4ZCKA

Crystal structure of c-terminal fragment of escherichia coli bipa/typa
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
299
Chain Sequence
GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gtp-binding protein
molecule keywords GTP-binding protein TypA/BipA
total genus 90
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 4zckA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zckA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 4zckA01
4QR1A 2I8EA 2NPFA 2YWHA 4ZCKA 1WDTA 2YWGA 3EXCX 2I0XA 3B8HA 2BM0A 1T95A 1N0UA 4TNOA 4ES3A 2J7KA 2ZITA 1DARA 4ZCMA 2BV3A 2XEXA 4FN5A 3B78A 4MAKA 1ZM9A 1KTVA 2BM1A 4MYTA 4ES2A 4ZCLA 1ELOA 1U2RA 1ZPWX 4QR2A 3OQ2A 2DY1A 1N0VC 1P9QC 3UI3A 2YWEA 3E3XA 2CVEA 3B82A 4MYUA 1ZM3A 1VI7A 3CB4A 2E1RA 1ZM4A 4ES1A 4QR0A 3ZZTA 1ZM2A 4ZCIA 2KDOA 5G4DA 3ZZUA 2EFGA 2YWFA 2L9NA 2IVYA 2WBMA 3ZZ0A 4M1KA 3LH2S 1FNMA
chains in the Genus database with same CATH superfamily
5J1ZA 2IM3A 3CC7S 1VJQA 3A7LA 1LWFB 2XCAA 4DAMA 1IR2A 3VGSA 4S3SA 3HOWH 4LR7A 4LFAQ 4ZUIA 3MMJA 2XZTB 4X62Q 1VQPS 5LMUL 1Y4ZB 3B4DA 3NAHA 1GOZA 4DKAC 5IGCA 4LQ9A 3DLLQ 3SR1A 2JA7G 4X64F 2MO0A 3KHRA 2LU1A 3KMSA 1FR3A 4RW6B 2V68A 4IFDH 1K0SA 3OPOA 4LF5L 3AD9C 3THVA 1IZ6A 1HQMC 2F3IA 4F26A 2RUSA 1CM9A 2WSFC 1QVGA 4OX9L 3FZ2A 4AXIA 2QSFA 2QEXS 2AYBA 2P8IA 2JC0A 5FJ4A 3O3LA 3J7YW 1ONLA 4JUZA 2AJ1A 3I4HX 4WU2A 1WJ9A 3AD8C 4N8FA 3HOXB 1XNQL 1FD8A 2Z2LA 2RU9A 4DV7J 2ZE2B 1IJFB 4U7CA 4KRWA 3UQSA 2HIYA 2GIRA 2IX1A 2XYHB 3FC9A 2ZOMA 3MPDA 1ZA1B 5LJ5Y 2FMMA 4RA8A 3BQ1A 3NEMA 2A6ED 4C6AA 1J5EL 3AXKA 4CO5A 4NXMJ 3OFGA 1GXLA 3FCVA 1UVNA 1SYGA 2DJGC 2IBKA 2A2DA 3TJ9A 3RZDH 2FJEB 3CD7A 4RAUC 1E22A 7FD1A 2CQPA 3DYAA 2F5GA 4DMZA 3URYA 1T9WA 4CIOA 4DCPB 1HL6A 1JOKA 3TOQA 2K5VA 5JVGQ 5CORA 1EIGA 3D66A 3DXJC 3GTQB 1I4XA 2L9WA 1DQAA 1MGSA 3G8TA 2H5IB 4DU7A 5HSPA 4YR2A 5LMNL 2JLFA 3PRDA 2RU3A 4K2JA 5F3ZA 1DGSA 4LSNA 3RZAA 2EFOA 2ASLA 2HNYA 5L1KA 3R93A 5KFMA 4X4SA 3CCRA 3L7ZC 1SMXA 4QF4A 1I50B 5I9PA 2JA8B 5HN0A 4RGTA 3KK1A 4DK1A 2PW5A 3CJ0A 2C3YA 2SNMA 1NB7A 2W4CA 5JOBA 2J7UA 4F8MA 1V1PB 3C15B 4U7UK 4KAIA 3VDYA 3H94A 2XIWA 1OTCA 3GB0A 2K03A 1EZ8A 4BY1G 1MN9A 1VRQC 2Y1LB 2J9DA 2N8NA 3V4MA 4A8YA 2J0SD 2JC1A 2EPBA 4FBTA 2B9WA 3ILJA 2LFNA 1N48A 1WC6A 2JHEA 4PZ8A 4C0HA 3OJSA 3QSIA 5EHHA 3GO5A 5T1GA 4RUBA 3ND8A 4OYMA 1IBKJ 3RJMB 2Q3PA 1O7ZA 5L37A 4ZS6A 2ZDOA 1ESFA 5BJRA 3BKFA 2PCFB 4IO9A 3OOCA 1MG7A 1PIEA 4EWTA 2HFSA 2GVDA 3HOUH 4DV1L 3IRBA 4QUFA 1H0HB 1AROP 1SYFA 2H5JB 3WX8A 3UNYA 3IAYA 3NNCA 3IGNA 2LKVA 2XLJA 1NRKA 4NXMQ 4OO1I 5E3PA 2QLFB 4BWJA 4UZBA 4B9MA 1PKUA 2BDNA 4ZVRB 3SQGA 3NWGA 2V4QA 1F9SA 2A1BA 3CRLC 5M5XB 1IR0A 3MXNB 3AU7A 1XMOL 1WTXA 2P5VA 4LUOA 1DOLA 1JT8A 2DR9A 4Y2IA 4IPCA 2RDFA 1V9PA 2YNIB 1GMUA 4ECSA 4YCVA 2JRSA 3BQ2A 3SI8A 3AMUA 4FP5D 3BH7B 5I3UB 4AIMA 4J9VA 5ETRA 2ADBA 4RKUC 1S1TB 1QNKA 3AB2B 2DNCA 4CDDC 2XYGB 2MNAA 3U58A 1HBNA 5EGTA 2M88A 4F7XA 3K2YA 4DU9A 3SMZA 2UUBL 5I42B 2M52A 1X4BA 1BR9A 2E9TA 4B3SF 3S1RH 5BR8L 2OPQB 3MECA 3M30A 1MW7A 5DG7A 3NELA 3I5AA 2VC1A 1XJVA 1YJRA 4NCGB 1SKWA 2XCPA 5DRKA 1RT7B 1WUUA 2KJWA 3I55S 2BJ1A 2GC8A 5DG9A 4WORA 1ZS6A 3M2RB 5LMUF 4FVCA 5CD4A 3DU6A 5LSRA 2DNQA 1KD1T 1J6QA 4DXGA 1S4ZA 2AX0A 3OIQA 5C3EH 1FWLA 2YKNA 2ZVIA 1RCXB 1Y5NB 4ZJQA 2PZWA 2ZKUA 4QWCA 1QM9A 1K0RA 4KH1B 2MMYA 3V96A 5KFHA 4J91A 3OVSA 2NZCA 3MD3A 3IFEA 4NEZA 1LK7A 3OWFA 5EAYA 3AFQA 2Z2ZA 4LF6J 1UFKA 4JI3F 3HOXG 4RKBA 3L4BC 4KGZB 2QDBA 1CQNA 4UY85 3S14B 4L73A 1IKLA 4Y7NH 3FQLA 3ET6A 2HVDA 3QIPA 4KD3A 1PH1A 2YKPA 2DNGA 4IALA 4ZCIA 1U45A 1JXVA 1AFPA 1Y3JA 2YNIA 3VVTA 2KHIA 2BANA 4PXCA 1V8QA 3JSMA 2ZEJA 3HFKA 4M5NA 4RL1A 4CLSA 4FN5A 4TYAA 4XDXA 1BXNA 4GC7A 4LF4Q 3CPWR 4P7VA 3NG8A 3LGMA 3H0PA 4IDKA 4I0WA 2VV5A 4BBSH 1KVIA 1SXTA 2YNHA 1JLAA 3P49B 4QIWD 1JWWA 3R5DA 4JYAL 3LP2A 1TR5A 2DIVA 2JK8A 3MR7A 2XNAC 4Q44A 2HDLA 2VBXA 1CS4A 1HMVB 5E7OB 3WIUA 3FEZA 3U50C 2YTXA 3I0RA 1ROFA 2L9NA 4M1KA 3HHLB 1G6ZA 1QJHA 5IIFA 1WEYA 4C3JB 3M2UA 4QU7A 1JQYD 3AAWB 3HSZA 1TS2A 2VONA 4KGKA 2J76E 2R7VA 3UDXA 4DV6F 1TL5A 3KLVA 2YH0A 2V2QA 1V3RA 4BY7B 2RCNA 5KFTA 2B6AA 3HEJA 3TO8A 5CHCB 1SLJA 2KECA 2GCFA 1I3QH 2KRRA 4QMGA 4G7HC 1UEUA 4IJHA 1NK4A 1TV6B 5KFWA 4JI4L 4OFZA 3T1YL 5KFXA 3ZNJ1 1U0HA 4X66Q 3MFYA 3WHIA 3P75A 1NK5A 3Q8SB 1E6VB 3MOJB 1WYDA 1T9UA 3W62A 1BE4A 3O13A 1VRTA 2CPYA 4B08A 3MR2A 2Y8YA 2XNQA 4JI2L 1WELA 4ZP7A 2G0CA 3T19A 1GAOA 1L1OA 5JVH3 4TKOB 4A3MG 5ETSA 4ZKBB 5C25A 5DQHA 4BBRB 5DGAA 2D62A 2F0HA 1VLOA 1F9PA 1CZGA 4ZMMA 1SRUA 2GAHC 2EBEA 2JA6B 5E3AA 2E8GA 2GHPA 2VQFQ 3AA8A 5AT1B 3HO1A 1VRUB 3TBIB 3RBZA 3QGHA 5KT7A 3OTOJ 4KO0A 4NLOA 5E7NA 3R5JB 2FJBB 3HX9A 3OD2A 1YJNA 2JA7H 3DLKA 1WC1A 5IOCA 4XK8C 4JYAJ 2F4VL 3WX4A 2R3VA 2E2DC 4KY6A 1ZKOA 1CJTB 4Y3CA 5IYDG 2YX4A 4LBIA 3N5FA 3FVYA 2Z2MA 1N5SA 2ATLA 1QSSA 2JFKA 1VQ6S 4A93G 3GONA 1UMJA 3FEYB 2FJWA 3FEXB 2R93G 1BUXA 3G71A 2VQFJ 1DYQA 3KLSA 3FSIA 4TQRA 1Y8NB 2QFJA 4F04B 3PDNA 2VFUA 5JJZA 1N32F 1HQEA 4GMKA 3E5SA 1X7VA 3QJLA 1SE4A 4P2CB 3K59A 4E0DA 4KN4C 4A8KA 1SC4B 5HROA 4ZDNA 1D9AA 2WFWA 1HNZJ 2BE7D 1S76D 