4JI4Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji4Q00
4POGA 2LXKA 4NPSA 3UDIA 2N49A 4A3KH 4GLXA 1PH4A 3S1MH 5ELNA 5GAEC 1NBWA 3VDYA 4BY7H 2UXCL 1JT8A 2ID0A 2H5XA 1TWAH 3ERSX 3CC2A 1C0AA 4POFA 1L1OC 1YJ9A 1UEBA 4APVA 2MQHA 1Y14B 4LUOA 4X66Q 4HIMA 1YI2A 2F4VL 3PO3G 1MKHA 1K8GA 4MNOA 5AJ3L 1RL2A 1IBML 3U58A 1WFQA 3CCSA 5JJLA 1N33Q 4LWCA 1JJ2A 2KHIA 2YYZA 1XMQQ 3MXNB 4R4TA 3CF5A 4ALPA 4JI4L 3GTQH 4B3SL 4DR4Q 4B3TQ 1VS0A 4RMFA 4LF7Q 4OX9Q 3M4OH 4AIMA 2ZM6Q 1VQJA 3STBD 3HFZB 3W1BA 3NBHB 1HR0Q 3CC7A 4NXNQ 3I4MH 3TS2A 2MNAA 1TXYA 3HOZG 3E9HA 3RLOA 4LUVA 5C0XJ 1PA6A 3ULJA 4LF9L 3ER0A 4R4CA 3W5OA 5IYBG 1BBUA 2ATWA 3PUWA 3G4SA 2KBNA 1T9HA 2QGQA 5J3BA 3KJPA 1VCIA 3CCMA 5IY0A 4BXXH 1C9OA 4R4IA 1UE6A 1W2BA 1HNWQ 5C0XI 1I5FA 3UDXA 1VQPA 3GTOH 2B3GA 2R6GA 4BBRG 4AQYL 1PH9A 3M3YH 1PH6A 3PO2G 5IWAL 1AE3A 4YWLA 4JV5Q 2D0OA 1QZHA 1L1OA 1NY4A 3J81j 2VS1A 1L2FA 3BZKA 2JEBI 4JI8L 3T1HL 5IYDH 2R7DA 4IJHA 1PYBA 2WP8J 4R4OA 5IYCG 4DR2Q 2IHEA 4DV0Q 1JB7A 1FJGQ 4P71A 4KHPL 4L5TA 3HOZH 1YIJA 2F3IA 3RLFA 3GTPH 4A3MG 2OQ0A 2PQAB 1H95A 1VQFA 3DLLA 1Q82C 2BH2A 5IP7H 1QUQA 4JI1L 2ES2A 3HOVH 4C2MH 4A3GH 1JMCA 1FJGL 4KHPQ 4IFDJ 4O0AA 3DM3A 2YV5A 2B63H 2JJQA 2RF4A 1E1OA 4R4QA 4JI2L 1XNRQ 4A93G 3G71A 4HIOA 4LF8Q 3S2DH 4IFDI 2VY3A 1X54A 5HGQA 3FKIH 1NE3A 2UUAL 2JK8A 1N9WA 4JG2A 4A3EG 4YCWA 5M3FH 3AFQA 3CCQA 2JA5G 5C4XG 4DR4L 2HQLA 1PH7A 1K83H 1KQSA 3HOYG 3H15A 2VW9A 3SGIA 4JI7L 2PNHA 2ZTEA 3I4OA 3CC4A 3PUYA 3JAMc 2FXQA 1XJVA 3D31A 4GN5A 1PVOA 2VQEL 1CKMA 4LFAQ 4QIWE 1Q7YC 1HNZL 1I6HH 4GKKQ 2YTVA 1IL2A 2Q2UA 4KHZA 2JA8H 4OO1I 4Y52H 4A76A 1U0LA 3S14H 4X65Q 1B8AA 4GKJQ 4LFCL 1YEZA 1Z47A 3L7ZC 2R93G 4H02A 3I7FA 4BXXG 3JAMi 3KFUA 4IPGA 3J81c 4MTNA 1VQOA 4NXMQ 1Y1VH 1K9MC 3I4NH 3HOYH 1KC8C 4UP7A 4GOPB 2Q2IA 2LXJA 1P16A 1PH2A 1N34Q 4C3HH 4DR3L 3OW2A 1VQLA 1FVIA 2LSSA 3M4PA 2UU9Q 3RN5A 1KRSA 1SFOH 1IXRA 2BA1A 1D7QA 2KHJA 4OWWB 1D8LA 2VUMG 4A3LH 4LFAL 3CCLA 2JA6G 1VQCA 4JI6Q 1XPOA 1HZBA 1I50H 1SR3A 1CUKA 3J7ZC 4LF6Q 1ASZA 3PUXA 2UXDL 1E22A 5ELOA 1NJIC 3RNUA 4GLAC 3PIOA 1QUQB 2OCEA 4GOPC 2ZTDA 1R9TH 1EIFA 3LGJA 4UP9A 2PQAA 4BBRH 1N33L 1TWHH 3AEVA 1J5EQ 4A3DG 1KIXA 3K80C 3CCRA 1LTLA 4XTCS 4A3JH 2CWPA 2N3SA 4DR6Q 1G51A 2YTXA 4UPAA 4A75A 2DUDA 2I5LX 5JJKA 4YY3L 1Q81C 4DV6L 2WAQE 3OTOL 3STBC 4LF7L 4YCUA 3GTKH 4A3LG 2E8GA 1XNQL 5BR8L 3K8AA 3M4QA 1HZCA 4DR1L 2CFMA 3UDGA 2Y0SE 4JV5L 2XTIA 3W1GA 4A3MH 4BA2I 3F1ZA 4KLKA 1Z9FA 4AH6A 4B3ML 1VQNA 5H1SE 3B6YA 4BY1G 3M7NA 3GTLH 1MJCA 1AH9A 1PYSB 4DUYL 4OXPA 4QY7A 2K52A 4AYBE 4EX5A 4RG1A 3UE0A 4LF5Q 2VZAA 1A62A 3PV0A 4YHHL 4DR6L 3TRZA 1X56A 3F2DA 1S40A 1GVPA 2VUMH 3K0XA 4YWKA 4JBKA 4Y7NH 3PF5A 2UUBL 3MEFA 3CPWA 2RHQB 3CCEA 1N8RC 4DV1Q 1K0RA 1Q46A 3M85A 2KCTA 4AQYQ 1WI5A 4OWXB 2F52A 4DR3Q 1UE1A 1NMGA 2R93H 3F2CA 5IYBH 2IX1A 1OXVA 1G291 2PMZE 3CP0A 1PH1A 2NVXH 2WB1E 4JI0Q 2PI2A 3H3VH 1EUJA 4GOPA 1HZ9A 4A3DH 1LM0A 3PO2H 1GD7A 2JA7H 4DR2L 2UXBL 2Z0SA 4A3JG 2Q2HA 1X65A 1SMXA 2XGTA 1X3EA 1XNRL 1IYJB 1BVSA 1SROA 2IHFA 4FDBA 4GN4B 4YY3Q 4DV6Q 1KD1C 1N36Q 2CCZA 4K0KQ 1KHIA 3ULPA 3S24A 3A5ZB 2WFWA 4JI1Q 3OYYA 5JEAG 1SRUA 2UXBQ 4X62Q 4IPHA 3T1YL 1XTDA 4DPGA 1E3PA 4B3RL 1NTGA 5C4JH 3BU2A 2HIVA 2NZHA 3PUZA 4DUZL 1W3SA 4LF6L 1HNXQ 1VQGA 1YBYA 3GD7A 1KXLA 3H3VI 1SLJA 3G6EA 2AHOB 4A3KG 4JI5Q 2RCNA 5FLMH 3I55A 1UE5A 2VQFQ 2C35B 2N8NA 3HKZG 2CQOA 2IY5B 1MIUA 4P72A 4LW1A 1VQ4A 1QVCA 1XMOQ 2DGYA 4P75A 4JI2Q 4LFBQ 5IE8A 1CKOA 1I3QH 4TVAB 5EAYA 2NVTH 3FHWA 2UUCQ 4HIKA 1E24A 3HKSA 5C0XG 2E2HH 1EWIA 3KOJA 1XMOL 4DR7L 3GTGH 2ZTCA 1YNXA 2K75A 4JI3L 2A19A 2EXDA 3J80i 1TWCH 1VQHA 2K5NA 2JE6I 2WAQG 3KDFB 3GO5A 4JI6L 3CAMA 1Y1WG 1SN8A 1E1TA 4LF5L 2OTLA 1VQIA 4L5QA 3RZOH 2MO1A 4B3RQ 4BY1H 2GVBA 1YHBA 2I5MX 5IP9G 4ME3A 2JA9A 3U50C 5LMUQ 4DUZQ 1EIYB 2R92H 4QL5A 1VQ8A 3HOUH 3I56A 2K4KA 3CPFA 4A3BH 5JJIA 4DNIA 3AFPA 1FGUA 3NEMA 4LUZA 4JBJA 4A3FH 4X6AH 3BZCA 2AWNA 5M5YH 3FKIG 4IOCA 1KL9A 2R7FA 4JBMA 1I94L 1EQRA 1Q1EA 2K5HA 4C3JH 2HHHQ 4TQUS 2Z6KC 1XMQL 1V1QA 2R7ZG 2E5LQ 4PG3A 5C44G 3EN2A 4DKAC 2E2JH 2UUCL 4GN3B 3S16H 1LUZA 5GQOA 1HR0L 4DR5Q 2QA4A 1IBMQ 3OTOQ 3I2ZA 3KDFA 3PCOB 4GS3A 2HHHL 2B29A 2IT1A 1VQKA 4LFCQ 3J7A5 3F8TA 3S15H 4LFBL 1PH5A 3KF6A 1HJPA 2VQEQ 1DGSA 3Q8DA 4JBWA 1J5EL 1VQ5A 1S3OA 4L5SA 1N32L 4DV1L 4A3CG 3L2PA 1Q8KA 1TWFH 3KF8B 1KRTA 3I4MG 3HOWH 2V1CC 5IWAQ 4X66L 3BJUA 2UU9L 2YTYA 3S2HH 4WJ4A 1FL0A 4DK6C 4JI7Q 1Y1VG 2IX0A 1YHQA 4LF4L 1QVGA 4GLVB 2ZJQA 4EQ5A 3EBEA 4X64Q 4DR5L 1M1KC 3FP9A 4X62L 1JE5A 3J80c 4HJ9A 5LMNW 5FLMG 1MJEA 1VQDA 4XIGS 4MZ9A 1GO3E 2Z6KA 3RR5A 1YZ6A 1QZGA 1K8AC 4OX9L 3K7UC 1N36L 1IBLL 4DUYQ 4IJLA 2ZJPA 4QJFA 4JCVE 4GNXA 2MO0A 1VQMA 3H0GG 3ZJYC 4BBSH 3TQYA 3RZDH 1P8LA 1HH2P 1VQAA 2OQKA 2VL6A 3I4NG 1LYLA 5E7NA 2ALYB 1XPRA 1IBLQ 4DV2L 4IOAA 4PZ7A 3EIVA 2KENA 4BA1I 2BH8A 3E9IA 1OXXK 4YCVA 2RHSB 3GTJH 2QEXA 4UP8A 1M90C 1UWVA 3IRBA 2VQFL 3NENA 2AMCB 3AYHB 2JEAI 1VQ9A 5FJ8H 4BY7G 1GKHA 1CSPA 2K50A 4KI0A 4LF8L 1N32Q 2VNUD 3KLWA 4DV3Q 1Y1WH 1IBKL 3K81C 1N34L 1A0IA 1HR0W 1ASYA 2R7ZH 3CQZH 1YITA 2JQOA 2MFIA 2HT1A 3PO3H 1WCMG 3S1NH 2I0QA 4JI4Q 1U5KA 2Y0SG 1CKNA 2NN6G 3PSIA 4NB3A 2A8VA 2HIXA 2GN5A 2N78A 3S17H 5GROA 1UE7A 2KCMA 4B3MQ 1HZAA 1L0WA 3WWVA 2ZJRA 2UXDQ 2PI2E 4DV2Q 1OTCA 4X65L 1X6OA 4YWMA 2BA0A 1C7YA 4GNXC 3RN2A 1PV4A 2NZOA 4JOIC 4LF9Q 3CD6A 4HJAA 1BBWA 1HNZQ 4PZ8A 1EQQA 4A3CH 1OXUA 1WJJA 1YHAA 2EIFA 4JYAQ 4WJ3M 4HJ7A 3HOWG 1VQBA 4DV5Q 2YU9H 2F4VQ 4BBSG 3A5UA 2AKWB 4AYBG 4JI0L 3HOVG 5LMUL 5AJ3Q 4A3GG 1L1OB 5HY6A 2JA7G 1Q12A 4P74A 2ASBA 3UDFA 2NVQH 4DV7Q 1K73C 1RIPA 1X3FA 2UUBQ 3K7AH 4DAYB 1YJNA 1VQ6A 3CCUA 2EQSA 4NXNL 2K14A 2ZM6L 1NMFA 5C3EG 4DV4L 4IO9A 2JA6H 1J6QA 3ICEA 2L15A 2D0PA 1QVFA 1A63A 4X64L 3U4VA 1SE8A 4JI3Q 5M3MH 5C4XH 4OONA 3L0OA 4A3IH 1E7ZA 2E2IH 1EFWA 4JOIA 3T1YQ 4NXML 3ULLA 1X55A 3HKZE 3D0FA 1EYGA 5IP9H 3M9BA 2R92G 2UUAQ 1JJCB 3CCVA 4GKJL 3PUVA 1OXSC 3RLNA 5JEAJ 1X3GA 4C3IH 4K0KL 4DK3C 3T1HQ 1K3RA 4JI8Q 1V43A 2JA8G 3PGZA 4DAMA 4DV0L 2K5VA 1A8VA 1Q86C 1JJGA 4DV4Q 4DR7Q 1KAWA 4DV5L 3A0JA 1TWGH 3TREA 5LMNL 1PFSA 3S1RH 5K36G 4QGUA 4R1JA 1B70B 5C44H 3U4ZA 1B7YB 3PF4A 2CWAA 2UXCQ 4P73A 4HJ5A 4QQBX 3JC66 5GAGC 3TEHB 1EOVA 1WYDA 2GVAA 4JI5L 3CMEA 3A74A 5LMNQ 1PH3A 5FJ8G 5DLQE 4YHHQ 4A3FG 4IPCA 3CMAA 3HOXG 2D62A 2NN6I 1X9NA 1AE2A 3KF6B 4IPDA 4UY8C 1IZ6A 3GDEA 5IYDG 5BR8Q 5C3EH 2Q2TA 4LF4Q 2I5HA 4O2DA 5IYCH 4HJ8A 1YVCA 3F2BA 1WCMH 5GADC 2OWOA 3NELA 4LNQA 3AQQA 1OXTA 1GM5A 4B3TL 4A4IA 2NVYH 1VQ7A 4A3IG 3GTMH 4DV3L 1YJWA 1IBKQ 3CXCA 3PIPA 4HIDA 3KYHC 5IP7G 1VQEA 2A1AA 3G48A 4OWTB 5M5XH 3KJOA 1PH8A 1XNQQ 4A3BG 4DR1Q 4IFDG 4JYAL 3J81i 1XPUA 1CSQA 5GAHC 2E5LL 2B63G 2AWOA 4GKKL 4B3SQ 4A93H 1Q1BA 1O7IA 1V9PA 3TS0A 1CKNB 4J15A 1PHJA 5IT9c 3HOXH 1I94Q 1WOCA 4GNXB 3CW2C 4JC0A 1HNXL 2WB1G 5M3MG 4A3EH 3H0GH 2OTJA 4DV7L 1S72A 4PZ6A 5M5WH 5M3FG 2JA5H 3CCJA 4OO1G 4PMWA 2CKZB 1HNWL 1G6PA 4L5RC 3HOUG 5FLXc 3E0EA 3UE1A 1BKBA 3S1QH
chains in the Genus database with same CATH superfamily
2LXKA 1AW7A 4NPSA 1PH4A 1SE2A 5ELNA 2B2WA 3T53B 2ID0A 3ERSX 3CC2A 2DY8A 2IX3A 2FMMA 4G4KA 1Y14B 4X66Q 4HIMA 2F0EA 1IBML 1CM9A 1GHJA 3CCSA 4HTHA 3PIO3 1A3UA 3U9SA 2YYZA 1XMQQ 4R4TA 4JI4L 3OSOA 1PZJD 3M4OH 3W1BA 1HR0Q 3I4MH 4RH6A 5C3EB 2MNAA 2FHTA 1PA6A 3I4MB 1KABA 3EROA 3G4SA 3KJPA 4BXXH 1C9OA 4R4IA 1HNWQ 2EY1A 1I5FA 2PQEA 2DN8A 1PH6A 2F0QA 3DMUA 1AE3A 5KEEA 3TP8A 1EZ8A 1QE6A 4HCEA 4YWLA 1L1OA 1NY4A 3BZKA 4JI8L 5IGEA 2R7DA 4IJHA 2G9HD 1CQFA 4DR2Q 2IHEA 4DV0Q 4P71A 5ISRA 1YIJA 1ZKOA 3NHHA 3RLFA 3GV3A 3H0GB 2PMZB 1H95A 1VQFA 3DLLA 4A3JB 1QUQA 1TWHB 4KHPQ 1B44D 4O0AA 1AP0A 2JJQA 3N6RA 4A93G 4ZAIA 4HIOA 3S2DH 3HOZB 1EYCA 3K5LA 2UUAL 2JK8A 4A3EG 1EU3A 2JA5G 1TVXA 3M7GA 2F0DA 5D3DA 5BN5A 3CCQA 2HQLA 1B1ZA 1Q3LA 1K83H 3HOYG 1JR0D 3GTLB 3OOCA 2ZTEA 2Z8LA 2SOBA 3T16A 3D31A 4FXGC 1CKMA 2EZVA 2JA5B 4FNFA 4X3KA 1CTMA 1SYDA 2YTVA 3VR3A 1PTOF 1U0LA 2QDLA 1PFBA 3S14H 1V8QA 4X65Q 2D9UA 5C44B 4GKJQ 2RQXA 4LFCL 2R93B 2R93G 4BXXG 5C3XA 1EYAA 3K5MA 2AQ3B 1Y1VH 3H6MA 1MSGA 4CGYB 2LXJA 1R9TB 4C3HH 1DD2A 3M4PA 1PFMA 1SMYD 2BA1A 1D8LA 2VUMG 3DHQA 5D3IB 2JA6G 4JI6Q 1HZBA 3MXPA 1U4RA 1EOTA 3PUXA 5ELOA 2P5ZX 4RCOA 2OCEA 4GOPC 2QW7A 4UP9A 4BBRH 1N33L 1TWHH 1J9OA 5JPMC 3AEVA 2CH4W 3K80C 4A3IB 1LTLA 4XTCS 4DR6Q 2N3SA 5IGDA 1G51A 2YTXA 1I4XA 4A75A 2DUDA 5JJKA 5A35A 4FF3A 5ELDA 4DV6L 3OTOL 2PYKA 1A2UA 4A3LG 2E8GA 1TY0A 1GUNA 2HDLA 2CFMA 3E6ZX 4BA2I 4KLKA 1QOHA 4AH6A 1FR3A 1KDCA 4BY1G 3GTLH 1JWMD 1PYSB 2K05A 5C0XH 4EX5A 2K03A 3GTKB 3Q0AA 1B50A 4YHHL 2PNRC 1S40A 2EY5A 2BDNA 3K0XA 2UUBL 4G7ZC 3MEFA 4RWSC 2RHQB 3CCEA 1N8RC 4RHRA 2F3VA 1JICA 2F52A 5CBAE 4DR3Q 3VYRA 2R93H 1LABA 2WKDA 4DN4M 2PMZE 3CP0A 1RTNA 2NVXH 1IKMA 3AU7A 1BBXC 1EUJA 1TIID 2R92B 1GD7A 5KIXA 2JA7H 2E2DC 2Q2HA 4A3JG 1SROA 4FDBA 4K0KQ 2F0MA 1N36Q 1KHIA 4JI1Q 1S5BD 3MWYW 2EPBA 1D6EC 5JEAG 4C1NI 1M4VA 1MBYA 2UXBQ 1VMPA 1CA5A 4A3EB 2HIVA 3BS1A 3SR1A 1G8ZD 3PUZA 1KXLA 1STAA 2J7ZA 4RKBA 1AZQA 1SLJA 4ZCKA 1W6KA 3R2IA 4OELB 2VQFQ 3KK7A 2NVQB 3WDNA 3E0JA 2V4DA 1QVCA 2DGYA 1CKOA 3A8IE 4V0BA 5NUCA 3OIPA 3U9OA 4CKEA 2UUCQ 5L37A 2ZTCA 1D5XC 4JI3L 2A19A 2PCFB 3J80i 1TWCH 2L12A 3P75A 1HQRD 2JE6I 3KDFB 3BG3A 4JI6L 4K8JA 3EJIA 2MO1A 1EIYB 2R92H 4ME3A 2JA9A 4N8X1 3U50C 4HCSA 5LMUQ 4R9WA 4DUZQ 1GUWA 1VQ8A 4NKLA 4HR7B 2LKVA 3O13A 3NEMA 2XVSA 