4PQXA

Crystal structure of a nigd-like protein (baccac_02139) from bacteroides caccae atcc 43185 at 2.39 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
201
Chain Sequence
SRSLVISTINQISEDSKEFYFTLDNGKTMFPSNSQAWGGEKFENGQRAFVIFNELEQPVNGYDYNIQVRDITKVLTKEIVTMDDEENTEEKIGDDKINATYMWISKDKKYLTIEFQYYSTHSEDKKHFLNLVINNKDNTDDEYINLEFRHNSERDSPDHLGEGYVSFKLDKIEEQIEGKKGLNIRVRTLYDGIKNYKVQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACCAC_02139) from Bacteroides caccae ATCC 43185 at 2.39 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 55
structure length 201
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pqxA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pqxA02
4PQXA 3QWNA 3K0YA 4J8QA 3K6OA 3NQIA
chains in the Genus database with same CATH superfamily
3H0GB 2X87A 2FSEA 5AVTB 3C12A 1ZXTA 1UACL 5FUOH 5ID0B 1XXGA 2NYYC 3RL1A 3I9IA 3MVVA 3DWPA 1N32Q 1GZPA 4R4QA 3FT3A 4LB8A 1WZ1H 1H6TA 4JVPA 1WFIA 3TN0B 5H94B 5HPOA 4TVAB 1LO0L 1GJXA 1E40A 4JJ5A 4TM9A 3TBWA 4H0HB 4AWJC 3G6JF 1B4LA 3PRZA 4HIEB 3KLHC 1CL7I 3GSVA 4POZD 1FL6A 1XV8A 3IDIA 4LLDB 1KTDA 2VXWA 2BNQA 4X4KA 1E43A 1L6ZA 2R83A 3GBLA 3KYNA 3QCTL 4HJGB 5T5FA 3CZGA 3PQYA 2XWDA 4YGVB 4M62L 3N5AA 3X3FL 4CVWA 5E4AA 1PSKH 2Q2IA 2BW5A 3L7ZC 1YIJA 3S1NH 5B22A 4RGNB 3S15B 2AJXH 1JTPA 5KVEH 2GC4C 2P8LB 3LSOA 2O2LD 3G08B 1A3TA 5C0AA 4ATTA 2M83A 3HRZC 5HGGS 3PF4A 1IC1A 1WAAA 4PPTA 1X5AA 1UQSA 3LN4B 4BRVA 3R93A 4DP9X 2FGWL 5I30H 4P05A 5EPMB 3UBFA 1S5CD 4LSQH 4IDLA 2IOIA 5ELEA 1TT6A 3ULVE 4ONFL 2B4CL 1KBVA 1ZTMA 1X3GA 2I5LX 5TK4A 4B60A 2EH7H 5I0ZA 4GFTB 4OXPA 3FC8A 5T3ZD 4DETA 4XYQA 1QD0A 4TUOB 4RWYL 3OG4B 3K81C 4LF6Q 4DXGA 1FHNA 2L11A 4J12A 5LG6A 3L6FB 4KTDH 1CFTB 1B53A 3MCKB 4R6UA 2R8SH 1RERA 1YAZA 1CVRA 1LHZA 2FSEB 3GUTA 3BWSA 3HUJA 3V4VA 5BOZG 4PD4K 1IGCH 4CKVX 3M8OH 2VLKE 3MXUA 1B88A 2UXGA 2WTRA 4HWZA 2W38A 3OQ3B 3W56A 1AGCA 1GZPB 5HDOA 3TCTA 4GKJL 3FT3B 1UZ6E 2WKOA 3GEFA 3DMUA 3V4PL 4F58L 4JO1L 4JJ5B 3BT2H 1PMYA 3FQYA 3TBWB 3VO0A 4Y5YC 5T1JA 1ZA6A 3RNUA 4AL8C 3IKJA 3I2CH 3GSVB 5EV7A 1XPUA 3TA3C 1FL6B 3IDIB 4TLSA 1KTDB 1IKOP 2BNQB 4MXWH 1ZIBA 3KYNB 2ZWKA 1DBJH 3PQYB 5AJ3Q 4K5OA 4QTFA 5IQOA 2JB5H 3SK4A 1CDUA 4Z7OF 2J6WA 1A9EA 4KRPD 1Y14B 2WSPA 4HC1H 3K71A 3BH8A 4XCCH 2FVNA 2C4FT 3CPLA 3D09A 1NCVA 1RU9H 1OTSC 3VSTA 3D5OF 2NY2C 2FR4A 1PH5A 3LSOB 3QA3A 5LMNQ 1T1ZA 2XZQL 5C0AB 5F6IB 1U41A 3LKPA 2FIRT 3T0DA 4QYOA 1UQSB 5JVH3 5FOJA 3BIKA 1EL0A 3ABMB 4U7SA 5KS9E 4GFXA 4NRXA 1VQ4A 1GYAA 4TQ8A 2MMXA 4NXML 4UYPA 5LO7A 2GJJA 4Z1PA 1Q46A 3EYFA 1UYWH 4AQ8C 5T5NG 1AO7D 3WMSA 2HLEB 1BOSA 3GNMH 3CXDL 3MC0A 4BHUI 3VD5A 4Y5XC 4AC2A 2FBJH 3TS2A 5BZZA 3I4NB 2XBZA 1VDGA 2K70A 2R2BA 2WZ0A 2XRSD 1WO2A 4AXWA 3EAKA 4FFWC 3R2TA 2A9BA 4XB8A 3FRPA 3GUTB 3MOAH 3VXTB 1CICC 4Z3IA 3V4VB 1BAFL 1P5VA 2J55A 4HWZB 2WTRB 3MJ7A 4JM2F 3WJJC 1IAOA 2OXPA 3HA0A 1AGCB 3I85A 4GBXD 1E3FA 2HKFH 3QR0A 2HQLA 1EVTC 4UQEA 3K80C 1CCZA 5I23A 1WUZA 1LM0A 3BESR 5C3WA 4TKWA 1ZA6B 2FEDD 1AE6L 1DQDL 1RZKL 1KB3A 4QOKE 1JDCA 1OPGL 4K7PY 3RGVC 3N91A 5DHDA 4FQJH 3B9AA 2HLFC 4A7QA 2DH2A 3UTTA 1ESFA 2J5LC 5EOTA 3EO9L 2ID0A 2N01B 4NN5C 3TYGL 1NNXA 3KBEA 3ZJYC 1RUAL 3CSPA 4PNYA 4E6IA 4ZMZA 1A9EB 4GQ9L 3K71B 3BH8B 4NXNL 3D48R 4FOMA 3DROA 4IU3A 3CPLB 2IJ0A 4ONGL 4CN1A 3O2VH 1Z3GL 3VDAA 2FR4B 1WG3A 2EYLA 4JFXB 4EMZA 3QA3B 3X3NA 4X6CE 1T1ZB 1O7LA 2IQ9L 1STNA 2KHJA 2C9QA 3N9GH 3C60D 1OZTG 3OMAB 4JFFD 2L0CA 3LKPB 3OZKA 4C3IG 2IBBA 4MD5A 5EH1A 2NQCA 4QYOB 4MKMA 5BOJA 2HUHA 1XF2A 3BIKB 3VDCA 1EZ8A 3QCVH 4BWUA 4CMHB 4ZS6C 4NRXB 1GY2A 2D4DA 3B2XA 3R4DA 4DO5A 4KROC 4KTYA 2NQDA 1M53A 2VQ1A 3L8QA 1JJ2A 3O8XA 1FA4A 1FPTH 4U49A 3HG0A 3EYFB 4YHOL 5EOQL 4UTAL 4K0KL 3TBVA 4JFEE 1X4YA 3MC0B 3UDFA 1KYDA 5T1DL 2BSBA 5DZVA 4AXWB 1ORSA 2FJUB 1UAPA 3FRPB 2Y6TE 1A3LL 2JSFA 3KPSD 4LPYA 4KHPL 4HWEH 5LXVA 3KUPA 4OLXL 3J81i 1P5VB 3MJ7B 2CBQA 3O11A 3WIAA 1IAOB 1BMZA 2F0TA 3MQIA 5CSGA 3L1OH 4ZJ9A 4BY1G 5GGVH 4PJXA 4MYPA 3KBHE 4JQXC 1D5IL 2Y6SC 4IOFC 4GLRI 4NQVA 3RY4A 1MHCA 3S6CA 4WNQA 4X4ME 5DWPA 4K2LA 1CTOA 4YXHH 3BJUA 2F58H 1SM3L 2QT6A 5C0ND 4ABVA 2BXYA 4LXFA 2DIAA 3UTTB 2D03H 2KHAA 4HFUH 5EOTB 1QA9A 1HYSD 5DNFA 3MACH 3NA9L 2DLTA 1H0DA 3D0FA 4A3IH 3KW8A 3QAZB 3DROB 1LDPL 4IU3B 2CGYA 3NZSA 3VMNA 1SR3A 5BRPA 3RN5A 1HL4A 4FQXD 4A2MA 1NGQH 1WFJA 4KO5A 1A3ZA 4N2IA 1H3XA 3IMTA 2R39A 1AZVA 2KDGA 2ZWLT 5B39G 1E5ZA 3OVUB 4ZK9B 2BLFA 3VRLE 5GS3A 2JJTC 4MD5B 1NFAA 3DXAA 4J7RA 4BA1I 2LXKA 4IRJD 2PXYC 1A8JH 2VDKH 1Y8PB 5GRWA 1XF2B 4GBXC 1GHFH 3QPQD 3ZKXB 1FFRA 1RVFH 4AX3A 3LXBA 3S88H 3R0MA 2E7HA 2KQMA 4JO4H 1D7FA 1QAWA 2VLMD 2VQ1B 3IFDA 1HR0W 4FNTA 3O8XB 4RWHA 2BSCA 1YJ9A 5CP7A 1IU1A 1NOAA 4TVUA 2G60L 4FZ8L 3VD3A 3TBVB 1SYCA 1MUJA 1QNZL 2XDHA 4QF4A 2PW5A 1T1YA 2QTEA 2ZTEA 4FQIH 3SGDI 3IK2A 3B3IA 3I91A 1ORSB 2I69A 1PG7X 5J12C 5SX5K 3ZYZA 2J7ZA 1OTTD 2Y5EA 3DJ9A 4F7TA 5GGVY 4BH8A 3O11B 1JE5A 4Q0XH 4JRWA 3UMTA 4P2RD 3TJHC 3WYRA 2DW5A 3O0RH 3HW7A 2IANA 5EU7E 4LRIC 4PJXB 1D2PA 4I3GA 4U1JA 4R8NA 4Q89A 3L81A 4N2DA 4U1LA 5EIIA 1BM3H 3VTMA 1VRSA 3U9UA 5I1GH 4NQVB 1MHCB 5CIPB 4FQLL 4WNQB 2PQEA 3FMGH 1GM5A 