1HUMA

Solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA
publication title High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine(chemotactic)
total genus 10
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1humA00
1BNZA 2FMMA 4X3SA 1DZ1A 1F9RA 1ESRA 2FFKB 2JYOA 1GUWA 1B50A 3F2UA 2IL8A 4IUVA 3KBXA 2JP1A 2NYZD 1J9OA 4R8IA 2HDLA 4ZKBB 1BF4A 5COYA 5EPJA 1NAPA 3DM1A 4QUFA 1CA6A 1EIGA 1WTOA 1WD0A 5CMDA 1HA6A 2RSOA 2KECA 3R93A 2MPMA 3GV6A 1U4PA 3SVMA 1G91A 1B53A 1WTRA 3MTSA 2EE1A 1U4RA 3DEOA 1ML0D 5CBEE 1RHPA 1EOTA 1SDFA 5D65A 1G2TA 2RVLA 1G2SA 1IKLA 2DY8A 2KEDA 1HRJA 2FJ2A 1U4LA 4HSVA 2L11A 1O7ZA 4O42A 2L1BA 1ZXTA 2B2VC 1RTNA 2EOTA 1RJTA 3FDTA 2K04A 3TN2A 4XT3B 2EPBA 5T1IA 3I91A 2FHTA 4HAEA 2D9UA 1PFNA 4XT1B 1O7YA 1Q3LA 1X32A 4R9WA 2B2VA 2HCIA 4MHEA 2B2UC 3TZDA 3GV3A 5EJWA 1IKMA 1EIHA 2MGSA 1PDQA 2M2LA 2K03A 4RWSC 2Q8TA 4ZKCB 1U4MA 1XYIA 1HUNA 2Q8RE 1WVLA 1G6ZA 1MSGA 4ZK9B 4CJ1B 1B2TA 1X3PA 1ICWA 2B2TC 4U68A 1IL8A 1KNEA 3IL8A 2HDMA 1DOLA 5D14A 4ZLTF 1RTOA 1AP0A 1MSHA 3D6WA 2B2WC 3I90A 4IUQA 1A15A 4RA8A 1DONA 1HHVA 2KVMA 1NCVA 1X3QA 3FPUB 1BO0A 2K28A 2K1BA 3HP3A 2B2TA 2RA4A 2BDNA 2X6LA 4OIKA 1EL0A 1NR2A 3Q6SA 1CA5A 3G7LA 2L4NA 4X3UA 2KOLA 1JICA 4LMQD 2B2WA 2MP1A 2N88A 2X69A 3MWYW 4RAUC 4QUCA 4X3TA 3KUPA 1ILPA 1O80A 1XX8A 3I3CA 1PFBA 1EQTA 2K05A 2CVRA 1B3AA 4CJ0B 1WTWA 4IUTA 3I8ZA 4CJ2C 1F9PA 2MJ8A 4IUPA 1M8AA 4ZAIA 1VMCA 2KUMA 4NW2A 4DN4M 5EPKA 1SAPA 1DOMA 2X6GA 4IUUA 1WTXA 2NWGA 1PFMA 5JJZA 2K01A 1BBXC 1HFNA 3IFDA 4UAIA 2HCCA 2KEEA 1MI2A 5E4WC 1WTQA 5EQ0A 1VMPA 1F9SA 2B2UA 2SDFA 1QG7A 4XDXA 2R3ZA 2J7ZA 1WTPA 5CBAE 4HEDA 4MN3A 1S4ZA 1WD1A 1KNAA 3DEPA 3QO2A 1HFGA 5AFWA 1B4OA 2L9HA 2DY7A 1ILQA 5CORA 1SSOA 1C8CA 5EKIA 1F2LA 1E0BA 4OIJA 1RODA 3LWEA 4HCSA 2HUGA 1TVXA 3N52A 1DOKA 2L12A 2B2YC 1NR4A 2RSNA 1AZQA 2VXWA 2NZ1D 1LV9A 1MGSA 1PLFA 4X3KA 1CM9A 1HUMA 2FINB 2H1EA 4IURA 3UI2A 1WTVA 3H91A 1AZPA 1QNKA 3ONAB 5E4XA 5T1GA 1F9QA 1QE6A 5DNFA 5EPLA 2XIWA 2B2YA 1J8IA 3P7JA 1JE4A 2N55A
chains in the Genus database with same CATH superfamily
1I4XA 1QWYA 2EVBA 3DWQA 3FKIG 4RFBA 3N6RA 3VR4A 4KI0A 1IW7C 1S5CD 2NYZD 1J9OA 4RCOA 1VQNA 5COYA 2A73B 2RDFA 1A63A 1LTBD 1VQBA 3R93A 1A6XA 2CCZA 5EBCA 1B53A 2QEJC 1N32L 1AEXA 2JQOA 4HIOA 3S1NB 1QB5D 2F0OA 5IT9E 1RDPD 1YNXA 1SNMA 3LNNA 3QR8A 3A8KE 4JG2A 4QB4A 3DWAA 4QCLA 3VYRA 1EY9A 5FLMH 5C4XH 1PZKD 3OW2A 1O7IA 4WORA 2F0LA 1BXTA 4A3EG 3RZDB 4TRDA 1HNXQ 5FO8B 3I91A 3TSSA 5C3WA 3QOLA 4S3SA 3QOJA 4NMZA 3S16H 3EN2A 4IPGA 4CDDC 1D6EC 3HRZC 1K8AC 1C48A 3AB9A 1TWGH 1IL8A 2VB3X 3BVMA 4DXFA 2OQ0A 2UU9L 4A76A 1QZGA 1K8GA 1SE2A 2N78A 2JXMB 2EY6A 2BDOA 2C5CA 4KJOA 1BBUA 1D1KA 2B3GA 1YI2A 1K73C 3H15A 3CHBD 4A3JG 2L0CA 2LFNA 1S72A 3GTPH 5JPNC 2X69A 1FGUA 1XTCD 4DK1A 4Z9CB 1XNRQ 1T9HA 1IBLL 2PYKA 4DN4M 4MTKA 1TIID 2ZXOA 1IYJB 1E1OA 1SAPA 4OHJA 1STHA 2KCTA 1GD7A 4DR1Q 4DV7L 4FNFA 1V8QA 2CWPA 1V1QA 1CHPD 5I2YA 1LTID 2R92H 2KENA 3URYA 4DFAA 1VQIA 2JJQA 3KF8B 4EX5A 2VZAA 1SNDA 2QDLA 1HNWQ 1PLFA 3KK7A 3I4MG 1HUMA 1YHQA 3UI2A 1K0RA 3J7AF 4A3GG 5KNCA 5FK9C 1K28A 3K5MA 1K3BC 1TKWB 2K28A 2N55A 3CCUA 2UXDL 1VQAA 1X3GA 3SK4A 3M4PA 1CA6A 1HPCA 3J81i 2NBFA 5KIXA 1R4PB 4DR2Q 4A3CH 3RZOB 4UY8C 1Y1VB 4JOIA 4LUVA 4JI7L 4GKKQ 1P8LA 1N36Q 4A3IB 1GO3E 2B63H 3ND9A 2L1BA 1EIFA 5I9OA 3FDTA 3KDFB 3PMFA 2FHTA 3A8IE 1UWVA 4QQBX 1H95A 4A3EB 3ND8A 3HOZB 3NQTA 1FJGL 3TZDA 3LX0A 1EIHA 1OXXK 2R7FA 1LLRD 1HQMC 1TY2A 5M3FH 1SNCA 3KJPA 1PXUA 4C3IG 1NNXA 4GS3A 3S2HB 5D14A 3VR5A 4BY7G 4JI1L 1SJHD 5FJ8G 1PH3A 1HHVA 1BO0A 1I4QA 5IP9H 2KHSA 3T56B 3E9HA 2N88A 2MP1A 2K32A 4GN5A 1HR0Q 1LYLA 4JI0L 2QKIC 1PFBA 1QUQA 2CVRA 1OTCA 4KTAA 4CJ2C 2MJ8A 1YITA 3OWEB 4N9TA 2LXJA 4IZ8A 4C3HH 1KC8C 3F2DA 2X6GA 4LFBQ 1WTQA 4Y7NB 1NJIC 4LF7Q 3DXJC 4I7AA 2XRQD 5M3MB 4OO1G 1EY7A 4N8X1 4PZ8A 2DY7A 2IWHA 2PCFB 1E1TA 5E3FA 1RODA 3LWEA 4C1NI 3KF6A 1B9MA 1H9SA 2F0NA 2UU9Q 1XPUA 3STBD 1TVXA 3KFUA 3J80c 1STGA 2E2DC 1L0XB 2FINB 4GLAC 3CF5A 3NK9A 5KGUA 3K81C 4LWCA 1QE6A 1J8IA 1HTPA 4A3GB 3G6EA 3X3MA 4FYDA 1O78A 1TS4A 3PGZA 1A3VA 4JYAL 1B50A 4IUVA 3TBIB 1IBLQ 1LTTD 2VL6A 3GTOB 5GAEC 1WTOA 4KN4C 3AMUA 1PVOA 2PQAA 5FLMG 5DEHA 4OO1I 5C4XG 2PO4A 3L9AX 4DAYB 4ABNA 4L5QA 3CC4A 3CCQA 1XMQL 2NVQH 5EAYA 3R2IA 2FJ2A 4XQQA 2JA5G 2IX3A 5C3XA 5GAHC 1LTLA 4KD4A 4JK1C 3MAQA 3VA5A 2ASBA 1QCBD 3GTQH 4BXXH 4A3FB 2RF4A 4RGTA 4KHZA 4R8NA 4H13C 3DLLA 4ZUJA 2LMCB 4ZKCB 1SYEA 1U4MA 3I7FA 4CHTB 4JVZA 2UXDQ 3VDYA 4NXML 4JI8L 1L1OB 1Q81C 2NVTB 3WOEA 4GKJQ 1KABA 1X3QA 1SBBB 1YEZA 2G9DA 2SNMA 1HXYD 1EYAA 1QUQB 3BDLA 4JBJA 2K50A 2N3SA 1STEA 3CCVA 4X3TA 4JI7Q 3S1QB 5JJLA 1XX8A 1A0IA 1VF5C 1L0WA 1EQTA 3HOVB 1YZ6A 1M4VA 4DNIA 1QVCA 3T1YL 1TXYA 2XNAC 2R93B 2DJGC 1S5BD 1K8OA 4PMCA 3K7AH 2R92G 1HFNA 1JJCB 4QMGA 4AIMA 2L5TA 2HQLA 5ELOA 2B29A 1FJGQ 2PI2A 1H9SB 3NSWA 1FD7D 2A6EC 3J80L 5M5WB 4IUNA 3E9IA 2MUYA 4HCSA 4JI1Q 1I6VC 2ZTCA 3HG9A 4EQ5A 4DF7A 1D1IA 1AZPA 1YNNC 1P16A 4IPDA 4HMIA 1EEID 1QJOA 1SMXA 4HCEA 4JI0Q 1SRUA 1PRTB 1DZ1A 1F9RA 3RLFA 4GOPC 2PQAB 4DR5L 4HJ9A 4IOAA 4WRDA 3S14B 3HGBA 1HA6A 4J15A 2SEBD 2B63G 2Z6KA 4BY1G 1H9MA 5HURA 4XYOA 1Q82C 1A3UA 3NPPA 3QWNA 1EOTA 3M4OH 5C4XB 1G8ZD 4FF3A 1ZYRD 3KLWA 1E7ZA 2VS1A 2WKCA 1V1PA 2E74C 4R4CA 4QGUA 4ZYSA 5M3FG 2ICEC 1EY4A 2I07B 1HZBA 4JBWA 2R7ZH 1XPRA 3S16B 1AH9A 4CDEC 3CU7A 3NENA 2EXZA 1VQDA 2PW7A 4OWTB 1SFOH 5JOBA 1KIXA 3FKIH 1MIUA 3OMCA 1WJJA 4JYAQ 5IP9G 3QG1A 3S1RH 4QY7A 1KAWA 4OEMB 2H5XA 1Q1EA 1VQHA 5DAUA 1YNJC 4GLXA 3GTPB 2M00A 1UE5A 5IP7H 4WJ4A 2KOLA 1M1KC 2JK8A 4C3HG 2JA6H 4WJWA 2QILA 1XMQQ 1QNUA 3I4NH 4POGA 2VQEL 3EIVA 4KHPL 3MFGA 3SK6A 1GUTA 1AW7A 2YU9H 3HS0C 4UP7A 1NMGA 4PZ7A 5ELCA 1Z9FA 5C5LA 2SDFA 3HOYH 5LHY1 2R92B 2J7ZA 1PH6A 1B3QA 3NBHB 4B3ML 4JI4Q 5IE8A 3SXHA 2AMCB 2OQKA 3FMCA 4K8JA 4Q0FA 5ELBA 4G4KA 1FYCA 5TSSA 3C46A 4NXMQ 3OPOA 1STAA 2PNHA 4HJ5A 1SMYC 4RHSA 5IODA 4OX9L 3IKJA 2RHSB 1F9QA 3U4ZA 5C44G 4JI3L 1RCVD 1ET9A 4KHVA 4X3SA 2A1AA 3T1YQ 1FNUA 1EIYB 3F2UA 4POFA 2RKSA 5CV6A 1NAPA 5FLXc 1X3EA 1Z47A 3L7ZC 3RD4A 2RSOA 4JPBW 4JI5L 3K7UC 2D2CC 4E6IA 1GUNA 1OXVA 2MPMA 3J7YW 4A3MG 1Y69U 1KLUD 2EE1A 1U4RA 1C9OA 2A6HD 1RHPA 1YBYA 4DAMA 2B63B 1E2WA 2D5DA 2NVXH 2C9OA 2KEDA 3CAMA 3CPFA 4HSVA 4BXXG 2YTYA 1AE2A 2ZTDA 1ZXTA 3S9WA 4B3SL 2DNEA 1ICFB 3DWPA 2BH8A 3M4YA 5J22A 2WP8J 4IQZA 5T1IA 2RHQB 3S17H 3PUXA 4IO9A 2VUMB 2B8GA 1FL0A 1IHZA 3PQIA 2J0TD 4MHEA 3H09A 1PDQA 2Q8RE 1SNQA 4U68A 1ICWA 1PH5A 3M3YB 4DR5Q 4O0AA 4LFCL 1XMOL 1YJNA 5C6AA 1FR3A 4BBRB 4YWMA 1GOZA 1A15A 3GTKH 3KLSX 2K1BA 3I70A 2F1MA 1X9NA 2BDNA 3FPPA 1EL0A 2RDHA 1JICA 4C2MH 3C2PA 3MWYW 4NDXA 4QUCA 4LF8L 3PUYA 4C3HB 1F9PA 2F0VA 1JMCA 1TWHH 1GXDC 3W2DA 1S5FD 3OIQA 2KEEA 2JSOA 3J81j 3UDXA 5I6WA 4A3DB 3K0YA 4KKUA 3SR1A 5IYCH 3WWVA 3T1HL 3AEVA 1JR0D 5FKAC 3MXNA 2A74C 4BY7H 1SROA 1F2YA 4GNXC 3PSIA 5IIFA 1SE8A 2CH4A 1MGSA 2KHIA 3K6OA 2WB1G 3T51B 1PRTD 2O4XA 4XQNA 4HMJA 2XWBB 3CQZH 1D8LA 1JB3A 1I4HA 4DV2L 2YV5A 4JI6L 4L63B 2XIWA 4DK3C 3FRPB 2VQEQ 5FLXL 4KHPQ 1H9RA 3NTHA 1MJCA 4K0KQ 3BS1A 5LL6X 3VR3A 3GTLH 5M5XH 4DR4L 1G91A 1U4PA 2K5VA 1CTMA 4GOPA 1VS0A 2LSSA 2NZOA 1Z7TA 2NVQB 1WI5A 4B3MQ 4JI2L 2PZWA 2I5HA 3PUZA 1I94L 1EQRA 1OXTA 1IZ6A 2R7ZG 2UUCL 1X54A 2BA1A 3L2PA 1CFMA 1VCIA 3IFTA 1JCKB 4M1UB 3PIO3 5J39A 3ITPA 1RTNA 3GTQB 2OCEA 1PA6A 3BJUA 4F8MA 4PQXA 5IYBH 1X6OA 1MKHA 4OX9Q 1IBML 2K7VA 1O7YA 1LO5D 1PTOB 2R61A 1QILA 2L55A 1A8VA 3GV3A 4FXKC 1FGBD 3K8AA 2UUBL 3MVVA 4O2DA 5M5YH 3FP9A 5HY6A 3TQYA 4ME3A 5IGFA 5IP7G 4LFAL 1EYDA 2JA6G 1XTDA 3I4NG 5L37A 4M8AA 3E5SA 4JI5Q 1KQSA 1BVSA 3S2DH 1VQ4A 4DR6L 2L4NA 2E2JH 3K5NA 2AWNA 3D4RA 2JA5H 1O80A 3HOYG 2CQOA 5LMUL 3K7AB 1PZID 1E22A 4B3SQ 1XNQL 3WDNA 1VMCA 2DN8A 4DV5L 1YJ9A 1W2BA 1E24A 2HCCA 5E4WC 3NQIA 2B2UA 3MXNB 2CWAA 3EQLC 5C4JH 4R4OA 4TVAB 5LMNW 4HEDA 2K5HA 1KD1C 1PYWD 2K6AA 3DEPA 1HFGA 3NP8A 5BR8Q 2GA4B 3C1FA 1C8CA 4OIJA 4LFCQ 1XMOQ 4RHRA 2RCNA 3CCEA 2HUGA 3D6CA 4BWGB 2NZ1D 1W6JA 3VYUA 2EYPA 5KEEA 2K5WA 5CV9A 2K33A 5T1GA 1S3OA 2WB1B 5DNFA 3ICEA 3FEWX 2JEBI 1BNZA 3ERSX 3TP5A 4LF8Q 2FXQA 2EQSA 4GN4B 4GOPB 3HOWG 1A2UA 4NKLA 5A2QL 4DXGA 3JAML 2KJXA 4LF6L 2OEOA 1WD0A 2MHVA 4A3BH 3P20A 3M4OB 2A69C 4OONA 3CCMA 3MXGA 1KAAA 1ML0D 3I72A 3CRLC 1SDFA 2XSCA 4DNRB 3T1HQ 1Y14B 2SOBA 2NN6G 3I73A 4G7ZC 2PMZE 1HJPA 2N49A 3VR6A 1NY4A 2Z0SA 4L6TB 2R7ZB 2F0FA 1GHJA 2K75A 3RR5A 4RGOS 3P1HA 4H7BA 3V96A 4MIUA 4A3KH 3MA2B 5C0XJ 3KJOA 1SFOB 3FKIB 3HOUH 3A8JE 3CPWA 1EQQA 4JI6Q 2KA7A 4FVMA 5ELEA 1QVFA 2K03A 