4ZCKA

Crystal structure of c-terminal fragment of escherichia coli bipa/typa
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
299
Chain Sequence
b'GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTP-binding protein TypA/BipA
publication title Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gtp-binding protein
total genus 90
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 4zckA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zckA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 4zckA01
3EXCX 2I0XA 4QR2A 3ZZUA 2J7KA 2L9NA 4MYUA 1ELOA 5G4DA 3ZZTA 3B8HA 1WDTA 1DARA 2BV3A 1ZM2A 2I8EA 2YWEA 1N0VC 1T95A 1ZM9A 3OQ2A 2YWGA 4ZCKA 4QR0A 2BM1A 1ZM3A 4FN5A 1N0UA 4ES3A 2IVYA 3UI3A 4ZCLA 2E1RA 3CB4A 4QR1A 2YWFA 4ZCMA 2WBMA 4ZCIA 4M1KA 3B82A 2ZITA 2BM0A 1ZM4A 2KDOA 3B78A 4MYTA 4ES2A 2DY1A 4TNOA 3E3XA 1P9QC 4ES1A 2NPFA 1KTVA 2CVEA 3ZZ0A 4MAKA 2YWHA 2EFGA 2XEXA 3LH2S 1U2RA 1VI7A 1ZPWX 1FNMA
chains in the Genus database with same CATH superfamily
1HW8A 2CQ3A 3U58A 5EQ0A 3NL0A 3THVA 2ZNZA 1TMMA 3S6EA 4WWSA 2XG8A 1PFNA 1WC3A 3HK2A 3K7AH 4YDDB 3MM5B 3FEXB 1Y7PA 1IYJB 4LRAA 3J81U 1JX4A 4PPDA 3ONQA 4IFDI 1VQCA 1G7CB 1YJNS 2EFPA 5C25A 1RWUA 1Q81C 1EY4A 5MLCV 5LMNQ 5C4HA 3HT0A 4DV1Q 2VG6B 2KVIA 5FDLA 1UWAA 5EPLA 4NMLA 2EC0A 2OPPB 2IC3A 2G0IA 3TQ1A 5F3ZA 5CYJA 4MK9A 5A2QL 1HBMB 1AZSA 2ZITA 1ULRA 3KG1A 3BSNA 2E44A 3CD7A 1HI0P 4JI0J 2KDOA 3GE9A 1NY4A 4B3SQ 2BACA 1M5HA 1DTQA 3I56S 1TWHB 4Y2IA 3KLHA 1TQOA 5JJIA 2F1MA 1HNVA 2B2UC 2HIVA 6FDRA 3OUYA 1D5ZC 3UE2A 1YRTA 4DI6A 1T9XA 1VQAA 5H9EJ 2SEBD 2KM8C 1I5FA 2FIUA 3CC7A 4F8MA 2VFTA 4HYKA 4HR2A 3S1MH 2J7UA 5FO9B 5HGQA 4DV7F 1N33J 4OLOA 3H5XA 4M5JA 2XC9A 1TT2A 3R6LB 2OPQB 4ELUA 3GTPB 4OZ1A 2XI3A 1MJEA 3GTOB 4NWBA 1U5KA 1N5TA 2BR0A 2J7WA 2NYHA 3FCVA 1EIYB 2GA4B 1UE6A 2BE2B 5KFDA 3RRGA 3R7NB 3FRPB 3MHBA 1OSCA 3PV8A 5KNDA 1KDCA 5D3GA 1JLFB 3Q8RB 1F5CA 2LQJA 1FE4A 1HWJA 4WXOA 3Q22A 2MQOA 4DAYB 3HSDA 1S12A 3J81j 4OYBA 2MHVA 1TFYA 5M5WH 2E2JB 3R7SB 2DH9A 2ZE2A 4DQIA 3GJQB 3PKYA 2I5LX 3MXHP 2NN6G 2YNGB 4FNIA 1HNZJ 1BCPF 2ASYA 4WJ4A 4L63B 4C4WA 1RTJB 1UWBA 2DK2A 4IYQA 5IWAQ 4HJAA 3Q6SA 3MEGA 2W2OP 1TWAB 5LMUQ 1RK8A 1RT2A 2EY2A 5ETQA 4PXBA 2AWZA 4R9WA 5K36G 1SXLA 1QVFR 4JI4J 3UE0A 2FVSA 1Y1WG 5LM7E 2AP6A 4ECRA 2DNKA 3BGRA 2MQHA 1IQTA 1RAJA 2V0NA 5HMYA 1SPBP 4DUYQ 2Q79A 2C35B 2MDAA 3CMAS 1Y8NB 2Q6BA 4FDFA 3SDEB 1YNND 4OELB 3L95X 3CCSS 3GIJA 1QZHA 3Q24A 1PRTD 3J7ZC 1WTFA 4ZHRA 2F0PA 4JYAF 4JI7F 2FXQA 2H5XA 1UFKA 2B2WC 3DYAA 2MGZB 2BA0A 4ZYSA 4JP8A 2A2CA 5DM63 2FJWA 4OYIA 3H94A 1VQ5A 2AGPA 2DR7A 4V19X 2XN9C 2F0LA 2H65B 2WB1E 3M7NA 2G4BA 2WKDA 4FF2A 1PMRA 5K36H 4ZVRB 2KI2A 5M3FG 3JXOA 2DGVA 4C56C 4EQOA 1I50B 3AA8A 3K5MA 2E1AA 2HQEA 1Q86T 3I90A 2BE7D 5L1KA 3KMSA 2PNHA 5ELCA 3QWUA 3FDTA 3MM6B 4DV7Q 4MIUA 5IT9E 2LLZA 1C48A 2EK6A 2EPBA 3I70A 1G2EA 2WBMA 3MCMA 4ZLJA 1NAQA 4XAKA 2XSFA 4CO4A 1WI5A 1Y1VB 3PNIA 2R3ZA 1A0OB 2XYGB 2EFQA 2IPKD 5I6WA 1J5EF 4NLSA 2KECA 3CJSA 2R7WA 1FKPB 3VWSA 4C7QA 1O5JA 4C2MH 5M3FH 1F1BB 4GVBB 4B9SA 4Q8EA 4DSIA 1UNSA 5CV7A 5AXLA 1NUEA 3DXJC 1CJUB 3CCTA 3GP7A 3PMFA 3KG4A 2FHKA 1K0RA 3PIP3 4DQPA 3PM9A 1GUGA 4LF7F 2CKZB 2JC1A 2HG4A 1ZM3A 5K8PA 1CC8A 1S1VA 4PG7A 4OYMA 4USIA 1YNJC 3UN2A 3MEEB 2UUAL 4CLFA 2DGSA 2PMZE 3MMAB 3PFOA 2L0CA 4NLRA 4HIMA 4KJOA 2K7VA 3F8TA 3H0GG 4ABNA 4FF4A 2F3IA 1CTMA 1YJ7A 3DOLB 4NP5A 1AUDA 3OVAA 4H4OA 4URQU 1N5VA 1NB7A 4JV5L 2WVDA 3KLFA 2GJIA 3DI6A 3SCJE 2GHPA 3I5BA 1JWWA 3A54A 4DX8H 4N9PA 3HMJG 3VR3A 4Q0FA 3QRRA 2CWXA 4TLRA 2BH2A 1SJ3P 3T41A 5D4OA 1LW2B 3JTPA 5I42B 2FGCA 4YCWA 3NEKA 1NB2A 3GJSB 3TVZA 2YWWA 3UCUP 3A74A 5GADI 1YHAA 4JYAQ 3C6UA 3H0GH 3TO8A 3VGUA 1S6QA 4ZIWA 2ROGA 3H4DA 1LACA 1NCLA 3G4SS 2R7ZG 1Q1BA 4A3DB 1T9VA 2DGQA 4OHJA 3M3YB 1ZAXA 1YX2A 4YR0A 4U8YA 2K1RA 1VQKS 2VQFF 4CKEA 4ZKAA 5ETVA 4H02A 1LYLA 4LFBL 5C3XA 4Z9CB 2WVFA 4Y00A 4WTYA 2DH8A 1FRKA 1SMXA 3OTCA 2ZZMA 1HNZF 1FFWB 4LR9A 2WIIB 2YKQA 1GXDC 1PFSA 2R7ZH 5ISRA 2HRYA 1ZPVA 1EB0A 2SNMA 3RLNA 1I1GA 3NNAA 3EZUA 2Q6CA 3C15B 3PYDA 2ZHOA 5CD4H 3E2EA 5C44B 1RJJA 3MM8B 2LXUA 1YJWA 4EZ9A 3W1BA 1O51A 3GTKB 1NHVA 2HHTA 4WFXA 2DT9A 2JC0A 4QYRA 1UEKA 2LEPA 1I3QH 4LVOP 2FLPA 1TFWA 2LSSA 3TOQA 3P20A 1KD1C 1Z47A 3RRHA 1C9OA 4LFAF 3H2UB 3O3LA 1LWEA 2OUGA 1MWYA 4K2LA 3SK4A 5B0EA 5DGBA 2UU9F 4GOPB 4BBYA 1W2BA 3JTOA 1NU4A 1RWKB 1TWGH 3BGOP 1YEZA 4J9OA 4DN9A 3MZ5A 1BXNA 5FIIA 1CKOA 2PI5A 5KG1A 1KOOA 4JI0Q 2J0XA 1SE4A 3P49B 3A12A 2FC8A 3EVWA 1SKUB 2DB1A 5C4XB 1ZA2B 3J7AN 1P1TA 2DIUA 1RWPB 1A15A 1TKDA 1U02A 4DK6C 3EZ5A 1OQ6A 4GOPC 1NDPA 4PXCA 4RW9A 3HSGA 1WSRA 2DXEA 3NXWA 2XTJP 5L39A 4KE5A 3N6RA 1WNEA 2MJUA 5LL6S 1N33Q 4EEYA 5KFHA 3PIO3 1HNXJ 3S7RA 1VQNS 4A3IG 2GVDB 3M2VB 5KT3A 2W7OA 1FESA 4CDIA 1Q5VA 3BQ1A 1FL0A 3SCLE 5JJZA 1RWVB 2G0CA 3W64A 2RMLA 3BDEA 2B4OA 2A0FB 3UD5A 4DPOA 2GQQA 1SE3A 4DV4F 1NJZA 4KRWA 2UXCL 1SJED 1L3KA 1RKNA 2MQQA 5C5LA 3TNVA 3G8SA 3OSNA 2N88A 5D6GA 2J4XA 1VQ4S 1TL7A 2F52A 3PGZA 5L1LA 1XNQL 1D0EA 2CJ9A 4O3QA 2G13A 5KEEA 1F2HA 2X69A 4RKLA 1SC3B 3LH2S 1X4FA 5KFAA 3NEMA 4K4WA 2AEJA 2JL9A 2KTQA 