1HUNA

Solution structure of the chemokine hmip-1beta(slash)act-2 by multi-dimensional nmr: a novel chemokine dimer
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
69
structure length
69
Chain Sequence
APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine(chemotactic)
molecule keywords HUMAN MACROPHAGE INFLAMMATORY PROTEIN 1 BETA
publication title High-resolution solution structure of the beta chemokine hMIP-1 beta by multidimensional NMR.
pubmed rcsb
source organism Homo sapiens
total genus 8
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 1994-01-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1hunA00
4RWSC 4NW2A 1EIHA 4CJ2C 1KNAA 3H91A 2K28A 1G2TA 1LV9A 2MJ8A 4XDXA 1BBXC 2K05A 5DNFA 1G6ZA 1F9RA 1EIGA 1WTPA 1X3PA 1MGSA 1U4PA 1X32A 1GUWA 1WTRA 2FINB 1DOMA 1ESRA 4X3TA 1WTVA 1ML0D 2DY8A 1J8IA 3I91A 4CJ1B 2B2TA 4X3KA 2SDFA 1ILPA 3HP3A 2RSNA 4IUTA 2EOTA 2KECA 2VXWA 1MSGA 1RTNA 1WD1A 1JICA 1MSHA 4OIJA 5T1IA 1O7YA 1EQTA 2XIWA 5CBEE 1U4RA 1QE6A 4X3UA 1VMCA 2B2WA 2KOLA 4ZKCB 4IUPA 1F9PA 2KVMA 1ICWA 1KNEA 5COYA 3I3CA 1WTQA 3QO2A 3Q6SA 4DN4M 1O80A 5JJZA 2L4NA 2MGSA 3N52A 1IKMA 2B2VA 1E0BA 3ONAB 1CA6A 1SDFA 5E4XA 1IL8A 2HUGA 3I90A 1DOKA 2CVRA 1HFNA 1B4OA 5EQ0A 4R8IA 1C8CA 1DZ1A 1O7ZA 4UAIA 1X3QA 2IL8A 1PDQA 4XT1B 4U68A 1G91A 2DY7A 2L12A 3R93A 1NAPA 2M2LA 4IUQA 2BDNA 1NR4A 4QUFA 1WD0A 2NWGA 1B2TA 4CJ0B 1EL0A 2HDMA 3GV6A 5CMDA 1PFBA 2MP1A 1QG7A 4HCSA 2N88A 1F2LA 2B2YC 2Q8TA 3UI2A 2B2UC 1XYIA 1JE4A 2K1BA 2K04A 3FPUB 1B53A 1HHVA 3P7JA 4ZK9B 1F9QA 1SAPA 1RJTA 1Q3LA 3SVMA 1S4ZA 3GV3A 1WTOA 4ZLTF 4ZAIA 1HUNA 1G2SA 1U4LA 3DM1A 1AZPA 1HFGA 3IFDA 4QUCA 2JP1A 5D65A 5AFWA 1AZQA 1RHPA 1BF4A 1IKLA 1QNKA 1RTOA 2RSOA 3DEOA 1ZXTA 2MPMA 2EE1A 4X3SA 1RODA 5T1GA 3D6WA 3I8ZA 2D9UA 5EPKA 1DONA 1PFNA 2B2VC 3KBXA 2X6LA 4O42A 2KEEA 1F9SA 1HUMA 1SSOA 2HDLA 2X69A 5D14A 1CM9A 2L9HA 5CBAE 1AP0A 1M8AA 4IURA 4MHEA 4XT3B 1U4MA 1DOLA 3G7LA 1B3AA 2RA4A 2HCIA 4OIKA 2B2TC 5EPLA 1WVLA 2FFKB 2FHTA 2K01A 3FDTA 2FMMA 2J7ZA 2RVLA 5E4WC 1J9OA 4IUVA 4ZKBB 3MWYW 2HCCA 4HAEA 1B50A 1PLFA 1TVXA 2K03A 3LWEA 2Q8RE 2X6GA 3TZDA 4R9WA 1HA6A 1WTXA 3IL8A 4IUUA 1HRJA 3F2UA 3KUPA 1MI2A 1EOTA 1ILQA 1XX8A 2KUMA 2N55A 1CA5A 1VMPA 2B2WC 2FJ2A 2B2YA 2NYZD 2R3ZA 2B2UA 4HEDA 4RA8A 5EPJA 4LMQD 5EKIA 2NZ1D 4MN3A 5EJWA 2EPBA 2L1BA 1A15A 1NCVA 1PFMA 3MTSA 2KEDA 2H1EA 1BNZA 3TN2A 2JYOA 1BO0A 4HSVA 1NR2A 4RAUC 5CORA 2L11A 1WTWA 3DEPA
chains in the Genus database with same CATH superfamily
1UAPA 3KLSX 4IO9A 2B63H 2JA7B 1KNAA 2IX0A 2NVYH 4LF9Q 3KDFB 1GUSA 2BA0A 5IYBH 2K5WA 1EY0A 1KRSA 1GUWA 4B3RL 3KF8A 2FINB 1I6VC 1KRTA 3RNUA 1K0SA 2EY2A 5FLMG 3OYYA 1PTOC 3D4DA 4GNXC 3OWEB 1YBYA 4H44C 2A68C 2ZXOA 4LFCL 5M3MH 3KJPA 3S16B 5AJ3L 2KA7A 3CKIB 3L0OA 4JI7L 3W1GA 5FO9B 3GTKH 1U4RA 4C3IG 1NBWA 4IUPA 1X54A 1IBML 1L1OA 4GKKL 2NB0A 1NNXA 4DV2L 3T1YL 1AW7A 3QO2A 4DN4M 4GN3B 1QVGA 2IW3A 4LNQA 4DK1A 4JV5Q 1AEXA 1GUOA 3EROA 2D0OA 4OGQC 3PQIA 1A6XA 2HUGA 4V190 4K6DA 3IFTA 4B9XA 1WYDA 2A74C 2WFWA 2PQAB 2VQEL 2DY7A 4K6LA 5D3DA 1FJGQ 4JBMA 2O5IC 2R7FA 1YITA 4DF7A 5LMUL 3S9WA 1HR0W 1F2LA 3PUZA 1JE4A 2K1BA 2R7DA 2VUMB 3E6ZX 4Q0FA 3SDZA 4CHTB 3DWQA 5C4XH 4GNXA 2HQEA 3GTLH 5GAHC 1D6EC 1IKLA 4AQYL 2C5CA 1E24A 1OO9B 2EE1A 1LTLA 4A76A 3RZDB 2X6LA 2I5LX 1AE2A 3CPFA 4RMFA 5DLQE 3M4PA 1EY5A 1MJCA 2Z0SA 1Z9FA 4LW1A 1XPRA 5KIXA 2OWOA 2VL6A 3FRPB 4IPHA 2CH4W 5JJIA 3N6RA 1KQSA 3LWEA 2X6GA 4ME5A 1WTXA 3S15H 1XX8A 1DJRD 1XMQQ 2PPBC 2B2WC 1UNSA 2VW9A 4IFDI 4GS3A 3CCLA 3HOVG 5LMNL 1DM0B 4BA1I 2QILA 3OIPA 2UXDQ 3TN2A 2WB1B 3P20A 4NW2A 1TS5A 2OQKA 4YY3Q 2WINB 3NP8A 2MQHA 3LGJA 1CUKA 2CHBD 1IBLQ 4A93G 4PZ6A 4F7XA 1JORA 3CCRA 3R2TA 4DV5L 3KDFA 2JA8B 3VDYA 3BZCA 1FL0A 3U4VA 3HOZH 1VQDA 3QOJA 5IT9E 4DV7L 5K36G 2HIXA 3DXJC 2VXWA 3V96A 2ZJPA 2E2JH 4XYOA 1HQRD 1PA6A 4X3UA 4DV6L 4OX9Q 1A3UA 1YNJC 2B2WA 2RBMA 4BBSH 3BJUA 1BCPD 4DAYA 5ELDA 3V2TA 3C1EA 3UDIA 1EQQA 3I90A 1TWCB 2CVRA 1P16A 4G4KA 5DEHA 1C8CA 2BH2A 5J22A 4RFBA 2IL8A 4QF4A 3GTQH 2NVQH 2HQLA 1NAPA 1G8ZD 2M2LA 3OMCA 4LFBQ 5M3FB 5BN3A 2GVAA 1ZKOA 2VZAA 1QZHA 4A3JG 3PV0A 3PO3H 4LJZC 2YU9B 1B53A 3Q22A 1EYGA 1S5CD 2LXKA 4LK1C 4A3BG 5IYCH 1SNCA 4XIGS 4X3SA 4JI5Q 4P72A 3TS0A 1YHAA 3UDGA 4A3CH 4L5RC 2K5QA 5DAUA 1CSPA 2Z6KA 1YJWA 3TP8A 1HUMA 1SSOA 3HFZB 3CHBD 4X64L 2NN6G 5KNDA 1XWEA 3J81L 1K8OA 2Z8LA 1YNND 3AFQA 3KYHC 3H3VH 4I7ZC 1SLJA 2F3VA 2FMMA 2KHSA 3B6YA 5E4WC 3HKZG 3RLOA 3J80c 2E76C 4C2MB 2K03A 1STBA 2R92G 4RH6A 2F0IA 2Q8RE 4A3FG 2EQSA 4FXGC 2F0KA 5KNCA 2A6HC 4DR5Q 1OXTA 2N55A 3D3RA 5C0XG 1T9HA 1HJPA 3TP6A 3CAMA 2GN5A 3NPPA 3M3YH 2F0WA 4KMUC 2G9DA 4CKEA 2K4KA 3LX0A 2D2CC 4A3KG 1EIHA 3ND9A 2DNCA 2KJXA 4KY5A 1TWHB 4KHPQ 2F1MA 3CCSA 1ONLA 1JJ2A 2MO0A 2AUJD 3T1HQ 2NVTB 2TSSA 5IT9L 1Y1WB 4F88A 3RZDH 2SEBD 3A74A 4CBVA 2EJMA 2EOTA 3MXUA 3F1ZA 2Q2TA 4DPGA 5I4DA 1JR0D 1BCPB 3HGBA 1EY4A 5JVH3 1XPOA 1SMYD 4PMWA 2QDBA 1IHZA 1VQCA 5IWAL 2RDFA 4C3HH 2JJQA 3ERQA 4V0BA 1VQGA 3Q6SA 4R4TA 4A3EH 1JB3A 5I6YA 3H0GG 1IKMA 3JAMi 4POFA 4MTNA 3DUZA 2K50A 5CV6A 4O1NA 5C5LA 2L15A 1BUVT 2E2DC 1Z6HA 1O78A 1M90C 4QMGA 1EU4A 3K0XA 4NXNL 4JC0A 4KHZA 3SK6A 3HOYG 1NUCA 3NSWA 2Q2IA 4HR7B 1HNZL 1EL0A 1WJJA 3M9BA 2PI2E 1V9PA 2Q8TA 3R2IA 5HURA 4JVZA 2EVBA 3I4MG 1V43A 3M4YA 4XQJA 3CQZB 5ELFA 4PQXA 4ZLTF 1J5EL 3I4NH 1D5ZC 2ASBA 1H9MA 2JP1A 2Y0SE 2AQ2B 4DUZQ 1BF4A 1RTOA 4N9PA 1ZXTA 3PO2H 3BU2A 3I8ZA 1SYFA 1Q7YC 4KJOA 2Z1CA 1JOQA 3KF6A 4EQOA 1N36Q 3HOVB 1K3BC 5JOBA 1VQ9A 1SR3A 1STAA 3I2ZA 3I70A 2XNAC 3M85A 1M4VA 3CCUA 1I4PA 1PLFA 1TVXA 3L2PA 4DV0Q 1LYLA 4KY6A 3D4WA 4RA8A 5IE8A 4MN3A 3R8BA 1VS0A 1XTCD 1A15A 4PZ7A 1QNUA 3K5NA 1BO0A 4DV3Q 3C3LA 5KEEA 4WJ4A 5EKKA 4DAPA 4K14A 2B39A 5GROA 1CTMA 2KHJA 1KHIA 2QW7A 3PF5A 1G6ZA 2OCEA 1MGSA 1WFQA 1TXYA 4S3SA 3O13A 5ELNA 1RD9D 4C3JB 3K81C 4BY7G 3ICEA 3S14B 2XSCA 1PH4A 1JOOA 3OTOL 1JICA 2IWHA 4DA2A 2WP8J 3G6EA 2OQ0A 5I6WA 1NY4A 3HOWB 2AWOA 2EZVA 2NZHA 5BN5A 1PH2A 4A3JB 3M7GA 5FLXE 1L0XB 4OWXB 3NE5B 4X65L 1HR0Q 1GUGA 4YCWA 1ESFA 1DZ1A 3MAQA 3TQYA 5FLMH 4KN7C 1JT8A 1FNVA 1FYCA 1LT4D 2A5HA 1CQFA 3S24A 4EQPA 1Q8KA 2MP1A 4C3IH 1XYIA 1H9KA 2RCFA 4DXGA 4ZAIA 1AZPA 5D3IB 1N9WA 4Y7NB 3IFDA 4DR3L 4A3FB 2XWBB 2N78A 3SE0A 1PRTF 5M5WH 1NMGA 4DV4L 1WCMG 1H9RA 4IPCA 5FO7B 3CMAA 4LF8Q 1R9TB 4GKJL 1VQLA 5IYDG 3MVVA 3PGZA 1BOSA 2HDLA 3IRBA 5D14A 3G6JB 2R93B 1U4MA 1DOLA 3MXNB 5LL6S 2B2TC 1CI3M 4A3KB 2K01A 1I4HA 2PW7A 4I7AA 2QGQA 4KKTA 2B63B 1KAAA 4H7BA 2XRQD 2NVYB 4ZYSA 2QA4A 4U673 1IBKQ 1PTOD 3TZDA 2G5DA 2A68D 2EY5A 1QUQA 4X66L 4DV1Q 4IZ8A 4LF7L 3Q8DA 5M5XH 3SK8A 1D7QA 3J7A5 3RZOH 1CT1D 1I50H 2PNRC 1CK1A 1KDCA 4EQNA 4DR1L 1GHJA 2H1EA 1A2UA 4LFAQ 3BDLA 2JA5G 1A0IA 4XTCS 5F2DA 3OPOA 3CQZH 3K5OA 2LMCB 1PH3A 1X3GA 3GTKB 4DR6Q 1PVOA 3S1NB 3VYSA 2Y0SB 3I55A 2PMZB 4JBKA 2EYLA 1I5FA 1S5FD 3EJIA 3T53B 4F87A 3BYTB 4R1JA 1EFID 2B2TA 2F03A 2UUBQ 4ME3A 1EYAA 2MFIA 4KKSA 3HOVH 4DR4Q 1MSGA 1F2YA 4JI4L 2PW5A 1O7YA 3HOYB 1F2ZA 4BBRG 3FVQA 3A7AB 3OWFA 4JI0Q 5IP9G 2EIFA 2ZM6L 3KF8B 2NVXB 4LF9L 3N52A 4A93H 4GOPC 2WIIB 4WFN3 1SDFA 1Z47A 5C4XB 1W6JA 3VYTA 3GTLB 4DAVA 1U5KA 1A2TA 3NUCA 5K36H 1PYSB 3QWNA 3V05A 1K28A 3BZDB 1RIPA 1NR4A 1L1OB 4CKCA 1B2TA 4K8JA 3AQQA 1NMFA 1Z7TA 1OXSC 5IT9c 2XVSA 3P7JA 4IN3A 4EQ5A 4HCEA 2IJ0A 2ICIA 5LMNW 3DM1A 1QVCA 5CV5A 4BWGB 4C1NI 1CKOA 4JV5L 4GLVB 1BDOA 1QNKA 4ZCKA 5I2YA 5IIFA 1AH9A 3S15B 2V4DA 4RKBA 2IX3A 4P71A 1PXUA 1Q90A 5CBAE 2OF1A 3QR8A 1SMXA 2JEBI 4ABNA 1FJGL 1LABA 2RA4A 3MFGA 1PTOB 4GNXB 4A3JH 2WB1E 3T13A 5CV8A 2K5VA 2FHTA 4POGA 2CW0C 1VQAA 4IFDJ 4YWLA 4A3BH 4L5TA 1ET9A 1H9SA 2WKDA 3J81j 3QOLA 2WAQE 4LMQD 3NTHA 4LF4Q 2EPBA 1MJEA 3S1QH 1K8AC 4UP8A 2NN6H 1TS3A 3J80i 5IGGA 1Q81C 1RDPD 2E2JB 2UXCL 3W3AA 1LV9A 1U0LA 4Y7NH 2HT1A 2NTTA 1EIYB 2R92H 4JI3Q 1JMCA 4A3FH 1STEA 2F0EA 2DGYA 3ZJYC 2AWNA 5C0XH 2JA6G 1TIID 3RN5A 3VR6A 4G7HC 3GTGB 3H6MA 4RCNA 1S5DD 1TY0A 3U58A 2AQ1B 3GTQB 1N8RC 5JJKA 1MD2D 2UXDL 2Z6BA 1SJHD 2A19A 1L2FA 2AKWB 1VQ5A 1N33Q 2KVMA 2P5ZX 4WRDA 4ZQ3A 3PO3B 2PYKA 1U9RA 1Y1VG 5C4ZA 4LF5Q 1IZ6A 2Q2HA 3BVZA 3PSIA 4M8AA 1HCZA 1PZJD 5J1ZA 1PZID 1QOHA 3GTMB 3SK4A 2UUCQ 2NTSA 5C44G 4XT1B 5CR3A 4U68A 1EY7A 4PV1C 1V1PA 3R93A 2CCZA 3SXHA 3SHLA 2HDMA 2A6HD 3U9SA 4DAYB 1HHVA 3S1NH 1XNRQ 3TZUA 1RJTA 4FP5D 1G2SA 1L0WA 3H0GH 3CW2C 4KJNA 3HOUG 2HHHL 4X6AH 4DK3C 2F0SA 3FEWX 1RODA 4TQUS 4WORA 2L55A 4KKUA 2QCPX 2M9VA 5BR8L 2UUAL 1UE7A 2EXZA 1QCBD 1TWFB 4O42A 3RLFA 1W3SA 3F2BA 3HOYH 4YHHQ 3CD6A 2F0DA 3M3YB 1KXLA 4LFBL 4QJFA 4FYDA 2JA5B 1I94Q 4R4IA 1WVLA 2NVXH 