4PQXA

Crystal structure of a nigd-like protein (baccac_02139) from bacteroides caccae atcc 43185 at 2.39 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
201
Chain Sequence
b'SRSLVISTINQISEDSKEFYFTLDNGKTMFPSNSQAWGGEKFENGQRAFVIFNELEQPVNGYDYNIQVRDITKVLTKEIVTMDDEENTEEKIGDDKINATYMWISKDKKYLTIEFQYYSTHSEDKKHFLNLVINNKDNTDDEYINLEFRHNSERDSPDHLGEGYVSFKLDKIEEQIEGKKGLNIRVRTLYDGIKNYKVQFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
molecule tags Structural genomics, unknown function
source organism Bacteroides caccae
publication title Crystal structure of a hypothetical protein (BACCAC_02139) from Bacteroides caccae ATCC 43185 at 2.39 A resolution (CASP Target)
rcsb
total genus 55
structure length 201
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pqxA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pqxA02
3K6OA 4PQXA 3QWNA 3NQIA 4J8QA 3K0YA
chains in the Genus database with same CATH superfamily
1SYCA 5B21A 4ZBJA 1OF2B 2Z8WC 1VMCA 1RPQA 3DRTA 3ILQD 2EOTA 2HPTA 5J1SC 2YAQA 5E08H 1AHWA 1QLEL 4O2CB 4QT5A 2GI7A 2WXIA 5AVVB 3RL2B 1U4RA 2E47A 1OOWA 1KC5H 3KYOB 3K7AH 2K8MA 3OL2A 4JFXB 4U7MA 5TDNB 2X4OB 3IBEA 2YK1L 5AYQA 4KKTA 1IZ6A 3MEFA 4HSCX 4GG6E 5CD3A 2NW2A 4JPQA 1T3FB 5IK3A 4PH8A 4GAGL 1LDPL 2VDQH 1E24A 1DJRD 3GXUB 1IC0A 4EIZC 1BOYA 4ZRZA 2C4XA 3GRWA 5GS0H 2W1NA 3U0TA 3S97C 1EHNA 2V3EA 3ARGC 4JO4L 3ECVA 1DO6A 4LRIA 3V5HB 3J81i 4DZBB 3DOSA 3STZA 2BSCA 2DH3A 4NXKA 1DN0B 4KQ3L 1E50A 1NMCB 3PL6A 1AQKH 2B9BA 5I0WA 3N43F 3ZDXB 3AXLB 2GN5A 5KEEA 3R3OA 4GOSA 2DF3A 3RVTC 4B95C 1J0ZA 1T22B 2BY0A 3IU4L 4YXHL 3WBDA 3EXLA 2YOCA 4XPFL 1ORSB 5B7MA 5LGHL 4FTVB 3MVSA 4TUKH 4OLZH 5IESH 2OMUB 2W94A 2ICEC 4XXDB 2CPCA 1HXYB 3NZ8B 5KSBA 2YSTA 5KVEL 2KA7A 3WOFA 3J80c 3RBGA 3PHOB 4MBRA 1S46A 2YD8A 3RPBA 4NOFA 1WRFA 3FAWA 1NGZA 1N9WA 1WITA 3TP8A 2CJUL 1HEHC 3LY6A 3TA4D 4E42B 5IJDC 4UMGA 4MMXA 1DN0A 5CJ5A 3KR3H 3LYRA 4IRJB 3CFBA 3VMOA 4BK8A 3IETB 4UOW1 4JZOB 3BAJA 5C0DB 1X4YA 2D7OA 5LMUL 3DUUA 3GB7B 2YTYA 2XU9A 2XJLA 3E80A 2B3GA 3BD3A 1BPVA 2XWEA 3ABZA 3NBIA 2L1BA 4CC1A 3K72B 5F7DA 2HXAA 2O5NA 2L7EA 3A21A 4UT9A 1EWHA 4KXZH 3KPRB 5MEPB 3R18A 1FVDB 4PWIA 4J12A 2FBJH 2WBJC 3HHSA 5JAVA 4KROB 3TGXA 4BA0A 4U7SA 2NNCA 5C0RH 4F2MB 4Y5XC 3PNRB 4FF9A 5DTFB 2EXWD 5C09E 3D8MA 2JA8H 2F3WA 1BBXC 3FUNA 3UP6A 1RUAH 4FLSA 3B8YA 3N1QC 5TQ2L 4U31A 1LTGD 5C4HA 1J9TA 1AGCA 1JXKA 2B2YA 3DPBA 3EDEA 3ZKXB 1EY6A 4F57L 5KYYB 1UJ3C 2EDJA 1AHWC 1I9RL 2E7MA 3U7YL 4KTEL 3C9NA 5E1FA 3UJJL 1FFOA 3JV6B 1J0JA 3FO0H 1L1OA 1TO5A 4AQ8C 5GRUL 1JVKA 3SGIA 3QA3A 1NBYA 5L2KD 2Y7OA 3PWVB 4Q2ZB 1MRFH 4YHNB 5HDQH 2UUCL 2FGWH 2WUBH 4U1NB 2XXMB 5C08E 4WF7A 2F2HA 1ZLSH 2AUKA 3UC0H 4BUGA 4CVWA 2FYYA 2IJ0A 1TIUA 2IALA 5EIIG 5BRPA 1DVUA 1BG9A 3EYSL 3MMEA 2DMCA 3MSPA 1HZAA 4LLAA 3SKNB 2AW2A 4N2CA 2KI6A 4HK3N 1Z7TA 3WFHB 1SYBA 3PL6C 2YC1A 5FAAA 5I8KH 2ZTBA 4OCRH 5I1HH 4FG6D 1CICB 5F9DC 3BHBB 3V4VB 2VERA 2VDQL 3RWEB 2OJZL 1LO0L 5T3XH 4KNQA 1G91A 1LO5D 4HV8B 1BYOA 4AQYQ 1J8HE 2HVBA 4CC4A 3NEEA 2F1BA 2C9RA 3CCEA 1DJGA 1VGKB 2B0SL 2OMVA 5LJYH 1N5AB 3UE1A 2WACA 1U3HD 2WMPB 3HI5H 2NY7L 3CVHH 2K01A 1EEYB 3OR6A 1QB5D 4QOKD 1HCYA 3JBG7 3KCPB 1JPST 3DTXA 5FK9A 2FNWA 4N2EA 5IT2H 1I4PA 3X1BA 3VYNA 2IQAA 2FHFA 4NJ9H 4PB9L 1JDCA 4RFOH 1C48A 4OJCA 5EC2B 3GMRA 3S8GB 3EO0B 1DDHA 2XN9D 4JFFB 2IX0A 4QRBA 2P26A 1Y14B 3L9BA 4U1HA 1U3HC 5JNYA 1KDBA 3I2CH 4O5LH 2R7ZG 4PLKD 2PQAA 2DM4A 5F6HJ 1KABA 2HRPL 1RODA 1KHIA 4NQTA 2Q7YB 1KN4L 4DK6A 3BS1A 3II1A 4XMWA 3ZL4L 4WTWA 3CSYB 4DKFL 4IU3B 3I90A 1QG3A 3ARFC 1LO2H 3NABL 2P8LA 1M57B 2UZYB 4QHLB 1BCPD 1OP3K 1NGQH 2LTQB 5DZJA 3HOXB 2C34A 4FXKA 1KACB 1WAAE 4KTAA 1XGPA 5LO7A 4R0LA 5I4DA 5CN1A 4EUPG 4ODGA 2IANB 1TUPA 5FJ8G 4PFEA 2HQLA 1JWMA 3LRMA 4LSVL 1IC5L 3RKDC 1VZIA 2JLPA 4XP4H 2Z31C 1UWEL 3MRJA 4N8FA 4M1UB 1BXAA 1SBSL 2ADFH 3LJ3A 4HKZA 2M8XA 4KKBC 2WVTA 3UYPA 2IFGA 3R4DA 2BDNA 1WBZB 5F7YC 4D94A 2VCOA 4KZDL 1KY7A 2R1WB 5EIQA 1A3ZA 3GO5A 2G75A 4NWTL 5BV7H 1IKNC 4LFCL 2EYSA 4L63B 3QQ9C 1WEJL 2BCKB 4PRID 3Q3GA 1IEAB 1R4PB 1N9PA 1R5WB 2EIZA 1G9MC 3BPOB 3HZVA 4QF1B 1S7RB 2X4UA 4P2RA 3GJEB 3Q44A 4MDJB 3PP4L 3ZZSA 3VA2C 5IHHA 4PAZA 1EEQA 4QIWE 4P2CB 2MHAA 2EICA 4FO2A 2VISA 1OAZH 4JCLA 4RZKA 8FABA 5E8PA 5LUMA 4HIXH 1KLFB 4U0QB 2Y6TE 3EOAA 3TS2A 4M5TA 5DMIL 5JIIA 4G9FA 3AREC 4FP8L 2A6IB 1U0QA 1ZHKA 4KRPC 2MQHA 2K5VA 2JJSC 2ZG2A 1ZCRA 4JL2A 4XCFL 4HIHB 1J86A 4J8RB 4WGVB 4KK5C 4DK5A 5H4ZA 4JZJA 5DD1H 4PJ7B 3G5ZB 3I02B 1E5AA 1LJMA 2DD8H 1KYFA 4M7LH 3IMRA 1QFHA 4N2DA 5EPLA 4DGWC 4XAWL 2ADGB 3N5AA 1BZ9A 2EDFA 3QI9B 1SM3H 2BJMH 1MFCL 1OXXK 4YCUA 1AHKA 2BDNL 4JKWA 1BJMA 2Q76B 4CNIA 1GZHA 4PW3A 3ZJAA 1NCIA 3UTPE 4AKPA 1VPOH 1JNNH 1AHMA 3BAEL 5CV7A 3NSJA 4O58L 3BKML 4QRAA 4J2QA 3UZQA 4KJPD 2A73A 5TDOB 4CVUA 4ZX4A 4FULA 1BMZA 1EIHA 3ER0A 4G80B 1TEGA 1RZ8B 3Q6FB 2XWXA 3ULVH 4RCOA 4ZMXA 2VM4A 2QR0B 1QSFB 4BA1I 1TVHA 4M8UA 4Z3JA 4LCWB 3X11A 1DBJL 1CU4H 2QTVA 4QWWC 1KYOK 1T1YB 4YBQC 4Z23A 4ANUA 5JO5A 3SKJH 1UXWB 4MAUL 2BHFA 3GRWH 2F19L 3CXHK 3ZTJH 1VDGA 1SN8A 2A6IA 2IMNA 2YEVB 2GB2A 3PJSA 4P48A 5E4EB 2DKSA 5H8DA 1KPVA 1EEZB 2D3NA 