4YWKA 3S1RB 4Y52H 2YYZA 5DLQE 5G3LD 3Q22A 1BKBA 4ZCKA 1D5XC 4JC0A 1CKMA 3QJYA 1DM0B 4DR4Q 4BY1H 1SYGA 2VB2X 3CXCA 1C0AA 3ERQA 1EY6A 4OIKA 4P72A 1HZ9A 1NR2A 2RBMA 3FVQA 3I4NB 4JI2Q 2OTLA 4RAUC 1I94Q 4K5VA 3UDIA 2UUCQ 1TWAH 2YU9B 1Q8KA 4K6LA 3D3RA 4BA2I 4L5TA 1M8AA 2JA9A 5IYCG 1N33L 1G51A 2WFWA 1BDOA 2NWGA 4A93H 2BCOA 1IBMQ 4EQOA 1VDZA 2EYJA 1VQMA 4XTCS 1EYCA 5CBAE 5JVG3 4K8IA 2UUBQ 1TS5A 1Y8PB 2Q2TA 3GTGH 2ALYB 4C3JH 1N32Q 3DUZA 4AYBG 1HA5A 3TS2A 1II3A 4RKLA 3NELA 1A2TA 4A3JB 4X6AH 1B70B 3OTOL 3H91A 3S1MH 4GNXA 3D4DA 3A5ZB 1V1OA 2EDGA 1B9NA 2FFKB 1VQ6A 2F0MA 3KBXA 2YTXA 1BCPC 1XNQQ 4ZKBB 4DV5Q 5JJKA 3CMAA 1CKNA 2LXKA 1VQGA 4Q5VA 3D31A 3SK8A 3CP0A 5C5MA 1BOSA 3SVMA 2Q2UA 4B9XA 3UE1A 3T4AC 2E8GA 5IYBG 1G2TA 3DHQA 2SNSA 3C3LA 2DY8A 2WKDA 3TDQA 2EY2A 3I4MB 1I3QH 1PTOD 2GVBA 4V0BA 1SNPA 3NHHA 5JVH3 4LF4L 3S17B 1RJTA 4LNQA 5H1SE 3AQQA 3H94A 4XT3B 4QF4A 1Q7YC 5BN4A 3J7ZC 5IGCA 1Q3LA 5C44H 4NPSA 3T53B 2HIXA 2JA7G 4K14A 4DV7Q 4TSSA 2PI2E 2JA8H 1STBA 3RUZA 3TREA 2LY7A 1WCMG 2B2TC 5FO9B 4LF6Q 4A3MH 3TMEA 4IFDJ 3HP3A 3RLNA 2X6LA 4C2MB 1CA5A 1HNZL 4YHHL 1HR0W 3HKZG 2F0JA 2EZVA 4IFDG 3P75A 2GVAA 2P5ZX 3I8ZA 4FO2A 1ZEQX 1KDAA 5F2DA 3STBC 2RDGA 4IUUA 3TZUA 1BBXC 1PFMA 3BZCA 2K01A 4HIMA 1L0YB 2A6ED 1VQ7A 1HCZA 4K6DA 1QG7A 3UE0A 4C3IB 4X66L 4DAPA 2VY3A 1SYFA 1PH8A 4BY7B 4OGQC 2PMZB 2F4VL 1L2FA 2IPKD 4NP5A 1HZAA 1DYQA 1LTAD 5EKIA 1AN8A 1YNND 1EU3A 3PIP3 4DU9A 3J81c 2RSNA 1NR4A 1SYBA 4H44C 4GNXB 3CRKC 4O1NA 3CQZB 1I4GA 1LV9A 4DUYL 4ODGA 4IJHA 3I55A 4LUOA 1DCZA 1QNKA 4J6HA 3HZXA 2I46A 2F0SA 1EWIA 1GUWA 4A3BG 1HH2P 3GTLB 3KF6B 4JV5L 2IL8A 1N33Q 1EQVA 2AUJD 5EPJA 1TQOA 5EBDA 1NBWA 4P74A 3PF4A 1RKNA 1XJVA 3GV6A 4P75A 1B44D 4FP5D 4L5RC 2I0QA 2AUKA 1VQPA 1QVGA 2CW0C 4HTHA 4KY5A 1E3PA 4DKAC 1IKLA 2H4OA 4C1NK 4A3KG 1U4LA 2A68C 2IJ0A 3HOUG 3VYSA 1VQLA 2EJGC 2BOSA 2QCPX 2VNUD 2ICIA 5GADC 1CSPA 2K52A 3OTOQ 4HAEA 2PW5A 1ET6A 1X32A 2RCFA 4XIGS 5M5YB 2HCIA 3FHWA 1K9MC 1XYIA 1RF2D 2LS01 1WVLA 3U9SA 3BZKA 1TWCH 1CHQD 4C56C 1DOLA 4HIKA 3I90A 4IUQA 4CKCA 1NCVA 3M85A 4G57A 3IAYA 4AQYL 3S2DB 2M9VA 2KCNA 2E2JB 3V2TA 2N8NA 2JA5B 1PYBA 4EQNA 1GM5A 3M4QA 1VQKA 4A93G 4LK1C 3MHBA 4BS9A 1R4QB 4IUPA 1TWGB 4LF4Q 4L5SA 3EVQA 4OXPA 2UUAL 1JQYD 2K5NA 5AJ3L 1HTLD 3S15H 5IWAL 1E2ZA 4C3JG 1JJ2A 2MQHA 5CYUA 1MI2A 2ZJQA 2QW7A 1JT8A 4MN3A 1S5ED 4CDCC 3J81L 3OW7A 3A0JA 1W3SA 3NWTA 1LT4D 4ULLA 2L15A 3VA7A 1JOOA 3GD7A 3PIOA 3TRZA 2KCCA 5IGEA 1WTVA 1D5ZC 1STNA 4B9WA 2QF7A 1TWFH 1HNZQ 3BG3A 3SEBA 4YHHQ 3L0OA 3PO2H 4PMBA 1OO9B 5FLXE 2JYOA 2GN5A 1EFWA 1JB7A 4R8IA 2AQ2B 4A3BB 1U0LA 1LT3D 5K36G 5I2XA 3BDCA 3D0FA 1C4QA 1SYCA 4RG1A 2AWOA 4JI8Q 3JAMi 3G71A 2KCMA 4EGVA 2ZTEA 4X66Q 3K59A 3F8TA 1JORA 3WOFA 1AE3A 4HIDA 3V05A 1EWCA 5KRUA 2HIVA 4X65L 2F4VQ 1G2SA 1HRJA 3J7A5 3S2HH 4KKTA 1O7ZA 1EY0A 4DPGA 3M7GA 3R2TA 1N8RC 3B6YA 2EY1A 4A3KB 2BE5C 4XYQA 5KNDA 4DUYQ 2JA8G 2O2LD 3HOUB 2E2IH 2F52A 3NE5B 4MZ9A 2ENBA 2Q8TA 1CZGA 1GUGA 1C7YA 4FXDA 3HOWH 1PYSB 3GDEA 4JV5Q 1V1PB 3H0GH 3PV0A 4ZLTF 4BY1B 5GROA 1MSHA 2B2WC 1SXTA 2ZM6L 5IY0A 2FMCA 4NXNL 2B2TA 1I6HH 3RMHA 5BN5A 3U58A 4B08A 1UAPA 1FNVA 5M3MH 2CHBD 1TWAB 1X56A 2NN6H 1G291 3G4SA 1EOVA 3I3CA 4KJNA 5FO7B 4DUZL 5M3FB 4YCUA 3G6JB 3EA6A 1B8AA 2WB1E 4ZAIA 4A93B 3C1EA 1SYDA 1FVIA 3H3VC 1SE4A 5EPKA 4IN3A 3M9BA 1DXMA 1ESFA 1KDCA 1VMPA 3T16A 3UDFA 4C3JB 2EYLA 2KHJA 5C0XH 4R4TA 4A75A 1EEFD 3CCSA 2EYMA 4R4IA 4X64L 2Y0SG 2WACA 3I4OA 4R4QA 1F77A 1Y1WH 2I5LX 2D62A 2ZJPA 3TEHB 2ES2A 3R8BA 1BCPF 3D8GA 3BVGA 3E6ZX 4U673 4LJZC 4JBKA 4GN3B 1VQCA 1XPOA 2HD3A 2JP1A 3BYTB 2CQAA 3ULPA 2UUAQ 1BF4A 5A2QE 1JOKA 4KK7A 5CV8A 5AJ3Q 3JAME 1UEBA 5CMDA 4A3FH 3D4WA 1VQEA 2E76C 5DM73 4PV1C 1L1OC 2ZXPA 1DJRD 1I3QB 5D65A 1JWUD 2Z8LA 5ISRA 1HNWL 1IW7D 5EKKA 1VQFA 3HOXH 2EOTA 2F0TA 1GUOA 5C44B 2EJFC 4UP8A 4DR7L 4XT1B 2IW3A 3I2ZA 2Z4HA 4HJ8A 1KDBA 2JA8B 3CC7A 4IPHA 1O7LA 1IKMA 4YCWA 1TS2A 3HOVH 4CJ1B 1VQ8A 2AKWB 5IGBA 1BR9A 4A3MB 1S40A 1N9WA 4L8JA 2UXBL 4RA8A 1Q90A 3K57A 4LW1A 3Q0AA 1X65A 2RA4A 2OWOA 4GKKL 2D0OA 2EIFA 4X65Q 2AQ1B 1T5EA 1JWSD 1PH1A 2K05A 1UNSA 1B3AA 2NTSA 5JAVA 2VQFL 4RMFA 4JI3Q 5ELNA 2IX0A 2KBNA 1S5DD 3OHXC 3TS0A 3NTIA 5JEAJ 4UAIA 4ME5A 2JA7H 4XDXA 2F0GA 1K8MA 1LT6D 1S4ZA 1LT5D 5IYDG 1WCMH 1I4RA 3EROA 5JEAG 1VF7A 1ILQA 5CORA 3AFPA 5CV7A 1Q46A 1E0BA 1SNOA 1GUSA 1GVPA 5J3BA 1Y1VG 2OXPA 3E0EA 3S14H 2ZXRA 3N52A 4TKOB 2ZM6Q 1N34L 2VXWA 3PO2G 3BZDB 4A3IG 1CM9A 4NXNQ 1HR0L 3ONAB 3U50C 2Y0SB 2WAQE 3H6MA 4IFDH 3P7JA 1PZJD 1JE4A 2F0IA 4LUZA 2R7DA 3Q23A 1J5EL 4DUZQ 3HOZG 3GP7A 1EZ8A 2AHOB 1UE1A 4LFBL 1VQ9A 4F87A 2A69D 3NTKA 1TT2A 4H02A 3VYTA 1AFPA 4LF7L 2XGTA 3KDFA 3U4VA 3J80i 2Q2HA 2G9HD 1YHAA 3I4LA 4CKBA 3MTSA 1M90C 5KNBA 4RCNA 2OTJA 3ULJA 4O42A 2Q8IB 5GQOA 4DV4L 2B2VC 5IT9c 1QZHA 1EY8A 4X64Q 3HKSA 3HEJA 2EPBA 2D9UA 4QIWE 5IOCA 1W6KA 3H0GG 2XRSD 1TWCB 4ZRZA 1X3PA 4P71A 2NTTA 2JN4A 5M3MG 2A8VA 4BA1I 4UDUC 1DONA 2WAQG 3D6WA 1UUPA 5CC4A 3K58A 1VQ5A 3PIPA 1K83H 3NEMA 2TMPA 5C3EH 2B2WA 2EXDA 1SJED 4AYBE 1KTKA 1CI3M 3BU2A 4XXEA 4DV2Q 2OT2A 3OSOA 4CJ0B 3S15B 2E75C 2Z1CA 2KUMA 4N8FA 4NW2A 5C0XG 2BH2A 4X62L 4J8QA 4DR7Q 4ILWA 5EQ0A 3A56A 1SR3A 3RN2A 4CDFC 3MZ5A 2Z6KC 5A35A 1YJWA 1WD1A 1PH4A 2JA6B 1UEAB 5I4DA 2EYHA 2L9HA 3E0JA 1Y1WG 1SSOA 4GKJL 2NN6I 3CCRA 3KOJA 2TSSA 4F7XA 2UXBQ 4CKEA 2L12A 2B2YC 3F2CA 1AZQA 4X3KA 4JBMA 1F2MA 1SEBD 2WINB 1F2ZA 1TWFB 3RLOA 4DK6C 4A4IA 3PO2B 3PCOB 3PUWA 4PMWA 3HOYB 4FF1A 1BCPD 4DR3L 3OWFA 4DAYA 2MO0A 4KY7A 1MHWC 1JC7A 1CSQA 4A3FG 2FMMA 3H3VI 1ESRA 1RIPA 2VQFQ 1MD2D 4I65A 1V43A 3A5UA 5C0XI 4HJAA 4KY6A 3BYYB 3J80E 4IJLA 1LABA 3EJIA 3VR2A 5HGQA 4RKBA 1BBWA 4RH6A 4LFAQ 2VUMH 4DA2A 2ATWA 1EU4A 2XN9C 2JEAI 3X3NA 4KMUC 3HOXG 1I50H 4UHVA 1B1ZA 5IT9L 3W3AA 3M3YH 2IT1A 2E5LL 3PO3H 1LACA 2E2HH 4DR6Q 1LUZA 1MBYA 4P73A 1GHKA 4BBRH 1ENFA 3KLSA 1ASYA 1N34Q 1L1OA 4TQUS 2E2IB 3HOVG 2PZTA 5LMUQ 4FXGC 2HQEA 2R93G 1PFNA 4R9WA 2F3WA 2IHEA 3S24A 3HKZE 4YIJA 3W5OA 4KV6A 4BBSH 2MGSA 3HOWB 1IYVA 1HUNA 2A5HA 3H0GB 2CKZB 2NVYH 1J5EQ 4J1MA 3A55A 5ELFA 2NVXB 3IL8A 3M7NA 5K36H 3GTJH 1I6HB 1LM0A 1STYA 2KVMA 1PH9A 3FPUB 3MXUA 3ZYYX 4UPAA 1R9TH 4A3DH 1IBKL 2WAQB 3BDOA 5I9PA 4JW0A 5CV5A 4X3UA 4KD3A 2IX1A 4HJ7A 2DJFC 3E3XA 1K0SA 5GAGC 2JE6I 5C4HA 2Q2IA 2HT1A 2DUDA 1JWMD 3AYHB 4DV4Q 3L3OC 1EYGA 4IPCA 1CK1A 4WFN3 3MEHA 3OMGA 1EWHA 3GTKB 3GTMH 3NUCA 2EJMA 2IHFA 3CC2A 5FOBB 1WTPA 3DM3A 3EFXD 4DGZA 5ELDA 2NZHA 1B4OA 3T13A 2MNAA 3J81E 5HGTA 1EFID 2DNCA 3RNUA 2QDBA 1KL9A 2F0QA 4CGYB 1QOHA 5CGKA 2Z9HA 4DK0A 3EBEA 3MEFA 1Y1WB 3SHLA 1NTGA 2KQ3A 4QIWB 1YVCA 2CH4W 4DNTB 2ZJRA 1TWHB 1LTSD 2IY5B 1WFQA 1EUJA 1UE6A 4OL7A 3LWUA 3MFYA 5EPLA 3Q8DA 1G6ZA 2K14A 2OF1A 3K80C 4EQPA 1Q8IA 1WOCA 2F0KA 1SN8A 2WIIB 1IXRA 1PTOC 3U9OA 1PFSA 2HDLA 1OXUA 1BQQT 2PQEA 2CW0D 5EKLA 1PTOH 4X62Q 3QIAA 4YY3L 4JI4L 4FF4A 1Q12A 3CD6A 1RD9D 1NUCA 1WTRA 4AYBB 2A68D 2F4IA 1CQFA 3NWSA 5CBEE 1E2VA 2B39A 2EYOA 1EZ6A 3HOXB 3S1NH 1YIJA 4LF5L 4IFDI 1Y8NB 4DV3L 1CKNB 1CT1D 3A7AB 4DAVA 4EVOA 2C35B 5M5XB 3KLRA 2F0DA 4DV1L 4K5WA 3RZDH 1LTGD 4OWXB 1XXGA 1PV4A 2B2VA 3RN5A 5EJWA 4DR3Q 4RWSC 5EGTA 1PHJA 4GZYC 4FF2A 4ZK9B 4A3LH 1B2TA 2XVSA 3HFZB 5C3EG 1RTOA 1D5MC 1AP0A 1HZCA 1NMFA 3ER0A 4UP9A 1IYUA 5E7NA 2EYFA 1LTRD 2NB0A 3W1BA 3NBHA 3KUPA 2A19A 2E5LQ 1PRTF 3I56A 2JA7B 1YNJD 4AH6A 1WTXA 3TP6A 4K2KA 3K5OA 5NUCA 1WCMB 3AFQA 2I5MX 5IGGA 3QO2A 4A3CG 1I5FA 3F2BA 4B3RL 1TR5A 2YTVA 3R3OA 1YHBA 4ZUIA 2HHHL 2QEXA 5DM63 1KLGD 2PPBC 3OOCA 5J1ZA 1Q86C 1PH2A 4IURA 3QB3A 4HR7B 1IBKQ 3HKZB 3SE0A 2UXCL 2ZT9C 1HQRD 4KLKA 4B3TL 3SGIA 1DGSA 5CR3A 5C4JB 2B2YA 3W1GA 1JE5A 2WV6D 2VUMG 1ASZA 1PMRA 3KBGA 1GJXA 4QUFA 3K5LA 1EIGA 1U9RA 1SMYD 3OIPA 3CCJA 4KKSA 3PO3G 4MTNA 4G7HC 4BBRG 5IYDH 2F0EA 3DEOA 5JEAH 3RZOH 4YCVA 4WJ3M 4I7ZC 2CFMA 2V1CC 2BE5D 2F0UA 1Y1VH 2L11A 2MFIA 4LF9L 3NXWA 5M9OA 3TP8A 4ZQ3A 4BBSG 4A3IH 3MXPA 5K5PA 2K04A 5E1FA 1JOQA 4P2CB 1ZYRC 1U5KA 2R6GA 1RL2A 4ID6A 5LL6S 3O13A 2B2UC 5LMNL 1ZKOA 1MJEA 4XQJA 4OELB 2M2LA 4A3EH 2EY5A 3HOZH 4K0KL 1KXLA 4HN7A 2V4DA 1Y8OB 4A3DG 1X3FA 1KNEA 1CUKA 1ENAA 1K83B 4JCVE 5C4ZA 5JJIA 2F03A 5C3EB 2K5QA 4YY3Q 3GO5A 2O5IC 3UDGA 4RGMA 4YWLA 3SK5A 4DV6L 4DV0L 1ILPA 3A54A 2DGYA 1NE3A 4IALA 4LF5Q 1WYDA 2PZUA 2Y0SE 4DV3Q 4HSPA 4A3JH 1Z6HA 4V190 1H9JA 1DOMA 5JJZA 1PH7A 1KHIA 4DV1Q 1EY5A 4QL5A 5KYLA 1F9SA 2Z6BA 2K5DA 4Y7NH 1KNAA 5AFWA 2K4KA 1F2LA 5D3DA 3G48A 3PF5A 2RQXA 3AU7A 1DOKA 2F0PA 4R1JA 1HNXL 2D0PA 2H1EA 3J7AV 3Q24A 2ID0A 1FNWA 5E4XA 3GQBA 4ALPA 2LKVA 3MC0B 3NBIA 1JJGA 2F0HA 3I4MH 4F88A 4QJFA 3H3VH 3GTGB 4IOCA 1D7QA 4A3GH 2O5JC 4JOIC 1VQOA 3DM1A 2BA0A 1J6QA 4GLVB 1H9KA 2KECA 3SDZA 1I50B 3GTOH 2NUCA 1I4PA 1KRTA 5BR8L 3ULLA 3S1MB 4FDBA 1T5XD 5KYIA 4KN7C 4AQYQ 3PO3B 5G3LF 2E2HB 4G7OC 4B3RQ 2F3IA 4NB3A 2RVLA 4LAAA 5IGDA 3CMEA 2HHHQ 1XNRL 1GKHA 2Z4IA 1SE3A 2A6HC 1TY0A 1XWEA 1KRSA 1A62A 3A7LA 3TN2A 3LGJA 3KYHC 3TP7A 4A3LG 4DR1L 3IRBA 4BBSB 2UXCQ 1K3RA 4PNYA 1BCPB 4H0LC 2NVYB 5IWAQ 4B3TQ 3JC66 3PUVA 5BN3A 3DMUA 1G6PA 1MSGA 2AQ3B 5D3IB 3GTJB 2HDMA 4N9PA 1ONLA 1ENCA 1CQVA 2G5DA 1R9TB 3CCLA 1B7YB 1Q1BA 3CKIB 4MNOA 5JPMC 2MO1A 2NVTH 4C3IH 4RGNA 2QA4A 3Q6SA 2VW9A 3G7LA 5FJ8H 4LMQD 1CZWA 1SLJA 2XWJB 1X55A 3BVZA 3K0XA 1WTWA 1A3TA 4LF9Q 4IUTA 3S1QH 2J4XA 1V9PA 1CKOA 2F0WA 3GTMB 1DD2A 2R93H 3CW2C 3IFDA 1NSNS 1UE7A 4PG3A 3A74A 2R3ZA 4DR2L 4K5XA 2B8FA 5LMNQ 2F3VA 4K2LA 1IL2A 3ZJYC 1OXSC 1N36L 4APVA 1VQJA 5M5WH 2PNRC 1TU2B 4PZ6A 4OO1H 2QGQA 3JAMc 4OWWB 2XTIA 5CV4A 3KF8A 3F1ZA 1WTHA 1TS3A 3OYYA 1D2BA 5I6YA 4CBVA 1PTOF 1PRTC 1BUVT 4DV6Q 4DV0Q