3I4MH 4DR7Q 4NXMQ 2E2IH 4JI8Q 2PZUA 3C1FA 1BVSA 2EJGC 2Z4IA 1VQ8A 2ZXPA 4GLAC 3HG9A 2JXMB 1WTHA 4PMCA 4RKLA 1PH7A 3AFPA 5EJWA 1YVCA 5EBDA 1B9MA 1K0RA 4KN4C 5FKAC 1VQ7A 5ELBA 2KEDA 1QVFA 1ZYRC 4RAUC 3MZ5A 4XQNA 1SE4A 3KLRA 5M9OA 1IYUA 4I65A 3J81E 1OXVA 4LF6Q 2LFNA 1Q1EA 4BBRB 3U50C 1QZGA 3S1RB 4NDXA 3RR5A 3U4ZA 1WTPA 1Q1BA 5H1SE 4C3HB 4A3EB 2L5TA 1FD7D 1EY9A 1JB7A 4G7OC 3A0JA 3I4LA 1ASYA 2B8GA 4IUTA 3VYUA 1E3PA 2JE6I 4JI2L 4WJ3M 1PTOH 4A3MG 1ZEQX 4P2CB 3ERSX 1KLGD 5I2XA 1PFSA 2MGSA 5EBCA 1XMOQ 3CU7A 1CZGA 4UP7A 2NN6I 1BBUA 3I4NB 3T1HL 4FF3A 2WAQB 4BY7H 2BCOA 4DNRB 1R4PB 4A3IG 3ULLA 4JYAQ 3PO2B 2KCNA 1NTGA 1VQNA 3JAME 2N88A 1YHQA 3UI2A 2F4VL 1X55A 1IW7C 2K7VA 4BY1H 4TKOB 2QDLA 4B3RQ 1U4LA 5CYUA 3K0YA 5JVG3 2F0TA 1AZQA 2EYHA 3NXWA 1UE6A 3KOJA 1YIJA 2K5DA 2PCFB 1HNWQ 4PZ8A 5T1GA 3GTGH 2MHVA 4LFCQ 1O7LA 5FLXc 1R4QB 5AJ3Q 1YHBA 3M4QA 1B7YB 1LT3D 4UY8C 1W2BA 4IURA 4GKKQ 2PQEA 1IBMQ 4DV2Q 4IQZA 2J7ZA 4RG1A 3C46A 1AN8A 1VQPA 4HIDA 3IL8A 4B9WA 5JEAJ 3GTMH 1ILQA 3CCJA 3EA6A 2F52A 3KF6B 4HEDA 5I9PA 2F0GA 1SN8A 3CCVA 3X3NA 2A6ED 1WCMH 2HD3A 1YNXA 4IJHA 3AU7A 4P73A 5IYDH 3UDFA 4IFDG 3A55A 4O0AA 4HMIA 1HQMC 2FMCA 3BDOA 3PIPA 3H91A 2JSOA 4N8FA 1EWIA 1GXDC 4AQYQ 1KC8C 4BS9A 4N9TA 1TS4A 1Y1VB 2IT1A 4FDBA 2KBNA 4NKLA 1VQEA 4QQBX 1ASZA 2QEJC 2DY8A 4CJ1B 3GO5A 5M5YB 2V1CC 1CQVA 1TWFH 1AFPA 3QG1A 2OTJA 5E1FA 5C44B 3E0JA 2EYPA 2FXQA 2JA5H 2UXBQ 2B29A 5CBEE 4DV3L 1KTKA 1ENCA 1TT2A 1C4QA 2N8NA 4RGOS 3F2CA 4C3IB 4F8MA 2L4NA 4XXEA 5LL6X 1GD7A 1E0BA 3ONAB 3L7ZC 1DOKA 3HKZE 5JAVA 1VQ6A 3H15A 3AYHB 4PG3A 2XTIA 5M5WB 4L5QA 3JAML 1VQFA 3TDQA 3NQTA 4K0KL 1Y8PB 3STBC 3K5LA 3FHWA 4IPGA 4BBRH 4HJ7A 3G4SA 3OIQA 3S1RH 1SNPA 1KLUD 5IP9H 3A8JE 4HJ9A 4B3TQ 2DJGC 4KD3A 3MA2B 5J39A 4KHVA 1HTPA 4XYQA 4DAMA 4DV7Q 1EY8A 1S40A 1LUZA 4DR2L 3VR5A 5ELEA 3TP7A 3KJOA 3MEFA 5M5XB 1E1OA 1STNA 4YIJA 4JPBW 2L9HA 4DV6Q 1I50B 3OMGA 4DNIA 4OO1G 1FNWA 3RZOB 3G7LA 3OW7A 1Q8IA 4UHVA 3BZKA 4LWCA 1K73C 4FNFA 3S2HH 3FP9A 1IL2A 1PHJA 1CA5A 2PMZE 2F4IA 3K8AA 3A56A 3Q0AA 3BYYB 4ZRZA 2E5LQ 2VQFL 1NCVA 2KCCA 5G3LD 2YYZA 4RWSC 3DLLA 4GLXA 4A3MB 4JI1Q 1QUQB 2XRSD 2GVBA 2K05A 1EUJA 1A63A 4Y52H 4A93B 4RGNA 1KAWA 4X64Q 1LTRD 2C35B 3PIO3 1GUNA 1CFMA 2ZT9C 3NWSA 1EQTA 3WDNA 4ZKCB 4DKAC 2HIVA 2UU9L 4AH6A 2WKCA 2B8FA 1LM0A 1GJXA 1O7IA 3R3OA 1CHQD 4FF2A 4QY7A 1DCZA 3NBIA 1B4OA 3E5SA 2JA6H 4NP5A 1H9JA 3E3XA 1JWUD 1WI5A 1JOKA 2CW0D 5DM63 4L6TB 1HNXL 3H3VI 3BDCA 4QUFA 1FR3A 4DR4L 1X9NA 2JA9A 1PRTC 3RUZA 1SYBA 2VS1A 1HZ9A 3TS2A 4GN4B 2K6AA 4BY1G 1ICFB 4JI0L 1Y1VH 1HFGA 1JWSD 2VB3X 4HJ8A 4GZYC 1RHPA 1PMRA 5M5YH 5C3WA 1FGUA 1F2MA 4A3BB 2SNMA 5C44H 5CV9A 5IOCA 2KQ3A 4X62L 3A5ZB 3PUXA 3QJYA 3S1QB 1P8LA 4XT3B 2HCIA 1SYCA 1AE3A 1JQYD 5EPLA 1XNQQ 3OW2A 3EIVA 3CF5A 5LHY1 4HIMA 4RHRA 2A8VA 3S1MB 1BCPF 3HKZB 4TVAB 3HOUH 1IYJB 2R92B 2AHOB 1X56A 2K5NA 3TSSA 2FJ2A 4A4IA 3HZXA 1EEFD 4OHJA 1NE3A 2OTLA 1HNZQ 1BBWA 3CRLC 3A7LA 3H94A 4JI6L 2JA7G 2QF7A 1JWMD 4B08A 1SNMA 5DM73 1WTWA 1FGBD 3DEPA 5JEAG 1D2BA 1J5EQ 1E2WA 1TKWB 5C6AA 3AB9A 3X3MA 3S17H 1H9SB 5HGQA 3BVGA 1E1TA 1NSNS 1HPCA 3VR4A 2PNHA 1A3TA 1MKHA 1U4PA 4QL5A 4G57A 1Y8OB 3WOEA 1N32Q 1UE5A 3K80C 3FKIG 4DXFA 1J6QA 1W6KA 4B3SL 4OWWB 2LKVA 3NHHA 3EFXD 1G51A 1VMCA 3NK9A 4NB3A 2ICEC 1OTCA 2EYFA 4IPDA 2N49A 5EGTA 4IUNA 2YTYA 4JI3L 4A3LG 3H0GB 2C9OA 3J81c 4BXXG 1PDQA 3PUYA 1C48A 1RCVD 1Q86C 3IKJA 4EGVA 2BOSA 4A3MH 5A2QE 2CH4A 4CJ0B 5CMDA 3SGIA 2VUMG 1PFBA 1QG7A 1A62A 4DFAA 4ODGA 2RHQB 4UP9A 1SAPA 5C3XA 4JCVE 4G7ZC 4OELB 1N33L 5CC4A 1SEBD 1TWGH 3I4MB 4QUCA 2K32A 3K7UC 2E2IB 1ZYRD 2F0PA 1V1PB 4J8QA 1D5MC 4ALPA 1CKNA 3OTOQ 1HXYD 4A3IH 1VQ4A 4A3DG 3ULJA 3CMEA 1I6HH 2B2VC 2GA4B 3KBXA 4IALA 2RDGA 3NWTA 2RQXA 1I4RA 2EXDA 4OIKA 1SBBB 3M7NA 4MZ9A 1SNOA 3FDTA 2ENBA 5CV7A 2F0QA 3C2PA 1XNRL 1HRJA 2A73B 2RCNA 4K8IA 3NTIA 5EPJA 1LT6D 1EQRA 3DM3A 3NELA 2F3WA 4ID6A 1NR2A 5KRUA 1STGA 1EFWA 1YZ6A 4GOPA 5FOBB 1EU3A 1E22A 5CGKA 2BA1A 4FVMA 1G2TA 2EDGA 1X65A 1IYVA 4QGUA 2EY1A 2JA8G 1EIGA 4DR7L 4IOAA 3RMHA 5JPNC 4DV4Q 1EWHA 4NPSA 1H95A 3J80L 1GUTA 1IW7D 2RSNA 1YNJD 1EIFA 1VQMA 4BY7B 4KD4A 4IFDH 4DK6C 1MHWC 5T1IA 4K5VA 1GOZA 4GN5A 2D62A 4QB4A 3S1MH 3E9HA 4MNOA 3PMFA 1KNEA 3GTOB 4X66Q 5GQOA 2F0MA 4LF6L 4BY1B 2M00A 4M1UB 1SFOH 1OXXK 5IGFA 5GADC 2LY7A 1XPUA 2BH8A 2XWJB 3TP5A 1X3QA 3EBEA 5M3FG 1N34Q 1XMQL 1VQJA 5IP7G 3TRZA 4OONA 5A2QL 5EAYA 5J3BA 3RN2A 1LTID 3A5UA 1SNDA 2AUKA 1Q46A 2J4XA 3D6CA 4C1NK 1YEZA 1FNUA 3TEHB 4YY3L 2K75A 2RF4A 1G6PA 1XMOL 1IBLL 3M4OH 3GTJH 4WJWA 3CCMA 4JI4Q 3D6WA 1BKBA 3T51B 1UUPA 2KEEA 1WCMB 2QKIC 1LTGD 1CM9A 1TY2A 3SK5A 1M8AA 4DUYQ 2ZM6Q 5ISRA 4Q5VA 5E3FA 3H09A 1J9OA 4OX9L 3A8IE 1D8LA 3NBHA 1JJGA 3URYA 3E9IA 4HIKA 1VMPA 4PNYA 5FK9C 5C4HA 4QIWE 5EKIA 5HY6A 4RHSA 3F2DA 4DNTB 1K83B 3K5MA 1HNWL 2E2HH 2L1BA 3CXCA 3FKIB 4Z9CB 4HIOA 4OO1H 2NUCA 1TWAH 2L11A 5GAEC 4A75A 1LO5D 1F77A 2D5DA 5IGDA 2PZWA 2R7ZG 3BS1A 1Y1WG 4A3GG 1D1KA 2Z4HA 4B3MQ 2XGTA 3D4RA 4X3TA 1WTVA 1I4QA 4KV6A 3STBD 5JJLA 3HP3A 1SE8A 1A3VA 4JI5L 1RTNA 2F0LA 4OIJA 1EYDA 3KLWA 2XIWA 2D0PA 1STHA 4RCOA 3W5OA 1VDZA 2K5HA 1WTQA 1JC7A 1VF5C 1PH1A 1PTOF 3LWUA 4R4QA 2MUYA 4DK0A 1XJVA 3P75A 4O2DA 4DR5L 4BA2I 4JG2A 1G91A 1RL2A 4FXKC 2L12A 2CFMA 3Q23A 4A3DB 3HOXG 1B3QA 2BDNA 2F0NA 3GV6A 2UXCQ 1SE2A 3D8GA 2UXBL 2A69C 5FJ8G 3FPUB 2RKSA 1F9QA 1Q3LA 4ILWA 1PYBA 4KHPL 3S2HB 4KK7A 3FMCA 2QEXA 1I4GA 2XN9C 2MPMA 3S2DH 3MXPA 1LTSD 1CSQA 1STYA 3K7AB 4K5WA 5ELCA 2I0QA 4J15A 2WV6D 2EY6A 2X69A 2CWAA 1JJCB 1AP0A 5L37A 4E6IA 3H3VC 4L63B 2ZXRA 3GTOH 1D5XC 2R61A 1SYEA 1SNQA 1V8QA 1VQHA 2IHEA 3A8KE 4UPAA 5C0XI 4B3TL 4J1MA 1WOCA 2IY5B 4APVA 1HZBA 2AQ3B 2CKZB 3J7AV 2H5XA 3ULPA 2NZ1D 1Y8NB 3AMUA 5HGTA 1PFMA 4JI7Q 1BNZA 2JEAI 3OSOA 1S72A 2BE5C 1JE5A 3WOFA 4UDUC 1D1IA 3K57A 4CJ2C 4AYBG 3T1YQ 2Z6KC 3I7FA 1L0YB 2HHHQ 2LSSA 2G9HD 1F9RA 3NEMA 3RLNA 4C3JG 1X3PA 4OEMB 4R4CA 1HA5A 1WTRA 1B8AA 1LLRD 1OXUA 2UUAQ 5BR8Q 2IPKD 1B44D 1PRTD 4KI0A 2VQEQ 4DGZA 4DUZL 4H13C 3KLSA 3ER0A 1BR9A 2JA6B 3HOWG 1WD1A 1MSHA 5LMUQ 2E5LL 2JA7H 3PF4A 2PQAA 1TR5A 5IODA 2NBFA 5JEAH 1N36L 2J0TD 3IAYA 2DUDA 4JI1L 1O80A 3PIP3 4AYBE 3F8TA 2NZOA 1CA6A 5E4XA 4DV0L 3GP7A 1VQIA 4JBWA 5EQ0A 4OO1I 1K83H 4QIWB 1LTTD 2ID0A 4FF4A 3FKIH 4OXPA 3S16H 3I72A 4ZUIA 3VA7A 1VQOA 5I9OA 1EEID 5C3EG 1BQQT 5E7NA 3FPPA 2L0CA 1WD0A 1PH5A 2F3IA 4QCLA 3CP0A 1I3QB 3JC66 3AEVA 1Q82C 1HZAA 4JW0A 1I4XA 1XTDA 4RGTA 3SVMA 1HTLD 1K9MC 1HUNA 3SR1A 3WWVA 2BDOA 5AFWA 3KFUA 3J81i 4A3LH 3J7AF 4JI2Q 2JK8A 5LMNQ 3HOUB 1SRUA 4BXXH 3CRKC 5JPMC 3K59A 2R93G 4MIUA 1F9SA 1UWVA 5IGBA 2VUMH 1B3AA 3HRZC 1T5EA 2B63G 3CC7A 4HJAA 2OT2A 4JK1C 4ZKBB 4YWKA 5IYBG 1NJIC 4C56C 4HAEA 2CWPA 4DV5Q 2EYJA 3F2UA 3S17B 2R7ZB 1LTBD 2JN4A 4A3GB 2CQAA 3NENA 1HR0L 3E0EA 1SROA 2WACA 2A1AA 4N8X1 2B3GA 4P75A 4A3DH 1K8MA 4IJLA 5M3MG 2F4VQ 2JYOA 1FVIA 5CORA 2ZTCA 1V1OA 5C4JB 2Q8IB 2Y0SG 5ELOA 3EQLC 1XNQL 4XDXA 1PRTB 1PH8A 1B70B 1E2VA 2PO4A 3QB3A 4EVOA 3K58A 1DYQA 3W2DA 1ENFA 2F0HA 3CCEA 1ESRA 3K7AH 3CPWA 2LXJA 1ENAA 3EVQA 1ILPA 3OOCA 3J7ZC 1SXTA 4HN7A 2E75C 4LF8L 3Q24A 3HOXB 3NTKA 1EWCA 1XXGA 1C0AA 3DWAA 1UE1A 3MFYA 4MTKA 4CDFC 4H02A 4RGMA 3VR2A 2ZTDA 2ZTEA 5C4XG 1UEAB 2JA8H 1B9NA 4K5XA 1GO3E 4OL7A 5NUCA 1TWGB 1IBKL 4FF1A 4JOIC 3KK7A 1X3EA 1CKMA 3GTPB 4DV1L 1LACA 4CKBA 1QB5D 5BN4A 1N32L 5TSSA 3VR3A 2TMPA 3BVMA 3TREA 4A3IB 2NWGA 5FO8B 2F0UA 1I6HB 4HCSA 1II3A 4LFAL 1KD1C 2K04A 1GKHA 4ZK9B 1EQVA 1KL9A 1S4ZA 3GV3A 4HTHA 1TWCH 2I46A 3A54A 5KYIA 2MO1A 3P1HA 5D65A 4DR6L 2RSOA 1S3OA 3MC0B 3PUWA 3MXGA 3VA5A 1BXTA 3PIOA 2D9UA 1BCPC 2N3SA 1SYGA 5M3FH 5IP7H 2O4XA 5KNBA 2UUBL 3K6OA 3SEBA 2YU9H 4HSPA 2PZTA 5K5PA 2I5MX 2VB2X 2ZJQA 2EJFC 4JOIA 4KY7A 4L5SA 2FFKB 1LT5D 1VQKA 1X6OA 3MWYW 4AYBB 2HCCA 1PH6A 3G71A 3MHBA 4KTAA 4TSSA 1CKNB 1EOTA 3GD7A 3HOZG 4FO2A 5KYLA 2I07B 4K0KQ 3D31A 1QJOA 1T5XD 1I3QH 3EN2A 4HSVA 1Y14B 3KBGA 4R8NA 5IWAQ 2A6EC 1X3FA 3UE1A 2F0FA 4C2MH 3T16A 4BBSG 1B1ZA 3PCOB 2K28A 4CDEC 5EKLA 2Q2UA 1JCKB 1PV4A 4LUZA 4L8JA 2RHSB 1CHPD 4DR2Q 3MEHA 1X32A 1YNNC 3GDEA 1DOMA 1ML0D 1J8IA 1TS2A 3I91A 1SFOB 4YCUA 2SDFA 4NXNQ 2DJFC 4GOPB 2R6GA 1TU2B 5C3EB 3PO3G 1TWHH 1QE6A 1UEBA 1VF7A 2KOLA 1ICWA 3DWPA 5CV4A 2NVTH 2VNUD 2DN8A 2R7ZH 3ZYYX 4YWMA 1Y1WH 4A3GH 4AIMA 1YJ9A 3I73A 1E2ZA 2AMCB 2EYMA 4CGYB 4K2LA 5IYCG 1GHKA 3RD4A 4K2KA 1HFNA 2VQFQ 4UAIA 3M4OB 4A3CG 3J80E 3GTJB 2ES2A 1MBYA 3DMUA 1HH2P 4R4OA 2SOBA 1YI2A 4LF4L 4EX5A 5C4JH 2E74C 4J6HA 4OWTB 2K33A 2B2YC 1EZ8A 1WTOA 2KCTA 4JBJA 4NMZA 1KDBA 4ULLA 1SMYC 4CDDC 3TBIB 4IOCA 5C5MA 4PMBA 2SNSA 1DONA 