3U58A

Crystal structure of the tetrahymena telomerase processivity factor teb1 ab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahymena Teb1 AB
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein/dna
total genus 40
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A02
3NBHB 1QVFA 2FXQA 2D0OA 1B70B 4DV6L 4OO1I 1A62A 4JI0L 1K83H 1BKBA 2B3GA 4KI0A 4MZ9A 3CAMA 4AQYL 4R4TA 3J80c 4BA2I 1CSPA 3KFUA 3I2ZA 4XIGS 5IP9G 1DGSA 1Y1WG 1PHJA 1AH9A 5GAHC 1EIYB 2R93H 1WOCA 2B63H 1L1OA 4B3MQ 4BBSH 1XNQQ 1G51A 1MIUA 3NENA 3SGIA 4JI7L 3CCUA 1ASZA 1I3QH 3DM3A 4R4QA 4JG2A 4POFA 1U5KA 4DR7Q 2RCNA 1SFOH 2NVXH 2E8GA 3CCSA 3GTMH 1SR3A 3HOWH 4A3BH 1HH2P 4GN4B 4QGUA 3GTJH 3G6EA 1YHQA 1B8AA 3DLLA 4LF6Q 1U0LA 3CXCA 2ES2A 1T9HA 4DR2Q 4HJ5A 3F2BA 4DUYQ 3S16H 3F2CA 2Z6KA 1VQDA 3G4SA 2QA4A 4A3IG 4LFCQ 5C0XG 1JJCB 3I7FA 4DAMA 3ULLA 4C3HH 2CWAA 4UP7A 5C0XJ 1PH4A 1XNRQ 1MKHA 1S40A 1RIPA 3TRZA 4OWXB 1A63A 3WWVA 2A8VA 3PV0A 3AFQA 5C4JH 4DV7L 2GVBA 3CCEA 1HNWQ 1YHAA 3GTKH 4B3ML 4Y7NH 4LF8Q 5DLQE 4DV2L 1I6HH 5LMUL 1PH2A 4QIWE 3AQQA 5E7NA 2ZM6Q 1IBLQ 4YY3Q 1IBKQ 2HT1A 4GKJQ 1KD1C 3GTPH 1FGUA 3GTQH 5M5YH 2OCEA 2HIVA 3ERSX 3H0GG 2PMZE 2RHSB 3ER0A 4DR1Q 1VQ5A 3CCLA 1N32Q 2UUBQ 4B3SQ 5IP9H 1TWFH 3J81j 1UE1A 4DUYL 4ALPA 1LYLA 1PH9A 1SN8A 4H02A 3B6YA 3I56A 2ALYB 3K7UC 4AH6A 4NXMQ 2R7FA 4JI4L 3M7NA 4A3MG 1J5EL 4DR5L 2ZJPA 4QY7A 1XPOA 2NVTH 4JYAL 1XNRL 1KXLA 5JJLA 5GAEC 4JBMA 3FP9A 5LMNL 1KC8C 1HZ9A 1YHBA 4LF9Q 2K14A 1SROA 1X3EA 4WJ4A 4PZ7A 4LF8L 5BR8Q 4X65Q 1XJVA 4A3LH 2AWNA 3S2HH 4A3IH 4A3FG 5JEAJ 3PUZA 3VDYA 4IFDG 3PO2G 4HIOA 4GLVB 1Z9FA 4DR1L 3M9BA 5M5WH 4IFDJ 1VQ8A 3I4MG 1VQFA 4C3JH 2DGYA 1EUJA 1X9NA 3AEVA 2UU9Q 1SLJA 1SRUA 4YWKA 2VQEQ 3EBEA 2V1CC 3IRBA 1QVGA 3GTGH 4JI2Q 4B3RL 1JMCA 1SE8A 2EQSA 3A0JA 4NPSA 1HNXQ 2R7DA 1VQMA 4GLXA 1R9TH 4DR3Q 4NXNQ 4LF9L 3KJPA 2JA6G 2JA9A 3H0GH 1PYSB 4JOIA 3I55A 3CPFA 2ASBA 1C0AA 1N9WA 1PH8A 1A0IA 3PF5A 1VQ6A 2F4VL 1Q8KA 3JC66 1YNXA 5BR8L 4KHPL 2HIXA 1Q82C 4HIMA 4OO1G 1JJGA 3RN2A 3TS2A 2QGQA 4R4OA 4JV5Q 1NY4A 4A3MH 3CQZH 2PQAB 1Q7YC 2OQKA 1UE7A 2R93G 3CC4A 1RL2A 1Q1BA 2C35B 3JAMi 3F2DA 5HGQA 3S24A 3BZKA 4JI2L 4RMFA 1V43A 1VQCA 2N3SA 1VQBA 1VQIA 1W3SA 3GDEA 1K0RA 2NZOA 4OX9L 1IBML 2Q2TA 2CQOA 4A3FH 3CMAA 4WJ3M 4UPAA 3K81C 4DR3L 1LTLA 1VQJA 2K50A 4P72A 3ULJA 2AHOB 4DV1L 3PO2H 5FLXc 4GOPB 2UXBQ 1X6OA 5JJKA 1VQNA 1YBYA 2VZAA 3L7ZC 3I4MH 3KF6B 3CD6A 1HNZL 2CCZA 4EX5A 2JA5G 3S1MH 1EQQA 3UDIA 4IPGA 4PG3A 3PGZA 3PUYA 5IWAL 2AWOA 1KQSA 1QUQB 1GO3E 3S15H 5M3FG 3CCMA 1GKHA 1X56A 1OXVA 4DKAC 2JA7G 1XMQQ 2JA6H 1K8AC 3RLOA 1I50H 1VQEA 1X54A 3K0XA 2JEAI 3H3VI 3HOXG 4QQBX 1N36L 2CWPA 4J15A 1BVSA 4DV5L 2HHHQ 4LW1A 1KHIA 3NELA 5GROA 4A3JG 1N33L 1N34L 2OQ0A 4GN3B 1L0WA 1VQAA 2KHIA 4IO9A 1JJ2A 2Y0SE 2VY3A 3I4NG 2UXBL 1VQ9A 3NEMA 4X62Q 5C3EG 3W5OA 2PNHA 4P73A 1YI2A 3CCRA 2Y0SG 4JI3L 1XMOL 3J80i 4YHHQ 1I94Q 4BBRG 3K80C 4B3TQ 4A3EG 4DK6C 1KAWA 4A75A 4JI5Q 4A93G 1NE3A 2K52A 1OXUA 1XMQL 2VQFQ 1CKMA 3M4OH 4ME3A 2NVQH 4OONA 5IY0A 4DUZQ 1JT8A 1EWIA 2JA5H 4GKKQ 1FJGQ 3I4OA 4IOAA 1E3PA 4PZ8A 1E24A 4YWLA 3KJOA 4JI6Q 3KOJA 4KHZA 1HR0W 3RNUA 5M3FH 1VCIA 4X62L 1XNQL 2JA7H 3J81i 3HOZG 2N49A 4JBWA 1YIJA 4DR7L 4LUZA 1BBWA 3HOXH 4YHHL 1I94L 2N78A 1AE2A 2MO0A 2HQLA 4LF6L 2ATWA 2R6GA 4BY7G 4Y52H 2IHEA 4A3JH 3S1NH 2BH8A 1HZCA 2CFMA 4QL5A 4LUVA 4LF7Q 4DR2L 2VQFL 3PUXA 4LFCL 4XTCS 2Q2IA 4JI1Q 2F3IA 3STBC 3UDGA 3I4NH 1E1OA 4DUZL 1X55A 5M5XH 5C3EH 3TS0A 1PH5A 1MJCA 1N8RC 4TVAB 4GKKL 1IL2A 1FJGL 4JBKA 3A74A 1KL9A 4BBRH 1VQOA 2R7ZG 4JI8Q 4A3EH 1HNWL 2D0PA 3KDFB 2WAQE 4DV4Q 1PV4A 3RLNA 2VS1A 3K7AH 2IX1A 4A93H 4K0KQ 3RLFA 4PZ6A 4UP9A 1LM0A 3OYYA 2UXCQ 2WAQG 2LXJA 1GVPA 1VQGA 5JEAG 5FJ8G 2QEXA 2ZM6L 1IBLL 4YY3L 1IBKL 1OTCA 4GKJL 4IJLA 4LF4Q 1X65A 1EOVA 1E22A 4A3DG 1Q12A 4GS3A 3D31A 3G71A 4LF5Q 4DR6Q 4IPDA 3GD7A 1N32L 4NB3A 2E2JH 2UUBL 3F1ZA 4B3SL 2VL6A 5ELNA 4YWMA 4DK3C 1UE5A 1Q86C 1OXTA 4HIKA 5GAGC 4IPHA 4DV0Q 2NN6I 1YJWA 2ZJRA 4NXML 3HOZH 3AYHB 3UE0A 4P74A 4GOPC 3ULPA 4LFAQ 1V1QA 2JEBI 4DPGA 3CCJA 1BBUA 4PMWA 4BY1H 4DV4L 4BY7H 1C7YA 1Y1VG 3CCQA 3TQYA 2RHQB 1KRSA 4X65L 5J3BA 3U50C 2UXCL 3LGJA 1I5FA 4X66Q 2ID0A 3M3YH 3PUVA 2R92G 1TWCH 3BJUA 2OWOA 1G291 3D0FA 2JQOA 1FL0A 2CKZB 4IOCA 2UUAQ 3CF5A 2BH2A 2YTYA 4P75A 2I0QA 3CMEA 2BA1A 1M1KC 5ELOA 2UU9L 3PO3G 3MEFA 1IYJB 2EIFA 2VQEL 2Q2UA 5IE8A 4X64Q 1YITA 1EYGA 4LUOA 4DV3Q 2IX0A 2K5HA 2Z0SA 3HFZB 4O0AA 4OXPA 3Q8DA 4YCUA 3JAMc 5LMNW 5FJ8H 4A76A 1VQPA 1HNXL 2K75A 1HR0Q 2H5XA 4NXNL 4A3DH 1L2FA 3UDXA 1XPUA 3HOVG 3PUWA 4FDBA 1WYDA 2AMCB 3RR5A 1CKNA 2JJQA 1QVCA 1XTDA 4GNXB 3E0EA 5IYBG 4JBJA 1YEZA 3S1QH 1G6PA 2IHFA 2YYZA 2I5MX 1HZAA 3T1HQ 4IJHA 3U4VA 1VQ4A 4JV5L 1YJNA 4DV6Q 2A1AA 1QUQA 3KYHC 2ZTCA 1QZGA 1J6QA 1KRTA 3PSIA 4O2DA 5GADC 3MXNB 1SMXA 5AJ3Q 3KF8B 1D7QA 2E2HH 1Y1VH 2AKWB 1P16A 4IPCA 4KLKA 4AIMA 2IY5B 5FLMG 4DV3L 4HIDA 1GD7A 2UUCQ 1E1TA 4EQ5A 1S3OA 1PYBA 4R4CA 1Q46A 1YVCA 3J7A5 4JI7Q 4HJAA 1VQ7A 2E2IH 3ZJYC 2R92H 1CUKA 4RG1A 1XPRA 2R7ZH 2KENA 2KHJA 1WCMG 3CCVA 2DUDA 1UEBA 1IXRA 2Z6KC 4A3KG 3PO3H 4BXXG 1Z47A 1PH3A 3T1HL 2I5LX 2JA8G 1X3GA 2XTIA 4DR4L 1HJPA 3HOYG 5AJ3L 3RZDH 5GQOA 2N8NA 2MQHA 3HKSA 4DAYB 4APVA 2ZJQA 3GTLH 3HOVH 2K5NA 4JCVE 3BU2A 1TWGH 2OTLA 1WFQA 4DV7Q 1PFSA 2HHHL 1FVIA 2UUCL 5IYBH 3CC2A 1L1OB 3G48A 4DV2Q 5LMUQ 4C3IH 3OW2A 1QZHA 3U4ZA 3CW2C 2D62A 1O7IA 3W1GA 3L0OA 4A4IA 3STBD 3U58A 1VQLA 2K4KA 2MO1A 2E5LQ 2LXKA 1PH7A 4P71A 4BA1I 2NN6G 2VUMG 3TEHB 3BZCA 5FLMH 4B3TL 2WFWA 2MFIA 2YTXA 4L5QA 3J81c 4BY1G 2PI2E 4JI5L 4L5RC 5K36G 4POGA 4LFBQ 3S14H 4OWTB 4JI4Q 1YZ6A 5C4XG 2L15A 4GN5A 2ZTEA 1J5EQ 4DR5Q 1CSQA 1Y14B 5IYDG 4A3CG 1W2BA 4JYAQ 5IT9c 1WCMH 5LMNQ 1PH1A 2VNUD 3GO5A 3EIVA 4A3KH 4BXXH 1OXSC 2JA8H 5JJIA 4JI6L 4HJ8A 1TXYA 1Q81C 2VW9A 4OWWB 3KDFA 3S17H 4UY8C 3CP0A 3UE1A 2K5VA 1UE6A 3HOYH 1CKOA 4GLAC 1D8LA 1NJIC 1Q1EA 3A5ZB 1TWHH 1S72A 1MJEA 2E5LL 4A3GG 3TREA 2BA0A 1EIFA 3M4QA 1Y1WH 3E9HA 2F52A 2GN5A 1OXXK 1A8VA 3M4PA 4LFBL 4LF7L 4B3RQ 4HJ7A 1KIXA 4JOIC 4JI1L 2WB1E 4R4IA 5M3MG 1NTGA 3HKZE 1NMGA 3E9IA 2WB1G 2ZTDA 1PVOA 5C0XI 1WI5A 3HKZG 4LWCA 1JB7A 4L5TA 2F4VQ 2VUMH 2NZHA 3T1YQ 1K3RA 2WP8J 4JI8L 3UDFA 5IP7G 4YCVA 4K0KL 4GNXC 1UWVA 2A19A 3HOUG 4L5SA 2B29A 2KBNA 5C4XH 4A3CH 5IYDH 3H15A 2OTJA 1HZBA 1VQKA 3FKIG 4LNQA 4LF4L 5IYCG 2PQAA 4LF5L 1ASYA 3CC7A 4DR6L 3J7ZC 3ICEA 1E7ZA 1PA6A 3GTOH 5C44G 2LSSA 4OX9Q 2KCTA 1IBMQ 2YU9H 4HJ9A 2IT1A 2YV5A 4MNOA 4JC0A 4DV0L 4A3LG 2UXDQ 4DV1Q 2RF4A 4X6AH 4A3GH 4UP8A 4LFAL 1LUZA 3K8AA 1K9MC 1HNZQ 1V9PA 1IZ6A 4YCWA 3T1YL 4GOPA 5IWAQ 2Q2HA 3S1RH 3KF6A 1AE3A 3OTOQ 1NMFA 5HY6A 2GVAA 3CPWA 3F8TA 4GNXA 1JE5A 3RZOH 1X3FA 2XGTA 3PIPA 1YJ9A 5M3MH 1C9OA 4X66L 3A5UA 2B63G 4BBSG 1VS0A 1K8GA 2JK8A 4DNIA 1K73C 2YTVA 1WJJA 5H1SE 3PIOA 4JI0Q 2UUAL 3EN2A 3L2PA 1N36Q 2EXDA 3HOWG 4A3BG 4AQYQ 4IFDI 4DV5Q 5IP7H 2MNAA 3KLWA 1L1OC 4X64L 1N33Q 3HOUH 2JE6I 4MTNA 1N34Q 3AFPA 2NVYH 1GM5A 2UXDL 3S2DH 1B7YB 1H95A 3H3VH 3M85A 3FKIH 3PCOB 4QJFA 3PF4A 1CKNB 4DR4Q 1HR0L 1P8LA 5IYCH 4JI3Q 1TWAH 1VQHA 1XMOQ 1NBWA 3FHWA 4AYBE 5EAYA 3RN5A 2I5HA 1EQRA 2PI2A 4C2MH 4R1JA 4TQUS 4KHPQ 5C44H 1M90C 3OTOL 1EFWA 4AYBG 3W1BA 2KCMA 1PH6A
chains in the Genus database with same CATH superfamily
3NHHA 1EY6A 4IALA 4ZK9B 2FXQA 2N88A 3JAME 1XTCD 4JI0L 1K83H 2KA7A 4O42A 2B3GA 4MZ9A 3S9WA 2WINB 3J80c 2MUYA 4QIWB 1JQYD 4XIGS 3RD4A 4F87A 2PMZB 1EIYB 4OELB 4BBSH 1L1OA 4DR4L 1HFNA 4JI7L 1I3QH 2I46A 4JG2A 4DR7Q 1U5KA 2F0LA 2RCNA 1SFOH 4A3BH 4QGUA 1U0LA 4K2KA 3U9SA 2ICEC 4EQNA 4HJ5A 3S16H 3R3OA 4A3FB 1S5ED 1JJCB 5C0XJ 4UP7A 1A3UA 3QWNA 1SYDA 3TRZA 3LWEA 4DV7L 1HNWQ 1BBXC 5G3LF 4IUTA 3DM1A 1I6HH 3S15B 3AQQA 5J39A 4CDCC 2Q8TA 3VR6A 3NK9A 1FGUA 3GTQH 2OCEA 2HIVA 5JPMC 1I50B 5EPJA 4LAAA 2UUBQ 4B3SQ 3VR3A 1PH9A 4ALPA 2ALYB 3C1FA 4AH6A 2E2DC 5D3DA 4JYAL 1KXLA 3G6JB 5LMNL 1LABA 1GOZA 1L0YB 4WJ4A 1HXYD 2B8GA 2F03A 4X65Q 4KTAA 2AWNA 5C4ZA 3T56B 4DN4M 4A3FG 4JPBW 3VDYA 1IL8A 1Z9FA 4IFDJ 1E2WA 5C3WA 3FPUB 2DGYA 1U4LA 4ODGA 1SLJA 4YWKA 4CJ2C 3EBEA 2AUKA 1JWSD 1H9JA 4NPSA 2NYZD 1VQMA 4GLXA 2A6HD 2JA7B 5I9PA 3I55A 2NTSA 1A0IA 3HOXB 2F4VL 1YNJD 2F0EA 5C5MA 4HIMA 2XVSA 1SJED 3D3RA 5C3XA 4PNYA 4A3JB 1C8CA 1NY4A 2A5HA 2PQAB 4MIUA 2OQKA 4N9TA 1Q1BA 3H6MA 5C3EB 4ZKCB 2HCCA 1E2VA 3GDEA 1W3SA 1K0RA 2NZOA 1LT3D 4FNFA 4ID6A 1U4MA 2Q2TA 2CQOA 3W2DA 4A3FH 1AZPA 1QNUA 2NWGA 5E1FA 3ULJA 3E0JA 5JJKA 2UXBQ 4RHRA 1X6OA 1RHPA 3NE5B 2K05A 4X3UA 1TKWB 4DAVA 3UDIA 4PG3A 4CDFC 5IWAL 4CDDC 1ESFA 1GO3E 2NBFA 3GV3A 5E3FA 3S15H 2JA7G 1K8AC 1JE4A 1EZ8A 1I50H 1VQEA 1X54A 2K7VA 2CHBD 3WDNA 3HOXG 2L55A 3QR8A 4BY1B 3NELA 5ELFA 4A3JG 2GA4B 4GN3B 1VQAA 2F0SA 2KHIA 2Y0SE 2VY3A 2UXBL 3C46A 1CK1A 2EZVA 5C3EG 2PNHA 4JI3L 1XMOL 3J80L 3I72A 3J80i 2B8FA 4A75A 2Z4IA 5BN3A 1STNA 1KNEA 2ZXRA 4OONA 5FLXE 2EJGC 1JT8A 5IGEA 3OOCA 3KJOA 4C3JG 1WTXA 4KHZA 1D1KA 4JW0A 2K1BA 3RNUA 1GXDC 4X3SA 2JA7H 2N49A 1RJTA 1MGSA 3HOXH 3R2IA 1NUCA 2N78A 2MO0A 2HQLA 3LNNA 4A3JH 1Y69U 1Y1VB 3HRZC 1BCPF 2WKCA 4JI1Q 1TS3A 1VF7A 2F3IA 3STBC 1E1OA 5C3EH 1Z6HA 1IL2A 2KVMA 1HA6A 2R7ZB 2JSOA 2WAQE 4I65A 4DV4Q 4PZ6A 1XWEA 4FVMA 3OYYA 4K5VA 2UXCQ 5CV8A 5FJ8G 3VA5A 1B3AA 2ZM6L 1IBKL 2X69A 1E22A 1EOVA 1F2MA 4DR6Q 5CBEE 4NB3A 2VL6A 4KMUC 4DK3C 2N55A 2AQ2B 1OXTA 1R4PB 3LWUA 5CR3A 1SNOA 2OF1A 4IPHA 1K3BC 2NN6I 1GUWA 2VB3X 2ZXPA 1IW7D 4C3IB 4P74A 3ULPA 4LFAQ 