4A3FH 2B2UA 5KYLA 2ZT9C 5M5YH 4IOCA 1B53A 2R7FA 2K5HA 2HHHQ 2L9HA 2K6AA 2XRSD 2Z6KC 5AFWA 2NBFA 1XMQL 2R7ZG 1QNUA 2KA7A 4PG3A 1C8CA 3EN2A 1H9SA 5DM73 4GN3B 1HR0L 1IBMQ 2O5JC 3I2ZA 5ELEA 3PCOB 1TS3A 4GS3A 3S2HB 1CHPD 5IOCA 2IT1A 1VQKA 3TP5A 5M3MB 1NSNS 3BVZA 1J5EL 1VQ5A 1S3OA 4EQPA 1DOMA 2A74C 1KLUD 3Q22A 1I4PA 2UU9L 5EKIA 3HOXB 1ZEQX 4FXDA 1O7YA 3P20A 1YHQA 1STYA 4LF4L 4GLVB 2ZJQA 1C4QA 1K83B 4X3TA 1BUVT 1R4PB 1K8AC 1RTOA 2DY7A 1N36L 1EZ6A 2B8FA 4DAYA 2ZJPA 4QJFA 4GNXA 5FLXL 1PRTD 5EKLA 1E2WA 1VQMA 1HA6A 2J0TD 3EA6A 1IYVA 1YNJC 1P8LA 3A8KE 3HGBA 3OWEB 3S14B 1F2ZA 1RHPA 5E7NA 2ALYB 1IBLQ 4DV2L 4PZ7A 3A7AB 1OXXK 1EIGA 2L5TA 3GTJH 2QEXA 1CI3M 3IRBA 2AMCB 3NTIA 2JEAI 1VQ9A 4ZYSA 3J7AV 1CSPA 1N32Q 3PQIA 4KY7A 4DV3Q 2R7ZH 2FJ2A 1D5MC 1WCMG 2I0QA 1CKNA 4K5VA 2HIXA 5I6WA 2N78A 4B3MQ 1JORA 3M3YB 2PI2E 4X65L 4YWMA 1XYIA 4JOIC 4LK1C 4ABNA 1BBWA 2MGSA 4RGNA 1EQQA 1NR2A 3KF8A 5IGCA 2YU9H 4KJNA 4AYBG 5AJ3Q 2WB1B 1L1OB 1TWAB 5M9OA 3UDFA 3NQTA 4DV7Q 4WRDA 5C3EG 1J6QA 1FNVA 1QVFA 2D0PA 3D4DA 2F0JA 1A63A 3U4VA 5M3MH 2FFKB 1DCZA 1E7ZA 2F0UA 3T1YQ 5IP9H 1SE3A 4OHJA 4GKJL 3PUVA 1SNMA 1OXSC 2WIIB 1LTSD 1SYEA 4KJOA 1K3RA 5JAVA 5FK9C 1SDFA 4FO2A 1KAWA 1AFPA 4CDCC 3S1RH 1TWGH 5LMNL 1PFSA 4L6TB 5K36G 4IURA 3FVQA 4RA8A 3PF4A 3TN2A 2UXCQ 4HJ5A 5GAGC 1H9RA 1RODA 5IT9L 4JI5L 3CMEA 2AUKA 4IUPA 4IUTA 1H9JA 1MGSA 1VF7A 4YHHQ 2D62A 4IPDA 1A3TA 2EYJA 4IALA 4HSVA 5COYA 2E2JB 3S16B 4KHVA 1HRJA 4ZLTF 2FINB 2KECA 2I07B 2EYOA 1LO5D 2MP1A 3CXCA 4HIDA 3SXHA 5M5XH 4OWTB 4A3BG 4IFDG 3C1EA 3GP7A 4PV1C 3IAYA 2B63G 1GUGA 4K8IA 4GKKL 2EXZA 2AQ1B 4J15A 1I94Q 2WB1G 5KNDA 3QB3A 4DV7L 2KEEA 1S72A 4OO1G 1WTXA 5JVG3 1HNWL 2FMCA 3Q24A 1Y8PB 3S1QH 2KJXA 2EE1A 3OHXC 5K5PA 3MVVA 1ESFA 4A3KH 4PMCA 4GLXA 4EGVA 5GAEC 3VDYA 5DM63 1TWAH 1S5FD 1TQOA 3LX0A 1YJ9A 1UEBA 3S1RB 1BQQT 2MQHA 5CGKA 1DYQA 2EJMA 1K8GA 4MNOA 1RL2A 1WFQA 3SEBA 5JJLA 1SNCA 2KHIA 3CF5A 3GTQH 4B3SL 1Y1WB 1BCPB 1BCPC 4AIMA 2ZM6Q 4OX9Q 3HFZB 4J1MA 3NBHB 3TS2A 1TXYA 1JOQA 4LUVA 1G2SA 3ULJA 4LF9L 5IYBG 5I9PA 1BBUA 2A68C 3HP3A 3PUWA 2HDMA 3CCMA 1UE6A 1EL0A 2F3WA 3GTOH 3PO2G 3J80E 5M5XB 4OIKA 1FNWA 5IWAL 4HMIA 2HD3A 4JV5Q 1UAPA 2D0OA 3P7JA 4S3SA 2VS1A 1L2FA 3D4RA 1DXMA 3V05A 1PYBA 3BDCA 5IYCG 4KHPL 4LJZC 1KAAA 3GTPH 4A3MG 1Q82C 5FLXE 2BH2A 2R3ZA 3HOVH 2B2YA 4JI1L 2E76C 5CV8A 2XWBB 3QR8A 3RUZA 3W2DA 1FJGL 4K6DA 4IUQA 2RF4A 1E1OA 4R4QA 2CHBD 4JK1C 4LF8Q 3DWAA 3FKIH 4KKUA 1NE3A 4KY5A 1L0YB 5M3FH 5C4XG 3CRLC 2B2VC 4DR4L 4WFN3 4KN4C 1KQSA 5EBCA 3H15A 2R7ZB 1ENAA 1GOZA 3I4OA 2NTTA 3JAMc 4LFAQ 1Q7YC 3VYTA 4GKKQ 2XSCA 2JA8H 4Y52H 4A76A 1NNXA 3S1QB 2VXWA 1YEZA 4O1NA 3I91A 3I7FA 4KN7C 4MTNA 5C6AA 4HN7A 3I4NH 1KC8C 4GOPB 3NPPA 2Q2IA 1PH2A 1VQLA 1X3PA 2UU9Q 1IXRA 4OWWB 2EVBA 3CCLA 3QIAA 1XPOA 2O2LD 1SR3A 2F1MA 4LF6Q 4R8IA 1NJIC 4GLAC 3MZ5A 2D2CC 2B2YC 3WOEA 1NUCA 4DA2A 2PQAA 2RSNA 4M1UB 3NBHA 3CCRA 2CWPA 3DM1A 4J6HA 4UPAA 1STNA 5JJZA 2I5LX 1U9RA 1AN8A 3S9WA 4YCUA 1XNQL 3M4QA 1HZCA 4DR1L 2Y0SE 3W1GA 4A3MH 2A68D 1Z9FA 1STHA 1VQNA 5J22A 4HEDA 3M7NA 3HKZB 1MJCA 3SVMA 3RMHA 4DUYL 3AB9A 4LF5Q 3UE0A 1A62A 3PV0A 1SYBA 3ITPA 1L0XB 3KLRA 3F2DA 4Y7NH 2Z9HA 3ONAB 4DV1Q 1K0RA 2KCTA 4AQYQ 1NMGA 2DNEA 5IYBH 3F2CA 1B3AA 2IX1A 1OXVA 1G291 4JI0Q 4FP5D 3RZOB 3L3OC 3H3VH 4GOPA 3MC0B 2OT2A 3QJYA 1U4LA 4P2CB 1LT6D 2UXBL 2Z0SA 5M5YB 3K5OA 2F03A 4YY3Q 1KD1C 4TSSA 2CCZA 1EYDA 2QCPX 1QWYA 1EQTA 1O78A 2G9DA 4X62Q 4IPHA 4FF1A 3EVQA 3VR4A 1SNPA 3D8GA 1A6XA 5C4JH 2JA8B 3DEPA 1MD2D 4QCLA 2WV6D 2MUYA 4LF6L 1LTID 3GD7A 3KLSX 4UDUC 2KQ3A 2AHOB 4A3KG 4JI5Q 2ZXPA 3I55A 1Z7TA 2C35B 4C3JG 4LW1A 3FPPA 1HFGA 4JI2Q 2A69D 4QUFA 3J7YW 2NVTH 1Y8NB 4Z9CB 2NTSA 4U673 3KOJA 1TU2B 1XMOL 4DK1A 4DAPA 1EU4A 3GTGH 4CDEC 2D5DA 1YNXA 2K75A 2Q8IB 1SN8A 4LF5L 5IGFA 3RZOH 4B3RQ 1SE4A 4K2KA 3HOUH 4DXGA 2K4KA 3I56A 5JJIA 1WTPA 4DNIA 3AFPA 4LUZA 4BY7B 1ICFB 1JOOA 1O7LA 2EYLA 4X6AH 2KCNA 3BZCA 5CV5A 2EJGC 1KL9A 1KDBA 4JBMA 1I94L 1Q1EA 2Y0SB 2JN4A 1V1QA 4WJWA 3K5NA 1NR4A 4DKAC 2UUCL 3X3MA 1IKLA 3IFDA 3TP7A 2QA4A 4DR5Q 5IIFA 3FEWX 3N52A 1PMRA 4LFBL 2KEDA 1BDOA 1H9KA 1HJPA 2K28A 4RKLA 3Q8DA 1DM0B 4JBWA 2CQAA 1N32L 4L5SA 3H94A 1KRTA 1TWFH 3KF8B 3I4MG 3HOWH 1E0BA 5IWAQ 2F0KA 4JPBW 1CZGA 3OPOA 1QJOA 4BBRB 4NDXA 1QVGA 1I4RA 2NVTB 1STBA 4EQ5A 4X64Q 3FP9A 1I3QB 2XNAC 5LMNW 2A5HA 1MJEA 3R2TA 1GO3E 1S5DD 2Z6KA 3VYUA 1SJED 4OX9L 2G5DA 2ICIA 2Z6BA 3IFTA 3K7UC 1IBLL 1U4MA 2K7VA 3IL8A 3C46A 3SHLA 5CBEE 4C2MB 5IGBA 3LWUA 1HH2P 1VQAA 5EKKA 2B2WC 2F0TA 5LL6X 2F0PA 4IOAA 3QG1A 2KENA 4BY1B 2BH8A 2VUMB 4YCVA 1JC7A 4N8FA 3NENA 3AYHB 4BY7G 2VNUD 4BWGB 1TWGB 4LF8L 1ET9A 1N34L 2JQOA 3S1NH 4JI4Q 2Y0SG 2NN6G 2NVXB 2GN5A 3W3AA 4PMBA 4TRDA 2UXDQ 4BS9A 1F9PA 4TKOB 1OTCA 4U68A 4CJ2C 2LMCB 4GNXC 3RN2A 2N88A 2NZOA 3J7AF 3G7LA 4DAVA 1QNKA 1ESRA 1PDQA 1WJJA 2BDOA 4JYAQ 5CMDA 1Q8IA 3JAML 3K7AB 1VQBA 3S17B 3H3VC 2F4VQ 1SJHD 2KUMA 1RKNA 1S5CD 1SNOA 2AKWB 4IUUA 3SK8A 4A3GG 1IL8A 1I6VC 5LL6S 4P74A 2SEBD 1X3FA 1YJNA 2HCCA 1ENFA 5EPJA 1NMFA 1CA6A 2JA6H 1HHVA 2J4XA 1I4QA 2L15A 3IKJA 4A3BB 4X64L 3QOLA 3S2DB 4Y7NB 5DEHA 5C4XH 1C48A 3ND9A 1T5EA 5E4XA 1EFWA 1U4PA 4JOIA 3ULLA 1X55A 2B2TC 2HUGA 3D0FA 3HKZE 1EYGA 3DUZA 3M9BA 2MJ8A 2UUAQ 1JJCB 5JEAJ 4C3IH 4DK3C 3T1HQ 3MHBA 4NMZA 4JI8Q 2JA8G 3BYTB 3PGZA 1LT3D 3K57A 4DV4Q 4X3SA 1IHZA 1EY7A 3SK6A 3A0JA 3TREA 4G7HC 4K6LA 1ILPA 4R1JA 1F2MA 1NCVA 5C44H 3HOYB 3JC66 2JSOA 4HMJA 3TEHB 5BN3A 1Y1VB 4EVOA 5C4JB 2C9OA 1PH3A 4V190 4A3FG 4IPCA 5I4DA 5C4ZA 5IYDG 4FF2A 2JXMB 1YVCA 1TR5A 3H09A 3F2BA 3FMCA 3AQQA 1GM5A 3NE5B 1VQ7A 2IWHA 3GTMH 1IBKQ 1YJWA 1F9QA 1VQEA 3G48A 4QMGA 1XNQQ 3FDTA 4DR1Q 4JYAL 3A56A 3MAQA 1CSQA 2NWGA 2KCCA 2IL8A 1SSOA 2AWOA 2F0HA 4RGTA 1PHJA 1V9PA 1F9SA 2I46A 1SAPA 4MN3A 1WTWA 2QDBA 4JC0A 4X3UA 1SNDA 5HGTA 3HOVB 2OTJA 1V1PA 1D5ZC 5M5WH 5EBDA 3CCJA 1EY9A 2A73B 4L5RC 3HOUG 4B08A 2A6HD 5FLXc 2M9VA 1EQVA 5J39A 3C3LA 1GHKA 1XWEA 4H44C 1SMYC 1TY2A 2PPBC 2OXPA 2N49A 5T1IA 3S1MH 5CR3A 1NBWA 4BY7H 1JT8A 4C56C 2H5XA 1ICWA 1C0AA 1JB3A 4RCNA 4LUOA 2F4VL 2IPKD 4KKSA 3PO3G 1MKHA 1KTKA 1N33Q 4LWCA 1M8AA 4ID6A 3MXNB 5JVH3 4ALPA 4B3TQ 1CZWA 1VS0A 4RMFA 5LHY1 4NXNQ 3STBD 3CC7A 5E4WC 3E9HA 3RLOA 5C0XJ 1EEID 2Q8RE 3ER0A 2ATWA 1EWCA 1FNUA 2KBNA 1T9HA 5J3BA 1K8MA 3EFXD 4Q5VA 3M3YH 4AQYL 4BBRG 5G3LF 2K01A 4IUNA 1PH9A 2M00A 1LT5D 1CT1D 2Z4IA 1QZHA 1ONLA 4C3JB 2JEBI 3T1HL 5IYDH 3CRKC 1JB7A 1FJGQ 1KDAA 5C5MA 3HOZH 1GUTA 2F3IA 2YU9B 2PQAB 4XQNA 5IP7H 2ES2A 4C2MH 1HTPA 4F87A 2YV5A 2LS01 5CC4A 3SE0A 1XNRQ 4OIJA 3TMEA 3CHBD 2PZWA 2E75C 2VY3A 3VYSA 4IFDI 1ENCA 2B39A 2BE5D 3JAME 3CKIB 2RA4A 5C3WA 3UI2A 5A2QL 5G3LD 2PZUA 3AFQA 2EYHA 1K3BC 2PNHA 2RDHA 3MEHA 4OL7A 4K2LA 3CC4A 2FXQA 2K1BA 4L63B 4EQNA 1XJVA 4GN5A 4XQJA 1PVOA 3NSWA 5M5WB 3KLSA 1IL2A 4OO1I 2AQ2B 1B8AA 4H02A 2X6GA 3JAMi 4IPGA 5IODA 5FKAC 1D1IA 1K9MC 4N9PA 4UP7A 5J1ZA 1N34Q 4DR3L 2LSSA 3MXUA 4CHTB 3RN5A 1SFOH 1D7QA 2JYOA 5ELFA 2SNSA 1VQCA 2UXDL 1CUKA 3J7ZC 1ASZA 3RNUA 1QUQB 2ZTDA 1JCKB 1R9TH 3C2PA 3LGJA 1JWUD 1J5EQ 3TP6A 1KIXA 1I4GA 2IJ0A 3NP8A 3T13A 1HTLD 4YY3L 5I2YA 2B63B 2WAQE 1S5ED 3STBC 3GTKH 1TKWB 2TMPA 3K8AA 1A15A 1RCVD 2EJFC 2ICEC 1EIHA 2KHSA 1CK1A 1AH9A 4OEMB 4AYBE 4RG1A 2F0LA 2ZXOA 3NK9A 4DR6L 4F88A 3TZDA 3TRZA 1X56A 1LTBD 2F0WA 1GVPA 3PF5A 3HS0C 1Q46A 3J80L 4KY6A 2XN9C 3VA7A 1QCBD 2NN6H 3V2TA 2RCFA 1I4HA 1HZ9A 1HQMC 4A3DH 1LM0A 3M4OB 2XGTA 1SMXA 2NUCA 1XNRL 1BVSA 4GN4B 2O5IC 3ULPA 1PLFA 5CORA 3S24A 3A5ZB 1TS4A 1PTOB 2WKCA 2WFWA 3OYYA 1LTGD 3QWNA 1SRUA 2JA7B 4B3RL 1DOKA 3GTOB 2NZHA 4PQXA 3FRPB 1W6JA 2L1BA 1HNXQ 1ZYRC 3H3VI 5D14A 1FGBD 2RCNA 3DWQA 4C3IG 5FLMH 1J8IA 1UE5A 3HKZG 4P72A 1XMOQ 3CU7A 1LACA 1TWCB 4P75A 2PW5A 3GTPB 1SYCA 1I3QH 4TVAB 5EAYA 5JOBA 3FHWA 3HEJA 2E2HH 3HKSA 3D6CA 1KNAA 5C0XG 3CQZB 2Q8TA 2EXDA 1VQHA 3I3CA 3Q23A 2WAQG 1TT2A 1Y1WG 3OMCA 2RDFA 2OTLA 3H91A 3RZDB 4N9TA 1VQIA 1PRTF 4BY1H 1YHBA 4OGQC 5IP9G 4QL5A 3CPFA 3OW7A 1EY6A 2F0NA 2QF7A 3FKIG 3MTSA 4KV6A 4CKBA 2MPMA 4C3JH 4TQUS 5K36H 2VB2X 2NVYB 2LFNA 2E2JH 3S16H 1LUZA 4JVZA 1O7ZA 1WTVA 2B29A 3J7A5 4AYBB 1JQYD 2LY7A 3KF6A 4I7AA 1II3A 2VQEQ 4Q0FA 4A93B 1WD1A 4KK7A 5JEAH 3EQLC 2V1CC 5EPKA 4X66L 3S2HH 4WJ4A 4C1NK 4E6IA 5KYIA 5IT9E 4JI7Q 2N55A 1D1KA 1CHQD 3EBEA 1M1KC 5C4HA 1JE5A 3J80c 4HJ9A 5FLMG 4XIGS 3RR5A 3TBIB 1YNND 3K0YA 4JCVE 3ZJYC 4A3MB 3RZDH 2VL6A 4FYDA 2A6EC 1LYLA 3EIVA 4H13C 4BA1I 3E9IA 1ZYRD 3K59A 4HAEA 4UP8A 1M90C 1EFID 2VQFL 1STGA 1AZPA 3SDZA 1GKHA 2K50A 3KLWA 1Y1WH 2E2HB 1XTCD 3K81C 4F7XA 1SNQA 3CQZH 1JOKA 2QILA 1BR9A 4IQZA 2A8VA 1UE7A 1HZAA 1L0WA 3WWVA 3NUCA 4RAUC 4DV2Q 1X6OA 2BA0A 4LF9Q 1PV4A 4NP5A 3CD6A 5JPNC 1T5XD 4DK0A 1R4QB 1OXUA 2EIFA 4WJ3M 4HJ7A 1XXGA 3HRZC 3GTQB 4BBSG 1K28A 3G6JB 4JI0L 5LMUL 1HPCA 5HY6A 3GV6A 2ASBA 2NVQH 1RIPA 4DAYB 1BCPD 1VQ6A 3CCUA 2ZM6L 1Y8OB 4IO9A 3ICEA 4DFAA 4KTAA 3I72A 4JI3Q 4XT3B 3L0OA 1VMCA 2E2IH 3KBGA 4UAIA 2R92G 3CCVA 4H0LC 4KD3A 3RLNA 3NQIA 2DJGC 5EQ0A 1JE4A 1QG7A 5CV9A 4DAMA 2K5VA 1A8VA 1Q86C 4DR7Q 4DV5L 4LMQD 2KVMA 1ILQA 3U4ZA 1B7YB 1PXUA 2CWAA 4QQBX 3HOUB 1PTOC 4A3FB 3AMUA 4M8AA 2GVAA 2PO4A 5M3FB 3LWEA 1X9NA 4UY8C 3BVMA 3KF6B 2MHVA 1E2ZA 4O42A 1YNNC 5FO7B 1GUSA 2OF1A 2OWOA 1PRTC 4O2DA 5IYCH 4LNQA 1WCMH 5GADC 2L4NA 1YNJD 2X6LA 3P1HA 2A6ED 3TZUA 4A3IG 1LLRD 4DV3L 3PIPA 3A54A 3KYHC 3OIQA 1SXTA 2A1AA 3KJOA 2B2TA 3A7LA 5DAUA 4ODGA 3J81i 