3U58A

Crystal structure of the tetrahymena telomerase processivity factor teb1 ab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein/dna
molecule keywords Tetrahymena Teb1 AB
total genus 40
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A02
3T1HQ 1PA6A 4X64L 1IBML 4A3LG 5C3EG 1FVIA 3ULJA 3I7FA 4JG2A 4QY7A 2NVXH 4P74A 2CWPA 2R92G 1K8AC 3NELA 3KJOA 1VQ9A 4UP9A 3G4SA 3HOUG 1N9WA 2KCTA 4B3SL 3M9BA 4KHPQ 4R4OA 1CSQA 5FJ8H 1OTCA 3TS2A 3NEMA 4WJ3M 4DV3L 4A3MH 2OQKA 4O2DA 5LMUL 2RCNA 4A3FG 4POGA 2UXDL 3HOZH 3ULLA 1GM5A 5M5WH 2Q2TA 1GVPA 1O7IA 2N3SA 4LFAQ 3RLFA 3F2BA 4DR3Q 1X9NA 4C3HH 3PIPA 3I56A 5LMNQ 4OWTB 1ASZA 4DV1Q 4OO1G 4IPCA 4RMFA 2UXCL 4J15A 4DV2Q 4GLVB 1X3FA 2BH2A 4BY7G 1XPUA 2WAQG 1YHBA 2JQOA 1XMOL 3AYHB 3CPWA 2BA0A 3DM3A 4O0AA 3GTLH 1S72A 4HJ7A 5J3BA 1XNRQ 4DR5L 4IOCA 2CCZA 1YITA 1XMQL 5C44H 1N33Q 4A3BG 3CCEA 2CKZB 1HZBA 1J5EL 4C3JH 2JE6I 4PZ8A 4UP8A 1EFWA 4A3GH 4DV7Q 2K5NA 1OXVA 4A3EH 1XMQQ 5M5YH 1NMFA 5GAHC 2PQAA 1EYGA 3GTKH 4LFBL 1G6PA 4LFCQ 3S1NH 2WB1E 4MZ9A 2NN6I 4DAMA 1GD7A 4C3IH 4IJHA 1L2FA 4R4TA 4DR4L 5GQOA 2V1CC 4X6AH 4JBWA 4X66L 2RHSB 3PUVA 1N32Q 1A62A 1PYBA 5C44G 4HJ8A 4A76A 3AEVA 4JC0A 3PO3G 3M7NA 2ZM6Q 2A8VA 4OX9L 2R7ZH 1Q1BA 4X66Q 3CF5A 2Y0SG 5AJ3Q 4YCUA 5M3MG 1PVOA 4IPDA 1IBKL 1XNQL 1MJCA 4IFDJ 4ALPA 4GOPC 4A3BH 1K83H 1MKHA 3HOZG 1PYSB 2MO0A 1XPOA 3PIOA 1L1OA 3IRBA 4YWLA 1JE5A 4DK3C 1IBLL 4LF5Q 4A3CG 3HOYG 4GKJQ 4NXML 4IJLA 3AFPA 5C4JH 2F4VL 1JJCB 2L15A 4JI8L 4NXNL 4A3JG 1KAWA 4GKJL 5FLXc 2A1AA 1VQJA 5IYCG 1E1OA 3PO2H 1Q81C 3HOVH 2IT1A 1NY4A 1FL0A 1EQQA 3W1GA 1RIPA 4X65L 2JA5H 2D0OA 4KHPL 2PMZE 3I4NH 4IFDI 2PI2A 2WFWA 3E0EA 3T1YL 4LF8L 3GTOH 2N49A 2I5HA 1W3SA 4APVA 4DV0L 3S14H 1KIXA 4JI3L 4LW1A 4A3EG 1YI2A 2IY5B 1MJEA 1HR0L 2E8GA 3CCLA 4GNXA 3J81c 3M3YH 3G71A 2Z6KC 1QVFA 3UDIA 3I4NG 1TWCH 4A93H 4YCVA 3CCQA 1HZ9A 2XGTA 2E5LQ 1KRSA 4B3SQ 3OTOL 2RF4A 1K73C 2Q2UA 4DV7L 5AJ3L 5C0XJ 2JEAI 2F3IA 3JAMi 3GO5A 1UE5A 1EUJA 4A3DG 4A4IA 1U0LA 3K80C 3ICEA 1XNRL 5JJKA 4LF6L 2GVAA 2ES2A 5IYDH 5IYBG 2CFMA 3CXCA 3HKZE 4HJAA 1PH3A 4B3MQ 4JI7Q 2KHIA 2ID0A 1C0AA 4LF4Q 4LF6Q 1Q7YC 4JI4Q 4DV6Q 3PCOB 2K52A 2UUBL 2ZM6L 1D8LA 2QGQA 4BA1I 4A3CH 4DNIA 5IP7G 1N8RC 2UU9Q 3S17H 1VQ5A 2NN6G 2ZJPA 1LTLA 1Y1WG 3J7A5 3BZCA 4GKKQ 4A3JH 2YU9H 1HR0Q 1CKMA 1W2BA 1VQNA 3M4OH 3PO2G 1HR0W 2VNUD 1PH7A 2MO1A 1X6OA 2N8NA 2YV5A 2JA8H 2Q2HA 4L5TA 3SGIA 2AKWB 3T1HL 5LMUQ 3Q8DA 1PH4A 4A3KG 4JCVE 1KD1C 3H15A 5IP7H 3WWVA 1VQHA 4HIKA 4DR2Q 1VQIA 5E7NA 4YWMA 4DPGA 1X3EA 4DR5Q 2NVYH 2C35B 1G291 1LUZA 1TXYA 2WP8J 4DK6C 4JI0L 1L1OC 2UUCL 4GN4B 1PH1A 4QQBX 1IZ6A 2XTIA 5GAEC 4PZ7A 4DR6Q 3S15H 1H95A 4JI1L 2JA7G 3GD7A 1YHAA 3J81i 4JOIC 5C0XG 3UDGA 1HNZL 1PH8A 4DUYL 3S2DH 4JI4L 5IY0A 2ZJQA 2K75A 1OXUA 1HNXQ 4JBMA 3CD6A 1KRTA 1PH5A 4ME3A 1E7ZA 2H5XA 4UPAA 2JA6H 4A3DH 4GKKL 4JV5Q 4X62L 1VQLA 1CSPA 3S2HH 1I94Q 3L7ZC 4XIGS 3M85A 2E2JH 3F8TA 2JA5G 2YYZA 4DV6L 2LSSA 1VQEA 2UUBQ 3I4MH 2NZHA 2N78A 4JI5L 3EIVA 3JC66 2R7ZG 3HKSA 2PI2E 2UXCQ 4LF9L 2HHHL 2AHOB 3PGZA 3F2DA 4IOAA 1FJGL 4L5SA 2LXKA 1EWIA 4LUVA 1MIUA 3K8AA 4AYBG 5JJIA 4DR6L 1Y1VG 4GLXA 1SN8A 2ZTCA 3I4MG 1WJJA 4JBJA 1GKHA 2QEXA 4IO9A 1L1OB 4GOPB 3U4ZA 2D62A 4YWKA 4DAYB 5C3EH 1I5FA 4HIMA 4MNOA 1SR3A 1Q1EA 4LF7L 4AQYL 1UE6A 3NBHB 1VQAA 2BA1A 4YY3Q 4A3MG 5JJLA 4QIWE 3HOVG 1VQPA 2D0PA 5LMNW 4DV5Q 5IYDG 2MFIA 1SRUA 2MQHA 1E24A 3HFZB 3TREA 1L0WA 3PUWA 5GAGC 3ZJYC 1K8GA 4DUYQ 3RLOA 2KCMA 2DUDA 3H3VH 1VQCA 4P75A 1KHIA 4X65Q 1B7YB 1P16A 4R4IA 1VQOA 3GTMH 1X55A 4LF9Q 2E2HH 4P71A 3CW2C 3MEFA 3CMEA 2HT1A 3PF5A 4L5RC 3GTGH 2RHQB 3RLNA 2HQLA 2GVBA 2K50A 4AH6A 4LUZA 4EQ5A 1VQMA 5IE8A 4HJ5A 1B70B 4LF7Q 1IBLQ 4LF5L 3CCSA 4X64Q 1IBMQ 2UXBQ 1K0RA 1EIYB 3RN2A 2HHHQ 4BBRG 3TEHB 1Z9FA 1M90C 4DR3L 1BBUA 4LFAL 1XNQQ 4TQUS 2VW9A 2VQEL 1YJNA 1N34L 2ATWA 4A3GG 1SFOH 1Q12A 5M3FH 3RR5A 1R9TH 1HH2P 3U58A 4PMWA 4IPGA 1VQ4A 3CQZH 2F52A 4JV5L 3PUYA 2K14A 4JI8Q 1X56A 4BBSH 4JOIA 1QZHA 4TVAB 1QZGA 3GTQH 5IWAQ 1HNWL 1AE3A 2AWNA 4GOPA 1Y1WH 5H1SE 2YTVA 1EIFA 2EQSA 2UXBL 1TWAH 4DR2L 1IL2A 4DV2L 1V43A 1YZ6A 2WB1G 4NPSA 4HIDA 2CQOA 2VUMG 1PV4A 4WJ4A 4YHHQ 4JI2L 1WCMG 1S40A 4JI7L 1NMGA 4MTNA 3PV0A 1UWVA 4POFA 2UUCQ 2E2IH 4B3RQ 1Y14B 5GROA 1VQDA 3STBC 1XMOQ 3HOYH 4K0KL 3OYYA 4DR7L 2R92H 2VQFL 1LYLA 4AQYQ 4P72A 1IYJB 3KLWA 5C0XI 3L2PA 2IX1A 2VQFQ 1UEBA 4A3FH 2OWOA 1EQRA 2JK8A 3UE1A 1Z47A 5IYBH 4LF4L 1WFQA 3LGJA 1NE3A 4R4CA 4NXNQ 3GTPH 3CCJA 1VQFA 1CKOA 4B3TQ 3UE0A 2JEBI 4YHHL 1HJPA 2WAQE 3EN2A 3PUZA 3G6EA 3AQQA 1KC8C 4DV1L 1M1KC 5JEAJ 4BXXG 2HIVA 3CCMA 1PHJA 2UXDQ 1SE8A 3A74A 4EX5A 1N32L 4FDBA 4K0KQ 4C2MH 2EXDA 1QVCA 1CKNA 2DGYA 3BU2A 4GLAC 4OXPA 3PSIA 4L5QA 1ASYA 4BY7H 5DLQE 5K36G 4A93G 3W1BA 2OCEA 3J81j 2R7DA 5FLMH 4JI2Q 2B29A 1UE7A 1A8VA 2A19A 3UDFA 1JMCA 1OXSC 3U50C 3FP9A 2KBNA 3UDXA 3HOWH 2K4KA 4A3KH 3RZOH 3J80i 1G51A 4DR1L 1CUKA 1Q8KA 2KHJA 3HOXG 3KDFB 2I5MX 1JJ2A 4B3ML 3PUXA 3I55A 4JI3Q 1VS0A 1N36L 5EAYA 1I6HH 3CC7A 5HY6A 4BY1G 2Y0SE 1FJGQ 2EIFA 4YY3L 1X65A 4YCWA 2IHEA 4DUZL 1PFSA 2AWOA 1J5EQ 3HOWG 2K5HA 3K0XA 4GN3B 1N34Q 1OXXK 2CWAA 1QUQB 1HZCA 2ZJRA 4BBRH 4DKAC 5C4XG 1HZAA 1VCIA 2IHFA 1B8AA 3KF8B 4DV0Q 1PH2A 1AH9A 1YJWA 1VQGA 2ALYB 1VQ7A 4P73A 1RL2A 2R93H 2HIXA 3ER0A 4B3TL 4KLKA 1E1TA 1IXRA 5IP9G 3VDYA 1N36Q 4LFBQ 5M5XH 3D31A 2JA8G 3FKIH 4JYAL 1V9PA 3A5ZB 5C4XH 3S1QH 4RG1A 1K9MC 2JA9A 1C9OA 3H3VI 2VL6A 4R4QA 1J6QA 1I3QH 3AFQA 4IFDG 3FHWA 1D7QA 2UUAL 4H02A 3HOUH 3I4OA 2VQEQ 2LXJA 1Y1VH 5IWAL 5FJ8G 1QVGA 1VQKA 3TQYA 3S1RH 1YHQA 3KFUA 4GS3A 3GTJH 4DR1Q 2OQ0A 2MNAA 4A75A 3S24A 2B3GA 3KF6A 2K5VA 2PQAB 3HOXH 4Y7NH 3CP0A 1PH6A 1I94L 2UU9L 5GADC 2NVQH 4QGUA 1QUQA 3PO3H 2NZOA 1T9HA 1HNWQ 2VZAA 1YEZA 4BY1H 1OXTA 2F4VQ 4DR7Q 3OTOQ 4PG3A 3M4QA 4DV4Q 1Q82C 2VY3A 1TWFH 3ULPA 1XJVA 3HKZG 2AMCB 3JAMc 3U4VA 3L0OA 5LMNL 2Z6KA 3K7UC 4UY8C 3MXNB 3A5UA 2OTLA 1YBYA 3RN5A 1HNXL 4OONA 1KXLA 2JJQA 3A0JA 1BBWA 4BA2I 2R6GA 3KYHC 3K81C 1A63A 2R93G 3W5OA 3EBEA 1PH9A 3CC2A 1YIJA 1KQSA 3BZKA 3I2ZA 2OTJA 3J80c 2VS1A 3J7ZC 2GN5A 1WI5A 3NENA 3RNUA 1X54A 4KI0A 4JI6Q 1VQ6A 3FKIG 4NB3A 4OWWB 4DV4L 3F1ZA 4B3RL 1U5KA 4IPHA 3H0GG 2B63H 3TRZA 3D0FA 1IBKQ 3B6YA 5HGQA 3DLLA 4JI6L 1BVSA 2NVTH 1SROA 3K7AH 1SLJA 5M3FG 1TWGH 1XTDA 1N33L 4QL5A 1S3OA 1JJGA 1V1QA 2QA4A 1E3PA 4OO1I 1Q86C 3F2CA 4GNXB 1UE1A 4LNQA 4BBSG 3CCVA 4DV5L 1TWHH 3T1YQ 1SMXA 1JB7A 4QJFA 4LFCL 3H0GH 2B63G 1WYDA 2I5LX 2Q2IA 2UUAQ 4HIOA 2YTYA 1HNZQ 4LUOA 5FLMG 3TS0A 2JA7H 2BH8A 3G48A 5IYCH 5IT9c 2IX0A 4Y52H 2ZTDA 3CC4A 1NJIC 1VQ8A 2Z0SA 4JI5Q 4NXMQ 3S1MH 1WOCA 1DGSA 3CCUA 4JI0Q 4R1JA 1BKBA 3KOJA 3GDEA 3CCRA 4HJ9A 2I0QA 2ASBA 3KDFA 1GO3E 4JI1Q 4GN5A 5BR8L 3KJPA 3RZDH 4GNXC 1JT8A 2R7FA 4XTCS 3E9HA 4AIMA 2PNHA 2KENA 5M3MH 2JA6G 1YVCA 2YTXA 1I50H 1LM0A 1C7YA 1EOVA 3BJUA 5ELNA 2E5LL 4OWXB 3STBD 4OX9Q 3KF6B 1Q46A 2FXQA 4AYBE 1AE2A 4A3IH 3CPFA 4BXXH 5JEAG 1NTGA 4JBKA 3PF4A 1A0IA 4A3LH 4X62Q 1CKNB 1NBWA 1X3GA 1YJ9A 4DR4Q 4DV3Q 4JYAQ 3OW2A 4KHZA 4UP7A 1E22A 1WCMH 3E9IA 3CMAA 4LF8Q 1P8LA 3ERSX 1XPRA 1KL9A 1K3RA 2VUMH 4PZ6A 2ZTEA 1VQBA 3CAMA 4LWCA 1FGUA 3M4PA 5BR8Q 5IP9H 5ELOA 4DUZQ 3S16H 4A3IG 1YNXA
chains in the Genus database with same CATH superfamily
4FF2A 4X64L 3ULJA 4JG2A 2CWPA 3S1MB 1AW7A 2KCTA 4B3SL 3M9BA 4KHPQ 4R4OA 1LO5D 3GV6A 1OTCA 1SNPA 4O2DA 1S5FD 1K0SA 1YNND 3OPOA 1IYVA 2L9HA 3ULLA 2KEDA 3QB3A 1PXUA 2N3SA 4JVZA 3RLFA 4DR3Q 1X9NA 3DMUA 4J8QA 1RCVD 4ULLA 4C3HH 3PIPA 5LMNQ 3VA5A 2B2TC 4RMFA 3VYTA 2Z4IA 1X3FA 2BH2A 4BY7G 1QOHA 4UHVA 1XMOL 4QIWB 2B2WC 1Y1WB 2JP1A 1Z7TA 2CCZA 2R3ZA 3S2DB 1J5EL 1HZBA 5KNBA 1E2WA 4PZ8A 1MSHA 1EFWA 4DV7Q 1EY0A 4OO1H 1UAPA 3L3OC 1EYGA 5GAHC 2PQAA 5ELCA 3GTKH 3S1NH 1SYEA 4MZ9A 4DAMA 2B2TA 4IJHA 1L2FA 5GQOA 4JBWA 1S5DD 3PUVA 2NVQB 4A76A 1Y8PB 2ZM6Q 2R7ZH 5IGEA 3QG1A 1Q1BA 4X66Q 4G57A 2HCIA 4YCUA 2JA8B 1PVOA 1STEA 5JPNC 4LK1C 4ALPA 1QG7A 1PYSB 4BS9A 1L1OA 3IRBA 3NXWA 1JE5A 1RKNA 4LF5Q 3HOYG 5C4JH 3A54A 2L15A 1M8AA 3IFDA 2NN6H 5IGGA 5FLXc 2A1AA 3HOVH 1RIPA 4XXEA 5E4WC 3TP6A 3NWTA 4KHPL 4G7ZC 4IFDI 1EEFD 2QILA 2PI2A 2N49A 4DV0L 4EVOA 1KIXA 3NQTA 5CGKA 1MJEA 4RGNA 1AZPA 4N8X1 3CCLA 4DAPA 3K5OA 2BCOA 3M3YH 1TWCH 1HZ9A 4IUTA 2RF4A 3NE5B 2EZVA 4EQNA 4DV7L 1BCPD 2JEAI 1EUJA 1B53A 5IYDH 4HN7A 4HJAA 4KJOA 2A69D 4IN3A 2KHIA 2ID0A 4CKCA 4LF4Q 4WRDA 2K52A 2ZM6L 3K58A 4A3CH 5IP7G 4XT3B 2UU9Q 1R4PB 1F2LA 3K59A 2ZJPA 1D5MC 3JAME 3BZCA 1W2BA 4FF1A 3M4OH 2VNUD 1PH7A 4NW2A 2MO1A 4XYQA 2YV5A 4RKBA 1BR9A 3T1HL 1PTOB 1BBXC 3H0GB 1VQHA 1X3EA 4C3IB 2E2IB 1LUZA 1VDZA 4RCOA 3M4OB 4PZ7A 3RD4A 3DXJC 3J81i 5C0XG 1HNZL 3HP3A 1QNUA 1PH8A 3S2DH 1TY0A 2K01A 4JI4L 2G9HD 4PQXA 3GTJB 2K75A 1HNXQ 3HOZB 2MHVA 3NQIA 4RHSA 3I72A 3L7ZC 2JA5G 1ZYRC 4DV6L 1C48A 2K5DA 3I91A 4C1NI 2PPBC 1NCVA 1STBA 2ZXPA 5J1ZA 4IURA 2VUMB 3R93A 5JJIA 4TRDA 1Y1VG 4GLXA 3A7AB 4JBJA 2QEXA 1L1OB 1EEID 4K5XA 1BNZA 5C3EH 4MNOA 3SK8A 2H1EA 2XRSD 5LMNW 3C1EA 5C4ZA 1IW7C 2E2HB 2L55A 3H3VH 1VQCA 4P75A 1KHIA 4CBVA 2SNSA 1B7YB 3CHBD 4L63B 5KNDA 3M7GA 5M5XB 3MEFA 2RHQB 2HQLA 1QE6A 2NUCA 4MTKA 1D1IA 4XYOA 1IBLQ 4X64Q 2UXBQ 2VB2X 3RN2A 2HHHQ 4BBRG 2AQ2B 1Z9FA 4DR3L 2HCCA 4RA8A 5LL6S 1Q12A 5C5LA 5A2QE 1EY9A 1TQOA 3RR5A 3NK9A 1R9TH 1ENFA 1FNVA 1O7ZA 1DOKA 3V2TA 4ME5A 2JSOA 2F52A 3PUYA 2K14A 4BBSH 4DK0A 3NTKA 4C3IG 3GTQH 2CW0C 1HNWL 4GOPA 1Y1WH 2DY8A 2YTVA 3Q22A 1EIFA 4NPSA 2VUMG 4WJ4A 