1PFNA 3HS0C 1N34L 2Z9HA 1RKNA 5A35A 3HOXH 2E2HB 5IY0A 5IGEA 5M3MB 4DU9A 2UU9Q 5IGCA 2IX1A 3HKSA 5FJ8H 1TWAB 1DXMA 2O2LD 2RVLA 2F0OA 3ND8A 1ET6A 2I5HA 2E8GA 1B50A 1M1KC 1CZWA 1VQBA 4ZUJA 4IUUA 3W1BA 3CCQA 1E7ZA 3ITPA 4LF5L 3UE0A 3GTPH 1C9OA 2OEOA 2R3ZA 2B2YA 2IHFA 1HNXQ 2OXPA 3TMEA 3VYRA 3I56A 2RDHA 3MTSA 2UUCL 1KIXA 1PYWD 3BG3A 3PUVA 5FLXL 2YTXA 3NBHB 3U9OA 4DUYL 4X65Q 1TQOA 4C3HG 2MJ8A 1BBXC 4A3EG 5DNFA 1PZKD 1K3RA 3JAMc 2KCMA 2F0VA 3T56B 2LS01 4CDCC 4X3KA 3L9AX 2YV5A 2A69D 4X62Q 2DNEA 2KHIA 3HEJA 2KECA 2WB1G 1QILA 3G48A 2K14A 4FXDA 3DHQA 2JQOA 1KDAA 1SE3A 1SYDA 4YHHL 2ATWA 1RF2D 2EYOA 1EYCA 1F9PA 1A8VA 4HMJA 5COYA 3I3CA 1QWYA 1I94L 5JJZA 4DR3Q 3I4NG 3L3OC 2B2VA 2WAQG 4C3JH 2MNAA 4NXML 1IL8A 1G291 3S14H 4JI8L 4R8IA 3D0FA 1DGSA 3PO2G 1O7ZA 2ALYB 2KENA 4B3ML 2K52A 3J7YW 4GKJQ 4JI6Q 5GAGC 1SJED 3QIAA 3S2DB 3GQBA 5G3LF 3HOWH 1EOVA 4IUQA 1LTAD 2O5JC 4XQQA 2B2UC 4LUVA 4LUOA 1PH9A 1HZCA 3CC2A 2VY3A 1Q12A 1YJNA 1C7YA 3MXNA 4TRDA 1Y69U 3CC4A 4LF7Q 3NQIA 2F0JA 2BE5D 3DEOA 4B3SQ 1EZ6A 5EPKA 4DR1Q 3OHXC 3HOZB 1GVPA 3I4OA 5C3EH 1GM5A 1IXRA 1S5BD 2YTVA 4MHEA 4P74A 5C0XJ 1S5ED 1KABA 2CQOA 2PI2A 4IUVA 4KLKA 4BBSB 1EY6A 1HA6A 4R9WA 3LNNA 3KUPA 4H0LC 1MI2A 2KUMA 3T4AC 2H4OA 2NYZD 1K8GA 2B2UA 1R9TH 1L1OC 5KGUA 4YCVA 2R93H 4HJ5A 4LAAA 2ZJRA 1DD2A 1MIUA 3UDXA 1V1QA 2NVQB 4A3KH 4JYAL 1VCIA
chains in the Genus database with same CATH topology
1UAPA 3KLSX 2JA7B 1KNAA 2IX0A 1GUSA 2BA0A 2K5WA 1EY0A 1GUWA 3KF8A 2FINB 1I6VC 2EY2A 1PTOC 3D4DA 3OWEB 4H44C 2A68C 2ZXOA 3S16B 2KA7A 3CKIB 5FO9B 1U4RA 4C3IG 4IUPA 2NB0A 1AW7A 3QO2A 4DN4M 2IW3A 4DK1A 1AEXA 1GUOA 3EROA 4OGQC 1A6XA 2HUGA 4V190 4K6DA 3IFTA 4B9XA 2A74C 2DY7A 4K6LA 5D3DA 2O5IC 4DF7A 3S9WA 1F2LA 3PUZA 1JE4A 2K1BA 2VUMB 3E6ZX 4Q0FA 3SDZA 4CHTB 3DWQA 2HQEA 1D6EC 1IKLA 2C5CA 1OO9B 2EE1A 3RZDB 2X6LA 1EY5A 5KIXA 3FRPB 3N6RA 3LWEA 2X6GA 4ME5A 1WTXA 1XX8A 1DJRD 2PPBC 2B2WC 1UNSA 4IFDI 1DM0B 4BA1I 2QILA 3OIPA 3TN2A 2WB1B 3P20A 4NW2A 1TS5A 2WINB 3NP8A 2CHBD 4F7XA 1JORA 3R2TA 2JA8B 3QOJA 5IT9E 5K36G 3DXJC 2VXWA 3V96A 4XYOA 1HQRD 4X3UA 1A3UA 1YNJC 2B2WA 2RBMA 1BCPD 4DAYA 5ELDA 3V2TA 3C1EA 3I90A 1TWCB 2CVRA 4G4KA 5DEHA 1C8CA 5J22A 4RFBA 2IL8A 4QF4A 1NAPA 1G8ZD 2M2LA 3OMCA 5M3FB 5BN3A 1ZKOA 3PV0A 4LJZC 2YU9B 1B53A 3Q22A 1S5CD 4LK1C 1SNCA 4XIGS 4X3SA 2K5QA 5DAUA 3TP8A 1HUMA 1SSOA 3CHBD 2NN6G 5KNDA 1XWEA 3J81L 1K8OA 2Z8LA 1YNND 4I7ZC 2F3VA 2FMMA 2KHSA 5E4WC 2E76C 4C2MB 2K03A 1STBA 4RH6A 2F0IA 2Q8RE 4FXGC 2F0KA 5KNCA 2A6HC 1OXTA 2N55A 3D3RA 5C0XG 3TP6A 3NPPA 2F0WA 4KMUC 2G9DA 4CKEA 3LX0A 2D2CC 1EIHA 3ND9A 2DNCA 2KJXA 4KY5A 1TWHB 2F1MA 1ONLA 2AUJD 2NVTB 2TSSA 5IT9L 1Y1WB 4F88A 2SEBD 4CBVA 2EJMA 2EOTA 3MXUA 5I4DA 1JR0D 1BCPB 3HGBA 1EY4A 5JVH3 1SMYD 4PMWA 2QDBA 1IHZA 2RDFA 3ERQA 4V0BA 3Q6SA 1JB3A 5I6YA 1IKMA 3DUZA 5CV6A 4O1NA 5C5LA 1BUVT 2E2DC 1Z6HA 1O78A 4QMGA 1EU4A 4KHZA 3SK6A 1NUCA 3NSWA 4HR7B 1EL0A 2Q8TA 3R2IA 5HURA 2EVBA 1V43A 3M4YA 4XQJA 3CQZB 5ELFA 4PQXA 4ZLTF 1D5ZC 1H9MA 2JP1A 2AQ2B 1BF4A 1RTOA 4N9PA 1ZXTA 3I8ZA 1SYFA 4KJOA 2Z1CA 1JOQA 4EQOA 3HOVB 5JOBA 1STAA 3I70A 2XNAC 3M85A 1M4VA 1I4PA 1PLFA 1TVXA 4KY6A 3D4WA 4RA8A 4MN3A 3R8BA 1XTCD 1A15A 1QNUA 3K5NA 1BO0A 3C3LA 5KEEA 5EKKA 4DAPA 4K14A 2B39A 1CTMA 1G6ZA 1MGSA 4S3SA 3O13A 1RD9D 4C3JB 3S14B 2XSCA 1JOOA 1JICA 2IWHA 4DA2A 2WP8J 5I6WA 3HOWB 2AWOA 2EZVA 5BN5A 4A3JB 3M7GA 5FLXE 1L0XB 3NE5B 1GUGA 1ESFA 1DZ1A 3MAQA 4KN7C 1FNVA 1FYCA 1LT4D 2A5HA 1CQFA 4EQPA 2MP1A 1XYIA 1H9KA 4DXGA 4ZAIA 1AZPA 5D3IB 4Y7NB 3IFDA 4A3FB 2XWBB 3SE0A 1PRTF 1H9RA 5FO7B 1R9TB 1BOSA 2HDLA 3MVVA 5D14A 3G6JB 2R93B 1U4MA 1DOLA 5LL6S 2B2TC 1CI3M 4A3KB 2K01A 1I4HA 2PW7A 4KKTA 2B63B 1KAAA 4H7BA 2XRQD 2NVYB 4ZYSA 4U673 1PTOD 3TZDA 2A68D 2EY5A 4IZ8A 3SK8A 1CT1D 2PNRC 1CK1A 1KDCA 4EQNA 1GHJA 2H1EA 1A2UA 3BDLA 4XTCS 5F2DA 3OPOA 3K5OA 2LMCB 3GTKB 3S1NB 3VYSA 2Y0SB 2PMZB 2EYLA 1S5FD 3EJIA 3T53B 4F87A 3BYTB 1EFID 2B2TA 2F03A 1EYAA 4KKSA 1MSGA 1F2YA 2PW5A 1O7YA 3HOYB 1F2ZA 3FVQA 3A7AB 3OWFA 2NVXB 3N52A 2WIIB 4WFN3 1SDFA 1Z47A 5C4XB 1W6JA 3VYTA 3GTLB 4DAVA 1A2TA 3NUCA 5K36H 3QWNA 3V05A 3BZDB 1NR4A 4CKCA 1B2TA 4K8JA 1Z7TA 1OXSC 2XVSA 3P7JA 4IN3A 4HCEA 2IJ0A 2ICIA 3DM1A 5CV5A 4BWGB 4C1NI 1BDOA 1QNKA 5IIFA 5I2YA 3S15B 2V4DA 4RKBA 2IX3A 1PXUA 1Q90A 5CBAE 2OF1A 4ABNA 2JEBI 1LABA 2RA4A 3MFGA 1PTOB 3T13A 5CV8A 2FHTA 2CW0C 4IFDJ 1ET9A 1H9SA 2WKDA 3QOLA 4LMQD 3NTHA 2EPBA 2NN6H 1TS3A 5IGGA 2E2JB 1RDPD 3W3AA 1LV9A 2NTTA 1STEA 2F0EA 2AWNA 5C0XH 1TIID 3VR6A 4G7HC 3GTGB 3H6MA 4RCNA 1S5DD 1TY0A 2AQ1B 3GTQB 1MD2D 1SJHD 2KVMA 4ZQ3A 4WRDA 3PO3B 2PYKA 1U9RA 5C4ZA 3BVZA 4M8AA 1HCZA 1PZJD 5J1ZA 1PZID 1QOHA 3GTMB 3SK4A 2NTSA 4XT1B 5CR3A 4U68A 1EY7A 4PV1C 1V1PA 3R93A 3SXHA 3SHLA 2HDMA 2A6HD 3U9SA 1HHVA 3TZUA 1RJTA 4FP5D 1G2SA 4KJNA 2F0SA 3FEWX 1RODA 4TQUS 4WORA 2L55A 4KKUA 2QCPX 2M9VA 2EXZA 1QCBD 1TWFB 4O42A 3RLFA 2F0DA 3M3YB 4FYDA 2JA5B 1WVLA 2PZUA 3C1FA 2EJGC 2Z4IA 2ZXPA 3HG9A 2JXMB 4PMCA 4RKLA 5EJWA 5EBDA 1B9MA 4KN4C 5FKAC 5ELBA 2KEDA 1ZYRC 4RAUC 3MZ5A 4XQNA 1SE4A 3KLRA 5M9OA 1IYUA 4I65A 3J81E 1OXVA 2LFNA 1Q1EA 4BBRB 3S1RB 4NDXA 1WTPA 1Q1BA 4C3HB 4A3EB 2L5TA 1FD7D 1EY9A 4G7OC 3I4LA 2B8GA 4IUTA 3VYUA 2JE6I 1PTOH 1ZEQX 4P2CB 1KLGD 5I2XA 2MGSA 5EBCA 3CU7A 1CZGA 2NN6I 3I4NB 4FF3A 2WAQB 2BCOA 4DNRB 1R4PB 3PO2B 2KCNA 3JAME 2N88A 3UI2A 2K7VA 1IW7C 4TKOB 1U4LA 5CYUA 3K0YA 5JVG3 2F0TA 1AZQA 2EYHA 3NXWA 2K5DA 2PCFB 5T1GA 2MHVA 1O7LA 1R4QB 1LT3D 4IURA 2PQEA 4IQZA 2J7ZA 3C46A 1AN8A 3IL8A 4B9WA 5JEAJ 1ILQA 3EA6A 4HEDA 5I9PA 2F0GA 3X3NA 2A6ED 3AU7A 4IFDG 3A55A 4HMIA 1HQMC 2FMCA 3BDOA 3H91A 2JSOA 1GXDC 4BS9A 4N9TA 1TS4A 1Y1VB 2IT1A 4NKLA 2QEJC 2DY8A 4CJ1B 3GO5A 5M5YB 1CQVA 1AFPA 3QG1A 5E1FA 5C44B 3E0JA 2EYPA 5CBEE 1KTKA 1ENCA 1TT2A 1C4QA 4RGOS 4C3IB 4F8MA 2L4NA 4XXEA 5LL6X 1E0BA 3ONAB 3L7ZC 1DOKA 5JAVA 5M5WB 3JAML 3TDQA 3NQTA 1Y8PB 3K5LA 3OIQA 1SNPA 1KLUD 3A8JE 4KD3A 3MA2B 5J39A 4KHVA 1HTPA 4XYQA 1EY8A 3VR5A 5ELEA 3TP7A 5M5XB 1STNA 4YIJA 3RZOB 2L9HA 4OO1G 1I50B 3OMGA 1FNWA 3G7LA 3OW7A 1Q8IA 4FNFA 1CA5A 2F4IA 3A56A 3Q0AA 3BYYB 4ZRZA 1NCVA 2KCCA 5G3LD 2YYZA 4RWSC 4A3MB 2XRSD 2K05A 4A93B 4RGNA 1LTRD 3PIO3 1GUNA 1CFMA 2ZT9C 3NWSA 1EQTA 3WDNA 4ZKCB 2WKCA 2B8FA 1GJXA 3R3OA 1CHQD 4FF2A 1DCZA 3NBIA 1B4OA 3E5SA 4NP5A 1H9JA 1JWUD 1JOKA 2CW0D 5DM63 4L6TB 3BDCA 4QUFA 1FR3A 1PRTC 3RUZA 1SYBA 2K6AA 1HFGA 1JWSD 2VB3X 4GZYC 1RHPA 1PMRA 5C3WA 1F2MA 4A3BB 2SNMA 5CV9A 5IOCA 2KQ3A 3PUXA 3QJYA 3S1QB 4XT3B 2HCIA 1SYCA 1JQYD 5EPLA 5LHY1 4RHRA 3S1MB 1BCPF 3HKZB 2R92B 3TSSA 2FJ2A 3HZXA 1EEFD 4OHJA 3CRLC 3A7LA 3H94A 2QF7A 1JWMD 4B08A 1SNMA 5DM73 1WTWA 1FGBD 3DEPA 5JEAG 1D2BA 1E2WA 1TKWB 5C6AA 3AB9A 3X3MA 1H9SB 3BVGA 1NSNS 1HPCA 3VR4A 1A3TA 1U4PA 4G57A 1Y8OB 3WOEA 4DXFA 1W6KA 2LKVA 3NHHA 3EFXD 1VMCA 3NK9A 2ICEC 2EYFA 5EGTA 4IUNA 3H0GB 2C9OA 1PDQA 3PUYA 1C48A 1RCVD 3IKJA 4EGVA 2BOSA 5A2QE 4CJ0B 5CMDA 1PFBA 1QG7A 4DFAA 4ODGA 4G7ZC 1SAPA 5C3XA 5CC4A 1SEBD 3I4MB 4QUCA 2K32A 2E2IB 1ZYRD 2F0PA 1V1PB 4J8QA 1D5MC 1HXYD 2B2VC 2GA4B 3KBXA 4IALA 2RDGA 3NWTA 2RQXA 1I4RA 4OIKA 1SBBB 3M7NA 1SNOA 3FDTA 2ENBA 5CV7A 2F0QA 3C2PA 1HRJA 2A73B 4K8IA 3NTIA 5EPJA 1LT6D 2F3WA 4ID6A 1NR2A 5KRUA 1STGA 5FOBB 1EU3A 5CGKA 2BA1A 4FVMA 1G2TA 2EDGA 1IYVA 2EY1A 1EIGA 3RMHA 5JPNC 1EWHA 3J80L 1GUTA 1IW7D 2RSNA 1YNJD 4BY7B 4KD4A 4IFDH 5T1IA 4K5VA 1GOZA 2D62A 4QB4A 3PMFA 1KNEA 3GTOB 2F0MA 4BY1B 2M00A 4M1UB 1OXXK 5IGFA 2LY7A 2XWJB 3TP5A 1X3QA 5A2QL 1LTID 1SNDA 2AUKA 2J4XA 3D6CA 4C1NK 1FNUA 4WJWA 3D6WA 3T51B 1UUPA 2KEEA 1WCMB 2QKIC 1LTGD 1CM9A 1TY2A 3SK5A 1M8AA 5ISRA 4Q5VA 5E3FA 3H09A 1J9OA 3A8IE 3NBHA 3URYA 1VMPA 4PNYA 5FK9C 5C4HA 5EKIA 4RHSA 4DNTB 1K83B 3K5MA 2L1BA 3FKIB 4Z9CB 4OO1H 2NUCA 2L11A 1LO5D 1F77A 2D5DA 5IGDA 2PZWA 3BS1A 1D1KA 2Z4HA 3D4RA 4X3TA 1WTVA 1I4QA 4KV6A 3HP3A 1A3VA 1RTNA 2F0LA 4OIJA 1EYDA 2XIWA 4RCOA 1STHA 1VDZA 1WTQA 1JC7A 1VF5C 1PTOF 3LWUA 2MUYA 4DK0A 3P75A 4BA2I 1G91A 4FXKC 2L12A 3Q23A 4A3DB 2BDNA 2F0NA 3GV6A 1SE2A 3D8GA 2A69C 3FPUB 2RKSA 1F9QA 1Q3LA 4ILWA 3S2HB 4KK7A 3FMCA 1I4GA 2XN9C 2MPMA 3MXPA 1LTSD 1STYA 3K7AB 4K5WA 5ELCA 2WV6D 2EY6A 2X69A 1AP0A 4E6IA 3H3VC 4L63B 2ZXRA 1D5XC 2R61A 1SYEA 1SNQA 1V8QA 3A8KE 5C0XI 4J1MA 2AQ3B 3J7AV 2NZ1D 1Y8NB 3AMUA 5HGTA 1PFMA 1BNZA 2JEAI 3OSOA 2BE5C 3WOFA 4UDUC 1D1IA 3K57A 4CJ2C 1L0YB 2G9HD 1F9RA 4C3JG 1X3PA 1HA5A 1WTRA 1LLRD 1OXUA 2IPKD 1B44D 1PRTD 4KI0A 4DGZA 4H13C 3KLSA 2JA6B 1BR9A 1WD1A 1MSHA 1TR5A 5IODA 2NBFA 5JEAH 2J0TD 3IAYA 1O80A 3PIP3 1CA6A 5E4XA 3GP7A 4JBWA 4OO1I 5EQ0A 4QIWB 1LTTD 2ID0A 4FF4A 3I72A 4ZUIA 3VA7A 