3AQQA

Crystal structure of human crhsp-24
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
99
Chain Sequence
SPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIKNEKLQAVEVVITHLAPGTKHETWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-regulated heat stable protein 1
publication title CRHSP-24 is a novel cargo adaptor trafficking between stress granules and processing bodies
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 99
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aqqA00
3S16H 1LM0A 4JI6Q 3GTLH 3CCVA 4QQBX 1PV4A 4A75A 1XMQQ 1YHQA 4B3TL 4HJ9A 3T1YL 5M5XH 4KI0A 1PH1A 2WB1G 4NXML 1N36Q 1VQCA 4DNIA 3PO2G 1LUZA 1VQJA 4B3ML 2EIFA 2R92G 4LFCQ 3VDYA 1K8AC 1EQRA 1X56A 3JAMi 3HOXH 4KLKA 3U58A 4H02A 3H3VI 1D7QA 5IWAQ 1X3EA 4IJHA 3ZJYC 2WP8J 3STBC 3I4NG 2RF4A 3BJUA 4QIWE 1W2BA 4IPDA 3K7UC 3I4OA 4EQ5A 1C0AA 1NE3A 1WJJA 4JI3L 5M3MG 2UXDQ 2OQ0A 3HOVH 2EXDA 5IYBH 3ULPA 5HGQA 1NJIC 4R4IA 3H0GG 4P73A 3OW2A 4AQYQ 2VZAA 1G51A 4BBRH 4GNXA 2ZM6Q 1PA6A 3H3VH 3T1HL 1SFOH 1JB7A 3CCEA 3PUXA 1XPRA 2VUMG 4QY7A 4DKAC 4DR3L 4GN4B 3G4SA 4DR4L 3A5UA 4BY1H 5AJ3L 3KDFB 2ZJPA 2NZOA 3DLLA 1W3SA 2UUBQ 4LF8Q 4DR6Q 1CKNB 1N32L 2OTJA 1YJNA 4PZ6A 4JI0Q 5DLQE 4LFBL 1QVFA 3DM3A 3PUYA 1M90C 1XNRQ 4Y52H 2UUCQ 4UP7A 2ZJQA 3RLFA 3CCLA 4DV5Q 1A62A 2JA6G 3TQYA 1XNQL 3JAMc 3NELA 1VQLA 3RN2A 5C0XI 1HNZL 2Q2TA 5HY6A 4DV7L 2JJQA 5IP9G 4A3JG 1IBMQ 1SROA 1YHAA 3S1QH 2F52A 5C4XH 3RZOH 1S72A 1MJCA 1I6HH 3AQQA 4JBMA 1KIXA 2JE6I 3WWVA 1VQ7A 4LF7L 3F1ZA 4LW1A 4MNOA 3J81c 1A63A 3HOYH 1NMGA 1WCMH 2AMCB 3CPWA 4DR7L 1PFSA 1X9NA 4X6AH 1TWGH 1I5FA 2E5LQ 2WB1E 3RNUA 4GKKQ 2F4VQ 5IT9c 3J80i 1X3GA 4YCUA 4GN3B 1PVOA 1UWVA 1YBYA 2Z6KC 1K8GA 2BH8A 4JV5L 2CCZA 1S3OA 1KD1C 2CFMA 4TVAB 4DR1Q 1SN8A 2CKZB 2UUAQ 1L1OB 3E9HA 3B6YA 2RCNA 1Y1VG 1X55A 2GVAA 1TWCH 4L5SA 1TWFH 1VQ8A 4A3GG 4LFAL 1Q82C 1N33Q 4RMFA 1HNWL 2H5XA 2PI2A 2R7FA 5LMNQ 1EIYB 2I5HA 4DR5Q 1JJCB 5EAYA 4P72A 1N34Q 3PO3H 1YIJA 4PG3A 1EFWA 1KAWA 2IX1A 3HOZH 4IFDJ 5ELOA 2K5VA 3CD6A 4GLXA 2YV5A 5C0XJ 4JI5Q 4A3CG 2N3SA 3RR5A 3F2DA 4DUZQ 2E2IH 4LF5Q 1XPUA 1PH8A 1JJGA 3GTKH 3ERSX 3TS0A 1PH6A 4DV3Q 4JI1Q 1FL0A 1B70B 1YEZA 4P74A 4DV0Q 1XMOQ 3PF4A 3FKIH 2UU9L 1Q12A 1J5EL 1Q46A 4A4IA 4UY8C 1UEBA 5IYDH 3J80c 3CXCA 4DR2Q 2WAQE 1RL2A 1EYGA 1MIUA 2LXKA 5H1SE 4A3EG 4DUYL 3RZDH 4DAYB 4IFDG 1SMXA 2IY5B 3HKZG 2ES2A 5C0XG 2UXBQ 3I4MH 4MZ9A 2R6GA 4A3IH 3KOJA 2NN6I 4HJ7A 4LF6L 2K4KA 3S1MH 2JA9A 3G6EA 1SR3A 4IPGA 1YI2A 2YU9H 1Q1EA 4AYBG 2NZHA 2B63G 1VQNA 3E9IA 3PV0A 1JT8A 5M3FG 1J6QA 2PNHA 4HIDA 3KYHC 3J7ZC 4LFAQ 4BY7G 1ASZA 3HOWG 4HIKA 2K52A 1HNXQ 3I7FA 3BZKA 4DV6L 4X64Q 4A93G 4A3DH 5FJ8G 1A8VA 1OTCA 4DAMA 1HR0L 1SLJA 3F2BA 1I94L 4LNQA 2VQEL 1CKMA 1E1TA 2R92H 4KHZA 4DV2L 4C2MH 3NEMA 4A3LH 4Y7NH 3PIOA 2HHHL 2R7ZG 5IYCH 5GADC 1VQAA 1XTDA 5GAHC 4YY3L 2HQLA 2Q2IA 4O0AA 3D0FA 4JI8Q 3TREA 3OTOL 4LUOA 4A3FG 3BU2A 3JC66 4AIMA 3HOUG 3U4ZA 3GO5A 2L15A 1KRTA 2ASBA 4LF9Q 4IOAA 1EWIA 2UXCQ 4JI4L 1KHIA 4BBSG 2KENA 1OXVA 2VL6A 1QVCA 3OYYA 1QVGA 4OX9L 3GTMH 4LF4Q 3K0XA 5C44H 3K7AH 4OWWB 3RLNA 4A3BG 1AH9A 1CSQA 1LYLA 2ALYB 2CWAA 4A3KH 1N9WA 3NENA 4JOIA 2ZTCA 4DV4L 2XGTA 2Y0SG 1OXTA 5IP9H 4HIMA 1YITA 1IL2A 2EQSA 1Y1WH 4J15A 1TWHH 1P8LA 1Z9FA 4GNXB 2PI2E 2Q2HA 4A3MG 2VW9A 4BXXG 2C35B 1GM5A 4JYAL 4HJ5A 3K81C 3LGJA 1VQFA 2N78A 2I0QA 1PYBA 1Q1BA 3HKZE 3J81j 5LMUL 1QZGA 4B3TQ 1L1OC 5LMNW 1PH3A 2R93G 3TS2A 3T1YQ 4NXMQ 1CKOA 2I5LX 2CQOA 2K5NA 4OO1I 4X62L 1E7ZA 1P16A 1WFQA 2NN6G 3EIVA 3HKSA 4BA1I 3KJOA 1FGUA 2GN5A 4B3MQ 3M7NA 3FP9A 1VQPA 4GOPA 4YHHQ 1BKBA 1QUQA 2MNAA 5C3EH 1R9TH 1FVIA 5FLMH 4GOPB 1QUQB 2VQFL 1GO3E 1IBLL 3A74A 4JG2A 3U4VA 4HJ8A 1Y1VH 2PMZE 4JI3Q 1KXLA 5GQOA 4DV1L 4JBKA 1HZCA 2PQAA 3HOXG 2Z0SA 1NY4A 1WI5A 2BA0A 2PQAB 1X6OA 3L2PA 1CUKA 4A76A 2KHIA 2VY3A 4L5TA 3I55A 3T1HQ 1IBKL 5IE8A 1TWAH 1KRSA 2JA8H 4WJ4A 2NVYH 3HOVG 1G291 4DR3Q 5IYBG 1GVPA 2QEXA 3EBEA 3F2CA 1S40A 2E2JH 2JA5H 4DR4Q 4P75A 5AJ3Q 4FDBA 1N32Q 3UDXA 1O7IA 1Z47A 4BBRG 1Q86C 3E0EA 1SE8A 1DGSA 3MXNB 1VS0A 4X66L 3KJPA 4NXNL 1VQ4A 4BA2I 5IP7H 4R4CA 3H15A 4LFBQ 4R4OA 2B3GA 2JA7H 4GKJL 4K0KL 1LTLA 3MEFA 5BR8L 4BY1G 4L5RC 4B3RL 4GS3A 3STBD 1XNQQ 1YNXA 3M85A 1V1QA 1HNZQ 1E3PA 2OQKA 4IPCA 4DV7Q 1E1OA 1HZAA 1GKHA 3PCOB 2AKWB 1VQEA 3ULLA 5GAEC 1I50H 1K73C 4LF7Q 1OXSC 3D31A 1FJGL 1VQ9A 1UE6A 4DR7Q 2A8VA 2B29A 3PUWA 4X65L 2AWNA 5C4XG 3KF8B 3PUZA 1HZBA 4OONA 4UPAA 3ER0A 3HOYG 1VQBA 5J3BA 2Q2UA 3AFQA 4JV5Q 3UE1A 1XJVA 1VQDA 4JBWA 1CSPA 2K14A 4JC0A 4MTNA 4OWXB 4KHPL 3GTJH 1OXUA 3CCMA 3PO2H 4UP8A 1X3FA 4YHHL 2K50A 2OTLA 2V1CC 3UDFA 1HJPA 1K3RA 5C4JH 4IO9A 4JI6L 3PUVA 1XMQL 1NMFA 3GDEA 2K5HA 3CP0A 3I4NH 1HNWQ 3CC4A 5GROA 4QL5A 1N36L 4GNXC 4HIOA 1HH2P 1T9HA 1YJ9A 4LFCL 3UDIA 3A0JA 5M3MH 3KFUA 2Z6KA 3M3YH 1X54A 4TQUS 3GTOH 4POGA 3CC7A 1FJGQ 5IWAL 3H0GH 3U50C 3CCQA 1C9OA 5JJIA 1IYJB 5GAGC 2VS1A 2NVTH 2MQHA 2UXDL 3PO3G 1PHJA 2ATWA 2VUMH 1UE5A 2UU9Q 4ALPA 3HOZG 1J5EQ 1NTGA 3AEVA 4JI7L 1MKHA 4AQYL 1PH5A 3CF5A 1YHBA 2FXQA 2ZM6L 1Q8KA 4DUYQ 3CMAA 4PMWA 1PH9A 3M4QA 1WOCA 2D0PA 1N8RC 2ZTEA 4R1JA 1L0WA 4LF6Q 3FKIG 3HFZB 2A19A 5IYDG 1K0RA 2QA4A 5M5WH 1NBWA 2QGQA 1Q7YC 2WFWA 4LF8L 2JA6H 5JEAJ 2UUBL 1PYSB 3RLOA 2D0OA 4LUVA 4DR6L 2BA1A 4C3HH 3G71A 2OCEA 1HZ9A 4O2DA 4PZ8A 4A3JH 4JI0L 1VQMA 3I4MG 2KCTA 1U0LA 4A3IG 1JJ2A 1XNRL 3CQZH 1IZ6A 2UUCL 2NVXH 3J7A5 3S2HH 1AE2A 4DV6Q 5IY0A 3I2ZA 4DV5L 4LWCA 4QJFA 3RN5A 1V9PA 4ME3A 1HR0Q 1BBUA 4LUZA 1VQKA 1I94Q 2VQEQ 3PSIA 1IBML 3K8AA 5JJLA 4DV2Q 5JEAG 1V43A 3UDGA 1YJWA 4YCWA 2HHHQ 2A1AA 4A3DG 3ULJA 1SRUA 4YY3Q 3J81i 3TEHB 4AYBE 1MJEA 2D62A 3OTOQ 3PGZA 4JI7Q 2KCMA 1EIFA 1VQ5A 3GTQH 2E5LL 3M9BA 3BZCA 4OXPA 4YWLA 5FLXc 1L2FA 2F4VL 3KLWA 3GTGH 4A3LG 5IYCG 4GKKL 2YTXA 4JI4Q 3KDFA 3S2DH 4DPGA 1Q81C 4OX9Q 2MFIA 1CKNA 2R7DA 5JJKA 4L5QA 1IXRA 2MO1A 3S1RH 4C3IH 1E24A 4DR1L 3PIPA 1C7YA 4A3GH 1VQIA 3FHWA 2E2HH 3NBHB 3M4PA 4DK3C 4DV4Q 2UUAL 2OWOA 1BBWA 2BH2A 4NB3A 1EUJA 3IRBA 3CCSA 1D8LA 1XPOA 5C44G 2I5MX 4XTCS 2WAQG 4JYAQ 4IFDI 2VNUD 4A3KG 4A3CH 1I3QH 4AH6A 4EX5A 3CCUA 1N33L 5ELNA 5LMNL 4JI2L 5LMUQ 3L7ZC 4DR5L 1JE5A 1Y1WG 1N34L 2LXJA 2IX0A 1YVCA 4X62Q 2KHJA 3CPFA 4B3RQ 4JI5L 1VQHA 1ASYA 4C3JH 1A0IA 4HJAA 4DUZL 4A3EH 1QZHA 4LF5L 1UE7A 3TRZA 4OWTB 1PH2A 4DV3L 4JI1L 2Y0SE 3UE0A 1WYDA 2DUDA 1G6PA 4DV0L 1EQQA 3S15H 1RIPA 1XMOL 2VQFQ 2YTYA 2N8NA 1UE1A 1IBLQ 1TXYA 2HIXA 2JQOA 4DR2L 2MO0A 2IHFA 2NVQH 1Y14B 1H95A 3CC2A 4DV1Q 5E7NA 2K75A 3W5OA 2B63H 4IPHA 1BVSA 2JK8A 3GD7A 5C3EG 5M3FH 1K83H 1L1OA 4DK6C 2N49A 5FLMG 4GLVB 2UXBL 3S1NH 4BY7H 4QGUA 3HOWH 3S17H 2HT1A 1K9MC 2AHOB 1IBKQ 4A93H 1KC8C 5FJ8H 4IOCA 4OO1G 3SGIA 3W1BA 1WCMG 3F8TA 2JEAI 1B7YB 2XTIA 3CW2C 4JI2Q 4POFA 2AWOA 4B3SL 4PZ7A 4R4QA 1HNXL 2R7ZH 2IT1A 4X66Q 4X64L 4NXNQ 4YWMA 2JA8G 2HIVA 4GKJQ 3G48A 1X65A 4K0KQ 4P71A 3Q8DA 5BR8Q 4R4TA 3AYHB 2GVBA 4A3FH 2JA5G 3M4OH 3HOUH 1YZ6A 1VQ6A 4IJLA 3ICEA 1HR0W 3CAMA 1M1KC 4JOIC 2E8GA 2YYZA 3EN2A 5IP7G 4BBSH 3CMEA 4XIGS 1VQGA 4GLAC 2JA7G 2ID0A 4JI8L 1VCIA 4UP9A 4A3BH 3CCRA 3I56A 1PH7A 3W1GA 1KL9A 2YTVA 2DGYA 1B8AA 2IHEA 2KBNA 4LF9L 1KQSA 4JCVE 2UXCL 5K36G 4APVA 3A5ZB 3KF6A 1AE3A 3CCJA 4X65Q 4RG1A 1JMCA 4LF4L 2CWPA 3KF6B 1OXXK 4A3MH 3S24A 3L0OA 2RHSB 4BXXH 3PF5A 3S14H 2F3IA 5M5YH 2ZJRA 2LSSA 4GOPC 3K80C 3GTPH 4B3SQ 1GD7A 4YWKA 4JBJA 2ZTDA 2R93H 2RHQB 1VQOA 1PH4A 4WJ3M 4YCVA 3AFPA 4GN5A 4NPSA 4KHPQ 2JEBI 1EOVA 1E22A 1U5KA
chains in the Genus database with same CATH superfamily
1LM0A 4JI6Q 3GTLH 4QQBX 3J80L 1YHQA 4QMGA 1EWHA 1GUOA 4HMIA 4NXML 1ESRA 4XT3B 1N36Q 5ISRA 1KABA 2SNSA 1VQJA 4A3DB 4ZUIA 1K8AC 1EQRA 3DMUA 3HOXH 4H02A 1D7QA 1X3EA 4IJHA 1GUSA 1ILQA 4C2MB 4QIWE 2NVTB 4Y7NB 5CBEE 1S4ZA 4PQXA 3M4YA 3O13A 3VR3A 1PYWD 1F2ZA 4GNXA 2EYJA 1JB7A 4J6HA 2VUMG 3GTMB 2L11A 5C44B 4OELB 4DR4L 1SBBB 1UNSA 2F0QA 2LKVA 4RGMA 3SK5A 3A8KE 3VR2A 2UUBQ 4BY1H 1N32L 1CKNB 3HEJA 4JI0Q 1LT3D 4XT1B 4LFBL 4HAEA 1QVFA 3DM3A 2NVXB 4Q5VA 3MVVA 1XNQL 5C0XI 5IP9G 2FINB 2F52A 3RZOH 1S72A 3J81c 4K2KA 3HOYH 1WCMH 2AMCB 4K5WA 2IWHA 3CHBD 1I5FA 2F0LA 3BYYB 4IN3A 3C2PA 5FO9B 4EQOA 3E0JA 4YCUA 3K57A 1A15A 3S1RB 1D1IA 3I91A 1YNJC 2CFMA 4ZKBB 4CJ0B 1STGA 3BDLA 2JN4A 5IGGA 1GUGA 2NVYB 2GVAA 1TWCH 1ICWA 2KECA 1VQ8A 4C3IG 5CV7A 4A3GG 1KDBA 1LV9A 4GZYC 1JJCB 3PO3H 4P72A 4PG3A 4LMQD 4Z9CB 4U673 5ELOA 3CD6A 4GLXA 1Y8NB 1PFNA 4DUZQ 3KF8A 4LF5Q 2J4XA 1PH6A 1FL0A 1D6EC 1WVLA 3PF4A 2OEOA 3FKIH 2RCFA 1Q12A 2UU9L 1Q46A 4DR2Q 1EYGA 4DFAA 2ICEC 5H1SE 5IODA 4A3EG 1SMXA 3H6MA 1STNA 5KGUA 1S5DD 4A3IH 3KOJA 2NN6I 4HJ7A 3S1MH 1SR3A 2PMZB 2YU9H 4AYBG 2B2UA 3H09A 4R8IA 3E9IA 2L0CA 1J6QA 2PNHA 4LFAQ 2K03A 5BN5A 1VDZA 3PO2B 4A3DH 4A93G 1WTHA 5CR3A 2ZT9C 4C2MH 3NEMA 2F0NA 4Y7NH 2R7ZG 4CHTB 1EY6A 4YY3L 3NTIA 3GQBA 2Q2IA 1H9SB 2PZUA 3D0FA 3GTOB 1JCKB 1O7LA 4LUOA 3BU2A 4A3FG 2ASBA 1OO9B 1EWIA 3TBIB 4JI4L 2KA7A 1RCVD 1UAPA 4K6DA 3GTMH 3CKIB 4A3MB 3K0XA 4RHSA 5C44H 2GA4B 2JXMB 5IGEA 3TSSA 2K5QA 1QNUA 1Y1WH 4J15A 1Z9FA 2Q2HA 1AP0A 1O7YA 2EY1A 4FF1A 1SYGA 5M5WB 3LGJA 4FO2A 3CRKC 2N78A 4IUVA 4BS9A 1QZGA 2KHSA 3J81j 4E6IA 3NHHA 1XXGA 2K5NA 4K5XA 1GUNA 4OO1I 3S2HB 4B3RL 3EIVA 4B3MQ 1I4XA 1QUQA 1FVIA 2CQAA 5FLMH 1ET9A 1DD2A 2EYLA 2MP1A 1TQOA 3U4VA 4HJ8A 2PMZE 5EKLA 4DV1L 4EQPA 1HZCA 3A54A 4OO1H 1HHVA 3HOXG 4NDXA 3GTQB 5E4XA 3VYTA 1K8OA 4FNFA 1TWAH 1KRSA 4X3KA 2NVYH 4KK7A 5CYUA 4MIUA 1YNNC 1PRTF 4DR3Q 4KY6A 1RD9D 5J22A 