4ZCKA

Crystal structure of c-terminal fragment of escherichia coli bipa/typa
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
300
structure length
299
Chain Sequence
GSTVSMFFCVNTSPFCGKEGKFVTSRQILDRLNKELVHNVALRVEETEDADAFRVSGRGELHLSVLIENMRREGFELAVSRPKVIFREIDGRKQEPYENVTLDVEEQHQGSVMQALGERKGDLKNMNPDGKGRVRLDYVIPSRGLIGFRSEFMTMTSGTGLLYSTFSHYDDVRPGEVGQRQNGVLISNGQGKAVAFALFGLQDRGKLFLGHGAEVYEGQIIGIHSRSNDLTVNCLTGKKLTNMRASTDEAVVLVPPIRMTLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gtp-binding protein
molecule keywords GTP-binding protein TypA/BipA
publication title Structural and Functional Analysis of BipA, a Regulator of Virulence in Enteropathogenic Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 90
structure length 299
sequence length 300
ec nomenclature
pdb deposition date 2015-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00679 EFG_C Elongation factor G C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.250 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) bipa protein 4zckA03
3.30.70.240 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4zckA02
3.30.70.870 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Elongation Factor G (Translational Gtpase), domain 3 4zckA01
1FNMA 3B8HA 2YWGA 2CVEA 1ZM9A 1DARA 1ELOA 2KDOA 4ZCIA 1KTVA 3B78A 4MYTA 4QR0A 3ZZ0A 2XEXA 3ZZTA 2I8EA 4MYUA 4ES2A 2YWEA 2YWFA 1P9QC 2J7KA 3EXCX 2EFGA 1WDTA 4ES1A 3UI3A 4TNOA 3CB4A 4ES3A 2BM0A 1ZM4A 2BV3A 2L9NA 2IVYA 2ZITA 1ZM3A 2I0XA 4ZCLA 4MAKA 1ZM2A 1VI7A 2WBMA 1N0UA 4M1KA 3E3XA 3ZZUA 2BM1A 1U2RA 3OQ2A 3LH2S 4QR2A 4ZCMA 2E1RA 4FN5A 2DY1A 4QR1A 4ZCKA 1ZPWX 2NPFA 1N0VC 2YWHA 3B82A 5G4DA 1T95A
chains in the Genus database with same CATH superfamily
1XPUA 2DB1A 2VQFJ 4KPCA 4DN4M 3GCXP 2R93G 3C15A 2P2CB 2YX7A 3DI6A 2UXDJ 3FBBA 3TANA 3UE1A 1SB6A 4DU7A 2CPIA 1HTPA 1LTGD 4DR3F 2YH0A 3A13A 4EWTA 4C2MH 2F0OA 2GQCA 3HKZD 1CSJA 5E7NA 4I0WA 3CDBA 3I82A 4RW8B 3MURP 2J6TA 3KHGA 2VG5B 5EQ0A 3GFZA 2QFJA 4BBSB 4ALPA 3HVWA 3CTRA 2OP5A 5C3XA 1XNRL 4O3PA 1LWCB 4LF9Q 2CXEA 1YI2S 2ZE2B 1TP7A 2Z2LA 2VQEQ 4USIA 2HDMA 1KDCA 4U8VA 1E6VB 4M94A 2HFSA 4FP9A 5ETMA 5AXNA 2V4JB 3Q8DA 3RB4A 1HQUA 4DQPA 2CQCA 2RB7A 1AUSL 4LFAL 3NCQA 2ZNZA 4B3RQ 4QGUA 2ZM6J 5IT9Y 5E2QA 2EFNA 1HWLA 4KHMA 3M9OB 1FGBD 1SJQA 3R1LA 4OJHA 2QGQA 4F26A 4B3TJ 4B3ML 2KJVA 1K0RA 3I4MG 4UZCA 2Y1RI 5KFLA 1SQFA 1AZSB 4RKUC 4CYUB 3OVAA 5DEHA 2R7OA 1NK9A 4JI6L 2VXWA 4LIRA 3PACA 1Z2ZA 1OXXK 4Y65A 3HOWH 1DLOB 1TL1B 1C1CA 3GB0A 4GOPC 1HR0Q 1RWPB 4A3GG 1VMPA 3PXGa 1SQEA 2M88A 3NL0A 2RQXA 4EZ6A 5ETSA 3G6VA 2OEMA 1UFWA 3QOLA 3QJPA 2CNKB 3THPA 1U5KA 3MCSA 4ZLTF 3M1VA 3NQIA 2AGQA 2VQFQ 4RLEA 2CAJA 4L3NA 3NS7B 1D8ZA 1QSSA 3U58A 4OL8A 4MH8A 3H0GH 5CCLA 4CLKA 1UE1A 2MNAA 6AT1B 1R0AA 2TMPA 1WTXA 1RB0A 2VNUD 2UXDQ 4KFBA 2GVDA 1XNRF 2BJ9A 1LKZA 3S15H 2XZDB 4UW2A 2VUMG 1FFWB 4FO2A 1TUVA 1SYEA 3THTA 4A3KH 1SKRA 1FKOA 3H4DA 3DMJB 1VQ5A 2QLFB 1PTOC 1H7WA 2IX0A 2W4CA 2VH7A 1RHQB 2Y1JA 2D3UA 1FEEA 4NCGB 4XK8C 4K6LA 5GMDA 1S1UA 1WF1A 1SRUA 1WC5A 4K4VA 1SLJA 4U9RA 1MBYA 1WNEA 1B70B 4IOBA 4PV1C 2BE7D 1RKJA 1H9RA 2QEXA 2E1RA 4B3MF 2CG4A 2OPPA 1Q7YT 4B3SL 5B08A 3G6JB 2KDOA 5DM6Q 2GHWA 3GV5B 1GNKA 4CH1A 1STYA 5IYCG 1X3FA 3PV0A 3K7UC 2O2LD 1I3OB 5HROA 5A35A 1U2CA 3NXZA 2AGPA 3GTQH 1RF2D 2C2ZB 5M2RA 2ZM6Q 3H25A 5C25A 3FSIA 5K20B 1FCAA 1WD1A 1FJGL 2W2PP 1Q12A 5KFQA 2KT5A 3HOUB 4QJFA 4B3TQ 3TUPA 3IWXA 1SJ3P 1FRKA 5FLXE 4DL2A 3KF6A 3KK1B 2O5JC 2B8GA 3V81B 4WU3A 1NPKA 1P6TA 5HP1A 4DR1F 4ZVPB 5J1ZA 2VA2A 1PRTC 2VC1A 3PNIA 4QBUA 1N32J 1KIXA 1CULB 3E0EA 1U4RA 4GKJJ 4AFFA 3PW2A 3T51B 1BCPB 1Y69U 4KYZA 2QLJB 3FSYA 1GMWA 2SXLA 2ZC4A 1E0BA 4JW0A 3J7YW 1K9MT 2OEKA 2CPHA 1I3QH 4GKKJ 1S76D 2CPFA 1DXMA 1VISA 1YJVA 5D3GA 2EY2A 3BH6B 4KY6A 3TA1A 5COYA 5LMNW 1IYVA 4TKTA 4JV2A 2YX1A 2NSCA 1YQHA 2X3GA 1KTVA 4F04B 4ZP6A 1JE4A 2VONA 5E3FA 4ZKCB 4USVA 4C4WA 1REGX 2HAFA 3O13A 3QJJA 2FB0A 5C3EH 4KPYA 4JBJA 4HJ7A 2LXFA 4J9UE 2GV1A 1EIHA 2TSSA 4K59A 4ZVQB 2HD3A 5IV3A 3KUPA 1F9SA 4LBIA 4ZPAA 2W4PA 1W3SA 1ZA1B 4C1NI 1YBYA 1VQOS 4LJZC 5HLFA 4B3SF 5IT9c 4WP8A 4BA1I 5C5JA 1M1HA 1TVRB 4DPOA 4BCAA 4C8ZA 4Y2MA 5IOCA 1ICEB 1RE1B 3UDEA 4KGXB 5I4MA 1BE4A 2KA7A 3KBGA 3RD4A 3N9UC 1YLXA 4WU2A 4Q5VA 4X64L 5KG6A 1HHVA 1FJGF 4KE5A 1N8RT 2VG6A 5KT5A 1SROA 4NX9A 2LDYA 3UCUP 3PRVA 1S5FD 3EVQA 4J37A 4NI2A 4USTA 2UP1A 2IAJA 1F9HA 2MFIA 3D4WA 4K8IA 2E5HA 5E3CA 3CD6S 2VJUA 1NJIC 3ADAC 5F8NA 4DL7A 1QTNB 2GW8A 2KVMA 2XMTA 2YPZA 2DRBA 2J6UA 5ELEA 3TR5A 4C3IH 2QCPX 3W62A 2VJVA 3J81i 2IHR1 3CMQA 1I50B 2SNSA 4K5WA 3HP3A 2E2IH 5IT9U 3HHEA 3AB4B 1UPPA 1OY6A 4KV8A 4NP5A 1N32Q 5LSLA 4KHPJ 3T5LA 4K7QA 4GKJQ 5I42A 1KAWA 3DLBA 1AH9A 1UWVA 1KLNA 1ILPA 2Q8IB 1NZ8A 2DHXA 4GKKQ 4R4OA 1F9RA 4DFJA 2ZOFA 1U45A 2LQ5A 3VYSA 2V1CC 1P8LA 5M3MG 1LT4D 4IRKA 1EEID 5E3PA 1GH8A 2PCFB 4PWWA 1SNMA 4A75A 4RWSC 4K8JA 4OZ0A 5H9EK 1JIHA 1XR5A 2R7ZB 1KAAA 2IWHA 1TL7A 4PPDA 4GVLA 2GO8A 1NAPA 4LR8A 5CHCB 3GILA 4HT5A 1GXTA 4KH0B 4KBIA 5GAEC 4E6IA 4TLRA 3DM3A 4EI2A 4F7VA 1WC3A 2K8GA 3Q8QB 3MM5B 1SH2A 3RZOB 4X64F 2AX1A 2QEJC 4IURA 2BQRA 4HSPA 4DR3Q 2EYOA 1OXVA 2A68D 2XNAC 3KLFA 3HVTB 1IJFB 1VC5A 1F9PA 3SDZA 