3VW3L 1OSYA 4BXXG 2XWCA 2YWYA 5C86A 5EEYA 1FLTX 1GOZA 3QWRD 1QA9B 2HWZH 5FX3A 4OLYH 5JPNA 1IC4H 5HI3D 5HHOD 1U8CA 2I85A 4PRPA 1X5MA 1X65A 4G7VH 4ERSL 1YNTF 1IGMH 2CJSA 4KPHL 1K8MA 1B50A 1FBIH 1H0DB 4PJDA 3SKJL 2UWEA 4L1SA 3EJIA 4CDFC 1L9TA 1OAKL 3IS1X 5AL0A 2J7LA 5EZIL 3BT0A 5C07A 4KY1H 2BVPA 4DR5Q 3C8KA 1EMTH 5KVFL 5MI0B 2IH9A 4DTGL 4KKSA 2MQCA 3OJDA 4TNGA 4EX5A 2M2DA 3DXAB 3FU0A 4WJG3 5CR8A 1Q94A 2WQAA 3CC5A 4HD9A 2RSNA 1BDYA 3I84A 3LNIA 4JFZH 2JE6I 4GN3B 3SKMA 2Q2LA 1AXIB 1RLBA 2ED8A 2F1EA 2W9EL 2WWNA 1PH9A 4JPWL 2FTAA 4GKZB 4MQXD 3F1ZA 4XO9A 4OIIL 3HMXL 4NPSA 3ES6A 2HZHA 4C57C 4F7MA 1MFAL 3WSQH 3HC4L 1RULH 4ZYSA 1KB5L 5CP7B 2A9MH 2BHUA 3DSNA 4KOCA 1MRFH 5C0NC 3HG1D 1HA6A 1MUJB 1F3RB 3QO1A 1GJUA 1KXVC 3R3OA 4O2CA 1T1YB 2FX9L 1YEJL 1WZAA 1JGVH 1XJVA 1PAZA 3B5TA 3ZZSA 2Z8SA 1J1OL 3B3IB 5KEEA 1EAOA 3EYVA 1DANU 2ITDA 1M90C 4MNGA 4OX9L 4PTUA 4F7TB 1LTBD 3VH8G 3ZYIA 2GA4B 4BH8B 4E9VA 4LUOA 5IGEA 3QZWG 5DURD 4HEME 4AMXA 2ZXAA 2QGDA 5ESQA 4NP4H 2IANB 4F57H 3HNTL 4PBDA 4U1JB 3RA7L 4U1LB 5EIIB 5D8JL 3NP8A 2NY5C 3U9UB 1KXTA 4DV6L 1I9JH 2J71A 2P9RA 3MV9D 2X5PA 5I9QB 1ESRA 4L4TD 3UO1H 5DUMH 1Y8OB 3NQKA 5GRVL 2EDHA 3T3ME 3M1OA 3HBPA 1KLFA 2VKWA 1NANH 4B3MQ 1YMMD 4PUBH 1G9EA 4CKBA 5TPWH 1A9BA 1FNEA 3OG6B 4ANVA 3B43A 1G9HA 1LMIA 3PWUA 4AUUA 5JPNB 1U8CB 3F58L 4PRPB 2F5AH 5I15L 1AFVH 1N6QL 4N4YB 4JRYA 5CEXA 2NNFA 4PJDB 3F2CA 2UWEB 3LV3A 4NC1E 4WY7L 3MFGA 2X89A 1I8UA 5C07B 3M85A 4CSSA 2BVPB 4NNYA 3C8KB 5AVXB 3NIGE 3Q1SL 3QG7H 4NP9A 3KXFA 4QHKJ 1NCAL 1A6TA 2P44B 2BE5C 3S5LA 3VG9B 3OJDB 2AQRA 2R93G 2I5MX 2FX7L 2HCZX 1Q94B 4LASH 3CC5B 4TV3A 6CGTA 4DSYA 4P9HH 3SKMB 2C26A 2XUWA 1F4WL 4QF1A 3JUZA 1GGBL 3A6BL 4YHNA 1CGSL 3HPJA 3ULUC 3FTSA 4HKXA 3ES6B 3F00A 4F7MB 3MA7A 1FWXA 2BOCA 5KNCA 3JC66 1H8LA 3DSNB 4XCEA 3QO1B 4Q9RH 4H88L 4O2CB 5EKIA 3DUHA 3GM8A 1SHXA 3NTCH 4UOW1 1VQ5A 4BBRH 1QG7A 2APTA 5AW6B 3UCRA 4W4OC 3ZGHA 4I7ZC 2WBJC 1EHAA 2JQZA 1DSYA 3EYVB 2X88A 2ITDB 1D5RA 2WD0A 4O02B 3IBEA 4XO5A 1SDFA 2FEEL 3IRPX 4JRLA 4MNGB 4PTUB 3RAJH 1T7VA 2ROXA 5TE7L 3D52A 4FNUA 4K9EH 4Q14A 4MQSB 1DSFL 3N40F 4LEOA 1JORA 5ESQB 1WT5C 3TO4D 2E56A 4MS6A 4KKLD 2JQMA 4LF7Q 2UUCQ 4HJUA 1JZEA 1KXTB 1WFQA 4M6OL 3ULJA 3K6NA 2EINB 1BQUA 4KKUA 3RZDB 5AZUA 5C0BA 2AF2A 4JG5A 4PVLA 4Y4HC 1A66A 1KLFB 1Y6KR 4X4YA 1CL7L 4NAJA 4P48A 4GW4A 3RZCA 1A9BB 1FNEB 5GGQH 1AHWC 1WIOA 3WCYA 2CGRL 3PWUB 1BQQT 2QADD 3BSZH 4GEIA 1OCWH 1PTOH 1LILA 4C4UA 3HOXB 1JGLH 1RSFA 2VYRE 4HCIA 4JRYB 5CEXB 4JO8A 4ALPA 1KBBA 3LV3B 3MZ5A 4E9SA 2E6JA 1HILA 2AQSA 3MFGB 4OAWB 1ZYRC 1TTUA 4E2OA 3KPPA 3RTLA 1IBKL 5FKAA 3JTSB 4NNYB 5F1IA 4EI0A 4K3GA 3KXFB 1I4RA 3Q48A 2VXUH 3S5LB 1G9ML 3HAEH 3LJ3A 3JWNH 1OANA 4GLAC 4EI6A 4LQFH 3UYOD 2NXYB 2XKNA 1FCCA 3U1SL 3HOVH 4XT1C 2I24N 3KBGA 5B1AB 2ZOTA 4QF1B 3HZKA 2PPEA 2YRLA 1JWMA 5E0QA 4YHNB 3HPJB 4HKXB 3MLXH 3RJDA 3MA7B 3QUYC 4G1EA 1XSOA 4OCRH 2BOCB 2F1BA 2DUDA 2YQ2A 4RBPH 4ZUWA 4XCEB 5A40E 5EUOE 4K2UL 3ZTNH 2Y1AA 1DVQA 4FTVD 3HI6L 4OZGA 4GS3A 1QHPA 2VR5A 2CFMA 5I73C 2ISDA 5HXMA 5ELBA 3GRBA 4OD3H 2ZICA 2OMBA 2ZX8A 4G8FA 1KLGD 4DKEL 3QJHA 3W57A 5D1XC 1BQ5A 1B0GA 2ZOWA 5MEND 5ISZE 2M00A 3QCUL 2LVCA 2DF3A 4YDIH 5F8QC 3RNQA 3HTLX 3MRNA 4LEOB 4YXKH 4HR7B 2G2NA 3S36H 2H45A 1NMCB 2AI0H 5AKVA 4C3HG 1GOHA 2K7VA 4KVPA 1Y1VG 5L37A 4NW2A 1F00I 2APFA 4JKMA 1HEJC 5C0BB 3LIZL 3LDBB 4X4YB 5CR3A 3RZCB 4ZRZA 1GGCH 1YY9C 3B7YA 3BPNC 1XEDA 4GW4B 5E9AA 1HINH 5J1AA 4NJ9H 1BPLB 4DVBA 4GKJQ 2B63G 4N90E 5ICZA 3KWVA 2JA8B 2P42B 3BN3B 3FUIA 4A2EA 3WDNA 5GISH 1HILB 2VOTA 3KPPB 1NICA 5FKAB 2F03A 4BA8A 5F1IB 5FK9A 2AAAA 3EOBA 3MAQA 3MV8E 2AS5M 3CV5A 3TZVA 4O2FA 1KGXA 1VQNA 1FO0L 4TTDC 4MA7L 4EI6B 1MCRA 2KZ1B 2LKVA 2XKNB 3VXPA 4G1MA 3IF1A 1TCRA 4ES9A 2VZOA 5C3IA 5K9JL 3HZKB 3AACA 4HW6A 5C2BH 1QLRA 1JWMB 1T2XA 2HT2C 2E7LA 5IGCA 1EO8H 1XMOQ 1J48A 1DJIA 2WXNA 4IS6A 3OPOA 2VR7A 4G1EB 2ZXDA 5IMKB 5D4JA 2B1AH 2E7BA 4ZUWB 4JN1L 4HYTB 5IT2H 4R4CA 5DF0A 1TCMA 4UQ9A 3PF2A 1IGFH 3ESPA 4XNUH 4OZGB 5JW4Q 1EJOH 1M57B 1XCQA 2X10A 1MNNA 1KSRA 4G8FB 1EDYA 3SK6A 5JMOC 1M9WA 3QJHB 4FYSA 2UXBL 1B0GB 1OVZA 3GTMH 1IKNC 4WORA 1RIHH 4NXMQ 3RNQB 4UTBA 3MRNB 4RCAA 5IHUH 1FV1A 4HKBA 5BVPL 3KYKH 3GT6A 4RMWA 3E9HA 1DFXA 1WTWA 1ED3A 1ZVYA 3WXWL 1AZZC 4GOSA 3N43F 2PABA 4W9FC 4LP4A 4YC2C 4N2OA 3M4PA 2VISA 4N1EA 4QCIA 5I1JH 1NIEA 1JUFA 3A23A 2WTPA 1MDAA 1ZK9A 3PP3K 3ARFA 4WWKC 2Y5QA 5E08L 2EYOA 2F19H 2G9HA 5J1AB 4G82A 3BDXA 3K6OA 3IN0A 3I9GL 3O6FC 3MGOA 2ZSWA 1UWXH 2WW8A 5FO7A 1BCPF 4DVBB 5ICZB 5D2LA 3DWQA 5JXEA 3MLRL 2X1XR 1A1NA 3SPIA 5FV1L 4NEHB 1B9MA 4YFLF 1MFNA 1OAXL 1R4XA 5DEGA 2QQLH 4KNUA 2VW4A 1IJNA 1LQSR 3EOBB 5FK9B 3V4UH 5I75B 3T65A 5IFHH 3TZVB 4O2FB 2VR6A 4G9FD 1I9RH 3IRCA 3NJKA 2ZNWA 4OF6A 1FRGL 1PKQE 2XZZA 2E5LL 2Y0SA 3L2MA 3DX9A 1Z6JT 4GQQA 3VXPB 3Q06A 4G1MB 3IF1B 3FULA 5DJ0A 1TCRB 2Z6BA 1IC5L 4QD2E 1QLRB 4JGUA 2WAQG 3A22A 4LU5H 5IWLA 4KXBA 3UBXI 5FYKL 1TTGA 3GI8L 4IS6B 3BZCA 3C6LD 3KGRA 7FABH 1J86A 4UDUA 1LE5A 2VQUA 2FO1A 4IOCA 4LFBQ 1CLCA 3TFKC 2EQSA 1T22A 2DWEA 3ARYA 3HR5A 4YSPA 3US9A 4P4KD 2BK8A 3ILQD 4G43A 1PYWB 3PPEA 4HMDA 3PGFL 4RMUA 2ZWYA 