2XSJA 4YR3A 5G3LD 3PFEA 1F3VA 4JK1C 3A8JE 3KDOA 3UO0A 1HNZQ 1QWYA 1BMQB 1DM0B 1SI9A 1S1XA 3L9ZA 4QIFA 2JOQA 3E9HA 1NK6A 4XDDA 3GR0A 1IL8A 5KNCA 4HIKA 4YQWA 3DM2B 1BGXT 2CW0D 2ZTEA 1R89A 1N5YA 4KJIA 1PTOC 1OXXK 2K75A 4NPSA 1R0BG 3LNNA 1LK7A 3I4OA 2V94A 4WJBA 1STYA 2ID0A 3R2IA 1RT6A 3M6XA 1N32J 3U50C 2NSBA 1NCVA 3IR5B 3AFPA 4LFAQ 4K2KA 4WP9A 2ASBA 2XMUA 4RG1A 2UU9Q 2YKOA 1L0XB 2JEAI 3OMCA 4G1QA 2J8AA 1Z4UA 1PIEA 1LT4D 1CHQD 4A3EG 2I5JB 2CFXA 3I82A 4DLEA 1B7YB 1UAPA 5D8HB 4CLPA 2WV6D 4A47A 5J2NA 1NK5A 4MT1A 1OIAA 2R2TA 2YNHA 3GIMA 4CTAB 5J2QB 3RYLA 3CCEA 3TP7A 2VIHA 2DO4A 1YBYA 3DWAA 1X54A 5KAKA 2XB2D 3P45B 4Q0BA 1DOKA 2XGPA 2QGQA 1JWUD 4B08A 3CCRA 3CJ5A 2QDBA 4HHUA 4CLYA 2FFKB 1HQUA 4X64J 1DZ5A 2R7XA 2BQRA 5KG3A 4DR7F 3U9OA 4ED6A 2JP1A 2DEIA 2R7FA 4DUZF 4HMIA 2W2QP 5GAHU 3NS7B 4HLBA 4YUDA 2C2DA 1L5UA 1B53A 2NVTB 1P9QC 1ZYRC 4KGXB 4LUZA 1VRUB 4USVA 1HD1A 3UNGC 3UDEA 4CJ2C 2J7KA 4LT6A 4DV4Q 4Q43A 3OT9A 1A0IA 1Q5YA 5DG8A 2Z6KC 3I4LA 1U0HA 1YLXA 3BBFA 4HVZA 1KFDA 3JQKA 4NLDA 5LJ5Y 3TZYA 4K4ZA 3I55A 4NI2B 1BQMB 1NKCA 1PJ5A 2GMHA 1PHJA 4YWLA 4LF9L 5J2MB 2IDEA 1DQ8A 4OV1A 4ED4A 3IS9B 1ZM2A 1O8BA 4FF3A 4AL5A 1ILQA 4DR4J 2W9CA 4YB5A 4F4XA 4AYBD 4USTA 4DV5F 3DGVA 1OS5A 2YV5A 5FO7B 1JJ4A 3CXCR 1T8EA 1M5SA 1S0NA 2IJNA 1MSHA 4K6DA 4N5SA 1CJVB 3QIPB 3CW2C 2L08A 2M52A 4DV6J 1HZCA 1Q81T 1TUGB 3GCXP 4PAAA 1WD0A 2HNDA 3R5AA 1F77A 2COLA 4C0BA 3H4BA 4K4XA 4EQPA 2X7IA 3HD1A 3W5YA 1FEHA 2IDLA 1EYCA 3T56B 1F9RA 4MIBA 4CLWA 2WW4A 3CMQA 5A0YB 1MMLA 4PPZA 3M9MB 1HNXF 3DKDA 2NXEA 4JBMA 3UR0A 2M5YA 2VDIA 1ZTWA 1N52B 2FJXA 1URNA 4FS2A 4KY6A 2RU3A 3SHLA 2V4DA 3JSMB 3PJXA 4CLUA 1T9YA 3OR1A 2ZH7A 1YJNA 4UOFA 1E22A 2WOMB 5D0RA 1AEXA 2B3TB 3NP8A 4K5RA 5D4NA 4JW0A 3KLRA 1G8ZD 2ZD1A 4DV0J 1F5BA 5K5PA 1KC8C 2CJKA 4K8RA 1OYEA 2F65A 4X66F 5CYMB 2JJQA 4KO0B 4G4KA 1S1TA 1IXRA 5I4MA 4RGNA 4XIUA 3HJFA 3M9OB 1FD8A 2E1CA 4ILLA 4HACB 4NYPA 3GZ7A 4J9LA 3KJNB 5EN1A 2V8PA 1WUUA 1ROFA 5JMNA 4IALA 2CQOA 3RBDA 4H4KA 1XERA 1Q1KA 2HAIA 2B9XA 3TSSA 3DLKB 2GZOA 2DNQA 4IO9Q 2O5DA 3UW1A 1MROA 1RB0A 2RF4A 2B8QA 2WAQE 2A73B 3OFHA 3B82A 2KHIA 1VCTA 2RIJA 4PWDB 3K58A 4LW1A 3NE5B 4K50A 2VUGA 2RRAA 2E5JA 1NR2A 3H6MA 1NEEA 3WOFA 1R0AA 2KL8A 3MM7B 3DRSB 1DARA 3GU0A 3ENAA 3RJMB 3VDYA 2RF2B 1C7YA 3RD4A 4YB6A 3I87A 2RDIA 2HFUA 2NUCA 3PV0A 4RW7A 3Q2SC 1NJIC 2P9EA 4ELTA 2X1AA 1YIJS 3AQQA 5JEAJ 4DV5Q 1CQMA 1CQNA 4MTPA 2F3JA 1AP0A 1SKSA 1HQEB 4I68A 3T9ZA 1ICEB 2BM0A 4P71A 3J7ZT 2ZVIA 1WG4A 2GIQA 4GC6A 5BR8L 2D9PA 3SSQA 3IFTA 5IC6B 3QLHB 2HZVA 3R6GB 2DRAA 4MFBB 2O5IC 1UJ6A 4DQQA 4A3FG 1Y9OA 1HNXQ 3QAUA 1YI2S 1TK5A 4I7FA 2ZHBA 1QUVA 1Q8LA 1HWLA 2C3MA 3U4VA 1X4EA 3K17A 4A8YA 1SH2A 4DL0C 1HYSA 2VXWA 4GN3B 3TUZC 4NB3A 3CMAA 3PEHA 2UVVA 1M5PC 1PTOF 4WZQA 3FBBA 4LSNB 1NBEB 3CCSA 2L3MA 1PFBA 1TP7A 1RAGB 1UEVA 3PX0A 1NO8A 3MUTP 3VAFA 1E1TA 3U7JA 3SE0A 2U1AA 4NLTA 2ZM6L 4PMWA 4JOIC 4A3CG 4USKA 1HXYD 4OX9J 4DS4A 4A3FH 2A69C 1XNRL 4DR3F 1II3A 4NXMJ 1UVNA 3V6KA 4QQBX 5E3RA 3GQCA 5M3MG 4DF7A 1S49A 3EMTA 5J22A 3PHEA 3GWCA 3M2RA 2K05A 3J80E 4JI2J 4RCNA 4BBRB 2AX1A 3GFYA 3R7BB 3W2WB 2CH4W 4XDCA 1HQ2A 1BQQT 2Q1LA 3UN3A 2K04A 1N0UA 2ICEC 3HZGA 1U8SA 4DR6J 4DL6A 4RW4A 1RI7A 2BJDA 3CDAA 1HBUB 2K3IA 1B0VA 4LFCL 3RU0A 5ETSA 4KFBA 4U7UD 4U8VA 3DOMA 4LJZC 3HXMA 1K83B 2R7DA 5IXUA 2IIHA 3SK8A 2BJ7A 4F3MA 2R9LA 1X6OA 3QFHA 3PVXA 3M7GA 4EYHB 5M3MH 1J8IA 1Y0HA 4NMXA 4DFKA 1N34L 2YNIB 3BREA 4IN3A 2EVZA 4ED8A 1MBYA 4R4CA 3R97A 2X1FA 1DLOB 4B3TF 1EQVA 3KLSX 2QA1A 2DNOA 2IHEA 2Y3YA 4JC0A 4RW8B 4WKYA 4ZP6A 1TL5A 5IZHA 2MPMA 4N76A 5T7LA 3H3VH 3BQ0A 1NZAA 2N3SA 3HKZB 3MR3A 2QW7A 1WOSA 2AMCB 1FT8A 4DV0F 3UDGA 1XTZA 1I94J 3TQEA 1IYUA 2PEBA 1JQYD 3QQCD 3BJYA 2D3OR 3EUNA 2B63H 1KR4A 1NSAA 5L8RC 4XQJA 2KCMA 3FKIG 1YJTA 4PYDA 1F9QA 3MECA 4RU9A 3OXGA 1KEKA 3JAMi 1D1IA 1FNUA 4KKOA 4I7AA 2IY5B 5I3UB 1SL0A 1BUXA 5ETTA 3QOJA 3UDVA 1S0OA 1CZWA 4ZA1A 5A8RA 1RHMB 3V4MA 1G291 4J7CA 2BX6A 3E0JA 2OPRA 1PO6A 2FHMA 4X62J 1GXUA 1H9KA 2I5MX 2HLUA 1RTNA 4DSLA 4M95A 1D6EC 1I4PA 2Z2LA 2JVRA 3AOAA 2NXUA 4EQ5A 2BJ9A 3NG8A 4AYBE 3HOXH 1CA5A 3OPOA 5D14A 1YJ9S 3OTDA 4ZPDA 1IHZA 1WHWA 3NBPB 2EBEA 4NW2A 4I2PB 3G4SA 3GV7B 2PW7A 2AWNA 1IBLF 3LP0B 4RW6B 3RB3A 2MY8A 4B9VA 3V96A 2FQQB 4J1MA 4UT4A 3CGIA 5DJBA 2ZH5A 5EPJA 1HKAA 1VQKA 5H1SV 4IOAQ 3G87A 4KB7A 5IODA 1Z2LA 4Z37A 2MFIA 1Y11A 1FRMA 2ZH1A 1Q53A 3OL6A 2N3LA 4S0MA 3UFCX 2EXZA 4ID8A 2EYJA 2XNAC 1EAYC 4URGA 2FGOA 1BD6A 1KD1T 3QO9B 3WQPA 2WONA 4ILWA 3BZKA 4FYYB 5ETKA 3EROA 2J0TD 1IJFB 5L38A 3IFDA 1JKHB 4KKUA 1D1KA 3E01B 1QVCA 4E8UA 3BEGB 2D9OA 5G0RB 4Y0FA 3GTMH 1WCMG 2Y0SB 1Q8IA 4TSSA 2RD5C 3AFGA 5HJXA 1I6HB 1MN9A 2HHPA 3KYHC 2CFMA 1FGBD 4MTKA 1FO1A 2IJRA 3D6TB 5FJ4A 1MJCA 3MA2B 3AY0A 5A76A 1Q8KA 1RWMB 4DQSA 2HZCA 4C6AA 2HBRB 2I9SA 3Q8UA 1REGX 5K14B 4C1NI 1I4QA 1P1LA 1HZAA 4K4VA 1TQLA 3CCJA 3B8HA 4DV1L 1B99A 4OXPA 1MLAA 1KSPA 4DV0Q 4ZLPA 3QRQA 1WTOA 1VS3A 2GO8A 5KG4A 4OX9F 2GVBA 2LKVA 4MHEA 1D2BA 4EBDA 2B56A 2KVMA 2BKOA 1AROP 4B3SL 4XIGS 1PC5A 3ZZPA 4OL8A 5M2PA 1EKRA 2I0XA 3I96A 2RCNA 3QWPA 2CPIA 2MKKA 1FKOA 1KLNA 3TREA 