4JI4Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji4Q00
4DV6Q 1XNRL 2GVBA 1OXVA 3HOUH 1HZBA 4YWMA 1BKBA 4LFCL 2K14A 1M90C 1VQDA 1HNZL 1VQOA 2UU9L 3PO2H 1VQ5A 1EQRA 3PUXA 4X6AH 5FJ8H 1VS0A 4ALPA 4B3TQ 1AE3A 2OQ0A 3I4NH 3S1NH 3CW2C 1TWGH 1H95A 4DV1L 1WFQA 3E9IA 1A63A 4P73A 4C3HH 1QUQA 3GD7A 1L2FA 3E9HA 1EQQA 4BXXG 2AKWB 5GAGC 1K83H 4X66L 4PZ8A 1L0WA 4A3JH 5J3BA 2JA6G 4AH6A 2UXBL 1NE3A 3CC4A 4WJ4A 2Y0SE 1JB7A 4YCUA 5JEAJ 4JOIA 3HOWH 2HIVA 1GM5A 1S40A 5C4XG 1DGSA 3LGJA 3OW2A 4JBKA 2Q2UA 1XNRQ 4DK6C 4GN3B 4GKJQ 4DR5L 2Z6KA 4JI4L 4LFCQ 3PUZA 4LF5Q 1B70B 2MNAA 1HNZQ 2NVQH 2UU9Q 1X65A 2CWPA 1VQEA 3CAMA 5EAYA 4GLAC 2JA5G 4A3BG 1YITA 1SE8A 1JJ2A 5LMUL 2IX0A 3UE0A 3ZJYC 2F4VL 1EUJA 3A5ZB 1EIFA 3SGIA 2NN6G 2WB1E 4DV1Q 1MJEA 2K4KA 1K73C 1WOCA 3G6EA 4R4OA 1N36L 3ER0A 5IYDH 4X66Q 2CKZB 3F8TA 1VCIA 3U58A 2YU9H 4NXNL 1YI2A 4LFAL 2UXBQ 1OXXK 2VY3A 3HOZH 1KHIA 4GNXA 1X54A 3BZCA 4IPHA 1KIXA 4HIMA 3B6YA 2MFIA 2YV5A 5C3EG 4HJ7A 4DR5Q 4JI4Q 2K5HA 4JC0A 1V43A 5IP9G 1VQGA 4A3MG 1FJGL 4MTNA 5M5XH 1XTDA 1HNXL 4BBRG 4IFDI 3AYHB 1OXTA 1YBYA 4HJ9A 4OONA 1XPUA 5LMUQ 4Y7NH 2EXDA 4A3FG 2F4VQ 3CF5A 1E1OA 3PV0A 1E22A 1G6PA 3I4OA 1N34L 3PUVA 1JT8A 3KOJA 2RCNA 3I4MH 2D0OA 4JCVE 1PH3A 3J81j 3PO3H 1N36Q 4HIDA 3T1YL 3L2PA 4AIMA 2JJQA 1E24A 3JAMc 3I56A 4LFAQ 4GOPA 4UP8A 3T1HL 3Q8DA 2N3SA 4BY1G 4GLVB 4YCVA 3JC66 1VQNA 1BBWA 1QZHA 1XNQL 2ES2A 1UE7A 4DUYL 5C0XI 3FKIH 1VQFA 2NVYH 4B3RL 2AWNA 3M85A 3KF6B 2MO0A 1YEZA 1HNWL 2IHEA 3ICEA 1HZCA 4Y52H 2JEBI 2K50A 3CCEA 4A93H 4P74A 4IOCA 2R92H 4JI5Q 1FJGQ 3NELA 1I5FA 1K0RA 2LXKA 2VZAA 4JBWA 1XPOA 1R9TH 1HNXQ 2OWOA 1IBLL 4P72A 3I7FA 2K5NA 3K81C 2B29A 5M5WH 1JE5A 4BA2I 4KHPL 3OYYA 5GADC 4B3ML 1N34Q 4A3CH 3PGZA 1SROA 2GN5A 3T1YQ 1IBML 5ELNA 1SN8A 2L15A 2JA8H 2AHOB 3GTPH 2B63G 4JYAL 1AH9A 4DR2L 3S2DH 2XGTA 3ERSX 4DUYQ 2R7ZG 3CCJA 3H3VI 1L1OA 2Y0SG 1C0AA 2QEXA 1N33L 3F2CA 4B3RQ 3ULPA 1K9MC 2F52A 1HH2P 1HNWQ 4A3IH 2Q2TA 2N8NA 5FLMH 1Q1EA 5LMNQ 2UUCL 4K0KQ 1XJVA 4LUOA 3I4MG 4LF7L 3PO3G 1PH6A 1N32L 1LTLA 5ELOA 1HJPA 3IRBA 4DV0L 4GKKL 1B8AA 5GQOA 4KHPQ 4UPAA 4B3MQ 4UP7A 5M3FG 4WJ3M 1K8GA 5IYCG 2CFMA 2I5MX 1Q46A 3FKIG 3MXNB 4JBJA 4P75A 4TVAB 4A3EG 3HOYG 4FDBA 1S3OA 3F2DA 1QUQB 1IBMQ 1JJCB 2KHIA 4JG2A 2E2IH 1V9PA 3FHWA 2JA7G 4JYAQ 3EIVA 1PH1A 1SR3A 2HQLA 4AYBE 4DR2Q 1LUZA 3H0GH 1HR0L 1TWCH 1NY4A 1N33Q 3EBEA 1YJWA 4X64L 5IT9c 2IY5B 4DR6L 1YJNA 3KLWA 4BA1I 1VQ7A 3M7NA 2UUCQ 2WP8J 4DV3L 1PYSB 4A3CG 2OQKA 2VS1A 4BY7G 4LF7Q 1U5KA 3H15A 4JI0L 2K52A 2PQAA 3S1RH 1N32Q 3K7UC 3CXCA 4DV0Q 1CKNA 1FVIA 2D62A 2K5VA 5AJ3L 4GKKQ 3S1QH 4IPCA 5BR8L 2I0QA 1D8LA 5C44H 4DR1L 2QA4A 3GTOH 2WAQE 3NBHB 2ZJPA 1K3RA 1Z9FA 4R4CA 4OWXB 1Y1VH 4JI2Q 2UUAL 2UUBL 1Q12A 4YWKA 1PYBA 2BH2A 5GROA 3RZOH 3I4NG 4BBSH 4A3GH 4K0KL 3CCUA 3I55A 3GTKH 1HR0Q 4QJFA 3FP9A 4DV5L 4GNXB 5K36G 4X64Q 4QY7A 5IP7H 4LUVA 2AMCB 2EIFA 3GTQH 3D0FA 3ULLA 4KLKA 5IWAL 1KAWA 2E5LL 2NZHA 2BA1A 4DV3Q 1O7IA 3S16H 4GN5A 3W1BA 1VQMA 2JEAI 4JI0Q 1IXRA 3K7AH 1XMOL 1G51A 2DUDA 4HIOA 5AJ3Q 1ASYA 5BR8Q 4DR1Q 2VUMG 5JJIA 3H0GG 4HJ8A 4B3SL 4QQBX 2JE6I 2R93H 1VQKA 4LWCA 3HOUG 1I6HH 1B7YB 2NVXH 3K8AA 3L7ZC 2UUAQ 3RN5A 2UUBQ 4DR7L 4IJHA 4AQYL 2C35B 3J81c 1CUKA 4R1JA 1Q82C 2B3GA 2KCTA 2KCMA 4JI6L 1QVFA 3M4QA 3PO2G 1YJ9A 2RF4A 3CPFA 4DV5Q 5FJ8G 4IOAA 2ZTCA 1X55A 1WYDA 2LSSA 3BZKA 1GO3E 1AE2A 3K0XA 1OTCA 2E2JH 3TS2A 2N49A 4UY8C 1IYJB 5IWAQ 4DV4L 2I5HA 2E5LQ 2OCEA 1EFWA 5IYBH 5M3MH 1YZ6A 4A3JG 1G291 1PV4A 3RLOA 3S17H 1KRSA 4IJLA 1XMOQ 4HJ5A 1VQJA 3PCOB 4JI1L 4LF9L 3HOWG 3M3YH 1C7YA 3CCQA 3OTOL 4B3SQ 3AFPA 1J5EL 3UDIA 1S72A 4NXNQ 1CKMA 3CQZH 3H3VH 2YYZA 1P16A 4DR7Q 2UXDL 2V1CC 1HZ9A 4LF8L 1PFSA 1ASZA 3ULJA 2DGYA 3HKSA 4JI6Q 3DM3A 4JI8L 1E3PA 1YIJA 4AYBG 1W2BA 1A0IA 1L1OB 1Y1WH 4A3DH 3L0OA 1GVPA 4DPGA 4NXML 4DV4Q 4OO1G 1VQHA 1XPRA 1NJIC 5IYDG 3UDFA 2RHSB 1PH9A 5C0XG 2VQEL 4IO9A 4OX9L 2KHJA 1VQ9A 4GLXA 3EN2A 3HOZG 3JAMi 4JI1Q 4YCWA 1YHQA 3MEFA 3OTOQ 4DR4L 2HHHL 2PI2A 4PG3A 1J5EQ 3T1HQ 4C2MH 3CCRA 2UXDQ 3HOVH 1EOVA 2WAQG 1XNQQ 4PZ6A 4LF8Q 1FL0A 1A8VA 1IL2A 4A3KH 4QIWE 1WCMH 1X3FA 3J80c 1VQ6A 4JI8Q 4A4IA 4QGUA 3CCMA 1KQSA 4GN4B 2BH8A 3CD6A 5DLQE 4JI7L 1VQLA 4NXMQ 1JMCA 1P8LA 3KYHC 3PUWA 1IBLQ 2MO1A 1Q8KA 4EX5A 1E7ZA 1MJCA 1OXUA 4IPGA 1Q7YC 4A3LH 2VQEQ 4A76A 1MIUA 1X56A 4OX9Q 2ZJRA 4KI0A 4X65L 1K8AC 4JV5L 1QVCA 4X62L 3D31A 2PQAB 1TWHH 2WB1G 3BU2A 4NPSA 3STBD 2HHHQ 3TRZA 4DR4Q 4BXXH 1LYLA 3UDXA 4YWLA 3A0JA 1W3SA 2JA6H 4A93G 2ZTEA 4YHHL 3CPWA 2R92G 1GKHA 5C4XH 1GD7A 3VDYA 2Q2HA 1XMQL 3GTGH 2WFWA 2RHQB 2VL6A 1UEBA 1MKHA 1X3GA 4XTCS 4JI7Q 1NMFA 2ALYB 3HOXH 4IFDJ 3U4VA 3G4SA 1VQ4A 4POFA 2XTIA 4LNQA 1Q1BA 3AQQA 2JA5H 2MQHA 3S14H 3KDFA 4A3BH 1U0LA 3K80C 2ZM6L 1VQCA 1N8RC 2JA8G 3HOVG 4X65Q 4JV5Q 1QVGA 1BBUA 1VQ8A 3CP0A 1KL9A 2GVAA 2AWOA 4LUZA 1FGUA 3W1GA 2ID0A 2K75A 3F2BA 2PNHA 1EIYB 3M4OH 5JJKA 3TEHB 2NVTH 3S2HH 4GKJL 5C0XJ 4A3IG 1WI5A 5FLMG 1Q86C 4LF4L 4LF5L 4YHHQ 3UE1A 4A3KG 1YVCA 1CSQA 4LF6L 1XMQQ 4DR6Q 4LFBL 5C3EH 2HIXA 1X3EA 4A3LG 4R4TA 4PZ7A 5IP9H 3CCLA 4UP9A 2YTYA 4A3MH 3TREA 4L5SA 1VQAA 4GS3A 1V1QA 2Q2IA 4BBRH 1PA6A 3RZDH 1IBKL 1YHAA 3WWVA 2ZM6Q 4PMWA 4A3FH 1UE5A 3M9BA 1SMXA 4R4IA 4OWTB 4O2DA 2VQFL 3AEVA 3RN2A 2BA0A 1L1OC 4XIGS 3CMAA 3GTMH 2NN6I 2D0PA 3TS0A 4DV7L 4BY1H 2PMZE 4GOPB 4LF4Q 4L5RC 3HOXG 4ME3A 4RMFA 4RG1A 3S1MH 5IY0A 3G48A 1PH2A 3S15H 5GAEC 4LF6Q 4OXPA 3AFQA 1M1KC 2ATWA 4DKAC 4LFBQ 4JI3L 1UE1A 3PIPA 1A62A 1YNXA 5E7NA 4IPDA 1NTGA 1PH8A 4H02A 1YHBA 4HIKA 5C44G 4TQUS 3HKZE 2JK8A 2KENA 3PUYA 1Q81C 1Y1VG 2ZJQA 1IBKQ 1C9OA 2CQOA 2KBNA 4L5TA 1I3QH 3HFZB 2VQFQ 3S24A 1T9HA 3KF8B 1LM0A 1NMGA 4EQ5A 5LMNW 3RNUA 3J81i 4A3GG 3CMEA 3GTJH 1PVOA 4DAYB 3CCSA 5IP7G 2N78A 4DK3C 4IFDG 1VQIA 4AQYQ 1N9WA 1OXSC 2Z0SA 3I2ZA 4DV7Q 2B63H 1PHJA 1J6QA 1RL2A 5HGQA 2R6GA 4YY3L 1PH4A 4OWWB 4JI5L 2R7ZH 1EWIA 4DR3L 4C3JH 2VW9A 1BVSA 2CCZA 4JI3Q 3NEMA 4L5QA 1JJGA 3TQYA 3A5UA 1Z47A 3GDEA 4DUZL 4R4QA 2EQSA 5JJLA 1KD1C 4O0AA 1TWFH 1IZ6A 4DV2L 2R93G 1KRTA 2I5LX 1WJJA 2JQOA 4DNIA 3M4PA 4JOIC 4LF9Q 4OO1I 1Y14B 1SRUA 5M5YH 3BJUA 3E0EA 2IHFA 2R7FA 5M3FH 1RIPA 5IYCH 3PIOA 4A3EH 3HOYH 2Z6KC 1UE6A 1CSPA 2UXCL 2A8VA 2JA7H 3W5OA 2IT1A 2PI2E 4YY3Q 3J7ZC 5LMNL 4APVA 3GO5A 5IYBG 4DR3Q 5M3MG 2E2HH 1KC8C 1D7QA 4MNOA 3UDGA 3STBC 3G71A 1SFOH 3A74A 4C3IH 5FLXc 5JEAG 3KJOA 4LW1A 2A19A 1QZGA 4DUZQ 1I94L 5HY6A 1PH5A 1SLJA 2F3IA 4DV2Q 1HR0W 2E8GA 5IE8A 5H1SE 4BY7H 2YTVA 5GAHC 1X6OA 1NBWA 4QL5A 3U50C 4GNXC 3KF6A 2H5XA 3F1ZA 3KDFB 1CKNB 3NENA 1VQBA 1TXYA 4KHZA 3PSIA 3RR5A 3CCVA 4DV6L 5C4JH 3PF5A 1VQPA 2ZTDA 3J80i 4HJAA 3RLNA 2HT1A 4NB3A 2UXCQ 1Y1WG 4A3DG 1HZAA 2R7DA 4BBSG 3CC2A 2NZOA 3DLLA 4JBMA 2FXQA 2JA9A 1PH7A 1I50H 4MZ9A 2CWAA 4B3TL 3KJPA 1E1TA 4P71A 2OTLA 1UWVA 2VNUD 2ASBA 1I94Q 3PF4A 2QGQA 1CKOA 1TWAH 3J7A5 1EYGA 4POGA 1X9NA 3GTLH 3RLFA 2OTJA 2IX1A 4DAMA 4GOPC 3KFUA 3HKZG 3U4ZA 4A75A 4JI2L 1KXLA 4X62Q 2A1AA 2YTXA 3CC7A 2LXJA 1WCMG 2VUMH 4J15A
chains in the Genus database with same CATH superfamily
3BVZA 4DV6Q 2GVBA 3A7LA 1H9JA 3HOUH 2EYJA 1BKBA 3K57A 3I4MB 4LJZC 2BDNA 4F87A 1HNZL 3PO2H 1VQ5A 2EYMA 3Q22A 3PUXA 5M5YB 2I46A 1EY6A 4HSVA 4X6AH 3S1NH 1HQMC 1VS0A 2OQ0A 3MXNA 2X69A 4DV1L 2EY5A 4XQNA 4C3HH 1QUQA 1ILPA 5GAGC 2E2HB 2JA6G 3D3RA 4OEMB 3CC4A 4YCUA 2F0GA 4JOIA 5C4XG 2HCCA 1HUMA 1XNRQ 1B4OA 2Z6KA 4JI4L 5IT9L 1B70B 2MNAA 3D4WA 4KJOA 3CAMA 1RTNA 2JA5G 4FF4A 2IX0A 3UE0A 2F4VL 3NBHA 3JAME 2WB1E 2Z4IA 3AMUA 5CBAE 2H1EA 1K28A 4R4OA 2PQEA 3ER0A 3A56A 3F8TA 3PIP3 4LFAL 3ZYYX 1OXXK 1WTPA 3C46A 1PTOH 1RCVD 2EY2A 3B6YA 1TWAB 4HIMA 1KIXA 2EJGC 2K5HA 1F9PA 2F0WA 3CHBD 3TMEA 5IP9G 4A3MG 2F0FA 1HNXL 1A15A 4DK1A 1SE2A 3H0GB 5LMUQ 1Z6HA 4HMJA 1E22A 1N34L 5FKAC 1U4PA 3PUVA 3KOJA 3DWPA 2C5CA 5EPKA 4BWGB 3Q8DA 4YCVA 3I4NB 1QZHA 3D4RA 4DUYL 1VQFA 1R4QB 3MFGA 4B3RL 4RGNA 3M85A 4X3SA 4WORA 4ZCKA 3CCEA 4A93H 4P74A 4IOCA 1FJGQ 3HOWB 1K0RA 2VZAA 4JBWA 2NB0A 1BDOA 4HR7B 1X3QA 4X3KA 2O4XA 5G3LF 4B3ML 5GADC 1EY4A 3K5MA 1B50A 1JQYD 5ELNA 1HCZA 3LWUA 3K58A 1AH9A 3NK9A 4DR2L 5TSSA 2XGTA 3ERSX 1D5MC 4IALA 3TP7A 1HNWQ 2N8NA 5LMNQ 1C48A 1QNKA 1SNDA 3QR8A 1SEBD 4RKBA 4ZAIA 3PO3G 1GUWA 1PH6A 1JWMD 1N32L 4GKKL 1B8AA 3EA6A 4UP7A 5M3FG 5IYCG 4JBJA 4FDBA 1ZKOA 1JJCB 2KHIA 4QB4A 1V9PA 2A5HA 2JA7G 4JYAQ 2A6EC 2HQLA 1LUZA 3J80L 1YJWA 1WTRA 1RJTA 4C3IG 4DR6L 1YJNA 2F4IA 3TP8A 4PQXA 4A3CG 4M1UB 2VS1A 4BY7G 1HQRD 3CXCA 4DV0Q 3MXGA 5A2QL 2K5VA 4RWSC 5BR8L 1D8LA 1KNEA 5IGDA 1WVLA 3GTOH 1K3RA 4KK7A 1LO5D 2UUAL 4CDDC 3NQTA 1PYBA 1WTHA 1PXUA 5GROA 3RZOH 4CKCA 4QJFA 4CJ1B 4X64Q 2B2WA 1PFNA 5IP7H 1IYVA 4LUVA 3OIQA 3GTQH 2EIFA 1KAWA 3V05A 2BA1A 1O7IA 3S16H 4GN5A 3EJIA 2IJ0A 3HP3A 1XMOL 1SYBA 2DUDA 1NSNS 3BDLA 5AJ3Q 4DXGA 4QUFA 1ASYA 4K8JA 4DR1Q 2KCNA 1MGSA 2QILA 2C35B 2Z9HA 1YJ9A 4DV5Q 5FJ8G 2ZTCA 3BZKA 3QG1A 4J6HA 1AE2A 1E2ZA 3TS2A 1STAA 2N49A 1CA6A 1F2MA 1U4LA 4DV4L 5IWAQ 2E5LQ 5M3MH 1YZ6A 4NKLA 3RLOA 1EOTA 4LF9L 1PTOF 2CH4W 3T4AC 5HGTA 4XT1B 4B3SQ 3QJYA 3OW7A 3KBXA 2YYZA 2UXDL 3A8KE 1HZ9A 5EPLA 4R8IA 3S1RB 3J81L 1STHA 5E3FA 3S1QB 1E3PA 3I8ZA 1W2BA 3OWEB 5IOCA 1L1OB 1ESRA 1GVPA 2BE5D 1XPRA 3GTKB 3QWNA 5C0XG 1ICFB 3HOZG 4OGQC 3JAMi 4JI1Q 4YCWA 1YHQA 3MEFA 1D6EC 3RUZA 2JN4A 2PI2A 1KAAA 2B2VC 4I7ZC 3CCRA 2OF1A 1S5ED 4PZ6A 1G6ZA 4KKTA 1HPCA 1A8VA 4MN3A 4A3KH 1WCMH 1X3FA 4A4IA 3VR3A 4QGUA 3CCMA 2BH8A 