4PQXA

Crystal structure of a nigd-like protein (baccac_02139) from bacteroides caccae atcc 43185 at 2.39 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
201
Chain Sequence
SRSLVISTINQISEDSKEFYFTLDNGKTMFPSNSQAWGGEKFENGQRAFVIFNELEQPVNGYDYNIQVRDITKVLTKEIVTMDDEENTEEKIGDDKINATYMWISKDKKYLTIEFQYYSTHSEDKKHFLNLVINNKDNTDDEYINLEFRHNSERDSPDHLGEGYVSFKLDKIEEQIEGKKGLNIRVRTLYDGIKNYKVQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACCAC_02139) from Bacteroides caccae ATCC 43185 at 2.39 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
total genus 55
structure length 201
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pqxA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pqxA02
3QWNA 4J8QA 3NQIA 3K0YA 3K6OA 4PQXA
chains in the Genus database with same CATH superfamily
2XKNB 4F87A 4DAYB 4FHBD 3HVDA 1Q86C 4S1RH 4MAUL 5AKVA 3EDFA 3FHEA 1GGIL 2VZ1A 4LVHB 2BH8A 3BDBA 4TTDC 5EU3A 1CF1A 4U1IA 1U8QB 3MRQB 4AJ0A 1T7WA 2A74A 2R56H 4POZC 5GGTH 5K9OA 4RRPA 3FQWA 2W5PA 1MQKL 4MBRA 1G7QB 3TA3A 1KD1C 4UOJA 3V10A 1FNFA 2IPTH 1ZLWK 2WD0A 3TX4A 1KB5A 4B5EA 3F2LA 2R9HC 3IJ9A 2QA4A 2F03A 3F2CA 2R93B 2KQNA 3RWIB 3TASA 1Z9SB 3REWB 2JTYA 2E75C 5KTEH 3GUTA 2DN7A 2OJEB 1EVTC 1NFAA 2Y6SC 4LVNC 3V0JA 4QRBA 1J1OH 1A8ZA 5CS7A 3C8HA 4CDEC 2JA6H 3ZIYA 2H8PB 2Y7MA 3QZWA 3NWSA 3VXRA 1RAMA 4E36A 1OP9A 4YC2B 1BBUA 1JGLL 1HQ4B 2WKLA 3B7TA 3FMGL 2ITCB 1CXFA 5GZNA 2IAMD 3VD0A 2A6ED 1ZA6B 3DX9A 4H02A 3IFPB 3GYRA 2PO6A 2YXVA 4IOFC 3IFDA 3MZ5A 4DAVA 1FH5H 3GDCA 4PRDB 2ZOLB 4N1HB 1A7QL 1ZLUH 1KELL 1RLBA 5KYYA 2RVLA 2ENSA 2SDFA 3MV7E 1MVFA 2EO9A 3NRPA 1RZFL 2FEDD 4YDLB 4JK0D 3Q1SH 2K5HA 2VN7A 3TZUA 2QEJA 4APQC 3QUMA 1DN0B 2NN6I 3G6JF 3G5XB 4XCEB 1EO8H 3L6FA 1KY7A 4XBGA 1GM5A 1D2OA 3FSWA 1L3WA 3FN9A 1N0XL 4R83A 2Y1AA 1H3WM 3KWUA 3W81A 5L4MA 4Q0XH 5LMNQ 3EO1A 4Q0FA 2FX8L 1I9IL 2F74A 1OVZA 2ZXRA 5C3XA 3L2LA 5K36G 4XMWA 1QNZL 3GIVB 4QUOA 1OOAA 3T8MA 1WBZA 5LB1A 2HTLD 4BSWB 2VLJA 1T2XA 5KUMA 1D7FA 1GMEA 1SLWA 4GIPD 2VSDA 2O93L 2CJSA 1UE5A 2XY1A 5EF2A 5EU4B 1Q0YL 3QIBA 2ED7A 4QRPB 3VR3A 1SF3A 2ED8A 4Z0BH 5JA8B 2BSRA 3DOIA 2XWTB 3S96A 3ZW3A 6FABL 4DZ8B 3C5SA 1FA4A 4YSDA 1NUGA 3LZNA 4GOPB 2ZKWA 1KB5H 3VGEA 4A67A 4JAMA 5FV2A 2NNFA 4L5FL 2F1AA 3S1MB 2VH5L 3I75B 3MQIA 2R1XA 2V7NA 5C09E 2W94A 1EU3A 4ZFGL 2BS9A 4CMHC 2B1AL 1BQHG 3VR4A 2XIBA 3IAQA 5FYLH 1TVHA 4ZXBC 1W8NA 2MFIA 1VFBB 3R2IA 1B3JA 1G9MH 1CDIA 2JJWA 3MV9A 4OKVA 4QUFA 1KXQA 4NUPA 5KNDA 3O11B 3QXTA 3DVGA 2I46A 2WV3A 3NIFE 4HUXA 5CBAB 2TRHA 1LE9A 4F9LA 1BXVA 2E0PA 4OCRL 4QJ3B 4K8RL 2QSCH 5CLXA 1P5UB 1N64H 2UXCQ 2AJUL 5I9PA 4R96A 1NFDA 2JSFA 3HRZA 5IGFA 1GHFH 1JOIA 1X3EA 4F37F 3QXAB 3RGVA 1BCPC 1IKMA 2Y3NA 4IDJH 3QI9A 3V55A 1A2TA 1K8DB 4YO0B 4CSZA 1V8QA 3S1NB 2APSA 4MXWH 2COQA 3URYA 5EH1A 1M7DA 3FU7A 4FQHB 2BERA 4NN5B 4YPGA 2BOCB 2AGJL 5PCYA 3RNUA 3MACL 4DFAA 4DP9X 4DV1L 1CKNA 1JWUB 2YD9A 5BN5A 5DD1H 1DBKH 4G6JH 3VD2A 4XPAL 1BBJB 3ARGA 5H94A 3K5SA 3QDME 3A56A 4FZEL 2E8YA 1MIUA 4CKEA 1JNLL 2AXWA 2FJGA 1YPZE 2WLJA 3MNVB 1S7TB 3QISA 2BM3A 4NJAH 4NQDD 2AV1B 4KRPD 2WBXA 3WIFA 1JZJA 2APFA 4B53A 4ZSOA 1PY4A 1T0MA 4MJJA 3JV6A 1BQLH 4HSCX 3BZKA 5I6XC 3KDFA 4UDTB 4H13C 2FO4A 3X1EA 2YAMA 5IVXA 5D3IB 3GXTA 4FL4B 1QWNA 3TJEH 1MJJA 3SYPA 3R4DA 3MCKA 3MRNA 4JV5Q 3FKIB 2KUMA 4UILL 4AQ1A 2IC2A 1X3FA 5KANI 4OO1H 3VG9C 5FX3A 1UXWB 4X6DB 5A1AA 2E7HA 3QPXL 4JREB 1QVFA 2GT9B 4PJ7A 1Y1WH 1K73C 4MKTA 2WYTA 2ERJB 3SE3C 2YZ8A 5I2XA 5IM7A 3V5DA 2BC4A 2VDMB 1RZKH 1HHIA 2PW2A 4NNXB 4OGAC 3IMBA 3NJGA 1F8TH 1KOAA 1RJZB 1WFNA 4GRLC 3V4PL 3W0WA 4Q74A 3ZT5A 1C8PA 4DGYH 3L9YA 3NCYP 3F05A 4KDVA 2PETA 3ZJAA 1TCRB 4X4ME 3WGVB 2ZX7A 4FG4A 3HLAB 2PW5A 4BXVA 5AG9A 4PGJA 4HIMA 2V2TA 4QRSB 5DRZA 4L48A 1K4CB 4EVNA 1HJPA 1J8HB 4CVXA 3TEYA 2WNWA 5BW7C 1OAZL 3NJMA 1WT5A 1I8LA 2DZEA 2WWKT 1OWRM 1I9EA 5F3HA 4FFYL 2M83A 3L3IA 1R24B 5E6IC 3C6EA 5EN2B 3PO3H 2A99A 2F8OA 2MP1A 3HNTL 3MUZ1 5EF1A 2R39A 2IANE 1MCJA 1RZPA 2M8XA 5IHUH 1QB5D 4HEDA 2QGBA 4BWWA 4NZJA 3TBWB 3LKOB 1WK0A 1AO7B 3B2UD 1WTWA 1VPOH 4M61A 2XA8L 4Q52A 2P7TB 4PJIA 3DX6B 3SKMB 1NZRA 3W39A 2NYZA 1JTPA 2OI9B 2O5YH 3C75A 1EZVX 2MOGA 3CCHB 3FTZA 1YEGH 2C3VB 5C0RH 1UYWL 2HG0A 3ILPB 4IU2B 3QNZB 4LCUB 1BP3B 3E80A 4JRXD 3IAGC 3EOAA 3FN0H 2HH0H 4X8XA 3M4OB 2EDFA 4HV8A 1XX8A 1KEML 4MQXC 4LCWA 2PMZE 3MXNA 4M7JL 4JFTA 1LO2L 3GD1C 3K74B 3UABA 1DOMA 1A1OB 1BQHB 2UU9Q 1NDMB 3O4OB 1B6DA 4LNVA 1QVCA 1TWFB 1AP2B 1O6TA 4G42A 2P3YA 4IRJA 5DEHA 4HCFA 4LE8A 4NO2B 2Y5QA 1T5WB 3ZMEA 1CU4L 4X4YB 4Z3TA 3MBWB 2GC4C 1AFVH 4K4KA 1A25A 3WMQA 4WI2A 4A55A 4CC1A 1DCZA 4XRCA 4C3IH 2JEAI 1I7ZB 2BY3A 4R7VA 4U1NA 4M43L 3SKJH 2DEXX 4NQEB 3EJRA 5IKCB 2WM0A 4DNIA 1MHHB 3L7FA 3QT2A 4GW5B 1MGSA 4KJWC 5D1QA 2AHIA 1S78D 1QI5A 4WNJA 4BK5A 5MERA 2AUJD 5J0BA 1SBSL 2CA4A 4JPKL 1NAKL 2JP1A 2OA9A 3A4AA 4MMYB 4G9FD 3BGAA 4TUOB 2K7VA 1AACA 4EN3D 1HK6A 4Z7OE 3QNYA 3X1FA 4DCQB 1H3VA 5DF0A 2ZOKB 4O02L 1AGBA 4PVMA 1SN8A 1AQDB 1U36A 4HP5A 1FYCA 4MYWB 2EYTB 4NQQA 2FL5A 3V0WH 4AKQA 4FQXA 3E8UL 1L6ZA 4B3ML 4J3OG 2L9HA 1U8MA 4GI6A 2NTTA 2NDGA 4GS7B 4JO2H 2P48B 3HE6A 4R26H 2ZTCA 1WICA 