1HUMA

Solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine(chemotactic)
molecule keywords HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA
publication title High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
pubmed rcsb
source organism Homo sapiens
total genus 10
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1humA00
5EQ0A 1JICA 3I91A 1PLFA 4CJ0B 4RAUC 1G6ZA 1PFNA 2D9UA 2B2WA 3MTSA 1B4OA 2K28A 2MGSA 4NW2A 2M2LA 2L4NA 2RSOA 1AZQA 5COYA 1PDQA 3TZDA 2H1EA 2K04A 3ONAB 1WTQA 2KVMA 1Q3LA 1U4RA 1WTWA 5E4WC 3IFDA 2RA4A 1WTVA 1J9OA 2FFKB 1WD0A 1HFNA 1IKLA 1VMPA 1HUMA 1LV9A 1ZXTA 2EPBA 2B2VA 2KUMA 5DNFA 5EPLA 2B2TA 1WTOA 1X32A 1NCVA 4OIKA 1CM9A 1G2TA 1XX8A 4IUUA 4QUFA 3I8ZA 4CJ1B 1MSHA 1MI2A 2N55A 1WTRA 2N88A 1AP0A 2EE1A 2RSNA 1F2LA 1F9PA 1SAPA 2NZ1D 2X6LA 1MSGA 1F9SA 3GV3A 1F9QA 2L1BA 2HCIA 3KBXA 1HFGA 1DOMA 2NWGA 5EJWA 5AFWA 1NR4A 1GUWA 3QO2A 3HP3A 1BNZA 2Q8RE 2B2UC 1U4LA 2FJ2A 3DM1A 1EL0A 2B2YC 1JE4A 1IKMA 5D14A 4XDXA 1EOTA 1RODA 4CJ2C 1NR2A 4HCSA 4ZKCB 4HAEA 1DZ1A 1QNKA 2DY7A 4HSVA 4IUPA 3N52A 4R8IA 2HCCA 2MJ8A 2MPMA 1RJTA 1KNAA 5EPKA 1X3PA 4X3UA 1RTNA 1DOLA 2EOTA 1BBXC 1CA6A 3F2UA 1CA5A 3R93A 1HHVA 4X3SA 1WTXA 2KOLA 4XT1B 4R9WA 1F9RA 2K01A 1SSOA 1PFBA 4IURA 1EIGA 1RHPA 1XYIA 2B2UA 4ZK9B 1BO0A 1G2SA 3DEOA 4DN4M 2KEDA 4OIJA 3SVMA 4XT3B 1EQTA 3D6WA 2KEEA 2FHTA 1DONA 5T1GA 1QG7A 2NYZD 4IUTA 4ZKBB 1WD1A 1S4ZA 1U4MA 1J8IA 4RWSC 2MP1A 5CBAE 2L12A 2L11A 2IL8A 3P7JA 2JP1A 3MWYW 1IL8A 1O7ZA 4ZAIA 3TN2A 2FINB 1HUNA 1ML0D 5CBEE 1HRJA 1B3AA 4MHEA 2R3ZA 2K1BA 3H91A 4QUCA 1AZPA 1SDFA 1BF4A 1ESRA 1O80A 2X69A 4X3KA 1B50A 2FMMA 1EIHA 2DY8A 1U4PA 2RVLA 4RA8A 2J7ZA 5EPJA 3LWEA 3IL8A 3UI2A 3FDTA 1C8CA 1M8AA 4X3TA 1QE6A 5JJZA 5T1IA 1TVXA 1X3QA 2B2YA 1ILQA 2HUGA 1WVLA 3DEPA 2KECA 1MGSA 4UAIA 4O42A 1VMCA 2B2WC 2JYOA 3KUPA 1RTOA 4IUVA 1O7YA 4HEDA 2HDLA 5CORA 1PFMA 1G91A 1ICWA 4MN3A 1NAPA 3I90A 4IUQA 5E4XA 5EKIA 1WTPA 2XIWA 3I3CA 3GV6A 4U68A 5CMDA 2CVRA 2HDMA 1A15A 2BDNA 2L9HA 3Q6SA 2K03A 2K05A 1KNEA 2SDFA 2X6GA 1HA6A 1E0BA 1DOKA 2B2VC 5D65A 2B2TC 3FPUB 4ZLTF 1B2TA 4LMQD 2VXWA 1ILPA 3G7LA 1B53A 2Q8TA
chains in the Genus database with same CATH superfamily
4WORA 5I9PA 1TS3A 3KLSA 1PFNA 3CC7A 5M5YH 3MEFA 2EYFA 1JR0D 3GTGB 4CDCC 2RHQB 2BH8A 1TY0A 1YNJC 3RN5A 4PZ7A 1Q3LA 1EQQA 2PI2A 1EUJA 1WD0A 1YIJA 4JG2A 1LV9A 1QWYA 4EVOA 3HOVB 1EY5A 1ASZA 5C0XG 4DK3C 4QCLA 2BE5D 2N88A 4N8X1 3H3VC 2F0SA 5BR8L 2IW3A 4G7OC 1BCPB 1CQFA 3HP3A 4GN5A 2B2UC 2ZM6Q 4DV2Q 1K0SA 3CC4A 3TP7A 3CCRA 4JI6Q 2OWOA 2OEOA 3KJPA 3W5OA 1P16A 3A0JA 4DNIA 3VYTA 3ERSX 1SMYD 1VQHA 4YCUA 3NE5B 1CQVA 3C3LA 2K5NA 1EU4A 1VQ8A 5IYBH 4KN7C 2ZTDA 3VR4A 2BOSA 5C3EH 2OF1A 1QCBD 5M3MB 5IWAL 1ENCA 1XYIA 4GNXC 4IO9A 1VQ4A 3S2HB 1GUOA 4I7AA 2GN5A 5CC4A 4H7BA 1JB7A 3M3YB 5M3MH 4B9WA 3F2BA 4IUTA 4V190 2PO4A 3SK6A 5CBAE 3S2HH 2L12A 1CZWA 1JB3A 3HG9A 3GTJB 5CR3A 2ICIA 2Z1CA 1QVGA 3M3YH 2AUJD 3V2TA 4QL5A 1RL2A 1O80A 2MUYA 3AB9A 2EIFA 2AQ2B 1NNXA 2VW9A 1OXVA 4B9XA 4X64L 3H3VI 3S14B 1M8AA 1WYDA 2ZT9C 1QE6A 3KF6B 2PQAB 3S9WA 1KLUD 1LO5D 1W6JA 2Z6BA 2KHSA 3U4VA 1HQRD 4IUVA 3HOUB 1RTOA 3S14H 1XWEA 1Q86C 1UE6A 1X3EA 3KF6A 4DU9A 2VL6A 3HOUH 5GAHC 1K3BC 3KLWA 1Z6HA 1AE3A 3K0XA 1EYAA 2QGQA 1VQBA 3BDLA 2EVBA 1HNZL 2EYOA 3NEMA 3OIPA 2UXCQ 3M7GA 3F2DA 3FPPA 3RD4A 3K5NA 4DUYL 1GUGA 3OTOQ 4P71A 5I9OA 1VQPA 4K5VA 5FKAC 2Z6KA 2H1EA 1TKWB 4C1NI 2KVMA 1U4RA 2WB1G 2A6HD 2A68C 2WIIB 3KYHC 1CKNB 5DEHA 1X32A 1F77A 4DR5Q 1NJIC 1PYWD 4CJ1B 4EQOA 1Q1BA 1F9PA 1SAPA 1F9QA 1NUCA 1Y1WG 5FLXE 1LTSD 1N8RC 3A56A 2FJ2A 1F2MA 2B2YC 3D4RA 1HR0W 2HIXA 5LL6S 3IAYA 4LWCA 2OQKA 4L5TA 3WOFA 2NN6H 4RH6A 4R4CA 3CCEA 2JA6B 2O4XA 3QIAA 4L6TB 1MD2D 4OO1H 1K3RA 2J4XA 1T5EA 2RCNA 3K7AB 2K01A 4JI2Q 2F0DA 2V4DA 3VA5A 1YITA 3DEOA 2D62A 1S5BD 4EQ5A 3K7AH 4FF1A 4HR7B 1AFPA 1QG7A 1VQCA 1I5FA 3BU2A 4ZKBB 1WD1A 4WJ4A 4X6AH 1EZ6A 3IKJA 2UUBL 4LF6Q 1PH8A 1K8MA 5ELFA 4NMZA 1B3AA 2R3ZA 1FGUA 1AZPA 1Y69U 1ESRA 4IPDA 1FD7D 1B3QA 1VDZA 1EIHA 3RUZA 1ENFA 1TWAH 1EWCA 3SEBA 5C0XH 2PZUA 1PMRA 3NSWA 3U50C 4DNRB 1ILQA 3QWNA 1MHWC 2UUAL 1HR0Q 3PUYA 2B2WC 3QR8A 4JOIA 4A3IB 2XN9C 1BQQT 1YJNA 1VQEA 1I4PA 5E4XA 2A6EC 2IX1A 1XXGA 2DJFC 1BCPF 2K05A 2TSSA 1HA6A 4A3IH 2OT2A 2IPKD 4ZQ3A 3VA7A 4CDEC 1B44D 1A3VA 1I94L 3CRKC 1G6ZA 2VB2X 1XMOL 4DAVA 2M2LA 3IRBA 2L4NA 4NB3A 2VQFQ 2A5HA 1AZQA 3S24A 2D2CC 4KHPQ 3WDNA 3MHBA 4KHVA 2JA5B 1YZ6A 5LHY1 1VQNA 4OWWB 1KLGD 4Y7NH 4C3HB 1GOZA 4B08A 3CPWA 2E76C 4L5SA 5C44G 3I70A 1EQVA 5C0XI 4HTHA 1PVOA 1FNUA 3TS2A 2PQEA 4H13C 3R8BA 2QF7A 4IOCA 2IY5B 5JJLA 4NDXA 1QNKA 2D5DA 5JOBA 5KEEA 1D5ZC 2MJ8A 3K0YA 3TZUA 4BS9A 4R4QA 2GVBA 3R93A 2DJGC 4C3IG 3H0GG 1SE4A 1KDBA 1Q1EA 4FP5D 5ELEA 1L1OC 3S1RB 2FXQA 3MFYA 3D0FA 4K0KQ 4R8NA 3PIP3 4OEMB 1K0RA 3X3MA 3K7UC 4I7ZC 1O7ZA 4OX9Q 1CZGA 3GO5A 1VQOA 3S1QB 4MHEA 3KF8B 5BN3A 4DV1L 1JOKA 5HGTA 3S1QH 3PO2G 3KF8A 2DNCA 5C3WA 3I4NB 4N9TA 5JJZA 2F0FA 4A3JB 5IGEA 1VCIA 4UP8A 1TWFB 1VQAA 1KABA 4DR7L 1IBKL 3I2ZA 1CSQA 2JA7G 1VQMA 3I4NH 4UP9A 2EJMA 5IYDG 4UY8C 5LMUQ 4ZCKA 1S5CD 3EJIA 1TWFH 3DM3A 1W2BA 3GV6A 1I6VC 1SRUA 2CVRA 2HDMA 5H1SE 2K03A 1SXTA 3NTIA 3W1GA 5A2QL 3Q8DA 4LMQD 2VXWA 4POFA 5C5LA 1DONA 2LS01 4A3KG 1CKOA 1PRTC 1L0YB 1DD2A 1ICFB 1SE2A 3NBIA 3VR2A 4DR1Q 2Q2IA 3X3NA 4LF4L 1HJPA 2UXBQ 1B70B 4QY7A 1L0WA 3TZDA 4LUZA 3V05A 5IT9E 3SK4A 3WOEA 2QCPX 4TRDA 4ZUJA 5L37A 1SYBA 1OO9B 2PYKA 4IUUA 1S5ED 4LFAL 4PMCA 2E2DC 1WTRA 5GAGC 2HCIA 1HFGA 5EJWA 3BZCA 3QO2A 3GTLH 2EJGC 2E8GA 2R92G 1Q81C 3HGBA 1KTKA 2KCMA 4IUPA 3RZDB 1BBUA 4S3SA 2AQ3B 2AQ1B 1KNAA 5EPKA 3GQBA 1EY4A 1RTNA 1FJGL 3CHBD 5FLXc 4XT1B 3RZDH 1VS0A 3NBHB 1SSOA 3FKIG 3PIOA 1YNJD 4MTNA 4AYBG 2Q2HA 3QOJA 4H44C 2ES2A 4KMUC 2I0QA 4NXML 3K57A 1M90C 1HXYD 3NBHA 4CKEA 2CW0C 5T1GA 1W3SA 4GKJQ 1J6QA 4A3LG 1Y1VB 1AH9A 3LGJA 4GLVB 2YV5A 1A2TA 2NTTA 5BR8Q 1Y1VH 4KY7A 2QKIC 4IUNA 4A3EG 2L5TA 3EROA 5C44B 5EPJA 3EFXD 2K6AA 5IGFA 1SN8A 1MIUA 2IHEA 1BBWA 2KA7A 2R7FA 3CCUA 4UAIA 5C44H 1Q8IA 2EYHA 1JORA 4X65L 4NP5A 1SBBB 1EFWA 4KV6A 2A74C 4DR2L 2E74C 5IWAQ 4K8JA 2B2VC 1QOHA 1E2ZA 4J15A 3H0GH 2F0IA 2NUCA 4G7ZC 1SJHD 4A3DB 4JI4L 2EY6A 3RLOA 1RD9D 4RGNA 4PMWA 1VQ9A 1H9SB 4KKTA 3QB3A 4A3DH 4LAAA 2IX0A 3A55A 1H9SA 5E1FA 4X64Q 1VMPA 3J7A5 5EPLA 2JN4A 4CBVA 2B2TA 3MC0B 4G4KA 4RGOS 1X65A 2K52A 3EIVA 2B8GA 2QEJC 4IFDH 3PSIA 5A35A 3U9SA 3HOWG 1CUKA 2YYZA 4KD3A 3TBIB 3PO2H 2P5ZX 3UDFA 1PZID 1PH7A 2NVQH 5F2DA 4A75A 4TKOB 1J5EQ 2IHFA 2ZTEA 3ERQA 4JI5L 2TMPA 4FF4A 3HKZE 3Q0AA 3G71A 3A8IE 1HNZQ 3N52A 5C4HA 5IYDH 2QDBA 2JJQA 2UU9Q 1C4QA 4J1MA 1V1QA 1PA6A 1SNDA 1DOLA 2CFMA 4A3BG 1N32L 2AWNA 1LT3D 1RDPD 3OW2A 1SFOH 5DLQE 4R9WA 1O7LA 4DUYQ 2L55A 1UEAB 4JC0A 4UHVA 1EWHA 4FVMA 2A68D 4DV7L 2NVXB 4A3KH 1JJGA 5HURA 4F8MA 3D6WA 1JE5A 5JPMC 4U673 1X9NA 1R9TB 4X62Q 1E3PA 5FO7B 4GN3B 1A63A 3R2IA 5CGKA 2NVXH 2JEBI 4I65A 1N9WA 1R9TH 1K8GA 2PI2E 1TWCB 1Q82C 2WINB 2PW5A 2RVLA 1TWCH 4PV1C 4K14A 2KJXA 1NMFA 5T1IA 3L2PA 1UE7A 1OXTA 2R92H 3A74A 1RIPA 4K8IA 5K36G 4XQQA 3M85A 4A3FG 5CMDA 5KYLA 3QG1A 4EQNA 2X6GA 4A4IA 1SYFA 2BA1A 3J81E 3KBGA 3C1EA 2F0UA 2JP1A 4NXNL 3CCLA 5CV8A 3PO3G 3CPFA 2Z4IA 2UUBQ 1PTOC 1ZEQX 1CSPA 3K81C 1CK1A 3HOXB 2RSOA 5COYA 1IZ6A 2K04A 1UWVA 5GADC 4A3LH 1J9OA 1X6OA 3HOXH 2Y0SB 1HZBA 4OIKA 2KCNA 4V0BA 4BBSG 2UUAQ 2XRQD 1VQ6A 3AEVA 1FR3A 1MSHA 3I4MG 2AKWB 2NZ1D 4ALPA 2O5JC 2A6ED 1D1IA 4KKUA 4BXXG 4IFDJ 1BVSA 3MXGA 3KDFB 4L5RC 1BNZA 3NHHA 5IT9c 1JQYD 4DAPA 1NE3A 2RHSB 3G4SA 3H94A 1IBMQ 4JYAL 3LX0A 3KDFA 1S5FD 4HAEA 2DY7A 1V9PA 3KJOA 3VYUA 1K8OA 2ZJQA 4X3UA 1BBXC 4GKKL 1I94Q 1V1PB 3EA6A 1HHVA 1XNQQ 3MXPA 1WTXA 3H3VH 1A3TA 1XMOQ 5IIFA 4B3RL 1EIGA 3NWSA 4XYQA 1V1PA 2B2UA 1IBLL 1JWSD 1I4GA 1O7IA 4AIMA 5I2YA 1Y14B 1STBA 2NYZD 1VQ5A 1Q90A 5JEAG 5IYCG 5JPNC 2OTLA 2B3GA 1LTGD 5KNBA 4A3GG 4O0AA 4GNXB 2EYLA 2YTVA 3F1ZA 1V8QA 1HRJA 5C3EB 3OSOA 3TP5A 1KDCA 3HOWB 1M4VA 1GD7A 2FMMA 1PH3A 1B50A 2CWAA 3HOZG 4E6IA 5I6YA 5IOCA 5IGDA 2D0PA 2F0MA 4JI3L 4JI1Q 3HOWH 4LUOA 2KQ3A 4B3TL 1X54A 2MO0A 1HA5A 3URYA 1STEA 3KUPA 3OMGA 1O7YA 4DNTB 5CORA 2GVAA 4DV6L 3U4ZA 1NBWA 5HGQA 4A3BB 3L9AX 1I6HH 4QJFA 4C56C 2XIWA 1WTHA 4U68A 2G5DA 2SDFA 5EAYA 3W1BA 3PF4A 4A93B 4C2MH 4A3BH 5D3DA 1SNOA 3FPUB 1S72A 3ICEA 3PV0A 1DM0B 2SNSA 3S16H 2EZVA 1PH6A 1XNRL 4A93H 3J80E 4YHHQ 2NB0A 2C35B 3A7AB 1B4OA 2PMZB 5KNCA 3MEHA 3DUZA 2F4VL 4DV1Q 4WRDA 5JJIA 1PH9A 2PQAA 3BVZA 1K28A 2CHBD 1SNPA 2QW7A 3S1NH 1E24A 3J81j 1AP0A 1IBKQ 1PH1A 1F2LA 4IZ8A 4A3CH 4DUZQ 4HMJA 1HZ9A 1S5DD 