4YHHQ 1WCMG 3L9AX 2OF1A 1NMGA 2UUCQ 3D4RA 2E2IH 4KY5A 1WTRA 1Y14B 5GROA 3HOYH 3FRPB 2R92H 3UI2A 3E6ZX 2VQFL 4U673 4ZUJA 1Q3LA 3KLWA 2NZ1D 4A3FH 2OWOA 3S15B 2JK8A 3S1NB 2K1BA 2YU9B 3GTPH 1VQFA 4B3TQ 3G6EA 3EN2A 1GJXA 5FO7B 2UXDQ 1SE8A 4EX5A 1SJHD 4S3SA 4LJZC 1Y1VB 4L5QA 1ASYA 1NNXA 3IFTA 3W1BA 2B29A 5DEHA 1GHJA 3FEWX 1OXSC 5CBEE 2K4KA 1DXMA 1G51A 3KDFB 1NUCA 4B3ML 2F0GA 3QOJA 1O80A 1N36L 5EAYA 5M3MB 3CC7A 4BY1G 3H09A 1X65A 1WTOA 2IHEA 3FMCA 5C0XH 2EYMA 1PFMA 3K0XA 4GN3B 1SYCA 1OXXK 1QUQB 3M4YA 1NSNS 5I2XA 4DKAC 1MHWC 2SEBD 1VCIA 3KF8B 4XQJA 1YJWA 3Q0AA 2B2UC 4R8NA 1BCPC 4P73A 1VQ7A 3OMCA 4OEMB 3TDQA 3ER0A 2V4DA 3IAYA 1E1TA 1IXRA 1X3QA 3VDYA 5M5XH 2JA8G 4CKEA 1PRTC 2VL6A 4R4QA 3OWFA 1DJRD 3FHWA 4KKSA 2UUAL 1SNOA 4HCSA 2VQEQ 1Y1VH 2WACA 1YHQA 4PNYA 4DFAA 1SJED 2OQ0A 4FVMA 2MUYA 3HOXH 1H9SB 2PQAB 3KF6A 1PH6A 5FO9B 2UU9L 1EOTA 2NVQH 3PO3H 4IFDH 3BZDB 2VZAA 1ESFA 1NR2A 4DR7Q 2F4IA 4CDDC 1HHVA 1UNSA 5CV4A 1XJVA 3L0OA 5LMNL 2Z6KA 1QILA 2F0DA 3A5UA 1YBYA 3RN5A 1HNXL 2I46A 1KXLA 1GXDC 1H9KA 2A6EC 2R6GA 4ABNA 1B9MA 3KYHC 1B2TA 1II3A 1JOQA 1A3TA 2KCCA 1PH9A 1G2TA 1KQSA 3BZKA 2OTJA 3K6OA 5CV9A 3NENA 3VR4A 4KI0A 2AQ1B 1ZYRD 3FPPA 1VQ6A 4DV4L 4B3RL 3H0GG 2B63H 1IBKQ 1SE2A 1E2ZA 3K7AH 1SLJA 4XQQA 1TWGH 1HFGA 1PMRA 1V1PB 2F1MA 1V1QA 2XVSA 3T4AC 4BBSG 2NVXB 1TWHH 3D4DA 1U4PA 4QJFA 3MEHA 2UUAQ 2Q2IA 3S1QB 3QWNA 2YTYA 4V0BA 1TWFB 2JA7H 4KD4A 2BH8A 3G48A 1E2VA 2B2YC 3CC4A 1VQ8A 2Z0SA 1WOCA 1DGSA 2F0SA 1BKBA 4R1JA 5KNCA 3MZ5A 3KDFA 1GO3E 4JI1Q 4GN5A 4ZKBB 3KJPA 1TU2B 2R7FA 3ONAB 1I50H 1LM0A 2YTXA 4AYBB 1AZQA 3STBD 3HOUB 1FNUA 1NTGA 2BE5D 3PF4A 1B9NA 1CKNB 1NBWA 2B2YA 4DR4Q 2A6HC 2L0CA 4UP7A 3C2PA 1WCMH 1DONA 3OWEB 4BY7B 1P8LA 5CR3A 5IP9H 1FGUA 5J22A 1YNJD 5ELOA 5EJWA 3J80E 3J7YW 4CHTB 1F9RA 4P74A 1ENAA 3SK4A 3KJOA 1VQ9A 4R9WA 3VYRA 1N9WA 4N9TA 3T56B 3TS2A 1ILQA 2JA7B 5LMUL 2RCNA 2I07B 5CV8A 3SXHA 2VXWA 5C44B 1TS4A 3HOZH 2WKCA 1EY8A 2Q2TA 1O7IA 4LFAQ 3GTLB 3OOCA 5FK9C 4CKBA 1ASZA 1TY2A 1JC7A 4IPCA 2UXCL 3AU7A 4FO2A 4DNTB 1HA5A 3AYHB 1U4LA 2BA0A 3DM3A 3GTLH 3IL8A 4DN4M 1XNRQ 3MFYA 1N33Q 4KJNA 2CKZB 1IKLA 3NUCA 4C3JH 4UP8A 2KHSA 3T53B 1XMQQ 5M5YH 1SFOB 1EQVA 1O7YA 4LFCQ 1GD7A 2NVYB 4DR4L 2V1CC 1HQMC 5C44G 4JC0A 3PO3G 4DF7A 2A8VA 5L37A 2Y0SG 5AJ3Q 2EJFC 5M3MG 1KAAA 3EJIA 2A5HA 1F9QA 4IFDJ 1A15A 1K83H 1MKHA 1EL0A 1I3QB 2SOBA 1D2BA 1XPOA 1HA6A 1KNEA 5C4XB 4A3CG 2LY7A 2NWGA 4NXML 3FKIB 4JI8L 4JK1C 2ICIA 4GKJL 5IYCG 3PO2H 1Q81C 1EQQA 4HR7B 2JA5H 5COYA 1U4RA 3ND8A 3OHXC 1PZID 2D0OA 3GTOH 4A3BH 4LF8L 4QCLA 1A2UA 2I5HA 1W3SA 4LW1A 4A3EG 1D5ZC 1YI2A 2IY5B 5K36H 2EVBA 4GNXA 3EA6A 1A2TA 4K6DA 3NSWA 1KDAA 2AUJD 2E5LQ 2OXPA 1Q8IA 2F0VA 4A3KB 5HURA 2F3IA 1A3VA 2WAQB 2B2WA 1XNRL 5JJKA 4LF6L 1S5ED 1IKMA 3BVGA 2EDGA 2CFMA 1PLFA 4MN3A 1Q7YC 4POGA 3PCOB 1NR4A 2Z8LA 3J7AV 1FYCA 5EPKA 1LTLA 1Y1WG 4GKKQ 4A3JH 2X6GA 1CKMA 5M9OA 1X6OA 2KECA 2Q2HA 1KDCA 4L5TA 2F0QA 2AKWB 3Q6SA 4K6LA 4MHEA 1PFBA 3A55A 3Q8DA 4A3KG 1KD1C 5KRUA 3H6MA 4DPGA 5E4XA 2C35B 1G291 4DK6C 4JI0L 4EQPA 1L1OC 2UUCL 4QQBX 1IZ6A 1RJTA 2XTIA 5BN5A 1PTOF 4A3JB 3S15H 3NP8A 3R2IA 4C3HB 3MHBA 1Y8NB 1ILPA 3MC0B 1V1PA 1BF4A 1H9MA 3S1RB 2B8GA 2KUMA 1KRTA 5FKAC 1EWHA 2H5XA 4UPAA 4A3DH 4JV5Q 3J7AF 4X62L 1VQLA 3TZUA 1B50A 1I94Q 2E2JH 4XIGS 3MWYW 2N78A 5D14A 2EOTA 3QR8A 1ICWA 3WDNA 2AHOB 2IL8A 4IOAA 1F2YA 1R9TB 2C9OA 2LXKA 1EWIA 1I4GA 1YNJC 1MIUA 1ENCA 3K8AA 4AYBG 4V190 1VF5C 2JN4A 3I4MG 1SDFA 1WJJA 3EQLC 1CM9A 4GOPB 3U4ZA 4Y7NB 4DAYB 2JA5B 4HCEA 3NBHB 1IYUA 4DV5Q 4IUQA 2MQHA 3HFZB 3OSOA 3TREA 1EQTA 4JPBW 5JJZA 1IL8A 1JOKA 2OT2A 4O42A 2F0JA 1U4MA 1JB3A 4X65Q 1P16A 4R4IA 1VQOA 3K57A 5EKIA 5I4DA 2E2HH 3PF5A 5E3FA 3RLNA 2FFKB 4WFN3 1B70B 5IOCA 1H9RA 3CCSA 4E6IA 2IPKD 2Q8RE 3TEHB 4LFAL 1BBUA 2CHBD 4N9PA 1TT2A 3GTPB 5NUCA 4TQUS 2VW9A 1PRTD 2VQEL 4A3GG 2F0WA 2DJGC 1EY7A 1HH2P 2WINB 4RKLA 4XT1B 4CJ1B 4IPGA 1VQ4A 4JV5L 1CA5A 4NMZA 1X56A 4JOIA 4TVAB 1KLUD 1JE4A 1ET6A 1MD2D 3I70A 2F3VA 2J7ZA 3D4WA 2DJFC 2UXBL 1TWAH 1W6KA 3N52A 2PMZB 4HIDA 1EZ6A 1K83B 3EROA 4JI2L 1EY4A 1S40A 1WTXA 3D3RA 4MTNA 4POFA 1F2ZA 4JI7L 4DR7L 1K28A 3P20A 4BBSB 1TS3A 2ICEC 4GZYC 4ZAIA 1IYJB 3HRZC 3Q23A 2IX1A 1UEBA 1RTOA 4R4CA 1VMPA 2EYFA 5ELFA 2CH4W 3HGBA 3UE0A 4YHHL 4C3JB 3VYSA 1KC8C 2IX3A 4DV1L 2HIVA 3CCMA 1PHJA 3A74A 4FDBA 3X3MA 2EXDA 4BY7H 5DLQE 1WCMB 4RH6A 4K2KA 1UE7A 1A8VA 2A19A 5A2QL 3FPUB 1TWAB 3UDXA 3FP9A 3PO3B 3HKZB 4A3KH 2QEJC 5CYUA 4IUPA 1SE3A 1CUKA 1JJ2A 4NKLA 2R61A 1RTNA 3R3OA 4UAIA 1I6HH 2R93B 2Y0SE 1Q90A 1FJGQ 1LT3D 2QCPX 2PNRC 4CDCC 3HOWG 2K5HA 4K8IA 4F8MA 2L11A 2CWAA 2ZJRA 1CHQD 1SBBB 2H4OA 5C4XG 1B8AA 1SNCA 1AH9A 3BS1A 2F0TA 1J9OA 2ALYB 3SK6A 5IGBA 3LWUA 4B3TL 2LS01 1S4ZA 3NPPA 1CTMA 5IP9G 1N36Q 2O5IC 4LFBQ 3D31A 1V9PA 1BO0A 2JA9A 1C9OA 2F0KA 3H3VI 1J6QA 3GV3A 3AFQA 1AFPA 4ID6A 4H02A 2XNAC 1LTGD 1HUNA 3K7AB 2L4NA 3ND9A 2RSOA 3GTJH 1EU4A 3KF8A 4A75A 2K5VA 2XWJB 4Y7NH 3CP0A 2PZWA 3JAML 2NB0A 4QGUA 1B1ZA 1DCZA 5C4HA 2NZOA 3TMEA 3K5LA 4IUVA 4ZQ3A 1YEZA 1EY5A 2XWBB 5EGTA 2F4VQ 3OTOQ 1BDOA 3QO2A 1Q82C 4A3EB 1TWFH 1CZGA 4FXGC 2AMCB 3BG3A 2JJQA 2Q8TA 1BBWA 3K81C 1OO9B 4BY1B 3CC2A 1YIJA 3I2ZA 3J7ZC 2GN5A 1X54A 4FF3A 2B2VC 5LL6X 3F1ZA 1ZKOA 4IPHA 4FYDA 4JI6L 5HGQA 1SROA 1LTTD 2EXZA 2EY2A 1N33L 1JJGA 3AB9A 1LT4D 4ZK9B 3J80L 4R8IA 4OO1I 4GNXB 4LNQA 2ENBA 1QCBD 3KBXA 4DV5L 4LFCL 4RHRA 2PW7A 2RDGA 5EBCA 4QUFA 2FMCA 2CQAA 5JAVA 1RF2D 1SXTA 5IYCH 4JI5Q 1PRTF 4OHJA 1NJIC 4NXMQ 3S14B 4CDFC 3KOJA 3GDEA 4DU9A 2KOLA 3CCRA 4HJ9A 5BR8L 3RZDH 1JT8A 3HG9A 5M3MH 5ISRA 2KENA 2JA6G 1C7YA 1EOVA 3BJUA 5CV6A 2F0PA 4OX9Q 2Z9HA 1Q46A 2FXQA 4C56C 1LACA 1AE2A 4AYBE 2A69C 3CPFA 2EPBA 1A0IA 1ET9A 1X32A 4DV3Q 1WD1A 4JYAQ 3OW2A 3VA7A 1WTVA 1K3BC 3E9IA 3CMAA 5LHY1 4LF8Q 3ERSX 2EYOA 4DUZQ 3M4PA 3S16H 1L0XB 4A3IG 1WVLA 4OWTB 3T1HQ 1LTRD 2F03A 2K7VA 2Z6BA 1IBML 4A3LG 5C3EG 1FVIA 3I7FA 4HEDA 2NVXH 1DM0B 5CMDA 1K8AC 4OL7A 2K28A 2KA7A 3NBHA 5D3DA 1SYFA 2E2JB 1EZ8A 4H0LC 5FJ8H 2UXDL 2OQKA 1C8CA 2RSNA 1WTHA 2EY6A 3NHHA 2NTTA 3H91A 1GVPA 2E75C 1L0YB 1D6EC 3I56A 3I8ZA 4EGVA 1HQRD 4DV1Q 1JQYD 4OO1G 1VF7A 2X69A 1I4QA 4DV2Q 4GLVB 2F3WA 1XPUA 1YHBA 2HD3A 2WAQG 2ZXRA 2IJ0A 3CPWA 1S72A 4HJ7A 1U9RA 1MSGA 3CCEA 3DM1A 2JE6I 2A73B 5CBAE 1NMFA 1CI3M 3E3XA 2WB1E 2Z1CA 5M5YB 3HS0C 3KLRA 4C3IH 4R4TA 3S17B 4X66L 2KEEA 3AEVA 1PTOH 3NTIA 3M7NA 4OX9L 4O1NA 4K8JA 3TP8A 1XNQL 1KABA 2F0LA 4GOPC 2MO0A 3C46A 3PIOA 3MXNA 3IKJA 4DK3C 1IBLL 4A3IB 3AFPA 4C3HG 4WJWA 4NXNL 4A3JG 4HTHA 5IT9E 1SNMA 3NBIA 1E1OA 2IT1A 2Z4HA 3W1GA 3F2UA 3SVMA 1LT6D 3H3VC 4CGYB 4KKTA 3T1YL 4APVA 3S14H 3CRLC 2BDOA 1HR0L 3NWSA 2O2LD 3PO2B 3G71A 4A93H 2K32A 4YCVA 3CCQA 2XGTA 1KRSA 3OTOL 1K73C 5AJ3L 5C0XJ 4DK1A 1SSOA 4RGTA 3JAMi 3ZYYX 1SYDA 4K5WA 1UE5A 4A3DG 4A4IA 1U0LA 3K80C 1JR0D 3NTHA 3ICEA 2GVAA 2ES2A 1XXGA 3RUZA 2JA6B 1I6HB 1PH3A 3PIO3 3HKZE 1C0AA 4DAVA 2UUBL 2QF7A 2QGQA 4KN7C 4IZ8A 1STGA 1N8RC 1E0BA 5FO8B 1SAPA 2NN6G 2AUKA 2YU9H 4QB4A 1WD0A 2JA8H 2EY1A 3R8BA 2B2UA 2D5DA 1KDBA 3H15A 5IP7H 3WWVA 5E7NA 1HFNA 4DR5Q 2WP8J 3EVQA 4DR6Q 1H95A 2AQ3B 2HUGA 4JI1L 1YHAA 1K8OA 4JOIC 2BDNA 4KMUC 1JWUD 3SEBA 4DUYL 3OIQA 4L6TB 1LABA 1EU3A 1ONLA 4Q0FA 1HRJA 1STHA 3SHLA 1E7ZA 1BXTA 2LFNA 4OIJA 2JA6H 4GKKL 2A68C 4A3MB 2CH4A 1CA6A 1CSPA 2MJ8A 2LSSA 4KHVA 3A8IE 4JI5L 3EIVA 2DNEA 2X6LA 5IIFA 2RCFA 1GUTA 4LF9L 4F7XA 3BDCA 4PMBA 4L5SA 3M3YB 1A3UA 3D6CA 4LUVA 3A8JE 1EYCA 4FF4A 1SN8A 3TSSA 1C4QA 3PIP3 3KBGA 1GKHA 4IO9A 3SK5A 1GUSA 3DWQA 1JWSD 1I5FA 5DAUA 1Q1EA 1GUOA 4LF7L 1UE6A 1VQAA 2BA1A 2WV6D 4QIWE 2LKVA 4CJ2C 3K5MA 1F9PA 1SRUA 2TMPA 1E24A 5IT9L 3PUWA 3ZJYC 3P7JA 1I4HA 2DUDA 1SEBD 5C3EB 1IW7D 3GTMH 3HOWB 3PQIA 5KYLA 3CMEA 2EYPA 2GVBA 2K50A 2QKIC 4LUZA 1FD7D 4OIKA 4AH6A 4A93B 3LWEA 4HJ5A 3LX0A 2K6AA 1LLRD 4LF5L 4KK7A 2M2LA 1IBMQ 2HDMA 1K0RA 4QUCA 3A8KE 2NYZD 1M90C 1I4RA 1N34L 1YJNA 2WKDA 1B4OA 1ZXTA 5M3FH 3HOVB 4N8FA 3CQZH 2E2DC 4JI8Q 4IUNA 2JXMB 1QZHA 4FXDA 4IUUA 2EQSA 2CW0D 3RZOB 4DR2L 1IL2A 4DV2L 1V43A 1YZ6A 1SE4A 3I73A 2A68D 3PV0A 1UWVA 2J4XA 1AP0A 1S5BD 4B3RQ 1VQDA 4K0KL 3OYYA 1DYQA 3QIAA 1LT5D 1EIGA 4IALA 5F2DA 3SDZA 3L2PA 2VQFQ 1EQRA 3U9SA 3UE1A 4HAEA 4LF4L 1WTQA 3GTKB 4NXNQ 3CCJA 1CKOA 1HJPA 2WAQE 3PUZA 1M1KC 3AQQA 4BXXG 5JEAJ 3FDTA 5K5PA 3AMUA 1N32L 4C2MH 1QVCA 2DGYA 4GLAC 4CJ0B 4A93G 2OCEA 3KUPA 1K8MA 4JI2Q 2QDLA 2RKSA 1JMCA 4XQNA 3RZOH 2L12A 3FVQA 3J80i 1KNAA 1ZEQX 4DR1L 2KHJA 3HOXG 2I5MX 1IHZA 3BYYB 3CQZB 1VS0A 2KJXA 5HY6A 2EIFA 4YY3L 1PYWD 4NDXA 1PFSA 1J5EQ 1N34Q 1HZCA 1JORA 5C3XA 3QJYA 1PH2A 1GUWA 4X3SA 4QMGA 1BOSA 5IGFA 4DA2A 4DXFA 1RL2A 3URYA 4JW0A 2SDFA 2HIXA 4M1UB 1UUPA 4KLKA 1TIID 5C4JB 4JYAL 2HQEA 4U68A 3P75A 1XWEA 5KIXA 4G7HC 4RG1A 4IQZA 1K9MC 1XX8A 2RVLA 2EYJA 5ELEA 5JOBA 4IFDG 3S2HB 1QVGA 5IWAL 5FJ8G 3TQYA 3S1RH 4C2MB 2QW7A 2MNAA 1CZWA 2B3GA 5T1IA 1I94L 3I4NG 1EIHA 1R4QB 1QUQA 4BY1H 1OXTA 1PRTB 4PG3A 3M4QA 2VY3A 5EKKA 2ZXOA 3HKZG 4PMCA 2DY7A 3JAMc 2SNMA 3V96A 3MXNB 4OONA 5EPLA 4BA2I 1T5XD 2R93G 3W5OA 1CT1D 2G9DA 1XYIA 2VS1A 1BCPB 5IODA 3KK7A 3FKIG 4NB3A 4OWWB 3OW7A 5A35A 3ERQA 3TRZA 2K5WA 3DLLA 2QDBA 1H9JA 5BN4A 2K5QA 5M3FG 1XTDA 4QL5A 2QA4A 1E3PA 4BWGB 1Q86C 3H94A 3I3CA 4F87A 3VR5A 4KV6A 1PZJD 3CCVA 1JB7A 3H0GH 2B63G 5JVG3 2I5LX 3OIPA 4LUOA 1CFMA 5FLMG 4KTAA 1D5XC 3CU7A 2RBMA 2JYOA 1WTWA 4H44C 2IX0A 4Y52H 2ZTDA 2J0TD 4FP5D 3DHQA 5DNFA 3CCUA 2KQ3A 