3UDXA 2E2HB 1SE8A 4KKUA 1VQ4A 4NXNL 1KAAA 1Q3LA 4R4CA 4GKJL 2B3GA 3U9OA 1TS4A 3MEFA 3H91A 3T16A 4BY1G 3MXGA 3PIP3 1HNZQ 4RFBA 4CDFC 1LACA 2XVSA 4IZ8A 1VMCA 3KLSX 2AKWB 1VQEA 4G4KA 3V96A 1B4OA 4RKBA 2WKCA 4ZLTF 1X32A 2B29A 2LMCB 2A8VA 2Z9HA 2AWNA 3WOFA 2K1BA 1HZBA 1CTMA 3MA2B 2R61A 1Y8OB 3HOYG 2F0SA 1VQBA 1DYQA 3UE1A 1XJVA 3J80E 1IL8A 1CSPA 2K14A 3I3CA 4OWXB 3PO2H 3UDFA 1HJPA 4JI6L 5IT9L 2KUMA 2EZVA 1ZYRC 3R8BA 3GDEA 5NUCA 3QWNA 2NUCA 3NWSA 1LT6D 3MTSA 4QL5A 1N36L 2A5HA 1EY5A 2DN8A 1X3QA 5J39A 1YJ9A 3A0JA 1X54A 4TQUS 4DA2A 3GTOH 2KEDA 1EQTA 1C9OA 1NSNS 2VS1A 3PO3G 3BVZA 1AZQA 4K2LA 2EJGC 1F2MA 1YNJD 3AMUA 1LO5D 1PH5A 4DUYQ 2Y0SB 2D0PA 4YIJA 2CH4A 4J1MA 4R1JA 4LF6Q 3FKIG 2A19A 1SNQA 4R8NA 5M5WH 2RBMA 2UUBL 1E2ZA 5IGDA 2BA1A 1CA6A 4EQNA 1U4RA 2K5WA 3OPOA 1IW7C 3R3OA 4FF2A 5M5YB 4PZ8A 4JI0L 1SYEA 4A3IG 2R93B 4ZRZA 3J7A5 3S2HH 1AE2A 3NPPA 1PMRA 4QJFA 2F0TA 1SE2A 3PMFA 3QR8A 1HRJA 3PSIA 4M1UB 1B44D 1CK1A 4A3DG 3A7AB 1B3QA 2KCMA 3QG1A 1VQ5A 3GTQH 3M9BA 3BZCA 4OXPA 4YWLA 3QOJA 3GTGH 2F0IA 2ICIA 1FR3A 1V8QA 3NTKA 1Q81C 3K6OA 3HOVB 2R7DA 5JJKA 2MO1A 3PIPA 1VQIA 5ELFA 4R9WA 3NBHB 4BBRB 2E2HH 4L6TB 1BBWA 4WORA 3TP5A 1EUJA 4IUTA 1KLUD 3MC0B 3PQIA 5C44G 3M7GA 4ULLA 4A3CH 4AH6A 3CCUA 5LMUQ 5CBAE 1Y1WG 1PRTC 3OW7A 1QCBD 1J8IA 2OXPA 3BYTB 1ASYA 1A0IA 1EY4A 4DUZL 4LF5L 3TRZA 4OWTB 2Y0SE 3S1QB 2DUDA 2VQFQ 3NQTA 2YTYA 1I6HB 4CDCC 1V1PB 3A8JE 2JQOA 4DR2L 2MO0A 2IHFA 1Y14B 1B9NA 4DK0A 2NTTA 5E7NA 1WTWA 2MHVA 2N49A 5FLMG 4GLVB 1TWGB 3JAML 4BY7H 4L8JA 3UI2A 3K5NA 5JAVA 4OO1G 2JP1A 1TU2B 2CH4W 2F3VA 1SEBD 4JI2Q 4B3SL 1A3TA 5ELEA 4YWMA 4IUUA 2J7ZA 1TS3A 1F9SA 2BE5C 4R4TA 1ZXTA 3HOUH 1YZ6A 1VQ6A 2A74C 2L55A 1JICA 1PZJD 4PNYA 2TMPA 1NR2A 3MXUA 4GLAC 4XIGS 3IFTA 2C5CA 3I56A 1KL9A 2YTVA 3T53B 1AZPA 2E2IB 4JCVE 1CZWA 1G2SA 3CCJA 3F2UA 1YNND 2IW3A 3KF6B 4K8IA 2B2YC 2F0GA 2KOLA 2F3IA 5M5YH 3Q23A 4GOPC 1JE4A 2B39A 3OWFA 2WB1B 2R93H 3I70A 3GTJB 2D2CC 4NPSA 4KY5A 4N8FA 1HTLD 2R92B 1EOVA 1B1ZA 1E22A 2BDNA 2G9HD 4DAPA 2RQXA 3W3AA 1CFMA 1RTOA 1DZ1A 5M3MB 3PO2G 1LUZA 4B3ML 2EIFA 4DU9A 1X56A 1QNKA 5IWAQ 5D14A 3ZJYC 1U4LA 1W2BA 4HCEA 1C0AA 4K14A 1NE3A 1ENFA 2N88A 3HOVH 3SR1A 2FJ2A 2WINB 3ULPA 1SDFA 1NJIC 2IPKD 3OW2A 4AQYQ 2VZAA 4BBRH 2ZM6Q 2PNRC 4K8JA 1SFOH 1QG7A 4ME5A 1XPRA 4I65A 4DR3L 1ZYRD 3DHQA 2ZJPA 2OTJA 1YJNA 4EVOA 4HEDA 2PW7A 5DLQE 2MJ8A 4Y52H 1M90C 1ILPA 5FO7B 3A8IE 3CCLA 5HURA 1JB3A 1FD7D 2F0MA 1HNZL 1LTID 2JJQA 3S1QH 1YHAA 1I6HH 4JBMA 1KIXA 1MSGA 2R3ZA 2JE6I 3WWVA 5L37A 4MNOA 1EFID 4I7ZC 1A63A 4F88A 1W6JA 1NMGA 5C3EB 3CPWA 4N8X1 1VF7A 1TWGH 4L63B 1CZGA 2E5LQ 2WB1E 3RNUA 5M9OA 1Y1VB 3J80i 1X3GA 4Q0FA 1PVOA 1L0XB 1UWVA 1IW7D 1HQRD 1YBYA 2Z6KC 4UAIA 5IT9E 5C3XA 2CCZA 1EOTA 2K01A 1BCPB 1SN8A 5DM63 1RDPD 1WTRA 3GV6A 2CVRA 5FOBB 2JA5B 1WD0A 2PI2A 5EPKA 3EVQA 1A2UA 1EIYB 2I5HA 2EY5A 2JA7B 1EFWA 1KAWA 2IX1A 2NBFA 4IFDJ 2K5VA 5CV5A 3QB3A 2YV5A 4OL7A 4A3CG 1SYCA 2E2IH 1XPUA 3ERSX 1YEZA 4P74A 3TP7A 3K5MA 1SJED 1I50B 1F2LA 4QF4A 4A4IA 1UEBA 2J0TD 1LTGD 4KD4A 3J80c 4DAYA 1RL2A 3T4AC 2B63B 2LXKA 1PDQA 3P1HA 4DUYL 2IY5B 4CJ2C 3HKZG 3S1NB 2UXBQ 1JOOA 2R6GA 4LF6L 1H9MA 1GHKA 2JA9A 1LTAD 2NZHA 3PV0A 1CI3M 4HIDA 1K0SA 3J7ZC 4BY7G 2B2VA 1ASZA 1PRTD 1HNXQ 2K52A 3LNNA 3MXPA 4X64Q 1A8VA 3NP8A 3F2BA 4LNQA 2HDLA 2BCOA 1KLGD 2K05A 3I4NB 3PIOA 3Q22A 2HQLA 2B2WA 1PTOB 2EYFA 5ELCA 2SDFA 3HOUG 3GO5A 3URYA 1STHA 3H0GB 1HA6A 4G7ZC 3CU7A 2KENA 4OIJA 1QVGA 2VB3X 4FF4A 1AH9A 1CSQA 1XX8A 2ALYB 4CKBA 4MHEA 4JOIA 4DNRB 1PLFA 2ZTCA 2XGTA 2Y0SG 1YITA 4HMJA 4PV1C 3SDZA 1P8LA 4NP5A 2BE5D 4B9XA 5CV9A 4DAVA 2JA6B 3NK9A 1SNMA 1BCPC 4C3HB 5LMUL 4B3TQ 1M8AA 1HXYD 1PH3A 2R93G 2HDMA 1WD1A 3Q6SA 1EYAA 3ERQA 1P16A 1WFQA 3HKSA 3KJOA 1BKBA 5CV4A 4F8MA 5C3EH 1A2TA 3J7AV 4G7OC 1QUQB 5KIXA 1GO3E 1SMYC 1V1OA 4OGQC 3JAME 2VQFL 2M2LA 4JG2A 1EEFD 1Y1VH 4JI3Q 1KXLA 4JBKA 2PQAA 2Z0SA 4RH6A 3R93A 2EOTA 4DN4M 3L2PA 1X6OA 3BVMA 1I4PA 2VY3A 1DOMA 2K04A 3I55A 1AFPA 1DOLA 4XYOA 3S2DB 4WJ4A 3HOVG 1G291 1D1KA 3OSOA 1GVPA 3F2CA 5CV8A 2JA5H 1AEXA 2RKSA 4P75A 3MXNA 1EZ8A 1O7IA 4BBRG 3QJYA 2Z8LA 3H15A 2JA7H 5EKIA 1ICFB 2NB0A 4GS3A 4PMCA 1YNXA 1TS5A 5K36H 1CHQD 3ND8A 3QO2A 3R2TA 2I07B 3PCOB 4RWSC 5GAEC 1I50H 5JPMC 5A2QL 4LF7Q 1NAPA 1JWMD 3D31A 4C3JB 1EY0A 2O2LD 5CGKA 3Q24A 1UE6A 4DR7Q 3PUWA 4MTKA 3I4LA 1SE3A 4F87A 3S15B 1X3PA 2HCCA 3MFYA 4OONA 2TSSA 1XYIA 3NWTA 1QJOA 3P7JA 1GUTA 3J81L 5M3FB 3AFQA 1W6KA 3HOWB 3S17B 1E0BA 1OXUA 3C3LA 1X3FA 4CBVA 2K50A 2V1CC 2QW7A 3PUVA 2CHBD 4DXGA 2K5HA 3CP0A 3I4NH 1SNPA 3KBXA 5GROA 1QOHA 5BN3A 1PTOH 1WTXA 1QWYA 2PPBC 4POGA 1FNVA 2VB2X 1LLRD 5EGTA 1FJGQ 5IWAL 3H0GH 3S9WA 2D5DA 2NVTH 4BBSB 1PHJA 4KY7A 2B8GA 1J5EQ 2NWGA 1HUMA 1FNUA 4AQYL 1G2TA 2B8FA 1YHBA 2ZM6L 3CMAA 3HFZB 4P2CB 1NBWA 3W2DA 5D3DA 2JA6H 5JEAJ 1SJHD 4LUVA 3S14B 4C3HH 3G71A 4K6LA 1VQMA 2KCTA 2EY6A 2LFNA 4RCOA 3G6JB 2NVXH 4DV6Q 1V9PA 2VQEQ 3V05A 2DNCA 5C4HA 1V43A 3UDGA 5I2YA 2HHHQ 3ULJA 1SRUA 3TEHB 4HR7B 3ZYYX 5F2DA 3SK6A 3PGZA 4JI7Q 1LT5D 5J1ZA 2IL8A 1EIFA 2E5LL 1EZ6A 1EIGA 3E5SA 3KLWA 5G3LF 5CC4A 4V0BA 2YTXA 3S2DH 4OX9Q 1CKNA 4L5QA 3S1RH 2QF7A 3FHWA 1RKNA 3CCSA 3K5OA 3FVQA 3BDCA 3TDQA 4IFDI 5C6AA 2EYPA 5ELNA 2ZXOA 2RDFA 1S5BD 3L7ZC 1Y69U 2IX0A 4X62Q 2KHJA 3CPFA 1ET6A 3A55A 4C3JH 4HJAA 1QZHA 1D5ZC 1UE7A 3BG3A 4IFDH 3K5LA 5CORA 1EQQA 5C4XB 3S15H 4N9TA 2N8NA 2Z6BA 1U4PA 3CC2A 3W5OA 1BVSA 2JK8A 3GD7A 5C3EG 5M3FH 4IURA 2UXBL 4DF7A 5EJWA 3HOWH 3S17H 1NCVA 1RHPA 3GP7A 2JA8B 2AHOB 3I72A 1IBKQ 2HUGA 3MZ5A 1KC8C 5FJ8H 4IOCA 3ITPA 1F9PA 3VR4A 1BCPD 1MBYA 4XXEA 1WCMG 4JK1C 1KDCA 4POFA 2V4DA 4PZ7A 1HNXL 4X64L 1LT4D 4P71A 3Q8DA 5BR8Q 2JA5G 3DEOA 3HGBA 4HCSA 5JVH3 3ICEA 4IJLA 1SMYD 1H9RA 1M1KC 1IHZA 3K0YA 4BBSH 2F3WA 2JA7G 2ID0A 1SYFA 3V2TA 1PXUA 2KVMA 1VCIA 2MUYA 2DGYA 1TVXA 1B8AA 2I46A 1KQSA 5K36G 3A5ZB 3GTKB 1JMCA 1JWSD 4A3MH 4BXXH 3L0OA 5JVG3 3S14H 2LSSA 3N6RA 4XQNA 1GD7A 1XTCD 1PH4A 4WJ3M 5FK9C 3T51B 2JEBI 1N8RC 1KD1C 4YHHQ 2E76C 3CCVA 1PV4A 4B3TL 3H3VC 3IFDA 4KI0A 1PH1A 3TZDA 1K8MA 4K5VA 4DNIA 4LFCQ 1EU3A 3VDYA 3HRZC 1TIID 3JAMi 1GUWA 4KLKA 3U58A 5BN4A 3H3VI 2WP8J 3VA5A 2RF4A 3BJUA 3EJIA 3I4NG 4IPDA 4EQ5A 4WFN3 3C1EA 1WJJA 4JI3L 2UXDQ 2OQ0A 4C1NK 1STYA 3FMCA 1HUNA 5HGQA 3H0GG 4P73A 4H13C 1G51A 1PA6A 3K58A 3H3VH 3CCEA 1C8CA 1BUVT 4DKAC 1PFMA 1A3UA 3KDFB 2NZOA 1C4QA 1W3SA 5E3FA 3DLLA 4A3KB 4LF8Q 4DR6Q 4PZ6A 5DM73 1MD2D 2PQEA 1TWHB 3J7AF 3PUYA 1XNRQ 1ML0D 2UUCQ 2B2TC 3RLFA 3NTHA 2JA6G 1A62A 3JAMc 1JR0D 1VQLA 4C3HG 2Q2TA 2PYKA 1IBMQ 5C4XH 5E1FA 1MJCA 4RHRA 2N55A 3G7LA 4LF7L 3AB9A 1VQ7A 3F1ZA 1JOQA 3EA6A 2LY7A 1R9TB 2K32A 4CGYB 4DR7L 4X6AH 5KNDA 3J81E 4DNTB 2EJFC 4GKKQ 4FYDA 1STAA 5K5PA 1S5FD 4B9WA 1MI2A 1WTOA 1NR4A 3SK8A 2BH8A 4KN4C 4DR1Q 4TVAB 2H1EA 2CKZB 2UUAQ 1L1OB 3E9HA 3B6YA 3VYRA 2A68C 1BO0A 2A6EC 2Z4HA 4XQJA 4LFAL 1Z7TA 4RMFA 2R7FA 5LMNQ 1BBXC 3HG9A 4LK1C 2EYMA 1N34Q 4OIKA 5C0XJ 3F2DA 1ENCA 1DM0B 3GTKH 1VMPA 4DV3Q 4JI1Q 3DXJC 5JPNC 1BNZA 2EJMA 4DV0Q 4IUPA 1XMOQ 1J5EL 2NVQB 4AYBB 4UY8C 5IYDH 3CXCA 2PZWA 4C3JG 2QCPX 1TY0A 2K6AA 4DAYB 4IFDG 2E75C 3FRPB 1IKLA 5EKKA 1UEAB 2XSCA 3G6EA 4IPGA 4KJNA 1JT8A 4OEMB 5I6WA 2AUKA 5M3FG 3L3OC 5EQ0A 3KYHC 5JEAH 3HOWG 1BF4A 1CQFA 3BZKA 4DV6L 5IOCA 3X3MA 1CQVA 5FJ8G 1OTCA 1SYBA 4DAMA 5I2XA 3TMEA 2VQEL 1CKMA 4A3LH 2HHHL 3MEHA 4IUNA 5IYCH 1H9KA 2QEJC 2M00A 4JI8Q 3TREA 3JC66 4AIMA 4IOAA 3FDTA 4LF9Q 1KNAA 4BBSG 1OXVA 2VL6A 3HS0C 4OX9L 5CV6A 2SOBA 3D8GA 3X3NA 1HPCA 1LYLA 4A3KH 3NENA 1WTVA 5IP9H 1OXTA 3KLRA 4HIMA 1IL2A 1BCPF 3P75A 1TWHH 4GNXB 2PI2E 4A3MG 2VW9A 4BXXG 1GM5A 1CA5A 3I8ZA 3E3XA 2QDBA 1PZKD 1VQFA 5CMDA 3C46A 2I0QA 2HCIA 2K5DA 4A3JB 4IQZA 1L1OC 4U68A 5IGCA 4RGNA 5LMNW 3T1YQ 2B2YA 1WTQA 3TS2A 1CKOA 2I5LX 1EL0A 4X62L 1IYUA 1E7ZA 4B08A 4WRDA 3M7NA 1VQPA 4GOPA 1WTPA 1R9TH 2MNAA 4ILWA 1ESFA 3C1FA 2Q8IB 3OHXC 3NBHA 1EY7A 3BS1A 1WI5A 1IKMA 2PQAB 1R4PB 1CUKA 4A76A 4TSSA 4L5TA 3T1HQ 1IBKL 4MN3A 4V190 3BDOA 5AJ3Q 1D5MC 2XWJB 1Q86C 3E0EA 3KJPA 3MXNB 2A69C 1VS0A 4BA2I 3MWYW 4R4OA 4XQQA 5FLXL 1LTLA 5BR8L 3CRLC 3RMHA 2F0UA 4H0LC 1B50A 1C48A 3M85A 2IX3A 1V1QA 1V1PA 4IPCA 4DV7Q 3FPUB 1E1OA 4CDDC 2RSNA 4ZAIA 1OXSC 1PTOF 4JVZA 1D2BA 1Q90A 1VQ9A 2X6GA 1EY8A 5LL6X 2KCCA 5C4XG 3T56B 3KF8B 5D3IB 1GOZA 5G3LD 1K83B 2Q2UA 4JV5Q 4FVMA 4JBWA 4MTNA 4CDEC 3GTJH 2DY8A 3CCMA 1F2YA 3I90A 4YHHL 2R92H 2OTLA 1TWCB 1A6XA 1G6ZA 1K3RA 4JW0A 3VYSA 4IO9A 5IIFA 1RODA 3VR5A 1NMFA 2QDLA 1SYDA 3OIPA 3ONAB 3VYUA 2AQ3B 3H94A 2EYHA 2C9OA 3GV3A 1HNWQ 2L1BA 3HZXA 3CC4A 4GNXC 2O5IC 3PO3B 5KYIA 4LFCL 5M3MH 2Z6KA 5KRUA 2PO4A 3CCQA 4N9PA 1IYJB 2XRSD 5GAGC 3N52A 1NNXA 2UXDL 3FKIB 2EVBA 5C3WA 4ALPA 4A3BB 2Z1CA 1EEID 1NTGA 3TZUA 3AEVA 4NKLA 1MKHA 3FPPA 2JYOA 1SSOA 2NTSA 2FXQA 1JC7A 1Q8KA 1SNCA 1II3A 1TS2A 4PMWA 2A68D 2NYZD 5IYDG 2KQ3A 5C5MA 1Q7YC 4G7HC 2A6ED 2WFWA 4LF8L 3DWPA 1PYSB 4DR6L 2G5DA 5I6YA 2OCEA 4A3JH 4CKCA 4ODGA 3WOEA 1XNRL 3BVGA 2UUCL 3J7YW 5IY0A 5C4ZA 3RN5A 3S16B 2Z4IA 1HR0Q 1BBUA 4LUZA 1QB5D 1I94Q 1IBML 2WACA 2XWBB 5JJLA 4DV2Q 5JEAG 5M5XB 1YJWA 1PZID 4HN7A 3J81i 2QKIC 3A56A 4IUQA 3OTOQ 2NZ1D 5JJZA 4ZKCB 4A3LG 4GKKL 5IYCG 1CHPD 4KKTA 4CKEA 1SXTA 1IXRA 4DR1L 3M4PA 5IGFA 4DV4Q 4ZUJA 2UUAL 2OWOA 1Y1WB 2BH2A 1FNWA 2DJGC 2I5MX 4JYAQ 2VNUD 4A3KG 4DXFA 1F9RA 3U9SA 4RA8A 5LMNL 4JI2L 2RVLA 3SE0A 1JE5A 1ONLA 1N34L 2LXJA 1YVCA 1TT2A 3RD4A 2Q8RE 5IGBA 2B2UC 1PH2A 4DV3L 4JI1L 3UE0A 1WYDA 5C0XH 1G6PA 