4ZCKA

Crystal structure of c-terminal fragment of escherichia coli bipa/typa
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
299
Chain Sequence
GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gtp-binding protein
molecule keywords GTP-binding protein TypA/BipA
total genus 90
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 4zckA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zckA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 4zckA01
1ZM2A 2BM1A 1P9QC 2L9NA 4ZCIA 4TNOA 1T95A 2J7KA 1ZPWX 4FN5A 2NPFA 3ZZ0A 1ZM9A 3UI3A 2ZITA 1ZM3A 2I8EA 4ZCMA 1WDTA 4MYTA 2YWEA 1N0UA 2BM0A 2BV3A 3B78A 3B8HA 4ES1A 4QR2A 2DY1A 2WBMA 3B82A 1FNMA 3OQ2A 2E1RA 1VI7A 5G4DA 3E3XA 3ZZUA 4ZCLA 2XEXA 1DARA 1N0VC 1ZM4A 4QR1A 2KDOA 1ELOA 3EXCX 4MAKA 2YWFA 2YWGA 2EFGA 4ES3A 1KTVA 3ZZTA 1U2RA 4M1KA 2YWHA 4MYUA 4ES2A 4QR0A 3LH2S 2IVYA 3CB4A 2CVEA 4ZCKA 2I0XA
chains in the Genus database with same CATH superfamily
2V8HA 4UQTA 2NPFA 4UOFA 3UI3A 4ID5A 1SIWB 3WC0A 4DV5J 3GTLB 4I7FA 1JR0D 5HURA 1V1PA 2VS1A 2KCTA 4LRAA 4TLQA 4EGVA 1WG4A 4BA2I 4QPTA 2LVWA 2VZ9A 3RU0A 1QTMA 4UUWA 4N56A 5EGTA 2EY5A 1M4VA 3HZEA 4J9LA 2N3SA 4DFPA 1LV9A 5EUHA 3GE9A 4P2CB 2OEKA 2HBYB 3KOJA 3C6TA 1K8MA 2NSBA 1KKHA 1GM5A 3D6HB 4G1QB 3W8PA 2K50A 1LQ9A 4R4OA 3MUVP 3SSSA 1FD8A 1S59A 3TEHB 2ERRA 3RAMA 1CHQD 1Z2LA 3H0PA 3EZOA 2LEBA 2YYZA 2J7ZA 1X9MA 2D0PA 3G4SA 1M5VC 1W3SA 2ILZA 2PMZD 4DR6Q 3HSJA 2F4VQ 5GAEC 3H7HB 3SCLE 4DFAA 1UWBB 3GR0A 2WVFA 3U02A 4DV1L 2IY5B 1IBLL 1UETA 3SFUA 2WAQD 4IFDH 1FI4A 2EVZA 3BN7A 2KKHA 3MOJB 3UDCA 2ZH6A 1EIYB 1KBRA 1UA0A 1TV6A 1YEZA 2IM1A 4DV7F 2EYJA 4QIFA 3I2ZA 4B3TF 4RBVA 4IR9A 1S0VA 3P1HA 4DNTB 4RW9A 4DNIA 1G2TA 4YY3L 3RN5A 5IQQA 3MCNA 2XLJA 2HS4A 3LX0A 2Z6KA 3PO2G 2OPSB 3CDEA 3W5ZA 2ZJPA 3MWBA 5D4PA 2E5LL 4PEOA 3TW0A 3EQLC 5JEAH 3KLGB 1R6VA 2P2CB 4IOCA 1G6ZA 2OAUA 2UXBJ 5K8NA 4HHUA 4U7UK 4IUVA 3K0YA 4LF4J 3W2WB 1JKHA 2M00A 1GX5A 1FDNA 3SQGA 3D8GA 1I6HH 3H5SA 5KT4A 2CJYB 1G2SA 2RDFA 5J2PA 2JSXA 3CJTA 2NBFA 1GUWA 1QDUB 1VQ9S 3VAGA 3TJ9A 3CD6S 3EVMA 1IBMQ 1F9QA 2C1EB 1SJ4P 4A48A 4Z7CA 1JK9B 1M5HA 2M70A 4B3SJ 3OYYA 3JAME 1RAHB 3EXCX 4C3LA 5RUBA 1QUQB 4X4PA 4DV6L 4X66F 2HMIA 2Z4HA 2BKPA 4GKKQ 1RWUA 4FP9A 4AXJA 5LMUQ 1ICFB 4OI3A 4A3LG 3M6UA 2GIQA 2RF2A 4FZVA 1D2BA 1YDLA 1VQJA 2OPRA 2QSWA 2B2UA 2WV6D 5AFWA 4UQGA 1TS5A 2B8QA 3SK8A 2E74C 4LFAQ 1YRUA 2BOAA 4N8X1 1AZPA 1AH9A 2DR9A 3J81E 1TK0A 4KHVA 2B7BB 2B2WA 2IAJA 1HNXF 2YQ3A 3T1YQ 3S1MB 1YRXA 4TSSA 2ZNYA 3LTOA 4DQQA 2L55A 3J7AN 4CLWA 4HHJA 1CSPA 5K8OA 3NUCA 4JI0F 4ED8A 2NXJA 3SCIE 3H3VI 2JA5G 2OJ3A 2IBKA 3PRDA 5KG4A 2F03A 2OTJS 3KFUA 3QBCA 2HHPA 1WOPA 3J81i 2BE5D 2GA4B 1IJEB 3JC66 3ZZYA 5CYJA 1S9EA 4ZPCA 3BDPA 1BQMB 3SK5A 3T1HJ 2XS2A 1WJ9A 2BRLA 2XHWA 3TJ8A 1QLNA 4AIMA 1RAIB 1R8AA 3GJTB 1QSLA 3HO1A 1WD6A 3NCRA 2Y1RI 3J81U 2XM3A 1HNZJ 3D31A 4YCUA 1HRJA 2XQCA 4PXDA 3SXHA 3RRGA 1NK0A 2VC0A 1NK8A 1DCZA 2BDNA 3AAWB 2F0OA 1UFWA 5L1LA 1F9FA 1Q53A 1YSJA 1IL8A 2CDQA 2CNKB 2ZVSA 4LFCJ 1XNRL 4OZ1A 2Z2LA 2W2QP 4ZHRB 2Z2MA 3NKYA 2HHXA 3N52A 4LFBQ 1ZEQX 4DG1A 1NHKL 2UV8G 2VL6A 2BKOA 4DKAC 1GUTA 3EGVA 4PYAA 1SAPA 4F0KA 4DV1F 3CO0P 2Q2IA 1F9SA 4ZLLA 2JSOA 3W9IA 1RB0A 4R4IA 1SNMA 4WFN3 4OZ5A 1CA5A 1IKXA 3AJ2A 5FOBB 5F8GA 4ZQ3A 4WK1A 2VBWA 4WE1B 1IBML 4NL5A 3BU2A 2I0XA 2W24A 4B9SA 2JNJA 3MXNA 4LQ3A 1C48A 4X64J 2YTXA 4OZ3A 4DOZA 4UY8C 1DZ5A 2BXJA 2LQ5A 2PEBA 1E2ZA 2YNIB 5CQGA 3PY8A 3M7VA 1QAXA 1VQPS 1OYDA 2RNEA 3CCSA 4Y2CA 1H9SA 2E5GA 4YS2A 2CFMA 1NK6A 4N8NA 2UUAJ 2UXCJ 1ZM9A 1JWSD 5IWAJ 4NA3A 3C3LA 1NAQA 4DUZL 4GNXB 2MO1A 4G7HC 3LO3A 1SIZA 1U1PA 1XYIA 4QYZK 2YKQA 2V6AA 1LK7A 5M5XH 3HOZH 3W1YC 3D0FA 2CPXA 1EAYC 3QO9A 4OX9J 1S6QA 4DUTA 3BYYB 5EX3A 3MFIA 2Q79A 1I4QA 3LPEA 1RTHA 1SFOB 2ASDA 1IBCB 3DXBA 3TP6A 4JI2Q 3RRKA 4RW8B 2Z56B 3OR2A 5L39A 4IO9A 1U4MA 4OJGA 4WE1A 3IN5A 4FYXB 2V50A 4TU8A 5CH7B 1H9KA 2MHEA 1EY9A 3LANA 4DV0F 1YBYA 1H7WA 1WCMH 3D4DA 2DNYA 1I4RA 5M5YH 2F3VA 1UVJA 2JFKA 2OGUA 1MNEA 4KV8A 3PEHA 1RJJA 1VYAA 3S16B 3PF4A 1D1UA 3CDWA 3MEEA 1XQIA 1AB8A 2OSQA 3J7YI 3J7A5 1L0XB 1CQFA 3L2PA 1IJFB 2MZTA 1DGSA 4KJIA 2FVPA 2JEGA 3ET6B 3FSYA 3I4NB 3T1YF 4KMUC 1X5TA 4DF7A 4GNXA 3BQ0A 4I6YA 1GOZA 4A8SA 3BH7B 1BHNA 2FJWA 3QIPA 3L3OC 2B51A 2DR7A 4DV5L 1WEYA 3SI8A 1KN6A 4DQSA 3K2YA 3I9V9 1YVFA 5E7OB 2BH8A 3NCQA 2YNHB 2G5DA 3MZIA 3DHXA 1AZQA 2ROEA 3RAXA 1DRZA 4WP3A 3RB6A 2GN5A 1KNAA 5DQGA 1YNXA 3HKZG 1NNDA 1TS2A 3QJJA 1S1VA 1RXOB 3GJRB 4DR5L 1EWCA 5IYDH 3RAQA 2KN4A 1JLFB 4PWWA 2HQCA 3A8IE 2OF1A 4DA2A 1L1OB 2FJAB 3T6BA 5C42A 2XWBB 1PV4A 9RUBA 2MJNA 4C0BA 1BCPD 2AWZA 3MPVA 2Q2HA 2BR0A 1X3GA 1S5DD 2V9KA 1HXYD 1Q0NA 1A3VA 1B7YB 3NAHA 2E9RX 1YI2S 1VRQC 3D6CA 5C42B 2RQMA 3HKZB 1MWQA 1WCMG 4NWBA 1GQEA 4IFDG 6FD1A 4H13C 2APOA 1H9MA 1PAEX 2J4XA 3NGUA 4A3KB 4RGOS 1HNVB 4QWEA 3FRZA 4LK1C 4PUOB 4NRTA 4WF9Q 3NTHA 5NUCA 3CD5A 4X66Q 3BB5A 4IUTA 3MEKA 1MIUA 2R61A 1Y7PA 1ZS6A 1S1TB 4WFZA 1YJUA 3A3NB 2K5DA 4D3GA 3Q86A 1STGA 3STBD 3ZXWA 4B17A 5IOLA 1CJUA 4EQPA 3PIOA 1HFNA 2J6UA 1QM9A 4HR2A 2GVDB 3CCTA 2UVRA 2GCFA 1VC6A 2JRSA 1CBKA 2P9GA 