3U58A

Crystal structure of the tetrahymena telomerase processivity factor teb1 ab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein/dna
molecule keywords Tetrahymena Teb1 AB
total genus 40
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A02
2F3IA 4AQYL 3SGIA 3AQQA 1SMXA 1HNWL 3RLFA 1WCMH 1K73C 1IBML 4YCUA 2QGQA 1UE1A 1EYGA 2AWNA 4IO9A 1Q1BA 2EIFA 1VQJA 5M3MG 1BBWA 4DV5L 2MQHA 2CCZA 1MKHA 3EBEA 2VUMH 3PO3G 5JJIA 1C9OA 2E8GA 3CCVA 1VQOA 5K36G 1X55A 2I0QA 5LMNQ 1Q7YC 2R93G 2Z6KA 2F52A 2VQEQ 4JCVE 4IFDI 2GVBA 3ERSX 4DNIA 1DGSA 5IP9G 2RHQB 1NTGA 3I7FA 4JG2A 4OO1G 1PVOA 2IHEA 1O7IA 5LMUL 1FL0A 3PGZA 2K52A 1VQPA 4A3LG 2CKZB 3A74A 2E5LQ 4PZ6A 1KL9A 4DUZQ 4B3ML 1UE6A 3HOXH 3CF5A 4LFBQ 3M9BA 2BH2A 3HOUG 1HR0L 4R1JA 4XTCS 5M3MH 2RCNA 2V1CC 5FLXc 2VY3A 2PMZE 3A0JA 4LFCL 1Q46A 1K3RA 4JV5L 1EQQA 4B3TL 4JI0Q 3CCLA 4JI3Q 3AFQA 5C4XH 2R6GA 3CMEA 1S40A 1JJGA 4YY3Q 4KHZA 1IYJB 3G71A 3HOVG 1HJPA 4YCWA 1V43A 2L15A 4LF5Q 2ATWA 3K7AH 1GVPA 2UU9Q 3HOUH 5HGQA 2LXJA 2QEXA 2UXDQ 5AJ3L 1H95A 4X66L 4LWCA 3CCRA 3ZJYC 4AYBG 1VQ9A 1JJCB 5IWAQ 1XNRQ 4JI2L 3HKZG 1GD7A 3B6YA 4BY1G 5JJKA 4DPGA 1HZ9A 3RLOA 3FKIH 3M4QA 4GOPC 5C44G 3M4PA 4A3EH 4OWWB 4POGA 3GDEA 4JOIC 3CMAA 3G4SA 2K75A 4A3IG 4JV5Q 2D62A 4X6AH 1TXYA 1X3EA 1VQ5A 3CCEA 4ALPA 4JOIA 4JYAQ 4X65L 5JEAG 1YI2A 1Y1WH 1UWVA 2NN6I 4YWLA 2I5MX 2ALYB 1UEBA 4OWTB 4LFBL 5FJ8H 3W1GA 2A19A 4IPCA 2FXQA 4UY8C 4IFDG 1VQMA 4LF5L 3G6EA 4EX5A 2UU9L 2R7ZH 1VQAA 4UP9A 2Q2UA 1XMOQ 1KRTA 4YHHQ 3GTGH 1RL2A 2JE6I 1Z9FA 2IHFA 2XGTA 3I55A 2KHIA 2WB1E 1HZBA 4A3IH 4LNQA 3ULJA 3PCOB 2JA9A 4IPGA 3T1YL 2IX1A 4MNOA 1OXXK 1SE8A 2NN6G 4NB3A 3MXNB 2D0PA 4JI2Q 4AH6A 5GQOA 2MNAA 1VQ4A 1TWHH 2UXCL 1S72A 2WFWA 4DUYQ 1XMQQ 4PMWA 5AJ3Q 4BY7H 1WJJA 3MEFA 4BBRH 1AH9A 4DV7Q 3W1BA 1XMQL 3J81i 4A93G 2ZJQA 1QUQB 4JBJA 1EQRA 2VW9A 4DR3L 1YJ9A 4GNXC 1W2BA 4A3JH 1N8RC 3J7A5 3S1NH 4JI5Q 5GAEC 1N9WA 1K8GA 2OWOA 4POFA 4LF9Q 1LYLA 1P16A 1X54A 2E2HH 5LMUQ 4DV1L 4A3FH 4L5TA 4LF6L 2JA6H 4B3RQ 1XTDA 5FLMH 1HNXL 4A3CG 2JA5G 3J81c 4B3SQ 2NVQH 1KHIA 1E22A 4C3IH 3S2HH 4X64L 2EXDA 3CQZH 1VQHA 1YVCA 2JA8G 1XPRA 2KCTA 1U0LA 1M1KC 1JT8A 4DV0Q 4DV4L 4P73A 4RMFA 4DKAC 3I56A 2F4VQ 4NXMQ 2VUMG 1VQBA 3ICEA 2Z6KC 1HH2P 5C0XJ 2HHHL 2B29A 1C0AA 1CKMA 4IOCA 2K14A 1Q86C 1NMGA 3JAMc 2UXCQ 2VZAA 4YY3L 5M5WH 2VQFL 4PZ7A 1X9NA 3NEMA 1VQ6A 4DR5L 2LXKA 4RG1A 3KDFB 1E7ZA 1ASYA 1IZ6A 2RF4A 3RNUA 4A3LH 1EFWA 3TS2A 4QL5A 4YHHL 4A75A 1LUZA 4LFCQ 4A3KG 1WOCA 2E2JH 2IX0A 2Z0SA 2JA8H 1UE5A 1T9HA 2MFIA 4OXPA 2BA0A 3PUZA 1YBYA 5C0XG 3J81j 1KXLA 2PI2A 3H3VH 1PH5A 2K5HA 2JQOA 1YNXA 3UDFA 2IY5B 3KDFA 4X64Q 4A3DG 2OTJA 2KENA 1PH3A 4JI7L 3LGJA 5IYCH 2KHJA 3BU2A 2YU9H 4L5RC 1NBWA 4LUVA 2N3SA 4C3JH 1AE2A 4GN4B 3GTJH 2A8VA 2AWOA 2WB1G 2VL6A 4JBWA 3JC66 3DLLA 2HIVA 1SFOH 3H3VI 1OXSC 4DR2L 5IWAL 2ASBA 1VQFA 1SR3A 2ID0A 1LM0A 3H15A 2JEBI 1OXUA 3BJUA 3K7UC 4UP7A 3F2CA 2BA1A 2N78A 1KIXA 1JB7A 1IBLL 1KD1C 2JA7G 5IYBG 3U4ZA 1V9PA 2F4VL 2QA4A 3S14H 3PO2G 4BY1H 2JJQA 3UDIA 3L2PA 3M3YH 1SROA 1VQ8A 3GTLH 3STBC 4HJ7A 3CPWA 4LUZA 2HT1A 3UDGA 4LF4Q 2PNHA 4LF8L 1HNZL 3J7ZC 1VQNA 3S24A 3UE0A 1Q82C 3CCUA 3GTQH 2AMCB 2R92G 4QY7A 1PHJA 1Y14B 4JI7Q 1TWGH 1YEZA 4P75A 4NXNL 2VQEL 1BKBA 3PO3H 4QQBX 1B8AA 2VS1A 1FJGL 4DV7L 3GTPH 1X3GA 4DR4Q 1W3SA 3KF6B 3PSIA 4X65Q 4GOPB 1SRUA 1IBMQ 4L5QA 3HOWG 3I4OA 4JI6Q 4GN3B 5C4XG 4XIGS 3CC4A 1PFSA 4BA2I 3CP0A 3K8AA 3RLNA 2E5LL 4LUOA 1CKNA 4Y7NH 4B3MQ 4JC0A 4UPAA 3RN5A 1YHBA 1OTCA 3DM3A 2YTXA 2JA5H 1Q12A 3CCQA 4NPSA 1K8AC 4JBKA 1QUQA 3S2DH 4AIMA 3EIVA 2AHOB 5IYDH 2K50A 1N33L 3Q8DA 5FJ8G 3TRZA 4DV3Q 1ASZA 4DR6Q 3PF5A 4HIKA 1MJEA 1L1OA 1FVIA 4IOAA 4C2MH 2R7ZG 4BBRG 1CKNB 2ZTDA 4R4QA 1YJNA 4GNXA 1WFQA 3CC2A 2K5NA 3HKSA 1QVCA 4HJ8A 4AQYQ 1A8VA 1VQDA 3S15H 3KF6A 4A3GG 4DV6L 3NBHB 5IP7H 4WJ3M 1Y1VG 2I5HA 4JI5L 2MO0A 4GLVB 4JI3L 1EWIA 5IYDG 4LF9L 2I5LX 1S3OA 1WCMG 3PF4A 3S1RH 1LTLA 1OXVA 1VCIA 3TQYA 2YYZA 4OX9Q 2E2IH 3HOZH 1XJVA 2KBNA 3F2BA 3TEHB 1IL2A 2K4KA 4GNXB 3U50C 2PQAB 3S17H 1VQCA 4GKJL 3GTOH 3KJPA 1C7YA 2NZHA 1QVFA 1JMCA 4P72A 3PUXA 2PQAA 1P8LA 5ELOA 5EAYA 1N32Q 3RR5A 4JI6L 1L0WA 2CQOA 5GROA 3I4NH 1G51A 2A1AA 1N36L 5IP7G 1XPOA 1CSQA 4JI4L 4A3BH 2UUBL 4DK3C 3E0EA 1PH4A 3T1HQ 2WAQE 1Q8KA 1M90C 4GS3A 1A62A 1EIFA 1UE7A 3HKZE 1IBLQ 4P71A 3PIOA 1VQKA 1PH1A 4DAMA 5M5XH 5IT9c 2D0OA 2N8NA 4P74A 1N33Q 4JYAL 2NVYH 3CD6A 1WYDA 3KF8B 5GAGC 4OX9L 3CC7A 4HJ9A 2OTLA 1J5EL 4LFAL 2H5XA 3K0XA 3CPFA 2OQ0A 3I4MH 5J3BA 4DV2Q 3BZKA 1N34Q 1PV4A 1I3QH 2Q2HA 5BR8Q 3HOYH 4GKKQ 1GM5A 2GN5A 1QVGA 1YJWA 4C3HH 3HOVH 4IJHA 2Y0SG 1TWFH 3AFPA 3GD7A 1IXRA 2IT1A 3S1MH 1X65A 3OTOL 4GLAC 1XNRL 1GO3E 1TWCH 1B70B 4A76A 4DR4L 1FJGQ 4BXXH 3HOWH 1U5KA 1E24A 1AE3A 1G291 1J6QA 1VQGA 4MZ9A 4OWXB 3T1YQ 4QGUA 3U58A 1YHQA 2AKWB 4A3EG 3T1HL 3UE1A 1HR0W 2UUAL 3W5OA 1VQ7A 4B3SL 2ZM6Q 4K0KQ 2K5VA 1PA6A 3HOYG 1IBKL 5FLMG 1N32L 4A3KH 4DAYB 3PUYA 4JI8L 3S16H 3D31A 4YWMA 4DR7L 1YZ6A 5GAHC 2XTIA 4DR7Q 1JJ2A 4JI1L 4IPDA 1V1QA 2CWPA 2VQFQ 4DR1Q 1L1OB 1KQSA 2R7FA 5LMNW 1X6OA 4YWKA 1PYBA 4TVAB 4DR1L 4A3GH 1GKHA 1Y1VH 1Q1EA 3CAMA 3I2ZA 4A3MG 1EOVA 5M3FG 4PZ8A 2CWAA 5H1SE 4LF7Q 2DGYA 1I50H 4H02A 4HJ5A 1NJIC 4NXNQ 5C3EG 3HOZG 3E9IA 2B63G 5LMNL 2UXDL 2C35B 3GO5A 5M5YH 1YHAA 1IBKQ 1NY4A 4A3JG 1VQIA 3K80C 4ME3A 4DV3L 1D8LA 4A93H 4PG3A 1I94L 2ES2A 4O2DA 3U4VA 1XNQQ 1HNWQ 2UXBL 4LW1A 1HNXQ 5IP9H 1VQEA 3H0GH 4HIDA 1PYSB 2LSSA 2R92H 1A63A 4KI0A 5M3FH 5C3EH 4A4IA 4APVA 3HOXG 1K9MC 1CSPA 2OCEA 3TS0A 2HIXA 4NXML 1OXTA 4J15A 3FP9A 4X62L 3CCSA 4DV0L 1MIUA 1EUJA 1SLJA 3STBD 4DV4Q 2OQKA 4HIMA 1K83H 1I5FA 2Q2IA 2RHSB 2HQLA 3HFZB 4R4OA 5ELNA 1VQLA 4LF7L 5IE8A 3PO2H 1E3PA 4QJFA 4WJ4A 4O0AA 3FKIG 3RZDH 4Y52H 4LFAQ 1J5EQ 1A0IA 3RN2A 3ULLA 3GTMH 2DUDA 4EQ5A 3H0GG 5E7NA 2WP8J 3RZOH 3I4NG 1XMOL 2VNUD 4DR5Q 4BBSH 3L7ZC 4FDBA 1EIYB 3G48A 5HY6A 3VDYA 1VS0A 2BH8A 1Y1WG 1JE5A 1FGUA 4DV5Q 1CUKA 4BA1I 1HR0Q 4L5SA 4IJLA 4DUYL 2R93H 2EQSA 3M85A 4LF4L 3KFUA 1L1OC 2NZOA 3OW2A 1G6PA 1MJCA 4YCVA 2ZJRA 4HJAA 5C4JH 4JBMA 1KRSA 3KJOA 4TQUS 1Q81C 4A3BG 4DUZL 4K0KL 2NVXH 1HZAA 1I94Q 3UDXA 1XNQL 2HHHQ 4IPHA 3IRBA 4BBSG 3NELA 1WI5A 1CKOA 1YIJA 1D7QA 3CW2C 1XPUA 3S1QH 3A5UA 5IYBH 1KAWA 1Z47A 2Y0SE 2YTYA 1B7YB 3ULPA 1PH2A 3OTOQ 3KOJA 4X66Q 1BVSA 4DV6Q 1PH6A 4R4IA 3PV0A 4GOPA 4UP8A 5DLQE 4OO1I 3PIPA 2N49A 4LF8Q 3AEVA 1PH9A 3E9HA 5C0XI 5JJLA 4HIOA 3GTKH 3KYHC 1E1OA 4GKKL 4DK6C 4DV2L 1N34L 2KCMA 2B3GA 2UUCL 3TREA 3F8TA 2R7DA 3KLWA 2ZJPA 4JI1Q 4R4CA 3J80i 1X56A 3BZCA 3FHWA 4BXXG 3CXCA 3L0OA 2WAQG 4KHPQ 3OYYA 3CCMA 1BBUA 4R4TA 2NVTH 4JI8Q 4KHPL 3CCJA 2CFMA 1HZCA 3PUVA 4DR2Q 3JAMi 1NMFA 1L2FA 2ZTEA 1N36Q 2UUBQ 5C44H 2UXBQ 4KLKA 2ZTCA 2ZM6L 1KC8C 2UUAQ 4JI4Q 3I4MG 2YTVA 2MO1A 4LF6Q 4B3RL 4A3FG 1PH8A 1TWAH 2GVAA 4GN5A 4AYBE 2JA6G 3M4OH 4GKJQ 5JEAJ 4A3MH 4DR6L 3WWVA 1E1TA 5GADC 4QIWE 1YITA 4JI0L 3M7NA 1X3FA 3NENA 5IY0A 3EN2A 4B3TQ 4DR3Q 1SN8A 1K0RA 2PI2E 3A5ZB 4OONA 2Q2TA 4X62Q 4BY7G 4IFDJ 1PH7A 3F2DA 1QZGA 2B63H 2JA7H 3K81C 2JK8A 1HNZQ 1RIPA 4GLXA 2UUCQ 4DV1Q 4A3DH 1R9TH 3J80c 5BR8L 3F1ZA 3D0FA 5IYCG 2JEAI 1NE3A 2YV5A 3ER0A 4MTNA 3AYHB 3PUWA 1QZHA 1I6HH 4A3CH
chains in the Genus database with same CATH superfamily
2BDOA 1WCMH 3D4WA 2L11A 1IBML 4YCUA 1W6KA 1PDQA 5CV8A 3JAML 2AWNA 1BF4A 2FMMA 2L5TA 4IO9A 2CCZA 1BBWA 1MKHA 2VUMH 5IGEA 1D2BA 1HUMA 4O1NA 5LMNQ 2R93G 2VQEQ 4DNIA 1DGSA 2RHQB 2F0VA 4JG2A 1SBBB 1GUSA 1PVOA 1O7IA 1FL0A 4TRDA 2K52A 1TR5A 4A3LG 1KL9A 3CF5A 3M9BA 2BH2A 3HOUG 3X3NA 4C3IG 3D8GA 5L37A 2RCNA 5I6WA 2VY3A 1Q46A 4B3TL 3C46A 2NVTB 4U68A 3PQIA 1S40A 2NWGA 2A6EC 4A3JB 3S1NB 4ZUIA 2E2HB 4YCWA 4RGOS 4BY7B 2LMCB 2DJFC 3O13A 5TSSA 1SNPA 5HGQA 3IAYA 3Q23A 2UXDQ 3BDCA 2TMPA 3QWNA 1CA6A 4LWCA 1DZ1A 1EY5A 3OIPA 1JJCB 1W6JA 1JWUD 2RBMA 2MUYA 2IW3A 4GOPC 3VA5A 3K5NA 4OWWB 4UAIA 2PCFB 2K75A 1CZWA 4KHVA 3IKJA 4X6AH 2JP1A 4JYAQ 5C4JB 5KIXA 1YI2A 1UWVA 1D1KA 2NN6I 1JOKA 4YWLA 4LFBL 3W1GA 4IPCA 4UY8C 1VQMA 3G6EA 4PNYA 4EX5A 3OIQA 1VQAA 3MFGA 4FF2A 2JE6I 1Z9FA 1S5FD 3NBHA 1F2MA 2WB1E 3ULJA 5C4HA 3NTIA 3VR5A 2NN6G 4X3UA 5CYUA 3HP3A 2Z1CA 2WFWA 5I2XA 1BO0A 3PIP3 1B9NA 3K7AB 1WJJA 2JN4A 4BBRH 3W1BA 1W2BA 3K58A 4GNXC 4RKBA 4A3JH 3S1NH 4JI5Q 1EWCA 5GAEC 1K8GA 1LYLA 2E2HH 1B50A 4DV1L 4L5TA 4LF6L 3EQLC 4B3RQ 2B2VA 1XTDA 1HNXL 1NR2A 4PMBA 2PZTA 4X64L 2EXDA 1LTRD 3CQZH 1YVCA 5M5YB 1XPRA 2KCTA 1M4VA 1U0LA 1JT8A 4DV0Q 4DV4L 2D9UA 2RSOA 3I91A 4NXMQ 2BDNA 1VQBA 3GTKB 1C0AA 2K14A 1NMGA 3JAMc 2QKIC 1I50B 1ZEQX 2VZAA 3E0JA 4PV1C 5ELDA 3OWEB 1X9NA 1JE4A 1TY2A 1YNND 1V1PB 3K5OA 2IX0A 2Z0SA 2JA8H 4ME5A 4A3FB 1T9HA 2MFIA 3EFXD 3A8KE 2HDMA 3PUZA 4C2MB 5C0XG 3J81j 2PI2A 3SXHA 1PH5A 3M3YB 5I4DA 1JICA 3KDFA 1EU4A 4V190 2OTJA 1SXTA 4JI7L 2KHJA 2BOSA 2WV6D 1M8AA 2EJMA 2FFKB 4J1MA 4N9PA 5FO7B 3RZDB 4JBWA 4KD4A 1GUGA 5T1IA 1CI3M 4CDCC 1Q90A 1VQFA 1LTGD 3P1HA 4R8IA 2JEBI 3F2CA 2NVQH 1H9RA 1JB7A 4IFDH 4NMZA 5BN3A 3PO2G 1FGBD 3MC0B 3UDIA 1VQ8A 5A2QL 2NUCA 5HGTA 3RMHA 3UDGA 1MHWC 4LF4Q 1HNZL 4ZKBB 3J7ZC 1R4QB 3S24A 1VQNA 1H9MA 2F4IA 4QY7A 1PHJA 3I4LA 4DAYA 1H9KA 1BKBA 3GTPH 1X3GA 1W3SA 3PSIA 4GOPB 1IBMQ 1SMYD 4H13C 1SRUA 1KDBA 1KLUD 1ZYRD 4L5QA 1H9JA 3FDTA 3CC4A 4BA2I 3Q24A 4S3SA 4Y7NH 2DY7A 4UPAA 1SFOB 5KEEA 1L0YB 2JA5H 1EIHA 4AIMA 3CKIB 3FVQA 2VXWA 3TRZA 4DV3Q 1TIID 2WACA 5ELBA 3ND9A 4KKSA 1L1OA 1XXGA 1SDFA 4BBRG 1CKNB 4GNXA 3OMCA 3FMCA 