5AVUB 3VB9A 4EI5B 4RGNC 3LH9A 4BKTC 2Q7NA 4F1ZA 1QI4A 3T4AA 4CUCA 4WV1A 3VFTB 2K0RA 2IMNA 2MKWA 1O78A 2K6ZA 1JHLL 3TEUA 3GTJH 2PWGA 2AXGB 4LPYA 4ZBJA 1G6RL 4B9FA 3KDPB 4ZKBB 1DSFH 1MIEL 4H1LG 4OBRA 3QAZB 2KBGA 2ZXEB 4K5PA 4QHKI 3NOIA 3MXGA 3GM0A 4P48A 2VL6A 1PDQA 1AE6L 1EXUA 1SFDA 3KJ4B 4KJQD 3CE1A 3F12B 5B21A 4AMXA 3P54A 4QRRD 1E8WA 1O5PA 3GRBA 2WV6D 3HHRB 5CIPA 2NNAA 3WFCL 1UOLA 4P23A 3FQUA 2CDEA 1A7PL 2CH4W 3OMAB 4PG2A 5TE7L 2PP8A 2PP7A 5J9PA 4X50A 3IN0A 3UAJC 5EBCA 5M3FB 1NKOA 4Y0GA 3V6OA 1E43A 3UZEC 1WWAX 1CA6A 2C26A 1RJLA 5LHDA 3DK0A 4A75A 2ADFH 5BZZA 3K46A 1CYGA 1QFWM 2CM6A 5DO8A 4PSRA 1HH6B 2DQMA 2ENBA 1QSEE 3K2UL 1OE1A 3U2JA 1BWMA 4XVSH 4PBXA 4X3KA 1I50B 3U25A 1K2DB 1PX8A 1E9OB 2V9QA 3BAEH 1PH5A 1PS3A 1RZ8A 2JB5L 1RIVL 1NR2A 3SY0B 3WNOA 5C0DA 1OSPH 1SXNA 4FTVE 3H91A 1XGUB 4JDTH 2Y06H 4MLIA 2EEDA 1QJOA 2HHHL 1ADQL 1F77A 5AUMB 1FV1A 2KHAA 4OY9A 4UAHA 3WL9B 4KQ0A 4OFIA 4PJEE 1JYNA 4FMVA 1P7QB 4XP4L 4G80B 4XCCL 2R0WL 3OX8A 1UZGA 2Q2LA 3MVSA 1KJ2H 4YUEH 3R3OA 1X65A 5COYA 3ZKMC 1WZAA 5BPPA 5E8DH 3AROA 5AW6B 2WKGA 2I9TB 2P5EB 1OCWL 4P2OC 4DR7Q 2O61B 5GADC 3JWOH 4DGIH 5BUAA 2WJ7A 3M9BA 2Z0UA 3HZMB 1EQVA 4YIQB 1P69B 1JGEB 3LHPH 5C1MB 1HIML 1MJ7L 2K01A 4AEHH 5JW5A 4WTXA 3LXAA 1BLNA 2Y7LA 3IFNH 3LXUX 4WI5A 1OCOB 1W2BA 4ZODA 7PCYA 4DW2L 3MLTA 4Y1AD 1VKXA 2QADC 2P8MA 2CR0A 2WXPA 2QQNH 3TP5A 1EH9A 2ZIDA 1MXDA 3DUZA 3GB7A 1IHZA 4G9DB 3VCLB 4F2MB 3HCVA 3MRHA 4ODXB 1FSKB 4BWTA 1WVLA 1H8SA 1KTRL 4TF4A 3CW2C 2OSXA 2XTJB 5F21B 3PWLA 4JI6Q 1TKWB 5HGAA 1U8IA 3HHSB 5LWYL 3A21A 4QNPE 1Q3LA 3Q0AA 1YNNC 5ADPH 1H9KA 1TO4A 3BGFC 3KCPB 1VQ9A 4LPTA 3OMGA 3D05A 3DHMA 5ILTL 2JCCA 1CFQB 3LPGA 3QHFL 3RJDA 1UZ8B 1CMOA 3WFBH 5J06A 2XJLA 1G7PA 4E5XA 3J7YW 2WMPA 2LAAA 3RFZC 1J9OA 3WIIH 3UG4A 1HKLL 2FJHA 1KHIA 4GKNA 4ZO9A 3IF1A 3WGUB 4BK4A 4K9JA 4JI1L 4D0DA 5E4WC 5INDB 4UU9B 1HA5A 1Q9WA 4F7TB 4N2HA 5DEJA 1SY6A 4NN7C 3CWGA 3E6FA 5DUBA 5ALCL 4GG6A 2WLYA 1HNXQ 4WNSA 3S2AA 3IDXH 3O9WB 5DMGD 1YIJA 3BPNC 5K1VA 3IMRA 3ZKXB 5IMLB 4OZIB 2IWGA 2J43A 1PH3A 4PJHA 3FTGB 1SYSB 2Y07L 1M6OB 1WH0A 3PREA 5F44A 5B1JC 2QPFA 2IALA 3SD5A 2WFWA 1AQKH 3GSQB 4JO3H 2PYED 4X7SL 4YHYB 1E4XH 1DJXA 4DV7L 2D2CC 4W4OC 3ARUA 3HI5H 3VRJB 2VNCA 4YS4A 1HR0Q 1GOHA 5FYJD 3ZKQD 2DWEA 4K2LA 1RK1A 4LDLB 2I60H 1PMYA 1MFBL 5DR5L 2WP8J 5E99L 5IFHH 3QNFA 3IXAB 5J5EA 3OG4B 4XO4A 2CWAA 4GXVL 1U5KA 3UYPB 3CXDH 3EO0A 1HQRA 3DO3A 5D7KE 3WNMA 3EBAA 4YHOH 3LS4H 3WFHA 4WUUD 2EY1A 1U8CA 5AW0B 4P4KC 2NVXB 2QW7A 1YPZF 4A93G 2XWCA 2X1QA 2AABH 3EBGA 2B1HH 1LTID 1XL4A 2UWEB 2XG4B 1BGXH 4LRNH 4LK4A 1KB9J 5EPJA 1GIGL 1HNYA 1EY5A 1CXHA 2P8LA 5IB3B 1E6OL 5HI5C 3KUPA 3HR5B 1IM9D 4QAMB 2A73A 3AQQA 2X10A 2GJRA 3JV4A 5B3NA 4J23A 3T0EE 1UB6B 2BY2A 2NYZD 2PABA 4RFEB 3BKCH 3BEWA 4Z3JA 5F96L 1KJVA 3T2NH 5I76A 1JOKA 4B3RL 1NCAL 5B39A 3L1GA 1YN7B 3AS0A 2BNQE 4R4BA 1WS7A 2WZ5A 2YXWA 2ID0A 2ZWNA 2VDKL 4K8RC 4OR1A 4FXKC 1FAIL 3CDZB 2WBJD 1PH1A 2XX0A 3LYRA 5KVGH 1X5IA 2FGWH 2YBGA 3D8GA 3HR6A 2V4DA 1GSKA 4O58L 3A54A 1CLZH 1MJ8H 4NZRL 1C7TA 5F3FA 4Q9RH 4NUGL 1DQDH 1IKNC 4U6VH 1E8YA 3D85A 4TLSA 4NKIH 4WENB 5I8KL 2ZSVA 1IZKA 1EWCA 3LS5L 3V8CA 1QBLL 3UG5A 2YBRB 5A2BA 1PGRB 4PHZA 4IBTA 1T2QH 3J7ZC 3DIVA 3INUH 2E5LL 4BSVB 2DQUH 4AW4A 4FZ8H 4JFXB 4U6XA 5CF3A 4S1RL 4BH7B 3K0WA 4PH8A 4QHPA 1JOQA 4FYSA 2VR5A 4OT1L 3ZUNC 1OL0A 1UUNA 1XXDC 3G6JB 4DUZQ 2VWEC 4P5TB 4ZFFB 1NGYB 3K4AA 1UFGA 1H8NA 3BP7B 4XH2B 2R56L 1AOZA 3MR9B 4IZ8A 3RVWD 3GTQH 4I7AA 3WTVA 2AANA 1BREA 1HNFA 1MI2A 1FNGB 3ERXA 4NKOB 4FLHA 1ASQA 3VFSA 5IK3B 3O13A 4HSVA 2ZM6L 4A3BG 5IGGA 2EH8H 1TFPA 4NNYA 1K85A 4QHUB 1UM5H 4JB9H 2YPKA 1GUTA 3L3HA 2F54D 5J11C 5KTEL 1DE4A 2J8UA 2YWYA 1XQ4A 3QUYB 4KBPA 4MWFB 1UD3A 1L0PA 5T3XD 4GKKQ 2X2YA 1J1OL 5FJ8G 3I3DA 4A6YA 1T1XB 1EFXD 4IOSA 2F0WA 4RQQB 2VUMH 3MHZA 5EV7A 3RNKB 4G8EA 3D4GA 3DVNA 2PWHA 2B5IC 1O7SA 3QCTH 3K6SB 4W9IC 4IBVA 4Q2ZB 1U9KA 4OFDA 1DANT 1MJUH 3DUUA 3GSOA 3HOGA 4GMSL 5EBGA 3EYOB 1B88A 1VGKB 4NXMQ 2L3BA 1FH5L 4A7GA 4KROD 1ZVSB 3PGFH 4R4ND 1MCBA 2H0EA 4N3TA 5H4ZA 2O5NA 4M1CD 4C4KT 1CTNA 3TPKA 4IRSC 2NX5D 3N55A 1KYOJ 3Q1SL 5ES4B 2QF7A 3PHOA 1SLXA 1AD9A 2DKSA 3G9AB 4O1NA 1IUZA 3MA7A 1O9ZA 2J1WA 5HHXH 1TWAH 1EO8L 4ZTPH 1BOGA 2ENPA 1V54B 1G6PA 3FPPA 3EFOB 1SOXA 4ODVH 5TJWK 2AITA 2NY3D 4WAFA 2Z92A 2D73A 4P2QA 2J0TD 4E0RA 3B9KC 4C2MB 4I18A 1MVUB 3SKUD 2JLPA 5DJDA 5FO9A 3TZVA 4TYUA 3FO2B 4HLJA 3RG1C 2WP3T 2WZ0A 4HFUL 4KUCD 3T4YA 3OXRB 5BVPH 1J88A 2HAZA 3SGIA 2BP0B 2KPNA 4DKEH 4Z7OF 1BQRA 1JFHA 2OCCB 1N9WA 2WNXA 1NIFA 3BESR 4R2GC 4LFHG 5F7DA 3UMTA 3HKSA 5JOPD 3RZCA 2VAJA 1QHOA 3F7LA 4KXZH 3NFSH 4IKNA 5L2KE 5CJQH 1HCFX 2P44B 4Z0BL 1XCTB 4IS6A 1XR9A 1SAPA 3L0OA 3SK6A 1OEZW 4PW4A 2EYOA 5IWAQ 4R7NA 4U3CA 3LZFL 3F2UA 2VIRA 3GLZA 1KB5L 3KWWA 3MFFA 5KBDA 1H5BA 2EE6A 1A2YB 1JVLA 2UZYB 1Z9OA 3ITPA 5FGCE 1HX0A 1FYTA 2WLLA 1NUFA 2K6YA 3Q8EA 1TZGH 1XGTA 4WI0A 4WFHD 3BW9B 4LEOB 1JUFB 2Z9HA 4A6YH 3EROA 1E0BA 4Z7QE 1G9ML 4V2CB 3O3UN 2VC2B 3HG5A 5KN5B 3KBFA 2HJLB 3A6OA 4A3KH 1ZHBA 2IAAC 2AVGA 5C97A 1X4XA 1ENFA 3MA2B 4AIEA 3CMEA 5EMYA 1S4IA 3BAYA 4NZ8A 2QPDB 4UQCA 5AD0A 