4PRFA 4ID5B 4NLQA 4FO2A 5M5WH 2B2YA 2BV3A 4DR4J 1CULB 4UW2A 2XLIA 1RHMB 5U47A 3S7RA 1YJ7A 4NLSA 4L3NA 1QUQB 3R1LA 2HRUA 3BB5A 4DR6Q 1JLCB 3C19A 1NLKL 1BQMA 1QAIA 2I0XA 2CJBA 1CKNB 5D4LA 1XNRJ 3OSNA 1SNCA 1LW0A 3BR9A 3GP9A 4N8OA 2GVDB 1F9EB 3VGVA 3ELHA 1F2YA 3CCJA 2E7XA 4IO1A 5AFWA 4ED3A 2GZOA 4CH1A 1L1OC 1QCBD 4ZN3A 3KBXA 3J81L 4ZLNA 1D8YA 5HMZA 5KYLA 4YB7A 1XNQJ 2AUKA 4M5IA 3P5TL 2JLGA 1Q78A 1VR6A 3P45B 1T94A 1UFWA 4BBRG 3IGVA 3C1EA 3QRQA 1KAAA 3CD6A 4IG0A 2UP1A 4OJ3A 1IW7D 3F41A 2B8PA 3T1HQ 1LYLA 4LFCQ 2M9VA 3CDWA 2E1MC 3G6XA 1IJEB 4J5OA 3W3AA 1ICFB 1RXOB 4BCAA 3GIIA 4OWWB 4GN3B 1K8OA 3HHLD 2VUMG 3ZO7A 2XN9C 2F3JA 2LQBA 1KQFB 4A3LG 3V81A 1WTHA 3GD7A 2M4MA 4DR2F 3GTOB 2KM8C 4DQPA 2J9DE 1TIID 4LJZC 2XULA 2JJ4D 3G9CA 2R93B 2LVWA 1N33J 1LABA 3FKIB 4NZ0A 3V4IB 1IW7C 2ZBRA 4DLGA 4DSEA 2EQSA 3IRWP 3PIOA 1OQ3A 4DQRA 1T95A 2J7ZA 5IWAF 2OTJA 3G87A 2PQEA 4UAIA 1YBYA 1H2UX 2Z30B 1Y1VH 4H13C 3FGVA 3PHEA 2QMXA 3LGHA 1KLMB 1IM4A 5DETA 4N56A 2GAGC 3GDEA 5C3XA 4DQQA 4JV5L 1FK9B 5HJYA 1ET9A 3BBBA 3BYYB 2BOPA 3P4UB 1IVZA 3AOCA 1ZYRD 5DAUA 1KABA 1ZZFA 3PM9A 2V4JB 4IG3A 4CJ2C 1TY0A 3UO0A 1LLRD 3P6YC 1PXUA 2FJDB 3R8YA 1XMQL 4CTAB 3M9MB 1I1GA 1YJ9S 1C4CA 4JI2F 2MKIA 3A54A 4APVA 1QAXA 4YY3J 5BN3A 3BVGA 3OSOA 2CUYA 1NUEA 1RWKB 2CQDA 2QA4S 2UUWA 4AFFA 5IP7G 4A3KH 4OZ1A 4HTIA 4BBYA 1VBXA 1HIYA 3IRXA 4A3EB 2P2CB 4CNZA 4ED2A 4ZP8A 2MQOA 1M5VC 1UAWA 4LIRA 1N34J 2GS8A 4HTJA 5T7LA 4USUA 2IC3A 2L55A 1E24A 1IQZA 5KG6A 3K8VA 3GTPH 2AJ0A 3VYUA 3AA9A 3BQ0A 2UXBF 2HVHA 2C2EA 3QGIA 4JK1C 2DGSA 4IUUA 4C8YA 1AFJA 2J4XA 4NEYA 1TFYA 4OX9Q 1EUJA 4B3SQ 1X0PA 5H1SE 1IQTA 3OIPA 2CDRB 1B44D 5F9LA 1LT6D 4ZIWA 3BS1A 1IXKA 3U1MA 3U1NA 4LRAA 2AEFA 3SQGB 2EY1A 5DQIA 3CJTA 1FKAF 3D1HA 3GR1A 4BWGB 2UXBL 1BO0A 3J7AN 3IAM9 2N78A 4YP3A 2IRUA 4DAVA 4GLVB 2V4DA 3TX8A 1HNIA 4DV0Q 4WFYA 1SKUB 2IAJB 3QT6A 1Q0NA 2YTCA 4LSLA 1JB3A 4F3MA 1SC1B 4QU6A 2H4YB 5M3MH 4ICLA 5F8JA 4XQJA 1UJ4A 2L48A 4YR0A 1T7PA 1Q90A 3CC2A 2JFDA 1LKZA 2UVRA 1S97A 2NVQH 3CD6S 3T9ZA 4NXNQ 2OMOA 1VRUA 2DNRA 1RT5A 2JA5G 5D6GA 2YV5A 4Z7YA 1JLFA 2HIQA 3FRPB 1Y1WG 2ACYA 4HJ9A 3RRKA 4M95A 4FVMA 3ZZOA 1E1OA 2E1CA 4IR1A 4WK1A 3VTIA 5IP9H 3ND9A 2CKWA 3M8PB 4FXDA 3H40A 1T05A 2WB4A 3DWQA 1TL1B 3NWSA 3PO2H 3PYFA 1F5CA 5A2QU 1Q8LA 2O66A 1R8CA 1A62A 4F4WA 1PMRA 3SDEB 1YZ6A 1XPRA 2MDAA 3DM1A 3AB4B 1S48A 1QE1B 4M5KA 4I56A 1DONA 3CQZH 3GFZA 4J9SA 5EN1A 2AQ4A 3TVKA 1Q1BA 2G1HA 3HF5A 4YDDB 4JBJA 3HCXA 1TKXA 2JEAI 4X4QA 2M5YA 2HVEA 2I8EA 1J2VA 2SXLA 4KPCA 1WTOA 2Z6KC 4DV7F 2FHOB 3CDUA 1PFNA 4U673 2PA3A 2PFFB 4TVAB 3M6UA 4DR3F 3RZOB 5GADU 3A3PB 2BOSA 2XY6A 4QPXA 2A3JA 3SCKE 2GO8A 2HNZA 1H9RA 3MM6B 4OO1G 3KK2B 1RTJA 5HBMA 1QZHA 2CFXA 2R2RA 2QLJB 4DV3J 4NW2A 3CE8A 2K5NA 5F0WA 5EKIA 3EGVA 5K8PA 1U0SA 3QPIA 2FHTA 1HBNB 1STAA 4KV8B 4F0HA 3QWNA 3UNGC 3TJAA 4OJ1A 1N4LA 3MM9A 2XMTA 3N4WA 1E6YB 1MBYA 1PFSA 4DQIA 3CCWA 2KXNB 3IR7B 2JEIA 4AL6A 5KEEA 4O0AA 3TZZA 4GNXB 4MZ9A 1PJ6A 4ZVTB 2F0TA 2IVFB 1B9MA 3OR2B 3H09A 4WK3A 1U4RA 3FUYA 4OLOA 2CPEA 2NR0A 4QIWB 3DRYA 2MPMA 2KJXA 2NVQB 4CGYB 1U1LA 1TAUA 3TSSA 1ZA2B 3RB0A 2F0QA 4KD4A 4R5PB 4A75A 1LT3D 2EZVA 1DOKA 1M90T 3LOUA 3IG1B 1G91A 4QCLA 1BCPC 1XJWB 3SSRA 3C6TA 1WG1A 2NZ4A 3QO2A 5IP9G 3VR1A 4LF1A 4AL7A 1TQOA 4CM0A 2BH8A 2CQIA 2HRTA 2F0VA 4EMDA 3F8TA 1NJIT 3V4IA 2IJ0A 2RD5C 1JX4A 1FERA 3KUGA 4H4KC 5H9FJ 4LF7Q 5C6AA 4X65L 1I94Q 3TQYA 5HLFB 1LXJA 3M8ZA 5T14A 4A3DB 1EY6A 1RKIA 3RUBL 3POTB 4ZLPA 5ETNA 4I1TA 3CNQP 3C6UA 2KCCA 4N76A 4RBVA 4L5SA 2VD3A 1GT8A 2KU7A 3CPWA 1B0TA 4JC0A 4NMXA 2N4CA 3HSGA 4AQYJ 2EFGA 2BKNA 5K5MA 4YCWA 4KV8A 4ECXA 2NVTH 1MROB 4OX9F 1C0TB 1REGX 4ICLB 3I87A 2Q2HA 1YI2A 1HA1A 3VYRA 4DN0A 1FNOA 1N8RC 3HVWA 2OFHX 2OPPA 1B0VA 3CWJA 1G291 4CKCA 2Y0SD 5CV8A 1SJFA 3NXWA 4H7BA 2QDLA 2OGUA 4F2RA 3EIVA 2QIFA 5L46A 2FD2A 2GMJA 1PYWD 1WD1A 2XLKA 2KFZA 2M3DA 4ED6A 1ZTTA 1GHJA 3A3OB 1RGVA 4NXMF 2J8SA 1KFSA 2W24A 1CULA 1YKWA 5KNBA 4ETXA 4CH7A 4Q8FA 4HR2A 4O3RA 4PNYA 5CGKA 1J9OA 3PYEA 8RUCA 1M8AA 2NTTA 1CJVA 2HS3A 1QE1A 4QWAA 4TLRA 4ES3A 5GAGI 4DXFA 1RTZA 2KHCA 4GZYC 3ENQA 3OFHA 1I94F 1EEFD 1VRTB 3MD1A 5IGEA 1ICEB 5JJKA 3LWUA 5D3GB 2VFTA 1ML0D 1RT6A 5FLXY 1G51A 2KCNA 4LF9Q 1VDHA 1HFEL 2CXEA 1KNAA 2E1PA 2QMUB 3M2UB 3G2XA 1HCZA 4K5VA 4QYRA 3PIPA 5EWFA 4DR2J 4KY5A 4X64J 1NPPA 1NK7A 2E2HH 4V1Ak 5K36G 3J7ZC 4LF5J 3AYHB 3MPUB 4DPWA 1YJUA 2ENBA 4DCOB 2G0JA 2UV8G 3C66A 2NXNA 2DGVA 4M5GA 2MZQA 3MECB 1WF2A 2Y1IA 2B2WC 2AZ1A 4O3SA 4K4YA 5KFAA 4PG5A 2KT5A 4I6YA 3Q89A 4AQYL 3V6JA 1BOSA 1DTTB 2HQLA 2CQ1A 2JEBI 2Z8LA 3BF4A 5CV4A 4UQGA 2ZNYA 2AJFE 5E4XA 3BDPA 5DO2A 2NVYB 4ZCLA 4KY7A 4A3MH 2K14A 1J5EJ 3GG0A 2P6SA 3DRSA 1KFDA 2MSSA 1TUWA 3Q8VA 2UV8A 2GA7A 5C44H 4RZRA 5G0RB 1YTYA 4HDGA 1TL7A 4DAYA 3L09A 2WB1E 3LF0A 1UEVA 2UU9Q 5HP1A 1VK3A 2WHOA 4RCNA 1TWAH 5C44B 1HFNA 1Y0HA 2LXUA 3RN2A 4A3BB 1D9FA 3AXMA 3ZZTA 4K4XA 2M8HA 1YJVA 2NVTB 3CMAS 4GC6A 4LF6L 5KFEA 1VQEA 2QILA 4A3JG 2WZ1A 5HL7Q 2B4OA 3LW5C 2W7AA 1H38A 4PMCA 2FB0A 4YQWA 4WYWA 3K5NA 2HUGA 4KT0C 3V6HA 1TU2B 2DRDA 4P74A 3ETMA 5K9FA 2X6GA 1WORA 1VOMA 4CDFC 1Q82C 2N82B 