2RKSA 1I6HB 4NXMQ 1SJHD 2EY1A 3HRZC 1G91A 4PMCA 4EX5A 1XWEA 2VQEQ 4N8FA 5IODA 3DM1A 3R2TA 3D31A 5C3WA 3STBD 3TRZA 4DR4Q 1EY8A 4BXXH 4I65A 2FINB 1LYLA 3UDXA 2M00A 2E74C 1CTMA 5M9OA 1CHPD 1Y8PB 3S17B 4YHHL 1GKHA 4KTAA 5CORA 1KLGD 3NQIA 3VDYA 2F03A 3J7YW 3GTGH 1HFGA 3J7AV 4XTCS 1EY9A 3SK4A 3CQZB 1NMFA 4JI7Q 2ENBA 1VQ4A 1X3PA 1Q1BA 1PRTD 3S14H 1U0LA 2KHSA 2ZM6L 1VQCA 2RCFA 1N8RC 2JA8G 3HOVG 1QVGA 1BBUA 1KL9A 1O7LA 2AWOA 1FGUA 2XIWA 1O80A 4KD3A 1K0SA 3FVQA 4A3IG 2EXZA 1WI5A 2EYOA 4GKJL 1Q86C 1BBXC 4LF5L 1IYUA 2A6HC 2M2LA 1R4PB 1A3TA 1CSQA 2RSNA 4DR6Q 1YNNC 1X3EA 2KOLA 3QOLA 3HKZB 3OMCA 2XSCA 3CCLA 1VQAA 3RZDH 5I2YA 3WWVA 4A3FH 3M9BA 5EJWA 1MD2D 4R4IA 4OWTB 4O2DA 2VQFL 3RN2A 3E5SA 1T5XD 1DOMA 1LT5D 1TU2B 3HGBA 1S5BD 3K5LA 4BY1H 4XQQA 4GOPB 4L5RC 4RMFA 1BQQT 3G48A 5LHY1 1M1KC 1DONA 5KRUA 5E7NA 1O78A 1PH8A 2PW5A 3WOEA 2JA6B 4Z9CB 4HCSA 1D5ZC 3CU7A 4RA8A 5C4XB 3TP6A 4FVMA 2QCPX 4JVZA 4A3GG 1T9HA 3KF8B 4RGMA 2KUMA 4K6DA 2F0NA 2PW7A 5IIFA 4DV7Q 2JA5B 2DY8A 5HGQA 1PH4A 2LY7A 4C3JH 1BVSA 4JI3Q 4L5QA 1JJGA 4RGTA 1D5XC 1HTLD 3GDEA 3VR6A 2EQSA 4V190 1PZID 2R93G 2CW0C 1SNPA 2KEEA 1QNUA 1C4QA 4UAIA 4LF9Q 4OO1I 1BF4A 1SRUA 5M5YH 4O1NA 3WDNA 2QDLA 1ESFA 4A3MB 2UXCL 2KEDA 2A8VA 1TT2A 1UEAB 4YY3Q 1RTOA 4MTKA 3GO5A 5IYBG 2E2HH 1QJOA 1S5FD 3UDGA 2KCCA 2JXMB 5JEAG 3GTMB 2A19A 4R8NA 3TN2A 4DK0A 4G4KA 5E4WC 3S1MB 2G5DA 2ICEC 4QMGA 5IE8A 1EQVA 3MHBA 1SYCA 1X6OA 1PRTF 5IGBA 2Q8TA 3KDFB 4KHZA 3CCVA 4DV6L 1TS2A 3E6ZX 4XYOA 1PZJD 2F0OA 1Y1WG 4A3DG 1HZAA 3NBIA 3CC2A 1F2ZA 2D2CC 3L3OC 3DUZA 3KJPA 2OTLA 1UWVA 2AUJD 1I94Q 3PF4A 1FNWA 1CKOA 1TWAH 3J7A5 4XQJA 3MXPA 1B2TA 3BG3A 5CBEE 4DAPA 4OL7A 4CDEC 1TY0A 4CBVA 2A1AA 3CC7A 4QUCA 4DPGA 2N88A 2XWBB 1U4RA 1XNRL 4LMQD 1TWFB 2PMZB 1HZBA 1M90C 3PO3B 4TRDA 4V0BA 4KY5A 1BCPB 2ZXOA 1EQRA 5M3FB 1WTXA 4ALPA 2J0TD 3I4NH 2M9VA 1H95A 3SE0A 3E9IA 2K5WA 2JA7B 3GD7A 1L2FA 1GUSA 4ZKBB 4EGVA 1EY7A 4AH6A 1R9TB 1V8QA 1JB7A 4C3IB 5I6YA 3HOWH 2HIVA 1GM5A 3D6WA 5KNBA 4EVOA 3LGJA 3OW2A 3GV3A 2Q2UA 4GKJQ 4LFCQ 4BY7B 2RVLA 3PUZA 4LF5Q 5I4DA 2FJ2A 4CHTB 2CWPA 1VQEA 1CZGA 3QO2A 4DNTB 4GLAC 4LAAA 3S2DB 2B2UA 5ELBA 2K6AA 5LMUL 5IGFA 1SNQA 4EQNA 2D5DA 2N55A 1MJEA 2L11A 3G6EA 1JR0D 5DM63 1VCIA 1YI2A 1ONLA 3MWYW 4DN4M 4GNXA 2BOSA 3RMHA 5J39A 1NNXA 4ZUJA 2MFIA 2YV5A 5C3EG 4DR5Q 1AN8A 4G57A 1S5DD 4JC0A 1II3A 1LT4D 4HMIA 1FJGL 2JSOA 4BBRG 4IFDI 4KMUC 1XPUA 3I4OA 1JT8A 2F0QA 2D0OA 5NUCA 3J81j 1N36Q 4HIDA 3L2PA 3JAMc 4GOPA 1PYWD 2DJGC 4GLVB 1VQNA 3FPPA 2ES2A 1AP0A 5C0XI 3P75A 2NVYH 2ZT9C 2F0EA 3KF6B 2MO0A 1HNWL 3ICEA 4Y52H 5JVH3 2IX3A 5A2QE 1LACA 3NELA 1XPOA 1J9OA 4ZUIA 1X32A 1D2BA 3KF8A 1JE5A 5K5PA 4BA2I 5CV5A 3OYYA 2NVQB 4XYQA 2IPKD 2GN5A 1RDPD 5CV9A 3T1YQ 3VR5A 1H9MA 1LT6D 4K5VA 3SEBA 1EEID 4JYAL 2Z6BA 5EBCA 2R7ZG 3CCJA 3H3VI 1C0AA 2QEXA 2F52A 1HUNA 4HCEA 1HH2P 2LFNA 2PZTA 5FLMH 2YU9B 3MEHA 3HOZB 1VF7A 1RD9D 4K0KQ 1XJVA 3R2IA 1DCZA 3D4DA 4DV0L 4KHPQ 4P75A 3HOYG 4TVAB 4PNYA 4WFN3 4Y7NB 3EIVA 2J7ZA 4FF3A 4AYBE 2QDBA 2EE1A 4OIKA 3EBEA 2VB2X 3EROA 4KHVA 4X64L 2IY5B 3KLWA 1JICA 4XXEA 4BA1I 1VQ7A 2UUCQ 4N8X1 4LF7Q 3FKIB 3FEWX 2XN9C 1U5KA 3S1RH 2PQAA 1FVIA 2D62A 5AJ3L 3S1QH 2F0MA 1NR2A 4DR1L 2TMPA 3AU7A 3J81E 2FHTA 1Z9FA 5ELDA 1PZKD 3F2UA 3GTKH 5LL6X 3I55A 4RCNA 5EKIA 4DV5L 2FMMA 1YNJC 4HEDA 2BCOA 1TS5A 2JA8B 3ULLA 3GTPB 5IWAL 3HOVB 2E5LL 2NZHA 1MHWC 4DV3Q 5FK9C 1VQMA 2CH4A 4A3IB 5C6AA 1E2VA 4B3SL 4QQBX 1PFBA 2JE6I 3NXWA 3W3AA 1FNUA 1I6HH 1B7YB 2UUBQ 1BXTA 2P5ZX 1CUKA 2KCTA 4ODGA 2F0KA 1RODA 1X55A 4NP5A 1WYDA 1OTCA 1IW7C 2AQ2B 4UY8C 4IUUA 2A73B 2OCEA 1U4MA 1B44D 1GUTA 4A3JG 1G291 1TWCB 3S17H 1KRSA 3QB3A 1VQJA 4JI1L 1EZ8A 1ZEQX 3H09A 1WD1A 3AFPA 3CQZH 4UDUC 1ENCA 1ENFA 1ASZA 4JW0A 1F9QA 2HDLA 3H6MA 3DM3A 1ICWA 1YIJA 4AYBG 5CMDA 4NXML 4F7XA 2PO4A 4OO1G 4A3GB 1XYIA 5IYDG 3UDFA 2VQEL 2KHJA 1PTOD 5FO9B 3EN2A 4GLXA 1VQ9A 5IGEA 3OTOQ 3T56B 3SVMA 4DR4L 1BCPC 5C5MA 5I9OA 5KNCA 4NMZA 4LF8Q 4QIWE 4JI8Q 3GP7A 1KQSA 2HD3A 1EYDA 2R93B 4IUNA 4CGYB 4JI7L 1VQLA 1O7YA 1LTSD 1SMYD 5D14A 1JMCA 3S9WA 1XX8A 1TS4A 1Q8KA 2NBFA 1Q7YC 4TSSA 4A3LH 1UAPA 3KLSA 3T13A 1L0YB 1QVCA 4FXDA 2NTSA 2WB1G 4NPSA 2MJ8A 2Z1CA 2JA6H 3A0JA 1W3SA 5T1IA 2R92G 1F9SA 2X6GA 3CPWA 5CV6A 5C4XH 1GD7A 4B9WA 2WFWA 1MKHA 3HOXH 4IFDJ 2EYFA 1HA6A 2CHBD 2KQ3A 2JA5H 5BN3A 1LTTD 2F0LA 1Y1WB 4DXFA 4A3DB 1DD2A 4LUZA 4XDXA 1C8CA 5C0XJ 4X3UA 1BR9A 1QOHA 1XMQQ 4R4TA 1FGBD 3KK7A 4C2MB 1QWYA 5IP9H 1RF2D 1JWSD 4A3MH 3TREA 2K7VA 1V1QA 2QF7A 1YHAA 4O42A 3AEVA 2K05A 2O5IC 2BA0A 1VF5C 3CMAA 3GTMH 1JC7A 2D0PA 3TS0A 4DV7L 5CV8A 3I72A 2H4OA 4RG1A 3S1MH 5IY0A 4OXPA 2ATWA 2O2LD 4LFBQ 3AB9A 4JI3L 1TIID 1UE1A 3PIPA 1YNXA 1ML0D 4IPDA 4IUTA 4MHEA 3MC0B 4QF4A 5JJZA 5C44G 4TQUS 1Y1VG 1H9SB 4K8IA 1IBKQ 2CQOA 4BBSG 3J81i 1QE6A 1BOSA 5KGUA 5JPNC 2N78A 1QILA 4IFDG 1HFNA 1N9WA 1OXSC 4LK1C 5FLXE 3BDCA 3SHLA 1KDCA 4YY3L 2R6GA 3NPPA 4I7AA 4JI5L 2VW9A 2CCZA 3NEMA 5BN5A 2PZUA 2LMCB 1Z47A 3C3LA 2NVTB 3A7AB 5JJLA 1KTKA 2OT2A 1TWFH 1IZ6A 5FO8B 2JP1A 2I5LX 2R61A 3M4PA 1IW7D 5C3EB 4HAEA 3IFDA 3E0EA 2IHFA 3J7AF 4PV1C 5M3FH 1RIPA 5IYCH 2A69C 3H3VC 4G7OC 4BBRB 3R93A 1GUNA 2JA7H 4FYDA 2PI2E 5FO7B 4ZKCB 1PFMA 1SE3A 3G71A 4C3IH 3KJOA 5ISRA 1I94L 5KIXA 5HY6A 2OEOA 1AZQA 2MUYA 1PH5A 1SLJA 1HR0W 2E8GA 4BY7H 1ZYRC 2YTVA 3JAML 4QL5A 2MP1A 3F1ZA 3NENA 1KD1C 1CKNB 1VQBA 1IKLA 4HN7A 3RLNA 1K8OA 3E0JA 1I4QA 3C1EA 5KEEA 3ND8A 3GTJB 2VNUD 2IWHA 1NR4A 3RLFA 2IX1A 2R7ZB 4A75A 3VYSA 4JI2L 4ZK9B 2NN6H 1AFPA 4MIUA 2YTXA 4J15A 2RDHA 5KYLA 1OXVA 4LFCL 1TKWB 1VQDA 1VQOA 1LABA 1S4ZA 4KN7C 5FJ8H 1WD0A 1AE3A 1GXDC 3HOYB 3CW2C 2A6ED 3ITPA 1WFQA 3W2DA 4P73A 1QG7A 2HCIA 1LV9A 1EQQA 4PZ8A 3MZ5A 5J3BA 3DHQA 1SFOB 5JEAJ 1TR5A 3OIPA 4RFBA 2RDGA 4DK6C 4GN3B 4DR5L 3VA7A 4HSPA 3URYA 2NVQH 2UU9Q 3VYRA 4A3BG 1YITA 1SE8A 2DN8A 5C4JB 2L55A 3ZJYC 2ZXRA 1EUJA 2ICIA 3A5ZB 3I73A 2XRQD 2K4KA 1K73C 1HXYD 1WOCA 3G7LA 1N36L 4X66Q 3U58A 2YU9H 1I50B 5C0XH 2UXBQ 2VY3A 3HOZH 1A2UA 1KHIA 1O7ZA 3BYYB 4CDFC 3BZCA 2O5JC 2DNEA 2OXPA 4RH6A 2K32A 4HJ7A 3HEJA 3SK8A 3GTLB 1CI3M 1V43A 2R3ZA 1VQGA 3CRLC 3RD4A 2B2YC 1XTDA 1OXTA 4Y7NH 2EXDA 2PPBC 3M7GA 1UNSA 3CF5A 3PV0A 4FP5D 2Z4HA 2RCNA 3I4MH 1CK1A 4UHVA 1NUCA 3T1YL 4AIMA 2JJQA 1E24A 4RGOS 3HZXA 3I56A 1L0XB 1IL8A 2N3SA 3JC66 4C1NK 1XNQL 1I4GA 1TWGB 1UE7A 1H9KA 1WTVA 3FKIH 3P7JA 1LTAD 1MSHA 4NDXA 2AWNA 2L4NA 2PYKA 5I6WA 2IHEA 1K83B 1HZCA 4A3JB 1JB3A 2JEBI 2K50A 3NSWA 4JI5Q 1I5FA 2LXKA 4K0KL 1EFID 3HS0C 2WINB 1DYQA 5CR3A 1ET9A 1BCPF 2K5NA 1V1OA 2B29A 1VMPA 4KHPL 3NUCA 1F77A 3PGZA 1B9NA 2KECA 3FDTA 1SROA 4DA2A 2RBMA 2K28A 2L15A 2AHOB 5IT9E 4AYBB 5C3XA 2B63G 2JA8H 3GTPH 2EYPA 2SDFA 3NTHA 1L1OA 2A68C 2MHVA 4A3IH 2Q2TA 1Q1EA 1SSOA 2B2TC 2QKIC 4C56C 2UUCL 3TBIB 4L6TB 4LUOA 4LF7L 1A3UA 1LTLA 5ELOA 1HJPA 3IRBA 1V1PB 5GQOA 4UPAA 4WJ3M 2CFMA 2I5MX 1Q46A 3MXNB 4A3EG 4WRDA 5M5XB 1G2SA 1PLFA 2HDMA 5EBDA 1QUQB 3F2DA 1OO9B 1IBMQ 4JG2A 1NCVA 2V4DA 3KBGA 4N9TA 3H0GH 1TWCH 5COYA 1N33Q 1HA5A 1DOKA 2ZXPA 3M7NA 2WP8J 4H0LC 2XWJB 2RSOA 4DV3L 1PYSB 2WB1B 2IW3A 3K7UC 1CKNA 1EYCA 2QA4A 2R92B 1EY5A 2WAQE 3NBHB 1W6KA 4J1MA 1I4PA 4JI2Q 2UUBL 4DGZA 1FYCA 4YWKA 2QEJC 5M5WB 1AW7A 4A3GH 1HR0Q 1M4VA 5K36G 2KA7A 4RCOA 3IL8A 2E75C 2I07B 2NZ1D 4X3TA 2AMCB 1WTOA 1UUPA 2JEAI 4JI0Q 1DM0B 3LNNA 1IXRA 2A6HD 5ELEA 2VUMG 1YNND 1FD7D 1G8ZD 2R93H 1VQKA 4LWCA 2J4XA 4KV6A 3HOUG 3K8AA 3L7ZC 4IJHA 4AQYL 2VB3X 3J81c 4FXGC 4R1JA 3X3MA 1Q82C 3PO2G 4DNRB 4K6LA 3CPFA 2AUKA 3UI2A 3MVVA 4K2KA 4C3HG 3N52A 2E2IB 2I5HA 5IYBH 3HG9A 3FRPB 3NHHA 5JEAH 4ZQ3A 2L1BA 4OIJA 1C7YA 1EEFD 1GUOA 4B08A 3OTOL 1EY0A 3UDIA 3J80E 1CKMA 1P16A 4DR7Q 2V1CC 4KKUA 4LF8L 1PFSA 3HKSA 4FF2A 1DOLA 3K0YA 4JI6Q 4FF1A 1GHJA 4JI8L 5C44B 5HURA 2E76C 1Y1VB 1Y1WH 4A3DH 1GHKA 3LWEA 5T1GA 3PIO3 1SNCA 1CFMA 1VQHA 5DM73 4BBSB 3M4YA 2RHSB 4IO9A 4EQPA 5JVG3 4FO2A 4PG3A 1J5EQ 4C2MH 1KLUD 2WAQG 1XNQQ 2WKCA 4KY6A 3K7AB 3K5OA 3TZUA 1IL2A 2CW0D 4DAVA 3K59A 2DJFC 3CD6A 5J22A 5IGCA 2NVXB 2F0PA 1I4RA 3KYHC 3PUWA 4RHSA 5ELFA 2MO1A 3BVGA 1E7ZA 2F0JA 2TSSA 1OXUA 2IL8A 2F0IA 4FXKC 4A76A 4OX9Q 2B39A 2NTTA 2E2JB 1Z7TA 2Q8IB 4ZYSA 1LTGD 1CZWA 3BU2A 2HHHQ 3SXHA 3A8IE 3MTSA 2EY6A 4A93G 3M3YB 1EL0A 1XMQL 5C4ZA 1X3GA 2ALYB 2B8GA 2XVSA 2K04A 3Q6SA 4M8AA 4LNQA 3DWAA 3QIAA 3AQQA 2MQHA 3KDFA 4JV5Q 4X65Q 4F88A 1MBYA 1VQ8A 3CP0A 2F0VA 5EQ0A 2K75A 3ND9A 2PNHA 3F2BA 4H7BA 2Z8LA 5JJKA 3TEHB 2NVTH 4IZ8A 3FMCA 1BUVT 3UE1A 2FMCA 3ERQA 3A55A 3Q24A 1TS3A 4LFBL 1V1PA 5I2XA 5C3EH 4A3LG 1SBBB 4GZYC 4YIJA 3TZDA 4GS3A 2Q2IA 4BBRH 1PA6A 1IBKL 4ID6A 4KN4C 4IQZA 2EJFC 1B53A 3E3XA 1RHPA 5CYUA 5EGTA 5JPMC 2PMZE 4LF4Q 3HOXG 4ME3A 3OMGA 1GUGA 1PH2A 5GAEC 4LF6Q 3AFQA 1CQVA 1KDBA 1TWHB 2L5TA 1A62A 5E4XA 4H02A 5JAVA 1YHBA 4HIKA 2JK8A 1PMRA 2KENA 1Q81C 3VA5A 2ZJQA 1C9OA 1QCBD 1Q90A 2G9HD 2SEBD 4K5WA 4L5TA 2F3WA 3S24A 3I90A 1LM0A 2F0TA 1Y8OB 3I70A 3OPOA 2BE5C 3GTJH 1PVOA 1E2WA 4DAYB 3CCSA 4KJNA 4CKBA 5IP7G 3NP8A 1VQIA 2F3VA 4AQYQ 2Z0SA 4A3BB 2JYOA 1J6QA 4OWWB 1A2TA 2R7ZH 2K01A 2G9DA 5DEHA 3TQYA 2CVRA 3M4OB 3A5UA 3S2HB 2K5DA 3IKJA 4PMBA 4R4QA 3PMFA 4O0AA 4WJWA 1VMCA 1KRTA 3U9OA 1SJED 2JQOA 4Q5VA 1XTCD 3TP5A 4DNIA 1STBA 5IGGA 1I4XA 4JOIC 1ILQA 3G6JB 4RAUC 2R7FA 3PIOA 2CQAA 3HOYH 2Z6KC 3VR4A 1CSPA 2EOTA 2GA4B 1ET6A 4RKLA 2RQXA 3W5OA 2IT1A 3J7ZC 5E1FA 4DR3Q 5M3MG 1KC8C 3SR1A 1D7QA 1S5CD 3STBC 1SFOH 5CV4A 