4PQXA

Crystal structure of a nigd-like protein (baccac_02139) from bacteroides caccae atcc 43185 at 2.39 a resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
210
structure length
201
Chain Sequence
SRSLVISTINQISEDSKEFYFTLDNGKTMFPSNSQAWGGEKFENGQRAFVIFNELEQPVNGYDYNIQVRDITKVLTKEIVTMDDEENTEEKIGDDKINATYMWISKDKKYLTIEFQYYSTHSEDKKHFLNLVINNKDNTDDEYINLEFRHNSERDSPDHLGEGYVSFKLDKIEEQIEGKKGLNIRVRTLYDGIKNYKVQFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Crystal structure of a hypothetical protein (BACCAC_02139) from Bacteroides caccae ATCC 43185 at 2.39 A resolution (CASP Target)
rcsb
source organism Bacteroides caccae
molecule tags Structural genomics, unknown function
total genus 55
structure length 201
sequence length 210
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12667 NigD_N NigD-like N-terminal OB domain
A PF17415 NigD_C NigD-like C-terminal beta sandwich domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.500 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4pqxA01
2.60.40.2370 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4pqxA02
3K0YA 3K6OA 4J8QA 3NQIA 3QWNA 4PQXA
chains in the Genus database with same CATH superfamily
1ID5I 4OJDH 4RRPG 2LLNA 4NPJA 3QUKA 4JFED 3KBXA 3HNVL 2BVPA 43CAB 3UROR 3NBIA 3DPDA 1RIPA 2L7UA 5IT2L 4U7MA 1AW7A 1S7TB 1JG9A 4QHNA 2FJGA 3Q0HA 3KG5A 4DUZL 1T7VA 1AD9A 4JZOB 3HCVB 5C0CA 5AL8A 3CPUA 2ITDA 5T3XE 3PGZA 3DGGB 4R8NA 1K4CB 1Q72L 2O30A 3HG3A 5IB2B 3LKOB 4XNYL 3RRQA 1GUSA 4JFFD 5CV4A 1YMHA 4TUJA 1SXBA 4KFMA 3U9PL 3CZNA 4G7HC 1H9SB 3L4VA 5ITFB 4GKZA 3CK0H 4DGVH 5FFLA 2X4RB 3EYOB 3LVEA 2IDQA 3I4MB 5E9DE 2ADFL 4QWWD 3FF7A 4RGMB 1DQIA 1C5BL 4JVUA 4A3MH 4KOBA 1PH8A 1BZQK 4JY6B 3BVGA 4XXWC 4E9QA 1P5UB 1NKOA 1CLYH 1RK1B 4A3DG 1E4XL 2B5IC 2AJXL 5KAQF 4B9WA 3GTNA 1YUHB 4IK6A 4EI5D 1SYVA 1Y07A 4Z7QB 4Q6KA 2TSAA 1RUAL 5H1SE 1VGKA 3BXNA 3GK8L 2BX5A 4S1RH 3RYMA 4DV3Q 2G5DA 1MWAB 3E3QC 1FNAA 1UKTA 3OPZL 3OTOQ 1OALA 4KHXL 2CIKA 1E4KA 1LWJA 2VLKB 3F7RA 3ZDZF 3Q3GA 5J3HD 4Y52H 1IIIA 1TJXA 2UXGA 4YXLH 1B0IA 5DJZB 2EQSA 3JAMc 5ALCL 4ZW6A 5C3IA 4BHUI 4LBEA 5ECJE 4X8JB 4OGYH 2K52A 4Q5VA 1JF1A 3ATDA 2L0CA 1YEGH 3MBXH 3PGDB 3QZWB 4QRTB 3SBWA 2TRHA 1H15B 3S3JA 4NOBA 5LWYH 5I2YA 2BJMH 3U36A 3F8TA 2L7QA 2EYHA 4IOAA 4R0LC 3UE0A 2UU9L 2ASBA 1EDYA 1YEWA 2VISA 3TT1H 3V6OA 2FIRT 4P0DA 1F3DH 3AU7A 3O3AA 4K94C 3KYHC 4AXWA 3OGCB 2RQ8A 2C9UA 3KS0J 2RACA 3QEHB 4P07A 5GJTH 1QNIA 5IB5B 2EUZA 4AK1A 4FFVC 5EU3A 3WIFB 2YAHA 5C5MA 4MRBA 2CCVA 2ZIDA 1K28A 1RZIB 5CINL 2WQVA 1ZGLM 2R92G 1MWAH 1C12A 1R33A 1GYAA 4XN9A 1ENCA 3IDIB 5TH2B 2FHTA 2J55A 3G6JF 4ABVA 3NDZE 3ILEA 1HJCA 5BVPL 2ZWNA 1RU9L 2XU9A 2XWTB 4QAMB 5KSAC 2J6EA 1WISA 3J81L 3A6CL 2W07A 3O6FA 4XMKL 3U6RA 4D9RE 2AFNA 4L23A 2JLLA 4D0DB 1CYGA 3IMRA 2X6BA 4QUFA 5CBEB 5GZND 2HVJA 4BA1I 2Y1AA 4U1GB 3QUMB 5EC2B 4RRPM 2YMXL 3TBBA 1X6NA 5C09B 3RU8H 4LSUH 4F57H 3B7YA 1B3QA 5AYUH 2D0FA 2WYIA 2XWRA 3GXFA 4GW4B 3U0WL 3KDMA 5HYQA 4A3CG 4ZUUB 3OR7B 3O8XC 1HR0Q 1SBSH 2FJUB 3APCA 1IM3A 1ZT1B 3MRLA 4BY1B 4MMXB 5B4MD 2YC1B 5J6HA 4N25A 3UBXA 1F58L 1GM5A 4EKJA 3DXAD 3EOAB 2KLSA 3KL3A 2B9BA 2H3KA 4YE4H 5G55A 3EGDB 3IFPB 3KPQB 4P4KC 5BVJA 1CF8H 2CWRA 4YSDA 3JTSA 4JE0A 3S0PA 5I6OA 4CKQA 3RGHA 2E9BA 4FKEA 4PRIE 5T1GA 3ZMNA 2DBJA 4E9SA 4BUGA 4PJXB 4WEBL 1EQQA 4JVWA 3S97C 5CGTA 4URKA 1CIDA 2FQEA 3BH8A 5I28A 2V5RA 1KC5H 2G3XA 4FQQA 1T22A 4I13B 4OZ4A 3V6ZA 3RVUC 2NY4B 4OI8A 4GINA 3VW3L 2DJUA 1KDCA 3QUMH 4N1CA 4F2MA 4C4BA 2DYPA 2Q76A 3DK0A 3GNML 4YBHA 3FONA 4HEME 3MTXA 4PM1A 4NQCB 4BY1H 5DJYB 5BMFL 1EFID 3ULVL 4N22A 1N8ZB 4PMCA 1ORQA 3PAZA 3KLKA 1J7VR 3HG1D 4FNUA 5C97A 2J8UA 2WKOF 3QR1A 3ERQA 4EUPB 1NFDA 4OV5B 2ERJC 3UTPE 2Y72A 5DU7A 3NIGE 1BXVA 3DURB 5EDSA 3V2TA 1AI1L 4QOKA 3SOBL 2WVTA 4P9HL 4C54A 3CFCL 5IGXH 1MG3C 1UXLA 2EZ0C 2Z6KC 1KTCA 4HFWA 1HNZL 2CLZB 3M9BA 1SLXA 3CX5J 4PRHE 4G6FB 4Y5VB 1HDMB 2IIJA 2F0OA 1FVDB 2Z31A 3QI9C 3A0JA 3TJEH 4XC1H 4PS8A 4FEIA 2XTJC 1W0WB 2O5NA 1MRFH 1JQYD 4L0YA 2WZPA 2NN6G 1T89C 2CLRA 5M5YB 2A9DA 4L5FE 3T0AA 2X4NB 3VU2A 3GXUB 4FS0A 3MUZ1 5SWQB 3ZMEA 3WY4A 5CD5C 2C5DC 3CCSA 2YPLA 4LE8A 3MEHA 2XN9B 2WVVA 3VJ6A 3GEWB 3DVGB 3FQ4A 3FUIA 1MAML 1G0XA 4IFDG 1TQUA 4EUPH 2H1LM 5DM73 1WFQA 2ZXWB 3L13A 1C8CA 4H8WH 4X9BA 5F7AA 1IE5A 5CP7B 3T1YL 2UYLA 5C2UB 3M7OA 5HDBE 2FQDA 4JFEE 3SZKC 1HFNA 3KBGA 3PDOA 3FZUC 1A6ZA 2IHEA 4BZ2A 5KS9A 4LLDA 4M6NH 2VZTA 1T3FB 2BNQA 3C08H 1CQKA 3V52L 4K2LA 1KSRA 5LL6S 2AQNA 2C7UB 3RVVC 4YO0A 5IV2B 3P3TA 3HOWB 1BCIA 1ZEAH 4ZXBC 4M1DH 2DQTL 4C58B 3CP0A 2EVJA 4FL4C 1CWVA 2A99A 4Q8BA 3BCDA 1L6PA 2WB1G 5E51A 3SPIA 3MFYA 2XWZA 5M5YH 1TQOA 3MJ8A 4GY4A 2VUMB 5B1JA 2JJVA 2OPCA 2XLLA 3GB7B 2ENQA 3SKMA 4N9TA 5H94B 5C0RH 2WB1E 2JIXD 4LCVA 4LF6L 1HCYA 1OGAD 4MQSB 3ZIYA 1CKNB 4LF9Q 1EY7A 4HH8A 4P23D 3UZQB 2BO0A 4DK6A 1ILPA 2PPDA 4F7CA 3QO1B 1IBKQ 3GSNA 3HHRB 3O6KL 4WNQB 3HC3L 4BKSC 3R18A 5AAWA 5J56B 1W8EA 4KTGA 5K93A 4J6RH 1E1TA 5FHBH 3O4OC 1IEBB 1OCOB 1G6RA 3VTTA 5L2KB 2W60A 4A7TA 2I32A 4M61B 3HOWH 3QARA 3MLSL 4HOXA 1FZKA 5J12B 2A74B 4POZD 1QRNB 1MJJB 1CKOA 4YHZH 3A7LA 4MXVF 4ZS7H 4JEGB 5SV4A 3VO0A 3S36L 3THMH 