1ET5A 1N64L 3BAXA 5C9KA 1GHFL 4JFWA 1EV2E 2FWSA 3TCLB 3APNA 5JJLA 3B9EA 2HVJA 4DR4L 4IOIA 4LUZA 3VXQA 3H55A 3QUML 3TPUB 3W9DB 3LNIA 3Q8BA 3HAEG 4PI2A 3W11D 3SPHA 2P46B 4F24A 4QRUA 4RSVA 5SWSD 1URIA 4D0BA 4A3DH 3GHBH 4LL1A 4YHHQ 1LHZA 4Y16D 3DWPA 1DBKL 4G43A 3VXMD 2E2JH 2YEZB 4XXEA 5FA4B 3MTSA 2LMCB 1Z7JA 1UT1A 1B4OA 1ED3B 2BY0A 4IKIA 4RH4A 3ZVVA 1Z47A 1YZZA 1SHXA 2FZ3B 2FUTA 3GZOA 1TITA 4C56E 1RXLA 4HHWA 4U1JA 4KHVA 5CCJA 2CW0C 1BQLL 1HH9A 3QFDA 1STEA 1S3KH 1CA5A 4L4VD 1ETB1 4A3BB 1ZVNA 3JTTA 5ID1B 3SGKC 4N2EA 2WAQE 4H0LC 1QG3A 4PJEF 1WIUA 3JSSA 1B0RB 4R8WL 5GGRB 5EKKA 2XCMC 3M1BB 3FMCA 1WZKA 4LUOA 5JXEA 3D4CA 2YPLD 2OMXA 4ODUB 2DLFH 3F64A 4HXAH 4NKLA 4Z18A 2FR4A 3BVTA 4GNXB 3P0GB 3R8QA 4M1DH 2GTZB 4PRAB 1T1YA 1MXGA 3QDGE 5GJTH 5LBVA 3TCTA 2GVBA 3UGXA 4Y7MA 2AAAA 3S4SG 5HDWA 2YAQA 4Y7NH 1Y1DA 3VG9B 2BSSB 1QUPA 4NZUH 1UTDA 1AY1H 3GHEL 4K3HA 1F8TL 2PWEA 4LT7A 4NPSA 1I8IA 2NCMA 2EYRB 2MTAA 2VXSL 2AK4B 1VZIA 3CHOA 1D5XC 4RMRA 4PNYA 3PO2B 2D0HA 4XP6L 1YYLL 1U95A 2WXKA 3T0VA 4C55A 4IEFB 3IRCA 2DM3A 1GOZA 4TVPL 4X42A 2DN8A 4O42A 4JI8L 5HYSB 3EVQA 4WORA 2H32B 3L9RB 5DAUA 4QB4A 2ESVB 3B1TA 2MFNA 1DBBH 3EFFA 5I26A 3ROOA 3TTYA 2XUWA 3JV0A 1F4WH 3C6LB 3MXVH 5DQDH 2CR6A 2EIZB 3T51B 4J8QA 3EYVB 3PQYA 4XVTL 5C4XH 2WXMA 3QIUD 3H56A 5DFWH 4QNPF 4LGPB 5IB2B 3C60A 1D2BA 1M3IA 3QEQB 1ND0B 1WISA 4GKSB 5IHUL 2LLNA 3VMPA 2A6IA 4PLJD 5BRZE 1VPOL 3NQIA 1EJ8A 4UT9H 5NUCA 2QPUA 3CPLA 5I8OL 5C08E 5CGBA 2P47B 1AGEB 5IGDA 3DPBB 3D07A 5EDSA 4R90L 2KCMA 1KN4H 1O9WA 4KKPA 1YEGL 1N7MH 5HI4D 1E2VA 1GD7A 5C71A 2AXHA 3FN0L 4NRXB 1PJWA 2HH0L 3CVIH 4JFPB 2DBLL 4MTKA 4EQNA 3BRFA 3IRZA 2OXPA 2DIAA 4LL4A 5EUOA 4UOW1 3M1OA 4X6CB 1TLMA 2XN9E 3S48A 3QIAA 3O3BB 3T3PE 4OZFG 4QYOB 3EYQC 3O8XD 4ELME 2KVMA 1NCIA 1OZUA 1I3UA 3KPNB 1I1AD 2GSIA 4K3DH 2UVFA 2V8MA 2EUVA 4P4RA 2QMKA 5FPIA 2CLRA 2MCPH 4KDTC 4NDXA 5JHDD 1LDSA 1CUKA 1AFVL 1N8ZA 1DYZA 1X7SA 4UDUC 2MQ3A 4NB3A 1VQFA 5DK2A 2M2LA 3L4TA 4L8SA 1QQDB 1DONA 2ZNXA 4CGTA 1GW6A 1RURH 2BS71 2HTLC 3IDIA 4XYQA 1IAOB 1QSFA 4GAYB 4IN3A 3IGUA 2OJ1A 1V05A 4PV8B 4K5XA 1XGPA 5LAXA 1ZE3C 3GNML 1I7UB 3NBNA 3GUFA 1OT1A 3GSXA 2ZCKH 3RIAK 2Z4HA 3Q8AA 1OW0A 5GAEC 2BSCA 4D3CH 1BSIA 5K33A 4XO9A 5A3ID 5HJBA 3D69B 3QP3A 3RWEB 1FO0B 3UP1A 3V0WL 3FQNA 4QXTA 3GRGA 2YSSA 5JA9A 5HD8C 1B0GA 3AQYA 2BE5D 2QMJA 2K45A 4JO2L 5KSAD 4LLMA 1XCWA 2PI2E 4DR1L 3RBGA 4MN3A 4XWGH 4AV5A 3SBWC 4LHUD 4JHUA 5SWZA 3UDXA 3B5HA 2BNUA 2IH1B 2K04A 2XZQH 3L4VA 1GJUA 1ZGLA 4BFOA 1P7HL 2CU9A 1WFOA 4X7CC 5MENA 1EOVA 1KB3A 4G6AC 2VB3X 2O6CA 5AW9B 3VA2C 3E3QE 4DUWA 2XNAA 4H5SA 3MRJA 1DSFL 1WZLA 4P59H 4RGNB 4O9HH 2A5HA 3PG2A 1F1GA 3EH5B 4RETB 4UT6A 1SBBA 4ZW5A 2CBTA 2H7WA 3UBXI 1RULH 3M88A 3PWUB 5LNGA 3CJJA 4PP1D 4DNLA 5DMJB 3EJJX 1SM3H 4X62L 1S46A 4RGMB 5EWIH 3UYRH 1NWPA 2WLMA 3G6AA 1SJHA 5C0JB 3P9MB 2IT1A 2FNBA 1I94L 2HT3C 3Q43A 3ULUE 3TONA 4NFBA 3O41A 4HX1A 4PLNC 5DXWA 4FHKA 4JFVA 3U1QA 1WC7B 3HPLB 3ZOAA 3ZDWA 1WA0X 4LLWB 3RL1A 5C0XI 1GZPA 1PZ5B 2CBQA 3IXTB 1BMWA 3WOEA 3A22A 3CIQA 3V6ZA 2ADFL 3MFGB 4Z9KB 4ZYKB 2F08A 4Y5YC 3B8SA 1U4FA 2ZUSA 3TEZA 1M71A 1VS0A 4TRDA 3D12B 3ZYYX 1OAQL 2BNRD 3FT2B 2F0HA 3PHSA 1WI5A 1FLRH 2VLKD 4ZAKC 3RDTD 5DJXA 3JYCA 3P0YH 2B4CH 1HRJA 1FLTX 1KIPA 3FQYA 4OV6F 5IV2B 4LSVH 1BJ8A 1OSPL 3UTQA 4PZ8A 3GXDA 3BUTA 2KDYA 1P8LA 4A3JB 1H9VA 4Y19E 3S34H 3MJ7B 3T2OA 3U79A 1SRDA 2X89D 4JDTL 2Y06L 5C07D 3ZTCC 5BOPA 1CIDA 1XWVA 2R4SH 1N2RA 2R1YB 4DQAA 5TDOA 3MNZA 1QFHA 5B1KA 3NTKA 2LLGA 3NAAH 4L8DA 2ADJB 3I02A 3ND8A 2VJ8A 1MD2D 4QTHB 5BOZG 2EXDA 1ILPA 3D8MA 3FU0A 3GSRB 4KK8D 3S2DB 4PREA 3WKYA 3NT0A 1Z9PA 3S3PA 2MHAA 2HLEB 3O2DA 2WZPD 1OAUH 2F0EA 3WNIA 5DO2D 3C5JB 4FXGA 2HLFD 3LCYA 1XIWC 1QSZA 2OR8A 3JWOL 5DK0B 4ICWA 5SX4H 2CJUH 3OXSA 2ZXPA 4A3IG 4UT6H 5M5WH 3WE6A 4OZFB 3LHPL 3H6JA 1IYUA 4AEHL 2I5YL 4KKAC 2GC7C 1JP5A 3NRQA 4W6XB 4N9PA 3ZZ1A 1Y0LA 5F88A 5DURD 2Z4IA 3U1PA 1A6PA 4P2OB 2HX7A 1XF5B 3TJPA 2KENA 3PFUA 1USZA 3RX7A 1U8OB 3SB3A 1SLVA 2QQNL 5JHBA 3RGHA 4I48A 4EMZA 3LN5A 3MLZL 1PFBA 2WB1B 1U6AH 4YAQA 3K81C 5EFIA 1UQSA 4X7TB 1OT4A 2WZ6A 5E7BA 1JPST 1RJYA 1SXZA 4HH9A 1OCZB 5AALA 3GMMB 1ADWA 1TEFA 2IWFA 3AU0A 4GZYC 1W72A 4DVBB 5ADPL 4WFEE 4HDIB 4LASH 5T3ZH 3K71B 3K7UC 4HJEA 4HJJH 1YO4A 2KLTA 2FJFB 3U9PL 3LVEA 3WFBL 3QUZA 5KYWA 4JPIA 2CCVA 5LMNL 4XCYB 3S35L 4QJ5B 4ZMPA 1SMXA 1HDMA 1RZGA 3QEHB 4GQ9H 3F2DA 3KPRD 3B1UA 4GKZB 1GXEA 3BP4A 1MAKA 1PFOA 4BKLA 1KUMA 4ANVA 3UZVA 2VXTH 3E6HA 4JRLA 3U9UA 1NWOA 4LEBA 3KPSD 4O00A 1EY8A 3BZCA 1XB6A 3ASOB 1GGBH 4NCC1 4AYDC 3ZXAC 3PXLA 4ETQB 2FWOB 4JGJA 4BFIB 1LEGA 4Z7QF 3A6CL 3IDXL 4PRHE 3X13A 3NBHA 2B3RA 4F58H 5D6CB 3JWNG 3N85H 4J6RH 4AUYA 3RI5K 5GGRY 3EO9H 4HG4J 3O2DH 4DR5L 1N8RC 3HOVH 2I69A 5AKRA 5F89B 2ZAGA 1RZ7L 1AQKL 4JO3L 4KKSA 5EO0A 4IO9A 3UAFA 3VM7A 3ULVD 3LRSA 1YC8A 3ENEA 4FI7A 3HI5L 5A6LA 1S9WA 2C9VA 4R0LB 2IADA 1S78C 4UM8B 1W6KA 5I15H 2NZ1D 1Z3RA 4FFWD 1DFXA 4HAGA 3RWGA 4HKBB 1PQZA 3GKZA 2I60L 1THCA 2F7IA 1HEZB 3D0AA 1F3DH 2BHUA 4MCYB 5IFHL 4PJAA 1O7IA 1R33A 4Z7VB 4GO6B 5DI8A 5IMMA 2G3MA 3OAUL 4YHNB 5DC4B 3CXDL 4PQXA 4NRYA 2A74C 4YHOL 3CDGA 