3U58A

Crystal structure of the tetrahymena telomerase processivity factor teb1 ab
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
213
Chain Sequence
GSLSDQLSKQTLLISQLQVGKNRFSFKFEGRVVYKSSTFQNQQDSKYFFITAQDANNQEINLSFWQKVDQSYQTLKVGQYYYFIGGEVKQFKNNLELKFKFGDYQIIPKETLGGSGGSTLLISEVLKTSKQYLSVLAQVVDIQSSDKNIRLKICDNSCNQELKVVIFPDLCYEWRDKFSINKWYYFNEFVRQIYNDEVQLKNNIHSSIKESDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tetrahymena Teb1 AB
publication title Structural basis for Tetrahymena telomerase processivity factor Teb1 binding to single-stranded telomeric-repeat DNA.
pubmed doi rcsb
source organism Tetrahymena thermophila
molecule tags Dna binding protein/dna
total genus 40
structure length 213
sequence length 213
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3u58A02
3RZOH 5HGQA 5M5YH 1X56A 1HH2P 2Y0SE 3F2CA 1BVSA 1E1TA 4HJ9A 1Z9FA 1A63A 1MKHA 3M3YH 2WB1E 4X64Q 4A3MH 4DR4L 5M5WH 4DUZQ 2K5HA 4DR7Q 1TXYA 1Q81C 4JI6Q 2ES2A 4KHZA 2LXJA 3STBC 5H1SE 1BKBA 2ID0A 3K80C 4DV4Q 4JI3Q 1K83H 4RG1A 4X66Q 1X65A 4A3EH 1HNWL 3CPFA 4YWMA 1XPOA 4H02A 4LFCL 3J80c 2KHJA 2JA7H 1YHBA 3U58A 1UE5A 4LUZA 1EWIA 2K75A 4DV1Q 4DR4Q 1N34L 3D31A 1BBWA 2JQOA 3ULJA 1QZHA 1Y1WH 1I94Q 3KFUA 3T1YL 2LSSA 4X62L 1NMFA 4R4QA 3ULLA 5GAHC 4A3KH 1YIJA 1XMOL 2UXDQ 1WCMG 4KLKA 3U50C 3K81C 5JEAG 1XJVA 4A3JH 4LF9Q 1UWVA 2R7ZH 2R7FA 1KIXA 4AIMA 3KDFB 1IXRA 2KHIA 2XGTA 4AH6A 3H0GG 1Q7YC 3AFPA 1MJEA 3J80i 2JA5H 1PH9A 4NB3A 1K3RA 4C3HH 3NBHB 4A3IH 1BBUA 1LTLA 2Z0SA 2UXBL 4OXPA 4A75A 3J81c 3I4MG 3I4NH 4A3BG 3M4QA 3UE0A 2N49A 3CCEA 1VCIA 2F3IA 1UEBA 4P72A 4JI2Q 4BA1I 4GNXB 1VQ6A 1V1QA 2UUBQ 3PO2H 1KHIA 1VQ4A 1NY4A 3NEMA 1HZBA 4J15A 4JV5Q 4C3JH 3CC2A 2E2IH 1HZ9A 4A3GH 3BJUA 4DV2Q 2F4VQ 3OTOL 3J81i 3CCJA 3CCSA 2K5VA 1HNXL 1FJGL 1XNRQ 2OTJA 5GQOA 2ZTEA 2QEXA 1KL9A 4R4TA 4POGA 1QVGA 5IE8A 1X55A 2E5LQ 5C4XG 5K36G 3ZJYC 2CWAA 2Q2UA 4R4CA 4A3MG 1EFWA 1VQ7A 1SR3A 3CQZH 2XTIA 4A3LH 3CP0A 1M1KC 4GS3A 3S14H 4JI0Q 2VNUD 5BR8Q 3HOYH 3L7ZC 4EQ5A 4YCVA 2B29A 2QA4A 3JC66 2ZM6Q 4FDBA 4OX9L 2K5NA 1VS0A 1WYDA 3HFZB 3G71A 1C7YA 2JA7G 3S24A 1J5EQ 1L1OA 3I2ZA 4IPGA 4DV3Q 1W2BA 3S16H 2HHHQ 1OTCA 4JYAQ 5C44H 1EOVA 1HZCA 4BBRH 4P74A 4DAYB 1Y1WG 3NELA 4QGUA 4A3KG 4BXXH 4PZ6A 5LMNQ 2JEBI 4LFAL 2I5MX 4BY1H 3HOVH 1OXXK 2UUAL 2EIFA 4JBKA 3TS0A 3FKIH 5LMNW 3CXCA 4A3JG 1XPUA 2R7ZG 4GKKQ 4LF4Q 1QVFA 1N32L 1VQFA 1PH7A 2UU9L 1WOCA 2RF4A 4JOIA 2VQEL 5LMUQ 1K9MC 1B8AA 2CCZA 2E2JH 2NVTH 4B3RL 1K0RA 3PUZA 4A3IG 2JK8A 1L2FA 4IPCA 5M3FH 5JJIA 2RHSB 1SN8A 1Q8KA 4DV6L 3M4OH 3H0GH 2OQ0A 3KJPA 5AJ3Q 3I4NG 2RCNA 2I5HA 4DR3L 5C4JH 2QGQA 4C2MH 5FLMH 1L1OC 1IBLQ 3GTLH 3SGIA 1PH4A 2LXKA 1CKOA 1Q86C 1GD7A 4OWXB 3I4MH 1SMXA 1N36Q 1PHJA 1B7YB 4WJ3M 2I5LX 4A3CH 4RMFA 4X64L 3CCUA 1QZGA 2WAQG 4DUZL 4NXMQ 1O7IA 1JJCB 4A3GG 4DR7L 4JI6L 3GTPH 4PZ7A 1HJPA 1N9WA 5M5XH 1PH3A 5HY6A 3TRZA 2F52A 4JI3L 4DV4L 1YHQA 4POFA 1X3EA 2NZOA 2VL6A 4JOIC 3EN2A 3M4PA 4X66L 2Q2TA 3A5ZB 4IFDI 3UE1A 3E9IA 3D0FA 1TWGH 1WJJA 2AKWB 2PQAA 3DM3A 3OW2A 1VQCA 1GVPA 3J7ZC 2OCEA 1NE3A 3HOWH 5ELNA 1TWCH 3HOYG 4DV1L 4QJFA 3G6EA 4HIDA 1WI5A 3A5UA 1I94L 4APVA 3M7NA 4GKJQ 1KAWA 2PNHA 5JEAJ 2UXDL 2VW9A 2UUCQ 2A19A 1OXSC 1P16A 2R7DA 1RL2A 4MZ9A 3PUWA 3F2BA 4HJ8A 2IX1A 1HNZQ 4LF9L 1EIFA 3E0EA 3PUXA 1IBMQ 2RHQB 1Z47A 3KDFA 4GOPA 1VQLA 5C44G 3FHWA 3ULPA 4BBRG 4DR6Q 2Q2HA 4HIKA 2DUDA 1K73C 4BXXG 4JC0A 2B3GA 2VZAA 4BY1G 4HIMA 4B3TQ 1X3GA 3GTQH 3HOVG 2IY5B 5C3EH 3FKIG 5ELOA 2A8VA 1VQBA 3TEHB 4XTCS 3PCOB 3HKZE 2GVAA 4JI2L 2B63H 4L5RC 3TQYA 3RN2A 1UE6A 4LUOA 3GDEA 3GO5A 3CCRA 5M3FG 1VQPA 2I0QA 2UUBL 3PIOA 3GTJH 4NXNQ 3PUYA 4IPHA 2IHEA 2AWNA 4JV5L 1IZ6A 5IP7H 1SFOH 2R6GA 1V9PA 3RLOA 1QVCA 5FLMG 2R92G 3OYYA 5C0XJ 4R4OA 4DV2L 2PI2E 4Y7NH 2F4VL 3S1MH 2N3SA 4QL5A 3T1HQ 1XNRL 1CKNA 4GOPC 4UP7A 4AQYQ 3S1RH 1HR0Q 3Q8DA 2E5LL 2AHOB 3BZCA 5FJ8G 4A3CG 2OQKA 1CUKA 1QUQA 2V1CC 3BU2A 1VQDA 1IYJB 2EQSA 4YY3Q 4K0KQ 3KOJA 4JI0L 5IP9H 5BR8L 3L0OA 1VQOA 1KXLA 1ASYA 2ZM6L 2IX0A 1AH9A 4BY7G 4TVAB 4MTNA 3JAMc 5C0XG 3AYHB 1NTGA 1J5EL 4DV3L 2AWOA 3KF8B 4YWLA 3CPWA 2HHHL 3HOWG 4A93H 3STBD 1UE1A 3TREA 4X65Q 3H3VH 4UP8A 4JYAL 1D7QA 2JJQA 1HZAA 2PMZE 4JI8Q 1LUZA 5LMNL 1B70B 4DK3C 3FP9A 4DUYQ 2N8NA 4OO1I 3KJOA 3LGJA 1VQIA 1JJ2A 4LF4L 1AE3A 4B3SQ 4BA2I 4GKKL 2KCMA 5IT9c 3W5OA 1FGUA 3JAMi 3PF5A 5JJKA 2IT1A 1J6QA 5LMUL 1U0LA 1E1OA 2CKZB 4PG3A 1SLJA 3RN5A 1EIYB 1LYLA 4JCVE 3F1ZA 1L0WA 5C3EG 4DV5Q 1YI2A 3PIPA 4GLVB 2VQFQ 5AJ3L 1JT8A 4TQUS 3EBEA 2B63G 3W1BA 1IBLL 1Q1BA 4A3FH 3E9HA 4KI0A 5IY0A 3H15A 4JG2A 1A0IA 1ASZA 1N36L 2NN6I 4R1JA 2WAQE 4JBMA 4UY8C 3CMEA 1VQEA 3PO3G 3S15H 3CW2C 4AYBG 5IP7G 2C35B 1KQSA 4LF6Q 1N33Q 4DV0Q 4A3LG 3IRBA 4NXML 1PH1A 1X54A 2YYZA 4PMWA 3UDFA 3RNUA 4DR2Q 3GTGH 1E22A 2NVYH 4EX5A 4A3DH 3VDYA 2R92H 1X3FA 3AEVA 4LF8Q 5EAYA 2K52A 4JI7Q 2YTVA 2CWPA 4OONA 1NBWA 4IOCA 2A1AA 4JI4Q 2JEAI 4WJ4A 1X9NA 4NPSA 3I55A 4LF7Q 1OXVA 5IP9G 3PUVA 3CCLA 1SRUA 5FJ8H 2D62A 3PGZA 4DNIA 3KLWA 4GKJL 1L1OB 1GKHA 2CQOA 2UUCL 4HIOA 1XMQQ 1LM0A 1MIUA 1C0AA 1HNZL 3F8TA 4QIWE 1K8GA 1S40A 1IBKQ 1IBML 4A93G 4QQBX 4BY7H 2UXCQ 4XIGS 3S2HH 4DR6L 4IFDG 1E7ZA 4DV7Q 3I56A 4KHPQ 2YV5A 2E8GA 1EQQA 5C4XH 4B3TL 1PH8A 3CCQA 4PZ8A 3G4SA 3KF6B 4A4IA 1X6OA 3HKSA 4ALPA 2NVXH 1PA6A 3CAMA 1TWHH 2MNAA 4UPAA 1RIPA 1XNQQ 4L5QA 4DK6C 1N8RC 3PF4A 4LFBQ 4OWTB 3CCMA 4DR1Q 5GAGC 4YCWA 1IL2A 1YBYA 1JMCA 1T9HA 1Y1VH 2ZJQA 2KENA 4NXNL 4B3MQ 2D0OA 1VQGA 2YU9H 1YZ6A 1UE7A 1EUJA 3HOUG 3UDGA 3RZDH 2VS1A 5IYDH 5GADC 4JI5Q 1GM5A 3J81j 3F2DA 4A3FG 1U5KA 2ALYB 3T1HL 4YHHL 2MO0A 4P73A 2ZJPA 1V43A 4QY7A 5GAEC 5IWAQ 4GNXA 4LF5Q 4AQYL 3B6YA 1HR0L 2BA0A 3PV0A 5IYBG 4R4IA 2MO1A 4YY3L 4K0KL 2NVQH 4DR5Q 5IYCH 4JI1Q 3CC4A 3PO3H 1VQAA 4A3DG 1K8AC 1WFQA 3PSIA 2VUMH 1PV4A 3GTOH 4GN3B 1PH5A 2NZHA 3J7A5 2PQAB 1VQ9A 1CSPA 4YHHQ 3K7UC 2JA8H 3M85A 4BBSG 5JJLA 1EQRA 2Y0SG 4X65L 5FLXc 3A0JA 4OWWB 2WB1G 2JE6I 3K8AA 4IJLA 1OXTA 3U4ZA 4GLAC 1HR0W 4JI8L 2L15A 1YEZA 3UDIA 3S1NH 4IOAA 2GVBA 4DUYL 3M9BA 3AFQA 4GNXC 1HNWQ 1YITA 4GOPB 4Y52H 4B3SL 3AQQA 4LFCQ 1PH6A 3W1GA 3S2DH 1G6PA 5M3MH 1Y14B 1KD1C 1DGSA 2BH8A 1N34Q 3WWVA 3MXNB 2BA1A 3I4OA 1KRSA 4LWCA 4X62Q 1NMGA 2AMCB 4DV5L 3T1YQ 1XMOQ 1VQJA 1VQNA 4IJHA 1JJGA 2K4KA 4GN4B 1PH2A 3TS2A 2R93H 2VQFL 1P8LA 2N78A 3HKZG 3MEFA 4GLXA 4YCUA 4AYBE 1YJWA 1XTDA 2HQLA 2PI2A 3RLFA 1E24A 1Y1VG 1G51A 2VY3A 4P71A 2JA6H 4OO1G 1PVOA 1Q46A 3RLNA 1PYSB 1TWFH 1YHAA 2MFIA 5C0XI 3HOXG 1NJIC 2UXBQ 2K50A 4LF6L 4JBWA 4A76A 1PYBA 4DKAC 5IYDG 4DV0L 1N33L 4DPGA 1JB7A 3L2PA 1I6HH 1CKNB 4O2DA 1YJNA 4P75A 4DR2L 4LUVA 1KRTA 2WP8J 1TWAH 1XPRA 3HOUH 3CCVA 1S72A 2E2HH 1QUQB 1EYGA 3S17H 4LW1A 4LF8L 4JBJA 2KCTA 4JI7L 4JI4L 1VQ8A 4HJAA 3RR5A 5IYCG 4LF7L 1M90C 4A3EG 2VUMG 2NN6G 2Z6KA 3OTOQ 1FJGQ 1HNXQ 5IYBH 2GN5A 1KC8C 4GN5A 4LNQA 3K7AH 3KYHC 3CMAA 2DGYA 1XMQL 2JA8G 3CF5A 3U4VA 1CSQA 1IBKL 1PFSA 1E3PA 4C3IH 2OWOA 1W3SA 4IFDJ 4IPDA 2ZJRA 2UXCL 5E7NA 3GTMH 1A62A 4DV7L 4BBSH 3EIVA 4KHPL 2BH2A 2FXQA 4L5SA 4OX9Q 2H5XA 1Q1EA 1VQ5A 3KF6A 1Q12A 1SROA 3BZKA 5GROA 3CD6A 1WCMH 1AE2A 2ASBA 5J3BA 2JA5G 2YTYA 3DLLA 3I7FA 4MNOA 1VQKA 3GTKH 3ER0A 1C9OA 5M3MG 4HJ7A 2OTLA 4ME3A 1R9TH 1XNQL 1FVIA 4YWKA 3ICEA 4LFBL 1D8LA 4DR1L 1CKMA 2ZTDA 1MJCA 1OXUA 2Z6KC 1I50H 3K0XA 4B3ML 4LFAQ 3G48A 1G291 2UUAQ 5DLQE 1GO3E 4UP9A 2KBNA 1A8VA 1I3QH 2HIVA 2JA9A 2MQHA 2Q2IA 3NENA 4JI5L 4DAMA 1VQMA 3PO2G 1N32Q 1S3OA 3HOZG 4A3BH 2UU9Q 3HOZH 1JE5A 1SE8A 2CFMA 2VQEQ 2JA6G 4B3RQ 1FL0A 4O0AA 2HIXA 2EXDA 2R93G 1YNXA 3ERSX 5IWAL 3S1QH 4LF5L 2YTXA 2ATWA 4HJ5A 4X6AH 1H95A 4IO9A 4DV6Q 1YVCA 2IHFA 3A74A 4L5TA 4DR3Q 2HT1A 1I5FA 2K14A 1Q82C 3H3VI 1VQHA 2ZTCA 3GD7A 3HOXH 4JI1L 4DR5L 3CC7A 3UDXA 1YJ9A 2D0PA 2WFWA
chains in the Genus database with same CATH superfamily
3NQIA 5M5YH 1PTOC 1HH2P 2MUYA 3V05A 3PQIA 1SNQA 2L5TA 4X3TA 1Z9FA 1V1PB 5T1IA 1MKHA 3M3YH 2BOSA 2K5HA 3BYYB 4DR7Q 2ES2A 4CKEA 1K83H 4X66Q 1X65A 3WDNA 3CPFA 1XPOA 2JA7H 1TWFB 1HTPA 1YHBA 4KKTA 5IOCA 1UE5A 4LUZA 2KEEA 1N34L 3ULJA 3KFUA 1QZHA 1NMFA 4BWGB 1XMOL 3K0YA 3K81C 3E5SA 3J81E 1XJVA 1RD9D 5IGBA 1UWVA 1KIXA 4AIMA 3KDFB 5CGKA 2XGTA 2KHIA 2KJXA 4AH6A 2A69C 4NB3A 3NBHB 4B9WA 2Z0SA 3HG9A 5C6AA 5F2DA 5A2QE 3I4MG 3I4NH 2CVRA 3K7AB 4EVOA 4A3BG 4QF4A 3CCEA 4GNXB 2N55A 4P72A 2PYKA 2RDFA 5IGCA 3JAML 1V1QA 1U9RA 1VQ4A 5NUCA 4CDEC 3I90A 2E2DC 4DXFA 1Y8OB 4RGMA 2F4VQ 3OTOL 3J81i 1HNXL 3G7LA 2QEXA 4POGA 1B4OA 5IE8A 3C46A 1EEID 5I6WA 2E5LQ 2MJ8A 4R4CA 5JVG3 1I50B 1C4QA 1YNJD 1SR3A 4JI0Q 2B2TC 2VNUD 5CORA 1WD1A 4EQ5A 5C5LA 2QA4A 4A3BB 2K5NA 2Z1CA 1C7YA 4XT3B 2Q8RE 2JA7G 5CMDA 1J5EQ 3HKZB 1HXYD 4RHRA 3KLRA 3I91A 3Q0AA 1O7LA 1ET9A 1TQOA 3KUPA 3NELA 2HDMA 2I5MX 1CQVA 1SNDA 3TS0A 3FKIH 3D4WA 5M5YB 2O2LD 1STNA 1B3AA 5CV8A 3K5NA 3T16A 2RF4A 4B3RL 2E2JH 4XQNA 1K0RA 2RHSB 3MAQA 1Y69U 1K83B 3H0GH 3K6OA 3KJPA 3I4NG 5IGFA 4FYDA 4DXGA 1IBLQ 2JA7B 1B1ZA 1GD7A 4OWXB 1SMXA 3E6ZX 4RCOA 2BCOA 1B7YB 2I5LX 4RMFA 3FRPB 4EGVA 1GUTA 1O7IA 4DUZL 4J1MA 4NXMQ 4JI6L 1I4QA 4OELB 2PMZB 1BDOA 4JI3L 2VL6A 3M4PA 2Q2TA 4NKLA 2AKWB 1SYBA 1VMCA 2PQAA 1RTOA 3EQLC 4DF7A 2XSCA 4DV1L 3U9OA 3I4NB 2K04A 3A5UA 4APVA 1E2ZA 2EY6A 4HJ8A 2UUCQ 1BBXC 2PPBC 2IX1A 1B44D 1HCZA 3PUXA 2RHQB 5IIFA 1WTWA 2Q2HA 1WTHA 1BCPD 2DUDA 2B3GA 2VZAA 3FKIG 3MXPA 2DJFC 3H94A 3Q6SA 2A8VA 3ERQA 3R2IA 3IAYA 1MGSA 1NNXA 2GVAA 4KJNA 3RN2A 1UE6A 3GO5A 3CCRA 3GTJH 4IPHA 5I4DA 3PIP3 1X3PA 2IHEA 2AWNA 3C3LA 4JV5L 5FLXL 