5TSSA 1RCYA 1HH9A 1AMXA 1CGYA 3DM3A 1F1AA 1KJMB 4XVUC 2WNKA 3UAJC 2B9AA 4RFNB 1CXHA 1KXQA 2XN0A 3KW7A 4KVPA 1WI5A 2VUMH 1U2CA 4OJYA 2FECI 2C8NA 2PMZB 1S9XA 4POGA 5CNHA 5A1AA 2PCPA 3WO4B 5IHWA 3NHHA 4NPKA 4P49A 1NTDA 4F1ZA 1ZT4B 2B3RA 3BAEH 4Y5YC 1P6FA 3KWWA 2Y5TB 4NUGH 3IDMB 5E94A 3LB6D 2A6IA 2HDMA 4G42A 1S7RB 4UY8C 3BH9B 4PJIB 5D7KD 5IHUH 3T1HL 1G9MH 5AOJA 3QQDB 1DQLL 43C9A 4WW2C 4HZLB 4MRCA 4TLTA 1S7QA 3MJ9L 2VB2X 3WY2A 1T03H 1IC7H 1U36A 3K8KA 4XBPB 1OP4A 4DK1A 5E56A 4J28A 3NFPB 4ODVL 3RA7L 2NY6D 2E59A 5C0AA 1QQDB 3GI9H 4AGMA 5BN5A 5JXED 3RWEA 1CT1D 1CGUA 4DKEL 5F3HA 2XI9A 5C4HA 1OP9A 3T2QA 1RP8A 1FC2D 4HUXA 1K8OA 5F7EH 4XVSH 1PYBA 3SE4C 1ZOXA 4NC2B 1LWHA 5KGUA 4LOUC 3SHSA 2AANA 4LLWB 3VB9A 1AG6A 4EQOA 1F8TL 4TNWF 2C34A 4OLXL 2F61A 3T0VA 4U1LB 5I82A 2NW2A 4HAKA 3X3FH 1UOKA 1CLCA 1AS7A 1QLFB 2NDFA 3GMOA 4JRWA 4E5XA 2P5EE 5FCSH 2B2VA 3MV9B 4MKMA 3M17B 5KZCB 2W0LA 3DXAE 4CJ0A 4HUMB 5H2BA 5D3IB 5EEVA 4BUQA 4AIZA 1IGMH 5HHVL 2PW7A 5C4JB 3MBEB 4XHQA 3IAGC 4ZUJA 4A3FB 3QWQB 3BWUC 3W2DH 3O45A 3VQ1C 3MXNA 1CTMA 5IFHL 3KYMA 3FF8A 3NA9H 1IM9B 4LW1A 4PJCA 1UE6A 2IX0A 5EN2B 3EFXD 1ZHBA 3HHSA 2RH0A 1NC4B 5AZUA 4GAGL 4GMTH 1PTOB 3LRKA 3PP4H 5HPMA 2BPBA 1P2CB 5CD3B 2OZNA 4FXKA 5GRVK 4QHMA 1CQVA 3Q5TA 4WI6A 1O7DE 1EDQA 2HJFB 4WU7A 5SX4H 4PYGA 1USQA 1QR1B 2MUYA 2EXWC 3M45A 2B2YC 4PGZA 1MVYA 4PTUB 4U33A 1A3RH 3TCLB 2XWBB 2JJSA 2XY1A 1KN4H 2W8CA 1UEYA 4NJ9H 4O00A 3HS8A 4IZ8A 2EY2A 2UZPA 2Y1ZA 1X3DA 3N1QC 2EINB 3T51B 3JZYA 5MEPB 2LLGA 1VQJA 4Z77B 1PKQE 3HG1E 5TQ2H 4KZEH 4KHTL 4DFIA 3NOIA 2EABA 4APQA 4RIRA 1HE7A 2ZPKL 4OUOA 2PWGA 3FT4B 3UL4A 4OM1H 5I1GL 1E2ZA 1E5AA 2P24A 3CBRA 3QP3A 2M2DA 1BMWA 1X5FA 4A3FH 5DQDL 4PLJD 1XF5A 1IQWL 1L7TH 4MNGE 1IYVA 1G7PA 1HUMA 1QSVA 2D7PA 4PJHB 4XGZA 5DQ9A 4QRBA 5EBGA 1GXDC 1S72A 3D7PA 1YEFL 2ED7A 3V4LA 2JXMA 4IKKA 1X6LA 3FQRB 4EZKA 1IC4L 5JHDA 4A2EA 4F88A 1W0YT 3VWJD 1AQMA 2XUWA 5HGAB 1NCOA 1Z3RA 2J8UF 3D4WA 4Y4KA 4LEOA 2WAQE 5EFIB 1A7NH 1IGYA 3UGUA 3S2CA 5FLXc 3NZHL 1U8QA 5F9JB 4NXKA 1KEMH 2W59A 4H20L 2FTAA 4K9EH 3PO3B 1QBMH 2DL9A 4Q9CA 5D2LF 1FD7D 5DLLA 4NQSA 4HX1B 5D7IB 5GS0C 3MREA 3VD0A 1A63A 3ISRA 3ZPDA 4ZX3A 1FL3A 2RD0A 1T83A 1EEZB 5G5DB 4DERA 4Q2ZA 1FYTB 1YVCA 3K57A 2AK4B 2XNAB 3LZNA 2OL3L 3QIBA 4I3SL 3LQAL 1UXSA 1KGCE 4RMTA 1PFMA 1HYSD 3QUYA 3V4VL 3B8YA 3RDTC 1DZBA 3T2NL 1H9VA 2F58L 2WMPA 3SDCC 3MA7A 4DP7X 1MDAA 1BZDA 3TS2A 3W9DB 2A6DB 4WW2F 2YD9A 4QI3A 1B2TA 5GPRA 4PVNA 1I7RA 1NGXA 2VDLB 2YSTA 1O5DT 3GD7A 4M9OA 2PETA 1P4BH 3B2MA 5BPPA 5FEBA 2YD8A 4CN1A 3QISA 2HG5B 4IUPA 4NOFA 1MH5B 4QCIB 4DN3H 1A14L 4XTRD 4WUUD 2AVFA 5AW8B 5LGYA 1IYUA 1XH3A 1VENA 2WO3B 4K5OA 3TJHD 2WUCH 2VMEA 3BKYH 2Y06L 5GRUL 4Y7NB 3CHPA 3W11D 4IURA 2F19L 1VZGA 1MQKH 5C44B 2IBZX 3B34A 4LHUA 4AEIH 4HHGA 3V55A 1B2YA 1YJDL 2PYKA 4TVUA 3JVGC 5COYA 5B8CB 1T21A 3ND9A 2UUCQ 1REIA 3SO3C 2VQEQ 5DRXA 1OAUH 5F1KC 3FUHA 3NSJA 3SK5A 2FO1A 3HC2A 3BZCA 4HJ9A 3CQPA 4L4TA 5ADPH 3HPLA 1EY9A 2NBFA 2DQEH 5K9OB 2CHZA 3EO9L 1TZAA 1JRHI 2AZUA 3HLAB 2GSMB 3LH8A 4N8CL 3VVWA 2F8IA 4X7CC 2XWXA 3AFQA 2OR8A 3FRUB 3M3YB 3CDZB 5DFTA 3TO4B 2N7SA 1CT8A 5EGTA 1GUGA 1SDAB 2IF7A 3BWUF 2KCCA 3FHAA 1TEGA 2MP1A 3UZVA 3QIWC 2OTLA 1P0SE 1XIWD 3K5MA 5E6RB 1PLBA 1TQBC 3AG4B 3ILQD 1E42A 3T6QC 1Z5LA 35C8H 1D9KB 4JFFA 2VDKB 5AB9A 3QRGL 4PY7B 1RKRA 4IFDI 2FYYA 2KPWA 4F33B 4Y7NH 3QUHA 1M90C 3GXDA 4KKSA 5AB0A 5D7KE 2CO4A 1KELH 4I3RH 5IW6A 3IFNH 3ARYA 1SEQL 4K3DL 4LBAA 2CWPA 4H5SB 2Q0ZX 2R1YA 2IALA 3PWPB 4FQXB 5JIQA 1F56A 1DUZA 2A4EA 4MJIE 4L18A 5IQ7H 5JHMA 4DV5Q 2X88A 3CFUA 4IQHA 1UYWL 1HI6B 4UOW1 2ICEB 2DJFC 4GNXB 3O6ML 1IKOP 5CKGA 3TS8A 2KL6A 1JNNH 5CJXC 4YHYB 4NMZA 3ESPA 3ZTNL 2PZTA 3NELA 3M3YH 2XG4B 4NZJA 3OKLB 4PR5A 3DX8A 1PY0A 2GT9B 2I9TA 1DVTA 1BSIA 3TXAA 4IU3A 5BZWA 2J1YA 3L3IB 4OCYH 4UU9A 4GAAA 1W72A 4W6YB 1M6OB 1QNUA 2C1PB 3CGTA 3GJEB 4ELMA 2EUWA 4HC1A 2VDKH 2WUBH 5FYJD 2R7FA 4GRLC 1OKEA 2IDSA 2LQRA 4CJ2C 2Y7NA 1C16A 3UPRA 2XV3A 4WO4D 5DJ2B 1AHWB 2EDFA 1FVCA 2BMKA 4CDCC 4TVPD 4XP5L 2IXQB 2K5WA 3CQZH 5F6HJ 3HNVH 3MHBA 1BBXC 1IQDB 3LNNA 2WWMD 5I23A 5IT2H 3S1NH 4G8EA 2CHXA 1BM3L 3CXHJ 3IPFA 2H2SC 3X1FA 3MRNA 2DN8A 4Y89A 4WFEE 2J8HA 2X1PA 1NA8A 1GZQB 2H4OA 1A7RL 1K3BC 1UM4L 5BO0D 2ATKB 4LCCB 1Q72H 3FSWA 4HIIB 3T0XA 4ICWA 3TA3B 4F3FB 4KXZH 1RK7A 4XHJD 4XNYH 5INDA 4Z7OB 1KTKE 4Z7UF 2R0KL 4BFBD 1FJ1B 2YSSB 2DWDB 1RK0A 3U9PH 5DDHA 3DYOA 3II1A 3ARFC 2CR0A 3QH3B 1EY5A 5GGRA 2Z0UA 5EU5A 4GN5A 1HN1A 1T2JA 3IPEA 2CK0L 2ADFH 15C8L 3L3GA 3O3EA 1EEUA 1C5BH 5GGQH 3C5ZD 3TH2T 4ILWA 4NNPL 3T0DA 1XGZA 5HGHA 4CC0A 4UUJA 3ELQA 1VHPA 4J3OC 1E4XH 4NO5A 4PJCF 2AJXH 1KD1C 2XWEA 4NXMQ 4N8UA 5HSFA 4TNFA 1MCQA 1L4IA 4HA1A 1HOEA 1LMIA 3G5XB 3FCGA 3BUDA 1II4E 2EXDA 1RUAH 2YBRA 4U2ZA 5LKNA 3GK8H 3MV7E 4KHXH 3OPZH 4G71B 1JL8A 3G3LA 1QVOA 3GS7A 3HUJB 1PZ3A 2QLYA 5CBAE 2A9CA 2X41A 2XKNA 3BKJL 3NP3A 5AVYB 3R4RA 4OFYD 5TGBA 4O2DA 5IFAL 2CXKA 4B3SL 4GNKB 3MCYA 3JWNE 2YQ3A 5ALCH 4Z7VA 3V5HA 4G57A 2YA0A 1CS6A 4PJ9B 3DTUB 5EU6E 5HD8D 3BUTA 3T0ED 3G5ZB 3QXUA 4MAYD 4NKOA 3WN5B 4WO0A 3JWOL 1TQCB 5C8JB 1NDTA 2BS8A 5AVZB 2EVHA 2WW8A 4AQEB 4XE0A 4DQOL 2ZX6A 3CN3A 3HN5A 2NYZA 5SWZA 2VNCA 