3AQQA

Crystal structure of human crhsp-24
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
99
Chain Sequence
SPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIKNEKLQAVEVVITHLAPGTKHETWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-regulated heat stable protein 1
publication title CRHSP-24 is a novel cargo adaptor trafficking between stress granules and processing bodies
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 22
structure length 99
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aqqA00
5DLQE 4DAYB 1EWIA 5LMNQ 4LNQA 3F1ZA 4JBKA 2IX1A 1HZAA 3AEVA 3STBC 1WI5A 2BA1A 1E24A 5HY6A 4X62Q 4DV3Q 4B3SL 2UUBQ 4DV0L 1P8LA 1I94Q 2WAQG 1UEBA 1GD7A 1Y1VG 1BBUA 1SR3A 3GD7A 2JA8G 1D7QA 4EQ5A 3CCQA 2CCZA 2Y0SE 1L1OA 4ALPA 3I4MH 5GROA 3GTMH 4B3MQ 1NJIC 1PH9A 4QQBX 5FJ8G 2Q2TA 3PF4A 2UUCL 1XNRL 1NMGA 2FXQA 2JK8A 1YVCA 3W1GA 5FLMG 3W5OA 5LMNL 1SFOH 4B3TQ 4LF7Q 1TXYA 1PH1A 3HOVG 4HIDA 2HT1A 3GTJH 2NVTH 4X62L 4DV3L 1NBWA 4DR3Q 2UUBL 4DUZQ 2NVYH 2D0PA 5EAYA 1VQLA 1WFQA 4DR1Q 3UDFA 1HZ9A 1I94L 3E9HA 1IZ6A 4GN5A 4OWTB 5JJKA 3KF6B 1SN8A 2ZM6Q 4P72A 2I5LX 2Z6KA 3U4VA 4GOPA 1S40A 2IHEA 4GNXA 4IOCA 4A3FG 1Q46A 3M4OH 1YIJA 4JOIA 4B3ML 4TVAB 3CF5A 4POFA 2NN6G 1LTLA 1X3FA 3PO3G 2UXCQ 4BA2I 3U50C 5IYDG 1EFWA 3CCEA 2K5NA 1PYBA 4A3IG 4B3TL 4HJ7A 4LF7L 3TS0A 3B6YA 1VQBA 2VQEQ 4R4OA 5GQOA 3OYYA 4DR3L 4DUZL 4GKKQ 4C3HH 1I50H 1OXUA 4DR1L 4JI3L 2UU9Q 4HJ8A 1BKBA 3EIVA 4AH6A 1Z9FA 2ZM6L 1CKOA 1K8AC 1KRSA 3HKZG 4DAMA 4R4CA 4X65L 2RF4A 4JYAQ 4IFDG 4FDBA 4A4IA 1WCMH 1QZHA 3PUZA 2UUAQ 2EIFA 4UP8A 2UXCL 2L15A 4MTNA 2JEAI 2A1AA 1ASYA 3AFPA 4JBJA 1MJCA 3M85A 2VQEL 2E8GA 4GKKL 1XMQL 2R92G 1N9WA 5GAEC 3CXCA 1L1OC 3ULPA 1EQQA 2UU9L 1AE2A 4A3GH 3CMEA 1G291 1N34Q 2MFIA 4R4IA 2VL6A 1WOCA 3NBHB 3UE1A 2LXJA 4DUYQ 1R9TH 5IP9H 4Y52H 2JA6G 1C9OA 2ZJQA 1VQOA 3CMAA 2IHFA 2OCEA 3GO5A 2K52A 4X66Q 1NTGA 3L0OA 2UUAL 1B7YB 1FVIA 1W2BA 4IOAA 3KF8B 1QUQB 3S2HH 1PH7A 3VDYA 2VUMH 2I5HA 3M3YH 1PA6A 3HOYG 2N49A 1C7YA 3ICEA 3M4PA 1CUKA 2NZOA 3MEFA 5C0XJ 5IYCG 1GKHA 3CPWA 4A3CG 1VQJA 1N8RC 5M3MG 4JI5L 1XPOA 1FGUA 1XPUA 4A3DH 2RHQB 3GDEA 4DUYL 3CC4A 1YHQA 1Q12A 4R1JA 1JJ2A 1OXVA 3PUWA 2BH8A 2E5LQ 4A3MH 4LF5Q 3M9BA 2LXKA 1YHBA 1DGSA 3NELA 2HIXA 4AYBE 3L2PA 1CKNB 3S1QH 3CP0A 5IYBH 3LGJA 4JG2A 4YWLA 4YHHL 1VQGA 3J81c 4A75A 2E2IH 1PH6A 2OQKA 1MKHA 1SRUA 2PQAA 4PZ6A 5JEAJ 2I5MX 2VW9A 4APVA 4JV5Q 3GTGH 1HJPA 3CCUA 1K3RA 4PMWA 1YBYA 4JC0A 2A8VA 4UPAA 2WB1G 3CCMA 2MNAA 1Y1WG 2JJQA 2VQFQ 3RNUA 2E5LL 3T1YQ 3I4NG 1VQPA 2R93H 4LF5L 3KDFA 2XTIA 4L5TA 3GTKH 2KENA 3RN2A 4A3BH 3TQYA 2E2JH 2HHHQ 4DV4Q 3JAMi 5M3FH 4QIWE 1NE3A 4DR5Q 3PV0A 1X3GA 4YCUA 3HOWH 5M5XH 1SE8A 5GAGC 1K9MC 1Q8KA 4OX9Q 2AKWB 2ZJPA 4BBRH 2ZJRA 1P16A 4JV5L 2AMCB 1X6OA 4H02A 1TWAH 5C44H 4LFCQ 4MZ9A 1KIXA 2C35B 4C2MH 3EN2A 2GVBA 3I2ZA 1QVFA 2I0QA 3GTLH 1ASZA 4HIKA 2VQFL 3K8AA 3T1YL 3U4ZA 4NXML 4K0KQ 2UXDQ 1KAWA 3RZDH 5IE8A 3A5ZB 3GTQH 2HHHL 2ZTEA 3CCVA 4LF6Q 2ASBA 4DV4L 1HNWQ 1BBWA 1CSPA 4JBWA 4DR5L 2B63G 3H0GH 4GN4B 2IX0A 4JI3Q 5LMUQ 3H3VI 4BBSG 4OX9L 1GVPA 3PO2G 3PUYA 4XIGS 3RLOA 3F8TA 3W1BA 3PGZA 4X65Q 1PH8A 4QGUA 1VQKA 4LFCL 3S2DH 2PI2A 1X3EA 3OW2A 4KI0A 2GVAA 2WAQE 2JA9A 1XJVA 2NVQH 5IWAQ 1HZCA 3TRZA 1HNXQ 4OWXB 4K0KL 2UXDL 1VQDA 4BY1H 3S1RH 3G48A 2Z0SA 4LF6L 1K83H 4IFDI 1HNWL 1H95A 2JA5H 1XMQQ 4UP9A 3K7AH 1XNQQ 1HH2P 5LMUL 1YJWA 2K5HA 1VQ4A 3I4MG 3ZJYC 3HOUH 2DUDA 1TWHH 2K4KA 3M4QA 1SROA 1K0RA 3J7ZC 3S1MH 3PIPA 2OWOA 4PG3A 4DNIA 4A93H 1LYLA 5JJIA 2KCTA 1VQNA 4A3LH 1VQEA 2V1CC 4UP7A 4DK6C 1JT8A 3PCOB 3BJUA 1KRTA 4QY7A 4BA1I 4RMFA 4GLXA 1Q81C 3STBD 5IWAL 4JI7Q 2UXBQ 1EIFA 3HKSA 1X9NA 1YJNA 1KD1C 2HIVA 2R7FA 1HNXL 4GLVB 3RZOH 1LUZA 3TREA 1IBLQ 4BXXH 5C4XG 4DV7Q 3H15A 1XPRA 1OXTA 2F4VQ 4IJLA 1L0WA 2AWOA 4LF8Q 1XNQL 3J81j 1Q82C 1QZGA 1T9HA 2ZTDA 2VY3A 3KF6A 4ME3A 4JI5Q 4OO1G 3HOXH 1WYDA 1IXRA 2KHJA 4IPDA 3RR5A 4OWWB 3E9IA 1EQRA 2EXDA 1BVSA 1MIUA 1IL2A 2JA7H 4P71A 4LFAQ 1HZBA 2N8NA 3K7UC 5M5YH 3HOZH 4JI7L 2RHSB 2UXBL 1A8VA 3HKZE 1X55A 1C0AA 3RLFA 3JC66 1IBLL 2R7ZH 4LW1A 4P73A 2R6GA 4DV7L 1YEZA 2QA4A 1J5EQ 2F4VL 4YHHQ 1VQ6A 1KXLA 3CCRA 2MO1A 3S1NH 4LF8L 1Y14B 3U58A 3G71A 1VQ9A 4UY8C 1YHAA 4A3LG 1V43A 1WCMG 1VCIA 1VS0A 1A0IA 1XTDA 5IP7H 1S3OA 5IY0A 4A3EH 4JI0L 1N32Q 4WJ4A 3K81C 3F2DA 2Q2UA 3A5UA 4C3JH 4DV2Q 4DKAC 3DLLA 2PNHA 4JCVE 2EQSA 1VQMA 1M90C 4LFAL 3PSIA 4LFBQ 