4ZCKA

Crystal structure of c-terminal fragment of escherichia coli bipa/typa
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
299
Chain Sequence
GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTP-binding protein TypA/BipA
publication title Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gtp-binding protein
total genus 90
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 4zckA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zckA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 4zckA01
3OQ2A 3E3XA 4QR1A 1T95A 4ZCKA 1ZPWX 1ZM9A 2ZITA 4ES1A 2KDOA 2YWFA 2BM1A 3ZZTA 2YWHA 2BM0A 4QR0A 3CB4A 4ZCIA 5G4DA 4ZCMA 2CVEA 1ZM4A 2YWGA 2XEXA 3B8HA 4MYTA 3EXCX 2EFGA 2DY1A 4MAKA 3LH2S 4ES3A 1DARA 2BV3A 3UI3A 1ZM3A 1WDTA 4ZCLA 3B78A 1KTVA 2J7KA 4M1KA 1VI7A 1U2RA 1FNMA 2NPFA 4ES2A 4MYUA 2IVYA 2I0XA 2WBMA 2E1RA 1N0UA 1N0VC 3B82A 4FN5A 3ZZUA 1P9QC 1ELOA 2I8EA 1ZM2A 4TNOA 2YWEA 2L9NA 4QR2A 3ZZ0A
chains in the Genus database with same CATH superfamily
3BKFA 3VGTA 5CV7A 2DO4A 2EPIA 2ENBA 2RJZA 1BBXC 3MTKA 2WW4A 4R0EA 3UO0A 4G1IA 2C3PA 4ZVEA 2E7WA 2KCNA 2F4VL 1JLBA 1C1CB 2L9DA 3VALA 4Z37A 3VAHA 2F0MA 3GCWP 4ANEA 2ZKTA 2YKNB 1J5EF 4USTA 1WSRA 5BYRA 2WBMA 2HFSA 2ZH8A 4K0KL 1SKSA 4C48A 4CH0S 1OSCA 4K5SA 5MAOA 1Q3LA 4NXNL 4IUTA 5HN0A 4CBVA 1NDCA 2C42A 1XNQF 3LP1B 3CCRS 1WKKA 3PIOQ 4P2XA 2J9DA 1QUVA 4KGMA 2UV8G 3PKYA 3LQVA 2JLGA 1HI8A 2JC1A 4LQ3A 3I82A 1HZCA 3HOUB 4DR6L 4OZLA 2WSCC 4MYTA 3RUBL 4KHMA 4WJ4A 4K4ZA 2DNPA 3PGZA 4DR4J 1QD1A 3PY8A 4LRAA 1D5XC 3EGNA 2ZC4A 3LWLA 4KN4C 1RTDA 3T5KA 4PWDA 3HS0C 2OPQA 3UDIA 4ID5B 1QAJA 4LFAL 1G3OA 3J81i 3QWNA 1VBZA 1STEA 4RNNA 4ZYSA 1EQMA 1N0UA 1H7WA 1HQUA 2CPYA 3FRPB 3OMCA 2QX0A 1LWXA 3I4MG 4HR2A 3I4HX 4DPWA 3J7AF 2V1CC 4YWKA 3I31A 5IWAJ 3R5JB 4ITSA 4JI2Q 2EG2A 4R5PA 2VG5B 3DLEA 2AW0A 2XCPA 4X84A 4X64L 4L6V3 2IA0A 5C6AA 1HWKA 1I94Q 5KYIA 3E0EA 1KOHA 3ENAA 4U9RA 1VQ6A 2GQQA 2AJ1A 1N56A 4LMZA 4YCVA 1U24A 1Q16B 2DXEA 1JKHA 2DISA 3W8PA 3CPWA 3ZC4A 1UVJA 2MLZA 5I3UA 4DN4M 4NLRA 4YUDA 4DK1A 4KO0A 5JEAJ 1AEXA 1E22A 2OEKA 2KB2A 4DSEA 1RHKB 1TAQA 1UJ5A 4M5HA 3VGUA 4J9PA 2VQFQ 1R31A 4WBFA 5FLXL 3M2VA 4RNFA 1M5SA 1QSYA 4DR5J 1VQ9A 3I5BA 4QIWE 1XNRJ 5KFAA 4UQTA 2V8VA 3NBHB 3VHQA 1FF2A 5DM7Q 3AOCA 1A3UA 1JICA 4PZ7A 2R3VA 4NDXA 2FJAB 3CUNA 5JJBA 1HI1A 5KG3A 2KENA 5AXKA 4YEAA 5J1EB 3R1HA 1SAPA 5A8KB 2XVSA 2ASBA 3PO3H 2F0OA 2QMUB 3QT7A 1VQ6S 2OQKA 4I2PA 1VQAA 1CA6A 2H5XA 3I56A 1H98A 2KOLA 1NDKA 1VRTA 3EMTA 3QFHA 1WJJA 4IPCA 3H2UB 3VAGA 2VUMH 2KT2A 3M7GA 4HAEA 4PAAA 1A6LA 2OPPA 2ES2A 5F0UA 3L0OA 4USJC 1LTSD 4KRWA 5CYMA 3BB5A 4WXOA 3TA1A 1TWHB 3S2HB 1HNWJ 1FYCA 3TANA 2OPRA 1VF7A 1B44D 4DR4Q 1FKPA 4C3IB 1NPPA 3BVZA 5M2RA 4URQU 2NN6G 1GMVA 5K8OA 3OD2A 1WELA 4OHZA 1HWIA 2NXCA 4K14A 1OY6A 1D3WA 3RLFA 2B3TB 1GK8A 4JI2F 5IYCG 3M7VA 4MFBB 5AE2A 1JLQB 3MEFA 3VYSA 2MZ1A 1CM9A 1JWSD 4RWXA 2DHSA 5KFJA 2XM3A 4GN4B 4CCHA 1EU3A 1I94F 4YHHJ 3KHGA 5JJIA 1H6KX 3TAMB 1KTQA 3OIQA 1U45A 3JS9A 1C0TB 4BLGA 1D5ZC 3IRWP 3PJWA 2G2YA 1ZAXA 1JWMD 4C56C 4FBUA 2AWOA 1L0YB 3I56S 2RF4A 3HGBA 4DFJA 3QRRA 4NLQA 2QO3A 5J39A 4GOPA 1NKEA 3ZFVA 2B2WC 2DY8A 4MIUA 4EX5A 4A8KA 5KNBA 4K4YA 4ZLNA 4IRDA 3FEZA 1FL0A 2R3ZA 3I55A 2VQFF 1WHYA 2F8HA 2NVQH 2BJ9A 1S9GA 2AZ3A 1C0AA 4A8MP 3V5RA 4UUXA 3J7ZT 2W4CA 3KK2A 4DQQA 1RAOA 1NB2A 2KJWA 2R6GA 2MQOA 3DXSX 1EYCA 5F8HA 3B78A 2ZH7A 5G3LF 2XBPA 2M00A 3BVGA 4KY5A 1XNRQ 3THVA 4YCWA 1Q8IA 5IOCA 4NXML 4ULLA 1M5OC 2LFVA 5LMNQ 1H9SB 3HT3A 2R7SA 1FERA 1VISA 1SV5B 3OTEA 2VONA 1YHQA 3FBEA 3UDGA 1M1GA 1QAYA 1NPKA 4A3GB 1YNND 3QB3A 3TUJC 2QF7A 3SQOP 1PSDA 1K3BC 2VU5A 2VFSA 3I4PA 4NLPA 3HD2A 4XPEA 4ILWA 1OPZA 1K73C 3CSKA 3MM7A 3I55S 1SNMA 1TS4A 2XC9A 2X69A 1YBTA 4JI1L 3D1OA 1UCNA 1Q7YC 3QIPA 4N8X1 2J7ZA 4DR4F 1QUPA 2FY8A 1JORA 4HHJA 1NJZA 2DJFC 3FHWA 3QSIA 3K0JA 5LT5A 4F0MA 5JMNA 1T9VA 3G6YA 2VBZA 1FNVA 2CA9A 1HNWQ 2PMZE 2MFIA 4QYRA 5FD1A 4USMA 1R6YA 3DLKA 2HZCA 1CTMA 2HFZA 4L76A 1XMOL 3T5LA 4KR0B 4DV3L 3H5XA 5H1SE 3M9BA 4DR1L 4ZLTF 2J7WA 4ER8A 2BDPA 2HVHA 3HI9A 3MAAB 2YNFA 3W9JA 1CA5A 1PH5A 2L41A 5E7NA 4EO8A 4DGZA 1KONA 4CM2A 2CKZB 1YHQS 5C4HA 5M2PA 3T56B 1CUKA 3JTOA 3WIUA 1VQHA 5I6YA 4CKEA 4YHHQ 4C9DA 4JI0J 2Y0SB 3MEGB 4U8YA 1GO3E 2JA5B 5M3MH 1PFBA 2A6EC 1FA0A 4IFDG 1MN7A 2JEFA 2V9WA 2RAQA 3BEGB 4F7XA 1GUSA 1UAPA 3WIVA 4KN7C 4ZOSA 2CQOA 2LEPA 1QVFA 3FC9A 3T9NA 4DZ6A 3N5BA 4C3LA 4CDDC 3A5UA 2X1AA 4RWWA 4OJHA 1UEAB 1TKDA 1IKXA 1GMUA 4F67A 4ES1A 4RGTA 4QWAA 1B64A 1LTRD 1XWEA 2HHSA 1F9QA 3STBC 3CNQP 2MQ8A 1RIPA 3LP0B 2OGUA 2CJXB 1QTNB 1XNRF 1S4EA 5HGTA 2ALZA 3M9MB 5JJLA 5LMNF 2V6AA 4A93B 1FXLA 1SE8A 5C4JB 1ULRA 2JA8G 1NK4A 1JLEB 2J0TD 3H3VI 2RF2B 4U7UK 2DNRA 2WONB 2Q1LA 4R4TA 3OTOJ 4OX9L 2UXDJ 1GTEA 2LQ9A 2CQDA 2DH9A 4OI6A 3NMAA 2OLWA 5IYBG 4K4WA 2R8KA 4B3SL 3HHKA 3H42A 2DNQA 3MR7A 1SMXA 2DYAA 2GW8A 2JHEA 2ROPA 2OELA 1CZWA 2ZNZA 4LNQA 2JZ5A 3RZDB 4C8KA 1F9EB 4KT0C 2GIQA 2UU9J 2XNQA 4Y6IA 1SE3A 4YQWA 2JK8A 2NYZD 3MECA 1K0SA 1BNZA 1PBUA 1LYLA 2IHFA 1PA6A 3BGRB 4OHYA 1IBML 2B2TA 1KLMB 5EKIA 4MK8A 5D4PA 3IC1A 4F25A 1HNWF 1PH7A 1H72C 