chains in the Genus database with same CATH topology
1I4XA 1QWYA 2EVBA 3DWQA 4RFBA 3N6RA 3VR4A 4KI0A 1IW7C 1S5CD 2NYZD 1J9OA 4RCOA 5COYA 2A73B 2RDFA 1LTBD 3R93A 1A6XA 5EBCA 1B53A 2QEJC 1AEXA 3S1NB 1QB5D 2F0OA 5IT9E 1RDPD 1SNMA 3LNNA 3A8KE 4QB4A 3DWAA 4QCLA 3VYRA 1EY9A 1PZKD 4WORA 2F0LA 1BXTA 3RZDB 4TRDA 5FO8B 3I91A 3TSSA 5C3WA 3QOLA 4S3SA 3QOJA 4NMZA 1D6EC 3HRZC 1C48A 3AB9A 1IL8A 2VB3X 3BVMA 4DXFA 1SE2A 2JXMB 2EY6A 2BDOA 2C5CA 4KJOA 1D1KA 3CHBD 2L0CA 2LFNA 5JPNC 2X69A 1XTCD 4DK1A 4Z9CB 2PYKA 4DN4M 1TIID 2ZXOA 1SAPA 4OHJA 1STHA 4FNFA 1V8QA 1CHPD 5I2YA 1LTID 3URYA 4DFAA 1SNDA 1PLFA 3KK7A 1HUMA 3UI2A 3J7AF 5KNCA 5FK9C 3K5MA 1TKWB 2K28A 2N55A 3SK4A 1CA6A 1HPCA 2NBFA 5KIXA 1R4PB 3RZOB 1Y1VB 4A3IB 3ND9A 2L1BA 5I9OA 3FDTA 3PMFA 2FHTA 3A8IE 4A3EB 3ND8A 3HOZB 3NQTA 3TZDA 3LX0A 1EIHA 1OXXK 1LLRD 1HQMC 1TY2A 1SNCA 1PXUA 4C3IG 3S2HB 5D14A 3VR5A 1SJHD 1HHVA 1BO0A 1I4QA 2KHSA 3T56B 2N88A 2MP1A 2K32A 2QKIC 1PFBA 2CVRA 4KTAA 4CJ2C 2MJ8A 3OWEB 4N9TA 4IZ8A 2X6GA 1WTQA 4Y7NB 3DXJC 2XRQD 5M3MB 4OO1G 1EY7A 2DY7A 2IWHA 2PCFB 5E3FA 1RODA 3LWEA 4C1NI 1B9MA 1H9SA 2F0NA 1TVXA 1STGA 2E2DC 1L0XB 2FINB 3NK9A 5KGUA 1QE6A 1J8IA 1HTPA 4A3GB 3X3MA 4FYDA 1O78A 1TS4A 1A3VA 1B50A 4IUVA 3TBIB 1LTTD 3GTOB 1WTOA 4KN4C 3AMUA 5DEHA 4OO1I 2PO4A 3L9AX 4ABNA 3R2IA 2FJ2A 4XQQA 2IX3A 5C3XA 4KD4A 4JK1C 3MAQA 3VA5A 1QCBD 4A3FB 4RGTA 4KHZA 4R8NA 4H13C 4ZUJA 2LMCB 4ZKCB 1SYEA 1U4MA 4CHTB 2NVTB 3WOEA 1KABA 1X3QA 1SBBB 2G9DA 2SNMA 1HXYD 1EYAA 3BDLA 1STEA 4X3TA 3S1QB 1XX8A 1VF5C 1EQTA 3HOVB 1M4VA 2XNAC 2R93B 1S5BD 1K8OA 4PMCA 1HFNA 4QMGA 2L5TA 1H9SB 3NSWA 1FD7D 2A6EC 3J80L 5M5WB 4IUNA 2MUYA 4HCSA 1I6VC 3HG9A 4DF7A 1D1IA 1AZPA 1YNNC 4HMIA 1EEID 1QJOA 4HCEA 1PRTB 1DZ1A 1F9RA 3RLFA 4WRDA 3S14B 3HGBA 1HA6A 2SEBD 1H9MA 5HURA 4XYOA 1A3UA 3NPPA 3QWNA 1EOTA 5C4XB 1G8ZD 4FF3A 1ZYRD 2WKCA 1V1PA 2E74C 4ZYSA 2ICEC 1EY4A 2I07B 4JBWA 3S16B 3CU7A 2EXZA 2PW7A 5JOBA 3OMCA 3QG1A 1Q1EA 5DAUA 1YNJC 3GTPB 2M00A 2KOLA 4C3HG 4WJWA 2QILA 1QNUA 3MFGA 3SK6A 1GUTA 1AW7A 3HS0C 5ELCA 5C5LA 2SDFA 5LHY1 2R92B 2J7ZA 3SXHA 3FMCA 4K8JA 4Q0FA 5ELBA 4G4KA 1FYCA 5TSSA 3C46A 3OPOA 1STAA 1SMYC 4RHSA 5IODA 3IKJA 1F9QA 1RCVD 1ET9A 4KHVA 4X3SA 1FNUA 3F2UA 2RKSA 5CV6A 1NAPA 1Z47A 3L7ZC 3RD4A 2RSOA 2D2CC 4E6IA 1GUNA 1OXVA 2MPMA 3J7YW 1Y69U 1KLUD 2EE1A 1U4RA 2A6HD 1RHPA 2B63B 1E2WA 2D5DA 2C9OA 2KEDA 4HSVA 1ZXTA 3S9WA 2DNEA 3DWPA 3M4YA 5J22A 2WP8J 4IQZA 5T1IA 3PUXA 2VUMB 2B8GA 1IHZA 2J0TD 4MHEA 3H09A 1PDQA 2Q8RE 1SNQA 4U68A 1ICWA 3M3YB 5C6AA 1FR3A 4BBRB 1GOZA 1A15A 3KLSX 2K1BA 3I70A 2F1MA 2BDNA 3FPPA 1EL0A 2RDHA 1JICA 3C2PA 3MWYW 4NDXA 4QUCA 3PUYA 4C3HB 1F9PA 2F0VA 1GXDC 3W2DA 1S5FD 3OIQA 2KEEA 2JSOA 5I6WA 4A3DB 3K0YA 4KKUA 3SR1A 1JR0D 5FKAC 3MXNA 2A74C 1F2YA 5IIFA 1MGSA 3K6OA 3T51B 1PRTD 2O4XA 4XQNA 4HMJA 2XWBB 1JB3A 1I4HA 4L63B 2XIWA 3FRPB 5FLXL 1H9RA 3NTHA 3BS1A 5LL6X 3VR3A 1G91A 1U4PA 1CTMA 1Z7TA 2NVQB 2PZWA 3PUZA 1OXTA 2BA1A 1CFMA 1VCIA 3IFTA 1JCKB 4M1UB 3PIO3 5J39A 3ITPA 1RTNA 3GTQB 4F8MA 4PQXA 2K7VA 1O7YA 1LO5D 1PTOB 2R61A 1QILA 2L55A 3GV3A 4FXKC 1FGBD 3MVVA 5IGFA 1EYDA 4M8AA 3E5SA 2L4NA 3K5NA 2AWNA 3D4RA 1O80A 3K7AB 1PZID 3WDNA 1VMCA 2DN8A 2HCCA 5E4WC 3NQIA 2B2UA 3EQLC 4HEDA 1PYWD 2K6AA 3DEPA 1HFGA 3NP8A 2GA4B 3C1FA 1C8CA 4OIJA 4RHRA 2HUGA 3D6CA 4BWGB 2NZ1D 1W6JA 3VYUA 2EYPA 5KEEA 2K5WA 5CV9A 2K33A 5T1GA 2WB1B 5DNFA 3FEWX 2JEBI 1BNZA 3TP5A 1A2UA 4NKLA 5A2QL 4DXGA 3JAML 2KJXA 2OEOA 1WD0A 2MHVA 3P20A 3M4OB 2A69C 3MXGA 1KAAA 1ML0D 3I72A 3CRLC 1SDFA 2XSCA 4DNRB 2SOBA 2NN6G 3I73A 4G7ZC 3VR6A 4L6TB 2R7ZB 2F0FA 1GHJA 4RGOS 3P1HA 4H7BA 3V96A 4MIUA 3MA2B 5C0XJ 1SFOB 3FKIB 3A8JE 2KA7A 4FVMA 5ELEA 2K03A 3S1RB 2YYZA 5G3LD 3Q22A 1D5XC 3QJYA 1DM0B 1SYGA 2VB2X 3ERQA 1EY6A 4OIKA 3FVQA 1NR2A 2RBMA 3I4NB 4RAUC 4K5VA 2YU9B 4K6LA 3D3RA 4BA2I 1M8AA 1BDOA 2NWGA 2BCOA 4EQOA 1VDZA 2EYJA 4XTCS 1EYCA 5CBAE 5JVG3 4K8IA 1TS5A 1Y8PB 3DUZA 1HA5A 1II3A 4RKLA 1A2TA 4A3JB 3H91A 3D4DA 1V1OA 2EDGA 1B9NA 2FFKB 2F0MA 3KBXA 1BCPC 4ZKBB 4Q5VA 3D31A 3SK8A 5C5MA 1BOSA 3SVMA 4B9XA 3T4AC 1G2TA 3DHQA 2SNSA 3C3LA 2DY8A 2WKDA 3TDQA 2EY2A 3I4MB 1PTOD 4V0BA 1SNPA 3NHHA 5JVH3 3S17B 1RJTA 3H94A 4XT3B 4QF4A 5BN4A 5IGCA 1Q3LA 3T53B 4K14A 4TSSA 1STBA 3RUZA 2LY7A 2B2TC 5FO9B 3TMEA 4IFDJ 3HP3A 2X6LA 4C2MB 1CA5A 2F0JA 2EZVA 4IFDG 3P75A 3I8ZA 4FO2A 1ZEQX 1KDAA 5F2DA 2RDGA 4IUUA 3TZUA 1BBXC 1PFMA 2K01A 1L0YB 2A6ED 1HCZA 4K6DA 1QG7A 4C3IB 4DAPA 1SYFA 4BY7B 4OGQC 2PMZB 2IPKD 4NP5A 1DYQA 1LTAD 5EKIA 1AN8A 1YNND 1EU3A 3PIP3 4DU9A 2RSNA 1NR4A 1SYBA 4H44C 3CRKC 4O1NA 3CQZB 1I4GA 1LV9A 4ODGA 1DCZA 1QNKA 4J6HA 3HZXA 2I46A 2F0SA 1GUWA 3GTLB 2IL8A 1EQVA 2AUJD 5EPJA 1TQOA 5EBDA 1RKNA 3GV6A 1B44D 4FP5D 2AUKA 2CW0C 4HTHA 4KY5A 1IKLA 2H4OA 4C1NK 1U4LA 2A68C 2IJ0A 3VYSA 2EJGC 2BOSA 2QCPX 2VNUD 2ICIA 4HAEA 2PW5A 1ET6A 1X32A 4XIGS 5M5YB 2HCIA 1XYIA 1RF2D 2LS01 1WVLA 3U9SA 1CHQD 4C56C 1DOLA 3I90A 4IUQA 4CKCA 1NCVA 3M85A 4G57A 3IAYA 3S2DB 2M9VA 2KCNA 2E2JB 3V2TA 2JA5B 4EQNA 4LK1C 3MHBA 4BS9A 1R4QB 4IUPA 1TWGB 3EVQA 1JQYD 1HTLD 1E2ZA 4C3JG 5CYUA 1MI2A 4MN3A 1S5ED 3J81L 3OW7A 3NWTA 1LT4D 4ULLA 3VA7A 1JOOA 3GD7A 2KCCA 5IGEA 1WTVA 1D5ZC 1STNA 4B9WA 2QF7A 3BG3A 3SEBA 4PMBA 1OO9B 5FLXE 2JYOA 4R8IA 2AQ2B 4A3BB 1LT3D 5K36G 5I2XA 3BDCA 1C4QA 1SYCA 2AWOA 4EGVA 3K59A 1JORA 3WOFA 3V05A 1EWCA 5KRUA 1G2SA 1HRJA 4KKTA 1O7ZA 1EY0A 3M7GA 3R2TA 2EY1A 4A3KB 2BE5C 4XYQA 5KNDA 2O2LD 3HOUB 3NE5B 2ENBA 2Q8TA 1CZGA 1GUGA 4FXDA 1V1PB 3PV0A 4ZLTF 4BY1B 1MSHA 2B2WC 1SXTA 2FMCA 2B2TA 3RMHA 5BN5A 4B08A 1UAPA 1FNVA 2CHBD 1TWAB 2NN6H 1G291 3I3CA 4KJNA 5FO7B 5M3FB 3G6JB 3EA6A 4ZAIA 4A93B 3C1EA 1SYDA 3H3VC 1SE4A 5EPKA 4IN3A 1DXMA 1ESFA 1KDCA 1VMPA 3T16A 4C3JB 2EYLA 5C0XH 1EEFD 2EYMA 2WACA 1F77A 2D62A 3R8BA 1BCPF 3D8GA 3BVGA 3E6ZX 4U673 4LJZC 2JP1A 3BYTB 2CQAA 1BF4A 5A2QE 1JOKA 4KK7A 5CV8A 3JAME 5CMDA 3D4WA 2E76C 5DM73 4PV1C 2ZXPA 1DJRD 1I3QB 5D65A 1JWUD 2Z8LA 5ISRA 1IW7D 5EKKA 2EOTA 2F0TA 1GUOA 5C44B 2EJFC 4XT1B 2IW3A 2Z4HA 1KDBA 2JA8B 1O7LA 1IKMA 1TS2A 4CJ1B 5IGBA 1BR9A 4A3MB 4L8JA 4RA8A 1Q90A 3K57A 3Q0AA 2RA4A 2AQ1B 1T5EA 1JWSD 2K05A 1UNSA 1B3AA 2NTSA 5JAVA 2IX0A 1S5DD 3OHXC 3NTIA 5JEAJ 4UAIA 4ME5A 4XDXA 2F0GA 1K8MA 1LT6D 1S4ZA 1LT5D 1I4RA 3EROA 5JEAG 1VF7A 1ILQA 5CORA 5CV7A 1SNOA 1E0BA 1GUSA 2OXPA 2ZXRA 3N52A 4TKOB 2VXWA 3BZDB 1CM9A 3ONAB 2Y0SB 3H6MA 4IFDH 3P7JA 1PZJD 1JE4A 2F0IA 3Q23A 3GP7A 1EZ8A 4F87A 2A69D 3NTKA 1TT2A 3VYTA 1AFPA 2G9HD 3I4LA 4CKBA 3MTSA 5KNBA 4RCNA 4O42A 2Q8IB 2B2VC 1EY8A 3HEJA 2EPBA 2D9UA 5IOCA 1W6KA 2XRSD 1TWCB 4ZRZA 1X3PA 2NTTA 4BA1I 4UDUC 1DONA 3D6WA 1UUPA 5CC4A 3K58A 2TMPA 2B2WA 1SJED 1KTKA 1CI3M 4XXEA 2OT2A 3OSOA 4CJ0B 3S15B 2E75C 2Z1CA 2KUMA 4NW2A 5C0XG 4J8QA 4ILWA 5EQ0A 3A56A 3MZ5A 5A35A 1WD1A 2JA6B 1UEAB 5I4DA 2EYHA 2L9HA 3E0JA 1SSOA 2NN6I 2TSSA 4F7XA 4CKEA 2L12A 2B2YC 1AZQA 4X3KA 1F2MA 1SEBD 2WINB 1F2ZA 1TWFB 3PO2B 3PUWA 4PMWA 3HOYB 4FF1A 1BCPD 3OWFA 4DAYA 4KY7A 1JC7A 2FMMA 1ESRA 1MD2D 4I65A 1V43A 5C0XI 4KY6A 3BYYB 3J80E 1LABA 3EJIA 3VR2A 4RKBA 4RH6A 4DA2A 1EU4A 2XN9C 2JEAI 3X3NA 4KMUC 1B1ZA 5IT9L 3W3AA 2IT1A 1LACA 1MBYA 1GHKA 1ENFA 3KLSA 4TQUS 2E2IB 2PZTA 4FXGC 2HQEA 1PFNA 4R9WA 2F3WA 4YIJA 4KV6A 2MGSA 3HOWB 1IYVA 1HUNA 2A5HA 3H0GB 4J1MA 3A55A 5ELFA 2NVXB 3IL8A 3M7NA 5K36H 1I6HB 1STYA 2KVMA 3FPUB 3MXUA 3ZYYX 2WAQB 3BDOA 5I9PA 5CV5A 4X3UA 4KD3A 2IX1A 2JE6I 5C4HA 1JWMD 3L3OC 1CK1A 4WFN3 3MEHA 3OMGA 1EWHA 3GTKB 3NUCA 2EJMA 5FOBB 1WTPA 3EFXD 