4WI2A 1XCQB 5D7EA 4CU7A 1UD6A 2VR9A 2OSYA 3D08A 3ZDZB 3BE1H 1NL0L 1C1EL 4K5WA 1J1XL 4OO1H 1SJXA 5F0JB 3VWKD 1F58L 4QHNA 3E9TA 3CVHL 1F9QA 4O9HH 4YPGA 2K5QA 5D7LA 4U0RB 2FQDA 1FV1B 4OGAD 4ZNCD 4KJQC 4LIQE 4X6EA 5I1EH 1GS8A 1L5GA 2VLLA 2IAMA 2ZPKH 1ED3B 2J72A 2Y2YA 4A3IB 2PCYA 4MZ2A 5C3EG 4MJ6A 2GJ6A 3H85A 3MX0A 1ETB1 2VISB 3RURA 4QCIB 2NVQH 4OWWB 1HAUA 1JUFB 2ATWA 3SEBA 3ARFB 4G2AA 1KB9J 5HTSA 2G9HB 5I6WA 1S9YA 1SLJA 2JXMA 4G11A 4ORZC 5E9DE 5CJXA 2J8UA 3MGOB 5FO7B 2ZSWB 3KL5A 4HA1A 5B7FA 5LQBL 5D2LB 4GI6A 4UNTA 5GZND 4NQEE 5M5YH 1ACYL 4I65A 2J88L 4EN3C 2VQFQ 1A1NB 2EYJA 1K0RA 1PCSA 2LR4A 4GLVB 2X4NA 4O5LH 4PGEA 5I6OA 5JTWA 5DEGB 4NPKA 4KV5E 1KEML 2Z7UA 1FC2D 1RODA 3QPKA 4FNSA 4MDJA 4MLSA 4UQDA 3T65B 5E4OA 1XZ0A 2IG2L 1CVSC 3UJIH 4J3OF 2BSRA 1TWGB 2Y0SB 3DX9B 3RFZA 1E4WL 5B21A 1KJVA 5DJ0B 1BIIA 1ZVSA 1KJ2L 1HNFA 3DMMA 3BGFC 4KHXL 2CO2A 3RTQA 2CHXA 4FERA 2P5PA 4UOZA 1T9HA 2DWYA 4UDUB 2WIMA 1LE5B 4RA3A 5HDBB 2OL3H 4CSZA 5IESL 1T22B 2DWEB 3CHRA 3HR5B 2WOBA 3G5ZA 4FNRA 4LEBA 4G43B 2WCGA 2FE0A 2W80C 3VXSD 3LX0A 3EJYC 5EO0A 3T0ED 3BLPX 2QF7A 1ZANH 3WMPA 3WKML 3HNVL 3WNLA 5IWAQ 3GMOA 4QHNB 4ADJA 4JC0A 1TETL 1J0HA 4GOPC 1RZFH 3QIWC 1C8QA 4YPGB 5D7LB 2HX7A 4WEMB 3WTXA 4GJTB 4NDXA 5EAYA 1UM5L 4X6EB 2Z35B 2C5CA 1L5GB 1DJYA 1WA1X 2IAMB 1BD2D 2VLLB 4FLOA 5DUPH 4MJ6B 2GJ6B 1NDTA 2Y7SA 3MX0B 3FQ1A 5K69A 3KLRA 3V2TA 4G3YH 1P7BA 4XTRC 1B3AA 2JA5H 3TBTA 1LT6D 1SLXA 3QG6A 1QLEL 1R9TH 1S9YB 3ZKQD 5A7EA 2JXMB 4K8JA 4KJNA 4PFEA 1C4QA 2J8UB 4GAJH 2DQTL 4B53A 4W93A 4XPTL 4LLYA 1XNQL 2B4CC 4PGEB 4G7YH 4WW2A 4XPFH 4XVTL 1IGIH 2X4NB 4AUYA 1AKJD 4ELMF 2CALA 4P49A 1SLUA 1QSFD 3MLVH 2NYKA 2XETA 4MDJB 1BJMA 4YSTA 2AQTA 2MPVA 3EUUA 1RV6X 3DDFA 3GXIA 2J43A 1HTPA 1K72A 1XZ0B 1ZV5A 2EIZA 3Q9PA 4K94H 4M1DH 4X6DA 2BSRB 5FB8A 1NCGA 1MAKA 3RFZB 5SV4A 2RDGA 1KJVB 1NMAL 4CDHA 1BIIB 1ZVSB 3DMMB 1OCRB 3BD4A 3D6GA 4MA3A 3RTQB 3STBC 3LYRA 3MOBH 1PEWA 5GQOA 4R0LA 2VXQA 1E8ZA 2VB3X 3B7TA 1DZBA 3GK8H 2YPLA 1XD1A 1Z47A 3G5ZB 3KCWA 5CJBA 4AE0A 3WDHA 3GTLH 3C5ZD 4QXGH 4R7LA 2K14A 1J9RA 5K59E 5EO0B 2VXTH 1T7WA 2BNQE 3GEWB 1QASA 3MRCA 4KKQA 3G5WA 4GT7A 4U6YA 3GMOB 3PQYE 2EDKA 4OF7A 4PB9L 3CJJA 4RGOH 3BSZA 2KH2B 4LF5Q 2IMMA 4WUUE 5IZ7A 2D3VA 2V2XA 4B9KC 4XQJA 4KJPC 4BGDA 1KENL 5TDOB 1Q0EA 4ZXBC 3D85D 1IB5A 2KKQA 1K8OA 4HWUA 5C0AE 4Y1AA 1BXXA 5IREA 3TBTB 4W9JC 4OX9Q 5E3FA 1WAAE 1OCCB 2MOGA 3QG6B 3HAEA 3X17A 1CTMA 2ORBH 4HDIA 2XOTA 3V2AR 4N5UA 1WBXA 1EUJA 3U82B 1PH1A 3TIEA 2BSEA 1WTQA 4FNLH 4WW2B 2Q8AH 4MTMA 3C9NA 1J9SA 4M29A 1A6WH 2IHEA 1E22A 1NCNA 3LVEA 4QRPA 3MCG1 4WTXA 1XTCD 3B2UC 4UINH 3QUXD 3T0EC 1ZLEA 4AZUA 4PJ8D 5JOPE 4E0RA 4N0UA 2EIZB 4TUKL 4X6DB 4AIMA 2F18A 4IHOA 4JM4L 4N2KA 5FHAH 1FP5A 3CDZA 5DZPA 5FB8B 3T5WA 1HIML 4LF9L 4XN1A 5CEYA 4PV1C 4GRLC 1B8AA 1S9XA 4A3GH 4DK3C 4MA3B 4PS3A 5CCKL 1XIWA 1TMCB 4Y2DC 5DI8A 1PY4A 1YJDL 4XQNA 2BDNA 5M3MB 3KR3H 3L4XA 1AZBA 4GT0A 4R0LB 3D4RA 1CUKA 3VGGA 4B9YA 1XEUA 3QRGH 3WI9A 2YPLB 1JAEA 3X1BA 3F7KA 4CDGC 2CRYA 1RZKC 4ZYKB 5IF0A 3E1F1 1TYJA 1MJEA 4QRFA 3ZKND 3OV6A 1FFPA 1QFWH 3MRCB 1XPOA 2HDLA 2OJZH 4IQHA 3L16A 4U6YB 3ULVF 1FVDA 5GRYA 1ZXQA 5AYTA 1KN2H 1P16A 1KTJA 3MBXL 4G4KA 5JQ6H 3RPBA 2J21A 4X7FC 2J6EA 2V2XB 1W72A 5DD0H 3I6LE 2A9DA 3U9WA 2N8NA 3M1BA 3QQNA 1KY7A 1ENFA 1SHSA 5HYIA 2FMCA 5I6PA 3UZEC 1TQVA 3KF8A 5F9JA 4Y1AB 2WO4A 1INQA 3KYMA 1KEGH 3KPMA 1NJIC 3HN5A 4Z95L 4ZAIA 2VLJD 3ML8A 3HAEB 4K8RL 2ES2A 1BQHG 5C0RH 3BUIA 1PY0A 5KYXA 3OPZL 4HDIB 1QBLH 4Y88A 3EHBC 5JQHC 1WBXB 3CCQA 1UZ6F 1N19A 4NRYA 3TIEB 3MJ9H 1EJFA 1NR4A 1VQMA 1VQ6A 1GIGL 1SJMA 1WPCA 2O5ZL 3C9NB 3ETTA 4DOHB 2XICA 5J6GB 3FRUA 3F7YA 4QRPB 2YRPA 1QSEA 1RZ8A 3LZNA 1E8WA 1AR1B 4E0RB 5H4YA 4PU2A 4N0UB 2X53A 3VI3A 1M05A 4KI5D 4NQDA 1TZAA 2H1PL 3VFRA 3ALXA 3CDZB 3TONA 3PO3G 1EJ6A 4KKAC 4X42A 4XNYL 4WZ9A 5CEYB 3O9WD 3ZE2B 2ZM6Q 4H8HA 4PTTA 1S9XB 3QOLA 4URTB 1XIWB 5C6PB 5DI8B 2WXOA 3LHPH 4IRSD 4CW1A 1QRKA 1IBKQ 1ZTXH 2KCCA 2ZUUA 3II1A 3P7JA 4NO5A 3V0AC 4TQHA 2QLYA 4YLCA 2NCMA 3RY5A 2ESVA 3OKLA 2WUBL 1BCPC 2SDFA 5IF0B 4BY7B 1OP3H 3NCBB 1SVZA 1FFPB 2X09A 3JVGC 2N7AA 4A3DH 3UTTE 3UYRH 4CADA 3RWFA 5KS9F 1K85A 4LK1C 1FVDB 1SY6A 4FXTA 2BP8A 4PJ9A 3L0OA 5BS0D 3FO0H 2PWGA 1L7TL 5FGSA 3GJFA 4DN3L 4QTIL 2B2TA 3GM0A 3NJJA 4Y8AA 3APFA 5AVVB 5C6TL 5I71B 4HAFA 3G9AB 1W72B 2WB1E 5ERWA 3ZTJG 3OZLA 3M1BB 1RZJL 1N0LA 2VSDA 4OTXH 2EY5A 4CUCA 1N18A 4NFCA 2E47A 3KF8B 5CBAE 2IMNA 1N34L 3LRGA 5CGBA 5F9JB 3HE6D 5H37H 4A3BH 1LK2A 2F54A 1INQB 1KIQA 3KYMB 3PCOB 3KPMB 2K6YA 4ODVH 5EBWA 5GAGC 2V0AA 1IEHA 4BZ1H 2UU9Q 3MNZA 3CE1A 3CHSA 5KYXB 3RDTA 1JZGA 4MCMA 2Q3AA 2IPKA 4PN6A 4JKPL 4NRYB 5I0YA 2F0NA 5KW9H 4Z0XA 1V1OA 2AW2A 1CSPA 3FFCA 2R0WL 1ZDSA 1MXGA 3FRUB 1P6WA 3ZQ9A 3F7YB 4OVUA 1QSEB 4UT7H 1RZ8B 1U4FA 4OCLC 1MJ8L 1U4LA 1G0XA 3BP5A 3KLSA 1RHHB 4C3JG 4F2FA 4U6HA 1M05B 4NQDB 3VI3B 3S2HB 5TF1H 1QFUH 5JJKA 3DSFL 5EPKA 3HI5L 2RAMA 1SMXA 2OTWA 2XSCA 1TEFA 2GYSA 4PTTB 5DVNA 5IQNA 3O4OC 1I53A 4X5QA 5DJXA 5JEAJ 4QTHA 3LEVH 1FFOA 4RZCA 4CW1B 2WBWB 3V8OA 1LEIA 2EVGA 1DEDA 4YZFE 4CBPA 3BRFA 4PJHE 2XVSA 1BGXH 5TD4A 3E3XA 4FKEA 1U2HA 