5FLXc 4LW1A 1QZGA 4DUZQ 3CKIB 5CV7A 3K5NA 4C1NI 4DV2Q 5H1SE 3S15B 5GAHC 1GJXA 2SOBA 4P2CB 1SYDA 3I3CA 1STNA 3KF6A 2H5XA 3RR5A 1VQPA 5C4JH 3J80i 4HJAA 4FNFA 4NB3A 1PRTC 1A3VA 3NWTA 1JORA 3DLLA 3DMUA 1I3QB 4EQOA 1PH7A 1ZXTA 1I50H 4MZ9A 1U9RA 4ZRZA 4CKEA 1E1TA 4P71A 4DU9A 1STGA 1LT3D 2B63B 2WACA 1X9NA 4POGA 3GTLH 2OTJA 3O13A 1LTID 4L8JA 1KXLA 2L9HA 4Q0FA 4A3KG 1WCMG 4NW2A 1B3AA 3BS1A 4K14A 1H9RA 4YWMA 4CJ0B 2K14A 2UU9L 1KDAA 2WV6D 1K3BC 4BS9A 4B3TQ 4A3EB 2EYHA 2BDOA 2NVYB 1TWGH 5F2DA 3GQBA 1A63A 1M8AA 1B1ZA 2NUCA 3E9HA 1DJRD 4BXXG 2AKWB 1K83H 3A54A 4X66L 1L0WA 5KNDA 4A3JH 2UXBL 3MXUA 4WJ4A 1NE3A 2Y0SE 1JWUD 1S40A 1DGSA 5D65A 4JBKA 2B2VA 3N6RA 1A6XA 1HNZQ 1EYAA 1X65A 1AZPA 5EAYA 2HQEA 5L37A 1JJ2A 3DEOA 3R3OA 4DV1Q 3C2PA 1EIFA 3SGIA 2NN6G 4OO1H 5IYDH 1YNJD 2CKZB 4NXNL 2FFKB 3MA2B 2F0HA 3PQIA 1X54A 4IPHA 1SNOA 1SE4A 2A74C 4U673 4JI4Q 3MAQA 1G2TA 1WTQA 4ZLTF 4MTNA 3D8GA 5M5XH 5D3IB 3TSSA 3AYHB 2VUMB 4HJ9A 1YBYA 4OONA 1Q8IA 4A3FG 1CM9A 2F4VQ 4DFAA 3HOUB 1E1OA 2DY7A 1G6PA 3DWQA 4K2LA 3CRKC 4ME5A 4JCVE 1PH3A 3PO3H 3PO2B 1Y8NB 2EPBA 4LFAQ 4UP8A 3T1HL 4BY1G 3S1NB 1BBWA 2WKDA 1CQFA 1QB5D 2MGSA 4C3HB 2B2WC 3DEPA 4E6IA 1YEZA 1JOOA 1RKNA 2R92H 1DXMA 1R9TH 1HNXQ 2OWOA 1IBLL 4P72A 4IN3A 3I7FA 1BO0A 2C9OA 3K81C 5M5WH 3VYTA 1PDQA 1N34Q 1EIGA 4A3CH 4DAYA 4QCLA 3EQLC 1IBML 1SN8A 3GV6A 2SNSA 1JOKA 3BYTB 4U68A 3S2DH 4DUYQ 2Y0SG 4C3JG 4RHRA 4TKOB 1N33L 4B3RQ 3F2CA 3ULPA 1K9MC 2PNRC 5D3DA 2QW7A 3ONAB 2K5QA 1BCPD 2PZWA 3C1FA 3I4MG 1PTOB 3BDOA 3VYUA 1SXTA 1BNZA 4B3MQ 1I4HA 2WAQB 3T16A 1K8GA 2L12A 3FKIG 1S3OA 4JK1C 4IUQA 3T51B 2E2IH 3TDQA 3FHWA 1PH1A 2NYZD 1SR3A 4DR2Q 1HR0L 1NY4A 3T53B 5ELCA 5IT9c 1D1KA 1F2YA 4DF7A 1B9MA 4ILWA 2K03A 5J1ZA 2F0UA 2B2YA 2OQKA 1D1IA 4KKSA 2E2DC 5I9PA 3H15A 4JI0L 2K52A 3IFTA 1N32Q 4GKKQ 4IPCA 2I0QA 2F0SA 5C44H 1EU3A 4A93B 2ZJPA 4R4CA 1EWHA 4OWXB 1Y1VH 1WTWA 1Q12A 2LS01 2BH2A 4BBSH 3CCUA 1CA5A 2Q8RE 3FP9A 1JOQA 4GNXB 4QY7A 4IFDH 3D0FA 3L9AX 4KLKA 2LKVA 3W1BA 3K7AH 1EWCA 1G51A 4HIOA 1IKMA 1DZ1A 5BR8Q 5JJIA 3BVMA 3R8BA 1MI2A 3H0GG 4HJ8A 2NVXH 2UUAQ 1AEXA 4DR7L 3RN5A 3EVQA 1QVFA 2B3GA 2KCMA 4JI6L 3M4QA 2RF4A 4IOAA 2LSSA 3I4NG 5DAUA 3K0XA 1GO3E 2HUGA 2E2JH 4J8QA 2B2TA 1IYJB 1EFWA 1SYFA 2L0CA 3I91A 1PV4A 4OELB 5EKKA 3NE5B 4IJLA 1XMOQ 2WIIB 4HJ5A 3PCOB 2VXWA 3HOWG 3M3YH 3V96A 3CCQA 3HOXB 1EIHA 1J5EL 1S72A 4NXNQ 3H3VH 3SK6A 3OOCA 3WOFA 3H91A 1TVXA 2DGYA 3ULJA 1GOZA 4H13C 5C5LA 3GTOB 4F8MA 1A0IA 3L0OA 1H9SA 4K5XA 4DV4Q 4N9PA 3RZOB 1NJIC 1EU4A 4OX9L 2XRSD 3K6OA 3IAYA 4IUVA 3GTQB 3MFYA 2HHHL 3S16B 1JCKB 3T1HQ 2UXDQ 4KD4A 1EOVA 3HOVH 1K8MA 1T5EA 1Y69U 1FL0A 3J80c 1VQ6A 4GN4B 4CDCC 5DLQE 1SNMA 3Q23A 4G7HC 2PCFB 1P8LA 2A69D 1SYGA 2K33A 4ULLA 5EPJA 1IBLQ 1LTRD 1MJCA 4IPGA 5BN4A 1MIUA 1X56A 3EFXD 1EZ6A 2ZJRA 4KI0A 4X65L 1K8AC 4JV5L 4X62L 5CC4A 2PQAB 2DNCA 3VR2A 1TWHH 3NTKA 5CGKA 5M3MB 4YWLA 2ZTEA 2KVMA 1TY2A 1XXGA 1ZYRD 5LL6S 1MSGA 2B8FA 2Q2HA 2RHQB 2VL6A 1UEBA 3OHXC 2XNAC 5FLXL 1FNVA 3U4VA 3G4SA 4POFA 2XTIA 4OHJA 3QOJA 3P1HA 4A3BH 2F0DA 3K80C 2GVAA 3W1GA 1EIYB 2ID0A 3I4LA 1F2LA 3M4OH 3S2HH 4B9XA 5FLMG 4R9WA 4LF4L 4YHHQ 3NWSA 1YVCA 4LF6L 1KABA 1Q3LA 2HIXA 1B3QA 1W6JA 3DXJC 1JE4A 4PZ7A 4S3SA 4UP9A 1PRTB 2YTYA 3A8JE 3SK5A 4CJ2C 4L5SA 4A3KB 1WCMB 2ZM6Q 4PMWA 1UE5A 1SMXA 3H94A 3OSOA 2AQ3B 3FPUB 1L1OC 2EJMA 3Q0AA 1J8IA 4XIGS 3V2TA 2NN6I 1EQTA 2F1MA 3KUPA 3S15H 1KNAA 4DKAC 1NTGA 1IHZA 4G7ZC 1NAPA 3HKZE 3KLSX 3PUYA 1STEA 4HTHA 1CT1D 5AFWA 2KBNA 3GTGB 1I3QH 3HFZB 1SYEA 4EQ5A 2VQFQ 3RNUA 5LMNW 1NMGA 2RDFA 1STYA 2SNMA 3CMEA 1TQOA 2KJXA 3NTIA 2K1BA 4DK3C 3P20A 4QIWB 3I2ZA 3S14B 2B63H 1PTOC 1PHJA 1RL2A 2EYLA 1EWIA 4DR3L 5A35A 1HTPA 3KLRA 4DUZL 3D6CA 1HHVA 5JOBA 4DV2L 1WJJA 2MPMA 4KY7A 2X6LA 1Y14B 3BJUA 4JPBW 4ABNA 1SMYC 4A3EH 2AQ1B 5EKLA 3BZDB 1UE6A 3RZDB 4A3FB 5LMNL 1I6VC 4APVA 4L63B 4MNOA 1E0BA 2B2UC 3A74A 4IURA 2EVBA 1LLRD 2NWGA 3SDZA 3LX0A 4BY1B 2EDGA 2F3IA 1FR3A 2EZVA 1NBWA 1HRJA 3U50C 4GNXC 1SAPA 2D9UA 3X3NA 1PH9A 1TXYA 3PF5A 1ENAA 3PSIA 2ZTDA 3OWFA 4XT3B 2HT1A 2UXCQ 1F9RA 2R7DA 4JBMA 2NZOA 2FXQA 2JA9A 5C4HA 2CWAA 1CHQD 5K36H 4B3TL 5DNFA 5G3LD 3U9SA 5FOBB 2ASBA 2QGQA 1EYGA 4IUPA 2RA4A 1SDFA 3KFUA 4DAMA 4GOPC 2A68D 2Y0SB 3HKZG 4H44C 3U4ZA 4C3JB 1LTBD 5KYIA 4X62Q 1VDZA 2LXJA 2VUMH
chains in the Genus database with same CATH topology
4DV6Q 1XNRL 2GVBA 1OXVA 3HOUH 1HZBA 4YWMA 1BKBA 4LFCL 2K14A 1M90C 1VQDA 1HNZL 1VQOA 2UU9L 3PO2H 1VQ5A 1EQRA 3PUXA 4X6AH 5FJ8H 1VS0A 4ALPA 4B3TQ 1AE3A 2OQ0A 3I4NH 3S1NH 3CW2C 1TWGH 1H95A 4DV1L 1WFQA 3E9IA 1A63A 4P73A 4C3HH 1QUQA 3GD7A 1L2FA 3E9HA 1EQQA 4BXXG 2AKWB 5GAGC 1K83H 4X66L 4PZ8A 1L0WA 4A3JH 5J3BA 2JA6G 4AH6A 2UXBL 1NE3A 3CC4A 4WJ4A 2Y0SE 1JB7A 4YCUA 5JEAJ 4JOIA 3HOWH 2HIVA 1GM5A 1S40A 5C4XG 1DGSA 3LGJA 3OW2A 4JBKA 2Q2UA 1XNRQ 4DK6C 4GN3B 4GKJQ 4DR5L 2Z6KA 4JI4L 4LFCQ 3PUZA 4LF5Q 1B70B 2MNAA 1HNZQ 2NVQH 2UU9Q 1X65A 2CWPA 1VQEA 3CAMA 5EAYA 4GLAC 2JA5G 4A3BG 1YITA 1SE8A 1JJ2A 5LMUL 2IX0A 3UE0A 3ZJYC 2F4VL 1EUJA 3A5ZB 1EIFA 3SGIA 2NN6G 2WB1E 4DV1Q 1MJEA 2K4KA 1K73C 1WOCA 3G6EA 4R4OA 1N36L 3ER0A 5IYDH 4X66Q 2CKZB 3F8TA 1VCIA 3U58A 2YU9H 4NXNL 1YI2A 4LFAL 2UXBQ 1OXXK 2VY3A 3HOZH 1KHIA 4GNXA 1X54A 3BZCA 4IPHA 1KIXA 4HIMA 3B6YA 2MFIA 2YV5A 5C3EG 4HJ7A 4DR5Q 4JI4Q 2K5HA 4JC0A 1V43A 5IP9G 1VQGA 4A3MG 1FJGL 4MTNA 5M5XH 1XTDA 1HNXL 4BBRG 4IFDI 3AYHB 1OXTA 1YBYA 4HJ9A 4OONA 1XPUA 5LMUQ 4Y7NH 2EXDA 4A3FG 2F4VQ 3CF5A 1E1OA 3PV0A 1E22A 1G6PA 3I4OA 1N34L 3PUVA 1JT8A 3KOJA 2RCNA 3I4MH 2D0OA 4JCVE 1PH3A 3J81j 3PO3H 1N36Q 4HIDA 3T1YL 3L2PA 4AIMA 2JJQA 1E24A 3JAMc 3I56A 4LFAQ 4GOPA 4UP8A 3T1HL 3Q8DA 2N3SA 4BY1G 4GLVB 4YCVA 3JC66 1VQNA 1BBWA 1QZHA 1XNQL 2ES2A 1UE7A 4DUYL 5C0XI 3FKIH 1VQFA 2NVYH 4B3RL 2AWNA 3M85A 3KF6B 2MO0A 1YEZA 1HNWL 2IHEA 3ICEA 1HZCA 4Y52H 2JEBI 2K50A 3CCEA 4A93H 4P74A 4IOCA 2R92H 4JI5Q 1FJGQ 3NELA 1I5FA 1K0RA 2LXKA 2VZAA 4JBWA 1XPOA 1R9TH 1HNXQ 2OWOA 1IBLL 4P72A 3I7FA 2K5NA 3K81C 2B29A 5M5WH 1JE5A 4BA2I 4KHPL 3OYYA 5GADC 4B3ML 1N34Q 4A3CH 3PGZA 1SROA 2GN5A 3T1YQ 1IBML 5ELNA 1SN8A 2L15A 2JA8H 2AHOB 3GTPH 2B63G 4JYAL 1AH9A 4DR2L 3S2DH 2XGTA 3ERSX 4DUYQ 2R7ZG 3CCJA 3H3VI 1L1OA 2Y0SG 1C0AA 2QEXA 1N33L 3F2CA 4B3RQ 3ULPA 1K9MC 2F52A 1HH2P 1HNWQ 4A3IH 2Q2TA 2N8NA 5FLMH 1Q1EA 5LMNQ 2UUCL 4K0KQ 1XJVA 4LUOA 3I4MG 4LF7L 3PO3G 1PH6A 1N32L 1LTLA 5ELOA 1HJPA 3IRBA 4DV0L 4GKKL 1B8AA 5GQOA 4KHPQ 4UPAA 4B3MQ 4UP7A 5M3FG 4WJ3M 1K8GA 5IYCG 2CFMA 2I5MX 1Q46A 3FKIG 3MXNB 4JBJA 4P75A 4TVAB 4A3EG 3HOYG 4FDBA 1S3OA 3F2DA 1QUQB 1IBMQ 1JJCB 2KHIA 4JG2A 2E2IH 1V9PA 3FHWA 2JA7G 4JYAQ 3EIVA 1PH1A 1SR3A 2HQLA 4AYBE 4DR2Q 1LUZA 3H0GH 1HR0L 1TWCH 1NY4A 1N33Q 3EBEA 1YJWA 4X64L 5IT9c 2IY5B 4DR6L 1YJNA 3KLWA 4BA1I 1VQ7A 3M7NA 2UUCQ 2WP8J 4DV3L 1PYSB 4A3CG 2OQKA 2VS1A 4BY7G 4LF7Q 1U5KA 3H15A 4JI0L 2K52A 2PQAA 3S1RH 1N32Q 3K7UC 3CXCA 4DV0Q 1CKNA 1FVIA 2D62A 2K5VA 5AJ3L 4GKKQ 3S1QH 4IPCA 5BR8L 2I0QA 1D8LA 5C44H 4DR1L 2QA4A 3GTOH 2WAQE 3NBHB 2ZJPA 1K3RA 1Z9FA 4R4CA 4OWXB 1Y1VH 4JI2Q 2UUAL 2UUBL 1Q12A 4YWKA 1PYBA 2BH2A 5GROA 3RZOH 3I4NG 4BBSH 4A3GH 4K0KL 3CCUA 3I55A 3GTKH 1HR0Q 4QJFA 3FP9A 4DV5L 4GNXB 5K36G 4X64Q 4QY7A 5IP7H 4LUVA 2AMCB 2EIFA 3GTQH 3D0FA 3ULLA 4KLKA 5IWAL 1KAWA 2E5LL 2NZHA 2BA1A 4DV3Q 1O7IA 3S16H 4GN5A 3W1BA 1VQMA 2JEAI 4JI0Q 1IXRA 3K7AH 1XMOL 1G51A 2DUDA 4HIOA 5AJ3Q 1ASYA 5BR8Q 4DR1Q 2VUMG 5JJIA 3H0GG 4HJ8A 4B3SL 4QQBX 2JE6I 2R93H 1VQKA 4LWCA 3HOUG 1I6HH 1B7YB 2NVXH 3K8AA 3L7ZC 2UUAQ 3RN5A 2UUBQ 4DR7L 4IJHA 4AQYL 2C35B 3J81c 1CUKA 4R1JA 1Q82C 2B3GA 2KCTA 2KCMA 4JI6L 1QVFA 3M4QA 3PO2G 1YJ9A 2RF4A 3CPFA 4DV5Q 5FJ8G 4IOAA 2ZTCA 1X55A 1WYDA 2LSSA 3BZKA 1GO3E 1AE2A 3K0XA 1OTCA 2E2JH 3TS2A 2N49A 4UY8C 1IYJB 5IWAQ 4DV4L 2I5HA 2E5LQ 2OCEA 1EFWA 5IYBH 5M3MH 1YZ6A 4A3JG 1G291 1PV4A 3RLOA 3S17H 1KRSA 4IJLA 1XMOQ 4HJ5A 1VQJA 3PCOB 4JI1L 4LF9L 3HOWG 3M3YH 1C7YA 3CCQA 3OTOL 4B3SQ 3AFPA 1J5EL 3UDIA 1S72A 4NXNQ 1CKMA 3CQZH 3H3VH 2YYZA 1P16A 4DR7Q 2UXDL 2V1CC 1HZ9A 4LF8L 1PFSA 1ASZA 3ULJA 2DGYA 3HKSA 4JI6Q 3DM3A 4JI8L 1E3PA 1YIJA 4AYBG 1W2BA 1A0IA 1L1OB 1Y1WH 4A3DH 3L0OA 1GVPA 4DPGA 4NXML 4DV4Q 4OO1G 1VQHA 1XPRA 1NJIC 5IYDG 3UDFA 2RHSB 1PH9A 5C0XG 2VQEL 4IO9A 4OX9L 2KHJA 1VQ9A 4GLXA 3EN2A 3HOZG 3JAMi 4JI1Q 4YCWA 1YHQA 3MEFA 3OTOQ 4DR4L 2HHHL 2PI2A 4PG3A 1J5EQ 3T1HQ 4C2MH 3CCRA 2UXDQ 3HOVH 1EOVA 2WAQG 1XNQQ 4PZ6A 4LF8Q 1FL0A 1A8VA 1IL2A 4A3KH 4QIWE 1WCMH 1X3FA 3J80c 1VQ6A 4JI8Q 4A4IA 4QGUA 3CCMA 1KQSA 4GN4B 2BH8A 3CD6A 5DLQE 4JI7L 1VQLA 4NXMQ 1JMCA 1P8LA 3KYHC 3PUWA 1IBLQ 2MO1A 1Q8KA 4EX5A 1E7ZA 1MJCA 1OXUA 4IPGA 1Q7YC 4A3LH 2VQEQ 4A76A 1MIUA 1X56A 4OX9Q 2ZJRA 4KI0A 4X65L 1K8AC 4JV5L 1QVCA 4X62L 3D31A 2PQAB 1TWHH 2WB1G 3BU2A 4NPSA 3STBD 2HHHQ 3TRZA 4DR4Q 4BXXH 1LYLA 3UDXA 4YWLA 3A0JA 1W3SA 2JA6H 4A93G 2ZTEA 4YHHL 3CPWA 2R92G 1GKHA 5C4XH 1GD7A 3VDYA 2Q2HA 1XMQL 3GTGH 2WFWA 2RHQB 2VL6A 1UEBA 1MKHA 1X3GA 4XTCS 4JI7Q 1NMFA 2ALYB 3HOXH 4IFDJ 3U4VA 3G4SA 1VQ4A 4POFA 2XTIA 4LNQA 1Q1BA 3AQQA 2JA5H 2MQHA 3S14H 3KDFA 4A3BH 1U0LA 3K80C 2ZM6L 1VQCA 1N8RC 2JA8G 3HOVG 4X65Q 4JV5Q 1QVGA 1BBUA 1VQ8A 3CP0A 1KL9A 2GVAA 2AWOA 4LUZA 1FGUA 3W1GA 2ID0A 2K75A 3F2BA 2PNHA 1EIYB 3M4OH 5JJKA 3TEHB 2NVTH 3S2HH 4GKJL 5C0XJ 4A3IG 1WI5A 5FLMG 1Q86C 4LF4L 4LF5L 4YHHQ 3UE1A 4A3KG 1YVCA 1CSQA 4LF6L 1XMQQ 4DR6Q 4LFBL 5C3EH 2HIXA 1X3EA 4A3LG 4R4TA 4PZ7A 5IP9H 3CCLA 4UP9A 