1RL2A 3OHAA 3AQQA 1NBWA 1GUGA 2BA0A 1PRTC 2R7RA 1BQXA 4B9XA 1FESA 4C3MA 3S01A 3Q8DA 5EBCA 1F2LA 4H4KA 2DY8A 2UUAF 3U9SA 1ZYRC 2WOMA 3OL8A 3W61A 5IE8A 5F9NA 3D68A 1PC4A 4A3FG 3B82A 3M8QA 1T03B 1Q5YA 3THTA 3KLEA 3QOLA 4PYAA 3BEGB 2DKOB 2XYPB 2DNMA 1FJCA 1PH6A 3OTOF 1REVB 1E2WA 2XI2A 4DAYB 2UVUA 2MJUA 2CIMA 4F67A 2K6AA 1HH2P 2R92H 4OYOA 2EXUA 1D7QA 5IWAJ 1JJ2A 1BCPB 3M4XA 4GKKJ 3NOGA 1V6HA 5COYA 2HFZA 2V9KA 1TK8A 2CJ9A 3VAGA 5JPMC 4X64Q 5CXTA 4RW4B 5HK4A 3OSPA 4TLQA 2JSOA 1UEKA 4UOGA 2NVXB 2HPUA 2SEBD 2F63A 2HNDB 4CLUA 1RT4B 3ISNC 2QFIA 3ENAA 3O6QA 3GTLH 1KD1C 3AH6A 4NXNF 1G7CB 2K5DA 4DV3Q 3H5XA 2F0UA 1ZETA 2QE5A 2VIHA 4QW9A 9RUBA 1X0FA 3H20A 4ANCA 2WRMA 1GVPA 5DDRC 3SSSA 1UWVA 2PI2E 1FYCA 3UE1A 3TAMB 3GIMA 3MAHA 5CC4A 1MMDA 1KC8C 4DWIA 1HR0J 2LQ5A 3JQJA 3LP0B 4LAAA 1EY7A 1ZTWA 3H8YA 3PX6A 5GQOA 1TU0B 4WCEQ 1VQNS 1WC4A 2MGSA 3I90A 4DA2A 3A55A 2VBZA 2VG7B 1PYSB 2YNFB 5DDQC 2H3EB 3HKWA 3Q86A 1GTHA 4X84A 2QTWA 3EUNA 1UPPA 1RAFB 1XMQQ 3LAKA 4JV2A 3J7Z5 2ZH1A 2ADCA 4ABNA 4C3HG 1L0YB 2A6HC 2NBFA 3KF6A 1STHA 3KDFA 4XTCS 4IQZA 4RBTA 1TUGB 5LXRA 3DI6A 1C0TA 1ZYQA 2Y1RI 4KKOA 1TKZB 4KY3A 3BO4A 1KP6A 2LFVA 1RJTA 1S10A 3A8IE 2GMLA 4NLUA 4TYBA 2LY7A 1HBOB 5EJWA 4UQTA 3RD4A 4LF8F 1U2RA 3KMQA 2RJZA 4B3MJ 5KNDA 3KLGB 4ZAIA 3ZTSA 1N32L 2Q2TA 1S72A 3HOZG 3SV4A 2HHTA 2RILA 1UL3A 4JOIA 1K83B 4KJNA 4B3RL 2DNKA 3RAMA 2HWIA 3VAKA 1V5VA 1HNZQ 4Q7AA 4JI5Q 5M5YH 5J1PA 1F2MA 3TAMA 1KQKA 3NL0A 4X66J 4ZVGA 4P75A 1BLUA 1GMWD 2QEXA 2DB1A 3DDKA 2VZAA 2AP6A 5DDOC 1TWFH 2XRQD 2QO3A 4NLYA 2KQ3A 2W9AA 4OHWA 4FXKC 1HW8A 3W2WA 1OY9A 4CI0B 1IXRA 2ZC4A 2ZOFA 1CA5A 5JUMA 5G3LF 3N9UC 4DS5A 4B3SL 2V8PA 4J8QA 4PUOA 4UDUC 2CQOA 2UU9F 1JLBA 4E98A 2E66A 1OWXA 4HKQA 4WKRA 4ZN1A 1UVMA 2J6SA 2FVRA 5A0YB 2ILZA 3E9IA 1X3PA 5IM0A 4HHJA 3CO0P 1DHMA 3E3XA 2VBWA 5ETQA 1LTBD 3H2UB 3LP2B 3W5OA 2YNGB 3Q22A 1YK9A 3C8YA 5HO4A 1DTQA 3GTPB 4K4ZA 3GU0A 2Y9HA 2DNLA 1FDDA 1SBRA 3PR5B 2JX2A 3DM2A 4H54A 2DHXA 3CCUA 1P1LA 1X9NA 4U8YA 3QLHB 4M5LA 1HNIB 4JI6J 2Z4HA 1EWCA 3I82A 3DXBA 1BVSA 5KFLA 2DHGA 5C0XJ 4FZVA 4TU9A 3T1AA 2PQAB 3QJJA 4RUCA 1HWUA 4JI1Q 1DURA 2K3IA 3MHBA 1TZ0A 4HVZA 5ELNA 1R43A 3MEGB 2CQGA 2FJAB 3OXGA 2DGUA 3HOZH 1PZJD 3FP9A 2J7WA 4AT1B 4DV6J 3TVYA 2MEWA 3MGJA 4FF1A 2VC0A 2E2JH 2E9ZA 2CNKB 4RCOA 3T6JA 2DH7A 4F7VA 2BCOA 5I2YA 2D74B 4ZJOA 4QGUA 1XTDA 3R2TA 8AT1B 1N36L 4DSKA 2NVXH 1B50A 3H3VH 2IPOB 5HVGA 2YKMA 4IFDG 2IM2A 3PCOB 5I42A 3V5RA 2UXCJ 4EYIB 1A0OB 2VG6A 3AODA 1RAEB 2EVBA 1KDBA 3FSXA 3AD7C 2B63G 2KL8A 1A3TA 3C1FA 1SJ1A 1APSA 1JE5A 4RFBA 3T1YQ 4RJVA 1VQDA 4DV3F 2Q79A 2WVFA 3CXCR 2A18A 1WVLA 2DNEA 2ASBA 3I4NB 4F2SA 2LQ8A 4GNXC 1TTHB 2BE2B 1W6JA 3KLIA 5JVHQ 3NGDA 2XSJB 1X3FA 1ZAWA 3G96A 1R7IA 4DR3J 4X3KA 4DSIA 2YKNB 3P3DA 3GYGA 1NMGA 5A2QY 5A8KB 2OLWA 5KGUA 3MEGA 5HURA 4C8KA 2OPRB 1U1OA 2WVEA 1MU2A 2MSTA 5HQLA 3KBGA 5I6WA 1JJ4A 4A8SA 2BE5D 5CBEE 2K7JA 3DRRA 3T5JA 1HNWF 3FHWA 4M63A 5CYJA 4N47A 5FLMH 4HL9A 2Y0BB 2C42A 2PI5A 2RA4A 1KS2A 3M1VB 2VB2X 2BMBA 4I64A 2IA6A 3JSYA 3QB3A 3JB9k 3JYTA 3CU7A 3H6MA 1A63A 1ILPA 5FLXU 3W2VA 3CO9A 2AJ4A 4OX6A 5FO7B 3J81j 1JXEA 5KG3A 1AH9A 2MJ8A 5EUHA 3EZ5A 1EP4B 3PUWA 2CPZA 3PMFA 4H4OB 2A74C 4CO1A 4DPYA 2G0IA 4ODGA 2L0CA 5L1LA 4LRCA 3BO3A 1AEXA 1WWHA 4UOHA 1B53A 1F0XA 3MPWA 2A6OA 1S77D 4K50A 4RW8B 2MFIA 1B99A 4RHSA 3KK3A 2APOA 3HFVA 1DTTA 3FDSA 4A3FH 2NSBA 2PMHA 4NRTA 3MAQA 3F73A 3HJVA 4JBCA 2NVYH 1NHUA 4I65A 1RTNA 1TFWA 2E74C 2D1CA 3S1QB 1NTGA 1X5OA 4DPGA 3E8OA 2CPHA 2O01C 2AD9A 4JCVE 3CJ4A 2IBOA 2K8GA 3TQEA 5JJLA 1M5PC 4ELVA 2R7XA 3PG9A 4KR0B 2UXCF 2BACA 2PMWA 4KHVA 2DHAA 1PA6A 5KG1A 4AE5A 2Z6KA 2J5AA 3EQLC 1ASZA 2EC2A 1YBAA 4F50A 2Z58B 5LMUQ 1RWWB 2CNLB 5E3QA 4DSFA 3BPSP 2KG1A 3HHNB 5J3BA 4A8MP 2FHMA 3DYAB 1M1KT 4QZVB 2G2OA 4FDBA 3IFTA 2EYFA 1NXIA 3CCMS 3RB3A 4PEOA 1PH4A 2IWHA 2A10A 2PQAA 1FGBD 1S0MA 3X3NA 3NRBA 4DR7L 2FY1A 2KVIA 3N6MA 1RTOA 1SE8A 2IHFA 1WOPA 2GVZB 3NOCA 2BW2A 3BYTB 3NGUA 5KFSA 4R25A 2FLOA 3GJTB 2F4IA 4K8JA 2AWOA 3C14B 3NTIA 4DR5J 2J6TA 5D3GA 3IN5A 3J81i 3CC4S 3H0GH 2B7BB 2BJDA 4MK8A 3KF8A 2CFMA 2PI2A 1B0PA 3CJKB 3MR3A 3GJQB 1IBLL 1LV5A 3RRHA 2AKWB 2M7SA 3MM9B 3OPKA 4OI6A 1YITS 2XY5A 1C1CB 2K4KA 4BA1I 4ID8A 1U1RA 4YB6A 4CO2A 1IL2A 2D9PA 1R0BG 2DN8A 5KFIA 2AEJA 2R8HA 1WF0A 1YNXA 5LL6S 5IT9U 5EKKA 3TZXA 2MQPA 2QL7B 1EYGA 2Z4PA 5D0HA 3Q8PB 3OW2R 1EYCA 1S12A 4K59A 1RT3B 3CP0A 3DDIA 4LSZB 3NBIA 3LAMA 4UOFA 3C46A 2BM0A 5J1EB 1AA1B 1RU2A 4URSA 4RNFA 4V19X 2H4OA 3G86A 1HYSB 4V0BA 2MJNA 3EVMA 4AUKA 2FJ2A 4EZ6A 1PH7A 1MNEA 4ZOSA 4UTGA 4R8NA 3G6YA 4UHVA 4B3TL 1Q8KA 4X66F 2R2TA 3HKSA 2PI4A 1LW0B 1MN7A 1D3WA 3MM7A 3TP8A 4HHHA 2HRYA 2UXDL 2HS0A 1F2HA 1RAIB 2HT1A 3IWXA 3IA0A 2C2RA 2DNYA 1O5JA 1RADB 4RUHA 2K1RA 4GN4B 4BBSB 1RD9D 2AJ2A 3OLBA 5LHY1 2IJFA 1I4RA 3NK9A 4OI2A 3A8EA 2NYIA 3KKFA 3AOBA 3SXLA 4GN5A 3WIVA 2JA7B 3T9NA 2C3UA 4ZPAA 1NJXA 3E2EA 1F5BA 3SZ2A 3F0NA 5DM7Q 4CDIA 4DHVA 2OMLA 3BSNA 3P1HA 4IG0B 1WCMH 1FFGB 2F40A 5IWAQ 2ZOGA 1PTOH 1FT8A 4DN4M 1URRA 1D9DA 4A3IH 1XR6A 1CT1D 2RCFA 3DU5A 2BJEA 1RTDB 3T51B 2LQJA 4RWSC 1FX2A 3NPPA 2B4VA 