4CO0A 4YFUA 2E7VA 1YNNC 2UXBL 4AL6A 1S49A 4LBHA 1EQRA 5J2QA 3UDFA 3NGRA 5IT9c 1JB7A 1BQXA 5KFTA 2BABA 2TMPA 3CO9A 1CULA 2UVVA 3EROA 3D0IE 1HW9A 2BV3A 2V2KA 4KN7C 2CQHA 5ETLA 2IHFA 3PDNA 5E3RA 4B08A 3R5GA 2H5IB 3PIPA 2V69A 5DM73 1WOOA 4B3RF 4FXGC 3MM7A 2DRAA 2H4YB 3CC7S 3ONQA 1X4EA 2XIWA 1HNVA 4JV5L 4KK7A 5I3UB 3EVWA 2HVDA 4A46A 1ZA1B 3JAMU 4OGQC 2KEDA 2GA7A 3BS1A 2Y1IA 5IV3A 2GVAA 1U2CA 3C1EA 3J81L 4RLEA 4A3LH 1SH3A 4GS3A 3S1NB 4ZN3A 2SOBA 2CVRA 4BXXG 3IO1A 4HEA9 1HNIB 2O66A 4ED7A 4Y7NB 1JE5A 2IC3A 3DLHA 4MAKA 2MY7A 3G7LA 5CBEE 5AXKA 2OFGX 1X56A 1LYLA 3CB4A 1PXUA 1PIEA 1L0WA 3R1LA 2K1BA 1VQ9A 1JT8A 2VZAA 4DK6C 4DR7Q 2C28A 3I72A 2CNNB 2OH2A 2KCMA 1DLOB 2VB6A 4XIGS 1NHUA 4I69A 2AYMA 3A8KE 2E2JB 3Q2TC 1Y5IB 2PGCA 4NPOA 1NTGA 4L6V3 1MSWD 4DAMA 2PA8D 1JLEB 3PZPA 4ZUJA 3P3DA 2GQ2A 2VONA 4MFBA 5H9FJ 5B0GA 1V1PB 2CYYA 4P9SA 4GRSA 3W5XA 1S6PB 1TUGB 5HQLA 4LF8Q 5K14A 5KG1A 1GH8A 1VQ8A 3I55S 1H98A 1E2WA 2DRBA 4CT8A 3H6MA 2WACA 4HIDA 1RK8A 4IR1A 4K4SA 5EAYA 4JI7J 2RQCA 5FO8B 1QVFR 1YHAA 1G91A 2QLJB 2DPIA 1LOUA 1RABB 1RT4B 2QMWA 2G0IA 3JAMY 4KAIA 3ISNC 4ECQA 3BR9A 1SQGA 3RZDH 3NOGA 1OMSA 3PUYA 1PTOD 4RL1A 4NZ6A 4DL3A 2AEJA 4UW2A 2WFWA 3MMJA 2WBRA 3MTKA 4JV1A 4Q7AA 2JA6B 3W65A 2C2RA 4DLGA 5CYUA 4DQRA 3L7UA 1XMQJ 3H4DA 1S7HA 1HZCA 3V81B 3K89A 1PAUB 3ZYYX 1PILA 1IM4A 3LP1A 3LWEA 2NVTB 4RMFA 3PRVA 4BLGA 4KYZA 5LJ5Y 2F4IA 3J80i 3KHRA 4CLTA 4JBKA 4HEDA 3OFFA 2ZH3A 1P8LA 5DQHA 4JI2F 2MYFA 2HRTA 1LTID 4JI8J 5L1KA 2KXHA 4CO3A 1I4PA 3CCLA 3CRKC 2NTSA 3T1AA 4FF2A 2XO6A 1S0OA 4ZN1A 3J7ZT 1CLFA 4A8YA 4IUQA 4OO1H 2YH1A 2FHOB 2MSTA 5H9FK 2AGPA 1UVKA 4A3BG 3EM1A 3AXMA 1IKVA 3DLJA 1WCMB 2OFHX 4J1MA 2NUHA 1X3FA 4YR2A 3HI9A 2UUAL 5K9FA 3S1QB 2LMCB 3UE0A 1NB7A 4F0HA 4DV3J 1BY9A 1GHKA 1HTLD 3BDCA 4OHXA 4IQZA 3D3RA 3UDLA 2YQ0A 4A3MH 3HOYB 2EXUA 4DU9A 2A69C 4LF7Q 5LMNF 1UEAB 4N9PA 1YJRA 4FXWA 2L4NA 3MCSA 2IJNA 5A0YA 1Q81C 4K8JA 2EYFA 3G48A 3OR1B 1KHIA 2LKZA 4YEAA 1TL1A 4DZ6A 1YWXA 3IR5B 2CPHA 4W4MA 4JBJA 1LTAD 5IM0A 2NVXH 3AOCA 1PH1A 3TVYA 1VBYA 1IBLF 4A3CH 1B9NA 3CPFA 3R3TA 3MR6A 1PFSA 1TIID 2K04A 1PRTB 4A3EH 3SXLA 1TFWA 3CJQA 2EY1A 1N32Q 1P1LA 3CIMA 2RIJA 1YITS 4XQJA 3DM2A 4KC5A 2HLUA 4A3BB 2D69A 2AZ3A 4LF4Q 5KFRA 4DV0L 3HD1A 3A5UA 2XI2A 3ISND 4QW8A 3PW7A 4CO1A 2DNCA 1IXKA 4OLPA 1N34J 4CI0B 5KNCA 5KFBA 2HDMA 3H40A 3LGNA 3T5LA 2F40A 2NLWA 1DQ9A 2V4DA 4DX5A 5KG7A 4GVBB 3T9NA 1S3OA 3CC2S 3PUZA 5DJBA 3G8SA 3SYZA 2XG8A 3M9BA 4OYIA 3B6YA 4EFAC 1NRKA 4LF7J 1S77D 1YBUA 3EUNA 1E7ZA 3FSIA 4RNOA 4X3UA 4DUZF 5J1PA 1T03B 1SBBB 2EOTA 1K73T 1S9EB 4ZUIA 4RFBA 4X62J 1TMMA 3W8GA 2PW5A 2DY9A 5KNBA 2N82B 2HFSA 3CF5Q 4OYOA 4ZRZA 1LW0A 4QR2A 5KOWA 5C2GA 2BJEA 2W25A 1IN0A 3BKTA 2KXNB 4FBUA 4QUFA 4ZLTF 3AXKA 4OX9Q 4PG8A 1U1OA 1PH7A 4K0KF 4JI1Q 3MM6A 1W2IA 4ZP8A 4KFBA 3U27A 1I6VC 3MCOA 4K5RA 3CUNA 2CWXA 3ONAB 2GVZB 3BYTB 1PHJA 2GNKA 4OJ3A 3CMQA 9ATCB 1TWGB 2FLPA 3ITHA 2OMLA 2ATLA 3MMCA 4TQUS 1CS4B 2XCPA 1WSRA 2PMZB 5F3ZA 4CLUA 2FUG9 5IT4A 1FF2A 1WG1A 2BQ3A 3OUYA 4EEYA 2UXBF 2PQAB 2W7OA 2VD3A 1QUQA 1LTBD 1RAAB 3U7JA 2VQFF 3S17B 2KVMA 2P6SA 3MMBA 1CT1D 2IJFA 3H3VH 1S48A 1Q7YT 4M94A 1ZKOA 2JA7H 2CG8A 3C46A 1A15A 1KWMA 2VBXA 2SNMA 3CCSS 3HFVA 5CD4H 4NXMJ 1P8GA 2YXLA 4I7FB 2WB1G 1VQFA 5I42B 4A76A 2NPIA 2FZCB 1TVRA 3C14A 4H54A 2XNRA 3A12A 4KKUA 3HS0C 3G6YA 2XSCA 2R92B 2DGQA 1SYFA 1XBWA 1VQ7S 1WKJA 1HQEA 1XNQJ 1TXYA 4U96A 1T9VA 5A6PA 2NZ1D 2L5TA 1RGVA 2R7ZH 2I5LX 4HT5A 1E6VB 2RHQB 3GV8B 2ZH5A 2LXKA 3GV6A 4K5XA 4K5VA 1EQTA 2W1BA 4OV6A 2BE7D 2MQNA 3A8JE 4DPGA 1KC8T 1HMVB 1WUUA 4OZLA 1SYDA 1IW7D 4QL5A 3W1BA 4O3SA 1JORA 4LMQD 2V34A 3G9CA 4ELUA 2IRUA 4EYIB 4KHPL 4LJZC 1VQ7A 2NVQH 2HWIA 3ENWA 3AODA 1HNXL 2PSZA 4RWXA 2VB2X 5BN5A 1KVKA 3ETOA 2VKRA 5A6WA 3GSIA 3M1VA 5A8KA 3S1RH 4PXBA 3K80C 4H44C 5DO2A 4C11A 3RW7A 5A8RB 1IBKF 4BY7B 3N9UC 4CO4A 1K8OA 3VCDA 3A8EA 2DD8S 4JI4J 2UUBQ 4GC7A 3QRQA 4X4VA 3I5CA 4DR4F 2MEWA 3GFZA 4S3SA 1W7WA 2BACA 4YHHJ 4FKYA 1P6TA 2UVUA 2GVDA 4NLOA 2J5AA 2QF7A 5AJ3Q 4K7QA 2JZ5A 3M30B 4N41A 3M8QA 1HR0F 3ULLA 5FO9B 1EU4A 3OIPA 1L3KA 3K8WA 4HTHA 2DCUB 2RKSA 3BF4A 2X7IA 3EMTA 3UD4P 1WEZA 1X3PA 2IC3B 1Y1VH 4C2MA 2XS5A 1MMNA 4DV1J 2YU9H 3L9AX 5EPKA 2QGFB 5T41A 1KDNA 2B3GA 2FHJA 3HX9A 4X3SA 3CMES 3MUTP 4AYBD 1V3RA 1QVFA 2HAIA 2H4OA 3GDEA 2EWHA 4JI7L 1PZJD 3KJPA 2MKYA 4ER8A 2DO4A 4M5KA 4DK3C 5M5WB 3HFKA 1RF2D 3AU7A 4OX9F 4DR4L 3NGTA 2NR0A 2W2MP 2HFUA 3I56A 5GAGC 3IG1A 4BC9A 5KFDA 2GJIA 2BZ2A 4I65A 3DUZA 1ROFA 2XSJA 3P45B 2LMIA 3GP9A 4C1NK 1SV5A 1SNCA 3HVTB 5GAEU 4LF7F 5ELCA 4FKXA 1U0HA 3VAKA 2HHUA 3NQTA 1F2MA 4J7CA 2MZ1A 3GQCA 2EDGA 2QG9B 2FINB 4A3MB 1FKPB 2ZH2A 1RU2A 3BYPA 1FD7D 1LT3D 2ZOGA 3M8PA 3MXUA 3HGBA 3U9OA 2D9PA 2ZH8A 1K44A 4FNHA 3A54A 2JEFA 4B3SL 2NYZD 1DM0B 2MZQA 2JOQA 4IYQA 1V8QA 4OHWA 3LWMA 4M5LA 2ACYA 4LR7A 4TKTA 3NAIA 1K0SA 1DQAA 1HNWL 3A7LA 1C0AA 3E2EA 1AW0A 4F4WA 2I2YA 4WWSA 4CLLA 3NE5B 1CJTA 4YR0A 3G82A 4AL7A 1XNQF 4NYOA 5ELNA 1UWAA 4CT9A 3BO3A 2F0FA 4JG2A 4ZP9A 4M95A 4HR7B 4DXFA 2K7KA 2UUBL 1S1XA 2RRNA 3NRBA 2QDLA 1C2PA 3NEKA 3AFPA 4XTTA 3IBCB 3OL7A 3DYAB 1HBOB 2W4DA 