5JOBA 3I8ZA 2R6GA 2R92G 4ZUIA 4R4OA 4DV2L 1KABA 3OHXC 4ZK9B 1ZXTA 3S1MH 1XNRL 2EY1A 3RMHA 1GUOA 5EPLA 4AQYQ 3Q8DA 1GUGA 5FJ8G 1QUQA 3BU2A 4HN7A 3RD4A 5FO7B 4K0KQ 3FKIB 1ENCA 3SDZA 1ASYA 1TY0A 2ZM6L 1A15A 3E3XA 3T51B 5IODA 4TVAB 4MTNA 5CV4A 3JAMc 4DV3L 2AWOA 4A93H 3H0GB 2I46A 1UE1A 5FO8B 2ENBA 1LO5D 2VB3X 1LTSD 5LMNL 3FP9A 4N9TA 4DUYQ 2N8NA 1B2TA 2H1EA 1UUPA 4BA2I 4LF4L 4GKKL 2KQ3A 2KCMA 2IT1A 2K05A 5LMUL 3S1QB 4N8FA 1EIYB 3KLSA 5D65A 1LYLA 4DV5Q 3PIPA 1A3UA 4GLVB 3OSOA 1F9SA 5AJ3L 1FGBD 4IUQA 4K5VA 2HCIA 3EROA 3W1BA 1Q1BA 5IY0A 3H15A 3SK4A 2V4DA 2A69D 2NN6I 4ZQ3A 2L9HA 3PO3G 4AYBG 2RKSA 3FMCA 5EPKA 1ET6A 1PH1A 2F3WA 2YYZA 3RNUA 1KNEA 3ITPA 1E22A 4EX5A 2RBMA 4A3DH 3VDYA 3SXHA 3AEVA 5EAYA 2K52A 4FF3A 3TDQA 1AEXA 1NBWA 4IOCA 4WJ4A 1KNAA 4MN3A 5COYA 1WTVA 1V1PA 1JB3A 3CCLA 1FYCA 4GKJL 3KLWA 4MIUA 2F0QA 3TP5A 1C0AA 1HNZL 4ZKBB 1FNWA 3GTJB 1K8GA 1S40A 1IBKQ 1IBML 3M4YA 1SAPA 4QQBX 4A93G 4AYBB 3FDTA 3NTHA 2GA4B 2B2VC 2K6AA 3I56A 2PCFB 1EU4A 3S1MB 3AB9A 4PZ8A 3G4SA 3KF6B 4A4IA 4ALPA 1BNZA 4DK6C 2CH4W 1D6EC 2M00A 1UE7A 3ZYYX 2LKVA 5GADC 3NBHA 4JI5Q 3F2DA 1U5KA 2ALYB 5KNBA 3LWUA 5C5MA 4KTAA 1V43A 4A93B 1LT5D 4GNXA 1CT1D 1D1IA 2QDBA 4G7HC 1EOTA 1GUWA 4I7ZC 2MO1A 4YY3L 2PW7A 4A3DG 1WFQA 3PSIA 4KHVA 1PV4A 3GTOH 1KDCA 1PRTB 1CSPA 1SMYD 2NUCA 1GOZA 2P5ZX 1PTOF 5FLXc 1A3TA 3SHLA 1SJHD 3S1NH 4IOAA 1HNWQ 1YITA 4GOPB 3KBXA 1SE3A 3S2DH 4OIJA 1Y14B 2BH8A 3WWVA 1LTBD 2SDFA 2BA1A 1JJGA 1GUSA 4A3DB 3URYA 3MEHA 4B9XA 1P8LA 3A8JE 2N78A 1KTKA 4GLXA 1YJWA 2HQLA 4OO1G 4P71A 4V0BA 1Q46A 5C0XI 1PYSB 3HOXG 5E4XA 3OW7A 1A6XA 4LF6L 4DKAC 4DV0L 1ENFA 3F2UA 2B2WA 3D8GA 3NUCA 1I6HH 3DWPA 4RAUC 3NTKA 2XN9C 3E0JA 3GV3A 3CCVA 1W6KA 4LW1A 4LF8L 4FF4A 3ND8A 3Q22A 1W6JA 4HJAA 1EY8A 1HPCA 5EPJA 3J7AV 1F9RA 3OOCA 1QNUA 1KC8C 2L0CA 1FD7D 3KYHC 4ZCKA 4IPDA 2JYOA 2ZJRA 3TZUA 1JWUD 3GTMH 1LACA 4BBSH 3TBIB 1BF4A 2QF7A 3VA5A 1F2ZA 1VQ5A 4K2LA 5GROA 3OWEB 2JA5G 2YTYA 1STYA 4MNOA 1C9OA 4C1NK 3LWEA 3ICEA 1CKMA 2ZTDA 1MJCA 1FR3A 3MTSA 1K0SA 3QJYA 1QG7A 4U673 1J9OA 4FXKC 3GTOB 2JN4A 1GO3E 1O7YA 2F0EA 2JA9A 3NENA 4UP9A 1VQMA 3PO2G 1N32Q 2PZUA 1H9SB 2UU9Q 3HOZH 2QDLA 2VQEQ 2EXDA 1YNXA 3ERSX 5IWAL 4LJZC 1S5DD 2RDGA 3MXUA 3S1NB 4L5TA 2HT1A 1S5CD 3S2DB 2WFWA 1X56A 1E1TA 2F0JA 3VYSA 1BOSA 3J80E 2WB1E 4X64Q 4A3MH 5IGEA 5M5WH 2WIIB 4KHZA 1BKBA 2ID0A 3K80C 1YNJC 4RG1A 2X6LA 4A3EH 2NN6H 5CC4A 1CHQD 4YWMA 4LFCL 4NMZA 2KHJA 5ELFA 5BN3A 4CJ0B 3U58A 2EY5A 4QCLA 1EWIA 1RDPD 3BDLA 1I6HB 3D31A 4N9PA 1STAA 1I94Q 3MWYW 1E0BA 3T1YL 5LHY1 1T5EA 2DJGC 1X3QA 4LF9Q 3CHBD 2D9UA 1UAPA 2R7FA 4FF2A 1IXRA 2NYZD 5CV7A 2M9VA 3J80i 1PH9A 1JE4A 4FO2A 4DU9A 5KGUA 3BVZA 3C1FA 4F7XA 4A75A 2MPMA 3J81c 1BUVT 3HOZG 1UEBA 4CGYB 1EY0A 2K33A 3I73A 4PQXA 1KHIA 3GTMB 3NEMA 4BBSB 4R8IA 4IUTA 4C3JH 3CC2A 4EQPA 2E2IH 1HZ9A 2XRSD 1XWEA 3TZDA 1GHKA 3CCJA 1FJGL 3CCSA 2RDHA 5GQOA 4R4TA 2F03A 2DY8A 1X55A 5K36G 2Q2UA 1O78A 4A3MG 1VQ7A 1I4HA 2XTIA 2KVMA 3S14H 4MHEA 1DJRD 2QKIC 4OIKA 2B29A 3JC66 3HOZB 1WYDA 1TT2A 3S24A 3S16H 3I2ZA 1W2BA 3NPPA 4K2KA 1JC7A 3N52A 4IUVA 4BBRH 2B8FA 4QGUA 4P2CB 5CBEE 1A3VA 1RCVD 2K03A 4PZ6A 1NAPA 2JEBI 4LFAL 4GZYC 4F88A 4BY1H 1IYVA 2UUAL 4JBKA 1XPUA 1BCPC 1ZKOA 1Y8NB 5G3LD 1F2LA 4A3MB 2J4XA 2OT2A 1R4PB 5M5WB 2NVTH 1B8AA 3PUZA 4IPCA 5JJIA 2OXPA 1FNUA 4A3EB 1CA6A 3I4LA 4FNFA 2NBFA 2LXKA 3I4MH 1N36Q 1CK1A 3I72A 1QCBD 4EQOA 1K8MA 3HRZC 4BS9A 3M7GA 1EEFD 3CCUA 1CZGA 4IZ8A 1QZGA 2KEDA 4G57A 4DR7L 2HDLA 3GTPH 4PZ7A 4Q0FA 2E75C 4L6TB 1YHQA 4POFA 4X66L 2NZOA 3UE1A 3E9IA 1TWGH 4RH6A 5C0XH 3P7JA 3R3OA 2CH4A 2OCEA 1NE3A 5CV5A 1CFMA 3C2PA 4OEMB 2O5JC 4QJFA 3G6EA 1WI5A 4NP5A 4NW2A 3T53B 2KA7A 1KAWA 4UDUC 3AMUA 2VW9A 4WORA 1P16A 2R7DA 4MZ9A 1RL2A 1BO0A 1EIFA 2B2YA 4JPBW 3E0EA 5HURA 3H3VC 4GOPA 4C3JB 4DGZA 3ULPA 3SK6A 4BBRG 2E2IB 4HIKA 4C56C 4BY1G 4B3TQ 2F3VA 1X3GA 2IY5B 4FXGC 5ELOA 4XTCS 4OGQC 1TWAB 2AQ3B 1SYGA 3GQBA 3TMEA 1CI3M 3S14B 3I70A 2BDOA 2I0QA 2Z4IA 5DEHA 3PUYA 2SNMA 2F0GA 4KK7A 1QVCA 5C0XJ 2F4VL 2N3SA 4PNYA 3S16B 2H4OA 5EBDA 1I4RA 4UP7A 3X3NA 5EQ0A 3S1RH 4BBRB 1HR0Q 2E5LL 2IL8A 1TU2B 5ELDA 1CUKA 2V1CC 4QUCA 4BY1B 2EQSA 3W2DA 4JI0L 3NWTA 1VQOA 1DD2A 2WKCA 2IX0A 1AH9A 4BY7G 4CBVA 1LTRD 2NVTB 5K5PA 3AYHB 5C0XG 1NTGA 5IT9E 1J5EL 4HTHA 4UP8A 2G9HD 1HZAA 4JI8Q 1LUZA 4ZAIA 4RGNA 4ZUJA 4OO1I 3I4MB 3KJOA 1JJ2A 2XNAC 4B3SQ 3D3RA 1J6QA 4PG3A 1CTMA 3GTPB 1WVLA 1PRTD 3F1ZA 4JCVE 5EGTA 1L0WA 3V2TA 5G3LF 1E2VA 2K5DA 2ZXRA 3MVVA 1TWGB 2LFNA 1G8ZD 1IBLL 5ELEA 2ZXPA 4PMCA 4XDXA 1H9SA 2WAQE 4R1JA 4UY8C 3M3YB 2QEJC 1LT3D 1VQEA 3S15H 1VDZA 2ZXOA 3IRBA 4NXML 2EZVA 4PMWA 2RQXA 2NVYH 1QB5D 2R92H 2ICIA 1X3FA 2ICEC 2F1MA 4ME5A 4JI7Q 4RFBA 2YTVA 4JI4Q 2A1AA 2JEAI 1NR4A 1OXVA 1SMYC 1SYCA 5FJ8H 3TP6A 3PGZA 4CDFC 5I2YA 1DOMA 1L1OB 2CQOA 2KCNA 2UUCL 2F0FA 1LM0A 5FKAC 4QIWE 2UXCQ 1HFNA 1M8AA 2F0HA 3S2HH 4IFDG 4DV7Q 3VYUA 2E8GA 1S4ZA 4QUFA 1O80A 3K57A 1Q90A 2NVXH 1PA6A 3S1RB 5D3IB 1XNQQ 3PF4A 4OWTB 3CCMA 3MXGA 4YCWA 1JMCA 3VR6A 2ZJQA 2YU9H 5CR3A 2Z6BA 1EUJA 1LABA 3HOUG 5KRUA 3RZDH 1HFGA 5IYDH 1GM5A 1GJXA 1CHPD 1AP0A 3P75A 3GV6A 1AN8A 2ZJPA 5GAEC 2EJGC 4AQYL 3CRLC 3ONAB 1U4PA 4K0KL 2NVQH 1SXTA 3MA2B 4KD3A 3CC4A 3PO3H 3OIPA 4GN3B 1MI2A 4C3IG 3HZXA 3A55A 3IKJA 3K7UC 2JA8H 3M85A 4H13C 4IURA 5JJZA 2JSOA 3HS0C 1B9NA 3A0JA 4KD4A 2WB1G 1SDFA 3K8AA 4IJLA 1OXTA 3BZDB 4GLAC 2ZT9C 2G9DA 4RKLA 5JVH3 3AFQA 4DUYL 4GNXC 5KIXA 1X32A 2A68C 3W1GA 3S15B 1G6PA 2E2JB 1KD1C 1SYFA 3MXNB 3QOLA 3I4OA 3Q24A 2B2TA 4ULLA 4X62Q 4DV5L 2NVYB 1WTQA 1VQJA 4GN4B 2FFKB 4FVMA 4LK1C 1PH2A 4EQNA 3TS2A 2EYOA 2R92B 2L55A 4XT1B 1G2SA 1QNKA 2KUMA 4YCUA 2RA4A 3RLFA 1CM9A 3RLNA 3RUZA 1NJIC 2WB1B 2NB0A 2UXBQ 4JBWA 4A76A 1PYBA 5IYDG 1R4QB 4RWSC 5KNCA 4O2DA 4Z9CB 1KRTA 1ILPA 4KN4C 1S72A 4HMIA 2E2HH 3S2HB 1EYGA 2F0WA 3S17H 2KCTA 4HMJA 1MSHA 5CV6A 1IL8A 1S5BD 1M90C 2NVXB 2SEBD 2GN5A 4LNQA 1RKNA 1EU3A 4M1UB 3CMAA 2JA8G 3U4VA 2IW3A 1CSQA 1SE4A 1IBKL 2YU9B 1E3PA 2OWOA 1W3SA 2B2WC 1TKWB 4TKOB 1STBA 3RZDB 4CKBA 5C3XA 3EIVA 3HGBA 4X3SA 4OX9Q 2D2CC 2X69A 3CD6A 3DWAA 4OHJA 2F0OA 2ASBA 2LY7A 1VQKA 4ME3A 2SNSA 1D8LA 5ELBA 5HGTA 2NVQB 4HR7B 3PO3B 3K0XA 3G48A 1RJTA 3D6CA 4DAVA 2OF1A 2KBNA 3IFTA 3OIQA 1A8VA 2EYHA 1K28A 2HIVA 4JI5L 4RHSA 1S3OA 2JA8B 4CHTB 3OMGA 1U4MA 2CFMA 4IQZA 4K6DA 4O0AA 1BCPF 5TSSA 3SEBA 2PZWA 2ATWA 1H95A 2AQ2B 4DV6Q 1YVCA 3CRKC 1Q8IA 1I5FA 2K14A 4DR3Q 4OO1H 3GD7A 3HOXH 3UDXA 1YJ9A 2D0PA 5M5XH 4A3LG 2TSSA 5HGQA 3QR8A 3F2CA 4FP5D 4HJ9A 4M8AA 4DR4L 1TXYA 3STBC 2LXJA 5H1SE 4DV4Q 3OPOA 1PFMA 1HNWL 4IUUA 2O5IC 4H02A 3J80c 1AW7A 4HEDA 4X3UA 1LLRD 4ZYSA 2K75A 1PZJD 4DR4Q 1VMPA 2LSSA 5GAHC 1L0XB 4R4QA 2UXDQ 4KLKA 3LX0A 2PZTA 5JEAG 2E2HB 2R7ZH 3S17B 3J81L 1TS5A 4PMBA 4IUPA 2NZ1D 1Q7YC 3AFPA 2JA5H 4XYOA 3KK7A 3NTIA 1B3QA 4G4KA 4C3HH 4A3IH 1BBUA 1LTLA 2EYJA 1RTNA 3M4QA 3UE0A 5A2QL 1VCIA 4JI2Q 4BA1I 1C8CA 1D1KA 3NK9A 2FMCA 5EBCA 1SYEA 2UUBQ 3PO2H 1PTOH 1NY4A 2TMPA 1HZBA 4IALA 3QWNA 4KN7C 5J39A 2K1BA 1U4LA 5E3FA 4DK0A 1HQRD 2K5VA 5J22A 1KL9A 1G6ZA 3CKIB 1JQYD 3ZJYC 1EFID 2CWAA 1EFWA 1QILA 4FF1A 1V8QA 1TS2A 5BR8Q 3HOYH 3L7ZC 2BDNA 1IW7D 4WFN3 4FDBA 4B08A 2F0NA 1LTAD 1FNVA 4QB4A 2FHTA 2XWBB 1L1OA 1I6VC 4IPGA 3P20A 2HHHQ 1WTOA 4JYAQ 4K8JA 5C44H 1HZCA 1D5ZC 1BXTA 3HOXB 1A2UA 2FMMA 4BXXH 3SK5A 3HOVH 5M5XB 1OXXK 2EIFA 4MTKA 2R7ZG 2A68D 3X3MA 1QVFA 2F0LA 5T1GA 1N32L 1VQFA 1PH7A 3J7YW 2UU9L 1WOCA 4JOIA 3MZ5A 2VQEL 2CCZA 3QG1A 4C3HG 4A3IG 2JK8A 1L2FA 5M3FH 2B2VA 4PV1C 2F0MA 3HEJA 1AFPA 1V1OA 4K14A 5FLMH 2WINB 3SK8A 5ELCA 1Q86C 1PDQA 3MFYA 1ML0D 4WJ3M 1ILQA 4LAAA 4X64L 4A3CH 4L8JA 2IJ0A 2VXWA 2WAQG 1NUCA 1WTRA 1N9WA 2B39A 5J1ZA 5HY6A 1PH3A 3TRZA 2F52A 2R7ZB 1X3EA 5LL6S 4IFDI 1EQVA 2JA5B 3OMCA 1WJJA 1SYDA 4C3HB 4A3IB 1VQCA 1ESRA 1TWCH 3HOYG 5K36H 1HUMA 1JICA 4HIDA 1I94L 3FPPA 3M7NA 1OXSC 2A6ED 3PO2B 4LF9L 1PTOB 4H7BA 1Z47A 1MHWC 3BG3A 3FHWA 5C44G 4DR6Q 2DNEA 2WAQB 1K73C 4BXXG 4JC0A 1F9PA 3K58A 4HIMA 3HOVG 5C3EH 2K28A 1VQBA 3MXNA 3TEHB 3PCOB 1PRTC 2B63H 4L5RC 4LUOA 3GDEA 5M3FG 1PFBA 3PIOA 4NXNQ 3HOYB 1F77A 5FLXE 3VR5A 2F0VA 1IZ6A 4C1NI 1V9PA 5FLMG 3OYYA 3KBGA 2B2YC 2PI2E 3NE5B 4Y7NH 1WD0A 4QL5A 3T1HQ 2LS01 3OWFA 2C5CA 4GOPC 4KMUC 3D4RA 5C44B 5D3DA 4QIWB 4A3CG 3BZCA 3EVQA 1STEA 3HOVB 1IYJB 3DWQA 1JWMD 1WTXA 1II3A 3L0OA 1KXLA 1M4VA 2VB2X 1G2TA 5KNDA 1DOLA 2CW0C 1JOOA 2L12A 5M3FB 3KF8B 2QW7A 3STBD 4X65Q 1D7QA 4DA2A 1D2BA 1C48A 1F2YA 3G6JB 2A6HD 1B70B 1IYUA 4O42A 5IT9c 3W5OA 1FGUA 3S9WA 3PF5A 3N6RA 4R8NA 3BVMA 2G5DA 3I3CA 5EKLA 5C3EG 1YI2A 1UEAB 1Q3LA 4KY6A 1GXDC 2L11A 2VQFQ 1VF5C 3CU7A 2B63G 5M9OA 1NCVA 4S3SA 4FXDA 3E9HA 4KI0A 2B2UA 4IN3A 1A0IA 4JG2A 1N36L 1TWCB 3T4AC 3CMEA 3CW2C 1HA6A 1N33Q 1X54A 2KCCA 3EJIA 2SOBA 3UDFA 4DR2Q 1KAAA 3VYTA 5AFWA 2QILA 1X9NA 4NPSA 2Q8TA 4RGTA 5C3EB 3I55A 4LF7Q 3PUVA 4KKUA 1SRUA 2JP1A 2D62A 4KV6A 4DNIA 2B63B 1GKHA 2QCPX 2PO4A 4HIOA 1XMQQ 1MIUA 1G91A 3EA6A 4O1NA 4BY7H 4XIGS 5JAVA 1E7ZA 4KHPQ 3D6WA 1EQQA 4HSVA 4Y7NB 5C4XH 4B3TL 1LT6D 1X6OA 4U68A 3HKSA 1EWCA 4H0LC 1TWHH 2MNAA 5BN4A 1TIID 1IKLA 4YIJA 4LFBQ 2PQEA 4DR1Q 1I4XA 2RCFA 4I7AA 1Y1VH 4B3MQ 2KENA 5C4HA 2D0OA 1GHJA 1YZ6A 3MC0B 2E76C 2VS1A 3A56A 4DK1A 4YHHL 4P73A 2NWGA 3NBIA 5EJWA 4LF5Q 1HR0L 2BA0A 2K01A 5IYBG 3FEWX 4R4IA 4DR5Q 5IYCH 3A54A 4JI1Q 1XX8A 1ESFA 3QB3A 2R3ZA 2A73B 3J7A5 2KHSA 4UHVA 1VQ9A 1ICFB 1PZID 1DOKA 4YHHQ 5JJLA 2IWHA 1HRJA 4RGOS 2RVLA 1HHVA 2FJ2A 1J8IA 3PMFA 2EYMA 1HR0W 4JI8L 2L15A 1YEZA 