1E1TA 1TXYA 1U4LA 1YEZA 2YTYA 3QJYA 2R93B 4HJ8A 4L8JA 1FNWA 3STBD 4ODGA 1VF5C 4IJLA 1QVCA 2R93H 1PRTD 2N3SA 3E3XA 4B3ML 5K36H 3T51B 5J1ZA 2CQOA 2RBMA 4LF5L 1UE5A 1DYQA 1EEFD 3EVQA 3SK5A 4IURA 1CKNA 3T56B 2GA4B 2FMCA 4DR4Q 3N6RA 4GS3A 3FRPB 5NUCA 1JCKB 3FP9A 4PZ6A 4AQYL 3SVMA 2VZAA 5CYUA 4RMFA 4IPHA 4K5WA 4M8AA 4RWSC 2LMCB 2JXMB 2L11A 1IL8A 3TP6A 4BBSB 2JEAI 4QUCA 5DM73 3BDCA 1G8ZD 4BBSH 4ABNA 4RA8A 5ELDA 2J7ZA 4K2KA 2N8NA 5LL6X 1LTID 3TREA 3BZDB 1G291 4BXXH 3PGZA 1RCVD 5LMNL 3ZYYX 1YHQA 4RCOA 4UP7A 4OONA 1TR5A 1PFSA 3RZOB 5C3XA 4JBMA 1TWAB 2DNEA 4B3SL 4KD4A 2MO1A 3RZOH 3FVQA 4NXMQ 2RCFA 1BKBA 4HMIA 2CKZB 2QEXA 4FF3A 2HIVA 2VB3X 3PIO3 2I46A 4GN4B 2R7ZG 1FYCA 4CJ0B 3MZ5A 2B2WA 3CCMA 3BDOA 3D6CA 1WI5A 3L0OA 1SNCA 4NW2A 4MNOA 4P73A 4YWKA 4A3GB 4XQNA 4HIMA 4IALA 4DF7A 3DHQA 3SXHA 5JEAH 3SGIA 5IYCH 3J81c 2IT1A 2ZJRA 4A3GH 4FF2A 1ZXTA 3HOZB 1G2TA 1LT6D 2XWBB 2EXZA 2UXDQ 3KBXA 3HOZH 2MHVA 4HCEA 2NWGA 5AFWA 1NR4A 4DR2Q 5C4XG 4R4TA 4JI0Q 2B63G 5JVH3 3DWPA 1QB5D 3GTMB 1SNQA 4OXPA 2G9DA 4K5XA 1DZ1A 1K8AC 2HCCA 2LXJA 4Y7NB 4DV4Q 3GTMH 3P1HA 1LLRD 1TS5A 2KBNA 2EXDA 1A0IA 1F9RA 5ELNA 1N34L 1RHPA 2DUDA 4LF7L 5AJ3L 3UDXA 2K5WA 2K5DA 3HS0C 1UNSA 3I4OA 4JI8L 4APVA 1O78A 4XT3B 1EQTA 3A5UA 1D5MC 1GUNA 2KEEA 4P74A 3K59A 3Q22A 3BYTB 3R3OA 4RGMA 4DKAC 4DV2L 5EBCA 5JVG3 3I73A 1L1OB 4JI6L 2HHHQ 3HRZC 1ET6A 2X69A 4QB4A 1L1OA 3SHLA 4JBKA 4JI5Q 1VQGA 4RFBA 1TQOA 2F0HA 3GTOB 4OGQC 1X3QA 1KIXA 4CKBA 4DR6Q 2Q8IB 1KXLA 1MGSA 5A2QE 1D2BA 1GKHA 3QOLA 2L0CA 1S3OA 1N32Q 2WB1B 3GTOH 2KHIA 1KQSA 2CH4A 1OXSC 4MN3A 1HNXQ 2JSOA 2MFIA 4BY1G 2EY2A 1HTPA 4DV7Q 2Z8LA 1DOKA 3T1YL 1Z7TA 2Z0SA 1Y1WB 4FNFA 1B53A 2F0KA 3KLRA 1CFMA 3J7AF 4LNQA 3TS0A 2MGSA 3OPOA 5C0XJ 1GUSA 4Q0FA 4QIWB 1Y1WH 3Q23A 1STNA 2H4OA 2K7VA 2I5LX 3MXNB 5M5XH 1WTVA 4G57A 1PRTB 3JAML 1IKLA 1UEBA 3M4QA 5JEAJ 4DV3L 3H09A 5K5PA 2LXKA 2E5LL 3J80c 3MXNA 3VR6A 4ID6A 1YJ9A 3I8ZA 3P75A 1QILA 1SNMA 4QGUA 1AN8A 1ZKOA 1I3QB 3GV3A 2L1BA 3EN2A 1EY6A 2NVTB 2J0TD 1WJJA 3E0EA 1BDOA 1Z9FA 2VNUD 1I3QH 1W6KA 1EYGA 2NVTH 1SYDA 4LUVA 3BS1A 1LM0A 3E5SA 2IWHA 1RJTA 3AFPA 4NXNQ 3PCOB 1OTCA 1STHA 3SDZA 1AW7A 3NQTA 3T53B 1PTOD 2WAQG 4FXGC 4LFBQ 4DV0Q 1B7YB 3EQLC 4BBRG 3GTLB 3M7NA 5D3IB 4ZK9B 4DR5L 4IPCA 4X66L 4HIOA 1S40A 3TSSA 3M4YA 4WJ3M 2F0PA 2WP8J 1SE8A 4KN4C 1GJXA 5JAVA 2NTSA 1XPRA 2MP1A 3E0JA 3DLLA 1SE3A 1KRTA 3ULPA 1PHJA 3FMCA 3I55A 2JA8G 3H15A 4P75A 3AMUA 2UUCL 3CF5A 4CDFC 1HPCA 3I72A 1VQFA 2ZTCA 1E2WA 2B63B 1EIYB 3CCVA 3DWQA 3NQIA 1FNVA 3NTHA 1P8LA 3IFTA 1HTLD 2NVYB 2Z9HA 4GKKQ 4EGVA 5C4XH 2B63H 2RF4A 1NAPA 3I90A 4IUQA 3CXCA 1JOOA 4HJAA 2NVYH 1A15A 1IBLQ 5M3FG 1A6XA 4H02A 1E0BA 1EY7A 1TU2B 2NZOA 5D65A 1B1ZA 2HD3A 2PNHA 4O1NA 4RHSA 5BN4A 1VQKA 3RLNA 2R7DA 5FO9B 5CV5A 3VR3A 5FLMG 2VUMG 4JPBW 3HKZG 3NXWA 1T5XD 3UE0A 1PDQA 3LWUA 4JW0A 1TY2A 1CHPD 1GUTA 2K33A 1RKNA 3AQQA 2KUMA 2B2VA 4C3IB 3H0GB 5JJKA 1NMGA 3C2PA 2EY1A 4QQBX 1XX8A 4C3JG 3S1MB 1QNUA 1MI2A 2N55A 2EE1A 1HNWL 4LW1A 4C3IH 4DPGA 4DV6Q 3S1MH 5GQOA 2VY3A 2F3WA 3MA2B 2C9OA 1JE4A 1EEID 2K4KA 3CCQA 1Q7YC 4HCSA 2LKVA 4R8IA 4Q5VA 1XNRQ 1CT1D 1K83H 2F0WA 4BY1H 2ATWA 4X3SA 3T16A 1CKMA 3PO2B 4KHPL 1AEXA 3HOVG 2N49A 2VQEL 2NVQB 2B39A 4LFCL 3CP0A 1BO0A 3CQZH 3S17H 2KEDA 2EYMA 3O13A 1A2UA 4OIJA 5E7NA 2JA7B 1EQRA 1S4ZA 1CI3M 3NENA 2Q2UA 2O2LD 2IL8A 2OTJA 3P7JA 1B8AA 4UDUC 1SFOB 2JA7H 2OQ0A 5IODA 1STGA 1MJEA 3SE0A 3G6JB 2K1BA 1HQMC 3M9BA 4A3KB 5LMNW 3PMFA 2Y0SE 4KJNA 1F2YA 5J3BA 1KAAA 5M3MG 1NSNS 1PRTF 5TSSA 3MVVA 4O42A 4B3MQ 1E22A 3J7YW 3TRZA 5EKLA 1I4XA 4LF5Q 1PH5A 1NY4A 2WAQB 5C4JH 2L9HA 5EBDA 3AYHB 4OX9L 5HY6A 4PMBA 3SK8A 4AQYQ 2WACA 4L5QA 4ZLTF 1N36L 1LTTD 2Q8TA 1SYEA 1EY0A 4JBJA 4BBRH 2KENA 2K14A 2R92B 5EKKA 4MTKA 2K28A 1LTRD 3NP8A 2LFNA 2HQLA 3OIQA 4DR3L 3PUVA 3HFZB 1WTWA 4LF9L 2ZXRA 3BZKA 2FFKB 1HUMA 3TQYA 4OWTB 2JA8H 3WWVA 1PTOB 3V96A 2WV6D 3FKIB 3KFUA 4AYBB 5CV7A 4FXDA 3NPPA 5LMNQ 2F0EA 1F9SA 3CRLC 3UDIA 4DAYB 5IGCA 1PTOH 2G9HD 3FKIH 2Q8RE 5DAUA 3TP8A 3CCSA 1EL0A 2XSCA 1IKMA 4FO2A 1SMXA 2KCCA 3JC66 4DAYA 1G6PA 2DN8A 1JOQA 1MBYA 1YNNC 2D0OA 2OXPA 4XTCS 4Y52H 2MPMA 4JI7L 2KCTA 2EOTA 4A3EB 1CA6A 2CH4W 5J39A 4DK1A 5C4ZA 2B8FA 1FVIA 4A3EH 1DXMA 1VQJA 2ID0A 3D31A 1NTGA 5CV6A 4IJHA 5FLMH 1SROA 2VUMH 1PZJD 3AFQA 1H95A 2NN6G 2F0VA 4ZAIA 4KY6A 4OO1G 1LTBD 2PMZE 3R2TA 2C5CA 4GOPC 3H91A 2JA6G 5ELCA 1BXTA 3I7FA 1SJED 4PNYA 2I5MX 3JAMi 4IN3A 4R1JA 4C3JH 1XPUA 3CD6A 2SNMA 4DXFA 5IGBA 2HUGA 1WVLA 1IL2A 4DK0A 1VMCA 1LYLA 2JYOA 3J81L 1TS2A 4DV5L 1G91A 3GTGH 2XWJB 2LY7A 1N34Q 4LF7Q 5AJ3Q 4YCWA 3ITPA 4GKJL 4JI8Q 4DK6C 2M9VA 4KK7A 3FHWA 3HOYG 5IE8A 1GO3E 1X56A 4XIGS 4GNXA 3HOVH 5EQ0A 3J7ZC 3I91A 4ZYSA 4RAUC 1A8VA 3RR5A 1KRSA 3MTSA 1C9OA 1YHAA 4HJ9A 4JV5L 1I6HB 2KHJA 1YJWA 3D4DA 2WKCA 3D4WA 1Y8NB 4IPGA 1ASYA 1XTDA 2M00A 4C2MB 3CKIB 1HFNA 2RA4A 2RDHA 2BCOA 1BCPC 2ZXOA 3TEHB 4A3IG 1I50B 2F0TA 3S16B 4K6LA 4WFN3 1CM9A 3RMHA 1RF2D 2L15A 1IYJB 1I50H 3K5MA 3KLSX 1MSGA 3GDEA 5M9OA 2QDLA 3A54A 2QA4A 2F52A 1ONLA 2Z4HA 4TVAB 1X55A 1I4QA 1ZYRC 4IQZA 2XTIA 1IYVA 4UPAA 3T1YQ 3CAMA 3S1NB 1PYSB 1PH2A 1X3PA 1JWUD 4YY3L 3C1FA 3F2UA 2JA5G 3GTJH 1OXUA 2KOLA 5KGUA 3T1HL 1WFQA 2XRSD 1PFBA 4DR7Q 1H9MA 2PCFB 4C3HG 4ME3A 4Z9CB 4DA2A 4DN4M 2K50A 3K8AA 2QILA 3LNNA 1H9KA 4DV3Q 4NPSA 4XXEA 2E5LQ 4A3FB 2FINB 5CBEE 1J5EL 2HQEA 1BF4A 3G48A 5G3LD 4A3FH 1MJCA 2F4IA 1GHJA 1DCZA 1X3GA 2UU9L 3NUCA 4LF4Q 2YTXA 3H6MA 1QJOA 3UI2A 1K73C 3PO3B 4X3TA 4F87A 2B2YA 4HIDA 3OMCA 4HJ7A 1PTOF 3PO3H 1LUZA 3UDGA 4C1NK 2HDLA 4EQPA 1Q8KA 4DAMA 1L2FA 3J80L 1BUVT 5FJ8G 5GAEC 4X62L 4LFAQ 1WTPA 2Z6KC 1F2ZA 1MKHA 2BDNA 2YU9B 1U9RA 4X66Q 3I4MB 3HKSA 2AWOA 1B2TA 2K5HA 3G7LA 1ENAA 2ASBA 1C7YA 1JICA 2YU9H 1PLFA 2NZHA 3I4MH 4A3MG 5IP9G 3ND9A 3I4NG 1XMQL 4A3JG 2IX3A 2UUCQ 1QVFA 1PV4A 4ZUIA 1GXDC 1D1KA 2ALYB 1FJGQ 1N33L 3ONAB 3W3AA 3B6YA 1HZCA 3HEJA 3IFDA 5E4WC 1IW7C 1TWHB 1LACA 2CW0D 4P2CB 3UE1A 1PH4A 2JA6H 5EGTA 4GZYC 1TWHH 4HIKA 2RSNA 1HUNA 2A69C 4BY7G 1KDAA 1SR3A 1D7QA 5E3FA 2XGTA 1L0XB 2EYPA 3TDQA 1IHZA 2JA9A 3KOJA 1XTCD 1RODA 1STYA 4CJ2C 1NR2A 2WKDA 4K6DA 1BOSA 4J6HA 1PZKD 2R6GA 5FLXL 3HOYB 4RG1A 3KK7A 2WB1E 4LF8L 2F1MA 3PUXA 1SYGA 3HOYH 4X65Q 1EFID 1A3UA 1G2SA 3OOCA 1GHKA 1EYCA 3PQIA 1SLJA 4QF4A 5DM63 1U4MA 3AU7A 1II3A 2A19A 2H5XA 2F0NA 4ZRZA 4JOIC 1ML0D 1CHQD 4QIWE 1HNWQ 1PXUA 1IBML 2NN6I 1U5KA 1SDFA 1YHBA 1EWIA 1QUQB 4JI4Q 1R4PB 4OO1I 3FEWX 3OWFA 4OL7A 3LWEA 1SEBD 3FDTA 3RNUA 1XNQL 3EBEA 1QUQA 2BH2A 1EY8A 4GLAC 1LABA 1WCMG 3I56A 4O2DA 3A5ZB 3CC2A 2A73B 4JK1C 2F0GA 2JK8A 3CCJA 2BE5C 3RN2A 1EOVA 2ZM6L 2VQEQ 1Y1VG 4CGYB 3DWAA 4LFCQ 3Q6SA 1KNEA 1STAA 1KAWA 1QZGA 1VQIA 1VF7A 2RKSA 4OELB 2JA5H 5ISRA 4MIUA 4F88A 1R4QB 4KY5A 1SMYC 3JAME 1C0AA 4FXKC 4C3HH 1Z47A 1Q12A 1YVCA 4YIJA 4JI1L 2A8VA 3SR1A 1WTQA 1I4RA 3HZXA 2NBFA 1BR9A 5DNFA 1JWMD 2O5IC 1WTOA 3VDYA 3E9HA 3J7AV 2IJ0A 2E75C 4DXGA 3MAQA 2F03A 4M1UB 2PPBC 4KJOA 2K5VA 1CTMA 1X3FA 1GUWA 1XJVA 3GD7A 5M5XB 4A3DG 1YNXA 3E9IA 3S1RH 2E2IB 3GTKB 1Q46A 4YHHL 4DFAA 1FL0A 2JE6I 1N36Q 1B9MA 3J81i 5FJ8H 2E2IH 3GTKH 4IFDG 1GVPA 3K5LA 1CA5A 2MNAA 2JQOA 1QZHA 3C46A 4A3MB 4CDDC 1OXXK 4HN7A 4DR3Q 4N8FA 3OHXC 1IXRA 4LF9Q 1HCZA 4HSPA 5GROA 4A3MH 5IP9H 1C48A 1M1KC 4JCVE 3DMUA 1EU3A 4KI0A 4DUZL 4A3JH 2UXCL 4FYDA 1UUPA 3TN2A 2OCEA 1H9JA 1EY9A 3OTOL 5IGGA 1B9NA 5I2XA 1U0LA 4BY7B 2PZTA 3STBC 1KD1C 2R7ZB 3DXJC 2E2HB 1YNND 3IL8A 4OWXB 2A6HC 5M5WB 4BY7H 1SYCA 1TT2A 1EIFA 2KECA 4PQXA 3PF5A 2R7ZH 2F0JA 2XNAC 2E2HH 4DR4L 4JI7Q 1FGBD 2XVSA 5M5WH 1PFMA 1DGSA 3CU7A 3ZJYC 5EKIA 3U58A 2CQAA 5FO8B 2AMCB 3BVMA 4XYOA 3CW2C 4L63B 5CV9A 1ILPA 4F7XA 1AE2A 1WOCA 1LTAD 3OWEB 4YWLA 3CMAA 5C4XB 4JYAQ 2D9UA 2EDGA 1T9HA 1HZAA 3D8GA 3K6OA 4JI2L 4HJ5A 4H0LC 3ND8A 3Q24A 1EZ8A 5KYIA 4B3RQ 1NCVA 1VQ7A 2CWPA 3K5OA 1ESFA 5IP7G 4LF6L 1WCMB 2K32A 2RDGA 3D3RA 4DV5Q 4RGTA 2ZXPA 3ULLA 5IT9L 3MFGA 3DM1A 4RKBA 1YBYA 1WCMH 2EJFC 5D14A 1JJ2A 3HOXG 3VR5A 4HSVA 1HR0L 1TIID 2I5HA 2K75A 3A7LA 4KHZA 3A8JE 4JI3Q 4B3TQ 2Y0SG 4CHTB 4JV5Q 1V43A 1D8LA 3J80i 4DGZA 2WAQE 3CMEA 3GTQB 5BN5A 1BCPD 4EX5A 2R61A 3VYRA 3F8TA 2UXDL 4RKLA 4P72A 1H9RA 2FHTA 4XQJA 2MQHA 3G6EA 4ME5A 3GTQH 2V1CC 1TS4A 4JBWA 4NKLA 4OHJA 1LTLA 1K83B 4BY1B 4YWMA 2SEBD 4JI0L 2ICEC 5KRUA 4J8QA 2VQFL 5I6WA 3K80C 4X3KA 3CQZB 3S17B 2CCZA 1Y8OB 1ZYRD 2DY8A 1U4PA 5FK9C 4DV4L 1JMCA 3RLFA 2F4VQ 2EQSA 1HH2P 4AYBE 1LT5D 4FDBA 4GLXA 1K9MC 3K58A 3OW7A 4YY3Q 2EYJA 4HEDA 1PYBA 4IOAA 2AUKA 3T4AC 4A76A 1ICWA 3T1HQ 1UE1A 1YI2A 4LK1C 3BJUA 5IYBG 1JC7A 5I4DA 3L7ZC 1XPOA 5C3EG 5FOBB 1KL9A 1IYUA 2B2TC 2K5QA 4KLKA 2HHHL 1ET9A 2A1AA 3GTPB 2Q2TA 3P20A 3PUZA 2AHOB 4G7HC 4MZ9A 4PG3A 2PNRC 1KC8C 4R4IA 4BWGB 3M4PA 5G3LF 4POGA 3PIPA 5C4JB 3GTPH 5J22A 3BYYB 4K2LA 4DR6L 4ULLA 4K0KL 3NK9A 2F0QA 4N9PA 1DJRD 2EPBA 2VS1A 1GM5A 4RCNA 4WJWA 3JAMc 4R4OA 4BBRB 1HNXL 4QUFA 4KKSA 4A93G 5KNDA 3OYYA 1I4HA 4TQUS 2ZJPA 2X6LA 3PUWA 3T13A 3S15B 3E6ZX 1DOMA 2LSSA 2E2JB 1UAPA 5C6AA 2B29A 5ELOA 1LT4D 3L3OC 3BVGA 1JT8A 2ENBA 4LJZC 3TMEA 5C5MA 3S15H 4XDXA 1E7ZA 1EOTA 3BG3A 3VYSA 3GP7A 3I4LA 4ZKCB 2E2JH 3HOUG 2JA8B 2HT1A 1E2VA 2PZWA 3U9OA 1VQDA 1Y8PB 4KTAA 5KIXA 4YCVA 5CV4A 1G51A 2DGYA 2RDFA 3F2CA 5LMUL 3NELA 3NWTA 4A3CG 3A8KE 1XMQQ 3M4OB 2F3IA 3W2DA 4IFDI 2BA0A 2BDOA 1N33Q 1IW7D 4CKCA 2SOBA 3M4OH 2EY5A 2WFWA 3S2DB 1J8IA 2R93G 4B3SQ 4RHRA 4DR1L 3MWYW 2A69D 5M3FB 1D5XC 5ELBA 4QMGA 4BA2I 3S2DH 2UXBL 1JJCB 2N78A 1E1OA 2F0LA 5M3FH 3NTKA 2PW7A 2I07B 3ER0A 4ILWA 5IP7H 2VUMB 1C8CA 1A62A 2F3VA 5IY0A 3HKZB 1TVXA 1TWGB 4LFBL 4GOPB 4DV0L 3DEPA 1D6EC 4AH6A 4JVZA 4LF8Q 1TWGH 4GOPA 3ULJA 1KHIA 1V1OA 1EYDA 3MXUA 3I3CA 2F0OA 4C3JB 4PZ8A 4TSSA 4BA1I 2RQXA 1VQLA 5M5YB