1RTHA 3MOJB 2BE9B 2E5IA 3CUNA 3X3UA 3IWLA 4YS2A 3RAXA 3DDIA 4DR6F 1Y8PB 1OO9B 3MZIA 4UTGA 2JFDA 2YWKA 1X4AA 3FHWA 4RAUC 4XO0A 4L73A 3CTRA 2PQAA 2DR8A 2CJAA 1UETA 3K89A 5K5MA 1S72S 5ETOA 4NXNL 2WVEA 4NZ0A 5HY6A 4X4PA 3EJIA 4ME3A 1YNJD 1C4AA 1DJRD 3PJ9A 1PH5A 4RWSC 1VQ4A 3KFWX 3J7YW 3EICA 1IXKA 2RUGA 2FLLA 4WP3A 2F0JA 4HSPA 2GV1A 2XMAA 3HZEA 2OPQA 2Z9HA 4HMJA 1Z1ZA 5CH7B 1ZPWX 4OHYA 4JI8F 3TQYA 1MMNA 5D3IB 2NVXH 2L1BA 3BR9A 4DF8A 1GX5A 2MKIA 5HQLA 4YFUA 3GYXB 5IYDG 5SUHA 1VYAA 2CPDA 2DJFC 1HWKA 1GUWA 1N5QA 1IBML 4NLYA 3KJOA 3BV8A 3TX0A 2XCAA 3VAKA 1HI8A 4JI6J 5IWAL 2E5HA 2AYMA 2V9KA 5U47A 3RLFA 3MFHA 5GAGI 4DU7A 5LMUL 1QVFA 4KAIA 2Z4PA 3DGPA 5GROA 2B7CB 4Q7AA 2RKSA 4O4GB 1YZ6A 2VFVA 5KFWA 5C4JH 1IW7C 1IN0A 2F0DA 2BJEA 4A8OA 4M94A 3TUPA 4PQUA 1DTTB 3OXFA 3ZNUA 2FPHX 1HCZA 1OPZA 3JAME 3W3AA 4UP8A 3CNQP 4DFJA 1TKTA 1AFIA 1LW0A 2RJZA 3BDCA 3GIRA 2B29A 1LQ9A 5IYDH 4N8NA 2F4VJ 3KMQA 3MMBB 2ZZNA 1S0VA 1U0LA 2BRLA 3ENWA 2B0GA 3LF0A 4OX9Q 3KNGA 2B2WA 5I9PA 1NZ8A 2NXCA 1JLCB 4NXMQ 4F36A 5A8WA 4NASA 1LTGD 4R1JA 1YG0A 2HMIA 3HOUG 3LGHA 2O01C 4WE1A 2AKWB 1GVPA 8ATCB 1X3PA 5I4DA 4K4UA 1U1KA 2XNRA 3RMHA 2LFNA 3U1LA 3EIVA 5KFGA 4MYUA 3QPIA 2IX0A 4DR6Q 3CIMA 1PH2A 4A93B 4DV7L 3PDNA 1NHUA 1V3ZA 4LF6J 2XHCA 5IGEA 4OYXA 1R8BA 5IM0A 3HS0C 3H0PA 2HHUA 1RTZA 4Z2XA 4RZRA 3UQSA 3D1QA 1SC6A 3HP6A 2R7VA 2FHOB 1V3SA 1KVKA 3I9ZA 5FO8B 3ICLA 1DAXA 4OHXA 2R93B 3UVJA 4WIQA 5FD1A 1YITS 1QB5D 1KLUD 4ZP9A 2E1RA 1E6YB 4ZQ3A 2VONA 4ZP7A 5FK9C 5GAEC 1YBUA 2KG0A 4DR1J 4LBPA 1C1BB 3D8GA 3VYRA 4N8FA 2OPSA 4OHWA 2JFKA 3NGRA 4JI8Q 2PZWA 4KIAA 3VGSA 2RVLA 3C19A 1R43A 2FY8A 2M8HA 3CDEA 3JB9k 4LBIA 4U68A 4WJ3M 2C2NA 1GX6A 1X3EA 3LX0A 2OELA 2Z2YB 3W65A 2HRUA 2FVCA 2K4KA 3ONAB 2CDQA 2A6HC 1WTXA 1CJUA 2NZCA 4DR2F 2ZBIA 1EY0A 5FJ8H 2EXUA 5EKLA 2QA4S 4I56A 1ENCA 3BH6B 1Q46A 2D0OA 2DO0A 1KLMA 2E2JH 3KUPA 1KC8T 1EYDA 2KQ3A 4C3JB 4PZVA 1T3OA 2J0QD 5B0FA 2IL8A 4HAEA 2VUMB 4X62Q 4HT7A 1O80A 4WU3A 4FXWA 1H9MA 2P2CB 4TY8A 5J1EB 1GJXA 2AYBA 4LR7A 1XEZA 1TWAH 2ZH8A 1QJOA 4JYAL 5CQGA 4JI7L 5D15A 3HEJA 2H5IB 3FMWA 4DX6A 1HR0J 2CJYB 1X0FA 4CO1A 1YHQA 1S7IA 1M1KC 2FJDB 4B9LA 1SUQB 2XGQA 2CUYA 1LW2A 4F50A 4DK0A 1L1OB 4QUFA 3KKFA 5FLMH 2NTTA 1QAYA 4IDKB 3R5DA 2DHSA 3DRPA 2P8IA 2IT1A 3HSZA 3NOCA 2BRKA 3KYLA 3K80C 1Y1VG 3LPYA 1JB0C 1PTOD 2AZ1A 2G2OA 4ZITA 1UEBA 1KQFB 1EUJA 1F0XA 3Q2TC 3OXLA 3S1TA 2ERRA 2M70A 1MGSA 1YK9A 1FRXA 2XIWA 5EAYA 2PMZB 1UFLA 3G96A 2K5NA 3OV7A 1LWCA 1NJIT 4LF5F 1HZ9A 3TDQA 3VALA 1I50H 1L1OC 1ZM9A 1J5EL 3O6QA 2EG2A 2NYIA 2KFZA 2VB3X 2CADA 4B17A 2EK1A 1UW4A 4A48A 4YDXA 1VRTB 3QMQA 1RQ0A 2XZTB 1H9SB 3LW5C 2JA8B 1JB3A 1PZJD 3ADAC 4A3MG 4J9KA 1HWUA 3HHNB 3Q8PB 3BYTB 3TAPA 5HP1A 2L9DA 3GSIA 1Y1VH 3Q83A 1FDAA 2JX2A 5HSPA 3FBCA 2XMTA 1N8RC 4TKOB 1PILA 2YH0A 3D54A 1U48A 1EEID 2JEFA 3M8QB 2NZ1D 3L4BC 4OI1A 1VF7A 3F2BA 1YIJA 2A6MA 4XYOA 2VQEJ 5KG7A 3HVRA 2RQCA 3F0NA 1X5TA 1TL3B 3BBBA 4IQZA 2AYEA 2IJ0A 1S99A 1EYAA 1JWMD 3IBWA 4LF4F 1PYWD 4EBCA 4QIEA 1RDPD 4P10A 5F8JA 4XT3B 4DZ6A 1FK9A 3CMES 3FC9A 4DR2Q 2VKRA 3H3VI 4A3MH 2VG5B 4ZVEA 4JV0A 2OSRA 3DHQA 1ZYRD 4ETXA 1QUQA 3G82B 2DPJA 5IT9c 3DU6A 3NENA 3IG1B 3BSAA 3CKIB 2DJWA 3M6UA 3MR7A 1LO5D 2XS7A 5ELOA 2VU5A 1FNXH 2J6SA 3R5CA 4R4QA 2YKMA 1YI2A 1SYCA 2IJFA 5F2DA 2F5GA 5HLFA 2CCZA 4ES1A 2CRLA 3TN2A 3FJ2A 2HQ3A 2DHAA 4MMOA 3T1AA 3T13A 2GIRA 3BSOA 3GJRB 4DV3F 4IRKA 4ILRA 4L76A 3L7ZC 1AN8A 1VK3A 2Q2UA 4F2SA 1M5KC 1RF2D 4PQXA 1VMBA 3M2VA 1UP1A 1H74A 2VQFL 1TVXA 2EYLA 1L3UA 4B3RF 1H2VZ 3CCMS 2BANA 5F8MA 1E6VA 2XY5A 3ZZOA 1ICFB 4JUZA 1S6PA 3R1HA 1BXTA 4MTNA 2LDYA 2DR6A 2OMOA 2LS01 3VR2A 1E2ZA 1HNZL 3M3YH 1X5OA 4LF5Q 3GSDA 5KFRA 2HLTA 3K5LA 4DL7A 2E7WA 4JI6Q 3GILA 1IR2A 4YWMA 4EMDA 1MD2D 3AMUA 1PFMA 2J9DE 3G48A 5JJKA 1UE1A 2B4VA 1YRUA 2K2PA 1KLGD 2MKSA 3K8AA 1SV5B 1SIWB 3EPGA 4B3OB 2HSEB 2D3UA 4AUKA 5KFYA 3PX4A 4JI5J 3PCOB 1K28A 1ZA1B 1S9GB 1BVSA 3TEGA 3H42A 3OL7A 1X65A 4GN4B 1QZGA 5F9LA 3HVTA 4LFAL 1A2TA 3ZTQA 4F4AA 2MKHA 2F4VQ 4IOCA 2HVEA 3AEVA 2KXNB 2UU9L 4QYZK 5C4XG 2H51B 2MKJA 1NHKL 3J81E 3QZ8A 4LQ9A 1HZBA 4AQYJ 3BM7A 5DDRC 2XO6A 5C44H 3T3FA 3IC1A 4O3PA 2UUCJ 3HDSA 4P74A 1VQFA 3S1QB 2WVCA 3NTIA 3UI2A 1JMCA 2VC0A 2HHQA 3CHBD 2HNYB 2YTCA 1TU2B 3PUXA 1S3OA 3SV3A 2ZHAA 3PO2G 4K2XA 5CV6A 2MUYA 1QDUB 2VPXB 4J37A 2HHHJ 3GTLB 3RBXA 1G6ZA 2KO1A 2XYHB 4I65A 4EX5A 1HLWA 1PH8A 4LF6Q 3PW5A 3W1GA 2I5JA 3A8KA 5C4XH 3KLIB 1D8LA 5F9NA 3FCWA 3QB3A 2VH7A 2LCWA 4L72B 1MMDA 4Y7NB 1EYGA 4ES2A 1N36J 1VMCA 4DV4L 3CPWA 3DDNA 4C8NA 5BXIA 4DV3Q 1CJKA 1GXTA 3KK2B 4AXJA 2KUMA 1HA1A 1WTVA 4ID5B 1RT4B 1YJ9A 3ZTPA 5E4WC 4WK1A 2Z6KA 1T05B 4ZDNA 2WVBA 4DR1Q 4OZ3A 2D3O1 1T5XD 4P6QA 5JVGQ 1RHQB 3IO1A 3PG9A 3ZZZA 4KPYA 4DL5A 4B3RQ 4LRCA 4M1UB 4GKJF 3EGNA 4J9PA 3DXBA 4YMEA 4PXDA 1LTBD 1UFWA 4WFZA 1I3OB 3DU5A 4OX8A 2ZBRA 3CXCA 1S57A 3VR4A 2PFFB 2FJAB 1GKHA 3I31A 1HA5A 4OJ3A 1RU1A 3J7YU 4C1NK 1BR9A 4X65J 1K1QA 1KFSA 1DFDA 2BZ2A 3TZDA 3T5JA 4IFDJ 1F6TA 2X3DA 5CYUA 5J2MA 4O0NA 1TAQA 3PY8A 1RWXB 4IPCA 2FJBB 1PTOH 1JLAA 2V68A 3M4YA 1W7WA 3BH7B 1C0TA 1RISA 3CP0A 2E7XA 1OYDA 1U2RA 3GTQB 2N55A 