3LS4L 3SR1A 2NNRA 2BP8B 1QRNA 3VFNB 1NSNL 3S5LG 3VXPA 3CVCA 1KYAA 2PTVA 3TA3C 3RVXD 4HLZH 1RZIB 3H3BC 5MEOA 4EGVA 4XNMB 2B1HL 1IB5A 5FOBB 1BGXL 4LRNL 5IYCH 4FP5D 1W72H 4MFHA 1RI8A 4GP5B 4X9GA 3I4NB 2C3HA 5JW4M 1NCDH 4P2AA 1JPSL 2NY4B 4PRIA 1VAHA 3IMWA 2IANB 4WEEA 5EORH 3T09A 2LHAA 5CP7B 1WAAA 1YJWA 1HYRC 1NOLA 3FB8A 4QO1A 2P4AB 5IQNA 4X4XA 5BRPA 1G9MC 3IPFA 3T2NL 2ZWLT 1H9SB 3T53B 4HEMA 4I77H 3UTTA 3WJLA 3I6LE 5KVEE 1H15B 1SY6L 5GZNC 5SWQB 2GITB 3W56A 5J1AA 2PO6C 4BA8A 8PAZA 1A21A 3PUCA 2AJSH 5DDHB 4MNGE 1P2CB 1X5HA 2FGWL 4B96A 3M7OA 2MO0A 3TBTB 2UZXB 3QARA 1MJ8L 5I73B 3HG2A 4V1DA 4BD4A 4I88A 4JV5L 1OO9B 1HVXA 2K5WA 5M7QA 2OMWB 1ZK5A 1DQDL 1MCEA 1HU8A 4Q9RL 2MCMA 5DJ6A 2QEJC 4MXQC 3C5ZA 4NKIL 1K3ZA 4A3IB 4UTAA 4ZTOH 3X11A 5BR8Q 3ECUA 3PCYA 3CIAA 4NC1E 3P77B 5BS0E 4G82A 4FDBA 3INUL 3QW9A 1SNQA 4HZ1A 5K59E 3TREA 1MCRA 5LGJB 2DQUL 4FZ8L 4PJCA 4JMXA 1FFNB 2IDFA 3HG1E 2LFEA 1UGKA 5JZ7D 3H7BA 2Z1PA 3MYZA 4R5XA 3BVZA 2BP3A 5E9NA 3Q44A 4U6HA 4JO8A 3WLBA 1MCWW 5EA0H 4Y4HD 1A14H 2A6KB 1F11B 2OQJB 5GS2D 3ZE2E 4BY1B 3IJHB 4YR6A 1FDLH 2EEAA 3QIBC 2CFMA 1P6WA 4FCAA 3VI4A 4DIXA 5DHVB 2AKWB 2F0KA 3KYMA 2P5WD 4OZGA 5L4IA 3DMUA 4WIQA 2EH8L 5E4EC 1KLFB 1YQVH 2PXYA 3UBHA 4JB9L 1UWXK 3GSVA 4A2MA 3CHXA 2VZ3A 4WQOA 3MV8D 5IW6B 3D2UD 1UH4A 3DA0A 2ZUXA 4JFHD 4LLDB 3ZN6A 4GW4B 4PJ8B 2CHNA 1IGYA 2OF1A 2C4FT 2OP4H 2R2HA 5I6WA 4JC0A 3QCTL 4G3YH 4LDOB 2CO6A 3PL6A 2YA2A 4UT7H 1MJUL 3NPPA 4WEBH 3OSOA 1LTXA 3KBXA 3T3PF 5IVOA 3T71A 4ELMF 1N6QH 4HIJA 3QDAA 2UUCQ 4XN7A 4F9LC 5J13B 1MRDL 2VO8A 2E7DA 1YJDL 4X3SA 2OSYA 2BVQA 3PGFL 3F84A 5FGBA 4ANUA 1XAKA 3HRZC 4DV4L 3QULA 2R4RL 3D25A 4JCLA 4X65Q 1RLWA 5ELFA 1KTLA 4FLRA 3RGVC 1NGPH 3QI9C 2IHEA 1YEIH 1MNNA 2DTMH 5KBNC 4ENZA 2Y6TE 5HHXL 4UTAH 1CVRA 2E9BA 4ZTPL 4HOWA 4U673 1OK8A 4JK1C 2KDGA 1RY7B 2R29A 2NUPA 4ODVL 1JCKB 5F7BA 4DSYA 1WBYA 3SCMA 4JDVB 4BK8A 1PYSB 1AYRA 2W60B 3DWQA 4PVLA 3ARGC 5BVPL 4MB4A 3D33A 1VQIA 3FT4A 4DKEL 4ONHB 1KLUB 3DOSA 4ERSL 4YSQA 4JFFA 3HFMH 1AH1A 1C8CA 3UPRB 4L8CB 1CGVA 3TEXA 3S8FB 1HHVA 3L4CA 4PCKA 5B38A 2FJ2A 3S5LB 4HIQA 3IPBA 2YC1B 2N4IA 3CH1A 5KVFH 1B7YB 1BZ7A 1QEWA 4KU1A 1ZLDA 3GTGB 2WPGA 4J3WA 5E4IA 3RZWA 1C5DB 3QWOA 3UIZA 3OKEB 4A3LG 1CJYA 3FSVA 2VMCA 3KS0H 5KSUA 4AQ1C 3PP4H 1YEKL 1L0XB 5GQBA 1MUJB 2YEVB 4L05A 5T5NF 4KK9D 4NI3A 3VU1A 4BJLA 4X6FB 1CE6B 3T9WA 3LTVA 3E3XA 4A6YL 4JGNA 1F3DJ 2VDQB 1OAKH 3AS3A 4Z7WE 4E41E 4RVBA 4I0PD 3CQZB 1K9MC 1UJ3A 2B3GA 2X6CA 4NHCH 3DPDA 3H3KA 4OCWH 4HW6A 5HVWA 1U3HD 2MWCA 1WCMG 2V2XA 2XPGB 3FQTB 3MCLL 5D7JA 4WW1B 3FFCE 4F2EA 2A9MH 5CMAB 1BM7A 2GJZA 4U1MA 1PVHA 1S9XB 1A0QH 1RUML 1JPGB 4Z77A 1Z5HA 2F53A 3CHPA 3ULUF 4MMXA 3Q1EA 1Q1JH 4P46B 3BISA 5LXGL 3KEDA 1SN2A 2CK2A 3X3NA 3J7AF 4MJIE 5HYJE 2BZCA 3BN9C 3QPQD 2VW7A 4U1KB 3ME0B 4U31A 2NRDA 3O2WH 3CX5K 1WT5C 1FVDA 1I8LC 2YD2A 2YOAA 4J28A 4ONOA 4WI8A 4XMKH 2R29H 3MRCB 4FXTA 1PCXA 4MHHG 1JZ7A 3V0DA 3GHBL 1DVFD 3PGZA 1S9YB 1BO0A 3PIPA 1H3PL 2KC0A 3TDQA 1MH5B 5FO2A 4LLQB 2MQGA 1QYGH 1HWHB 4MB1A 2FBRA 1KTKE 1AZBA 3ZTNH 5IJKA 1NKGA 1SYVB 2Z31D 2Z8LA 3BZ4B 4NHUB 1FHNA 4GRWE 4H88H 5T1KD 3RFRA 5FC9A 3QWRA 2QSQA 1B4TA 3DX8B 2F0VA 1TVBA 3IJ8A 2AQ2A 4YMPA 4YDNA 3V0IA 5C6AA 1S3KL 3LNHA 1J9TA 2DY2A 3TCXA 1W0YT 2CO7B 4HJIA 3I9PA 4S1DD 1KENH 4A76A 2CKBH 1T0NA 2SEBD 2NW3B 3ARFA 4FYDA 5IFJA 1RK0A 3TBSB 1FGNH 2VITA 1XMEB 3UTZB 4K5VA 3EG9A 3N44F 4XT1B 1WD8A 3QS2A 1CICA 4WWPA 5CM1A 2BWIA 1EHLL 4RFOL 3VD5A 1NDGB 2Y23A 4HXAL 4NCC2 1HXMB 3F85A 1ZXQA 2VM4A 5GJTL 2WWMD 4JFEB 1YY9D 4IRJC 4J2QA 2VDRB 1I3QH 5FAAA 5I6KA 3GMOA 1B4JH 4NZUL 2OMZA 1XF4B 5D1XA 1AY1L 1NC2D 1IILE 2C9RA 1LEIB 2ZUQB 5AZUA 5J1SC 2CALA 3I3EA 3BO8B 3M3YB 3VWKD 3HOYG 4AJWA 2A1WL 5M5XB 1K8GA 3EH4B 3A4DA 5D1QC 4D9RE 5KSBE 2ZYHA 4MAZA 4HIEB 5C0CE 4OKDA 4BK5C 1BVSA 1SYFA 4P5RA 5IW1B 4ONGL 2NWGA 3CZSA 4U7SA 1GTNA 1M56B 2AKRB 2BVPA 3P4NB 1FL5B 3L3OB 1F4WL 3MXVL 1MAJA 4JDZB 2IBZX 4M5TA 5DQDL 3SPJA 3MRPA 3WEOA 4ELKA 3ZU8A 1J1PL 4JRYE 5KZCB 5M9OA 4NO0D 5E70A 3ILQC 4Y4FA 1LLAA 5CCHE 5IHBA 3DUSB 3K58A 3M17A 4FQXC 4ELDA 2NB0A 1QMUA 1SDDA 1ZPUA 4PM1A 1UEBA 3U9OA 5C0EB 3QSKB 5CEZD 1SOQA 1W0VA 3HE6C 3QG6A 5C6PB 3U4EA 1UXSB 2VDPB 3T4AC 3P0VH 4J1MA 5KIXA 2OTUA 4WV1C 3PABA 4BY7G 4JQXA 2D7OA 1ZJBA 3SDDB 1GYVA 2AQ1B 1VJSA 4RA3A 5ANMA 2APBA 3TWCH 2G2RB 3DWTA 2ZUTA 4NIKB 4A38A 1IVTA 3CHBD 3CVIL 4DV5Q 2ICWI 5LMNW 4AUUA 3JWOC 4GSDH 3CXCA 1YHPA 5JLZA 1T5XD 3TGXA 3OMCA 3ROLA 3HE7A 4WTWA 3HUJA 2X6MA 4K3DL 4JHZA 5DEZA 2VZOA 3ESVF 3SDCD 3MREA 2EEXA 4P23C 2BNQB 2IFFL 3OGOE 1CZGA 1EHXA 3KYHC 1Q72L 1QA9B 4PG2C 3D39D 5E8OB 5I1HH 5JMOC 1ZHNB 4IURA 1HNXL 3AREB 3L1OH 4WEUD 4WUKH 3TFKC 5I8CB 4ZMWA 4LHQB 3V6OC 5GZOA 3UC2A 2I27N 3MOBH 2Q10A 2B1OA 3ZQXA 4KZ0A 2I07B 1DQQB 1VFUA 2E56A 4S2SA 1RURL 3E9HA 1U58A 2KECA 3KS0J 3FZUD 2CUIA 1CSPA 3Q3GB 2Z4QA 1PTOB 2ED6A 1JT8A 5A6IA 4DVRH 2AEPH 4F15C 1HR0L 5HHNB 5EBLB 2ZCKL 1VFAA 1D6EA 2J21A 1C9SA 5EB9A 2KPWA 4OLWH 2JE6I 4D0CB 3RUZA 4JJ5A 3FUJA 4OFVA 2VDLH 4YGVB 3VM5A 1KFAH 2BW5A 1OF0A 3UPAA 5K9KB 2CQOA 4XPFH 4KRNA 2DNCA 5CZKA 4XWGL 4AQAA 2K03A 1GKEA 3CZFA 2XZQL 4ZFOA 4IIQA 1G6VK 3CN0A 