chains in the Genus database with same CATH topology
4WORA 5I9PA 1TS3A 3KLSA 1PFNA 2EYFA 1JR0D 3GTGB 1TY0A 1YNJC 1Q3LA 1WD0A 1LV9A 1QWYA 4EVOA 3HOVB 1EY5A 5C0XG 4QCLA 2BE5D 2N88A 3H3VC 2F0SA 2IW3A 4G7OC 1BCPB 1CQFA 3HP3A 2B2UC 3TP7A 2OEOA 3VYTA 1SMYD 3NE5B 1CQVA 3C3LA 1EU4A 4KN7C 3VR4A 2BOSA 2OF1A 1QCBD 5M3MB 1ENCA 1XYIA 3S2HB 1GUOA 5CC4A 4H7BA 3M3YB 4B9WA 4IUTA 4V190 2PO4A 3SK6A 5CBAE 2L12A 1CZWA 1JB3A 3HG9A 3GTJB 5CR3A 2ICIA 2Z1CA 2AUJD 3V2TA 1O80A 2MUYA 3AB9A 2AQ2B 1OXVA 4B9XA 3S14B 1M8AA 2ZT9C 1QE6A 3S9WA 1KLUD 1LO5D 1W6JA 3HOUB 2KHSA 1HQRD 4IUVA 1RTOA 1XWEA 4DU9A 1Z6HA 1EYAA 3BDLA 2EVBA 2EYOA 3OIPA 3M7GA 3FPPA 3RD4A 3K5NA 1GUGA 5I9OA 4K5VA 5FKAC 2H1EA 1TKWB 4C1NI 2KVMA 1U4RA 2A6HD 2A68C 2WIIB 5DEHA 1X32A 1F77A 1PYWD 4CJ1B 4EQOA 1Q1BA 1F9PA 1SAPA 1F9QA 1NUCA 5FLXE 1LTSD 3A56A 2FJ2A 1F2MA 2B2YC 3D4RA 5LL6S 3IAYA 3WOFA 2NN6H 4RH6A 2JA6B 2O4XA 3QIAA 4L6TB 1MD2D 4OO1H 2J4XA 1T5EA 3K7AB 2K01A 2F0DA 2V4DA 3VA5A 3DEOA 2D62A 1S5BD 4FF1A 4HR7B 1AFPA 1QG7A 4ZKBB 1WD1A 1EZ6A 3IKJA 1K8MA 5ELFA 4NMZA 1B3AA 2R3ZA 1AZPA 1Y69U 1ESRA 1FD7D 1VDZA 1EIHA 3RUZA 1ENFA 1EWCA 3SEBA 5C0XH 2PZUA 1PMRA 3NSWA 4DNRB 1ILQA 3QWNA 3PUYA 2B2WC 4A3IB 2XN9C 1BQQT 1I4PA 5E4XA 2A6EC 2IX1A 1XXGA 1BCPF 2K05A 2TSSA 1HA6A 2OT2A 2IPKD 4ZQ3A 3VA7A 1B44D 1A3VA 1G6ZA 3CRKC 2VB2X 4DAVA 2M2LA 2L4NA 2A5HA 1AZQA 2D2CC 3WDNA 3MHBA 4KHVA 2JA5B 5LHY1 1KLGD 4C3HB 1GOZA 4B08A 2E76C 3I70A 1EQVA 5C0XI 4HTHA 1FNUA 2PQEA 4H13C 3R8BA 2QF7A 4NDXA 1QNKA 2D5DA 5JOBA 5KEEA 1D5ZC 2MJ8A 3K0YA 3TZUA 4BS9A 3R93A 4C3IG 1SE4A 1KDBA 1Q1EA 4FP5D 5ELEA 3S1RB 3MFYA 4R8NA 3PIP3 3X3MA 4I7ZC 1O7ZA 1CZGA 3GO5A 3S1QB 4MHEA 5BN3A 1JOKA 5HGTA 3KF8A 2DNCA 5C3WA 3I4NB 4N9TA 5JJZA 2F0FA 4A3JB 5IGEA 1VCIA 1TWFB 1KABA 2EJMA 1S5CD 3EJIA 3GV6A 1I6VC 2CVRA 2HDMA 2K03A 1SXTA 3NTIA 5A2QL 4LMQD 2VXWA 5C5LA 1DONA 2LS01 1PRTC 1L0YB 1DD2A 1SE2A 3NBIA 3VR2A 3X3NA 3TZDA 3V05A 5IT9E 3SK4A 3WOEA 2QCPX 4TRDA 4ZUJA 1SYBA 1OO9B 2PYKA 4IUUA 1S5ED 4PMCA 2E2DC 1WTRA 2HCIA 1HFGA 5EJWA 3QO2A 2EJGC 3HGBA 1KTKA 4IUPA 3RZDB 4S3SA 2AQ3B 2AQ1B 1KNAA 5EPKA 3GQBA 1EY4A 1RTNA 3CHBD 4XT1B 1SSOA 1YNJD 3QOJA 4H44C 4KMUC 3K57A 1HXYD 4CKEA 3NBHA 2CW0C 5T1GA 1Y1VB 1A2TA 2NTTA 4KY7A 2QKIC 4IUNA 2L5TA 3EROA 5C44B 5EPJA 3EFXD 2K6AA 5IGFA 2KA7A 4UAIA 1Q8IA 2EYHA 1JORA 4NP5A 1SBBB 4KV6A 2A74C 2E74C 4K8JA 2B2VC 1QOHA 1E2ZA 2F0IA 2NUCA 4G7ZC 1SJHD 4A3DB 2EY6A 1RD9D 4RGNA 4PMWA 1H9SB 4KKTA 3QB3A 4LAAA 2IX0A 3A55A 1H9SA 5E1FA 1VMPA 5EPLA 4CBVA 2B2TA 3MC0B 4G4KA 4RGOS 2B8GA 2QEJC 4IFDH 5A35A 3U9SA 2YYZA 4KD3A 3TBIB 1PZID 5F2DA 4TKOB 3ERQA 2TMPA 4FF4A 3Q0AA 3A8IE 3N52A 5C4HA 2QDBA 1C4QA 4J1MA 1SNDA 1DOLA 2AWNA 1LT3D 1RDPD 4R9WA 1O7LA 2L55A 1UEAB 1EWHA 4FVMA 2A68D 2NVXB 5HURA 4F8MA 3D6WA 5JPMC 1R9TB 4U673 5FO7B 3R2IA 5CGKA 2JEBI 4I65A 1TWCB 2WINB 2PW5A 2RVLA 4PV1C 4K14A 2KJXA 5T1IA 1OXTA 4K8IA 5K36G 4XQQA 3M85A 5CMDA 5KYLA 3QG1A 4EQNA 2X6GA 1SYFA 2BA1A 3J81E 3KBGA 3C1EA 2F0UA 2JP1A 5CV8A 2Z4IA 1PTOC 1ZEQX 1CK1A 3HOXB 2RSOA 5COYA 2K04A 1J9OA 2Y0SB 4OIKA 2KCNA 4V0BA 2XRQD 1FR3A 1MSHA 2NZ1D 2O5JC 2A6ED 1D1IA 4KKUA 4IFDJ 3MXGA 1BNZA 3NHHA 1JQYD 4DAPA 3H94A 3LX0A 1S5FD 4HAEA 2DY7A 3VYUA 1K8OA 4X3UA 1BBXC 1V1PB 3EA6A 1HHVA 3MXPA 1WTXA 1A3TA 5IIFA 1EIGA 3NWSA 4XYQA 1V1PA 2B2UA 1JWSD 1I4GA 5I2YA 1STBA 2NYZD 1Q90A 5JEAG 5JPNC 1LTGD 5KNBA 2EYLA 1V8QA 1HRJA 5C3EB 3OSOA 3TP5A 1KDCA 3HOWB 1M4VA 1B50A 2FMMA 4E6IA 5I6YA 5IOCA 5IGDA 2F0MA 2KQ3A 1HA5A 3URYA 1STEA 3KUPA 3OMGA 1O7YA 4DNTB 5CORA 4A3BB 3L9AX 4C56C 2XIWA 4U68A 2SDFA 4A93B 5D3DA 1SNOA 3FPUB 3PV0A 1DM0B 2SNSA 2EZVA 3J80E 2NB0A 3A7AB 1B4OA 2PMZB 5KNCA 3MEHA 3DUZA 4WRDA 3BVZA 2CHBD 1SNPA 1AP0A 1F2LA 4IZ8A 4HMJA 1S5DD 1U4LA 2R93B 3QJYA 4L8JA 1FNWA 4ODGA 1VF5C 1PRTD 5K36H 3T51B 5J1ZA 2RBMA 1DYQA 1EEFD 3EVQA 3SK5A 4IURA 3T56B 2GA4B 2FMCA 3N6RA 3FRPB 5NUCA 1JCKB 3SVMA 5CYUA 4K5WA 4M8AA 4RWSC 2LMCB 2JXMB 2L11A 1IL8A 3TP6A 4BBSB 2JEAI 4QUCA 5DM73 3BDCA 1G8ZD 4ABNA 4RA8A 5ELDA 2J7ZA 4K2KA 5LL6X 1LTID 3BZDB 1G291 1RCVD 3ZYYX 4RCOA 1TR5A 3RZOB 5C3XA 1TWAB 2DNEA 4KD4A 3FVQA 4HMIA 4FF3A 2VB3X 3PIO3 2I46A 1FYCA 4CJ0B 3MZ5A 2B2WA 3BDOA 3D6CA 4NW2A 1SNCA 4A3GB 4XQNA 4IALA 4DF7A 3DHQA 3SXHA 5JEAH 2IT1A 4FF2A 1ZXTA 3HOZB 1G2TA 1LT6D 2XWBB 2EXZA 3KBXA 2MHVA 4HCEA 2NWGA 5AFWA 1NR4A 5JVH3 3DWPA 1QB5D 3GTMB 1SNQA 2G9DA 4K5XA 1DZ1A 2HCCA 4Y7NB 3P1HA 1LLRD 1TS5A 1F9RA 1RHPA 2K5WA 2K5DA 3HS0C 1UNSA 1O78A 4XT3B 1EQTA 1D5MC 1GUNA 2KEEA 3K59A 3Q22A 3BYTB 3R3OA 4RGMA 5EBCA 5JVG3 3I73A 3HRZC 1ET6A 2X69A 4QB4A 3SHLA 4RFBA 1TQOA 2F0HA 3GTOB 4OGQC 1X3QA 4CKBA 2Q8IB 1MGSA 5A2QE 1D2BA 3QOLA 2L0CA 2WB1B 1OXSC 4MN3A 2JSOA 2EY2A 1HTPA 2Z8LA 1DOKA 1Z7TA 1Y1WB 4FNFA 1B53A 2F0KA 3KLRA 1CFMA 3J7AF 2MGSA 3OPOA 5C0XJ 1GUSA 4Q0FA 4QIWB 3Q23A 1STNA 2H4OA 2K7VA 1WTVA 4G57A 1PRTB 3JAML 1IKLA 5JEAJ 3H09A 5K5PA 3MXNA 3VR6A 4ID6A 3I8ZA 3P75A 1QILA 1SNMA 1AN8A 1ZKOA 1I3QB 3GV3A 2L1BA 1EY6A 2NVTB 2J0TD 1BDOA 2VNUD 1W6KA 1SYDA 3BS1A 3E5SA 2IWHA 1RJTA 1STHA 3SDZA 1AW7A 3NQTA 3T53B 1PTOD 4FXGC 3EQLC 3GTLB 3M7NA 5D3IB 4ZK9B 3TSSA 3M4YA 2F0PA 2WP8J 4KN4C 1GJXA 5JAVA 2NTSA 2MP1A 3E0JA 1SE3A 3FMCA 3AMUA 1HPCA 3I72A 1E2WA 2B63B 3DWQA 3NQIA 1FNVA 3NTHA 3IFTA 1HTLD 2NVYB 4EGVA 1NAPA 3I90A 4IUQA 1JOOA 1A15A 1A6XA 1E0BA 1EY7A 1TU2B 5D65A 1B1ZA 4O1NA 4RHSA 5BN4A 5FO9B 5CV5A 3VR3A 3NXWA 1T5XD 1PDQA 3LWUA 1TY2A 1CHPD 1GUTA 2K33A 1RKNA 2KUMA 2B2VA 4C3IB 3H0GB 3C2PA 2EY1A 1XX8A 4C3JG 3S1MB 1QNUA 1MI2A 2N55A 2EE1A 2F3WA 3MA2B 2C9OA 1JE4A 1EEID 4HCSA 2LKVA 4R8IA 4Q5VA 1CT1D 2F0WA 4X3SA 3T16A 3PO2B 1AEXA 2NVQB 2B39A 1BO0A 2KEDA 2EYMA 3O13A 1A2UA 4OIJA 2JA7B 1S4ZA 1CI3M 2O2LD 2IL8A 3P7JA 4UDUC 1SFOB 5IODA 1STGA 3SE0A 3G6JB 2K1BA 1HQMC 4A3KB 3PMFA 4KJNA 1F2YA 1KAAA 1NSNS 1PRTF 5TSSA 3MVVA 4O42A 3J7YW 5EKLA 1I4XA 2WAQB 2L9HA 5EBDA 3SK8A 4PMBA 2WACA 4ZLTF 1LTTD 2Q8TA 1SYEA 1EY0A 2R92B 5EKKA 2K28A 1LTRD 3NP8A 2LFNA 3OIQA 3PUVA 1WTWA 2ZXRA 2FFKB 1HUMA 1PTOB 3V96A 2WV6D 3FKIB 4AYBB 5CV7A 4FXDA 3NPPA 2F0EA 1F9SA 3CRLC 5IGCA 1PTOH 2G9HD 2Q8RE 5DAUA 3TP8A 1EL0A 2XSCA 1IKMA 4FO2A 2KCCA 4DAYA 2DN8A 1JOQA 1MBYA 1YNNC 2OXPA 4XTCS 2MPMA 2EOTA 4A3EB 1CA6A 5J39A 4DK1A 5C4ZA 2B8FA 1DXMA 2ID0A 3D31A 5CV6A 1PZJD 2NN6G 2F0VA 4ZAIA 4KY6A 4OO1G 1LTBD 3R2TA 2C5CA 3H91A 5ELCA 1BXTA 1SJED 4PNYA 4IN3A 2SNMA 4DXFA 5IGBA 2HUGA 1WVLA 4DK0A 1VMCA 2JYOA 3J81L 1TS2A 1G91A 2XWJB 2LY7A 3ITPA 2M9VA 4KK7A 4XIGS 5EQ0A 3I91A 4ZYSA 4RAUC 3MTSA 1I6HB 3D4DA 2WKCA 3D4WA 1Y8NB 2M00A 4C2MB 3CKIB 1HFNA 2RA4A 2RDHA 2BCOA 1BCPC 2ZXOA 1I50B 2F0TA 3S16B 4K6LA 4WFN3 1CM9A 3RMHA 1RF2D 3K5MA 3KLSX 1MSGA 5M9OA 3A54A 1ONLA 2Z4HA 1I4QA 1ZYRC 4IQZA 1IYVA 3S1NB 1X3PA 1JWUD 3C1FA 3F2UA 1OXUA 2KOLA 5KGUA 2XRSD 1PFBA 1H9MA 2PCFB 4C3HG 4Z9CB 4DN4M 4DA2A 2QILA 3LNNA 1H9KA 4XXEA 4A3FB 2FINB 5CBEE 2HQEA 1BF4A 5G3LD 2F4IA 1GHJA 1DCZA 3NUCA 3H6MA 1QJOA 3UI2A 3PO3B 4X3TA 4F87A 2B2YA 3OMCA 1PTOF 4C1NK 2HDLA 4EQPA 3J80L 1BUVT 1WTPA 1F2ZA 2BDNA 2YU9B 1U9RA 3I4MB 2AWOA 1B2TA 3G7LA 1ENAA 1JICA 1PLFA 3ND9A 2IX3A 4ZUIA 1GXDC 1D1KA 3ONAB 3W3AA 3HEJA 5E4WC 3IFDA 1IW7C 1TWHB 1LACA 2CW0D 4P2CB 5EGTA 4GZYC 2RSNA 1HUNA 2A69C 1KDAA 5E3FA 1L0XB 2EYPA 3TDQA 1IHZA 1XTCD 1RODA 1STYA 4CJ2C 1NR2A 2WKDA 4K6DA 1BOSA 4J6HA 1PZKD 2R6GA 5FLXL 3HOYB 3KK7A 2F1MA 3PUXA 1SYGA 1EFID 1A3UA 1G2SA 3OOCA 1GHKA 1EYCA 4QF4A 5DM63 1U4MA 3AU7A 1II3A 2F0NA 4ZRZA 