2D0GA 3HOWH 2Q3ZA 3UEZA 3FH7A 1BF4A 3T6WA 3SGDH 3MRBB 4M1CD 4WWPA 2K7PA 2QSQA 5IB2B 4FQXB 4W6YB 4YBQD 4Y4FA 1Z5YD 4EN3A 1YNND 3QUMA 1U6AH 1VGEH 2EO7A 3O6KH 3AB9A 4K3DL 4LUOA 1UZ6F 2LU5A 4WK2B 3U0PA 4HHWA 3W9EA 5FGBA 2R23B 2GJ6D 5I1CH 2AXGB 3VU2A 1PX4A 5CM1A 4P3CH 2R8SH 5D7SH 3BWAA 3WMQA 3GSUA 2JXMB 4K5NA 3HN3A 3L4ZA 1KN2L 4CUCA 1BVOA 4JBJA 1H8SA 3S35L 4LF3A 1UB5B 3QFDA 5LN4A 2AABL 1RJLB 3P77A 4GW5A 3O4OC 5E2WH 4KQ4H 2CR3A 1AZBA 5GRVK 3UZVB 3PIQA 4WSKA 2JE6I 1ZYRC 3TSSA 2X44D 4PGJA 3U50C 1M6UA 4Y2OB 5AFWA 2QADC 1MIML 3AS3A 4LF7L 3DV6B 3BAWA 4X8CA 5HDBF 1I94Q 4L4VB 2WSKA 3TS0A 5I26A 3D4WA 1TZHA 4YR6A 3BC9A 1RHHA 5C6TL 3BPCB 5AW2B 1H9VA 3CFIC 4FFZH 4TSCH 4QD2E 4Q4IA 4PJCB 3NYKA 3ZT7A 5DC4B 4L1HA 4AYMC 1HE7A 2D0PA 1CE6B 5C0EA 3CP0A 4NQQA 1OD7A 1PLGL 4HP5A 5F9OH 5J06A 5FCSH 2A6ED 2EQSA 2YK1H 2Z9HA 2ZG3A 3NQTA 4X7DC 1D6VH 4FF2A 1UKSA 1TVHB 1BGXH 1M7DA 1PTOC 1DQLL 1ODAA 1AGFB 3J7ZC 5D2LB 4JPIA 5EF0A 1XIWB 5JXAL 3FP9A 3I75B 4JGUA 3BRGC 4BJLA 1CB4A 1CD1A 4UV7H 4N3UA 4LPCA 1E9OB 2A6EC 4Y7NH 3FQRA 4TQEH 3PGCB 2E5EA 1G291 1EO8L 1DANT 3T0EC 1B0RB 3PP3K 3VFTA 4MS8C 1AOHA 4OUUA 2Q10A 4J3OC 1NNXA 3VFUB 5F9JA 3W11C 4OWWB 4PVBA 4FQXA 3ULJA 4RH6A 1N34Q 4GXVH 3ROLA 1OQOA 2OM5A 4KRPB 1O80A 4Y4KA 2DLEA 2F7QA 1KOAA 3SE8H 4R4BA 3EA6A 1I4XA 1K72A 3MYJA 5EO9A 1R33A 4NIKB 1C8CA 2W95A 5MEOB 4ATWA 5LVEA 1BAFH 2BY3A 4WW1A 4ZODA 1W8EA 4XPBL 1IAIL 4UCFA 3KEDA 4YBLB 4FFVC 3BPLB 2IT1A 1JMXA 1HI6A 3QQNA 1JZ2A 5IW1A 5D1QB 3JT0A 4U3CA 1GSMA 3MBWB 4FQIH 1ZHKB 3MZGB 3LWEA 3GS7A 5T1IA 4YHNA 4ZFOB 3F6IA 2A38A 5FHAH 5F9AC 3CD4A 4BSWA 3QUZD 2WXMA 2WLZA 1N7ML 1YAZA 4RDQG 2XYCA 4XNAA 1MFBH 1LQBC 1OAKL 1TTBA 2FL5B 1QD0A 4YDIH 5EJWA 3X3MA 5I19L 2PWGA 2IHEA 2VISB 4QHNB 3DX3A 5CEYA 3BJ91 4R8IA 2YGOA 5DRNA 3Q9QA 3FT2B 2NTFA 5J5EA 1P6WA 1I5FA 3MV8B 2IAMA 3HOYG 5BVJA 1E3FA 1JF1A 3MV7A 4YPGA 3E7JA 1CDIA 4HIDA 5DYOB 5HYIA 2Q76A 4TUUA 3AY2A 4NB3A 2IY5B 1YPZB 1FC1A 4IIQA 2CW0C 2J4XA 4ZFZA 4OJFL 1DQMH 5JEAH 2EKSB 4HBCL 5F7DB 1CGVA 4JI6Q 1FBIH 4PG9A 1QASA 1IBYA 3QDMA 3DVFA 3IWVA 4KNUA 5E2WL 3ULAB 1UA3A 1HNFA 1NCHA 3L2NA 4JFYA 4MJIB 3CPWA 4P3WA 4Q6IB 5I8EB 3OGCA 5IP9G 1F6FB 3OC5A 4HK3J 5BZDA 3EHBC 2IW3A 2UZIL 1N8ZB 4WDIB 3AT8A 4YAQB 5CLYA 5C0DA 4OR1A 5HI3D 4ELMB 1NBWA 1A7NL 4GLXA 3MDJA 4ZS7L 3KLAB 1G43A 1SOKA 4W4NA 5JHLA 3HHMA 4J4PA 4X6FA 4KAQL 1RPUA 2F0WA 3VG0H 4AW7A 5DQ9A 4PS8A 4ZW5A 2HP4A 4YDIL 1HVXA 2R0WH 4QQBX 4I4WA 5HJGA 2F58H 1O7ZA 3U2SB 3H91A 2FEEL 1Q9LA 4XMKL 4APVA 4MJIA 1JZDC 3MREB 2HLFD 3DTXB 1IC5H 3FTZA 3RFZB 2B2UA 2XNAA 3GXMA 5GSVA 3V0AC 1WUZA 3W5MA 3RUZA 2CU9A 3H2PA 5C3TA 5EPJA 1S8DA 4R4CA 3N41B 2ZSWB 4N87A 4A93G 1IBKL 1A64A 1RZ7H 3MOBH 5EF3A 4Z7WF 3BWUF 4MQXC 3MV11 2NQDA 1E0OB 1F11A 5M5WH 1K8GA 3VXRE 2FMCA 4FP5D 2X87A 4UIKH 4TRPL 4W6XB 3SPJA 4EDXA 1C08A 4MS6A 2R0KL 4HIIB 3PQYB 4Z0XB 3WS6A 3QJUB 2Q2IA 2QGQA 3UTTD 4DGVL 5AW6B 3BHBA 3RHWF 3L2PA 1ILUA 2BX5A 5DRNB 5AW5B 4FZEH 4YK4B 3EZJB 3PWPB 5KOVC 5TSSA 4R7NA 1U8CB 3RTQD 4B9XA 5HGHB 1NBQA 3ARYA 5F72S 1R3HB 3I4OA 3RDTA 2J4WL 1FGBD 3ARBB 3H8NA 1H6UA 3UBFA 4UF7C 4Z7NF 3F05A 1A7QH 5IVZB 3UIZA 5DRWA 2CWRA 5HI5C 3VD2A 2PPAA 3IJSB 4F7PA 2WJ5A 1E67A 4LSPL 5FPIA 4PY8J 2XGTA 4MD4B 4LWCA 5A7EA 3GDEA 4NQED 3QYCA 1KZQA 5E9DD 1CDYA 3AUWB 3PWVA 2PO6B 4JGJA 3X1NA 1CXHA 1L9TA 1RZIA 2CHXA 5FYKL 3PF4A 4PJFB 5T5FA 1PZBA 2N8NA 2AEOA 4IUQA 2DQJL 2IEPA 2VLLB 1TTFA 1XL4A 3QRBA 5T33L 4YUEH 4KTGA 5GGUA 3C9NB 4I3SH 3QI9C 3L13A 4PTTA 1YHAA 2X2YA 1H19A 3T4AC 1XL6A 1P7HL 1YNXA 1W0WA 1NGYB 2AMUA 2WCSA 4HCEA 2FX7L 1X7QA 3AJ7A 5E6YA 3FK3A 3S15B 4HYTB 4GSRA 3EG9B 3G08B 1XXFC 1KNEA 5DM73 1G87A 2DN7A 2NZ9D 2YOAA 3H15A 4RX4D 4PWFA 4XZUA 3JUYA 2TAAA 4WUKL 4MX7A 1Z6HA 2JSOA 2ZICA 4K7PY 4JKNA 3CSFA 5HGGS 1F3JA 2AJVH 4ZW7A 5CGBA 3R8BA 4TLSA 3ZDXF 4GP8B 4HULB 2BSEA 3QGVA 3ABGA 2EYMA 1ZXTA 2J1ZA 3O0RH 2NN6I 4A3JG 4ODTL 1KBWA 3QEUB 1A47A 3A0JA 1WIOA 3FQ4A 3T53B 2EEDA 4HKXB 2W65B 3WXVH 5JZ7D 4R4FL 1UCBH 4C2MB 3DUUB 1D6VL 3GB7A 1A6ZA 2P5WA 5A2JH 1QATA 1QFOA 1JBJA 4JX0A 1FORL 3RWHB 3HZ3A 2EAEA 1ACXA 3WLWD 1JZ7A 3FN0L 4TQIA 2MPMA 3BGFB 3VXTA 3WIIH 4FF4A 3RLNA 1Q9KA 3M8OL 4BKLB 2A77H 1IGFH 4CMMA 2O26U 1OD9A 2NQ3A 3BD4A 1JV5B 4ZRGA 1A1NB 4L8SB 4LEBA 4NLAA 1RJZB 3FMCA 1OGPA 4HVBA 8CGTA 2VW7A 1F5WA 3F5WA 1Q0YH 4DUXA 1S5ED 5J11C 25C8L 3FOLB 4KTYA 4ME5A 4A3EG 1K8AC 1HL9A 1LHZA 2KKQA 3D07A 3IDIA 3AREB 4HS3B 4QOKE 3WTUA 3BRFA 5EBMA 4ZKCB 3VGEA 1DJSA 5I1AB 2HG5A 3IJ9A 4WHTB 5DXWA 4EN3D 5HDBE 1W6KA 4GS7C 2QQKH 5HHNB 1OB1A 1MCKA 4WI6A 3BQUB 3D09A 4Q56A 3TEHB 5GRUH 1MG3C 3TBVB 2VR5A 2F3IA 1I1AA 1MAML 5DJ6A 1NBVH 1FNWA 1TNMA 5D7IA 4Z7OB 2GW5A 2TSBA 3GMNA 4AM0B 1BV8A 4RVBA 3O3DA 4WK4B 2NMSA 5ID0B 1QHOA 2R29H 3O0LA 4WKXA 4X6EB 2K33A 1COBA 4HWBH 3D51A 3PAVA 4RGOH 4UOQA 3S35X 4XX1E 4A3IH 5CINL 4JQVA 2X40A 5TDNA 5GHWL 1NBZB 5CLWA 4QRPE 1YUKB 2VDNB 3II3A 4YX2H 3FOMB 1HSBB 1QRND 3CFEA 1OHZA 1VLXA 3O3UN 2VUYA 1MZZA 5CMDA 5KBLA 4XN2A 4LCWA 1CG9B 3PWLB 3REWB 3HE7C 2H1XA 5D1XE 4IRZH 3ZYIA 1EXUA 3WN5C 1J1XH 3HOVB 4TSAH 4E6IA 5L88H 5F3BB 4LEXL 5ESQA 3L0OA 4UNVA 4DTGH 2XQYG 4XNZB 3ERSX 3DO7A 4W9IC 1FL6A 1MQKL 3ESUF 4LSTL 3RNKB 3P02A 