3U58A

Crystal structure of the tetrahymena telomerase processivity factor teb1 ab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Tetrahymena Teb1 AB
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
total genus 40
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A02
4IPDA 5J3BA 1TWGH 1XMOL 3ERSX 4GKKL 1QVGA 4NXML 4OO1G 1X9NA 1N32L 3S15H 1WCMH 4BY7G 2KCMA 3DM3A 3J7ZC 3L2PA 3PF5A 3F2CA 4JOIC 1IBLQ 4LW1A 4GLVB 4DV3L 4NXNL 3GTGH 2UXCQ 3BJUA 1VQFA 3HOWH 4GOPA 1WI5A 4DV6L 2N8NA 3I4MG 5IYBH 3U50C 1WFQA 5H1SE 1VQPA 3HOZH 5BR8L 1LYLA 2QGQA 1VQ6A 4DR2L 3U4ZA 4DV2L 2F3IA 2E5LL 4MNOA 1A62A 2Y0SG 1VQIA 3RR5A 4LFCQ 1MKHA 1Y1VH 2AWOA 2AKWB 4JI5L 3U58A 2R92H 4BXXG 5IP9H 1U5KA 1KIXA 1VQKA 1WOCA 4JC0A 2VQFL 3M9BA 1SN8A 1HR0W 2LXJA 4YHHQ 5AJ3Q 1VQEA 3S16H 5M5WH 3PIOA 3RNUA 4K0KL 4A75A 3RZOH 3T1HQ 1VQBA 1OXUA 5IE8A 4POGA 3HOYH 5LMUQ 2K4KA 1PA6A 4A3GG 4DR6Q 4BXXH 2WAQG 1VQHA 1OXTA 2DUDA 3T1YL 4JBJA 4YWKA 4OX9Q 1X3FA 3GTJH 1JB7A 1V9PA 4DUZQ 3GD7A 4BY7H 4HIDA 1CSPA 4DR1Q 4JI8Q 4HIOA 1PH9A 5C0XJ 2HT1A 4JI6Q 1KL9A 3K8AA 4AYBE 2IHFA 3I4MH 4A76A 3PO3G 4JYAL 1IZ6A 2F52A 2R7DA 4QL5A 4IPGA 3F2BA 3AFQA 4MZ9A 1Q1BA 2ASBA 4B3SQ 5C3EG 4LUVA 1M1KC 4WJ4A 1PH2A 3I4NG 4DV1L 5ELNA 4LFAQ 1U0LA 3A5UA 2UXBQ 1KHIA 3KF6A 3RN2A 1BKBA 5HGQA 2LSSA 2HIXA 4JBWA 1BBWA 4X64L 1HJPA 3BZCA 3PSIA 4DKAC 4A3BG 2EXDA 1HNXL 4A3FG 1LTLA 4MTNA 3WWVA 4A93G 2JQOA 4HJ5A 1I94Q 1H95A 2UUCQ 2VZAA 4KI0A 2K5NA 1FJGQ 1S40A 1NE3A 1L0WA 2Q2UA 3H3VH 1I3QH 5M3MG 3A0JA 1HR0Q 4WJ3M 4B3RQ 4JBMA 1VQNA 3CCLA 3HFZB 2I5LX 1QVCA 3I55A 2JA8G 2JK8A 2LXKA 1IBML 3F2DA 1HZCA 3CPWA 2VUMG 4JI3L 4OWTB 4XTCS 4IOCA 3PUZA 2VL6A 2PI2A 3M85A 3E9HA 2UUBL 3PO3H 1BVSA 4DV7Q 3FHWA 3MXNB 4GNXB 4AQYQ 4LWCA 4DK6C 4P75A 5C3EH 3CCEA 2GVAA 3I4OA 3A74A 1S72A 4OWWB 3GTKH 3I4NH 1IBLL 2UXCL 1P8LA 3CMAA 1EFWA 3J81c 4GS3A 4LF4Q 1I6HH 3S1RH 2BH8A 3EN2A 5ELOA 1N34L 3UDIA 4JI7Q 4OO1I 4A3BH 2JA5G 1PVOA 3F1ZA 4A3FH 1YNXA 2MQHA 1D7QA 3G6EA 4JI2Q 4A93H 3UDXA 1B8AA 1CKMA 2N49A 4OONA 4LFCL 5M5YH 4HIMA 2IY5B 2B63G 3PF4A 4A3DG 1UE6A 4EX5A 2OTJA 3AQQA 3KJOA 1K0RA 5M3FG 2I5MX 1K9MC 1X3EA 2JA6H 1SRUA 2ATWA 1VQ4A 5JJLA 2K50A 2L15A 2JA8H 2AWNA 1E24A 1PFSA 2PMZE 3PCOB 1G291 4YHHL 2VUMH 3TS2A 1IXRA 4O0AA 5AJ3L 5IWAQ 2NVYH 3UDGA 4GKJQ 2EIFA 4GN4B 3NBHB 3UDFA 2QEXA 4POFA 3T1HL 5JEAG 1BBUA 3D0FA 4QJFA 3PUVA 5LMUL 1Q7YC 4DR6L 1XNQQ 3G71A 1Q46A 4JG2A 1FGUA 1KD1C 3CC2A 2VW9A 4P72A 1K8GA 2OTLA 4JI0Q 4P74A 4OX9L 3CCUA 3K7UC 4DUZL 1Q86C 1TWCH 1JJ2A 1C0AA 2MNAA 3KJPA 5GQOA 1XMQQ 1CKOA 4IJHA 3HOYG 4DR1L 4JI8L 1L2FA 2Q2IA 2OQKA 4C3IH 1PH6A 4JI6L 1VS0A 3I56A 3RZDH 3ULLA 2VNUD 4LF7Q 2FXQA 2JA7H 2GN5A 3W1GA 2JA5H 4P71A 4APVA 1ASZA 2HIVA 2ZTCA 4GN3B 4B3SL 3J80i 2B63H 4A3DH 1N34Q 3S2HH 2MO0A 3GTQH 5M3FH 3PV0A 2C35B 4XIGS 1OXVA 4A3CG 1I5FA 4LFAL 1X56A 3CPFA 1Z47A 4DV4Q 2UXBL 3H3VI 2BH2A 1QZGA 1TXYA 3CCMA 1SE8A 3CCSA 3S2DH 1AH9A 2IT1A 1B7YB 1X54A 2YYZA 1JMCA 3K7AH 3OTOQ 1YI2A 4X62Q 3PO2G 4QQBX 2Q2HA 1MJEA 5JJIA 2K5HA 2NVXH 4L5TA 1LM0A 4LF8Q 1CUKA 4IO9A 1I94L 2UUCL 2RCNA 4H02A 1KRTA 1L1OC 1FJGL 1VCIA 5C4JH 3TQYA 2NZHA 1HR0L 2KCTA 1Q1EA 4B3RL 2GVBA 4R4OA 1HNZQ 4DR7Q 1WJJA 1W3SA 1J5EQ 3F8TA 4LUOA 4GNXA 3JAMi 4TVAB 1K73C 1JE5A 3A5ZB 2CQOA 3GTLH 4L5RC 2OCEA 4LF6Q 1JJCB 2E2HH 1E3PA 4IJLA 5FJ8G 3HOXG 4DV7L 4AQYL 4GOPC 2E2JH 4B3TQ 1EQQA 1X3GA 3HKZG 1YIJA 4LFBQ 1NMFA 1NTGA 2XGTA 3H0GG 1WYDA 4LF5Q 4LF4L 4A3CH 3KFUA 5GROA 2WP8J 2F4VQ 3PGZA 1VQ5A 4DUYQ 4JI7L 1Y14B 1NY4A 1OXXK 1NBWA 2YV5A 1LUZA 5IT9c 5LMNW 3PO2H 5JJKA 1KC8C 1KQSA 2ID0A 5FLXc 4JI2L 3S1NH 2YU9H 2UU9Q 4O2DA 1PH7A 3S1QH 4DR5Q 3GTPH 1N33Q 1TWAH 4YY3Q 2BA0A 3CF5A 1YHBA 1EIFA 2A1AA 3PUXA 5IWAL 4GKJL 4IOAA 2D0PA 1GO3E 1N9WA 3EBEA 3CCVA 5HY6A 4R1JA 1XNQL 1GD7A 3NEMA 4LUZA 1K83H 2MFIA 3HOXH 5FJ8H 4A3MG 1YHQA 2JA6G 4JI0L 5JEAJ 1I50H 4L5SA 1A8VA 2K5VA 1YJWA 2AMCB 4NB3A 5DLQE 4A3JG 1W2BA 4DR3Q 1XMQL 3H0GH 4X6AH 2NN6G 1X55A 2CFMA 2EQSA 4JV5L 1HZAA 1Q8KA 4IPHA 2JEBI 3BZKA 4JI4Q 4LF7L 1A63A 4A3EG 1EUJA 1K3RA 1N8RC 3KDFB 3S24A 2Y0SE 3CW2C 3EIVA 2Z6KA 3RLNA 5IY0A 4HJAA 4BY1G 1VQOA 3CCQA 1IL2A 4X65Q 2ZTDA 3JC66 4PMWA 4OXPA 2JA9A 3S17H 3TRZA 1JJGA 1VQMA 4KHPQ 2JA7G 2HQLA 4DV4L 5LMNQ 4UP7A 3OTOL 4QIWE 4QGUA 4X62L 5EAYA 3ZJYC 3RN5A 2YTXA 2JE6I 3J80c 3ER0A 3K80C 1VQ8A 4LF8L 3J81j 1SR3A 3DLLA 1T9HA 3CXCA 4A3MH 1PH4A 4BA2I 4IFDG 5E7NA 1XNRQ 3M7NA 3KLWA 1B70B 3ULJA 4A3JH 1QZHA 1UE1A 1HNZL 4DR7L 2KENA 1GKHA 2QA4A 1J5EL 4GN5A 4P73A 3PIPA 4HJ7A 3CCJA 1N36Q 4QY7A 1KAWA 1PH3A 1VQGA 4LF6L 2A8VA 3GTMH 4AYBG 4A3EH 5GAGC 2RF4A 1G6PA 1EQRA 2CWPA 2JEAI 3GTOH 4BY1H 4B3TL 3B6YA 1E1OA 4JOIA 1X65A 4ME3A 3JAMc 1Q82C 2HHHQ 3OYYA 3M4OH 4LFBL 1HZ9A 3UE1A 4A3KG 1VQ9A 1Q81C 4LF5L 1SFOH 2RHQB 1MJCA 4EQ5A 2F4VL 5FLMG 1FL0A 1KRSA 2IHEA 4DV5Q 4X66Q 4R4TA 2R6GA 4DUYL 1HNWQ 2UXDQ 4C3JH 1VQ7A 4DV0Q 2UUAQ 1IBKQ 4NPSA 4GLXA 3RLFA 4DAYB 1RIPA 1EIYB 2MO1A 3AEVA 3ICEA 2UU9L 2KHIA 3LGJA 2KBNA 2VQEQ 4DR5L 1YEZA 1N33L 3M4QA 1G51A 4UP9A 4HJ9A 2ZTEA 3L7ZC 4YY3L 5GAHC 2ZJRA 2ALYB 1E7ZA 3I7FA 1FVIA 1C7YA 1SMXA 1S3OA 3KOJA 2BA1A 3IRBA 4ALPA 1V1QA 3KF8B 4PZ8A 5IYCG 2NVTH 1YBYA 2AHOB 4YWMA 1YJ9A 1KXLA 3G48A 3HKSA 2K52A 4PZ7A 4HIKA 2ZJQA 4A4IA 1SLJA 4J15A 4DNIA 1UWVA 4BBRG 2CKZB 5GADC 3HOVH 1VQDA 2JJQA 3CP0A 4DR3L 4A3KH 4JBKA 4BBSG 3KDFA 4JI1Q 3CC7A 1YITA 4DR4L 1TWFH 1CKNA 1PYBA 5FLMH 3D31A 4DPGA 1K8AC 3CMEA 4LF9Q 4JI4L 2WB1E 1QUQB 1P16A 3GDEA 1XPRA 2PI2E 2IX1A 2ZM6Q 1EOVA 2E8GA 4X65L 4IPCA 1YHAA 3ULPA 4B3MQ 1MIUA 3SGIA 3FP9A 1OTCA 4KHPL 4Y52H 4LNQA 1V43A 3H15A 5LMNL 3I2ZA 2PQAB 4YWLA 3CAMA 4R4CA 2K75A 5IYCH 1M90C 3M4PA 4A3LG 4FDBA 1HH2P 3NELA 3W5OA 5IYDG 1E22A 2NN6I 3AYHB 1VQCA 1C9OA 5GAEC 2OQ0A 1RL2A 1Z9FA 4GNXC 4BBRH 1XNRL 2B3GA 1EWIA 4JCVE 1PH1A 4GLAC 1XPUA 4IFDJ 2R93G 1CSQA 3TS0A 2NVQH 4PZ6A 1L1OB 1XMOQ 1TWHH 1GM5A 2VY3A 3GO5A 4GKKQ 4BBSH 4NXMQ 3PUWA 3STBC 3CC4A 1N32Q 4YCUA 2R7ZG 1A0IA 3U4VA 3W1BA 1N36L 4BA1I 4DV3Q 4NXNQ 4R4IA 2IX0A 1PH5A 4AIMA 4DV6Q 3MEFA 3G4SA 3L0OA 1Q12A 2DGYA 3PUYA 1NMGA 5BR8Q 4DR2Q 1VQAA 2Z0SA 4DV2Q 2E5LQ 2HHHL 3AFPA 4DR4Q 4PG3A 5C0XI 4GOPB 4IFDI 3VDYA 4JI5Q 2I0QA 1XTDA 1E1TA 3HOUG 1YVCA 2E2IH 1VQLA 4A3GH 5K36G 1HZBA 4KLKA 4DV5L 1D8LA 4X66L 2UXDL 2VQFQ 1XJVA 1CKNB 2YTYA 4A3LH 3Q8DA 1HNWL 2VS1A 2D0OA 4DV0L 1PH8A 1AE3A 2R7FA 1IBKL 2UUAL 5IYDH 3E9IA 3K81C 2CCZA 3S1MH 1NJIC 3FKIG 5C44G 4K0KQ 4JV5Q 4UP8A 2CWAA 2NZOA 4RMFA 2VQEL 1O7IA 1EYGA 1JT8A 2R93H 2N78A 2PNHA 1PHJA 3T1YQ 4AH6A 3OW2A 4UY8C 3BU2A 5C0XG 2R7ZH 3NENA 2WAQE 2OWOA 3CCRA 3STBD 4DK3C 2H5XA 1YJNA 1QVFA 1OXSC 4A3IG 2D62A 5C4XG 2YTVA 4KHZA 1UE5A 2XTIA 5IP7G 1Y1WG 4TQUS 3CD6A 2K14A 1R9TH 3RLOA 3HKZE 3UE0A 4JYAQ 3M3YH 4DAMA 4OWXB 1QUQA 2WB1G 1UE7A 4Y7NH 3CQZH 2ZJPA 4JI1L 3HOUH 1WCMG 2Z6KC 2WFWA 4C2MH 1XPOA 5M5XH 1PV4A 1UEBA 3K0XA 1YZ6A 4DV1Q 4LF9L 3HOVG 4YCWA 3HOWG 1PYSB 5M3MH 5IYBG 1AE2A 2I5HA 4X64Q 2ES2A 2ZM6L 3HOZG 3FKIH 5C44H 1HNXQ 2PQAA 1SROA 2V1CC 1VQJA 3KF6B 2Q2TA 4B3ML 1Y1VG 2R92G 4L5QA 3TEHB 4C3HH 5IP9G 3KYHC 1ASYA 2KHJA 4HJ8A 4UPAA 4R4QA 1X6OA 1IBMQ 2B29A 1GVPA 4YCVA 3TREA 2A19A 4JI3Q 1L1OA 3S14H 3J7A5 4A3IH 2N3SA 5C4XH 3J81i 1Y1WH 5IP7H 1J6QA 1DGSA 3E0EA 4RG1A 2UUBQ 1IYJB 2RHSB
chains in the Genus database with same CATH superfamily
5J3BA 3RZDB 1SNDA 4GKKL 4MHEA 5ELCA 2WB1B 1N32L 1X9NA 3DM3A 1WD1A 3F2CA 1IBLQ 2UXCQ 4LW1A 4NXNL 3GTGB 3BJUA 2B63B 1FGBD 4R8NA 1WI5A 5DEHA 5IYBH 4LMQD 3J7AF 3U50C 1VQPA 5BR8L 2QGQA 2E5LL 2L5TA 5IGEA 1A62A 2MP1A 4K6LA 1VQIA 4LFCQ 4DK0A 1MKHA 3U58A 5IP9H 2KQ3A 1KIXA 1KABA 3A56A 1VQKA 1CA5A 4XT3B 3M9BA 3R2IA 4FXGC 3BS1A 2M2LA 2XSCA 2HDLA 5IIFA 5M5WH 1JE4A 1VQBA 2ICEC 5E4WC 4POGA 1CI3M 5LMUQ 3HOYB 4DR6Q 3SK6A 4BXXH 2DUDA 2EYHA 4JBJA 1B50A 4OX9Q 4ABNA 1V9PA 4MIUA 3GD7A 2AUKA 4HIDA 2KUMA 1CSPA 4DR1Q 3MFGA 1PH9A 1LTBD 2OF1A 3OWFA 3UI2A 1O7ZA 4OIJA 1Z7TA 3DWPA 1D5ZC 4JYAL 1RHPA 2F52A 4IPGA 3AFQA 5AFWA 4B3SQ 5EKLA 1K28A 4WJ4A 3A7LA 5D65A 1LO5D 1CFMA 1U0LA 2I07B 1BKBA 2LSSA 1BBWA 1TWAB 3L9AX 1VF5C 4A3BG 3TBIB 2JQOA 5KNBA 2K5NA 1FJGQ 3HRZC 2EY6A 1I3QH 4WJ3M 1HR0Q 1UAPA 4B3RQ 1K83B 2AQ1B 4QCLA 3I55A 2JA8G 2JK8A 3F2DA 2B2TA 4G7OC 4IOCA 2ENBA 4KJOA 4C3HG 4ZYSA 1VDZA 2PI2A 1BVSA 4DV7Q 4GNXB 4LWCA 5IGBA 2DNCA 3FPUB 3K5OA 1FNUA 1GUGA 1TU2B 5IODA 4GS3A 1I6HH 1N34L 2EYJA 3S1RB 3UDIA 4HR7B 4JI7Q 2RBMA 1PVOA 1KNEA 5M5YH 4XYOA 1UE6A 4EX5A 3MFYA 3I3CA 2B39A 1A2UA 4J6HA 1PFSA 3PCOB 4OO1I 1GJXA 3TS2A 5AJ3L 4GKJQ 5EJWA 4POFA 1BBUA 2ZXOA 3D0FA 1Q7YC 1XNQQ 2B2YA 3U9OA 4K6DA 4P74A 3SK5A 4JVZA 4DUZL 1MHWC 2F0IA 2MNAA 3KLSX 4R9WA 1F9PA 3RZDH 4B08A 3V2TA 1HXYD 2JA7B 4DNRB 2PW7A 1NAPA 3TP8A 4C3JB 2B63H 4A3DB 2MO0A 5HGTA 3S2HB 2C35B 1STGA 1I5FA 4XQNA 2UXBL 4DV4Q 3H3VI 2BH2A 3URYA 3S2DH 4KY6A 1JMCA 1EY9A 2J4XA 4KN7C 3BDOA 3KLSA 1YI2A 3PO2G 5JEAH 4L5TA 1LM0A 4IO9A 2RCNA 5C4JH 1SJHD 1SNQA 4AYBB 1EU3A 5BN4A 5J22A 1PTOC 2KECA 1U4LA 3A5ZB 2EYMA 3SE0A 1K3BC 2IJ0A 5EPLA 4ZKCB 4QB4A 4GOPC 1EQQA 2LFNA 1PFNA 1CA6A 1WYDA 4LF4L 4A3CH 1EEFD 2XRQD 2F0LA 5I9OA 1VQ5A 1WTWA 3S1NB 4O2DA 4X3SA 2YU9B 4DR5Q 3GTPH 1TWAH 3I73A 3S1QB 4HCEA 3NBHA 4WRDA 1NNXA 1YHBA 5IWAL 5KNCA 2NVQB 1STAA 1QNUA 1JWSD 4LUZA 1K83H 4B9WA 3HOXH 4A3MG 1YHQA 3N52A 2EYLA 4KMUC 2F0KA 1I50H 2K5VA 5IT9L 1I6VC 5DLQE 4A3JG 3A54A 1BR9A 3D4WA 3TN2A 5IGGA 2FHTA 4IPHA 4OELB 2AQ3B 1GUSA 3KDFB 5KRUA 2Y0SE 3A8KE 1F9QA 1IL2A 2ZTDA 4C3IG 4OXPA 5C5MA 2PMZB 1VQMA 2NYZD 