1QVCA 1HQMC 1VQDA 3S15H 3KF6A 4A3GG 2GA4B 2F0QA 1Y1VG 3IL8A 1EWIA 4XQJA 4LF9L 1EWHA 1HCZA 2I5LX 1TS2A 1WCMG 4ZRZA 5C6AA 1VCIA 4A3IB 4V0BA 4KY6A 3TP5A 2KBNA 3SK8A 4UHVA 2RA4A 3F2BA 4DXFA 1GUNA 4GNXB 3U50C 4QUFA 1TWCB 4BS9A 2HD3A 2KCCA 1C7YA 3OMGA 4OEMB 4C1NK 4JI6L 2AUJD 1S4ZA 4A3BH 3E0EA 1AP0A 4L8JA 3T1HQ 3FEWX 5IIFA 2NVYB 2PMZB 3SEBA 1RDPD 4CDEC 1JOQA 1PH1A 1PTOB 1IYVA 2N8NA 4P74A 3K57A 1B44D 2NVYH 2OXPA 4ZLTF 3CC7A 1J5EL 3SE0A 3K0XA 3CPFA 5BN5A 3VR2A 3NQTA 2Q2HA 5BR8Q 4GKKQ 2XNAC 1I6VC 4X3SA 1YJWA 2Y0SG 3AFPA 3ZYYX 1IXRA 1G91A 1X65A 3Q0AA 1XNRL 1GO3E 4I65A 1E24A 1AE3A 1G291 2KHSA 2EE1A 2AKWB 1HR0W 3VYSA 3TDQA 3A8IE 1A2TA 1K28A 2K5VA 1PA6A 5FLMG 3EA6A 4JPBW 1SYCA 1N32L 2V4DA 1B2TA 2A68C 4DR7L 2IJ0A 2L55A 1RHPA 2BCOA 2XTIA 5CV5A 4F87A 1VF5C 3DWPA 2P5ZX 3T4AC 1X3PA 4CJ0B 2QILA 5LMNW 1EIGA 2RDFA 1GKHA 5EGTA 4WJWA 1Q1EA 4A3MG 5M5WB 4PZ8A 1SJED 1NJIC 2PYKA 3C3LA 4NXNQ 5C3EG 2UXDL 2RKSA 5M5YH 3NPPA 1K8OA 5KYIA 3QB3A 1JQYD 1LT6D 3MA2B 4LW1A 1GUWA 2BE5C 3F2UA 4KN4C 2J7ZA 1VQEA 2WINB 4HIDA 3H3VC 3SHLA 4RGMA 2WIIB 3K0YA 4RGTA 4APVA 3C1EA 4NXML 5G3LF 1B9MA 1OXTA 4JVZA 5ELEA 3CCSA 1UNSA 4IZ8A 1U4RA 4RKLA 1EUJA 1SLJA 2C5CA 2L0CA 2OQKA 1K83H 2Q2IA 4R4OA 2ICEC 2HQLA 3HFZB 5ELNA 3PO2H 4WJ4A 3J7YW 3FKIG 4LFAQ 4XQNA 3S14B 3GTMH 1PFMA 1A3TA 4QF4A 4Z9CB 2VNUD 1HTPA 1PLFA 2HDLA 3G48A 1VS0A 4NW2A 4O42A 1U9RA 4BA1I 3EJIA 2EQSA 4LF4L 3KFUA 2NZOA 5IGDA 5IODA 5IT9E 3V05A 2ZJRA 4HJAA 3BVZA 3KJOA 4A3BG 5CORA 1F9PA 3UDXA 2HHHQ 1Y69U 1ILPA 1WI5A 3CW2C 3FPUB 3S1QH 1RCVD 3TZUA 3ULPA 1Q3LA 3KOJA 3SDZA 1QCBD 1PH6A 1Y8NB 3MXGA 1MI2A 2R93B 2MHVA 5C0XI 3GTKH 3P75A 4DK6C 1EU3A 2B3GA 3I70A 4DK0A 2F0NA 2R7DA 3KLWA 5JAVA 1AW7A 2MGSA 4BXXG 3CXCA 3CCMA 4EQOA 5HURA 5C3XA 3LNNA 3CCJA 2IL8A 1DOMA 2KECA 4ABNA 1L2FA 2RQXA 1AEXA 1YNJD 4X3TA 3R2IA 4JI4Q 2ZTCA 4DU9A 4DXGA 2YTVA 4LF6Q 4B3RL 4A3FG 3P20A 1TWAH 5IGBA 2N55A 5CR3A 4AYBE 4A3MH 2XRQD 1E1TA 3WWVA 4QIWE 5GADC 4JI0L 3NENA 4B3TQ 1TU2B 5DAUA 1K0RA 4BY7G 3A5ZB 2Q2TA 3W3AA 4IFDJ 1PZKD 2A6ED 2JA7H 1YNJC 2RSNA 3GTJB 4DV1Q 1R9TH 2JEAI 2MP1A 3J80L 1LTAD 4MTNA 1SNOA 4AQYL 1FNWA 5JOBA 3VR6A 1K73C 3BDOA 1UE1A 1RTOA 1Z6HA 2WKCA 4DA2A 1C9OA 3U9SA 4J8QA 1AZQA 1Q7YC 2Z6KA 2F52A 4KMUC 4JCVE 4DN4M 4IFDI 3ERSX 1BCPD 4OO1G 3HG9A 3M4OB 2EYFA 1FNUA 3AU7A 5DNFA 2E5LQ 4PZ6A 4DUZQ 2SNMA 3HZXA 3J80E 1UE6A 3HOXH 4DK1A 1HR0L 5I6YA 5J22A 3S15B 2V1CC 5CBEE 5C4XB 4LFCL 1WTOA 1X3QA 4JI0Q 4IURA 1K8MA 5C4XH 2R6GA 4EQNA 2IWHA 4KHZA 2G9DA 2JA6B 2F1MA 1SAPA 3G71A 4FXGC 3HOVG 1HJPA 1SE4A 3HOUH 2QEXA 3SR1A 3WDNA 4BBRB 3ZJYC 1AZPA 1CT1D 1EY7A 3R2TA 4IUQA 1TT2A 3RLOA 3FKIH 1ESRA 3M4QA 5C44G 1EY8A 4JK1C 4POGA 5KYLA 2E74C 4A3IG 1QNUA 2B8GA 1TXYA 3OWFA 2B2UA 3SK4A 1NCVA 3CU7A 1QILA 4HCEA 1JOOA 1UEBA 1R9TB 4OWTB 4HN7A 3G6JB 3NBIA 3QG1A 2ZT9C 1CFMA 4LF5L 2E2DC 1PTOH 1YNNC 1KRTA 3GTGH 1PRTD 3L9AX 2CW0C 2E2IB 2XGTA 2F03A 3I55A 1TWGB 2A68D 1HZBA 3PCOB 2IX1A 3T1YL 3CCQA 4NB3A 2D0PA 2MNAA 4A3BB 5BN4A 1UAPA 1CK1A 5C4ZA 1S72A 4DUYQ 1QNKA 3J81i 2F0WA 1QUQB 2VW9A 1EQRA 2PPBC 2EZVA 3OOCA 4KKTA 5LMUQ 4A3FH 1NAPA 2Z9HA 4C3IH 1M1KC 1KNEA 4WRDA 2VUMG 1JC7A 3ICEA 2Z6KC 5C0XJ 2HHHL 1DXMA 2B29A 2QDBA 4IOCA 1MSGA 2UXCQ 1CQVA 3KLRA 2FMCA 1I4GA 2Z6BA 4YY3L 5IGGA 4PZ7A 3VYUA 3NEMA 4DR5L 4RG1A 3KDFB 1E2VA 3OSOA 4A3LH 3J81L 1E2ZA 4YHHL 4A75A 4LFCQ 5EKIA 5CGKA 1ENCA 2EYPA 1UE5A 3BVGA 1KXLA 2K5HA 4R9WA 1SNCA 3NTKA 4A3DG 2KENA 1LTBD 1V1PA 1CZGA 1NSNS 1Y8PB 1JR0D 4C3JH 3J7AF 1HA5A 4GN4B 2F0DA 2AWOA 1EZ6A 2VL6A 3N52A 2B63B 5KGUA 1OXSC 4DR2L 4CDDC 1I4QA 2ASBA 4HMIA 1WCMB 2BA1A 1KD1C 2JA7G 3U4ZA 1V9PA 2F0GA 3PO3B 5FOBB 2F0SA 2Z4IA 3A55A 3GTLH 1F2LA 3STBC 4HJ7A 4IUVA 1C4QA 2JA8B 1D5XC 3UE0A 1PXUA 2F0FA 2R92G 5D65A 1O80A 1YEZA 5D3IB 1KLGD 4P75A 4NXNL 2VQEL 4QQBX 3FKIB 3T53B 5C4XG 4XIGS 4K6DA 1GHJA 1QWYA 2X6LA 3H0GB 4LUOA 4RFBA 4B3MQ 1B3QA 1LLRD 4M8AA 1IW7C 1YHBA 1EOTA 3Q22A 5EPKA 5J1ZA 1K8AC 3S2DH 4B9WA 1JCKB 1EQVA 2K50A 1EL0A 2XRSD 3DEOA 1S5BD 2B2TA 2ZTDA 3R3OA 1HRJA 1WFQA 3K6OA 1RTNA 3MXUA 2K5NA 4AQYQ 3T13A 4RA8A 4JI5L 4KJNA 2SOBA 2MO0A 4JI3L 3S1RH 1LTLA 1ET6A 1WTWA 2YYZA 3G7LA 4OX9Q 4ZKCB 3KBGA 3TEHB 3DWQA 2DN8A 1EQTA 2ZXOA 2K4KA 4FYDA 1VQCA 4I7ZC 3KJPA 2B39A 2PQAA 3I73A 3NSWA 5EAYA 1N32Q 1L0WA 3I4NH 1G51A 2BE5D 5IP7G 4DK3C 4B08A 3A7LA 2WAQE 1F77A 4GS3A 4NKLA 4A3MB 3HKZE 4P71A 3PIOA 1PRTC 2X69A 1B53A 1WYDA 5G3LD 5GAGC 4OX9L 2OTLA 4LFAL 1PFBA 2H5XA 4A93B 2OQ0A 1N34Q 1AN8A 1PV4A 3HOYH 1GM5A 1HA6A 4C3HH 3HOVH 1TWFH 3GTOB 3GD7A 2IT1A 4M1UB 3S1MH 2NBFA 4DNRB 2R7ZB 3BZDB 1A3VA 1TWCH 4A76A 1B70B 3C2PA 2M9VA 1LTSD 3HOWH 1U5KA 1YHQA 3DXJC 4A3EG 3T1HL 2LFNA 3UE1A 5C5LA 2UUAL 5EBCA 4B3SL 4RHSA 3E3XA 4K0KQ 2HCIA 5M3MB 3PUYA 2EXZA 4YWMA 1XTCD 3RD4A 4HSPA 1LTID 5EPLA 4DR7Q 2QW7A 3T51B 4ZK9B 1F2ZA 2TSSA 3OPOA 1HXYD 1V1QA 5NUCA 4RWSC 3C1FA 1O7LA 4CKBA 1Y1VH 5FLXL 3I2ZA 1QG7A 5COYA 5M3FG 2EPBA 4LF7Q 4N8X1 4HJ5A 1HPCA 3HOZG 3E9IA 2B63G 3S9WA 2DJGC 1TKWB 4KY7A 3R8BA 4DV3L 4A93H 3HOVB 1VF7A 1I94L 2ES2A 1XNQQ 2UXBL 1U4PA 3I8ZA 1PYSB 2LSSA 1GUOA 2R92H 4HTHA 4KI0A 1TS3A 1UUPA 2HIXA 4CGYB 2R92B 2JYOA 4J15A 4OIJA 1EY9A 5C44B 4DV0L 4DV4Q 4HIMA 4LNQA 2RHSB 4LF7L 5IE8A 4QJFA 4O0AA 2H1EA 1J5EQ 2R61A 4BWGB 3ULLA 3GTGB 3H0GG 2WP8J 3I4NG 4MIUA 3TP6A 1RD9D 5JEAH 2BH8A 4DV5Q 4HAEA 1O78A 1EYAA 2R93H 3M85A 2K28A 1L1OC 4C1NI 2X6GA 5CMDA 5C4JH 1DONA 4FP5D 1TWAB 1IYUA 1I94Q 1QOHA 2EYJA 2NTSA 4ZQ3A 1XNQL 4IPHA 4BBSG 2O4XA 3MTSA 3NELA 1CKOA 3A5UA 3OHXC 5IYBH 1KAWA 2YTYA 4KD3A 4X66Q 2O5JC 4R4IA 1DYQA 5DLQE 2N49A 3AEVA 3KYHC 4HSVA 3R93A 1N34L 3NXWA 3F8TA 2ZJPA 4JI1Q 3BZCA 4NP5A 2WAQG 3OYYA 1D5ZC 2EDGA 2EYHA 2NVTH 2PNRC 1EY6A 5M9OA 2NZ1D 2UUBQ 2KEDA 2MPMA 3D4DA 4KLKA 4F8MA 1KC8C 3I4MG 2MO1A 4XXEA 1LT4D 3DWAA 1I6HB 5JEAJ 1KDAA 2KUMA 2B2YC 1X3FA 3KBXA 2OEOA 5JVG3 2PI2E 3GP7A 4KKUA 1PH7A 3F2DA 2A6HD 1QZGA 2B63H 3K81C 5I9OA 1HNZQ 4GLXA 4A3DH 5BR8L 1PTOC 1SE2A 5IYCG 2YV5A 1WTQA 3ER0A 2F0LA 4HR7B 3QR8A 3PUWA 1QZHA 3D6CA 2WKDA 2F3IA 4A3EB 3SGIA 3AQQA 4XDXA 5KNDA 1FD7D 2F3VA 2B2TC 3HRZC 2JA7B 5M3MG 1VQJA 4OGQC 1FNVA 3EBEA 3PO3G 1VQOA 3NUCA 4HEDA 1MBYA 2K32A 1NTGA 3I7FA 2QF7A 2PW5A 1I4RA 5LMUL 3PGZA 4PMCA 2CKZB 3A74A 2IX3A 3H6MA 1G8ZD 2Q8TA 4B3ML 4LFBQ 4R1JA 4ZUJA 4XTCS 1PRTF 1B3AA 3NTHA 1BDOA 3A0JA 1Q8IA 3S2HB 1K3RA 1EQQA 1HHVA 2MJ8A 3CMEA 4YY3Q 4RAUC 1Z7TA 4KV6A 4XT3B 3J7AV 5IGFA 4IUPA 4LF5Q 1QJOA 3K7AH 3N6RA 1GVPA 2UU9Q 2LXJA 4TKOB 5AJ3L 4X66L 4AYBG 3QOLA 1XNRQ 1LV9A 4YIJA 2Q8IB 1RODA 3LX0A 1GD7A 5JJKA 1HZ9A 2VUMB 4ZCKA 4A3EH 5C5MA 2EVBA 4G4KA 1CQFA 4JV5Q 5FKAC 1J8IA 1X3EA 2AQ1B 2R3ZA 1VQ5A 2SDFA 1EEFD 1PYWD 5JEAG 1Y1WH 1L0XB 5EPJA 3K5LA 1K0SA 3I4NB 4G7ZC 2ALYB 1C8CA 5FJ8H 2F0EA 4E6IA 2A19A 2JSOA 2FXQA 1PTOD 1Y1WB 5CV7A 1LT5D 1QB5D 2R7ZH 4UP9A 5EBDA 1RL2A 2IHFA 2HQEA 4A3IH 2JA9A 4JI2Q 1OXXK 1SE8A 1VQ4A 5GQOA 1SYDA 1XMQQ 5M5XB 1UEAB 4BY7H 4DV7Q 1STNA 1V1OA 4A93G 3H3VI 4JBJA 4DR3L 1YJ9A 4K5XA 1N8RC 4WJ3M 2D2CC 4K5VA 2OWOA 4POFA 2KQ3A 4HMJA 5FO8B 1ZKOA 3ND8A 2AUKA 2JA5G 4B3SQ 1KHIA 1E22A 2NN6H 3S2HH 1XYIA 1BNZA 1VQHA 1SNDA 2JA8G 4P2CB 3M7GA 1HQRD 2B2VC 4WORA 2KOLA 1PFNA 2I07B 1BBXC 2VQFL 3RUZA 2PW7A 2LXKA 2Q8RE 4N8FA 1ASYA 1IZ6A 2RF4A 3IFDA 3RNUA 1EFWA 4QL5A 1LUZA 1PMRA 3A54A 4OXPA 3BG3A 1YBYA 4FXKC 5J39A 4Y7NB 3H3VH 3UDFA 3VA7A 4X64Q 3SK5A 3LGJA 5IYCH 1HUNA 3DEPA 1ZXTA 4XYQA 4XYOA 5JPNC 2YU9H 4L5RC 4LUVA 1LO5D 3VYTA 3GTJH 3JC66 3JAME 2LKVA 2HIVA 3GTMB 5KRUA 1SR3A 3SVMA 1LM0A 3H15A 3BJUA 1KIXA 2PZUA 5C0XH 2K01A 2KA7A 5IYBG 2F4VL 1XWEA 2HUGA 1SROA 3CPWA 4EVOA 2HT1A 1FR3A 2KEEA 4LF8L 3GTQH 3MAQA 3QIAA 3CCUA 1Y14B 4K6LA 1TWGH 2DNCA 3PO3H 2Z4HA 1FJGL 4DR4Q 5A2QE 3KF6B 4X65Q 1TS5A 1B4OA 3I4OA 3KF8A 4JI6Q 3J81E 4GN3B 2XWJB 1PFSA 3CP0A 3RLNA 2NYZD 2E5LL 4OO1H 1CKNA 4JC0A 1WTPA 3RN5A 1O7YA 3QO2A 4H44C 2YTXA 1Q12A 5E3FA 2B2UC 2EYLA 3TZDA 4JBKA 4TSSA 3EIVA 2F0PA 4DAPA 5IYDH 1DOLA 4CKEA 3Q8DA 1N33L 1ASZA 3ERQA 2Y0SB 4DR6Q 4RCOA 4KY5A 3NHHA 1MJEA 3TN2A 4IOAA 4C2MH 1SJHD 1YJNA 4AYBB 5EJWA 4IUNA 1TS4A 2WB1B 1SEBD 3CC2A 3HKSA 3QJYA 1U4MA 3S2DB 2M2LA 1F9QA 1TY0A 2I5HA 2B2WC 1S3OA 3PF4A 3H91A 2QCPX 1JB3A 3TQYA 1JWMD 1OXVA 4ILWA 2RDGA 1VMCA 1XJVA 2XN9C 1BOSA 4RH6A 1IL2A 4CJ2C 1VMPA 2F3WA 1SSOA 2PQAB 1TWFB 1HTLD 2EY5A 3GTOH 2NZHA 1JMCA 4P72A 3PUXA 1P8LA 5ELOA 3TSSA 3RR5A 1T5XD 2CQOA 1N36L 1KAAA 1CSQA 5EKLA 1XPOA 4N9TA 2UUBL 1H9SA 2ICIA 1PH4A 1Q8KA 4K14A 1EYCA 3HOWB 1A62A 1EIFA 4ZAIA 5M3FB 1UE7A 1IBLQ 4UDUC 4DAMA 5IT9c 2D0OA 1N33Q 3I4MB 4JYAL 2KJXA 4G57A 5CV9A 1GUTA 2CHBD 5J3BA 3I4MH 1STHA 1I3QH 1QVGA 4IJHA 5JPMC 4FNFA 3OTOL 4GLAC 3TP8A 3T16A 1GHKA 1PTOF 2O2LD 1A3UA 2FINB 4MZ9A 1G6ZA 4IUTA 4EQPA 4QGUA 2F0JA 4G7OC 1R4PB 1F9SA 1VQ7A 4C3HG 5I9PA 2B2YA 2RCFA 4IQZA 2D5DA 1IBKL 3HOYG 4DFAA 4A3KH 4DAYB 1IL8A 1FYCA 1XX8A 1YZ6A 5GAHC 2ENBA 4A3KB 4XT1B 1JJ2A 1TQOA 2CWPA 5JVH3 1L1OB 3TMEA 4DR1L 4A3GH 4MHEA 1VDZA 4H0LC 1EOVA 2DGYA 3A56A 3I3CA 4BBSB 1ESFA 1TVXA 1NY4A 1I3QB 1VQIA 1D8LA 4PG3A 4O2DA 3GTQB 1HFNA 1HNXQ 5IP9H 3NK9A 3H94A 2QDLA 1BCPB 1A63A 1RJTA 3ONAB 5C3EH 5M3FH 4A4IA 1K9MC 4K2LA 3W2DA 3HKZB 4BY1B 2PO4A 1MIUA 1SNMA 1I5FA 2H4OA 2WAQB 3L3OC 1E3PA 3EROA 3RZDH 4Y52H 1LTTD 3CRKC 2EY1A 3RN2A 1LACA 2DUDA 5E7NA 3NP8A 1ET9A 2L1BA 4DR5Q 3BYTB 1BCPC 4FDBA 3L7ZC 4OELB 4QUCA 1CHQD 2VB3X 1EIYB 1Y1WG 2EYOA 4K8IA 5ISRA 1CUKA 1GXDC 1HR0Q 3HEJA 4IJLA 5CV6A 4KJOA 4I7AA 1G6PA 3TBIB 4JBMA 1S5CD 