4DV0L 1XMOL 5LL6S 4DGZA 1IBLQ 1H95A 1D5XC 4KKSA 2K75A 2B63H 4IPHA 1K83H 3D4RA 4DK6C 4J8QA 3S1NH 4I7AA 2HT1A 1TWAB 2EYOA 1JWUD 5D65A 1PTOC 1EYCA 1J9OA 2F0DA 3W1BA 3F8TA 2JEAI 1B7YB 2XTIA 2AWOA 2FMMA 4RGOS 2IT1A 4ZK9B 4X66Q 2G9DA 1HFNA 2HIVA 4KD3A 3G48A 1X65A 4K0KQ 1TWFB 3VA7A 2GVBA 1HR0W 2RDGA 3TP8A 4F7XA 3CMEA 1VQGA 4JI8L 4UP9A 3HOZB 4A3BH 3DUZA 1PH7A 3W1GA 4LF9L 2KBNA 1LTRD 5ELBA 4APVA 4RKLA 2SEBD 4ZQ3A 1AE3A 1H9JA 2E2DC 1MSHA 4X65Q 2CWPA 1G91A 2RA4A 3S24A 1VF5C 1HFGA 3PF5A 1Q8IA 3EFXD 3TN2A 3RZDB 2A69D 3K80C 3I73A 4B3SQ 4OHJA 4YWKA 3I4MB 3P20A 3SVMA 1Y8PB 4YCVA 4RAUC 1JORA 3AFPA 4GN5A 4KHPQ 4G57A 2NN6H 1U5KA 3S16H 4FXKC 4A75A 1B9MA 1XMQQ 3SHLA 4HJ9A 3T1YL 5M5XH 2WB1G 1BQQT 5DEHA 1VQCA 4QUCA 2XIWA 2R92G 1LABA 1BR9A 3K59A 5DNFA 3TP6A 4BWGB 5KNBA 4QUFA 1PFBA 3STBC 1CT1D 3I4OA 1SAPA 3K7UC 5A35A 4RCNA 5M3MG 1AN8A 1ENAA 2EXDA 5IYBH 2D9UA 1SE4A 5LHY1 4R4IA 2HQEA 3T1HL 3PUXA 2A6HC 3FEWX 4QY7A 1UUPA 1G8ZD 4GN4B 3K7AB 2WAQB 2KJXA 5FLXE 3G4SA 3A5UA 5AJ3L 2F0EA 1EU4A 2AQ1B 1F9QA 2CW0C 4LJZC 4HSVA 4UP7A 2ZJQA 4DV5Q 2ENBA 3TQYA 3NELA 3RN2A 1KDAA 5HY6A 4DV7L 3OWEB 4A3JG 1SROA 1T5EA 3AQQA 1MHWC 3R2IA 3D3RA 4LW1A 5COYA 2F0OA 1DONA 3DWAA 2JSOA 2O5JC 4CJ1B 2XN9C 1PFSA 1X9NA 4JPBW 3HP3A 2DNEA 3GTGB 5KEEA 2OF1A 2F4VQ 2LS01 1AW7A 5IT9c 2AUJD 4GN3B 1K8GA 4JV5L 1S3OA 4FF3A 2FMCA 5I4DA 2RCNA 2SNMA 1Y1VG 1X55A 4L5SA 1TWFH 2E2JB 1M4VA 3EROA 4LAAA 1Q82C 1N33Q 1HNWL 2H5XA 1A3VA 1GJXA 3A7LA 1F77A 4DR5Q 1S5CD 5EAYA 1I4QA 1YIJA 3HOZH 1TKWB 4M8AA 4JI5Q 1MGSA 2N3SA 3RR5A 2F0JA 3HKZB 1PH8A 1JJGA 3TS0A 4H7BA 1B70B 1EQVA 2F1MA 4QCLA 2FHTA 3Q0AA 1JOKA 2WAQE 5ELDA 4FP5D 1MIUA 5EPJA 1QILA 2EE1A 3RZDH 2AQ2B 4BY7B 2ZXRA 1CM9A 5C0XG 2ES2A 3I4MH 4MZ9A 2K4KA 1ZEQX 5C5LA 1YI2A 1PRTB 1Q1EA 4ZCKA 2B63G 1VQNA 2BOSA 1BOSA 1QE6A 4HIKA 3I7FA 4KN7C 1B3AA 2VXWA 3KUPA 5C4JB 3LX0A 2EDGA 1HR0L 3HOUB 1SLJA 1I94L 1E1TA 4KHZA 4DV2L 1BXTA 1FGBD 5E4WC 2L4NA 1O7ZA 1H9SA 3VR6A 1VQAA 1XTDA 5GADC 5GAHC 3M3YB 3NUCA 4O0AA 2BDOA 3OTOL 3T13A 2F0KA 3U4ZA 2L15A 2WV6D 1KRTA 2MPMA 4WJWA 2UXCQ 2PW5A 1KHIA 1PTOD 3OYYA 1QVCA 2VUMB 4LF4Q 3L9AX 4A3BG 3K7AH 4OWWB 3RLNA 2CWAA 1N9WA 5KNCA 4DV4L 2EQSA 3OMCA 4JYAL 2C35B 4HJ5A 3K81C 2WKDA 3SXHA 1PYBA 1Q1BA 3HKZE 4NXMQ 2CQOA 3CQZB 3SK4A 2NN6G 1RJTA 4BA1I 1FGUA 2GN5A 3FP9A 4QB4A 4RGTA 5A2QE 2DJFC 3IKJA 4GOPB 1RF2D 1SNOA 1IBLL 3A74A 3E6ZX 2MGSA 5GQOA 4ABNA 3AU7A 1NY4A 2BA0A 2KHIA 1SFOB 1IYVA 2E74C 5T1IA 5IE8A 2JA8H 2M9VA 4IALA 3MFGA 5IYBG 3D6WA 2QEXA 3EBEA 4X3TA 1S40A 2E2JH 4DR4Q 3EQLC 4FDBA 4C3IB 4A3GB 1N32Q 1Z47A 4X66L 1DGSA 5IP7H 1B2TA 4LFBQ 2RDHA 4K0KL 2OT2A 3MAQA 1E2VA 5I9PA 4L5RC 1LTSD 3STBD 1XNQQ 1I3QB 1E3PA 2OQKA 1I4HA 1S5ED 1HZAA 3NSWA 4O1NA 1GKHA 3ULLA 1K73C 3LWUA 3NBIA 3KK7A 1I6VC 1FJGL 4A3EB 1DOKA 4NMZA 4PMBA 2A6HD 4X65L 3QIAA 2IJ0A 2B2TA 3PUZA 2DY7A 1EY9A 2X69A 3ER0A 4UPAA 1U9RA 1BDOA 5J3BA 2CW0D 1VQDA 4JC0A 2F0WA 3KLSA 4DK1A 4TRDA 4KHPL 1LTBD 4TKOB 4UP8A 4A93B 5C4JH 2PZTA 1XMQL 1U4MA 2L5TA 1I4RA 2R7ZB 2P5ZX 4HIOA 1HH2P 1T9HA 4NW2A 3M3YH 3UDIA 3KFUA 5FO8B 3MHBA 4A3FB 3D6CA 3CC7A 3M4OB 3IL8A 3U50C 5JJIA 4S3SA 2MQHA 1HCZA 1K3BC 5KYLA 2ATWA 3BZDB 1UE5A 2VUMH 2UU9Q 2F4IA 3HOZG 3NQIA 2ZXPA 4JI7L 3CF5A 2F0PA 1PH9A 3M4QA 1WOCA 2ZTEA 3WDNA 1L0WA 1EYDA 1R4QB 1K0RA 2PCFB 3DM1A 2QA4A 2QGQA 2K33A 3ND9A 3RLOA 2D0OA 1HZ9A 4O2DA 3GTPB 3I4MG 1U0LA 1JJ2A 1SNDA 5EBCA 2O4XA 3CQZH 1IZ6A 1KTKA 2RSOA 2XRQD 1O78A 2A73B 3I2ZA 4DV5L 4LWCA 1EWCA 3KBGA 3GTLB 4ME3A 2EY2A 3OIQA 2F0VA 1VQKA 3K8AA 4XYQA 2HD3A 4YCWA 3IAYA 1DCZA 2A1AA 4YY3Q 4X3SA 1MJEA 4AYBE 2D62A 3HOXB 2F0FA 5T1GA 1DXMA 2XNAC 3RUZA 5FLXc 1L2FA 3PIO3 2F4VL 1T5XD 4JI4Q 3KDFA 4DPGA 2MFIA 4UHVA 1TY2A 5TSSA 4C3IH 1E24A 4A3GH 1C7YA 4DK3C 1JQYD 2WIIB 1FYCA 4NB3A 3IRBA 3D4WA 1D8LA 1XPOA 4EGVA 1XWEA 4XTCS 2WAQG 1E2WA 4BY1B 2EPBA 1HTPA 1I3QH 4KV6A 4EX5A 1STBA 1N33L 1I4GA 2X6LA 4C56C 4DR5L 4X3UA 4B3RQ 1GHJA 1VQHA 4JI5L 1Z6HA 4A3EH 1TR5A 3OMGA 3OOCA 1RIPA 3RZOB 1RTNA 1UE1A 2B2VC 5FKAC 1TXYA 2HIXA 1HA5A 2NVQH 4DV1Q 4HTHA 2EXZA 3HOYB 4ZYSA 1O80A 1WCMB 1L1OA 3QOLA 4C1NI 4QIWB 4ID6A 4QGUA 1K9MC 4A93H 4FXDA 4KMUC 2B2WC 2Q8TA 3SGIA 1L0YB 1GXDC 2KEEA 3CW2C 2K7VA 4R4QA 2R7ZH 4H44C 2QILA 3D4DA 4XDXA 4NXNQ 2JA8G 2KCNA 1EIHA 2K28A 5HGTA 4GKJQ 1K28A 3DWQA 3AYHB 4A3FH 3M4OH 4KHVA 3CAMA 2L12A 5AFWA 1KNEA 2E8GA 2L9HA 2YYZA 3EN2A 4JOIC 4KJOA 5IP7G 1NUCA 5EBDA 5DAUA 3NXWA 4KTAA 3CCRA 2H4OA 2F0HA 2IHEA 1HQMC 1B53A 2UXCL 4HSPA 3KF6A 4O42A 1ZKOA 4RG1A 2F03A 4LF4L 3LWEA 1OXXK 4FXGC 2RHSB 1DJRD 3DEPA 5I9OA 2ZJRA 3NE5B 1STEA 3SEBA 3GTPH 4JBJA 2ZTDA 2RHQB 4A3IB 1VQOA 3S1MB 2FFKB 4UDUC 5EPLA 1LTTD 2YU9B 5JOBA
chains in the Genus database with same CATH topology
3S16H 1LM0A 4JI6Q 3GTLH 3CCVA 4QQBX 1PV4A 4A75A 1XMQQ 1YHQA 4B3TL 4HJ9A 3T1YL 5M5XH 4KI0A 1PH1A 2WB1G 4NXML 1N36Q 1VQCA 4DNIA 3PO2G 1LUZA 1VQJA 4B3ML 2EIFA 2R92G 4LFCQ 3VDYA 1K8AC 1EQRA 1X56A 3JAMi 3HOXH 4KLKA 3U58A 4H02A 3H3VI 1D7QA 5IWAQ 1X3EA 4IJHA 3ZJYC 2WP8J 3STBC 3I4NG 2RF4A 3BJUA 4QIWE 1W2BA 4IPDA 3K7UC 3I4OA 4EQ5A 1C0AA 1NE3A 1WJJA 4JI3L 5M3MG 2UXDQ 2OQ0A 3HOVH 2EXDA 5IYBH 3ULPA 5HGQA 1NJIC 4R4IA 3H0GG 4P73A 3OW2A 4AQYQ 2VZAA 1G51A 4BBRH 4GNXA 2ZM6Q 1PA6A 3H3VH 3T1HL 1SFOH 1JB7A 3CCEA 3PUXA 1XPRA 2VUMG 4QY7A 4DKAC 4DR3L 4GN4B 3G4SA 4DR4L 3A5UA 4BY1H 5AJ3L 3KDFB 2ZJPA 2NZOA 3DLLA 1W3SA 2UUBQ 4LF8Q 4DR6Q 1CKNB 1N32L 2OTJA 1YJNA 4PZ6A 4JI0Q 5DLQE 4LFBL 1QVFA 3DM3A 3PUYA 1M90C 1XNRQ 4Y52H 2UUCQ 4UP7A 2ZJQA 3RLFA 3CCLA 4DV5Q 1A62A 2JA6G 3TQYA 1XNQL 3JAMc 3NELA 1VQLA 3RN2A 5C0XI 1HNZL 2Q2TA 5HY6A 4DV7L 2JJQA 5IP9G 4A3JG 1IBMQ 1SROA 1YHAA 3S1QH 2F52A 5C4XH 3RZOH 1S72A 1MJCA 1I6HH 3AQQA 4JBMA 1KIXA 2JE6I 3WWVA 1VQ7A 4LF7L 3F1ZA 4LW1A 4MNOA 3J81c 1A63A 3HOYH 1NMGA 1WCMH 2AMCB 3CPWA 4DR7L 1PFSA 1X9NA 4X6AH 1TWGH 1I5FA 2E5LQ 2WB1E 3RNUA 4GKKQ 2F4VQ 5IT9c 3J80i 1X3GA 4YCUA 4GN3B 1PVOA 1UWVA 1YBYA 2Z6KC 1K8GA 2BH8A 4JV5L 2CCZA 1S3OA 1KD1C 2CFMA 4TVAB 4DR1Q 1SN8A 2CKZB 2UUAQ 1L1OB 3E9HA 3B6YA 2RCNA 1Y1VG 1X55A 2GVAA 1TWCH 4L5SA 1TWFH 1VQ8A 4A3GG 4LFAL 1Q82C 1N33Q 4RMFA 1HNWL 2H5XA 2PI2A 2R7FA 5LMNQ 1EIYB 2I5HA 4DR5Q 1JJCB 5EAYA 4P72A 1N34Q 3PO3H 1YIJA 4PG3A 1EFWA 1KAWA 2IX1A 3HOZH 4IFDJ 5ELOA 2K5VA 3CD6A 4GLXA 2YV5A 5C0XJ 4JI5Q 4A3CG 2N3SA 3RR5A 3F2DA 4DUZQ 2E2IH 4LF5Q 1XPUA 1PH8A 1JJGA 3GTKH 3ERSX 3TS0A 1PH6A 4DV3Q 4JI1Q 1FL0A 1B70B 1YEZA 4P74A 4DV0Q 1XMOQ 3PF4A 3FKIH 2UU9L 1Q12A 1J5EL 1Q46A 4A4IA 4UY8C 1UEBA 5IYDH 3J80c 3CXCA 4DR2Q 2WAQE 1RL2A 1EYGA 1MIUA 2LXKA 5H1SE 4A3EG 4DUYL 3RZDH 4DAYB 4IFDG 1SMXA 2IY5B 3HKZG 2ES2A 5C0XG 2UXBQ 3I4MH 4MZ9A 2R6GA 4A3IH 3KOJA 2NN6I 4HJ7A 4LF6L 2K4KA 3S1MH 2JA9A 3G6EA 1SR3A 4IPGA 1YI2A 2YU9H 1Q1EA 4AYBG 2NZHA 2B63G 1VQNA 3E9IA 3PV0A 1JT8A 5M3FG 1J6QA 2PNHA 4HIDA 3KYHC 3J7ZC 4LFAQ 4BY7G 1ASZA 3HOWG 4HIKA 2K52A 1HNXQ 3I7FA 3BZKA 4DV6L 4X64Q 4A93G 4A3DH 5FJ8G 1A8VA 1OTCA 4DAMA 1HR0L 1SLJA 3F2BA 1I94L 4LNQA 2VQEL 1CKMA 1E1TA 2R92H 4KHZA 4DV2L 4C2MH 3NEMA 4A3LH 4Y7NH 3PIOA 2HHHL 2R7ZG 5IYCH 5GADC 1VQAA 1XTDA 5GAHC 4YY3L 2HQLA 2Q2IA 4O0AA 3D0FA 4JI8Q 3TREA 3OTOL 4LUOA 4A3FG 3BU2A 3JC66 4AIMA 3HOUG 3U4ZA 3GO5A 2L15A 1KRTA 2ASBA 4LF9Q 4IOAA 1EWIA 2UXCQ 4JI4L 1KHIA 4BBSG 2KENA 1OXVA 2VL6A 1QVCA 3OYYA 1QVGA 4OX9L 3GTMH 4LF4Q 3K0XA 5C44H 3K7AH 4OWWB 3RLNA 4A3BG 1AH9A 1CSQA 1LYLA 2ALYB 2CWAA 4A3KH 1N9WA 3NENA 4JOIA 2ZTCA 4DV4L 2XGTA 2Y0SG 1OXTA 5IP9H 4HIMA 1YITA 1IL2A 2EQSA 1Y1WH 4J15A 1TWHH 1P8LA 1Z9FA 4GNXB 2PI2E 2Q2HA 4A3MG 2VW9A 4BXXG 2C35B 1GM5A 4JYAL 4HJ5A 3K81C 3LGJA 1VQFA 2N78A 2I0QA 1PYBA 1Q1BA 3HKZE 3J81j 5LMUL 1QZGA 4B3TQ 1L1OC 5LMNW 1PH3A 2R93G 3TS2A 3T1YQ 4NXMQ 1CKOA 2I5LX 2CQOA 2K5NA 4OO1I 4X62L 1E7ZA 1P16A 1WFQA 2NN6G 3EIVA 3HKSA 4BA1I 3KJOA 1FGUA 2GN5A 4B3MQ 3M7NA 3FP9A 1VQPA 4GOPA 4YHHQ 1BKBA 1QUQA 2MNAA 5C3EH 1R9TH 1FVIA 5FLMH 4GOPB 1QUQB 2VQFL 1GO3E 1IBLL 3A74A 4JG2A 3U4VA 4HJ8A 1Y1VH 2PMZE 4JI3Q 1KXLA 5GQOA 4DV1L 4JBKA 1HZCA 2PQAA 3HOXG 2Z0SA 1NY4A 1WI5A 2BA0A 2PQAB 1X6OA 3L2PA 1CUKA 4A76A 2KHIA 2VY3A 4L5TA 3I55A 3T1HQ 1IBKL 5IE8A 1TWAH 1KRSA 2JA8H 4WJ4A 2NVYH 3HOVG 1G291 4DR3Q 5IYBG 1GVPA 2QEXA 3EBEA 3F2CA 1S40A 2E2JH 2JA5H 4DR4Q 4P75A 5AJ3Q 4FDBA 1N32Q 3UDXA 1O7IA 1Z47A 4BBRG 1Q86C 3E0EA 1SE8A 1DGSA 3MXNB 1VS0A 4X66L 3KJPA 4NXNL 1VQ4A 4BA2I 5IP7H 4R4CA 3H15A 4LFBQ 4R4OA 2B3GA 2JA7H 4GKJL 4K0KL 1LTLA 3MEFA 5BR8L 4BY1G 4L5RC 4B3RL 4GS3A 3STBD 1XNQQ 1YNXA 3M85A 1V1QA 1HNZQ 1E3PA 2OQKA 4IPCA 4DV7Q 1E1OA 1HZAA 1GKHA 3PCOB 2AKWB 1VQEA 3ULLA 5GAEC 1I50H 1K73C 4LF7Q 1OXSC 3D31A 1FJGL 1VQ9A 1UE6A 4DR7Q 2A8VA 2B29A 3PUWA 4X65L 2AWNA 5C4XG 3KF8B 3PUZA 1HZBA 4OONA 4UPAA 3ER0A 3HOYG 1VQBA 5J3BA 2Q2UA 3AFQA 4JV5Q 3UE1A 1XJVA 1VQDA 4JBWA 1CSPA 2K14A 4JC0A 4MTNA 4OWXB 4KHPL 3GTJH 1OXUA 3CCMA 3PO2H 4UP8A 1X3FA 4YHHL 2K50A 2OTLA 2V1CC 3UDFA 1HJPA 1K3RA 5C4JH 4IO9A 4JI6L 3PUVA 1XMQL 1NMFA 3GDEA 2K5HA 3CP0A 3I4NH 1HNWQ 3CC4A 5GROA 4QL5A 1N36L 4GNXC 4HIOA 1HH2P 1T9HA 1YJ9A 4LFCL 3UDIA 3A0JA 5M3MH 3KFUA 2Z6KA 3M3YH 1X54A 4TQUS 3GTOH 4POGA 3CC7A 1FJGQ 5IWAL 3H0GH 3U50C 3CCQA 1C9OA 5JJIA 1IYJB 5GAGC 2VS1A 2NVTH 2MQHA 2UXDL 3PO3G 1PHJA 2ATWA 2VUMH 1UE5A 2UU9Q 4ALPA 3HOZG 1J5EQ 1NTGA 3AEVA 4JI7L 1MKHA 4AQYL 1PH5A 3CF5A 1YHBA 2FXQA 2ZM6L 1Q8KA 4DUYQ 3CMAA 4PMWA 1PH9A 3M4QA 1WOCA 2D0PA 1N8RC 2ZTEA 4R1JA 1L0WA 4LF6Q 3FKIG 3HFZB 2A19A 5IYDG 1K0RA 2QA4A 5M5WH 1NBWA 2QGQA 1Q7YC 2WFWA 4LF8L 2JA6H 5JEAJ 2UUBL 1PYSB 3RLOA 2D0OA 