3UDIA 2GVBA 3LNNA 1EWHA 1QJOA 1SNMA 1WTPA 1SJED 4B3SL 2HQEA 5C4ZA 2IX3A 5M3MH 1DGSA 1Z7TA 1N34Q 1DONA 5C4XG 2BH2A 1KRSA 2AMCB 1XMOQ 1EY7A 1VQNA 3L9AX 2K4KA 4IFDH 2J0TD 3HKZG 3MEFA 1ONLA 5DAUA 3K5MA 1XTDA 2JA6H 2R93H 1E24A 1Y1VG 1G51A 2F0UA 2VY3A 1BQQT 3EFXD 2MFIA 2K50A 4XQQA 5BN5A 1EY5A 1JB7A 1CKNB 1YJNA 4F8MA 4P75A 3TP8A 2WP8J 4JK1C 4L63B 1XPRA 3HOUH 4BY7B 3MHBA 4HCEA 4TSSA 2KECA 4JBJA 4JI7L 4WJWA 4JI4L 5C4XB 3GP7A 2EY2A 2N88A 5IYCG 2XIWA 4F87A 2CQAA 5I6YA 2Z6KA 3OTOQ 1HNXQ 1TWHB 3DEOA 4GN5A 2LMCB 2M2LA 2OEOA 1ZYRC 1ZEQX 2DGYA 1PZKD 5JPMC 1Y1VB 4XYQA 4C3IH 4IFDJ 2UXCL 1I4GA 4K5XA 2AUKA 5E7NA 2AUJD 4RA8A 4DV7L 3TP7A 2CW0D 1Q12A 1SROA 1F9QA 1LV9A 5CYUA 1WCMH 2HCCA 3R8BA 3I7FA 3GTKH 3ER0A 5M3MG 2MP1A 1R9TH 1XNQL 1FVIA 2HUGA 1OXUA 2F0PA 4ODGA 3IFDA 5DLQE 1I3QH 2MQHA 1RHPA 4DAMA 5DNFA 1SE2A 3U9SA 2JA6G 4B3RQ 1FL0A 2R93G 1SNOA 1MSGA 1U4RA 2F0DA 2YTXA 3S1QH 4HJ5A 4TRDA 3D4DA 4IO9A 3A74A 2IHFA 3BYTB 3H3VI 2Z8LA 4KY5A 2ZTCA 3DUZA 1EY6A 1HUNA 4WRDA 5D14A 5M3MB 3RZOH 2EJFC 2Y0SE 1BVSA 4CJ1B 1A63A 2E74C 4DUZQ 1B50A 2F4IA 3J80L 4CDDC 1Q81C 1H9KA 4JI6Q 4X3KA 3FPUB 3TN2A 4JI3Q 1E2WA 1KLGD 1JORA 1Y8PB 2JA6B 2PW5A 2R93B 1IW7C 1YNNC 1NR2A 4DV1Q 1BBWA 1OO9B 2JQOA 3BDCA 3KF8A 1Y1WH 5KYIA 4X62L 4A3KH 3ULLA 1YIJA 2BE5C 3HOUB 1EY9A 1WCMG 3U50C 4ABNA 3QIAA 4A3JH 1DCZA 4K6LA 3H0GG 1MJEA 5KEEA 1K3RA 2UXBL 3NWSA 4OXPA 3FVQA 3K5LA 5I2XA 3VR4A 2N49A 2F3IA 2A5HA 2EPBA 3IL8A 4C3IB 1VQ6A 1PRTF 4J15A 3SR1A 2EXZA 4JV5Q 1EYAA 2NTSA 1PTOD 2EYPA 4A3GH 1WCMB 2WKDA 3BJUA 4ILWA 4DV2Q 2Z4HA 2OTJA 3GTKB 1XNRQ 2ZTEA 1R9TB 1NSNS 4XQJA 1QVGA 1AZPA 3A7AB 4J8QA 3H09A 4A3LH 3CQZH 3CP0A 1M1KC 4GS3A 1HA5A 1XXGA 1I3QB 4DNTB 4YCVA 5E4WC 2ZM6Q 4OX9L 1VS0A 3HFZB 3G71A 3J7AF 5IGDA 2HD3A 4ID6A 4DV3Q 4K8IA 1OTCA 1A2TA 2K5QA 2K5WA 4I65A 2A6EC 1EOVA 3K59A 4DAYB 4P74A 1Y1WG 1EZ6A 4A3KG 5LMNQ 2F0TA 3QOJA 1SSOA 4A3JG 5LMNW 3RZOB 3CXCA 4GKKQ 4LF4Q 1BR9A 2XWJB 5LMUQ 3WOFA 5JEAH 1K9MC 1LT4D 2F0KA 1Q8KA 1SN8A 4DV6L 3M4OH 2OQ0A 5AJ3Q 2RCNA 2I5HA 2X6GA 5C4JH 4DR3L 2QGQA 4C2MH 4DAPA 1L1OC 3GTLH 1I4PA 1PYWD 3SGIA 1PH4A 1CKOA 1JOQA 4N8X1 3SVMA 1PHJA 3NHHA 1CQFA 1XYIA 1Y1WB 3R93A 1HQMC 4A3KB 4A3GG 1JJCB 3NP8A 4A3JB 1HJPA 4DV4L 5CV9A 5CBAE 1GUNA 4JOIC 3EN2A 3A5ZB 3ND9A 1IKMA 3NSWA 2DN8A 3D0FA 4ZLTF 3T56B 3DM3A 3OW2A 1GVPA 3J7ZC 3H6MA 3HOWH 5ELNA 1LTGD 1ZYRD 4GKJQ 2PNHA 5JEAJ 2UXDL 2A19A 3F2BA 3PUWA 5KYLA 1O7ZA 1HNZQ 3BDOA 1IBMQ 1DZ1A 2A6HC 3KDFA 1VQLA 2DNCA 4DN4M 4A3GB 4ZKCB 3GTQH 1S5FD 1DYQA 2MGSA 5C3WA 2AQ1B 5FO9B 1ENAA 3HKZE 3SE0A 2WV6D 2NTTA 4JI2L 1D5XC 3CQZB 3TQYA 2A74C 3MFGA 3O13A 1VQPA 1L0YB 2UUBL 1PXUA 3L3OC 4RCNA 5IP7H 1SFOH 1TR5A 5A35A 3RLOA 5EKKA 1CKNA 3JAME 1JCKB 2RSOA 2Q8IB 2AHOB 2MHVA 1Z6HA 2OQKA 3DEPA 1VQDA 4YY3Q 1EL0A 3KOJA 5IP9H 5BR8L 3T13A 3BS1A 2F0SA 4XXEA 4E6IA 1B9MA 4YWLA 2HHHL 3CPWA 3HOWG 3M4OB 5IT9L 3TREA 3NQTA 3H3VH 4JYAL 4UAIA 1HTLD 5C4JB 4DFAA 2JJQA 5I9OA 4C2MB 2PMZE 1TVXA 1RF2D 2XRQD 3GTLB 4DK3C 1CZWA 3LGJA 1VQIA 4NDXA 1AE3A 1YNND 1H9RA 3JAMi 5JJKA 4J6HA 4IUNA 1U0LA 1E1OA 2CKZB 1SLJA 3RN5A 1SEBD 1DXMA 1PMRA 2BE5D 1PLFA 2I07B 2EYFA 1MD2D 2B8GA 3C1EA 3WOEA 4ZRZA 1JT8A 5E1FA 4LMQD 4TQUS 3EBEA 2EYLA 4A3FH 1TY2A 1ASZA 3HOWB 4JBMA 3QO2A 3NXWA 5IP7G 1KQSA 2C35B 3DMUA 4LF6Q 4DV0Q 5FOBB 1STHA 2K7VA 3GTGH 3A7LA 1BCPB 3A8IE 4Q5VA 4RKBA 4LF8Q 1T5XD 2CWPA 4OONA 3GTQB 3PIO3 1DM0B 3DHQA 5IP9G 1MBYA 1XTCD 4HSPA 4KJOA 4HCSA 1K3BC 1VF7A 2B2UC 2EE1A 3F8TA 3DM1A 1EQTA 4HAEA 2KOLA 1SFOB 4DR6L 2YV5A 5I9PA 1PH8A 3CCQA 4G7OC 1EYDA 3CAMA 4V190 2R61A 4UPAA 1RIPA 4L5QA 1N8RC 4KKSA 5GAGC 1IL2A 1TS4A 1YBYA 1T9HA 4NXNL 1VQGA 2Z9HA 3UDGA 3P1HA 3J81j 4A3FG 1IHZA 4JVZA 3T1HL 2MO0A 4QY7A 5IWAQ 5IGGA 1EY4A 3B6YA 3PV0A 1KLUD 4R9WA 1RODA 4OL7A 1VQAA 1K8AC 2VUMH 1UNSA 1LTTD 2EVBA 1PH5A 2NZHA 4CKCA 2PQAB 1JWSD 3W3AA 4BBSG 1EQRA 2Y0SG 3Q23A 3H91A 4X65L 5FK9C 1STGA 4OWWB 2JE6I 3U4ZA 4A3FB 3KLSX 3M9BA 1SBBB 4Y52H 1SNPA 1D5MC 2L1BA 4JW0A 3AQQA 5DM63 1PH6A 4LFCQ 3VR2A 2FINB 4KY7A 1JOKA 2D5DA 3BVGA 2F0IA 3GTGB 5JPNC 3TSSA 3T1YQ 4LWCA 1NMGA 1H9JA 4IJHA 4DAYA 2VQFL 3AU7A 1PFNA 1QOHA 3R2TA 2PNRC 4CJ2C 4AYBE 2PI2A 2Y0SB 4DNRB 1PVOA 1YHAA 1H9MA 1TWFH 1N33L 4DPGA 1JR0D 3L2PA 4DR2L 1LTID 4LUVA 1TWAH 2IPKD 1QUQB 1ICWA 1B53A 1EIHA 1VQ8A 1AZQA 4QMGA 3RR5A 4LF7L 1KDBA 4A3EG 2VUMG 2NN6G 5DM73 5LL6X 2EDGA 1FJGQ 1EYCA 5IYBH 3VA7A 2J7ZA 3K7AH 2EOTA 4G7ZC 1XMQL 1SNCA 3CF5A 2CHBD 1PFSA 3A8KE 5ISRA 1A62A 4KHPL 1EZ8A 5EKIA 3K5OA 2FXQA 4L5SA 3HP3A 2H5XA 3VYRA 1Q1EA 3KF6A 3BZKA 2O4XA 1AE2A 1S5ED 5J3BA 1F2MA 3DLLA 2JXMB 2OTLA 4HJ7A 3VR3A 4YWKA 4LFBL 4DR1L 2Z6KC 4H44C 1I50H 4B3ML 3DXJC 4LFAQ 2VUMB 1G291 2UUAQ 2EJMA 1QWYA 2Q2IA 1CA5A 4A3BH 1JE5A 1SE8A 3V96A 4C3JG 2HIXA 4CDCC 4X6AH 4LF5L 4K5WA 2K32A 2WACA 1KDAA 5L37A 1TS3A 2RSNA 2DY7A 2XVSA 1Q82C 1VQHA 2C9OA 1QE6A 4DR5L 4JI1L 1EIGA 3CC7A 1K8OA 2L4NA 3UI2A
chains in the Genus database with same CATH topology
3RZOH 5HGQA 5M5YH 1X56A 1HH2P 2Y0SE 3F2CA 1BVSA 1E1TA 4HJ9A 1Z9FA 1A63A 1MKHA 3M3YH 2WB1E 4X64Q 4A3MH 4DR4L 5M5WH 4DUZQ 2K5HA 4DR7Q 1TXYA 1Q81C 4JI6Q 2ES2A 4KHZA 2LXJA 3STBC 5H1SE 1BKBA 2ID0A 3K80C 4DV4Q 4JI3Q 1K83H 4RG1A 4X66Q 1X65A 4A3EH 1HNWL 3CPFA 4YWMA 1XPOA 4H02A 4LFCL 3J80c 2KHJA 2JA7H 1YHBA 3U58A 1UE5A 4LUZA 1EWIA 2K75A 4DV1Q 4DR4Q 1N34L 3D31A 1BBWA 2JQOA 3ULJA 1QZHA 1Y1WH 1I94Q 3KFUA 3T1YL 2LSSA 4X62L 1NMFA 4R4QA 3ULLA 5GAHC 4A3KH 1YIJA 1XMOL 2UXDQ 1WCMG 4KLKA 3U50C 3K81C 5JEAG 1XJVA 4A3JH 4LF9Q 1UWVA 2R7ZH 2R7FA 1KIXA 4AIMA 3KDFB 1IXRA 2KHIA 2XGTA 4AH6A 3H0GG 1Q7YC 3AFPA 1MJEA 3J80i 2JA5H 1PH9A 4NB3A 1K3RA 4C3HH 3NBHB 4A3IH 1BBUA 1LTLA 2Z0SA 2UXBL 4OXPA 4A75A 3J81c 3I4MG 3I4NH 4A3BG 3M4QA 3UE0A 2N49A 3CCEA 1VCIA 2F3IA 1UEBA 4P72A 4JI2Q 4BA1I 4GNXB 1VQ6A 1V1QA 2UUBQ 3PO2H 1KHIA 1VQ4A 1NY4A 3NEMA 1HZBA 4J15A 4JV5Q 4C3JH 3CC2A 2E2IH 1HZ9A 4A3GH 3BJUA 4DV2Q 2F4VQ 3OTOL 3J81i 3CCJA 3CCSA 2K5VA 1HNXL 1FJGL 1XNRQ 2OTJA 5GQOA 2ZTEA 2QEXA 1KL9A 4R4TA 4POGA 1QVGA 5IE8A 1X55A 2E5LQ 5C4XG 5K36G 3ZJYC 2CWAA 2Q2UA 4R4CA 4A3MG 1EFWA 1VQ7A 1SR3A 3CQZH 2XTIA 4A3LH 3CP0A 1M1KC 4GS3A 3S14H 4JI0Q 2VNUD 5BR8Q 3HOYH 3L7ZC 4EQ5A 4YCVA 2B29A 2QA4A 3JC66 2ZM6Q 4FDBA 4OX9L 2K5NA 1VS0A 1WYDA 3HFZB 3G71A 1C7YA 2JA7G 3S24A 1J5EQ 1L1OA 3I2ZA 4IPGA 4DV3Q 1W2BA 3S16H 2HHHQ 1OTCA 4JYAQ 5C44H 1EOVA 1HZCA 4BBRH 4P74A 4DAYB 1Y1WG 3NELA 4QGUA 4A3KG 4BXXH 4PZ6A 5LMNQ 2JEBI 4LFAL 2I5MX 4BY1H 3HOVH 1OXXK 2UUAL 2EIFA 4JBKA 3TS0A 3FKIH 5LMNW 3CXCA 4A3JG 1XPUA 2R7ZG 4GKKQ 4LF4Q 1QVFA 1N32L 1VQFA 1PH7A 2UU9L 1WOCA 2RF4A 4JOIA 2VQEL 5LMUQ 1K9MC 1B8AA 2CCZA 2E2JH 2NVTH 4B3RL 1K0RA 3PUZA 4A3IG 2JK8A 1L2FA 4IPCA 5M3FH 5JJIA 2RHSB 1SN8A 1Q8KA 4DV6L 3M4OH 3H0GH 2OQ0A 3KJPA 5AJ3Q 3I4NG 2RCNA 2I5HA 4DR3L 5C4JH 2QGQA 4C2MH 5FLMH 1L1OC 1IBLQ 3GTLH 3SGIA 1PH4A 2LXKA 1CKOA 1Q86C 1GD7A 4OWXB 3I4MH 1SMXA 1N36Q 1PHJA 1B7YB 4WJ3M 2I5LX 4A3CH 4RMFA 4X64L 3CCUA 1QZGA 2WAQG 4DUZL 4NXMQ 1O7IA 1JJCB 4A3GG 4DR7L 4JI6L 3GTPH 4PZ7A 1HJPA 1N9WA 5M5XH 1PH3A 5HY6A 3TRZA 2F52A 4JI3L 4DV4L 1YHQA 4POFA 1X3EA 2NZOA 2VL6A 4JOIC 3EN2A 3M4PA 4X66L 2Q2TA 3A5ZB 4IFDI 3UE1A 3E9IA 3D0FA 1TWGH 1WJJA 2AKWB 2PQAA 3DM3A 3OW2A 1VQCA 1GVPA 3J7ZC 2OCEA 1NE3A 3HOWH 5ELNA 1TWCH 3HOYG 4DV1L 4QJFA 3G6EA 4HIDA 1WI5A 3A5UA 1I94L 4APVA 3M7NA 4GKJQ 1KAWA 2PNHA 5JEAJ 2UXDL 2VW9A 2UUCQ 2A19A 1OXSC 1P16A 2R7DA 1RL2A 4MZ9A 3PUWA 3F2BA 4HJ8A 2IX1A 1HNZQ 4LF9L 1EIFA 3E0EA 3PUXA 1IBMQ 2RHQB 1Z47A 3KDFA 4GOPA 1VQLA 5C44G 3FHWA 3ULPA 4BBRG 4DR6Q 2Q2HA 4HIKA 2DUDA 1K73C 4BXXG 4JC0A 2B3GA 2VZAA 4BY1G 4HIMA 4B3TQ 1X3GA 3GTQH 3HOVG 2IY5B 5C3EH 3FKIG 5ELOA 2A8VA 1VQBA 3TEHB 4XTCS 3PCOB 3HKZE 2GVAA 4JI2L 2B63H 4L5RC 3TQYA 3RN2A 1UE6A 4LUOA 3GDEA 3GO5A 3CCRA 5M3FG 1VQPA 2I0QA 2UUBL 3PIOA 3GTJH 4NXNQ 3PUYA 4IPHA 2IHEA 2AWNA 4JV5L 1IZ6A 5IP7H 1SFOH 2R6GA 1V9PA 3RLOA 1QVCA 5FLMG 2R92G 3OYYA 5C0XJ 4R4OA 4DV2L 2PI2E 4Y7NH 2F4VL 3S1MH 2N3SA 4QL5A 3T1HQ 1XNRL 1CKNA 4GOPC 4UP7A 4AQYQ 3S1RH 1HR0Q 3Q8DA 2E5LL 2AHOB 3BZCA 5FJ8G 4A3CG 2OQKA 1CUKA 1QUQA 2V1CC 3BU2A 1VQDA 1IYJB 2EQSA 4YY3Q 4K0KQ 3KOJA 4JI0L 5IP9H 5BR8L 3L0OA 1VQOA 1KXLA 1ASYA 2ZM6L 2IX0A 1AH9A 4BY7G 4TVAB 4MTNA 3JAMc 5C0XG 3AYHB 1NTGA 1J5EL 4DV3L 2AWOA 3KF8B 4YWLA 3CPWA 2HHHL 3HOWG 4A93H 3STBD 1UE1A 3TREA 4X65Q 3H3VH 4UP8A 4JYAL 1D7QA 2JJQA 1HZAA 2PMZE 4JI8Q 1LUZA 5LMNL 1B70B 4DK3C 3FP9A 4DUYQ 2N8NA 4OO1I 3KJOA 3LGJA 1VQIA 1JJ2A 4LF4L 1AE3A 4B3SQ 4BA2I 4GKKL 2KCMA 5IT9c 3W5OA 1FGUA 3JAMi 3PF5A 5JJKA 2IT1A 1J6QA 5LMUL 1U0LA 1E1OA 2CKZB 4PG3A 1SLJA 3RN5A 1EIYB 1LYLA 4JCVE 3F1ZA 1L0WA 5C3EG 4DV5Q 1YI2A 3PIPA 4GLVB 2VQFQ 5AJ3L 1JT8A 4TQUS 3EBEA 2B63G 3W1BA 1IBLL 1Q1BA 4A3FH 3E9HA 4KI0A 5IY0A 3H15A 4JG2A 1A0IA 1ASZA 1N36L 2NN6I 4R1JA 2WAQE 4JBMA 4UY8C 3CMEA 1VQEA 3PO3G 3S15H 3CW2C 4AYBG 5IP7G 2C35B 1KQSA 4LF6Q 1N33Q 4DV0Q 4A3LG 3IRBA 4NXML 1PH1A 1X54A 2YYZA 4PMWA 3UDFA 3RNUA 4DR2Q 3GTGH 1E22A 2NVYH 4EX5A 4A3DH 3VDYA 2R92H 1X3FA 3AEVA 4LF8Q 5EAYA 2K52A 4JI7Q 2YTVA 2CWPA 4OONA 1NBWA 4IOCA 2A1AA 4JI4Q 2JEAI 4WJ4A 1X9NA 4NPSA 3I55A 4LF7Q 1OXVA 5IP9G 3PUVA 3CCLA 1SRUA 5FJ8H 2D62A 3PGZA 4DNIA 3KLWA 4GKJL 1L1OB 1GKHA 2CQOA 2UUCL 4HIOA 1XMQQ 1LM0A 1MIUA 1C0AA 1HNZL 3F8TA 4QIWE 1K8GA 1S40A 1IBKQ 1IBML 4A93G 4QQBX 4BY7H 2UXCQ 4XIGS 3S2HH 4DR6L 4IFDG 1E7ZA 4DV7Q 3I56A 4KHPQ 2YV5A 2E8GA 1EQQA 5C4XH 4B3TL 1PH8A 3CCQA 4PZ8A 3G4SA 3KF6B 4A4IA 1X6OA 3HKSA 4ALPA 2NVXH 1PA6A 3CAMA 1TWHH 2MNAA 4UPAA 1RIPA 1XNQQ 4L5QA 4DK6C 1N8RC 