4TQUS 4K0KL 2NVXH 1HZAA 3IRBA 3HGBA 1YIJA 3VYRA 3I90A 2NVXB 1O7ZA 1XPUA 3MVVA 2Y0SE 1PH2A 1B7YB 1BVSA 4DV6Q 1LT3D 4UP8A 2JA5B 4OO1I 4LF8Q 3CQZB 1NR4A 1PH9A 5JJLA 2N88A 1E1OA 2NB0A 3HOXB 2KCMA 2UUCL 4GZYC 2F0OA 1A2UA 1PZJD 2KCNA 4R4CA 3FHWA 3L0OA 5D3DA 3DHQA 3GQBA 1SNQA 4JI8Q 4KHPL 1HZCA 4DR2Q 1NMFA 1K83B 2ZTEA 5LL6X 1I4HA 2UXBQ 1JWSD 4K8JA 2O5IC 2ZM6L 2DY8A 3D3RA 1SYFA 2GVAA 1ENAA 4GN5A 2JA6G 2NVQB 2F0HA 4DR6L 2FJ2A 3M7NA 1SYGA 3EN2A 2K1BA 2CH4A 1SN8A 4DR3Q 4X62Q 1EEID 3J80c 1MD2D 5T1GA 3U9OA 1NE3A 4DNTB 5F2DA 1I6HH 3NE5B 4A3CH 1D1IA 2YU9B 2E75C 1SMXA 5K5PA 3RLFA 1HNWL 2QEJC 2QGQA 5LHY1 4C3HB 1EYGA 1Q1BA 2EIFA 3HOYB 4DV5L 5JJIA 2EJFC 2MQHA 5CC4A 2E8GA 3CCVA 5K36G 1X55A 4QIWB 2I0QA 3BS1A 2GVBA 5IP9G 2EY6A 5AFWA 2IHEA 3D6WA 4EGVA 1VQPA 3MEHA 3ITPA 3A8JE 2F0UA 5M3MH 5FLXc 2PMZE 1H9SB 4JV5L 3CCLA 4JI3Q 3AFQA 1JJGA 1S5ED 1WTXA 1IYJB 2VB2X 3X3MA 3MZ5A 1V43A 2L15A 2ATWA 2F0KA 1ILQA 3QOJA 4ULLA 1H95A 1KDCA 3CCRA 2A73B 2AQ3B 1VQ9A 5IWAQ 4JI2L 3HKZG 3B6YA 4BY1G 2F0IA 3S1QB 4DPGA 4OL7A 3M4PA 5DEHA 2FHTA 1T5EA 3GDEA 4RGNA 4JOIC 3CMAA 3Q6SA 3G4SA 2SNSA 2EJGC 4KTAA 2D62A 1A6XA 3CCEA 4ALPA 4H7BA 4JOIA 4X65L 1SYBA 2I5MX 3P7JA 2NTTA 2XWBB 4IFDG 3UI2A 4C3JB 2Z8LA 2UU9L 2Q2UA 1XMOQ 4YHHQ 2RDHA 2KVMA 4A3DB 4KN7C 5E4WC 4LJZC 3KK7A 2KHIA 2A5HA 3KLSX 4IPGA 1ICFB 4MNOA 4AH6A 3K5MA 1WTVA 3MXNB 1DCZA 4XQQA 5I2YA 2XVSA 1RKNA 1TWHH 2UXCL 2L12A 3A7AB 3MFYA 4PMWA 5AJ3Q 1AH9A 3MEFA 1WVLA 3GV6A 2E76C 1XMQL 5KNBA 3BDLA 1ONLA 2ZJQA 3J7A5 1G2TA 4FO2A 2DNEA 4J6HA 1N9WA 2K04A 4LF9Q 1P16A 4QCLA 1X54A 3LWEA 4L63B 1A15A 3AMUA 1STGA 5A35A 2JA6H 1C48A 3MXPA 1ICWA 5FLMH 4A3CG 2OT2A 2XIWA 4RCNA 3J81c 4P73A 4RMFA 4DKAC 2EOTA 3I56A 2F4VQ 1CA5A 1HH2P 1D6EC 3BYYB 1CKMA 5C3WA 1Q86C 3H09A 4IN3A 3I72A 3SK6A 1BCPF 5M5WH 1VQ6A 2CVRA 1E7ZA 4F88A 3TS2A 2C9OA 3E6ZX 4A3KG 1WOCA 1V8QA 2E2JH 3VR4A 2BA0A 1Y8OB 2JQOA 1YNXA 2IY5B 3WOEA 1PH3A 2CQAA 3BU2A 3RZOB 4OHJA 4U673 1NBWA 1EY0A 2N3SA 1AE2A 3IFTA 2A8VA 2WB1G 3DLLA 1SFOH 1J9OA 2SEBD 5IWAL 4FF4A 4CKCA 1SE3A 1DJRD 2ID0A 5K36H 1OXUA 3K7UC 4UP7A 4WFN3 1IBLL 4KK7A 2N78A 5DM63 3S14H 2QA4A 2A69C 2ZXRA 5IOCA 4BY1H 4B9XA 1I4XA 2JJQA 3L2PA 4HCSA 3M3YH 3PMFA 4LUZA 2K5DA 2PNHA 1TWHB 4LK1C 1Q82C 2AMCB 1STBA 1ENFA 4JI7Q 3T56B 5D14A 3HOUB 1B8AA 2VS1A 4DV7L 3HOWG 2G5DA 1NNXA 3K8AA 4DGZA 3D4RA 1STEA 2M00A 1OTCA 3DM3A 4NPSA 1QUQA 2AHOB 5IGCA 5FJ8G 1DM0B 2K5WA 3PF5A 4HIKA 5EQ0A 5E1FA 1FVIA 2R7ZG 1SYEA 3S16B 1BR9A 2K7VA 4R4QA 2K03A 1OO9B 3NWSA 2E2JB 3MXNA 3E5SA 4HJ8A 1A8VA 5E4XA 4DV6L 3NBHB 4ID6A 5IP7H 1F9RA 3MHBA 5IYDG 1RF2D 4GLVB 1IHZA 3GV3A 2A6HC 4LMQD 2E2IH 3URYA 1EYDA 3HOZH 2XSCA 4CHTB 4NDXA 5IT9L 4IUUA 1WD1A 3GTPB 1GJXA 3S17H 4GKJL 1QVFA 4C3JG 5GROA 4QMGA 2A1AA 5EKKA 4JI4L 5FK9C 1M90C 3HS0C 1NUCA 2J4XA 4K2KA 1VQKA 4R8NA 5M5XH 2IPKD 3CD6A 3KF8B 4Q0FA 4FVMA 4HJ9A 1E0BA 3KUPA 3NQIA 4DV2Q 3BZKA 1CHPD 4F7XA 2GN5A 2K5QA 1DD2A 3TP7A 1HFGA 4DR4L 2EYMA 1FJGQ 4BXXH 1VQGA 5ELFA 3T1YQ 1J6QA 3U58A 4OWXB 3EVQA 1BQQT 4A3GB 4ODGA 1G2SA 3W5OA 2I46A 2ZM6Q 1F2YA 1I4PA 1MGSA 2A69D 1STAA 4OIKA 4JI8L 1MSHA 3S16H 4FXDA 3D31A 4Q5VA 4IALA 3MWYW 4QB4A 1GOZA 1BXTA 4JI1L 4IPDA 3AB9A 2VQFQ 3DUZA 4DR1Q 1KQSA 2R7FA 1PRTB 1X6OA 4YWKA 2F0MA 1PYBA 4TVAB 4C3IB 1WTRA 3CAMA 4G7HC 2CWAA 5H1SE 1S5DD 1I50H 4H02A 1IW7D 5LMNL 2C35B 3DM1A 3GO5A 1YHAA 5JJZA 1IBKQ 1ML0D 4A3JG 3K80C 4ME3A 3LWUA 1SMYC 1ZYRC 1HNWQ 2PZWA 3U4VA 1K3BC 3PO2B 1BUVT 3H0GH 1EZ8A 1WD0A 2PQEA 2K6AA 3HOXG 1CSPA 2OCEA 3TS0A 3S1MB 1B1ZA 5FO9B 3FP9A 4X62L 3STBD 3OW7A 1KABA 3KLSA 3V96A 3V2TA 1VQLA 4FF3A 5CBAE 3FRPB 4JW0A 1PZID 1A0IA 3M4YA 1DOKA 4C56C 1CTMA 4MTKA 3CHBD 4EQ5A 2B2WA 4DAVA 3RZOH 1IKMA 4PQXA 1XMOL 4BBSH 2JXMB 2L9HA 2B8FA 5HY6A 3VDYA 2CW0D 1JE5A 1E2WA 1FGUA 4X3KA 3DMUA 4L5SA 3CRLC 3PIO3 4DUYL 4LAAA 3S1RB 3OW2A 1MJCA 4YCVA 1KRSA 2CH4W 2F0TA 1Q81C 4DUZL 5C3EB 3VR3A 3HOZB 2J0TD 1D7QA 1Y1VB 2K33A 5ELCA 1KNAA 2G9HD 4CDFC 1Z47A 1LABA 1STYA 3OTOQ 2EY2A 5KNCA 1IKLA 3PV0A 4GOPA 5FLXE 3PIPA 3E9HA 1CM9A 4RHRA 4HIOA 4GKKL 1KTKA 4DV2L 3TREA 3NWTA 1QE6A 2RVLA 3J80i 1X56A 4CBVA 4FF1A 4KHPQ 1BBUA 1WTHA 4R4TA 2OF1A 4L6TB 5LL6S 2CFMA 3K59A 1EY4A 1JORA 3PUVA 4MN3A 3JAMi 5CV4A 2A74C 5C44H 1N36Q 3BVMA 2UUAQ 2LS01 4K5WA 2HCCA 1AFPA 1PH8A 1II3A 4GKJQ 3FPPA 3M4OH 4CJ1B 1U4LA 4ZYSA 1YITA 5IY0A 4OONA 2AQ2B 4DF7A 2ZXPA 3WOFA 1X32A 2JK8A 1RIPA 2UUCQ 2LY7A 3GTLB 3F1ZA 3D0FA 1EFID 2K05A 1D5MC 3AYHB 5DM73 3S17B 2L4NA
chains in the Genus database with same CATH topology
2F3IA 4AQYL 3SGIA 3AQQA 1SMXA 1HNWL 3RLFA 1WCMH 1K73C 1IBML 4YCUA 2QGQA 1UE1A 1EYGA 2AWNA 4IO9A 1Q1BA 2EIFA 1VQJA 5M3MG 1BBWA 4DV5L 2MQHA 2CCZA 1MKHA 3EBEA 2VUMH 3PO3G 5JJIA 1C9OA 2E8GA 3CCVA 1VQOA 5K36G 1X55A 2I0QA 5LMNQ 1Q7YC 2R93G 2Z6KA 2F52A 2VQEQ 4JCVE 4IFDI 2GVBA 3ERSX 4DNIA 1DGSA 5IP9G 2RHQB 1NTGA 3I7FA 4JG2A 4OO1G 1PVOA 2IHEA 1O7IA 5LMUL 1FL0A 3PGZA 2K52A 1VQPA 4A3LG 2CKZB 3A74A 2E5LQ 4PZ6A 1KL9A 4DUZQ 4B3ML 1UE6A 3HOXH 3CF5A 4LFBQ 3M9BA 2BH2A 3HOUG 1HR0L 4R1JA 4XTCS 5M3MH 2RCNA 2V1CC 5FLXc 2VY3A 2PMZE 3A0JA 4LFCL 1Q46A 1K3RA 4JV5L 1EQQA 4B3TL 4JI0Q 3CCLA 4JI3Q 3AFQA 5C4XH 2R6GA 3CMEA 1S40A 1JJGA 4YY3Q 4KHZA 1IYJB 3G71A 3HOVG 1HJPA 4YCWA 1V43A 2L15A 4LF5Q 2ATWA 3K7AH 1GVPA 2UU9Q 3HOUH 5HGQA 2LXJA 2QEXA 2UXDQ 5AJ3L 1H95A 4X66L 4LWCA 3CCRA 3ZJYC 4AYBG 1VQ9A 1JJCB 5IWAQ 1XNRQ 4JI2L 3HKZG 1GD7A 3B6YA 4BY1G 5JJKA 4DPGA 1HZ9A 3RLOA 3FKIH 3M4QA 4GOPC 5C44G 3M4PA 4A3EH 4OWWB 4POGA 3GDEA 4JOIC 3CMAA 3G4SA 2K75A 4A3IG 4JV5Q 2D62A 4X6AH 1TXYA 1X3EA 1VQ5A 3CCEA 4ALPA 4JOIA 4JYAQ 4X65L 5JEAG 1YI2A 1Y1WH 1UWVA 2NN6I 4YWLA 2I5MX 2ALYB 1UEBA 4OWTB 4LFBL 5FJ8H 3W1GA 2A19A 4IPCA 2FXQA 4UY8C 4IFDG 1VQMA 4LF5L 3G6EA 4EX5A 2UU9L 2R7ZH 1VQAA 4UP9A 2Q2UA 1XMOQ 1KRTA 4YHHQ 3GTGH 1RL2A 2JE6I 1Z9FA 2IHFA 2XGTA 3I55A 2KHIA 2WB1E 1HZBA 4A3IH 4LNQA 3ULJA 3PCOB 2JA9A 4IPGA 3T1YL 2IX1A 4MNOA 1OXXK 1SE8A 2NN6G 4NB3A 3MXNB 2D0PA 4JI2Q 4AH6A 5GQOA 2MNAA 1VQ4A 1TWHH 2UXCL 1S72A 2WFWA 4DUYQ 1XMQQ 4PMWA 5AJ3Q 4BY7H 1WJJA 3MEFA 4BBRH 1AH9A 4DV7Q 3W1BA 1XMQL 3J81i 4A93G 2ZJQA 1QUQB 4JBJA 1EQRA 2VW9A 4DR3L 1YJ9A 4GNXC 1W2BA 4A3JH 1N8RC 3J7A5 3S1NH 4JI5Q 5GAEC 1N9WA 1K8GA 2OWOA 4POFA 4LF9Q 1LYLA 1P16A 1X54A 2E2HH 5LMUQ 4DV1L 4A3FH 4L5TA 4LF6L 2JA6H 4B3RQ 1XTDA 5FLMH 1HNXL 4A3CG 2JA5G 3J81c 4B3SQ 2NVQH 1KHIA 1E22A 4C3IH 3S2HH 4X64L 2EXDA 3CQZH 1VQHA 1YVCA 2JA8G 1XPRA 2KCTA 1U0LA 1M1KC 1JT8A 4DV0Q 4DV4L 4P73A 4RMFA 4DKAC 3I56A 2F4VQ 4NXMQ 2VUMG 1VQBA 3ICEA 2Z6KC 1HH2P 5C0XJ 2HHHL 2B29A 1C0AA 1CKMA 4IOCA 2K14A 1Q86C 1NMGA 3JAMc 2UXCQ 2VZAA 4YY3L 5M5WH 2VQFL 4PZ7A 1X9NA 3NEMA 1VQ6A 4DR5L 2LXKA 4RG1A 3KDFB 1E7ZA 1ASYA 1IZ6A 2RF4A 3RNUA 4A3LH 1EFWA 3TS2A 4QL5A 4YHHL 4A75A 1LUZA 4LFCQ 4A3KG 1WOCA 2E2JH 2IX0A 2Z0SA 2JA8H 1UE5A 1T9HA 2MFIA 4OXPA 2BA0A 3PUZA 1YBYA 5C0XG 3J81j 1KXLA 2PI2A 3H3VH 1PH5A 2K5HA 2JQOA 1YNXA 3UDFA 2IY5B 3KDFA 4X64Q 4A3DG 2OTJA 2KENA 1PH3A 4JI7L 3LGJA 5IYCH 2KHJA 3BU2A 2YU9H 4L5RC 1NBWA 4LUVA 2N3SA 4C3JH 1AE2A 4GN4B 3GTJH 2A8VA 2AWOA 2WB1G 2VL6A 4JBWA 3JC66 3DLLA 2HIVA 1SFOH 3H3VI 1OXSC 4DR2L 5IWAL 2ASBA 1VQFA 1SR3A 2ID0A 1LM0A 3H15A 2JEBI 1OXUA 3BJUA 3K7UC 4UP7A 3F2CA 2BA1A 2N78A 1KIXA 1JB7A 1IBLL 1KD1C 2JA7G 5IYBG 3U4ZA 1V9PA 2F4VL 2QA4A 3S14H 3PO2G 4BY1H 2JJQA 3UDIA 3L2PA 3M3YH 1SROA 1VQ8A 3GTLH 3STBC 4HJ7A 3CPWA 4LUZA 2HT1A 3UDGA 4LF4Q 2PNHA 4LF8L 1HNZL 3J7ZC 1VQNA 3S24A 3UE0A 1Q82C 3CCUA 3GTQH 2AMCB 2R92G 4QY7A 1PHJA 1Y14B 4JI7Q 1TWGH 1YEZA 4P75A 4NXNL 2VQEL 1BKBA 3PO3H 4QQBX 1B8AA 2VS1A 1FJGL 4DV7L 3GTPH 1X3GA 4DR4Q 1W3SA 3KF6B 3PSIA 4X65Q 4GOPB 1SRUA 1IBMQ 4L5QA 3HOWG 3I4OA 4JI6Q 4GN3B 5C4XG 4XIGS 3CC4A 1PFSA 4BA2I 3CP0A 3K8AA 3RLNA 2E5LL 4LUOA 1CKNA 4Y7NH 4B3MQ 4JC0A 4UPAA 3RN5A 1YHBA 1OTCA 3DM3A 2YTXA 2JA5H 1Q12A 3CCQA 4NPSA 1K8AC 4JBKA 1QUQA 3S2DH 4AIMA 3EIVA 2AHOB 5IYDH 2K50A 1N33L 3Q8DA 5FJ8G 3TRZA 4DV3Q 1ASZA 4DR6Q 3PF5A 4HIKA 1MJEA 1L1OA 1FVIA 4IOAA 4C2MH 2R7ZG 4BBRG 1CKNB 2ZTDA 4R4QA 1YJNA 4GNXA 1WFQA 3CC2A 2K5NA 3HKSA 1QVCA 4HJ8A 4AQYQ 1A8VA 1VQDA 3S15H 3KF6A 4A3GG 4DV6L 3NBHB 5IP7H 4WJ3M 1Y1VG 2I5HA 4JI5L 2MO0A 4GLVB 4JI3L 1EWIA 5IYDG 4LF9L 2I5LX 1S3OA 1WCMG 3PF4A 3S1RH 1LTLA 1OXVA 1VCIA 3TQYA 2YYZA 4OX9Q 2E2IH 3HOZH 1XJVA 2KBNA 3F2BA 3TEHB 1IL2A 2K4KA 4GNXB 3U50C 2PQAB 3S17H 1VQCA 4GKJL 3GTOH 3KJPA 1C7YA 2NZHA 1QVFA 1JMCA 4P72A 3PUXA 2PQAA 1P8LA 5ELOA 5EAYA 1N32Q 3RR5A 4JI6L 1L0WA 2CQOA 5GROA 3I4NH 1G51A 2A1AA 1N36L 5IP7G 1XPOA 1CSQA 4JI4L 4A3BH 2UUBL 4DK3C 3E0EA 1PH4A 3T1HQ 2WAQE 1Q8KA 1M90C 4GS3A 1A62A 1EIFA 1UE7A 3HKZE 1IBLQ 4P71A 3PIOA 1VQKA 1PH1A 4DAMA 5M5XH 5IT9c 2D0OA 2N8NA 4P74A 1N33Q 4JYAL 2NVYH 3CD6A 1WYDA 3KF8B 5GAGC 4OX9L 3CC7A 4HJ9A 2OTLA 1J5EL 4LFAL 2H5XA 3K0XA 3CPFA 2OQ0A 3I4MH 5J3BA 4DV2Q 3BZKA 1N34Q 1PV4A 1I3QH 2Q2HA 5BR8Q 3HOYH 4GKKQ 1GM5A 2GN5A 1QVGA 1YJWA 4C3HH 3HOVH 4IJHA 2Y0SG 1TWFH 3AFPA 3GD7A 1IXRA 2IT1A 3S1MH 1X65A 3OTOL 4GLAC 1XNRL 1GO3E 1TWCH 1B70B 4A76A 4DR4L 1FJGQ 4BXXH 3HOWH 1U5KA 1E24A 1AE3A 1G291 1J6QA 1VQGA 4MZ9A 4OWXB 3T1YQ 4QGUA 3U58A 1YHQA 2AKWB 4A3EG 3T1HL 3UE1A 1HR0W 2UUAL 3W5OA 1VQ7A 4B3SL 2ZM6Q 4K0KQ 2K5VA 1PA6A 3HOYG 1IBKL 5FLMG 1N32L 4A3KH 4DAYB 3PUYA 4JI8L 3S16H 3D31A 4YWMA 4DR7L 1YZ6A 5GAHC 2XTIA 4DR7Q 1JJ2A 4JI1L 4IPDA 1V1QA 2CWPA 2VQFQ 4DR1Q 1L1OB 1KQSA 2R7FA 5LMNW 1X6OA 4YWKA 1PYBA 4TVAB 4DR1L 4A3GH 1GKHA 1Y1VH 1Q1EA 3CAMA 3I2ZA 4A3MG 1EOVA 5M3FG 