4PB9L 1HTLD 3I4OA 5DSCA 1ZT7A 4IPHA 4KHPQ 1DUZA 1PTZA 2EYSB 2PWDA 5BMFH 2FB4H 2G9HA 3VFOB 4XPGH 2VM3A 2ZKMX 1XNQL 4O9HL 2FYVA 1NBYB 1SVZA 1KWGA 4TLKA 1JXFA 3STZB 2Z91B 1C12A 4PWGA 4Y5VC 2IPKA 1ZLEA 1JDAA 1RULL 3CV5A 2XKSA 3HRPA 1KIQA 3Q7JA 3SSGA 1EZUA 3X12A 4XMLH 4LNRB 4CVZB 3UYRL 2OBGA 2MUYA 5EWIL 1ZMYA 3KPMB 4AL8H 1G2SA 5A2AA 5FYKD 1OO2A 1JWMD 1IAIH 1YEFL 3QZPA 1VACB 4XC1H 3CGTA 5K59F 3BAIA 1CDHA 3FRUB 1P84K 5DUMH 2OMYB 3IDYC 5EBMA 4B50A 3HOYB 1XFPA 3FUMA 4PLKC 4IW4C 2GVYA 5IMOB 5FCUH 1EYAA 1G7MB 4JKMA 4L4TA 5J6GA 5EO1A 1BZQK 1KDAA 1YSOA 1ROCA 2LT9A 1YNTA 4ZYSA 2ITDA 1GRWA 3RU8L 4AIZB 5IQOA 3SCMD 2JFCA 2X2UA 5H1SE 4HZAA 3KBGA 1N3NB 3ZE2F 2YKKA 1FLRL 3BRGC 4R7DB 2K70A 1BCPF 2LV4A 2B4CL 3P0YL 4XXDA 1CFSB 3GXPA 5EU5A 2Y69B 3HOWG 4JX0A 4LSVL 4J3XA 4KITB 1CKOA 3S34L 5HGHB 1TJXA 2OJZL 4X80L 2MPMA 3TP4A 3GTPH 5FLXc 1U30A 2PPDA 3HFZB 4YNYA 2CHXA 3QC6X 1FFOB 3P30H 1O75A 4WGWB 1FC2D 4UV4H 2HKHH 3NAAL 1IE5A 3ZTEA 1JNHB 4PS4L 1CO1A 2P24B 3BDLA 4N2NA 3OKNA 3T0XA 2VE6B 4BY7B 3RVUC 1WTGT 3LX0A 4BA0A 3U0PA 3C9NB 3HJEA 1J0IA 1OAUL 4Y7OC 2PPEA 4L5FE 4LMQD 2F61A 3HN8A 2EVFA 2CJUL 3BFWA 1OTTC 1XGRB 4UT6L 1JJCB 2V6HA 5LKNA 3MLVH 1AGFB 4DP1X 2XG5B 3D9AH 4PJFA 4P75A 2LVEA 5FUCC 1AXTL 3GSNA 3MKGA 1FVCA 4FGMA 2GIXA 1IGJB 3ZBMA 4WK0B 4F3FA 1CPUA 2CO3A 5EOCH 3OWRA 3LN4A 4Q14A 3RTLA 2F53D 2WO4A 2ENQA 4LF9Q 3D18A 4Y1TA 4QF1B 3MYJA 1EWHA 1U6AL 4GW1B 3WKNA 1KYFA 2ZTBA 4PJXE 3DGGA 4MD0B 5CEYA 1MI5B 3PQIA 1SEBA 2B59A 2E3VA 3IBOA 1OV8A 2AEQH 3MV7D 3BZFB 4MAYA 4MDIA 1E28B 3IS1X 1FZKA 3PIP3 5FB8A 2AQPA 2XJKA 4HJJL 2OCFD 1XCQB 2TSAA 2VM9A 1WRFA 3FT3A 1EYGA 3VJ6A 2HLAB 1HXYD 1XTDA 1TR5A 1ZA3B 3OJVC 3ZDYB 5JDJA 3NEMA 4F5CA 4GQ9L 3HS0A 1G5AA 2VZAA 5E4OA 1T1ZA 2QPSA 4Z78B 4HSPA 2X7LB 3J27A 3UJJH 1I7RA 4EZKA 2Y3AA 3GMPA 2EDGA 3IYLW 4C56B 3I3BA 5EC2A 1ECYA 1GGBL 1CT8B 3SGDI 3LN9A 4JFOA 3S14B 1BVKB 4U7MA 2BHZA 4Z7WF 3G9VA 1NICA 2N8NA 4F58L 3ISYA 4D94A 3A67L 4J6RL 1CICD 2ICIA 3PAYA 3D6GA 1J0HA 3O2DL 1R6VA 1E4JA 1OTUC 4N85A 5DGQA 2CA3A 2R7EB 4JM2A 3STBD 3S6CA 2YUZA 4MX7B 1N59B 4CDDC 1S7RB 3EBEA 1IGMH 1UWFA 2BWQA 4YDIH 4I9XA 4TQHA 5I1JH 3GXUB 4X64L 3A4EA 1BD2B 3QDGB 5C09D 2EIFA 2FMCA 1YNKH 1WO2A 2OW6A 4Y9BA 2IGLA 3HNVH 4HWUA 4PTUA 4QJ4B 1FBIH 1PSKH 2RA1A 1PL3A 3NSJA 1FNWA 3IAYA 4HUVB 1KAAA 4PVNA 3QJRB 5J12B 3BDOA 1TJHH 4D7BA 2W07A 1JZGA 4PTTA 3S16H 4ZTEA 5I1EH 1VRSA 5JR1H 1E27A 1L5GB 5BXFB 2GJ6E 32C2B 3V4VA 4TSSA 2BE5C 4WJG3 3ZR5A 3I55A 1IW7D 1NY4A 3LB6D 1A9EA 3QFGA 3WXWH 4UQ3B 3WE1A 4JQVA 4JL1A 5K9QG 3GTOH 3BJ91 1UWGH 2OXHA 3C12A 4U1IB 3F8TA 4GRWF 4RBPK 1PKQB 1W72L 2HPOA 3NXWA 2GUOA 5K9OB 2A9BA 1Q1PA 4HK3J 2XKNA 4JI0Q 1IKLA 1ICWA 3FQWB 3MVVA 4DAYA 2DQCL 3TA3B 2YU9H 3LQZB 4YHHL 1PLFA 4QLRA 3S88H 1RUAH 4HIHB 1SN0A 3WO3B 1U8QA 3MRQA 2DWSA 1C08B 3NYKA 4M62H 4GUPB 1JXDA 1J0KA 1IBYA 1HYSC 4GEJA 5E9DE 1NGQH 5C08B 4MZ9A 1PD1A 1I3VA 1G8ZD 5E5RB 1G7QA 3TS8A 2MNWA 3TEWA 1JD7A 3PFQA 4FFVC 3NSYA 5L8LB 2PPFA 2XWXA 1HA6A 2EZ0D 4HGMA 4PMWA 2J88H 4YSSA 4W68A 5T3XH 2FT7A 3E9TA 4X9YA 4YZWA 4EIBA 3D3VB 3RWIA 1Z9SA 4LF3B 2ISDA 4ZTOL 1WTVA 5DZPA 3T3PB 2NY7H 2PO6B 1A1NB 3TN0D 4F37K 2XZZA 3U46A 1J9RA 1AZCA 1J10A 2H8PA 4RA8A 2XLLA 1FL0A 3L5IA 4QKXB 3ZZLA 4AV4A 4LMQI 2LAGB 3H9SA 5I6LA 2IW3A 2BVYA 5KSBF 4FOMA 4HALA 4PWFA 4XNZB 3OAYK 4LK1C 1HQ4A 1F42A 2ITCA 4I18C 1ZA6A 3TZVC 4NRZB 3IFPA 1G1CA 1AIZA 4UUJB 1AMXA 1HCZA 4PRDA 2ZOLA 3ARPA 1ZKOA 3I73A 2BRQA 5EA0L 1A14L 1IU1A 4EXKA 4OI9A 3F7YB 4W9FC 3RZCC 3ZTJG 5A2JH 3A55A 4BXXG 3HMWH 4TLUA 1FDLL 1DEDA 4OZHB 2JKNA 4YXKH 2XWDA 4GN3B 1DN0A 4PRPD 3H85A 1TCMA 1ICFB 2X5PA 3DDFA 1CVSC 4XCEA 3S35X 1P1ZB 1MW2A 3H2QA 4DOHE 4PJ5D 4KO7A 1H5BC 3WEBA 4BE5A 2DM2A 1A3LH 1PH9A 4L3EA 4X8GA 1W6WA 4AYBG 1AFPA 3R7QA 5I5MA 3ZYIA 4URTB 4OBSA 1ECZA 2NZHA 3GIVA 3C46A 1CR9H 4BSWA 5EOCJ 4PIBA 2OP4L 4M48H 4IK7A 3Q01A 4MJ2A 2F68X 2EDOA 4UT7L 5EU4A 1NANH 4OWXB 2V7NB 1A65A 5IP9H 4P2RB 4QRPA 1N6QL 1E30A 1QD0A 1Y1WB 3L5HA 2XWTA 4N2IA 4DZ8A 1TVHB 3OWFA 4WO4D 4X8JB 1JOOA 4F88A 5GRXG 1ROWA 1NGPL 1V3MA 3DVGB 4GFXA 2JE8A 2Y1VA 2JVUA 2X4UB 3I75A 2R93H 3VA5A 1J5IA 4OFYD 4J15A 4GN5A 2DTML 3SJVE 2DQDH 3PGCA 3EJPA 4KX9A 4ZO7A 2UUDK 4MASA 3L3JB 4LKXB 5D4IA 5HSFA 3GMQB 3I2ZA 3HRZB 3C8DA 4ZRGA 2E9GA 1SOSA 3O0LA 3O11A 5KJ7E 4DR2Q 4FI6A 5CBAA 4TNVF 4RISH 3ULAB 4JN1L 1U0QA 5DCCA 4RNRB 2D8KA 2EADA 1RTOA 1P5UA 3HFML 1VQHA 4U05A 1F2ZA 1U8HA 1YMME 4XX5A 4LIQH 3IJEB 1X5AA 3QXAA 2O6FA 4APXB 2E9WA 4NCDA 3ULSB 4NMZA 1VQBA 1JF1B 2KZ1B 3M1CA 4YO0A 5EZOH 3BUPA 1HR0W 5CFHA 5DRNB 2EDBA 4FQHA 4U1SA 3N1GC 2BOCA 2P5PA 1EZ6A 4LCYB 2YA1A 2B39A 3PP4L 1HZKA 2VR8A 5HGDB 5JXEC 1JWUA 2E7LA 4W9KC 1A6TB 2CCZA 4XMZA 3WIHA 1BBJA 1CLCA 1JF6A 1LDPH 3KVPA 4LOUC 2FO4B 3EUUA 5CU5A 4CKVX 1OAKL 3MNVA 3GRWA 3X1NA 4N0UE 1S7TA 4HGWA 3EJQA 5EJWA 5CR8A 3WG7B 3NBIA 1MCPH 2AV1A 2DQIH 4POGA 4OCWL 3CXHK 3PDOB 3KJOA 2XRSD 5I28A 3VR6A 2D03H 3N44B 1JNNH 5DVNA 1WITA 1L9NA 5AAWA 3DX7B 4ABUA 5FYKU 4UDTA 2ICCA 1QNIA 3MLWH 4KTEH 4XHJC 3CLWA 5EOQL 2YAHA 3K0YA 1I9RL 4Q9CA 1A0QL 5FLUA 1M90C 2D0FA 2DI9A 2ICES 1D7CA 1OP3K 3WD5H 2CKNA 4DN4L 2DJSA 5EIVA 3BMVA 2VERA 4JDEB 