5FO9B 4PMWA 4BY1H 3NWSA 4DV4L 1Y1VG 4XYOA 5TSSA 3O13A 1U4RA 2IX3A 2UXCL 3LGJA 1I5FA 1PFMA 3S14B 3PUVA 1RKNA 2JN4A 2AQ1B 2R7ZG 2CKZB 4IOCA 2UUAQ 3CF5A 1M4VA 4G7ZC 2VQEL 5I2YA 4A3KB 1LTSD 3C1EA 2O5JC 5IE8A 2JA8B 1LTTD 5CV6A 3T51B 2EXZA 3Q8DA 5FJ8H 3S17B 1ZXTA 4NXNL 5BN5A 3Q22A 2IJ0A 2CVRA 1WYDA 1I4XA 1CKNA 2JJQA 4NP5A 1Y1WB 2IHFA 2I5MX 1HZAA 4QF4A 1ILPA 1YJNA 4DV6Q 1QILA 2A1AA 1EY8A 2QDLA 4WRDA 1QNKA 3OIPA 3PSIA 4O2DA 2F0VA 3OHXC 1SMXA 1ZYRC 5GADC 5AJ3Q 1DONA 3KF8B 3GP7A 1Y1VH 4KLKA 4AIMA 1STHA 2F0QA 4X3TA 1E1TA 4R8NA 2OT2A 1D5MC 4HJAA 3ZJYC 2R7ZH 1QG7A 2DUDA 3SK4A 1IXRA 3NWTA 4A3KG 1Z47A 3PQIA 3D8GA 3MHBA 2JA8G 2RKSA 1LACA 4G7OC 5AJ3L 5KIXA 2N8NA 3KLRA 2K5NA 4UDUC 2F0FA 1E2ZA 5HURA 2PQEA 5LMUQ 4C3IH 1EIHA 3OW2A 4KY6A 2KEDA 2M00A 4WORA 3U4ZA 4DGZA 1B9MA 2X6LA 1HA5A 2O4XA 2E5LQ 2BE5C 1BCPB 4P71A 4BA1I 5F2DA 1CZWA 3BZCA 2WFWA 3R93A 4NDXA 4IQZA 2HQEA 4L5QA 3J81c 4L5RC 1B1ZA 4LFBQ 3S14H 5C5LA 1J5EQ 3S2DB 2VNUD 1SMYD 4DK0A 1TIID 4DNRB 4A3KH 2JA8H 4OWWB 3S17H 4UY8C 1FR3A 2LY7A 5J22A 4GLAC 1Q1EA 4IUQA 2E5LL 1A3VA 2E74C 4K8IA 3M4QA 4H7BA 1Y1WH 1CM9A 2GN5A 4LFBL 3K5MA 3IKJA 1JB3A 4B3RQ 5LHY1 2Q8IB 2F3WA 2JXMB 2WB1E 3ND9A 4R4IA 1NMGA 1PTOD 1JB7A 4FF1A 5IGCA 4K0KL 4GNXC 4J1MA 4ZRZA 2B29A 1B44D 2EY5A 1GUTA 1HZBA 4PMBA 5EKLA 1OO9B 1NR4A 2DY7A 1V8QA 1HFGA 2EY1A 3NTKA 4NW2A 5C4JB 4OIJA 2KCTA 1IBMQ 4HJ9A 2EYPA 2CW0D 3I8ZA 4AYBB 4J8QA 4EQOA 4XYQA 3NBIA 4DV1Q 4UP8A 3OIQA 1F9QA 1V9PA 5M5YB 4GOPA 3KLSA 4N9PA 1STGA 2Q2HA 3KF6A 3OTOQ 1DOLA 1KAAA 1X3FA 1C9OA 3A54A 4X66L 2JK8A 4RGTA 2YTVA 1WJJA 3X3MA 2NVTB 1F9RA 3L2PA 1N36Q 4H0LC 4DV5Q 2MNAA 3KLWA 3KF8A 2C9OA 2JE6I 1D5ZC 3S2DH 1B7YB 3H3VH 2FFKB 4QJFA 3PF4A 4HTHA 1WVLA 4R1JA 3ITPA 3OTOL 1EFWA 4K2LA 4AYBG 1PH6A 1QVFA 3W3AA 2D0OA 2XNAC 4OO1I 4F8MA 4RCOA 1JICA 4KI0A 1FD7D 3H0GB 1HTPA 4XQJA 1QJOA 1LTRD 4RH6A 3L9AX 1NNXA 1PHJA 3R2TA 1WOCA 1B3QA 1XNQQ 1G51A 3SGIA 1ASZA 3OWEB 4A3MB 2E8GA 3G6EA 1B8AA 2Z8LA 3CXCA 4FXKC 2FMMA 3A56A 2ES2A 1FYCA 4R8IA 4DUYQ 4DR2Q 3F2CA 5HGTA 2QA4A 4DAMA 3ULLA 3A7AB 3PO2B 1HCZA 4N8X1 1XNRQ 1MKHA 1S40A 1A63A 3WOFA 2A8VA 3S1QB 2D9UA 3PV0A 5C4JH 4HCEA 4CKEA 3CCEA 3GTKH 1QB5D 4M8AA 3J81L 1VDZA 2D2CC 5DLQE 4DV2L 4DU9A 5A35A 4YY3Q 1KD1C 5M5YH 3ERSX 3H0GG 5CV7A 1N32Q 3J81j 5KYLA 4DUYL 4H02A 1IKLA 2R7FA 2L1BA 4A3MG 2ZJPA 1SJHD 1XPOA 2RDGA 2NVTH 1XNRL 5GAEC 1PRTF 4XQNA 3H94A 1SROA 1X3EA 4S3SA 3RMHA 2KEEA 2MGSA 2R3ZA 3SDZA 1XJVA 4KN4C 3J81E 2B2UC 5JEAJ 3PO2G 4HIOA 3M4OB 3M9BA 4H44C 3T16A 2JA5B 1GJXA 4K6LA 4DF7A 4Q0FA 2Z6BA 4JI2Q 2PO4A 2F0JA 4BWGB 1HNXQ 5M3FB 3HS0C 3VYTA 2TMPA 3KJPA 1C0AA 3H0GH 2LKVA 1N9WA 2WACA 3PF5A 2J4XA 2JYOA 4KHPL 3JC66 1YNXA 2PW7A 4XDXA 1PLFA 1ZYRD 4QMGA 1IW7C 3S1NB 1SE3A 4ME5A 4A3MH 1EY5A 1UE7A 3CC4A 3I4NB 3JAMi 3ERQA 3NQTA 3S24A 2Y0SB 2N3SA 1VQBA 3TMEA 1O78A 4BBRB 4OX9L 4UPAA 1RTOA 3K81C 1LTLA 1VQJA 3PO2H 4P72A 5FLXc 4ILWA 3S1QH 3L7ZC 4OL7A 3BDOA 2JA5G 4EX5A 1F77A 3K6OA 2AWOA 4P2CB 1A6XA 1MI2A 4DA2A 5I4DA 5CV9A 5M3FG 1GKHA 5AFWA 3RLOA 5CC4A 1AFPA 4QQBX 3EJIA 4DAPA 3SEBA 1BVSA 2HHHQ 2B2WA 4LW1A 1KHIA 2K5WA 4BY7B 3SXHA 1PMRA 1N34L 4LJZC 5I6WA 1WD1A 2BE5D 1JJ2A 3I4NG 3EQLC 4P73A 3M3YB 2Y0SG 3H91A 2O5IC 5DEHA 4YHHQ 1Q8IA 2JP1A 3DMUA 4BBRG 4B3TQ 2K5DA 1K0SA 3TP7A 1OXUA 3M4OH 4ME3A 2F0OA 2WAQB 5IY0A 2JA5H 1BF4A 4IOAA 4Q5VA 1B9NA 4PZ8A 5FKAC 3Q23A 1KLGD 3KOJA 4O1NA 5M3FH 1Z7TA 2M2LA 1DOKA 5ISRA 4JBWA 4DR7L 1STYA 4OGQC 2F0NA 4YHHL 1AE2A 5KYIA 2ATWA 2PW5A 4BY7G 3S1NH 4LF7Q 1BDOA 2Q2IA 1X3PA 3I4NH 1PRTB 3TS0A 1X55A 4TVAB 5EJWA 1G2TA 2HDMA 5D65A 1CFMA 2ICIA 3A74A 4BBRH 2RCFA 4JI8Q 1HNWL 3PO3B 4V0BA 3K7AH 3RLNA 1AN8A 2RBMA 3RLFA 1I4QA 4UP9A 2VXWA 2J0TD 1SMYC 2WAQG 4IURA 5JEAG 3R8BA 2QEXA 1OTCA 1DXMA 4IJLA 1DYQA 4LF4Q 1Q12A 1HUNA 4LF5Q 3GD7A 1BQQT 4RWSC 2UUBL 2PZTA 4B3SL 3K5NA 1TWGB 4KD4A 4U68A 5ELNA 1UE5A 4HMIA 2KJXA 1H9MA 4GOPC 3NQIA 5ELCA 1I6VC 1SDFA 1V1QA 2JEBI 1BBUA 1ENAA 3KUPA 3I4LA 3TZUA 4BY7H 1C7YA 5KGUA 3TQYA 2RHQB 4FP5D 4X65L 5J3BA 3KBXA 1PTOC 5NUCA 1TS4A 3M3YH 4HR7B 2QW7A 3Q24A 3TBIB 1BR9A 4P75A 1M1KC 1WCMB 3U9OA 4L8JA 2Z1CA 4HCSA 1SSOA 3MEFA 3PO3G 2EE1A 4ZCKA 1EU3A 1LT5D 2K5HA 1SYBA 4OXPA 4YCUA 1A3TA 5JEAH 1CHPD 4HMJA 1HR0Q 3HOYB 1T5EA 2ZXOA 5IIFA 3QOJA 2MPMA 2AMCB 2CW0C 1QVCA 1YEZA 2F0DA 5CGKA 3TDQA 3MXUA 1IYVA 3BDCA 5IOCA 3KYHC 5FLXL 1J6QA 1KRTA 4GZYC 1G2SA 1ENFA 1D7QA 4IPCA 3J7YW 2IY5B 4OIKA 4EQ5A 3J7A5 5BN4A 1S5CD 2R61A 4PQXA 1WCMG 1DCZA 1B4OA 2WV6D 1DJRD 3TP6A 3FDTA 3PO3H 4BXXG 1ESRA 2F0IA 2DN8A 2XTIA 4DFAA 1JWUD 2CH4W 1JR0D 4RGMA 2J7ZA 1RF2D 3HOYG 3HKSA 4DAYB 4APVA 2PYKA 4A3GB 4FXDA 3M7GA 1TWGH 3SK5A 1FVIA 1EL0A 1TU2B 1K8MA 3T4AC 4B08A 1XYIA 3S1RB 3CRLC 3CQZB 3VYSA 3CW2C 1O7IA 3A8JE 3C3LA 3U58A 2K4KA 2WB1B 1GUOA 2NN6G 3OWFA 2XIWA 2MFIA 2YTXA 5FOBB 4BY1G 1EOTA 4TSSA 1O80A 3SK6A 4OWTB 4JI4Q 4DR5Q 1Y14B 5IYDG 3OW7A 3KK7A 3MZ5A 1C4QA 3FEWX 1WCMH 4IN3A 2L4NA 1TS2A 4M1UB 4BXXH 4UHVA 1OXSC 5JJIA 4HJ8A 2RSNA 2F3VA 3EROA 3KBGA 1QOHA 1EIGA 2CQAA 4FO2A 3CP0A 1UE6A 3NPPA 4ZQ3A 3HOYH 3ONAB 1CQVA 2JA6B 1WTHA 1WTPA 4A3GG 2EJFC 2KCCA 3TREA 1A8VA 1KDBA 3VR4A 1KIXA 1J9OA 4JI1L 2R93B 2B63B 5CYUA 3HKZE 3H09A 1D5XC 2WB1G 4ZUIA 5C0XI 4ZYSA 2NN6H 1EYAA 3GTMB 2NZHA 3T1YQ 3GTJB 1UWVA 2A69C 3D6CA 2B2VC 1PZKD 2KOLA 3K0YA 5IYDH 4KD3A 3TP8A 1JWMD 4QB4A 5IT9E 3OMCA 4MHEA 4C3HB 5KNCA 2PQAA 4DR6L 2B2TC 3J7ZC 1TT2A 2IT1A 2YV5A 2Z4HA 3K59A 1Q3LA 4CKCA 2AUJD 4X6AH 4A3GH 1IYUA 4LFAL 1HNZQ 3GTPB 4YCWA 3T1YL 2PZWA 3S1RH 5G3LD 1SNCA 1NMFA 1TWFB 3F8TA 2B63G 3PIPA 1CZGA 1K73C 4C3IG 2UUAL 2EXDA 4AQYQ 4IFDI 3CU7A 4LMQD 1ET6A 3OMGA 1L1OC 1N33Q 3MEHA 1PFNA 3CRKC 1HPCA 1LTAD 1O7ZA 3S2HB 1JORA 4A3IB 1HRJA 5CORA 3NSWA 1NBWA 2IL8A 1TR5A 5M5WB 3I3CA 4TQUS 1M90C 3TN2A 1STEA 1KDAA 3W1BA 1AW7A 4DV6L 1B70B 1A62A 1UEAB 5DNFA 4R4TA 4AQYL 1UAPA 1CSPA 3KFUA 2X6GA 2EOTA 1Y1WG 1AH9A 2R93H 2B63H 3A55A 4B3MQ 3K5OA 1MIUA 2L12A 3NENA 5J1ZA 3CCUA 4POFA 3I70A 1CT1D 3CCSA 4CBVA 3GTMH 2PNRC 1HH2P 3GTJH 1YHQA 4LF6Q 3DLLA 3V2TA 4A3LG 3F2BA 2Z6KA 1VQDA 3G4SA 1KLUD 4A3IG 4LFCQ 1SAPA 4IUNA 2PPBC 5IGFA 1V1PB 4HSVA 4C3HH 2CWAA 2L5TA 5I2XA 2K6AA 4OWXB 3WWVA 3I4MB 3V96A 3AFQA 4XQQA 5ELEA 3S1MB 1YHAA 4DK1A 4B3ML 1C48A 3MVVA 5LMUL 1BOSA 3D6WA 2K01A 5E7NA 1IBLQ 4GKJQ 2Q8RE 3GTPH 3CCLA 3ER0A 2RHSB 4DR1Q 2LFNA 1M8AA 1TWFH 1HQMC 3SE0A 1SN8A 5EKIA 2L9HA 2EJMA 1GUSA 4NXMQ 3M7NA 3M4YA 1J5EL 2F1MA 1LLRD 1U9RA 2FJ2A 4JBMA 1HZ9A 1YHBA 4LF9Q 2K14A 4PZ7A 4A3LH 5CV5A 3S2HH 1Y8NB 4A3IH 3D4DA 3EA6A 1QCBD 4GLVB 4DR1L 3NP8A 5M5WH 4PMCA 3I4MG 1UUPA 1VQFA 2F0PA 1X9NA 2F0TA 3AEVA 2UU9Q 4KY5A 4RHSA 1GUGA 3IRBA 1QVGA 2KECA 4ZAIA 4B3RL 1SE8A 3A0JA 4G4KA 2F0KA 2F0MA 2R7DA 4LF9L 2ZT9C 1BUVT 3CPFA 5KEEA 2ASBA 3ZYYX 2HIXA 4OO1G 1JJGA 3RN2A 1STAA 4R4OA 5COYA 4JV5Q 2CH4A 1Y8OB 1LTBD 1Q7YC 1SE4A 3F2DA 5KNDA 5M5XB 1EZ6A 1H9SB 5HGQA 1HQRD 4RMFA 1VQIA 1IBML 4F88A 1BCPD 4A93B 4WJ3M 4EQPA 4IUPA 2AHOB 4DV1L 2IPKD 4CDEC 1YBYA 3I4MH 1O7YA 3CD6A 2CCZA 3S1MH 2MHVA 2K03A 3PGZA 4ZKBB 2KHSA 4DKAC 1I4RA 3EFXD 3K0XA 3H3VI 2PZUA 1N36L 2CWPA 3NTIA 4I7AA 4DV5L 1WTOA 3EVQA 4OO1H 2F0UA 1MSGA 2XWJB 3IL8A 4DXGA 3E5SA 1I4HA 3V05A 3NEMA 2XRSD 4RFBA 1FNVA 1AEXA 1UNSA 1O7LA 3CCRA 4DNTB 3HGBA 3PIP3 1PZID 4XT1B 1I94Q 3BDLA 5IGGA 1QE6A 1KAWA 4A93G 4JI5Q 1NE3A 2K52A 3SK8A 1CKMA 1EY7A 1PXUA 2VQFQ 3CHBD 4GKKQ 1FJGQ 3I4OA 1E3PA 1S4ZA 4YWLA 1EY4A 4JI6Q 1STBA 5I9OA 3OSOA 1HR0W 3SVMA 3KLSX 1XNQL 3J81i 3FRPB 4LUZA 5EKKA 1BBWA 4ZUJA 2KQ3A 2A68C 4C1NI 1I94L 3BYTB 2IHEA 2E2HB 1HZCA 2BDOA 4DR2L 2VQFL 1SNMA 1F9SA 1HUMA 4K8JA 1PH5A 5M5XH 1N8RC 4GKKL 3D4WA 1FJGL 2E2IB 2A69D 4JBKA 1KL9A 4HEDA 2EYHA 1BXTA 4A93H 3IAYA 1PV4A 2IX1A 1SEBD 3FVQA 4NMZA 2DJGC 1LM0A 4ABNA 2LXJA 4YY3L 1Y8PB 1X65A 4GS3A 3RZDB 4RCNA 3D31A 3GTLB 4IPDA 3HOVB 1N32L 3F1ZA 4YWMA 1QWYA 2A73B 3DWAA 1G8ZD 3A8IE 4DV0Q 1YJWA 1JOKA 1ICWA 3AU7A 4DPGA 3CCJA 2FMCA 3DWQA 5DM63 1NSNS 4E6IA 2DNEA 3BJUA 3D0FA 2BH2A 2I0QA 2H1EA 2BA1A 2MJ8A 1H9SA 5ELOA 5LL6S 1IYJB 2Q2UA 4X64Q 1YITA 1EYGA 4JI2L 2IX0A 1Q86C 3HFZB 4O0AA 1HNXL 4A76A 3SR1A 2K75A 2QEJC 2HUGA 2H5XA 2EYMA 4I7ZC 3UDXA 1WTRA 3HOVG 4FDBA 3RR5A 4HAEA 1XXGA 3TP5A 1B50A 4GNXB 1LTID 3E0EA 5IYBG 4IUVA 1RODA 4JBJA 1EYDA 3T1HQ 3D4RA 2LMCB 1VQ4A 2ZTCA 1MBYA 4KHVA 3A7LA 4N8FA 2E2HH 1P16A 3MA2B 5KRUA 2VUMB 3BVMA 1EU4A 1II3A 2UUCQ 1GD7A 4B9XA 1YVCA 4K6DA 4JI7Q 1VQ7A 3QOLA 2E2IH 1F9PA 2NZ1D 1F2ZA 2NUCA 3G7LA 1X3QA 3CCVA 1CTMA 2EYFA 1UEBA 2Z6KC 2Z9HA 4RGNA 3BZDB 2I5LX 3QG1A 3T1HL 5D14A 1X3GA 1MHWC 3GTOB 2NTTA 3IFDA 1TQOA 1HJPA 3GQBA 4ULLA 3RZDH 2ZJQA 3GTLH 3HOVH 4JCVE 3BU2A 1WFQA 2OXPA 4LK1C 4DV7Q 1PFSA 2C5CA 2HHHL 1NAPA 4K14A 5IYBH 2UUCL 3G48A 1S5FD 2HDLA 5JAVA 4WJWA 1B53A 1QZHA 1CI3M 3BS1A 3RZOB 5M3MB 1PZJD 3DXJC 4A4IA 2D5DA 4RKBA 4MTKA 1PH7A 3HKZB 3TEHB 2VUMG 4B3TL 3HEJA 2PI2E 3HOUB 1YZ6A 2NVYB 1D2BA 1CSQA 3P75A 4JYAQ 1NCVA 4KJOA 1W2BA 2XSCA 5D3IB 4JVZA 5IT9c 5LMNQ 4OEMB 3GO5A 1TWAB 1FNWA 1WD0A 1S5BD 2LS01 1Q81C 3I73A 3NTHA 4FF2A 1NJIC 1S72A 1MJEA 2BA0A 3MFGA 5ELBA 2RSOA 3E9HA 1DD2A 3J7AV 2EY2A 3T53B 1OXXK 4LF7L 2AQ3B 1SNDA 2L11A 1YNND 3P7JA 5M3MG 1V1OA 3MTSA 1R4QB 4YIJA 1EEID 1WI5A 3HKZG 2F4VQ 2B2YA 4L5TA 2VUMH 2NVXB 3HOWB 2WP8J 4JI8L 4YCVA 3HOUG 2KBNA 1ILQA 2EY6A 1CHQD 1VQKA 1F2YA 4LNQA 4LF4L 5IYCG 3VYRA 4XT3B 4LF5L 3MAQA 3CC7A 3ICEA 1PA6A 3GTOH 3FMCA 3HP3A 4RAUC 1EQTA 4MNOA 4JC0A 4Y7NB 1ET9A 1ONLA 1IKMA 1TY2A 1JOOA 2BDNA 2DJFC 