4N47A 4ZJQA 3A8KE 3NWRA 3M8WA 1SH0A 1SVDA 1D5MC 4M5JA 2JP1A 1Z4UA 4GRSA 2FZKB 2HYIB 3MAAB 3PTWA 4NLPA 2Z4IA 5G3LD 3WWVA 4JI0J 4RO0A 3DRPA 2F63A 4FKXA 2BOSA 4U673 3SSSA 3KHRA 1MHWC 4ZN1A 4CLYA 2B7CB 2QMUB 3D2WA 5AXLA 1RACB 1IBLJ 2E9RX 4UQGA 2KCNA 3SXHA 4AT1B 4QR0A 1UJ6A 3B54A 4F25A 5CQGA 2DVIA 4JI8L 4A3IG 4CRJA 4ED2A 1TELA 2AZ1A 1MKHA 1D8LA 1F2YA 1VDHA 3MWBA 1G2EA 3HVAA 2DRAA 2NZ1D 4H7BA 4RCNA 2FYXA 5I6WA 1Q1KA 3BF4A 3PIOQ 1IN0A 2HLUA 4ECWA 3D6TB 3FVQA 1L2FA 2GJFA 3QPIA 3D5MA 3QB3A 1U02A 2C2KB 1M90C 3I0SB 4TVAB 2PQAA 4DR1J 1WCMB 2IJNA 3TAPA 4I6AA 1S5ZA 5KFYA 4CO3A 4PUOB 3GYXB 1LTLA 2CWKA 2HFOA 2A69D 3NG8A 3I4NB 1BQQT 3PF4A 3PG9A 3ILJA 2EY6A 3IFEA 4RBVA 2Y8YA 2Q6BA 1VQOA 2PD1A 4UP7A 5BN3A 4KKUA 3EDQB 4KGZB 3ETOA 1VRUB 4LSZB 2JA6G 3RMHA 2NPFA 1VGYA 3CJ4A 3MFIA 2AWNA 3ZZYA 1XK8A 1JOOA 2F3JA 4K4ZA 2QV6A 4ZOSA 1UL3A 3A0JA 3DOMB 3HOZG 2IL8A 1CC8A 3OW7A 3HM9A 2DGXA 1HUNA 5BJRA 4WIQA 2LXIA 4ER8A 2HWTA 2BE2B 3M3YB 2FJBB 2APOA 1CM9A 1TU0B 1VQKS 1ESFA 3CD6A 3OSPA 2BZ2A 1YVFA 2DISA 1LWFA 4JI3J 2DXDA 4ID5A 4TY8B 2XY7A 4JI8F 2HRTA 1APSA 5IGCA 3DM2A 5C4JH 1RWVB 2XY5A 2QW7A 1DOMA 2NCKL 4O3OA 3SEOA 4MMOA 3AD9C 4JI0Q 1NY4A 1BXNA 4ERDA 2ZTDA 1XMOL 2FJVA 2Z6KC 1HHSA 5L1JA 1N5YA 1FWPA 2ZXPA 4UP8A 1F6TA 3O2IA 2CNOB 3G71A 2F03A 1LW2A 1OO0B 4DV2F 1VF5C 2FVRA 5F3TA 2QO3A 1PMRA 1KDAA 1JICA 1IBLQ 1SC1B 4WZMA 1FFSB 4TLQA 2W4DA 3HKSA 1KQSR 1LTAD 4CI0B 3CCZA 3R2CJ 4H4OB 4LFBL 3QATA 1PXUA 4WKYA 5LJ3Y 2POKA 1MG7A 1HI0P 5M5WH 4AYBD 2R92H 5LMNJ 1SC6A 3VQTA 1WHXA 1FE0A 2DO4A 1SKSA 4X6AH 4MTPA 1QAXA 1RU1A 1TAQA 2ZJPA 1UZDA 3PO3G 3PHEA 1O5JA 1T3NA 5C0XG 2MY8A 4QIWB 3TVZA 4QWCA 1TY2A 4UY85 3EA6A 4DR1Q 4QF4A 1VQSA 4J9RA 1KHWA 3CQZH 3W5YA 1D1KA 3ER0A 3I96A 1T94A 4LK1C 4X66F 3T1YL 2KT3A 2LSSA 2ADBA 3SMZA 4ZPVR 2Z9HA 4NPOA 4RUAA 1NBEB 1S57A 2I5LX 3GTOH 5D77A 2RNEA 4RKBA 5D0EA 2VIHA 4OMFG 4R5PB 4DSKA 4RW9B 2JA7H 3H3VH 1RT2A 5H1SE 3R27A 3F0NA 1VQIA 3JAML 1RWUA 3EDRB 2N88A 4DR6J 2FJ2A 1K28A 2BMBA 3K6OA 3QRQA 4AL7A 1KHVA 4QW8A 2WINB 1A0OB 2XLJA 3KG1A 3TSSA 1KQFB 1NHVA 2R4FA 1U0LA 2J0QD 3NENA 2J7ZA 1N5QA 2NS1B 3KLSX 3FSXA 5D4NA 1XMOF 1PTOD 2AQ1B 2DHHA 3I55A 2R7XA 3SK8A 1Q81T 1TL5A 1UJ5A 2M2BA 3SCLE 4JI3Q 4K2KA 5JUMA 4LFBF 2OLWA 1Y3KA 2CZ4A 3EGNA 4YWLA 4BBSG 2ZJRQ 1ZZFA 5LMUJ 3E0JA 2OQKA 1JLEA 1IZ6A 4PG4A 5LJ5Y 3G96A 1LUZA 2B4VA 3F2BA 2HS0A 1M1KC 4DV0F 3OFFA 4BY1B 3VR4A 3F56A 3M4YA 4L6TB 1GX6A 4CO4A 1BO0A 1WTHA 3Q8RB 1XJVA 1FWLA 3D0IE 3M6UA 2CFXA 1U9RA 1V8QA 3WDOA 5LMNQ 5K5PA 3FVYA 1UVMA 1P1TA 4ED1A 4FZVA 1KDBA 3T1YF 3KG0A 1L3TA 4KHRA 2L0CA 4L5QA 4R9WA 4ZYSA 5JJKA 2KHSA 5KFDA 4OZ3A 3M8RA 1MIUA 2GVAA 3H2LA 1MSWD 2CVIA 2G4BA 2PFFB 2PSZA 2YPYA 1X31C 1EY7A 2FJEB 5J1PA 1H9SB 3BZCA 1FEHA 1TWCH 3GSIA 5K8NA 9RUBA 2EG1A 4JI7J 3Q6SA 3LOUA 4YB1P 3VR6A 5JEAH 1VQBA 2Y9HA 1VQCA 1KTKA 1CJKB 4ZP8A 3MGJA 3OBIA 4GC6A 1BGXT 1YJWA 3J81Y 5DLGA 3RB6A 2KFZA 4YCVA 1GT8A 1REVA 1TK0A 2MQOA 3J80L 1RHRB 2F0NA 1YRTA 4J9SA 4CO0A 1KN6A 3KK3A 4FXDA 1F60B 2B9XA 4DR6Q 3QLHB 5D3DA 4IFDG 3J7A5 4I67A 1RODA 2ZH1A 2KCCA 2RRAA 1RT7B 4JI5F 2MPUA 2G0JA 4FYYB 2KUMA 2DNQA 2J8SA 5L9XA 1AE3A 3NGSA 1J5EF 3UCGA 3NAIA 2CVEA 1MWQA 1RSCA 3H91A 3MHYA 2MKHA 3PYDA 2YTVA 1MROA 2J0SD 2DR8A 2MZJA 4KLKA 5LL6S 2CNNB 2NVQH 4DX5A 2GA7A 3BS9A 1HQEB 3D8GA 2W25A 3A3NB 5B09A 1HQRD 2QL7B 3Q83A 5B0GA 2GNKA 3OL8A 2IJRA 1IBKF 4QIEA 4KJIA 3GTKB 5EGTA 1HA6A 2Z1CA 1F5AA 2JL9A 4M8AA 3M7NA 2Q1LA 2PZUA 5FO8B 5LMUQ 2V0NA 3HKZE 3CCJS 3V6DA 3HG9A 2BBEA 2NBFA 4YHHL 1T9VA 1FNMA 2N3OA 4DV2J 1Q8LA 2I8EA 3GR1A 1SCJB 2GVZB 3BDCA 3P1HA 1YK9A 1EY0A 5CV9A 3WX8A 5D0HA 2D3OR 2KFYA 1NCLA 3QBCA 1QD1A 2HVEA 2DNEA 4DMZA 2Q2IA 1YHBA 1U0SA 2FFKB 1ZEQX 2B7BB 2G5DA 2F3WA 2CPXA 5BYQA 5KG7A 3HOUG 1DQAA 2RCNA 1Y1WH 2DHSA 4KTAA 1T03A 3OFEA 5L1LA 3L7UA 5T14A 2CQGA 1PH1A 3LP1B 2DGVA 2K4KA 1C7YA 1XNQL 3CF5Q 1RTZA 1TKTA 1CQVA 3GYGA 3BDOA 3IG1B 4X66J 4RMFA 4QMGA 4NLTA 3S1NB 3W9HA 1CG2A 4F3MA 2BRLA 4M1KA 2ZTEA 2KH9A 1SJ4P 3QGPA 3KMQA 4DV6L 2V4QA 3VWSA 3TS0A 2JZ5A 4LF4L 2OGUA 3BR8A 4ZP7A 4KHPL 4YCUA 5JVHQ 5F9LA 2ROGA 5AE2A 2P5VA 2KZZA 5J1EA 3NXWA 5M2UA 5CR3A 2PZWA 4LT6A 3MD1A 2RQKA 1QB5D 2DGSA 3OJSA 3SYZA 1WKJA 4LF5J 3MF5A 3CJ8A 5I6YA 1BNZA 2H1EA 2CJAA 1HD1A 3J7AF 4CO2A 3LPEA 3ONAB 3QT6A 5HO4A 4YHHF 1RBAA 5DQGA 3NBPA 4BY7B 3S01A 1SIWB 2RF2A 1W2BA 2K52A 2V8GA 1BHNA 2L4NA 4HN7A 4DV4J 1SYGA 4AD6A 4ME3A 1KD1C 5JVG3 3NNCA 2F4VF 3S8SA 1WG5A 3DMUA 5JPMC 4EYIB 3OSOA 1CC7A 1T9TA 1PIEA 4DV2Q 4I6WA 4KY5A 4ZLJA 2UU9L 4ZK7M 3P6YC 4M5DA 1ZM3A 4K0KF 4Z37A 2CQ3A 3J81c 2WV6D 3OPOA 1NSKL 3T53B 4RAUC 5E0OA 1XNQF 2YU9B 1S0MA 2LQ8A 4YB7A 1F2MA 4YY3L 1LOUA 2C9OA 2CHBD 1WTPA 1IKVB 5J3BA 3HRZC 1ENFA 1N56A 2PA3A 5IGFA 1SN8A 1TU2B 4LSNA 3P96A 1URNA 1K47A 4DV6F 3O6QA 3DLEB 3DN9A 2PMHA 2SOBA 3DXJC 1S1XA 1WJ9A 3D0HE 1X5PA 1HYSB 4CCHA 1W6KA 3OV7A 1WOPA 5F3ZA 1KQSA 4UOGA 4KIAA 4QYRA 1RCVD 3PR4A 4RCOA 4X65L 2QILA 2H3EB 4JOIA 4MIUA 1Y7PA 4X66Q 5IE8A 4OHZA 1N4LA 1L3SA 2R61A 2ES2A 3I4PA 2NREA 4NZ6A 2FHMA 4JV5J 1EQRA 3CC4S 2HZCA 4DN0A 1NJXA 2XGTA 2DPJA 4BXXH 4ICLB 4EZ9A 3J81U 1QSLA 3O44A 2H48B 1PH3A 1GTEA 2RD5C 2OFHX 3JSBA 3ND9A 1NXIA 2R7ZG 4CNYA 1URRA 3MOZA 3DLJA 3R5GA 2B43A 4H0LC 4JI5J 1ILQA 4LF5Q 3UD3P 