5I9OA 1TS5A 5CV4A 2E5LL 4QIWB 3I70A 3TS0A 1O7IA 1CKNB 5IT9c 3HOXH 1EY0A 1SYGA 3CW2C 1HNXL 2AUJD 5M3MG 2HCIA 4FF4A 1QB5D 2IW3A 4PZ6A 5M3FG 2E2IB 4PMWA 2CKZB 1G6PA 1QILA 1JWSD 3E0EA 3UE1A 4QF4A 4POGA 3UDIA 4I7ZC 1ET6A 4KMUC 2UXCL 4R8NA 2DNCA 4POFA 1L1OC 5FO8B 4APVA 1YI2A 1HUNA 1K0SA 5AJ3L 2B2VA 3U58A 1LTAD 1JJ2A 5ELBA 1IYUA 2SDFA 4DR4Q 4L8JA 1I6HB 5C5LA 4LF7Q 1VQJA 1B3QA 5TSSA 5EPLA 3OMGA 3BDOA 3HOZG 1WCMB 4R4CA 1MSHA 3W5OA 3URYA 3S1NB 2QGQA 1VCIA 5IY0A 1FYCA 1V1OA 2PW7A 1W2BA 5C0XI 1VQPA 3UDXA 2B3GA 2R6GA 1ML0D 4B9XA 1PRTB 3VR2A 3J81j 1PZKD 5KNCA 2WP8J 4R4OA 5FOBB 4IUVA 4L5TA 2Z1CA 2O4XA 2OQ0A 2F0VA 1V1PB 3S15B 4A3GH 1S4ZA 4ZK9B 1JMCA 1PTOD 4IFDJ 3DM3A 2B63H 4JI2L 5KRUA 1BO0A 3G71A 3MXGA 5HGQA 1X54A 4K14A 3GTGB 1N9WA 4JG2A 3PO2B 4YCWA 5BN4A 4MTKA 2BCOA 1PH7A 2VW9A 3NTHA 3SGIA 4JI7L 5CYUA 4K5XA 4GZYC 3PUYA 3FKIB 2VQEL 1I6HH 2F0FA 4QIWE 1HNZL 3KUPA 1WTOA 1K8OA 2Q2UA 4KHZA 5D65A 5DNFA 3QOJA 4ZUJA 3V96A 1Z47A 1SEBD 3L7ZC 5EGTA 3KFUA 3J81c 2NYZD 1VQOA 4NXMQ 3SK4A 3I8ZA 3HOYH 2TSSA 5KGUA 1P16A 3OW2A 2E74C 1FVIA 1KRSA 5E1FA 2KHJA 1PTOH 1STEA 2XWJB 1UUPA 4A3LH 4LFAL 2ZXRA 2K5WA 3T4AC 1RF2D 1I50H 3I4LA 2RDGA 4CDDC 1BF4A 3TSSA 1PYWD 1E22A 3J81L 3I90A 3T56B 1BOSA 3PIOA 1TWFB 1EIFA 4OO1H 2R61A 2RKSA 2OEOA 3F2UA 4HSPA 4A3DG 1EY5A 5KNBA 4A3JH 1Y69U 4DNRB 1IW7D 1NAPA 2L55A 1Q81C 4EQOA 4LF7L 5BR8L 2EYPA 1HXYD 3UDGA 4JV5L 5F2DA 2XTIA 3F1ZA 3L9AX 1DJRD 1PZID 1ZXTA 4B3ML 5H1SE 3B6YA 2K5QA 4DXFA 1OO9B 5HURA 1EY8A 1CQVA 4FVMA 4QB4A 4G57A 3MXNA 1CFMA 4NW2A 4OXPA 2K52A 4QY7A 4A3KB 2VZAA 3J81E 4DF7A 2QKIC 2VUMH 4YWKA 2RSOA 4JBKA 2Z4HA 3CPWA 1RD9D 4KKTA 4MIUA 3M85A 1WI5A 4RGMA 4OWXB 1UE1A 5I2XA 1PH1A 2WB1E 3PIP3 2C5CA 2PI2A 3ZYYX 3NWTA 1O80A 3KBXA 2HQEA 3K6OA 3BZDB 1EEFD 3PO2H 1X3QA 4MHEA 4DR2L 1X65A 5CV6A 1WD0A 1X3EA 3PMFA 3MFYA 1IYJB 2IHFA 2VB3X 4DV6Q 2X69A 3E3XA 4ZRZA 1A3VA 2L11A 3K58A 1VF5C 1H9SB 2BOSA 1XTDA 3T1YL 4K5WA 2F0OA 3I73A 4DPGA 1E3PA 1NTGA 3BU2A 2F0SA 4DUZL 1W3SA 1KNEA 1VQGA 1YBYA 4KD4A 3G6EA 2WACA 3DXJC 1HA5A 2N8NA 5ELCA 2CQOA 2KOLA 1MIUA 2IY5B 1VQ4A 1H9MA 4LFBQ 5IE8A 2L0CA 3ERQA 4I65A 1BCPF 3GQBA 3T51B 2SNMA 1E24A 4HIKA 1EWIA 4DR7L 4YIJA 4ZKBB 2EY2A 3VR5A 2K5NA 3GO5A 1WTHA 3CAMA 2DJFC 1E1TA 4BBSB 4L5QA 5FO9B 1WTQA 1EWHA 1B4OA 2CW0D 2GVBA 2I5MX 1KLGD 4CBVA 2JA6B 4FXKC 4A3BH 1MHWC 3NXWA 1FGUA 1IW7C 5C4XB 4QUCA 4JBJA 2AWNA 4ILWA 4UHVA 3M4YA 2QEJC 5EJWA 1EQRA 3QO2A 4CJ1B 4CJ0B 1XX8A 3I4NB 3PO3B 1BXTA 4B9WA 4C3IB 5C44G 4CDFC 2E5LQ 2PZTA 3DEOA 2K32A 3A8JE 1B2TA 5GQOA 4IFDH 3OTOQ 5T1GA 3KDFA 3NWSA 4H7BA 2EYMA 4XQQA 2HHHL 3GTMB 4WORA 4LFCQ 3S15H 3F8TA 2K04A 1PH5A 4XDXA 3R8BA 1DGSA 1F2LA 4J8QA 4DV1L 4A3CG 3L2PA 1F2YA 1Q8KA 3BJUA 3E5SA 3NBIA 2YTYA 2F0IA 1FL0A 4RFBA 4DK6C 1FD7D 1Y1VG 2IX0A 2B2UC 4DR5L 4X62L 1AEXA 1VQDA 4MZ9A 3Q6SA 3RD4A 1YZ6A 1LTRD 4IZ8A 1QZGA 4DUYQ 1HFNA 4IJLA 3OWFA 2XRQD 3TDQA 2MO0A 3H0GG 4BBSH 3TQYA 1G6ZA 3DWPA 1G91A 2OQKA 3I4NG 3BYYB 2RVLA 1XPRA 1A2TA 1Z6HA 2M2LA 3X3NA 2RHSB 2EDGA 5A2QE 1UWVA 4XXEA 1F77A 5FJ8H 2XIWA 4KI0A 2EYFA 1RJTA 2WAQB 2F0GA 1IBKL 3FPUB 1A0IA 4RHSA 1HR0W 1ASYA 4ZUIA 1YITA 2MFIA 2HT1A 2A69C 3PO3H 1I50B 4NB3A 1U5KA 3PSIA 5CV7A 3HG9A 3VR6A 3S17H 5GROA 2KCMA 2A6HC 2ZJRA 4A3DB 1X32A 1VDZA 1BNZA 1C7YA 3R3OA 2K33A 1EY4A 4HJAA 1HNZQ 5E3FA 4PZ8A 4A3CH 1YHAA 2EY6A 3MA2B 3WOFA 3D3RA 3HOWG 1B9MA 1HUMA 4XYOA 1WTRA 4DV5Q 2H1EA 1G2TA 2B8GA 3A5UA 2CW0C 4C3HB 3HOVG 5IGGA 3C1FA 3HZXA 3D6WA 2JA7G 1Q12A 1UNSA 2GA4B 1K73C 2EOTA 2UUBQ 3K7AH 2EQSA 4G7OC 1GJXA 4NXNL 2K14A 4DV4L 1PFNA 1SE8A 1GUOA 4OONA 1RDPD 4IN3A 4ULLA 4A3IH 1HCZA 4NXML 1LT4D 1DOLA 2RBMA 3LNNA 1WVLA 2CH4A 1LTTD 1GXDC 2ENBA 1X3GA 4DNTB 4K0KL 2WINB 1V43A 3GTJB 4DV0L 4F8MA 1JJGA 1F9RA 4ZQ3A 2NZ1D 3NTKA 4QGUA 1B70B 4P73A 4PNYA 2JP1A 2NB0A 1EOVA 1WYDA 3MFGA 3BDLA 3A74A 5LMNQ 5FJ8G 5DLQE 3CMAA 3HOXG 2NN6I 1AE2A 1IZ6A 3BVGA 2BE5C 3GDEA 2CVRA 5BR8Q 3D4WA 5C3EH 2Q2TA 4DU9A 4LF4Q 2I5HA 4HJ8A 1SBBB 4XT1B 3NELA 1MI2A 4ZKCB 4XYQA 1OXTA 4B3TL 4A4IA 2NVYH 4ME5A 3A55A 5IP7G 4C3HG 1PH8A 4JW0A 1XPUA 5GAHC 3SK5A 4B3SQ 4A93H 3HOWB 1Q1BA 5I6YA 1SYFA 1D2BA 1WOCA 4GNXB 1E2VA 4RGOS 1Q90A 1DONA 3VA5A 3S1MB 4CKCA 4A3EH 4A3GB 1SFOB 3H0GH 1DZ1A 2F4IA 2JA5H 4DGZA 3R93A 1TS2A 3ND8A 1B9NA 4LAAA 1UEAB 2K5DA 1BKBA 1LV9A 2H4OA
chains in the Genus database with same CATH topology
4POGA 2LXKA 4NPSA 3UDIA 2N49A 4A3KH 4GLXA 1PH4A 3S1MH 5ELNA 5GAEC 1NBWA 3VDYA 4BY7H 2UXCL 1JT8A 2ID0A 2H5XA 1TWAH 3ERSX 3CC2A 1C0AA 4POFA 1L1OC 1YJ9A 1UEBA 4APVA 2MQHA 1Y14B 4LUOA 4X66Q 4HIMA 1YI2A 2F4VL 3PO3G 1MKHA 1K8GA 4MNOA 5AJ3L 1RL2A 1IBML 3U58A 1WFQA 3CCSA 5JJLA 1N33Q 4LWCA 1JJ2A 2KHIA 2YYZA 1XMQQ 3MXNB 4R4TA 3CF5A 4ALPA 4JI4L 3GTQH 4B3SL 4DR4Q 4B3TQ 1VS0A 4RMFA 4LF7Q 4OX9Q 3M4OH 4AIMA 2ZM6Q 1VQJA 3STBD 3HFZB 3W1BA 3NBHB 1HR0Q 3CC7A 4NXNQ 3I4MH 3TS2A 2MNAA 1TXYA 3HOZG 3E9HA 3RLOA 4LUVA 5C0XJ 1PA6A 3ULJA 4LF9L 3ER0A 4R4CA 3W5OA 5IYBG 1BBUA 2ATWA 3PUWA 3G4SA 2KBNA 1T9HA 2QGQA 5J3BA 3KJPA 1VCIA 3CCMA 5IY0A 4BXXH 1C9OA 4R4IA 1UE6A 1W2BA 1HNWQ 5C0XI 1I5FA 3UDXA 1VQPA 3GTOH 2B3GA 2R6GA 4BBRG 4AQYL 1PH9A 3M3YH 1PH6A 3PO2G 5IWAL 1AE3A 4YWLA 4JV5Q 2D0OA 1QZHA 1L1OA 1NY4A 3J81j 2VS1A 1L2FA 3BZKA 2JEBI 4JI8L 3T1HL 5IYDH 2R7DA 4IJHA 1PYBA 2WP8J 4R4OA 5IYCG 4DR2Q 2IHEA 4DV0Q 1JB7A 1FJGQ 4P71A 4KHPL 4L5TA 3HOZH 1YIJA 2F3IA 3RLFA 3GTPH 4A3MG 2OQ0A 2PQAB 1H95A 1VQFA 3DLLA 1Q82C 2BH2A 5IP7H 1QUQA 4JI1L 2ES2A 3HOVH 4C2MH 4A3GH 1JMCA 1FJGL 4KHPQ 4IFDJ 4O0AA 3DM3A 2YV5A 2B63H 2JJQA 2RF4A 1E1OA 4R4QA 4JI2L 1XNRQ 4A93G 3G71A 4HIOA 4LF8Q 3S2DH 4IFDI 2VY3A 1X54A 5HGQA 3FKIH 1NE3A 2UUAL 2JK8A 1N9WA 4JG2A 4A3EG 4YCWA 5M3FH 3AFQA 3CCQA 2JA5G 5C4XG 4DR4L 2HQLA 1PH7A 1K83H 1KQSA 3HOYG 3H15A 2VW9A 3SGIA 4JI7L 2PNHA 2ZTEA 3I4OA 3CC4A 3PUYA 3JAMc 2FXQA 1XJVA 3D31A 4GN5A 1PVOA 2VQEL 1CKMA 4LFAQ 4QIWE 1Q7YC 1HNZL 1I6HH 4GKKQ 2YTVA 1IL2A 2Q2UA 4KHZA 2JA8H 4OO1I 4Y52H 4A76A 1U0LA 3S14H 4X65Q 1B8AA 4GKJQ 4LFCL 1YEZA 1Z47A 3L7ZC 2R93G 4H02A 3I7FA 4BXXG 3JAMi 3KFUA 4IPGA 3J81c 4MTNA 1VQOA 4NXMQ 1Y1VH 1K9MC 3I4NH 3HOYH 1KC8C 4UP7A 4GOPB 2Q2IA 2LXJA 1P16A 1PH2A 1N34Q 4C3HH 4DR3L 3OW2A 1VQLA 1FVIA 2LSSA 3M4PA 2UU9Q 3RN5A 1KRSA 1SFOH 1IXRA 2BA1A 1D7QA 2KHJA 4OWWB 1D8LA 2VUMG 4A3LH 4LFAL 3CCLA 2JA6G 1VQCA 4JI6Q 1XPOA 1HZBA 1I50H 1SR3A 1CUKA 3J7ZC 4LF6Q 1ASZA 3PUXA 2UXDL 1E22A 5ELOA 1NJIC 3RNUA 4GLAC 3PIOA 1QUQB 2OCEA 4GOPC 2ZTDA 1R9TH 1EIFA 3LGJA 4UP9A 2PQAA 4BBRH 1N33L 1TWHH 3AEVA 1J5EQ 4A3DG 1KIXA 3K80C 3CCRA 1LTLA 4XTCS 4A3JH 2CWPA 2N3SA 4DR6Q 1G51A 2YTXA 4UPAA 4A75A 2DUDA 2I5LX 5JJKA 4YY3L 1Q81C 4DV6L 2WAQE 3OTOL 3STBC 4LF7L 4YCUA 3GTKH 4A3LG 2E8GA 1XNQL 5BR8L 3K8AA 3M4QA 1HZCA 4DR1L 2CFMA 3UDGA 2Y0SE 4JV5L 2XTIA 3W1GA 4A3MH 4BA2I 3F1ZA 4KLKA 1Z9FA 4AH6A 4B3ML 1VQNA 5H1SE 3B6YA 4BY1G 3M7NA 3GTLH 1MJCA 1AH9A 1PYSB 4DUYL 4OXPA 4QY7A 2K52A 4AYBE 4EX5A 4RG1A 3UE0A 4LF5Q 2VZAA 1A62A 3PV0A 4YHHL 4DR6L 3TRZA 1X56A 3F2DA 1S40A 1GVPA 2VUMH 3K0XA 4YWKA 4JBKA 4Y7NH 3PF5A 2UUBL 3MEFA 3CPWA 2RHQB 3CCEA 1N8RC 4DV1Q 1K0RA 1Q46A 3M85A 2KCTA 4AQYQ 1WI5A 4OWXB 2F52A 4DR3Q 1UE1A 1NMGA 2R93H 3F2CA 5IYBH 2IX1A 1OXVA 1G291 2PMZE 3CP0A 1PH1A 2NVXH 2WB1E 4JI0Q 2PI2A 3H3VH 1EUJA 4GOPA 1HZ9A 4A3DH 1LM0A 3PO2H 1GD7A 2JA7H 4DR2L 2UXBL 2Z0SA 4A3JG 2Q2HA 1X65A 1SMXA 2XGTA 1X3EA 1XNRL 1IYJB 1BVSA 1SROA 2IHFA 4FDBA 4GN4B 4YY3Q 4DV6Q 1KD1C 1N36Q 2CCZA 4K0KQ 1KHIA 3ULPA 3S24A 3A5ZB 2WFWA 4JI1Q 3OYYA 5JEAG 1SRUA 2UXBQ 4X62Q 4IPHA 3T1YL 1XTDA 4DPGA 1E3PA 4B3RL 1NTGA 5C4JH 3BU2A 2HIVA 2NZHA 3PUZA 4DUZL 1W3SA 4LF6L 1HNXQ 1VQGA 1YBYA 3GD7A 1KXLA 3H3VI 1SLJA 3G6EA 2AHOB 4A3KG 4JI5Q 2RCNA 5FLMH 3I55A 1UE5A 2VQFQ 2C35B 2N8NA 3HKZG 2CQOA 2IY5B 1MIUA 4P72A 4LW1A 1VQ4A 1QVCA 1XMOQ 2DGYA 4P75A 4JI2Q 4LFBQ 5IE8A 1CKOA 1I3QH 4TVAB 5EAYA 2NVTH 3FHWA 2UUCQ 4HIKA 1E24A 3HKSA 5C0XG 2E2HH 1EWIA 3KOJA 1XMOL 4DR7L 3GTGH 2ZTCA 1YNXA 2K75A 4JI3L 2A19A 2EXDA 3J80i 1TWCH 1VQHA 2K5NA 2JE6I 2WAQG 3KDFB 3GO5A 4JI6L 3CAMA 1Y1WG 1SN8A 1E1TA 4LF5L 2OTLA 1VQIA 4L5QA 3RZOH 2MO1A 4B3RQ 4BY1H 2GVBA 1YHBA 2I5MX 5IP9G 4ME3A 2JA9A 3U50C 5LMUQ 4DUZQ 1EIYB 2R92H 4QL5A 1VQ8A 3HOUH 3I56A 2K4KA 3CPFA 4A3BH 5JJIA 4DNIA 3AFPA 1FGUA 3NEMA 4LUZA 4JBJA 4A3FH 4X6AH 3BZCA 2AWNA 5M5YH 3FKIG 4IOCA 1KL9A 2R7FA 4JBMA 1I94L 1EQRA 1Q1EA 2K5HA 4C3JH 2HHHQ 4TQUS 2Z6KC 1XMQL 1V1QA 2R7ZG 2E5LQ 4PG3A 5C44G 3EN2A 4DKAC 2E2JH 2UUCL 4GN3B 3S16H 1LUZA 5GQOA 1HR0L 4DR5Q 2QA4A 1IBMQ 3OTOQ 3I2ZA 3KDFA 3PCOB 4GS3A 2HHHL 2B29A 2IT1A 1VQKA 4LFCQ 3J7A5 3F8TA 3S15H 4LFBL 1PH5A 3KF6A 1HJPA 2VQEQ 1DGSA 3Q8DA 4JBWA 1J5EL 1VQ5A 1S3OA 4L5SA 1N32L 4DV1L 4A3CG 3L2PA 1Q8KA 1TWFH 3KF8B 1KRTA 3I4MG 3HOWH 2V1CC 5IWAQ 4X66L 3BJUA 2UU9L 2YTYA 3S2HH 4WJ4A 1FL0A 4DK6C 4JI7Q 1Y1VG 2IX0A 1YHQA 4LF4L 1QVGA 4GLVB 2ZJQA 4EQ5A 3EBEA 4X64Q 4DR5L 1M1KC 3FP9A 4X62L 1JE5A 3J80c 4HJ9A 5LMNW 5FLMG 1MJEA 1VQDA 4XIGS 4MZ9A 1GO3E 2Z6KA 3RR5A 1YZ6A 1QZGA 1K8AC 4OX9L 3K7UC 1N36L 1IBLL 4DUYQ 4IJLA 2ZJPA 4QJFA 4JCVE 4GNXA 2MO0A 1VQMA 3H0GG 3ZJYC 4BBSH 3TQYA 3RZDH 1P8LA 1HH2P 1VQAA 2OQKA 2VL6A 3I4NG 1LYLA 5E7NA 2ALYB 1XPRA 1IBLQ 4DV2L 4IOAA 4PZ7A 3EIVA 2KENA 4BA1I 2BH8A 3E9IA 1OXXK 4YCVA 2RHSB 3GTJH 2QEXA 4UP8A 1M90C 1UWVA 3IRBA 2VQFL 3NENA 2AMCB 3AYHB 2JEAI 1VQ9A 5FJ8H 4BY7G 1GKHA 1CSPA 2K50A 4KI0A 4LF8L 1N32Q 2VNUD 3KLWA 4DV3Q 1Y1WH 1IBKL 3K81C 1N34L 1A0IA 1HR0W 1ASYA 2R7ZH 