3CW2C 2VNUD 1NY4A 1V9PA 4LUZA 1AE3A 2F3IA 2JE6I 4OONA 5HGQA 1VQFA 1GO3E 2CFMA 5E7NA 4A3GG 1J5EL 3Q8DA 1JJCB 1E22A 3HOXG 1KC8C 2GN5A 1CKMA 3A74A 3J80c 1X65A 1B70B 2K75A 5IP9G 1L1OB 4LF4Q 3SGIA 4L5SA 4IO9A 1HNZQ 4JI1Q 1N32L 1Y1VH 2D62A 1TWCH 1XMOQ 3G4SA 4DR2Q 2JA8H 4A76A 5J3BA 4Y7NH 4DV2L 1IBKQ 4POGA 3M7NA 3BZKA 2R7ZG 4LUOA 3IRBA 5C0XG 1K8GA 2VUMG 4NXMQ 4LFBL 4YCWA 5FLXc 4IPCA 4C3IH 4B3RQ 1E3PA 2Y0SG 1D8LA 2MQHA 2QGQA 5FJ8H 1KQSA 1MJEA 4KHZA 3J81i 1VQAA 3JAMc 1PHJA 5FLMH 1QUQA 4NXNQ 4A3DG 3CC2A 2RCNA 2F52A 2YTXA 3PUXA 4GOPB 3HOVH 1I6HH 5ELNA 2E2HH 4GNXB 1CSQA 3TS2A 2OTLA 2YYZA 3FKIH 4KLKA 4OXPA 4LF4L 1SMXA 1HNZL 2H5XA 4JI1L 1XMOL 4BY7H 4A3MG 4HJ9A 5GAHC 4DR2L 3PUVA 4A3JH 2CWPA 4JI6Q 1PFSA 1IBKL 2VZAA 4YWKA 4JI2Q 3J7A5 4O0AA 3KOJA 1SLJA 5JEAG 5IYBG 5BR8Q 4A3FH 1VQ7A 3I55A 2HQLA 1YJ9A 1YITA 1B8AA 4HIOA 1K73C 3S24A 3H3VH 3PO3H 4B3RL 3UE0A 1EOVA 2DGYA 1VQHA 5JJLA 2WB1E 5M5WH 1CKNA 3AFQA 3F2CA 1L2FA 1N33L 3GTOH 4NXNL 4A3IH 4JI4Q 5IYDH 2NN6I 3D0FA 1KL9A 5K36G 1PV4A 4JI8Q 1Q7YC 2YTVA 3CC7A 3GTPH 3ULLA 1OXXK 2R93G 4IJHA 4JI6L 4JI2L 4A3BG 1GM5A 1JJGA 1VQCA 5BR8L 4O2DA 1U0LA 1U5KA 3DM3A 5M3FG 1PH2A 3S15H 1UE1A 2N78A 3HOWG 4IFDJ 5C4JH 4X64Q 5AJ3Q 1S72A 4BBRG 3ER0A 2K50A 1YI2A 3FKIG 1HR0W 2NVXH 4JI4L 2ATWA 1E7ZA 5C44G 1I5FA 1UWVA 2YV5A 1A62A 3L7ZC 3ULJA 4BY7G 1V1QA 1Q86C 4PZ7A 4JI8L 3KJOA 4A3JG 2JEBI 3K0XA 3WWVA 2R92H 1J6QA 1OXSC 3S17H 4YY3Q 4A3KH 4R4QA 1QVGA 3I4OA 1UE6A 4R4TA 4YWMA 4XTCS 4PZ8A 4HJAA 3I7FA 2PMZE 2JA6H 4J15A 3H0GG 1JE5A 5C4XH 4OO1I 2ID0A 3S16H 1VQIA 3FHWA 4X64L 5AJ3L 1IBMQ 2CQOA 2CKZB 1VQ5A 1Q1EA 2ES2A 1KHIA 1I3QH 3CCJA 1IYJB 1Z47A 3CAMA 4IPGA 1EUJA 3OTOQ 4LF9Q 1PYSB 4RG1A 4WJ3M 1OTCA 3NEMA 3HOYH 3ERSX 2ALYB 3CD6A 4A3CH 4YY3L 5IYCH 2K14A 1JMCA 4DR6Q 2K5VA 3KYHC 5M3MH 1N36Q 2YTYA 1PVOA 5ELOA 4MNOA 2BH2A 4BY1G 4DR4Q 1W3SA 2KCMA 4IPHA 1RL2A 3UDXA 5GADC 2NZHA 1PH4A 2PI2E 3KLWA 2JA5G 1NMFA 4GLAC 3KFUA 2KHIA 4DV5Q 4AQYQ 1IBML 3HOUG 4NPSA 2PQAB 3PF5A 1Q1BA 1EYGA 2AHOB 2IY5B 3E0EA 4A93G 4EX5A 1X56A 3OTOL 4LF9L 3CPFA 3UDIA 4A3KG 3A0JA 3S14H 3TEHB 3D31A 2IT1A 1HR0Q 3I56A 4LWCA 4AYBG 2AWNA 4JYAL 3PIOA 4DR6L 2A19A 5LMNW 1N36L 3RLNA 2MO0A 4DR4L 3KDFB 4BXXG 4GKJQ 4P75A 1PH3A 3EBEA 3T1HQ 4AIMA 1VQ8A 1YNXA 1FL0A 1TWGH 4DPGA 5C3EH 1Y1WH 4KHPQ 3AYHB 4DV5L 1O7IA 2Z6KC 4TQUS 4AQYL 3K80C 2LSSA 3G6EA 4DV6Q 4GOPC 3I4NH 4X6AH 4GS3A 2Q2IA 4JBMA 4GN3B 4GNXC 1WJJA 1G6PA 3F2BA 2D0OA 4YCVA 2JQOA 4JOIC 4L5RC 5C0XI 1UE5A 2JA7G 3MXNB 1N34L 1HR0L 4L5QA 1TWFH 3HOZG 1E1OA 2R7DA 4P74A 1JB7A 3RN5A 1FJGQ 4DR7Q 1UE7A 2OTJA 5IT9c 4DV1Q 1AH9A 4DK3C 1RIPA 2B29A 4X66L 5H1SE 1X54A 3KJPA 1PH5A 2CWAA 4GKJL 3AQQA 3BZCA 4JI0Q 3FP9A 3T1HL 3CCLA 2WP8J 4HJ5A 4KHPL 3CCSA 4B3SQ 3UDGA 4DV0Q 4DV6L 3NENA 1N33Q 2Q2HA 1LM0A 3HFZB 4QJFA 5IP7G 4A3EG 3J80i 1M1KC 2BA0A 1A63A 2B63H 4NB3A 2B3GA 2ZTCA 2XGTA 2N3SA 3CQZH 2QEXA 4BBSH 4DR7L 1FJGL 3PO2H 2KBNA 2VS1A 1G51A 4LUVA 4DV1L 1QVCA 2OQ0A 5C3EG 2YU9H 1E1TA 4HIMA 4QL5A 1EIYB 3BU2A 2UUCQ 2WFWA 1YZ6A 1XNRQ
chains in the Genus database with same CATH superfamily
5DLQE 3H0GB 2NZ1D 3F1ZA 2BA1A 5HY6A 4CKEA 2K28A 3X3NA 4DV0L 1D2BA 5D3DA 3MAQA 1SYBA 1UEBA 1Y1VG 1SR3A 5F2DA 5D14A 1D5ZC 2CCZA 1K0SA 3Q22A 2NVQB 5GROA 4CDDC 4OL7A 4C3IG 1B50A 4QQBX 5E4WC 5FJ8G 2Q2TA 4BY1B 1K83B 5EGTA 1XNRL 1FNUA 4B3TQ 5FLMG 3TSSA 4HIDA 2NVTH 4H13C 4DV3L 1PDQA 4DR3Q 2UUBL 2NVYH 1HZ9A 1I94L 3E9HA 4A93B 1SN8A 3OMCA 2ZM6Q 2RSNA 1ESRA 1S40A 2DY8A 1Q46A 1YIJA 3K58A 4WRDA 4OO1H 4EGVA 4POFA 1X3FA 4RKLA 1VDZA 1PYBA 4HJ7A 5KRUA 3J80E 5IGCA 4BS9A 3OIQA 4DR1L 1SE2A 4JI3L 5FO9B 1K8AC 1H9KA 1BF4A 1BXTA 4R4CA 4DK1A 4IFDG 5M5YB 1F9PA 4A4IA 4KJOA 2UUAQ 2EIFA 2JXMB 3DWAA 3CRKC 4JBJA 1DXMA 4OEMB 4N8FA 2NYZD 3IAYA 3WOEA 4GKKL 1XMQL 4A3GH 3U9OA 3CMEA 2MFIA 1BCPD 3NBHB 1RTOA 4IUPA 4DUYQ 4Y52H 2WKCA 2B8GA 3GO5A 4X66Q 3HRZC 1R4PB 1F9RA 1B7YB 1PZID 1NR2A 2B2VA 4IOAA 3WDNA 1QUQB 3MC0B 5C0XH 2K04A 3VDYA 1ICWA 3M4PA 2EPBA 1YNJD 5IYCG 1N8RC 4K5VA 1CT1D 2RHQB 1U4PA 3CC4A 2WINB 2EDGA 3T4AC 1OXVA 2F0IA 2NBFA 3M9BA 3NELA 1B53A 1DGSA 2HIXA 1PRTB 3C1FA 5IYBH 2JP1A 3LGJA 5A2QE 3J81c 1AN8A 1VQGA 4CDCC 4ZK9B 3FKIB 1CA5A 5HGTA 2OQKA 2VW9A 1EU3A 4JW0A 4BY7B 1LTTD 1HJPA 3CCUA 2KEEA 3DHQA 3NWSA 4PMWA 1LT4D 2WB1G 3DMUA 2VQFQ 3I4NG 5M5WB 2XTIA 3GTOB 2QEJC 4A3BH 3TQYA 2HHHQ 3JAMi 1SJED 4DR5Q 3HOWH 1X3GA 2BOSA 2SNMA 5GAGC 4OX9Q 4MHEA 3J81L 4BBRH 2ZJRA 2EYFA 