2R7DA 2WSFC 1K83B 3OUYA 5KT6A 1J5EJ 1A8VA 1NCVA 3OYYA 3HOUH 3NUCA 3ENAA 2ZJQQ 3CD7A 3VAFA 2F4IA 4P7TA 1FJ7A 5KG5A 1VCTA 3FQKA 2WVDA 4JOUA 1B0PA 1D7QA 1VQLS 3UE0A 5J2PB 5D78A 3TZDA 4NEYA 1XJWB 3GTLB 2PW7A 3URYA 2O66A 4I69A 1N0VC 3V96A 2PC6A 2F1FA 2UU9F 1YJ9A 1I4PA 3QAUA 2D9UA 1VQJA 1IBKJ 2MSSA 4DR5J 8ATCB 1FWKA 3PUZA 4DV4Q 3NMRA 1LFPA 2Y1IA 5EAYA 1GXDC 2GGPA 1X54A 1M90T 2HBYB 1HKAA 4EVOA 1LW0A 4WPAA 4C3MA 1BQXA 5RUBA 4NLSA 1CA6A 1NSNS 4O4GA 4DG1A 2BA1A 2KJWA 4GS3A 4DV0Q 4OYIA 4U7UD 1GX5A 2B6AB 2E1PA 2H5JB 1STEA 3FPUB 1G3OA 1SXTA 5JMNA 1YKWA 1IW7C 3J7AV 3W8GA 2WSCC 2BJ8A 2IIHA 4Y6IA 4X65F 4NWBA 1X3EA 3H7HB 2EZVA 2V63A 3DU5A 4MFBA 5FD1A 3SCIE 4RZRA 3CSKA 2CQBA 4UOCA 4DPWA 4FS2A 3VHQA 4LVNP 1HTLD 4PXEA 1NK8A 3DDKA 5LXYA 3K59A 3H94A 1WCMG 2GQQA 4LF2A 1H9KA 4RHSA 3FCVA 2HWIA 2OI2A 2MKJA 2PFDA 1MN7A 1KXLA 3EZUA 3EQLC 5GAHC 4F8MA 1H6KX 4A3BH 2EWHA 1S4FA 3DWQA 1G2TA 2Q43A 4GLAC 2WB4A 3PDNA 4PQUB 4G1QA 3JSRA 3I4NG 5G0RB 1NR2A 3GD7A 3FHWA 2HQEA 1U2FA 4XQQA 3UDIA 4RW6B 2YY3A 4RW4B 2EXZA 4JV5Q 1OYDA 4RR5A 4DV3F 4OFZA 4DX6A 4Q0BB 1LQ9A 5C42B 4ES1A 2FJXA 4M8LA 4H02A 1AW7A 2B9WA 2IVMA 2EYPA 3MMAA 4ZPDA 1H95A 5KAKA 1N33L 2DR7A 4OI1A 4JK1C 4OXPA 5K14A 2NXUA 4QY7A 1V1QA 5K36H 4JI5Q 4HIMA 2F65A 2CQ0A 3MM8B 2AW0A 3B78A 5IXUA 1J5EQ 4CWBA 2OT2A 4ANEA 3PIPQ 1GM5A 4I64A 1FRMA 1YJRA 4YWMA 1SPBP 3C6UB 2HWHA 3HJVA 3OJUA 3OMGA 4FYDA 1Y0HA 4DX7A 1I50H 3OR2B 5FLMH 1GUWA 3AXMA 2A3JA 3J81j 3BGRB 3BGOP 3N4WA 4DCJB 2JA5B 4KY7A 4KC5A 4A3JH 5CZVA 4NMZA 4ED4A 7FDRA 2ASLA 4NLYA 2KM8C 1IBKQ 4DR5Q 1HBOB 1D3WA 1U09A 2NN6H 4A46A 1L0WA 2M70A 2F4VJ 3KMSA 1NJYA 3T9ZA 1V1OA 3PYGA 1HNIB 5IT9L 5FJ8G 2H1YA 1FJCA 2FLNA 1CSQA 4J9LA 4F3OA 2E2DC 4IQZA 2MHEA 3TARA 4OL7A 2OPRB 5HMXA 4CO1A 4K0KJ 2AJFE 1JK9B 1HBNA 5E5NA 4WWSA 1NZAA 4O44B 3KF8B 5B0CA 1HQ2A 2ICIA 3LA0A 3I7FA 1U1NA 1M8AA 1QNUA 3CC4A 3M8QA 6FDRA 2EJGC 4KAIA 4YP3A 2RQCA 3DLHA 1WG4A 4KN4C 3S14H 3U4VA 1EOTA 1JLGA 3M4OB 4EFAC 3MXNB 2IYGA 3OL9A 3S16B 4OI2A 2Z30B 3TO8A 5KFBA 2ZDPA 3G8SA 5T41A 4ZK9B 5KFUA 3V6KA 1HZBA 2CJQA 3S1RB 2IPOB 1N33F 2LFVA 4ZP9A 1OY9A 3PO4A 1G1XA 1Y3JA 4X3UA 3Q2TC 5A6PA 2KBNA 2D41A 2H51B 3OW2A 3GLJA 1G2SA 1KTQA 3Q22A 2MJNA 4JI7L 1Z1ZA 4I7AA 1HNWJ 5DJBA 2XWXA 2OPSB 5E1FA 4OI6A 4DX8H 3NGUA 2WONA 1B3AA 3CC7A 2C3PA 3GTPB 1V3SA 4B9MA 2KVIA 1X4CA 3H3VC 4K8RA 1ICWA 3W3SA 2YNFA 1YNND 2KI2A 3R2DJ 3MXUA 1S4EA 1WTBA 3TEHB 2HNYA 4D3HA 5EWGA 1FRLA 2B8PA 3OOCA 4ILLA 3I32A 1TS5A 4GVBA 1KNZA 1CJUB 4LF7F 2N8NA 3NELA 5GAGI 1FTRA 2NYHA 3D28A 3M8ZA 1KS2A 1WCMH 2K06A 2KECA 5C44B 2JEBI 4L72B 2NTSA 2F8EX 4DR2F 3K81C 5TSSA 3I4NH 1J5OB 1DTTA 1R6YA 4PABA 2UUCF 1PV4A 2GIRA 1EU3A 4L5TA 4BHQA 4HMJA 3TI0A 2F4VQ 5LT5A 2LYVA 4C8KA 2LXUA 1VBXA 1RZMA 4QQBX 2HNZA 3JQMA 4K50A 1TWFB 2I1RA 1NH8A 3L4BC 2R8KA 4QPTA 5CXTA 4A3DB 1LXJA 1T9UA 3FGVA 5J2MB 4DV5F 5I4DA 3NSWA 2Q8TA 4WFNQ 3NQTA 1N6QA 4P73A 4BY1G 2BM1A 4K0KQ 3AB9A 3TVKA 3A74A 4CT9A 2RDJA 4F2SA 2YQ3A 1NJWA 1QCBD 1UZHA 3U1MA 2XNQA 3BBCA 2EY1A 4M5NA 1CKMA 4TYBA 3VGUA 2J0XA 3ZXWA 3M2VB 1CJVB 4W4MA 4AQYJ 2P5ZX 5FLXc 2P9GA 2V94A 2WBMA 1LT3D 4PMBA 1ZETA 1YNJC 3E3XA 5DNFA 1D8YA 1SI9A 3BEGB 2EEYA 3BV8A 1JOKA 4U7UK 2KRBA 3JC66 3FBFA 2F0JA 2F0SA 4ZPWR 3FDSA 1Q16B 3I87A 2OIHA 4EQPA 1RA6A 2JA9A 4XT3B 1G91A 5EX0A 1FXLA 1OY8A 4DKAC 4X3SA 4ECQA 4XYQA 5KRUA 4YR0A 2ZJRA 4I6YA 4N76A 1O6XA 3DRSB 5KFRA 1MSHA 4QL5A 2I5JB 4IO1A 1PYTA 1K73C 1B9NA 1PH4A 2M8HA 2K1BA 4DV7L 1HNWQ 1S9GB 3RYLA 4JUZA 4DV3J 1JC7A 3PFEA 5C0XI 3KK2B 2YTXA 2LKZA 1S1VB 1FT8A 4NRUA 2VFTA 2K3KA 4WE1A 1PRTF 2A73B 1GHJA 1NO8A 2YNIB 2C35B 2MGZB 1HWJA 2F1MA 1S12A 3OLBA 2UVUA 1B3TA 5FLXU 1R43A 1QWYA 4WJ3M 4R4TA 4HR7B 3CCES 4WYWA 1SE2A 4XIGS 1WVLA 4NXNL 1UWBB 3DRRA 2A6EC 3ISNC 4A8KA 2YNHB 5KGUA 3T1HL 2WSEC 2EXDA 2CPJA 2MZ1A 4Y34A 2FXQA 2J5AA 2CPYA 4O0IA 1IKWA 3CDWA 4LRFA 2XB2D 4CP5A 1QJHA 3FC9A 2F9DA 2FZCB 2ZH2A 3GONA 4TRDA 2E5LF 2OTLA 3RBZA 2F40A 1X9NA 5IWAL 3SSRA 1VR6A 1STNA 4R25A 2B0GA 1UVKA 1Z7TA 2A6HC 2JK8A 1WWHA 2XCPA 3E01B 4LFCL 4MT1A 4C8OA 2HDLA 2PI2E 3KUHA 2FGOA 3PO2G 1FO1A 2KN4A 3QJLA 2CQ1A 1QNKA 4OX9L 5M9OA 5CYUA 1RWOB 2MQNA 3EZ5A 3AJ2A 3UI2A 2LEPA 1A3TA 1MU2B 1U2RA 4GOPA 2FIUA 1WTWA 1QVGR 3JSMB 2CFMA 2OHDA 1VQGA 2G0IA 1QILA 3SQOP 2D74B 1HNVA 3AFPA 3GFXA 1PFNA 3X1LB 2O5IC 1VK8A 4ECZA 3R6LB 2CYYA 3MM6B 5CYMB 1IKXA 5J2QA 3RLOA 2ZH9A 2K50A 1Q86C 2WVBA 3PR5B 2XHWA 2CJYB 1AZPA 5IOLA 4R4QA 4OQJA 4L5SA 1Y10A 2I07B 2D1CA 2Z4HA 4NLGA 3CJ3A 4X4OA 5ETRA 2B39A 3RBXA 1D5ZC 4JBMA 1VRTB 2L9DA 5IYDG 3FUYA 1RYSA 1RTDB 4DV3Q 2EFGA 1V6HA 4NKLA 4RWWA 2LS01 4BY1H 1C4QA 4LWCA 4PYDA 1EQ0A 1FF2A 2HIYA 3W2WB 4KD4A 1KD1T 1UJ4A 2ZDOA 4NXNF 2YWWA 1A2UA 4ITSA 4G7HC 2LQ9A 3T1HF 4BWGB 3RW7A 4QU6A 2M2LA 3HVRA 4DR7F 3DLLQ 3CULA 2V2ZA 2FHTA 2OWOA 1VQ6A 3FMWA 3I70A 1EWIA 4KJNA 3BVMA 3L95X 2BV3A 4OEMB 2JXMB 4JG2A 1E3PA 1KL9A 4J90A 1JXLA 4RGMA 2V2VA 3KJOA 2IDLA 1RT1B 4MNOA 1ESRA 2K04A 1R7IA 3NRBA 5E3RA 5IWAF 4JCVE 2YKAA 4K14A 2QA4A 1Q95G 4BY7G 2QN6B 3OHBA 5A0YB 3V4MA 2NUHA 4DR2J 3MUMP 2RILA 2DXEA 3FEXB 4LFCF 3CJRA 3QO2A 1NSPA 1K0TA 2JA8B 1TWHB 2UUAJ 4DPTA 3FFIB 2RJZA 4UAIA 4JI1L 2Q6CA 4LQ9A 2FJWA 3T13A 3ND8A 1IW7D 2DJWA 2O3DA 4NXMJ 1QE1A 1Q8KA 1NHKL 4DV5J 5M2PA 