4LAA A;  4FXG C;  4JK1 C;  2PCF B;  1H9S B;  2XIW A;  2Z1C A;  1MBY A;  1PRT B;  1UNS A;  3V96 A;  5C0X G;  3BYY B;  4KN4 C;  5K36 G;  4IAL A;  1SFO B;  1TS2 A;  3P75 A;  1LTG D;  2XVS A;  3MXN A;  3E6Z X;  1X3P A;  2HUG A;  3BVG A;  5BN4 A;  3SHL A;  1GHJ A;  1RDP D;  4FP5 D;  2CHB D;  1WVL A;  4K6D A;  4L8J A;  2VXW A;  3RZO B;  2Z4I A;  2EY1 A;  4CBV A;  1EWC A;  5KRU A;  2V4D A;  2O5J C;  1I4G A;  4HN7 A;  2SEB D;  1SMY D;  3HGB A;  4ID6 A;  4XXE A;  1WTR A;  1B53 A;  1QOH A;  1D6E C;  1XX8 A;  1BCP F;  5C5L A;  1B2T A;  4BA2 I;  1I4P A;  1HUN A;  1JE4 A;  2F0J A;  2TMP A;  1F2M A;  1U4R A;  1HFG A;  1H9K A;  4WJW A;  3Q22 A;  2ZT9 C;  3Q23 A;  3SDZ A;  5F2D A;  3HZX A;  3GO5 A;  3OWF A;  1PFM A;  3SK4 A;  4K6L A;  3VR2 A;  4K5W A;  4HMI A;  1H9M A;  2EJG C;  1ICW A;  3TZD A;  3LNN A;  3MFG A;  1I4X A;  5T1G A;  5C4H A;  4HSP A;  4KJO A;  1EY0 A;  3A8I E;  5KYL A;  3HOY B;  1Y1V B;  2AUJ D;  1KLU D;  4J1M A;  2JSO A;  1AZP A;  5CC4 A;  5IGB A;  1H9R A;  1A15 A;  1H9J A;  1EWH A;  4C3J B;  1EZ8 A;  4HCS A;  2JA6 B;  1A2U A;  2B2U A;  5NUC A;  1CQV A;  1HQM C;  4IUV A;  4A3B B;  3J7A F;  2F3V A;  1U4P A;  4V19 0;  1QG7 A;  2PZW A;  1STY A;  3W3A A;  4DK0 A;  3M7N A;  1JWU D;  1G29 1;  1YNJ D;  4GZY C;  3K6O A;  4H0L C;  3M85 A;  4XQN A;  4RGO S;  3KF8 A;  4U68 A;  2F0N A;  3NTI A;  4UAI A;  3RUZ A;  4DGZ A;  1I4Q A;  5CV7 A;  1R4Q B;  5DAU A;  5M3F B;  1SND A;  1RJT A;  3S15 B;  1QE6 A;  1EY6 A;  5CBE E;  3NWS A;  1SYD A;  2YYZ A;  3K5L A;  4F7X A;  3QB3 A;  5D3D A;  1SNO A;  1HA5 A;  3L3O C;  3FMC A;  1CI3 M;  4LMQ D;  1TY0 A;  2RVL A;  2TSS A;  5DM6 3;  1A6X A;  2XWJ B;  3RD4 A;  1SNP A;  3DWA A;  5ELB A;  3CRK C;  5CV6 A;  4HCE A;  3PUW A;  4C3H G;  4OHJ A;  1B3A A;  4RH6 A;  5JAV A;  1QB5 D;  2PMZ B;  3DUZ A;  1STA A;  2LKV A;  2L9H A;  1FNU A;  4KHV A;  3IFT A;  1LO5 D;  1EY4 A;  1F9Q A;  5FKA C;  2OXP A;  2C5C A;  4ZQ3 A;  1OO9 B;  3HG9 A;  1LTT D;  4XT1 B;  3PO2 B;  3J7Y W;  2SOB A;  1G8Z D;  4A3J B;  1JOK A;  2R7Z B;  2BDN A;  3HOU B;  4ZLT F;  4FF3 A;  2F0P A;  3QJY A;  4OL7 A;  3MAQ A;  1TKW B;  1STB A;  1AN8 A;  2E2J B;  2G9H D;  2HCC A;  1NR4 A;  3OIP A;  3MVV A;  5M5Y B;  3KBG A;  3PIO 3;  4WFN 3;  2RSN A;  5ELD A;  3K7A B;  1PXU A;  1EYC A;  2F0E A;  3J7A V;  1ENF A;  2B2V C;  3P7J A;  1SYC A;  3HEJ A;  2K33 A;  4ZUJ A;  2Q8I B;  2RDF A;  5HUR A;  3H0G B;  3N6R A;  1BQQ T;  3WDN A;  2I46 A;  1EFI D;  2A68 D;  1SNQ A;  1FD7 D;  3PUX A;  3GTL B;  1GUT A;  3GTP