5I9OA 1EEID 1BQQT 3FPPA 2L0CA 1WD0A 4QCLA 1I3QB 1I4XA 4RGTA 3SVMA 1HTLD 1HUNA 3SR1A 2BDOA 5AFWA 3J7AF 3HOUB 3CRKC 5JPMC 3K59A 4MIUA 1F9SA 5IGBA 1B3AA 3HRZC 1T5EA 2OT2A 4JK1C 4ZKBB 4C56C 4HAEA 2EYJA 3F2UA 3S17B 2R7ZB 1LTBD 4A3GB 2CQAA 2WACA 1K8MA 2JYOA 5CORA 1V1OA 5C4JB 2Q8IB 3EQLC 4XDXA 1PRTB 1E2VA 2PO4A 3QB3A 4EVOA 3K58A 1DYQA 3W2DA 1ENFA 2F0HA 1ESRA 1ENAA 3EVQA 1ILPA 3OOCA 1SXTA 4HN7A 2E75C 3Q24A 3HOXB 3NTKA 1EWCA 1XXGA 3DWAA 3MFYA 4RGMA 3VR2A 1UEAB 1B9NA 4K5XA 4OL7A 5NUCA 1TWGB 4FF1A 3KK7A 3GTPB 5BN4A 1LACA 1QB5D 4CKBA 5TSSA 3VR3A 2TMPA 3BVMA 4A3IB 2NWGA 5FO8B 2F0UA 1I6HB 4HCSA 1II3A 2K04A 4ZK9B 1EQVA 1S4ZA 3GV3A 4HTHA 2I46A 3A54A 5KYIA 3P1HA 5D65A 2RSOA 3MC0B 3PUWA 3MXGA 3VA5A 1BXTA 2D9UA 1BCPC 1SYGA 2O4XA 5KNBA 3K6OA 3SEBA 4HSPA 2PZTA 5K5PA 2VB2X 2EJFC 4KY7A 2FFKB 1LT5D 3MWYW 4AYBB 2HCCA 3MHBA 4KTAA 4TSSA 1EOTA 3GD7A 4FO2A 5KYLA 2I07B 3D31A 1QJOA 1T5XD 4HSVA 3KBGA 4R8NA 2A6EC 2F0FA 3T16A 1B1ZA 2K28A 5EKLA 1JCKB 4L8JA 1CHPD 3MEHA 1X32A 1YNNC 1DOMA 1ML0D 1J8IA 1TS2A 3I91A 1SFOB 2SDFA 2R6GA 1TU2B 5C3EB 1QE6A 1VF7A 2KOLA 1ICWA 3DWPA 5CV4A 2VNUD 2DN8A 3ZYYX 3I73A 4CGYB 1E2ZA 2EYMA 1GHKA 4K2LA 1HFNA 3RD4A 4K2KA 4UAIA 3M4OB 3J80E 3GTJB 1MBYA 3DMUA 2SOBA 2E74C 4J6HA 2K33A 2B2YC 1EZ8A 1WTOA 4NMZA 1KDBA 4ULLA 1SMYC 3TBIB 5C5MA 4PMBA 2SNSA 1DONA 1PFNA 3HS0C 1RKNA 5A35A 2E2HB 5IGEA 5M3MB 4DU9A 2IX1A 5IGCA 1TWAB 1DXMA 2O2LD 2RVLA 2F0OA 1ET6A 3ND8A 1B50A 1CZWA 4ZUJA 4IUUA 3ITPA 2OEOA 2R3ZA 2B2YA 2OXPA 3TMEA 3VYRA 2RDHA 3MTSA 1PYWD 3BG3A 3PUVA 5FLXL 3U9OA 1TQOA 4C3HG 2MJ8A 1BBXC 5DNFA 1PZKD 2F0VA 3T56B 2LS01 4X3KA 3L9AX 2A69D 2DNEA 3HEJA 2KECA 1QILA 4FXDA 3DHQA 1KDAA 1SE3A 1SYDA 1RF2D 2EYOA 1EYCA 1F9PA 4HMJA 5COYA 3I3CA 1QWYA 5JJZA 3L3OC 2B2VA 1IL8A 1G291 4R8IA 1O7ZA 3J7YW 1SJED 3QIAA 3S2DB 3GQBA 5G3LF 4IUQA 1LTAD 2O5JC 4XQQA 2B2UC 1Q12A 3MXNA 4TRDA 1Y69U 3NQIA 2F0JA 2BE5D 3DEOA 1EZ6A 5EPKA 3OHXC 3HOZB 1S5BD 4MHEA 5C0XJ 1S5ED 1KABA 4IUVA 4BBSB 1EY6A 1HA6A 4R9WA 3LNNA 3KUPA 4H0LC 1MI2A 2KUMA 3T4AC 2H4OA 2NYZD 2B2UA 5KGUA 4LAAA 1DD2A 2NVQB 1VCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RWS C;  4NW2 A;  1EIH A;  4CJ2 C;  1KNA A;  3H91 A;  2K28 A;  1G2T A;  1LV9 A;  2MJ8 A;  4XDX A;  1BBX C;  2K05 A;  5DNF A;  1G6Z A;  1F9R A;  1EIG A;  1WTP A;  1X3P A;  1MGS A;  1U4P A;  1X32 A;  1GUW A;  1WTR A;  2FIN B;  1DOM A;  1ESR A;  4X3T A;  1WTV A;  1ML0 D;  2DY8 A;  1J8I A;  3I91 A;  4CJ1 B;  2B2T A;  4X3K A;  2SDF A;  1ILP A;  3HP3 A;  2RSN A;  4IUT A;  2EOT A;  2KEC A;  2VXW A;  1MSG A;  1RTN A;  1WD1 A;  1JIC A;  1MSH A;  4OIJ A;  5T1I A;  1O7Y A;  1EQT A;  2XIW A;  5CBE E;  1U4R A;  1QE6 A;  4X3U A;  1VMC A;  2B2W A;  2KOL A;  4ZKC B;  4IUP A;  1F9P A;  2KVM A;  1ICW A;  1KNE A;  5COY A;  3I3C A;  1WTQ A;  3QO2 A;  3Q6S A;  4DN4 M;  1O80 A;  5JJZ A;  2L4N A;  2MGS A;  3N52 A;  1IKM A;  2B2V A;  1E0B A;  3ONA B;  1CA6 A;  1SDF A;  5E4X A;  1IL8 A;  2HUG A;  3I90 A;  1DOK A;  2CVR A;  1HFN A;  1B4O A;  5EQ0 A;  4R8I A;  1C8C A;  1DZ1 A;  1O7Z A;  4UAI A;  1X3Q A;  2IL8 A;  1PDQ A;  4XT1 B;  4U68 A;  1G91 A;  2DY7 A;  2L12 A;  3R93 A;  1NAP A;  2M2L A;  4IUQ A;  2BDN A;  1NR4 A;  4QUF A;  1WD0 A;  2NWG A;  1B2T A;  4CJ0 B;  1EL0 A;  2HDM A;  3GV6 A;  5CMD A;  1PFB A;  2MP1 A;  1QG7 A;  4HCS A;  2N88 A;  1F2L A;  2B2Y C;  2Q8T A;  3UI2 A;  2B2U C;  1XYI A;  1JE4 A;  2K1B A;  2K04 A;  3FPU B;  1B53 A;  1HHV A;  3P7J A;  4ZK9 B;  1F9Q A;  1SAP A;  1RJT A;  1Q3L A;  3SVM A;  1S4Z A;  3GV3 A;  1WTO A;  4ZLT F;  4ZAI A;  1HUN A;  1G2S A;  1U4L A;  3DM1 A;  1AZP A;  1HFG A;  3IFD A;  4QUC A;  2JP1 A;  5D65 A;  5AFW A;  1AZQ A;  1RHP A;  1BF4 A;  1IKL A;  1QNK A;  1RTO A;  2RSO A;  3DEO A;  1ZXT A;  2MPM A;  2EE1 A;  4X3S A;  1ROD A;  5T1G A;  3D6W A;  3I8Z A;  2D9U A;  5EPK A;  1DON A;  1PFN A;  2B2V C;  3KBX A;  2X6L A;  4O42 A;  2KEE A;  1F9S A;  1HUM A;  1SSO A;  2HDL A;  2X69 A;  5D14 A;  1CM9 A;  2L9H A;  5CBA E;  1AP0 A;  1M8A A;  4IUR A;  4MHE A;  4XT3 B;  1U4M A;  1DOL A;  3G7L A;  1B3A A;  2RA4 A;  2HCI A;  4OIK A;  2B2T C;  5EPL A;  1WVL A;  2FFK B;  2FHT A;  2K01 A;  3FDT A;  2FMM A;  2J7Z A;  2RVL A;  5E4W C;  1J9O A;  4IUV A;  4ZKB B;  3MWY W;  2HCC A;  4HAE A;  1B50 A;  1PLF A;  1TVX A;  2K03 A;  3LWE A;  2Q8R E;  2X6G A;  3TZD A;  4R9W A;  1HA6 A;  1WTX A;  3IL8 A;  4IUU A;  1HRJ A;  3F2U A;  3KUP A;  1MI2 A;  1EOT A;  1ILQ A;  1XX8 A;  2KUM A;  2N55 A;  1CA5 A;  1VMP A;  2B2W C;  2FJ2 A;  2B2Y A;  2NYZ D;  2R3Z A;  2B2U A;  4HED A;  4RA8 A;  5EPJ A;  4LMQ D;  5EKI A;  2NZ1 D;  4MN3 A;  5EJW A;  2EPB A;  2L1B A;  1A15 A;  1NCV A;  1PFM A;  3MTS A;  2KED A;  2H1E A;  1BNZ A;  3TN2 A;  2JYO A;  1BO0 A;  4HSV A;  1NR2 A;  4RAU C;  5COR A;  2L11 A;  1WTW A;  3DEP A; 
#chains in the Genus database with same CATH topology
 1UAP A;  3KLS X;  4IO9 A;  2B63 H;  2JA7 B;  1KNA A;  2IX0 A;  2NVY H;  4LF9 Q;  3KDF B;  1GUS A;  2BA0 A;  5IYB H;  2K5W A;  1EY0 A;  1KRS A;  1GUW A;  4B3R L;  3KF8 A;  2FIN B;  1I6V C;  1KRT A;  3RNU A;  1K0S A;  2EY2 A;  5FLM G;  3OYY A;  1PTO C;  3D4D A;  4GNX C;  3OWE B;  1YBY A;  4H44 C;  2A68 C;  2ZXO A;  4LFC L;  5M3M H;  3KJP A;  3S16 B;  5AJ3 L;  2KA7 A;  3CKI B;  3L0O A;  4JI7 L;  3W1G A;  5FO9 B;  3GTK H;  1U4R A;  4C3I G;  1NBW A;  4IUP A;  1X54 A;  1IBM L;  1L1O A;  4GKK L;  2NB0 A;  1NNX A;  4DV2 L;  3T1Y L;  1AW7 A;  3QO2 A;  4DN4 M;  4GN3 B;  1QVG A;  2IW3 A;  4LNQ A;  4DK1 A;  4JV5 Q;  1AEX A;  1GUO A;  3ERO A;  2D0O A;  4OGQ C;  3PQI A;  1A6X A;  2HUG A;  4V19 0;  4K6D A;  3IFT A;  4B9X A;  1WYD A;  2A74 C;  2WFW A;  2PQA B;  2VQE L;  2DY7 A;  4K6L A;  5D3D A;  1FJG Q;  4JBM A;  2O5I C;  2R7F A;  1YIT A;  4DF7 A;  5LMU L;  3S9W A;  1HR0 W;  1F2L A;  3PUZ A;  1JE4 A;  2K1B A;  2R7D A;  2VUM B;  3E6Z X;  4Q0F A;  3SDZ A;  4CHT B;  3DWQ A;  5C4X H;  4GNX A;  2HQE A;  3GTL H;  5GAH C;  1D6E C;  1IKL A;  4AQY L;  2C5C A;  1E24 A;  1OO9 B;  2EE1 A;  1LTL A;  4A76 A;  3RZD B;  2X6L A;  2I5L X;  1AE2 A;  3CPF A;  4RMF A;  5DLQ E;  3M4P A;  1EY5 A;  1MJC A;  2Z0S A;  1Z9F A;  4LW1 A;  1XPR A;  5KIX A;  2OWO A;  2VL6 A;  3FRP B;  4IPH A;  2CH4 W;  5JJI A;  3N6R A;  1KQS A;  3LWE A;  2X6G A;  4ME5 A;  1WTX A;  3S15 H;  1XX8 A;  1DJR D;  1XMQ Q;  2PPB C;  2B2W C;  1UNS A;  2VW9 A;  4IFD I;  4GS3 A;  3CCL A;  3HOV G;  5LMN L;  1DM0 B;  4BA1 I;  2QIL A;  3OIP A;  2UXD Q;  3TN2 A;  2WB1 B;  3P20 A;  4NW2 A;  1TS5 A;  2OQK A;  4YY3 Q;  2WIN B;  3NP8 A;  2MQH A;  3LGJ A;  1CUK A;  2CHB D;  1IBL Q;  4A93 G;  4PZ6 A;  4F7X A;  1JOR A;  3CCR A;  3R2T A;  4DV5 L;  3KDF A;  2JA8 B;  3VDY A;  3BZC A;  1FL0 A;  3U4V A;  3HOZ H;  1VQD A;  3QOJ A;  5IT9 E;  4DV7 L;  5K36 G;  2HIX A;  3DXJ C;  2VXW A;  3V96 A;  2ZJP A;  2E2J H;  4XYO A;  1HQR D;  1PA6 A;  4X3U A;  4DV6 L;  4OX9 Q;  1A3U A;  1YNJ C;  2B2W A;  2RBM A;  4BBS H;  3BJU A;  1BCP D;  4DAY A;  5ELD A;  3V2T A;  3C1E A;  3UDI A;  1EQQ A;  3I90 A;  1TWC B;  2CVR A;  1P16 A;  4G4K A;  5DEH A;  1C8C A;  2BH2 A;  5J22 A;  4RFB A;  2IL8 A;  4QF4 A;  3GTQ H;  2NVQ H;  2HQL A;  1NAP A;  1G8Z D;  2M2L A;  3OMC A;  4LFB Q;  5M3F B;  5BN3 A;  2GVA A;  1ZKO A;  2VZA A;  1QZH A;  4A3J G;  3PV0 A;  3PO3 H;  4LJZ C;  2YU9 B;  1B53 A;  3Q22 A;  1EYG A;  1S5C D;  2LXK A;  4LK1 C;  4A3B G;  5IYC H;  1SNC A;  4XIG S;  4X3S A;  4JI5 Q;  4P72 A;  3TS0 A;  1YHA A;  3UDG A;  4A3C H;  4L5R C;  2K5Q A;  5DAU A;  1CSP A;  2Z6K A;  1YJW A;  3TP8 A;  1HUM A;  1SSO A;  3HFZ B;  3CHB D;  4X64 L;  2NN6 G;  5KND A;  1XWE A;  3J81 L;  1K8O A;  2Z8L A;  1YNN D;  3AFQ A;  3KYH C;  3H3V H;  4I7Z C;  1SLJ A;  2F3V A;  2FMM A;  2KHS A;  3B6Y A;  5E4W C;  3HKZ G;  3RLO A;  3J80 c;  2E76 C;  4C2M B;  2K03 A;  1STB A;  2R92 G;  4RH6 A;  2F0I A;  2Q8R E;  4A3F G;  2EQS A;  4FXG C;  2F0K A;  5KNC A;  2A6H C;  4DR5 Q;  1OXT A;  2N55 A;  3D3R A;  5C0X G;  1T9H A;  1HJP A;  3TP6 A;  3CAM A;  2GN5 A;  3NPP A;  3M3Y H;  2F0W A;  4KMU C;  2G9D A;  4CKE A;  2K4K A;  3LX0 A;  2D2C C;  4A3K G;  1EIH A;  3ND9 A;  2DNC A;  2KJX A;  4KY5 A;  1TWH B;  4KHP Q;  2F1M A;  3CCS A;  1ONL A;  1JJ2 A;  2MO0 A;  2AUJ D;  3T1H Q;  2NVT B;  2TSS A;  5IT9 L;  1Y1W B;  4F88 A;  3RZD H;  2SEB D;  3A74 A;  4CBV A;  2EJM A;  2EOT A;  3MXU A;  3F1Z A;  2Q2T A;  4DPG A;  5I4D A;  1JR0 D;  1BCP B;  3HGB A;  1EY4 A;  5JVH 3;  1XPO A;  1SMY D;  4PMW A;  2QDB A;  1IHZ A;  1VQC A;  5IWA L;  2RDF A;  4C3H