2HJLB 3IJEB 3HNSL 1H19A 4BSVA 5IBUB 1CHQD 1ZWIA 1ILQA 4DF7A 1G9HA 2F1AA 3RPIB 1OW0C 5D1ZI 4IGBB 1I3RA 2ZUQC 3SE9H 4UT6L 2P26A 4KNUA 5IP9H 4A93G 4KRPB 5EOTB 3FVQA 5HJBA 3ZE1E 2O61B 1E9QA 4W70A 1OB1B 5CINH 5E3FA 3HI6L 3PUZA 1NMFA 1R19A 1EXHA 4ORGA 3ICEA 4AMWA 1JXDA 2HJKA 5BVPH 1RU9H 3WDIA 1F1DA 5K9JL 5J1AA 3PHAA 4S0TD 2ZUUA 3A6CH 1U95A 4XMKH 4IKJA 4FMVA 5I1IL 4UAOC 5B39G 4F8NA 1JPST 1Z7JA 2RDHA 4QYOB 3MUGA 4XE5B 3QG7L 2J0TD 3AB0C 2HFFA 5HGBA 2YMXH 4DV1Q 2H6PB 1EZVY 2DLEA 1KPUB 1CFSA 4BZ1A 1JZJA 2BOCA 4EVNB 3DUHA 3U0WH 4EQ5A 2WXMA 4CVZA 3O3DA 1CXIA 4X62L 2G2NA 4BE5A 4K4KA 3T4AB 5ICXA 4UTAA 4O02L 3FPYA 4DUVA 4PJ5B 1H3GA 4MCYA 1F58H 1A6TA 5IOKA 3RWJA 1ZSHA 4OHJA 4H0IA 5HYJB 4NN7B 4PJFE 3L08A 3NT0A 5C3WA 1U8HA 2VOTA 4F5CE 3X13B 1CN4A 3OAUL 2B8GA 2LR4A 2JA6G 1DBKL 2AGJL 2P8PB 1ETA1 4W4NA 4B53A 1T1YA 4WEBH 3VXPA 1AE3A 3JVFC 4YFDB 1RPKA 4JR9L 4DPBX 5DJCB 3K2UL 1BCPC 2IDFA 2J43A 1E8ZA 3VW3H 1EIYB 2X2HA 5TDNB 5C3EB 3L3OC 3GTMH 2ED6A 4ZPTA 2WTRB 3R4DA 4DVBA 5HYSB 2DJSA 1FHNA 1UURA 2E5LL 4LF4Q 2IQAB 3ARED 4NZRL 5EO1A 3PP3K 4RQQB 4RAVB 3GNMH 2VJXA 1T4KA 5D4QA 1IX2A 3ULVH 5BMFH 4OLWL 1CA6A 3HJ0A 4YH6A 3HOYG 3AB9A 3RIFK 4Z23A 5G3LD 1SJHA 1O6SA 3MVSA 2P28B 3CH1B 1LM0A 3VE0B 3ZYIA 2R56L 4AQAA 4ELKB 4L5SA 2EE2A 1VFAA 1RD6A 1TPXB 2G2RB 2JIXA 4IIQC 4M5YL 2EJGC 3Q8AA 5FA4A 1IAIM 2E5EA 1AI1H 1OGAA 2WLMA 2CDFA 3SOBH 4P9HH 3CFCH 4AIEA 1GS7A 2W9EL 4Y0GA 4FFVD 4GOPC 2JSOA 4NP5A 1IRAY 3OJMB 2DQJL 1AZBA 3CFNA 5BV7L 1D3CA 1IGJB 2E56A 5ANMA 1VQPA 1R0AL 4A2FA 1V05A 1WYDA 1EHLL 4WWKB 3QVAA 4XP4L 3ATFA 1BFTA 1YN7B 2C3VA 1P4IL 2V37A 4JJHA 2GVBA 1J5IA 1R34A 5KSAD 4JY4B 4DKAC 5KAQG 3LDBB 4ONHA 4XO4A 1AD0A 5KW9L 1L0YB 3VTAA 3BUQA 2XBDA 2AMCB 3DPBA 4R84A 5M94B 1DANU 4NIYE 4R4QA 3QCUL 7CGTA 4Q7DA 4DV7Q 2WQXA 3LJ3A 3N40P 3KR3L 4OF5A 4Y8AA 5JOBA 2IEPA 5FYJE 3VFPB 3KPNA 3SY6A 1MAMH 3O8XD 4O2EA 1CDBA 5LXVA 2HCCA 4FGMA 4KQ0A 1VJSA 2YD0A 2APVA 2EDTA 2QFRA 4K2KA 3CXFA 1U8OA 2NSQA 4TVPE 4ZUSA 1IBHA 3ZDZE 1SGKA 2G0LA 1B8AA 2FECL 3Q2LA 1BBJB 4XBGA 4P4KD 1GZHC 2XYCA 5EPMA 1IBBA 2VQ1B 2DMGA 3V52H 1MPAL 4DESA 3D6GA 1NCIA 1BX2B 1S3RA 2CKBL 4JLRB 3FO9A 4K6LA 3DMMB 2X1OA 4ELMF 2DQTH 4L1SA 2R1XB 5IJKA 1D5XA 1S5HA 3ET9F 3QB3A 1GO3E 5ESVA 3RVUD 3IETA 1J9OA 2BSCA 4NZ8A 5JXEA 3I3CA 2BNRD 2R2BB 4F8MA 3ZKSD 4YN3A 1QX1A 4N8FA 3VXOA 3NSWA 1W8NA 4MD0B 1STGA 4XPBL 1TDQA 4NWUL 1OLZA 1ZHLB 1F9QA 3OM3B 1U5KA 4HJGA 3BSZL 4DGWC 4I48B 2UZYB 1RJTA 2DY8A 5AKTA 3U1PA 5T1MB 3ZE2F 5I16B 2F0VA 1O5PA 3RGVB 3VACA 4NLHA 2FR4A 4NBYB 2CCWA 4AYGA 4B3RQ 4JOIA 1T20A 2PTVA 3HC3H 3O6KH 4FP5D 2QMJA 1FYCA 4IS6A 3LS4L 3GSXB 5E2VL 4NX0A 1MCIA 1KBBA 1DANT 4ES9A 4U1NA 3MLSH 2BC4B 2F3VA 2EZ0D 2G9HB 2H32A 2X4QA 2IH1B 3VDYA 1LVEA 3S36H 3E2HB 1U8PA 1D7FA 1B0WA 4R97B 3HR5A 2IV8A 1E1OA 1CFQA 3QI9D 2XTJD 1A5FL 1H5BA 3KLRA 2ZX7A 3CSFA 4GKJQ 4LNVA 4F7TB 3NK3A 1FO0B 4L3EA 2V5SA 4HDIA 3ZR5A 1Z6HA 2FWOA 4DV4Q 3ARBC 5IVZB 1SHXA 4U3CA 3ZT7A 2BOBA 1WBZB 3KLQA 4HLZH 4YLCA 3S16B 1E28B 3L95B 1W0VB 3CX2A 3K6IA 4MJ2A 4YSEA 5CD5D 1ZE3C 4GLVB 3L8QA 3TREA 3QZPA 5DD5L 5I1AB 3F62A 4RGNC 1TMQA 3SKJL 1KG0A 4XYOA 1TY0A 1QFPA 5BQ7A 3WJJC 3V05A 1DQLH 1QUQB 3OIPA 2C7UA 1N3NA 2UUDH 2V2XB 4Z7VF 3SDDB 1U2YA 3PS6A 4RMRA 1J8HB 3D2TA 1AE6L 3MJ9H 3BAYA 2MFIA 3DTXB 3QR0A 3FCSA 1W3SA 4YDJB 5JW4Q 3FZUD 1F2LA 1HXKA 2JWYA 3P4MB 4KMLB 4ODVH 4RCAA 3RA7H 2WXHA 1NUFA 2I7OA 4M4RA 3CHBD 2F7OA 4G7SB 4QPEA 3OKMA 4JZOA 4DKEH 4YSAA 2P8LB 3RVVD 3O4LD 4JI6L 3AQXA 2KDGA 3DGGA 1PLFA 1K4CA 1KGXA 4K5PA 4ZXBD 2RQEA 4GOSA 3D3VB 3LKOA 5ETUB 5D71L 5IB2A 3QXDB 4LRNL 1F8TH 4OLXH 4PGCB 2NZ9C 4YXKL 4U6TA 3V79C 5ITFA 5EN3A 2B2TC 5E1IA 3S16H 1AQDB 5C7XL 4F7KA 4HKBB 1VQAA 1CFMA 3IFTA 5DHVH 2KZBA 3RFRA 3L3HA 2A2QT 4HG4K 3P2DA 4RGMA 1E4JA 4I8DA 4P5KA 3U9UB 1K3IA 1LTXA 4JY6A 4JZNB 3FBKA 1GC1C 1EQRA 5DYOA 5HHVH 3VM5A 3FBQA 1OAYL 1ZK9A 3M7GA 3N0PB 3LRMA 4RA0C 4EN3B 3NCFB 3NFNA 4AKPA 3K6NA 4A55A 3K5RA 5IFHH 3KPRB 3DRQB 4B9YA 1MEXL 3ES6B 4HBQA 2V2TB 4S0SD 5BR8Q 5M5XB 3P7JA 1JSYA 1UT9A 1SUJA 2BLFA 4GAGH 4ODWB 3SGEH 2W38A 3TFKC 2BK8A 1IAII 1NE3A 1YC8A 5DJZA 5I9OA 4XNUL 5JPNC 2HRPL 1A0QL 1G7JB 2VXQH 1TFHA 5C0GB 4XVUD 3UAJD 1ZSDB 2VMDA 3RX8A 4A3JB 4X8JA 3LRSB 4K5WA 2M26A 3B9DA 4QRTA 1I8MB 3DV6B 4MCMA 4UM9B 5IUCA 4LOVA 4PGJA 4GSQA 4JDZB 2XV0A 4P99A 3LOWA 2YGPA 2GI0A 4G7ZC 4KHTH 1FIEA 5KNBA 2WKDA 1VERA 4XNZC 4BFIB 3OGCA 4WUUA 3QEHA 5KTEH 2ZPKH 5I1GH 4RMWA 5DJ6A 5IGBA 4GXVL 5IB5A 1Q1BA 1S5CD 1IC0A 3WIFA 2OL3B 5DQDH 1F18A 3OBAA 1IQWH 1KTLA 1RZIA 2BVOB 1FYHB 3RG1C 4ODUA 5JHLL 4WWID 5TH2A 3V4VB 1YEFH 1DEEA 4LP8A 1HOCB 4LU5L 5M5XH 1IC4H 2V9UA 4EBQL 5C4XB 4B5EA 3F7YA 3RVTC 5KJ7E 2B63G 1E9PB 1Y1VH 2O4EA 4D0DA 4X6EB 5I24A 4OIFA 2ZOWA 4ENED 4A3JH 1LNUA 4FI8A 4I89A 3MYJB 3NJGA 4NCC2 2DI9A 3IMWA 3HAEG 3L1GA 1HSAB 3IJHB 3LEVL 4KK7A 3NZHH 3A5UA 3PSIA 1GL4B 5DMJB 4H20H 4LOUD 3UJIL 5BRPA 2VTFA 4ZUUA 4RH4A 3LZRA 3BQUC 4C3HG 2EJ1A 2WO2B 3GJFA 5HHQB 1JRHL 4LCUA 5I76B 3PCYA 3NUCA 5KVMC 5L8JB 1AIZA 1GW6A 4UAHA 3EOAA 3DHJA 1XNRQ 5IVXA 1QSEE 3W0WD 3EGDA 5JZ7C 3IFPA 2ILLA 3J81c 1OPGL 2OL3H 4P2RB 3OB8A 4I3SH 1U42A 2YQGA 2Y7MA 3LQAH 4NSKB 4AH6A 4HOMA 1MIUA 5DC2A 3S17B 2EPBA 3E9TA 2ZXAA 3V4VH 