4PZ8A 2CWAA 5H1SE 4LF7Q 2DGYA 1I50H 4H02A 4HJ5A 1NJIC 4NXNQ 5C3EG 3HOZG 3E9IA 2B63G 5LMNL 2UXDL 2C35B 3GO5A 5M5YH 1YHAA 1IBKQ 1NY4A 4A3JG 1VQIA 3K80C 4ME3A 4DV3L 1D8LA 4A93H 4PG3A 1I94L 2ES2A 4O2DA 3U4VA 1XNQQ 1HNWQ 2UXBL 4LW1A 1HNXQ 5IP9H 1VQEA 3H0GH 4HIDA 1PYSB 2LSSA 2R92H 1A63A 4KI0A 5M3FH 5C3EH 4A4IA 4APVA 3HOXG 1K9MC 1CSPA 2OCEA 3TS0A 2HIXA 4NXML 1OXTA 4J15A 3FP9A 4X62L 3CCSA 4DV0L 1MIUA 1EUJA 1SLJA 3STBD 4DV4Q 2OQKA 4HIMA 1K83H 1I5FA 2Q2IA 2RHSB 2HQLA 3HFZB 4R4OA 5ELNA 1VQLA 4LF7L 5IE8A 3PO2H 1E3PA 4QJFA 4WJ4A 4O0AA 3FKIG 3RZDH 4Y52H 4LFAQ 1J5EQ 1A0IA 3RN2A 3ULLA 3GTMH 2DUDA 4EQ5A 3H0GG 5E7NA 2WP8J 3RZOH 3I4NG 1XMOL 2VNUD 4DR5Q 4BBSH 3L7ZC 4FDBA 1EIYB 3G48A 5HY6A 3VDYA 1VS0A 2BH8A 1Y1WG 1JE5A 1FGUA 4DV5Q 1CUKA 4BA1I 1HR0Q 4L5SA 4IJLA 4DUYL 2R93H 2EQSA 3M85A 4LF4L 3KFUA 1L1OC 2NZOA 3OW2A 1G6PA 1MJCA 4YCVA 2ZJRA 4HJAA 5C4JH 4JBMA 1KRSA 3KJOA 4TQUS 1Q81C 4A3BG 4DUZL 4K0KL 2NVXH 1HZAA 1I94Q 3UDXA 1XNQL 2HHHQ 4IPHA 3IRBA 4BBSG 3NELA 1WI5A 1CKOA 1YIJA 1D7QA 3CW2C 1XPUA 3S1QH 3A5UA 5IYBH 1KAWA 1Z47A 2Y0SE 2YTYA 1B7YB 3ULPA 1PH2A 3OTOQ 3KOJA 4X66Q 1BVSA 4DV6Q 1PH6A 4R4IA 3PV0A 4GOPA 4UP8A 5DLQE 4OO1I 3PIPA 2N49A 4LF8Q 3AEVA 1PH9A 3E9HA 5C0XI 5JJLA 4HIOA 3GTKH 3KYHC 1E1OA 4GKKL 4DK6C 4DV2L 1N34L 2KCMA 2B3GA 2UUCL 3TREA 3F8TA 2R7DA 3KLWA 2ZJPA 4JI1Q 4R4CA 3J80i 1X56A 3BZCA 3FHWA 4BXXG 3CXCA 3L0OA 2WAQG 4KHPQ 3OYYA 3CCMA 1BBUA 4R4TA 2NVTH 4JI8Q 4KHPL 3CCJA 2CFMA 1HZCA 3PUVA 4DR2Q 3JAMi 1NMFA 1L2FA 2ZTEA 1N36Q 2UUBQ 5C44H 2UXBQ 4KLKA 2ZTCA 2ZM6L 1KC8C 2UUAQ 4JI4Q 3I4MG 2YTVA 2MO1A 4LF6Q 4B3RL 4A3FG 1PH8A 1TWAH 2GVAA 4GN5A 4AYBE 2JA6G 3M4OH 4GKJQ 5JEAJ 4A3MH 4DR6L 3WWVA 1E1TA 5GADC 4QIWE 1YITA 4JI0L 3M7NA 1X3FA 3NENA 5IY0A 3EN2A 4B3TQ 4DR3Q 1SN8A 1K0RA 2PI2E 3A5ZB 4OONA 2Q2TA 4X62Q 4BY7G 4IFDJ 1PH7A 3F2DA 1QZGA 2B63H 2JA7H 3K81C 2JK8A 1HNZQ 1RIPA 4GLXA 2UUCQ 4DV1Q 4A3DH 1R9TH 3J80c 5BR8L 3F1ZA 3D0FA 5IYCG 2JEAI 1NE3A 2YV5A 3ER0A 4MTNA 3AYHB 3PUWA 1QZHA 1I6HH 4A3CH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F3I A;  4AQY L;  3SGI A;  3AQQ A;  1SMX A;  1HNW L;  3RLF A;  1WCM H;  1K73 C;  1IBM L;  4YCU A;  2QGQ A;  1UE1 A;  1EYG A;  2AWN A;  4IO9 A;  1Q1B A;  2EIF A;  1VQJ A;  5M3M G;  1BBW A;  4DV5 L;  2MQH A;  2CCZ A;  1MKH A;  3EBE A;  2VUM H;  3PO3 G;  5JJI A;  1C9O A;  2E8G A;  3CCV A;  1VQO A;  5K36 G;  1X55 A;  2I0Q A;  5LMN Q;  1Q7Y C;  2R93 G;  2Z6K A;  2F52 A;  2VQE Q;  4JCV E;  4IFD I;  2GVB A;  3ERS X;  4DNI A;  1DGS A;  5IP9 G;  2RHQ B;  1NTG A;  3I7F A;  4JG2 A;  4OO1 G;  1PVO A;  2IHE A;  1O7I A;  5LMU L;  1FL0 A;  3PGZ A;  2K52 A;  1VQP A;  4A3L G;  2CKZ B;  3A74 A;  2E5L Q;  4PZ6 A;  1KL9 A;  4DUZ Q;  4B3M L;  1UE6 A;  3HOX H;  3CF5 A;  4LFB Q;  3M9B A;  2BH2 A;  3HOU G;  1HR0 L;  4R1J A;  4XTC S;  5M3M H;  2RCN A;  2V1C C;  5FLX c;  2VY3 A;  2PMZ E;  3A0J A;  4LFC L;  1Q46 A;  1K3R A;  4JV5 L;  1EQQ A;  4B3T L;  4JI0 Q;  3CCL A;  4JI3 Q;  3AFQ A;  5C4X H;  2R6G A;  3CME A;  1S40 A;  1JJG A;  4YY3 Q;  4KHZ A;  1IYJ B;  3G71 A;  3HOV G;  1HJP A;  4YCW A;  1V43 A;  2L15 A;  4LF5 Q;  2ATW A;  3K7A H;  1GVP A;  2UU9 Q;  3HOU H;  5HGQ A;  2LXJ A;  2QEX A;  2UXD Q;  5AJ3 L;  1H95 A;  4X66 L;  4LWC A;  3CCR A;  3ZJY C;  4AYB G;  1VQ9 A;  1JJC B;  5IWA Q;  1XNR Q;  4JI2 L;  3HKZ G;  1GD7 A;  3B6Y A;  4BY1 G;  5JJK A;  4DPG A;  1HZ9 A;  3RLO A;  3FKI H;  3M4Q A;  4GOP C;  5C44 G;  3M4P A;  4A3E H;  4OWW B;  4POG A;  3GDE A;  4JOI C;  3CMA A;  3G4S A;  2K75 A;  4A3I G;  4JV5 Q;  2D62 A;  4X6A H;  1TXY A;  1X3E A;  1VQ5 A;  3CCE A;  4ALP A;  4JOI A;  4JYA Q;  4X65 L;  5JEA G;  1YI2 A;  1Y1W H;  1UWV A;  2NN6 I;  4YWL A;  2I5M X;  2ALY B;  1UEB A;  4OWT B;  4LFB L;  5FJ8 H;  3W1G A;  2A19 A;  4IPC A;  2FXQ A;  4UY8 C;  4IFD G;  1VQM A;  4LF5 L;  3G6E A;  4EX5 A;  2UU9 L;  2R7Z H;  1VQA A;  4UP9 A;  2Q2U A;  1XMO Q;  1KRT A;  4YHH Q;  3GTG H;  1RL2 A;  2JE6 I;  1Z9F A;  2IHF A;  2XGT A;  3I55 A;  2KHI A;  2WB1 E;  1HZB A;  4A3I H;  4LNQ A;  3ULJ A;  3PCO B;  2JA9 A;  4IPG A;  3T1Y L;  2IX1 A;  4MNO A;  1OXX K;  1SE8 A;  2NN6 G;  4NB3 A;  3MXN B;  2D0P A;  4JI2 Q;  4AH6 A;  5GQO A;  2MNA A;  1VQ4 A;  1TWH H;  2UXC L;  1S72 A;  2WFW A;  4DUY Q;  1XMQ Q;  4PMW A;  5AJ3 Q;  4BY7 H;  1WJJ A;  3MEF A;  4BBR H;  1AH9 A;  4DV7 Q;  3W1B A;  1XMQ L;  3J81 i;  4A93 G;  2ZJQ A;  1QUQ B;  4JBJ A;  1EQR A;  2VW9 A;  4DR3 L;  1YJ9 A;  4GNX C;  1W2B A;  4A3J H;  1N8R C;  3J7A 5;  3S1N H;  4JI5 Q;  5GAE C;  1N9W A;  1K8G A;  2OWO A;  4POF A;  4LF9 Q;  1LYL A;  1P16 A;  1X54 A;  2E2H H;  5LMU Q;  4DV1 L;  4A3F H;  4L5T A;  4LF6 L;  2JA6 H;  4B3R Q;  1XTD A;  5FLM H;  1HNX L;  4A3C G;  2JA5 G;  3J81 c;  4B3S Q;  2NVQ H;  1KHI A;  1E22 A;  4C3I H;  3S2H H;  4X64 L;  2EXD A;  3CQZ H;  1VQH A;  1YVC A;  2JA8 G;  1XPR A;  2KCT A;  1U0L A;  1M1K C;  1JT8 A;  4DV0 Q;  4DV4 L;  4P73 A;  4RMF A;  4DKA C;  3I56 A;  2F4V Q;  4NXM Q;  2VUM G;  1VQB A;  3ICE A;  2Z6K C;  1HH2 P;  5C0X J;  2HHH L;  2B29 A;  1C0A A;  1CKM A;  4IOC A;  2K14 A;  1Q86 C;  1NMG A;  3JAM c;  2UXC Q;  2VZA A;  4YY3 L;  5M5W H;  2VQF L;  4PZ7 A;  1X9N A;  3NEM A;  1VQ6 A;  4DR5 L;  2LXK A;  4RG1 A;  3KDF B;  1E7Z A;  1ASY A;  1IZ6 A;  2RF4 A;  3RNU A;  4A3L H;  1EFW A;  3TS2 A;  4QL5 A;  4YHH L;  4A75 A;  1LUZ A;  4LFC Q;  4A3K G;  1WOC A;  2E2J H;  2IX0 A;  2Z0S A;  2JA8 H;  1UE5 A;  1T9H A;  2MFI A;  4OXP A;  2BA0 A;  3PUZ A;  1YBY A;  5C0X G;  3J81 j;  1KXL A;  2PI2 A;  3H3V H;  1PH5 A;  2K5H A;  2JQO A;  1YNX A;  3UDF A;  2IY5 B;  3KDF A;  4X64 Q;  4A3D G;  2OTJ A;  2KEN A;  1PH3 A;  4JI7 L;  3LGJ A;  5IYC H;  2KHJ A;  3BU2 A;  2YU9 H;  4L5R C;  1NBW A;  4LUV A;  2N3S A;  4C3J H;  1AE2 A;  4GN4 B;  3GTJ H;  2A8V A;  2AWO A;  2WB1 G;  2VL6 A;  4JBW A;  3JC6 6;  3DLL A;  2HIV A;  1SFO H;  3H3V I;  1OXS C;  4DR2 L;  5IWA L;  2ASB A;  1VQF A;  1SR3 A;  2ID0 A;  1LM0 A;  3H15 A;  2JEB I;  1OXU A;  3BJU A;  3K7U C;  4UP7 A;  3F2C A;  2BA1 A;  2N78 A;  1KIX A;  1JB7 A;  1IBL L;  1KD1 C;  2JA7 G;  5IYB G;  3U4Z A;  1V9P A;  2F4V L;  2QA4 A;  3S14 H;  3PO2 G;  4BY1 H;  2JJQ A;  3UDI A;  3L2P A;  3M3Y H;  1SRO A;  1VQ8 A;  3GTL H;  3STB C;  4HJ7 A;  3CPW A;  4LUZ A;  2HT1 A;  3UDG A;  4LF4 Q;  2PNH A;  4LF8 L;  1HNZ L;  3J7Z C;  1VQN A;  3S24 A;  3UE0 A;  1Q82 C;  3CCU A;  3GTQ H;  2AMC B;  2R92 G;  4QY7 A;  1PHJ A;  1Y14 B;  4JI7 Q;  1TWG H;  1YEZ A;  4P75 A;  4NXN L;  2VQE L;  1BKB A;  3PO3 H;  4QQB X;  1B8A A;  2VS1 A;  1FJG L;  4DV7 L;  3GTP H;  1X3G A;  4DR4 Q;  1W3S A;  3KF6 B;  3PSI A;  4X65 Q;  4GOP B;  1SRU A;  1IBM Q;  4L5Q A;  3HOW G;  3I4O A;  4JI6 Q;  4GN3 B;  5C4X G;  4XIG S;  3CC4 A;  1PFS A;  4BA2 I;  3CP0 A;  3K8A A;  3RLN A;  2E5L L;  4LUO A;  1CKN A;  4Y7N H;  4B3M Q;  4JC0 A;  4UPA A;  3RN5 A;  1YHB A;  1OTC A;  3DM3 A;  2YTX A;  2JA5 H;  1Q12 A;  3CCQ A;  4NPS A;  1K8A C;  4JBK A;  1QUQ A;  3S2D H;  4AIM A;  3EIV A;  2AHO B;  5IYD H;  2K50 A;  1N33 L;  3Q8D A;  5FJ8 G;  3TRZ A;  4DV3 Q;  1ASZ A;  4DR6 Q;  3PF5 A;  4HIK A;  1MJE A;  1L1O A;  1FVI A;  4IOA A;  4C2M H;  2R7Z G;  4BBR G;  1CKN B;  2ZTD A;  4R4Q A;  1YJN A;  4GNX A;  1WFQ A;  3CC2 A;  2K5N A;  3HKS A;  1QVC A;  4HJ8 A;  4AQY Q;  1A8V A;  1VQD A;  3S15 H;  3KF6 A;  4A3G G;  4DV6 L;  3NBH B;  5IP7 H;  4WJ3 M;  1Y1V G;  2I5H A;  4JI5 L;  2MO0 A;  4GLV B;  4JI3 L;  1EWI A;  5IYD G;  4LF9 L;  2I5L X;  1S3O A;  1WCM G;  3PF4 A;  3S1R H;  1LTL A;  1OXV A;  1VCI A;  3TQY A;  2YYZ A;  4OX9 Q;  2E2I H;  3HOZ H;  1XJV A;  2KBN A;  3F2B A;  3TEH B;  1IL2 A;  2K4K A;  4GNX B;  3U50 C;  2PQA B;  3S17 H;  1VQC A;  4GKJ L;  3GTO H;  3KJP A;  1C7Y A;  2NZH A;  1QVF A;  1JMC A;  4P72 A;  3PUX A;  2PQA A;  1P8L A;  5ELO A;  5EAY A;  1N32 Q;  3RR5 A;  4JI6 L;  1L0W A;  2CQO A;  5GRO A;  3I4N H;  1G51 A;  2A1A A;  1N36 L;  5IP7 G;  1XPO A;  1CSQ A;  4JI4 L;  4A3B H;  2UUB L;  4DK3 C;  3E0E A;  1PH4 A;  3T1H Q;  2WAQ E;  1Q8K A;  1M90 C;  4GS3 A;  1A62 A;  1EIF A;  1UE7 A;  3HKZ E;  1IBL Q;  4P71 A;  3PIO A;  1VQK A;  1PH1 A;  4DAM A;  5M5X H;  5IT9 c;  2D0O A;  2N8N A;  4P74 A;  1N33 Q;  4JYA L;  2NVY H;  3CD6 A;  1WYD A;  3KF8 B;  5GAG C;  4OX9 L;  3CC7 A;  4HJ9 A;  2OTL A;  1J5E L;  4LFA L;  2H5X A;  3K0X A;  3CPF A;  2OQ0 A;  3I4M H;  5J3B A;  4DV2 Q;  3BZK A;  1N34 Q;  1PV4 A;  1I3Q H;  2Q2H A;  5BR8 Q;  3HOY H;  4GKK Q;  1GM5 A;  2GN5 A;  1QVG A;  1YJW A;  4C3H H;  3HOV H;  4IJH A;  2Y0S G;  1TWF H;  3AFP A;  3GD7 A;  1IXR A;  2IT1 A;  3S1M H;  1X65 A;  3OTO L;  4GLA C;  1XNR L;  1GO3 E;  1TWC H;  1B70 B;  4A76 A;  4DR4 L;  1FJG Q;  4BXX H;  3HOW H;  1U5K A;  1E24 A;  1AE3 A;  1G29 1;  1J6Q A;  1VQG A;  4MZ9 A;  4OWX B;  3T1Y Q;  4QGU A;  3U58 A;  1YHQ A;  2AKW B;  4A3E G;  3T1H L;  3UE1 A;  1HR0 W;  2UUA L;  3W5O A;  1VQ7 A;  4B3S L;  2ZM6 Q;  4K0K Q;  2K5V A;  1PA6 A;  3HOY G;  1IBK L;  5FLM G;  1N32 L;  4A3K H;  4DAY B;  3PUY A;  4JI8 L;  3S16 H;  3D31 A;  4YWM A;  4DR7 L;  1YZ6 A;  5GAH C;  2XTI A;  4DR7 Q;  1JJ2 A;  4JI1 L;  4IPD A;  1V1Q A;  2CWP A;  2VQF Q;  4DR1 Q;  1L1O B;  1KQS A;  2R7F A;  5LMN W;  1X6O A;  4YWK A;  1PYB A;  4TVA B;  4DR1 L;  4A3G H;  1GKH A;  1Y1V H;  1Q1E A;  3CAM A;  3I2Z A;  4A3M G;  1EOV A;  