3K8AA 1EWHA 5JJZA 1IZ6A 5DM73 3FPPA 5IWAQ 1AE3A 5HY6A 2GVAA 4GNXA 2K5QA 3RZOH 2XGTA 2HCIA 1YJ9A 1EY9A 5M3MH 4DNIA 2QKIC 4G7HC 3PIOA 2WKDA 3HOWG 1H9RA 4UAIA 4PV1C 2VB2X 4C56C 2QDBA 3HOUH 1GHJA 4MTNA 3AFPA 2NVYH 2RQXA 3LX0A 3DUZA 3HG9A 1J8IA 3M85A 1CKNB 1HR0L 5IYCH 1LT4D 3AB9A 1TWAH 1PRTD 1VQHA 2ENBA 3FHWA 1XMOQ 4JI3Q 4CJ1B 2I5HA 4B9WA 1BCPC 4EGVA 4QUFA 4C3JB 3VYUA 4CHTB 2TSSA 3K57A 4XXEA 5L37A 3AMUA 2E75C 3NBHB 3GTGB 1PTOF 3H3VC 1R9TB 1BKBA 4BA2I 3CAMA 5JOBA 3I2ZA 5EBCA 5IP9G 1DGSA 3MXPA 2A68D 5GAHC 3DM3A 4R4QA 4CKBA 4RGOS 2NVXH 1SR3A 3HOWH 4GN4B 1VMPA 1RCVD 1ML0D 2SDFA 1T9HA 1RD9D 4KN7C 1I4GA 3BVZA 2B39A 5C0XG 3I7FA 3MWYW 1PH4A 5T1IA 1DOMA 1RIPA 2GVBA 2SNMA 1HHVA 4KKSA 2HD3A 4Y7NH 4LF8Q 5M9OA 2G9DA 1KDCA 1KTKA 1PH2A 4V190 4QIWE 2ZM6Q 2IWHA 1IBKQ 2HT1A 4HSPA 5IT9L 3NUCA 2PMZE 3J80E 1VQ5A 1EY0A 3L3OC 4L63B 4K5XA 5IP9H 3QO2A 1UE1A 1LYLA 1SXTA 3B6YA 3I56A 1EEFD 3K7UC 5E4WC 4KKUA 4JI4L 4DR5L 2EYOA 4QY7A 5JJLA 3FP9A 1KC8C 4LF8L 1B2TA 5BR8Q 1W6KA 1X32A 3UI2A 1MSHA 2BOSA 3QIAA 5C0XH 3CKIB 3PUZA 4IFDG 1SYEA 3QB3A 2NVQB 1VQ8A 5FO8B 2EPBA 4C3JH 1EUJA 1SRUA 2VQEQ 1S5DD 2V1CC 3GTGH 1SYFA 1SBBB 1JMCA 2EQSA 1TVXA 1U4PA 1R9TH 3E3XA 4DR3Q 4NXNQ 4H13C 2JA6G 2JA9A 1PYSB 4JOIA 1PH8A 1VQ6A 1Q8KA 5BR8L 2A6ED 2RDFA 1Q82C 5C6AA 1SNPA 3TS2A 4J6HA 2QGQA 3CQZH 4IZ8A 2R93G 2B2UA 1RL2A 2C35B 3WOEA 1GHKA 3BZKA 1PFBA 2B2WC 1WTWA 1V43A 1VQCA 2SNSA 2K28A 4A3EB 4X3KA 3CMAA 2RA4A 3PMFA 4DR3L 2K50A 4IFDH 1LT6D 4GOPB 5EBDA 1Q90A 1VQNA 2VZAA 5KNBA 3KF6B 1HNZL 4C3HG 3VA7A 1EQQA 3K58A 4IPGA 1ZKOA 3PUYA 3RUZA 2SEBD 3MC0B 2E2JB 1KQSA 1QUQB 2K32A 1PTOB 1AP0A 3CCMA 1X56A 1OXVA 3HOZB 1XMQQ 3NBHA 2JA6H 4FF3A 2JEAI 2RDHA 1CA5A 4J15A 5DAUA 4DAYA 5GROA 1N33L 1SNQA 3A8KE 2OQ0A 1GUNA 3DEOA 1L0WA 4IO9A 3DHQA 2DY8A 1VQ9A 4X62Q 1MD2D 2OEOA 3W5OA 1YI2A 1TWCB 5IGBA 2V4DA 3K80C 1ENCA 3PIO3 4A3EG 4DK6C 2F0GA 3T13A 1D6EC 3BG3A 5E4XA 3F2UA 1XMQL 2NVQH 4KKTA 4DUZQ 5ELDA 1EWIA 5IODA 4BS9A 4A3DB 1E24A 3URYA 1VCIA 1PDQA 4X62L 3HOZG 5EQ0A 3Q6SA 1YIJA 4KY7A 3N6RA 5EPLA 4LF6L 4NKLA 2R6GA 4Y52H 2O2LD 2BH8A 4OHJA 2CFMA 4QL5A 4LUVA 2KCNA 1IHZA 3PUXA 4LFCL 4XTCS 3UDGA 2OTJA 4DUZL 1T5XD 1MJCA 2B2YC 3I90A 2R92B 4JK1C 1LO5D 1VQOA 4A3EH 1D1IA 2D0PA 2EDGA 2KUMA 3KDFB 4K0KQ 2VS1A 1RDPD 5CBAE 2EYJA 2QF7A 1GVPA 1VQGA 1IBLL 4GKJL 5JVH3 1PYWD 4A3DG 1JC7A 3BVGA 3G71A 3X3NA 3TZDA 1DZ1A 2E2JH 1EFID 1PTOH 3NXWA 1SE2A 4HIKA 1SYGA 5GAGC 4NXML 3HOZH 2ZJRA 2IW3A 2G5DA 3AYHB 3UE0A 3N52A 1KNAA 1G6ZA 5FO7B 1DM0B 4CGYB 1A2TA 3K5LA 3CCQA 1YNNC 1KRSA 3U50C 4QUCA 1JCKB 2QCPX 4X66Q 1RTNA 2ID0A 2P5ZX 2R92G 1TWCH 2OWOA 1G291 1F2LA 2JQOA 1FL0A 2F0WA 2YTYA 3CMEA 2EYLA 2FINB 2UU9L 2F0HA 2EIFA 3GTKB 4LUOA 4DV3Q 1EQVA 2Z0SA 3JAMc 5LMNW 1VQPA 1SYCA 2A74C 1G91A 4A3DH 1L2FA 5T1GA 1XPUA 1TWHB 3MFYA 3PUWA 2SOBA 1XTDA 2A6HC 1G6PA 2YYZA 2XWBB 4IJHA 3U4VA 4JV5L 1ZEQX 1I4PA 1QUQA 1YNJC 1QZGA 1K28A 1TY0A 3MXNB 3P20A 2AKWB 1K8OA 5EGTA 4U673 5FLMG 2K33A 1KABA 4DV3L 3HZXA 3E6ZX 4HIDA 1S3OA 1PYBA 4R4CA 5CV4A 1L0XB 1Q46A 2L0CA 1WTVA 4QCLA 2R92H 2PCFB 5C4XB 1CUKA 4RG1A 2M9VA 1XPRA 2KENA 2KHJA 4DXFA 4IUUA 4G57A 1PH3A 1TS5A 1CQFA 2YU9B 1PRTC 1EYCA 5GQOA 1VF5C 2MQHA 4MN3A 4TKOB 2OTLA 1V1PA 3SHLA 5IGDA 3CC2A 5I6YA 1L1OB 1ICFB 4DV2Q 1XX8A 2FHTA 5C4HA 5A2QL 1LV9A 3VR2A 5JVG3 3I91A 1HTLD 2D62A 3W1GA 3L0OA 3C2PA 2RVLA 3STBD 3VR5A 1VQLA 2MO1A 4WFN3 2LXKA 3QJYA 5LL6X 5FLMH 1LTGD 5K36G 4JI5L 4POGA 4FF4A 5C4XG 2L15A 4GN5A 2ZTEA 1FGBD 4A3CG 3OPOA 3FKIB 1PH1A 4RKLA 3EIVA 3BYYB 4C1NK 4C2MB 4JI6L 1TXYA 3Q0AA 5C44B 2VW9A 3KDFA 4FYDA 3UE1A 1FNUA 2K5VA 3MXGA 5A2QE 3J7AF 1CKOA 1D8LA 3GV6A 3A5ZB 1W6JA 1TWHH 1K83B 2WIIB 3IFTA 3DEPA 1EIFA 2E76C 2F52A 1H9KA 2MP1A 3M4PA 2I07B 4CJ0B 4HJ7A 4JOIC 1JOQA 4BBSB 1NTGA 2G9HD 2QILA 4FXGC 5CMDA 3E9IA 4L6TB 1I3QB 2ZTDA 2EVBA 1PVOA 1SFOB 4LWCA 4KHPQ 4A3BB 1K3RA 3UDFA 5IP7G 5K36H 2A19A 5EPKA 4L5SA 5JPNC 1VMCA 5C4XH 1A15A 1BNZA 4TRDA 3S16B 4A3CH 3H15A 3FKIG 2DNCA 2NB0A 2BCOA 4Z9CB 1ASYA 1AZQA 1CA6A 1E7ZA 3DWPA 2LSSA 5K5PA 5C44G 4OX9Q 2YU9H 4DV0L 1A2UA 2UXDQ 1I6HB 2RF4A 4R9WA 4KJNA 1LUZA 1K9MC 2H4OA 1E0BA 2F4IA 3GTQB 2XRQD 4HN7A 1BO0A 4RA8A 1WTQA 3TSSA 4F7XA 3CPWA 3JAML 1JE5A 4BBSG 3A5UA 3P1HA 1VS0A 2XN9C 4EVOA 1K8GA 2B2VA 5H1SE 2A6EC 4JI0Q 3EN2A 4KV6A 4A3BG 5IP7H 3MXNA 2B2TA 3K7AB 4X64L 1N34Q 2K04A 4KK7A 1GM5A 2UXDL 1H95A 3FKIH 4K5WA 3ND8A 3PCOB 4DR4Q 1P8LA 1NR2A 5FK9C 4AYBE 5EAYA 4ZLTF 2PI2A 1EQRA 3RN5A 4C2MH 5C44H 1EWCA 2KCMA
chains in the Genus database with same CATH topology
3NBHB 1QVFA 2FXQA 2D0OA 1B70B 4DV6L 4OO1I 1A62A 4JI0L 1K83H 1BKBA 2B3GA 4KI0A 4MZ9A 3CAMA 4AQYL 4R4TA 3J80c 4BA2I 1CSPA 3KFUA 3I2ZA 4XIGS 5IP9G 1DGSA 1Y1WG 1PHJA 1AH9A 5GAHC 1EIYB 2R93H 1WOCA 2B63H 1L1OA 4B3MQ 4BBSH 1XNQQ 1G51A 1MIUA 3NENA 3SGIA 4JI7L 3CCUA 1ASZA 1I3QH 3DM3A 4R4QA 4JG2A 4POFA 1U5KA 4DR7Q 2RCNA 1SFOH 2NVXH 2E8GA 3CCSA 3GTMH 1SR3A 3HOWH 4A3BH 1HH2P 4GN4B 4QGUA 3GTJH 3G6EA 1YHQA 1B8AA 3DLLA 4LF6Q 1U0LA 3CXCA 2ES2A 1T9HA 4DR2Q 4HJ5A 3F2BA 4DUYQ 3S16H 3F2CA 2Z6KA 1VQDA 3G4SA 2QA4A 4A3IG 4LFCQ 5C0XG 1JJCB 3I7FA 4DAMA 3ULLA 4C3HH 2CWAA 4UP7A 5C0XJ 1PH4A 1XNRQ 1MKHA 1S40A 1RIPA 3TRZA 4OWXB 1A63A 3WWVA 2A8VA 3PV0A 3AFQA 5C4JH 4DV7L 2GVBA 3CCEA 1HNWQ 1YHAA 3GTKH 4B3ML 4Y7NH 4LF8Q 5DLQE 4DV2L 1I6HH 5LMUL 1PH2A 4QIWE 3AQQA 5E7NA 2ZM6Q 1IBLQ 4YY3Q 1IBKQ 2HT1A 4GKJQ 1KD1C 3GTPH 1FGUA 3GTQH 5M5YH 2OCEA 2HIVA 3ERSX 3H0GG 2PMZE 2RHSB 3ER0A 4DR1Q 1VQ5A 3CCLA 1N32Q 2UUBQ 4B3SQ 5IP9H 1TWFH 3J81j 1UE1A 4DUYL 4ALPA 1LYLA 1PH9A 1SN8A 4H02A 3B6YA 3I56A 2ALYB 3K7UC 4AH6A 4NXMQ 2R7FA 4JI4L 3M7NA 4A3MG 1J5EL 4DR5L 2ZJPA 4QY7A 1XPOA 2NVTH 4JYAL 1XNRL 1KXLA 5JJLA 5GAEC 4JBMA 3FP9A 5LMNL 1KC8C 1HZ9A 1YHBA 4LF9Q 2K14A 1SROA 1X3EA 4WJ4A 4PZ7A 4LF8L 5BR8Q 4X65Q 1XJVA 4A3LH 2AWNA 3S2HH 4A3IH 4A3FG 5JEAJ 3PUZA 3VDYA 4IFDG 3PO2G 4HIOA 4GLVB 1Z9FA 4DR1L 3M9BA 5M5WH 4IFDJ 1VQ8A 3I4MG 1VQFA 4C3JH 2DGYA 1EUJA 1X9NA 3AEVA 2UU9Q 1SLJA 1SRUA 4YWKA 2VQEQ 3EBEA 2V1CC 3IRBA 1QVGA 3GTGH 4JI2Q 4B3RL 1JMCA 1SE8A 2EQSA 3A0JA 4NPSA 1HNXQ 2R7DA 1VQMA 4GLXA 1R9TH 4DR3Q 4NXNQ 4LF9L 3KJPA 2JA6G 2JA9A 3H0GH 1PYSB 4JOIA 3I55A 3CPFA 2ASBA 1C0AA 1N9WA 1PH8A 1A0IA 3PF5A 1VQ6A 2F4VL 1Q8KA 3JC66 1YNXA 5BR8L 4KHPL 2HIXA 1Q82C 4HIMA 4OO1G 1JJGA 3RN2A 3TS2A 2QGQA 4R4OA 4JV5Q 1NY4A 4A3MH 3CQZH 2PQAB 1Q7YC 2OQKA 1UE7A 2R93G 3CC4A 1RL2A 1Q1BA 2C35B 3JAMi 3F2DA 5HGQA 3S24A 3BZKA 4JI2L 4RMFA 1V43A 1VQCA 2N3SA 1VQBA 1VQIA 1W3SA 3GDEA 1K0RA 2NZOA 4OX9L 1IBML 2Q2TA 2CQOA 4A3FH 3CMAA 4WJ3M 4UPAA 3K81C 4DR3L 1LTLA 1VQJA 2K50A 4P72A 3ULJA 2AHOB 4DV1L 3PO2H 5FLXc 4GOPB 2UXBQ 1X6OA 5JJKA 1VQNA 1YBYA 2VZAA 3L7ZC 3I4MH 3KF6B 3CD6A 1HNZL 2CCZA 4EX5A 2JA5G 3S1MH 1EQQA 3UDIA 4IPGA 4PG3A 3PGZA 3PUYA 5IWAL 2AWOA 1KQSA 1QUQB 1GO3E 3S15H 5M3FG 3CCMA 1GKHA 1X56A 1OXVA 4DKAC 2JA7G 1XMQQ 2JA6H 1K8AC 3RLOA 1I50H 1VQEA 1X54A 3K0XA 2JEAI 3H3VI 3HOXG 4QQBX 1N36L 2CWPA 4J15A 1BVSA 4DV5L 2HHHQ 4LW1A 1KHIA 3NELA 5GROA 4A3JG 1N33L 1N34L 2OQ0A 4GN3B 1L0WA 1VQAA 2KHIA 4IO9A 1JJ2A 2Y0SE 2VY3A 3I4NG 2UXBL 1VQ9A 3NEMA 4X62Q 5C3EG 3W5OA 2PNHA 4P73A 1YI2A 3CCRA 2Y0SG 4JI3L 1XMOL 3J80i 4YHHQ 1I94Q 4BBRG 3K80C 4B3TQ 4A3EG 4DK6C 1KAWA 4A75A 4JI5Q 4A93G 1NE3A 2K52A 1OXUA 1XMQL 2VQFQ 1CKMA 3M4OH 4ME3A 2NVQH 4OONA 5IY0A 4DUZQ 1JT8A 1EWIA 2JA5H 4GKKQ 1FJGQ 3I4OA 4IOAA 1E3PA 4PZ8A 1E24A 4YWLA 3KJOA 4JI6Q 3KOJA 4KHZA 1HR0W 3RNUA 5M3FH 1VCIA 4X62L 1XNQL 2JA7H 3J81i 3HOZG 2N49A 4JBWA 1YIJA 4DR7L 4LUZA 1BBWA 3HOXH 4YHHL 1I94L 2N78A 1AE2A 2MO0A 2HQLA 4LF6L 2ATWA 2R6GA 4BY7G 4Y52H 2IHEA 4A3JH 3S1NH 2BH8A 1HZCA 2CFMA 4QL5A 4LUVA 4LF7Q 4DR2L 2VQFL 3PUXA 4LFCL 4XTCS 2Q2IA 4JI1Q 2F3IA 3STBC 3UDGA 3I4NH 1E1OA 4DUZL 1X55A 5M5XH 5C3EH 3TS0A 1PH5A 1MJCA 1N8RC 4TVAB 4GKKL 1IL2A 1FJGL 4JBKA 3A74A 1KL9A 4BBRH 1VQOA 2R7ZG 4JI8Q 4A3EH 1HNWL 2D0PA 3KDFB 2WAQE 4DV4Q 1PV4A 3RLNA 2VS1A 3K7AH 2IX1A 4A93H 4K0KQ 3RLFA 4PZ6A 4UP9A 1LM0A 3OYYA 2UXCQ 2WAQG 2LXJA 1GVPA 1VQGA 5JEAG 5FJ8G 2QEXA 2ZM6L 1IBLL 4YY3L 1IBKL 1OTCA 4GKJL 4IJLA 4LF4Q 1X65A 1EOVA 1E22A 4A3DG 1Q12A 4GS3A 3D31A 3G71A 4LF5Q 4DR6Q 4IPDA 3GD7A 1N32L 4NB3A 2E2JH 2UUBL 3F1ZA 4B3SL 2VL6A 5ELNA 4YWMA 4DK3C 1UE5A 1Q86C 1OXTA 4HIKA 5GAGC 4IPHA 4DV0Q 2NN6I 1YJWA 2ZJRA 4NXML 3HOZH 3AYHB 3UE0A 4P74A 4GOPC 3ULPA 4LFAQ 1V1QA 2JEBI 4DPGA 3CCJA 1BBUA 4PMWA 4BY1H 4DV4L 4BY7H 1C7YA 1Y1VG 3CCQA 3TQYA 2RHQB 1KRSA 4X65L 5J3BA 3U50C 2UXCL 3LGJA 1I5FA 4X66Q 2ID0A 3M3YH 3PUVA 2R92G 1TWCH 3BJUA 2OWOA 1G291 3D0FA 2JQOA 1FL0A 2CKZB 4IOCA 2UUAQ 3CF5A 2BH2A 2YTYA 4P75A 2I0QA 3CMEA 2BA1A 1M1KC 5ELOA 2UU9L 3PO3G 3MEFA 1IYJB 2EIFA 2VQEL 2Q2UA 5IE8A 4X64Q 1YITA 1EYGA 4LUOA 4DV3Q 2IX0A 2K5HA 2Z0SA 3HFZB 4O0AA 4OXPA 3Q8DA 4YCUA 3JAMc 5LMNW 5FJ8H 4A76A 1VQPA 1HNXL 2K75A 1HR0Q 2H5XA 4NXNL 4A3DH 1L2FA 3UDXA 1XPUA 3HOVG 3PUWA 4FDBA 1WYDA 2AMCB 3RR5A 1CKNA 2JJQA 1QVCA 1XTDA 4GNXB 3E0EA 5IYBG 4JBJA 1YEZA 3S1QH 1G6PA 2IHFA 2YYZA 2I5MX 1HZAA 3T1HQ 4IJHA 3U4VA 1VQ4A 4JV5L 1YJNA 4DV6Q 2A1AA 1QUQA 3KYHC 2ZTCA 1QZGA 1J6QA 1KRTA 3PSIA 4O2DA 5GADC 3MXNB 1SMXA 5AJ3Q 3KF8B 1D7QA 2E2HH 1Y1VH 2AKWB 1P16A 4IPCA 4KLKA 4AIMA 2IY5B 5FLMG 4DV3L 4HIDA 1GD7A 2UUCQ 1E1TA 4EQ5A 1S3OA 1PYBA 4R4CA 1Q46A 1YVCA 3J7A5 4JI7Q 4HJAA 1VQ7A 2E2IH 3ZJYC 2R92H 1CUKA 4RG1A 1XPRA 2R7ZH 2KENA 2KHJA 1WCMG 3CCVA 2DUDA 1UEBA 1IXRA 2Z6KC 4A3KG 3PO3H 4BXXG 1Z47A 1PH3A 3T1HL 2I5LX 2JA8G 1X3GA 2XTIA 4DR4L 