4JV5L 2L11A 3HKZB 5C44H 1KIXA 2C35B 2B2VC 3EVQA 3I2ZA 5A35A 1JE4A 5C4JB 3K8AA 3T1YL 3RZDH 3GP7A 2NVXB 5IE8A 3GTQH 2ZTEA 1S5FD 1HNWQ 2NTSA 4DV4L 1MBYA 4JBWA 3H0GH 3SK6A 4GN4B 4JI3Q 5LMUQ 3H3VI 3MXUA 3PO2G 4XIGS 3TBIB 3V2TA 3PGZA 1VQKA 4LFCL 2JA6B 5BN4A 1X3EA 1KLGD 2JA9A 2AUJD 2NVQH 5IWAQ 3S16B 4BY1H 3O13A 4LF6L 1CK1A 1K83H 1H95A 1XMQQ 2A73B 1HH2P 2Q8TA 1KDBA 4DXGA 1K0RA 1KLUD 3J7ZC 2OWOA 4A93H 4DNIA 1LYLA 1M4VA 3N52A 5JJIA 1YNJC 1VQNA 4A3LH 2V1CC 1JT8A 3PCOB 1E0BA 1KD1C 1YJNA 1HNXL 2F0NA 1EQTA 1IBLQ 2IX3A 4BXXH 2NTTA 1EY9A 3J81j 1CA6A 4OO1G 1WYDA 1AEXA 2KHJA 1SE4A 1ICFB 3E9IA 2EYJA 1ILPA 1JCKB 1Y1WB 3K7UC 5M5YH 2RHSB 1LTSD 3HKZE 1X55A 1FD7D 4LW1A 2QA4A 1JB3A 1IHZA 1SYFA 3NPPA 1Y14B 4UY8C 1V43A 1QJOA 1XTDA 2PQEA 1CI3M 4U68A 1Y69U 2Q2UA 3H3VC 3DLLA 1ZYRD 2K32A 2A69D 5ELCA 1EYDA 1PYWD 4OONA 1VQFA 2CFMA 4A3GG 2B63B 3CQZB 1CKMA 1EU4A 5EPLA 4LF4Q 1EZ8A 4IO9A 4L5SA 4JI1Q 1N32L 1D1KA 3Q23A 1PRTF 1K28A 3VA7A 4POGA 1IBKQ 3IRBA 5C0XG 1H9RA 1K8GA 4YCWA 1E3PA 3PQIA 5E3FA 3X3MA 1B9MA 3FDTA 1XYIA 1RF2D 4LMQD 1VQAA 3JAMc 3KF8A 3Q24A 3VR6A 2RCNA 1OO9B 2YTXA 3OPOA 1CSQA 3FKIH 2ZT9C 3NTHA 3I70A 3NXWA 2RDGA 1XMOL 2X6LA 4BY7H 4HJ9A 1PFSA 3QR8A 1VQ7A 1SLJA 5IYBG 1DOMA 2L5TA 1I4HA 2H4OA 4J6HA 4HIOA 2NN6H 3PO3H 3UE0A 1VQHA 5M5WH 5IYDH 3GTOH 4NXNL 2PZUA 3D0FA 1W6JA 2Z1CA 5K36G 4KY7A 3JAML 3M4OB 5DNFA 2YTVA 4JVZA 3CC7A 1RKNA 2PZWA 4IJHA 3R3OA 4A3BG 2HDMA 3T16A 3HOWG 4IFDJ 5C4JH 4X64Q 5CGKA 4BBRG 4M8AA 2FFKB 1YI2A 2F0VA 1HR0W 2NVXH 4FO2A 1EY5A 5C44G 1UWVA 3ULJA 1V1QA 4PZ7A 4JI8L 3KJOA 1WCMB 4A3JG 3K0XA 3ITPA 1OXSC 4YY3Q 3I4OA 1UE6A 3BG3A 4QUFA 1TVXA 3IFDA 1C4QA 2JA6H 5I2XA 3H0GG 5KNDA 1JE5A 1MSHA 4K14A 3J81E 1A3VA 3S16H 5AJ3L 1IBMQ 1GXDC 2KHSA 1QWYA 2Z4HA 4RG1A 4H0LC 4WJ3M 3NEMA 1LT6D 1TKWB 1U9RA 1SBBB 5FK9C 3VYSA 1ENAA 4A3CH 1JMCA 4DR6Q 3NHHA 2K5VA 3KYHC 3P7JA 1N36Q 1WVLA 4MNOA 3R93A 1STBA 4BY1G 4ZKCB 4DR4Q 1SNCA 2KCMA 5GADC 2PI2E 4GLAC 5IGBA 3ZYYX 2KHIA 3FVQA 4AQYQ 1EYGA 4A3DB 1GOZA 4A93G 3CPFA 3C2PA 4XYQA 2B2WA 1LT3D 3I56A 4LWCA 1F2ZA 1KTKA 2LKVA 4J1MA 3TZUA 2F0KA 3DWPA 2EE1A 2A6ED 3GV6A 1DOKA 1EQVA 4BXXG 3EBEA 2K5DA 3T1HQ 4CBVA 1VQ8A 2MUYA 1Y1WH 4K5WA 1O7IA 4TQUS 1A2TA 4X6AH 3K80C 3U9SA 1S5DD 3DWQA 4GS3A 2DNEA 4CDEC 1RTNA 1G6PA 1EYAA 2JQOA 3E3XA 4JOIC 5G3LF 1G91A 1N34L 1HR0L 3NP8A 2R93B 4KD3A 1AH9A 3LWEA 4DK3C 4KN4C 3GTKB 1PH5A 1X54A 2R61A 1LTBD 4JI0Q 5EKKA 3CRLC 1GUGA 3TMEA 1DONA 4B3SQ 3UDGA 4DV6L 3NENA 2Q2HA 1LM0A 3HFZB 5KEEA 1EOTA 1ESFA 2LFNA 1M1KC 3NUCA 2B63H 2B3GA 1GHKA 3GTLB 3CQZH 4M1UB 2N3SA 3TP6A 4DR7L 1KNAA 2VS1A 4DV1L 1QVCA 2OQ0A 5T1IA 4QUCA 4HIMA 2A6HC 1J9OA 1RJTA 1Z6HA 2NVYB 2D2CC 3K6OA 2IX1A 3STBC 4X62Q 3VA5A 1P8LA 1SYCA 1GD7A 1I4RA 1BBUA 2B2UA 2K7VA 1LT5D 3H09A 2Q8IB 1A2UA 1L1OA 3GTMH 1PH9A 3PF4A 1NMGA 2FXQA 4RGOS 4N8X1 4B08A 1SFOH 1TXYA 1HRJA 2HT1A 1NBWA 4G4KA 3HOUB 5EAYA 2D0PA 3S1MB 3UDFA 1UEAB 4F87A 4P72A 4FF4A 4GOPA 1I4PA 2IHEA 4FNFA 2NWGA 4GNXA 3HP3A 4IUNA 3M4OH 2A68D 2NN6G 3PO3G 4BA2I 1GUTA 5IYDG 3CCEA 4B3TL 1II3A 3B6YA 1HCZA 2F0PA 5GQOA 4DR3L 2L55A 1OXUA 3BS1A 3SK5A 3GV3A 4HJ8A 4AH6A 2ZM6L 1HFGA 4CGYB 1KRSA 2QW7A 3HKZG 2ENBA 1VMCA 3TDQA 4DGZA 4FDBA 1WCMH 5LL6S 3PUZA 4ZYSA 1VF5C 4J8QA 3OOCA 2B2UC 1EY0A 3M85A 2E8GA 2MP1A 1N9WA 4CJ0B 5GAEC 1L1OC 3MFYA 3ULPA 2DJGC 1STAA 2F0JA 1G291 3NK9A 3QB3A 1N34Q 3DEOA 3OW7A 2JA6G 1C9OA 1HA5A 1F77A 2ZJQA 1SJHD 5KYLA 2UUAL 3D4DA 1FNWA 2K52A 1NTGA 2G5DA 5CV8A 3AB9A 1CQVA 1FVIA 1EY8A 1MD2D 3KF8B 1PMRA 2L1BA 3D3RA 2I5HA 2N49A 3ICEA 3NE5B 5C0XJ 3VYTA 4A3CG 2JA8B 1T5EA 1XPOA 1FGUA 4Y7NB 4A3DH 2B2TC 4DUYL 1TR5A 4R1JA 3QJYA 1JJ2A 3PUWA 2E5LQ 4Z9CB 4QMGA 1YHBA 3L2PA 3HOVB 2E2HB 4YHHL 2PQAA 3R8BA 4APVA 4A3JB 4RH6A 1AFPA 5JVH3 3I72A 3C3LA 2AQ3B 1Y1WG 2FMCA 2JJQA 2L0CA 1VMPA 2R93H 4A3IB 3GTKH 3E0JA 1NSNS 1NE3A 4RFBA 2O5IC 4YCUA 3NQIA 2Z9HA 2AKWB 1P16A 1ET9A 1QE6A 2SOBA 1S5CD 1PTOB 3MXNA 5C3WA 3EN2A 2GVBA 2V4DA 4RGNA 3PIP3 2I0QA 3GTLH 4HIKA 2VQFL 2HCIA 4G57A 4NXML 2UXDQ 2F0GA 2HHHL 4DR5L 2B63G 1TIID 2R92B 4EQOA 3S17B 4OX9L 1CM9A 1QG7A 4TRDA 3RLOA 2CHBD 4ZAIA 4QGUA 4ME5A 2PI2A 3OW2A 2GVAA 4NDXA 1ONLA 5EQ0A 3A8JE 5IODA 1Y8OB 3TRZA 2M2LA 2Z0SA 1HNWL 1C8CA 4IFDI 4IUUA 1XWEA 5EPJA 4B9XA 3HOYB 1XNQQ 5LMUL 5J1ZA 2K5HA 3HOUH 2DUDA 5TSSA 1SROA 5M3MB 3S1MH 1VQEA 4UP7A 4DK6C 2F0SA 3T13A 4QY7A 4BA1I 5IWAL 4JI7Q 2F3VA 2HIVA 4IN3A 1LUZA 1B1ZA 1LABA 4XQQA 5EJWA 1QZGA 2VY3A 