3CQZH 1YITA 2JQOA 2MFIA 2HT1A 3PO3H 1WCMG 3S1NH 2I0QA 4JI4Q 1U5KA 2Y0SG 1CKNA 2NN6G 3PSIA 4NB3A 2A8VA 2HIXA 2GN5A 2N78A 3S17H 5GROA 1UE7A 2KCMA 4B3MQ 1HZAA 1L0WA 3WWVA 2ZJRA 2UXDQ 2PI2E 4DV2Q 1OTCA 4X65L 1X6OA 4YWMA 2BA0A 1C7YA 4GNXC 3RN2A 1PV4A 2NZOA 4JOIC 4LF9Q 3CD6A 4HJAA 1BBWA 1HNZQ 4PZ8A 1EQQA 4A3CH 1OXUA 1WJJA 1YHAA 2EIFA 4JYAQ 4WJ3M 4HJ7A 3HOWG 1VQBA 4DV5Q 2YU9H 2F4VQ 4BBSG 3A5UA 2AKWB 4AYBG 4JI0L 3HOVG 5LMUL 5AJ3Q 4A3GG 1L1OB 5HY6A 2JA7G 1Q12A 4P74A 2ASBA 3UDFA 2NVQH 4DV7Q 1K73C 1RIPA 1X3FA 2UUBQ 3K7AH 4DAYB 1YJNA 1VQ6A 3CCUA 2EQSA 4NXNL 2K14A 2ZM6L 1NMFA 5C3EG 4DV4L 4IO9A 2JA6H 1J6QA 3ICEA 2L15A 2D0PA 1QVFA 1A63A 4X64L 3U4VA 1SE8A 4JI3Q 5M3MH 5C4XH 4OONA 3L0OA 4A3IH 1E7ZA 2E2IH 1EFWA 4JOIA 3T1YQ 4NXML 3ULLA 1X55A 3HKZE 3D0FA 1EYGA 5IP9H 3M9BA 2R92G 2UUAQ 1JJCB 3CCVA 4GKJL 3PUVA 1OXSC 3RLNA 5JEAJ 1X3GA 4C3IH 4K0KL 4DK3C 3T1HQ 1K3RA 4JI8Q 1V43A 2JA8G 3PGZA 4DAMA 4DV0L 2K5VA 1A8VA 1Q86C 1JJGA 4DV4Q 4DR7Q 1KAWA 4DV5L 3A0JA 1TWGH 3TREA 5LMNL 1PFSA 3S1RH 5K36G 4QGUA 4R1JA 1B70B 5C44H 3U4ZA 1B7YB 3PF4A 2CWAA 2UXCQ 4P73A 4HJ5A 4QQBX 3JC66 5GAGC 3TEHB 1EOVA 1WYDA 2GVAA 4JI5L 3CMEA 3A74A 5LMNQ 1PH3A 5FJ8G 5DLQE 4YHHQ 4A3FG 4IPCA 3CMAA 3HOXG 2D62A 2NN6I 1X9NA 1AE2A 3KF6B 4IPDA 4UY8C 1IZ6A 3GDEA 5IYDG 5BR8Q 5C3EH 2Q2TA 4LF4Q 2I5HA 4O2DA 5IYCH 4HJ8A 1YVCA 3F2BA 1WCMH 5GADC 2OWOA 3NELA 4LNQA 3AQQA 1OXTA 1GM5A 4B3TL 4A4IA 2NVYH 1VQ7A 4A3IG 3GTMH 4DV3L 1YJWA 1IBKQ 3CXCA 3PIPA 4HIDA 3KYHC 5IP7G 1VQEA 2A1AA 3G48A 4OWTB 5M5XH 3KJOA 1PH8A 1XNQQ 4A3BG 4DR1Q 4IFDG 4JYAL 3J81i 1XPUA 1CSQA 5GAHC 2E5LL 2B63G 2AWOA 4GKKL 4B3SQ 4A93H 1Q1BA 1O7IA 1V9PA 3TS0A 1CKNB 4J15A 1PHJA 5IT9c 3HOXH 1I94Q 1WOCA 4GNXB 3CW2C 4JC0A 1HNXL 2WB1G 5M3MG 4A3EH 3H0GH 2OTJA 4DV7L 1S72A 4PZ6A 5M5WH 5M3FG 2JA5H 3CCJA 4OO1G 4PMWA 2CKZB 1HNWL 1G6PA 4L5RC 3HOUG 5FLXc 3E0EA 3UE1A 1BKBA 3S1QH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4POG A;  2LXK A;  4NPS A;  3UDI A;  2N49 A;  4A3K H;  4GLX A;  1PH4 A;  3S1M H;  5ELN A;  5GAE C;  1NBW A;  3VDY A;  4BY7 H;  2UXC L;  1JT8 A;  2ID0 A;  2H5X A;  1TWA H;  3ERS X;  3CC2 A;  1C0A A;  4POF A;  1L1O C;  1YJ9 A;  1UEB A;  4APV A;  2MQH A;  1Y14 B;  4LUO A;  4X66 Q;  4HIM A;  1YI2 A;  2F4V L;  3PO3 G;  1MKH A;  1K8G A;  4MNO A;  5AJ3 L;  1RL2 A;  1IBM L;  3U58 A;  1WFQ A;  3CCS A;  5JJL A;  1N33 Q;  4LWC A;  1JJ2 A;  2KHI A;  2YYZ A;  1XMQ Q;  3MXN B;  4R4T A;  3CF5 A;  4ALP A;  4JI4 L;  3GTQ H;  4B3S L;  4DR4 Q;  4B3T Q;  1VS0 A;  4RMF A;  4LF7 Q;  4OX9 Q;  3M4O H;  4AIM A;  2ZM6 Q;  1VQJ A;  3STB D;  3HFZ B;  3W1B A;  3NBH B;  1HR0 Q;  3CC7 A;  4NXN Q;  3I4M H;  3TS2 A;  2MNA A;  1TXY A;  3HOZ G;  3E9H A;  3RLO A;  4LUV A;  5C0X J;  1PA6 A;  3ULJ A;  4LF9 L;  3ER0 A;  4R4C A;  3W5O A;  5IYB G;  1BBU A;  2ATW A;  3PUW A;  3G4S A;  2KBN A;  1T9H A;  2QGQ A;  5J3B A;  3KJP A;  1VCI A;  3CCM A;  5IY0 A;  4BXX H;  1C9O A;  4R4I A;  1UE6 A;  1W2B A;  1HNW Q;  5C0X I;  1I5F A;  3UDX A;  1VQP A;  3GTO H;  2B3G A;  2R6G A;  4BBR G;  4AQY L;  1PH9 A;  3M3Y H;  1PH6 A;  3PO2 G;  5IWA L;  1AE3 A;  4YWL A;  4JV5 Q;  2D0O A;  1QZH A;  1L1O A;  1NY4 A;  3J81 j;  2VS1 A;  1L2F A;  3BZK A;  2JEB I;  4JI8 L;  3T1H L;  5IYD H;  2R7D A;  4IJH A;  1PYB A;  2WP8 J;  4R4O A;  5IYC G;  4DR2 Q;  2IHE A;  4DV0 Q;  1JB7 A;  1FJG Q;  4P71 A;  4KHP L;  4L5T A;  3HOZ H;  1YIJ A;  2F3I A;  3RLF A;  3GTP H;  4A3M G;  2OQ0 A;  2PQA B;  1H95 A;  1VQF A;  3DLL A;  1Q82 C;  2BH2 A;  5IP7 H;  1QUQ A;  4JI1 L;  2ES2 A;  3HOV H;  4C2M H;  4A3G H;  1JMC A;  1FJG L;  4KHP Q;  4IFD J;  4O0A A;  3DM3 A;  2YV5 A;  2B63 H;  2JJQ A;  2RF4 A;  1E1O A;  4R4Q A;  4JI2 L;  1XNR Q;  4A93 G;  3G71 A;  4HIO A;  4LF8 Q;  3S2D H;  4IFD I;  2VY3 A;  1X54 A;  5HGQ A;  3FKI H;  1NE3 A;  2UUA L;  2JK8 A;  1N9W A;  4JG2 A;  4A3E G;  4YCW A;  5M3F H;  3AFQ A;  3CCQ A;  2JA5 G;  5C4X G;  4DR4 L;  2HQL A;  1PH7 A;  1K83 H;  1KQS A;  3HOY G;  3H15 A;  2VW9 A;  3SGI A;  4JI7 L;  2PNH A;  2ZTE A;  3I4O A;  3CC4 A;  3PUY A;  3JAM c;  2FXQ A;  1XJV A;  3D31 A;  4GN5 A;  1PVO A;  2VQE L;  1CKM A;  4LFA Q;  4QIW E;  1Q7Y C;  1HNZ L;  1I6H H;  4GKK Q;  2YTV A;  1IL2 A;  2Q2U A;  4KHZ A;  2JA8 H;  4OO1 I;  4Y52 H;  4A76 A;  1U0L A;  3S14 H;  4X65 Q;  1B8A A;  4GKJ Q;  4LFC L;  1YEZ A;  1Z47 A;  3L7Z C;  2R93 G;  4H02 A;  3I7F A;  4BXX G;  3JAM i;  3KFU A;  4IPG A;  3J81 c;  4MTN A;  1VQO A;  4NXM Q;  1Y1V H;  1K9M C;  3I4N H;  3HOY H;  1KC8 C;  4UP7 A;  4GOP B;  2Q2I A;  2LXJ A;  1P16 A;  1PH2 A;  1N34 Q;  4C3H H;  4DR3 L;  3OW2 A;  1VQL A;  1FVI A;  2LSS A;  3M4P A;  2UU9 Q;  3RN5 A;  1KRS A;  1SFO H;  1IXR A;  2BA1 A;  1D7Q A;  2KHJ A;  4OWW B;  1D8L A;  2VUM G;  4A3L H;  4LFA L;  3CCL A;  2JA6 G;  1VQC A;  4JI6 Q;  1XPO A;  1HZB A;  1I50 H;  1SR3 A;  1CUK A;  3J7Z C;  4LF6 Q;  1ASZ A;  3PUX A;  2UXD L;  1E22 A;  5ELO A;  1NJI C;  3RNU A;  4GLA C;  3PIO A;  1QUQ B;  2OCE A;  4GOP C;  2ZTD A;  1R9T H;  1EIF A;  3LGJ A;  4UP9 A;  2PQA A;  4BBR H;  1N33 L;  1TWH H;  3AEV A;  1J5E Q;  4A3D G;  1KIX A;  3K80 C;  3CCR A;  1LTL A;  4XTC S;  4A3J H;  2CWP A;  2N3S A;  4DR6 Q;  1G51 A;  2YTX A;  4UPA A;  4A75 A;  2DUD A;  2I5L X;  5JJK A;  4YY3 L;  1Q81 C;  4DV6 L;  2WAQ E;  3OTO L;  3STB C;  4LF7 L;  4YCU A;  3GTK H;  4A3L G;  2E8G A;  1XNQ L;  5BR8 L;  3K8A A;  3M4Q A;  1HZC A;  4DR1 L;  2CFM A;  3UDG A;  2Y0S E;  4JV5 L;  2XTI A;  3W1G A;  4A3M H;  4BA2 I;  3F1Z A;  4KLK A;  1Z9F A;  4AH6 A;  4B3M L;  1VQN A;  5H1S E;  3B6Y A;  4BY1 G;  3M7N A;  3GTL H;  1MJC A;  1AH9 A;  1PYS B;  4DUY L;  4OXP A;  4QY7 A;  2K52 A;  4AYB E;  4EX5 A;  4RG1 A;  3UE0 A;  4LF5 Q;  2VZA A;  1A62 A;  3PV0 A;  4YHH L;  4DR6 L;  3TRZ A;  1X56 A;  3F2D A;  1S40 A;  1GVP A;  2VUM H;  3K0X A;  4YWK A;  4JBK A;  4Y7N H;  3PF5 A;  2UUB L;  3MEF A;  3CPW A;  2RHQ B;  3CCE A;  1N8R C;  4DV1 Q;  1K0R A;  1Q46 A;  3M85 A;  2KCT A;  4AQY Q;  1WI5 A;  4OWX B;  2F52 A;  4DR3 Q;  1UE1 A;  1NMG A;  2R93 H;  3F2C A;  5IYB H;  2IX1 A;  1OXV A;  1G29 1;  2PMZ E;  3CP0 A;  1PH1 A;  2NVX H;  2WB1 E;  4JI0 Q;  2PI2 A;  3H3V H;  1EUJ A;  4GOP A;  1HZ9 A;  4A3D H;  1LM0 A;  3PO2 H;  1GD7 A;  2JA7 H;  4DR2 L;  2UXB L;  2Z0S A;  4A3J G;  2Q2H A;  1X65 A;  1SMX A;  2XGT A;  1X3E A;  1XNR L;  1IYJ B;  1BVS A;  1SRO A;  2IHF A;  4FDB A;  4GN4 B;  4YY3 Q;  4DV6 Q;  1KD1 C;  1N36 Q;  2CCZ A;  4K0K Q;  1KHI A;  3ULP A;  3S24 A;  3A5Z B;  2WFW A;  4JI1 Q;  3OYY A;  5JEA G;  1SRU A;  2UXB Q;  4X62 Q;  4IPH A;  3T1Y L;  1XTD A;  4DPG A;  1E3P A;  4B3R L;  1NTG A;  5C4J H;  3BU2 A;  2HIV A;  2NZH A;  3PUZ A;  4DUZ L;  1W3S A;  4LF6 L;  1HNX Q;  1VQG A;  1YBY A;  3GD7 A;  1KXL A;  3H3V I;  1SLJ A;  3G6E A;  2AHO B;  4A3K G;  4JI5 Q;  2RCN A;  5FLM H;  3I55 A;  1UE5 A;  2VQF Q;  2C35 B;  2N8N A;  3HKZ G;  2CQO A;  2IY5 B;  1MIU A;  4P72 A;  4LW1 A;  1VQ4 A;  1QVC A;  1XMO Q;  2DGY A;  4P75 A;  4JI2 Q;  4LFB Q;  5IE8 A;  1CKO A;  1I3Q H;  4TVA B;  5EAY A;  2NVT H;  3FHW A;  2UUC Q;  4HIK A;  1E24 A;  3HKS A;  5C0X G;  2E2H H;  1EWI A;  3KOJ A;  1XMO L;  4DR7 L;  3GTG H;  2ZTC A;  1YNX A;  2K75 A;  4JI3 L;  2A19 A;  2EXD A;  3J80 i;  1TWC H;  1VQH A;  2K5N A;  2JE6 I;  2WAQ G;  3KDF B;  3GO5 A;  4JI6 L;  3CAM A;  1Y1W G;  1SN8 A;  1E1T A;  4LF5 L;  2OTL A;  1VQI A;  4L5Q A;  3RZO H;  2MO1 A;  4B3R Q;  4BY1 H;  2GVB A;  1YHB A;  2I5M X;  5IP9 G;  4ME3 A;  2JA9 A;  3U50 C;  5LMU Q;  4DUZ Q;  1EIY B;  2R92 H;  4QL5 A;  1VQ8 A;  3HOU H;  3I56 A;  2K4K A;  3CPF A;  4A3B H;  5JJI A;  4DNI A;  3AFP A;  1FGU A;  3NEM A;  4LUZ A;  4JBJ A;  4A3F H;  4X6A H;  3BZC A;  2AWN A;  5M5Y H;  3FKI G;  4IOC A;  1KL9 A;  2R7F A;  4JBM A;  1I94 L;  1EQR A;  1Q1E A;  2K5H A;  4C3J H;  2HHH Q;  4TQU S;  2Z6K C;  1XMQ L;  1V1Q A;  2R7Z G;  2E5L Q;  4PG3 A;  5C44 G;  3EN2 A;  4DKA C;  2E2J H;  2UUC L;  4GN3 B;  3S16 H;  1LUZ A;  5GQO A;  1HR0 L;  4DR5 Q;  2QA4 A;  1IBM Q;  3OTO Q;  3I2Z A;  3KDF A;  3PCO B;  4GS3 A;  2HHH L;  2B29 A;  2IT1 A;  1VQK A;  4LFC Q;  3J7A 5;  3F8T A;  3S15 H;  4LFB L;  1PH5 A;  3KF6 A;  1HJP A;  2VQE Q;  1DGS A;  3Q8D A;  4JBW A;  1J5E L;  1VQ5 A;  1S3O A;  4L5S A;  1N32 L;  4DV1 L;  4A3C G;  3L2P A;  1Q8K A;  1TWF H;  3KF8 B;  1KRT A;  3I4M G;  3HOW H;  2V1C C;  5IWA Q;  4X66 L;  3BJU A;  2UU9 L;  2YTY A;  3S2H H;  4WJ4 A;  1FL0 A;  4DK6 C;  4JI7 Q;  1Y1V G;  2IX0 A;  1YHQ A;  4LF4 L;  1QVG A;  4GLV B;  2ZJQ A;  4EQ5 A;  3EBE A;  4X64 Q;  4DR5 L;  1M1K C;  3FP9 A;  4X62 L;  1JE5 A;  3J80 c;  4HJ9 A;  5LMN W;  5FLM G;  1MJE A;  1VQD A;  4XIG S;  4MZ9 A;  1GO3 E;  2Z6K A;  3RR5 A;  1YZ6 A;  1QZG A;  1K8A C;  4OX9 L;  3K7U C;  1N36 L;  1IBL L;  4DUY Q;  4IJL A;  2ZJP A;  4QJF A;  4JCV E;  4GNX A;  2MO0 A;  1VQM A;  3H0G G;  3ZJY C;  4BBS H;  3TQY A;  3RZD H;  1P8L A;  1HH2 P;  1VQA A;  2OQK A;  2VL6 A;  3I4N G;  1LYL A;  5E7N A;  2ALY B;  1XPR A;  1IBL Q;  4DV2 L;  4IOA A;  4PZ7 A;  3EIV A;  2KEN A;  4BA1 I;  2BH8 A;  3E9I A;  1OXX K;  4YCV A;  2RHS B;  3GTJ H;  2QEX A;  4UP8 A;  1M90 C;  1UWV A;  3IRB A;  2VQF L;  3NEN A;  2AMC B;  3AYH B;  2JEA I;  1VQ9 A;  5FJ8 H;  4BY7 G;  1GKH A;  1CSP A;  2K50 A;  4KI0 A;  4LF8 L;  1N32 Q;  2VNU D;  3KLW