3PF4A 4LFBQ 4OWTB 3CCMA 4DR1Q 5GAGC 4YCWA 1IL2A 1YBYA 1JMCA 1T9HA 1Y1VH 2ZJQA 2KENA 4NXNL 4B3MQ 2D0OA 1VQGA 2YU9H 1YZ6A 1UE7A 1EUJA 3HOUG 3UDGA 3RZDH 2VS1A 5IYDH 5GADC 4JI5Q 1GM5A 3J81j 3F2DA 4A3FG 1U5KA 2ALYB 3T1HL 4YHHL 2MO0A 4P73A 2ZJPA 1V43A 4QY7A 5GAEC 5IWAQ 4GNXA 4LF5Q 4AQYL 3B6YA 1HR0L 2BA0A 3PV0A 5IYBG 4R4IA 2MO1A 4YY3L 4K0KL 2NVQH 4DR5Q 5IYCH 4JI1Q 3CC4A 3PO3H 1VQAA 4A3DG 1K8AC 1WFQA 3PSIA 2VUMH 1PV4A 3GTOH 4GN3B 1PH5A 2NZHA 3J7A5 2PQAB 1VQ9A 1CSPA 4YHHQ 3K7UC 2JA8H 3M85A 4BBSG 5JJLA 1EQRA 2Y0SG 4X65L 5FLXc 3A0JA 4OWWB 2WB1G 2JE6I 3K8AA 4IJLA 1OXTA 3U4ZA 4GLAC 1HR0W 4JI8L 2L15A 1YEZA 3UDIA 3S1NH 4IOAA 2GVBA 4DUYL 3M9BA 3AFQA 4GNXC 1HNWQ 1YITA 4GOPB 4Y52H 4B3SL 3AQQA 4LFCQ 1PH6A 3W1GA 3S2DH 1G6PA 5M3MH 1Y14B 1KD1C 1DGSA 2BH8A 1N34Q 3WWVA 3MXNB 2BA1A 3I4OA 1KRSA 4LWCA 4X62Q 1NMGA 2AMCB 4DV5L 3T1YQ 1XMOQ 1VQJA 1VQNA 4IJHA 1JJGA 2K4KA 4GN4B 1PH2A 3TS2A 2R93H 2VQFL 1P8LA 2N78A 3HKZG 3MEFA 4GLXA 4YCUA 4AYBE 1YJWA 1XTDA 2HQLA 2PI2A 3RLFA 1E24A 1Y1VG 1G51A 2VY3A 4P71A 2JA6H 4OO1G 1PVOA 1Q46A 3RLNA 1PYSB 1TWFH 1YHAA 2MFIA 5C0XI 3HOXG 1NJIC 2UXBQ 2K50A 4LF6L 4JBWA 4A76A 1PYBA 4DKAC 5IYDG 4DV0L 1N33L 4DPGA 1JB7A 3L2PA 1I6HH 1CKNB 4O2DA 1YJNA 4P75A 4DR2L 4LUVA 1KRTA 2WP8J 1TWAH 1XPRA 3HOUH 3CCVA 1S72A 2E2HH 1QUQB 1EYGA 3S17H 4LW1A 4LF8L 4JBJA 2KCTA 4JI7L 4JI4L 1VQ8A 4HJAA 3RR5A 5IYCG 4LF7L 1M90C 4A3EG 2VUMG 2NN6G 2Z6KA 3OTOQ 1FJGQ 1HNXQ 5IYBH 2GN5A 1KC8C 4GN5A 4LNQA 3K7AH 3KYHC 3CMAA 2DGYA 1XMQL 2JA8G 3CF5A 3U4VA 1CSQA 1IBKL 1PFSA 1E3PA 4C3IH 2OWOA 1W3SA 4IFDJ 4IPDA 2ZJRA 2UXCL 5E7NA 3GTMH 1A62A 4DV7L 4BBSH 3EIVA 4KHPL 2BH2A 2FXQA 4L5SA 4OX9Q 2H5XA 1Q1EA 1VQ5A 3KF6A 1Q12A 1SROA 3BZKA 5GROA 3CD6A 1WCMH 1AE2A 2ASBA 5J3BA 2JA5G 2YTYA 3DLLA 3I7FA 4MNOA 1VQKA 3GTKH 3ER0A 1C9OA 5M3MG 4HJ7A 2OTLA 4ME3A 1R9TH 1XNQL 1FVIA 4YWKA 3ICEA 4LFBL 1D8LA 4DR1L 1CKMA 2ZTDA 1MJCA 1OXUA 2Z6KC 1I50H 3K0XA 4B3ML 4LFAQ 3G48A 1G291 2UUAQ 5DLQE 1GO3E 4UP9A 2KBNA 1A8VA 1I3QH 2HIVA 2JA9A 2MQHA 2Q2IA 3NENA 4JI5L 4DAMA 1VQMA 3PO2G 1N32Q 1S3OA 3HOZG 4A3BH 2UU9Q 3HOZH 1JE5A 1SE8A 2CFMA 2VQEQ 2JA6G 4B3RQ 1FL0A 4O0AA 2HIXA 2EXDA 2R93G 1YNXA 3ERSX 5IWAL 3S1QH 4LF5L 2YTXA 2ATWA 4HJ5A 4X6AH 1H95A 4IO9A 4DV6Q 1YVCA 2IHFA 3A74A 4L5TA 4DR3Q 2HT1A 1I5FA 2K14A 1Q82C 3H3VI 1VQHA 2ZTCA 3GD7A 3HOXH 4JI1L 4DR5L 3CC7A 3UDXA 1YJ9A 2D0PA 2WFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZO H;  5HGQ A;  5M5Y H;  1X56 A;  1HH2 P;  2Y0S E;  3F2C A;  1BVS A;  1E1T A;  4HJ9 A;  1Z9F A;  1A63 A;  1MKH A;  3M3Y H;  2WB1 E;  4X64 Q;  4A3M H;  4DR4 L;  5M5W H;  4DUZ Q;  2K5H A;  4DR7 Q;  1TXY A;  1Q81 C;  4JI6 Q;  2ES2 A;  4KHZ A;  2LXJ A;  3STB C;  5H1S E;  1BKB A;  2ID0 A;  3K80 C;  4DV4 Q;  4JI3 Q;  1K83 H;  4RG1 A;  4X66 Q;  1X65 A;  4A3E H;  1HNW L;  3CPF A;  4YWM A;  1XPO A;  4H02 A;  4LFC L;  3J80 c;  2KHJ A;  2JA7 H;  1YHB A;  3U58 A;  1UE5 A;  4LUZ A;  1EWI A;  2K75 A;  4DV1 Q;  4DR4 Q;  1N34 L;  3D31 A;  1BBW A;  2JQO A;  3ULJ A;  1QZH A;  1Y1W H;  1I94 Q;  3KFU A;  3T1Y L;  2LSS A;  4X62 L;  1NMF A;  4R4Q A;  3ULL A;  5GAH C;  4A3K H;  1YIJ A;  1XMO L;  2UXD Q;  1WCM G;  4KLK A;  3U50 C;  3K81 C;  5JEA G;  1XJV A;  4A3J H;  4LF9 Q;  1UWV A;  2R7Z H;  2R7F A;  1KIX A;  4AIM A;  3KDF B;  1IXR A;  2KHI A;  2XGT A;  4AH6 A;  3H0G G;  1Q7Y C;  3AFP A;  1MJE A;  3J80 i;  2JA5 H;  1PH9 A;  4NB3 A;  1K3R A;  4C3H H;  3NBH B;  4A3I H;  1BBU A;  1LTL A;  2Z0S A;  2UXB L;  4OXP A;  4A75 A;  3J81 c;  3I4M G;  3I4N H;  4A3B G;  3M4Q A;  3UE0 A;  2N49 A;  3CCE A;  1VCI A;  2F3I A;  1UEB A;  4P72 A;  4JI2 Q;  4BA1 I;  4GNX B;  1VQ6 A;  1V1Q A;  2UUB Q;  3PO2 H;  1KHI A;  1VQ4 A;  1NY4 A;  3NEM A;  1HZB A;  4J15 A;  4JV5 Q;  4C3J H;  3CC2 A;  2E2I H;  1HZ9 A;  4A3G H;  3BJU A;  4DV2 Q;  2F4V Q;  3OTO L;  3J81 i;  3CCJ A;  3CCS A;  2K5V A;  1HNX L;  1FJG L;  1XNR Q;  2OTJ A;  5GQO A;  2ZTE A;  2QEX A;  1KL9 A;  4R4T A;  4POG A;  1QVG A;  5IE8 A;  1X55 A;  2E5L Q;  5C4X G;  5K36 G;  3ZJY C;  2CWA A;  2Q2U A;  4R4C A;  4A3M G;  1EFW A;  1VQ7 A;  1SR3 A;  3CQZ H;  2XTI A;  4A3L H;  3CP0 A;  1M1K C;  4GS3 A;  3S14 H;  4JI0 Q;  2VNU D;  5BR8 Q;  3HOY H;  3L7Z C;  4EQ5 A;  4YCV A;  2B29 A;  2QA4 A;  3JC6 6;  2ZM6 Q;  4FDB A;  4OX9 L;  2K5N A;  1VS0 A;  1WYD A;  3HFZ B;  3G71 A;  1C7Y A;  2JA7 G;  3S24 A;  1J5E Q;  1L1O A;  3I2Z A;  4IPG A;  4DV3 Q;  1W2B A;  3S16 H;  2HHH Q;  1OTC A;  4JYA Q;  5C44 H;  1EOV A;  1HZC A;  4BBR H;  4P74 A;  4DAY B;  1Y1W G;  3NEL A;  4QGU A;  4A3K G;  4BXX H;  4PZ6 A;  5LMN Q;  2JEB I;  4LFA L;  2I5M X;  4BY1 H;  3HOV H;  1OXX K;  2UUA L;  2EIF A;  4JBK A;  3TS0 A;  3FKI H;  5LMN W;  3CXC A;  4A3J G;  1XPU A;  2R7Z G;  4GKK Q;  4LF4 Q;  1QVF A;  1N32 L;  1VQF A;  1PH7 A;  2UU9 L;  1WOC A;  2RF4 A;  4JOI A;  2VQE L;  5LMU Q;  1K9M C;  1B8A A;  2CCZ A;  2E2J H;  2NVT H;  4B3R L;  1K0R A;  3PUZ A;  4A3I G;  2JK8 A;  1L2F A;  4IPC A;  5M3F H;  5JJI A;  2RHS B;  1SN8 A;  1Q8K A;  4DV6 L;  3M4O H;  3H0G H;  2OQ0 A;  3KJP A;  5AJ3 Q;  3I4N G;  2RCN A;  2I5H A;  4DR3 L;  5C4J H;  2QGQ A;  4C2M H;  5FLM H;  1L1O C;  1IBL Q;  3GTL H;  3SGI A;  1PH4 A;  2LXK A;  1CKO A;  1Q86 C;  1GD7 A;  4OWX B;  3I4M H;  1SMX A;  1N36 Q;  1PHJ A;  1B7Y B;  4WJ3 M;  2I5L X;  4A3C H;  4RMF A;  4X64 L;  3CCU A;  1QZG A;  2WAQ G;  4DUZ L;  4NXM Q;  1O7I A;  1JJC B;  4A3G G;  4DR7 L;  4JI6 L;  3GTP H;  4PZ7 A;  1HJP A;  1N9W A;  5M5X H;  1PH3 A;  5HY6 A;  3TRZ A;  2F52 A;  4JI3 L;  4DV4 L;  1YHQ A;  4POF A;  1X3E A;  2NZO A;  2VL6 A;  4JOI C;  3EN2 A;  3M4P A;  4X66 L;  2Q2T A;  3A5Z B;  4IFD I;  3UE1 A;  3E9I A;  3D0F A;  1TWG H;  1WJJ A;  2AKW B;  2PQA A;  3DM3 A;  3OW2 A;  1VQC A;  1GVP A;  3J7Z C;  2OCE A;  1NE3 A;  3HOW H;  5ELN A;  1TWC H;  3HOY G;  4DV1 L;  4QJF A;  3G6E A;  4HID A;  1WI5 A;  3A5U A;  1I94 L;  4APV A;  3M7N A;  4GKJ Q;  1KAW A;  2PNH A;  5JEA J;  2UXD L;  2VW9 A;  2UUC Q;  2A19 A;  1OXS C;  1P16 A;  2R7D A;  1RL2 A;  4MZ9 A;  3PUW A;  3F2B A;  4HJ8 A;  2IX1 A;  1HNZ Q;  4LF9 L;  1EIF A;  3E0E A;  3PUX A;  1IBM Q;  2RHQ B;  1Z47 A;  3KDF A;  4GOP A;  1VQL A;  5C44 G;  3FHW A;  3ULP A;  4BBR G;  4DR6 Q;  2Q2H A;  4HIK A;  2DUD A;  1K73 C;  4BXX G;  4JC0 A;  2B3G A;  2VZA A;  4BY1 G;  4HIM A;  4B3T Q;  1X3G A;  3GTQ H;  3HOV G;  2IY5 B;  5C3E H;  3FKI G;  5ELO A;  2A8V A;  1VQB A;  3TEH B;  4XTC S;  3PCO B;  3HKZ E;  2GVA A;  4JI2 L;  2B63 H;  4L5R C;  3TQY A;  3RN2 A;  1UE6 A;  4LUO A;  3GDE A;  3GO5 A;  3CCR A;  5M3F G;  1VQP A;  2I0Q A;  2UUB L;  3PIO A;  3GTJ H;  4NXN Q;  3PUY A;  4IPH A;  2IHE A;  2AWN A;  4JV5 L;  1IZ6 A;  5IP7 H;  1SFO H;  2R6G A;  1V9P A;  3RLO A;  1QVC A;  5FLM G;  2R92 G;  3OYY A;  5C0X J;  4R4O A;  4DV2 L;  2PI2 E;  4Y7N H;  2F4V L;  3S1M H;  2N3S A;  4QL5 A;  3T1H Q;  1XNR L;  1CKN A;  4GOP C;  4UP7 A;  4AQY Q;  3S1R H;  1HR0 Q;  3Q8D A;  2E5L L;  2AHO B;  3BZC A;  5FJ8 G;  4A3C G;  2OQK A;  1CUK A;  1QUQ A;  2V1C C;  3BU2 A;  1VQD A;  1IYJ B;  2EQS A;  4YY3 Q;  4K0K Q;  3KOJ A;  4JI0 L;  5IP9 H;  5BR8 L;  3L0O A;  1VQO A;  1KXL A;  1ASY A;  2ZM6 L;  2IX0 A;  1AH9 A;  4BY7 G;  4TVA B;  4MTN A;  3JAM c;  5C0X G;  3AYH B;  1NTG A;  1J5E L;  4DV3 L;  2AWO A;  3KF8 B;  4YWL A;  3CPW A;  2HHH L;  3HOW G;  4A93 H;  3STB D;  1UE1 A;  3TRE A;  4X65 Q;  3H3V H;  4UP8 A;  4JYA L;  1D7Q A;  2JJQ A;  1HZA A;  2PMZ E;  4JI8 Q;  1LUZ A;  5LMN L;  1B70 B;  4DK3 C;  3FP9 A;  4DUY Q;  2N8N A;  4OO1 I;  3KJO A;  3LGJ A;  1VQI A;  1JJ2 A;  4LF4 L;  1AE3 A;  4B3S Q;  4BA2 I;  4GKK L;  2KCM A;  5IT9 c;  3W5O A;  1FGU A;  3JAM i;  3PF5 A;  5JJK A;  2IT1 A;  1J6Q A;  5LMU L;  1U0L A;  1E1O A;  2CKZ B;  4PG3 A;  1SLJ A;  3RN5 A;  1EIY B;  1LYL A;  4JCV E;  3F1Z A;  1L0W A;  5C3E G;  4DV5 Q;  1YI2 A;  3PIP A;  4GLV B;  2VQF Q;  5AJ3 L;  1JT8 A;  4TQU S;  3EBE A;  2B63 G;  3W1B A;  1IBL L;  1Q1B A;  4A3F H;  3E9H A;  4KI0 A;  5IY0 A;  3H15 A;  4JG2 A;  1A0I A;  1ASZ A;  1N36 L;  2NN6 I;  4R1J A;  2WAQ E;  4JBM A;  4UY8 C;  3CME A;  1VQE A;  3PO3 G;  3S15 H;  3CW2 C;  4AYB G;  5IP7 G;  2C35 B;  1KQS A;  4LF6 Q;  1N33 Q;  4DV0 Q;  4A3L G;  3IRB A;  4NXM L;  1PH1 A;  1X54 A;  2YYZ A;  4PMW A;  3UDF A;  3RNU A;  4DR2 Q;  3GTG H;  1E22 A;  2NVY H;  4EX5 A;  4A3D H;  3VDY A;  2R92 H;  1X3F A;  3AEV A;  4LF8 Q;  5EAY A;  2K52 A;  4JI7 Q;  2YTV A;  2CWP A;  4OON A;  1NBW A;  4IOC A;  2A1A A;  4JI4 Q;  2JEA I;  4WJ4 A;  1X9N A;  4NPS A;  3I55 A;  4LF7 Q;  1OXV A;  5IP9 G;  3PUV A;  3CCL A;  1SRU A;  5FJ8 H;  2D62 A;  3PGZ A;  4DNI A;  3KLW A;  4GKJ L;  1L1O B;  1GKH A;  2CQO A;  2UUC L;  4HIO A;  1XMQ Q;  1LM0 A;  1MIU A;  1C0A A;  1HNZ L;  3F8T A;  4QIW E;  1K8G A;  1S40 A;  1IBK Q;  1IBM L;  4A93 G;  4QQB X;  4BY7 H;  2UXC Q;  4XIG S;  3S2H H;  4DR6 L;  4IFD G;  1E7Z A;  4DV7 Q;  3I56 A;  4KHP Q;  2YV5 A;  2E8G A;  1EQQ A;  5C4X H;  4B3T L;  1PH8 A;  3CCQ A;  4PZ8 A;  3G4S A;  3KF6 B;  4A4I A;  1X6O A;  3HKS A;  4ALP A;  2NVX H;  1PA6 A;  3CAM A;  1TWH H;  2MNA A;  4UPA A;  1RIP A;  1XNQ Q;  4L5Q A;  4DK6 C;  1N8R C;  3PF4 A;  4LFB Q;  4OWT B;  3CCM A;  4DR1 Q;  5GAG C;  4YCW A;  1IL2 A;  1YBY A;  1JMC A;  1T9H A;  1Y1V H;  2ZJQ A;  2KEN A;  4NXN L;  4B3M Q;  2D0O A;  1VQG A;  2YU9 H;  1YZ6 A;  1UE7 A;  1EUJ A;  3HOU G;  3UDG A;  3RZD H;  2VS1 A;  5IYD