1HJPA 3HOYG 5AJ3L 3RZDH 5GQOA 2N8NA 2MQHA 3HKSA 4DAYB 4APVA 2ZJQA 3GTLH 3HOVH 2K5NA 4JCVE 3BU2A 1TWGH 2OTLA 1WFQA 4DV7Q 1PFSA 2HHHL 1FVIA 2UUCL 5IYBH 3CC2A 1L1OB 3G48A 4DV2Q 5LMUQ 4C3IH 3OW2A 1QZHA 3U4ZA 3CW2C 2D62A 1O7IA 3W1GA 3L0OA 4A4IA 3STBD 3U58A 1VQLA 2K4KA 2MO1A 2E5LQ 2LXKA 1PH7A 4P71A 4BA1I 2NN6G 2VUMG 3TEHB 3BZCA 5FLMH 4B3TL 2WFWA 2MFIA 2YTXA 4L5QA 3J81c 4BY1G 2PI2E 4JI5L 4L5RC 5K36G 4POGA 4LFBQ 3S14H 4OWTB 4JI4Q 1YZ6A 5C4XG 2L15A 4GN5A 2ZTEA 1J5EQ 4DR5Q 1CSQA 1Y14B 5IYDG 4A3CG 1W2BA 4JYAQ 5IT9c 1WCMH 5LMNQ 1PH1A 2VNUD 3GO5A 3EIVA 4A3KH 4BXXH 1OXSC 2JA8H 5JJIA 4JI6L 4HJ8A 1TXYA 1Q81C 2VW9A 4OWWB 3KDFA 3S17H 4UY8C 3CP0A 3UE1A 2K5VA 1UE6A 3HOYH 1CKOA 4GLAC 1D8LA 1NJIC 1Q1EA 3A5ZB 1TWHH 1S72A 1MJEA 2E5LL 4A3GG 3TREA 2BA0A 1EIFA 3M4QA 1Y1WH 3E9HA 2F52A 2GN5A 1OXXK 1A8VA 3M4PA 4LFBL 4LF7L 4B3RQ 4HJ7A 1KIXA 4JOIC 4JI1L 2WB1E 4R4IA 5M3MG 1NTGA 3HKZE 1NMGA 3E9IA 2WB1G 2ZTDA 1PVOA 5C0XI 1WI5A 3HKZG 4LWCA 1JB7A 4L5TA 2F4VQ 2VUMH 2NZHA 3T1YQ 1K3RA 2WP8J 4JI8L 3UDFA 5IP7G 4YCVA 4K0KL 4GNXC 1UWVA 2A19A 3HOUG 4L5SA 2B29A 2KBNA 5C4XH 4A3CH 5IYDH 3H15A 2OTJA 1HZBA 1VQKA 3FKIG 4LNQA 4LF4L 5IYCG 2PQAA 4LF5L 1ASYA 3CC7A 4DR6L 3J7ZC 3ICEA 1E7ZA 1PA6A 3GTOH 5C44G 2LSSA 4OX9Q 2KCTA 1IBMQ 2YU9H 4HJ9A 2IT1A 2YV5A 4MNOA 4JC0A 4DV0L 4A3LG 2UXDQ 4DV1Q 2RF4A 4X6AH 4A3GH 4UP8A 4LFAL 1LUZA 3K8AA 1K9MC 1HNZQ 1V9PA 1IZ6A 4YCWA 3T1YL 4GOPA 5IWAQ 2Q2HA 3S1RH 3KF6A 1AE3A 3OTOQ 1NMFA 5HY6A 2GVAA 3CPWA 3F8TA 4GNXA 1JE5A 3RZOH 1X3FA 2XGTA 3PIPA 1YJ9A 5M3MH 1C9OA 4X66L 3A5UA 2B63G 4BBSG 1VS0A 1K8GA 2JK8A 4DNIA 1K73C 2YTVA 1WJJA 5H1SE 3PIOA 4JI0Q 2UUAL 3EN2A 3L2PA 1N36Q 2EXDA 3HOWG 4A3BG 4AQYQ 4IFDI 4DV5Q 5IP7H 2MNAA 3KLWA 1L1OC 4X64L 1N33Q 3HOUH 2JE6I 4MTNA 1N34Q 3AFPA 2NVYH 1GM5A 2UXDL 3S2DH 1B7YB 1H95A 3H3VH 3M85A 3FKIH 3PCOB 4QJFA 3PF4A 1CKNB 4DR4Q 1HR0L 1P8LA 5IYCH 4JI3Q 1TWAH 1VQHA 1XMOQ 1NBWA 3FHWA 4AYBE 5EAYA 3RN5A 2I5HA 1EQRA 2PI2A 4C2MH 4R1JA 4TQUS 4KHPQ 5C44H 1M90C 3OTOL 1EFWA 4AYBG 3W1BA 2KCMA 1PH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBH B;  1QVF A;  2FXQ A;  2D0O A;  1B70 B;  4DV6 L;  4OO1 I;  1A62 A;  4JI0 L;  1K83 H;  1BKB A;  2B3G A;  4KI0 A;  4MZ9 A;  3CAM A;  4AQY L;  4R4T A;  3J80 c;  4BA2 I;  1CSP A;  3KFU A;  3I2Z A;  4XIG S;  5IP9 G;  1DGS A;  1Y1W G;  1PHJ A;  1AH9 A;  5GAH C;  1EIY B;  2R93 H;  1WOC A;  2B63 H;  1L1O A;  4B3M Q;  4BBS H;  1XNQ Q;  1G51 A;  1MIU A;  3NEN A;  3SGI A;  4JI7 L;  3CCU A;  1ASZ A;  1I3Q H;  3DM3 A;  4R4Q A;  4JG2 A;  4POF A;  1U5K A;  4DR7 Q;  2RCN A;  1SFO H;  2NVX H;  2E8G A;  3CCS A;  3GTM H;  1SR3 A;  3HOW H;  4A3B H;  1HH2 P;  4GN4 B;  4QGU A;  3GTJ H;  3G6E A;  1YHQ A;  1B8A A;  3DLL A;  4LF6 Q;  1U0L A;  3CXC A;  2ES2 A;  1T9H A;  4DR2 Q;  4HJ5 A;  3F2B A;  4DUY Q;  3S16 H;  3F2C A;  2Z6K A;  1VQD A;  3G4S A;  2QA4 A;  4A3I G;  4LFC Q;  5C0X G;  1JJC B;  3I7F A;  4DAM A;  3ULL A;  4C3H H;  2CWA A;  4UP7 A;  5C0X J;  1PH4 A;  1XNR Q;  1MKH A;  1S40 A;  1RIP A;  3TRZ A;  4OWX B;  1A63 A;  3WWV A;  2A8V A;  3PV0 A;  3AFQ A;  5C4J H;  4DV7 L;  2GVB A;  3CCE A;  1HNW Q;  1YHA A;  3GTK H;  4B3M L;  4Y7N H;  4LF8 Q;  5DLQ E;  4DV2 L;  1I6H H;  5LMU L;  1PH2 A;  4QIW E;  3AQQ A;  5E7N A;  2ZM6 Q;  1IBL Q;  4YY3 Q;  1IBK Q;  2HT1 A;  4GKJ Q;  1KD1 C;  3GTP H;  1FGU A;  3GTQ H;  5M5Y H;  2OCE A;  2HIV A;  3ERS X;  3H0G G;  2PMZ E;  2RHS B;  3ER0 A;  4DR1 Q;  1VQ5 A;  3CCL A;  1N32 Q;  2UUB Q;  4B3S Q;  5IP9 H;  1TWF H;  3J81 j;  1UE1 A;  4DUY L;  4ALP A;  1LYL A;  1PH9 A;  1SN8 A;  4H02 A;  3B6Y A;  3I56 A;  2ALY B;  3K7U C;  4AH6 A;  4NXM Q;  2R7F A;  4JI4 L;  3M7N A;  4A3M G;  1J5E L;  4DR5 L;  2ZJP A;  4QY7 A;  1XPO A;  2NVT H;  4JYA L;  1XNR L;  1KXL A;  5JJL A;  5GAE C;  4JBM A;  3FP9 A;  5LMN L;  1KC8 C;  1HZ9 A;  1YHB A;  4LF9 Q;  2K14 A;  1SRO A;  1X3E A;  4WJ4 A;  4PZ7 A;  4LF8 L;  5BR8 Q;  4X65 Q;  1XJV A;  4A3L H;  2AWN A;  3S2H H;  4A3I H;  4A3F G;  5JEA J;  3PUZ A;  3VDY A;  4IFD G;  3PO2 G;  4HIO A;  4GLV B;  1Z9F A;  4DR1 L;  3M9B A;  5M5W H;  4IFD J;  1VQ8 A;  3I4M G;  1VQF A;  4C3J H;  2DGY A;  1EUJ A;  1X9N A;  3AEV A;  2UU9 Q;  1SLJ A;  1SRU A;  4YWK A;  2VQE Q;  3EBE A;  2V1C C;  3IRB A;  1QVG A;  3GTG H;  4JI2 Q;  4B3R L;  1JMC A;  1SE8 A;  2EQS A;  3A0J A;  4NPS A;  1HNX Q;  2R7D A;  1VQM A;  4GLX A;  1R9T H;  4DR3 Q;  4NXN Q;  4LF9 L;  3KJP A;  2JA6 G;  2JA9 A;  3H0G H;  1PYS B;  4JOI A;  3I55 A;  3CPF A;  2ASB A;  1C0A A;  1N9W A;  1PH8 A;  1A0I A;  3PF5 A;  1VQ6 A;  2F4V L;  1Q8K A;  3JC6 6;  1YNX A;  5BR8 L;  4KHP L;  2HIX A;  1Q82 C;  4HIM A;  4OO1 G;  1JJG A;  3RN2 A;  3TS2 A;  2QGQ A;  4R4O A;  4JV5 Q;  1NY4 A;  4A3M H;  3CQZ H;  2PQA B;  1Q7Y C;  2OQK A;  1UE7 A;  2R93 G;  3CC4 A;  1RL2 A;  1Q1B A;  2C35 B;  3JAM i;  3F2D A;  5HGQ A;  3S24 A;  3BZK A;  4JI2 L;  4RMF A;  1V43 A;  1VQC A;  2N3S A;  1VQB A;  1VQI A;  1W3S A;  3GDE A;  1K0R A;  2NZO A;  4OX9 L;  1IBM L;  2Q2T A;  2CQO A;  4A3F H;  3CMA A;  4WJ3 M;  4UPA A;  3K81 C;  4DR3 L;  1LTL A;  1VQJ A;  2K50 A;  4P72 A;  3ULJ A;  2AHO B;  4DV1 L;  3PO2 H;  5FLX c;  4GOP B;  2UXB Q;  1X6O A;  5JJK A;  1VQN A;  1YBY A;  2VZA A;  3L7Z C;  3I4M H;  3KF6 B;  3CD6 A;  1HNZ L;  2CCZ A;  4EX5 A;  2JA5 G;  3S1M H;  1EQQ A;  3UDI A;  4IPG A;  4PG3 A;  3PGZ A;  3PUY A;  5IWA L;  2AWO A;  1KQS A;  1QUQ B;  1GO3 E;  3S15 H;  5M3F G;  3CCM A;  1GKH A;  1X56 A;  1OXV A;  4DKA C;  2JA7 G;  1XMQ Q;  2JA6 H;  1K8A C;  3RLO A;  1I50 H;  1VQE A;  1X54 A;  3K0X A;  2JEA I;  3H3V I;  3HOX G;  4QQB X;  1N36 L;  2CWP A;  4J15 A;  1BVS A;  4DV5 L;  2HHH Q;  4LW1 A;  1KHI A;  3NEL A;  5GRO A;  4A3J G;  1N33 L;  1N34 L;  2OQ0 A;  4GN3 B;  1L0W A;  1VQA A;  2KHI A;  4IO9 A;  1JJ2 A;  2Y0S E;  2VY3 A;  3I4N G;  2UXB L;  1VQ9 A;  3NEM A;  4X62 Q;  5C3E G;  3W5O A;  2PNH A;  4P73 A;  1YI2 A;  3CCR A;  2Y0S G;  4JI3 L;  1XMO L;  3J80 i;  4YHH Q;  1I94 Q;  4BBR G;  3K80 C;  4B3T Q;  4A3E G;  4DK6 C;  1KAW A;  4A75 A;  4JI5 Q;  4A93 G;  1NE3 A;  2K52 A;  1OXU A;  1XMQ L;  2VQF Q;  1CKM A;  3M4O H;  4ME3 A;  2NVQ H;  4OON A;  5IY0 A;  4DUZ Q;  1JT8 A;  1EWI A;  2JA5 H;  4GKK Q;  1FJG Q;  3I4O A;  4IOA A;  1E3P A;  4PZ8 A;  1E24 A;  4YWL A;  3KJO A;  4JI6 Q;  3KOJ A;  4KHZ A;  1HR0 W;  3RNU A;  5M3F H;  1VCI A;  4X62 L;  1XNQ L;  2JA7 H;  3J81 i;  3HOZ G;  2N49 A;  4JBW A;  1YIJ A;  4DR7 L;  4LUZ A;  1BBW A;  3HOX H;  4YHH L;  1I94 L;  2N78 A;  1AE2 A;  2MO0 A;  2HQL A;  4LF6 L;  2ATW A;  2R6G A;  4BY7 G;  4Y52 H;  2IHE A;  4A3J H;  3S1N H;  2BH8 A;  1HZC A;  2CFM A;  4QL5 A;  4LUV A;  4LF7 Q;  4DR2 L;  2VQF L;  3PUX A;  4LFC L;  4XTC S;  2Q2I A;  4JI1 Q;  2F3I A;  3STB C;  3UDG A;  3I4N H;  1E1O A;  4DUZ L;  1X55 A;  5M5X H;  5C3E H;  3TS0 A;  1PH5 A;  1MJC A;  1N8R C;  4TVA B;  4GKK L;  1IL2 A;  1FJG L;  4JBK A;  3A74 A;  1KL9 A;  4BBR H;  1VQO A;  2R7Z G;  4JI8 Q;  4A3E H;  1HNW L;  2D0P A;  3KDF B;  2WAQ E;  4DV4 Q;  1PV4 A;  3RLN A;  2VS1 A;  3K7A H;  2IX1 A;  4A93 H;  4K0K Q;  3RLF A;  4PZ6 A;  4UP9 A;  1LM0 A;  3OYY A;  2UXC Q;  2WAQ G;  2LXJ A;  1GVP A;  1VQG A;  5JEA G;  5FJ8 G;  2QEX A;  2ZM6 L;  1IBL L;  4YY3 L;  1IBK L;  1OTC A;  4GKJ L;  4IJL A;  4LF4 Q;  1X65 A;  1EOV A;  1E22 A;  4A3D G;  1Q12 A;  4GS3 A;  3D31 A;  3G71 A;  4LF5 Q;  4DR6 Q;  4IPD A;  3GD7 A;  1N32 L;  4NB3 A;  2E2J H;  2UUB L;  3F1Z A;  4B3S L;  2VL6 A;  5ELN A;  4YWM A;  4DK3 C;  1UE5 A;  1Q86 C;  1OXT A;  4HIK A;  5GAG C;  4IPH A;  4DV0 Q;  2NN6 I;  1YJW A;  2ZJR A;  4NXM L;  3HOZ H;  3AYH B;  3UE0 A;  4P74 A;  4GOP C;  3ULP A;  4LFA Q;  1V1Q A;  2JEB I;  4DPG A;  3CCJ A;  1BBU A;  4PMW A;  4BY1 H;  4DV4 L;  4BY7 H;  1C7Y A;  1Y1V G;  3CCQ A;  3TQY A;  2RHQ B;  1KRS A;  4X65 L;  5J3B A;  3U50 C;  2UXC L;  3LGJ A;  1I5F A;  4X66 Q;  2ID0 A;  3M3Y H;  3PUV A;  2R92 G;  1TWC H;  3BJU A;  2OWO A;  1G29 1;  3D0F A;  2JQO A;  1FL0 A;  2CKZ B;  4IOC A;  2UUA Q;  3CF5 A;  2BH2 A;  2YTY A;  4P75 A;  2I0Q A;  3CME A;  2BA1 A;  1M1K C;  5ELO A;  2UU9 L;  3PO3 G;  3MEF A;  1IYJ B;  2EIF A;  2VQE L;  2Q2U A;  5IE8 A;  4X64 Q;  1YIT A;  1EYG A;  4LUO A;  4DV3 Q;  2IX0 A;  2K5H A;  2Z0S A;  3HFZ B;  4O0A A;  4OXP A;  3Q8D A;  4YCU A;  3JAM c;  5LMN W;  5FJ8 H;  4A76 A;  1VQP A;  1HNX L;  2K75 A;  1HR0 Q;  2H5X A;  4NXN L;  4A3D H;  1L2F A;  3UDX A;  1XPU A;  3HOV G;  3PUW A;  4FDB A;  1WYD A;  2AMC B;  3RR5 A;  1CKN A;  2JJQ A;  1QVC A;  1XTD A;  4GNX B;  3E0E A;  5IYB G;  4JBJ A;  1YEZ A;  3S1Q H;  1G6P A;  2IHF A;  2YYZ A;  2I5M X;  1HZA A;  3T1H Q;  4IJH A;  3U4V A;  1VQ4 A;  4JV5 L;  1YJN A;  4DV6 Q;  2A1A A;  1QUQ A;  3KYH C;  2ZTC A;  1QZG A;  1J6Q A;  1KRT A;  3PSI A;  4O2D A;  5GAD C;  3MXN B;  1SMX A;  5AJ3 Q;  3KF8 B;  1D7Q A;  2E2H H;  1Y1V H;  2AKW B;  1P16 A;  4IPC A;  4KLK A;  4AIM A;  2IY5 B;  5FLM G;  4DV3 L;  4HID A;  1GD7 A;  2UUC Q;  1E1T A;  4EQ5 A;  1S3O A;  1PYB A;  4R4C A;  1Q46 A;  1YVC A;  3J7A 5;  4JI7 Q;  4HJA A;  1VQ7 A;  2E2I H;  3ZJY C;  2R92 H;  1CUK A;  4RG1 A;  1XPR A;  2R7Z H;  2KEN A;  2KHJ A;  1WCM G;  3CCV A;  2DUD A;  1UEB A;  1IXR A;  2Z6K C;  4A3K G;  3PO3 H;  4BXX G;  1Z47 A;  1PH3 A;  3T1H L;  2I5L X;  2JA8 G;  1X3G A;  2XTI A;  4DR4 L;  1HJP A;  3HOY