3FQKA 4OWTB 1Q82T 1LT5D 4ME3A 4F88A 1RTHB 3NAIA 5KFDA 5C0XI 3ZYYX 5IT9E 1H6KX 1NJIC 3H98A 4IH6A 4DNRB 3W2VB 3NQIA 3CCEA 3KJFB 3DWPA 1KDCA 1S9EA 2V8VA 1ZZNA 2IY5B 2O67A 2J8AA 2BW7A 4ZLTF 2CHBD 3ET6B 1P27B 5K14B 3JAMU 4PG8A 2V67A 3CJ5A 2P5ZX 2HD3A 2QCPX 3LP1B 3G6ES 1R4QB 4CLKA 4L74A 3CKIB 3E0EA 5ETTA 2EYJA 4DR6L 3MMCB 4RLEA 5CV6A 3CJQA 3M8PA 1SVDA 1FJGJ 3W5ZA 3CIZA 3T1HF 1F1BB 3MMAA 2FVSA 4TY9A 1JR0D 4RW9A 3TA0A 2BUNA 1EKRA 1JMCA 2B2TC 4C8ZA 4OIJA 2OHDA 2YWGA 3KK7A 4FF2A 5KFVA 3W1GA 5DLGA 3QZ8A 4ES2A 2WVBA 4DV2L 1JNZB 1PBUA 4IQXA 4Y34A 4JI3L 4DDFA 3ZZUA 5D3DA 3R27A 2BR0A 2V8DA 4TY8A 1FKPB 2FIUA 3PJXA 4ZRZA 2BBEA 2OTJS 2FHJD 3I4LA 1S1UB 4A3BG 1RK8A 3FSYA 2MKKA 3ULHA 5GAGC 2RMLA 3I4PA 2KCTA 1STBA 2R4FA 1YHQA 1T8EA 2G2YA 3BYRA 3JTPA 2YNFA 4G1IA 4PWUA 2OT2A 1RWNB 2WIIB 3C16B 2W9BA 4C8OA 5A76A 4MH8A 1OXSC 3UDEA 2BABA 1O7IA 2LYVA 2CKZB 3D28A 5GAEI 1WD0A 4A3LH 2JQOA 4XYOA 2RE1A 1SMYD 2K7VA 1Y5IB 2EE1A 3CC2S 1QDUB 2BRLA 1D8LA 3DLGB 2HW3A 4TQUS 1C1BA 1UVJA 1SYBA 1HKAA 1T9TA 1VQ4A 2JH3A 1KHVA 1FFSB 2KB2A 1G8ZD 1RCOB 1OXTA 3JTNA 4I4BA 3GILA 2ZH6A 2QGQA 1TUVA 1VIXA 1K44A 4LJMA 2XTIA 3GZ7A 1PYTA 3ITPA 1N33Q 2JA8H 1WTPA 3GTJH 1IBMF 1HPZA 2IW3A 4JI0L 2VW9A 3TUJC 2YBVA 1CFMA 3ZTQA 4ZVFA 3MAAA 2ZBIA 2VQEJ 3EYZA 1W2IA 1ZXTA 3V6DB 1BWVA 3PO2G 3KOAA 3ZTOA 5KOWA 3R97A 5MAOA 5B0GA 2RSQA 2BJ3A 3N6NA 2QL9B 2KFNA 4RKLA 1IKWB 3PW7A 2LP4A 1DM0B 1U47A 3S2HB 1KLNA 2QA4G 1HBMB 2F65A 4Z7CA 4CLPA 1HYSA 2JA5H 1M5OC 5EWGA 2NPIA 2RQXA 4ED5A 3W2WB 4MHEA 1U25A 1YHBA 3RZDB 1S57A 4LUVA 1PH3A 1UEAB 5E2QA 5C2GA 2C2ZB 3S17B 1RTDA 3D6MB 5K20B 4IPHA 4OHXA 2PO4A 3IAS9 4NLVA 5KT2A 3K7RA 3IWNC 3H3VI 4QJVA 1VQ9S 1RWVB 1YEZA 1K8AT 1AE3A 1DRZA 4DPUA 1EEID 2HVIA 3D7SB 4A48A 2R92B 1DFDA 3KFWX 2MQHA 2PMZD 4ECYA 1VQ6A 1C1CA 3CIMA 2B29A 2XTJP 1FEHA 2LS01 1PTOD 3I5CA 3KLHA 3IBCB 1VQNA 1N34Q 2K01A 1UA1A 2Z2YB 3L7OA 5M2RA 4DFMA 4W92B 3GTGH 3QLHA 2QYCA 4CTAA 4MTNA 1E6VA 5IGGA 4Q0BA 2OTLA 1QOHA 1PBAA 1P9YA 1VMCA 2KEDA 2NXUA 1JB7A 1TWFB 1IM6A 2CJKA 4RW9B 5IY0A 2Q8IB 2R6GA 4DJBA 4HEA9 1N5YA 3CUNA 1W3SA 2ZWOA 4OHVA 1KRPA 1Y14B 2WCXA 2AT1B 3KTQA 1VQ8A 2EVZA 1CQVA 1CJUB 3MEKA 1I4HA 3BZQA 4UP9A 1MHWC 3S1NH 3ERQA 2NZHA 2AHOB 2VNUD 1XIQA 3M4OH 1P1TA 4Y6IA 4FPIA 3FKIH 4PXBA 4PQUB 5FIIA 3BDOA 3N79A 1L5UA 4A93B 4M8AA 3B54A 2CW0C 1SV5A 4RHRA 3D2WA 3HVTB 2M8DB 4KN7C 4O3OA 1GUOA 4DV4F 2DCLA 2H5EA 5LT5A 2RDDA 2N88A 3D4RA 2VICA 4R1JA 2ZKTA 3AJ1A 1TWGH 3FCHA 4I2PB 1AYEA 1BBUA 5EPJA 5A8RB 3QOJA 3BVMA 2LDYA 2VL6A 1U0LA 3S1TA 1UJ5A 2HZVA 2DPIA 5BXIA 4DF8A 2ALZA 3LO3A 4PWDA 3PXGa 2NB0A 3CCLA 4DR7J 4XYQA 5FLMG 2OQ0A 3HZEA 3OTBA 1C0UA 2NUUG 4P6QA 2K32A 2BH2A 3HVRA 4XT3B 1VLYA 4B9SA 2NREA 1A3UA 4WTYA 4WIIA 4L5TA 4LF7J 3BSOA 3VR5A 2V69A 3ZZ0A 3AHPA 4DV5Q 4DNIA 3KLFA 3BZKA 1Z7TA 5CQGA 4EZ9A 4IPDA 2FVCA 1UKUA 2K5QA 3JSBA 3VA7A 2RT3A 1JLAB 3NKYA 3TNVA 3OQ2A 3QFHA 4DR2L 1I6HH 3PUXA 2AEMA 2MXYA 1PO6A 2N55A 4N8X1 1UWBA 1PJ5A 1NKEA 4EFAC 4U96A 1WDTA 2ICEC 2FTRA 1OO9B 2ZBCA 3JYTB 3TA1A 5IT4A 4OONA 2OJ3A 4K7QA 3NS6A 4JI4F 3I4MB 2BE9B 2ACMA 2R9LA 1D1KA 2HK3A 2F0NA 2HEKA 4ZPTR 4DSLA 1KRTA 3MEFA 5M5WB 4C97A 5KG5A 1SNPA 1LUZA 2LXIA 4KKUA 3FMCA 2QSWA 4OMFG 4OZNA 2RDJA 1TL1A 1JLEA 1ENCA 3OHXC 5C5MA 5A8KA 1YBUA 2DJWA 3IFDA 2K28A 3HOXH 2OH2A 2VPYB 5LL6X 2DHSA 3BVZA 3LNNA 1NCLA 4ZQ3A 2G5DA 4A3IG 2HMIA 3K5OA 4AYBB 1DJRD 1YQHA 4TY8B 3KK3B 2W2QP 4I7ZC 4OV1A 4Y0FA 1F9HA 4P72A 5M9OA 1EQ0A 1FRXA 1EQTA 5C3WA 4LF4J 4NA2A 2WKCA 4JW0A 3FFIB 4F36A 1XK8A 1KRSA 3K0YA 4DX5A 2E1RA 2DH8A 3OJUA 1NZ8A 1K1QA 5CA5A 3I5BA 3PFOA 3ZXWA 2W9CA 1EWIA 2W9BB 1KNEA 1U4LA 1NBEB 2R7SA 2B51A 4NI2B 3CCUS 4YHHQ 4CDEC 2MQMA 2EJGC 2AUJD 3A8KA 4DX6A 2HHUA 4UUXA 2C3OA 1S5FD 1O0PA 3KHGA 2VHGA 3MM7B 2DR8A 3TEGA 2BDOA 1RHPA 4A3FB 1TK0A 4KO0B 1V5IB 3SE0A 1B3TA 4CYUA 4WFAQ 3W1BA 3H2LA 5CZVA 2CJAA 1I4GA 1AUSL 4LSLB 1EY9A 1YVFA 1OXUA 5ITHA 2NYZD 3MXUA 4ZVOB 2NQPA 1LW2A 2F03A 4QBUA 2F9JA 2QLWA 3SDZA 2WAQD 1ELOA 1BQMB 3J81U 4PQUA 5HAOA 2A5HA 5ETMA 1QWYA 2WONA 3NP5A 3GYXB 1B2TA 2VUGA 2BJ9A 5FO9B 2RBMA 3MZIA 2Q8TA 2UUAL 4IOBA 2MB0B 1GK8A 1L2FA 5B7WA 2X1BA 5FDLA 3L95X 4HYKA 1VC0A 2QW7A 2CDQA 2HHQA 2LEAA 2BA1A 1Z1ZA 4DR5F 2F8MA 3MA2B 4QIEA 1CVJA 4U6PA 1HUMA 2W2MP 4WZMA 2VA3A 1J27A 1QY7A 4NYPA 1FJGQ 4OLPA 4XIGS 2JN4A 1DD2A 1M5SA 3EROA 4A4IA 5FLXE 4YIJA 1MU2B 4DK6C 4V190 5T7LB 4JI0J 4DU8A 4OZ5A 1U49A 1EL0A 1SQGA 4OYPA 5D0EA 3W5YA 4KTAA 2XWBB 4H4MA 2PT0A 1SFOB 1JLBB 1KR4A 4CYUB 2R8KA 1PH9A 1OYDA 4YCUA 3MC0B 2VPXB 3VYSA 2IFXA 4USKA 2VBYA 1X32A 4I67A 1XMOJ 2YTYA 4MKVA 3R7BB 2K2PA 5KFBA 3RBXA 3TEHB 3RGIA 4JI6Q 2VPZB 4HTHA 1WDDA 5IC4B 3T4AC 1RDRA 2OPPB 2HQ3A 5C4XH 2EC0A 1X5TA 4DK3C 1S6PB 1J5OB 1X3EA 1HQUB 4LF9F 4LFCF 2K1RB 3VAJA 1ZH5A 1SR3A 1JLQA 3LA0A 3CTRA 4FXWA 4B3OB 2D69A 3B6BA 3TQ1A 3NP8A 2ZH4A 1RA6A 2XMKA 2K3KA 2CCZA 4JI7F 3HJFA 1T3OA 3OLAA 2JA5B 1S9FA 1EIFA 1TKTB 1D5ZC 3TW0A 3M8SA 1YRTA 4KV6A 2DYAA 4JV0A 5F41A 5DZ6A 3A5ZB 1RHRB 1IBKL 2NLWA 2F0WA 4NLXA 2DISA 1TWAB 2K5WA 4OGQC 3VYTA 2V2KA 4K0KL 5EPLA 1CHPD 4C8MA 3HXMA 5L1JA 2ZJPA 2F0IA 1DJ0A 2ZJQA 3BS9A 2C35B 4MTPA 4AYBD 1ZPWX 1EY0A 