5M3F G;  4PZ8 A;  2CWA A;  5H1S E;  4LF7 Q;  2DGY A;  1I50 H;  4H02 A;  4HJ5 A;  1NJI C;  4NXN Q;  5C3E G;  3HOZ G;  3E9I A;  2B63 G;  5LMN L;  2UXD L;  2C35 B;  3GO5 A;  5M5Y H;  1YHA A;  1IBK Q;  1NY4 A;  4A3J G;  1VQI A;  3K80 C;  4ME3 A;  4DV3 L;  1D8L A;  4A93 H;  4PG3 A;  1I94 L;  2ES2 A;  4O2D A;  3U4V A;  1XNQ Q;  1HNW Q;  2UXB L;  4LW1 A;  1HNX Q;  5IP9 H;  1VQE A;  3H0G H;  4HID A;  1PYS B;  2LSS A;  2R92 H;  1A63 A;  4KI0 A;  5M3F H;  5C3E H;  4A4I A;  4APV A;  3HOX G;  1K9M C;  1CSP A;  2OCE A;  3TS0 A;  2HIX A;  4NXM L;  1OXT A;  4J15 A;  3FP9 A;  4X62 L;  3CCS A;  4DV0 L;  1MIU A;  1EUJ A;  1SLJ A;  3STB D;  4DV4 Q;  2OQK A;  4HIM A;  1K83 H;  1I5F A;  2Q2I A;  2RHS B;  2HQL A;  3HFZ B;  4R4O A;  5ELN A;  1VQL A;  4LF7 L;  5IE8 A;  3PO2 H;  1E3P A;  4QJF A;  4WJ4 A;  4O0A A;  3FKI G;  3RZD H;  4Y52 H;  4LFA Q;  1J5E Q;  1A0I A;  3RN2 A;  3ULL A;  3GTM H;  2DUD A;  4EQ5 A;  3H0G G;  5E7N A;  2WP8 J;  3RZO H;  3I4N G;  1XMO L;  2VNU D;  4DR5 Q;  4BBS H;  3L7Z C;  4FDB A;  1EIY B;  3G48 A;  5HY6 A;  3VDY A;  1VS0 A;  2BH8 A;  1Y1W G;  1JE5 A;  1FGU A;  4DV5 Q;  1CUK A;  4BA1 I;  1HR0 Q;  4L5S A;  4IJL A;  4DUY L;  2R93 H;  2EQS A;  3M85 A;  4LF4 L;  3KFU A;  1L1O C;  2NZO A;  3OW2 A;  1G6P A;  1MJC A;  4YCV A;  2ZJR A;  4HJA A;  5C4J H;  4JBM A;  1KRS A;  3KJO A;  4TQU S;  1Q81 C;  4A3B G;  4DUZ L;  4K0K L;  2NVX H;  1HZA A;  1I94 Q;  3UDX A;  1XNQ L;  2HHH Q;  4IPH A;  3IRB A;  4BBS G;  3NEL A;  1WI5 A;  1CKO A;  1YIJ A;  1D7Q A;  3CW2 C;  1XPU A;  3S1Q H;  3A5U A;  5IYB H;  1KAW A;  1Z47 A;  2Y0S E;  2YTY A;  1B7Y B;  3ULP A;  1PH2 A;  3OTO Q;  3KOJ A;  4X66 Q;  1BVS A;  4DV6 Q;  1PH6 A;  4R4I A;  3PV0 A;  4GOP A;  4UP8 A;  5DLQ E;  4OO1 I;  3PIP A;  2N49 A;  4LF8 Q;  3AEV A;  1PH9 A;  3E9H A;  5C0X I;  5JJL A;  4HIO A;  3GTK H;  3KYH C;  1E1O A;  4GKK L;  4DK6 C;  4DV2 L;  1N34 L;  2KCM A;  2B3G A;  2UUC L;  3TRE A;  3F8T A;  2R7D A;  3KLW A;  2ZJP A;  4JI1 Q;  4R4C A;  3J80 i;  1X56 A;  3BZC A;  3FHW A;  4BXX G;  3CXC A;  3L0O A;  2WAQ G;  4KHP Q;  3OYY A;  3CCM A;  1BBU A;  4R4T A;  2NVT H;  4JI8 Q;  4KHP L;  3CCJ A;  2CFM A;  1HZC A;  3PUV A;  4DR2 Q;  3JAM i;  1NMF A;  1L2F A;  2ZTE A;  1N36 Q;  2UUB Q;  5C44 H;  2UXB Q;  4KLK A;  2ZTC A;  2ZM6 L;  1KC8 C;  2UUA Q;  4JI4 Q;  3I4M G;  2YTV A;  2MO1 A;  4LF6 Q;  4B3R L;  4A3F G;  1PH8 A;  1TWA H;  2GVA A;  4GN5 A;  4AYB E;  2JA6 G;  3M4O H;  4GKJ Q;  5JEA J;  4A3M H;  4DR6 L;  3WWV A;  1E1T A;  5GAD C;  4QIW E;  1YIT A;  4JI0 L;  3M7N A;  1X3F A;  3NEN A;  5IY0 A;  3EN2 A;  4B3T Q;  4DR3 Q;  1SN8 A;  1K0R A;  2PI2 E;  3A5Z B;  4OON A;  2Q2T A;  4X62 Q;  4BY7 G;  4IFD J;  1PH7 A;  3F2D A;  1QZG A;  2B63 H;  2JA7 H;  3K81 C;  2JK8 A;  1HNZ Q;  1RIP A;  4GLX A;  2UUC Q;  4DV1 Q;  4A3D H;  1R9T H;  3J80 c;  5BR8 L;  3F1Z A;  3D0F A;  5IYC G;  2JEA I;  1NE3 A;  2YV5 A;  3ER0 A;  4MTN A;  3AYH B;  3PUW A;  1QZH A;  1I6H H;  4A3C H; 
#chains in the Genus database with same CATH topology
 2BDO A;  1WCM H;  3D4W A;  2L11 A;  1IBM L;  4YCU A;  1W6K A;  1PDQ A;  5CV8 A;  3JAM L;  2AWN A;  1BF4 A;  2FMM A;  2L5T A;  4IO9 A;  2CCZ A;  1BBW A;  1MKH A;  2VUM H;  5IGE A;  1D2B A;  1HUM A;  4O1N A;  5LMN Q;  2R93 G;  2VQE Q;  4DNI A;  1DGS A;  2RHQ B;  2F0V A;  4JG2 A;  1SBB B;  1GUS A;  1PVO A;  1O7I A;  1FL0 A;  4TRD A;  2K52 A;  1TR5 A;  4A3L G;  1KL9 A;  3CF5 A;  3M9B A;  2BH2 A;  3HOU G;  3X3N A;  4C3I G;  3D8G A;  5L37 A;  2RCN A;  5I6W A;  2VY3 A;  1Q46 A;  4B3T L;  3C46 A;  2NVT B;  4U68 A;  3PQI A;  1S40 A;  2NWG A;  2A6E C;  4A3J B;  3S1N B;  4ZUI A;  2E2H B;  4YCW A;  4RGO S;  4BY7 B;  2LMC B;  2DJF C;  3O13 A;  5TSS A;  1SNP A;  5HGQ A;  3IAY A;  3Q23 A;  2UXD Q;  3BDC A;  2TMP A;  3QWN A;  1CA6 A;  4LWC A;  1DZ1 A;  1EY5 A;  3OIP A;  1JJC B;  1W6J A;  1JWU D;  2RBM A;  2MUY A;  2IW3 A;  4GOP C;  3VA5 A;  3K5N A;  4OWW B;  4UAI A;  2PCF B;  2K75 A;  1CZW A;  4KHV A;  3IKJ A;  4X6A H;  2JP1 A;  4JYA Q;  5C4J B;  5KIX A;  1YI2 A;  1UWV A;  1D1K A;  2NN6 I;  1JOK A;  4YWL A;  4LFB L;  3W1G A;  4IPC A;  4UY8 C;  1VQM A;  3G6E A;  4PNY A;  4EX5 A;  3OIQ A;  1VQA A;  3MFG A;  4FF2 A;  2JE6 I;  1Z9F A;  1S5F D;  3NBH A;  1F2M A;  2WB1 E;  3ULJ A;  5C4H A;  3NTI A;  3VR5 A;  2NN6 G;  4X3U A;  5CYU A;  3HP3 A;  2Z1C A;  2WFW A;  5I2X A;  1BO0 A;  3PIP 3;  1B9N A;  3K7A B;  1WJJ A;  2JN4 A;  4BBR H;  3W1B A;  1W2B A;  3K58 A;  4GNX C;  4RKB A;  4A3J H;  3S1N H;  4JI5 Q;  1EWC A;  5GAE C;  1K8G A;  1LYL A;  2E2H H;  1B50 A;  4DV1 L;  4L5T A;  4LF6 L;  3EQL C;  4B3R Q;  2B2V A;  1XTD A;  1HNX L;  1NR2 A;  4PMB A;  2PZT A;  4X64 L;  2EXD A;  1LTR D;  3CQZ H;  1YVC A;  5M5Y B;  1XPR A;  2KCT A;  1M4V A;  1U0L A;  1JT8 A;  4DV0 Q;  4DV4 L;  2D9U A;  2RSO A;  3I91 A;  4NXM Q;  2BDN A;  1VQB A;  3GTK B;  1C0A A;  2K14 A;  1NMG A;  3JAM c;  2QKI C;  1I50 B;  1ZEQ X;  2VZA A;  3E0J A;  4PV1 C;  5ELD A;  3OWE B;  1X9N A;  1JE4 A;  1TY2 A;  1YNN D;  1V1P B;  3K5O A;  2IX0 A;  2Z0S A;  2JA8 H;  4ME5 A;  4A3F B;  1T9H A;  2MFI A;  3EFX D;  3A8K E;  2HDM A;  3PUZ A;  4C2M B;  5C0X G;  3J81 j;  2PI2 A;  3SXH A;  1PH5 A;  3M3Y B;  5I4D A;  1JIC A;  3KDF A;  1EU4 A;  4V19 0;  2OTJ A;  1SXT A;  4JI7 L;  2KHJ A;  2BOS A;  2WV6 D;  1M8A A;  2EJM A;  2FFK B;  4J1M A;  4N9P A;  5FO7 B;  3RZD B;  4JBW A;  4KD4 A;  1GUG A;  5T1I A;  1CI3 M;  4CDC C;  1Q90 A;  1VQF A;  1LTG D;  3P1H A;  4R8I A;  2JEB I;  3F2C A;  2NVQ H;  1H9R A;  1JB7 A;  4IFD H;  4NMZ A;  5BN3 A;  3PO2 G;  1FGB D;  3MC0 B;  3UDI A;  1VQ8 A;  5A2Q L;  2NUC A;  5HGT A;  3RMH A;  3UDG A;  1MHW C;  4LF4 Q;  1HNZ L;  4ZKB B;  3J7Z C;  1R4Q B;  3S24 A;  1VQN A;  1H9M A;  2F4I A;  4QY7 A;  1PHJ A;  3I4L A;  4DAY A;  1H9K A;  1BKB A;  3GTP H;  1X3G A;  1W3S A;  3PSI A;  4GOP B;  1IBM Q;  1SMY D;  4H13 C;  1SRU A;  1KDB A;  1KLU D;  1ZYR D;  4L5Q A;  1H9J A;  3FDT A;  3CC4 A;  4BA2 I;  3Q24 A;  4S3S A;  4Y7N H;  2DY7 A;  4UPA A;  1SFO B;  5KEE A;  1L0Y B;  2JA5 H;  1EIH A;  4AIM A;  3CKI B;  3FVQ A;  2VXW A;  3TRZ A;  4DV3 Q;  1TII D;  2WAC A;  5ELB A;  3ND9 A;  4KKS A;  1L1O A;  1XXG A;  1SDF A;  4BBR G;  1CKN B;  4GNX A;  3OMC A;  3FMC A;  1QVC A;  1HQM C;  1VQD A;  3S15 H;  3KF6 A;  4A3G G;  2GA4 B;  2F0Q A;  1Y1V G;  3IL8 A;  1EWI A;  4XQJ A;  4LF9 L;  1EWH A;  1HCZ A;  2I5L X;  1TS2 A;  1WCM G;  4ZRZ A;  5C6A A;  1VCI A;  4A3I B;  4V0B A;  4KY6 A;  3TP5 A;  2KBN A;  3SK8 A;  4UHV A;  2RA4 A;  3F2B A;  4DXF A;  1GUN A;  4GNX B;  3U50 C;  4QUF A;  1TWC B;  4BS9 A;  2HD3 A;  2KCC A;  1C7Y A;  3OMG A;  4OEM B;  4C1N K;  4JI6 L;  2AUJ D;  1S4Z A;  4A3B H;  3E0E A;  1AP0 A;  4L8J A;  3T1H Q;  3FEW X;  5IIF A;  2NVY B;  2PMZ B;  3SEB A;  1RDP D;  4CDE C;  1JOQ A;  1PH1 A;  1PTO B;  1IYV A;  2N8N A;  4P74 A;  3K57 A;  1B44 D;  2NVY H;  2OXP A;  4ZLT F;  3CC7 A;  1J5E L;  3SE0 A;  3K0X A;  3CPF A;  5BN5 A;  3VR2 A;  3NQT A;  2Q2H A;  5BR8 Q;  4GKK Q;  2XNA C;  1I6V C;  4X3S A;  1YJW A;  2Y0S G;  3AFP A;  3ZYY X;  1IXR A;  1G91 A;  1X65 A;  3Q0A A;  1XNR L;  1GO3 E;  4I65 A;  1E24 A;  1AE3 A;  1G29 1;  2KHS A;  2EE1 A;  2AKW B;  1HR0 W;  3VYS A;  3TDQ A;  3A8I E;  1A2T A;  1K28 A;  2K5V A;  1PA6 A;  5FLM G;  3EA6 A;  4JPB W;  1SYC A;  1N32 L;  2V4D A;  1B2T A;  2A68 C;  4DR7 L;  2IJ0 A;  2L55 A;  1RHP A;  2BCO A;  2XTI A;  5CV5 A;  4F87 A;  1VF5 C;  3DWP A;  2P5Z X;  3T4A C;  1X3P A;  4CJ0 B;  2QIL A;  5LMN W;  1EIG A;  2RDF A;  1GKH A;  5EGT A;  4WJW A;  1Q1E A;  4A3M G;  5M5W B;  4PZ8 A;  1SJE D;  1NJI C;  2PYK A;  3C3L A;  4NXN Q;  5C3E G;  2UXD L;  2RKS A;  5M5Y H;  3NPP A;  1K8O A;  5KYI A;  3QB3 A;  1JQY D;  1LT6 D;  3MA2 B;  4LW1 A;  1GUW A;  2BE5 C;  3F2U A;  4KN4 C;  2J7Z A;  1VQE A;  2WIN B;  4HID A;  3H3V C;  3SHL A;  4RGM A;  2WII B;  3K0Y A;  4RGT A;  4APV A;  3C1E A;  4NXM L;  5G3L F;  1B9M A;  1OXT A;  4JVZ A;  5ELE A;  3CCS A;  1UNS A;  4IZ8 A;  1U4R A;  4RKL A;  1EUJ A;  1SLJ A;  2C5C A;  2L0C A;  2OQK A;  1K83 H;  2Q2I A;  4R4O A;  2ICE C;  2HQL A;  3HFZ B;  5ELN A;  3PO2 H;  4WJ4 A;  3J7Y W;  3FKI G;  4LFA Q;  4XQN A;  3S14 B;  3GTM H;  1PFM A;  1A3T A;  4QF4 A;  4Z9C B;  2VNU D;  1HTP A;  1PLF A;  2HDL A;  3G48 A;  1VS0 A;  4NW2 A;  4O42 A;  1U9R A;  4BA1 I;  3EJI A;  2EQS A;  4LF4 L;  3KFU A;  2NZO A;  5IGD A;  5IOD A;  5IT9 E;  3V05 A;  2ZJR A;  4HJA A;  3BVZ A;  3KJO A;  4A3B G;  5COR A;  1F9P A;  3UDX A;  2HHH Q;  1Y69 U;  1ILP A;  1WI5 A;  3CW2 C;  3FPU B;  3S1Q H;  1RCV D;  3TZU A;  3ULP A;  1Q3L A;  3KOJ A;  3SDZ A;  1QCB D;  1PH6 A;  1Y8N B;  3MXG A;  1MI2 A;  2R93 B;  2MHV A;  5C0X I;  3GTK H;  3P75 A;  4DK6 C;  1EU3 A;  2B3G A;  3I70 A;  4DK0 A;  2F0N A;  2R7D A;  3KLW A;  5JAV A;  1AW7 A;  2MGS A;  4BXX G;  3CXC A;  3CCM A;  4EQO A;  5HUR A;  5C3X A;  3LNN A;  3CCJ A;  2IL8 A;  1DOM A;  2KEC A;  4ABN A;  1L2F A;  2RQX A;  1AEX A;  1YNJ D;  4X3T A;  3R2I A;  4JI4 Q;  2ZTC A;  4DU9 A;  4DXG A;  2YTV A;  4LF6 Q;  4B3R L;  4A3F G;  3P20 A;  1TWA H;  5IGB A;  2N55 A;  5CR3 A;  4AYB E;  4A3M H;  2XRQ D;  1E1T A;  3WWV A;  4QIW E;  5GAD C;  4JI0 L;  3NEN A;  4B3T Q;  1TU2 B;  5DAU A;  1K0R A;  4BY7 G;  3A5Z B;  2Q2T A;  3W3A A;  4IFD