1HUMA

Solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA
publication title High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine(chemotactic)
total genus 10
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1humA00
1WTPA 1EIGA 4MHEA 3DEOA 2B2UA 5CORA 5E4WC 2KVMA 2HDMA 3I8ZA 2HCIA 2X6LA 3GV6A 1IKLA 1DOKA 1ML0D 2KEDA 3I3CA 3KBXA 4X3SA 5CBEE 4NW2A 1BF4A 1HFNA 1F2LA 1RJTA 1PFBA 1B3AA 2B2WA 4ZKCB 2EOTA 2K1BA 4CJ1B 1B4OA 1KNAA 1WTRA 3MWYW 1QE6A 2N55A 3DM1A 1F9QA 1G91A 1QG7A 2RSNA 1CM9A 1Q3LA 2KOLA 1CA6A 1CA5A 4XT3B 1NAPA 3F2UA 1ESRA 4OIJA 1HUNA 4ZAIA 1X3PA 2K04A 4X3UA 1J9OA 5D65A 3DEPA 5JJZA 3KUPA 1U4RA 2NZ1D 1DOLA 1HFGA 5D14A 3FDTA 3GV3A 1O7ZA 1BNZA 1B53A 1F9RA 3SVMA 4UAIA 1EL0A 1PFMA 4XDXA 2NWGA 5EPLA 1SAPA 2L4NA 2KECA 2IL8A 2DY8A 4IUQA 2NYZD 4IUTA 1WVLA 1B50A 1XX8A 1U4PA 1MSGA 4ZK9B 1WTOA 1MI2A 5EKIA 1SSOA 3Q6SA 5CBAE 1XYIA 2RSOA 4O42A 1E0BA 4XT1B 1AZPA 2K28A 1PFNA 1GUWA 2K01A 1MGSA 1EOTA 1MSHA 2B2TC 2L11A 2RVLA 1M8AA 2FJ2A 2X6GA 1NCVA 1WD0A 3ONAB 3MTSA 2HUGA 4IUUA 1A15A 1HHVA 2MPMA 1DONA 4QUFA 1WTVA 2B2VC 4HAEA 1G6ZA 1QNKA 2B2VA 1X3QA 2SDFA 4X3KA 1RTNA 2MGSA 1ILPA 1AP0A 2EPBA 4OIKA 5EPJA 5CMDA 1EQTA 2FFKB 2FMMA 2Q8RE 1PDQA 2XIWA 4CJ2C 2K03A 2M2LA 4X3TA 4IURA 5T1IA 4R8IA 3G7LA 2HCCA 2L9HA 3IFDA 1IL8A 4RAUC 2JYOA 1F9PA 1J8IA 1ICWA 1RTOA 1S4ZA 1U4LA 2B2YC 4RWSC 2B2YA 1AZQA 3I90A 2FINB 5EPKA 1HUMA 1O7YA 3N52A 1JICA 4CJ0B 1IKMA 3H91A 4R9WA 3UI2A 5AFWA 5DNFA 3TZDA 2B2TA 1DZ1A 1WTQA 5T1GA 2L1BA 2MJ8A 2B2UC 1B2TA 5E4XA 2JP1A 1G2TA 2EE1A 2J7ZA 5EQ0A 1VMCA 3LWEA 1F9SA 1X32A 1SDFA 4ZLTF 1BO0A 2D9UA 2VXWA 2DY7A 1WTWA 1C8CA 4HEDA 2R3ZA 1O80A 2H1EA 1LV9A 2L12A 2B2WC 3QO2A 3FPUB 4LMQD 3D6WA 1NR2A 1TVXA 2K05A 1WD1A 4IUVA 2X69A 1BBXC 4MN3A 5EJWA 2HDLA 2MP1A 3HP3A 3IL8A 2N88A 2FHTA 5COYA 3TN2A 4ZKBB 1VMPA 4U68A 2Q8TA 1RODA 1HA6A 4DN4M 4IUPA 1NR4A 3R93A 1G2SA 2KUMA 3I91A 3P7JA 1JE4A 2RA4A 4HSVA 1HRJA 1EIHA 1WTXA 1DOMA 2KEEA 1RHPA 1PLFA 1ILQA 1KNEA 1U4MA 2BDNA 1ZXTA 4RA8A 4HCSA 4QUCA 2CVRA
chains in the Genus database with same CATH superfamily
3PO2B 4MHEA 5LMNL 2ZXOA 4LUZA 2K32A 1D5XC 1VDZA 2N3SA 4DR6L 4TQUS 2OXPA 3PUVA 3D4WA 1HQRD 2EJFC 4X3SA 3K0YA 4BS9A 2VQEQ 3ICEA 1EFID 3T1HL 1LT5D 3EFXD 4FYDA 2NUCA 4L5SA 5KIXA 2PPBC 1I3QB 2ALYB 1E2VA 3Q24A 1LABA 4OWTB 1MKHA 4TKOB 2DJFC 1N36L 1TS2A 1G6PA 2K14A 3H3VH 5C3EB 4JBMA 4KV6A 3FDTA 1ET6A 1JR0D 3HOXG 1K8GA 2IX0A 3UDIA 4YHHQ 4DV0Q 1PH1A 3SVMA 5EPLA 3HOYG 3CQZB 3M4QA 3VR2A 4A3KB 2ID0A 2P5ZX 2EYLA 4C3HG 4XYOA 4NDXA 3T13A 1XYIA 3ULLA 2UXDL 1E1TA 2LXKA 3SEBA 2WAQB 1X6OA 4DV2L 4HCEA 1OO9B 1N8RC 2X6GA 1PYWD 3I4MH 3OPOA 3NBHA 2F4IA 3UDFA 4BBSH 4JI3Q 1KDCA 4IUUA 3AYHB 4HAEA 1PFSA 5M5XB 3GTQB 1PRTB 1X3QA 4ILWA 3WOEA 1ENCA 1RTNA 3PGZA 3RNUA 4KY6A 1YNJC 2PZUA 3KDFB 1XPRA 4FXDA 5CMDA 4Y7NB 3SK6A 3GTOH 5T1IA 1IW7D 1KRTA 3SGIA 2EQSA 2JYOA 2FXQA 4OX9Q 1N34L 3T4AC 2E2HH 1K73C 1D5ZC 3RUZA 3AMUA 4DK0A 1K3BC 4LK1C 3EVQA 1TWAB 4I65A 1IYVA 5LMNQ 2JP1A 4WRDA 3JAMc 4DV4L 1V1OA 2D9UA 3H94A 3W2DA 2R3ZA 3KLWA 4OO1G 3T1HQ 4BXXG 1I94L 3RLNA 3LWUA 3J7AF 2J4XA 3W1GA 3AB9A 4HJ5A 3K6OA 1NR4A 2KUMA 3DXJC 5JJKA 4QF4A 1YJ9A 4DK6C 1KNEA 2EY5A 4EQOA 4RA8A 1W6JA 1N36Q 4A3FH 1WTPA 3ER0A 3I4OA 2E5LL 4R4QA 1AEXA 2I5MX 4DV5L 4DNTB 5HURA 3HZXA 3I3CA 3HS0C 1VQ5A 4QJFA 4WJWA 3Q0AA 2B2WA 1HQMC 5IP7G 2BE5C 1CSQA 1ZYRD 4GOPC 3M4YA 3K80C 1IHZA 1WCMG 1YEZA 3V96A 5BN3A 1UEBA 3BVZA 3IRBA 3K7AB 3CCRA 4B9WA 2Z1CA 1WTHA 1XMOL 4JI6L 3S1RH 3LX0A 3KJPA 5DAUA 2K52A 2RBMA 3HOZB 3MHBA 4OXPA 1K9MC 3RLOA 2R92H 4GN3B 1QUQA 4C3JG 4TVAB 5I9OA 2F0QA 5GAHC 1NUCA 1N34Q 3E9HA 4O42A 5C5LA 4LF7Q 3M9BA 2K4KA 5ELOA 4G4KA 2RQXA 1KRSA 3Q23A 4KD4A 2DUDA 1H9SB 5A35A 1PZJD 4HTHA 5G3LF 1PYBA 3FMCA 5JJLA 1KC8C 3H09A 1WTVA 2AQ1B 5FLMH 1ZKOA 5KYLA 3NE5B 3U50C 5DM73 1C48A 1I4HA 3JC66 3NENA 4DV4Q 1XNQL 3ULJA 4B3TL 4IFDI 3A8JE 5KNCA 3S1NH 2UXCL 3J80c 2K6AA 1Y1WG 1O7LA 1N32L 1JJGA 3D6CA 1T9HA 5GADC 2JA6G 1LTID 4IN3A 1TY0A 3GQBA 2CW0C 4QCLA 1KL9A 1BUVT 1WYDA 4FXKC 2V1CC 4KN4C 2L1BA 5T1GA 4UPAA 5GROA 2PW7A 2PMZE 1L0WA 2E5LQ 2SNMA 5EQ0A 4DV5Q 2K75A 1S40A 1I6HH 1X3FA 5FLXL 2IY5B 1CT1D 1Q81C 4L8JA 3M3YH 2VUMB 1Q8IA 1DM0B 4UP9A 1PH3A 1IBKL 1TXYA 5C3WA 3I91A 1CKMA 2VZAA 2NB0A 4WORA 1RHPA 1HTPA 1U4MA 2PQAB 1KTKA 4HJAA 4RCNA 1XMOQ 4JI6Q 3VYUA 1XWEA 2F0GA 1UE5A 3Q22A 2OTLA 3HOVG 2XRSD 4IPHA 1IKLA 1KDAA 3T1YL 4IFDH 1CQVA 2EDGA 5E1FA 5IGGA 2D62A 2K1BA 3CMEA 3GTLH 2R93B 3PIO3 1JB3A 1Y1VB 4DR1Q 5E3FA 1XNRL 2JA8H 1Q3LA 2Y0SB 1B70B 4DUZL 2L5TA 4GLXA 2R7DA 1STEA 2K04A 5C44B 3KUPA 4AIMA 3S9WA 5IYDH 1CI3M 1GJXA 2PYKA 3UDGA 4JBWA 5EAYA 1LTBD 2WKCA 1H9JA 5BN5A 4LF5L 1XNQQ 1I6VC 3RZOH 4YWLA 3CKIB 3HOYB 4OHJA 2E2DC 2UXCQ 1BCPD 1YJWA 5C4XB 1N32Q 2MNAA 1A6XA 1GUSA 4C3HB 2K28A 1OXVA 3GTPH 1MSHA 4K14A 2FJ2A 1QB5D 4ME3A 4X64L 2HUGA 1VQBA 1H9MA 1UUPA 1DXMA 2E75C 3TSSA 4B3RL 3N6RA 4I7ZC 2AQ3B 2VL6A 1S3OA 2XIWA 4CJ2C 2F0WA 4R8IA 3G7LA 1IBLL 1IBKQ 5EPKA 1STAA 1I50H 5C4HA 2IT1A 4TRDA 3K57A 2B2TA 4RGMA 2JA7G 3M7GA 3K5LA 2JN4A 2YU9B 1A2UA 4JI0L 4PMCA 4OWWB 1ET9A 3HRZC 2LKVA 2DNCA 1CTMA 1EY9A 1F9SA 3ZJYC 4KKUA 4MZ9A 3X3MA 3QO2A 2B2WC 3T1YQ 3L3OC 4H02A 1H9KA 1TR5A 1A2TA 1A62A 2G9DA 3PIP3 1RKNA 4JPBW 2BDOA 1XNRQ 1B3QA 4XXEA 4DUZQ 4DAYA 2VNUD 2CVRA 4JC0A 1IYJB 1ENFA 1PTOC 2AMCB 2NVXB 2PNRC 3K5MA 1HZ9A 4BY7H 4H13C 3J81j 2Z8LA 4OWXB 1JWUD 4LF5Q 1IW7C 2WFWA 1X65A 3EJIA 4GN4B 4A3BH 1B3AA 4JVZA 2EOTA 4DXFA 1TWCH 1Y69U 5DM63 1KNAA 1Y8OB 2F0FA 3M4OB 3IKJA 4APVA 1SBBB 3F2UA 2NVTH 1YJNA 3V2TA 3PO2G 2F0IA 4X64Q 3GV3A 3PCOB 5KEEA 3DLLA 2ZTDA 3KLSX 5H1SE 2OF1A 4ULLA 4X65L 4B3RQ 4R4CA 2L4NA 5HGQA 2Q2UA 1Q7YC 1TWHH 1XX8A 1GHJA 4G57A 1ICFB 5EKIA 1HPCA 4R1JA 4J1MA 2G9HD 2OCEA 1CZWA 3KF6B 1IBLQ 4L5QA 3DMUA 4ZQ3A 1DCZA 3U4VA 4NXNL 5LMUL 3ONAB 4B3MQ 5C3EG 1JWMD 4RG1A 1HCZA 1EZ8A 3I4MB 2NBFA 4JI7Q 1G6ZA 3G71A 2JSOA 4A3KG 1L1OA 1QVFA 1EFWA 2D5DA 2SDFA 4WFN3 4A76A 1QWYA 1TU2B 3PQIA 2E2IB 4QY7A 3WWVA 3QIAA 1DYQA 1VQNA 4DR4L 3HOUH 1RD9D 2H5XA 3IFDA 1I4RA 4WJ3M 2WKDA 1AZQA 2B2YA 4IO9A 3PF4A 1JQYD 4LF9L 2N49A 3SR1A 2E2HB 1VQ6A 2A6HD 4AH6A 1HR0Q 4YIJA 1VQ8A 2SEBD 4X66L 3X3NA 3MEFA 1MJCA 4NKLA 4O1NA 1C8CA 2HQEA 1SN8A 1UNSA 1BKBA 4ZKBB 3L9AX 5C0XH 2O5JC 1VQJA 3CCEA 4HMIA 2XN9C 3C2PA 3OOCA 2KCMA 4KHZA 1PLFA 3FHWA 2PMZB 5J3BA 2ICEC 5IGBA 1V8QA 3AU7A 3CU7A 3H3VC 4N8X1 3MAQA 2PW5A 3URYA 3E9IA 5I2YA 1T5EA 1YNXA 4DR3L 1EQQA 1PRTF 1K83H 2KEDA 3GV6A 4B9XA 2F03A 3HOVB 4BA1I 3QR8A 1Z7TA 1B1ZA 4CDCC 5IGDA 2KCCA 5IT9L 3NWSA 2R61A 3DM1A 1PHJA 2NTSA 1SE4A 1SXTA 2F0DA 3VYTA 5CC4A 5K5PA 1HUNA 4J6HA 3RD4A 3CD6A 4IOCA 2F0TA 3ND8A 5D14A 1BNZA 4F8MA 2JXMB 1PRTD 3KLRA 1PFMA 3QOLA 4XDXA 2XWJB 2A69D 4PV1C 1SNOA 3ERQA 2BCOA 2QDLA 1I5FA 1UE7A 4ZRZA 5CBAE 3ZYYX 1R4PB 3F2CA 2IHEA 1PZID 1YITA 4LF9Q 3RN2A 1GUWA 1EOTA 2B2TC 2RVLA 3I55A 3CCQA 1KABA 3HOZG 4YY3L 4A3JB 1GO3E 3NTIA 1PZKD 2ZJRA 4C3IG 1OXTA 1SMYC 2SOBA 2RCFA 2Z6KC 1EQTA 4LF6L 2AKWB 2WINB 4KLKA 2EYMA 1F9PA 5GAEC 1ICWA 4RWSC 4A3DB 1UE6A 2VS1A 3TP7A 1HUMA 1NBWA 1GUTA 3B6YA 1B9MA 1EOVA 2B63H 1JB7A 1TWFH 1SYGA 1B2TA 5ELCA 3LWEA 2LY7A 1P16A 1WTWA 3OTOL 2DJGC 4OO1I 2L12A 4AQYL 3D6WA 3PV0A 1BBXC 4MN3A 5C5MA 4P2CB 3J81c 1I6HB 2N88A 5CV7A 3TN2A 5IYBH 1VMPA 4PNYA 2XSCA 4HJ7A 3PUZA 1HA6A 2YTYA 1WI5A 3A7LA 1WJJA 3G6JB 5M3FH 1Q90A 3WDNA 1HZAA 2A1AA 3R8BA 1N33L 3UE0A 1NY4A 2EJGC 1X3GA 3A55A 3VDYA 4FF3A 3S1MH 2HT1A 2NVQH 2KVMA 1YNNC 1GM5A 1NMGA 2UXBL 2VUMG 4NW2A 2CHBD 2O4XA 2R6GA 4EQNA 5AJ3Q 1I4QA 1CZGA 4P75A 1SFOB 4A3LG 2N55A 3GTLB 2MO1A 1FYCA 4DNRB 5IOCA 1CA5A 1HA5A 2F3WA 1G51A 1GOZA 2JA8B 2XGTA 5CV5A 3VYRA 4IOAA 5IGEA 4YY3Q 3MXNB 1HNZL 4K6DA 1SAPA 2K5VA 2L55A 4NMZA 1I4XA 3OIPA 1QJOA 4LF6Q 3S2DH 1X54A 4A93B 2F52A 3RZOB 1I4GA 2R93G 1EY0A 1Y1VG 2QW7A 4A3GG 2UUAL 3OWFA 1JJ2A 2Y0SG 4IPDA 4R8NA 1PFNA 3BDCA 3S16B 2K01A 3W3AA 5C44G 2A68C 1JMCA 3GTPB 4GNXC 5C6AA 1J6QA 4OEMB 2MPMA 1TQOA 5IYCG 5TSSA 3PUXA 1J5EQ 2EYPA 3A54A 2L0CA 3NHHA 4AQYQ 2Q8RE 1QCBD 1PDQA 2K03A 5C4XG 3TRZA 4KK7A 3GTKH 2MO0A 1EWIA 3FKIB 1WCMH 3LNNA 3MC0B 3I90A 3VA7A 1E22A 4B3SL 3VR4A 1PVOA 1TS5A 4GOPB 5D3DA 2K5HA 4K8JA 4RHRA 3BJUA 2GVAA 2KJXA 4K2KA 1RIPA 3OMCA 5K36G 1K3RA 4IPCA 4ZCKA 3H0GH 1I50B 2MJ8A 5CGKA 2A6EC 4CDEC 5FO7B 3U4ZA 1BO0A 1YHQA 4C3JH 1PTOF 3FPUB 2R7ZH 1STYA 1YHBA 1GHKA 1HR0W 4H7BA 3D4DA 2RCNA 1CUKA 1RODA 1HRJA 1TY2A 1JE4A 2VB3X 2F0LA 3PIOA 1SYDA 3DEOA 1AN8A 2PI2A 5J1ZA 1XTDA 1HNZQ 4DR6Q 2HCIA 3BDOA 1ML0D 4P71A 4BY7B 2GA4B 3MA2B 2E2JH 4EQPA 1Y1WH 2QA4A 3STBC 2JA6H 