4F88A 5J39A 4N9PA 4QIWE 3RN5A 2YTXA 3DLLA 3CXCA 2R7ZB 2HCCA 1EYDA 1XNRQ 3H94A 4Q0FA 3M7NA 4DAVA 1PZKD 1B70B 2F03A 1HNZL 1QZHA 4DR7L 1GKHA 2QA4A 2F0PA 2NN6H 5A2QE 1PFBA 1KAWA 4H13C 5FKAC 1VQGA 4L6TB 2A8VA 5ELEA 4C2MB 1G6PA 1AZQA 1PDQA 2JEAI 1G2TA 3P75A 1MI2A 4RH6A 3B6YA 4B3TL 2NUCA 1HZ9A 4A3KG 4LF5L 2MHVA 2RA4A 3FKIB 2RHQB 1MJCA 2F4VL 3GV3A 5FLMG 1FL0A 2IHEA 1R4QB 4DV5Q 4DUYL 1HNWQ 5KYLA 4C3JH 4DV0Q 2NTSA 1JORA 4FYDA 3AEVA 1I4QA 3LGJA 1EEID 1DCZA 4HJ9A 4UP9A 3L7ZC 5GAHC 1E7ZA 5C4XB 1FVIA 1SMXA 4ALPA 3SDZA 1D6EC 3HKSA 2K52A 4G7ZC 1C4QA 4DNIA 5C4HA 3FVQA 3FEWX 3HOVB 1FNVA 3HOWB 2H1EA 1BQQT 1H9RA 4JBKA 1YITA 1ET9A 4JI1Q 2TSSA 4ZRZA 3NHHA 1G8ZD 1I4PA 2R92B 3K5NA 1P16A 1XYIA 1XPRA 4ILWA 4X3KA 2O5IC 4IUPA 1GHJA 1LABA 5JJZA 5K5PA 4KY7A 4FXDA 1B2TA 1V43A 2E74C 5IYCH 1HH2P 1E22A 3AYHB 5GAEC 4BY7B 1IKMA 1RL2A 1Z9FA 5JOBA 1KLGD 1RTNA 2R93G 5T1IA 5CR3A 2NVQH 1PTOD 4PZ6A 1L1OB 2VY3A 2NBFA 1PFMA 2EVBA 5FK9C 3STBC 3CC4A 4I7AA 3ND8A 1A0IA 3D6WA 3QWNA 1N36L 1ICWA 4DV3Q 2A6EC 1PH5A 4DV6Q 2SNSA 5A35A 2E2DC 2XWJB 4ID6A 3VYTA 5BN5A 1F2MA 4DR2Q 4HSVA 1EY7A 3C1EA 1BCPD 4IFDI 2I0QA 3HGBA 4DAYA 1VQLA 5K36G 2UXDL 1GXDC 3E0JA 2VQFQ 4A3LH 1Q3LA 4FXKC 2R7FA 1FNWA 3T53B 2CCZA 1Y8OB 5C3XA 1NJIC 1I4RA 2R61A 4UP8A 2QDLA 4RMFA 1O7IA 3QOJA 3VYSA 2F0HA 2PNHA 4EQNA 3T1YQ 1EY5A 4RWSC 2R7ZH 3PO3B 1EZ6A 1SMYC 1CM9A 1U9RA 5C3EB 1OXSC 1UE5A 2LY7A 2XTIA 3CD6A 4N9TA 1R9TH 2IWHA 3RLOA 3HKZE 4IUVA 3UE0A 3C2PA 2EOTA 1WTOA 2WB1G 3CQZH 4DAPA 3HOUH 2Z6KC 3VR3A 1F9RA 4C2MH 5I6WA 4A3FB 4IZ8A 1EY6A 1UEBA 4A93B 4HEDA 1IW7C 1EY0A 3R8BA 2G5DA 5M3MB 2ES2A 3FKIH 4PMCA 4OGQC 1PYWD 2VUMB 3DWQA 3TEHB 4F8MA 4K5XA 4C3HH 2EPBA 3S9WA 3H91A 4HJ8A 3G7LA 5C0XH 1GVPA 4YCVA 2A19A 4JI3Q 2DY8A 3J7A5 4A3IH 5C4XH 2B2VC 1J6QA 2PQEA 1LT6D 2F0DA 2UUBQ 1IYJB 5CMDA 3DEOA 4IPDA 3KBGA 1XMOL 3RUZA 2L9HA 4NXML 4KTAA 3SXHA 3J7ZC 3DEPA 4GLVB 1VQFA 3HOWH 4GOPA 4G57A 3I4MG 4ZLTF 5I9PA 2JP1A 2Y0SG 3RR5A 1Y1VH 2AWOA 3K7AB 2R92H 1HUNA 2HCIA 1U5KA 1ESFA 2M9VA 3EJIA 1WOCA 4JC0A 1QOHA 3NPPA 4K8JA 1SN8A 3S16H 2AUJD 3PIOA 4K0KL 3RZOH 1JC7A 1HTLD 5KEEA 3T1HQ 4JV5L 4A3GG 2K4KA 1M8AA 1PA6A 3T56B 1OXTA 3T13A 2XIWA 4CGYB 3GTJH 4OO1H 2F0OA 1JB7A 4BY7H 4HTHA 1LLRD 1Y69U 4HAEA 4OIKA 2Z8LA 1LV9A 2EDGA 4K2KA 5JVH3 4QL5A 1Q1BA 3C3LA 5CV6A 3EVQA 2BCOA 3MAQA 4RGNA 3I4NG 4DV1L 2IPKD 3A5UA 1PRTC 3E6ZX 2C5CA 1DONA 4TKOB 1ZKOA 1HJPA 4X64L 1KDCA 1F2YA 1GUTA 2EXDA 1HNXL 3AMUA 1QILA 4OHJA 1I94Q 2WAQB 1NE3A 3CRLC 3H3VH 4G7HC 3A0JA 1I3QB 5JAVA 2X69A 1ENAA 3CPWA 1IYVA 2K33A 4OWTB 4XTCS 3K6OA 2VL6A 3H0GB 4DFAA 2KVMA 5TSSA 2AQ2B 3PO3H 2CH4A 1EIGA 1X3QA 2CVRA 3HG9A 5C3EH 4C1NK 2WINB 1QJOA 3CMAA 1I4HA 2BH8A 2G9HD 3EN2A 3BZDB 1RD9D 1LT4D 5IOCA 2JA5G 4A3FH 1YNXA 2MQHA 1AZPA 1D7QA 3G6EA 4JI2Q 3C1FA 4A93H 2N49A 4CKCA 5M5YB 4A3DG 1ESRA 3KJOA 1F9SA 2KJXA 4F7XA 1SRUA 1HFGA 2ATWA 1VQ4A 4QUFA 1L0YB 2K5DA 4YHHL 2VUMH 1G291 2F3VA 1IXRA 4O0AA 1RF2D 2EIFA 2ICIA 3NBHB 2RSNA 2F0NA 3J81L 3G71A 3IL8A 1GOZA 2O4XA 1CK1A 2B8FA 4JI0Q 2B2WA 2VW9A 2OTLA 3K7UC 3GTMB 4A3EB 1XXGA 1B44D 1TWCH 1C0AA 1CKOA 1SMYD 4IJHA 4BY1B 4JI8L 1L2FA 2Q2IA 4C3IH 1PH6A 5IGCA 4JI6L 1VS0A 4IUUA 3V05A 4LF7Q 2FXQA 3W1GA 4APVA 1ASZA 2HIVA 2ZTCA 1K0SA 3P20A 5M3FH 3PV0A 4M8AA 4LFAL 1X56A 3CPFA 2LMCB 4ZAIA 1IW7D 1AH9A 1X54A 3PIO3 3S2DB 3K7AH 2B2UC 4X62Q 1FD7D 2E75C 2O2LD 4LF8Q 1SNOA 2UUCL 4DXGA 4ULLA 2K5WA 3TQYA 5C4JB 2KCTA 5T1GA 2GVBA 1WJJA 1W3SA 2EY5A 3F8TA 4LUOA 3MXNA 1K73C 3GTLH 4ZUIA 5HURA 1UUPA 1HTPA 5FJ8G 4AQYL 5EBDA 5I4DA 4ZKBB 4Q5VA 3ZYYX 1EQVA 3HKZG 1YIJA 3BVGA 4LFBQ 1NMFA 2MJ8A 1NTGA 3I91A 4FO2A 3GQBA 3PGZA 1HFNA 5JJKA 3A7AB 4XDXA 2ID0A 5FLXc 2Z4IA 4V190 1N33Q 5CBEE 3GTPB 1QWYA 5JPNC 1F2ZA 5IGDA 3PUXA 1EIFA 2A1AA 1ONLA 2H4OA 2Q8IB 4IOAA 2D0PA 4RHSA 1CQVA 4BBSB 5DM63 5HY6A 3CCVA 2JA6G 2MFIA 1X32A 3HOXB 5JEAJ 1KLUD 2DNEA 1I50B 5KIXA 2I46A 1XMQL 3H0GH 4OL7A 3FMCA 5KGUA 3K5LA 4KD3A 1H9SA 1HPCA 2CFMA 4JPBW 2EQSA 5E4XA 1I4GA 4N8FA 2JEBI 3BZKA 1A6XA 2Z6KA 1LTRD 3CCQA 4X65Q 4PMWA 2JA9A 2PNRC 4KHPQ 1PRTD 5FO9B 2KCNA 1RCVD 3OTOL 4QGUA 3ZJYC 3J80c 4KK7A 1T9HA 1AW7A 1JCKB 5E7NA 4I7ZC 1SAPA 3R2TA 3W3AA 5IGFA 2A74C 2KENA 1J5EL 2QILA 4GN5A 4P73A 1NR4A 3PIPA 1EU4A 4HJ7A 2RCFA 2K7VA 2P5ZX 4LF6L 3GTMH 2VXWA 4A3EH 2D9UA 2CWPA 4BY1H 3OPOA 1X65A 1QE6A 4ME3A 3X3MA 3JAMc 1TY2A 3UE1A 1VQ9A 2IX3A 1KRSA 4X66Q 5CV8A 2PYKA 1VQ7A 5ELBA 1IBKQ 3E3XA 4GLXA 4DAYB 1RIPA 2DJFC 3I72A 2MO1A 3ICEA 4IFDH 2A6HD 2UU9L 2D5DA 3M4QA 1G51A 2ZTEA 4YY3L 2ZJRA 2ALYB 1Y1WB 2OEOA 1S3OA 3IRBA 1BNZA 1HA6A 1EWCA 3DHQA 1TWGB 4X3TA 4HIKA 3QO2A 1WCMB 4A4IA 1GUWA 1E0BA 1SLJA 3ITPA 4KJNA 5FLXE 2E76C 4BBRG 3K59A 2OT2A 3KUPA 1VQDA 1TVXA 5I2XA 1AP0A 4DNTB 1JWUD 4DR3L 1JOKA 1V8QA 5EPKA 3U9SA 3HOZB 1K8MA 3D31A 4KD4A 5EPJA 1K8AC 2Q8TA 2QKIC 4CDDC 4LF9Q 4JI4L 2WB1E 3LWUA 3NTHA 1U4PA 1ZYRD 1BCPC 5CV9A 2E8GA 4IPCA 1O78A 2A73B 2J7ZA 2L55A 5LMNL 4R4CA 1EYAA 2CW0D 5EGTA 2Z1CA 1C9OA 1Y8PB 3VR6A 3QIAA 2EJMA 1WTVA 1CSQA 3HP3A 1S4ZA 4GKKQ 4BBSH 2L1BA 3PUWA 2JXMB 1N32Q 4PNYA 1F77A 4ZQ3A 1YNJD 4BA1I 4NXNQ 2IX0A 2BE5C 2J0TD 4AIMA 3J80E 2F0JA 2EYPA 4EQOA 3L0OA 3PUYA 5BR8Q 1LT5D 2A69D 2E5LQ 2HHHL 4GOPB 3OSOA 4M1UB 4JW0A 4A3GH 1QG7A 1O7YA 2C9OA 1D8LA 1XJVA 1CKNB 2YTYA 2UUAL 5IYDH 2Z9HA 3K81C 3KLRA 5CORA 5C44G 1EYGA 3KF8A 3MVVA 2VQEL 1I4XA 3OMCA 3TP7A 3JAME 1PHJA 2JSOA 3PIP3 3OW2A 3NQIA 3I70A 2Z4HA 4XXEA 1ICFB 1WTHA 4DK3C 3SR1A 1QVFA 1SE4A 2D62A 2RDHA 1Z6HA 4TQUS 4RHRA 1R9TB 4JYAQ 1CTMA 3O13A 1QUQA 1XWEA 2RDFA 3CQZB 4A3BB 3PMFA 3HOUB 1PV4A 5DM73 1PYSB 1MSGA 5IYBG 1B4OA 1AE2A 2I5HA 3RD4A 2ZM6L 2PQAA 1SROA 3BDCA 2Q2TA 4B3ML 1RODA 5IP9G 3KYHC 4C3HB 2KHJA 1SEBD 4R4QA 1A2TA 3BYTB 1A3UA 5CYUA 4IURA 4ZUJA 2PZUA 2N3SA 4A3IB 1Y1WH 5IP7H 1DGSA 4V0BA 4RG1A 1XPUA 4BXXG 1TWGH 3ERSX 4S3SA 1WCMH 5BN3A 3L2PA 1CT1D 1WD0A 4JOIC 2QW7A 4HN7A 4JK1C 1WFQA 3HOZH 1LYLA 4FF2A 1VQ6A 4DV2L 2F3IA 3FDTA 4L63B 3BVZA 4JI5L 1Y1VB 1DOMA 1Q8IA 3D4DA 4HMJA 5AJ3Q 1VQEA 3RNUA 3S16B 4A75A 1II3A 2KOLA 3RZOB 1IHZA 2F0FA 3F2UA 2WAQG 1A15A 1TT2A 4YWKA 4DUZQ 3GTJB 3TMEA 2EY1A 3K57A 4HIOA 2E2JB 4NW2A 5C0XJ 4AYBE 2IHFA 1STYA 2EJGC 2MGSA 2LS01 4IUNA 4H0LC 2R7DA 5C6AA 4MZ9A 2Z6BA 1M1KC 3PO2B 4CDCC 4PMBA 5ELNA 2UXBQ 1HQMC 5DAUA 3RN2A 4JBWA 3BZCA 3PSIA 1KDAA 2XWBB 1LTLA 2JYOA 3MHBA 4HJ5A 5FOBB 1H95A 1S5ED 3I4LA 2A5HA 4YIJA 3P1HA 1HCZA 2WIIB 2XVSA 1VQNA 3CCLA 3HFZB 4B9XA 1NR2A 1IBML 1HZCA 3NTKA 3WDNA 3PUZA 2X6LA 4K8IA 1AFPA 3FHWA 3MXNB 1OO9B 4DK6C 1S5DD 4P75A 4E6IA 5KYIA 3I4OA 3A74A 1S72A 4OWWB 2N88A 3GTKH 1IBLL 2UXCL 4LF4Q 2VB3X 5I2YA 4PV1C 2BE5D 5CC4A 2CH4W 1W6KA 3NXWA 4A3BH 3F1ZA 1BDOA 1B8AA 1CKMA 4L8JA 4OONA 4LFCL 4HIMA 2IY5B 2B63G 3PF4A 2OTJA 3AQQA 3NWTA 2JA6H 1X3EA 4DU9A 5JJLA 2K50A 2L15A 3OHXC 5G3LF 2JA8H 3NSWA 2PMZE 4CDFC 5IWAQ 2NVYH 1C48A 2KA7A 4A3JB 1E2VA 2QEXA 1TQOA 5JEAG 4QJFA 5LMUL 4DR6L 3V96A 4CDEC 1Q46A 2L12A 3GV6A 4P72A 1K8GA 4OX9L 4EVOA 3ONAB 4FF3A 3G6JB 1Q86C 1TS5A 3E5SA 1TWCB 3HOYG 2QEJC 4IALA 4DR1L 3GTOB 4C3IB 1ILPA 5LL6X 4H44C 4P71A 4CKBA 4GN3B 1H9SB 4B3SL 3J80i 4KKTA 1KDBA 5DNFA 2PZTA 1OXVA 4N8X1 5M3FB 4A3CG 2SDFA 1J9OA 1V1OA 1CHQD 4CHTB 1TXYA 1QZGA 1QNKA 1B7YB 2YYZA 4DA2A 5JJIA 4QQBX 2NVXH 2B2YC 1MBYA 2NVTB 4U68A 3T16A 2FINB 3DUZA 1FJGL 1VCIA 4K5VA 3Q22A 2NZHA 4J8QA 1HR0L 1Q1EA 4B3RL 2WV6D 4R4OA 1HNZQ 4DR7Q 4HMIA 3IFTA 3JAMi 4TVAB 3FRPB 4H7BA 3GTLB 4KKUA 5A2QL 1E3PA 3HOXG 4DV7L 3TP6A 4K5WA 1EZ8A 2E2JH 4B3TQ 1X3GA 4U673 2MPMA 3MTSA 4RKLA 1EL0A 4LF5Q 1BOSA 3KFUA 3MXPA 1X3PA 5GROA 2F4VQ 1FR3A 1WTXA 3BG3A 3QB3A 4DUYQ 4JI7L 1Y14B 2YV5A 5IT9c 1LUZA 5LMNW 3PO2H 1KC8C 2QF7A 1TS2A 1SBBB 4QUCA 1PH7A 2CHBD 1LTSD 3QOLA 1LT3D 2GA4B 3L3OC 1AEXA 5CV4A 3GP7A 4BWGB 4GKJL 1H9JA 1TWHB 2CQAA 1SSOA 5FO7B 1XNQL 1GD7A 3NEMA 4KY5A 5C3WA 1DJRD 1A8VA 4C1NI 1IKLA 2AMCB 3IAYA 1W2BA 2PPBC 1O80A 2NN6G 1X55A 4KHVA 1SYDA 1Q8KA 2F0VA 3TDQA 1A63A 1EUJA 1K3RA 2OXPA 3S24A 2RKSA 3CW2C 3EIVA 4HJAA 3JC66 3TRZA 3A55A 2JA7G 3S1MB 4DV4L 4WJWA 4UP7A 5COYA 2F0MA 1PZJD 4C3JG 2A6HC 2JE6I 1GUNA 3ER0A 3K80C 1VQ8A 3J81j 4BA2I 4A3MH 1PH4A 3CKIB 2LKVA 1D1IA 3OOCA 3ULJA 4A3JH 2FFKB 3W2DA 1SE3A 3M3YB 1N36Q 1TY0A 4QY7A 4CJ0B 4AYBG 1EQRA 2SNMA 3GTOH 3N6RA 4JOIA 3ERQA 1QCBD 2NTTA 3NUCA 1YNND 1H9MA 1ILQA 1ZYRC 2UXDQ 2F0WA 1DD2A 4UDUC 4NPSA 1B3AA 4UHVA 3RLFA 1KNAA 1JOQA 5C4ZA 1EIYB 2VB2X 3TZUA 2KHIA 4DR5L 1YEZA 4CJ2C 3S14B 3ND9A 2K04A 3QR8A 2CW0C 2QCPX 4RGMA 1C7YA 1J8IA 3KOJA 1V1QA 2JN4A 3KF8B 4PZ8A 1VMPA 5IYCG 2NVTH 4YWMA 1YJ9A 2BOSA 2F0TA 4QMGA 1KXLA 2A68C 3G48A 1ZEQX 3LWEA 5IT9E 2FMCA 1RDPD 2K03A 4PZ7A 2RSOA 3S15B 4J15A 1UWVA 5GADC 2CKZB 4MTKA 1E2WA 3CP0A 2F0GA 4A3KH 1YNJC 1NUCA 2R3ZA 4QF4A 4NP5A 1KAAA 5FLMH 5E1FA 4RAUC 4DPGA 4C56C 2A69C 1QUQB 2O5JC 3GDEA 2KEEA 2PI2E 1WTQA 1EY8A 1EOVA 3ULPA 4FF1A 4ODGA 1MIUA 3SGIA 4Y52H 3HS0C 4LNQA 2PZWA 3H15A 3I2ZA 2PQAB 4YWLA 3CAMA 4A3LG 2K75A 3M4PA 1DXMA 2XNAC 3W5OA 5JPMC 1RKNA 3VA5A 1VQCA 2OQ0A 4GNXC 1SE2A 1XNRL 1PH1A 4GLAC 4IFDJ 3PQIA 3TS0A 1XMOQ 3I4MB 1TWHH 3WOEA 1GM5A 3GO5A 4NXMQ 1ML0D 4YCUA 2R7ZG 3U4VA 2Y0SB 3HZXA 2N55A 2FJ2A 3G4SA 2PCFB 2DGYA 1EYCA 1HQRD 4DR4Q 4PG3A 1IYUA 2QDBA 5C0XI 2KEDA 3VDYA 4QIWB 1XTDA 2WKDA 3HOUG 1YVCA 1SYGA 1RTOA 4A3GB 4DV5L 1HNWL 4CBVA 2VS1A 4DV0L 3K0YA 1AE3A 1L0XB 3OMGA 1PH8A 3E9IA 1PLFA 3D4RA 3S1MH 3FKIG 3HEJA 3P7JA 4K0KQ 1SNCA 4JV5Q 2CWAA 2NZOA 2M00A 2R93H 2N78A 3DM1A 4AH6A 4UY8C 3BU2A 