4LUVA 4DR6L 2BA1A 4C3HH 3G71A 2OCEA 1HZ9A 4O2DA 4PZ8A 4A3JH 4JI0L 1VQMA 3I4MG 2KCTA 1U0LA 4A3IG 1JJ2A 1XNRL 3CQZH 1IZ6A 2UUCL 2NVXH 3J7A5 3S2HH 1AE2A 4DV6Q 5IY0A 3I2ZA 4DV5L 4LWCA 4QJFA 3RN5A 1V9PA 4ME3A 1HR0Q 1BBUA 4LUZA 1VQKA 1I94Q 2VQEQ 3PSIA 1IBML 3K8AA 5JJLA 4DV2Q 5JEAG 1V43A 3UDGA 1YJWA 4YCWA 2HHHQ 2A1AA 4A3DG 3ULJA 1SRUA 4YY3Q 3J81i 3TEHB 4AYBE 1MJEA 2D62A 3OTOQ 3PGZA 4JI7Q 2KCMA 1EIFA 1VQ5A 3GTQH 2E5LL 3M9BA 3BZCA 4OXPA 4YWLA 5FLXc 1L2FA 2F4VL 3KLWA 3GTGH 4A3LG 5IYCG 4GKKL 2YTXA 4JI4Q 3KDFA 3S2DH 4DPGA 1Q81C 4OX9Q 2MFIA 1CKNA 2R7DA 5JJKA 4L5QA 1IXRA 2MO1A 3S1RH 4C3IH 1E24A 4DR1L 3PIPA 1C7YA 4A3GH 1VQIA 3FHWA 2E2HH 3NBHB 3M4PA 4DK3C 4DV4Q 2UUAL 2OWOA 1BBWA 2BH2A 4NB3A 1EUJA 3IRBA 3CCSA 1D8LA 1XPOA 5C44G 2I5MX 4XTCS 2WAQG 4JYAQ 4IFDI 2VNUD 4A3KG 4A3CH 1I3QH 4AH6A 4EX5A 3CCUA 1N33L 5ELNA 5LMNL 4JI2L 5LMUQ 3L7ZC 4DR5L 1JE5A 1Y1WG 1N34L 2LXJA 2IX0A 1YVCA 4X62Q 2KHJA 3CPFA 4B3RQ 4JI5L 1VQHA 1ASYA 4C3JH 1A0IA 4HJAA 4DUZL 4A3EH 1QZHA 4LF5L 1UE7A 3TRZA 4OWTB 1PH2A 4DV3L 4JI1L 2Y0SE 3UE0A 1WYDA 2DUDA 1G6PA 4DV0L 1EQQA 3S15H 1RIPA 1XMOL 2VQFQ 2YTYA 2N8NA 1UE1A 1IBLQ 1TXYA 2HIXA 2JQOA 4DR2L 2MO0A 2IHFA 2NVQH 1Y14B 1H95A 3CC2A 4DV1Q 5E7NA 2K75A 3W5OA 2B63H 4IPHA 1BVSA 2JK8A 3GD7A 5C3EG 5M3FH 1K83H 1L1OA 4DK6C 2N49A 5FLMG 4GLVB 2UXBL 3S1NH 4BY7H 4QGUA 3HOWH 3S17H 2HT1A 1K9MC 2AHOB 1IBKQ 4A93H 1KC8C 5FJ8H 4IOCA 4OO1G 3SGIA 3W1BA 1WCMG 3F8TA 2JEAI 1B7YB 2XTIA 3CW2C 4JI2Q 4POFA 2AWOA 4B3SL 4PZ7A 4R4QA 1HNXL 2R7ZH 2IT1A 4X66Q 4X64L 4NXNQ 4YWMA 2JA8G 2HIVA 4GKJQ 3G48A 1X65A 4K0KQ 4P71A 3Q8DA 5BR8Q 4R4TA 3AYHB 2GVBA 4A3FH 2JA5G 3M4OH 3HOUH 1YZ6A 1VQ6A 4IJLA 3ICEA 1HR0W 3CAMA 1M1KC 4JOIC 2E8GA 2YYZA 3EN2A 5IP7G 4BBSH 3CMEA 4XIGS 1VQGA 4GLAC 2JA7G 2ID0A 4JI8L 1VCIA 4UP9A 4A3BH 3CCRA 3I56A 1PH7A 3W1GA 1KL9A 2YTVA 2DGYA 1B8AA 2IHEA 2KBNA 4LF9L 1KQSA 4JCVE 2UXCL 5K36G 4APVA 3A5ZB 3KF6A 1AE3A 3CCJA 4X65Q 4RG1A 1JMCA 4LF4L 2CWPA 3KF6B 1OXXK 4A3MH 3S24A 3L0OA 2RHSB 4BXXH 3PF5A 3S14H 2F3IA 5M5YH 2ZJRA 2LSSA 4GOPC 3K80C 3GTPH 4B3SQ 1GD7A 4YWKA 4JBJA 2ZTDA 2R93H 2RHQB 1VQOA 1PH4A 4WJ3M 4YCVA 3AFPA 4GN5A 4NPSA 4KHPQ 2JEBI 1EOVA 1E22A 1U5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S16 H;  1LM0 A;  4JI6 Q;  3GTL H;  3CCV A;  4QQB X;  1PV4 A;  4A75 A;  1XMQ Q;  1YHQ A;  4B3T L;  4HJ9 A;  3T1Y L;  5M5X H;  4KI0 A;  1PH1 A;  2WB1 G;  4NXM L;  1N36 Q;  1VQC A;  4DNI A;  3PO2 G;  1LUZ A;  1VQJ A;  4B3M L;  2EIF A;  2R92 G;  4LFC Q;  3VDY A;  1K8A C;  1EQR A;  1X56 A;  3JAM i;  3HOX H;  4KLK A;  3U58 A;  4H02 A;  3H3V I;  1D7Q A;  5IWA Q;  1X3E A;  4IJH A;  3ZJY C;  2WP8 J;  3STB C;  3I4N G;  2RF4 A;  3BJU A;  4QIW E;  1W2B A;  4IPD A;  3K7U C;  3I4O A;  4EQ5 A;  1C0A A;  1NE3 A;  1WJJ A;  4JI3 L;  5M3M G;  2UXD Q;  2OQ0 A;  3HOV H;  2EXD A;  5IYB H;  3ULP A;  5HGQ A;  1NJI C;  4R4I A;  3H0G G;  4P73 A;  3OW2 A;  4AQY Q;  2VZA A;  1G51 A;  4BBR H;  4GNX A;  2ZM6 Q;  1PA6 A;  3H3V H;  3T1H L;  1SFO H;  1JB7 A;  3CCE A;  3PUX A;  1XPR A;  2VUM G;  4QY7 A;  4DKA C;  4DR3 L;  4GN4 B;  3G4S A;  4DR4 L;  3A5U A;  4BY1 H;  5AJ3 L;  3KDF B;  2ZJP A;  2NZO A;  3DLL A;  1W3S A;  2UUB Q;  4LF8 Q;  4DR6 Q;  1CKN B;  1N32 L;  2OTJ A;  1YJN A;  4PZ6 A;  4JI0 Q;  5DLQ E;  4LFB L;  1QVF A;  3DM3 A;  3PUY A;  1M90 C;  1XNR Q;  4Y52 H;  2UUC Q;  4UP7 A;  2ZJQ A;  3RLF A;  3CCL A;  4DV5 Q;  1A62 A;  2JA6 G;  3TQY A;  1XNQ L;  3JAM c;  3NEL A;  1VQL A;  3RN2 A;  5C0X I;  1HNZ L;  2Q2T A;  5HY6 A;  4DV7 L;  2JJQ A;  5IP9 G;  4A3J G;  1IBM Q;  1SRO A;  1YHA A;  3S1Q H;  2F52 A;  5C4X H;  3RZO H;  1S72 A;  1MJC A;  1I6H H;  3AQQ A;  4JBM A;  1KIX A;  2JE6 I;  3WWV A;  1VQ7 A;  4LF7 L;  3F1Z A;  4LW1 A;  4MNO A;  3J81 c;  1A63 A;  3HOY H;  1NMG A;  1WCM H;  2AMC B;  3CPW A;  4DR7 L;  1PFS A;  1X9N A;  4X6A H;  1TWG H;  1I5F A;  2E5L Q;  2WB1 E;  3RNU A;  4GKK Q;  2F4V Q;  5IT9 c;  3J80 i;  1X3G A;  4YCU A;  4GN3 B;  1PVO A;  1UWV A;  1YBY A;  2Z6K C;  1K8G A;  2BH8 A;  4JV5 L;  2CCZ A;  1S3O A;  1KD1 C;  2CFM A;  4TVA B;  4DR1 Q;  1SN8 A;  2CKZ B;  2UUA Q;  1L1O B;  3E9H A;  3B6Y A;  2RCN A;  1Y1V G;  1X55 A;  2GVA A;  1TWC H;  4L5S A;  1TWF H;  1VQ8 A;  4A3G G;  4LFA L;  1Q82 C;  1N33 Q;  4RMF A;  1HNW L;  2H5X A;  2PI2 A;  2R7F A;  5LMN Q;  1EIY B;  2I5H A;  4DR5 Q;  1JJC B;  5EAY A;  4P72 A;  1N34 Q;  3PO3 H;  1YIJ A;  4PG3 A;  1EFW A;  1KAW A;  2IX1 A;  3HOZ H;  4IFD J;  5ELO A;  2K5V A;  3CD6 A;  4GLX A;  2YV5 A;  5C0X J;  4JI5 Q;  4A3C G;  2N3S A;  3RR5 A;  3F2D A;  4DUZ Q;  2E2I H;  4LF5 Q;  1XPU A;  1PH8 A;  1JJG A;  3GTK H;  3ERS X;  3TS0 A;  1PH6 A;  4DV3 Q;  4JI1 Q;  1FL0 A;  1B70 B;  1YEZ A;  4P74 A;  4DV0 Q;  1XMO Q;  3PF4 A;  3FKI H;  2UU9 L;  1Q12 A;  1J5E L;  1Q46 A;  4A4I A;  4UY8 C;  1UEB A;  5IYD H;  3J80 c;  3CXC A;  4DR2 Q;  2WAQ E;  1RL2 A;  1EYG A;  1MIU A;  2LXK A;  5H1S E;  4A3E G;  4DUY L;  3RZD H;  4DAY B;  4IFD G;  1SMX A;  2IY5 B;  3HKZ G;  2ES2 A;  5C0X G;  2UXB Q;  3I4M H;  4MZ9 A;  2R6G A;  4A3I H;  3KOJ A;  2NN6 I;  4HJ7 A;  4LF6 L;  2K4K A;  3S1M H;  2JA9 A;  3G6E A;  1SR3 A;  4IPG A;  1YI2 A;  2YU9 H;  1Q1E A;  4AYB G;  2NZH A;  2B63 G;  1VQN A;  3E9I A;  3PV0 A;  1JT8 A;  5M3F G;  1J6Q A;  2PNH A;  4HID A;  3KYH C;  3J7Z C;  4LFA Q;  4BY7 G;  1ASZ A;  3HOW G;  4HIK A;  2K52 A;  1HNX Q;  3I7F A;  3BZK A;  4DV6 L;  4X64 Q;  4A93 G;  4A3D H;  5FJ8 G;  1A8V A;  1OTC A;  4DAM A;  1HR0 L;  1SLJ A;  3F2B A;  1I94 L;  4LNQ A;  2VQE L;  1CKM A;  1E1T A;  2R92 H;  4KHZ A;  4DV2 L;  4C2M H;  3NEM A;  4A3L H;  4Y7N H;  3PIO A;  2HHH L;  2R7Z G;  5IYC H;  5GAD C;  1VQA A;  1XTD A;  5GAH C;  4YY3 L;  2HQL A;  2Q2I A;  4O0A A;  3D0F A;  4JI8 Q;  3TRE A;  3OTO L;  4LUO A;  4A3F G;  3BU2 A;  3JC6 6;  4AIM A;  3HOU G;  3U4Z A;  3GO5 A;  2L15 A;  1KRT A;  2ASB A;  4LF9 Q;  4IOA A;  1EWI A;  2UXC Q;  4JI4 L;  1KHI A;  4BBS G;  2KEN A;  1OXV A;  2VL6 A;  1QVC A;  3OYY A;  1QVG A;  4OX9 L;  3GTM H;  4LF4 Q;  3K0X A;  5C44 H;  3K7A H;  4OWW B;  3RLN A;  4A3B G;  1AH9 A;  1CSQ A;  1LYL A;  2ALY B;  2CWA A;  4A3K H;  1N9W A;  3NEN A;  4JOI A;  2ZTC A;  4DV4 L;  2XGT A;  2Y0S G;  1OXT A;  5IP9 H;  4HIM A;  1YIT A;  1IL2 A;  2EQS A;  1Y1W H;  4J15 A;  1TWH H;  1P8L A;  1Z9F A;  4GNX B;  2PI2 E;  2Q2H A;  4A3M G;  2VW9 A;  4BXX G;  2C35 B;  1GM5 A;  4JYA L;  4HJ5 A;  3K81 C;  3LGJ A;  1VQF A;  2N78 A;  2I0Q A;  1PYB A;  1Q1B A;  3HKZ E;  3J81 j;  5LMU L;  1QZG A;  4B3T Q;  1L1O C;  5LMN W;  1PH3 A;  2R93 G;  3TS2 A;  3T1Y Q;  4NXM Q;  1CKO A;  2I5L X;  2CQO A;  2K5N A;  4OO1 I;  4X62 L;  1E7Z A;  1P16 A;  1WFQ A;  2NN6 G;  3EIV A;  3HKS A;  4BA1 I;  3KJO A;  1FGU A;  2GN5 A;  4B3M Q;  3M7N A;  3FP9 A;  1VQP A;  4GOP A;  4YHH Q;  1BKB A;  1QUQ A;  2MNA A;  5C3E H;  1R9T H;  1FVI A;  5FLM H;  4GOP B;  1QUQ B;  2VQF L;  1GO3 E;  1IBL L;  3A74 A;  4JG2 A;  3U4V A;  4HJ8 A;  1Y1V H;  2PMZ E;  4JI3 Q;  1KXL A;  5GQO A;  4DV1 L;  4JBK A;  1HZC A;  2PQA A;  3HOX G;  2Z0S A;  1NY4 A;  1WI5 A;  2BA0 A;  2PQA B;  1X6O A;  3L2P A;  1CUK A;  4A76 A;  2KHI A;  2VY3 A;  4L5T A;  3I55 A;  3T1H Q;  1IBK L;  5IE8 A;  1TWA H;  1KRS A;  2JA8 H;  4WJ4 A;  2NVY H;  3HOV G;  1G29 1;  4DR3 Q;  5IYB G;  1GVP A;  2QEX A;  3EBE A;  3F2C A;  1S40 A;  2E2J H;  2JA5 H;  4DR4 Q;  4P75 A;  5AJ3 Q;  4FDB A;  1N32 Q;  3UDX A;  1O7I A;  1Z47 A;  4BBR G;  1Q86 C;  3E0E A;  1SE8 A;  1DGS A;  3MXN B;  1VS0 A;  4X66 L;  3KJP A;  4NXN L;  1VQ4 A;  4BA2 I;  5IP7 H;  4R4C A;  3H15 A;  4LFB Q;  4R4O A;  2B3G A;  2JA7 H;  4GKJ L;  4K0K L;  1LTL A;  3MEF A;  5BR8 L;  4BY1 G;  4L5R C;  4B3R L;  4GS3 A;  3STB D;  1XNQ Q;  1YNX A;  3M85 A;  1V1Q A;  1HNZ Q;  1E3P A;  2OQK A;  4IPC A;  4DV7 Q;  1E1O A;  1HZA A;  1GKH A;  3PCO B;  2AKW B;  1VQE A;  3ULL A;  5GAE C;  1I50 H;  1K73 C;  4LF7 Q;  1OXS C;  3D31 A;  1FJG L;  1VQ9 A;  1UE6 A;  4DR7 Q;  2A8V A;  2B29 A;  3PUW A;  4X65 L;  2AWN A;  5C4X G;  3KF8 B;  3PUZ A;  1HZB A;  4OON A;  4UPA A;  3ER0 A;  3HOY G;  1VQB A;  5J3B A;  2Q2U A;  3AFQ A;  4JV5 Q;  3UE1 A;  1XJV A;  1VQD A;  4JBW A;  1CSP A;  2K14 A;  4JC0 A;  4MTN A;  4OWX B;  4KHP L;  3GTJ H;  1OXU A;  3CCM A;  3PO2 H;  4UP8 A;  1X3F A;  4YHH L;  2K50 A;  2OTL A;  2V1C C;  3UDF A;  1HJP A;  1K3R A;  5C4J H;  4IO9 A;  4JI6 L;  3PUV A;  1XMQ L;  1NMF A;  3GDE A;  2K5H A;  3CP0 A;  3I4N H;  1HNW Q;  3CC4 A;  5GRO A;  4QL5 A;  1N36 L;  4GNX C;  4HIO A;  1HH2 P;  1T9H A;  1YJ9 A;  4LFC L;  3UDI A;  3A0J A;  5M3M H;  3KFU A;  2Z6K A;  3M3Y H;  1X54 A;  4TQU S;  3GTO H;  4POG A;  3CC7 A;  1FJG Q;  5IWA L;  3H0G H;  3U50 C;  3CCQ A;  1C9O A;  5JJI A;  1IYJ B;  5GAG C;  2VS1 A;  2NVT H;  2MQH A;  2UXD L;  3PO3 G;  1PHJ A;  2ATW A;  2VUM H;  1UE5 A;  2UU9 Q;  4ALP A;  3HOZ G;  1J5E Q;  1NTG A;  3AEV A;  4JI7 L;  1MKH A;  4AQY L;  1PH5 A;  3CF5 A;  1YHB A;  2FXQ A;  2ZM6 L;  1Q8K A;  4DUY Q;  3CMA A;  4PMW A;  1PH9 A;  3M4Q A;  1WOC A;  2D0P A;  1N8R C;  2ZTE A;  4R1J A;  1L0W A;  4LF6 Q;  3FKI G;  3HFZ B;  2A19 A;  5IYD G;  1K0R A;  2QA4 A;  5M5W H;  1NBW A;  2QGQ A;  1Q7Y C;  2WFW A;  4LF8 L;  2JA6 H;  5JEA J;  2UUB L;  1PYS B;  3RLO A;  2D0O A;  4LUV A;  4DR6 L;  2BA1 A;  4C3H H;  3G71 A;  2OCE A;  1HZ9 A;  4O2D A;  4PZ8 A;  4A3J H;  4JI0 L;  1VQM A;  