1B4OA 1O7IA 4OELB 2UUAQ 5M5YH 1EYDA 3HOWH 1TWCB 3CF5A 4XQQA 5M3MH 4LW1A 2OTJA 1E2WA 4X3UA 2AHOB 2E74C 2KQ3A 3DEPA 5JEAH 3I4LA 4PQXA 1MD2D 1Q1EA 5C3XA 4A3CH 3W1BA 1SYBA 1SRUA 4JI8L 1VQOA 2EYJA 4A3MH 2KCTA 3RR5A 1S5ED 1U4PA 4R4IA 5ELFA 4BY1H 4G7OC 5FOBB 4QGUA 3TQYA 3PF5A 2UXDQ 4B3SQ 4E6IA 1PYSB 1AFPA 4DV2Q 3LGJA 4JI1L 1TS3A 3TP8A 5JPMC 1Y14B 2EY1A 3MTSA 4DF7A 1EY6A 4C2MH 1JOKA 2B2VC 3D8GA 1KLUD 1BR9A 3CC4A 2K5QA 3OMGA 3S2HH 1O78A 4JBJA 4C3IB 1LTSD 3BVGA 3S1QH 4OONA 2HCCA 4K6LA 4F88A 4RAUC 1J8IA 4FF2A 3NP8A 1EWCA 3CXCA 5LL6X 2CQAA 3PIPA 3UI2A 3TZDA 3V05A 2CCZA 3I4MG 2AWNA 1B9NA 3NBHB 4GN5A 4S3SA 1WTQA 4BBSG 3MZ5A 3A8KE 1FNUA 2J7ZA 3PSIA 2OQKA 3I70A 5IT9E 4JOIA 4V190 1EYAA 1II3A 4IFDJ 1TVXA 4IUVA 2JEAI 5EKLA 1KQSA 2MP1A 4CKEA 1I94Q 4U68A 1D1IA 1SMXA 2K50A 4DN4M 1A8VA 5DLQE 5G3LD 5EBCA 5C4JB 1AE3A 4RKLA 3FP9A 5CORA 3J7A5 5FJ8H 1YZ6A 4HIKA 2X6LA 1DOKA 2NN6I 1KHIA 4K2LA 3TDQA 1Q1BA 1MJEA 4DR5L 1D7QA 4RH6A 5NUCA 2OT2A 1SJED 3S15H 1CA6A 2KOLA 2JA5B 1STGA 2EJMA 3A5UA 2LFNA 4A3FG 1K8AC 2KCNA 2NZ1D 3T16A 5IODA 3TMEA 2JQOA 1PH4A 3I4NH 2WV6D 1F9RA 2ZTEA 1SYEA 4Q0FA 1EL0A 2KECA 3F1ZA 3SK8A 1B50A 3E0JA 2EXZA 2JE6I 3QWNA 4FP5D 1U5KA 3IAYA 4ZK9B 1WTOA 1TWGH 2F4VL 3I56A 3DWPA 3Q6SA 1YI2A 4YCWA 2HIVA 1C0AA 1QVCA 2RDFA 3D0FA 3EQLC 4A3GB 2RHQB 5I6WA 3K8AA 1BXTA 2F3IA 2A73B 1WFQA 4A3EH 3QOJA 1SNPA 1EZ6A 1PTOB 1SJHD 4OIKA 2NN6H 3GTJH 5I4DA 1Q46A 2H4OA 4ZYSA 4B3TQ 1QUQB 3GTMH 1GXDC 2BH2A 1SE2A 2QEJC 3A8IE 5JVH3 5LL6S 3CC2A 1JC7A 3H91A 2N78A 3PO2H 3NQIA 2Z0SA 2F0SA 5I9PA 2Q2TA 4A3JG 1EIYB 5ISRA 2XRQD 1Z9FA 4KY7A 1VQPA 1GKHA 2LS01 1TWFB 5FLMG 4X6AH 3DHQA 1FNWA 3MEHA 3NBIA 4LMQD 3DUZA 5JAVA 5F2DA 1NR2A 1I3QH 4A3DG 3NSWA 5FLXc 2QEXA 4KKTA 4DR5Q 1XJVA 2PCFB 1IXRA 1JOOA 1CK1A 3TBIB 2CFMA 5C3EH 3E6ZX 1STNA 4YWMA 1AH9A 2ATWA 4K5WA 4QB4A 5M3FB 3CQZH 1S5BD 4K5VA 1U0LA 3PUYA 5E4WC 2EYOA 4DU9A 2EXDA 1F77A 3GD7A 4LAAA 1JT8A 4DR2L 1SR3A 2EYHA 4YCUA 3S17B 2F0KA 5IWAL 4HJ8A 1VQKA 3VR6A 5LMNW 1WTRA 2F0PA 2Q8IB 3JAME 3SK4A 4MNOA 2RSNA 2NVYB 3A7AB 4K8IA 4XT3B 3WOFA 5M5XH 4YCVA 3GTQH 3PO3B 1D2BA 2EZVA 5KNDA 4LFBL 4DV3L 4Y7NH 1E24A 1YBYA 1XTCD 2DN8A 1WVLA 4IFDG 2ZXRA 1STHA 1XMQL 3A74A 4HN7A 3S2DB 1Y8NB 1GD7A 2IWHA 1JCKB 3EN2A 1S5CD 5IP9H 3BZKA 1TWAH 1VQDA 4DXGA 1HTLD 2JA8G 1Q12A 3R2TA 1W6KA 4QUFA 4CKBA 1VQ7A 4KHVA 5IYDG 3UE1A 2MQHA 1EU4A 4HJ9A 2IX3A 4A93G 2MUYA 1IZ6A 4FF1A 1LACA 1YIJA 5CV6A 3RLFA 3PUWA 1S4ZA 3K59A 4BBRH 2I5LX 1L0XB 5C0XJ 1EIFA 3GTKB 3KF8A 3MXUA 3KOJA 3S24A 4RGTA 5DNFA 2PZWA 3RZDH 1Y8PB 2F0OA 1BQQT 3T53B 2Q2HA 4IZ8A 4FNFA 4A3IH 2IW3A 4JI0Q 4XIGS 3ND9A 4OGQC 4BBSB 1K8MA 5A2QE 1KXLA 1LV9A 4DR2Q 3GO5A 4JI4L 4XQJA 1YNJD 2R7FA 4A4IA 1K0SA 3FKIG 3CCMA 2UUBL 1ZYRC 5EJWA 1VCIA 2CWPA 1Q82C 4JW0A 4DK1A 3GTOB 1UAPA 1MHWC 1ENAA 2NZOA 3H15A 3F8TA 3HOZH 3J80E 4MTNA 4LFBQ 4DV3Q 2PZTA 3TP5A 4QIWE 4ABNA 3HKZE 2B29A 4EGVA 1NSNS 3K5OA 1MBYA 4GKJL 1VQ9A 3HFZB 1HFNA 4ZKCB 4IQZA 1DJRD 5C4ZA 1RCVD 1EEFD 2IPKD 1TIID 4DV7L 1X56A 4RMFA 4CKCA 4EVOA 4PZ8A 3HOWB 1X3PA 1J9OA 4HSPA 1O7ZA 5E7NA 1B53A 4A3FB 1VQFA 3OIQA 4BY7G 5KGUA 4X65Q 2KENA 4IUTA 2UUCL 1NTGA 3RN5A 4A3BG 3NPPA 2QILA 3K81C 1BDOA 1FGBD 1VQCA 4HIMA 2BE5D 1QVGA 3QJYA 1X55A 4NXNQ 4LFAL 5LMUQ 1R9TH 1UE1A 1EY5A 3ERSX 5LHY1 2OWOA 2AWOA 3P20A 1V1QA 2CKZB 2CQOA 4KKSA 4RCOA 4X3KA 1AP0A 3S1RB 4PMBA 1VQIA 4P74A 3Q8DA 4JI4Q 2HIXA 3S2HB 3A5ZB 4DR4Q 5CV4A 1QOHA 4A3LH 2R92B 1OXUA 1A0IA 2FINB 3N52A 4CJ0B 1JICA 2LSSA 4DUYL 2LMCB 1IKMA 4AYBE 1Q8KA 3GTGH 5ELNA 2YYZA 1SLJA 3OYYA 3F2DA 5E4XA 1G2TA 4X66Q 2HD3A 1MIUA 1KLGD 2H1EA 2K7VA 4IUNA 1QZGA 4GKJQ 2R93H 2X69A 1BOSA 4HIOA 4KN7C 3S14H 4O0AA 3AFQA 3RMHA 3AQQA 1TS4A 4ME5A 2ZM6L 3MXGA 2F0MA 4X62L 4HSVA 3S1NB 2Z9HA 5EBDA 4DV7Q 4Y52H 1I4PA 4QQBX 4H0LC 1OTCA 2CW0D 2VB2X 1SYFA 5FK9C 3SE0A 4DV1L 2YTVA 3L0OA 4DFAA 4GNXB 3HOXH 3C3LA 1K8OA 2LXJA 3HOYH 1RDPD 2PI2E 5EGTA 2VQEL 4OL7A 5BN4A 1M4VA 4LJZC 4PZ7A 4DR3Q 4BA2I 2UUCQ 4G7HC 2IX1A 1F2LA 4C3HH 1BCPC 4CJ1B 2ZT9C 5ELDA 2O5IC 1IYUA 4C56C 5C0XG 5KYIA 4GOPA 3C1EA 3M3YB 1G91A 2I5HA 5CV8A 4R4OA 4A75A 2O2LD 1HFGA 3OHXC 4JV5L 1XXGA 4DV0L 4Q5VA 3KDFA 3I4NB 2MFIA 1S72A 4J8QA 1PA6A 1EY8A 2XWBB 3SXHA 1E0BA 3BVMA 2JA5G 2I0QA 2JJQA 4UY8C 4DUYQ 1G291 1F2YA 2M9VA 3NXWA 1EY4A 1WD0A 4F7XA 1V9PA 2QDBA 1V43A 3H3VI 1CKOA 2F0HA 1ONLA 4ODGA 1L1OC 3SDZA 3CW2C 3AFPA 3CCLA 1CQFA 4GKKL 2EPBA 4OO1H 1JWSD 3NELA 4BXXH 3JAMi 4X3TA 3MVVA 1B8AA 4OX9L 3J7YW 2ENBA 1DD2A 2B2YC 1RTOA 3I2ZA 1GVPA 1UWVA 4TSSA 4X62Q 3O13A 2DNEA 4DK3C 2NVXH 3JAML 4DV1Q 1PH7A 1AE2A 1SNDA 3E0EA 2QKIC 4MIUA 4XTCS 3EBEA 3OTOQ 1HZCA 5IP7H 3L2PA 4LNQA 1KD1C 3M4OH 5FO8B 2FHTA 5COYA 4C1NI 1A63A 1QZHA 4IUPA 2SNSA 1V1PB 3QB3A 1BBUA 5M5WH 2M00A 2B63G 1ILQA 1ZXTA 4NXML 3TZUA 5GAGC 1N33Q 2QF7A 1LYLA 5JEAJ 4JV5Q 2F0VA 5IGFA 2CWAA 2ICIA 3FPPA 5ELEA 4CDFC 2UXBQ 1Q86C 4MTKA 2HHHL 4V0BA 2I07B 4JI2L 5IYBG 4ZUIA 1F2MA 1QG7A 1H9SA 1S5FD 5M3FG 3G6EA 1HJPA 1LO5D 3DWQA 2XVSA 3R3OA 2E2IH 3NTKA 4QIWB 4DKAC 1KAWA 1GUNA 2AQ2B 3HKZB 5IGCA 1PTOD 5JJIA 2NWGA 4GKKQ 2IL8A 4LWCA 2RDHA 2K33A 4BWGB 5A2QL 4LF7L 2PNHA 4A3BB 2MHVA 1B44D 5GQOA 3J80i 3PO3G 2A6HC 1CKNB 1PH5A 4UHVA 3CHBD 3FVQA 3A0JA 3ITPA 2D0PA 4J15A 1DONA 2N8NA 2NVTB 4M1UB 3NWTA 3VR3A 2MGSA 1T5XD 2F0JA 4R4TA 3UDXA 2FFKB 3J80L 1LTGD 2D2CC 1FL0A 2Z6BA 4NB3A 4IURA 4JK1C 2L9HA 1SNCA 2F0UA 1TWHB 2OQ0A 3E5SA 1O7YA 2VW9A 3MFYA 4BBRB 2PQAA 2F1MA 4DNIA 2K5NA 4NXMQ 2ZJPA 5ELBA 2JA9A 1YHAA 3RZDB 4NP5A 3HOVH 1PMRA 3BZCA 3OSOA 4XQNA 4A3IB 4K5XA 2IJ0A 4JYAL 4GLAC 2NTTA 3KLSA 1E3PA 1CFMA 1SNMA 2PQEA 2HHHQ 3E3XA 1EQRA 4JI2Q 3EROA 3HOUB 3IFTA 4AYBB 3CPWA 1WTXA 2WIIB 2AUKA 4M8AA 1E2ZA 1X3EA 1E7ZA 3H0GG 3HKSA 1PRTC 2WB1E 1R4QB 1ESFA 3H6MA 2HDMA 2A69C 3VA5A 1JOQA 3TS2A 3A56A 2Z4IA 3T51B 3D3RA 1K28A 2IHFA 5CBEE 3U58A 1BF4A 2R7ZG 3M7NA 2BA1A 2EVBA 3HG9A 1S5DD 4DR1L 1QE6A 1LTLA 3NTHA 5CV9A 2WACA 1CM9A 2WB1G 2B39A 4ZUJA 4A3JH 5IIFA 2UU9L 4CHTB 2A19A 1FD7D 5D65A 5JJZA 4JI5L 1DOLA 3J81E 1H95A 2G5DA 2EY6A 4UAIA 1N9WA 4JI8Q 2NYZD 5JPNC 1LLRD 4A3DH 2JK8A 2F0EA 1K83B 1Z47A 2B8GA 3SK5A 3HOWG 4EQ5A 2L11A 4I7AA 2C5CA 2JA7H 4KI0A 5M3MG 3HGBA 4JI1Q 3OW2A 3BS1A 1PV4A 5JEAG 1R9TB 3CP0A 4A3CG 1QNKA 4KJOA 2K5WA 3CC7A 1GUOA 5IE8A 1JJCB 4JYAQ 4A3MG 1HXYD 2YV5A 1IL2A 4BY1G 1C4QA 1NNXA 2A8VA 2EIFA 3I73A 2EY2A 3BDLA 4HR7B 3D4RA 1FNVA 1SEBD 4FVMA 4EX5A 4KHPL 3GTGB 1FR3A 5L37A 4GLVB 4IJHA 2HQLA 2VXWA 2DY7A 1O80A 2ZXPA 1SMYD 4DR7L 4L5TA 3CMAA 4CGYB 1SFOH 2K05A 2R92G 1D5MC 1GUGA 1VF5C 4DV6L 1VQEA 4KY5A 2E8GA 1SYCA 1XPUA 3M85A 1BCPF 4LUVA 3CRKC 2A74C 4L6TB 3S14B 2UU9Q 2BDNA 2C9OA 2Z4HA 3I7FA 2ES2A 4JI5Q 2B63B 2F3VA 2B2UA 4H44C 4F87A 4A93H 3HOXB 1FVIA 1Z6HA 1VQAA 5M9OA 1ZEQX 3S16H 4GS3A 1NJIC 3BYTB 3KF6A 5KNBA 5JVG3 1NAPA 1ESRA 4DA2A 4QL5A 1WOCA 1OXSC 1K0RA 4A3KH 3OWEB 1PH8A 5CYUA 5FJ8G 1CSPA 1YNND 3FKIH 1L2FA 3S1MB 2NVQB 1QNUA 3VR5A 5FO9B 2F4VQ 4FXGC 1AZPA 3NK9A 1MGSA 1JORA 5HY6A 3GDEA 2RDGA 1M8AA 4B3ML 4FF4A 5JOBA 1FGUA 4JI7L 4KHPQ 2TMPA 4DAPA 5IY0A 4FO2A 3EIVA 1U9RA 1HNXL 1FJGL 3I4NG 1HH2P 4QMGA 3K5NA 3TS0A 1X9NA 1M90C 4DR7Q 2FMMA 2Z6KA 3CCUA 3U9OA 3KK7A 1SE3A 4DV6Q 3EA6A 4L63B 1NE3A 1F2ZA 1SNQA 4K0KL 1W3SA 1RF2D 5AFWA 1JE5A 2DGYA 4DAVA 1HR0L 2A68D 3MXPA 1AW7A 4LFCL 1E1OA 1EY7A 4A3EG 1X32A 1SDFA 4ZLTF 4JOIC 1PH9A 1A3TA 1VQHA 3U9SA 3T56B 2NN6G 4POFA 3R2IA 3TEHB 3TP6A 4RGNA 1HNWL 2TSSA 2HDLA 3HP3A 2F0NA 4JBKA 3CCVA 1G2SA 4LF4L 1EIHA 2KEEA 4LF8L 3P75A 1P8LA 1WCMB 4HCSA 2BOSA 2VQFL 5M5WB 1C7YA 2RHSB 1A3UA 2KA7A 3DWAA 2A6ED 3H0GB 4N9PA 1LUZA 2XTIA 2QGQA 1RJTA 1PFBA 2EYFA 1HZBA 4C3JB 3BG3A 5IWAQ 5C0XI 1D8LA 2R7ZB 5FKAC 1YVCA 4Z9CB 4DGZA 5D3IB 3P1HA 2B3GA 4RKBA 3K7AH 2RKSA 2WAQE 3GP7A 1PH6A 1KAAA 4HMJA 5KRUA 4ZAIA 2WB1B 2C35B 2ASBA 1U4RA 2VY3A 4C3IH 2RF4A 2NZHA 1HNXQ 1LTAD 4P73A 4CBVA 4IALA 4B08A 1FJGQ 1LTTD 1RL2A 1B7YB 2DY8A 4JCVE 1VQMA 1MSGA 1BBWA 4NPSA 2WAQG 1EYGA 1SSOA 1XMQQ 3STBD 3G4SA 3W5OA 2E2JB 4XT1B 1XPOA 1Y1WB 1D1KA 4PMWA 2JA6B 4GZYC 4K0KQ 4IJLA 1C9OA 4YWKA 1NCVA 1TT2A 3NUCA 5M5YB 1A3VA 4GNXA 4LFCQ 3HKZG 1LT4D 4DAYB 5M3MB 1BVSA 3CRLC 2CH4W 5EPJA 2I46A 2M2LA 3VYSA 1NMFA 4LUOA 1HNWQ 1IL8A 2KBNA 3KJOA 4A3MB 1U4LA 3BYYB 1BCPB 5C4JH 3F2BA 4PZ6A 2XNAC 3J81i 5IP9G 4BY1B 4LF4Q 4FDBA 1ASYA 4LF8Q 1QILA 4UDUC 3J7ZC 1VQLA 1SROA 4POGA 3SHLA 2VQFQ 2B2UC 1VF7A 4RFBA 2EE1A 1VQ4A 4P72A 4C2MB 1IBML 2VUMH 2L15A 3J81L 1UEAB 2FMCA 5BR8L 2JA5H 2UUBQ 5CR3A 4UP7A 3S1QB 4BBRG 1KIXA 3TREA 3R93A 3KF8B 3P7JA 5HGTA 2K5DA 1TKWB 4XYQA 4U673 4QUCA 2GN5A 2OEOA 1EIGA 1SE8A 3MXNA 1CHPD 4A3IG 3I72A 3HEJA 2WP8J 3I8ZA 4KJNA 1L1OB 4N9TA 2YTXA 2BH8A 3QG1A 3NEMA 2JEBI 3KBXA 4RGOS 5AJ3L 1Y1VH 1LT3D 3AEVA 3HOUG 1PH2A 4A3GH 4KMUC 4AYBG 2ZJQA 3L7ZC 2B8FA 2KHJA 5I2XA 4G7ZC 1DGSA 3MWYW 1M1KC 5DEHA 1F9QA 1OXXK 3CCJA 5C44H 3ULPA 2GVBA 4OIJA 1STBA 1PTOH 5FLXE 3G48A 3C1FA 3DM3A 3KYHC 5IYCH 2ZTCA 3J7AV 1H9RA 2KHSA 3BZDB 4IUQA 5C4XH 3K58A 1MI2A 3CPFA 5I6YA 3K0XA 4UP8A 4ID6A 2RSOA 1V1PA 5J22A 1L0YB 3NQTA 1KDBA 1EYCA 4PG3A 5IT9c 4C1NK 3FEWX 5K36H 3KFUA 4LFAQ 1LT6D 1D6EC 3PMFA 4RHSA 3M4PA 3S15B 1A15A 1LM0A 2JA7B 1HHVA 1EQVA 4KD3A 3KBGA 2B2VA 3CAMA 3OW7A 4YHHL 4KTAA 2J0TD 1J5EL 2PO4A 1ILPA 1EWHA 1LTRD 1VS0A 1IBMQ 2Q2IA 3CCSA 5BR8Q 4DPGA 2KHIA 1TWGB 3MFGA 4N8FA 4R9WA 5J39A 4JG2A 2YU9H 1DZ1A 4JI3L 2E76C 4WJ4A 1VMCA 3FRPB 3S17H 2AUJD 2D0OA 3D31A 4HEDA 2CH4A 4IPGA 4A3EB 3K7UC 1WD1A 1EEID 1VQGA 3BU2A 5EKKA 3C46A 1EU3A 4ALPA 3IL8A 3GTJB 2NVYH 4O2DA 2A5HA 2Q8TA 3GTMB 4L5RC 3PO3H 1EUJA 1ASZA 2V4DA 2ZM6Q 1W2BA 2RA4A 1CKNA 2QCPX 1DOMA 2Y0SE 4CDDC 1CHQD 1G8ZD 4DAMA 4HIDA 1PXUA 2BA0A