2YTYA 4A3MH 3TREA 4L5SA 1VQAA 4GS3A 1V1QA 2Q2IA 4BBRH 1PA6A 3RZDH 1IBKL 1YHAA 3WWVA 2ZM6Q 4PMWA 4A3FH 1UE5A 3M9BA 1SMXA 4R4IA 4OWTB 4O2DA 2VQFL 3AEVA 3RN2A 2BA0A 1L1OC 4XIGS 3CMAA 3GTMH 2NN6I 2D0PA 3TS0A 4DV7L 4BY1H 2PMZE 4GOPB 4LF4Q 4L5RC 3HOXG 4ME3A 4RMFA 4RG1A 3S1MH 5IY0A 3G48A 1PH2A 3S15H 5GAEC 4LF6Q 4OXPA 3AFQA 1M1KC 2ATWA 4DKAC 4LFBQ 4JI3L 1UE1A 3PIPA 1A62A 1YNXA 5E7NA 4IPDA 1NTGA 1PH8A 4H02A 1YHBA 4HIKA 5C44G 4TQUS 3HKZE 2JK8A 2KENA 3PUYA 1Q81C 1Y1VG 2ZJQA 1IBKQ 1C9OA 2CQOA 2KBNA 4L5TA 1I3QH 3HFZB 2VQFQ 3S24A 1T9HA 3KF8B 1LM0A 1NMGA 4EQ5A 5LMNW 3RNUA 3J81i 4A3GG 3CMEA 3GTJH 1PVOA 4DAYB 3CCSA 5IP7G 2N78A 4DK3C 4IFDG 1VQIA 4AQYQ 1N9WA 1OXSC 2Z0SA 3I2ZA 4DV7Q 2B63H 1PHJA 1J6QA 1RL2A 5HGQA 2R6GA 4YY3L 1PH4A 4OWWB 4JI5L 2R7ZH 1EWIA 4DR3L 4C3JH 2VW9A 1BVSA 2CCZA 4JI3Q 3NEMA 4L5QA 1JJGA 3TQYA 3A5UA 1Z47A 3GDEA 4DUZL 4R4QA 2EQSA 5JJLA 1KD1C 4O0AA 1TWFH 1IZ6A 4DV2L 2R93G 1KRTA 2I5LX 1WJJA 2JQOA 4DNIA 3M4PA 4JOIC 4LF9Q 4OO1I 1Y14B 1SRUA 5M5YH 3BJUA 3E0EA 2IHFA 2R7FA 5M3FH 1RIPA 5IYCH 3PIOA 4A3EH 3HOYH 2Z6KC 1UE6A 1CSPA 2UXCL 2A8VA 2JA7H 3W5OA 2IT1A 2PI2E 4YY3Q 3J7ZC 5LMNL 4APVA 3GO5A 5IYBG 4DR3Q 5M3MG 2E2HH 1KC8C 1D7QA 4MNOA 3UDGA 3STBC 3G71A 1SFOH 3A74A 4C3IH 5FLXc 5JEAG 3KJOA 4LW1A 2A19A 1QZGA 4DUZQ 1I94L 5HY6A 1PH5A 1SLJA 2F3IA 4DV2Q 1HR0W 2E8GA 5IE8A 5H1SE 4BY7H 2YTVA 5GAHC 1X6OA 1NBWA 4QL5A 3U50C 4GNXC 3KF6A 2H5XA 3F1ZA 3KDFB 1CKNB 3NENA 1VQBA 1TXYA 4KHZA 3PSIA 3RR5A 3CCVA 4DV6L 5C4JH 3PF5A 1VQPA 2ZTDA 3J80i 4HJAA 3RLNA 2HT1A 4NB3A 2UXCQ 1Y1WG 4A3DG 1HZAA 2R7DA 4BBSG 3CC2A 2NZOA 3DLLA 4JBMA 2FXQA 2JA9A 1PH7A 1I50H 4MZ9A 2CWAA 4B3TL 3KJPA 1E1TA 4P71A 2OTLA 1UWVA 2VNUD 2ASBA 1I94Q 3PF4A 2QGQA 1CKOA 1TWAH 3J7A5 1EYGA 4POGA 1X9NA 3GTLH 3RLFA 2OTJA 2IX1A 4DAMA 4GOPC 3KFUA 3HKZG 3U4ZA 4A75A 4JI2L 1KXLA 4X62Q 2A1AA 2YTXA 3CC7A 2LXJA 1WCMG 2VUMH 4J15A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 Q;  1XNR L;  2GVB A;  1OXV A;  3HOU H;  1HZB A;  4YWM A;  1BKB A;  4LFC L;  2K14 A;  1M90 C;  1VQD A;  1HNZ L;  1VQO A;  2UU9 L;  3PO2 H;  1VQ5 A;  1EQR A;  3PUX A;  4X6A H;  5FJ8 H;  1VS0 A;  4ALP A;  4B3T Q;  1AE3 A;  2OQ0 A;  3I4N H;  3S1N H;  3CW2 C;  1TWG H;  1H95 A;  4DV1 L;  1WFQ A;  3E9I A;  1A63 A;  4P73 A;  4C3H H;  1QUQ A;  3GD7 A;  1L2F A;  3E9H A;  1EQQ A;  4BXX G;  2AKW B;  5GAG C;  1K83 H;  4X66 L;  4PZ8 A;  1L0W A;  4A3J H;  5J3B A;  2JA6 G;  4AH6 A;  2UXB L;  1NE3 A;  3CC4 A;  4WJ4 A;  2Y0S E;  1JB7 A;  4YCU A;  5JEA J;  4JOI A;  3HOW H;  2HIV A;  1GM5 A;  1S40 A;  5C4X G;  1DGS A;  3LGJ A;  3OW2 A;  4JBK A;  2Q2U A;  1XNR Q;  4DK6 C;  4GN3 B;  4GKJ Q;  4DR5 L;  2Z6K A;  4JI4 L;  4LFC Q;  3PUZ A;  4LF5 Q;  1B70 B;  2MNA A;  1HNZ Q;  2NVQ H;  2UU9 Q;  1X65 A;  2CWP A;  1VQE A;  3CAM A;  5EAY A;  4GLA C;  2JA5 G;  4A3B G;  1YIT A;  1SE8 A;  1JJ2 A;  5LMU L;  2IX0 A;  3UE0 A;  3ZJY C;  2F4V L;  1EUJ A;  3A5Z B;  1EIF A;  3SGI A;  2NN6 G;  2WB1 E;  4DV1 Q;  1MJE A;  2K4K A;  1K73 C;  1WOC A;  3G6E A;  4R4O A;  1N36 L;  3ER0 A;  5IYD H;  4X66 Q;  2CKZ B;  3F8T A;  1VCI A;  3U58 A;  2YU9 H;  4NXN L;  1YI2 A;  4LFA L;  2UXB Q;  1OXX K;  2VY3 A;  3HOZ H;  1KHI A;  4GNX A;  1X54 A;  3BZC A;  4IPH A;  1KIX A;  4HIM A;  3B6Y A;  2MFI A;  2YV5 A;  5C3E G;  4HJ7 A;  4DR5 Q;  4JI4 Q;  2K5H A;  4JC0 A;  1V43 A;  5IP9 G;  1VQG A;  4A3M G;  1FJG L;  4MTN A;  5M5X H;  1XTD A;  1HNX L;  4BBR G;  4IFD I;  3AYH B;  1OXT A;  1YBY A;  4HJ9 A;  4OON A;  1XPU A;  5LMU Q;  4Y7N H;  2EXD A;  4A3F G;  2F4V Q;  3CF5 A;  1E1O A;  3PV0 A;  1E22 A;  1G6P A;  3I4O A;  1N34 L;  3PUV A;  1JT8 A;  3KOJ A;  2RCN A;  3I4M H;  2D0O A;  4JCV E;  1PH3 A;  3J81 j;  3PO3 H;  1N36 Q;  4HID A;  3T1Y L;  3L2P A;  4AIM A;  2JJQ A;  1E24 A;  3JAM c;  3I56 A;  4LFA Q;  4GOP A;  4UP8 A;  3T1H L;  3Q8D A;  2N3S A;  4BY1 G;  4GLV B;  4YCV A;  3JC6 6;  1VQN A;  1BBW A;  1QZH A;  1XNQ L;  2ES2 A;  1UE7 A;  4DUY L;  5C0X I;  3FKI H;  1VQF A;  2NVY H;  4B3R L;  2AWN A;  3M85 A;  3KF6 B;  2MO0 A;  1YEZ A;  1HNW L;  2IHE A;  3ICE A;  1HZC A;  4Y52 H;  2JEB I;  2K50 A;  3CCE A;  4A93 H;  4P74 A;  4IOC A;  2R92 H;  4JI5 Q;  1FJG Q;  3NEL A;  1I5F A;  1K0R A;  2LXK A;  2VZA A;  4JBW A;  1XPO A;  1R9T H;  1HNX Q;  2OWO A;  1IBL L;  4P72 A;  3I7F A;  2K5N A;  3K81 C;  2B29 A;  5M5W H;  1JE5 A;  4BA2 I;  4KHP L;  3OYY A;  5GAD C;  4B3M L;  1N34 Q;  4A3C H;  3PGZ A;  1SRO A;  2GN5 A;  3T1Y Q;  1IBM L;  5ELN A;  1SN8 A;  2L15 A;  2JA8 H;  2AHO B;  3GTP H;  2B63 G;  4JYA L;  1AH9 A;  4DR2 L;  3S2D H;  2XGT A;  3ERS X;  4DUY Q;  2R7Z G;  3CCJ A;  3H3V I;  1L1O A;  2Y0S G;  1C0A A;  2QEX A;  1N33 L;  3F2C A;  4B3R Q;  3ULP A;  1K9M C;  2F52 A;  1HH2 P;  1HNW Q;  4A3I H;  2Q2T A;  2N8N A;  5FLM H;  1Q1E A;  5LMN Q;  2UUC L;  4K0K Q;  1XJV A;  4LUO A;  3I4M G;  4LF7 L;  3PO3 G;  1PH6 A;  1N32 L;  1LTL A;  5ELO A;  1HJP A;  3IRB A;  4DV0 L;  4GKK L;  1B8A A;  5GQO A;  4KHP Q;  4UPA A;  4B3M Q;  4UP7 A;  5M3F G;  4WJ3 M;  1K8G A;  5IYC G;  2CFM A;  2I5M X;  1Q46 A;  3FKI G;  3MXN B;  4JBJ A;  4P75 A;  4TVA B;  4A3E G;  3HOY G;  4FDB A;  1S3O A;  3F2D A;  1QUQ B;  1IBM Q;  1JJC B;  2KHI A;  4JG2 A;  2E2I H;  1V9P A;  3FHW A;  2JA7 G;  4JYA Q;  3EIV A;  1PH1 A;  1SR3 A;  2HQL A;  4AYB E;  4DR2 Q;  1LUZ A;  3H0G H;  1HR0 L;  1TWC H;  1NY4 A;  1N33 Q;  3EBE A;  1YJW A;  4X64 L;  5IT9 c;  2IY5 B;  4DR6 L;  1YJN A;  3KLW A;  4BA1 I;  1VQ7 A;  3M7N A;  2UUC Q;  2WP8 J;  4DV3 L;  1PYS B;  4A3C G;  2OQK A;  2VS1 A;  4BY7 G;  4LF7 Q;  1U5K A;  3H15 A;  4JI0 L;  2K52 A;  2PQA A;  3S1R H;  1N32 Q;  3K7U C;  3CXC A;  4DV0 Q;  1CKN A;  1FVI A;  2D62 A;  2K5V A;  5AJ3 L;  4GKK Q;  3S1Q H;  4IPC A;  5BR8 L;  2I0Q A;  1D8L A;  5C44 H;  4DR1 L;  2QA4 A;  3GTO H;  2WAQ E;  3NBH B;  2ZJP A;  1K3R A;  1Z9F A;  4R4C A;  4OWX B;  1Y1V H;  4JI2 Q;  2UUA L;  2UUB L;  1Q12 A;  4YWK A;  1PYB A;  2BH2 A;  5GRO A;  3RZO H;  3I4N G;  4BBS H;  4A3G H;  4K0K L;  3CCU A;  3I55 A;  3GTK H;  1HR0 Q;  4QJF A;  3FP9 A;  4DV5 L;  4GNX B;  5K36 G;  4X64 Q;  4QY7 A;  5IP7 H;  4LUV A;  2AMC B;  2EIF A;  3GTQ H;  3D0F A;  3ULL A;  4KLK A;  5IWA L;  1KAW A;  2E5L L;  2NZH A;  2BA1 A;  4DV3 Q;  1O7I A;  3S16 H;  4GN5 A;  3W1B A;  1VQM A;  2JEA I;  4JI0 Q;  1IXR A;  3K7A H;  1XMO L;  1G51 A;  2DUD A;  4HIO A;  5AJ3 Q;  1ASY A;  5BR8 Q;  4DR1 Q;  2VUM G;  5JJI A;  3H0G G;  4HJ8 A;  4B3S L;  4QQB X;  2JE6 I;  2R93 H;  1VQK A;  4LWC A;  3HOU G;  1I6H H;  1B7Y B;  2NVX H;  3K8A A;  3L7Z C;  2UUA Q;  3RN5 A;  2UUB Q;  4DR7 L;  4IJH A;  4AQY L;  2C35 B;  3J81 c;  1CUK A;  4R1J A;  1Q82 C;  2B3G A;  2KCT A;  2KCM A;  4JI6 L;  1QVF A;  3M4Q A;  3PO2 G;  1YJ9 A;  2RF4 A;  3CPF A;  4DV5 Q;  5FJ8 G;  4IOA A;  2ZTC A;  1X55 A;  1WYD A;  2LSS A;  3BZK A;  1GO3 E;  1AE2 A;  3K0X A;  1OTC A;  2E2J H;  3TS2 A;  2N49 A;  4UY8 C;  1IYJ B;  5IWA Q;  4DV4 L;  2I5H A;  2E5L Q;  2OCE A;  1EFW A;  5IYB H;  5M3M H;  1YZ6 A;  4A3J G;  1G29 1;  1PV4 A;  3RLO A;  3S17 H;  1KRS A;  4IJL A;  1XMO Q;  4HJ5 A;  1VQJ A;  3PCO B;  4JI1 L;  4LF9 L;  3HOW G;  3M3Y H;  1C7Y A;  3CCQ A;  3OTO L;  4B3S Q;  3AFP A;  1J5E L;  3UDI A;  1S72 A;  4NXN Q;  1CKM A;  3CQZ H;  3H3V H;  2YYZ A;  1P16 A;  4DR7 Q;  2UXD L;  2V1C C;  1HZ9 A;  4LF8 L;  1PFS A;  1ASZ A;  3ULJ A;  2DGY A;  3HKS A;  4JI6 Q;  3DM3 A;  4JI8 L;  1E3P A;  1YIJ A;  4AYB G;  1W2B A;  1A0I A;  1L1O B;  1Y1W H;  4A3D H;  3L0O A;  1GVP A;  4DPG A;  4NXM L;  4DV4 Q;  4OO1 G;  1VQH A;  1XPR A;  1NJI C;  5IYD G;  3UDF A;  2RHS B;  1PH9 A;  5C0X G;  2VQE L;  4IO9 A;  4OX9 L;  2KHJ A;  1VQ9 A;  4GLX A;  3EN2 A;  3HOZ G;  3JAM i;  4JI1 Q;  4YCW A;  1YHQ A;  3MEF A;  3OTO Q;  4DR4 L;  2HHH L;  2PI2 A;  4PG3 A;  1J5E Q;  3T1H Q;  4C2M H;  3CCR A;  2UXD Q;  3HOV H;  1EOV A;  2WAQ G;  1XNQ Q;  4PZ6 A;  4LF8 Q;  1FL0 A;  1A8V A;  1IL2 A;  4A3K H;  4QIW E;  1WCM H;  1X3F A;  3J80 c;  1VQ6 A;  4JI8 Q;  4A4I A;  4QGU A;  3CCM A;  1KQS A;  4GN4 B;  2BH8 A;  3CD6 A;  5DLQ E;  4JI7 L;  1VQL A;  4NXM Q;  1JMC A;  1P8L A;  3KYH C;  3PUW A;  1IBL Q;  2MO1 A;  1Q8K A;  4EX5 A;  1E7Z A;  1MJC A;  1OXU A;  4IPG A;  1Q7Y C;  4A3L H;  2VQE Q;  4A76 A;  1MIU A;  1X56 A;  4OX9 Q;  2ZJR A;  4KI0 A;  4X65 L;  1K8A C;  4JV5 L;  1QVC A;  4X62 L;  3D31 A;  2PQA B;  1TWH H;  2WB1 G;  3BU2 A;  4NPS A;  3STB D;  2HHH Q;  3TRZ A;  4DR4 Q;  4BXX H;  1LYL A;  3UDX A;  4YWL A;  3A0J A;  1W3S A;  2JA6 H;  4A93 G;  2ZTE A;  4YHH L;  3CPW A;  2R92 G;  1GKH A;  5C4X H;  1GD7 A;  3VDY A;  2Q2H A;  1XMQ L;  3GTG H;  2WFW A;  2RHQ B;  2VL6 A;  1UEB A;  1MKH A;  1X3G A;  4XTC S;  4JI7 Q;  1NMF A;  2ALY B;  3HOX H;  4IFD J;  3U4V A;  3G4S A;  1VQ4 A;  4POF A;  2XTI A;  4LNQ A;  1Q1B A;  3AQQ A;  2JA5 H;  2MQH A;  3S14 H;  3KDF A;  4A3B H;  1U0L A;  3K80 C;  2ZM6 L;  1VQC A;  1N8R C;  2JA8 G;  3HOV G;  4X65 Q;  4JV5 Q;  1QVG A;  1BBU A;  1VQ8 A;  3CP0 A;  1KL9 A;  2GVA A;  2AWO A;  4LUZ A;  1FGU A;  3W1G A;  2ID0 A;  2K75 A;  3F2B A;  2PNH A;  1EIY B;  3M4O H;  5JJK A;  3TEH B;  2NVT H;  3S2H H;  4GKJ L;  5C0X J;  4A3I G;  1WI5 A;  5FLM G;  1Q86 C;  4LF4 L;  4LF5 L;  4YHH Q;  3UE1 A;  4A3K G;  1YVC A;  1CSQ A;  4LF6 L;  1XMQ Q;  4DR6 Q;  4LFB L;  