3I5CA 4C3HG 1CSJA 2VA3A 1LQ9A 3D28A 1JXEA 3QZ8A 5JEAH 4M5DA 4KGZB 5HLFA 1HFNA 1QY7A 2BKPA 4J91A 3ET6A 2E5HA 1LV5A 3J81Y 4DUZJ 1CG2A 1EB0A 2NPIA 2IJNA 1TWGH 4K4UA 3CVKA 3OHBA 1T7PA 3MWBA 2ZTEA 1IZ6A 1AT1B 3R8YA 4YHHF 3MPWA 5C44B 1NJYA 1TKXA 4M1KA 4JP8A 5KFIA 2UV8A 2I07B 2N3OA 1RT6B 4YB1P 3DXJC 4LBPA 1X3QA 2HHHL 1MROA 4PMCA 1O6XA 4CWBA 3SV3A 2PI5A 3IGVA 1RT7B 3IMQJ 1X4CA 3A8JA 3U4VA 1DLOA 3FDSA 4DFKA 3OWEB 2HDMA 2PPBC 3ZYYX 4JI7L 3AYHB 4FNIA 2DR8A 3VYTA 3BS9A 1VQOA 2BH2A 1VC5A 4FDFA 4A3BH 4DV4J 3UN5A 2J9CA 2VPZB 5IXUA 3DM2A 3TP5A 5AE3A 1GFWB 3CJKA 3CMAA 3V2UC 2K01A 2MTLA 2H65B 3IL8A 5KFYA 1X4EA 2VA2A 3SMZA 1VC6A 4RMFA 3IFTA 2J5AA 5IGEA 3PUXA 1RTOA 4GKJL 4JI6L 1PZJD 2D74B 3TAPA 3PDNA 2V2ZA 3L7OA 5DJBA 2GQCA 4PABA 1SFOB 4LF8L 4O3PA 3OTDA 1YK9A 1WF0A 4DV6L 4TY8A 3W5ZA 5IC4B 3H3VC 3V81A 1UVMA 4I4BA 1RF2D 3ZTQA 2WBRA 2C5CA 2HCCA 2YKAA 4NYOA 1NU4A 1JLFA 2YH0A 2GC8A 3NGUA 4DUYQ 3DDNA 2AKWB 2X3DA 3DOKB 4F4YA 3M4YA 1OTCA 1VQOS 4J9SA 4XT3B 2QSFA 3KUEA 2WKCA 4B3OB 1KVKA 2V4DA 1GAOA 1R89A 4CZCA 2FVPA 1AFJA 4H4OB 1G2SA 3KBXA 2OEMA 2PD1A 2E2HH 5ETLA 2JSOA 3S1MH 4X4PA 2J0QD 2RQMA 3GTJB 2K6AA 3CMAS 1ZTWA 2LMIA 1I4PA 1FX4A 4LBHA 2Y1JA 2OTLA 2F0DA 4RL1A 3C6TB 2I5MX 3CW2C 1UAWA 2IM1A 5KFGA 1URNA 1XR7A 1EEFD 5C3XA 3X3NA 1NY4A 1SNQA 4EK2A 3OXGA 4YDXA 4E0DA 4R4IA 3NS7B 3ADAC 3H09A 1B1ZA 1C7YA 4DUZQ 1WYDA 1RWUA 1JJGA 3W1YC 4ELUA 4JC0A 3OR2A 1N32Q 1YDLA 3C15A 4B3MQ 1LTID 2WVEA 3I72A 3ULLA 4JI8J 4ZAIA 1CJVA 4I6YA 1Y1WG 2V8HA 2A2CA 1YNJD 1UVLA 2QEJC 2K50A 5BN3A 2W9AA 1XBWA 3EFXD 2R93G 3EXCX 5IZHA 3P96A 5KOXA 3QAEA 4OO1G 2FTRA 2D2CC 2K32A 3PYEA 1JJ2R 1N8RC 4P71A 4USWA 3TEHB 1VIOA 2V8DA 2B29A 2YKPA 1EY5A 4L5QA 1C0UA 2YNGA 1U1OA 4LJZC 4QGUA 1RDRA 1YJNA 2OTLS 3RZAA 5SZTA 5IP9H 2RMLA 3GTLH 1KNEA 4QYZK 4HT7A 3QOJA 2OPSB 3SHLA 3H7HB 3SK5A 5M2UA 2OMOA 2K4KA 3PM9A 3CD7A 4WP8A 1RLDA 2H51B 5DNFA 1RJJA 4C3KA 2WCXA 4CO5A 2HK3A 2QZ8A 3PYFA 1GVPA 4WFXA 1K83H 5KG1A 5JPNC 2VL1A 3PMFA 2RQKA 3FUYA 2R2UA 4ED2A 3U1NA 3UD5A 4DMZA 2UXDF 1HQEA 3B82A 3EPIA 4LUZA 5ETTA 2L1BA 4DUYF 4M5MA 4LFBJ 3PO3B 1SQEA 3W2WB 4V19J 4QWBA 1QZHA 2CQIA 2DY1A 3KK1A 1SYFA 2E2IH 3RW6A 3NGSA 3GPAA 5E3FA 3NNCA 4A3JH 3W2VA 2VUMB 1YJNS 5EKLA 2YNHA 4ZVOB 4KHPJ 3UR0A 2Z6BA 3Q6SA 1KP6A 2DUDA 2F0GA 3GO5A 2XLJA 3CIZA 3OTCA 2ROGA 2V8GA 3OIPA 1HQ2A 2QL5B 1FK9A 3NAIA 5IQQA 2WAQE 1NCVA 1RBOB 1EL0A 4DV7Q 4QPTA 5HSPA 3OLBA 1U9RA 1WKLA 2DY7A 4DUZF 4EUVA 2CJKA 1WI8A 3A5ZB 5G4DA 3MR2A 5B0FA 1N32F 1N5VA 2XMJA 4ES3A 4B3MF 4LUVA 2K5NA 2VZAA 2ZBPA 2GJ2A 4Y7NB 3GTOB 3CCMA 1CSQA 4L8JA 3CDEA 5B0AA 2G2OA 4HI1A 1JWUD 3DYAB 4NCGB 4IR1A 1H38A 1ZM4A 2G0IA 3EVOA 5EN1A 2J9EA 1IKMA 3UN3A 3N4WA 1IWGA 4JI8Q 2E5GA 4ZVFA 4X4OA 3LWMA 2JA6B 3S1QH 1N33L 2UUBL 4HKQA 5E0OA 5IYDG 4A3KG 4DV4F 1TKTA 3M05A 3S15B 1RT2A 4ZP7A 3GJTB 4W98A 2PMWA 1RU1A 2VIHA 3QNWB 4PMWA 2HQ3A 5KTQA 3AB9A 2W9BB 3MD3A 4U7CA 4V190 2NVQB 2K33A 3DLLA 3TMEA 3NELA 1DTTA 4YN3B 1GQEA 2GIRA 3VZHA 4FF3A 1OO0B 1SKUB 5CGKA 1N6QB 4OL8A 4ZVRB 2HNYA 2J76E 1JB3A 2YWKA 2EXUA 7FD1A 3KJFB 1TZ0A 4YOEA 3TEGA 1CJTB 2RKIA 3EVMA 4MTKA 2HHQA 1RT1A 4LREA 4B17A 3CCMS 2JC0A 5C3EG 3GTYX 4RBVA 1ML0D 4U95A 4DEZA 1S1VA 1WG5A 3KJVA 2KXFA 1SJQA 1T05B 4LFBQ 3FBFA 3T1YJ 3H2LA 3HOXH 4J6HA 4LT6A 1RHQB 1D1UA 2SEBD 2N7CA 2PCFB 4BC7A 3KF6B 4MKAA 1TR5A 1TWAB 2V4JA 2EFNA 4C98A 4R1JA 4CLTA 3N01A 3T5HA 3Q2SC 3D0HE 4FS1A 2ZHBA 2G0JA 1WUUA 5A6WA 4QYZJ 1HI0P 1WEZA 3RG6A 5GQOA 4F2RA 1KD1T 1WOSA 2B4VA 3OSOA 1DD2A 5J1ZA 2CYYA 1ZYRD 2HFVA 4DF4A 3S2DB 2MKIA 1GX6A 4N77A 3MDFA 2IC3B 1STNA 2B8GA 1G6BA 1RTNA 1HNIB 3DWAA 4NZ6A 1KRTA 5IT4A 1UUPA 2I2YA 2A73B 4USKA 3EWGA 1A7GE 2DH8A 2ZBIA 4TU7A 1RWMB 2BW7A 3QJYA 3U1LA 3RB6A 2RB7A 1JB7A 3P45B 2WB1G 2YWHA 2XHCA 4JI8F 1NMFA 1K1QA 4JVZA 4J9RA 2NLWA 4Q8FA 2RD5C 3DLGB 1TK8A 2VG6A 4O3SA 1G1XA 1TL3B 1O80A 4TXSA 5EAYA 2Z0GA 2ZEJA 3OVBA 2NXUA 5A0YB 4PWUA 3V6HA 4MK7A 3SBMA 3A8KE 5M3MB 2DRDA 1HTPA 2VB6A 2F4FA 2CDRB 1SNCA 3N52A 4ZIVA 2ZWOA 4UHVA 4KQZA 2OD6A 1UEUA 4C1NI 3WZ0A 2XSCA 1EKSA 2NVYB 2CQ4A 1PH8A 4PG8A 1STGA 1B7YB 2DJGC 4K4SA 1TS5A 3IFDA 2CXEA 3MWYW 4JI4J 3R7NB 2JEBI 2O5JC 1NMEB 4P72A 4DQRA 2BW2A 5FKAC 3W62A 5THWA 2JFKA 3CJ4A 4DAYB 2HAFA 3HOWG 2AYEA 3H2VE 1IYUA 3T9ZA 3AFQA 2WACA 2VBWA 5KT3A 4M1UB 2EKNA 4R8UA 1URRA 4IDKB 1GM5A 1QAXA 3DRRB 2LECA 4RW4A 4LFBF 3FPUB 2WSEC 2GO8A 1V6HA 1GKHA 2RHQB 3JSRA 1S7IA 4B08A 1BGXT 1KLUD 4BBRH 3M2UA 3R2DJ 3NE5B 2BOAA 2J6SA 4OX8A 2BYCA 1B0VA 3BPSP 4GNXA 2FVQA 1UW9A 3MXPA 3BYPA 2Y1RI 3R5BA 1NZ8A 2ZOGA 2ZUGA 4KTAA 2W7AA 1VYAA 3SE0A 3MFGA 4NI2B 4ICLB 1T9YA 5F3TA 2EVZA 1U0LA 1L1OC 2CDQA 4QOTA 1TL1B 3N5FA 4GRSA 2ZT9C 1D8YA 3TX0A 5T14A 1BHNA 1EQTA 4PR6A 4A3IB 1KQSA 4ZVSB 2E44A 3I0SA 3CJ5A 1F9RA 2COLA 3MZIA 1WTVA 3F1ZA 4IUVA 4EYIB 3MEKA 1YGYA 1B9MA 2ZVSA 1AH9A 1K9MT 2DRAA 4MK9A 2E2DC 1PFNA 2D0PA 3BSOA 1X4BA 5RUBA 2QT7A 5KT2A 1PVOA 3TAQA 4NRTA 4CP5A 4XPCA 2N55A 1L3TA 4X3UA 4GLXA 4OIKA 5L1LA 1JNZB 2PZWA 5J2QA 4NA2A 4XK8C 4BY7H 3VAMA 2RRNA 2D5DA 1U2FA 3T6JA 4XAKA 1UE7A 1RAHB 1FDNA 5LM7E 2MQMA 2H5IB 2A8VA 3ZZUA 1EIFA 3UWTA 1FJGQ 2F3WA 2JFDA 3R2IA 4A8QA 4RO0A 2Y0SE 5BN4A 