5LXYA 4WFN3 5HATA 1WHYA 3NHHA 4HDHA 1FRIA 1GKHA 4Y52H 4ETZA 2ASDA 2WACA 3GV7B 2MHNA 3GTJB 4RGNA 1XR5A 4UP8A 4JI7L 1NCVA 2L9HA 4X2BA 3DOMA 1OY8A 4F0KA 4NYZA 4YHHL 7FDRA 3R2IA 1KTQA 1XWLA 3Q8RB 4C11A 1VQIA 1H9KA 3GMGA 1BCPF 1PH5A 4G4KA 3M9BA 1VQLA 1UZHA 2AWNA 1DCZA 3M2VB 2K1BA 5JJIA 1Z2ZA 2CQHA 2FJXA 1GUNA 2EY5A 5M2PA 4IJLA 1WTFA 2F0OA 2ATWA 3MDFA 3AFPA 1KWMA 5GAHI 4PZ7A 2C3PA 5FD1A 1LWEB 2QG9B 3MCSA 3PEHA 4MIUA 5CABA 5C5LA 3PHTA 2YKOA 2L5TA 1ZM3A 3JS9A 4PMWA 2CH4W 2IM0A 1WHXA 3D5MA 3AOAA 3OTDA 3K0JA 3A8JE 4JV5F 2HDMA 1JLGA 4F3QA 1S6OA 2UVWA 3M6WA 2FHKA 2DNZA 1HBMA 1ZM9A 3HHEA 1MD2D 1G4CA 2KVQE 1AUDA 4PG7A 3R6GB 1VISA 2M70A 2NSCA 3U9OA 2EYOA 2RKIA 1U26A 1QILA 5C4XG 2YX1A 2AZ3A 3CCQA 1URNA 4PAAA 1LXNA 2E5LL 3AQOA 3DDNA 1GUWA 2RF2B 1FE4A 2IRXA 2HURA 4NPSA 1O8BA 2DO4A 4N9PA 4YWMA 4ZVQB 1U7LA 4OZ2A 5EX0A 5C24B 4J9RA 2XS2A 5CZXA 2H1EA 2WAQE 2UXBQ 3RBDA 1UZDA 4ZHRA 2L15A 5I9OA 1PV4A 1U9RA 1Q8IA 4CT8A 2CPJA 2OFGX 1ULRA 1V1OA 2ZZNA 1VQGA 3F2CA 1FL0A 1Q95G 2WB1B 3PW0A 4X4RA 1IKMA 1YRXA 4RNNA 3OVBA 2VB3X 5IWAL 1QUPA 2Y0SE 1HR0L 4ID6A 3B4MA 2OPQA 3GV5B 2Q6CA 3IO1A 3W7BA 3KG4A 1QJOA 3U4ZA 3G6EA 1LWEA 2WVCA 4D3HA 3QG1A 3LUYA 2ID0A 3U4VA 2LDIA 2LEBA 3HOYH 1U6ZA 3UDCA 4XDDA 1UE7A 4RNOA 3EM1A 4BY1B 1HNXL 2F0MA 1JJCB 4YB1P 1N5YB 2HCCA 3GV8B 3I2ZA 3QT5A 2CQ2A 2HBRB 2UUCJ 4B3TJ 3AEVA 1GEHA 4PCQA 1TS5A 3AT1B 1KQSA 5T1IA 3UDGA 3B8HA 4R4QA 3ZZZA 1HHSA 4DZ6A 2MKCA 4FNFA 4CT9A 1D5MC 2Z56B 3X3UA 4TU7A 2XGPA 1QAJA 3H59A 2PMZB 1GFWB 2B4PA 1EQVA 1F3FA 2ZH5A 2BKPA 4YWLA 3EZOA 4CLFA 1VQOA 4DNTB 2Q1LA 4XT1B 2RQCA 5ELCA 3D3CJ 2F0DA 1CLFA 4L5QA 1Y1WH 4HT7A 4F4YA 1MMNA 2HHPA 1QB5D 5HJXA 3QNWB 2BA9A 3D0GE 2ICIA 2CJXB 2YNGA 5CD4H 1EHWA 2RKSA 5F8GA 4O4GB 2EW9A 1RBOB 5AE1A 4GO7X 1E3PA 2FLNA 3I4NG 2JXMB 4WF9Q 4EQNA 3M30B 4USHA 4LF9L 4GVLA 5EDWA 4U7UD 3PFEA 1NDCA 4MAKA 5BYSA 4R4IA 4JI4Q 1NSNS 1RUSA 2XRSD 1STYA 1JJGA 3BKUA 2MKHA 4NDXA 5KTQA 1S6PA 2W4DA 4HCSA 4E6IA 1YNNC 3TREA 1BDOA 3MWBA 4A4JA 3MURP 2DO0A 1IBML 2B43A 1LNQA 3SSQA 1V1QA 3U1LA 1HNXQ 1VQPA 1QNUA 1AZQA 1FRHA 1T5XD 1BGXT 3IS9B 4G3IA 3JAML 4JOIC 3T41A 2UUBJ 2VG7A 3BSCA 2BQ3A 4OIKA 3GCWP 2VOOA 1U1KA 1G2SA 2MLZA 3E6ZX 3AFGA 3S1MH 5IZHA 4LREA 4JI5F 3OXLA 2X6LA 3K17A 4Y7NB 1FVIA 4DUTA 2F4FA 4R8UA 3D0IE 1RU1A 3KFUA 2HHWA 5I2XA 1YITA 4X64L 2D3ZA 1U5KA 1JICA 2X1AA 2DRAA 2YWKA 3NGKA 4MKBA 4PQAA 1HNWQ 1VHIA 5C3EB 2DNOA 3I96A 2F0PA 3WOEA 1XBWA 2B0GA 1X5SA 2HBZB 2E5LQ 2F9DA 4A3GH 3CDAA 1K8GA 2GN5A 3GIRA 3H0GB 3X3MA 1S6QB 3CJ8A 1RT5B 5E5NA 1WI5A 2BEFA 1S1WA 3UDLA 2DR7A 3QIAA 2WV6D 1HARA 1D2BA 3CMES 3GIJA 2ERRA 2OELA 1N36F 2PD1A 3IG1A 1H72C 2JLEA 4Z37A 2MZSA 3DWAA 4DV5L 3TZDA 1XNRF 5GMDA 1RT4A 4LR8A 2JNJA 3ILIA 3ZTPA 3D6HB 4MIAA 2YWWA 3K5LA 4A3EG 1XNRL 4BC7A 4DR2Q 1ILQA 5C42A 2FINB 2VXWA 2ZXRA 4FP9A 1YG0A 3K5PA 2JEFA 1GUTA 2NWGA 2GIFA 1CQMA 4EO6A 5DGBA 1JCKB 3V6DA 3CJSA 5CR3A 1FCAA 4XPCA 3G8QA 1I94J 4FXGC 3TP5A 1RYRA 2AQ1B 5LMNJ 1ZOTA 4HI2A 4DUZF 4FDFA 3CDBA 2PEBA 2XWXA 4JI3J 5KFCA 5C25B 1Q1EA 5IQQA 1Y1VB 3I56S 3BG3A 2EK1A 4DV2F 3DNCA 1HI8A 3DHXA 5BYRA 4C3HB 2VKRA 1Q7LB 4IRKA 3OVAA 1S49A 5J2MA 4QWEA 3M7GA 1S79A 4J9NA 2AIRB 3KNGA 3UDFA 2AV5A 5EQ0A 1N33L 2QT7A 4MIBA 1SIWB 3PGZA 5ELBA 2O1PA 4L5RC 4A3DG 4MYTA 5KFOA 4EUVA 2GJIA 3VAIA 3TARA 4OEMB 2VODA 4I6WA 1KDNA 2HQDA 1OXXK 1DY3A 1VBZA 2I5HA 2A6EC 4J9UE 3TS2A 1EYAA 1DQ8A 3QYYA 2F8HA 3H15A 1H74A 4C8NA 2QRRA 3HI9A 4FYYB 1XNRQ 1A9NB 4ZPWR 1I6HB 3NS5A 1G2TA 1FVSA 3G4SS 5ETKA 1P8LA 4L6V3 5B0FA 2NN6H 4M5MA 4EO8A 3RLFA 4RMFA 2KI2A 3BBCA 1AFIA 4I69A 4WWSA 5CMDA 4ZJLA 3LANA 3OYYA 2WAQB 5J39A 3Q0AA 2I6WA 2Z6BA 3BZCA 2MZTA 1K8MA 3OL6A 1MJEA 2HBQB 1SE3A 3LWLA 4L6TB 4Q43A 4OYAA 2N3SA 4B3TF 3DMUA 3J81E 3QR8A 3ILLA 4LFCJ 4LF9J 1SNDA 2VJVA 3H4BA 1S5BD 3EZUA 1L3KA 1RB0A 4EQOA 1HD1A 3PF5A 4HT5A 1OYEA 3BGFA 4HACA 3UE2A 4ALPA 2EDGA 2VKZG 1KTKA 2QJ3A 3CULA 3C3LA 4YWKA 1UE5A 2XSJA 1VQ7S 1U1PA 1NH7A 2FZKB 4GS3A 1CC7A 4QWDA 2B9YA 3G7LA 2J9EA 4OYBA 3MUVP 3UDIA 3J80L 1FNMA 2RUGA 2SDFA 1X6OA 2HBYB 2E5GA 4U8VA 2IYIA 4POFA 3VZHA 3OUYA 4A8OA 1AT1B 2LXJA 3A1YG 3QATA 3EPIA 1H9MA 2ZD1B 5HP1B 1KC8T 3SFUA 3X1LB 2XVSA 2B39A 4QB4A 3QGPA 5F8NA 4DUZL 2HAIA 1YVCA 1MSGA 2VQEL 2VOPA 1OS5A 1GH8A 1MIUA 2E75C 2DIUA 5ELFA 2CAJA 4WJ4A 3PX4A 4A3GG 3HOZB 3T53B 3EBEA 1RHQB 4KKOB 3QWPA 4ILRA 4QIFA 2UUCL 1UW4A 1ZAVA 2XO7A 1NZAA 1R4PB 1WG4A 1HNXJ 5JAVA 4PWWA 1S1VB 4FF4A 3PW2A 2W2PP 3J7YI 3M8RA 4NE9C 4NLWA 3IRXB 2OD6A 2VUMB 1JLFB 2B5JB 3K80C 4DUYQ 5A6PA 1VF7A 3S15H 1CBKA 4A8QA 3I0SB 5A6WA 3T16A 2BZ2A 4O4RA 1D09B 3R5GA 4LWCA 5KAKA 4ITSA 2QEJC 3Q24A 2L3MA 1UP1A 1Q7YT 2EXDA 2H51B 5HQMA 1SIZA 2VB6A 1TP7A 1K3RA 3F2DA 4M5JA 4DL4A 2A68C 1I51B 1L0WA 1TL3A 5HANA 3LX0A 3CDEA 2E2IB 5K5PA 1PFBA 5DLFA 2Z0SA 4XO0A 4O3NA 3RG6A 1RLCL 4KSEB 4P52A 3PUVA 3VZIA 4NL5A 4YUDA 5GAHC 1VQLS 2KBNA 4OYZA 4Y2MA 3G6JB 1K9MT 1RA7A 1T9HA 5K36H 2E44A 3LPYA 1EIHA 1SNQA 2DPJA 3A7AB 1FWPA 1HPCA 3J81c 1I4QA 3PW5A 1UVLA 1KTVA 3W1YC 1TS3A 3SIPB 4LF4F 4CLLA 5JEAH 3PF4A 1LQ9A 2B6AB 3J7A5 2UUCQ 1SAPA 3S9WA 1MWQA 5AXKA 4DV2Q 4OI0A 2J0WA 3M05A 4LNQA 3NWRA 2BM1A 2CH4A 