4DGZA 5ELDA 1B4OA 3T13A 3J81E 5HGTA 1EFID 2DNCA 2QDBA 2F0QA 4CGYB 1QOHA 5CGKA 4DK0A 1Y1WB 3SHLA 2KQ3A 4QIWB 4DNTB 1TWHB 1LTSD 4OL7A 3LWUA 3MFYA 5EPLA 1G6ZA 2OF1A 4EQPA 1Q8IA 2F0KA 2WIIB 1PTOC 3U9OA 2HDLA 1OXUA 1BQQT 2PQEA 2CW0D 5EKLA 1PTOH 3QIAA 4FF4A 1Q12A 1RD9D 1NUCA 1WTRA 4AYBB 2A68D 2F4IA 1CQFA 3NWSA 5CBEE 1E2VA 2B39A 2EYOA 1EZ6A 3HOXB 4IFDI 1Y8NB 1CT1D 3A7AB 4DAVA 4EVOA 5M5XB 3KLRA 2F0DA 4K5WA 1LTGD 1XXGA 2B2VA 5EJWA 4RWSC 5EGTA 4GZYC 4FF2A 4ZK9B 1B2TA 2XVSA 1RTOA 1D5MC 1AP0A 1IYUA 2EYFA 1LTRD 2NB0A 3NBHA 3KUPA 1PRTF 2JA7B 1YNJD 1WTXA 3TP6A 4K2KA 3K5OA 5NUCA 1WCMB 5IGGA 3QO2A 1TR5A 3R3OA 4ZUIA 5DM63 1KLGD 2PPBC 3OOCA 5J1ZA 4IURA 3QB3A 4HR7B 3HKZB 3SE0A 2ZT9C 1HQRD 5CR3A 5C4JB 2B2YA 2WV6D 1PMRA 3KBGA 1GJXA 4QUFA 3K5LA 1EIGA 1U9RA 1SMYD 3OIPA 4KKSA 4G7HC 2F0EA 3DEOA 5JEAH 4I7ZC 2BE5D 2F0UA 2L11A 3NXWA 5M9OA 3TP8A 4ZQ3A 3MXPA 5K5PA 2K04A 5E1FA 1JOQA 4P2CB 1ZYRC 2R6GA 4ID6A 5LL6S 3O13A 2B2UC 1ZKOA 4XQJA 2M2LA 2EY5A 4HN7A 2V4DA 1Y8OB 1KNEA 1ENAA 1K83B 5C4ZA 2F03A 5C3EB 2K5QA 3GO5A 2O5IC 4RGMA 3SK5A 1ILPA 3A54A 4IALA 2PZUA 4HSPA 1Z6HA 4V190 1H9JA 1DOMA 5JJZA 1EY5A 5KYLA 1F9SA 2K5DA 1KNAA 5AFWA 1F2LA 5D3DA 2RQXA 3AU7A 1DOKA 2F0PA 2H1EA 3J7AV 3Q24A 2ID0A 1FNWA 5E4XA 3GQBA 2LKVA 3MC0B 3NBIA 2F0HA 4F88A 3GTGB 2O5JC 3DM1A 2BA0A 1H9KA 2KECA 3SDZA 1I50B 2NUCA 1I4PA 3S1MB 1T5XD 5KYIA 4KN7C 3PO3B 4G7OC 5G3LF 2E2HB 2RVLA 4LAAA 5IGDA 2Z4IA 1SE3A 2A6HC 1TY0A 1XWEA 3A7LA 3TN2A 3TP7A 4BBSB 4PNYA 1BCPB 4H0LC 2NVYB 3PUVA 5BN3A 3DMUA 1MSGA 2AQ3B 5D3IB 3GTJB 2HDMA 4N9PA 1ONLA 1ENCA 1CQVA 1R9TB 1Q1BA 3CKIB 5JPMC 4RGNA 3Q6SA 3G7LA 4LMQD 1CZWA 2XWJB 3BVZA 1WTWA 1A3TA 4IUTA 2J4XA 3GTMB 2F0WA 1DD2A 3IFDA 1NSNS 2R3ZA 4K5XA 2B8FA 2F3VA 4K2LA 1OXSC 2PNRC 1TU2B 4OO1H 5CV4A 3KF8A 1TS3A 1D2BA 5I6YA 4CBVA 1PTOF 1PRTC 1BUVT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BNZ A;  2FMM A;  4X3S A;  1DZ1 A;  1F9R A;  1ESR A;  2FFK B;  2JYO A;  1GUW A;  1B50 A;  3F2U A;  2IL8 A;  4IUV A;  3KBX A;  2JP1 A;  2NYZ D;  1J9O A;  4R8I A;  2HDL A;  4ZKB B;  1BF4 A;  5COY A;  5EPJ A;  1NAP A;  3DM1 A;  4QUF A;  1CA6 A;  1EIG A;  1WTO A;  1WD0 A;  5CMD A;  1HA6 A;  2RSO A;  2KEC A;  3R93 A;  2MPM A;  3GV6 A;  1U4P A;  3SVM A;  1G91 A;  1B53 A;  1WTR A;  3MTS A;  2EE1 A;  1U4R A;  3DEO A;  1ML0 D;  5CBE E;  1RHP A;  1EOT A;  1SDF A;  5D65 A;  1G2T A;  2RVL A;  1G2S A;  1IKL A;  2DY8 A;  2KED A;  1HRJ A;  2FJ2 A;  1U4L A;  4HSV A;  2L11 A;  1O7Z A;  4O42 A;  2L1B A;  1ZXT A;  2B2V C;  1RTN A;  2EOT A;  1RJT A;  3FDT A;  2K04 A;  3TN2 A;  4XT3 B;  2EPB A;  5T1I A;  3I91 A;  2FHT A;  4HAE A;  2D9U A;  1PFN A;  4XT1 B;  1O7Y A;  1Q3L A;  1X32 A;  4R9W A;  2B2V A;  2HCI A;  4MHE A;  2B2U C;  3TZD A;  3GV3 A;  5EJW A;  1IKM A;  1EIH A;  2MGS A;  1PDQ A;  2M2L A;  2K03 A;  4RWS C;  2Q8T A;  4ZKC B;  1U4M A;  1XYI A;  1HUN A;  2Q8R E;  1WVL A;  1G6Z A;  1MSG A;  4ZK9 B;  4CJ1 B;  1B2T A;  1X3P A;  1ICW A;  2B2T C;  4U68 A;  1IL8 A;  1KNE A;  3IL8 A;  2HDM A;  1DOL A;  5D14 A;  4ZLT F;  1RTO A;  1AP0 A;  1MSH A;  3D6W A;  2B2W C;  3I90 A;  4IUQ A;  1A15 A;  4RA8 A;  1DON A;  1HHV A;  2KVM A;  1NCV A;  1X3Q A;  3FPU B;  1BO0 A;  2K28 A;  2K1B A;  3HP3 A;  2B2T A;  2RA4 A;  2BDN A;  2X6L A;  4OIK A;  1EL0 A;  1NR2 A;  3Q6S A;  1CA5 A;  3G7L A;  2L4N A;  4X3U A;  2KOL A;  1JIC A;  4LMQ D;  2B2W A;  2MP1 A;  2N88 A;  2X69 A;  3MWY W;  4RAU C;  4QUC A;  4X3T A;  3KUP A;  1ILP A;  1O80 A;  1XX8 A;  3I3C A;  1PFB A;  1EQT A;  2K05 A;  2CVR A;  1B3A A;  4CJ0 B;  1WTW A;  4IUT A;  3I8Z A;  4CJ2 C;  1F9P A;  2MJ8 A;  4IUP A;  1M8A A;  4ZAI A;  1VMC A;  2KUM A;  4NW2 A;  4DN4 M;  5EPK A;  1SAP A;  1DOM A;  2X6G A;  4IUU A;  1WTX A;  2NWG A;  1PFM A;  5JJZ A;  2K01 A;  1BBX C;  1HFN A;  3IFD A;  4UAI A;  2HCC A;  2KEE A;  1MI2 A;  5E4W C;  1WTQ A;  5EQ0 A;  1VMP A;  1F9S A;  2B2U A;  2SDF A;  1QG7 A;  4XDX A;  2R3Z A;  2J7Z A;  1WTP A;  5CBA E;  4HED A;  4MN3 A;  1S4Z A;  1WD1 A;  1KNA A;  3DEP A;  3QO2 A;  1HFG A;  5AFW A;  1B4O A;  2L9H A;  2DY7 A;  1ILQ A;  5COR A;  1SSO A;  1C8C A;  5EKI A;  1F2L A;  1E0B A;  4OIJ A;  1ROD A;  3LWE A;  4HCS A;  2HUG A;  1TVX A;  3N52 A;  1DOK A;  2L12 A;  2B2Y C;  1NR4 A;  2RSN A;  1AZQ A;  2VXW A;  2NZ1 D;  1LV9 A;  1MGS A;  1PLF A;  4X3K A;  1CM9 A;  1HUM A;  2FIN B;  2H1E A;  4IUR A;  3UI2 A;  1WTV A;  3H91 A;  1AZP A;  1QNK A;  3ONA B;  5E4X A;  5T1G A;  1F9Q A;  1QE6 A;  5DNF A;  5EPL A;  2XIW A;  2B2Y A;  1J8I A;  3P7J A;  1JE4 A;  2N55 A; 
#chains in the Genus database with same CATH topology
 1I4X A;  1QWY A;  2EVB A;  3DWQ A;  3FKI G;  4RFB A;  3N6R A;  3VR4 A;  4KI0 A;  1IW7 C;  1S5C D;  2NYZ D;  1J9O A;  4RCO A;  1VQN A;  5COY A;  2A73 B;  2RDF A;  1A63 A;  1LTB D;  1VQB A;  3R93 A;  1A6X A;  2CCZ A;  5EBC A;  1B53 A;  2QEJ C;  1N32 L;  1AEX A;  2JQO A;  4HIO A;  3S1N B;  1QB5 D;  2F0O A;  5IT9 E;  1RDP D;  1YNX A;  1SNM A;  3LNN A;  3QR8 A;  3A8K E;  4JG2 A;  4QB4 A;  3DWA A;  4QCL A;  3VYR A;  1EY9 A;  5FLM H;  5C4X H;  1PZK D;  3OW2 A;  1O7I A;  4WOR A;  2F0L A;  1BXT A;  4A3E G;  3RZD B;  4TRD A;  1HNX Q;  5FO8 B;  3I91 A;  3TSS A;  5C3W A;  3QOL A;  4S3S A;  3QOJ A;  4NMZ A;  3S16 H;  3EN2 A;  4IPG A;  4CDD C;  1D6E C;  3HRZ C;  1K8A C;  1C48 A;  3AB9 A;  1TWG H;  1IL8 A;  2VB3 X;  3BVM A;  4DXF A;  2OQ0 A;  2UU9 L;  4A76 A;  1QZG A;  1K8G A;  1SE2 A;  2N78 A;  2JXM B;  2EY6 A;  2BDO A;  2C5C A;  4KJO A;  1BBU A;  1D1K A;  2B3G A;  1YI2 A;  1K73 C;  3H15 A;  3CHB D;  4A3J G;  2L0C A;  2LFN A;  1S72 A;  3GTP H;  5JPN C;  2X69 A;  1FGU A;  1XTC D;  4DK1 A;  4Z9C B;  1XNR Q;  1T9H A;  1IBL L;  2PYK A;  4DN4 M;  4MTK A;  1TII D;  2ZXO A;  1IYJ B;  1E1O A;  1SAP A;  4OHJ A;  1STH A;  2KCT A;  1GD7 A;  4DR1 Q;  4DV7 L;  4FNF A;  1V8Q A;  2CWP A;  1V1Q A;  1CHP D;  5I2Y A;  1LTI D;  2R92 H;  2KEN A;  3URY A;  4DFA A;  1VQI A;  2JJQ A;  3KF8 B;  4EX5 A;  2VZA A;  1SND A;  2QDL A;  1HNW Q;  1PLF A;  3KK7 A;  3I4M G;  1HUM A;  1YHQ A;  3UI2 A;  1K0R A;  3J7A F;  4A3G G;  5KNC A;  5FK9 C;  1K28 A;  3K5M A;  1K3B C;  1TKW B;  2K28 A;  2N55 A;  3CCU A;  2UXD L;  1VQA A;  1X3G A;  3SK4 A;  3M4P A;  1CA6 A;  1HPC A;  3J81 i;  2NBF A;  5KIX A;  1R4P B;  4DR2 Q;  4A3C H;  3RZO B;  4UY8 C;  1Y1V B;  4JOI A;  4LUV A;  4JI7 L;  4GKK Q;  1P8L A;  1N36 Q;  4A3I B;  1GO3 E;  2B63 H;  3ND9 A;  2L1B A;  1EIF A;  5I9O A;  3FDT A;  3KDF B;  3PMF A;  2FHT A;  3A8I E;  1UWV A;  4QQB X;  1H95 A;  4A3E B;  3ND8 A;  3HOZ B;  3NQT A;  1FJG L;  3TZD A;  3LX0 A;  1EIH A;  1OXX K;  2R7F A;  1LLR D;  1HQM C;  1TY2 A;  5M3F H;  1SNC A;  3KJP A;  1PXU A;  4C3I G;  1NNX A;  4GS3 A;  3S2H B;  5D14 A;  3VR5 A;  4BY7 G;  4JI1 L;  1SJH D;  5FJ8 G;  1PH3 A;  1HHV A;  1BO0 A;  1I4Q A;  5IP9 H;  2KHS A;  3T56 B;  3E9H A;  2N88 A;  2MP1 A;  2K32 A;  4GN5 A;  1HR0 Q;  1LYL A;  4JI0 L;  2QKI C;  1PFB A;  1QUQ A;  2CVR A;  1OTC A;  4KTA A;  4CJ2 C;  2MJ8 A;  1YIT A;  3OWE B;  4N9T A;  2LXJ A;  4IZ8 A;  4C3H H;  1KC8 C;  3F2D A;  2X6G A;  4LFB Q;  1WTQ A;  4Y7N B;  1NJI C;  4LF7 Q;  3DXJ C;  4I7A A;  2XRQ D;  5M3M B;  4OO1 G;  1EY7 A;  4N8X 1;  4PZ8 A;  2DY7 A;  2IWH A;  2PCF B;  1E1T A;  5E3F A;  1ROD A;  3LWE A;  4C1N I;  3KF6 A;  1B9M A;  1H9S A;  2F0N A;  2UU9 Q;  1XPU A;  3STB D;  1TVX A;  3KFU A;  3J80 c;  1STG A;  2E2D C;  1L0X B;  2FIN B;  4GLA C;  3CF5 A;  3NK9 A;  5KGU A;  3K81 C;  4LWC A;  1QE6 A;  1J8I A;  1HTP A;  4A3G B;  3G6E A;  3X3M A;  4FYD A;  1O78 A;  1TS4 A;  3PGZ A;  1A3V A;  4JYA L;  1B50 A;  4IUV A;  3TBI B;  1IBL Q;  1LTT D;  2VL6 A;  3GTO B;  5GAE C;  1WTO A;  4KN4 C;  3AMU A;  1PVO A;  2PQA A;  5FLM G;  5DEH A;  4OO1 I;  5C4X G;  2PO4 A;  3L9A X;  4DAY B;  4ABN A;  4L5Q A;  3CC4 A;  3CCQ A;  1XMQ L;  2NVQ H;  5EAY A;  3R2I A;  2FJ2 A;  4XQQ A;  2JA5 G;  2IX3 A;  5C3X A;  5GAH C;  1LTL A;  4KD4 A;  4JK1 C;  3MAQ A;  3VA5 A;  2ASB A;  1QCB D;  3GTQ H;  4BXX H;  4A3F B;  2RF4 A;  4RGT A;  4KHZ A;  4R8N A;  4H13 C;  3DLL A;  4ZUJ A;  2LMC B;  4ZKC B;  1SYE A;  1U4M A;  3I7F A;  4CHT B;  4JVZ A;  2UXD Q;  3VDY A;  4NXM L;  4JI8 L;  1L1O B;  1Q81 C;  2NVT B;  3WOE A;  4GKJ Q;  1KAB A;  1X3Q A;  1SBB B;  1YEZ A;  2G9D A;  2SNM A;  1HXY D;  1EYA A;  1QUQ B;  3BDL A;  4JBJ A;  2K50 A;  2N3S A;  1STE A;  3CCV A;  4X3T A;  4JI7 Q;  3S1Q B;  5JJL A;  1XX8 A;  1A0I A;  1VF5 C;  1L0W A;  1EQT