4RFBA 3I4NB 3I90A 2ASBA 1CHPD 4UDUC 2MPMA 3PMFA 2N88A 5I2YA 2F0EA 3E9HA 2PNHA 3DEPA 1YVCA 1AN8A 2E5LL 1QB5D 4OWXB 2K33A 3KF6B 1H9SA 1B3QA 1QJOA 2PCFB 4BXXH 5JEAG 1T5EA 1W6JA 5KGUA 1MI2A 3CRKC 4KHZA 1E22A 4HMIA 1I50B 1KL9A 3BVZA 1K3RA 4ZKCB 2VUMH 4PZ6A 1HXYD 5BR8Q 3TZDA 1PA6A 5DM63 1JCKB 4QY7A 4ZYSA 3LNNA 2R92G 3NELA 5CV5A 4UP9A 3G4SA 3HOUG 5I9OA 1CSQA 3KLSA 2F0NA 3NEMA 2O5JC 4WJ3M 4DV3L 4A3MH 4A3FG 4K2LA 1LV9A 1SYBA 4WORA 1GM5A 5M5WH 2FHTA 3F2BA 2G5DA 1B44D 3BDOA 4C3JG 5G3LF 4J15A 1TWGB 2MP1A 4A3DB 2JQOA 3GQBA 4O0AA 5J3BA 1S5CD 1HTLD 4IOCA 4DR5L 1YITA 2R7ZB 1XMQL 1MBYA 5C44H 4A3BG 1QNKA 1RDPD 4A3GH 2K5NA 1OXVA 4A3EH 2RDHA 2C5CA 3R2TA 5CV7A 3KLSX 4Q5VA 4LFBL 1G6PA 3T16A 2NN6I 2WB1B 4X6AH 1EYAA 3C1FA 2RHSB 1N32Q 1A62A 1PYBA 4HJ8A 3CKIB 2XSCA 2B2VA 3VR6A 4TKOB 2NBFA 3CF5A 1M4VA 3MTSA 4IPDA 1IBKL 1O78A 1I4PA 5DM73 1MJCA 5FLXE 2RA4A 4X3UA 3HOZG 1O7LA 1STYA 3TP5A 4YWLA 1TR5A 4GKJQ 1KLGD 4IJLA 5JVH3 1STAA 2F4VL 1JJCB 1I4XA 2IWHA 1GOZA 1KAWA 1TWCB 1VQJA 1NY4A 1FL0A 4B9WA 4X65L 3WOEA 1QWYA 3N6RA 2PMZE 3I4NH 2WFWA 3E0EA 4BBRB 3EFXD 4HSPA 4X3TA 2O4XA 2PZTA 4JI3L 4FXKC 3W2DA 1G6ZA 2E8GA 3TP7A 1DOLA 4RWSC 2F0UA 3X3NA 3J81c 1SMYD 1EWCA 2Z6KC 3UDIA 4DNRB 1QVFA 4QF4A 4LMQD 4HMJA 3GTGB 5D65A 3W3AA 4B3SQ 4C1NK 1TWHB 4RCNA 2Q2UA 3GTOB 4A3BB 3I4MB 5CC4A 3Q24A 3GO5A 4ZUIA 5ELDA 2A6HD 1X3PA 5IYBG 1SYGA 4RGMA 1KTKA 3CXCA 4H13C 4JI7Q 4B3MQ 4G7OC 1MGSA 4LF6Q 2FMMA 2EJGC 5T1GA 4DV6Q 4JI4Q 1D8LA 4ZCKA 4BA1I 1V8QA 4DNIA 3S17H 1VQ5A 4F88A 3J7A5 1LTBD 2XN9C 1HR0Q 1VQNA 3PO2G 1HR0W 3DUZA 5I9PA 2N8NA 3SGIA 5JEAH 4HSVA 5LMUQ 4TSSA 1PH4A 2XRQD 4JCVE 4DR2Q 4HIKA 5CORA 1VQIA 4YWMA 2NVYH 1TXYA 3DWPA 3MFGA 4P2CB 3D8GA 4CDEC 4GN4B 5BN3A 1PH1A 5GAEC 4ZLTF 4A3FB 1ESRA 2JA7G 3GD7A 1TS5A 5J39A 2EYHA 3UDGA 2E74C 4NP5A 2DN8A 4A3GB 3MXPA 3HOXB 2FJ2A 5IY0A 2ZJQA 3CD6A 1OXUA 5C6AA 4JBMA 5C5MA 1PH5A 4ME3A 3T13A 1F9SA 2WIIB 1GUNA 4RAUC 5IGDA 3S2HH 3VYUA 3M85A 1EY6A 3F8TA 2YYZA 1RHPA 2UUBQ 1VQEA 3I4MH 2NZHA 1LTAD 1XTCD 3JC66 1UEAB 4KY7A 2FINB 3HKSA 1HUMA 2PI2E 3TN2A 2R7ZG 2UXCQ 2HHHL 3A7LA 3F2DA 3PGZA 3S16B 1PTOC 1FJGL 4DGZA 2L1BA 4K14A 5G3LD 5M3FB 1HTPA 4K5VA 4DR6L 4I7AA 2ZTCA 4KKUA 3DWAA 2B39A 2Q8IB 3I4LA 2D62A 4YWKA 4HIMA 1Y69U 1SR3A 3DEOA 4AQYL 5JJLA 4YY3Q 4A3MG 3HOVG 1VQPA 2D0PA 5IYDG 2MFIA 5EKLA 4I65A 4RGOS 1L0WA 5GAGC 5FOBB 1K8GA 4DUYQ 3RLOA 2KCMA 1V1OA 1BQQT 3BDLA 1I6VC 4YIJA 2F0OA 1ML0D 2D9UA 1X55A 2DNCA 5JPMC 4LF9Q 4P71A 3CW2C 2F0IA 1DOMA 2HT1A 3GTGH 4L5RC 3P1HA 4EQ5A 3S9WA 4I7ZC 1VQMA 5IE8A 5KYIA 3MXGA 4LF7Q 1RODA 5TSSA 1EIYB 3MVVA 5HGTA 1XNQQ 2MGSA 4KY6A 1NAPA 2ATWA 4ZRZA 1SFOH 1PTOD 2HDLA 2B8FA 3C3LA 2TSSA 1LTID 3G6JB 4PMWA 4MIUA 3U58A 2NVTB 1G91A 2R92B 1QZGA 5IWAQ 1AE3A 2AWNA 5H1SE 1FNWA 3WOFA 1J8IA 2WB1G 2CQOA 1PV4A 3SR1A 3A56A 1RD9D 5I6YA 1CQFA 3K5NA 2F0HA 3HZXA 5EQ0A 3STBC 1XMOQ 2B63B 3MA2B 3MXUA 1LYLA 2BE5C 4AQYQ 4P72A 1BCPF 1TKWB 5EPJA 5C0XI 4XDXA 1Z47A 5IYBH 1WFQA 3LGJA 1NE3A 1Z6HA 2F0MA 2EYLA 3O13A 2JEBI 4OGQC 2N55A 2VB3X 4K0KQ 3BU2A 1CKNA 4OXPA 1SMYC 3ITPA 3PSIA 5K36G 5FLXL 3J81j 2R7DA 5FLMH 3VR2A 1HCZA 1EYDA 2PZUA 3UDFA 1F77A 3U50C 3HOWH 2KBNA 3GTMB 1GHKA 1Q8KA 5M5WB 2L5TA 3PUXA 3I55A 4JI3Q 4KD3A 2RQXA 4B08A 3V05A 3J81L 1SNDA 4YCWA 2Y0SB 2CVRA 5IGCA 3MAQA 4DUZL 2AWOA 5AFWA 3T51B 1AEXA 4BBRH 1GUGA 1DD2A 1HZAA 2IHFA 2PW5A 4DV0Q 1TS2A 1VQGA 4ILWA 2KCNA 1F2MA 1PZKD 2RDFA 2R93H 3VR3A 3U9OA 2E76C 2A6ED 1FGBD 4LAAA 1CQVA 4EQOA 3FKIH 1B3AA 3A5ZB 5C4XH 2ZT9C 1I3QH 2OEOA 1PFNA 1D7QA 1ICFB 4OELB 3HOUH 1DZ1A 3I4OA 2LXJA 4L8JA 1VMCA 4DXGA 1VQKA 3KFUA 4GS3A 4DR1Q 3S24A 2M9VA 2EJMA 3QOLA 3G7LA 5GADC 2PO4A 1T9HA 1HNWQ 2LMCB 2A74C 2K03A 4KN4C 1STNA 4Z9CB 1CK1A 4DV4Q 2NTSA 4G4KA 1G2SA 3ULPA 1PDQA 1FR3A 2K04A 3TBIB 1JOOA 2GA4B 5ELBA 3U4VA 3K7UC 1G8ZD 4UY8C 2OTLA 3SE0A 3A0JA 3GP7A 4M8AA 1A63A 1Y8OB 3EBEA 3E0JA 3J80c 3BYTB 1WI5A 5E1FA 3RNUA 4JI6Q 1U5KA 3HOYB 3D0FA 5C3WA 3B6YA 2PQEA 2NVTH 1BVSA 4X3KA 1LTSD 1SNQA 1TVXA 2P5ZX 1S3OA 3D6WA 1HPCA 3BVMA 3F2CA 3J81E 2F0FA 2M00A 1UE1A 4PV1C 3T1YQ 1SMXA 4B9XA 3GTQB 4J1MA 1WYDA 1D1KA 4HIOA 1HNZQ 1YNNC 3TS0A 2EE1A 4DAYA 1BUVT 2PYKA 1JICA 5IT9c 3S1MH 3HEJA 2K05A 1JWMD 5D3IB 4JI0Q 3K0YA 5EBDA 2BOSA 2I0QA 2EY5A 3E5SA 4J6HA 4GNXC 4XTCS 4AIMA 2IW3A 5ELNA 4FNFA 2XIWA 5KEEA 2D2CC 4H7BA 5I6WA 4A3IH 1EFID 4JBKA 3OMGA 2KVMA 4X62Q 4A3LH 3RMHA 1YJ9A 1X3GA 4ODGA 1A6XA 1XPRA 2ZTEA 1VQBA 3CAMA 4LWCA 1WTPA 3RZDB 3S1QH 1YNXA
chains in the Genus database with same CATH topology
3T1HQ 1PA6A 4X64L 1IBML 4A3LG 5C3EG 1FVIA 3ULJA 3I7FA 4JG2A 4QY7A 2NVXH 4P74A 2CWPA 2R92G 1K8AC 3NELA 3KJOA 1VQ9A 4UP9A 3G4SA 3HOUG 1N9WA 2KCTA 4B3SL 3M9BA 4KHPQ 4R4OA 1CSQA 5FJ8H 1OTCA 3TS2A 3NEMA 4WJ3M 4DV3L 4A3MH 2OQKA 4O2DA 5LMUL 2RCNA 4A3FG 4POGA 2UXDL 3HOZH 3ULLA 1GM5A 5M5WH 2Q2TA 1GVPA 1O7IA 2N3SA 4LFAQ 3RLFA 3F2BA 4DR3Q 1X9NA 4C3HH 3PIPA 3I56A 5LMNQ 4OWTB 1ASZA 4DV1Q 4OO1G 4IPCA 4RMFA 2UXCL 4J15A 4DV2Q 4GLVB 1X3FA 2BH2A 4BY7G 1XPUA 2WAQG 1YHBA 2JQOA 1XMOL 3AYHB 3CPWA 2BA0A 3DM3A 4O0AA 3GTLH 1S72A 4HJ7A 5J3BA 1XNRQ 4DR5L 4IOCA 2CCZA 1YITA 1XMQL 5C44H 1N33Q 4A3BG 3CCEA 2CKZB 1HZBA 1J5EL 4C3JH 2JE6I 4PZ8A 4UP8A 1EFWA 4A3GH 4DV7Q 2K5NA 1OXVA 4A3EH 1XMQQ 5M5YH 1NMFA 5GAHC 2PQAA 1EYGA 3GTKH 4LFBL 1G6PA 4LFCQ 3S1NH 2WB1E 4MZ9A 2NN6I 4DAMA 1GD7A 4C3IH 4IJHA 1L2FA 4R4TA 4DR4L 5GQOA 2V1CC 4X6AH 4JBWA 4X66L 2RHSB 3PUVA 1N32Q 1A62A 1PYBA 5C44G 4HJ8A 4A76A 3AEVA 4JC0A 3PO3G 3M7NA 2ZM6Q 2A8VA 4OX9L 2R7ZH 1Q1BA 4X66Q 3CF5A 2Y0SG 5AJ3Q 4YCUA 5M3MG 1PVOA 4IPDA 1IBKL 1XNQL 1MJCA 4IFDJ 4ALPA 4GOPC 4A3BH 1K83H 1MKHA 3HOZG 1PYSB 2MO0A 1XPOA 3PIOA 1L1OA 3IRBA 4YWLA 1JE5A 4DK3C 1IBLL 4LF5Q 4A3CG 3HOYG 4GKJQ 4NXML 4IJLA 3AFPA 5C4JH 2F4VL 1JJCB 2L15A 4JI8L 4NXNL 4A3JG 1KAWA 4GKJL 5FLXc 2A1AA 1VQJA 5IYCG 1E1OA 3PO2H 1Q81C 3HOVH 2IT1A 1NY4A 1FL0A 1EQQA 3W1GA 1RIPA 4X65L 2JA5H 2D0OA 4KHPL 2PMZE 3I4NH 4IFDI 2PI2A 2WFWA 3E0EA 3T1YL 4LF8L 3GTOH 2N49A 2I5HA 1W3SA 4APVA 4DV0L 3S14H 1KIXA 4JI3L 4LW1A 4A3EG 1YI2A 2IY5B 1MJEA 1HR0L 2E8GA 3CCLA 4GNXA 3J81c 3M3YH 3G71A 2Z6KC 1QVFA 3UDIA 3I4NG 1TWCH 4A93H 4YCVA 3CCQA 1HZ9A 2XGTA 2E5LQ 1KRSA 4B3SQ 3OTOL 2RF4A 1K73C 2Q2UA 4DV7L 5AJ3L 5C0XJ 2JEAI 2F3IA 3JAMi 3GO5A 1UE5A 1EUJA 4A3DG 4A4IA 1U0LA 3K80C 3ICEA 1XNRL 5JJKA 4LF6L 2GVAA 2ES2A 5IYDH 5IYBG 2CFMA 3CXCA 3HKZE 4HJAA 1PH3A 4B3MQ 4JI7Q 2KHIA 2ID0A 1C0AA 4LF4Q 4LF6Q 1Q7YC 4JI4Q 4DV6Q 3PCOB 2K52A 2UUBL 2ZM6L 1D8LA 2QGQA 4BA1I 4A3CH 4DNIA 5IP7G 1N8RC 2UU9Q 3S17H 1VQ5A 2NN6G 2ZJPA 1LTLA 1Y1WG 3J7A5 3BZCA 4GKKQ 4A3JH 2YU9H 1HR0Q 1CKMA 1W2BA 1VQNA 3M4OH 3PO2G 1HR0W 2VNUD 1PH7A 2MO1A 1X6OA 2N8NA 2YV5A 2JA8H 2Q2HA 4L5TA 3SGIA 2AKWB 3T1HL 5LMUQ 3Q8DA 1PH4A 4A3KG 4JCVE 1KD1C 3H15A 5IP7H 3WWVA 1VQHA 4HIKA 4DR2Q 1VQIA 5E7NA 4YWMA 4DPGA 1X3EA 4DR5Q 2NVYH 2C35B 1G291 1LUZA 1TXYA 2WP8J 4DK6C 4JI0L 1L1OC 2UUCL 4GN4B 1PH1A 4QQBX 1IZ6A 2XTIA 5GAEC 4PZ7A 4DR6Q 3S15H 1H95A 4JI1L 2JA7G 3GD7A 1YHAA 3J81i 4JOIC 5C0XG 3UDGA 1HNZL 1PH8A 4DUYL 3S2DH 4JI4L 5IY0A 2ZJQA 2K75A 1OXUA 1HNXQ 4JBMA 3CD6A 1KRTA 1PH5A 4ME3A 1E7ZA 2H5XA 4UPAA 2JA6H 4A3DH 4GKKL 4JV5Q 4X62L 1VQLA 1CSPA 3S2HH 1I94Q 3L7ZC 4XIGS 3M85A 2E2JH 3F8TA 2JA5G 2YYZA 4DV6L 2LSSA 1VQEA 2UUBQ 3I4MH 2NZHA 2N78A 4JI5L 3EIVA 3JC66 2R7ZG 3HKSA 2PI2E 2UXCQ 4LF9L 2HHHL 2AHOB 3PGZA 3F2DA 4IOAA 1FJGL 4L5SA 2LXKA 1EWIA 4LUVA 1MIUA 3K8AA 4AYBG 5JJIA 4DR6L 1Y1VG 4GLXA 1SN8A 2ZTCA 3I4MG 1WJJA 4JBJA 1GKHA 2QEXA 4IO9A 1L1OB 4GOPB 3U4ZA 2D62A 4YWKA 4DAYB 5C3EH 1I5FA 4HIMA 4MNOA 1SR3A 1Q1EA 4LF7L 4AQYL 1UE6A 3NBHB 1VQAA 2BA1A 4YY3Q 4A3MG 5JJLA 4QIWE 3HOVG 1VQPA 2D0PA 5LMNW 4DV5Q 5IYDG 2MFIA 1SRUA 2MQHA 1E24A 3HFZB 3TREA 1L0WA 3PUWA 5GAGC 3ZJYC 1K8GA 4DUYQ 3RLOA 2KCMA 2DUDA 3H3VH 1VQCA 4P75A 1KHIA 4X65Q 1B7YB 1P16A 4R4IA 1VQOA 3GTMH 1X55A 4LF9Q 2E2HH 4P71A 3CW2C 3MEFA 3CMEA 2HT1A 3PF5A 4L5RC 3GTGH 2RHQB 3RLNA 2HQLA 2GVBA 2K50A 4AH6A 4LUZA 4EQ5A 1VQMA 5IE8A 4HJ5A 1B70B 4LF7Q 1IBLQ 4LF5L 3CCSA 4X64Q 1IBMQ 2UXBQ 1K0RA 1EIYB 3RN2A 2HHHQ 4BBRG 3TEHB 1Z9FA 1M90C 4DR3L 1BBUA 4LFAL 1XNQQ 4TQUS 2VW9A 2VQEL 1YJNA 1N34L 2ATWA 4A3GG 1SFOH 1Q12A 5M3FH 3RR5A 1R9TH 1HH2P 3U58A 4PMWA 4IPGA 1VQ4A 3CQZH 2F52A 4JV5L 3PUYA 2K14A 4JI8Q 1X56A 4BBSH 4JOIA 1QZHA 4TVAB 1QZGA 3GTQH 5IWAQ 1HNWL 1AE3A 2AWNA 4GOPA 1Y1WH 5H1SE 2YTVA 1EIFA 2EQSA 2UXBL 1TWAH 4DR2L 1IL2A 4DV2L 1V43A 1YZ6A 2WB1G 4NPSA 4HIDA 2CQOA 2VUMG 1PV4A 4WJ4A 4YHHQ 4JI2L 1WCMG 1S40A 4JI7L 1NMGA 4MTNA 3PV0A 1UWVA 4POFA 2UUCQ 2E2IH 4B3RQ 1Y14B 5GROA 1VQDA 3STBC 1XMOQ 3HOYH 4K0KL 3OYYA 4DR7L 2R92H 2VQFL 1LYLA 4AQYQ 4P72A 1IYJB 3KLWA 5C0XI 3L2PA 2IX1A 2VQFQ 1UEBA 4A3FH 2OWOA 1EQRA 2JK8A 3UE1A 1Z47A 5IYBH 4LF4L 1WFQA 3LGJA 1NE3A 4R4CA 4NXNQ 3GTPH 3CCJA 1VQFA 1CKOA 4B3TQ 3UE0A 2JEBI 4YHHL 1HJPA 2WAQE 3EN2A 3PUZA 3G6EA 3AQQA 1KC8C 4DV1L 1M1KC 5JEAJ 4BXXG 2HIVA 3CCMA 1PHJA 2UXDQ 1SE8A 3A74A 4EX5A 1N32L 4FDBA 4K0KQ 4C2MH 2EXDA 1QVCA 1CKNA 2DGYA 3BU2A 4GLAC 4OXPA 3PSIA 4L5QA 1ASYA 4BY7H 5DLQE 5K36G 4A93G 3W1BA 2OCEA 3J81j 2R7DA 5FLMH 4JI2Q 2B29A 1UE7A 1A8VA 2A19A 3UDFA 1JMCA 1OXSC 3U50C 3FP9A 2KBNA 3UDXA 3HOWH 2K4KA 4A3KH 3RZOH 3J80i 1G51A 4DR1L 1CUKA 1Q8KA 2KHJA 3HOXG 3KDFB 2I5MX 1JJ2A 4B3ML 3PUXA 3I55A 4JI3Q 1VS0A 1N36L 5EAYA 1I6HH 3CC7A 5HY6A 4BY1G 2Y0SE 1FJGQ 2EIFA 4YY3L 1X65A 4YCWA 2IHEA 4DUZL 1PFSA 2AWOA 1J5EQ 3HOWG 2K5HA 3K0XA 4GN3B 1N34Q 1OXXK 2CWAA 1QUQB 1HZCA 2ZJRA 