chains in the Genus database with same CATH topology
3PO2B 4MHEA 2ZXOA 2K32A 1D5XC 1VDZA 4TQUS 2OXPA 3PUVA 3D4WA 1HQRD 2EJFC 4X3SA 3K0YA 4BS9A 1EFID 1LT5D 3EFXD 4FYDA 2NUCA 5KIXA 2PPBC 1I3QB 1E2VA 3Q24A 1LABA 4TKOB 1TS2A 5C3EB 4KV6A 3FDTA 1ET6A 1JR0D 2IX0A 3SVMA 5EPLA 3CQZB 3VR2A 4A3KB 2ID0A 2EYLA 4C3HG 4XYOA 4NDXA 3T13A 1XYIA 3SEBA 2WAQB 4HCEA 1OO9B 2X6GA 1PYWD 3OPOA 3NBHA 2F4IA 1KDCA 4IUUA 4HAEA 5M5XB 3GTQB 1PRTB 1X3QA 4ILWA 3WOEA 1ENCA 1RTNA 4KY6A 1YNJC 2PZUA 4FXDA 5CMDA 4Y7NB 3SK6A 5T1IA 1IW7D 2JYOA 3T4AC 1D5ZC 3RUZA 3AMUA 4DK0A 4LK1C 3EVQA 1TWAB 4I65A 1IYVA 2JP1A 4WRDA 1V1OA 2D9UA 3H94A 3W2DA 2R3ZA 4OO1G 3LWUA 3J7AF 2J4XA 3AB9A 3K6OA 1NR4A 2KUMA 3DXJC 4QF4A 1KNEA 2EY5A 4EQOA 4RA8A 1W6JA 1WTPA 1AEXA 4DNTB 5HURA 3HZXA 3I3CA 3HS0C 4WJWA 3Q0AA 2B2WA 1HQMC 2BE5C 1ZYRD 3M4YA 1IHZA 3V96A 5BN3A 3BVZA 3K7AB 4B9WA 2Z1CA 3LX0A 5DAUA 2RBMA 3HOZB 3MHBA 4C3JG 5I9OA 2F0QA 1NUCA 4O42A 5C5LA 4G4KA 2RQXA 3Q23A 4KD4A 1H9SB 5A35A 1PZJD 4HTHA 5G3LF 3FMCA 3H09A 1WTVA 2AQ1B 1ZKOA 5KYLA 3NE5B 5DM73 1C48A 1I4HA 4IFDI 3A8JE 5KNCA 2K6AA 1O7LA 3D6CA 1LTID 4IN3A 1TY0A 3GQBA 2CW0C 4QCLA 1BUVT 4FXKC 4KN4C 2L1BA 5T1GA 2PW7A 2SNMA 5EQ0A 5FLXL 1CT1D 4L8JA 2VUMB 1Q8IA 1DM0B 5C3WA 3I91A 4WORA 2NB0A 1RHPA 1HTPA 1U4MA 1KTKA 4RCNA 3VYUA 1XWEA 2F0GA 3Q22A 2XRSD 1IKLA 1KDAA 4IFDH 1CQVA 2EDGA 5E1FA 5IGGA 2D62A 2K1BA 2R93B 3PIO3 1JB3A 1Y1VB 5E3FA 1Q3LA 2Y0SB 2L5TA 1STEA 2K04A 5C44B 3KUPA 3S9WA 1CI3M 1GJXA 2PYKA 4JBWA 1LTBD 2WKCA 1H9JA 5BN5A 1I6VC 3CKIB 3HOYB 4OHJA 2E2DC 1BCPD 5C4XB 1A6XA 1GUSA 4C3HB 2K28A 1OXVA 1MSHA 4K14A 2FJ2A 1QB5D 2HUGA 1H9MA 1UUPA 1DXMA 2E75C 3TSSA 3N6RA 4I7ZC 2AQ3B 2XIWA 4CJ2C 2F0WA 4R8IA 3G7LA 5EPKA 1STAA 5C4HA 2IT1A 4TRDA 3K57A 2B2TA 4RGMA 3M7GA 3K5LA 2YU9B 1A2UA 4PMCA 1ET9A 3HRZC 2LKVA 2DNCA 1CTMA 1EY9A 1F9SA 4KKUA 3X3MA 3QO2A 2B2WC 3L3OC 1H9KA 1TR5A 1A2TA 2G9DA 3PIP3 1RKNA 2BDOA 4XXEA 4DAYA 2VNUD 2CVRA 1ENFA 1PTOC 2NVXB 2PNRC 3K5MA 4H13C 2Z8LA 1JWUD 1IW7C 3EJIA 1B3AA 2EOTA 4DXFA 1Y69U 5DM63 1KNAA 1Y8OB 2F0FA 3M4OB 3IKJA 1SBBB 3F2UA 3V2TA 2F0IA 3GV3A 5KEEA 3KLSX 2OF1A 4ULLA 2L4NA 1XX8A 1GHJA 4G57A 5EKIA 1HPCA 4J1MA 2G9HD 1CZWA 3DMUA 4ZQ3A 1DCZA 3ONAB 1JWMD 1HCZA 1EZ8A 3I4MB 2NBFA 1G6ZA 2JSOA 2D5DA 2SDFA 4WFN3 1QWYA 1TU2B 2E2IB 3QIAA 1DYQA 1RD9D 3IFDA 1I4RA 2WKDA 1AZQA 2B2YA 1JQYD 3SR1A 2E2HB 2A6HD 4YIJA 2SEBD 3X3NA 4NKLA 4O1NA 1C8CA 2HQEA 1UNSA 4ZKBB 3L9AX 5C0XH 2O5JC 4HMIA 2XN9C 3C2PA 3OOCA 4KHZA 1PLFA 2PMZB 2ICEC 5IGBA 1V8QA 3AU7A 3CU7A 3H3VC 3MAQA 2PW5A 3URYA 5I2YA 1T5EA 1PRTF 2KEDA 3GV6A 4B9XA 2F03A 3HOVB 4BA1I 1Z7TA 1B1ZA 5IGDA 2KCCA 5IT9L 3NWSA 2R61A 3DM1A 2NTSA 1SE4A 1SXTA 2F0DA 3VYTA 5CC4A 5K5PA 1HUNA 4J6HA 3RD4A 2F0TA 3ND8A 5D14A 1BNZA 4F8MA 2JXMB 1PRTD 3KLRA 1PFMA 3QOLA 4XDXA 2XWJB 2A69D 4PV1C 1SNOA 3ERQA 2BCOA 4ZRZA 5CBAE 3ZYYX 1R4PB 1PZID 1GUWA 1EOTA 2B2TC 2RVLA 1KABA 4A3JB 3NTIA 1PZKD 4C3IG 1OXTA 1SMYC 2SOBA 1EQTA 2WINB 2EYMA 1F9PA 1ICWA 4RWSC 4A3DB 3TP7A 1HUMA 1GUTA 1B9MA 1SYGA 1B2TA 5ELCA 3LWEA 2LY7A 1WTWA 4OO1I 2L12A 3D6WA 3PV0A 1BBXC 4MN3A 5C5MA 4P2CB 1I6HB 2N88A 5CV7A 3TN2A 1VMPA 4PNYA 2XSCA 3PUZA 1HA6A 3A7LA 3G6JB 1Q90A 3WDNA 3R8BA 2EJGC 3A55A 4FF3A 2KVMA 1YNNC 4NW2A 2CHBD 2O4XA 2R6GA 4EQNA 1I4QA 1CZGA 1SFOB 2N55A 3GTLB 1FYCA 4DNRB 5IOCA 1CA5A 1HA5A 2F3WA 1GOZA 2JA8B 5CV5A 3VYRA 5IGEA 4K6DA 1SAPA 2L55A 4NMZA 1I4XA 3OIPA 1QJOA 4A93B 3RZOB 1I4GA 1EY0A 3OWFA 4R8NA 1PFNA 3BDCA 3S16B 2K01A 3W3AA 2A68C 3GTPB 5C6AA 2MPMA 1TQOA 5TSSA 3PUXA 2EYPA 3A54A 2L0CA 3NHHA 2Q8RE 1QCBD 1PDQA 2K03A 4KK7A 3FKIB 3LNNA 3MC0B 3VA7A 3I90A 3VR4A 1TS5A 5D3DA 4K8JA 4RHRA 2KJXA 4K2KA 3OMCA 5K36G 1I50B 2MJ8A 5CGKA 2A6EC 5FO7B 1BO0A 1PTOF 3FPUB 1STYA 1GHKA 4H7BA 3D4DA 1RODA 1HRJA 1TY2A 1JE4A 2VB3X 2F0LA 1SYDA 3DEOA 1AN8A 5J1ZA 2HCIA 3BDOA 1ML0D 4BY7B 2GA4B 3MA2B 4EQPA 1B4OA 1EYDA 1TWCB 4XQQA 1E2WA 4X3UA 2E74C 2KQ3A 3DEPA 5JEAH 3I4LA 4PQXA 1MD2D 1Q1EA 5C3XA 1SYBA 2EYJA 1S5ED 1U4PA 5ELFA 4G7OC 5FOBB 4E6IA 1AFPA 3TP8A 1TS3A 5JPMC 2EY1A 3MTSA 4DF7A 1EY6A 1JOKA 2B2VC 3D8GA 1KLUD 1BR9A 2K5QA 3OMGA 1O78A 4C3IB 1LTSD 3BVGA 2HCCA 4K6LA 4F88A 4RAUC 1J8IA 4FF2A 3NP8A 1EWCA 5LL6X 2CQAA 3UI2A 3TZDA 3V05A 2AWNA 1B9NA 1WTQA 4S3SA 3MZ5A 3A8KE 1FNUA 2J7ZA 3I70A 5IT9E 4V190 1EYAA 1II3A 4IFDJ 1TVXA 4IUVA 2JEAI 5EKLA 2MP1A 4CKEA 4U68A 1D1IA 4DN4M 5G3LD 5EBCA 5C4JB 4RKLA 5CORA 2X6LA 1DOKA 2NN6I 4K2LA 3TDQA 1Q1BA 4RH6A 5NUCA 2OT2A 1SJED 1CA6A 2KOLA 2JA5B 1STGA 2EJMA 2LFNA 2KCNA 2NZ1D 3T16A 5IODA 3TMEA 2WV6D 1F9RA 4Q0FA 1SYEA 1EL0A 2KECA 3SK8A 1B50A 3E0JA 2EXZA 2JE6I 3QWNA 4FP5D 3IAYA 4ZK9B 1WTOA 3DWPA 3Q6SA 2RDFA 3EQLC 4A3GB 5I6WA 1BXTA 2A73B 3QOJA 1SNPA 1EZ6A 1PTOB 1SJHD 4OIKA 2NN6H 5I4DA 2H4OA 4ZYSA 1GXDC 1SE2A 2QEJC 3A8IE 5JVH3 5LL6S 1JC7A 3H91A 3NQIA 2F0SA 5I9PA 5ISRA 2XRQD 4KY7A 2LS01 1TWFB 3DHQA 1FNWA 3MEHA 3NBIA 4LMQD 3DUZA 5JAVA 5F2DA 1NR2A 3NSWA 4KKTA 2PCFB 1JOOA 1CK1A 3TBIB 3E6ZX 1STNA 4K5WA 4QB4A 5M3FB 4K5VA 1S5BD 3PUYA 5E4WC 2EYOA 4DU9A 1F77A 3GD7A 4LAAA 2EYHA 3S17B 2F0KA 3VR6A 1WTRA 2F0PA 2Q8IB 3JAME 3SK4A 2RSNA 2NVYB 3A7AB 4K8IA 4XT3B 3WOFA 3PO3B 1D2BA 2EZVA 5KNDA 1XTCD 2DN8A 1WVLA 4IFDG 2ZXRA 1STHA 4HN7A 3S2DB 1Y8NB 2IWHA 1JCKB 1S5CD 4DXGA 1HTLD 1Q12A 3R2TA 1W6KA 4QUFA 4CKBA 4KHVA 1EU4A 2IX3A 2MUYA 4FF1A 1LACA 5CV6A 3RLFA 3PUWA 1S4ZA 3K59A 5C0XJ 1L0XB 3GTKB 3KF8A 3MXUA 4RGTA 5DNFA 2PZWA 1Y8PB 2F0OA 1BQQT 3T53B 4IZ8A 4FNFA 2IW3A 4XIGS 3ND9A 4OGQC 4BBSB 1K8MA 5A2QE 1LV9A 3GO5A 4XQJA 1YNJD 1ZYRC 5EJWA 1VCIA 4DK1A 3GTOB 1UAPA 1ENAA 3J80E 2PZTA 3TP5A 4ABNA 4EGVA 1NSNS 3K5OA 1MBYA 1HFNA 4ZKCB 4IQZA 1DJRD 5C4ZA 1RCVD 1EEFD 2IPKD 1TIID 4CKCA 4EVOA 3HOWB 1X3PA 1J9OA 4HSPA 1O7ZA 1B53A 4A3FB 3OIQA 5KGUA 4IUTA 3NPPA 2QILA 1BDOA 1FGBD 2BE5D 3QJYA 1EY5A 5LHY1 2AWOA 3P20A 4KKSA 4RCOA 4X3KA 1AP0A 3S1RB 4PMBA 3S2HB 5CV4A 1QOHA 2R92B 1OXUA 2FINB 3N52A 4CJ0B 1JICA 2LMCB 1IKMA 2YYZA 5E4XA 1G2TA 1KLGD 2H1EA 2K7VA 4IUNA 2X69A 1BOSA 4KN7C 3RMHA 1TS4A 4ME5A 3MXGA 2F0MA 4HSVA 3S1NB 5EBDA 1I4PA 4H0LC 2CW0D 2VB2X 1SYFA 5FK9C 3SE0A 4DFAA 1K8OA 3C3LA 1RDPD 5EGTA 4OL7A 5BN4A 1M4VA 4LJZC 4BA2I 4G7HC 2IX1A 1F2LA 1BCPC 4CJ1B 2ZT9C 5ELDA 2O5IC 1IYUA 4C56C 5C0XG 5KYIA 3C1EA 3M3YB 1G91A 5CV8A 2O2LD 1HFGA 3OHXC 1XXGA 4Q5VA 3I4NB 4J8QA 1EY8A 2XWBB 3SXHA 1E0BA 3BVMA 1G291 1F2YA 2M9VA 3NXWA 1EY4A 1WD0A 4F7XA 2QDBA 1V43A 2F0HA 1ONLA 4ODGA 3SDZA 1CQFA 2EPBA 4OO1H 1JWSD 4X3TA 3MVVA 3J7YW 2ENBA 1DD2A 2B2YC 1RTOA 4TSSA 3O13A 2DNEA 3JAML 1SNDA 2QKIC 4MIUA 4XTCS 5FO8B 2FHTA 5COYA 4C1NI 4IUPA 2SNSA 1V1PB 3QB3A 2M00A 1ILQA 1ZXTA 3TZUA 2QF7A 5JEAJ 2F0VA 5IGFA 2ICIA 3FPPA 5ELEA 4V0BA 2I07B 4ZUIA 1F2MA 1QG7A 1H9SA 1S5FD 1LO5D 3DWQA 2XVSA 3R3OA 3NTKA 4QIWB 1GUNA 2AQ2B 3HKZB 5IGCA 1PTOD 2NWGA 2IL8A 2RDHA 2K33A 4BWGB 5A2QL 4A3BB 2MHVA 1B44D 2A6HC 3CHBD 3FVQA 3ITPA 1DONA 2NVTB 4M1UB 3NWTA 3VR3A 2MGSA 1T5XD 2F0JA 2FFKB 3J80L 1LTGD 2D2CC 4IURA 4JK1C 2L9HA 1SNCA 2F0UA 1TWHB 3E5SA 1O7YA 3MFYA 4BBRB 2F1MA 5ELBA 3RZDB 4NP5A 1PMRA 3OSOA 4XQNA 4A3IB 4K5XA 2IJ0A 2NTTA 3KLSA 1CFMA 1SNMA 2PQEA 3EROA 3HOUB 3IFTA 4AYBB 1WTXA 2WIIB 2AUKA 4M8AA 1E2ZA 1ESFA 1PRTC 1R4QB 3H6MA 2HDMA 2A69C 3VA5A 1JOQA 3A56A 2Z4IA 3T51B 3D3RA 5CBEE 1BF4A 3M7NA 2BA1A 2EVBA 3HG9A 1S5DD 1QE6A 3NTHA 5CV9A 2WACA 1CM9A 2B39A 4ZUJA 5IIFA 4CHTB 1FD7D 5D65A 5JJZA 1DOLA 3J81E 2EY6A 4UAIA 2NYZD 5JPNC 1LLRD 2F0EA 1K83B 1Z47A 2B8GA 3SK5A 2L11A 2C5CA 4KI0A 3HGBA 3BS1A 1R9TB 5JEAG 1QNKA 4KJOA 2K5WA 1GUOA 1HXYD 