The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
90
|
sequence length |
300
|
structure length |
299
|
Chain Sequence |
GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb |
source organism |
Escherichia coli (strain k12)
|
molecule tags |
Gtp-binding protein
|
molecule keywords |
GTP-binding protein TypA/BipA
|
total genus |
90
|
structure length |
299
|
sequence length |
300
|
ec nomenclature | |
pdb deposition date | 2015-04-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00679 | EFG_C | Elongation factor G C-terminus |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | OB fold (Dihydrolipoamide Acetyltransferase, E2P) | bipa protein | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Alpha-Beta Plaits | ||
Alpha Beta | 2-Layer Sandwich | Alpha-Beta Plaits | Elongation Factor G (Translational Gtpase), domain 3 |