4IURA 4ME3A 2H1EA 1XX8A 1Y8PB 1HQMC 1EQRA 3OIPA 2EXDA 1MIUA 1TWGB 2MJ8A 4P71A 1I4XA 1HZBA 2B39A 1RCVD 2XWJB 3JC66 1IBLL 1IYVA 4YHHQ 3CCRA 1Z7TA 3U58A 1JOKA 1WCMG 1VCIA 1JOQA 5IP7H 4ILWA 3MZ5A 4DV2Q 4DKAC 1D5MC 1SEBD 3OMGA 3CW2C 2VNUD 2QDLA 4LUZA 2F3IA 2JE6I 3K59A 3SHLA 1GO3E 5E7NA 4RHSA 1NCVA 3S9WA 3N6RA 3A74A 3WOFA 1B3AA 1B70B 4RWSC 4BBSB 1O7YA 3MEHA 1L1OB 2PMZB 1HNZQ 2D62A 5K36H 3OHXC 4RGMA 1DJRD 3G4SA 2JA8H 1CHQD 5J3BA 4Y7NH 1EY7A 3M7NA 3PO3B 4XQJA 2R7ZG 2EVBA 1D5XC 4NXMQ 2G9HD 2QGQA 1KQSA 1PHJA 4A3DG 2F52A 4GOPB 3PUXA 3HOVH 5ELNA 2E2HH 3K0YA 4GNXB 4HCEA 2OTLA 2KUMA 4LF4L 4JI1L 4K2KA 3SXHA 4A3JH 4JI6Q 4DNTB 1IBKL 2VZAA 3KLRA 4YWKA 3I90A 4JI2Q 4JK1C 3J7A5 5BR8Q 3GTJB 3C46A 3I55A 2HQLA 1BOSA 3E6ZX 4OGQC 1B8AA 2DGYA 5JJLA 1Q90A 4XQNA 1VF7A 1CKNA 2C9OA 3F2CA 1L2FA 1PTOF 4A3IH 4JI4Q 1QOHA 4F8MA 3A8KE 2TMPA 2F4IA 4MN3A 2R93G 1BCPC 1K8OA 2KQ3A 4KN7C 1PTOH 3S15H 1UE1A 2N78A 1KABA 4C3HB 1LTGD 3DUZA 3F2UA 1WTHA 2K50A 3ER0A 4C1NI 2ATWA 1CQFA 1TT2A 3L7ZC 1Q86C 4DN4M 5FKAC 2QILA 2R92H 1IYUA 4CKCA 1J6QA 3S17H 5CV4A 1TY2A 3CHBD 3EJIA 5JJZA 4HJAA 4K2LA 5CORA 2PMZE 5DEHA 3PIO3 4KJNA 4OO1I 2ID0A 4CHTB 3FHWA 4X64L 5K5PA 3BVMA 2HD3A 1Z47A 1F9QA 4IPGA 3OTOQ 4LF9Q 1R9TB 4FF3A 4CDFC 3HOYH 1TU2B 2EY2A 4YY3L 2K14A 4DK0A 4OHJA 2J0TD 3URYA 5EKIA 5M3MH 2SEBD 2BH2A 1FGBD 2F0WA 4IPHA 3D4RA 2VUMB 4HAEA 2QKIC 1NMFA 5C5LA 2EY6A 1DD2A 4DV5Q 1IBML 3HOUG 4NPSA 1SNOA 2PQAB 1Q1BA 3KBGA 5IGEA 4EX5A 1X56A 1J8IA 3A0JA 3TEHB 1XXGA 2N55A 4KTAA 4K8JA 4RAUC 2AWNA 2EYMA 3A56A 3VR2A 2A19A 4DR6L 5CBAE 1N36L 5E4XA 4DR4L 1AP0A 2DJFC 3DEPA 1B4OA 2KOLA 2LMCB 2Z8LA 4RGTA 1L0YB 1A3TA 1FL0A 1TWGH 4G7HC 3E5SA 1CFMA 2IW3A 2Z6KC 4AQYL 2LSSA 1IL8A 4JBMA 1U4LA 2KJXA 2Q2IA 4KMUC 3GTGB 4QF4A 2CW0D 4L5RC 4IZ8A 5I4DA 5C0XI 5ELEA 2Z6BA 2PO4A 3MXNB 2P5ZX 2K01A 2R7DA 1JB7A 3EA6A 4K6LA 1STEA 1NUCA 2NB0A 2CWAA 1I4GA 2F0TA 3T1HL 1WTPA 2WP8J 2MGSA 4HJ5A 5M5XB 1LTID 3CCSA 2OF1A 5COYA 1EY4A 5J39A 1AZQA 5IP7G 2JYOA 3J80i 5M9OA 1TWAB 3MWYW 2IL8A 3GTMB 1RDPD 5C6AA 2ZTCA 4BBSH 4IUTA 1SFOB 1STYA 3AU7A 3HS0C 1E1TA 1EIYB 1NNXA 2UUCQ 4JI0L 2E2DC 5T1GA 5FO8B 1EWIA 5I6WA 5LMNQ 4JBKA 3AEVA 1HZAA 1WI5A 4PV1C 2K1BA 3ND9A 5KIXA 4B3SL 5EBCA 1IW7D 1BO0A 4HSPA 4ZLTF 4ZUIA 3GD7A 2JA8G 4EQ5A 3CCQA 1EL0A 4DAVA 2ICEC 4DA2A 3I4MH 4B3MQ 1NJIC 4UAIA 2XNAC 1WTOA 2JA5B 1TS5A 3W1GA 1YVCA 5EBDA 4LF7Q 1EZ6A 3HOVG 1PH1A 3GTJH 2F03A 4X62L 4DUZQ 2O4XA 1VQLA 1CHPD 4GN5A 4OWTB 1MGSA 3SR1A 2K5WA 3LNNA 3U4VA 3H91A 4HSVA 2M00A 3RZOB 4JOIA 4XXEA 3CF5A 3D6WA 2CVRA 2UXCQ 3SK8A 3NQTA 4HN7A 3V05A 1EFWA 2K5NA 4A3IG 3QWNA 1VQBA 1ZYRC 2VQEQ 4OELB 1G6ZA 2A69C 4C3HH 3H6MA 2UU9Q 2KCCA 3RD4A 3EIVA 4NMZA 4X65L 3SE0A 3QOLA 2EZVA 3BYYB 4ULLA 1B9NA 2R7ZB 4MTNA 2VXWA 1BCPB 2A1AA 1MJCA 3M7GA 2R92G 1EQQA 3CXCA 3DXJC 5JVG3 1AE2A 5I9OA 1ML0D 1WOCA 3UE1A 2LXJA 3MFGA 1R9TH 4N9TA 4P2CB 4R9WA 3CMAA 3VR4A 4ZCKA 2L12A 1K3BC 4QB4A 1W2BA 3T51B 1PH7A 2VUMH 1Q8IA 4DFAA 1PA6A 3HOYG 1PFMA 1FYCA 3MEFA 2NZOA 1TWCB 1GKHA 2B8FA 1VQJA 5M3MG 2PW7A 4JI5L 2I46A 1IW7C 1SYEA 3GDEA 3TZDA 3KLSX 4KHVA 1CZGA 1Q12A 4IQZA 2HDLA 4LF5Q 1KDCA 1EIGA 4ZRZA 1CKNB 4IUVA 1SMYD 4A75A 2XSCA 4PZ6A 2I5MX 1BUVT 3ONAB 4E6IA 3GTGH 1X3PA 1EWHA 4A3FB 1KDAA 1K3RA 1PRTD 1YBYA 2CQAA 2A8VA 2MNAA 3RNUA 2E5LL 1SNDA 3RN2A 3Q6SA 3A7AB 3PV0A 4DF7A 5M5XH 1SE8A 5DM63 1Q8KA 3GTPB 2ZJPA 5ISRA 2F0EA 2I07B 4RKBA 4H02A 1TWAH 3LWUA 1R4QB 1QILA 4IALA 1QVFA 4X3SA 3I8ZA 1EY6A 3CKIB 1H9JA 1ASZA 4K0KQ 1KAWA 4DAPA 3K5LA 5FO7B 2ASBA 1BBWA 1CSPA 3VR3A 3FEWX 2IX0A 3DM1A 2EJFC 1STGA 2J4XA 4BBSG 1GVPA 3NWTA 3W1BA 4X65Q 1PH8A 5EPKA 1E2VA 4KI0A 2WAQE 3MA2B 5C4XB 2CH4A 1G2TA 2B2TA 1HUMA 2K33A 1HZCA 4OWXB 2UXDL 2LS01 1I3QB 3EROA 3BYTB 4HEDA 1H9MA 2A6EC 4DAYA 1PZJD 1LTRD 2JA5H 2RDFA 4UP9A 1IKLA 1VQ4A 3I4MG 3QG1A 3ZJYC 5DM73 3EQLC 3PIPA 4PG3A 5CV5A 2KCTA 1JWUD 2IWHA 1V8QA 4V190 4GLXA 1XTCD 1PXUA 2UXBQ 3RZOH 1JWSD 3JAME 3TREA 4DV7Q 3H15A 1WTQA 4U673 2F4VQ 3S14B 1L0WA 2E74C 4LF8Q 4JPBW 1XNQL 4H44C 2OXPA 1T9HA 1SMYC 3KF6A 4JI5Q 2PPBC 3D8GA 1IXRA 1HPCA 4IPDA 4OWWB 1ILQA 4LFAQ 1B2TA 4K8IA 1PRTC 4JI7L 2L4NA 4C3HG 4O1NA 3RLFA 2R7ZH 4HR7B 1VQ6A 1YEZA 1J5EQ 2CH4W 2XN9C 1LACA 1TWFB 3G71A 1C48A 1YHAA 1A15A 3FRPB 1CTMA 1S3OA 5IY0A 4WJ4A 1SNMA 1X32A 3F2DA 3OWEB 4L63B 3HEJA 2PNHA 4JCVE 4N9PA 2EQSA 1M90C 1AZPA 1O7ZA 3SEBA 4LFBQ 1V9PA 3QIAA 1SDFA 2D5DA 1JJCB 5LL6X 3HOXG 3GQBA 5IGGA 5JOBA 