G;  5AJ3 L;  3RZD H;  5GQO A;  2N8N A;  2MQH A;  3HKS A;  4DAY B;  4APV A;  2ZJQ A;  3GTL H;  3HOV H;  2K5N A;  4JCV E;  3BU2 A;  1TWG H;  2OTL A;  1WFQ A;  4DV7 Q;  1PFS A;  2HHH L;  1FVI A;  2UUC L;  5IYB H;  3CC2 A;  1L1O B;  3G48 A;  4DV2 Q;  5LMU Q;  4C3I H;  3OW2 A;  1QZH A;  3U4Z A;  3CW2 C;  2D62 A;  1O7I A;  3W1G A;  3L0O A;  4A4I A;  3STB D;  3U58 A;  1VQL A;  2K4K A;  2MO1 A;  2E5L Q;  2LXK A;  1PH7 A;  4P71 A;  4BA1 I;  2NN6 G;  2VUM G;  3TEH B;  3BZC A;  5FLM H;  4B3T L;  2WFW A;  2MFI A;  2YTX A;  4L5Q A;  3J81 c;  4BY1 G;  2PI2 E;  4JI5 L;  4L5R C;  5K36 G;  4POG A;  4LFB Q;  3S14 H;  4OWT B;  4JI4 Q;  1YZ6 A;  5C4X G;  2L15 A;  4GN5 A;  2ZTE A;  1J5E Q;  4DR5 Q;  1CSQ A;  1Y14 B;  5IYD G;  4A3C G;  1W2B A;  4JYA Q;  5IT9 c;  1WCM H;  5LMN Q;  1PH1 A;  2VNU D;  3GO5 A;  3EIV A;  4A3K H;  4BXX H;  1OXS C;  2JA8 H;  5JJI A;  4JI6 L;  4HJ8 A;  1TXY A;  1Q81 C;  2VW9 A;  4OWW B;  3KDF A;  3S17 H;  4UY8 C;  3CP0 A;  3UE1 A;  2K5V A;  1UE6 A;  3HOY H;  1CKO A;  4GLA C;  1D8L A;  1NJI C;  1Q1E A;  3A5Z B;  1TWH H;  1S72 A;  1MJE A;  2E5L L;  4A3G G;  3TRE A;  2BA0 A;  1EIF A;  3M4Q A;  1Y1W H;  3E9H A;  2F52 A;  2GN5 A;  1OXX K;  1A8V A;  3M4P A;  4LFB L;  4LF7 L;  4B3R Q;  4HJ7 A;  1KIX A;  4JOI C;  4JI1 L;  2WB1 E;  4R4I A;  5M3M G;  1NTG A;  3HKZ E;  1NMG A;  3E9I A;  2WB1 G;  2ZTD A;  1PVO A;  5C0X I;  1WI5 A;  3HKZ G;  4LWC A;  1JB7 A;  4L5T A;  2F4V Q;  2VUM H;  2NZH A;  3T1Y Q;  1K3R A;  2WP8 J;  4JI8 L;  3UDF A;  5IP7 G;  4YCV A;  4K0K L;  4GNX C;  1UWV A;  2A19 A;  3HOU G;  4L5S A;  2B29 A;  2KBN A;  5C4X H;  4A3C H;  5IYD H;  3H15 A;  2OTJ A;  1HZB A;  1VQK A;  3FKI G;  4LNQ A;  4LF4 L;  5IYC G;  2PQA A;  4LF5 L;  1ASY A;  3CC7 A;  4DR6 L;  3J7Z C;  3ICE A;  1E7Z A;  1PA6 A;  3GTO H;  5C44 G;  2LSS A;  4OX9 Q;  2KCT A;  1IBM Q;  2YU9 H;  4HJ9 A;  2IT1 A;  2YV5 A;  4MNO A;  4JC0 A;  4DV0 L;  4A3L G;  2UXD Q;  4DV1 Q;  2RF4 A;  4X6A H;  4A3G H;  4UP8 A;  4LFA L;  1LUZ A;  3K8A A;  1K9M C;  1HNZ Q;  1V9P A;  1IZ6 A;  4YCW A;  3T1Y L;  4GOP A;  5IWA Q;  2Q2H A;  3S1R H;  3KF6 A;  1AE3 A;  3OTO Q;  1NMF A;  5HY6 A;  2GVA A;  3CPW A;  3F8T A;  4GNX A;  1JE5 A;  3RZO H;  1X3F A;  2XGT A;  3PIP A;  1YJ9 A;  5M3M H;  1C9O A;  4X66 L;  3A5U A;  2B63 G;  4BBS G;  1VS0 A;  1K8G A;  2JK8 A;  4DNI A;  1K73 C;  2YTV A;  1WJJ A;  5H1S E;  3PIO A;  4JI0 Q;  2UUA L;  3EN2 A;  3L2P A;  1N36 Q;  2EXD A;  3HOW G;  4A3B G;  4AQY Q;  4IFD I;  4DV5 Q;  5IP7 H;  2MNA A;  3KLW A;  1L1O C;  4X64 L;  1N33 Q;  3HOU H;  2JE6 I;  4MTN A;  1N34 Q;  3AFP A;  2NVY H;  1GM5 A;  2UXD L;  3S2D H;  1B7Y B;  1H95 A;  3H3V H;  3M85 A;  3FKI H;  3PCO B;  4QJF A;  3PF4 A;  1CKN B;  4DR4 Q;  1HR0 L;  1P8L A;  5IYC H;  4JI3 Q;  1TWA H;  1VQH A;  1XMO Q;  1NBW A;  3FHW A;  4AYB E;  5EAY A;  3RN5 A;  2I5H A;  1EQR A;  2PI2 A;  4C2M H;  4R1J A;  4TQU S;  4KHP Q;  5C44 H;  1M90 C;  3OTO L;  1EFW A;  4AYB G;  3W1B A;  2KCM A;  1PH6 A; 
#chains in the Genus database with same CATH topology
 3NHH A;  1EY6 A;  4IAL A;  4ZK9 B;  2FXQ A;  2N88 A;  3JAM E;  1XTC D;  4JI0 L;  1K83 H;  2KA7 A;  4O42 A;  2B3G A;  4MZ9 A;  3S9W A;  2WIN B;  3J80 c;  2MUY A;  4QIW B;  1JQY D;  4XIG S;  3RD4 A;  4F87 A;  2PMZ B;  1EIY B;  4OEL B;  4BBS H;  1L1O A;  4DR4 L;  1HFN A;  4JI7 L;  1I3Q H;  2I46 A;  4JG2 A;  4DR7 Q;  1U5K A;  2F0L A;  2RCN A;  1SFO H;  4A3B H;  4QGU A;  1U0L A;  4K2K A;  3U9S A;  2ICE C;  4EQN A;  4HJ5 A;  3S16 H;  3R3O A;  4A3F B;  1S5E D;  1JJC B;  5C0X J;  4UP7 A;  1A3U A;  3QWN A;  1SYD A;  3TRZ A;  3LWE A;  4DV7 L;  1HNW Q;  1BBX C;  5G3L F;  4IUT A;  3DM1 A;  1I6H H;  3S15 B;  3AQQ A;  5J39 A;  4CDC C;  2Q8T A;  3VR6 A;  3NK9 A;  1FGU A;  3GTQ H;  2OCE A;  2HIV A;  5JPM C;  1I50 B;  5EPJ A;  4LAA A;  2UUB Q;  4B3S Q;  3VR3 A;  1PH9 A;  4ALP A;  2ALY B;  3C1F A;  4AH6 A;  2E2D C;  5D3D A;  4JYA L;  1KXL A;  3G6J B;  5LMN L;  1LAB A;  1GOZ A;  1L0Y B;  4WJ4 A;  1HXY D;  2B8G A;  2F03 A;  4X65 Q;  4KTA A;  2AWN A;  5C4Z A;  3T56 B;  4DN4 M;  4A3F G;  4JPB W;  3VDY A;  1IL8 A;  1Z9F A;  4IFD J;  1E2W A;  5C3W A;  3FPU B;  2DGY A;  1U4L A;  4ODG A;  1SLJ A;  4YWK A;  4CJ2 C;  3EBE A;  2AUK A;  1JWS D;  1H9J A;  4NPS A;  2NYZ D;  1VQM A;  4GLX A;  2A6H D;  2JA7 B;  5I9P A;  3I55 A;  2NTS A;  1A0I A;  3HOX B;  2F4V L;  1YNJ D;  2F0E A;  5C5M A;  4HIM A;  2XVS A;  1SJE D;  3D3R A;  5C3X A;  4PNY A;  4A3J B;  1C8C A;  1NY4 A;  2A5H A;  2PQA B;  4MIU A;  2OQK A;  4N9T A;  1Q1B A;  3H6M A;  5C3E B;  4ZKC B;  2HCC A;  1E2V A;  3GDE A;  1W3S A;  1K0R A;  2NZO A;  1LT3 D;  4FNF A;  4ID6 A;  1U4M A;  2Q2T A;  2CQO A;  3W2D A;  4A3F H;  1AZP A;  1QNU A;  2NWG A;  5E1F A;  3ULJ A;  3E0J A;  5JJK A;  2UXB Q;  4RHR A;  1X6O A;  1RHP A;  3NE5 B;  2K05 A;  4X3U A;  1TKW B;  4DAV A;  3UDI A;  4PG3 A;  4CDF C;  5IWA L;  4CDD C;  1ESF A;  1GO3 E;  2NBF A;  3GV3 A;  5E3F A;  3S15 H;  2JA7 G;  1K8A C;  1JE4 A;  1EZ8 A;  1I50 H;  1VQE A;  1X54 A;  2K7V A;  2CHB D;  3WDN A;  3HOX G;  2L55 A;  3QR8 A;  4BY1 B;  3NEL A;  5ELF A;  4A3J G;  2GA4 B;  4GN3 B;  1VQA A;  2F0S A;  2KHI A;  2Y0S E;  2VY3 A;  2UXB L;  3C46 A;  1CK1 A;  2EZV A;  5C3E G;  2PNH A;  4JI3 L;  1XMO L;  3J80 L;  3I72 A;  3J80 i;  2B8F A;  4A75 A;  2Z4I A;  5BN3 A;  1STN A;  1KNE A;  2ZXR A;  4OON A;  5FLX E;  2EJG C;  1JT8 A;  5IGE A;  3OOC A;  3KJO A;  4C3J G;  1WTX A;  4KHZ A;  1D1K A;  4JW0 A;  2K1B A;  3RNU A;  1GXD C;  4X3S A;  2JA7 H;  2N49 A;  1RJT A;  1MGS A;  3HOX H;  3R2I A;  1NUC A;  2N78 A;  2MO0 A;  2HQL A;  3LNN A;  4A3J H;  1Y69 U;  1Y1V B;  3HRZ C;  1BCP F;  2WKC A;  4JI1 Q;  1TS3 A;  1VF7 A;  2F3I A;  3STB C;  1E1O A;  5C3E H;  1Z6H A;  1IL2 A;  2KVM A;  1HA6 A;  2R7Z B;  2JSO A;  2WAQ E;  4I65 A;  4DV4 Q;  4PZ6 A;  1XWE A;  4FVM A;  3OYY A;  4K5V A;  2UXC Q;  5CV8 A;  5FJ8 G;  3VA5 A;  1B3A A;  2ZM6 L;  1IBK L;  2X69 A;  1E22 A;  1EOV A;  1F2M A;  4DR6 Q;  5CBE E;  4NB3 A;  2VL6 A;  4KMU C;  4DK3 C;  2N55 A;  2AQ2 B;  1OXT A;  1R4P B;  3LWU A;  5CR3 A;  1SNO A;  2OF1 A;  4IPH A;  1K3B C;  2NN6 I;  1GUW A;  2VB3 X;  2ZXP A;  1IW7 D;  4C3I B;  4P74 A;  3ULP A;  4LFA Q;  5FO9 B;  4PMW A;  4BY1 H;  3NWS A;  4DV4 L;  1Y1V G;  4XYO A;  5TSS A;  3O13 A;  1U4R A;  2IX3 A;  2UXC L;  3LGJ A;  1I5F A;  1PFM A;  3S14 B;  3PUV A;  1RKN A;  2JN4 A;  2AQ1 B;  2R7Z G;  2CKZ B;  4IOC A;  2UUA Q;  3CF5 A;  1M4V A;  4G7Z C;  2VQE L;  5I2Y A;  4A3K B;  1LTS D;  3C1E A;  2O5J C;  5IE8 A;  2JA8 B;  1LTT D;  5CV6 A;  3T51 B;  2EXZ A;  3Q8D A;  5FJ8 H;  3S17 B;  1ZXT A;  4NXN L;  5BN5 A;  3Q22 A;  2IJ0 A;  2CVR A;  1WYD A;  1I4X A;  1CKN A;  2JJQ A;  4NP5 A;  1Y1W B;  2IHF A;  2I5M X;  1HZA A;  4QF4 A;  1ILP A;  1YJN A;  4DV6 Q;  1QIL A;  2A1A A;  1EY8 A;  2QDL A;  4WRD A;  1QNK A;  3OIP A;  3PSI A;  4O2D A;  2F0V A;  3OHX C;  1SMX A;  1ZYR C;  5GAD C;  5AJ3 Q;  1DON A;  3KF8 B;  3GP7 A;  1Y1V H;  4KLK A;  4AIM A;  1STH A;  2F0Q A;  4X3T A;  1E1T A;  4R8N A;  2OT2 A;  1D5M C;  4HJA A;  3ZJY C;  2R7Z H;  1QG7 A;  2DUD A;  3SK4 A;  1IXR A;  3NWT A;  4A3K G;  1Z47 A;  3PQI A;  3D8G A;  3MHB A;  2JA8 G;  2RKS A;  1LAC A;  4G7O C;  5AJ3 L;  5KIX A;  2N8N A;  3KLR A;  2K5N A;  4UDU C;  2F0F A;  1E2Z A;  5HUR A;  2PQE A;  5LMU Q;  4C3I H;  1EIH A;  3OW2 A;  4KY6 A;  2KED A;  2M00 A;  4WOR A;  3U4Z A;  4DGZ A;  1B9M A;  2X6L A;  1HA5 A;  2O4X A;  2E5L Q;  2BE5 C;  1BCP B;  4P71 A;  4BA1 I;  5F2D A;  1CZW A;  3BZC A;  2WFW A;  3R93 A;  4NDX A;  4IQZ A;  2HQE A;  4L5Q A;  3J81 c;  4L5R C;  1B1Z A;  4LFB Q;  3S14 H;  5C5L A;  1J5E Q;  3S2D B;  2VNU D;  1SMY D;  4DK0 A;  1TII D;  4DNR B;  4A3K H;  2JA8 H;  4OWW B;  3S17 H;  4UY8 C;  1FR3 A;  2LY7 A;  5J22 A;  4GLA C;  1Q1E A;  4IUQ A;  2E5L L;  1A3V A;  2E74 C;  4K8I A;  3M4Q A;  4H7B A;  1Y1W H;  1CM9 A;  2GN5 A;  4LFB L;  3K5M A;  3IKJ A;  1JB3 A;  4B3R Q;  5LHY 1;  2Q8I B;  2F3W A;  2JXM B;  2WB1 E;  3ND9 A;  4R4I A;  1NMG A;  1PTO D;  1JB7 A;  4FF1 A;  5IGC A;  4K0K L;  4GNX C;  4J1M A;  4ZRZ A;  2B29 A;  1B44 D;  2EY5 A;  1GUT A;  1HZB A;  4PMB A;  5EKL A;  1OO9 B;  1NR4 A;  2DY7 A;  1V8Q A;  1HFG A;  2EY1 A;  3NTK A;  4NW2 A;  5C4J B;  4OIJ A;  2KCT A;  1IBM Q;  4HJ9 A;  2EYP A;  2CW0 D;  3I8Z A;  4AYB B;  4J8Q A;  4EQO A;  4XYQ A;  3NBI A;  4DV1 Q;  4UP8 A;  3OIQ A;  1F9Q A;  1V9P A;  5M5Y B;  4GOP A;  3KLS A;  4N9P A;  1STG A;  2Q2H A;  3KF6 A;  3OTO Q;  1DOL A;  1KAA A;  1X3F A;  1C9O A;  3A54 A;  4X66 L;  2JK8 A;  4RGT A;  2YTV A;  1WJJ A;  3X3M A;  2NVT B;  1F9R A;  3L2P A;  1N36 Q;  4H0L C;  4DV5 Q;  2MNA A;  3KLW A;  3KF8 A;  2C9O A;  2JE6 I;  1D5Z C;  3S2D H;  1B7Y B;  3H3V H;  2FFK B;  4QJF A;  3PF4 A;  4HTH A;  1WVL A;  4R1J A;  3ITP A;  3OTO L;  1EFW A;  4K2L A;  4AYB G;  1PH6 A;  1QVF A;  3W3A A;  2D0O A;  2XNA C;  4OO1 I;  4F8M A;  4RCO A;  1JIC A;  4KI0 A;  1FD7 D;  3H0G B;  1HTP A;  4XQJ A;  1QJO A;  1LTR D;  4RH6 A;  3L9A X;  1NNX A;  1PHJ A;  3R2T A;  1WOC A;  1B3Q A;  1XNQ Q;  1G51 A;  3SGI A;  1ASZ A;  3OWE B;  4A3M B;  2E8G A;  3G6E A;  1B8A A;  2Z8L A;  3CXC A;  4FXK C;  2FMM A;  3A56 A;  2ES2 A;  1FYC A;  4R8I A;  4DUY Q;  4DR2 Q;  3F2C A;  5HGT A;  2QA4 A;  4DAM A;  