3MR6A 2PIIA 4PCQA 1AUSL 1VDHA 4A3FG 1WG4A 5KFEA 1JLCA 5K5PA 1UJ4A 2GJIA 5E3QA 1DZ1A 5EPLA 4F3MA 4DDFA 1P9QC 2CWPA 3SYZA 1FJCA 1F6TA 2K75A 2BJ1A 1T5XD 3N0VA 3W8GA 3G7LA 4YR3A 4GN5A 4CDCC 3X3MA 4QIFA 4DU8A 4ID6A 2A74C 4JI4Q 5DEHA 2J9DE 4YDDB 1M90T 3MCMA 3TRGA 3EJIA 3P6YC 3BR9A 4O1NA 1Q46A 1L3UA 4W92B 1HPCA 1X6OA 5GAHI 3U7JA 1YQHA 1QVGA 4C11A 2IWHA 2X6LA 5B0GA 3NTHA 1RT5A 5B7WA 3I4NH 5KFSA 2B8QA 2HAIA 1QCBD 3NUCA 3NKYA 4ME3A 4G57A 3Q24A 2KXNB 1S9FA 4DR7Q 1G4CA 1U2CA 3PCOB 2F0WA 3D0IE 1DCZA 4P74A 2EYMA 4DV2Q 4J9QA 2JEJA 1DJRD 3G8QA 1BWVA 3D1QA 3D68A 1QE1A 1Z7TA 3QG1A 3NEMA 1A0OB 5HROA 3JYTB 2MB0B 5AXLA 3RLNA 2AUKA 4U673 2KCTA 1N5SA 2D0OA 4X66J 5ETSA 2N49A 2Z0SA 1M5VC 2E2HB 2DR5A 1TVXA 2NB0A 2L9NA 4USUA 3S1MB 1KNZA 1S99A 1J2VA 2FJEB 4DPYA 2H1YA 1F5CA 1KVJA 4ZK7M 1RA6A 2XY5A 2DEIA 4NYZA 2FJDB 1Y8OB 2CWAA 1KAAA 1KFSA 3CGIA 2WSFC 1IKYA 4RWSC 2AX1A 2HKEA 3N6NA 3JAMU 2LXJA 3BSAA 3KYHC 1GMWA 2KVMA 3JAME 2A0FB 5GAHU 1WWHA 4LF7Q 3HVWA 3K89A 1HMVA 2B5JA 2ZH4A 2PFFB 2EYOA 1LK5A 1L1OB 4LR7A 1X65A 1VQBA 1M8AA 1NAQA 3KTQA 3FSXA 3BZQA 3HCXA 4R0JA 1FJGF 1XTZA 1V9OA 2HUGA 2D62A 1G2EA 4DWIA 3C16B 4I64A 1HIYA 3NGTA 3H25A 2ATWA 5KFTA 2JX2A 1IBLJ 3IAS9 2YKMA 1K0VA 5EPJA 1LM0A 1QUQA 1QTMA 2AP6A 2IVFB 4UF4A 2DNYA 2FC9A 5ETVA 2M4MA 2YU9H 2CIMA 1HLWA 4C4WA 1T9TA 3EXYA 3GTLB 3AXMA 1PYWD 3DRXA 1S1WA 4TLQA 4JI4F 1HFEL 1C4QA 1Y1VH 3T1HL 4CTAA 4BBYA 4ECSA 1SLJA 3KLGA 1Q8BA 1P27B 3OL9A 1PRTD 4ID8A 2ZHOA 3KLHB 1LWEB 4JV1A 1SYBA 3MMBA 1TELA 2KHIA 2TSSA 4RAUC 4RH6A 4BXXG 1LWCA 1ZZFA 3NY0A 2L4NA 2ZDPA 4DV2F 2B63H 2F3IA 3J80L 4AXIA 3HOZG 2M52A 3HKZD 1HUMA 2EBEA 2QFJA 2LMCB 3QGHA 4LF2A 1QSLA 5M3FG 2F3VA 3PO2H 5SUHA 2K5WA 3HHNB 3S1RH 4WE1A 3GYNA 5DGAA 3CCSS 1HNZL 5ADZA 3UD3P 4IUPA 5KT7A 2E2IB 3JSYA 1B4SA 4I2QA 3C46A 2UVVA 3M6VA 4WZMA 2DT9A 3CC4A 4A3JB 4AXJA 1R0AA 1ELOA 2U2FA 2L08A 2M5YA 1OY9A 1PYBA 1HBMA 2ZC3A 4EZ9A 2JVOA 3EA6A 4AL5A 1WEYA 4Y2CA 4CLYA 1OXTA 1SKRA 3GFHA 1II3A 2XSJA 2EY2A 2IPKD 2W9CB 2GA7A 1S4ZA 3WC2A 2R7UA 4RW9A 4LF7F 1TT2A 1KSPA 1SH0A 3CXCR 3CDAA 2KDOA 1KN6A 2F8EX 4FYYB 1VQPA 5ETRA 1FD8A 1IN0A 3HVTB 3K7AB 4O4GA 3JSMA 3BYRA 3B4DA 2EDGA 3DKDA 2CJBA 3HOVH 3CDUA 3MUMP 5IV3A 2KT3A 4YB7A 3SCKE 3OFGA 3R6LB 3KF8A 4MTNA 4HTHA 1ICFB 4EQPA 4PXDA 1YZ7A 4JV5J 4OHJA 4NLWA 5C0XG 3EPGA 2PQAA 3S1QB 2Z6KC 4ZKBB 3CCLA 2ZUAA 2DRBA 1SJED 1W2IA 3M32A 2HMIA 3CC4S 4K5XA 1EKRA 2B2YA 1K0RA 2KECA 4YMEA 1S49A 1IBLQ 4CT8A 4C8NA 1X5PA 2QTWA 1RTIA 1X4FA 1QE6A 2R7QA 1HBOA 4DSJA 4ED0A 4JI3J 3PUWA 4B3RJ 5B0DA 4U67Q 2DN8A 1V1PB 4DNRB 2DHGA 2YTXA 3TP6A 5KG5A 3RB3A 4I7FA 1VQ5A 3SZ2A 3O5TB 1GNKA 1T9HA 3V4MA 1TU0B 2FHOB 5E3PA 1YSJA 3MM5A 3O1LA 2IJ0A 3DLLQ 3VGVA 4H4KA 4J1MA 1VQCA 4JI6J 2Z2ZA 2EYPA 3HFVA 1YVFA 3S1NH 1RTDB 2W8KA 1ZKOA 1VQSA 4P7VA 1VQPS 4GOPC 1WC6A 5KT4A 1HNVB 3R5GA 1IYVA 5IT9U 2JEIA 4KB7A 5IT9E 3S14H 1GTHA 1KHWA 3KG4A 2HRYA 4DXFA 1B0PA 3NP8A 4Y3CA 3TQEA 2LQ8A 4EBDA 3R6GB 1STAA 4F8RA 2CQBA 4PUOA 1KDAA 2MHEA 3CCLS 2ZOFA 4QWCA 4PPZA 4DHVA 2XSFA 5DM6Q 5HBMB 2C2RA 1BCPD 4OZ1A 2LQBA 1UPMB 1IJEB 2WRMA 2X1GA 2IA6A 4CO0A 3MMAB 1WD6A 1EOVA 2K1RA 3RGIA 3H91A 2O4XA 2ZH6A 1LW2A 4KV8A 2RU3A 5EX0A 4X66F 2XMTA 3SDEA 4QBUA 3DM3A 1Q7LB 2Q8TA 5IP7G 3I6PA 2LEBA 4A3DG 4AT1B 4DX6A 4OI0A 5FO8B 1I3OB 2HT1A 1HL6A 3BGUA 3A54A 3QLHB 3JTNA 2GGPB 4ZVPB 2MKJA 5I3UB 1R27B 5HVGA 3NXZA 3L7ZC 3CPFA 3M6XA 4M5NA 2DEJA 3OT9A 2XULA 4DOZA 1IQTA 1NJIC 1YRTA 4A3MB 2BE2B 1N36Q 3GQBA 4LRFA 1JR0D 2B2VA 4OV6A 2H5EA 4Q0BB 3G71A 2WVBA 1JC7A 1RTZA 3LAMA 1U48A 2FJBB 2F0TA 1WC1A 5GMEA 5CABA 5BR8L 5KFWA 3KUGA 3ITHA 3UDCA 4EBCA 2CZ9A 2HCIA 3GE9A 2NREA 1S7HA 1TV6A 4TLRA 3DI6B 3DWQA 2E9TA 2NTSA 5K36H 4NEYA 3CWJA 4PG4A 1FVSA 2XY7A 3SR1A 2CQ3A 4XXEA 5F8GA 3AJDA 3A74A 2RVJA 4KHZA 1JB0C 4BBSH 2MKSA 2Z58B 4QJVA 2AU0A 2NVXH 1IBLF 4AYBG 2YXLA 4RUHA 3IWLA 2Q2HA 3FCWA 4A3EH 2ZJQA 5DO2A 1PMRA 1X7VA 4PXBA 1IXKA 2UUAJ 4JYAL 3TQYA 1CBKA 2ACYA 4PRFA 2OD4A 3TP2A 1KQKA 3BM7A 1B2TA 4JI3Q 2A5HA 4B3RQ 5T7LB 2AT1B 2F0IA 2MNAA 3G71S 3TZWA 1RI7A 4IG0B 4WFN3 2YQ0A 4IOAA 1X4GA 3E3XA 4FXKC 4WKRA 5ELOA 1RKIA 1EQQA 1QJHA 4DV1J 2RA4A 2M9VA 3ILLA 3UDEA 2GA4B 1E2ZA 4RU2A 4CRJA 1RWVB 1QJOA 1I94L 1AYEA 2IJRA 2ZJRQ 2CZVC 3T3FA 1CKMA 1LWFA 1GHKA 2B6AA 4K4TA 1YJUA 1L5UA 2XMVA 1E2WA 2A68D 4NLXA 1WTQA 1N5TA 2YBVA 3AY0A 3M2RA 1UNSA 3MCOA 1ZXTA 4F26A 1YJWA 2CPFA 2MQPA 2CAJA 2F0PA 4GOPB 2FDNA 1AP0A 5CYJA 4X4RA 5M3FH 4TU9A 1TUWA 3TR5A 3HOYH 5DZ7A 3R5CA 3EDRB 3B54A 1CQVA 4EZ6A 1AZSB 2M70A 4LJMA 3OPOA 1N36F 4Z2XA 4CDEC 2FVRA 3MXUA 2U1AA 3PVXA 5D0HA 1RKJA 1SC3B 2PE8A 2DGTA 5LSLA 5M5YH 1S9GB 4IH6A 3PG9A 1RWPB 3A8JE 4G65A 3WQPA 2M8HA 4WYWA 3I9ZA 1GOZA 5LXRA 2GVDA 4RGMA 3HOUG 3T4AC 1E6VA 2ZE2A 1ESFA 2D9UA 3JAMc 2D41A 2OKQA 3PHTA 3ND8A 3SK8A 2DKOB 3KDFB 1HR0W 1EETA 5AJ3J 5DDPC 3Q22A 4BY7B 2YKOA 4JV5F 1BQNA 4H44C 4ECXA 1IVZA 3KJQB 1BC6A 1FKAF 1YJWS 1MKHA 4LF6Q 1RYRA 2FYXA 1AFIA 2B56A 5C5JA 5C25A 2R92H 2GVAA 3CJRA 1H2VZ 3M8YA 2HVZA 5C0XH 3OXLA 4P7TA 4JI3F 1R4QB 4B3RF 4DR4L 3SDZA 2VY3A 2RDFA 4CLPA 3IWXA 2B4UA 1NK8A 3M8ZA 4Q8EA 1RAGB 2UUAQ 1SYEA 2F0EA 2OJ3A 1VCIA 4OX7A 4DL0C 2B3GA 