1PFNA 1X65A 5G3LD 3SGIA 2KECA 2A5HA 1TWCH 3I91A 4DR2Q 4A76A 4DV2L 2VB2X 4LUOA 2VUMG 3RMHA 5ELDA 1F2MA 5FLXc 2LY7A 2A68C 4B3RQ 2MQHA 1MJEA 3NTKA 3J81i 5CR3A 3CC2A 2HCCA 2YYZA 4OXPA 4KKUA 1HNZL 2FMMA 3IL8A 3S15B 1LO5D 4O0AA 5JEAG 4A3FH 5IIFA 1F2YA 2ZXOA 3TP7A 2MHVA 3H3VH 2F0FA 4X3UA 5I6YA 1JORA 5FLXL 1N33L 1MSGA 1D1IA 2R3ZA 5E1FA 5IGFA 1PV4A 5BN5A 4Q5VA 2DY7A 3GTPH 2KCNA 1OXXK 4NKLA 4ODGA 4JI6L 4JI2L 5BR8L 1U0LA 1U5KA 1PH2A 3L3OC 3K5NA 1BQQT 1NAPA 1I50B 3KBXA 1GUNA 4PMBA 4JI4L 1E7ZA 2PNRC 1I5FA 2F0UA 2YV5A 4HMIA 1A62A 1I6VC 1JOOA 3WWVA 3KUPA 2RDHA 1SE3A 4KKSA 2K5QA 4R4QA 3P20A 1QVGA 4YWMA 4R4TA 4XTCS 1SXTA 4K6DA 1O7LA 3I7FA 3J7AV 4CKBA 4J15A 4DU9A 2RBMA 5C4XH 1WTXA 1VQ5A 2ES2A 2CKZB 4WFN3 1I3QH 1EUJA 2FINB 5D3IB 4L6TB 3G7LA 2ALYB 3CD6A 2F0DA 1WTRA 3A8IE 1PVOA 1B3QA 1W3SA 3UDXA 1RL2A 3S2HB 1PH4A 2NZHA 5KGUA 3I4LA 2JA5G 3M3YB 5LHY1 2Y0SB 3KFUA 1W6KA 3PF5A 5KNCA 4PNYA 1SSOA 3OTOL 4LF9L 3BZDB 4A3KG 3S14H 3D31A 1DM0B 1DOLA 3D6CA 4JYAL 3PIOA 1NR4A 4A3MB 4I65A 3IFTA 5LMNW 3S1QB 4GKJQ 3SDZA 2E2IB 2EXZA 2JN4A 4KHPQ 4DV5L 3FPUB 2IY5B 4G7OC 2ICIA 1WJJA 4DXFA 3HGBA 2D0OA 4YCVA 3IKJA 4PMCA 2L9HA 1UE5A 1WTVA 1TWFH 1FJGQ 4P74A 3RN5A 1Q3LA 1UE7A 2OTJA 5IT9c 3L9AX 1RIPA 2B29A 5H1SE 3KJPA 4EVOA 2E2JB 3A54A 5ELFA 3BZCA 5M3FB 3FMCA 3FP9A 4ZKBB 1HA6A 1O80A 2TSSA 3T56B 1HHVA 4DV0Q 1N33Q 5KYIA 4EQNA 3NTIA 3I4MB 2RCFA 3A55A 1A63A 3ND8A 4C2MB 4NB3A 2HQEA 2F0MA 2QDBA 2QEXA 2XGTA 5CYUA 4ZQ3A 1UNSA 2GA4B 2M9VA 4NW2A 4LUVA 5I9PA 5C3EG 2PCFB 5JPNC 2O2LD 3BU2A 5IT9L 2WFWA 5CV6A 1XNRQ 1HFNA 4DAYB 4LNQA 1ZXTA 3M4YA 1E24A 4DV3Q 2UUBQ 1CZWA 1I94Q 2RA4A 2X6GA 2WAQG 3MHBA 3S2DB 2BDNA 2RKSA 4NP5A 1GHJA 1D7QA 2Y0SE 2PZTA 4ALPA 1RODA 1JC7A 1EFID 4WORA 1KNEA 3S1RB 1ET6A 2UUCL 3VYRA 1QCBD 2JK8A 5LMNL 3W5OA 3K7AB 1TWHB 1WFQA 4DR1Q 3W2DA 1IZ6A 1LTAD 5JJKA 3KF6B 2I5LX 1JR0D 2Z6KA 4DNRB 4OIJA 1HUNA 4IOCA 4AYBB 4A3FG 2F0LA 3OSOA 1M8AA 4B3ML 4TVAB 3C1EA 4UDUC 1LTLA 5CV9A 3U50C 4LK1C 3BVGA 4LF7L 3TS0A 1TS4A 4R4OA 3OYYA 4DUZL 4GKKQ 5L37A 1I50H 3HOXB 1BKBA 1Z9FA 1CKOA 4KY5A 1E2WA 2JA7B 4DAMA 1DYQA 2RF4A 4KY6A 3HOZB 4JYAQ 2EY5A 1ZEQX 1QZHA 4RCOA 4QIWB 1BBXC 4UP8A 5FLXE 2UXCL 2L15A 2JEAI 1ASYA 3AFPA 3W3AA 3S1NB 3KK7A 2VQEL 5CBEE 3MXPA 2FJ2A 4A3EB 1WTWA 3K5OA 2UU9L 4L8JA 4C3JB 5J22A 1PZKD 4R4IA 1GUOA 2VL6A 5IP9H 3R2TA 1WD0A 1VQOA 5C4XG 2IHFA 2OCEA 3L0OA 1LV9A 1U4MA 1KAAA 3MTSA 2AQ2B 5C3XA 2EYLA 2MPMA 1PFBA 3S2HH 2SNSA 2E75C 3M3YH 1C7YA 1Y1VB 1CUKA 2WKDA 3TP5A 1V1OA 3CPWA 5CMDA 2K6AA 1XPUA 1H9SA 1YHQA 2EYHA 2G9DA 3MVVA 1SNQA 4C3IB 3VR5A 1DZ1A 2BH8A 1BDOA 2XWBB 4F88A 4A3MH 1WD1A 1QNUA 2LXKA 1S5ED 4AYBE 3S1QH 5EKLA 3CP0A 1IKMA 1I6HB 1E2ZA 4FP5D 4JG2A 4YWLA 4KV6A 2E2IH 1PH6A 1MKHA 1SRUA 5JEAJ 4XYOA 4XT3B 1EYCA 5CC4A 1MI2A 4JV5Q 4S3SA 4XDXA 4JC0A 4LJZC 4UPAA 3CCMA 1B44D 5JPMC 4FVMA 4B9WA 3J7YW 3T1YQ 3I73A 1VQPA 4LF5L 2OEOA 3KDFA 4L5TA 2KENA 2E2JH 4DV4Q 3QOJA 5M3FH 4QIWE 5D65A 1DCZA 4HMJA 4F7XA 3NSWA 1K9MC 1V1PA 2WACA 4C56C 3R2IA 2AMCB 1X6OA 2WIIB 1EWCA 4LFCQ 4MZ9A 4C2MH 1LLRD 1F2LA 3U4ZA 5AFWA 4CJ2C 5FOBB 3A5ZB 1S5BD 1STNA 3CCVA 4LF6Q 4FXDA 1SYGA 1PTOD 5I2YA 4TSSA 4A3KB 3PUYA 3F8TA 4KKTA 3BDCA 4CJ1B 1QB5D 2PYKA 3S2DH 4I7AA 3VYUA 3G6JB 1XJVA 2PW5A 3NBIA 3D4WA 1BR9A 1U4RA 4PQXA 1HNXQ 1HXYD 1ZKOA 4K0KL 1YNND 3EFXD 1VQDA 1T5XD 3S1RH 3G48A 3QO2A 1BNZA 4C1NK 3SK4A 3T53B 3K7AH 4LAAA 1YJWA 1TWHH 2K4KA 3M4QA 1JQYD 5IT9E 2A6HD 2CW0C 4FF1A 1JWMD 5DAUA 3BJUA 1KRTA 1Q81C 4RMFA 1HTLD 4X3TA 2E76C 3STBD 2EJMA 3J7AF 1EIFA 3HKSA 1X9NA 1TS2A 2KVMA 2R7FA 4GLVB 1EIHA 2RQXA 1GUSA 4RHRA 1XPRA 1OXTA 4IJLA 4IUQA 4HTHA 2AWOA 4GZYC 1Q82C 3UI2A 4RCNA 3PMFA 2ZTDA 4KK7A 3TP8A 3HOXH 3RR5A 2DN8A 2JA7H 1BVSA 2WB1B 1IL2A 5C3EB 3OWFA 3HOZH 2N8NA 2UXBL 3I4NB 2O5JC 2IJ0A 1A8VA 3LX0A 1STHA 2ZXRA 1C0AA 2F0OA 2SDFA 3MXGA 4P73A 2R6GA 4DV7L 2F4VL 1KXLA 1K8MA 2MO1A 3S1NH 4LF8L 2WAQB 1VQ9A 4A3LG 1VS0A 1A0IA 4A3EH 1N32Q 4FXKC 3K81C 1GJXA 5CV7A 4C3JH 3A5UA 2EJGC 5KNBA 4H7BA 4LFAL 1VQMA 4FYDA 3PSIA 1NY4A 2KEDA 1AE3A 1L0XB 5HGQA 5JEAH 1QNKA 1F9SA 1SAPA 1J5EL 3Q8DA 1E22A 4MIUA 1KC8C 2GN5A 3P75A 1G2SA 3J80c 1SNPA 2K75A 5IP9G 3PO2B 1X3QA 3Q0AA 1PTOC 1GUWA 1Y1VH 2YU9B 4ID6A 1XMOQ 1FNVA 3NBHA 3BZKA 4LFBL 1A6XA 4IPCA 4C3IH 2D9UA 2Y0SG 1D8LA 4RA8A 2Z4IA 5FJ8H 5ELBA 3V96A 4KHZA 5C5MA 4NXNQ 5FLMH 1QUQA 1YNNC 2JSOA 4WJWA 1I6HH 1TS3A 3TS2A 4KLKA 1SMXA 3J80L 2H5XA 3FPPA 1ENFA 4Q0FA 4A3MG 5GAHC 