3IXTA 3VVVA 5I6LA 1OT2A 4KI1A 2A2QT 1BIIA 1JZFA 1U33A 1YJDL 2UZPA 2C9QA 4N1HB 1QO3A 3U1SL 3FUKA 4ZUIA 2PWDA 1UKTA 3AQDA 2YKKA 2V6HA 3WDHA 1KQSA 4UILL 3OKLA 5J22A 2ZWSA 4NDMA 3SE3C 2GITA 1CLOL 2Z7ZA 1I6HH 4AZ8A 4MMZC 5C0CD 5DRXA 2HFEB 3U9WA 2UXCQ 3HOZB 1Q46A 4OZHA 4XB8A 5CP7B 1HZHL 4JI3Q 4G8GE 1EEID 3GXTA 4TLKA 4FYTA 2OMYB 1P0SE 1X3QA 2IGFH 1T4KB 2CXGA 3KUPA 2HLAB 3T13A 1CICC 4HUVA 4B53A 1AHWB 4K4KA 1UEAB 1UJ3B 2K50A 3BEWB 5D72H 3O6FD 4E9VA 2WQSA 4JW0A 3NPZB 4BZ2A 3BUTA 3ZKXC 1B44D 3QEHB 3CLEH 2WP3O 2NVYB 1B0GB 1QWNA 5DYFA 2EXDA 1W0WB 4ZZFA 4IQZA 1QUQB 3B7RL 1JGDA 3EOBA 2B1HH 3V52L 2ZPKL 4PJDF 1SXZA 4DO6A 1EJ8A 4FEIA 2J72A 3GYRA 1UT9A 3EW3B 1CICD 2WNXA 5IOCA 3H9HA 2JI2A 4H2CA 5B3JE 4HX1B 2IC2A 2YA2A 4WKZA 1XMQQ 5K5YA 3ZUNC 1HHKA 2SEBB 1XH3B 4A2HA 2A99A 2HUHA 1J48A 1GY1A 3NFSH 3Q3GB 4JPVL 4WV1A 2Q87A 2XQBL 4EZMA 4QRSB 4L3EE 4RQQB 4S1SH 4UAOB 1W0YT 4Y19D 2YXWA 2QQQA 3L81A 5E2TL 5GGSA 1C7TA 4QMEA 5EBLA 1E2ZA 4G7VL 4H7BA 1J9OA 4F8NA 1FVEB 2K3HA 4LSUL 3A5UA 3GD1C 1NOLA 4KOCA 2GPZA 4AJ0A 2WY3B 2XZQL 1U8CA 4ORGB 3HG1D 1CE1H 3NAAL 2NY7H 1F8TL 1UM5L 1K6QL 3TT3L 4UPAA 4PRAA 5JHLL 2HT3D 2DW5A 2DLFL 4DERA 4X8GA 3ISRA 4QXTA 1K3BC 2RCSL 3IMVA 1JL8A 3WOVA 4W70A 4Y5XB 2R0LH 4CADA 4ETQA 3DBXA 5ACZA 1N3NB 1R3JB 1THAA 4LF9Q 1SLXA 4ODVL 4Y5YC 3NJJA 1IGYB 2P28B 2PQAB 3NJGA 4Z7QF 1G6RB 4ZUUA 2XXCB 2I24N 3QP3A 1SFOH 3DXJC 1TJIH 1UZ8A 4LASL 2C3HA 2BNQB 4YIQB 4IPCA 4OLWH 3QORB 2NY5L 4YEFA 5C9JA 1GUOA 3PUZA 4BSVB 2ZM6Q 4WI0A 5DSCB 1Q0EA 4IRJC 5AZEL 4S0TD 5AD0A 2WKCA 2J55A 3QZWB 2DM3A 3ZDZE 2B3IA 5ALCL 1KV3A 1NFDF 1PFMA 1Y07A 4Y1SA 2K7QA 3T16A 3KW7A 4WNJA 5KW9H 2LXKA 5GGTL 1XV8A 2YRZA 3DO4A 1QFWI 3KYMA 1CR9L 3FTUA 4G9DA 3ZHLA 1FIGH 3EJUA 2GBAA 4OCWL 1B3JA 3BVNB 4I0PB 1AKPA 4Z76B 4P2QB 2EABA 4MMYB 4IRJD 2K8QA 4HIKA 2C9AA 5GZOD 3C1FA 2ESVE 4G7HC 1IAOA 4XVTL 3QXTA 4XCYB 5BZWA 1I9RH 1VQJA 1SJVA 3MODH 2WKDA 1CFQA 2F0OA 2AJYL 2JP1A 3S88L 5D3DA 2VLKA 4LOFA 5JR1H 5CV6A 3V6OA 5KYXA 2ALYB 2EY6A 1L0QA 1XF2A 3LEYL 1YIJA 3FT3A 1JDAA 3U6XA 3CVHB 4KBPA 4M5SA 1BD2D 1VFBB 4QDGA 1S40A 1DVSA 5KVEH 1EJ6A 5E94A 3W39A 4L37B 4FZ8H 4HJIA 4WJWA 3GBNH 4WI5A 2XWTB 4JI5L 3OC8A 5CSGA 2OCJA 1NCBH 2FYYB 3QC6X 1KRTA 5FKAC 2Z65C 3NE5B 3Q6GL 3D7PA 4CAGA 1ZTXE 5I74C 4IW4C 4ZUSA 3BIAX 2Y07H 5CSBA 2C7UB 4BFNA 3L9RB 2OK0H 2DIJA 5FXCH 5JIHA 1WTXA 1P5VA 3KJOA 1YZ6A 3QPKA 2MCPL 4XO9A 3KPPB 4J1MA 5SWZB 2FIKB 2CCLA 4GNKB 3QQ4B 1KGXA 4FF1A 1LTAD 2R4SL 4IJHA 3KWXA 2HCCA 4PS4L 2BA0A 3T0EE 3K0WA 1O5DT 1X3DA 4NZ8A 3CVDA 4DP5X 1R4QB 1X5YA 1X5XA 2I85A 5F7BA 1HI6B 4N2LA 1GJWA 2X6LA 2X28A 4WZ9A 5JLZA 4YHYC 5CZRA 2AAVA 5EFIB 3L3IA 4YMPA 1H3XA 2UZXA 3BZFB 3DHUA 3DMUA 1C4QA 4G7ZC 1XJVA 1G0XA 1G9NL 3PHQA 4IRSA 4WW2A 3T77B 2JI3A 3WY1A 4Y52H 5M9OA 2WXPA 5AW1B 4A3MG 4QHKJ 3CXHJ 2DQHL 1P7KB 3KLKA 3ARUA 3S34L 1O7IA 3IDGB 3B3BA 3ESMA 3JTTA 1OT4A 3JAMc 3EJZD 3CFJA 1EUUA 1FAIL 1U2CA 4I77H 1UZ6E 4UYPA 5EB9A 3VH8B 3VTAA 5AYTA 5FDWA 3TZUA 4PVNA 3NWTA 1MKFA 3F2CA 4O2FB 3SDDB 4GLRI 1Q1JL 3BKCH 4BBSH 2ARJQ 2FNBA 3AW5A 3K5SA 3WG7B 5IFHL 4LP4A 5C09B 4X6DF 3KJ4B 4AWJC 5HYFA 1HSAA 1E9PA 3K0YA 2HKFL 1JICA 1INQA 2FH8A 1MUJB 1D7CA 2OEOA 2WLHA 2K28A 4HTHA 5C70A 1RURL 1MHEB 1HJCA 2HCZX 1N64L 4JK0D 3T0DA 3EYFA 5IF0B 4AYFA 1HXYA 1T03L 1CA5A 4PV9A 1N6VA 2DKMA 3TQYA 3CG8A 4JRLA 4XP4L 5L2JA 1CZ8H 4HQQL 4OGAD 1WT5A 1PDKB 3B2XA 1YUHA 5AKVA 3C8HA 3QISA 3U9OA 3TCLA 4OL7A 3GSXB 1LTLA 2K45A 4OFKA 2B77A 2LHAA 5DUJA 3KYNB 5F93C 4L0ZA 4L4TD 1C5CL 2AXFB 4LSSH 3TZVB 5KANG 4L3ED 2VXUH 2Q2HA 2NX5B 3INUL 4KI5F 3WNLA 3QDGE 1KTKE 3MRDA 1HNWL 4H88L 1RK0A 5D72L 1PF3A 1GHJA 3LKQB 4OGAC 1MQ8A 3WNPA 3GUTB 2JJUA 2VR8A 4R97B 3IRCA 1A9EA 2W65A 1RIVH 5CYUA 4FCHA 5E7FA 5FYJE 5GS0L 2HVKB 3IFPA 1VHPA 2OL3A 3EFOA 5BVPL 2BWIA 5IBUB 3MUZ1 3HOWB 3FCBA 4PB9H 2F74A 4P2OD 3WTVA 5A1AA 1UB5A 3N6YA 1QTPA 5MENA 4PJIA 3HOVH 1B4JH 1AD9B 3VMPA 1AXTH 4R8NA 4ZMPA 3IS0X 4JRYA 3MFGA 3QVAA 4NPKA 1WZKA 2SEBA 2V33A 4GS7B 3P4LA 4PJ5E 2CK2A 4IEFB 3C2PA 1ET7A 2GUOA 4P5SA 4L8CB 4QXGL 1KJ2B 4GQPH 3ZDYF 2O6EA 3VXPA 4FNLH 4OJDH 5HDRA 1MJEA 1EO7A 5E8NB 1GGIL 1Q3LA 3V6FA 3D3VA 3OPUA 4KD4A 2VZUA 4FI8A 3WFBL 3CHPA 2WLKA 1C5CH 3W81A 2ZX7A 2AJ3B 4Z7VA 1T1YA 2IQ9H 4ZTEA 3KYKH 1UJ3A 2PPDA 4YLCA 3CC1A 1S5FD 4GMSH 4MFHA 3OXRA 4JI5Q 3CAMA 3KZ8A 3W0WE 3LN4A 3QJSB 3PUYA 1MF2L 4TNFA 3BCDA 3ATBA 2O5ZL 3Q0AA 4D9RE 1PH7A 1EUJA 3UAEA 1HIMH 4ORZC 1PZSA 5BN5A 4AZ8B 12E8H 1KCWA 2F0LA 2FQFA 2WLLA 2V9UA 3APCA 5BS0D 1SEBD 1CK0H 1DCLA 2HT4C 2J56A 4L5TA 3PAYA 1N70A 3H3VH 1CWVA 3QUYD 2KT6A 1E27B 2IWFA 4HISA 2D2OA 4PCSA 4CSTA 4GKZB 3V52H 4L3EA 3V6OC 3E9TA 2W07B 5LCVA 1LWRA 1D9KD 5FHAL 1GKOA 3DVIA 4UDUB 1YECH 5CJ8A 2ZUTA 3G04A 3P3RA 2ADGA 4GUPB 5IIFA 5ESQB 4RESB 3L2LA 3C09C 3GEWB 4K6DA 5HGDA 4HLZG 3V4PL 4HJGA 4D9QD 4FHJA 2CMRL 4XPBH 3TBTB 1F02I 4GI9A 3WIFB 1T1WA 2BNRB 1RTNA 3ESNA 4FQ1H 4QRUB 4UTBL 5IIEA 1JHKH 4WEUD 1MIEH 2A77L 4BFEA 5G55A 1OAUL 2VL5A 5AAPA 2VAAB 2PMZB 2WC7A 2KC0A 4HWZB 5EZLB 5GGVL 1BVNP 3KPSD 1CFTB 1F00I 2Y69B 3T0AA 3PABB 4K2LA 5HGTA 1XNRQ 1A3RL 2OSXA 5D1XD 3FEWX 1FJ1A 4XCEA 5F7WC 1XR9A 4WHDA 1FNAA 4KHPL 2C3VB 1VACB 4WHYH 3HMWH 1BFTA 