3EA6A 5C0XG 3NENA 2WAQE 2OWOA 3CCRA 1STBA 2H5XA 2HQEA 4A3IG 3I4NB 5C4XG 3J7YW 2Q8RE 4O42A 4XT1B 2ZT9C 2B2VA 4DAMA 3VYRA 3M3YH 4K2LA 4DXFA 1SYCA 2ZJPA 1UE7A 3LNNA 4ZK9B 4JI1L 3H6MA 2WFWA 4G4KA 5K36H 1ENCA 4DV1Q 1EFID 3HOVG 1TKWB 3MC0B 3HOWG 3MZ5A 1BO0A 4X64Q 1PXUA 1HNXQ 2F0SA 1Y1VG 2R92G 4L5QA 2EYOA 3DWAA 3NQTA 3MXUA 3IKJA 1H9KA 1B9MA 1X6OA 2B29A 3TREA 5CBAE 5EQ0A 3NE5B 3S14H 4NMZA 1BF4A 3I8ZA 2HUGA 3MXGA 2V4DA 3E0EA 4RCOA 5E3FA 2RHSB 1LTGD 5F2DA 1QVGA 3Q0AA 4OO1G 3S15H 4BY7G 2KCMA 2JA5B 3PF5A 3GTGH 4DV3L 1TS3A 2K5QA 1VMCA 4DV6L 1UEAB 4DN4M 2N8NA 3GTQB 2X6GA 5H1SE 2L11A 3D6CA 4DR2L 3U4ZA 4TSSA 4MNOA 3EQLC 3NK9A 2AKWB 2PW5A 2G9DA 4RKBA 2VQFL 1DOLA 4FNFA 1HR0W 1ET6A 2LXJA 4YHHQ 3CRKC 4XQQA 2DJGC 3HOYH 5IE8A 1OXUA 1SNPA 1U4MA 1VQHA 3T1YL 1X3FA 1CZWA 2E2HB 2A68D 4JI8Q 2HT1A 4JI6Q 1KL9A 3K8AA 2F0EA 3I4MH 4A76A 3PO3G 1IZ6A 3CHBD 3F2BA 1PTOB 2ASBA 1EOTA 5C3EG 4LUVA 1PH2A 4NDXA 4FVMA 1EY4A 4LFAQ 3TP5A 5EKKA 1KHIA 3KF6A 1DM0B 3VR5A 5HGQA 1V1PA 2HIXA 4DKAC 3NP8A 3Q24A 2WKCA 4A3FG 4MTNA 3WWVA 4A93G 1BCPB 2UUCQ 2VZAA 1G2SA 4KI0A 5EKIA 1S40A 2Q2UA 1L0WA 5M3MG 4JBMA 1SNMA 3TSSA 2I5LX 1QVCA 3I90A 2LXKA 2VUMG 2IW3A 3RMHA 1PTOF 3HKZB 4JI3L 3Q23A 1NSNS 2SOBA 5C5LA 3H09A 4GZYC 4ME5A 1D5MC 3M85A 3E9HA 2UUBL 4AQYQ 1Q90A 3EFXD 4EQPA 1JOOA 1R4PB 5ELDA 1S5FD 5M9OA 2L0CA 3CCEA 2GVAA 2RVLA 3I4NH 1P8LA 1EFWA 3GTKB 3J81c 3S1RH 3VR4A 5ELOA 1BCPF 2B8GA 4R8IA 3S17B 3VA7A 3WOFA 3J7AV 2EXZA 3UDXA 1LTID 1PZID 1Y8NB 3MEHA 1K0RA 5M3FG 2I5MX 1K9MC 2JA6B 1CQFA 4HSPA 2AWNA 1E24A 1T5XD 2JA8B 3UDGA 3BVMA 4GN4B 3UDFA 2NVYB 3T1HL 3CU7A 4LJZC 4RGOS 2B2UA 3PUVA 1A3TA 4JG2A 1FGUA 1KD1C 3CC2A 1NCVA 1TIID 4IUTA 2HDMA 4XYQA 3CCUA 1JJ2A 3KJPA 5GQOA 1XMQQ 1B9NA 2NWGA 2OQKA 3M4OB 3I56A 1AN8A 1GUOA 5ELFA 3ULLA 2VNUD 2JA7H 2KHSA 5D3DA 2GN5A 1SFOB 2JA5H 5ISRA 1STNA 2KCCA 3R3OA 3R93A 5KNDA 4A3DH 3SVMA 1N34Q 3S2HH 3GTQH 4XIGS 1G6ZA 2K01A 1Z47A 2F3WA 1T5EA 3CCMA 1SE8A 3CCSA 2IT1A 1DZ1A 3OTOQ 4IUQA 2Q2HA 1MJEA 3NWSA 2K5HA 1S5BD 2NVXB 3DMUA 2B2WC 1CUKA 1STHA 1WVLA 1I94L 3OW7A 4H02A 1D2BA 1KRTA 1L1OC 4BS9A 1J5EQ 4LK1C 4GNXA 1JE5A 2CQOA 4L5RC 1E2ZA 2OCEA 2DN8A 4LF6Q 1JJCB 4CJ1B 2E2HH 4DF7A 1TWFB 4IJLA 3SK4A 1B3QA 1CHPD 2XGTA 3H0GG 1DOKA 3M7GA 2WP8J 1WTRA 1PTOH 2F1MA 2TMPA 4OEMB 3H3VC 4FP5D 1NY4A 1OXXK 1NBWA 1BUVT 1LACA 1RJTA 1KQSA 1HRJA 4JI2L 1EQTA 3S1NH 2YU9H 2UU9Q 3S1QH 3FPPA 1DYQA 4YY3Q 3DXJC 2BA0A 3D8GA 5JVG3 4WFN3 1UNSA 4BBRB 4DGZA 3CF5A 3J81E 1HHVA 4KN4C 2ZXRA 1GO3E 1N9WA 3EBEA 4ZCKA 4R1JA 4P2CB 5I6YA 5FJ8H 4JI0L 4L5SA 1LTAD 3BYYB 1YJWA 4NB3A 4DR3Q 1JB3A 3OIQA 5FLXL 4X6AH 1IL8A 1EWHA 1HZAA 1HUMA 4LF7L 4JI4Q 3NBIA 4A3EG 1N8RC 2E2IB 5IY0A 3AU7A 3RLNA 3QJYA 1VQOA 4BY1G 1YNNC 4J1MA 4O1NA 1MGSA 3S17H 2EY2A 1JJGA 3M4YA 1O7LA 2HQLA 3TZDA 3D3RA 3OWEB 5LMNQ 3BDLA 4X62L 5EAYA 4KKSA 4LF8L 1SXTA 1SR3A 4IFDG 4A3MB 1PMRA 2XRSD 2B2TC 5J1ZA 1SYBA 2DY7A 3KLWA 3EROA 1UE1A 2PO4A 2BDOA 3CCJA 1BXTA 4RCNA 1WTPA 2MUYA 1PH3A 5CV5A 1EIHA 4Y7NB 3Q6SA 5GAGC 2RF4A 4RFBA 2K28A 5M5XB 2D2CC 1E1OA 3KK7A 1Q82C 2HHHQ 3M4OH 3OYYA 4LFBL 3J80L 1JICA 5EBCA 1Q81C 1TR5A 1SYFA 5C44B 1SFOH 4EQ5A 4R4TA 2R6GA 3T4AC 2RQXA 2K32A 2UUAQ 1JR0D 3QG1A 5NUCA 2KBNA 3MWYW 2VQEQ 1N33L 1SYEA 4LAAA 1MSHA 1LTTD 3I7FA 4IQZA 1M4VA 2BA1A 2ZXPA 1YBYA 3JAML 2AHOB 4HCSA 1B1ZA 4MN3A 2ZJQA 2RDGA 2XN9C 5FO8B 1QB5D 3HOVH 5L37A 2JJQA 3VR2A 4X3UA 4A3KB 4BBSG 5D3IB 3KDFA 4IN3A 3CC7A 4DR4L 2EE1A 1TWFH 1CKNA 1PYBA 2F4IA 3LX0A 1G91A 1A3VA 5D14A 3SEBA 5LHY1 2FMMA 3CMEA 3OIPA 4DK1A 4RA8A 2IX1A 2ZM6Q 4X65L 1YHAA 1GHKA 4B3MQ 3FP9A 2EZVA 5M5WB 1OTCA 4KHPL 4EGVA 3K58A 4NKLA 1M90C 4FDBA 1C8CA 3NELA 5IYDG 1ZXTA 4TRDA 2NN6I 3NTIA 2IL8A 1VF7A 4BBRH 1JQYD 2B3GA 1EWIA 4JCVE 1BBXC 1SDFA 1ENFA 1U4RA 4UAIA 2K05A 3A8JE 3AB9A 2F0UA 3W1BA 1HA5A 4R4IA 4I65A 1KTKA 3MEFA 1F2LA 1Q12A 1XTCD 1NMGA 3T51B 1VQAA 2Z0SA 4K14A 3SK8A 4DV2Q 3AFPA 1D5XC 2L4NA 4JI5Q 2WACA 4XQJA 1E1TA 2E2IH 1HZBA 4KLKA 4X66L 3Q8DA 2D0OA 2NB0A 3IFDA 1IBKL 5CGKA 1JT8A 4WORA 5G3LD 5CV7A 2R93B 1PRTB 3X3NA 1D1KA 2NZ1D 4FF4A 2BDNA 2K6AA 3A8IE 1B53A 3STBD 3C46A 1YJNA 4KV6A 2YTVA 4KHZA 1Y1WG 5IP7G 1FYCA 2K14A 2A6ED 1I6HB 3VYUA 4PQXA 4OWXB 2SEBD 2HD3A 4Y7NH 1WCMG 2K1BA 1XPOA 1STEA 5M5XH 3K0XA 1YZ6A 4LF9L 4YCWA 1K8OA 4RGTA 1CZGA 5M3MH 1PRTF 1MD2D 3HOZG 4CKEA 5C44H 1W6JA 1TS4A 2V1CC 1VQJA 3KF6B 3MA2B 1V1PB 2EYFA 4Z9CB 1ASYA 1JWMD 1XX8A 3SHLA 4UPAA 2F0QA 1IBMQ 1L1OA 3KBXA 3K5MA 2EJFC 4F87A 3J81i 5LL6S 1S5CD 1SJED
chains in the Genus database with same CATH topology
4IPDA 5J3BA 1TWGH 1XMOL 3ERSX 4GKKL 1QVGA 4NXML 4OO1G 1X9NA 1N32L 3S15H 1WCMH 4BY7G 2KCMA 3DM3A 3J7ZC 3L2PA 3PF5A 3F2CA 4JOIC 1IBLQ 4LW1A 4GLVB 4DV3L 4NXNL 3GTGH 2UXCQ 3BJUA 1VQFA 3HOWH 4GOPA 1WI5A 4DV6L 2N8NA 3I4MG 5IYBH 3U50C 1WFQA 5H1SE 1VQPA 3HOZH 5BR8L 1LYLA 2QGQA 1VQ6A 4DR2L 3U4ZA 4DV2L 2F3IA 2E5LL 4MNOA 1A62A 2Y0SG 1VQIA 3RR5A 4LFCQ 1MKHA 1Y1VH 2AWOA 2AKWB 4JI5L 3U58A 2R92H 4BXXG 5IP9H 1U5KA 1KIXA 1VQKA 1WOCA 4JC0A 2VQFL 3M9BA 1SN8A 1HR0W 2LXJA 4YHHQ 5AJ3Q 1VQEA 3S16H 5M5WH 3PIOA 3RNUA 4K0KL 4A75A 3RZOH 3T1HQ 1VQBA 1OXUA 5IE8A 4POGA 3HOYH 5LMUQ 2K4KA 1PA6A 4A3GG 4DR6Q 4BXXH 2WAQG 1VQHA 1OXTA 2DUDA 3T1YL 4JBJA 4YWKA 4OX9Q 1X3FA 3GTJH 1JB7A 1V9PA 4DUZQ 3GD7A 4BY7H 4HIDA 1CSPA 4DR1Q 4JI8Q 4HIOA 1PH9A 5C0XJ 2HT1A 4JI6Q 1KL9A 3K8AA 4AYBE 2IHFA 3I4MH 4A76A 3PO3G 4JYAL 1IZ6A 2F52A 2R7DA 4QL5A 4IPGA 3F2BA 3AFQA 4MZ9A 1Q1BA 2ASBA 4B3SQ 5C3EG 4LUVA 1M1KC 4WJ4A 1PH2A 3I4NG 4DV1L 5ELNA 4LFAQ 1U0LA 3A5UA 2UXBQ 1KHIA 3KF6A 3RN2A 1BKBA 5HGQA 2LSSA 2HIXA 4JBWA 1BBWA 4X64L 1HJPA 3BZCA 3PSIA 4DKAC 4A3BG 2EXDA 1HNXL 4A3FG 1LTLA 4MTNA 3WWVA 4A93G 2JQOA 4HJ5A 1I94Q 1H95A 2UUCQ 2VZAA 4KI0A 2K5NA 1FJGQ 1S40A 1NE3A 1L0WA 2Q2UA 3H3VH 1I3QH 5M3MG 3A0JA 1HR0Q 4WJ3M 4B3RQ 4JBMA 1VQNA 3CCLA 3HFZB 2I5LX 1QVCA 3I55A 2JA8G 2JK8A 2LXKA 1IBML 3F2DA 1HZCA 3CPWA 2VUMG 4JI3L 4OWTB 4XTCS 4IOCA 3PUZA 2VL6A 2PI2A 3M85A 3E9HA 2UUBL 3PO3H 1BVSA 4DV7Q 3FHWA 3MXNB 4GNXB 4AQYQ 4LWCA 4DK6C 4P75A 5C3EH 3CCEA 2GVAA 3I4OA 3A74A 1S72A 4OWWB 3GTKH 3I4NH 1IBLL 2UXCL 1P8LA 3CMAA 1EFWA 3J81c 4GS3A 4LF4Q 1I6HH 3S1RH 2BH8A 3EN2A 5ELOA 1N34L 3UDIA 4JI7Q 4OO1I 4A3BH 2JA5G 1PVOA 3F1ZA 4A3FH 1YNXA 2MQHA 1D7QA 3G6EA 4JI2Q 4A93H 3UDXA 1B8AA 1CKMA 2N49A 4OONA 4LFCL 5M5YH 4HIMA 2IY5B 2B63G 3PF4A 4A3DG 1UE6A 4EX5A 2OTJA 3AQQA 3KJOA 1K0RA 5M3FG 2I5MX 1K9MC 1X3EA 2JA6H 1SRUA 2ATWA 1VQ4A 5JJLA 2K50A 2L15A 2JA8H 2AWNA 1E24A 1PFSA 2PMZE 3PCOB 1G291 4YHHL 2VUMH 3TS2A 1IXRA 4O0AA 5AJ3L 5IWAQ 2NVYH 3UDGA 4GKJQ 2EIFA 4GN4B 3NBHB 3UDFA 2QEXA 4POFA 3T1HL 5JEAG 1BBUA 3D0FA 4QJFA 3PUVA 5LMUL 1Q7YC 4DR6L 1XNQQ 3G71A 1Q46A 4JG2A 1FGUA 1KD1C 3CC2A 2VW9A 4P72A 1K8GA 2OTLA 4JI0Q 4P74A 4OX9L 3CCUA 3K7UC 4DUZL 1Q86C 1TWCH 1JJ2A 1C0AA 2MNAA 3KJPA 5GQOA 1XMQQ 1CKOA 4IJHA 3HOYG 4DR1L 4JI8L 1L2FA 2Q2IA 2OQKA 4C3IH 1PH6A 4JI6L 1VS0A 3I56A 3RZDH 3ULLA 2VNUD 4LF7Q 2FXQA 2JA7H 2GN5A 3W1GA 2JA5H 4P71A 4APVA 1ASZA 2HIVA 2ZTCA 4GN3B 4B3SL 3J80i 2B63H 4A3DH 1N34Q 3S2HH 2MO0A 3GTQH 5M3FH 3PV0A 2C35B 4XIGS 1OXVA 4A3CG 1I5FA 4LFAL 1X56A 3CPFA 1Z47A 4DV4Q 2UXBL 3H3VI 2BH2A 1QZGA 1TXYA 3CCMA 1SE8A 3CCSA 3S2DH 1AH9A 2IT1A 1B7YB 1X54A 2YYZA 1JMCA 3K7AH 3OTOQ 1YI2A 4X62Q 3PO2G 4QQBX 2Q2HA 1MJEA 5JJIA 2K5HA 2NVXH 4L5TA 1LM0A 4LF8Q 1CUKA 4IO9A 1I94L 2UUCL 2RCNA 4H02A 1KRTA 1L1OC 1FJGL 1VCIA 5C4JH 3TQYA 2NZHA 1HR0L 2KCTA 1Q1EA 4B3RL 2GVBA 4R4OA 1HNZQ 4DR7Q 1WJJA 1W3SA 1J5EQ 3F8TA 4LUOA 4GNXA 3JAMi 4TVAB 1K73C 1JE5A 3A5ZB 2CQOA 3GTLH 4L5RC 2OCEA 4LF6Q 1JJCB 2E2HH 1E3PA 4IJLA 5FJ8G 3HOXG 4DV7L 4AQYL 4GOPC 2E2JH 4B3TQ 1EQQA 1X3GA 3HKZG 1YIJA 4LFBQ 1NMFA 1NTGA 2XGTA 3H0GG 1WYDA 4LF5Q 4LF4L 4A3CH 3KFUA 5GROA 2WP8J 2F4VQ 3PGZA 1VQ5A 4DUYQ 4JI7L 1Y14B 1NY4A 1OXXK 1NBWA 2YV5A 1LUZA 5IT9c 5LMNW 3PO2H 5JJKA 1KC8C 1KQSA 2ID0A 5FLXc 4JI2L 3S1NH 2YU9H 2UU9Q 4O2DA 1PH7A 3S1QH 4DR5Q 3GTPH 1N33Q 1TWAH 4YY3Q 2BA0A 3CF5A 1YHBA 1EIFA 2A1AA 3PUXA 5IWAL 4GKJL 4IOAA 2D0PA 1GO3E 1N9WA 3EBEA 3CCVA 5HY6A 4R1JA 1XNQL 1GD7A 3NEMA 4LUZA 1K83H 2MFIA 3HOXH 5FJ8H 4A3MG 1YHQA 2JA6G 4JI0L 5JEAJ 1I50H 4L5SA 1A8VA 2K5VA 1YJWA 2AMCB 4NB3A 5DLQE 4A3JG 1W2BA 4DR3Q 1XMQL 3H0GH 4X6AH 2NN6G 1X55A 2CFMA 2EQSA 4JV5L 1HZAA 1Q8KA 4IPHA 2JEBI 3BZKA 4JI4Q 4LF7L 1A63A 4A3EG 1EUJA 1K3RA 1N8RC 3KDFB 3S24A 2Y0SE 3CW2C 3EIVA 2Z6KA 3RLNA 5IY0A 4HJAA 4BY1G 1VQOA 3CCQA 1IL2A 4X65Q 2ZTDA 3JC66 4PMWA 4OXPA 2JA9A 3S17H 3TRZA 1JJGA 1VQMA 4KHPQ 2JA7G 2HQLA 4DV4L 5LMNQ 4UP7A 3OTOL 4QIWE 4QGUA 4X62L 5EAYA 3ZJYC 3RN5A 2YTXA 2JE6I 3J80c 3ER0A 3K80C 1VQ8A 4LF8L 3J81j 1SR3A 3DLLA 1T9HA 3CXCA 4A3MH 1PH4A 4BA2I 4IFDG 5E7NA 1XNRQ 3M7NA 3KLWA 1B70B 3ULJA 4A3JH 1QZHA 1UE1A 1HNZL 4DR7L 2KENA 1GKHA 2QA4A 1J5EL 4GN5A 4P73A 3PIPA 4HJ7A 3CCJA 1N36Q 4QY7A 1KAWA 1PH3A 1VQGA 4LF6L 2A8VA 3GTMH 4AYBG 4A3EH 5GAGC 2RF4A 1G6PA 1EQRA 2CWPA 2JEAI 3GTOH 4BY1H 4B3TL 3B6YA 1E1OA 4JOIA 1X65A 4ME3A 3JAMc 1Q82C 2HHHQ 3OYYA 3M4OH 4LFBL 1HZ9A 3UE1A 4A3KG 1VQ9A 1Q81C 4LF5L 1SFOH 2RHQB 1MJCA 4EQ5A 2F4VL 5FLMG 1FL0A 1KRSA 2IHEA 4DV5Q 4X66Q 4R4TA 2R6GA 4DUYL 1HNWQ 2UXDQ 4C3JH 1VQ7A 4DV0Q 2UUAQ 1IBKQ 4NPSA 4GLXA 3RLFA 4DAYB 1RIPA 1EIYB 2MO1A 3AEVA 3ICEA 2UU9L 2KHIA 3LGJA 2KBNA 2VQEQ 4DR5L 1YEZA 1N33L 3M4QA 1G51A 4UP9A 4HJ9A 2ZTEA 3L7ZC 4YY3L 5GAHC 2ZJRA 2ALYB 1E7ZA 3I7FA 1FVIA 1C7YA 1SMXA 1S3OA 3KOJA 2BA1A 3IRBA 4ALPA 1V1QA 3KF8B 4PZ8A 5IYCG 2NVTH 1YBYA 2AHOB 4YWMA 