4DR2L 3PUVA 2CWPA 2ZXPA 3KOJA 1HQRD 2NVTB 3A7LA 3BDOA 4XT1B 1YJ9A 2QCPX 1YITA 1K73C 3S24A 4B3RL 1EOVA 3H94A 2B2WC 1JICA 2WB1E 3AFQA 2HUGA 2XVSA 2BE5D 2NN6I 1KL9A 4I7ZC 4X3KA 4JI8Q 1Q7YC 2NUCA 4OIKA 4R8IA 3ULLA 5JAVA 2QF7A 1GM5A 1JJGA 1VQCA 4IFDH 4O2DA 3HG9A 3DM3A 4UHVA 5M3FG 4K5XA 4HCSA 2EOTA 5AJ3Q 1RD9D 1S72A 3KLSA 1TQOA 2EYPA 3FKIG 2EY1A 2J7ZA 1SYDA 2X69A 3BVZA 4BY7G 1FR3A 4O42A 2C5CA 2JEBI 4KD4A 2F3WA 2RVLA 4A3KH 2BCOA 5BN3A 2K03A 4PZ8A 5IGDA 2FHTA 5C4HA 3I3CA 1VQIA 1RHPA 3ERQA 2CQOA 4QCLA 1Q1EA 1O78A 4A3GB 1KHIA 2AQ1B 2DNCA 3CCJA 4BWGB 1IYJB 3CAMA 1PYSB 1OTCA 1H9SB 3P1HA 3ERSX 2EYOA 1BCPF 1TY0A 5A2QL 1I4QA 2WV6D 5IYCH 2A74C 5HURA 2B2YA 2YTYA 5ELOA 3BDLA 4TKOB 3K57A 3KLWA 3HZXA 4R8NA 1PLFA 2AHOB 1AW7A 3E0EA 4FXGC 1EEFD 3RUZA 3UDIA 2OT2A 2IT1A 2F0QA 3K5MA 1HR0Q 4AYBG 1G8ZD 4ZUJA 4FF2A 1ENCA 1HTPA 3RLNA 2MO0A 3KDFB 4P75A 1MHWC 1PH3A 1UUPA 4AIMA 1YNXA 4DPGA 5C3EH 2N88A 3AYHB 2K05A 3I4NH 3G6EA 4DV6Q 4GOPC 2XRSD 2Q8RE 1V1PB 4GN3B 4GNXC 1A3UA 1EEID 2XIWA 1UAPA 3F2BA 1S4ZA 4G7ZC 2JA7G 2BE5C 1Y8NB 4L5QA 5IOCA 3HOZG 4DR7Q 1E1OA 2AUKA 2KA7A 4DV1Q 4V0BA 4X66L 4GKJL 4A3BB 3AQQA 3AMUA 2VB3X 3SVMA 2BDOA 3CCLA 3HOWB 2IPKD 4KHPL 5C4ZA 4BBRB 2RSOA 4QJFA 4A3EG 5C44B 2BA0A 4C3JG 3TN2A 2B2YC 2F0HA 3CU7A 4EQPA 4MTKA 1FJGL 3PO2H 2KBNA 1G51A 2XRQD 4YIJA 5NUCA 4ABNA 3RZDB 2F1MA 2YU9H 4QL5A 3GTQB 1YZ6A 1D6EC
chains in the Genus database with same CATH topology
5DLQE 4DAYB 1EWIA 5LMNQ 4LNQA 3F1ZA 4JBKA 2IX1A 1HZAA 3AEVA 3STBC 1WI5A 2BA1A 1E24A 5HY6A 4X62Q 4DV3Q 4B3SL 2UUBQ 4DV0L 1P8LA 1I94Q 2WAQG 1UEBA 1GD7A 1Y1VG 1BBUA 1SR3A 3GD7A 2JA8G 1D7QA 4EQ5A 3CCQA 2CCZA 2Y0SE 1L1OA 4ALPA 3I4MH 5GROA 3GTMH 4B3MQ 1NJIC 1PH9A 4QQBX 5FJ8G 2Q2TA 3PF4A 2UUCL 1XNRL 1NMGA 2FXQA 2JK8A 1YVCA 3W1GA 5FLMG 3W5OA 5LMNL 1SFOH 4B3TQ 4LF7Q 1TXYA 1PH1A 3HOVG 4HIDA 2HT1A 3GTJH 2NVTH 4X62L 4DV3L 1NBWA 4DR3Q 2UUBL 4DUZQ 2NVYH 2D0PA 5EAYA 1VQLA 1WFQA 4DR1Q 3UDFA 1HZ9A 1I94L 3E9HA 1IZ6A 4GN5A 4OWTB 5JJKA 3KF6B 1SN8A 2ZM6Q 4P72A 2I5LX 2Z6KA 3U4VA 4GOPA 1S40A 2IHEA 4GNXA 4IOCA 4A3FG 1Q46A 3M4OH 1YIJA 4JOIA 4B3ML 4TVAB 3CF5A 4POFA 2NN6G 1LTLA 1X3FA 3PO3G 2UXCQ 4BA2I 3U50C 5IYDG 1EFWA 3CCEA 2K5NA 1PYBA 4A3IG 4B3TL 4HJ7A 4LF7L 3TS0A 3B6YA 1VQBA 2VQEQ 4R4OA 5GQOA 3OYYA 4DR3L 4DUZL 4GKKQ 4C3HH 1I50H 1OXUA 4DR1L 4JI3L 2UU9Q 4HJ8A 1BKBA 3EIVA 4AH6A 1Z9FA 2ZM6L 1CKOA 1K8AC 1KRSA 3HKZG 4DAMA 4R4CA 4X65L 2RF4A 4JYAQ 4IFDG 4FDBA 4A4IA 1WCMH 1QZHA 3PUZA 2UUAQ 2EIFA 4UP8A 2UXCL 2L15A 4MTNA 2JEAI 2A1AA 1ASYA 3AFPA 4JBJA 1MJCA 3M85A 2VQEL 2E8GA 4GKKL 1XMQL 2R92G 1N9WA 5GAEC 3CXCA 1L1OC 3ULPA 1EQQA 2UU9L 1AE2A 4A3GH 3CMEA 1G291 1N34Q 2MFIA 4R4IA 2VL6A 1WOCA 3NBHB 3UE1A 2LXJA 4DUYQ 1R9TH 5IP9H 4Y52H 2JA6G 1C9OA 2ZJQA 1VQOA 3CMAA 2IHFA 2OCEA 3GO5A 2K52A 4X66Q 1NTGA 3L0OA 2UUAL 1B7YB 1FVIA 1W2BA 4IOAA 3KF8B 1QUQB 3S2HH 1PH7A 3VDYA 2VUMH 2I5HA 3M3YH 1PA6A 3HOYG 2N49A 1C7YA 3ICEA 3M4PA 1CUKA 2NZOA 3MEFA 5C0XJ 5IYCG 1GKHA 3CPWA 4A3CG 1VQJA 1N8RC 5M3MG 4JI5L 1XPOA 1FGUA 1XPUA 4A3DH 2RHQB 3GDEA 4DUYL 3CC4A 1YHQA 1Q12A 4R1JA 1JJ2A 1OXVA 3PUWA 2BH8A 2E5LQ 4A3MH 4LF5Q 3M9BA 2LXKA 1YHBA 1DGSA 3NELA 2HIXA 4AYBE 3L2PA 1CKNB 3S1QH 3CP0A 5IYBH 3LGJA 4JG2A 4YWLA 4YHHL 1VQGA 3J81c 4A75A 2E2IH 1PH6A 2OQKA 1MKHA 1SRUA 2PQAA 4PZ6A 5JEAJ 2I5MX 2VW9A 4APVA 4JV5Q 3GTGH 1HJPA 3CCUA 1K3RA 4PMWA 1YBYA 4JC0A 2A8VA 4UPAA 2WB1G 3CCMA 2MNAA 1Y1WG 2JJQA 2VQFQ 3RNUA 2E5LL 3T1YQ 3I4NG 1VQPA 2R93H 4LF5L 3KDFA 2XTIA 4L5TA 3GTKH 2KENA 3RN2A 4A3BH 3TQYA 2E2JH 2HHHQ 4DV4Q 3JAMi 5M3FH 4QIWE 1NE3A 4DR5Q 3PV0A 1X3GA 4YCUA 3HOWH 5M5XH 1SE8A 5GAGC 1K9MC 1Q8KA 4OX9Q 2AKWB 2ZJPA 4BBRH 2ZJRA 1P16A 4JV5L 2AMCB 1X6OA 4H02A 1TWAH 5C44H 4LFCQ 4MZ9A 1KIXA 2C35B 4C2MH 3EN2A 2GVBA 3I2ZA 1QVFA 2I0QA 3GTLH 1ASZA 4HIKA 2VQFL 3K8AA 3T1YL 3U4ZA 4NXML 4K0KQ 2UXDQ 1KAWA 3RZDH 5IE8A 3A5ZB 3GTQH 2HHHL 2ZTEA 3CCVA 4LF6Q 2ASBA 4DV4L 1HNWQ 1BBWA 1CSPA 4JBWA 4DR5L 2B63G 3H0GH 4GN4B 2IX0A 4JI3Q 5LMUQ 3H3VI 4BBSG 4OX9L 1GVPA 3PO2G 3PUYA 4XIGS 3RLOA 3F8TA 3W1BA 3PGZA 4X65Q 1PH8A 4QGUA 1VQKA 4LFCL 3S2DH 2PI2A 1X3EA 3OW2A 4KI0A 2GVAA 2WAQE 2JA9A 1XJVA 2NVQH 5IWAQ 1HZCA 3TRZA 1HNXQ 4OWXB 4K0KL 2UXDL 1VQDA 4BY1H 3S1RH 3G48A 2Z0SA 4LF6L 1K83H 4IFDI 1HNWL 1H95A 2JA5H 1XMQQ 4UP9A 3K7AH 1XNQQ 1HH2P 5LMUL 1YJWA 2K5HA 1VQ4A 3I4MG 3ZJYC 3HOUH 2DUDA 1TWHH 2K4KA 3M4QA 1SROA 1K0RA 3J7ZC 3S1MH 3PIPA 2OWOA 4PG3A 4DNIA 4A93H 1LYLA 