5C3E H;  2HIX A;  1X3E A;  4A3L G;  4R4T A;  4PZ7 A;  5IP9 H;  3CCL A;  4UP9 A;  2YTY A;  4A3M H;  3TRE A;  4L5S A;  1VQA A;  4GS3 A;  1V1Q A;  2Q2I A;  4BBR H;  1PA6 A;  3RZD H;  1IBK L;  1YHA A;  3WWV A;  2ZM6 Q;  4PMW A;  4A3F H;  1UE5 A;  3M9B A;  1SMX A;  4R4I A;  4OWT B;  4O2D A;  2VQF L;  3AEV A;  3RN2 A;  2BA0 A;  1L1O C;  4XIG S;  3CMA A;  3GTM H;  2NN6 I;  2D0P A;  3TS0 A;  4DV7 L;  4BY1 H;  2PMZ E;  4GOP B;  4LF4 Q;  4L5R C;  3HOX G;  4ME3 A;  4RMF A;  4RG1 A;  3S1M H;  5IY0 A;  3G48 A;  1PH2 A;  3S15 H;  5GAE C;  4LF6 Q;  4OXP A;  3AFQ A;  1M1K C;  2ATW A;  4DKA C;  4LFB Q;  4JI3 L;  1UE1 A;  3PIP A;  1A62 A;  1YNX A;  5E7N A;  4IPD A;  1NTG A;  1PH8 A;  4H02 A;  1YHB A;  4HIK A;  5C44 G;  4TQU S;  3HKZ E;  2JK8 A;  2KEN A;  3PUY A;  1Q81 C;  1Y1V G;  2ZJQ A;  1IBK Q;  1C9O A;  2CQO A;  2KBN A;  4L5T A;  1I3Q H;  3HFZ B;  2VQF Q;  3S24 A;  1T9H A;  3KF8 B;  1LM0 A;  1NMG A;  4EQ5 A;  5LMN W;  3RNU A;  3J81 i;  4A3G G;  3CME A;  3GTJ H;  1PVO A;  4DAY B;  3CCS A;  5IP7 G;  2N78 A;  4DK3 C;  4IFD G;  1VQI A;  4AQY Q;  1N9W A;  1OXS C;  2Z0S A;  3I2Z A;  4DV7 Q;  2B63 H;  1PHJ A;  1J6Q A;  1RL2 A;  5HGQ A;  2R6G A;  4YY3 L;  1PH4 A;  4OWW B;  4JI5 L;  2R7Z H;  1EWI A;  4DR3 L;  4C3J H;  2VW9 A;  1BVS A;  2CCZ A;  4JI3 Q;  3NEM A;  4L5Q A;  1JJG A;  3TQY A;  3A5U A;  1Z47 A;  3GDE A;  4DUZ L;  4R4Q A;  2EQS A;  5JJL A;  1KD1 C;  4O0A A;  1TWF H;  1IZ6 A;  4DV2 L;  2R93 G;  1KRT A;  2I5L X;  1WJJ A;  2JQO A;  4DNI A;  3M4P A;  4JOI C;  4LF9 Q;  4OO1 I;  1Y14 B;  1SRU A;  5M5Y H;  3BJU A;  3E0E A;  2IHF A;  2R7F A;  5M3F H;  1RIP A;  5IYC H;  3PIO A;  4A3E H;  3HOY H;  2Z6K C;  1UE6 A;  1CSP A;  2UXC L;  2A8V A;  2JA7 H;  3W5O A;  2IT1 A;  2PI2 E;  4YY3 Q;  3J7Z C;  5LMN L;  4APV A;  3GO5 A;  5IYB G;  4DR3 Q;  5M3M G;  2E2H H;  1KC8 C;  1D7Q A;  4MNO A;  3UDG A;  3STB C;  3G71 A;  1SFO H;  3A74 A;  4C3I H;  5FLX c;  5JEA G;  3KJO A;  4LW1 A;  2A19 A;  1QZG A;  4DUZ Q;  1I94 L;  5HY6 A;  1PH5 A;  1SLJ A;  2F3I A;  4DV2 Q;  1HR0 W;  2E8G A;  5IE8 A;  5H1S E;  4BY7 H;  2YTV A;  5GAH C;  1X6O A;  1NBW A;  4QL5 A;  3U50 C;  4GNX C;  3KF6 A;  2H5X A;  3F1Z A;  3KDF B;  1CKN B;  3NEN A;  1VQB A;  1TXY A;  4KHZ A;  3PSI A;  3RR5 A;  3CCV A;  4DV6 L;  5C4J H;  3PF5 A;  1VQP A;  2ZTD A;  3J80 i;  4HJA A;  3RLN A;  2HT1 A;  4NB3 A;  2UXC Q;  1Y1W G;  4A3D G;  1HZA A;  2R7D A;  4BBS G;  3CC2 A;  2NZO A;  3DLL A;  4JBM A;  2FXQ A;  2JA9 A;  1PH7 A;  1I50 H;  4MZ9 A;  2CWA A;  4B3T L;  3KJP A;  1E1T A;  4P71 A;  2OTL A;  1UWV A;  2VNU D;  2ASB A;  1I94 Q;  3PF4 A;  2QGQ A;  1CKO A;  1TWA H;  3J7A 5;  1EYG A;  4POG A;  1X9N A;  3GTL H;  3RLF A;  2OTJ A;  2IX1 A;  4DAM A;  4GOP C;  3KFU A;  3HKZ G;  3U4Z A;  4A75 A;  4JI2 L;  1KXL A;  4X62 Q;  2A1A A;  2YTX A;  3CC7 A;  2LXJ A;  1WCM G;  2VUM H;  4J15 A; 
#chains in the Genus database with same CATH topology
 3BVZ A;  4DV6 Q;  2GVB A;  3A7L A;  1H9J A;  3HOU H;  2EYJ A;  1BKB A;  3K57 A;  3I4M B;  4LJZ C;  2BDN A;  4F87 A;  1HNZ L;  3PO2 H;  1VQ5 A;  2EYM A;  3Q22 A;  3PUX A;  5M5Y B;  2I46 A;  1EY6 A;  4HSV A;  4X6A H;  3S1N H;  1HQM C;  1VS0 A;  2OQ0 A;  3MXN A;  2X69 A;  4DV1 L;  2EY5 A;  4XQN A;  4C3H H;  1QUQ A;  1ILP A;  5GAG C;  2E2H B;  2JA6 G;  3D3R A;  4OEM B;  3CC4 A;  4YCU A;  2F0G A;  4JOI A;  5C4X G;  2HCC A;  1HUM A;  1XNR Q;  1B4O A;  2Z6K A;  4JI4 L;  5IT9 L;  1B70 B;  2MNA A;  3D4W A;  4KJO A;  3CAM A;  1RTN A;  2JA5 G;  4FF4 A;  2IX0 A;  3UE0 A;  2F4V L;  3NBH A;  3JAM E;  2WB1 E;  2Z4I A;  3AMU A;  5CBA E;  2H1E A;  1K28 A;  4R4O A;  2PQE A;  3ER0 A;  3A56 A;  3F8T A;  3PIP 3;  4LFA L;  3ZYY X;  1OXX K;  1WTP A;  3C46 A;  1PTO H;  1RCV D;  2EY2 A;  3B6Y A;  1TWA B;  4HIM A;  1KIX A;  2EJG C;  2K5H A;  1F9P A;  2F0W A;  3CHB D;  3TME A;  5IP9 G;  4A3M G;  2F0F A;  1HNX L;  1A15 A;  4DK1 A;  1SE2 A;  3H0G B;  5LMU Q;  1Z6H A;  4HMJ A;  1E22 A;  1N34 L;  5FKA C;  1U4P A;  3PUV A;  3KOJ A;  3DWP A;  2C5C A;  5EPK A;  4BWG B;  3Q8D A;  4YCV A;  3I4N B;  1QZH A;  3D4R A;  4DUY L;  1VQF A;  1R4Q B;  3MFG A;  4B3R L;  4RGN A;  3M85 A;  4X3S A;  4WOR A;  4ZCK A;  3CCE A;  4A93 H;  4P74 A;  4IOC A;  1FJG Q;  3HOW B;  1K0R A;  2VZA A;  4JBW A;  2NB0 A;  1BDO A;  4HR7 B;  1X3Q A;  4X3K A;  2O4X A;  5G3L F;  4B3M L;  5GAD C;  1EY4 A;  3K5M A;  1B50 A;  1JQY D;  5ELN A;  1HCZ A;  3LWU A;  3K58 A;  1AH9 A;  3NK9 A;  4DR2 L;  5TSS A;  2XGT A;  3ERS X;  1D5M C;  4IAL A;  3TP7 A;  1HNW Q;  2N8N A;  5LMN Q;  1C48 A;  1QNK A;  1SND A;  3QR8 A;  1SEB D;  4RKB A;  4ZAI A;  3PO3 G;  1GUW A;  1PH6 A;  1JWM D;  1N32 L;  4GKK L;  1B8A A;  3EA6 A;  4UP7 A;  5M3F G;  5IYC G;  4JBJ A;  4FDB A;  1ZKO A;  1JJC B;  2KHI A;  4QB4 A;  1V9P A;  2A5H A;  2JA7 G;  4JYA Q;  2A6E C;  2HQL A;  1LUZ A;  3J80 L;  1YJW A;  1WTR A;  1RJT A;  4C3I G;  4DR6 L;  1YJN A;  2F4I A;  3TP8 A;  4PQX A;  4A3C G;  4M1U B;  2VS1 A;  4BY7 G;  1HQR D;  3CXC A;  4DV0 Q;  3MXG A;  5A2Q L;  2K5V A;  4RWS C;  5BR8 L;  1D8L A;  1KNE A;  5IGD A;  1WVL A;  3GTO H;  1K3R A;  4KK7 A;  1LO5 D;  2UUA L;  4CDD C;  3NQT A;  1PYB A;  1WTH A;  1PXU A;  5GRO A;  3RZO H;  4CKC A;  4QJF A;  4CJ1 B;  4X64 Q;  2B2W A;  1PFN A;  5IP7 H;  1IYV A;  4LUV A;  3OIQ A;  3GTQ H;  2EIF A;  1KAW A;  3V05 A;  2BA1 A;  1O7I A;  3S16 H;  4GN5 A;  3EJI A;  2IJ0 A;  3HP3 A;  1XMO L;  1SYB A;  2DUD A;  1NSN S;  3BDL A;  5AJ3 Q;  4DXG A;  4QUF A;  1ASY A;  4K8J A;  4DR1 Q;  2KCN A;  1MGS A;  2QIL A;  2C35 B;  2Z9H A;  1YJ9 A;  4DV5 Q;  5FJ8 G;  2ZTC A;  3BZK A;  3QG1 A;  4J6H A;  1AE2 A;  1E2Z A;  3TS2 A;  1STA A;  2N49 A;  1CA6 A;  1F2M A;  1U4L A;  4DV4 L;  5IWA Q;  2E5L Q;  5M3M H;  1YZ6 A;  4NKL A;  3RLO A;  1EOT A;  4LF9 L;  1PTO F;  2CH4 W;  3T4A C;  5HGT A;  4XT1 B;  4B3S Q;  3QJY A;  3OW7 A;  3KBX A;  2YYZ A;  2UXD L;  3A8K E;  1HZ9 A;  5EPL A;  4R8I A;  3S1R B;  3J81 L;  1STH A;  5E3F A;  3S1Q B;  1E3P A;  3I8Z A;  1W2B A;  3OWE B;  5IOC A;  1L1O B;  1ESR A;  1GVP A;  2BE5 D;  1XPR A;  3GTK B;  3QWN A;  5C0X G;  1ICF B;  3HOZ G;  4OGQ C;  3JAM i;  4JI1 Q;  4YCW A;  1YHQ A;  3MEF A;  1D6E C;  3RUZ A;  2JN4 A;  2PI2 A;  1KAA A;  2B2V C;  4I7Z C;  3CCR A;  2OF1 A;  1S5E D;  4PZ6 A;  1G6Z A;  4KKT A;  1HPC A;  1A8V A;  4MN3 A;  4A3K H;  1WCM H;  1X3F A;  4A4I A;  3VR3 A;  4QGU A;  3CCM A;  2BH8 A;  2RKS A;  1I6H B;  4NXM Q;  1SJH D;  2EY1 A;  3HRZ C;  1G91 A;  4PMC A;  4EX5 A;  1XWE A;  2VQE Q;  4N8F A;  5IOD A;  3DM1 A;  3R2T A;  3D31 A;  5C3W A;  3STB D;  3TRZ A;  4DR4 Q;  1EY8 A;  4BXX H;  4I65 A;  2FIN B;  1LYL A;  3UDX A;  2M00 A;  2E74 C;  1CTM A;  5M9O A;  1CHP D;  1Y8P B;  3S17 B;  4YHH L;  1GKH A;  4KTA A;  5COR A;  1KLG D;  3NQI A;  3VDY A;  2F03 A;  3J7Y W;  3GTG H;  1HFG A;  3J7A V;  4XTC S;  1EY9 A;  3SK4 A;  3CQZ B;  1NMF A;  4JI7 Q;  2ENB A;  1VQ4 A;  1X3P A;  1Q1B A;  1PRT D;  3S14 H;  1U0L A;  2KHS A;  2ZM6 L;  1VQC A;  2RCF A;  1N8R C;  2JA8 G;  3HOV G;  1QVG A;  1BBU A;  1KL9 A;  1O7L A;  2AWO A;  1FGU A;  2XIW A;  1O80 A;  4KD3 A;  1K0S A;  3FVQ A;  4A3I G;  2EXZ A;  1WI5 A;  2EYO A;  4GKJ L;  1Q86 C;  1BBX C;  4LF5 L;  1IYU A;  2A6H C;  2M2L A;  1R4P B;  1A3T A;  1CSQ A;  2RSN A;  4DR6 Q;  1YNN C;  1X3E A;  2KOL A;  3QOL A;  3HKZ B;  3OMC A;  2XSC A;  3CCL A;  1VQA A;  3RZD H;  5I2Y A;  3WWV A;  4A3F H;  3M9B A;  5EJW A;  1MD2 D;  4R4I A;  4OWT B;  4O2D A;  2VQF L;  3RN2 A;  3E5S A;  1T5X D;  1DOM A;  1LT5 D;  1TU2 B;  3HGB A;  1S5B D;  3K5L A;  4BY1 H;  4XQQ A;  4GOP B;  4L5R C;  4RMF A;  1BQQ T;  3G48 A;  5LHY 1;  1M1K C;  1DON A;  5KRU A;  5E7N A;  1O78 A;  1PH8 A;  2PW5 A;  3WOE A;  2JA6 B;  4Z9C B;  4HCS A;  1D5Z C;  3CU7 A;  4RA8 A;  5C4X B;  3TP6 A;  4FVM A;  2QCP X;  4JVZ A;  4A3G G;  1T9H A;  3KF8 B;  4RGM A;  2KUM A;  4K6D A;  2F0N A;  2PW7 A;  5IIF A;  4DV7 Q;  2JA5 B;  2DY8 A;  5HGQ A;  1PH4 A;  2LY7 A;  4C3J H;  1BVS A;  4JI3 Q;  4L5Q A;  1JJG A;  4RGT A;  1D5X C;  1HTL D;  3GDE A;  3VR6 A;  2EQS A;  4V19 0;  1PZI D;  2R93 G;  2CW0 C;  1SNP A;  2KEE A;  1QNU A;  1C4Q A;  4UAI A;  4LF9 Q;  4OO1 I;  1BF4 A;  1SRU A;  5M5Y H;  4O1N A;  3WDN A;  2QDL A;  1ESF A;  4A3M B;  2UXC L;  2KED A;  2A8V A;  1TT2 A;  1UEA B;  4YY3 Q;  1RTO A;  4MTK A;  3GO5 A;  5IYB G;  2E2H H;  1QJO A;  1S5F D;  3UDG A;  2KCC A;  2JXM B;  5JEA G;  3GTM B;  2A19 A;  4R8N A;  3TN2 A;  4DK0 A;  4G4K A;  5E4W C;  3S1M B;  2G5D A;  2ICE C;  4QMG A;  5IE8 A;  1EQV A;  3MHB A;  1SYC A;  1X6O A;  1PRT F;  5IGB A;  2Q8T A;  3KDF B;  4KHZ A;  3CCV A;  4DV6 L;  1TS2 A;  3E6Z X;  4XYO A;  1PZJ D;  2F0O A;  1Y1W G;  4A3D G;  1HZA A;  3NBI A;  3CC2 A;  1F2Z A;  2D2C C;  3L3O C;  3DUZ A;  3KJP A;  2OTL A;  1UWV A;  2AUJ D;  1I94 Q;  3PF4 A;  1FNW A;  1CKO A;  1TWA H;  3J7A 5;  4XQJ A;  3MXP A;  1B2T A;  3BG3 A;  5CBE E;  4DAP A;  4OL7 A;  4CDE C;  1TY0 A;  4CBV A;  2A1A A;  3CC7 A;  4QUC A;  4DPG A;  2N88 A;  2XWB B;  1U4R A;  1XNR L;  4LMQ D;  1TWF B;  2PMZ B;  1HZB A;  1M90 C;  3PO3 B;  4TRD A;  4V0B A;  4KY5 A;  1BCP B;  2ZXO A;  1EQR A;  5M3F B;  1WTX A;  4ALP A;  2J0T D;  3I4N H;  2M9V A;  1H95 A;  3SE0 A;  3E9I A;  2K5W A;  2JA7 B;  3GD7 A;  1L2F