5L1KA 4LF1A 4FN5A 2NXJA 1DOLA 2HHWA 4QMGA 1W2BA 1RTHA 2X1BA 4A3LH 2HVIA 2RQ4A 2WB1D 5ELEA 4XQNA 4DV1Q 2ILYA 5IWAL 2V5HG 1WI6A 4IRCA 4RW8B 2VG7B 3LALA 2YNFB 4NA3A 2IY5B 1CJKA 2NN6I 2ZJPA 1LW0B 1IJFB 4LQ9A 3GG0A 2JA7B 1FX2A 3BN7A 4K2XA 3WOFA 3UW1A 4GMKA 3C14A 4RCNA 3CCJA 2E8GA 3PUVA 1WTWA 1VQJA 1YVCA 3TS2A 1NSKL 5AXMA 3DOMB 1ASZA 4USVA 4G1QA 4C3MA 5A6PA 1KC8C 2F5GA 3M30B 1LV9A 2E7XA 3NNHA 4OZ3A 1D2BA 2Z56B 2AD9A 4FPRA 3P5BP 3HP6A 2R9LA 4I7AA 1QM9A 1RLCL 3G82B 4ZLJA 4PQUB 1QSSA 5KFLA 5L9NA 4A8XA 4DR5L 3CB4A 1S5ZA 4BY1B 5C4XH 1XNRL 5KT6A 4WP9A 4MMOA 3HFKA 2R2SA 3FFIB 3EE3A 2C9OA 2B9WA 3U50C 3GTMH 1YJ9A 4WFNQ 1VJQA 1BQXA 1WD1A 1YTYA 2Y8YA 4I6AA 4JBKA 4TSSA 1Q82C 2E1CA 1V9PA 3DRPA 4O3QA 1SXTA 3ZTPA 4X4VA 2D7SA 1F9FA 1WD0A 2QSWA 2MGSA 3CCJS 1FESA 4C3IG 2KVQE 5KFVA 4HIDA 1YJTA 4JBWA 2IDLA 4GKKJ 5D3IB 2D9OA 2UXCJ 1SR3A 2M0GB 3IKJA 5HY6A 1HNXJ 4HCSA 4XTCS 4Z7CA 1UP1A 1E3PA 2UUAF 3LOUA 1MMLA 4ZIWA 1HNWL 1ESRA 3BO4A 4FS2A 1EUJA 2ZM6J 5LL6d 1JMTA 4NCAA 2KHCA 3TVKA 1SQGA 1WDDA 2A10A 1B99A 1N5YA 1Y1VB 4IJLA 1FT8A 4NLOA 1YJ9S 2B4PA 2F1FA 1FR3A 4AFFA 4DV1F 3G2XA 3ET6B 2YTCA 2DR9A 4DG1A 2XNRA 4WPAA 1UWBA 1H2UX 2UVRA 4DX7A 4YHHL 2IAJA 2QE5A 5IT9c 4ILRA 5HMXA 3C6UB 1HD1A 1IL8A 5L39A 3NXWA 2KL8A 3D6CA 2IM0A 1SL0A 1RUSA 1VQDA 2B63B 4GLVB 1TKXB 2CCZA 3GIMA 2XGTA 4UP9A 1Y3JA 3U02A 3EJMA 2G0CA 3PEJA 3PO2B 4H4MB 3S1RB 5HP1A 2P9CA 1T03A 1F2LA 3MVVA 1ZBTA 4RLEA 1UZHA 3FZ2A 3W5XA 5CHCB 2VKRA 5KFDA 1YJ7A 1M5KC 4WRDA 2IIHA 1FRIA 2NZHA 2DNLA 1K8OA 5JUMA 3GV3A 1A0IA 1R8BA 4IFDI 4TVAB 1C1BB 3KLFA 3TS0A 5C3WA 4A3GG 3QMQA 2GHPA 2DGOA 1WTHA 3MM9A 5CH7B 2LEAA 3TJ9A 4DR3J 2ERRA 1IW7C 4OYWA 3BSNA 2QW7A 2OUGA 4QIEA 2HGMA 2XGPA 1NM2A 1ICEB 1RCVD 3I4MB 3WX4A 2VNUD 3I0RA 3JQKA 4LF4Q 3FKBA 1PH9A 1YLXA 4RKBA 1ZAVA 2NWGA 3AEVA 4I65A 2HHTA 3HDSA 4KH0B 1VMBA 3D3CJ 3OW2A 4OJ3A 2MKYA 4O0NA 4AL6A 4L6TB 1DGSA 3FPPA 1JLFB 4YFUA 1TY2A 4K8RA 5CR3A 2ZD1A 3QO2A 3ILJA 1ZA2B 2BM0A 4ZJQA 1TU2B 2UXCQ 2F4VQ 4JV2A 2Q6CA 3J7A5 1QNKA 2IL8A 2AQ2B 1OXUA 5C2GA 3IAYA 4NLVA 1HD0A 1RCXB 1SJ4P 1HNXQ 1N88A 1U4RA 2WHOA 1Z47A 2YH1A 4I67A 4LVNP 2DNOA 2HPUA 2HQCA 1F9HA 3DRSB 1CKNA 4F8MA 2LQ5A 2VFVA 1HHSA 3HHLA 1NH8A 1UZDA 1AE3A 2Y0SG 2N7YA 3RBDA 3I5AA 2MZTA 1KHVA 2BE7D 2ZH1A 4CJ2C 2QIFA 1S59A 4FYXB 1TK0A 2L48A 1MSHA 3S14B 1S1TA 2NXEA 4DR6Q 3NTIA 1U4MA 1HBNA 2HNDB 5K14A 4NP5A 4WJ3M 1TP7A 3UDFA 3QWPA 4JPBW 2E76C 4R8NA 4JI0L 4A47A 3M8QB 3DMJB 1WG1A 4WJWA 1MD2D 1CJVB 3TO8A 2LXFA 1LLRD 5DDRC 2WIIB 3V2TA 3SXLA 1E24A 2O5DA 5JJKA 2JOQA 4UOHA 1PJ6A 1S6OA 3QYYA 4DN9A 4A93G 1JXLA 5D3GA 4M5JA 2RILA 2VDHA 3TZYA 4JB8B 3MXNB 5KFPA 1JIHA 1TKWB 1ASYA 3IRXA 2M7SA 3FKIH 3Q83A 2JNJA 1EIGA 2CKWA 2MY7A 3KK3B 3K8WA 4OHWA 3D31A 5KG7A 2LA4A 3F41A 1NMGA 2JLFA 1IWAA 4DQSA 4X64Q 3RJMB 4K4VA 2HVDA 4DLEA 4DR3Q 3JAMi 2R61A 4LF4F 5AXNA 1C48A 3M4OH 2LCWA 3OTOL 2FVCA 2UXDL 3H0GH 4DS4A 3JSBA 5KFMA 4L63B 1XEZA 1MJEA 1HQEB 3L3CA 3CP0A 3DEPA 3EGVA 2HHUA 1C1CA 1V1OA 1F5AA 4FO2A 2WTFA 2C2EA 1FGUA 2YKNA 2UXCF 2UU9L 2F4VF 2DK2A 5KFHA 2BM1A 1HA1A 3RAMA 4BBSB 3S2HH 5E3RA 3A12A 2X1FA 1AE2A 4I68A 3C8YA 1HNXF 4G3IA 2FLLA 3GZ7A 3KK1B 5LHY1 2PSZA 2ZJQQ 1N54B 2IMOA 2NSBA 1WNEA 5G0RA 4K8JA 5C44G 2YNHB 1PYOB 1F9SA 3UQSA 4B9MA 5A2QL 4N8FA 2I38A 2CNLB 3HKZE 1M5HA 4DUZL 3HZEA 3Q8YA 3IFEA 1VGYA 2JEGA 5EJWA 3FP9A 4IOAQ 3PIPQ 1HWJA 5KYLA 4AD6A 2RS8A 1NAPA 3RTVA 1HZBA 4DN0A 1YI2A 1N9WA 2W2NP 4MHEA 4RW6B 2P6SA 1RHRB 1HQRD 2DIVA 3FMCA 2MQHA 5A2QE 3GFYA 3AT1B 4ME5A 1FKOB 5KEEA 4RZRA 2ZH5A 3RN5A 1DQ9A 1REGX 2ACMA 1DJ0A 2RUGA 2MJ8A 3GJQB 2G1DA 2CHBD 2GAHC 3KLWA 4ZP8A 4CDIA 1NHUA 3NGDA 2VB3X 2YWGA 4NX9A 1TKZB 3NPPA 5CV9A 1KS2A 4DV4L 3CU7A 1MLAA 4CNZA 1S9EB 2HHVA 1X5TA 2ZXRA 1TWFB 1VS0A 3AQQA 4LSLA 1S0OA 4QY7A 1TKTB 2PN6A 3EZUA 4K2LA 2X51A 3E6ZX 4OO1I 2V8PA 1YHAA 4X64F 2FZGB 1H9RA 2CJ9A 5ETPA 2MJUA 2NS1B 2XTJP 2XS2A 3ONAB 4CLSA 4DR3F 1J5EJ 1YITA 5HQLA 2EEYA 2MEWA 1LKZA 3RUZA 2EFOA 1YI2S 4DL6A 3AODA 1XNQJ 2OFHX 3D4RA 3GV5B 2AJ2A 2CVRA 2BACA 2RKIB 2KU7A 1EZ8A 3NBHA 1PFSA 2AEMA 4J8QA 1EFID 2F65A 3R5AA 4OYOA 3TRZA 3UDLA 2B4OA 2Y1LB 2RSNA 1XTCD 2R92B 5KFNA 2GS8A 2V4JB 3KG1A 5A8KA 4XDCA 3S17H 2EE1A 2HWIA 4NXMQ 3BKUA 4KMUC 1RAEB 1UFKA 2X7IA 3MHBA 2G5DA 1KIXA 3TUIC 4M5IA 3HHLD 1R43A 1JK9B 3R9LA 3M7NA 4DXGA 3H8YA 3ZTSA 4QQBA 3G86A 2HGLA 2JA8B 2NCKL 4IOCA 2XS7A 3CEDA 2JA5H 5HVFA 4HEA9 4WTOB 2QKIC 2VBYA 2L11A 1MWYA 4JI8L 1WCMH 4FYDA 2FZKB 3Q2TC 5HL7Q 4JI1Q 3BQ0A 3OV7A 1LUZA 2JSXA 4AYBD 4O42A 5ELBA 1U1PA 3M8PB 2EIFA 2NTTA 3P3DA 2CQGA 3A4TA 4MFBA 4O3NA 1JLQA 2L9HA 2C2ZB 3GV6A 4FKXA 2LQJA 1NSAA 3A8KA 1M4VA 4EQ5A 4CO2A 7AT1B 1C0TA 4DV3Q 3EIVA 4WJBA 4DR1Q 1KABA 4C3HB 2HBQB 1TQOA 2RCNA 4DJBA 3HF5A 3VAJA 3EN2A 4HVZA 5DS7A 3KLEB 4DQIA 3N79A 2E66A 3PO3G 1PTOF 1R8CA 1X0PA 4OJ1A 1BDOA 5K9FA 2RQCA 4ECWA 2GHWA 1S0VA 2YKQA 1I51B 4IH5A 1KLNA 4ECRA 1UEBA 2Y9HA 3GTMB 2CPJA 5ETKA 1NHKL 1XR5A 5E7OB 2VUMG 3TQ1A 3MI7X 4Y2AA 2P9GA 2QDBA 4LFBL 3EVWA 4PG7A 4S3SA 2B7BB 5ETMA 3GIIA 3PEHA 4ZVTB 3PR5B 2QEXA 3AA9A 3D3RA 5CZVA 1O5JA 3F2UA 1H9SA 4XYOA 2LU2A 2RUSA 2A69D 1VRUB 4KHPL 3VTIA 3RB0A 3D8GA 4A8WA 5HQ8A 1SV5A 