1HI8A 2YVSA 5C24A 2IJ0A 1RCOB 2EJFC 3BGFA 5F0WA 4ZUIA 5AJ3J 1KR4A 1UCNA 2HFVA 3GP7A 5KNDA 4FDFA 2F0GA 1VJQA 4J1MA 3JQKA 4NLVA 4X4SA 3CD0A 3NKYA 2WTFA 1T5EA 3LTOA 3MM9B 3CMAS 4V19J 2HNDA 1C0TB 4ZDNA 3M32A 4DQRA 2MQLA 3BPDA 3SSQA 2PA8D 2R93B 2QYCA 1CTMA 5DM73 2QL5B 4PR6A 4RKLA 4P2XA 2KENA 1ZBTA 3CB4A 4F4AA 3ZC4A 4H4MA 3GTKH 3WC0A 1SL1A 3F44A 5BN5A 3L3OC 4R0EA 4I2QB 1DZ5A 4A3MH 1NDPA 2DNLA 1KLMA 4IPHA 3LX0A 2B2WC 1WTQA 2XLKA 3NCPA 1S40A 2XSCA 1HNXF 3E8OA 2VOOA 4DFKA 3SZ2A 3CPFA 4Y7NB 1Z2LA 1TFWA 1XXGA 2BDNA 1HNZL 4U68A 3IP0A 5EKLA 2VD3A 1YWXA 1SE8A 3KJPA 4ZCLA 4DPXA 4JYAF 4EGLA 5C4ZA 4TQSA 3SV3A 4G7OC 1S6QA 1DOLA 2K3IA 1J8IA 1TL3B 1OWXA 3NCRA 1PILA 4LSLB 3N0VA 2DY9A 1KKHA 4A3LG 2MLXA 5B0AA 3JB9k 3K8AA 3H40A 2XY6A 2E2HB 3E9IA 1SMYD 4JB8B 4DUZJ 2VFVA 2MP1A 4JI1F 1SKUB 3W1BA 1M5HA 4OX8A 4LF7Q 1R31A 2OEOA 3A7LA 3BDEA 1VQNS 1HZ9A 1AB8A 2F0EA 2F3VA 4DR4L 1YHAA 3DWAA 3EICA 4EU0A 1W6JA 5KG3A 4R1JA 1KVIA 4DR2Q 1L0YB 1PZID 3I0RB 2EW9A 3CWJA 4C7QA 3EIVA 4ZJOA 1EHWA 2UUCQ 2L15A 4CH7A 2UUAQ 3GJTB 3PX4A 2N82B 4DQSA 1BCPC 3CHBD 3QR8A 2EI5A 4CLPA 2E5LJ 4POGA 1TKZA 5HVHA 3HOVG 3CXCR 4ZVTB 4UZBA 4NXMQ 1RT5B 4DV5Q 3QAEA 5IIFA 2DO0A 2F0FA 5IM0A 1ZYQA 1WTOA 2B56A 1SJRA 4F4WA 5AJ3Q 4A3GB 2EYJA 1FXDA 1R3NA 1CS4B 3IAM9 4P6QA 2O01C 3QO9B 1WC6A 2ZVSA 3FKIG 5KFPA 3IL8A 1X0PA 2UV8A 2CH4W 5HK4A 4OYOA 1NTGA 1UEAB 4FP5D 2XSFA 4TQUS 2ZZTA 4JI4J 1E1TA 2QYGA 2RQ4A 1NPPA 1FK9A 3STBC 1M0SA 3N5BA 2FQQB 3V4IA 4DNIA 1AROP 1HNZF 4BY7H 3UVJA 4RNOA 1C48A 3K80C 2OD4A 3KNAA 3G6ES 4AE5A 2IC3B 2EDGA 1XPRA 1JB0C 1W7WA 4C3HH 2EFPA 1TKDA 1CEZA 1BVSA 3KJVA 3JS9A 3S24A 2VBWA 2X51A 4J5OA 2D0OA 1SQGA 3RBEA 1YJUA 3UDCA 4EQNA 3R7NB 4PXCA 1S1TA 2GN5A 3FBEA 1W25A 4C11A 2AKWB 1HBUA 2IPKD 2DGTA 4CZCA 2F0LA 2FHKA 4PAAA 1LWEA 5F8HA 2DNPA 3T5HA 5A8WA 2W9BA 4DR4F 5M5XB 2YU9H 4ULLA 1OS5A 5IV4A 4DR7J 1KRTA 2HMIA 2EPIA 1KWMA 4BDPA 3CCSA 1CSPA 2ZXOA 1RXOB 4USMA 3HKWA 2AHOB 2JVRA 1TTHB 1PO6A 4DUZQ 2DPIA 5M5YB 4Y52H 2J9DA 2K5DA 2CJXB 1II3A 5B0BA 3D0FA 1XMQL 1CJTA 3GIKA 3HFVA 3HHLB 1UVJA 5EBCA 4BWJA 4M5LA 3HFZB 4DBQA 3CMAA 2RT3A 2JA5G 5CD4A 3D0GE 5IS2A 1JKHA 2LECA 2WFWA 1JT8A 3PYEA 1WOSA 1BBWA 4WFZA 1S9EA 1Q5VA 3ONQA 1RLDA 4I65A 3D1HA 2QLWA 5DDOC 3TP7A 4OYXA 2YWGA 4IUPA 2FY8A 2CKWA 2QGFB 1IWAA 3KLHA 3M2UB 2E5LQ 3S1MB 2MKKA 3MTJA 2V5HG 2KYZA 2Z2MA 1EIGA 2F0HA 1EYDA 2G0CA 4OLOA 5HQMA 3T41A 3MC0B 1TR5A 4PYAA 3T1AA 4YR2A 2PQEA 1QVCA 4NLDA 1JWWA 4TKOB 1MJCA 1EFID 4A3LH 2GA4B 4IPCA 3RGIA 4ELUA 1W2IA 4HJAA 5C4XB 2BRKA 4MYTA 1PH9A 1UEKA 3M8PB 2SNMA 1GKHA 3PIPA 3MAHA 4L6V3 4DXGA 1N36L 1F2GA 2F0TA 1CFMA 4K4YA 4ZLNA 1VF7A 2Z0SA 1JLBA 4JI4Q 1AFJA 2HCIA 3J81L 5CORA 4JOIC 3GTLH 2RCFA 3AMUA 2FJAB 2L9HA 3UDFA 3MR6A 4HJ8A 2HAIA 4IFYA 1DHMA 4NOHA 1WORA 3HT3A 1RWKB 2A1BA 2D0PA 3HOYH 4PWDA 4AQYL 2L12A 1K9MC 2Q2HA 1YIJS 3BVGA 4KKOB 1HNXJ 3FRYA 1U7LA 1OJ4A 2MZRA 2HHQA 3RZDH 4IUUA 1EY6A 4IH7A 4ZITA 2B2TC 4V190 3R5CA 2PE8A 3TAMA 4ZVRB 2CJ9A 3P20A 3D54A 4Q43A 1YBAA 1S5DD 2CQAA 4C3KA 4CLUA 1U4BA 3SK5A 1XMQF 5HMZA 1YNXA 3D1QA 3PX6A 1BQMB 1MJEA 2YV5A 4DR7Q 1ZOTA 1H98A 3WOEA 3MPVA 5KG1A 5AFWA 4C3LA 4C3JB 2A6ED 3HOXH 1UA0A 1O7YA 4IDKB 4ZHRB 3ZNJ1 2KU7A 1H9MA 2UXBL 4JV0A 3L3CA 2HBZB 3VZHA 3LWLA 3DNCA 4A3CG 1UUPA 1EZ8A 1FNOA 2CQPA 2ZKTA 1T05A 5KIXA 2Z6KA 2E5GA 3CDEA 3S17B 4TYAA 2EQSA 4Y3CA 3TZZA 3MEEB 1ZTTA 1MWZA 2Z56B 2F5GA 5C44G 1J2VA 4MAKA 1M5SA 1UETA 3HT0A 4CH0S 5C3WA 3TQ1A 3GQBA 1UAPA 3LNNA 4DLEA 1T9XA 1Q82T 1NEEA 1RGVA 5KFJA 3ZZZA 1DRZA 4O3RA 3BDPA 1RTNA 2A6HD 1O8BA 1TVXA 1N8RC 5CYQB 4AXIA 5KT7A 2YNGA 1N36F 3OR1A 3AB2B 1RTJB 2GO9A 1N5VA 2YBVA 3R3TA 2KHDA 5KTQA 5JPNC 2AUKA 1RHMB 4A3DG 2W9AA 2A5HA 1I94J 5C0XJ 1H72C 4ZVOB 2AYMA 2CVRA 1NSAA 3ET6B 2X1FA 3EZOA 2C22A 5JAVA 2MQ8A 3NAHA 1RT4B 4LIWA 3TP2A 1WEXA 2F8HA 3CCTA 4HSVA 2QJ3A 4EO6A 5EBDA 2CG8A 3ZZOA 2HEKA 2G9DA 4LJMA 2DHAA 4A3FB 1FESA 1ONLA 3SGIA 4ILWA 2MQQA 1YITS 4P2MA 1SNOA 4ED5A 3C6TB 4A8SA 3CC2A 1IWGA 4I7FB 4DV1L 1PAEX 3MD3A 1F3FA 1RTIB 2OH2A 1UE6A 1HNXQ 1L1OB 5L46A 3DXBA 3ITHA 3M30A 5I2XA 1VQPS 4HDGA 2RH3A 1AXQA 2X1GA 1I4RA 4GO7X 3VVTA 2R3ZA 2MHVA 4RW7A 4N56A 4OJGA 2HPUA 1EU4A 1VIOA 1HLWA 1GUSA 4ETXA 3VGVA 4LQ3A 2F0MA 1PH6A 5CD4H 3TX8A 3DOLA 2V4DA 3KJNB 3GFHA 1FHTA 2QKIC 2ROPA 2J0TD 4C2MA 1B99A 3KLEA 3CNQP 2GIFA 2XO7A 1FFGB 2YKNB 5FOBB 2BKNA 2HQIA 3MPYA 4R0JA 4I56A 4IFVB 3TP8A 1RDPD 4OIKA 1DURA 2RIJA 4Z9CB 2VUGA 5D14A 4MTKA 4IYQA 2B8FA 2DR6A 3TNVA 2K1RA 6FD1A 4IOCQ 5DG8A 3J7Z5 4JI2L 5BR8L 3KLWA 2XI3A 3ISZA 2DRDA 1PYWD 4QWBA 2Z58B 3IWLA 2C2MB 4CDEC 2B2VA 2HVZA 4MKVA 1FR3A 1S6OA 1TV6B 3FZBA 1JLCB 1X3GA 1UEVA 3M7VA 3ILLA 2N55A 1PCAA 1TFYA 1N34L 3OTCA 1HXYD 1TKXB 4PKDB 1I94Q 1WELA 2JA6B 1WSVA 2N4CA 5GROA 1PHJA 3ULLA 3OTOL 2FLOA 1EJ7L 3CCLA 2LU2A 3W60A 2AJ2A 3E9HA 1A6XA 2M4MA 4S0MA 2XSJB 2Z8LA 5H9FJ 3WIUA 3ELHA 4GN5A 3CXCA 3UO0A 1K8OA 2VPZB 1CKNA 4IG3A 3I56S 4ZPTR 2VL6A 3S6EA 3H3VI 2I0XA 1HW8A 1WTRA 3OWEB 3IBWA 1Q7LB 2DY1A 1AZQA 2WKDA 1NNXA 5LOQA 4R4IA 3VGTA 1LFWA 3NK9A 4DL4A 4DSEA 1IBML 1K0SA 4OO1H 4N9PA 2MYFA 3S1QB 4IFDJ 1VK3A 1TK5A 4K4TA 2E2JH 3SV4A 2BABA 4KO0A 2L9NA 1WG1A 2IRUA 4A3DH 2XG8A 2QC3A 3LAMA 2L55A 5LXRA 4JPBW 2WAQB 5KFCA 1SC3B 2ATCB 2HVHA 1KNEA 1EOVA 