3ULL A;  3A7A B;  3PO2 B;  1HCZ A;  4N8X 1;  1XNR Q;  1MKH A;  1S40 A;  1A63 A;  3WOF A;  2A8V A;  3S1Q B;  2D9U A;  3PV0 A;  5C4J H;  4HCE A;  4CKE A;  3CCE A;  3GTK H;  1QB5 D;  4M8A A;  3J81 L;  1VDZ A;  2D2C C;  5DLQ E;  4DV2 L;  4DU9 A;  5A35 A;  4YY3 Q;  1KD1 C;  5M5Y H;  3ERS X;  3H0G G;  5CV7 A;  1N32 Q;  3J81 j;  5KYL A;  4DUY L;  4H02 A;  1IKL A;  2R7F A;  2L1B A;  4A3M G;  2ZJP A;  1SJH D;  1XPO A;  2RDG A;  2NVT H;  1XNR L;  5GAE C;  1PRT F;  4XQN A;  3H94 A;  1SRO A;  1X3E A;  4S3S A;  3RMH A;  2KEE A;  2MGS A;  2R3Z A;  3SDZ A;  1XJV A;  4KN4 C;  3J81 E;  2B2U C;  5JEA J;  3PO2 G;  4HIO A;  3M4O B;  3M9B A;  4H44 C;  3T16 A;  2JA5 B;  1GJX A;  4K6L A;  4DF7 A;  4Q0F A;  2Z6B A;  4JI2 Q;  2PO4 A;  2F0J A;  4BWG B;  1HNX Q;  5M3F B;  3HS0 C;  3VYT A;  2TMP A;  3KJP A;  1C0A A;  3H0G H;  2LKV A;  1N9W A;  2WAC A;  3PF5 A;  2J4X A;  2JYO A;  4KHP L;  3JC6 6;  1YNX A;  2PW7 A;  4XDX A;  1PLF A;  1ZYR D;  4QMG A;  1IW7 C;  3S1N B;  1SE3 A;  4ME5 A;  4A3M H;  1EY5 A;  1UE7 A;  3CC4 A;  3I4N B;  3JAM i;  3ERQ A;  3NQT A;  3S24 A;  2Y0S B;  2N3S A;  1VQB A;  3TME A;  1O78 A;  4BBR B;  4OX9 L;  4UPA A;  1RTO A;  3K81 C;  1LTL A;  1VQJ A;  3PO2 H;  4P72 A;  5FLX c;  4ILW A;  3S1Q H;  3L7Z C;  4OL7 A;  3BDO A;  2JA5 G;  4EX5 A;  1F77 A;  3K6O A;  2AWO A;  4P2C B;  1A6X A;  1MI2 A;  4DA2 A;  5I4D A;  5CV9 A;  5M3F G;  1GKH A;  5AFW A;  3RLO A;  5CC4 A;  1AFP A;  4QQB X;  3EJI A;  4DAP A;  3SEB A;  1BVS A;  2HHH Q;  2B2W A;  4LW1 A;  1KHI A;  2K5W A;  4BY7 B;  3SXH A;  1PMR A;  1N34 L;  4LJZ C;  5I6W A;  1WD1 A;  2BE5 D;  1JJ2 A;  3I4N G;  3EQL C;  4P73 A;  3M3Y B;  2Y0S G;  3H91 A;  2O5I C;  5DEH A;  4YHH Q;  1Q8I A;  2JP1 A;  3DMU A;  4BBR G;  4B3T Q;  2K5D A;  1K0S A;  3TP7 A;  1OXU A;  3M4O H;  4ME3 A;  2F0O A;  2WAQ B;  5IY0 A;  2JA5 H;  1BF4 A;  4IOA A;  4Q5V A;  1B9N A;  4PZ8 A;  5FKA C;  3Q23 A;  1KLG D;  3KOJ A;  4O1N A;  5M3F H;  1Z7T A;  2M2L A;  1DOK A;  5ISR A;  4JBW A;  4DR7 L;  1STY A;  4OGQ C;  2F0N A;  4YHH L;  1AE2 A;  5KYI A;  2ATW A;  2PW5 A;  4BY7 G;  3S1N H;  4LF7 Q;  1BDO A;  2Q2I A;  1X3P A;  3I4N H;  1PRT B;  3TS0 A;  1X55 A;  4TVA B;  5EJW A;  1G2T A;  2HDM A;  5D65 A;  1CFM A;  2ICI A;  3A74 A;  4BBR H;  2RCF A;  4JI8 Q;  1HNW L;  3PO3 B;  4V0B A;  3K7A H;  3RLN A;  1AN8 A;  2RBM A;  3RLF A;  1I4Q A;  4UP9 A;  2VXW A;  2J0T D;  1SMY C;  2WAQ G;  4IUR A;  5JEA G;  3R8B A;  2QEX A;  1OTC A;  1DXM A;  4IJL A;  1DYQ A;  4LF4 Q;  1Q12 A;  1HUN A;  4LF5 Q;  3GD7 A;  1BQQ T;  4RWS C;  2UUB L;  2PZT A;  4B3S L;  3K5N A;  1TWG B;  4KD4 A;  4U68 A;  5ELN A;  1UE5 A;  4HMI A;  2KJX A;  1H9M A;  4GOP C;  3NQI A;  5ELC A;  1I6V C;  1SDF A;  1V1Q A;  2JEB I;  1BBU A;  1ENA A;  3KUP A;  3I4L A;  3TZU A;  4BY7 H;  1C7Y A;  5KGU A;  3TQY A;  2RHQ B;  4FP5 D;  4X65 L;  5J3B A;  3KBX A;  1PTO C;  5NUC A;  1TS4 A;  3M3Y H;  4HR7 B;  2QW7 A;  3Q24 A;  3TBI B;  1BR9 A;  4P75 A;  1M1K C;  1WCM B;  3U9O A;  4L8J A;  2Z1C A;  4HCS A;  1SSO A;  3MEF A;  3PO3 G;  2EE1 A;  4ZCK A;  1EU3 A;  1LT5 D;  2K5H A;  1SYB A;  4OXP A;  4YCU A;  1A3T A;  5JEA H;  1CHP D;  4HMJ A;  1HR0 Q;  3HOY B;  1T5E A;  2ZXO A;  5IIF A;  3QOJ A;  2MPM A;  2AMC B;  2CW0 C;  1QVC A;  1YEZ A;  2F0D A;  5CGK A;  3TDQ A;  3MXU A;  1IYV A;  3BDC A;  5IOC A;  3KYH C;  5FLX L;  1J6Q A;  1KRT A;  4GZY C;  1G2S A;  1ENF A;  1D7Q A;  4IPC A;  3J7Y W;  2IY5 B;  4OIK A;  4EQ5 A;  3J7A 5;  5BN4 A;  1S5C D;  2R61 A;  4PQX A;  1WCM G;  1DCZ A;  1B4O A;  2WV6 D;  1DJR D;  3TP6 A;  3FDT A;  3PO3 H;  4BXX G;  1ESR A;  2F0I A;  2DN8 A;  2XTI A;  4DFA A;  1JWU D;  2CH4 W;  1JR0 D;  4RGM A;  2J7Z A;  1RF2 D;  3HOY G;  3HKS A;  4DAY B;  4APV A;  2PYK A;  4A3G B;  4FXD A;  3M7G A;  1TWG H;  3SK5 A;  1FVI A;  1EL0 A;  1TU2 B;  1K8M A;  3T4A C;  4B08 A;  1XYI A;  3S1R B;  3CRL C;  3CQZ B;  3VYS A;  3CW2 C;  1O7I A;  3A8J E;  3C3L A;  3U58 A;  2K4K A;  2WB1 B;  1GUO A;  2NN6 G;  3OWF A;  2XIW A;  2MFI A;  2YTX A;  5FOB B;  4BY1 G;  1EOT A;  4TSS A;  1O80 A;  3SK6 A;  4OWT B;  4JI4 Q;  4DR5 Q;  1Y14 B;  5IYD G;  3OW7 A;  3KK7 A;  3MZ5 A;  1C4Q A;  3FEW X;  1WCM H;  4IN3 A;  2L4N A;  1TS2 A;  4M1U B;  4BXX H;  4UHV A;  1OXS C;  5JJI A;  4HJ8 A;  2RSN A;  2F3V A;  3ERO A;  3KBG A;  1QOH A;  1EIG A;  2CQA A;  4FO2 A;  3CP0 A;  1UE6 A;  3NPP A;  4ZQ3 A;  3HOY H;  3ONA B;  1CQV A;  2JA6 B;  1WTH A;  1WTP A;  4A3G G;  2EJF C;  2KCC A;  3TRE A;  1A8V A;  1KDB A;  3VR4 A;  1KIX A;  1J9O A;  4JI1 L;  2R93 B;  2B63 B;  5CYU A;  3HKZ E;  3H09 A;  1D5X C;  2WB1 G;  4ZUI A;  5C0X I;  4ZYS A;  2NN6 H;  1EYA A;  3GTM B;  2NZH A;  3T1Y Q;  3GTJ B;  1UWV A;  2A69 C;  3D6C A;  2B2V C;  1PZK D;  2KOL A;  3K0Y A;  5IYD H;  4KD3 A;  3TP8 A;  1JWM D;  4QB4 A;  5IT9 E;  3OMC A;  4MHE A;  4C3H B;  5KNC A;  2PQA A;  4DR6 L;  2B2T C;  3J7Z C;  1TT2 A;  2IT1 A;  2YV5 A;  2Z4H A;  3K59 A;  1Q3L A;  4CKC A;  2AUJ D;  4X6A H;  4A3G H;  1IYU A;  4LFA L;  1HNZ Q;  3GTP B;  4YCW A;  3T1Y L;  2PZW A;  3S1R H;  5G3L D;  1SNC A;  1NMF A;  1TWF B;  3F8T A;  2B63 G;  3PIP A;  1CZG A;  1K73 C;  4C3I G;  2UUA L;  2EXD A;  4AQY Q;  4IFD I;  3CU7 A;  4LMQ D;  1ET6 A;  3OMG A;  1L1O C;  1N33 Q;  3MEH A;  1PFN A;  3CRK C;  1HPC A;  1LTA D;  1O7Z A;  3S2H B;  1JOR A;  4A3I B;  1HRJ A;  5COR A;  3NSW A;  1NBW A;  2IL8 A;  1TR5 A;  5M5W B;  3I3C A;  4TQU S;  1M90 C;  3TN2 A;  1STE A;  1KDA A;  3W1B A;  1AW7 A;  4DV6 L;  1B70 B;  1A62 A;  1UEA B;  5DNF A;  4R4T A;  4AQY L;  1UAP A;  1CSP A;  3KFU A;  2X6G A;  2EOT A;  1Y1W G;  1AH9 A;  2R93 H;  2B63 H;  3A55 A;  4B3M Q;  3K5O A;  1MIU A;  2L12 A;  3NEN A;  5J1Z A;  3CCU A;  4POF A;  3I70 A;  1CT1 D;  3CCS A;  4CBV A;  3GTM H;  2PNR C;  1HH2 P;  3GTJ H;  1YHQ A;  4LF6 Q;  3DLL A;  3V2T A;  4A3L G;  3F2B A;  2Z6K A;  1VQD A;  3G4S A;  1KLU D;  4A3I G;  4LFC Q;  1SAP A;  4IUN A;  2PPB C;  5IGF A;  1V1P B;  4HSV A;  4C3H H;  2CWA A;  2L5T A;  5I2X A;  2K6A A;  4OWX B;  3WWV A;  3I4M B;  3V96 A;  3AFQ A;  4XQQ A;  5ELE A;  3S1M B;  1YHA A;  4DK1 A;  4B3M L;  1C48 A;  3MVV A;  5LMU L;  1BOS A;  3D6W A;  2K01 A;  5E7N A;  1IBL Q;  4GKJ Q;  2Q8R E;  3GTP H;  3CCL A;  3ER0 A;  2RHS B;  4DR1 Q;  2LFN A;  1M8A A;  1TWF H;  1HQM C;  3SE0 A;  1SN8 A;  5EKI A;  2L9H A;  2EJM A;  1GUS A;  4NXM Q;  3M7N A;  3M4Y A;  1J5E L;  2F1M A;  1LLR D;  1U9R A;  2FJ2 A;  4JBM A;  1HZ9 A;  1YHB A;  4LF9 Q;  2K14 A;  4PZ7 A;  4A3L H;  5CV5 A;  3S2H H;  1Y8N B;  4A3I H;  3D4D A;  3EA6 A;  1QCB D;  4GLV B;  4DR1 L;  3NP8 A;  5M5W H;  4PMC A;  3I4M G;  1UUP A;  1VQF A;  2F0P A;  1X9N A;  2F0T A;  3AEV A;  2UU9 Q;  4KY5 A;  4RHS A;  1GUG A;  3IRB A;  1QVG A;  2KEC A;  4ZAI A;  4B3R L;  1SE8 A;  3A0J A;  4G4K A;  2F0K A;  2F0M A;  2R7D A;  4LF9 L;  2ZT9 C;  1BUV T;  3CPF A;  5KEE A;  2ASB A;  3ZYY X;  2HIX A;  4OO1 G;  1JJG A;  3RN2 A;  1STA A;  4R4O A;  5COY A;  4JV5 Q;  2CH4 A;  1Y8O B;  1LTB D;  1Q7Y C;  1SE4 A;  3F2D A;  5KND A;  5M5X B;  1EZ6 A;  1H9S B;  5HGQ A;  1HQR D;  4RMF A;  1VQI A;  1IBM L;  4F88 A;  1BCP D;  4A93 B;  4WJ3 M;  4EQP A;  4IUP A;  2AHO B;  4DV1 L;  2IPK D;  4CDE C;  1YBY A;  3I4M H;  1O7Y A;  3CD6 A;  2CCZ A;  3S1M H;  2MHV A;  2K03 A;  3PGZ A;  4ZKB B;  2KHS A;  4DKA C;  1I4R A;  3EFX D;  3K0X A;  3H3V I;  2PZU A;  1N36 L;  2CWP A;  3NTI A;  4I7A A;  4DV5 L;  1WTO A;  3EVQ A;  4OO1 H;  2F0U A;  1MSG A;  2XWJ B;  3IL8 A;  4DXG A;  3E5S A;  1I4H A;  3V05 A;  3NEM A;  2XRS D;  4RFB A;  1FNV A;  1AEX A;  1UNS A;  1O7L A;  3CCR A;  4DNT B;  3HGB A;  3PIP 3;  1PZI D;  4XT1 B;  1I94 Q;  3BDL A;  5IGG A;  1QE6 A;  1KAW A;  4A93 G;  4JI5 Q;  1NE3 A;  2K52 A;  3SK8 A;  1CKM A;  1EY7 A;  1PXU A;  2VQF Q;  3CHB D;  4GKK Q;  1FJG Q;  3I4O A;  1E3P A;  1S4Z A;  4YWL A;  1EY4 A;  4JI6 Q;  1STB A;  5I9O A;  3OSO A;  1HR0 W;  3SVM A;  3KLS X;  1XNQ L;  3J81 i;  3FRP B;  4LUZ A;  5EKK A;  1BBW A;  4ZUJ A;  2KQ3 A;  2A68 C;  4C1N I;  1I94 L;  3BYT B;  2IHE A;  2E2H B;  1HZC A;  2BDO A;  4DR2 L;  2VQF L;  1SNM A;  1F9S A;  1HUM A;  4K8J A;  1PH5 A;  5M5X H;  1N8R C;  4GKK L;  3D4W A;  1FJG L;  2E2I B;  2A69 D;  4JBK A;  1KL9 A;  4HED A;  2EYH A;  1BXT A;  4A93 H;  3IAY A;  1PV4 A;  2IX1 A;  1SEB D;  3FVQ A;  4NMZ A;  2DJG C;  1LM0 A;  4ABN A;  2LXJ A;  4YY3 L;  1Y8P B;  1X65 A;  4GS3 A;  3RZD B;  4RCN A;  3D31 A;  3GTL B;  4IPD A;  3HOV B;  1N32 L;  3F1Z A;  4YWM A;  1QWY A;  2A73 B;  3DWA A;  1G8Z D;  3A8I E;  4DV0 Q;  1YJW A;  1JOK A;  1ICW A;  3AU7 A;  4DPG A;  3CCJ A;  2FMC A;  3DWQ A;  5DM6 3;  1NSN S;  4E6I A;  2DNE A;  3BJU A;  3D0F A;  2BH2 A;  2I0Q A;  2H1E A;  2BA1 A;  2MJ8 A;  1H9S A;  5ELO A;  5LL6 S;  1IYJ B;  2Q2U A;  4X64 Q;  1YIT A;  1EYG A;  4JI2 L;  2IX0 A;  1Q86 C;  3HFZ B;  4O0A A;  1HNX L;  4A76 A;  3SR1 A;  2K75 A;  2QEJ C;  2HUG A;  2H5X A;  2EYM A;  4I7Z C;  3UDX A;  1WTR A;  3HOV G;  4FDB A;  3RR5 A;  4HAE A;  1XXG A;  3TP5 A;  1B50 A;  4GNX B;  1LTI D;  3E0E A;  5IYB G;  4IUV A;  1ROD A;  4JBJ A;  1EYD A;  3T1H Q;  3D4R A;  2LMC B;  1VQ4 A;  2ZTC A;  1MBY A;  4KHV A;  3A7L A;  4N8F A;  2E2H H;  1P16 A;  3MA2 B;  5KRU A;  2VUM B;  3BVM A;  1EU4 A;  1II3 A;  2UUC Q;  1GD7 A;  4B9X A;  1YVC