J;  1PZK D;  2A6E D;  2JA7 H;  1YNJ C;  2RSN A;  3GTJ B;  4DV1 Q;  1R9T H;  2JEA I;  2MP1 A;  3J80 L;  1LTA D;  4MTN A;  1SNO A;  4AQY L;  1FNW A;  5JOB A;  3VR6 A;  1K73 C;  3BDO A;  1UE1 A;  1RTO A;  1Z6H A;  2WKC A;  4DA2 A;  1C9O A;  3U9S A;  4J8Q A;  1AZQ A;  1Q7Y C;  2Z6K A;  2F52 A;  4KMU C;  4JCV E;  4DN4 M;  4IFD I;  3ERS X;  1BCP D;  4OO1 G;  3HG9 A;  3M4O B;  2EYF A;  1FNU A;  3AU7 A;  5DNF A;  2E5L Q;  4PZ6 A;  4DUZ Q;  2SNM A;  3HZX A;  3J80 E;  1UE6 A;  3HOX H;  4DK1 A;  1HR0 L;  5I6Y A;  5J22 A;  3S15 B;  2V1C C;  5CBE E;  5C4X B;  4LFC L;  1WTO A;  1X3Q A;  4JI0 Q;  4IUR A;  1K8M A;  5C4X H;  2R6G A;  4EQN A;  2IWH A;  4KHZ A;  2G9D A;  2JA6 B;  2F1M A;  1SAP A;  3G71 A;  4FXG C;  3HOV G;  1HJP A;  1SE4 A;  3HOU H;  2QEX A;  3SR1 A;  3WDN A;  4BBR B;  3ZJY C;  1AZP A;  1CT1 D;  1EY7 A;  3R2T A;  4IUQ A;  1TT2 A;  3RLO A;  3FKI H;  1ESR A;  3M4Q A;  5C44 G;  1EY8 A;  4JK1 C;  4POG A;  5KYL A;  2E74 C;  4A3I G;  1QNU A;  2B8G A;  1TXY A;  3OWF A;  2B2U A;  3SK4 A;  1NCV A;  3CU7 A;  1QIL A;  4HCE A;  1JOO A;  1UEB A;  1R9T B;  4OWT B;  4HN7 A;  3G6J B;  3NBI A;  3QG1 A;  2ZT9 C;  1CFM A;  4LF5 L;  2E2D C;  1PTO H;  1YNN C;  1KRT A;  3GTG H;  1PRT D;  3L9A X;  2CW0 C;  2E2I B;  2XGT A;  2F03 A;  3I55 A;  1TWG B;  2A68 D;  1HZB A;  3PCO B;  2IX1 A;  3T1Y L;  3CCQ A;  4NB3 A;  2D0P A;  2MNA A;  4A3B B;  5BN4 A;  1UAP A;  1CK1 A;  5C4Z A;  1S72 A;  4DUY Q;  1QNK A;  3J81 i;  2F0W A;  1QUQ B;  2VW9 A;  1EQR A;  2PPB C;  2EZV A;  3OOC A;  4KKT A;  5LMU Q;  4A3F H;  1NAP A;  2Z9H A;  4C3I H;  1M1K C;  1KNE A;  4WRD A;  2VUM G;  1JC7 A;  3ICE A;  2Z6K C;  5C0X J;  2HHH L;  1DXM A;  2B29 A;  2QDB A;  4IOC A;  1MSG A;  2UXC Q;  1CQV A;  3KLR A;  2FMC A;  1I4G A;  2Z6B A;  4YY3 L;  5IGG A;  4PZ7 A;  3VYU A;  3NEM A;  4DR5 L;  4RG1 A;  3KDF B;  1E2V A;  3OSO A;  4A3L H;  3J81 L;  1E2Z A;  4YHH L;  4A75 A;  4LFC Q;  5EKI A;  5CGK A;  1ENC A;  2EYP A;  1UE5 A;  3BVG A;  1KXL A;  2K5H A;  4R9W A;  1SNC A;  3NTK A;  4A3D G;  2KEN A;  1LTB D;  1V1P A;  1CZG A;  1NSN S;  1Y8P B;  1JR0 D;  4C3J H;  3J7A F;  1HA5 A;  4GN4 B;  2F0D A;  2AWO A;  1EZ6 A;  2VL6 A;  3N52 A;  2B63 B;  5KGU A;  1OXS C;  4DR2 L;  4CDD C;  1I4Q A;  2ASB A;  4HMI A;  1WCM B;  2BA1 A;  1KD1 C;  2JA7 G;  3U4Z A;  1V9P A;  2F0G A;  3PO3 B;  5FOB B;  2F0S A;  2Z4I A;  3A55 A;  3GTL H;  1F2L A;  3STB C;  4HJ7 A;  4IUV A;  1C4Q A;  2JA8 B;  1D5X C;  3UE0 A;  1PXU A;  2F0F A;  2R92 G;  5D65 A;  1O80 A;  1YEZ A;  5D3I B;  1KLG D;  4P75 A;  4NXN L;  2VQE L;  4QQB X;  3FKI B;  3T53 B;  5C4X G;  4XIG S;  4K6D A;  1GHJ A;  1QWY A;  2X6L A;  3H0G B;  4LUO A;  4RFB A;  4B3M Q;  1B3Q A;  1LLR D;  4M8A A;  1IW7 C;  1YHB A;  1EOT A;  3Q22 A;  5EPK A;  5J1Z A;  1K8A C;  3S2D H;  4B9W A;  1JCK B;  1EQV A;  2K50 A;  1EL0 A;  2XRS D;  3DEO A;  1S5B D;  2B2T A;  2ZTD A;  3R3O A;  1HRJ A;  1WFQ A;  3K6O A;  1RTN A;  3MXU A;  2K5N A;  4AQY Q;  3T13 A;  4RA8 A;  4JI5 L;  4KJN A;  2SOB A;  2MO0 A;  4JI3 L;  3S1R H;  1LTL A;  1ET6 A;  1WTW A;  2YYZ A;  3G7L A;  4OX9 Q;  4ZKC B;  3KBG A;  3TEH B;  3DWQ A;  2DN8 A;  1EQT A;  2ZXO A;  2K4K A;  4FYD A;  1VQC A;  4I7Z C;  3KJP A;  2B39 A;  2PQA A;  3I73 A;  3NSW A;  5EAY A;  1N32 Q;  1L0W A;  3I4N H;  1G51 A;  2BE5 D;  5IP7 G;  4DK3 C;  4B08 A;  3A7L A;  2WAQ E;  1F77 A;  4GS3 A;  4NKL A;  4A3M B;  3HKZ E;  4P71 A;  3PIO A;  1PRT C;  2X69 A;  1B53 A;  1WYD A;  5G3L D;  5GAG C;  4OX9 L;  2OTL A;  4LFA L;  1PFB A;  2H5X A;  4A93 B;  2OQ0 A;  1N34 Q;  1AN8 A;  1PV4 A;  3HOY H;  1GM5 A;  1HA6 A;  4C3H H;  3HOV H;  1TWF H;  3GTO B;  3GD7 A;  2IT1 A;  4M1U B;  3S1M H;  2NBF A;  4DNR B;  2R7Z B;  3BZD B;  1A3V A;  1TWC H;  4A76 A;  1B70 B;  3C2P A;  2M9V A;  1LTS D;  3HOW H;  1U5K A;  1YHQ A;  3DXJ C;  4A3E G;  3T1H L;  2LFN A;  3UE1 A;  5C5L A;  2UUA L;  5EBC A;  4B3S L;  4RHS A;  3E3X A;  4K0K Q;  2HCI A;  5M3M B;  3PUY A;  2EXZ A;  4YWM A;  1XTC D;  3RD4 A;  4HSP A;  1LTI D;  5EPL A;  4DR7 Q;  2QW7 A;  3T51 B;  4ZK9 B;  1F2Z A;  2TSS A;  3OPO A;  1HXY D;  1V1Q A;  5NUC A;  4RWS C;  3C1F A;  1O7L A;  4CKB A;  1Y1V H;  5FLX L;  3I2Z A;  1QG7 A;  5COY A;  5M3F G;  2EPB A;  4LF7 Q;  4N8X 1;  4HJ5 A;  1HPC A;  3HOZ G;  3E9I A;  2B63 G;  3S9W A;  2DJG C;  1TKW B;  4KY7 A;  3R8B A;  4DV3 L;  4A93 H;  3HOV B;  1VF7 A;  1I94 L;  2ES2 A;  1XNQ Q;  2UXB L;  1U4P A;  3I8Z A;  1PYS B;  2LSS A;  1GUO A;  2R92 H;  4HTH A;  4KI0 A;  1TS3 A;  1UUP A;  2HIX A;  4CGY B;  2R92 B;  2JYO A;  4J15 A;  4OIJ A;  1EY9 A;  5C44 B;  4DV0 L;  4DV4 Q;  4HIM A;  4LNQ A;  2RHS B;  4LF7 L;  5IE8 A;  4QJF A;  4O0A A;  2H1E A;  1J5E Q;  2R61 A;  4BWG B;  3ULL A;  3GTG B;  3H0G G;  2WP8 J;  3I4N G;  4MIU A;  3TP6 A;  1RD9 D;  5JEA H;  2BH8 A;  4DV5 Q;  4HAE A;  1O78 A;  1EYA A;  2R93 H;  3M85 A;  2K28 A;  1L1O C;  4C1N I;  2X6G A;  5CMD A;  5C4J H;  1DON A;  4FP5 D;  1TWA B;  1IYU A;  1I94 Q;  1QOH A;  2EYJ A;  2NTS A;  4ZQ3 A;  1XNQ L;  4IPH A;  4BBS G;  2O4X A;  3MTS A;  3NEL A;  1CKO A;  3A5U A;  3OHX C;  5IYB H;  1KAW A;  2YTY A;  4KD3 A;  4X66 Q;  2O5J C;  4R4I A;  1DYQ A;  5DLQ E;  2N49 A;  3AEV A;  3KYH C;  4HSV A;  3R93 A;  1N34 L;  3NXW A;  3F8T A;  2ZJP A;  4JI1 Q;  3BZC A;  4NP5 A;  2WAQ G;  3OYY A;  1D5Z C;  2EDG A;  2EYH A;  2NVT H;  2PNR C;  1EY6 A;  5M9O A;  2NZ1 D;  2UUB Q;  2KED A;  2MPM A;  3D4D A;  4KLK A;  4F8M A;  1KC8 C;  3I4M G;  2MO1 A;  4XXE A;  1LT4 D;  3DWA A;  1I6H B;  5JEA J;  1KDA A;  2KUM A;  2B2Y C;  1X3F A;  3KBX A;  2OEO A;  5JVG 3;  2PI2 E;  3GP7 A;  4KKU A;  1PH7 A;  3F2D A;  2A6H D;  1QZG A;  2B63 H;  3K81 C;  5I9O A;  1HNZ Q;  4GLX A;  4A3D H;  5BR8 L;  1PTO C;  1SE2 A;  5IYC G;  2YV5 A;  1WTQ A;  3ER0 A;  2F0L A;  4HR7 B;  3QR8 A;  3PUW A;  1QZH A;  3D6C A;  2WKD A;  2F3I A;  4A3E B;  3SGI A;  3AQQ A;  4XDX A;  5KND A;  1FD7 D;  2F3V A;  2B2T C;  3HRZ C;  2JA7 B;  5M3M G;  1VQJ A;  4OGQ C;  1FNV A;  3EBE A;  3PO3 G;  1VQO A;  3NUC A;  4HED A;  1MBY A;  2K32 A;  1NTG A;  3I7F A;  2QF7 A;  2PW5 A;  1I4R A;  5LMU L;  3PGZ A;  4PMC A;  2CKZ B;  3A74 A;  2IX3 A;  3H6M A;  1G8Z D;  2Q8T A;  4B3M L;  4LFB Q;  4R1J A;  4ZUJ A;  4XTC S;  1PRT F;  1B3A A;  3NTH A;  1BDO A;  3A0J A;  1Q8I A;  3S2H B;  1K3R A;  1EQQ A;  1HHV A;  2MJ8 A;  3CME A;  4YY3 Q;  4RAU C;  1Z7T A;  4KV6 A;  4XT3 B;  3J7A V;  5IGF A;  4IUP A;  4LF5 Q;  1QJO A;  3K7A H;  3N6R A;  1GVP A;  2UU9 Q;  2LXJ A;  4TKO B;  5AJ3 L;  4X66 L;  4AYB G;  3QOL A;  1XNR Q;  1LV9 A;  4YIJ A;  2Q8I B;  1ROD A;  3LX0 A;  1GD7 A;  5JJK A;  1HZ9 A;  2VUM B;  4ZCK A;  4A3E H;  5C5M A;  2EVB A;  4G4K A;  1CQF A;  4JV5 Q;  5FKA C;  1J8I A;  1X3E A;  2AQ1 B;  2R3Z A;  1VQ5 A;  2SDF A;  1EEF D;  1PYW D;  5JEA G;  1Y1W H;  1L0X B;  5EPJ A;  3K5L A;  1K0S A;  3I4N B;  4G7Z C;  2ALY B;  1C8C A;  5FJ8 H;  2F0E A;  4E6I A;  2A19 A;  2JSO A;  2FXQ A;  1PTO D;  1Y1W B;  5CV7 A;  1LT5 D;  1QB5 D;  2R7Z H;  4UP9 A;  5EBD A;  1RL2 A;  2IHF A;  2HQE A;  4A3I H;  2JA9 A;  4JI2 Q;  1OXX K;  1SE8 A;  1VQ4 A;  5GQO A;  1SYD A;  1XMQ Q;  5M5X B;  1UEA B;  4BY7 H;  4DV7 Q;  1STN A;  1V1O A;  4A93 G;  3H3V I;  4JBJ A;  4DR3 L;  1YJ9 A;  4K5X A;  1N8R C;  4WJ3 M;  2D2C C;  4K5V A;  2OWO A;  4POF A;  2KQ3 A;  4HMJ A;  5FO8 B;  1ZKO A;  3ND8 A;  2AUK A;  2JA5 G;  4B3S Q;  1KHI A;  1E22 A;  2NN6 H;  3S2H H;  1XYI A;  1BNZ A;  1VQH A;  1SND A;  2JA8 G;  4P2C B;  3M7G A;  1HQR D;  2B2V C;  4WOR A;  2KOL A;  1PFN A;  2I07 B;  1BBX C;  2VQF L;  3RUZ A;  2PW7 A;  2LXK A;  2Q8R E;  4N8F A;  1ASY A;  1IZ6 A;  2RF4 A;  3IFD A;  3RNU A;  1EFW A;  4QL5 A;  1LUZ A;  1PMR A;  3A54 A;  4OXP A;  3BG3 A;  1YBY A;  4FXK C;  5J39 A;  4Y7N B;  3H3V H;  3UDF A;  3VA7 A;  4X64 Q;  3SK5 A;  3LGJ A;  5IYC H;  1HUN A;  3DEP A;  1ZXT A;  4XYQ A;  4XYO A;  5JPN C;  2YU9 H;  4L5R C;  4LUV A;  1LO5 D;  3VYT A;  3GTJ H;  3JC6 6;  3JAM E;  2LKV A;  2HIV A;  3GTM B;  5KRU A;  1SR3 A;  3SVM A;  1LM0 A;  3H15 A;  3BJU A;  1KIX A;  2PZU A;  5C0X H;  2K01 A;  2KA7 A;  5IYB G;  2F4V L;  1XWE A;  2HUG A;  1SRO A;  3CPW A;  4EVO A;  2HT1 A;  1FR3 A;  2KEE A;  4LF8 L;  3GTQ H;  3MAQ A;  3QIA A;  3CCU A;  1Y14 B;  4K6L A;  1TWG H;  2DNC A;  3PO3 H;  2Z4H A;  1FJG L;  4DR4 Q;  5A2Q E;  3KF6 B;  4X65 Q;  1TS5 A;  1B4O A;  3I4O A;  3KF8 A;  4JI6 Q;  3J81 E;  4GN3 B;  2XWJ B;  1PFS A;  3CP0 A;  3RLN A;  2NYZ D;  2E5L L;  4OO1 H;  1CKN A;  4JC0 A;  1WTP A;  3RN5 A;  1O7Y A;  3QO2 A;  4H44 C;  2YTX A;  1Q12 A;  5E3F A;  2B2U C;  2EYL A;  3TZD A;  4JBK A;  4TSS A;  3EIV A;  2F0P A;  4DAP A;  5IYD H;  1DOL A;  4CKE A;  3Q8D A;  1N33 L;  1ASZ A;  3ERQ A;  2Y0S B;  4DR6 Q;  4RCO A;  4KY5 A;  3NHH A;  1MJE A;  3TN2 A;  4IOA A;  4C2M H;  1SJH D;  1YJN A;  4AYB B;  5EJW A;  4IUN A;  1TS4 A;  2WB1 B;  1SEB D;  3CC2 A;  3HKS A;  3QJY A;  1U4M A;  3S2D B;  2M2L A;  1F9Q A;  1TY0 A;  2I5H A;  2B2W C;  1S3O A;  3PF4 A;  3H91 A;  2QCP X;  1JB3 A;  3TQY A;  1JWM D;  1OXV A;  4ILW A;  2RDG A;  1VMC A;  1XJV A;  2XN9 C;  1BOS A;  4RH6 A;  1IL2 A;  4CJ2 C;  1VMP A;  2F3W A;  1SSO A;  2PQA B;  1TWF B;  1HTL D;  2EY5 A;  3GTO H;  2NZH A;  1JMC A;  4P72 A;  3PUX A;  1P8L A;  5ELO A;  3TSS A;  3RR5 