5JJIA 2KCTA 1VQNA 4A3LH 1VQEA 2V1CC 4UP7A 4DK6C 1JT8A 3PCOB 3BJUA 1KRTA 4QY7A 4BA1I 4RMFA 4GLXA 1Q81C 3STBD 5IWAL 4JI7Q 2UXBQ 1EIFA 3HKSA 1X9NA 1YJNA 1KD1C 2HIVA 2R7FA 1HNXL 4GLVB 3RZOH 1LUZA 3TREA 1IBLQ 4BXXH 5C4XG 4DV7Q 3H15A 1XPRA 1OXTA 2F4VQ 4IJLA 1L0WA 2AWOA 4LF8Q 1XNQL 3J81j 1Q82C 1QZGA 1T9HA 2ZTDA 2VY3A 3KF6A 4ME3A 4JI5Q 4OO1G 3HOXH 1WYDA 1IXRA 2KHJA 4IPDA 3RR5A 4OWWB 3E9IA 1EQRA 2EXDA 1BVSA 1MIUA 1IL2A 2JA7H 4P71A 4LFAQ 1HZBA 2N8NA 3K7UC 5M5YH 3HOZH 4JI7L 2RHSB 2UXBL 1A8VA 3HKZE 1X55A 1C0AA 3RLFA 3JC66 1IBLL 2R7ZH 4LW1A 4P73A 2R6GA 4DV7L 1YEZA 2QA4A 1J5EQ 2F4VL 4YHHQ 1VQ6A 1KXLA 3CCRA 2MO1A 3S1NH 4LF8L 1Y14B 3U58A 3G71A 1VQ9A 4UY8C 1YHAA 4A3LG 1V43A 1WCMG 1VCIA 1VS0A 1A0IA 1XTDA 5IP7H 1S3OA 5IY0A 4A3EH 4JI0L 1N32Q 4WJ4A 3K81C 3F2DA 2Q2UA 3A5UA 4C3JH 4DV2Q 4DKAC 3DLLA 2PNHA 4JCVE 2EQSA 1VQMA 1M90C 4LFAL 3PSIA 4LFBQ 3CW2C 2VNUD 1NY4A 1V9PA 4LUZA 1AE3A 2F3IA 2JE6I 4OONA 5HGQA 1VQFA 1GO3E 2CFMA 5E7NA 4A3GG 1J5EL 3Q8DA 1JJCB 1E22A 3HOXG 1KC8C 2GN5A 1CKMA 3A74A 3J80c 1X65A 1B70B 2K75A 5IP9G 1L1OB 4LF4Q 3SGIA 4L5SA 4IO9A 1HNZQ 4JI1Q 1N32L 1Y1VH 2D62A 1TWCH 1XMOQ 3G4SA 4DR2Q 2JA8H 4A76A 5J3BA 4Y7NH 4DV2L 1IBKQ 4POGA 3M7NA 3BZKA 2R7ZG 4LUOA 3IRBA 5C0XG 1K8GA 2VUMG 4NXMQ 4LFBL 4YCWA 5FLXc 4IPCA 4C3IH 4B3RQ 1E3PA 2Y0SG 1D8LA 2MQHA 2QGQA 5FJ8H 1KQSA 1MJEA 4KHZA 3J81i 1VQAA 3JAMc 1PHJA 5FLMH 1QUQA 4NXNQ 4A3DG 3CC2A 2RCNA 2F52A 2YTXA 3PUXA 4GOPB 3HOVH 1I6HH 5ELNA 2E2HH 4GNXB 1CSQA 3TS2A 2OTLA 2YYZA 3FKIH 4KLKA 4OXPA 4LF4L 1SMXA 1HNZL 2H5XA 4JI1L 1XMOL 4BY7H 4A3MG 4HJ9A 5GAHC 4DR2L 3PUVA 4A3JH 2CWPA 4JI6Q 1PFSA 1IBKL 2VZAA 4YWKA 4JI2Q 3J7A5 4O0AA 3KOJA 1SLJA 5JEAG 5IYBG 5BR8Q 4A3FH 1VQ7A 3I55A 2HQLA 1YJ9A 1YITA 1B8AA 4HIOA 1K73C 3S24A 3H3VH 3PO3H 4B3RL 3UE0A 1EOVA 2DGYA 1VQHA 5JJLA 2WB1E 5M5WH 1CKNA 3AFQA 3F2CA 1L2FA 1N33L 3GTOH 4NXNL 4A3IH 4JI4Q 5IYDH 2NN6I 3D0FA 1KL9A 5K36G 1PV4A 4JI8Q 1Q7YC 2YTVA 3CC7A 3GTPH 3ULLA 1OXXK 2R93G 4IJHA 4JI6L 4JI2L 4A3BG 1GM5A 1JJGA 1VQCA 5BR8L 4O2DA 1U0LA 1U5KA 3DM3A 5M3FG 1PH2A 3S15H 1UE1A 2N78A 3HOWG 4IFDJ 5C4JH 4X64Q 5AJ3Q 1S72A 4BBRG 3ER0A 2K50A 1YI2A 3FKIG 1HR0W 2NVXH 4JI4L 2ATWA 1E7ZA 5C44G 1I5FA 1UWVA 2YV5A 1A62A 3L7ZC 3ULJA 4BY7G 1V1QA 1Q86C 4PZ7A 4JI8L 3KJOA 4A3JG 2JEBI 3K0XA 3WWVA 2R92H 1J6QA 1OXSC 3S17H 4YY3Q 4A3KH 4R4QA 1QVGA 3I4OA 1UE6A 4R4TA 4YWMA 4XTCS 4PZ8A 4HJAA 3I7FA 2PMZE 2JA6H 4J15A 3H0GG 1JE5A 5C4XH 4OO1I 2ID0A 3S16H 1VQIA 3FHWA 4X64L 5AJ3L 1IBMQ 2CQOA 2CKZB 1VQ5A 1Q1EA 2ES2A 1KHIA 1I3QH 3CCJA 1IYJB 1Z47A 3CAMA 4IPGA 1EUJA 3OTOQ 4LF9Q 1PYSB 4RG1A 4WJ3M 1OTCA 3NEMA 3HOYH 3ERSX 2ALYB 3CD6A 4A3CH 4YY3L 5IYCH 2K14A 1JMCA 4DR6Q 2K5VA 3KYHC 5M3MH 1N36Q 2YTYA 1PVOA 5ELOA 4MNOA 2BH2A 4BY1G 4DR4Q 1W3SA 2KCMA 4IPHA 1RL2A 3UDXA 5GADC 2NZHA 1PH4A 2PI2E 3KLWA 2JA5G 1NMFA 4GLAC 3KFUA 2KHIA 4DV5Q 4AQYQ 1IBML 3HOUG 4NPSA 2PQAB 3PF5A 1Q1BA 1EYGA 2AHOB 2IY5B 3E0EA 4A93G 4EX5A 1X56A 3OTOL 4LF9L 3CPFA 3UDIA 4A3KG 3A0JA 3S14H 3TEHB 3D31A 2IT1A 1HR0Q 3I56A 4LWCA 4AYBG 2AWNA 4JYAL 3PIOA 4DR6L 2A19A 5LMNW 1N36L 3RLNA 2MO0A 4DR4L 3KDFB 4BXXG 4GKJQ 4P75A 1PH3A 3EBEA 3T1HQ 4AIMA 1VQ8A 1YNXA 1FL0A 1TWGH 4DPGA 5C3EH 1Y1WH 4KHPQ 3AYHB 4DV5L 1O7IA 2Z6KC 4TQUS 4AQYL 3K80C 2LSSA 3G6EA 4DV6Q 4GOPC 3I4NH 4X6AH 4GS3A 2Q2IA 4JBMA 4GN3B 4GNXC 1WJJA 1G6PA 3F2BA 2D0OA 4YCVA 2JQOA 4JOIC 4L5RC 5C0XI 1UE5A 2JA7G 3MXNB 1N34L 1HR0L 4L5QA 1TWFH 3HOZG 1E1OA 2R7DA 4P74A 1JB7A 3RN5A 1FJGQ 4DR7Q 1UE7A 2OTJA 5IT9c 4DV1Q 1AH9A 4DK3C 1RIPA 2B29A 4X66L 5H1SE 1X54A 3KJPA 1PH5A 2CWAA 4GKJL 3AQQA 3BZCA 4JI0Q 3FP9A 3T1HL 3CCLA 2WP8J 4HJ5A 4KHPL 3CCSA 4B3SQ 3UDGA 4DV0Q 4DV6L 3NENA 1N33Q 2Q2HA 1LM0A 3HFZB 4QJFA 5IP7G 4A3EG 3J80i 1M1KC 2BA0A 1A63A 2B63H 4NB3A 2B3GA 2ZTCA 2XGTA 2N3SA 3CQZH 2QEXA 4BBSH 4DR7L 1FJGL 3PO2H 2KBNA 2VS1A 1G51A 4LUVA 4DV1L 1QVCA 2OQ0A 5C3EG 2YU9H 1E1TA 4HIMA 4QL5A 1EIYB 3BU2A 2UUCQ 2WFWA 1YZ6A 1XNRQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLQ E;  4DAY B;  1EWI A;  5LMN Q;  4LNQ A;  3F1Z A;  4JBK A;  2IX1 A;  1HZA A;  3AEV A;  3STB C;  1WI5 A;  2BA1 A;  1E24 A;  5HY6 A;  4X62 Q;  4DV3 Q;  4B3S L;  2UUB Q;  4DV0 L;  1P8L A;  1I94 Q;  2WAQ G;  1UEB A;  1GD7 A;  1Y1V G;  1BBU A;  1SR3 A;  3GD7 A;  2JA8 G;  1D7Q A;  4EQ5 A;  3CCQ A;  2CCZ A;  2Y0S E;  1L1O A;  4ALP A;  3I4M H;  5GRO A;  3GTM H;  4B3M Q;  1NJI C;  1PH9 A;  4QQB X;  5FJ8 G;  2Q2T A;  3PF4 A;  