1KTLA 4U1MB 3SCMB 3K6IA 1S7RA 4NM4L 1QKZL 4J3XA 2CHBD 1XNRL 2E27L 3IFOA 4JN1L 4KJWD 4WENB 5CILH 3HE6D 4XP5L 3APDA 3GTNA 2R9HC 4JRXA 3D6CA 4AEFA 1TWGH 5D1XC 4F3FA 2P48B 1MAMH 1GJIA 1G7JB 4K55A 4LQFH 3C2AL 4HKZB 3K1DA 4JO3L 5KSAD 4UNIA 3UYPB 5F9OL 2FJUB 2G9HD 2NY5H 5EIVA 1DQTA 4V190 2R61A 4WQOA 3PO3H 1UQSB 2C9SA 3BZDA 3K6SB 1NM9A 4P4KD 2IPTL 2R92G 1ADQL 1RJZA 2IAMB 2ENBA 1WGVA 3DHPA 4JPWL 5AVWB 4YFLI 3WMSA 5F7FA 2E9BA 5MHSE 3PQIA 4KO5A 3GMMB 4HD9A 4EKJA 2J7ZA 3U0WH 1D5XA 1L5GA 4N90E 1S6NA 2UXBQ 4KK8D 3NJMA 5HHPA 3DLQR 2YGNA 1ETB1 4UT6L 4Z77B 5I1DB 1I85A 4QTFA 4P4KC 4MDRA 2K5QA 4KKZA 1YAIA 2WPGA 3T09A 1F2LA 1BXXA 1DQKA 4KY2A 4PBWD 4UIMB 5E8DH 3T8XB 3SN6N 1WFOA 3AM8C 3DTUB 3FBQA 3A67H 2VUMG 3HLAB 4DR7L 2G0LA 1XF3A 2NNAA 2DEWX 3LPGA 4UQ2A 5KN5B 5DF0A 3M6DA 3T0ED 3N44B 2R7FA 2P5WE 1FCCA 5EUKB 4JBWA 2HQEA 3CF5A 4OB5H 4RMQA 1RP9A 5CV8A 4B5ZA 3MYJB 1ASQA 4DV3Q 1LGVA 4LPXA 5LGHH 1DDTA 5A43C 1KYDA 3FUEA 3H0TB 1XGTB 1JZ6A 4PB0H 4YHPA 2R2HB 2PP8A 3CHRA 1RLWA 4L9DA 3KPMB 3R0NA 2EYRB 4NP9A 4KZEL 2I5YH 4APXB 4JFUA 3P9MA 1BD2A 1G2SA 3DVNB 4ACPA 4LO9A 1J9SA 3VFRB 2NY1C 1G7QA 1M8AA 1X55A 2BVOA 3WFHA 2H1EA 1D5BA 4LP8A 3G5VB 1TFHA 1I8LA 2NNXA 1A8JH 3ARGD 3MR9A 4OO1G 2XTJB 1YNKH 4Y7OC 5A2FA 1HDMA 3MRKA 1X3GA 4R26H 4I3SL 3ULUF 1QYGL 4X50A 5D2NE 2IPUG 5M5XB 1NGXB 3EIFA 3FSOA 3PQYE 4DP0X 1CF1A 4H4NA 5D5MB 1HYSD 1IKFL 2R56L 3AAZA 2NUTA 3WWVA 1FFNA 4PJEA 1KBGL 3WY3A 3V0DA 2WLNA 4OY9A 3V0IA 1JYXA 5LCVL 3EIVA 4IJLA 5AG8A 3GMOB 5C71A 2FQGA 3A67L 1KTBA 4L8DA 3WXWL 5K9KA 1FVCB 4B3RQ 1AS7A 3I9IA 1S7XB 1R6VA 4PW4A 3DXAB 3NBHB 4A04A 2LGNA 2V9TA 2VZTA 4G11A 5B1CA 4JVUA 2AEQH 3GMMA 3DROB 4C3HH 4XNBA 2L8AA 3BPLC 2AXWA 4YBHA 2EH7L 1H3PL 1I8KA 3AB0C 4AITA 2VLRA 3S5LB 4MCNA 4M48H 1MI2A 2HLEB 1HOCA 1H3TA 3KPTA 5IW6A 1QRNA 1C8QA 2GAZA 5JW4R 4E9XA 2PYFB 4F2MA 4EE2A 4GAJL 4L4JA 4X5WB 1UVQB 1EH9A 5HI3C 4DKTA 4LLYA 5C0XH 1JFQH 4KUZL 3EDDA 3HOWG 3L3KA 1RD6A 4F3FB 3WFDH 4MD0B 5KSUB 4JFEA 1LM8V 2MO1A 4P2QD 3BT2L 1EXHA 2X09A 5JOPE 3KLHC 3B6YA 3H0GG 3ARDC 2A9BA 4UIMA 2A3TA 4JQXC 4PS3A 5I19H 1OCOB 2BIOA 4XO3A 5AYUH 4U1MA 3UTSD 3NP8A 1Q90A 2M2DA 7TAAA 1XIWC 5SX5H 3IB4A 3T5WA 1K8IB 2FK9A 5HPMB 1JPGB 1MFUA 1V55B 4AGPA 1ASZA 3B2MA 2R0KH 3LKNB 1S9WA 1OGTB 5LBGA 1CLZL 3UH8A 1JGVH 4UQBA 4FKEA 3KXFA 2XBDA 1WCMH 5D70H 2PMZA 4NWTH 2D4DA 4W93A 5BV7L 1Y69U 4WW2F 4DN3H 2ESVA 1CLVA 4S11A 4ZFFA 2CLVB 4RKBA 1XCTB 2ZUYA 4BFRA 1TOXA 3OZ9H 2A1WH 2VDQB 3RPIB 4P59L 3ECQA 3D85D 2R39A 5DMKB 3D8GA 4ZDHA 2C9UA 4LNRB 1NTGA 3I7FA 1U8NA 4EBQH 1SDFA 1C5BH 2A6JB 4ZNEA 4AKOA 5CEXA 2X4NA 3D18A 2JB6B 2AJYH 2G5RA 4L9LA 3VR4A 1KB5B 1VEOA 1VQIA 1YEFH 1JHTA 4R84A 1OZUA 2J5LC 2X5PA 1STAA 1IBZA 4YHOL 1VADB 3GSNH 5D4JA 2VW9A 3I2CL 2VSCA 1UM4L 3LKPA 4FG6C 4JI7L 4F7MB 2YQGA 4JV5L 4JDEA 3C5ZB 3SGKA 2FL5A 4ONGL 3ULVE 4X62L 4M43L 3UAFA 4KITB 3DVGB 4HWZA 4UWQB 1H9SA 2E76C 3I02A 1FE8L 3SE9L 4F9LA 3QQDB 2IADA 3W1BA 2H0JA 2YSSB 2EDMA 3MUUA 2WYIA 2Y1ZA 4RFBA 5DEHA 4FA7B 2OYPA 3AMKA 3F64A 1EU3A 2ZAIA 3GSQA 1G84A 3D0LB 2R56H 4DAMA 5D7JA 1A4CA 1BBJB 3EOAB 3HBPA 4K8RL 1MRCL 1A1MA 2F0GA 5DQJA 1OCWL 4CJ1B 2VDPL 5AW0B 4WWID 2VXSH 1XCQA 2XT1B 4UDUA 4XNUH 1TY2A 3TO4D 2UV3A 5FUZH 4XMPL 5GSRA 1TQVA 5I6YA 1IZKA 2F54E 1UM5H 5I5JA 4RWHA 1KBKA 3GJEA 1FGUA 1A3LH 1K9MC 2AV1A 4MDJA 4NO3A 2NLJB 4OUUB 4QGTA 1DBAL 1YEZA 1O0VA 1RK7A 4KI5C 3UPAA 2VDOH 1GO3E 3CHQA 4GT0A 4MCYA 2BCMA 4N9GA 1VKXB 1JORA 4OCSL 1XR8A 3GK8L 3MGOA 3J80i 4JFPB 4C4BA 2CO6A 3F7LA 1HUMA 1ZPUA 2JKSA 2WKOA 5C0BE 4DK3A 1WA2X 2L11A 3FKIG 2DJ4A 3BH9A 5DD6A 2W0PA 1ASOA 1SFDA 2Q3AA 1Y6KR 1NDMB 4P57B 4V11A 4ZO6A 3HB3B 3UL4A 4PRDB 3UYRL 5CSZA 3BFWA 5AVUB 5D9SB 3L1OH 1LK2A 2ZJPA 1EAJA 3VE0A 2J1YA 2R8SL 2PNHA 3OJ2C 3TC9A 4AV5A 4ZPTA 3QQ9D 2HT2D 3VWJC 2X6GA 4LSRL 4Z8FL 2EE3A 4R4IA 1T5WA 3QZWG 4YZFF 4OKDA 4NWUH 3ULVC 1EV2E 3BVVA 5JW3H 3GSXA 3PGFL 2OR9H 4U3HA 4RKLA 4U1HB 3I85A 1TJHH 3IRZA 4J3OF 2RA1A 1S7TB 3OKMB 1SYEA 1A25A 5FC9A 3AG2B 4G43B 3ZT5A 3FT0A 4IUTA 4AYFB 1JZ5A 1WAAA 5LXGH 1NCWH 3S3JA 4JFED 4L29A 1HL4A 2QQLL 1V1PB 1GKHA 4ZO8A 3UTSB 1TQOA 2YZ8A 4Q8BA 5KIXA 3GHBL 3ILPA 2UX6A 1ED3B 1IAIM 1KXVA 2CQOA 3KGRA 4HAEA 2J1WA 3RGVA 3L3OB 4RHRA 4C3JG 3BG3A 1XGYH 4FA8A 1T5XB 4ZFOL 1ZLUK 1INDH 2Q2LA 3CBRA 3KLSA 5IYBG 3X13B 4QAWA 2YD5A 3RVUC 4DV2Q 4AYID 3LV3B 5JTWA 1YECL 2WW8A 5DHDA 3VFVB 4JPBW 4Z3TA 3LKQA 5J6GA 2QTEA 2CBPA 4ZQKA 4MA8H 2EE0A 5I2IB 3CFJB 1ZDQA 4ZXBB 3FJTA 3WS3A 2RBLA 5AB9A 5DVLA 2ZXOA 1N2RB 2YC1B 4XVJL 2J5WA 4LMQD 1A14H 1JHKL 4KJPC 2X4TA 3RVUD 4KJNA 3HOUH 3J2PA 3UCRA 4FQ1L 5L6YH 4Y2NA 3CUPA 4GRLB 3L3JB 5CU5A 3I8ZA 5EUOB 3SPIA 4G6AC 2R69L 1EYCA 1IQWH 1KB5H 2BHZA 1CHQD 1JI1A 1GC1C 4PV8A 5CZVH 1NBYB 1TYRA 3PV7A 3QA3B 4H5SB 1QLFB 4F93B 5EU3A 3LMJH 4H8VA 1KPRA 3HKZE 3M4OH 3EADA 3QQ4A 1EZ8A 4WORA 5F7AA 2XRAH 3RJDA 3VRJA 4ZZKA 2RHQB 2F0KA 4HXBL 2A6HC 1T1ZA 4AEEA 4B7IA 3ZGHA 4JZNB 4HG4K 1T9HA 1AGCB 1GHFL 2VB5A 3NJNA 6FABH 1JGIA 2GBTA 1PRTF 4BV1A 2PZWA 2H6UA 1HIML 4H0LC 3IT8D 4GMTL 3HOZG 1PSKL 2C4FU 4JVWA 4YHKL 3TJPA 3BGAA 4DFHA 1VQLA 5EHFA 1TYEB 5C4XB 3QI9A 4M7KH 3QS2A 1M2VB 1IGIL 1VFBA 3WAKA 4WW2B 3N85H 4Y9FA 1QUNA 4GFTB 