5FLMH 3MI7X 4FPRA 1FXRA 3LAMA 5LSLA 5DG9A 5IGBA 1SC3B 2VQEL 3W2WA 2BM0A 2ZNZA 2BJ7A 2EFPA 2F52A 3Q8PB 2MKHA 2CH4W 4K6LA 5T14A 1JQYD 4HT7A 4EYHB 2OQKA 5CZVA 2IM3A 3HOXG 4H4KA 3MMAB 4DSEA 4LIWA 5EQ0A 3BR8A 1SYGA 1R9TB 1VMCA 1N34Q 4U7CA 1N5VA 2RHSB 1IKYA 3V4IA 3MM8B 1I4GA 5HBMB 4A93H 3I7FA 1PFMA 2R2TA 3RB4A 2YX7A 2IJRA 3FDSA 3NXZA 3I32A 5FLXc 3ULJA 2LKVA 5CCMA 1R27B 2KI2A 4AYBE 1FNXH 4J9UE 3NMAA 1O7IA 3RZOB 1GFWB 1Q8IA 2Y0SB 4XIUA 3IFDA 1UKUA 3G2XA 1RA6A 2XY7A 1RHQB 2Y0SE 1BCPB 3EJIA 2X3DA 3BDEA 4ID8A 2E9TA 2ID0A 4DL5A 1KQGB 1SKUB 4B9VA 1S6OA 3WOEA 2BW7A 4PKDB 2LYVA 3QAEA 1VISA 2J7KA 2QTWA 4GOPA 4LFCL 4ILMA 2BJ8A 4ZS6A 3CMAA 3K7AH 3AD7C 4RA8A 4BWJA 3GIIA 2HD3A 5C3XA 3J81Y 1DARA 1CKNA 1XMOQ 4PMCA 1N6QB 4PZVA 3NHHA 5EBDA 3D6TB 5LXRA 1OY8A 2EQSA 3GTOB 2QFJA 2DGSA 1S12A 1VIOA 4OX8A 1HUMA 5A76A 4RUAA 4C3KA 1IBMJ 2V4RA 4Q0BA 3L0OA 3TYTA 1RSCA 2JWNA 1CHPD 2PA3A 4JI7F 5KRUA 1D5MC 2RSOA 3BSCA 4JI5Q 1DFDA 2DT9A 3ZZZA 3V05A 5KFIA 2EJFC 1KTKA 4NCGA 1WTVA 4WIIA 5HVFA 2RQ4A 2ZKUA 3I56S 4IFVA 4MIUA 2NVYH 1B0VA 4NLRA 4Y00A 1S6PA 4MYTA 2ZUGA 3J7Z5 3W9JA 1NBEB 5D3IB 2JHEA 1JJCB 1N52B 3D54A 2MQLA 4QR1A 2F0KA 4DR1F 2AU0A 3DRPB 3HOWG 3PO3H 4I6WA 2J0SD 4DI6A 1N5SA 1SJ1A 2K6AA 4USMA 4BBSH 3BG3A 4DCOB 1KLUD 2XSFA 1AUSL 2G2OA 5IT9E 1KABA 1WVLA 5J1NA 4FDBA 3KHHA 1VGYA 4M5DB 2Z2ZA 2QMXA 4ECXA 5KFEA 4R5PB 5D77A 3B4MA 4DK1A 3T1HQ 3DOKA 2FGOA 1XMQQ 3H4BA 1XNQQ 4DSJA 2I5MX 3KFWX 3VGTA 1PYWD 4W98A 4CDIA 3PO3G 1UAWA 4R5PA 5CR3A 4OIXA 5FLXY 1L3UA 5CYMB 3OL8A 3KLEA 1B0PA 1AEXA 5FKAC 4USUA 3T5HA 3CCVS 1R8HA 2E5LJ 3WHIA 4CM2A 1FNVA 1EB0A 2F0QA 2OEOA 3U1LA 1N88A 3W62A 2G2YA 1R0AB 4LF9Q 2QLBB 3LUYA 4NI2B 1UP1A 4BXXH 3A8JA 2GC8A 4LSNB 3HVTA 2FMCA 2G4BA 2QRRA 1IKVB 3M4PA 3BGUA 5IT9L 3FUYA 1PJ7A 1KHWA 2FGCA 3AJ1A 5JOBA 2FC8A 2E2HH 4V0BA 5G3LF 2UXCQ 2B8PA 1T9HA 2G0JA 1G1XA 4TYBA 5IYDG 3PO2B 2BCOA 4YHHL 2VF3A 4LAAA 3T3FA 1QAIA 4HJ5A 1D9AA 3PR5B 4HKQA 2Z8QA 1S76D 2C3PA 3M1VB 3GTPH 1WKKA 4GKKF 4YMEA 3A55A 3VAFA 3GSDA 3UFCX 3A8IA 2CHBD 4UOGA 4C8MA 5IGFA 3P96A 4Z37A 3FZ2A 1ESFA 2ZD1B 1Q3LA 1N8RT 1X3EA 3TQYA 4UZCA 3BV8A 3CDUA 1HNZF 1UJ6A 1X0PA 4B3TJ 1ICEB 1UJ4A 3IG1B 2R93G 3H5YA 2M7SA 3VHQA 3HVWA 4F4AA 1XR5A 1M5KC 2O2LD 1RBOB 5F0WA 3RLFA 3KHGA 2FJVA 3T19A 1NPKA 3OJSA 4F4ZA 3R6LB 3HVRA 1PBUA 2UUAQ 3TAPA 3UD5A 1LM0A 2FZKB 1R3NA 2YWHA 3EDQB 4O0IA 2XBPA 4YCWA 2CW0C 2HYIB 2XLIA 2RDIA 1W25A 1OJ4A 1ICWA 3HT3A 1U47A 4MKBA 1ZPWX 2XYPB 4FVCA 5A0YB 3RLNA 2AT1B 4A3CG 1X9WA 5E3AA 3Q8DA 1Y69U 3M2UB 1L1OA 4X62Q 2E8GA 2OPRB 1WDDA 2F5GA 5ETRA 4DR3J 1EEFD 4ERDA 3KLSA 4LF6Q 4BA1I 4M5NA 2WAQG 4RKLA 5JJIA 5IP9G 1V43A 2ZC3A 1Q82T 4PQUB 5BR8Q 1JWMD 3K7RA 3VGUA 2NUCA 2PI4A 1ILQA 4FYDA 4CHTB 4FN5A 3MVVA 3MFYA 1W2BA 2ZWPA 3S15H 4GKJL 5HL7Q 2B6AA 5K5MA 2YWEA 1F3FA 1HKAA 3Q8UA 1KQSA 1RWWB 5K14B 2FHTA 2CWKA 1I5FA 3CDAA 1CS4A 5JEAJ 1J8IA 5C3EH 1E6YB 3HZGA 2RB7A 2E5IA 2Z0GA 1ITPA 1MG7A 1RKIA 2R7XA 1X54A 3WX4A 5TSSA 1CZGA 4JV5F 2AQ2B 3RTVA 4U9RA 1Q46A 4L5RC 2YKOA 1RHPA 4CRJA 3RZOH 1HYSB 2M0GB 5DDPC 1LK5A 2J7WA 2FY1A 1HA5A 4ZPBA 4A3JH 1A0IA 1KQKA 2VQEJ 4IFDI 5GMEA 1F9PA 1WSVA 4ZPTR 4MTNA 5HMYA 2SXLA 5E2QA 1HUNA 2POKA 3GG0A 4KKSA 2PQEA 1D3WA 3EXYA 5GMKa 3H0GH 3OXGA 2E1CA 1EIFA 1U02A 2R7SA 1N5YB 5HP1A 4F4KA 4JK1C 2R4FA 1SKSA 1QAJA 1UE7A 1PRTF 3UNGC 2B4VA 4WU2A 4ID6A 3M8PB 2QKIC 3OBIA 1IZ6A 5KGUA 2HS0A 2IL8A 2FD2A 2VC1A 3KOAA 4IG3A 5ETVA 4DL2A 3VVUA 4BBRB 3SQOP 2PMWA 4TRDA 4IH7A 2DTJA 1FJ7A 3PIO3 4GVBA 2EY2A 3AQOA 1SJHD 5D0RA 2BEFA 4NMXA 3W7BA 4DL6A 2R7ZG 2K7VA 2GIFA 1QVGR 1OSDA 4EO6A 1EZ8A 3EICA 2ASJA 3OTOF 3JB9k 4ZLPA 3QSIA 4A3IB 4DV0Q 3FRYA 2F0VA 5C0XG 1UMJA 1X4HA 3K0XA 1DOLA 3KDNA 5IYBG 1A7GE 1EP4A 1HBUB 5AT1B 1HBOA 3PGZA 2NSCA 1WI6A 3ZZPA 2KM8C 1VQBA 4KHMA 1XK8A 1HARA 4MTKA 2VUGA 5HMZA 1NR2A 3KF6B 2X1BA 3HKSA 2PMHA 2HWTA 3IRWP 2MFIA 1HFGA 3PSIA 3J80L 2RVLA 2X1AA 3BDOA 2A1BA 3SK4A 2IJ0A 2IBOA 5E3FA 2KUMA 4B3TQ 2UU9L 1PH8A 2Q6CA 5I2YA 1KP6A 3TX0A 4CDFC 4KHPQ 3BGRB 4J8QA 5C25B 3QMQA 1N33L 4ZIWA 4K8IA 2HHWA 1EY7A 4RNMA 4HLBA 3CXCR 3K5NA 3QNWB 2KFZA 1HR0L 4KH1B 2V5HG 3DRRA 3ZZ0A 4DR5F 4ATNA 4C4WA 3O2IA 3FBFA 4RW6A 1F9EB 4KJOA 1BR9A 4ZVRB 1U1KA 4RR5A 2K75A 2UV8A 3F2DA 1H7XA 1FWPA 1D9DA 2QMUB 1SXTA 1N36J 3PX6A 3AFQA 1GXLA 3TVZA 5KFHA 2K5VA 1N6QA 2VBYA 4X3KA 3DI6A 3KLFA 4P7TA 1MD2D 2XZWA 3M30A 1NDLA 1Q82C 4QOTA 1EY0A 3UCZP 2G9DA 3KUHA 4L5QA 1RT4A 3TOQA 1RHUB 1N32J 3CE8A 2KHJA 4ZITA 2L9HA 2JA5H 1NJXA 2HGLA 4Z7YA 2I8EA 4LF9J 1UWBA 2HNDB 2K7JA 5B09A 3T1YJ 3S14B 1RTHB 2CQ3A 1SDFA 1IWAA 2B8GA 4QU7A 2ZXPA 3ZZOA 3X1LB 3C15A 4X4RA 1QOHA 3I4MG 4LF5L 4MH8A 2ZITA 4DXGA 2VJUA 4DPOA 4LF8J 1ET6A 3M7GA 2VUMG 2PYKA 2AQ4A 2YNFB 5D4OA 2CJQA 2VOPA 3N0VA 2AIRB 3MR3A 2A8VA 1HLWA 1LEOA 4I68A 4JI3F 3C1FA 4IRCA 2QEXS 3GD7A 4KB7A 1MU2A 2KZZA 2ZJRA 1MSGA 5KFVA 2CG4A 4K4YA 3R27A 3F8TA 1BOSA 4A8KA 4DSLA 4FP5D 1K9MT 5JPNC 5LL6S 1TKTA 4JOUA 3KLSX 2PZWA 1I6JA 2ZHAA 1QE1B 2R8IA 2OUGA 2DGVA 2B4UA 4X4TA 4K8RA 1T02A 4RX6A 2V2VA 5HJXA 3E3XA 2HBQB 4GLXA 2QYCA 1HI0P 2PE8A 1EZZB 4WPAA 1KHVA 3OTOL 1K47A 1B3QA 2E5HA 4KH0B 2F4VL 1UE6A 4HIMA 1D7QA 1FDDA 