A;  1T5X D;  2CQO A;  1N36 L;  1KAA A;  1CSQ A;  5EKL A;  1XPO A;  4N9T A;  2UUB L;  1H9S A;  2ICI A;  1PH4 A;  1Q8K A;  4K14 A;  1EYC A;  3HOW B;  1A62 A;  1EIF A;  4ZAI A;  5M3F B;  1UE7 A;  1IBL Q;  4UDU C;  4DAM A;  5IT9 c;  2D0O A;  1N33 Q;  3I4M B;  4JYA L;  2KJX A;  4G57 A;  5CV9 A;  1GUT A;  2CHB D;  5J3B A;  3I4M H;  1STH A;  1I3Q H;  1QVG A;  4IJH A;  5JPM C;  4FNF A;  3OTO L;  4GLA C;  3TP8 A;  3T16 A;  1GHK A;  1PTO F;  2O2L D;  1A3U A;  2FIN B;  4MZ9 A;  1G6Z A;  4IUT A;  4EQP A;  4QGU A;  2F0J A;  4G7O C;  1R4P B;  1F9S A;  1VQ7 A;  4C3H G;  5I9P A;  2B2Y A;  2RCF A;  4IQZ A;  2D5D A;  1IBK L;  3HOY G;  4DFA A;  4A3K H;  4DAY B;  1IL8 A;  1FYC A;  1XX8 A;  1YZ6 A;  5GAH C;  2ENB A;  4A3K B;  4XT1 B;  1JJ2 A;  1TQO A;  2CWP A;  5JVH 3;  1L1O B;  3TME A;  4DR1 L;  4A3G H;  4MHE A;  1VDZ A;  4H0L C;  1EOV A;  2DGY A;  3A56 A;  3I3C A;  4BBS B;  1ESF A;  1TVX A;  1NY4 A;  1I3Q B;  1VQI A;  1D8L A;  4PG3 A;  4O2D A;  3GTQ B;  1HFN A;  1HNX Q;  5IP9 H;  3NK9 A;  3H94 A;  2QDL A;  1BCP B;  1A63 A;  1RJT A;  3ONA B;  5C3E H;  5M3F H;  4A4I A;  1K9M C;  4K2L A;  3W2D A;  3HKZ B;  4BY1 B;  2PO4 A;  1MIU A;  1SNM A;  1I5F A;  2H4O A;  2WAQ B;  3L3O C;  1E3P A;  3ERO A;  3RZD H;  4Y52 H;  1LTT D;  3CRK C;  2EY1 A;  3RN2 A;  1LAC A;  2DUD A;  5E7N A;  3NP8 A;  1ET9 A;  2L1B A;  4DR5 Q;  3BYT B;  1BCP C;  4FDB A;  3L7Z C;  4OEL B;  4QUC A;  1CHQ D;  2VB3 X;  1EIY B;  1Y1W G;  2EYO A;  4K8I A;  5ISR A;  1CUK A;  1GXD C;  1HR0 Q;  3HEJ A;  4IJL A;  5CV6 A;  4KJO A;  4I7A A;  1G6P A;  3TBI B;  4JBM A;  1S5C D;  4TQU S;  4K0K L;  2NVX H;  1HZA A;  3IRB A;  3HGB A;  1YIJ A;  3VYR A;  3I90 A;  2NVX B;  1O7Z A;  1XPU A;  3MVV A;  2Y0S E;  1PH2 A;  1B7Y B;  1BVS A;  4DV6 Q;  1LT3 D;  4UP8 A;  2JA5 B;  4OO1 I;  4LF8 Q;  3CQZ B;  1NR4 A;  1PH9 A;  5JJL A;  2N88 A;  1E1O A;  2NB0 A;  3HOX B;  2KCM A;  2UUC L;  4GZY C;  2F0O A;  1A2U A;  1PZJ D;  2KCN A;  4R4C A;  3FHW A;  3L0O A;  5D3D A;  3DHQ A;  3GQB A;  1SNQ A;  4JI8 Q;  4KHP L;  1HZC A;  4DR2 Q;  1NMF A;  1K83 B;  2ZTE A;  5LL6 X;  1I4H A;  2UXB Q;  1JWS D;  4K8J A;  2O5I C;  2ZM6 L;  2DY8 A;  3D3R A;  1SYF A;  2GVA A;  1ENA A;  4GN5 A;  2JA6 G;  2NVQ B;  2F0H A;  4DR6 L;  2FJ2 A;  3M7N A;  1SYG A;  3EN2 A;  2K1B A;  2CH4 A;  1SN8 A;  4DR3 Q;  4X62 Q;  1EEI D;  3J80 c;  1MD2 D;  5T1G A;  3U9O A;  1NE3 A;  4DNT B;  5F2D A;  1I6H H;  3NE5 B;  4A3C H;  1D1I A;  2YU9 B;  2E75 C;  1SMX A;  5K5P A;  3RLF A;  1HNW L;  2QEJ C;  2QGQ A;  5LHY 1;  4C3H B;  1EYG A;  1Q1B A;  2EIF A;  3HOY B;  4DV5 L;  5JJI A;  2EJF C;  2MQH A;  5CC4 A;  2E8G A;  3CCV A;  5K36 G;  1X55 A;  4QIW B;  2I0Q A;  3BS1 A;  2GVB A;  5IP9 G;  2EY6 A;  5AFW A;  2IHE A;  3D6W A;  4EGV A;  1VQP A;  3MEH A;  3ITP A;  3A8J E;  2F0U A;  5M3M H;  5FLX c;  2PMZ E;  1H9S B;  4JV5 L;  3CCL A;  4JI3 Q;  3AFQ A;  1JJG A;  1S5E D;  1WTX A;  1IYJ B;  2VB2 X;  3X3M A;  3MZ5 A;  1V43 A;  2L15 A;  2ATW A;  2F0K A;  1ILQ A;  3QOJ A;  4ULL A;  1H95 A;  1KDC A;  3CCR A;  2A73 B;  2AQ3 B;  1VQ9 A;  5IWA Q;  4JI2 L;  3HKZ G;  3B6Y A;  4BY1 G;  2F0I A;  3S1Q B;  4DPG A;  4OL7 A;  3M4P A;  5DEH A;  2FHT A;  1T5E A;  3GDE A;  4RGN A;  4JOI C;  3CMA A;  3Q6S A;  3G4S A;  2SNS A;  2EJG C;  4KTA A;  2D62 A;  1A6X A;  3CCE A;  4ALP A;  4H7B A;  4JOI A;  4X65 L;  1SYB A;  2I5M X;  3P7J A;  2NTT A;  2XWB B;  4IFD G;  3UI2 A;  4C3J B;  2Z8L A;  2UU9 L;  2Q2U A;  1XMO Q;  4YHH Q;  2RDH A;  2KVM A;  4A3D B;  4KN7 C;  5E4W C;  4LJZ C;  3KK7 A;  2KHI A;  2A5H A;  3KLS X;  4IPG A;  1ICF B;  4MNO A;  4AH6 A;  3K5M A;  1WTV A;  3MXN B;  1DCZ A;  4XQQ A;  5I2Y A;  2XVS A;  1RKN A;  1TWH H;  2UXC L;  2L12 A;  3A7A B;  3MFY A;  4PMW A;  5AJ3 Q;  1AH9 A;  3MEF A;  1WVL A;  3GV6 A;  2E76 C;  1XMQ L;  5KNB A;  3BDL A;  1ONL A;  2ZJQ A;  3J7A 5;  1G2T A;  4FO2 A;  2DNE A;  4J6H A;  1N9W A;  2K04 A;  4LF9 Q;  1P16 A;  4QCL A;  1X54 A;  3LWE A;  4L63 B;  1A15 A;  3AMU A;  1STG A;  5A35 A;  2JA6 H;  1C48 A;  3MXP A;  1ICW A;  5FLM H;  4A3C G;  2OT2 A;  2XIW A;  4RCN A;  3J81 c;  4P73 A;  4RMF A;  4DKA C;  2EOT A;  3I56 A;  2F4V Q;  1CA5 A;  1HH2 P;  1D6E C;  3BYY B;  1CKM A;  5C3W A;  1Q86 C;  3H09 A;  4IN3 A;  3I72 A;  3SK6 A;  1BCP F;  5M5W H;  1VQ6 A;  2CVR A;  1E7Z A;  4F88 A;  3TS2 A;  2C9O A;  3E6Z X;  4A3K G;  1WOC A;  1V8Q A;  2E2J H;  3VR4 A;  2BA0 A;  1Y8O B;  2JQO A;  1YNX A;  2IY5 B;  3WOE A;  1PH3 A;  2CQA A;  3BU2 A;  3RZO B;  4OHJ A;  4U67 3;  1NBW A;  1EY0 A;  2N3S A;  1AE2 A;  3IFT A;  2A8V A;  2WB1 G;  3DLL A;  1SFO H;  1J9O A;  2SEB D;  5IWA L;  4FF4 A;  4CKC A;  1SE3 A;  1DJR D;  2ID0 A;  5K36 H;  1OXU A;  3K7U C;  4UP7 A;  4WFN 3;  1IBL L;  4KK7 A;  2N78 A;  5DM6 3;  3S14 H;  2QA4 A;  2A69 C;  2ZXR A;  5IOC A;  4BY1 H;  4B9X A;  1I4X A;  2JJQ A;  3L2P A;  4HCS A;  3M3Y H;  3PMF A;  4LUZ A;  2K5D A;  2PNH A;  1TWH B;  4LK1 C;  1Q82 C;  2AMC B;  1STB A;  1ENF A;  4JI7 Q;  3T56 B;  5D14 A;  3HOU B;  1B8A A;  2VS1 A;  4DV7 L;  3HOW G;  2G5D A;  1NNX A;  3K8A A;  4DGZ A;  3D4R A;  1STE A;  2M00 A;  1OTC A;  3DM3 A;  4NPS A;  1QUQ A;  2AHO B;  5IGC A;  5FJ8 G;  1DM0 B;  2K5W A;  3PF5 A;  4HIK A;  5EQ0 A;  5E1F A;  1FVI A;  2R7Z G;  1SYE A;  3S16 B;  1BR9 A;  2K7V A;  4R4Q A;  2K03 A;  1OO9 B;  3NWS A;  2E2J B;  3MXN A;  3E5S A;  4HJ8 A;  1A8V A;  5E4X A;  4DV6 L;  3NBH B;  4ID6 A;  5IP7 H;  1F9R A;  3MHB A;  5IYD G;  1RF2 D;  4GLV B;  1IHZ A;  3GV3 A;  2A6H C;  4LMQ D;  2E2I H;  3URY A;  1EYD A;  3HOZ H;  2XSC A;  4CHT B;  4NDX A;  5IT9 L;  4IUU A;  1WD1 A;  3GTP B;  1GJX A;  3S17 H;  4GKJ L;  1QVF A;  4C3J G;  5GRO A;  4QMG A;  2A1A A;  5EKK A;  4JI4 L;  5FK9 C;  1M90 C;  3HS0 C;  1NUC A;  2J4X A;  4K2K A;  1VQK A;  4R8N A;  5M5X H;  2IPK D;  3CD6 A;  3KF8 B;  4Q0F A;  4FVM A;  4HJ9 A;  1E0B A;  3KUP A;  3NQI A;  4DV2 Q;  3BZK A;  1CHP D;  4F7X A;  2GN5 A;  2K5Q A;  1DD2 A;  3TP7 A;  1HFG A;  4DR4 L;  2EYM A;  1FJG Q;  4BXX H;  1VQG A;  5ELF A;  3T1Y Q;  1J6Q A;  3U58 A;  4OWX B;  3EVQ A;  1BQQ T;  4A3G B;  4ODG A;  1G2S A;  3W5O A;  2I46 A;  2ZM6 Q;  1F2Y A;  1I4P A;  1MGS A;  2A69 D;  1STA A;  4OIK A;  4JI8 L;  1MSH A;  3S16 H;  4FXD A;  3D31 A;  4Q5V A;  4IAL A;  3MWY W;  4QB4 A;  1GOZ A;  1BXT A;  4JI1 L;  4IPD A;  3AB9 A;  2VQF Q;  3DUZ A;  4DR1 Q;  1KQS A;  2R7F A;  1PRT B;  1X6O A;  4YWK A;  2F0M A;  1PYB A;  4TVA B;  4C3I B;  1WTR A;  3CAM A;  4G7H C;  2CWA A;  5H1S E;  1S5D D;  1I50 H;  4H02 A;  1IW7 D;  5LMN L;  2C35 B;  3DM1 A;  3GO5 A;  1YHA A;  5JJZ A;  1IBK Q;  1ML0 D;  4A3J G;  3K80 C;  4ME3 A;  3LWU A;  1SMY C;  1ZYR C;  1HNW Q;  2PZW A;  3U4V A;  1K3B C;  3PO2 B;  1BUV T;  3H0G H;  1EZ8 A;  1WD0 A;  2PQE A;  2K6A A;  3HOX G;  1CSP A;  2OCE A;  3TS0 A;  3S1M B;  1B1Z A;  5FO9 B;  3FP9 A;  4X62 L;  3STB D;  3OW7 A;  1KAB A;  3KLS A;  3V96 A;  3V2T A;  1VQL A;  4FF3 A;  5CBA E;  3FRP B;  4JW0 A;  1PZI D;  1A0I A;  3M4Y A;  1DOK A;  4C56 C;  1CTM A;  4MTK A;  3CHB D;  4EQ5 A;  2B2W A;  4DAV A;  3RZO H;  1IKM A;  4PQX A;  1XMO L;  4BBS H;  2JXM B;  2L9H A;  2B8F A;  5HY6 A;  3VDY A;  2CW0 D;  1JE5 A;  1E2W A;  1FGU A;  4X3K A;  3DMU A;  4L5S A;  3CRL C;  3PIO 3;  4DUY L;  4LAA A;  3S1R B;  3OW2 A;  1MJC A;  4YCV A;  1KRS A;  2CH4 W;  2F0T A;  1Q81 C;  4DUZ L;  5C3E B;  3VR3 A;  3HOZ B;  2J0T D;  1D7Q A;  1Y1V B;  2K33 A;  5ELC A;  1KNA A;  2G9H D;  4CDF C;  1Z47 A;  1LAB A;  1STY A;  3OTO Q;  2EY2 A;  5KNC A;  1IKL A;  3PV0 A;  4GOP A;  5FLX E;  3PIP A;  3E9H A;  1CM9 A;  4RHR A;  4HIO A;  4GKK L;  1KTK A;  4DV2 L;  3TRE A;  3NWT A;  1QE6 A;  2RVL A;  3J80 i;  1X56 A;  4CBV A;  4FF1 A;  4KHP Q;  1BBU A;  1WTH A;  4R4T A;  2OF1 A;  4L6T B;  5LL6 S;  2CFM A;  3K59 A;  1EY4 A;  1JOR A;  3PUV A;  4MN3 A;  3JAM i;  5CV4 A;  2A74 C;  5C44 H;  1N36 Q;  3BVM A;  2UUA Q;  2LS0 1;  4K5W A;  2HCC A;  1AFP A;  1PH8 A;  1II3 A;  4GKJ Q;  3FPP A;  3M4O H;  4CJ1 B;  1U4L A;  4ZYS A;  1YIT A;  5IY0 A;  4OON A;  2AQ2 B;  4DF7 A;  2ZXP A;  3WOF A;  1X32 A;  2JK8 A;  1RIP A;  2UUC Q;  2LY7 A;  3GTL B;  3F1Z A;  3D0F A;  1EFI D;  2K05 A;  1D5M C;  3AYH B;  5DM7 3;  3S17 B;  2L4N A; 
#chains in the Genus database with same CATH homology