1HWIA 1UTAA 4M5HA 4NZ7A 3S2DH 1W7WA 4PPDA 4MYUA 4WPAA 3M3YB 1JLQB 4IUQA 2IM1A 3DMJA 1JKHA 2OQKA 2CADA 1XMQJ 2DVIA 1B3AA 5KFNA 2QF7A 4X4OA 2OIHA 2MKJA 2RF4A 2JEJA 1UCNA 1DARA 2ZXOA 4HIKA 1RWOB 3R8BA 4IUFA 2E9RX 1EYDA 3A4TA 1IBKF 2U2FA 2C28A 2B8FA 2KFYA 2KA7A 2BXJA 1RABB 4P10A 1W2BR 2HHXA 3D31A 3NTKA 2R3ZA 1RI7A 1S5ZA 2NUCA 3BYPA 4BBRH 4ZKAA 1Y10A 3BR8A 1KL9A 2BJ8A 4OWXB 4PZ6A 3MM5A 1F77A 1W25A 2RH3A 4DCJB 3S17H 1KLGD 3CPFA 4DR6J 4CRJA 3EDRB 2NPFA 4F4ZA 2KZZA 4NLRA 5SUHA 3VWSA 1Q86C 4PG3A 5J1EA 5DM63 4IUPA 1OPIA 1IBMQ 1HZBA 3PYDA 1FO1A 2DEJA 3D8GA 2CVRA 1WSRA 3HD1A 1RAJA 3KNAA 1FXDA 4NCAA 2QKIC 5KFQA 5HLFA 4V19J 5IGDA 1MWYA 3Q8UA 2H65B 2RB7A 1UWBB 3DOLA 1Q4RA 1X31C 4IOAA 3R7SB 3UDVA 1VQ5S 2HS4A 3DLBA 3UI2A 1V9OA 4B3TQ 4H4MB 1JKHB 4FNIA 4JV1A 1IWGA 4Y00A 2W8KA 2FGCA 1WI8A 3GTLB 5KFGA 4EBDA 1EY5A 4BXXH 2ZH3A 3EVQA 1RWPB 1EU3A 3CJRA 2HYIB 4WFBQ 3DUZA 7AT1B 2IMOA 1RT2A 5GROA 3NTHA 4DFJA 2UXCL 4DL7A 3ULJA 2Q2IA 2W25A 1HUNA 2A69D 2DCUB 3NGTA 2EY6A 1W2BA 4FPRA 2ZVSA 2RVLA 1FTRA 1YHAA 3J81Y 3SBMA 4JBKA 2KEEA 3RU0A 4YHHJ 3GTMB 4JI7Q 3PJ9A 2NYHA 2GW8A 3HHDA 4R5PA 4FNHA 1BY9A 3KJVB 2DXEA 1VQ7A 1FKOA 1VBKA 2R2SA 3V2TA 1F9FA 4B3MF 2B63B 4KI0A 1Y69U 4TNOA 4TQSA 4USJC 1NK9A 5IYCH 5M3FG 1FX4A 2HHHL 2FC9A 4DEZA 4MT1A 3K8WA 1TMJA 2EPIA 2MLXA 4B3RJ 1TL7B 2GVBA 1WF1A 2ZH2A 3J7ZT 4C9DA 2HFUA 2CWXA 2ZTDA 4JB8B 4WE1B 1Q79A 2UUTA 4B3ML 3HGBA 3TUPA 2ZUGA 2HHHF 4ILLA 4O4GA 1AW7A 4Y2CA 1EWHA 4OL7A 1X4FA 2B9EA 5C5JA 1CTMA 1N36J 3DI6B 3EE3A 2ZC3A 1RSCA 3TAPA 3T5KA 1XC9A 3VR6A 1UVKA 3OUYB 4A47A 2M2LA 2QMWA 1LT4D 1R8PA 1B4OA 3JC66 1X8DA 3QRRA 4M94A 4DPXA 1IYVA 2V4RA 4KBIA 3NE5B 4JI0Q 2XB2D 4BS2A 4CBVA 4KPYA 1VK8A 4MMOA 3HMJG 1YZ7A 3S1RB 2Z4IA 5JXSA 2GJ2A 1I4PA 1S1UA 2VQEQ 3F1ZA 4IFDJ 1GO3E 3GTQH 4DR5L 2UXBJ 1FJ7A 3N52A 1X4HA 3UN5A 1RDPD 3A0JA 4NZ6A 2RHSB 4A46A 3FMWA 2ZH8A 1VCTA 1VS3A 2VG6B 1KN6A 3G6VA 4K2XA 3ZZYA 2OPSB 4KHPQ 1CC8A 3N5BA 4DR4F 3OMGA 5E33A 2IIHA 3GG1A 3GV6A 4LW1A 1C9OA 1CZWA 4PABA 4WE1A 4CQ1A 4EVOA 3Q83A 1GMWA 1X4GA 1NKCA 1LO5D 3EVOA 2MGZB 1WNEA 5KRUA 1MLAA 1RE1B 4GKKF 2EXZA 4HSPA 1N32J 3DGPB 4ID5A 5I4MA 4ECTA 1LTAD 3CCJS 1QSYA 4QQBA 3NNHA 2RRAA 4JI2J 4Y2KA 4CJ1B 1BQNA 4ZVHA 3DLEA 5HMXA 5K8MA 2E5JA 3NXZA 3HOUB 3MUMP 1CSJA 1U09A 4JBMA 5KFUA 4GOPA 2A0FB 1TAQA 5JPNC 4ERDA 4J9PA 3W66A 1S1WB 3NBPB 3W2DA 2V50A 1VYAA 3E0JA 2G13A 2HZAA 3I4MH 1JORA 3EICA 1N32Q 2OEMA 3HSDA 2ES2A 3S2DB 2LECA 1K47A 4RW7B 3AJ2A 2J9CA 1VQMA 5KT4A 3MFIA 1WC3A 2ZXPA 2IRYA 2Z1CA 4XQQA 2R42A 1NPRA 5CBAE 1U2CA 3FKBA 2R8JA 5H9FK 3MWYW 1RJJA 4K8RA 3EWGA 4PMBA 3S1QH 2DGXA 2NZ1D 2HAFA 2EYMA 4MK9A 2HFVA 2N3OA 2PYKA 3JSMB 2W2OP 4HMIA 3DMJB 2C9OA 4M8LA 1VQ8S 2FY8A 2GVAA 3M2RA 2CNOB 2YKMB 2B2VA 2Q66A 3KJQB 3OWEB 1X55A 4K14A 1NHVA 3NNAA 4HEDA 1WKLA 5EKLA 1JXLA 4K5WA 4XXEA 2FVQA 1WKJA 1Y8OB 3TN2A 4R0EA 2K33A 1QVFA 4WKYA 2KT2A 2F4VF 1YRUA 2Y1JA 3RN5A 2C2NA 3I9V9 4YY3Q 3CF5Q 4O2DA 1SKSA 1LTGD 3PO3B 2W1BA 3GTKH 1MWZA 5DM6Q 4MTKA 1RISA 3UD4P 5TSSA 2NN6G 3VAHA 2TMPA 3BGRB 3L7PA 4LR9A 1JWSD 1M5HA 4I7FB 2OP5A 5KOXA 1VMBA 4P2FA 5HROB 1VQFA 4ZPBA 2JJQA 4J1MA 2XSFA 2HFOA 3S15B 2V94A 3M4OB 4C0OC 5F2DA 1XERA 3LQVA 5EPKA 1Y1VG 1O78A 2OPRA 1HR0Q 4DOZA 5JJBA 4C2MA 4NXML 2HHHJ 1DOMA 1E1TA 2XMJA 2JVOA 2WINB 1O6XA 2MQLA 2XG8A 3OFEA 2W9CB 1VQMS 2JP1A 1TELA 1SI9A 1SJQA 1F9RA 2FVPA 1TV6A 2CNNB 4LF2A 1HHVA 3LP1A 1EZZB 3WQPA 3RRGA 3TP2A 1SNMA 4OIXA 1C4QA 4R4CA 4O3QA 3HS0C 1VFJA 1AZSA 4KKTA 5IYCG 3M1VA 4FYXB 4LK1C 2NXJA 1IBMJ 1ENAA 1C4AA 2R7ZH 4YR3A 2QX0A 1V43A 3W5XA 3POTA 3FRYA 3KF8B 2DNHA 5KG4A 3K6OA 1R3NA 3CF5A 3PIO3 4K4SA 5IT9Y 4QY7A 5J2QA 1RAOA 5C4XB 1MKHA 5GADI 5C44G 4MKYA 9ATCB 5IT0A 1VCIA 2F0GA 2PMZE 2N4DA 2HNDA 4J9LA 2VQFF 4DL6A 3PW4A 3DOKA 4BC9A 2WONB 4UUWA 5L9XA 2E2HB 3NBHA 1LEOA 2HIVA 3N6RA 3M8YA 2XS5A 1X56A 3GLJA 4K5RA 1HWJA 3DEOA 3M4QA 2Q43A 5H1SV 2AQ3B 1WEXA 1VQBA 1SYDA 2CJQA 1L3VA 1NJYA 4OI3A 4IKAA 2XS7A 2ZM6Q 2YQ1A 4OZLA 4IOCQ 4L72B 1K73C 2QLXA 3PJWA 2AYEA 2J0TD 4QR1A 2EG2A 4ECUA 2WSCC 1PRTD 1X4EA 4ZPVR 1SJED 4DAPA 2NXEA 4F25A 3LTOA 2VZ9A 2OF1A 4J9QA 3DLHA 3PY8A 3M9OB 4EBEA 3FZBA 2OO4A 4QQBX 2YTVA 3CMQA 3MOZA 2MKSA 3LPEA 1Y3KA 1HQEB 1QG7A 5DQGA 3DLGA 5C7PA 4C3IB 1VQYA 1LTSD 3BN4A 4IZ8A 4CCHA 2F0JA 2CZ9A 3ICLA 4K5XA 5C4ZA 5IYBH 4WTOB 1J8IA 3M4PA 4JI5L 1VDZA 2BKOA 5E3FA 4B3RQ 2W7PA 1NAPA 4FKXA 1BC6A 1FTCA 3BZDB 1JLCA 2HCIA 3NMRA 3PO2B 1R9TH 2KHSA 4HIOA 3I0SA 2EYHA 3D67A 3TRZA 3CCQS 1N34L 3C14A 2ALYB 1UA0A 1TXYA 2D9OA 2KZMA 3F2UA 3CD5A 3DM3A 3FNNA 1N88A 3MMAB 4EYHB 1UAPA 3ZNUA 5C2CA 3W9JA 2FXQA 3HKZB 3KWMA 4O0IA 5EGYA 2R61A 3L9ZA 4JI6L 4LBHA 2Y8WA 2WVDA 1YWXA 4EQPA 1CI3M 3GFHA 3CC7A 2BX6A 4X4PA 2A68D 5ELOA 4ED8A 4P2XA 2K52A 4CO0A 2IDLA 3ETOA 4R0JA 1EETA 3THPA 3ICEA 3W8GA 1NPKA 2AJQA 1PRTF 2ROGA 3I73A 3KF6B 1YSJA 3NGSA 3JAMY 5CYUA 2OSRA 3I4NH 1A3VA 2ASYA 3ZC4A 4ZLJA 1PHJA 4B9TA 2AX1A 2KHJA 3A5UA 2DXDA 4JI8J 2PZTA 2GX8A 1S1XA 4O44A 2R7TA 2PZUA 4K6LA 2R93H 3D3BJ 4KLKA 3STBC 3UCUP 4CDCC 2KOLA 3PIPQ 3DLEB 2YU9H 3O1LA 2RQMA 1LW2B 1X4CA 3T5HA 3M4YA 1HBUB 3OR1B 2FJVA 5THWA 3PUYA 3K8AA 4B9VA 1FNVA 3QAEA 1R6VA 