1X65A 4PNYA 3NK9A 3LPYA 1TKXA 4LFBL 3OSNA 1LFPA 2UU9Q 3UE2A 1BBUA 4YDXA 3N6NA 1AUDA 5ETPA 2WINB 3RD4A 1LLRD 1NMGA 3ZZTA 1BXNA 3RJMB 2MPMA 2BQUA 3VALA 2G13A 1U6BA 3DM1A 2Y3YA 4W90B 3A74A 2VICA 3F2BA 2HHHJ 2N49A 1NMFA 2VUMH 2HEKA 2HG4A 2WVDA 3A13A 3FFIB 4BS9A 4DS5A 2KJVA 2OPQA 3N01A 3IRBA 4K4UA 2L1BA 3NP5A 2M5YA 3GV7B 4R25A 1GXDC 2E5JA 4F36A 2DHXA 4GN4B 2JC1A 4POGA 2CJBA 1CC7A 3MEHA 2U1AA 4F26A 4OJHA 4DR3L 1T05B 3CJKA 1N33F 1NXIA 1STHA 4H4MA 2Z58B 4PCQA 5HAOA 2VNUD 3D3BJ 3OUYB 1J9OA 4MIBA 4EWTA 3D28A 1NH8A 4W92B 2EY6A 4IO1A 3N28A 1HQUA 1XTCD 2IPKD 3LP2B 3CKIB 4ED1A 1Y1WH 3O44A 4R0JA 4NCBA 3UN2A 3RZAA 1HNXJ 2EFGA 3V4MA 3R5JB 4QIWE 2BM1A 3RGIA 2NWGA 1F6TA 2DXEA 3PHTA 4ZA1A 3M4OH 4KFBB 1L2FA 2RBMA 2YKNB 4N76A 4QGUA 2LXIA 3OW2R 1SCJB 4M63A 3X3UA 2EPIA 3J80Y 3VAHA 1WTRA 4L5SA 4JI8L 4FS1A 4KSEB 3CJRA 5KFWA 1A2UA 2J8AA 1PLFA 3IFEA 3JYTA 2AJ2A 1ZYRD 2W7AA 1EHWA 2OHDA 1D0EA 1SYCA 5LOQA 1Z4UA 5KYLA 4PZ8A 5I6YA 4I67A 5I3PA 1LTSD 1X4GA 4A3FH 3FEXB 1I5OB 3PKYA 1U0HB 2CUYA 3RR5A 2K3KA 2CZ4A 3G6ES 3CCZA 3GLJA 2OSRA 4PZ7A 5IWAQ 2B2TC 3HHLC 2HHHF 4X66L 4WJBA 3HCXA 2DHHA 1OIAA 4DR1L 1QNUA 3MHYA 7AT1B 4JC0A 2X69A 3DXJC 2X1FA 2L0CA 1VQOS 2G1DA 4V19J 1WTOA 1SUQA 4HIKA 4LFCF 3VR1A 2HS3A 4ECZA 4MZ9A 3W2DA 1JJGA 4USWA 4ILWA 2NTTA 5EHHA 5DGBA 4UP7A 2CCZA 2FB0A 1PTOH 2HGNA 1IVZA 4N9TA 1FRJA 3BKFA 2VFSA 1GUGA 2WW8A 3G6EA 4ANEA 3T5KA 4NZ0A 1YJ9A 2IYIA 1TS4A 2LEAA 1TL5A 2W4CA 2JA8B 3MTJA 1CKOA 1LWFB 3WIVA 1XIQA 6FDRA 2PT0A 1YI2A 3R7NB 3NY0A 3RB0A 2FHKA 2I38A 4DR5Q 1I3OB 4U95A 4LF4F 4DV6F 1RZMA 5T7LB 5AXNA 2CPJA 1N34L 3K59A 3CAMA 3KUGA 3HOVG 1A0OB 3G8TA 4K6DA 3W66A 1VF7A 2FLOA 2VKZG 1B70B 4UHVA 2HNDA 3NBPA 1RWOB 3RBDA 3OTEA 5DM6Q 5KNDA 4HYKA 2NCKL 5DETA 3IXQA 1S6QB 3JAMi 1RL2A 5B0AA 1FVQA 2XB2D 2ZTCA 3DM3A 5HANA 5HGTA 2QJ3A 3MM8A 2B4PA 2AEFA 4A3DH 2NZ4A 2VASA 4ZVFA 3CJ0A 1O80A 2UUBJ 1NO8A 1QJOA 4QR0A 2DHSA 4ZK7M 1K0RA 3PIPQ 3HVAA 3QIPB 4L63B 2RQXA 3NELA 3OW7A 3PYEA 2LLZA 2ZZMA 2DHAA 4PQXA 3MAAA 5E33A 4EK2A 1JLGB 1S4FA 4G3IA 1M5OC 1KIXA 5EKLA 1QZGA 4DF4A 2BE2B 2Y8WA 5DDRC 4DFJA 4Y65A 3NNCA 2IRYA 3ITHB 4B3SQ 1TY0A 1UVIA 3UE1A 2ZXRA 3BSAA 2Z6BA 5EPLA 2UXCL 4RWWA 1LWCB 4IUNA 1PTOC 1YNJD 2COLA 2JA6H 1X32A 2WIIB 2XWXA 3S1TA 3NBHA 2GAHC 1KQFB 4DUZJ 3GMGA 1SYEA 4B3RQ 3GWCA 5B0DA 2KO1A 1DTTA 4RHSA 3M2VA 4DX6A 1WELA 3MMBB 1WD0A 2RDGA 3GB0A 4J9NA 3M4YA 2MQ8A 1FTCA 1PH5A 1EIHA 1KVJA 2HFNA 1XTZA 3DLKA 3AD9C 3C19A 2N7YA 2O5IC 4MKVA 2M3DA 1Q78A 1I4XA 2Q2TA 3PJ9A 5M3MH 2EYMA 4QW9A 1HWJA 4TNOA 5ETQA 3MDFA 1S1XB 4I0WA 1CVJA 4KGMA 2EKNA 1EFWA 2YTCA 3P49B 1LWXA 2H5EA 4MNOA 2V8PA 1A63A 2A3JA 2B2YA 5M9OA 2A68C 4ALPA 1HNWF 2EC0A 1CJVA 3G6JB 2CQIA 5IODA 2J0TD 1TL3A 1Q1BA 1S5BD 1XNQL 2HT1A 1AYEA 3UN5A 2KVIA 1TT2A 2PNRC 1N36F 2XGQA 5D15A 3PRBA 3W61A 1HZAA 3I4LA 3BGLA 5E3PA 1BBWA 1JWWA 1QZHA 3CJ4A 1RT7A 5K36H 2G1HA 1KDCA 2HK2A 1HQMC 2R2UA 4Y6IA 3UDIA 4IDKA 3AOBA 4NEZA 5FJ8H 5J1EB 4X65J 2W9CA 2GO9A 4RZRA 1R0BG 5KG5A 1E3PA 2KQ3A 1REGX 5M3FH 1H3DA 4Q44A 2U2FA 1R8CA 2B4OA 1DZ1A 1IQTA 3SSQA 4QIGA 4IPHA 3PW0A 5LSRA 3OTBA 5CORA 1VK8A 3NNAA 1M1HA 3TAQA 1CQNA 1PYSB 2Q2UA 2LFVA 3KK7A 4PR6A 2VQFJ 2PI2E 2CQ1A 1M90T 1JLAA 3V2TA 3OTOJ 4L74A 2QA2A 3LW5C 1EOVA 4WJ3M 2L08A 2QA4A 3TQEA 2AJ4A 2UUBF 3MEGB 3AMUA 1FX2A 4DV5F 3M8YA 1FVIA 1YLXA 3NQIA 4DR5J 1SL2A 4LFBJ 3OHBA 2VIHA 2KHDA 3F73A 1W2BR 3OSOA 4C3HB 1JLAB 1RBAA 1GXTA 4DN4M 5D8HB 3OFEA 4URQU 3B78A 3MFGA 4DV6Q 3QIDA 1IYJB 4GLAC 2R3VA 5I4DA 1Y1WB 3FCWA 1GMWD 4XYOA 4NLPA 2DCLA 3EDRB 4IO9Q 1RT7B 2QL5B 4B9WA 1HPCA 2OELA 3M4OB 4IDKB 3I90A 3V6DA 1WC1A 5K8MA 5IC6B 3DLGA 2DY1A 4DAYA 2H4WB 1VQNS 5KFOA 3QZ7A 3CRLC 3M3YH 4B9XA 1SFOH 4OYWA 1UNSA 2YWGA 4U8YA 1LFWA 1UEKA 3HDSA 4F3OA 1NY4A 1X31C 3P5BP 1DYQA 3O8WA 2CQ4A 2DYAA 4S0MA 3AYHB 3SCKE 1F9RA 1VI7A 1VS0A 1S79A 1CZWA 3JTPA 3WZ0A 4L3KA 2XMAA 4WKRA 1K1QA 4ETZA 1V1OA 4A3MG 1BDOA 1YHBA 1PH2A 2GAGC 4B3OA 1WF0A 4LFAF 3PG9A 4Q5VA 2GFFA 3S16H 4F2SA 4FXDA 2IAJB 1YRTA 4ZPAA 2HBRB 4UAIA 2K32A 4FYWB 2A1AA 3UCUP 2VFRA 3SV3A 3BPDA 4MFBB 2LA4A 2ALYB 2K5NA 3BBFA 3AT1B 3NG8A 4AFFA 1MI2A 1IKWA 4XPEA 1YJWS 3KUEA 4YHHQ 3TP2A 3DRSB 2Q8IB 4WXWA 2ALZA 3KG4A 1IKYB 1WC3A 2Z4PA 1ONLA 1SE3A 1F2GA 2KJWA 1T7PA 3CHBD 4P2MA 4RGMA 3OR2B 1PFBA 3VZHA 4A3IG 1C1CB 2N88A 5LL6X 1HNWJ 4L75A 1KAAA 3QWPA 5LMNJ 1SE2A 2LU1A 5IYCG 1PO6A 4JV2A 1ZM4A 3DCAA 4AH6A 3Q6SA 1J6QA 3FRPB 1IBKL 4QQBX 3TUIC 1PJ5A 4I2QA 2XC9A 2HVZA 2HW3A 5FLXE 4IFDJ 3BBCA 2RS8A 4HL9A 2R42A 2MNAA 2HIQA 3BJUA 2B43A 5H1SV 1I51B 2ATWA 2F9JA 5IFMA 3FQKA 4A3KH 2XWJB 1IM6A 4DR6L 5DQIA 3PUVA 3K58A 2VL1A 1ACMB 4H0LC 2DITA 2WB1E 4GKKJ 2EE1A 4LF1A 3BJYA 1U1NA 4Y2KA 4XT1B 1X4BA 3HULA 4ZPVR 3GFXA 2HNZA 5DDQC 1Z9FA 3G6VA 5KFLA 1NK7A 3H09A 1HYSA 3V81A 1TWCB 4OI0A 4JOIC 4X65Q 1FWKA 2VJVA 1P9YA 2HNZB 5F8NA 2B39A 3DLKB 3IGNA 3PR4A 1BMQB 1HZ9A 4KKTA 2DNKA 3DLEB 1MU2B 4MT1A 4K50A 4OYBA 1LUZA 5CCLA 3G6XA 1B1ZA 3MXPA 5LMUJ 4ZKAA 2F0EA 3V5RA 4LF6J 2XMWA 2H1EA 5G0RB 2B63B 1KDBA 4LMZA 1CSQA 1C7YA 1QUPA 4RW4A 5IM0B 2C9OA 2J76E 1PJ6A 4HSVA 2HIYA 5KTQA 1KFSA 4CLKA 1OQ6A 4UP8A 3L9ZA 1BD6A 4CQ1A 3VAIA 2VODA 1FKOB 