4ZCKA

Crystal structure of c-terminal fragment of escherichia coli bipa/typa
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
299
Chain Sequence
GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GTP-binding protein TypA/BipA
publication title Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Gtp-binding protein
total genus 90
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 4zckA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zckA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 4zckA01
1FNMA 1ZM3A 1P9QC 4QR1A 1ZM4A 4M1KA 2I8EA 2XEXA 2KDOA 2J7KA 4ZCLA 1ZM2A 3UI3A 1KTVA 3CB4A 3B82A 2BV3A 2YWEA 3ZZ0A 4TNOA 4QR0A 4ES2A 5G4DA 2BM1A 1U2RA 4ZCKA 3B78A 2L9NA 2YWHA 1T95A 2BM0A 1VI7A 1N0UA 4ES3A 2WBMA 4ES1A 4QR2A 2I0XA 4MYUA 2IVYA 3OQ2A 2YWGA 1ZPWX 1ZM9A 3ZZTA 4ZCMA 1N0VC 3E3XA 3B8HA 3LH2S 4MYTA 2E1RA 2CVEA 3ZZUA 1WDTA 2ZITA 2YWFA 1DARA 4MAKA 1ELOA 2EFGA 4ZCIA 4FN5A 3EXCX 2NPFA 2DY1A
chains in the Genus database with same CATH superfamily
2RCNA 3MWYW 1EU4A 3C46A 2KXFA 1FJGJ 4ECWA 1EKSA 1X3GA 4LF7J 5C42B 3EJIA 1WOCA 4IPHA 4P73A 4FBUA 2NVTH 5FLXc 1U7LA 4ZVUB 5F8HA 4QJFA 2OQ0A 4K4UA 1U1QA 2F4VF 2QO3A 5EQ0A 1SE3A 4I2PB 1IKVB 2JA8H 3A8KE 1QB5D 3EYZA 3OTDA 1FFGB 4JI4F 2WBMA 4WXOA 4YHHL 2VOPA 5ISRA 5C3EB 1YJNS 1NTGA 3MEFA 4FZVA 2GVZA 2IM0A 4GN3B 4IO9A 4XO0A 4JYAJ 1NSPA 3BGLA 2UVRA 3G6JB 4A3MB 1O7IA 4DI6A 2E2HH 1SQFA 5KT6A 1L0WA 5KFBA 3QRRA 2ZH3A 3CJ2A 1H6KX 3NPPA 3HSGA 3DN9A 4DUYQ 4DR5F 4GLXA 3K6OA 5CV7A 1WKLA 1S5CD 5GAHC 4FYDA 1YWXA 3GFZA 2ADBA 1SNCA 3D1HA 1TWFH 1J5EL 1UZDA 3TP5A 2ASYA 3SHLA 2UXBQ 1FE4A 3I0SB 1T9XA 3KLFB 1X9NA 1KAAA 4J7CA 1ENFA 5M9OA 1WC4A 5ELEA 4GC7A 2Y0SB 3HO1A 1N6QA 2EXZA 1EWIA 4POFA 3MAQA 1B3QA 4UZBA 3R1HA 1TL7A 2CNNB 4IG0A 5IIFA 2GW8A 4XTTA 5HBMB 5D0GA 2B4OA 5C0XG 4J9UE 1JJ4A 2C42A 4IFDH 1RQ0A 2OQKA 1GT8A 3LX0A 1M90C 3S17B 1VK3A 4K14A 3US5A 1VF7A 4HKQA 5T1GA 5CCLA 3HHLA 4F3OA 4HACB 3Q8UA 1QE6A 3LGMA 3PKMA 2WB1D 3CCSS 2KCNA 5KFRA 3ZTRA 1IBMJ 4FBTA 2R7OA 4FKYA 3CRLC 1RHQB 3FZBA 2NTSA 1HFNA 2VD3A 4LQ9A 3H2UB 3NBPB 3AFPA 5A6WA 4Y2IA 3ICEA 2EK1A 2A19A 3C16B 1GNKA 1RU2A 2KHCA 4DV7J 4X64Q 5DLQE 2NZ4A 3H09A 4LRFA 2BJ1A 2AUJD 2YKNB 4LVOP 4R8UA 3CSKA 3NNCA 3PIPA 2QYGA 4GVLA 1TS4A 2F4VL 2Q3PA 4HEA9 2BE5D 3QIPA 1VBYA 4UW2A 3SZ2A 3WIVA 5IM0B 5M2PA 2HVEA 1OIAA 4JI4L 1RAEB 3KK1B 5DGAA 2A2CA 4HLBA 3E6ZX 2W4DA 1LV9A 3DMUA 2CVRA 1ACMB 3ZTSA 1ZM9A 4CKBA 2WRMA 3IS9A 2BQ3A 1UPPA 1SNOA 2XSCA 4NMZA 3DRSA 2DNLA 3I7FA 1TWHB 3TN2A 2A6EC 3VCDA 2RF4A 5BN4A 4DR5L 4DXGA 2BA9A 4WBFA 4AQYJ 2J4XA 1LT4D 4DV2Q 4JP8A 1HH2P 5D4OA 4KO0A 1N5YA 3KLSX 4L3KA 4ER8A 5KFNA 2HWIA 1X65A 3LP1B 3AOCA 2CZ4A 1YIJS 5BN5A 4PQUB 3BDLA 3JB9k 5KFKA 3KK7A 5IV4A 4C3IH 1ZZNA 1SRUA 4K2KA 2PYKA 1EY9A 4F02A 1U2CA 3BYRA 1L0XB 1BKBA 3OUYB 4KPYA 2R9LA 1WTVA 1PTOF 2LECA 4NCGB 2B3TB 1Y1VG 3DRXA 2E29A 3OT9A 4WU3A 3DHQA 2YNIB 2QZ8A 1LYLA 2N8NA 1DURA 4BBSG 2H3EB 3I5AA 1XXGA 1IL2A 3CT9A 1FWPA 1ET9A 4UOHA 3P49B 2FJVA 5G3LF 4ZCKA 4DBQA 5CR3A 1C0UB 2GGPB 4HR2A 1R89A 3F41A 5HK4A 1BXNA 4JI0F 2E1PA 3AHPA 1HZ9A 2AZ1A 2NZCA 2PNRC 1YK9A 2XS5A 1SYBA 1MD2D 3HVAA 1N32F 3IXQA 4YCUA 2LU2A 3ENWA 1RBOB 1RKNA 1M0SA 3PX0A 2BE2A 3DYAB 4DR6Q 3RZDB 3OXFA 3V81B 4ILLA 4MKVA 1VLOA 4C56C 4P72A 2U1AA 1EQTA 4A3KB 3HZEA 2WBRA 4OWTB 4BY7G 3Q23A 3WBZA 3NMAA 4PG6A 1N52B 1FESA 1TTHB 6AT1B 2R7WA 3GTQH 2QRRA 4WFN3 3DI6B 2E9ZA 1HBNA 5KGUA 1M5VC 1SYFA 5F2DA 2R92B 2DO4A 1UE1A 4A8XA 4IYQA 4PYDA 2K1RB 4QWEA 3DLKB 2DY8A 3MM9B 4DQQA 1AH9A 2I5LX 3MAHA 4MIUA 5E2QA 4ECZA 4O23A 1NK6A 4GKKQ 1ZA1B 4X62J 3NOGA 1A0OB 1LT6D 2A68D 2GIFA 4P2CB 4BBRB 3HOUG 5HVFA 2LCWA 4XK8C 4A4IA 2QW7A 4ANEA 4TY8A 5I3QA 3W7BA 4LR9A 5IYCH 3D31A 3C6TA 2HVZA 3W3AA 4I7FA 3UNYA 3TBIB 3I9ZA 4B3RQ 2GFFA 4DR3F 2ZDPA 1JJCB 1PH6A 1YJVA 3FFIB 1F60B 2OPRB 2L9WA 1X3EA 2P6TA 3CDAA 1R6YA 2PQEA 3D3CJ 4F26A 5A2QY 2L08A 4DG1A 3T1YF 2R3ZA 3I31A 3WX8A 5CBAE 1XPUA 4CM0A 2ERRA 3RRHA 4FXGC 1U47A 3IWLA 2HRTA 1LTLA 1KTVA 4Q5VA 4HIDA 1RWXB 4DNRB 1NPPA 2FD2A 5GADI 2CXEA 1F9RA 3G8QA 1FJGQ 2Z2YB 1IKXA 4LF7Q 1IQZA 2V2QA 1RTHB 1Q46A 2DR5A 4F8RA 4IOAA 3SEBA 1GEHA 2XSFA 1OS5A 3K7RA 3VGSA 3NS5A 2Q8TA 3N9UC 1HXYD 1YQHA 1CS4B 1NBWA 3MECB 2VQEF 2PI2E 4F3QA 4IJHA 3GIJA 1MJEA 2Z1CA 4ZCMA 5KT5A 1Q78A 4UAIA 4M63A 2RMLA 3MTJA 1JXEA 4JYAQ 3PW2A 1SJHD 3CMEA 3TI0A 1CFMA 4JI0L 4DV6F 3ENQA 1FFWB 1AFPA 4G4KA 2MPUA 1XWEA 2BR0A 1KC8T 3KMSA 1N32L 2UUBF 1AROP 2OXPA 4A3DG 5LHY1 3OL7A 1I5OB 2EVZA 1DLOA 3ND8A 5D0EA 1K1SA 2CG8A 1LWFA 4P52A 2ATWA 4RW6A 1BCPB 2G2ZA 4RUCA 5KOWA 1N4LA 1IZ6A 3EJMA 1BQQT 4IUNA 3B54A 4ILWA 4P75A 2NWGA 4FYXB 2QILA 4IUUA 4H4MB 1R9TB 3J7YI 5E3RA 4RCOA 4NEYA 1VQGA 1K8MA 4XQQA 2HK2A 1SVDA 4A4JA 2VC0A 2PW7A 3NK9A 2FIUA 1DM0B 4GKJF 1RT2B 2RF2B 2DKOB 2FLLA 2O67A 3G96A 3QAUA 3RUZA 3IBFB 3T13A 5EKIA 1YITS 3A8IA 4IJLA 4P74A 4DN9A 3LWEA 2U2FA 3PJWA 3TA2A 3CAMA 4IUFA 5HP1A 3MR6A 1UEUA 3FK4A 2AWZA 4ZRZA 4FPRA 1CKOA 5J2QA 5I6YA 2XVSA 2LXJA 1NMEB 1S1UA 3HKZD 4QPTA 4ZVQB 4OX7A 4C48A 3MR5A 3CD5A 4DSEA 3MEDB 4LUOA 3M2RA 4XT1B 2PNHA 2Q6BA 4YHHJ 5M3FH 2VV5A 4DR3L 4KY7A 3NWTA 2AT1B 3J7AF 