A;  4K6D A;  4JI7 Q;  1VQ7 A;  3QOL A;  2E2I H;  1F9P A;  2NZ1 D;  1F2Z A;  2NUC A;  3G7L A;  1X3Q A;  3CCV A;  1CTM A;  2EYF A;  1UEB A;  2Z6K C;  2Z9H A;  4RGN A;  3BZD B;  2I5L X;  3QG1 A;  3T1H L;  5D14 A;  1X3G A;  1MHW C;  3GTO B;  2NTT A;  3IFD A;  1TQO A;  1HJP A;  3GQB A;  4ULL A;  3RZD H;  2ZJQ A;  3GTL H;  3HOV H;  4JCV E;  3BU2 A;  1WFQ A;  2OXP A;  4LK1 C;  4DV7 Q;  1PFS A;  2C5C A;  2HHH L;  1NAP A;  4K14 A;  5IYB H;  2UUC L;  3G48 A;  1S5F D;  2HDL A;  5JAV A;  4WJW A;  1B53 A;  1QZH A;  1CI3 M;  3BS1 A;  3RZO B;  5M3M B;  1PZJ D;  3DXJ C;  4A4I A;  2D5D A;  4RKB A;  4MTK A;  1PH7 A;  3HKZ B;  3TEH B;  2VUM G;  4B3T L;  3HEJ A;  2PI2 E;  3HOU B;  1YZ6 A;  2NVY B;  1D2B A;  1CSQ A;  3P75 A;  4JYA Q;  1NCV A;  4KJO A;  1W2B A;  2XSC A;  5D3I B;  4JVZ A;  5IT9 c;  5LMN Q;  4OEM B;  3GO5 A;  1TWA B;  1FNW A;  1WD0 A;  1S5B D;  2LS0 1;  1Q81 C;  3I73 A;  3NTH A;  4FF2 A;  1NJI C;  1S72 A;  1MJE A;  2BA0 A;  3MFG A;  5ELB A;  2RSO A;  3E9H A;  1DD2 A;  3J7A V;  2EY2 A;  3T53 B;  1OXX K;  4LF7 L;  2AQ3 B;  1SND A;  2L11 A;  1YNN D;  3P7J A;  5M3M G;  1V1O A;  3MTS A;  1R4Q B;  4YIJ A;  1EEI D;  1WI5 A;  3HKZ G;  2F4V Q;  2B2Y A;  4L5T A;  2VUM H;  2NVX B;  3HOW B;  2WP8 J;  4JI8 L;  4YCV A;  3HOU G;  2KBN A;  1ILQ A;  2EY6 A;  1CHQ D;  1VQK A;  1F2Y A;  4LNQ A;  4LF4 L;  5IYC G;  3VYR A;  4XT3 B;  4LF5 L;  3MAQ A;  3CC7 A;  3ICE A;  1PA6 A;  3GTO H;  3FMC A;  3HP3 A;  4RAU C;  1EQT A;  4MNO A;  4JC0 A;  4Y7N B;  1ET9 A;  1ONL A;  1IKM A;  1TY2 A;  1JOO A;  2BDN A;  2DJF C;  3K8A A;  1EWH A;  5JJZ A;  1IZ6 A;  5DM7 3;  3FPP A;  5IWA Q;  1AE3 A;  5HY6 A;  2GVA A;  4GNX A;  2K5Q A;  3RZO H;  2XGT A;  2HCI A;  1YJ9 A;  1EY9 A;  5M3M H;  4DNI A;  2QKI C;  4G7H C;  3PIO A;  2WKD A;  3HOW G;  1H9R A;  4UAI A;  4PV1 C;  2VB2 X;  4C56 C;  2QDB A;  3HOU H;  1GHJ A;  4MTN A;  3AFP A;  2NVY H;  2RQX A;  3LX0 A;  3DUZ A;  3HG9 A;  1J8I A;  3M85 A;  1CKN B;  1HR0 L;  5IYC H;  1LT4 D;  3AB9 A;  1TWA H;  1PRT D;  1VQH A;  2ENB A;  3FHW A;  1XMO Q;  4JI3 Q;  4CJ1 B;  2I5H A;  4B9W A;  1BCP C;  4EGV A;  4QUF A;  4C3J B;  3VYU A;  4CHT B;  2TSS A;  3K57 A;  4XXE A;  5L37 A;  3AMU A;  2E75 C;  3NBH B;  3GTG B;  1PTO F;  3H3V C;  1R9T B;  1BKB A;  4BA2 I;  3CAM A;  5JOB A;  3I2Z A;  5EBC A;  5IP9 G;  1DGS A;  3MXP A;  2A68 D;  5GAH C;  3DM3 A;  4R4Q A;  4CKB A;  4RGO S;  2NVX H;  1SR3 A;  3HOW H;  4GN4 B;  1VMP A;  1RCV D;  1ML0 D;  2SDF A;  1T9H A;  1RD9 D;  4KN7 C;  1I4G A;  3BVZ A;  2B39 A;  5C0X G;  3I7F A;  3MWY W;  1PH4 A;  5T1I A;  1DOM A;  1RIP A;  2GVB A;  2SNM A;  1HHV A;  4KKS A;  2HD3 A;  4Y7N H;  4LF8 Q;  5M9O A;  2G9D A;  1KDC A;  1KTK A;  1PH2 A;  4V19 0;  4QIW E;  2ZM6 Q;  2IWH A;  1IBK Q;  2HT1 A;  4HSP A;  5IT9 L;  3NUC A;  2PMZ E;  3J80 E;  1VQ5 A;  1EY0 A;  3L3O C;  4L63 B;  4K5X A;  5IP9 H;  3QO2 A;  1UE1 A;  1LYL A;  1SXT A;  3B6Y A;  3I56 A;  1EEF D;  3K7U C;  5E4W C;  4KKU A;  4JI4 L;  4DR5 L;  2EYO A;  4QY7 A;  5JJL A;  3FP9 A;  1KC8 C;  4LF8 L;  1B2T A;  5BR8 Q;  1W6K A;  1X32 A;  3UI2 A;  1MSH A;  2BOS A;  3QIA A;  5C0X H;  3CKI B;  3PUZ A;  4IFD G;  1SYE A;  3QB3 A;  2NVQ B;  1VQ8 A;  5FO8 B;  2EPB A;  4C3J H;  1EUJ A;  1SRU A;  2VQE Q;  1S5D D;  2V1C C;  3GTG H;  1SYF A;  1SBB B;  1JMC A;  2EQS A;  1TVX A;  1U4P A;  1R9T H;  3E3X A;  4DR3 Q;  4NXN Q;  4H13 C;  2JA6 G;  2JA9 A;  1PYS B;  4JOI A;  1PH8 A;  1VQ6 A;  1Q8K A;  5BR8 L;  2A6E D;  2RDF A;  1Q82 C;  5C6A A;  1SNP A;  3TS2 A;  4J6H A;  2QGQ A;  3CQZ H;  4IZ8 A;  2R93 G;  2B2U A;  1RL2 A;  2C35 B;  3WOE A;  1GHK A;  3BZK A;  1PFB A;  2B2W C;  1WTW A;  1V43 A;  1VQC A;  2SNS A;  2K28 A;  4A3E B;  4X3K A;  3CMA A;  2RA4 A;  3PMF A;  4DR3 L;  2K50 A;  4IFD H;  1LT6 D;  4GOP B;  5EBD A;  1Q90 A;  1VQN A;  2VZA A;  5KNB A;  3KF6 B;  1HNZ L;  4C3H G;  3VA7 A;  1EQQ A;  3K58 A;  4IPG A;  1ZKO A;  3PUY A;  3RUZ A;  2SEB D;  3MC0 B;  2E2J B;  1KQS A;  1QUQ B;  2K32 A;  1PTO B;  1AP0 A;  3CCM A;  1X56 A;  1OXV A;  3HOZ B;  1XMQ Q;  3NBH A;  2JA6 H;  4FF3 A;  2JEA I;  2RDH A;  1CA5 A;  4J15 A;  5DAU A;  4DAY A;  5GRO A;  1N33 L;  1SNQ A;  3A8K E;  2OQ0 A;  1GUN A;  3DEO A;  1L0W A;  4IO9 A;  3DHQ A;  2DY8 A;  1VQ9 A;  4X62 Q;  1MD2 D;  2OEO A;  3W5O A;  1YI2 A;  1TWC B;  5IGB A;  2V4D A;  3K80 C;  1ENC A;  3PIO 3;  4A3E G;  4DK6 C;  2F0G A;  3T13 A;  1D6E C;  3BG3 A;  5E4X A;  3F2U A;  1XMQ L;  2NVQ H;  4KKT A;  4DUZ Q;  5ELD A;  1EWI A;  5IOD A;  4BS9 A;  4A3D B;  1E24 A;  3URY A;  1VCI A;  1PDQ A;  4X62 L;  3HOZ G;  5EQ0 A;  3Q6S A;  1YIJ A;  4KY7 A;  3N6R A;  5EPL A;  4LF6 L;  4NKL A;  2R6G A;  4Y52 H;  2O2L D;  2BH8 A;  4OHJ A;  2CFM A;  4QL5 A;  4LUV A;  2KCN A;  1IHZ A;  3PUX A;  4LFC L;  4XTC S;  3UDG A;  2OTJ A;  4DUZ L;  1T5X D;  1MJC A;  2B2Y C;  3I90 A;  2R92 B;  4JK1 C;  1LO5 D;  1VQO A;  4A3E H;  1D1I A;  2D0P A;  2EDG A;  2KUM A;  3KDF B;  4K0K Q;  2VS1 A;  1RDP D;  5CBA E;  2EYJ A;  2QF7 A;  1GVP A;  1VQG A;  1IBL L;  4GKJ L;  5JVH 3;  1PYW D;  4A3D G;  1JC7 A;  3BVG A;  3G71 A;  3X3N A;  3TZD A;  1DZ1 A;  2E2J H;  1EFI D;  1PTO H;  3NXW A;  1SE2 A;  4HIK A;  1SYG A;  5GAG C;  4NXM L;  3HOZ H;  2ZJR A;  2IW3 A;  2G5D A;  3AYH B;  3UE0 A;  3N52 A;  1KNA A;  1G6Z A;  5FO7 B;  1DM0 B;  4CGY B;  1A2T A;  3K5L A;  3CCQ A;  1YNN C;  1KRS A;  3U50 C;  4QUC A;  1JCK B;  2QCP X;  4X66 Q;  1RTN A;  2ID0 A;  2P5Z X;  2R92 G;  1TWC H;  2OWO A;  1G29 1;  1F2L A;  2JQO A;  1FL0 A;  2F0W A;  2YTY A;  3CME A;  2EYL A;  2FIN B;  2UU9 L;  2F0H A;  2EIF A;  3GTK B;  4LUO A;  4DV3 Q;  1EQV A;  2Z0S A;  3JAM c;  5LMN W;  1VQP A;  1SYC A;  2A74 C;  1G91 A;  4A3D H;  1L2F A;  5T1G A;  1XPU A;  1TWH B;  3MFY A;  3PUW A;  2SOB A;  1XTD A;  2A6H C;  1G6P A;  2YYZ A;  2XWB B;  4IJH A;  3U4V A;  4JV5 L;  1ZEQ X;  1I4P A;  1QUQ A;  1YNJ C;  1QZG A;  1K28 A;  1TY0 A;  3MXN B;  3P20 A;  2AKW B;  1K8O A;  5EGT A;  4U67 3;  5FLM G;  2K33 A;  1KAB A;  4DV3 L;  3HZX A;  3E6Z X;  4HID A;  1S3O A;  1PYB A;  4R4C A;  5CV4 A;  1L0X B;  1Q46 A;  2L0C A;  1WTV A;  4QCL A;  2R92 H;  2PCF B;  5C4X B;  1CUK A;  4RG1 A;  2M9V A;  1XPR A;  2KEN A;  2KHJ A;  4DXF A;  4IUU A;  4G57 A;  1PH3 A;  1TS5 A;  1CQF A;  2YU9 B;  1PRT C;  1EYC A;  5GQO A;  1VF5 C;  2MQH A;  4MN3 A;  4TKO B;  2OTL A;  1V1P A;  3SHL A;  5IGD A;  3CC2 A;  5I6Y A;  1L1O B;  1ICF B;  4DV2 Q;  1XX8 A;  2FHT A;  5C4H A;  5A2Q L;  1LV9 A;  3VR2 A;  5JVG 3;  3I91 A;  1HTL D;  2D62 A;  3W1G A;  3L0O A;  3C2P A;  2RVL A;  3STB D;  3VR5 A;  1VQL A;  2MO1 A;  4WFN 3;  2LXK A;  3QJY A;  5LL6 X;  5FLM H;  1LTG D;  5K36 G;  4JI5 L;  4POG A;  4FF4 A;  5C4X G;  2L15 A;  4GN5 A;  2ZTE A;  1FGB D;  4A3C G;  3OPO A;  3FKI B;  1PH1 A;  4RKL A;  3EIV A;  3BYY B;  4C1N K;  4C2M B;  4JI6 L;  1TXY A;  3Q0A A;  5C44 B;  2VW9 A;  3KDF A;  4FYD A;  3UE1 A;  1FNU A;  2K5V A;  3MXG A;  5A2Q E;  3J7A F;  1CKO A;  1D8L A;  3GV6 A;  3A5Z B;  1W6J A;  1TWH H;  1K83 B;  2WII B;  3IFT A;  3DEP A;  1EIF A;  2E76 C;  2F52 A;  1H9K A;  2MP1 A;  3M4P A;  2I07 B;  4CJ0 B;  4HJ7 A;  4JOI C;  1JOQ A;  4BBS B;  1NTG A;  2G9H D;  2QIL A;  4FXG C;  5CMD A;  3E9I A;  4L6T B;  1I3Q B;  2ZTD A;  2EVB A;  1PVO A;  1SFO B;  4LWC A;  4KHP Q;  4A3B B;  1K3R A;  3UDF A;  5IP7 G;  5K36 H;  2A19 A;  5EPK A;  4L5S A;  5JPN C;  1VMC A;  5C4X H;  1A15 A;  1BNZ A;  4TRD A;  3S16 B;  4A3C H;  3H15 A;  3FKI G;  2DNC A;  2NB0 A;  2BCO A;  4Z9C B;  1ASY A;  1AZQ A;  1CA6 A;  1E7Z A;  3DWP A;  2LSS A;  5K5P A;  5C44 G;  4OX9 Q;  2YU9 H;  4DV0 L;  1A2U A;  2UXD Q;  1I6H B;  2RF4 A;  4R9W A;  4KJN A;  1LUZ A;  1K9M C;  2H4O A;  1E0B A;  2F4I A;  3GTQ B;  2XRQ D;  4HN7 A;  1BO0 A;  4RA8 A;  1WTQ A;  3TSS A;  4F7X A;  3CPW A;  3JAM L;  1JE5 A;  4BBS G;  3A5U A;  3P1H A;  1VS0 A;  2XN9 C;  4EVO A;  1K8G A;  2B2V A;  5H1S E;  2A6E C;  4JI0 Q;  3EN2 A;  4KV6 A;  4A3B G;  5IP7 H;  3MXN A;  2B2T A;  3K7A B;  4X64 L;  1N34 Q;  2K04 A;  4KK7 A;  1GM5 A;  2UXD L;  1H95 A;  3FKI H;  4K5W A;  3ND8 A;  3PCO B;  4DR4 Q;  1P8L A;  1NR2 A;  5FK9 C;  4AYB E;  5EAY A;  4ZLT F;  2PI2 A;  1EQR A;  3RN5 A;  4C2M H;  5C44 H;  1EWC A;  2KCM A; 
#chains in the Genus database with same CATH homology