1C4QA 3I73A 2EY2A 3BDLA 4HR7B 3D4RA 1FNVA 1SEBD 4FVMA 3GTGB 1FR3A 2VXWA 2DY7A 1O80A 2ZXPA 1SMYD 4CGYB 2K05A 1D5MC 1GUGA 1VF5C 4KY5A 1SYCA 3M85A 1BCPF 3CRKC 2A74C 4L6TB 3S14B 2BDNA 2C9OA 2Z4HA 2B63B 2F3VA 2B2UA 4H44C 4F87A 3HOXB 1Z6HA 5M9OA 1ZEQX 3BYTB 5KNBA 5JVG3 1NAPA 1ESRA 4DA2A 1OXSC 3OWEB 5CYUA 1YNND 3S1MB 2NVQB 1QNUA 3VR5A 5FO9B 4FXGC 1AZPA 3NK9A 1MGSA 1JORA 2RDGA 1M8AA 4FF4A 5JOBA 2TMPA 4DAPA 4FO2A 1U9RA 4QMGA 3K5NA 2FMMA 3U9OA 3KK7A 1SE3A 3EA6A 4L63B 1F2ZA 1SNQA 1RF2D 5AFWA 4DAVA 2A68D 3MXPA 1AW7A 1EY7A 1X32A 1SDFA 4ZLTF 1A3TA 3U9SA 3T56B 2NN6G 3R2IA 3TP6A 4RGNA 2TSSA 2HDLA 3HP3A 2F0NA 1G2SA 1EIHA 2KEEA 3P75A 1WCMB 4HCSA 2BOSA 5M5WB 1A3UA 2KA7A 3DWAA 2A6ED 3H0GB 4N9PA 1RJTA 1PFBA 2EYFA 4C3JB 3BG3A 5C0XI 2R7ZB 5FKAC 4Z9CB 4DGZA 5D3IB 3P1HA 4RKBA 2RKSA 3GP7A 1KAAA 4HMJA 5KRUA 4ZAIA 2WB1B 1U4RA 1LTAD 4CBVA 4IALA 4B08A 1LTTD 2DY8A 1MSGA 1SSOA 2E2JB 4XT1B 1Y1WB 1D1KA 4PMWA 2JA6B 4GZYC 1NCVA 1TT2A 3NUCA 5M5YB 1A3VA 1LT4D 5M3MB 3CRLC 5EPJA 2I46A 2M2LA 3VYSA 1IL8A 4A3MB 1U4LA 3BYYB 1BCPB 2XNAC 4BY1B 1QILA 4UDUC 3SHLA 2B2UC 1VF7A 4RFBA 2EE1A 4C2MB 3J81L 1UEAB 2FMCA 5CR3A 3S1QB 3R93A 3P7JA 5HGTA 2K5DA 1TKWB 4XYQA 4U673 4QUCA 2OEOA 1EIGA 3MXNA 1CHPD 3I72A 3HEJA 2WP8J 3I8ZA 4KJNA 4N9TA 3QG1A 3KBXA 2JEBI 4RGOS 1LT3D 4KMUC 3L7ZC 2B8FA 5I2XA 4G7ZC 3MWYW 5DEHA 1F9QA 1OXXK 4OIJA 1STBA 1PTOH 5FLXE 3C1FA 3J7AV 1H9RA 2KHSA 3BZDB 4IUQA 3K58A 1MI2A 5I6YA 4ID6A 2RSOA 1V1PA 5J22A 1L0YB 3NQTA 1KDBA 1EYCA 4C1NK 3FEWX 5K36H 1LT6D 1D6EC 3PMFA 4RHSA 3S15B 1A15A 1HHVA 2JA7B 1EQVA 4KD3A 3KBGA 2B2VA 3OW7A 4KTAA 2J0TD 2PO4A 1ILPA 1EWHA 1LTRD 1TWGB 3MFGA 4R9WA 5J39A 1DZ1A 2E76C 1VMCA 3FRPB 2AUJD 3D31A 4HEDA 4A3EB 1WD1A 1EEID 5EKKA 3C46A 1EU3A 3GTJB 3IL8A 2A5HA 2Q8TA 3GTMB 2V4DA 2RA4A 2QCPX 1DOMA 1CHQD 1G8ZD 1PXUA 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTP A;  1EIG A;  4MHE A;  3DEO A;  2B2U A;  5COR A;  5E4W C;  2KVM A;  2HDM A;  3I8Z A;  2HCI A;  2X6L A;  3GV6 A;  1IKL A;  1DOK A;  1ML0 D;  2KED A;  3I3C A;  3KBX A;  4X3S A;  5CBE E;  4NW2 A;  1BF4 A;  1HFN A;  1F2L A;  1RJT A;  1PFB A;  1B3A A;  2B2W A;  4ZKC B;  2EOT A;  2K1B A;  4CJ1 B;  1B4O A;  1KNA A;  1WTR A;  3MWY W;  1QE6 A;  2N55 A;  3DM1 A;  1F9Q A;  1G91 A;  1QG7 A;  2RSN A;  1CM9 A;  1Q3L A;  2KOL A;  1CA6 A;  1CA5 A;  4XT3 B;  1NAP A;  3F2U A;  1ESR A;  4OIJ A;  1HUN A;  4ZAI A;  1X3P A;  2K04 A;  4X3U A;  1J9O A;  5D65 A;  3DEP A;  5JJZ A;  3KUP A;  1U4R A;  2NZ1 D;  1DOL A;  1HFG A;  5D14 A;  3FDT A;  3GV3 A;  1O7Z A;  1BNZ A;  1B53 A;  1F9R A;  3SVM A;  4UAI A;  1EL0 A;  1PFM A;  4XDX A;  2NWG A;  5EPL A;  1SAP A;  2L4N A;  2KEC A;  2IL8 A;  2DY8 A;  4IUQ A;  2NYZ D;  4IUT A;  1WVL A;  1B50 A;  1XX8 A;  1U4P A;  1MSG A;  4ZK9 B;  1WTO A;  1MI2 A;  5EKI A;  1SSO A;  3Q6S A;  5CBA E;  1XYI A;  2RSO A;  4O42 A;  1E0B A;  4XT1 B;  1AZP A;  2K28 A;  1PFN A;  1GUW A;  2K01 A;  1MGS A;  1EOT A;  1MSH A;  2B2T C;  2L11 A;  2RVL A;  1M8A A;  2FJ2 A;  2X6G A;  1NCV A;  1WD0 A;  3ONA B;  3MTS A;  2HUG A;  4IUU A;  1A15 A;  1HHV A;  2MPM A;  1DON A;  4QUF A;  1WTV A;  2B2V C;  4HAE A;  1G6Z A;  1QNK A;  2B2V A;  1X3Q A;  2SDF A;  4X3K A;  1RTN A;  2MGS A;  1ILP A;  1AP0 A;  2EPB A;  4OIK A;  5EPJ A;  5CMD A;  1EQT A;  2FFK B;  2FMM A;  2Q8R E;  1PDQ A;  2XIW A;  4CJ2 C;  2K03 A;  2M2L A;  4X3T A;  4IUR A;  5T1I A;  4R8I A;  3G7L A;  2HCC A;  2L9H A;  3IFD A;  1IL8 A;  4RAU C;  2JYO A;  1F9P A;  1J8I A;  1ICW A;  1RTO A;  1S4Z A;  1U4L A;  2B2Y C;  4RWS C;  2B2Y A;  1AZQ A;  3I90 A;  2FIN B;  5EPK A;  1HUM A;  1O7Y A;  3N52 A;  1JIC A;  4CJ0 B;  1IKM A;  3H91 A;  4R9W A;  3UI2 A;  5AFW A;  5DNF A;  3TZD A;  2B2T A;  1DZ1 A;  1WTQ A;  5T1G A;  2L1B A;  2MJ8 A;  2B2U C;  1B2T A;  5E4X A;  2JP1 A;  1G2T A;  2EE1 A;  2J7Z A;  5EQ0 A;  1VMC A;  3LWE A;  1F9S A;  1X32 A;  1SDF A;  4ZLT F;  1BO0 A;  2D9U A;  2VXW A;  2DY7 A;  1WTW A;  1C8C A;  4HED A;  2R3Z A;  1O80 A;  2H1E A;  1LV9 A;  2L12 A;  2B2W C;  3QO2 A;  3FPU B;  4LMQ D;  3D6W A;  1NR2 A;  1TVX A;  2K05 A;  1WD1 A;  4IUV A;  2X69 A;  1BBX C;  4MN3 A;  5EJW A;  2HDL A;  2MP1 A;  3HP3 A;  3IL8 A;  2N88 A;  2FHT A;  5COY A;  3TN2 A;  4ZKB B;  1VMP A;  4U68 A;  2Q8T A;  1ROD A;  1HA6 A;  4DN4 M;  4IUP A;  1NR4 A;  3R93 A;  1G2S A;  2KUM A;  3I91 A;  3P7J A;  1JE4 A;  2RA4 A;  4HSV A;  1HRJ A;  1EIH A;  1WTX A;  1DOM A;  2KEE A;  1RHP A;  1PLF A;  1ILQ A;  1KNE A;  1U4M A;  2BDN A;  1ZXT A;  4RA8 A;  4HCS A;  4QUC A;  2CVR A; 
#chains in the Genus database with same CATH topology
 3PO2 B;  4MHE A;  5LMN L;  2ZXO A;  4LUZ A;  2K32 A;  1D5X C;  1VDZ A;  2N3S A;  4DR6 L;  4TQU S;  2OXP A;  3PUV A;  3D4W A;  1HQR D;  2EJF C;  4X3S A;  3K0Y A;  4BS9 A;  2VQE Q;  3ICE A;  1EFI D;  3T1H L;  1LT5 D;  3EFX D;  4FYD A;  2NUC A;  4L5S A;  5KIX A;  2PPB C;  1I3Q B;  2ALY B;  1E2V A;  3Q24 A;  1LAB A;  4OWT B;  1MKH A;  4TKO B;  2DJF C;  1N36 L;  1TS2 A;  1G6P A;  2K14 A;  3H3V H;  5C3E B;  4JBM A;  4KV6 A;  3FDT A;  1ET6 A;  1JR0 D;  3HOX G;  1K8G A;  2IX0 A;  3UDI A;  4YHH Q;  4DV0 Q;  1PH1 A;  3SVM A;  5EPL A;  3HOY G;  3CQZ B;  3M4Q A;  3VR2 A;  4A3K B;  2ID0 A;  2P5Z X;  2EYL A;  4C3H G;  4XYO A;  4NDX A;  3T13 A;  1XYI A;  3ULL A;  2UXD L;  1E1T A;  2LXK A;  3SEB A;  2WAQ B;  1X6O A;  4DV2 L;  4HCE A;  1OO9 B;  1N8R C;  2X6G A;  1PYW D;  3I4M H;  3OPO A;  3NBH A;  2F4I A;  3UDF A;  4BBS H;  4JI3 Q;  1KDC A;  4IUU A;  3AYH B;  4HAE A;  1PFS A;  5M5X B;  3GTQ B;  1PRT B;  1X3Q A;  4ILW A;  3WOE A;  1ENC A;  1RTN A;  3PGZ A;  3RNU A;  4KY6 A;  1YNJ C;  2PZU A;  3KDF B;  1XPR A;  4FXD A;  5CMD A;  4Y7N B;  3SK6 A;  3GTO H;  5T1I A;  1IW7 D;  1KRT A;  3SGI A;  2EQS A;  2JYO A;  2FXQ A;  4OX9 Q;  1N34 L;  3T4A C;  2E2H H;  1K73 C;  1D5Z C;  3RUZ A;  3AMU A;  4DK0 A;  1K3B C;  4LK1 C;  3EVQ A;  1TWA B;  4I65 A;  1IYV A;  5LMN Q;  2JP1 A;  4WRD A;  3JAM c;  4DV4 L;  1V1O A;  2D9U A;  3H94 A;  3W2D A;  2R3Z A;  3KLW A;  4OO1 G;  3T1H Q;  4BXX G;  1I94 L;  3RLN A;  3LWU A;  3J7A F;  2J4X A;  3W1G A;  3AB9 A;  4HJ5 A;  3K6O A;  1NR4 A;  2KUM A;  3DXJ C;  5JJK A;  4QF4 A;  1YJ9 A;  4DK6 C;  1KNE A;  2EY5 A;  4EQO A;  4RA8 A;  1W6J A;  1N36 Q;  4A3F H;  1WTP A;  3ER0 A;  3I4O A;  2E5L L;  4R4Q A;  1AEX A;  2I5M X;  4DV5 L;  4DNT B;  5HUR A;  3HZX A;  3I3C A;  3HS0 C;  1VQ5 A;  4QJF A;  4WJW A;  3Q0A A;  2B2W A;  1HQM C;  5IP7 G;  2BE5 C;  1CSQ A;  1ZYR D;  4GOP C;  3M4Y A;  3K80 C;  1IHZ A;  1WCM G;  1YEZ A;  3V96 A;  5BN3 A;  1UEB A;  3BVZ A;  3IRB A;  3K7A B;  3CCR A;  4B9W A;  2Z1C A;  1WTH A;  1XMO L;  4JI6 L;  3S1R H;  3LX0 A;  3KJP A;  5DAU A;  2K52 A;  2RBM A;  3HOZ B;  3MHB A;  4OXP A;  1K9M C;  3RLO A;  2R92 H;  4GN3 B;  1QUQ A;  4C3J G;  4TVA B;  5I9O A;  2F0Q A;  5GAH C;  1NUC A;  1N34 Q;  3E9H A;  4O42 A;  5C5L A;  4LF7 Q;  3M9B A;  2K4K A;  5ELO A;  4G4K A;  2RQX A;  1KRS A;  3Q23 A;  4KD4 A;  2DUD A;  1H9S B;  5A35 A;  1PZJ D;  4HTH A;  5G3L F;  1PYB A;  3FMC A;  5JJL A;  1KC8 C;  3H09 A;  1WTV A;  2AQ1 B;  5FLM H;  1ZKO A;  5KYL A;  3NE5 B;  3U50 C;  5DM7 3;  1C48 A;  1I4H A;  3JC6 6;  3NEN A;  4DV4 Q;  1XNQ L;  3ULJ A;  4B3T L;  4IFD I;  3A8J E;  5KNC A;  3S1N H;  2UXC L;  3J80 c;  2K6A A;  1Y1W G;  1O7L A;  1N32 L;  1JJG A;  3D6C A;  1T9H A;  5GAD C;  2JA6 G;  1LTI D;  4IN3 A;  1TY0 A;  3GQB A;  2CW0 C;  4QCL A;  1KL9 A;  1BUV T;  1WYD A;  4FXK C;  2V1C C;  4KN4 C;  2L1B A;  5T1G A;  4UPA A;  5GRO A;  2PW7 A;  2PMZ E;  1L0W A;  2E5L Q;  2SNM A;  5EQ0 A;  4DV5 Q;  2K75 A;  1S40 A;  1I6H H;  1X3F A;  5FLX L;  2IY5 B;  1CT1 D;  1Q81 C;  4L8J A;  3M3Y H;  2VUM B;  1Q8I A;  1DM0 B;  4UP9 A;  1PH3 A;  1IBK L;  1TXY A;  5C3W A;  3I91 A;  1CKM A;  2VZA A;  2NB0 A;  4WOR A;  1RHP A;  1HTP A;  1U4M A;  2PQA B;  1KTK A;  4HJA A;  4RCN A;  1XMO Q;  4JI6 Q;  3VYU A;  1XWE A;  2F0G A;  1UE5 A;  3Q22 A;  2OTL A;  3HOV G;  2XRS D;  4IPH A;  1IKL A;  1KDA A;  3T1Y L;  4IFD H;  1CQV A;  2EDG A;  5E1F A;  5IGG A;  2D62 A;  2K1B A;  3CME A;  3GTL H;  2R93 B;  3PIO 3;  1JB3 A;  1Y1V B;  4DR1 Q;  5E3F A;  1XNR L;  2JA8 H;  1Q3L A;  2Y0S B;  1B70 B;  4DUZ L;  2L5T A;  4GLX A;  2R7D A;  1STE A;  2K04 A;  5C44 B;  3KUP A;  4AIM A;  3S9W A;  5IYD H;  1CI3 M;  1GJX A;  2PYK A;  3UDG A;  4JBW A;  5EAY A;  1LTB D;  2WKC A;  1H9J A;  5BN5 A;  4LF5 L;  1XNQ Q;  1I6V C;  3RZO H;  4YWL