A;  1GUS A;  4ZKB B;  4EGV A;  1EY7 A;  4AH6 A;  1R9T B;  1V8Q A;  1JB7 A;  4C3I B;  5I6Y A;  3HOW H;  2HIV A;  1GM5 A;  3D6W A;  5KNB A;  4EVO A;  3LGJ A;  3OW2 A;  3GV3 A;  2Q2U A;  4GKJ Q;  4LFC Q;  4BY7 B;  2RVL A;  3PUZ A;  4LF5 Q;  5I4D A;  2FJ2 A;  4CHT B;  2CWP A;  1VQE A;  1CZG A;  3QO2 A;  4DNT B;  4GLA C;  4LAA A;  3S2D B;  2B2U A;  5ELB A;  2K6A A;  5LMU L;  5IGF A;  1SNQ A;  4EQN A;  2D5D A;  2N55 A;  1MJE A;  2L11 A;  3G6E A;  1JR0 D;  5DM6 3;  1VCI A;  1YI2 A;  1ONL A;  3MWY W;  4DN4 M;  4GNX A;  2BOS A;  3RMH A;  5J39 A;  1NNX A;  4ZUJ A;  2MFI A;  2YV5 A;  5C3E G;  4DR5 Q;  1AN8 A;  4G57 A;  1S5D D;  4JC0 A;  1II3 A;  1LT4 D;  4HMI A;  1FJG L;  2JSO A;  4BBR G;  4IFD I;  4KMU C;  1XPU A;  3I4O A;  1JT8 A;  2F0Q A;  2D0O A;  5NUC A;  3J81 j;  1N36 Q;  4HID A;  3L2P A;  3JAM c;  4GOP A;  1PYW D;  2DJG C;  4GLV B;  1VQN A;  3FPP A;  2ES2 A;  1AP0 A;  5C0X I;  3P75 A;  2NVY H;  2ZT9 C;  2F0E A;  3KF6 B;  2MO0 A;  1HNW L;  3ICE A;  4Y52 H;  5JVH 3;  2IX3 A;  5A2Q E;  1LAC A;  3NEL A;  1XPO A;  1J9O A;  4ZUI A;  1X32 A;  1D2B A;  3KF8 A;  1JE5 A;  5K5P A;  4BA2 I;  5CV5 A;  3OYY A;  2NVQ B;  4XYQ A;  2IPK D;  2GN5 A;  1RDP D;  5CV9 A;  3T1Y Q;  3VR5 A;  1H9M A;  1LT6 D;  4K5V A;  3SEB A;  1EEI D;  4JYA L;  2Z6B A;  5EBC A;  2R7Z G;  3CCJ A;  3H3V I;  1C0A A;  2QEX A;  2F52 A;  1HUN A;  4HCE A;  1HH2 P;  2LFN A;  2PZT A;  5FLM H;  2YU9 B;  3MEH A;  3HOZ B;  1VF7 A;  1RD9 D;  4K0K Q;  1XJV A;  3R2I A;  1DCZ A;  3D4D A;  4DV0 L;  4KHP Q;  4P75 A;  3HOY G;  4TVA B;  4PNY A;  4WFN 3;  4Y7N B;  3EIV A;  2J7Z A;  4FF3 A;  4AYB E;  2QDB A;  2EE1 A;  4OIK A;  3EBE A;  2VB2 X;  3ERO A;  4KHV A;  4X64 L;  2IY5 B;  3KLW A;  1JIC A;  4XXE A;  4BA1 I;  1VQ7 A;  2UUC Q;  4N8X 1;  4LF7 Q;  3FKI B;  3FEW X;  2XN9 C;  1U5K A;  3S1R H;  2PQA A;  1FVI A;  2D62 A;  5AJ3 L;  3S1Q H;  2F0M A;  1NR2 A;  4DR1 L;  2TMP A;  3AU7 A;  3J81 E;  2FHT A;  1Z9F A;  5ELD A;  1PZK D;  3F2U A;  3GTK H;  5LL6 X;  3I55 A;  4RCN A;  5EKI A;  4DV5 L;  2FMM A;  1YNJ C;  4HED A;  2BCO A;  1TS5 A;  2JA8 B;  3ULL A;  3GTP B;  5IWA L;  3HOV B;  2E5L L;  2NZH A;  1MHW C;  4DV3 Q;  5FK9 C;  1VQM A;  2CH4 A;  4A3I B;  5C6A A;  1E2V A;  4B3S L;  4QQB X;  1PFB A;  2JE6 I;  3NXW A;  3W3A A;  1FNU A;  1I6H H;  1B7Y B;  2UUB Q;  1BXT A;  2P5Z X;  1CUK A;  2KCT A;  4ODG A;  2F0K A;  1ROD A;  1X55 A;  4NP5 A;  1WYD A;  1OTC A;  1IW7 C;  2AQ2 B;  4UY8 C;  4IUU A;  2A73 B;  2OCE A;  1U4M A;  1B44 D;  1GUT A;  4A3J G;  1G29 1;  1TWC B;  3S17 H;  1KRS A;  3QB3 A;  1VQJ A;  4JI1 L;  1EZ8 A;  1ZEQ X;  3H09 A;  1WD1 A;  3AFP A;  3CQZ H;  4UDU C;  1ENC A;  1ENF A;  1ASZ A;  4JW0 A;  1F9Q A;  2HDL A;  3H6M A;  3DM3 A;  1ICW A;  1YIJ A;  4AYB G;  5CMD A;  4NXM L;  4F7X A;  2PO4 A;  4OO1 G;  4A3G B;  1XYI A;  5IYD G;  3UDF A;  2VQE L;  2KHJ A;  1PTO D;  5FO9 B;  3EN2 A;  4GLX A;  1VQ9 A;  5IGE A;  3OTO Q;  3T56 B;  3SVM A;  4DR4 L;  1BCP C;  5C5M A;  5I9O A;  5KNC A;  4NMZ A;  4LF8 Q;  4QIW E;  4JI8 Q;  3GP7 A;  1KQS A;  2HD3 A;  1EYD A;  2R93 B;  4IUN A;  4CGY B;  4JI7 L;  1VQL A;  1O7Y A;  1LTS D;  1SMY D;  5D14 A;  1JMC A;  3S9W A;  1XX8 A;  1TS4 A;  1Q8K A;  2NBF A;  1Q7Y C;  4TSS A;  4A3L H;  1UAP A;  3KLS A;  3T13 A;  1L0Y B;  1QVC A;  4FXD A;  2NTS A;  2WB1 G;  4NPS A;  2MJ8 A;  2Z1C A;  2JA6 H;  3A0J A;  1W3S A;  5T1I A;  2R92 G;  1F9S A;  2X6G A;  3CPW A;  5CV6 A;  5C4X H;  1GD7 A;  4B9W A;  2WFW A;  1MKH A;  3HOX H;  4IFD J;  2EYF A;  1HA6 A;  2CHB D;  2KQ3 A;  2JA5 H;  5BN3 A;  1LTT D;  2F0L A;  1Y1W B;  4DXF A;  4A3D B;  1DD2 A;  4LUZ A;  4XDX A;  1C8C A;  5C0X J;  4X3U A;  1BR9 A;  1QOH A;  1XMQ Q;  4R4T A;  1FGB D;  3KK7 A;  4C2M B;  1QWY A;  5IP9 H;  1RF2 D;  1JWS D;  4A3M H;  3TRE A;  2K7V A;  1V1Q A;  2QF7 A;  1YHA A;  4O42 A;  3AEV A;  2K05 A;  2O5I C;  2BA0 A;  1VF5 C;  3CMA A;  3GTM H;  1JC7 A;  2D0P A;  3TS0 A;  4DV7 L;  5CV8 A;  3I72 A;  2H4O A;  4RG1 A;  3S1M H;  5IY0 A;  4OXP A;  2ATW A;  2O2L D;  4LFB Q;  3AB9 A;  4JI3 L;  1TII D;  1UE1 A;  3PIP A;  1YNX A;  1ML0 D;  4IPD A;  4IUT A;  4MHE A;  3MC0 B;  4QF4 A;  5JJZ A;  5C44 G;  4TQU S;  1Y1V G;  1H9S B;  4K8I A;  1IBK Q;  2CQO A;  4BBS G;  3J81 i;  1QE6 A;  1BOS A;  5KGU A;  5JPN C;  2N78 A;  1QIL A;  4IFD G;  1HFN A;  1N9W A;  1OXS C;  4LK1 C;  5FLX E;  3BDC A;  3SHL A;  1KDC A;  4YY3 L;  2R6G A;  3NPP A;  4I7A A;  4JI5 L;  2VW9 A;  2CCZ A;  3NEM A;  5BN5 A;  2PZU A;  2LMC B;  1Z47 A;  3C3L A;  2NVT B;  3A7A B;  5JJL A;  1KTK A;  2OT2 A;  1TWF H;  1IZ6 A;  5FO8 B;  2JP1 A;  2I5L X;  2R61 A;  3M4P A;  1IW7 D;  5C3E B;  4HAE A;  3IFD A;  3E0E A;  2IHF A;  3J7A F;  4PV1 C;  5M3F H;  1RIP A;  5IYC H;  2A69 C;  3H3V C;  4G7O C;  4BBR B;  3R93 A;  1GUN A;  2JA7 H;  4FYD A;  2PI2 E;  5FO7 B;  4ZKC B;  1PFM A;  1SE3 A;  3G71 A;  4C3I H;  3KJO A;  5ISR A;  1I94 L;  5KIX A;  5HY6 A;  2OEO A;  1AZQ A;  2MUY A;  1PH5 A;  1SLJ A;  1HR0 W;  2E8G A;  4BY7 H;  1ZYR C;  2YTV A;  3JAM L;  4QL5 A;  2MP1 A;  3F1Z A;  3NEN A;  1KD1 C;  1CKN B;  1VQB A;  1IKL A;  4HN7 A;  3RLN A;  1K8O A;  3E0J A;  1I4Q A;  3C1E A;  5KEE A;  3ND8 A;  3GTJ B;  2VNU D;  2IWH A;  1NR4 A;  3RLF A;  2IX1 A;  2R7Z B;  4A75 A;  3VYS A;  4JI2 L;  4ZK9 B;  2NN6 H;  1AFP A;  4MIU A;  2YTX A;  4J15 A;  2RDH A;  5KYL A;  1OXV A;  4LFC L;  1TKW B;  1VQD A;  1VQO A;  1LAB A;  1S4Z A;  4KN7 C;  5FJ8 H;  1WD0 A;  1AE3 A;  1GXD C;  3HOY B;  3CW2 C;  2A6E D;  3ITP A;  1WFQ A;  3W2D A;  4P73 A;  1QG7 A;  2HCI A;  1LV9 A;  1EQQ A;  4PZ8 A;  3MZ5 A;  5J3B A;  3DHQ A;  1SFO B;  5JEA J;  1TR5 A;  3OIP A;  4RFB A;  2RDG A;  4DK6 C;  4GN3 B;  4DR5 L;  3VA7 A;  4HSP A;  3URY A;  2NVQ H;  2UU9 Q;  3VYR A;  4A3B G;  1YIT A;  1SE8 A;  2DN8 A;  5C4J B;  2L55 A;  3ZJY C;  2ZXR A;  1EUJ A;  2ICI A;  3A5Z B;  3I73 A;  2XRQ D;  2K4K A;  1K73 C;  1HXY D;  1WOC A;  3G7L A;  1N36 L;  4X66 Q;  3U58 A;  2YU9 H;  1I50 B;  5C0X H;  2UXB Q;  2VY3 A;  3HOZ H;  1A2U A;  1KHI A;  1O7Z A;  3BYY B;  4CDF C;  3BZC A;  2O5J C;  2DNE A;  2OXP A;  4RH6 A;  2K32 A;  4HJ7 A;  3HEJ A;  3SK8 A;  3GTL B;  1CI3 M;  1V43 A;  2R3Z A;  1VQG A;  3CRL C;  3RD4 A;  2B2Y C;  1XTD A;  1OXT A;  4Y7N H;  2EXD A;  2PPB C;  3M7G A;  1UNS A;  3CF5 A;  3PV0 A;  4FP5 D;  2Z4H A;  2RCN A;  3I4M H;  1CK1 A;  4UHV A;  1NUC A;  3T1Y L;  4AIM A;  2JJQ A;  1E24 A;  4RGO S;  3HZX A;  3I56 A;  1L0X B;  1IL8 A;  2N3S A;  3JC6 6;  4C1N K;  1XNQ L;  1I4G A;  1TWG B;  1UE7 A;  1H9K A;  1WTV A;  3FKI H;  3P7J A;  1LTA D;  1MSH A;  4NDX A;  2AWN A;  2L4N A;  2PYK A;  5I6W A;  2IHE A;  1K83 B;  1HZC A;  4A3J B;  1JB3 A;  2JEB I;  2K50 A;  3NSW A;  4JI5 Q;  1I5F A;  2LXK A;  4K0K L;  1EFI D;  3HS0 C;  2WIN B;  1DYQ A;  5CR3 A;  1ET9 A;  1BCP F;  2K5N A;  1V1O A;  2B29 A;  1VMP A;  4KHP L;  3NUC A;  1F77 A;  3PGZ A;  1B9N A;  2KEC A;  3FDT A;  1SRO A;  4DA2 A;  2RBM A;  2K28 A;  2L15 A;  2AHO B;  5IT9 E;  4AYB B;  5C3X A;  2B63 G;  2JA8 H;  3GTP H;  2EYP A;  2SDF A;  3NTH A;  1L1O A;  2A68 C;  2MHV A;  4A3I H;  2Q2T A;  1Q1E A;  1SSO A;  2B2T C;  2QKI C;  4C56 C;  2UUC L;  3TBI B;  4L6T B;  4LUO A;  4LF7 L;  1A3U A;  1LTL A;  5ELO A;  1HJP A;  3IRB A;  1V1P B;  5GQO A;  4UPA A;  4WJ3 M;  2CFM A;  2I5M X;  1Q46 A;  3MXN B;  4A3E G;  4WRD A;  5M5X B;  1G2S A;  1PLF A;  2HDM A;  5EBD A;  1QUQ B;  3F2D A;  1OO9 B;  1IBM Q;  4JG2 A;  1NCV A;  2V4D A;  3KBG A;  4N9T A;  3H0G H;  1TWC H;  5COY A;  1N33 Q;  1HA5 A;  1DOK A;  2ZXP A;  3M7N A;  2WP8 J;  4H0L C;  2XWJ B;  2RSO A;  4DV3 L;  1PYS B;  2WB1 B;  2IW3 A;  3K7U C;  1CKN A;  1EYC A;  2QA4 A;  2R92 B;  1EY5 A;  2WAQ E;  3NBH B;  1W6K A;  4J1M A;  1I4P A;  4JI2 Q;  2UUB L;  4DGZ A;  1FYC A;  4YWK A;  2QEJ C;  5M5W B;  1AW7 A;  4A3G H;  1HR0 Q;  1M4V A;  5K36 G;  2KA7 A;  4RCO A;  3IL8 A;  2E75 C;  2I07 B;  2NZ1 D;  4X3T A;  2AMC B;  1WTO A;  1UUP A;  2JEA I;  4JI0 Q;  1DM0 B;  3LNN A;  1IXR A;  2A6H D;  5ELE A;  2VUM G;  1YNN D;  1FD7 D;  1G8Z D;  2R93 H;  1VQK A;  4LWC A;  2J4X A;  4KV6 A;  3HOU G;  3K8A A;  3L7Z C;  4IJH A;  4AQY L;  2VB3 X;  3J81 c;  4FXG C;  4R1J A;  3X3M A;  1Q82 C;  3PO2 G;  4DNR B;  4K6L A;  3CPF A;  2AUK A;  3UI2 A;  3MVV A;  4K2K A;  4C3H G;  3N52 A;  2E2I B;  2I5H A;  5IYB H;  3HG9 A;  3FRP B;  3NHH A;  5JEA H;  4ZQ3 A;  2L1B A;  4OIJ A;  1C7Y A;  1EEF D;  1GUO A;  4B08 A;  3OTO L;  1EY0 A;  3UDI A;  3J80 E;  1CKM A;  1P16 A;  4DR7 Q;  2V1C C;  4KKU A;  4LF8 L;  1PFS A;  3HKS A;  4FF2 A;  1DOL A;  3K0Y A;  4JI6 Q;  4FF1 A;  1GHJ A;  4JI8 L;  5C44 B;  5HUR A;  2E76 C;  1Y1V B;  1Y1W H;  4A3D H;  1GHK A;  3LWE A;  5T1G A;  3PIO 3;  1SNC A;  1CFM A;  1VQH A;  5DM7 3;  4BBS B;  3M4Y A;  2RHS B;  4IO9 A;  4EQP A;  5JVG 3;  4FO2 A;  4PG3 A;  1J5E Q;  4C2M H;  1KLU D;  2WAQ G;  1XNQ Q;  2WKC A;  4KY6 A;  3K7A B;  3K5O A;  3TZU A;  1IL2 A;  2CW0 D;  4DAV A;  3K59 A;  2DJF C;  3CD6 A;  5J22 A;  5IGC A;  2NVX B;  2F0P A;  1I4R A;  3KYH C;  3PUW A;  4RHS A;  5ELF A;  2MO1 A;  3BVG A;  1E7Z A;  2F0J A;  2TSS A;  1OXU A;  2IL8 A;  2F0I A;  4FXK C;  4A76 A;  4OX9 Q;  2B39 A;  2NTT A;  2E2J B;  1Z7T A;  2Q8I B;  4ZYS A;  1LTG D;  1CZW A;  3BU2 A;  2HHH Q;  