5B0EA 1NK0A 1LK7A 1EYDA 2DB1A 2OP5A 3ISNC 2HIYA 4DSLA 5D65A 1LT6D 4YIJA 3M6WA 4JI2J 1PH1A 2PC6A 3I0SB 4B3SQ 3CCVA 2AQ4A 4BHQA 1MW7A 1HBUB 1LACA 3VR6A 3CCQA 3CD0A 1NK6A 2DXDA 4LRCA 2C2OB 1D09B 1JLGB 4TQRA 2C3MA 3I9V9 5AE1A 1DQ8A 2NSCA 3K5OA 3MFHA 4OHVA 2QEXS 1EX8A 2EC0A 3CJ8A 2QA4G 3OVAA 4EFAC 3L9AX 1OYDA 3P49B 1Q78A 3MAAA 4IUFA 4JCVE 4DV3F 2BX6A 2VQFJ 4DR1F 2MSSA 1VQLA 4UOGA 3VVTA 2PI2A 3OUYB 3MEGA 2R2TA 3BVMA 1NTGA 1QG7A 1NH7A 4RNMA 4FPIA 1FNWA 1UKUA 2JXMB 3AJ1A 4UPAA 3WOEA 3HEJA 1SFOH 1YBUA 3L95X 3CCVS 5I9PA 5CBAE 2VS1A 2XI2A 3JAMY 3BQ1A 2EJFC 4OIXA 1U09A 4A3CH 5A35A 3CCQS 3B6YA 9ATCB 5B09A 1IKVB 4CO3A 4USIA 3OW7A 2XCAA 1A9NB 3LP0A 2IVYA 1Y1WB 4PNYA 3CMEA 5MLCV 4TU8A 3U1MA 4KE5A 3SFGA 1RT5B 1ICWA 3EGZA 3FBBA 4DAVA 5L1IA 5JJZA 3T1YL 2B2WA 2ZTCA 4QB4A 5F8MA 3CQZB 3GTJH 1HR0J 1JLEA 2IW3A 2O1PA 1VQLS 3QT8A 3OFFA 2RF2A 1EWHA 4AH6A 2VJUA 2WB1E 2QA1A 1BR9A 5F8IA 3E5SA 1A62A 2E2JB 4GKJQ 2I1RA 4KIAA 3BO3A 2F0FA 2ADBA 4QQBX 4HIOA 1OWXA 2OIHA 2BJ8A 2IRYA 4LF8Q 1X32A 4MAKA 3BDCA 4DV6Q 4B3SF 3FDTA 2F03A 2BJ7A 2IRXA 3I4OA 1VQEA 3DGVA 5M3MG 4OI2A 5CXTA 4BWMA 3BGRA 2D3ZA 3BF4A 2CUYA 4HJAA 2JWNA 1KLMA 1F3VA 4FF4A 2CJYB 1FRJA 1WJ9A 5C24B 5DQIA 2ZDOA 5JAVA 4DF8A 1IKYB 5E5NA 2R7XA 3CMES 4UP8A 3IM9A 1M5PC 4FXDA 3T16A 5FLMG 3IR6B 2B5JB 2N3LA 2R7RA 1PBAA 4RKLA 4LRDA 3HP3A 1Q81T 2KFZA 3RBEA 1S97A 4LWCA 3SK4A 4IQXA 1U1QA 5IIFA 4ODGA 5F8JA 4H4KC 1OXXK 2IDEA 3A56A 2AYBA 3KNAA 4ZQ3A 1RQ0A 1Y7PA 3IG1B 3M9OB 2MDAA 3P1HA 1RT6A 5F8LA 1LT5D 4Q5VA 1WTPA 2IYGA 3FSYA 1KDBA 3FKIB 1XQIA 1RT7A 2LLZA 1X9NA 4WK1A 4JI4L 3MCNA 5LMNJ 1UETA 5D4OA 3NQIA 1WF1A 4TRDA 2ATCB 1CULA 1A2UA 4QR2A 1S1WB 2LY7A 4C1NK 3KLSX 1V43A 2GIFA 5DQHA 5FLXU 5KFZA 3GIRA 5FLXE 3LO3A 2ICEC 2Z2LA 4C2MH 4N5SA 2DGWA 1BE4A 3M4OB 1RWNB 2EC2A 1D1KA 4F04B 2HLTA 1OPIA 3J81L 3IS9B 5JXSA 2YNIB 3PSIA 1DFDA 3H0GB 2DHAA 3U4ZA 1K3RA 4C3JB 3MFIA 1NHVA 5LXYA 4A3IG 1XPRA 4PEOA 1HA5A 5JEAG 4QIGA 1SH3A 1KOOA 3MHYA 1AB8A 3H3VH 3S24A 2B2VC 2YX4A 4YY3J 1MU2B 3IBFB 2ASYA 4PYDA 1HR0Q 2PEBA 1LTTD 1U6FA 1NUEA 1VOMA 2B7CB 2ZBCA 1VQ9S 1SXLA 3QRPA 2J8AA 4NRUA 2MKKA 4DV6F 2F0KA 3QT5A 2F9DA 3BO2A 4WU3A 3H59A 2D9PA 5D0EA 4LIWA 1S1UB 2SNSA 3DOKA 4NZ0A 2JYOA 5CCMA 1S5DD 1DHMA 4AUKA 4DXLA 1IM6A 1NSQA 3RRGA 4B3OA 2KQ3A 4K7QA 4Y7NH 3GTOH 3NCPA 4H4OA 4M5KA 4F0KA 2PEHA 1DBDA 5CD4H 1IR0A 1EEID 3AHPA 2YQ1A 3VQSA 3NMRA 4I6WA 2JA6H 4NLGA 3EZ5A 4FP9A 4MH8A 1B53A 3C6TA 4A3BG 4WIIA 1S5ED 1RWKB 2RH3A 3KBGA 4O4GB 2XMUA 3JSMB 3VCDA 2ASJA 2WV6D 4NA1A 3QWUA 5H9EK 3S15H 3PYGA 2Y1IA 1X4HA 2CPHA 1D8LA 1DOMA 4ZPDA 1HUNA 5CV8A 1CI3M 2DPJA 2LS01 1RTJB 3TWZA 2P8IA 2BABA 3PW4A 3M32B 2F9JA 2BDOA 1HW8A 1NB7A 3OTBA 5C42B 2Y0SD 4IG3B 1PH2A 4ATNA 1HBOB 3EICA 1SYCA 4DS5A 1RABB 1PYTA 4NLDA 4HSVA 4JBCA 5HMYA 3IBCB 2BQUA 4G6VB 3CF5Q 4LSNB 1H0HB 2Q2IA 4E2FB 4EQNA 3MAHA 1FTRA 5K8MA 2FLOA 5HK4A 2OPSA 3DU5A 3OBIA 5IS2A 3KJOA 1TWAH 3QJPA 3KNGA 3B6BA 3TA2A 5HVHA 4RPFA 3JXOA 1Y0HA 8AT1B 3TW0A 1HR0F 1RKNA 5EHHA 4KKSA 1B9NA 5LOQA 2DR6A 4NLTA 4CKBA 3FBCA 1PTOC 4YY3Q 4X66L 2XEXA 5CBEE 3S2DH 1A15A 4FF2A 4LIRA 2VPWB 2FHTA 4AQYJ 3CCZA 5IC6B 2RDHA 3S17B 3W2WA 1ITPA 2ZVIA 1R4PB 4EO6A 4TKTA 2RVLA 3BDLA 2W2OP 4WFZA 2K52A 2E1AA 2F0JA 2GQ2A 1U4PA 3SSRA 4OYXA 1FFSB 2BKNA 1U26A 4ZVHA 1RP5A 1IKWB 1E0BA 4JOIA 1V5IB 2R7ZB 3T41A 1XXGA 2VFTA 3HOWB 2AJFE 2DY9A 3HHDA 4TN2A 3TX8A 4QWEA 4IOCQ 4DUTA 2DTJA 2BE5C 2DXFA 1XWLA 4KD3A 3CDWA 4POGA 1S6PA 1EAYC 1TR0A 4QIWB 3RB4A 1A2TA 1TFWA 1WCMB 1TFYA 3GV8B 5IP9G 1FVIA 2LSSA 2MLXA 2O01C 3TVZA 2WVCA 2BJDA 2DH7A 2D69A 3KYLA 3GP9A 3MR3A 4KAIA 2NVYH 1ET9A 1W6KA 4I56A 1PH6A 1LT4D 3HPOA 2HIVA 5FLMH 2E5LJ 1IBLL 1S6QA 2CQ1A 2PA8D 3RRHA 2BDNA 5T1IA 1D9FA 3DYAA 4NCGA 5CV5A 4Q0FA 1RXOB 1X0FA 4D3GA 3DXBA 2B51A 4F4ZA 4HJ9A 5C0XI 2ZTDA 1BXTA 1M1KT 4LSZB 3KMSA 1SJFA 2V2VA 3QR8A 3PUZA 3FQKA 3W1BA 2ZWPA 1S72A 4H54A 1KQFB 4HN7A 4UT4A 1UE5A 1G51A 1WOCA 1U1NA 5KFXA 4DUYJ 3M3YH 2W9BA 3NRBA 2GVZB 3BBBA 4MJKA 4YR0A 4A3JG 1EQ0A 3M8SA 1HYSA 2K1BA 4YR2A 4QR0A 1EHWA 2QA4A 4MT1A 1VQ7A 3TREA 5H9EJ 4UDUC 1I6JA 4LR9A 3SSSA 1N6QA 1QILA 3FGVA 1FJEB 4W90B 1CJTA 1RZMA 1S5CD 2ATLA 4Y0FA 3TA0A 4YY3F 2DO0A 1LEOA 3CCTA 2CPIA 3T5JA 1BF4A 4A3IH 1LTBD 4AL7A 3RW7A 1ENCA 4OL7A 3GTPH 3IA0A 1PH3A 3BGFA 5IODA 4C8YA 3A8IA 1EYGA 2EY1A 2NZ4A 3STBD 3UDXA 3MEDB 1T05A 1Q0NA 4AQYQ 1KFDA 3GSIA 4IFYB 3QATA 1H9JA 5J2MB 1N32J 2A2DA 1D5MC 1NEEA 4B3MJ 3KUHA 4B9WA 3QZ7A 3MUVP 1JQGA 5EUHA 2AEJA 3W3AA 4OLOA 1SUQB 4DNIA 3HULA 2F63A 1SKWA 1CK1A 2C22A 2JA9A 2FGOA 4ZLLA 3H90A 1ONLA 2G9HD 1X3GA 3I8ZA 1PYSB 2QA4S 1VQ7S 4ENOA 3HM9A 2XS5A 1RHMB 2MPMA 3HKZG 1SDFA 2QL9B 2R8GA 3MM6B 4L75A 1SMYC 1U1RA 2BANB 4JV5L 1BY9A 1HNIA 4A8YA 4A8OA 4MN3A 2HGNA 4NMXA 3BZCA 5KG0A 1S1XB 3F73A 3AB4B 1YG0A 1VJWA 1REVB 2E5LQ 3VAFA 4A8SA 2HFOA 3Q8UA 4GVBB 3H5SA 3S16H 4JI3L 3UNYA 3DLGA 1HH2P 1APSA 1HWLA 4B3RL 1H9MA 2NZ1D 3U27A 1NKBA 3FNNA 8ATCB 5J2PA 1IHZA 2VC1A 4HJ5A 3NBPA 4CI0B 3J7A1 2HBYB 5J3BA 2KG0A 2IYIA 2B39A 2OFGX 3HOXG 2BA9A 3W2DA 4B3TJ 4IQMA 5KT5A 2CVIA 1WTOA 1C8CA 3MTJA 1PC4A 5GMDA 5FLXc 4YP3A 3L7UA 5KG2A 2XZWA 2K05A 2FJ2A 4P2FA 1NSPA 