A;  3HOV B;  1YZ6 A;  1M4V A;  4DNI A;  1QVC A;  3T1Y L;  1TXY A;  2XNA C;  2R93 B;  2DJG C;  1S5B D;  1K8O A;  4PMC A;  3K7A H;  2R92 G;  1HFN A;  1JJC B;  4QMG A;  4AIM A;  2L5T A;  2HQL A;  5ELO A;  2B29 A;  1FJG Q;  2PI2 A;  1H9S B;  3NSW A;  1FD7 D;  2A6E C;  3J80 L;  5M5W B;  4IUN A;  3E9I A;  2MUY A;  4HCS A;  4JI1 Q;  1I6V C;  2ZTC A;  3HG9 A;  4EQ5 A;  4DF7 A;  1D1I A;  1AZP A;  1YNN C;  1P16 A;  4IPD A;  4HMI A;  1EEI D;  1QJO A;  1SMX A;  4HCE A;  4JI0 Q;  1SRU A;  1PRT B;  1DZ1 A;  1F9R A;  3RLF A;  4GOP C;  2PQA B;  4DR5 L;  4HJ9 A;  4IOA A;  4WRD A;  3S14 B;  3HGB A;  1HA6 A;  4J15 A;  2SEB D;  2B63 G;  2Z6K A;  4BY1 G;  1H9M A;  5HUR A;  4XYO A;  1Q82 C;  1A3U A;  3NPP A;  3QWN A;  1EOT A;  3M4O H;  5C4X B;  1G8Z D;  4FF3 A;  1ZYR D;  3KLW A;  1E7Z A;  2VS1 A;  2WKC A;  1V1P A;  2E74 C;  4R4C A;  4QGU A;  4ZYS A;  5M3F G;  2ICE C;  1EY4 A;  2I07 B;  1HZB A;  4JBW A;  2R7Z H;  1XPR A;  3S16 B;  1AH9 A;  4CDE C;  3CU7 A;  3NEN A;  2EXZ A;  1VQD A;  2PW7 A;  4OWT B;  1SFO H;  5JOB A;  1KIX A;  3FKI H;  1MIU A;  3OMC A;  1WJJ A;  4JYA Q;  5IP9 G;  3QG1 A;  3S1R H;  4QY7 A;  1KAW A;  4OEM B;  2H5X A;  1Q1E A;  1VQH A;  5DAU A;  1YNJ C;  4GLX A;  3GTP B;  2M00 A;  1UE5 A;  5IP7 H;  4WJ4 A;  2KOL A;  1M1K C;  2JK8 A;  4C3H G;  2JA6 H;  4WJW A;  2QIL A;  1XMQ Q;  1QNU A;  3I4N H;  4POG A;  2VQE L;  3EIV A;  4KHP L;  3MFG A;  3SK6 A;  1GUT A;  1AW7 A;  2YU9 H;  3HS0 C;  4UP7 A;  1NMG A;  4PZ7 A;  5ELC A;  1Z9F A;  5C5L A;  2SDF A;  3HOY H;  5LHY 1;  2R92 B;  2J7Z A;  1PH6 A;  1B3Q A;  3NBH B;  4B3M L;  4JI4 Q;  5IE8 A;  3SXH A;  2AMC B;  2OQK A;  3FMC A;  4K8J A;  4Q0F A;  5ELB A;  4G4K A;  1FYC A;  5TSS A;  3C46 A;  4NXM Q;  3OPO A;  1STA A;  2PNH A;  4HJ5 A;  1SMY C;  4RHS A;  5IOD A;  4OX9 L;  3IKJ A;  2RHS B;  1F9Q A;  3U4Z A;  5C44 G;  4JI3 L;  1RCV D;  1ET9 A;  4KHV A;  4X3S A;  2A1A A;  3T1Y Q;  1FNU A;  1EIY B;  3F2U A;  4POF A;  2RKS A;  5CV6 A;  1NAP A;  5FLX c;  1X3E A;  1Z47 A;  3L7Z C;  3RD4 A;  2RSO A;  4JPB W;  4JI5 L;  3K7U C;  2D2C C;  4E6I A;  1GUN A;  1OXV A;  2MPM A;  3J7Y W;  4A3M G;  1Y69 U;  1KLU D;  2EE1 A;  1U4R A;  1C9O A;  2A6H D;  1RHP A;  1YBY A;  4DAM A;  2B63 B;  1E2W A;  2D5D A;  2NVX H;  2C9O A;  2KED A;  3CAM A;  3CPF A;  4HSV A;  4BXX G;  2YTY A;  1AE2 A;  2ZTD A;  1ZXT A;  3S9W A;  4B3S L;  2DNE A;  1ICF B;  3DWP A;  2BH8 A;  3M4Y A;  5J22 A;  2WP8 J;  4IQZ A;  5T1I A;  2RHQ B;  3S17 H;  3PUX A;  4IO9 A;  2VUM B;  2B8G A;  1FL0 A;  1IHZ A;  3PQI A;  2J0T D;  4MHE A;  3H09 A;  1PDQ A;  2Q8R E;  1SNQ A;  4U68 A;  1ICW A;  1PH5 A;  3M3Y B;  4DR5 Q;  4O0A A;  4LFC L;  1XMO L;  1YJN A;  5C6A A;  1FR3 A;  4BBR B;  4YWM A;  1GOZ A;  1A15 A;  3GTK H;  3KLS X;  2K1B A;  3I70 A;  2F1M A;  1X9N A;  2BDN A;  3FPP A;  1EL0 A;  2RDH A;  1JIC A;  4C2M H;  3C2P A;  3MWY W;  4NDX A;  4QUC A;  4LF8 L;  3PUY A;  4C3H B;  1F9P A;  2F0V A;  1JMC A;  1TWH H;  1GXD C;  3W2D A;  1S5F D;  3OIQ A;  2KEE A;  2JSO A;  3J81 j;  3UDX A;  5I6W A;  4A3D B;  3K0Y A;  4KKU A;  3SR1 A;  5IYC H;  3WWV A;  3T1H L;  3AEV A;  1JR0 D;  5FKA C;  3MXN A;  2A74 C;  4BY7 H;  1SRO A;  1F2Y A;  4GNX C;  3PSI A;  5IIF A;  1SE8 A;  2CH4 A;  1MGS A;  2KHI A;  3K6O A;  2WB1 G;  3T51 B;  1PRT D;  2O4X A;  4XQN A;  4HMJ A;  2XWB B;  3CQZ H;  1D8L A;  1JB3 A;  1I4H A;  4DV2 L;  2YV5 A;  4JI6 L;  4L63 B;  2XIW A;  4DK3 C;  3FRP B;  2VQE Q;  5FLX L;  4KHP Q;  1H9R A;  3NTH A;  1MJC A;  4K0K Q;  3BS1 A;  5LL6 X;  3VR3 A;  3GTL H;  5M5X H;  4DR4 L;  1G91 A;  1U4P A;  2K5V A;  1CTM A;  4GOP A;  1VS0 A;  2LSS A;  2NZO A;  1Z7T A;  2NVQ B;  1WI5 A;  4B3M Q;  4JI2 L;  2PZW A;  2I5H A;  3PUZ A;  1I94 L;  1EQR A;  1OXT A;  1IZ6 A;  2R7Z G;  2UUC L;  1X54 A;  2BA1 A;  3L2P A;  1CFM A;  1VCI A;  3IFT A;  1JCK B;  4M1U B;  3PIO 3;  5J39 A;  3ITP A;  1RTN A;  3GTQ B;  2OCE A;  1PA6 A;  3BJU A;  4F8M A;  4PQX A;  5IYB H;  1X6O A;  1MKH A;  4OX9 Q;  1IBM L;  2K7V A;  1O7Y A;  1LO5 D;  1PTO B;  2R61 A;  1QIL A;  2L55 A;  1A8V A;  3GV3 A;  4FXK C;  1FGB D;  3K8A A;  2UUB L;  3MVV A;  4O2D A;  5M5Y H;  3FP9 A;  5HY6 A;  3TQY A;  4ME3 A;  5IGF A;  5IP7 G;  4LFA L;  1EYD A;  2JA6 G;  1XTD A;  3I4N G;  5L37 A;  4M8A A;  3E5S A;  4JI5 Q;  1KQS A;  1BVS A;  3S2D H;  1VQ4 A;  4DR6 L;  2L4N A;  2E2J H;  3K5N A;  2AWN A;  3D4R A;  2JA5 H;  1O80 A;  3HOY G;  2CQO A;  5LMU L;  3K7A B;  1PZI D;  1E22 A;  4B3S Q;  1XNQ L;  3WDN A;  1VMC A;  2DN8 A;  4DV5 L;  1YJ9 A;  1W2B A;  1E24 A;  2HCC A;  5E4W C;  3NQI A;  2B2U A;  3MXN B;  2CWA A;  3EQL C;  5C4J H;  4R4O A;  4TVA B;  5LMN W;  4HED A;  2K5H A;  1KD1 C;  1PYW D;  2K6A A;  3DEP A;  1HFG A;  3NP8 A;  5BR8 Q;  2GA4 B;  3C1F A;  1C8C A;  4OIJ A;  4LFC Q;  1XMO Q;  4RHR A;  2RCN A;  3CCE A;  2HUG A;  3D6C A;  4BWG B;  2NZ1 D;  1W6J A;  3VYU A;  2EYP A;  5KEE A;  2K5W A;  5CV9 A;  2K33 A;  5T1G A;  1S3O A;  2WB1 B;  5DNF A;  3ICE A;  3FEW X;  2JEB I;  1BNZ A;  3ERS X;  3TP5 A;  4LF8 Q;  2FXQ A;  2EQS A;  4GN4 B;  4GOP B;  3HOW G;  1A2U A;  4NKL A;  5A2Q L;  4DXG A;  3JAM L;  2KJX A;  4LF6 L;  2OEO A;  1WD0 A;  2MHV A;  4A3B H;  3P20 A;  3M4O B;  2A69 C;  4OON A;  3CCM A;  3MXG A;  1KAA A;  1ML0 D;  3I72 A;  3CRL C;  1SDF A;  2XSC A;  4DNR B;  3T1H Q;  1Y14 B;  2SOB A;  2NN6 G;  3I73 A;  4G7Z C;  2PMZ E;  1HJP A;  2N49 A;  3VR6 A;  1NY4 A;  2Z0S A;  4L6T B;  2R7Z B;  2F0F A;  1GHJ A;  2K75 A;  3RR5 A;  4RGO S;  3P1H A;  4H7B A;  3V96 A;  4MIU A;  4A3K H;  3MA2 B;  5C0X J;  3KJO A;  1SFO B;  3FKI B;  3HOU H;  3A8J E;  3CPW A;  1EQQ A;  4JI6 Q;  2KA7 A;  4FVM A;  5ELE A;  1QVF A;  2K03 A;  4YWK A;  3S1R B;  4Y52 H;  2YYZ A;  5DLQ E;  5G3L D;  3Q22 A;  1BKB A;  4ZCK A;  1D5X C;  4JC0 A;  1CKM A;  3QJY A;  1DM0 B;  4DR4 Q;  4BY1 H;  1SYG A;  2VB2 X;  3CXC A;  1C0A A;  3ERQ A;  1EY6 A;  4OIK A;  4P72 A;  1HZ9 A;  1NR2 A;  2RBM A;  3FVQ A;  3I4N B;  4JI2 Q;  2OTL A;  4RAU C;  1I94 Q;  4K5V A;  3UDI A;  2UUC Q;  1TWA H;  2YU9 B;  1Q8K A;  4K6L A;  3D3R A;  4BA2 I;  4L5T A;  1M8A A;  2JA9 A;  5IYC G;  1N33 L;  1G51 A;  2WFW A;  1BDO A;  2NWG A;  4A93 H;  2BCO A;  1IBM Q;  4EQO A;  1VDZ A;  2EYJ A;  1VQM A;  4XTC S;  1EYC A;  5CBA E;  5JVG 3;  4K8I A;  2UUB Q;  1TS5 A;  1Y8P B;  2Q2T A;  3GTG H;  2ALY B;  4C3J H;  1N32 Q;  3DUZ A;  4AYB G;  1HA5 A;  3TS2 A;  1II3 A;  4RKL A;  3NEL A;  1A2T A;  4A3J B;  4X6A H;  1B70 B;  3OTO L;  3H91 A;  3S1M H;  4GNX A;  3D4D A;  3A5Z B;  1V1O A;  2EDG A;  1B9N A;  2FFK B;  1VQ6 A;  2F0M A;  3KBX A;  2YTX A;  1BCP C;  1XNQ Q;  4ZKB B;  4DV5 Q;  5JJK A;  3CMA A;  1CKN A;  2LXK A;  1VQG A;  4Q5V A;  3D31 A;  3SK8 A;  3CP0 A;  5C5M A;  1BOS A;  3SVM A;  2Q2U A;  4B9X A;  3UE1 A;  3T4A C;  2E8G A;  5IYB G;  1G2T A;  3DHQ A;  2SNS A;  3C3L A;  2DY8 A;  2WKD A;  3TDQ A;  2EY2 A;  3I4M B;  1I3Q H;  1PTO D;  2GVB A;  4V0B A;  1SNP A;  3NHH A;  5JVH 3;  4LF4 L;  3S17 B;  1RJT A;  4LNQ A;  5H1S E;  3AQQ A;  3H94 A;  4XT3 B;  4QF4 A;  1Q7Y C;  5BN4 A;  3J7Z C;  5IGC A;  1Q3L A;  5C44 H;  4NPS A;  3T53 B;  2HIX A;  2JA7 G;  4K14 A;  4DV7 Q;  4TSS A;  2PI2 E;  2JA8 H;  1STB A;  3RUZ A;  3TRE A;  2LY7 A;  1WCM G;  2B2T C;  5FO9 B;  4LF6 Q;  4A3M H;  3TME A;  4IFD J;  3HP3 A;  3RLN A;  2X6L A;  4C2M B;  1CA5 A;  1HNZ L;  4YHH L;  1HR0 W;  3HKZ G;  2F0J A;  2EZV A;  4IFD G;  3P75 A;  2GVA A;  2P5Z X;  3I8Z A;  4FO2 A;  1ZEQ X;  1KDA A;  5F2D A;  3STB C;  2RDG A;  4IUU A;  3TZU A;  1BBX C;  1PFM A;  3BZC A;  2K01 A;  4HIM A;  1L0Y B;  2A6E D;  1VQ7 A;  1HCZ A;  4K6D A;  1QG7 A;  3UE0 A;  4C3I B;  4X66 L;  4DAP A;  2VY3 A;  1SYF A;  1PH8 A;  4BY7 B;  4OGQ C;  2PMZ B;  2F4V L;  1L2F A;  2IPK D;  4NP5 A;  1HZA A;  1DYQ A;  1LTA D;  5EKI A;  1AN8 A;  1YNN D;  1EU3 A;  3PIP 3;  4DU9 A;  3J81 c;  2RSN A;  1NR4 A;  1SYB A;  4H44 C;  4GNX B;  3CRK C;  4O1N A;  3CQZ B;  1I4G A;  1LV9 A;  4DUY L;  4ODG A;  4IJH A;  3I55 A;  4LUO A;  1DCZ A;  1QNK A;  4J6H A;  3HZX A;  2I46 A;  2F0S A;  1EWI A;  1GUW A;  4A3B G;  1HH2 P;  3GTL B;  3KF6 B;  4JV5 L;  2IL8 A;  1N33 Q;  1EQV A;  2AUJ D;  5EPJ A;  1TQO A;  5EBD A;  1NBW A;  4P74 A;  3PF4 A;  1RKN A;  1XJV A;  3GV6 A;  4P75 A;  1B44 D;  4FP5 D;  4L5R C;  2I0Q A;  2AUK A;  1VQP A;  1QVG A;  2CW0 C;  4HTH A;  4KY5 A;  1E3P A;  4DKA C;  1IKL A;  2H4O A;  4C1N K;  4A3K G;  1U4L A;  2A68 C;  2IJ0 A;  3HOU