3SXH A;  3A8I E;  3MTS A;  2EY6 A;  4A93 G;  3M3Y B;  1EL0 A;  1XMQ L;  5C4Z A;  1X3G A;  2ALY B;  2B8G A;  2XVS A;  2K04 A;  3Q6S A;  4M8A A;  4LNQ A;  3DWA A;  3QIA A;  3AQQ A;  2MQH A;  3KDF A;  4JV5 Q;  4X65 Q;  4F88 A;  1MBY A;  1VQ8 A;  3CP0 A;  2F0V A;  5EQ0 A;  2K75 A;  3ND9 A;  2PNH A;  3F2B A;  4H7B A;  2Z8L A;  5JJK A;  3TEH B;  2NVT H;  4IZ8 A;  3FMC A;  1BUV T;  3UE1 A;  2FMC A;  3ERQ A;  3A55 A;  3Q24 A;  1TS3 A;  4LFB L;  1V1P A;  5I2X A;  5C3E H;  4A3L G;  1SBB B;  4GZY C;  4YIJ A;  3TZD A;  4GS3 A;  2Q2I A;  4BBR H;  1PA6 A;  1IBK L;  4ID6 A;  4KN4 C;  4IQZ A;  2EJF C;  1B53 A;  3E3X A;  1RHP A;  5CYU A;  5EGT A;  5JPM C;  2PMZ E;  4LF4 Q;  3HOX G;  4ME3 A;  3OMG A;  1GUG A;  1PH2 A;  5GAE C;  4LF6 Q;  3AFQ A;  1CQV A;  1KDB A;  1TWH B;  2L5T A;  1A62 A;  5E4X A;  4H02 A;  5JAV A;  1YHB A;  4HIK A;  2JK8 A;  1PMR A;  2KEN A;  1Q81 C;  3VA5 A;  2ZJQ A;  1C9O A;  1QCB D;  1Q90 A;  2G9H D;  2SEB D;  4K5W A;  4L5T A;  2F3W A;  3S24 A;  3I90 A;  1LM0 A;  2F0T A;  1Y8O B;  3I70 A;  3OPO A;  2BE5 C;  3GTJ H;  1PVO A;  1E2W A;  4DAY B;  3CCS A;  4KJN A;  4CKB A;  5IP7 G;  3NP8 A;  1VQI A;  2F3V A;  4AQY Q;  2Z0S A;  4A3B B;  2JYO A;  1J6Q A;  4OWW B;  1A2T A;  2R7Z H;  2K01 A;  2G9D A;  5DEH A;  3TQY A;  2CVR A;  3M4O B;  3A5U A;  3S2H B;  2K5D A;  3IKJ A;  4PMB A;  4R4Q A;  3PMF A;  4O0A A;  4WJW A;  1VMC A;  1KRT A;  3U9O A;  1SJE D;  2JQO A;  4Q5V A;  1XTC D;  3TP5 A;  4DNI A;  1STB A;  5IGG A;  1I4X A;  4JOI C;  1ILQ A;  3G6J B;  4RAU C;  2R7F A;  3PIO A;  2CQA A;  3HOY H;  2Z6K C;  3VR4 A;  1CSP A;  2EOT A;  2GA4 B;  1ET6 A;  4RKL A;  2RQX A;  3W5O A;  2IT1 A;  3J7Z C;  5E1F A;  4DR3 Q;  5M3M G;  1KC8 C;  3SR1 A;  1D7Q A;  1S5C D;  3STB C;  1SFO H;  5CV4 A;  5FLX c;  4LW1 A;  1QZG A;  4DUZ Q;  3CKI B;  5CV7 A;  3K5N A;  4C1N I;  4DV2 Q;  5H1S E;  3S15 B;  5GAH C;  1GJX A;  2SOB A;  4P2C B;  1SYD A;  3I3C A;  1STN A;  3KF6 A;  2H5X A;  3RR5 A;  1VQP A;  5C4J H;  3J80 i;  4HJA A;  4FNF A;  4NB3 A;  1PRT C;  1A3V A;  3NWT A;  1JOR A;  3DLL A;  3DMU A;  1I3Q B;  4EQO A;  1PH7 A;  1ZXT A;  1I50 H;  4MZ9 A;  1U9R A;  4ZRZ A;  4CKE A;  1E1T A;  4P71 A;  4DU9 A;  1STG A;  1LT3 D;  2B63 B;  2WAC A;  1X9N A;  4POG A;  3GTL H;  2OTJ A;  3O13 A;  1LTI D;  4L8J A;  1KXL A;  2L9H A;  4Q0F A;  4A3K G;  1WCM G;  4NW2 A;  1B3A A;  3BS1 A;  4K14 A;  1H9R A;  4YWM A;  4CJ0 B;  2K14 A;  2UU9 L;  1KDA A;  2WV6 D;  1K3B C;  4BS9 A;  4B3T Q;  4A3E B;  2EYH A;  2BDO A;  2NVY B;  1TWG H;  5F2D A;  3GQB A;  1A63 A;  1M8A A;  1B1Z A;  2NUC A;  3E9H A;  1DJR D;  4BXX G;  2AKW B;  1K83 H;  3A54 A;  4X66 L;  1L0W A;  5KND A;  4A3J H;  2UXB L;  3MXU A;  4WJ4 A;  1NE3 A;  2Y0S E;  1JWU D;  1S40 A;  1DGS A;  5D65 A;  4JBK A;  2B2V A;  3N6R A;  1A6X A;  1HNZ Q;  1EYA A;  1X65 A;  1AZP A;  5EAY A;  2HQE A;  5L37 A;  1JJ2 A;  3DEO A;  3R3O A;  4DV1 Q;  3C2P A;  1EIF A;  3SGI A;  2NN6 G;  4OO1 H;  5IYD H;  1YNJ D;  2CKZ B;  4NXN L;  2FFK B;  3MA2 B;  2F0H A;  3PQI A;  1X54 A;  4IPH A;  1SNO A;  1SE4 A;  2A74 C;  4U67 3;  4JI4 Q;  3MAQ A;  1G2T A;  1WTQ A;  4ZLT F;  4MTN A;  3D8G A;  5M5X H;  5D3I B;  3TSS A;  3AYH B;  2VUM B;  4HJ9 A;  1YBY A;  4OON A;  1Q8I A;  4A3F G;  1CM9 A;  2F4V Q;  4DFA A;  3HOU B;  1E1O A;  2DY7 A;  1G6P A;  3DWQ A;  4K2L A;  3CRK C;  4ME5 A;  4JCV E;  1PH3 A;  3PO3 H;  3PO2 B;  1Y8N B;  2EPB A;  4LFA Q;  4UP8 A;  3T1H L;  4BY1 G;  3S1N B;  1BBW A;  2WKD A;  1CQF A;  1QB5 D;  2MGS A;  4C3H B;  2B2W C;  3DEP A;  4E6I A;  1YEZ A;  1JOO A;  1RKN A;  2R92 H;  1DXM A;  1R9T H;  1HNX Q;  2OWO A;  1IBL L;  4P72 A;  4IN3 A;  3I7F A;  1BO0 A;  2C9O A;  3K81 C;  5M5W H;  3VYT A;  1PDQ A;  1N34 Q;  1EIG A;  4A3C H;  4DAY A;  4QCL A;  3EQL C;  1IBM L;  1SN8 A;  3GV6 A;  2SNS A;  1JOK A;  3BYT B;  4U68 A;  3S2D H;  4DUY Q;  2Y0S G;  4C3J G;  4RHR A;  4TKO B;  1N33 L;  4B3R Q;  3F2C A;  3ULP A;  1K9M C;  2PNR C;  5D3D A;  2QW7 A;  3ONA B;  2K5Q A;  1BCP D;  2PZW A;  3C1F A;  3I4M G;  1PTO B;  3BDO A;  3VYU A;  1SXT A;  1BNZ A;  4B3M Q;  1I4H A;  2WAQ B;  3T16 A;  1K8G A;  2L12 A;  3FKI G;  1S3O A;  4JK1 C;  4IUQ A;  3T51 B;  2E2I H;  3TDQ A;  3FHW A;  1PH1 A;  2NYZ D;  1SR3 A;  4DR2 Q;  1HR0 L;  1NY4 A;  3T53 B;  5ELC A;  5IT9 c;  1D1K A;  1F2Y A;  4DF7 A;  1B9M A;  4ILW A;  2K03 A;  5J1Z A;  2F0U A;  2B2Y A;  2OQK A;  1D1I A;  4KKS A;  2E2D C;  5I9P A;  3H15 A;  4JI0 L;  2K52 A;  3IFT A;  1N32 Q;  4GKK Q;  4IPC A;  2I0Q A;  2F0S A;  5C44 H;  1EU3 A;  4A93 B;  2ZJP A;  4R4C A;  1EWH A;  4OWX B;  1Y1V H;  1WTW A;  1Q12 A;  2LS0 1;  2BH2 A;  4BBS H;  3CCU A;  1CA5 A;  2Q8R E;  3FP9 A;  1JOQ A;  4GNX B;  4QY7 A;  4IFD H;  3D0F A;  3L9A X;  4KLK A;  2LKV A;  3W1B A;  3K7A H;  1EWC A;  1G51 A;  4HIO A;  1IKM A;  1DZ1 A;  5BR8 Q;  5JJI A;  3BVM A;  3R8B A;  1MI2 A;  3H0G G;  4HJ8 A;  2NVX H;  2UUA Q;  1AEX A;  4DR7 L;  3RN5 A;  3EVQ A;  1QVF A;  2B3G A;  2KCM A;  4JI6 L;  3M4Q A;  2RF4 A;  4IOA A;  2LSS A;  3I4N G;  5DAU A;  3K0X A;  1GO3 E;  2HUG A;  2E2J H;  4J8Q A;  2B2T A;  1IYJ B;  1EFW A;  1SYF A;  2L0C A;  3I91 A;  1PV4 A;  4OEL B;  5EKK A;  3NE5 B;  4IJL A;  1XMO Q;  2WII B;  4HJ5 A;  3PCO B;  2VXW A;  3HOW G;  3M3Y H;  3V96 A;  3CCQ A;  3HOX B;  1EIH A;  1J5E L;  1S72 A;  4NXN Q;  3H3V H;  3SK6 A;  3OOC A;  3WOF A;  3H91 A;  1TVX A;  2DGY A;  3ULJ A;  1GOZ A;  4H13 C;  5C5L A;  3GTO B;  4F8M A;  1A0I A;  3L0O A;  1H9S A;  4K5X A;  4DV4 Q;  4N9P A;  3RZO B;  1NJI C;  1EU4 A;  4OX9 L;  2XRS D;  3K6O A;  3IAY A;  4IUV A;  3GTQ B;  3MFY A;  2HHH L;  3S16 B;  1JCK B;  3T1H Q;  2UXD Q;  4KD4 A;  1EOV A;  3HOV H;  1K8M A;  1T5E A;  1Y69 U;  1FL0 A;  3J80 c;  1VQ6 A;  4GN4 B;  4CDC C;  5DLQ E;  1SNM A;  3Q23 A;  4G7H C;  2PCF B;  1P8L A;  2A69 D;  1SYG A;  2K33 A;  4ULL A;  5EPJ A;  1IBL Q;  1LTR D;  1MJC A;  4IPG A;  5BN4 A;  1MIU A;  1X56 A;  3EFX D;  1EZ6 A;  2ZJR A;  4KI0 A;  4X65 L;  1K8A C;  4JV5 L;  4X62 L;  5CC4 A;  2PQA B;  2DNC A;  3VR2 A;  1TWH H;  3NTK A;  5CGK A;  5M3M B;  4YWL A;  2ZTE A;  2KVM A;  1TY2 A;  1XXG A;  1ZYR D;  5LL6 S;  1MSG A;  2B8F A;  2Q2H A;  2RHQ B;  2VL6 A;  1UEB A;  3OHX C;  2XNA C;  5FLX L;  1FNV A;  3U4V A;  3G4S A;  4POF A;  2XTI A;  4OHJ A;  3QOJ A;  3P1H A;  4A3B H;  2F0D A;  3K80 C;  2GVA A;  3W1G A;  1EIY B;  2ID0 A;  3I4L A;  1F2L A;  3M4O H;  3S2H H;  4B9X A;  5FLM G;  4R9W A;  4LF4 L;  4YHH Q;  3NWS A;  1YVC A;  4LF6 L;  1KAB A;  1Q3L A;  2HIX A;  1B3Q A;  1W6J A;  3DXJ C;  1JE4 A;  4PZ7 A;  4S3S A;  4UP9 A;  1PRT B;  2YTY A;  3A8J E;  3SK5 A;  4CJ2 C;  4L5S A;  4A3K B;  1WCM B;  2ZM6 Q;  4PMW A;  1UE5 A;  1SMX A;  3H94 A;  3OSO A;  2AQ3 B;  3FPU B;  1L1O C;  2EJM A;  3Q0A A;  1J8I A;  4XIG S;  3V2T A;  2NN6 I;  1EQT A;  2F1M A;  3KUP A;  3S15 H;  1KNA A;  4DKA C;  1NTG A;  1IHZ A;  4G7Z C;  1NAP A;  3HKZ E;  3KLS X;  3PUY A;  1STE A;  4HTH A;  1CT1 D;  5AFW A;  2KBN A;  3GTG B;  1I3Q H;  3HFZ B;  1SYE A;  4EQ5 A;  2VQF Q;  3RNU A;  5LMN W;  1NMG A;  2RDF A;  1STY A;  2SNM A;  3CME A;  1TQO A;  2KJX A;  3NTI A;  2K1B A;  4DK3 C;  3P20 A;  4QIW B;  3I2Z A;  3S14 B;  2B63 H;  1PTO C;  1PHJ A;  1RL2 A;  2EYL A;  1EWI A;  4DR3 L;  5A35 A;  1HTP A;  3KLR A;  4DUZ L;  3D6C A;  1HHV A;  5JOB A;  4DV2 L;  1WJJ A;  2MPM A;  4KY7 A;  2X6L A;  1Y14 B;  3BJU A;  4JPB W;  4ABN A;  1SMY C;  4A3E H;  2AQ1 B;  5EKL A;  3BZD B;  1UE6 A;  3RZD B;  4A3F B;  5LMN L;  1I6V C;  4APV A;  4L63 B;  4MNO A;  1E0B A;  2B2U C;  3A74 A;  4IUR A;  2EVB A;  1LLR D;  2NWG A;  3SDZ A;  3LX0 A;  4BY1 B;  2EDG A;  2F3I A;  1FR3 A;  2EZV A;  1NBW A;  1HRJ A;  3U50 C;  4GNX C;  1SAP A;  2D9U A;  3X3N A;  1PH9 A;  1TXY A;  3PF5 A;  1ENA A;  3PSI A;  2ZTD A;  3OWF A;  4XT3 B;  2HT1 A;  2UXC Q;  1F9R A;  2R7D A;  4JBM A;  2NZO A;  2FXQ A;  2JA9 A;  5C4H A;  2CWA A;  1CHQ D;  5K36 H;  4B3T L;  5DNF A;  5G3L D;  3U9S A;  5FOB B;  2ASB A;  2QGQ A;  1EYG A;  4IUP A;  2RA4 A;  1SDF A;  3KFU A;  4DAM A;  4GOP C;  2A68 D;  2Y0S B;  3HKZ G;  4H44 C;  3U4Z A;  4C3J B;  1LTB D;  5KYI A;  4X62 Q;  1VDZ A;  2LXJ A;  2VUM H; 
#chains in the Genus database with same CATH homology