A;  4DV3 Q;  1Y1W H;  1IBK L;  3K81 C;  1N34 L;  1A0I A;  1HR0 W;  1ASY A;  2R7Z H;  3CQZ H;  1YIT A;  2JQO A;  2MFI A;  2HT1 A;  3PO3 H;  1WCM G;  3S1N H;  2I0Q A;  4JI4 Q;  1U5K A;  2Y0S G;  1CKN A;  2NN6 G;  3PSI A;  4NB3 A;  2A8V A;  2HIX A;  2GN5 A;  2N78 A;  3S17 H;  5GRO A;  1UE7 A;  2KCM A;  4B3M Q;  1HZA A;  1L0W A;  3WWV A;  2ZJR A;  2UXD Q;  2PI2 E;  4DV2 Q;  1OTC A;  4X65 L;  1X6O A;  4YWM A;  2BA0 A;  1C7Y A;  4GNX C;  3RN2 A;  1PV4 A;  2NZO A;  4JOI C;  4LF9 Q;  3CD6 A;  4HJA A;  1BBW A;  1HNZ Q;  4PZ8 A;  1EQQ A;  4A3C H;  1OXU A;  1WJJ A;  1YHA A;  2EIF A;  4JYA Q;  4WJ3 M;  4HJ7 A;  3HOW G;  1VQB A;  4DV5 Q;  2YU9 H;  2F4V Q;  4BBS G;  3A5U A;  2AKW B;  4AYB G;  4JI0 L;  3HOV G;  5LMU L;  5AJ3 Q;  4A3G G;  1L1O B;  5HY6 A;  2JA7 G;  1Q12 A;  4P74 A;  2ASB A;  3UDF A;  2NVQ H;  4DV7 Q;  1K73 C;  1RIP A;  1X3F A;  2UUB Q;  3K7A H;  4DAY B;  1YJN A;  1VQ6 A;  3CCU A;  2EQS A;  4NXN L;  2K14 A;  2ZM6 L;  1NMF A;  5C3E G;  4DV4 L;  4IO9 A;  2JA6 H;  1J6Q A;  3ICE A;  2L15 A;  2D0P A;  1QVF A;  1A63 A;  4X64 L;  3U4V A;  1SE8 A;  4JI3 Q;  5M3M H;  5C4X H;  4OON A;  3L0O A;  4A3I H;  1E7Z A;  2E2I H;  1EFW A;  4JOI A;  3T1Y Q;  4NXM L;  3ULL A;  1X55 A;  3HKZ E;  3D0F A;  1EYG A;  5IP9 H;  3M9B A;  2R92 G;  2UUA Q;  1JJC B;  3CCV A;  4GKJ L;  3PUV A;  1OXS C;  3RLN A;  5JEA J;  1X3G A;  4C3I H;  4K0K L;  4DK3 C;  3T1H Q;  1K3R A;  4JI8 Q;  1V43 A;  2JA8 G;  3PGZ A;  4DAM A;  4DV0 L;  2K5V A;  1A8V A;  1Q86 C;  1JJG A;  4DV4 Q;  4DR7 Q;  1KAW A;  4DV5 L;  3A0J A;  1TWG H;  3TRE A;  5LMN L;  1PFS A;  3S1R H;  5K36 G;  4QGU A;  4R1J A;  1B70 B;  5C44 H;  3U4Z A;  1B7Y B;  3PF4 A;  2CWA A;  2UXC Q;  4P73 A;  4HJ5 A;  4QQB X;  3JC6 6;  5GAG C;  3TEH B;  1EOV A;  1WYD A;  2GVA A;  4JI5 L;  3CME A;  3A74 A;  5LMN Q;  1PH3 A;  5FJ8 G;  5DLQ E;  4YHH Q;  4A3F G;  4IPC A;  3CMA A;  3HOX G;  2D62 A;  2NN6 I;  1X9N A;  1AE2 A;  3KF6 B;  4IPD A;  4UY8 C;  1IZ6 A;  3GDE A;  5IYD G;  5BR8 Q;  5C3E H;  2Q2T A;  4LF4 Q;  2I5H A;  4O2D A;  5IYC H;  4HJ8 A;  1YVC A;  3F2B A;  1WCM H;  5GAD C;  2OWO A;  3NEL A;  4LNQ A;  3AQQ A;  1OXT A;  1GM5 A;  4B3T L;  4A4I A;  2NVY H;  1VQ7 A;  4A3I G;  3GTM H;  4DV3 L;  1YJW A;  1IBK Q;  3CXC A;  3PIP A;  4HID A;  3KYH C;  5IP7 G;  1VQE A;  2A1A A;  3G48 A;  4OWT B;  5M5X H;  3KJO A;  1PH8 A;  1XNQ Q;  4A3B G;  4DR1 Q;  4IFD G;  4JYA L;  3J81 i;  1XPU A;  1CSQ A;  5GAH C;  2E5L L;  2B63 G;  2AWO A;  4GKK L;  4B3S Q;  4A93 H;  1Q1B A;  1O7I A;  1V9P A;  3TS0 A;  1CKN B;  4J15 A;  1PHJ A;  5IT9 c;  3HOX H;  1I94 Q;  1WOC A;  4GNX B;  3CW2 C;  4JC0 A;  1HNX L;  2WB1 G;  5M3M G;  4A3E H;  3H0G H;  2OTJ A;  4DV7 L;  1S72 A;  4PZ6 A;  5M5W H;  5M3F G;  2JA5 H;  3CCJ A;  4OO1 G;  4PMW A;  2CKZ B;  1HNW L;  1G6P A;  4L5R C;  3HOU G;  5FLX c;  3E0E A;  3UE1 A;  1BKB A;  3S1Q H; 
#chains in the Genus database with same CATH topology
 2LXK A;  1AW7 A;  4NPS A;  1PH4 A;  1SE2 A;  5ELN A;  2B2W A;  3T53 B;  2ID0 A;  3ERS X;  3CC2 A;  2DY8 A;  2IX3 A;  2FMM A;  4G4K A;  1Y14 B;  4X66 Q;  4HIM A;  2F0E A;  1IBM L;  1CM9 A;  1GHJ A;  3CCS A;  4HTH A;  3PIO 3;  1A3U A;  3U9S A;  2YYZ A;  1XMQ Q;  4R4T A;  4JI4 L;  3OSO A;  1PZJ D;  3M4O H;  3W1B A;  1HR0 Q;  3I4M H;  4RH6 A;  5C3E B;  2MNA A;  2FHT A;  1PA6 A;  3I4M B;  1KAB A;  3ERO A;  3G4S A;  3KJP A;  4BXX H;  1C9O A;  4R4I A;  1HNW Q;  2EY1 A;  1I5F A;  2PQE A;  2DN8 A;  1PH6 A;  2F0Q A;  3DMU A;  1AE3 A;  5KEE A;  3TP8 A;  1EZ8 A;  1QE6 A;  4HCE A;  4YWL A;  1L1O A;  1NY4 A;  3BZK A;  4JI8 L;  5IGE A;  2R7D A;  4IJH A;  2G9H D;  1CQF A;  4DR2 Q;  2IHE A;  4DV0 Q;  4P71 A;  5ISR A;  1YIJ A;  1ZKO A;  3NHH A;  3RLF A;  3GV3 A;  3H0G B;  2PMZ B;  1H95 A;  1VQF A;  3DLL A;  4A3J B;  1QUQ A;  1TWH B;  4KHP Q;  1B44 D;  4O0A A;  1AP0 A;  2JJQ A;  3N6R A;  4A93 G;  4ZAI A;  4HIO A;  3S2D H;  3HOZ B;  1EYC A;  3K5L A;  2UUA L;  2JK8 A;  4A3E G;  1EU3 A;  2JA5 G;  1TVX A;  3M7G A;  2F0D A;  5D3D A;  5BN5 A;  3CCQ A;  2HQL A;  1B1Z A;  1Q3L A;  1K83 H;  3HOY G;  1JR0 D;  3GTL B;  3OOC A;  2ZTE A;  2Z8L A;  2SOB A;  3T16 A;  3D31 A;  4FXG C;  1CKM A;  2EZV A;  2JA5 B;  4FNF A;  4X3K A;  1CTM A;  1SYD A;  2YTV A;  3VR3 A;  1PTO F;  1U0L A;  2QDL A;  1PFB A;  3S14 H;  1V8Q A;  4X65 Q;  2D9U A;  5C44 B;  4GKJ Q;  2RQX A;  4LFC L;  2R93 B;  2R93 G;  4BXX G;  5C3X A;  1EYA A;  3K5M A;  2AQ3 B;  1Y1V H;  3H6M A;  1MSG A;  4CGY B;  2LXJ A;  1R9T B;  4C3H H;  1DD2 A;  3M4P A;  1PFM A;  1SMY D;  2BA1 A;  1D8L A;  2VUM G;  3DHQ A;  5D3I B;  2JA6 G;  4JI6 Q;  1HZB A;  3MXP A;  1U4R A;  1EOT A;  3PUX A;  5ELO A;  2P5Z X;  4RCO A;  2OCE A;  4GOP C;  2QW7 A;  4UP9 A;  4BBR H;  1N33 L;  1TWH H;  1J9O A;  5JPM C;  3AEV A;  2CH4 W;  3K80 C;  4A3I B;  1LTL A;  4XTC S;  4DR6 Q;  2N3S A;  5IGD A;  1G51 A;  2YTX A;  1I4X A;  4A75 A;  2DUD A;  5JJK A;  5A35 A;  4FF3 A;  5ELD A;  4DV6 L;  3OTO L;  2PYK A;  1A2U A;  4A3L G;  2E8G A;  1TY0 A;  1GUN A;  2HDL A;  2CFM A;  3E6Z X;  4BA2 I;  4KLK A;  1QOH A;  4AH6 A;  1FR3 A;  1KDC A;  4BY1 G;  3GTL H;  1JWM D;  1PYS B;  2K05 A;  5C0X H;  4EX5 A;  2K03 A;  3GTK B;  3Q0A A;  1B50 A;  4YHH L;  2PNR C;  1S40 A;  2EY5 A;  2BDN A;  3K0X A;  2UUB L;  4G7Z C;  3MEF A;  4RWS C;  2RHQ B;  3CCE A;  1N8R C;  4RHR A;  2F3V A;  1JIC A;  2F52 A;  5CBA E;  4DR3 Q;  3VYR A;  2R93 H;  1LAB A;  2WKD A;  4DN4 M;  2PMZ E;  3CP0 A;  1RTN A;  2NVX H;  1IKM A;  3AU7 A;  1BBX C;  1EUJ A;  1TII D;  2R92 B;  1GD7 A;  5KIX A;  2JA7 H;  2E2D C;  2Q2H A;  4A3J G;  1SRO A;  4FDB A;  4K0K Q;  2F0M A;  1N36 Q;  1KHI A;  4JI1 Q;  1S5B D;  3MWY W;  2EPB A;  1D6E C;  5JEA G;  4C1N I;  1M4V A;  1MBY A;  2UXB Q;  1VMP A;  1CA5 A;  4A3E B;  2HIV A;  3BS1 A;  3SR1 A;  1G8Z D;  3PUZ A;  1KXL A;  1STA A;  2J7Z A;  4RKB A;  1AZQ A;  1SLJ A;  4ZCK A;  1W6K A;  3R2I A;  4OEL B;  2VQF Q;  3KK7 A;  2NVQ B;  3WDN A;  3E0J A;  2V4D A;  1QVC A;  2DGY A;  1CKO A;  3A8I E;  4V0B A;  5NUC A;  3OIP A;  3U9O A;  4CKE A;  2UUC Q;  5L37 A;  2ZTC A;  1D5X C;  4JI3 L;  2A19 A;  2PCF B;  3J80 i;  1TWC H;  2L12 A;  3P75 A;  1HQR D;  2JE6 I;  3KDF B;  3BG3 A;  4JI6 L;  4K8J A;  3EJI A;  2MO1 A;  1EIY B;  2R92 H;  4ME3 A;  2JA9 A;  4N8X 1;  3U50 C;  4HCS A;  5LMU Q;  4R9W A;  4DUZ Q;  1GUW A;  1VQ8 A;  4NKL A;  4HR7 B;  2LKV A;  3O13 A;  3NEM A;  2XVS A;  4A3F H;  2B2U A;  5KYL A;  2ZT9 C;  5M5Y H;  4IOC A;  1B53 A;  2R7F A;  2K5H A;  2HHH Q;  2L9H A;  2K6A A;  2XRS D;  2Z6K C;  5AFW A;  2NBF A;  1XMQ L;  2R7Z G;  1QNU A;  2KA7 A;  4PG3 A;  1C8C A;  3EN2 A;  1H9S A;  5DM7 3;  4GN3 B;  1HR0 L;  1IBM Q;  2O5J C;  3I2Z A;  5ELE A;  3PCO B;  1TS3 A;  4GS3 A;  3S2H B;  1CHP D;  5IOC A;  2IT1 A;  1VQK A;  3TP5 A;  5M3M B;  1NSN S;  3BVZ A;  1J5E L;  1VQ5 A;  1S3O A;  4EQP A;  1DOM A;  2A74 C;  1KLU D;  3Q22 A;  1I4P A;  2UU9 L;  5EKI A;  3HOX B;  1ZEQ X;  4FXD A;  1O7Y A;  3P20 A;  1YHQ A;  1STY A;  4LF4 L;  4GLV B;  2ZJQ A;  1C4Q A;  1K83 B;  4X3T A;  1BUV T;  1R4P B;  1K8A C;  1RTO A;  2DY7 A;  1N36 L;  1EZ6 A;  2B8F A;  4DAY A;  2ZJP A;  4QJF A;  4GNX A;  5FLX L;  1PRT D;  5EKL A;  1E2W A;  1VQM A;  1HA6 A;  2J0T D;  3EA6 A;  1IYV A;  1YNJ C;  1P8L A;  3A8K E;  3HGB A;  3OWE B;  3S14 B;  1F2Z A;  1RHP A;  5E7N A;  2ALY B;  1IBL Q;  4DV2 L;  4PZ7 A;  3A7A B;  1OXX K;  1EIG A;  2L5T A;  3GTJ H;  2QEX A;  1CI3 M;  3IRB A;  2AMC B;  3NTI A;  2JEA I;  1VQ9 A;  4ZYS A;  3J7A V;  1CSP A;  1N32 Q;  3PQI A;  4KY7 A;  4DV3 Q;  2R7Z H;  2FJ2 A;  1D5M C;  1WCM G;  2I0Q A;  1CKN A;  4K5V A;  2HIX A;  5I6W A;  2N78 A;  4B3M Q;  1JOR A;  3M3Y B;  2PI2 E;  4X65 L;  4YWM A;  1XYI A;  4JOI C;  4LK1 C;  4ABN A;  1BBW A;  2MGS A;  4RGN A;  1EQQ A;  1NR2 A;  3KF8 A;  5IGC A;  2YU9 H;  4KJN A;  4AYB G;  5AJ3 Q;  2WB1 B;  1L1O B;  1TWA B;  5M9O A;  3UDF A;  3NQT A;  4DV7 Q;  4WRD A;  5C3E G;  1J6Q A;  1FNV A;  1QVF A;  2D0P A;  3D4D A;  2F0J A;  1A63 A;  3U4V A;  5M3M H;  2FFK B;  1DCZ A;  1E7Z A;  2F0U A;  3T1Y Q;  5IP9 H;  1SE3 A;  4OHJ A;  4GKJ L;  3PUV A;  1SNM A;  1OXS C;  2WII B;  1LTS D;  1SYE A;  4KJO A;  1K3R A;  5JAV A;  5FK9 C;  1SDF A;  4FO2 A;  1KAW A;  1AFP A;  4CDC C;  3S1R H;  1TWG H;  5LMN L;  1PFS A;  4L6T B;  5K36 G;  4IUR A;  3FVQ A;  4RA8 A;  3PF4 A;  3TN2 A;  2UXC Q;  4HJ5 A;  5GAG C;  1H9R A;  1ROD A;  5IT9 L;  4JI5 L;  3CME A;  2AUK A;  4IUP A;  4IUT A;  1H9J A;  1MGS A;  1VF7 A;  4YHH Q;  2D62 A;  4IPD A;  1A3T A;  2EYJ A;  4IAL A;  4HSV A;  5COY A;  2E2J B;  3S16 B;  4KHV A;  1HRJ A;  4ZLT F;  2FIN B;  2KEC A;  2I07 B;  2EYO A;  1LO5 D;  2MP1 A;  3CXC A;  4HID A;  3SXH A;  5M5X H;  4OWT B;  4A3B G;  4IFD G;  3C1E A;  3GP7 A;  4PV1 C;  3IAY A;  2B63 G;  1GUG A;  4K8I A;  4GKK L;  2EXZ A;  2AQ1 B;  4J15 A;  1I94 Q;  2WB1 G;  5KND A;  3QB3 A;  4DV7 L;  2KEE A;  1S72 A;  4OO1 G;  1WTX A;  5JVG 3;  1HNW L;  2FMC A;  3Q24 A;  1Y8P B;  3S1Q H;  2KJX A;  2EE1 A;  3OHX C;  5K5P A;  3MVV A;  1ESF A;  4A3K H;  4PMC A;  4GLX A;  4EGV A;  5GAE C;  3VDY A;  5DM6 3;  1TWA H;  1S5F D;  1TQO A;  3LX0 A;  1YJ9 A;  1UEB A;  3S1R B;  1BQQ T;  2MQH A;  5CGK A;  1DYQ A;  2EJM A;  1K8G A;  4MNO A;  1RL2 A;  1WFQ A;  