H;  2JJQ A;  3ERQ A;  4V0B A;  1VQG A;  3Q6S A;  4R4T A;  4A3E H;  1JB3 A;  5I6Y A;  3H0G G;  1IKM A;  3JAM i;  4POF A;  4MTN A;  3DUZ A;  2K50 A;  5CV6 A;  4O1N A;  5C5L A;  2L15 A;  1BUV T;  2E2D C;  1Z6H A;  1O78 A;  1M90 C;  4QMG A;  1EU4 A;  3K0X A;  4NXN L;  4JC0 A;  4KHZ A;  3SK6 A;  3HOY G;  1NUC A;  3NSW A;  2Q2I A;  4HR7 B;  1HNZ L;  1EL0 A;  1WJJ A;  3M9B A;  2PI2 E;  1V9P A;  2Q8T A;  3R2I A;  5HUR A;  4JVZ A;  2EVB A;  3I4M G;  1V43 A;  3M4Y A;  4XQJ A;  3CQZ B;  5ELF A;  4PQX A;  4ZLT F;  1J5E L;  3I4N H;  1D5Z C;  2ASB A;  1H9M A;  2JP1 A;  2Y0S E;  2AQ2 B;  4DUZ Q;  1BF4 A;  1RTO A;  4N9P A;  1ZXT A;  3PO2 H;  3BU2 A;  3I8Z A;  1SYF A;  1Q7Y C;  4KJO A;  2Z1C A;  1JOQ A;  3KF6 A;  4EQO A;  1N36 Q;  3HOV B;  1K3B C;  5JOB A;  1VQ9 A;  1SR3 A;  1STA A;  3I2Z A;  3I70 A;  2XNA C;  3M85 A;  1M4V A;  3CCU A;  1I4P A;  1PLF A;  1TVX A;  3L2P A;  4DV0 Q;  1LYL A;  4KY6 A;  3D4W A;  4RA8 A;  5IE8 A;  4MN3 A;  3R8B A;  1VS0 A;  1XTC D;  1A15 A;  4PZ7 A;  1QNU A;  3K5N A;  1BO0 A;  4DV3 Q;  3C3L A;  5KEE A;  4WJ4 A;  5EKK A;  4DAP A;  4K14 A;  2B39 A;  5GRO A;  1CTM A;  2KHJ A;  1KHI A;  2QW7 A;  3PF5 A;  1G6Z A;  2OCE A;  1MGS A;  1WFQ A;  1TXY A;  4S3S A;  3O13 A;  5ELN A;  1RD9 D;  4C3J B;  3K81 C;  4BY7 G;  3ICE A;  3S14 B;  2XSC A;  1PH4 A;  1JOO A;  3OTO L;  1JIC A;  2IWH A;  4DA2 A;  2WP8 J;  3G6E A;  2OQ0 A;  5I6W A;  1NY4 A;  3HOW B;  2AWO A;  2EZV A;  2NZH A;  5BN5 A;  1PH2 A;  4A3J B;  3M7G A;  5FLX E;  1L0X B;  4OWX B;  3NE5 B;  4X65 L;  1HR0 Q;  1GUG A;  4YCW A;  1ESF A;  1DZ1 A;  3MAQ A;  3TQY A;  5FLM H;  4KN7 C;  1JT8 A;  1FNV A;  1FYC A;  1LT4 D;  2A5H A;  1CQF A;  3S24 A;  4EQP A;  1Q8K A;  2MP1 A;  4C3I H;  1XYI A;  1H9K A;  2RCF A;  4DXG A;  4ZAI A;  1AZP A;  5D3I B;  1N9W A;  4Y7N B;  3IFD A;  4DR3 L;  4A3F B;  2XWB B;  2N78 A;  3SE0 A;  1PRT F;  5M5W H;  1NMG A;  4DV4 L;  1WCM G;  1H9R A;  4IPC A;  5FO7 B;  3CMA A;  4LF8 Q;  1R9T B;  4GKJ L;  1VQL A;  5IYD G;  3MVV A;  3PGZ A;  1BOS A;  2HDL A;  3IRB A;  5D14 A;  3G6J B;  2R93 B;  1U4M A;  1DOL A;  3MXN B;  5LL6 S;  2B2T C;  1CI3 M;  4A3K B;  2K01 A;  1I4H A;  2PW7 A;  4I7A A;  2QGQ A;  4KKT A;  2B63 B;  1KAA A;  4H7B A;  2XRQ D;  2NVY B;  4ZYS A;  2QA4 A;  4U67 3;  1IBK Q;  1PTO D;  3TZD A;  2G5D A;  2A68 D;  2EY5 A;  1QUQ A;  4X66 L;  4DV1 Q;  4IZ8 A;  4LF7 L;  3Q8D A;  5M5X H;  3SK8 A;  1D7Q A;  3J7A 5;  3RZO H;  1CT1 D;  1I50 H;  2PNR C;  1CK1 A;  1KDC A;  4EQN A;  4DR1 L;  1GHJ A;  2H1E A;  1A2U A;  4LFA Q;  3BDL A;  2JA5 G;  1A0I A;  4XTC S;  5F2D A;  3OPO A;  3CQZ H;  3K5O A;  2LMC B;  1PH3 A;  1X3G A;  3GTK B;  4DR6 Q;  1PVO A;  3S1N B;  3VYS A;  2Y0S B;  3I55 A;  2PMZ B;  4JBK A;  2EYL A;  1I5F A;  1S5F D;  3EJI A;  3T53 B;  4F87 A;  3BYT B;  4R1J A;  1EFI D;  2B2T A;  2F03 A;  2UUB Q;  4ME3 A;  1EYA A;  2MFI A;  4KKS A;  3HOV H;  4DR4 Q;  1MSG A;  1F2Y A;  4JI4 L;  2PW5 A;  1O7Y A;  3HOY B;  1F2Z A;  4BBR G;  3FVQ A;  3A7A B;  3OWF A;  4JI0 Q;  5IP9 G;  2EIF A;  2ZM6 L;  3KF8 B;  2NVX B;  4LF9 L;  3N52 A;  4A93 H;  4GOP C;  2WII B;  4WFN 3;  1SDF A;  1Z47 A;  5C4X B;  1W6J A;  3VYT A;  3GTL B;  4DAV A;  1U5K A;  1A2T A;  3NUC A;  5K36 H;  1PYS B;  3QWN A;  3V05 A;  1K28 A;  3BZD B;  1RIP A;  1NR4 A;  1L1O B;  4CKC A;  1B2T A;  4K8J A;  3AQQ A;  1NMF A;  1Z7T A;  1OXS C;  5IT9 c;  2XVS A;  3P7J A;  4IN3 A;  4EQ5 A;  4HCE A;  2IJ0 A;  2ICI A;  5LMN W;  3DM1 A;  1QVC A;  5CV5 A;  4BWG B;  4C1N I;  1CKO A;  4JV5 L;  4GLV B;  1BDO A;  1QNK A;  4ZCK A;  5I2Y A;  5IIF A;  1AH9 A;  3S15 B;  2V4D A;  4RKB A;  2IX3 A;  4P71 A;  1PXU A;  1Q90 A;  5CBA E;  2OF1 A;  3QR8 A;  1SMX A;  2JEB I;  4ABN A;  1FJG L;  1LAB A;  2RA4 A;  3MFG A;  1PTO B;  4GNX B;  4A3J H;  2WB1 E;  3T13 A;  5CV8 A;  2K5V A;  2FHT A;  4POG A;  2CW0 C;  1VQA A;  4IFD J;  4YWL A;  4A3B H;  4L5T A;  1ET9 A;  1H9S A;  2WKD A;  3J81 j;  3QOL A;  2WAQ E;  4LMQ D;  3NTH A;  4LF4 Q;  2EPB A;  1MJE A;  3S1Q H;  1K8A C;  4UP8 A;  2NN6 H;  1TS3 A;  3J80 i;  5IGG A;  1Q81 C;  1RDP D;  2E2J B;  2UXC L;  3W3A A;  1LV9 A;  1U0L A;  4Y7N H;  2HT1 A;  2NTT A;  1EIY B;  2R92 H;  4JI3 Q;  1JMC A;  4A3F H;  1STE A;  2F0E A;  2DGY A;  3ZJY C;  2AWN A;  5C0X H;  2JA6 G;  1TII D;  3RN5 A;  3VR6 A;  4G7H C;  3GTG B;  3H6M A;  4RCN A;  1S5D D;  1TY0 A;  3U58 A;  2AQ1 B;  3GTQ B;  1N8R C;  5JJK A;  1MD2 D;  2UXD L;  2Z6B A;  1SJH D;  2A19 A;  1L2F A;  2AKW B;  1VQ5 A;  1N33 Q;  2KVM A;  2P5Z X;  4WRD A;  4ZQ3 A;  3PO3 B;  2PYK A;  1U9R A;  1Y1V G;  5C4Z A;  4LF5 Q;  1IZ6 A;  2Q2H A;  3BVZ A;  3PSI A;  4M8A A;  1HCZ A;  1PZJ D;  5J1Z A;  1PZI D;  1QOH A;  3GTM B;  3SK4 A;  2UUC Q;  2NTS A;  5C44 G;  4XT1 B;  5CR3 A;  4U68 A;  1EY7 A;  4PV1 C;  1V1P A;  3R93 A;  2CCZ A;  3SXH A;  3SHL A;  2HDM A;  2A6H D;  3U9S A;  4DAY B;  1HHV A;  3S1N H;  1XNR Q;  3TZU A;  1RJT A;  4FP5 D;  1G2S A;  1L0W A;  3H0G H;  3CW2 C;  4KJN A;  3HOU G;  2HHH L;  4X6A H;  4DK3 C;  2F0S A;  3FEW X;  1ROD A;  4TQU S;  4WOR A;  2L55 A;  4KKU A;  2QCP X;  2M9V A;  5BR8 L;  2UUA L;  1UE7 A;  2EXZ A;  1QCB D;  1TWF B;  4O42 A;  3RLF A;  1W3S A;  3F2B A;  3HOY H;  4YHH Q;  3CD6 A;  2F0D A;  3M3Y B;  1KXL A;  4LFB L;  4QJF A;  4FYD A;  2JA5 B;  1I94 Q;  4R4I A;  1WVL A;  2NVX H;  3I4M H;  4DR7 Q;  4NXM Q;  2E2I H;  4JI8 Q;  2PZU A;  3C1F A;  1BVS A;  2EJG C;  2Z4I A;  1VQ8 A;  2ZXP A;  4GLA C;  3HG9 A;  2JXM B;  1WTH A;  4PMC A;  4RKL A;  1PH7 A;  3AFP A;  5EJW A;  1YVC A;  5EBD A;  1B9M A;  1K0R A;  4KN4 C;  5FKA C;  1VQ7 A;  5ELB A;  2KED A;  1QVF A;  1ZYR C;  4RAU C;  3MZ5 A;  4XQN A;  1SE4 A;  3KLR A;  5M9O A;  1IYU A;  4I65 A;  3J81 E;  1OXV A;  4LF6 Q;  2LFN A;  1Q1E A;  4BBR B;  3U50 C;  1QZG A;  3S1R B;  4NDX A;  3RR5 A;  3U4Z A;  1WTP A;  1Q1B A;  5H1S E;  4C3H B;  4A3E B;  2L5T A;  1FD7 D;  1EY9 A;  1JB7 A;  4G7O C;  3A0J A;  3I4L A;  1ASY A;  2B8G A;  4IUT A;  3VYU A;  1E3P A;  2JE6 I;  4JI2 L;  4WJ3 M;  1PTO H;  4A3M G;  1ZEQ X;  4P2C B;  3ERS X;  1KLG D;  5I2X A;  1PFS A;  2MGS A;  5EBC A;  1XMO Q;  3CU7 A;  1CZG A;  4UP7 A;  2NN6 I;  1BBU A;  3I4N B;  3T1H L;  4FF3 A;  2WAQ B;  4BY7 H;  2BCO A;  4DNR B;  1R4P B;  4A3I G;  3ULL A;  4JYA Q;  3PO2 B;  2KCN A;  1NTG A;  1VQN A;  3JAM E;  2N88 A;  1YHQ A;  3UI2 A;  2F4V L;  1X55 A;  1IW7 C;  2K7V A;  4BY1 H;  4TKO B;  2QDL A;  4B3R Q;  1U4L A;  5CYU A;  3K0Y A;  5JVG 3;  2F0T A;  1AZQ A;  2EYH A;  3NXW A;  1UE6 A;  3KOJ A;  1YIJ A;  2K5D A;  2PCF B;  1HNW Q;  4PZ8 A;  5T1G A;  3GTG H;  2MHV A;  4LFC Q;  1O7L A;  5FLX c;  1R4Q B;  5AJ3 Q;  1YHB A;  3M4Q A;  1B7Y B;  1LT3 D;  4UY8 C;  1W2B A;  4IUR A;  4GKK Q;  2PQE A;  1IBM Q;  4DV2 Q;  4IQZ A;  2J7Z A;  4RG1 A;  3C46 A;  1AN8 A;  1VQP A;  4HID A;  3IL8 A;  4B9W A;  5JEA J;  3GTM H;  1ILQ A;  3CCJ A;  3EA6 A;  2F52 A;  3KF6 B;  4HED A;  5I9P A;  2F0G A;  1SN8 A;  3CCV A;  3X3N A;  2A6E D;  1WCM H;  2HD3 A;  1YNX A;  4IJH A;  3AU7 A;  4P73 A;  5IYD H;  3UDF A;  4IFD G;  3A55 A;  4O0A A;  4HMI A;  1HQM C;  2FMC A;  3BDO A;  3PIP A;  3H91 A;  2JSO A;  4N8F A;  1EWI A;  1GXD C;  4AQY Q;  1KC8 C;  4BS9 A;  4N9T A;  1TS4 A;  1Y1V B;  2IT1 A;  4FDB A;  2KBN A;  4NKL A;  1VQE A;  4QQB X;  1ASZ A;  2QEJ C;  2DY8 A;  4CJ1 B;  3GO5 A;  5M5Y B;  2V1C C;  1CQV A;  1TWF H;  1AFP A;  3QG1 A;  2OTJ A;  5E1F A;  5C44 B;  3E0J A;  2EYP A;  2FXQ A;  2JA5 H;  2UXB Q;  2B29 A;  5CBE E;  4DV3 L;  1KTK A;  1ENC A;  1TT2 A;  1C4Q A;  2N8N A;  4RGO S;  3F2C A;  4C3I B;  4F8M A;  2L4N A;  4XXE A;  5LL6 X;  1GD7 A;  1E0B A;  3ONA B;  3L7Z C;  1DOK A;  3HKZ E;  5JAV A;  1VQ6 A;  3H15 A;  3AYH B;  4PG3 A;  2XTI A;  5M5W B;  4L5Q A;  3JAM L;  1VQF A;  3TDQ A;  3NQT A;  4K0K L;  1Y8P B;  3STB C;  3K5L A;  3FHW A;  4IPG A;  4BBR H;  4HJ7 A;  3G4S A;  3OIQ A;  3S1R H;  1SNP A;  1KLU D;  5IP9 H;  3A8J E;  4HJ9 A;  4B3T Q;  2DJG C;  4KD3 A;  3MA2 B;  5J39 A;  4KHV A;  1HTP A;  4XYQ A;  4DAM A;  4DV7 Q;  1EY8 A;  1S40 A;  1LUZ A;  4DR2 L;  3VR5 A;  5ELE A;  3TP7 A;  3KJO A;  3MEF A;  5M5X B;  1E1O A;  1STN A;  4YIJ A;  4JPB W;  2L9H A;  4DV6 Q;  1I50 B;  3OMG A;  4DNI A;  4OO1 G;  1FNW A;  3RZO B;  3G7L A;  3OW7 A;  1Q8I A;  4UHV A;  3BZK A;  4LWC A;  1K73 C;  4FNF A;  3S2H H;  3FP9 A;  1IL2 A;  1PHJ A;  1CA5 A;  2PMZ E;  2F4I A;  3K8A A;  3A56 A;  3Q0A A;  3BYY B;  4ZRZ A;  2E5L Q;  2VQF L;  1NCV A;  2KCC A;  5G3L D;  2YYZ A;  4RWS