1ML0D 1CHQD 1PXUA 2NN6I 1SDFA 1R4PB 4OO1I 3FEWX 3OWFA 4OL7A 3LWEA 1SEBD 3FDTA 1EY8A 1LABA 2A73B 4JK1C 2F0GA 2BE5C 4CGYB 3DWAA 3Q6SA 1KNEA 1STAA 1VF7A 2RKSA 5ISRA 4MIUA 4F88A 1R4QB 4KY5A 1SMYC 3JAME 4FXKC 1Z47A 1Q12A 4YIJA 3SR1A 1WTQA 1I4RA 3HZXA 2NBFA 1BR9A 5DNFA 1JWMD 2O5IC 1WTOA 3J7AV 2IJ0A 2E75C 4DXGA 3MAQA 2F03A 4M1UB 2PPBC 4KJOA 1CTMA 1GUWA 3GD7A 5M5XB 2E2IB 3GTKB 4DFAA 2JE6I 1B9MA 4IFDG 3K5LA 1CA5A 3C46A 4A3MB 1OXXK 4HN7A 3OHXC 1HCZA 4HSPA 1C48A 3DMUA 1EU3A 4KI0A 4FYDA 1UUPA 3TN2A 1H9JA 1EY9A 5IGGA 1B9NA 5I2XA 4BY7B 2PZTA 2R7ZB 3DXJC 2E2HB 1YNND 3IL8A 2A6HC 5M5WB 1SYCA 1TT2A 2KECA 4PQXA 2F0JA 2XNAC 1FGBD 2XVSA 1PFMA 3CU7A 5EKIA 2CQAA 5FO8B 3BVMA 4XYOA 4L63B 5CV9A 1ILPA 4F7XA 1LTAD 3OWEB 5C4XB 2D9UA 2EDGA 3D8GA 3K6OA 4H0LC 3ND8A 3Q24A 1EZ8A 5KYIA 1NCVA 3K5OA 1ESFA 1WCMB 2K32A 2RDGA 3D3RA 4RGTA 2ZXPA 5IT9L 3MFGA 3DM1A 4RKBA 2EJFC 5D14A 3VR5A 4HSVA 1TIID 3A7LA 4KHZA 3A8JE 4CHTB 1V43A 4DGZA 3GTQB 5BN5A 1BCPD 2R61A 3VYRA 4RKLA 1H9RA 2FHTA 4XQJA 4ME5A 1TS4A 4JBWA 4NKLA 4OHJA 1K83B 4BY1B 2SEBD 2ICEC 5KRUA 4J8QA 5I6WA 4X3KA 3CQZB 3S17B 1Y8OB 1ZYRD 2DY8A 1U4PA 5FK9C 3RLFA 1LT5D 3K58A 3OW7A 2EYJA 4HEDA 2AUKA 3T4AC 1ICWA 4LK1C 1JC7A 5I4DA 3L7ZC 5FOBB 1IYUA 2B2TC 2K5QA 1ET9A 3GTPB 3P20A 3PUZA 4G7HC 2PNRC 4BWGB 5G3LF 5C4JB 5J22A 3BYYB 4K2LA 4ULLA 3NK9A 2F0QA 4N9PA 1DJRD 2EPBA 4RCNA 4WJWA 4BBRB 4QUFA 4KKSA 5KNDA 1I4HA 4TQUS 2X6LA 3PUWA 3T13A 3S15B 3E6ZX 1DOMA 2E2JB 1UAPA 5C6AA 1LT4D 3L3OC 3BVGA 2ENBA 4LJZC 3TMEA 5C5MA 4XDXA 1EOTA 3BG3A 3VYSA 3GP7A 3I4LA 4ZKCB 2JA8B 1E2VA 2PZWA 3U9OA 1Y8PB 4KTAA 5KIXA 5CV4A 2RDFA 3NWTA 3A8KE 3M4OB 3W2DA 4IFDI 2BA0A 2BDOA 1IW7D 4CKCA 2SOBA 2EY5A 3S2DB 1J8IA 4RHRA 3MWYW 2A69D 5M3FB 1D5XC 5ELBA 4QMGA 4BA2I 2F0LA 3NTKA 2PW7A 2I07B 4ILWA 2VUMB 1C8CA 2F3VA 3HKZB 1TVXA 1TWGB 3DEPA 1D6EC 1V1OA 1EYDA 3MXUA 3I3CA 2F0OA 4C3JB 4TSSA 4BA1I 2RQXA 5M5YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EQ0 A;  1JIC A;  3I91 A;  1PLF A;  4CJ0 B;  4RAU C;  1G6Z A;  1PFN A;  2D9U A;  2B2W A;  3MTS A;  1B4O A;  2K28 A;  2MGS A;  4NW2 A;  2M2L A;  2L4N A;  2RSO A;  1AZQ A;  5COY A;  1PDQ A;  3TZD A;  2H1E A;  2K04 A;  3ONA B;  1WTQ A;  2KVM A;  1Q3L A;  1U4R A;  1WTW A;  5E4W C;  3IFD A;  2RA4 A;  1WTV A;  1J9O A;  2FFK B;  1WD0 A;  1HFN A;  1IKL A;  1VMP A;  1HUM A;  1LV9 A;  1ZXT A;  2EPB A;  2B2V A;  2KUM A;  5DNF A;  5EPL A;  2B2T A;  1WTO A;  1X32 A;  1NCV A;  4OIK A;  1CM9 A;  1G2T A;  1XX8 A;  4IUU A;  4QUF A;  3I8Z A;  4CJ1 B;  1MSH A;  1MI2 A;  2N55 A;  1WTR A;  2N88 A;  1AP0 A;  2EE1 A;  2RSN A;  1F2L A;  1F9P A;  1SAP A;  2NZ1 D;  2X6L A;  1MSG A;  1F9S A;  3GV3 A;  1F9Q A;  2L1B A;  2HCI A;  3KBX A;  1HFG A;  1DOM A;  2NWG A;  5EJW A;  5AFW A;  1NR4 A;  1GUW A;  3QO2 A;  3HP3 A;  1BNZ A;  2Q8R E;  2B2U C;  1U4L A;  2FJ2 A;  3DM1 A;  1EL0 A;  2B2Y C;  1JE4 A;  1IKM A;  5D14 A;  4XDX A;  1EOT A;  1ROD A;  4CJ2 C;  1NR2 A;  4HCS A;  4ZKC B;  4HAE A;  1DZ1 A;  1QNK A;  2DY7 A;  4HSV A;  4IUP A;  3N52 A;  4R8I A;  2HCC A;  2MJ8 A;  2MPM A;  1RJT A;  1KNA A;  5EPK A;  1X3P A;  4X3U A;  1RTN A;  1DOL A;  2EOT A;  1BBX C;  1CA6 A;  3F2U A;  1CA5 A;  3R93 A;  1HHV A;  4X3S A;  1WTX A;  2KOL A;  4XT1 B;  4R9W A;  1F9R A;  2K01 A;  1SSO A;  1PFB A;  4IUR A;  1EIG A;  1RHP A;  1XYI A;  2B2U A;  4ZK9 B;  1BO0 A;  1G2S A;  3DEO A;  4DN4 M;  2KED A;  4OIJ A;  3SVM A;  4XT3 B;  1EQT A;  3D6W A;  2KEE A;  2FHT A;  1DON A;  5T1G A;  1QG7 A;  2NYZ D;  4IUT A;  4ZKB B;  1WD1 A;  1S4Z A;  1U4M A;  1J8I A;  4RWS C;  2MP1 A;  5CBA E;  2L12 A;  2L11 A;  2IL8 A;  3P7J A;  2JP1 A;  3MWY W;  1IL8 A;  1O7Z A;  4ZAI A;  3TN2 A;  2FIN B;  1HUN A;  1ML0 D;  5CBE E;  1HRJ A;  1B3A A;  4MHE A;  2R3Z A;  2K1B A;  3H91 A;  4QUC A;  1AZP A;  1SDF A;  1BF4 A;  1ESR A;  1O80 A;  2X69 A;  4X3K A;  1B50 A;  2FMM A;  1EIH A;  2DY8 A;  1U4P A;  2RVL A;  4RA8 A;  2J7Z A;  5EPJ A;  3LWE A;  3IL8 A;  3UI2 A;  3FDT A;  1C8C A;  1M8A A;  4X3T A;  1QE6 A;  5JJZ A;  5T1I A;  1TVX A;  1X3Q A;  2B2Y A;  1ILQ A;  2HUG A;  1WVL A;  3DEP A;  2KEC A;  1MGS A;  4UAI A;  4O42 A;  1VMC A;  2B2W C;  2JYO A;  3KUP A;  1RTO A;  4IUV A;  1O7Y A;  4HED A;  2HDL A;  5COR A;  1PFM A;  1G91 A;  1ICW A;  4MN3 A;  1NAP A;  3I90 A;  4IUQ A;  5E4X A;  5EKI A;  1WTP A;  2XIW A;  3I3C A;  3GV6 A;  4U68 A;  5CMD A;  2CVR A;  2HDM A;  1A15 A;  2BDN A;  2L9H A;  3Q6S A;  2K03 A;  2K05 A;  1KNE A;  2SDF A;  2X6G A;  1HA6 A;  1E0B A;  1DOK A;  2B2V C;  5D65 A;  2B2T C;  3FPU B;  4ZLT F;  1B2T A;  4LMQ D;  2VXW A;  1ILP A;  3G7L A;  1B53 A;  2Q8T A; 
#chains in the Genus database with same CATH topology
 4WOR A;  5I9P A;  1TS3 A;  3KLS A;  1PFN A;  3CC7 A;  5M5Y H;  3MEF A;  2EYF A;  1JR0 D;  3GTG B;  4CDC C;  2RHQ B;  2BH8 A;  1TY0 A;  1YNJ C;  3RN5 A;  4PZ7 A;  1Q3L A;  1EQQ A;  2PI2 A;  1EUJ A;  1WD0 A;  1YIJ A;  4JG2 A;  1LV9 A;  1QWY A;  4EVO A;  3HOV B;  1EY5 A;  1ASZ A;  5C0X G;  4DK3 C;  4QCL A;  2BE5 D;  2N88 A;  4N8X 1;  3H3V C;  2F0S A;  5BR8 L;  2IW3 A;  4G7O C;  1BCP B;  1CQF A;  3HP3 A;  4GN5 A;  2B2U C;  2ZM6 Q;  4DV2 Q;  1K0S A;  3CC4 A;  3TP7 A;  3CCR A;  4JI6 Q;  2OWO A;  2OEO A;  3KJP A;  3W5O A;  1P16 A;  3A0J A;  4DNI A;  3VYT A;  3ERS X;  1SMY D;  1VQH A;  4YCU A;  3NE5 B;  1CQV A;  3C3L A;  2K5N A;  1EU4 A;  1VQ8 A;  5IYB H;  4KN7 C;  2ZTD A;  3VR4 A;  2BOS A;  5C3E H;  2OF1 A;  1QCB D;  5M3M B;  5IWA L;  1ENC A;  1XYI A;  4GNX C;  4IO9 A;  1VQ4 A;  3S2H B;  1GUO A;  4I7A A;  2GN5 A;  5CC4 A;  4H7B A;  1JB7 A;  3M3Y B;  5M3M H;  4B9W A;  3F2B A;  4IUT A;  4V19 0;  2PO4 A;  3SK6 A;  5CBA E;  3S2H H;  2L12 A;  1CZW A;  1JB3 A;  3HG9 A;  3GTJ B;  5CR3 A;  2ICI A;  2Z1C A;  1QVG A;  3M3Y H;  2AUJ D;  3V2T A;  4QL5 A;  1RL2 A;  1O80 A;  2MUY A;  3AB9 A;  2EIF A;  2AQ2 B;  1NNX A;  2VW9 A;  1OXV A;  4B9X A;  4X64 L;  3H3V I;  3S14 B;  1M8A A;  1WYD A;  2ZT9 C;  1QE6 A;  3KF6 B;  2PQA B;  3S9W A;  1KLU D;  1LO5 D;  1W6J A;  2Z6B A;  2KHS A;  3U4V A;  1HQR D;  4IUV A;  3HOU B;  1RTO A;  3S14 H;  1XWE A;  1Q86 C;  1UE6 A;  1X3E A;  3KF6 A;  4DU9 A;  2VL6 A;  3HOU H;  5GAH C;  1K3B C;  3KLW A;  1Z6H A;  1AE3 A;  3K0X A;  1EYA A;  2QGQ A;  1VQB A;  3BDL A;  2EVB A;  1HNZ L;  2EYO A;  3NEM A;  3OIP A;  2UXC Q;  3M7G A;  3F2D A;  3FPP A;  3RD4 A;  3K5N A;  4DUY L;  1GUG A;  3OTO Q;  4P71 A;  5I9O A;  1VQP A;  4K5V A;  5FKA C;  2Z6K A;  2H1E A;  1TKW B;  4C1N I;  2KVM A;  1U4R A;  2WB1 G;  2A6H D;  2A68 C;  2WII B;  3KYH C;  1CKN B;  5DEH A;  1X32 A;  1F77 A;  4DR5 Q;  1NJI C;  1PYW D;  4CJ1 B;  4EQO A;  1Q1B A;  1F9P A;  1SAP A;  1F9Q A;  1NUC A;  1Y1W G;  5FLX E;  1LTS D;  1N8R C;  3A56 A;  2FJ2 A;  1F2M A;  2B2Y C;  3D4R A;  1HR0 W;  2HIX A;  5LL6 S;  3IAY A;  4LWC A;  2OQK A;  4L5T A;  3WOF A;  2NN6 H;  4RH6 A;  4R4C A;  3CCE A;  2JA6 B;  2O4X A;  3QIA A;  4L6T B;  1MD2 D;  4OO1 H;  1K3R A;  2J4X A;  1T5E A;  2RCN A;  3K7A B;  2K01 A;  4JI2 Q;  2F0D A;  2V4D A;  3VA5 A;  1YIT A;  3DEO A;  2D62 A;  1S5B D;  4EQ5 A;  3K7A H;  4FF1 A;  4HR7 B;  1AFP A;  1QG7 A;  1VQC A;  1I5F A;  3BU2 A;  4ZKB B;  1WD1 A;  4WJ4 A;  4X6A H;  1EZ6 A;  3IKJ A;  2UUB L;  4LF6 Q;  1PH8 A;  1K8M A;  5ELF A;  4NMZ A;  1B3A A;  2R3Z A;  1FGU A;  1AZP A;  1Y69 U;  1ESR A;  4IPD A;  1FD7 D;  1B3Q A;  1VDZ A;  1EIH A;  3RUZ A;  1ENF A;  1TWA H;  1EWC A;  3SEB A;  5C0X H;  2PZU A;  1PMR A;  3NSW A;  3U50 C;  4DNR B;  1ILQ A;  3QWN A;  1MHW C;  2UUA L;  1HR0 Q;  3PUY A;  2B2W C;  3QR8 A;  4JOI A;  4A3I B;  2XN9 C;  1BQQ T;  1YJN A;  1VQE A;  1I4P A;  5E4X A;  2A6E C;  2IX1 A;  1XXG A;  2DJF C;  1BCP F;  2K05 A;  2TSS A;  1HA6 A;  4A3I H;  2OT2 A;  2IPK D;  4ZQ3 A;  3VA7 A;  4CDE C;  1B44 D;  1A3V A;  1I94 L;  3CRK C;  1G6Z A;  2VB2 X;  1XMO L;  4DAV A;  2M2L A;  3IRB A;  2L4N A;  4NB3 A;  2VQF Q;  2A5H A;  1AZQ A;  3S24 A;  2D2C C;  4KHP Q;  3WDN A;  3MHB A;  4KHV A;  2JA5 B;  1YZ6 A;  5LHY 1;  1VQN A;  4OWW B;  1KLG D;  4Y7N H;  4C3H B;  1GOZ A;  4B08 A;  3CPW A;  2E76 C;  4L5S A;  5C44 G;  3I70 A;  1EQV A;  5C0X I;  4HTH A;  1PVO A;  1FNU A;  3TS2 A;  2PQE A;  4H13 C;  3R8B A;  2QF7 A;  4IOC A;  2IY5 B;  5JJL A;  4NDX A;  1QNK A;  2D5D A;  5JOB A;  5KEE A;  1D5Z C;  2MJ8 A;  3K0Y A;  3TZU A;  4BS9 A;  4R4Q A;  2GVB A;  3R93 A;  2DJG C;  4C3I G;  3H0G G;  1SE4 A;  1KDB A;  1Q1E A;  4FP5 D;  5ELE A;  1L1O C;  3S1R B;  2FXQ A;  3MFY A;  3D0F