3W8GA 3M4OB 4PG3A 4AH6A 4KHPJ 1TV6A 1RJTA 4EI2A 3B54A 2OP5A 4CLSA 3OHAA 2HURA 1XTCD 2EFNA 4MAKA 1HR0Q 1PCAA 1YGYA 2RS2A 5C3EB 2VS1A 4C8ZA 4RX6A 2Z0GA 4DXFA 2VKZG 3MPWA 4HN7A 1JK9B 2YQ3A 2KFNA 4RNMA 4POFA 3M1VA 4UAIA 2VDHA 2MKCA 3DMJA 2F0GA 1D5XC 1JR0D 5KFJA 3NPPA 4NA3A 3R27A 3EXYA 2HQIA 1SC4B 4CP5A 3HCXA 4FYWB 5L1JA 3UDXA 1WEZA 1LOUA 5GQOA 2E5LF 1EFID 1E24A 2E5GA 1DOMA 4DUZL 1SNMA 4ED5A 2KHJA 3DLEB 5M5YH 1JLEA 5I2XA 4RL1A 4KK7A 2BUNA 2FZGB 1UEAB 4TY9A 1N56A 3W5ZA 2B8PA 3KF8B 1S72A 1TELA 3PKMA 3UI3A 2KYZA 3MFYA 3CWJA 3R3TA 4WZMA 3BVMA 1WG5A 4FXKC 4ZVOB 3O8WA 2V34A 5IT4A 5ELNA 3FGVA 4ED0A 5CMDA 2NVTH 1JQGA 1LT6D 2NVYB 2ILYA 5HMWA 1T5EA 4XDXA 1OTCA 1U8WA 5LSRA 2A5HA 2VBXA 5DRKA 4M5MA 1IKVA 4CDFC 2VQEQ 2DITA 4QIGA 3T1YJ 4G57A 2MO1A 2XCPA 1QJHA 4DV5L 1GXLA 3WIUA 2NYZD 3QWNA 5C42A 3P1HA 4CKCA 5CYQA 2F3WA 4HJ9A 2ES2A 1Q12A 5KFSA 3VA5A 3K7UC 5CABA 2RQMA 4HT5A 3THTA 2GJ2A 3VAJA 4QGUA 2B5JB 4NCGA 2ZJPA 4PWUA 2AJFE 6FD1A 4R8UA 3MCSA 1LLRD 4RJVA 3MPYA 2PI4A 1CKNA 5CV4A 1VCIA 2RB7A 4HL9A 3POTA 3FMCA 2NR0A 3LGNA 4IR1A 2FZCB 1HNXL 3UDLA 2QMUB 3WC2A 4WP8A 3R93A 2VY3A 1PJ6A 3EYZA 4K8JA 4RWXA 2QN6B 2GCFA 3MMCA 3U9SA 3HJVA 4CLLA 1WTHA 2QG9B 2HWIA 1C0UB 2I5HA 3DLLQ 5GAEU 4P2XA 3NWSA 2K7JA 2WAQB 1RT7B 4IOBA 2R61A 2EFVA 1U1RA 1X32A 2I07B 3A7AB 2CH4A 1HPZA 3IA0A 3AD7C 4MFBA 3MFGA 1H38A 2QV6A 5I9OA 1CVJA 1KAWA 4R8NA 1RBAA 4OQJA 2DISA 4BWJA 3IR7B 4X66L 3LTOA 1U4RA 3W8PA 2F7VA 2XQCA 2ASDA 3PQIA 3AJDA 4FPIA 4QR1A 2XS5A 4BS2A 1HQRD 2XVSA 4FXGC 3KDFB 1X8DA 4OI4A 3PRVA 4O44A 4AD6A 3NBHB 2KRRA 4CO0A 2O67A 4EWTA 4QF4A 5EKIA 2Y1JA 2CPYA 4L8JA 2ZJRA 2CKWA 1KTQA 2JQOA 4RPFA 4J9QA 4DF4A 2Q8RE 4DA2A 2Q8TA 1FE0A 2Z2MA 4FS1A 2ATCB 1B0PA 1UA0A 3K7RA 3K8VA 2R92B 1VQLS 1UVJA 4RA8A 4LAAA 2A1AA 2XULA 2V4JA 4WRDA 3RBEA 1YITA 3CCVS 1RYRA 2Y0SD 2F0SA 3HOZB 1IM4A 4R4TA 2AJ0A 5C5JA 2E7VA 1RAIB 4CLKA 2MLYA 1DQ9A 3FQLA 3S15H 3BYPA 4Z7CA 2UXBJ 3B6YA 4AQYQ 5AE3A 3L3CA 1JMTA 1RP5A 1X3QA 2QO3A 1BQNB 2D41A 3CJ2A 3GTGH 4F0MA 1EZ8A 1AW0A 4X2BA 1WOPA 5KT4A 4X4SA 3C6TB 3VQTA 1HJPA 3I72A 2DRBA 2WBRA 2R8IA 2XEXA 4KJNA 5E2QA 4CH7A 1D8ZA 3RW6A 2B9YA 2CQ4A 2GO9A 4Y6IA 3CJ0A 1DJ0A 1SNCA 2WFWA 5LMNW 1PRTF 4YEAA 2MTLA 2ZJQA 5HJYA 3D31A 1G4CA 5BR8F 5HBMB 1TMJA 5CBAE 1PH4A 4YHHF 4ECYA 1M1KT 3KJVB 5FOBB 1TKXB 3ZZTA 4Y52H 1XBWA 2JA6B 5F8GA 2OFGX 3KHGA 4CH1A 1S1UA 4FYVB 3NK9A 4OI3A 2W9BB 2QCPX 3EWGA 1N36Q 3UCGA 3D1HA 1SMYC 1X4DA 3OTBA 1BQXA 3FRZA 5J2PB 1A63A 3WIVA 3CC2S 4OZLA 3HF5A 3EA6A 4F0HA 4GS3A 1T9TA 4H13C 4ZVGA 4DR3L 2QMWA 5M5XB 3D4DA 4POGA 2CNKB 4KYZA 1IYVA 1GFWB 1YQHA 3WDNA 3HOYB 2HS0A 1RTDA 4LF8F 1SNDA 3DRYA 3LALA 4DL2A 5IT9Y 3G6VA 2XMMA 5ELFA 3I91A 2ZKUA 2PE8A 4X65Q 3HHLB 1IW7D 1N8RT 2HUGA 3KJFB 5DLGA 4QMGA 3HKWA 3OIPA 1RTIA 3ITHB 1PYOB 1SQEA 1YSJA 1XN9A 2WP8J 2J6UA 1RT1A 1V3RA 3PO3B 1FNVA 3EBEA 2V2VA 1REVB 5KFCA 3EGWB 2CVRA 3SDZA 4GC7A 1RWNB 3AXMA 1VQ9S 3GONA 2E75C 3HOWB 2CPEA 5C6AA 2QA4G 4YY3J 4F88A 3I9V9 2HVHA 4QUCA 1SAPA 5AE1A 2DPIA 3RAQA 1TS2A 1LWFA 1CSJA 1FXDA 3HULA 4TQRA 2Q2TA 2BKNA 1UW9A 3DDKA 1J5OA 2RKIA 2ICIA 2SOBA 1K83H 1NPRA 2YTYA 4JBCA 4HJ8A 3IM9A 5CAAA 2K5VA 3E51A 2AV5A 2OT2A 3ZJYC 4ED7A 2VOOA 1XPOA 4DV0L 2A10A 1FJGF 2YWEA 1WF1A 3GV6A 1K73C 4XXEA 2HS3A 5CORA 4G6VB 1ILPA 3B6BA 2XZWA 4TYBA 1X4CA 3J80c 1SIZA 4OZNA 2BA1A 2QZ8A 3F1ZA 3IRBA 2YU9B 1IBKF 1HMVA 1NRKA 1X4GA 4NMZA 2H4OA 3J7Z5 3OHBA 4DPGA 1VR6A 1EP4B 5E1FA 4OIKA 5M2RA 3PR5B 3V4IB 4NLVA 2C28A 2OEKA 2M88A 1U4MA 4ZKCB 3RUBL 3KWMA 3DOKA 4KKSA 2DY1A 3CCWA 4HH1A 3WZ0A 4DV2J 4QPTA 2YKNA 3EN2A 4R5PA 4B9MA 2UUAJ 1XTDA 2FYXA 2BOAA 4PWWA 4ELVA 3HKZE 3KJQB 2XO7A 1IBLL 4K0KF 1UL3A 3C2PA 4I1TA 1NNXA 1R27B 2UXBF 1FXRA 1CSPA 5A8KA 2RSQA 2BOSA 2A6HD 4JV5J 3KF6B 1NJXA 1PZKD 1NPKA 3WX8A 3ICEA 2HQDA 3CCMA 1JLBA 1D1UA 3IRXA 2J0SD 1IQZA 3ULPA 2RDGA 1N5SA 2KT2A 3UN5A 3SZ2A 3B4MA 4OWWB 3Q89A 1HFEL 1IKYA 3CDUA 4UF4A 4K59A 2WSEC 1NM2A 1SH3A 4HEDA 4C48A 3ZTSA 2H48B 1JJ2A 2Y0SG 1FVIA 1X56A 2B51A 4QW8A 1JOOA 3H25A 2GHVC 2I1RA 4IJHA 3T1HJ 2CVEA 4I69A 1S7HA 2GVZB 5I3QA 3VGVA 1C1CB 2JH3A 4NYZA 4NYOA 1S9EB 3KLEA 3GG0A 1HNWF 1T95A 5D0EA 4F3OA 2HFVA 1CHPD 4W4MA 1T11A 5DM6Q 4WU2A 3ISNC 4ZS6A 2ADBA 4HI1A 1TS4A 3R1LA 4FBTA 1RLCL 4BWMA 2E29A 4LFBJ 5KFFA 1FTCA 1VISA 3PYFA 4WIIA 3MEDA 3CF5Q 1RT5A 5DM73 4K4SA 2H4YB 4WF9Q 1FJGQ 4BC9A 3RB6A 5C25B 1LTID 1EIFA 2XMJA 4OX9L 3RW7A 5LMNF 4KV8A 1B3QA 4DV1F 4NXML 4LSLA 2Z30B 2APOA 2HQFA 4KHRA 4ECUA 5FDLB 4K2JA 1ZTTA 1KNZA 1IBKQ 4RO0A 3O2IA 4WFAQ 1X9NA 2IC3B 3I4MG 1AZSB 1VQIA 2GS8A 3UNYA 4TU8A 5C0XG 2GX8A 1ZAVA 1CBKA 2MQMA 3MEFA 3D0GE 1HBOA 1DTQB 4J5OA 3C16A 2Y1IA 3KLHB 3AFQA 2OHDA 4DR6L 2CPHA 1HNVB 1GUOA 4BBSG 1JXEA 1VQYA 3HI9A 3OUYB 4ZAIA 4ENOA 1YVFA 4EZ6A 1Y1WB 2PMZD 1JOKA 1PGZA 2CQ1A 2B2YA 3T19A 1VDZA 5IV4A 4RBVA 1JLCA 1PH9A 2N4CA 1GHJA 2VF3A 1RAHB 4CIOA 3PIPQ 1GH8A 2FD2A 1S5FD 3S1RH 4YY3F 2AQ4A 5G3LF 1D9DA 5DLQE 5HQMA 5H9EK 3D5MA 2CYYA 4FYXB 5C0XH 4KV6A 3OTOF 2UXBQ 1AH9A 4FPRA 3STBC 4XPCA 3HP3A 2MKYA 3K2YA 5LXYA 2W7AA 1T9WA 1G91A 3EFXD 1JLGA 5M3FB 1IKWA 3NHHA 2BV3A 3CJTA 4JI8L 5D3GB 2L9HA 3G2XA 4ZPBA 3KDNA 5KG0A 2E66A 