4BBRH 4DKAC 5C4XG 1HZAA 1VCIA 2IHFA 1B8AA 3KF8B 4DV0Q 1PH2A 1AH9A 1YJWA 1VQGA 2ALYB 1VQ7A 4P73A 1RL2A 2R93H 2HIXA 3ER0A 4B3TL 4KLKA 1E1TA 1IXRA 5IP9G 3VDYA 1N36Q 4LFBQ 5M5XH 3D31A 2JA8G 3FKIH 4JYAL 1V9PA 3A5ZB 5C4XH 3S1QH 4RG1A 1K9MC 2JA9A 1C9OA 3H3VI 2VL6A 4R4QA 1J6QA 1I3QH 3AFQA 4IFDG 3FHWA 1D7QA 2UUAL 4H02A 3HOUH 3I4OA 2VQEQ 2LXJA 1Y1VH 5IWAL 5FJ8G 1QVGA 1VQKA 3TQYA 3S1RH 1YHQA 3KFUA 4GS3A 3GTJH 4DR1Q 2OQ0A 2MNAA 4A75A 3S24A 2B3GA 3KF6A 2K5VA 2PQAB 3HOXH 4Y7NH 3CP0A 1PH6A 1I94L 2UU9L 5GADC 2NVQH 4QGUA 1QUQA 3PO3H 2NZOA 1T9HA 1HNWQ 2VZAA 1YEZA 4BY1H 1OXTA 2F4VQ 4DR7Q 3OTOQ 4PG3A 3M4QA 4DV4Q 1Q82C 2VY3A 1TWFH 3ULPA 1XJVA 3HKZG 2AMCB 3JAMc 3U4VA 3L0OA 5LMNL 2Z6KA 3K7UC 4UY8C 3MXNB 3A5UA 2OTLA 1YBYA 3RN5A 1HNXL 4OONA 1KXLA 2JJQA 3A0JA 1BBWA 4BA2I 2R6GA 3KYHC 3K81C 1A63A 2R93G 3W5OA 3EBEA 1PH9A 3CC2A 1YIJA 1KQSA 3BZKA 3I2ZA 2OTJA 3J80c 2VS1A 3J7ZC 2GN5A 1WI5A 3NENA 3RNUA 1X54A 4KI0A 4JI6Q 1VQ6A 3FKIG 4NB3A 4OWWB 4DV4L 3F1ZA 4B3RL 1U5KA 4IPHA 3H0GG 2B63H 3TRZA 3D0FA 1IBKQ 3B6YA 5HGQA 3DLLA 4JI6L 1BVSA 2NVTH 1SROA 3K7AH 1SLJA 5M3FG 1TWGH 1XTDA 1N33L 4QL5A 1S3OA 1JJGA 1V1QA 2QA4A 1E3PA 4OO1I 1Q86C 3F2CA 4GNXB 1UE1A 4LNQA 4BBSG 3CCVA 4DV5L 1TWHH 3T1YQ 1SMXA 1JB7A 4QJFA 4LFCL 3H0GH 2B63G 1WYDA 2I5LX 2Q2IA 2UUAQ 4HIOA 2YTYA 1HNZQ 4LUOA 5FLMG 3TS0A 2JA7H 2BH8A 3G48A 5IYCH 5IT9c 2IX0A 4Y52H 2ZTDA 3CC4A 1NJIC 1VQ8A 2Z0SA 4JI5Q 4NXMQ 3S1MH 1WOCA 1DGSA 3CCUA 4JI0Q 4R1JA 1BKBA 3KOJA 3GDEA 3CCRA 4HJ9A 2I0QA 2ASBA 3KDFA 1GO3E 4JI1Q 4GN5A 5BR8L 3KJPA 3RZDH 4GNXC 1JT8A 2R7FA 4XTCS 3E9HA 4AIMA 2PNHA 2KENA 5M3MH 2JA6G 1YVCA 2YTXA 1I50H 1LM0A 1C7YA 1EOVA 3BJUA 5ELNA 2E5LL 4OWXB 3STBD 4OX9Q 3KF6B 1Q46A 2FXQA 4AYBE 1AE2A 4A3IH 3CPFA 4BXXH 5JEAG 1NTGA 4JBKA 3PF4A 1A0IA 4A3LH 4X62Q 1CKNB 1NBWA 1X3GA 1YJ9A 4DR4Q 4DV3Q 4JYAQ 3OW2A 4KHZA 4UP7A 1E22A 1WCMH 3E9IA 3CMAA 4LF8Q 1P8LA 3ERSX 1XPRA 1KL9A 1K3RA 2VUMH 4PZ6A 2ZTEA 1VQBA 3CAMA 4LWCA 1FGUA 3M4PA 5BR8Q 5IP9H 5ELOA 4DUZQ 3S16H 4A3IG 1YNXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H Q;  1PA6 A;  4X64 L;  1IBM L;  4A3L G;  5C3E G;  1FVI A;  3ULJ A;  3I7F A;  4JG2 A;  4QY7 A;  2NVX H;  4P74 A;  2CWP A;  2R92 G;  1K8A C;  3NEL A;  3KJO A;  1VQ9 A;  4UP9 A;  3G4S A;  3HOU G;  1N9W A;  2KCT A;  4B3S L;  3M9B A;  4KHP Q;  4R4O A;  1CSQ A;  5FJ8 H;  1OTC A;  3TS2 A;  3NEM A;  4WJ3 M;  4DV3 L;  4A3M H;  2OQK A;  4O2D A;  5LMU L;  2RCN A;  4A3F G;  4POG A;  2UXD L;  3HOZ H;  3ULL A;  1GM5 A;  5M5W H;  2Q2T A;  1GVP A;  1O7I A;  2N3S A;  4LFA Q;  3RLF A;  3F2B A;  4DR3 Q;  1X9N A;  4C3H H;  3PIP A;  3I56 A;  5LMN Q;  4OWT B;  1ASZ A;  4DV1 Q;  4OO1 G;  4IPC A;  4RMF A;  2UXC L;  4J15 A;  4DV2 Q;  4GLV B;  1X3F A;  2BH2 A;  4BY7 G;  1XPU A;  2WAQ G;  1YHB A;  2JQO A;  1XMO L;  3AYH B;  3CPW A;  2BA0 A;  3DM3 A;  4O0A A;  3GTL H;  1S72 A;  4HJ7 A;  5J3B A;  1XNR Q;  4DR5 L;  4IOC A;  2CCZ A;  1YIT A;  1XMQ L;  5C44 H;  1N33 Q;  4A3B G;  3CCE A;  2CKZ B;  1HZB A;  1J5E L;  4C3J H;  2JE6 I;  4PZ8 A;  4UP8 A;  1EFW A;  4A3G H;  4DV7 Q;  2K5N A;  1OXV A;  4A3E H;  1XMQ Q;  5M5Y H;  1NMF A;  5GAH C;  2PQA A;  1EYG A;  3GTK H;  4LFB L;  1G6P A;  4LFC Q;  3S1N H;  2WB1 E;  4MZ9 A;  2NN6 I;  4DAM A;  1GD7 A;  4C3I H;  4IJH A;  1L2F A;  4R4T A;  4DR4 L;  5GQO A;  2V1C C;  4X6A H;  4JBW A;  4X66 L;  2RHS B;  3PUV A;  1N32 Q;  1A62 A;  1PYB A;  5C44 G;  4HJ8 A;  4A76 A;  3AEV A;  4JC0 A;  3PO3 G;  3M7N A;  2ZM6 Q;  2A8V A;  4OX9 L;  2R7Z H;  1Q1B A;  4X66 Q;  3CF5 A;  2Y0S G;  5AJ3 Q;  4YCU A;  5M3M G;  1PVO A;  4IPD A;  1IBK L;  1XNQ L;  1MJC A;  4IFD J;  4ALP A;  4GOP C;  4A3B H;  1K83 H;  1MKH A;  3HOZ G;  1PYS B;  2MO0 A;  1XPO A;  3PIO A;  1L1O A;  3IRB A;  4YWL A;  1JE5 A;  4DK3 C;  1IBL L;  4LF5 Q;  4A3C G;  3HOY G;  4GKJ Q;  4NXM L;  4IJL A;  3AFP A;  5C4J H;  2F4V L;  1JJC B;  2L15 A;  4JI8 L;  4NXN L;  4A3J G;  1KAW A;  4GKJ L;  5FLX c;  2A1A A;  1VQJ A;  5IYC G;  1E1O A;  3PO2 H;  1Q81 C;  3HOV H;  2IT1 A;  1NY4 A;  1FL0 A;  1EQQ A;  3W1G A;  1RIP A;  4X65 L;  2JA5 H;  2D0O A;  4KHP L;  2PMZ E;  3I4N H;  4IFD I;  2PI2 A;  2WFW A;  3E0E A;  3T1Y L;  4LF8 L;  3GTO H;  2N49 A;  2I5H A;  1W3S A;  4APV A;  4DV0 L;  3S14 H;  1KIX A;  4JI3 L;  4LW1 A;  4A3E G;  1YI2 A;  2IY5 B;  1MJE A;  1HR0 L;  2E8G A;  3CCL A;  4GNX A;  3J81 c;  3M3Y H;  3G71 A;  2Z6K C;  1QVF A;  3UDI A;  3I4N G;  1TWC H;  4A93 H;  4YCV A;  3CCQ A;  1HZ9 A;  2XGT A;  2E5L Q;  1KRS A;  4B3S Q;  3OTO L;  2RF4 A;  1K73 C;  2Q2U A;  4DV7 L;  5AJ3 L;  5C0X J;  2JEA I;  2F3I A;  3JAM i;  3GO5 A;  1UE5 A;  1EUJ A;  4A3D G;  4A4I A;  1U0L A;  3K80 C;  3ICE A;  1XNR L;  5JJK A;  4LF6 L;  2GVA A;  2ES2 A;  5IYD H;  5IYB G;  2CFM A;  3CXC A;  3HKZ E;  4HJA A;  1PH3 A;  4B3M Q;  4JI7 Q;  2KHI A;  2ID0 A;  1C0A A;  4LF4 Q;  4LF6 Q;  1Q7Y C;  4JI4 Q;  4DV6 Q;  3PCO B;  2K52 A;  2UUB L;  2ZM6 L;  1D8L A;  2QGQ A;  4BA1 I;  4A3C H;  4DNI A;  5IP7 G;  1N8R C;  2UU9 Q;  3S17 H;  1VQ5 A;  2NN6 G;  2ZJP A;  1LTL A;  1Y1W G;  3J7A 5;  3BZC A;  4GKK Q;  4A3J H;  2YU9 H;  1HR0 Q;  1CKM A;  1W2B A;  1VQN A;  3M4O H;  3PO2 G;  1HR0 W;  2VNU D;  1PH7 A;  2MO1 A;  1X6O A;  2N8N A;  2YV5 A;  2JA8 H;  2Q2H A;  4L5T A;  3SGI A;  2AKW B;  3T1H L;  5LMU Q;  3Q8D A;  1PH4 A;  4A3K G;  4JCV E;  1KD1 C;  3H15 A;  5IP7 H;  3WWV A;  1VQH A;  4HIK A;  4DR2 Q;  1VQI A;  5E7N A;  4YWM A;  4DPG A;  1X3E A;  4DR5 Q;  2NVY H;  2C35 B;  1G29 1;  1LUZ A;  1TXY A;  2WP8 J;  4DK6 C;  4JI0 L;  1L1O C;  2UUC L;  4GN4 B;  1PH1 A;  4QQB X;  1IZ6 A;  2XTI A;  5GAE C;  4PZ7 A;  4DR6 Q;  3S15 H;  1H95 A;  4JI1 L;  2JA7 G;  3GD7 A;  1YHA A;  3J81 i;  4JOI C;  5C0X G;  3UDG A;  1HNZ L;  1PH8 A;  4DUY L;  3S2D H;  4JI4 L;  5IY0 A;  2ZJQ A;  2K75 A;  1OXU A;  1HNX Q;  4JBM A;  3CD6 A;  1KRT A;  1PH5 A;  4ME3 A;  1E7Z A;  2H5X A;  4UPA A;  2JA6 H;  4A3D H;  4GKK L;  4JV5 Q;  4X62 L;  1VQL A;  1CSP A;  3S2H H;  1I94 Q;  3L7Z C;  4XIG S;  3M85 A;  2E2J H;  3F8T A;  2JA5 G;  2YYZ A;  4DV6 L;  2LSS A;  1VQE A;  2UUB Q;  3I4M H;  2NZH A;  2N78 A;  4JI5 L;  3EIV A;  3JC6 6;  2R7Z G;  3HKS A;  2PI2 E;  2UXC Q;  4LF9 L;  2HHH L;  2AHO B;  3PGZ A;  3F2D A;  4IOA A;  1FJG L;  4L5S A;  2LXK A;  1EWI A;  4LUV A;  1MIU A;  3K8A A;  4AYB G;  5JJI A;  4DR6 L;  1Y1V G;  4GLX A;  1SN8 A;  2ZTC A;  3I4M G;  1WJJ A;  4JBJ A;  1GKH A;  2QEX A;  4IO9 A;  1L1O B;  4GOP B;  3U4Z A;  2D62 A;  4YWK A;  4DAY B;  5C3E H;  1I5F A;  4HIM A;  4MNO A;  1SR3 A;  1Q1E A;  4LF7 L;  4AQY L;  1UE6 A;  3NBH B;  1VQA A;  2BA1 A;  4YY3 Q;  4A3M G;  5JJL A;  4QIW E;  3HOV G;  1VQP A;  2D0P A;  5LMN W;  4DV5 Q;  5IYD G;  2MFI A;  1SRU A;  2MQH A;  1E24 A;  3HFZ B;  3TRE A;  1L0W A;  3PUW A;  5GAG C;  3ZJY C;  1K8G A;  4DUY Q;  3RLO A;  2KCM A;  2DUD A;  3H3V H;  1VQC A;  4P75 A;  1KHI A;  4X65 Q;  1B7Y B;  1P16 A;  4R4I A;  1VQO A;  3GTM H;  1X55 A;  4LF9 Q;  2E2H H;  4P71 A;  3CW2 C;  3MEF A;  3CME A;  2HT1 A;  3PF5 A;  4L5R C;  3GTG H;  2RHQ B;  3RLN A;  2HQL A;  2GVB A;  2K50 A;  4AH6 A;  4LUZ A;  4EQ5 A;  1VQM A;  5IE8 A;  4HJ5 A;  1B70 B;  4LF7 Q;  1IBL Q;  4LF5 L;  3CCS A;  4X64 Q;  1IBM Q;  2UXB Q;  1K0R A;  1EIY B;  3RN2 A;  2HHH Q;  4BBR G;  3TEH B;  1Z9F A;  1M90 C;  4DR3 L;  1BBU A;  4LFA L;  1XNQ Q;  4TQU S;  2VW9 A;  2VQE L;  1YJN A;  1N34 L;  2ATW A;  4A3G G;  1SFO H;  1Q12 A;  5M3F H;  3RR5 A;  1R9T H;  1HH2 P;  3U58 A;  4PMW A;  4IPG A;  1VQ4 A;  3CQZ H;  2F52 A;  4JV5 L;  3PUY A;  2K14 A;  4JI8 Q;  1X56 A;  4BBS H;  4JOI A;  1QZH A;  4TVA B;  1QZG A;  3GTQ H;  5IWA Q;  1HNW L;  1AE3 A;  2AWN A;  4GOP A;  1Y1W H;  5H1S E;  2YTV A;  1EIF A;  2EQS A;  2UXB L;  1TWA H;  4DR2 L;  1IL2 A;  4DV2 L;  1V43 A;  1YZ6 A;  2WB1 G;  4NPS A;  4HID A;  2CQO A;  2VUM G;  1PV4 A;  4WJ4 A;  4YHH Q;  4JI2 L;  1WCM G;  1S40 A;  4JI7 L;  1NMG A;  4MTN A;  3PV0 A;  1UWV A;  4POF A;  2UUC Q;  2E2I H;  4B3R Q;  1Y14 B;  5GRO A;  1VQD A;  3STB C;  1XMO Q;  3HOY H;  4K0K L;  3OYY A;  4DR7 L;  2R92 H;  2VQF L;  1LYL A;  4AQY Q;  4P72 A;  1IYJ B;  3KLW A;  5C0X I;  3L2P A;  2IX1 A;  2VQF Q;  1UEB A;  4A3F H;  2OWO A;  1EQR A;  2JK8 A;  3UE1 A;  1Z47 A;  5IYB H;  4LF4 L;  1WFQ A;  3LGJ A;  1NE3 A;  4R4C A;  4NXN Q;  3GTP H;  3CCJ A;  1VQF A;  1CKO A;  4B3T Q;  3UE0 A;  2JEB I;  4YHH L;  1HJP A;  2WAQ E;  3EN2 A;  3PUZ A;  3G6E A;  3AQQ A;  1KC8 C;  4DV1 L;  1M1K C;  5JEA J;  4BXX G;  2HIV A;  3CCM A;  1PHJ A;  2UXD Q;  1SE8 A;  3A74 A;  4EX5 A;  1N32 L;  4FDB A;  4K0K Q;  4C2M H;  2EXD A;  1QVC A;  1CKN A;  2DGY A;  3BU2 A;  4GLA C;  4OXP A;  3PSI A;  4L5Q A;  1ASY A;  4BY7 H;  5DLQ E;  5K36 G;  4A93 G;  3W1B A;  2OCE A;  3J81 j;  2R7D A;  5FLM H;  4JI2 Q;  2B29 A;  1UE7 A;  1A8V A;  2A19 A;  3UDF A;  1JMC A;  1OXS C;  3U50 C;  3FP9 A;  2KBN A;  3UDX A;  3HOW H;  2K4K A;  4A3K H;  3RZO H;  3J80 i;  1G51 A;  4DR1 L;  1CUK A;  1Q8K A;  2KHJ A;  3HOX G;  3KDF B;  2I5M X;  1JJ2 A;  4B3M L;  3PUX A;  3I55 A;  4JI3 Q;  1VS0 A;  1N36 L;  5EAY A;  1I6H H;  3CC7 A;  5HY6 A;  4BY1 G;  2Y0S E;  1FJG Q;  2EIF A;  4YY3 L;  1X65 A;  4YCW A;  2IHE A;  4DUZ L;  1PFS A;  2AWO A;  1J5E Q;  3HOW G;  2K5H A;  3K0X A;  4GN3 B;  1N34 Q;  1OXX K;  2CWA A;  1QUQ B;  1HZC A;  2ZJR A;  4BBR