 2F3I A;  4AQY L;  3SGI A;  3AQQ A;  1SMX A;  1HNW L;  3RLF A;  1WCM H;  1K73 C;  1IBM L;  4YCU A;  2QGQ A;  1UE1 A;  1EYG A;  2AWN A;  4IO9 A;  1Q1B A;  2EIF A;  1VQJ A;  5M3M G;  1BBW A;  4DV5 L;  2MQH A;  2CCZ A;  1MKH A;  3EBE A;  2VUM H;  3PO3 G;  5JJI A;  1C9O A;  2E8G A;  3CCV A;  1VQO A;  5K36 G;  1X55 A;  2I0Q A;  5LMN Q;  1Q7Y C;  2R93 G;  2Z6K A;  2F52 A;  2VQE Q;  4JCV E;  4IFD I;  2GVB A;  3ERS X;  4DNI A;  1DGS A;  5IP9 G;  2RHQ B;  1NTG A;  3I7F A;  4JG2 A;  4OO1 G;  1PVO A;  2IHE A;  1O7I A;  5LMU L;  1FL0 A;  3PGZ A;  2K52 A;  1VQP A;  4A3L G;  2CKZ B;  3A74 A;  2E5L Q;  4PZ6 A;  1KL9 A;  4DUZ Q;  4B3M L;  1UE6 A;  3HOX H;  3CF5 A;  4LFB Q;  3M9B A;  2BH2 A;  3HOU G;  1HR0 L;  4R1J A;  4XTC S;  5M3M H;  2RCN A;  2V1C C;  5FLX c;  2VY3 A;  2PMZ E;  3A0J A;  4LFC L;  1Q46 A;  1K3R A;  4JV5 L;  1EQQ A;  4B3T L;  4JI0 Q;  3CCL A;  4JI3 Q;  3AFQ A;  5C4X H;  2R6G A;  3CME A;  1S40 A;  1JJG A;  4YY3 Q;  4KHZ A;  1IYJ B;  3G71 A;  3HOV G;  1HJP A;  4YCW A;  1V43 A;  2L15 A;  4LF5 Q;  2ATW A;  3K7A H;  1GVP A;  2UU9 Q;  3HOU H;  5HGQ A;  2LXJ A;  2QEX A;  2UXD Q;  5AJ3 L;  1H95 A;  4X66 L;  4LWC A;  3CCR A;  3ZJY C;  4AYB G;  1VQ9 A;  1JJC B;  5IWA Q;  1XNR Q;  4JI2 L;  3HKZ G;  1GD7 A;  3B6Y A;  4BY1 G;  5JJK A;  4DPG A;  1HZ9 A;  3RLO A;  3FKI H;  3M4Q A;  4GOP C;  5C44 G;  3M4P A;  4A3E H;  4OWW B;  4POG A;  3GDE A;  4JOI C;  3CMA A;  3G4S A;  2K75 A;  4A3I G;  4JV5 Q;  2D62 A;  4X6A H;  1TXY A;  1X3E A;  1VQ5 A;  3CCE A;  4ALP A;  4JOI A;  4JYA Q;  4X65 L;  5JEA G;  1YI2 A;  1Y1W H;  1UWV A;  2NN6 I;  4YWL A;  2I5M X;  2ALY B;  1UEB A;  4OWT B;  4LFB L;  5FJ8 H;  3W1G A;  2A19 A;  4IPC A;  2FXQ A;  4UY8 C;  4IFD G;  1VQM A;  4LF5 L;  3G6E A;  4EX5 A;  2UU9 L;  2R7Z H;  1VQA A;  4UP9 A;  2Q2U A;  1XMO Q;  1KRT A;  4YHH Q;  3GTG H;  1RL2 A;  2JE6 I;  1Z9F A;  2IHF A;  2XGT A;  3I55 A;  2KHI A;  2WB1 E;  1HZB A;  4A3I H;  4LNQ A;  3ULJ A;  3PCO B;  2JA9 A;  4IPG A;  3T1Y L;  2IX1 A;  4MNO A;  1OXX K;  1SE8 A;  2NN6 G;  4NB3 A;  3MXN B;  2D0P A;  4JI2 Q;  4AH6 A;  5GQO A;  2MNA A;  1VQ4 A;  1TWH H;  2UXC L;  1S72 A;  2WFW A;  4DUY Q;  1XMQ Q;  4PMW A;  5AJ3 Q;  4BY7 H;  1WJJ A;  3MEF A;  4BBR H;  1AH9 A;  4DV7 Q;  3W1B A;  1XMQ L;  3J81 i;  4A93 G;  2ZJQ A;  1QUQ B;  4JBJ A;  1EQR A;  2VW9 A;  4DR3 L;  1YJ9 A;  4GNX C;  1W2B A;  4A3J H;  1N8R C;  3J7A 5;  3S1N H;  4JI5 Q;  5GAE C;  1N9W A;  1K8G A;  2OWO A;  4POF A;  4LF9 Q;  1LYL A;  1P16 A;  1X54 A;  2E2H H;  5LMU Q;  4DV1 L;  4A3F H;  4L5T A;  4LF6 L;  2JA6 H;  4B3R Q;  1XTD A;  5FLM H;  1HNX L;  4A3C G;  2JA5 G;  3J81 c;  4B3S Q;  2NVQ H;  1KHI A;  1E22 A;  4C3I H;  3S2H H;  4X64 L;  2EXD A;  3CQZ H;  1VQH A;  1YVC A;  2JA8 G;  1XPR A;  2KCT A;  1U0L A;  1M1K C;  1JT8 A;  4DV0 Q;  4DV4 L;  4P73 A;  4RMF A;  4DKA C;  3I56 A;  2F4V Q;  4NXM Q;  2VUM G;  1VQB A;  3ICE A;  2Z6K C;  1HH2 P;  5C0X J;  2HHH L;  2B29 A;  1C0A A;  1CKM A;  4IOC A;  2K14 A;  1Q86 C;  1NMG A;  3JAM c;  2UXC Q;  2VZA A;  4YY3 L;  5M5W H;  2VQF L;  4PZ7 A;  1X9N A;  3NEM A;  1VQ6 A;  4DR5 L;  2LXK A;  4RG1 A;  3KDF B;  1E7Z A;  1ASY A;  1IZ6 A;  2RF4 A;  3RNU A;  4A3L H;  1EFW A;  3TS2 A;  4QL5 A;  4YHH L;  4A75 A;  1LUZ A;  4LFC Q;  4A3K G;  1WOC A;  2E2J H;  2IX0 A;  2Z0S A;  2JA8 H;  1UE5 A;  1T9H A;  2MFI A;  4OXP A;  2BA0 A;  3PUZ A;  1YBY A;  5C0X G;  3J81 j;  1KXL A;  2PI2 A;  3H3V H;  1PH5 A;  2K5H A;  2JQO A;  1YNX A;  3UDF A;  2IY5 B;  3KDF A;  4X64 Q;  4A3D G;  2OTJ A;  2KEN A;  1PH3 A;  4JI7 L;  3LGJ A;  5IYC H;  2KHJ A;  3BU2 A;  2YU9 H;  4L5R C;  1NBW A;  4LUV A;  2N3S A;  4C3J H;  1AE2 A;  4GN4 B;  3GTJ H;  2A8V A;  2AWO A;  2WB1 G;  2VL6 A;  4JBW A;  3JC6 6;  3DLL A;  2HIV A;  1SFO H;  3H3V I;  1OXS C;  4DR2 L;  5IWA L;  2ASB A;  1VQF A;  1SR3 A;  2ID0 A;  1LM0 A;  3H15 A;  2JEB I;  1OXU A;  3BJU A;  3K7U C;  4UP7 A;  3F2C A;  2BA1 A;  2N78 A;  1KIX A;  1JB7 A;  1IBL L;  1KD1 C;  2JA7 G;  5IYB G;  3U4Z A;  1V9P A;  2F4V L;  2QA4 A;  3S14 H;  3PO2 G;  4BY1 H;  2JJQ A;  3UDI A;  3L2P A;  3M3Y H;  1SRO A;  1VQ8 A;  3GTL H;  3STB C;  4HJ7 A;  3CPW A;  4LUZ A;  2HT1 A;  3UDG A;  4LF4 Q;  2PNH A;  4LF8 L;  1HNZ L;  3J7Z C;  1VQN A;  3S24 A;  3UE0 A;  1Q82 C;  3CCU A;  3GTQ H;  2AMC B;  2R92 G;  4QY7 A;  1PHJ A;  1Y14 B;  4JI7 Q;  1TWG H;  1YEZ A;  4P75 A;  4NXN L;  2VQE L;  1BKB A;  3PO3 H;  4QQB X;  1B8A A;  2VS1 A;  1FJG L;  4DV7 L;  3GTP H;  1X3G A;  4DR4 Q;  1W3S A;  3KF6 B;  3PSI A;  4X65 Q;  4GOP B;  1SRU A;  1IBM Q;  4L5Q A;  3HOW G;  3I4O A;  4JI6 Q;  4GN3 B;  5C4X G;  4XIG S;  3CC4 A;  1PFS A;  4BA2 I;  3CP0 A;  3K8A A;  3RLN A;  2E5L L;  4LUO A;  1CKN A;  4Y7N H;  4B3M Q;  4JC0 A;  4UPA A;  3RN5 A;  1YHB A;  1OTC A;  3DM3 A;  2YTX A;  2JA5 H;  1Q12 A;  3CCQ A;  4NPS A;  1K8A C;  4JBK A;  1QUQ A;  3S2D H;  4AIM A;  3EIV A;  2AHO B;  5IYD H;  2K50 A;  1N33 L;  3Q8D A;  5FJ8 G;  3TRZ A;  4DV3 Q;  1ASZ A;  4DR6 Q;  3PF5 A;  4HIK A;  1MJE A;  1L1O A;  1FVI A;  4IOA A;  4C2M H;  2R7Z G;  4BBR G;  1CKN B;  2ZTD A;  4R4Q A;  1YJN A;  4GNX A;  1WFQ A;  3CC2 A;  2K5N A;  3HKS A;  1QVC A;  4HJ8 A;  4AQY Q;  1A8V A;  1VQD A;  3S15 H;  3KF6 A;  4A3G G;  4DV6 L;  3NBH B;  5IP7 H;  4WJ3 M;  1Y1V G;  2I5H A;  4JI5 L;  2MO0 A;  4GLV B;  4JI3 L;  1EWI A;  5IYD G;  4LF9 L;  2I5L X;  1S3O A;  1WCM G;  3PF4 A;  3S1R H;  1LTL A;  1OXV A;  1VCI A;  3TQY A;  2YYZ A;  4OX9 Q;  2E2I H;  3HOZ H;  1XJV A;  2KBN A;  3F2B A;  3TEH B;  1IL2 A;  2K4K A;  4GNX B;  3U50 C;  2PQA B;  3S17 H;  1VQC A;  4GKJ L;  3GTO H;  3KJP A;  1C7Y A;  2NZH A;  1QVF A;  1JMC A;  4P72 A;  3PUX A;  2PQA A;  1P8L A;  5ELO A;  5EAY A;  1N32 Q;  3RR5 A;  4JI6 L;  1L0W A;  2CQO A;  5GRO A;  3I4N H;  1G51 A;  2A1A A;  1N36 L;  5IP7 G;  1XPO A;  1CSQ A;  4JI4 L;  4A3B H;  2UUB L;  4DK3 C;  3E0E A;  1PH4 A;  3T1H Q;  2WAQ E;  1Q8K A;  1M90 C;  4GS3 A;  1A62 A;  1EIF A;  1UE7 A;  3HKZ E;  1IBL Q;  4P71 A;  3PIO A;  1VQK A;  1PH1 A;  4DAM A;  5M5X H;  5IT9 c;  2D0O A;  2N8N A;  4P74 A;  1N33 Q;  4JYA L;  2NVY H;  3CD6 A;  1WYD A;  3KF8 B;  5GAG C;  4OX9 L;  3CC7 A;  4HJ9 A;  2OTL A;  1J5E L;  4LFA L;  2H5X A;  3K0X A;  3CPF A;  2OQ0 A;  3I4M H;  5J3B A;  4DV2 Q;  3BZK A;  1N34 Q;  1PV4 A;  1I3Q H;  2Q2H A;  5BR8 Q;  3HOY H;  4GKK Q;  1GM5 A;  2GN5 A;  1QVG A;  1YJW A;  4C3H H;  3HOV H;  4IJH A;  2Y0S G;  1TWF H;  3AFP A;  3GD7 A;  1IXR A;  2IT1 A;  3S1M H;  1X65 A;  3OTO L;  4GLA C;  1XNR L;  1GO3 E;  1TWC H;  1B70 B;  4A76 A;  4DR4 L;  1FJG Q;  4BXX H;  3HOW H;  1U5K A;  1E24 A;  1AE3 A;  1G29 1;  1J6Q A;  1VQG A;  4MZ9 A;  4OWX B;  3T1Y Q;  4QGU A;  3U58 A;  1YHQ A;  2AKW B;  4A3E G;  3T1H L;  3UE1 A;  1HR0 W;  2UUA L;  3W5O A;  1VQ7 A;  4B3S L;  2ZM6 Q;  4K0K Q;  2K5V A;  1PA6 A;  3HOY G;  1IBK L;  5FLM G;  1N32 L;  4A3K H;  4DAY B;  3PUY A;  4JI8 L;  3S16 H;  3D31 A;  4YWM A;  4DR7 L;  1YZ6 A;  5GAH C;  2XTI A;  4DR7 Q;  1JJ2 A;  4JI1 L;  4IPD A;  1V1Q A;  2CWP A;  2VQF Q;  4DR1 Q;  1L1O B;  1KQS A;  2R7F A;  5LMN W;  1X6O A;  4YWK A;  1PYB A;  4TVA B;  4DR1 L;  4A3G H;  1GKH A;  1Y1V H;  1Q1E A;  3CAM A;  3I2Z A;  4A3M G;  1EOV A;  5M3F G;  4PZ8 A;  2CWA A;  5H1S E;  4LF7 Q;  2DGY A;  1I50 H;  4H02 A;  4HJ5 A;  1NJI C;  4NXN Q;  5C3E G;  3HOZ G;  3E9I A;  2B63 G;  5LMN L;  2UXD L;  2C35 B;  3GO5 A;  5M5Y H;  1YHA A;  1IBK Q;  1NY4 A;  4A3J G;  1VQI A;  3K80 C;  4ME3 A;  4DV3 L;  1D8L A;  4A93 H;  4PG3 A;  1I94 L;  2ES2 A;  4O2D A;  3U4V A;  1XNQ Q;  1HNW Q;  2UXB L;  4LW1 A;  1HNX Q;  5IP9 H;  1VQE A;  3H0G H;  4HID A;  1PYS B;  2LSS A;  2R92 H;  1A63 A;  4KI0 A;  5M3F H;  5C3E H;  4A4I A;  4APV A;  3HOX G;  1K9M C;  1CSP A;  2OCE A;  3TS0 A;  2HIX A;  4NXM L;  1OXT A;  4J15 A;  3FP9 A;  4X62 L;  3CCS A;  4DV0 L;  1MIU A;  1EUJ A;  1SLJ A;  3STB D;  4DV4 Q;  2OQK A;  4HIM A;  1K83 H;  1I5F A;  2Q2I A;  2RHS B;  2HQL A;  3HFZ B;  4R4O A;  5ELN A;  1VQL A;  4LF7 L;  5IE8 A;  3PO2 H;  1E3P A;  4QJF A;  4WJ4 A;  4O0A A;  3FKI G;  3RZD H;  4Y52 H;  4LFA Q;  1J5E Q;  1A0I A;  3RN2 A;  3ULL A;  3GTM H;  2DUD A;  4EQ5 A;  3H0G G;  5E7N A;  2WP8 J;  3RZO H;  3I4N G;  1XMO L;  2VNU D;  4DR5 Q;  4BBS H;  3L7Z C;  4FDB A;  1EIY B;  3G48 A;  5HY6 A;  3VDY A;  1VS0 A;  2BH8 A;  1Y1W G;  1JE5 A;  1FGU A;  4DV5 Q;  1CUK A;  4BA1 I;  1HR0 Q;  4L5S A;  4IJL A;  4DUY L;  2R93 H;  2EQS A;  3M85 A;  4LF4 L;  3KFU A;  1L1O C;  2NZO A;  3OW2 A;  1G6P A;  1MJC A;  4YCV A;  2ZJR A;  4HJA A;  5C4J H;  4JBM A;  1KRS A;  3KJO A;  4TQU S;  1Q81 C;  4A3B G;  4DUZ L;  4K0K L;  2NVX H;  1HZA A;  1I94 Q;  3UDX A;  1XNQ L;  2HHH Q;  4IPH A;  3IRB A;  4BBS G;  3NEL A;  1WI5 A;  1CKO A;  1YIJ A;  1D7Q A;  3CW2 C;  1XPU A;  3S1Q H;  3A5U A;  5IYB H;  1KAW A;  1Z47 A;  2Y0S E;  2YTY A;  1B7Y B;  3ULP A;  1PH2 A;  3OTO Q;  3KOJ A;  4X66 Q;  1BVS A;  4DV6 Q;  1PH6 A;  4R4I A;  3PV0 A;  4GOP A;  4UP8 A;  5DLQ E;  4OO1 I;  3PIP A;  2N49 A;  4LF8 Q;  3AEV A;  1PH9 A;  3E9H A;  5C0X I;  5JJL A;  4HIO A;  3GTK H;  3KYH C;  1E1O A;  4GKK L;  4DK6 C;  4DV2 L;  1N34 L;  2KCM A;  2B3G A;  2UUC L;  3TRE A;  3F8T A;  2R7D A;  3KLW A;  2ZJP A;  4JI1 Q;  4R4C A;  3J80 i;  1X56 A;  3BZC A;  3FHW A;  4BXX G;  3CXC A;  3L0O A;  2WAQ G;  4KHP Q;  3OYY A;  3CCM A;  1BBU A;  4R4T A;  2NVT H;  4JI8 Q;  4KHP L;  3CCJ A;  2CFM A;  1HZC A;  3PUV A;  4DR2 Q;  3JAM i;  1NMF A;  1L2F A;  2ZTE A;  1N36 Q;  2UUB Q;  5C44 H;  2UXB Q;  4KLK A;  2ZTC A;  2ZM6 L;  1KC8 C;  2UUA Q;  4JI4 Q;  3I4M G;  2YTV A;  2MO1 A;  4LF6 Q;  4B3R L;  4A3F G;  1PH8 A;  1TWA H;  2GVA A;  4GN5 A;  4AYB E;  2JA6 G;  3M4O H;  4GKJ Q;  5JEA J;  4A3M H;  4DR6 L;  3WWV A;  1E1T A;  5GAD C;  4QIW E;  1YIT A;  4JI0 L;  3M7N A;  1X3F A;  3NEN A;  5IY0 A;  3EN2 A;  4B3T Q;  4DR3 Q;  1SN8 A;  1K0R A;  2PI2 E;  3A5Z B;  4OON A;  2Q2T A;  4X62 Q;  4BY7 G;  4IFD J;  1PH7 A;  3F2D A;  1QZG A;  2B63 H;  2JA7 H;  3K81 C;  2JK8 A;  1HNZ Q;  1RIP A;  4GLX A;  2UUC Q;  4DV1 Q;  4A3D H;  1R9T H;  3J80 c;  5BR8 L;  3F1Z A;  3D0F A;  5IYC G;  2JEA I;  1NE3 A;  2YV5 A;  3ER0 A;  4MTN A;  3AYH B;  3PUW A;  1QZH A;  1I6H H;  4A3C H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...