3I4M G;  2KCT A;  1U0L A;  4A3I G;  1JJ2 A;  1XNR L;  3CQZ H;  1IZ6 A;  2UUC L;  2NVX H;  3J7A 5;  3S2H H;  1AE2 A;  4DV6 Q;  5IY0 A;  3I2Z A;  4DV5 L;  4LWC A;  4QJF A;  3RN5 A;  1V9P A;  4ME3 A;  1HR0 Q;  1BBU A;  4LUZ A;  1VQK A;  1I94 Q;  2VQE Q;  3PSI A;  1IBM L;  3K8A A;  5JJL A;  4DV2 Q;  5JEA G;  1V43 A;  3UDG A;  1YJW A;  4YCW A;  2HHH Q;  2A1A A;  4A3D G;  3ULJ A;  1SRU A;  4YY3 Q;  3J81 i;  3TEH B;  4AYB E;  1MJE A;  2D62 A;  3OTO Q;  3PGZ A;  4JI7 Q;  2KCM A;  1EIF A;  1VQ5 A;  3GTQ H;  2E5L L;  3M9B A;  3BZC A;  4OXP A;  4YWL A;  5FLX c;  1L2F A;  2F4V L;  3KLW A;  3GTG H;  4A3L G;  5IYC G;  4GKK L;  2YTX A;  4JI4 Q;  3KDF A;  3S2D H;  4DPG A;  1Q81 C;  4OX9 Q;  2MFI A;  1CKN A;  2R7D A;  5JJK A;  4L5Q A;  1IXR A;  2MO1 A;  3S1R H;  4C3I H;  1E24 A;  4DR1 L;  3PIP A;  1C7Y A;  4A3G H;  1VQI A;  3FHW A;  2E2H H;  3NBH B;  3M4P A;  4DK3 C;  4DV4 Q;  2UUA L;  2OWO A;  1BBW A;  2BH2 A;  4NB3 A;  1EUJ A;  3IRB A;  3CCS A;  1D8L A;  1XPO A;  5C44 G;  2I5M X;  4XTC S;  2WAQ G;  4JYA Q;  4IFD I;  2VNU D;  4A3K G;  4A3C H;  1I3Q H;  4AH6 A;  4EX5 A;  3CCU A;  1N33 L;  5ELN A;  5LMN L;  4JI2 L;  5LMU Q;  3L7Z C;  4DR5 L;  1JE5 A;  1Y1W G;  1N34 L;  2LXJ A;  2IX0 A;  1YVC A;  4X62 Q;  2KHJ A;  3CPF A;  4B3R Q;  4JI5 L;  1VQH A;  1ASY A;  4C3J H;  1A0I A;  4HJA A;  4DUZ L;  4A3E H;  1QZH A;  4LF5 L;  1UE7 A;  3TRZ A;  4OWT B;  1PH2 A;  4DV3 L;  4JI1 L;  2Y0S E;  3UE0 A;  1WYD A;  2DUD A;  1G6P A;  4DV0 L;  1EQQ A;  3S15 H;  1RIP A;  1XMO L;  2VQF Q;  2YTY A;  2N8N A;  1UE1 A;  1IBL Q;  1TXY A;  2HIX A;  2JQO A;  4DR2 L;  2MO0 A;  2IHF A;  2NVQ H;  1Y14 B;  1H95 A;  3CC2 A;  4DV1 Q;  5E7N A;  2K75 A;  3W5O A;  2B63 H;  4IPH A;  1BVS A;  2JK8 A;  3GD7 A;  5C3E G;  5M3F H;  1K83 H;  1L1O A;  4DK6 C;  2N49 A;  5FLM G;  4GLV B;  2UXB L;  3S1N H;  4BY7 H;  4QGU A;  3HOW H;  3S17 H;  2HT1 A;  1K9M C;  2AHO B;  1IBK Q;  4A93 H;  1KC8 C;  5FJ8 H;  4IOC A;  4OO1 G;  3SGI A;  3W1B A;  1WCM G;  3F8T A;  2JEA I;  1B7Y B;  2XTI A;  3CW2 C;  4JI2 Q;  4POF A;  2AWO A;  4B3S L;  4PZ7 A;  4R4Q A;  1HNX L;  2R7Z H;  2IT1 A;  4X66 Q;  4X64 L;  4NXN Q;  4YWM A;  2JA8 G;  2HIV A;  4GKJ Q;  3G48 A;  1X65 A;  4K0K Q;  4P71 A;  3Q8D A;  5BR8 Q;  4R4T A;  3AYH B;  2GVB A;  4A3F H;  2JA5 G;  3M4O H;  3HOU H;  1YZ6 A;  1VQ6 A;  4IJL A;  3ICE A;  1HR0 W;  3CAM A;  1M1K C;  4JOI C;  2E8G A;  2YYZ A;  3EN2 A;  5IP7 G;  4BBS H;  3CME A;  4XIG S;  1VQG A;  4GLA C;  2JA7 G;  2ID0 A;  4JI8 L;  1VCI A;  4UP9 A;  4A3B H;  3CCR A;  3I56 A;  1PH7 A;  3W1G A;  1KL9 A;  2YTV A;  2DGY A;  1B8A A;  2IHE A;  2KBN A;  4LF9 L;  1KQS A;  4JCV E;  2UXC L;  5K36 G;  4APV A;  3A5Z B;  3KF6 A;  1AE3 A;  3CCJ A;  4X65 Q;  4RG1 A;  1JMC A;  4LF4 L;  2CWP A;  3KF6 B;  1OXX K;  4A3M H;  3S24 A;  3L0O A;  2RHS B;  4BXX H;  3PF5 A;  3S14 H;  2F3I A;  5M5Y H;  2ZJR A;  2LSS A;  4GOP C;  3K80 C;  3GTP H;  4B3S Q;  1GD7 A;  4YWK A;  4JBJ A;  2ZTD A;  2R93 H;  2RHQ B;  1VQO A;  1PH4 A;  4WJ3 M;  4YCV A;  3AFP A;  4GN5 A;  4NPS A;  4KHP Q;  2JEB I;  1EOV A;  1E22 A;  1U5K A; 
#chains in the Genus database with same CATH topology
 1LM0 A;  4JI6 Q;  3GTL H;  4QQB X;  3J80 L;  1YHQ A;  4QMG A;  1EWH A;  1GUO A;  4HMI A;  4NXM L;  1ESR A;  4XT3 B;  1N36 Q;  5ISR A;  1KAB A;  2SNS A;  1VQJ A;  4A3D B;  4ZUI A;  1K8A C;  1EQR A;  3DMU A;  3HOX H;  4H02 A;  1D7Q A;  1X3E A;  4IJH A;  1GUS A;  1ILQ A;  4C2M B;  4QIW E;  2NVT B;  4Y7N B;  5CBE E;  1S4Z A;  4PQX A;  3M4Y A;  3O13 A;  3VR3 A;  1PYW D;  1F2Z A;  4GNX A;  2EYJ A;  1JB7 A;  4J6H A;  2VUM G;  3GTM B;  2L11 A;  5C44 B;  4OEL B;  4DR4 L;  1SBB B;  1UNS A;  2F0Q A;  2LKV A;  4RGM A;  3SK5 A;  3A8K E;  3VR2 A;  2UUB Q;  4BY1 H;  1N32 L;  1CKN B;  3HEJ A;  4JI0 Q;  1LT3 D;  4XT1 B;  4LFB L;  4HAE A;  1QVF A;  3DM3 A;  2NVX B;  4Q5V A;  3MVV A;  1XNQ L;  5C0X I;  5IP9 G;  2FIN B;  2F52 A;  3RZO H;  1S72 A;  3J81 c;  4K2K A;  3HOY H;  1WCM H;  2AMC B;  4K5W A;  2IWH A;  3CHB D;  1I5F A;  2F0L A;  3BYY B;  4IN3 A;  3C2P A;  5FO9 B;  4EQO A;  3E0J A;  4YCU A;  3K57 A;  1A15 A;  3S1R B;  1D1I A;  3I91 A;  1YNJ C;  2CFM A;  4ZKB B;  4CJ0 B;  1STG A;  3BDL A;  2JN4 A;  5IGG A;  1GUG A;  2NVY B;  2GVA A;  1TWC H;  1ICW A;  2KEC A;  1VQ8 A;  4C3I G;  5CV7 A;  4A3G G;  1KDB A;  1LV9 A;  4GZY C;  1JJC B;  3PO3 H;  4P72 A;  4PG3 A;  4LMQ D;  4Z9C B;  4U67 3;  5ELO A;  3CD6 A;  4GLX A;  1Y8N B;  1PFN A;  4DUZ Q;  3KF8 A;  4LF5 Q;  2J4X A;  1PH6 A;  1FL0 A;  1D6E C;  1WVL A;  3PF4 A;  2OEO A;  3FKI H;  2RCF A;  1Q12 A;  2UU9 L;  1Q46 A;  4DR2 Q;  1EYG A;  4DFA A;  2ICE C;  5H1S E;  5IOD A;  4A3E G;  1SMX A;  3H6M A;  1STN A;  5KGU A;  1S5D D;  4A3I H;  3KOJ A;  2NN6 I;  4HJ7 A;  3S1M H;  1SR3 A;  2PMZ B;  2YU9 H;  4AYB G;  2B2U A;  3H09 A;  4R8I A;  3E9I A;  2L0C A;  1J6Q A;  2PNH A;  4LFA Q;  2K03 A;  5BN5 A;  1VDZ A;  3PO2 B;  4A3D H;  4A93 G;  1WTH A;  5CR3 A;  2ZT9 C;  4C2M H;  3NEM A;  2F0N A;  4Y7N H;  2R7Z G;  4CHT B;  1EY6 A;  4YY3 L;  3NTI A;  3GQB A;  2Q2I A;  1H9S B;  2PZU A;  3D0F A;  3GTO B;  1JCK B;  1O7L A;  4LUO A;  3BU2 A;  4A3F G;  2ASB A;  1OO9 B;  1EWI A;  3TBI B;  4JI4 L;  2KA7 A;  1RCV D;  1UAP A;  4K6D A;  3GTM H;  3CKI B;  4A3M B;  3K0X A;  4RHS A;  5C44 H;  2GA4 B;  2JXM B;  5IGE A;  3TSS A;  2K5Q A;  1QNU A;  1Y1W H;  4J15 A;  1Z9F A;  2Q2H A;  1AP0 A;  1O7Y A;  2EY1 A;  4FF1 A;  1SYG A;  5M5W B;  3LGJ A;  4FO2 A;  3CRK C;  2N78 A;  4IUV A;  4BS9 A;  1QZG A;  2KHS A;  3J81 j;  4E6I A;  3NHH A;  1XXG A;  2K5N A;  4K5X A;  1GUN A;  4OO1 I;  3S2H B;  4B3R L;  3EIV A;  4B3M Q;  1I4X A;  1QUQ A;  1FVI A;  2CQA A;  5FLM H;  1ET9 A;  1DD2 A;  2EYL A;  2MP1 A;  1TQO A;  3U4V A;  4HJ8 A;  2PMZ E;  5EKL A;  4DV1 L;  4EQP A;  1HZC A;  3A54 A;  4OO1 H;  1HHV A;  3HOX G;  4NDX A;  3GTQ B;  5E4X A;  3VYT A;  1K8O A;  4FNF A;  1TWA H;  1KRS A;  4X3K A;  2NVY H;  4KK7 A;  5CYU A;  4MIU A;  1YNN C;  1PRT F;  4DR3 Q;  4KY6 A;  1RD9 D;  5J22 A;  3UDX A;  2E2H B;  1SE8 A;  4KKU A;  1VQ4 A;  4NXN L;  1KAA A;  1Q3L A;  4R4C A;  4GKJ L;  2B3G A;  3U9O A;  1TS4 A;  3MEF A;  3H91 A;  3T16 A;  4BY1 G;  3MXG A;  3PIP 3;  1HNZ Q;  4RFB A;  4CDF C;  1LAC A;  2XVS A;  4IZ8 A;  1VMC A;  3KLS X;  2AKW B;  1VQE A;  4G4K A;  3V96 A;  1B4O A;  4RKB A;  2WKC A;  4ZLT F;  1X32 A;  2B29 A;  2LMC B;  2A8V A;  2Z9H A;  2AWN A;  3WOF A;  2K1B A;  1HZB A;  1CTM A;  3MA2 B;  2R61 A;  1Y8O B;  3HOY G;  2F0S A;  1VQB A;  1DYQ A;  3UE1 A;  1XJV A;  3J80 E;  1IL8 A;  1CSP A;  2K14 A;  3I3C A;  4OWX B;  3PO2 H;  3UDF A;  1HJP A;  4JI6 L;  5IT9 L;  2KUM A;  2EZV A;  1ZYR C;  3R8B A;  3GDE A;  5NUC A;  3QWN A;  2NUC A;  3NWS A;  1LT6 D;  3MTS A;  4QL5 A;  1N36 L;  2A5H A;  1EY5 A;  2DN8 A;  1X3Q A;  5J39 A;  1YJ9 A;  3A0J A;  1X54 A;  4TQU S;  4DA2 A;  3GTO H;  2KED A;  1EQT A;  1C9O A;  1NSN S;  2VS1 A;  3PO3 G;  3BVZ A;  1AZQ A;  4K2L A;  2EJG C;  1F2M A;  1YNJ D;  3AMU A;  1LO5 D;  1PH5 A;  4DUY Q;  2Y0S B;  2D0P A;  4YIJ A;  2CH4 A;  4J1M A;  4R1J A;  4LF6 Q;  3FKI G;  2A19 A;  1SNQ A;  4R8N A;  5M5W H;  2RBM A;  2UUB L;  1E2Z A;  5IGD A;  2BA1 A;  1CA6 A;  4EQN A;  1U4R A;  2K5W A;  3OPO A;  1IW7 C;  3R3O A;  4FF2 A;  5M5Y B;  4PZ8 A;  4JI0 L;  1SYE A;  4A3I G;  2R93 B;  4ZRZ A;  3J7A 5;  3S2H H;  1AE2 A;  3NPP A;  1PMR A;  4QJF A;  2F0T A;  1SE2 A;  3PMF A;  3QR8 A;  1HRJ A;  3PSI A;  4M1U B;  1B44 D;  1CK1 A;  4A3D G;  3A7A B;  1B3Q A;  2KCM A;  3QG1 A;  1VQ5 A;  3GTQ H;  3M9B A;  3BZC A;  4OXP A;  4YWL A;  3QOJ A;  3GTG H;  2F0I A;  2ICI A;  1FR3 A;  1V8Q A;  3NTK A;  1Q81 C;  3K6O A;  3HOV B;  2R7D A;  5JJK A;  2MO1 A;  3PIP A;  1VQI A;  5ELF A;  4R9W A;  3NBH B;  4BBR B;  2E2H H;  4L6T B;  1BBW A;  4WOR A;  3TP5 A;  1EUJ A;  4IUT A;  1KLU D;  3MC0 B;  3PQI A;  5C44 G;  3M7G A;  4ULL A;  4A3C H;  4AH6 A;  3CCU A;  5LMU Q;  5CBA E;  1Y1W G;  1PRT C;  3OW7 A;  1QCB D;  1J8I A;  2OXP A;  3BYT B;  1ASY A;  1A0I A;  1EY4 A;  4DUZ L;  4LF5 L;  3TRZ A;  4OWT B;  2Y0S E;  3S1Q B;  2DUD A;  2VQF Q;  3NQT A;  2YTY A;  1I6H B;  4CDC C;  1V1P B;  3A8J E;  2JQO A;  4DR2 L;  2MO0 A;  2IHF A;  1Y14 B;  1B9N A;  4DK0 A;  2NTT A;  5E7N A;  1WTW A;  2MHV A;  2N49 A;  5FLM G;  4GLV B;  1TWG B;  3JAM L;  4BY7 H;  4L8J A;  3UI2 A;  3K5N A;  5JAV A;  4OO1 G;  2JP1 A;  1TU2 B;  2CH4 W;  2F3V A;  1SEB D;  4JI2 Q;  4B3S L;  1A3T A;  5ELE A;  4YWM A;  4IUU A;  2J7Z A;  1TS3 A;  1F9S A;  2BE5 C;  4R4T A;  1ZXT A;  3HOU H;  1YZ6 A;  1VQ6 A;  2A74 C;  2L55 A;  1JIC A;  1PZJ D;  4PNY A;  2TMP A;  1NR2 A;  3MXU A;  4GLA C;  4XIG S;  3IFT A;  2C5C A;  3I56 A;  1KL9 A;  2YTV A;  3T53 B;  1AZP A;  2E2I B;  4JCV E;  1CZW A;  1G2S A;  3CCJ A;  3F2U A;  1YNN D;  2IW3 A;  3KF6 B;  4K8I A;  2B2Y C;  2F0G A;  2KOL A;  2F3I A;  5M5Y H;  3Q23 A;  4GOP C;  1JE4 A;  2B39 A;  3OWF A;  2WB1 B;  2R93 H;  3I70 A;  3GTJ B;  2D2C C;  4NPS A;  4KY5 A;  4N8F A;  1HTL D;  2R92 B;  1EOV A;  1B1Z A;  1E22 A;  2BDN A;  2G9H D;  4DAP A;  2RQX A;  3W3A A;  1CFM A;  1RTO A;  1DZ1 A;  5M3M B;  3PO2 G;  1LUZ A;  4B3M L;  2EIF A;  4DU9 A;  1X56 A;  1QNK A;  5IWA Q;  5D14 A;  3ZJY C;  1U4L A;  1W2B A;  4HCE A;  1C0A A;  4K14 A;  1NE3 A;  1ENF A;  2N88 A;  3HOV H;  3SR1 