C;  3DLL A;  4GLX A;  4A3M B;  4JI1 Q;  1QUQ B;  2XRS D;  2GVB A;  2K05 A;  1EUJ A;  1A63 A;  4Y52 H;  4A93 B;  4RGN A;  1KAW A;  4X64 Q;  1LTR D;  2C35 B;  3PIO 3;  1GUN A;  1CFM A;  2ZT9 C;  3NWS A;  1EQT A;  3WDN A;  4ZKC B;  4DKA C;  2HIV A;  2UU9 L;  4AH6 A;  2WKC A;  2B8F A;  1LM0 A;  1GJX A;  1O7I A;  3R3O A;  1CHQ D;  4FF2 A;  4QY7 A;  1DCZ A;  3NBI A;  1B4O A;  3E5S A;  2JA6 H;  4NP5 A;  1H9J A;  3E3X A;  1JWU D;  1WI5 A;  1JOK A;  2CW0 D;  5DM6 3;  4L6T B;  1HNX L;  3H3V I;  3BDC A;  4QUF A;  1FR3 A;  4DR4 L;  1X9N A;  2JA9 A;  1PRT C;  3RUZ A;  1SYB A;  2VS1 A;  1HZ9 A;  3TS2 A;  4GN4 B;  2K6A A;  4BY1 G;  1ICF B;  4JI0 L;  1Y1V H;  1HFG A;  1JWS D;  2VB3 X;  4HJ8 A;  4GZY C;  1RHP A;  1PMR A;  5M5Y H;  5C3W A;  1FGU A;  1F2M A;  4A3B B;  2SNM A;  5C44 H;  5CV9 A;  5IOC A;  2KQ3 A;  4X62 L;  3A5Z B;  3PUX A;  3QJY A;  3S1Q B;  1P8L A;  4XT3 B;  2HCI A;  1SYC A;  1AE3 A;  1JQY D;  5EPL A;  1XNQ Q;  3OW2 A;  3EIV A;  3CF5 A;  5LHY 1;  4HIM A;  4RHR A;  2A8V A;  3S1M B;  1BCP F;  3HKZ B;  4TVA B;  3HOU H;  1IYJ B;  2R92 B;  2AHO B;  1X56 A;  2K5N A;  3TSS A;  2FJ2 A;  4A4I A;  3HZX A;  1EEF D;  4OHJ A;  1NE3 A;  2OTL A;  1HNZ Q;  1BBW A;  3CRL C;  3A7L A;  3H94 A;  4JI6 L;  2JA7 G;  2QF7 A;  1JWM D;  4B08 A;  1SNM A;  5DM7 3;  1WTW A;  1FGB D;  3DEP A;  5JEA G;  1D2B A;  1J5E Q;  1E2W A;  1TKW B;  5C6A A;  3AB9 A;  3X3M A;  3S17 H;  1H9S B;  5HGQ A;  3BVG A;  1E1T A;  1NSN S;  1HPC A;  3VR4 A;  2PNH A;  1A3T A;  1MKH A;  1U4P A;  4QL5 A;  4G57 A;  1Y8O B;  3WOE A;  1N32 Q;  1UE5 A;  3K80 C;  3FKI G;  4DXF A;  1J6Q A;  1W6K A;  4B3S L;  4OWW B;  2LKV A;  3NHH A;  3EFX D;  1G51 A;  1VMC A;  3NK9 A;  4NB3 A;  2ICE C;  1OTC A;  2EYF A;  4IPD A;  2N49 A;  5EGT A;  4IUN A;  2YTY A;  4JI3 L;  4A3L G;  3H0G B;  2C9O A;  3J81 c;  4BXX G;  1PDQ A;  3PUY A;  1C48 A;  1RCV D;  1Q86 C;  3IKJ A;  4EGV A;  2BOS A;  4A3M H;  5A2Q E;  2CH4 A;  4CJ0 B;  5CMD A;  3SGI A;  2VUM G;  1PFB A;  1QG7 A;  1A62 A;  4DFA A;  4ODG A;  2RHQ B;  4UP9 A;  1SAP A;  5C3X A;  4JCV E;  4G7Z C;  4OEL B;  1N33 L;  5CC4 A;  1SEB D;  1TWG H;  3I4M B;  4QUC A;  2K32 A;  3K7U C;  2E2I B;  1ZYR D;  2F0P A;  1V1P B;  4J8Q A;  1D5M C;  4ALP A;  1CKN A;  3OTO Q;  1HXY D;  4A3I H;  1VQ4 A;  4A3D G;  3ULJ A;  3CME A;  1I6H H;  2B2V C;  2GA4 B;  3KBX A;  4IAL A;  2RDG A;  3NWT A;  2RQX A;  1I4R A;  2EXD A;  4OIK A;  1SBB B;  3M7N A;  4MZ9 A;  1SNO A;  3FDT A;  2ENB A;  5CV7 A;  2F0Q A;  3C2P A;  1XNR L;  1HRJ A;  2A73 B;  2RCN A;  4K8I A;  3NTI A;  5EPJ A;  1LT6 D;  1EQR A;  3DM3 A;  3NEL A;  2F3W A;  4ID6 A;  1NR2 A;  5KRU A;  1STG A;  1EFW A;  1YZ6 A;  4GOP A;  5FOB B;  1EU3 A;  1E22 A;  5CGK A;  2BA1 A;  4FVM A;  1G2T A;  2EDG A;  1X65 A;  1IYV A;  4QGU A;  2EY1 A;  2JA8 G;  1EIG A;  4DR7 L;  4IOA A;  3RMH A;  5JPN C;  4DV4 Q;  1EWH A;  4NPS A;  1H95 A;  3J80 L;  1GUT A;  1IW7 D;  2RSN A;  1YNJ D;  1EIF A;  1VQM A;  4BY7 B;  4KD4 A;  4IFD H;  4DK6 C;  1MHW C;  5T1I A;  4K5V A;  1GOZ A;  4GN5 A;  2D62 A;  4QB4 A;  3S1M H;  3E9H A;  4MNO A;  3PMF A;  1KNE A;  3GTO B;  4X66 Q;  5GQO A;  2F0M A;  4LF6 L;  4BY1 B;  2M00 A;  4M1U B;  1SFO H;  1OXX K;  5IGF A;  5GAD C;  2LY7 A;  1XPU A;  2BH8 A;  2XWJ B;  3TP5 A;  1X3Q A;  3EBE A;  5M3F G;  1N34 Q;  1XMQ L;  1VQJ A;  5IP7 G;  3TRZ A;  4OON A;  5A2Q L;  5EAY A;  5J3B A;  3RN2 A;  1LTI D;  3A5U A;  1SND A;  2AUK A;  1Q46 A;  2J4X A;  3D6C A;  4C1N K;  1YEZ A;  1FNU A;  3TEH B;  4YY3 L;  2K75 A;  2RF4 A;  1G6P A;  1XMO L;  1IBL L;  3M4O H;  3GTJ H;  4WJW A;  3CCM A;  4JI4 Q;  3D6W A;  1BKB A;  3T51 B;  1UUP A;  2KEE A;  1WCM B;  2QKI C;  1LTG D;  1CM9 A;  1TY2 A;  3SK5 A;  1M8A A;  4DUY Q;  2ZM6 Q;  5ISR A;  4Q5V A;  5E3F A;  3H09 A;  1J9O A;  4OX9 L;  3A8I E;  1D8L A;  3NBH A;  1JJG A;  3URY A;  3E9I A;  4HIK A;  1VMP A;  4PNY A;  5FK9 C;  5C4H A;  4QIW E;  5EKI A;  5HY6 A;  4RHS A;  3F2D A;  4DNT B;  1K83 B;  3K5M A;  1HNW L;  2E2H H;  2L1B A;  3CXC A;  3FKI B;  4Z9C B;  4HIO A;  4OO1 H;  2NUC A;  1TWA H;  2L11 A;  5GAE C;  4A75 A;  1LO5 D;  1F77 A;  2D5D A;  5IGD A;  2PZW A;  2R7Z G;  3BS1 A;  1Y1W G;  4A3G G;  1D1K A;  2Z4H A;  4B3M Q;  2XGT A;  3D4R A;  4X3T A;  1WTV A;  1I4Q A;  4KV6 A;  3STB D;  5JJL A;  3HP3 A;  1SE8 A;  1A3V A;  4JI5 L;  1RTN A;  2F0L A;  4OIJ A;  1EYD A;  3KLW A;  2XIW A;  2D0P A;  1STH A;  4RCO A;  3W5O A;  1VDZ A;  2K5H A;  1WTQ A;  1JC7 A;  1VF5 C;  1PH1 A;  1PTO F;  3LWU A;  4R4Q A;  2MUY A;  4DK0 A;  1XJV A;  3P75 A;  4O2D A;  4DR5 L;  4BA2 I;  4JG2 A;  1G91 A;  1RL2 A;  4FXK C;  2L12 A;  2CFM A;  3Q23 A;  4A3D B;  3HOX G;  1B3Q A;  2BDN A;  2F0N A;  3GV6 A;  2UXC Q;  1SE2 A;  3D8G A;  2UXB L;  2A69 C;  5FJ8 G;  3FPU B;  2RKS A;  1F9Q A;  1Q3L A;  4ILW A;  1PYB A;  4KHP L;  3S2H B;  4KK7 A;  3FMC A;  2QEX A;  1I4G A;  2XN9 C;  2MPM A;  3S2D H;  3MXP A;  1LTS D;  1CSQ A;  1STY A;  3K7A B;  4K5W A;  5ELC A;  2I0Q A;  4J15 A;  2WV6 D;  2EY6 A;  2X69 A;  2CWA A;  1JJC B;  1AP0 A;  5L37 A;  4E6I A;  3H3V C;  4L63 B;  2ZXR A;  3GTO H;  1D5X C;  2R61 A;  1SYE A;  1SNQ A;  1V8Q A;  1VQH A;  2IHE A;  3A8K E;  4UPA A;  5C0X I;  4B3T L;  4J1M A;  1WOC A;  2IY5 B;  4APV A;  1HZB A;  2AQ3 B;  2CKZ B;  3J7A V;  2H5X A;  3ULP A;  2NZ1 D;  1Y8N B;  3AMU A;  5HGT A;  1PFM A;  4JI7 Q;  1BNZ A;  2JEA I;  3OSO A;  1S72 A;  2BE5 C;  1JE5 A;  3WOF A;  4UDU C;  1D1I A;  3K57 A;  4CJ2 C;  4AYB G;  3T1Y Q;  2Z6K C;  3I7F A;  1L0Y B;  2HHH Q;  2LSS A;  2G9H D;  1F9R A;  3NEM A;  3RLN A;  4C3J G;  1X3P A;  4OEM B;  4R4C A;  1HA5 A;  1WTR A;  1B8A A;  1LLR D;  1OXU A;  2UUA Q;  5BR8 Q;  2IPK D;  1B44 D;  1PRT D;  4KI0 A;  2VQE Q;  4DGZ A;  4DUZ L;  4H13 C;  3KLS A;  3ER0 A;  1BR9 A;  2JA6 B;  3HOW G;  1WD1 A;  1MSH A;  5LMU Q;  2E5L L;  2JA7 H;  3PF4 A;  2PQA A;  1TR5 A;  5IOD A;  2NBF A;  5JEA H;  1N36 L;  2J0T D;  3IAY A;  2DUD A;  4JI1 L;  1O80 A;  3PIP 3;  4AYB E;  3F8T A;  2NZO A;  1CA6 A;  5E4X A;  4DV0 L;  3GP7 A;  1VQI A;  4JBW A;  5EQ0 A;  4OO1 I;  1K83 H;  4QIW B;  1LTT D;  2ID0 A;  4FF4 A;  3FKI H;  4OXP A;  3S16 H;  3I72 A;  4ZUI A;  3VA7 A;  1VQO A;  5I9O A;  1EEI D;  5C3E G;  1BQQ T;  5E7N A;  3FPP A;  2L0C A;  1WD0 A;  1PH5 A;  2F3I A;  4QCL A;  3CP0 A;  1I3Q B;  3JC6 6;  3AEV A;  1Q82 C;  1HZA A;  4JW0 A;  1I4X A;  1XTD A;  4RGT A;  3SVM A;  1HTL D;  1K9M C;  1HUN A;  3SR1 A;  3WWV A;  2BDO A;  5AFW A;  3KFU A;  3J81 i;  4A3L H;  3J7A F;  4JI2 Q;  2JK8 A;  5LMN Q;  3HOU B;  1SRU A;  4BXX H;  3CRK C;  5JPM C;  3K59 A;  2R93 G;  4MIU A;  1F9S A;  1UWV A;  5IGB A;  2VUM H;  1B3A A;  3HRZ C;  1T5E A;  2B63 G;  3CC7 A;  4HJA A;  2OT2 A;  4JK1 C;  4ZKB B;  4YWK A;  5IYB G;  1NJI C;  4C56 C;  4HAE A;  2CWP A;  4DV5 Q;  2EYJ A;  3F2U A;  3S17 B;  2R7Z B;  1LTB D;  2JN4 A;  4A3G B;  2CQA A;  3NEN A;  1HR0 L;  3E0E A;  1SRO A;  2WAC A;  2A1A A;  4N8X 1;  2B3G A;  4P75 A;  4A3D H;  1K8M A;  4IJL A;  5M3M G;  2F4V Q;  2JYO A;  1FVI A;  5COR A;  2ZTC A;  1V1O A;  5C4J B;  2Q8I B;  2Y0S G;  5ELO A;  3EQL C;  1XNQ L;  4XDX A;  1PRT B;  1PH8 A;  1B70 B;  1E2V A;  2PO4 A;  3QB3 A;  4EVO A;  3K58 A;  1DYQ A;  3W2D A;  1ENF A;  2F0H A;  3CCE A;  1ESR A;  3K7A H;  3CPW A;  2LXJ A;  1ENA A;  3EVQ A;  1ILP A;  3OOC A;  3J7Z C;  1SXT A;  4HN7 A;  2E75 C;  4LF8 L;  3Q24 A;  3HOX B;  3NTK A;  1EWC A;  1XXG A;  1C0A A;  3DWA A;  1UE1 A;  3MFY A;  4MTK A;  4CDF C;  4H02 A;  4RGM A;  3VR2 A;  2ZTD A;  2ZTE A;  5C4X G;  1UEA B;  2JA8 H;  1B9N A;  4K5X A;  1GO3 E;  4OL7 A;  5NUC A;  1TWG B;  1IBK L;  4FF1 A;  4JOI C;  3KK7 A;  1X3E A;  1CKM A;  3GTP B;  4DV1 L;  1LAC A;  4CKB A;  1QB5 D;  5BN4 A;  1N32 L;  5TSS A;  3VR3 A;  2TMP A;  3BVM A;  3TRE A;  4A3I B;  2NWG A;  5FO8 B;  2F0U A;  1I6H B;  4HCS A;  1II3 A;  4LFA L;  1KD1 C;  2K04 A;  1GKH A;  4ZK9 B;  1EQV A;  1KL9 A;  1S4Z A;  3GV3 A;  4HTH A;  1TWC H;  2I46 A;  3A54 A;  5KYI A;  2MO1 A;  3P1H A;  5D65 A;  4DR6 L;  2RSO A;  1S3O A;  3MC0 B;  3PUW A;  3MXG A;  3VA5 A;  1BXT A;  3PIO A;  2D9U A;  1BCP C;  2N3S A;  1SYG A;  5M3F H;  5IP7 H;  2O4X A;  5KNB A;  2UUB L;  3K6O A;  3SEB A;  2YU9 H;  4HSP A;  2PZT A;  5K5P A;  2I5M X;  2VB2 X;  2ZJQ A;  2EJF C;  4JOI A;  4KY7 A;  4L5S A;  2FFK B;  1LT5 D;  1VQK A;  1X6O A;  3MWY W;  4AYB B;  2HCC A;  1PH6 A;  3G71 A;  3MHB A;  4KTA A;  4TSS A;  1CKN B;  1EOT A;  3GD7 A;  3HOZ G;  4FO2 A;  5KYL A;  2I07 