A;  3CKI B;  3HOY B;  4OHJ A;  2E2D C;  2UXC Q;  1BCP D;  1YJW A;  5C4X B;  1N32 Q;  2MNA A;  1A6X A;  1GUS A;  4C3H B;  2K28 A;  1OXV A;  3GTP H;  1MSH A;  4K14 A;  2FJ2 A;  1QB5 D;  4ME3 A;  4X64 L;  2HUG A;  1VQB A;  1H9M A;  1UUP A;  1DXM A;  2E75 C;  3TSS A;  4B3R L;  3N6R A;  4I7Z C;  2AQ3 B;  2VL6 A;  1S3O A;  2XIW A;  4CJ2 C;  2F0W A;  4R8I A;  3G7L A;  1IBL L;  1IBK Q;  5EPK A;  1STA A;  1I50 H;  5C4H A;  2IT1 A;  4TRD A;  3K57 A;  2B2T A;  4RGM A;  2JA7 G;  3M7G A;  3K5L A;  2JN4 A;  2YU9 B;  1A2U A;  4JI0 L;  4PMC A;  4OWW B;  1ET9 A;  3HRZ C;  2LKV A;  2DNC A;  1CTM A;  1EY9 A;  1F9S A;  3ZJY C;  4KKU A;  4MZ9 A;  3X3M A;  3QO2 A;  2B2W C;  3T1Y Q;  3L3O C;  4H02 A;  1H9K A;  1TR5 A;  1A2T A;  1A62 A;  2G9D A;  3PIP 3;  1RKN A;  4JPB W;  2BDO A;  1XNR Q;  1B3Q A;  4XXE A;  4DUZ Q;  4DAY A;  2VNU D;  2CVR A;  4JC0 A;  1IYJ B;  1ENF A;  1PTO C;  2AMC B;  2NVX B;  2PNR C;  3K5M A;  1HZ9 A;  4BY7 H;  4H13 C;  3J81 j;  2Z8L A;  4OWX B;  1JWU D;  4LF5 Q;  1IW7 C;  2WFW A;  1X65 A;  3EJI A;  4GN4 B;  4A3B H;  1B3A A;  4JVZ A;  2EOT A;  4DXF A;  1TWC H;  1Y69 U;  5DM6 3;  1KNA A;  1Y8O B;  2F0F A;  3M4O B;  3IKJ A;  4APV A;  1SBB B;  3F2U A;  2NVT H;  1YJN A;  3V2T A;  3PO2 G;  2F0I A;  4X64 Q;  3GV3 A;  3PCO B;  5KEE A;  3DLL A;  2ZTD A;  3KLS X;  5H1S E;  2OF1 A;  4ULL A;  4X65 L;  4B3R Q;  4R4C A;  2L4N A;  5HGQ A;  2Q2U A;  1Q7Y C;  1TWH H;  1XX8 A;  1GHJ A;  4G57 A;  1ICF B;  5EKI A;  1HPC A;  4R1J A;  4J1M A;  2G9H D;  2OCE A;  1CZW A;  3KF6 B;  1IBL Q;  4L5Q A;  3DMU A;  4ZQ3 A;  1DCZ A;  3U4V A;  4NXN L;  5LMU L;  3ONA B;  4B3M Q;  5C3E G;  1JWM D;  4RG1 A;  1HCZ A;  1EZ8 A;  3I4M B;  2NBF A;  4JI7 Q;  1G6Z A;  3G71 A;  2JSO A;  4A3K G;  1L1O A;  1QVF A;  1EFW A;  2D5D A;  2SDF A;  4WFN 3;  4A76 A;  1QWY A;  1TU2 B;  3PQI A;  2E2I B;  4QY7 A;  3WWV A;  3QIA A;  1DYQ A;  1VQN A;  4DR4 L;  3HOU H;  1RD9 D;  2H5X A;  3IFD A;  1I4R A;  4WJ3 M;  2WKD A;  1AZQ A;  2B2Y A;  4IO9 A;  3PF4 A;  1JQY D;  4LF9 L;  2N49 A;  3SR1 A;  2E2H B;  1VQ6 A;  2A6H D;  4AH6 A;  1HR0 Q;  4YIJ A;  1VQ8 A;  2SEB D;  4X66 L;  3X3N A;  3MEF A;  1MJC A;  4NKL A;  4O1N A;  1C8C A;  2HQE A;  1SN8 A;  1UNS A;  1BKB A;  4ZKB B;  3L9A X;  5C0X H;  2O5J C;  1VQJ A;  3CCE A;  4HMI A;  2XN9 C;  3C2P A;  3OOC A;  2KCM A;  4KHZ A;  1PLF A;  3FHW A;  2PMZ B;  5J3B A;  2ICE C;  5IGB A;  1V8Q A;  3AU7 A;  3CU7 A;  3H3V C;  4N8X 1;  3MAQ A;  2PW5 A;  3URY A;  3E9I A;  5I2Y A;  1T5E A;  1YNX A;  4DR3 L;  1EQQ A;  1PRT F;  1K83 H;  2KED A;  3GV6 A;  4B9X A;  2F03 A;  3HOV B;  4BA1 I;  3QR8 A;  1Z7T A;  1B1Z A;  4CDC C;  5IGD A;  2KCC A;  5IT9 L;  3NWS A;  2R61 A;  3DM1 A;  1PHJ A;  2NTS A;  1SE4 A;  1SXT A;  2F0D A;  3VYT A;  5CC4 A;  5K5P A;  1HUN A;  4J6H A;  3RD4 A;  3CD6 A;  4IOC A;  2F0T A;  3ND8 A;  5D14 A;  1BNZ A;  4F8M A;  2JXM B;  1PRT D;  3KLR A;  1PFM A;  3QOL A;  4XDX A;  2XWJ B;  2A69 D;  4PV1 C;  1SNO A;  3ERQ A;  2BCO A;  2QDL A;  1I5F A;  1UE7 A;  4ZRZ A;  5CBA E;  3ZYY X;  1R4P B;  3F2C A;  2IHE A;  1PZI D;  1YIT A;  4LF9 Q;  3RN2 A;  1GUW A;  1EOT A;  2B2T C;  2RVL A;  3I55 A;  3CCQ A;  1KAB A;  3HOZ G;  4YY3 L;  4A3J B;  1GO3 E;  3NTI A;  1PZK D;  2ZJR A;  4C3I G;  1OXT A;  1SMY C;  2SOB A;  2RCF A;  2Z6K C;  1EQT A;  4LF6 L;  2AKW B;  2WIN B;  4KLK A;  2EYM A;  1F9P A;  5GAE C;  1ICW A;  4RWS C;  4A3D B;  1UE6 A;  2VS1 A;  3TP7 A;  1HUM A;  1NBW A;  1GUT A;  3B6Y A;  1B9M A;  1EOV A;  2B63 H;  1JB7 A;  1TWF H;  1SYG A;  1B2T A;  5ELC A;  3LWE A;  2LY7 A;  1P16 A;  1WTW A;  3OTO L;  2DJG C;  4OO1 I;  2L12 A;  4AQY L;  3D6W A;  3PV0 A;  1BBX C;  4MN3 A;  5C5M A;  4P2C B;  3J81 c;  1I6H B;  2N88 A;  5CV7 A;  3TN2 A;  5IYB H;  1VMP A;  4PNY A;  2XSC A;  4HJ7 A;  3PUZ A;  1HA6 A;  2YTY A;  1WI5 A;  3A7L A;  1WJJ A;  3G6J B;  5M3F H;  1Q90 A;  3WDN A;  1HZA A;  2A1A A;  3R8B A;  1N33 L;  3UE0 A;  1NY4 A;  2EJG C;  1X3G A;  3A55 A;  3VDY A;  4FF3 A;  3S1M H;  2HT1 A;  2NVQ H;  2KVM A;  1YNN C;  1GM5 A;  1NMG A;  2UXB L;  2VUM G;  4NW2 A;  2CHB D;  2O4X A;  2R6G A;  4EQN A;  5AJ3 Q;  1I4Q A;  1CZG A;  4P75 A;  1SFO B;  4A3L G;  2N55 A;  3GTL B;  2MO1 A;  1FYC A;  4DNR B;  5IOC A;  1CA5 A;  1HA5 A;  2F3W A;  1G51 A;  1GOZ A;  2JA8 B;  2XGT A;  5CV5 A;  3VYR A;  4IOA A;  5IGE A;  4YY3 Q;  3MXN B;  1HNZ L;  4K6D A;  1SAP A;  2K5V A;  2L55 A;  4NMZ A;  1I4X A;  3OIP A;  1QJO A;  4LF6 Q;  3S2D H;  1X54 A;  4A93 B;  2F52 A;  3RZO B;  1I4G A;  2R93 G;  1EY0 A;  1Y1V G;  2QW7 A;  4A3G G;  2UUA L;  3OWF A;  1JJ2 A;  2Y0S G;  4IPD A;  4R8N A;  1PFN A;  3BDC A;  3S16 B;  2K01 A;  3W3A A;  5C44 G;  2A68 C;  1JMC A;  3GTP B;  4GNX C;  5C6A A;  1J6Q A;  4OEM B;  2MPM A;  1TQO A;  5IYC G;  5TSS A;  3PUX A;  1J5E Q;  2EYP A;  3A54 A;  2L0C A;  3NHH A;  4AQY Q;  2Q8R E;  1QCB D;  1PDQ A;  2K03 A;  5C4X G;  3TRZ A;  4KK7 A;  3GTK H;  2MO0 A;  1EWI A;  3FKI B;  1WCM H;  3LNN A;  3MC0 B;  3I90 A;  3VA7 A;  1E22 A;  4B3S L;  3VR4 A;  1PVO A;  1TS5 A;  4GOP B;  5D3D A;  2K5H A;  4K8J A;  4RHR A;  3BJU A;  2GVA A;  2KJX A;  4K2K A;  1RIP A;  3OMC A;  5K36 G;  1K3R A;  4IPC A;  4ZCK A;  3H0G H;  1I50 B;  2MJ8 A;  5CGK A;  2A6E C;  4CDE C;  5FO7 B;  3U4Z A;  1BO0 A;  1YHQ A;  4C3J H;  1PTO F;  3FPU B;  2R7Z H;  1STY A;  1YHB A;  1GHK A;  1HR0 W;  4H7B A;  3D4D A;  2RCN A;  1CUK A;  1ROD A;  1HRJ A;  1TY2 A;  1JE4 A;  2VB3 X;  2F0L A;  3PIO A;  1SYD A;  3DEO A;  1AN8 A;  2PI2 A;  5J1Z A;  1XTD A;  1HNZ Q;  4DR6 Q;  2HCI A;  3BDO A;  1ML0 D;  4P71 A;  4BY7 B;  2GA4 B;  3MA2 B;  2E2J H;  4EQP A;  1Y1W H;  2QA4 A;  3STB C;  2JA6 H;  1B4O A;  1O7I A;  4OEL B;  2UUA Q;  5M5Y H;  1EYD A;  3HOW H;  1TWC B;  3CF5 A;  4XQQ A;  5M3M H;  4LW1 A;  2OTJ A;  1E2W A;  4X3U A;  2AHO B;  2E74 C;  2KQ3 A;  3DEP A;  5JEA H;  3I4L A;  4PQX A;  1MD2 D;  1Q1E A;  5C3X A;  4A3C H;  3W1B A;  1SYB A;  1SRU A;  4JI8 L;  1VQO A;  2EYJ A;  4A3M H;  2KCT A;  3RR5 A;  1S5E D;  1U4P A;  4R4I A;  5ELF A;  4BY1 H;  4G7O C;  5FOB B;  4QGU A;  3TQY A;  3PF5 A;  2UXD Q;  4B3S Q;  4E6I A;  1PYS B;  1AFP A;  4DV2 Q;  3LGJ A;  4JI1 L;  1TS3 A;  3TP8 A;  5JPM C;  1Y14 B;  2EY1 A;  3MTS A;  4DF7 A;  1EY6 A;  4C2M H;  1JOK A;  2B2V C;  3D8G A;  1KLU D;  1BR9 A;  3CC4 A;  2K5Q A;  3OMG A;  3S2H H;  1O78 A;  4JBJ A;  4C3I B;  1LTS D;  3BVG A;  3S1Q H;  4OON A;  2HCC A;  4K6L A;  4F88 A;  4RAU C;  1J8I A;  4FF2 A;  3NP8 A;  1EWC A;  3CXC A;  5LL6 X;  2CQA A;  3PIP A;  3UI2 A;  3TZD A;  3V05 A;  2CCZ A;  3I4M G;  2AWN A;  1B9N A;  3NBH B;  4GN5 A;  4S3S A;  1WTQ A;  4BBS G;  3MZ5 A;  3A8K E;  1FNU A;  2J7Z A;  3PSI A;  2OQK A;  3I70 A;  5IT9 E;  4JOI A;  4V19 0;  1EYA A;  1II3 A;  4IFD J;  1TVX A;  4IUV A;  2JEA I;  5EKL A;  1KQS A;  2MP1 A;  4CKE A;  1I94 Q;  4U68 A;  1D1I A;  1SMX A;  2K50 A;  4DN4 M;  1A8V A;  5DLQ E;  5G3L D;  5EBC A;  5C4J B;  1AE3 A;  4RKL A;  3FP9 A;  5COR A;  3J7A 5;  5FJ8 H;  1YZ6 A;  4HIK A;  2X6L A;  1DOK A;  2NN6 I;  1KHI A;  4K2L A;  3TDQ A;  1Q1B A;  1MJE A;  4DR5 L;  1D7Q A;  4RH6 A;  5NUC A;  2OT2 A;  1SJE D;  3S15 H;  1CA6 A;  2KOL A;  2JA5 B;  1STG A;  2EJM A;  3A5U A;  2LFN A;  4A3F G;  1K8A C;  2KCN A;  2NZ1 D;  3T16 A;  5IOD A;  3TME A;  2JQO A;  1PH4 A;  3I4N H;  2WV6 D;  1F9R A;  2ZTE A;  1SYE A;  4Q0F A;  1EL0 A;  2KEC A;  3F1Z A;  3SK8 A;  1B50 A;  3E0J A;  2EXZ A;  2JE6 I;  3QWN A;  4FP5 D;  1U5K A;  3IAY A;  4ZK9 B;  1WTO A;  1TWG H;  2F4V L;  3I56 A;  3DWP A;  3Q6S A;  1YI2 A;  4YCW A;  2HIV A;  1C0A A;  1QVC A;  2RDF A;  3D0F A;  3EQL C;  4A3G B;  2RHQ B;  5I6W A;  3K8A A;  1BXT A;  2F3I A;  2A73 B;  1WFQ A;  4A3E H;  3QOJ A;  1SNP A;  1EZ6 A;  1PTO B;  1SJH D;  4OIK A;  2NN6 H;  3GTJ H;  5I4D A;  1Q46 A;  2H4O A;  4ZYS A;  4B3T Q;  1QUQ B;  3GTM H;  1GXD C;  2BH2 A;  1SE2 A;  2QEJ C;  3A8I E;  5JVH 3;  5LL6 S;  3CC2 A;  1JC7 A;  3H91 A;  2N78 A;  3PO2 H;  3NQI A;  2Z0S A;  2F0S A;  5I9P A;  2Q2T A;  4A3J G;  1EIY B;  5ISR A;  2XRQ D;  1Z9F A;  4KY7 A;  1VQP A;  1GKH A;  2LS0 1;  1TWF B;  5FLM G;  4X6A H;  3DHQ A;  1FNW A;  3MEH A;  3NBI A;  4LMQ D;  3DUZ A;  5JAV A;  5F2D A;  1NR2 A;  1I3Q H;  4A3D G;  3NSW A;  5FLX c;  2QEX A;  4KKT A;  4DR5 Q;  1XJV A;  2PCF B;  1IXR A;  1JOO A;  1CK1 A;  3TBI B;  2CFM A;  5C3E H;  3E6Z X;  1STN A;  4YWM A;  1AH9 A;  2ATW A;  4K5W A;  4QB4 A;  5M3F B;  