4HPYL 4NO5B 2NY4C 1A0QH 4X6CF 2ESVB 4XN5A 1ASOA 1DQML 4O4YL 4ZODA 4P2YA 3DVFA 5ABZA 1FNHA 2JA6H 3C6SA 2VL6A 4CADB 1A8VA 1NCHA 3RWFB 4BIKA 2IXQA 1WCMH 2BP8B 4LRNH 1GMEA 4P5TA 4PJ9B 2BM3A 3GJFB 4ODTL 5IOKA 1VEMA 1KNEA 2CPUA 4JRXE 2EACA 3A6CL 3QI9C 3F04A 1LE9A 5TGBA 5ADPH 3SB3A 5ERWB 2D9UA 4V1DD 1N0LB 2OTPA 3SE9H 3S16B 3D87B 4ZPVA 4Z7UA 1LK2B 2F54B 3MCLH 1KIQB 3DXAE 1CIDA 4Q8BA 5EBWB 1VPOH 3MNZB 4X8JA 1NWOA 4QLRA 1IBDA 3RDTB 2KDYA 3VWJC 4AT6A 2IPKB 5E6ZA 2NT1A 1TFPA 2RGSA 2AAVA 4Z0XB 3FFCB 3CSTA 5IP7G 2LV4A 2GIYA 3QJVB 4HOZA 2WTOA 5DMGC 2OX5A 3VXRA 3BP5B 4GSDL 5L4MA 2B29A 4U6HB 3SDDD 4J3OG 1UKSA 2L55A 5C92A 1LYLA 1TQCC 2H2PC 1J5OH 4DP2X 2OTWB 3MLZL 4U6VH 1JXKA 2XFGB 1QFWM 3OPUA 5DJXB 3UAFA 4QTHB 2G0LA 1FFOB 4RZCB 2F7PA 5BV7C 4I85A 1LEIB 2DGYA 2CR3A 3MRLA 4FG2A 2KBNA 2MCMA 2EXWC 2WVSA 5CILH 2OJEA 2XVBA 4GRWH 2GC7C 4A3JH 3VRLF 2AZAA 3DETC 2YGOA 3QDJD 2JJQA 3DX6A 4HXBH 3OKKA 4HZ1A 3H3VC 5CJ5A 2FATL 1G7HA 1VB9A 4K3EH 5L4FA 1D7CA 4ZTOL 3UJTL 3C6SB 5GS0H 3II3A 2Q8TA 2ZJPA 1PRTB 1ZIAA 2IXQB 4HKJA 4MCYA 2CLZA 4P5TB 3L3OA 4CNIA 4P46C 5AKSA 2ZXPA 2WMPA 2EXTA 1KGCD 3GRWH 1T83C 4N5EC 4WKZA 4PJDE 5EORH 1OKEA 4POUB 3SPVA 2F7RA 2B2YA 1LE9B 4MA8H 5TGBB 4OZFH 1MFCL 4ZPVB 1OGPA 4Z7UB 4AGQA 3UGXA 4TYUA 4LIQL 2HHHL 1CZ8L 4U2YA 2V7HA 4ZD3L 3KVPA 4OI7A 2WKCA 4P06A 4KZEH 4PW4A 2XX1A 4X8JB 5TE4L 1FQ9C 1XWVA 4A4IA 4Y1SA 4J2XA 3S96A 3SOBH 2E4FA 4UV7L 2OV0A 1NCCH 3CFKA 4N8CL 1DP0A 4XXCA 1QR4A 2BRRH 2Y3AA 2F0LA 4LEXH 4OM1L 2A74A 5F89A 5AAMA 1VQBA 4JG0L 1FG2A 3B6SA 3KYHC 1VSCA 2OX5B 4E9QA 3WNJA 4PJEA 1B3QA 4YHMH 2Z6FA 2HFTA 3VXRB 2WQ8A 2X70A 3C5JA 2O6EA 1R5IA 5B1BB 2Q2HA 2QPFA 3FPUB 3O4LD 4M7KH 1PLGL 1IV8A 3CFIC 4H8QA 4NKOA 4JPBW 1CQKA 4LHJB 4KKCC 4ZMWA 4X6BA 1NPNA 2EO1A 2AEPL 3BKJL 1XGZA 4PRBA 4ENEC 3MRLB 1CG9A 4K5LA 3W37A 1CU4L 5ELDA 5C4XB 3ARSA 4S1DD 2Y7LA 2Z9HA 4PZ8A 5EEWA 4IUQA 4MNOA 1I1AD 3DX6B 3OKKB 4R4OA 4CHTB 1G7HB 2E27L 4S1RL 4AI7A 1UOVA 3S5ZA 4LFHD 3O6KL 1PAMA 3PIP3 2LW3A 4HKJB 1RZ7L 4HX1A 4OGYH 3K5RA 4C56A 2JA5B 1ZJBA 2CLZB 4MCYB 3L3OB 4OLZL 5EU6D 3TS0A 4HEPA 2Z6KA 2B2XL 2FJFA 4CNIB 2WMPB 4HUNB 1F6LL 4WKZB 3W11D 1AH9A 3LH2H 1VJSA 1FGVH 4OQTL 1I31A 3SPVB 1OXSC 1YYLL 2NY6B 3FO2A 3V9EA 1O9WA 1PTOF 5IYDH 4M5SA 3MJ8A 4UAOC 1KELH 5I1LA 1AY1L 1YNLH 4IN3A 1KPVA 2MKLC 1G9MC 2V7HB 4JDTH 4P3CH 1HWWA 1CXLA 2FHFA 5KNDA 1FGUA 1L6XA 2UVEA 3NPSC 3VXME 1T66D 1TO4A 3S96B 2CHWA 1SUJA 3IDGA 4JFWA 3CFKB 4PM1A 1T03H 4Z3EA 3DJTA 3PIQA 1TXKA 1O7IA 2W59A 3CVCA 3MRQA 4YDZA 5EEZA 2IY5B 4IFDH 1M7UA 1BJ8A 2A74B 4UAIA 4XC3H 1FG2B 3B6SB 5F89B 3HB3D 4R7DA 1FVIA 4PJEB 3ULVC 2QILA 3T3MF 4NOBA 2TRYA 2QTVA 4S1SL 2DWDA 3VYTA 2X70B 3C5JB 3OMCA 3QHFH 1F3DH 1R5IB 2A9CA 5C09D 3M7NA 5MEPA 1O75A 2YPKA 2F6AA 4XVJL 2QDLA 2ZWNA 2DMHA 4JQVC 2F8XC 1CLZL 4NKOB 1ECZA 1QRND 5D55A 4X6BB 5ACMA 3FEWX 1YEHH 4YWGL 5B3SB 1X6NA 1I1FA 1T2JA 1U8MA 4PRBB 4BK8A 2VDNH 5M5XB 3DM1A 1CG9B 1VFMA 3RLFA 4LGSB 4U1IB 5E00A 5C08D 2ZF8A 3NIGF 1PEZA 4R90H 3CUPB 4PW3A 3T1WA 2AJVH 4LCVA 5FYKD 1A3UA 3US1A 1F2QA 2DJFC 3VFVA 3SQOL 4K8IA 2MCG1 1TIUA 4M5YH 2ATKA 4HIXH 1OGAA 3N1FC 1CXHA 1G7JA 1BVSA 4NT6A 4JBWA 2FJFB 1ZLSH 1MVYA 5AB0A 3HRZA 1FL3B 3MREB 4XRCA 1EDQA 3CMAA 2R56L 3FO2B 4LVNB 3LS5H 2CK0L 4UDTA 1P69B 2ED7A 4Y19A 2N4IA 1R6VA 2GVBA 4LJZC 5AYUH 5DA0B 3MJ8B 1BBWA 2MCPH 2EDLA 3ATBA 3BLKA 5TF0A 5I1LB 5I26A 4HJ9A 1JGDA 1KPVB 4PJ7A 4FEIA 2K5NA 4LSVH 5A2KH 5FIEA 4PRHD 3VD7A 1SJEA 2ALWA 5LMUQ 4IOSD 3DX2A 1L0PA 3BI9X 2H6OA 5DFVC 4RFNB 3RBSA 3MBEA 3IDGB 4NZRH 3DIDA 4O00A 2EDNA 3PIQB 4A3GB 1KF9B 4ELDA 3MRQB 1YEEH 3BSGA 3NCJH 2ZYRA 2V4DA 2AMCB 5HI5C 3TU6A 2HH0L 4R7DB 2ZCLH 3PABA 4XH2A 4E41D 2LLNA 2DWDB 1UVQA 2C9AA 4OZGE 3WFHA 5MEPB 1OL0A 1BECA 2YPKB 1PH4A 4F9PA 2R2HA 3U25A 1L1OC 1XF3A 3X1NA 4HQQL 4Y5YA 4J8QA 3HOUH 2L0DA 5HVHC 1QX1A 2Z4TA 4ZSOA 1W80A 1I1FB 1E9OA 1U8MB 2COVD 1M1KC 4B9IA 4PVBA 5IG7A 5KJRL 5E00B 4DV3L 2WP8J 1D9KC 1OT1A 4GAFB 4N68A 3V4VL 1U30A 1U8NA 3BZFA 5IB1A 3SYPA 4YHKL 1JYWA 3JWOL 2CDGA 2V5SA 4LVOB 2IWKA 4W6XB 3VFVB 4DVRL 1QTYT 1UJTA 2DDQL 3FOMA 1DTUA 5HGBA 1XYIA 2XN9A 4NWTH 2AJYL 4NS0A 4PD4J 2ATKB 3BUBA 4K5MA 1OGAB 4HJ1A 5I8EA 1Q86C 3WN5A 4PJIE 1G7JB 4YHPA 4NT6B 1UKTA 1RK0A 2VC2H 5BXFA 1JNNL 3SJVE 1NBQA 3HRZB 5EUOF 4XRCB 5F7DA 2YPVH 3DX7A 3PV7A 4LT7A 4UDTB 4NZTL 1FLRH 1XXDC 1BBJA 2EDRA 4PS4H 4Y19B 3WNPA 3V95A 5CN3A 3HN8A 5CGMA 3ZZQA 4KHTH 1JGDB 3AS3A 2FWOA 4PJ7B 2YXWA 2MQHA 1D5BA 4M02A 5D1QE 3EA6A 4Y7MA 1SJEB 2NPLX 5ELOA 3WELA 3HR6A 2L12A 1SJHD 5EDSA 4KUZH 5F9WB 2XTIA 1BFTA 1GOGA 2OKMA 3KJ4C 4FZEH 4JK0D 4R2GB 3MBEB 3SCMD 1J9QA 3SKNA 5CC4A 3K0XA 3PV0A 2E9WA 5CZVL 4M48H 1NMBH 5L9DH 3FN0H 2JKJA 2V2WA 3N44B 2GIXA 3GC3A 4XN7A 5D9SA 1NLBH 2XY1A 5HYSG 2Z0BA 3PABB 4XH2B 4HOXA 2BINA 1UVQB 3WFHB 1DM0B 4AM0Q 2I32A 1FE8H 2R2HB 3X1FA 1MCDA 3UG3A 3K6DA 5IMMA 4ZMXA 1XF3B 3WS6A 2VDMH 4G6KL 4Y5YB 1Y1WH 2H32A 4RFBA 4WWNA 2VL4A 1JI1A 1JGUL 4ZSOB 3W0WD 3GKWL 5DMIH 1E9OB 2D0GA 2JLPA 1B2WL 5IG7B 1I1CA 3C1FA 3CSBA 3NABL 5T33H 3TA4D 3ESMA 5I1AA 1U8NB 3BZFB 1D3CA 3MLSH 2MJWA 2GHZA 3KLDA 4DIXA 5IB1B 1JR0D 3BKCH 3L7FA 5FLMG 4LVHB 4XMVA 2CDGB 4YHLL 2GTWA 