B;  4K0K Q;  3D31 A;  1QJO A;  1T5X D;  1I3Q H;  3EN2 A;  4HSV A;  1Y14 B;  3KBG A;  4R8N A;  5IWA Q;  2A6E C;  1X3F A;  3UE1 A;  2F0F A;  4C2M H;  3T16 A;  4BBS G;  1B1Z A;  3PCO B;  2K28 A;  4CDE C;  5EKL A;  2Q2U A;  1JCK B;  1PV4 A;  4LUZ A;  4L8J A;  2RHS B;  1CHP D;  4DR2 Q;  3MEH A;  1X32 A;  1YNN C;  3GDE A;  1DOM A;  1ML0 D;  1J8I A;  1TS2 A;  3I91 A;  1SFO B;  4YCU A;  2SDF A;  4NXN Q;  2DJF C;  4GOP B;  2R6G A;  1TU2 B;  5C3E B;  3PO3 G;  1TWH H;  1QE6 A;  1UEB A;  1VF7 A;  2KOL A;  1ICW A;  3DWP A;  5CV4 A;  2NVT H;  2VNU D;  2DN8 A;  2R7Z H;  3ZYY X;  4YWM A;  1Y1W H;  4A3G H;  4AIM A;  1YJ9 A;  3I73 A;  1E2Z A;  2AMC B;  2EYM A;  4CGY B;  4K2L A;  5IYC G;  1GHK A;  3RD4 A;  4K2K A;  1HFN A;  2VQF Q;  4UAI A;  3M4O B;  4A3C G;  3J80 E;  3GTJ B;  2ES2 A;  1MBY A;  3DMU A;  1HH2 P;  4R4O A;  2SOB A;  1YI2 A;  4LF4 L;  4EX5 A;  5C4J H;  2E74 C;  4J6H A;  4OWT B;  2K33 A;  2B2Y C;  1EZ8 A;  1WTO A;  2KCT A;  4JBJ A;  4NMZ A;  1KDB A;  4ULL A;  1SMY C;  4CDD C;  3TBI B;  4IOC A;  5C5M A;  4PMB A;  2SNS A;  1DON A;  1PFN A;  3HS0 C;  1N34 L;  2Z9H A;  1RKN A;  5A35 A;  3HOX H;  2E2H B;  5IY0 A;  5IGE A;  5M3M B;  4DU9 A;  2UU9 Q;  5IGC A;  2IX1 A;  3HKS A;  5FJ8 H;  1TWA B;  1DXM A;  2O2L D;  2RVL A;  2F0O A;  3ND8 A;  1ET6 A;  2I5H A;  2E8G A;  1B50 A;  1M1K C;  1CZW A;  1VQB A;  4ZUJ A;  4IUU A;  3W1B A;  3CCQ A;  1E7Z A;  3ITP A;  4LF5 L;  3UE0 A;  3GTP H;  1C9O A;  2OEO A;  2R3Z A;  2B2Y A;  2IHF A;  1HNX Q;  2OXP A;  3TME A;  3VYR A;  3I56 A;  2RDH A;  3MTS A;  2UUC L;  1KIX A;  1PYW D;  3BG3 A;  3PUV A;  5FLX L;  2YTX A;  3NBH B;  3U9O A;  4DUY L;  4X65 Q;  1TQO A;  4C3H G;  2MJ8 A;  1BBX C;  4A3E G;  5DNF A;  1PZK D;  1K3R A;  3JAM c;  2KCM A;  2F0V A;  3T56 B;  2LS0 1;  4CDC C;  4X3K A;  3L9A X;  2YV5 A;  2A69 D;  4X62 Q;  2DNE A;  2KHI A;  3HEJ A;  2KEC A;  2WB1 G;  1QIL A;  3G48 A;  2K14 A;  4FXD A;  3DHQ A;  2JQO A;  1KDA A;  1SE3 A;  1SYD A;  4YHH L;  2ATW A;  1RF2 D;  2EYO A;  1EYC A;  1F9P A;  1A8V A;  4HMJ A;  5COY A;  3I3C A;  1QWY A;  1I94 L;  5JJZ A;  4DR3 Q;  3I4N G;  3L3O C;  2B2V A;  2WAQ G;  4C3J H;  2MNA A;  4NXM L;  1IL8 A;  1G29 1;  3S14 H;  4JI8 L;  4R8I A;  3D0F A;  1DGS A;  3PO2 G;  1O7Z A;  2ALY B;  2KEN A;  4B3M L;  2K52 A;  3J7Y W;  4GKJ Q;  4JI6 Q;  5GAG C;  1SJE D;  3QIA A;  3S2D B;  3GQB A;  5G3L F;  3HOW H;  1EOV A;  4IUQ A;  1LTA D;  2O5J C;  4XQQ A;  2B2U C;  4LUV A;  4LUO A;  1PH9 A;  1HZC A;  3CC2 A;  2VY3 A;  1Q12 A;  1YJN A;  1C7Y A;  3MXN A;  4TRD A;  1Y69 U;  3CC4 A;  4LF7 Q;  3NQI A;  2F0J A;  2BE5 D;  3DEO A;  4B3S Q;  1EZ6 A;  5EPK A;  4DR1 Q;  3OHX C;  3HOZ B;  1GVP A;  3I4O A;  5C3E H;  1GM5 A;  1IXR A;  1S5B D;  2YTV A;  4MHE A;  4P74 A;  5C0X J;  1S5E D;  1KAB A;  2CQO A;  2PI2 A;  4IUV A;  4KLK A;  4BBS B;  1EY6 A;  1HA6 A;  4R9W A;  3LNN A;  3KUP A;  4H0L C;  1MI2 A;  2KUM A;  3T4A C;  2H4O A;  2NYZ D;  1K8G A;  2B2U A;  1R9T H;  1L1O C;  5KGU A;  4YCV A;  2R93 H;  4HJ5 A;  4LAA A;  2ZJR A;  1DD2 A;  1MIU A;  3UDX A;  1V1Q A;  2NVQ B;  4A3K H;  4JYA L;  1VCI A; 
#chains in the Genus database with same CATH homology
 1UAP A;  3KLS X;  2JA7 B;  1KNA A;  2IX0 A;  1GUS A;  2BA0 A;  2K5W A;  1EY0 A;  1GUW A;  3KF8 A;  2FIN B;  1I6V C;  2EY2 A;  1PTO C;  3D4D A;  3OWE B;  4H44 C;  2A68 C;  2ZXO A;  3S16 B;  2KA7 A;  3CKI B;  5FO9 B;  1U4R A;  4C3I G;  4IUP A;  2NB0 A;  1AW7 A;  3QO2 A;  4DN4 M;  2IW3 A;  4DK1 A;  1AEX A;  1GUO A;  3ERO A;  4OGQ C;  1A6X A;  2HUG A;  4V19 0;  4K6D A;  3IFT A;  4B9X A;  2A74 C;  2DY7 A;  4K6L A;  5D3D A;  2O5I C;  4DF7 A;  3S9W A;  1F2L A;  3PUZ A;  1JE4 A;  2K1B A;  2VUM B;  3E6Z X;  4Q0F A;  3SDZ A;  4CHT B;  3DWQ A;  2HQE A;  1D6E C;  1IKL A;  2C5C A;  1OO9 B;  2EE1 A;  3RZD B;  2X6L A;  1EY5 A;  5KIX A;  3FRP B;  3N6R A;  3LWE A;  2X6G A;  4ME5 A;  1WTX A;  1XX8 A;  1DJR D;  2PPB C;  2B2W C;  1UNS A;  4IFD I;  1DM0 B;  4BA1 I;  2QIL A;  3OIP A;  3TN2 A;  2WB1 B;  3P20 A;  4NW2 A;  1TS5 A;  2WIN B;  3NP8 A;  2CHB D;  4F7X A;  1JOR A;  3R2T A;  2JA8 B;  3QOJ A;  5IT9 E;  5K36 G;  3DXJ C;  2VXW A;  3V96 A;  4XYO A;  1HQR D;  4X3U A;  1A3U A;  1YNJ C;  2B2W A;  2RBM A;  1BCP D;  4DAY A;  5ELD A;  3V2T A;  3C1E A;  3I90 A;  1TWC B;  2CVR A;  4G4K A;  5DEH A;  1C8C A;  5J22 A;  4RFB A;  2IL8 A;  4QF4 A;  1NAP A;  1G8Z D;  2M2L A;  3OMC A;  5M3F B;  5BN3 A;  1ZKO A;  3PV0 A;  4LJZ C;  2YU9 B;  1B53 A;  3Q22 A;  1S5C D;  4LK1 C;  1SNC A;  4XIG S;  4X3S A;  2K5Q A;  5DAU A;  3TP8 A;  1HUM A;  1SSO A;  3CHB D;  2NN6 G;  5KND A;  1XWE A;  3J81 L;  1K8O A;  2Z8L A;  1YNN D;  4I7Z C;  2F3V A;  2FMM A;  2KHS A;  5E4W C;  2E76 C;  4C2M B;  2K03 A;  1STB A;  4RH6 A;  2F0I A;  2Q8R E;  4FXG C;  2F0K A;  5KNC A;  2A6H C;  1OXT A;  2N55 A;  3D3R A;  5C0X G;  3TP6 A;  3NPP A;  2F0W A;  4KMU C;  2G9D A;  4CKE A;  3LX0 A;  2D2C C;  1EIH A;  3ND9 A;  2DNC A;  2KJX A;  4KY5 A;  1TWH B;  2F1M A;  1ONL A;  2AUJ D;  2NVT B;  2TSS A;  5IT9 L;  1Y1W B;  4F88 A;  2SEB D;  4CBV A;  2EJM A;  2EOT A;  3MXU A;  5I4D A;  1JR0 D;  1BCP B;  3HGB A;  1EY4 A;  5JVH 3;  1SMY D;  4PMW A;  2QDB A;  1IHZ A;  2RDF A;  3ERQ A;  4V0B A;  3Q6S A;  1JB3 A;  5I6Y A;  1IKM A;  3DUZ A;  5CV6 A;  4O1N A;  5C5L A;  1BUV T;  2E2D C;  1Z6H A;  1O78 A;  4QMG A;  1EU4 A;  4KHZ A;  3SK6 A;  1NUC A;  3NSW A;  4HR7 B;  1EL0 A;  2Q8T A;  3R2I A;  5HUR A;  2EVB A;  1V43 A;  3M4Y A;  4XQJ A;  3CQZ B;  5ELF A;  4PQX A;  4ZLT F;  1D5Z C;  1H9M A;  2JP1 A;  2AQ2 B;  1BF4 A;  1RTO A;  4N9P A;  1ZXT A;  3I8Z A;  1SYF A;  4KJO A;  2Z1C A;  1JOQ A;  4EQO A;  3HOV B;  5JOB A;  1STA A;  3I70 A;  2XNA C;  3M85 A;  1M4V A;  1I4P A;  1PLF A;  1TVX A;  4KY6 A;  3D4W A;  4RA8 A;  4MN3 A;  3R8B A;  1XTC D;  1A15 A;  1QNU A;  3K5N A;  1BO0 A;  3C3L A;  5KEE A;  5EKK A;  4DAP A;  4K14 A;  2B39 A;  1CTM A;  1G6Z A;  1MGS A;  4S3S A;  3O13 A;  1RD9 D;  4C3J B;  3S14 B;  2XSC A;  1JOO A;  1JIC A;  2IWH A;  4DA2 A;  2WP8 J;  5I6W A;  3HOW B;  2AWO A;  2EZV A;  5BN5 A;  4A3J B;  3M7G A;  5FLX E;  1L0X B;  3NE5 B;  1GUG A;  1ESF A;  1DZ1 A;  3MAQ A;  4KN7 C;  1FNV A;  1FYC A;  1LT4 D;  2A5H A;  1CQF A;  4EQP A;  2MP1 A;  1XYI A;  1H9K A;  4DXG A;  4ZAI A;  1AZP A;  5D3I B;  4Y7N B;  3IFD A;  4A3F B;  2XWB B;  3SE0 A;  1PRT F;  1H9R A;  5FO7 B;  1R9T B;  1BOS A;  2HDL A;  3MVV A;  5D14 A;  3G6J B;  2R93 B;  1U4M A;  1DOL A;  5LL6 S;  2B2T C;  1CI3 M;  4A3K B;  2K01 A;  1I4H A;  2PW7 A;  4KKT A;  2B63 B;  1KAA A;  4H7B A;  2XRQ D;  2NVY B;  4ZYS A;  4U67 3;  1PTO D;  3TZD A;  2A68 D;  2EY5 A;  4IZ8 A;  3SK8 A;  1CT1 D;  2PNR C;  1CK1 A;  1KDC A;  4EQN A;  1GHJ A;  2H1E A;  1A2U A;  3BDL A;  4XTC S;  5F2D A;  3OPO A;  3K5O A;  2LMC B;  3GTK B;  3S1N B;  3VYS A;  2Y0S B;  2PMZ B;  2EYL A;  1S5F D;  3EJI A;  3T53 B;  4F87 A;  3BYT B;  1EFI D;  2B2T A;  2F03 A;  1EYA A;  4KKS A;  1MSG A;  1F2Y A;  2PW5 A;  1O7Y A;  3HOY B;  1F2Z A;  3FVQ A;  3A7A B;  3OWF A;  2NVX B;  3N52 A;  2WII B;  4WFN 3;  1SDF A;  1Z47 A;  5C4X B;  1W6J A;  3VYT A;  3GTL B;  4DAV A;  1A2T A;  3NUC A;  5K36 H;  3QWN A;  3V05 A;  3BZD B;  1NR4 A;  4CKC A;  1B2T A;  4K8J A;  1Z7T A;  1OXS C;  2XVS A;  3P7J A;  4IN3 A;  4HCE A;  2IJ0 A;  2ICI A;  3DM1 A;  5CV5 A;  4BWG B;  4C1N I;  1BDO A;  1QNK A;  5IIF A;  5I2Y A;  3S15 B;  2V4D A;  4RKB A;  2IX3 A;  1PXU A;  1Q90 A;  5CBA E;  2OF1 A;  4ABN A;  2JEB I;  1LAB A;  2RA4 A;  3MFG A;  1PTO B;  3T13 A;  5CV8 A;  2FHT A;  2CW0 C;  4IFD J;  1ET9 A;  1H9S A;  2WKD A;  3QOL A;  4LMQ D;  3NTH A;  2EPB A;  2NN6 H;  1TS3 A;  5IGG A;  2E2J B;  1RDP D;  3W3A A;  1LV9 A;  2NTT A;  1STE A;  2F0E A;  2AWN A;  5C0X H;  1TII D;  3VR6 A;  4G7H C;  3GTG B;  3H6M A;  4RCN A;  1S5D D;  1TY0 A;  2AQ1 B;  3GTQ B;  1MD2 D;  1SJH D;  2KVM A;  4ZQ3 A;  4WRD A;  3PO3 B;  2PYK A;  1U9R A;  5C4Z A;  3BVZ A;  4M8A A;  1HCZ A;  1PZJ D;  5J1Z A;  1PZI D;  1QOH A;  3GTM B;  3SK4 A;  2NTS A;  4XT1 B;  5CR3 A;  4U68 A;  1EY7 A;  4PV1 C;  1V1P A;  3R93 A;  3SXH A;  3SHL A;  2HDM A;  2A6H D;  3U9S A;  1HHV A;  3TZU A;  1RJT A;  4FP5 D;  1G2S A;  4KJN A;  2F0S A;  3FEW X;  1ROD A;  4TQU S;  4WOR A;  2L55 A;  4KKU A;  2QCP X;  2M9V A;  2EXZ A;  1QCB D;  1TWF B;  4O42 A;  3RLF A;  2F0D A;  3M3Y B;  4FYD A;  2JA5 B;  1WVL A;  2PZU A;  3C1F A;  2EJG C;  2Z4I A;  2ZXP A;  3HG9 A;  2JXM B;  4PMC A;  4RKL A;  5EJW A;  5EBD