3CQZ H;  1S5B D;  4K5V A;  1U0L A;  3PUY A;  5E4W C;  2EYO A;  4DU9 A;  2EXD A;  1F77 A;  3GD7 A;  4LAA A;  1JT8 A;  4DR2 L;  1SR3 A;  2EYH A;  4YCU A;  3S17 B;  2F0K A;  5IWA L;  4HJ8 A;  1VQK A;  3VR6 A;  5LMN W;  1WTR A;  2F0P A;  2Q8I B;  3JAM E;  3SK4 A;  4MNO A;  2RSN A;  2NVY B;  3A7A B;  4K8I A;  4XT3 B;  3WOF A;  5M5X H;  4YCV A;  3GTQ H;  3PO3 B;  1D2B A;  2EZV A;  5KND A;  4LFB L;  4DV3 L;  4Y7N H;  1E24 A;  1YBY A;  1XTC D;  2DN8 A;  1WVL A;  4IFD G;  2ZXR A;  1STH A;  1XMQ L;  3A74 A;  4HN7 A;  3S2D B;  1Y8N B;  1GD7 A;  2IWH A;  1JCK B;  3EN2 A;  1S5C D;  5IP9 H;  3BZK A;  1TWA H;  1VQD A;  4DXG A;  1HTL D;  2JA8 G;  1Q12 A;  3R2T A;  1W6K A;  4QUF A;  4CKB A;  1VQ7 A;  4KHV A;  5IYD G;  3UE1 A;  2MQH A;  1EU4 A;  4HJ9 A;  2IX3 A;  4A93 G;  2MUY A;  1IZ6 A;  4FF1 A;  1LAC A;  1YIJ A;  5CV6 A;  3RLF A;  3PUW A;  1S4Z A;  3K59 A;  4BBR H;  2I5L X;  1L0X B;  5C0X J;  1EIF A;  3GTK B;  3KF8 A;  3MXU A;  3KOJ A;  3S24 A;  4RGT A;  5DNF A;  2PZW A;  3RZD H;  1Y8P B;  2F0O A;  1BQQ T;  3T53 B;  2Q2H A;  4IZ8 A;  4FNF A;  4A3I H;  2IW3 A;  4JI0 Q;  4XIG S;  3ND9 A;  4OGQ C;  4BBS B;  1K8M A;  5A2Q E;  1KXL A;  1LV9 A;  4DR2 Q;  3GO5 A;  4JI4 L;  4XQJ A;  1YNJ D;  2R7F A;  4A4I A;  1K0S A;  3FKI G;  3CCM A;  2UUB L;  1ZYR C;  5EJW A;  1VCI A;  2CWP A;  1Q82 C;  4JW0 A;  4DK1 A;  3GTO B;  1UAP A;  1MHW C;  1ENA A;  2NZO A;  3H15 A;  3F8T A;  3HOZ H;  3J80 E;  4MTN A;  4LFB Q;  4DV3 Q;  2PZT A;  3TP5 A;  4QIW E;  4ABN A;  3HKZ E;  2B29 A;  4EGV A;  1NSN S;  3K5O A;  1MBY A;  4GKJ L;  1VQ9 A;  3HFZ B;  1HFN A;  4ZKC B;  4IQZ A;  1DJR D;  5C4Z A;  1RCV D;  1EEF D;  2IPK D;  1TII D;  4DV7 L;  1X56 A;  4RMF A;  4CKC A;  4EVO A;  4PZ8 A;  3HOW B;  1X3P A;  1J9O A;  4HSP A;  1O7Z A;  5E7N A;  1B53 A;  4A3F B;  1VQF A;  3OIQ A;  4BY7 G;  5KGU A;  4X65 Q;  2KEN A;  4IUT A;  2UUC L;  1NTG A;  3RN5 A;  4A3B G;  3NPP A;  2QIL A;  3K81 C;  1BDO A;  1FGB D;  1VQC A;  4HIM A;  2BE5 D;  1QVG A;  3QJY A;  1X55 A;  4NXN Q;  4LFA L;  5LMU Q;  1R9T H;  1UE1 A;  1EY5 A;  3ERS X;  5LHY 1;  2OWO A;  2AWO A;  3P20 A;  1V1Q A;  2CKZ B;  2CQO A;  4KKS A;  4RCO A;  4X3K A;  1AP0 A;  3S1R B;  4PMB A;  1VQI A;  4P74 A;  3Q8D A;  4JI4 Q;  2HIX A;  3S2H B;  3A5Z B;  4DR4 Q;  5CV4 A;  1QOH A;  4A3L H;  2R92 B;  1OXU A;  1A0I A;  2FIN B;  3N52 A;  4CJ0 B;  1JIC A;  2LSS A;  4DUY L;  2LMC B;  1IKM A;  4AYB E;  1Q8K A;  3GTG H;  5ELN A;  2YYZ A;  1SLJ A;  3OYY A;  3F2D A;  5E4X A;  1G2T A;  4X66 Q;  2HD3 A;  1MIU A;  1KLG D;  2H1E A;  2K7V A;  4IUN A;  1QZG A;  4GKJ Q;  2R93 H;  2X69 A;  1BOS A;  4HIO A;  4KN7 C;  3S14 H;  4O0A A;  3AFQ A;  3RMH A;  3AQQ A;  1TS4 A;  4ME5 A;  2ZM6 L;  3MXG A;  2F0M A;  4X62 L;  4HSV A;  3S1N B;  2Z9H A;  5EBD A;  4DV7 Q;  4Y52 H;  1I4P A;  4QQB X;  4H0L C;  1OTC A;  2CW0 D;  2VB2 X;  1SYF A;  5FK9 C;  3SE0 A;  4DV1 L;  2YTV A;  3L0O A;  4DFA A;  4GNX B;  3HOX H;  3C3L A;  1K8O A;  2LXJ A;  3HOY H;  1RDP D;  2PI2 E;  5EGT A;  2VQE L;  4OL7 A;  5BN4 A;  1M4V A;  4LJZ C;  4PZ7 A;  4DR3 Q;  4BA2 I;  2UUC Q;  4G7H C;  2IX1 A;  1F2L A;  4C3H H;  1BCP C;  4CJ1 B;  2ZT9 C;  5ELD A;  2O5I C;  1IYU A;  4C56 C;  5C0X G;  5KYI A;  4GOP A;  3C1E A;  3M3Y B;  1G91 A;  2I5H A;  5CV8 A;  4R4O A;  4A75 A;  2O2L D;  1HFG A;  3OHX C;  4JV5 L;  1XXG A;  4DV0 L;  4Q5V A;  3KDF A;  3I4N B;  2MFI A;  1S72 A;  4J8Q A;  1PA6 A;  1EY8 A;  2XWB B;  3SXH A;  1E0B A;  3BVM A;  2JA5 G;  2I0Q A;  2JJQ A;  4UY8 C;  4DUY Q;  1G29 1;  1F2Y A;  2M9V A;  3NXW A;  1EY4 A;  1WD0 A;  4F7X A;  1V9P A;  2QDB A;  1V43 A;  3H3V I;  1CKO A;  2F0H A;  1ONL A;  4ODG A;  1L1O C;  3SDZ A;  3CW2 C;  3AFP A;  3CCL A;  1CQF A;  4GKK L;  2EPB A;  4OO1 H;  1JWS D;  3NEL A;  4BXX H;  3JAM i;  4X3T A;  3MVV A;  1B8A A;  4OX9 L;  3J7Y W;  2ENB A;  1DD2 A;  2B2Y C;  1RTO A;  3I2Z A;  1GVP A;  1UWV A;  4TSS A;  4X62 Q;  3O13 A;  2DNE A;  4DK3 C;  2NVX H;  3JAM L;  4DV1 Q;  1PH7 A;  1AE2 A;  1SND A;  3E0E A;  2QKI C;  4MIU A;  4XTC S;  3EBE A;  3OTO Q;  1HZC A;  5IP7 H;  3L2P A;  4LNQ A;  1KD1 C;  3M4O H;  5FO8 B;  2FHT A;  5COY A;  4C1N I;  1A63 A;  1QZH A;  4IUP A;  2SNS A;  1V1P B;  3QB3 A;  1BBU A;  5M5W H;  2M00 A;  2B63 G;  1ILQ A;  1ZXT A;  4NXM L;  3TZU A;  5GAG C;  1N33 Q;  2QF7 A;  1LYL A;  5JEA J;  4JV5 Q;  2F0V A;  5IGF A;  2CWA A;  2ICI A;  3FPP A;  5ELE A;  4CDF C;  2UXB Q;  1Q86 C;  4MTK A;  2HHH L;  4V0B A;  2I07 B;  4JI2 L;  5IYB G;  4ZUI A;  1F2M A;  1QG7 A;  1H9S A;  1S5F D;  5M3F G;  3G6E A;  1HJP A;  1LO5 D;  3DWQ A;  2XVS A;  3R3O A;  2E2I H;  3NTK A;  4QIW B;  4DKA C;  1KAW A;  1GUN A;  2AQ2 B;  3HKZ B;  5IGC A;  1PTO D;  5JJI A;  2NWG A;  4GKK Q;  2IL8 A;  4LWC A;  2RDH A;  2K33 A;  4BWG B;  5A2Q L;  4LF7 L;  2PNH A;  4A3B B;  2MHV A;  1B44 D;  5GQO A;  3J80 i;  3PO3 G;  2A6H C;  1CKN B;  1PH5 A;  4UHV A;  3CHB D;  3FVQ A;  3A0J A;  3ITP A;  2D0P A;  4J15 A;  1DON A;  2N8N A;  2NVT B;  4M1U B;  3NWT A;  3VR3 A;  2MGS A;  1T5X D;  2F0J A;  4R4T A;  3UDX A;  2FFK B;  3J80 L;  1LTG D;  2D2C C;  1FL0 A;  2Z6B A;  4NB3 A;  4IUR A;  4JK1 C;  2L9H A;  1SNC A;  2F0U A;  1TWH B;  2OQ0 A;  3E5S A;  1O7Y A;  2VW9 A;  3MFY A;  4BBR B;  2PQA A;  2F1M A;  4DNI A;  2K5N A;  4NXM Q;  2ZJP A;  5ELB A;  2JA9 A;  1YHA A;  3RZD B;  4NP5 A;  3HOV H;  1PMR A;  3BZC A;  3OSO A;  4XQN A;  4A3I B;  4K5X A;  2IJ0 A;  4JYA L;  4GLA C;  2NTT A;  3KLS A;  1E3P A;  1CFM A;  1SNM A;  2PQE A;  2HHH Q;  3E3X A;  1EQR A;  4JI2 Q;  3ERO A;  3HOU B;  3IFT A;  4AYB B;  3CPW A;  1WTX A;  2WII B;  2AUK A;  4M8A A;  1E2Z A;  1X3E A;  1E7Z A;  3H0G G;  3HKS A;  1PRT C;  2WB1 E;  1R4Q B;  1ESF A;  3H6M A;  2HDM A;  2A69 C;  3VA5 A;  1JOQ A;  3TS2 A;  3A56 A;  2Z4I A;  3T51 B;  3D3R A;  1K28 A;  2IHF A;  5CBE E;  3U58 A;  1BF4 A;  2R7Z G;  3M7N A;  2BA1 A;  2EVB A;  3HG9 A;  1S5D D;  4DR1 L;  1QE6 A;  1LTL A;  3NTH A;  5CV9 A;  2WAC A;  1CM9 A;  2WB1 G;  2B39 A;  4ZUJ A;  4A3J H;  5IIF A;  2UU9 L;  4CHT B;  2A19 A;  1FD7 D;  5D65 A;  5JJZ A;  4JI5 L;  1DOL A;  3J81 E;  1H95 A;  2G5D A;  2EY6 A;  4UAI A;  1N9W A;  4JI8 Q;  2NYZ D;  5JPN C;  1LLR D;  4A3D H;  2JK8 A;  2F0E A;  1K83 B;  1Z47 A;  2B8G A;  3SK5 A;  3HOW G;  4EQ5 A;  2L11 A;  4I7A A;  2C5C A;  2JA7 H;  4KI0 A;  5M3M G;  3HGB A;  4JI1 Q;  3OW2 A;  3BS1 A;  1PV4 A;  5JEA G;  1R9T B;  3CP0 A;  4A3C G;  1QNK A;  4KJO A;  2K5W A;  3CC7 A;  1GUO A;  5IE8 A;  1JJC B;  4JYA Q;  4A3M G;  1HXY D;  2YV5 A;  1IL2 A;  4BY1 G;  1C4Q A;  1NNX A;  2A8V A;  2EIF A;  3I73 A;  2EY2 A;  3BDL A;  4HR7 B;  3D4R A;  1FNV A;  1SEB D;  4FVM A;  4EX5 A;  4KHP L;  3GTG B;  1FR3 A;  5L37 A;  4GLV B;  4IJH A;  2HQL A;  2VXW A;  2DY7 A;  1O80 A;  2ZXP A;  1SMY D;  4DR7 L;  4L5T A;  3CMA A;  4CGY B;  1SFO H;  2K05 A;  2R92 G;  1D5M C;  1GUG A;  1VF5 C;  4DV6 L;  1VQE A;  4KY5 A;  2E8G A;  1SYC A;  1XPU A;  3M85 A;  1BCP F;  4LUV A;  3CRK C;  2A74 C;  4L6T B;  3S14 B;  2UU9 Q;  2BDN A;  2C9O A;  2Z4H A;  3I7F A;  2ES2 A;  4JI5 Q;  2B63 B;  2F3V A;  2B2U A;  4H44 C;  4F87 A;  4A93 H;  3HOX B;  1FVI A;  1Z6H A;  1VQA A;  5M9O A;  1ZEQ X;  3S16 H;  4GS3 A;  1NJI C;  3BYT B;  3KF6 A;  5KNB A;  5JVG 3;  1NAP A;  1ESR A;  4DA2 A;  4QL5 A;  1WOC A;  1OXS C;  1K0R A;  4A3K H;  3OWE B;  1PH8 A;  5CYU A;  5FJ8 G;  1CSP A;  1YNN D;  3FKI H;  1L2F A;  3S1M B;  2NVQ B;  1QNU A;  3VR5 A;  5FO9 B;  2F4V Q;  4FXG C;  1AZP A;  3NK9 A;  1MGS A;  1JOR A;  5HY6 A;  3GDE A;  2RDG A;  1M8A A;  4B3M L;  4FF4 A;  5JOB A;  1FGU A;  4JI7 L;  4KHP Q;  2TMP A;  4DAP A;  5IY0 A;  4FO2 A;  3EIV A;  1U9R A;  1HNX L;  1FJG L;  3I4N G;  1HH2 P;  4QMG A;  3K5N A;  3TS0 A;  1X9N A;  1M90 C;  4DR7 Q;  2FMM A;  2Z6K A;  3CCU A;  3U9O A;  3KK7 A;  1SE3 A;  4DV6 Q;  3EA6 A;  4L63 B;  1NE3 A;  1F2Z A;  1SNQ A;  4K0K L;  1W3S A;  1RF2 D;  5AFW A;  1JE5 A;  2DGY A;  4DAV A;  1HR0 L;  2A68 D;  3MXP A;  1AW7 A;  4LFC L;  1E1O A;  1EY7 A;  4A3E G;  1X32 A;  1SDF A;  4ZLT F;  4JOI C;  1PH9 A;  1A3T A;  1VQH A;  3U9S A;  3T56 B;  2NN6 G;  4POF A;  3R2I A;  3TEH B;  3TP6 A;  4RGN A;  1HNW L;  2TSS A;  2HDL A;  3HP3 A;  2F0N A;  4JBK A;  3CCV A;  1G2S A;  4LF4 L;  1EIH A;  2KEE A;  4LF8 L;  3P75 A;  1P8L A;  1WCM B;  4HCS A;  2BOS A;  2VQF L;  5M5W B;  1C7Y A;  2RHS B;  1A3U A;  2KA7 A;  3DWA A;  2A6E D;  3H0G B;  4N9P A;  1LUZ A;  2XTI