2JA7G 3S5LB 1GY2A 3T2NH 1DTUA 2F58H 2Y36L 2WANA 1YZZA 5C4XH 4NGHL 4ZW5A 1A3TA 3UC0L 2DM7A 4CN4A 3BWZA 4R3SB 4CDDC 3F7KA 3PIP3 4NZFA 1JVKA 3K7UC 3DVNB 3S1MB 5I0ZA 2BNRE 3FCTB 3CC2A 1R5WA 4JQVA 5T5FL 5C0JA 4YJZL 1A14H 2QV4A 2EXWD 2K9FB 2R15A 3J80i 3GHBL 1GD7A 1XXGA 5DJYA 1XD0A 4NQCA 1SJMA 2Y06H 3DHUA 9PCYA 5GRUH 2AKRB 1THCA 3ELAT 2F19H 1FFOB 2V7NA 2XQBL 5FF6A 1YJDH 1BOYA 1CVSC 2FO8A 1PEZA 4HPYL 2IHFA 1PPIA 3N44F 4J15A 4JKLA 2ZT9C 4XPHL 2HIXA 4ZMVA 2VZ3A 1GCYA 3D4GA 3VXQB 4ZOAA 5HHOD 2CLZA 4L4VD 4W9FC 4Y5VA 4CMMA 1AKPA 2VSKB 1HDMA 1K8MA 4XDXA 2W9LA 3EO9H 4N8CH 5K59F 1FVDA 3GWJA 3T6ZA 1XBRA 1MHHB 3F6JA 5D1QB 1I1AC 1FVEA 4F15C 1MCWM 3GBLA 1LTSD 2XTJE 1NM4A 3MLTB 3WDHA 1U8JB 2X4NA 1QAWA 3LN9A 4OIKA 4JO4L 1D5IL 3CSBA 2VXSL 3A7AB 5I6YA 4OIIL 1S4IA 3JWDL 4Y2OB 5KWYC 3QRGH 4QHUB 5TE4L 5D1XB 1G9NL 2XN9A 3PO2B 1QKZL 3V0DA 3V95A 3IN0A 3CU1A 2ZOKB 3DRTB 3V0EA 4N24A 1SEQH 4K3DH 3NIFB 5GS0D 5CP7A 2WAHA 5CEYB 4N2GA 2VXUL 3BUYB 4W9DC 3ABGA 4L8DA 1CICC 4JN2B 3ZE0B 5EUOA 5KEEA 1XR9B 3GXIA 4POUB 4P71A 1UYWH 1XGYL 5T5NF 3RVXC 3O6MH 1T3FA 4MGXA 3MRKB 3GLEA 3HIZA 2OTWA 5J5EA 3N06B 5IV2A 2OMUB 4P3DA 2LAGB 3RDTD 4ESKA 3FSZA 1D2BA 3F83A 3O4LE 5AWNL 1RJLB 2ZUVA 5K1NA 2XPGB 2OCFD 5IOCA 4TTDC 1CXFA 1KTRL 3PNRB 3QIUC 4N9PA 2XXFA 3TBTA 4YIQB 1BMZA 3ZTJG 5CC4A 5F71A 2CO2A 1D6EC 4JRXD 2D0GA 2Z93A 2NY4C 1LT4D 3T0EA 1ACCA 1KB5A 4JHVA 1J0JA 3RZOB 4K0KL 3PO2H 3RZCC 1KNEA 5BO1L 5DEGA 4XP5H 1K9MC 3C6LC 4DP9X 1LK3L 3QPKA 2ZOOA 3H9SD 2BSED 2NUPB 4X5PA 5JJKA 1NOFA 1ZAGA 3HOXB 4HKXB 4MDRA 4WNQA 5HHPB 5GRXG 3A55A 2XGTA 4BKLB 1BM3H 3NXWA 2PF6A 3WE1A 3T5WA 4KVCL 4KD3A 5T8IA 3JV0A 2ZKHL 1PV4A 5T1LD 1A7RH 1UM4H 1ZTXL 4NRXB 3RI5F 2QA4A 2F0NA 3QHFL 4M61A 4YDKL 2OK0L 3RL2A 4PW9A 1MJJA 3MRGA 2R0KH 3PUCA 1KIUA 4GQRA 1NCCL 2PTTA 1Q9LA 5D2LE 5C2BL 4YWGL 2YEZB 3ECBB 4ISVB 4ZFGL 3O9WB 4JFDD 2CK0H 2CAKA 3MOAL 4IJLA 15C8H 2NT1A 2PMZA 4YSPA 3QIWD 4Z7QF 2VR8A 4NNPH 2OMWB 3RZOH 1FCGA 2P80D 4QRAA 4WNSA 3WY1A 4KKAC 1WAAF 3G9VA 5JDJA 3KPLB 3IDMA 2VUYA 4U0RB 4PJ7B 4HCRL 1S7RA 1BECA 3S6CA 4F7PA 4YHNB 4TVAB 3JUYA 4PJIA 2X10A 3WEXB 1JWMD 1SFDA 3OPOA 1BXAA 1PGRB 3DUSA 3M7NA 5JTWA 4GG6B 3HOXH 3LN5A 3L7FA 3DGCR 5GRVL 3A4EA 3BKJH 4IMLB 3KBFA 1FQ9C 2V5YA 2F3WA 1PYSB 1HFGA 2F3IA 1QASA 1ETB1 3HP3A 3NFPA 2D0HA 1PLAA 3CSYA 4LLYB 4BDVA 5IFAH 3ZL4L 5HVFB 4PJ8B 4MBRA 1VAHA 3IBOA 5C3LD 2RCFA 5LBGA 1ZJAA 5HVWA 5JLZB 3JWOH 4WQOA 1ORSB 2F0MA 1F6FB 1BQLL 2QQKL 4DQOH 3B2XA 4L2YA 4AZ8B 2WXIA 4LLWA 2Y0SA 2X3AA 3HNSH 4O02B 4YL4A 5A2AA 2GHWB 1SF3A 1YO4A 4X8XA 1EIFA 1BOGA 2NX5D 5DURB 4UT6H 3VD2A 4GRLD 2ITCB 4RFBA 1DVZA 5AENA 2EKJA 4FXGA 2NNFA 3CCEA 3L1FA 5M9OA 4XCNA 1VQHA 2ZJRA 4BFRA 3W0WE 3HI6H 5ID0B 1OSZB 4W68A 4GMSL 4RMVA 3D0FA 1A22B 4EI0A 3N04A 4H1LA 4LEEA 5K9JH 1GYVA 1QBLL 3TIEB 4JQIA 5AUMB 1I1RA 1G9MC 1FG9C 2H2SD 5I1IH 3QDGE 5E7NA 1NC4A 4J1UB 3QG7H 2OBGA 1DJZA 4WJ5B 2Q8BL 1YNXA 4F80A 1P2CA 1XXDC 2XWJB 4X6DB 3V7AG 2GEQA 3MC0A 4GZYC 1C1EL 4PJBA 4HIOA 3MRFA 1HNWQ 3U1SL 2M1KA 4NP9A 1U8IB 1IUZA 4UM8B 5KSAA 4PTUA 4O02H 3ARFD 4Z76A 1HNZQ 1X4XA 2EDYA 1W80A 1YYLL 4LGRB 1PLCA 1LEKB 2K1MA 3PHSA 3W3BA 4WW1B 1DOKA 3TONA 4P5TA 4P74A 4PJXF 5D9SB 3FEWX 2YAFA 4J3OD 4A7VA 3OF6A 1E5BA 4P73A 1YHAA 1NCWL 3OAUH 1DBKH 4M8QB 2AGJH 1WA1X 3STZB 4B9XA 4LNRB 3OWEA 4OCRL 1YEIL 4KKTA 5BV7B 2HTKC 4JR9H 1SMXA 3NZ8A 3FW6A 3K2UH 4ABNA 3QDJE 3QJRB 4PJHA 5HJ3B 2D4FA 4L4VE 3FQUB 1AC0A 2F0CA 1LTID 1S7SB 4JHUA 4LGPB 3FQRA 4JI4Q 1LO0L 3QUXB 1BXXA 2JKIS 3T1YQ 1Q4NX 2A7BA 2IMMA 5GGTA 1JYNA 3IPBA 4NZRH 2JH2A 3BVNA 1H9JA 4L9LB 1A3LL 1IBDA 1SFOB 4BEIA 2HD3A 3ESVF 4FQ1L 5EFIA 2EEBA 5FV1L 4OLWH 4NS0A 1H9DA 3DARA 2AJ3B 1P8LA 4MB4A 2BNRA 2GSGA 2X6UA 3FN9A 2R56H 5FIEA 4FAAB 2O72A 3AS1A 1HVXA 1OCZB 3GTLB 1MCKA 1SJEB 1FR3A 3UO1L 3DXJC 2F7IA 5CSZB 5I6NA 4M5YH 3KPPA 4HX1A 2P3YA 5DD6A 2PXYB 3P9MA 2KECA 4KC3B 4TNGA 4WHDA 4QF1A 1PAMA 1ZPLA 2W9EH 4IKNA 1RMFL 4P4RA 2KJXA 4HUWB 2X3BA 5HYFA 2AK4A 3CRKC 2DQJH 3GSUB 5BV7H 2DDQL 1HEJC 4CMHB 1R0AH 4Z7UE 3C5SB 2CKBB 1DFXA 1EHLH 3QEQD 5ESAB 1P4IH 3VX1A 2KHJA 1WE5A 1X4ZA 3TFBA 3MV11 3N6YA 2QDLA 3OZ9L 4XPGL 5KW9H 5J1SC 1QA9B 5LMNQ 4AIMA 1PJWA 3QCUH 1SFOH 2ZNXA 1XWVA 3TBIB 5IYDG 3ALPA 3L3DA 2E27L 2EDLA 4GS7C 4JRXE 4X0KB 2HG5A 3BPCA 2AVGA 3QI9A 3KCPB 4QCIA 4LF7Q 5E8EA 5C3XA 5LN4A 4X6FB 3DO7A 2GCYA 4PJEB 3M4OH 1AS6A 1TO4A 3X14B 1T89A 3GTLH 1GUTA 4OZHB 2DM4A 5HHMB 2CG9X 1FCCA 2WOYA 3A5ZB 4N2OA 1S5ED 4J3VA 2FDBP 2IT1A 1CPUA 1GKOA 3P40A 1KGWA 4DR4L 3HE6D 5H37A 3RLSA 3ZRFC 1QPPA 3ETBJ 3X1EA 4K9EC 2ZM6Q 4Z7WB 1WQVT 5D7HA 1X65A 1BQHG 4NYLA 1MPAH 5B8CA 1I1YB 2CKBH 4AUYA 5L2JB 4OD2A 2BSSB 4M93C 1Z5HA 3OLIA 1K4DB 3NJVA 1H0DA 4N2NA 1Q94B 1BCPD 4LIQL 5F97E 5HDQL 5AB2A 1JI2A 3HLAA 1IBYA 3A8IE 3L1EA 5C0FA 4X42A 4JJ5A 3TO4A 3SBQA 3HKFA 3WXVL 3V4PA 5C5LA 4JFDE 4XPBH 3LKPA 4NWUH 5DHYA 4H8UA 4LCWB 5F6IB 4FQPA 3BSZH 1UWVA 2O6EA 1JF6A 1SFHA 2PPCA 4F33A 4NKDB 2HT1A 4MNHA 3UBXI 1M05A 1VDZA 1K85A 1ZANL 1IB5A 5DTFB 2HWZL 4S10A 1CD1B 5D7LB 4UQ9A 3LS4H 2NCMA 3OSVA 4U1MA 5E2VH 4ZUWB 4DETA 4NQQA 4EIBA 5A2CA 3UZEC 1IYJB 3PWPA 5H8DA 4FQXA 1TR7A 2HHHL 3QWOB 3CN1A 1QW8A 2ROYA 3FT2B 3PIQA 1E7UA 4U49A 4A3DH 5E8OA 4XVOA 1HI6A 