2KLRA 1UXWA 4XNUH 3S1MH 4X6DA 2I0QA 5FKAA 1MZYA 3CN2A 4J27A 2GT9A 3CQFA 2UX7A 5D2LE 3IN2A 4U3SA 2LABA 4XMKL 4EDWH 1IEHA 2R29L 4JJOA 1QILA 4LLUA 3WV0A 1PAMA 2M26A 2RF4A 1IAII 2NY0D 3CCSA 5AZ2H 1CG9B 3EDKA 3WNKA 3LZPA 3C60C 4NQVB 4AI7A 4JCWA 1G94A 1VQ7A 1BR9A 2K14A 5IOCA 3RNQB 1RJZA 1MFDH 3FF7A 2KBNA 1MKFA 3NCXA 5F9WC 3ZTNL 2F8IA 4H88L 2EYMA 1WFMA 1TCRA 3J2PA 3IRPX 3UG3A 3HLAA 3MRRB 3HN3A 3QHZH 2DJGC 4QRSA 1CSQA 3KFUA 1J8HA 4Z7NE 1KENL 3S1NH 3KWVA 1TG8A 1YJNA 3NJKA 5FW7A 3S36H 1FFRA 5F6IB 3ETBJ 1R24A 2YLKA 4PJIB 4GPVA 1C5CH 1EMTL 5EN2A 4AYBB 4YDKH 3FNKA 1PRTC 1VQAA 1A6UH 1S2EA 2DYSB 4LBEB 2BCKB 5JEAG 1NAMB 2KCNA 1X5JA 3WIHH 3X3FH 1GO3E 2K7PA 3RY4A 2DQGH 3LKOA 4A63A 4F8NA 1AO7A 4FTVD 4F93B 3GRWH 3MRBB 3K6FA 2NY1D 2R0ZH 5D4HA 3DX6A 2HRPL 3AXIA 1B4JL 3OF6A 4MS8C 3SKMA 1PLBA 2VLLB 4W4NA 3MXNB 4M8QB 4N26A 3MEHA 4A3EG 2J73A 4GLRI 4MJ4A 1ZWIA 3HEIB 3CCHA 2HJKB 1NCWH 2C3VA 3ILPA 4AH6A 2CBPA 2WNGA 3CVDA 3QNZA 4J6HA 2FX7L 4IU2A 4L8SC 4LCUA 4ADIA 5KBKA 5ISZB 4IBUA 3VYNA 3CX2A 4QGYA 3TJHD 5CZXD 5FHAH 1FL3A 2E6PA 1BQHA 1A1OA 1EYDA 1JZEA 1NDMA 2NY6C 1AP2A 2IH3B 4PJXF 1E7VA 2B4CC 2OL3B 5JDSB 1XSOA 3BVMA 2D4DA 2LTQC 5T8IA 4GXUM 1OW0C 5TDPB 4NO2A 3KW7A 1U4RA 3POHA 1T5WA 4X4YA 2Z1KA 3MBWA 2ALYB 4XTRD 5DFVC 1ZEQX 2NOYA 4YBHA 4X98B 3FB7B 2FSEB 2EXZA 1GS7A 1I7ZA 3ARDD 1T1WB 4X5QA 4YJZL 4NQEA 2FQEA 4AGPA 3OAZH 5EU6B 5IKCA 1MHHA 5DD5H 3HZ3A 2RHQB 1AGBB 4Q5VA 2BIPA 2R83A 2BZDA 4RZKA 3MV01 2YQ2A 1A66A 1N8OE 5ACLA 3W3AA 4NBXB 4NQDE 4DV3Q 4KHXL 4MMYA 1K28A 2XNAC 4TUOA 2VDNB 3F7VB 3LY6A 4M02A 5D7LB 4E9WA 1S7SA 4GQQA 3K6OA 1RSYA 4GSDL 4DCQA 3A74A 4QIWB 1AQDA 2EYTA 4N87A 1KJ2B 1N0LB 1AANA 4IPCA 1JPTH 5BO0D 1VMCA 4I65A 1S5ED 2J57A 3AMUA 5K36H 4KN7C 1I8UA 4AYFB 5KYXB 4EI5A 1C4QA 3Q8FA 7TAAA 5HDOA 3MBED 3V79C 2ZXGA 3UO1H 5F0PB 2RB8A 5I1HL 1KBGL 3GC3A 1MELA 3NSDA 3KYAA 1HNWQ 3L1OL 3VFTA 4WUKL 4OLZH 4X5RA 1SJED 4MNGB 1LWJA 1KTDB 4NP5A 1JK8B 2AXGA 3GBNL 4WWKA 2QDWA 5L8KB 3TYGL 4U4IA 3GI9H 5GRWA 4P23B 3RPKA 4XVUC 1NCVA 2MPVA 3RTQB 4NKMB 3SKNB 4X3TA 5C4JH 4ZUVB 5FLXE 4OGZA 1YRKA 2WWKO 3D4ZA 5D6DA 1XXGA 3F12A 1PBYA 3OKMB 4AOFA 2AEPL 1AZZC 1EQWA 3L3DB 4N0YL 1DYQA 1RSFA 5D7SH 1AQMA 1J1XL 1TWFH 3COOA 4DA2A 4GBXD 4OLWL 3FJTA 5FOJA 2V7HB 2B08A 5EPLA 1JD9A 2QSVA 2VDLL 4MA7H 2W92A 4TUJB 1FPTL 1KFAL 3NDYE 1J12A 3UXFA 3LKSB 1JZ4A 3N41B 1MWOA 4XPFL 3K5RA 3ZE2B 1RZ8B 3LPWA 3ARBD 4ENED 1MWAB 3WNNA 3FH7A 5D7KD 1HH6A 1E5BA 4XCNA 1BBDH 4HJ1A 2FWLB 3AT9A 5DA0B 2YRBA 3O4LE 1HINH 4ZW8A 2FBJH 1KGWA 2XN0A 3PHQB 4OM1L 5C0AB 4JI7Q 1CK0H 1K2DA 4LAJH 4XPGL 1BFVH 1ZS8B 2F3WA 3VXNB 3X1GA 4ZMYA 3BJLA 2QVIA 2QVTA 3JT0A 4R4FH 4FXGC 3SY0A 1EAJA 2D0OA 2XWJA 1WVZA 1SSOA 1IZ6A 1AZRA 1E5YA 1OWWA 2GB2A 5CC4A 2AQ3B 2X12A 3BLBA 4HC1A 4WW2A 4RG1A 4XMLL 3ZSTA 4QWWD 4RMBA 5E1FA 4HPYL 3WS6A 4EJ1C 5AUMA 2GBAA 3JT2A 4XI5D 4AL8L 3WL9A 3T0ED 4Q6KA 1XAUA 1IAIL 2J7ZA 4NJ9H 4U1HB 4TSAH 4K71B 4ERSH 4G80A 4A3EB 3VRIB 5TK2A 2BMKB 1FNLA 1SYCA 2K5QA 2UYLB 5DUML 3N40P 3KLQA 2AWOA 1V9PA 2I9TA 2P5EA 5LO7A 3BHBB 3PWPB 1VKXB 2O61A 3CFNA 3TESA 1XJVA 1M2VB 3I7FA 4YIQA 4JG5A 3HZMA 5I18L 2OMVB 1JGEA 2X44D 4QT5B 4XBPB 3MRHB 1EHAA 4XNXL 4CVWA 1ERNA 3HC4H 3D48R 4OGYH 5EUKB 5AVVB 3S37H 4K8IA 4AIOA 3KGRA 3QUZC 3ARTA 3AVEA 5HGAB 1U8IB 2H2SD 2YZ1A 5ELIA 1MNUL 5F1IB 2BSEA 3DYMA 3A7AB 3MEFA 1T7VA 2X70B 3DV4B 5GPRA 3U1SH 4FFZA 4YK4C 5A2FA 3VCLA 4G9DA 3P30L 4F2MA 4ODXA 2WKCA 4FQLL 3CHRA 2HKHL 2WOBA 4M6AA 4B3TL 3SK4A 1EBPA 4C58B 1VQMA 1TKWA 2WMPB 1P4LB 1ZY9A 3HHSA 3KGTA 3M6DA 4FF9A 1RDPD 4OCLC 4ZFOL 1YY9C 4GKNB 3K4DA 1JXJA 1P4UA 3IF1B 5ELEA 4NYLB 5BZDB 4IJ3B 1I50H 3KCPA 1LD9A 5SV4A 1IT9H 1DDHB 1CFQA 3UTSB 1QFPA 2EYFA 1UZ8A 3QRFM 2IGTA 2MMXA 2VQEL 1BJ1H 1JPFB 2K6AA 3VX0A 2XSCA 3WY3A 1YYCA 3GGWB 4HC1H 4E41B 5E1GA 1H9JA 5INDA 2W9DL 4UU9A 1OAXH 4OIBA 1V3KA 3DMMD 3IT8D 3KYOB 3VXRE 4F7TA 5BJTB 4MJHA 1NANI 1VZHA 4KNTA 2HTKD 2ZE0A 1ZSHA 4IGBD 4KWUA 4IU3B 4AE0A 4BCZA 3QUKB 3FFCB 4KY1H 5AKSA 2XQYK 3FQ2A 5JW4Q 4MTMA 4PJ9D 1JR0D 1CZWA 3LPFA 3MRGB 2BO0A 3NFNB 3O9WA 3VSUA 2EVGA 5IMLA 3DNKA 4OZIA 1J9SA 3WAKA 1YEJH 4A3DG 1CIUA 1SYSA 3FTGA 1M6OA 4H1LA 3MOQA 3QUXA 1EZVY 4LJZC 4B3VA 3IU4H 1IGIH 5I5RA 3U7WL 1TMQA 3GSQA 1DQIA 2K4AA 3FC8A 3BKMH 3TWYA 2YPVA 2WXHA 5IMKB 2YV5A 5E6UB 3VRJA 3DTXB 2JQOA 1FIEA 4CBZA 5I0VA 3WFHB 3CX5J 4JPQA 2NXZC 3JQOB 15C8H 2W65B 1Z9LA 4LP8A 2Z34A 3Q2WA 4N2AA 4DTGH 3VYRA 3UYPA 4FFZH 3UJJL 5IY5B 2VXQH 4PJBF 2VLJE 3CLEH 1T5KA 2GY7B 4KY7A 3WJLC 2XBZA 4NIYE 4Z7IA 5JPNB 4MDRA 5L2JB 2A73B 1J5EQ 3QG1A 4ORGB 1N4XL 5FUOL 3SDCC 2GCYB 2H3NA 3P4LA 5DEGB 4YWGL 2JXMA 5CMDA 4LHJB 4PR5B 5ICZB 3ELQA 4QTIH 2KLSA 2UWEA 4XBMA 3MLRH 1SDFA 4MA1C 2PN5A 3ARQA 4N2KA 4NB7A 3V05A 3HR5A 4L18A 5EEXA 4GFTB 2HT2D 3TVMD 3C5ZC 1IGML 1R4PB 4YDIL 2RDFA 1FH2A 5I1JL 4JUTA 4MTNA 1UB6A 2ZX9A 3ARVA 3HC2A 4J3OH 1MEXL 4RFEA 4Y4KD 5T1LD 3MV9E 3GSNL 3ECQA 4DP4X 3K5OA 4JZOB 2UVEA 2DRUA 3SKOB 1FBIL 1PSKL 2MNUA 4ZUUB 3L3KA 3IS0X 4PI0A 3O6LL 5D2LF 5HHQB 2ROXA 5FFLA 5B8CB 5JQHC 2EDYA 4A3GG 2EZVA 5BRQA 1E4KA 1SXBA 4IHOB 4PB0L 1CBJA 1N32Q 3GXIA 3FN3A 1KN2H 4S10A 5I1EL 1NFDE 5JR1L 2UXBL 4HWBA 1U3YA 5AJ3L 