2AWOA 2FTRA 4G3IA 1S3OA 3UCZP 5BR8F 2GHPA 4USWA 2X7IA 1ZTWA 1KABA 4DI6A 2MKYA 4DOZA 2COLA 3PRDA 2QFIA 1C0UB 3CMES 3PF5A 1EY5A 4JBKA 4OYAA 3G86A 1V3ZA 3G82A 2ILZA 1RT6A 2AZ3A 4X62J 3BQ1A 2L11A 3CCUA 3TBIB 1SFOB 1BKBA 5GQOA 3IRXB 3E6ZX 1BCPD 2ZZNA 4KH1B 4DN9A 2FVQA 2R6GA 4O1NA 4HEA9 2KT2A 1FKPA 3C16A 3D4DA 1X5TA 1SUQA 5HAOA 3OTOF 2EE1A 1SV5A 2F0UA 2V68A 5D4OA 2JA8G 4U6PA 1TL4A 2UUWA 3GG1A 4KJOA 4FS1A 2QA1A 2MY7A 1GQEA 1QDUB 2G13A 3PY8A 3DOKA 4OHYA 1XTZA 1S9FA 4A8MP 5A8RA 3PUXA 2MKCA 2WRMA 1X60A 4I2QA 1IXRA 3LP0B 4YDXA 1HR0J 3DLLA 5CV6A 2ADCA 4O23A 2GAHC 2BYCA 1AFPA 1RWNB 3KFWX 4A93G 4Q2LA 1ZA2B 5I3UA 3SQGA 4LF8L 2LP4A 5KT2A 3HFKA 1IYUA 1SYFA 2RDDA 3FMBA 4HTJA 3CDAA 3MECB 1ASZA 1X0FA 1XTDA 2RSQA 4K5XA 1SJHD 4OONA 4ECYA 3LF0A 3W2VB 4WBFA 2E1MC 4OZNA 2RQMA 3CCVA 4LF6L 3KLIB 3VAJA 5FLXL 5J2NA 3TZXA 3PZPA 1IR1A 4C8MA 5T7LA 2V50A 4O3NA 3A4TA 3HSJA 4BWMA 1VHFA 4DAYB 5KYIA 5HBMA 1HL6A 1RT3B 3JTOA 5I3QA 2KHCA 3NP8A 1PFSA 2UVVA 3GO5A 2VS1A 4F67A 4HKQA 5CV5A 4ZIVA 4FKYA 2M00A 3WC2A 3BZQA 4X4VA 1I4HA 4RBTA 2PN6A 2W9CA 2YKMB 1SL2A 2CRLA 3IS9B 1R8PA 2OF1A 4TNOA 5HATA 3TS2A 4F88A 1D9DA 4WTOB 4PG6A 1VC6A 2AQ3B 4OIJA 2LEBA 4DFMA 2ZD1A 5D15A 3SBMA 1QZGA 2N4DA 3SDEB 3R5BA 2L9WA 1JE5A 3R2TA 5CC4A 4X62Q 2MLYA 3Q89A 1NSQA 1EQMA 2EBGA 1PKUA 4ZVSB 1PA6A 1GXUA 2FC9A 2D2CC 1Q81C 4EBDA 1JLFB 1EZZB 1ZPVA 3I8ZA 3CKIB 1JLAB 2AEFA 4GLXA 4PG3A 1FTCA 1QZHA 2HHSA 1V1PA 1IQTA 3AT1B 2J8AA 5DDPC 4F4ZA 4IALA 3G4SS 2WOMB 4B3OB 1RAFB 1OYEA 3DEPA 2D3ZA 1YSJA 4CKBA 5IP7G 2YX4A 1ZAWA 2M7SA 5KFXA 2E9TA 2CA9A 2N7CA 1LK7A 5FDLB 5IQQA 2C2EA 3POTB 1STGA 1K1QA 3SK6A 1V43A 3BGUA 3MEHA 3VA5A 2E44A 1MW7A 3PCOB 3S2DH 3RB3A 4LF6F 5ETKA 2HHHJ 4NPSA 4CQ1A 3PMFA 1T9WA 5J39A 1NMEB 3GTMB 5IC4B 3KHHA 1TT2A 3SEBA 4EBEA 4G6VB 4ZCIA 3MZ5A 2ZT9C 2H4YB 4G1PA 2BANA 3BGLA 3P4UB 5JXSA 2CJKA 2LKVA 3HZEA 1D9FA 2Y8WA 1L0XB 4I2PA 1UVNA 4GNXA 3ENQA 1TKWB 2BCOA 1YTYA 2JEAI 3CMEA 1SNQA 3H2VE 1TWHH 3WHIA 1MD2D 2DGYA 2BDPA 5IP9G 4OI4A 2VG7A 4IG0A 1BWVA 3GIMA 2IVFB 3AOBA 3LWUA 3R5JB 3LGMA 3CCRA 3GJRB 1SC4B 2PW5A 2OELA 1MMLA 3T19A 2GQ2A 4LBPA 4MK7A 1QSYA 2D9OA 4YCWA 1ULRA 1KLGD 1NKBA 4LFAF 5C5MA 3MEGB 4DFAA 4PCQA 4LF1A 1BQNA 4ED7A 1IBCB 2JSXA 1XWLA 3W3AA 3TAQA 4GLVB 3OFGA 2B5JA 2B63H 4A76A 2RBMA 2HIQA 3DLGB 4B9UA 3B4MA 3I4HX 3IO1A 5A8KA 5IT0A 2QG9B 5HI7A 4OHWA 4PQXA 4NDXA 3OD2A 2R93H 3M2RA 3BQ2A 1KC8C 1ZS6A 4ES3A 1BDOA 4RGNA 1HBMB 1H2TZ 3H0GB 4JI6F 1NAQA 2MKIA 2N49A 3SFUA 5KFFA 1KBRA 3S15B 5EGYA 3KDFB 1L5UA 3LP2B 1F5BA 3OHXC 2RKIA 1B2TA 3MDFA 1XTCD 4YS2A 3DGVA 3MAQA 1E6YA 2KEEA 4PG5A 1VDZA 3MMBB 5A76A 2NXJA 2ASYA 4A3KB 5JJBA 5GADI 4DUYL 4ED6A 2V9KA 1Q0NA 4OWXB 1UVIA 4C0OC 3F2DA 3GYNA 1VQ8S 3W9IA 3NOGA 3MR5A 1R0BG 2WIIB 4MZ9A 2AWZA 4W92B 2KYXA 2O67A 2UXCJ 2QLXA 1GMWD 2QE5A 3ENWA 1P9QC 1CBKA 3HMJG 4V1Ak 2HHHQ 3GTYX 5IGGA 1FDAA 3DGPB 5C4XG 5DS7A 1S72S 3DLKB 1CQFA 2VU5A 3MEDB 5EWEA 4HACA 4M5HA 2BJDA 4QWEA 1SYBA 5HVGA 2UUBL 1JQYD 2CDRB 3GTQB 3MM7A 1RJJA 1U6BA 1YI2A 2KG1A 4WXWA 1UAWA 4MIAA 2QT7A 3PW5A 3I4MH 1S1WB 3TX0A 1ZPWX 1QLNA 4JP8A 1Y11A 4RBUA 1JJ2A 2PMZD 2C5CA 3KLGA 2VB3X 5KFEA 3DFEA 5DG9A 4DR3J 2A0FB 2XI2A 1WEZA 1QUPA 1RTOA 1ZM2A 3PUWA 4W98A 1KOOA 3IGNA 3EPGA 1XIQA 5HMYA 3AYHB 2G1DA 2ZBPA 4ZAIA 3HD2A 3C15B 1I3QB 3NWTA 4A3GH 1H2UX 3DRYA 4ES2A 3VAIA 1VQMS 1B53A 3G4SA 3DI6B 3PW4A 3CJ2A 2I2YA 1RL2A 2OQ0A 4CKEA 3OTDA 2PI4A 1YEZA 3WQPA 1RBOB 4HCEA 2BJ3A 2AJQA 3RJMB 4C3JG 4QIWD 1C1BA 3HLUA 3OLAA 3A1YG 1DTQA 3GFYA 3FMCA 3OSNA 3N52A 3CD5A 4DUYF 4XAKA 1BUXA 4OZ1A 5C3EB 3IM8A 1ZXTA 5DLFA 1X56A 4YQWA 2HRYA 2F0PA 3V2TA 1JLQA 1AUDA 4ELVA 4OIXA 2VUMH 4WRDA 2GS8A 3AEVA 1HMVA 4KGVB 3HX9A 4CHTB 1E1OA 2W2QP 2EG2A 2KO1A 3PW7A 4JVZA 2JNJA 1O78A 1B0VA 2WB1B 1WSRA 3QYYA 4WFXA 2HVIA 1PGZA 5KFAA 2IHFA 2UUBF 5D0RA 3GCWP 2UXCQ 2ZHAA 4Y28C 2R2TA 1DBDA 1GOZA 3D4RA 3NBHA 2NQPA 4B08A 1PBAA 3BVZA 2OPQA 1H38A 4C6AA 4R8NA 4O0NA 5DAUA 2RE1A 1S97A 1I6JA 3QIPA 3TN2A 3RR5A 1A9NB 5IYCH 1BD6A 2EVBA 3ZYYX 1OXSC 2V8HA 1RABB 3VAHA 3H59A 1N52B 5K8PA 4R8UA 1XMBA 1D0EA 3BO2A 1TS2A 2CQIA 4BBYA 2VC0A 3N01A 5THWA 5B7WA 1C1CB 2ZH5A 2ZH3A 1DM0B 1FDDA 2OTJS 4A3FG 4KGKA 4C3IB 1HIYA 1XNRJ 5MAOA 4DZ6A 4CLLA 3FBCA 2ZFHA 2D62A 2I5HA 1EETA 2GMLA 2I46A 3M1VB 2HS3A 2WAQE 1IM6A 3MPUB 1R9TH 4MHEA 5EUHA 4OJ1A 1NHUA 2A6MA 3MUTP 2J7UA 3K2YA 3VCDA 3P3DA 3H6MA 4FXVA 1Q3LA 5D6GA 3R3OA 3MUVP 3I31A 1R0AB 4KFBB 2GVDB 3D3BJ 4RUCA 4X4NA 4LUVA 2VW9A 3MMCA 2R7TA 1EY9A 3D7SB 2F0VA 1C8CA 4B3MJ 3F41A 4C98A 2NPIA 1IKLA 1G8ZD 1OQ6A 3BN7A 2PZTA 2R3VA 1I5FA 1HPZA 5HN0A 2M52A 1FKOB 2H54B 5DQIA 5DRKA 3R1HA 5CYJA 4LF9L 3H09A 1EUJA 2DK2A 4M95A 4JI6J 4CTAA 2HFNA 3CIZA 4Y2KA 3DYAA 2VQEL 1S72A 1S1UB 2F0IA 1Y9OA 4H4KA 2Z0GA 3ERSX 2U2FA 2SDFA 2EC0A 2IJFA 2AP6A 3ZFVA 2CUYA 1OO9B 1GUGA 2AIRB 3ETMA 4FPIA 1IJEB 2OPPB 2QMXA 4CDDC 4B3RL 3CJKA 2D69A 1E7ZA 4G57A 3KYHC 4RL1A 1LNQA 5F2DA 4F50A 5HROB 1BF4A 3BSCA 3GP9A 1TWAB 2W2NP 5C25B 4IR1A 5HVFA 4XPEA 4A4JA 1KLUD 2WK4A 2CQDA 4HEDA 1BBXC 1EP4A 2AMCB 3BU2A 1TS4A 3KF6B 2JEIA 1HZCA 2K5HA 1G6PA 4QJVA 3HHDA 5HP1B 2JSOA 1NBWA 4DF4A 3PVXA 3NGTA 1W2BR 3J80Y 1RISA 3A8KA 3S17H 1I5OB 3T6BA 2C28A 2O1PA 1HR0L 2CCZA 4DL3A 4YR3A 1YJNS 3N6NA 3HHKA 3DEOA 1RTHA 