2F0MA 2WAQB 3BZQA 3BSNA 4JI3J 4KBIA 3MR2A 3NGKA 1ZTWA 4MKAA 4ED0A 1XN9A 4MK9A 3VQSA 2DKOB 4RNFA 4B3MF 3LWLA 3GR1A 1CSJA 1TKZA 3ILLA 3VR3A 3ICEA 4TY8B 1Y00A 3CC7A 2JH3A 4WFAQ 2D7SA 3OLAA 2BKNA 3IC1A 1SMXA 3JXOA 3NOCA 2BA9A 1ZAVA 5L46A 3KG1A 1NUEA 3CCJA 3ZNUA 2V8VA 1EKSA 3JSRA 1SNQA 2ZD1A 2ZT9C 3RW6A 5F2DA 4NZ7A 2JLEA 5EPJA 4YWLA 5M5YB 2ZVIA 5HATA 1HBMB 4O3QA 4Y0FA 3CCRA 4LWCA 4NLTA 2HLTA 4C3JG 3L3CA 4OO1I 2E66A 1GTEA 2HVIA 5JEAG 3TR5A 2YKNA 3NBPB 4DX7A 4YY3F 3S01A 4CYUA 3M8WA 3MPYA 2RA4A 3DMUA 1HD1A 2HRUA 3D0HE 3CCEA 3CCUS 5ETTA 5FD1A 4KD4A 2AJFE 3MR5A 2GJFA 2CAJA 2DNMA 4ILLA 2F9DA 1MN9A 5KT7A 3RB3A 4KGXB 3FKIH 2VHGA 4LF2A 2D41A 4DV4Q 4A93G 3URYA 3L95X 4KPCA 3LP2A 4QBUA 1SC6A 2HFZA 5DEHA 1VMPA 2K06A 4UOHA 2WAQE 4ME3A 3HOXH 2Y0BB 4LUZA 3GG1A 1GX6A 4HJ8A 1FEHA 4AT1B 4DXLA 3D1HA 5IP7H 5HLFA 4NCGB 3ZO7A 2MXYA 5GADI 1XMQF 2B56A 4LQ9A 1HJPA 3S8SA 1G6BA 5C0XH 3JQJA 3RLOA 2IWHA 2VA3A 2ROGA 3JTOA 4G57A 3WX8A 3E8OA 3UI2A 4OWTB 3KLEB 4FXKC 1YQHA 4OI6A 3KJFB 4X65L 3V96A 2LEPA 3IAM9 1GVPA 2NXEA 2AGQA 1BUXA 4LF7L 3QFHA 2JEBI 1RAJA 3KLGA 2WONA 5IY0A 3F0NA 2HHVA 2JLGA 3NTKA 4NCAA 4WTOB 3T53B 2F0JA 4OL8A 1Y1VG 2KYZA 5CV5A 1VQ5S 4X62L 5C3EG 2H65B 2OT2A 3U4VA 1JMTA 1VQKA 1CJKA 1HQUB 3GONA 4DFKA 2DY7A 1F2YA 1S72A 4HACA 3TZUA 1MLAA 1PMRA 2B7CB 1N33J 3AOAA 2ZJRQ 1GUSA 4CH0S 1CA6A 1JLBB 4K0KQ 4HMIA 2UP1A 4ELTA 5FLXL 4I2PB 3WQPA 5L9XA 4C98A 4J15A 1U25A 1HHQA 1HMVA 3EX7B 4JI5J 4IH6A 1OTCA 1ASZA 4X84A 5KFKA 4C11B 1PC5A 2NYHA 2V2QA 4O44A 2D5DA 1P1TA 4P7VA 4TXSA 3HG9A 5B0FA 2PNHA 4PG4A 2UXDF 1S72S 3FKBA 5DLFA 1EY6A 5D3GA 2CQAA 3TAMA 4ES2A 4DQIA 4QY7A 2RAQA 3QFWA 2LQJA 1EEID 4ZJLA 2EK6A 2FPHX 4QYZJ 2LU2A 5KFMA 1QG7A 4ED3A 4QYRA 1QSYA 1TKTB 1SC4B 4EMDA 1ZYRC 5M3MG 2HVEA 4FYYB 3H25A 4NPSA 4R4CA 2I5JA 1S0MA 2JEIA 4A3EB 2KCCA 4KO0B 5KOXA 4PWUA 1Y8PB 1B2TA 2D2CC 3HOZG 4IJHA 2P5VA 1K0TA 1SNOA 5A2QU 4HDHA 2CQGA 3CCMA 3DLGB 4B3ML 4BY7G 3OPKA 4GO5X 2E76C 3SCJE 4KY5A 1G7CB 4F2RA 5C44G 3GP7A 2IVMA 1AZSB 4LF8L 5JAVA 2CVEA 3I4MB 3K17A 4P2XA 3V2UC 3VR5A 1PYBA 2E9ZA 1C0UA 1XR7A 3R5BA 2M52A 2CPFA 3PO5A 3IKJA 3LP0A 2F0SA 4F3MA 2GVBA 1F2ZA 3D4RA 1NMEB 2HQGA 1D5XC 4CNZA 5HJYA 1MKHA 1EX8A 3GCXP 4QIWB 3R6GB 4OYPA 4CH7A 3KK1B 1E2VA 2XRQD 4PAAA 1S4ZA 2HCCA 1PCAA 3DI6B 4AYBG 1YG0A 3VR2A 1KTQA 2WTFA 3PYDA 3BO4A 3MD1A 5C4JH 1WHYA 1RQ0A 1KR4A 1C0TA 2ICIA 2AYEA 4BBSB 1YHQS 3I91A 1I94Q 2C2OB 3V4IB 1UFKA 3S2HB 1HQ2A 5LM7E 1TWFH 3AEVA 1E1OA 4DUYQ 1TWCH 3CVKA 2W4PA 1SV5B 1UZDA 1HWKA 3IWLA 1CKMA 4PG3A 3W9HA 1G291 3KNGA 4BWGB 2E7XA 1VCTA 1NK4A 4J9OA 2F4VJ 2JYOA 4K4TA 2X51A 3DXSX 2F0TA 4JYAF 2HHQA 4DV2L 2AF6A 2XGTA 3PFOA 4EZ9A 1K0VA 1JOKA 1ZZFA 2JA9A 2F0WA 1SUQB 2VFTA 5EX0A 2DH7A 3RZDB 1WKLA 3UQSA 1IR2A 3HHKA 2Q8TA 2B63H 1T94A 3V6HA 1RT5A 5IS2A 5DZ7A 4DV7L 4C8NA 3OIQA 2GIRA 4Y52H 2IVFB 4Y2AA 1TUWA 1TQLA 1V3SA 5CA5A 4GKKL 1S97A 5CV6A 1H6KX 4K2KA 3E51A 1KSPA 2B8FA 2XZDB 2Z8LA 5C7PA 1J27A 3H8YA 3THPA 1V6HA 3AA8A 1RTIA 4RW7A 4O42A 1B3TA 4C9DA 4B3MQ 2AZ1A 5J3BA 1RTNA 3SK6A 3TA1A 1DURA 1IKLA 2HRYA 4JI6Q 1URNA 4TKOB 4J9SA 4C2MB 2E2DC 3VYRA 1TAQA 1S5CD 3U9SA 4CJ0B 4J9MA 1PBAA 3CU7A 4X64Q 2AW0A 1R8PA 2DO0A 3F41A 2R8KA 2LDYA 4RCOA 1O78A 4EBCA 2N4CA 4H7BA 3VGVA 1T11A 1CI3M 1VQHA 1NSKL 1FEEA 3EA6A 1FJEB 4JI2J 3AB2B 2IVYA 1PKUA 3JAML 3KXDA 2ASYA 3VF0B 4NLSA 3UN3A 5KFYA 5J2NA 3B8HA 3M6XA 4JI3L 2B5JA 3HSGA 5KG3A 2AEMA 3SQGB 1K1SA 5J2MA 4DV7Q 1CKNB 1FGUA 2C35B 4OONA 2QCPX 4NYZA 1NKEA 4IPGA 2DNLA 2DNOA 5KFAA 4A3KG 1IXRA 4XDXA 2XLKA 3KK2A 1OO9B 4AYBB 4MIAA 1D6EC 4AE5A 1OXUA 1VQDA 2OIHA 1LWCA 3DU6A 2Q66A 4L6TB 2CW0D 1TTHB 2QO3A 1EARA 3O13A 1RKJA 3I5BA 5H9EK 4X66J 3U1MA 2OKQA 2K28A 4C8OA 4A8QA 1EQMA 1S1VB 1XWLA 3IMQJ 4CJ2C 3VDYA 2DNNA 1HR0J 3TA2A 4WORA 2F8EX 3IRXA 4LF9F 2MQPA 1QCBD 2MJUA 3KDFA 1HHVA 2ZFHA 3UVJA 1VS3A 3Q8RB 2R8JA 3FFIA 5EDWA 4WJWA 2DH8A 1SXLA 1R4QB 1JIHA 4Q8EA 1LXJA 3E9HA 1VHIA 2YWWA 4ITSA 3FEZA 3J7ZC 1N36L 3JSMA 1KC8C 2XTIA 1T3OA 1R8BA 4ZVSB 1T05A 1SYBA 2XN9C 1SMYC 4V190 1YJTA 1WC6A 5F8JA 3TMEA 3FEYB 1A6XA 1PSDA 4URGA 5M2PA 1SL1A 1GUOA 4OHYA 1OXSC 1PH9A 3FHWA 3CCRS 3G4SS 1G3OA 2I5JB 3KK3B 1RHRB 3WOFA 2MJ8A 3TSSA 4OZ2A 1NJIC 2K1RB 1D8YA 3M7NA 4QUCA 3HPOA 3I82A 4RBUA 3BH6B 5LMNQ 1WACA 1JXEA 1T3NA 3TS2A 4CLFA 3C2PA 1IUJA 4CTAB 4E2FB 3FZBA 4WZQA 1Q12A 1FE4A 2MZJA 5F8MA 2YKAA 3CJSA 3M6VA 5F8LA 5FO7B 4CZCA 4AQYL 1SN8A 3S17H 2DVIA 5JPMC 5CC4A 4LVOP 5D14A 2CWAA 1WTHA 1JXVA 1NPRA 3BM7A 3FPPA 1IR0A 4LREA 2HDLA 5J1ZA 2BJ9A 3H5UA 4O44B 1X9SA 3JQMA 4CLYA 2FJDB 1G6PA 5B0CA 2RVJA 4M1KA 4EQNA 3RN2A 3R5CA 2MGSA 1Q5VA 1RHJB 1EYCA 1BWEA 3NMRA 2MHNA 3N5BA 4KLKA 3HF5A 2F0HA 4JI5L 2GMHA 3VGSA 3OW2A 2FLNA 3SGIA 4CIOA 5IGDA 4JI7Q 1HA6A 3CP0A 2R92G 5IT9Y 1DOMA 3N6LA 2WRMA 2IMWP 2J9DE 5T7LA 1LTGD 4KT0C 1U09A 2HBZB 1ZZNA 4DUYL 2W9BA 3PF5A 2XTJP 3R2DJ 1EKRA 4U7UD 1FCAA 4HCEA 2H3EB 1I94L 3IWXA 4NE9C 4BC7A 2CQDA 2B2VA 3JSYA 4RU9A 2DPJA 4PPDA 4K2LA 4DPYA 5BR8F 1YVCA 5JJZA 3RR7A 1VR6A 1ENCA 4F50A 5ADZA 3ETMA 5GAHC 1SI9A 2R7OA 4DL4A 2EYOA 2VY3A 4USIA 1KLMB 2KA7A 5J2QB 1MWYA 1RISA 5C4JB 3ENAA 2MZRA 4RW6B 2V8GA 4A93B 5L9NA 