4PQXA

Crystal structure of a nigd-like protein (baccac_02139) from bacteroides caccae atcc 43185 at 2.39 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
201
Chain Sequence
SRSLVISTINQISEDSKEFYFTLDNGKTMFPSNSQAWGGEKFENGQRAFVIFNELEQPVNGYDYNIQVRDITKVLTKEIVTMDDEENTEEKIGDDKINATYMWISKDKKYLTIEFQYYSTHSEDKKHFLNLVINNKDNTDDEYINLEFRHNSERDSPDHLGEGYVSFKLDKIEEQIEGKKGLNIRVRTLYDGIKNYKVQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a hypothetical protein (BACCAC_02139) from Bacteroides caccae ATCC 43185 at 2.39 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 55
structure length 201
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pqxA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pqxA02
4J8QA 3K0YA 3K6OA 4PQXA 3QWNA 3NQIA
chains in the Genus database with same CATH superfamily
3TDQA 4O9HL 4M6MH 1QR1A 1NC2A 3ULUF 5EZLB 1YZZA 2OPCA 3QR2A 4BZ1L 1JZFA 1PYWA 3HB3D 4KY7A 1K8AC 2X4TA 1UXSA 4PCYA 2XVSA 2GJZB 4WHYH 3MV9D 4PJFE 4HUWB 4AV5A 1YAIA 3H3KA 3A6OA 3GSNA 3HUJA 2XZAH 2A83A 4YFEA 1BFTA 2K9UA 3SO3C 2TRYA 2FTAA 3GLDA 5KBLA 3F2BA 2F0FA 2HTLC 5KAQG 1T21B 2VDRH 3EBGA 1YJDH 4Q9QL 2J0TD 3PO2H 5JJLA 3F7VB 2F54D 2GJ6E 4G6JH 1IGFL 1MNNA 3C2AL 1T7XA 3G5ZA 4Z23A 1NLDH 3CVIL 3DURB 5DQ9B 2XIDA 4R4BB 3FQNB 2NVXB 1DYZA 5MHSD 4OCSH 3D3VA 1T5KA 5C4ZA 2CCZA 4XCEA 5FFOA 8FABA 4LLDB 4NRZA 1CUKA 4QLRA 3WNPA 4MDIB 4HBCH 1KGYE 2OQKA 4TOYH 1CXIA 4MZIA 4I3SH 1DEEB 1E43A 1Z66A 4I7AA 2EIMB 1CICB 1HHHB 3VFRA 1XX8A 3OD3A 1INQB 5T1LB 3RGVD 5AAPA 1Q72L 1GS8A 4L8CB 5LHDA 1XGTB 3GSWB 1U58B 2XWBA 1RZGB 2EDBA 2LAAA 4DUVA 3NABH 5T5NG 3TV8A 4OKVA 4GQZA 3OLEA 4YX2L 3NPPA 3HZ3A 3GT6A 1GTNA 4IZ8A 1JRHH 2HMID 4EKJA 1WUNT 1GZHA 3C8KB 1AGDB 3PV6B 3WTVA 2P43B 1KAAA 4HJGA 5C86A 3ZKMD 4JRXA 4U68A 2UUDH 3VFMA 2EE9A 3CN1A 1N5AA 3P0YH 4KZDL 5IYCG 1I3GL 1T4KB 5HHPA 4DXGA 2NY2D 3TCXA 3FRUB 1O5PA 1XBRA 3P69A 3TV3L 5LB1A 4ATTA 2O6FA 1LP9F 1JOQA 2ZICA 4N0CC 1S9VB 4P9MH 3DV4A 4PJ8D 4DEUA 5MHSE 5CBAB 5EU6A 1KN2L 1GC1C 1IC4L 2F19H 1DBBL 4O02A 3V5DA 4CC0A 4JFZL 1PTOH 4LOFA 2B9BA 5TJWK 3E9UA 5JW5B 5GGSA 1JWMD 4IMKA 3SVMA 2FFKB 4EOWH 3VXTA 5BS0B 4Z7UB 2Q10A 1BKBA 4XHQA 1XXFC 4Y2DA 4LLAA 5KOMC 4GLXA 2A6IA 3BIKB 3HNSH 3U1SL 4AGPA 1P7QB 1BXUA 3LRHA 4ZMVA 4R4FL 4L4VB 3FQUB 1JPTH 4UIMB 1TY0A 1YMME 3T09A 3KLHC 2AXHA 5C0BA 2FT8A 2DQTL 3BVGA 1B0GA 1YYLL 4JPQA 4JCLA 4NPYA 1YIJA 1KFAH 4AE0A 1A4KA 1G1CA 2X1WL 4P5RA 3P9MA 5HDQH 3MLSL 3SGKC 3RFZA 1XGRB 1I4XA 1N19A 4DGUA 4LPUA 2H26A 1X5AA 4GUPB 4XNXH 4DFIA 2ZXCA 2H4EA 1GGCL 3A54A 3MV8E 1HE8A 4Y1AE 2BY2A 4OM0L 1WZKA 4P4KA 4QIWB 1LDPH 3LQZB 2OQJA 3MNZB 3D4RA 3HW7A 3MXVH 3VI4B 3D39A 1OQXA 3DXAD 2E6PA 4LEEA 1MY7A 1SJHB 2WNGA 3AQZA 3RBGA 3JSSA 3QQ3B 3EVQA 1A2TA 3OKEB 1GVPA 5BV7H 3U7YH 5KANI 3HG3A 4POZC 1CGTA 1EUTA 4LLWB 4WFFE 1HQRB 1MIMH 2YMOA 2Y1ZA 1RKRA 2B15A 5TGBB 5GS1A 4FQQA 4IFDG 4Q9BA 1TY2A 1IJNA 3VXQB 1SBBA 1T7YA 3NP8A 4FFVC 4LSPL 5C0XG 2OL3A 3L17A 4QXTA 1TVBA 5AZEL 2XT1B 3VDCA 2HIXA 3QZPA 5KSAD 4IUQA 4GFTB 3IGKA 3VU2A 1A1MA 4IHOB 4JFED 5B7MA 4O4YH 3CD6A 1UOWA 1FAIL 2L3BA 3KPPB 2H9GB 2R56H 3T2NH 2I9LB 2CW0C 1S5BD 3IMVA 4JMXA 1MJJA 4GW5B 4JHZA 5KNBA 1RK1B 2ESVD 4BSVB 5HHNA 2BSRB 4NNYA 1JNLL 2W9DH 1PGRB 4N86A 4L3ED 4YIQA 1XXGA 1WP6A 1LGVA 5D7LB 5BJTB 1RK0B 2B20A 2CK0L 4XNQB 2JLLA 5JOPD 4N8VA 1A3UA 2OJZH 1JNNH 3ET9F 3WY1A 2EQDA 1H9DA 1N5AB 4BFEA 2MQCA 1MFBH 3RL2A 4KX9A 3VGEA 5F96L 5K36H 1PBYA 3QQ9C 5GZND 4TPRH 1R5VB 2GIXA 3CZGA 3REWA 2DLIA 3IVKA 2XIBA 4MBOA 1TR7A 1S9VA 2Z4TA 5DHXB 2V6HA 4L8DB 1UYWH 4OZIF 3U2IA 2YGQA 4LESA 4DESA 1U2YA 3L5WB 2W65A 4KX8A 4E41A 2DTSA 2G60L 1XB3A 5E4AA 2ZXGA 4F2EA 4JI1Q 2V5MA 4JDTL 1FNHA 3ZDZE 1CXHA 2NUTA 4WLCA 5DO2C 5IT9L 1C16B 1TZIA 3SGEI 5BVPH 5EUOA 4LVHC 3KPRB 3TYGH 1S7RB 3HLKA 2YXWA 4HWNA 4QYOA 3P9MB 4K5MA 4PRID 5BR8L 4JNXA 1NDMA 1AGCA 1P6WA 3BP6A 3OSVA 4ICXA 3DROB 3T1FA 4DNLA 1R4XA 4HJ7A 2QQLL 1KIUA 1IGCL 4PSPA 4YBLB 1FA4A 4NW2A 5CAYB 1I8MB 3T4YB 4KDTC 4UQ2B 2DQFB 1R5WA 3HI5H 1T5WA 3G5XA 5MEPA 1JFQH 1CZGA 2NVYB 4X2UA 4GT7A 3UX9B 3D8MA 3OKNB 2F2HA 3NJFA 1LM8V 4N0RA 2UZXB 2OAAA 2A74B 3CXDH 3OLIA 2J8UF 2CKNA 3ARYA 1DZ1A 2OZ4A 3PWNA 3QIWD 4IBUA 5KS9E 4K7PX 3BPOC 3ITPA 5IVZA 1XZ0B 1IMHC 2FX9H 1U8MA 5JDJA 2YR3A 3LB6C 4YDJB 2JB6B 5GS1B 2AJUH 5IESL 3G7LA 4DF9A 1I85A 3I4MH 4HK3J 4HKZA 1VDGA 2EKSA 3CFDB 2X41A 3MZTA 5I5JA 3IGAB 4CSSA 3NHHA 2GSMB 1P2CA 3GSNH 2ENQA 3MPCA 4Z6AT 4CJ0A 1JSYA 5GRWA 2CDFA 3FCSB 2EXYD 4MCYA 4CVUA 3G71A 3BSHA 3ATAA 3S88H 1E28A 1XJVA 3SKOA 3CH1B 4HEDA 5FLMH 2H45A 3IF1B 5IOPB 5HHNB 3W2DA 5C3EB 4GNXB 2JA8G 2VW4A 5E9NA 4AIEA 3E38A 1T04B 2DI9A 2BA1A 3D0LA 3KD4A 5KAQF 2V5SA 3A7LA 1F11A 1G9MH 1LJMA 2ZXPA 1PYBA 3OKDB 3MYJA 2EPBA 4JFDE 5JO5A 2VWEC 3EH4B 3GMQB 3B9KB 1CC3A 3DA0A 4X8XA 4W9JC 5HI4C 3FSVA 2XWDA 5FFLA 5M9OA 2FWOB 4IKNA 3QNXA 1EJOH 4LPXA 1SAPA 5KVFL 4BH8B 3DLQR 2EE3A 4DAPA 3L5WA 2DY2A 3W0WA 3LN4B 3TA3D 1QE6A 3BVWA 4IIZA 4R5VA 1NL0H 1M8AA 4JFEB 2Z31B 3GHBL 4WGVB 1WDAA 3BZ4B 4XYQA 2YQBA 2CQOA 3WKML 3A4AA 3OJDA 1NDTA 4R96A 1OAXH 2WN3A 2YFOA 4X6CB 2J8HA 3DSFL 2UZIL 1EFWA 2IBZY 3BC9A 4HIXH 4WO4D 3EGSA 5HVFB 1E3FA 5AW5B 