 3NBH B;  1QVF A;  2FXQ A;  2D0O A;  1B70 B;  4DV6 L;  4OO1 I;  1A62 A;  4JI0 L;  1K83 H;  1BKB A;  2B3G A;  4KI0 A;  4MZ9 A;  3CAM A;  4AQY L;  4R4T A;  3J80 c;  4BA2 I;  1CSP A;  3KFU A;  3I2Z A;  4XIG S;  5IP9 G;  1DGS A;  1Y1W G;  1PHJ A;  1AH9 A;  5GAH C;  1EIY B;  2R93 H;  1WOC A;  2B63 H;  1L1O A;  4B3M Q;  4BBS H;  1XNQ Q;  1G51 A;  1MIU A;  3NEN A;  3SGI A;  4JI7 L;  3CCU A;  1ASZ A;  1I3Q H;  3DM3 A;  4R4Q A;  4JG2 A;  4POF A;  1U5K A;  4DR7 Q;  2RCN A;  1SFO H;  2NVX H;  2E8G A;  3CCS A;  3GTM H;  1SR3 A;  3HOW H;  4A3B H;  1HH2 P;  4GN4 B;  4QGU A;  3GTJ H;  3G6E A;  1YHQ A;  1B8A A;  3DLL A;  4LF6 Q;  1U0L A;  3CXC A;  2ES2 A;  1T9H A;  4DR2 Q;  4HJ5 A;  3F2B A;  4DUY Q;  3S16 H;  3F2C A;  2Z6K A;  1VQD A;  3G4S A;  2QA4 A;  4A3I G;  4LFC Q;  5C0X G;  1JJC B;  3I7F A;  4DAM A;  3ULL A;  4C3H H;  2CWA A;  4UP7 A;  5C0X J;  1PH4 A;  1XNR Q;  1MKH A;  1S40 A;  1RIP A;  3TRZ A;  4OWX B;  1A63 A;  3WWV A;  2A8V A;  3PV0 A;  3AFQ A;  5C4J H;  4DV7 L;  2GVB A;  3CCE A;  1HNW Q;  1YHA A;  3GTK H;  4B3M L;  4Y7N H;  4LF8 Q;  5DLQ E;  4DV2 L;  1I6H H;  5LMU L;  1PH2 A;  4QIW E;  3AQQ A;  5E7N A;  2ZM6 Q;  1IBL Q;  4YY3 Q;  1IBK Q;  2HT1 A;  4GKJ Q;  1KD1 C;  3GTP H;  1FGU A;  3GTQ H;  5M5Y H;  2OCE A;  2HIV A;  3ERS X;  3H0G G;  2PMZ E;  2RHS B;  3ER0 A;  4DR1 Q;  1VQ5 A;  3CCL A;  1N32 Q;  2UUB Q;  4B3S Q;  5IP9 H;  1TWF H;  3J81 j;  1UE1 A;  4DUY L;  4ALP A;  1LYL A;  1PH9 A;  1SN8 A;  4H02 A;  3B6Y A;  3I56 A;  2ALY B;  3K7U C;  4AH6 A;  4NXM Q;  2R7F A;  4JI4 L;  3M7N A;  4A3M G;  1J5E L;  4DR5 L;  2ZJP A;  4QY7 A;  1XPO A;  2NVT H;  4JYA L;  1XNR L;  1KXL A;  5JJL A;  5GAE C;  4JBM A;  3FP9 A;  5LMN L;  1KC8 C;  1HZ9 A;  1YHB A;  4LF9 Q;  2K14 A;  1SRO A;  1X3E A;  4WJ4 A;  4PZ7 A;  4LF8 L;  5BR8 Q;  4X65 Q;  1XJV A;  4A3L H;  2AWN A;  3S2H H;  4A3I H;  4A3F G;  5JEA J;  3PUZ A;  3VDY A;  4IFD G;  3PO2 G;  4HIO A;  4GLV B;  1Z9F A;  4DR1 L;  3M9B A;  5M5W H;  4IFD J;  1VQ8 A;  3I4M G;  1VQF A;  4C3J H;  2DGY A;  1EUJ A;  1X9N A;  3AEV A;  2UU9 Q;  1SLJ A;  1SRU A;  4YWK A;  2VQE Q;  3EBE A;  2V1C C;  3IRB A;  1QVG A;  3GTG H;  4JI2 Q;  4B3R L;  1JMC A;  1SE8 A;  2EQS A;  3A0J A;  4NPS A;  1HNX Q;  2R7D A;  1VQM A;  4GLX A;  1R9T H;  4DR3 Q;  4NXN Q;  4LF9 L;  3KJP A;  2JA6 G;  2JA9 A;  3H0G H;  1PYS B;  4JOI A;  3I55 A;  3CPF A;  2ASB A;  1C0A A;  1N9W A;  1PH8 A;  1A0I A;  3PF5 A;  1VQ6 A;  2F4V L;  1Q8K A;  3JC6 6;  1YNX A;  5BR8 L;  4KHP L;  2HIX A;  1Q82 C;  4HIM A;  4OO1 G;  1JJG A;  3RN2 A;  3TS2 A;  2QGQ A;  4R4O A;  4JV5 Q;  1NY4 A;  4A3M H;  3CQZ H;  2PQA B;  1Q7Y C;  2OQK A;  1UE7 A;  2R93 G;  3CC4 A;  1RL2 A;  1Q1B A;  2C35 B;  3JAM i;  3F2D A;  5HGQ A;  3S24 A;  3BZK A;  4JI2 L;  4RMF A;  1V43 A;  1VQC A;  2N3S A;  1VQB A;  1VQI A;  1W3S A;  3GDE A;  1K0R A;  2NZO A;  4OX9 L;  1IBM L;  2Q2T A;  2CQO A;  4A3F H;  3CMA A;  4WJ3 M;  4UPA A;  3K81 C;  4DR3 L;  1LTL A;  1VQJ A;  2K50 A;  4P72 A;  3ULJ A;  2AHO B;  4DV1 L;  3PO2 H;  5FLX c;  4GOP B;  2UXB Q;  1X6O A;  5JJK A;  1VQN A;  1YBY A;  2VZA A;  3L7Z C;  3I4M H;  3KF6 B;  3CD6 A;  1HNZ L;  2CCZ A;  4EX5 A;  2JA5 G;  3S1M H;  1EQQ A;  3UDI A;  4IPG A;  4PG3 A;  3PGZ A;  3PUY A;  5IWA L;  2AWO A;  1KQS A;  1QUQ B;  1GO3 E;  3S15 H;  5M3F G;  3CCM A;  1GKH A;  1X56 A;  1OXV A;  4DKA C;  2JA7 G;  1XMQ Q;  2JA6 H;  1K8A C;  3RLO A;  1I50 H;  1VQE A;  1X54 A;  3K0X A;  2JEA I;  3H3V I;  3HOX G;  4QQB X;  1N36 L;  2CWP A;  4J15 A;  1BVS A;  4DV5 L;  2HHH Q;  4LW1 A;  1KHI A;  3NEL A;  5GRO A;  4A3J G;  1N33 L;  1N34 L;  2OQ0 A;  4GN3 B;  1L0W A;  1VQA A;  2KHI A;  4IO9 A;  1JJ2 A;  2Y0S E;  2VY3 A;  3I4N G;  2UXB L;  1VQ9 A;  3NEM A;  4X62 Q;  5C3E G;  3W5O A;  2PNH A;  4P73 A;  1YI2 A;  3CCR A;  2Y0S G;  4JI3 L;  1XMO L;  3J80 i;  4YHH Q;  1I94 Q;  4BBR G;  3K80 C;  4B3T Q;  4A3E G;  4DK6 C;  1KAW A;  4A75 A;  4JI5 Q;  4A93 G;  1NE3 A;  2K52 A;  1OXU A;  1XMQ L;  2VQF Q;  1CKM A;  3M4O H;  4ME3 A;  2NVQ H;  4OON A;  5IY0 A;  4DUZ Q;  1JT8 A;  1EWI A;  2JA5 H;  4GKK Q;  1FJG Q;  3I4O A;  4IOA A;  1E3P A;  4PZ8 A;  1E24 A;  4YWL A;  3KJO A;  4JI6 Q;  3KOJ A;  4KHZ A;  1HR0 W;  3RNU A;  5M3F H;  1VCI A;  4X62 L;  1XNQ L;  2JA7 H;  3J81 i;  3HOZ G;  2N49 A;  4JBW A;  1YIJ A;  4DR7 L;  4LUZ A;  1BBW A;  3HOX H;  4YHH L;  1I94 L;  2N78 A;  1AE2 A;  2MO0 A;  2HQL A;  4LF6 L;  2ATW A;  2R6G A;  4BY7 G;  4Y52 H;  2IHE A;  4A3J H;  3S1N H;  2BH8 A;  1HZC A;  2CFM A;  4QL5 A;  4LUV A;  4LF7 Q;  4DR2 L;  2VQF L;  3PUX A;  4LFC L;  4XTC S;  2Q2I A;  4JI1 Q;  2F3I A;  3STB C;  3UDG A;  3I4N H;  1E1O A;  4DUZ L;  1X55 A;  5M5X H;  5C3E H;  3TS0 A;  1PH5 A;  1MJC A;  1N8R C;  4TVA B;  4GKK L;  1IL2 A;  1FJG L;  4JBK A;  3A74 A;  1KL9 A;  4BBR H;  1VQO A;  2R7Z G;  4JI8 Q;  4A3E H;  1HNW L;  2D0P A;  3KDF B;  2WAQ E;  4DV4 Q;  1PV4 A;  3RLN A;  2VS1 A;  3K7A H;  2IX1 A;  4A93 H;  4K0K Q;  3RLF A;  4PZ6 A;  4UP9 A;  1LM0 A;  3OYY A;  2UXC Q;  2WAQ G;  2LXJ A;  1GVP A;  1VQG A;  5JEA G;  5FJ8 G;  2QEX A;  2ZM6 L;  1IBL L;  4YY3 L;  1IBK L;  1OTC A;  4GKJ L;  4IJL A;  4LF4 Q;  1X65 A;  1EOV A;  1E22 A;  4A3D G;  1Q12 A;  4GS3 A;  3D31 A;  3G71 A;  4LF5 Q;  4DR6 Q;  4IPD A;  3GD7 A;  1N32 L;  4NB3 A;  2E2J H;  2UUB L;  3F1Z A;  4B3S L;  2VL6 A;  5ELN A;  4YWM A;  4DK3 C;  1UE5 A;  1Q86 C;  1OXT A;  4HIK A;  5GAG C;  4IPH A;  4DV0 Q;  2NN6 I;  1YJW A;  2ZJR A;  4NXM L;  3HOZ H;  3AYH B;  3UE0 A;  4P74 A;  4GOP C;  3ULP A;  4LFA Q;  1V1Q A;  2JEB I;  4DPG A;  3CCJ A;  1BBU A;  4PMW A;  4BY1 H;  4DV4 L;  4BY7 H;  1C7Y A;  1Y1V G;  3CCQ A;  3TQY A;  2RHQ B;  1KRS A;  4X65 L;  5J3B A;  3U50 C;  2UXC L;  3LGJ A;  1I5F A;  4X66 Q;  2ID0 A;  3M3Y H;  3PUV A;  2R92 G;  1TWC H;  3BJU A;  2OWO A;  1G29 1;  3D0F A;  2JQO A;  1FL0 A;  2CKZ B;  4IOC A;  2UUA Q;  3CF5 A;  2BH2 A;  2YTY A;  4P75 A;  2I0Q A;  3CME A;  2BA1 A;  1M1K C;  5ELO A;  2UU9 L;  3PO3 G;  3MEF A;  1IYJ B;  2EIF A;  2VQE L;  2Q2U A;  5IE8 A;  4X64 Q;  1YIT A;  1EYG A;  4LUO A;  4DV3 Q;  2IX0 A;  2K5H A;  2Z0S A;  3HFZ B;  4O0A A;  4OXP A;  3Q8D A;  4YCU A;  3JAM c;  5LMN W;  5FJ8 H;  4A76 A;  1VQP A;  1HNX L;  2K75 A;  1HR0 Q;  2H5X A;  4NXN L;  4A3D H;  1L2F A;  3UDX A;  1XPU A;  3HOV G;  3PUW A;  4FDB A;  1WYD A;  2AMC B;  3RR5 A;  1CKN A;  2JJQ A;  1QVC A;  1XTD A;  4GNX B;  3E0E A;  5IYB G;  4JBJ A;  1YEZ A;  3S1Q H;  1G6P A;  2IHF A;  2YYZ A;  2I5M X;  1HZA A;  3T1H Q;  4IJH A;  3U4V A;  1VQ4 A;  4JV5 L;  1YJN A;  4DV6 Q;  2A1A A;  1QUQ A;  3KYH C;  2ZTC A;  1QZG A;  1J6Q A;  1KRT A;  3PSI A;  4O2D A;  5GAD C;  3MXN B;  1SMX A;  5AJ3 Q;  3KF8 B;  1D7Q A;  2E2H H;  1Y1V H;  2AKW B;  1P16 A;  4IPC A;  4KLK A;  4AIM A;  2IY5 B;  5FLM G;  4DV3 L;  4HID A;  1GD7 A;  2UUC Q;  1E1T A;  4EQ5 A;  1S3O A;  1PYB A;  4R4C A;  1Q46 A;  1YVC A;  3J7A 5;  4JI7 Q;  4HJA A;  1VQ7 A;  2E2I H;  3ZJY C;  2R92 H;  1CUK A;  4RG1 A;  1XPR A;  2R7Z H;  2KEN A;  2KHJ A;  1WCM G;  3CCV A;  2DUD A;  1UEB A;  1IXR A;  2Z6K C;  4A3K G;  3PO3 H;  4BXX G;  1Z47 A;  1PH3 A;  3T1H L;  2I5L X;  2JA8 G;  1X3G A;  2XTI A;  4DR4 L;  1HJP A;  3HOY G;  5AJ3 L;  3RZD H;  5GQO A;  2N8N A;  2MQH A;  3HKS A;  4DAY B;  4APV A;  2ZJQ A;  3GTL H;  3HOV H;  2K5N A;  4JCV E;  3BU2 A;  1TWG H;  2OTL A;  1WFQ A;  4DV7 Q;  1PFS A;  2HHH L;  1FVI A;  2UUC L;  5IYB H;  3CC2 A;  1L1O B;  3G48 A;  4DV2 Q;  5LMU Q;  4C3I H;  3OW2 A;  1QZH A;  3U4Z A;  3CW2 C;  2D62 A;  1O7I A;  3W1G A;  3L0O A;  4A4I A;  3STB D;  3U58 A;  1VQL A;  2K4K A;  2MO1 A;  2E5L Q;  2LXK A;  1PH7 A;  4P71 A;  4BA1 I;  2NN6 G;  2VUM G;  3TEH B;  3BZC A;  5FLM H;  4B3T L;  2WFW A;  2MFI A;  2YTX A;  4L5Q A;  3J81 c;  4BY1 G;  2PI2 E;  4JI5 L;  4L5R C;  5K36 G;  4POG A;  4LFB Q;  3S14 H;  4OWT B;  4JI4 Q;  1YZ6 A;  5C4X G;  2L15 A;  4GN5 A;  2ZTE A;  1J5E Q;  4DR5 Q;  1CSQ A;  1Y14 B;  5IYD G;  4A3C G;  1W2B A;  4JYA Q;  5IT9 c;  1WCM H;  5LMN Q;  1PH1 A;  2VNU D;  3GO5 A;  3EIV A;  4A3K H;  4BXX H;  1OXS C;  2JA8 H;  5JJI A;  4JI6 L;  4HJ8 A;  1TXY A;  1Q81 C;  2VW9 A;  4OWW B;  3KDF A;  3S17 H;  4UY8 C;  3CP0 A;  3UE1 A;  2K5V A;  1UE6 A;  3HOY H;  1CKO A;  4GLA C;  1D8L A;  1NJI C;  1Q1E A;  3A5Z B;  1TWH H;  1S72 A;  1MJE A;  2E5L L;  4A3G G;  3TRE A;  2BA0 A;  1EIF A;  3M4Q A;  1Y1W H;  3E9H A;  2F52 A;  2GN5 A;  1OXX K;  1A8V A;  3M4P A;  4LFB L;  4LF7 L;  4B3R Q;  4HJ7 A;  1KIX A;  4JOI C;  4JI1 L;  2WB1 E;  4R4I A;  5M3M G;  1NTG A;  3HKZ E;  1NMG A;  3E9I A;  2WB1 G;  2ZTD A;  1PVO A;  5C0X I;  1WI5 A;  3HKZ G;  4LWC A;  1JB7 A;  4L5T A;  2F4V Q;  2VUM H;  2NZH A;  3T1Y Q;  1K3R A;  2WP8 J;  4JI8 L;  3UDF A;  5IP7 G;  4YCV A;  4K0K L;  4GNX C;  1UWV A;  2A19 A;  3HOU G;  4L5S A;  2B29 A;  2KBN A;  5C4X H;  4A3C H;  5IYD H;  3H15 A;  2OTJ A;  1HZB A;  1VQK A;  3FKI G;  4LNQ A;  4LF4 L;  5IYC G;  2PQA A;  4LF5 L;  1ASY A;  3CC7 A;  4DR6 L;  3J7Z C;  3ICE A;  1E7Z A;  1PA6 A;  3GTO H;  5C44 G;  2LSS A;  4OX9 Q;  2KCT A;  1IBM Q;  2YU9 H;  4HJ9 A;  2IT1 A;  2YV5 A;  4MNO A;  4JC0 A;  4DV0 L;  4A3L G;  2UXD Q;  4DV1 Q;  2RF4 A;  4X6A H;  4A3G H;  4UP8 A;  4LFA L;  1LUZ A;  3K8A A;  1K9M C;  1HNZ Q;  1V9P A;  1IZ6 A;  4YCW A;  3T1Y L;  4GOP A;  5IWA Q;  2Q2H A;  3S1R H;  3KF6 A;  1AE3 A;  3OTO Q;  1NMF A;  5HY6 A;  2GVA A;  3CPW A;  3F8T A;  4GNX A;  1JE5 A;  3RZO H;  1X3F A;  2XGT A;  3PIP A;  1YJ9 A;  5M3M H;  1C9O A;  4X66 L;  3A5U A;  2B63 G;  4BBS G;  1VS0 A;  1K8G A;  2JK8 A;  4DNI A;  1K73 C;  2YTV A;  1WJJ A;  5H1S E;  3PIO A;  4JI0 Q;  2UUA L;  3EN2 A;  3L2P A;  1N36 Q;  2EXD A;  3HOW G;  4A3B G;  4AQY Q;  4IFD I;  4DV5 Q;  5IP7 H;  2MNA A;  3KLW A;  1L1O C;  4X64 L;  1N33 Q;  3HOU H;  2JE6 I;  4MTN A;  1N34 Q;  3AFP A;  2NVY H;  1GM5 A;  2UXD L;  3S2D H;  1B7Y B;  1H95 A;  3H3V H;  3M85 A;  3FKI H;  3PCO B;  4QJF A;  3PF4 A;  1CKN B;  4DR4 Q;  1HR0 L;  1P8L A;  5IYC H;  4JI3 Q;  1TWA H;  1VQH A;  1XMO Q;  1NBW A;  3FHW A;  4AYB E;  5EAY A;  3RN5 A;  2I5H A;  1EQR A;  2PI2 A;  4C2M H;  4R1J A;  4TQU S;  4KHP Q;  5C44 H;  1M90 C;  3OTO L;  1EFW A;  4AYB G;  3W1B A;  2KCM A;  1PH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...