1YJ9A 1KXLA 3G48A 3HKSA 2K52A 4PZ7A 4HIKA 2ZJQA 4A4IA 1SLJA 4J15A 4DNIA 1UWVA 4BBRG 2CKZB 5GADC 3HOVH 1VQDA 2JJQA 3CP0A 4DR3L 4A3KH 4JBKA 4BBSG 3KDFA 4JI1Q 3CC7A 1YITA 4DR4L 1TWFH 1CKNA 1PYBA 5FLMH 3D31A 4DPGA 1K8AC 3CMEA 4LF9Q 4JI4L 2WB1E 1QUQB 1P16A 3GDEA 1XPRA 2PI2E 2IX1A 2ZM6Q 1EOVA 2E8GA 4X65L 4IPCA 1YHAA 3ULPA 4B3MQ 1MIUA 3SGIA 3FP9A 1OTCA 4KHPL 4Y52H 4LNQA 1V43A 3H15A 5LMNL 3I2ZA 2PQAB 4YWLA 3CAMA 4R4CA 2K75A 5IYCH 1M90C 3M4PA 4A3LG 4FDBA 1HH2P 3NELA 3W5OA 5IYDG 1E22A 2NN6I 3AYHB 1VQCA 1C9OA 5GAEC 2OQ0A 1RL2A 1Z9FA 4GNXC 4BBRH 1XNRL 2B3GA 1EWIA 4JCVE 1PH1A 4GLAC 1XPUA 4IFDJ 2R93G 1CSQA 3TS0A 2NVQH 4PZ6A 1L1OB 1XMOQ 1TWHH 1GM5A 2VY3A 3GO5A 4GKKQ 4BBSH 4NXMQ 3PUWA 3STBC 3CC4A 1N32Q 4YCUA 2R7ZG 1A0IA 3U4VA 3W1BA 1N36L 4BA1I 4DV3Q 4NXNQ 4R4IA 2IX0A 1PH5A 4AIMA 4DV6Q 3MEFA 3G4SA 3L0OA 1Q12A 2DGYA 3PUYA 1NMGA 5BR8Q 4DR2Q 1VQAA 2Z0SA 4DV2Q 2E5LQ 2HHHL 3AFPA 4DR4Q 4PG3A 5C0XI 4GOPB 4IFDI 3VDYA 4JI5Q 2I0QA 1XTDA 1E1TA 3HOUG 1YVCA 2E2IH 1VQLA 4A3GH 5K36G 1HZBA 4KLKA 4DV5L 1D8LA 4X66L 2UXDL 2VQFQ 1XJVA 1CKNB 2YTYA 4A3LH 3Q8DA 1HNWL 2VS1A 2D0OA 4DV0L 1PH8A 1AE3A 2R7FA 1IBKL 2UUAL 5IYDH 3E9IA 3K81C 2CCZA 3S1MH 1NJIC 3FKIG 5C44G 4K0KQ 4JV5Q 4UP8A 2CWAA 2NZOA 4RMFA 2VQEL 1O7IA 1EYGA 1JT8A 2R93H 2N78A 2PNHA 1PHJA 3T1YQ 4AH6A 3OW2A 4UY8C 3BU2A 5C0XG 2R7ZH 3NENA 2WAQE 2OWOA 3CCRA 3STBD 4DK3C 2H5XA 1YJNA 1QVFA 1OXSC 4A3IG 2D62A 5C4XG 2YTVA 4KHZA 1UE5A 2XTIA 5IP7G 1Y1WG 4TQUS 3CD6A 2K14A 1R9TH 3RLOA 3HKZE 3UE0A 4JYAQ 3M3YH 4DAMA 4OWXB 1QUQA 2WB1G 1UE7A 4Y7NH 3CQZH 2ZJPA 4JI1L 3HOUH 1WCMG 2Z6KC 2WFWA 4C2MH 1XPOA 5M5XH 1PV4A 1UEBA 3K0XA 1YZ6A 4DV1Q 4LF9L 3HOVG 4YCWA 3HOWG 1PYSB 5M3MH 5IYBG 1AE2A 2I5HA 4X64Q 2ES2A 2ZM6L 3HOZG 3FKIH 5C44H 1HNXQ 2PQAA 1SROA 2V1CC 1VQJA 3KF6B 2Q2TA 4B3ML 1Y1VG 2R92G 4L5QA 3TEHB 4C3HH 5IP9G 3KYHC 1ASYA 2KHJA 4HJ8A 4UPAA 4R4QA 1X6OA 1IBMQ 2B29A 1GVPA 4YCVA 3TREA 2A19A 4JI3Q 1L1OA 3S14H 3J7A5 4A3IH 2N3SA 5C4XH 3J81i 1Y1WH 5IP7H 1J6QA 1DGSA 3E0EA 4RG1A 2UUBQ 1IYJB 2RHSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPD A;  5J3B A;  1TWG H;  1XMO L;  3ERS X;  4GKK L;  1QVG A;  4NXM L;  4OO1 G;  1X9N A;  1N32 L;  3S15 H;  1WCM H;  4BY7 G;  2KCM A;  3DM3 A;  3J7Z C;  3L2P A;  3PF5 A;  3F2C A;  4JOI C;  1IBL Q;  4LW1 A;  4GLV B;  4DV3 L;  4NXN L;  3GTG H;  2UXC Q;  3BJU A;  1VQF A;  3HOW H;  4GOP A;  1WI5 A;  4DV6 L;  2N8N A;  3I4M G;  5IYB H;  3U50 C;  1WFQ A;  5H1S E;  1VQP A;  3HOZ H;  5BR8 L;  1LYL A;  2QGQ A;  1VQ6 A;  4DR2 L;  3U4Z A;  4DV2 L;  2F3I A;  2E5L L;  4MNO A;  1A62 A;  2Y0S G;  1VQI A;  3RR5 A;  4LFC Q;  1MKH A;  1Y1V H;  2AWO A;  2AKW B;  4JI5 L;  3U58 A;  2R92 H;  4BXX G;  5IP9 H;  1U5K A;  1KIX A;  1VQK A;  1WOC A;  4JC0 A;  2VQF L;  3M9B A;  1SN8 A;  1HR0 W;  2LXJ A;  4YHH Q;  5AJ3 Q;  1VQE A;  3S16 H;  5M5W H;  3PIO A;  3RNU A;  4K0K L;  4A75 A;  3RZO H;  3T1H Q;  1VQB A;  1OXU A;  5IE8 A;  4POG A;  3HOY H;  5LMU Q;  2K4K A;  1PA6 A;  4A3G G;  4DR6 Q;  4BXX H;  2WAQ G;  1VQH A;  1OXT A;  2DUD A;  3T1Y L;  4JBJ A;  4YWK A;  4OX9 Q;  1X3F A;  3GTJ H;  1JB7 A;  1V9P A;  4DUZ Q;  3GD7 A;  4BY7 H;  4HID A;  1CSP A;  4DR1 Q;  4JI8 Q;  4HIO A;  1PH9 A;  5C0X J;  2HT1 A;  4JI6 Q;  1KL9 A;  3K8A A;  4AYB E;  2IHF A;  3I4M H;  4A76 A;  3PO3 G;  4JYA L;  1IZ6 A;  2F52 A;  2R7D A;  4QL5 A;  4IPG A;  3F2B A;  3AFQ A;  4MZ9 A;  1Q1B A;  2ASB A;  4B3S Q;  5C3E G;  4LUV A;  1M1K C;  4WJ4 A;  1PH2 A;  3I4N G;  4DV1 L;  5ELN A;  4LFA Q;  1U0L A;  3A5U A;  2UXB Q;  1KHI A;  3KF6 A;  3RN2 A;  1BKB A;  5HGQ A;  2LSS A;  2HIX A;  4JBW A;  1BBW A;  4X64 L;  1HJP A;  3BZC A;  3PSI A;  4DKA C;  4A3B G;  2EXD A;  1HNX L;  4A3F G;  1LTL A;  4MTN A;  3WWV A;  4A93 G;  2JQO A;  4HJ5 A;  1I94 Q;  1H95 A;  2UUC Q;  2VZA A;  4KI0 A;  2K5N A;  1FJG Q;  1S40 A;  1NE3 A;  1L0W A;  2Q2U A;  3H3V H;  1I3Q H;  5M3M G;  3A0J A;  1HR0 Q;  4WJ3 M;  4B3R Q;  4JBM A;  1VQN A;  3CCL A;  3HFZ B;  2I5L X;  1QVC A;  3I55 A;  2JA8 G;  2JK8 A;  2LXK A;  1IBM L;  3F2D A;  1HZC A;  3CPW A;  2VUM G;  4JI3 L;  4OWT B;  4XTC S;  4IOC A;  3PUZ A;  2VL6 A;  2PI2 A;  3M85 A;  3E9H A;  2UUB L;  3PO3 H;  1BVS A;  4DV7 Q;  3FHW A;  3MXN B;  4GNX B;  4AQY Q;  4LWC A;  4DK6 C;  4P75 A;  5C3E H;  3CCE A;  2GVA A;  3I4O A;  3A74 A;  1S72 A;  4OWW B;  3GTK H;  3I4N H;  1IBL L;  2UXC L;  1P8L A;  3CMA A;  1EFW A;  3J81 c;  4GS3 A;  4LF4 Q;  1I6H H;  3S1R H;  2BH8 A;  3EN2 A;  5ELO A;  1N34 L;  3UDI A;  4JI7 Q;  4OO1 I;  4A3B H;  2JA5 G;  1PVO A;  3F1Z A;  4A3F H;  1YNX A;  2MQH A;  1D7Q A;  3G6E A;  4JI2 Q;  4A93 H;  3UDX A;  1B8A A;  1CKM A;  2N49 A;  4OON A;  4LFC L;  5M5Y H;  4HIM A;  2IY5 B;  2B63 G;  3PF4 A;  4A3D G;  1UE6 A;  4EX5 A;  2OTJ A;  3AQQ A;  3KJO A;  1K0R A;  5M3F G;  2I5M X;  1K9M C;  1X3E A;  2JA6 H;  1SRU A;  2ATW A;  1VQ4 A;  5JJL A;  2K50 A;  2L15 A;  2JA8 H;  2AWN A;  1E24 A;  1PFS A;  2PMZ E;  3PCO B;  1G29 1;  4YHH L;  2VUM H;  3TS2 A;  1IXR A;  4O0A A;  5AJ3 L;  5IWA Q;  2NVY H;  3UDG A;  4GKJ Q;  2EIF A;  4GN4 B;  3NBH B;  3UDF A;  2QEX A;  4POF A;  3T1H L;  5JEA G;  1BBU A;  3D0F A;  4QJF A;  3PUV A;  5LMU L;  1Q7Y C;  4DR6 L;  1XNQ Q;  3G71 A;  1Q46 A;  4JG2 A;  1FGU A;  1KD1 C;  3CC2 A;  2VW9 A;  4P72 A;  1K8G A;  2OTL A;  4JI0 Q;  4P74 A;  4OX9 L;  3CCU A;  3K7U C;  4DUZ L;  1Q86 C;  1TWC H;  1JJ2 A;  1C0A A;  2MNA A;  3KJP A;  5GQO A;  1XMQ Q;  1CKO A;  4IJH A;  3HOY G;  4DR1 L;  4JI8 L;  1L2F A;  2Q2I A;  2OQK A;  4C3I H;  1PH6 A;  4JI6 L;  1VS0 A;  3I56 A;  3RZD H;  3ULL A;  2VNU D;  4LF7 Q;  2FXQ A;  2JA7 H;  2GN5 A;  3W1G A;  2JA5 H;  4P71 A;  4APV A;  1ASZ A;  2HIV A;  2ZTC A;  4GN3 B;  4B3S L;  3J80 i;  2B63 H;  4A3D H;  1N34 Q;  3S2H H;  2MO0 A;  3GTQ H;  5M3F H;  3PV0 A;  2C35 B;  4XIG S;  1OXV A;  4A3C G;  1I5F A;  4LFA L;  1X56 A;  3CPF A;  1Z47 A;  4DV4 Q;  2UXB L;  3H3V I;  2BH2 A;  1QZG A;  1TXY A;  3CCM A;  1SE8 A;  3CCS A;  3S2D H;  1AH9 A;  2IT1 A;  1B7Y B;  1X54 A;  2YYZ A;  1JMC A;  3K7A H;  3OTO Q;  1YI2 A;  4X62 Q;  3PO2 G;  4QQB X;  2Q2H A;  1MJE A;  5JJI A;  2K5H A;  2NVX H;  4L5T A;  1LM0 A;  4LF8 Q;  1CUK A;  4IO9 A;  1I94 L;  2UUC L;  2RCN A;  4H02 A;  1KRT A;  1L1O C;  1FJG L;  1VCI A;  5C4J H;  3TQY A;  2NZH A;  1HR0 L;  2KCT A;  1Q1E A;  4B3R L;  2GVB A;  4R4O A;  1HNZ Q;  4DR7 Q;  1WJJ A;  1W3S A;  1J5E Q;  3F8T A;  4LUO A;  4GNX A;  3JAM i;  4TVA B;  1K73 C;  1JE5 A;  3A5Z B;  2CQO A;  3GTL H;  4L5R C;  2OCE A;  4LF6 Q;  1JJC B;  2E2H H;  1E3P A;  4IJL A;  5FJ8 G;  3HOX G;  4DV7 L;  4AQY L;  4GOP C;  2E2J H;  4B3T Q;  1EQQ A;  1X3G A;  3HKZ G;  1YIJ A;  4LFB Q;  1NMF A;  1NTG A;  2XGT A;  3H0G G;  1WYD A;  4LF5 Q;  4LF4 L;  4A3C H;  3KFU A;  5GRO A;  2WP8 J;  2F4V Q;  3PGZ A;  1VQ5 A;  4DUY Q;  4JI7 L;  1Y14 B;  1NY4 A;  1OXX K;  1NBW A;  2YV5 A;  1LUZ A;  5IT9 c;  5LMN W;  3PO2 H;  5JJK A;  1KC8 C;  1KQS A;  2ID0 A;  5FLX c;  4JI2 L;  3S1N H;  2YU9 H;  2UU9 Q;  4O2D A;  1PH7 A;  3S1Q H;  4DR5 Q;  3GTP H;  1N33 Q;  1TWA H;  4YY3 Q;  2BA0 A;  3CF5 A;  1YHB A;  1EIF A;  2A1A A;  3PUX A;  5IWA L;  4GKJ L;  4IOA A;  2D0P A;  1GO3 E;  1N9W A;  3EBE A;  3CCV A;  5HY6 A;  4R1J A;  1XNQ L;  1GD7 A;  3NEM A;  4LUZ A;  1K83 H;  2MFI A;  3HOX H;  5FJ8 H;  4A3M G;  1YHQ A;  2JA6 G;  4JI0 L;  5JEA J;  1I50 H;  4L5S A;  1A8V A;  2K5V A;  1YJW A;  2AMC B;  4NB3 A;  5DLQ E;  4A3J G;  1W2B A;  4DR3 Q;  1XMQ L;  3H0G H;  4X6A H;  2NN6 G;  1X55 A;  2CFM A;  2EQS A;  4JV5 L;  1HZA A;  1Q8K A;  4IPH A;  2JEB I;  3BZK A;  4JI4 Q;  4LF7 L;  1A63 A;  4A3E G;  1EUJ A;  1K3R A;  1N8R C;  3KDF B;  3S24 A;  2Y0S E;  3CW2 C;  3EIV A;  2Z6K A;  3RLN A;  5IY0 A;  4HJA A;  4BY1 G;  1VQO A;  3CCQ A;  1IL2 A;  4X65 Q;  2ZTD A;  3JC6 6;  4PMW A;  4OXP A;  2JA9 A;  3S17 H;  3TRZ A;  1JJG A;  1VQM A;  4KHP Q;  2JA7 G;  2HQL A;  4DV4 L;  5LMN Q;  4UP7 A;  3OTO L;  4QIW E;  4QGU A;  4X62 L;  5EAY A;  3ZJY C;  3RN5 A;  2YTX A;  2JE6 I;  3J80 c;  3ER0 A;  3K80 C;  1VQ8 A;  4LF8 L;  3J81 j;  1SR3 A;  3DLL A;  1T9H A;  3CXC A;  4A3M H;  1PH4 A;  4BA2 I;  4IFD G;  5E7N A;  1XNR Q;  3M7N A;  3KLW A;  1B70 B;  3ULJ A;  4A3J H;  1QZH A;  1UE1 A;  1HNZ L;  4DR7 L;  2KEN A;  1GKH A;  2QA4 A;  1J5E L;  4GN5 A;  4P73 A;  3PIP A;  4HJ7 A;  3CCJ A;  1N36 Q;  4QY7 A;  1KAW A;  1PH3 A;  1VQG A;  4LF6 L;  2A8V A;  3GTM H;  4AYB G;  4A3E H;  5GAG C;  2RF4 A;  1G6P A;  1EQR A;  2CWP A;  2JEA I;  3GTO H;  4BY1 H;  4B3T L;  3B6Y A;  1E1O A;  4JOI A;  1X65 A;  4ME3 A;  3JAM c;  1Q82 C;  2HHH Q;  3OYY A;  3M4O H;  4LFB L;  1HZ9 A;  3UE1 A;  4A3K G;  1VQ9 A;  1Q81 C;  4LF5 L;  1SFO H;  2RHQ B;  1MJC A;  4EQ5 A;  2F4V L;  5FLM G;  1FL0 A;  1KRS A;  2IHE A;  4DV5 Q;  4X66 Q;  4R4T A;  2R6G A;  4DUY L;  1HNW Q;  2UXD Q;  4C3J H;  1VQ7 A;  4DV0 Q;  2UUA Q;  1IBK Q;  4NPS A;  4GLX A;  3RLF A;  4DAY B;  1RIP A;  1EIY B;  2MO1 A;  3AEV A;  3ICE A;  2UU9 L;  2KHI A;  3LGJ A;  2KBN A;  2VQE Q;  4DR5 L;  1YEZ A;  1N33 L;  3M4Q A;  1G51 A;  4UP9 A;  4HJ9 A;  2ZTE A;  3L7Z C;  4YY3 L;  5GAH C;  2ZJR A;  2ALY B;  1E7Z A;  3I7F A;  1FVI A;  1C7Y A;  1SMX A;  1S3O A;  3KOJ A;  2BA1 A;  3IRB A;  4ALP A;  1V1Q A;  3KF8 B;  4PZ8 A;  5IYC G;  2NVT H;  1YBY A;  2AHO B;  4YWM A;  1YJ9 A;  1KXL