2ZD0A 4NQCA 1MLBB 3C2AH 1XSKA 2CBMA 3SY0B 2N0KA 4JKKA 4JI4Q 2J57A 3OC8A 2DYPB 2QVFB 2VW6A 3JYCA 4FJ6A 3MODL 3FULA 2VDNB 3ZR6A 4HBCL 1R5WB 3B9DA 3OWEA 1X65A 1PH1A 5CSZA 3SZKC 5E00B 1EYCA 2QPEB 1MWAB 2MFIA 3HG1D 4LCCC 1FORH 2B7DT 3K0YA 3GMMA 1UZ8B 4UOW1 3BKYL 2P28B 1XTDA 4MX7B 5CLXA 2A6JB 3LKNB 3GXPA 2NNCA 4E9VA 3U4KA 2R4SL 3V0JA 4AM0B 4TKWA 2R7ZB 4WK0B 4WU5A 5IQ9A 2XV2A 4MIUA 3H2QA 4OB5L 5A2AA 3NABL 1ZT4A 2B9AA 1IBBA 4MMZA 1NCTA 1G5GA 1ZJBA 2H32H 3WLBB 4D0BA 4UV4L 3UABA 1IQDA 2MHVA 3T71A 1VFAA 3SPHA 3CHRA 4OIIL 4R90L 3SDDD 4EN3C 3JVGA 3UYRH 4FQJL 1QSFE 1SJMA 4AZ8B 5DEHA 3ARDC 3TO4C 3VI4E 4Y5YA 1Y8PB 2X4UB 4JHUA 3WFDL 4KV5E 1ANUA 1J9SA 4BY1B 2WHVA 3SD2A 1G87A 3IU4H 4XCFL 1NAMA 1NFDA 3H7LA 1JGDA 4UTBA 2H6UA 4JN2B 3J7YW 2X12A 2VR9A 2FH8A 1NOFA 3ONAB 2NY3D 3FZUD 2HN7A 4QRTA 4PWIA 3KPRD 1OQOA 1BBXC 1AC6A 3QA3B 3ARBA 4Y9BA 1RZKH 3A67H 3N91A 4P4RA 4EOWL 1SN0A 4JY4B 5AAMA 4Y4KB 5JMRA 1KELH 2HCIA 2Y5TB 4GH7B 2CU9A 1DE4B 4XN4A 2BINA 3V9EA 1FSKB 3HNSL 3U1SH 1ZYRD 3HJEA 4JM2F 2Z6BA 1WAAF 3LN5B 4I2XA 3GZOA 4AXWA 3B9KA 5EOCH 3AFQA 3NH7L 4R5TA 1S7WA 4XZ4A 4UQBA 1BBJB 3IAYA 3BDLA 5IT9c 2YMTA 3CHXA 1RFDL 3FUKA 5ITBH 4D8PA 5ABZA 3TU6A 1E5BA 1KBGL 1UWYA 1E5UI 4KXCA 1I7UB 4FD0A 1T0MA 1STYA 2WZ6A 2ERJC 1SQMA 1H3PL 5IP9G 3DO7A 2CR3A 4HIIB 3RKDD 3AT8A 2ZOUA 3SEBA 3FONB 4PV8A 3U4EB 2IJ0A 1OAZL 2ZPKL 3MNWB 1RHHA 3F2CA 1GGCH 1QUNB 1XGUB 1QLRB 1S9XA 1O9VA 2HYMA 2VSKB 4HP5A 3KS0H 2PO6C 4JRLA 4LLVB 5HHMD 1KIQA 4S10A 3KPNA 3RVWC 1N70A 3MXVL 2ZE0A 1MFCL 3MTXA 5D6CA 5EDXA 1OXYA 4EUPB 1VJSA 1YDPB 4F7EA 1AQKH 1FZKB 2YRPA 3NPSC 2ZOWA 2W59A 1JORA 2ZKHL 4KKTA 1GYVA 4KH2A 1HKFA 4XXDA 1EHXA 1Z3RA 2UZYA 1I6HB 3LVTA 1RJTA 1FBIH 1MIML 1A7NH 4X5LA 4A3KH 4ENEC 1MI5A 4XOEA 2HD3A 1XGPB 2CO4A 2ZF8A 5KYLA 4P9HH 3D0VB 4J1MA 3Q48A 3V6ZA 3MA2B 4RKBA 3M6DA 2XBDA 3WN5A 1NCUA 4LO9A 1TTFA 4G8AC 4RAUB 5MEOB 2VC2H 4J4PC 4E0RA 5FW8A 3ZX1A 2R56L 4P59L 4R83A 5LMNQ 3T1HL 3S0PA 3O45B 4ODVH 1FL5B 3LNHA 4G11A 3UPAA 1EIBA 2W9DL 3J80i 5D96C 3VR3A 5C0BE 3H85A 3HE7B 2EH8H 4N2EA 1TEYA 2WOBA 2CK0H 3EHBD 4I89A 4U6VL 2GC4C 4F37F 1CDUA 2P47B 5IBTH 4XVSL 5TDOB 5E8OA 2BSCA 2D9QB 3FU8A 4KXBA 4D9QE 4DAVA 2OULB 3LEXA 1F02I 4W6WB 2R93H 4FF9A 4KY1L 1HZ9A 2E2DC 1P6AB 1U41A 4TPRL 3U4ZA 2HRLA 5KWYC 3JWNG 3JAML 2JQAA 4C56D 2G0LA 1L4IA 4O2CB 4RVBA 4JI8L 2P5WB 3VNYA 3IRZA 1NAPA 4B9KC 2X7LB 3AG4B 2WJ5A 3UROR 4L4VA 5GGUB 3RY6C 3FU7B 2VQ4A 4U1MA 1RH8A 4ZMXA 12E8L 3CWGA 5EOTB 3ZYOA 1OAKH 2E5EA 1TQCC 3OPZH 3FT1A 4XWGL 2QDVA 1WITA 1PZJD 3GIZL 1KB3A 3EOYG 3U0WL 2JV6A 1T6VN 4HUNB 3V2AR 4I2XB 5PCYA 4WTXA 3GS7A 3W2DL 3BE1L 4FG6D 2YOAA 3LN9A 3U9PH 1EZUA 4DT2A 1KBVA 1WG3A 1CGSL 3BPOB 4U1IB 1KGUA 3LZNA 1WTRA 2IMNA 5CFAA 3T0AA 4A3EH 2EICA 3QCVH 2WXLA 3H3PH 1A7OL 3DYPA 3JV4B 3NOIA 2QQLH 1A14H 1VQ6A 1IGCH 1YEZA 5DHVA 4PLNC 3FPXA 4P4KC 4LF9L 4JQXA 1CICD 3DX0A 4RQQA 1AO7D 1W72H 4NKMB 3VXNA 2FBRA 3IBOA 5FGRA 3MRRA 2XSCA 2V0AA 5F0JB 3RIFF 1M71A 3QH3A 2K4WA 5C6TL 2YU9B 5I6XB 4PBVC 2YD2A 3GSOB 3LKSA 2YJQA 5C5LA 3CXDL 4MRCA 3ZZQA 5EBGA 1DQLL 1LWJA 2FT6A 5EJWA 4V1DD 3CW2C 2ZM6Q 1DBAL 3JYBA 4LCUA 4Y1TA 2FX9L 4P73A 1BQLH 4YSAA 2RCSL 2F58L 3HI1B 3TBTA 1JZ7A 2AJUL 1L1OA 3HOZB 5CUSH 4NQVB 1O0VA 4NKLA 2BC4B 3H9SE 3ARFA 4IALA 2BX5A 3BZFB 4RNRB 1DFBH 3NCWA 1THCA 4JRYD 1FVDB 4MLIA 4UAHA 4U1JB 1U8LB 2XJKA 2BVQA 4BXSV 3L1OH 4WJ5B 4UY8C 3L3OA 1STHA 5FGCE 3VXSB 2WC7A 1AZPA 1E22A 3O45A 4OFPA 2CRZA 5FA4A 3VM5A 4RRPM 1YEGL 3A5UA 3QRFM 5DEFB 2R23A 1M7XA 3H0TA 1WWCA 1UGKA 2AVFA 2EDMA 3IKCA 1JZ6A 3HOGA 3CQZB 1G9ML 3O3AA 4G9DA 2KVMA 1XR8B 4OFDA 4ZG1A 3QXDA 2W65B 3EH5B 5FGBA 5BO1H 4F91B 1S5HA 2DD8H 1T1ZB 4R7XA 4GLRH 1GOGA 4K8RC 4IFDJ 3FRUA 1W8OA 3GSUB 3VXRB 5AB0A 4YK4C 4JI1L 1CFTA 1EJOL 4AUUA 1Z32X 3VU1A 3ZK0A 2OCEA 3NFPB 3ETTA 4XN1A 5ICZA 5HGBB 3FU0A 4X8JA 3JWDH 5D2LF 2WXPA 4Y19A 3PJLA 5L9DL 4NFCA 4RGND 5B8CC 1PZDA 3UAJA 3WKMH 4KK9C 2EDJA 1D7QA 2WLNA 1L9NA 5E9AA 1PY0A 2XRSD 3RPBA 1KPUA 4XHJC 2JIXD 3DSFH 3EJJX 4H8PA 2UZIH 2F0MA 1KIUB 4KQ3L 4X62Q 4QY8A 4KJNA 1U8CA 5IW3A 1SYVB 5IY5B 3TT3L 3O6FD 4Q14A 5EA0L 4FMVA 1SFOB 1D5BA 4CNIB 3D05A 4J3SA 5IB1B 5EEZA 4NO5B 1N36L 4PJ7E 1T7ZA 5IKCB 2XICA 1IAKB 3KVPA 2ZWYA 5AZ2H 3KFUA 1BM7A 1U3HA 4Q89A 4KHZA 4IEFB 2KLSA 1FFNA 1Z47A 2X6VA 2EJ1A 2N56A 5F9DC 1Q1BA 1W91A 2AHIA 1ZTXE 1DQVA 4HUUA 5LBGA 2A6DB 4LU5L 2DOCA 4ZLTF 2VZAA 4JCWA 1OD9A 3B2VH 5KVDH 5I24A 4RETB 3BKYH 3LQAC 4LRIA 2DEWX 4NS0A 3O4LD 4X4YA 1LO5D 2RCFA 5K5PA 3I4NH 1PJWA 1J18A 2R4SH 2VOTA 2X4SA 2ZUSA 4NQEA 4J3OD 4PMFA 4AMKH 4HKXB 4G42A 4U1HA 4EVOA 2B3IA 2EKSB 3BEVB 4ABWA 4PJ6A 4OFYD 5C2BL 1LTXA 4A7SA 2NUCA 4C3HG 2CCLA 1FIGL 1UATA 1E9PB 4OIIH 4EIUA 4R90H 1GHKA 4Y4HA 3VGDA 4F7MA 3UYRL 3EJTA 4FQJH 4HEPG 1J0HA 5IFAL 2F0TA 3J80c 3SKOB 1GR7A 1DQIA 4LNVA 2XWJA 1MFNA 3WFDH 5F8QC 3BYYB 4GBXB 2Y1AA 3IU4L 1XF1A 4JG2A 3HE7C 4JJ5A 1H9VA 3O8XB 4W9HC 3LQMA 2FO1A 1BEXA 2H9GA 3IMTA 1PZID 2BHZA 4M4PA 1KJVB 3K1KC 3UG5A 3CSGA 1HHGA 4P3DB 5LL6X 1PKQE 4OO1I 1NGQL 3Q6FB 2IH1A 5BZXA 2PR9A 3QIBA 4PRBA 3KLRA 1S72A 4ZX5A 3T3PE 1AFPA 2J5LC 4M61A 4X98B 4IO9A 2J20A 2TRHA 4A75A 2XWEA 4M7JL 3F85A 3SDXF 1KCKA 1PQZB 