4Y52H 1HR0W 1IBMQ 3NNHA 3GWCA 5LL6S 5HO4A 3HOWG 2TMPA 1WC0A 1EP4A 4NWBA 4B02A 4C11A 1NMFA 5A2QE 3T1YL 1KTQA 3CCES 3W2WA 2HBZB 4DDFA 3T51B 1S6QA 1YHBA 4PG7A 2MO1A 3A7LA 3T9ZA 3FNNA 4KGXB 5ITHA 2IC3B 4MZ9A 3AXKA 3S1TA 3OHAA 4IFDI 4C0OC 4HJ5A 1FKOA 1U2RA 2BRLA 2J76E 1WI6A 1WF1A 1VCTA 2LA4A 3BF4A 2Z58B 1AE2A 4A75A 1G2TA 4OJGA 5KT7A 4N76A 2HS4A 1WDTA 4KFBB 3SK5A 2IAJB 2VQEL 1JOOA 3GTJH 3TP7A 3W2VA 1J5OA 5D3GA 1RB0A 2EBGA 4RW7B 1T05A 3MFGA 1PTOD 2Q2IA 5EWEA 2DHXA 5IE8A 4A76A 3HVTA 5ETMA 3FP9A 2EFNA 1X5SA 4DV6L 5K8OA 1RCVD 1E3PA 2QLWA 2WVCA 5G3LD 2XY7A 4ZJLA 1RTIB 2K2PA 2B8GA 3TP8A 4N8NA 3CC2S 4AQYQ 2QEXS 5L1JA 3NUCA 2FMMA 1LQ9A 3SK8A 1S48A 2HHXA 1RT3A 4ALPA 3FUYA 5L39A 4LUBA 4YDDB 5L9XA 3UDIA 1S40A 2JA7G 5C2CA 2KHDA 4FKXA 1VQ4S 3CPWA 1GHJA 1B99A 1RT6B 1HTPA 4GKJL 4LF5F 3HD2A 1TK5A 4S3SA 1H9KA 4O4GA 4ZDNA 1RHPA 1S6PB 3M2UB 3RR7A 3AB4B 2IX3A 1S99A 1JMCA 1MROB 4WP3A 2B51A 1EZZB 3EXCX 1S0VA 5D0RA 3MXPA 1NKCA 4JVZA 1QE1A 5ELCA 1CJUA 5AXMA 3GTYX 1F5AA 4OJ1A 2WP8J 1Y1VB 2DTJA 3B8HA 2V6AA 4JI4J 3BO3A 3I4MH 1UEAB 1XBWA 4BBSB 2I38A 2XQCA 2KJXA 5HAOA 2OO4A 5C5MA 1Y5LB 5CYQA 2X6LA 4WPAA 3TS0A 3EXYA 4ZPCA 1JB3A 3LPYA 3D3BJ 1JLQB 1PH5A 5LXRA 3UDXA 4ZAIA 1HI8A 3PUZA 4OONA 2M52A 2VODA 2QJ3A 4DR5J 1EX8A 3MXNA 1B44D 1AP0A 4DL7A 3LTOA 3D9BA 4RU2A 2Y8WA 4ME5A 4BY7B 2HFUA 2YKMB 3TVZA 4KMUC 4DU7A 4YCVA 2UU9F 4IUVA 5BN3A 3HX9A 1QM9A 2RE1A 1A15A 2F8EX 3M8WA 2K4KA 1ZEQX 3M3YB 1N5QA 4X62Q 5AJ3F 4EQPA 1L3TA 4RKBA 4LSZB 1LKZA 1GUGA 4LFAF 3NGUA 1DTTB 4ED3A 2K5WA 1NHKL 1KKHA 3Q0AA 3KFWX 3DDKA 3DLEA 3BSAA 4QJVA 5F3ZA 4AFFA 3GTLH 4A3CG 1TL3A 1YNJD 2BBEA 3HOUB 2ZH6A 1Y9OA 4KKTA 4RNNA 3R7NB 4HCSA 4OZ1A 2XNAC 5FO9B 3GTPH 2FLOA 5JJKA 3K8VA 3FSIA 3E01B 1IBLF 4PAAA 3LO3A 1VFJA 1CSJA 1R0BG 1XN9A 3TJ8A 4AT1B 3V6DB 2F8HA 4V19X 1GM5A 2A6MA 2AWNA 3KK2B 2LVWA 2WVBA 3S1NH 4LF1A 5F8MA 4CDFC 2O66A 2CWXA 4F36A 3R7SB 5FLXE 3MCSA 3O44A 5A8WA 2ZH1A 3I72A 3IFTA 3HMJG 5IP9G 3LP0B 5BJRA 2ADCA 4OYWA 4U7UK 1RT4B 4NLWA 3NNAA 1RA7A 4F88A 2IY5B 2PSZA 4J9PA 4I68A 3MM7A 1LW0B 4NZ0A 2J6SA 1H38A 4K2JA 3FBCA 2IA0A 4TLRA 1N9WA 2PQAA 2DNEA 3M4PA 2JOQA 4WIIA 1SH3A 4JBWA 3ZZOA 4QZVB 3F8TA 3FBBA 1QOHA 4CTAA 4ZVRB 4RW4A 2EY6A 3QGGA 4A3IG 4DX6A 3GJTB 4EX5A 1HARA 4QR1A 3H15A 1B0VA 1PTOH 1S6OA 3EDQB 1XWLA 5LMNF 2UXCF 3TVKA 3E0JA 4U7UD 4A3DB 2DGOA 2H4WB 1LTGD 5CYUA 1HPZA 1IR2A 2K06A 1VQMA 3DRPB 1RAIB 1TMJA 3FRYA 5GAEU 2ZM6F 2PCFB 3KF6A 1UFLA 2RDGA 3S1RH 2GQCA 2XGTA 1IKWB 1G3OA 1PG5B 2ZH9A 1AZSB 2XMTA 1CEZA 2P2CB 2CJYB 4RHSA 4K2LA 2VPWB 3DOLB 4EZ6A 1LTTD 1ZYQA 2UU9L 2HCCA 1GH8A 2R7DA 3RRKA 2KCMA 2V2ZA 5FJ4A 3J7YW 1TIID 2EIFA 3NEKA 3CC7S 4B9XA 5AJ3L 3I96A 1J2VA 4GNXA 1HBMA 3TVYA 3CD6S 2JA8G 3O13A 4LFAL 1D9DA 2F0GA 1UTAA 2MEWA 5C42A 4ABNA 1VHFA 2ZTEA 4DPGA 2C1EB 4P7TA 1H98A 4YHHQ 2A10A 3NBHA 5AFWA 5A8KB 2BOAA 3EE3A 3PW7A 4JI0J 1WOSA 1NK5A 1IKVA 3IRXB 4RNHA 4FF2A 3M4OB 2NN6H 5C5JA 3HOYH 4CYUA 1IN0A 4UF4A 2X1BA 1IBLL 3RMHA 1N32J 2Z2ZA 1RP5A 3AT1B 1YBUA 3VA5A 3HOWB 4NL5A 2UP1A 2OUGA 1TWGH 2DIUA 3VHQA 1KOHA 3RBEA 4J15A 1FDAA 4BWMA 1X4AA 2JX2A 4NYPA 3PIOA 1T9VA 1J5EQ 3GPAA 2MZQA 4RBVA 1S9GB 2V4RA 4Q2LA 3M32B 2WIIB 1RWNB 3PIP3 1PKUA 4KRWA 5FO7B 5FLMH 2DNOA 3FDTA 2MZJA 2NUUG 2AX1A 3PYEA 2W7AA 4X3KA 4W98A 3S7RA 1SL2A 2MJ8A 1A3VA 3L4BC 2MZ1A 4OHXA 1NU4A 4MNOA 3KLFA 3VAMA 2HVHA 2EC2A 1ZYRC 2KFNA 4FYWB 4EO6A 3NCRA 3W8GA 4MK7A 4YMEA 4IFDG 1Z2ZA 3R5BA 3RAQA 3I56S 4DX8H 2KZMA 1R31A 5DAUA 2B9YA 3LP2B 3NY0A 5EKLA 3G8TA 3DRRA 2KT5A 3X3MA 5HBMA 1D6EC 3TX8A 3FGVA 3KXDA 5ETKA 3IO1A 3CULA 1NK8A 3BSCA 1SFOH 3D4JA 5LMUF 5LMNL 4KR0B 2UXCL 2O5IC 3F1ZA 1BCPC 4DAPA 2LEPA 2QF7A 3STBC 4PG8A 1PYWD 1HHTP 2ZM6L 2GHVC 1TR0A 3D0IE 3FC9A 2DHHA 5KFXA 4HACA 4HHJA 2WVDA 1FRMA 2W1BA 2EKNA 4M1UB 4C7QA 2L15A 2J6TA 2IWHA 1FWKA 1UPMB 2EG1A 1AFJA 1QSYA 1X4FA 3G86A 2JA7B 4MT1A 5E3QA 1H7WA 3DLLA 1WI8A 3QFHA 1NK0A 4PMBA 2N82B 2XN9C 4Y2MA 1MI2A 1TKTB 4IQZA 4DFJA 2EXDA 1F2YA 3KF8A 2Q1LA 3NBPA 4PMWA 2F4VQ 2AUKA 3CDUA 4MKBA 4F4YA 3MVVA 7FD1A 2VQEJ 3Q6SA 1ZAWA 3C16A 2D5DA 3M4YA 4JI4Q 2HURA 3RB4A 3RJMB 4RU9A 1Q81C 3UI3A 1RAJA 2KG0A 3ER0A 2MQHA 3AXMA 3E9IA 4PABA 3LW5C 4DV6J 4AE5A 4ECQA 3GMGA 3KLIA 1FX4A 3JQMA 2E2DC 4H54A 2R4FA 2UUBJ 4JCVE 4JBMA 5K14A 1XJWB 3BN7A 1JLAA 1YJUA 2HZAA 4DR5Q 2KCTA 3NTHA 5J22A 2DR7A 1YBAA 1SNPA 1RHUB 3ZTQA 5D77A 3HPOA 4Y7NH 1LNQA 5LXYA 5H9FK 1N36F 5IYBG 3MMCA 3OTEA 3J80Y 1HQ2A 3OVSA 3GO5A 2RRNA 4DV3L 5A0YB 1IKLA 1K3BC 3BV8A 2HHTA 2XY6A 1NSNS 2VG5A 4M94A 2Y8YA 4C3IG 4WJWA 4KGKA 2YWEA 5DDQC 1N33J 5L46A 3D0GE 1U25A 4ALZA 1WTQA 1U1KA 5F0UA 2BJ7A 2XCPA 1UWAA 4HDGA 3LP1A 5B0EA 5D3IB 4WCEQ 3M7NA 3NELA 4WJBA 1REGX 1K8OA 5M5YB 1FE0A 4TY9A 2JC1A 1GX6A 3OUYA 2OPSB 2IM1A 1YX2A 2F4IA 1KQSA 2D0OA 1IYJB 5K20B 3BDOA 4K59A 1EUJA 3U50C 3J81j 3H40A 3THTA 1ICWA 3WX4A 1ZM4A 2YNIA 3PO2H 2Y3YA 3N6LA 3KUGA 3R6GB 2BX6A 3TAPA 1WEZA 3JTNA 1C0UA 1U02A 2XI2A 2GGPA 3V2UC 1CJKB 5CV5A 4H4KC 3KFUA 2HVDA 3ZO7A 1EL0A 2NXJA 2EZVA 1EZ6A 1KNAA 4KYZA 4A8MP 3DYAA 3Q8DA 2LXFA 4MTPA 3BEGB 3V81A 4OHVA 1SB6A 1BBUA 4FP5D 5EPJA 1FVSA 4K5RA 5E4WC 1ZKOA 3UDCA 4OYZA 2N78A 1AFIA 3ND9A 1WG5A 