H;  4DKA C;  5C4X G;  1HZA A;  1VCI A;  2IHF A;  1B8A A;  3KF8 B;  4DV0 Q;  1PH2 A;  1AH9 A;  1YJW A;  1VQG A;  2ALY B;  1VQ7 A;  4P73 A;  1RL2 A;  2R93 H;  2HIX A;  3ER0 A;  4B3T L;  4KLK A;  1E1T A;  1IXR A;  5IP9 G;  3VDY A;  1N36 Q;  4LFB Q;  5M5X H;  3D31 A;  2JA8 G;  3FKI H;  4JYA L;  1V9P A;  3A5Z B;  5C4X H;  3S1Q H;  4RG1 A;  1K9M C;  2JA9 A;  1C9O A;  3H3V I;  2VL6 A;  4R4Q A;  1J6Q A;  1I3Q H;  3AFQ A;  4IFD G;  3FHW A;  1D7Q A;  2UUA L;  4H02 A;  3HOU H;  3I4O A;  2VQE Q;  2LXJ A;  1Y1V H;  5IWA L;  5FJ8 G;  1QVG A;  1VQK A;  3TQY A;  3S1R H;  1YHQ A;  3KFU A;  4GS3 A;  3GTJ H;  4DR1 Q;  2OQ0 A;  2MNA A;  4A75 A;  3S24 A;  2B3G A;  3KF6 A;  2K5V A;  2PQA B;  3HOX H;  4Y7N H;  3CP0 A;  1PH6 A;  1I94 L;  2UU9 L;  5GAD C;  2NVQ H;  4QGU A;  1QUQ A;  3PO3 H;  2NZO A;  1T9H A;  1HNW Q;  2VZA A;  1YEZ A;  4BY1 H;  1OXT A;  2F4V Q;  4DR7 Q;  3OTO Q;  4PG3 A;  3M4Q A;  4DV4 Q;  1Q82 C;  2VY3 A;  1TWF H;  3ULP A;  1XJV A;  3HKZ G;  2AMC B;  3JAM c;  3U4V A;  3L0O A;  5LMN L;  2Z6K A;  3K7U C;  4UY8 C;  3MXN B;  3A5U A;  2OTL A;  1YBY A;  3RN5 A;  1HNX L;  4OON A;  1KXL A;  2JJQ A;  3A0J A;  1BBW A;  4BA2 I;  2R6G A;  3KYH C;  3K81 C;  1A63 A;  2R93 G;  3W5O A;  3EBE A;  1PH9 A;  3CC2 A;  1YIJ A;  1KQS A;  3BZK A;  3I2Z A;  2OTJ A;  3J80 c;  2VS1 A;  3J7Z C;  2GN5 A;  1WI5 A;  3NEN A;  3RNU A;  1X54 A;  4KI0 A;  4JI6 Q;  1VQ6 A;  3FKI G;  4NB3 A;  4OWW B;  4DV4 L;  3F1Z A;  4B3R L;  1U5K A;  4IPH A;  3H0G G;  2B63 H;  3TRZ A;  3D0F A;  1IBK Q;  3B6Y A;  5HGQ A;  3DLL A;  4JI6 L;  1BVS A;  2NVT H;  1SRO A;  3K7A H;  1SLJ A;  5M3F G;  1TWG H;  1XTD A;  1N33 L;  4QL5 A;  1S3O A;  1JJG A;  1V1Q A;  2QA4 A;  1E3P A;  4OO1 I;  1Q86 C;  3F2C A;  4GNX B;  1UE1 A;  4LNQ A;  4BBS G;  3CCV A;  4DV5 L;  1TWH H;  3T1Y Q;  1SMX A;  1JB7 A;  4QJF A;  4LFC L;  3H0G H;  2B63 G;  1WYD A;  2I5L X;  2Q2I A;  2UUA Q;  4HIO A;  2YTY A;  1HNZ Q;  4LUO A;  5FLM G;  3TS0 A;  2JA7 H;  2BH8 A;  3G48 A;  5IYC H;  5IT9 c;  2IX0 A;  4Y52 H;  2ZTD A;  3CC4 A;  1NJI C;  1VQ8 A;  2Z0S A;  4JI5 Q;  4NXM Q;  3S1M H;  1WOC A;  1DGS A;  3CCU A;  4JI0 Q;  4R1J A;  1BKB A;  3KOJ A;  3GDE A;  3CCR A;  4HJ9 A;  2I0Q A;  2ASB A;  3KDF A;  1GO3 E;  4JI1 Q;  4GN5 A;  5BR8 L;  3KJP A;  3RZD H;  4GNX C;  1JT8 A;  2R7F A;  4XTC S;  3E9H A;  4AIM A;  2PNH A;  2KEN A;  5M3M H;  2JA6 G;  1YVC A;  2YTX A;  1I50 H;  1LM0 A;  1C7Y A;  1EOV A;  3BJU A;  5ELN A;  2E5L L;  4OWX B;  3STB D;  4OX9 Q;  3KF6 B;  1Q46 A;  2FXQ A;  4AYB E;  1AE2 A;  4A3I H;  3CPF A;  4BXX H;  5JEA G;  1NTG A;  4JBK A;  3PF4 A;  1A0I A;  4A3L H;  4X62 Q;  1CKN B;  1NBW A;  1X3G A;  1YJ9 A;  4DR4 Q;  4DV3 Q;  4JYA Q;  3OW2 A;  4KHZ A;  4UP7 A;  1E22 A;  1WCM H;  3E9I A;  3CMA A;  4LF8 Q;  1P8L A;  3ERS X;  1XPR A;  1KL9 A;  1K3R A;  2VUM H;  4PZ6 A;  2ZTE A;  1VQB A;  3CAM A;  4LWC A;  1FGU A;  3M4P A;  5BR8 Q;  5IP9 H;  5ELO A;  4DUZ Q;  3S16 H;  4A3I G;  1YNX A; 
#chains in the Genus database with same CATH topology
 4FF2 A;  4X64 L;  3ULJ A;  4JG2 A;  2CWP A;  3S1M B;  1AW7 A;  2KCT A;  4B3S L;  3M9B A;  4KHP Q;  4R4O A;  1LO5 D;  3GV6 A;  1OTC A;  1SNP A;  4O2D A;  1S5F D;  1K0S A;  1YNN D;  3OPO A;  1IYV A;  2L9H A;  3ULL A;  2KED A;  3QB3 A;  1PXU A;  2N3S A;  4JVZ A;  3RLF A;  4DR3 Q;  1X9N A;  3DMU A;  4J8Q A;  1RCV D;  4ULL A;  4C3H H;  3PIP A;  5LMN Q;  3VA5 A;  2B2T C;  4RMF A;  3VYT A;  2Z4I A;  1X3F A;  2BH2 A;  4BY7 G;  1QOH A;  4UHV A;  1XMO L;  4QIW B;  2B2W C;  1Y1W B;  2JP1 A;  1Z7T A;  2CCZ A;  2R3Z A;  3S2D B;  1J5E L;  1HZB A;  5KNB A;  1E2W A;  4PZ8 A;  1MSH A;  1EFW A;  4DV7 Q;  1EY0 A;  4OO1 H;  1UAP A;  3L3O C;  1EYG A;  5GAH C;  2PQA A;  5ELC A;  3GTK H;  3S1N H;  1SYE A;  4MZ9 A;  4DAM A;  2B2T A;  4IJH A;  1L2F A;  5GQO A;  4JBW A;  1S5D D;  3PUV A;  2NVQ B;  4A76 A;  1Y8P B;  2ZM6 Q;  2R7Z H;  5IGE A;  3QG1 A;  1Q1B A;  4X66 Q;  4G57 A;  2HCI A;  4YCU A;  2JA8 B;  1PVO A;  1STE A;  5JPN C;  4LK1 C;  4ALP A;  1QG7 A;  1PYS B;  4BS9 A;  1L1O A;  3IRB A;  3NXW A;  1JE5 A;  1RKN A;  4LF5 Q;  3HOY G;  5C4J H;  3A54 A;  2L15 A;  1M8A A;  3IFD A;  2NN6 H;  5IGG A;  5FLX c;  2A1A A;  3HOV H;  1RIP A;  4XXE A;  5E4W C;  3TP6 A;  3NWT A;  4KHP L;  4G7Z C;  4IFD I;  1EEF D;  2QIL A;  2PI2 A;  2N49 A;  4DV0 L;  4EVO A;  1KIX A;  3NQT A;  5CGK A;  1MJE A;  4RGN A;  1AZP A;  4N8X 1;  3CCL A;  4DAP A;  3K5O A;  2BCO A;  3M3Y H;  1TWC H;  1HZ9 A;  4IUT A;  2RF4 A;  3NE5 B;  2EZV A;  4EQN A;  4DV7 L;  1BCP D;  2JEA I;  1EUJ A;  1B53 A;  5IYD H;  4HN7 A;  4HJA A;  4KJO A;  2A69 D;  4IN3 A;  2KHI A;  2ID0 A;  4CKC A;  4LF4 Q;  4WRD A;  2K52 A;  2ZM6 L;  3K58 A;  4A3C H;  5IP7 G;  4XT3 B;  2UU9 Q;  1R4P B;  1F2L A;  3K59 A;  2ZJP A;  1D5M C;  3JAM E;  3BZC A;  1W2B A;  4FF1 A;  3M4O H;  2VNU D;  1PH7 A;  4NW2 A;  2MO1 A;  4XYQ A;  2YV5 A;  4RKB A;  1BR9 A;  3T1H L;  1PTO B;  1BBX C;  3H0G B;  1VQH A;  1X3E A;  4C3I B;  2E2I B;  1LUZ A;  1VDZ A;  4RCO A;  3M4O B;  4PZ7 A;  3RD4 A;  3DXJ C;  3J81 i;  5C0X G;  1HNZ L;  3HP3 A;  1QNU A;  1PH8 A;  3S2D H;  1TY0 A;  2K01 A;  4JI4 L;  2G9H D;  4PQX A;  3GTJ B;  2K75 A;  1HNX Q;  3HOZ B;  2MHV A;  3NQI A;  4RHS A;  3I72 A;  3L7Z C;  2JA5 G;  1ZYR C;  4DV6 L;  1C48 A;  2K5D A;  3I91 A;  4C1N I;  2PPB C;  1NCV A;  1STB A;  2ZXP A;  5J1Z A;  4IUR A;  2VUM B;  3R93 A;  5JJI A;  4TRD A;  1Y1V G;  4GLX A;  3A7A B;  4JBJ A;  2QEX A;  1L1O B;  1EEI D;  4K5X A;  1BNZ A;  5C3E H;  4MNO A;  3SK8 A;  2H1E A;  2XRS D;  5LMN W;  3C1E A;  5C4Z A;  1IW7 C;  2E2H B;  2L55 A;  3H3V H;  1VQC A;  4P75 A;  1KHI A;  4CBV A;  2SNS A;  1B7Y B;  3CHB D;  4L63 B;  5KND A;  3M7G A;  5M5X B;  3MEF A;  2RHQ B;  2HQL A;  1QE6 A;  2NUC A;  4MTK A;  1D1I A;  4XYO A;  1IBL Q;  4X64 Q;  2UXB Q;  2VB2 X;  3RN2 A;  2HHH Q;  4BBR G;  2AQ2 B;  1Z9F A;  4DR3 L;  2HCC A;  4RA8 A;  5LL6 S;  1Q12 A;  5C5L A;  5A2Q E;  1EY9 A;  1TQO A;  3RR5 A;  3NK9 A;  1R9T H;  1ENF A;  1FNV A;  1O7Z A;  1DOK A;  3V2T A;  4ME5 A;  2JSO A;  2F52 A;  3PUY A;  2K14 A;  4BBS H;  4DK0 A;  3NTK A;  4C3I G;  3GTQ H;  2CW0 C;  1HNW L;  4GOP A;  1Y1W H;  2DY8 A;  2YTV A;  3Q22 A;  1EIF A;  4NPS A;  2VUM G;  4WJ4 A;  4YHH Q;  1WCM G;  3L9A X;  2OF1 A;  1NMG A;  2UUC Q;  3D4R A;  2E2I H;  4KY5 A;  1WTR A;  1Y14 B;  5GRO A;  3HOY H;  3FRP B;  2R92 H;  3UI2 A;  3E6Z X;  2VQF L;  4U67 3;  4ZUJ A;  1Q3L A;  3KLW A;  2NZ1 D;  4A3F H;  2OWO A;  3S15 B;  2JK8 A;  3S1N B;  2K1B A;  2YU9 B;  3GTP H;  1VQF A;  4B3T Q;  3G6E A;  3EN2 A;  1GJX A;  5FO7 B;  2UXD Q;  1SE8 A;  4EX5 A;  1SJH D;  4S3S A;  4LJZ C;  1Y1V B;  4L5Q A;  1ASY A;  1NNX A;  3IFT A;  3W1B A;  2B29 A;  5DEH A;  1GHJ A;  3FEW X;  1OXS C;  5CBE E;  2K4K A;  1DXM A;  1G51 A;  3KDF B;  1NUC A;  4B3M L;  2F0G A;  3QOJ A;  1O80 A;  1N36 L;  5EAY A;  5M3M B;  3CC7 A;  4BY1 G;  3H09 A;  1X65 A;  1WTO A;  2IHE A;  3FMC A;  5C0X H;  2EYM A;  1PFM A;  3K0X A;  4GN3 B;  1SYC A;  1OXX K;  1QUQ B;  3M4Y A;  1NSN S;  5I2X A;  4DKA C;  1MHW C;  2SEB D;  1VCI A;  3KF8 B;  4XQJ A;  1YJW A;  3Q0A A;  2B2U C;  4R8N A;  1BCP C;  4P73 A;  1VQ7 A;  3OMC A;  4OEM B;  3TDQ A;  3ER0 A;  2V4D A;  3IAY A;  1E1T A;  1IXR A;  1X3Q A;  3VDY A;  5M5X H;  2JA8 G;  4CKE A;  1PRT C;  2VL6 A;  4R4Q A;  3OWF A;  1DJR D;  3FHW A;  4KKS A;  2UUA L;  1SNO A;  4HCS A;  2VQE Q;  1Y1V H;  2WAC A;  1YHQ A;  4PNY A;  4DFA A;  1SJE D;  2OQ0 A;  4FVM A;  2MUY A;  3HOX H;  1H9S B;  2PQA B;  3KF6 A;  1PH6 A;  5FO9 B;  2UU9 L;  1EOT A;  2NVQ H;  3PO3 H;  4IFD H;  3BZD B;  2VZA A;  1ESF A;  1NR2 A;  4DR7 Q;  2F4I A;  4CDD C;  1HHV A;  1UNS A;  5CV4 A;  1XJV A;  3L0O A;  5LMN L;  2Z6K A;  1QIL A;  2F0D A;  3A5U A;  1YBY A;  3RN5 A;  1HNX L;  2I46 A;  1KXL A;  1GXD C;  1H9K A;  2A6E C;  2R6G A;  4ABN A;  1B9M A;  3KYH C;  1B2T A;  1II3 A;  1JOQ A;  1A3T A;  2KCC A;  1PH9 A;  1G2T A;  1KQS A;  3BZK A;  2OTJ A;  3K6O A;  5CV9 A;  3NEN A;  3VR4 A;  4KI0 A;  2AQ1 B;  1ZYR D;  3FPP A;  1VQ6 A;  4DV4 L;  4B3R L;  3H0G G;  2B63 H;  1IBK Q;  1SE2 A;  1E2Z A;  3K7A H;  1SLJ A;  4XQQ A;  1TWG H;  1HFG A;  1PMR A;  1V1P B;  2F1M A;  1V1Q A;  2XVS A;  3T4A C;  4BBS G;  2NVX B;  1TWH H;  3D4D A;  1U4P A;  4QJF A;  3MEH A;  2UUA Q;  2Q2I A;  3S1Q B;  3QWN A;  2YTY A;  4V0B A;  1TWF B;  2JA7 H;  4KD4 A;  2BH8 A;  3G48 A;  1E2V A;  2B2Y C;  3CC4 A;  1VQ8 A;  2Z0S A;  1WOC A;  1DGS A;  2F0S A;  1BKB A;  4R1J A;  5KNC A;  3MZ5 A;  3KDF A;  1GO3 E;  4JI1 Q;  4GN5 A;  4ZKB B;  3KJP A;  1TU2 B;  2R7F A;  3ONA B;  1I50 H;  1LM0 A;  2YTX A;  4AYB B;  1AZQ A;  3STB D;  3HOU B;  1FNU A;  1NTG A;  2BE5 D;  3PF4 A;  1B9N A;  1CKN B;  1NBW A;  2B2Y A;  4DR4 Q;  2A6H C;  2L0C A;  4UP7 A;  3C2P A;  1WCM H;  1DON A;  3OWE B;  4BY7 B;  1P8L A;  5CR3 A;  5IP9 H;  1FGU A;  5J22 A;  1YNJ D;  5ELO A;  5EJW A;  3J80 E;  3J7Y W;  4CHT B;  1F9R A;  4P74 A;  1ENA A;  3SK4 A;  3KJO A;  1VQ9 A;  4R9W A;  3VYR A;  1N9W A;  4N9T A;  3T56 B;  3TS2 A;  1ILQ A;  2JA7 B;  5LMU L;  2RCN A;  2I07 B;  5CV8 A;  3SXH A;  2VXW A;  5C44 B;  1TS4 A;  3HOZ H;  2WKC A;  1EY8 A;  2Q2T A;  1O7I A;  4LFA Q;  3GTL B;  3OOC A;  5FK9 C;  4CKB A;  1ASZ A;  1TY2 A;  1JC7 A;  4IPC A;  2UXC