3O2DL 2ICEA 4GNXA 1I9IL 2XNAC 2QPFA 1XVSA 3HBPA 4Y4FB 4B9FA 4F7MA 5D14A 3LKRB 5CGKA 1A5FH 2CHDA 3K0WA 5KYNA 2IDCA 5IROA 2GT9A 3C09C 1NOAA 1TS3A 4PJIF 5DVOA 1XAKA 4LFHD 4DA2A 5FKPB 4XTCS 1FFPB 4IRJB 2C1PA 3UCRA 3H3BC 3I6GB 3BFOA 4LVEA 1GGCL 5DD5H 1NWPA 3GRWA 2FX7L 1SR3A 2MHVA 2NX5E 5FYLE 3SKJH 4BSWA 2J8OA 1J8SA 3CFJB 3HRZC 1A21A 3ASNB 3V0HA 3K6SB 5GS3A 2IXQA 3WFBL 1AE6H 1OY3B 1S9WB 2NXZB 3FQ2A 2V1CC 1IQDA 2OF1A 1RZFL 3B5TA 4Y5YA 5E9AA 1NTGA 5C9KA 3AGVA 4X3TA 1BG9A 1WHOA 2YQBA 3JQOB 4NQDD 3SJVB 3LXAA 5IF0B 2BDNL 4ZSOB 2EDOA 2ZSVA 3REWB 3BMVA 2JB6B 4LGSB 4DP1X 3L4UA 3UACA 2WJ7A 1HK6A 1HZLA 3QC5X 4WFN3 1EY0A 4LCCA 1SMOA 4HIIA 3KF6B 1WCBB 5D71H 3WKYA 1DXMA 1AGBA 3X1GA 2DNCA 1I3GL 1LDSA 3DX7A 4OGZA 4LRNH 3V0AC 4LAJH 2WOBA 3WS3A 1FJ1A 2YSSA 2Z1CA 3QNYB 4EI6B 5I5MA 4YXKH 3ESUF 3QH3A 4UQIM 4GBXC 1UZ6F 5C7XH 2Q6WA 2C4FU 4KRNA 4APXB 3TN0B 4DV6Q 3BW9B 4RSYA 4K3JL 4AMKL 3LX0A 5KYXA 3UIZA 5LCVL 1OAYH 4WJKB 5IB1B 2VLJD 1EAOA 1G7HA 3AWEA 4GKKQ 2C7FA 1ZHNA 2VL6A 3VR2A 4NDMB 1D9KC 1YNKL 4DGZA 1PTOF 4HZ1A 3TOPA 2MQ3A 2P49B 1NCGA 1T7XA 4WU5B 3WN6A 2VLMD 3C75A 4FQIL 1OP3H 4CU7A 5I2IA 1MEXH 2GUOA 2P8MA 4MFHA 3GUTA 3U30C 3JYBA 1UE1A 4BY7B 1N59B 3MNDA 2F0DA 1JGVL 1H3PL 1MCEA 5E6YA 2WLYA 2NYYC 1LP9B 5ELNA 3S9WA 2F53D 1NCJA 2FE0A 1HHKA 3KOJA 3GKWL 2BHUA 1Y69U 2WLJA 4P2AA 1PHJA 4XNUH 2HRPH 1A0QH 3MLWL 5CUSL 4ERSL 3EJQA 1S7WB 4GLXA 1N0XL 1NMCB 4K8RL 3VA5A 4WWPA 3GSWA 3G5ZA 2PZWA 4E0RB 3T09A 5C8JA 4IRSC 4AQEA 3TPUA 2QHLA 2H1EA 4DV0L 2EO1A 2X44D 3ZYZA 5IMOB 4X8GA 2BSBA 4AEFA 3IJEA 3RN2A 3ARBD 3MCKA 1M57B 2EP6A 3QXAA 4DCQB 4DUYL 3EJZD 4I2XE 2XPYA 2B2YA 4PJHF 3I72A 2JQOA 3I2ZA 3BO8B 4HIXL 4GXVH 1T1WB 4C1NK 1P4LB 3H42L 4KK9C 4KQ3L 1WA0X 1L1OB 4RGND 5DEFB 5KVDE 5IY0A 1FH2A 2RCSL 3JAME 2GTWA 2WXGA 4ZO7A 3ZL1A 5K39B 3ME0A 2D4DA 3UADA 5EZIL 1AHWC 2Z4QB 5JHLH 1GJUA 4NAQA 3V8OA 3WDJA 4QO1A 4LU5H 4BY7H 3VGHA 2P48B 4BV1A 1UH2A 4QUOA 4EBQH 3IDGB 3GMLB 1SN8A 1LK2B 3GI8L 1CZ8L 3OC5A 3HEIB 1P7KB 2YTYA 3E3XA 3K5LA 4FLRA 1DQQB 2NDGA 3OB0K 5D5MA 4L4VA 5HHOA 1K83B 5EPKA 1C7SA 2L1BA 5D7IF 3B5GA 1KPUA 3LEVH 5C07D 5E6UB 3UJIH 1HCVA 3RR5A 2N78A 3CXHK 1B9MA 1UVQB 2NZ9D 1JRHH 1T0NA 2WYHA 5JEAG 1TETL 2B3GA 5HJGA 1X5LA 5EV7A 1ZS8A 3D85B 3ARZA 5D6CA 1W6LA 2E6JA 1HZ9A 5C0IB 3UX9B 3D39D 3MR9A 5IQLA 1OPGH 3MU3A 4ZTPL 5GGUA 4AX3A 2OV0A 3WNPA 1NEZB 1KLFB 5MI0C 3I9GL 1LEGB 2P8PA 4JGUA 4U3HA 3UYOD 4OZGE 1UQSB 2JKLA 4IFDH 1UACL 2Y36H 3ZY7A 4NGHH 5LBSA 3QXTA 3C8DA 4HV8B 2D3JA 5AQ0A 3UC0H 2XYBA 1NIDA 7PAZA 1NIAA 1P6AB 3BYTA 3TFKD 4UPAA 2WTRA 3TEXA 4DAPA 4G72B 5T5FH 3GGWB 4GSRA 5DD0L 4ZS6C 4QIWE 1JGDB 3SDCA 4RQQA 1Q0EA 3GHBH 4RAVA 1X9RA 1UG9A 5BRZD 1CQFA 1ET5A 2R69A 3BE1L 3GSRB 3L16A 4BJLA 3FFOA 3BG3A 2GABA 2QGCA 1KGUA 4OTXL 4JRXA 3VE0A 5C1MB 2XQBH 1M4VA 2SDFA 2G2RA 1QHPA 4JY5L 4DXGA 3FFCB 1X3QA 1O9ZA 1R3JA 4HPYH 4MNQE 4DUXA 2IAMB 5I5IA 5CIPB 4CDFC 1ODUA 4XPHH 5F3BB 5BOJA 1FZOB 4IGBC 1JC7A 4TQIA 3H9SA 4MMYB 4ZQKB 1M1XB 3DGDA 1IGJA 1LXMA 2VT0A 3HVNA 3CU7A 1L9NA 4KXBA 3HFFA 3JVGA 4M02A 4XYQA 3RNQB 3WNIA 2QT6A 3SR1A 1PFBA 2FIKB 1G2TA 2QR0A 4I9WD 3NP4A 4K07A 3V0JA 3MZ5A 3RVTD 4JPBW 2EC8A 2IPKB 3VXMB 1CF1A 1PH7A 4AOFA 1IKLA 4LK1C 2E8GA 5GGRY 4ZDHA 4JO4H 3LXUX 2GTZB 2VXSH 4OIIH 3JWDH 4ZO9A 2APSA 3HE7C 3OW2A 4YWMA 1G9NH 5TE4H 2UXDQ 4C57C 1IVTA 4QHKJ 1QKZH 2I69A 4JFDA 3OLEA 5IQMA 3B6SB 2DYRB 3BQUD 3EBAA 3LEYL 2G3ZA 1CC3A 4NKLA 3QIWA 2VMJA 2VXUH 2XSKA 3FPXA 4QXTB 4LQ1A 4HH9B 5D96C 2FSEB 5CIPH 3ZUNC 4EO5A 5BUAA 1BBJA 1HX0A 4N9OB 5JZ7D 5LG6A 2GHZA 3MRQA 1XGYH 1CFNA 4X7DC 3NQKA 1ECYA 5GAHC 3VYSA 3MXGA 3CC7A 3OXSA 4R90L 3ZHNA 1FF5A 5D1ZB 4FF1A 3HMWL 5TK4A 1F86A 1I50H 1NIBA 3WIAA 2BA0A 4JAMA 4RKBA 1DN2A 3IRCA 4XCEA 4ZOBA 5CAYB 5AWNH 2QADB 4QGTA 3EDDA 5C7ZA 1HHHA 1J05B 2VZ1A 1DLFL 4UP8A 5I30L 3LCYA 3J7AV 1WCMG 3HKZE 3L5WB 3L4TA 3V6FB 3VG9C 3W56A 1M71B 5JIHA 3VD5A 2R2BA 5DJXA 4FVMA 3T04D 5CJXA 2OMYA 2OSLB 2VLKD 5I1DB 3CD4A 2GPZA 4MD0A 4R4NC 3RVWC 2VAJA 2HFGL 4JG1L 5BO1H 3I74A 1BM7A 1ZHLA 4DHLA 2BH0A 4B3SQ 4GP5B 1CDCA 1VQ6A 3S15B 1T2XA 2A6JB 2UZYA 1IE4A 1LK3H 4MXQC 1E8XA 2NXYB 5T1MA 3ZZQA 5GXBB 3S8WA 2CO6B 2VLJE 5IMMB 1Z47A 1QABA 3L5XL 2FFKB 4Z7OF 2Z0SA 2VLME 4KVCH 4KV6A 3GSXA 3JV4B 3QYNA 3PWLB 2ZKHH 3CCVA 3D3RA 1ZTXH 2OTPA 3QHFH 4YDKH 3BAKA 2OK0H 2BC4A 2G9HA 3P3UA 4AH2A 2OMNA 1PD6A 2IH1A 1WS7A 5EOCJ 3ARDB 5FECB 4YHHQ 1NCCH 2W9DL 3TBSB 2Z65C 5E5MB 3T9WA 1V3JA 3T0BA 4G11A 2AC0A 4DGUA 1J0ZA 2NW3B 3VWKC 1I1AD 4ZFGH 4UQ2B 2GW5A 2KLTA 2LHAA 4WWKC 2I9LA 3MOAH 5CLYA 4GIOA 2VL5B 4F7TA 1FO0A 3S1QH 5T1KD 4LFCL 1QLEL 3ULJA 4G1EB 4KNSA 5C0BE 2BHFA 4UOW0 5DJAB 5IVZA 1WBZA 1E28A 3HFML 3L95A 4KTYA 4OI7A 1MLCB 4MA3A 3CVIL 3HUJF 1D8LA 1MWOA 4HCRH 3ARFA 4RFEA 1Y1WG 1AZUA 4YPGB 5DS8B 2D7QA 5I1AA 4QLWA 1H9RA 3K4AA 4FA8A 1IW7C 1PVHA 2E7BA 2PP9A 3SDXE 3SDDA 1IGCH 4LSVL 4XNBA 4ZMXA 2D3LA 3DTXA 4OCLC 3PIOA 4X62Q 4PGBB 4XMWA 4YDJA 5F1OB 1Z2KA 3G5VB 1CICD 4NO0D 1CLVA 3EXJA 4U6HB 3RVXD 3ZL4H 2JJWA 2J56A 3NACL 4YDNA 1SE4A 1AYRA 1ZDSA 2R2CA 3C5JB 1TCRA 4B7LA 1WYJA 4C8XA 1DVQA 4ZMOA 5GS1B 4AM0Q 4YHML 3TEHB 1N2RB 1BQLH 2VAAA 3LNIA 1VF5C 3OKOA 5ETUA 2QQKH 1MUJA 4CA4A 4WGVB 1G7MB 2VXQA 3QXDA 1N9WA 4TTDD 4ORZC 