A;  2FJ2 A;  2WIN B;  3ULP A;  1SDF A;  1NJI C;  2IPK D;  3OW2 A;  4AQY Q;  2VZA A;  4BBR H;  2ZM6 Q;  2PNR C;  4K8J A;  1SFO H;  1QG7 A;  4ME5 A;  1XPR A;  4I65 A;  4DR3 L;  1ZYR D;  3DHQ A;  2ZJP A;  2OTJ A;  1YJN A;  4EVO A;  4HED A;  2PW7 A;  5DLQ E;  2MJ8 A;  4Y52 H;  1M90 C;  1ILP A;  5FO7 B;  3A8I E;  3CCL A;  5HUR A;  1JB3 A;  1FD7 D;  2F0M A;  1HNZ L;  1LTI D;  2JJQ A;  3S1Q H;  1YHA A;  1I6H H;  4JBM A;  1KIX A;  1MSG A;  2R3Z A;  2JE6 I;  3WWV A;  5L37 A;  4MNO A;  1EFI D;  4I7Z C;  1A63 A;  4F88 A;  1W6J A;  1NMG A;  5C3E B;  3CPW A;  4N8X 1;  1VF7 A;  1TWG H;  4L63 B;  1CZG A;  2E5L Q;  2WB1 E;  3RNU A;  5M9O A;  1Y1V B;  3J80 i;  1X3G A;  4Q0F A;  1PVO A;  1L0X B;  1UWV A;  1IW7 D;  1HQR D;  1YBY A;  2Z6K C;  4UAI A;  5IT9 E;  5C3X A;  2CCZ A;  1EOT A;  2K01 A;  1BCP B;  1SN8 A;  5DM6 3;  1RDP D;  1WTR A;  3GV6 A;  2CVR A;  5FOB B;  2JA5 B;  1WD0 A;  2PI2 A;  5EPK A;  3EVQ A;  1A2U A;  1EIY B;  2I5H A;  2EY5 A;  2JA7 B;  1EFW A;  1KAW A;  2IX1 A;  2NBF A;  4IFD J;  2K5V A;  5CV5 A;  3QB3 A;  2YV5 A;  4OL7 A;  4A3C G;  1SYC A;  2E2I H;  1XPU A;  3ERS X;  1YEZ A;  4P74 A;  3TP7 A;  3K5M A;  1SJE D;  1I50 B;  1F2L A;  4QF4 A;  4A4I A;  1UEB A;  2J0T D;  1LTG D;  4KD4 A;  3J80 c;  4DAY A;  1RL2 A;  3T4A C;  2B63 B;  2LXK A;  1PDQ A;  3P1H A;  4DUY L;  2IY5 B;  4CJ2 C;  3HKZ G;  3S1N B;  2UXB Q;  1JOO A;  2R6G A;  4LF6 L;  1H9M A;  1GHK A;  2JA9 A;  1LTA D;  2NZH A;  3PV0 A;  1CI3 M;  4HID A;  1K0S A;  3J7Z C;  4BY7 G;  2B2V A;  1ASZ A;  1PRT D;  1HNX Q;  2K52 A;  3LNN A;  3MXP A;  4X64 Q;  1A8V A;  3NP8 A;  3F2B A;  4LNQ A;  2HDL A;  2BCO A;  1KLG D;  2K05 A;  3I4N B;  3PIO A;  3Q22 A;  2HQL A;  2B2W A;  1PTO B;  2EYF A;  5ELC A;  2SDF A;  3HOU G;  3GO5 A;  3URY A;  1STH A;  3H0G B;  1HA6 A;  4G7Z C;  3CU7 A;  2KEN A;  4OIJ A;  1QVG A;  2VB3 X;  4FF4 A;  1AH9 A;  1CSQ A;  1XX8 A;  2ALY B;  4CKB A;  4MHE A;  4JOI A;  4DNR B;  1PLF A;  2ZTC A;  2XGT A;  2Y0S G;  1YIT A;  4HMJ A;  4PV1 C;  3SDZ A;  1P8L A;  4NP5 A;  2BE5 D;  4B9X A;  5CV9 A;  4DAV A;  2JA6 B;  3NK9 A;  1SNM A;  1BCP C;  4C3H B;  5LMU L;  4B3T Q;  1M8A A;  1HXY D;  1PH3 A;  2R93 G;  2HDM A;  1WD1 A;  3Q6S A;  1EYA A;  3ERQ A;  1P16 A;  1WFQ A;  3HKS A;  3KJO A;  1BKB A;  5CV4 A;  4F8M A;  5C3E H;  1A2T A;  3J7A V;  4G7O C;  1QUQ B;  5KIX A;  1GO3 E;  1SMY C;  1V1O A;  4OGQ C;  3JAM E;  2VQF L;  2M2L A;  4JG2 A;  1EEF D;  1Y1V H;  4JI3 Q;  1KXL A;  4JBK A;  2PQA A;  2Z0S A;  4RH6 A;  3R93 A;  2EOT A;  4DN4 M;  3L2P A;  1X6O A;  3BVM A;  1I4P A;  2VY3 A;  1DOM A;  2K04 A;  3I55 A;  1AFP A;  1DOL A;  4XYO A;  3S2D B;  4WJ4 A;  3HOV G;  1G29 1;  1D1K A;  3OSO A;  1GVP A;  3F2C A;  5CV8 A;  2JA5 H;  1AEX A;  2RKS A;  4P75 A;  3MXN A;  1EZ8 A;  1O7I A;  4BBR G;  3QJY A;  2Z8L A;  3H15 A;  2JA7 H;  5EKI A;  1ICF B;  2NB0 A;  4GS3 A;  4PMC A;  1YNX A;  1TS5 A;  5K36 H;  1CHQ D;  3ND8 A;  3QO2 A;  3R2T A;  2I07 B;  3PCO B;  4RWS C;  5GAE C;  1I50 H;  5JPM C;  5A2Q L;  4LF7 Q;  1NAP A;  1JWM D;  3D31 A;  4C3J B;  1EY0 A;  2O2L D;  5CGK A;  3Q24 A;  1UE6 A;  4DR7 Q;  3PUW A;  4MTK A;  3I4L A;  1SE3 A;  4F87 A;  3S15 B;  1X3P A;  2HCC A;  3MFY A;  4OON A;  2TSS A;  1XYI A;  3NWT A;  1QJO A;  3P7J A;  1GUT A;  3J81 L;  5M3F B;  3AFQ A;  1W6K A;  3HOW B;  3S17 B;  1E0B A;  1OXU A;  3C3L A;  1X3F A;  4CBV A;  2K50 A;  2V1C C;  2QW7 A;  3PUV A;  2CHB D;  4DXG A;  2K5H A;  3CP0 A;  3I4N H;  1SNP A;  3KBX A;  5GRO A;  1QOH A;  5BN3 A;  1PTO H;  1WTX A;  1QWY A;  2PPB C;  4POG A;  1FNV A;  2VB2 X;  1LLR D;  5EGT A;  1FJG Q;  5IWA L;  3H0G H;  3S9W A;  2D5D A;  2NVT H;  4BBS B;  1PHJ A;  4KY7 A;  2B8G A;  1J5E Q;  2NWG A;  1HUM A;  1FNU A;  4AQY L;  1G2T A;  2B8F A;  1YHB A;  2ZM6 L;  3CMA A;  3HFZ B;  4P2C B;  1NBW A;  3W2D A;  5D3D A;  2JA6 H;  5JEA J;  1SJH D;  4LUV A;  3S14 B;  4C3H H;  3G71 A;  4K6L A;  1VQM A;  2KCT A;  2EY6 A;  2LFN A;  4RCO A;  3G6J B;  2NVX H;  4DV6 Q;  1V9P A;  2VQE Q;  3V05 A;  2DNC A;  5C4H A;  1V43 A;  3UDG A;  5I2Y A;  2HHH Q;  3ULJ A;  1SRU A;  3TEH B;  4HR7 B;  3ZYY X;  5F2D A;  3SK6 A;  3PGZ A;  4JI7 Q;  1LT5 D;  5J1Z A;  2IL8 A;  1EIF A;  2E5L L;  1EZ6 A;  1EIG A;  3E5S A;  3KLW A;  5G3L F;  5CC4 A;  4V0B A;  2YTX A;  3S2D H;  4OX9 Q;  1CKN A;  4L5Q A;  3S1R H;  2QF7 A;  3FHW A;  1RKN A;  3CCS A;  3K5O A;  3FVQ A;  3BDC A;  3TDQ A;  4IFD I;  5C6A A;  2EYP A;  5ELN A;  2ZXO A;  2RDF A;  1S5B D;  3L7Z C;  1Y69 U;  2IX0 A;  4X62 Q;  2KHJ A;  3CPF A;  1ET6 A;  3A55 A;  4C3J H;  4HJA A;  1QZH A;  1D5Z C;  1UE7 A;  3BG3 A;  4IFD H;  3K5L A;  5COR A;  1EQQ A;  5C4X B;  3S15 H;  4N9T A;  2N8N A;  2Z6B A;  1U4P A;  3CC2 A;  3W5O A;  1BVS A;  2JK8 A;  3GD7 A;  5C3E G;  5M3F H;  4IUR A;  2UXB L;  4DF7 A;  5EJW A;  3HOW H;  3S17 H;  1NCV A;  1RHP A;  3GP7 A;  2JA8 B;  2AHO B;  3I72 A;  1IBK Q;  2HUG A;  3MZ5 A;  1KC8 C;  5FJ8 H;  4IOC A;  3ITP A;  1F9P A;  3VR4 A;  1BCP D;  1MBY A;  4XXE A;  1WCM G;  4JK1 C;  1KDC A;  4POF A;  2V4D A;  4PZ7 A;  1HNX L;  4X64 L;  1LT4 D;  4P71 A;  3Q8D A;  5BR8 Q;  2JA5 G;  3DEO A;  3HGB A;  4HCS A;  5JVH 3;  3ICE A;  4IJL A;  1SMY D;  1H9R A;  1M1K C;  1IHZ A;  3K0Y A;  4BBS H;  2F3W A;  2JA7 G;  2ID0 A;  1SYF A;  3V2T A;  1PXU A;  2KVM A;  1VCI A;  2MUY A;  2DGY A;  1TVX A;  1B8A A;  2I46 A;  1KQS A;  5K36 G;  3A5Z B;  3GTK B;  1JMC A;  1JWS D;  4A3M H;  4BXX H;  3L0O A;  5JVG 3;  3S14 H;  2LSS A;  3N6R A;  4XQN A;  1GD7 A;  1XTC D;  1PH4 A;  4WJ3 M;  5FK9 C;  3T51 B;  2JEB I;  1N8R C;  1KD1 C;  4YHH Q;  2E76 C;  3CCV A;  1PV4 A;  4B3T L;  3H3V C;  3IFD A;  4KI0 A;  1PH1 A;  3TZD A;  1K8M A;  4K5V A;  4DNI A;  4LFC Q;  1EU3 A;  3VDY A;  3HRZ C;  1TII D;  3JAM i;  1GUW A;  4KLK A;  3U58 A;  5BN4 A;  3H3V I;  2WP8 J;  3VA5 A;  2RF4 A;  3BJU A;  3EJI A;  3I4N G;  4IPD A;  4EQ5 A;  4WFN 3;  3C1E A;  1WJJ A;  4JI3 L;  2UXD Q;  2OQ0 A;  4C1N K;  1STY A;  3FMC A;  1HUN A;  5HGQ A;  3H0G G;  4P73 A;  4H13 C;  1G51 A;  1PA6 A;  3K58 A;  3H3V H;  3CCE A;  1C8C A;  1BUV T;  4DKA C;  1PFM A;  1A3U A;  3KDF B;  2NZO A;  1C4Q A;  1W3S A;  5E3F A;  3DLL A;  4A3K B;  4LF8 Q;  4DR6 Q;  4PZ6 A;  5DM7 3;  1MD2 D;  2PQE A;  1TWH B;  3J7A F;  3PUY A;  1XNR Q;  1ML0 D;  2UUC Q;  2B2T C;  3RLF A;  3NTH A;  2JA6 G;  1A62 A;  3JAM c;  1JR0 D;  1VQL A;  4C3H G;  2Q2T A;  2PYK A;  1IBM Q;  5C4X H;  5E1F A;  1MJC A;  4RHR A;  2N55 A;  3G7L A;  4LF7 L;  3AB9 A;  1VQ7 A;  3F1Z A;  1JOQ A;  3EA6 A;  2LY7 A;  1R9T B;  2K32 A;  4CGY B;  4DR7 L;  4X6A H;  5KND A;  3J81 E;  4DNT B;  2EJF C;  4GKK Q;  4FYD A;  1STA A;  5K5P A;  1S5F D;  4B9W A;  1MI2 A;  1WTO A;  1NR4 A;  3SK8 A;  2BH8 A;  4KN4 C;  4DR1 Q;  4TVA B;  2H1E A;  2CKZ B;  2UUA Q;  1L1O B;  3E9H A;  3B6Y A;  3VYR A;  2A68 C;  1BO0 A;  2A6E C;  2Z4H A;  4XQJ A;  4LFA L;  1Z7T A;  4RMF A;  2R7F A;  5LMN Q;  1BBX C;  3HG9 A;  4LK1 C;  2EYM A;  1N34 Q;  4OIK A;  5C0X J;  3F2D A;  1ENC A;  1DM0 B;  3GTK H;  1VMP A;  4DV3 Q;  4JI1 Q;  3DXJ C;  5JPN C;  1BNZ A;  2EJM A;  4DV0 Q;  4IUP A;  1XMO Q;  1J5E L;  2NVQ B;  4AYB B;  4UY8 C;  5IYD H;  3CXC A;  2PZW A;  4C3J G;  2QCP X;  1TY0 A;  2K6A A;  4DAY B;  4IFD G;  2E75 C;  3FRP B;  1IKL A;  5EKK A;  1UEA B;  2XSC A;  3G6E A;  4IPG A;  4KJN A;  1JT8 A;  4OEM B;  5I6W A;  2AUK A;  5M3F G;  3L3O C;  5EQ0 A;  3KYH C;  5JEA H;  3HOW G;  1BF4 A;  1CQF A;  3BZK A;  4DV6 L;  5IOC A;  3X3M A;  1CQV A;  5FJ8 G;  1OTC A;  1SYB A;  4DAM A;  5I2X A;  3TME A;  2VQE L;  1CKM A;  4A3L H;  2HHH L;  3MEH A;  4IUN A;  5IYC H;  1H9K A;  2QEJ C;  2M00 A;  4JI8 Q;  3TRE A;  3JC6 6;  4AIM A;  4IOA A;  3FDT A;  4LF9 Q;  1KNA A;  4BBS G;  1OXV A;  2VL6 A;  3HS0 C;  4OX9 L;  5CV6 A;  2SOB A;  3D8G A;  3X3N A;  1HPC A;  1LYL A;  4A3K H;  3NEN A;  1WTV A;  5IP9 H;  1OXT A;  3KLR A;  4HIM A;  1IL2 A;  1BCP F;  3P75 A;  1TWH H;  4GNX B;  2PI2 E;  4A3M G;  2VW9 A;  4BXX G;  1GM5 A;  1CA5 A;  3I8Z A;  3E3X A;  2QDB A;  1PZK D;  1VQF A;  5CMD A;  3C46 A;  2I0Q A;  2HCI A;  2K5D A;  4A3J B;  4IQZ A;  1L1O C;  4U68 A;  5IGC A;  4RGN A;  5LMN W;  3T1Y Q;  2B2Y A;  1WTQ A;  3TS2 A;  1CKO A;  2I5L X;  1EL0 A;  4X62 L;  1IYU A;  1E7Z A;  4B08 A;  4WRD A;  3M7N A;  1VQP A;  4GOP A;  1WTP A;  1R9T H;  2MNA A;  4ILW A;  1ESF A;  3C1F A;  2Q8I B;  3OHX C;  3NBH A;  1EY7 A;  3BS1 A;  1WI5 A;  1IKM A;  2PQA B;  1R4P B;  1CUK A;  4A76 A;  4TSS A;  4L5T A;  3T1H Q;  1IBK L;  4MN3 A;  4V19 0;  3BDO A;  5AJ3 Q;  1D5M C;  2XWJ B;  1Q86 C;  3E0E A;  3KJP A;  3MXN B;  2A69 C;  1VS0 A;  4BA2 I;  3MWY W;  4R4O A;  4XQQ A;  5FLX L;  1LTL A;  5BR8 L;  3CRL C;  3RMH A;  2F0U A;  4H0L C;  1B50 A;  1C48 A;  3M85 A;  2IX3 A;  1V1Q A;  1V1P A;  4IPC A;  4DV7 Q;  3FPU B;  1E1O A;  4CDD C;  2RSN A;  4ZAI A;  1OXS C;  1PTO F;  4JVZ A;  1D2B A;  1Q90 A;  1VQ9 A;  2X6G A;  1EY8 A;  5LL6 X;  2KCC A;  5C4X G;  3T56 B;  3KF8 B;  5D3I B;  1GOZ A;  5G3L D;  1K83 B;  2Q2U A;  4JV5 Q;  4FVM A;  4JBW A;  4MTN A;  4CDE C;  3GTJ H;  2DY8 A;  3CCM A;  1F2Y A;  3I90 A;  4YHH L;  2R92 H;  2OTL A;  1TWC B;  1A6X A;  1G6Z A;  1K3R A;  4JW0 A;  3VYS A;  4IO9 A;  5IIF A;  1ROD A;  3VR5 A;  1NMF A;  2QDL A;  1SYD A;  3OIP A;  3ONA B;  3VYU A;  2AQ3 B;  3H94 A;  2EYH A;  2C9O