A;  3G48 A;  3HKS A;  2K52 A;  4PZ7 A;  4HIK A;  2ZJQ A;  4A4I A;  1SLJ A;  4J15 A;  4DNI A;  1UWV A;  4BBR G;  2CKZ B;  5GAD C;  3HOV H;  1VQD A;  2JJQ A;  3CP0 A;  4DR3 L;  4A3K H;  4JBK A;  4BBS G;  3KDF A;  4JI1 Q;  3CC7 A;  1YIT A;  4DR4 L;  1TWF H;  1CKN A;  1PYB A;  5FLM H;  3D31 A;  4DPG A;  1K8A C;  3CME A;  4LF9 Q;  4JI4 L;  2WB1 E;  1QUQ B;  1P16 A;  3GDE A;  1XPR A;  2PI2 E;  2IX1 A;  2ZM6 Q;  1EOV A;  2E8G A;  4X65 L;  4IPC A;  1YHA A;  3ULP A;  4B3M Q;  1MIU A;  3SGI A;  3FP9 A;  1OTC A;  4KHP L;  4Y52 H;  4LNQ A;  1V43 A;  3H15 A;  5LMN L;  3I2Z A;  2PQA B;  4YWL A;  3CAM A;  4R4C A;  2K75 A;  5IYC H;  1M90 C;  3M4P A;  4A3L G;  4FDB A;  1HH2 P;  3NEL A;  3W5O A;  5IYD G;  1E22 A;  2NN6 I;  3AYH B;  1VQC A;  1C9O A;  5GAE C;  2OQ0 A;  1RL2 A;  1Z9F A;  4GNX C;  4BBR H;  1XNR L;  2B3G A;  1EWI A;  4JCV E;  1PH1 A;  4GLA C;  1XPU A;  4IFD J;  2R93 G;  1CSQ A;  3TS0 A;  2NVQ H;  4PZ6 A;  1L1O B;  1XMO Q;  1TWH H;  1GM5 A;  2VY3 A;  3GO5 A;  4GKK Q;  4BBS H;  4NXM Q;  3PUW A;  3STB C;  3CC4 A;  1N32 Q;  4YCU A;  2R7Z G;  1A0I A;  3U4V A;  3W1B A;  1N36 L;  4BA1 I;  4DV3 Q;  4NXN Q;  4R4I A;  2IX0 A;  1PH5 A;  4AIM A;  4DV6 Q;  3MEF A;  3G4S A;  3L0O A;  1Q12 A;  2DGY A;  3PUY A;  1NMG A;  5BR8 Q;  4DR2 Q;  1VQA A;  2Z0S A;  4DV2 Q;  2E5L Q;  2HHH L;  3AFP A;  4DR4 Q;  4PG3 A;  5C0X I;  4GOP B;  4IFD I;  3VDY A;  4JI5 Q;  2I0Q A;  1XTD A;  1E1T A;  3HOU G;  1YVC A;  2E2I H;  1VQL A;  4A3G H;  5K36 G;  1HZB A;  4KLK A;  4DV5 L;  1D8L A;  4X66 L;  2UXD L;  2VQF Q;  1XJV A;  1CKN B;  2YTY A;  4A3L H;  3Q8D A;  1HNW L;  2VS1 A;  2D0O A;  4DV0 L;  1PH8 A;  1AE3 A;  2R7F A;  1IBK L;  2UUA L;  5IYD H;  3E9I A;  3K81 C;  2CCZ A;  3S1M H;  1NJI C;  3FKI G;  5C44 G;  4K0K Q;  4JV5 Q;  4UP8 A;  2CWA A;  2NZO A;  4RMF A;  2VQE L;  1O7I A;  1EYG A;  1JT8 A;  2R93 H;  2N78 A;  2PNH A;  1PHJ A;  3T1Y Q;  4AH6 A;  3OW2 A;  4UY8 C;  3BU2 A;  5C0X G;  2R7Z H;  3NEN A;  2WAQ E;  2OWO A;  3CCR A;  3STB D;  4DK3 C;  2H5X A;  1YJN A;  1QVF A;  1OXS C;  4A3I G;  2D62 A;  5C4X G;  2YTV A;  4KHZ A;  1UE5 A;  2XTI A;  5IP7 G;  1Y1W G;  4TQU S;  3CD6 A;  2K14 A;  1R9T H;  3RLO A;  3HKZ E;  3UE0 A;  4JYA Q;  3M3Y H;  4DAM A;  4OWX B;  1QUQ A;  2WB1 G;  1UE7 A;  4Y7N H;  3CQZ H;  2ZJP A;  4JI1 L;  3HOU H;  1WCM G;  2Z6K C;  2WFW A;  4C2M H;  1XPO A;  5M5X H;  1PV4 A;  1UEB A;  3K0X A;  1YZ6 A;  4DV1 Q;  4LF9 L;  3HOV G;  4YCW A;  3HOW G;  1PYS B;  5M3M H;  5IYB G;  1AE2 A;  2I5H A;  4X64 Q;  2ES2 A;  2ZM6 L;  3HOZ G;  3FKI H;  5C44 H;  1HNX Q;  2PQA A;  1SRO A;  2V1C C;  1VQJ A;  3KF6 B;  2Q2T A;  4B3M L;  1Y1V G;  2R92 G;  4L5Q A;  3TEH B;  4C3H H;  5IP9 G;  3KYH C;  1ASY A;  2KHJ A;  4HJ8 A;  4UPA A;  4R4Q A;  1X6O A;  1IBM Q;  2B29 A;  1GVP A;  4YCV A;  3TRE A;  2A19 A;  4JI3 Q;  1L1O A;  3S14 H;  3J7A 5;  4A3I H;  2N3S A;  5C4X H;  3J81 i;  1Y1W H;  5IP7 H;  1J6Q A;  1DGS A;  3E0E A;  4RG1 A;  2UUB Q;  1IYJ B;  2RHS B; 
#chains in the Genus database with same CATH topology
 5J3B A;  3RZD B;  1SND A;  4GKK L;  4MHE A;  5ELC A;  2WB1 B;  1N32 L;  1X9N A;  3DM3 A;  1WD1 A;  3F2C A;  1IBL Q;  2UXC Q;  4LW1 A;  4NXN L;  3GTG B;  3BJU A;  2B63 B;  1FGB D;  4R8N A;  1WI5 A;  5DEH A;  5IYB H;  4LMQ D;  3J7A F;  3U50 C;  1VQP A;  5BR8 L;  2QGQ A;  2E5L L;  2L5T A;  5IGE A;  1A62 A;  2MP1 A;  4K6L A;  1VQI A;  4LFC Q;  4DK0 A;  1MKH A;  3U58 A;  5IP9 H;  2KQ3 A;  1KIX A;  1KAB A;  3A56 A;  1VQK A;  1CA5 A;  4XT3 B;  3M9B A;  3R2I A;  4FXG C;  3BS1 A;  2M2L A;  2XSC A;  2HDL A;  5IIF A;  5M5W H;  1JE4 A;  1VQB A;  2ICE C;  5E4W C;  4POG A;  1CI3 M;  5LMU Q;  3HOY B;  4DR6 Q;  3SK6 A;  4BXX H;  2DUD A;  2EYH A;  4JBJ A;  1B50 A;  4OX9 Q;  4ABN A;  1V9P A;  4MIU A;  3GD7 A;  2AUK A;  4HID A;  2KUM A;  1CSP A;  4DR1 Q;  3MFG A;  1PH9 A;  1LTB D;  2OF1 A;  3OWF A;  3UI2 A;  1O7Z A;  4OIJ A;  1Z7T A;  3DWP A;  1D5Z C;  4JYA L;  1RHP A;  2F52 A;  4IPG A;  3AFQ A;  5AFW A;  4B3S Q;  5EKL A;  1K28 A;  4WJ4 A;  3A7L A;  5D65 A;  1LO5 D;  1CFM A;  1U0L A;  2I07 B;  1BKB A;  2LSS A;  1BBW A;  1TWA B;  3L9A X;  1VF5 C;  4A3B G;  3TBI B;  2JQO A;  5KNB A;  2K5N A;  1FJG Q;  3HRZ C;  2EY6 A;  1I3Q H;  4WJ3 M;  1HR0 Q;  1UAP A;  4B3R Q;  1K83 B;  2AQ1 B;  4QCL A;  3I55 A;  2JA8 G;  2JK8 A;  3F2D A;  2B2T A;  4G7O C;  4IOC A;  2ENB A;  4KJO A;  4C3H G;  4ZYS A;  1VDZ A;  2PI2 A;  1BVS A;  4DV7 Q;  4GNX B;  4LWC A;  5IGB A;  2DNC A;  3FPU B;  3K5O A;  1FNU A;  1GUG A;  1TU2 B;  5IOD A;  4GS3 A;  1I6H H;  1N34 L;  2EYJ A;  3S1R B;  3UDI A;  4HR7 B;  4JI7 Q;  2RBM A;  1PVO A;  1KNE A;  5M5Y H;  4XYO A;  1UE6 A;  4EX5 A;  3MFY A;  3I3C A;  2B39 A;  1A2U A;  4J6H A;  1PFS A;  3PCO B;  4OO1 I;  1GJX A;  3TS2 A;  5AJ3 L;  4GKJ Q;  5EJW A;  4POF A;  1BBU A;  2ZXO A;  3D0F A;  1Q7Y C;  1XNQ Q;  2B2Y A;  3U9O A;  4K6D A;  4P74 A;  3SK5 A;  4JVZ A;  4DUZ L;  1MHW C;  2F0I A;  2MNA A;  3KLS X;  4R9W A;  1F9P A;  3RZD H;  4B08 A;  3V2T A;  1HXY D;  2JA7 B;  4DNR B;  2PW7 A;  1NAP A;  3TP8 A;  4C3J B;  2B63 H;  4A3D B;  2MO0 A;  5HGT A;  3S2H B;  2C35 B;  1STG A;  1I5F A;  4XQN A;  2UXB L;  4DV4 Q;  3H3V I;  2BH2 A;  3URY A;  3S2D H;  4KY6 A;  1JMC A;  1EY9 A;  2J4X A;  4KN7 C;  3BDO A;  3KLS A;  1YI2 A;  3PO2 G;  5JEA H;  4L5T A;  1LM0 A;  4IO9 A;  2RCN A;  5C4J H;  1SJH D;  1SNQ A;  4AYB B;  1EU3 A;  5BN4 A;  5J22 A;  1PTO C;  2KEC A;  1U4L A;  3A5Z B;  2EYM A;  3SE0 A;  1K3B C;  2IJ0 A;  5EPL A;  4ZKC B;  4QB4 A;  4GOP C;  1EQQ A;  2LFN A;  1PFN A;  1CA6 A;  1WYD A;  4LF4 L;  4A3C H;  1EEF D;  2XRQ D;  2F0L A;  5I9O A;  1VQ5 A;  1WTW A;  3S1N B;  4O2D A;  4X3S A;  2YU9 B;  4DR5 Q;  3GTP H;  1TWA H;  3I73 A;  3S1Q B;  4HCE A;  3NBH A;  4WRD A;  1NNX A;  1YHB A;  5IWA L;  5KNC A;  2NVQ B;  1STA A;  1QNU A;  1JWS D;  4LUZ A;  1K83 H;  4B9W A;  3HOX H;  4A3M G;  1YHQ A;  3N52 A;  2EYL A;  4KMU C;  2F0K A;  1I50 H;  2K5V A;  5IT9 L;  1I6V C;  5DLQ E;  4A3J G;  3A54 A;  1BR9 A;  3D4W A;  3TN2 A;  5IGG A;  2FHT A;  4IPH A;  4OEL B;  2AQ3 B;  1GUS A;  3KDF B;  5KRU A;  2Y0S E;  3A8K E;  1F9Q A;  1IL2 A;  2ZTD A;  4C3I G;  4OXP A;  5C5M A;  2PMZ B;  1VQM A;  2NYZ D;  4F88 A;  5J39 A;  4N9P A;  4QIW E;  3RN5 A;  2YTX A;  3DLL A;  3CXC A;  2R7Z B;  2HCC A;  1EYD A;  1XNR Q;  3H94 A;  4Q0F A;  3M7N A;  4DAV A;  1PZK D;  1B70 B;  2F03 A;  1HNZ L;  1QZH A;  4DR7 L;  1GKH A;  2QA4 A;  2F0P A;  2NN6 H;  5A2Q E;  1PFB A;  1KAW A;  4H13 C;  5FKA C;  1VQG A;  4L6T B;  2A8V A;  5ELE A;  4C2M B;  1G6P A;  1AZQ A;  1PDQ A;  2JEA I;  1G2T A;  3P75 A;  1MI2 A;  4RH6 A;  3B6Y A;  4B3T L;  2NUC A;  1HZ9 A;  4A3K G;  4LF5 L;  2MHV A;  2RA4 A;  3FKI B;  2RHQ B;  1MJC A;  2F4V L;  3GV3 A;  5FLM G;  1FL0 A;  2IHE A;  1R4Q B;  4DV5 Q;  4DUY L;  1HNW Q;  5KYL A;  4C3J H;  4DV0 Q;  2NTS A;  1JOR A;  4FYD A;  3AEV A;  1I4Q A;  3LGJ A;  1EEI D;  1DCZ A;  4HJ9 A;  4UP9 A;  3L7Z C;  5GAH C;  1E7Z A;  5C4X B;  1FVI A;  1SMX A;  4ALP A;  3SDZ A;  1D6E C;  3HKS A;  2K52 A;  4G7Z C;  1C4Q A;  4DNI A;  5C4H A;  3FVQ A;  3FEW X;  3HOV B;  1FNV A;  3HOW B;  2H1E A;  1BQQ T;  1H9R A;  4JBK A;  1YIT A;  1ET9 A;  4JI1 Q;  2TSS A;  4ZRZ A;  3NHH A;  1G8Z D;  1I4P A;  2R92 B;  3K5N A;  1P16 A;  1XYI A;  1XPR A;  4ILW A;  4X3K A;  2O5I C;  4IUP A;  1GHJ A;  1LAB A;  5JJZ A;  5K5P A;  4KY7 A;  4FXD A;  1B2T A;  1V43 A;  2E74 C;  5IYC H;  1HH2 P;  1E22 A;  3AYH B;  5GAE C;  4BY7 B;  1IKM A;  1RL2 A;  1Z9F A;  5JOB A;  1KLG D;  1RTN A;  2R93 G;  5T1I A;  5CR3 A;  2NVQ H;  1PTO D;  4PZ6 A;  1L1O B;  2VY3 A;  2NBF A;  1PFM A;  2EVB A;  5FK9 C;  3STB C;  3CC4 A;  4I7A A;  3ND8 A;  1A0I A;  3D6W A;  3QWN A;  1N36 L;  1ICW A;  4DV3 Q;  2A6E C;  1PH5 A;  4DV6 Q;  2SNS A;  5A35 A;  2E2D C;  2XWJ B;  4ID6 A;  3VYT A;  5BN5 A;  1F2M A;  4DR2 Q;  4HSV A;  1EY7 A;  3C1E A;  1BCP D;  4IFD I;  2I0Q A;  3HGB A;  4DAY A;  1VQL A;  5K36 G;  2UXD L;  1GXD C;  3E0J A;  2VQF Q;  4A3L H;  1Q3L A;  4FXK C;  2R7F A;  1FNW A;  3T53 B;  2CCZ A;  1Y8O B;  5C3X A;  1NJI C;  1I4R A;  2R61 A;  4UP8 A;  2QDL A;  4RMF A;  1O7I A;  3QOJ A;  3VYS A;  2F0H A;  2PNH A;  4EQN A;  3T1Y Q;  1EY5 A;  4RWS C;  2R7Z H;  3PO3 B;  1EZ6 A;  1SMY C;  1CM9 A;  1U9R A;  5C3E B;  1OXS C;  1UE5 A;  2LY7 A;  2XTI A;  3CD6 A;  4N9T A;  1R9T H;  2IWH A;  3RLO A;  3HKZ E;  4IUV A;  3UE0 A;  3C2P A;  2EOT A;  1WTO A;  2WB1 G;  3CQZ H;  4DAP A;  3HOU H;  2Z6K C;  3VR3 A;  1F9R A;  4C2M H;  5I6W A;  4A3F B;  4IZ8 A;  1EY6 A;  1UEB A;  4A93 B;  4HED A;  1IW7 C;  1EY0 A;  3R8B A;  2G5D A;  5M3M B;  2ES2 A;  3FKI H;  4PMC A;  4OGQ C;  1PYW D;  2VUM B;  3DWQ A;  3TEH B;  4F8M A;  4K5X A;  4C3H H;  2EPB A;  3S9W A;  3H91 A;  4HJ8 A;  3G7L A;  5C0X H;  1GVP A;  4YCV A;  2A19 A;  4JI3 Q;  2DY8 A;  3J7A 5;  4A3I H;  5C4X H;  2B2V C;  1J6Q A;  2PQE A;  1LT6 D;  2F0D A;  2UUB Q;  1IYJ B;  5CMD A;  3DEO A;  4IPD A;  3KBG A;  1XMO L;  3RUZ A;  2L9H A;  4NXM L;  4KTA A;  3SXH A;  3J7Z C;  3DEP A;  4GLV B;  1VQF A;  3HOW H;  4GOP A;  4G57 A;  3I4M G;  4ZLT F;  5I9P A;  2JP1 A;  2Y0S G;  3RR5 A;  1Y1V H;  2AWO A;  3K7A B;  2R92 H;  1HUN A;  2HCI A;  1U5K A;  1ESF A;  2M9V A;  3EJI A;  1WOC A;  4JC0 A;  1QOH A;  