5C07E 2QTEA 3TURA 2EDMA 4HGWA 4PJGB 4XB8A 4PGCA 2VM3A 1MN4A 2C9AA 4ODTL 3AQYA 1AQDA 1ET7A 3ZSSA 2NY4D 4PRPA 3MRBB 1JB3A 3NENA 1PKOA 3Q06A 4BFFA 2MCPH 5KUKA 3CN2A 3U9OA 3RZCD 3MXVL 4CDGC 3F7VA 4GMSH 1FGUA 1VF7A 1IBLQ 3FQXB 4WHYH 5F7WC 5EO9B 4ANKA 2E5LQ 1QPXA 5KVEE 4EN3A 2EYJA 3PGFL 5D2NC 3VXUB 3FDTA 1QBLH 4YR6A 1Y8PB 4N8VA 2QKIB 2LT9A 3UFIA 3TNMA 3EO1B 8FABB 2VSCA 1PZBA 1NY4A 3O2WL 4X65Q 4XVJL 2WHVA 2ZTCA 1XH2A 4YEFA 2Q8BH 1RY7B 3ARGB 4JQXA 4TNVF 2SNMA 4KO6A 3ULVF 4HCEA 3HC0B 3QEQA 4YAQB 4ETQB 1C1EH 3RD4A 3U1SH 1G7JA 3BZFB 3VD7A 4OGXH 4DZ8A 4PREB 1QWUA 3QZNA 5FLMG 5FLVA 2DIEA 3RY6A 1I8MA 2BE5C 5T5NG 4NUPA 1Q81C 4KKZA 4R97C 1SMYC 1TKWA 1UH3A 4UM9A 1HSBB 5KN5A 1YYLH 1I4XA 3D31A 3RMHA 1YQVL 1AG0A 5DZPA 1F5WA 2VW4A 4FA7B 1E2VA 1DQJB 2GKIA 1S4ZA 1N8RC 1UHVA 1IHZA 5EBMB 1NCWH 3K71B 4U0QB 5DJ0B 1LM8V 1V5JA 2ZXBA 3N55A 4OCRH 1YEIH 5DGQA 3VI3B 1WTXA 2AQ3B 1PIGA 3P0VL 3SKOB 1MCFA 1KAAA 3FH8A 4HWZA 1OD9A 2X89D 1BVKB 3OKEB 2ZOLB 1T0OA 4M1UB 2ZXGA 4JX0A 4P2OA 5F89B 1LO0H 3EDKA 3CZFB 2VWEE 4OZGA 3VI4E 4E9TA 1U93B 3UCQA 1X7SA 3ULUC 1G7IA 1QO3B 2GK0A 1FNSL 1WCQA 4I9WE 4V33A 1E9PA 2J4XA 1CFTA 4X6EA 5LAXB 1A3LH 1E4WL 3BP5B 3BYYA 5JHAA 4KJNA 4FQ1H 2BNUB 3MRDA 2QW7A 3CZJA 4I0CC 1HSAA 1YNNC 2CBOA 4YCUA 3L3OA 3AS3A 1D5ZC 4TUOB 1AXTL 2FCBA 2J6EL 4Y2DC 3GTPB 1VMCA 3B43A 3BDBA 5ES4B 3Q9QA 3UO1H 5HHQA 2KT6A 4N1EA 5I76A 5GRZA 1QNKA 2AJVL 1I1CA 3I4MG 1L5GA 3QNZA 4J8RA 1KCVL 4R8IA 4ZPVB 1RMFH 3TH3T 3PHQB 1ONLA 3HI1B 2CUIA 1WTOA 4P2RA 1OT4A 1E67A 4DP0X 1JT8A 2DDQH 4E41A 1S7XA 1KPRB 4NSKA 1A2YA 3CFIC 4YK4C 3S5LA 1URLA 4IIQA 3RLOA 5A2BA 3KGRA 3LS5L 2OCCB 3NP8A 5CV8A 2BDOA 1R3IL 5FLXE 4UTCA 3RAJL 5F9WB 1NIEA 3TZVB 3I6SA 2PCXA 4GOPA 4FF2A 2VM9A 3OZ9H 4GEJA 4JL2A 3FRPB 4PJ6A 4X4XB 4XPGH 3SGJC 1D7QA 1TVBB 1SYDA 3D18A 2ICWJ 4AV0A 3MLZL 5CR1A 1WAAE 4PI0A 4KZ0A 3EOBB 2WACA 3DVNA 3W39A 2C3GA 3FCTA 1E6JL 1LL1A 2E27H 3ONAB 3MRRB 2QCPX 2VLKE 4CVWA 3Q22A 3QZWG 2JQMA 4X7TB 3TJPA 2PP8A 1PZ5B 1WTQA 3GTPH 3GMMB 2HSIA 1THAA 2JVUA 4LLMB 5FYKL 2DICA 3TS0A 3CHSA 2X0WA 2DWTA 1X5GA 4MCZB 1I7UB 2UUBQ 2JJQA 3ROOA 1QEXA 1HXYA 4OFDA 3JUZA 2D73A 1EJOL 3E1F1 4CADB 4Z3TA 2OM5A 4B97A 1TF4A 5BJTA 1P69B 6PAZA 2ICWA 3L81A 3NK4A 5DLML 1U58B 2VO8A 3X3GL 2HTKD 3E9HA 3OMNB 3PFQA 3R8BB 2BSRB 3EHBC 3ARVA 2F7PA 4LIQH 5HDQH 4OM0L 3BISA 4PH8A 2BRRL 4NQDA 4IKLA 1MHHA 4X83A 5D1QA 5E1FA 5CMDA 4TKWA 2F52A 2Y7QB 1GKEA 3WXVH 3MHZA 2Y07L 4BE6A 4YIJA 3WEOA 1EZSA 3MLTA 4JGJA 5I5JA 2GY5A 3IMSA 1PH1A 1I85A 1A8ZA 2Z8WC 1EEFD 3PAVA 4TRPL 4Y2OA 1MHPL 4Y1SA 3VAEA 5L6YL 3I84A 3NZUA 3VFWA 5FK9B 2IV9A 2L11A 5D1XA 5CBEE 4I7AA 1ZANH 3HNTL 1QLRB 3IE4A 4BY1G 2J2ZB 3W82A 2HWZH 3DRTA 5C09E 3KJ4C 5C6TL 1P7QD 2VXTL 1U8KB 3HN8A 1NMGA 2PCFA 2ZKMX 3H0GB 3KYOB 4PBDA 5IB3A 2ZTDA 2AJZA 3AU0A 1HKLL 3VFUA 2E9IA 4JFTA 4XX1E 4TQUS 2C26A 5C0XJ 2O2LD 2X6MA 4JN2A 1KPVA 3L9AX 3I70A 3REVB 5D6DC 1TY2A 4WY7L 3O2DH 4YHPB 4C47A 1JGIA 1I9IH 2DS4A 5KZCD 4ULLA 5DRZB 4P2QB 1EY4A 2ZUXA 3SE3C 1LO5D 1ESFA 2DH2A 1B1ZA 2B59B 3SKNA 1AHMA 4ZT1A 5AD0B 3ETSA 5D93C 2K7QA 2MQ0A 1TTUA 1RJLA 5ABDE 2XPGA 3KBPA 3CJJA 5EHFA 5B1CA 2EYOA 2QILA 3I55A 2F53A 4BZ2L 4PRNA 4PJXE 4MSWB 2FUQA 2X2YA 3N6RA 1AGFB 1N5AB 1OE1A 3UTSB 4PRDA 5KOVC 1GGCH 1CL7I 4BGDA 2FX7H 3LXCA 3ECQA 2W0FB 4Q6YA 2NTFA 5B1KA 4MA1C 3WFBH 2QVFB 2B14A 2HLFC 3H0GH 5J22A 1VFMA 3I9PA 1RZFH 4IDLA 4QRRB 3JBG7 2NUPA 4KJPC 4EUPG 2MQCA 1GZPB 2Q2LA 4N87A 1K5NB 2JTDA 4RGNA 3LPFA 1MFCL 3Q7JA 4H4NA 1XF4B 2NY2C 4W1TA 2BDNH 1BVLB 2VR7A 5D7JC 4A93H 3WJJA 4AV5A 1CXEA 3TIDB 4EDXB 1XGUB 4ZMYA 5J57B 1C08A 4Z18A 4KTAA 2WLHA 4R7VA 4OZFB 1I3GH 5JR1L 1MHEB 2O5YL 3CFKB 3GSNL 4Y9GA 2J21A 3SGIA 4LAQL 4M6OL 4U1JB 2BIQA 2F7RA 2YEZA 4ISVA 4OCXL 1EGJA 2FVNA 5F7FA 1G6RL 4XWOC 2QV2A 2NTTA 2VR3A 4GRMA 4LKXB 4K3JH 5EUKB 4AMKH 1BZ7A 3AFLA 4W9EC 4OUUB 1QYGL 1AXSA 5LCVH 3UTQA 2ALAA 3KPLA 4WJWA 4JN1L 5FA3B 1PTZA 2DYSB 5F88A 5KSBB 4NDXA 2B2TA 1YNKH 3W1BA 2HB0A 3B9KC 1XTMA 3H6AA 3ZBMA 2OMBA 4FQIH 1SEBB 3ZDYB 2I5YH 1R3KA 4J6HA 3D39A 3PU7A 4LK4A 4BCXA 2A6HC 5EPLA 1NJIC 5IEHB 2QHRL 2K4KA 1JGVH 4LF5L 1H3PH 1LYLA 1QATA 3LRLA 1R24B 3RLFA 3PAYA 4PB0L 2HVKA 1YITA 4LLYA 4MJ5B 3GKWH 1RJZB 3ZHFA 1A6UH 4NRZB 1J1PL 4PJ8A 4HHAB 5CUSH 4ERSH 4ODSL 4KOCA 1KGJA 1N0XH 3DSNA 4K8RH 3S98A 4OWWB 3HOWG 1N5YL 2A1WL 3EA6A 5GGSA 4BFEA 3DA0A 1R9TH 2CKZB 1DBAL 5IKCB 4PCYA 3PJNA 2WWNA 3PPEA 2VUMG 4R7NB 4HJ0C 2N59A 5EA0L 4HIXH 5H4ZA 2QELA 1HILB 3H42H 3L7EB 1CU4L 3HG4A 4KQ3H 1JWSD 3GSOA 4QRPB 5BRZA 3BRDA 4BWUA 2EYMA 2RCSH 4GG8A 2BA1A 4DR6Q 3MAWA 2F0UA 2I07A 3KVPA 3UYRL 4MVBC 3TMEA 5EZIH 4S1SL 3R7RA 2GJRA 4CJ1B 3D34A 1GOFA 1OCRB 3PP3H 2PO4A 2GAZA 4PRAB 3TIEA 1DVSA 3TBVB 5AUMA 4AGQA 1IZKA 4FF4A 3GI8H 1H8SA 1CZ8H 1S9YB 1TLMA 1ET9A 4KMUC 2X6LA 2NSMA 3PQYD 3KGSA 4IN3A 3WUWA 4ATTA 4WJ5A 1D5MC 3SPGA 1KLGA 4Y1AD 2ICIA 2E47A 4X6DA 1AZZC 3SYCA 4BUHA 3VI4A 1PZJD 3B2UC 4QB4A 1LTAD 3KLSA 4X4YB 4K5NA 4HIHA 3I6LD 2LV4A 1AACA 3B3IB 5HYIA 4QJ5B 1L3NA 2LE9A 3H6JA 3TBYB 1E8WA 1TETH 2CDGB 3U7WL 1QRNE 4GBXD 4I0PB 2ZX9A 2BM3A 4C56C 3H7BB 1NUCA 4ODBD 2X40A 5ENWB 4BXSV 4ZTPH 5D9SA 5AVSB 3OXRB 1N4XL 4U673 2PO6C 1M3JA 3H09A 1H8LA 1OOWA 1BIIB 1OK8A 3FCBA 4HJ8A 3I9GH 