3SEB A;  5JJL A;  1SNC A;  2KHI A;  3CF5 A;  3GTQ H;  4B3S L;  1Y1W B;  1BCP B;  1BCP C;  4AIM A;  2ZM6 Q;  4OX9 Q;  3HFZ B;  4J1M A;  3NBH B;  3TS2 A;  1TXY A;  1JOQ A;  4LUV A;  1G2S A;  3ULJ A;  4LF9 L;  5IYB G;  5I9P A;  1BBU A;  2A68 C;  3HP3 A;  3PUW A;  2HDM A;  3CCM A;  1UE6 A;  1EL0 A;  2F3W A;  3GTO H;  3PO2 G;  3J80 E;  5M5X B;  4OIK A;  1FNW A;  5IWA L;  4HMI A;  2HD3 A;  4JV5 Q;  1UAP A;  2D0O A;  3P7J A;  4S3S A;  2VS1 A;  1L2F A;  3D4R A;  1DXM A;  3V05 A;  1PYB A;  3BDC A;  5IYC G;  4KHP L;  4LJZ C;  1KAA A;  3GTP H;  4A3M G;  1Q82 C;  5FLX E;  2BH2 A;  2R3Z A;  3HOV H;  2B2Y A;  4JI1 L;  2E76 C;  5CV8 A;  2XWB B;  3QR8 A;  3RUZ A;  3W2D A;  1FJG L;  4K6D A;  4IUQ A;  2RF4 A;  1E1O A;  4R4Q A;  2CHB D;  4JK1 C;  4LF8 Q;  3DWA A;  3FKI H;  4KKU A;  1NE3 A;  4KY5 A;  1L0Y B;  5M3F H;  5C4X G;  3CRL C;  2B2V C;  4DR4 L;  4WFN 3;  4KN4 C;  1KQS A;  5EBC A;  3H15 A;  2R7Z B;  1ENA A;  1GOZ A;  3I4O A;  2NTT A;  3JAM c;  4LFA Q;  1Q7Y C;  3VYT A;  4GKK Q;  2XSC A;  2JA8 H;  4Y52 H;  4A76 A;  1NNX A;  3S1Q B;  2VXW A;  1YEZ A;  4O1N A;  3I91 A;  3I7F A;  4KN7 C;  4MTN A;  5C6A A;  4HN7 A;  3I4N H;  1KC8 C;  4GOP B;  3NPP A;  2Q2I A;  1PH2 A;  1VQL A;  1X3P A;  2UU9 Q;  1IXR A;  4OWW B;  2EVB A;  3CCL A;  3QIA A;  1XPO A;  2O2L D;  1SR3 A;  2F1M A;  4LF6 Q;  4R8I A;  1NJI C;  4GLA C;  3MZ5 A;  2D2C C;  2B2Y C;  3WOE A;  1NUC A;  4DA2 A;  2PQA A;  2RSN A;  4M1U B;  3NBH A;  3CCR A;  2CWP A;  3DM1 A;  4J6H A;  4UPA A;  1STN A;  5JJZ A;  2I5L X;  1U9R A;  1AN8 A;  3S9W A;  4YCU A;  1XNQ L;  3M4Q A;  1HZC A;  4DR1 L;  2Y0S E;  3W1G A;  4A3M H;  2A68 D;  1Z9F A;  1STH A;  1VQN A;  5J22 A;  4HED A;  3M7N A;  3HKZ B;  1MJC A;  3SVM A;  3RMH A;  4DUY L;  3AB9 A;  4LF5 Q;  3UE0 A;  1A62 A;  3PV0 A;  1SYB A;  3ITP A;  1L0X B;  3KLR A;  3F2D A;  4Y7N H;  2Z9H A;  3ONA B;  4DV1 Q;  1K0R A;  2KCT A;  4AQY Q;  1NMG A;  2DNE A;  5IYB H;  3F2C A;  1B3A A;  2IX1 A;  1OXV A;  1G29 1;  4JI0 Q;  4FP5 D;  3RZO B;  3L3O C;  3H3V H;  4GOP A;  3MC0 B;  2OT2 A;  3QJY A;  1U4L A;  4P2C B;  1LT6 D;  2UXB L;  2Z0S A;  5M5Y B;  3K5O A;  2F03 A;  4YY3 Q;  1KD1 C;  4TSS A;  2CCZ A;  1EYD A;  2QCP X;  1QWY A;  1EQT A;  1O78 A;  2G9D A;  4X62 Q;  4IPH A;  4FF1 A;  3EVQ A;  3VR4 A;  1SNP A;  3D8G A;  1A6X A;  5C4J H;  2JA8 B;  3DEP A;  1MD2 D;  4QCL A;  2WV6 D;  2MUY A;  4LF6 L;  1LTI D;  3GD7 A;  3KLS X;  4UDU C;  2KQ3 A;  2AHO B;  4A3K G;  4JI5 Q;  2ZXP A;  3I55 A;  1Z7T A;  2C35 B;  4C3J G;  4LW1 A;  3FPP A;  1HFG A;  4JI2 Q;  2A69 D;  4QUF A;  3J7Y W;  2NVT H;  1Y8N B;  4Z9C B;  2NTS A;  4U67 3;  3KOJ A;  1TU2 B;  1XMO L;  4DK1 A;  4DAP A;  1EU4 A;  3GTG H;  4CDE C;  2D5D A;  1YNX A;  2K75 A;  2Q8I B;  1SN8 A;  4LF5 L;  5IGF A;  3RZO H;  4B3R Q;  1SE4 A;  4K2K A;  3HOU H;  4DXG A;  2K4K A;  3I56 A;  5JJI A;  1WTP A;  4DNI A;  3AFP A;  4LUZ A;  4BY7 B;  1ICF B;  1JOO A;  1O7L A;  2EYL A;  4X6A H;  2KCN A;  3BZC A;  5CV5 A;  2EJG C;  1KL9 A;  1KDB A;  4JBM A;  1I94 L;  1Q1E A;  2Y0S B;  2JN4 A;  1V1Q A;  4WJW A;  3K5N A;  1NR4 A;  4DKA C;  2UUC L;  3X3M A;  1IKL A;  3IFD A;  3TP7 A;  2QA4 A;  4DR5 Q;  5IIF A;  3FEW X;  3N52 A;  1PMR A;  4LFB L;  2KED A;  1BDO A;  1H9K A;  1HJP A;  2K28 A;  4RKL A;  3Q8D A;  1DM0 B;  4JBW A;  2CQA A;  1N32 L;  4L5S A;  3H94 A;  1KRT A;  1TWF H;  3KF8 B;  3I4M G;  3HOW H;  1E0B A;  5IWA Q;  2F0K A;  4JPB W;  1CZG A;  3OPO A;  1QJO A;  4BBR B;  4NDX A;  1QVG A;  1I4R A;  2NVT B;  1STB A;  4EQ5 A;  4X64 Q;  3FP9 A;  1I3Q B;  2XNA C;  5LMN W;  2A5H A;  1MJE A;  3R2T A;  1GO3 E;  1S5D D;  2Z6K A;  3VYU A;  1SJE D;  4OX9 L;  2G5D A;  2ICI A;  2Z6B A;  3IFT A;  3K7U C;  1IBL L;  1U4M A;  2K7V A;  3IL8 A;  3C46 A;  3SHL A;  5CBE E;  4C2M B;  5IGB A;  3LWU A;  1HH2 P;  1VQA A;  5EKK A;  2B2W C;  2F0T A;  5LL6 X;  2F0P A;  4IOA A;  3QG1 A;  2KEN A;  4BY1 B;  2BH8 A;  2VUM B;  4YCV A;  1JC7 A;  4N8F A;  3NEN A;  3AYH B;  4BY7 G;  2VNU D;  4BWG B;  1TWG B;  4LF8 L;  1ET9 A;  1N34 L;  2JQO A;  3S1N H;  4JI4 Q;  2Y0S G;  2NN6 G;  2NVX B;  2GN5 A;  3W3A A;  4PMB A;  4TRD A;  2UXD Q;  4BS9 A;  1F9P A;  4TKO B;  1OTC A;  4U68 A;  4CJ2 C;  2LMC B;  4GNX C;  3RN2 A;  2N88 A;  2NZO A;  3J7A F;  3G7L A;  4DAV A;  1QNK A;  1ESR A;  1PDQ A;  1WJJ A;  2BDO A;  4JYA Q;  5CMD A;  1Q8I A;  3JAM L;  3K7A B;  1VQB A;  3S17 B;  3H3V C;  2F4V Q;  1SJH D;  2KUM A;  1RKN A;  1S5C D;  1SNO A;  2AKW B;  4IUU A;  3SK8 A;  4A3G G;  1IL8 A;  1I6V C;  5LL6 S;  4P74 A;  2SEB D;  1X3F A;  1YJN A;  2HCC A;  1ENF A;  5EPJ A;  1NMF A;  1CA6 A;  2JA6 H;  1HHV A;  2J4X A;  1I4Q A;  2L15 A;  3IKJ A;  4A3B B;  4X64 L;  3QOL A;  3S2D B;  4Y7N B;  5DEH A;  5C4X H;  1C48 A;  3ND9 A;  1T5E A;  5E4X A;  1EFW A;  1U4P A;  4JOI A;  3ULL A;  1X55 A;  2B2T C;  2HUG A;  3D0F A;  3HKZ E;  1EYG A;  3DUZ A;  3M9B A;  2MJ8 A;  2UUA Q;  1JJC B;  5JEA J;  4C3I H;  4DK3 C;  3T1H Q;  3MHB A;  4NMZ A;  4JI8 Q;  2JA8 G;  3BYT B;  3PGZ A;  1LT3 D;  3K57 A;  4DV4 Q;  4X3S A;  1IHZ A;  1EY7 A;  3SK6 A;  3A0J A;  3TRE A;  4G7H C;  4K6L A;  1ILP A;  4R1J A;  1F2M A;  1NCV A;  5C44 H;  3HOY B;  3JC6 6;  2JSO A;  4HMJ A;  3TEH B;  5BN3 A;  1Y1V B;  4EVO A;  5C4J B;  2C9O A;  1PH3 A;  4V19 0;  4A3F G;  4IPC A;  5I4D A;  5C4Z A;  5IYD G;  4FF2 A;  2JXM B;  1YVC A;  1TR5 A;  3H09 A;  3F2B A;  3FMC A;  3AQQ A;  1GM5 A;  3NE5 B;  1VQ7 A;  2IWH A;  3GTM H;  1IBK Q;  1YJW A;  1F9Q A;  1VQE A;  3G48 A;  4QMG A;  1XNQ Q;  3FDT A;  4DR1 Q;  4JYA L;  3A56 A;  3MAQ A;  1CSQ A;  2NWG A;  2KCC A;  2IL8 A;  1SSO A;  2AWO A;  2F0H A;  4RGT A;  1PHJ A;  1V9P A;  1F9S A;  2I46 A;  1SAP A;  4MN3 A;  1WTW A;  2QDB A;  4JC0 A;  4X3U A;  1SND A;  5HGT A;  3HOV B;  2OTJ A;  1V1P A;  1D5Z C;  5M5W H;  5EBD A;  3CCJ A;  1EY9 A;  2A73 B;  4L5R C;  3HOU G;  4B08 A;  2A6H D;  5FLX c;  2M9V A;  1EQV A;  5J39 A;  3C3L A;  1GHK A;  1XWE A;  4H44 C;  1SMY C;  1TY2 A;  2PPB C;  2OXP A;  2N49 A;  5T1I A;  3S1M H;  5CR3 A;  1NBW A;  4BY7 H;  1JT8 A;  4C56 C;  2H5X A;  1ICW A;  1C0A A;  1JB3 A;  4RCN A;  4LUO A;  2F4V L;  2IPK D;  4KKS A;  3PO3 G;  1MKH A;  1KTK A;  1N33 Q;  4LWC A;  1M8A A;  4ID6 A;  3MXN B;  5JVH 3;  4ALP A;  4B3T Q;  1CZW A;  1VS0 A;  4RMF A;  5LHY 1;  4NXN Q;  3STB D;  3CC7 A;  5E4W C;  3E9H A;  3RLO A;  5C0X J;  1EEI D;  2Q8R E;  3ER0 A;  2ATW A;  1EWC A;  1FNU A;  2KBN A;  1T9H A;  5J3B A;  1K8M A;  3EFX D;  4Q5V A;  3M3Y H;  4AQY L;  4BBR G;  5G3L F;  2K01 A;  4IUN A;  1PH9 A;  2M00 A;  1LT5 D;  1CT1 D;  2Z4I A;  1QZH A;  1ONL A;  4C3J B;  2JEB I;  3T1H L;  5IYD H;  3CRK C;  1JB7 A;  1FJG Q;  1KDA A;  5C5M A;  3HOZ H;  1GUT A;  2F3I A;  2YU9 B;  2PQA B;  4XQN A;  5IP7 H;  2ES2 A;  4C2M H;  1HTP A;  4F87 A;  2YV5 A;  2LS0 1;  5CC4 A;  3SE0 A;  1XNR Q;  4OIJ A;  3TME A;  3CHB D;  2PZW A;  2E75 C;  2VY3 A;  3VYS A;  4IFD I;  1ENC A;  2B39 A;  2BE5 D;  3JAM E;  3CKI B;  2RA4 A;  5C3W A;  3UI2 A;  5A2Q L;  5G3L D;  2PZU A;  3AFQ A;  2EYH A;  1K3B C;  2PNH A;  2RDH A;  3MEH A;  4OL7 A;  4K2L A;  3CC4 A;  2FXQ A;  2K1B A;  4L63 B;  4EQN A;  1XJV A;  4GN5 A;  4XQJ A;  1PVO A;  3NSW A;  5M5W B;  3KLS A;  1IL2 A;  4OO1 I;  2AQ2 B;  1B8A A;  4H02 A;  2X6G A;  3JAM i;  4IPG A;  5IOD A;  5FKA C;  1D1I A;  1K9M C;  4N9P A;  4UP7 A;  5J1Z A;  1N34 Q;  4DR3 L;  2LSS A;  3MXU A;  4CHT B;  3RN5 A;  1SFO H;  1D7Q A;  2JYO A;  5ELF A;  2SNS A;  1VQC A;  2UXD L;  1CUK A;  3J7Z C;  1ASZ A;  3RNU A;  1QUQ B;  2ZTD A;  1JCK B;  1R9T H;  3C2P A;  3LGJ A;  1JWU D;  1J5E Q;  3TP6 A;  1KIX A;  1I4G A;  2IJ0 A;  3NP8 A;  3T13 A;  1HTL D;  4YY3 L;  5I2Y A;  2B63 B;  2WAQ E;  1S5E D;  3STB C;  3GTK H;  1TKW B;  2TMP A;  3K8A A;  1A15 A;  1RCV D;  2EJF C;  2ICE C;  1EIH A;  2KHS A;  1CK1 A;  1AH9 A;  4OEM B;  4AYB E;  4RG1 A;  2F0L A;  2ZXO A;  3NK9 A;  4DR6 L;  4F88 A;  3TZD A;  3TRZ A;  1X56 A;  1LTB D;  2F0W A;  1GVP A;  3PF5 A;  3HS0 C;  1Q46 A;  3J80 L;  4KY6 A;  2XN9 C;  3VA7 A;  1QCB D;  2NN6 H;  3V2T A;  2RCF A;  1I4H A;  1HZ9 A;  1HQM C;  4A3D H;  1LM0 A;  3M4O B;  2XGT A;  1SMX A;  2NUC A;  1XNR L;  1BVS A;  4GN4 B;  2O5I C;  3ULP A;  1PLF A;  5COR A;  3S24 A;  3A5Z B;  1TS4 A;  1PTO B;  2WKC A;  2WFW A;  3OYY A;  1LTG D;  3QWN A;  1SRU A;  2JA7 B;  4B3R L;  1DOK A;  3GTO B;  2NZH A;  4PQX A;  3FRP B;  1W6J A;  2L1B A;  1HNX Q;  1ZYR C;  3H3V I;  5D14 A;  1FGB D;  2RCN A;  3DWQ A;  4C3I G;  5FLM H;  1J8I A;  1UE5 A;  3HKZ G;  4P72 A;  1XMO Q;  3CU7 A;  1LAC A;  1TWC B;  4P75 A;  2PW5 A;  3GTP B;  1SYC A;  1I3Q H;  4TVA B;  5EAY A;  5JOB A;  3FHW A;  3HEJ A;  2E2H H;  3HKS A;  3D6C A;  1KNA A;  5C0X G;  3CQZ B;  2Q8T A;  2EXD A;  1VQH A;  3I3C A;  3Q23 A;  2WAQ G;  1TT2 A;  1Y1W G;  3OMC A;  2RDF A;  2OTL A;  3H91 A;  3RZD B;  4N9T A;  1VQI A;  1PRT F;  4BY1 H;  1YHB A;  4OGQ C;  5IP9 G;  4QL5 A;  3CPF A;  3OW7 A;  1EY6 A;  2F0N A;  2QF7 A;  3FKI G;  3MTS A;  4KV6 A;  4CKB A;  2MPM A;  4C3J H;  4TQU S;  5K36 H;  2VB2 X;  2NVY B;  2LFN A;  2E2J H;  3S16 H;  1LUZ A;  4JVZ A;  1O7Z A;  1WTV A;  2B29 A;  3J7A 5;  4AYB B;  1JQY D;  2LY7 A;  3KF6 A;  4I7A A;  1II3 A;  2VQE Q;  4Q0F A;  4A93 B;  1WD1 A;  4KK7 A;  5JEA H;  