5FYKH 1IKNA 2LU4A 5TTRA 4DFAA 4K0KL 1U8JA 4JFQA 3SDXA 2J44A 3GSUA 4XH2A 3RDTD 2ZAHA 5IB3A 3REVA 2AXFA 2FX7L 1W72B 2J6EA 5E5LA 1BQHA 4NQCE 1CFTB 1G2TA 3QO1B 1Y6MR 4K0OA 3SZ6A 1JICA 3PUXA 3UTSB 1LK2A 3L5HA 3L16A 4G1EA 3VWJA 1E2WA 4TL5A 2ITCB 2VL5A 4XNBA 2O5NA 1UD2A 4QAMB 4M02A 5IHLB 1GZQA 1P69B 1JK9A 2ZPKH 2O6CA 2ZX7A 4N90D 5AYTA 3KPSE 3I8ZA 5D2NB 4GIOA 1BVLA 3TH3T 1E1OA 3K2KA 4LVNB 4GG6F 4YOKA 1C16A 2MP1A 5I1HH 3QUMB 2P8LA 1AQKL 5B1BB 1PZUB 2IPUK 2UXCQ 4N9GA 5CGMA 1BF4A 5F7HA 3KJOA 3MXGA 1N9PA 5JA8B 2NWGA 4IEFA 4TVPH 3TONA 5J9PB 1FBIL 1A7NL 3OMNB 3TBCA 3DVGA 5D1XC 4E36A 2AVGA 4L0YA 1GKHA 3FB8A 2Q6WB 5CEZD 4MMZB 2IAND 4P9HL 4HXBH 2FEJA 2V2XB 2AFNA 2EE6A 1XQ4A 1ADQA 4LDCA 2Z7ZA 2G3NA 1ZV9A 1KDIA 3ILQC 5D70H 2ZCZA 1P1ZB 2K28A 1PZSA 5IB4B 3QDGA 4AZ8A 2KA7A 3O6LL 4MA3B 4I3RL 3NSWA 3MRFA 4XP4L 1TJHH 4XCEB 8FABB 4FKKA 4ODVL 5EZOH 2RH0A 4RCNA 4J2XA 3QIUB 4HD5A 3ES6A 1XF5A 4JG0L 2X42A 5HGDB 1VQHA 1DVQA 3DEOA 2EH8L 4PWHA 5B8CA 2UU9Q 4O51B 4BINA 1KIPA 4MAUH 3IJHA 3RAJL 4R4NC 5GRJH 3K7AB 3FOMA 2MJWA 3BYYA 1TTRA 2KERA 4JG9A 3E6FA 4KY1H 3KAAA 2CDFB 1DJGA 2G5DA 2CBPA 4G6AD 3WY3A 3K80C 4U6TA 1B2YA 1L9PA 4KHTL 1JIBA 1WC7A 3AVEA 2MGSA 3EFOB 4N0UE 3NXWA 4WEBL 4TLUA 2F8XC 1E3ZA 1FFRA 5CZXC 4XGZA 3KOJA 1WTLA 4DV1L 1LO5A 3PV6A 4JFEE 1LABA 3T8VA 1UXWA 3MV11 1V10A 1JZ4A 2RSOA 2R6GA 4XWGH 3KPTA 4AL8L 4JHVA 5T5NF 1VEMA 2RJMA 3TA3A 3EOTH 3QZWA 4QJ5B 3U0WH 3ZZSA 4PJXE 1MAKA 5HHPB 1T80A 3BE1H 3U9PL 5KVEE 4GKJQ 1FFPB 2L9HA 3U4EA 1E6JH 3RRQA 4A6YB 1M7DA 4X7EC 4EGVA 1YNTA 2NVYH 3KEHA 3L3GB 3MO1B 3MNVA 4XVTH 1PZ3A 1A14L 4HD9A 3IMUA 1OCOB 4QRRB 3U79A 3BOVA 3C6LD 5KYNA 1CI3M 3BMWA 1UB6A 4YPGB 4FNLL 3FCTB 1Q94B 3MREB 2JKWA 5KSVB 4Z3FA 2W95A 2AKWB 3NP3A 3BX7C 4E5XG 4CHTB 1B4JH 2XC8A 1Q8IA 3ARBD 4N9GB 4ABVA 5JHDB 1O7IA 4R9WA 3GMPB 4LLMA 4KXDA 5ACMA 4CU7A 2XVLA 4GAAA 4LLUB 3VRLF 3CCSA 1DBAH 3LD8B 4LCWA 4ZUVA 3VXMB 1BQLL 3N0AA 2E2IB 2RCSH 4R8IA 3LIUA 4HCGA 3DYOA 1O6SA 1EO5A 3WUWA 4D3CL 2XG4A 3EXJA 4X50A 3MRDA 4LK1C 1P7KA 5EFIA 3SBPA 1I82A 3HAEH 4HAFA 4PJXF 1DFBL 2J8UB 4UT9A 2ATPB 4D0DB 3EGDB 3SKUD 4N0CD 4D94A 2ITDB 1S7QA 3BDXA 1KHIA 3CLEH 5C70A 5FO8B 1UT1A 3JV0A 5TQ0H 1M7IB 2X88A 1SJHD 3CDGB 4FN0A 4H8QA 3WY4A 3SO3B 1KEGL 4EZMA 3L3KA 2D0GA 2DLFH 3BAEH 4KMTL 1A22B 4NJAL 4PJGE 2R9HC 1RCYA 1YEGH 3ULAB 3M4OB 3RKPA 4I9XA 1W3SA 2ADFL 3ESOA 3KVQA 4BWTA 1HR0Q 3NCCB 5HVHB 4I48A 4LPYA 5FF6B 4HSPA 3HRZC 1IFHH 1G7PA 2KKQA 2MNAA 5DVPA 3NCXA 1W8EA 3MV9A 1DOMA 4Q4EA 4OGYL 1B3AA 5IGGA 4LSUL 4BDVA 1VPOL 4HIHA 4DV0L 2LXJA 3UL4A 4DV0Q 1F3JB 2FQGA 4HGWA 1RKNA 2KT6A 2VUOA 4X3TA 1ODUA 1FJ1B 2PNDA 2V2WA 3MJWA 4WFHE 4X6BA 3V0FA 3EYFA 5I9OA 3F8UB 3TF7C 3DMMC 3VYUA 4EDXA 4C56B 4I5BB 4YHKL 2Y2YA 3N42F 2AP2A 2K5DA 1XBDA 1GUWA 1K6QH 1QI5A 2YAEA 3HB3B 3QDJB 2Y2WA 3HJ0A 3HNVL 4Y4KA 4R4IA 2JQMA 4QOKA 4MZRA 1FGVH 5JOFA 1ZE3H 4NHCH 3NENA 5F9WB 4XWOD 4RAVA 3AFLA 4O42A 3GTMB 1G291 1HZHL 3TT3H 3V0HA 1SDYA 2XXCB 4G7SB 5A2BA 3GEFA 1XWVA 1QILA 1PKQB 4FG6C 4MB5A 5L2KB 5TK4A 4AIOA 2NX5B 2PW1A 3L5XL 4JM2D 4PP1C 1LTLA 3DUHA 3LMJH 4N68A 1KY6A 5AOZA 2H6PA 1Z3GH 1RQ5A 1V54B 3DO7B 3SJVA 2XRAH 4PV8B 1NIDA 4KV6A 1MSGA 2ES2A 3B3IA 4RH4A 1Q94A 4H88H 1MHPL 2VDQL 1RIVL 3DBXB 3O9WC 2R3ZA 1N4XH 1QSED 3CXHK 4WQOA 3B2VL 1F9RA 4HIPA 5HHXL 3EJPA 1UWXK 3TIEA 3EBIA 4EO5A 1SM3L 1NCNA 4R4OA 4MQ7B 1XIWA 4A2HA 4LKXA 5J1TC 4AMKL 4LARH 4KJPC 4NKIL 5BUAA 2Z1CA 1QWNA 5EF1A 3SKJH 4DUZQ 3L7EA 4JPKL 2UZYB 1ZYRC 3A6BL 4PS8A 4EZKA 1ZWIB 5GS0D 3WAJA 4WORA 2DWYA 3MRDB 5EFIB 5IFAH 3FT9A 3VFNA 4IRSD 1OW0A 4TNVK 1BJMA 1FV1B 5HDBB 4HJ1A 2C1PA 3OYYA 2V2TB 1X3EA 1ZEQX 1QLFB 2JQOA 1I8LC 2AJVH 3QZBA 3O3DA 4HUXB 1TWFB 1T22A 1T2XA 2WXQA 3MEFA 3OKNA 2YD6A 2R23B 5D7JC 5I8EB 2IGTA 5JQIB 2NZ1A 1R4PB 1HTPA 3PNWA 3CRLC 1M7IA 4N8CL 3WIIL 4YO0A 1O9WA 2V5YA 2XLLA 1N0LB 1F56A 3AXLB 1XGQB 3BPCA 4J27A 3VG0L 5L0QB 3S1RH 1XZ0A 5HI3D 1EGJH 1TQTA 3EGXA 1BFSA 3DMUA 1S7SB 2HT4C 1M1SA 1TU2B 3LZQA 4NPJA 4ZX6A 3MLRL 5JZ7D 1X7QA 5L2JA 3EAKA 3RIAK 3WNJA 1NGQH 4OAWA 5JEAG 4J6RH 1MY5A 3H7BB 1OF2A 1V3LA 3K74B 1HI6A 1UOLA 3JQOB 3PS6A 4LSVH 5BO0D 2OWOA 4JEGB 3TEZA 4RX4A 4PRPE 5HXMA 3LZLA 4AGOA 4E9WA 4ZDHA 1FHNA 1WF5A 2FR4B 5FYKL 3HOWH 1XCXA 2FLRT 4ONHA 1QFWI 4YEEA 1HE7A 4BFIA 3V4LA 4CDHA 2NTSA 2FX7H 5DJ2B 3V55A 5AFAA 1XF3A 4G8IA 3PSIA 4ODXB 1KB5L 4JE4B 2DEXX 3C12A 1A4JA 4P0DA 2FJGB 1CF8H 3L7FA 2NY0B 1YEEH 3KCPB 3TO4A 2A6KA 3QIAA 4JGJA 3NQIA 2AV7A 3LCYA 3H09A 5IBUG 4BFKA 1T3FB 2VDOB 1X9RA 2QSCH 1GYUA 3CZFB 4ODSL 2VJ0A 5FJ8H 1FDLH 4APXA 2Z31C 3CCEA 1MCBA 3Q23A 4QRBA 1N7ML 2QDWA 5I1HL 2GCYB 3F2UA 2DJFC 5IT9E 4R26H 2HA1A 3EHBC 4WGWB 4ESKA 3H3BC 1C7YA 3KWWB 5CEYA 1WUZA 4F8QA 4LHQB 4HG4J 3F12A 5EN2B 1MHHB 4TVPL 2APTA 3KLHD 3ZO9A 3P75A 2ID0A 2CK2A 2V7HA 1LTRD 4K2UL 3T1YL 2BOCA 4A39A 3UJJH 3ULVC 1ET5A 1RZKC 3H54A 1UOVA 3RWIA 3UAJD 1U5KA 5IOCA 1JZIA 1TR5A 3EGSB 5E3FA 3GK8H 1E9PA 1IGJB 2O6EA 4G5AA 1XNRQ 1ULVA 3LKSB 2D0FA 2PP8A 4KZCA 1EQVA 1KGJA 3K7UA 4PCTA 3T9WA 4Q9RH 2XZQH 1IAOA 3MOBH 3C5ZB 1Q9OA 5GSRA 4O5LH 1LT3D 1WFQA 5H2BA 4GBXA 1D5RA 4JFPA 5J12C 3VXOB 3WJJA 1CK0H 1VCBC 4FFWD 3IFDA 3CH8A 4O58L 4YSEA 