L;  3AU7 A;  4FO2 A;  4DNT B;  1HA5 A;  3AYH B;  1U4L A;  2BA0 A;  3DM3 A;  3GTL H;  3IL8 A;  4DN4 M;  1XNR Q;  3MFY A;  1N33 Q;  4KJN A;  2CKZ B;  1IKL A;  3NUC A;  4C3J H;  4UP8 A;  2KHS A;  3T53 B;  1XMQ Q;  5M5Y H;  1SFO B;  1EQV A;  1O7Y A;  4LFC Q;  1GD7 A;  2NVY B;  4DR4 L;  2V1C C;  1HQM C;  5C44 G;  4JC0 A;  3PO3 G;  4DF7 A;  2A8V A;  5L37 A;  2Y0S G;  5AJ3 Q;  2EJF C;  5M3M G;  1KAA A;  3EJI A;  2A5H A;  1F9Q A;  4IFD J;  1A15 A;  1K83 H;  1MKH A;  1EL0 A;  1I3Q B;  2SOB A;  1D2B A;  1XPO A;  1HA6 A;  1KNE A;  5C4X B;  4A3C G;  2LY7 A;  2NWG A;  4NXM L;  3FKI B;  4JI8 L;  4JK1 C;  2ICI A;  4GKJ L;  5IYC G;  3PO2 H;  1Q81 C;  1EQQ A;  4HR7 B;  2JA5 H;  5COY A;  1U4R A;  3ND8 A;  3OHX C;  1PZI D;  2D0O A;  3GTO H;  4A3B H;  4LF8 L;  4QCL A;  1A2U A;  2I5H A;  1W3S A;  4LW1 A;  4A3E G;  1D5Z C;  1YI2 A;  2IY5 B;  5K36 H;  2EVB A;  4GNX A;  3EA6 A;  1A2T A;  4K6D A;  3NSW A;  1KDA A;  2AUJ D;  2E5L Q;  2OXP A;  1Q8I A;  2F0V A;  4A3K B;  5HUR A;  2F3I A;  1A3V A;  2WAQ B;  2B2W A;  1XNR L;  5JJK A;  4LF6 L;  1S5E D;  1IKM A;  3BVG A;  2EDG A;  2CFM A;  1PLF A;  4MN3 A;  1Q7Y C;  4POG A;  3PCO B;  1NR4 A;  2Z8L A;  3J7A V;  1FYC A;  5EPK A;  1LTL A;  1Y1W G;  4GKK Q;  4A3J H;  2X6G A;  1CKM A;  5M9O A;  1X6O A;  2KEC A;  2Q2H A;  1KDC A;  4L5T A;  2F0Q A;  2AKW B;  3Q6S A;  4K6L A;  4MHE A;  1PFB A;  3A55 A;  3Q8D A;  4A3K G;  1KD1 C;  5KRU A;  3H6M A;  4DPG A;  5E4X A;  2C35 B;  1G29 1;  4DK6 C;  4JI0 L;  4EQP A;  1L1O C;  2UUC L;  4QQB X;  1IZ6 A;  1RJT A;  2XTI A;  5BN5 A;  1PTO F;  4A3J B;  3S15 H;  3NP8 A;  3R2I A;  4C3H B;  3MHB A;  1Y8N B;  1ILP A;  3MC0 B;  1V1P A;  1BF4 A;  1H9M A;  3S1R B;  2B8G A;  2KUM A;  1KRT A;  5FKA C;  1EWH A;  2H5X A;  4UPA A;  4A3D H;  4JV5 Q;  3J7A F;  4X62 L;  1VQL A;  3TZU A;  1B50 A;  1I94 Q;  2E2J H;  4XIG S;  3MWY W;  2N78 A;  5D14 A;  2EOT A;  3QR8 A;  1ICW A;  3WDN A;  2AHO B;  2IL8 A;  4IOA A;  1F2Y A;  1R9T B;  2C9O A;  2LXK A;  1EWI A;  1I4G A;  1YNJ C;  1MIU A;  1ENC A;  3K8A A;  4AYB G;  4V19 0;  1VF5 C;  2JN4 A;  3I4M G;  1SDF A;  1WJJ A;  3EQL C;  1CM9 A;  4GOP B;  3U4Z A;  4Y7N B;  4DAY B;  2JA5 B;  4HCE A;  3NBH B;  1IYU A;  4DV5 Q;  4IUQ A;  2MQH A;  3HFZ B;  3OSO A;  3TRE A;  1EQT A;  4JPB W;  5JJZ A;  1IL8 A;  1JOK A;  2OT2 A;  4O42 A;  2F0J A;  1U4M A;  1JB3 A;  4X65 Q;  1P16 A;  4R4I A;  1VQO A;  3K57 A;  5EKI A;  5I4D A;  2E2H H;  3PF5 A;  5E3F A;  3RLN A;  2FFK B;  4WFN 3;  1B70 B;  5IOC A;  1H9R A;  3CCS A;  4E6I A;  2IPK D;  2Q8R E;  3TEH B;  4LFA L;  1BBU A;  2CHB D;  4N9P A;  1TT2 A;  3GTP B;  5NUC A;  4TQU S;  2VW9 A;  1PRT D;  2VQE L;  4A3G G;  2F0W A;  2DJG C;  1EY7 A;  1HH2 P;  2WIN B;  4RKL A;  4XT1 B;  4CJ1 B;  4IPG A;  1VQ4 A;  4JV5 L;  1CA5 A;  4NMZ A;  1X56 A;  4JOI A;  4TVA B;  1KLU D;  1JE4 A;  1ET6 A;  1MD2 D;  3I70 A;  2F3V A;  2J7Z A;  3D4W A;  2DJF C;  2UXB L;  1TWA H;  1W6K A;  3N52 A;  2PMZ B;  4HID A;  1EZ6 A;  1K83 B;  3ERO A;  4JI2 L;  1EY4 A;  1S40 A;  1WTX A;  3D3R A;  4MTN A;  4POF A;  1F2Z A;  4JI7 L;  4DR7 L;  1K28 A;  3P20 A;  4BBS B;  1TS3 A;  2ICE C;  4GZY C;  4ZAI A;  1IYJ B;  3HRZ C;  3Q23 A;  2IX1 A;  1UEB A;  1RTO A;  4R4C A;  1VMP A;  2EYF A;  5ELF A;  2CH4 W;  3HGB A;  3UE0 A;  4YHH L;  4C3J B;  3VYS A;  1KC8 C;  2IX3 A;  4DV1 L;  2HIV A;  3CCM A;  1PHJ A;  3A74 A;  4FDB A;  3X3M A;  2EXD A;  4BY7 H;  5DLQ E;  1WCM B;  4RH6 A;  4K2K A;  1UE7 A;  1A8V A;  2A19 A;  5A2Q L;  3FPU B;  1TWA B;  3UDX A;  3FP9 A;  3PO3 B;  3HKZ B;  4A3K H;  2QEJ C;  5CYU A;  4IUP A;  1SE3 A;  1CUK A;  1JJ2 A;  4NKL A;  2R61 A;  1RTN A;  3R3O A;  4UAI A;  1I6H H;  2R93 B;  2Y0S E;  1Q90 A;  1FJG Q;  1LT3 D;  2QCP X;  2PNR C;  4CDC C;  3HOW G;  2K5H A;  4K8I A;  4F8M A;  2L11 A;  2CWA A;  2ZJR A;  1CHQ D;  1SBB B;  2H4O A;  5C4X G;  1B8A A;  1SNC A;  1AH9 A;  3BS1 A;  2F0T A;  1J9O A;  2ALY B;  3SK6 A;  5IGB A;  3LWU A;  4B3T L;  2LS0 1;  1S4Z A;  3NPP A;  1CTM A;  5IP9 G;  1N36 Q;  2O5I C;  4LFB Q;  3D31 A;  1V9P A;  1BO0 A;  2JA9 A;  1C9O A;  2F0K A;  3H3V I;  1J6Q A;  3GV3 A;  3AFQ A;  1AFP A;  4ID6 A;  4H02 A;  2XNA C;  1LTG D;  1HUN A;  3K7A B;  2L4N A;  3ND9 A;  2RSO A;  3GTJ H;  1EU4 A;  3KF8 A;  4A75 A;  2K5V A;  2XWJ B;  4Y7N H;  3CP0 A;  2PZW A;  3JAM L;  2NB0 A;  4QGU A;  1B1Z A;  1DCZ A;  5C4H A;  2NZO A;  3TME A;  3K5L A;  4IUV A;  4ZQ3 A;  1YEZ A;  1EY5 A;  2XWB B;  5EGT A;  2F4V Q;  3OTO Q;  1BDO A;  3QO2 A;  1Q82 C;  4A3E B;  1TWF H;  1CZG A;  4FXG C;  2AMC B;  3BG3 A;  2JJQ A;  2Q8T A;  1BBW A;  3K81 C;  1OO9 B;  4BY1 B;  3CC2 A;  1YIJ A;  3I2Z A;  3J7Z C;  2GN5 A;  1X54 A;  4FF3 A;  2B2V C;  5LL6 X;  3F1Z A;  1ZKO A;  4IPH A;  4FYD A;  4JI6 L;  5HGQ A;  1SRO A;  1LTT D;  2EXZ A;  2EY2 A;  1N33 L;  1JJG A;  3AB9 A;  1LT4 D;  4ZK9 B;  3J80 L;  4R8I A;  4OO1 I;  4GNX B;  4LNQ A;  2ENB A;  1QCB D;  3KBX A;  4DV5 L;  4LFC L;  4RHR A;  2PW7 A;  2RDG A;  5EBC A;  4QUF A;  2FMC A;  2CQA A;  5JAV A;  1RF2 D;  1SXT A;  5IYC H;  4JI5 Q;  1PRT F;  4OHJ A;  1NJI C;  4NXM Q;  3S14 B;  4CDF C;  3KOJ A;  3GDE A;  4DU9 A;  2KOL A;  3CCR A;  4HJ9 A;  5BR8 L;  3RZD H;  1JT8 A;  3HG9 A;  5M3M H;  5ISR A;  2KEN A;  2JA6 G;  1C7Y A;  1EOV A;  3BJU A;  5CV6 A;  2F0P A;  4OX9 Q;  2Z9H A;  1Q46 A;  2FXQ A;  4C56 C;  1LAC A;  1AE2 A;  4AYB E;  2A69 C;  3CPF A;  2EPB A;  1A0I A;  1ET9 A;  1X32 A;  4DV3 Q;  1WD1 A;  4JYA Q;  3OW2 A;  3VA7 A;  1WTV A;  1K3B C;  3E9I A;  3CMA A;  5LHY 1;  4LF8 Q;  3ERS X;  2EYO A;  4DUZ Q;  3M4P A;  3S16 H;  1L0X B;  4A3I G;  1WVL A;  4OWT B;  3T1H Q;  1LTR D;  2F03 A;  2K7V A;  2Z6B A;  1IBM L;  4A3L G;  5C3E G;  1FVI A;  3I7F A;  4HED A;  2NVX H;  1DM0 B;  5CMD A;  1K8A C;  4OL7 A;  2K28 A;  2KA7 A;  3NBH A;  5D3D A;  1SYF A;  2E2J B;  1EZ8 A;  4H0L C;  5FJ8 H;  2UXD L;  2OQK A;  1C8C A;  2RSN A;  1WTH A;  2EY6 A;  3NHH A;  2NTT A;  3H91 A;  1GVP A;  2E75 C;  1L0Y B;  1D6E C;  3I56 A;  3I8Z A;  4EGV A;  1HQR D;  4DV1 Q;  1JQY D;  4OO1 G;  1VF7 A;  2X69 A;  1I4Q A;  4DV2 Q;  4GLV B;  2F3W A;  1XPU A;  1YHB A;  2HD3 A;  2WAQ G;  2ZXR A;  2IJ0 A;  3CPW A;  1S72 A;  4HJ7 A;  1U9R A;  1MSG A;  3CCE A;  3DM1 A;  2JE6 I;  2A73 B;  5CBA E;  1NMF A;  1CI3 M;  3E3X A;  2WB1 E;  2Z1C A;  5M5Y B;  3HS0 C;  3KLR A;  4C3I H;  4R4T A;  3S17 B;  4X66 L;  2KEE A;  3AEV A;  1PTO H;  3NTI A;  3M7N A;  4OX9 L;  4O1N A;  4K8J A;  3TP8 A;  1XNQ L;  1KAB A;  2F0L A;  4GOP C;  2MO0 A;  3C46 A;  3PIO A;  3MXN A;  3IKJ A;  4DK3 C;  1IBL L;  4A3I B;  3AFP A;  4C3H G;  4WJW A;  4NXN L;  4A3J G;  4HTH A;  5IT9 E;  1SNM A;  3NBI A;  1E1O A;  2IT1 A;  2Z4H A;  3W1G A;  3F2U A;  3SVM A;  1LT6 D;  3H3V C;  4CGY B;  4KKT A;  3T1Y L;  4APV A;  3S14 H;  3CRL C;  2BDO A;  1HR0 L;  3NWS A;  2O2L D;  3PO2 B;  3G71 A;  4A93 H;  2K32 A;  4YCV A;  3CCQ A;  2XGT A;  1KRS A;  3OTO L;  1K73 C;  5AJ3 L;  5C0X J;  4DK1 A;  1SSO A;  4RGT A;  3JAM i;  3ZYY X;  1SYD A;  4K5W A;  1UE5 A;  4A3D G;  4A4I A;  1U0L A;  3K80 C;  1JR0 D;  3NTH A;  3ICE A;  2GVA A;  2ES2 A;  1XXG A;  3RUZ A;  2JA6 B;  1I6H B;  1PH3 A;  3PIO 3;  3HKZ E;  1C0A A;  4DAV A;  2UUB L;  2QF7 A;  2QGQ A;  4KN7 C;  4IZ8 A;  1STG A;  1N8R C;  1E0B A;  5FO8 B;  1SAP A;  2NN6 G;  2AUK A;  2YU9 H;  4QB4 A;  1WD0 A;  2JA8 H;  2EY1 A;  3R8B A;  2B2U A;  2D5D A;  1KDB A;  3H15 A;  5IP7 H;  3WWV A;  5E7N A;  1HFN A;  4DR5 Q;  2WP8 J;  3EVQ A;  4DR6 Q;  1H95 A;  2AQ3 B;  2HUG A;  4JI1 L;  1YHA A;  1K8O A;  4JOI C;  2BDN A;  4KMU C;  1JWU D;  3SEB A;  4DUY L;  3OIQ A;  4L6T B;  1LAB A;  1EU3 A;  1ONL A;  4Q0F A;  1HRJ A;  1STH A;  3SHL A;  1E7Z A;  1BXT A;  2LFN A;  4OIJ A;  2JA6 H;  4GKK L;  2A68 C;  4A3M B;  2CH4 A;  1CA6 A;  1CSP A;  2MJ8 A;  2LSS A;  4KHV A;  3A8I E;  4JI5 L;  3EIV A;  2DNE A;  2X6L A;  5IIF A;  2RCF A;  1GUT A;  4LF9 L;  4F7X A;  3BDC A;  4PMB A;  4L5S A;  3M3Y B;  1A3U A;  3D6C A;  4LUV A;  3A8J E;  1EYC A;  4FF4 A;  1SN8 A;  3TSS A;  1C4Q A;  3PIP 3;  3KBG A;  1GKH A;  4IO9 A;  3SK5 A;  1GUS A;  3DWQ A;  1JWS D;  1I5F A;  5DAU A;  1Q1E A;  1GUO A;  4LF7 L;  1UE6 A;  1VQA A;  2BA1 A;  2WV6 D;  4QIW E;  2LKV A;  4CJ2 C;  3K5M A;  1F9P A;  1SRU A;  2TMP A;  1E24 A;  5IT9 L;  3PUW A;  3ZJY C;  3P7J A;  1I4H A;  2DUD A;  1SEB D;  5C3E B;  1IW7 D;  3GTM H;  3HOW B;  3PQI A;  5KYL A;  3CME A;  2EYP A;  2GVB A;  2K50 A;  2QKI C;  4LUZ A;  1FD7 D;  4OIK A;  4AH6 A;  4A93 B;  3LWE A;  4HJ5 A;  3LX0 A;  2K6A A;  1LLR D;  4LF5 L;  4KK7 A;  2M2L A;  1IBM Q;  2HDM A;  1K0R A;  4QUC A;  3A8K E;  2NYZ D;  1M90 C;  1I4R A;  1N34 L;  1YJN A;  2WKD A;  1B4O A;  1ZXT A;  5M3F H;  3HOV B;  4N8F A;  3CQZ H;  2E2D C;  4JI8 Q;  4IUN A;  2JXM B;  1QZH A;  4FXD A;  4IUU A;  2EQS A;  2CW0 D;  3RZO B;  4DR2 L;  1IL2 A;  4DV2 L;  1V43 A;  1YZ6 A;  1SE4 A;  3I73 A;  2A68 D;  3PV0 A;  1UWV A;  2J4X A;  1AP0 A;  1S5B D;  4B3R Q;  1VQD A;  4K0K L;  3OYY A;  1DYQ A;  3QIA A;  1LT5 D;  1EIG A;  4IAL A;  5F2D A;  3SDZ A;  3L2P A;  2VQF Q;  1EQR A;  3U9S A;  3UE1 A;  4HAE A;  4LF4 L;  1WTQ A;  3GTK B;  4NXN Q;  3CCJ A;  1CKO A;  1HJP A;  2WAQ E;  3PUZ A;  1M1K C;  3AQQ A;  4BXX G;  5JEA J;  3FDT A;  5K5P A;  3AMU A;  1N32 L;  4C2M H;  1QVC