3EQL C;  2V1C C;  5EPK A;  4X66 L;  3S2H H;  4WJ4 A;  4C1N K;  4E6I A;  5KYI A;  5IT9 E;  4JI7 Q;  2N55 A;  1D1K A;  1CHQ D;  3EBE A;  1M1K C;  5C4H A;  1JE5 A;  3J80 c;  4HJ9 A;  5FLM G;  4XIG S;  3RR5 A;  3TBI B;  1YNN D;  3K0Y A;  4JCV E;  3ZJY C;  4A3M B;  3RZD H;  2VL6 A;  4FYD A;  2A6E C;  1LYL A;  3EIV A;  4H13 C;  4BA1 I;  3E9I A;  1ZYR D;  3K59 A;  4HAE A;  4UP8 A;  1M90 C;  1EFI D;  2VQF L;  1STG A;  1AZP A;  3SDZ A;  1GKH A;  2K50 A;  3KLW A;  1Y1W H;  2E2H B;  1XTC D;  3K81 C;  4F7X A;  1SNQ A;  3CQZ H;  1JOK A;  2QIL A;  1BR9 A;  4IQZ A;  2A8V A;  1UE7 A;  1HZA A;  1L0W A;  3WWV A;  3NUC A;  4RAU C;  4DV2 Q;  1X6O A;  2BA0 A;  4LF9 Q;  1PV4 A;  4NP5 A;  3CD6 A;  5JPN C;  1T5X D;  4DK0 A;  1R4Q B;  1OXU A;  2EIF A;  4WJ3 M;  4HJ7 A;  1XXG A;  3HRZ C;  3GTQ B;  4BBS G;  1K28 A;  3G6J B;  4JI0 L;  5LMU L;  1HPC A;  5HY6 A;  3GV6 A;  2ASB A;  2NVQ H;  1RIP A;  4DAY B;  1BCP D;  1VQ6 A;  3CCU A;  2ZM6 L;  1Y8O B;  4IO9 A;  3ICE A;  4DFA A;  4KTA A;  3I72 A;  4JI3 Q;  4XT3 B;  3L0O A;  1VMC A;  2E2I H;  3KBG A;  4UAI A;  2R92 G;  3CCV A;  4H0L C;  4KD3 A;  3RLN A;  3NQI A;  2DJG C;  5EQ0 A;  1JE4 A;  1QG7 A;  5CV9 A;  4DAM A;  2K5V A;  1A8V A;  1Q86 C;  4DR7 Q;  4DV5 L;  4LMQ D;  2KVM A;  1ILQ A;  3U4Z A;  1B7Y B;  1PXU A;  2CWA A;  4QQB X;  3HOU B;  1PTO C;  4A3F B;  3AMU A;  4M8A A;  2GVA A;  2PO4 A;  5M3F B;  3LWE A;  1X9N A;  4UY8 C;  3BVM A;  3KF6 B;  2MHV A;  1E2Z A;  4O42 A;  1YNN C;  5FO7 B;  1GUS A;  2OF1 A;  2OWO A;  1PRT C;  4O2D A;  5IYC H;  4LNQ A;  1WCM H;  5GAD C;  2L4N A;  1YNJ D;  2X6L A;  3P1H A;  2A6E D;  3TZU A;  4A3I G;  1LLR D;  4DV3 L;  3PIP A;  3A54 A;  3KYH C;  3OIQ A;  1SXT A;  2A1A A;  3KJO A;  2B2T A;  3A7L A;  5DAU A;  4ODG A;  3J81 i;  5I9O A;  1TS5 A;  5CV4 A;  2E5L L;  4QIW B;  3I70 A;  3TS0 A;  1O7I A;  1CKN B;  5IT9 c;  3HOX H;  1EY0 A;  1SYG A;  3CW2 C;  1HNX L;  2AUJ D;  5M3M G;  2HCI A;  4FF4 A;  1QB5 D;  2IW3 A;  4PZ6 A;  5M3F G;  2E2I B;  4PMW A;  2CKZ B;  1G6P A;  1QIL A;  1JWS D;  3E0E A;  3UE1 A;  4QF4 A;  4POG A;  3UDI A;  4I7Z C;  1ET6 A;  4KMU C;  2UXC L;  4R8N A;  2DNC A;  4POF A;  1L1O C;  5FO8 B;  4APV A;  1YI2 A;  1HUN A;  1K0S A;  5AJ3 L;  2B2V A;  3U58 A;  1LTA D;  1JJ2 A;  5ELB A;  1IYU A;  2SDF A;  4DR4 Q;  4L8J A;  1I6H B;  5C5L A;  4LF7 Q;  1VQJ A;  1B3Q A;  5TSS A;  5EPL A;  3OMG A;  3BDO A;  3HOZ G;  1WCM B;  4R4C A;  1MSH A;  3W5O A;  3URY A;  3S1N B;  2QGQ A;  1VCI A;  5IY0 A;  1FYC A;  1V1O A;  2PW7 A;  1W2B A;  5C0X I;  1VQP A;  3UDX A;  2B3G A;  2R6G A;  1ML0 D;  4B9X A;  1PRT B;  3VR2 A;  3J81 j;  1PZK D;  5KNC A;  2WP8 J;  4R4O A;  5FOB B;  4IUV A;  4L5T A;  2Z1C A;  2O4X A;  2OQ0 A;  2F0V A;  1V1P B;  3S15 B;  4A3G H;  1S4Z A;  4ZK9 B;  1JMC A;  1PTO D;  4IFD J;  3DM3 A;  2B63 H;  4JI2 L;  5KRU A;  1BO0 A;  3G71 A;  3MXG A;  5HGQ A;  1X54 A;  4K14 A;  3GTG B;  1N9W A;  4JG2 A;  3PO2 B;  4YCW A;  5BN4 A;  4MTK A;  2BCO A;  1PH7 A;  2VW9 A;  3NTH A;  3SGI A;  4JI7 L;  5CYU A;  4K5X A;  4GZY C;  3PUY A;  3FKI B;  2VQE L;  1I6H H;  2F0F A;  4QIW E;  1HNZ L;  3KUP A;  1WTO A;  1K8O A;  2Q2U A;  4KHZ A;  5D65 A;  5DNF A;  3QOJ A;  4ZUJ A;  3V96 A;  1Z47 A;  1SEB D;  3L7Z C;  5EGT A;  3KFU A;  3J81 c;  2NYZ D;  1VQO A;  4NXM Q;  3SK4 A;  3I8Z A;  3HOY H;  2TSS A;  5KGU A;  1P16 A;  3OW2 A;  2E74 C;  1FVI A;  1KRS A;  5E1F A;  2KHJ A;  1PTO H;  1STE A;  2XWJ B;  1UUP A;  4A3L H;  4LFA L;  2ZXR A;  2K5W A;  3T4A C;  1RF2 D;  1I50 H;  3I4L A;  2RDG A;  4CDD C;  1BF4 A;  3TSS A;  1PYW D;  1E22 A;  3J81 L;  3I90 A;  3T56 B;  1BOS A;  3PIO A;  1TWF B;  1EIF A;  4OO1 H;  2R61 A;  2RKS A;  2OEO A;  3F2U A;  4HSP A;  4A3D G;  1EY5 A;  5KNB A;  4A3J H;  1Y69 U;  4DNR B;  1IW7 D;  1NAP A;  2L55 A;  1Q81 C;  4EQO A;  4LF7 L;  5BR8 L;  2EYP A;  1HXY D;  3UDG A;  4JV5 L;  5F2D A;  2XTI A;  3F1Z A;  3L9A X;  1DJR D;  1PZI D;  1ZXT A;  4B3M L;  5H1S E;  3B6Y A;  2K5Q A;  4DXF A;  1OO9 B;  5HUR A;  1EY8 A;  1CQV A;  4FVM A;  4QB4 A;  4G57 A;  3MXN A;  1CFM A;  4NW2 A;  4OXP A;  2K52 A;  4QY7 A;  4A3K B;  2VZA A;  3J81 E;  4DF7 A;  2QKI C;  2VUM H;  4YWK A;  2RSO A;  4JBK A;  2Z4H A;  3CPW A;  1RD9 D;  4KKT A;  4MIU A;  3M85 A;  1WI5 A;  4RGM A;  4OWX B;  1UE1 A;  5I2X A;  1PH1 A;  2WB1 E;  3PIP 3;  2C5C A;  2PI2 A;  3ZYY X;  3NWT A;  1O80 A;  3KBX A;  2HQE A;  3K6O A;  3BZD B;  1EEF D;  3PO2 H;  1X3Q A;  4MHE A;  4DR2 L;  1X65 A;  5CV6 A;  1WD0 A;  1X3E A;  3PMF A;  3MFY A;  1IYJ B;  2IHF A;  2VB3 X;  4DV6 Q;  2X69 A;  3E3X A;  4ZRZ A;  1A3V A;  2L11 A;  3K58 A;  1VF5 C;  1H9S B;  2BOS A;  1XTD A;  3T1Y L;  4K5W A;  2F0O A;  3I73 A;  4DPG A;  1E3P A;  1NTG A;  3BU2 A;  2F0S A;  4DUZ L;  1W3S A;  1KNE A;  1VQG A;  1YBY A;  4KD4 A;  3G6E A;  2WAC A;  3DXJ C;  1HA5 A;  2N8N A;  5ELC A;  2CQO A;  2KOL A;  1MIU A;  2IY5 B;  1VQ4 A;  1H9M A;  4LFB Q;  5IE8 A;  2L0C A;  3ERQ A;  4I65 A;  1BCP F;  3GQB A;  3T51 B;  2SNM A;  1E24 A;  4HIK A;  1EWI A;  4DR7 L;  4YIJ A;  4ZKB B;  2EY2 A;  3VR5 A;  2K5N A;  3GO5 A;  1WTH A;  3CAM A;  2DJF C;  1E1T A;  4BBS B;  4L5Q A;  5FO9 B;  1WTQ A;  1EWH A;  1B4O A;  2CW0 D;  2GVB A;  2I5M X;  1KLG D;  4CBV A;  2JA6 B;  4FXK C;  4A3B H;  1MHW C;  3NXW A;  1FGU A;  1IW7 C;  5C4X B;  4QUC A;  4JBJ A;  2AWN A;  4ILW A;  4UHV A;  3M4Y A;  2QEJ C;  5EJW A;  1EQR A;  3QO2 A;  4CJ1 B;  4CJ0 B;  1XX8 A;  3I4N B;  3PO3 B;  1BXT A;  4B9W A;  4C3I B;  5C44 G;  4CDF C;  2E5L Q;  2PZT A;  3DEO A;  2K32 A;  3A8J E;  1B2T A;  5GQO A;  4IFD H;  3OTO Q;  5T1G A;  3KDF A;  3NWS A;  4H7B A;  2EYM A;  4XQQ A;  2HHH L;  3GTM B;  4WOR A;  4LFC Q;  3S15 H;  3F8T A;  2K04 A;  1PH5 A;  4XDX A;  3R8B A;  1DGS A;  1F2L A;  4J8Q A;  4DV1 L;  4A3C G;  3L2P A;  1F2Y A;  1Q8K A;  3BJU A;  3E5S A;  3NBI A;  2YTY A;  2F0I A;  1FL0 A;  4RFB A;  4DK6 C;  1FD7 D;  1Y1V G;  2IX0 A;  2B2U C;  4DR5 L;  4X62 L;  1AEX A;  1VQD A;  4MZ9 A;  3Q6S A;  3RD4 A;  1YZ6 A;  1LTR D;  4IZ8 A;  1QZG A;  4DUY Q;  1HFN A;  4IJL A;  3OWF A;  2XRQ D;  3TDQ A;  2MO0 A;  3H0G G;  4BBS H;  3TQY A;  1G6Z A;  3DWP A;  1G91 A;  2OQK A;  3I4N G;  3BYY B;  2RVL A;  1XPR A;  1A2T A;  1Z6H A;  2M2L A;  3X3N A;  2RHS B;  2EDG A;  5A2Q E;  1UWV A;  4XXE A;  1F77 A;  5FJ8 H;  2XIW A;  4KI0 A;  2EYF A;  1RJT A;  2WAQ B;  2F0G A;  1IBK L;  3FPU B;  1A0I A;  4RHS A;  1HR0 W;  1ASY A;  4ZUI A;  1YIT A;  2MFI A;  2HT1 A;  2A69 C;  3PO3 H;  1I50 B;  4NB3 A;  1U5K A;  3PSI A;  5CV7 A;  3HG9 A;  3VR6 A;  3S17 H;  5GRO A;  2KCM A;  2A6H C;  2ZJR A;  4A3D B;  1X32 A;  1VDZ A;  1BNZ A;  1C7Y A;  3R3O A;  2K33 A;  1EY4 A;  4HJA A;  1HNZ Q;  5E3F A;  4PZ8 A;  4A3C H;  1YHA A;  2EY6 A;  3MA2 B;  3WOF A;  3D3R A;  3HOW G;  1B9M A;  1HUM A;  4XYO A;  1WTR A;  4DV5 Q;  2H1E A;  1G2T A;  2B8G A;  3A5U A;  2CW0 C;  4C3H B;  3HOV G;  5IGG A;  3C1F A;  3HZX A;  3D6W A;  2JA7 G;  1Q12 A;  1UNS A;  2GA4 B;  1K73 C;  2EOT A;  2UUB Q;  3K7A H;  2EQS A;  4G7O C;  1GJX A;  4NXN L;  2K14 A;  4DV4 L;  1PFN A;  1SE8 A;  1GUO A;  4OON A;  1RDP D;  4IN3 A;  4ULL A;  4A3I H;  1HCZ A;  4NXM L;  1LT4 D;  1DOL A;  2RBM A;  3LNN A;  1WVL A;  2CH4 A;  1LTT D;  1GXD C;  2ENB A;  1X3G A;  4DNT B;  4K0K L;  2WIN B;  1V43 A;  3GTJ B;  4DV0 L;  4F8M A;  1JJG A;  1F9R A;  4ZQ3 A;  2NZ1 D;  3NTK A;  4QGU A;  1B70 B;  4P73 A;  4PNY A;  2JP1 A;  2NB0 A;  1EOV A;  1WYD A;  3MFG A;  3BDL A;  3A74 A;  5LMN Q;  5FJ8 G;  5DLQ E;  3CMA A;  3HOX G;  2NN6 I;  1AE2 A;  1IZ6 A;  3BVG A;  2BE5 C;  3GDE A;  2CVR A;  5BR8 Q;  3D4W A;  5C3E H;  2Q2T A;  4DU9 A;  4LF4 Q;  2I5H A;  4HJ8 A;  1SBB B;  4XT1 B;  3NEL A;  1MI2 A;  4ZKC B;  4XYQ A;  1OXT A;  4B3T L;  4A4I A;  2NVY H;  4ME5 A;  3A55 A;  5IP7 G;  4C3H G;  1PH8 A;  4JW0 A;  1XPU A;  5GAH C;  3SK5 A;  4B3S Q;  4A93 H;  3HOW B;  1Q1B A;  5I6Y A;  1SYF A;  1D2B A;  1WOC A;  4GNX B;  1E2V A;  4RGO S;  1Q90 A;  1DON A;  3VA5 A;  3S1M B;  4CKC A;  4A3E H;  4A3G B;  1SFO B;  3H0G H;  1DZ1 A;  2F4I A;  2JA5 H;  4DGZ A;  3R93 A;  1TS2 A;  3ND8 A;  1B9N A;  4LAA A;  1UEA B;  2K5D A;  1BKB A;  1LV9 A;  2H4O A; 
#chains in the Genus database with same CATH homology