3HAEB 1YNLH 3PRZA 3SK5A 1TJMA 5DLML 3HFML 5BXFB 3MA7A 1CFQB 1MRDH 1NCUA 1NJIC 5ABZA 1JJUA 5KS9E 3R06A 5IGCA 3RGVD 1WV7T 1TVBB 5IOKA 5CJBA 1I9JL 4J3OH 3UCQA 2EVJA 1QRNE 1T1ZB 5I6PA 2RBMA 2QADD 1U5KA 3BAEH 4O58H 3MGAA 3EQLC 4NQEB 4ZAIA 3KPPA 5CBAA 4DV7L 3UX9B 4CVXB 1TKWB 4DEPB 3BCFA 4DXFA 1PLAA 3INUH 4H5SA 1FGNH 2ZKYA 1SLUA 2WQVA 2ICWI 4GI6A 5F1NA 4XO8A 4WCYH 4YQXL 1JHLH 1E3ZA 3ARDB 3Q05A 5BZZA 2F53D 4P9HH 5H37A 1UENA 5ICXB 1OGAD 3SO3C 1LNUA 3O8XA 3CUPB 3ZQWA 4LVNB 3MV9A 5E4OA 4GEJA 4QXUL 4JEGB 5ELOA 3M17B 1Z66A 3DECA 4A3DG 1G7MA 1OP4A 1STGA 2DWSA 3WFDL 2FR4B 5JPMB 4PV1C 2B63H 4MJ6A 5INDA 3FU7B 1AS8A 4HJJH 1YZZA 4ZD3H 4OX9Q 1F4WH 4R0LB 5AWNL 4ZMLA 1HKFA 1O7YA 2YD9A 3T3MB 5IM7A 4BXSV 1KFAL 3STBA 1G9EA 4JI8Q 3T6ZA 3PAZA 3CMEA 1UYWH 4F7KA 4OELB 2J43A 3R0MA 2Q7YA 2ZXCA 4EI5B 1MXGA 4DR6L 2HWZL 4NIYE 4PHZA 4ANWA 2C8NA 1K2DA 4N8X1 1JGEB 1RZQA 1HZ9A 1A9BA 3VFNB 3HUJE 5FOBA 1QA9B 3EROA 3MLXH 3T2NL 3GT6A 2YEQA 4L29B 4PV8B 1JRHH 1VIWA 3V2AR 5DUBA 4OO1I 2VXVH 2G2RA 1RHPA 5AVSB 3DNKA 5BS0A 4IUNA 1M7UA 4Q9CA 5HHMD 3OKMA 4UT6H 3FYIB 4DZ8A 2X41A 3OR6B 1ULVA 3N0AA 4OFYD 1EY9A 2BSDA 2CGRL 3Q1SH 4TVPH 4PR5B 4R90H 4UANA 3TO4A 1TQSA 2VE6A 4JO8A 4DV0L 4OLEA 5C6AA 4UB0L 4XVSL 4MNHA 1FNFA 3QCVL 4JW3A 5E8EB 3WS3B 2EDGA 2ZXPA 2LFGA 2GJ6A 2XPGB 2EE2A 4AIOA 3CDZB 5LQBH 4QYOB 4HXBH 1KGCD 4CU7A 3BP6A 4X0NA 5C08B 2ETWA 1OW0C 3MC0B 2D73A 4LHUD 2VQEL 1A7PL 5ISZB 1WIPA 3BFQG 3OKNB 5I1JL 1AC0A 1D9KB 5J12B 2XG5B 1Z9SA 5JEAJ 5A3IC 3P11L 3RLOA 5ETUA 1TO4A 4QRRD 5GS1A 4XI5C 3T04D 4DNTB 2QBWA 1KXVC 4PJGF 1PW3A 4PG3A 5HJ3A 4AE0A 1LD9A 1IGML 2Z93A 5FM8A 1LNUB 3O8XB 5FA3B 2QHRH 1FN4B 3RLFA 1WFUA 1QNKA 4QRTA 5D5MF 5DZAA 2NYZD 4TVSa 3SDYH 2I7SA 1R5VB 2XZAH 4HH9A 2VXQL 3WE1A 1B2YA 1B2WH 1R5IB 3QXAB 4HDIB 4OAWB 1U41A 3QULA 3B7SA 2N7AA 1LT4D 3QJYA 1GR7A 1YDPB 3EF7A 4HFWB 5D8JL 3A5VA 1OTUC 1FL6B 3LZRA 4PP1C 1DOKA 4XVTH 1EIYB 1BXVA 1JNLH 2CRYA 3NTCL 1FSKC 1MCNA 3PIOA 3JWDH 3CPFA 5IOPB 2LOEA 3CZFB 5IEKA 2PCPA 2J1XA 2NR6A 5I1EH 3VR6A 1S5IH 2P43B 3GI8H 4H0HB 1E65A 1N32L 4OI7A 4UP9A 1NDMA 3SOBL 5LNEA 4EKXA 2G5BB 1RFDH 4DWHA 2XKUA 2BVPA 3MRHA 5DEFB 3X3FL 3MN8A 1MI5E 4BZ2L 2X1QA 4XRCA 2EJ1A 4FQQA 1WZMA 1WVLA 4EI0A 5HDQL 3ULLA 2CO6B 5L6YL 5H1SE 1UD5A 2XG4B 3F01A 4FFZA 5I6XC 1XO8A 4AM0A 2E74C 3VWKD 2VRQA 3MXNA 4X4XA 5M3FH 4YSTA 3BYTB 1GMIA 1JHTB 4LQ1A 3L7ZC 1A6AA 2BFVH 4RA8A 1MH5A 4Y4HB 4PRIE 4ZW6A 3GUFA 3RWJB 1O75A 5I9QC 4DP6X 4PJAA 3FQTB 1TQUA 3I55A 2K78A 3VR3A 4KKNA 4RETB 2KEEA 2A6JA 2LS01 1GGTA 4RBPK 1U8QB 2FEJA 2P5WD 5JIPA 2JA5G 3ULUD 3MV9D 1CR9H 4LDLB 4XC1L 3REWA 4N6QA 2VQFL 4OV5A 1N6UA 2NX5D 2RHSB 1D1KA 1QW8A 1DUZA 3DWPA 2ESVB 4GRLA 1KIUB 2ZNXA 2E3VA 1CDHA 4XMLH 3V0WL 5FO8A 1D7BA 4P2QE 5F88B 2FWOB 3MLYL 4LJZC 2V7NB 2WM0A 3GIZL 3MRCB 3QNZB 1Q1JH 3BKCL 4FYSA 5EH1A 4L8BA 1JPGA 3WHE0 2RCNA 4JDEB 4GN4B 4UM9A 3U4ZA 3F12A 2MKLC 5FUOH 1K5NB 4JL1A 3V10A 4K7FA 2P5ZX 3PS6A 5A40E 1KLUD 3GKWH 1JGUH 2WD0A 4W9CC 3VGAC 3QI9D 4ZPVB 4A6YH 1G1YA 3UBHA 4O5LL 2B14A 3F84A 3X13A 1KB5A 3L4VA 3SDXE 3QDGB 3NSYA 3BQUA 3S3BB 2FRGP 4XBEL 2HIVA 4B9JA 2WTRB 5B7FA 4LLYB 3L5XL 2HLFC 5EU5B 5EU4B 1T03H 2P4AB 2MTPA 2EUVA 1NUGA 3FZUC 5C0JB 1ZD6A 4FL4C 3UBXG 4IU2B 1VFAA 4WWKC 5E0QA 3QUXC 3T0XA 3NESA 4PRBB 4NKDA 5FJ8H 2BOSA 4Z0BH 4LSVH 1I8KB 2CLVA 1YQVL 5FYJU 3S16H 4JFQB 5DQ9B 2O1AA 1KDCA 2FWLB 3O6FA 1PFCA 1AYRA 5JJLA 5BV7B 2ATAA 2R83A 1PKOA 3WENA 5F7NC 1IGCH 4JQIH 3QJRB 4M6OL 5ITFA 5AWNH 2G4GA 4MA1C 1DFBL 2CHNA 1G94A 1IILE 3PLYA 5HBBA 2VDPB 1RUMH 3TF7C 1WZLA 4XTCS 1MRCH 3RD4A 2YAOA 3WKMH 2NUTB 3MXWL 2ZCHH 4LFHD 2RDHA 2GTZB 4AYEC 1OZTG 4IS6B 3NMEA 2F5BL 4LNVA 2H32B 4GKLA 1FNVA 2WYTA 3S36L 4XX5A 4BY7G 1Z2KA 5KS9F 1CZWA 5C3IA 4UTAL 4JFWA 4PW9A 1C16B 3QR0A 2WNKA 4X5WA 5IWLC 1BEYL 1IO4C 1E28B 2ENYA 1D7DA 2D7QA 1D5MB 2JB5H 3FO9A 3GQBA 3MRFB 4DK1A 1NPJA 2V2WB 4JRWA 1U6AL 2B2TC 3O6KL 4QXWA 2N1TE 2XTLA 1G5AA 4IBQA 2VLRB 3B7TA 3BD5A 5HHOE 4LCCA 3CFMA 2RDFA 2DQ6A 2WKLA 3F1ZA 1UXSA 3LH2H 4EDXB 4OF7A 3CWGA 2XIIA 4HCGA 3FO9B 3MRFA 5D4IA 4UM8A 3KWUA 4PJEE 4JG5A 2GBUA 5BO1L 1VAHA 3O41A 3QXDB 4H7VA 1XYIA 5FGRA 4P2AA 1FHNA 4QYAA 3U4VA 4BFGA 5EOQH 5E2JA 4DP2X 1UGNA 3KBXA 5GSVB 2R6GA 4BY7B 1A0QH 5H35A 5KTEH 1J5IA 4NJAH 2MOQA 1NJ9B 1ROWA 2IBGA 4CDCC 2X4QA 4NKQB 2Y2YA 2MCMA 1E8WA 4BFKA 4G82A 1TZ8A 3Q24A 2G3MA 3MZ5A 2Y5TA 5L2KA 1WDAA 5F71A 4P0DA 3IVKB 3IDJA 1NAML 1DCZA 2MSPA 2WWNA 2YXFA 2NW3B 3CFKA 3NFPA 3DBSA 1CI3M 2I26N 1T21A 3NJXA 4KJWC 1IBML 3EJYC 2R9HD 3L1EA 3AWGA 1JQYD 4AQ1C 3MRLA 4LE8A 3O6FB 4N9OB 3CC7A 3SDYL 4ELMA 3TH2T 2Z6KA 3CHSA 3KR3L 1WTQA 4B9ZA 3P9MB 1TZAA 4CSZA 4RGNC 2P45B 5EGTA 3TA3B 1F4YL 3H42H 4A3FB 4M5YL 2D9UA 1YEJL 4M1DH 1B4TA 4X4YB 3HGBA 2Z34A 4HEPG 3EJYD 4LGPB 3K2UL 3Q7JA 2OL3L 4WJ3M 1KNOB 4DPCX 3L08A 1QBLL 2UUBL 1JT8A 1QFUH 4HLJA 1FBIL 2D3LA 2FEDC 4XP1H 1NCOA 3L95B 3MREA 3RFZA 2DTSA 2NY0D 4LFHG 1YQ2A 3WKYA 1XF3B 1AE3A 1EVUA 4MA3B 3DGGA 1D5RA 3GXIA 5ELFA 1YPZF 3DWQA 4QAMB 4Z7OE 3GJFK 2D2CC 2BNQE 4OD2B 4K7FB 3ALPA 3ELQA 3V6OE 4U1JB 3PDGA 5B38A 2LAGB 1P5UB 2FEDD 1FNEA 1XXDC 2BH8A 3VI3B 1SE3A 3OMGA 3J7AV 3QAZB 5FKPA 2JKNA 1TQCB 1HH9A 3LXAA 4ABWA 5CCKH 4AENA 