H;  5GAD C;  4JI5 Q;  1GM5 A;  3J81 j;  3F2D A;  4A3F G;  1U5K A;  2ALY B;  3T1H L;  4YHH L;  2MO0 A;  4P73 A;  2ZJP A;  1V43 A;  4QY7 A;  5GAE C;  5IWA Q;  4GNX A;  4LF5 Q;  4AQY L;  3B6Y A;  1HR0 L;  2BA0 A;  3PV0 A;  5IYB G;  4R4I A;  2MO1 A;  4YY3 L;  4K0K L;  2NVQ H;  4DR5 Q;  5IYC H;  4JI1 Q;  3CC4 A;  3PO3 H;  1VQA A;  4A3D G;  1K8A C;  1WFQ A;  3PSI A;  2VUM H;  1PV4 A;  3GTO H;  4GN3 B;  1PH5 A;  2NZH A;  3J7A 5;  2PQA B;  1VQ9 A;  1CSP A;  4YHH Q;  3K7U C;  2JA8 H;  3M85 A;  4BBS G;  5JJL A;  1EQR A;  2Y0S G;  4X65 L;  5FLX c;  3A0J A;  4OWW B;  2WB1 G;  2JE6 I;  3K8A A;  4IJL A;  1OXT A;  3U4Z A;  4GLA C;  1HR0 W;  4JI8 L;  2L15 A;  1YEZ A;  3UDI A;  3S1N H;  4IOA A;  2GVB A;  4DUY L;  3M9B A;  3AFQ A;  4GNX C;  1HNW Q;  1YIT A;  4GOP B;  4Y52 H;  4B3S L;  3AQQ A;  4LFC Q;  1PH6 A;  3W1G A;  3S2D H;  1G6P A;  5M3M H;  1Y14 B;  1KD1 C;  1DGS A;  2BH8 A;  1N34 Q;  3WWV A;  3MXN B;  2BA1 A;  3I4O A;  1KRS A;  4LWC A;  4X62 Q;  1NMG A;  2AMC B;  4DV5 L;  3T1Y Q;  1XMO Q;  1VQJ A;  1VQN A;  4IJH A;  1JJG A;  2K4K A;  4GN4 B;  1PH2 A;  3TS2 A;  2R93 H;  2VQF L;  1P8L A;  2N78 A;  3HKZ G;  3MEF A;  4GLX A;  4YCU A;  4AYB E;  1YJW A;  1XTD A;  2HQL A;  2PI2 A;  3RLF A;  1E24 A;  1Y1V G;  1G51 A;  2VY3 A;  4P71 A;  2JA6 H;  4OO1 G;  1PVO A;  1Q46 A;  3RLN A;  1PYS B;  1TWF H;  1YHA A;  2MFI A;  5C0X I;  3HOX G;  1NJI C;  2UXB Q;  2K50 A;  4LF6 L;  4JBW A;  4A76 A;  1PYB A;  4DKA C;  5IYD G;  4DV0 L;  1N33 L;  4DPG A;  1JB7 A;  3L2P A;  1I6H H;  1CKN B;  4O2D A;  1YJN A;  4P75 A;  4DR2 L;  4LUV A;  1KRT A;  2WP8 J;  1TWA H;  1XPR A;  3HOU H;  3CCV A;  1S72 A;  2E2H H;  1QUQ B;  1EYG A;  3S17 H;  4LW1 A;  4LF8 L;  4JBJ A;  2KCT A;  4JI7 L;  4JI4 L;  1VQ8 A;  4HJA A;  3RR5 A;  5IYC G;  4LF7 L;  1M90 C;  4A3E G;  2VUM G;  2NN6 G;  2Z6K A;  3OTO Q;  1FJG Q;  1HNX Q;  5IYB H;  2GN5 A;  1KC8 C;  4GN5 A;  4LNQ A;  3K7A H;  3KYH C;  3CMA A;  2DGY A;  1XMQ L;  2JA8 G;  3CF5 A;  3U4V A;  1CSQ A;  1IBK L;  1PFS A;  1E3P A;  4C3I H;  2OWO A;  1W3S A;  4IFD J;  4IPD A;  2ZJR A;  2UXC L;  5E7N A;  3GTM H;  1A62 A;  4DV7 L;  4BBS H;  3EIV A;  4KHP L;  2BH2 A;  2FXQ A;  4L5S A;  4OX9 Q;  2H5X A;  1Q1E A;  1VQ5 A;  3KF6 A;  1Q12 A;  1SRO A;  3BZK A;  5GRO A;  3CD6 A;  1WCM H;  1AE2 A;  2ASB A;  5J3B A;  2JA5 G;  2YTY A;  3DLL A;  3I7F A;  4MNO A;  1VQK A;  3GTK H;  3ER0 A;  1C9O A;  5M3M G;  4HJ7 A;  2OTL A;  4ME3 A;  1R9T H;  1XNQ L;  1FVI A;  4YWK A;  3ICE A;  4LFB L;  1D8L A;  4DR1 L;  1CKM A;  2ZTD A;  1MJC A;  1OXU A;  2Z6K C;  1I50 H;  3K0X A;  4B3M L;  4LFA Q;  3G48 A;  1G29 1;  2UUA Q;  5DLQ E;  1GO3 E;  4UP9 A;  2KBN A;  1A8V A;  1I3Q H;  2HIV A;  2JA9 A;  2MQH A;  2Q2I A;  3NEN A;  4JI5 L;  4DAM A;  1VQM A;  3PO2 G;  1N32 Q;  1S3O A;  3HOZ G;  4A3B H;  2UU9 Q;  3HOZ H;  1JE5 A;  1SE8 A;  2CFM A;  2VQE Q;  2JA6 G;  4B3R Q;  1FL0 A;  4O0A A;  2HIX A;  2EXD A;  2R93 G;  1YNX A;  3ERS X;  5IWA L;  3S1Q H;  4LF5 L;  2YTX A;  2ATW A;  4HJ5 A;  4X6A H;  1H95 A;  4IO9 A;  4DV6 Q;  1YVC A;  2IHF A;  3A74 A;  4L5T A;  4DR3 Q;  2HT1 A;  1I5F A;  2K14 A;  1Q82 C;  3H3V I;  1VQH A;  2ZTC A;  3GD7 A;  3HOX H;  4JI1 L;  4DR5 L;  3CC7 A;  3UDX A;  1YJ9 A;  2D0P A;  2WFW A; 
#chains in the Genus database with same CATH topology
 3NQI A;  5M5Y H;  1PTO C;  1HH2 P;  2MUY A;  3V05 A;  3PQI A;  1SNQ A;  2L5T A;  4X3T A;  1Z9F A;  1V1P B;  5T1I A;  1MKH A;  3M3Y H;  2BOS A;  2K5H A;  3BYY B;  4DR7 Q;  2ES2 A;  4CKE A;  1K83 H;  4X66 Q;  1X65 A;  3WDN A;  3CPF A;  1XPO A;  2JA7 H;  1TWF B;  1HTP A;  1YHB A;  4KKT A;  5IOC A;  1UE5 A;  4LUZ A;  2KEE A;  1N34 L;  3ULJ A;  3KFU A;  1QZH A;  1NMF A;  4BWG B;  1XMO L;  3K0Y A;  3K81 C;  3E5S A;  3J81 E;  1XJV A;  1RD9 D;  5IGB A;  1UWV A;  1KIX A;  4AIM A;  3KDF B;  5CGK A;  2XGT A;  2KHI A;  2KJX A;  4AH6 A;  2A69 C;  4NB3 A;  3NBH B;  4B9W A;  2Z0S A;  3HG9 A;  5C6A A;  5F2D A;  5A2Q E;  3I4M G;  3I4N H;  2CVR A;  3K7A B;  4EVO A;  4A3B G;  4QF4 A;  3CCE A;  4GNX B;  2N55 A;  4P72 A;  2PYK A;  2RDF A;  5IGC A;  3JAM L;  1V1Q A;  1U9R A;  1VQ4 A;  5NUC A;  4CDE C;  3I90 A;  2E2D C;  4DXF A;  1Y8O B;  4RGM A;  2F4V Q;  3OTO L;  3J81 i;  1HNX L;  3G7L A;  2QEX A;  4POG A;  1B4O A;  5IE8 A;  3C46 A;  1EEI D;  5I6W A;  2E5L Q;  2MJ8 A;  4R4C A;  5JVG 3;  1I50 B;  1C4Q A;  1YNJ D;  1SR3 A;  4JI0 Q;  2B2T C;  2VNU D;  5COR A;  1WD1 A;  4EQ5 A;  5C5L A;  2QA4 A;  4A3B B;  2K5N A;  2Z1C A;  1C7Y A;  4XT3 B;  2Q8R E;  2JA7 G;  5CMD A;  1J5E Q;  3HKZ B;  1HXY D;  4RHR A;  3KLR A;  3I91 A;  3Q0A A;  1O7L A;  1ET9 A;  1TQO A;  3KUP A;  3NEL A;  2HDM A;  2I5M X;  1CQV A;  1SND A;  3TS0 A;  3FKI H;  3D4W A;  5M5Y B;  2O2L D;  1STN A;  1B3A A;  5CV8 A;  3K5N A;  3T16 A;  2RF4 A;  4B3R L;  2E2J H;  4XQN A;  1K0R A;  2RHS B;  3MAQ A;  1Y69 U;  1K83 B;  3H0G H;  3K6O A;  3KJP A;  3I4N G;  5IGF A;  4FYD A;  4DXG A;  1IBL Q;  2JA7 B;  1B1Z A;  1GD7 A;  4OWX B;  1SMX A;  3E6Z X;  4RCO A;  2BCO A;  1B7Y B;  2I5L X;  4RMF A;  3FRP B;  4EGV A;  1GUT A;  1O7I A;  4DUZ L;  4J1M A;  4NXM Q;  4JI6 L;  1I4Q A;  4OEL B;  2PMZ B;  1BDO A;  4JI3 L;  2VL6 A;  3M4P A;  2Q2T A;  4NKL A;  2AKW B;  1SYB A;  1VMC A;  2PQA A;  1RTO A;  3EQL C;  4DF7 A;  2XSC A;  4DV1 L;  3U9O A;  3I4N B;  2K04 A;  3A5U A;  4APV A;  1E2Z A;  2EY6 A;  4HJ8 A;  2UUC Q;  1BBX C;  2PPB C;  2IX1 A;  1B44 D;  1HCZ A;  3PUX A;  2RHQ B;  5IIF A;  1WTW A;  2Q2H A;  1WTH A;  1BCP D;  2DUD A;  2B3G A;  2VZA A;  3FKI G;  3MXP A;  2DJF C;  3H94 A;  3Q6S A;  2A8V A;  3ERQ A;  3R2I A;  3IAY A;  1MGS A;  1NNX A;  2GVA A;  4KJN A;  3RN2 A;  1UE6 A;  3GO5 A;  3CCR A;  3GTJ H;  4IPH A;  5I4D A;  3PIP 3;  1X3P A;  2IHE A;  2AWN A;  3C3L A;  4JV5 L;  5FLX L;  5JOB A;  3I8Z A;  2R6G A;  2R92 G;  4ZUI A;  4R4O A;  4DV2 L;  1KAB A;  3OHX C;  4ZK9 B;  1ZXT A;  3S1M H;  1XNR L;  2EY1 A;  3RMH A;  1GUO A;  5EPL A;  4AQY Q;  3Q8D A;  1GUG A;  5FJ8 G;  1QUQ A;  3BU2 A;  4HN7 A;  3RD4 A;  5FO7 B;  4K0K Q;  3FKI B;  1ENC A;  3SDZ A;  1ASY A;  1TY0 A;  2ZM6 L;  1A15 A;  3E3X A;  3T51 B;  5IOD A;  4TVA B;  4MTN A;  5CV4 A;  3JAM c;  4DV3 L;  2AWO A;  4A93 H;  3H0G B;  2I46 A;  1UE1 A;  5FO8 B;  2ENB A;  1LO5 D;  2VB3 X;  1LTS D;  5LMN L;  3FP9 A;  4N9T A;  4DUY Q;  2N8N A;  1B2T A;  2H1E A;  1UUP A;  4BA2 I;  4LF4 L;  4GKK L;  2KQ3 A;  2KCM A;  2IT1 A;  2K05 A;  5LMU L;  3S1Q B;  4N8F A;  1EIY B;  3KLS A;  5D65 A;  1LYL A;  4DV5 Q;  3PIP A;  1A3U A;  4GLV B;  3OSO A;  1F9S A;  5AJ3 L;  1FGB D;  4IUQ A;  4K5V A;  2HCI A;  3ERO A;  3W1B A;  1Q1B A;  5IY0 A;  3H15 A;  3SK4 A;  2V4D A;  2A69 D;  2NN6 I;  4ZQ3 A;  2L9H A;  3PO3 G;  4AYB G;  2RKS A;  3FMC A;  5EPK A;  1ET6 A;  1PH1 A;  2F3W A;  2YYZ A;  3RNU A;  1KNE A;  3ITP A;  1E22 A;  4EX5 A;  2RBM A;  4A3D H;  3VDY A;  3SXH A;  3AEV A;  5EAY A;  2K52 A;  4FF3 A;  3TDQ A;  1AEX A;  1NBW A;  4IOC A;  4WJ4 A;  1KNA A;  4MN3 A;  5COY A;  1WTV A;  1V1P A;  1JB3 A;  3CCL A;  1FYC A;  4GKJ L;  3KLW A;  4MIU A;  2F0Q A;  3TP5 A;  1C0A A;  1HNZ L;  4ZKB B;  1FNW A;  3GTJ B;  1K8G A;  1S40 A;  1IBK Q;  1IBM L;  3M4Y A;  1SAP A;  4QQB X;  4A93 G;  4AYB B;  3FDT A;  3NTH A;  2GA4 B;  2B2V C;  2K6A A;  3I56 A;  2PCF B;  1EU4 A;  3S1M B;  3AB9 A;  4PZ8 A;  3G4S A;  3KF6 B;  4A4I A;  4ALP A;  1BNZ A;  4DK6 C;  2CH4 W;  1D6E C;  2M00 A;  1UE7 A;  3ZYY X;  2LKV A;  5GAD C;  3NBH A;  4JI5 Q;  3F2D A;  1U5K A;  2ALY B;  5KNB A;  3LWU A;  5C5M A;  4KTA A;  1V43 A;  4A93 B;  1LT5 D;  4GNX A;  1CT1 D;  1D1I A;  2QDB A;  4G7H C;  1EOT A;  1GUW A;  4I7Z C;  2MO1 A;  4YY3 L;  2PW7 A;  4A3D G;  1WFQ A;  3PSI A;  4KHV A;  1PV4 A;  3GTO H;  1KDC A;  1PRT B;  1CSP A;  1SMY D;  2NUC A;  1GOZ A;  2P5Z X;  1PTO F;  5FLX c;  1A3T A;  3SHL A;  1SJH D;  3S1N H;  4IOA A;  1HNW Q;  1YIT A;  4GOP B;  3KBX A;  1SE3 A;  3S2D H;  4OIJ A;  1Y14 B;  2BH8 A;  3WWV A;  1LTB D;  2SDF A;  2BA1 A;  1JJG A;  1GUS A;  4A3D B;  3URY A;  3MEH A;  4B9X A;  1P8L A;  3A8J E;  2N78 A;  1KTK A;  4GLX A;  1YJW A;  2HQL A;  4OO1 G;  4P71 A;  4V0B A;  1Q46 A;  5C0X I;  1PYS B;  3HOX G;  5E4X A;  3OW7 A;  1A6X A;  4LF6 L;  4DKA C;  4DV0 L;  1ENF A;  3F2U A;  2B2W A;  3D8G A;  3NUC A;  1I6H H;  3DWP A;  4RAU C;  3NTK A;  2XN9 C;  3E0J A;  3GV3 A;  3CCV A;  1W6K A;  4LW1 A;  4LF8 L;  4FF4 A;  3ND8 A;  3Q22 A;  1W6J A;  4HJA A;  1EY8 A;  1HPC A;  5EPJ A;  3J7A V;  1F9R A;  3OOC A;  1QNU A;  1KC8 C;  2L0C A;  1FD7 D;  3KYH C;  4ZCK A;  4IPD A;  2JYO A;  2ZJR A;  3TZU A;  1JWU D;  3GTM H;  1LAC A;  4BBS H;  3TBI B;  1BF4 A;  2QF7 A;  3VA5 A;  1F2Z A;  1VQ5 A;  4K2L A;  5GRO A;  3OWE B;  2JA5 G;  2YTY A;  1STY A;  4MNO A;  1C9O A;  4C1N K;  3LWE A;  3ICE A;  1CKM A;  2ZTD A;  1MJC A;  1FR3 A;  3MTS A;  1K0S A;  3QJY A;  1QG7 A;  4U67 3;  1J9O A;  4FXK C;  3GTO B;  2JN4 A;  1GO3 E;  1O7Y A;  2F0E A;  2JA9 A;  3NEN A;  4UP9 A;  1VQM A;  3PO2 G;  1N32 Q;  2PZU A;  1H9S B;  2UU9 Q;  3HOZ H;  2QDL A;  2VQE Q;  2EXD A;  1YNX A;  3ERS X;  5IWA L;  4LJZ C;  1S5D D;  2RDG A;  3MXU A;  3S1N B;  4L5T A;  2HT1 A;  1S5C D;  3S2D B;  2WFW A;  1X56 A;  1E1T A;  2F0J A;  3VYS A;  1BOS A;  3J80 E;  2WB1 E;  4X64 Q;  4A3M H;  5IGE A;  5M5W H;  2WII B;  4KHZ A;  1BKB A;  2ID0 A;  3K80 C;  1YNJ C;  4RG1 A;  