 4POG A;  2LXK A;  4NPS A;  3UDI A;  2N49 A;  4A3K H;  4GLX A;  1PH4 A;  3S1M H;  5ELN A;  5GAE C;  1NBW A;  3VDY A;  4BY7 H;  2UXC L;  1JT8 A;  2ID0 A;  2H5X A;  1TWA H;  3ERS X;  3CC2 A;  1C0A A;  4POF A;  1L1O C;  1YJ9 A;  1UEB A;  4APV A;  2MQH A;  1Y14 B;  4LUO A;  4X66 Q;  4HIM A;  1YI2 A;  2F4V L;  3PO3 G;  1MKH A;  1K8G A;  4MNO A;  5AJ3 L;  1RL2 A;  1IBM L;  3U58 A;  1WFQ A;  3CCS A;  5JJL A;  1N33 Q;  4LWC A;  1JJ2 A;  2KHI A;  2YYZ A;  1XMQ Q;  3MXN B;  4R4T A;  3CF5 A;  4ALP A;  4JI4 L;  3GTQ H;  4B3S L;  4DR4 Q;  4B3T Q;  1VS0 A;  4RMF A;  4LF7 Q;  4OX9 Q;  3M4O H;  4AIM A;  2ZM6 Q;  1VQJ A;  3STB D;  3HFZ B;  3W1B A;  3NBH B;  1HR0 Q;  3CC7 A;  4NXN Q;  3I4M H;  3TS2 A;  2MNA A;  1TXY A;  3HOZ G;  3E9H A;  3RLO A;  4LUV A;  5C0X J;  1PA6 A;  3ULJ A;  4LF9 L;  3ER0 A;  4R4C A;  3W5O A;  5IYB G;  1BBU A;  2ATW A;  3PUW A;  3G4S A;  2KBN A;  1T9H A;  2QGQ A;  5J3B A;  3KJP A;  1VCI A;  3CCM A;  5IY0 A;  4BXX H;  1C9O A;  4R4I A;  1UE6 A;  1W2B A;  1HNW Q;  5C0X I;  1I5F A;  3UDX A;  1VQP A;  3GTO H;  2B3G A;  2R6G A;  4BBR G;  4AQY L;  1PH9 A;  3M3Y H;  1PH6 A;  3PO2 G;  5IWA L;  1AE3 A;  4YWL A;  4JV5 Q;  2D0O A;  1QZH A;  1L1O A;  1NY4 A;  3J81 j;  2VS1 A;  1L2F A;  3BZK A;  2JEB I;  4JI8 L;  3T1H L;  5IYD H;  2R7D A;  4IJH A;  1PYB A;  2WP8 J;  4R4O A;  5IYC G;  4DR2 Q;  2IHE A;  4DV0 Q;  1JB7 A;  1FJG Q;  4P71 A;  4KHP L;  4L5T A;  3HOZ H;  1YIJ A;  2F3I A;  3RLF A;  3GTP H;  4A3M G;  2OQ0 A;  2PQA B;  1H95 A;  1VQF A;  3DLL A;  1Q82 C;  2BH2 A;  5IP7 H;  1QUQ A;  4JI1 L;  2ES2 A;  3HOV H;  4C2M H;  4A3G H;  1JMC A;  1FJG L;  4KHP Q;  4IFD J;  4O0A A;  3DM3 A;  2YV5 A;  2B63 H;  2JJQ A;  2RF4 A;  1E1O A;  4R4Q A;  4JI2 L;  1XNR Q;  4A93 G;  3G71 A;  4HIO A;  4LF8 Q;  3S2D H;  4IFD I;  2VY3 A;  1X54 A;  5HGQ A;  3FKI H;  1NE3 A;  2UUA L;  2JK8 A;  1N9W A;  4JG2 A;  4A3E G;  4YCW A;  5M3F H;  3AFQ A;  3CCQ A;  2JA5 G;  5C4X G;  4DR4 L;  2HQL A;  1PH7 A;  1K83 H;  1KQS A;  3HOY G;  3H15 A;  2VW9 A;  3SGI A;  4JI7 L;  2PNH A;  2ZTE A;  3I4O A;  3CC4 A;  3PUY A;  3JAM c;  2FXQ A;  1XJV A;  3D31 A;  4GN5 A;  1PVO A;  2VQE L;  1CKM A;  4LFA Q;  4QIW E;  1Q7Y C;  1HNZ L;  1I6H H;  4GKK Q;  2YTV A;  1IL2 A;  2Q2U A;  4KHZ A;  2JA8 H;  4OO1 I;  4Y52 H;  4A76 A;  1U0L A;  3S14 H;  4X65 Q;  1B8A A;  4GKJ Q;  4LFC L;  1YEZ A;  1Z47 A;  3L7Z C;  2R93 G;  4H02 A;  3I7F A;  4BXX G;  3JAM i;  3KFU A;  4IPG A;  3J81 c;  4MTN A;  1VQO A;  4NXM Q;  1Y1V H;  1K9M C;  3I4N H;  3HOY H;  1KC8 C;  4UP7 A;  4GOP B;  2Q2I A;  2LXJ A;  1P16 A;  1PH2 A;  1N34 Q;  4C3H H;  4DR3 L;  3OW2 A;  1VQL A;  1FVI A;  2LSS A;  3M4P A;  2UU9 Q;  3RN5 A;  1KRS A;  1SFO H;  1IXR A;  2BA1 A;  1D7Q A;  2KHJ A;  4OWW B;  1D8L A;  2VUM G;  4A3L H;  4LFA L;  3CCL A;  2JA6 G;  1VQC A;  4JI6 Q;  1XPO A;  1HZB A;  1I50 H;  1SR3 A;  1CUK A;  3J7Z C;  4LF6 Q;  1ASZ A;  3PUX A;  2UXD L;  1E22 A;  5ELO A;  1NJI C;  3RNU A;  4GLA C;  3PIO A;  1QUQ B;  2OCE A;  4GOP C;  2ZTD A;  1R9T H;  1EIF A;  3LGJ A;  4UP9 A;  2PQA A;  4BBR H;  1N33 L;  1TWH H;  3AEV A;  1J5E Q;  4A3D G;  1KIX A;  3K80 C;  3CCR A;  1LTL A;  4XTC S;  4A3J H;  2CWP A;  2N3S A;  4DR6 Q;  1G51 A;  2YTX A;  4UPA A;  4A75 A;  2DUD A;  2I5L X;  5JJK A;  4YY3 L;  1Q81 C;  4DV6 L;  2WAQ E;  3OTO L;  3STB C;  4LF7 L;  4YCU A;  3GTK H;  4A3L G;  2E8G A;  1XNQ L;  5BR8 L;  3K8A A;  3M4Q A;  1HZC A;  4DR1 L;  2CFM A;  3UDG A;  2Y0S E;  4JV5 L;  2XTI A;  3W1G A;  4A3M H;  4BA2 I;  3F1Z A;  4KLK A;  1Z9F A;  4AH6 A;  4B3M L;  1VQN A;  5H1S E;  3B6Y A;  4BY1 G;  3M7N A;  3GTL H;  1MJC A;  1AH9 A;  1PYS B;  4DUY L;  4OXP A;  4QY7 A;  2K52 A;  4AYB E;  4EX5 A;  4RG1 A;  3UE0 A;  4LF5 Q;  2VZA A;  1A62 A;  3PV0 A;  4YHH L;  4DR6 L;  3TRZ A;  1X56 A;  3F2D A;  1S40 A;  1GVP A;  2VUM H;  3K0X A;  4YWK A;  4JBK A;  4Y7N H;  3PF5 A;  2UUB L;  3MEF A;  3CPW A;  2RHQ B;  3CCE A;  1N8R C;  4DV1 Q;  1K0R A;  1Q46 A;  3M85 A;  2KCT A;  4AQY Q;  1WI5 A;  4OWX B;  2F52 A;  4DR3 Q;  1UE1 A;  1NMG A;  2R93 H;  3F2C A;  5IYB H;  2IX1 A;  1OXV A;  1G29 1;  2PMZ E;  3CP0 A;  1PH1 A;  2NVX H;  2WB1 E;  4JI0 Q;  2PI2 A;  3H3V H;  1EUJ A;  4GOP A;  1HZ9 A;  4A3D H;  1LM0 A;  3PO2 H;  1GD7 A;  2JA7 H;  4DR2 L;  2UXB L;  2Z0S A;  4A3J G;  2Q2H A;  1X65 A;  1SMX A;  2XGT A;  1X3E A;  1XNR L;  1IYJ B;  1BVS A;  1SRO A;  2IHF A;  4FDB A;  4GN4 B;  4YY3 Q;  4DV6 Q;  1KD1 C;  1N36 Q;  2CCZ A;  4K0K Q;  1KHI A;  3ULP A;  3S24 A;  3A5Z B;  2WFW A;  4JI1 Q;  3OYY A;  5JEA G;  1SRU A;  2UXB Q;  4X62 Q;  4IPH A;  3T1Y L;  1XTD A;  4DPG A;  1E3P A;  4B3R L;  1NTG A;  5C4J H;  3BU2 A;  2HIV A;  2NZH A;  3PUZ A;  4DUZ L;  1W3S A;  4LF6 L;  1HNX Q;  1VQG A;  1YBY A;  3GD7 A;  1KXL A;  3H3V I;  1SLJ A;  3G6E A;  2AHO B;  4A3K G;  4JI5 Q;  2RCN A;  5FLM H;  3I55 A;  1UE5 A;  2VQF Q;  2C35 B;  2N8N A;  3HKZ G;  2CQO A;  2IY5 B;  1MIU A;  4P72 A;  4LW1 A;  1VQ4 A;  1QVC A;  1XMO Q;  2DGY A;  4P75 A;  4JI2 Q;  4LFB Q;  5IE8 A;  1CKO A;  1I3Q H;  4TVA B;  5EAY A;  2NVT H;  3FHW A;  2UUC Q;  4HIK A;  1E24 A;  3HKS A;  5C0X G;  2E2H H;  1EWI A;  3KOJ A;  1XMO L;  4DR7 L;  3GTG H;  2ZTC A;  1YNX A;  2K75 A;  4JI3 L;  2A19 A;  2EXD A;  3J80 i;  1TWC H;  1VQH A;  2K5N A;  2JE6 I;  2WAQ G;  3KDF B;  3GO5 A;  4JI6 L;  3CAM A;  1Y1W G;  1SN8 A;  1E1T A;  4LF5 L;  2OTL A;  1VQI A;  4L5Q A;  3RZO H;  2MO1 A;  4B3R Q;  4BY1 H;  2GVB A;  1YHB A;  2I5M X;  5IP9 G;  4ME3 A;  2JA9 A;  3U50 C;  5LMU Q;  4DUZ Q;  1EIY B;  2R92 H;  4QL5 A;  1VQ8 A;  3HOU H;  3I56 A;  2K4K A;  3CPF A;  4A3B H;  5JJI A;  4DNI A;  3AFP A;  1FGU A;  3NEM A;  4LUZ A;  4JBJ A;  4A3F H;  4X6A H;  3BZC A;  2AWN A;  5M5Y H;  3FKI G;  4IOC A;  1KL9 A;  2R7F A;  4JBM A;  1I94 L;  1EQR A;  1Q1E A;  2K5H A;  4C3J H;  2HHH Q;  4TQU S;  2Z6K C;  1XMQ L;  1V1Q A;  2R7Z G;  2E5L Q;  4PG3 A;  5C44 G;  3EN2 A;  4DKA C;  2E2J H;  2UUC L;  4GN3 B;  3S16 H;  1LUZ A;  5GQO A;  1HR0 L;  4DR5 Q;  2QA4 A;  1IBM Q;  3OTO Q;  3I2Z A;  3KDF A;  3PCO B;  4GS3 A;  2HHH L;  2B29 A;  2IT1 A;  1VQK A;  4LFC Q;  3J7A 5;  3F8T A;  3S15 H;  4LFB L;  1PH5 A;  3KF6 A;  1HJP A;  2VQE Q;  1DGS A;  3Q8D A;  4JBW A;  1J5E L;  1VQ5 A;  1S3O A;  4L5S A;  1N32 L;  4DV1 L;  4A3C G;  3L2P A;  1Q8K A;  1TWF H;  3KF8 B;  1KRT A;  3I4M G;  3HOW H;  2V1C C;  5IWA Q;  4X66 L;  3BJU A;  2UU9 L;  2YTY A;  3S2H H;  4WJ4 A;  1FL0 A;  4DK6 C;  4JI7 Q;  1Y1V G;  2IX0 A;  1YHQ A;  4LF4 L;  1QVG A;  4GLV B;  2ZJQ A;  4EQ5 A;  3EBE A;  4X64 Q;  4DR5 L;  1M1K C;  3FP9 A;  4X62 L;  1JE5 A;  3J80 c;  4HJ9 A;  5LMN W;  5FLM G;  1MJE A;  1VQD A;  4XIG S;  4MZ9 A;  1GO3 E;  2Z6K A;  3RR5 A;  1YZ6 A;  1QZG A;  1K8A C;  4OX9 L;  3K7U C;  1N36 L;  1IBL L;  4DUY Q;  4IJL A;  2ZJP A;  4QJF A;  4JCV E;  4GNX A;  2MO0 A;  1VQM A;  3H0G G;  3ZJY C;  4BBS H;  3TQY A;  3RZD H;  1P8L A;  1HH2 P;  1VQA A;  2OQK A;  2VL6 A;  3I4N G;  1LYL A;  5E7N A;  2ALY B;  1XPR A;  1IBL Q;  4DV2 L;  4IOA A;  4PZ7 A;  3EIV A;  2KEN A;  4BA1 I;  2BH8 A;  3E9I A;  1OXX K;  4YCV A;  2RHS B;  3GTJ H;  2QEX A;  4UP8 A;  1M90 C;  1UWV A;  3IRB A;  2VQF L;  3NEN A;  2AMC B;  3AYH B;  2JEA I;  1VQ9 A;  5FJ8 H;  4BY7 G;  1GKH A;  1CSP A;  2K50 A;  4KI0 A;  4LF8 L;  1N32 Q;  2VNU D;  3KLW A;  4DV3 Q;  1Y1W H;  1IBK L;  3K81 C;  1N34 L;  1A0I A;  1HR0 W;  1ASY A;  2R7Z H;  3CQZ H;  1YIT A;  2JQO A;  2MFI A;  2HT1 A;  3PO3 H;  1WCM G;  3S1N H;  2I0Q A;  4JI4 Q;  1U5K A;  2Y0S G;  1CKN A;  2NN6 G;  3PSI A;  4NB3 A;  2A8V A;  2HIX A;  2GN5 A;  2N78 A;  3S17 H;  5GRO A;  1UE7 A;  2KCM A;  4B3M Q;  1HZA A;  1L0W A;  3WWV A;  2ZJR A;  2UXD Q;  2PI2 E;  4DV2 Q;  1OTC A;  4X65 L;  1X6O A;  4YWM A;  2BA0 A;  1C7Y A;  4GNX C;  3RN2 A;  1PV4 A;  2NZO A;  4JOI C;  4LF9 Q;  3CD6 A;  4HJA A;  1BBW A;  1HNZ Q;  4PZ8 A;  1EQQ A;  4A3C H;  1OXU A;  1WJJ A;  1YHA A;  2EIF A;  4JYA Q;  4WJ3 M;  4HJ7 A;  3HOW G;  1VQB A;  4DV5 Q;  2YU9 H;  2F4V Q;  4BBS G;  3A5U A;  2AKW B;  4AYB G;  4JI0 L;  3HOV G;  5LMU L;  5AJ3 Q;  4A3G G;  1L1O B;  5HY6 A;  2JA7 G;  1Q12 A;  4P74 A;  2ASB A;  3UDF A;  2NVQ H;  4DV7 Q;  1K73 C;  1RIP A;  1X3F A;  2UUB Q;  3K7A H;  4DAY B;  1YJN A;  1VQ6 A;  3CCU A;  2EQS A;  4NXN L;  2K14 A;  2ZM6 L;  1NMF A;  5C3E G;  4DV4 L;  4IO9 A;  2JA6 H;  1J6Q A;  3ICE A;  2L15 A;  2D0P A;  1QVF A;  1A63 A;  4X64 L;  3U4V A;  1SE8 A;  4JI3 Q;  5M3M H;  5C4X H;  4OON A;  3L0O A;  4A3I H;  1E7Z A;  2E2I H;  1EFW A;  4JOI A;  3T1Y Q;  4NXM L;  3ULL A;  1X55 A;  3HKZ E;  3D0F A;  1EYG A;  5IP9 H;  3M9B A;  2R92 G;  2UUA Q;  1JJC B;  3CCV A;  4GKJ L;  3PUV A;  1OXS C;  3RLN A;  5JEA J;  1X3G A;  4C3I H;  4K0K L;  4DK3 C;  3T1H Q;  1K3R A;  4JI8 Q;  1V43 A;  2JA8 G;  3PGZ A;  4DAM A;  4DV0 L;  2K5V A;  1A8V A;  1Q86 C;  1JJG A;  4DV4 Q;  4DR7 Q;  1KAW A;  4DV5 L;  3A0J A;  1TWG H;  3TRE A;  5LMN L;  1PFS A;  3S1R H;  5K36 G;  4QGU A;  4R1J A;  1B70 B;  5C44 H;  3U4Z A;  1B7Y B;  3PF4 A;  2CWA A;  2UXC Q;  4P73 A;  4HJ5 A;  4QQB X;  3JC6 6;  5GAG C;  3TEH B;  1EOV A;  1WYD A;  2GVA A;  4JI5 L;  3CME A;  3A74 A;  5LMN Q;  1PH3 A;  5FJ8 G;  5DLQ E;  4YHH Q;  4A3F G;  4IPC A;  3CMA A;  3HOX G;  2D62 A;  2NN6 I;  1X9N A;  1AE2 A;  3KF6 B;  4IPD A;  4UY8 C;  1IZ6 A;  3GDE A;  5IYD G;  5BR8 Q;  5C3E H;  2Q2T A;  4LF4 Q;  2I5H A;  4O2D A;  5IYC H;  4HJ8 A;  1YVC A;  3F2B A;  1WCM H;  5GAD C;  2OWO A;  3NEL A;  4LNQ A;  3AQQ A;  1OXT A;  1GM5 A;  4B3T L;  4A4I A;  2NVY H;  1VQ7 A;  4A3I G;  3GTM H;  4DV3 L;  1YJW A;  1IBK Q;  3CXC A;  3PIP A;  4HID A;  3KYH C;  5IP7 G;  1VQE A;  2A1A A;  3G48 A;  4OWT B;  5M5X H;  3KJO A;  1PH8 A;  1XNQ Q;  4A3B G;  4DR1 Q;  4IFD G;  4JYA L;  3J81 i;  1XPU A;  1CSQ A;  5GAH C;  2E5L L;  2B63 G;  2AWO A;  4GKK L;  4B3S Q;  4A93 H;  1Q1B A;  1O7I A;  1V9P A;  3TS0 A;  1CKN B;  4J15 A;  1PHJ A;  5IT9 c;  3HOX H;  1I94 Q;  1WOC A;  4GNX B;  3CW2 C;  4JC0 A;  1HNX L;  2WB1 G;  5M3M G;  4A3E H;  3H0G H;  2OTJ A;  4DV7 L;  1S72 A;  4PZ6 A;  5M5W H;  5M3F G;  2JA5 H;  3CCJ A;  4OO1 G;  4PMW A;  2CKZ B;  1HNW L;  1G6P A;  4L5R C;  3HOU G;  5FLX c;  3E0E A;  3UE1 A;  1BKB A;  3S1Q H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...