A;  3GV3 A;  1HNW Q;  2L1B A;  3HZX A;  3CC4 A;  4GNX C;  2O5I C;  3PO3 B;  5KYI A;  4LFC L;  5M3M H;  2Z6K A;  5KRU A;  2PO4 A;  3CCQ A;  4N9P A;  1IYJ B;  2XRS D;  5GAG C;  3N52 A;  1NNX A;  2UXD L;  3FKI B;  2EVB A;  5C3W A;  4ALP A;  4A3B B;  2Z1C A;  1EEI D;  1NTG A;  3TZU A;  3AEV A;  4NKL A;  1MKH A;  3FPP A;  2JYO A;  1SSO A;  2NTS A;  2FXQ A;  1JC7 A;  1Q8K A;  1SNC A;  1II3 A;  1TS2 A;  4PMW A;  2A68 D;  2NYZ D;  5IYD G;  2KQ3 A;  5C5M A;  1Q7Y C;  4G7H C;  2A6E D;  2WFW A;  4LF8 L;  3DWP A;  1PYS B;  4DR6 L;  2G5D A;  5I6Y A;  2OCE A;  4A3J H;  4CKC A;  4ODG A;  3WOE A;  1XNR L;  3BVG A;  2UUC L;  3J7Y W;  5IY0 A;  5C4Z A;  3RN5 A;  3S16 B;  2Z4I A;  1HR0 Q;  1BBU A;  4LUZ A;  1QB5 D;  1I94 Q;  1IBM L;  2WAC A;  2XWB B;  5JJL A;  4DV2 Q;  5JEA G;  5M5X B;  1YJW A;  1PZI D;  4HN7 A;  3J81 i;  2QKI C;  3A56 A;  4IUQ A;  3OTO Q;  2NZ1 D;  5JJZ A;  4ZKC B;  4A3L G;  4GKK L;  5IYC G;  1CHP D;  4KKT A;  4CKE A;  1SXT A;  1IXR A;  4DR1 L;  3M4P A;  5IGF A;  4DV4 Q;  4ZUJ A;  2UUA L;  2OWO A;  1Y1W B;  2BH2 A;  1FNW A;  2DJG C;  2I5M X;  4JYA Q;  2VNU D;  4A3K G;  4DXF A;  1F9R A;  3U9S A;  4RA8 A;  5LMN L;  4JI2 L;  2RVL A;  3SE0 A;  1JE5 A;  1ONL A;  1N34 L;  2LXJ A;  1YVC A;  1TT2 A;  3RD4 A;  2Q8R E;  5IGB A;  2B2U C;  1PH2 A;  4DV3 L;  4JI1 L;  3UE0 A;  1WYD A;  5C0X H;  1G6P A;  4DV0 L;  1XMO L;  5LL6 S;  4DGZ A;  1IBL Q;  1H95 A;  1D5X C;  4KKS A;  2K75 A;  2B63 H;  4IPH A;  1K83 H;  3D4R A;  4DK6 C;  4J8Q A;  3S1N H;  4I7A A;  2HT1 A;  1TWA B;  2EYO A;  1JWU D;  5D65 A;  1PTO C;  1EYC A;  1J9O A;  2F0D A;  3W1B A;  3F8T A;  2JEA I;  1B7Y B;  2XTI A;  2AWO A;  2FMM A;  4RGO S;  2IT1 A;  4ZK9 B;  4X66 Q;  2G9D A;  1HFN A;  2HIV A;  4KD3 A;  3G48 A;  1X65 A;  4K0K Q;  1TWF B;  3VA7 A;  2GVB A;  1HR0 W;  2RDG A;  3TP8 A;  4F7X A;  3CME A;  1VQG A;  4JI8 L;  4UP9 A;  3HOZ B;  4A3B H;  3DUZ A;  1PH7 A;  3W1G A;  4LF9 L;  2KBN A;  1LTR D;  5ELB A;  4APV A;  4RKL A;  2SEB D;  4ZQ3 A;  1AE3 A;  1H9J A;  2E2D C;  1MSH A;  4X65 Q;  2CWP A;  1G91 A;  2RA4 A;  3S24 A;  1VF5 C;  1HFG A;  3PF5 A;  1Q8I A;  3EFX D;  3TN2 A;  3RZD B;  2A69 D;  3K80 C;  3I73 A;  4B3S Q;  4OHJ A;  4YWK A;  3I4M B;  3P20 A;  3SVM A;  1Y8P B;  4YCV A;  4RAU C;  1JOR A;  3AFP A;  4GN5 A;  4KHP Q;  4G57 A;  2NN6 H;  1U5K A;  3S16 H;  4FXK C;  4A75 A;  1B9M A;  1XMQ Q;  3SHL A;  4HJ9 A;  3T1Y L;  5M5X H;  2WB1 G;  1BQQ T;  5DEH A;  1VQC A;  4QUC A;  2XIW A;  2R92 G;  1LAB A;  1BR9 A;  3K59 A;  5DNF A;  3TP6 A;  4BWG B;  5KNB A;  4QUF A;  1PFB A;  3STB C;  1CT1 D;  3I4O A;  1SAP A;  3K7U C;  5A35 A;  4RCN A;  5M3M G;  1AN8 A;  1ENA A;  2EXD A;  5IYB H;  2D9U A;  1SE4 A;  5LHY 1;  4R4I A;  2HQE A;  3T1H L;  3PUX A;  2A6H C;  3FEW X;  4QY7 A;  1UUP A;  1G8Z D;  4GN4 B;  3K7A B;  2WAQ B;  2KJX A;  5FLX E;  3G4S A;  3A5U A;  5AJ3 L;  2F0E A;  1EU4 A;  2AQ1 B;  1F9Q A;  2CW0 C;  4LJZ C;  4HSV A;  4UP7 A;  2ZJQ A;  4DV5 Q;  2ENB A;  3TQY A;  3NEL A;  3RN2 A;  1KDA A;  5HY6 A;  4DV7 L;  3OWE B;  4A3J G;  1SRO A;  1T5E A;  3AQQ A;  1MHW C;  3R2I A;  3D3R A;  4LW1 A;  5COY A;  2F0O A;  1DON A;  3DWA A;  2JSO A;  2O5J C;  4CJ1 B;  2XN9 C;  1PFS A;  1X9N A;  4JPB W;  3HP3 A;  2DNE A;  3GTG B;  5KEE A;  2OF1 A;  2F4V Q;  2LS0 1;  1AW7 A;  5IT9 c;  2AUJ D;  4GN3 B;  1K8G A;  4JV5 L;  1S3O A;  4FF3 A;  2FMC A;  5I4D A;  2RCN A;  2SNM A;  1Y1V G;  1X55 A;  4L5S A;  1TWF H;  2E2J B;  1M4V A;  3ERO A;  4LAA A;  1Q82 C;  1N33 Q;  1HNW L;  2H5X A;  1A3V A;  1GJX A;  3A7L A;  1F77 A;  4DR5 Q;  1S5C D;  5EAY A;  1I4Q A;  1YIJ A;  3HOZ H;  1TKW B;  4M8A A;  4JI5 Q;  1MGS A;  2N3S A;  3RR5 A;  2F0J A;  3HKZ B;  1PH8 A;  1JJG A;  3TS0 A;  4H7B A;  1B70 B;  1EQV A;  2F1M A;  4QCL A;  2FHT A;  3Q0A A;  1JOK A;  2WAQ E;  5ELD A;  4FP5 D;  1MIU A;  5EPJ A;  1QIL A;  2EE1 A;  3RZD H;  2AQ2 B;  4BY7 B;  2ZXR A;  1CM9 A;  5C0X G;  2ES2 A;  3I4M H;  4MZ9 A;  2K4K A;  1ZEQ X;  5C5L A;  1YI2 A;  1PRT B;  1Q1E A;  4ZCK A;  2B63 G;  1VQN A;  2BOS A;  1BOS A;  1QE6 A;  4HIK A;  3I7F A;  4KN7 C;  1B3A A;  2VXW A;  3KUP A;  5C4J B;  3LX0 A;  2EDG A;  1HR0 L;  3HOU B;  1SLJ A;  1I94 L;  1E1T A;  4KHZ A;  4DV2 L;  1BXT A;  1FGB D;  5E4W C;  2L4N A;  1O7Z A;  1H9S A;  3VR6 A;  1VQA A;  1XTD A;  5GAD C;  5GAH C;  3M3Y B;  3NUC A;  4O0A A;  2BDO A;  3OTO L;  3T13 A;  2F0K A;  3U4Z A;  2L15 A;  2WV6 D;  1KRT A;  2MPM A;  4WJW A;  2UXC Q;  2PW5 A;  1KHI A;  1PTO D;  3OYY A;  1QVC A;  2VUM B;  4LF4 Q;  3L9A X;  4A3B G;  3K7A H;  4OWW B;  3RLN A;  2CWA A;  1N9W A;  5KNC A;  4DV4 L;  2EQS A;  3OMC A;  4JYA L;  2C35 B;  4HJ5 A;  3K81 C;  2WKD A;  3SXH A;  1PYB A;  1Q1B A;  3HKZ E;  4NXM Q;  2CQO A;  3CQZ B;  3SK4 A;  2NN6 G;  1RJT A;  4BA1 I;  1FGU A;  2GN5 A;  3FP9 A;  4QB4 A;  4RGT A;  5A2Q E;  2DJF C;  3IKJ A;  4GOP B;  1RF2 D;  1SNO A;  1IBL L;  3A74 A;  3E6Z X;  2MGS A;  5GQO A;  4ABN A;  3AU7 A;  1NY4 A;  2BA0 A;  2KHI A;  1SFO B;  1IYV A;  2E74 C;  5T1I A;  5IE8 A;  2JA8 H;  2M9V A;  4IAL A;  3MFG A;  5IYB G;  3D6W A;  2QEX A;  3EBE A;  4X3T A;  1S40 A;  2E2J H;  4DR4 Q;  3EQL C;  4FDB A;  4C3I B;  4A3G B;  1N32 Q;  1Z47 A;  4X66 L;  1DGS A;  5IP7 H;  1B2T A;  4LFB Q;  2RDH A;  4K0K L;  2OT2 A;  3MAQ A;  1E2V A;  5I9P A;  4L5R C;  1LTS D;  3STB D;  1XNQ Q;  1I3Q B;  1E3P A;  2OQK A;  1I4H A;  1S5E D;  1HZA A;  3NSW A;  4O1N A;  1GKH A;  3ULL A;  1K73 C;  3LWU A;  3NBI A;  3KK7 A;  1I6V C;  1FJG L;  4A3E B;  1DOK A;  4NMZ A;  4PMB A;  2A6H D;  4X65 L;  3QIA A;  2IJ0 A;  2B2T A;  3PUZ A;  2DY7 A;  1EY9 A;  2X69 A;  3ER0 A;  4UPA A;  1U9R A;  1BDO A;  5J3B A;  2CW0 D;  1VQD A;  4JC0 A;  2F0W A;  3KLS A;  4DK1 A;  4TRD A;  4KHP L;  1LTB D;  4TKO B;  4UP8 A;  4A93 B;  5C4J H;  2PZT A;  1XMQ L;  1U4M A;  2L5T A;  1I4R A;  2R7Z B;  2P5Z X;  4HIO A;  1HH2 P;  1T9H A;  4NW2 A;  3M3Y H;  3UDI A;  3KFU A;  5FO8 B;  3MHB A;  4A3F B;  3D6C A;  3CC7 A;  3M4O B;  3IL8 A;  3U50 C;  5JJI A;  4S3S A;  2MQH A;  1HCZ A;  1K3B C;  5KYL A;  2ATW A;  3BZD B;  1UE5 A;  2VUM H;  2UU9 Q;  2F4I A;  3HOZ G;  3NQI A;  2ZXP A;  4JI7 L;  3CF5 A;  2F0P A;  1PH9 A;  3M4Q A;  1WOC A;  2ZTE A;  3WDN A;  1L0W A;  1EYD A;  1R4Q B;  1K0R A;  2PCF B;  3DM1 A;  2QA4 A;  2QGQ A;  2K33 A;  3ND9 A;  3RLO A;  2D0O A;  1HZ9 A;  4O2D A;  3GTP B;  3I4M G;  1U0L A;  1JJ2 A;  1SND A;  5EBC A;  2O4X A;  3CQZ H;  1IZ6 A;  1KTK A;  2RSO A;  2XRQ D;  1O78 A;  2A73 B;  3I2Z A;  4DV5 L;  4LWC A;  1EWC A;  3KBG A;  3GTL B;  4ME3 A;  2EY2 A;  3OIQ A;  2F0V A;  1VQK A;  3K8A A;  4XYQ A;  2HD3 A;  4YCW A;  3IAY A;  1DCZ A;  2A1A A;  4YY3 Q;  4X3S A;  1MJE A;  4AYB E;  2D62 A;  3HOX B;  2F0F A;  5T1G A;  1DXM A;  2XNA C;  3RUZ A;  5FLX c;  1L2F A;  3PIO 3;  2F4V L;  1T5X D;  4JI4 Q;  3KDF A;  4DPG A;  2MFI A;  4UHV A;  1TY2 A;  5TSS A;  4C3I H;  1E24 A;  4A3G H;  1C7Y A;  4DK3 C;  1JQY D;  2WII B;  1FYC A;  4NB3 A;  3IRB A;  3D4W A;  1D8L A;  1XPO A;  4EGV A;  1XWE A;  4XTC S;  2WAQ G;  1E2W A;  4BY1 B;  2EPB A;  1HTP A;  1I3Q H;  4KV6 A;  4EX5 A;  1STB A;  1N33 L;  1I4G A;  2X6L A;  4C56 C;  4DR5 L;  4X3U A;  4B3R Q;  1GHJ A;  1VQH A;  4JI5 L;  1Z6H A;  4A3E H;  1TR5 A;  3OMG A;  3OOC A;  1RIP A;  3RZO B;  1RTN A;  1UE1 A;  2B2V C;  5FKA C;  1TXY A;  2HIX A;  1HA5 A;  2NVQ H;  4DV1 Q;  4HTH A;  2EXZ A;  3HOY B;  4ZYS A;  1O80 A;  1WCM B;  1L1O A;  3QOL A;  4C1N I;  4QIW B;  4ID6 A;  4QGU A;  1K9M C;  4A93 H;  4FXD A;  4KMU C;  2B2W C;  2Q8T A;  3SGI A;  1L0Y B;  1GXD C;  2KEE A;  3CW2 C;  2K7V A;  4R4Q A;  2R7Z H;  4H44 C;  2QIL A;  3D4D A;  4XDX A;  4NXN Q;  2JA8 G;  2KCN A;  1EIH A;  2K28 A;  5HGT A;  4GKJ Q;  1K28 A;  3DWQ A;  3AYH B;  4A3F H;  3M4O H;  4KHV A;  3CAM A;  2L12 A;  5AFW A;  1KNE A;  2E8G A;  2L9H A;  2YYZ A;  3EN2 A;  4JOI C;  4KJO A;  5IP7 G;  1NUC A;  5EBD A;  5DAU A;  3NXW A;  4KTA A;  3CCR A;  2H4O A;  2F0H A;  2IHE A;  1HQM C;  1B53 A;  2UXC L;  4HSP A;  3KF6 A;  4O42 A;  1ZKO A;  4RG1 A;  2F03 A;  4LF4 L;  3LWE A;  1OXX K;  4FXG C;  2RHS B;  1DJR D;  3DEP A;  5I9O A;  2ZJR A;  3NE5 B;  1STE A;  3SEB A;  3GTP H;  4JBJ A;  2ZTD A;  2RHQ B;  4A3I B;  1VQO A;  3S1M B;  2FFK B;  4UDU C;  5EPL A;  1LTT D;  2YU9 B;  5JOB A; 
#chains in the Genus database with same CATH homology