2F8IA 5BS0E 5IR1B 2DLEA 4NXNQ 2HFTA 1MDAA 4FQPA 4PREB 5EO0A 4X0NA 2UXCL 4FQXD 2H47C 3QUMH 2P42B 2H2PC 4CMHC 3P9LA 2R1WB 4A3FG 1ZLUH 2VWEE 2IVFC 1MXDA 2YGOA 5CSBA 3QIBB 4PRBB 1N59A 1OSPL 3VCLB 1S9YB 2A9BA 2EYTA 4HS6B 4EUPG 4PB0L 5KYYB 1DSYA 2OX5A 2UYLB 2QJDA 5KSBF 3OQRA 5D7IA 1ILSA 1WWWX 4A3DB 2EACA 1XFPA 3QT2A 4I88A 1IQDB 1EQTA 2X28A 3E1F1 1SJEB 3ZQWA 4JV5L 1DP0A 1HNZL 4GG6A 2C9UA 3BMVA 2ZP0T 5DUJA 5F7UA 1LQBC 3HZXA 2HLAB 3OX8A 4IBZA 3TBWA 4PRAB 2CA4A 4ODWB 4UDTB 4YZFE 5E2TL 2BZ7A 3SGDI 3B6SB 4C1NK 4NN6C 4DKTA 3WHE0 4JI3L 2FB4L 3VD5A 4U1KA 4MNQA 2YEQA 1E7ZA 1PH3A 2CMRH 3T6XA 5KUMA 2AK1L 2WO3B 3L7FB 1XAKA 3D3RA 4Z8FL 3DRTA 4XVTL 1I4PA 4UINL 4A7GF 3S5LA 1JB3A 1QSFD 1OB1B 3C5ZC 2BWIA 1KULA 3N40P 1HNWQ 3ZQXA 5J1AA 2K4KA 3F2LA 3OHXB 1D5ZB 4ALAH 1AQ8A 1J5DA 3CZFA 1TT2A 2OMYA 2V17H 2FLMA 5IV2A 4JFFB 1UNSA 2W91A 2H1PH 2X53A 3FPPA 4DO6A 4Y2DD 3S14B 3NIFB 4DP5X 3LVEA 5HYJA 1FNAA 2EYRB 1BBJA 1THAA 4UANA 5ESQA 3UC0L 1L6ZA 3DX8B 5IB1A 4D8PB 3QR8A 4MAYA 5HD8C 5IKCA 3B2XA 4Y9CA 4EN3D 4DPCX 3SDDB 2OQJB 4ZQKA 3SDCD 2WLZA 1RURL 2G3ZA 1FL3A 4AIXA 1VGKA 4AJWA 1XEDA 1SJHA 1X6LA 3EHBB 3PG2A 1RHHB 3ARGD 3FFCE 1JRHI 4MNHB 3VUAA 3B7YA 5T1KD 4UTBL 5T8IA 1PTOF 1KTLB 4N20A 4MD5A 5EPJA 1OLLA 4ZFGL 3MLPA 5EGTA 2JA7G 4U3HA 4MASA 3CLEL 3MHBA 1GGIL 1P9MC 2K6YA 3VG9B 5TQ0L 3WFZA 4O51A 3MRJA 2K7QA 1G9NC 5ICUA 2Y7NA 1IL2A 5DS1A 4PJCA 3ZSSA 4UT7L 5C0ND 1RODA 4WW2F 3DDGA 5M5YH 3CHQA 5FK9C 4F2MB 2WQ8A 3FT4A 3FSZA 2Y36L 3TCLB 2G2NA 1RK1A 2M9VA 4OQTA 3H0GH 4K15A 3VSTA 1ZGLP 2UUCQ 4LPVA 5TSSA 3MAQA 3RZOB 2VLKA 1JPST 5D8JL 5HBBA 4OGXH 4RAUA 4Z7NF 1VPOH 3DXAA 4QKXB 5KVMC 3ZGIA 3S37H 3FTGB 4U3XA 2F0GA 2N1TE 3RHWK 4HSCX 5JUEL 1C0AA 1ZHLB 3P4OB 3MSPA 4J3TA 4XNUL 4HK3N 2HJLB 5ABAA 3MXNB 1H15B 2BNRB 5J89A 3WEOA 1NANI 3B4NA 4AYFB 1PDKA 2IH1B 3OGCB 4ADJA 2GABA 2EH7H 3VYNA 2X3AA 4PSRA 4DTGH 3PWPA 4H20H 3E8VA 5DI8B 5GGTL 1FGVL 2V37A 4LSTL 4NHCL 1FIEA 5CSGA 1E8ZA 5KJRH 5INCB 1RPQA 3RX5A 3HBGA 2FECI 3Q9QA 3NQTA 1XMEB 1QOKA 2P5WA 5E8NB 5F97E 5C0AB 2CDEA 3LS4L 1I4QA 1ITCA 3S1QB 1UC6A 3UTSA 3I2ZA 2VR5A 4ES9A 3G6AA 1Z3GL 2IC2A 3MC0B 4GW4B 2XRAL 4QY7A 4YXLH 1S7RA 1R1CA 1NH6A 4HSAC 4OUUB 2AC0A 5E94B 4LLUA 5KVEL 1JG9A 3KL0A 3U6XS 1F4YL 3MFFA 3TN0C 1YJNA 2EXWC 1J5EQ 1N4XL 4WFED 4AYGA 2AJYL 2ZYHA 4Y4KC 3S9WA 2J6WA 6PAZA 3BSZL 1I8MA 2J88L 3IMRA 4UQ2A 3E1ZA 4LVEA 1QWHA 1URZA 3LNDA 4LARL 2XN9A 3PIQB 3DUSB 4M7KH 1ITBB 3MLXH 4NKIH 5C0CD 2XIWA 4G57A 4PWEA 3V0VB 3OMIB 5SWSA 1B50A 4AQAA 3QDGD 3C60B 2EY1A 4F1SA 4WUKH 3K6SA 3UIZA 2XCMC 3FQ2A 3HS0A 1MJUH 3VXNB 3SDXE 35C8L 1MCNA 2AV1A 4DSYA 1UZGA 1DR9A 3A55A 2AJVL 2FUQA 4GKNA 1AD9A 1Z6JT 4IRSA 4Z3JA 4TMPA 3DX2A 4NO0B 3WIIH 1JJGA 1KSRA 5DURD 4C3IG 1IYVA 3QDGB 4WGKA 3VH8A 3W38A 5C4XB 1L5GA 3S37X 1AE3A 5CO1A 4ZMOA 3LRSB 4UMGA 4AJVA 5JYLA 1UFGA 4MMYB 5CR8A 5EBLA 4EQ3A 4LFHD 4WTZA 2C3HA 4FQCH 4NQVA 2EIDA 2WQSA 4X6CE 4F9LA 3WOEA 3E0EA 2IO5A 2AS5M 5GAGC 1FCGA 1QFUL 3D25A 1BXVA 2MQ0A 3MRGA 1AKJD 1WQVT 1LQSR 1CE6A 4HJ0C 4WI2A 1A66A 3CXFA 3M45A 1KB5H 4EQNA 1ZS2A 4A3FH 3F00A 4DR4Q 5CP7A 2IBGA 1BZ7B 4JZNB 3ZR5A 1Q4NX 2H3NA 3SYAA 3V6OA 1NCJA 4Y88A 1PDKB 1YEEL 3MTRA 3RPIA 3O11A 2R69H 1MEXH 2KLRA 2VDLH 1A3RH 3HE6A 3C6SB 3HKFA 4Z7UE 3BUTA 1DOKA 4X7DC 4YZFF 3TBVB 3V5HB 1TIID 2NR6A 4PTUB 1XR8A 3OSKA 4O02L 1S4IA 1BIHA 4P4KD 5EOCJ 2F0IA 2P49B 1UHVA 1FDLL 4HUMB 4RMUA 4V1DE 1K8IB 3BWUF 2H6PB 1JZ5A 2KJXA 3GJEA 1MOEA 4G43B 1N7MH 2JE8A 4RGMC 2OKMA 2KS0A 2EDYA 3VXMD 4R26L 3DBXA 4QHLA 2NY0C 4HZAA 1M7DB 2W07B 2YHGA 4H1LG 4CC4A 3RFRA 3TIEB 4I0PB 4IJ3B 2HKAA 2OTLA 3H0GG 1RVFH 4AQ1A 1CE1H 3QS3A 4ZD3L 3GMOA 3O41B 4A7VA 2CALA 1SEQH 1KJ3L 1C5BH 2VDQB 4BUHA 2GN5A 1UA6H 2L7EA 3RVVC 5B1CA 2WSPA 3RZCA 5CHNA 4U6YB 2B2WA 5CZXD 3RA7H 3QG7H 1NCBL 2Q7NA 2C1PB 4Q9RL 2XZQL 4MXWL 4NN5B 2ZTDA 1QLFA 3GMPA 4PV1C 3CIQA 2P45B 1EFXD 2RQ8A 3KR3H 3MOBL 3NESA 5D1XE 3AG3B 7TAAA 4PJGB 2X4NA 1T2QL 3VI3F 5IB5B 3C60A 3V52H 4A2LA 1CK0L 5HGHB 2F1EA 1EFID 4M1UB 2IQ9H 3SCMB 2QADC 5J06A 3O4LA 1QFHA 2XU9A 1N0LA 4YHYC 2FL5A 3PP3K 1I7RA 2YEZA 1PSKH 2A5UA 3AS2A 1PX4A 3QUML 5IW6A 4AYBA 2E8YA 5F1NB 4IRSB 3WEBA 1TVDA 4XXWA 3WO4B 3N2JA 1S5IH 3N40F 3O3BA 4PCSA 2X4SB 4Y1SA 4TVAB 2IAMA 3N43F 1FCCA 1DJHA 1K5WA 1H8LA 4G42B 3QW9A 1HU8A 4PRDB 5EBLB 1FI8C 5AWNL 1K83H 1PHJA 2NVQB 4PVMA 3CZEA 2FXQA 1NBWA 5J39A 3GTNA 3VXRE 3WL9B 3A4FA 2E9JA 5M7QA 1NMAH 4N0FB 5JIKA 5EEXA 4R8NA 1XF3B 3QORB 4LSQL 3RWFA 4I48B 4ZTPH 4JZOB 5FF6A 4PJDF 3IJEB 4XPHH 2FHBA 2P8MB 3RWDB 1HAWA 2MTPA 1YJWA 3NFSL 3GFUA 1V1PA 2X6CA 3KWTA 4MA7L 4Y7NB 1T3FA 3M3YH 2BSED 3L5JA 1A25A 3MRQA 4FYQA 3WE6B 3EJIA 4YE0A 1Q38A 2AQNA 3EJQA 4ENZA 4XBGA 1HDMB 3ROOA 2IF7A 4UINH 3WIHA 5IGBA 4NJ9H 3NCFB 4UM9A 1MXGA 4PJCF 1OP4A 5DD6B 4W9EC 1KLGB 5CC4A 2VDKB 2B3GA 4PTUA 3T0EC 2D31B 5JXEA 3UZEC 3ER0A 4UTAL 2WKOA 2B63G 2AEIT 4FF3A 5EN2A 5AW2B 2DMBA 3QFGA 3ZDZB 5ITFB 2VSCA 4MS8D 5FHBH 4OKVB 4UOJA 1G6ZA 3DX7A 1ZXTA 3RVTC 4DNTB 1A1NA 2B2WC 2W0PA 2E47A 3ZIYA 1H9MA 1JGUL 1OT2A 2G9HA 4M6AA 2YTYA 4ZSOE 4DP2X 2AABH 5HHME 1D9KD 4BZ2H 2BXYA 2Y4SA 1VQCA 3MA7B 1RURH 4EQOA 1SQ2N 5I66A 3BT2L 1LE5A 5B3JE 1CKNA 1MHCB 3RIFK 