1JOKA 3CD4A 5AW4B 3FOMB 5HGBB 1S9WA 2QMKA 4KRNA 1QHQA 1Q7YC 1R33A 2XN9B 5FXCH 3VSVA 3WN5B 5I8EB 5AZ2H 2AQ1A 5M5WH 4YHPB 1FH2A 2IDFA 2R69H 2EUXA 1RK0B 1WFOA 2OPCA 5C0XG 1K0SA 3MRRA 5BXFB 3OAZH 3AGVA 1H6FA 3ABLB 4PJAA 4OLVL 4JPIA 2SNSA 2R2CA 5F7DB 3NJNA 2NZ1D 2W94A 4Z9CB 2HT1A 3DX7B 5IJKA 3P30H 2NT0A 1BBJB 4KVCH 1VQ9A 5HYEA 2H3NA 3AITA 1S5IL 3KF6A 3PDGA 3VE0A 4MAYD 4IURA 1OZUA 3UP6A 1J18A 1GUOA 2FWOB 2FH8A 3LQZB 1D5BB 3HOYB 1V8HA 3UCQA 3T8VA 2Y0SE 2XQBL 3ARBD 1UCBL 4AVIA 3UFIA 3NEEA 2R15A 3LB6C 1AQ8A 3ARDD 3CIAA 2DRUA 3SKNB 5E2TL 4FYTA 3FPYA 4M6AA 1MLBA 3NGBC 2JELH 1MCWW 2V2WB 5FGBA 1SMDA 5D9SB 4A7GA 1XCXA 1TQSA 3CVIL 4AGLA 3HE7C 3HOWB 2I5YL 5M7QA 3QXWA 4F1ZA 5CKAA 1M8AA 1X6OA 3QO0A 5KYWA 5MHSD 3H1ZA 1T0OA 4U68A 4LWCA 4TNVF 1JWSD 4JQXA 5IMMB 2BIPA 5DC2A 1Y6MR 3CCLA 2A99A 2AQ2A 4K3JH 4NO3A 4Z9KB 1VA9A 1GW0A 3LS4L 2JA6B 3ICEA 2H32B 2EE1A 2HTLD 2A6HD 2F74A 3N41F 1BYOA 5EWIL 3RUZA 4CVXA 5I1AB 4UV4H 3ZHFA 3NK4A 1SLWA 3U2JA 3U7AA 1A3RH 1EZVX 1QATA 3L7FB 5EPJA 3FCSA 1XMQL 5NUCA 2GTWB 5HGAA 3A7AB 1AO7A 2DQUH 3ABGA 5EU7C 4AV4A 4AYGA 1S9WB 2XWRA 4JO2H 2AJUH 1P9MC 1KCSL 2K5HA 5GAEC 1S7VA 2Z1PA 2ZYIA 4FLRA 4YSSA 2AQ1B 5EA0L 4R26L 1ANUA 2WZ5A 5I6MA 3EDEA 1MI5D 2J8UE 3CHQA 1X32A 3F12A 2C35B 3MRRB 5E2WH 2AMGA 2EC9U 2Q9OA 4PJAB 3O3EA 4JPIB 1H9MA 1EGJH 4PHXA 4R9HA 4X5RA 1GVPA 5L6YH 4GBXA 2W0LA 2JJWA 4UM9D 1BZ7A 5K9QG 1CXIA 2H3NB 4LAJH 2BZ7A 3WUWA 3VE0B 3SYAA 1L9MA 1U0QA 1K3ZA 4CILA 2A38A 3I2ZA 2YA1A 4TRPL 3TS8A 3QYCA 2UZIH 1MCPL 4EZKA 1HTLD 2BVUA 4EQ3A 2BOSA 5IP9G 1TZHA 2BHYA 3T71A 1KL9A 4F8LA 1VQIA 4J3WA 1OXTA 4FP8H 1GTFA 3VFSA 4KRPB 3F05A 1TU2A 4EXKA 3QISA 1RTOA 3AG2B 2HJLA 5F7KC 1DVYA 2HLAA 2KZBA 2IPTH 4UZUA 4WI3A 3QO0B 5KYWB 2VJ8A 3BMVA 5EOCJ 2I26N 2DL2A 1P53A 4DGUA 2Y2TA 1H9JA 2J8HA 3HGBA 4KRLB 1SLVA 3C60A 4JFFA 4BSVA 4NO3B 2AQ2B 4NZUH 5B1JC 4BK4A 4EQ2A 1EX0A 3GTKB 4BBRG 4TSAL 3CCSA 2NVYH 1KYUA 4FD0A 4F7EA 1VQ7A 4WEBL 4X9IA 1QVFA 1NANI 3UP1A 1YZZA 1JZ4A 2F74B 3BEVA 4CVXB 4D0DA 4KV5F 3QDGD 3UROR 5DZLA 1MNUH 1EY7A 1YEDB 3A4AA 3FCSB 1IBMQ 1HCFX 3T4AC 5HGAB 1AO7B 1CFNA 2LGNA 3WO3B 3IXTA 2DQDH 2G2PA 2HRLA 3RI5F 4C54A 2D5DA 2BFGA 2R7ZG 3NCWA 3O0LA 4LCIH 3Q22A 1NPJA 2QFPA 4B95C 3KPSA 2N49A 1FC1A 5GGTL 2Z0UA 1B0WA 1X5FA 2JE8A 3F12B 3NIFB 4NZJA 2B2WC 5BN5A 1CSQA 2KQ3A 3O3EB 4JMNA 3WNOA 3A4DA 3WOVA 1VF5C 3I4OA 2OZ4H 2P28B 2O5JC 1UWVA 1P1ZA 4GBXB 2QPUA 4TL4A 1X5HA 1BZ7B 2VO8A 3FH8A 4HT1H 1UB5A 3BAIA 4BBSB 3FT0A 3RZWA 3WUWB 1TOXA 4ANUA 1TVHA 4NNPH 3TP5A 4W70A 1ODAA 4NC1C 2HKHL 5I1DB 2Q20A 2W9DH 3RZOH 2NRDA 4NQQA 2HTLC 2BIMA 3DX8A 2A6HC 2R0KH 2X6GA 2HT4D 4EBQL 2QQQA 2GSGA 2JCCE 1TZHB 2WQUA 4XBGA 1S3RA 1YJDC 3HOVG 3TSSA 4JLRA 4NO0D 4TSBH 3VFSB 1YNND 1TU2B 1WIPA 4XP9H 1IT9H 4JW3A 3RX9A 1MW0A 2HJLB 5E4XA 2HLAB 1KTKA 2A69D 4KK6D 4L9LA 5AOZA 1OXUA 4FQXA 5CS7A 2E7MA 5BO1H 4Y16D 2XVGA 1YHAA 4DH2A 1EUTA 2WO3B 1Z9NA 4BSVB 4A93H 3C60B 4JFFB 4B50A 5DEJA 1OIOA 3QHTC 4NUMA 1WZ1L 4Q6IC 5HPMA 4YAQA 3F83A 4YHYB 1BA9A 4IRJA 3M3YB 4NM8H 4F7EB 2XRQD 3QZNA 1KZQA 3GLDA 3BVDB 2IX1A 5DVKA 3QZMA 3BEVB 1V3JA 4D0DB 2EDFA 4AMKH 2H7WA 4UAHA 1WFMA 4CN4A 3H9HA 4LL9A 2GY7B 5DJAB 4EAEA 5JHDD 1O7SA 4JM2D 3QQ9D 1GS6X 1CFNB 3QDME 1TLKA 3IXTB 4DW2L 2I07A 4BQ6A 5J6HA 1SXBA 4WJ5B 4HF5H 5IB5A 2L4OA 1F13A 4FI7A 4K8RC 1SHMA 3QQXA 3KPSB 1UG9A 3TRZA 3PL6D 2PCFA 2F53D 3TT1H 5G5DA 1JB3A 5ENWB 5C97A 2YAQA 1TZGL 2EXYD 1P1ZB 4FMKA 1MIEH 4P2RA 4WO4C 5DD3H 5E94A 5I76A 4QXVA 2JEAI 4Z3GA 3Q7JA 1UB5B 5CO1A 4OJFH 5I30L 1NPUA 1OCZB 1TVHB 3M45A 5K59F 1Z7JA 1KWKA 2ALYB 3QIBD 1JPTH 2ARJQ 3H9SA 1NUNB 4XHJC 5LJYH 2YFNA 4KZDH 2DNCA 2MQGA 3DX8B 3P69A 2EH7L 1EIGA 3K58A 3QWRA 2N55A 2GSGB 5FYJD 3IDXH 5HHOA 1IHZA 4XBGB 2HQEA 1E8XA 3DI2B 4JLRB 4NXKA 1IW7C 3QXDA 4KTDL 4ZAKD 3A8JE 4TQIA 1MCHA 3UGEA 4L9LB 4FQXB 3UTSD 1UD3A 5F1OB 3PUUA 1IGCL 1EO7A 1I75A 2IOOA 1WAAF 3M8OL 4W9LC 2DM7A 2DTMH 1IBYA 3HIZA 5KBKA 2K6WA 4LMQI 3UBHA 2NYZD 4AEHH 3BUYA 4UBDC 3F6LA 3BX7C 5HPMB 4YAQB 3FQXA 5F9OH 4IRJB 3SDXA 2Z64C 4JFUA 3IAYA 4OFKA 1KCKA 2C8NA 1XGTA 1OAUL 4PWFA 4G57A 3I2CL 3BZDA 3D12B 2CO6A 2X28A 4LSRL 2EXDA 3J81E 3N0PB 3NRPA 1F4AA 4JY5H 2PZUA 4PV8A 4D9RE 1WD9A 3H9HB 3LVTA 1RZJC 4K7PL 5JEAH 2JB5L 3KLAA 4WJKB 3HG1A 1ZE3C 2I07B 1TQBB 4FFVD 4DN4H 5J6HB 4HC1L 4XMKH 3WS3A 5IB5B 5LBVA 1K28A 1PX3A 2K45A 3IAPA 4M3HA 2PW2A 2MNJB 5IBUG 1N3NA 3HBGA 4EI5C 1G94A 2QSCL 1YNNC 1U2YA 4IRZA 3WLBA 2SOBA 5G5DB 4X3SA 5IW3A 1I50H 1A4CA 3W2DH 2VB2X 5E94B 4P2RB 5I76B 1BWMA 5A2JH 2MWCA 5SWZD 4TVPL 2Q3ZA 2ODIA 1DVFC 2VDLB 2XY2A 2EECA 1JI2A 3U46A 3MV9A 3H9SB 5KSAC 3D07A 4L4TA 2HTKC 2GT9A 3MJGX 4Y5VA 1YMMA 4QGUA 3AROA 1UYWL 3ATFA 4TF4A 4NLHA 4C83A 1EH9A 3GNML 3TXAA 5HHOB 3ZUCA 4G8EA 1S7TA 3QXDB 4KJWD 1VQEA 3P2BA 4RISH 4NZ8A 5BR8L 4HU2A 5B1CA 3MOAL 3FT4A 1F4XH 4ESKA 3OJ2C 1JK9A 4FQ1H 2WV6D 1MQKH 2KLSA 3BKMH 2ZP9A 1PH3A 1AGDA 5T1GA 4RBPK 3CXCA 2HKFL 4A3FB 2I7OA 3BUYB 3NZHH 5JIKA 1G0YR 2IWHA 1EWCA 2OTUA 3FQXB 3KPLA 4L1TA 2NUPA 3SDXB 1XGTB 5IOCA 1OCOB 4LLQA 1ACCA 5TTRA 5BRZE 3BZDB 1H9KA 2CO6B 1AHWB 1TS5A 5M3FB 4ZMQA 4FQJL 4PV8B 2E2IH 3GIZL 4M8AA 5F7AA 3U1PA 4N2CA 5J06A 3H42L 2C7UA 1SNOA 