1VQ8A 1QEXA 2WUCH 3IDJB 2IAAC 3WJJA 2XLLA 4QOKB 2KENA 3MKGA 2E8ZA 3U30C 4OM1H 2LAAA 1EAQA 5D3IB 1A6TB 2YAEA 3EAKA 1HKLH 3CFDA 1AR2A 1FDLL 3BOVA 4KKPA 4LPYA 1HA5A 2CNZA 2NY6D 3IBOA 4B9CA 3L8QA 3CPUA 3L5WB 1A15A 4U0RC 3FYEB 4B6ZA 1XF5A 1BX2A 2OR7A 4XPHH 1XF4B 4Z7NE 2Y2WA 1WP6A 1PJ9A 2ZUXA 1IQDA 4IGBA 1FO0L 3RWJA 5F7KC 4OV6F 1OPGL 2OMXB 5FF6A 2FECI 4LF4L 5AKRA 3SZ6A 1MSGA 5EU7C 3ARPA 3ZL4H 4WJKB 5I18L 3GMPA 5MEND 4AK1A 3J7YW 1RJCA 1ANUA 1PMYA 2X7LA 4PJHB 4GN5A 2F0VA 3HRZA 1CGSL 1Z9OA 3PABA 2RSNA 3HI6H 2EVBA 3KBHE 4GO8A 1J5CA 4NN7C 2ZKHL 3CFKB 3NFPB 3D4GA 3EDJA 3G6JF 3I4LA 1AGFA 5D2LA 1GAFH 3S16B 4G83A 3FCGA 3SE9H 4KRNA 3UJIL 5BNXD 4AQ1A 4B0MB 3OMZA 1HZHH 1TU2B 2QKIA 3VFMA 1ZHNB 3S35H 1J0KA 4HU2A 3HS0B 4DHLA 2JCCA 1OP5K 2CXKA 3R8QA 2FJFB 4AIEA 4WW1B 3O6FC 3HNVL 2L0DA 2QEJC 4RFNC 4ZMYA 3TF4A 3M1CA 3MR9B 5EZJB 3IFNL 1GKEA 4HJ8A 2VZ3A 4N2OA 2LLNA 4N8UA 4NKOB 5BQDA 5L4IA 4X9HA 3ROLB 4M8QB 2MRYA 3BX7C 3FQXA 5B39G 4IEFA 2MNWA 4A6YB 4G6FD 1F58H 3U9PH 3QDJE 2JKXA 4A3KH 3OAWA 4HEPA 4TUOB 1VFAB 4YWGL 2HHHQ 2ZP8A 4TSBH 5GJSL 4MNGE 1DM0B 3WJMB 3FCUB 4UIKL 3V0VA 3QUKA 1RCYA 4JKPH 2NVYH 1CSQA 1IU1A 4XC1H 2F4VL 1O7DE 4OLYH 4GRWE 1BZ8A 3QPXL 2GHZA 5DWUL 2XV0A 1CDBA 2V37A 3AB0B 4N2GA 4HLEA 5JHBA 5MI0B 4W9KC 5TTRA 1FIEA 2UX7A 4XOCA 4R83A 5C08A 1Q81C 4EN3B 3VRIB 1PSKH 4ONOA 2WQ8A 3QG7H 1J9RA 3SYPA 4GSXA 5HHPB 3ULSB 3L7FA 3FFCA 3B2UD 1EEZA 1KPVB 3SZKC 2FWOA 2PR4H 3LKOB 4HCRL 5G4OA 3EGXB 4TNWF 2WZAA 5AVTB 5L7XH 4M93C 3L4CA 3U4EB 2CRMA 4K3JL 1JFQL 1U3YA 4NOBA 5FFGA 1J0IA 4BZ2H 3V6BR 2N0KA 4H25A 4TQHA 4DVBB 5BQ7A 5LMUQ 4MA1B 3ALXA 4YHML 1M6OA 2I25N 3BGMA 1KLUA 5HDBB 2M2LA 2QQNH 1FG9C 3LQAH 3Q6FA 3OWEB 4JO2H 2AMGA 3RI5K 3VXMD 3N85L 2LR4A 3MLSL 4G80A 3SR1A 2G2NA 2VAJA 3VXMB 4U3XA 3WFBH 1G0YR 1X54A 3VACA 1JB3A 2WAHA 1LEIB 2BP5M 3HA0A 5EOTA 3SDDA 4UQEA 3MAQA 3OF6A 3TXAA 3E0EA 4J3VA 1JE4A 3MHBA 1DZ1A 1ZA3A 5FA4A 1CF8H 2NVTH 2PI2A 2YXMA 5ELNA 1OCWH 3RZOH 4NT6A 4PS7A 2XTJE 3ZTNL 4FL4B 3ZVVA 1FJ1B 4RBPH 2F53A 3FONA 4XCEB 5AZ2H 3WJLA 5EIIB 3ISYA 1KBGH 4XNZC 4PY8I 2VXQH 1HEZA 4NHCL 1G7MB 1YCSA 4C3IB 3VI4B 3BWZA 1SM3L 1YVCA 2FB4L 4JLRB 4LRNL 1KCRL 5D7EA 2ZYHA 5L2JB 3GTKB 4EIBA 1C5BL 2I9LA 1VQ5A 3KD4A 2PP9A 4OU3A 4EQ5A 1MHHA 5JXEA 2EXWC 4QIRA 4CJ0B 4C4KT 3A8JE 2GY5A 3WHXB 3FN0H 3TP7A 3S2AA 1MAJA 5E1IA 4QHUA 2F8VA 1KBVA 5CBAB 4I9WE 1YMME 3GSNL 2V2TA 4XCCL 1RZ8A 1JWUA 2E6JA 1SN0A 2WXGA 2OA9A 4WFEE 2H45A 2WAQA 4CVZB 3Q8DA 3ZTCC 4HC1A 4E9TA 2HB0A 3VD4A 2VM3A 1M71A 1DSFH 2EIMB 3MROA 4KMQA 4ODUA 3U1QA 4LSRH 4N2MA 3IU3A 3FFCD 2BCKA 4OKVB 1YEGH 4IJ3C 5AVRB 3C8KA 1EGJL 4BY1H 4R7DB 2KUMA 3LB6C 4NO5B 2KZKA 5JPNC 3D3RA 4NUJA 4N9PA 4AC2A 2EUZA 3CH1B 3EO1A 1I7ZB 3GBEA 5F21B 2JA7B 4XRCB 2F4IA 2C9XA 2JLLA 4PJFE 3HRPA 2X9ZA 3RWCA 3HJEA 2VIRA 4Y4KD 3JC66 1UFGA 2R1XA 4KQ4L 2A9AA 3V55A 3EJIA 3C75A 4PRHE 4HPOL 3ARVA 1CLYL 2YN5A 2HJLB 1QNUA 4RGNB 3VD7A 2AQPA 2NY4C 1MCWM 3K4AA 4XNUL 2SNMA 2E2HB 1YYCA 3D39A 5G5DB 5KSAB 1QEWA 2B4CL 3CW2C 3CTTA 4OF3A 4Q52A 4EUPH 4ISVB 1ZRUA 2R93G 1EFID 1JJ2A 2VE6B 5C0BB 3MBXL 4PM1A 1SZNA 4E5XA 3CU1A 1JR0D 4DKEH 3WNOA 3VSQA 1P9MC 4BWUA 4ZUSB 2FLMA 4PWHA 1SXTA 1I82A 2QDVA 4XCCH 3RMHA 5K1JA 3WLBA 4N0CD 2A1AA 1IEAA 2EIZB 3NJVA 3OMIB 3ARTA 4PJHF 2DQDL 1RUKL 3LEXB 1A2YB 4K94H 3NCCB 5H37G 3U7WL 4LHUG 2XWTA 4MN3A 4W4OA 4MD5B 1PFNA 4Y2DA 4PJIB 3UO8B 5MENB 4MNQD 5LGJA 1S9YB 3MRRA 3WO4B 2EVIA 5HGBB 3RA7H 4YWMA 5ETUB 1HA6A 1YC7A 5B1JC 2PP7A 3SODB 4GRWF 5ACZB 4NXML 1CQFA 1JNNL 5KYXB 3RHWK 4OQTH 1LO5A 1TEFA 1P84J 1HZCA 2K32A 1YN7B 3H3PL 2AK4B 1BWWA 4XVOA 4B3SQ 1N8OE 2Y2TA 4POZD 3BP6B 3GTVA 4JM2D 5JIMA 2A9MH 1T4WA 2RH0A 3DX7B 3FTGB 1DQVA 4LVOB 4OGXH 3CCRA 4ODXA 2DQEL 2VQTA 2ZXBA 4Q97A 4AX3A 3JVFC 1AO7A 3KPNA 3RJOA 3A24A 4DV1Q 2MPAL 2VQFQ 4RRPG 3VXRA 4K6LA 3PO2B 2Y1YA 1MGSA 4OZGA 3BWUC 4TMPA 1SSOA 2ALAA 1TJGL 5LGJB 1VF7A 3B9AA 3QJHA 4POZC 1D9KC 5J12C 1W72B 3RWDA 2DBLH 4MMXC 4HEMA 3C5ZD 4ZMWA 3DWTA 5D70L 4G8FA 5BS0B 4G43A 1HNZL 5ECJE 4TF4A 5EU6B 3SGKC 5GJSH 4DP9X 1T7XA 2KOLA 4QRRB 2VO8A 4B5EA 1HXMA 1E7UA 1K8DB 3LQAC 3NSXA 3CCHA 3OMNB 3BYYA 4JREB 4MNGB 3BDLA 1AO7B 1NEZB 3EOBB 4YDLB 5ADPL 1QEWB 2YV5A 1BW8A 4BWTA 3BN9C 1YN6A 5C0XI 4TTDD 2WBJA 5ICUA 3J07A 1LK2B 5IM7B 3VH8G 3H4HA 2O61A 2GY7B 5IFJA 3GJFB 5JOEA 1RZPA 4HJTA 3BI9X 3F7KA 1NUFA 1T4KA 1P7KA 3N9GL 1LP9B 4FEMA 1SHXA 4KRPD 4QKTA 3E6FA 1ACZA 1ECYA 2X6UA 1FVDA 1LTRD 3MNZA 1ICFB 2WFWA 4FNSA 2RTTA 3RUGB 3K6OA 3H3VI 2F9BT 4PJ5B 3U7AA 1JP5A 2PR9A 4GOPC 3UJIH 1OY3B 2F0TA 1F4XL 4XPFH 5E5LA 4DOHB 4ZX6A 2OWOA 2I27N 4JDZB 4AQ8A 1VESA 2W0FA 5E5MA 2NN6G 2IWHA 1ZIBA 1N36L 1B88A 3AXIA 3KLLA 2OYKA 5I1LB 5DD5L 1HZKA 2H3NA 3FU0A 5EN2B 3K74B 1E8XA 3D6GA 3E3QC 1TDQA 3IFLH 1FFOB 4A3GH 5GRJL 2K05A 2YMOA 4E42A 5B8CA 4KY7A 4W81A 2WWMD 3VB9A 4U6HB 5HYJB 4KHZA 4K8JA 2EC9T 3I3EA 3L9RA 1P6AB 2C7UA 4OWXB 3KLDA 4KK6C 1DVFC 4U49A 5IKCA 3US9A 4ELMF 3PHOA 4G59C 3H53A 4N8CH 3BFOA 3TFKD 4MDIB 1FNHA 1UEMA 5KVMC 5D1ZB 3NZ8A 5D1ZC 3VXRD 3ML8A 1HSBA 5ALCH 2HLAA 1T89C 2R1XB 1FC2D 2VUKA 2YUXA 4XGZB 4DN4L 1KCLA 4Z7WA 4GKKL 5E9AA 1X5HA 4K94L 4UTBH 1T22A 2EJFC 3U7WH 4BCZA 2X4TB 1KEGL 1PZ2A 2R27A 