2AMCB 1WTPA 2B9WA 4X4UA 1S4EA 3P4UB 3N4WA 3VA7A 2FJXA 2HCIA 5IZHA 3TREA 1RT1B 1FR3A 1YTYA 3S1RB 5GQOA 2LY7A 1YIJS 3R7BB 1LTTD 2IIHA 2BVZA 2CJ9A 1UA1A 3POTB 4CDEC 3D6FB 5KFUA 5CAAA 2ZHOA 3MHBA 3GJSB 1PVOA 1Q5YA 1VDZA 5D0GA 4CLZA 4CBVA 4UOCA 2HUGA 2A18A 2DIUA 4MMOA 2VQFQ 2AJQA 3K7AB 1ESRA 4DR3F 5A8WB 1RAFB 2ZDOA 2KU7A 5IT9U 3KF8A 4O3NA 4R8UA 1WHVA 4B02A 1YJ9S 4A3GH 4H4OB 4C1NI 1LT6D 1M5PC 3HMJG 3W2VB 1YITA 3D66A 1T8EA 2OI2A 4RKBA 1RT2A 1Y0HA 2UUCF 5CBAE 3OR1A 1S1UB 2PI5A 1SQEA 5F9LA 3NWRA 2AYGA 1JJ4A 3RNUA 4OELB 4YIJA 3PUXA 4CGYB 4YWKA 1HR0W 1RCOB 3K81C 2G2ZA 3ZTSA 3W63A 2F3WA 4KO0A 2KG1A 3I0SB 4B9LA 4N8OA 5M5WH 3RRHA 3CD6A 3LQVA 1J5OA 1LO5D 4K5WA 1EWHA 3W64A 4WJ4A 1T9YA 3QYYA 2WKCA 2PI2A 3D4WA 1HPZA 2E44A 2RH3A 2EXZA 2XULA 2B63G 1WNEA 3S14H 2MDAA 1JLCB 2A69D 4L5TA 1UUPA 2DGOA 3DMJB 3UR0A 2XY5A 4R9WA 1TL7A 2I1RA 3OXFA 4AUKA 3M2VB 2IA6A 1STYA 5C44H 4NASA 3KLHA 3PO3B 1CC8A 1DTQA 1EJ7L 4ALZA 4HTIA 1NJIT 1N54B 2XNAC 4DR1J 4B3TL 4FXVA 1TL7B 1HNZQ 3M85A 5KT5A 4N77A 2ACMA 2RU3A 1DD2A 1T9XA 4Q0BB 2C5CA 1FTRA 2FVQA 2FLLA 5IGEA 3TX8A 2QA4S 2FJ2A 1BUVT 5FK9C 1RADB 2QIFA 2H51B 5GAGU 1RYSA 4V19X 3WC2A 4DR4Q 3NS7B 1VHFA 1NSNS 2EFOA 2FC9A 2A74C 5G0RA 1EQ0A 4YCVA 4JBWA 3PW2A 4LT6A 5ETMA 5F9NA 4KHZA 1EQVA 3QO9B 3Q8SB 1VLYA 5J2NB 4DZDA 3MCMA 1V5IB 1U8WA 5F41A 1OY6A 5CV7A 2RJZA 1X4CA 1IYVA 1FJGQ 3OTDA 4I1TA 1B7FA 3H5XA 5D3GB 4DV4L 4LBIA 2HFVA 5HP1B 3PQIA 3MM5B 1NJZA 2Y0SG 2EG1A 2GV1A 3PW4A 3QIAA 3KK3A 3BZCA 3LH2S 5ELBA 2L3MA 2R93H 3MWYW 2C2KB 2B2YC 1CJTB 1XMOJ 2FIUA 1IQZA 5F3TA 5HLFB 1Y4ZB 1MW7A 2ZOMA 3IR7B 2LXJA 4O3PA 1FD2A 2YKPA 1P16A 1KVIA 1X55A 1OXXK 1R9TH 2E2HB 2B0GA 3D3CJ 4U8VA 1WF1A 2N4DA 3S9WA 3SDZA 3GTKB 2HWHA 3H42A 2D3O1 3CC4A 2NXCA 1U4RA 3TRGA 3TA0A 1AT1B 4KY6A 4BY1G 4FBTA 1M90C 3FEWX 2MPUA 2KZMA 4I4BA 1NAPA 4IOAQ 2X1GA 4NKLA 4KGZB 4CYUB 2QV6A 4LIRA 4QJFA 2F4FA 2KT3A 3TUZC 1WHWA 3OT9A 4UP9A 2GVZA 4ANDA 2W01A 4PRFA 3OQ2A 5KFXA 1DY3A 3NWGA 4C3IG 3BGFA 4LJMA 1JLQA 1E1TA 3NL0A 4HMJA 1RIPA 2XWYA 2BX6A 1CJUB 1T9WA 2D1CA 4LUBA 4WP8A 4NXMF 4M8AA 3CJ3A 1PRTC 2R6GA 4HSPA 4CDCC 2WBMA 2KRRA 3GTOH 2W7PA 4LRFA 3CD0A 2DK2A 4DF8A 3R93A 4BY1H 1APSA 4ZKBB 3B6BA 3A3OB 4ZVQB 5ELEA 1S99A 5BXIA 4JI1J 3FQLA 2O5DA 3HKZD 3B54A 4ECRA 4B9MA 1W26A 2EBEA 5M2RA 2JQOA 2YX4A 1Q7YC 1EOTA 3W3AA 2FYXA 1DJ0A 2A0FB 2F63A 5LMUL 4UUXA 3SDEB 3LA0A 4LF6L 4F8MA 3L09A 3RG6A 1S1TA 4FNIA 5GADC 4HTJA 2OQ0A 5EWEA 1KRTA 3ULPA 2CQPA 4HVZA 2ZM6F 4GLVB 1I1GA 1BXTA 1WI5A 1S1WB 3H94A 4JBMA 4OL7A 1JLQB 1BO0A 1W6KA 3B4DA 1FRHA 4DPUA 4LSLA 3GTQH 3HKZE 1Y5NB 3LGJA 4PZ6A 1RT6A 3S15B 1AFIA 2A6OA 5LL6d 3LOUA 2DGYA 3QO2A 3R2TA 1H2VZ 1SKWA 2VQEF 3QB3A 4NXNQ 1JWUD 1VQEA 1YNND 2PEHA 5T1IA 4WFNQ 1U5KA 1L3VA 2D0OA 1U8SA 2KH9A 3KLIB 4JP8A 3DRRB 4JI6L 1R7IA 1KDAA 3GPAA 4LSZB 3VAMA 2D9UA 1RT5B 2Z4IA 4IPCA 4BBYA 1JE4A 1X60A 1ENFA 3F1ZA 2BE5C 4R1JA 4R4QA 2N3OA 1OYEA 4A3JB 1C1BA 1IKMA 3L4BC 1VIXA 3PYGA 5HGQA 3S7RA 4C3JH 1FL0A 1F5BA 2OTLA 1TS3A 2ZM6L 4E6IA 4PG7A 2F0LA 2J9EA 1RDRA 4DGZA 3SSRA 1S9FA 1EETB 1VRUB 1XMOF 3GIRA 1VQ5A 4NI2A 4NEYA 2C2EA 2CPIA 1YJ7A 4C8YA 4A3GB 2X3GA 3CXCA 2JFDA 1N56A 2R7DA 4OYMA 1MWZA 3PX4A 5F0UA 2ZJQA 3CCQS 1FX4A 1UW4A 1D9FA 5D4LA 4ECWA 1U1RA 2CADA 3FCHA 4K4WA 3FBEA 4F88A 1EUJA 3KYHC 5FDLA 3CQZB 1FFGB 4WK3A 4K2JA 2UXCF 1Q16B 2MB0B 1KRSA 1U2RA 3DNCA 2P8IA 3EPIA 1C1CA 1KOOA 2PFFB 3I6PA 1R0CB 3BDLA 2DIVA 4EGLA 3ND9A 4LR8A 3DLEA 2JJQA 3PO2H 4USKA 1N32L 1H73A 1YBTA 3TS0A 1XPOA 3D1OA 2ZOFA 2ABYA 2D62A 2XI3A 2Y1LB 2I0QA 3IM8A 2ATCB 5EBCA 3T1YL 1R31A 1TR5A 3IWNC 3CCES 2KL8A 3VVTA 3J7AV 2YTVA 5A8KB 3KJVB 3HFZB 1YHQA 2FMMA 2Y0SD 1JLEA 4LF5J 3I4HX 1Z7TA 1VQGA 1ZAXA 2W2PP 1STNA 1VMBA 3Q24A 3S2DH 2CPEA 3I4NG 3Q89A 1ML0D 2AJ1A 4K0KJ 2EYLA 2PPBC 5FJ4A 4JV0A 5GAGI 3EYZA 2XRSD 3TZZA 5COYA 2JC0A 5LJ3Y 1WC4A 3R5DA 1H95A 2CJKA 2H54B 3CMAS 1UAPA 2V94A 2EFQA 4P6QA 3OVAA 5IV4A 2VPZB 4C48A 2L9DA 1HWIA 1XMBA 1LW0B 5AJ3L 3ZZUA 4Z9CB 1EU3A 1SH0A 3OOCA 1KXLA 2RRAA 1S1UA 3G71S 3FBBA 1RT3A 3ZJYC 1AZSA 1HQRD 1RWMB 3CCVA 1NH7A 3JS9A 2DEIA 1BVSA 1U7LA 5C5MA 4JI8F 5D3DA 1WORA 1SJQA 3LP1B 1PG5B 2R7VA 3A8KA 3TEGA 1HWUA 5JJBA 3GIJA 2N55A 5J2MB 3BBBA 2V4JA 1II3A 3I73A 4HAEA 1JOOA 4X4OA 2Y9HA 5EN1A 5E4XA 2FHJD 4H4KC 4U673 1J5OB 1I3QB 5C4XG 1N8RC 1TP7A 2WVEA 1KTVA 1H9RA 3MM7B 3OL9A 4FVMA 1GMUA 3E0EA 1PRTD 2R93B 4ZCKA 1W6JA 5IYCH 3Q0AA 1LWEA 4IG0B 2LFNA 1QUVA 3H98A 4G6VB 2DGUA 4DL0C 3A5ZB 5I3UA 2GGPA 4HJ9A 1TKDA 4R8UB 2D3ZA 1F2LA 4WYLA 4RU2A 4JI4F 4PYDA 2A2CA 3CCJS 2FQQB 1PZID 4IFYA 3MF5A 3KBXA 3BVGA 2ZH4A 4DR6J 1PC4A 2Z57B 3AQQA 3P6YC 3VZIA 4BWMA 1YJNA 2VG7B 5DDOC 1GMWA 2HHHL 4Y3CA 1C4AA 2IFXA 3M2UA 2YTYA 1GEHA 2WB1B 3GTKH 3OMCA 4DR6F 2D3UA 4B3MJ 1C8CA 3GV3A 2LECA 1OPZA 2BW2A 2DNHA 4YN3B 2XHCA 2YPZA 1KEKA 2RF2B 4KGVB 2OLWA 1XNRF 1RWKB 2XMJA 4A75A 5BN3A 2AV5A 1QJHA 3UPFA 5C2CA 4LUVA 3Q8QB 2CPDA 3PTWA 4KD3A 2OTJA 4LR9A 1TMJA 4C3IB 1S5ZA 4XO0A 5B08A 4C3HH 5B7WA 5FLMG 3GTJB 4QWCA 3VR4A 1BWVA 1K73C 2LCWA 1TU0B 4K14A 1SL0A 1B3AA 2Z9HA 2Z1CA 1Q8KA 4N8FA 4XDDA 4WYWA 1SVDA 1TWHH 4IURA 1NU4A 1YNJC 2UUAF 2OPPB 4BY1B 4O1NA 5KFNA 3PJWA 