3NPP A;  4K8J A;  1SN8 A;  3S16 H;  2AUJ D;  3PIO A;  4K0K L;  3RZO H;  1JC7 A;  1HTL D;  5KEE A;  3T1H Q;  4JV5 L;  4A3G G;  2K4K A;  1M8A A;  1PA6 A;  3T56 B;  1OXT A;  3T13 A;  2XIW A;  4CGY B;  3GTJ H;  4OO1 H;  2F0O A;  1JB7 A;  4BY7 H;  4HTH A;  1LLR D;  1Y69 U;  4HAE A;  4OIK A;  2Z8L A;  1LV9 A;  2EDG A;  4K2K A;  5JVH 3;  4QL5 A;  1Q1B A;  3C3L A;  5CV6 A;  3EVQ A;  2BCO A;  3MAQ A;  4RGN A;  3I4N G;  4DV1 L;  2IPK D;  3A5U A;  1PRT C;  3E6Z X;  2C5C A;  1DON A;  4TKO B;  1ZKO A;  1HJP A;  4X64 L;  1KDC A;  1F2Y A;  1GUT A;  2EXD A;  1HNX L;  3AMU A;  1QIL A;  4OHJ A;  1I94 Q;  2WAQ B;  1NE3 A;  3CRL C;  3H3V H;  4G7H C;  3A0J A;  1I3Q B;  5JAV A;  2X69 A;  1ENA A;  3CPW A;  1IYV A;  2K33 A;  4OWT B;  4XTC S;  3K6O A;  2VL6 A;  3H0G B;  4DFA A;  2KVM A;  5TSS A;  2AQ2 B;  3PO3 H;  2CH4 A;  1EIG A;  1X3Q A;  2CVR A;  3HG9 A;  5C3E H;  4C1N K;  2WIN B;  1QJO A;  3CMA A;  1I4H A;  2BH8 A;  2G9H D;  3EN2 A;  3BZD B;  1RD9 D;  1LT4 D;  5IOC A;  2JA5 G;  4A3F H;  1YNX A;  2MQH A;  1AZP A;  1D7Q A;  3G6E A;  4JI2 Q;  3C1F A;  4A93 H;  2N49 A;  4CKC A;  5M5Y B;  4A3D G;  1ESR A;  3KJO A;  1F9S A;  2KJX A;  4F7X A;  1SRU A;  1HFG A;  2ATW A;  1VQ4 A;  4QUF A;  1L0Y B;  2K5D A;  4YHH L;  2VUM H;  1G29 1;  2F3V A;  1IXR A;  4O0A A;  1RF2 D;  2EIF A;  2ICI A;  3NBH B;  2RSN A;  2F0N A;  3J81 L;  3G71 A;  3IL8 A;  1GOZ A;  2O4X A;  1CK1 A;  2B8F A;  4JI0 Q;  2B2W A;  2VW9 A;  2OTL A;  3K7U C;  3GTM B;  4A3E B;  1XXG A;  1B44 D;  1TWC H;  1C0A A;  1CKO A;  1SMY D;  4IJH A;  4BY1 B;  4JI8 L;  1L2F A;  2Q2I A;  4C3I H;  1PH6 A;  5IGC A;  4JI6 L;  1VS0 A;  4IUU A;  3V05 A;  4LF7 Q;  2FXQ A;  3W1G A;  4APV A;  1ASZ A;  2HIV A;  2ZTC A;  1K0S A;  3P20 A;  5M3F H;  3PV0 A;  4M8A A;  4LFA L;  1X56 A;  3CPF A;  2LMC B;  4ZAI A;  1IW7 D;  1AH9 A;  1X54 A;  3PIO 3;  3S2D B;  3K7A H;  2B2U C;  4X62 Q;  1FD7 D;  2E75 C;  2O2L D;  4LF8 Q;  1SNO A;  2UUC L;  4DXG A;  4ULL A;  2K5W A;  3TQY A;  5C4J B;  2KCT A;  5T1G A;  2GVB A;  1WJJ A;  1W3S A;  2EY5 A;  3F8T A;  4LUO A;  3MXN A;  1K73 C;  3GTL H;  4ZUI A;  5HUR A;  1UUP A;  1HTP A;  5FJ8 G;  4AQY L;  5EBD A;  5I4D A;  4ZKB B;  4Q5V A;  3ZYY X;  1EQV A;  3HKZ G;  1YIJ A;  3BVG A;  4LFB Q;  1NMF A;  2MJ8 A;  1NTG A;  3I91 A;  4FO2 A;  3GQB A;  3PGZ A;  1HFN A;  5JJK A;  3A7A B;  4XDX A;  2ID0 A;  5FLX c;  2Z4I A;  4V19 0;  1N33 Q;  5CBE E;  3GTP B;  1QWY A;  5JPN C;  1F2Z A;  5IGD A;  3PUX A;  1EIF A;  2A1A A;  1ONL A;  2H4O A;  2Q8I B;  4IOA A;  2D0P A;  4RHS A;  1CQV A;  4BBS B;  5DM6 3;  5HY6 A;  3CCV A;  2JA6 G;  2MFI A;  1X32 A;  3HOX B;  5JEA J;  1KLU D;  2DNE A;  1I50 B;  5KIX A;  2I46 A;  1XMQ L;  3H0G H;  4OL7 A;  3FMC A;  5KGU A;  3K5L A;  4KD3 A;  1H9S A;  1HPC A;  2CFM A;  4JPB W;  2EQS A;  5E4X A;  1I4G A;  4N8F A;  2JEB I;  3BZK A;  1A6X A;  2Z6K A;  1LTR D;  3CCQ A;  4X65 Q;  4PMW A;  2JA9 A;  2PNR C;  4KHP Q;  1PRT D;  5FO9 B;  2KCN A;  1RCV D;  3OTO L;  4QGU A;  3ZJY C;  3J80 c;  4KK7 A;  1T9H A;  1AW7 A;  1JCK B;  5E7N A;  4I7Z C;  1SAP A;  3R2T A;  3W3A A;  5IGF A;  2A74 C;  2KEN A;  1J5E L;  2QIL A;  4GN5 A;  4P73 A;  1NR4 A;  3PIP A;  1EU4 A;  4HJ7 A;  2RCF A;  2K7V A;  2P5Z X;  4LF6 L;  3GTM H;  2VXW A;  4A3E H;  2D9U A;  2CWP A;  4BY1 H;  3OPO A;  1X65 A;  1QE6 A;  4ME3 A;  3X3M A;  3JAM c;  1TY2 A;  3UE1 A;  1VQ9 A;  2IX3 A;  1KRS A;  4X66 Q;  5CV8 A;  2PYK A;  1VQ7 A;  5ELB A;  1IBK Q;  3E3X A;  4GLX A;  4DAY B;  1RIP A;  2DJF C;  3I72 A;  2MO1 A;  3ICE A;  4IFD H;  2A6H D;  2UU9 L;  2D5D A;  3M4Q A;  1G51 A;  2ZTE A;  4YY3 L;  2ZJR A;  2ALY B;  1Y1W B;  2OEO A;  1S3O A;  3IRB A;  1BNZ A;  1HA6 A;  1EWC A;  3DHQ A;  1TWG B;  4X3T A;  4HIK A;  3QO2 A;  1WCM B;  4A4I A;  1GUW A;  1E0B A;  1SLJ A;  3ITP A;  4KJN A;  5FLX E;  2E76 C;  4BBR G;  3K59 A;  2OT2 A;  3KUP A;  1VQD A;  1TVX A;  5I2X A;  1AP0 A;  4DNT B;  1JWU D;  4DR3 L;  1JOK A;  1V8Q A;  5EPK A;  3U9S A;  3HOZ B;  1K8M A;  3D31 A;  4KD4 A;  5EPJ A;  1K8A C;  2Q8T A;  2QKI C;  4CDD C;  4LF9 Q;  4JI4 L;  2WB1 E;  3LWU A;  3NTH A;  1U4P A;  1ZYR D;  1BCP C;  5CV9 A;  2E8G A;  4IPC A;  1O78 A;  2A73 B;  2J7Z A;  2L55 A;  5LMN L;  4R4C A;  1EYA A;  2CW0 D;  5EGT A;  2Z1C A;  1C9O A;  1Y8P B;  3VR6 A;  3QIA A;  2EJM A;  1WTV A;  1CSQ A;  3HP3 A;  1S4Z A;  4GKK Q;  4BBS H;  2L1B A;  3PUW A;  2JXM B;  1N32 Q;  4PNY A;  1F77 A;  4ZQ3 A;  1YNJ D;  4BA1 I;  4NXN Q;  2IX0 A;  2BE5 C;  2J0T D;  4AIM A;  3J80 E;  2F0J A;  2EYP A;  4EQO A;  3L0O A;  3PUY A;  5BR8 Q;  1LT5 D;  2A69 D;  2E5L Q;  2HHH L;  4GOP B;  3OSO A;  4M1U B;  4JW0 A;  4A3G H;  1QG7 A;  1O7Y A;  2C9O A;  1D8L A;  1XJV A;  1CKN B;  2YTY A;  2UUA L;  5IYD H;  2Z9H A;  3K81 C;  3KLR A;  5COR A;  5C44 G;  1EYG A;  3KF8 A;  3MVV A;  2VQE L;  1I4X A;  3OMC A;  3TP7 A;  3JAM E;  1PHJ A;  2JSO A;  3PIP 3;  3OW2 A;  3NQI A;  3I70 A;  2Z4H A;  4XXE A;  1ICF B;  1WTH A;  4DK3 C;  3SR1 A;  1QVF A;  1SE4 A;  2D62 A;  2RDH A;  1Z6H A;  4TQU S;  4RHR A;  1R9T B;  4JYA Q;  1CTM A;  3O13 A;  1QUQ A;  1XWE A;  2RDF A;  3CQZ B;  4A3B B;  3PMF A;  3HOU B;  1PV4 A;  5DM7 3;  1PYS B;  1MSG A;  5IYB G;  1B4O A;  1AE2 A;  2I5H A;  3RD4 A;  2ZM6 L;  2PQA A;  1SRO A;  3BDC A;  2Q2T A;  4B3M L;  1ROD A;  5IP9 G;  3KYH C;  4C3H B;  2KHJ A;  1SEB D;  4R4Q A;  1A2T A;  3BYT B;  1A3U A;  5CYU A;  4IUR A;  4ZUJ A;  2PZU A;  2N3S A;  4A3I B;  1Y1W H;  5IP7 H;  1DGS A;  4V0B A;  4RG1 A;  1XPU A;  4BXX G;  1TWG H;  3ERS X;  4S3S A;  1WCM H;  5BN3 A;  3L2P A;  1CT1 D;  1WD0 A;  4JOI C;  2QW7 A;  4HN7 A;  4JK1 C;  1WFQ A;  3HOZ H;  1LYL A;  4FF2 A;  1VQ6 A;  4DV2 L;  2F3I A;  3FDT A;  4L63 B;  3BVZ A;  4JI5 L;  1Y1V B;  1DOM A;  1Q8I A;  3D4D A;  4HMJ A;  5AJ3 Q;  1VQE A;  3RNU A;  3S16 B;  4A75 A;  1II3 A;  2KOL A;  3RZO B;  1IHZ A;  2F0F A;  3F2U A;  2WAQ G;  1A15 A;  1TT2 A;  4YWK A;  4DUZ Q;  3GTJ B;  3TME A;  2EY1 A;  3K57 A;  4HIO A;  2E2J B;  4NW2 A;  5C0X J;  4AYB E;  2IHF A;  1STY A;  2EJG C;  2MGS A;  2LS0 1;  4IUN A;  4H0L C;  2R7D A;  5C6A A;  4MZ9 A;  2Z6B A;  1M1K C;  3PO2 B;  4CDC C;  4PMB A;  5ELN A;  2UXB Q;  1HQM C;  5DAU A;  3RN2 A;  4JBW A;  3BZC A;  3PSI A;  1KDA A;  2XWB B;  1LTL A;  2JYO A;  3MHB A;  4HJ5 A;  5FOB B;  1H95 A;  1S5E D;  3I4L A;  2A5H A;  4YIJ A;  3P1H A;  1HCZ A;  2WII B;  2XVS A;  1VQN A;  3CCL A;  3HFZ B;  4B9X A;  1NR2 A;  1IBM L;  1HZC A;  3NTK A;  3WDN A;  3PUZ A;  2X6L A;  4K8I A;  1AFP A;  3FHW A;  3MXN B;  1OO9 B;  4DK6 C;  1S5D D;  4P75 A;  4E6I A;  5KYI A;  3I4O A;  3A74 A;  1S72 A;  4OWW B;  2N88 A;  3GTK H;  1IBL L;  2UXC L;  4LF4 Q;  2VB3 X;  5I2Y A;  4PV1 C;  2BE5 D;  5CC4 A;  2CH4 W;  1W6K A;  3NXW A;  4A3B H;  3F1Z A;  1BDO A;  1B8A A;  1CKM A;  4L8J A;  4OON A;  4LFC L;  4HIM A;  2IY5 B;  2B63 G;  3PF4 A;  2OTJ A;  3AQQ A;  3NWT A;  2JA6 H;  1X3E A;  4DU9 A;  5JJL A;  2K50 A;  2L15 A;  3OHX C;  5G3L F;  2JA8 H;  3NSW A;  2PMZ E;  4CDF C;  5IWA Q;  2NVY H;  1C48 A;  2KA7 A;  4A3J B;  1E2V A;  2QEX A;  1TQO A;  5JEA G;  4QJF A;  5LMU L;  4DR6 L;  3V96 A;  4CDE C;  1Q46 A;  2L12 A;  3GV6 A;  4P72 A;  1K8G A;  4OX9 L;  4EVO A;  3ONA B;  4FF3 A;  3G6J B;  1Q86 C;  1TS5 A;  3E5S A;  1TWC B;  3HOY G;  2QEJ C;  4IAL A;  4DR1 L;  3GTO B;  4C3I B;  1ILP A;  5LL6 X;  4H44 C;  4P71 A;  4CKB A;  4GN3 B;  1H9S B;  4B3S L;  3J80 i;  4KKT A;  1KDB A;  5DNF A;  2PZT A;  1OXV A;  4N8X 1;  5M3F B;  4A3C G;  2SDF A;  1J9O A;  1V1O A;  1CHQ D;  4CHT B;  1TXY A;  1QZG A;  1QNK A;  1B7Y B;  2YYZ A;  4DA2 A;  5JJI A;  4QQB X;  2NVX H;  2B2Y C;  1MBY A;  2NVT B;  4U68 A;  3T16 A;  2FIN B;  3DUZ A;  1FJG L;  1VCI A;  4K5V A;  3Q22 A;  2NZH A;  4J8Q A;  1HR0 L;  1Q1E A;  4B3R L;  2WV6 D;  4R4O A;  1HNZ Q;  4DR7 Q;  4HMI A;  3IFT A;  3JAM i;  4TVA B;  3FRP B;  4H7B A;  3GTL B;  4KKU A;  5A2Q L;  1E3P A;  3HOX G;  4DV7 L;  3TP6 A;  4K5W A;  1EZ8 A;  2E2J H;  4B3T Q;  1X3G A;  4U67 3;  2MPM A;  3MTS A;  4RKL A;  1EL0 A;  4LF5 Q;  1BOS A;  3KFU A;  3MXP A;  1X3P A;  5GRO A;  2F4V Q;  1FR3 A;  1WTX A;  3BG3 A;  3QB3 A;  4DUY Q;  4JI7 L;  1Y14 B;  2YV5 A;  5IT9 c;  1LUZ A;  5LMN W;  3PO2 H;  1KC8 C;  2QF7 A;  1TS2 A;  1SBB B;  4QUC A;  1PH7 A;  2CHB D;  1LTS D;  3QOL A;  1LT3 D;  2GA4 B;  3L3O C;  1AEX A;  5CV4 A;  3GP7 A;  4BWG B;  4GKJ L;  1H9J A;  1TWH B;  2CQA A;  1SSO A;  5FO7 B;  1XNQ L;  1GD7 A;  3NEM A;  4KY5 A;  5C3W A;  1DJR D;  1A8V A;  4C1N I;  1IKL A;  2AMC B;  3IAY A;  1W2B A;  2PPB C;  1O80 A;  2NN6 G;  1X55 A;  4KHV A;  1SYD A;  1Q8K A;  2F0V A;  3TDQ A;  1A63 A;  1EUJ A;  1K3R A;  2OXP A;  3S24 A;  2RKS A;  3CW2 C;  3EIV A;  4HJA A;  3JC6 6;  3TRZ A;  3A55 A;  2JA7 G;  3S1M B;  4DV4 L;  4WJW A;  4UP7 A;  5COY A;  2F0M A;  1PZJ D;  4C3J G;  2A6H C;  2JE6 I;  1GUN A;  3ER0 A;  3K80 C;  1VQ8 A;  3J81 j;  4BA2 I;  4A3M H;  1PH4 A;  3CKI B;  2LKV A;  1D1I A;  3OOC A;  3ULJ A;  4A3J H;  2FFK B;  3W2D A;  1SE3 A;  3M3Y B;  1N36 Q;  1TY0 A;  4QY7 A;  4CJ0 B;  4AYB G;  1EQR A;  2SNM A;  3GTO H;  3N6R A;  4JOI A;  3ERQ A;  1QCB D;  2NTT A;  3NUC A;  1YNN D;  1H9M A;  1ILQ A;  1ZYR C;  2UXD Q;  2F0W A;  1DD2 A;  4UDU C;  4NPS A;  1B3A A;  4UHV A;  3RLF A;  1KNA A;  1JOQ A;  5C4Z