2FY1A 1H0HB 2YTXA 2Z8QA 2IRYA 3G7LA 3DHXA 4ODGA 5KFLA 3GV8B 2D9UA 1TK8A 2SNSA 3I32A 5DZ7A 2E76C 4IFVA 3K59A 1HD0A 2BJ8A 4U7UK 2ZE2B 7AT1B 3PEJA 1K9MC 4F4WA 1WORA 2BVZA 1UWBB 1BBXC 1K3RA 5LMUF 5DQGA 3MEGB 3EXCX 1RT2B 1XNQJ 4R8IA 4X62L 3HOVB 4LWCA 5L1IA 2LQ5A 2VICA 4ZLTF 2CPZA 2PA3A 4P72A 4HSVA 3NNCA 3BGRB 1SJ1A 2HWTA 2PA8D 5HVFA 3W2VA 1O7ZA 2C1EB 4DUYF 5FLXY 3BVZA 3PW7A 1SYGA 3DM3A 5BYQA 3D3RA 2C22A 3JQMA 2CQAA 4XPEA 3RN2A 4ZHRB 4O3RA 3MWBA 1VQBA 3F41A 2WTFA 4L5QA 1MU2A 5C2CA 3DYAB 4ZCMA 3M32A 5GAGU 4A93G 1Y3JA 3NCPA 5F8IA 4ATNA 2HNZA 3VVTA 5LXRA 2F0OA 1WKLA 3C14A 2EY5A 1UMJA 1KL9A 2XWBB 2HDLA 3FSIA 3SQOP 2ZXRA 2KHDA 2R2RA 4BY7B 3AD9C 4ZVQB 5KRUA 4YR2A 2HWHA 3GP9A 4X3KA 1DZ1A 4PG8A 3T1HF 3D4JA 1FWPA 1V9OA 1D3WA 1NPPA 2F9DA 2AD9A 1N6QA 1EY5A 4Q8FA 4YY3Q 2UZAA 1SYBA 1IZ6A 5BN5A 3JAMc 1U9RA 3S24A 4A93H 3MM9A 3WOEA 3V2TA 5GMDA 4CT9A 3CAMA 3OTOQ 1G6BA 2KXFA 4OHZA 3ERQA 1NUCA 1AA1B 4C2MA 4C8OA 4KHVA 1R6YA 2CDRB 4PUOA 2MJ8A 1V1QA 4OYWA 3AD8C 3FEZA 1GMWA 2PC6A 2R93H 2WB1G 2YX4A 3HHDA 4NL5A 1VQSA 3ZZUA 2M0GB 1QSYA 2IM1A 2ZBCA 1S1VB 1I3QB 2BDOA 2HQLA 1TTHB 4FKXA 3DWQA 2HAFA 4F67A 4L6TB 4DR2L 1QVGR 3PIOQ 4HDHA 3V5RA 4C3JG 2DY7A 1L3TA 2FJEB 4BA2I 3GJTB 2VUMG 2CIMA 4OI6A 3BZCA 1K8AC 3M8YA 4IPHA 3KXDA 5HROB 2ALYB 2MGSA 4H4OB 3JTNA 3GYGA 2IMOA 1WOOA 4DHVA 2IRXA 1KONA 3HHEA 2CZVC 3KLFB 4JOUA 4LF9J 3AOCA 3ILLA 5E3QA 3HT3A 2DN8A 3DI6B 4HJ5A 4DV2Q 5HVHA 4DDFA 2RS8A 4OX7A 2V4RA 3NBIA 5C2GA 2KHCA 2UUAQ 1R8PA 3MXUA 1UZDA 4F87A 2WSCC 4C0HA 2EE1A 3BPSP 3I8ZA 1KDBA 4C3JH 4ZCIA 2IYIA 2K8GA 4LIRA 3NQTA 2VUMH 3C6UB 1XWEA 3ILJA 1GNKA 2X6LA 3BS9A 2FHJD 4OJ1A 4JV5Q 1S6QB 2XM3A 4TQSA 1DHMA 3GLJA 2RT3A 1SR3A 2ZH2A 3KOAA 1AE3A 4K8IA 3LOUA 1XMOJ 2F4FA 1K8GA 5D0GA 1HPCA 3URYA 2QL7B 2NVQB 1VFJA 4HR7B 2MLZA 2LU1A 4M5HA 4H7BA 1QTNB 2K1RB 1K8MA 5CCLA 2XRSD 4HEA9 4UP9A 4LF5L 1RHJB 1DXMA 2VW9A 4L75A 1QTMA 2JA5B 4GRSA 4FF1A 3T1HQ 4DN4M 1K0TA 3IBFB 4A3IB 3L7PA 3MTSA 2B9WA 3TAQA 1U4PA 2IW3A 4JV2A 3CCUS 4RNFA 1VQLA 2CZ4A 1RBOB 3FPUB 2M4MA 2XY7A 3CCVA 4F0KA 3P7JA 2IVFB 1KXLA 2B8GA 4NPOA 2QFJA 2JEGA 2EBGA 4I2QB 1HRJA 4LFBQ 2TSSA 4QCLA 3MURP 5CD4A 1K44A 1EOTA 4R4IA 3CE8A 2CQGA 5JOBA 3QT6A 1XMQJ 3F2UA 4CYUA 3NS5A 3G6ES 1B9MA 3OR2A 2OI2A 4LF4L 1WC1A 1S5ED 3S8SA 2Q66A 1LWEB 1IR0A 2QLJB 4W98A 3CQZB 2YQ1A 4JI0F 1EX8A 3QSIA 3LGJA 4P75A 2JEBI 2NUHA 4ZKBB 1F2YA 3EQLC 4HIOA 4OLPA 3TUJC 4ES3A 5ELEA 3SIPB 2LVWA 2HHVA 4DX5A 1H7WA 1NSNS 2PZUA 4DMZA 2VB6A 1EETA 1S5ZA 4RW9B 4N56A 7FDRA 1N33F 2ZDPA 2D3ZA 5LL6d 1N0VC 1RA7A 2V50A 3NRBA 3CCLA 3TJ9A 2RH3A 4ECXA 1SL2A 3A5UA 4DV3L 4LRDA 3D6WA 3R8BA 3ETMA 1XIQA 1NNDA 4ZPCA 5KG6A 2ROEA 2NXJA 4J9MA 3VGTA 3PO5A 4A3EB 3LP1A 3U4ZA 4DR1L 1VIXA 4OZ0A 5HATA 2ZUAA 3EPIA 2RA4A 2O66A 2VZ9A 3CC7S 3J80Y 1SKRA 4FNHA 4B3RL 5EGYA 5EBCA 4ZPVR 1TL7B 2DHHA 2OAUA 4G65A 3QGHA 4FXVA 2V2QA 1EY6A 1DBDA 3D28A 5IP9H 1KVJA 1IR1A 4ID5A 2WZ1A 1KOHA 1FTRA 3GFZA 2FINB 4QWDA 3AJ1A 2GVAA 1CI3M 2GA7A 2FHJA 2XSJB 2P5ZX 4YP3A 4OYOA 3THPA 3V2UC 3TWZA 1RT3A 2F8MA 4ZVFA 1I6JA 1VQ9A 4PZ8A 4RLEA 3RZDB 2DNHA 3R5JB 2PIIA 4EO8A 4J6HA 1K73T 3SEBA 1S48A 2JLFA 4MK8A 4ZN3A 4X3TA 2W9AA 1XNQQ 4Y2KA 4JI4F 4Q2LA 2GQ2A 1N5YB 3QGIA 1XNRJ 5C7PA 3DMUA 2K3KA 3LAMA 4ZVTB 4L5SA 1N48A 2PCFB 3M05A 4BLGA 5KOXA 1R8CA 1SFOB 4C3IG 4QJVA 3E5SA 4BCAA 1RT6B 3EM1A 1EKSA 1HR0L 1LXJA 2WAQD 1OO0B 1ASZA 5DDQC 2EEYA 3TYTA 1PH7A 1Y5LB 3DXSX 4C3LA 3MPVA 1TL1A 4G1QB 2HCIA 2YY3A 2JN4A 1U7LA 1WFQA 3JYTA 1XMOF 1CSQA 3Q0AA 2XLJA 2NTSA 4HI2A 5J2NB 3HM9A 1S59A 2LMCB 2YNHB 1TKZA 1GTHA 4C11A 2RQXA 5DG7A 2CJXB 3H7HB 4ZOSA 3S1QH 3DFEA 4PRFA 4C3IH 3PUYA 4MN3A 4JI1J 1ZYQA 4Q0BB 3BO4A 2ZWOA 3ZTRA 1NK9A 2B9EA 3BJUA 3LP2A 1RHKB 1R8AA 2Y1LB 4JI3J 3GTLH 3DRXA 9ATCB 4ERDA 3J7YI 2PMWA 1XWLA 2AYGA 1XC9A 1LT5D 2HVZA 2CG4A 5AJ3J 1XMBA 3DEPA 1XYIA 3BR8A 3CT9A 4P2SA 2Y8WA 4FVMA 3G6YA 2RDJA 3ZO7A 4IUTA 1QG7A 4C8YA 3BU2A 4Y7NH 2JE6I 1YNXA 4RGOS 1U0HB 3IKJA 5KFTA 1B70B 3CRLC 5D0HA 3MAAA 2YWGA 4GKJL 1M1HA 2N78A 1XMQF 2KH9A 2VQEL 3V6DA 4HJ7A 1WEXA 3M8PA 2AGOA 2HHSA 4DR5J 1U25A 1GO3E 5C0XI 5F8NA 3T16A 5IT9L 1QAJA 3QYYA 2DNLA 5I6YA 4ZMMA 3VYUA 4WFN3 1P8GA 3DCAA 3I0SA 1HH2P 1FD7D 2W9CB 1V1PA 3KLGA 1EJ7L 3CPFA 4DCJB 4UOGA 4JB8B 4UY8C 1CULA 2GFFA 5IP7G 1Y3KA 1PBUA 4G3IA 1SMYD 4A46A 2GIFA 3OJSA 2MZQA 1V5VA 4WPAA 3I0RA 2F0HA 1R4QB 3NWRA 3GG1A 4G1PA 2HNDB 4IQXA 1CA6A 4JI4Q 2BA9A 1QILA 2L4NA 3K0YA 3F44A 2HQGA 3QAEA 2AIRB 2QRRA 1Q7YC 4IRDA 2D74B 1ESRA 2EVBA 4PNYA 2YNFA 2DY9A 3IL8A 3TS2A 1WI8A 1XXGA 4CKBA 2PZTA 1WKJA 3QFWA 2KOLA 1JXLA 1JJGA 3LUYA 2ZBPA 2VODA 3OR1B 3PHTA 2I38A 5IP7H 2HYIB 4A3LH 2XWYA 2EDGA 4C3KA 1EY9A 4IH7A 3R3OA 2F0WA 1T3NA 2DR5A 3TVYA 3UD3P 3HFZB 3D67A 4O3SA 5FLXE 1HTPA 2M9VA 1XMOQ 2B7BB 4RUBA 1V43A 3L7UA 1FA0A 1P9YA 2D5DA 4FVCA 1Y10A 3JAMU 2ZD1B 2V5HG 1D8YA 5C3EH 1UJ5A 4YWKA 3QT5A 5LSLA 3ET6A 4USWA 2E5LL 3H5YA 1S1TB 2RBMA 3HHLD 2CG8A 3BGFA 5BN4A 2ZC3A 2GMJA 2YTVA 3VR1A 3MXNA 3ZFVA 1IUJA 2MHNA 2ATLA 3TVKA 2KCCA 4V0BA 2LXKA 7FD1A 3ELHA 2W4PA 1MROB 1HNIA 1WTWA 5IFMA 2AJ4A 5A35A 5THWA 4ICLA 3CPWR 2A6EC 3DRRA 2DKOB 2GJFA 2YKAA 1XMQQ 4LSZB 3J80i 1K9MT 1R0AB 