2GMJA 4IPGA 4WXOA 2XS5A 4DQIA 1S5BD 1U1PA 3IR7B 2CWPA 1GTHA 4DL0C 1EARA 1XNRQ 4DCOB 3QRPA 5C2CA 1A3VA 2OKQA 3RRHA 5D3GB 5K5MA 2VQFL 2CZ9A 1YJ7A 1RDRA 1KEKA 1R6VA 2FHOB 4QYZJ 4EYHB 2AYGA 4B3SJ 3THVA 1EZ6A 4S3SA 4KKSA 1M5OC 2NXNA 3KFUA 2R7SA 3A8IE 1U0HA 2HHPA 2XWBB 1N5TA 2UXDL 2V4RA 2EBEA 2CKZB 2F8MA 3H5YA 3FEWX 3C3LA 4LF9F 3CEDA 3KLRA 4LFAQ 3V2UC 5M3MH 4YIJA 1R8BA 2V8DA 2WAQG 3CO0P 3C14A 2VQEF 2PMZB 1FJGJ 2VFSA 4P2FA 3A8JE 2IM1A 4WK1A 2CNLB 2L08A 4B3MQ 1SL0A 2H65B 1HFEL 2ZNYA 2QMWA 3JYTA 3S1TA 3KXDA 4NMXA 3CT9A 4FPRA 5HLFB 2VB2X 4RNFA 4B3RF 1X3QA 2E66A 4FVMA 3OL6A 4HJ9A 4EO8A 1XYIA 4JI6Q 4A3FH 1B4SA 3KKFA 2KEDA 3EJIA 1DD2A 1K8AT 2CQ4A 4QUCA 1VFJA 2VG6B 3GV6A 2V34A 1S6PA 4KD3A 2XRQD 4DHVA 4Q8FA 2LFNA 2J76E 4RWXA 4F3QA 2ZM6L 3IBFB 3TJAA 4NI2B 2IAJB 4CDFC 3QGGA 2KHIA 5C4JB 1HCZA 3UD4P 4FF4A 4B3TL 2F9JA 4ATNA 2DD8S 1O7ZA 1N5SA 5GAEU 3TA2A 1G291 4FDBA 1A0IA 4B9XA 3ULHA 2JEGA 3GDEA 4E98A 2E5JA 4XYOA 2R7VA 2LXKA 2VQFF 4A3IH 2ALZA 4RW8A 5FIIA 3MOJB 3Q0AA 5D4LA 1ET9A 3MMJA 4KV8B 2VG5A 1X7VA 1FNXH 3R5AA 2DYAA 3C1EA 5ELCA 3ZZPA 2R92B 3A8IA 3AQQA 5I42B 2CH4A 4H54A 4NLUA 1LWCA 2UXDF 2DNHA 4K2JA 1DQ9A 2KHJA 2ZE2A 3SVMA 2LA6A 1JNRB 1V9OA 1UKUA 1E6VA 4X64J 3TVYA 2DR9A 5LHY1 4U67Q 4GZYC 1YJTA 2V4JA 4F87A 2G2YA 2RU9A 2VY3A 2BKOA 4B3SQ 3MFYA 1WDDA 3FK4A 4NA1A 3OXFA 2IT1A 3CQZB 1TL7B 1ZAVA 3Q8UA 2RVJA 4ECRA 3P5BP 2MQHA 2WKCA 2YKPA 4OZ2A 1WI5A 1VQHA 4KSEB 3D3RA 2NZCA 4DSFA 2JA6H 4DK6C 3GTOB 3AU7A 4LBHA 5EDWA 3K0JA 3RB0A 2DH7A 2MQPA 1FJGQ 1AZSA 1RHPA 1A3UA 4LRAA 4CYUA 1GHKA 2JA7B 3G48A 2VFRA 1U47A 2JEJA 3KLFB 4FBUA 3RAQA 2O4XA 1NPRA 1B9MA 1DYQA 5J1NA 3HOZH 1TZ0A 1V9PA 2GX8A 3U1NA 1DLOA 1TL1A 4HHUA 4YMEA 2ZM6F 3GIIA 5KNBA 1CLFA 3K7AH 2B2VC 3Q8PB 4U95A 1S5ED 5H1SV 4B3TF 1HHQA 3EUNA 1P1LA 1RAEB 2LDIA 2NTTA 3DRPB 3OXLA 2DTJA 1FRJA 4P72A 1ZYRC 5IZHA 4KHVA 2UZAA 1BUVT 2ATLA 2IX1A 1I6HH 1Q5YA 1XN9A 3AD7C 3O5TB 4PG8A 2KTQA 1YJNA 1WKKA 2JYOA 4RGTA 3L2PA 1OXUA 3FCHA 2XIWA 4ZIWA 5GMEA 5IGDA 1Q8BA 1SXLA 2CQHA 2V9WA 3PO5A 3OIQA 1HWUA 1S49A 3IAS9 3GU0A 3P45B 5FK9C 1VQKA 4OYWA 1NRKA 5A6WA 3ICLA 3A8EA 3B6BA 2BXJA 1PC5A 2BH8A 1OPZA 4DXFA 1WOOA 3HZXA 1KQKA 1N32L 2IM0A 1SJED 2HUGA 2WBRA 3AY0A 4GKJL 3DMJA 2B2WA 2PQAB 2YQ1A 3NLCA 4X3KA 4PZ7A 4CBVA 5ELOA 3ICEA 4GKKL 1CPZA 1ROFA 4NCGA 4X4UA 3H5SA 2JEFA 5IYBG 3R7SB 4XT1B 2RS2A 2EFVA 4A48A 3PO3H 1Z9FA 5C0XH 2A6OA 5ADZA 4N8X1 1VBYA 1S99A 1V5VA 2KCMA 1Z6HA 4X64Q 2DKOB 2W8LA 2PMWA 4RX6A 1YNNC 3E51A 1TWCB 1KC8T 5NUCA 3HEJA 1RWXB 3I73A 4L76A 5IY0A 3EWGA 1T5XD 4J7CA 2R7WA 4A8WA 3QGIA 4ECSA 3ERQA 4JI8J 1HWKA 2VBYA 3G6XA 5EN1A 4DR3L 3LP2A 1QUQB 2KXFA 1KQGB 4EUVA 2PGCA 2PI5A 3KK1A 1TWGH 1F2HA 1LK5A 3V81A 4FF1A 1LTBD 4ZMMA 3M4PA 3H5XA 3DC2A 3D6CA 4URGA 2QDBA 3NTKA 1J6QA 2VKZG 5LM7E 1EL0A 1CULA 3KUGA 2DT9A 3GV7B 3T3FA 1LWFB 3RRKA 2DR5A 1K3RA 3PO2B 2CPZA 4ID5B 3F73A 3P75A 3AOAA 3MPDA 2MKSA 3DM2B 4Y2AA 1NMFA 1VQ5S 2NSBA 1Y5IB 2BJ7A 3H0GG 3N6MA 1NDKA 4DDFA 2VBZA 1YGYA 4ED0A 2HSEB 3OW2R 4HIOA 3I6PA 3H42A 2EPBA 1EYCA 4URSA 5E3AA 5DM63 1BY9A 3JTPA 1U26A 1N5YB 1LV9A 1LW2B 3ENVA 2NVQB 3VALA 4OGQC 1N32F 2QEXS 5IQ6A 5IFMA 4XDDA 4A3KG 5T1IA 1SYCA 1M1GA 3I90A 2DNOA 4BBSH 4GKKF 5EHHA 2M0GB 2EKYA 2ZWPA 1R0CB 2K01A 3TP6A 1EQTA 1Q90A 3TZWA 1DCZA 1OPIA 3WOFA 2OMLA 1I6VC 4Z7YA 1FA0A 3S7RA 1FJEB 3ZTSA 2A1AA 5KFWA 1NK7A 3QWNA 3M6WA 1TVRA 1EY8A 4NA3A 3FJ2A 3UWTA 3OPKA 5HQLA 2G9OA 4AIMA 4PQAA 1FL0A 3KG4A 3KUEA 3HPOA 1WHYA 2J9EA 4OYPA 2RUSA 3PJXA 4NYPA 1Y1WB 1U6FA 2ATWA 2XZTB 1XMOJ 1HA1A 1SH3A 1B7FA 1A6LA 1RT2B 1S0OA 3IM9A 4DK0A 3TP5A 4FN5A 2EFQA 2E5IA 1TUWA 1JMCA 2JLFA 3TA0A 3CPWA 3M05A 1SSOA 4LFBJ 4JI8Q 3K58A 4OYZA 2AUJD 2DNKA 2EYLA 3GTMH 2ILYA 2E7VA 5F41A 2XLIA 3UN3A 4DU9A 2H9ZA 3C2PA 3KJQB 1N48A 2BEFA 4IFDH 4DV0J 5E4XA 1X9WA 3M4XA 4P2CB 5IYBH 1IQZA 3C1FA 5A2QE 2MTLA 2P6SA 3D3CJ 3MPWA 4JI0L 4WJWA 3C46A 1LT5D 2B2YC 4ZJLA 4YFUA 5C3EG 2QL9B 3TRGA 4KTQA 2ZBQA 2IA0A 3B8HA 5B0FA 4HTIA 2EVZA 3CJQA 3T1YJ 2I6WA 1JLEB 1U24A 2KRRA 1IBLL 3HULA 3OMCA 5KG4A 2H5XA 5E33A 3NPPA 4V0BA 4NYOA 4LF4F 4KHPF 5KEEA 1WHWA 3D9BA 2K03A 3E5SA 4EEYA 3IFTA 1Y00A 2WB1G 4P71A 1LM0A 1KFSA 3BJUA 4LR7A 2L3MA 3P8BB 3MM5A 4RNHA 5KFMA 4CLTA 3PRBA 3QIAA 4IRCA 1U1QA 4CJ2C 2IFXA 4DR1L 3W8PA 3HVTA 1DONA 3KOJA 2OFGX 3SHLA 4OX6A 4GNXC 4MK8A 3IA0A 1CZWA 1AP0A 1KONA 3BH7B 3WZ0A 4AUKA 1UFKA 3MAAA 1JQGA 3R8BA 1JR0D 2E74C 3CCJA 1T9HA 2ASDA 2B2TA 2X3DA 2ZHOA 1U1KA 3O1LA 4IH6A 4ED3A 1B64A 4J9PA 2VA3A 4V19X 3IKJA 1REVB 2C2RA 1F9FA 3HHLC 1XC9A 3SI8A 1RADB 2ENBA 4C3IG 4J6HA 2OO4A 5H9EJ 4YWKA 1WF2A 1MGSA 2P8IA 1XMOQ 2W2OP 3K5NA 1L3UA 1UW9A 3M9MB 3KK3B 2GJ2A 3ZJYC 3UD5A 1G7CB 3MZIA 1A62A 2QIFA 4UY8T 1F2ZA 4PXBA 2NUCA 2GZOA 2V69A 4F8RA 4E2FB 3RTVA 4CDIA 4KHZA 1NDLA 5EJWA 4JI0F 2PMZE 4LFBQ 1B44D 2KOLA 2KZMA 3GTGB 3VAMA 3KHLA 4IO9Q 2WW8A 2ZBRA 4YY3F 1H74A 3RW6A 2DNMA 3I0SA 3HOVB 1PJ6A 4K2LA 1MROB 1IBLF 2E29A 1EQQA 1IM4A 2DY8A 4JI3L 2K75A 3IMQJ 2BE9B 4H13C 4FYWB 2K5VA 2LMIA 4PUOA 2W1BA 2VFUA 4K4WA 1YHQS 2VZ9A 5KFNA 3FKIB 3U9OA 4C1NK 1LTRD 5L1KA 1PYOB 3N79A 1H7XA 3BSAA 3QOJA 1FE4A 1VRUA 4QIWE 2HVDA 5LL6d 1QAJA 3T1YQ 4KB7A 4KY3A 3HO1A 3V6DB 4Q7AA 3L09A 1SR3A 4I7ZC 2MQMA 2F0KA 4FF2A 4B9VA 1SKWA 2R7FA 5LMNL 