2B8FA 4TVPE 5C0CB 5DHXB 4H1LH 2E9JA 4F9PA 3WXWL 5DLML 3NMEA 2K1MA 2KZBA 2YBRA 5E5LA 1Q1EA 2YPVH 1UD5A 3ZRCC 2PXYC 1CGSH 2JLLA 3M8OH 1AHWB 3DLLA 2RFXB 4JFXA 4N0CD 2JJTA 1OE2A 4F20A 2YRLA 4Z7NF 2NXYD 3S88L 3GINA 2ZG2A 3K6DA 4BH7A 3BZEB 1DUYB 1ZSDB 3O6FB 4P5TA 4YX2H 1T83A 3DJRA 3G6JA 1NLBL 1DZ1A 1QW9A 1NGYA 4LSUH 4F7MA 4XH2A 4ZFFA 4QF4A 1OB1B 4M7LH 1NGQL 2V3FA 3MR9A 3OJMB 4I3SH 3PL6C 1VQGA 2J8UB 3JC66 3N6RA 1KG0B 3MJ9A 4ZSOE 1BUVT 1FNGA 4NKOA 3KXFB 3OKDB 2YN3A 3L5WB 2E2HB 4L4JA 3QEGH 5IK3A 5FGBC 3QORB 1F4YL 2J88L 1Q0XH 1DQMH 2NTFB 5KGUA 4QHUA 1N70A 3MNDA 3DVNB 1SRUA 1AS8A 4PMFA 5CN2A 4JZNB 3PDGA 4L5QA 1GKHA 1YNLH 1IX2A 1QNUA 3QUYA 4BDVA 2ZOTA 2CQAA 2GFBB 3FYIB 1T1XA 1J8RA 4HCSA 4RQQA 4PJ7E 2WXRA 1D2PA 1XVSA 1MAMH 4B97A 4KJYB 5IVZB 2PYEE 2DGYA 1OM3H 5GJSL 4N5ED 3SCMC 3K6SA 4Q2ZA 4AEIL 2D7QA 2EXTA 2PWFA 2WIIB 2ZKHL 2A6HD 5L6YH 3AWGA 5EEWA 2VMDA 2DEYX 3US9A 4A7TA 1RODA 4DV2L 4OQTL 1VQ6A 3WFDL 5KS9E 2CHDA 4A3DB 5B7EA 1PV4A 1E2WA 4KKNA 4I18B 4HWBH 3BD3A 3MMEA 3V4VL 2OLDA 4YXKL 4L2LA 5E51A 4HJUA 1QLRB 1EAOA 2HUHA 4WUUE 4F91B 1BJ1J 5F7DB 5IBLD 3EFOA 3EBIA 1Z6JT 3CHQA 2DAVA 3L4XA 3GSUB 1LL1A 1PDKB 1A3LL 4NUQA 4B0MM 2FHBA 1F4XH 5CU9A 1G87A 1A3VA 3N0AA 3GSWB 3I4MG 1MVUA 3A5VA 3U6XA 2XBTA 5AW7B 3IJYB 2O4EA 4BQ6A 1XR9B 3GK8H 1TR7A 3CFCH 1CR9L 2K5DA 2ZKXA 1OGAB 2BP0A 3HN5A 3OXRA 4OJFH 1HOEA 1BKBA 3MFFB 5E23A 1UJ3C 4IALA 3ZDZE 5LDSA 4E42B 4GMTH 4XMPH 1PPIA 4NBYB 5BRZD 5IOPB 4NQUA 1XCTA 3FUFA 5D7JC 1OTSC 2O5JC 1D9KB 1OOWA 3MJ9H 1DN2A 4GLVB 2NQ3A 1I8MB 2A69C 1GYWA 1FL6B 4L0PB 1MRFH 2H1XA 2F19H 4Q9QH 1T66D 1AQ8A 2QL1A 2R0KH 5D70H 5SX5K 1A2YA 4L9LA 1MPAH 1NTGA 2UZYA 4DV5L 4MMXC 5DLQE 1QR1A 2H2PC 3ICEA 2DQDL 5F7WC 3M07A 2JJUA 5KG9A 3BW9A 4KKCD 2IQ9H 4LEOA 1O7ZA 3NHHA 1JUFA 5IHHA 2GEEA 4TUUA 1P7QD 3CMOL 2XN9D 2JCWA 4W70A 5TQ0H 4L5TA 2YWZA 1TJIH 4I2XB 5E1QA 5HDBE 5KN5A 4KLKA 2HJLA 3BMWA 3F7QA 1XSKA 1CCZA 2XT1B 4N20A 4RISL 3AW5A 3OB0H 4XVJH 3WTXA 5I1LB 5CLWA 3QIWB 4LF6L 1KYUA 2ADIB 2F3IA 4YSPA 5DEFB 4E9LA 4A3GB 3BWUF 3UE1A 5IJKC 4YOKA 5E1HB 4L37B 5E0FA 5BQ7B 4LIQL 4QRUB 3NJIA 2WXLA 2Q1EA 3QJFB 3TCLA 5FECA 3DC0A 1G6ZA 5D1QE 5KOMC 3HPJB 5GS3A 1AIFA 4S0SD 4K3EH 5KBLA 4A3FH 1R1CA 1JVKA 1UH2A 2HFGH 3LPOA 3TPUA 3W9DA 4I3RH 5J57B 4QOKA 3ARFC 5F93C 1XPUA 5ADOH 3OM3B 4AH2B 2F0IA 2OT2A 1FZMB 1U8NA 1CICC 2VMFA 2PP9A 3TTSA 4C2MH 1LDPL 4KHZA 1WZMA 4P07A 5D71H 2G2PA 4FE9A 5FA4A 5E7NA 1MCKA 1ED3A 2E6JA 1L4IA 1R5WA 3STBC 2WLIB 2ZTEA 2FZ3A 1MCPL 5CUSH 1B70B 2AJZB 2OMXB 5I23A 1JNNL 5D1XC 4C4KO 2LOEA 3MLWL 1MFCH 4KTEL 4FLSA 5ID1A 5EPMA 4KHPL 4A93H 4Z7UB 4MNQA 1K3RA 1A4JB 1B0RA 3CDYA 4PYGA 5GGRA 3M1BA 1A6XA 3A0JA 5FWQA 4Z6AT 1BZ8A 3AJ7A 3SE9H 4ODUA 1VMPA 4JFZL 4B7LA 4HD5A 4GNXA 2GTZA 4PRAA 4S1QH 4EDWL 3HZYB 4QTFA 1I3GH 3J81c 2UXVA 2VC2H 2WP3O 4Y4FC 5AZ2L 3BH9B 2BZ7A 2WYIA 3GEFA 2BSSA 2DL2A 3V5HB 3KF6B 4RZCB 1IBLQ 2CQVA 2EYRA 5JW3H 4F33B 2AK4A 3ULUD 2KEDA 4LF7L 1T9HA 2VL4A 4ATWA 1L0QA 4IEFA 2PW7A 4XXWC 4DP5X 5HYSA 4M93B 4FA8A 2WINB 1V3LA 4LFBQ 1XO8A 2H32A 2W95A 3L9RA 3OG6B 3QHZL 3O3EB 4MBOA 4HHGA 3QRLA 1WA1X 5JOPE 1EX0A 2X4QB 1E0OB 2F1MA 4YSRA 1DBJH 2E8ZA 3C6LA 4AGNA 2EIZA 5GISH 1Z6HA 1RQ5A 2XTSA 3EYVA 2A0LC 3S36L 4WLCA 2CDFB 2C35B 1C5CL 1B9NA 4JYAL 4OF7A 4YDKL 3I4MB 5IB2A 2LXJA 1A6UL 3NZHL 1CGUA 3DXAB 3QEQA 1ND0A 4GKSA 3WIHL 3E0EA 1LJMA 3OMZA 3BQUD 3X3FL 5EEVA 3HE7C 2DQGL 3WTSA 1ZCRA 5EEYA 1VQNA 1RU9H 4AL8C 4Y19D 3NZ8B 2B0SL 3O45B 3GRWL 4WVRA 1AR1D 1IM3B 1NMCB 2R0ZL 3NIDE 1W3SA 3D4WA 5DQ9A 1X6OA 4GSUA 2DWXA 1AGEA 1GSMA 1UOVA 2XWRA 1E6JH 3DPBA 4TUKL 1SYBA 2VNUD 2ZP9A 1WZ1L 5DJCA 1VQJA 4G7QB 1NCWL 1QUNB 5GZOC 4Q4IA 4XB3A 1Q9OB 4JFPA 2ZJPA 5H37H 1YDPB 4MKMA 1MCDA 5IGXH 3TEHB 3PF5A 2IOIA 4FG0A 1QP1A 4G5AA 5FHAL 4LSRH 4X6CA 2UUBQ 3QC5X 1H9MA 1TYJA 3F6IA 3O3BA 4HQQH 4QYOA 5FJ8H 1C1EH 5DK2B 5HXMA 1PMRA 1WG3A 5EIIG 4L8SB 4XN8A 1WBXA 1D6EC 3C09B 3PSIA 1ILUA 5IT2L 2VDML 1HQMC 1J5OL 5CV5A 3QDJB 1JFQH 5I0XA 4JRFA 4RGTA 3B43A 1MHCA 1WIOA 2CJ3A 3VWJB 5F3BB 2EIMB 2DM7A 3H3VH 3VQ1C 5DD5L 4NW2A 1QQDA 5I74B 4X6AH 2H1PL 5FHBH 2CHBD 4IIQC 1S5BD 1USQA 1LLRD 2ZP8A 3CSYB 1IAOA 1N34L 2A3TA 3EOTH 2H32H 3KM1A 4GAYA 1JS4A 2YSSB 2Z0BA 4XNDA 4PV8A 3RPIA 1WFIA 1KLGB 3DECA 4I0KA 4KNUA 3BPOC 1I7UA 4JL2A 1JF5A 2EE3A 3HZKB 3OW2A 5KANG 1G84A 4YEFA 2JCCE 3OWEB 4WFED 3FQXB 3S3SA 4DP8X 2IQAB 3D69A 3CBKB 1F6LL 1FO0A 4WO4C 3RWEA 2DYPD 2KYIA 2X2HA 3BCFA 3NDZE 2G75B 2F18A 4ZUWB 1A5FH 3OPZH 2GSMB 1CF8H 2NVYH 4UP9A 1AP0A 3PIOA 2YPLE 5INCB 4J3TA 1NGXB 4RMQA 1LEKB 4TTDD 1NDTA 5HYFA 2A9AA 1VQLA 4PAZA 1BVLB 4OJCA 2IH1A 3ER0A 3MRKB 3UO1L 9PCYA 5M5WB 1RPUA 3GXFA 3DIFB 4POZD 4GG6E 2QSTA 4OLZL 4YBLC 1ONLA 1OIOA 2EO7A 5A2KH 1TQSA 5GS0H 1KC8C 1D5BB 4PRHD 1THAA 2AJVL 2Y72A 3OKKB 4FEMA 4PJHE 4QRFA 5DU7A 3G6AB 4B3EA 2R9HD 3OQRA 4HX1B 4J6IA 2A7BA 2CRYA 2FCBA 2HZHA 1R3IH 3APFA 4UOQA 3WEMA 4V11A 3RL1B 5TK4A 3PWUA 1NFDF 2ORBH 1QVGA 1JGUH 2N88A 5D7IB 5FUCE 4DF9A 2XZAH 4RGMA 3TO4B 4TTGA 4UM9D 4F8OA 4UB0H 3P9MA 5B1CA 2OCJA 4UF7C 4DKAA 1RIHL 1T2JA 4IBSA 4IJLA 2NLJB 3HPLA 2C7UA 4LLWA 3IXTA 1PZ5A 1X3QA 1V10A 2BS8A 3HFFA 4N25A 1Q81C 3RWDA 4TULH 4IOFD 3UIYA 