 3S16 H;  1LM0 A;  4JI6 Q;  3GTL H;  3CCV A;  4QQB X;  1PV4 A;  4A75 A;  1XMQ Q;  1YHQ A;  4B3T L;  4HJ9 A;  3T1Y L;  5M5X H;  4KI0 A;  1PH1 A;  2WB1 G;  4NXM L;  1N36 Q;  1VQC A;  4DNI A;  3PO2 G;  1LUZ A;  1VQJ A;  4B3M L;  2EIF A;  2R92 G;  4LFC Q;  3VDY A;  1K8A C;  1EQR A;  1X56 A;  3JAM i;  3HOX H;  4KLK A;  3U58 A;  4H02 A;  3H3V I;  1D7Q A;  5IWA Q;  1X3E A;  4IJH A;  3ZJY C;  2WP8 J;  3STB C;  3I4N G;  2RF4 A;  3BJU A;  4QIW E;  1W2B A;  4IPD A;  3K7U C;  3I4O A;  4EQ5 A;  1C0A A;  1NE3 A;  1WJJ A;  4JI3 L;  5M3M G;  2UXD Q;  2OQ0 A;  3HOV H;  2EXD A;  5IYB H;  3ULP A;  5HGQ A;  1NJI C;  4R4I A;  3H0G G;  4P73 A;  3OW2 A;  4AQY Q;  2VZA A;  1G51 A;  4BBR H;  4GNX A;  2ZM6 Q;  1PA6 A;  3H3V H;  3T1H L;  1SFO H;  1JB7 A;  3CCE A;  3PUX A;  1XPR A;  2VUM G;  4QY7 A;  4DKA C;  4DR3 L;  4GN4 B;  3G4S A;  4DR4 L;  3A5U A;  4BY1 H;  5AJ3 L;  3KDF B;  2ZJP A;  2NZO A;  3DLL A;  1W3S A;  2UUB Q;  4LF8 Q;  4DR6 Q;  1CKN B;  1N32 L;  2OTJ A;  1YJN A;  4PZ6 A;  4JI0 Q;  5DLQ E;  4LFB L;  1QVF A;  3DM3 A;  3PUY A;  1M90 C;  1XNR Q;  4Y52 H;  2UUC Q;  4UP7 A;  2ZJQ A;  3RLF A;  3CCL A;  4DV5 Q;  1A62 A;  2JA6 G;  3TQY A;  1XNQ L;  3JAM c;  3NEL A;  1VQL A;  3RN2 A;  5C0X I;  1HNZ L;  2Q2T A;  5HY6 A;  4DV7 L;  2JJQ A;  5IP9 G;  4A3J G;  1IBM Q;  1SRO A;  1YHA A;  3S1Q H;  2F52 A;  5C4X H;  3RZO H;  1S72 A;  1MJC A;  1I6H H;  3AQQ A;  4JBM A;  1KIX A;  2JE6 I;  3WWV A;  1VQ7 A;  4LF7 L;  3F1Z A;  4LW1 A;  4MNO A;  3J81 c;  1A63 A;  3HOY H;  1NMG A;  1WCM H;  2AMC B;  3CPW A;  4DR7 L;  1PFS A;  1X9N A;  4X6A H;  1TWG H;  1I5F A;  2E5L Q;  2WB1 E;  3RNU A;  4GKK Q;  2F4V Q;  5IT9 c;  3J80 i;  1X3G A;  4YCU A;  4GN3 B;  1PVO A;  1UWV A;  1YBY A;  2Z6K C;  1K8G A;  2BH8 A;  4JV5 L;  2CCZ A;  1S3O A;  1KD1 C;  2CFM A;  4TVA B;  4DR1 Q;  1SN8 A;  2CKZ B;  2UUA Q;  1L1O B;  3E9H A;  3B6Y A;  2RCN A;  1Y1V G;  1X55 A;  2GVA A;  1TWC H;  4L5S A;  1TWF H;  1VQ8 A;  4A3G G;  4LFA L;  1Q82 C;  1N33 Q;  4RMF A;  1HNW L;  2H5X A;  2PI2 A;  2R7F A;  5LMN Q;  1EIY B;  2I5H A;  4DR5 Q;  1JJC B;  5EAY A;  4P72 A;  1N34 Q;  3PO3 H;  1YIJ A;  4PG3 A;  1EFW A;  1KAW A;  2IX1 A;  3HOZ H;  4IFD J;  5ELO A;  2K5V A;  3CD6 A;  4GLX A;  2YV5 A;  5C0X J;  4JI5 Q;  4A3C G;  2N3S A;  3RR5 A;  3F2D A;  4DUZ Q;  2E2I H;  4LF5 Q;  1XPU A;  1PH8 A;  1JJG A;  3GTK H;  3ERS X;  3TS0 A;  1PH6 A;  4DV3 Q;  4JI1 Q;  1FL0 A;  1B70 B;  1YEZ A;  4P74 A;  4DV0 Q;  1XMO Q;  3PF4 A;  3FKI H;  2UU9 L;  1Q12 A;  1J5E L;  1Q46 A;  4A4I A;  4UY8 C;  1UEB A;  5IYD H;  3J80 c;  3CXC A;  4DR2 Q;  2WAQ E;  1RL2 A;  1EYG A;  1MIU A;  2LXK A;  5H1S E;  4A3E G;  4DUY L;  3RZD H;  4DAY B;  4IFD G;  1SMX A;  2IY5 B;  3HKZ G;  2ES2 A;  5C0X G;  2UXB Q;  3I4M H;  4MZ9 A;  2R6G A;  4A3I H;  3KOJ A;  2NN6 I;  4HJ7 A;  4LF6 L;  2K4K A;  3S1M H;  2JA9 A;  3G6E A;  1SR3 A;  4IPG A;  1YI2 A;  2YU9 H;  1Q1E A;  4AYB G;  2NZH A;  2B63 G;  1VQN A;  3E9I A;  3PV0 A;  1JT8 A;  5M3F G;  1J6Q A;  2PNH A;  4HID A;  3KYH C;  3J7Z C;  4LFA Q;  4BY7 G;  1ASZ A;  3HOW G;  4HIK A;  2K52 A;  1HNX Q;  3I7F A;  3BZK A;  4DV6 L;  4X64 Q;  4A93 G;  4A3D H;  5FJ8 G;  1A8V A;  1OTC A;  4DAM A;  1HR0 L;  1SLJ A;  3F2B A;  1I94 L;  4LNQ A;  2VQE L;  1CKM A;  1E1T A;  2R92 H;  4KHZ A;  4DV2 L;  4C2M H;  3NEM A;  4A3L H;  4Y7N H;  3PIO A;  2HHH L;  2R7Z G;  5IYC H;  5GAD C;  1VQA A;  1XTD A;  5GAH C;  4YY3 L;  2HQL A;  2Q2I A;  4O0A A;  3D0F A;  4JI8 Q;  3TRE A;  3OTO L;  4LUO A;  4A3F G;  3BU2 A;  3JC6 6;  4AIM A;  3HOU G;  3U4Z A;  3GO5 A;  2L15 A;  1KRT A;  2ASB A;  4LF9 Q;  4IOA A;  1EWI A;  2UXC Q;  4JI4 L;  1KHI A;  4BBS G;  2KEN A;  1OXV A;  2VL6 A;  1QVC A;  3OYY A;  1QVG A;  4OX9 L;  3GTM H;  4LF4 Q;  3K0X A;  5C44 H;  3K7A H;  4OWW B;  3RLN A;  4A3B G;  1AH9 A;  1CSQ A;  1LYL A;  2ALY B;  2CWA A;  4A3K H;  1N9W A;  3NEN A;  4JOI A;  2ZTC A;  4DV4 L;  2XGT A;  2Y0S G;  1OXT A;  5IP9 H;  4HIM A;  1YIT A;  1IL2 A;  2EQS A;  1Y1W H;  4J15 A;  1TWH H;  1P8L A;  1Z9F A;  4GNX B;  2PI2 E;  2Q2H A;  4A3M G;  2VW9 A;  4BXX G;  2C35 B;  1GM5 A;  4JYA L;  4HJ5 A;  3K81 C;  3LGJ A;  1VQF A;  2N78 A;  2I0Q A;  1PYB A;  1Q1B A;  3HKZ E;  3J81 j;  5LMU L;  1QZG A;  4B3T Q;  1L1O C;  5LMN W;  1PH3 A;  2R93 G;  3TS2 A;  3T1Y Q;  4NXM Q;  1CKO A;  2I5L X;  2CQO A;  2K5N A;  4OO1 I;  4X62 L;  1E7Z A;  1P16 A;  1WFQ A;  2NN6 G;  3EIV A;  3HKS A;  4BA1 I;  3KJO A;  1FGU A;  2GN5 A;  4B3M Q;  3M7N A;  3FP9 A;  1VQP A;  4GOP A;  4YHH Q;  1BKB A;  1QUQ A;  2MNA A;  5C3E H;  1R9T H;  1FVI A;  5FLM H;  4GOP B;  1QUQ B;  2VQF L;  1GO3 E;  1IBL L;  3A74 A;  4JG2 A;  3U4V A;  4HJ8 A;  1Y1V H;  2PMZ E;  4JI3 Q;  1KXL A;  5GQO A;  4DV1 L;  4JBK A;  1HZC A;  2PQA A;  3HOX G;  2Z0S A;  1NY4 A;  1WI5 A;  2BA0 A;  2PQA B;  1X6O A;  3L2P A;  1CUK A;  4A76 A;  2KHI A;  2VY3 A;  4L5T A;  3I55 A;  3T1H Q;  1IBK L;  5IE8 A;  1TWA H;  1KRS A;  2JA8 H;  4WJ4 A;  2NVY H;  3HOV G;  1G29 1;  4DR3 Q;  5IYB G;  1GVP A;  2QEX A;  3EBE A;  3F2C A;  1S40 A;  2E2J H;  2JA5 H;  4DR4 Q;  4P75 A;  5AJ3 Q;  4FDB A;  1N32 Q;  3UDX A;  1O7I A;  1Z47 A;  4BBR G;  1Q86 C;  3E0E A;  1SE8 A;  1DGS A;  3MXN B;  1VS0 A;  4X66 L;  3KJP A;  4NXN L;  1VQ4 A;  4BA2 I;  5IP7 H;  4R4C A;  3H15 A;  4LFB Q;  4R4O A;  2B3G A;  2JA7 H;  4GKJ L;  4K0K L;  1LTL A;  3MEF A;  5BR8 L;  4BY1 G;  4L5R C;  4B3R L;  4GS3 A;  3STB D;  1XNQ Q;  1YNX A;  3M85 A;  1V1Q A;  1HNZ Q;  1E3P A;  2OQK A;  4IPC A;  4DV7 Q;  1E1O A;  1HZA A;  1GKH A;  3PCO B;  2AKW B;  1VQE A;  3ULL A;  5GAE C;  1I50 H;  1K73 C;  4LF7 Q;  1OXS C;  3D31 A;  1FJG L;  1VQ9 A;  1UE6 A;  4DR7 Q;  2A8V A;  2B29 A;  3PUW A;  4X65 L;  2AWN A;  5C4X G;  3KF8 B;  3PUZ A;  1HZB A;  4OON A;  4UPA A;  3ER0 A;  3HOY G;  1VQB A;  5J3B A;  2Q2U A;  3AFQ A;  4JV5 Q;  3UE1 A;  1XJV A;  1VQD A;  4JBW A;  1CSP A;  2K14 A;  4JC0 A;  4MTN A;  4OWX B;  4KHP L;  3GTJ H;  1OXU A;  3CCM A;  3PO2 H;  4UP8 A;  1X3F A;  4YHH L;  2K50 A;  2OTL A;  2V1C C;  3UDF A;  1HJP A;  1K3R A;  5C4J H;  4IO9 A;  4JI6 L;  3PUV A;  1XMQ L;  1NMF A;  3GDE A;  2K5H A;  3CP0 A;  3I4N H;  1HNW Q;  3CC4 A;  5GRO A;  4QL5 A;  1N36 L;  4GNX C;  4HIO A;  1HH2 P;  1T9H A;  1YJ9 A;  4LFC L;  3UDI A;  3A0J A;  5M3M H;  3KFU A;  2Z6K A;  3M3Y H;  1X54 A;  4TQU S;  3GTO H;  4POG A;  3CC7 A;  1FJG Q;  5IWA L;  3H0G H;  3U50 C;  3CCQ A;  1C9O A;  5JJI A;  1IYJ B;  5GAG C;  2VS1 A;  2NVT H;  2MQH A;  2UXD L;  3PO3 G;  1PHJ A;  2ATW A;  2VUM H;  1UE5 A;  2UU9 Q;  4ALP A;  3HOZ G;  1J5E Q;  1NTG A;  3AEV A;  4JI7 L;  1MKH A;  4AQY L;  1PH5 A;  3CF5 A;  1YHB A;  2FXQ A;  2ZM6 L;  1Q8K A;  4DUY Q;  3CMA A;  4PMW A;  1PH9 A;  3M4Q A;  1WOC A;  2D0P A;  1N8R C;  2ZTE A;  4R1J A;  1L0W A;  4LF6 Q;  3FKI G;  3HFZ B;  2A19 A;  5IYD G;  1K0R A;  2QA4 A;  5M5W H;  1NBW A;  2QGQ A;  1Q7Y C;  2WFW A;  4LF8 L;  2JA6 H;  5JEA J;  2UUB L;  1PYS B;  3RLO A;  2D0O A;  4LUV A;  4DR6 L;  2BA1 A;  4C3H H;  3G71 A;  2OCE A;  1HZ9 A;  4O2D A;  4PZ8 A;  4A3J H;  4JI0 L;  1VQM A;  3I4M G;  2KCT A;  1U0L A;  4A3I G;  1JJ2 A;  1XNR L;  3CQZ H;  1IZ6 A;  2UUC L;  2NVX H;  3J7A 5;  3S2H H;  1AE2 A;  4DV6 Q;  5IY0 A;  3I2Z A;  4DV5 L;  4LWC A;  4QJF A;  3RN5 A;  1V9P A;  4ME3 A;  1HR0 Q;  1BBU A;  4LUZ A;  1VQK A;  1I94 Q;  2VQE Q;  3PSI A;  1IBM L;  3K8A A;  5JJL A;  4DV2 Q;  5JEA G;  1V43 A;  3UDG A;  1YJW A;  4YCW A;  2HHH Q;  2A1A A;  4A3D G;  3ULJ A;  1SRU A;  4YY3 Q;  3J81 i;  3TEH B;  4AYB E;  1MJE A;  2D62 A;  3OTO Q;  3PGZ A;  4JI7 Q;  2KCM A;  1EIF A;  1VQ5 A;  3GTQ H;  2E5L L;  3M9B A;  3BZC A;  4OXP A;  4YWL A;  5FLX c;  1L2F A;  2F4V L;  3KLW A;  3GTG H;  4A3L G;  5IYC G;  4GKK L;  2YTX A;  4JI4 Q;  3KDF A;  3S2D H;  4DPG A;  1Q81 C;  4OX9 Q;  2MFI A;  1CKN A;  2R7D A;  5JJK A;  4L5Q A;  1IXR A;  2MO1 A;  3S1R H;  4C3I H;  1E24 A;  4DR1 L;  3PIP A;  1C7Y A;  4A3G H;  1VQI A;  3FHW A;  2E2H H;  3NBH B;  3M4P A;  4DK3 C;  4DV4 Q;  2UUA L;  2OWO A;  1BBW A;  2BH2 A;  4NB3 A;  1EUJ A;  3IRB A;  3CCS A;  1D8L A;  1XPO A;  5C44 G;  2I5M X;  4XTC S;  2WAQ G;  4JYA Q;  4IFD I;  2VNU D;  4A3K G;  4A3C H;  1I3Q H;  4AH6 A;  4EX5 A;  3CCU A;  1N33 L;  5ELN A;  5LMN L;  4JI2 L;  5LMU Q;  3L7Z C;  4DR5 L;  1JE5 A;  1Y1W G;  1N34 L;  2LXJ A;  2IX0 A;  1YVC A;  4X62 Q;  2KHJ A;  3CPF A;  4B3R Q;  4JI5 L;  1VQH A;  1ASY A;  4C3J H;  1A0I A;  4HJA A;  4DUZ L;  4A3E H;  1QZH A;  4LF5 L;  1UE7 A;  3TRZ A;  4OWT B;  1PH2 A;  4DV3 L;  4JI1 L;  2Y0S E;  3UE0 A;  1WYD A;  2DUD A;  1G6P A;  4DV0 L;  1EQQ A;  3S15 H;  1RIP A;  1XMO L;  2VQF Q;  2YTY A;  2N8N A;  1UE1 A;  1IBL Q;  1TXY A;  2HIX A;  2JQO A;  4DR2 L;  2MO0 A;  2IHF A;  2NVQ H;  1Y14 B;  1H95 A;  3CC2 A;  4DV1 Q;  5E7N A;  2K75 A;  3W5O A;  2B63 H;  4IPH A;  1BVS A;  2JK8 A;  3GD7 A;  5C3E G;  5M3F H;  1K83 H;  1L1O A;  4DK6 C;  2N49 A;  5FLM G;  4GLV B;  2UXB L;  3S1N H;  4BY7 H;  4QGU A;  3HOW H;  3S17 H;  2HT1 A;  1K9M C;  2AHO B;  1IBK Q;  4A93 H;  1KC8 C;  5FJ8 H;  4IOC A;  4OO1 G;  3SGI A;  3W1B A;  1WCM G;  3F8T A;  2JEA I;  1B7Y B;  2XTI A;  3CW2 C;  4JI2 Q;  4POF A;  2AWO A;  4B3S L;  4PZ7 A;  4R4Q A;  1HNX L;  2R7Z H;  2IT1 A;  4X66 Q;  4X64 L;  4NXN Q;  4YWM A;  2JA8 G;  2HIV A;  4GKJ Q;  3G48 A;  1X65 A;  4K0K Q;  4P71 A;  3Q8D A;  5BR8 Q;  4R4T A;  3AYH B;  2GVB A;  4A3F H;  2JA5 G;  3M4O H;  3HOU H;  1YZ6 A;  1VQ6 A;  4IJL A;  3ICE A;  1HR0 W;  3CAM A;  1M1K C;  4JOI C;  2E8G A;  2YYZ A;  3EN2 A;  5IP7 G;  4BBS H;  3CME A;  4XIG S;  1VQG A;  4GLA C;  2JA7 G;  2ID0 A;  4JI8 L;  1VCI A;  4UP9 A;  4A3B H;  3CCR A;  3I56 A;  1PH7 A;  3W1G A;  1KL9 A;  2YTV A;  2DGY A;  1B8A A;  2IHE A;  2KBN A;  4LF9 L;  1KQS A;  4JCV E;  2UXC L;  5K36 G;  4APV A;  3A5Z B;  3KF6 A;  1AE3 A;  3CCJ A;  4X65 Q;  4RG1 A;  1JMC A;  4LF4 L;  2CWP A;  3KF6 B;  1OXX K;  4A3M H;  3S24 A;  3L0O A;  2RHS B;  4BXX H;  3PF5 A;  3S14 H;  2F3I A;  5M5Y H;  2ZJR A;  2LSS A;  4GOP C;  3K80 C;  3GTP H;  4B3S Q;  1GD7 A;  4YWK A;  4JBJ A;  2ZTD A;  2R93 H;  2RHQ B;  1VQO A;  1PH4 A;  4WJ3 M;  4YCV A;  3AFP A;  4GN5 A;  4NPS A;  4KHP Q;  2JEB I;  1EOV A;  1E22 A;  1U5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...