5G3LF 3DOMA 4KN7C 3PIO3 1HW9A 2K7KA 2NZ4A 4ODGA 2N3LA 3A3OB 4IUNA 1EEFD 1RK8A 1K8GA 1STBA 4F0KA 4NLXA 2BE2A 2IY5B 1MSGA 1FVQA 3MCMA 1GJXA 3RR8A 3FRPB 2F7VA 2FLPA 3NTHA 3I9ZA 4G1IA 4X4TA 3GTJB 2XVSA 1X4BA 3ILIA 1T03B 5DZ7A 4TY8A 4F4YA 4ZA1A 3LGNA 2NR0A 2Y0SB 3W64A 2VPXB 5CBAE 1D6EC 3VR3A 2MXYA 1M5PC 1TKTB 3K5MA 1TIID 1QJOA 3PIOA 3N5FA 3QSIA 3EGZA 4HR2A 3KJFB 4ZVUB 4F0MA 1S0VA 3OL7A 5JVGQ 4J9NA 3FZ2A 1YG0A 5F8MA 3N6RA 4Q0FA 4DR6L 4N77A 2XMUA 8RUCA 1O7LA 1WEYA 1DAXA 2G1HA 4YHHJ 4DAMA 1KVKA 2LXJA 4H4OA 4JI3F 2Z2ZA 4RH6A 1U1MA 4B9SA 5J1EB 3UQSA 1SMYC 4BS9A 3L0OA 2B51A 1UTAA 1IL8A 4A3BB 1JORA 2F3IA 1ACMB 1LWXA 1NDCA 1O80A 2IBOA 1JXVA 1U1RA 1B0TA 2ZH6A 1NJZA 3HKZB 4HJ5A 5BYRA 5ETTA 2B4UA 1E22A 3BKTA 1CVJA 1ZZNA 1HA5A 1PDQA 3NBPB 1J9OA 4L75A 2R7ZH 2RF2B 2DBBA 2KXHA 1ZYRD 4M5KA 5LMNF 2EYHA 1H2VZ 1VS3A 2E7WA 5LMUL 1NKEA 3HSZA 1UVLA 4L74A 1NB2A 1N9WA 1XNQJ 3PM9A 1TK8A 5AT1B 3AODA 3VVUA 2FD2A 3RZOH 4R5PA 2BM0A 4XIUA 3D68A 5AE1A 4RW9A 3R5DA 2E1AA 4DV6J 4L5RC 3EN2A 4CM0A 2GFFA 4Y00A 2F52A 4LF4J 1UP1A 4A3JB 1KOHA 3RN5A 1PSDA 4M5DB 3G71S 4NW2A 1SNCA 2BJ1A 1U4PA 2JN4A 1PVOA 3M85A 1L1OC 2HK3A 2GJIA 5GAEI 3G9CA 5HY6A 4FNIA 3NGKA 5KFKA 4E0DA 2AJ4A 3AOCA 1VQLA 1VC0A 4KI0A 4ME5A 2M5YA 2R7RA 1HI1A 2AJ0A 3L7ZC 2JRSA 1RAOA 4HHJA 4LSNB 1V3RA 5HURA 3R9LA 5KFOA 1S1XB 4DR6F 4ZVGA 1Y4ZB 3EYZA 4ANCA 2QTWA 3ZZRA 1RA7A 3JSYA 4OHVA 1N54B 2ICEC 2R92G 2XC9A 1RWMB 1UMJA 3P5TL 3S14B 1EB0A 1UNSA 2G2OA 4P10A 3UN2A 2PIIA 2CDQA 2BH2A 1YHQA 2V67A 2WW4A 1Q79A 4IQMA 2YYZA 4YHHQ 4X4RA 2VZAA 4TU8A 5J22A 4LREA 5HQ8A 4I68A 2UU9J 5CV7A 1UE5A 2K7VA 5KFGA 1TWAH 5LMUF 4NASA 4WIIA 4DEZA 4XXEA 2RRBA 2AV5A 3K8WA 1LT6D 2MO0A 3OUYB 4IJLA 2XMJA 4YY3J 1FD7D 1MMDA 3VYRA 1Q46A 4XDXA 1D09B 1RQ0A 2HZVA 1H9SA 1PAUB 4BBRB 1UE7A 5GAGC 1WDTA 2R8HA 1UEBA 2JA7G 2FZGB 1FERA 4H4KC 3TQYA 4O42A 1CJKA 3I55S 3I4LA 4MKYA 3KLVA 4QR1A 3TREA 4M63A 2HFUA 3HSDA 1PTOF 1XNQQ 4X65J 3JTNA 2GGPB 4RUBA 4MYUA 4DV2L 5GAHU 1S6UA 4P74A 5DETA 1E2ZA 3ITPA 3M3YH 1TUGB 1LW0B 2IM3A 4IQXA 2DJFC 4DV6Q 3D6WA 4JI7F 2KB2A 1Q82C 1C0AA 1JCKB 2C42A 5U47A 4QQBA 1YRXA 4O4GB 4DG1B 4LF4Q 2XGPA 3QLHA 2RU3A 2LMCB 4KHPQ 3BKFA 1DGSA 2H5EA 5CV8A 1XBWA 4WCEQ 1RT7A 4QIGA 1A63A 2AYBA 2DIUA 4WP3A 4OELB 2AJ1A 3CRKC 4N41A 3NP5A 1JNZB 3M6XA 2B9YA 5JJZA 3OVBA 3HXMA 2EK1A 5FJ8H 2NXCA 2XYHB 1SNPA 1E2WA 4CJ1B 1O7IA 3KNGA 4MFBB 2DNNA 2YKOA 2JLEA 1JMTA 2XO6A 2H4WB 1ITPA 1HQEA 3DHWC 2ZHBA 1RUSA 2NYIA 2YKQA 4OO1I 4X66L 1CA5A 1QUQA 2BOPA 4C56C 1ML0D 1IL2A 4G1QB 2NB0A 4YN3B 4PZVA 1YJWS 2FPHX 5I2YA 3LALA 1X5SA 1F9EB 1J27A 2GVZA 3TUJC 1WF0A 3U02A 1OTCA 2HG4A 2EYMA 1D9AA 5KFTA 2P9EA 3WX4A 4J9QA 3QT5A 4B9WA 1X8DA 1RWWB 2FMCA 4LF5L 2JOQA 3MMAB 2UU9Q 5EKIA 1F9QA 5JEAG 1DZ1A 2AT1B 5L37A 3B6YA 5K14B 2BACA 5KFVA 3T6JA 4OHXA 2GIQA 2ROEA 1KRSA 4RU9A 3T9NA 4HT7A 4YY3Q 3CCQS 2XRSD 1FNWA 4CKCA 2CIMA 2NVTB 2YWEA 4DV4L 2L48A 3LP1A 1VQYA 4LUOA 1TS3A 1Y14B 1RAJA 2NVYB 3IG1A 2DJGC 1Y1VB 1LXNA 2VF3A 3GMGA 3MVVA 3LANA 2KL8A 1HRJA 1FGUA 2XHCA 2WVFA 4X65Q 3QNWB 4OI0A 5B0EA 4MKAA 1SAPA 5BN4A 3Q2SC 1E2VA 4DV0L 3UE2A 1GD7A 4P9SA 1GAOA 2QDLA 2WVCA 4Q45A 3MFGA 4DV7F 1Q8IA 2I9SA 1RHKB 4DAVA 3NGDA 2K33A 1HBNB 3NY0A 4UTGA 1QAYA 2IW3A 2OAUA 1N33J 3HGBA 4J9OA 1IKYB 1KVJA 1AYEA 5HJYA 3M8QB 4W90B 2EKNA 4LR9A 5CGKA 4AL5A 3R93A 3NWSA 4F4KA 4PZ6A 1LTTD 1U4LA 1JLGB 3VQSA 1EIFA 1F1BB 2A2DA 3BKUA 1HD0A 5KG2A 3H20A 1U1LA 1IR0A 2XMAA 4RU2A 4TQRA 3HHLD 1YBTA 4LF5F 2OD6A 3L9AX 1PYBA 3NNHA 3D6FB 4JV5L 2IBKA 3VYTA 3RN2A 2Z8QA 1JJ4A 1EYAA 5JVH3 1VYAA 3HK2A 2K7JA 3TYTA 2C2DA 3OIPA 4LF7J 2EOTA 1PH5A 1RP5A 4IR9A 1RU2A 1Y1WG 3DWPA 2B3TB 3EVOA 2WONB 2W01A 4JI5L 3QT7A 5GAGU 4DV4F 2R7UA 1GUNA 4NCBA 1R89A 2U1AA 3CF5A 1J5EL 1HWIA 1ZM4A 1XWEA 3CJ5A 1IKVA 3OXGA 4DPUA 3PV8A 2PI2A 3K0YA 3FDTA 2YNFB 2UUCJ 2ABYA 4LMQD 3OWFA 2HNYB 1TQLA 1RBLA 3DLEA 3EPIA 3NS5A 3PEJA 3HZGA 4GVBB 4RNNA 4OX9F 1AE2A 3GSDA 1CT1D 2M3DA 1H3DA 2K5WA 1HYSA 4WFBQ 3BR9A 1I51B 1IBKL 1A7GE 4DR5L 1BWEA 2HQFA 1H73A 1M4VA 4EBCA 1SNDA 3EMTA 1B50A 3AJ1A 1OSDA 4DLGA 2HQLA 1WC0A 3I4OA 4WFAQ 4A93B 2P6TA 3RR7A 2YTYA 1DTTB 3EGVA 1PRTD 5KFSA 4UDUC 1PG5B 4RUHA 1WUUA 3NWGA 4XQJA 2QA2A 2BA0A 2VICA 2CQ2A 4M5IA 4Y2CA 2HNZB 3GG0A 2HHVA 4ICLA 2Z6BA 5DGAA 3DXSX 3J7A1 2FGCA 4PZ8A 1PZKD 3A54A 1LLRD 2L5TA 4X84A 3F2UA 1N6QB 1VMBA 4ZKBB 2EIFA 1V5IB 1VQ7S 3IWNC 3F8TA 5DLQE 4GC7A 4IUFA 1U4MA 1N33Q 1UEUA 4ZKAA 2DH9A 2MJUA 3CCEA 2WVEA 4L3KA 2B2UC 1RIPA 5ELFA 2RHQB 3VYUA 2IX3A 2L41A 3RU0A 4JV5F 3BREA 4P2SA 4RJVA 4B9NA 1X4GA 2B4OA 5J2PA 1LTSD 4USJC 2Y0SE 3H15A 4NLQA 3UDLA 2R8JA 3LAKA 3MFHA 2MZSA 1VI7A 3LWEA 3PO2H 5M3FB 4AL6A 2KFNA 3X3UA 4MTNA 3CCQA 3D31A 3TOQA 4UP9A 2KXNB 2KG0A 1TQOA 4EGVA 1SE4A 3MCNA 1SE3A 2AYEA 4B9TA 4X4QA 3ULJA 2H5IB 2JFKA 2QF7A 4GN4B 4ZPCA 3RLNA 2B6AA 4KKTA 1EKSA 3A55A 5D65A 5F8LA 4DR5F 5FKAC 4NL5A 3KBXA 4WE1B 1XERA 2AEMA 4DNTB 2KJXA 4A3MB 1CKOA 4ECTA 1WI8A 1WKLA 4N8OA 4X4PA 3UR3C 2DIVA 3S1NH 4WK3A 1ENCA 3R97A 1FXRA 5IYDH 3M8YA 3BZKA 2RHSB 4FNFA 4HLBA 1MNEA 2XWJB 3QIDA 2O5DA 4BXXG 2HZAA 1Y5LB 3DRRB 4B17A 3JAME 3I9V9 3DDIA 4I1TA 2F4VL 3DUZA 4PQUA 2ZH7A 2CQOA 1YJ9S 2F0QA 5G0RA 1IKWB 1BOSA 3EXCX 2ZBCA 4RW6A 2ZJQA 3LW5C 4RW4A 3K7RA 1MMNA 4Q0BA 3BPSP 3QMQA 