2L1BA 3MFGA 2KJVA 2VH7A 1IYUA 2DY1A 5E41A 1IYJB 5EBDA 1B70B 3MTSA 5F8IA 1D1UA 1SJ4P 4CLYA 4MK7A 1YJWA 4RPFA 2L9DA 3ENVA 4I7FA 3KDOA 3IXQA 2F0LA 2J7KA 1Z4UA 5FJ8H 2K75A 1HJPA 3RBEA 3MMBB 3MTJA 4DFKA 2AWZA 1IR1A 1XEZA 3JQKA 3U7JA 4F3OA 4O0NA 3H0GG 1XTZA 3CVKA 5IOLA 2DD8S 2LCWA 4QIVA 1NSKL 3M8QB 1EETB 1HA6A 2R8IA 1ASYA 1OSDA 3SFGA 3MXGA 2L11A 2V63A 3HHKA 1S1TA 3GFXA 2ZDPA 3GIKA 4X6AH 2VDHA 1AN8A 4ZPDA 2E2IH 3UD3P 2FLPA 5IM0B 4QWBA 4OO1H 4LF7L 1HZ9A 4NLGA 6FDRA 2KCMA 5CYQB 1RWUA 3N01A 4KYZA 4KHPJ 1KLMA 2PDAA 5J2PA 4L8JA 5FKAC 2I0QA 2P9CA 4AL5A 1IKXB 2DJFC 2C3MA 1NHKL 1HBUA 3HP3A 4XAKA 4DR6F 4GKJJ 2R7UA 3HFZB 1PTOC 1HNZL 2YKAA 1YX2A 2PEHA 2H1YA 2F0FA 3F56A 4JPBW 1S59A 4EK2A 3S24A 4M5DB 1VHFA 2DEIA 2WKDA 3HRZC 1K9MC 3K89A 2GJFA 1XMOF 4KFBA 3RB4A 4IOAQ 2ZTCA 5D14A 4DV6Q 5KG0A 2IPKD 1PCAA 4YEAA 1JQGA 1RT2B 1C7YA 5GMEA 3IR6B 3QIPB 1IKVA 4ZITA 4Q2MA 3PZPA 4QYZJ 2FC8A 1SC3B 4UPAA 2PNRC 4G6VB 3BKTA 1GXDC 1FI4A 3GJSB 2XNRA 4G57A 1NMEB 1UW9A 2MQ8A 1NM2A 3S8SA 4OHZA 5AXNA 1QVCA 4RR5A 5AXMA 4CNYA 3D1QA 3BM7A 1R8BA 3I9ZA 2JA6G 3SK5A 1SJRA 3L2PA 1LWCA 4RBUA 1WOOA 1F5AA 4WP3A 4ATNA 3RR7A 3KLSX 4GKJF 1EU4A 2GVZA 2XMMA 2D3O1 3DXSX 2XMUA 1MSHA 3DOMB 1BUVT 3FCWA 5MLCV 2SNSA 1S5ED 5J2MB 1RHJB 3U27A 3MXPA 4QR2A 1R31A 4RO0A 2ZHBA 1O7LA 1SH0A 2B8GA 4ZIVA 4Y28C 3Q8QB 2YKQA 4GVBA 4R8IA 4DR7F 5L9NA 3MCNA 5GAEC 2MLYA 2JA8G 5G3LD 2JVRA 1QLNA 3EXCX 4B17A 2EOTA 1WFQA 4J15A 4FYVB 3RYLA 2HHHQ 1S7IA 4AH6A 5M2UA 3I3CA 2EJMA 3MM8B 2OUGA 1Q81C 1T5EA 5ISRA 4FBUA 2F4VQ 2HQFA 2WB1D 2L41A 3P20A 2CQ0A 1Q3LA 1YI2S 2UU9J 2XWYA 2FDNA 1V3ZA 1SUQA 5IXUA 1IKVB 1NEEA 2HWHA 4RW6A 3R5AA 3VR2A 1IKYA 3GP7A 2W01A 3FBEA 2HGLA 3N0VA 1RWXB 3RR8A 3TZYA 1Z6HA 1Y8PB 1K28A 3GCXP 4IG3B 2KM8B 1X3QA 2DK2A 3CCLS 3MHYA 3G71S 3L3OC 3FEWX 1RF2D 4WZQA 1IBLJ 5D65A 2GQ2A 3PV0A 1XPUA 2VFVA 1RAAB 2AGOA 5E3CA 3EGNA 4F87A 4NXNL 1PTOB 4DV1J 1ET6A 2F3VA 4LUZA 2AYGA 4C7QA 4ED1A 1T9VA 2FPHX 4DV7Q 1WC5A 2CA9A 1OXVA 5A8RA 3BDLA 4CZCA 1H9SB 2EKNA 3UWTA 4IDKB 3UN3A 1VQ9A 2V5HG 4IYQA 4CKEA 1FD7D 4DR4Q 4AYBG 4LQ3A 3H25A 4A3KG 2P9EA 4F0MA 5IP7H 2PW7A 3A74A 2OEKA 4JI8F 3MM6A 3KK2A 4X65Q 3S16B 2RS8A 4Y65A 4DV7L 3J80Y 3J80c 4UOCA 1KSPA 3VF0B 2R2UA 1SMYC 4KGXB 4H0LC 1B64A 4YS2A 4KJIA 4DV0L 1S9GB 5IYDH 3CD0A 4DUZQ 5B0DA 2D5DA 3W60A 4IQMA 3K5MA 5CYMB 3H2VE 5IS2A 5KT3A 3MUTP 4ILMA 3IM8A 4G65A 3LP0A 1RHKB 4G1QB 3D0FA 3G82B 3V6KA 3UPFA 4P9SA 3V2UC 4RWWA 3IC1A 3OR2A 1NK0A 1JWMD 1PILA 2DUDA 4F4XA 3NBPA 2BRKA 3RW6A 2F3WA 2UXDJ 3D0HE 1B9NA 3MR5A 4DR3L 2PFDA 1C8CA 3AQPA 3CJ2A 3QIDA 4WRDA 4JYAQ 3CQZB 2R7QA 3RLNA 1SKRA 4DFAA 3FFIA 2G9DA 4DV0F 2C5CA 2D3OR 5JEAG 1WTRA 2Y0SB 2DH9A 4DX7A 1N5QA 3W9HA 3J7AV 4P2SA 8ATCB 3AY0A 1N36Q 4J37A 2VFSA 3IM9A 5E3RA 2BE5C 1TWGB 2BDPA 3C16A 1VQSA 4L3KA 4LF7F 3VGUA 1E2VA 4X65F 2NUHA 4C3JH 2YU9B 1TT2A 4XTTA 2XHWA 2HGMA 3FBCA 1EARA 2I9SA 3NLCA 1EY8A 1X9SA 4K0KF 2E7VA 1IBCB 3D6CA 4RX6A 3PACA 3ITHB 4RW7A 3QAUA 4PV1C 2XZWA 1T05B 4ZHRB 5C0XH 2MZ1A 2IA0A 2A73B 2EEYA 2EFNA 3Q23A 3I70A 4ECRA 4XIUA 2UUAQ 4YY3F 3SDEA 2W8LA 3TAQA 2D9UA 5G0RA 2M00A 2LSSA 3T5LA 4USMA 2ROPA 2COLA 5KNCA 1SQEA 1I6JA 4EEYA 2K06A 4UF4A 2KENA 2MKYA 2E76C 4KJOA 4DQSA 3OXFA 3OTOQ 2RDHA 1TR0A 4JYAF 1OIAA 1PTOF 5F8HA 1RODA 4ECVA 4HR7B 4USIA 1NR4A 4B9LA 3L9AX 1RYSA 2DITA 1HXYD 3MEHA 1GMVA 1TVRB 3PO4A 1IKYB 2CQBA 5LMNF 3FRZA 1JJHA 2JSXA 4EX5A 2ZTEA 4POGA 5AJ3J 3EX7B 2IYGA 1GD7A 1K1SA 5D4PA 4DUYL 1JIHA 2HWTA 5F8MA 1SCJB 2HG4A 3M32A 3D6TB 3VV2B 3BN7A 1NNDA 1SE2A 2R8GA 1XQIA 3I56A 2WW4A 2BOAA 3OT9A 1JNRB 2ZHOA 5DDPC 4I6AA 2ATCB 2YWFA 1ENFA 1FK9A 2FLLA 4GOPC 1H95A 2G9OA 2CW0D 1M5KC 1Y1WB 3TRGA 1E6YA 1SL1A 4MFBB 3SCJE 2GO9A 2O5IC 1BQNB 4JI1F 3RLOA 3DEPA 5AJ3Q 5A8WB 1PG5B 3UR3C 5K8NA 4X4TA 2RKIB 3NWTA 2LEPA 5ELEA 4KIAA 4PG4A 1EKSA 1SH3A 1PZKD 5B0EA 4HJ5A 1N6QB 4OXPA 1LACA 3J80U 1GTEA 3BDCA 1G1XA 2MHVA 2ZJPQ 4R4OA 1IL8A 1EQMA 1SXLA 3FPUB 2ZM6F 3BGOP 2K5HA 1Q53A 1NK6A 1S0OA 3UVJA 4LFBJ 3JAMi 4W98A 4KH0B 4Z2XA 4NB3A 4A3JB 3EGZA 3SVMA 1KIXA 3MVVA 1PVOA 3DRSB 1M4VA 3VVUA 2YNHB 2F4VJ 4ZVSB 1STNA 1L0XB 1Q12A 1HNWL 5B0AA 4L63B 2X1GA 2ZM6L 1S1VA 2I5LX 1Y7PA 3CHBD 3MPVA 1WEZA 1CS4B 4ECWA 2M9KA 4JI8Q 3TZUA 3BREA 3CCVA 1UWAA 4HJ8A 1QE6A 2D0OA 3VR4A 3QJPA 2GQQA 3GWCA 1R27B 4AD6A 3QQCD 3CCES 2QZ8A 4JV5J 1YJWS 2UUBF 3O2IA 1HNZF 1BCPD 2XHCA 4YDXA 1A7GE 3PRVA 1R8AA 2H48B 2XMWA 1D8ZA 4O42A 4PG6A 1GXUA 3HLUA 1CJKA 5HGTA 1Q8BA 1FRKA 2DGWA 1YIJS 4P73A 4P2MA 2A1AA 1S5CD 1N6QA 4X62L 1H9JA 3PUZA 1T9XA 4C56C 4UZCA 4O23A 2RRBA 1RZMA 4DS4A 1RT3A 1N5TA 2XBPA 4DL2A 1NDPA 1Y11A 4L75A 2B9XA 1CJUA 1Q46A 1IBKQ 2OTLS 1YGYA 4FXVA 2QV6A 2EFVA 5DEHA 3DCAA 2O2LD 3MCOA 3R5BA 4QR0A 4D3GA 4ZK7M 3UCZP 1IKWA 3PEJA 2W7OA 2JYOA 3GTMH 3KLEB 1UFLA 1X9MA 2V9WA 2KH9A 1SJ3P 1BD6A 4ULLA 2B2YC 3JQMA 2J6UA 4DF7A 3ISZA 4ZVEA 3R5CA 4LF8L 4S0MA 1A15A 5M3FH 3KYHC 5K8OA 2QYGA 5FK9C 5C4JB 2YPZA 3D54A 4QUCA 3M8WA 1YJNS 5GAEU 4Q0FA 4YY3L 4BHQA 3UD5A 2MGZA 2ZHAA 1SB6A 2Z8QA 2B2UC 5CV5A 2TSSA 4C3IG 5M3FB 4CH0S 3KJOA 1CJTA 4DV5F 4GO5X 3CW2C 2OEOA 3KXDA 3NCRA 3C2PA 4MJKA 1F2GA 1Q5VA 5FLXc 1FJGF 1O80A 3DOKB 