4PJDA 3STZA 4LNRA 5E4OA 1D9KD 3MRHB 6CGTA 1UACH 2AQRA 2ZQKA 2GBUA 2EH8L 4X9HA 1LACA 3K6OA 2B4CL 1YPZB 2V3EA 1FSKB 1QHQA 1TWGB 1JOIA 1S7SA 2QKSA 3RNKB 5IWAQ 2NYYD 1F1GA 4NLAA 4EMZA 4LNQA 3GDEA 3C3LA 4U6VL 3II3A 5AYQA 5DD0H 3NWTA 1ETZA 3E38A 1G1YA 3H3PL 3BE1H 2MKLC 2AJ3A 3CPLB 3EFOB 1JXGA 3DUUB 4RSVA 4OTXH 1I4PA 2A83A 3K7UA 2IOOA 3D07A 3PMFA 2YUVA 3I50L 4MJ6B 3SPHA 4BA8A 4JY5H 6FABL 5CSZA 2PXYA 1YYMH 3DX9A 2JK8A 32C2B 3NCMA 3HB3B 5CILL 2RTTA 3FFDA 2VXWA 4FNLL 4KK9D 3ZSTA 1QEWB 2KZKA 4XXCC 3QJFB 3J80L 4U6YB 1TUPA 4HMJA 1F02I 2CLVA 1LLRD 1OL0A 4JDEA 3S34L 1DVUA 1JWUB 3GTJH 3T3MB 3U4AA 2A8VA 3BRGC 3MV9E 4X7FC 3FTXA 4A3FG 4Y5XB 1E43A 3FB6B 4LSDA 3QJHA 1CVRA 4CILA 2J7LA 3KYAA 2YRLA 1YBYA 1PYWB 1F3JA 1FL6B 1JZ8A 1VQ5A 3S2HB 1KXTA 1SYFA 1ZK5A 3H2PA 4FE9A 3X3NA 5I6XB 4HXAL 4FADA 2W1NA 4AMXA 1B4RA 3FU7A 3NIFF 2ZYRA 3ZKXB 3CHOA 3BPLB 4D94A 1QVGA 2VZOA 5ISZD 1S5DD 1I1AA 4X6FA 1R5IA 3LEYH 3ZE0F 4PJEA 2I26N 2XDHA 3X14A 3N42B 5CEXB 5EKKA 1SJXA 3MUY1 4OO1G 4PWGA 1NCDL 4DP6X 1KBKA 3ATEA 4WI0A 3SGDI 2WBJC 1V3MA 4JW3A 3NJKA 5E6ZA 1RODA 4R90H 4YPJA 1UENA 3HMWH 1CGVA 2QLVB 2ZXEB 3FHQA 3AC0A 5I26A 3QEGL 5L2JA 4JRYB 3WIIL 4MHEA 4A7GA 1E5UI 1K4DA 1E8YA 1J5OL 1CICA 1DLFH 3VSQA 4DV2L 1E65A 3EH4B 5I30H 5BV7C 2YA2A 3MROA 1STBA 4YSQA 3AMKA 1J8KA 1BG1A 3MA9L 3MRMA 4RDQF 4EIUA 2UY7B 2GI7A 5C0DB 4NW2A 2FLBT 1HTLD 1ZVSA 1UADC 4ZS6D 4LF8L 3K81C 2HFGH 1CTOA 4JG1H 4NO3B 4ZW3A 4XAWL 2DMKA 2ZAGA 5AVQB 1EYDA 2CMRL 3QIUA 5IJVA 4L9LC 1OWRM 3PO3G 2YPVA 1D6EA 4NKDA 1FJGL 3L5XH 1M1SA 3F05A 5DTFA 2EXTA 1FL5A 5FOJA 2R39A 5FAAA 1CD1A 1JNLL 2VL4A 3P4LA 1BD2B 3RZCA 4KH2A 4ZAKC 2W65B 4HKZA 5E6IB 4NQEB 5FKAC 3L6FA 1AO7D 1HEHC 1SBBA 3C6LA 3QWOA 3OAYK 1STYA 3FT2A 4GFTB 4IGBD 4BFGA 5D7IE 4XPAL 3IT8D 1BZEA 2VDNL 3ROLB 3RL1A 4TNWK 1XMEB 3PGCB 1VKXB 2Z7UA 1AZQA 1HPCA 2UV3A 1QMUA 1UA3A 1FYTE 1BZOA 1RZJH 2AXHA 3N43B 4DR1Q 2BVPB 3C60C 5D8JL 4MS8C 3VYNA 1QZNA 2QEJC 5F1IB 4PJ7F 4JI0L 3H85A 2BVYA 1QLEH 4Y16C 4EZJA 2D0OA 4QHNB 5IWLC 2FJGB 4GG6F 2UXBL 3HFMH 4YBQC 1AD9B 1FFPA 2O6DA 5C08D 1YMMB 1KT2B 4XI5C 2OYKA 1ZVHA 2JKWA 1E24A 3CVIH 3CVCA 3I6GA 2X2UA 4LEBA 2UXCL 2O93L 3HE7D 4X5WB 5E70A 1MREL 4G8GB 4Y4HC 3QEUA 1YMHB 4DFHA 5LNDA 4LSVH 1S9WA 1L7IL 3MJWA 1NLDL 4OWXB 4JM2C 4WJ3M 4GKZB 5C44G 2X7LA 1W72L 3JTBA 4PJ5D 5T3ZL 4NEHB 2GK2A 5J39A 2FWSA 3UP6A 3NACH 3SJVA 4V1DD 3AEVA 5IF0A 2ZWSA 4ZSOA 1X32A 1S9VB 2JB6A 4OCWL 3IS0X 2K14A 2O5XL 1VZHA 3PQYE 2BZDA 4G7YL 2K5DA 3IMBA 2A9NL 3KF6A 4Y1AE 3I6KA 3Q6GL 2AEQL 2N01B 3VSTA 2VR6A 1AH9A 1VGKB 3ZTEA 3BXNB 4R4FL 2PYED 3HS0C 4KGJA 4XMVA 4EI6A 3CHXA 3IJYB 5CU9A 4DFAA 4EXKA 4F37F 2R7EB 2CIKB 4ODTH 4ZRZA 5C0EA 1VQNA 1PQZA 3D69B 3Q3GB 5HHXL 3SPVB 2YMTA 1YA5A 3IDYB 5E7FA 3BW9A 4R4ND 4IBWA 3RVWD 4WZ9A 1WD1A 3QDMB 3MXVH 4BCZA 4LBEB 5E2WL 1GUWA 5IB1A 4MXQD 1F9SA 1YJ9A 1C9SA 2WXQA 3PGFH 1IKFL 1J0YA 4C3HH 4GXUN 3K0XA 3P1HA 1MFDL 2VH5L 4AG4L 4X6DF 4HR7B 1QCBD 1L0XA 3W5OA 4YY3Q 2X42A 3CH8A 3O2WH 3UABA 5ELBA 1E0OB 3O3AB 4XVJH 3G6EA 3VX0A 2D9CA 4AYBA 4A3KB 1LP9A 1KCBA 1YLBB 2R1WA 3F6IA 3N1MC 1BOSA 3U58A 3L54A 2VDRB 5I9QB 3C2PA 1F6AA 3NEMA 3GXMA 2RHEA 5EU3B 1VMPA 1HS6A 4K5MA 3O11A 2BRQA 4AGOA 1I6HB 1C12B 2JCCA 3VWKD 3HOUB 2B8OT 4WWKD 1ZYRC 4PJAE 1DDTA 1IILE 3AQQA 1F41A 3UGEA 1YQVH 1J8RA 4NUMA 5ELFA 2W07B 3O6FB 3U6RB 3GP7A 3KXFD 2P5WD 1AZRA 4H2CA 3T8XB 4DCQA 2R83A 4LKCA 3V5KA 3JT2A 3DVIA 1KIRA 3BO8A 1L1OA 3L5HA 3P0VH 5DEFA 3OJDA 1N6VA 2CALA 1IW7D 3HHMA 5D4IA 3KDMB 4M7KL 5K39A 2Z4QA 2B77A 1IM3B 3MRLB 2WLKA 4H0GA 2JA9A 4WHCA 1MCWW 4IU2A 1CA5A 3WHXA 3TASA 3UBXB 4KHPQ 1EBPA 1FNUA 4A3KH 1HWGB 1LK2A 1FNSH 5A2KH 2N1TE 1XTLA 1LT5D 1E4WH 4FZ8L 3JTSB 3BRFA 1GA2A 3U4VA 4DPAX 1I6HH 1NL0L 1WZLA 4F92B 1CXLA 1M7XA 3HOUH 3DUZA 4KDWA 3FSOA 3FYEB 3SD5A 3L9BA 3CC4A 1QZHA 1AXTH 2XIIA 1XMOL 3BH8B 2XCMC 2Z7ZA 1QVCA 1KDBA 2ZYIA 3LH2L 4FQQB 4PQXA 4OZ4B 2AJVH 2X09A 4IM8A 1TSRA 1KCVH 1EZ6A 1F11A 2JV6A 3TCXA 4X6CE 4F2MB 1JN6B 3LIUA 4BZ1L 3KS0H 3P20A 3SXHA 1U8NA 4TSBL 1KRSA 2DYPB 1KLFA 5IP9G 2YTVA 2D2OA 2Q76B 4OQTA 3A4FA 5A43C 2YFOA 4GW5B 4KI1A 1B7YB 3FONB 5D3DA 1KB3A 3TVMC 2H7WA 3UDWC 4UTAL 1UQSA 4QTIL 2G60L 3LS5H 3IMVA 4HUCA 1R3IH 2H47C 3WY3A 5LMUL 3RAJH 3SE6A 3D06A 3VXRD 5BW7C 2YOAA 1NFDB 5FJ8G 3FTYA 3MLZH 1KBVA 4PJEF 4R4BA 3UYPA 4AYDC 1R47A 1VSCA 1A9BA 4OZHF 1SVZA 1E6JH 1JJ2A 1LO5A 4QOKB 3HUJE 3UOAB 1K73C 3GGWA 4H8PA 2HHHQ 4HFWB 3WENA 1JGDA 4OELB 1YAZA 3DLLA 3J81E 5SX4I 5CV9A 3NJMA 1VQIA 2BE5D 5FYKH 4Z7WF 1J88A 2OSXA 2AERT 3S3CB 3GSRA 3WG7B 2Z31B 3KPSA 5E4EC 3OHMB 5IBUG 1VRSA 5IHLB 5FLUA 1EJOH 4TV3A 3EJJX 1SLUA 3GZKA 3FFCA 4YGAB 4NAJA 4HIJA 1WAEA 1CL7L 5B22A 1JMXA 1FZOA 2Q5BA 4M8VA 5DLMH 5KJ4A 1INQB 2YPLB 3X3GH 2R9HC 1B3AA 4MMYA 3NABL 1M1XA 2WVVB 5DSCA 3VH8A 3VJ6B 5FO8A 1JZ5A 3MFGB 2C1OA 4OM0H 3Q13A 2K75A 2DLFL 4WKXA 4P46C 2BRRH 4WGKA 5INCB 1X6OA 2BSTB 1CLOL 1RZ7L 2UYLB 2ZJSL 4KMTL 4KJYB 2FIKA 3PDOB 2Y07H 1A6ZB 3ULUD 4HF5L 5DF0A 1AQKL 3VXMA 5FWRA 1EYAA 3BT0A 2XRSD 2Q3ZA 3Q1SL 4LLDB 2JEBI 3UO8B 2GTZA 3ILDA 4TRPH 1HZHL 1MHPH 4JCVE 4YO0B 5L6YH 5C08E 4J1MA 1YNND 2BIHA 2JFCA 2OJZL 2NVQB 1BLNB 2WNWA 5C0ND 1V1QA 3HNTH 4NC0B 1JYWA 5C6TH 4OO1I 2VXTH 5ERWB 2V9TA 4OLZL 