1QZHA 2JVUA 4S2SA 2KQMA 3C5ZA 4JFOA 2XG5A 2Z35A 4UTBH 4HHAB 5HYSG 4JFPB 1GY1A 5IROA 5GISL 1R19A 3M17A 4WWKD 5D9SA 5G5DA 3BH4A 1GGIH 3T0VA 2VERN 1PZCA 4HPYH 4NUGL 3ZKQD 1ASQA 2OCCB 2XTLA 5E5RB 4HMJA 1IBDA 3V79C 1BGXL 4M7LT 3H3VC 4PJGA 3CPLB 2NYZA 2NB0A 4QRQB 2R2BA 3TURA 1ONLA 5EPKA 3U58A 2BS8A 3QUXB 1ZKAA 4E0RB 5JTWA 2VQ1A 1PRTD 1VMPA 1OAUH 1K3IA 4OL7A 4JKNA 2IL8A 5HDLA 1DGSA 3HZMA 2IPKB 5F1NA 3C9NB 4KDVA 1JDDA 4F92B 5EF2A 3N6RA 2H3KA 1SMAA 5I2IA 1XPRA 2A5HA 2ICEC 2FEEI 3HE7A 3S37L 3OV6A 5I18H 2J5LB 5JUEH 3J7A5 2K6WA 2B2UA 4LJZC 1U8KB 3VFUB 1CT8B 4NUJA 2F7PA 4B7IA 3BZDA 5KSUA 1VQIA 4C8XA 2E6JA 4M1GL 1MLCA 4XIGS 5DYFA 2W0LA 1XF5B 4KI5E 4OZFA 1OF2B 2VIRB 2EH7L 2MCAA 2ROXA 5KTEH 3IT8D 4DTGL 3SPCA 2V5RA 4OJEH 2KHJA 1FL6B 2K70A 2PNRC 5DMYA 2EO1A 3BO8B 4NWUH 4Q52A 2ITEA 4NQCD 4IFDI 4DAGL 3KPSB 4NT6A 4DR3Q 3EUDA 3WAKA 4JI0L 4KO6A 5TGBA 1D5ZA 3M3YB 1ZV2A 3QJFA 4HWZB 5DJ2A 5F88B 4ODBD 4IYKA 1A15A 2Z4HA 3ZHLA 3QNFA 4ZPTB 4DJMA 2BVOB 1MRFH 4X6AH 4WWOA 1WIOA 3S4SB 2X69A 4UPAA 4P2QE 2Q86A 3F64A 2Y1YA 3ME0B 4P06A 3SB3A 1JGEA 1EHLL 1DJSA 2ODHA 1XMOQ 4LSRH 4IKJA 4DN3H 4E9TA 5LGHH 4GEIA 1QO3B 4WKZB 2PXYD 3T51B 4LHUB 4ZUTB 1P1VA 2Y25A 4QTFA 3SOBL 4A6YH 1BQKA 1OAYL 4X5RA 1DN2A 2Z7YA 3M1BA 3BZEA 3FAWA 4S1DC 4A4IA 1G91A 2D3VA 2YUWA 3ILQD 4OQTL 1Y7VA 4GEJA 4PP2B 5T33H 3STLB 3MRRB 3BUYB 3CFJB 4GNKB 4N0UA 4PNYA 2OYPA 2FGZA 4DPBX 2YKLL 4YBQD 1B4TA 4LZKA 4PJHF 3X1GA 4X3KA 3SIKA 2F8VA 3DXAE 1YNND 3U46B 1MJUL 2IFFL 2Z0UA 3K5LA 3R0NA 4EZJA 1CKMA 2BOBA 4GAGL 2LT9A 3RWIB 3QARA 4XB3A 5E4EB 2CFMA 3O6ML 3UG4A 1HKLL 4MS6A 1JWSB 5ISZA 3TN0A 3R1GL 2JJSA 4FFZA 4F7PA 1KYOJ 2P1YA 1BDYA 5F70A 2XKSA 3T13A 1ZXQA 4QWWC 4YR6A 3BRGC 2NXZB 4HC1H 3TP5A 3J80E 5DM73 2KZ1B 3O3UN 1JR0D 4RWHA 2JTDA 4CDEC 3A4DA 5I6WA 1RULH 3HPJA 4Y19E 5J1SC 4QRQA 4CN1A 1WZ1H 5H2BB 2X0WA 5DJZB 3VA7A 1UQSB 5HVWA 3E8UH 1FD7D 1KYOK 3QISA 1QFUH 1S7XB 4CSZA 2NY0D 4LP5A 5GS2D 3RNQB 3BP6B 3GTGH 1GY2A 4C3JB 4FQIL 1AQMA 5I1EH 2V33A 3R19A 5D1XB 3Q01A 4JOIC 5KW9L 4OVUA 4NM8L 3ZVVA 1UM5H 1SUJA 4HF5H 4GS3A 1AR1C 3G5XB 4KNSA 4NUJB 5MEPB 5IMLA 4GI8A 5E2UH 2WVSA 1OM3H 2NVQH 1EEZB 4Y5XC 5FHAH 4ZUJA 1MEXL 1U95A 2VDLL 3IYLW 5E56A 3TZVA 3OOCA 5B1KA 3GTOB 4JLRB 2A68C 3GRGA 4IS6B 2VT0A 3KWXA 5HJDA 1NGPH 4Z0XA 3V8CA 3QXTA 1N0XH 5GGVY 2NVTB 2F15A 3S3BB 5K9QG 1II3A 1WVZA 5KG9A 4X3UA 2DWXA 1X5LA 2H32B 4MNQB 1AQHA 3LDBB 2Z0SA 1M90C 1HX0A 2G3MA 3TYFB 1CXKA 2B14A 1YN7B 5I0YA 4DK1A 5JHDE 4Y52H 3L9AX 1V3MA 2HCCA 1VESA 2XVKA 4X4KA 5FAAA 4L8BB 4CKBA 3DX6A 3MVVA 1P2CB 1RVFL 2XN9B 4GLRI 4PJFF 3S98A 4P2CB 4AYSA 1CE1L 3AGWA 4ZD3H 2IEPA 5D1ZD 2A19A 4ZMQA 1PYWB 4OWTB 2BJML 2DWTA 1C5BL 2CIKB 1BQUA 1J86A 4GQPH 5EHFA 1KJMB 3ESUF 1Z9FA 3GXMA 3RWEA 3LEYH 4WUUA 5DS8B 1UVQB 5FYLD 1GJUA 5ESQB 2ALWA 4PJ5E 1UA7A 2J12B 4MXWH 5ESVA 3QB3A 3N50A 2B1HL 1YPZE 1UXMA 3HOUG 3PP4H 5K9JL 4ZODA 5HVGB 1EK3A 4ZRGA 4LCCA 3SKNB 4HQQH 1SDAB 1FL3B 3HZKA 3C46A 1HQ4B 4BELD 4DQAA 4M48H 1Q82C 2BWDA 3BEVA 1JPGA 4MDJB 3C1FA 2DLTA 5I5IA 3RUGF 3E3XA 3ZQ9A 5F7AA 1JWSA 1IBMQ 1JP5A 5ISZB 5LAPA 4MDIA 5E1AB 5CR3A 1IBZA 4QTHB 1BMZA 4LLQB 3GQBA 1DTUA 1KDJA 1ROCA 1EVUA 2AWNA 1WCMB 1YEFL 4PBDA 3DURA 5DQ9A 5EC1B 4JYAQ 3LIZH 1KTRL 2DKMA 4X6CA 3AMLA 3A56A 3VWKD 1PZKD 3EJZD 2RSNA 5JHBA 1NMAL 1K5NA 3L3HB 2NNXA 4BY7B 4B3SQ 3FF7A 3MN8A 4ULLA 1EAJA 3R4DA 2SNSA 2I07A 4YHPB 1T22B 1X7TA 3UJTH 2C9XA 2XHNA 2E4FA 1D6EB 4E9QA 2LMCB 3LB6D 4TSAH 3CP0A 1XIWC 4MD0B 4RCAA 3ZT5A 2DJMA 1M6OA 2NXYD 3NZHL 4MA7H 1DVXA 1YC7A 1KXVA 3RNKB 4DKEL 2RR3A 5DHMC 3ARGC 1XR9A 5SWZE 1HQMC 3VAEA 2EY5A 1YEJH 2YUXA 4NBZB 2YTXA 4FCHA 2SODB 2X2JA 4BH7B 5KS9A 3KNBB 1KCSH 4NPSA 2GUYA 4M7LH 2GT9A 1QVOA 2GC7C 3HZVA 2DKUA 1VQ9A 1AGDA 3IEAA 2Z8VC 3PWPB 3QC5X 4JPWH 3IETB 1QTYT 5DQDL 4KKUA 2VRKA 4ILDA 5ADPL 2A77H 3PV7A 5FHBL 1E8XA 1NCAL 4DKAC 4X5WA 5E03A 2NSMA 5CGBA 1Z0NA 2WQVA 1Q9KA 2H32A 1X5ZA 4ZMPA 3T6QC 2H7WA 3NGBB 1YN7A 2BIHA 1H9SA 3EYVA 2IH9A 3X3GL 1I1FB 1I9EA 1XXDC 1JV5A 1VQ4A 3ILPA 4MNGB 3ZDYF 3KZ8A 1UWEH 4O02B 3LDBC 3MRHA 3GMLB 4NPYB 2F7QA 2YLHA 4X5QA 3NPSB 4P2RB 5GS0C 3WELA 2NW3B 2V9UA 3QIBD 2AXGA 4LHJB 4Z7WE 5GISH 1Y1VB 2Q1EA 3NCJL 2P46B 4GUQA 1BG9A 1FRGL 1HL4A 3HS9A 3MLTB 4NUGH 4OU3A 3SDAD 4P4RB 4LSSL 4X9IA 2QGEA 5GRUH 4CMMA 2EJFC 3HG9A 4XMLL 2VUMG 1I1CA 2Y69B 3DHJA 3NEOA 1KJ2A 1CDYA 4NHUB 2V7HB 5LN4A 1IVTA 1MCIA 3W9EB 4NXMQ 3VMPA 3K6SB 3WNIA 1OAUL 4MSWA 1HILB 2A9NL 2KC0A 4YXKL 3F7LA 2WIIB 1R3KB 4LPTA 4PJ9D 1RUKL 1MQ8A 4I2XE 3SKMA 1QI3A 2QGQA 4PR5B 4HJUA 1R3IL 3WNNA 1A6UL 3MXPA 5CD3B 2ZQKA 2F0VA 5I18L 2H41A 1GAFH 3BN9D 5L8LB 1RPKA 1IC1A 5B1JA 3QUKB 2PMZE 3BPNB 3V0EA 5D7HA 2WLJA 2X89A 5E70A 1KCWA 1F5WA 5IBLD 4HCSA 1I3QB 1ZT7B 4NNPH 4BXXH 1PS3A 4N1EA 5J11C 1PLCA 1BBUA 3I56A 1UWXH 5ELNA 1U8NB 4QXTB 4ZW7A 3S1MB 4ZFZA 5AB9A 3UACA 5TF1H 2AEPL 4IM8A 4DN4M 4I9WD 5FR3A 5DT1H 1BZ9B 3A4EA 2W1NA 4EN3B 4I0PD 1F2LA 1NEUA 3IJ8A 4PM1A 4JM0A 4OIJA 4YWKA 2VDKL 3ZE2E 3H6AA 4DWHA 5JEAJ 1FFPA 1YJ9A 5FYLL 3NSJA 2PI2A 3FN0H 4LGPB 1TENA 4RKLA 4OZ4A 5FLXE 5B7EA 5LGHL 3D39E 4AE1A 1BCPF 3BN3B 4L8DA 4KTDH 4B27A 3FPYA 5FECA 3IJSA 4S1SH 4D9RE 4H44C 2YD3A 1WTXA 3JBG7 