4RU2A 2AMCB 4HI1A 1VC6A 1SROA 4FS1A 2JL9A 4LFBQ 3M6VA 3W64A 5H9EJ 1UPMB 4HMJA 3I31A 4QW8A 1KOOA 4KE5A 3PTWA 2MZRA 1AE2A 1U1MA 2H5XA 4JBWA 1JJ2R 3RUZA 5E0OA 1J5EF 1PJ7A 2XM3A 3VAMA 1NJWA 4Y2AA 2IT1A 4KMUC 3R2CJ 4JI1L 3UI3A 3NQTA 4WFNQ 3KG0A 4A8XA 1ZBTA 3W63A 2JA9A 3PR4A 4ES1A 4GLXA 3MEEB 3CCVS 4KK7A 3L0OA 3HOWB 4LF4L 3UW1A 1M1HA 1OPZA 2IC3B 4C1NI 4DBQA 3SEBA 4LRBA 4WXOA 2CG4A 1PYBA 5CYQA 1KONA 4IUNA 4X3TA 3HZGA 5SZTA 3ITHA 5KIXA 3LH2S 4HCEA 1PYOB 5LJ3Y 1NU4A 4C3KA 3K58A 4PZVA 3CJKA 3SCIE 1U6BA 3B78A 3M85A 2DHHA 2H4WB 3UR0A 3BDEA 3NS7B 2WAQG 3MI7X 3T1YF 2WB1G 3TDQA 1HBOA 1HWKA 5CAAA 2MQNA 1E2ZA 3M3YH 1S6UA 4DR4L 5C42B 1NMFA 3EJMA 4LFAJ 4ZA1A 1NSQA 1UNSA 1FKPA 1R8HA 1K73T 3GSIA 1NJZA 5KT6A 3DRPA 5L8RC 4DV1F 5AE3A 1PGZA 1NUCA 1N52B 3WZ0A 4I2QB 2YXLA 5KFRA 2DR5A 3C6TB 1HZAA 1RHUB 3O44A 1MMLA 2OD4A 3UVJB 4UP7A 1H7XA 3WC2A 1RBLA 4G7OC 4GKKL 2R7ZG 1VQOS 1UETA 3A3NB 1KEKA 2DY7A 1LTID 2C2DA 1RQ0A 2WSEC 1MI2A 2EYLA 2FUG9 1C0AA 2YH1A 1HTPA 1XX8A 4WU3A 2FGOA 1I6VC 1S3OA 2BANB 3GFYA 5C24A 3JAMc 3MF5A 1YDLA 4RGMA 4Q5VA 3BBFA 4YFUA 1N8RT 3GTYX 3I4OA 4C8LA 1HZCA 1GX5A 3QFWA 5D4OA 1DXMA 1GNKA 5GAGU 1A8VA 2I46A 1HFGA 4TKTA 2DBBA 1DAXA 3SK4A 4G1QA 3S1MB 1I3OB 1NB2A 1K0TA 1EY4A 3WWVA 1C0UB 3OR1A 2CVEA 2PIIA 4DG1A 3I8ZA 4DR1J 4GVBB 4B3MQ 2UXCQ 1N9WA 1WJJA 3DKDA 3GQBA 3FJ2A 4DV1Q 5I3UA 1RKJA 3ZZRA 2E5IA 3JTOA 4CO4A 1RT1A 4ZLLA 3A12A 1S7HA 3W65A 2DTJA 5B0BA 3AJDA 1VQKA 1DBDA 1UUPA 1IWAA 5L1IA 2NXCA 2I5JB 2HLUA 3TA2A 5IV3A 1KOHA 1U4MA 2GGPB 1NDKA 2V6AA 4ANDA 4LSNB 3G8SA 3GTOH 1U2FA 2KG0A 4QJFA 4U68A 3MZ5A 3OHBA 4C3JG 4KKSA 3IKJA 1LM0A 5A2QE 4K2KA 5A35A 3PIP3 1TKDA 2VG5B 1YJTA 3A8KE 1HLWA 4E8UA 5BN4A 1WHVA 5KFKA 3H5SA 3OTOL 3ADAC 4O1NA 3PQIA 1NSPA 4URQU 1DZ5A 1I5FA 1T9YA 3HT0A 3J7A1 3ER0A 2YWEA 5J2QB 2X51A 1U1NA 3DGPA 4ZUJA 3EDQB 1B7FA 3L3CA 1JLEB 3G4SA 1HR0W 2EK6A 2B56A 2RIJA 2KHDA 2G4BA 2M0GB 1FNWA 4DR1F 3R1HA 3I4MG 1SUQB 2GIQA 4TXSA 3MEEA 3BSAA 4NRUA 2RAQA 1N34F 4A3GB 4OI1A 3OMCA 2K7KA 1YLXA 1S9GA 4KHPF 3HULA 1FXLA 3ULPA 2RRNA 1XPOA 4MN3A 2IJNA 3TI0A 3R6LB 4LRDA 3TUIC 3HKZE 3PIOQ 1NR2A 4Q2LA 2F0EA 2CQ4A 3MXHP 2Z57B 3D6FB 1L3SA 3IS9A 4C3LA 3SYZA 2ZT9C 3KJVA 3DHWC 2RQKA 1S0NA 3CCRS 1FGUA 2GQCA 1TVRA 3MCMA 4CLZA 4PXDA 1Y9OA 4C2MH 2J0QD 3L7UA 3FVQA 4N77A 4JP8A 3CSKA 5HVHA 5IQ6A 3HM9A 3PO3G 2Q8RE 5LOQA 3CAMA 2DNNA 1EX8A 3I0RB 2PPBC 3DLJA 3HVTA 1KBRA 2Q6BA 5KG2A 4A8FA 1A0IA 3OBIA 2RSOA 2X69A 5I3QA 2WW8A 4OHJA 4ELTA 3KLIB 4J9KA 4HIMA 2ILYA 2XEXA 3BGLA 4LF5Q 4RW4A 5DZ7A 1RP5A 4O44B 1S1XB 4MFBA 4LFAF 1SL0A 1ZM4A 2YPYA 1HNXF 2HQCA 3HT3A 4DR1Q 2PN6A 3CGIA 3VCDA 3P5BP 4IUVA 4IFYA 3S16H 1HHTP 4FKYA 1JE4A 1N33F 1PAUB 1HPZB 4X66L 1WOCA 4EGVA 3SQOP 2F0KA 1D1IA 2A6MA 2Y0SG 4K0KQ 2DRBA 3OFFA 1Z9FA 2QLBB 1HRJA 2RS2A 4KTQA 4LF6Q 4W4MA 4NA1A 2WOMB 1TK5A 1IBLQ 1CKMA 4OYWA 2WK4A 1FNXH 3RZOH 2F52A 3TANA 3J7YU 2F8EX 4X4VA 3HG9A 4WJ3M 2D2CC 1XWEA 3LGNA 1N0VC 5IV4A 3IBFB 4DG1B 4BBSG 4I7AA 3EXYA 2X1FA 2V2VA 3HK2A 4NLTA 5KG7A 3KUPA 3KJNB 4CM2A 1WC0A 4HACB 1RAHB 3QSYB 3RW7A 3GSDA 4KC5A 4JI4J 1VC5A 1ZAXA 5J2NA 3WC0A 1DLOA 2JWNA 3ERSX 4I68A 4N8NA 1VJWA 2VPWB 3C15A 4CO3A 2F1FA 5C4JH 2XMAA 3TMEA 2KN4A 2JZ5A 1UEBA 2EWHA 4YB5A 3V81B 3BO2A 1LV9A 1EQRA 2JA6H 2CZVC 2D0PA 2HHVA 4UY8C 3HKZD 2G1DA 2GGPA 1Q16B 5J2PB 2SOBA 5B0CA 2B3TB 4A3CH 1VBYA 5CCMA 4J6HA 2HFNA 4JI6F 3BGUA 2R7FA 1FDNA 5F0UA 2B2VC 1ZPVA 1CQFA 5G4DA 4LF8Q 3TP7A 4OV6A 3ZJYC 4GNXA 2FHJA 4DV5J 1Q81T 1WTVA 4GOPB 5AXLA 1HMVA 2Z0GA 4U95A 1SC6A 4NXNJ 1HWLA 4BS9A 3ISND 3SXHA 3HP6A 3IR5B 3CCSS 4I2QA 5F8LA 1FJGL 2ASJA 1C48A 2O3DA 3OL7A 2GMHA 3EA6A 1FDBA 4G1PA 1LWXA 2O5DA 1RKNA 1TWCH 2CQCA 2QGFB 1RACB 1WTWA 5CCLA 4DV3L 2UZAA 3S1NB 1TMMA 4JVZA 2UVVA 2CWAA 2CPIA 4HH1A 1R6YA 1QVFR 3CEDA 3T3FA 4K2LA 4QPTA 2ZNZA 5HGQA 4USWA 5I4DA 2DGQA 3KUHA 4OYIA 5L39A 2VS1A 1EZ6A 4DUYF 1TKWB 1XXGA 2VJUA 5D3IB 4EBCA 5J2NB 4DUYJ 4DFPA 1EP4A 4J9MA 2QA2A 5D4NA 3GR0A 2ZH7A 3HZXA 1A6XA 4I2PA 4JG2A 4HHUA 1HNVB 4OJHA 1CEZA 3WDOA 1STEA 4TSSA 3HPOA 4DV2J 2L12A 2GNKA 4LVOP 2DR6A 3CMAA 2ZZTA 2C2OB 5JVG3 2XGQA 2KO1A 1B3QA 3OW7A 1X4DA 4WP8A 2F1MA 2OWOA 4DUZJ 4ED7A 2I5MX 2LLZA 4NMLA 2EBGA 2EYPA 4EQ5A 1N54B 2LU2A 1X5PA 3Q2TC 1EB0A 1F6TA 2HQEA 1LTTD 1WCMG 1S6QA 3D3RA 1RTJB 2YX7A 1X9WA 2PA8D 3DM2B 5ADZA 5FO8B 1V3SA 4KFBB 1JWUD 4X65J 3GV3A 2RVJA 1S4FA 4A8WA 5FDLB 2A69C 1YBTA 4GLAC 3W3SA 1EIYB 3S14H 4DR5Q 4IPGA 1K8AC 1K0VA 2PC6A 3KLFB 4ZP6A 2MO1A 4ELUA 1AXQA 2RSNA 3QBCA 2JDJA 2LMIA 3KUEA 5A2QL 3MEDA 1KKHA 2I07B 4K4TA 3R3TA 2V34A 3FK4A 2LQ9A 1CA6A 4CP5A 1PLFA 3J80i 1KQSR 2IX0A 2R92G 2HIXA 3BH6B 3VAFA 3MM5B 3Q2SC 1AB8A 3QRPA 2WTFA 3FKIG 1Y5LB 2EG1A 1E7ZA 3H42A 3NEKA 4IURA 2P6TA 1G6PA 2UXDF 4IO9Q 1CSQA 4K8IA 4EU0A 2G2ZA 1PRTB 2AGPA 4RWXA 2B8QA 4NKLA 5M3MG 1MJCA 2AF6A 1QUQA 2ABYA 2K05A 1QZGA 1EAYC 3RR5A 2B5JA 3DOLB 4EGLA 3A56A 2V4JA 2MQQA 1RCVD 1HQUA 1GJXA 1FEEA 4IFYB 4GRSA 2NTSA 3D1OA 2EKYA 3K7UC 1UE1A 1FF2A 3KLGA 4LF5F 1LOUA 2NCKL 5C0XG 4B3RF 1KDAA 4EI2A 3KLWA 1Q1KA 2D7SA 4GKJL 1HHQA 1GUSA 1W26A 4ER8A 1U4BA 4OZ0A 2CPFA 1GHKA 1JOOA 1L3UA 3BPDA 1U24A 5M5XH 3WBZA 1EOTA 1VF5C 1UVIA