B;  3M4Y A;  2B2T C;  3I8Z A;  4K2L A;  4RKB A;  3HOX B;  1QWY A;  4G7Z C;  4KN7 C;  3CHB D;  2K05 A;  4QCL A;  2K5D A;  3U9S A;  4YIJ A;  1BCP B;  3DEP A;  3J81 L;  4RFB A;  4H13 C;  5COR A;  2RKS A;  2SNM A;  4DF7 A;  1EY9 A;  4DNR B;  2F0M A;  4OO1 I;  3Q24 A;  1CA5 A;  1Q12 A;  5J39 A;  1PRT C;  4RKL A;  5CMD A;  4FF1 A;  3LWU A;  4JBW A;  3VR6 A;  4ME5 A;  3A7A B;  3HRZ C;  2HQE A;  3MTS A;  1HTP A;  3SR1 A;  5LL6 X;  3CKI B;  5EBD A;  3PUY A;  1Y8P B;  2ICE C;  3OWE B;  3T56 B;  4DFA A;  2B2Y C;  1WTW A;  3SE0 A;  2WKC A;  5BN3 A;  1E2V A;  4DK1 A;  4A3E B;  1VCI A;  2N88 A;  3M3Y B;  1BXT A;  3S14 B;  1SEB D;  1GJX A;  1ZYR D;  3T53 B;  1VF7 A;  3QG1 A;  4KY7 A;  2OT2 A;  5LL6 S;  1F2L A;  2BOS A;  1TS4 A;  1B9M A;  3I91 A;  4PMB A;  1A3U A;  2FJ2 A;  1WTX A;  2PZU A;  1RD9 D;  3I3C A;  3WOF A;  4A3D B;  5EPK A;  2Q8R E;  4XQQ A;  3NUC A;  4X3S A;  2KVM A;  2B8G A;  2AQ2 B;  3NK9 A;  1SNM A;  1MI2 A;  3D3R A;  5J22 A;  2F03 A;  2OEO A;  3DM1 A;  2F0O A;  3D31 A;  1C4Q A;  1DD2 A;  4X3T A;  1GOZ A;  1TWH B;  1EL0 A;  3FVQ A;  1F9R A;  2BDO A;  5M9O A;  2EYJ A;  1ILP A;  2LFN A;  1LTI D;  1V1P A;  4Y7N B;  1Q3L A;  3HOZ B;  2EYF A;  2QF7 A;  4OO1 G;  2EY2 A;  2KHS A;  5G3L D;  1SYE A;  3AU7 A;  3NQI A;  3PV0 A;  4M1U B;  3PUZ A;  4G57 A;  3AB9 A;  1C8C A;  4BY7 B;  4DA2 A;  1NCV A;  1K8O A;  3M7G A;  1NAP A;  5DNF A;  1HFN A;  1E2W A;  2KEE A;  2A73 B;  1JIC A;  3TBI B;  3NPP A;  2MHV A;  1EYA A;  4EVO A;  5KYI A;  4F8M A;  3K59 A;  1RTO A;  1UAP A;  1IKM A;  2RDG A;  1AEX A;  4XT3 B;  1GXD C;  2CVR A;  3BDC A;  1S5B D;  3R93 A;  2EZV A;  4K14 A;  5C3E B;  4AYB B;  1J8I A;  3VA5 A;  2CW0 C;  4FO2 A;  2IWH A;  4K8J A;  4EQP A;  5C44 B;  1EOT A;  2B2W A;  3TP7 A;  1WTV A;  3G7L A;  1UEA B;  4FVM A;  2Z4H A;  2MGS A;  1GUW A;  2PO4 A;  5FLX L;  2JYO A;  2WKD A;  1PTO D;  2E76 C;  1Z47 A;  1S5C D;  2A6E C;  1Y1W B;  3SVM A;  2EJF C;  4QMG A;  1SSO A;  2R61 A;  1EY8 A;  2XWB B;  5ELF A;  5JVH 3;  3R8B A;  3S2H B;  1A2T A;  2F3W A;  1CTM A;  1S4Z A;  2F4I A;  2L0C A;  1STN A;  1T5E A;  5E4X A;  4NDX A;  1KAB A;  1B44 D;  1EQV A;  4OGQ C;  1PDQ A;  2SDF A;  4ODG A;  1K8M A;  2EYO A;  3N52 A;  3HOW B;  3VR3 A;  2K6A A;  1KNE A;  5IGG A;  3RZD B;  4ZRZ A;  4KKT A;  5LHY 1;  3SK8 A;  3IFD A;  5I2Y A;  2JP1 A;  5DM7 3;  4NW2 A;  3EQL C;  1ZEQ X;  2F0S A;  1W6K A;  1SDF A;  5A35 A;  4XDX A;  5CGK A;  4HTH A;  4CJ0 B;  2CQA A;  1BNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...