4NCC1 5EIVA 3QWRD 2J1WA 4YFLF 3L0OA 1HKLH 1NC2B 5E00A 1W91A 2X9XA 4HH9A 3UTTD 3ULVE 3FTSA 5DVNA 3CSPA 4PJ5E 2IBBA 4QWWC 2KCMA 4NCDA 4WY7H 5JOEA 5BOZG 5CU5A 2K70A 2JKXA 3BVTA 4I18C 5CM1A 2BCOA 5HYJE 1TZ8A 1N0LB 4V1DE 2E2IB 3ZZSA 1F4AA 1ITBB 1N7ML 4ZG1A 3IU4L 1ZGLB 3UZEA 4ZFFB 2FD6L 4F7CB 2L4OA 3WTYA 3MRJA 3CE1A 4ELDA 4ALPA 5I0VA 1WDAA 4M7LT 1P5VA 3V6FA 1E30A 4BZ2H 4EF3A 3ARRA 2YXFA 1MNNA 4CBVA 2GIXA 2PYEE 4JBSA 1IBML 4AQ1C 5HYSG 1L9RA 1G6RB 3R7QA 1S5FD 1HNFA 2OSLA 2W60B 5I1DA 4LSRL 2GVAA 4NT6B 3K80A 1N33Q 2B0SL 2NVQH 2XC8A 3Q2CA 3DV4A 4KTEL 4KX9A 1GOZA 3P9LB 2A6JA 4NPYA 1K2DA 2IGTA 3BLKA 3DIDA 4FHBD 2CO6A 4OU3A 2VYRE 4W9IC 5LDUA 5E6SB 3JWDC 2NY3B 3V6BR 1OSYA 2DB8A 1ZV5A 2NY0B 4AKQA 1G9NC 2LMCB 4ZAIA 1S9XB 4LVNC 4NBZB 1MFCH 3MRPA 2SEBD 4DEPB 4PZ8A 2PCPB 4Z3IA 3JV4A 1EIHA 5TDPA 3KWWB 3CF5A 5E94B 2E2IH 5JJLA 1M7IA 1WZKA 1LTTD 1V27A 3EHBD 4F8QA 5JR1H 1DSFL 1I6VC 2O5YH 3V0WL 4R26L 3GSNH 4L1DA 3ARDA 43C9B 5FECA 2EUVA 2EC9T 4LAQH 4M6OH 4GJTB 3ATAA 3TBSA 1GUOA 1I9EA 1XH1A 2WCPA 3VFNA 1S7QB 4OCXH 3PQYA 1G6RH 2ATPB 2DD8L 1WITA 2MNJB 1WF5A 3BWAA 1MQ8A 4HW6A 4QRUA 4FQLL 3H0TA 3NSXA 1QYGH 1FORL 1AR2A 1UXMA 3RWEB 1B0RA 2OKMA 4JN1H 1E27B 2P5WE 2FBJL 3FT1A 4WJ4A 5DS8A 2Z6BA 4WK2B 2KA7A 4HUXB 4GBXA 4JHAL 5DMKA 2NZ1D 3MNZB 3W57A 1C5DA 3VFGL 1LP9F 4TF4A 3QCVH 3A74A 3WSQL 1RURL 2HX8A 2QPDB 3UI2A 1Q7YC 2E7LA 2QHRH 2NW2B 4RKLA 4PB0H 4U7SA 3K74B 1MIEL 4AI7A 3G5VA 3GMOB 4Y9CA 4E5XB 4FQJL 3V9EA 1HA5A 3EADA 3LNFA 4U6HA 2Q8TA 5CCGE 3OGOE 1E3ZA 1J1PH 4RGTA 25C8L 3G7LA 4CJ0B 2YWZA 4ODSH 5SX5H 3M1BA 1TU2B 5H2BB 3WLWC 3ZTCC 5JPMB 3C5JA 1N5YH 5GS1A 4J4PC 1ZIAA 2A1WH 4LEXH 4JI7L 3BP4B 4D3CL 1VGEL 4XMXA 1DBAH 4DVRL 3UAEA 4NNYB 1G7MA 2N1KA 3SN6N 2DEXX 2UWEE 3MXNB 3G04B 3KYMB 1ZHKA 4JHWL 4UZUA 2CHNA 2YK1H 4HAEA 5LNGA 2VGLM 4Z0XA 2VKXA 3HHSB 3ISWA 3U4BL 3KBEA 1WD8A 3D0LA 3BC9A 4KY2A 2NNXA 5EA0H 5T1JA 1TTBA 4RCOA 4X6AH 3MRBA 4NB7A 1OWWA 1T1ZB 1CU4H 3DBXA 4HLZG 1O7DC 4FXKB 4TLSA 4BM7A 4IRSA 1JPSL 3UYRH 4K71B 5E08L 2O5ZL 4WU7B 2WXLA 3NIDE 3C5XA 3FQXA 4S1SH 2OR9L 4WTWA 2BWIA 2HLFD 2NR6C 5AOIA 5F8RC 4FHJA 4CC4C 1YDPB 1QUNB 4KJPD 1L0PA 2GJ6D 1EA9C 1A02N 1EEQA 1GH7A 5GHWL 5D2NE 4UNVA 4I4WB 1KCSL 4CC1A 4ZOEA 3FU8A 8FABA 2NY2D 5D7JD 3RFZB 2UUAQ 4I1NB 2R59A 4CSPA 4ZTEA 3BVWA 3ARGA 2XXGA 1GUNA 2XZZA 3GRBA 4B50A 2ZYHA 4DO4A 3CZEA 5FC9A 1G7PB 2H0PA 4XGZB 3U7WH 5DQ9B 3DK2A 2PR4L 5CR8A 4TQHA 1MI5A 2JXMB 1OV8A 4IO9A 1HSBA 4PRIB 2XT1B 3EOYG 3H4FA 3B9VA 4X4ME 4XWOD 1CGWA 3IRPX 2EIJB 3PJSB 1A2UA 4NKQB 5IYDH 4UOZA 1N4XH 5ISZA 1DQJA 2AAAA 4ZQTA 1R6VA 2BXYA 3MGTA 5C6WH 5EBMA 1H6FA 5KVGL 2DI7A 3RWDA 3SDZA 2D3NA 4LEOB 3FQWB 4J23A 1PNDA 4HBCL 4N2IA 5DMGC 5AW6B 1IGYB 2FJHA 3ZQWA 2AI0L 3VI3A 4TXVB 3B9KD 3NCXA 2EH8H 4Q9QL 1KTDB 2NZOA 1JPTL 3LH9A 2XFXB 3ZYYX 4YDLC 2B4CH 2A6HD 1TZHB 1U41A 1BVKA 2K5QA 5CGYC 1JF5A 3TYFB 1FL3B 1M7UA 1U93A 1J8HE 3VCLA 1B9KA 1QO3A 1U91A 1XL6A 4U6VH 3WFCL 3EYSL 1PEWA 2IAND 3QIBB 4AYFA 4YDIL 3QWNA 4Q6IC 1UXSB 1I4QA 3H3PH 3NIGB 2BNUA 4HS8L 4P57A 3QUYB 5I8KL 3VGAB 1JZ3A 4MTKA 1TYJA 2CUMA 3CCHA 2COVD 1KXVC 1FC1A 1X5AA 3FU6A 4TMPA 2PYFB 3OYYA 3MA7B 1TMCB 2LW3A 4FG6C 4TUOA 4TULL 4QGUA 2OI9B 1GJIA 2YD4A 5F44A 4X98A 6FABH 1EBAA 5J1ZA 3D3VE 4N5EC 1I7RB 1NGXB 4XP9L 4HOWA 5CILH 5GS2D 4U4IA 2EYSB 4FNLH 3OQ3B 3PHQA 4RAHA 4QF4A 3DJTA 3C9NA 3V0GA 3S34H 3UTTE 4CSSA 1W16A 1FNEB 5TD4A 4V2BA 3G6AB 2WVUA 4XO5A 1AGEB 5E5RB 2BCMA 1A6WL 3F7LA 5GQOA 2V33A 3DWTA 4X9IA 1AO7A 4QAWA 4HUNB 4LHUB 2J12B 3TZVA 3Q05A 2WYZA 3FRPA 1EFXD 2PPBC 1TVBA 4OGAC 1KCRL 2NNCA 4HXAH 4HSVA 2I85A 4KXDA 1DVXA 1WBXB 4ONFL 4JFEB 1QI4A 3B2UD 5ITBL 3MRRA 1PRTB 4P5MB 5DZVA 2MJWA 1BPLB 4A3JG 2ZAIA 1SROA 3GMMA 2GSIB 3BP7A 3K3QA 1TYRA 2OT2A 3MX0B 3ZUCA 3OD3A 4FYDA 1NCDH 4C56D 2VM4A 3WELA 1CT8B 4F9LA 2RQXA 1KC8C 1Z6JT 2Q9OA 3T77B 3MUUA 4N68A 3HE7A 1YNJC 1OAJA 3UZVB 3Q0AA 2M83A 2PO6D 5AW4B 5EBCA 3D4CA 1Z5LB 4JFFB 1GVPA 4JI1L 4CGUB 1GYWA 4MN3A 4CAGA 1U58A 1AFVL 3WIIH 2FYYB 3GSQA 2VDNB 5EEWA 4YLQT 3NBNA 1QI3A 1J5OH 3BZEB 4CBPA 3MJ6A 3GHPA 4FP8H 5FYJL 2Q2HA 5C4XG 4KN4C 3I4NB 2ZUYA 4V1DA 3MA9H 3QXWA 2Q7AA 3V0IA 3LXBA 2BP8A 2IALB 5DD1L 4JI2L 4TVPL 4HEPG 5E9NA 4ZFZB 3HPJB 3BHBA 4EI5B 3UDFA 1I8LA 1B4TA 1KZQA 3E6HB 4KUCF 4S2SA 4XAWH 2LU7A 4HVBA 1V1OA 3WOEA 2CMRH 3PUYA 2PYEA 3H94A 4DQAA 1QBAA 2X0UA 5CZKA 1B9NA 2Y5EA 5FK9A 2CR6A 3BDOA 3CCQA 2WVSA 1QI5A 5FO2A 3UPAA 3QFJD 2J2ZA 4B96A 1EVTC 1URZA 1JNLH 4IU3B 5BZWB 3FDWA 2NUCA 4GAJL 4NKMA 4UU9B 4MYPA 1JAEA 2JA8B 2BY3A 1OM3L 1D5RA 2F0KA 1FFTB 4H8QA 5LLIC 1NAMA 5ELOA 3REVA 4XPAH 5E24E 4BH8A 2H1XA 2VDNH 4YHPA 3TSSA 2R4SL 1SDDB 5DRZA 2BMKB 3S5LG 5I2XA 3IJ7A 3BD5A 4MXWL 5F0LB 3OMCA 5D8JH 4MB3A 2ED8A 4UMSA 1U3HC 3I4NH 1Z5YD 2FB4L 5DI8A 5K36G 3KDFA 4O2CB 2FHFA 3EYFB 1JZEA 4GKLA 5HXMA 1EOTA 4IYKA 4KVNL 1PH2A 4R9WA 1J1XL 4G8EB 1J5DA 3CC5A 4EIZC 1XF3A 4MSWA 2VY3A 4HIDA 1CDUA 1N5AA 2CVRA 2WQ8A 4JG9A 3QFDA 1MREH 1E6OL 1ND0A 4IOIA 5JIKA 5IZ7A 2W0FA 1XAUA 1PFSA 2R0LL 4AQYQ 5INDB 3CIAA 4DXFA 1NAKL 3WKML 1L7IH 2E6QA 1A6PA 1NLDH 3K4ZA 3KXFA 2PW5A 4JCLA 5DDHB 1L9MA 1QG7A 4EEEA 4RZCA 2JA8H 1W72H 5GGRB 5T3ZH 3S96A 4S0HA 2WBJD 3MTSA 1W6WA 1GZPA 3RE0A 4LL9A 4YX2L 3VGGA 1KB5L