2X6L A;  4A3E H;  2NN6 H;  5CC4 A;  1CHQ D;  4YWM A;  4LFC L;  4NMZ A;  2KHJ A;  5ELF A;  5BN3 A;  4CJ0 B;  3U58 A;  2EY5 A;  4QCL A;  1EWI A;  1RDP D;  3BDL A;  1I6H B;  3D31 A;  4N9P A;  1STA A;  1I94 Q;  3MWY W;  1E0B A;  3T1Y L;  5LHY 1;  1T5E A;  2DJG C;  1X3Q A;  4LF9 Q;  3CHB D;  2D9U A;  1UAP A;  2R7F A;  4FF2 A;  1IXR A;  2NYZ D;  5CV7 A;  2M9V A;  3J80 i;  1PH9 A;  1JE4 A;  4FO2 A;  4DU9 A;  5KGU A;  3BVZ A;  3C1F A;  4F7X A;  4A75 A;  2MPM A;  3J81 c;  1BUV T;  3HOZ G;  1UEB A;  4CGY B;  1EY0 A;  2K33 A;  3I73 A;  4PQX A;  1KHI A;  3GTM B;  3NEM A;  4BBS B;  4R8I A;  4IUT A;  4C3J H;  3CC2 A;  4EQP A;  2E2I H;  1HZ9 A;  2XRS D;  1XWE A;  3TZD A;  1GHK A;  3CCJ A;  1FJG L;  3CCS A;  2RDH A;  5GQO A;  4R4T A;  2F03 A;  2DY8 A;  1X55 A;  5K36 G;  2Q2U A;  1O78 A;  4A3M G;  1VQ7 A;  1I4H A;  2XTI A;  2KVM A;  3S14 H;  4MHE A;  1DJR D;  2QKI C;  4OIK A;  2B29 A;  3JC6 6;  3HOZ B;  1WYD A;  1TT2 A;  3S24 A;  3S16 H;  3I2Z A;  1W2B A;  3NPP A;  4K2K A;  1JC7 A;  3N52 A;  4IUV A;  4BBR H;  2B8F A;  4QGU A;  4P2C B;  5CBE E;  1A3V A;  1RCV D;  2K03 A;  4PZ6 A;  1NAP A;  2JEB I;  4LFA L;  4GZY C;  4F88 A;  4BY1 H;  1IYV A;  2UUA L;  4JBK A;  1XPU A;  1BCP C;  1ZKO A;  1Y8N B;  5G3L D;  1F2L A;  4A3M B;  2J4X A;  2OT2 A;  1R4P B;  5M5W B;  2NVT H;  1B8A A;  3PUZ A;  4IPC A;  5JJI A;  2OXP A;  1FNU A;  4A3E B;  1CA6 A;  3I4L A;  4FNF A;  2NBF A;  2LXK A;  3I4M H;  1N36 Q;  1CK1 A;  3I72 A;  1QCB D;  4EQO A;  1K8M A;  3HRZ C;  4BS9 A;  3M7G A;  1EEF D;  3CCU A;  1CZG A;  4IZ8 A;  1QZG A;  2KED A;  4G57 A;  4DR7 L;  2HDL A;  3GTP H;  4PZ7 A;  4Q0F A;  2E75 C;  4L6T B;  1YHQ A;  4POF A;  4X66 L;  2NZO A;  3UE1 A;  3E9I A;  1TWG H;  4RH6 A;  5C0X H;  3P7J A;  3R3O A;  2CH4 A;  2OCE A;  1NE3 A;  5CV5 A;  1CFM A;  3C2P A;  4OEM B;  2O5J C;  4QJF A;  3G6E A;  1WI5 A;  4NP5 A;  4NW2 A;  3T53 B;  2KA7 A;  1KAW A;  4UDU C;  3AMU A;  2VW9 A;  4WOR A;  1P16 A;  2R7D A;  4MZ9 A;  1RL2 A;  1BO0 A;  1EIF A;  2B2Y A;  4JPB W;  3E0E A;  5HUR A;  3H3V C;  4GOP A;  4C3J B;  4DGZ A;  3ULP A;  3SK6 A;  4BBR G;  2E2I B;  4HIK A;  4C56 C;  4BY1 G;  4B3T Q;  2F3V A;  1X3G A;  2IY5 B;  4FXG C;  5ELO A;  4XTC S;  4OGQ C;  1TWA B;  2AQ3 B;  1SYG A;  3GQB A;  3TME A;  1CI3 M;  3S14 B;  3I70 A;  2BDO A;  2I0Q A;  2Z4I A;  5DEH A;  3PUY A;  2SNM A;  2F0G A;  4KK7 A;  1QVC A;  5C0X J;  2F4V L;  2N3S A;  4PNY A;  3S16 B;  2H4O A;  5EBD A;  1I4R A;  4UP7 A;  3X3N A;  5EQ0 A;  3S1R H;  4BBR B;  1HR0 Q;  2E5L L;  2IL8 A;  1TU2 B;  5ELD A;  1CUK A;  2V1C C;  4QUC A;  4BY1 B;  2EQS A;  3W2D A;  4JI0 L;  3NWT A;  1VQO A;  1DD2 A;  2WKC A;  2IX0 A;  1AH9 A;  4BY7 G;  4CBV A;  1LTR D;  2NVT B;  5K5P A;  3AYH B;  5C0X G;  1NTG A;  5IT9 E;  1J5E L;  4HTH A;  4UP8 A;  2G9H D;  1HZA A;  4JI8 Q;  1LUZ A;  4ZAI A;  4RGN A;  4ZUJ A;  4OO1 I;  3I4M B;  3KJO A;  1JJ2 A;  2XNA C;  4B3S Q;  3D3R A;  1J6Q A;  4PG3 A;  1CTM A;  3GTP B;  1WVL A;  1PRT D;  3F1Z A;  4JCV E;  5EGT A;  1L0W A;  3V2T A;  5G3L F;  1E2V A;  2K5D A;  2ZXR A;  3MVV A;  1TWG B;  2LFN A;  1G8Z D;  1IBL L;  5ELE A;  2ZXP A;  4PMC A;  4XDX A;  1H9S A;  2WAQ E;  4R1J A;  4UY8 C;  3M3Y B;  2QEJ C;  1LT3 D;  1VQE A;  3S15 H;  1VDZ A;  2ZXO A;  3IRB A;  4NXM L;  2EZV A;  4PMW A;  2RQX A;  2NVY H;  1QB5 D;  2R92 H;  2ICI A;  1X3F A;  2ICE C;  2F1M A;  4ME5 A;  4JI7 Q;  4RFB A;  2YTV A;  4JI4 Q;  2A1A A;  2JEA I;  1NR4 A;  1OXV A;  1SMY C;  1SYC A;  5FJ8 H;  3TP6 A;  3PGZ A;  4CDF C;  5I2Y A;  1DOM A;  1L1O B;  2CQO A;  2KCN A;  2UUC L;  2F0F A;  1LM0 A;  5FKA C;  4QIW E;  2UXC Q;  1HFN A;  1M8A A;  2F0H A;  3S2H H;  4IFD G;  4DV7 Q;  3VYU A;  2E8G A;  1S4Z A;  4QUF A;  1O80 A;  3K57 A;  1Q90 A;  2NVX H;  1PA6 A;  3S1R B;  5D3I B;  1XNQ Q;  3PF4 A;  4OWT B;  3CCM A;  3MXG A;  4YCW A;  1JMC A;  3VR6 A;  2ZJQ A;  2YU9 H;  5CR3 A;  2Z6B A;  1EUJ A;  1LAB A;  3HOU G;  5KRU A;  3RZD H;  1HFG A;  5IYD H;  1GM5 A;  1GJX A;  1CHP D;  1AP0 A;  3P75 A;  3GV6 A;  1AN8 A;  2ZJP A;  5GAE C;  2EJG C;  4AQY L;  3CRL C;  3ONA B;  1U4P A;  4K0K L;  2NVQ H;  1SXT A;  3MA2 B;  4KD3 A;  3CC4 A;  3PO3 H;  3OIP A;  4GN3 B;  1MI2 A;  4C3I G;  3HZX A;  3A55 A;  3IKJ A;  3K7U C;  2JA8 H;  3M85 A;  4H13 C;  4IUR A;  5JJZ A;  2JSO A;  3HS0 C;  1B9N A;  3A0J A;  4KD4 A;  2WB1 G;  1SDF A;  3K8A A;  4IJL A;  1OXT A;  3BZD B;  4GLA C;  2ZT9 C;  2G9D A;  4RKL A;  5JVH 3;  3AFQ A;  4DUY L;  4GNX C;  5KIX A;  1X32 A;  2A68 C;  3W1G A;  3S15 B;  1G6P A;  2E2J B;  1KD1 C;  1SYF A;  3MXN B;  3QOL A;  3I4O A;  3Q24 A;  2B2T A;  4ULL A;  4X62 Q;  4DV5 L;  2NVY B;  1WTQ A;  1VQJ A;  4GN4 B;  2FFK B;  4FVM A;  4LK1 C;  1PH2 A;  4EQN A;  3TS2 A;  2EYO A;  2R92 B;  2L55 A;  4XT1 B;  1G2S A;  1QNK A;  2KUM A;  4YCU A;  2RA4 A;  3RLF A;  1CM9 A;  3RLN A;  3RUZ A;  1NJI C;  2WB1 B;  2NB0 A;  2UXB Q;  4JBW A;  4A76 A;  1PYB A;  5IYD G;  1R4Q B;  4RWS C;  5KNC A;  4O2D A;  4Z9C B;  1KRT A;  1ILP A;  4KN4 C;  1S72 A;  4HMI A;  2E2H H;  3S2H B;  1EYG A;  2F0W A;  3S17 H;  2KCT A;  4HMJ A;  1MSH A;  5CV6 A;  1IL8 A;  1S5B D;  1M90 C;  2NVX B;  2SEB D;  2GN5 A;  4LNQ A;  1RKN A;  1EU3 A;  4M1U B;  3CMA A;  2JA8 G;  3U4V A;  2IW3 A;  1CSQ A;  1SE4 A;  1IBK L;  2YU9 B;  1E3P A;  2OWO A;  1W3S A;  2B2W C;  1TKW B;  4TKO B;  1STB A;  3RZD B;  4CKB A;  5C3X A;  3EIV A;  3HGB A;  4X3S A;  4OX9 Q;  2D2C C;  2X69 A;  3CD6 A;  3DWA A;  4OHJ A;  2F0O A;  2ASB A;  2LY7 A;  1VQK A;  4ME3 A;  2SNS A;  1D8L A;  5ELB A;  5HGT A;  2NVQ B;  4HR7 B;  3PO3 B;  3K0X A;  3G48 A;  1RJT A;  3D6C A;  4DAV A;  2OF1 A;  2KBN A;  3IFT A;  3OIQ A;  1A8V A;  2EYH A;  1K28 A;  2HIV A;  4JI5 L;  4RHS A;  1S3O A;  2JA8 B;  4CHT B;  3OMG A;  1U4M A;  2CFM A;  4IQZ A;  4K6D A;  4O0A A;  1BCP F;  5TSS A;  3SEB A;  2PZW A;  2ATW A;  1H95 A;  2AQ2 B;  4DV6 Q;  1YVC A;  3CRK C;  1Q8I A;  1I5F A;  2K14 A;  4DR3 Q;  4OO1 H;  3GD7 A;  3HOX H;  3UDX A;  1YJ9 A;  2D0P A;  5M5X H;  4A3L G;  2TSS A;  5HGQ A;  3QR8 A;  3F2C A;  4FP5 D;  4HJ9 A;  4M8A A;  4DR4 L;  1TXY A;  3STB C;  2LXJ A;  5H1S E;  4DV4 Q;  3OPO A;  1PFM A;  1HNW L;  4IUU A;  2O5I C;  4H02 A;  3J80 c;  1AW7 A;  4HED A;  4X3U A;  1LLR D;  4ZYS A;  2K75 A;  1PZJ D;  4DR4 Q;  1VMP A;  2LSS A;  5GAH C;  1L0X B;  4R4Q A;  2UXD Q;  4KLK A;  3LX0 A;  2PZT A;  5JEA G;  2E2H B;  2R7Z H;  3S17 B;  3J81 L;  1TS5 A;  4PMB A;  4IUP A;  2NZ1 D;  1Q7Y C;  3AFP A;  2JA5 H;  4XYO A;  3KK7 A;  3NTI A;  1B3Q A;  4G4K A;  4C3H H;  4A3I H;  1BBU A;  1LTL A;  2EYJ A;  1RTN A;  3M4Q A;  3UE0 A;  5A2Q L;  1VCI A;  4JI2 Q;  4BA1 I;  1C8C A;  1D1K A;  3NK9 A;  2FMC A;  5EBC A;  1SYE A;  2UUB Q;  3PO2 H;  1PTO H;  1NY4 A;  2TMP A;  1HZB A;  4IAL A;  3QWN A;  4KN7 C;  5J39 A;  2K1B A;  1U4L A;  5E3F A;  4DK0 A;  1HQR D;  2K5V A;  5J22 A;  1KL9 A;  1G6Z A;  3CKI B;  1JQY D;  3ZJY C;  1EFI D;  2CWA A;  1EFW A;  1QIL A;  4FF1 A;  1V8Q A;  1TS2 A;  5BR8 Q;  3HOY H;  3L7Z C;  2BDN A;  1IW7 D;  4WFN 3;  4FDB A;  4B08 A;  2F0N A;  1LTA D;  1FNV A;  4QB4 A;  2FHT A;  2XWB B;  1L1O A;  1I6V C;  4IPG A;  3P20 A;  2HHH Q;  1WTO A;  4JYA Q;  4K8J A;  5C44 H;  1HZC A;  1D5Z C;  1BXT A;  3HOX B;  1A2U A;  2FMM A;  4BXX H;  3SK5 A;  3HOV H;  5M5X B;  1OXX K;  2EIF A;  4MTK A;  2R7Z G;  2A68 D;  3X3M A;  1QVF A;  2F0L A;  5T1G A;  1N32 L;  1VQF A;  1PH7 A;  3J7Y W;  2UU9 L;  1WOC A;  4JOI A;  3MZ5 A;  2VQE L;  2CCZ A;  3QG1 A;  4C3H G;  4A3I G;  2JK8 A;  1L2F A;  5M3F H;  2B2V A;  4PV1 C;  2F0M A;  3HEJ A;  1AFP A;  1V1O A;  4K14 A;  5FLM H;  2WIN B;  3SK8 A;  5ELC A;  1Q86 C;  1PDQ A;  3MFY A;  1ML0 D;  4WJ3 M;  1ILQ A;  4LAA A;  4X64 L;  4A3C H;  4L8J A;  2IJ0 A;  2VXW A;  2WAQ G;  1NUC A;  1WTR A;  1N9W A;  2B39 A;  5J1Z A;  5HY6 A;  1PH3 A;  3TRZ A;  2F52 A;  2R7Z B;  1X3E A;  5LL6 S;  4IFD I;  1EQV A;  2JA5 B;  3OMC A;  1WJJ A;  1SYD A;  4C3H B;  4A3I B;  1VQC A;  1ESR A;  1TWC H;  3HOY G;  5K36 H;  1HUM A;  1JIC A;  4HID A;  1I94 L;  3FPP A;  3M7N A;  1OXS C;  2A6E D;  3PO2 B;  4LF9 L;  1PTO B;  4H7B A;  1Z47 A;  1MHW C;  3BG3 A;  3FHW A;  5C44 G;  4DR6 Q;  2DNE A;  2WAQ B;  1K73 C;  4BXX G;  4JC0 A;  1F9P A;  3K58 A;  4HIM A;  3HOV G;  5C3E H;  2K28 A;  1VQB A;  3MXN A;  3TEH B;  3PCO B;  1PRT C;  2B63 H;  4L5R C;  4LUO A;  3GDE A;  5M3F G;  1PFB A;  3PIO A;  4NXN Q;  3HOY B;  1F77 A;  5FLX E;  3VR5 A;  2F0V A;  1IZ6 A;  4C1N I;  1V9P A;  5FLM G;  3OYY A;  3KBG A;  2B2Y C;  2PI2 E;  3NE5 B;  4Y7N H;  1WD0 A;  4QL5 A;  3T1H Q;  2LS0 1;  3OWF A;  2C5C A;  4GOP C;  4KMU C;  3D4R A;  5C44 B;  5D3D A;  4QIW B;  4A3C G;  3BZC A;  3EVQ A;  1STE A;  3HOV B;  1IYJ B;  3DWQ A;  1JWM D;  1WTX A;  1II3 A;  3L0O A;  1KXL A;  1M4V A;  2VB2 X;  1G2T A;  5KND A;  1DOL A;  2CW0 C;  1JOO A;  2L12 A;  5M3F B;  3KF8 B;  2QW7 A;  3STB D;  4X65 Q;  1D7Q A;  4DA2 A;  1D2B A;  1C48 A;  1F2Y A;  3G6J B;  2A6H D;  1B70 B;  1IYU A;  4O42 A;  5IT9 c;  3W5O A;  1FGU A;  3S9W A;  3PF5 A;  3N6R A;  4R8N A;  3BVM A;  2G5D A;  3I3C A;  5EKL A;  5C3E G;  1YI2 A;  1UEA B;  1Q3L A;  4KY6 A;  1GXD C;  2L11 A;  2VQF Q;  1VF5 C;  3CU7 A;  2B63 G;  5M9O A;  1NCV A;  4S3S A;  4FXD A;  3E9H A;  4KI0 A;  2B2U A;  4IN3 A;  1A0I A;  4JG2 A;  1N36 L;  1TWC B;  3T4A C;  3CME A;  3CW2 C;  1HA6 A;  1N33 