5D77A 1DTQB 4KKOB 2G4BA 5GAEI 2VOOA 2OQ0A 1RT3B 2CFMA 5CV4A 4G7ZC 4IO1A 1SQFA 3W7BA 2GJFA 1SJRA 4DAYA 3UI2A 3AAWB 4WYLA 2Q8RE 2B0GA 1VFJA 4RHSA 4OJGA 1RA7A 1FDAA 3E9IA 3NQTA 2PFDA 2VPYB 4DV7J 3PACA 4IDKA 4O2DA 3DRRA 3AXKA 2ZH9A 4AQYF 2GVBA 5FDLB 4QIVA 2KEDA 2QMXA 4ZPAA 3EQLC 4P2MA 3FMBA 1J8IA 1YRXA 2WOMA 2B2UA 1B3TA 2DGSA 1U0HB 2Q79A 1R7IA 4L72B 5HI7A 4AYBE 2BUNA 2FLNA 2RRBA 4XTTA 2EY5A 5CYQB 3KHLA 1BUVT 5KNCA 4ICLA 4KFBB 5IM0B 1FWPA 3E01B 3BZKA 1TL1A 3ZTOA 1J5OA 4D3HA 1AW7A 4FBTA 3G8SA 1T11A 3K7UC 1YBAA 5KGUA 5E2QA 3F44A 4U68A 3OFEA 5GAEU 1JCKB 3J7AV 2HURA 1PHJA 5KOWA 1BQQT 1TWCB 3DRPB 3GTGB 3HVAA 1HHTP 2R7FA 2LXUA 3J7ZC 4FYWB 5J1NA 4DA2A 2YX7A 3R7BB 5I4DA 2CW0C 4LAAA 3HHLC 3V4IB 2E5LF 3W9HA 1P8LA 2EQSA 3QIDA 1AZQA 5DG9A 1T94A 2A6HC 3MMCB 4QCLA 5HANA 2QGFB 1VDZA 1SYDA 2UUAL 1K8MA 2YWEA 3LPEA 4ECVA 2I5JB 3BBCA 1X9MA 5L38A 2CJQA 3ZO7A 4ZPBA 3KMQA 3GMGA 4M63A 1EY8A 3NGRA 4HIMA 4KY3A 4DV1L 4BBRG 1WORA 2G13A 2KFYA 4TNOA 4FDBA 3GJSB 4CYUB 4RNOA 1RAAB 4B3TQ 4LFCJ 5J2NA 4C2MB 2UUTA 5KFBA 2K5HA 3MURP 2V69A 2CQ0A 3FJ2A 3BU2A 1SI9A 3QJJA 4DPGA 1WHVA 5GAEC 2UP1A 3GIKA 2F0SA 1VQYA 1SH2A 4KH1B 3NTKA 2CPEA 1TK5A 1DXMA 1I6HB 1BQMA 3E2EA 1ET6A 2Q6BA 2YPZA 3QO9B 3T1HQ 4IALA 3GTQB 4ZS6A 2XMAA 1FDBA 4YB6A 3VV2B 4NEZA 3TP7A 3W5OA 4ZVQB 2CQCA 1RT4B 4YS2A 1D9AA 1KWMA 3KHHA 4XQQA 2K8GA 3LP2B 3RMHA 5L46A 4QPXA 4J9NA 3R7SB 2CH4W 3NWTA 2OAUA 4KJNA 1MHWC 1W6JA 1LTAD 3AMUA 4NCBA 4DR2J 3GFXA 5IFMA 2HQFA 1FCAA 1FNXH 4BY7G 1YKWA 2PI4A 1QOHA 1GXLA 2HDLA 3K7AH 2AHOB 3JYTA 2YX1A 3TJAA 3KLFB 4MYUA 3NAHA 1A8VA 2MJNA 1TVRA 5HAOA 3MM9B 3SCIE 3S7RA 3D66A 3RN2A 4KSEB 4UY85 4IH7A 5JPMC 3GP7A 1B3AA 2W25A 4B9VA 3CPWR 3VR1A 3FCVA 1VC0A 3MPUB 3R2TA 3BR8A 1FRLA 1HW9A 5AJ3L 4Q7AA 3CJSA 1EP4B 3BYYB 3MC0B 3PW0A 1WSVA 3EX7B 5KRUA 3QT6A 2OI2A 3MM8B 2QG9B 3LAKA 3OL8A 1T3OA 1U8WA 2LDIA 3ETOA 3K5NA 1ZM3A 1JOQA 1R8HA 1L1OA 2FJXA 2EJGC 3CD5A 5G3LD 1LFPA 1B4OA 3CT9A 3US5A 2MGZB 1DZ5A 1MI2A 4ZPCA 2A1AA 1EQRA 4A46A 3FCHA 3I4NG 4B9SA 4DPUA 2PA3A 3C16A 2QLXA 3HG9A 3WDNA 4NB3A 3ZZOA 2I5HA 2Z8LA 3VA7A 1ZTTA 4LF9J 1EY7A 4B3TF 4WORA 1DRZA 3U9SA 2PZUA 4RW7B 2MYFA 1YEZA 3ILOA 3EGWB 3NENA 1DURA 3V6DB 4QU6A 5LMUJ 3LWEA 3BKTA 2AGPA 2J6UA 2MP1A 3RR7A 1CFMA 4LFCQ 4F7VA 4BS9A 4Q2LA 4HMJA 5EGYA 1K73T 2E5JA 5DM73 3T1HF 1FEEA 4EEYA 3ZNUA 4HHUA 3UE0A 1HPZA 4WIQA 3KLHA 1LWEA 2AIRB 2FMMA 3M4PA 3D4WA 2WZ1A 2DNEA 1Q7YT 1MN9A 4DV7F 1SIWB 1NCLA 4L5TA 1E7ZA 1TL7B 1NNDA 5KIXA 3AOBA 5I42B 4A3MH 3K0YA 1AW0A 3R8BA 3SQGB 5D3GB 1EFWA 4B9UA 2LXKA 3BREA 1FE0A 2J7UA 1PFMA 1LNQA 2BH8A 3M4QA 4K2KA 2F1MA 1RAJA 4DK0A 2K03A 1PXUA 1E6YA 2ZH3A 1XMQJ 1FDDA 4DR2Q 3H5YA 1NLKL 4PXEA 2DIUA 4IFVB 2W2QP 1EY6A 1Q4RA 1KXLA 4LF4L 1BBUA 4DQPA 2KFNA 1WTXA 3G6XA 3QPIA 2UUCJ 1SE4A 2YYZA 1WOOA 3HSDA 1FJGJ 4ED6A 1UW4A 2MQQA 1JJ2A 2QA2A 4F0HA 1AUDA 4IRKA 3MZ5A 2ZXPA 4CLKA 1VLOA 3R93A 1K8GA 1EIHA 2VC0A 2W9CA 3NK9A 2CQPA 3G87A 1Y1VG 3W61A 4GKKL 1XR6A 2HFUA 2UXCL 1Y8NB 3PHEA 3D4JA 3CTRA 5D3DA 3HVTA 1HNXL 2HQEA 4PG6A 2VXWA 3OHAA 1LO5D 1XX8A 1N4LA 1FFGB 3VQTA 1CS4B 1FGBD 1SVDA 5LL6S 2E9ZA 5BR8Q 3HJFA 2FUG9 2ZM6L 1U7LA 1I4XA 2A19A 2RCFA 5G0RB 2ZFHA 2ID0A 3NCQA 3IXQA 2B63G 2KT5A 4ALZA 1SL2A 3GILA 4HIKA 3DOLB 4PQXA 3F2BA 3W9IA 3PO2G 4A75A 1KQGB 3LGNA 2V34A 1NJWA 4DFMA 4DR7J 3G96A 1RDPD 4ERDA 1OS5A 2XQCA 4LF9Q 2LXIA 1HARA 4LFCF 4DV2J 3P5TL 2WAQB 1V1PA 3C3LA 3CE8A 4HHHA 3M3YB 2IHEA 3GQCA 4C7QA 3HHEA 5LMUQ 4ZHRB 1G291 4G4KA 4MZ9A 3OSPA 2R7DA 3VAKA 2HNZB 3ELHA 4JYAQ 4DL4A 3LW5C 2VH7A 2EK6A 4RR5A 4JV0A 3POTB 2ICIA 1HNVA 4OYPA 3OLAA 1BWEA 2CWKA 3KK7A 2W2MP 2UVUA 4PV1C 1H74A 3R3TA 5D6GA 5LJ3Y 1HXYD 5EPKA 5DETA 4PQAA 4O4RA 4AE5A 3GTPB 3D9BA 4ED5A 3MXHP 4LK1C 3W60A 1L2FA 1TMJA 3K81C 4F3OA 5BYQA 1UTAA 4PG5A 4CJ1B 1B50A 1CHPD 4DR2F 3HOVG 3TYTA 1JLAB 1UFLA 4FNHA 1DONA 5HBMA 4LSLB 2NVTB 1V3SA 4LF7J 2DGUA 2I0XA 2R7WA 4DR3L 1T02A 4NLSA 1BMQB 3R2CJ 3MMAA 2KVIA 2MLYA 1XMQQ 1UMJA 5E4XA 1Y5LB 2W2PP 2XRQD 1CKOA 4UQGA 4ZPTR 3C1FA 2A6OA 3QAUA 1QVFR 1EWCA 4FXGC 3HSZA 3N28A 3QLHA 1GXDC 2ZXOA 2GGPA 2GMHA 1PZKD 2FLPA 1AN8A 2EZVA 2H54B 3N6MA 4OHXA 2UVWA 1SL1A 2K14A 2CQ2A 1TUVA 2IPOB 7FDRA 2UUCQ 4KKUA 1XERA 2FGCA 2PI2E 1RL2A 1PDQA 2BE2A 1IBKJ 1T95A 5A8WA 3G8TA 2BXJA 4Q0BA 5IQ6A 1KRSA 3KDOA 4LF5J 2B43A 1GXUA 3KLRA 2DVIA 3H0PA 4RNHA 3OPKA 3GR0A 3M8WA 2V50A 3DGPB 4NOHA 1PAUB 4K59A 3HMJG 3R1LA 5BR8F 3AB2B 3DI6A 3DFEA 1YHBA 3GWCA 3RR5A 1S5BD 3S16B 5H9FK 2KCMA 4DF7A 3IR5B 3MA2B 2FJVA 5F2DA 3OFHA 3OXFA 1PO6A 4QW8A 5DGBA 1QNUA 3D6WA 2ZBRA 4ECQA 4EYHB 2XYHB 2I8EA 2FB0A 4LF9F 2R7OA 2K7KA 3SSQA 3OR1A 2VPXB 4N47A 2HG4A 2JA7H 3WHIA 5LMUF 3UI3A 4FXVA 3KJPA 4J9UE 2HQLA 2HEKA 1KNAA 2BQRA 4X62J 4FF1A 3KOJA 3K59A 2V94A 5T7LA 4JYAF 2ABYA 2CRLA 4IG0A 3HKSA 3HRZC 1MG7A 4ILLA 3UN2A 4DBQA 4A4IA 2Z6KA 4CO4A 1IM4A 4M5LA 4ZN3A 1K0TA 5L8RC 1I50H 1KLGD 3I3CA 4POFA 2VHGA 2VOPA 4J5OA 2XMWA 3MXGA 2VUGA 4CO1A 5GVQA 5LL6X 3Q8DA 3JB9k 2WFWA 1TY0A 1IR1A 1Q1EA 4URSA 3R5DA 4BY1H 4OZ5A 5IGGA 1RYSA 2YQ3A 1YNNC 3NWSA 3LANA 1R6VA 5M5XB 1N34J 2HHPA 5IWAQ 1EY0A 4DV0J 5K36G 2ALYB 3NG8A 3THPA 1XMQF 2XB2D 1Q5YA 1Y3KA 2L55A 2CH4A 