2DK2A 3QT8A 4L63B 3SFGA 1Q1EA 1RJJA 2BM0A 1OSCA 4AYBG 5IOCA 3DI6A 1HI1A 5HVHA 1KQFB 3U58A 4ME3A 1Q8LA 3DLKA 3VR2A 2LQ8A 3FCVA 4JI8J 2QG9B 2GQ2A 2QLJB 4DF4A 1LXNA 2NVXH 1VQYA 3UDGA 4I0WA 4MIWA 3FJ2A 3UFCX 4TNOA 4YFUA 3DMJB 1UW9A 2Z0SA 3NXWA 1SDFA 4A3IB 4MAKA 4BS2A 2FHJD 3VGUA 4ECSA 1N36L 2JK8A 3I90A 2DXDA 5J3BA 5HLFB 3Q8RB 2A69C 3ULHA 1PBAA 4USVA 3FFIA 3OSNA 2OPRA 3R5JB 4UOFA 5GAHI 5JJLA 1FHTA 3JAMU 2OTLS 2G5DA 1FRKA 1KP6A 1QUQB 2J0XA 1YJWS 3SSQA 4LF5J 4X65F 4O44B 3U4VA 1N8RC 5KFGA 2JQOA 1G7CB 3PYFA 3D1OA 2I1RA 1Q4RA 1BLUA 4N41A 2DNKA 3F44A 2ZT9C 3PTWA 3RN5A 4IN3A 2FZGB 2L9NA 2Z4PA 1CZGA 1S9FA 4KJIA 2NVTB 1LEOA 3D54A 5JXSA 1NR2A 3QMQA 2UVWA 2PI4A 2BJ8A 2OT2A 4TQUS 1K0TA 2JA8B 3HGBA 2K3KA 1N48A 5KAKA 5E3CA 4F7XA 4JI0Q 5B0AA 3R7BB 3PF4A 1NB7A 1CS4A 3MECA 2UUCJ 1K73C 1OQ6A 2Z57B 4ZVHA 3W66A 4Z37A 1N32Q 2DCLA 2CAJA 4KJOA 3V96A 4NRUA 1S5DD 1S79A 3D4RA 2E2HB 5GAGU 4ZS6A 1P27B 1SSOA 2JSXA 5CZVA 4QYZK 3PXGa 2JJ4D 3N4WA 4K2XA 2WINB 2V68A 3JAMc 3ENVA 2ZOGA 2AEJA 2QA1A 3A12A 1DQ9A 1YIJA 1TWFB 2OSRA 4G1QA 2I8EA 1FXDA 5F41A 2UU9J 1DQAA 1ASZA 1GO3E 4Y3CA 3F2UA 2PZTA 2XWXA 3IN5A 2RBMA 3PO3G 4EZ9A 5RUBA 3WOFA 2DPJA 5AJ3J 4OQJA 4MJKA 3RRGA 2R8IA 2PMZD 1RT2A 2RF2A 4LFAJ 1TS5A 4ED0A 4DR2F 3BVZA 3PW5A 2FZCB 1VDZA 1IR1A 2MZSA 3EX7B 4CLLA 2EYJA 3AOAA 5M3FG 2K50A 2E75C 1WC5A 3C8YA 2ROPA 3HFZB 4DR3Q 4I6AA 3VQTA 4K5VA 1D8LA 4XPCA 4A3FH 2NUCA 1JQYD 4X4VA 3RYLA 4A3GH 1XNRJ 1AB8A 2O5DA 4ZPBA 1WKKA 1EJ7L 2L1BA 2XGPA 5CXTA 1IBLJ 3DLJA 4DCOB 2K33A 2MHNA 3T1YQ 3PW0A 1QAYA 4USHA 1VRQC 2MQ8A 4JBCA 2PI2A 4X4QA 2E1AA 1JWUD 3NEMA 1IBCB 2K5NA 2CQ2A 3BH7B 2E1CA 2DEIA 3K17A 4X65L 2B8FA 2F3VA 4R4IA 1IVZA 1PV4A 3UQSA 3GV6A 1TU0B 4UY8T 3ERQA 1RTZA 4TN2A 3DDNA 2B4VA 2VU5A 2E8GA 1K0RA 4YCWA 5KFEA 2VQEQ 2J0QD 2KUMA 2GO9A 2IC3A 1GD7A 1I4RA 5KNDA 4CJ1B 1J27A 1HYSB 2Q2TA 4DV6Q 3CJSA 1CT1D 4KFBA 5I3PA 2EFOA 4FVCA 2IAJA 4V19J 1Q86T 3OWFA 1W2IA 4K5SA 1K47A 5DQGA 2UUBQ 3KOJA 4RW7A 1DONA 4ZVGA 2LQJA 3GP7A 1F9FA 2Q8IB 1QVGR 5LMNJ 2UXCJ 1VGYA 4IFVB 3MUMP 1JOQA 5HQ8A 3NMRA 5HN0A 5KOXA 2HGMA 1RTIA 1KR4A 3PO4A 2VPXB 4A93H 5M2UA 4DU9A 1JICA 4O3NA 2QC3A 1CSPA 3BSOA 4P71A 3MEEA 2IRXA 2XMKA 1TFYA 3FHWA 1VQ5A 1GK8A 1WHYA 5DEHA 4C3IB 1HW8A 4H4KA 3R8YA 2W2QP 3RB0A 1W2BA 3R3TA 2KDOA 2ASDA 4I7AA 2MO0A 2KL8A 2DHSA 1RT6A 3GZ7A 2VKZG 3D4DA 1BHNA 4AD6A 2D9PA 2K5DA 2RU9A 1S6PA 4J5OA 2K05A 4DR2L 3M2UA 3RZAA 1KDCA 1X54A 2ZH5A 4IO1A 3I4MG 2WSCC 1CTMA 2ZXPA 1F2ZA 4DAYB 3AD9C 3U1NA 3UDLA 5DM7Q 1VQLS 2IM2A 2XC9A 1SCJB 2B6AB 1TELA 2XMMA 3OQ2A 2QA4S 3VAIA 3QR8A 1PH2A 4YY3F 2YKAA 3R93A 3TSSA 1YSJA 2YNHA 1URNA 5G0RB 3MCMA 1XPRA 2WOMB 4DK3C 1NNDA 2WB1E 4OEMB 1S12A 3POTB 4JBJA 1HNIB 1RT7B 3D1QA 1CQVA 4YIJA 1JLQA 1UEVA 4WXWA 5BR8F 1SN8A 2VBZA 3SK4A 1U6ZA 4J9VA 2XSJB 3BBFA 4L3NA 1ZAVA 1QCBD 3GTQB 1MN9A 4O0AA 1TK8A 2IDEA 4DFKA 1ONLA 3UE0A 4F87A 1YITA 2UXDL 2K52A 4OHZA 2NCKL 4MYUA 1U6BA 3OJSA 4TKOB 1VRTB 2A0FB 2YKMA 3KKFA 1GXLA 2B2YC 2IVMA 1PJ6A 3K81C 5AXNA 2BUNA 1M5OC 3GTOB 3FEZA 2GA7A 4IH7A 4URGA 4R8NA 4JI8Q 1SC3B 5E1FA 4BCAA 3IKJA 4F50A 3LANA 2YVSA 5LJ3Y 4LFBF 4WE1A 2MSSA 5D8HB 4LF9F 1WJJA 3L7OA 4ZVPB 3M4XA 3WZ0A 1CJTB 3GTKH 1TV6B 1DTTA 4O0IA 1S0OA 2CQ0A 2WONB 2GC8A 4IH6A 3T6JA 4G7OC 5LMUJ 3TJAA 3BYTB 2AYEA 4A8YA 3N28A 4M5LA 2RKSA 5E0OA 1KFSA 1C1BA 3CCEA 1TL5A 5FO8B 2RRAA 1CA6A 2DH9A 1SNMA 1E2ZA 4EK2A 1FERA 3E01A 4FNFA 2R2TA 1Y1WH 4QY7A 4LF5Q 4HVZA 3DU6A 2JA5H 2DGXA 1SKRA 2FJDB 2W8KA 4NZ7A 3I6PA 1OXUA 1QLNA 1KSPA 2LFVA 1D5ZC 1FNUA 3V4IB 3I73A 1U8WA 1HQEB 4OYMA 3D6MB 1F9PA 2CWKA 5C6AA 1GMWA 2JEAI 1EIGA 3LUYA 2XHCA 3J81L 1U4LA 1S7IA 2UUTA 4LRDA 3ZXWA 1F9SA 2XGQA 4G3IA 1TU2B 1D5MC 1RT4A 1PBUA 4I6WA 2C3OA 3HD1A 3CDBA 2RHSB 5DM6Q 2A6ED 3ICLA 2KENA 2RUSA 4FO2A 2WB4A 1JR0D 4YY3L 1LW0A 2ZHAA 2YWKA 3CCMS 5L9NA 5KG1A 3I0RB 1KBRA 2QX0A 2WTFA 2QEXA 2J8SA 3FCHA 1WTWA 4ELUA 1UE6A 2F0EA 3X3NA 4PZVA 2M2LA 1H9MA 2ABYA 4FXKC 1BQMB 2DNQA 3ONAB 2DO0A 2CJBA 1BUXA 3IM8A 1ZH5A 1YNXA 5BR8L 4OZLA 3EGZA 2BJDA 1ZBTA 2UU9Q 1Z47A 4K5WA 2K01A 1Y4ZB 3T5JA 1Y0HA 1IM6A 1EARA 3GONA 1FDBA 4RR5A 5JJZA 1IKWA 3I2ZA 2Q43A 1AZSA 4CO3A 1OO0B 1FD2A 1SYCA 4KTAA 5AJ3Q 3DOLA 2C2EA 3DEPA 1AW7A 1DHMA 4BXXH 2R7QA 4EWTA 4LFAQ 2NXEA 4LBHA 2R42A 2EE1A 5K36H 3PO3B 4BHQA 3CCUS 4C3MA 1F2MA 4LFBL 4IURA 3V5RA 2RKIB 4EEYA 3I5BA 2VBWA 4LF9L 1GMVA 1XNRQ 4IG0B 2NN6G 1Y11A 3ZZ0A 3HOYG 3CCRS 3DHXA 5M3FB 2MKHA 1IBLQ 3JQJA 1AN8A 2W2MP 1OPIA 5A6PA 3SQGA 1CA5A 3A7AB 1U4MA 1MWQA 3BYPA 4X2BA 3FMBA 1KVIA 3GLJA 1BOSA 1NH7A 5A8KA 3A1YG 1ZM3A 5DS7A 4UT4A 1RYSA 1JE5A 5J1ZA 2XNQA 2EVBA 3P3DA 3IRXA 4LR8A 1FK9B 2IJFA 2G9DA 2UVVA 2L12A 3KBXA 1HWIA 3SV3A 3I9V9 1T03B 3GV7B 3H4BA 5KFVA 2TSSA 3H0PA 2V8PA 2MGSA 3ETOA 2DNYA 5JEAH 1TK0A 4KD3A 2SXLA 4ZITA 3HVRA 1HNZL 1SR3A 3MM5B 2YQ1A 2FYXA 1NE3A 1S9GA 3OFFA 4LW1A 1STYA 3GTJB 1DD2A 3VDYA 1GXDC 3OMGA 1RDRA 4R8UB 2K75A 3MDFA 3THPA 3S14H 5KYIA 1BNZA 2GIQA 4OI6A 1O80A 5CAAA 3QIDA 3G6YA 1FWLA 1SROA 3GJQB 2VFTA 5LMNQ 4KE5A 2UXCQ 5CBEE 3HK2A 3VGVA 1VQOS 2ZVSA 2J9EA 1OXSC 2ZM6Q 2QFJA 3IRBA 4DV1F 4ZUJA 3HFVA 2ZH4A 5IQ6A 3BDCA 3D0FA 5CV9A 2YX4A 3IS9B 3CPWR 