3NCYP 4MKMA 3U36B 4OLYL 43CAA 3NUCA 3SDZA 3AQZA 3UZEA 4IDJH 3L3DA 3FAXA 4DV6Q 1URIA 3FFCE 3KPQB 3SQOH 4OZIF 4R7DA 2XZZA 4EQ3A 5C07E 3DJZA 3PJNA 1RIPA 4LK1C 2ID0A 2YPLA 3U6RB 1DXMA 3TVMA 3MXPA 2X12A 4Z95L 1JPEA 3SY6A 2P8PB 3I6GB 5A2QE 3EDFA 1XZ0B 5F1IB 4NBYB 4NUQA 4OSUH 5HHXL 5LDUA 4H8HA 4MMXB 4FQLL 3VRJB 4NZJA 2AQSA 4Y1AA 2BP8B 1MIMH 2XETA 2Q6WA 5ICZA 1VQAA 3DYMA 3MLUL 4LL4A 1KJ2H 1OAXH 4LIQE 4BXVA 3HC3H 3ZGIA 3AMLA 3MRGB 5MP6H 3KK7A 1GS6X 4B60A 2CALA 4K94C 1I3GH 1HE8A 2UUBQ 3TTSA 1CZ8L 3OSOA 3A6CL 2N88A 5I73B 2YD6A 4MHHI 5F7MC 3OOCA 1DLHA 1RQ5A 3VMNA 4FXKC 4W68A 3AXLA 4WI9A 4YHLH 1KGJA 2CO7B 2JJWA 4WWNA 4XBMA 2VR6A 4QJ5B 3DBXB 3VXTB 1FI8C 4CADB 4X64L 4AL8C 4ETQB 1HH6B 1MFAL 1FFPA 2EDKA 2EP6A 3P69A 4POGA 1JOQA 4JFFE 3SD5A 1QR4A 2Z7UA 3W3BA 1PH6A 1IGTB 3FU5A 4YXKL 5DA4A 4F1SA 1LEIA 4H8UA 3QCTH 1W8NA 1C5DB 4P9ML 4X7TB 1P4UA 5FW8A 4U05A 1GCYA 2DWDB 3KGUA 4O51A 4LLQA 2G9HA 3QIUC 1U3ZA 2NW2B 3F3HA 4PJ8D 5DS1A 1MIEL 1V3MA 1P4BL 4ZOEA 5I6MA 3G6JB 2BOCA 3S34H 3C6SB 4KX7A 4U3SA 3X2QB 5JQ6H 2VNCA 2MMXA 3GI8L 4PZ8A 2EACA 1KIXA 1SVCP 1OGAA 4OIIL 5EBLB 2B5IB 1DQIA 4KJYB 4ODSH 1PLBA 3H7LA 4IM8A 2WZPA 4LEEA 4JY6B 4BFIB 1BJ1J 1AZPA 3QCVH 4G7OC 1B90A 1MY7A 2NXYB 2W9DH 4PJ8C 4UB0H 1AI1H 1FR3A 1QSFE 4LEOA 4QUFA 3GZQA 3QEQB 4I3RH 1YEJH 4M1DL 3VD3A 5GSRB 3SYAA 3GO1L 1QKZH 1NAMH 1RSFA 2VDRB 3W11D 3CHOA 1BO0A 2FUQA 5EZJA 2AJSL 1FZKB 2JK5A 4RIRB 2L55A 1QUQA 4NPJA 3ZO9A 3TS8A 3HCVB 2JB5L 3CFUA 5SV3A 1T6WA 1GGCH 3JWOL 4P5KB 2JYOA 4Y1AD 4LDCA 1MJCA 2JKTM 5IP9H 3LQZB 3NIGB 4ZOCA 1J5EQ 1GZPA 3MCLL 4FFVD 5KUKA 3HFFA 3NIFF 1T0MA 3K2UH 1WC7A 2YD1A 5J1AB 5KYUB 3SCMD 5C2BL 2J57A 3SOTA 3WJMA 2EYLA 4EUPA 2Z9TA 5FCUH 1CVRA 2ORBH 3FUIA 4Z78A 1SYVA 2N7SA 3I4MG 2GK0A 5T1LA 3QR1A 4PVLA 2A6DA 1FL5B 1MCPH 4G9FE 1STBA 1T80A 4FYRA 1VDZA 1VMPA 1KXHA 3MO1A 1CCZA 3S3CB 1VQ9A 2B1AL 2NT0A 3QQ3A 4QLWA 2KMWA 2ZD0A 2B08A 4R0LC 1TSHA 4YHPB 1BDOA 5I30H 1KBBA 1HZLA 1DVQA 1USQA 5M5XH 2BNRD 1REIA 3RZCB 4NENB 4JI1Q 3GTGB 3DDFA 4BWWA 1MHCA 1P53A 1XF5B 1SRDA 5AJ3L 1D7FA 1KGUA 1MFDL 4LFBL 1ZA6A 5DDHA 3D0LA 5MEQB 3UDGA 3SO3B 3PFQA 3TMEA 4N2BA 1TJIL 4E9YA 2VUMB 4D9RD 5C4JB 4EQNA 4GW1B 4FDBA 2F08A 4NRYB 3OIPA 4FMVA 5E4AA 3TREA 1JIBA 3EBGA 4F8LA 2KLRA 3KDFA 2AXJA 2DJSA 3C8DA 4WRDA 1B0WA 2OQJA 3RVWC 2H0PA 4AQAA 1F9SA 2OMZA 1D5XB 4Z0BL 1GGUA 5E70A 2PWEA 3DYPA 3WFCL 4OCWH 2SEBD 4XHQA 3B7UX 3BP4A 2WTPA 1N8ZA 4PMWA 3PQYA 1Y1WG 5IB5A 4MQ7A 3TO4C 3TBVA 1IL1A 3HC2A 4JB9H 5CR8A 4DETA 4IOCA 2AGJH 4U33A 4UQIM 2MKWA 3RVWD 5JHLH 2CJSA 2APWA 1IKOP 2VZOA 4AQEB 3GMQA 4ILWA 1EMTH 4ODTH 3MXWH 5D65A 2CIKB 4EIGB 4F1ZA 5KSVB 5FM5M 3GTPB 3QUML 4JRXB 1GAFL 4F7EB 1VQEA 1BOGB 3H3BC 3E8UL 4X5RA 4HPHA 4XAKD 4DQAA 2X2JA 1VF5C 3UJJH 3VYUA 1J12A 2GC7C 3KWWB 2EXZA 4NM8H 3GLEA 5GS1C 1H3UA 2P7TA 2DMKA 3TO2A 3U0WL 3WYRA 5IJCC 3CFCL 5A16B 3UTOA 1AJ7L 2Z8RA 2Y07L 1WYDA 3GKWL 1ZHBB 4KFMA 1TTUA 1FNEB 3FPPA 1GTFA 2X05A 4XPGL 1J8HB 5IT9c 2LXJA 4OFYA 1DSYA 5EZLA 2PWFA 3NIDE 3OB0H 2MJ8A 4NRYA 1GZQB 1FIGL 3E3XA 1SYSA 3C5JB 3KPLB 4X5LA 2Y25A 1EFQA 3IM1A 2H2SD 4NKMB 2NOYA 4GKNA 2L9HA 2Y0SB 3PL6D 3E38A 2DWYA 4L5FL 3TBTA 1IBLQ 1A21A 3FQNA 5TFSH 4FXGC 4MSWB 2FO8A 2XTIA 1SBBB 2KL6A 4JB9L 3B8SA 4I87A 4B0MM 4CDGC 3R8BB 4HR7B 2NX5E 2BA1A 2P42B 4HUCA 5GS2D 2LLGA 4IHOB 5K9OA 1CD8A 1NC2A 3M85A 3BW9A 4GKSA 2GAZB 1QRNB 4LK4A 3FRPA 4W9JC 4EN3C 1JCKA 2VMDA 4BH8B 3A8KE 2VLMD 3N40F 1JUFA 1NAKH 5EULV 3TBWA 3PWJA 4PN6A 4MB1A 1OSPL 4R97C 1X7QB 5CP3H 3SDCC 5TQ0L 3E0JA 4GG6F 2CJTA 3FSZA 3ILDA 3G5XB 1H8LA 2F7PA 4WI7A 3DWAA 4WFED 2HUEA 5I66B 2Y5QA 2E86A 3B9DA 1I1YA 4A3EH 2JJQA 1CD1B 2K5HA 1T21B 2OMTA 3WUWB 3GPEA 1NOAA 1CSPA 2GTWB 1CXIA 3H9SE 2XN9C 4DNIA 1T0MB 2EDXA 1J8KA 2HIXA 5IJBC 1R0AL 1P7QA 4PGEA 1X7SA 1OE1A 2AQ2B 2QADB 4MD4A 3QZNA 3MJ9L 4DN4H 2HRLA 3FO0L 2PTTB 3IAQA 4PJIF 4WFFD 1PV4A 1VFOA 2QVKA 4PD4K 5B7EA 4JCMA 3KPRE 1BCPC 5EAYA 3BGFC 3G48A 3K91A 4GO9A 3T08A 5ICYB 1YY8B 3W9DB 4OT1L 3KJ4C 5IBLD 3LZQA 1A6UH 1KIRB 3RX9A 1KJ2A 5DHMC 3UPRA 3G5XA 2EIKB 3DMMB 4ODHL 1T0NA 5LKNA 4X9BA 1SFHA 5DLQE 4JI4Q 5KJRH 2F52A 1JK9A 2Z35B 5EUOE 3FRPB 4P9HC 5EG6C 2NUPA 4X9FA 4A68A 2JI1A 4LHUA 3UDIA 1ZGLA 2ITCB 1AFPA 1QSFD 4CKVX 2K14A 4I18B 5IV2A 3VUAA 4X42A 4DCQA 2AZAA 3FQNB 1Q12A 4DV1L 2Z91B 3GNML 4L2LA 5C3EB 2QVMA 3TT1H 1CFSB 3AABA 4BSJA 1U93B 3W9EB 1FWXA 3QH3A 3GV6A 3MCLH 3Q0HA 2PF6A 4RGOL 3P4OB 4LCUB 3SCMA 5I1JH 2XWDA 3TV8A 1RK0B 5IMOA 5IHUL 1TR7A 2ARJB 3MRBA 3FPYA 1ADQA 1DJIA 5IQNA 1OIOA 2J8UB 3ESOA 3AQXA 1XMOL 4M9OA 4QY7A 2VRKA 2JFCA 2R51A 1PTZA 4C8XA 1SYGA 2HJFA 1LDPH 2Y7QA 4UQ3B 4NNPH 4K3GA 2JCWA 4P5TA 4Q6YA 2EYHA 1JG9A 4PSRA 1F90L 4ZS6D 2BNRA 3LDBB 1CJYA 3GS4A 2OZ4H 1JVOA 3NA4A 3SDAD 5HYSB 4Y5VB 3SDAB 4Z5RB 4TRDA 1AQKL 1SXNA 3UYRH 3ULUH 2ITFA 1OTCA 2R69H 4GMSL 3A47A 4AYBA 3NENA 1Q0YL 3H3KA 4H1LH 2ZOKB 3P2DA 3PU7A 1X9LA 1VQ6A 2XX0A 2A4EA 2Z1PA 4AQEA 5JOPD 1O7DC 4MZ2A 3U1SH 3SBWA 3N0PB 4JFHD 5IY5B 5KBDA 1BWMA 3MBXH 4RAUB 2A73B 4HA1A 2R23A 2YEZB 2IAMC 2XN9A 4FQLH 4XIGS 2X38A 32C2A 1R9TB 2P3YA 1WYJA 3D30A 1SYFA 4YN3A 1MEXL 1NUDA 3VH8A 3ZDZB 4BQ8A 2NY2D 3OWRA 5F7LB 3V4UH 2ATKA 2CGRH 3Q1SL 4TVPL 3VR2A 