3KLAB 3HG1B 1SDAB 4JJHA 2WHVA 2F54E 4JFDE 3IYLW 3BWAA 3WS3B 1PFSA 3TNMA 2PW2B 4WTZG 4MHHG 5L2KD 1N3NB 4IUVA 3O2VL 4HUMB 1Q9OA 3UO8B 2AQQA 1SBSL 3K5MA 1MCKA 1S5ED 3CN4A 4AMWA 3II2A 5DURB 2K9FB 2XTSA 1A5FH 2AXWA 5DS8A 3TO4A 5B8CA 5SWSD 2X4PA 1BXVA 3DUSA 3U46B 3MV9B 1TYRA 2CJ3A 3QCVL 4F8NA 1BZOA 1SXZA 4L4TB 2IVFC 3TTSA 1NIBA 3CPWA 3CX2A 3LQAL 1MFEH 2GT9B 4P2QD 4Q2ZA 4Y5VB 1U8OA 1YMMB 2VDQB 1EWHA 4YMPA 4C83B 2VUMB 1Z5LA 3RVVD 4Q97A 3K72A 1FJGL 1EOVA 4G8EB 1S7TB 5DMJB 3NCMA 5BZWA 4Q6YA 3EJUA 5DJYA 4OO1I 3B9KD 2WQSA 1WJJA 4HWEL 3FB6A 4ZQ3A 3FT4B 2D7TL 1JK9B 3MEHA 4QRRD 4P73A 4HGKC 4F37F 3RMHA 3IMUA 4S10A 4A3EG 2Y5TA 1AGDB 3VU2A 1N10A 4XZ4A 3A8KE 3L1OL 5GGVL 1HL9A 1DBAH 4AVKA 1IILE 2WUCL 1WS8A 3IU4H 1B44D 1BFSA 3KPLB 3MV11 2OTUB 2NUPB 5TK2A 5KGUA 5F0MB 2WXHA 2KPNA 3FQRA 4H7BA 2Q2EB 2XWZA 4LLQB 3OHMB 1EY0A 3S36X 5M5WB 3BPNB 3I6SA 4YXHL 4A1RA 1MREL 2F58L 2NNXA 2J3SA 1F97A 2D03L 4HFUL 4H8UA 2E86A 2NVXH 4KK7A 2C7UB 4Z7UE 1GJIA 4J3BA 3RWHA 3EJZC 3BWAB 4FTVA 4ES8A 4N9GA 5C44H 1WBZA 3D4YA 3TNMB 4AQ1A 3TEWA 4XNZC 1MCCA 4AV0A 3A56A 1Q9OB 2V1CC 1KLGA 1VCBC 2K7PA 4YZFF 4ALAH 4PJHF 1YG9A 4KRMB 5MENA 4JFTA 4KWUA 4AG4L 3EBHA 3QJYA 4GIOA 4GQRA 3L4WA 4P2OD 5DS8B 3SE4C 3TO4B 5B8CB 2ZTCA 1REIA 2VDKL 3PWNA 4AYSA 4MTKA 1UWXK 3QUGA 3FKIH 2X4PB 4M1CC 3D4GA 1GHFL 3DUSB 3CVBA 3FUEA 4XWOD 3S88L 2Z1KA 1M2OA 4C2MH 1BWWA 2VZSA 2MCAA 4JO4L 1QI5A 2X1PA 4Q2ZB 2XTLA 1U8OB 1RKRA 3A5ZB 4AYDC 1HH9A 5F3HB 5DQ9A 1EHXA 1QUPA 2R4SL 3DO4A 3IFNH 3Q6SA 1GAFH 2QADB 1Z5LB 4LW1A 3RJOA 5J3BA 5I1HH 1CF1A 3NG5A 1QMUA 3K72B 1NCTA 5BZWB 3BPOC 4A76A 3J2PA 1BSIA 3EUDA 4FQIL 2H0JA 5DJYB 2Y1YA 1A1MA 2B39A 5DK0A 4XP5L 5I6KA 4HJIA 4YVUA 4LFCL 4CGUB 4PCKA 3M4YA 1F5WA 2NW2A 4R4ND 2Y5TB 3I3CA 4N8VB 1KIRA 3H7BA 4XMZA 1NM9A 2LFEA 5ADOL 4A66A 3O0RL 4DN4M 4Y7NB 2Q2UA 2VN5A 4JPSA 5B4MD 3WIHH 2DB8A 3ZDXB 5DZOA 4JI3L 3C5SA 3Q2LA 3FQRB 4U4BA 5AVSB 3HI1A 3ISRA 1BKBA 4F5CA 5JW4M 4W1TA 4TNEA 1C5CL 4OR1A 1A6VH 1NEZA 1SFOH 2I7SA 2Z4IA 4OF5A 2ZYHA 1CD0A 2HWZL 1EZUA 3KHOA 2X9ZA 3PWJA 4KX9A 5IQ7H 1RLWA 4G7VL 4D2NA 4AQYL 4FABH 4K07A 3BMWA 3RWHB 5JR1H 3CBRA 4FTVB 4RGNC 3IMWA 4N9GB 1QNIA 1WBZB 4AQ1B 3RVVC 4MSWA 3E2HC 4JL2A 4KY1L 1KLGB 2H5UA 4ZTPH 1EMTL 2VRQA 1DO5A 5MENB 3B9KC 4NFBA 2RJMA 2A1AA 3CXHK 3TURA 1XB6A 3C46A 1XBDA 3NSJA 2R29H 1C16A 4YJZL 1FHGA 1U8LA 3PWNB 3U6XA 5AENA 4X9BA 3T09A 4ENZA 4NBXB 2V5YA 4XBPA 3T1YL 3M7FB 4X80H 2PTVA 1KZYA 5LDUA 2UUBQ 1PLAA 1XF1A 8PAZA 3WSQL 2P5EA 2EKSA 3T2QA 5EO9A 1RULL 1Q3LA 3NFNA 3Q8CA 4ODSL 1HH9B 1QYGH 5DQ9B 3S1RH 1MRFL 4PJDF 5AW9B 4GH7B 3ZMEA 3EJRA 3X3GH 1X9UA 1HXYD 4N2AA 2O5XL 2XWXA 3WV0A 1A1MB 5DK0B 2NZ9C 3UDGA 5KVGH 4MRBA 1X56A 3F2DA 4QWWC 4J4PC 1JQYD 3CF5A 1T04A 3RWCA 5IT9L 1JIBA 1EEZA 2NW2B 4AJWA 1KIRB 3BUDA 3H7BB 3KPTA 1JXJA 4G9FA 4YEEA 4TNVK 3U0TA 4FLSA 2DEYX 1BAWA 3MV7E 4NP4L 4R4BA 4KN4C 5LWYH 1BZQK 4ORGA 1MCNA 4LSTH 1TIID 3C5SB 1I9JL 3UO1L 5T3XD 3HI1B 3P1HA 1CT8A 5DUML 2WLIA 2F0VA 4L5FL 4JK1C 3PHAA 1CLVA 2CWAA 1SNRA 1NEZB 2F08A 1NBZA 1UWYA 3C6LA 4RMSA 5I8KH 3FSWA 3F7RA 3PWJB 4IGBD 2I46A 2RD0A 4L3CA 2IFFH 1WFNA 1AFVL 5CLTA 1F77A 3US0A 4P4KA 1GC1H 5KNBA 3MRFA 1SDDB 1EFWA 3JV0A 4X64Q 4MSWB 5JA9A 3K7AB 4ZFGH 4PJ5E 2B2UA 5F6IC 3QG7L 3VWKA 3RZOB 4LKXA 2SNMA 3FF7A 1QVOB 1Y0LA 2O30A 5D6DA 1JDDA 2DQFA 1M42A 4NKLA 3AU7A 1MF2H 1C16B 4LASL 2R23A 4FFYA 1JOIA 4OUUB 1U8LB 1DUYA 4NWUH 1DJRD 1JWUD 1PLFA 1QILA 1VF7A 1IAMA 3EJTA 4I3SL 4OFDA 4XBPB 2KVMA 4PG3A 4NIYE 4KDWA 1J9CT 2GJZA 1KD1C 2P5EB 2EKSB 1FGNH 5EO9B 3NFNB 1BREA 4QO1A 1RIVH 1R3IL 4RGTA 3EZ8A 4Q9RL 4OGZA 4YUEH 3RVXC 3ELAT 3NTCL 5CZXD 1QFWI 2BJMH 3MXVH 3CHBD 3I02A 5GZNA 2NN6H 3FSAA 3H4HA 3L3JA 3RAJL 1NMGA 1ASZA 2BCOA 4PS8A 4PJ6A 5E1AA 4J3UA 4F8OA 3BS1A 1T04B 3RWCB 4K9EL 1EEZB 2NR6D 3V0FA 1W8OA 4DEPC 12E8H 4NO2A 4G9FB 4BE6A 1RMFL 4PYHA 4R4BB 1OGAE 4ORGB 4JI6L 4NZFA 3VTTA 1CT8B 2WLIB 5E1IA 1MBYA 1VQOA 4OZHA 5L2JA 3EJCA 5I0DA 5FW6A 1XX8A 4XXDA 1NBZB 3ETBF 1V3KA 3C6LB 1WEJH 4WFHD 4LGPB 3W2DA 1S78C 3BSZL 5HHVH 4L3CB 4RA8A 2FWLB 1OCWL 1BLNA 2MNWA 1NCUA 4PJ7E 3EBAA 4P4KB 3MRFB 5A43C 4RH6A 2DI9A 2HRPH 3VXSA 2ENBA 2HXAA 3V0JA 4XODA 3VSQA 4XO8A 3J7AV 1MJUH 2H41A 3QXAA 3OWFA 1UXWA 3B83A 3Q1EA 1FNFA 4QXUH 3T0EA 3VWKB 4LKXB 1PD6A 3S34L 4XB7A 1K3BC 2AJSL 2PR4L 1Y0LB 3WMQA 2DYPD 2P4AB 3V4LA 2DQFB 4J28A 3ZKMC 4Z7NE 1NCIA 2PMZE 2R23B 4DK3A 1Y07A 2HPOA 3EO0A 4CMHC 1DUYB 1B4RA 4DAVA 5C7XH 1N59A 4P74A 1BD2A 2WBXA 3WFDH 1H19A 3BGMA 1YITA 2YAFA 3MLXL 1JE4A 5IQLA 2GJZB 3N1GC 3ULSA 3VGDA 5ELFA 2WXGA 3HG5A 5L88H 2X05A 1BBDH 3VTAA 4QO1B 2ITEA 2CM6A 4WDIA 1CFMA 4N22A 5CV9A 2JKIS 1U6AH 2AQPA 1JMXA 3QAQA 3QRFM 1IGYA 4FQQA 2F1MA 5KANG 3I02B 3QP3A 1SVCP 3EJJX 4JHUA 2IAAC 3L3JB 1AKJA 2BDNL 2EE2A 2FQGA 5E1AB 1QSFA 4NKIL 5ACLA 4IUPA 3CQZH 4NO2B 4UNIA 5IVOA 4YXKL 4KK9C 3S36L 1X7TA 5FYLE 4HS8H 1JBJA 2WXKA 4R96A 4KY2A 4KV6A 4PJBA 4K71C 4OT1H 4OZHB 1LP9A 3FUKA 3J07A 5L2JB 1FORH 4XXDB 1GGCL 1AZRA 3CPUA 3DLQR 3PNWA 2MFIA 2ZQKA 4OZGF 1OLZA 2TRHA 3BOVA 3MI6A 1IBZA 3GS7A 1AIZA 1BLNB 3QAZC 2CO4A 3FRPG 4UT6H 3W9DA 3KLKA 4O2EA 2QDVA 3VXSB 1SMYD 3C5ZA 3WOEA 5GISL 4ZX3A 4UTAA 3UEQA 