2G9OA 3HVWA 2QMUB 4WFZA 2APOA 3RAXA 1U49A 4K6DA 3D6CA 3GR1A 5J1EB 1N5YB 3HHEA 1FD7D 4X65J 4C8OA 1KVKA 1UUPA 2HRYA 5KFYA 5L38A 4AXIA 3SCJE 4GN5A 2C3YA 2C2ZB 1X0FA 2JFKA 3Q2SC 2DBBA 4K8IA 1KLGD 2LQ9A 1TKTA 1P9YA 3GSDA 4CH7A 2H5JB 4HJ8A 4XQJA 2DISA 3C14B 4HH0A 2OEMA 2AF6A 4C8MA 3NBIA 1TKZB 4OIXA 1YBYA 2BANB 5C2GA 3VZIA 3OW7A 3I4MB 2LXIA 3HKZE 2CW0D 2ZBPA 1RXOB 1TWAH 3AD8C 4CO4A 1ENAA 2V8GA 1OWXA 3GTMH 5D0HA 3W65A 3BKFA 5IT9L 2HQCA 1P8LA 1S77D 2E9RX 3A0JA 2V2VA 1VMBA 2FVSA 4R25A 2BRKA 4J90A 1NNXA 1PH8A 1VBXA 1KD1T 1KAWA 4O2DA 1EB0A 4DA2A 1TVXA 2AJ1A 1WUUA 1Q95G 5KG0A 1VBKA 3S16H 4L6TB 1M5SA 2DH7A 3BR9A 5DDRC 3FCWA 3T1HF 3CF5Q 1UWBB 4NLPA 4RA8A 5FIIA 2KHJA 2R93H 2KT3A 2MTLA 2SDFA 2V9WA 2VNUD 4TRDA 3CC7A 2GMHA 5KT2A 1LWEB 3NXZA 2HNZA 2R7ZG 2KN4A 3AD7C 3CD6A 4A3BH 1MN7A 4C4WA 1XERA 4BA2I 4JBKA 3VYSA 2N7YA 4KKSA 2IBOA 1X7VA 1HI0P 4RWSC 4LF8F 3ONQA 4I65A 4LIRA 1YVFA 1UWVA 2MLYA 1KVJA 3GTLB 3PO2G 5CZXA 4F0MA 2C2KB 3KBGA 3KHLA 1V3SA 5LMUQ 2P9EA 2F0JA 2OPSA 4IOBA 1YTYA 4FF1A 2NBFA 3HS0C 1RUSA 1J8IA 2V34A 1NB2A 3GCWP 1LW2B 3A56A 2ZOFA 4ERDA 2I6WA 1HIYA 4NOHA 3GYNA 4DV1L 4I7FB 5F8NA 1N34F 4WP9A 5U47A 2RT3A 3UW1A 1IBKF 4J1MA 1CVJA 2XMAA 1EY4A 2MLZA 1FNXH 2KJVA 1N0UA 3M30B 2AX0A 1CJKA 4DG1B 4NI2A 4ICLB 1WACA 1XMQF 3UCGA 1SKSA 2XG8A 3P8BB 4IKAA 3QOJA 3MPWA 3NQIA 2OMLA 3CJ0A 1SJRA 3NAIA 3PKYA 5ADZA 1SAPA 4DL0C 2ZUAA 3TQEA 1Q82T 3OW2R 2Z4IA 2VFSA 5HI7A 3HJFA 3ZFVA 4G1IA 2QMWA 5EDWA 5CCMA 2HQEA 2L3MA 2PE8A 2ASBA 2E2JH 1WVLA 1V1PB 4YB7A 3TEGA 4YB6A 2EJMA 2AHOB 2C2DA 3I56A 3W1YC 2F7VA 4M8AA 2IHEA 1KHIA 1SKWA 2XMVA 4O3QA 3EIVA 5M5XH 4KY6A 1QUVA 3JSMB 3OFGA 3DWPA 3OIPA 2C5CA 1VOMA 1VQPS 1X0PA 4ULLA 3S24A 4IRDA 3GTGH 3KK3A 1AUDA 2GJ2A 3JAME 2EDGA 4ZKBB 2OEJA 1PTOB 1S5ZA 1VIXA 3MPUB 3OR2A 2FHOB 1PYBA 1HUNA 1RAOA 3DMJA 3S1RB 1HNXF 3UDVA 1R8BA 1KQKA 2Y0SD 2P8IA 2KBNA 1WCMH 3T1HL 4J6HA 3S15H 3CC4S 3GJSB 4LF6F 4B3OA 5HLFA 1SH2A 4HSVA 1E0BA 3H2VE 1EYDA 4ZIVA 1G2EA 1FGBD 2F0TA 4L5RC 5GVQA 4O44A 2ZD1B 1EQQA 3W5ZA 5AE1A 4LF8L 5HMYA 2JLFA 1BCPF 2YH0A 3CJ5A 2JLGA 3WIUA 1A62A 1GUSA 2QLXA 2PMWA 3MC0B 2DD8S 3V6JA 2X1AA 5KFTA 5J2QB 3NKYA 3QT7A 1ET6A 3HFKA 3QLHB 1KONA 3KDFB 3HOYB 4YY3J 4ZPWR 3M2RB 4ZLLA 2PC6A 1C8CA 1T9YA 2HNYB 3UWTA 2HUGA 1N34L 3HLUA 5FKAC 3M9OB 4F4AA 4B9LA 1IBKL 4NDXA 2EPBA 4OZ5A 4HT7A 4MKYA 2EFGA 4Q7AA 2VA3A 3SDZA 1E6VB 1MWYA 2GVBA 4CO2A 4R4CA 4C11B 1E22A 1XMQL 5BR8J 2D3UA 1CULA 1VK8A 3NCPA 4N9PA 2CPEA 1SNQA 3ILOA 2WAQD 3SCKE 4WORA 1FVIA 4ED5A 3IL8A 1F2HA 5LJ5Y 4NLDA 3MR7A 1Y5IB 4B9VA 4X4TA 1NAPA 4DUYJ 4MK9A 1FKOB 1S72A 2FHTA 3Q89A 1K9MT 3M2VA 1HWLA 5HQMA 5ETVA 4OV6A 4I4BA 1SV5B 3HKSA 1STAA 5D3GB 1J5OB 3EUNA 4TYBA 4LFBJ 3EQLC 4WF9Q 1JWWA 2IJ0A 4A3FG 3O1LA 2UXBJ 1T05B 4A3GG 2IYGA 3QJLA 5K8MA 2CQHA 4USMA 2Z2LA 1BR9A 3VVUA 1SH0A 2LQ5A 3K2YA 4DSIA 1DZ5A 4CLYA 4DXFA 2P6SA 3N5FA 4FXVA 3NTKA 5CA5A 3QATA 4K5XA 1YRXA 1HNXL 3E51A 1IQTA 3CCVS 4ES2A 4PZ6A 5J2PA 3ZNUA 4LF6L 4X65Q 1GXTA 1H72C 2OKQA 3QWNA 3PO5A 4NMXA 2FXQA 2JNJA 4PEOA 5K8PA 1A3UA 4RO0A 3BJYA 4CGYB 4NA2A 1EHWA 2ZWOA 1RD9D 4K4TA 2CNOB 4C0BA 3ELHA 2DR6A 1M1KC 2JVOA 2Q2UA 3FKIH 2XB2D 2L5TA 2NXNA 3TA1A 1UEKA 4DF8A 5C3WA 1I51B 4KB7A 2IHFA 5G4DA 4XT3B 4GO5X 3TAMA 3B4MA 2HMIB 2E66A 1HYSA 1ILQA 4QU6A 5C3EH 2H4OA 3JXOA 1WWHA 5GMDA 3PEJA 3HULA 5LL6d 1HUMA 3AQPA 4IUQA 2ROEA 4A3MH 1B9NA 5GAEC 3D0HE 1JORA 2KT2A 5CD4H 3T5HA 2ZJQQ 2EJFC 3S2DH 1YDLA 4Y7NB 5EX0A 4A93G 1JXLA 2B8QA 2RU3A 2F5GA 4NXNF 3HI9A 2I5JA 4L5SA 2F0SA 5IT0A 1F2GA 2Z4HA 4IFVA 3TX0A 5TSSA 2HHHF 1I6VC 2V4DA 1KRTA 1FX2A 4DV5F 2NQPA 2V9KA 5KG5A 3D67A 2F0WA 2VJVA 4E6IA 2PO4A 2ZNYA 1MGSA 1SYEA 1NUEA 1TWCB 3CCWA 2X6GA 1SLJA 4NEZA 3ZZRA 3FQKA 2R7SA 2I0QA 5A35A 3H3VH 4ETZA 4GMKA 1CBKA 2R7ZB 1NK7A 2BDPA 1I6JA 3UR3C 4ZCLA 5HANA 5E41A 2PA8D 1RIPA 2BA1A 3PYGA 1I50H 2BM1A 3GIKA 1GUWA 4KKOA 1RTJB 4WZQA 1TP7A 2V4QA 1S0NA 4HT5A 2E1RA 2GO8A 2HHQA 1D9AA 2QE5A 2OLWA 3DLEB 3JAMi 3PO2B 2LS01 2HIYA 4DAYA 2M88A 2A68C 3HHKA 4M95A 4F67A 3N52A 1G6PA 4ZK9B 1VQEA 1T02A 1IUJA 2AP6A 3L9AX 2B6AA 4QGUA 2QFIA 5I9PA 5C4JH 5HVGA 2FUG9 2YKPA 3J81U 4QWDA 3I8ZA 3PUXA 1TS3A 3BN4A 5G0RA 3G6ES 1S1WB 2ZUGA 2WOMA 1Z2LA 5L1IA 2P9GA 3CTRA 1KRPA 4KY5A 2PZUA 3RLFA 3EM1A 4JW0A 3POTA 2EBEA 4W90B 4DR1F 1RAAB 2LEBA 3DOMA 2HHPA 3VZHA 2HDMA 4FDFA 5BYRA 3TRGA 1RT7A 1EQMA 4PZ8A 3PGZA 4F7VA 2XSJA 3MCOA 2VICA 2D69A 4C98A 3QFWA 4MFBA 1XTCD 3QGPA 1KD1C 4JI5F 2B9XA 2RUGA 1BBWA 4M5HA 3PV8A 1JKHA 3VAHA 1NJIT 2VW9A 2CPZA 3IG1A 4Y2KA 4FF3A 1CJVA 1T5EA 1PFBA 2EEYA 3GG0A 4B3SF 3A8JE 4PNYA 1WC1A 2NVXB 2PIIA 5A2QL 3RZOH 1B70B 4ZLJA 3Q86A 3HEJA 2W9BB 2PQAB 2ZJPQ 3ADAC 4KHPF 1JNZB 4CTAB 2LEAA 5FLXU 2FJEB 1HPCA 2FGOA 2LSSA 1CJTA 3M6VA 4DV1J 3J81c 4JI1F 2DGVA 2ZFHA 1O8BA 3U1LA 4NXNL 4DQIA 3P20A 2BE9B 1Y1WG 3P4UB 1SXTA 2K6AA 2YBVA 3H20A 5DO2A 2HHHL 2GHWA 5L37A 4DV5L 1LWCA 3OYYA 1T7PA 4FS2A 3KF6B 3HZGA 2OAUA 3O2IA 3K57A 2OP5A 1OPZA 4ZN1A 3C15B 1UL3A 4OO1I 3BSNA 2A2DA 1IR0A 3M7VA 3M8SA 1YLXA 2HFNA 2VQFF 1Q8IA 2MKSA 2WHOA 1HQEA 2H51B 4IPCA 1YEZA 1N5SA 2A6OA 2IRYA 4GNXB 2DIVA 4I67A 1TS2A 1MLAA 3I82A 4EBCA 2VDIA 4HJ9A 1ZTTA 1N88A 