1XPUA 2MSTA 4BBSG 1Q95G 2AEFA 1AZSA 2UUCF 4MTPA 1KBRA 3NWGA 3K6OA 3T19A 4A3EG 1EY9A 1JE5A 5ETNA 3RBXA 2JLEA 2ZITA 1Z9FA 2XO6A 5F8NA 2NXNA 3HSGA 1SJ3P 1N8RT 3VR5A 2K5VA 1E1OA 1O8BA 4Y52H 1PIEA 3G6EA 1IBKQ 5DLGA 1CQMA 2PNHA 4LF5Q 4DR5Q 5CAAA 3CO9A 3RU0A 5GMKa 4K5WA 1CEZA 2VODA 5FO9B 1MMNA 1VQ4A 4KI0A 3QSYB 4FVCA 3KDFA 2RDJA 4LUBA 3JQMA 1BUXA 2L9WA 2KYZA 4L73A 3EUNA 1S6UA 2DD8S 2D1CA 2KZMA 3HXMA 3PX0A 3AD8C 2W4DA 5DDOC 3K5LA 2QGQA 2NBFA 4K5VA 4OQJA 1XC9A 2PGCA 4KD4A 1CJUB 1WHWA 4QZVB 2JJQA 4XIUA 3ZZZA 4B9LA 4DR7F 5GAHC 4IFDJ 4JOUA 1S79A 3J7AN 3NBIA 1NDPA 3J81j 2CQHA 3GTKH 5CMDA 2OTJA 2HS3A 2GX8A 4IUQA 4ZLPA 4M8AA 2RHSB 4ZRZA 3HOYG 4H13C 4X62Q 2OCEA 3ITPA 1KD1C 3I2ZA 1D6EC 4ALPA 3G6ES 2C3YA 1S40A 4NLYA 3MEEB 2EWHA 4QJFA 4DPOA 3AD9C 3EM1A 3J80U 4KV6A 2HRTA 3J80E 3CC2A 5K20B 1VQ4S 2QYCA 2L3MA 2XZDB 2KZZA 4L3KA 4RW8A 5H9FJ 1N36J 2VG7A 2HBZB 3ICLA 3NCRA 5IWAF 1LW0A 1F2MA 2UUWA 6FD1A 3MPDA 4PXCA 1W3SA 1HZAA 5E4WC 1NXIA 3HJVA 1FNUA 1KL9A 1N48A 2TMPA 1N34Q 1J5EL 3I4MH 1JLBB 3J7YW 2C3UA 5IOLA 3DOMA 4DV0Q 1MJCA 1I3QB 2FFKB 3TNVA 4F02A 4OIJA 3LGJA 3CMQA 3TARA 3A3OB 3Q8PB 3M30A 4DU9A 1XNQL 2OTJS 2N4CA 4V0BA 4XO0A 5C4ZA 1G7CB 1HA6A 2L0CA 2R92G 3I91A 2Z8QA 1EWIA 2W4PA 2RSQA 1ZPWX 1ENFA 2E75C 4NYPA 3SGIA 3G82A 4ANCA 4ETXA 4PQUA 1IBKF 5ELCA 1A3TA 1H2TZ 3KWMA 2VB2X 2RT3A 4LF5F 2BVZA 1NBWA 3FFIA 2ASLA 2D3OR 2PO4A 4DR5F 3CC2S 2J8SA 5A8RA 1SNDA 1OXSC 1RWXB 2SNMA 3VA5A 3VAIA 1XPOA 2F0VA 3D2WA 1P8GA 3PW5A 4A3LG 2KH9A 4X3KA 2ZZMA 3M4XA 1VBXA 2EBGA 2IBOA 3PRBA 1CPZA 1BVSA 5IGCA 3OL7A 3GSDA 3FEWX 2AYGA 1CC7A 4PWDB 2OPQB 4XQJA 4KTQA 3UE2A 4DKAC 1RD9D 1ZS6A 3N9UC 5FLXY 2QLFB 1ZOTA 4RA8A 1Q1BA 1HQUB 4J9KA 4MIAA 1NKCA 3MTSA 2M88A 2BJEA 2CZ4A 4ETZA 2XMMA 4X62F 1ZEQX 1S48A 1FJ7A 3TZDA 3QGIA 4O44A 2V2KA 4R5PB 2RDDA 3DLEB 4DL7A 5I4MA 2Q2TA 3GU0A 1Y14B 2AWZA 3UVJA 1BBWA 1XMBA 4A76A 2RSOA 4Q44A 4U96A 1K9MC 1H95A 1CQFA 5K8PA 3OJSA 5C4XG 1JKHB 2BRLA 3OQ2A 1VQ5S 5CV6A 2EFPA 5LJ5Y 3X1LB 3QIAA 3LNNA 1BKBA 2F4IA 3E9HA 3C6UA 4KO0B 4CNYA 2NN6H 4Q45A 1JJHA 4U7UD 1N34F 3PNIA 4OI4A 4DV0F 1YJRA 3KJNB 3M2VB 3WDOA 4CDFC 5IYCH 3DC2A 3ENVA 3K80C 4Y34A 5HMZA 2MZQA 4H4MA 2V4RA 4P2CB 4JI0Q 2G9OA 5EWGA 4HT5A 1FTCA 2H3EB 4KPYA 1FRXA 2EJMA 2CNKB 2KEEA 2ADCA 2XN9C 2PDAA 1CULB 3IBWA 3UCZP 2B9YA 1H9KA 3M9NB 5DLFA 3W3SA 4GC7A 4OGQC 4LF6J 1C1BA 2BA1A 2Q8IB 5B08A 3HFZB 2UXBJ 3KFUA 1FWLA 2YPYA 5DRKA 2JVRA 4I2PB 3UR3C 4P75A 3NOGA 2NZCA 1U25A 5KG6A 1VRTB 3DDKA 1M90C 3WX8A 1UFWA 2DNMA 1CHQD 2OPPB 4HR7B 4JOIC 3ZNJ1 2K7JA 4LUOA 4IR9A 4FVMA 4FKYA 5CYMB 2QRRA 4V19X 1YNJC 4UW2A 2AJ4A 2OPRB 1KDNA 5D4NA 1FKPB 1AZPA 1NNXA 3OTOQ 2UXDQ 3RYLA 1A3VA 1OO9B 3DCAA 2WVFA 3GFZA 2JP1A 4JI2L 2YV5A 4DAMA 1MSWD 2L15A 1R0BG 2HVEA 1UPPA 1VCTA 2IT1A 4EGVA 1VQKA 3JC66 3VZIA 5EBDA 2FHMA 1U6ZA 2H5JB 2Z2MA 3D1HA 4DI6A 3K17A 2UU9Q 1MMDA 2IRUA 4X65J 4BWGB 2HIXA 4ZPVR 1TS2A 3DRSA 1O7LA 2GV1A 4JW0A 4DAPA 2H48B 3D6TB 1NPRA 1PAEX 3NGKA 2KCCA 3A8IE 2XY6A 3BN4A 3P4UB 4NMLA 1LXNA 3BDPA 1TWFH 4DL2A 4WP3A 4C6AA 2JE6I 1WC5A 3F8TA 2LA6A 3T6BA 2VQFL 4BDPA 2N88A 2EXZA 5C5LA 4UOCA 4X4SA 1SEBD 2HLUA 2HNDA 5F9LA 3M8QA 1SPBP 2O66A 3H4DA 3VWSA 3LUYA 3DMJA 2Q3PA 3KK2B 3OHXC 4CKCA 4G7HC 3Q23A 4JI0F 1CVJA 3CXCA 4DK6C 1B0TA 4WFYA 3DRYA 1VQKS 1VHFA 1X31C 2MZJA 5D0GA 1UA1A 1RBAA 4I1TA 2GMLA 5FIIA 3CJQA 4EQOA 2XNAC 4HI2A 3MXNA 1YNXA 1OJ4A 2B2TC 3ULJA 1ENAA 2HSEB 1CZGA 3O6QA 2EW9A 1RISA 4IFDH 1SBRA 1FNOA 3T53B 4PPDA 3KK3A 3F2CA 4QUFA 2EYLA 1R0CB 2E5IA 1CT1D 4DV4Q 1D8ZA 5JVG3 1V8QA 4HCEA 2G9DA 1UE1A 2SDFA 2UXBQ 2YVSA 4HL9A 2K28A 2XWJB 5GAGI 5IV4A 1HR0L 4XDDA 3A1YG 1X8DA 3MM7B 2E7VA 5IT0A 3WBZA 5KG4A 2GN5A 2Y0BB 3QIPB 3H6MA 1IL2A 2XTIA 1ROFA 1PRTF 3OTOF 4ZITA 2FY1A 3UD4P 1O78A 2JA8H 1I4HA 1QLNA 2RIJA 1OY8A 4PZ6A 4NASA 2MQLA 2VQEJ 4FYVB 2KTQA 3DLKB 2KYXA 1BLUA 5BN5A 4URGA 4X4QA 4P6QA 3G9CA 1RE1B 1XYIA 2UU9F 3FVQA 2GMJA 4JI5J 5IYBH 3E8OA 3IO1A 2VW9A 4BCAA 4N41A 3LPYA 3RAXA 1KHIA 1UWAA 2RKSA 2XI3A 1UEKA 4EU0A 1FD2A 1SIZA 4X65Q 2CJAA 1G8ZD 5EBCA 1Q86T 5M5WH 4OYZA 4KGKA 3FKIG 3F56A 4J9VA 4F36A 3G4SA 3W65A 1S6PB 2Q66A 1RSCA 2V0NA 1KQSR 2R8JA 4U6PA 3MAQA 3PRVA 2QC3A 2DJWA 2HQGA 5GAGU 1JMCA 1I50B 1LT3D 3B8HA 5ETQA 2QJ3A 3QJLA 4C3HH 3J80c 4DV5J 4OFZA 4RW6A 1NK9A 2BJ3A 2OF1A 1IKXB 1FKOA 1S6QB 4X3TA 1VQGA 3EROA 4PWWA 1IQZA 4E8UA 1ILPA 1S4FA 3M1VA 1OXVA 1HZ9A 1F60B 3U9OA 1V1QA 3H0GG 2SXLA 5LMNL 3VVUA 3TOQA 1FD7D 1VBYA 4C3JG 2A6MA 1A63A 5M9OA 1FXDA 4I7ZC 4LF4J 1DAXA 2EFVA 1TKZA 4DSFA 3H40A 1S9EA 3JTPA 1CSPA 1JOKA 1RAFB 4NPOA 1D7QA 4CHTB 1Q8LA 4WCEQ 4KJOA 4LF6F 4WKYA 1O7YA 3H94A 2RDIA 2UXBF 2XGQA 1ZYRC 2KBNA 3G4SS 3DNCA 2J7KA 1SRUA 4IJHA 4ECZA 2F4VJ 1HYSB 3M6UA 2HZVA 3MMJA 4HDGA 3RLOA 2MPUA 2B2UC 3V05A 2MHNA 4HJ7A 2ZZTA 3MECB 3DWPA 2OSRA 5GAGC 3I7FA 4YY3L 4K0KJ 1TIID 4EMDA 4ANDA 4NXNJ 2VICA 3PR4A 1SJ1A 1HHQA 4HTIA 1MWQA 3G48A 4OONA 3H4BA 1S0NA 3PUYA 3H15A 1QVGR 1GUTA 2MMYA 4M5DB 5HLFB 1WACA 4RBUA 3TVYA 3AOAA 1V5VA 2VFRA 2M2BA 5E41A 4QWDA 4DR6J 2EVBA 3MOZA 2VQEQ 1GJXA 1XJVA 2I0QA 4ECTA 1HTLD 2B8FA 3C2PA 2FXQA 2MHVA 3QBCA 3K2YA 2LKVA 4X65F 2V63A 4JI5Q 3GR1A 4IQZA 5CC4A 3PYDA 