4GMKA 3RBZA 1LXNA 1BQNA 4J91A 3L7PA 4BBRH 1FJGL 3GTLH 1FKOA 1REVB 4DJBA 4M5JA 1XR6A 3QT6A 3DLLQ 4KR0B 3ZC4A 3FCVA 4TU7A 4NP5A 4OX6A 1FVSA 1F0XA 1ILPA 4WFXA 4Q45A 5I6WA 1ULRA 1J5EL 3FVYA 4G1IA 1MGSA 3NEMA 2ZM6Q 3GILA 4F7VA 1VDHA 1FRXA 1OQ3A 1KLMA 4DV7J 4TQSA 4Q8FA 4HCSA 4NLVA 1TL1B 2VPYB 5AE3A 1YJWA 1TU2B 3AA9A 1HBNA 5E4WC 1MN7A 3TARA 2ZBIA 5LMUF 4ZAIA 3KJOA 2EKYA 1NSQA 5F8IA 3ITPA 4RPFA 3SZ2A 3NWTA 3JYTB 1DHMA 1R6YA 4XK8C 2YBVA 5CMDA 5CABA 2RT3A 2NN6G 4KKOA 2BE2A 1ENAA 5IGCA 3HSZA 3I4PA 1HNXQ 1HTPA 4LSNA 4WIQA 2HIXA 3T51B 3GYXB 2AWOA 1QAYA 3IA0A 1G2EA 2XGPA 3P7JA 2VG5B 1RU1A 4KI0A 2W9CB 2OPPA 3VAJA 3EN2A 1FWLA 4JI0Q 3EJMA 4MIWA 5ISRA 3TRZA 1JCKB 1QB5D 1NHVA 4LFAJ 4LBPA 1NBWA 1T95A 2W2NP 1RTDA 2IHEA 2L11A 3FDTA 1VQCA 1QE6A 5HN0A 3MZ5A 2J7UA 4WKYA 4ZJOA 3P8BB 3M9OB 3N6RA 1B0TA 2RSQA 4U67Q 2C2MB 1GMVA 2JA6G 3NTIA 1FRIA 4DN9A 2EK1A 1JICA 4O3OA 1CQMA 3EE3A 5GADU 2R7UA 1TKXB 2RCFA 2MLXA 3BKUA 5BYSA 1NKCA 1RI7A 4JI8Q 2RE1A 3BZKA 4JBCA 1H0HB 2PIIA 5KT2A 4QWBA 3EPGA 3IAYA 3MPDA 4L72B 2J0WA 1VQ6S 1HD0A 4ZLJA 4JCVE 4KKOB 3T6JA 3PM9A 1NSAA 2Z30B 4PQUA 3C66A 1ET9A 1K28A 3J80E 4IFVB 3ER0A 3R5AA 4OZJA 4XPCA 2IYGA 2V1CC 4RW4B 3S24A 4LF5F 1WD1A 5AE2A 1TFYA 5A2QE 2AHOB 2KFYA 3LALA 3MA2B 3PIP3 5HVHA 1ZM3A 2R7RA 3DOLB 3DKDA 1FFWB 3G86A 1N0UA 1J2VA 1H38A 3OTOQ 4J6HA 2VFVA 5KFCA 2Z0SA 1K83H 1DTQB 2K5QA 5HMXA 2CJAA 2K1RA 4A3FB 4PMWA 2IPOB 3KLIA 3I31A 3HLUA 1HWLA 1I50B 3TANA 2B29A 2YKMB 2AUJD 1LTLA 3QRPA 2ZKTA 3FC9A 1FA0A 4Y2IA 2EI5A 2WB4A 3D68A 3US5A 1UW9A 4A8XA 4DK0A 3PEJA 1RT3B 2DNEA 4QPXA 1OWXA 1N5QA 2KBNA 2I9SA 4AL5A 4L8JA 1N9WA 4ECSA 4ILRA 4MKYA 1SE8A 2DRDA 5HROA 1HPZB 4DPWA 4P2FA 2DR8A 3GYGA 1GXUA 1EFID 2MKSA 1K8AC 1PTOB 3DRSA 4DPTA 1Y5LB 4C3HG 2HFOA 4QJVA 1Q95G 4HHHA 4MK8A 1Y10A 3MEDB 1CUKA 3MEGA 3MECA 3FMBA 1JB0C 3VA5A 3X3NA 4XQNA 2JA8H 3MMCB 5CV8A 1D1IA 2KECA 1Q86T 1EZ6A 4X6AH 3SFGA 1QWYA 2MKCA 1E0BA 2CQOA 3CT9A 4KHRA 4H4OA 1X5PA 1R4PB 4CM0A 2QE5A 4NLQA 5CV4A 1PTOF 3Q22A 4UDUC 4JI0L 4FO2A 1YZ6A 2IHR1 1A9NB 2UU9F 1B64A 4FPIA 2CQCA 1LT4D 1I3QH 4A3FG 2H48B 1NK9A 5C24A 3G82B 4ELVA 1WTQA 1PFNA 4DAYB 1N36Q 2L12A 4ZP6A 1X4FA 4G7ZC 5I4MA 1UFLA 5KFJA 2ZH7A 3ADAC 1LNQA 3KF6A 5H1SE 1B4OA 1V9OA 4DS4A 3M4XA 4BBSG 4OQJA 5I3QA 5KG2A 2H9ZA 3M2RB 4X4NA 4YWMA 3R8BA 4DR2F 3HP6A 2EW9A 2A6MA 4DCPB 1UL3A 2CFXA 3MECB 2R3ZA 3FKIB 2E1RA 2VU5A 3PO4A 4OXPA 2ZTDA 2VQFL 1N33Q 4XT3B 5HO4A 4RBTA 4ANCA 3C8YA 3QLHA 5D4NA 1B8AA 3K5MA 3CPWR 2BRKA 4OHVA 3T9ZA 4EBDA 2EJMA 2ZBCA 3RBXA 3KWMA 4DV5Q 1QNKA 4DV2J 1KLGD 4P10A 3HZXA 1K3RA 2K03A 2MKKA 4X3TA 1OSCA 2ZC4A 5L1IA 3GTJH 2KCNA 2VDIA 3HHLD 2L41A 4IN3A 3MAQA 4QIEA 2GQCA 2RDJA 1K9MC 2Q6BA 2AX1A 1EWIA 2OPQB 3QQCD 3TQ1A 3GJQB 3MGJA 4DX8H 3CCLS 3DGVA 4M5MA 1G51A 4XYQA 1I6HB 2AUKA 4F87A 4ICLB 3HOZB 5IE8A 3K57A 2ZH9A 4RUHA 3UR3C 4BBRG 1STEA 1RTZA 1C0TB 5M3MB 7FD1A 2ZHBA 1RD9D 4LF5Q 4WFBQ 1LWEB 4NOHA 4ECTA 3TWZA 2W8LA 1RLCL 4G1QA 6AT1B 7FDRA 2BE9B 3GV5B 2HAFA 1SRUA 4JI6F 5DS7A 3RBEA 3E9IA 2GQQA 2A73B 1KNEA 2A68D 5D0EA 4CTAA 4RGTA 3UCGA 1YBAA 2ASLA 1X8DA 4A8MP 2YNHA 3DC2A 2NS1B 4K59A 2MQQA 5IWAF 3S6EA 3QT8A 3PKMA 3K5OA 2EVBA 3DOMA 3SE0A 4NLDA 3M05A 4WXOA 1P27B 1Q90A 3F44A 2RUGA 1MBYA 3I4NH 4F0MA 4Q2LA 3PYFA 2AX0A 1VFJA 2EC2A 1IR1A 2F4VF 1H2TZ 4Y2MA 2OWOA 2SNSA 4IZ8A 2QILA 4IRKA 1FJGJ 4UY8T 2EJGC 2DNQA 2M8HA 3HHLB 2LS01 1IBLJ 4IOAA 1UPMB 4C97A 3AHPA 1QVGA 3BN4A 2HGMA 1HH2P 1FE0A 1MJCA 3T1HF 3HOUH 3BREA 2HQ3A 2CJXB 1QVCA 3QAUA 4DFMA 1UPPA 3OFHA 3D9BA 2DXDA 3W3SA 4GOPB 1WC5A 2MY8A 5LMNL 4YY3J 2V68A 3RYLA 3KK2B 4FDFA 3NENA 2IM0A 4Q0FA 4OFZA 3PX0A 5HY6A 2QL7B 3M9MB 1BCPF 4EX5A 1VQMS 2BJ1A 1AN8A 1RBLA 1VQ6A 3ZZRA 1IBKJ 1D09B 1F2HA 3I4MH 2LSSA 1IWGA 4WBFA 1FRMA 1G4CA 2AD9A 1NUCA 4LF4L 3K7UC 4J90A 3TZYA 4YB7A 1GJXA 2K05A 1RDPD 5I42A 4RJVA 3WWVA 4K4ZA 2LXFA 1XPUA 1ZETA 4DR7J 3TN2A 4R8IA 2EFVA 1BQQT 1H9JA 1GAOA 4XTCS 2EPBA 3THVA 3M3YB 4N7TA 1T5XD 1LWFA 1L3SA 4PWDB 4A3DB 3JQKA 5FJ8G 4ME5A 3GTMB 2C3YA 3HK2A 5K8PA 2EZVA 3KDOA 4CJ1B 3IGVA 1JJ2A 1A2TA 1HCZA 2HKEA 1FXLA 1K3BC 1RAGB 4FYVB 4DR2Q 1EIGA 4DU7A 1BQNB 4J9VA 1EY8A 2XEXA 4EI2A 1K83B 4RW7B 3QSYB 4CP5A 4HI2A 1WC0A 4I2PA 5C4XB 2BANA 2CVIA 3KF8B 1X5SA 1DOKA 1PH6A 1JLCA 1HI1A 3HKWA 3DLLA 4OHJA 3B82A 3ENQA 4J9QA 2YY3A 4CDDC 1KFDA 3HOUG 2A2DA 3KHLA 1X0FA 5L1JA 1IHZA 1C4QA 5G3LD 4O23A 1ZTTA 2OEMA 2XNQA 2F0IA 4LFCQ 2XVSA 1SB6A 3A0JA 1STAA 4BHQA 2HURA 4EVOA 4J9PA 4AQYJ 3BS9A 2HNYA 4EQ5A 2LQ8A 2ADCA 1FERA 1X5OA 2BA1A 1L3TA 3DOKB 2PMZE 1A3UA 2I5HA 3TBIB 1Y9OA 2HQFA 2GMJA 3C6UA 1O7LA 4CKEA 1S9GA 1U1MA 5M5XB 4YOEA 2JE6I 4CKCA 4R0EA 5GVQA 3WDOA 3N79A 1VQ4S 3BO2A 4C8KA 2UXDJ 8AT1B 3AD8C 2LQ9A 1UE5A 2R7QA 2XYHB 4X62F 3VYTA 4R4TA 1EYAA 2BH2A 4C2MH 5U47A 5HQMA 3I96A 1HNZL 2M4MA 2K4KA 4ECVA 1X9NA 2PCFB 2MQOA 3WIUA 3GIKA 2BANB 4WZMA 3E01A 4ZOSA 1BF4A 4JI5F 3HRZC 1Q1KA 3LWUA 4K2XA 2E1PA 1S1WA 1JLBA 3O3LA 4IQXA 1PA6A 4NXNL 5KFZA 1NK5A 1NCLA 4KRWA 4DUYJ 5DNFA 3ILOA 1JLFA 1GD7A 2ZJPQ 3OJUA 1Q8BA 4HIOA 2FVRA 1CM9A 1Y11A 1I94J 2NN6H 1TK5A 1FNWA 1VBXA 3GO5A 2QLWA 3CC4S 2K2PA 3O1LA 3U1NA 4OWWB 3QPIA 1K8AT 1DAXA 2M9KA 