3GSIA 5GROA 2ZDOA 1H3DA 4YY3Q 5KFDA 4EQOA 2J0TD 3J7ZT 2C3UA 2BEFA 4KJNA 3R5AA 3NBHB 4IR1A 1GAOA 1KHWA 1FFSB 4CYUB 2CA9A 3TP6A 1KDBA 3I0RA 3HOZH 5BR8Q 1NPKA 3IM9A 2OSQA 1SIWB 1UNSA 2G1HA 5CV4A 1NEEA 5I2XA 4J8QA 2KFZA 4DR1L 4M8LA 2KHSA 1BQMA 5KG3A 2QLFB 2DT9A 1R4QB 5C4HA 1HQRD 4BXXG 2FJ2A 2J0WA 1SJ1A 2K7KA 2VXWA 4H4OB 3GV3A 5K36G 3G71S 3CMQA 1LWXA 3GV8B 4C2MH 4DAMA 4JI5L 2HYIB 2YX1A 3CCQA 5B08A 3TQ1A 3U7JA 2W01A 4LFBQ 2KOLA 1RWUA 1RABB 5CYJA 4LF9Q 3NS7B 2FJBB 1HR0F 4B3SL 2FVCA 1UA1A 4RNOA 4UP7A 1HW9A 2P9CA 3P75A 4B9UA 2QA4A 1X56A 1L1OB 1GUNA 1X4HA 2XYPB 1Q16B 4KHPL 4A3FB 2POKA 4ZN3A 4A3GB 2E9TA 1B3AA 4PXBA 2RKIA 2HIVA 9ATCB 1MW7A 4DJBA 1PTOC 4C8YA 5KT3A 2CQGA 4QR0A 4JI1L 3DRRB 1OJ4A 4DFPA 4LT6A 4PZ7A 2FFKB 4N56A 1B4SA 1IBKJ 3O5TB 1R27B 1UP1A 4RW9B 2Q2HA 3NL0A 3E9HA 3VAKA 1JLCB 1VQ7A 3D8GA 4ZVSB 3CHBD 1WTXA 3S6EA 3ET6B 1KNEA 4C8NA 1FI4A 2DR9A 5JEAG 1XMQJ 4A3EH 3QZ8A 2SOBA 1RAGB 3H0GG 1FK9A 5CQGA 2ZBRA 3F56A 2D2CC 1VDHA 2E74C 4Y28C 4CLUA 2VQFL 1JXVA 3QYYA 1JLGB 1TAUA 1T03A 2YTXA 8AT1B 4HIOA 1AT1B 2QTWA 2VUGA 5IT9U 4DV0F 1U0HB 4RUHA 3MM5A 1V1QA 1QD1A 3KF8B 4A3LH 1PYSB 2Z2MA 1VIOA 5A8RA 1T5XD 2RD5C 3J7Z5 2VFUA 1Q0NA 1GX5A 4UUXA 2CQ1A 2PD1A 1I4GA 5AXKA 4XYOA 3FMCA 2A1AA 5F8GA 4RUBA 5KFCA 2O01C 3KLIB 1ESFA 2ZOMA 4JI6F 3KHHA 4LFCJ 4C6AA 5K14B 1U0LA 1JLAB 2RQCA 1EEID 1V5IB 4HDHA 2Z6BA 4A93B 1XR5A 1DCZA 4HIKA 2DB1A 1W2BR 1R9TH 4LF6J 3MMCB 2QDLA 3M6UA 2BYCA 2JEJA 1BMQB 1SJED 2VG5B 5K9FA 2CKWA 3S8SA 5IT9c 3PIOQ 3HT0A 1VQ8A 5J1EA 1QVGA 3EPIA 2ILZA 2LXKA 3IFDA 2QA2A 5SUHA 3S2HH 1HR0L 4X4UA 2PMZE 1SMXA 4DFAA 4DN4M 2GAHC 4DZDA 3CJ8A 1UJ4A 2DNNA 3EWGA 1KLMB 2L4NA 4NX9A 1R3NA 4A8QA 2R8JA 3H5SA 1O51A 2F3WA 3CCMA 2YWHA 3MI7X 5M2RA 1VQJA 3C14A 5GAGC 5C0XH 3K8AA 4S0MA 4ZLPA 3KHGA 1TKZA 3ULLA 5KFAA 3UE1A 2BANA 3BQ1A 2LKZA 1X4CA 1EYAA 5F8JA 1YJ9A 3IAYA 3R27A 4WFXA 1YNJC 4HCEA 3LAMA 4PQXA 1VQIA 1IXRA 1EETB 2OCEA 1S9EB 2MYFA 2JSOA 1UEBA 2UV8A 5HURA 3TARA 3MUTP 2Y1LB 3ITHA 2ZC4A 1EY5A 3IAS9 2R93G 3MEGB 2KRBA 1IXKA 4JOUA 2KFYA 1WG1A 4DCJB 3QJJA 4F04B 5C0XJ 4XTCS 3H42A 4EYIB 4A3BG 4CBVA 2KEDA 2H1EA 1HNVB 3TS2A 4TU8A 4DV0L 3EA6A 1X8DA 1YRUA 1UWBA 2XTIA 4JV2A 2G2YA 1KN6A 3VR3A 2Y1JA 3L2PA 5IC6B 1TL4A 1TY0A 4Z2XA 1R0CB 3O8WA 3NWRA 4RW8A 5M5WH 1LWEA 4X66J 1PRTF 2DGUA 4EYHB 4JB8B 1HFEL 4XXEA 1X60A 3CCRA 4UQTA 2HHUA 2IX0A 4GKKF 3NCQA 5B0GA 1DGSA 1WTPA 2A18A 3GTKB 1K44A 4XIUA 3NGDA 3P45B 3DM3A 3CMES 2PMZB 4DV1Q 4JI6L 3TAQA 1E6YB 4AH6A 1GOZA 3CB4A 2OPQB 3NE5B 1HQUB 1K8GA 3ZNJ1 3KLEB 5LOQA 3RLOA 2W2OP 3PNIA 3C2PA 1PMRA 1S5BD 4QWAA 2KU7A 1LW2A 3UD3P 4UP8A 1YGYA 3U9OA 4DR4F 3P7JA 4UP9A 1Y1WB 4DX7A 2FHKA 1VCIA 3D2WA 1NKEA 4DL2A 3W1BA 1S1VB 3IWXA 2I07B 3QPIA 1I4QA 3M30A 1FKAF 2RQMA 3TZWA 1KRSA 2OD4A 4IOCQ 1VJQA 3FPPA 5IYDG 4ICLA 1UVKA 2JYOA 1WC6A 3BQ0A 5KFIA 4L5TA 4LF7F 4CLFA 2CH4A 3D6WA 3NENA 4ID8A 4WK3A 4OV1A 5E5NA 2WCXA 3M6XA 4OO1G 2B4PA 5DG9A 1ZTWA 3QGIA 2HQIA 4AUKA 1Y1VH 1X3PA 2MHEA 1RCXB 1UMJA 4DL5A 4BC7A 3IC1A 3EN2A 3Q22A 1SC6A 4ZOSA 1S7HA 1V1PA 3EBEA 4IQXA 1JJ2R 2M3DA 1VQOA 4Y34A 5T41A 1IJEB 3R5DA 4R1JA 3GD7A 2ZBCA 2VZAA 1OQ3A 3JSMA 2B7CB 1YJ7A 1FKPA 3F2CA 1FO1A 4NLVA 1WCMG 4NXNJ 1NJIC 2XMUA 3T1HQ 4RWXA 2HHHJ 4L5QA 4NXMF 2KECA 4DV5J 3NTIA 1HQMC 3Q24A 1F5CA 1EIYB 3BGRB 2XHWA 2DGSA 4CP5A 5KFFA 1SC1B 3VVTA 1EIFA 4G1QB 2IM3A 3MA2B 1Q8BA 1ZZFA 3IAM9 2PGCA 4DUZF 2BDOA 4F25A 2JE6I 4QW9A 2CNKB 3QGHA 1CI3M 4RL1A 3M3YH 3TZXA 3EZUA 3CP0A 2PMHA 3SYZA 4FNHA 4LREA 2OH2A 3VR1A 5I4DA 3FDSA 3BO2A 2LQBA 3GFHA 2Q79A 2ES2A 2AYBA 2F0DA 3RNUA 2ZD1A 1FNMA 4GKKL 4BDPA 1B7FA 1B53A 3GP9A 2GVAA 4BC9A 4CM2A 3HP3A 1NSKL 3CUNA 3CD7A 5IGGA 3TUJC 1S4FA 2JRSA 1N34Q 1JLFA 4PR6A 2HZVA 3V2TA 1J9OA 1IBKQ 5B0FA 3CCZA 2MKYA 4C1NI 4MMOA 1JIHA 3QLHA 4XDCA 4IFYA 1MU2B 3KDFA 2W7OA 4L74A 4DR4L 3BKUA 1XMQQ 3IBWA 4O3SA 2HNYA 3M9MB 2HQFA 3KLRA 5LSLA 1FDNA 4DFMA 2VKRA 1C7YA 3T56B 4LRAA 4B9NA 4DR1J 3W64A 5B0BA 3SXLA 1E6VA 2GVDB 3J7ZC 1MKHA 3H0GB 2V2KA 2BV3A 2VB6A 1RK8A 3H7HB 1FT8A 2G0JA 2DY7A 4LF7L 3O3LA 1H73A 4DV7F 2VDHA 3OPOA 2R6GA 4GNXC 2A73B 1XMBA 3I4OA 2FY1A 1WHVA 3K5OA 4ZUIA 3R2DJ 3CJ4A 5KNBA 1J5EJ 5ETSA 1JQGA 2J9DE 3UD5A 4PWDB 4RPFA 4DPUA 4CKEA 4B3SJ 2FC8A 4ES1A 1ZAXA 4R4TA 2K28A 3ZYYX 2L55A 5HROB 1UFKA 1SV5A 3EVOA 1CHQD 3V6HA 5H9EK 4KHPJ 4LFCQ 3K0XA 4KH1B 4OI0A 3PEHA 2HHVA 4U68A 4JUZA 5KFSA 1FJEB 3PJ9A 4YS2A 2Q66A 2R2UA 1IJFB 3HZXA 3OFEA 1Z1ZA 3M85A 4LF6Q 4AQYF 1PVOA 2C2RA 4NXML 1K28A 4JI3F 3R9LA 3HSZA 3VTIA 2Z56B 3K7AH 3GU0A 5F8IA 1Y69U 3EROA 1JCKB 3MEEB 5LT5A 1M90T 1G6BA 4DUZL 2VQFJ 2V67A 1YHAA 3FKIG 3JYTB 4RLEA 4F4XA 5KFOA 1T9WA 3PJXA 1M5KC 3SBMA 3CMAS 1RHKB 2LYVA 1AUSL 1XR6A 1XTZA 1X6OA 5IGDA 1CKMA 3WHIA 4EI2A 1ZETA 5FLXY 1HMVB 1RHJB 1L1OC 1NZAA 4J9NA 3E3XA 1X9WA 3GV5B 1ZPVA 1OY9A 1TWAB 2X1FA 1VQPA 4ZCIA 1PRTD 2K32A 1YZ7A 3J7AV 4PXEA 3MHBA 3J80L 1VJWA 2ZJRQ 4R4OA 2F4VJ 1UE7A 4MHEA 5JPNC 2L41A 1UA0A 2KA7A 1RZMA 4YOEA 2VJUA 2Z8LA 2HMIA 2RA4A 3PZPA 2YNHB 3WC2A 2MUYA 4R0JA 1RT5A 1L0YB 2RQXA 3PMFA 1XX8A 3MM6A 4ZJQA 4ZVEA 5LM7E 2W7PA 2EYHA 3OOCA 5KEEA 5IODA 1BO0A 1MBYA 3TEHB 3A4TA 2R93B 1I6HB 2CVIA 3GYGA 