G;  3VYS A;  1VQL A;  2EJG C;  2BOS A;  2QCP X;  2VNU D;  2ICI A;  5GAD C;  1CSP A;  2K52 A;  3OTO Q;  4HAE A;  2PW5 A;  1ET6 A;  1X32 A;  2RCF A;  4XIG S;  5M5Y B;  2HCI A;  3FHW A;  1K9M C;  1XYI A;  1RF2 D;  2LS0 1;  1WVL A;  3U9S A;  3BZK A;  1TWC H;  1CHQ D;  4C56 C;  1DOL A;  4HIK A;  3I90 A;  4IUQ A;  4CKC A;  1NCV A;  3M85 A;  4G57 A;  3IAY A;  4AQY L;  3S2D B;  2M9V A;  2KCN A;  2E2J B;  3V2T A;  2N8N A;  2JA5 B;  1PYB A;  4EQN A;  1GM5 A;  3M4Q A;  1VQK A;  4A93 G;  4LK1 C;  3MHB A;  4BS9 A;  1R4Q B;  4IUP A;  1TWG B;  4LF4 Q;  4L5S A;  3EVQ A;  4OXP A;  2UUA L;  1JQY D;  2K5N A;  5AJ3 L;  1HTL D;  3S15 H;  5IWA L;  1E2Z A;  4C3J G;  1JJ2 A;  2MQH A;  5CYU A;  1MI2 A;  2ZJQ A;  2QW7 A;  1JT8 A;  4MN3 A;  1S5E D;  4CDC C;  3J81 L;  3OW7 A;  3A0J A;  1W3S A;  3NWT A;  1LT4 D;  4ULL A;  2L15 A;  3VA7 A;  1JOO A;  3GD7 A;  3PIO A;  3TRZ A;  2KCC A;  5IGE A;  1WTV A;  1D5Z C;  1STN A;  4B9W A;  2QF7 A;  1TWF H;  1HNZ Q;  3BG3 A;  3SEB A;  4YHH Q;  3L0O A;  3PO2 H;  4PMB A;  1OO9 B;  5FLX E;  2JYO A;  2GN5 A;  1EFW A;  1JB7 A;  4R8I A;  2AQ2 B;  4A3B B;  1U0L A;  1LT3 D;  5K36 G;  5I2X A;  3BDC A;  3D0F A;  1C4Q A;  1SYC A;  4RG1 A;  2AWO A;  4JI8 Q;  3JAM i;  3G71 A;  2KCM A;  4EGV A;  2ZTE A;  4X66 Q;  3K59 A;  3F8T A;  1JOR A;  3WOF A;  1AE3 A;  4HID A;  3V05 A;  1EWC A;  5KRU A;  2HIV A;  4X65 L;  2F4V Q;  1G2S A;  1HRJ A;  3J7A 5;  3S2H H;  4KKT A;  1O7Z A;  1EY0 A;  4DPG A;  3M7G A;  3R2T A;  1N8R C;  3B6Y A;  2EY1 A;  4A3K B;  2BE5 C;  4XYQ A;  5KND A;  4DUY Q;  2JA8 G;  2O2L D;  3HOU B;  2E2I H;  2F52 A;  3NE5 B;  4MZ9 A;  2ENB A;  2Q8T A;  1CZG A;  1GUG A;  1C7Y A;  4FXD A;  3HOW H;  1PYS B;  3GDE A;  4JV5 Q;  1V1P B;  3H0G H;  3PV0 A;  4ZLT F;  4BY1 B;  5GRO A;  1MSH A;  2B2W C;  1SXT A;  2ZM6 L;  5IY0 A;  2FMC A;  4NXN L;  2B2T A;  1I6H H;  3RMH A;  5BN5 A;  3U58 A;  4B08 A;  1UAP A;  1FNV A;  5M3M H;  2CHB D;  1TWA B;  1X56 A;  2NN6 H;  1G29 1;  3G4S A;  1EOV A;  3I3C A;  4KJN A;  5FO7 B;  4DUZ L;  5M3F B;  4YCU A;  3G6J B;  3EA6 A;  1B8A A;  2WB1 E;  4ZAI A;  4A93 B;  3C1E A;  1SYD A;  1FVI A;  3H3V C;  1SE4 A;  5EPK A;  4IN3 A;  3M9B A;  1DXM A;  1ESF A;  1KDC A;  1VMP A;  3T16 A;  3UDF A;  4C3J B;  2EYL A;  2KHJ A;  5C0X H;  4R4T A;  4A75 A;  1EEF D;  3CCS A;  2EYM A;  4R4I A;  4X64 L;  2Y0S G;  2WAC A;  3I4O A;  4R4Q A;  1F77 A;  1Y1W H;  2I5L X;  2D62 A;  2ZJP A;  3TEH B;  2ES2 A;  3R8B A;  1BCP F;  3D8G A;  3BVG A;  3E6Z X;  4U67 3;  4LJZ C;  4JBK A;  4GN3 B;  1VQC A;  1XPO A;  2HD3 A;  2JP1 A;  3BYT B;  2CQA A;  3ULP A;  2UUA Q;  1BF4 A;  5A2Q E;  1JOK A;  4KK7 A;  5CV8 A;  5AJ3 Q;  3JAM E;  1UEB A;  5CMD A;  4A3F H;  3D4W A;  1VQE A;  2E76 C;  5DM7 3;  4PV1 C;  1L1O C;  2ZXP A;  1DJR D;  1I3Q B;  5D65 A;  1JWU D;  2Z8L A;  5ISR A;  1HNW L;  1IW7 D;  5EKK A;  1VQF A;  3HOX H;  2EOT A;  2F0T A;  1GUO A;  5C44 B;  2EJF C;  4UP8 A;  4DR7 L;  4XT1 B;  2IW3 A;  3I2Z A;  2Z4H A;  4HJ8 A;  1KDB A;  2JA8 B;  3CC7 A;  4IPH A;  1O7L A;  1IKM A;  4YCW A;  1TS2 A;  3HOV H;  4CJ1 B;  1VQ8 A;  2AKW B;  5IGB A;  1BR9 A;  4A3M B;  1S40 A;  1N9W A;  4L8J A;  2UXB L;  4RA8 A;  1Q90 A;  3K57 A;  4LW1 A;  3Q0A A;  1X65 A;  2RA4 A;  2OWO A;  4GKK L;  2D0O A;  2EIF A;  4X65 Q;  2AQ1 B;  1T5E A;  1JWS D;  1PH1 A;  2K05 A;  1UNS A;  1B3A A;  2NTS A;  5JAV A;  2VQF L;  4RMF A;  4JI3 Q;  5ELN A;  2IX0 A;  2KBN A;  1S5D D;  3OHX C;  3TS0 A;  3NTI A;  5JEA J;  4UAI A;  4ME5 A;  2JA7 H;  4XDX A;  2F0G A;  1K8M A;  1LT6 D;  1S4Z A;  1LT5 D;  5IYD G;  1WCM H;  1I4R A;  3ERO A;  5JEA G;  1VF7 A;  1ILQ A;  5COR A;  3AFP A;  5CV7 A;  1Q46 A;  1E0B A;  1SNO A;  1GUS A;  1GVP A;  5J3B A;  1Y1V G;  2OXP A;  3E0E A;  3S14 H;  2ZXR A;  3N52 A;  4TKO B;  2ZM6 Q;  1N34 L;  2VXW A;  3PO2 G;  3BZD B;  4A3I G;  1CM9 A;  4NXN Q;  1HR0 L;  3ONA B;  3U50 C;  2Y0S B;  2WAQ E;  3H6M A;  4IFD H;  3P7J A;  1PZJ D;  1JE4 A;  2F0I A;  4LUZ A;  2R7D A;  3Q23 A;  1J5E L;  4DUZ Q;  3HOZ G;  3GP7 A;  1EZ8 A;  2AHO B;  1UE1 A;  4LFB L;  1VQ9 A;  4F87 A;  2A69 D;  3NTK A;  1TT2 A;  4H02 A;  3VYT A;  1AFP A;  4LF7 L;  2XGT A;  3KDF A;  3U4V A;  3J80 i;  2Q2H A;  2G9H D;  1YHA A;  3I4L A;  4CKB A;  3MTS A;  1M90 C;  5KNB A;  4RCN A;  2OTJ A;  3ULJ A;  4O42 A;  2Q8I B;  5GQO A;  4DV4 L;  2B2V C;  5IT9 c;  1QZH A;  1EY8 A;  4X64 Q;  3HKS A;  3HEJ A;  2EPB A;  2D9U A;  4QIW E;  5IOC A;  1W6K A;  3H0G G;  2XRS D;  1TWC B;  4ZRZ A;  1X3P A;  4P71 A;  2NTT A;  2JN4 A;  5M3M G;  2A8V A;  4BA1 I;  4UDU C;  1DON A;  2WAQ G;  3D6W A;  1UUP A;  5CC4 A;  3K58 A;  1VQ5 A;  3PIP A;  1K83 H;  3NEM A;  2TMP A;  5C3E H;  2B2W A;  2EXD A;  1SJE D;  4AYB E;  1KTK A;  1CI3 M;  3BU2 A;  4XXE A;  4DV2 Q;  2OT2 A;  3OSO A;  4CJ0 B;  3S15 B;  2E75 C;  2Z1C A;  2KUM A;  4N8F A;  4NW2 A;  5C0X G;  2BH2 A;  4X62 L;  4J8Q A;  4DR7 Q;  4ILW A;  5EQ0 A;  3A56 A;  1SR3 A;  3RN2 A;  4CDF C;  3MZ5 A;  2Z6K C;  5A35 A;  1YJW A;  1WD1 A;  1PH4 A;  2JA6 B;  1UEA B;  5I4D A;  2EYH A;  2L9H A;  3E0J A;  1Y1W G;  1SSO A;  4GKJ L;  2NN6 I;  3CCR A;  3KOJ A;  2TSS A;  4F7X A;  2UXB Q;  4CKE A;  2L12 A;  2B2Y C;  3F2C A;  1AZQ A;  4X3K A;  4JBM A;  1F2M A;  1SEB D;  2WIN B;  1F2Z A;  1TWF B;  3RLO A;  4DK6 C;  4A4I A;  3PO2 B;  3PCO B;  3PUW A;  4PMW A;  3HOY B;  4FF1 A;  1BCP D;  4DR3 L;  3OWF A;  4DAY A;  2MO0 A;  4KY7 A;  1MHW C;  1JC7 A;  1CSQ A;  4A3F G;  2FMM A;  3H3V I;  1ESR A;  1RIP A;  2VQF Q;  1MD2 D;  4I65 A;  1V43 A;  3A5U A;  5C0X I;  4HJA A;  4KY6 A;  3BYY B;  3J80 E;  4IJL A;  1LAB A;  3EJI A;  3VR2 A;  5HGQ A;  4RKB A;  1BBW A;  4RH6 A;  4LFA Q;  2VUM H;  4DA2 A;  2ATW A;  1EU4 A;  2XN9 C;  2JEA I;  3X3N A;  4KMU C;  3HOX G;  1I50 H;  4UHV A;  1B1Z A;  5IT9 L;  3W3A A;  3M3Y H;  2IT1 A;  2E5L L;  3PO3 H;  1LAC A;  2E2H H;  4DR6 Q;  1LUZ A;  1MBY A;  4P73 A;  1GHK A;  4BBR H;  1ENF A;  3KLS A;  1ASY A;  1N34 Q;  1L1O A;  4TQU S;  2E2I B;  3HOV G;  2PZT A;  5LMU Q;  4FXG C;  2HQE A;  2R93 G;  1PFN A;  4R9W A;  2F3W A;  2IHE A;  3S24 A;  3HKZ E;  4YIJ A;  3W5O A;  4KV6 A;  4BBS H;  2MGS A;  3HOW B;  1IYV A;  1HUN A;  2A5H A;  3H0G B;  2CKZ B;  2NVY H;  1J5E Q;  4J1M A;  3A55 A;  5ELF A;  2NVX B;  3IL8 A;  3M7N A;  5K36 H;  3GTJ H;  1I6H B;  1LM0 A;  1STY A;  2KVM A;  1PH9 A;  3FPU B;  3MXU A;  3ZYY X;  4UPA A;  1R9T H;  4A3D H;  1IBK L;  2WAQ B;  3BDO A;  5I9P A;  4JW0 A;  5CV5 A;  4X3U A;  4KD3 A;  2IX1 A;  4HJ7 A;  2DJF C;  3E3X A;  1K0S A;  5GAG C;  2JE6 I;  5C4H A;  2Q2I A;  2HT1 A;  2DUD A;  1JWM D;  3AYH B;  4DV4 Q;  3L3O C;  1EYG A;  4IPC A;  1CK1 A;  4WFN 3;  3MEH A;  3OMG A;  1EWH A;  3GTK B;  3GTM H;  3NUC A;  2EJM A;  2IHF A;  3CC2 A;  5FOB B;  1WTP A;  3DM3 A;  3EFX D;  4DGZ A;  5ELD A;  2NZH A;  1B4O A;  3T13 A;  2MNA A;  3J81 E;  5HGT A;  1EFI D;  2DNC A;  3RNU A;  2QDB A;  1KL9 A;  2F0Q A;  4CGY B;  1QOH A;  5CGK A;  2Z9H A;  4DK0 A;  3EBE A;  3MEF A;  1Y1W B;  3SHL A;  1NTG A;  2KQ3 A;  4QIW B;  1YVC A;  2CH4 W;  4DNT B;  2ZJR A;  1TWH B;  1LTS D;  2IY5 B;  1WFQ A;  1EUJ A;  1UE6 A;  4OL7 A;  3LWU A;  3MFY A;  5EPL A;  3Q8D A;  1G6Z A;  2K14 A;  2OF1 A;  3K80 C;  4EQP A;  1Q8I A;  1WOC A;  2F0K A;  1SN8 A;  2WII B;  1IXR A;  1PTO C;  3U9O A;  1PFS A;  2HDL A;  1OXU A;  1BQQ T;  2PQE A;  2CW0 D;  5EKL A;  1PTO H;  4X62 Q;  3QIA A;  4YY3 L;  4JI4 L;  4FF4 A;  1Q12 A;  3CD6 A;  1RD9 D;  1NUC A;  1WTR A;  4AYB B;  2A68 D;  2F4I A;  1CQF A;  3NWS A;  5CBE E;  1E2V A;  2B39 A;  2EYO A;  1EZ6 A;  3HOX B;  3S1N H;  1YIJ A;  4LF5 L;  4IFD I;  1Y8N B;  4DV3 L;  1CKN B;  1CT1 D;  3A7A B;  4DAV A;  4EVO A;  2C35 B;  5M5X B;  3KLR A;  2F0D A;  4DV1 L;  4K5W A;  3RZD H;  1LTG D;  4OWX B;  1XXG A;  1PV4 A;  2B2V A;  3RN5 A;  5EJW A;  4DR3 Q;  4RWS C;  5EGT A;  1PHJ A;  4GZY C;  4FF2 A;  4ZK9 B;  4A3L H;  1B2T A;  2XVS A;  3HFZ B;  5C3E G;  1RTO A;  1D5M C;  1AP0 A;  1HZC A;  1NMF A;  3ER0 A;  4UP9 A;  1IYU A;  5E7N A;  2EYF A;  1LTR D;  2NB0 A;  3W1B A;  3NBH A;  3KUP A;  2A19 A;  2E5L Q;  1PRT F;  3I56 A;  2JA7 B;  1YNJ D;  4AH6 A;  1WTX A;  3TP6 A;  4K2K A;  3K5O A;  5NUC A;  1WCM B;  3AFQ A;  2I5M X;  5IGG A;  3QO2 A;  4A3C G;  1I5F A;  3F2B A;  4B3R L;  1TR5 A;  2YTV A;  3R3O A;  1YHB A;  4ZUI A;  2HHH L;  2QEX A;  5DM6 3;  1KLG D;  2PPB C;  3OOC A;  5J1Z A;  1Q86 C;  1PH2 A;  4IUR A;  3QB3 A;  4HR7 B;  