A;  1EIY B;  2VB2 X;  3TZU A;  2KHI A;  4DR5 L;  1YEZ A;  4CJ2 C;  3S14 B;  3ND9 A;  2K04 A;  3QR8 A;  2CW0 C;  2QCP X;  4RGM A;  1C7Y A;  1J8I A;  3KOJ A;  1V1Q A;  2JN4 A;  3KF8 B;  4PZ8 A;  1VMP A;  5IYC G;  2NVT H;  4YWM A;  1YJ9 A;  2BOS A;  2F0T A;  4QMG A;  1KXL A;  2A68 C;  3G48 A;  1ZEQ X;  3LWE A;  5IT9 E;  2FMC A;  1RDP D;  2K03 A;  4PZ7 A;  2RSO A;  3S15 B;  4J15 A;  1UWV A;  5GAD C;  2CKZ B;  4MTK A;  1E2W A;  3CP0 A;  2F0G A;  4A3K H;  1YNJ C;  1NUC A;  2R3Z A;  4QF4 A;  4NP5 A;  1KAA A;  5FLM H;  5E1F A;  4RAU C;  4DPG A;  4C56 C;  2A69 C;  1QUQ B;  2O5J C;  3GDE A;  2KEE A;  2PI2 E;  1WTQ A;  1EY8 A;  1EOV A;  3ULP A;  4FF1 A;  4ODG A;  1MIU A;  3SGI A;  4Y52 H;  3HS0 C;  4LNQ A;  2PZW A;  3H15 A;  3I2Z A;  2PQA B;  4YWL A;  3CAM A;  4A3L G;  2K75 A;  3M4P A;  1DXM A;  2XNA C;  3W5O A;  5JPM C;  1RKN A;  3VA5 A;  1VQC A;  2OQ0 A;  4GNX C;  1SE2 A;  1XNR L;  1PH1 A;  4GLA C;  4IFD J;  3PQI A;  3TS0 A;  1XMO Q;  3I4M B;  1TWH H;  3WOE A;  1GM5 A;  3GO5 A;  4NXM Q;  1ML0 D;  4YCU A;  2R7Z G;  3U4V A;  2Y0S B;  3HZX A;  2N55 A;  2FJ2 A;  3G4S A;  2PCF B;  2DGY A;  1EYC A;  1HQR D;  4DR4 Q;  4PG3 A;  1IYU A;  2QDB A;  5C0X I;  2KED A;  3VDY A;  4QIW B;  1XTD A;  2WKD A;  3HOU G;  1YVC A;  1SYG A;  1RTO A;  4A3G B;  4DV5 L;  1HNW L;  4CBV A;  2VS1 A;  4DV0 L;  3K0Y A;  1AE3 A;  1L0X B;  3OMG A;  1PH8 A;  3E9I A;  1PLF A;  3D4R A;  3S1M H;  3FKI G;  3HEJ A;  3P7J A;  4K0K Q;  1SNC A;  4JV5 Q;  2CWA A;  2NZO A;  2M00 A;  2R93 H;  2N78 A;  3DM1 A;  4AH6 A;  4UY8 C;  3BU2 A;  3EA6 A;  5C0X G;  3NEN A;  2WAQ E;  2OWO A;  3CCR A;  1STB A;  2H5X A;  2HQE A;  4A3I G;  3I4N B;  5C4X G;  3J7Y W;  2Q8R E;  4O42 A;  4XT1 B;  2ZT9 C;  2B2V A;  4DAM A;  3VYR A;  3M3Y H;  4K2L A;  4DXF A;  1SYC A;  2ZJP A;  1UE7 A;  3LNN A;  4ZK9 B;  4JI1 L;  3H6M A;  2WFW A;  4G4K A;  5K36 H;  1ENC A;  4DV1 Q;  1EFI D;  3HOV G;  1TKW B;  3MC0 B;  3HOW G;  3MZ5 A;  1BO0 A;  4X64 Q;  1PXU A;  1HNX Q;  2F0S A;  1Y1V G;  2R92 G;  4L5Q A;  2EYO A;  3DWA A;  3NQT A;  3MXU A;  3IKJ A;  1H9K A;  1B9M A;  1X6O A;  2B29 A;  3TRE A;  5CBA E;  5EQ0 A;  3NE5 B;  3S14 H;  4NMZ A;  1BF4 A;  3I8Z A;  2HUG A;  3MXG A;  2V4D A;  3E0E A;  4RCO A;  5E3F A;  2RHS B;  1LTG D;  5F2D A;  1QVG A;  3Q0A A;  4OO1 G;  3S15 H;  4BY7 G;  2KCM A;  2JA5 B;  3PF5 A;  3GTG H;  4DV3 L;  1TS3 A;  2K5Q A;  1VMC A;  4DV6 L;  1UEA B;  4DN4 M;  2N8N A;  3GTQ B;  2X6G A;  5H1S E;  2L11 A;  3D6C A;  4DR2 L;  3U4Z A;  4TSS A;  4MNO A;  3EQL C;  3NK9 A;  2AKW B;  2PW5 A;  2G9D A;  4RKB A;  2VQF L;  1DOL A;  4FNF A;  1HR0 W;  1ET6 A;  2LXJ A;  4YHH Q;  3CRK C;  4XQQ A;  2DJG C;  3HOY H;  5IE8 A;  1OXU A;  1SNP A;  1U4M A;  1VQH A;  3T1Y L;  1X3F A;  1CZW A;  2E2H B;  2A68 D;  4JI8 Q;  2HT1 A;  4JI6 Q;  1KL9 A;  3K8A A;  2F0E A;  3I4M H;  4A76 A;  3PO3 G;  1IZ6 A;  3CHB D;  3F2B A;  1PTO B;  2ASB A;  1EOT A;  5C3E G;  4LUV A;  1PH2 A;  4NDX A;  4FVM A;  1EY4 A;  4LFA Q;  3TP5 A;  5EKK A;  1KHI A;  3KF6 A;  1DM0 B;  3VR5 A;  5HGQ A;  1V1P A;  2HIX A;  4DKA C;  3NP8 A;  3Q24 A;  2WKC A;  4A3F G;  4MTN A;  3WWV A;  4A93 G;  1BCP B;  2UUC Q;  2VZA A;  1G2S A;  4KI0 A;  5EKI A;  1S40 A;  2Q2U A;  1L0W A;  5M3M G;  4JBM A;  1SNM A;  3TSS A;  2I5L X;  1QVC A;  3I90 A;  2LXK A;  2VUM G;  2IW3 A;  3RMH A;  1PTO F;  3HKZ B;  4JI3 L;  3Q23 A;  1NSN S;  2SOB A;  5C5L A;  3H09 A;  4GZY C;  4ME5 A;  1D5M C;  3M85 A;  3E9H A;  2UUB L;  4AQY Q;  1Q90 A;  3EFX D;  4EQP A;  1JOO A;  1R4P B;  5ELD A;  1S5F D;  5M9O A;  2L0C A;  3CCE A;  2GVA A;  2RVL A;  3I4N H;  1P8L A;  1EFW A;  3GTK B;  3J81 c;  3S1R H;  3VR4 A;  5ELO A;  1BCP F;  2B8G A;  4R8I A;  3S17 B;  3VA7 A;  3WOF A;  3J7A V;  2EXZ A;  3UDX A;  1LTI D;  1PZI D;  1Y8N B;  3MEH A;  1K0R A;  5M3F G;  2I5M X;  1K9M C;  2JA6 B;  1CQF A;  4HSP A;  2AWN A;  1E24 A;  1T5X D;  2JA8 B;  3UDG A;  3BVM A;  4GN4 B;  3UDF A;  2NVY B;  3T1H L;  3CU7 A;  4LJZ C;  4RGO S;  2B2U A;  3PUV A;  1A3T A;  4JG2 A;  1FGU A;  1KD1 C;  3CC2 A;  1NCV A;  1TII D;  4IUT A;  2HDM A;  4XYQ A;  3CCU A;  1JJ2 A;  3KJP A;  5GQO A;  1XMQ Q;  1B9N A;  2NWG A;  2OQK A;  3M4O B;  3I56 A;  1AN8 A;  1GUO A;  5ELF A;  3ULL A;  2VNU D;  2JA7 H;  2KHS A;  5D3D A;  2GN5 A;  1SFO B;  2JA5 H;  5ISR A;  1STN A;  2KCC A;  3R3O A;  3R93 A;  5KND A;  4A3D H;  3SVM A;  1N34 Q;  3S2H H;  3GTQ H;  4XIG S;  1G6Z A;  2K01 A;  1Z47 A;  2F3W A;  1T5E A;  3CCM A;  1SE8 A;  3CCS A;  2IT1 A;  1DZ1 A;  3OTO Q;  4IUQ A;  2Q2H A;  1MJE A;  3NWS A;  2K5H A;  1S5B D;  2NVX B;  3DMU A;  2B2W C;  1CUK A;  1STH A;  1WVL A;  1I94 L;  3OW7 A;  4H02 A;  1D2B A;  1KRT A;  1L1O C;  4BS9 A;  1J5E Q;  4LK1 C;  4GNX A;  1JE5 A;  2CQO A;  4L5R C;  1E2Z A;  2OCE A;  2DN8 A;  4LF6 Q;  1JJC B;  4CJ1 B;  2E2H H;  4DF7 A;  1TWF B;  4IJL A;  3SK4 A;  1B3Q A;  1CHP D;  2XGT A;  3H0G G;  1DOK A;  3M7G A;  2WP8 J;  1WTR A;  1PTO H;  2F1M A;  2TMP A;  4OEM B;  3H3V C;  4FP5 D;  1NY4 A;  1OXX K;  1NBW A;  1BUV T;  1LAC A;  1RJT A;  1KQS A;  1HRJ A;  4JI2 L;  1EQT A;  3S1N H;  2YU9 H;  2UU9 Q;  3S1Q H;  3FPP A;  1DYQ A;  4YY3 Q;  3DXJ C;  2BA0 A;  3D8G A;  5JVG 3;  4WFN 3;  1UNS A;  4BBR B;  4DGZ A;  3CF5 A;  3J81 E;  1HHV A;  4KN4 C;  2ZXR A;  1GO3 E;  1N9W A;  3EBE A;  4ZCK A;  4R1J A;  4P2C B;  5I6Y A;  5FJ8 H;  4JI0 L;  4L5S A;  1LTA D;  3BYY B;  1YJW A;  4NB3 A;  4DR3 Q;  1JB3 A;  3OIQ A;  5FLX L;  4X6A H;  1IL8 A;  1EWH A;  1HZA A;  1HUM A;  4LF7 L;  4JI4 Q;  3NBI A;  4A3E G;  1N8R C;  2E2I B;  5IY0 A;  3AU7 A;  3RLN A;  3QJY A;  1VQO A;  4BY1 G;  1YNN C;  4J1M A;  4O1N A;  1MGS A;  3S17 H;  2EY2 A;  1JJG A;  3M4Y A;  1O7L A;  2HQL A;  3TZD A;  3D3R A;  3OWE B;  5LMN Q;  3BDL A;  4X62 L;  5EAY A;  4KKS A;  4LF8 L;  1SXT A;  1SR3 A;  4IFD G;  4A3M B;  1PMR A;  2XRS D;  2B2T C;  5J1Z A;  1SYB A;  2DY7 A;  3KLW A;  3ERO A;  1UE1 A;  2PO4 A;  2BDO A;  3CCJ A;  1BXT A;  4RCN A;  1WTP A;  2MUY A;  1PH3 A;  5CV5 A;  1EIH A;  4Y7N B;  3Q6S A;  5GAG C;  2RF4 A;  4RFB A;  2K28 A;  5M5X B;  2D2C C;  1E1O A;  3KK7 A;  1Q82 C;  2HHH Q;  3M4O H;  3OYY A;  4LFB L;  3J80 L;  1JIC A;  5EBC A;  1Q81 C;  1TR5 A;  1SYF A;  5C44 B;  1SFO H;  4EQ5 A;  4R4T A;  2R6G A;  3T4A C;  2RQX A;  2K32 A;  2UUA Q;  1JR0 D;  3QG1 A;  5NUC A;  2KBN A;  3MWY W;  2VQE Q;  1N33 L;  1SYE A;  4LAA A;  1MSH A;  1LTT D;  3I7F A;  4IQZ A;  1M4V A;  2BA1 A;  2ZXP A;  1YBY A;  3JAM L;  2AHO B;  4HCS A;  1B1Z A;  4MN3 A;  2ZJQ A;  2RDG A;  2XN9 C;  5FO8 B;  1QB5 D;  3HOV H;  5L37 A;  2JJQ A;  3VR2 A;  4X3U A;  4A3K B;  4BBS G;  5D3I B;  3KDF A;  4IN3 A;  3CC7 A;  4DR4 L;  2EE1 A;  1TWF H;  1CKN A;  1PYB A;  2F4I A;  3LX0 A;  1G91 A;  1A3V A;  5D14 A;  3SEB A;  5LHY 1;  2FMM A;  3CME A;  3OIP A;  4DK1 A;  4RA8 A;  2IX1 A;  2ZM6 Q;  4X65 L;  1YHA A;  1GHK A;  4B3M Q;  3FP9 A;  2EZV A;  5M5W B;  1OTC A;  4KHP L;  4EGV A;  3K58 A;  4NKL A;  1M90 C;  4FDB A;  1C8C A;  3NEL A;  5IYD G;  1ZXT A;  4TRD A;  2NN6 I;  3NTI A;  2IL8 A;  1VF7 A;  4BBR H;  1JQY D;  2B3G A;  1EWI A;  4JCV E;  1BBX C;  1SDF A;  1ENF A;  1U4R A;  4UAI A;  2K05 A;  3A8J E;  3AB9 A;  2F0U A;  3W1B A;  1HA5 A;  4R4I A;  4I65 A;  1KTK A;  3MEF A;  1F2L A;  1Q12 A;  1XTC D;  1NMG A;  3T51 B;  1VQA A;  2Z0S A;  4K14 A;  3SK8 A;  4DV2 Q;  3AFP A;  1D5X C;  2L4N A;  4JI5 Q;  2WAC A;  4XQJ A;  1E1T A;  2E2I H;  1HZB A;  4KLK A;  4X66 L;  3Q8D A;  2D0O A;  2NB0 A;  3IFD A;  1IBK L;  5CGK A;  1JT8 A;  4WOR A;  5G3L D;  5CV7 A;  2R93 B;  1PRT B;  3X3N A;  1D1K A;  2NZ1 D;  4FF4 A;  2BDN A;  2K6A A;  3A8I E;  1B53 A;  3STB D;  3C46 A;  1YJN A;  4KV6 A;  2YTV A;  4KHZ A;  1Y1W G;  5IP7 G;  1FYC A;  2K14 A;  2A6E D;  1I6H B;  3VYU A;  4PQX A;  4OWX B;  2SEB D;  2HD3 A;  4Y7N H;  1WCM G;  2K1B A;  1XPO A;  1STE A;  5M5X H;  3K0X A;  1YZ6 A;  4LF9 L;  4YCW A;  1K8O A;  4RGT A;  1CZG A;  5M3M H;  1PRT F;  1MD2 D;  3HOZ G;  4CKE A;  5C44 H;  1W6J A;  1TS4 A;  2V1C C;  1VQJ A;  3KF6 B;  3MA2 B;  1V1P B;  2EYF A;  4Z9C B;  1ASY A;  1JWM D;  1XX8 A;  3SHL A;  4UPA A;  2F0Q A;  1IBM Q;  1L1O A;  3KBX A;  3K5M A;  2EJF C;  4F87 A;  3J81 i;  5LL6 S;  1S5C D;  1SJE D; 
#chains in the Genus database with same CATH homology