3MFGA 1ITBB 4M8UA 1XYIA 1G9NH 1OD7A 2EDKA 1BBDL 1HINL 1B53A 1NBZB 2ATKB 2FBJL 2RCSH 2X4OB 3MODH 2IGFH 3O3DB 4JZJB 5DFTA 3UJIH 4UQAA 1CK0L 1E3FA 1Z3GH 5I1CL 1BFVL 3FT2A 4PGDB 5J89A 2W80C 4APQD 1A22B 2DJFC 3TNMB 5FIEA 3HAEH 4OD2B 1DZ0A 4M8RA 1A62A 5C0BD 5MI0C 4JI0L 3ZRFC 5IV2A 4GAJH 2HFEB 1FO0H 3EYSH 2CK0H 3MJ7A 2OR9L 4MDJB 4NAJA 3SPVA 1YNXA 3VQLA 1G43A 2BVEA 2R1YA 4EVOA 2Y7SA 2B2UA 3A23A 4P99A 4EI0A 2ADJA 4QTHA 2RBLA 3VQMA 3FCSB 3G6DH 3WHE0 1KTBA 3RDJA 4PJ7F 3I6LD 4Y5XB 2RHSB 1ZYRC 3WE6B 3MUUA 1PD6A 1TXKA 2QFPA 3Q05A 4G4KA 1GHKA 3ZQ9A 2WTPA 3TLRA 3CKIB 2EUXA 8CGTA 3C5JA 5DK0A 1K8OA 1T7XA 2R69A 3SJVB 2CUHA 4ZW6A 2K5VA 3VVVA 3STLB 4DPRA 1JGDB 1VDGA 1X9NA 1X55A 3PXJA 4OZFA 1EDQA 4UCFA 5KS9F 4I48B 1GCYA 4H8PA 5EIIB 3HC4L 2ENJA 4X99B 1UQSB 3S37L 4H7BA 5BS0D 4ZOCA 1XF5A 1JRHI 2DBJA 1RJYB 4ODWB 5ELCA 4ZXBD 4XX1E 1NCUA 1ZPLA 3U1SL 3HS0C 5CJOH 3RLSA 1IBMQ 3HG1D 4ANXA 1NUNB 3H8NA 1HEHC 2WB1A 3NACL 3GLEA 4Q7DA 2VRQA 3U2IA 3VX1A 4B60A 4OB5H 4JPIB 1HZLA 4LCCB 1KCWA 1IEBB 3V95A 1HDMB 3GMMA 4DR3L 1BCPD 3SGJA 4DVBA 3K71A 4MS6A 3BP4B 4HDIA 1N19A 3L9BA 3ZDZF 1KL9A 3EDJA 3UZVB 1IT9L 4DU9A 2EYJA 2FJFA 1NM9A 2LW3A 1NJ9B 3FB6B 2DQ6A 1D5ZB 4PJBB 3U9UB 4K23H 3KM2A 4JM2C 1DXMA 4QKTA 3G5ZB 4RKLA 4XCYA 2EECA 3QDMA 2PPAA 1C48A 1RZJH 1L9SA 1LEGB 5EQ0A 3QEHA 4NC0B 1WTLA 4KKBC 4GKZA 4XNYH 4IK6A 3DHPA 4J3VA 1W8OA 2EXYC 3VDCA 2K3TA 5IQLA 3VO0A 3V0AC 1LMKA 4ETQA 1WJJA 4KY1L 4YPJA 2FWOA 2VN3A 4PFEA 3CZNA 1DO5A 5AVRB 4TSBH 2IADB 2D3NA 2IAMB 1HJBC 5D6CA 1XZWA 2AJ3B 5HDBF 3S2DH 4K0KQ 1JXGA 1YEJL 2CXGA 3ZDXE 4BFRA 1IL8A 5DNFA 3ZUCA 1Y1UA 5F89A 3IU4L 3EQLC 1IGIL 2M2DA 5TPWH 4UMSA 2HQLA 3AMLA 4AIMA 4AUJA 3BKML 5J4MA 4JQVC 2R69H 5D2LB 3N1MC 1I1RA 1VCIA 4R0LA 4OZFH 6PCYA 4UM8A 2NTSA 1S7WB 4XPBL 3CDGB 1KY6A 4HKBA 2KQ3A 15C8L 5AFWA 1U8PB 2KT6A 3KVQA 5ERWB 1HEZA 4MCYA 1CB4A 1DQLL 2VLKE 4LVHC 1WV7T 1OSZB 4LPCA 4DTGL 4YHNA 4FFZL 4CN1A 4ALAH 4HLEA 4N1CA 4OGAD 3CLEL 2ESVD 2ZP0T 4GRLD 4N2MA 3VFNA 2EKSB 3SPGA 5F6HI 1YEHH 1PYWD 3D06A 1MKHA 5D9SB 1IQWH 1RZIA 3FB8B 4TQEH 4XNMA 1ZLVK 4X4XB 1OCRB 2HCZX 1T04B 3RJOA 4QTIL 5FOBA 5A16A 3L5XH 1IAKB 3MLRL 2DQEH 3UTTB 2F52A 4H25B 3VXSD 2BK8A 1I4RA 2TSSA 2W38A 5CZVH 2FQDA 4W81A 5IG7B 4IUPA 5ENWB 2IANA 4CU8A 5IYBG 4OF0A 3UC0H 1FYTE 5CP7A 1R4XA 4OIKA 1NR4A 1M4KA 1SXAA 4G8GD 4NX0A 1H9SA 1GTFA 1N33Q 2WN2A 3QGVA 4TNGA 4F8PA 3I50L 1NMBH 2N0KA 4YC2C 2PYKA 1YEEH 1H15A 5SWQA 4Z1PA 2GITA 2BRRL 4QIRA 4YXLH 1JI1A 1PAZA 5DDHA 2X6AA 1P2CA 5DJ2B 1XR8A 3TBTA 2UZXA 5E56A 3N40F 1PU0A 2E76C 4B5ZA 1F4HA 2EICA 2OMWA 2QQLH 1YHAA 2K05A 1UVQB 4QXUH 4YDLC 1X3PA 3RI5F 1LTAD 2WXQA 4KOCA 3R8BB 4YWLA 2VZTA 1PG7H 2YPVL 5HGBB 4MZRA 2MGSA 4MJID 4WDIB 3M8OL 4MQXD 2EJGC 4PGBB 5HYJD 2LKVA 3BVNB 1N5YH 3ESMA 1JL8A 3EJYC 1FFNA 1ZHLB 2GJJA 1U8LB 3HC0A 3L9AX 1VCAA 1GMIA 4YX2L 1DVYA 1SFOH 4MQ7B 4Y2OA 2VMJA 4IBQA 2HVKB 4LU5H 4NDMB 4M7LL 4JI5Q 1NE3A 4RGOH 4LFAQ 1F11A 2A6KA 2OQJA 3BH8B 1VLXA 3IJHA 3NPSB 3KPRE 1PH6A 2D2OA 2ZXCA 1VQPA 4M7ZB 5DHVA 4NQDB 4JW3A 4KRPB 4OVVA 3QEGL 4KJWD 4FG6C 1KLFA 4DGZA 3NIDF 3T8XB 4MB5A 4GOPC 4GKOA 3F83A 4KI1A 1MFEH 2DIJA 3PIO3 1GC1H 2J4WL 2V33A 3OHXB 3FSOA 4KUZH 5IW6A 1DDTA 3QE5A 4UOZA 4XO3A 4LLDA 4GW4A 1NKRA 4LFCL 4NWTH 3CSGA 2ZUUA 4PJ8A 1XBDA 5DYOB 1OM3L 3GLDA 4G11A 2CIIB 1JRHL 2FO8A 5IT9c 1G0YR 1U4LA 1V3JA 4ZS7H 4YXHH 5L6YL 4WFN3 3FCGA 3L81A 2Q76B 3CC2A 4RGND 1UATA 2UUAL 3BVVA 1SNCA 1P5UC 3TZDA 4HIOA 1ZEAH 3EGDA 3FFOA 5CILL 1SHMA 1MJEA 2DIEA 1OK0A 2WC7A 4HWBL 4ZPVB 5ICYB 1U42A 3IKKA 2F4VQ 1F9PA 4D9RD 3IL8A 4DEWA 4GG8B 4Z23A 1BYNA 4A3IH 3EYUH 4P3CL 1XMWA 2Q3ZA 3ZHLA 4U7KA 4NN5C 1JCKA 3D34A 3V0VB 1D3CA 1JHTB 4JDVA 5KYLA 3S1QB 2XRQD 2KMWA 3CH1B 4OJYA 1EFQA 1QPXA 3K80A 4JRYD 1UB5B 2E7LC 1XH2A 2W60A 1QEWB 1U21A 3T1WA 3GK8L 1UCTA 3CFCL 2CKBB 2YAPA 2ZF9A 4OJFL 4WZ9A 3RA7H 4ONHA 1KLUA 3ELAT 3NJJA 2JCCF 3G5YB 5KSUB 4R5VA 3EADA 5ABDE 3UPRA 5BV7H 2VXUL 4L8CA 3UAJD 1Y1VG 3QQ4B 5KVDL 4BIKA 4XMPL 4LAQH 3S5LA 1QSEA 3KPOB 2QEXA 2YC1A 2YD8A 2CSPA 3BZDB 2ATAA 3MJ9L 2QVFB 4XMUA 5DHVH 5AAWC 5CCGE 5DUPH 4YDVB 1CBVL 4DV3L 1QFOA 1C5DA 4Q9QL 3OKEA 3VDYA 4FL4C 3J81E 1UJ3B 1UUSA 5D70L 1YG9A 2EEFA 1WTPA 1L0XA 4GG6F 1I7TB 3T2QA 4MNOA 4OSUL 4PMCA 2DQJH 4JRXB 5D7JB 5FKAC 2OFQA 4AWJC 1CE6A 4JREC 3A6BL 1UM4H 1TZ8A 2LGNA 3BYTB 4PJHF 2ERJC 1IC1A 1I1FB 1TZOA 3PWVB 5TQ0L 1MFVA 2B8OT 1EIBA 1TJIL 4BFJA 4MMXB 3NENA 2BDNL 3P73B 3VFWA 5EOTB 1S8DB 1CD0A 2XPGA 1OY3B 3FQTA 1HNWL 1HHJB 1NIDA 5CMAA 1OP5H 4AKPA 1S9XA 3DBSA 3JWNH 2H1LM 1JPGA 4DH2A 2WLKA 4NKDB 3TC9A 3ZKMD 4P46A 4FYRA 4K3EL 1PZBA 3OC5A 2EDTA 1QSFE 4KI0A 5H4YA 5J1TC 4U1KA 5JQ6H 3ME0A 4P2OD 4J5VA 3UAAA 5BZXA 3DVIA 3LPPA 3CUPB 4YE4H 3MRCA 1UUPA 2ATWA 2E27H 4BFBD 3NIGF 5CGKA 2X9ZA 1XD1A 1OHZA 3JV5A 4G9FB 4EN3B 3KF8B 3CCJA 5D71L 2YTVA 3HGBA 1MH5A 4Q8BA 2VLME 4GIAA 4LLQA 4XN4A 5LLIC 1W8EA 3CCMA 1Q12A 1A7RH 1A0IA 2G0KA 4NPJA 1LP9E 1SYVA 3TT1L 1O80A 2J20A 3BZ4A 3PHAA 2GQHA 2VITB 4JFHE 3W1BA 2NR6A 12E8H 3DX8A 4OIIH 5SWZE 4PD4K 3TRZA 5ETUB 2OI9C 4X7EC 4B9KC 1MFCL 1BV8A 2CIKA 4KVNH 5AOIA 2CO7A 2YD6A 1FYHB 2RDHA 1GOFA 3P9LB 3V4LA 4JI7L 2NW3A 3VXUD 5L37A 1PZ2A <