A;  4K0K Q;  4R8N A;  3PIP 3;  4OEM B;  1K0R A;  3X3M A;  3K7U C;  4I7Z C;  1O7Z A;  4OX9 Q;  1CZG A;  3GO5 A;  1VQO A;  3S1Q B;  4MHE A;  3KF8 B;  5BN3 A;  4DV1 L;  1JOK A;  5HGT A;  3S1Q H;  3PO2 G;  3KF8 A;  2DNC A;  5C3W A;  3I4N B;  4N9T A;  5JJZ A;  2F0F A;  4A3J B;  5IGE A;  1VCI A;  4UP8 A;  1TWF B;  1VQA A;  1KAB A;  4DR7 L;  1IBK L;  3I2Z A;  1CSQ A;  2JA7 G;  1VQM A;  3I4N H;  4UP9 A;  2EJM A;  5IYD G;  4UY8 C;  5LMU Q;  4ZCK A;  1S5C D;  3EJI A;  1TWF H;  3DM3 A;  1W2B A;  3GV6 A;  1I6V C;  1SRU A;  2CVR A;  2HDM A;  5H1S E;  2K03 A;  1SXT A;  3NTI A;  3W1G A;  5A2Q L;  3Q8D A;  4LMQ D;  2VXW A;  4POF A;  5C5L A;  1DON A;  2LS0 1;  4A3K G;  1CKO A;  1PRT C;  1L0Y B;  1DD2 A;  1ICF B;  1SE2 A;  3NBI A;  3VR2 A;  4DR1 Q;  2Q2I A;  3X3N A;  4LF4 L;  1HJP A;  2UXB Q;  1B70 B;  4QY7 A;  1L0W A;  3TZD A;  4LUZ A;  3V05 A;  5IT9 E;  3SK4 A;  3WOE A;  2QCP X;  4TRD A;  4ZUJ A;  5L37 A;  1SYB A;  1OO9 B;  2PYK A;  4IUU A;  1S5E D;  4LFA L;  4PMC A;  2E2D C;  1WTR A;  5GAG C;  2HCI A;  1HFG A;  5EJW A;  3BZC A;  3QO2 A;  3GTL H;  2EJG C;  2E8G A;  2R92 G;  1Q81 C;  3HGB A;  1KTK A;  2KCM A;  4IUP A;  3RZD B;  1BBU A;  4S3S A;  2AQ3 B;  2AQ1 B;  1KNA A;  5EPK A;  3GQB A;  1EY4 A;  1RTN A;  1FJG L;  3CHB D;  5FLX c;  4XT1 B;  3RZD H;  1VS0 A;  3NBH B;  1SSO A;  3FKI G;  3PIO A;  1YNJ D;  4MTN A;  4AYB G;  2Q2H A;  3QOJ A;  4H44 C;  2ES2 A;  4KMU C;  2I0Q A;  4NXM L;  3K57 A;  1M90 C;  1HXY D;  3NBH A;  4CKE A;  2CW0 C;  5T1G A;  1W3S A;  4GKJ Q;  1J6Q A;  4A3L G;  1Y1V B;  1AH9 A;  3LGJ A;  4GLV B;  2YV5 A;  1A2T A;  2NTT A;  5BR8 Q;  1Y1V H;  4KY7 A;  2QKI C;  4IUN A;  4A3E G;  2L5T A;  3ERO A;  5C44 B;  5EPJ A;  3EFX D;  2K6A A;  5IGF A;  1SN8 A;  1MIU A;  2IHE A;  1BBW A;  2KA7 A;  2R7F A;  3CCU A;  4UAI A;  5C44 H;  1Q8I A;  2EYH A;  1JOR A;  4X65 L;  4NP5 A;  1SBB B;  1EFW A;  4KV6 A;  2A74 C;  4DR2 L;  2E74 C;  5IWA Q;  4K8J A;  2B2V C;  1QOH A;  1E2Z A;  4J15 A;  3H0G H;  2F0I A;  2NUC A;  4G7Z C;  1SJH D;  4A3D B;  4JI4 L;  2EY6 A;  3RLO A;  1RD9 D;  4RGN A;  4PMW A;  1VQ9 A;  1H9S B;  4KKT A;  3QB3 A;  4A3D H;  4LAA A;  2IX0 A;  3A55 A;  1H9S A;  5E1F A;  4X64 Q;  1VMP A;  3J7A 5;  5EPL A;  2JN4 A;  4CBV A;  2B2T A;  3MC0 B;  4G4K A;  4RGO S;  1X65 A;  2K52 A;  3EIV A;  2B8G A;  2QEJ C;  4IFD H;  3PSI A;  5A35 A;  3U9S A;  3HOW G;  1CUK A;  2YYZ A;  4KD3 A;  3TBI B;  3PO2 H;  2P5Z X;  3UDF A;  1PZI D;  1PH7 A;  2NVQ H;  5F2D A;  4A75 A;  4TKO B;  1J5E Q;  2IHF A;  2ZTE A;  3ERQ A;  4JI5 L;  2TMP A;  4FF4 A;  3HKZ E;  3Q0A A;  3G71 A;  3A8I E;  1HNZ Q;  3N52 A;  5C4H A;  5IYD H;  2QDB A;  2JJQ A;  2UU9 Q;  1C4Q A;  4J1M A;  1V1Q A;  1PA6 A;  1SND A;  1DOL A;  2CFM A;  4A3B G;  1N32 L;  2AWN A;  1LT3 D;  1RDP D;  3OW2 A;  1SFO H;  5DLQ E;  4R9W A;  1O7L A;  4DUY Q;  2L55 A;  1UEA B;  4JC0 A;  4UHV A;  1EWH A;  4FVM A;  2A68 D;  4DV7 L;  2NVX B;  4A3K H;  1JJG A;  5HUR A;  4F8M A;  3D6W A;  1JE5 A;  5JPM C;  4U67 3;  1X9N A;  1R9T B;  4X62 Q;  1E3P A;  5FO7 B;  4GN3 B;  1A63 A;  3R2I A;  5CGK A;  2NVX H;  2JEB I;  4I65 A;  1N9W A;  1R9T H;  1K8G A;  2PI2 E;  1TWC B;  1Q82 C;  2WIN B;  2PW5 A;  2RVL A;  1TWC H;  4PV1 C;  4K14 A;  2KJX A;  1NMF A;  5T1I A;  3L2P A;  1UE7 A;  1OXT A;  2R92 H;  3A74 A;  1RIP A;  4K8I A;  5K36 G;  4XQQ A;  3M85 A;  4A3F G;  5CMD A;  5KYL A;  3QG1 A;  4EQN A;  2X6G A;  4A4I A;  1SYF A;  2BA1 A;  3J81 E;  3KBG A;  3C1E A;  2F0U A;  2JP1 A;  4NXN L;  3CCL A;  5CV8 A;  3PO3 G;  3CPF A;  2Z4I A;  2UUB Q;  1PTO C;  1ZEQ X;  1CSP A;  3K81 C;  1CK1 A;  3HOX B;  2RSO A;  5COY A;  1IZ6 A;  2K04 A;  1UWV A;  5GAD C;  4A3L H;  1J9O A;  1X6O A;  3HOX H;  2Y0S B;  1HZB A;  4OIK A;  2KCN A;  4V0B A;  4BBS G;  2UUA Q;  2XRQ D;  1VQ6 A;  3AEV A;  1FR3 A;  1MSH A;  3I4M G;  2AKW B;  2NZ1 D;  4ALP A;  2O5J C;  2A6E D;  1D1I A;  4KKU A;  4BXX G;  4IFD J;  1BVS A;  3MXG A;  3KDF B;  4L5R C;  1BNZ A;  3NHH A;  5IT9 c;  1JQY D;  4DAP A;  1NE3 A;  2RHS B;  3G4S A;  3H94 A;  1IBM Q;  4JYA L;  3LX0 A;  3KDF A;  1S5F D;  4HAE A;  2DY7 A;  1V9P A;  3KJO A;  3VYU A;  1K8O A;  2ZJQ A;  4X3U A;  1BBX C;  4GKK L;  1I94 Q;  1V1P B;  3EA6 A;  1HHV A;  1XNQ Q;  3MXP A;  1WTX A;  3H3V H;  1A3T A;  1XMO Q;  5IIF A;  4B3R L;  1EIG A;  3NWS A;  4XYQ A;  1V1P A;  2B2U A;  1IBL L;  1JWS D;  1I4G A;  1O7I A;  4AIM A;  5I2Y A;  1Y14 B;  1STB A;  2NYZ D;  1VQ5 A;  1Q90 A;  5JEA G;  5IYC G;  5JPN C;  2OTL A;  2B3G A;  1LTG D;  5KNB A;  4A3G G;  4O0A A;  4GNX B;  2EYL A;  2YTV A;  3F1Z A;  1V8Q A;  1HRJ A;  5C3E B;  3OSO A;  3TP5 A;  1KDC A;  3HOW B;  1M4V A;  1GD7 A;  2FMM A;  1PH3 A;  1B50 A;  2CWA A;  3HOZ G;  4E6I A;  5I6Y A;  5IOC A;  5IGD A;  2D0P A;  2F0M A;  4JI3 L;  4JI1 Q;  3HOW H;  4LUO A;  2KQ3 A;  4B3T L;  1X54 A;  2MO0 A;  1HA5 A;  3URY A;  1STE A;  3KUP A;  3OMG A;  1O7Y A;  4DNT B;  5COR A;  2GVA A;  4DV6 L;  3U4Z A;  1NBW A;  5HGQ A;  4A3B B;  3L9A X;  1I6H H;  4QJF A;  4C56 C;  2XIW A;  1WTH A;  4U68 A;  2G5D A;  2SDF A;  5EAY A;  3W1B A;  3PF4 A;  4A93 B;  4C2M H;  4A3B H;  5D3D A;  1SNO A;  3FPU B;  1S72 A;  3ICE A;  3PV0 A;  1DM0 B;  2SNS A;  3S16 H;  2EZV A;  1PH6 A;  1XNR L;  4A93 H;  3J80 E;  4YHH Q;  2NB0 A;  2C35 B;  3A7A B;  1B4O A;  2PMZ B;  5KNC A;  3MEH A;  3DUZ A;  2F4V L;  4DV1 Q;  4WRD A;  5JJI A;  1PH9 A;  2PQA A;  3BVZ A;  1K28 A;  2CHB D;  1SNP A;  2QW7 A;  3S1N H;  1E24 A;  3J81 j;  1AP0 A;  1IBK Q;  1PH1 A;  1F2L A;  4IZ8 A;  4A3C H;  4DUZ Q;  4HMJ A;  1HZ9 A;  1S5D D;  1E1T A;  1TXY A;  1U4L A;  1YEZ A;  2YTY A;  3QJY A;  2R93 B;  4HJ8 A;  4L8J A;  1FNW A;  3STB D;  4ODG A;  1VF5 C;  4IJL A;  1QVC A;  2R93 H;  1PRT D;  2N3S A;  3E3X A;  4B3M L;  5K36 H;  3T51 B;  5J1Z A;  2CQO A;  2RBM A;  4LF5 L;  1UE5 A;  1DYQ A;  1EEF D;  3EVQ A;  3SK5 A;  4IUR A;  1CKN A;  3T56 B;  2GA4 B;  2FMC A;  4DR4 Q;  3N6R A;  4GS3 A;  3FRP B;  5NUC A;  1JCK B;  3FP9 A;  4PZ6 A;  4AQY L;  3SVM A;  2VZA A;  5CYU A;  4RMF A;  4IPH A;  4K5W A;  4M8A A;  4RWS C;  2LMC B;  2JXM B;  2L11 A;  1IL8 A;  3TP6 A;  4BBS B;  2JEA I;  4QUC A;  5DM7 3;  3BDC A;  1G8Z D;  4BBS H;  4ABN A;  4RA8 A;  5ELD A;  2J7Z A;  4K2K A;  2N8N A;  5LL6 X;  1LTI D;  3TRE A;  3BZD B;  1G29 1;  4BXX H;  3PGZ A;  1RCV D;  5LMN L;  3ZYY X;  1YHQ A;  4RCO A;  4UP7 A;  4OON A;  1TR5 A;  1PFS A;  3RZO B;  5C3X A;  4JBM A;  1TWA B;  2DNE A;  4B3S L;  4KD4 A;  2MO1 A;  3RZO H;  3FVQ A;  4NXM Q;  2RCF A;  1BKB A;  4HMI A;  2CKZ B;  2QEX A;  4FF3 A;  2HIV A;  2VB3 X;  3PIO 3;  2I46 A;  4GN4 B;  2R7Z G;  1FYC A;  4CJ0 B;  3MZ5 A;  2B2W A;  3CCM A;  3BDO A;  3D6C A;  1WI5 A;  3L0O A;  1SNC A;  4NW2 A;  4MNO A;  4P73 A;  4YWK A;  4A3G B;  4XQN A;  4HIM A;  4IAL A;  4DF7 A;  3DHQ A;  3SXH A;  5JEA H;  3SGI A;  5IYC H;  3J81 c;  2IT1 A;  2ZJR A;  4A3G H;  4FF2 A;  1ZXT A;  3HOZ B;  1G2T A;  1LT6 D;  2XWB B;  2EXZ A;  2UXD Q;  3KBX A;  3HOZ H;  2MHV A;  4HCE A;  2NWG A;  5AFW A;  1NR4 A;  4DR2 Q;  5C4X G;  4R4T A;  4JI0 Q;  2B63 G;  5JVH 3;  3DWP A;  1QB5 D;  3GTM B;  1SNQ A;  4OXP A;  2G9D A;  4K5X A;  1DZ1 A;  1K8A C;  2HCC A;  2LXJ A;  4Y7N B;  4DV4 Q;  3GTM H;  3P1H A;  1LLR D;  1TS5 A;  2KBN A;  2EXD A;  1A0I A;  1F9R A;  5ELN A;  1N34 L;  1RHP A;  2DUD A;  4LF7 L;  5AJ3 L;  3UDX A;  2K5W A;  2K5D A;  3HS0 C;  1UNS A;  3I4O A;  4JI8 L;  4APV A;  1O78 A;  4XT3 B;  1EQT A;  3A5U A;  1D5M C;  1GUN A;  2KEE A;  4P74 A;  3K59 A;  3Q22 A;  3BYT B;  3R3O A;  4RGM A;  4DKA C;  4DV2 L;  5EBC A;  5JVG 3;  3I73 A;  1L1O B;  4JI6 L;  2HHH Q;  3HRZ C;  1ET6 A;  2X69 A;  4QB4 A;  1L1O A;  3SHL A;  4JBK A;  4JI5 Q;  1VQG A;  4RFB A;  1TQO A;  2F0H A;  3GTO B;  4OGQ C;  1X3Q A;  1KIX A;  4CKB A;  4DR6 Q;  2Q8I B;  1KXL A;  1MGS A;  5A2Q E;  1D2B A;  1GKH A;  3QOL A;  2L0C A;  1S3O A;  1N32 Q;  2WB1 B;  3GTO H;  2KHI A;  1KQS A;  2CH4 A;  1OXS C;  4MN3 A;  1HNX Q;  2JSO A;  2MFI A;  4BY1 G;  2EY2 A;  1HTP A;  4DV7 Q;  2Z8L A;  1DOK A;  3T1Y L;  1Z7T A;  2Z0S A;  1Y1W B;  4FNF A;  1B53 A;  2F0K A;  3KLR A;  1CFM A;  3J7A F;  4LNQ A;  3TS0 A;  2MGS A;  3OPO A;  5C0X J;  1GUS A;  4Q0F A;  4QIW B;  1Y1W H;  3Q23 A;  1STN A;  2H4O A;  2K7V A;  2I5L X;  3MXN B;  5M5X H;  1WTV A;  4G57 A;  1PRT B;  3JAM L;  1IKL A;  1UEB A;  3M4Q A;  5JEA J;  4DV3 L;  3H09 A;  5K5P A;  2LXK A;  2E5L L;  3J80 c;  3MXN A;  3VR6 A;  4ID6 