2R61A 5GMEA 1RWMB 1R7IA 4N77A 3UN3A 1XC9A 4F2SA 4OMFG 1VMCA 4DV7L 2CQIA 5EGYA 4A3BB 1P16A 1C4AA 2B2WC 3B82A 4W4MA 2EPIA 2QYCA 5FDLB 1CLFA 4X66Q 1JK9B 3IRWP 3A74A 3C3LA 1A7GE 5KFWA 4Z7CA 2FC9A 2VB3X 4XQNA 1U2FA 1HR0J 4X62F 5IC4B 3PHEA 4M5MA 4UHVA 2KVMA 1LT3D 1DJ0A 2LMCB 1QUPA 2GJIA 3J81E 2NPIA 4WE1B 3UO0A 3TWZA 4CLTA 2RS8A 2ACMA 1RTJA 1U24A 4OI4A 1WSVA 2ICIA 3I87A 2HWTA 2MP1A 2EG2A 1FR3A 2L0CA 5CV6A 3RW6A 4O3RA 4AQYL 1F9HA 4ENOA 4JI3L 3EICA 3PVXA 1C1BB 1K83H 5ELBA 1NUCA 4IQMA 1VQMS 2HGLA 4MTKA 2RHQB 4QIVA 2O2LD 3IWNC 3CJ3A 1QVCA 4QYRA 4PPDA 5EKKA 4C1NK 1FNWA 3I55S 2ZVIA 1S1WA 4RKUC 3PR5B 5F9LA 1ENCA 4PCQA 1RDPD 2EYOA 3I4PA 2YV5A 1U5KA 1SNDA 1WI5A 5IT4A 3EZ5A 2KXHA 4LUVA 2ALYB 4OYBA 4DV0J 1LO5D 2NR0A 5DLGA 1RHRB 4DXLA 2IMOA 1VQHA 2WAQG 2IX1A 3AEVA 4EBEA 1V8QA 4NA3A 3G4SA 4KT0C 1HZBA 2RJZA 3MURP 2O3DA 2BA0A 2RVJA 4F4ZA 4HN7A 2KXNB 1EY0A 4RMFA 3DKDA 1NDPA 5M5XB 5T14A 3HT3A 1OYEA 2IVYA 3AJDA 5J39A 2OFHX 2KZZA 4PV1C 3GTGB 3KWMA 5FK9C 3T6BA 4ZKAA 3OW2A 3CVKA 4JI6J 1STGA 1PXUA 3I4HX 3MUVP 2ZXOA 4KHZA 5KIXA 2F0UA 4NXNQ 1RWKB 2W9BA 5KFLA 3CCVA 1C1CB 1R8CA 2ZZNA 2HHHQ 4K50A 4DV5Q 1WHWA 4GOPC 3A55A 4IRKA 1WCMB 2F3JA 2O5JC 1QSSA 4FN5A 3M4QA 2Z0GA 4Q2MA 3TUPA 4KN7C 1YG0A 2IPKD 1RBLA 3SVMA 5A76A 4G57A 5GMKa 4WYWA 2M9VA 4FXWA 3KUPA 4K0KF 2JEFA 1A6XA 2NZ1D 2ILYA 5FD1A 2B63H 3A3NB 4OZ2A 3LGJA 3C15A 1ZOTA 3BM7A 2OTJS 1C9OA 3NG8A 4XDXA 3O6QA 1DZ1A 1H0HB 3CCLA 5ELNA 4X62L 2VBXA 4A47A 2FLPA 3C19A 4ZLNA 3DWAA 3N6MA 1KXLA 2AEMA 2F9JA 3OMCA 4NLRA 4OYXA 3RW7A 4AL6A 4A3CH 2XO7A 1RJTA 4MK8A 4IUTA 3HOZG 1RCOB 3SQGB 2GA4B 1I94F 1S3OA 1M4VA 1S6UA 1WTFA 2M9KA 4DNIA 2ZZTA 4DR1Q 4DU8A 8RUCA 1A63A 1ICEB 2D1CA 5HQLA 2BQUA 4DGZA 5H9EJ 4QMGA 3A8JA 3MWBA 3Q8SB 3GYXB 3VR4A 1EY6A 3W1GA 4OLOA 3ILLA 1RYRA 2JZ5A 1NPRA 2QKIC 2XULA 3KLHA 4ZP6A 3OLAA 4O3OA 4LIWA 4OL8A 2L9HA 3UCUP 2BDNA 3CGIA 3I4NH 4RGNA 2F0IA 2IT1A 2A3JA 2DY1A 1U9RA 1U4RA 2AD9A 2EY1A 3PDNA 1B3TA 5BYQA 3OR1B 2Y0BB 4DV3F 2XMWA 2YH1A 1M8AA 4CNZA 3F2DA 4C97A 3QO2A 4B3SQ 4H4OA 1JWMD 1XPOA 2DJFC 2IFXA 2OHDA 3H2LA 1KC8C 2AQ2B 2MQPA 1H9JA 4MN3A 1SMYC 1WDDA 4KHPQ 1EFID 4RAUC 5JVH3 2VIHA 5C25A 4CJ2C 1QWYA 1QJHA 1E24A 3K0YA 3QSIA 3H91A 4Y0FA 2MJNA 1RF2D 4OZJA 3H98A 3ZTOA 4NRTA 4JI1Q 4POGA 4D3GA 5BYSA 1AEXA 4QUCA 4CLZA 1STNA 5GAEI 4DWIA 1L1OA 4ZA1A 1Q5YA 2MQQA 2XLIA 2W24A 2NPFA 4ZPAA 1TFWA 3G6EA 3FEWX 1V6HA 4A3EG 4DR4J 4HJ7A 2MZRA 4TVAB 3C6UB 3VAJA 2V63A 2F0HA 3NSWA 5IT9E 2BVZA 4DR3J 3MXHP 3GFXA 5HGTA 2Y0SE 4ZPTR 1AYEA 4RW9A 3PSIA 1DYQA 1RKJA 1JLCA 3S9WA 2HD3A 2VQFQ 4C3JH 4K0KL 3ET6A 4PWWA 1S1TB 3T1YJ 2CWAA 3A8KA 2F9DA 2NVQH 4Q8FA 2AZ3A 4A3LG 3GFYA 4K8JA 1O5JA 1QVFR 2IBKA 3MM8B 1GTEA 2DRAA 3FKIB 5JVHQ 1PZKD 2E1MC 3TZDA 2MMYA 3KTQA 1NJXA 3BBBA 4UOGA 2FJWA 1BUVT 5EPKA 1JLGA 1CC8A 5EWFA 4ZK7M 3PRDA 1TUVA 2CG4A 2HKEA 4EGVA 2YU9H 1U0HA 3J81i 3V05A 2CNLB 2B2WA 1URRA 3W2DA 4ID5B 3QT6A 1GQEA 3D66A 4DR7F 5IGFA 3KUHA 5LSOA 1V5VA 3UN2A 3AJ1A 5E7NA 5KFQA 1YHQS 2EK6A 1FL0A 1JE4A 2HFVA 1I94L 3OVAA 4WJ4A 3S2DB 1BQNA 1H9SB 1JLBB 4AXJA 1ESRA 4U8VA 1HA6A 3OSPA 3B6YA 3NAHA 2VB2X 4MTNA 1FRJA 2BE7D 4NXMJ 1LFPA 3H4DA 2OPPB 1RGVA 2GMLA 4YR2A 3QBCA 2DRBA 3JSRA 4FP9A 1YBTA 3T53B 1CQFA 1Q53A 4Y6IA 1Q7YT 5T1IA 3S1MB 4F8MA 2WAQE 4AYBD 1HWKA 5E3FA 1LV5A 2CQ4A 3OTCA 4DUZJ 3KJFB 1H7XA 5F9NA 3HM9A 4BWGB 3GILA 2B9EA 4KV6A 1QY7A 2EYMA 2B43A 2GS8A 1UVJA 2FHJA 2WVEA 1HR0Q 1PIEA 2HNZB 4H02A 1I50B 1DRZA 4GKJJ 1TQLA 4YB1P 4NLOA 2HBQB 4B9TA 4L8JA 1F5BA 2D3ZA 4DV4F 3UCZP 4CRJA 5B09A 5EAYA 2GV1A 2WW4A 4X4PA 4R0EA 3RBDA 2I5MX 1HD1A 1TQOA 4HMIA 2NZHA 2BZ2A 1KLMA 3BJUA 1D8ZA 2HCIA 1FTCA 4OZ3A 3PV0A 1SIZA 3BPSP 2KVIA 1RT1B 2D3OR 3QJYA 2EFVA 1HCZA 2DNPA 4CI0B 2R7RA 3N01A 2HT1A 2MDAA 3CF5A 5C4JB 4ETXA 3CQZH 1YJNA 3OBIA 3AA9A 5THWA 2BQRA 2A5HA 4ZP9A 3PUWA 1TKXB 5KG7A 2ZH2A 2JHEA 1NLKL 3BS1A 3OJUA 3HOVH 1F6TA 1R43A 2FDNA 2VA2A 2ZBQA 1LTAD 3CJQA 1EETA 4CQ1A 1S9EA 3MAAA 3W9HA 3BB5A 4A8KA 4IFDJ 2EFQA 4NI2B 2XMJA 2VZ9A 2CJ9A 4OI3A 3G71A 4DV0Q 1A0IA 2G13A 1ASYA 1CQNA 3MEGA 4GOPA 4TXSA 4R8IA 3W62A 2BW7A 1REVB 4Q45A 4R4QA 4OWXB 3DGPA 3L3OC 4HTHA 3DLGB 5JPMC 3VV2B 2QMXA 1HNVA 4ECYA 4M5KA 1EQVA 2WAQB 1VLYA 1UETA 4GZYC 2L48A 2N3LA 3QO9B 4DR7L 3RZOB 3CE8A 5J2NB 5MAOA 4YWKA 3RB3A 4JI6Q 4USTA 4YB5A 4EGLA 3QOLA 4LBIA 4OYAA 2XWJB 2AGOA 1CK1A 3OTBA 5IP7H 2RILA 4EUVA 3AB9A 4C9DA 3I70A 3ULJA 3KK3B 3UVJB 1SJ4P 5IYCG 1SEBD 2NZOA 4RG1A 1YKWA 1L3VA 3VWSA 2GCFA 1N5TA 4ZP7A 1E6YA 1HHVA 4JI3J 2UZAA 2OPQA 5DZ7A 3OR2B 1HQUA 1GTHA 4PKDB 2E5LF 3KLEA 3DU5A 3CCSA 2N49A 5IYBH 4CCHA 1PLFA 1FRLA 2CJKA 4IPGA 1CSQA 3MMBA 3JS9A 1D0EA 1FEHA 4B3OB 4OLPA 1MMNA 1S49A 4BLGA 3G8SA 1O7LA 1S1VA 1Q7LB 2WB1G 3ISNC 5IXUA 1F3FA 1CM9A 2W4PA 1RLCL 2GQQA 1E2WA 2B39A 3UN5A 4U7CA 3UPFA 5EN1A 4C8KA 4LRCA 4DV4L 2IL8A 3KYLA 3HG9A 1S5ED 2BOSA 3HHLD 5CYMB 4RBTA 5GADU 2DUDA 2AW0A 4Q43A 3EPGA 1AZPA 4QR2A 3DCAA 2R8HA 1JT8A 3DOKB 3BG3A 2Z6KC 2K1BA 5B7WA 1VQ6S 4LK1C 3T9NA 4H13C 3U27A 3H5YA 3HRZC 1SKUB 3BGUA 5AXLA 3DM2B 1HL6A 3CJRA 3EMTA 3IBCB 2L11A 3HOZB 4FXDA 2FPHX 3EGWB 4JI2F 4EBDA 4TU9A 5CMDA 1PFSA 3KG4A 1PZJD 4PG3A 2EJGC 1G91A 1D09B 