A;  2QGQ A;  1RJT A;  1PFB A;  2EYF A;  1HZB A;  4C3J B;  3BG3 A;  5IWA Q;  5C0X I;  1D8L A;  2R7Z B;  5FKA C;  1YVC A;  4Z9C B;  4DGZ A;  5D3I B;  3P1H A;  2B3G A;  4RKB A;  3K7A H;  2RKS A;  2WAQ E;  3GP7 A;  1PH6 A;  1KAA A;  4HMJ A;  5KRU A;  4ZAI A;  2WB1 B;  2C35 B;  2ASB A;  1U4R A;  2VY3 A;  4C3I H;  2RF4 A;  2NZH A;  1HNX Q;  1LTA D;  4P73 A;  4CBV A;  4IAL A;  4B08 A;  1FJG Q;  1LTT D;  1RL2 A;  1B7Y B;  2DY8 A;  4JCV E;  1VQM A;  1MSG A;  1BBW A;  4NPS A;  2WAQ G;  1EYG A;  1SSO A;  1XMQ Q;  3STB D;  3G4S A;  3W5O A;  2E2J B;  4XT1 B;  1XPO A;  1Y1W B;  1D1K A;  4PMW A;  2JA6 B;  4GZY C;  4K0K Q;  4IJL A;  1C9O A;  4YWK A;  1NCV A;  1TT2 A;  3NUC A;  5M5Y B;  1A3V A;  4GNX A;  4LFC Q;  3HKZ G;  1LT4 D;  4DAY B;  5M3M B;  1BVS A;  3CRL C;  2CH4 W;  5EPJ A;  2I46 A;  2M2L A;  3VYS A;  1NMF A;  4LUO A;  1HNW Q;  1IL8 A;  2KBN A;  3KJO A;  4A3M B;  1U4L A;  3BYY B;  1BCP B;  5C4J H;  3F2B A;  4PZ6 A;  2XNA C;  3J81 i;  5IP9 G;  4BY1 B;  4LF4 Q;  4FDB A;  1ASY A;  4LF8 Q;  1QIL A;  4UDU C;  3J7Z C;  1VQL A;  1SRO A;  4POG A;  3SHL A;  2VQF Q;  2B2U C;  1VF7 A;  4RFB A;  2EE1 A;  1VQ4 A;  4P72 A;  4C2M B;  1IBM L;  2VUM H;  2L15 A;  3J81 L;  1UEA B;  2FMC A;  5BR8 L;  2JA5 H;  2UUB Q;  5CR3 A;  4UP7 A;  3S1Q B;  4BBR G;  1KIX A;  3TRE A;  3R93 A;  3KF8 B;  3P7J A;  5HGT A;  2K5D A;  1TKW B;  4XYQ A;  4U67 3;  4QUC A;  2GN5 A;  2OEO A;  1EIG A;  1SE8 A;  3MXN A;  1CHP D;  4A3I G;  3I72 A;  3HEJ A;  2WP8 J;  3I8Z A;  4KJN A;  1L1O B;  4N9T A;  2YTX A;  2BH8 A;  3QG1 A;  3NEM A;  2JEB I;  3KBX A;  4RGO S;  5AJ3 L;  1Y1V H;  1LT3 D;  3AEV A;  3HOU G;  1PH2 A;  4A3G H;  4KMU C;  4AYB G;  2ZJQ A;  3L7Z C;  2B8F A;  2KHJ A;  5I2X A;  4G7Z C;  1DGS A;  3MWY W;  1M1K C;  5DEH A;  1F9Q A;  1OXX K;  3CCJ A;  5C44 H;  3ULP A;  2GVB A;  4OIJ A;  1STB A;  1PTO H;  5FLX E;  3G48 A;  3C1F A;  3DM3 A;  3KYH C;  5IYC H;  2ZTC A;  3J7A V;  1H9R A;  2KHS A;  3BZD B;  4IUQ A;  5C4X H;  3K58 A;  1MI2 A;  3CPF A;  5I6Y A;  3K0X A;  4UP8 A;  4ID6 A;  2RSO A;  1V1P A;  5J22 A;  1L0Y B;  3NQT A;  1KDB A;  1EYC A;  4PG3 A;  5IT9 c;  4C1N K;  3FEW X;  5K36 H;  3KFU A;  4LFA Q;  1LT6 D;  1D6E C;  3PMF A;  4RHS A;  3M4P A;  3S15 B;  1A15 A;  1LM0 A;  2JA7 B;  1HHV A;  1EQV A;  4KD3 A;  3KBG A;  2B2V A;  3CAM A;  3OW7 A;  4YHH L;  4KTA A;  2J0T D;  1J5E L;  2PO4 A;  1ILP A;  1EWH A;  1LTR D;  1VS0 A;  1IBM Q;  2Q2I A;  3CCS A;  5BR8 Q;  4DPG A;  2KHI A;  1TWG B;  3MFG A;  4N8F A;  4R9W A;  5J39 A;  4JG2 A;  2YU9 H;  1DZ1 A;  4JI3 L;  2E76 C;  4WJ4 A;  1VMC A;  3FRP B;  3S17 H;  2AUJ D;  2D0O A;  3D31 A;  4HED A;  2CH4 A;  4IPG A;  4A3E B;  3K7U C;  1WD1 A;  1EEI D;  1VQG A;  3BU2 A;  5EKK A;  3C46 A;  1EU3 A;  4ALP A;  3IL8 A;  3GTJ B;  2NVY H;  4O2D A;  2A5H A;  2Q8T A;  3GTM B;  4L5R C;  3PO3 H;  1EUJ A;  1ASZ A;  2V4D A;  2ZM6 Q;  1W2B A;  2RA4 A;  1CKN A;  2QCP X;  1DOM A;  2Y0S E;  4CDD C;  1CHQ D;  1G8Z D;  4DAM A;  4HID A;  1PXU A;  2BA0 A; 
#chains in the Genus database with same CATH homology
 3PO2 B;  4MHE A;  2ZXO A;  2K32 A;  1D5X C;  1VDZ A;  4TQU S;  2OXP A;  3PUV A;  3D4W A;  1HQR D;  2EJF C;  4X3S A;  3K0Y A;  4BS9 A;  1EFI D;  1LT5 D;  3EFX D;  4FYD A;  2NUC A;  5KIX A;  2PPB C;  1I3Q B;  1E2V A;  3Q24 A;  1LAB A;  4TKO B;  1TS2 A;  5C3E B;  4KV6 A;  3FDT A;  1ET6 A;  1JR0 D;  2IX0 A;  3SVM A;  5EPL A;  3CQZ B;  3VR2 A;  4A3K B;  2ID0 A;  2EYL A;  4C3H G;  4XYO A;  4NDX A;  3T13 A;  1XYI A;  3SEB A;  2WAQ B;  4HCE A;  1OO9 B;  2X6G A;  1PYW D;  3OPO A;  3NBH A;  2F4I A;  1KDC A;  4IUU A;  4HAE A;  5M5X B;  3GTQ B;  1PRT B;  1X3Q A;  4ILW A;  3WOE A;  1ENC A;  1RTN A;  4KY6 A;  1YNJ C;  2PZU A;  4FXD A;  5CMD A;  4Y7N B;  3SK6 A;  5T1I A;  1IW7 D;  2JYO A;  3T4A C;  1D5Z C;  3RUZ A;  3AMU A;  4DK0 A;  4LK1 C;  3EVQ A;  1TWA B;  4I65 A;  1IYV A;  2JP1 A;  4WRD A;  1V1O A;  2D9U A;  3H94 A;  3W2D A;  2R3Z A;  4OO1 G;  3LWU A;  3J7A F;  2J4X A;  3AB9 A;  3K6O A;  1NR4 A;  2KUM A;  3DXJ C;  4QF4 A;  1KNE A;  2EY5 A;  4EQO A;  4RA8 A;  1W6J A;  1WTP A;  1AEX A;  4DNT B;  5HUR A;  3HZX A;  3I3C A;  3HS0 C;  4WJW A;  3Q0A A;  2B2W A;  1HQM C;  2BE5 C;  1ZYR D;  3M4Y A;  1IHZ A;  3V96 A;  5BN3 A;  3BVZ A;  3K7A B;  4B9W A;  2Z1C A;  3LX0 A;  5DAU A;  2RBM A;  3HOZ B;  3MHB A;  4C3J G;  5I9O A;  2F0Q A;  1NUC A;  4O42 A;  5C5L A;  4G4K A;  2RQX A;  3Q23 A;  4KD4 A;  1H9S B;  5A35 A;  1PZJ D;  4HTH A;  5G3L F;  3FMC A;  3H09 A;  1WTV A;  2AQ1 B;  1ZKO A;  5KYL A;  3NE5 B;  5DM7 3;  1C48 A;  1I4H A;  4IFD I;  3A8J E;  5KNC A;  2K6A A;  1O7L A;  3D6C A;  1LTI D;  4IN3 A;  1TY0 A;  3GQB A;  2CW0 C;  4QCL A;  1BUV T;  4FXK C;  4KN4 C;  2L1B A;  5T1G A;  2PW7 A;  2SNM A;  5EQ0 A;  5FLX L;  1CT1 D;  4L8J A;  2VUM B;  1Q8I A;  1DM0 B;  5C3W A;  3I91 A;  4WOR A;  2NB0 A;  1RHP A;  1HTP A;  1U4M A;  1KTK A;  4RCN A;  3VYU A;  1XWE A;  2F0G A;  3Q22 A;  2XRS D;  1IKL A;  1KDA A;  4IFD H;  1CQV A;  2EDG A;  5E1F A;  5IGG A;  2D62 A;  2K1B A;  2R93 B;  3PIO 3;  1JB3 A;  1Y1V B;  5E3F A;  1Q3L A;  2Y0S B;  2L5T A;  1STE A;  2K04 A;  5C44 B;  3KUP A;  3S9W A;  1CI3 M;  1GJX A;  2PYK A;  4JBW A;  1LTB D;  2WKC A;  1H9J A;  5BN5 A;  1I6V C;  3CKI B;  3HOY B;  4OHJ A;  2E2D C;  1BCP D;  5C4X B;  1A6X A;  1GUS A;  4C3H B;  2K28 A;  1OXV A;  1MSH A;  4K14 A;  2FJ2 A;  1QB5 D;  2HUG A;  1H9M A;  1UUP A;  1DXM A;  2E75 C;  3TSS A;  3N6R A;  4I7Z C;  2AQ3 B;  2XIW A;  4CJ2 C;  2F0W A;  4R8I A;  3G7L A;  5EPK A;  1STA A;  5C4H A;  2IT1 A;  4TRD A;  3K57 A;  2B2T A;  4RGM A;  3M7G A;  3K5L A;  2YU9 B;  1A2U A;  4PMC A;  1ET9 A;  3HRZ C;  2LKV A;  2DNC A;  1CTM A;  1EY9 A;  1F9S A;  4KKU A;  3X3M A;  3QO2 A;  2B2W C;  3L3O C;  1H9K A;  1TR5 A;  1A2T A;  2G9D A;  3PIP 3;  1RKN A;  2BDO A;  4XXE A;  4DAY A;  2VNU D;  2CVR A;  1ENF A;  1PTO C;  2NVX B;  2PNR C;  3K5M A;  4H13 C;  2Z8L A;  1JWU D;  1IW7 C;  3EJI A;  1B3A A;  2EOT A;  4DXF A;  1Y69 U;  5DM6 3;  1KNA A;  1Y8O B;  2F0F A;  3M4O B;  3IKJ A;  1SBB B;  3F2U A;  3V2T A;  2F0I A;  3GV3 A;  5KEE A;  3KLS X;  2OF1 A;  4ULL A;  2L4N A;  1XX8 A;  1GHJ A;  4G57 A;  5EKI A;  1HPC A;  4J1M A;  2G9H D;  1CZW A;  3DMU A;  4ZQ3 A;  1DCZ A;  3ONA B;  1JWM D;  1HCZ A;  1EZ8 A;  3I4M B;  2NBF A;  1G6Z A;  2JSO A;  2D5D A;  2SDF A;  4WFN 3;  1QWY A;  1TU2 B;  2E2I B;  3QIA A;  1DYQ A;  1RD9 D;  3IFD A;  1I4R A;  2WKD A;  1AZQ A;  2B2Y A;  1JQY D;  3SR1 A;  2E2H B;  2A6H D;  4YIJ A;  2SEB D;  3X3N A;  4NKL A;  4O1N A;  1C8C A;  2HQE A;  1UNS A;  4ZKB B;  3L9A X;  5C0X H;  2O5J C;  4HMI A;  2XN9 C;  3C2P A;  3OOC A;  4KHZ A;  1PLF A;  2PMZ B;  2ICE C;  5IGB A;  1V8Q A;  3AU7 A;  3CU7 A;  3H3V C;  3MAQ A;  2PW5 A;  3URY A;  5I2Y A;  1T5E A;  1PRT F;  2KED A;  3GV6 A;  4B9X A;  2F03 A;  3HOV B;  4BA1 I;  1Z7T A;  1B1Z A;  5IGD A;  2KCC A;  5IT9 L;  3NWS A;  2R61 A;  3DM1 A;  2NTS A;  1SE4 A;  1SXT A;  2F0D A;  3VYT A;  5CC4 A;  5K5P A;  1HUN A;  4J6H A;  3RD4 A;  2F0T A;  3ND8 A;  5D14 A;  1BNZ A;  4F8M A;  2JXM B;  1PRT D;  3KLR A;  1PFM A;  3QOL A;  4XDX A;  2XWJ B;  2A69 D;  4PV1 C;  1SNO A;  3ERQ A;  2BCO A;  4ZRZ A;  5CBA E;  3ZYY X;  1R4P B;  1PZI D;  1GUW A;  1EOT A;  2B2T C;  2RVL A;  1KAB A;  4A3J B;  3NTI A;  1PZK D;  4C3I G;  1OXT A;  1SMY C;  2SOB A;  1EQT A;  2WIN B;  2EYM A;  1F9P A;  1ICW A;  4RWS C;  4A3D B;  3TP7 A;  1HUM A;  1GUT A;  1B9M A;  1SYG A;  1B2T A;  5ELC A;  3LWE A;  2LY7 A;  1WTW A;  4OO1 I;  2L12 A;  3D6W A;  3PV0 A;  1BBX C;  4MN3 A;  5C5M A;  4P2C B;  1I6H B;  2N88 A;  5CV7 A;  3TN2 A;  1VMP A;  4PNY A;  2XSC A;  3PUZ A;  1HA6 A;  3A7L A;  3G6J B;  1Q90 A;  3WDN A;  3R8B A;  2EJG C;  3A55 A;  4FF3 A;  2KVM A;  1YNN C;  4NW2 A;  2CHB D;  2O4X A;  2R6G A;  4EQN A;  1I4Q A;  1CZG A;  1SFO B;  2N55 A;  3GTL B;  1FYC A;  4DNR B;  5IOC A;  1CA5 A;  1HA5 A;  2F3W A;  1GOZ A;  2JA8 B;  5CV5 A;  3VYR A;  5IGE A;  4K6D A;  1SAP A;  2L55 A;  4NMZ A;  1I4X A;  3OIP A;  1QJO A;  4A93 B;  3RZO B;  1I4G A;  1EY0 A;  3OWF A;  4R8N A;  1PFN A;  3BDC A;  3S16 B;  2K01 A;  3W3A A;  2A68 C;  3GTP B;  5C6A A;  2MPM A;  1TQO A;  5TSS A;  3PUX A;  2EYP A;  3A54 A;  2L0C A;  3NHH A;  2Q8R E;  1QCB D;  1PDQ A;  2K03 A;  4KK7 A;  3FKI B;  3LNN A;  3MC0 B;  3VA7 A;  3I90 A;  3VR4 A;  1TS5 A;  5D3D A;  4K8J A;  4RHR A;  2KJX A;  4K2K A;  3OMC