5E5MB 5BZWA 5M3MB 2BH8A 1I8LA 4H25A 1OAYH 1G6VK 4NMZA 1SHXA 2L8AA 3VR5A 5T3ZH 1SLVA 2WYHA 3PDOA 2UUAL 1X3GA 1G6RA 1URLA 4YVNA 5AQ0A 4QJ4B 3AWGA 1RZJC 3RQ3A 4KTEL 3MRIB 5LKNA 3I72A 1J88A 3MUY1 3S3CB 2YKLH 2Q9OA 5IMMB 5DRWB 5JPMB 1STAA 2G0KA 4B3TQ 2R2CA 2YD5A 2K8QA 1AYOA 1SGKA 5DJ8B 4QMGA 3EROA 4P2RA 4C59B 1XH3B 1PX3A 1YLBB 1IBGL 1AGCB 1EWHA 2Y6TE 2P7TA 1SXAA 2I27N 2EYRA 4ELDA 1HKLH 5DMIH 3VB9A 2VXVL 3JTSB 2QHRL 4Z7OE 1T5WB 4TNFA 5D71L 1ZAGA 2DPKA 1MRDH 4D9LL 3GXUB 3HG1E 1J7VR 4N2MA 3RHWF 1EIHA 2IIJA 3HHMA 5L7XL 1WZ1L 1SXNA 1S7QB 4FOMA 3C09B 5IB5A 1UD8A 4A7UA 1AG6A 1FLTX 3A3YB 3ZMRA 3O4LB 4KJPD 3BGMB 4F2FA 3PUCA 1Q8MA 4JI5Q 1V3JA 4PRIA 1P5UA 4GXUN 3B9KC 1DUYB 4DQOH 2E46A 2PYFA 1KMGA 3PIO3 4HLJA 2GVBA 1CDJA 1YI2A 2AK4A 4L37B 4QXUH 4UQ3A 3V4VH 4Y16D 5DJ0B 1WTGT 3BWSA 1GZPB 4LL4A 4NM8H 3DO3A 1JN6B 1UM5L 4HF5L 3S3JA 3ZIMA 1LNUB 2ID5A 3W56A 1NGXB 2CE6A 1OM3L 1EOTA 2QV2A 3QPQC 4X3SA 2Y0SB 5HGTA 1FJ1A 4WU7B 3EJYC 4EIBA 4PYHA 3I4MB 2VZTA 2I60H 2X44D 4DV2L 4IUUA 4J15A 3E7JA 3FQXA 4LQFH 4OLYL 4EBQH 1N0XL 4QCIA 4BS9A 4EUPH 1WA0X 4M6OL 3A8JE 4FQXA 2H2SD 1FWXA 4YCVA 2QTVA 4XHJD 3ULVD 3M88A 5EMYA 5AD0B 2JA5H 3WOVA 4KKCC 3UTSE 1H9KA 4PJ8A 5JO5B 3SE9L 1SMYC 4IHBA 5JVH3 4NOFA 5C0AD 3ROOB 3T8XA 1X5YA 4BJLA 4OZ4B 4KO5A 2RACA 5C0IA 4ZXBC 2IADB 2OLDA 5E6YA 4H0GA 4Z76B 1M9WA 3N06B 4BHUA 1XNQQ 1XNQL 2EIKB 1PZ5B 3NCEB 4BYHA 1DVZA 3AB9A 5TE6H 4BSWA 1G2SA 3ETSA 5T3ZE 3WIFB 2EDTA 3CX5K 5E5MA 5F6IC 1DJWA 4JFEA 4RBPK 1DJIA 4YCWA 2AUJD 3KYOB 2HXAA 2HIVA 4XDXA 1J0ZA 3S1QH 3V6FA 4KTAA 5I1GH 3PUZA 4PV9B 2NY5H 5DHEA 3GUTB 4L8SA 2WAQE 5IEHA 3PP4L 2PKDA 4RGNA 4KJWD 1R0AH 4YDLC 1QG7A 3A0OA 5AENA 3D6CA 5I30L 1Q0XL 1EUUA 1WGVA 2BFGA 5BOJA 1QVCA 2W81C 4ALPA 3OBAA 1DYQA 1N64L 3PWVB 4FRWA 3GTJH 4GMSL 4TVUA 1PFNA 3B7SA 4UCFA 1ZWIA 5EBMB 4BFFA 2P5EE 1E2VA 3QEHB 2QKIB 3Q9PA 3TN2A 1MLBA 2MH4A 1F1DA 5I1IL 3DPBB 5E00A 1YEFH 1YSOA 5FJ8G 1I94L 2OT2A 3UAJC 1C7TA 4KHPQ 1SE3A 4WW2A 5H4ZA 2OP4L 3D18B 4RGNE 3VFWB 5AFWA 3KPMB 2Z6KA 4WEMB 5F7BA 2Z6FA 2EO7A 3C08L 3QUGA 4WU5B 3OQ3B 5IQ9B 2HQEA 1U8OA 3TBSB 1AYRA 5E6UB 2QVKA 2WNXA 3MCKA 4EDWH 1S7SA 2O61B 4OGZA 4ZUWA 5AAWC 5AJ3L 2WXJA 1JXDA 4OAWB 4CGUB 4TSAL 2X6BA 1C9OA 3D31A 1TSHA 3UTPE 3NZHH 4A3GG 1QLEH 3SYPA 4DKEH 1VQAA 3UO8B 2XQYG 5D5MF 5I1JH 4R7NA 2VN4A 1JYVA 4K3EH 4LEOB 1MCFA 3DDFA 5A6LA 1E3PA 5B4MC 3V95A 3O3EB 2MMXA 1R33A 1KQSA 4M93C 1JGDB 4X4YB 2HUHA 3PDGA 4RZCA 4PLKD 3D85B 4DH2A 1AD0A 4JPWL 4A3GH 2JA9A 3D25B 1TWGH 2CLVA 4QOKE 3QQNA 5IY0A 4DGVH 5DQDH 5ADPH 2X4UA 4QCIB 2A77L 4EQ2A 4LMQE 1JTPA 4OLWL 1Y1WG 1F3DJ 4F3FB 2V3DA 5EDSA 3K91A 4LLYB 4UIKH 1F2QA 5FYJE 3HG4A 1OO9B 2B4CC 2EZVA 3H9SD 5LAXB 4YBHA 3T8XB 3X3GH 5IEHB 2MHAA 5J13C 1UWEL 1S7WB 2MKWA 1FGUA 5IP4A 1OT1A 4Z76A 2EKJA 4Y16B 2GCYA 1JHTA 1O75A 5EBWA 4HJEA 2ZXDA 2VAJA 1U58A 2HH0L 2X6AA 2A4ZA 2BM3A 4JY4A 4HKJA 1INEL 1CQKA 1YA5A 1K8IA 2BK8A 2Y5TA 2ESVE 3DTXB 1QBLL 2UXDQ 4WWKA 4D7PA 5I9PA 1WT5C 3ZTJG 4PJDE 5DUML 3NCJH 1E30A 3MXWH 3HR5B 3FT2A 4NM4L 1FRGH 4A3LG 1MUJB 4PJHE 5EC2B 5GGVL 4LSSH 5GRUL 3U9UB 4L5QA 2XDHA 3CZNA 4F7CA 5C4JB 4BBRH 1CB4A 4GPVA 4WW2C 3C09C 3RI5F 1IGJA 3IDXL 4WUUE 4YSDA 4FXKB 2EO9A 1U2HA 2ZSWB 4WO4C 1OSZA 3KLAA 4KLKA 1MW2A 1TZGH 1FGBD 4WSGA 4NQXA 5IWLA 2A9NH 4HJTA 1OTSC 5FXCH 2AITA 5HDOA 3O4OC 4R3SA 1NPNA 1CYGA 2YO3A 2HFGH 3NCYS 1KLUA 3CDFA 1I50H 2OMUA 4NO2A 4OLUL 3VDBA 5CJQH 3S36L 5JW5A 5GRVK 1PTOD 2WXNA 5IG7A 4J3XA 2L7JA 2UX6A 2OSLA 4R2GC 3RBSA 5ANHA 3UP6A 4QHNB 1WHPA 2P5PA 1F58H 3VTAA 4P2OA 1XF2B 5T1KB 4QQBX 3FQUA 1PVHA 4UIMA 4Y5YC 3F2DA 1AXIB 2WOYA 3M7NA 4DR7Q 1JE4A 3ECUA 3EJUA 3H1ZA 4ZO6A 1G7JA 2Y07H 4J3OC 3VXSD 4ZFOL 2IBBA 1N10A 2VM9A 3ARUA 5IWAQ 2KZBA 2ZIDA 1SFHA 1QYGL 3FVQA 3U50C 1BCPB 4L8JA 1N8OE 4XNMA 2OMNA 1FH5H 3IFTA 5CEXB 1EFXA 1OKEA 4KRPC 3F04A 3FB8B 5CKGA 1SJVA 4JPIA 2Q6WA 3QUYA 2EE0A 3C60C 3TNMA 4QUFA 5C3XA 2HKHH 3AM8C 2VDKH 2O6DA 1MCCA 4RMSA 1I1YB 2LLNA 4N0FA 3BZ5A 5FYLH 1SLUA 3FN0L 3HN8A 4YHMH 4K8JA 4FGMA 4BKLA 1FSKC 3BJLA 3MJ7A 3DM3A 2BE5D 2YZ8A 1C1EL 2OBGA 3JWNC 5FWQA 5DZNA 3TFKC 2PYEA 3K5OA 1OCWL 5F3HB 3W9DB 1SNDA 1RAMA 2K14A 5A2QL 3DRTB 5DQJA 2LKVA 2IAMD 3QFDB 5I8OL 2CR0A 1B8AA 5BRZA 4PG2C 2B2UC 5GROA 4U1MB 4XAKE 1CICC 3X3MA 4P46C 4X4ZA 1BIIA 1R5IB 5CINL 4I8DA 3CFBA 2EYPA 1HDMA 1OPGH 3LWUA 1X3FA 4TUOA 3VA6A 1UAPA 3FTZA 3H6JA 4LOEA 3CZKA 4QRUA 1JYWA 2K78A 2WO4A 3MR9B 2F68X 5AKTA 4P3CH 5IF0B 3QRLA 1Z9PA 3FOLB 4M00A 1CFBA 3IMWA 4KI5F 3K5NA 1DQJB 3VFSA 3HOYB 4FNSA 2BCOA 1MJ7L 5DJAB 3A24A 5AUMB 4K07A 2IWHA 5HJ3A 3VXUE 4OCNC 1IGMH 1O7ZA 4IIQB 5ANME 4R7DA 5AALA 1MRDL 4HGKC 4YIQB 3QPQD 4FL4C 4D9LH 2XNAA 4YUEH 3TA3B 3L45A 4I87A 4ZAKC 5CLWA 5GZOD 4YL9A 2VM3A 3FQ4A 1OXSC 3WEMA 3UYPB 2QDLA 4AQ8C 5F6IB 2CJTA 3CTTA 3I4OA 3GV3A 3K8AA 3VFGH 4EMZA 5A3ID 4MDJA 3V6OE 5K5YA 3MO1A 5DK0A 4F8LA 2PCPB 2QLVB 2DYSB 4QRPD 3T0EE 3VYTA 1XV8A 4QXUL 1KG0B 4XP6L 3CBJB 3WHE1 1UT9A 5LWYH 3BG3A 5DO2D 3KPQA 2NR6D 4KKZA 4Z1PA 4URKA 4JI7L 2OSLB 3VJ6B 3CE1A 1V7MH 5ESAA 1HXMB 3POHA 4DVBA 3BHBA 4YN3A 1TZAA 2PQAA 2I5HA 2FO4B 1PTOC 5C44H 1IL1B 5E6RB 3TMEA 1M05B 1QOHA 3L3HA 2JELL 4JI6Q 4EN3A 1NY4A 1JZJA 