A;  2DGY A;  4GLA C;  4CJ0 B;  4A93 G;  2OCE A;  3KUP A;  1K8M A;  4JI2 Q;  2QDL A;  2RKS A;  1JMC A;  4XQN A;  3RZO H;  2L12 A;  3FVQ A;  3J80 i;  1KNA A;  1ZEQ X;  4DR1 L;  2KHJ A;  3HOX G;  2I5M X;  1IHZ A;  3BYY B;  3CQZ B;  1VS0 A;  2KJX A;  5HY6 A;  2EIF A;  4YY3 L;  1PYW D;  4NDX A;  1PFS A;  1J5E Q;  1N34 Q;  1HZC A;  1JOR A;  5C3X A;  3QJY A;  1PH2 A;  1GUW A;  4X3S A;  4QMG A;  1BOS A;  5IGF A;  4DA2 A;  4DXF A;  1RL2 A;  3URY A;  4JW0 A;  2SDF A;  2HIX A;  4M1U B;  1UUP A;  4KLK A;  1TII D;  5C4J B;  4JYA L;  2HQE A;  4U68 A;  3P75 A;  1XWE A;  5KIX A;  4G7H C;  4RG1 A;  4IQZ A;  1K9M C;  1XX8 A;  2RVL A;  2EYJ A;  5ELE A;  5JOB A;  4IFD G;  3S2H B;  1QVG A;  5IWA L;  5FJ8 G;  3TQY A;  3S1R H;  4C2M B;  2QW7 A;  2MNA A;  1CZW A;  2B3G A;  5T1I A;  1I94 L;  3I4N G;  1EIH A;  1R4Q B;  1QUQ A;  4BY1 H;  1OXT A;  1PRT B;  4PG3 A;  3M4Q A;  2VY3 A;  5EKK A;  2ZXO A;  3HKZ G;  4PMC A;  2DY7 A;  3JAM c;  2SNM A;  3V96 A;  3MXN B;  4OON A;  5EPL A;  4BA2 I;  1T5X D;  2R93 G;  3W5O A;  1CT1 D;  2G9D A;  1XYI A;  2VS1 A;  1BCP B;  5IOD A;  3KK7 A;  3FKI G;  4NB3 A;  4OWW B;  3OW7 A;  5A35 A;  3ERQ A;  3TRZ A;  2K5W A;  3DLL A;  2QDB A;  1H9J A;  5BN4 A;  2K5Q A;  5M3F G;  1XTD A;  4QL5 A;  2QA4 A;  1E3P A;  4BWG B;  1Q86 C;  3H94 A;  3I3C A;  4F87 A;  3VR5 A;  4KV6 A;  1PZJ D;  3CCV A;  1JB7 A;  3H0G H;  2B63 G;  5JVG 3;  2I5L X;  3OIP A;  4LUO A;  1CFM A;  5FLM G;  4KTA A;  1D5X C;  3CU7 A;  2RBM A;  2JYO A;  1WTW A;  4H44 C;  2IX0 A;  4Y52 H;  2ZTD A;  2J0T D;  4FP5 D;  3DHQ A;  5DNF A;  3CCU A;  2KQ3 A;  4RFB A;  3I4N B;  3I90 A;  2ASB A;  1CHP D;  4UDU C;  2MPM A;  3PMF A;  2N88 A;  5I2Y A;  2F0E A;  3E9H A;  2PNH A;  3DEP A;  1YVC A;  1AN8 A;  2E5L L;  1QB5 D;  4OWX B;  2K33 A;  3KF6 B;  1H9S A;  1B3Q A;  1QJO A;  2PCF B;  4BXX H;  5JEA G;  1T5E A;  1W6J A;  5KGU A;  1MI2 A;  3CRK C;  4KHZ A;  1E22 A;  4HMI A;  1I50 B;  1KL9 A;  3BVZ A;  1K3R A;  4ZKC B;  2VUM H;  4PZ6 A;  1HXY D;  5BR8 Q;  3TZD A;  1PA6 A;  5DM6 3;  1JCK B;  4QY7 A;  4ZYS A;  3LNN A;  2R92 G;  3NEL A;  5CV5 A;  4UP9 A;  3G4S A;  3HOU G;  5I9O A;  1CSQ A;  3KLS A;  2F0N A;  3NEM A;  2O5J C;  4WJ3 M;  4DV3 L;  4A3M H;  4A3F G;  4K2L A;  1LV9 A;  1SYB A;  4WOR A;  1GM5 A;  5M5W H;  2FHT A;  3F2B A;  2G5D A;  1B44 D;  3BDO A;  4C3J G;  5G3L F;  4J15 A;  1TWG B;  2MP1 A;  4A3D B;  2JQO A;  3GQB A;  4O0A A;  5J3B A;  1S5C D;  1HTL D;  4IOC A;  4DR5 L;  1YIT A;  2R7Z B;  1XMQ L;  1MBY A;  5C44 H;  4A3B G;  1QNK A;  1RDP D;  4A3G H;  2K5N A;  1OXV A;  4A3E H;  2RDH A;  2C5C A;  3R2T A;  5CV7 A;  3KLS X;  4Q5V A;  4LFB L;  1G6P A;  3T16 A;  2NN6 I;  2WB1 B;  4X6A H;  1EYA A;  3C1F A;  2RHS B;  1N32 Q;  1A62 A;  1PYB A;  4HJ8 A;  3CKI B;  2XSC A;  2B2V A;  3VR6 A;  4TKO B;  2NBF A;  3CF5 A;  1M4V A;  3MTS A;  4IPD A;  1IBK L;  1O78 A;  1I4P A;  5DM7 3;  1MJC A;  5FLX E;  2RA4 A;  4X3U A;  3HOZ G;  1O7L A;  1STY A;  3TP5 A;  4YWL A;  1TR5 A;  4GKJ Q;  1KLG D;  4IJL A;  5JVH 3;  1STA A;  2F4V L;  1JJC B;  1I4X A;  2IWH A;  1GOZ A;  1KAW A;  1TWC B;  1VQJ A;  1NY4 A;  1FL0 A;  4B9W A;  4X65 L;  3WOE A;  1QWY A;  3N6R A;  2PMZ E;  3I4N H;  2WFW A;  3E0E A;  4BBR B;  3EFX D;  4HSP A;  4X3T A;  2O4X A;  2PZT A;  4JI3 L;  4FXK C;  3W2D A;  1G6Z A;  2E8G A;  3TP7 A;  1DOL A;  4RWS C;  2F0U A;  3X3N A;  3J81 c;  1SMY D;  1EWC A;  2Z6K C;  3UDI A;  4DNR B;  1QVF A;  4QF4 A;  4LMQ D;  4HMJ A;  3GTG B;  5D65 A;  3W3A A;  4B3S Q;  4C1N K;  1TWH B;  4RCN A;  2Q2U A;  3GTO B;  4A3B B;  3I4M B;  5CC4 A;  3Q24 A;  3GO5 A;  4ZUI A;  5ELD A;  2A6H D;  1X3P A;  5IYB G;  1SYG A;  4RGM A;  1KTK A;  3CXC A;  4H13 C;  4JI7 Q;  4B3M Q;  4G7O C;  1MGS A;  4LF6 Q;  2FMM A;  2EJG C;  5T1G A;  4DV6 Q;  4JI4 Q;  1D8L A;  4ZCK A;  4BA1 I;  1V8Q A;  4DNI A;  3S17 H;  1VQ5 A;  4F88 A;  3J7A 5;  1LTB D;  2XN9 C;  1HR0 Q;  1VQN A;  3PO2 G;  1HR0 W;  3DUZ A;  5I9P A;  2N8N A;  3SGI A;  5JEA H;  4HSV A;  5LMU Q;  4TSS A;  1PH4 A;  2XRQ D;  4JCV E;  4DR2 Q;  4HIK A;  5COR A;  1VQI A;  4YWM A;  2NVY H;  1TXY A;  3DWP A;  3MFG A;  4P2C B;  3D8G A;  4CDE C;  4GN4 B;  5BN3 A;  1PH1 A;  5GAE C;  4ZLT F;  4A3F B;  1ESR A;  2JA7 G;  3GD7 A;  1TS5 A;  5J39 A;  2EYH A;  3UDG A;  2E74 C;  4NP5 A;  2DN8 A;  4A3G B;  3MXP A;  3HOX B;  2FJ2 A;  5IY0 A;  2ZJQ A;  3CD6 A;  1OXU A;  5C6A A;  4JBM A;  5C5M A;  1PH5 A;  4ME3 A;  3T13 A;  1F9S A;  2WII B;  1GUN A;  4RAU C;  5IGD A;  3S2H H;  3VYU A;  3M85 A;  1EY6 A;  3F8T A;  2YYZ A;  1RHP A;  2UUB Q;  1VQE A;  3I4M H;  2NZH A;  1LTA D;  1XTC D;  3JC6 6;  1UEA B;  4KY7 A;  2FIN B;  3HKS A;  1HUM A;  2PI2 E;  3TN2 A;  2R7Z G;  2UXC Q;  2HHH L;  3A7L A;  3F2D A;  3PGZ A;  3S16 B;  1PTO C;  1FJG L;  4DGZ A;  2L1B A;  4K14 A;  5G3L D;  5M3F B;  1HTP A;  4K5V A;  4DR6 L;  4I7A A;  2ZTC A;  4KKU A;  3DWA A;  2B39 A;  2Q8I B;  3I4L A;  2D62 A;  4YWK A;  4HIM A;  1Y69 U;  1SR3 A;  3DEO A;  4AQY L;  5JJL A;  4YY3 Q;  4A3M G;  3HOV G;  1VQP A;  2D0P A;  5IYD G;  2MFI A;  5EKL A;  4I65 A;  4RGO S;  1L0W A;  5GAG C;  5FOB B;  1K8G A;  4DUY Q;  3RLO A;  2KCM A;  1V1O A;  1BQQ T;  3BDL A;  1I6V C;  4YIJ A;  2F0O A;  1ML0 D;  2D9U A;  1X55 A;  2DNC A;  5JPM C;  4LF9 Q;  4P71 A;  3CW2 C;  2F0I A;  1DOM A;  2HT1 A;  3GTG H;  4L5R C;  3P1H A;  4EQ5 A;  3S9W A;  4I7Z C;  1VQM A;  5IE8 A;  5KYI A;  3MXG A;  4LF7 Q;  1ROD A;  5TSS A;  1EIY B;  3MVV A;  5HGT A;  1XNQ Q;  2MGS A;  4KY6 A;  1NAP A;  2ATW A;  4ZRZ A;  1SFO H;  1PTO D;  2HDL A;  2B8F A;  3C3L A;  2TSS A;  1LTI D;  3G6J B;  4PMW A;  4MIU A;  3U58 A;  2NVT B;  1G91 A;  2R92 B;  1QZG A;  5IWA Q;  1AE3 A;  2AWN A;  5H1S E;  1FNW A;  3WOF A;  1J8I A;  2WB1 G;  2CQO A;  1PV4 A;  3SR1 A;  3A56 A;  1RD9 D;  5I6Y A;  1CQF A;  3K5N A;  2F0H A;  3HZX A;  5EQ0 A;  3STB C;  1XMO Q;  2B63 B;  3MA2 B;  3MXU A;  1LYL A;  2BE5 C;  4AQY Q;  4P72 A;  1BCP F;  1TKW B;  5EPJ A;  5C0X I;  4XDX A;  1Z47 A;  5IYB H;  1WFQ A;  3LGJ A;  1NE3 A;  1Z6H A;  2F0M A;  2EYL A;  3O13 A;  2JEB I;  4OGQ C;  2N55 A;  2VB3 X;  4K0K Q;  3BU2 A;  1CKN A;  4OXP A;  1SMY C;  3ITP A;  3PSI A;  5K36 G;  5FLX L;  3J81 j;  2R7D A;  5FLM H;  3VR2 A;  1HCZ A;  1EYD A;  2PZU A;  3UDF A;  1F77 A;  3U50 C;  3HOW H;  2KBN A;  3GTM B;  1GHK A;  1Q8K A;  5M5W B;  2L5T A;  3PUX A;  3I55 A;  4JI3 Q;  4KD3 A;  2RQX A;  4B08 A;  3V05 A;  3J81 L;  1SND A;  4YCW A;  2Y0S B;  2CVR A;  5IGC A;  3MAQ A;  4DUZ L;  2AWO A;  5AFW A;  3T51 B;  1AEX A;  4BBR H;  1GUG A;  1DD2 A;  1HZA A;  2IHF A;  2PW5 A;  4DV0 Q;  1TS2 A;  1VQG A;  4ILW A;  2KCN A;  1F2M A;  1PZK D;  2RDF A;  2R93 H;  3VR3 A;  3U9O A;  2E76 C;  2A6E D;  1FGB D;  4LAA A;  1CQV A;  4EQO A;  3FKI H;  1B3A A;  3A5Z B;  5C4X H;  2ZT9 C;  1I3Q H;  2OEO A;  1PFN A;  1D7Q A;  1ICF B;  4OEL B;  3HOU H;  1DZ1 A;  3I4O A;  2LXJ A;  4L8J A;  1VMC A;  4DXG A;  1VQK A;  3KFU A;  4GS3 A;  4DR1 Q;  3S24 A;  2M9V A;  2EJM A;  3QOL A;  3G7L A;  5GAD C;  2PO4 A;  1T9H A;  1HNW Q;  2LMC B;  2A74 C;  2K03 A;  4KN4 C;  1STN A;  4Z9C B;  1CK1 A;  4DV4 Q;  2NTS A;  4G4K A;  1G2S A;  3ULP A;  1PDQ A;  1FR3 A;  2K04 A;  3TBI B;  1JOO A;  2GA4 B;  5ELB A;  3U4V A;  3K7U C;  1G8Z D;  4UY8 C;  2OTL A;  3SE0 A;  3A0J A;  3GP7 A;  4M8A A;  1A63 A;  1Y8O B;  3EBE A;  3E0J A;  3J80 c;  3BYT B;  1WI5 A;  5E1F A;  3RNU A;  4JI6 Q;  1U5K A;  3HOY B;  3D0F A;  5C3W A;  3B6Y A;  2PQE A;  2NVT H;  1BVS A;  4X3K A;  1LTS D;  1SNQ A;  1TVX A;  2P5Z X;  1S3O A;  3D6W A;  1HPC A;  3BVM A;  3F2C A;  3J81 E;  2F0F A;  2M00 A;  1UE1 A;  4PV1 C;  3T1Y Q;  1SMX A;  4B9X A;  3GTQ B;  4J1M A;  1WYD A;  1D1K A;  4HIO A;  1HNZ Q;  1YNN C;  3TS0 A;  2EE1 A;  4DAY A;  1BUV T;  2PYK A;  1JIC A;  5IT9 c;  3S1M H;  3HEJ A;  2K05 A;  1JWM D;  5D3I B;  4JI0 Q;  3K0Y A;  5EBD A;  2BOS A;  2I0Q A;  2EY5 A;  3E5S A;  4J6H A;  4GNX C;  4XTC S;  4AIM A;  2IW3 A;  5ELN A;  4FNF A;  2XIW A;  5KEE A;  2D2C C;  4H7B A;  5I6W A;  4A3I H;  1EFI D;  4JBK A;  3OMG A;  2KVM A;  4X62 Q;  4A3L H;  3RMH A;  1YJ9 A;  1X3G A;  4ODG A;  1A6X A;  1XPR A;  2ZTE A;  1VQB A;  3CAM A;  4LWC A;  1WTP A;  3RZD B;  3S1Q H;  1YNX A; 
#chains in the Genus database with same CATH homology