A;  1B9M A;  4KN4 C;  5FKA C;  5ELB A;  2KED A;  1ZYR C;  4RAU C;  3MZ5 A;  4XQN A;  1SE4 A;  3KLR A;  5M9O A;  1IYU A;  4I65 A;  3J81 E;  1OXV A;  2LFN A;  1Q1E A;  4BBR B;  3S1R B;  4NDX A;  1WTP A;  1Q1B A;  4C3H B;  4A3E B;  2L5T A;  1FD7 D;  1EY9 A;  4G7O C;  3I4L A;  2B8G A;  4IUT A;  3VYU A;  2JE6 I;  1PTO H;  1ZEQ X;  4P2C B;  1KLG D;  5I2X A;  2MGS A;  5EBC A;  3CU7 A;  1CZG A;  2NN6 I;  3I4N B;  4FF3 A;  2WAQ B;  2BCO A;  4DNR B;  1R4P B;  3PO2 B;  2KCN A;  3JAM E;  2N88 A;  3UI2 A;  2K7V A;  1IW7 C;  4TKO B;  1U4L A;  5CYU A;  3K0Y A;  5JVG 3;  2F0T A;  1AZQ A;  2EYH A;  3NXW A;  2K5D A;  2PCF B;  5T1G A;  2MHV A;  1O7L A;  1R4Q B;  1LT3 D;  4IUR A;  2PQE A;  4IQZ A;  2J7Z A;  3C46 A;  1AN8 A;  3IL8 A;  4B9W A;  5JEA J;  1ILQ A;  3EA6 A;  4HED A;  5I9P A;  2F0G A;  3X3N A;  2A6E D;  3AU7 A;  4IFD G;  3A55 A;  4HMI A;  1HQM C;  2FMC A;  3BDO A;  3H91 A;  2JSO A;  1GXD C;  4BS9 A;  4N9T A;  1TS4 A;  1Y1V B;  2IT1 A;  4NKL A;  2QEJ C;  2DY8 A;  4CJ1 B;  3GO5 A;  5M5Y B;  1CQV A;  1AFP A;  3QG1 A;  5E1F A;  5C44 B;  3E0J A;  2EYP A;  5CBE E;  1KTK A;  1ENC A;  1TT2 A;  1C4Q A;  4RGO S;  4C3I B;  4F8M A;  2L4N A;  4XXE A;  5LL6 X;  1E0B A;  3ONA B;  3L7Z C;  1DOK A;  5JAV A;  5M5W B;  3JAM L;  3TDQ A;  3NQT A;  1Y8P B;  3K5L A;  3OIQ A;  1SNP A;  1KLU D;  3A8J E;  4KD3 A;  3MA2 B;  5J39 A;  4KHV A;  1HTP A;  4XYQ A;  1EY8 A;  3VR5 A;  5ELE A;  3TP7 A;  5M5X B;  1STN A;  4YIJ A;  3RZO B;  2L9H A;  4OO1 G;  1I50 B;  3OMG A;  1FNW A;  3G7L A;  3OW7 A;  1Q8I A;  4FNF A;  1CA5 A;  2F4I A;  3A56 A;  3Q0A A;  3BYY B;  4ZRZ A;  1NCV A;  2KCC A;  5G3L D;  2YYZ A;  4RWS C;  4A3M B;  2XRS D;  2K05 A;  4A93 B;  4RGN A;  1LTR D;  3PIO 3;  1GUN A;  1CFM A;  2ZT9 C;  3NWS A;  1EQT A;  3WDN A;  4ZKC B;  2WKC A;  2B8F A;  1GJX A;  3R3O A;  1CHQ D;  4FF2 A;  1DCZ A;  3NBI A;  1B4O A;  3E5S A;  4NP5 A;  1H9J A;  1JWU D;  1JOK A;  2CW0 D;  5DM6 3;  4L6T B;  3BDC A;  4QUF A;  1FR3 A;  1PRT C;  3RUZ A;  1SYB A;  2K6A A;  1HFG A;  1JWS D;  2VB3 X;  4GZY C;  1RHP A;  1PMR A;  5C3W A;  1F2M A;  4A3B B;  2SNM A;  5CV9 A;  5IOC A;  2KQ3 A;  3PUX A;  3QJY A;  3S1Q B;  4XT3 B;  2HCI A;  1SYC A;  1JQY D;  5EPL A;  5LHY 1;  4RHR A;  3S1M B;  1BCP F;  3HKZ B;  2R92 B;  3TSS A;  2FJ2 A;  3HZX A;  1EEF D;  4OHJ A;  3CRL C;  3A7L A;  3H94 A;  2QF7 A;  1JWM D;  4B08 A;  1SNM A;  5DM7 3;  1WTW A;  1FGB D;  3DEP A;  5JEA G;  1D2B A;  1E2W A;  1TKW B;  5C6A A;  3AB9 A;  3X3M A;  1H9S B;  3BVG A;  1NSN S;  1HPC A;  3VR4 A;  1A3T A;  1U4P A;  4G57 A;  1Y8O B;  3WOE A;  4DXF A;  1W6K A;  2LKV A;  3NHH A;  3EFX D;  1VMC A;  3NK9 A;  2ICE C;  2EYF A;  5EGT A;  4IUN A;  3H0G B;  2C9O A;  1PDQ A;  3PUY A;  1C48 A;  1RCV D;  3IKJ A;  4EGV A;  2BOS A;  5A2Q E;  4CJ0 B;  5CMD A;  1PFB A;  1QG7 A;  4DFA A;  4ODG A;  4G7Z C;  1SAP A;  5C3X A;  5CC4 A;  1SEB D;  3I4M B;  4QUC A;  2K32 A;  2E2I B;  1ZYR D;  2F0P A;  1V1P B;  4J8Q A;  1D5M C;  1HXY D;  2B2V C;  2GA4 B;  3KBX A;  4IAL A;  2RDG A;  3NWT A;  2RQX A;  1I4R A;  4OIK A;  1SBB B;  3M7N A;  1SNO A;  3FDT A;  2ENB A;  5CV7 A;  2F0Q A;  3C2P A;  1HRJ A;  2A73 B;  4K8I A;  3NTI A;  5EPJ A;  1LT6 D;  2F3W A;  4ID6 A;  1NR2 A;  5KRU A;  1STG A;  5FOB B;  1EU3 A;  5CGK A;  2BA1 A;  4FVM A;  1G2T A;  2EDG A;  1IYV A;  2EY1 A;  1EIG A;  3RMH A;  5JPN C;  1EWH A;  3J80 L;  1GUT A;  1IW7 D;  2RSN A;  1YNJ D;  4BY7 B;  4KD4 A;  4IFD H;  5T1I A;  4K5V A;  1GOZ A;  2D62 A;  4QB4 A;  3PMF A;  1KNE A;  3GTO B;  2F0M A;  4BY1 B;  2M00 A;  4M1U B;  1OXX K;  5IGF A;  2LY7 A;  2XWJ B;  3TP5 A;  1X3Q A;  5A2Q L;  1LTI D;  1SND A;  2AUK A;  2J4X A;  3D6C A;  4C1N K;  1FNU A;  4WJW A;  3D6W A;  3T51 B;  1UUP A;  2KEE A;  1WCM B;  2QKI C;  1LTG D;  1CM9 A;  1TY2 A;  3SK5 A;  1M8A A;  5ISR A;  4Q5V A;  5E3F A;  3H09 A;  1J9O A;  3A8I E;  3NBH A;  3URY A;  1VMP A;  4PNY A;  5FK9 C;  5C4H A;  5EKI A;  4RHS A;  4DNT B;  1K83 B;  3K5M A;  2L1B A;  3FKI B;  4Z9C B;  4OO1 H;  2NUC A;  2L11 A;  1LO5 D;  1F77 A;  2D5D A;  5IGD A;  2PZW A;  3BS1 A;  1D1K A;  2Z4H A;  3D4R A;  4X3T A;  1WTV A;  1I4Q A;  4KV6 A;  3HP3 A;  1A3V A;  1RTN A;  2F0L A;  4OIJ A;  1EYD A;  2XIW A;  4RCO A;  1STH A;  1VDZ A;  1WTQ A;  1JC7 A;  1VF5 C;  1PTO F;  3LWU A;  2MUY A;  4DK0 A;  3P75 A;  4BA2 I;  1G91 A;  4FXK C;  2L12 A;  3Q23 A;  4A3D B;  2BDN A;  2F0N A;  3GV6 A;  1SE2 A;  3D8G A;  2A69 C;  3FPU B;  2RKS A;  1F9Q A;  1Q3L A;  4ILW A;  3S2H B;  4KK7 A;  3FMC A;  1I4G A;  2XN9 C;  2MPM A;  3MXP A;  1LTS D;  1STY A;  3K7A B;  4K5W A;  5ELC A;  2WV6 D;  2EY6 A;  2X69 A;  1AP0 A;  4E6I A;  3H3V C;  4L63 B;  2ZXR A;  1D5X C;  2R61 A;  1SYE A;  1SNQ A;  1V8Q A;  3A8K E;  5C0X I;  4J1M A;  2AQ3 B;  3J7A V;  2NZ1 D;  1Y8N B;  3AMU A;  5HGT A;  1PFM A;  1BNZ A;  2JEA I;  3OSO A;  2BE5 C;  3WOF A;  4UDU C;  1D1I A;  3K57 A;  4CJ2 C;  1L0Y B;  2G9H D;  1F9R A;  4C3J G;  1X3P A;  1HA5 A;  1WTR A;  1LLR D;  1OXU A;  2IPK D;  1B44 D;  1PRT D;  4KI0 A;  4DGZ A;  4H13 C;  3KLS A;  2JA6 B;  1BR9 A;  1WD1 A;  1MSH A;  1TR5 A;  5IOD A;  2NBF A;  5JEA H;  2J0T D;  3IAY A;  1O80 A;  3PIP 3;  1CA6 A;  5E4X A;  3GP7 A;  4JBW A;  4OO1 I;  5EQ0 A;  4QIW B;  1LTT D;  2ID0 A;  4FF4 A;  3I72 A;  4ZUI A;  3VA7 A;  5I9O A;  1EEI D;  1BQQ T;  3FPP A;  2L0C A;  1WD0 A;  4QCL A;  1I3Q B;  1I4X A;  4RGT A;  3SVM A;  1HTL D;  1HUN A;  3SR1 A;  2BDO A;  5AFW A;  3J7A F;  3HOU B;  3CRK C;  5JPM C;  3K59 A;  4MIU A;  1F9S A;  5IGB A;  1B3A A;  3HRZ C;  1T5E A;  2OT2 A;  4JK1 C;  4ZKB B;  4C56 C;  4HAE A;  2EYJ A;  3F2U A;  3S17 B;  2R7Z B;  1LTB D;  4A3G B;  2CQA A;  2WAC A;  1K8M A;  2JYO A;  5COR A;  1V1O A;  5C4J B;  2Q8I B;  3EQL C;  4XDX A;  1PRT B;  1E2V A;  2PO4 A;  3QB3 A;  4EVO A;  3K58 A;  1DYQ A;  3W2D A;  1ENF A;  2F0H A;  1ESR A;  1ENA A;  3EVQ A;  1ILP A;  3OOC A;  1SXT A;  4HN7 A;  2E75 C;  3Q24 A;  3HOX B;  3NTK A;  1EWC A;  1XXG A;  3DWA A;  3MFY A;  4RGM A;  3VR2 A;  1UEA B;  1B9N A;  4K5X A;  4OL7 A;  5NUC A;  1TWG B;  4FF1 A;  3KK7 A;  3GTP B;  5BN4 A;  1LAC A;  1QB5 D;  4CKB A;  5TSS A;  3VR3 A;  2TMP A;  3BVM A;  4A3I B;  2NWG A;  5FO8 B;  2F0U A;  1I6H B;  4HCS A;  1II3 A;  2K04 A;  4ZK9 B;  1EQV A;  1S4Z A;  3GV3 A;  4HTH A;  2I46 A;  3A54 A;  5KYI A;  3P1H A;  5D65 A;  2RSO A;  3MC0 B;  3PUW A;  3MXG A;  3VA5 A;  1BXT A;  2D9U A;  1BCP C;  1SYG A;  2O4X A;  5KNB A;  3K6O A;  3SEB A;  4HSP A;  2PZT A;  5K5P A;  2VB2 X;  2EJF C;  4KY7 A;  2FFK B;  1LT5 D;  3MWY W;  4AYB B;  2HCC A;  3MHB A;  4KTA A;  4TSS A;  1EOT A;  3GD7 A;  4FO2 A;  5KYL A;  2I07 B;  3D31 A;  1QJO A;  1T5X D;  4HSV A;  3KBG A;  4R8N A;  2A6E C;  2F0F A;  3T16 A;  1B1Z A;  2K28 A;  5EKL A;  1JCK B;  4L8J A;  1CHP D;  3MEH A;  1X32 A;  1YNN C;  1DOM A;  1ML0 D;  1J8I A;  1TS2 A;  3I91 A;  1SFO B;  2SDF A;  2R6G A;  1TU2 B;  5C3E B;  1QE6 A;  1VF7 A;  2KOL A;  1ICW A;  3DWP A;  5CV4 A;  2VNU D;  2DN8 A;  3ZYY X;  3I73 A;  4CGY B;  1E2Z A;  2EYM A;  1GHK A;  4K2L A;  1HFN A;  3RD4 A;  4K2K A;  4UAI A;  3M4O B;  3J80 E;  3GTJ B;  1MBY A;  3DMU A;  2SOB A;  2E74 C;  4J6H A;  2K33 A;  2B2Y C;  1EZ8 A;  1WTO A;  4NMZ A;  1KDB A;  4ULL A;  1SMY C;  3TBI B;  5C5M A;  4PMB A;  2SNS A;  1DON A;  1PFN A;  3HS0 C;  1RKN A;  5A35 A;  2E2H B;  5IGE A;  5M3M B;  4DU9 A;  2IX1 A;  5IGC A;  1TWA B;  1DXM A;  2O2L D;  2RVL A;  2F0O A;  1ET6 A;  3ND8 A;  1B50 A;  1CZW A;  4ZUJ A;  4IUU A;  3ITP A;  2OEO A;  2R3Z A;  2B2Y A;  2OXP A;  3TME A;  3VYR A;  2RDH A;  3MTS A;  1PYW D;  3BG3 A;  3PUV A;  5FLX L;  3U9O A;  1TQO A;  4C3H G;  2MJ8 A;  1BBX C;  5DNF A;  1PZK D;  2F0V A;  3T56 B;  2LS0 1;  4X3K A;  3L9A X;  2A69 D;  2DNE A;  3HEJ A;  2KEC A;  1QIL A;  4FXD A;  3DHQ A;  1KDA A;  1SE3 A;  1SYD A;  1RF2 D;  2EYO A;  1EYC A;  1F9P A;  4HMJ A;  5COY A;  3I3C A;  1QWY A;  5JJZ A;  3L3O C;  2B2V A;  1IL8 A;  1G29 1;  4R8I A;  1O7Z A;  3J7Y W;  1SJE D;  3QIA A;  3S2D B;  3GQB A;  5G3L F;  4IUQ A;  1LTA D;  2O5J C;  4XQQ A;  2B2U C;  1Q12 A;  3MXN A;  4TRD A;  1Y69 U;  3NQI A;  2F0J A;  2BE5 D;  3DEO A;  1EZ6 A;  5EPK A;  3OHX C;  3HOZ B;  1S5B D;  4MHE A;  5C0X J;  1S5E D;  1KAB A;  4IUV A;  4BBS B;  1EY6 A;  1HA6 A;  4R9W A;  3LNN A;  3KUP A;  4H0L C;  1MI2 A;  2KUM A;  3T4A C;  2H4O A;  2NYZ D;  2B2U A;  5KGU A;  4LAA A;  1DD2 A;  2NVQ B;  1VCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...