1OMSA 5MLCV 2BE5C 3LGHA 2XYPB 3W5XA 5BYSA 5C42A 1EWCA 2HQGA 3KK7A 4K0KL 3SIPB 1DFDA 4JI7Q 4XDCA 3WIVA 3S2HB 3BN4A 4ZQ3A 2R2UA 1FKAF 4DV7J 2AQ4A 5KFIA 4O0AA 2PNRC 2AGOA 2D3O1 1RKNA 4AYBB 3AHPA 1BBUA 2Q3PA 2LY7A 3CW2C 2XZWA 4XO0A 5I3PA 3CUNA 2DHGA 3RUZA 2MLZA 3VR2A 3ZTQA 1O51A 3MM8A 3K8VA 3G8TA 1JJGA 1XEZA 3C6UA 4IO9A 1VJWA 4JBCA 2PEHA 4TU7A 1QOHA 3RBDA 3OR2A 4IUTA 3Q23A 3KOAA 2E8GA 4GOPB 3BGRA 3D67A 2DEIA 4JV1A 3PJ9A 2FINB 3AXKA 1HNVB 4NXNJ 3A3PB 1HBOA 3GE9A 1ET6A 1PFMA 1MN9A 2Y0SG 3UW1A 3T1HJ 3WDNA 2HK2A 1IKXB 3GQCA 5J2QB 1L3VA 2YWKA 5K8OA 1HNWL 3W1GA 3MTKA 1HNIA 2HRUA 3U1LA 3S9WA 2N7YA 4R8IA 3VTIA 4UHVA 3M4QA 5AXKA 2OEJA 2XTJP 2D7SA 1TXYA 3BO4A 1NJIT 2DNZA 2OPRA 5IWAJ 3NNAA 3VR1A 4ILMA 3PYFA 4O44A 3KF8A 3K17A 4F36A 2BW2A 3CP0A 2MGSA 1P16A 3IGVA 3EBEA 3PIP3 3G6YA 4B02A 1GMVA 5HANA 4C3HB 1SBRA 4LFCJ 1YRUA 4A3BG 2EXUA 3RAXA 1PTOB 3LQVA 3MWYW 1VQ4S 3I5CA 4K2XA 2AQ2B 2ID0A 1FDBA 5L39A 3J80E 4OX9J 3MXNA 5SZTA 1XX8A 4RPFA 4WP9A 2HGMA 3HKZG 1VQ7A 4EMDA 4DUTA 2JC0A 4XTCS 4P7VA 2E1CA 4NCAA 2ZOGA 1UWAA 3U27A 2J7WA 3DCAA 5DM7Q 1U1OA 1H0HB 5LL6X 2XS7A 3CO9A 2KCTA 1T8EA 5K36G 2X69A 1K83H 5ITHA 2RMLA 1T0TV 4ILRA 1R8AA 1DQ8A 5EKKA 1TR0A 2IYIA 2OPSA 4FVCA 1KP6A 4U8YA 2FLLA 2Q2TA 3M9BA 3IC1A 4G4KA 5FLMG 2DNRA 3TDQA 1QE1B 4DV7Q 4GO5X 4BLGA 2C2OB 1R27B 5C24B 2OXPA 4A3JG 1AN8A 2WAQD 1WFQA 3LPYA 4BA2I 1G51A 3GTGH 5A2QY 1PRTB 3LH2S 2E75C 2NN6G 1PH2A 2JHEA 2OJ3A 2HHXA 1CJUA 4HH0A 4KMUC 2B8QA 1HNWF 5C4HA 1VQNA 1ZM9A 2BOAA 2A10A 3US5A 3HOVH 2HNDB 3M32B 2XMMA 2DITA 4JYAJ 1X65A 4DK3C 2MUYA 1RLCL 3QWPA 1I4XA 4NXNQ 5E7OB 1J5OA 1JWUD 3FKIH 4H4MB 1EAYC 3T1HQ 2RKSA 3ZTPA 4PEOA 2PDAA 1KLMB 1FVIA 4OV6A 2ZEJA 2ZUAA 4DV3L 3J7ZC 4PNYA 2RUGA 1RI7A 3QJYA 1MI2A 1FYCA 4UQTA 4LUZA 3QGHA 5EWFA 1HFGA 1D1IA 4ECUA 2CPEA 5J2MA 4JI1J 1GVPA 2RDIA 1RHUB 4RHRA 5IWAQ 3LO3A 4MIBA 3HI9A 5DO2A 4ZLLA 2JJ4D 2JE6I 1S6QB 4UUXA 3HOYB 2MZTA 4FYVB 3CC7S 1AW0A 1B8AA 3OTEA 4PG7A 1FD2A 4LFCQ 3PX0A 3M2VA 1CJVA 3TW0A 3OVSA 3UPFA 2Y1LB 1GUOA 1NM2A 1X4AA 3PJWA 3BQ0A 3RZDB 4QB4A 3NMAA 2XMWA 3QZ8A 2NZOA 2B9EA 2HHWA 4OX9Q 3G6EA 1NB7A 3GTJH 3R7BB 2QSFA 4BBRG 1STAA 2X1AA 1RYRA 2ZKUA 5GAHI 3RZAA 3PSIA 3AAWB 3DRSA 3HOXB 4AQYF 2I5JA 5DDQC 2VDHA 1WOCA 2MPMA 3NOCA 1S9GA 1XQIA 4EK2A 3RLFA 5DDRC 3MHBA 1RAGB 2K14A 1F0XA 4OJ3A 4WFN3 2OMOA 4N5SA 3KK2A 2MSTA 2QSWA 2EC2A 1TKZB 1S1VA 2X6LA 5T1GA 1HNZJ 2JA5H 1KDNA 5HJXA 2RSOA 1D5XC 4MKBA 3UI3A 2YNIA 5IM0B 2XCAA 3IN5A 2MGZA 1IYJB 2ZOMA 2ZH4A 4J8QA 1WC1A 4N8NA 3GPAA 3HJFA 1P9YA 2Z2YB 4DF8A 4FF3A 4DS5A 1NLKL 5I9OA 5FLXY 5CA5A 1UWBA 1FK9B 2UXBF 5ETQA 2YNHA 1G4CA 5DZ6A 4WJ4A 3V4IB 3EM1A 1HHTP 4TU9A 4JYAQ 3SE0A 1GEHA 3M7GA 4WFYA 3UVJB 1WD0A 4WF9Q 4K4UA 1FNUA 1UW4A 1D2BA 1LV5A 2FHJD 4C9DA 1S59A 4DR4J 1VQ4A 3I2ZA 4ALZA 2XEXA 4RFBA 2E7XA 5ELBA 4A3EB 2XS2A 1SJ1A 3KJVB 2F4FA 5FJ4A 3CDUA 3M4OH 3PFOA 3RRGA 4JI1Q 4HH1A 2Q79A 3L7OA 4G65A 1S1TB 3S16H 4Y2IA 4GMKA 4C11B 1HBUB 1SEBD 3RAMA 3E01A 4EX5A 4ZN3A 3CVKA 1LWEB 2Q8RE 1EYGA 1U6ZA 3S1RH 4QWDA 3VZIA 5A8WB 2W9BB 2C3UA 2R2SA 2HMIB 4LF7L 5CCMA 3P49B 1MU2A 3M8SA 5ETLA 5KFZA 2N3SA 2PO4A 1X4HA 4QIVA 1NNDA 2YWFA 3JSMA 2SEBD 2DNGA 1SIZA 3T5KA 1HZAA 2QRRA 2FJDB 4DR2L 1GO3E 3L7PA 1K8MA 2D9PA 4APVA 2EYFA 4FXWA 3GTPH 1CJTB 3E2EA 4ZRZA 1YDLA 1YIJA 3MM6A 2UUCL 5CYMA 3ILOA 4F02A 2UUAL 1VQ9S 2XTIA 4PPZA 1IKYA 1KNAA 1JKHB 3KWMA 4YB6A 3TEGA 3H5UA 5EPLA 1Y1VG 2AU0A 2MO1A 3VGSA 1S9EB 1JJ2R 3BBBA 2LQJA 3TRZA 2E9ZA 1R8HA 1VRTA 4NXML 1RTDA 4DV1F 4A3CH 3QZ7A 4DV5L 3KLHB 4IOAQ 4WKRA 1X4FA 3W1YC 2MDAA 2RAQA 3IFDA 3B82A 4NA2A 3W2WA 4IRDA 5AJ3L 2OTLS 5C44H 1HNZQ 3HHNB 4DL5A 2XMKA 5HSPA 4C0BA 4ETZA 1TY0A 1AT1B 2ZVIA 5HMWA 4QOTA 1FRHA 4DA2A 2MHNA 4U7CA 4TN2A 1I4QA 4CT8A 2BA9A 4GN3B 1B4OA 4Z2XA 4O2DA 1RT1A 2AF6A 1TWFH 1C2PA 1JLBB 4BBRH 1G6ZA 3UNGC 2HFZA 3ZTRA 5A2QU 1BR9A 2M9VA 4IUQA 3I3CA 3VA7A 1CHPD 5A0YA 4ZS6A 1PBUA 1GK8A 3K57A 4IFYB 4KT0C 5FO7B 1BLUA 1XMQJ 1HUMA 1CQNA 4DR4Q 1Y5NB 4PWDB 1SYDA 3FFIA 4JI2F 4X2BA 2FUG9 1M1KT 1X32A 1K0VA 1P27B 2GAGC 4DAPA 2RDFA 3GJSB 5AXMA 4NMLA 2MEWA 4ZCMA 4DSJA 2BR0A 5F8GA 2UUTA 4ZUJA 2XM3A 4ZVHA 3CAMA 3TAMB 4U96A 4CO5A 3TZYA 5KNCA 2JDJA 1RJTA 3G87A 4NZ0A 3K5PA 4KGMA 1IR2A 4PWUA 2RF4A 4P75A 3N28A 3H4BA 2Q66A 3VDYA 1N34F 3ZZUA 3EFXD 2UUAF 3H8YA 3MM9A 1QVFR 3MTSA 4ECVA 3FP9A 1U48A 4DUZL 1WD6A 1OQ3A 1T02A 2FVPA 1C0TA 4D3GA 2JLGA 4DGZA 2E2JB 1VQ6S 4YOEA 1ASYA 4PRFA 3SFGA 3W5OA 1FD8A 4NXMF 1N36J 3EXYA 3GV8B 4A47A 4K6DA 1T05B 1YITA 4OWWB 4UT4A 5ETOA 4OI3A 5AJ3F 2YH1A 3EE3A 2EY5A 4HVZA 3KYLA 3D4JA 2NVXB 2KKHA 2BQ3A 2BE5D 3SCJE 2QA4S 2QX0A 4DQQA 4KK7A 4BC7A 3O8WA 3ZNUA 5E41A 2E5LL 4ELTA 1VQPA 1QAIA 2M9KA 3NTIA 3K5OA 3UDGA 1Q4RA 3JAMi 3D66A 3QT8A 2DXFA 3W9JA 1K8AC 3OFHA 3SK4A 1LTID 4F0HA 1IBMF 2YNGB 3OR1B 4AYBE 4FBTA 2K32A 8AT1B 1NK4A 4A8YA 1VMCA 3MCOA 2WACA 3VAKA 3R8YA 3TJ8A 1NK5A 3U50C 5EX3A 3T56B 1TL3A 2LA4A 3EJMA 1F2LA 2HBQB 4LSLA 1VLYA 5ETVA 4YDDB 2DGWA 3QWUA 4O3SA 2XQCA 4JI4L 4IJHA 2MB0B 1YZ7A 3BG3A 2PEBA 5D0GA 2NVTH 1OXTA 2K6AA 5IT9E 2JC1A 1RHJB 2UXBJ 2EK6A 5HGTA 4PMCA 2NVYH 3I0RA 3MR7A 4ZPBA 1Y1VH 5D8HB 1XMQQ 1QM9A 5M3FG 5JJIA 4JBWA 2AD9A 5IGEA 2RSNA 1XR7A 4DUZF 2HQDA 1T11A 1XR6A 2OUGA 4IN3A 2VKRA 3M6VA 3MI7X 1DY3