4XCCH 5LDUA 9PCYA 3QIWB 3FO1A 2BSTA 4TQHA 5E4WC 4DR1Q 2CAKA 3MXNA 1H15A 3FZUC 3WKPA 2W0FA 2V5TA 5LNDA 3S96A 5KYIA 4GSQA 5DRZA 2PABA 5K9OB 4RMRA 5CD5D 3B34A 4PY7A 3DNKA 1CFVH 1QI4A 3TNMB 3CC5B 3LZPA 1N32Q 4PMEA 3SE9H 2CLZA 1SEBA 4HYTB 4P5TC 4IFDH 2UU9L 2YGVA 1TJXA 1YHAA 2PW5A 4RIRA 1ACZA 5AAMC 1PJ9A 2PCXA 3CDGA 1CL7H 2XFXB 2KENA 4W9LC 4ODUA 5DRWA 5JPMA 3PO2G 2XN0A 4E41D 3R8BA 3NJIA 1EMTL 1HNWL 2IANA 1ZA6B 1BIIB 4LFBQ 1TETH 5E2WL 2F08A 4GO6B 3I7FA 4KAQL 2IAMC 3CCHB 4BGDA 3D87B 3F7YA 4PIBA 3T6ZA 3UAEA 2NY5L 5KBPA 1V05A 4ZX3A 3RVWD 4HOXA 4UT9L 1ML0D 1J8HD 3QZWG 1OCCB 3RDTB 3JTSA 1JF6A 2JJVA 3ENEA 3N6YA 3R0MA 1X5XA 2XWCA 1HH9A 1Q0XH 1C8QA 1PFCA 4NO5A 3RN5A 5EEVA 3Q8BA 3B2PA 3CX5J 3I6KB 1LEIB 2B8FA 2AI0L 2JXMA 4LMQI 5IGXH 3PWPD 5D6DC 4GMSH 3G04A 2RCNA 4L3EA 3ML8A 5IOPA 1RF2D 5CP3A 3TH4T 2X4OA 3LPPA 3CFCL 1NUCA 2GJ6B 2O26U 4MXQC 4A3KB 4OGQC 2A9DA 4YSCA 4FNUA 3CFJA 4OZFH 5I1IH 3E2HC 2WW8A 2VITA 4Y2NA 4CMMB 4EZLA 4FDBA 5CV7A 1PLAA 2IHFA 1QATA 5IJVA 3NQKA 3M8OH 4MKMA 3C08H 1KYAA 1OOAA 1JDCA 4B5ZA 2F7IA 5AVUB 1ZS8B 2BVTA 2HT4D 2FX8L 1ZEAH 5IYBH 3KEDA 4X9HA 1UH3A 2XXGA 4OJCA 1WEJH 4FYRA 4LRNH 2YD0A 1BNZA 32C2A 3NSYA 5ANMA 1WJ3A 4BK8A 5JW4Q 3K5MA 5CJ5A 5A3IC 3SHSA 2LFEA 2MUYA 3Q5OA 1J0YA 3TJHC 3NP4A 5DR5H 4CA4A 2P48B 5I1JL 2B2YC 3BHBB 1HSAB 4L1BA 1BQHG 1J05A 1E4WL 1G7HA 4OSUH 3R2IA 2PXYC 3EKCA 4JFSA 1YEIH 2Z6KC 3NPZB 4QO1B 1JOKA 1X32A 1XL6A 4JW3A 4CDCC 3SPGA 5JPNA 3WHXA 3VXPA 1AI1H 2PR4H 4UT6A 4DK6C 1Q1EA 4OLWH 4KN7C 4NZTL 4NZUH 1M1KC 4XO3A 3GZKA 3ZT7A 3GBNH 3V10A 4ZZFA 1PQZA 4E9SA 5DAUA 3CMGA 5HY9A 2D3LA 3S34H 5I19H 2YTVA 4WY7H 4PW9A 4AYBE 3K58A 5E95B 5KYXA 4BXVA 1NOLA 4YAQA 3AY4A 2QSTA 3B8SA 5AW1B 4P2QD 3HEIB 4U6XB 1FO0A 1TQUA 4MA8H 4GRMB 4E9LA 5C3IA 2C5CA 4ZUUA 1E24A 1ZSDB 4KKPA 1TWHH 1TIUA 3L5IA 3PDOB 1HCZA 4RGNC 1E7VA 4YHIB 2XFGB 3QBTB 2EIFA 2IPTL 1OARH 3CK0L 4MNQD 5C9JA 1BZOA 3WIHH 2ZG3A 5I15H 3GBML 2DQHL 3PJNA 3IDXH 2QQQA 4X9YA 5ACLA 1SHWA 5TE7H 3GBLA 4OZHF 1TDQA 3WKNA 4JVZA 1MQKH 3ULUH 2ATKA 1KENH 3KYMA 1R17A 5F72S 3UTZB 4DKAA 4RDQF 4HOZA 5IW1B 4RDQG 4C3IB 2J4WL 3H9ZA 1NPJA 2B2XL 1XEUA 2X1OA 2D2CC 1KCVL 2JLPA 2WLIA 3NCBB 4L5TA 2E76C 1TUPA 2EDDA 1HXYB 4NIYE 3S36H 5C0FB 2B39A 3D6WA 3NEMA 1H3TA 1PG7X 1HN1A 2BS71 2C1OB 4RFOH 2F53B 4NO3B 2B8OT 5D93C 3TFKD 1UH2A 1DE4A 4DP6X 1NBQA 2DDQH 2VXTH 4XCYB 5BCAA 1UGNA 3LNIA 2X9WA 4B9YA 3OZKA 3PDDA 1ESFA 4GUCA 1IZ6A 4JX0A 1KTCA 4YGVB 1UM4L 3FH8A 3KYNB 3KXFD 4IK6A 1S46A 1G43A 2Y07L 1X55A 2JI2A 2NOYA 4HULB 1YECH 2DQEH 3R7QA 3VTTA 2XTSA 4BXXG 15C8H 4N2OA 4YIJA 1MCRA 5FFGA 5EKIA 4YVUA 1OTTD 5ANMB 3F7RA 1FH5L 3WD5L 1U92B 4XZUA 4LFAQ 2X4PA 4XR8C 2AGJL 1W9XA 3PWUA 1HSBB 5H94A 4L3EE 4NENA 1AH9A 4MNQE 2J7LA 4YHML 1HQRA 1XSIA 2A38A 1YDPA 3CN4A 5BZZA 1BFVL 1C1EH 3BQUB 3OKMA 4GZYC 5D7LE 5FW6A 1T6WA 3V0DA 5JPNB 4HFUH 4Z7UF 4P75A 3IDJB 3M07A 1Q9OB 2XQBL 2YBRB 1ZLVH 4M8AA 2R39A 4U7MA 5J6HA 4G83A 2HWZL 4U0QB 3KGTA 1NMBL 2KH2B 3T0BA 3E6FB 4L2YA 5ID1A 4FXDA 2XXMB 5M3FH 1PW3A 2ZX8A 5CINH 3ALPA 1Y8NB 4UTAA 5GRYA 5I71C 1BQRA 3UTTD 2AJSL 4F9PA 1LO3H 1QBAA 2EUVA 3DETC 3ZDWA 1HUMA 3AROA 5T5FH 4YWMA 4KTGA 1IGTA 1A1NB 2CUMA 4KROC 4Q4IA 4LOVA 2ZONA 3QI9B 2NZIA 2BP0B 4P3CL 1MUJA 5EC2A 1VFOA 5KYYA 3AU7A 4LGRB 3HOVB 1XCTB 1S7TB 5ALBL 3DIFA 4U6XA 5J7CC 3AREA 3UZQB 3UPRA 3BH9A 1FL5A 3L81A 1OSZB 3KLAB 1KF9B 3R18A 4JDZA 3G6EA 1JXFA 3L8QA 1Q9KB 4RWYL 1SJEA 2XQYA 1KIXA 3KYHC 1MNUH 1OVZA 4M1DH 4X62L 4WV1B 4YPGA 5C09A 3SN6N 3D08A 2H1XA 4A3CG 3UPCA 2YD7A 1MFEH 5LLIC 3ILPB 3KL5A 4PMBA 4A3MG 3MNVB 4LBEB 4HJJH 4RGNB 3OAYH 3EJZC 5EU6D 4AGQA 4X0KB 3TX4A 4MTMA 1W0YT 4JO3H 2Z91A 4RISL 4ONGL 1Y14B 4DUYL 1SHSA 3HC0B 3A21A 3FCTA 3HOVH 3S8GB 1YMMD 4KHXH 5CIPH 1XF2A 1JXKA 3T2QA 1MWAL 2C9QA 4XP6H 1HXYA 3MJ9A 1OB1A 4XN5A 4PWGA 2PMZA 2P5WE 1FLRH 1M9SA 3G08B 4P2QB 2K3HA 1JGLH 3BGFB 2BSBA 4DR6L 2EECA 2PW2A 2YMXH 2ITDA 4JDEA 4N8VG 5E6IB 2D0OA 3RJQB 2OI9B 3VFWA 5SWZB 3FTVA 4CBVA 3IDUA 2ENYA 4LCWD 2F54B 2BDNA 1NM9A 2JK8A 3K1DA 3QEQD 4FA7B 1RERA 3BUDA 4FEMA 4S0TD 3CLFH 3OPUA 3L3DB 1E67A 1QBML 2MO1A 1U4FA 1CD9B 1JV2A 5CORA 4LFCQ 5F6HI 3PWPE 3RVVD 2CUHA 1D8LA 5FIEA 3WYRA 2JKSA 3QUKA 2PZWA 4U0RC 1CFVL 3BEWA 3CVDA 4YDMA 3BDOA 1GZHC 1HSBA 3DI2B 1MD2D 3L1GA 3L3KB 3MLWH 4N2FA 4A68A 3HS8A 4PHZA 3U0TB 3VSVA 3PQYD 1MW0A 2NNAB 4QRPB 4PG3A 5CEZL 1X44A 4G6MH 5DHYB 2EXSA 5CV4A 3FQYA 4OD3L 3SPIA 3WS6C 2FEDD 4GXFA 1N3NA 3CX2A 2QGDA 5EZJA 4N8X1 4GN5A 5EV7A 3OF6A 2Y7LA 1NANH 5D2LE 2ALAA 3RY4A 1AH1A 1FZMA 2R8SL 1TETL 2YN3A 2WAQG 1ACYL 4NPKA 4QF1A 3FT4B 2DMKA 2X3CA 3KGUA 1AO7B 4OX9Q 4HXAH 5D7IF 5CCGE 3NTKA 4OX9L 5BRZE 3IF1A 3CRKC 5K33A 5F89B 4XT1C 4ADGA 3QRGL 1FVDA 2DH3A 1GHFL 3M1BB 5DRXA 4OCXL 1SNOA 1S3OA 4KK6D 4Z9KB 4HOMA 4JG5A 2XNAB 3DIFB 5E4EC 1HXKA 3QDJA 5KYUB 4MMXA 2NX5A 1XMWA 1R9TH 1YMHA 3OR6B 2JKTM 1PKOA 2RAMA 2BXZA 4P23C 3SGKA 3CFCH 1A6XA 2DIBA 5KZCD 2NLJA 2OJEA 1HNGA 4R7VA 1NWOA 4ZAKA 1OZTG 3OGCA 3QWNA 2RMNA 2FWOA 2QSVA 3MFYA 2GVYA 4XCNA 4XT1B 4BGLA 4XB7A 1CO1A 1O7DE 3LY6A 4FULA 5DJYA 4JKPL 3HOUB 5IBLC 3EJSA 4G3YH 3ABLB 2FX8H 3MJ8B 1ET7A 4GOPB 1QRNE 2WMPA 5KNDA 2VXQL 1WEJL 4JQVC 4OO1H 