A;  5K36 G;  1I50 B;  2MJ8 A;  5CGK A;  2A6E C;  5FO7 B;  1BO0 A;  1PTO F;  3FPU B;  1STY A;  1GHK A;  4H7B A;  3D4D A;  1ROD A;  1HRJ A;  1TY2 A;  1JE4 A;  2VB3 X;  2F0L A;  1SYD A;  3DEO A;  1AN8 A;  5J1Z A;  2HCI A;  3BDO A;  1ML0 D;  4BY7 B;  2GA4 B;  3MA2 B;  4EQP A;  1B4O A;  1EYD A;  1TWC B;  4XQQ A;  1E2W A;  4X3U A;  2E74 C;  2KQ3 A;  3DEP A;  5JEA H;  3I4L A;  4PQX A;  1MD2 D;  1Q1E A;  5C3X A;  1SYB A;  2EYJ A;  1S5E D;  1U4P A;  5ELF A;  4G7O C;  5FOB B;  4E6I A;  1AFP A;  3TP8 A;  1TS3 A;  5JPM C;  2EY1 A;  3MTS A;  4DF7 A;  1EY6 A;  1JOK A;  2B2V C;  3D8G A;  1KLU D;  1BR9 A;  2K5Q A;  3OMG A;  1O78 A;  4C3I B;  1LTS D;  3BVG A;  2HCC A;  4K6L A;  4F88 A;  4RAU C;  1J8I A;  4FF2 A;  3NP8 A;  1EWC A;  5LL6 X;  2CQA A;  3UI2 A;  3TZD A;  3V05 A;  2AWN A;  1B9N A;  1WTQ A;  4S3S A;  3MZ5 A;  3A8K E;  1FNU A;  2J7Z A;  3I70 A;  5IT9 E;  4V19 0;  1EYA A;  1II3 A;  4IFD J;  1TVX A;  4IUV A;  2JEA I;  5EKL A;  2MP1 A;  4CKE A;  4U68 A;  1D1I A;  4DN4 M;  5G3L D;  5EBC A;  5C4J B;  4RKL A;  5COR A;  2X6L A;  1DOK A;  2NN6 I;  4K2L A;  3TDQ A;  1Q1B A;  4RH6 A;  5NUC A;  2OT2 A;  1SJE D;  1CA6 A;  2KOL A;  2JA5 B;  1STG A;  2EJM A;  2LFN A;  2KCN A;  2NZ1 D;  3T16 A;  5IOD A;  3TME A;  2WV6 D;  1F9R A;  4Q0F A;  1SYE A;  1EL0 A;  2KEC A;  3SK8 A;  1B50 A;  3E0J A;  2EXZ A;  2JE6 I;  3QWN A;  4FP5 D;  3IAY A;  4ZK9 B;  1WTO A;  3DWP A;  3Q6S A;  2RDF A;  3EQL C;  4A3G B;  5I6W A;  1BXT A;  2A73 B;  3QOJ A;  1SNP A;  1EZ6 A;  1PTO B;  1SJH D;  4OIK A;  2NN6 H;  5I4D A;  2H4O A;  4ZYS A;  1GXD C;  1SE2 A;  2QEJ C;  3A8I E;  5JVH 3;  5LL6 S;  1JC7 A;  3H91 A;  3NQI A;  2F0S A;  5I9P A;  5ISR A;  2XRQ D;  4KY7 A;  2LS0 1;  1TWF B;  3DHQ A;  1FNW A;  3MEH A;  3NBI A;  4LMQ D;  3DUZ A;  5JAV A;  5F2D A;  1NR2 A;  3NSW A;  4KKT A;  2PCF B;  1JOO A;  1CK1 A;  3TBI B;  3E6Z X;  1STN A;  4K5W A;  4QB4 A;  5M3F B;  4K5V A;  1S5B D;  3PUY A;  5E4W C;  2EYO A;  4DU9 A;  1F77 A;  3GD7 A;  4LAA A;  2EYH A;  3S17 B;  2F0K A;  3VR6 A;  1WTR A;  2F0P A;  2Q8I B;  3JAM E;  3SK4 A;  2RSN A;  2NVY B;  3A7A B;  4K8I A;  4XT3 B;  3WOF A;  3PO3 B;  1D2B A;  2EZV A;  5KND A;  1XTC D;  2DN8 A;  1WVL A;  4IFD G;  2ZXR A;  1STH A;  4HN7 A;  3S2D B;  1Y8N B;  2IWH A;  1JCK B;  1S5C D;  4DXG A;  1HTL D;  1Q12 A;  3R2T A;  1W6K A;  4QUF A;  4CKB A;  4KHV A;  1EU4 A;  2IX3 A;  2MUY A;  4FF1 A;  1LAC A;  5CV6 A;  3RLF A;  3PUW A;  1S4Z A;  3K59 A;  5C0X J;  1L0X B;  3GTK B;  3KF8 A;  3MXU A;  4RGT A;  5DNF A;  2PZW A;  1Y8P B;  2F0O A;  1BQQ T;  3T53 B;  4IZ8 A;  4FNF A;  2IW3 A;  4XIG S;  3ND9 A;  4OGQ C;  4BBS B;  1K8M A;  5A2Q E;  1LV9 A;  3GO5 A;  4XQJ A;  1YNJ D;  1ZYR C;  5EJW A;  1VCI A;  4DK1 A;  3GTO B;  1UAP A;  1ENA A;  3J80 E;  2PZT A;  3TP5 A;  4ABN A;  4EGV A;  1NSN S;  3K5O A;  1MBY A;  1HFN A;  4ZKC B;  4IQZ A;  1DJR D;  5C4Z A;  1RCV D;  1EEF D;  2IPK D;  1TII D;  4CKC A;  4EVO A;  3HOW B;  1X3P A;  1J9O A;  4HSP A;  1O7Z A;  1B53 A;  4A3F B;  3OIQ A;  5KGU A;  4IUT A;  3NPP A;  2QIL A;  1BDO A;  1FGB D;  2BE5 D;  3QJY A;  1EY5 A;  5LHY 1;  2AWO A;  3P20 A;  4KKS A;  4RCO A;  4X3K A;  1AP0 A;  3S1R B;  4PMB A;  3S2H B;  5CV4 A;  1QOH A;  2R92 B;  1OXU A;  2FIN B;  3N52 A;  4CJ0 B;  1JIC A;  2LMC B;  1IKM A;  2YYZ A;  5E4X A;  1G2T A;  1KLG D;  2H1E A;  2K7V A;  4IUN A;  2X69 A;  1BOS A;  4KN7 C;  3RMH A;  1TS4 A;  4ME5 A;  3MXG A;  2F0M A;  4HSV A;  3S1N B;  5EBD A;  1I4P A;  4H0L C;  2CW0 D;  2VB2 X;  1SYF A;  5FK9 C;  3SE0 A;  4DFA A;  1K8O A;  3C3L A;  1RDP D;  5EGT A;  4OL7 A;  5BN4 A;  1M4V A;  4LJZ C;  4BA2 I;  4G7H C;  2IX1 A;  1F2L A;  1BCP C;  4CJ1 B;  2ZT9 C;  5ELD A;  2O5I C;  1IYU A;  4C56 C;  5C0X G;  5KYI A;  3C1E A;  3M3Y B;  1G91 A;  5CV8 A;  2O2L D;  1HFG A;  3OHX C;  1XXG A;  4Q5V A;  3I4N B;  4J8Q A;  1EY8 A;  2XWB B;  3SXH A;  1E0B A;  3BVM A;  1G29 1;  1F2Y A;  2M9V A;  3NXW A;  1EY4 A;  1WD0 A;  4F7X A;  2QDB A;  1V43 A;  2F0H A;  1ONL A;  4ODG A;  3SDZ A;  1CQF A;  2EPB A;  4OO1 H;  1JWS D;  4X3T A;  3MVV A;  3J7Y W;  2ENB A;  1DD2 A;  2B2Y C;  1RTO A;  4TSS A;  3O13 A;  2DNE A;  3JAM L;  1SND A;  2QKI C;  4MIU A;  4XTC S;  5FO8 B;  2FHT A;  5COY A;  4C1N I;  4IUP A;  2SNS A;  1V1P B;  3QB3 A;  2M00 A;  1ILQ A;  1ZXT A;  3TZU A;  2QF7 A;  5JEA J;  2F0V A;  5IGF A;  2ICI A;  3FPP A;  5ELE A;  4V0B A;  2I07 B;  4ZUI A;  1F2M A;  1QG7 A;  1H9S A;  1S5F D;  1LO5 D;  3DWQ A;  2XVS A;  3R3O A;  3NTK A;  4QIW B;  1GUN A;  2AQ2 B;  3HKZ B;  5IGC A;  1PTO D;  2NWG A;  2IL8 A;  2RDH A;  2K33 A;  4BWG B;  5A2Q L;  4A3B B;  2MHV A;  1B44 D;  2A6H C;  3CHB D;  3FVQ A;  3ITP A;  1DON A;  2NVT B;  4M1U B;  3NWT A;  3VR3 A;  2MGS A;  1T5X D;  2F0J A;  2FFK B;  3J80 L;  1LTG D;  2D2C C;  4IUR A;  4JK1 C;  2L9H A;  1SNC A;  2F0U A;  1TWH B;  3E5S A;  1O7Y A;  3MFY A;  4BBR B;  2F1M A;  5ELB A;  3RZD B;  4NP5 A;  1PMR A;  3OSO A;  4XQN A;  4A3I B;  4K5X A;  2IJ0 A;  2NTT A;  3KLS A;  1CFM A;  1SNM A;  2PQE A;  3ERO A;  3HOU B;  3IFT A;  4AYB B;  1WTX A;  2WII B;  2AUK A;  4M8A A;  1E2Z A;  1ESF A;  1PRT C;  1R4Q B;  3H6M A;  2HDM A;  2A69 C;  3VA5 A;  1JOQ A;  3A56 A;  2Z4I A;  3T51 B;  3D3R A;  5CBE E;  1BF4 A;  3M7N A;  2BA1 A;  2EVB A;  3HG9 A;  1S5D D;  1QE6 A;  3NTH A;  5CV9 A;  2WAC A;  1CM9 A;  2B39 A;  4ZUJ A;  5IIF A;  4CHT B;  1FD7 D;  5D65 A;  5JJZ A;  1DOL A;  3J81 E;  2EY6 A;  4UAI A;  2NYZ D;  5JPN C;  1LLR D;  2F0E A;  1K83 B;  1Z47 A;  2B8G A;  3SK5 A;  2L11 A;  2C5C A;  4KI0 A;  3HGB A;  3BS1 A;  1R9T B;  5JEA G;  1QNK A;  4KJO A;  2K5W A;  1GUO A;  1HXY D;  1C4Q A;  3I73 A;  2EY2 A;  3BDL A;  4HR7 B;  3D4R A;  1FNV A;  1SEB D;  4FVM A;  3GTG B;  1FR3 A;  2VXW A;  2DY7 A;  1O80 A;  2ZXP A;  1SMY D;  4CGY B;  2K05 A;  1D5M C;  1GUG A;  1VF5 C;  4KY5 A;  1SYC A;  3M85 A;  1BCP F;  3CRK C;  2A74 C;  4L6T B;  3S14 B;  2BDN A;  2C9O A;  2Z4H A;  2B63 B;  2F3V A;  2B2U A;  4H44 C;  4F87 A;  3HOX B;  1Z6H A;  5M9O A;  1ZEQ X;  3BYT B;  5KNB A;  5JVG 3;  1NAP A;  1ESR A;  4DA2 A;  1OXS C;  3OWE B;  5CYU A;  1YNN D;  3S1M B;  2NVQ B;  1QNU A;  3VR5 A;  5FO9 B;  4FXG C;  1AZP A;  3NK9 A;  1MGS A;  1JOR A;  2RDG A;  1M8A A;  4FF4 A;  5JOB A;  2TMP A;  4DAP A;  4FO2 A;  1U9R A;  4QMG A;  3K5N A;  2FMM A;  3U9O A;  3KK7 A;  1SE3 A;  3EA6 A;  4L63 B;  1F2Z A;  1SNQ A;  1RF2 D;  5AFW A;  4DAV A;  2A68 D;  3MXP A;  1AW7 A;  1EY7 A;  1X32 A;  1SDF A;  4ZLT F;  1A3T A;  3U9S A;  3T56 B;  2NN6 G;  3R2I A;  3TP6 A;  4RGN A;  2TSS A;  2HDL A;  3HP3 A;  2F0N A;  1G2S A;  1EIH A;  2KEE A;  3P75 A;  1WCM B;  4HCS A;  2BOS A;  5M5W B;  1A3U A;  2KA7 A;  3DWA A;  2A6E D;  3H0G B;  4N9P A;  1RJT A;  1PFB A;  2EYF A;  4C3J B;  3BG3 A;  5C0X I;  2R7Z B;  5FKA C;  4Z9C B;  4DGZ A;  5D3I B;  3P1H A;  4RKB A;  2RKS A;  3GP7 A;  1KAA A;  4HMJ A;  5KRU A;  4ZAI A;  2WB1 B;  1U4R A;  1LTA D;  4CBV A;  4IAL A;  4B08 A;  1LTT D;  2DY8 A;  1MSG A;  1SSO A;  2E2J B;  4XT1 B;  1Y1W B;  1D1K A;  4PMW A;  2JA6 B;  4GZY C;  1NCV A;  1TT2 A;  3NUC A;  5M5Y B;  1A3V A;  1LT4 D;  5M3M B;  3CRL C;  5EPJ A;  2I46 A;  2M2L A;  3VYS A;  1IL8 A;  4A3M B;  1U4L A;  3BYY B;  1BCP B;  2XNA C;  4BY1 B;  1QIL A;  4UDU C;  3SHL A;  2B2U C;  1VF7 A;  4RFB A;  2EE1 A;  4C2M B;  3J81 L;  1UEA B;  2FMC A;  5CR3 A;  3S1Q B;  3R93 A;  3P7J A;  5HGT A;  2K5D A;  1TKW B;  4XYQ A;  4U67 3;  4QUC A;  2OEO A;  1EIG A;  3MXN A;  1CHP D;  3I72 A;  3HEJ A;  2WP8 J;  3I8Z A;  4KJN A;  4N9T A;  3QG1 A;  3KBX A;  2JEB I;  4RGO S;  1LT3 D;  4KMU C;  3L7Z C;  2B8F A;  5I2X A;  4G7Z C;  3MWY W;  5DEH A;  1F9Q A;  1OXX K;  4OIJ A;  1STB A;  1PTO H;  5FLX E;  3C1F A;  3J7A V;  1H9R A;  2KHS A;  3BZD B;  4IUQ A;  3K58 A;  1MI2 A;  5I6Y A;  4ID6 A;  2RSO A;  1V1P A;  5J22 A;  1L0Y B;  3NQT A;  1KDB A;  1EYC A;  4C1N K;  3FEW X;  5K36 H;  1LT6 D;  1D6E C;  3PMF A;  4RHS A;  3S15 B;  1A15 A;  1HHV A;  2JA7 B;  1EQV A;  4KD3 A;  3KBG A;  2B2V A;  3OW7 A;  4KTA A;  2J0T D;  2PO4 A;  1ILP A;  1EWH A;  1LTR D;  1TWG B;  3MFG A;  4R9W A;  5J39 A;  1DZ1 A;  2E76 C;  1VMC A;  3FRP B;  2AUJ D;  3D31 A;  4HED A;  4A3E B;  1WD1 A;  1EEI D;  5EKK A;  3C46 A;  1EU3 A;  3GTJ B;  3IL8 A;  2A5H A;  2Q8T A;  3GTM B;  2V4D A;  2RA4 A;  2QCP X;  1DOM A;  1CHQ D;  1G8Z D;  1PXU A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...