1IBK Q;  3HKZ B;  3SE0 A;  2UXC L;  2ZT9 C;  1HQR D;  4KLK A;  4B3T L;  3SGI A;  1DGS A;  5CR3 A;  5C4J B;  2B2Y A;  3W1G A;  1JE5 A;  2WV6 D;  2VUM G;  1ASZ A;  1PMR A;  3KBG A;  1GJX A;  4QUF A;  3K5L A;  1EIG A;  1U9R A;  1SMY D;  3OIP A;  3CCJ A;  4KKS A;  3PO3 G;  4MTN A;  4G7H C;  4BBR G;  5IYD H;  2F0E A;  3DEO A;  5JEA H;  3RZO H;  4YCV A;  4WJ3 M;  4I7Z C;  2CFM A;  2V1C C;  2BE5 D;  2F0U A;  1Y1V H;  2L11 A;  2MFI A;  4LF9 L;  3NXW A;  5M9O A;  3TP8 A;  4ZQ3 A;  4BBS G;  4A3I H;  3MXP A;  5K5P A;  2K04 A;  5E1F A;  1JOQ A;  4P2C B;  1ZYR C;  1U5K A;  2R6G A;  1RL2 A;  4ID6 A;  5LL6 S;  3O13 A;  2B2U C;  5LMN L;  1ZKO A;  1MJE A;  4XQJ A;  4OEL B;  2M2L A;  4A3E H;  2EY5 A;  3HOZ H;  4K0K L;  1KXL A;  4HN7 A;  2V4D A;  1Y8O B;  4A3D G;  1X3F A;  1KNE A;  1CUK A;  1ENA A;  1K83 B;  4JCV E;  5C4Z A;  5JJI A;  2F03 A;  5C3E B;  2K5Q A;  4YY3 Q;  3GO5 A;  2O5I C;  3UDG A;  4RGM A;  4YWL A;  3SK5 A;  4DV6 L;  4DV0 L;  1ILP A;  3A54 A;  2DGY A;  1NE3 A;  4IAL A;  4LF5 Q;  1WYD A;  2PZU A;  2Y0S E;  4DV3 Q;  4HSP A;  4A3J H;  1Z6H A;  4V19 0;  1H9J A;  1DOM A;  5JJZ A;  1PH7 A;  1KHI A;  4DV1 Q;  1EY5 A;  4QL5 A;  5KYL A;  1F9S A;  2Z6B A;  2K5D A;  4Y7N H;  1KNA A;  5AFW A;  2K4K A;  1F2L A;  5D3D A;  3G48 A;  3PF5 A;  2RQX A;  3AU7 A;  1DOK A;  2F0P A;  4R1J A;  1HNX L;  2D0P A;  2H1E A;  3J7A V;  3Q24 A;  2ID0 A;  1FNW A;  5E4X A;  3GQB A;  4ALP A;  2LKV A;  3MC0 B;  3NBI A;  1JJG A;  2F0H A;  3I4M H;  4F88 A;  4QJF A;  3H3V H;  3GTG B;  4IOC A;  1D7Q A;  4A3G H;  2O5J C;  4JOI C;  1VQO A;  3DM1 A;  2BA0 A;  1J6Q A;  4GLV B;  1H9K A;  2KEC A;  3SDZ A;  1I50 B;  3GTO H;  2NUC A;  1I4P A;  1KRT A;  5BR8 L;  3ULL A;  3S1M B;  4FDB A;  1T5X D;  5KYI A;  4KN7 C;  4AQY Q;  3PO3 B;  5G3L F;  2E2H B;  4G7O C;  4B3R Q;  2F3I A;  4NB3 A;  2RVL A;  4LAA A;  5IGD A;  3CME A;  2HHH Q;  1XNR L;  1GKH A;  2Z4I A;  1SE3 A;  2A6H C;  1TY0 A;  1XWE A;  1KRS A;  1A62 A;  3A7L A;  3TN2 A;  3LGJ A;  3KYH C;  3TP7 A;  4A3L G;  4DR1 L;  3IRB A;  4BBS B;  2UXC Q;  1K3R A;  4PNY A;  1BCP B;  4H0L C;  2NVY B;  5IWA Q;  4B3T Q;  3JC6 6;  3PUV A;  5BN3 A;  3DMU A;  1G6P A;  1MSG A;  2AQ3 B;  5D3I B;  3GTJ B;  2HDM A;  4N9P A;  1ONL A;  1ENC A;  1CQV A;  2G5D A;  1R9T B;  3CCL A;  1B7Y B;  1Q1B A;  3CKI B;  4MNO A;  5JPM C;  2MO1 A;  2NVT H;  4C3I H;  4RGN A;  2QA4 A;  3Q6S A;  2VW9 A;  3G7L A;  5FJ8 H;  4LMQ D;  1CZW A;  1SLJ A;  2XWJ B;  1X55 A;  3BVZ A;  3K0X A;  1WTW A;  1A3T A;  4LF9 Q;  4IUT A;  3S1Q H;  2J4X A;  1V9P A;  1CKO A;  2F0W A;  3GTM B;  1DD2 A;  2R93 H;  3CW2 C;  3IFD A;  1NSN S;  1UE7 A;  4PG3 A;  3A74 A;  2R3Z A;  4DR2 L;  4K5X A;  2B8F A;  5LMN Q;  2F3V A;  4K2L A;  1IL2 A;  3ZJY C;  1OXS C;  1N36 L;  4APV A;  1VQJ A;  5M5W H;  2PNR C;  1TU2 B;  4PZ6 A;  4OO1 H;  2QGQ A;  3JAM c;  4OWW B;  2XTI A;  5CV4 A;  3KF8 A;  3F1Z A;  1WTH A;  1TS3 A;  3OYY A;  1D2B A;  5I6Y A;  4CBV A;  1PTO F;  1PRT C;  1BUV T;  4DV6 Q;  4DV0 Q; 
#chains in the Genus database with same CATH homology
 1I4X A;  1QWY A;  2EVB A;  3DWQ A;  4RFB A;  3N6R A;  3VR4 A;  4KI0 A;  1IW7 C;  1S5C D;  2NYZ D;  1J9O A;  4RCO A;  5COY A;  2A73 B;  2RDF A;  1LTB D;  3R93 A;  1A6X A;  5EBC A;  1B53 A;  2QEJ C;  1AEX A;  3S1N B;  1QB5 D;  2F0O A;  5IT9 E;  1RDP D;  1SNM A;  3LNN A;  3A8K E;  4QB4 A;  3DWA A;  4QCL A;  3VYR A;  1EY9 A;  1PZK D;  4WOR A;  2F0L A;  1BXT A;  3RZD B;  4TRD A;  5FO8 B;  3I91 A;  3TSS A;  5C3W A;  3QOL A;  4S3S A;  3QOJ A;  4NMZ A;  1D6E C;  3HRZ C;  1C48 A;  3AB9 A;  1IL8 A;  2VB3 X;  3BVM A;  4DXF A;  1SE2 A;  2JXM B;  2EY6 A;  2BDO A;  2C5C A;  4KJO A;  1D1K A;  3CHB D;  2L0C A;  2LFN A;  5JPN C;  2X69 A;  1XTC D;  4DK1 A;  4Z9C B;  2PYK A;  4DN4 M;  1TII D;  2ZXO A;  1SAP A;  4OHJ A;  1STH A;  4FNF A;  1V8Q A;  1CHP D;  5I2Y A;  1LTI D;  3URY A;  4DFA A;  1SND A;  1PLF A;  3KK7 A;  1HUM A;  3UI2 A;  3J7A F;  5KNC A;  5FK9 C;  3K5M A;  1TKW B;  2K28 A;  2N55 A;  3SK4 A;  1CA6 A;  1HPC A;  2NBF A;  5KIX A;  1R4P B;  3RZO B;  1Y1V B;  4A3I B;  3ND9 A;  2L1B A;  5I9O A;  3FDT A;  3PMF A;  2FHT A;  3A8I E;  4A3E B;  3ND8 A;  3HOZ B;  3NQT A;  3TZD A;  3LX0 A;  1EIH A;  1OXX K;  1LLR D;  1HQM C;  1TY2 A;  1SNC A;  1PXU A;  4C3I G;  3S2H B;  5D14 A;  3VR5 A;  1SJH D;  1HHV A;  1BO0 A;  1I4Q A;  2KHS A;  3T56 B;  2N88 A;  2MP1 A;  2K32 A;  2QKI C;  1PFB A;  2CVR A;  4KTA A;  4CJ2 C;  2MJ8 A;  3OWE B;  4N9T A;  4IZ8 A;  2X6G A;  1WTQ A;  4Y7N B;  3DXJ C;  2XRQ D;  5M3M B;  4OO1 G;  1EY7 A;  2DY7 A;  2IWH A;  2PCF B;  5E3F A;  1ROD A;  3LWE A;  4C1N I;  1B9M A;  1H9S A;  2F0N A;  1TVX A;  1STG A;  2E2D C;  1L0X B;  2FIN B;  3NK9 A;  5KGU A;  1QE6 A;  1J8I A;  1HTP A;  4A3G B;  3X3M A;  4FYD A;  1O78 A;  1TS4 A;  1A3V A;  1B50 A;  4IUV A;  3TBI B;  1LTT D;  3GTO B;  1WTO A;  4KN4 C;  3AMU A;  5DEH A;  4OO1 I;  2PO4 A;  3L9A X;  4ABN A;  3R2I A;  2FJ2 A;  4XQQ A;  2IX3 A;  5C3X A;  4KD4 A;  4JK1 C;  3MAQ A;  3VA5 A;  1QCB D;  4A3F B;  4RGT A;  4KHZ A;  4R8N A;  4H13 C;  4ZUJ A;  2LMC B;  4ZKC B;  1SYE A;  1U4M A;  4CHT B;  2NVT B;  3WOE A;  1KAB A;  1X3Q A;  1SBB B;  2G9D A;  2SNM A;  1HXY D;  1EYA A;  3BDL A;  1STE A;  4X3T A;  3S1Q B;  1XX8 A;  1VF5 C;  1EQT A;  3HOV B;  1M4V A;  2XNA C;  2R93 B;  1S5B D;  1K8O A;  4PMC A;  1HFN A;  4QMG A;  2L5T A;  1H9S B;  3NSW A;  1FD7 D;  2A6E C;  3J80 L;  5M5W B;  4IUN A;  2MUY A;  4HCS A;  1I6V C;  3HG9 A;  4DF7 A;  1D1I A;  1AZP A;  1YNN C;  4HMI A;  1EEI D;  1QJO A;  4HCE A;  1PRT B;  1DZ1 A;  1F9R A;  3RLF A;  4WRD A;  3S14 B;  3HGB A;  1HA6 A;  2SEB D;  1H9M A;  5HUR A;  4XYO A;  1A3U A;  3NPP A;  3QWN A;  1EOT A;  5C4X B;  1G8Z D;  4FF3 A;  1ZYR D;  2WKC A;  1V1P A;  2E74 C;  4ZYS A;  2ICE C;  1EY4 A;  2I07 B;  4JBW A;  3S16 B;  3CU7 A;  2EXZ A;  2PW7 A;  5JOB A;  3OMC A;  3QG1 A;  1Q1E A;  5DAU A;  1YNJ C;  3GTP B;  2M00 A;  2KOL A;  4C3H G;  4WJW A;  2QIL A;  1QNU A;  3MFG A;  3SK6 A;  1GUT A;  1AW7 A;  3HS0 C;  5ELC A;  5C5L A;  2SDF A;  5LHY 1;  2R92 B;  2J7Z A;  3SXH A;  3FMC A;  4K8J A;  4Q0F A;  5ELB A;  4G4K A;  1FYC A;  5TSS A;  3C46 A;  3OPO A;  1STA A;  1SMY C;  4RHS A;  5IOD A;  3IKJ A;  1F9Q A;  1RCV D;  1ET9 A;  4KHV A;  4X3S A;  1FNU A;  3F2U A;  2RKS A;  5CV6 A;  1NAP A;  1Z47 A;  3L7Z C;  3RD4 A;  2RSO A;  2D2C C;  4E6I A;  1GUN A;  1OXV A;  2MPM A;  3J7Y W;  1Y69 U;  1KLU D;  2EE1 A;  1U4R A;  2A6H D;  1RHP A;  2B63 B;  1E2W A;  2D5D A;  2C9O A;  2KED A;  4HSV A;  1ZXT A;  3S9W A;  2DNE A;  3DWP A;  3M4Y A;  5J22 A;  2WP8 J;  4IQZ A;  5T1I A;  3PUX A;  2VUM B;  2B8G A;  1IHZ A;  2J0T D;  4MHE A;  3H09 A;  1PDQ A;  2Q8R E;  1SNQ A;  4U68 A;  1ICW A;  3M3Y B;  5C6A A;  1FR3 A;  4BBR B;  1GOZ A;  1A15 A;  3KLS X;  2K1B A;  3I70 A;  2F1M A;  2BDN A;  3FPP A;  1EL0 A;  2RDH A;  1JIC A;  3C2P A;  3MWY W;  4NDX A;  4QUC A;  3PUY A;  4C3H B;  1F9P A;  2F0V A;  1GXD C;  3W2D A;  1S5F D;  3OIQ A;  2KEE A;  2JSO A;  5I6W A;  4A3D B;  3K0Y A;  4KKU A;  3SR1 A;  1JR0 D;  5FKA C;  3MXN A;  2A74 C;  1F2Y A;  5IIF A;  1MGS A;  3K6O A;  3T51 B;  1PRT D;  2O4X A;  4XQN A;  4HMJ A;  2XWB B;  1JB3 A;  1I4H A;  4L63 B;  2XIW A;  3FRP B;  5FLX L;  1H9R A;  3NTH A;  3BS1 A;  5LL6 X;  3VR3 A;  1G91 A;  1U4P A;  1CTM A;  1Z7T A;  2NVQ B;  2PZW A;  3PUZ A;  1OXT A;  2BA1 A;  1CFM A;  1VCI A;  3IFT A;  1JCK B;  4M1U B;  3PIO 3;  5J39 A;  3ITP A;  1RTN A;  3GTQ B;  4F8M A;  4PQX A;  2K7V A;  1O7Y A;  1LO5 D;  1PTO B;  2R61 A;  1QIL A;  2L55 A;  3GV3 A;  4FXK C;  1FGB D;  3MVV A;  5IGF A;  1EYD A;  4M8A A;  3E5S A;  2L4N A;  3K5N A;  2AWN A;  3D4R A;  1O80 A;  3K7A B;  1PZI D;  3WDN A;  1VMC A;  2DN8 A;  2HCC A;  5E4W C;  3NQI A;  2B2U A;  3EQL C;  4HED A;  1PYW D;  2K6A A;  3DEP A;  1HFG A;  3NP8 A;  2GA4 B;  3C1F A;  1C8C A;  4OIJ A;  4RHR A;  2HUG A;  3D6C A;  4BWG B;  2NZ1 D;  1W6J A;  3VYU A;  2EYP A;  5KEE A;  2K5W A;  5CV9 A;  2K33 A;  5T1G A;  2WB1 B;  5DNF A;  3FEW X;  2JEB I;  1BNZ A;  3TP5 A;  1A2U A;  4NKL A;  5A2Q L;  4DXG A;  3JAM L;  2KJX A;  2OEO A;  1WD0 A;  2MHV A;  3P20 A;  3M4O B;  2A69 C;  3MXG A;  1KAA A;  1ML0 D;  3I72 A;  3CRL C;  1SDF A;  2XSC A;  4DNR B;  2SOB A;  2NN6 G;  3I73 A;  4G7Z C;  3VR6 A;  4L6T B;  2R7Z B;  2F0F A;  1GHJ A;  4RGO S;  3P1H A;  4H7B A;  3V96 A;  4MIU A;  3MA2 B;  5C0X J;  1SFO B;  3FKI