1GKHA 4DPXA 4ECUA 2KTQA 3HOYG 5K36G 3M32A 5IP9H 3AFGA 3H15A 2QN6B 2VBZA 5BR8L 5B0BA 1JQGA 1VCIA 1VRTB 4JPBW 5M3FB 2XSJB 4PMBA 1Y14B 1ZM2A 1WHXA 2PFDA 1CJVB 2NXNA 3M32B 4NYPA 4ZDNA 1NLKL 3SR1A 3QOJA 4Z2XA 1WTFA 3W5OA 4P52A 1M5SA 3ERQA 2QLXA 4F4YA 3DEPA 2P5ZX 4IG3B 2HVHA 1FKAF 2A5HA 4OHZA 1N32F 1CQVA 1AFJA 1ZAWA 1F5CA 2OPSA 4ZIVA 2L9NA 4IFYB 3OTCA 3TAMB 2KB2A 3H59A 2HK3A 1RP5A 1E6VA 1LACA 4ZCLA 4NRUA 4M8LA 2H1YA 1UE1A 4A4JA 3T5JA 3CCWA 2PD1A 1VBZA 2FVSA 3NCPA 2DJWA 4PABA 4A3JG 3NPPA 1SQFA 5GAEI 3GTYX 2F8MA 2ZJQQ 2K14A 2XMUA 5J2PB 3THTA 3AJDA 1WTBA 2RS2A 3IP0A 2OXPA 2CRLA 3BVMA 1JNZB 1RWXB 2ZEJA 4P73A 4DUZQ 3TI0A 1PYOB 1AFPA 2UZAA 4E98A 5HROB 4ZVTB 2KHCA 1HW8A 1JMCA 3HJFA 3CPWA 5GAHU 2A19A 2BDOA 3KLVA 4LW1A 1BLUA 1DXMA 3I70A 5A8RA 3TUPA 1GK8A 2KHIA 2C2DA 1HNWQ 1HQEB 5EKKA 2MTLA 2ZM6J 2B2TA 1UVMA 3HHLA 2F8HA 2DH9A 4RWSC 3CJ5A 3NS5A 4IG0A 2M2BA 2I07B 4F7XA 2JN4A 1XPRA 1CJKB 1WDTA 3KJQB 2R7FA 3CSKA 1CK1A 1C9OA 4ED6A 3EWGA 2NXUA 2WSCC 2ZDPA 3NNHA 4OI4A 4A8FA 1REVA 1B50A 4L76A 5ELOA 1B44D 3K8AA 2WOMA 1YIJA 3HOYH 2A6ED 3PFEA 2G0CA 4GO7X 1VF5C 3QWNA 5JVHQ 5I9PA 4QU6A 1HHTP 4ZKCB 3CNQP 2CZ9A 3G96A 1OY9A 3UWTA 1QILA 1WTWA 1FNOA 2A6HC 2KM8B 3FSXA 4DCJB 1S7IA 2CIMA 4WCEQ 2BJ3A 2CPYA 1EQQA 4A47A 4B3OB 3UDEA 5IGGA 3HOUB 5THWA 3LP0B 1VQOA 3KG0A 2OTLS 5J39A 1X4AA 4TQRA 2CWPA 4X4SA 1T03A 2FJBB 2EXDA 2E5LQ 2C3UA 3HOXB 2C2ZB 2J0XA 1U24A 1GO3E 3DYAA 2JVRA 4JB8B 1WG5A 2GW8A 3OSPA 1U48A 2VG6B 4QMGA 3CCQA 4AQYQ 2VG5A 1VLOA 1MROA 2W2OP 3PVXA 3FMCA 3DRXA 3DMJA 4DV4J 1RTJA 5KG0A 2MGZA 3UDVA 3Q8YA 2V4QA 2NB0A 4A3DG 1N4LA 5CV9A 3IM9A 1PDQA 3BGRA 1Z47A 1FFSB 1S40A 1FO1A 3NWSA 4OLOA 2O4XA 4P2SA 1S0NA 4HDGA 3DWAA 3N5FA 1RODA 3JSBA 5A8WA 1XMOL 5E0OA 2DGWA 3FVQA 2E2JH 3NGDA 3PCOB 4USHA 1FNUA 3GTMH 4PQAA 5IXUA 4LFBF 4Y34A 2DJGC 4DSFA 2ZBQA 1KQSR 2B5JB 3MXNB 3J7A1 2M8DB 3SIPB 2RSNA 4JI1F 2YV5A 4EZ6A 2O01C 5C4XH 3UO0A 2K8GA 2PN6A 1XWEA 3H91A 2UVWA 4GN5A 1HHSA 5JMNA 3QJLA 5LSOA 3LNNA 3DRPA 5HK4A 1RYRA 1FGBD 4YQWA 4M5GA 3MTSA 2X6LA 2G9HD 1DJRD 1J5EQ 4CO5A 3GTGB 2CQBA 1V5VA 4CKBA 3W60A 1FHTA 2AKWB 1ZOTA 5AXLA 1UZHA 1SE4A 3ZTQA 1ZPVA 4B9TA 2Q3PA 2IX0A 1WI8A 4EU0A 4ULLA 4DR7L 4QZVB 5M2UA 3MEDA 2E75C 1FXDA 5KYIA 1K8GA 2VXWA 2JEJA 3GZ7A 4OI2A 1T9TA 2WKDA 2GMLA 1WJJA 4RH6A 5ELDA 2YPYA 4OMFG 1CFMA 4JYAL 4IUFA 5H9EJ 3RUBL 2NVTH 2CH4A 3Q23A 3MOZA 1UVLA 4GOPC 2AP6A 5KG6A 4OEMB 3DLBA 2NZCA 5KFQA 2ZXOA 2Y1JA 4HJAA 3CIZA 3SV4A 1VJQA 2HMIB 1CULB 2F0UA 2R2SA 3ELHA 2DB1A 4O4GA 3KKFA 3I8ZA 3CF5A 2O3DA 2BJDA 1SBRA 4CWBA 4JI1L 2KHSA 1RJTA 1NCVA 4DR2L 3K6OA 4LRCA 4RG1A 3OWEB 4M1UB 1HA1A 2R92H 2NUUG 2R2RA 3F2UA 4DEZA 2DNGA 4F3QA 1GNKA 4DDFA 3BQ1A 1TZ0A 2R9LA 5HVGA 3K5LA 2N7CA 3DM2B 4A3GG 5CZXA 2R7ZB 1U45A 4KV8B 3SEOA 4O2DA 5K20B 4KIAA 4P72A 1JXLA 3BZDB 4FF1A 4A3EG 1YJVA 3S1QH 1A8VA 4DR7F 5AXMA 4ABNA 3UD3P 3HOVH 1F60B 3H3VC 1JKHB 3CEDA 1KD1T 2E2IH 2EEYA 3BQ2A 2V67A 4C8LA 2GGPB 1FRLA 1Y8OB 2QSFA 1SNDA 4JI2L 1HNIA 2VH7A 4RNNA 2KG0A 1RWNB 1SROA 1TKZB 4J5OA 1U1QA 2VG7A 3D0GE 3J7YU 3GU0A 2GZOA 5D0HA 5GROA 2L48A 3IS9B 2DGXA 3IR6B 3S2HH 1TELA 2VQEQ 2JX2A 2Z2YB 3DRYA 1MJEA 2NVXB 3IAS9 4X65F 4F02A 1U49A 5L8RC 1FESA 1S5FD 1DLOA 4D3HA 2HHSA 1LW2A 3KNAA 4ED5A 2VFUA 4GVLA 3T16A 2E5LF 3H2LA 4A3BH 3IL8A 2N78A 2QGQA 4C56C 4KHPF 1GT8A 2JEAI 1NEEA 4G1PA 5G4DA 1WWHA 1M8AA 3GQBA 2CNOB 3M8SA 5AE1A 3CCMS 2LQBA 4KY7A 4DU8A 2A6EC 4OYZA 3PMFA 1XMQL 2XMVA 1DONA 2P9CA 3OLBA 2FFKB 2BA0A 1HR0Q 3DFEA 4TVAB 3T41A 1Y1VB 1V3ZA 5HI7A 4DQPA 2YU9B 1VQPA 1XXGA 4BCAA 1DQ8A 1QE1A 1IKXB 2L9WA 1LABA 3WDNA 5K5PA 3J81j 3OVSA 1N5TA 3M8ZA 1N48A 4IH5A 1D8ZA 3C15B 3QGIA 4ZMMA 4F4XA 5DGAA 1ZH5A 2IMOA 1IL2A 4MTPA 2V8DA 5FDLB 3KDFB 4ZP7A 3UVJB 1RCXB 3QWUA 5L38A 4DV6J 5DRKA 4AXIA 1UEVA 1FDAA 2OO4A 4HJ7A 2FY8A 3KYLA 3V6KA 2VDHA 4ZVEA 3D6WA 1U4LA 2F0NA 2JLFA 3FJ2A 4ES1A 3M4QA 2V4JB 2WVBA 4LRBA 4KV6A 4UT4A 1TWGH 2RQKA 3D1QA 1Y1WG 5C4ZA 4I7ZC 4CLSA 1VQLS 2NYIA 1VJWA 1J5EF 4YY3Q 1DBDA 1Y8NB 5DG8A 2JL9A 5JJKA 2XMTA 3PV0A 5JJLA 1VQMA 1H74A 2QL9B 3AB4B 3FMWA 1HZBA 2VPXB 4QF4A 1RAEB 5DLQE 4X4QA 3OWFA 4O4RA 1XJVA 1Y3KA 2GS8A 1IBLQ 2WVCA 4B3RJ 3AB9A 4K0KL 1BQMA 3JTNA 2DNRA 1RHKB 1L5UA 2Z6KC 2JA7B 2F7VA 3SMZA 2BYCA 3DDKA 5IC4B 3CJKB 4NW2A 2J9CA 1AW7A 4M5DA 2KVQE 5LT5A 2OD4A 3FBCA 3DN9A 4AQYF 2KENA 4TLRA 4U68A 5AJ3J 1SJRA 2RDDA 2YVSA 1ZXTA 2PZTA 4J37A 2HZVA 1GHJA 4AD6A 5DAUA 4ZPWR 8ATCB 3MFHA 2HZCA 2FXQA 2QFIA 2EYHA 4GN3B 3R9LA 3TO8A 4PXCA 2BUNA 4O0NA 5E1FA 1M0SA 1ZBTA 3L7ZC 3JAMc 3KK1A 1HBMA 1VQ4A 3U58A 2EBGA 1L1OC 2RD5C 5E3CA 1VQKS 4DHVA 2DR6A 1BGXT 2RMLA 1TK8A 2EFNA 1JNRB 4YDDB 3GTQB 3DDNA 3L7OA 3EIVA 3I0SA 4DV1Q 2NVQB 1KD1C 3KMSA 1I94F 4F25A 3NSWA 5LHY1 2B2UC 2GX8A 3NGSA 4ZPDA 2GHVC 1N34F 4QWDA 3H90A 2MGZB 1EY4A 4Y28C 1NJWA 1TWFB 2B2WC 2IX3A 3E01B 3ENVA 4X64L 1HBUA 2OMOA 3QRRA 2HQEA 4LNQA 3TP5A 3DEOA 2N3LA 1QY7A 3PJXA 3W2VA 1NZ8A 2W8KA 4I6AA 2V0NA 2LP4A 2KOLA 1SR3A 2YNGA 1EY5A 2ZE2A 1HBNB 2W9AA 4UF4A 2R7WA 4A8WA 1OXVA 3GTGH 4R8NA 2UXDQ 5D78A 4NDXA 1XNRQ 3MXGA 4RNHA 3DHQA 4OV1A 1YGYA 1S10A 3EGNA 4C3MA 2UUTA 1GUNA 4V1Ak 3P20A 3U50C 4CNYA 3V6JA 3CMEA