Q;  1X54 A;  2KCC A;  3EJI A;  2SOB A;  3UDF A;  4DR2 Q;  1KAA A;  3VYT A;  5AFW A;  2QIL A;  1X9N A;  4NPS A;  2Q8T A;  4RGT A;  5C3E B;  3I55 A;  4LF7 Q;  3PUV A;  4KKU A;  1SRU A;  2JP1 A;  2D62 A;  4KV6 A;  4DNI A;  2B63 B;  1GKH A;  2QCP X;  2PO4 A;  4HIO A;  1XMQ Q;  1MIU A;  1G91 A;  3EA6 A;  4O1N A;  4BY7 H;  4XIG S;  5JAV A;  1E7Z A;  4KHP Q;  3D6W A;  1EQQ A;  4HSV A;  4Y7N B;  5C4X H;  4B3T L;  1LT6 D;  1X6O A;  4U68 A;  3HKS A;  1EWC A;  4H0L C;  1TWH H;  2MNA A;  5BN4 A;  1TII D;  1IKL A;  4YIJ A;  4LFB Q;  2PQE A;  4DR1 Q;  1I4X A;  2RCF A;  4I7A A;  1Y1V H;  4B3M Q;  2KEN A;  5C4H A;  2D0O A;  1GHJ A;  1YZ6 A;  3MC0 B;  2E76 C;  2VS1 A;  3A56 A;  4DK1 A;  4YHH L;  4P73 A;  2NWG A;  3NBI A;  5EJW A;  4LF5 Q;  1HR0 L;  2BA0 A;  2K01 A;  5IYB G;  3FEW X;  4R4I A;  4DR5 Q;  5IYC H;  3A54 A;  4JI1 Q;  1XX8 A;  1ESF A;  3QB3 A;  2R3Z A;  2A73 B;  3J7A 5;  2KHS A;  4UHV A;  1VQ9 A;  1ICF B;  1PZI D;  1DOK A;  4YHH Q;  5JJL A;  2IWH A;  1HRJ A;  4RGO S;  2RVL A;  1HHV A;  2FJ2 A;  1J8I A;  3PMF A;  2EYM A;  1HR0 W;  4JI8 L;  2L15 A;  1YEZ A;  3UDI A;  2GVB A;  3LNN A;  1EWH A;  1QJO A;  1SNM A;  1WTP A;  1SJE D;  4B3S L;  2HQE A;  5C4Z A;  2IX3 A;  5M3M H;  1DGS A;  1Z7T A;  1N34 Q;  1DON A;  5C4X G;  2BH2 A;  1KRS A;  2AMC B;  1XMO Q;  1EY7 A;  1VQN A;  3L9A X;  2K4K A;  4IFD H;  2J0T D;  3HKZ G;  3MEF A;  1ONL A;  5DAU A;  3K5M A;  1XTD A;  2JA6 H;  2R93 H;  1E24 A;  1Y1V G;  1G51 A;  2F0U A;  2VY3 A;  1BQQ T;  3EFX D;  2MFI A;  2K50 A;  4XQQ A;  5BN5 A;  1EY5 A;  1JB7 A;  1CKN B;  1YJN A;  4F8M A;  4P75 A;  3TP8 A;  2WP8 J;  4JK1 C;  4L63 B;  1XPR A;  3HOU H;  4BY7 B;  3MHB A;  4HCE A;  4TSS A;  2KEC A;  4JBJ A;  4JI7 L;  4WJW A;  4JI4 L;  5C4X B;  3GP7 A;  2EY2 A;  2N88 A;  5IYC G;  2XIW A;  4F87 A;  2CQA A;  5I6Y A;  2Z6K A;  3OTO Q;  1HNX Q;  1TWH B;  3DEO A;  4GN5 A;  2LMC B;  2M2L A;  2OEO A;  1ZYR C;  1ZEQ X;  2DGY A;  1PZK D;  5JPM C;  1Y1V B;  4XYQ A;  4C3I H;  4IFD J;  2UXC L;  1I4G A;  4K5X A;  2AUK A;  5E7N A;  2AUJ D;  4RA8 A;  4DV7 L;  3TP7 A;  2CW0 D;  1Q12 A;  1SRO A;  1F9Q A;  1LV9 A;  5CYU A;  1WCM H;  2HCC A;  3R8B A;  3I7F A;  3GTK H;  3ER0 A;  5M3M G;  2MP1 A;  1R9T H;  1XNQ L;  1FVI A;  2HUG A;  1OXU A;  2F0P A;  4ODG A;  3IFD A;  5DLQ E;  1I3Q H;  2MQH A;  1RHP A;  4DAM A;  5DNF A;  1SE2 A;  3U9S A;  2JA6 G;  4B3R Q;  1FL0 A;  2R93 G;  1SNO A;  1MSG A;  1U4R A;  2F0D A;  2YTX A;  3S1Q H;  4HJ5 A;  4TRD A;  3D4D A;  4IO9 A;  3A74 A;  2IHF A;  3BYT B;  3H3V I;  2Z8L A;  4KY5 A;  2ZTC A;  3DUZ A;  1EY6 A;  1HUN A;  4WRD A;  5D14 A;  5M3M B;  3RZO H;  2EJF C;  2Y0S E;  1BVS A;  4CJ1 B;  1A63 A;  2E74 C;  4DUZ Q;  1B50 A;  2F4I A;  3J80 L;  4CDD C;  1Q81 C;  1H9K A;  4JI6 Q;  4X3K A;  3FPU B;  3TN2 A;  4JI3 Q;  1E2W A;  1KLG D;  1JOR A;  1Y8P B;  2JA6 B;  2PW5 A;  2R93 B;  1IW7 C;  1YNN C;  1NR2 A;  4DV1 Q;  1BBW A;  1OO9 B;  2JQO A;  3BDC A;  3KF8 A;  1Y1W H;  5KYI A;  4X62 L;  4A3K H;  3ULL A;  1YIJ A;  2BE5 C;  3HOU B;  1EY9 A;  1WCM G;  3U50 C;  4ABN A;  3QIA A;  4A3J H;  1DCZ A;  4K6L A;  3H0G G;  1MJE A;  5KEE A;  1K3R A;  2UXB L;  3NWS A;  4OXP A;  3FVQ A;  3K5L A;  5I2X A;  3VR4 A;  2N49 A;  2F3I A;  2A5H A;  2EPB A;  3IL8 A;  4C3I B;  1VQ6 A;  1PRT F;  4J15 A;  3SR1 A;  2EXZ A;  4JV5 Q;  1EYA A;  2NTS A;  1PTO D;  2EYP A;  4A3G H;  1WCM B;  2WKD A;  3BJU A;  4ILW A;  4DV2 Q;  2Z4H A;  2OTJ A;  3GTK B;  1XNR Q;  2ZTE A;  1R9T B;  1NSN S;  4XQJ A;  1QVG A;  1AZP A;  3A7A B;  4J8Q A;  3H09 A;  4A3L H;  3CQZ H;  3CP0 A;  1M1K C;  4GS3 A;  1HA5 A;  1XXG A;  1I3Q B;  4DNT B;  4YCV A;  5E4W C;  2ZM6 Q;  4OX9 L;  1VS0 A;  3HFZ B;  3G71 A;  3J7A F;  5IGD A;  2HD3 A;  4ID6 A;  4DV3 Q;  4K8I A;  1OTC A;  1A2T A;  2K5Q A;  2K5W A;  4I65 A;  2A6E C;  1EOV A;  3K59 A;  4DAY B;  4P74 A;  1Y1W G;  1EZ6 A;  4A3K G;  5LMN Q;  2F0T A;  3QOJ A;  1SSO A;  4A3J G;  5LMN W;  3RZO B;  3CXC A;  4GKK Q;  4LF4 Q;  1BR9 A;  2XWJ B;  5LMU Q;  3WOF A;  5JEA H;  1K9M C;  1LT4 D;  2F0K A;  1Q8K A;  1SN8 A;  4DV6 L;  3M4O H;  2OQ0 A;  5AJ3 Q;  2RCN A;  2I5H A;  2X6G A;  5C4J H;  4DR3 L;  2QGQ A;  4C2M H;  4DAP A;  1L1O C;  3GTL H;  1I4P A;  1PYW D;  3SGI A;  1PH4 A;  1CKO A;  1JOQ A;  4N8X 1;  3SVM A;  1PHJ A;  3NHH A;  1CQF A;  1XYI A;  1Y1W B;  3R93 A;  1HQM C;  4A3K B;  4A3G G;  1JJC B;  3NP8 A;  4A3J B;  1HJP A;  4DV4 L;  5CV9 A;  5CBA E;  1GUN A;  4JOI C;  3EN2 A;  3A5Z B;  3ND9 A;  1IKM A;  3NSW A;  2DN8 A;  3D0F A;  4ZLT F;  3T56 B;  3DM3 A;  3OW2 A;  1GVP A;  3J7Z C;  3H6M A;  3HOW H;  5ELN A;  1LTG D;  1ZYR D;  4GKJ Q;  2PNH A;  5JEA J;  2UXD L;  2A19 A;  3F2B A;  3PUW A;  5KYL A;  1O7Z A;  1HNZ Q;  3BDO A;  1IBM Q;  1DZ1 A;  2A6H C;  3KDF A;  1VQL A;  2DNC A;  4DN4 M;  4A3G B;  4ZKC B;  3GTQ H;  1S5F D;  1DYQ A;  2MGS A;  5C3W A;  2AQ1 B;  5FO9 B;  1ENA A;  3HKZ E;  3SE0 A;  2WV6 D;  2NTT A;  4JI2 L;  1D5X C;  3CQZ B;  3TQY A;  2A74 C;  3MFG A;  3O13 A;  1VQP A;  1L0Y B;  2UUB L;  1PXU A;  3L3O C;  4RCN A;  5IP7 H;  1SFO H;  1TR5 A;  5A35 A;  3RLO A;  5EKK A;  1CKN A;  3JAM E;  1JCK B;  2RSO A;  2Q8I B;  2AHO B;  2MHV A;  1Z6H A;  2OQK A;  3DEP A;  1VQD A;  4YY3 Q;  1EL0 A;  3KOJ A;  5IP9 H;  5BR8 L;  3T13 A;  3BS1 A;  2F0S A;  4XXE A;  4E6I A;  1B9M A;  4YWL A;  2HHH L;  3CPW A;  3HOW G;  3M4O B;  5IT9 L;  3TRE A;  3NQT A;  3H3V H;  4JYA L;  4UAI A;  1HTL D;  5C4J B;  4DFA A;  2JJQ A;  5I9O A;  4C2M B;  2PMZ E;  1TVX A;  1RF2 D;  2XRQ D;  3GTL B;  4DK3 C;  1CZW A;  3LGJ A;  1VQI A;  4NDX A;  1AE3 A;  1YNN D;  1H9R A;  3JAM i;  5JJK A;  4J6H A;  4IUN A;  1U0L A;  1E1O A;  2CKZ B;  1SLJ A;  3RN5 A;  1SEB D;  1DXM A;  1PMR A;  2BE5 D;  1PLF A;  2I07 B;  2EYF A;  1MD2 D;  2B8G A;  3C1E A;  3WOE A;  4ZRZ A;  1JT8 A;  5E1F A;  4LMQ D;  4TQU S;  3EBE A;  2EYL A;  4A3F H;  1TY2 A;  1ASZ A;  3HOW B;  4JBM A;  3QO2 A;  3NXW A;  5IP7 G;  1KQS A;  2C35 B;  3DMU A;  4LF6 Q;  4DV0 Q;  5FOB B;  1STH A;  2K7V A;  3GTG H;  3A7L A;  1BCP B;  3A8I E;  4Q5V A;  4RKB A;  4LF8 Q;  1T5X D;  2CWP A;  4OON A;  3GTQ B;  3PIO 3;  1DM0 B;  3DHQ A;  5IP9 G;  1MBY A;  1XTC D;  4HSP A;  4KJO A;  4HCS A;  1K3B C;  1VF7 A;  2B2U C;  2EE1 A;  3F8T A;  3DM1 A;  1EQT A;  4HAE A;  2KOL A;  1SFO B;  4DR6 L;  2YV5 A;  5I9P A;  1PH8 A;  3CCQ A;  4G7O C;  1EYD A;  3CAM A;  4V19 0;  2R61 A;  4UPA A;  1RIP A;  4L5Q A;  1N8R C;  4KKS A;  5GAG C;  1IL2 A;  1TS4 A;  1YBY A;  1T9H A;  4NXN L;  1VQG A;  2Z9H A;  3UDG A;  3P1H A;  3J81 j;  4A3F G;  1IHZ A;  4JVZ A;  3T1H L;  2MO0 A;  4QY7 A;  5IWA Q;  5IGG A;  1EY4 A;  3B6Y A;  3PV0 A;  1KLU D;  4R9W A;  1ROD A;  4OL7 A;  1VQA A;  1K8A C;  2VUM H;  1UNS A;  1LTT D;  2EVB A;  1PH5 A;  2NZH A;  4CKC A;  2PQA B;  1JWS D;  3W3A A;  4BBS G;  1EQR A;  2Y0S G;  3Q23 A;  3H91 A;  4X65 L;  5FK9 C;  1STG A;  4OWW B;  2JE6 I;  3U4Z A;  4A3F B;  3KLS X;  3M9B A;  1SBB B;  4Y52 H;  1SNP A;  1D5M C;  2L1B A;  4JW0 A;  3AQQ A;  5DM6 3;  1PH6 A;  4LFC Q;  3VR2 A;  2FIN B;  4KY7 A;  1JOK A;  2D5D A;  3BVG A;  2F0I A;  3GTG B;  5JPN C;  3TSS A;  3T1Y Q;  4LWC A;  1NMG A;  1H9J A;  4IJH A;  4DAY A;  2VQF L;  3AU7 A;  1PFN A;  1QOH A;  3R2T A;  2PNR C;  4CJ2 C;  4AYB E;  2PI2 A;  2Y0S B;  4DNR B;  1PVO A;  1YHA A;  1H9M A;  1TWF H;  1N33 L;  4DPG A;  1JR0 D;  3L2P A;  4DR2 L;  1LTI D;  4LUV A;  1TWA H;  2IPK D;  1QUQ B;  1ICW A;  1B53 A;  1EIH A;  1VQ8 A;  1AZQ A;  4QMG A;  3RR5 A;  4LF7 L;  1KDB A;  4A3E G;  2VUM G;  2NN6 G;  5DM7 3;  5LL6 X;  2EDG A;  1FJG Q;  1EYC A;  5IYB H;  3VA7 A;  2J7Z A;  3K7A H;  2EOT A;  4G7Z C;  1XMQ L;  1SNC A;  3CF5 A;  2CHB D;  1PFS A;  3A8K E;  5ISR A;  1A62 A;  4KHP L;  1EZ8 A;  5EKI A;  3K5O A;  2FXQ A;  4L5S A;  3HP3 A;  2H5X A;  3VYR A;  1Q1E A;  3KF6 A;  3BZK A;  2O4X A;  1AE2 A;  1S5E D;  5J3B A;  1F2M A;  3DLL A;  2JXM B;  2OTL A;  4HJ7 A;  3VR3 A;  4YWK A;  4LFB L;  4DR1 L;  2Z6K C;  4H44 C;  1I50 H;  4B3M L;  3DXJ C;  4LFA Q;  2VUM B;  1G29 1;  2UUA Q;  2EJM A;  1QWY A;  2Q2I A;  1CA5 A;  4A3B H;  1JE5 A;  1SE8 A;  3V96 A;  4C3J G;  2HIX A;  4CDC C;  4X6A H;  4LF5 L;  4K5W A;  2K32 A;  2WAC A;  1KDA A;  5L37 A;  1TS3 A;  2RSN A;  2DY7 A;  2XVS A;  1Q82 C;  1VQH A;  2C9O A;  1QE6 A;  4DR5 L;  4JI1 L;  1EIG A;  3CC7 A;  1K8O A;  2L4N A;  3UI2 A; 
#chains in the Genus database with same CATH homology