B;  3A8J E;  2KA7 A;  4FVM A;  5ELE A;  2K03 A;  3S1R B;  2YYZ A;  5G3L D;  3Q22 A;  1D5X C;  3QJY A;  1DM0 B;  1SYG A;  2VB2 X;  3ERQ A;  1EY6 A;  4OIK A;  3FVQ A;  1NR2 A;  2RBM A;  3I4N B;  4RAU C;  4K5V A;  2YU9 B;  4K6L A;  3D3R A;  4BA2 I;  1M8A A;  1BDO A;  2NWG A;  2BCO A;  4EQO A;  1VDZ A;  2EYJ A;  4XTC S;  1EYC A;  5CBA E;  5JVG 3;  4K8I A;  1TS5 A;  1Y8P B;  3DUZ A;  1HA5 A;  1II3 A;  4RKL A;  1A2T A;  4A3J B;  3H91 A;  3D4D A;  1V1O A;  2EDG A;  1B9N A;  2FFK B;  2F0M A;  3KBX A;  1BCP C;  4ZKB B;  4Q5V A;  3D31 A;  3SK8 A;  5C5M A;  1BOS A;  3SVM A;  4B9X A;  3T4A C;  1G2T A;  3DHQ A;  2SNS A;  3C3L A;  2DY8 A;  2WKD A;  3TDQ A;  2EY2 A;  3I4M B;  1PTO D;  4V0B A;  1SNP A;  3NHH A;  5JVH 3;  3S17 B;  1RJT A;  3H94 A;  4XT3 B;  4QF4 A;  5BN4 A;  5IGC A;  1Q3L A;  3T53 B;  4K14 A;  4TSS A;  1STB A;  3RUZ A;  2LY7 A;  2B2T C;  5FO9 B;  3TME A;  4IFD J;  3HP3 A;  2X6L A;  4C2M B;  1CA5 A;  2F0J A;  2EZV A;  4IFD G;  3P75 A;  3I8Z A;  4FO2 A;  1ZEQ X;  1KDA A;  5F2D A;  2RDG A;  4IUU A;  3TZU A;  1BBX C;  1PFM A;  2K01 A;  1L0Y B;  2A6E D;  1HCZ A;  4K6D A;  1QG7 A;  4C3I B;  4DAP A;  1SYF A;  4BY7 B;  4OGQ C;  2PMZ B;  2IPK D;  4NP5 A;  1DYQ A;  1LTA D;  5EKI A;  1AN8 A;  1YNN D;  1EU3 A;  3PIP 3;  4DU9 A;  2RSN A;  1NR4 A;  1SYB A;  4H44 C;  3CRK C;  4O1N A;  3CQZ B;  1I4G A;  1LV9 A;  4ODG A;  1DCZ A;  1QNK A;  4J6H A;  3HZX A;  2I46 A;  2F0S A;  1GUW A;  3GTL B;  2IL8 A;  1EQV A;  2AUJ D;  5EPJ A;  1TQO A;  5EBD A;  1RKN A;  3GV6 A;  1B44 D;  4FP5 D;  2AUK A;  2CW0 C;  4HTH A;  4KY5 A;  1IKL A;  2H4O A;  4C1N K;  1U4L A;  2A68 C;  2IJ0 A;  3VYS A;  2EJG C;  2BOS A;  2QCP X;  2VNU D;  2ICI A;  4HAE A;  2PW5 A;  1ET6 A;  1X32 A;  4XIG S;  5M5Y B;  2HCI A;  1XYI A;  1RF2 D;  2LS0 1;  1WVL A;  3U9S A;  1CHQ D;  4C56 C;  1DOL A;  3I90 A;  4IUQ A;  4CKC A;  1NCV A;  3M85 A;  4G57 A;  3IAY A;  3S2D B;  2M9V A;  2KCN A;  2E2J B;  3V2T A;  2JA5 B;  4EQN A;  4LK1 C;  3MHB A;  4BS9 A;  1R4Q B;  4IUP A;  1TWG B;  3EVQ A;  1JQY D;  1HTL D;  1E2Z A;  4C3J G;  5CYU A;  1MI2 A;  4MN3 A;  1S5E D;  3J81 L;  3OW7 A;  3NWT A;  1LT4 D;  4ULL A;  3VA7 A;  1JOO A;  3GD7 A;  2KCC A;  5IGE A;  1WTV A;  1D5Z C;  1STN A;  4B9W A;  2QF7 A;  3BG3 A;  3SEB A;  4PMB A;  1OO9 B;  5FLX E;  2JYO A;  4R8I A;  2AQ2 B;  4A3B B;  1LT3 D;  5K36 G;  5I2X A;  3BDC A;  1C4Q A;  1SYC A;  2AWO A;  4EGV A;  3K59 A;  1JOR A;  3WOF A;  3V05 A;  1EWC A;  5KRU A;  1G2S A;  1HRJ A;  4KKT A;  1O7Z A;  1EY0 A;  3M7G A;  3R2T A;  2EY1 A;  4A3K B;  2BE5 C;  4XYQ A;  5KND A;  2O2L D;  3HOU B;  3NE5 B;  2ENB A;  2Q8T A;  1CZG A;  1GUG A;  4FXD A;  1V1P B;  3PV0 A;  4ZLT F;  4BY1 B;  1MSH A;  2B2W C;  1SXT A;  2FMC A;  2B2T A;  3RMH A;  5BN5 A;  4B08 A;  1UAP A;  1FNV A;  2CHB D;  1TWA B;  2NN6 H;  1G29 1;  3I3C A;  4KJN A;  5FO7 B;  5M3F B;  3G6J B;  3EA6 A;  4ZAI A;  4A93 B;  3C1E A;  1SYD A;  3H3V C;  1SE4 A;  5EPK A;  4IN3 A;  1DXM A;  1ESF A;  1KDC A;  1VMP A;  3T16 A;  4C3J B;  2EYL A;  5C0X H;  1EEF D;  2EYM A;  2WAC A;  1F77 A;  2D62 A;  3R8B A;  1BCP F;  3D8G A;  3BVG A;  3E6Z X;  4U67 3;  4LJZ C;  2JP1 A;  3BYT B;  2CQA A;  1BF4 A;  5A2Q E;  1JOK A;  4KK7 A;  5CV8 A;  3JAM E;  5CMD A;  3D4W A;  2E76 C;  5DM7 3;  4PV1 C;  2ZXP A;  1DJR D;  1I3Q B;  5D65 A;  1JWU D;  2Z8L A;  5ISR A;  1IW7 D;  5EKK A;  2EOT A;  2F0T A;  1GUO A;  5C44 B;  2EJF C;  4XT1 B;  2IW3 A;  2Z4H A;  1KDB A;  2JA8 B;  1O7L A;  1IKM A;  1TS2 A;  4CJ1 B;  5IGB A;  1BR9 A;  4A3M B;  4L8J A;  4RA8 A;  1Q90 A;  3K57 A;  3Q0A A;  2RA4 A;  2AQ1 B;  1T5E A;  1JWS D;  2K05 A;  1UNS A;  1B3A A;  2NTS A;  5JAV A;  2IX0 A;  1S5D D;  3OHX C;  3NTI A;  5JEA J;  4UAI A;  4ME5 A;  4XDX A;  2F0G A;  1K8M A;  1LT6 D;  1S4Z A;  1LT5 D;  1I4R A;  3ERO A;  5JEA G;  1VF7 A;  1ILQ A;  5COR A;  5CV7 A;  1SNO A;  1E0B A;  1GUS A;  2OXP A;  2ZXR A;  3N52 A;  4TKO B;  2VXW A;  3BZD B;  1CM9 A;  3ONA B;  2Y0S B;  3H6M A;  4IFD H;  3P7J A;  1PZJ D;  1JE4 A;  2F0I A;  3Q23 A;  3GP7 A;  1EZ8 A;  4F87 A;  2A69 D;  3NTK A;  1TT2 A;  3VYT A;  1AFP A;  2G9H D;  3I4L A;  4CKB A;  3MTS A;  5KNB A;  4RCN A;  4O42 A;  2Q8I B;  2B2V C;  1EY8 A;  3HEJ A;  2EPB A;  2D9U A;  5IOC A;  1W6K A;  2XRS D;  1TWC B;  4ZRZ A;  1X3P A;  2NTT A;  4BA1 I;  4UDU C;  1DON A;  3D6W A;  1UUP A;  5CC4 A;  3K58 A;  2TMP A;  2B2W A;  1SJE D;  1KTK A;  1CI3 M;  4XXE A;  2OT2 A;  3OSO A;  4CJ0 B;  3S15 B;  2E75 C;  2Z1C A;  2KUM A;  4NW2 A;  5C0X G;  4J8Q A;  4ILW A;  5EQ0 A;  3A56 A;  3MZ5 A;  5A35 A;  1WD1 A;  2JA6 B;  1UEA B;  5I4D A;  2EYH A;  2L9H A;  3E0J A;  1SSO A;  2NN6 I;  2TSS A;  4F7X A;  4CKE A;  2L12 A;  2B2Y C;  1AZQ A;  4X3K A;  1F2M A;  1SEB D;  2WIN B;  1F2Z A;  1TWF B;  3PO2 B;  3PUW A;  4PMW A;  3HOY B;  4FF1 A;  1BCP D;  3OWF A;  4DAY A;  4KY7 A;  1JC7 A;  2FMM A;  1ESR A;  1MD2 D;  4I65 A;  1V43 A;  5C0X I;  4KY6 A;  3BYY B;  3J80 E;  1LAB A;  3EJI A;  3VR2 A;  4RKB A;  4RH6 A;  4DA2 A;  1EU4 A;  2XN9 C;  2JEA I;  3X3N A;  4KMU C;  1B1Z A;  5IT9 L;  3W3A A;  2IT1 A;  1LAC A;  1MBY A;  1GHK A;  1ENF A;  3KLS A;  4TQU S;  2E2I B;  2PZT A;  4FXG C;  2HQE A;  1PFN A;  4R9W A;  2F3W A;  4YIJ A;  4KV6 A;  2MGS A;  3HOW B;  1IYV A;  1HUN A;  2A5H A;  3H0G B;  4J1M A;  3A55 A;  5ELF A;  2NVX B;  3IL8 A;  3M7N A;  5K36 H;  1I6H B;  1STY A;  2KVM A;  3FPU B;  3MXU A;  3ZYY X;  2WAQ B;  3BDO A;  5I9P A;  5CV5 A;  4X3U A;  4KD3 A;  2IX1 A;  2JE6 I;  5C4H A;  1JWM D;  3L3O C;  1CK1 A;  4WFN 3;  3MEH A;  3OMG A;  1EWH A;  3GTK B;  3NUC A;  2EJM A;  5FOB B;  1WTP A;  3EFX D;  4DGZ A;  5ELD A;  1B4O A;  3T13 A;  3J81 E;  5HGT A;  1EFI D;  2DNC A;  2QDB A;  2F0Q A;  4CGY B;  1QOH A;  5CGK A;  4DK0 A;  1Y1W B;  3SHL A;  2KQ3 A;  4QIW B;  4DNT B;  1TWH B;  1LTS D;  4OL7 A;  3LWU A;  3MFY A;  5EPL A;  1G6Z A;  2OF1 A;  4EQP A;  1Q8I A;  2F0K A;  2WII B;  1PTO C;  3U9O A;  2HDL A;  1OXU A;  1BQQ T;  2PQE A;  2CW0 D;  5EKL A;  1PTO H;  3QIA A;  4FF4 A;  1Q12 A;  1RD9 D;  1NUC A;  1WTR A;  4AYB B;  2A68 D;  2F4I A;  1CQF A;  3NWS A;  5CBE E;  1E2V A;  2B39 A;  2EYO A;  1EZ6 A;  3HOX B;  4IFD I;  1Y8N B;  1CT1 D;  3A7A B;  4DAV A;  4EVO A;  5M5X B;  3KLR A;  2F0D A;  4K5W A;  1LTG D;  1XXG A;  2B2V A;  5EJW A;  4RWS C;  5EGT A;  4GZY C;  4FF2 A;  4ZK9 B;  1B2T A;  2XVS A;  1RTO A;  1D5M C;  1AP0 A;  1IYU A;  2EYF A;  1LTR D;  2NB0 A;  3NBH A;  3KUP A;  1PRT F;  2JA7 B;  1YNJ D;  1WTX A;  3TP6 A;  4K2K A;  3K5O A;  5NUC A;  1WCM B;  5IGG A;  3QO2 A;  1TR5 A;  3R3O A;  4ZUI A;  5DM6 3;  1KLG D;  2PPB C;  3OOC A;  5J1Z A;  4IUR A;  3QB3 A;  4HR7 B;  3HKZ B;  3SE0 A;  2ZT9 C;  1HQR D;  5CR3 A;  5C4J B;  2B2Y A;  2WV6 D;  1PMR A;  3KBG A;  1GJX A;  4QUF A;  3K5L A;  1EIG A;  1U9R A;  1SMY D;  3OIP A;  4KKS A;  4G7H C;  2F0E A;  3DEO A;  5JEA H;  4I7Z C;  2BE5 D;  2F0U A;  2L11 A;  3NXW A;  5M9O A;  3TP8 A;  4ZQ3 A;  3MXP A;  5K5P A;  2K04 A;  5E1F A;  1JOQ A;  4P2C B;  1ZYR C;  2R6G A;  4ID6 A;  5LL6 S;  3O13 A;  2B2U C;  1ZKO A;  4XQJ A;  2M2L A;  2EY5 A;  4HN7 A;  2V4D A;  1Y8O B;  1KNE A;  1ENA A;  1K83 B;  5C4Z A;  2F03 A;  5C3E B;  2K5Q A;  3GO5 A;  2O5I C;  4RGM A;  3SK5 A;  1ILP A;  3A54 A;  4IAL A;  2PZU A;  4HSP A;  1Z6H A;  4V19 0;  1H9J A;  1DOM A;  5JJZ A;  1EY5 A;  5KYL A;  1F9S A;  2K5D A;  1KNA A;  5AFW A;  1F2L A;  5D3D A;  2RQX A;  3AU7 A;  1DOK A;  2F0P A;  2H1E A;  3J7A V;  3Q24 A;  2ID0 A;  1FNW A;  5E4X A;  3GQB A;  2LKV A;  3MC0 B;  3NBI A;  2F0H A;  4F88 A;  3GTG B;  2O5J C;  3DM1 A;  2BA0 A;  1H9K A;  2KEC A;  3SDZ A;  1I50 B;  2NUC A;  1I4P A;  3S1M B;  1T5X D;  5KYI A;  4KN7 C;  3PO3 B;  4G7O C;  5G3L F;  2E2H B;  2RVL A;  4LAA A;  5IGD A;  2Z4I A;  1SE3 A;  2A6H C;  1TY0 A;  1XWE A;  3A7L A;  3TN2 A;  3TP7 A;  4BBS B;  4PNY A;  1BCP B;  4H0L C;  2NVY B;  3PUV A;  5BN3 A;  3DMU A;  1MSG A;  2AQ3 B;  5D3I B;  3GTJ B;  2HDM A;  4N9P A;  1ONL A;  1ENC A;  1CQV A;  1R9T B;  1Q1B A;  3CKI B;  5JPM C;  4RGN A;  3Q6S A;  3G7L A;  4LMQ D;  1CZW A;  2XWJ B;  3BVZ A;  1WTW A;  1A3T A;  4IUT A;  2J4X A;  3GTM B;  2F0W A;  1DD2 A;  3IFD A;  1NSN S;  2R3Z A;  4K5X A;  2B8F A;  2F3V A;  4K2L A;  1OXS C;  2PNR C;  1TU2 B;  4OO1 H;  5CV4 A;  3KF8 A;  1TS3 A;  1D2B A;  5I6Y A;  4CBV A;  1PTO F;  1PRT C;  1BUV T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...