 3T1H Q;  1PA6 A;  4X64 L;  1IBM L;  4A3L G;  5C3E G;  1FVI A;  3ULJ A;  3I7F A;  4JG2 A;  4QY7 A;  2NVX H;  4P74 A;  2CWP A;  2R92 G;  1K8A C;  3NEL A;  3KJO A;  1VQ9 A;  4UP9 A;  3G4S A;  3HOU G;  1N9W A;  2KCT A;  4B3S L;  3M9B A;  4KHP Q;  4R4O A;  1CSQ A;  5FJ8 H;  1OTC A;  3TS2 A;  3NEM A;  4WJ3 M;  4DV3 L;  4A3M H;  2OQK A;  4O2D A;  5LMU L;  2RCN A;  4A3F G;  4POG A;  2UXD L;  3HOZ H;  3ULL A;  1GM5 A;  5M5W H;  2Q2T A;  1GVP A;  1O7I A;  2N3S A;  4LFA Q;  3RLF A;  3F2B A;  4DR3 Q;  1X9N A;  4C3H H;  3PIP A;  3I56 A;  5LMN Q;  4OWT B;  1ASZ A;  4DV1 Q;  4OO1 G;  4IPC A;  4RMF A;  2UXC L;  4J15 A;  4DV2 Q;  4GLV B;  1X3F A;  2BH2 A;  4BY7 G;  1XPU A;  2WAQ G;  1YHB A;  2JQO A;  1XMO L;  3AYH B;  3CPW A;  2BA0 A;  3DM3 A;  4O0A A;  3GTL H;  1S72 A;  4HJ7 A;  5J3B A;  1XNR Q;  4DR5 L;  4IOC A;  2CCZ A;  1YIT A;  1XMQ L;  5C44 H;  1N33 Q;  4A3B G;  3CCE A;  2CKZ B;  1HZB A;  1J5E L;  4C3J H;  2JE6 I;  4PZ8 A;  4UP8 A;  1EFW A;  4A3G H;  4DV7 Q;  2K5N A;  1OXV A;  4A3E H;  1XMQ Q;  5M5Y H;  1NMF A;  5GAH C;  2PQA A;  1EYG A;  3GTK H;  4LFB L;  1G6P A;  4LFC Q;  3S1N H;  2WB1 E;  4MZ9 A;  2NN6 I;  4DAM A;  1GD7 A;  4C3I H;  4IJH A;  1L2F A;  4R4T A;  4DR4 L;  5GQO A;  2V1C C;  4X6A H;  4JBW A;  4X66 L;  2RHS B;  3PUV A;  1N32 Q;  1A62 A;  1PYB A;  5C44 G;  4HJ8 A;  4A76 A;  3AEV A;  4JC0 A;  3PO3 G;  3M7N A;  2ZM6 Q;  2A8V A;  4OX9 L;  2R7Z H;  1Q1B A;  4X66 Q;  3CF5 A;  2Y0S G;  5AJ3 Q;  4YCU A;  5M3M G;  1PVO A;  4IPD A;  1IBK L;  1XNQ L;  1MJC A;  4IFD J;  4ALP A;  4GOP C;  4A3B H;  1K83 H;  1MKH A;  3HOZ G;  1PYS B;  2MO0 A;  1XPO A;  3PIO A;  1L1O A;  3IRB A;  4YWL A;  1JE5 A;  4DK3 C;  1IBL L;  4LF5 Q;  4A3C G;  3HOY G;  4GKJ Q;  4NXM L;  4IJL A;  3AFP A;  5C4J H;  2F4V L;  1JJC B;  2L15 A;  4JI8 L;  4NXN L;  4A3J G;  1KAW A;  4GKJ L;  5FLX c;  2A1A A;  1VQJ A;  5IYC G;  1E1O A;  3PO2 H;  1Q81 C;  3HOV H;  2IT1 A;  1NY4 A;  1FL0 A;  1EQQ A;  3W1G A;  1RIP A;  4X65 L;  2JA5 H;  2D0O A;  4KHP L;  2PMZ E;  3I4N H;  4IFD I;  2PI2 A;  2WFW A;  3E0E A;  3T1Y L;  4LF8 L;  3GTO H;  2N49 A;  2I5H A;  1W3S A;  4APV A;  4DV0 L;  3S14 H;  1KIX A;  4JI3 L;  4LW1 A;  4A3E G;  1YI2 A;  2IY5 B;  1MJE A;  1HR0 L;  2E8G A;  3CCL A;  4GNX A;  3J81 c;  3M3Y H;  3G71 A;  2Z6K C;  1QVF A;  3UDI A;  3I4N G;  1TWC H;  4A93 H;  4YCV A;  3CCQ A;  1HZ9 A;  2XGT A;  2E5L Q;  1KRS A;  4B3S Q;  3OTO L;  2RF4 A;  1K73 C;  2Q2U A;  4DV7 L;  5AJ3 L;  5C0X J;  2JEA I;  2F3I A;  3JAM i;  3GO5 A;  1UE5 A;  1EUJ A;  4A3D G;  4A4I A;  1U0L A;  3K80 C;  3ICE A;  1XNR L;  5JJK A;  4LF6 L;  2GVA A;  2ES2 A;  5IYD H;  5IYB G;  2CFM A;  3CXC A;  3HKZ E;  4HJA A;  1PH3 A;  4B3M Q;  4JI7 Q;  2KHI A;  2ID0 A;  1C0A A;  4LF4 Q;  4LF6 Q;  1Q7Y C;  4JI4 Q;  4DV6 Q;  3PCO B;  2K52 A;  2UUB L;  2ZM6 L;  1D8L A;  2QGQ A;  4BA1 I;  4A3C H;  4DNI A;  5IP7 G;  1N8R C;  2UU9 Q;  3S17 H;  1VQ5 A;  2NN6 G;  2ZJP A;  1LTL A;  1Y1W G;  3J7A 5;  3BZC A;  4GKK Q;  4A3J H;  2YU9 H;  1HR0 Q;  1CKM A;  1W2B A;  1VQN A;  3M4O H;  3PO2 G;  1HR0 W;  2VNU D;  1PH7 A;  2MO1 A;  1X6O A;  2N8N A;  2YV5 A;  2JA8 H;  2Q2H A;  4L5T A;  3SGI A;  2AKW B;  3T1H L;  5LMU Q;  3Q8D A;  1PH4 A;  4A3K G;  4JCV E;  1KD1 C;  3H15 A;  5IP7 H;  3WWV A;  1VQH A;  4HIK A;  4DR2 Q;  1VQI A;  5E7N A;  4YWM A;  4DPG A;  1X3E A;  4DR5 Q;  2NVY H;  2C35 B;  1G29 1;  1LUZ A;  1TXY A;  2WP8 J;  4DK6 C;  4JI0 L;  1L1O C;  2UUC L;  4GN4 B;  1PH1 A;  4QQB X;  1IZ6 A;  2XTI A;  5GAE C;  4PZ7 A;  4DR6 Q;  3S15 H;  1H95 A;  4JI1 L;  2JA7 G;  3GD7 A;  1YHA A;  3J81 i;  4JOI C;  5C0X G;  3UDG A;  1HNZ L;  1PH8 A;  4DUY L;  3S2D H;  4JI4 L;  5IY0 A;  2ZJQ A;  2K75 A;  1OXU A;  1HNX Q;  4JBM A;  3CD6 A;  1KRT A;  1PH5 A;  4ME3 A;  1E7Z A;  2H5X A;  4UPA A;  2JA6 H;  4A3D H;  4GKK L;  4JV5 Q;  4X62 L;  1VQL A;  1CSP A;  3S2H H;  1I94 Q;  3L7Z C;  4XIG S;  3M85 A;  2E2J H;  3F8T A;  2JA5 G;  2YYZ A;  4DV6 L;  2LSS A;  1VQE A;  2UUB Q;  3I4M H;  2NZH A;  2N78 A;  4JI5 L;  3EIV A;  3JC6 6;  2R7Z G;  3HKS A;  2PI2 E;  2UXC Q;  4LF9 L;  2HHH L;  2AHO B;  3PGZ A;  3F2D A;  4IOA A;  1FJG L;  4L5S A;  2LXK A;  1EWI A;  4LUV A;  1MIU A;  3K8A A;  4AYB G;  5JJI A;  4DR6 L;  1Y1V G;  4GLX A;  1SN8 A;  2ZTC A;  3I4M G;  1WJJ A;  4JBJ A;  1GKH A;  2QEX A;  4IO9 A;  1L1O B;  4GOP B;  3U4Z A;  2D62 A;  4YWK A;  4DAY B;  5C3E H;  1I5F A;  4HIM A;  4MNO A;  1SR3 A;  1Q1E A;  4LF7 L;  4AQY L;  1UE6 A;  3NBH B;  1VQA A;  2BA1 A;  4YY3 Q;  4A3M G;  5JJL A;  4QIW E;  3HOV G;  1VQP A;  2D0P A;  5LMN W;  4DV5 Q;  5IYD G;  2MFI A;  1SRU A;  2MQH A;  1E24 A;  3HFZ B;  3TRE A;  1L0W A;  3PUW A;  5GAG C;  3ZJY C;  1K8G A;  4DUY Q;  3RLO A;  2KCM A;  2DUD A;  3H3V H;  1VQC A;  4P75 A;  1KHI A;  4X65 Q;  1B7Y B;  1P16 A;  4R4I A;  1VQO A;  3GTM H;  1X55 A;  4LF9 Q;  2E2H H;  4P71 A;  3CW2 C;  3MEF A;  3CME A;  2HT1 A;  3PF5 A;  4L5R C;  3GTG H;  2RHQ B;  3RLN A;  2HQL A;  2GVB A;  2K50 A;  4AH6 A;  4LUZ A;  4EQ5 A;  1VQM A;  5IE8 A;  4HJ5 A;  1B70 B;  4LF7 Q;  1IBL Q;  4LF5 L;  3CCS A;  4X64 Q;  1IBM Q;  2UXB Q;  1K0R A;  1EIY B;  3RN2 A;  2HHH Q;  4BBR G;  3TEH B;  1Z9F A;  1M90 C;  4DR3 L;  1BBU A;  4LFA L;  1XNQ Q;  4TQU S;  2VW9 A;  2VQE L;  1YJN A;  1N34 L;  2ATW A;  4A3G G;  1SFO H;  1Q12 A;  5M3F H;  3RR5 A;  1R9T H;  1HH2 P;  3U58 A;  4PMW A;  4IPG A;  1VQ4 A;  3CQZ H;  2F52 A;  4JV5 L;  3PUY A;  2K14 A;  4JI8 Q;  1X56 A;  4BBS H;  4JOI A;  1QZH A;  4TVA B;  1QZG A;  3GTQ H;  5IWA Q;  1HNW L;  1AE3 A;  2AWN A;  4GOP A;  1Y1W H;  5H1S E;  2YTV A;  1EIF A;  2EQS A;  2UXB L;  1TWA H;  4DR2 L;  1IL2 A;  4DV2 L;  1V43 A;  1YZ6 A;  2WB1 G;  4NPS A;  4HID A;  2CQO A;  2VUM G;  1PV4 A;  4WJ4 A;  4YHH Q;  4JI2 L;  1WCM G;  1S40 A;  4JI7 L;  1NMG A;  4MTN A;  3PV0 A;  1UWV A;  4POF A;  2UUC Q;  2E2I H;  4B3R Q;  1Y14 B;  5GRO A;  1VQD A;  3STB C;  1XMO Q;  3HOY H;  4K0K L;  3OYY A;  4DR7 L;  2R92 H;  2VQF L;  1LYL A;  4AQY Q;  4P72 A;  1IYJ B;  3KLW A;  5C0X I;  3L2P A;  2IX1 A;  2VQF Q;  1UEB A;  4A3F H;  2OWO A;  1EQR A;  2JK8 A;  3UE1 A;  1Z47 A;  5IYB H;  4LF4 L;  1WFQ A;  3LGJ A;  1NE3 A;  4R4C A;  4NXN Q;  3GTP H;  3CCJ A;  1VQF A;  1CKO A;  4B3T Q;  3UE0 A;  2JEB I;  4YHH L;  1HJP A;  2WAQ E;  3EN2 A;  3PUZ A;  3G6E A;  3AQQ A;  1KC8 C;  4DV1 L;  1M1K C;  5JEA J;  4BXX G;  2HIV A;  3CCM A;  1PHJ A;  2UXD Q;  1SE8 A;  3A74 A;  4EX5 A;  1N32 L;  4FDB A;  4K0K Q;  4C2M H;  2EXD A;  1QVC A;  1CKN A;  2DGY A;  3BU2 A;  4GLA C;  4OXP A;  3PSI A;  4L5Q A;  1ASY A;  4BY7 H;  5DLQ E;  5K36 G;  4A93 G;  3W1B A;  2OCE A;  3J81 j;  2R7D A;  5FLM H;  4JI2 Q;  2B29 A;  1UE7 A;  1A8V A;  2A19 A;  3UDF A;  1JMC A;  1OXS C;  3U50 C;  3FP9 A;  2KBN A;  3UDX A;  3HOW H;  2K4K A;  4A3K H;  3RZO H;  3J80 i;  1G51 A;  4DR1 L;  1CUK A;  1Q8K A;  2KHJ A;  3HOX G;  3KDF B;  2I5M X;  1JJ2 A;  4B3M L;  3PUX A;  3I55 A;  4JI3 Q;  1VS0 A;  1N36 L;  5EAY A;  1I6H H;  3CC7 A;  5HY6 A;  4BY1 G;  2Y0S E;  1FJG Q;  2EIF A;  4YY3 L;  1X65 A;  4YCW A;  2IHE A;  4DUZ L;  1PFS A;  2AWO A;  1J5E Q;  3HOW G;  2K5H A;  3K0X A;  4GN3 B;  1N34 Q;  1OXX K;  2CWA A;  1QUQ B;  1HZC A;  2ZJR A;  4BBR H;  4DKA C;  5C4X G;  1HZA A;  1VCI A;  2IHF A;  1B8A A;  3KF8 B;  4DV0 Q;  1PH2 A;  1AH9 A;  1YJW A;  1VQG A;  2ALY B;  1VQ7 A;  4P73 A;  1RL2 A;  2R93 H;  2HIX A;  3ER0 A;  4B3T L;  4KLK A;  1E1T A;  1IXR A;  5IP9 G;  3VDY A;  1N36 Q;  4LFB Q;  5M5X H;  3D31 A;  2JA8 G;  3FKI H;  4JYA L;  1V9P A;  3A5Z B;  5C4X H;  3S1Q H;  4RG1 A;  1K9M C;  2JA9 A;  1C9O A;  3H3V I;  2VL6 A;  4R4Q A;  1J6Q A;  1I3Q H;  3AFQ A;  4IFD G;  3FHW A;  1D7Q A;  2UUA L;  4H02 A;  3HOU H;  3I4O A;  2VQE Q;  2LXJ A;  1Y1V H;  5IWA L;  5FJ8 G;  1QVG A;  1VQK A;  3TQY A;  3S1R H;  1YHQ A;  3KFU A;  4GS3 A;  3GTJ H;  4DR1 Q;  2OQ0 A;  2MNA A;  4A75 A;  3S24 A;  2B3G A;  3KF6 A;  2K5V A;  2PQA B;  3HOX H;  4Y7N H;  3CP0 A;  1PH6 A;  1I94 L;  2UU9 L;  5GAD C;  2NVQ H;  4QGU A;  1QUQ A;  3PO3 H;  2NZO A;  1T9H A;  1HNW Q;  2VZA A;  1YEZ A;  4BY1 H;  1OXT A;  2F4V Q;  4DR7 Q;  3OTO Q;  4PG3 A;  3M4Q A;  4DV4 Q;  1Q82 C;  2VY3 A;  1TWF H;  3ULP A;  1XJV A;  3HKZ G;  2AMC B;  3JAM c;  3U4V A;  3L0O A;  5LMN L;  2Z6K A;  3K7U C;  4UY8 C;  3MXN B;  3A5U A;  2OTL A;  1YBY A;  3RN5 A;  1HNX L;  4OON A;  1KXL A;  2JJQ A;  3A0J A;  1BBW A;  4BA2 I;  2R6G A;  3KYH C;  3K81 C;  1A63 A;  2R93 G;  3W5O A;  3EBE A;  1PH9 A;  3CC2 A;  1YIJ A;  1KQS A;  3BZK A;  3I2Z A;  2OTJ A;  3J80 c;  2VS1 A;  3J7Z C;  2GN5 A;  1WI5 A;  3NEN A;  3RNU A;  1X54 A;  4KI0 A;  4JI6 Q;  1VQ6 A;  3FKI G;  4NB3 A;  4OWW B;  4DV4 L;  3F1Z A;  4B3R L;  1U5K A;  4IPH A;  3H0G G;  2B63 H;  3TRZ A;  3D0F A;  1IBK Q;  3B6Y A;  5HGQ A;  3DLL A;  4JI6 L;  1BVS A;  2NVT H;  1SRO A;  3K7A H;  1SLJ A;  5M3F G;  1TWG H;  1XTD A;  1N33 L;  4QL5 A;  1S3O A;  1JJG A;  1V1Q A;  2QA4 A;  1E3P A;  4OO1 I;  1Q86 C;  3F2C A;  4GNX B;  1UE1 A;  4LNQ A;  4BBS G;  3CCV A;  4DV5 L;  1TWH H;  3T1Y Q;  1SMX A;  1JB7 A;  4QJF A;  4LFC L;  3H0G H;  2B63 G;  1WYD A;  2I5L X;  2Q2I A;  2UUA Q;  4HIO A;  2YTY A;  1HNZ Q;  4LUO A;  5FLM G;  3TS0 A;  2JA7 H;  2BH8 A;  3G48 A;  5IYC H;  5IT9 c;  2IX0 A;  4Y52 H;  2ZTD A;  3CC4 A;  1NJI C;  1VQ8 A;  2Z0S A;  4JI5 Q;  4NXM Q;  3S1M H;  1WOC A;  1DGS A;  3CCU A;  4JI0 Q;  4R1J A;  1BKB A;  3KOJ A;  3GDE A;  3CCR A;  4HJ9 A;  2I0Q A;  2ASB A;  3KDF A;  1GO3 E;  4JI1 Q;  4GN5 A;  5BR8 L;  3KJP A;  3RZD H;  4GNX C;  1JT8 A;  2R7F A;  4XTC S;  3E9H A;  4AIM A;  2PNH A;  2KEN A;  5M3M H;  2JA6 G;  1YVC A;  2YTX A;  1I50 H;  1LM0 A;  1C7Y A;  1EOV A;  3BJU A;  5ELN A;  2E5L L;  4OWX B;  3STB D;  4OX9 Q;  3KF6 B;  1Q46 A;  2FXQ A;  4AYB E;  1AE2 A;  4A3I H;  3CPF A;  4BXX H;  5JEA G;  1NTG A;  4JBK A;  3PF4 A;  1A0I A;  4A3L H;  4X62 Q;  1CKN B;  1NBW A;  1X3G A;  1YJ9 A;  4DR4 Q;  4DV3 Q;  4JYA Q;  3OW2 A;  4KHZ A;  4UP7 A;  1E22 A;  1WCM H;  3E9I A;  3CMA A;  4LF8 Q;  1P8L A;  3ERS X;  1XPR A;  1KL9 A;  1K3R A;  2VUM H;  4PZ6 A;  2ZTE A;  1VQB A;  3CAM A;  4LWC A;  1FGU A;  3M4P A;  5BR8 Q;  5IP9 H;  5ELO A;  4DUZ Q;  3S16 H;  4A3I G;  1YNX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...