 3RZO H;  5HGQ A;  5M5Y H;  1X56 A;  1HH2 P;  2Y0S E;  3F2C A;  1BVS A;  1E1T A;  4HJ9 A;  1Z9F A;  1A63 A;  1MKH A;  3M3Y H;  2WB1 E;  4X64 Q;  4A3M H;  4DR4 L;  5M5W H;  4DUZ Q;  2K5H A;  4DR7 Q;  1TXY A;  1Q81 C;  4JI6 Q;  2ES2 A;  4KHZ A;  2LXJ A;  3STB C;  5H1S E;  1BKB A;  2ID0 A;  3K80 C;  4DV4 Q;  4JI3 Q;  1K83 H;  4RG1 A;  4X66 Q;  1X65 A;  4A3E H;  1HNW L;  3CPF A;  4YWM A;  1XPO A;  4H02 A;  4LFC L;  3J80 c;  2KHJ A;  2JA7 H;  1YHB A;  3U58 A;  1UE5 A;  4LUZ A;  1EWI A;  2K75 A;  4DV1 Q;  4DR4 Q;  1N34 L;  3D31 A;  1BBW A;  2JQO A;  3ULJ A;  1QZH A;  1Y1W H;  1I94 Q;  3KFU A;  3T1Y L;  2LSS A;  4X62 L;  1NMF A;  4R4Q A;  3ULL A;  5GAH C;  4A3K H;  1YIJ A;  1XMO L;  2UXD Q;  1WCM G;  4KLK A;  3U50 C;  3K81 C;  5JEA G;  1XJV A;  4A3J H;  4LF9 Q;  1UWV A;  2R7Z H;  2R7F A;  1KIX A;  4AIM A;  3KDF B;  1IXR A;  2KHI A;  2XGT A;  4AH6 A;  3H0G G;  1Q7Y C;  3AFP A;  1MJE A;  3J80 i;  2JA5 H;  1PH9 A;  4NB3 A;  1K3R A;  4C3H H;  3NBH B;  4A3I H;  1BBU A;  1LTL A;  2Z0S A;  2UXB L;  4OXP A;  4A75 A;  3J81 c;  3I4M G;  3I4N H;  4A3B G;  3M4Q A;  3UE0 A;  2N49 A;  3CCE A;  1VCI A;  2F3I A;  1UEB A;  4P72 A;  4JI2 Q;  4BA1 I;  4GNX B;  1VQ6 A;  1V1Q A;  2UUB Q;  3PO2 H;  1KHI A;  1VQ4 A;  1NY4 A;  3NEM A;  1HZB A;  4J15 A;  4JV5 Q;  4C3J H;  3CC2 A;  2E2I H;  1HZ9 A;  4A3G H;  3BJU A;  4DV2 Q;  2F4V Q;  3OTO L;  3J81 i;  3CCJ A;  3CCS A;  2K5V A;  1HNX L;  1FJG L;  1XNR Q;  2OTJ A;  5GQO A;  2ZTE A;  2QEX A;  1KL9 A;  4R4T A;  4POG A;  1QVG A;  5IE8 A;  1X55 A;  2E5L Q;  5C4X G;  5K36 G;  3ZJY C;  2CWA A;  2Q2U A;  4R4C A;  4A3M G;  1EFW A;  1VQ7 A;  1SR3 A;  3CQZ H;  2XTI A;  4A3L H;  3CP0 A;  1M1K C;  4GS3 A;  3S14 H;  4JI0 Q;  2VNU D;  5BR8 Q;  3HOY H;  3L7Z C;  4EQ5 A;  4YCV A;  2B29 A;  2QA4 A;  3JC6 6;  2ZM6 Q;  4FDB A;  4OX9 L;  2K5N A;  1VS0 A;  1WYD A;  3HFZ B;  3G71 A;  1C7Y A;  2JA7 G;  3S24 A;  1J5E Q;  1L1O A;  3I2Z A;  4IPG A;  4DV3 Q;  1W2B A;  3S16 H;  2HHH Q;  1OTC A;  4JYA Q;  5C44 H;  1EOV A;  1HZC A;  4BBR H;  4P74 A;  4DAY B;  1Y1W G;  3NEL A;  4QGU A;  4A3K G;  4BXX H;  4PZ6 A;  5LMN Q;  2JEB I;  4LFA L;  2I5M X;  4BY1 H;  3HOV H;  1OXX K;  2UUA L;  2EIF A;  4JBK A;  3TS0 A;  3FKI H;  5LMN W;  3CXC A;  4A3J G;  1XPU A;  2R7Z G;  4GKK Q;  4LF4 Q;  1QVF A;  1N32 L;  1VQF A;  1PH7 A;  2UU9 L;  1WOC A;  2RF4 A;  4JOI A;  2VQE L;  5LMU Q;  1K9M C;  1B8A A;  2CCZ A;  2E2J H;  2NVT H;  4B3R L;  1K0R A;  3PUZ A;  4A3I G;  2JK8 A;  1L2F A;  4IPC A;  5M3F H;  5JJI A;  2RHS B;  1SN8 A;  1Q8K A;  4DV6 L;  3M4O H;  3H0G H;  2OQ0 A;  3KJP A;  5AJ3 Q;  3I4N G;  2RCN A;  2I5H A;  4DR3 L;  5C4J H;  2QGQ A;  4C2M H;  5FLM H;  1L1O C;  1IBL Q;  3GTL H;  3SGI A;  1PH4 A;  2LXK A;  1CKO A;  1Q86 C;  1GD7 A;  4OWX B;  3I4M H;  1SMX A;  1N36 Q;  1PHJ A;  1B7Y B;  4WJ3 M;  2I5L X;  4A3C H;  4RMF A;  4X64 L;  3CCU A;  1QZG A;  2WAQ G;  4DUZ L;  4NXM Q;  1O7I A;  1JJC B;  4A3G G;  4DR7 L;  4JI6 L;  3GTP H;  4PZ7 A;  1HJP A;  1N9W A;  5M5X H;  1PH3 A;  5HY6 A;  3TRZ A;  2F52 A;  4JI3 L;  4DV4 L;  1YHQ A;  4POF A;  1X3E A;  2NZO A;  2VL6 A;  4JOI C;  3EN2 A;  3M4P A;  4X66 L;  2Q2T A;  3A5Z B;  4IFD I;  3UE1 A;  3E9I A;  3D0F A;  1TWG H;  1WJJ A;  2AKW B;  2PQA A;  3DM3 A;  3OW2 A;  1VQC A;  1GVP A;  3J7Z C;  2OCE A;  1NE3 A;  3HOW H;  5ELN A;  1TWC H;  3HOY G;  4DV1 L;  4QJF A;  3G6E A;  4HID A;  1WI5 A;  3A5U A;  1I94 L;  4APV A;  3M7N A;  4GKJ Q;  1KAW A;  2PNH A;  5JEA J;  2UXD L;  2VW9 A;  2UUC Q;  2A19 A;  1OXS C;  1P16 A;  2R7D A;  1RL2 A;  4MZ9 A;  3PUW A;  3F2B A;  4HJ8 A;  2IX1 A;  1HNZ Q;  4LF9 L;  1EIF A;  3E0E A;  3PUX A;  1IBM Q;  2RHQ B;  1Z47 A;  3KDF A;  4GOP A;  1VQL A;  5C44 G;  3FHW A;  3ULP A;  4BBR G;  4DR6 Q;  2Q2H A;  4HIK A;  2DUD A;  1K73 C;  4BXX G;  4JC0 A;  2B3G A;  2VZA A;  4BY1 G;  4HIM A;  4B3T Q;  1X3G A;  3GTQ H;  3HOV G;  2IY5 B;  5C3E H;  3FKI G;  5ELO A;  2A8V A;  1VQB A;  3TEH B;  4XTC S;  3PCO B;  3HKZ E;  2GVA A;  4JI2 L;  2B63 H;  4L5R C;  3TQY A;  3RN2 A;  1UE6 A;  4LUO A;  3GDE A;  3GO5 A;  3CCR A;  5M3F G;  1VQP A;  2I0Q A;  2UUB L;  3PIO A;  3GTJ H;  4NXN Q;  3PUY A;  4IPH A;  2IHE A;  2AWN A;  4JV5 L;  1IZ6 A;  5IP7 H;  1SFO H;  2R6G A;  1V9P A;  3RLO A;  1QVC A;  5FLM G;  2R92 G;  3OYY A;  5C0X J;  4R4O A;  4DV2 L;  2PI2 E;  4Y7N H;  2F4V L;  3S1M H;  2N3S A;  4QL5 A;  3T1H Q;  1XNR L;  1CKN A;  4GOP C;  4UP7 A;  4AQY Q;  3S1R H;  1HR0 Q;  3Q8D A;  2E5L L;  2AHO B;  3BZC A;  5FJ8 G;  4A3C G;  2OQK A;  1CUK A;  1QUQ A;  2V1C C;  3BU2 A;  1VQD A;  1IYJ B;  2EQS A;  4YY3 Q;  4K0K Q;  3KOJ A;  4JI0 L;  5IP9 H;  5BR8 L;  3L0O A;  1VQO A;  1KXL A;  1ASY A;  2ZM6 L;  2IX0 A;  1AH9 A;  4BY7 G;  4TVA B;  4MTN A;  3JAM c;  5C0X G;  3AYH B;  1NTG A;  1J5E L;  4DV3 L;  2AWO A;  3KF8 B;  4YWL A;  3CPW A;  2HHH L;  3HOW G;  4A93 H;  3STB D;  1UE1 A;  3TRE A;  4X65 Q;  3H3V H;  4UP8 A;  4JYA L;  1D7Q A;  2JJQ A;  1HZA A;  2PMZ E;  4JI8 Q;  1LUZ A;  5LMN L;  1B70 B;  4DK3 C;  3FP9 A;  4DUY Q;  2N8N A;  4OO1 I;  3KJO A;  3LGJ A;  1VQI A;  1JJ2 A;  4LF4 L;  1AE3 A;  4B3S Q;  4BA2 I;  4GKK L;  2KCM A;  5IT9 c;  3W5O A;  1FGU A;  3JAM i;  3PF5 A;  5JJK A;  2IT1 A;  1J6Q A;  5LMU L;  1U0L A;  1E1O A;  2CKZ B;  4PG3 A;  1SLJ A;  3RN5 A;  1EIY B;  1LYL A;  4JCV E;  3F1Z A;  1L0W A;  5C3E G;  4DV5 Q;  1YI2 A;  3PIP A;  4GLV B;  2VQF Q;  5AJ3 L;  1JT8 A;  4TQU S;  3EBE A;  2B63 G;  3W1B A;  1IBL L;  1Q1B A;  4A3F H;  3E9H A;  4KI0 A;  5IY0 A;  3H15 A;  4JG2 A;  1A0I A;  1ASZ A;  1N36 L;  2NN6 I;  4R1J A;  2WAQ E;  4JBM A;  4UY8 C;  3CME A;  1VQE A;  3PO3 G;  3S15 H;  3CW2 C;  4AYB G;  5IP7 G;  2C35 B;  1KQS A;  4LF6 Q;  1N33 Q;  4DV0 Q;  4A3L G;  3IRB A;  4NXM L;  1PH1 A;  1X54 A;  2YYZ A;  4PMW A;  3UDF A;  3RNU A;  4DR2 Q;  3GTG H;  1E22 A;  2NVY H;  4EX5 A;  4A3D H;  3VDY A;  2R92 H;  1X3F A;  3AEV A;  4LF8 Q;  5EAY A;  2K52 A;  4JI7 Q;  2YTV A;  2CWP A;  4OON A;  1NBW A;  4IOC A;  2A1A A;  4JI4 Q;  2JEA I;  4WJ4 A;  1X9N A;  4NPS A;  3I55 A;  4LF7 Q;  1OXV A;  5IP9 G;  3PUV A;  3CCL A;  1SRU A;  5FJ8 H;  2D62 A;  3PGZ A;  4DNI A;  3KLW A;  4GKJ L;  1L1O B;  1GKH A;  2CQO A;  2UUC L;  4HIO A;  1XMQ Q;  1LM0 A;  1MIU A;  1C0A A;  1HNZ L;  3F8T A;  4QIW E;  1K8G A;  1S40 A;  1IBK Q;  1IBM L;  4A93 G;  4QQB X;  4BY7 H;  2UXC Q;  4XIG S;  3S2H H;  4DR6 L;  4IFD G;  1E7Z A;  4DV7 Q;  3I56 A;  4KHP Q;  2YV5 A;  2E8G A;  1EQQ A;  5C4X H;  4B3T L;  1PH8 A;  3CCQ A;  4PZ8 A;  3G4S A;  3KF6 B;  4A4I A;  1X6O A;  3HKS A;  4ALP A;  2NVX H;  1PA6 A;  3CAM A;  1TWH H;  2MNA A;  4UPA A;  1RIP A;  1XNQ Q;  4L5Q A;  4DK6 C;  1N8R C;  3PF4 A;  4LFB Q;  4OWT B;  3CCM A;  4DR1 Q;  5GAG C;  4YCW A;  1IL2 A;  1YBY A;  1JMC A;  1T9H A;  1Y1V H;  2ZJQ A;  2KEN A;  4NXN L;  4B3M Q;  2D0O A;  1VQG A;  2YU9 H;  1YZ6 A;  1UE7 A;  1EUJ A;  3HOU G;  3UDG A;  3RZD H;  2VS1 A;  5IYD H;  5GAD C;  4JI5 Q;  1GM5 A;  3J81 j;  3F2D A;  4A3F G;  1U5K A;  2ALY B;  3T1H L;  4YHH L;  2MO0 A;  4P73 A;  2ZJP A;  1V43 A;  4QY7 A;  5GAE C;  5IWA Q;  4GNX A;  4LF5 Q;  4AQY L;  3B6Y A;  1HR0 L;  2BA0 A;  3PV0 A;  5IYB G;  4R4I A;  2MO1 A;  4YY3 L;  4K0K L;  2NVQ H;  4DR5 Q;  5IYC H;  4JI1 Q;  3CC4 A;  3PO3 H;  1VQA A;  4A3D G;  1K8A C;  1WFQ A;  3PSI A;  2VUM H;  1PV4 A;  3GTO H;  4GN3 B;  1PH5 A;  2NZH A;  3J7A 5;  2PQA B;  1VQ9 A;  1CSP A;  4YHH Q;  3K7U C;  2JA8 H;  3M85 A;  4BBS G;  5JJL A;  1EQR A;  2Y0S G;  4X65 L;  5FLX c;  3A0J A;  4OWW B;  2WB1 G;  2JE6 I;  3K8A A;  4IJL A;  1OXT A;  3U4Z A;  4GLA C;  1HR0 W;  4JI8 L;  2L15 A;  1YEZ A;  3UDI A;  3S1N H;  4IOA A;  2GVB A;  4DUY L;  3M9B A;  3AFQ A;  4GNX C;  1HNW Q;  1YIT A;  4GOP B;  4Y52 H;  4B3S L;  3AQQ A;  4LFC Q;  1PH6 A;  3W1G A;  3S2D H;  1G6P A;  5M3M H;  1Y14 B;  1KD1 C;  1DGS A;  2BH8 A;  1N34 Q;  3WWV A;  3MXN B;  2BA1 A;  3I4O A;  1KRS A;  4LWC A;  4X62 Q;  1NMG A;  2AMC B;  4DV5 L;  3T1Y Q;  1XMO Q;  1VQJ A;  1VQN A;  4IJH A;  1JJG A;  2K4K A;  4GN4 B;  1PH2 A;  3TS2 A;  2R93 H;  2VQF L;  1P8L A;  2N78 A;  3HKZ G;  3MEF A;  4GLX A;  4YCU A;  4AYB E;  1YJW A;  1XTD A;  2HQL A;  2PI2 A;  3RLF A;  1E24 A;  1Y1V G;  1G51 A;  2VY3 A;  4P71 A;  2JA6 H;  4OO1 G;  1PVO A;  1Q46 A;  3RLN A;  1PYS B;  1TWF H;  1YHA A;  2MFI A;  5C0X I;  3HOX G;  1NJI C;  2UXB Q;  2K50 A;  4LF6 L;  4JBW A;  4A76 A;  1PYB A;  4DKA C;  5IYD G;  4DV0 L;  1N33 L;  4DPG A;  1JB7 A;  3L2P A;  1I6H H;  1CKN B;  4O2D A;  1YJN A;  4P75 A;  4DR2 L;  4LUV A;  1KRT A;  2WP8 J;  1TWA H;  1XPR A;  3HOU H;  3CCV A;  1S72 A;  2E2H H;  1QUQ B;  1EYG A;  3S17 H;  4LW1 A;  4LF8 L;  4JBJ A;  2KCT A;  4JI7 L;  4JI4 L;  1VQ8 A;  4HJA A;  3RR5 A;  5IYC G;  4LF7 L;  1M90 C;  4A3E G;  2VUM G;  2NN6 G;  2Z6K A;  3OTO Q;  1FJG Q;  1HNX Q;  5IYB H;  2GN5 A;  1KC8 C;  4GN5 A;  4LNQ A;  3K7A H;  3KYH C;  3CMA A;  2DGY A;  1XMQ L;  2JA8 G;  3CF5 A;  3U4V A;  1CSQ A;  1IBK L;  1PFS A;  1E3P A;  4C3I H;  2OWO A;  1W3S A;  4IFD J;  4IPD A;  2ZJR A;  2UXC L;  5E7N A;  3GTM H;  1A62 A;  4DV7 L;  4BBS H;  3EIV A;  4KHP L;  2BH2 A;  2FXQ A;  4L5S A;  4OX9 Q;  2H5X A;  1Q1E A;  1VQ5 A;  3KF6 A;  1Q12 A;  1SRO A;  3BZK A;  5GRO A;  3CD6 A;  1WCM H;  1AE2 A;  2ASB A;  5J3B A;  2JA5 G;  2YTY A;  3DLL A;  3I7F A;  4MNO A;  1VQK A;  3GTK H;  3ER0 A;  1C9O A;  5M3M G;  4HJ7 A;  2OTL A;  4ME3 A;  1R9T H;  1XNQ L;  1FVI A;  4YWK A;  3ICE A;  4LFB L;  1D8L A;  4DR1 L;  1CKM A;  2ZTD A;  1MJC A;  1OXU A;  2Z6K C;  1I50 H;  3K0X A;  4B3M L;  4LFA Q;  3G48 A;  1G29 1;  2UUA Q;  5DLQ E;  1GO3 E;  4UP9 A;  2KBN A;  1A8V A;  1I3Q H;  2HIV A;  2JA9 A;  2MQH A;  2Q2I A;  3NEN A;  4JI5 L;  4DAM A;  1VQM A;  3PO2 G;  1N32 Q;  1S3O A;  3HOZ G;  4A3B H;  2UU9 Q;  3HOZ H;  1JE5 A;  1SE8 A;  2CFM A;  2VQE Q;  2JA6 G;  4B3R Q;  1FL0 A;  4O0A A;  2HIX A;  2EXD A;  2R93 G;  1YNX A;  3ERS X;  5IWA L;  3S1Q H;  4LF5 L;  2YTX A;  2ATW A;  4HJ5 A;  4X6A H;  1H95 A;  4IO9 A;  4DV6 Q;  1YVC A;  2IHF A;  3A74 A;  4L5T A;  4DR3 Q;  2HT1 A;  1I5F A;  2K14 A;  1Q82 C;  3H3V I;  1VQH A;  2ZTC A;  3GD7 A;  3HOX H;  4JI1 L;  4DR5 L;  3CC7 A;  3UDX A;  1YJ9 A;  2D0P A;  2WFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...