2AAVA 1KEML 4HJIA 4YFLI 3T2OA 1M05A 1VKXB 3NUCA 3IXTA 1PH2A 1CVSC 4NO2B 5FYLE 5HPOA 2UY7B 3NBNA 1UADC 4I18C 3QOJA 2XKUA 1JNHB 1ORSB 2YAFA 3NSXA 1ORQB 4G7ZC 3HFML 5FK9A 4I0PC 3IPFA 2NYYD 2C9VA 4OSUL 2DL2A 3HC2A 4UQIM 1GIGL 5HDBF 4NP4H 1YEIL 3BPCB 3GQFA 5IP7G 4Y5VB 1TVXA 1X5HA 2IV9A 2WXOA 3Q2NA 5KN5A 4HPOH 4GG6E 1Q81C 3GB7B 5JHLL 1YEHH 3QEGL 3TJEL 1U91A 2Y7QB 3J80L 3D39B 4HUXA 1NKGA 5BW7C 2QCPX 4K9EL 2NSQA 2KCNA 2A6JA 5EZPA 2H1LM 2EVHA 4XBPB 3GTLB 3GLEA 1AS8A 2BHUA 4X7FC 3CU7A 5F9JB 4HWBA 2R0ZH 4WEEA 5TE4H 3EBEA 3LZFL 4FHKA 2CHDA 3CVBA 5EIIB 4OCYH 1OE1A 5I19L 2GPZA 2OJ1A 1F6LL 4F5CA 2WQAA 4HDIB 1F8TH 4KGJA 4U7SA 5TPWH 3MBXH 2VZOA 1KNEA 1PYSB 4HKXA 2WV6D 2Q76B 2YPKB 1N3NB 5C07B 1L5GB 1LO4H 4LVNC 1T0NB 1BP3B 3MBWA 5A2LH 3WLWC 4MA8L 3FL7A 3II2A 1A1MB 4IHOA 4L8BA 1MJ8H 1EXUA 2WCGA 5E23A 5GRVL 3PPEA 1EIYB 1E65A 3Q43A 2VDNL 4XE5B 4LCVA 4XO9A 1NJ9A 3PHOB 5AVZB 5C0XJ 3GTPB 2J1XA 1LXMA 3CK0H 4L3EB 4A3DH 1YMMB 2BY3A 3AT9A 3GJFB 5ELOA 1UB5B 2F5BL 5DHDA 4YWGH 4K8IA 3GBMH 4KRNA 3J7AF 1NSNL 1Y69U 4FABL 2APWA 2HN7B 4QRTB 2X05A 3UTQA 3VQ2C 5HSFA 2D2OA 4FXLA 3D30A 4BCZA 2R29H 1AGFA 1KENL 5FUOL 2Z8RA 2Q7YA 1VGEL 2E7CA 2CH4W 3OR6A 3U25A 3TEYA 3UTSD 2YD4A 1MGSA 1XSOA 3CCMA 1WZAA 4JFXA 3S17B 4Y5XB 2AJ3A 1CDBA 4LB8A 1D5IH 3EO1B 1U8IB 4R7LA 2R2HB 3QFJA 4HMDA 1J5OH 1LL1A 4K73A 2L5TA 3ECBA 4B3RL 4KDTA 2MCPL 1A0IA 3UBGA 2LVCA 2DDQL 2VXTL 3X1BA 3QIUD 3L2NA 5F1IB 1W8NA 1F45A 1U8JB 3LRKA 4MHHG 3SBQA 1CDGA 4GMTH 3GXTA 4P5MB 3MNWA 4XOBA 1U8PB 1ENCA 1QPKA 1MJEA 1MKHA 4Z3HA 1LE9B 1E4XH 4BBSH 4FC3E 4JE0A 5D3IB 5HHOD 5EBMA 3ZJAA 1IM3B 1LK2B 4IGBC 3LNNA 3QXWA 1VADB 3V5KB 5TK2A 3IXTB 4AQYL 1R75A 1SMYD 1I94Q 4QYOB 2PW7A 1CG9B 4PS7A 1ET8A 3MRPA 3FO0H 4BFOA 5KVGE 3G6JA 3L6FB 4WUUD 3QR0A 1QBBA 2H2SC 4L5FE 4DV4L 4K71B 3WTUA 2X0UA 1I4FB 1RIPA 4IJLA 4X6DE 1IU1A 3RTQB 4MKTA 4DOHB 2BNRE 1BCPC 3EYQD 4Y5VA 1OAJA 5KIXA 1T20A 3QG1A 2OR8A 2ICWI 5DEZA 4BZYA 4HFUL 2WBXA 3K2UL 4OW6A 5DA0B 1SUHA 2XQBH 1EBAA 2VDOH 2HWZH 3OAYK 2ICWB 2ZUTA 2BW4A 2NY7L 4E41E 3HOZH 1CR9L 1QA9B 4LNRB 1SMOA 4XC3H 1JPSL 4JY5L 4LKCA 3IETA 2OX5B 1G7QB 3NJJA 2W9EL 4R2GB 2AJSH 3ZL1A 3FEWX 1ACCA 3B6SA 1KTDB 4GRMA 1HHJB 3GI9H 3HPLA 1Q9WA 3GMRA 2NY1D 1EO7A 3NUKA 2VABB 4X5XB 5FGBC 2DTMH 3N44F 5C9JB 1G8ZD 1PA6A 1EEYA 2NY2B 3OX8B 3HRZB 5JNYA 3VGFA 1G7LB 5D5MB 1Q0YL 1PFSA 3FCSA 1SBSH 4RWYH 1A6ZA 3GO1L 4LLYA 2R83A 1YNKH 4M1DL 5B8CB 1B2WH 1T89C 1OGSA 3IJEA 3EFFB 1HEZB 2GK0A 3L9YA 3US1A 3D39D 1LWHA 1T04A 3EH3B 1ERNA 3ARDA 3KG5A 1A65A 4KKLC 5KJ4A 3QDMA 4HR7B 3CVCA 3AADB 2B63H 4IBSA 4FXTA 4MQSB 4N25A 3TXAA 2DM3A 1UOKA 1MJCA 1LEIA 4FI6A 3DJ9A 1E4XI 3GSXA 5F3BB 4ONGH 3VG9C 3F1ZA 4JFXB 5I1CH 3K7UC 4N2KA 4AMXA 2AQ1A 2JK5B 2D73A 2AZAA 2PZUA 5AB1A 2F1MA 4YSUA 1KLGA 4PH8A 4AYID 4ZMAT 1AG0A 5MP6H 2YAOA 4CBZA 1F9QA 3NJVA 3QCUL 2LS01 2D4DA 1TYJA 2DQ6A 1AZZC 4LW1A 2C9PA 2MPMA 4WWID 2FIKB 4P5MA 3IM1A 5F1SA 1RI8A 1WFNA 3U4BH 1AXSA 4V1DA 3DOSB 4N6RA 4HK0A 4UNVA 2VB3X 2B0SH 2WKGA 3CLFL 3TEUA 2NPLX 2AEQL 2CIIB 4IRZA 3TEXA 1UJ3C 2C9OA 5GZOC 5JORB 4JN1H 3QH3B 3SBWC 2EDNA 3IFPB 5ACZA 5LGKA 4W70A 2I7OA 3WFCL 3I4NG 5C4XG 1SLWA 4N2IA 3MROA 5GGQH 5JDSB 1SVBA 4PJ8C 5FGCB 2FHFA 1RZFH 1U8NA 4F7KA 3IKJA 2VISB 3D85D 3VGAC 1X3PA 2WLYA 3FHEA 2VUKA 1F6AB 5DDHA 5A16A 5DD0H 3M17B 5G5DB 4LF4L 2WB1E 1UENA 2F52A 1T20B 5T1MA 1PH4A 5CSZB 1DQQA 3RLOA 3C5SA 4OCWL 3BRDA 2XZCH 1O5DT 4GLAC 2XWXA 2VLKB 1FE8L 1IEBB 3DUZA 4B9FA 4ZUSA 4IDJL 4EAEA 2ESVB 1ACYH 4LNRA 2DV6A 4W4OC 5DC0A 3NACL 3H9HA 1GUOA 4WJ5A 2F1BA 3QSKB 2ICCA 4HXAL 1ZHLA 5FPIA 2AEWA 1JL8A 4PG9A 1I1YA 4KKAC 1TFPA 2CR6A 1RJZB 2E8ZA 2QZ5A 1Q1PA 1GHFH 1PD1A 3KUPA 3R7RA 3H0TB 3VRIA 1IKNC 3BSGA 1RUMH 3FKIH 4CVXB 4DW2H 2YPVA 4NRYB 2ZCHL 2M26A 1GKOA 4FVMA 1RDPD 4NC0B 4YE4H 1UACL 2AF2A 2ZWSA 5K93A 4IRZL 4A3BH 1HWWA 3HC0A 5AVRB 4YMPA 4X8GA 1FL6A 5LNGA 5F8RC 4B95C 1YYCA 3UADA 5HGBA 2VUMH 2OMZB 4JKPH 5AW3B 4OXPA 4FJYA 1S40A 4G3YL 3D07A 5ALCH 5HI5C 4C3JH 3PUWA 2ATKB 3UTZA 5I75B 5E94A 4CADB 1XGRA 5ETUB 5SWZD 1FFTB 5EZIL 5A2CA 4C4KT 4JHWH 1KEMH 4JFTA 1SYVA 2RDHA 3BGAA 3DVNA 5FV1L 4K94H 4ATWA 1A7BA 1OTUD 1WRFA 3CMOL 3RY6A 3JZ7A 3X14A 5C92A 5J56B 3UDGA 1E27B 4MFHA 3ATBA 3INUH 1VQJA 2CBQA 2L1BA 3BGFC 2FNWA 4L37A 3V4PA 2VQUA 3ARTA 4G82A 1RUPL 1U3HB 3OMZA 1SLJA 2UWEB 5E2VH 1Y8OB 4L9DA 4JPVL 5JHLH 1MCQA 4UBDD 1YEHL 2PW1B 4TUKL 4WWKC 3KPQB 3KLWA 1BLNA 2R29A 1L9OA 3RJDA 1U92A 3GZPA 4P5SA 4C3IH 2R0ZL 3QRBA 1EJ8A 1H3GA 2VKWA 3KH3A 3HUJF 1QLEB 1XDTT 4WV1C 1BWWA 4PJBF 4G6KL 1OANA 5TPWL 5KBKA 3MBXL 3E9IA 3RG1C 4DU9A 2I9LA 3D4YA 2HZHA 5EUOF 4F7MB 1G9NH 2EC9T 5CGYD 2O4EA 1WOCA 1LD9A 2MFNA 3U6RB 1C5DA 3NELA 4D9RD 1MVUB 2L7QA 4MJ6B 1Z5LB 4PJ9C 1O80A 3L3IA 2R4RL 3WFEH 1INQA 5T1LA 4TLTA 3UO1L 1BFOB 1OCRB 3WSQL 1F2YA 2HJFB 1L2FA 1KRTA 1XGTA 2EEDA 3D9AH 1EEID 3GSWA 3H42L 5DZLA 4BSWB 4ZBJA 4UM8B 1AHWA 1J9TA 1TLKA 3LHPL 1UZ6E 1IEHA 1A6VL 1VFBA 3AS0A 4YWGL 5C0RL 1PV4A 4DOHE 5CS7A 3P20A 4KK8D 4MMXC 1K8DB 1WTPA 2IDQA 2OJEB 2F4VL 3ARBC 3EDEA 4PJEF 3TA3C 4CVXA 2I25N 3APCA 2TSSA 3CAFA 3Q2VA 4LIQE 5D72H 4X98A 3G5YB 3J7AV 1VGEH 4L8SB 4G7HC 5JXAH 3HZYB 3Q2LA 4EI5B 1TU2A