1CS4A 4QWBA 4O1NA 4BY1B 2DNZA 4AQYL 3CD6S 4B9XA 1NK8A 1FD2A 2K06A 2B2TA 2D69A 3OL8A 3ZYYX 3PW0A 5LT5A 3W2DA 1KP6A 4F02A 2VA3A 1SYDA 4X4UA 1UVMA 4HKQA 4RW7B 4DS5A 5IOCA 4NLWA 5GAEI 1JIHA 3W66A 4ZRZA 3I4NB 3CB4A 2A1BA 1ML0D 1L3SA 3M30A 3TP5A 5B09A 2CQHA 3BF4A 2ZXPA 4NXNJ 1F2GA 4O4RA 4LREA 3AHPA 1D9FA 3A0JA 1X3GA 4XQQA 2HBYB 2B2VC 3QGPA 3KLVA 1ET9A 3PF5A 5KNBA 2UUTA 4JI1F 3P6YC 3JAMY 1E2WA 3IN5A 4J8QA 2B8FA 2BEFA 4YOEA 1QE1A 1U1PA 4IPGA 4I7FB 4JI3F 2QGFB 1VOMA 2P9CA 4ALZA 4I6WA 2V67A 3WC0A 3RUZA 1UVKA 1VQOS 2Z6BA 4B9UA 1WVLA 2C3OA 2OD6A 1IBMJ 5IGBA 5A2QE 3HO1A 1RBLA 5KTQA 1TKXA 4AIMA 3RB0A 2Z56B 4K14A 4X4TA 3T5LA 3OLBA 1VQMS 3KOJA 2E9RX 1GHKA 3V81A 1AW7A 1IWAA 3I56A 1NAPA 2DGXA 3N6LA 1RZMA 4DUTA 4CI0B 1KHWA 2RDDA 5KFMA 4KT0C 3FKIB 2DD8S 3K6OA 3PIOA 3K57A 3W62A 1K0SA 3M2RB 2R92G 2VOPA 2DCUB 1N88A 3G6XA 1BCPB 4TNOA 3T6JA 2VFSA 5DO2A 3SXHA 3HOZG 2OTLS 3ISND 1KQSA 1HIYA 4YCVA 2ASLA 3KK3A 4H4MA 4RW4B 2IPOB 4LK1C 4DFPA 1I6VC 1O78A 5CV9A 1JLQA 1SYFA 5HQ8A 1K0VA 3Q8DA 4KFBB 2YX7A 1B3TA 1GK8A 3CVKA 3DOMB 1VQJA 4AE5A 3OW2A 2BBEA 3N28A 3PYGA 3SXLA 3DC2A 3K0JA 1VQPS 4KH1B 4HTJA 1N32F 3DN9A 1VQ7S 1FRHA 2Z57B 1K8AT 4ZVUB 2KJWA 2B4PA 2R92H 3CDWA 1HI1A 1YKWA 4R0EA 5I3PA 2NQPA 3T51B 2JEIA 3SK6A 1JNZB 3SFGA 4ANEA 3HOZH 1C4QA 5T7LB 2QL5B 2C2EA 3R5BA 2L41A 3S2DH 1NH7A 3P3DA 4LJMA 4CZCA 3HHKA 3CC4S 1S10A 1Z7TA 1SJHD 3OLAA 1Q95G 3Q8VA 3VV2B 4YHHL 1Z9FA 5GMEA 4JI1Q 5B7WA 1LTLA 4I7ZC 4X64F 2R7UA 3MECB 1WCMB 1JT8A 1NLKL 1H98A 1FF2A 2HBZB 1PV4A 1UJ4A 2IHR1 3VAHA 2CQ0A 2L55A 4KKOB 3PRDA 1EFWA 2OFHX 4JI3Q 2I2YA 1IKMA 4OIJA 3STBD 2UVRA 5A8RB 4FP5D 2AT1B 3I5AA 5AJ3Q 3TA1A 2OPRB 2PYKA 3CJ8A 1S4ZA 5KFXA 1VQGA 5C24A 3N5BA 2ZH6A 3HOYG 4L6V3 4BS9A 2WKCA 1WKKA 3CCES 3ENVA 5CHCB 2XGTA 2JA6H 2LY7A 5KFPA 1Y5NB 4KSEB 4RBUA 1E3PA 5AXNA 2J6TA 4QQBA 2IAJA 1WHYA 4DR5Q 1H95A 1QNUA 2FLOA 4LF8L 2OEJA 4DPUA 2QMXA 1SCJB 3JC66 4DK1A 3MI7X 3AB4B 4P7VA 2PN6A 4W90B 4DR4F 3K5OA 4E2FB 2EC2A 1S5DD 2N3OA 4RKBA 2FC9A 4F2RA 4RKUC 3GO5A 3D0FA 5M5XH 3HOWG 2QT7A 3AB2B 5IIFA 2FB0A 1MG7A 1S97A 1A6LA 1RAOA 2KJVA 4DV6F 3HOYH 4O23A 2RDHA 2GGPA 2E1PA 4JI7J 1FR3A 5B08A 4A3GB 3CCUA 2WONB 1QE6A 2E9TA 3QNWB 2FMMA 2XMVA 1EWHA 4HH0A 2F0KA 3DLGA 1KNEA 3RR5A 4ECTA 2O2LD 2CHBD 1PAUB 3PR4A 3HPOA 2JA9A 4KMUC 4CHTB 4LBHA 2B63G 1S4FA 3M9NB 5F8HA 3FRYA 1N32Q 4I64A 5EWGA 3PO3H 2DNMA 2V9WA 1HBNA 3QJLA 3BBCA 4AYBG 4PQAA 3N4WA 1FJCA 1A9NB 3S9WA 5IV3A 3HOWH 2K7KA 3IXQA 2BCOA 1VHFA 3G6EA 4C8LA 4DSKA 2RU9A 2VG7A 2GVZA 3SBMA 2K01A 3CJKB 1ZZFA 1FJGL 4I0WA 3PZPA 4A3KB 2F0FA 3ZNJ1 2K32A 5M2UA 3QT8A 1IKLA 3FK4A 1VBXA 1J5EJ 1IBKL 2ZOGA 1BNZA 1XQIA 2L9NA 4IG3B 4ZPTR 2XY6A 4WYLA 4MH8A 5GAHC 3BDOA 1I4HA 1SEBD 4DLGA 3RZOB 3HOXG 2JDJA 2PEHA 5J39A 4X64Q 1FKOB 5DG9A 2QSWA 1RTHB 2Y1RI 4LF7J 2YU9H 1R4PB 3TMEA 1NKEA 1FCAA 3S17H 2JA7B 5DLFA 1AE2A 2R3VA 2KM8B 4L3KA 2EJGC 2F9JA 1B8AA 2EKYA 1Q90A 1AFPA 1VC6A 1ZKOA 4DK3C 2PQAB 2NZHA 2Z1CA 2MSTA 2QKIC 4K0KL 1S1WB 1T03A 2HD3A 1RHRB 1U6FA 3UCZP 4DU8A 1DOLA 2UXBL 2P5VA 5ETMA 4CDCC 4QWAA 3GFXA 5KG5A 1P6TA 1U47A 3HOUB 1KVIA 4DR4Q 4Y2MA 1TWCH 3Q23A 4R4OA 4B02A 3OIQA 2AU0A 1A62A 3FBFA 4LF1A 1FFGB 3SGIA 1FWKA 3PUWA 3C66A 3SQGA 2DXDA 3Q8YA 4KGZB 2F8HA 4NXNQ 3MDFA 3OVBA 2H4WB 2K5WA 5KFVA 4DV6Q 2M9KA 5E5NA 2NUUG 4M5DA 3N79A 4XTCS 5K8NA 2RSNA 2E1MC 2K5HA 1HNWL 4KGKA 2X3GA 5E3AA 3D9BA 3FPPA 1HFGA 1PKUA 1A8VA 1S77D 2QLXA 3A8IA 5KFIA 5EUHA 3PO4A 3DGPB 3KK1B 4DG1A 4RMFA 4JG2A 2OF1A 3FQKA 2VQFJ 1MN7A 2K14A 3LWUA 4NLQA 3GMGA 3J81Y 1ZXTA 5KYLA 2C2OB 3QIAA 2KG1A 4PQUB 4DKAC 1R31A 4UHVA 2QE5A 4DPWA 3FSYA 4IH6A 1N9WA 2CQBA 4LR8A 3AAWB 4GNXB 1TVRA 2HW3A 3WDOA 2B39A 2Q3PA 4IFYA 1TKTB 4APVA 4G7OC 3J7A5 3QG1A 4CGYB 1LW0B 1VQ8S 1H7XA 1IBMQ 2EY1A 3ERSX 3D68A 5LMNL 3ZTOA 5C3WA 4U67Q 3AQPA 3L09A 4OIXA 4DOZA 1VC5A 1CKMA 3KHRA 1JNRB 1D9AA 2C42A 2JJ4D 2GNKA 1ONLA 1A2UA 3TA0A 3OTEA 4NXMF 1FDBA 1RE1B 1W6KA 3MM5A 4GNXC 5A8WB 3CRKC 5JAVA 2HMIB 2HPUA 3AU7A 1S40A 5IQ6A 5DNFA 3D6MB 4JI2F 1BKBA 4WE1B 4O2DA 5E7NA 2VFRA 8RUCA 2B2UA 3KK7A 2DYAA 3RBZA 2HBQB 1GM5A 4LFAJ 2IX1A 2VG6A 1EIHA 3US5A 1PH3A 2NN6H 2OPPA 3FP9A 2UU9J 1VQNA 5BYRA 1HBMA 3ZZRA 3TJAA 4UZBA 1WTPA 2HGMA 5IM0B 1J27A 4YY3L 4G7ZC 3BZQA 1ZEQX 4GVLA 5ETPA 4C3HB 4MJKA 5A6WA 4X3SA 2A68C 3TZZA 2AQ1B 2BYCA 1Y1WH 3OWFA 4UY8T 3OTOL 1WACA 3MTJA 3O13A 4CDDC 4QR2A 3UVJB 4JCVE 1SXTA 1SDFA 3J80L 2XNQA 4TYAA 1O0PA 3I4HX 1TWFB 1PZID 2W1BA 3S2HB 3FKBA 4NEZA 4ED3A 1Q7YT 4OONA 3NUCA 4QIWE 1VMPA 1QVGA 2HFOA 2OPSB 3TRZA 2FDNA 2QC3A 2BE2A 2Z0SA 1I94F 2C2RA 1Q79A 3CO0P 2KCTA 4DV4J 2BH8A 2PW5A 3HOVG 3C1EA 2K28A 1NTGA 1LV5A 1SJRA 4GO5X 1LTAD 1NMFA 4AFFA 1EU3A 3TEHB 1WF0A 1JLFA 1JJ2R 2FTRA 1STBA 2VBYA 1TK0A 4A3MB 2B43A 1UZHA 2RQKA 2VJVA 2DCLA 1UVIA 4DAYA 4DV2L 4CNZA 1KLMB 2VHGA 5GMKa 4X62F 2IM3A 2UUBJ 4DUYL 2YNGA 3FFIB 4C0OC 2V6AA 4RNHA 5DZ6A 1YBTA 4DAMA 4TY8B 1RTJA 3ILOA 2A8VA 1TUWA 4RWWA 5HROA 2MQNA 1AT1B 3HOVH 1ZOTA 4RU2A 1CQFA 5IGDA 1T94A 3CDBA 1PDQA 4BY7G 2ENBA 1ELOA 4AL7A 2HVIA 4J9SA 4ECZA 2MQLA 3FZ2A 1OJ4A 5ELBA 2OWOA 4V1Ak 4JI2Q 1FX4A 3VCDA 2PGCA 4IO1A 1SRUA 3S16B 4USHA 3SDEA 2Y8YA 1SVDA 1AZQA 4ZUIA 2OJ3A 3DRPB 4USUA 5G4DA 1VBKA 1S4EA 2AHOB 2GC8A 2MGZA 4JI7Q 2OSQA 3T1HL 1X0PA 1TWHH 1CM9A 1S6OA 5HAOA 2XHWA 1SBRA 4PV1C 1LWCB 1U2FA 2R8JA 1XPUA 4C8KA 3BGLA 1B4OA 4BY7H 1U4BA 2J9CA 2CA9A 2XSCA 2IX3A 2W01A 2XWXA 4OI0A 2AQ3B 2AEMA 2H3EB 4PG4A 3P75A 4Q5VA 1KHIA 2DGYA 5FJ8G 3MM6A 3SCIE 3KHHA 2R4FA 1L2FA 3CD6A 3GTPH 2MZTA 4OFZA 1UE7A 1PJ7A 3GTOH 5HP1B 2KA7A 2CPXA 1PLFA 3TARA 4DR7J 3ND8A 4DUZJ 3KUGA 1KRTA 2L48A 1WTBA 3H59A 4DFMA 4K4YA 3C1FA 2NXNA 3RG6A 2K6AA 5EX0A 1G3OA 3X3MA 4ZVHA 1J5EQ 1I94Q 3DNCA 1FKPA 1S5BD 2RDFA 4IUPA 2NSCA 4KY7A 3IAM9 1FKAF 2F0MA 5CV5A 3NS6A 4EGLA 4RNOA 4I2QA 4GVBA 1HR0W 5KFBA 5EWEA 1Q82C 1FK9B 2HVDA 2QYGA 4X4NA 2D0PA 3KNAA 4FZVA 3CJRA 5HMXA 3TANA 3QJYA 4L5RC 1WD1A 4Z7YA 1QUQB 4LF7Q 4DX7A 3K0XA 2PD1A 5HANA 4IO9A 3RAMA 3KTQA 4WJWA 3MEEA 1RAEB 1FEEA 1LK5A 2NWGA 4FDBA 5FLMG 2YKMB 4FKYA 3J81i 1HW9A 2IM2A 3CCJS 3MMAA 5EJWA 5HLFB 1FI4A 4DV5J 2MY7A 2VFUA 3O44A 4OWXB 1VQOA 1NJYA 3DOLA 4M5KA 1BDOA 2CZ9A 1V1OA 2HIXA 4CO5A 3H5SA 1SLJA 3B4DA 5AXKA 1SBBB 3EVOA 1DCZA 1VQMA 1TXYA 3MXPA 1EHWA 1FJ7A 3MOZA 4MYTA 3PO2B 1YHBA 4MZ9A 2JA5G 4BA1I 4ED2A 3AODA 4IG0B 5I42A 1R6VA 2CNNB 5IGGA 3RGIA 2DNEA 2XTIA 5E33A 2J9DA 2EXDA 2F63A 3GQBA 4U673 4QWEA 2IVYA 2LXIA 2BANB 2G1DA 1E6VB 1WTQA 3MR6A 1IWGA 1CJTB 2NCKL 1FWLA 1S6PB 4UQTA 3E3XA 3NAIA 2VBWA 4IUVA 2LDIA 5B0DA 2BJ1A 2OTLA 1SJQA 2F8EX 5H1SE 3ITPA 4JI6F 5LSOA 2IVMA 2NVQH 3PUZA 1STEA 1XK8A 1RWWB 3CU7A 3N9UC 5E41A 4NLOA 3NGDA 3I6PA 1EARA 5KYIA 3GB0A 1G6PA 4YB1P 2CVIA 2JXMB 3LWLA 1PBAA 3OYYA 2VQFQ 3TI0A 1JB7A 4X66J 4UDUC 1WC4A 1TU0B 1V5IB 2JA5H 1VQPA 2MZJA 5JVHQ 2QSFA 4A3IH 1VQ7A 3ENQA 3VF0B 3VAMA 5CR3A 2W4CA 1QSLA 1PTOB 1VS0A 2UUBF 3OL9A 1YRXA 4KD4A 4HHJA 2JYOA 2F4VF 1WC6A 1SROA 3HVTB 1I4RA 4CQ1A 4Q44A 2HFNA 1HFNA 4TKTA 1NMGA 4PYAA 2RILA 3U27A 2F0EA 2JHEA 4JI0L 1LXNA 4OMFG 3C15A 2EY6A 2R7TA 5J1ZA 4QW9A 3MM8A 1BY9A 3CC4A 1RABB 3BG3A 2MQPA 5IY0A 1H9RA 5AFWA 4O0IA 4FP9A 2H1YA 3M8RA 2C2ZB 1ACMB 2XLIA 4RGMA 3SFUA 3W9HA 3DLJA 3V6JA 3JAML 4A4JA 2YH1A 4GOPA 1N33L 3CQZH 1IKXB 4LF6F 1U26A 2GAHC 3FMBA 2A6ED 1Z6HA 1SH0A 5DQHA 3NWTA 1KTVA 1NDCA 1CT1D 1CK1A 3N6NA 4WXWA 4UPAA 5DS7A 5M9OA 4A3DG 3SMZA 3BGUA 1O7IA 5M5YB 4QZVB 3G6JB 2YQ0A 1H3DA 4KQZA 4IUNA 1CJKB 3N6MA 3PTWA 4NLPA 4MK7A 2EKNA 5HL7Q 3W9IA 4DSFA 2HDMA 3H20A 3HVAA 4DR1F 2CJQA 4ED1A 2GVDA 3RB4A 4ANDA 3PYEA 2DGOA 3IR6B 1OY6A 2NREA 1VJQA 1EY7A 4A3EH 2KENA 1RIPA 8AT1B 2G9OA 3AQOA 4DU9A 3NWGA 4A3DH 2KU7A 2KVQE 4NX9A 2KKHA 1U1MA 4KN7C 5KGUA 4OV6A 2BQUA 1URRA 2A6OA 5C44G 2YWFA 1A3VA 5HURA 2JVOA 2ZBQA 2XYPB 3D0IE 2I6WA 1Q4RA 4A3JB 4K5XA 4JI4L 5IYCG 1FFSB 2YPZA 5EPKA 5CC4A 5HVGA 4DR3J 3GTJB 3EZOA 3OW7A 4DNIA 1JLAB 5CXTA 1S79A 4A8WA 3WWVA 2DGUA 1BE4A 1C0TB 4A3BB 5LHY1 5CV8A 1VQEA 2UUBQ 1OXTA 3R2DJ 3RZDH 2GQCA 1ZH5A 1TV6B 4KKTA 3N01A 4ZJLA 3VQSA 2OIHA 4Y28C 2X51A 4LMZA 4LVNP 5CZXA 4DCPB 1TY2A 4J9UE 1HR0F 1RHPA 4KHZA 3DM2A 1EQMA 2VJUA 1R0CB 2MEWA 1SB6A 2VL1A 3GTKH 1X5SA 4ULLA 4P2CB 4IOAA 1XMOL 3SEOA 3C46A 2H5EA 2K5QA 3HKSA 4K6LA 5IYCH 1SFOH 3BQ2A 1R9TB 4AL6A 2QDLA 1W2IA 4A76A 3M1VB 4M5NA 3GV5B 3HD2A 3DMJB 2CQCA 1IBCB 4B3TJ 1B1ZA 3MCOA 3CD0A 2VPWB 2JZ5A 3M2UB 3BS1A 2H54B 2DHGA 3SK5A 1RKIA 5FKAC 5DGAA 2DEJA 1BCPD 4OZ5A 4PMCA 1GMVA 4NOHA 4DN0A 4ZUJA 4F4YA 4JBWA 2LP4A 2UXDJ 4CTAA 4B3MJ 3X3NA 5J2QA 1YHQS 3M6VA 1JLEB 2MB0B 1RCVD 3M85A 1TR0A 1AYEA 1VI7A 1AXQA 1B4SA 1QAXA 4OZJA 2NN6I 3FUYA 4WCEQ 5EDWA 4TXSA 1BO0A 1LTTD 4OEMB 2FVRA 2L9WA 4E6IA 1XMQL 2E2HB 2CNLB 5HMZA 1Y8OB 3E6ZX 3MF5A 2KZZA 2KXHA 1JJHA 3P8BB 4DR7Q 2PNRC 1RGVA 4DUZQ 2XLKA 1CC7A 1UVLA 2KBNA 1JORA 2VQEF 1VRUA 4Q45A 1OY8A 2DNNA 5KFQA 2JLGA 3UWTA 2G2YA 1EEFD 1IKVB 2M2BA 1IJEB 2D1CA 3S15B 4M5LA 1M5OC 2V8GA 4A75A 1WSVA 5C42B 4M8AA 5E0OA 1Q78A 3NELA 2PQEA 2QJ3A 5CYQB 4NI2A 1BQMA 3NTHA 3GTGB 5EHHA 1A7GE 2O3DA 1LTRD 4NCGB 1T02A 2O5JC 5DQIA 4EQNA 3IS9A 4R8UB 1IBLJ 3BYRA 3NXZA 1CKNB 2B2VA 1STAA 3NY0A 3MFIA 4RHSA 2QEXS 4Y3CA 3G8QA 3POTB 4QBUA 1GMUA 1VHIA 2H9ZA 2ZWPA 1KHVA 2HRTA 4UQGA 3T5HA 2PI2A 1STGA 1D7QA 3LGMA 3PSIA 3ZC4A 1DONA 2ZNYA 2E9ZA 1OY9A 4DXLA 3L0OA 4GZYC 1CJVA 4QIVA 3QIPA 1UA1A 3MMCB 4N8X1 3NMRA 3RN5A 4C3MA 4EBEA 2NZOA 1DGSA 1VQ8A 5HO4A 1HQMC 3W5OA 2SDFA 5JVH3 1MWZA 2OCEA 3R5GA 1HPZB 3SV4A 5A0YA 2C3UA 5KT5A 1U6ZA 4KHMA 1VC0A 2WCXA 3SSSA 2ZVSA 2R2SA 2DIVA 3UR3C 3IP0A 1RYSA 2LYVA 4QY7A 4BXXG 2H1EA 3JSMA 2OQKA 4EO6A 2F3VA 4Y2CA 1O6XA 2BW7A 2YPYA 2WOMA 3MWYW 1F9FA 4ECQA 2HK3A 5KFZA 4O44B 4GKKJ 4AXIA 4X84A 3PW4A 3QGGA 1EZZB 5KFEA 2QL9B 1M5VC 3IFEA 2DRDA 4OHVA 2KB2A 3M4XA 2VASA 1HUNA 3TUIC 2AW0A 1BC6A 1NKBA 1FRLA 5CYMA 1FNWA 4K5VA 2HEKA 3J7AF 4KO0A 2W8KA 4X66Q 4BY1G 3NGUA 1J9OA 5IYBG 5KIXA 2DY8A 5HGTA 1M90C 2E2IB 4U7CA 1XX8A 2OEOA 1JXVA 2Q43A 3D0HE 3TS0A 1GD7A 4BXXH 2N7YA 4OZ2A 4JI5F 2MHEA 3CCQS 4OJGA 4HACA 2RHQB 4LUVA 3GD7A 2V4JB 3OFFA 3S01A 1ICWA 3EE3A 4DSEA 3I4NG 2M8DB 3V6HA 3X1LB 3OD2A 2ZOFA 2XWJB 1F2MA 2XRQD 3DLKA 5FLXc 2HS4A 2BMBA 4DBQA 6AT1B 4AQYF 2AX0A 3FZBA 4USJC 1B64A 2BDNA 3IAYA 5SZTA 2UUCF 1LM0A 2BE5C 3HKZD 4PWDA 2CJBA 1P27B 2F40A 1EZ6A 4A3CH 1UPPA 3ZXWA 2AUKA 5J1NA 2UVWA 4DNRB 4BY1H 2IHFA 