1X32A 4KV8B 3IGNA 4KAIA 2FQQB 4GC6A 1ICFB 1CULB 5J2MB 2NYIA 2DVIA 2BH8A 1M1GA 1MHWC 1IW7D 1YNND 4NYZA 3BGRA 1U45A 2AEFA 4O1NA 4XIGS 4C2MB 2HPUA 2MKJA 4CO0A 2R8KA 1ZS6A 2HGNA 1F9QA 3DXJC 2MGZA 1VRUA 5KFMA 3GTOH 3J7YU 3M2VB 4KKUA 4EU0A 2JN4A 3R5CA 4R5PB 4BY1H 2OFGX 2CYYA 2BOPA 3ZZTA 3BREA 3BZKA 3TJ9A 2NN6I 2QA4G 3WC0A 4MH8A 3KDNA 2M5YA 2Z30B 1XQIA 2V0NA 4LF4F 3VF0B 3X1LB 1PFMA 5CV8A 4J9SA 2VFVA 2W8LA 2F0FA 1WFQA 3A5UA 3AH6A 2MKCA 1GXUA 1H74A 3NGSA 4NW2A 1MMDA 4DR4Q 2I0XA 4DPXA 1SL0A 3VA7A 3KG1A 5B0CA 1X31C 4QIGA 3GIRA 2ASJA 3S01A 2E5LL 1A2UA 2HQGA 4WFNQ 2DN8A 3VALA 4A3EB 3ZC4A 4GS3A 1MU2A 5J2PB 3BPDA 4IDKB 2VUMH 1AA1B 4C8LA 1C2PA 1FRXA 2QL5B 5IZHA 1VQ5S 2OD6A 2KYZA 5C5LA 4H7BA 3J80U 2XIWA 2J0SD 1R4PB 2X7IA 4B17A 1S1XA 2GVDA 2PPBC 1OXVA 1C0TB 5COYA 3UE2A 4WFBQ 2OEKA 4NB3A 1U1PA 1L3UA 2RSQA 3GR0A 2CADA 4WZMA 3EFXD 1HNWF 4A3JH 4OX8A 1P6TA 5H9FJ 4UPAA 2RDJA 3AMUA 2F40A 2UXDF 1JX4A 1T9UA 5B0DA 3ZZYA 5GAGI 4PWDA 2NVYH 4D3HA 3SE0A 3KJPA 2XRQD 3TAMB 2V4JB 1DOMA 3OSOA 1KABA 1UAPA 3KLGB 4LF2A 5HROA 1VF5C 2CW0C 2EWHA 3EGVA 3BVGA 2VL1A 4JI2L 4NXMQ 1BQXA 4QQBA 1SBBB 2CPJA 1HBOA 4Q44A 1XK8A 1I5FA 2F0OA 1EWHA 1HD0A 1KS2A 1VQKS 2Q8RE 1SC4B 2I5JB 4K4XA 2D9UA 2AJFE 5DM73 3J80c 4DUZQ 2MFIA 1EU3A 1N33F 4OX6A 2ZM6J 4A8OA 4K0KJ 5DJBA 1KL9A 1U26A 5ETQA 2UUAF 1GHKA 1C4CA 2M8DB 3TANA 5IGCA 4GKJQ 1H95A 4IPDA 2QGFB 2AU0A 3S2HB 4HJAA 3PO3H 2JEIA 1DOLA 1Q1KA 3JYTA 2ATCB 4ZJOA 3PYDA 3ILJA 2HLTA 1RI7A 2CZVC 2J6UA 3RR8A 1Y7PA 3JAML 3M8PA 1X5OA 1B2TA 1U1NA 3N6RA 1EY7A 3CIMA 5M3MH 4KKOB 2RSNA 4LF4L 3RLNA 3AAWB 3K8WA 2ZJQA 2B8PA 4PXCA 1HMVA 2AJ0A 1RWPB 4TKTA 2ZC3A 2H5XA 2C3PA 2MY8A 2M0GB 2E76C 1U8SA 3D5MA 1I94J 3L7ZC 4JI7F 4RBUA 4ILRA 4LSLB 4DPTA 2J9DA 1CKNB 3B78A 2UV8G 4ELVA 4WJ3M 1DTQB 4DSJA 2KM8B 2B5JB 4MIBA 4TLQA 1Q81T 3G9CA 4U96A 3IP0A 1STBA 2OMOA 3ISZA 3A3PB 5GQOA 4DV7Q 1WOOA 1PFNA 2IIHA 3DOMB 3NLCA 1M5HA 4UY85 2B9WA 1VHIA 4EO8A 1CG2A 2HIQA 2RRBA 4DV3J 2KQ3A 1U1RA 2D0PA 4IZ8A 4ECXA 5M5WB 1HNWL 3SR1A 1B9MA 4MFBB 3LGHA 4X3UA 5FDLA 1JKHB 2R3VA 2EY2A 4JI8F 3IG1B 1CJVB 1Q7YC 1JNRB 2FJXA 1YVCA 4CDDC 4CH1A 2UUBL 3TQYA 4U673 1TKWB 1P1LA 2MKIA 2RS2A 1QZHA 1D5XC 2E5IA 1LXJA 4JI3Q 2F0LA 3CXCR 3PQIA 3OFHA 5KYLA 2DGYA 4YQWA 5DZ6A 3A8EA 4UDUC 4N8X1 4Q0BB 2Z6KA 3KJVA 1TAQA 2XY5A 1KLUD 3T19A 1R0AB 3C1FA 1C0AA 5IQQA 3NP8A 4RWWA 2MQMA 3QRQA 4DZ6A 3HKZG 2Y1RI 2YX7A 4EQNA 2M8HA 2WSEC 3HOXH 1N33L 1LWCB 1VR6A 4KHVA 4KIAA 3BH6B 1PAUB 5DM63 2NSBA 2G2OA 2UUAL 3H3VC 2ICEC 2BH2A 2HVIA 2O1PA 3QT5A 2ZHOA 1V3ZA 2CH4W 4QWCA 4HTJA 2WB1B 2G0IA 1IKMA 1OY6A 2ZJPA 1RODA 2E44A 2YY3A 1OMSA 4U67Q 3NRBA 3TUIC 1NDCA 1PAEX 2DRDA 3G6XA 4MYTA 1HNZF 4QYZJ 2YQ0A 2X1GA 3M1VB 4OL7A 4DR7J 2UUCF 4QIWD 4M1KA 3DLHA 1KEKA 2ZZMA 3KLWA 2HRUA 2ZKTA 4HEDA 4PQAA 2FVQA 1VQNS 2XWBB 2WW8A 2BACA 1I4HA 4JK1C 4JI7L 3R3OA 2I9SA 3MXUA 3VAFA 2EW9A 5E7OB 2HFOA 1TUWA 3MPDA 3V6KA 3GDEA 2PN6A 4YWLA 3DFEA 5HMWA 1PJ7A 4L6V3 4HYKA 3CC2A 1BXTA 2HFSA 2W25A 1I3QH 1GUOA 2AWOA 1C1CA 2CFXA 2C35B 4P6QA 2QT7A 4ECUA 2A6HC 2LLZA 2B2VC 1JJ2A 2YNGA 4F0HA 4A8FA 1Y00A 1GUTA 3WDOA 1ROFA 1N36J 2B63G 4HR7B 3W3SA 2KEEA 1OY8A 3CMAA 1VQ4A 2RQ4A 4KTQA 1K8AT 4KGMA 5CORA 4WTYA 4ZKCB 1I4XA 2RDDA 2FJAB 1Y8NB 3S1QH 4J9OA 3CIZA 3ERSX 4DV4J 4QPXA 3KG0A 4JI8L 1W6JA 2RAQA 2FHMA 4OZ0A 2HW3A 4OELB 3CJKB 1VI7A 1N8RT 3GCXP 4XPEA 1GVPA 3WQPA 3MEKA 1XNRF 3KUEA 3MFHA 2L9DA 2PA3A 1WNEA 4P2FA 1NMGA 4TYAA 1S59A 4M5JA 2VHGA 1G4CA 1WTBA 1SE4A 1W6KA 1QTNB 3K5MA 1J6QA 3G82A 2PEBA 1M1HA 2K7VA 4TU7A 1PH1A 1S57A 2QV6A 1STHA 2K5HA 3PUVA 1N0VC 1HJPA 4FF4A 4CWBA 3H5XA 1FEEA 2GAGC 4LF5L 3D6TB 2AMCB 5L1LA 4KC5A 2MSTA 1HLWA 4I2QB 3I4NG 1K73T 1U48A 2F63A 2NUHA 4JV1A 1TL1A 3AB2B 2ZEJA 2EYLA 1T9TA 1WEYA 1L5UA 2OEOA 2DGQA 4Y65A 4ZYSA 1YJRA 4UTGA 3C1EA 5FLMG 1XTDA 4K8RA 4J91A 2IW3A 1NCLA 4K4VA 2E5GA 4L75A 4W92B 3K0JA 4CNYA 1F0XA 1EOTA 2WKDA 4BA1I 1XMOF 3L9ZA 1HHSA 4USJC 3OR1A 4CT8A 2B7BB 3VYRA 3CEDA 2DY9A 2MNAA 3FSXA 5A8RB 2UUCL 4OGQC 2KYXA 1Y3KA 4M5NA 2QEJC 5JJBA 3M9NB 4DSKA 2HQDA 1BF4A 4ED1A 3W61A 4X4SA 2JA6H 3W5YA 4FS1A 2C2OB 5HL7Q 1IL8A 2XTJP 2MZTA 3KMQA 4I56A 3QG1A 4DL6A 4HHUA 4RKLA 1JWSD 3MXGA 3OIQA 1EQRA 2MY7A 3LGNA 3DXSX 1IKYB 2E5LJ 3MD3A 1NZ8A 2JDJA 4IR9A 2VOOA 3K7AB 3M9BA 2FZKB 4NLUA 3UR0A 3SGIA 3FBEA 4C3JG 3I55A 2J9CA 3DGVA 1RAHB 2D62A 4CDIA 4K0KQ 1RACB 3LPEA 1E1TA 3VQSA 3AA8A 1BE4A 3AY0A 3C6UA 5KFJA 1DY3A 2CFMA 4IO9Q 4DOZA 1RHMB 1XEZA 2EYFA 2RDHA 1CPZA 4B3MF 3A5ZB 2CDRB 1P9QC 1RKIA 1SUQB 4GVBB 2J7KA 1S1TA 1MIUA 1PZID 3Q8YA 2NTTA 1MSHA 4HHHA 1U4BA 4XAKA 2BJEA 2HDLA 5IFMA 1D1UA 3MM8A 4NKLA 2ZBIA 3TR5A 1CUKA 4LUZA 4OYPA 3NHHA 4TQSA 1Z7TA 4YDXA 4N5SA 4K4YA 2BKPA 1XNRL 4K4WA 5ELFA 4I2PA 4CHTB 4X84A 3M7GA 1I94Q 2GIRA 4OHWA 4X4OA 1D1KA 4ID5A 2JEBI 2KTQA 2NXCA 4ED6A 4APVA 1N54B 1FJCA 3E2EA 5KG4A 4BWJA 4GO7X 4M5DB 2AYGA 4N7TA 1TT2A 1WELA 4JI2J 4UY8C 4M5GA 1X4BA 3SFUA 1E2VA 5CD4A 4HI2A 1HZCA 5JVG3 3AYHB 1L3KA 1H9SA 1JLBA 1DQ8A 4KQZA 3JAMY 3NGKA 4JOIC 3ITHB 1FNVA 4C3HH 2ZXRA 1RLDA 4JV0A 1Z6HA 1RADB 4QW8A 2DNCA 4MIAA 2OPPA 5IWAF 4DV3Q 4YWMA 2OTJA 4DUTA 2VG6B 2F0KA 1Q86C 3RTVA 1TMMA 3GIMA 3I0SA 