A;  1YJ9 A;  3I8Z A;  3P75 A;  1QIL A;  1SNM A;  4QGU A;  1AN8 A;  1ZKO A;  1I3Q B;  3GV3 A;  2L1B A;  3EN2 A;  1EY6 A;  2NVT B;  2J0T D;  1WJJ A;  3E0E A;  1BDO A;  1Z9F A;  2VNU D;  1I3Q H;  1W6K A;  1EYG A;  2NVT H;  1SYD A;  4LUV A;  3BS1 A;  1LM0 A;  3E5S A;  2IWH A;  1RJT A;  3AFP A;  4NXN Q;  3PCO B;  1OTC A;  1STH A;  3SDZ A;  1AW7 A;  3NQT A;  3T53 B;  1PTO D;  2WAQ G;  4FXG C;  4LFB Q;  4DV0 Q;  1B7Y B;  3EQL C;  4BBR G;  3GTL B;  3M7N A;  5D3I B;  4ZK9 B;  4DR5 L;  4IPC A;  4X66 L;  4HIO A;  1S40 A;  3TSS A;  3M4Y A;  4WJ3 M;  2F0P A;  2WP8 J;  1SE8 A;  4KN4 C;  1GJX A;  5JAV A;  2NTS A;  1XPR A;  2MP1 A;  3E0J A;  3DLL A;  1SE3 A;  1KRT A;  3ULP A;  1PHJ A;  3FMC A;  3I55 A;  2JA8 G;  3H15 A;  4P75 A;  3AMU A;  2UUC L;  3CF5 A;  4CDF C;  1HPC A;  3I72 A;  1VQF A;  2ZTC A;  1E2W A;  2B63 B;  1EIY B;  3CCV A;  3DWQ A;  3NQI A;  1FNV A;  3NTH A;  1P8L A;  3IFT A;  1HTL D;  2NVY B;  2Z9H A;  4GKK Q;  4EGV A;  5C4X H;  2B63 H;  2RF4 A;  1NAP A;  3I90 A;  4IUQ A;  3CXC A;  1JOO A;  4HJA A;  2NVY H;  1A15 A;  1IBL Q;  5M3F G;  1A6X A;  4H02 A;  1E0B A;  1EY7 A;  1TU2 B;  2NZO A;  5D65 A;  1B1Z A;  2HD3 A;  2PNH A;  4O1N A;  4RHS A;  5BN4 A;  1VQK A;  3RLN A;  2R7D A;  5FO9 B;  5CV5 A;  3VR3 A;  5FLM G;  2VUM G;  4JPB W;  3HKZ G;  3NXW A;  1T5X D;  3UE0 A;  1PDQ A;  3LWU A;  4JW0 A;  1TY2 A;  1CHP D;  1GUT A;  2K33 A;  1RKN A;  3AQQ A;  2KUM A;  2B2V A;  4C3I B;  3H0G B;  5JJK A;  1NMG A;  3C2P A;  2EY1 A;  4QQB X;  1XX8 A;  4C3J G;  3S1M B;  1QNU A;  1MI2 A;  2N55 A;  2EE1 A;  1HNW L;  4LW1 A;  4C3I H;  4DPG A;  4DV6 Q;  3S1M H;  5GQO A;  2VY3 A;  2F3W A;  3MA2 B;  2C9O A;  1JE4 A;  1EEI D;  2K4K A;  3CCQ A;  1Q7Y C;  4HCS A;  2LKV A;  4R8I A;  4Q5V A;  1XNR Q;  1CT1 D;  1K83 H;  2F0W A;  4BY1 H;  2ATW A;  4X3S A;  3T16 A;  1CKM A;  3PO2 B;  4KHP L;  1AEX A;  3HOV G;  2N49 A;  2VQE L;  2NVQ B;  2B39 A;  4LFC L;  3CP0 A;  1BO0 A;  3CQZ H;  3S17 H;  2KED A;  2EYM A;  3O13 A;  1A2U A;  4OIJ A;  5E7N A;  2JA7 B;  1EQR A;  1S4Z A;  1CI3 M;  3NEN A;  2Q2U A;  2O2L D;  2IL8 A;  2OTJ A;  3P7J A;  1B8A A;  4UDU C;  1SFO B;  2JA7 H;  2OQ0 A;  5IOD A;  1STG A;  1MJE A;  3SE0 A;  3G6J B;  2K1B A;  1HQM C;  3M9B A;  4A3K B;  5LMN W;  3PMF A;  2Y0S E;  4KJN A;  1F2Y A;  5J3B A;  1KAA A;  5M3M G;  1NSN S;  1PRT F;  5TSS A;  3MVV A;  4O42 A;  4B3M Q;  1E22 A;  3J7Y W;  3TRZ A;  5EKL A;  1I4X A;  4LF5 Q;  1PH5 A;  1NY4 A;  2WAQ B;  5C4J H;  2L9H A;  5EBD A;  3AYH B;  4OX9 L;  5HY6 A;  4PMB A;  3SK8 A;  4AQY Q;  2WAC A;  4L5Q A;  4ZLT F;  1N36 L;  1LTT D;  2Q8T A;  1SYE A;  1EY0 A;  4JBJ A;  4BBR H;  2KEN A;  2K14 A;  2R92 B;  5EKK A;  4MTK A;  2K28 A;  1LTR D;  3NP8 A;  2LFN A;  2HQL A;  3OIQ A;  4DR3 L;  3PUV A;  3HFZ B;  1WTW A;  4LF9 L;  2ZXR A;  3BZK A;  2FFK B;  1HUM A;  3TQY A;  4OWT B;  2JA8 H;  3WWV A;  1PTO B;  3V96 A;  2WV6 D;  3FKI B;  3KFU A;  4AYB B;  5CV7 A;  4FXD A;  3NPP A;  5LMN Q;  2F0E A;  1F9S A;  3CRL C;  3UDI A;  4DAY B;  5IGC A;  1PTO H;  2G9H D;  3FKI H;  2Q8R E;  5DAU A;  3TP8 A;  3CCS A;  1EL0 A;  2XSC A;  1IKM A;  4FO2 A;  1SMX A;  2KCC A;  3JC6 6;  4DAY A;  1G6P A;  2DN8 A;  1JOQ A;  1MBY A;  1YNN C;  2D0O A;  2OXP A;  4XTC S;  4Y52 H;  2MPM A;  4JI7 L;  2KCT A;  2EOT A;  4A3E B;  1CA6 A;  2CH4 W;  5J39 A;  4DK1 A;  5C4Z A;  2B8F A;  1FVI A;  4A3E H;  1DXM A;  1VQJ A;  2ID0 A;  3D31 A;  1NTG A;  5CV6 A;  4IJH A;  5FLM H;  1SRO A;  2VUM H;  1PZJ D;  3AFQ A;  1H95 A;  2NN6 G;  2F0V A;  4ZAI A;  4KY6 A;  4OO1 G;  1LTB D;  2PMZ E;  3R2T A;  2C5C A;  4GOP C;  3H91 A;  2JA6 G;  5ELC A;  1BXT A;  3I7F A;  1SJE D;  4PNY A;  2I5M X;  3JAM i;  4IN3 A;  4R1J A;  4C3J H;  1XPU A;  3CD6 A;  2SNM A;  4DXF A;  5IGB A;  2HUG A;  1WVL A;  1IL2 A;  4DK0 A;  1VMC A;  1LYL A;  2JYO A;  3J81 L;  1TS2 A;  4DV5 L;  1G91 A;  3GTG H;  2XWJ B;  2LY7 A;  1N34 Q;  4LF7 Q;  5AJ3 Q;  4YCW A;  3ITP A;  4GKJ L;  4JI8 Q;  4DK6 C;  2M9V A;  4KK7 A;  3FHW A;  3HOY G;  5IE8 A;  1GO3 E;  1X56 A;  4XIG S;  4GNX A;  3HOV H;  5EQ0 A;  3J7Z C;  3I91 A;  4ZYS A;  4RAU C;  1A8V A;  3RR5 A;  1KRS A;  3MTS A;  1C9O A;  1YHA A;  4HJ9 A;  4JV5 L;  1I6H B;  2KHJ A;  1YJW A;  3D4D A;  2WKC A;  3D4W A;  1Y8N B;  4IPG A;  1ASY A;  1XTD A;  2M00 A;  4C2M B;  3CKI B;  1HFN A;  2RA4 A;  2RDH A;  2BCO A;  1BCP C;  2ZXO A;  3TEH B;  4A3I G;  1I50 B;  2F0T A;  3S16 B;  4K6L A;  4WFN 3;  1CM9 A;  3RMH A;  1RF2 D;  2L15 A;  1IYJ B;  1I50 H;  3K5M A;  3KLS X;  1MSG A;  3GDE A;  5M9O A;  2QDL A;  3A54 A;  2QA4 A;  2F52 A;  1ONL A;  2Z4H A;  4TVA B;  1X55 A;  1I4Q A;  1ZYR C;  4IQZ A;  2XTI A;  1IYV A;  4UPA A;  3T1Y Q;  3CAM A;  3S1N B;  1PYS B;  1PH2 A;  1X3P A;  1JWU D;  4YY3 L;  3C1F A;  3F2U A;  2JA5 G;  3GTJ H;  1OXU A;  2KOL A;  5KGU A;  3T1H L;  1WFQ A;  2XRS D;  1PFB A;  4DR7 Q;  1H9M A;  2PCF B;  4C3H G;  4ME3 A;  4Z9C B;  4DA2 A;  4DN4 M;  2K50 A;  3K8A A;  2QIL A;  3LNN A;  1H9K A;  4DV3 Q;  4NPS A;  4XXE A;  2E5L Q;  4A3F B;  2FIN B;  5CBE E;  1J5E L;  2HQE A;  1BF4 A;  3G48 A;  5G3L D;  4A3F H;  1MJC A;  2F4I A;  1GHJ A;  1DCZ A;  1X3G A;  2UU9 L;  3NUC A;  4LF4 Q;  2YTX A;  3H6M A;  1QJO A;  3UI2 A;  1K73 C;  3PO3 B;  4X3T A;  4F87 A;  2B2Y A;  4HID A;  3OMC A;  4HJ7 A;  1PTO F;  3PO3 H;  1LUZ A;  3UDG A;  4C1N K;  2HDL A;  4EQP A;  1Q8K A;  4DAM A;  1L2F A;  3J80 L;  1BUV T;  5FJ8 G;  5GAE C;  4X62 L;  4LFA Q;  1WTP A;  2Z6K C;  1F2Z A;  1MKH A;  2BDN A;  2YU9 B;  1U9R A;  4X66 Q;  3I4M B;  3HKS A;  2AWO A;  1B2T A;  2K5H A;  3G7L A;  1ENA A;  2ASB A;  1C7Y A;  1JIC A;  2YU9 H;  1PLF A;  2NZH A;  3I4M H;  4A3M G;  5IP9 G;  3ND9 A;  3I4N G;  1XMQ L;  4A3J G;  2IX3 A;  2UUC Q;  1QVF A;  1PV4 A;  4ZUI A;  1GXD C;  1D1K A;  2ALY B;  1FJG Q;  1N33 L;  3ONA B;  3W3A A;  3B6Y A;  1HZC A;  3HEJ A;  3IFD A;  5E4W C;  1IW7 C;  1TWH B;  1LAC A;  2CW0 D;  4P2C B;  3UE1 A;  1PH4 A;  2JA6 H;  5EGT A;  4GZY C;  1TWH H;  4HIK A;  2RSN A;  1HUN A;  2A69 C;  4BY7 G;  1KDA A;  1SR3 A;  1D7Q A;  5E3F A;  2XGT A;  1L0X B;  2EYP A;  3TDQ A;  1IHZ A;  2JA9 A;  3KOJ A;  1XTC D;  1ROD A;  1STY A;  4CJ2 C;  1NR2 A;  2WKD A;  4K6D A;  1BOS A;  4J6H A;  1PZK D;  2R6G A;  5FLX L;  3HOY B;  4RG1 A;  3KK7 A;  2WB1 E;  4LF8 L;  2F1M A;  3PUX A;  1SYG A;  3HOY H;  4X65 Q;  1EFI D;  1A3U A;  1G2S A;  3OOC A;  1GHK A;  1EYC A;  3PQI A;  1SLJ A;  4QF4 A;  5DM6 3;  1U4M A;  3AU7 A;  1II3 A;  2A19 A;  2H5X A;  2F0N A;  4ZRZ A;  4JOI C;  1ML0 D;  1CHQ D;  4QIW E;  1HNW Q;  1PXU A;  1IBM L;  2NN6 I;  1U5K A;  1SDF A;  1YHB A;  1EWI A;  1QUQ B;  4JI4 Q;  1R4P B;  4OO1 I;  3FEW X;  3OWF A;  4OL7 A;  3LWE A;  1SEB D;  3FDT A;  3RNU A;  1XNQ L;  3EBE A;  1QUQ A;  2BH2 A;  1EY8 A;  4GLA C;  1LAB A;  1WCM G;  3I56 A;  4O2D A;  3A5Z B;  3CC2 A;  2A73 B;  4JK1 C;  2F0G A;  2JK8 A;  3CCJ A;  2BE5 C;  3RN2 A;  1EOV A;  2ZM6 L;  2VQE Q;  1Y1V G;  4CGY B;  3DWA A;  4LFC Q;  3Q6S A;  1KNE A;  1STA A;  1KAW A;  1QZG A;  1VQI A;  1VF7 A;  2RKS A;  4OEL B;  2JA5 H;  5ISR A;  4MIU A;  4F88 A;  1R4Q B;  4KY5 A;  1SMY C;  3JAM E;  1C0A A;  4FXK C;  4C3H H;  1Z47 A;  1Q12 A;  1YVC A;  4YIJ A;  4JI1 L;  2A8V A;  3SR1 A;  1WTQ A;  1I4R A;  3HZX A;  2NBF A;  1BR9 A;  5DNF A;  1JWM D;  2O5I C;  1WTO A;  3VDY A;  3E9H A;  3J7A V;  2IJ0 A;  2E75 C;  4DXG A;  3MAQ A;  2F03 A;  4M1U B;  2PPB C;  4KJO A;  2K5V A;  1CTM A;  1X3F A;  1GUW A;  1XJV A;  3GD7 A;  5M5X B;  4A3D G;  1YNX A;  3E9I A;  3S1R H;  2E2I B;  3GTK B;  1Q46 A;  4YHH L;  4DFA A;  1FL0 A;  2JE6 I;  1N36 Q;  1B9M A;  3J81 i;  5FJ8 H;  2E2I H;  3GTK H;  4IFD G;  1GVP A;  3K5L A;  1CA5 A;  2MNA A;  2JQO A;  1QZH A;  3C46 A;  4A3M B;  4CDD C;  1OXX K;  4HN7 A;  4DR3 Q;  4N8F A;  3OHX C;  1IXR A;  4LF9 Q;  1HCZ A;  4HSP A;  5GRO A;  4A3M H;  5IP9 H;  1C48 A;  1M1K C;  4JCV E;  3DMU A;  1EU3 A;  4KI0 A;  4DUZ L;  4A3J H;  2UXC L;  4FYD A;  1UUP A;  3TN2 A;  2OCE A;  1H9J A;  1EY9 A;  3OTO L;  5IGG A;  1B9N A;  5I2X A;  1U0L A;  4BY7 B;  2PZT A;  3STB C;  1KD1 C;  2R7Z B;  3DXJ C;  2E2H B;  1YNN D;  3IL8 A;  4OWX B;  2A6H C;  5M5W B;  4BY7 H;  1SYC A;  1TT2 A;  1EIF A;  2KEC A;  4PQX A;  3PF5 A;  2R7Z H;  2F0J A;  2XNA C;  2E2H H;  4DR4 L;  4JI7 Q;  1FGB D;  2XVS A;  5M5W H;  1PFM A;  1DGS A;  3CU7 A;  3ZJY C;  5EKI A;  3U58 A;  2CQA A;  5FO8 B;  2AMC B;  3BVM A;  4XYO A;  3CW2 C;  4L63 B;  5CV9 