 4IPD A;  5J3B A;  1TWG H;  1XMO L;  3ERS X;  4GKK L;  1QVG A;  4NXM L;  4OO1 G;  1X9N A;  1N32 L;  3S15 H;  1WCM H;  4BY7 G;  2KCM A;  3DM3 A;  3J7Z C;  3L2P A;  3PF5 A;  3F2C A;  4JOI C;  1IBL Q;  4LW1 A;  4GLV B;  4DV3 L;  4NXN L;  3GTG H;  2UXC Q;  3BJU A;  1VQF A;  3HOW H;  4GOP A;  1WI5 A;  4DV6 L;  2N8N A;  3I4M G;  5IYB H;  3U50 C;  1WFQ A;  5H1S E;  1VQP A;  3HOZ H;  5BR8 L;  1LYL A;  2QGQ A;  1VQ6 A;  4DR2 L;  3U4Z A;  4DV2 L;  2F3I A;  2E5L L;  4MNO A;  1A62 A;  2Y0S G;  1VQI A;  3RR5 A;  4LFC Q;  1MKH A;  1Y1V H;  2AWO A;  2AKW B;  4JI5 L;  3U58 A;  2R92 H;  4BXX G;  5IP9 H;  1U5K A;  1KIX A;  1VQK A;  1WOC A;  4JC0 A;  2VQF L;  3M9B A;  1SN8 A;  1HR0 W;  2LXJ A;  4YHH Q;  5AJ3 Q;  1VQE A;  3S16 H;  5M5W H;  3PIO A;  3RNU A;  4K0K L;  4A75 A;  3RZO H;  3T1H Q;  1VQB A;  1OXU A;  5IE8 A;  4POG A;  3HOY H;  5LMU Q;  2K4K A;  1PA6 A;  4A3G G;  4DR6 Q;  4BXX H;  2WAQ G;  1VQH A;  1OXT A;  2DUD A;  3T1Y L;  4JBJ A;  4YWK A;  4OX9 Q;  1X3F A;  3GTJ H;  1JB7 A;  1V9P A;  4DUZ Q;  3GD7 A;  4BY7 H;  4HID A;  1CSP A;  4DR1 Q;  4JI8 Q;  4HIO A;  1PH9 A;  5C0X J;  2HT1 A;  4JI6 Q;  1KL9 A;  3K8A A;  4AYB E;  2IHF A;  3I4M H;  4A76 A;  3PO3 G;  4JYA L;  1IZ6 A;  2F52 A;  2R7D A;  4QL5 A;  4IPG A;  3F2B A;  3AFQ A;  4MZ9 A;  1Q1B A;  2ASB A;  4B3S Q;  5C3E G;  4LUV A;  1M1K C;  4WJ4 A;  1PH2 A;  3I4N G;  4DV1 L;  5ELN A;  4LFA Q;  1U0L A;  3A5U A;  2UXB Q;  1KHI A;  3KF6 A;  3RN2 A;  1BKB A;  5HGQ A;  2LSS A;  2HIX A;  4JBW A;  1BBW A;  4X64 L;  1HJP A;  3BZC A;  3PSI A;  4DKA C;  4A3B G;  2EXD A;  1HNX L;  4A3F G;  1LTL A;  4MTN A;  3WWV A;  4A93 G;  2JQO A;  4HJ5 A;  1I94 Q;  1H95 A;  2UUC Q;  2VZA A;  4KI0 A;  2K5N A;  1FJG Q;  1S40 A;  1NE3 A;  1L0W A;  2Q2U A;  3H3V H;  1I3Q H;  5M3M G;  3A0J A;  1HR0 Q;  4WJ3 M;  4B3R Q;  4JBM A;  1VQN A;  3CCL A;  3HFZ B;  2I5L X;  1QVC A;  3I55 A;  2JA8 G;  2JK8 A;  2LXK A;  1IBM L;  3F2D A;  1HZC A;  3CPW A;  2VUM G;  4JI3 L;  4OWT B;  4XTC S;  4IOC A;  3PUZ A;  2VL6 A;  2PI2 A;  3M85 A;  3E9H A;  2UUB L;  3PO3 H;  1BVS A;  4DV7 Q;  3FHW A;  3MXN B;  4GNX B;  4AQY Q;  4LWC A;  4DK6 C;  4P75 A;  5C3E H;  3CCE A;  2GVA A;  3I4O A;  3A74 A;  1S72 A;  4OWW B;  3GTK H;  3I4N H;  1IBL L;  2UXC L;  1P8L A;  3CMA A;  1EFW A;  3J81 c;  4GS3 A;  4LF4 Q;  1I6H H;  3S1R H;  2BH8 A;  3EN2 A;  5ELO A;  1N34 L;  3UDI A;  4JI7 Q;  4OO1 I;  4A3B H;  2JA5 G;  1PVO A;  3F1Z A;  4A3F H;  1YNX A;  2MQH A;  1D7Q A;  3G6E A;  4JI2 Q;  4A93 H;  3UDX A;  1B8A A;  1CKM A;  2N49 A;  4OON A;  4LFC L;  5M5Y H;  4HIM A;  2IY5 B;  2B63 G;  3PF4 A;  4A3D G;  1UE6 A;  4EX5 A;  2OTJ A;  3AQQ A;  3KJO A;  1K0R A;  5M3F G;  2I5M X;  1K9M C;  1X3E A;  2JA6 H;  1SRU A;  2ATW A;  1VQ4 A;  5JJL A;  2K50 A;  2L15 A;  2JA8 H;  2AWN A;  1E24 A;  1PFS A;  2PMZ E;  3PCO B;  1G29 1;  4YHH L;  2VUM H;  3TS2 A;  1IXR A;  4O0A A;  5AJ3 L;  5IWA Q;  2NVY H;  3UDG A;  4GKJ Q;  2EIF A;  4GN4 B;  3NBH B;  3UDF A;  2QEX A;  4POF A;  3T1H L;  5JEA G;  1BBU A;  3D0F A;  4QJF A;  3PUV A;  5LMU L;  1Q7Y C;  4DR6 L;  1XNQ Q;  3G71 A;  1Q46 A;  4JG2 A;  1FGU A;  1KD1 C;  3CC2 A;  2VW9 A;  4P72 A;  1K8G A;  2OTL A;  4JI0 Q;  4P74 A;  4OX9 L;  3CCU A;  3K7U C;  4DUZ L;  1Q86 C;  1TWC H;  1JJ2 A;  1C0A A;  2MNA A;  3KJP A;  5GQO A;  1XMQ Q;  1CKO A;  4IJH A;  3HOY G;  4DR1 L;  4JI8 L;  1L2F A;  2Q2I A;  2OQK A;  4C3I H;  1PH6 A;  4JI6 L;  1VS0 A;  3I56 A;  3RZD H;  3ULL A;  2VNU D;  4LF7 Q;  2FXQ A;  2JA7 H;  2GN5 A;  3W1G A;  2JA5 H;  4P71 A;  4APV A;  1ASZ A;  2HIV A;  2ZTC A;  4GN3 B;  4B3S L;  3J80 i;  2B63 H;  4A3D H;  1N34 Q;  3S2H H;  2MO0 A;  3GTQ H;  5M3F H;  3PV0 A;  2C35 B;  4XIG S;  1OXV A;  4A3C G;  1I5F A;  4LFA L;  1X56 A;  3CPF A;  1Z47 A;  4DV4 Q;  2UXB L;  3H3V I;  2BH2 A;  1QZG A;  1TXY A;  3CCM A;  1SE8 A;  3CCS A;  3S2D H;  1AH9 A;  2IT1 A;  1B7Y B;  1X54 A;  2YYZ A;  1JMC A;  3K7A H;  3OTO Q;  1YI2 A;  4X62 Q;  3PO2 G;  4QQB X;  2Q2H A;  1MJE A;  5JJI A;  2K5H A;  2NVX H;  4L5T A;  1LM0 A;  4LF8 Q;  1CUK A;  4IO9 A;  1I94 L;  2UUC L;  2RCN A;  4H02 A;  1KRT A;  1L1O C;  1FJG L;  1VCI A;  5C4J H;  3TQY A;  2NZH A;  1HR0 L;  2KCT A;  1Q1E A;  4B3R L;  2GVB A;  4R4O A;  1HNZ Q;  4DR7 Q;  1WJJ A;  1W3S A;  1J5E Q;  3F8T A;  4LUO A;  4GNX A;  3JAM i;  4TVA B;  1K73 C;  1JE5 A;  3A5Z B;  2CQO A;  3GTL H;  4L5R C;  2OCE A;  4LF6 Q;  1JJC B;  2E2H H;  1E3P A;  4IJL A;  5FJ8 G;  3HOX G;  4DV7 L;  4AQY L;  4GOP C;  2E2J H;  4B3T Q;  1EQQ A;  1X3G A;  3HKZ G;  1YIJ A;  4LFB Q;  1NMF A;  1NTG A;  2XGT A;  3H0G G;  1WYD A;  4LF5 Q;  4LF4 L;  4A3C H;  3KFU A;  5GRO A;  2WP8 J;  2F4V Q;  3PGZ A;  1VQ5 A;  4DUY Q;  4JI7 L;  1Y14 B;  1NY4 A;  1OXX K;  1NBW A;  2YV5 A;  1LUZ A;  5IT9 c;  5LMN W;  3PO2 H;  5JJK A;  1KC8 C;  1KQS A;  2ID0 A;  5FLX c;  4JI2 L;  3S1N H;  2YU9 H;  2UU9 Q;  4O2D A;  1PH7 A;  3S1Q H;  4DR5 Q;  3GTP H;  1N33 Q;  1TWA H;  4YY3 Q;  2BA0 A;  3CF5 A;  1YHB A;  1EIF A;  2A1A A;  3PUX A;  5IWA L;  4GKJ L;  4IOA A;  2D0P A;  1GO3 E;  1N9W A;  3EBE A;  3CCV A;  5HY6 A;  4R1J A;  1XNQ L;  1GD7 A;  3NEM A;  4LUZ A;  1K83 H;  2MFI A;  3HOX H;  5FJ8 H;  4A3M G;  1YHQ A;  2JA6 G;  4JI0 L;  5JEA J;  1I50 H;  4L5S A;  1A8V A;  2K5V A;  1YJW A;  2AMC B;  4NB3 A;  5DLQ E;  4A3J G;  1W2B A;  4DR3 Q;  1XMQ L;  3H0G H;  4X6A H;  2NN6 G;  1X55 A;  2CFM A;  2EQS A;  4JV5 L;  1HZA A;  1Q8K A;  4IPH A;  2JEB I;  3BZK A;  4JI4 Q;  4LF7 L;  1A63 A;  4A3E G;  1EUJ A;  1K3R A;  1N8R C;  3KDF B;  3S24 A;  2Y0S E;  3CW2 C;  3EIV A;  2Z6K A;  3RLN A;  5IY0 A;  4HJA A;  4BY1 G;  1VQO A;  3CCQ A;  1IL2 A;  4X65 Q;  2ZTD A;  3JC6 6;  4PMW A;  4OXP A;  2JA9 A;  3S17 H;  3TRZ A;  1JJG A;  1VQM A;  4KHP Q;  2JA7 G;  2HQL A;  4DV4 L;  5LMN Q;  4UP7 A;  3OTO L;  4QIW E;  4QGU A;  4X62 L;  5EAY A;  3ZJY C;  3RN5 A;  2YTX A;  2JE6 I;  3J80 c;  3ER0 A;  3K80 C;  1VQ8 A;  4LF8 L;  3J81 j;  1SR3 A;  3DLL A;  1T9H A;  3CXC A;  4A3M H;  1PH4 A;  4BA2 I;  4IFD G;  5E7N A;  1XNR Q;  3M7N A;  3KLW A;  1B70 B;  3ULJ A;  4A3J H;  1QZH A;  1UE1 A;  1HNZ L;  4DR7 L;  2KEN A;  1GKH A;  2QA4 A;  1J5E L;  4GN5 A;  4P73 A;  3PIP A;  4HJ7 A;  3CCJ A;  1N36 Q;  4QY7 A;  1KAW A;  1PH3 A;  1VQG A;  4LF6 L;  2A8V A;  3GTM H;  4AYB G;  4A3E H;  5GAG C;  2RF4 A;  1G6P A;  1EQR A;  2CWP A;  2JEA I;  3GTO H;  4BY1 H;  4B3T L;  3B6Y A;  1E1O A;  4JOI A;  1X65 A;  4ME3 A;  3JAM c;  1Q82 C;  2HHH Q;  3OYY A;  3M4O H;  4LFB L;  1HZ9 A;  3UE1 A;  4A3K G;  1VQ9 A;  1Q81 C;  4LF5 L;  1SFO H;  2RHQ B;  1MJC A;  4EQ5 A;  2F4V L;  5FLM G;  1FL0 A;  1KRS A;  2IHE A;  4DV5 Q;  4X66 Q;  4R4T A;  2R6G A;  4DUY L;  1HNW Q;  2UXD Q;  4C3J H;  1VQ7 A;  4DV0 Q;  2UUA Q;  1IBK Q;  4NPS A;  4GLX A;  3RLF A;  4DAY B;  1RIP A;  1EIY B;  2MO1 A;  3AEV A;  3ICE A;  2UU9 L;  2KHI A;  3LGJ A;  2KBN A;  2VQE Q;  4DR5 L;  1YEZ A;  1N33 L;  3M4Q A;  1G51 A;  4UP9 A;  4HJ9 A;  2ZTE A;  3L7Z C;  4YY3 L;  5GAH C;  2ZJR A;  2ALY B;  1E7Z A;  3I7F A;  1FVI A;  1C7Y A;  1SMX A;  1S3O A;  3KOJ A;  2BA1 A;  3IRB A;  4ALP A;  1V1Q A;  3KF8 B;  4PZ8 A;  5IYC G;  2NVT H;  1YBY A;  2AHO B;  4YWM A;  1YJ9 A;  1KXL A;  3G48 A;  3HKS A;  2K52 A;  4PZ7 A;  4HIK A;  2ZJQ A;  4A4I A;  1SLJ A;  4J15 A;  4DNI A;  1UWV A;  4BBR G;  2CKZ B;  5GAD C;  3HOV H;  1VQD A;  2JJQ A;  3CP0 A;  4DR3 L;  4A3K H;  4JBK A;  4BBS G;  3KDF A;  4JI1 Q;  3CC7 A;  1YIT A;  4DR4 L;  1TWF H;  1CKN A;  1PYB A;  5FLM H;  3D31 A;  4DPG A;  1K8A C;  3CME A;  4LF9 Q;  4JI4 L;  2WB1 E;  1QUQ B;  1P16 A;  3GDE A;  1XPR A;  2PI2 E;  2IX1 A;  2ZM6 Q;  1EOV A;  2E8G A;  4X65 L;  4IPC A;  1YHA A;  3ULP A;  4B3M Q;  1MIU A;  3SGI A;  3FP9 A;  1OTC A;  4KHP L;  4Y52 H;  4LNQ A;  1V43 A;  3H15 A;  5LMN L;  3I2Z A;  2PQA B;  4YWL A;  3CAM A;  4R4C A;  2K75 A;  5IYC H;  1M90 C;  3M4P A;  4A3L G;  4FDB A;  1HH2 P;  3NEL A;  3W5O A;  5IYD G;  1E22 A;  2NN6 I;  3AYH B;  1VQC A;  1C9O A;  5GAE C;  2OQ0 A;  1RL2 A;  1Z9F A;  4GNX C;  4BBR H;  1XNR L;  2B3G A;  1EWI A;  4JCV E;  1PH1 A;  4GLA C;  1XPU A;  4IFD J;  2R93 G;  1CSQ A;  3TS0 A;  2NVQ H;  4PZ6 A;  1L1O B;  1XMO Q;  1TWH H;  1GM5 A;  2VY3 A;  3GO5 A;  4GKK Q;  4BBS H;  4NXM Q;  3PUW A;  3STB C;  3CC4 A;  1N32 Q;  4YCU A;  2R7Z G;  1A0I A;  3U4V A;  3W1B A;  1N36 L;  4BA1 I;  4DV3 Q;  4NXN Q;  4R4I A;  2IX0 A;  1PH5 A;  4AIM A;  4DV6 Q;  3MEF A;  3G4S A;  3L0O A;  1Q12 A;  2DGY A;  3PUY A;  1NMG A;  5BR8 Q;  4DR2 Q;  1VQA A;  2Z0S A;  4DV2 Q;  2E5L Q;  2HHH L;  3AFP A;  4DR4 Q;  4PG3 A;  5C0X I;  4GOP B;  4IFD I;  3VDY A;  4JI5 Q;  2I0Q A;  1XTD A;  1E1T A;  3HOU G;  1YVC A;  2E2I H;  1VQL A;  4A3G H;  5K36 G;  1HZB A;  4KLK A;  4DV5 L;  1D8L A;  4X66 L;  2UXD L;  2VQF Q;  1XJV A;  1CKN B;  2YTY A;  4A3L H;  3Q8D A;  1HNW L;  2VS1 A;  2D0O A;  4DV0 L;  1PH8 A;  1AE3 A;  2R7F A;  1IBK L;  2UUA L;  5IYD H;  3E9I A;  3K81 C;  2CCZ A;  3S1M H;  1NJI C;  3FKI G;  5C44 G;  4K0K Q;  4JV5 Q;  4UP8 A;  2CWA A;  2NZO A;  4RMF A;  2VQE L;  1O7I A;  1EYG A;  1JT8 A;  2R93 H;  2N78 A;  2PNH A;  1PHJ A;  3T1Y Q;  4AH6 A;  3OW2 A;  4UY8 C;  3BU2 A;  5C0X G;  2R7Z H;  3NEN A;  2WAQ E;  2OWO A;  3CCR A;  3STB D;  4DK3 C;  2H5X A;  1YJN A;  1QVF A;  1OXS C;  4A3I G;  2D62 A;  5C4X G;  2YTV A;  4KHZ A;  1UE5 A;  2XTI A;  5IP7 G;  1Y1W G;  4TQU S;  3CD6 A;  2K14 A;  1R9T H;  3RLO A;  3HKZ E;  3UE0 A;  4JYA Q;  3M3Y H;  4DAM A;  4OWX B;  1QUQ A;  2WB1 G;  1UE7 A;  4Y7N H;  3CQZ H;  2ZJP A;  4JI1 L;  3HOU H;  1WCM G;  2Z6K C;  2WFW A;  4C2M H;  1XPO A;  5M5X H;  1PV4 A;  1UEB A;  3K0X A;  1YZ6 A;  4DV1 Q;  4LF9 L;  3HOV G;  4YCW A;  3HOW G;  1PYS B;  5M3M H;  5IYB G;  1AE2 A;  2I5H A;  4X64 Q;  2ES2 A;  2ZM6 L;  3HOZ G;  3FKI H;  5C44 H;  1HNX Q;  2PQA A;  1SRO A;  2V1C C;  1VQJ A;  3KF6 B;  2Q2T A;  4B3M L;  1Y1V G;  2R92 G;  4L5Q A;  3TEH B;  4C3H H;  5IP9 G;  3KYH C;  1ASY A;  2KHJ A;  4HJ8 A;  4UPA A;  4R4Q A;  1X6O A;  1IBM Q;  2B29 A;  1GVP A;  4YCV A;  3TRE A;  2A19 A;  4JI3 Q;  1L1O A;  3S14 H;  3J7A 5;  4A3I H;  2N3S A;  5C4X H;  3J81 i;  1Y1W H;  5IP7 H;  1J6Q A;  1DGS A;  3E0E A;  4RG1 A;  2UUB Q;  1IYJ B;  2RHS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...