1YZ6A 3I91A 1XMOL 1JB7A 3B6BA 1DARA 2CQAA 1SBRA 4RW8B 3N79A 1QNKA 1FRIA 4LMQD 1FNOA 3H5UA 1KDNA 3BBCA 5C24B 3Q83A 4LF4J 1D8YA 4DMZA 1WEXA 4M5IA 4DR2J 3IGVA 1KNZA 3EVWA 3QAEA 5JVGQ 5E4XA 1N56A 2RIJA 3PIPQ 2V50A 3HOVG 4OYIA 1K83B 3PR4A 4WKRA 1RT1A 1WD6A 4ZPVR 4RZRA 3IR7B 1SI9A 1B0TA 1NKBA 2HQ3A 3GTPB 5L1KA 2B4UA 3RBXA 2R2SA 4PYAA 2QGQA 4DHVA 1HKAA 2B3GA 1OXXK 3HKZB 1TKXA 5AE2A 5DQIA 1FXLA 2KHIA 1WTHA 4B3ML 1RISA 3TW0A 3FRZA 4KN4C 4DNTB 1S4EA 1X9MA 4IH5A 3S1NB 3MMAB 1BD6A 2DH8A 5AT1B 2E2IH 4KI0A 3KYHC 1O7YA 1HBUB 2B2VA 3QNWB 5C44H 1CZWA 1QG7A 2H65B 2DPIA 5L8RC 1REVA 1HNWJ 4KHRA 2SNSA 1O78A 4DR7Q 2YKNA 4RX6A 2PI5A 2UXDJ 3DLGA 3OV7A 4NA1A 1IM4A 4J9MA 2RDIA 3H8YA 4CLKA 5C4XH 5IP7G 3PCOB 4L72B 4Q0FA 4KHMA 2FTRA 3IR5B 4DSFA 2K5VA 5IM0A 4HAEA 1XIQA 3QO9A 1AE3A 2HNDB 3OPKA 4QIFA 2DNHA 3KK1A 5J2NA 2V8VA 3MOZA 3VGTA 1T8EA 5H1SE 2I5HA 4KSEB 2KM8C 1VS0A 1Z4UA 3CPFA 2B56A 2A1BA 1FKPB 4IOCA 5IS2A 4K4ZA 3UVJA 3GG1A 4LJZC 2E5HA 3RGIA 1SXLA 1N36Q 2CCZA 3TUZC 4LSNB 3JTPA 1NY4A 5IWAL 2H1YA 1EIHA 2WV6D 2N4DA 4O4RA 3SQOP 1VQ9S 1BBXC 1WSRA 1JLEB 5I3UB 6FD1A 1TWCH 5JOBA 3K89A 1T11A 1WTRA 3LH2S 2UUAJ 1T0TV 3OLBA 1B4OA 3RG6A 2HWHA 2B63B 1PILA 3I4LA 3HHNB 2FVPA 2JC0A 3BR8A 4PQUA 2CQOA 1LUZA 2M7SA 3G87A 3KNAA 3P96A 1MNEA 2R7ZH 4DV4Q 5NUCA 2DGWA 1S72S 2PEHA 4ED7A 5GAHU 1VQBA 2RSOA 1X5PA 4NCGA 1RBAA 4R9WA 2UUWA 1PH4A 3DM1A 3PM9A 1Q79A 2D3O1 3IR6B 3MHYA 1LK5A 2PT0A 1YHQA 2NYZD 3PG9A 2F0PA 5LMUL 1X4GA 3BZQA 5CYMA 4X3TA 2XZDB 4OFZA 1H2TZ 2R7FA 3DHWC 2XRSD 4ECTA 3DOKA 2C3MA 2O4XA 4JI7J 1JLFB 2DNMA 5F0WA 4PUOB 1HWJA 2VG7B 3NGRA 5C7PA 1PRTB 1LTSD 4IFYB 4QUFA 1ZXTA 3DM2A 3VR5A 4KBIA 1RE1B 3N6NA 1IYVA 4JV5F 1XNQF 3L09A 4LBPA 3W9IA 5EGTA 1O0PA 1D9FA 2HS0A 4EMDA 1TWGB 3Q8VA 5BXIA 2RDFA 3UDEA 3I4NB 3DNCA 3MFYA 1VQFA 3N5BA 2OF1A 4KV8A 4TQRA 3CCJS 3CKIB 4KPCA 2EXUA 5J2MA 1T3OA 4DAVA 4BY1G 3OVBA 1G6ZA 2MKKA 5I2YA 4B9WA 2XLJA 2K04A 2CVEA 3DWQA 3CDEA 2K1RA 4C2MA 3MM9A 5ELOA 4OI1A 1B1ZA 4QQBX 1VYAA 1UCNA 3CU7A 3HSDA 4USKA 3DXBA 3BKTA 1NJZA 1RTOA 2W9CB 4R5PA 1FVQA 1ULRA 1F2LA 3HSJA 4DLGA 3SK6A 1NK4A 2EFPA 2CPFA 1K8AC 5D15A 4IOAQ 4PXDA 5HGQA 4LF9J 1Q1BA 1RTDB 2E5LQ 2CKZB 2ZE2B 1APSA 5D6GA 4JPBW 2BE5C 3J80E 3EDRB 4CT9A 2F8MA 1OSDA 1YI2S 2VUMG 2AGPA 1SFOB 3SDEB 2HBYB 1LM0A 2EI5A 1Y8OB 2MXYA 1MSWD 1HZAA 4C3JB 2VONA 7FDRA 3SSRA 4WKYA 2KKHA 2NVQB 2ZTDA 6FDRA 2CJQA 4IDKA 3DUZA 1AZQA 1C48A 4NCBA 1Q3LA 4X4RA 4E8UA 3VYTA 1K1QA 4JOIA 4A3JG 4F4WA 3FEYB 3T1AA 5LMNW 1RTHA 3KLVA 2HEKA 2FLNA 2YWWA 2LKVA 2YU9B 1LOUA 1HNZJ 4DQSA 3J7AN 3L7UA 1BY9A 2BKNA 2KI2A 1C0TA 3RUBL 3SEOA 4WWSA 2CIMA 2AGQA 4ZHRB 1JJHA 4OI2A 2G4BA 5C3XA 4UZCA 1EFWA 1HWUA 2F3IA 3EZOA 5KRUA 3FEXB 3M6WA 2YTVA 3QIAA 1QVFA 2D7SA 3OTOF 4JI2Q 1II3A 2VBYA 1W25A 4J9QA 3A13A 2V4JA 1LTID 2VC1A 5FJ8H 3QZ7A 2KRRA 2CDQA 5KFPA 3KLGA 4O0NA 3AQQA 1RT5B 4EVOA 4JV5L 1XNQL 2G0CA 3MM6B 1W7WA 4F0KA 4LR7A 4ANDA 2HIXA 5K8NA 4H4MA 1RU1A 2DXFA 1G1XA 4U9RA 3FQLA 4DPYA 2YTCA 4AL7A 3L7PA 4UOCA 1NSQA 3THVA 4P7VA 2OTLA 1YJWA 2CPXA 3BS9A 2FMCA 2WSFC 4B3TF 2C9OA 4ED8A 2BW2A 2HK3A 1B64A 2V8HA 2ZJRA 1K0SA 5KNCA 4F4KA 5M3MG 4KH0B 3SI8A 3PRBA 4LF4Q 3W8PA 4USIA 4K7QA 5T7LB 1V9PA 1BVSA 2R7VA 4DR2Q 5J1PA 4FPIA 3RU0A 1VQ6A 5LL6X 4DEZA 5IV3A 2F0QA 1UZHA 3ZZPA 3LNNA 5MLCV 3MEDA 5HMZA 3A54A 2X3GA 1A3TA 2JA9A 4LNQA 3CQZB 2COLA 4OJHA 1WTOA 1S0MA 1A2TA 1RA6A 1Q8KA 2KH9A 4AL5A 3H6MA 1EY8A 3GIIA 1QJOA 1B7YB 3S17H 4Y00A 2X69A 3AFQA 4N9TA 1EYGA 1D7QA 2V1CC 3HOVB 1NCVA 3RAMA 5KTQA 4LSLA 2LP4A 1CKNA 2XLKA 2AJ4A 2XCAA 4Y2CA 3M8QB 4WU2A 1Z9FA 1DTQA 4V1Ak 2B5JA 1WJ9A 4PRFA 1Y8PB 4QF4A 5DGBA 3HCXA 3QSYB 4I69A 1SMYD 2YTYA 3G48A 3IFEA 2ID0A 2ZTCA 5C4ZA 3BDPA 3OL6A 1HNWQ 4I64A 2W9AA 1G2SA 3UD4P 4XDDA 1XMOJ 2UXDQ 3ENAA 2GMJA 4AIMA 1ZYRD 3P5BP 2HHWA 2D9OA 2Q6CA 4HI1A 4YR3A 4OYOA 4FYYB 4I1TA 3MR2A 1CQMA 1HFGA 1NO8A 4OX9F 3QB3A 1V9OA 2EC0A 1SJ3P 1SE2A 2B2TC 4V0BA 3OWEB 3P6YC 3OTOL 1I3OB 1TR5A 4Y2AA 2HAFA 3BDEA 2ASLA 1BCPD 4DSLA 3K7UC 4ES3A 4B9SA 2EOTA 5DDOC 3STBD 3D3RA 4DKAC 2EY5A 3K5PA 2XO6A 3HOXG 2K7JA 4RFBA 1N33Q 4ZPDA 2GZOA 4QBUA 1FJ7A 4Q0BA 3A3OB 1TWHH 8ATCB 1R0AA 2UUAQ 1R8HA 3MTKA 2LFNA 1VC6A 1YRTA 1X55A 2E7VA 2ZWPA 2JA5G 2ZH8A 3EVMA 5JAVA 3CO0P 4AYBE 4DN0A 4B3MJ 4DL3A 3KHRA 4B3TL 4ZLTF 2QL9B 3ZTPA 1L2FA 4OZNA 4A46A 3CCQS 4FYVB 3CCTA 4ECRA 1GJXA 1UJ6A 1BWVA 1MROA 2KVQE 3T16A 4OIKA 1NHUA 5EWGA 3OL9A 3R2CJ 1NDKA 2ACYA 1M5PC 1FTRA 2CPYA 1T95A 3PY8A 2XYGB 2I46A 4GN4B 2H9ZA 4JI7Q 1BWEA 3J7A5 3H59A 3M1VA 1VQCA 2YNFB 3J80i 1TVRB 3KJOA 5I42B 1NJYA 2CPIA 5E3AA 2RQKA 2BXJA 4DLEA 1VQKA 3H90A 1PJ5A 1EKRA 1Q82C 1VQ7S 2P5ZX 4FVMA 4QIEA 3TDQA 4QCLA 2R7XA 3Q8QB 3H25A 1P8GA 1T3NA 3QQCD 4HMJA 2CPHA 2KJWA 2RCFA 5IWAJ 1WD1A 3RZDH 5D4LA 3X3UA 3M8RA 3CW2C 3G7LA 4LAAA 3KLHB 4A3KH 2J7ZA 1RAFB 2OGUA 2FB0A 4CKCA 2H48B 2J7UA 1KDAA 1H2UX 3VAGA 4DUYF 3T1HJ 2LY7A 4B9MA 3WOEA 1MMLA 4BY1B 2NSCA 2ALZA 4AYBB 4RJVA 2HG4A 2UXBF 2R92H 3VR6A 4OX9L 5EBCA 2F65A 2CUYA 1BC6A 1VQDA 4LF8J 5C25B 2NREA 4IG3B 3OXLA 1T94A 2OELA 2DYAA 3UI2A 2JVRA 3CJKA 1BDOA 1VQLA 4BBRH 2LXUA 1QAXA 3Q2TC 2DGTA 4DCPB 1PC4A 4RGOS 4LVNP 1OYDA 3MPYA</