 4DV6 Q;  1XNR L;  2GVB A;  1OXV A;  3HOU H;  1HZB A;  4YWM A;  1BKB A;  4LFC L;  2K14 A;  1M90 C;  1VQD A;  1HNZ L;  1VQO A;  2UU9 L;  3PO2 H;  1VQ5 A;  1EQR A;  3PUX A;  4X6A H;  5FJ8 H;  1VS0 A;  4ALP A;  4B3T Q;  1AE3 A;  2OQ0 A;  3I4N H;  3S1N H;  3CW2 C;  1TWG H;  1H95 A;  4DV1 L;  1WFQ A;  3E9I A;  1A63 A;  4P73 A;  4C3H H;  1QUQ A;  3GD7 A;  1L2F A;  3E9H A;  1EQQ A;  4BXX G;  2AKW B;  5GAG C;  1K83 H;  4X66 L;  4PZ8 A;  1L0W A;  4A3J H;  5J3B A;  2JA6 G;  4AH6 A;  2UXB L;  1NE3 A;  3CC4 A;  4WJ4 A;  2Y0S E;  1JB7 A;  4YCU A;  5JEA J;  4JOI A;  3HOW H;  2HIV A;  1GM5 A;  1S40 A;  5C4X G;  1DGS A;  3LGJ A;  3OW2 A;  4JBK A;  2Q2U A;  1XNR Q;  4DK6 C;  4GN3 B;  4GKJ Q;  4DR5 L;  2Z6K A;  4JI4 L;  4LFC Q;  3PUZ A;  4LF5 Q;  1B70 B;  2MNA A;  1HNZ Q;  2NVQ H;  2UU9 Q;  1X65 A;  2CWP A;  1VQE A;  3CAM A;  5EAY A;  4GLA C;  2JA5 G;  4A3B G;  1YIT A;  1SE8 A;  1JJ2 A;  5LMU L;  2IX0 A;  3UE0 A;  3ZJY C;  2F4V L;  1EUJ A;  3A5Z B;  1EIF A;  3SGI A;  2NN6 G;  2WB1 E;  4DV1 Q;  1MJE A;  2K4K A;  1K73 C;  1WOC A;  3G6E A;  4R4O A;  1N36 L;  3ER0 A;  5IYD H;  4X66 Q;  2CKZ B;  3F8T A;  1VCI A;  3U58 A;  2YU9 H;  4NXN L;  1YI2 A;  4LFA L;  2UXB Q;  1OXX K;  2VY3 A;  3HOZ H;  1KHI A;  4GNX A;  1X54 A;  3BZC A;  4IPH A;  1KIX A;  4HIM A;  3B6Y A;  2MFI A;  2YV5 A;  5C3E G;  4HJ7 A;  4DR5 Q;  4JI4 Q;  2K5H A;  4JC0 A;  1V43 A;  5IP9 G;  1VQG A;  4A3M G;  1FJG L;  4MTN A;  5M5X H;  1XTD A;  1HNX L;  4BBR G;  4IFD I;  3AYH B;  1OXT A;  1YBY A;  4HJ9 A;  4OON A;  1XPU A;  5LMU Q;  4Y7N H;  2EXD A;  4A3F G;  2F4V Q;  3CF5 A;  1E1O A;  3PV0 A;  1E22 A;  1G6P A;  3I4O A;  1N34 L;  3PUV A;  1JT8 A;  3KOJ A;  2RCN A;  3I4M H;  2D0O A;  4JCV E;  1PH3 A;  3J81 j;  3PO3 H;  1N36 Q;  4HID A;  3T1Y L;  3L2P A;  4AIM A;  2JJQ A;  1E24 A;  3JAM c;  3I56 A;  4LFA Q;  4GOP A;  4UP8 A;  3T1H L;  3Q8D A;  2N3S A;  4BY1 G;  4GLV B;  4YCV A;  3JC6 6;  1VQN A;  1BBW A;  1QZH A;  1XNQ L;  2ES2 A;  1UE7 A;  4DUY L;  5C0X I;  3FKI H;  1VQF A;  2NVY H;  4B3R L;  2AWN A;  3M85 A;  3KF6 B;  2MO0 A;  1YEZ A;  1HNW L;  2IHE A;  3ICE A;  1HZC A;  4Y52 H;  2JEB I;  2K50 A;  3CCE A;  4A93 H;  4P74 A;  4IOC A;  2R92 H;  4JI5 Q;  1FJG Q;  3NEL A;  1I5F A;  1K0R A;  2LXK A;  2VZA A;  4JBW A;  1XPO A;  1R9T H;  1HNX Q;  2OWO A;  1IBL L;  4P72 A;  3I7F A;  2K5N A;  3K81 C;  2B29 A;  5M5W H;  1JE5 A;  4BA2 I;  4KHP L;  3OYY A;  5GAD C;  4B3M L;  1N34 Q;  4A3C H;  3PGZ A;  1SRO A;  2GN5 A;  3T1Y Q;  1IBM L;  5ELN A;  1SN8 A;  2L15 A;  2JA8 H;  2AHO B;  3GTP H;  2B63 G;  4JYA L;  1AH9 A;  4DR2 L;  3S2D H;  2XGT A;  3ERS X;  4DUY Q;  2R7Z G;  3CCJ A;  3H3V I;  1L1O A;  2Y0S G;  1C0A A;  2QEX A;  1N33 L;  3F2C A;  4B3R Q;  3ULP A;  1K9M C;  2F52 A;  1HH2 P;  1HNW Q;  4A3I H;  2Q2T A;  2N8N A;  5FLM H;  1Q1E A;  5LMN Q;  2UUC L;  4K0K Q;  1XJV A;  4LUO A;  3I4M G;  4LF7 L;  3PO3 G;  1PH6 A;  1N32 L;  1LTL A;  5ELO A;  1HJP A;  3IRB A;  4DV0 L;  4GKK L;  1B8A A;  5GQO A;  4KHP Q;  4UPA A;  4B3M Q;  4UP7 A;  5M3F G;  4WJ3 M;  1K8G A;  5IYC G;  2CFM A;  2I5M X;  1Q46 A;  3FKI G;  3MXN B;  4JBJ A;  4P75 A;  4TVA B;  4A3E G;  3HOY G;  4FDB A;  1S3O A;  3F2D A;  1QUQ B;  1IBM Q;  1JJC B;  2KHI A;  4JG2 A;  2E2I H;  1V9P A;  3FHW A;  2JA7 G;  4JYA Q;  3EIV A;  1PH1 A;  1SR3 A;  2HQL A;  4AYB E;  4DR2 Q;  1LUZ A;  3H0G H;  1HR0 L;  1TWC H;  1NY4 A;  1N33 Q;  3EBE A;  1YJW A;  4X64 L;  5IT9 c;  2IY5 B;  4DR6 L;  1YJN A;  3KLW A;  4BA1 I;  1VQ7 A;  3M7N A;  2UUC Q;  2WP8 J;  4DV3 L;  1PYS B;  4A3C G;  2OQK A;  2VS1 A;  4BY7 G;  4LF7 Q;  1U5K A;  3H15 A;  4JI0 L;  2K52 A;  2PQA A;  3S1R H;  1N32 Q;  3K7U C;  3CXC A;  4DV0 Q;  1CKN A;  1FVI A;  2D62 A;  2K5V A;  5AJ3 L;  4GKK Q;  3S1Q H;  4IPC A;  5BR8 L;  2I0Q A;  1D8L A;  5C44 H;  4DR1 L;  2QA4 A;  3GTO H;  2WAQ E;  3NBH B;  2ZJP A;  1K3R A;  1Z9F A;  4R4C A;  4OWX B;  1Y1V H;  4JI2 Q;  2UUA L;  2UUB L;  1Q12 A;  4YWK A;  1PYB A;  2BH2 A;  5GRO A;  3RZO H;  3I4N G;  4BBS H;  4A3G H;  4K0K L;  3CCU A;  3I55 A;  3GTK H;  1HR0 Q;  4QJF A;  3FP9 A;  4DV5 L;  4GNX B;  5K36 G;  4X64 Q;  4QY7 A;  5IP7 H;  4LUV A;  2AMC B;  2EIF A;  3GTQ H;  3D0F A;  3ULL A;  4KLK A;  5IWA L;  1KAW A;  2E5L L;  2NZH A;  2BA1 A;  4DV3 Q;  1O7I A;  3S16 H;  4GN5 A;  3W1B A;  1VQM A;  2JEA I;  4JI0 Q;  1IXR A;  3K7A H;  1XMO L;  1G51 A;  2DUD A;  4HIO A;  5AJ3 Q;  1ASY A;  5BR8 Q;  4DR1 Q;  2VUM G;  5JJI A;  3H0G G;  4HJ8 A;  4B3S L;  4QQB X;  2JE6 I;  2R93 H;  1VQK A;  4LWC A;  3HOU G;  1I6H H;  1B7Y B;  2NVX H;  3K8A A;  3L7Z C;  2UUA Q;  3RN5 A;  2UUB Q;  4DR7 L;  4IJH A;  4AQY L;  2C35 B;  3J81 c;  1CUK A;  4R1J A;  1Q82 C;  2B3G A;  2KCT A;  2KCM A;  4JI6 L;  1QVF A;  3M4Q A;  3PO2 G;  1YJ9 A;  2RF4 A;  3CPF A;  4DV5 Q;  5FJ8 G;  4IOA A;  2ZTC A;  1X55 A;  1WYD A;  2LSS A;  3BZK A;  1GO3 E;  1AE2 A;  3K0X A;  1OTC A;  2E2J H;  3TS2 A;  2N49 A;  4UY8 C;  1IYJ B;  5IWA Q;  4DV4 L;  2I5H A;  2E5L Q;  2OCE A;  1EFW A;  5IYB H;  5M3M H;  1YZ6 A;  4A3J G;  1G29 1;  1PV4 A;  3RLO A;  3S17 H;  1KRS A;  4IJL A;  1XMO Q;  4HJ5 A;  1VQJ A;  3PCO B;  4JI1 L;  4LF9 L;  3HOW G;  3M3Y H;  1C7Y A;  3CCQ A;  3OTO L;  4B3S Q;  3AFP A;  1J5E L;  3UDI A;  1S72 A;  4NXN Q;  1CKM A;  3CQZ H;  3H3V H;  2YYZ A;  1P16 A;  4DR7 Q;  2UXD L;  2V1C C;  1HZ9 A;  4LF8 L;  1PFS A;  1ASZ A;  3ULJ A;  2DGY A;  3HKS A;  4JI6 Q;  3DM3 A;  4JI8 L;  1E3P A;  1YIJ A;  4AYB G;  1W2B A;  1A0I A;  1L1O B;  1Y1W H;  4A3D H;  3L0O A;  1GVP A;  4DPG A;  4NXM L;  4DV4 Q;  4OO1 G;  1VQH A;  1XPR A;  1NJI C;  5IYD G;  3UDF A;  2RHS B;  1PH9 A;  5C0X G;  2VQE L;  4IO9 A;  4OX9 L;  2KHJ A;  1VQ9 A;  4GLX A;  3EN2 A;  3HOZ G;  3JAM i;  4JI1 Q;  4YCW A;  1YHQ A;  3MEF A;  3OTO Q;  4DR4 L;  2HHH L;  2PI2 A;  4PG3 A;  1J5E Q;  3T1H Q;  4C2M H;  3CCR A;  2UXD Q;  3HOV H;  1EOV A;  2WAQ G;  1XNQ Q;  4PZ6 A;  4LF8 Q;  1FL0 A;  1A8V A;  1IL2 A;  4A3K H;  4QIW E;  1WCM H;  1X3F A;  3J80 c;  1VQ6 A;  4JI8 Q;  4A4I A;  4QGU A;  3CCM A;  1KQS A;  4GN4 B;  2BH8 A;  3CD6 A;  5DLQ E;  4JI7 L;  1VQL A;  4NXM Q;  1JMC A;  1P8L A;  3KYH C;  3PUW A;  1IBL Q;  2MO1 A;  1Q8K A;  4EX5 A;  1E7Z A;  1MJC A;  1OXU A;  4IPG A;  1Q7Y C;  4A3L H;  2VQE Q;  4A76 A;  1MIU A;  1X56 A;  4OX9 Q;  2ZJR A;  4KI0 A;  4X65 L;  1K8A C;  4JV5 L;  1QVC A;  4X62 L;  3D31 A;  2PQA B;  1TWH H;  2WB1 G;  3BU2 A;  4NPS A;  3STB D;  2HHH Q;  3TRZ A;  4DR4 Q;  4BXX H;  1LYL A;  3UDX A;  4YWL A;  3A0J A;  1W3S A;  2JA6 H;  4A93 G;  2ZTE A;  4YHH L;  3CPW A;  2R92 G;  1GKH A;  5C4X H;  1GD7 A;  3VDY A;  2Q2H A;  1XMQ L;  3GTG H;  2WFW A;  2RHQ B;  2VL6 A;  1UEB A;  1MKH A;  1X3G A;  4XTC S;  4JI7 Q;  1NMF A;  2ALY B;  3HOX H;  4IFD J;  3U4V A;  3G4S A;  1VQ4 A;  4POF A;  2XTI A;  4LNQ A;  1Q1B A;  3AQQ A;  2JA5 H;  2MQH A;  3S14 H;  3KDF A;  4A3B H;  1U0L A;  3K80 C;  2ZM6 L;  1VQC A;  1N8R C;  2JA8 G;  3HOV G;  4X65 Q;  4JV5 Q;  1QVG A;  1BBU A;  1VQ8 A;  3CP0 A;  1KL9 A;  2GVA A;  2AWO A;  4LUZ A;  1FGU A;  3W1G A;  2ID0 A;  2K75 A;  3F2B A;  2PNH A;  1EIY B;  3M4O H;  5JJK A;  3TEH B;  2NVT H;  3S2H H;  4GKJ L;  5C0X J;  4A3I G;  1WI5 A;  5FLM G;  1Q86 C;  4LF4 L;  4LF5 L;  4YHH Q;  3UE1 A;  4A3K G;  1YVC A;  1CSQ A;  4LF6 L;  1XMQ Q;  4DR6 Q;  4LFB L;  5C3E H;  2HIX A;  1X3E A;  4A3L G;  4R4T A;  4PZ7 A;  5IP9 H;  3CCL A;  4UP9 A;  2YTY A;  4A3M H;  3TRE A;  4L5S A;  1VQA A;  4GS3 A;  1V1Q A;  2Q2I A;  4BBR H;  1PA6 A;  3RZD H;  1IBK L;  1YHA A;  3WWV A;  2ZM6 Q;  4PMW A;  4A3F H;  1UE5 A;  3M9B A;  1SMX A;  4R4I A;  4OWT B;  4O2D A;  2VQF L;  3AEV A;  3RN2 A;  2BA0 A;  1L1O C;  4XIG S;  3CMA A;  3GTM H;  2NN6 I;  2D0P A;  3TS0 A;  4DV7 L;  4BY1 H;  2PMZ E;  4GOP B;  4LF4 Q;  4L5R C;  3HOX G;  4ME3 A;  4RMF A;  4RG1 A;  3S1M H;  5IY0 A;  3G48 A;  1PH2 A;  3S15 H;  5GAE C;  4LF6 Q;  4OXP A;  3AFQ A;  1M1K C;  2ATW A;  4DKA C;  4LFB Q;  4JI3 L;  1UE1 A;  3PIP A;  1A62 A;  1YNX A;  5E7N A;  4IPD A;  1NTG A;  1PH8 A;  4H02 A;  1YHB A;  4HIK A;  5C44 G;  4TQU S;  3HKZ E;  2JK8 A;  2KEN A;  3PUY A;  1Q81 C;  1Y1V G;  2ZJQ A;  1IBK Q;  1C9O A;  2CQO A;  2KBN A;  4L5T A;  1I3Q H;  3HFZ B;  2VQF Q;  3S24 A;  1T9H A;  3KF8 B;  1LM0 A;  1NMG A;  4EQ5 A;  5LMN W;  3RNU A;  3J81 i;  4A3G G;  3CME A;  3GTJ H;  1PVO A;  4DAY B;  3CCS A;  5IP7 G;  2N78 A;  4DK3 C;  4IFD G;  1VQI A;  4AQY Q;  1N9W A;  1OXS C;  2Z0S A;  3I2Z A;  4DV7 Q;  2B63 H;  1PHJ A;  1J6Q A;  1RL2 A;  5HGQ A;  2R6G A;  4YY3 L;  1PH4 A;  4OWW B;  4JI5 L;  2R7Z H;  1EWI A;  4DR3 L;  4C3J H;  2VW9 A;  1BVS A;  2CCZ A;  4JI3 Q;  3NEM A;  4L5Q A;  1JJG A;  3TQY A;  3A5U A;  1Z47 A;  3GDE A;  4DUZ L;  4R4Q A;  2EQS A;  5JJL A;  1KD1 C;  4O0A A;  1TWF H;  1IZ6 A;  4DV2 L;  2R93 G;  1KRT A;  2I5L X;  1WJJ A;  2JQO A;  4DNI A;  3M4P A;  4JOI C;  4LF9 Q;  4OO1 I;  1Y14 B;  1SRU A;  5M5Y H;  3BJU A;  3E0E A;  2IHF A;  2R7F A;  5M3F H;  1RIP A;  5IYC H;  3PIO A;  4A3E H;  3HOY H;  2Z6K C;  1UE6 A;  1CSP A;  2UXC L;  2A8V A;  2JA7 H;  3W5O A;  2IT1 A;  2PI2 E;  4YY3 Q;  3J7Z C;  5LMN L;  4APV A;  3GO5 A;  5IYB G;  4DR3 Q;  5M3M G;  2E2H H;  1KC8 C;  1D7Q A;  4MNO A;  3UDG A;  3STB C;  3G71 A;  1SFO H;  3A74 A;  4C3I H;  5FLX c;  5JEA G;  3KJO A;  4LW1 A;  2A19 A;  1QZG A;  4DUZ Q;  1I94 L;  5HY6 A;  1PH5 A;  1SLJ A;  2F3I A;  4DV2 Q;  1HR0 W;  2E8G A;  5IE8 A;  5H1S E;  4BY7 H;  2YTV A;  5GAH C;  1X6O A;  1NBW A;  4QL5 A;  3U50 C;  4GNX C;  3KF6 A;  2H5X A;  3F1Z A;  3KDF B;  1CKN B;  3NEN A;  1VQB A;  1TXY A;  4KHZ A;  3PSI A;  3RR5 A;  3CCV A;  4DV6 L;  5C4J H;  3PF5 A;  1VQP A;  2ZTD A;  3J80 i;  4HJA A;  3RLN A;  2HT1 A;  4NB3 A;  2UXC Q;  1Y1W G;  4A3D G;  1HZA A;  2R7D A;  4BBS G;  3CC2 A;  2NZO A;  3DLL A;  4JBM A;  2FXQ A;  2JA9 A;  1PH7 A;  1I50 H;  4MZ9 A;  2CWA A;  4B3T L;  3KJP A;  1E1T A;  4P71 A;  2OTL A;  1UWV A;  2VNU D;  2ASB A;  1I94 Q;  3PF4 A;  2QGQ A;  1CKO A;  1TWA H;  3J7A 5;  1EYG A;  4POG A;  1X9N A;  3GTL H;  3RLF A;  2OTJ A;  2IX1 A;  4DAM A;  4GOP C;  3KFU A;  3HKZ G;  3U4Z A;  4A75 A;  4JI2 L;  1KXL A;  4X62 Q;  2A1A A;  2YTX A;  3CC7 A;  2LXJ A;  1WCM G;  2VUM H;  4J15 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...