A;  1ILP A;  4F7X A;  1AE2 A;  1WOC A;  1LTA D;  3OWE B;  4YWL A;  3CMA A;  5C4X B;  4JYA Q;  2D9U A;  2EDG A;  1T9H A;  1HZA A;  3D8G A;  3K6O A;  4JI2 L;  4HJ5 A;  4H0L C;  3ND8 A;  3Q24 A;  1EZ8 A;  5KYI A;  4B3R Q;  1NCV A;  1VQ7 A;  2CWP A;  3K5O A;  1ESF A;  5IP7 G;  4LF6 L;  1WCM B;  2K32 A;  2RDG A;  3D3R A;  4DV5 Q;  4RGT A;  2ZXP A;  3ULL A;  5IT9 L;  3MFG A;  3DM1 A;  4RKB A;  1YBY A;  1WCM H;  2EJF C;  5D14 A;  1JJ2 A;  3HOX G;  3VR5 A;  4HSV A;  1HR0 L;  1TII D;  2I5H A;  2K75 A;  3A7L A;  4KHZ A;  3A8J E;  4JI3 Q;  4B3T Q;  2Y0S G;  4CHT B;  4JV5 Q;  1V43 A;  1D8L A;  3J80 i;  4DGZ A;  2WAQ E;  3CME A;  3GTQ B;  5BN5 A;  1BCP D;  4EX5 A;  2R61 A;  3VYR A;  3F8T A;  2UXD L;  4RKL A;  4P72 A;  1H9R A;  2FHT A;  4XQJ A;  2MQH A;  3G6E A;  4ME5 A;  3GTQ H;  2V1C C;  1TS4 A;  4JBW A;  4NKL A;  4OHJ A;  1LTL A;  1K83 B;  4BY1 B;  4YWM A;  2SEB D;  4JI0 L;  2ICE C;  5KRU A;  4J8Q A;  2VQF L;  5I6W A;  3K80 C;  4X3K A;  3CQZ B;  3S17 B;  2CCZ A;  1Y8O B;  1ZYR D;  2DY8 A;  1U4P A;  5FK9 C;  4DV4 L;  1JMC A;  3RLF A;  2F4V Q;  2EQS A;  1HH2 P;  4AYB E;  1LT5 D;  4FDB A;  4GLX A;  1K9M C;  3K58 A;  3OW7 A;  4YY3 Q;  2EYJ A;  4HED A;  1PYB A;  4IOA A;  2AUK A;  3T4A C;  4A76 A;  1ICW A;  3T1H Q;  1UE1 A;  1YI2 A;  4LK1 C;  3BJU A;  5IYB G;  1JC7 A;  5I4D A;  3L7Z C;  1XPO A;  5C3E G;  5FOB B;  1KL9 A;  1IYU A;  2B2T C;  2K5Q A;  4KLK A;  2HHH L;  1ET9 A;  2A1A A;  3GTP B;  2Q2T A;  3P20 A;  3PUZ A;  2AHO B;  4G7H C;  4MZ9 A;  4PG3 A;  2PNR C;  1KC8 C;  4R4I A;  4BWG B;  3M4P A;  5G3L F;  4POG A;  3PIP A;  5C4J B;  3GTP H;  5J22 A;  3BYY B;  4K2L A;  4DR6 L;  4ULL A;  4K0K L;  3NK9 A;  2F0Q A;  4N9P A;  1DJR D;  2EPB A;  2VS1 A;  1GM5 A;  4RCN A;  4WJW A;  3JAM c;  4R4O A;  4BBR B;  1HNX L;  4QUF A;  4KKS A;  4A93 G;  5KND A;  3OYY A;  1I4H A;  4TQU S;  2ZJP A;  2X6L A;  3PUW A;  3T13 A;  3S15 B;  3E6Z X;  1DOM A;  2LSS A;  2E2J B;  1UAP A;  5C6A A;  2B29 A;  5ELO A;  1LT4 D;  3L3O C;  3BVG A;  1JT8 A;  2ENB A;  4LJZ C;  3TME A;  5C5M A;  3S15 H;  4XDX A;  1E7Z A;  1EOT A;  3BG3 A;  3VYS A;  3GP7 A;  3I4L A;  4ZKC B;  2E2J H;  3HOU G;  2JA8 B;  2HT1 A;  1E2V A;  2PZW A;  3U9O A;  1VQD A;  1Y8P B;  4KTA A;  5KIX A;  4YCV A;  5CV4 A;  1G51 A;  2DGY A;  2RDF A;  3F2C A;  5LMU L;  3NEL A;  3NWT A;  4A3C G;  3A8K E;  1XMQ Q;  3M4O B;  2F3I A;  3W2D A;  4IFD I;  2BA0 A;  2BDO A;  1N33 Q;  1IW7 D;  4CKC A;  2SOB A;  3M4O H;  2EY5 A;  2WFW A;  3S2D B;  1J8I A;  2R93 G;  4B3S Q;  4RHR A;  4DR1 L;  3MWY W;  2A69 D;  5M3F B;  1D5X C;  5ELB A;  4QMG A;  4BA2 I;  3S2D H;  2UXB L;  1JJC B;  2N78 A;  1E1O A;  2F0L A;  5M3F H;  3NTK A;  2PW7 A;  2I07 B;  3ER0 A;  4ILW A;  5IP7 H;  2VUM B;  1C8C A;  1A62 A;  2F3V A;  5IY0 A;  3HKZ B;  1TVX A;  1TWG B;  4LFB L;  4GOP B;  4DV0 L;  3DEP A;  1D6E C;  4AH6 A;  4JVZ A;  4LF8 Q;  1TWG H;  4GOP A;  3ULJ A;  1KHI A;  1V1O A;  1EYD A;  3MXU A;  3I3C A;  2F0O A;  4C3J B;  4PZ8 A;  4TSS A;  4BA1 I;  2RQX A;  1VQL A;  5M5Y B; 
#chains in the Genus database with same CATH homology
 4WOR A;  5I9P A;  1TS3 A;  3KLS A;  1PFN A;  2EYF A;  1JR0 D;  3GTG B;  1TY0 A;  1YNJ C;  1Q3L A;  1WD0 A;  1LV9 A;  1QWY A;  4EVO A;  3HOV B;  1EY5 A;  5C0X G;  4QCL A;  2BE5 D;  2N88 A;  3H3V C;  2F0S A;  2IW3 A;  4G7O C;  1BCP B;  1CQF A;  3HP3 A;  2B2U C;  3TP7 A;  2OEO A;  3VYT A;  1SMY D;  3NE5 B;  1CQV A;  3C3L A;  1EU4 A;  4KN7 C;  3VR4 A;  2BOS A;  2OF1 A;  1QCB D;  5M3M B;  1ENC A;  1XYI A;  3S2H B;  1GUO A;  5CC4 A;  4H7B A;  3M3Y B;  4B9W A;  4IUT A;  4V19 0;  2PO4 A;  3SK6 A;  5CBA E;  2L12 A;  1CZW A;  1JB3 A;  3HG9 A;  3GTJ B;  5CR3 A;  2ICI A;  2Z1C A;  2AUJ D;  3V2T A;  1O80 A;  2MUY A;  3AB9 A;  2AQ2 B;  1OXV A;  4B9X A;  3S14 B;  1M8A A;  2ZT9 C;  1QE6 A;  3S9W A;  1KLU D;  1LO5 D;  1W6J A;  3HOU B;  2KHS A;  1HQR D;  4IUV A;  1RTO A;  1XWE A;  4DU9 A;  1Z6H A;  1EYA A;  3BDL A;  2EVB A;  2EYO A;  3OIP A;  3M7G A;  3FPP A;  3RD4 A;  3K5N A;  1GUG A;  5I9O A;  4K5V A;  5FKA C;  2H1E A;  1TKW B;  4C1N I;  2KVM A;  1U4R A;  2A6H D;  2A68 C;  2WII B;  5DEH A;  1X32 A;  1F77 A;  1PYW D;  4CJ1 B;  4EQO A;  1Q1B A;  1F9P A;  1SAP A;  1F9Q A;  1NUC A;  5FLX E;  1LTS D;  3A56 A;  2FJ2 A;  1F2M A;  2B2Y C;  3D4R A;  5LL6 S;  3IAY A;  3WOF A;  2NN6 H;  4RH6 A;  2JA6 B;  2O4X A;  3QIA A;  4L6T B;  1MD2 D;  4OO1 H;  2J4X A;  1T5E A;  3K7A B;  2K01 A;  2F0D A;  2V4D A;  3VA5 A;  3DEO A;  2D62 A;  1S5B D;  4FF1 A;  4HR7 B;  1AFP A;  1QG7 A;  4ZKB B;  1WD1 A;  1EZ6 A;  3IKJ A;  1K8M A;  5ELF A;  4NMZ A;  1B3A A;  2R3Z A;  1AZP A;  1Y69 U;  1ESR A;  1FD7 D;  1VDZ A;  1EIH A;  3RUZ A;  1ENF A;  1EWC A;  3SEB A;  5C0X H;  2PZU A;  1PMR A;  3NSW A;  4DNR B;  1ILQ A;  3QWN A;  3PUY A;  2B2W C;  4A3I B;  2XN9 C;  1BQQ T;  1I4P A;  5E4X A;  2A6E C;  2IX1 A;  1XXG A;  1BCP F;  2K05 A;  2TSS A;  1HA6 A;  2OT2 A;  2IPK D;  4ZQ3 A;  3VA7 A;  1B44 D;  1A3V A;  1G6Z A;  3CRK C;  2VB2 X;  4DAV A;  2M2L A;  2L4N A;  2A5H A;  1AZQ A;  2D2C C;  3WDN A;  3MHB A;  4KHV A;  2JA5 B;  5LHY 1;  1KLG D;  4C3H B;  1GOZ A;  4B08 A;  2E76 C;  3I70 A;  1EQV A;  5C0X I;  4HTH A;  1FNU A;  2PQE A;  4H13 C;  3R8B A;  2QF7 A;  4NDX A;  1QNK A;  2D5D A;  5JOB A;  5KEE A;  1D5Z C;  2MJ8 A;  3K0Y A;  3TZU A;  4BS9 A;  3R93 A;  4C3I G;  1SE4 A;  1KDB A;  1Q1E A;  4FP5 D;  5ELE A;  3S1R B;  3MFY A;  4R8N A;  3PIP 3;  3X3M A;  4I7Z C;  1O7Z A;  1CZG A;  3GO5 A;  3S1Q B;  4MHE A;  5BN3 A;  1JOK A;  5HGT A;  3KF8 A;  2DNC A;  5C3W A;  3I4N B;  4N9T A;  5JJZ A;  2F0F A;  4A3J B;  5IGE A;  1VCI A;  1TWF B;  1KAB A;  2EJM A;  1S5C D;  3EJI A;  3GV6 A;  1I6V C;  2CVR A;  2HDM A;  2K03 A;  1SXT A;  3NTI A;  5A2Q L;  4LMQ D;  2VXW A;  5C5L A;  1DON A;  2LS0 1;  1PRT C;  1L0Y B;  1DD2 A;  1SE2 A;  3NBI A;  3VR2 A;  3X3N A;  3TZD A;  3V05 A;  5IT9 E;  3SK4 A;  3WOE A;  2QCP X;  4TRD A;  4ZUJ A;  1SYB A;  1OO9 B;  2PYK A;  4IUU A;  1S5E D;  4PMC A;  2E2D C;  1WTR A;  2HCI A;  1HFG A;  5EJW A;  3QO2 A;  2EJG C;  3HGB A;  1KTK A;  4IUP A;  3RZD B;  4S3S A;  2AQ3 B;  2AQ1 B;  1KNA A;  5EPK A;  3GQB A;  1EY4 A;  1RTN A;  3CHB D;  4XT1 B;  1SSO A;  1YNJ D;  3QOJ A;  4H44 C;  4KMU C;  3K57 A;  1HXY D;  4CKE A;  3NBH A;  2CW0 C;  5T1G A;  1Y1V B;  1A2T A;  2NTT A;  4KY7 A;  2QKI C;  4IUN A;  2L5T A;  3ERO A;  5C44 B;  5EPJ A;  3EFX D;  2K6A A;  5IGF A;  2KA7 A;  4UAI A;  1Q8I A;  2EYH A;  1JOR A;  4NP5 A;  1SBB B;  4KV6 A;  2A74 C;  2E74 C;  4K8J A;  2B2V C;  1QOH A;  1E2Z A;  2F0I A;  2NUC A;  4G7Z C;  1SJH D;  4A3D B;  2EY6 A;  1RD9 D;  4RGN A;  4PMW A;  1H9S B;  4KKT A;  3QB3 A;  4LAA A;  2IX0 A;  3A55 A;  1H9S A;  5E1F A;  1VMP A;  5EPL A;  4CBV A;  2B2T A;  3MC0 B;  4G4K A;  4RGO S;  2B8G A;  2QEJ C;  4IFD H;  5A35 A;  3U9S A;  2YYZ A;  4KD3 A;  3TBI B;  1PZI D;  5F2D A;  4TKO B;  3ERQ A;  2TMP A;  4FF4 A;  3Q0A A;  3A8I E;  3N52 A;  5C4H A;  2QDB A;  1C4Q A;  4J1M A;  1SND A;  1DOL A;  2AWN A;  1LT3 D;  1RDP D;  4R9W A;  1O7L A;  2L55 A;  1UEA B;  1EWH A;  4FVM A;  2A68 D;  2NVX B;  5HUR A;  4F8M A;  3D6W A;  5JPM C;  1R9T B;  4U67 3;  5FO7 B;  3R2I A;  5CGK A;  2JEB I;  4I65 A;  1TWC B;  2WIN B;  2PW5 A;  2RVL A;  4PV1 C;  4K14 A;  2KJX A;  5T1I A;  1OXT A;  4K8I A;  5K36 G;  4XQQ A;  3M85 A;  5CMD A;  5KYL A;  3QG1 A;  4EQN A;  2X6G A;  1SYF A;  2BA1 A;  3J81 E;  3KBG A;  3C1E A;  2F0U A;  2JP1 A;  5CV8 A;  2Z4I A;  1PTO C;  1ZEQ X;  1CK1 A;  3HOX B;  2RSO A;  5COY A;  2K04 A;  1J9O A;  2Y0S B;  4OIK A;  2KCN A;  4V0B A;  2XRQ D;  1FR3 A;  1MSH A;  2NZ1 D;  2O5J C;  2A6E D;  1D1I A;  4KKU A;  4IFD J;  3MXG A;  1BNZ A;  3NHH A;  1JQY D;  4DAP A;  3H94 A;  3LX0 A;  1S5F D;  4HAE A;  2DY7 A;  3VYU A;  1K8O A;  4X3U A;  1BBX C;  1V1P B;  3EA6 A;  1HHV A;  3MXP A;  1WTX A;  1A3T A;  5IIF A;  1EIG A;  3NWS A;  4XYQ A;  1V1P A;  2B2U A;  1JWS D;  1I4G A;  5I2Y A;  1STB A;  2NYZ D;  1Q90 A;  5JEA G;  5JPN C;  1LTG D;  5KNB A;  2EYL A;  1V8Q A;  1HRJ A;  5C3E B;  3OSO A;  3TP5 A;  1KDC A;  3HOW B;  1M4V A;  1B50 A;  2FMM A;  4E6I A;  5I6Y A;  5IOC A;  5IGD A;  2F0M A;  2KQ3 A;  1HA5 A;  3URY A;  1STE A;  3KUP A;  3OMG A;  1O7Y A;  4DNT B;  5COR A;  4A3B B;  3L9A X;  4C56 C;  2XIW A;  4U68 A;  2SDF A;  4A93 B;  5D3D A;  1SNO A;  3FPU B;  3PV0 A;  1DM0 B;  2SNS A;  2EZV A;  3J80 E;  2NB0 A;  3A7A B;  1B4O A;  2PMZ B;  5KNC A;  3MEH A;  3DUZ A;  4WRD A;  3BVZ A;  2CHB D;  1SNP A;  1AP0 A;  1F2L A;  4IZ8 A;  4HMJ A;  1S5D D;  1U4L A;  2R93 B;  3QJY A;  4L8J A;  1FNW A;  4ODG A;  1VF5 C;  1PRT D;  5K36 H;  3T51 B;  5J1Z A;  2RBM A;  1DYQ A;  1EEF D;  3EVQ A;  3SK5 A;  4IUR A;  3T56 B;  2GA4 B;  2FMC A;  3N6R A;  3FRP B;  5NUC A;  1JCK B;  3SVM A;  5CYU A;  4K5W A;  4M8A A;  4RWS C;  2LMC B;  2JXM B;  2L11 A;  1IL8 A;  3TP6 A;  4BBS B;  2JEA I;  4QUC A;  5DM7 3;  3BDC A;  1G8Z D;  4ABN A;  4RA8 A;  5ELD A;  2J7Z A;  4K2K A;  5LL6 X;  1LTI D;  3BZD B;  1G29 1;  1RCV D;  3ZYY X;  4RCO A;  1TR5 A;  3RZO B;  5C3X A;  1TWA B;  2DNE A;  4KD4 A;  3FVQ A;  4HMI A;  4FF3 A;  2VB3 X;  3PIO 3;  2I46 A;  1FYC A;  4CJ0 B;  3MZ5 A;  2B2W A;  3BDO A;  3D6C A;  4NW2 A;  1SNC A;  4A3G B;  4XQN A;  4IAL A;  4DF7 A;  3DHQ A;  3SXH A;  5JEA H;  2IT1 A;  4FF2 A;  1ZXT A;  3HOZ B;  1G2T A;  1LT6 D;  2XWB B;  2EXZ A;  3KBX A;  2MHV A;  4HCE A;  2NWG A;  5AFW A;  1NR4 A;  5JVH 3;  3DWP A;  1QB5 D;  3GTM B;  1SNQ A;  2G9D A;  4K5X A;  1DZ1 A;  2HCC A;  4Y7N B;  3P1H A;  1LLR D;  1TS5 A;  1F9R A;  1RHP A;  2K5W A;  2K5D A;  3HS0 C;  1UNS A;  1O78 A;  4XT3 B;  1EQT A;  1D5M C;  1GUN A;  2KEE A;  3K59 A;  3Q22 A;  3BYT B;  3R3O A;  4RGM A;  5EBC A;  5JVG 3;  3I73 A;  3HRZ C;  1ET6 A;  2X69 A;  4QB4 A;  3SHL A;  4RFB A;  1TQO A;  2F0H A;  3GTO B;  4OGQ C;  1X3Q A;  4CKB A;  2Q8I B;  1MGS A;  5A2Q E;  1D2B A;  3QOL A;  2L0C A;  2WB1 B;  1OXS C;  4MN3 A;  2JSO A;  2EY2 A;  1HTP A;  2Z8L A;  1DOK A;  1Z7T A;  1Y1W B;  4FNF A;  1B53 A;  2F0K A;  3KLR A;  1CFM A;  3J7A F;  2MGS A;  3OPO A;  5C0X J;  1GUS A;  4Q0F A;  4QIW B;  3Q23 A;  1STN A;  2H4O A;  2K7V A;  1WTV A;  4G57 A;  1PRT B;  3JAM L;  1IKL A;  5JEA J;  3H09 A;  5K5P A;  3MXN A;  3VR6 A;  4ID6 A;  3I8Z A;  3P75 A;  1QIL A;  1SNM A;  1AN8 A;  1ZKO A;  1I3Q B;  3GV3 A;  2L1B A;  1EY6 A;  2NVT B;  2J0T D;  1BDO A;  2VNU D;  1W6K A;  1SYD A;  3BS1 A;  3E5S A;  2IWH A;  1RJT A;  1STH A;  3SDZ A;  1AW7 A;  3NQT A;  3T53 B;  1PTO D;  4FXG C;  3EQL C;  3GTL B;  3M7N A;  5D3I B;  4ZK9 B;  3TSS A;  3M4Y A;  2F0P A;  2WP8 J;  4KN4 C;  1GJX A;  5JAV A;  2NTS A;  2MP1 A;  3E0J A;  1SE3 A;  3FMC A;  3AMU A;  1HPC A;  3I72 A;  1E2W A;  2B63 B;  3DWQ A;  3NQI A;  1FNV A;  3NTH A;  3IFT A;  1HTL D;  2NVY B;  4EGV A;  1NAP A;  3I90 A;  4IUQ A;  1JOO A;  1A15 A;  1A6X A;  1E0B A;  1EY7 A;  1TU2 B;  5D65 A;  1B1Z A;  4O1N A;  4RHS A;  5BN4 A;  5FO9 B;  5CV5 A;  3VR3 A;  3NXW A;  1T5X D;  1PDQ A;  3LWU A;  1TY2 A;  1CHP D;  1GUT A;  2K33 A;  1RKN A;  2KUM A;  2B2V A;  4C3I B;  3H0G B;  3C2P A;  2EY1 A;  1XX8 A;  4C3J G;  3S1M B;  1QNU A;  1MI2 A;  2N55 A;  2EE1 A;  2F3W A;  3MA2 B;  2C9O A;  1JE4 A;  1EEI D;  4HCS A;  2LKV A;  4R8I A;  4Q5V A;  1CT1 D;  2F0W A;  4X3S A;  3T16 A;  3PO2 B;  1AEX A;  2NVQ B;  2B39 A;  1BO0 A;  2KED A;  2EYM A;  3O13 A;  1A2U A;  4OIJ A;  2JA7 B;  1S4Z A;  1CI3 M;  2O2L D;  2IL8 A;  3P7J A;  4UDU C;  1SFO B;  5IOD A;  1STG A;  3SE0 A;  3G6J B;  2K1B A;  1HQM C;  4A3K B;  3PMF A;  4KJN A;  1F2Y A;  1KAA A;  1NSN S;  1PRT F;  5TSS A;  3MVV A;  4O42 A;  3J7Y W;  5EKL A;  1I4X A;  2WAQ B;  2L9H A;  5EBD A;  3SK8 A;  4PMB A;  2WAC A;  4ZLT F;  1LTT D;  2Q8T A;  1SYE A;  1EY0 A;  2R92 B;  5EKK A;  2K28 A;  1LTR D;  3NP8 A;  2LFN A;  3OIQ A;  3PUV A;  1WTW A;  2ZXR A;  2FFK B;  1HUM A;  1PTO B;  3V96 A;  2WV6 D;  3FKI B;  4AYB B;  5CV7 A;  4FXD A;  3NPP A;  2F0E A;  1F9S A;  3CRL C;  5IGC A;  1PTO H;  2G9H D;  2Q8R E;  5DAU A;  3TP8 A;  1EL0 A;  2XSC A;  1IKM A;  4FO2 A;  2KCC A;  4DAY A;  2DN8 A;  1JOQ A;  1MBY A;  1YNN C;  2OXP A;  4XTC S;  2MPM A;  2EOT A;  4A3E B;  1CA6 A;  5J39 A;  4DK1 A;  5C4Z A;  2B8F A;  1DXM A;  2ID0 A;  3D31 A;  5CV6 A;  1PZJ D;  2NN6 G;  2F0V A;  4ZAI A;  4KY6 A;  4OO1 G;  1LTB D;  3R2T A;  2C5C A;  3H91 A;  5ELC A;  1BXT A;  1SJE D;  4PNY A;  4IN3 A;  2SNM A;  4DXF A;  5IGB A;  2HUG A;  1WVL A;  4DK0 A;  1VMC A;  2JYO A;  3J81 L;  1TS2 A;  1G91 A;  2XWJ B;  2LY7 A;  3ITP A;  2M9V A;  4KK7 A;  4XIG S;  5EQ0 A;  3I91 A;  4ZYS A;  4RAU C;  3MTS A;  1I6H B;  3D4D A;  2WKC A;  3D4W A;  1Y8N B;  2M00 A;  4C2M B;  3CKI B;  1HFN A;  2RA4 A;  2RDH A;  2BCO A;  1BCP C;  2ZXO A;  1I50 B;  2F0T A;  3S16 B;  4K6L A;  4WFN 3;  1CM9 A;  3RMH A;  1RF2 D;  3K5M A;  3KLS X;  1MSG A;  5M9O A;  3A54 A;  1ONL A;  2Z4H A;  1I4Q A;  1ZYR C;  4IQZ A;  1IYV A;  3S1N B;  1X3P A;  1JWU D;  3C1F A;  3F2U A;  1OXU A;  2KOL A;  5KGU A;  2XRS D;  1PFB A;  1H9M A;  2PCF B;  4C3H G;  4Z9C B;  4DN4 M;  4DA2 A;  2QIL A;  3LNN A;  1H9K A;  4XXE A;  4A3F B;  2FIN B;  5CBE E;  2HQE A;  1BF4 A;  5G3L D;  2F4I A;  1GHJ A;  1DCZ A;  3NUC A;  3H6M A;  1QJO A;  3UI2 A;  3PO3 B;  4X3T A;  4F87 A;  2B2Y A;  3OMC A;  1PTO F;  4C1N K;  2HDL A;  4EQP A;  3J80 L;  1BUV T;  1WTP A;  1F2Z A;  2BDN A;  2YU9 B;  1U9R A;  3I4M B;  2AWO A;  1B2T A;  3G7L A;  1ENA A;  1JIC A;  1PLF A;  3ND9 A;  2IX3 A;  4ZUI A;  1GXD C;  1D1K A;  3ONA B;  3W3A A;  3HEJ A;  5E4W C;  3IFD A;  1IW7 C;  1TWH B;  1LAC A;  2CW0 D;  4P2C B;  5EGT A;  4GZY C;  2RSN A;  1HUN A;  2A69 C;  1KDA A;  5E3F A;  1L0X B;  2EYP A;  3TDQ A;  1IHZ A;  1XTC D;  1ROD A;  1STY A;  4CJ2 C;  1NR2 A;  2WKD A;  4K6D A;  1BOS A;  4J6H A;  1PZK D;  2R6G A;  5FLX L;  3HOY B;  3KK7 A;  2F1M A;  3PUX A;  1SYG A;  1EFI D;  1A3U A;  1G2S A;  3OOC A;  1GHK A;  1EYC A;  4QF4 A;  5DM6 3;  1U4M A;  3AU7 A;  1II3 A;  2F0N A;  4ZRZ A;  1ML0 D;  1CHQ D;  1PXU A;  2NN6 I;  1SDF A;  1R4P B;  4OO1 I;  3FEW X;  3OWF A;  4OL7 A;  3LWE A;  1SEB D;  3FDT A;  1EY8 A;  1LAB A;  2A73 B;  4JK1 C;  2F0G A;  2BE5 C;  4CGY B;  3DWA A;  3Q6S A;  1KNE A;  1STA A;  1VF7 A;  2RKS A;  5ISR A;  4MIU A;  4F88 A;  1R4Q B;  4KY5 A;  1SMY C;  3JAM E;  4FXK C;  1Z47 A;  1Q12 A;  4YIJ A;  3SR1 A;  1WTQ A;  1I4R A;  3HZX A;  2NBF A;  1BR9 A;  5DNF A;  1JWM D;  2O5I C;  1WTO A;  3J7A V;  2IJ0 A;  2E75 C;  4DXG A;  3MAQ A;  2F03 A;  4M1U B;  2PPB C;  4KJO A;  1CTM A;  1GUW A;  3GD7 A;  5M5X B;  2E2I B;  3GTK B;  4DFA A;  2JE6 I;  1B9M A;  4IFD G;  3K5L A;  1CA5 A;  3C46 A;  4A3M B;  1OXX K;  4HN7 A;  3OHX C;  1HCZ A;  4HSP A;  1C48 A;  3DMU A;  1EU3 A;  4KI0 A;  4FYD A;  1UUP A;  3TN2 A;  1H9J A;  1EY9 A;  5IGG A;  1B9N A;  5I2X A;  4BY7 B;  2PZT A;  2R7Z B;  3DXJ C;  2E2H B;  1YNN D;  3IL8 A;  2A6H C;  5M5W B;  1SYC A;  1TT2 A;  2KEC A;  4PQX A;  2F0J A;  2XNA C;  1FGB D;  2XVS A;  1PFM A;  3CU7 A;  5EKI A;  2CQA A;  5FO8 B;  3BVM A;  4XYO A;  4L63 B;  5CV9 A;  1ILP A;  4F7X A;  1LTA D;  3OWE B;  5C4X B;  2D9U A;  2EDG A;  3D8G A;  3K6O A;  4H0L C;  3ND8 A;  3Q24 A;  1EZ8 A;  5KYI A;  1NCV A;  3K5O A;  1ESF A;  1WCM B;  2K32 A;  2RDG A;  3D3R A;  4RGT A;  2ZXP A;  5IT9 L;  3MFG A;  3DM1 A;  4RKB A;  2EJF C;  5D14 A;  3VR5 A;  4HSV A;  1TII D;  3A7L A;  4KHZ A;  3A8J E;  4CHT B;  1V43 A;  4DGZ A;  3GTQ B;  5BN5 A;  1BCP D;  2R61 A;  3VYR A;  4RKL A;  1H9R A;  2FHT A;  4XQJ A;  4ME5 A;  1TS4 A;  4JBW A;  4NKL A;  4OHJ A;  1K83 B;  4BY1 B;  2SEB D;  2ICE C;  5KRU A;  4J8Q A;  5I6W A;  4X3K A;  3CQZ B;  3S17 B;  1Y8O B;  1ZYR D;  2DY8 A;  1U4P A;  5FK9 C;  3RLF A;  1LT5 D;  3K58 A;  3OW7 A;  2EYJ A;  4HED A;  2AUK A;  3T4A C;  1ICW A;  4LK1 C;  1JC7 A;  5I4D A;  3L7Z C;  5FOB B;  1IYU A;  2B2T C;  2K5Q A;  1ET9 A;  3GTP B;  3P20 A;  3PUZ A;  4G7H C;  2PNR C;  4BWG B;  5G3L F;  5C4J B;  5J22 A;  3BYY B;  4K2L A;  4ULL A;  3NK9 A;  2F0Q A;  4N9P A;  1DJR D;  2EPB A;  4RCN A;  4WJW A;  4BBR B;  4QUF A;  4KKS A;  5KND A;  1I4H A;  4TQU S;  2X6L A;  3PUW A;  3T13 A;  3S15 B;  3E6Z X;  1DOM A;  2E2J B;  1UAP A;  5C6A A;  1LT4 D;  3L3O C;  3BVG A;  2ENB A;  4LJZ C;  3TME A;  5C5M A;  4XDX A;  1EOT A;  3BG3 A;  3VYS A;  3GP7 A;  3I4L A;  4ZKC B;  2JA8 B;  1E2V A;  2PZW A;  3U9O A;  1Y8P B;  4KTA A;  5KIX A;  5CV4 A;  2RDF A;  3NWT A;  3A8K E;  3M4O B;  3W2D A;  4IFD I;  2BA0 A;  2BDO A;  1IW7 D;  4CKC A;  2SOB A;  2EY5 A;  3S2D B;  1J8I A;  4RHR A;  3MWY W;  2A69 D;  5M3F B;  1D5X C;  5ELB A;  4QMG A;  4BA2 I;  2F0L A;  3NTK A;  2PW7 A;  2I07 B;  4ILW A;  2VUM B;  1C8C A;  2F3V A;  3HKZ B;  1TVX A;  1TWG B;  3DEP A;  1D6E C;  1V1O A;  1EYD A;  3MXU A;  3I3C A;  2F0O A;  4C3J B;  4TSS A;  4BA1 I;  2RQX A;  5M5Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...