1R3NA 2CG8A 4HACA 4X2BA 3GTKB 1BCPF 1IYJB 3KOAA 2VD3A 4OV1A 1NO8A 4ZA1A 4KHPQ 4R4QA 3PX4A 3A8EA 1MROB 3I96A 4TQUS 3P75A 4LFAJ 4Q2MA 2QYGA 4N8NA 4QR1A 4QF4A 1SC4B 1DLOB 4IZ8A 5HQMA 5JVGQ 3TDQA 1RBLA 2D3O1 1ILQA 2C2MB 2QLWA 3CULA 4N9PA 1JT8A 3GJRB 1TS3A 4ZUJA 1WKJA 2NPFA 3GCXP 1M1HA 4DV5Q 2PNRC 3DM2B 4X64J 4Y2KA 1NJXA 1S3OA 3CJKB 4OMFG 3M8PA 5KFUA 1PC5A 4B9TA 4JG2A 5J2PB 5FJ4A 1RCOB 3D6HB 3NBPB 1JNRB 1RODA 1RAIB 3D3BJ 2BOPA 1ZM9A 2ZHAA 1Y1WH 1IR2A 2Y3YA 5D14A 4ZCMA 2UZAA 3KLIA 4UAIA 2R93H 4TY8B 4GN3B 2I9SA 3V81B 4N76A 4OWWB 4OO1H 4GVLA 3KLEA 3CQZH 2LVWA 3AU7A 1X5SA 4PG3A 5EWEA 3I73A 2JL9A 3GONA 1VS3A 4O23A 3BPDA 5LSOA 1STHA 3LA0A 1OSDA 2DNCA 1YX2A 4IOBA 2PMHA 4FXWA 2BE9B 2E2JH 2JEAI 3NLCA 2R7ZG 4MKBA 1WC3A 1H3DA 2KI2A 2KHDA 4K0KQ 2XIWA 2R7VA 4RGOS 3TSSA 2OSQA 4NXNQ 4AQYL 2ZJRA 3DU6A 5ISRA 2JA5G 3RAQA 4LBIA 2HS4A 2VQEF 5KFCA 1S10A 1WCMG 5HJXA 2IVMA 2DHHA 2VKZG 3IR7B 1IW7D 2VFUA 2WOMB 2FVSA 4JI5F 1VRUA 3NNAA 3CRKC 2R8IA 4IKAA 5KFRA 1RWOB 3T1YQ 1Y00A 1GT8A 3BS1A 3OR2B 1BOSA 2FJWA 4KHPF 3C15B 2C1EB 4KJIA 1OQ6A 3PV8A 1B8AA 3DMUA 2BMBA 1WI5A 5C2CA 4EBEA 1I6VC 2BBEA 2CNOB 1GEHA 2ZOMA 3TUPA 1J5OB 5ETOA 1ZA1B 4EWTA 3NP5A 4OEMB 4CH1A 3D0FA 3V6KA 1Y4ZB 3FRYA 4LFAQ 1S5FD 2HD3A 3HLUA 5E3CA 3AA8A 3S6EA 2HWTA 2E5LL 1HBUA 2ZKUA 4Y2MA 4H0LC 2AJ0A 1W26A 2CG4A 4DV5F 3ENQA 5BXIA 1C0UB 2YNGB 1TWGB 4HH0A 5K8NA 2XO7A 1L3SA 1JLGA 1NJIT 8RUCA 3ISZA 5L37A 3BH7B 1SC6A 2OHDA 1KEKA 3LF0A 4M8LA 3TI0A 3MCSA 1EZ6A 1K28A 4MNOA 3LGMA 3GV7B 3U58A 1QZGA 4OYBA 1HQMC 2LU1A 4F50A 1DOKA 4ZKCB 5K5MA 3PFEA 4EGLA 4C3JH 4CLFA 4DUYL 3OUYA 4V1Ak 3VR3A 4DU7A 3KHRA 3WWVA 3J7Z5 3GD7A 4Y2IA 4A3BB 3T1AA 1H7XA 5KFQA 3MGJA 1E2VA 2JQOA 3KDNA 2FZCB 5J2NB 5IYDH 2H4WB 1IUJA 4A3KH 4DNTB 2HFNA 3HD1A 3OJUA 3ZJYC 3Q8RB 4NXMJ 3LP1A 4KYZA 3ETMA 1PLFA 4K0KF 5I9OA 1QB5D 3Q8SB 4NXNF 3W2VB 1IKVA 4C8MA 1BQMB 2W7OA 4RU9A 3OSNA 1D1IA 5AFWA 5EGTA 3EBEA 3KG0A 2XLIA 3R97A 1CLFA 3PW7A 4ZKAA 3THTA 1FK9B 1XJWB 5HURA 4RUAA 3BV8A 5ELFA 4ZP9A 3BG3A 2DNKA 1RK8A 4KK7A 2NUUG 1SCJB 1N32L 1DQAA 4RHRA 4B3ML 4DR6F 1WVLA 3T1YF 5J22A 4X3SA 4R9WA 5C3EH 2F7VA 1AXQA 1Q86C 1U49A 5A2QU 2GCFA 1NK5A 2JDJA 4JI1J 4N7TA 1P16A 2K2PA 4NW2A 3S9WA 4HDHA 1WOPA 4ID5A 3DHQA 4ZVUB 4BS2A 1HHVA 1TVRB 4C0OC 3CCEA 2AMCB 3K57A 3JAML 1Y10A 1STBA 4LFAF 2NUHA 2X6GA 2P2CB 3TP8A 4UOFA 1XMOJ 2DGYA 6AT1B 1PRTC 4DV3J 3J80i 2O5IC 3MUTP 4DR1J 4WFBQ 2VG5A 4CJ0B 1PJ5A 1Z2LA 2I46A 1IKLA 5C24A 2AGQA 2MKCA 3TZUA 2QCPX 3I4LA 1RT2B 5EDWA 2DITA 1JQYD 4L5RC 1RB0A 4HSPA 2VZ9A 4WFAQ 3MOJB 4A3CG 4C0BA 4KGXB 4PZVA 2FMCA 4Y65A 2F0LA 4R4OA 2BEFA 3CIMA 3A0JA 3RNUA 2B9XA 2DR7A 1DTTB 3SFUA 5DM63 2H4YB 1Q8KA 4X6AH 2HNYB 4IO9A 4GNXC 3MF5A 3GLJA 5I2YA 3BGOP 3KLVA 1X3FA 1G6PA 2MZSA 2NYIA 4B3TL 4DL3A 2W24A 3IG1A 1RT1B 2XHWA 3CCSA 2R8HA 2F0UA 1TAUA 1WTRA 4WU2A 2ZH2A 3CCES 5F0WA 1F2ZA 4N8OA 2HWHA 4Q43A 2AF6A 4F2SA 1S1VB 1W7WA 4U8VA 2F3JA 4FNFA 5FO7B 3ZZTA 1HJPA 2ILZA 2EFQA 3KJVB 3EZOA 4APVA 1VLYA 2CPZA 4M5GA 1U0SA 3MR5A 3D4DA 4ED1A 2F0HA 5J1EA 1GD7A 2QFIA 1O7ZA 1MWZA 5ITHA 4DV7L 4OLPA 1HPZB 4OX9J 3IS9A 2YNIA 3ER0A 1K83B 1FRHA 1YITS 1F2GA 2AQ3B 1LABA 3ZTRA 1NSNS 4B3SJ 3ULPA 2R7ZH 1VQNA 2ZNYA 3HOWH 3NS6A 3RBZA 1P9YA 2HIQA 4PYAA 1Z2ZA 1RHPA 3N6LA 3SK6A 1K47A 2DCLA 5IGBA 1C2PA 1MU2A 4HEDA 3T51B 1IBMJ 1EOTA 4DX5A 1E6YB 5KNDA 2ZBQA 4PKDB 2CQAA 5C0XJ 4JBMA 1Q12A 1R8AA 2E29A 1BD6A 4RUBA 2XG8A 5CYUA 2DNGA 1FNMA 1FRMA 2ZJPQ 2MO1A 2YY3A 1S1UA 3GYGA 2W8LA 3NHHA 2KJXA 2OH2A 2XZTB 2HQIA 2VG6B 4X66Q 4GC6A 5M5WB 4ED3A 5KFFA 1Q79A 5KAKA 2Z4HA 2Z9HA 1XMOQ 3TAMA 5HO4A 1KC8T 3O13A 3DLJA 2M8DB 4TQSA 3S1TA 5C7PA 4UP7A 4J7CA 3ULHA 1ZETA 3MPYA 4DSKA 3K8VA 1UWVA 1VQNS 1O0PA 2HHHJ 3MEHA 2AWNA 1EJ7L 2WW8A 1F2YA 1M0SA 2L12A 1PJ7A 4JI7J 1BCPC 4YWMA 1MNEA 1PRTB 2B8PA 2HBRB 3Q0AA 4J15A 3PKMA 1RTJA 3BJYA 5DZ6A 1Q82T 1UL3A 1EQVA 4LFCL 5C42A 4R8UB 2KKHA 1ZZNA 3HK2A 2H4OA 4IG3A 3C66A 4CLLA 3BJUA 4RW4B 4USHA 3HKZB 4QUCA 3A7LA 4DL5A 3OYYA 2Z4IA 5IT9L 3QGGA 5A76A 4P10A 4A3FH 3M2UB 3K8AA 2E1MC 3DEOA 4NXMF 4GKJJ 4LSNA 1X9WA 1V3ZA 4GNXB 4I0WA 3T13A 2GAGC 1GUWA 2J0WA 2CPDA 4K6DA 3Q8QB 4LF8J 2M2LA 4DV6J 2V9KA 1W2BR 3V6JA 4QL5A 1B70B 2AZ1A 4OX9Q 5FOBB 4BWJA 3WC0A 3BYTB 2JA6G 4ES2A 4IPGA 1YIJA 1UA0A 5E33A 4DR2L 2VJVA 1PTOH 2RE1A 4NLUA 1K8AT 1XIQA 4RGNA 4K8IA 2BR0A 5BYSA 4MIWA 4JI1F 3HOXB 4TY9A 3BDEA 2BV3A 3SXHA 5U47A 4RUCA 1JJ4A 1IBMQ 2IFXA 1FXRA 4F3QA 1X9SA 4IURA 3CKIB 4OYMA 4UY8T 4HLBA 4HYKA 5J2QB 5B0CA 3DHXA 2DCUB 4ELTA 4R4CA 2DBBA 2AYMA 3R3OA 3QFWA 3DLBA 3CAMA 1XMOF 1IKWA 1VRQC 4BA1I 2EYFA 2F0NA 5A8WB 3PJ9A 3M85A 4XT1B 4KBIA 3CJTA 1JLCB 1GX5A 2EG1A 3OOCA 1GMWD 3HZXA 3QRQA 1YIJS 2RNEA 3D0GE 3JQJA 1T0TV 2EYHA 3ISND 2I6WA 2HHHQ 2A68C 2FHJA 4DLGA 1OIAA 4ECYA 1SROA 4R25A 2EK1A 2BCOA 1GHJA 1G6ZA 2XLKA 3D7SB 1PV4A 2K3KA 5BJRA 4JI7Q 3CJ0A 2NYHA 4LF9L 4A4JA 4Z9CB 4OZJA 3FZBA 3CD6A 4JV5Q 2BKOA 5E1FA 2RQXA 1O51A 4W4MA 5D78A 4C11B 5LMUL 3OR1B 3TJ8A 1I1GA 2R93B 2G2ZA 3VYRA 3UDVA 1HWUA 2BRKA 2HYIB 4NPSA 4K6LA 2VF3A 1RWWB 1U2RA 4NZ7A 1ZH5A 1G91A 2WONA 4B02A 2I5LX 3PQIA 1BCPB 1QE1B 4KC5A 2KG1A 1VMCA 1FRKA 5HROB 3PIPA 3QGPA 4JI6Q</