4F8MA 3QXAB 3T0EB 1ASYA 5EBLA 1UXWB 5J5EA 1BVZA 2OMUA 3DUUA 5FW7A 4PWEA 5HJ3B 3M9BA 4D3CH 2XN2A 4R83A 4WAFA 4QRAA 3ARUA 1DVUA 4WU7A 1AACA 2XTJC 3D05A 4P9MH 5TQ2L 3ZKXC 1VQ8A 3EO0B 3AQYA 1N59B 4X9YA 1BD2B 2I60H 3TPUA 3CC2A 3A24A 3BGMB 3EJQA 3O8XC 4JI4L 3D85A 5B38A 2WWMC 3MLTA 4PLKC 1INDH 4PJIF 1WSST 3ULSB 2DQHL 4JKKA 1NEUA 1VFUA 4WDIB 5IT2L 5B3JE 1YBYA 4XHQA 1IGFL 1NGZA 2EO9A 2WB1G 3DVGB 4XNUL 1N7MH 3U0WL 2PO6D 1IGYB 4FQQB 4J3OD 5LGJA 4KTEL 3B7RL 3RIKA 2D2OA 3WTWA 3GI9L 1AKJB 4FHKA 5GADC 3S3JA 1QSFB 2J1XA 4TMPA 1ZRUA 4RESB 1JJCB 1E8YA 1PZ3A 2IWFA 1U4EA 5FYKU 3QUXA 5IHUL 4PJ8A 5DLQE 4DV4L 3L4ZA 4XMLH 5CAYB 4W9GC 3D9AL 1H5BA 1MDTA 2EXZA 3T4YA 4BQBA 1QFHA 4CKEA 35C8L 4R96B 3FU7A 1ODUA 4G6AC 4PJBB 1BJ1J 1IBLL 2XWEA 5EOCH 5KTEH 2ERJB 3HJEA 1OP3K 1YYMH 1LP9B 4NAMA 3H3KA 3VYUA 3NCYS 4PRDA 3PNWB 3J81c 3BDCA 1TKWA 2YFOA 1E6JL 4I48A 2F19L 5CEZE 1PW3A 2M2LA 1AEXA 3W9DB 4NC2B 2UXCL 4PJFA 2NOYA 4DAGH 5FFOA 4O2EB 3VACA 1IIKA 3C5ZB 1SOQA 1HFGA 4OZFG 5G3LF 5MI0C 1YEKL 4M7LT 5EBLB 4HIJA 2OMUB 2QQLL 3DUUB 3T2PA 5C6AA 5IFHL 4L0PB 3J7HA 4N0FA 1NSNS 1X44A 2RIKA 4BD4A 4HU8A 4UT9H 4WU7B 1X3DA 4DGIL 2IWGA 2ICWA 4UP7A 5FYLH 4JFOA 4TQPA 5I0XA 2E0PA 3BYYA 4NQSA 2X2YA 4QHKI 3VFOA 2EVHA 3TPUB 3D85B 1OM3H 3UACA 5B38B 4UF7C 1F90L 3MLTB 1U8JA 1J11A 7FABL 2YD3A 2KJXA 1AQDA 4E9LA 1R47A 4RAHA 2VLJA 2FEJA 1NGZB 1F4YH 2NTSP 5KSBE 2VERA 3N42F 1KIXA 4RKBA 3V5DA 2GITA 3VJ6A 2JKXA 1N64L 2LXJA 5LGJB 1PCXA 4J5VA 3L1GA 5K9OA 1BQLH 4E68A 5DM73 4O9HL 4P2CB 1G84A 4L37A 5I28A 3L45A 4PQXA 3QUXB 5BQDA 2P43B 4PJ8B 3L9RA 2BIQA 4WF7A 2JNZA 4HK3J 1I8KA 1H5BB 3T4YB 4K0OA 1RSYA 1ZHKA 2GI0A 1PIFA 2NB0A 3K59A 4U3XA 2ZPKL 1WCQA 2DD8L 3FU7B 3MODH 4M1GH 1FDLH 3O9WA 4HLJA 4AIEA 2PZWA 1BZDA 1BYPA 1JK8A 5DMYA 1HQ4A 4C3IH 2VDRH 4Z7QE 4IRSA 4PWHA 4GG6F 4PRDB 4UOQA 4IKLA 4JFHD 2ICCA 3HLKA 1TKWB 1KPUA 3IN2A 3FW6A 4I48B 3OSVA 3G4SA 3OAUH 4N2LA 4YDJA 3L2PA 3K2KA 1F6AA 2ZTBA 2R29A 4LHQB 2NUTA 1XTDA 1K8AC 3HMXA 1R1CA 2HG0A 3L5HA 1IEAA 1ZT7A 1PX8A 3LWUA 1WAPA 4K5VA 2VRAA 2Z34A 4H02A 4HIJB 4XNMA 2GBAA 5IJDC 3VG9C 2HRGA 1ACZA 5IBLD 4N0FB 5BS0A 1S7RA 5EIIG 4DU9A 1C7TA 3NCCB 1GD7A 3UJIL 2ICWB 2H2SD 4JFOB 3PUYA 2R92G 4Z78A 5D3IB 4NQSB 8FABA 3VFOB 2X3AA 3F62A 4IFDG 1X54A 1HFUA 4GKNA 5LL6S 5DFAA 4DGYH 6PAZA 2V17L 2N56A 2M1KA 3HE6A 1U8JB 2L3BA 4AW4A 4EDWH 2J8UF 4LCWE 1AQDB 2OL3L 1I7ZA 2VLJB 5E8DH 3SIKA 3AY4A 1SQ2N 1DDHA 5EBDA 3FTXA 4RMQA 3U2SA 3V5DB 2GITB 4O51A 3ONAB 3V9CA 3FVQA 5I1IL 3S3PA 5K9OB 1E5YA 3U9PH 2KZWA 2IBGA 3IPFA 3SDZA 2Y23A 3T3PE 3CW2C 4L37B 4EN2A 2Q8BH 3TTYA 2ROYA 4F37K 3MUJA 4HLEA 2XVLA 4Y7OC 3L9RB 3BVMA 1IO4C 3HZXA 1I8KB 2QFRA 1JJGA 3JVFC 1G1YA 1ZHKB 5CR1A 5F0LB 2BY1A 5DAUA 5DUPL 3KPSE 3O9WB 1ZKOA 5CSZA 1JK8B 4UP9A 3ZHNA 1VQPA 1HQ4B 2NXZC 3VA7A 1PU0A 4G3YL 3WE6A 4IRSB 4Z7VE 3BO8A 4LFCQ 2L7EA 4WNSA 2YS4A 1KPUB 1CS6A 2JJVA 1YI2A 2ZXGA 5ECJE 5I5MA 2Y1ZA 2Y36H 4YDJB 1TTAA 4ZX4A 1F6AB 2NUTB 5KAQF 4RNRB 2FHCA 3PFQA 1R34A 4GAJL 3UG5A 5KOMC 4JB9L 1W0WA 2RHSB 1A7PL 5E7BA 3A74A 1ZT7B 2CLRA 5FM5O 4XPFL 1JFQL 3DYPA 5DJZA 1PKOA 2ZZUT 4PGBA 4XNMB 3MCYA 4QGYA 1OARH 2YGQA 4N8FA 2YUXA 3ALWA 3IETA 3P0VH 4RVBA 4K94L 1S7RB 2NXYC 5BS0B 3T16A 4BSJA 1T21A 4M1DL 4ZMLA 3D0AA 5EZLA 1KXLA 2VLKD 4Z78B 4JHAH 4LAAA 2C7FA 3TJEH 8FABB 4A3CG 2HG5A 4L5TA 4V1DA 1E5BA 3G7TA 4GKNB 3FN3A 3M86A 1OP4A 3MOBL 3DVIA 3BP7A 2K5VA 1J12A 3D50A 5A2CA 3HE6B 3X14A 4CKQA 1K5NA 3HOXG 4YSDA 4RMTA 1I7ZB 4RHRA 1V7MH 2AKRA 3FZUD 1LT4D 3ASNB 4WW2F 1U2CA 3DV4A 4U7MA 5KBMA 1DDHB 4J3SA 3UAJD 4AJYV 2PN5A 3U2SB 2E2HB 4BXXH 3FQWA 4O51B 5AB1A 3MLYH 4CDCC 3HOUG 2EIFA 1DBML 1GZHA 2DLFL 3T1YQ 2AK4E 4AGNA 5ICUA 4QUFA 2CCVA 2KEDA 1PL3A 3Q2NA 4A6YH 1NMCC 4RGOL 2EIEA 4KUCF 5LN4A 3VXQA 3OL2A 1S40A 3SDDA 1FVEA 4H8VA 5IBLC 4GUOA 1RIUL 2CUAA 3PUWA 2JCCF 2EIKB 5CSZB 5BPPA 3LDBC 2R9HC 2QKSA 3RZCC 5J13B 1EPFA 3IMSA 4XCFL 3GHPA 3WE6B 3BO8B 1G2SA 3QEGH 3D0LA 4P2RE 2A9NH 4Z5RA 2WLKA 1JDAA 2YMXH 3ULUE 2ORBL 3H9SE 3MJ6A 3QDJA 3EYUH 2D31A 1W0WB 5FKAC 2CLRB 1RPUA 2ADIB 2CNZA 5LBSH 5DJZB 1A6WL 5B3NA 2C9RA 4RCNA 1HR0Q 4IJTA 4PGBB 3OIPA 4UINL 3WFZA 2BNUA 2J1ZA 3ZX1A 3IETB 2NY0D 3VUAA 5CJOH 5FHAL 1T21B 3I75A 1BQSA 4M9PA 5EZLB 5J1TC 1OF2A 1LTAD 1WF5A 3U6RA 4JL1A 1BNZA 3NHHA 2HG5B 4V1DB 1SMOA 3V0GA 4QY8A 1S2EA 4PS7A 3BP7B 3RU8L 4GXUN 1MCJA 1AVAA 1PH8A 1K5NB 2YWZA 3W1GA 1HZKA 2JA8G 3AWGA 3SDXE 2DIBA 1N6UA 2AKRB 4NUQA 4QOKD 3DV4B 1Q1JL 1NC2D 3FQWB 1A8ZA 3UTPE 1VERA 1PZAA 1RUQH 1YYCA 2ZUSA 2LU5A 1QFWL 1DBKH 4KKPA 1MGSA 4TNWF 3QNZA 2DQEH 2XCMC 1DLFH 2YD5A 4G6ML 4KK5D 2B15A 3VXQB 3SDDB 1F8TH 1FVEB 3Q23A 4MAUH 4R4FH 3O4LA 4NPJA 1N5AA 1NWPA 4OVVA 2XHNA 4QRQA 1J5EL 4M6NL 1URLA 4TNFA 2EPBA 1WTRA 2R93H 1FO0A 4PRIA 3RNKA 4XPGL 1NTGA 3D0LB 1XCTA 3I50H 5L8KB 4L3EE 4HSAC 2VS1A 4Z5RB 1O6SA 2ZIDA 1NGPH 1QBLL 3MV9E 3P1VA 3QDJB 15C8H 1I1AA 1IKLA 2D31B 5GS2H 3S5YA 5FK9C 3LQAC 3ML9A 1SN5A 5I75C 4XAWH 4JE4B 1YMME 1ILQA 3MUUA 3T2LA 1DN0A 1L0QA 3TZVC 2YBRA 2FLRT 2Z1CA 4XP4H 3D34A 3V7AE 1D5ZA 3PF5A 2BA0A 2BNUB 4BHUA 5EU6A 3OKEA 4JVUA 1QO3A 4KFZC 2X4RA 3I75B 2YO3A 1NSNL 2F0SA 4R7NA 1NCWL 5D1XE 1KDJA 4B7IA 4P0DA 1L9QA 