2ZC4A 3MM7A 3DRSA 2HHXA 2ZZTA 5IYBH 4QU7A 1L3VA 1YZ7A 5JEAG 3M8SA 3DM1A 2RF2A 4EGVA 2HHHF 4ECWA 4M1KA 1MSWD 2M7SA 4JI1L 2PPBC 3I4NH 3HGBA 3EDQB 4MIAA 5B0CA 2LEAA 2MSSA 4Y34A 2WK4A 3F2DA 1F9EB 1PG5B 1ASYA 2MPUA 4JI3L 3J81L 3UPFA 1HQEA 2DNYA 1H6KX 2UXDF 2A18A 3DLBA 4JI8J 2PFDA 2C3YA 4C97A 4B3MF 3TBIB 2LMIA 1N36F 5AJ3L 3OVSA 1S1UB 2DNRA 3NLCA 4DL4A 4KN4C 3S14B 1KDAA 3LO3A 4CJ1B 2EZVA 1X31C 2V8HA 2R7OA 3O5TB 5JEAH 3QLHA 2KT5A 3BKUA 2ZH9A 4FO2A 4UOHA 3ND9A 2YX1A 2W2PP 2GW8A 4HIDA 4WBFA 3WHIA 2PO4A 3JSBA 4DR5L 2Q8IB 1PYBA 2F0NA 2ZKTA 3OFGA 3TX8A 3I7FA 4JOIA 1MW7A 3HG9A 2L11A 2B6AB 2GAGC 2BQ3A 5GADC 2MXYA 4O42A 2L15A 3MAQA 3AOBA 1CG2A 4LSNA 4N47A 1RTDB 2V2ZA 3L7OA 4X4VA 5EX3A 3VZIA 4PR6A 4X65F 3QSYB 1N4LA 1U0SA 2A74C 1RDRA 3FEWX 1EWIA 2LA4A 4IOCQ 4OI2A 1RTIB 4KGMA 3FKIH 4G7HC 1GEHA 2DVIA 4KGVB 1RT1B 3BKFA 3H91A 1OXVA 3FBEA 2Y0BB 5DEHA 1RXOB 4DR3Q 1PH6A 4ANCA 1D09B 2EJMA 1H2UX 3FVYA 3L3OC 1VK8A 1U1OA 4JI5Q 2FLNA 5DM7Q 5T1GA 1QD1A 4HHHA 4KHPF 1N32L 5B0BA 3W2WA 4FYDA 1Q82T 1TY0A 1S76D 1F3FA 2GHWA 1JC7A 1B9NA 1G2SA 5IT9U 4MKVA 4TU9A 2R6GA 3Q8SB 1LWFB 1LTSD 2O4XA 3BPDA 4M5GA 4BC7A 1HBUA 4NLGA 2MP1A 1J5OB 3QBCA 2RKIB 1KTKA 2WRMA 1X5PA 2UUCQ 2BM1A 3MCNA 4OGQC 3T6BA 3I73A 3D4RA 2R7SA 4J91A 3PUVA 4P73A 2YNIA 4TLQA 3DHWC 4WKRA 3IMQJ 4LIWA 1DLOA 3D6CA 2RSOA 4C98A 2HHHQ 4JVZA 1T9UA 3F56A 4LF2A 4B3TQ 2M2LA 1HMVB 2QA4A 4RW8A 2W8LA 1WELA 4X64L 4A8MP 2IA6A 4GKKF 4QWCA 1NK4A 2A68D 2VZAA 1KKHA 3CJKA 1Q8BA 5ADZA 5KT2A 4C9DA 3MAHA 4CM2A 1Q16B 2AJ1A 1RACB 3P5TL 2QLFB 1K47A 3NCRA 3I2ZA 2UXDQ 5KFKA 4TN2A 1MKHA 4WFBQ 4B3MQ 2V63A 2RNEA 4IG3A 3VA7A 3DOKB 1KN6A 1OPIA 4HCEA 2ZDOA 4HDGA 1Y5IB 1WCMH 1YJVA 3BN4A 4PXEA 1XR6A 3R2CJ 4UW2A 1EQTA 3NMAA 2YKNB 4DR2J 4O3NA 4R5PB 3RNUA 3S1NB 2R42A 3BZDB 2DJGC 1RAFB 3K5PA 2Q2HA 4IJLA 1YJUA 5I3UA 3D4WA 4BBRG 1ENAA 4F4ZA 3S1RB 1Y00A 1JOQA 3I4MB 4K7QA 4QPXA 4UOCA 3W1YC 3T1YF 4DR4L 5LL6X 4X6AH 4EVOA 4NCBA 2IA0A 4BDPA 1K8OA 4U6PA 5A8KB 1N54B 4NLXA 3KUEA 4X4QA 3IBCB 1HHVA 1WJ9A 4A3GG 3ULHA 4QU6A 1TS3A 2WACA 4A4IA 2C5CA 4UUXA 4G1IA 1TIID 1JLBB 3M9BA 1WEYA 1S1WA 4BBSB 5HN0A 3IRXB 3MMJA 1SNPA 2JWNA 4DV6L 1EQ0A 3U02A 3NBPA 4ITSA 4MKAA 1JE5A 3ER0A 5KOWA 4I2PA 3TZWA 3T53B 4OO1G 1IKYB 1AB8A 3LP0A 4RW6A 1G51A 1IBLQ 1QNKA 3BO2A 2KZMA 2EW9A 4DSJA 4RGTA 2K50A 4BBRH 1X4HA 2RRBA 1KQSR 2HHWA 3H2LA 1CFMA 4KHPQ 3HHLC 3BDPA 2N8NA 2G5DA 4PABA 1U1QA 3KLEB 2J5AA 3OFEA 5T41A 4A3KG 1UWVA 4A3GH 2MLXA 1I4XA 2R7RA 4DQRA 3HKZG 3QO9A 4KTAA 3OW2R 3O1LA 2MNAA 2A19A 4P2MA 1HTLD 4FNFA 2DNPA 2RQ4A 3TAMB 4A8SA 1JKHA 3WBZA 3E01A 2IWHA 2V4QA 5JPNC 3H2VE 4PG6A 2ADCA 4LF5J 3EJMA 4OO1H 2OTJS 3K7AB 4CBVA 2OO4A 3D66A 3MEDB 5H9FK 4DAVA 5G0RA 2N7CA 3KFUA 1RT5B 2R8GA 3D6FB 3KK1A 2LECA 3CMEA 1CQVA 1H9JA 2G2ZA 4KV8B 4H0LC 4DEZA 4LSLB 5J3BA 2XI2A 4D3HA 2JA7G 1YBAA 4GNXA 2B3GA 4A3KH 1BF4A 4GKKQ 1NE3A 2DBBA 4GLAC 1SN8A 2VV5A 5K14A 5KFUA 1HBOB 5IE8A 1I5OB 5JXSA 2VB2X 3CULA 3G71S 3C16B 3H09A 3OBIA 3A8IE 4UUWA 1QM9A 4RH6A 3RZOH 4D3GA 5C0XJ 3EVQA 4IR9A 1LWXA 3FNNA 5L37A 4LF4J 2R2UA 1QSSA 4IH5A 3S1MB 3W3SA 4WORA 1BUVT 3E9IA 4ZJOA 5CCMA 1S0MA 4M8LA 1VBYA 3KLWA 3QZ7A 2HGNA 2JA7H 1BHNA 9RUBA 2ZJPQ 4EU0A 5JUMA 3L9AX 2VBZA 4LRFA 3T1YQ 2B2YC 2F1FA 2QTWA 1E7ZA 1TAUA 4DCOB 1VDHA 2IYGA 4H44C 1JLGB 1IKWB 1WG1A 2QFIA 4MIWA 4N41A 1T0TV 2G9HD 1FNMA 3RZAA 1ZS6A 4Y65A 4DFAA 1GUTA 2LQ8A 4A8KA 2AJ2A 1H72C 3HOUH 4CLTA 2KRBA 2RE1A 2ZH3A 4DV3J 3NOGA 4CLZA 3ETOA 1LV9A 3J7A1 3H98A 5B0GA 4ZJQA 3W61A 1B7FA 1YTYA 3NGSA 4IFVB 4P52A 5M5WB 2W25A 3P96A 4N8OA 1BBWA 2ZFHA 4XK8C 5E3FA 3E0EA 3W9JA 3TRGA 1NDKA 3M6WA 1RADB 4B3RJ 2C9OA 3L2PA 1YDLA 3QRPA 3M8ZA 1DQAA 4PCQA 1FVQA 1PYSB 4J9VA 1KAAA 4RCOA 4Q2MA 3CO9A 2FMCA 4ID6A 3DEOA 4QB4A 5K8OA 5JPMC 2JSXA 2WB1B 1STNA 2EJFC 1U09A 1OSDA 3W2VB 2ZJRQ 1TS5A 3PXGa 1UEUA 2DNCA 3BSCA 4YN3B 4O4GA 4QL5A 2AQ2B 2LKZA 1I6HH 3AB9A 3GV3A 3EX7B 1DTTA 2PDAA 2EQSA 3EDRB 4KR0B 3MEKA 2PMHA 5E4XA 1CEZA 1VIOA 1MU2B 3VR5A 2BW2A 1KBRA 1NDLA 1FRIA 4JI2L 2DHXA 1GTEA 3M32B 4QR0A 5ETLA 1W6JA 3SR1A 3FFIA 4I6AA 3PX6A 3M4PA 2HNZB 5C5MA 2KJXA 3C14B 2QA2A 4QIWB 3MMBA 2YBVA 2MO0A 1STHA 1FNOA 4ME5A 3W7BA 4C3HG 4PG5A 1X7VA 5FLXU 5LJ3Y 3VAGA 3IWNC 2XMKA 5F0WA 1B2TA 2ALZA 1N6QB 3SI8A 1JCKB 1MSGA 1WD6A 1SL1A 2NZ4A 2QX0A 3OQ2A 1VBZA 1KNAA 3MM9B 1DURA 3HVWA 4GN5A 1HHSA 1HUMA 4CNYA 1PSDA 2UV8A 3TW0A 2IMWP 1Q3LA 4YIJA 3UD4P 3NQIA 1JWSD 2ZJQQ 4C3HH 3A13A 1LEOA 3LAKA 4C2MB 4PUOB 4WFYA 1ITPA 2YKPA 1YVCA 1VQ6S 1I94L 3LWMA 2QF7A 3HZXA 1FDDA 3A56A 2ZH4A 2G9DA 2X1GA 3QATA 5AT1B 1A3UA 4X4OA 1E6YA 2Z2ZA 1TWFH 1FYCA 1PVOA 4DPTA 1X60A 4EYIB 2AUJD 3S2HH 5HK4A 1QCBD 2P6TA 4XTTA 2UXCJ 1XR5A 2CQIA 1VQDA 1C1BA 1HHQA 4LF7L 1GOZA 1R3NA 1KABA 4AT1B 1SQGA 2QEXA 1EOVA 3GIKA 3NSWA 3OHXC 2F0TA 2VNUD 3A4TA 3NCQA 4WYWA 1FRJA 4GKJJ 1WJJA 4U96A 4I4BA 4A8FA 2V8VA 4RUHA 3DLHA 2K1BA 4DV2F 4WTOB 2ATWA 3A1YG 2OD4A 3IAS9 4B9WA 5EBDA 1PXUA 3MPDA 2UUAF 3AA9A 1BWEA 4PEOA 5EGTA 4IUQA 3ZZ0A 1P16A 2LQ9A 2EIFA 1S9FA 2X6GA 1K1SA 4CO3A 4OYPA 4MKBA 4CDEC 2A2DA 4F7VA 2E74C 4JV5F 1HHTP 2DH7A 2RCFA 3H0GB 1SJ4P 2MMYA 4KTQA 4R25A 2W2MP 4DPXA 1VQHA 5KT6A 2NPFA 1M90