1GTNA 2G60L 1N8RC 4QCLA 1HHVA 1ICWA 3T9WA 2YU9H 1ESOA 4ZMOA 4H02A 1UWGH 3P73B 3FT9A 1SN5A 1A7RL 3QNZA 4FCAA 4QWWD 3GHEL 4K2UL 4ZQ3A 5I82A 1UH2A 3EUUA 3PHQB 1ZEAL 2IAMD 1QVCA 2CQVA 1BM3H 1IAKB 2PW2A 3TJEL 3HMXH 1NMFA 4UP7A 1MI5D 5CCGE 1PH1A 1X3FA 3MBWA 3Q8BA 3WMPA 2OTJA 5E2VH 5GHWH 4C3HG 4F5CA 3D69A 4M1CC 5SWSB 1VEPA 3SDCB 4ANVA 1IAKA 1BCPB 4JO1L 1I1FB 3AGWA 3QRLA 1ML0A 1PAMA 5IOPA 2R29A 4YDMA 4PJXE 2FIKA 1T7ZA 2EC9U 3C2SA 3N42B 3QFJE 2DIBA 1U58A 3QNYB 3CQPA 3NGBB 4DR5Q 5FUZL 2CWAA 3D3VE 1XT5A 4G6KH 2WAQG 4AL8L 2VXUL 1WVZA 5B1AB 3FRUB 4R3SA 2CE6A 1S9XA 4JRYB 4HOMA 4JI0L 1HHIA 3BVZA 1RUQL 3QWOA 3T1YQ 3V0WH 1W9XA 3H0GH 2W9EL 2OTUB 3D5OF 1WBZA 4GLRH 1VQFA 5E94B 3D87B 5JDJA 1XSKA 5C44H 5HYJE 2E6PA 4E36A 2CH8A 1DLFL 1M1XA 3SDAA 1FJGL 1B70B 4IUPA 4JZJB 4WIQA 2Q8BL 4NQCA 4EO5A 4DAGH 3DEPA 4IN3A 3P2TA 2M26A 3P9LB 1RUPH 5BZWB 3OPZL 1QE6A 4DO4A 2AJSH 2QPEB 2DYPD 2YPVA 2AERT 1UE1A 4B41A 4M1GL 4ZS7H 1ROCA 3V95A 1NSNH 2F7RA 1CD9B 3OKEB 2FD6L 5IQ9B 2FSDA 3GSWB 3O9WA 1SUHA 3VXPB 3CCHB 1L0YA 1IAII 3SHLA 1ONQA 3LH9A 3WTYA 3EGSB 4WO4A 4PIBA 2YLHA 3FUJA 3K2IA 3OG6B 5TGBA 1H9KA 3ZZ1A 1QVOB 4YCWA 1FZOA 1BQSA 1TS4A 3GSRA 1SEBB 5E5UB 4PV9B 3E2HC 2DQUL 3CMGA 2Z7WA 3QJXA 4PCYA 1ZDSA 1Y6NR 1MRDL 3N9GH 1LD9B 5CNHA 4A7GA 4JOIA 1CYXA 1WCMG 1I1CA 4FKKA 4U1GB 4QKXB 5DD0L 2BRRH 1D8LA 4CU8A 1J9QA 1INQB 4PP2A 1N6QH 4JFDE 3IDMB 4LLUA 4JAMB 4AY0A 2OX5B 2GQHA 2BC4A 1GRWA 2Q86A 3EFFB 4O2FA 1ZTXH 3N91A 4PRAB 2AK4A 4FADA 4OBRA 1MG2C 5FDWB 2EH8H 2Z3FA 1DR9A 4OGXL 3S9DB 4GYBA 5L0QB 1QWUA 1I4RA 1FORH 1Y1DA 2J73A 3HE7A 4N8VB 3UGXA 1FAKT 3K58A 1H3WM 2ZF9A 3ZSSA 5HGBA 1I7UB 4WEBL 4DA2A 4WU5B 4IBSA 1DHKA 5FUCC 5LBSA 1DDHB 1EX0A 2YYZA 1UXWA 3ZDWA 3GEFA 4N2AA 2DL9A 4RQQA 4YHMH 1PA6A 1ZPLA 1BZEA 1AGEA 1JTTA 1PCSA 3I6SA 5DUBB 4DNLA 5GAHC 2AK4E 1QSFA 4NKIH 1IKFH 3M7GA 3ZE0E 3X17A 4Z8FH 1VS0A 1E5YA 1L0WA 1MUJA 1NEUA 4AE1A 1F9PA 4FXLA 1U8MA 1U8KA 3FF7A 4MMZA 1IX2A 4PRHA 3NBNA 4KKUA 4NI3A 4E41B 1MOEA 5TDOA 4E0RB 5HVGB 4JM4L 4OFVA 4IFDJ 2JQZA 2VN6A 4OI8A 3R19A 5KVGE 5KS9A 4DPRA 2HJLA 2BZ7A 4NC1E 3W82A 5J57B 4K8RH 2I0QA 2QEJA 1PVHA 1AZVA 4BH8A 1DQQA 3LN5A 3NACL 4YSAA 1DCEA 2HH0H 1A62A 4X66Q 2QQLH 4LLDA 1ET8A 4OZFH 5IBTL 2WQWA 1EO8H 5K9JH 4NQSB 1TZGL 4IBZA 2AS5M 1EBPA 3RWCB 3EXJA 3MRIA 3MUGA 4IRSB 4L4VE 2GABA 3ME0B 1XGYL 1FSKB 1L0XA 1QCBD 1BOSA 4IURA 2BMKB 1YBYA 5DT1L 5FLMG 4N20A 3HC3L 3IAYA 3QAQA 2Z1CA 1SY6H 3RGHA 4ENEC 1WFMA 2HFGL 5CIPB 4NKMA 4ACTA 2MFNA 2NXYC 4KAQH 4PJ8B 2LABA 3IETA 1ESRA 4WWKD 4PRHB 4F7CA 2E8GA 3TBIB 3S9WA 1O6SB 3NCWA 5C92A 5C09D 1BIHA 2X2UA 2DB8A 4DKFH 5A16A 5EU3B 4XN4A 4YGAB 2H2PD 3P4NA 3ULVF 3Q48A 5C0CA 1V7ML 5LMNQ 4JO2L 4PCKA 2P5PA 3IMSA 3MOBL 2VDMB 5C3XA 5AOKA 5J6HB 3SDXA 3ARWA 2ZIDA 3I6LE 5IEHA 4JPWH 1GM5A 5FB8A 1CLYH 4Z7OF 4PJ9B 1IW7D 1YJWA 2A1WL 2MP1A 2AV7A 3OX8B 1AR1B 2H2PC 4YWKA 1MJUL 2VDLL 4NGHH 5JUEH 3CZLA 1G6RA 4ZUUB 2RD0A 3APNA 1UXLA 4GQZA 4DGVH 2QSCH 5EOCH 2QVFB 5G4MA 2EY1A 5ID1B 5JQIB 2IANA 2NZOA 4TSCL 1JWSA 4N26A 3BH4A 1N0LA 4AJWA 1ZIAA 3L16A 5I74B 1ZA3B 1JE5A 2ZUQC 1ML0D 1TMQA 4PJFF 3CFTA 3NSCA 4JZNA 5ADOL 1WBXA 3HKZG 3PO2H 2AFNA 5LG6A 1WFIA 4W9FC 1BHGA 3T4AB 5KYNA 4GUOA 4OIBA 4C59B 3KWVA 4G9DB 4Y7MA 3RU8H 1MI5A 1J18A 1UOKA 3LX9A 4AH2B 1EY8A 3QZBA 4M4PA 5D7LE 1IBHA 4PGDB 1VQGA 3LAFA 4XCFH 5GGVY 3OPOA 1WF5A 4YSUA 3ARGA 4LRIC 3NCBB 1R24A 3V7AG 5CGYD 1JPSL 5DK0A 1CIDA 5T1LD 3ONAB 2F0UA 4BSVA 4Z9CB 2OL3H 3KCPA 2WTOA 5K36H 4FNLL 2LU3A 1K5WA 3T1HL 2IPKD 5EBCA 4YO0B 4EZJA 3HOZH 2IXQA 2VT0A 4AEHH 4BKLA 4CMMB 3VXRB 4AGNA 3H94A 4NZRH 2A9ML 1X5ZA 4WNSA 1MCQA 4BUHA 3D85A 2QA4A 1ET5A 1P4IH 4H1LB 5DM63 2NXZC 1DJXA 4F8TA 1NMAH 2EEBA 1CLZH 4DAGL 1KPUA 1PZID 3WY2A 3RY6C 3MLSH 3ZKNC 1TETH 4FXTA 5CAYB 2E0PA 4LF6Q 1WFNA 2O5ZH 4HMCA 4P57A 1ETZB 4PJXB 4W9GC 3ZRCC 4EUPB 2HMIC 1FNGB 2YPKB 3VWKB 2XN2A 5IY0A 1IC7H 5JXED 1G7PB 3K80A 3F8TA 3L48A 4Y16A 1IIKA 2Y0SG 1ETZA 1JV2B 4BGDA 2BSTA 4F8MA 1BECA 4BZ1A 2NTSA 3MWYW 4ZTOL 2NLJA 3M4QA 1S7TA 1I75A 5D2NB 2JA9A 1N68A 5D7KE 5C0AE 2L7UA 3K71A 4ULLA 1NIBA 2IH1A 2J6EA 2UUCQ 3NWSA 4G2AA 2KERA 4A3MH 1E5UI 3IDYC 3NJHA 4PU2A 5GXBB 5IR1B 1HQMC 5F7UA 2Z1KA 2VLKD 3FPUB 4M3KB 4LBEA 5DEGB 1ZT7B 4PJDE 1STYA 2FT6A 4GW4B 3RWGB 1WE5A 1BYNA 2JCCB 3T2PA 1IE5A 1YEDA 1D2PA 3FNKA 1CG9A 3PWLA 5EBWA 3TV3H 4BK5C 2K7VA 1YG9A 2X0VA 4OB5L 2AK1L 3H7BB 2DWEB 4XOAA 4AQOA 1WOCA 2BH2A 4BXXH 1HEJC 3QOLA 4J6RL 5EEYA 3KPOA 2IQ9L 2Z31A 3ETBF 3IJYB 1R3KA 3ZDYB 5C4XG 1A5FL 3PNWB 4M6ML 2HD3A 1AS6A 2HCIA 1MEXH 2VW4A 3EH3B 3FUHA 1UAPA 2PXYB 3K6FA 4FHBD 5HHVH 2X7LB 4CMHC 1WBXB 1ZV9A 4Z7QB 1T0OA 1IKNA 1V8HA 2W92A 3O3DB 1A8VA 4XMPH 1DOMA 1AE2A 1IGTA 4H26B 1O7VA 1WBYB 1D2BA 1P2CA 2B4CC 1HXKA 1NSNL 4DV6L 2RCSH 4A93H 5E6ID 4PGBA 4MIUA 5EOCJ 4YSCA 1VA9A 2B63G 1SGKA 2NVXH 2GEEA 1Y1VG 1A6VH 1XAKA 2Z0SA 2IPTH 4UAIA 1NGZB 5HY6A 3STLB 1WSST 2GIYA 2L4NA 4ZQTA 4OVVA 1PLGH 2J20A 1Y8NB 1CUOA 3Q23A 1PFOA 3FOLA 5E6IC 5AVYB 3OBAA 4HJSA 4JJ5B 4JO1H 4Q9QH 1QABA 1ZK9A 2VR4A 1BGXL 2WXFA 3KL0A 4FTVA 4KY1L 4ZFFB 2VO5A 3P4NB 2H41A 4FLHA 4KV6A 2DQDH 4BZ1L 1NBZA 1NFAA 2LMCB 4UT9H 1PKQA 4KO6A 2MHVA 2BP8A 1Y1VB 3TN0C 1XMWA 5HDLA 2KDGA