1OF2B 2FT6A 4XX1E 1C48A 3G6DL 4RMVA 3BP6A 1J8KA 4OY9A 3OJVC 3U6RB 1LTSD 2CHDA 1V5JA 3GTJH 3GTOB 4QY8B 3LHPL 1CFVL 3T51B 2DJUA 4YWKA 4R3SA 4PI2A 1ZTXL 1OP5H 3NK3A 5F2DA 2FGZA 5CLXA 1PH6A 1IM9D 4P71A 4IJ3B 5HHMD 3ULUH 2NW3A 2MO0A 1W6KA 1VFBA 2ZE0A 3ZT6A 5CP3H 3W39A 5HD8D 3KBPA 3QNZB 3D6CA 4FLHA 1X3QA 1ILPA 4U0RC 4QEGA 2X3BA 2YQBA 3A67H 3DTXA 3U9OA 1I3VA 1YNJC 4IBLT 3IFLH 2HN7A 5C09A 4CC4A 3O4LB 4FN0A 3JAMc 1N5AB 2YXVA 4QRQB 2OAAA 4NIKB 2Z8RA 5ESVA 4AE1A 4DGVH 2QDBA 1FO0B 1QRNA 2ZXEB 3GXFA 3ARFC 4PRIB 3RNKB 2APXA 3TCLA 1UURA 4G72B 2EDMA 1XCTB 3M1CA 1ZHLA 4ODVL 2A6IA 5CHNA 4CSTA 5C08A 4PIRF 4JI1Q 2HFGH 1O6SB 3FDWA 4BZ1L 4LZKA 5JXEC 2PNRC 1UD8A 3ILDA 1IQDA 1I1AB 3P73A 1MFDH 5KW9L 3MZGB 1ZKAA 2K0RA 1MY7A 1NCOA 3MA9H 4QAMB 4K6DA 2NSMA 1DN0B 2J4WH 2OFQA 2YBRB 3FU8A 3HVDA 1D5ZB 1QACA 1CKOA 3HCVB 2E2DC 5EU6B 3WOFA 1JV5A 3OKEB 1QO3B 3EF7A 2NSXA 5I0VA 1OOAA 2X4RB 4R7NB 5TF1L 2QELA 1QFUL 5FYJU 2YA0A 3EIFA 2K1MA 3VFPA 2FXQA 3LX9A 4PR5A 3K6SA 1PDQA 3BP6B 5IWLC 1T0MA 3PREA 4U6TA 3P4LA 3R4RA 4FHJA 3LEVL 3BCDA 2VLRB 4MIUA 4UDUC 3CWGA 3O6MH 3SDYH 4R3SB 4LPVA 4OIJA 3UDXA 1U36A 2J1KA 2CKZB 4C3HH 5CU5A 1SAPA 1USZA 3ARTA 5CJQL 4YXLH 3ZDXE 1Y1VH 5CD5D 5IJKC 4AGMA 4UNUA 4PRHA 2OR8A 2NW3B 4IOSA 3REVA 2YU9B 1VFBB 3KG5A 5DC4B 1JPGA 3DYMA 4NSKA 3DRTA 4RFOL 4DUXA 4G5AA 5KBLA 4ZMTA 2ZSVA 3W39B 3NN8A 2L1BA 1LYQA 2GBVA 4JI4Q 3NJVA 3PAVA 1HJCA 2B63H 1G5AA 2RCFA 2Y0SG 3HB3B 2OYMA 3DTXB 4E41A 1OWWA 2IAMC 3V79C 2HN7B 2A6EC 5C09B 1O5PA 3ZT5A 4YHZH 4I8DA 3BHBA 2ZKMX 2K52A 5T3ZL 2Q10A 1PPIA 4LF8Q 2W07A 5D1XB 3FO9A 3B2VH 5COYA 2RCSH 5ESVB 3SE9L 1QRNB 2AEWA 3TCLB 3V8CA 5IVXA 5FAAA 4OIBA 4YHHL 1ROWA 3WLWD 3MCLL 1VGEH 2DQGH 1ZHLB 2GAZA 2A6IB 4TPRH 5CHNB 5CJXC 5C08B 1WFUA 4HN7A 1IUZA 3I6GA 4ZUJA 4YE4H 1E0OB 3ZE1F 1IQDB 1NFIA 3PP4H 3R18A 4TQEH 5M95B 3P73B 4HHAA 1AP2A 1E4JA 3UJJL 2WXPA 1PTOD 3PQIA 2XXCB 1JYNA 1T7YA 2VQEL 4I7AA 4PEEA 3VXOA 4OWXB 1JV5B 5CV5A 2X7LA 3RFZC 4TULL 5I5IA 2WYTA 2AABH 3PWPD 2AQ3A 1QKZH 2WV3A 3DMMC 1VS0A 3VFPB 2O93L 4PR5B 4Z7UF 3K6SB 1AW7A 3RTQC 5I8OH 1T0MB 3KBFA 5JORA 4ABWA 2AXFA 4AK1A 3CLFH 4IK7A 1BEXA 3TQYA 4GY4A 5TE6H 1MSPA 4UQ2A 4POGA 1IC7H 1NGXA 4U1SA 3ARXA 4PRHB 4H8WL 5ESAA 1A7RH 2C3WA 3DK2A 3REVB 1RXLA 1SJHA 1JPGB 4NSKB 3DRTB 2FZ3A 3UMNA 2ZSVB 3SCMA 5B39A 3J80L 2JKRM 3NN8B 1T5EA 4K3EL 2YRBA 1CI3M 1NMFA 1CA6A 2DN7A 4ZTEA 1NBVH 4X9FA 1UE6A 2ICES 1R46A 3CHXA 4LHUG 5HDQH 1J8HE 3RVWD 2G3MA 3GBNH 5L7XL 1X4XA 2NY7H 2XPZA 1AIFA 4P5SA 5F0PB 1LO4H 3GRWL 4V11A 3X13A 4E41B 5KSVA 5EORL 5C71A 5IYBH 5I6LA 3BHBB 4CDDC 2W07B 2LSSA 3FO9B 3NELA 2NY1D 3RHWF 3CMOH 4TQUS 4DCQA 4HZAA 3QNFA 1B0RA 4LMQD 5IVXB 3I72A 3BWZA 2BSDA 1N32L 4QYAA 1S6NA 1SN0A 4FCAA 4KXAA 3W0WA 3I3DA 1LABA 2GAZB 3CBKB 1V43A 1GHKA 3I6GB 2H26A 1F9SA 5KAQG 3JV6A 4WW2C 1NFIB 3RUGE 5ACZA 4G7RB 3RVUD 4HHAB 5E4EC 1AP2B 2XWTA 5HYJD 2P5EE 3L2NA 3KAAA 1A7NH 4LEXL 1FYTE 4BY1B 3NIDE 3T0BA 4XPBH 1CXEA 1T3FA 3VXOB 2X7LB 1O78A 3ARVA 2OLDA 3B34A 4J27A 2WP3T 4C47A 7PCYA 2MUYA 1CMOA 3GMNA 1EY6A 4LSPL 2NZ1A 1PFOA 2VN4A 3F7LA 3C1EA 2DLGA 1CD1A 2KOLA 4ZMVA 5JORB 2OXGA 4R0LC 2Q6WA 2AXFB 2H3XC 3AB0B 3GZKA 5AWNH 2AVFA 1SUHA 4K9EC 4N24A 4MAYA 1QPPA 1JNLH 4G9FE 3U30B 3K5OA 2Q76A 1BF8A 2GK0A 1NGXB 2PF6A 4U1SB 3QHZL 4BS9A 4RWSC 3ARBA 5ESAB 4ZFFA 5A6LA 1SJHB 3S37H 3HS8A 3EXJA 3ARDA 2FZ3B 4N6RA 3SCMB 3QQDB 5BJTA 3IJ8A 3FUNA 3TFBA 1PZUB 2XZAL 1QLEB 1C9OA 3KH3A 4HIIA 2B2WA 4LF6L 2R1WA 3X13B 3EROA 3CZUB 5KSVB 1GGIH 2FSDA 4NHCH 4PWKA 3LH2L 2OMXA 4KO7A 1KQSA 4JI2L 1JWSA 2NX5D 1W3SA 5M3MG 2PKDA 2D4FA 2YJLA 5HI4D 2VMFA 3BDLA 4R7VA 4ZDHA 1ZS8A 2BY0A 2J20A 1B0RB 2O6PA 1KELL 4U7KA 5LBSA 1KRTA 1YNLL 2WJ5A 1TWFB 3J81j 1EEYA 1S9VA 1PF3A 4N0CC 3U4EA 1VQJA 1IKMA 1FNSH 1MRDH 4JDTL 2L9HA 3VFGL 3TF4A 1E7UA 1COBA 2FNWA 3EYOB 2H26B 3KL0A 3L5XL 4HSCX 4PJCE 1EANA 4ZO6A 3JV6B 3E80A 1ZLWK 3TH2T 3ESVF 3L08A 5ACZB 1T03L 5FJ8G 3PO2H 3R19A 3V0EA 1WVLA 2XWTB 3SQBA 1FIEA 1S8DA 3QZWA 4XPHL 1YEGH 3T2NL 4XC3L 1AR1C 5AOMA 4PLJD 4KLKA 5C0XJ 1M7IA 2CLVA 1N4XL 1T3FB 4C4BA 1OD9A 2RQEA 3QHFL 1MI5A 3G6JA 4I18A 5EFIA 3ECQA 1GUWA 2A19A 3GMNB 3I56A 5DGQA 4ZW3A 5ISZD 2JLLA 2V5TA 1XIWC 2RB8A 1CD1B 4LUVA 1RIPA 5LMNL 2HT3C 3S2DB 3QR8A 1WTHA 1T6VN 2MOQA 2OXGB 4UM9A 2Q6WB 4MAYB 1H9DA 1UACH 2A2QT 3F84A 1ZGLM 2Q76B 3OTTA 2GK0B 5KUKA 3NQTA 1Z66A 3ZQXA 1CLOH 4ZFFB 3ARBB 4A2GA 4ODGA 2K6AA 4KNQA 1T0PB 4PP1C 3ARDB 1A0IA 4OHJA 1DUZA 4QKTA 1K4CA 2VZ1A 2CXKA 4N6RB 1YEIH 4OZHE 4B08A 3SDAD 3WN6A 5BJTB 1AANA 5JUEL 4N90D 2SEBD 4HIIB 5TDPA 4Q52A 5ALCH 4WHTA 3TEZA 5I71C 2LVEA 2R1WB 3TH3T 1BVNP 3EGXA 3MV8D 4IOAA 3AREC 1JWSB 3T0EE 1JP5A 4OCMC 3VFTA 1Q82C 5AYUL 1HHVA 3B9EA 4ZDHB 3X3FH 1ZS8B 1I82A 4B3EA 2MCPL 4WWPA 4OSUL 2EABA 4Q7DA 2A5UA 3FU3A 4DF7A 4UB0L 1EEYB 1S9VB 1ECYA 3LKQA 3U4EB 2D0HA 4G59C 5AAWA 4LSVL 3ESNA 3QR2A 2X1WL 1XZWA 2IALA 3NEXA 3QDGA 1PZ5A 4W9DC 4BY7G 1BD2E 3WJMA 4GMTH 3SK5A 2FRGP 1BJ1H 4NZRL 3U6XS 1DONA 3SQBB 3L3HA 1OXVA 3ERSX 1S8DB 3IMVA 3QZWB 1YEEL 2FGWH 4JHZA 3NCJL 3SR1A 3AYHB 4M00A 2VH5L 4OFVA 2EVIA 1M7IB 2CLVB 4ONFH 2ZCLL 2HD3A 1NINA 2B4CH 2QHLA 1MWAH 3I90A 3G6JB 1MI5B 1XXFC 4I18B 4KVNH