2UUC L;  1XNR L;  1NMG A;  2FXQ A;  2JK8 A;  1YVC A;  3W1G A;  5FLM G;  3W5O A;  5LMN L;  1SFO H;  4B3T Q;  4LF7 Q;  1TXY A;  1PH1 A;  3HOV G;  4HID A;  2HT1 A;  3GTJ H;  2NVT H;  4X62 L;  4DV3 L;  1NBW A;  4DR3 Q;  2UUB L;  4DUZ Q;  2NVY H;  2D0P A;  5EAY A;  1VQL A;  1WFQ A;  4DR1 Q;  3UDF A;  1HZ9 A;  1I94 L;  3E9H A;  1IZ6 A;  4GN5 A;  4OWT B;  5JJK A;  3KF6 B;  1SN8 A;  2ZM6 Q;  4P72 A;  2I5L X;  2Z6K A;  3U4V A;  4GOP A;  1S40 A;  2IHE A;  4GNX A;  4IOC A;  4A3F G;  1Q46 A;  3M4O H;  1YIJ A;  4JOI A;  4B3M L;  4TVA B;  3CF5 A;  4POF A;  2NN6 G;  1LTL A;  1X3F A;  3PO3 G;  2UXC Q;  4BA2 I;  3U50 C;  5IYD G;  1EFW A;  3CCE A;  2K5N A;  1PYB A;  4A3I G;  4B3T L;  4HJ7 A;  4LF7 L;  3TS0 A;  3B6Y A;  1VQB A;  2VQE Q;  4R4O A;  5GQO A;  3OYY A;  4DR3 L;  4DUZ L;  4GKK Q;  4C3H H;  1I50 H;  1OXU A;  4DR1 L;  4JI3 L;  2UU9 Q;  4HJ8 A;  1BKB A;  3EIV A;  4AH6 A;  1Z9F A;  2ZM6 L;  1CKO A;  1K8A C;  1KRS A;  3HKZ G;  4DAM A;  4R4C A;  4X65 L;  2RF4 A;  4JYA Q;  4IFD G;  4FDB A;  4A4I A;  1WCM H;  1QZH A;  3PUZ A;  2UUA Q;  2EIF A;  4UP8 A;  2UXC L;  2L15 A;  4MTN A;  2JEA I;  2A1A A;  1ASY A;  3AFP A;  4JBJ A;  1MJC A;  3M85 A;  2VQE L;  2E8G A;  4GKK L;  1XMQ L;  2R92 G;  1N9W A;  5GAE C;  3CXC A;  1L1O C;  3ULP A;  1EQQ A;  2UU9 L;  1AE2 A;  4A3G H;  3CME A;  1G29 1;  1N34 Q;  2MFI A;  4R4I A;  2VL6 A;  1WOC A;  3NBH B;  3UE1 A;  2LXJ A;  4DUY Q;  1R9T H;  5IP9 H;  4Y52 H;  2JA6 G;  1C9O A;  2ZJQ A;  1VQO A;  3CMA A;  2IHF A;  2OCE A;  3GO5 A;  2K52 A;  4X66 Q;  1NTG A;  3L0O A;  2UUA L;  1B7Y B;  1FVI A;  1W2B A;  4IOA A;  3KF8 B;  1QUQ B;  3S2H H;  1PH7 A;  3VDY A;  2VUM H;  2I5H A;  3M3Y H;  1PA6 A;  3HOY G;  2N49 A;  1C7Y A;  3ICE A;  3M4P A;  1CUK A;  2NZO A;  3MEF A;  5C0X J;  5IYC G;  1GKH A;  3CPW A;  4A3C G;  1VQJ A;  1N8R C;  5M3M G;  4JI5 L;  1XPO A;  1FGU A;  1XPU A;  4A3D H;  2RHQ B;  3GDE A;  4DUY L;  3CC4 A;  1YHQ A;  1Q12 A;  4R1J A;  1JJ2 A;  1OXV A;  3PUW A;  2BH8 A;  2E5L Q;  4A3M H;  4LF5 Q;  3M9B A;  2LXK A;  1YHB A;  1DGS A;  3NEL A;  2HIX A;  4AYB E;  3L2P A;  1CKN B;  3S1Q H;  3CP0 A;  5IYB H;  3LGJ A;  4JG2 A;  4YWL A;  4YHH L;  1VQG A;  3J81 c;  4A75 A;  2E2I H;  1PH6 A;  2OQK A;  1MKH A;  1SRU A;  2PQA A;  4PZ6 A;  5JEA J;  2I5M X;  2VW9 A;  4APV A;  4JV5 Q;  3GTG H;  1HJP A;  3CCU A;  1K3R A;  4PMW A;  1YBY A;  4JC0 A;  2A8V A;  4UPA A;  2WB1 G;  3CCM A;  2MNA A;  1Y1W G;  2JJQ A;  2VQF Q;  3RNU A;  2E5L L;  3T1Y Q;  3I4N G;  1VQP A;  2R93 H;  4LF5 L;  3KDF A;  2XTI A;  4L5T A;  3GTK H;  2KEN A;  3RN2 A;  4A3B H;  3TQY A;  2E2J H;  2HHH Q;  4DV4 Q;  3JAM i;  5M3F H;  4QIW E;  1NE3 A;  4DR5 Q;  3PV0 A;  1X3G A;  4YCU A;  3HOW H;  5M5X H;  1SE8 A;  5GAG C;  1K9M C;  1Q8K A;  4OX9 Q;  2AKW B;  2ZJP A;  4BBR H;  2ZJR A;  1P16 A;  4JV5 L;  2AMC B;  1X6O A;  4H02 A;  1TWA H;  5C44 H;  4LFC Q;  4MZ9 A;  1KIX A;  2C35 B;  4C2M H;  3EN2 A;  2GVB A;  3I2Z A;  1QVF A;  2I0Q A;  3GTL H;  1ASZ A;  4HIK A;  2VQF L;  3K8A A;  3T1Y L;  3U4Z A;  4NXM L;  4K0K Q;  2UXD Q;  1KAW A;  3RZD H;  5IE8 A;  3A5Z B;  3GTQ H;  2HHH L;  2ZTE A;  3CCV A;  4LF6 Q;  2ASB A;  4DV4 L;  1HNW Q;  1BBW A;  1CSP A;  4JBW A;  4DR5 L;  2B63 G;  3H0G H;  4GN4 B;  2IX0 A;  4JI3 Q;  5LMU Q;  3H3V I;  4BBS G;  4OX9 L;  1GVP A;  3PO2 G;  3PUY A;  4XIG S;  3RLO A;  3F8T A;  3W1B A;  3PGZ A;  4X65 Q;  1PH8 A;  4QGU A;  1VQK A;  4LFC L;  3S2D H;  2PI2 A;  1X3E A;  3OW2 A;  4KI0 A;  2GVA A;  2WAQ E;  2JA9 A;  1XJV A;  2NVQ H;  5IWA Q;  1HZC A;  3TRZ A;  1HNX Q;  4OWX B;  4K0K L;  2UXD L;  1VQD A;  4BY1 H;  3S1R H;  3G48 A;  2Z0S A;  4LF6 L;  1K83 H;  4IFD I;  1HNW L;  1H95 A;  2JA5 H;  1XMQ Q;  4UP9 A;  3K7A H;  1XNQ Q;  1HH2 P;  5LMU L;  1YJW A;  2K5H A;  1VQ4 A;  3I4M G;  3ZJY C;  3HOU H;  2DUD A;  1TWH H;  2K4K A;  3M4Q A;  1SRO A;  1K0R A;  3J7Z C;  3S1M H;  3PIP A;  2OWO A;  4PG3 A;  4DNI A;  4A93 H;  1LYL A;  5JJI A;  2KCT A;  1VQN A;  4A3L H;  1VQE A;  2V1C C;  4UP7 A;  4DK6 C;  1JT8 A;  3PCO B;  3BJU A;  1KRT A;  4QY7 A;  4BA1 I;  4RMF A;  4GLX A;  1Q81 C;  3STB D;  5IWA L;  4JI7 Q;  2UXB Q;  1EIF A;  3HKS A;  1X9N A;  1YJN A;  1KD1 C;  2HIV A;  2R7F A;  1HNX L;  4GLV B;  3RZO H;  1LUZ A;  3TRE A;  1IBL Q;  4BXX H;  5C4X G;  4DV7 Q;  3H15 A;  1XPR A;  1OXT A;  2F4V Q;  4IJL A;  1L0W A;  2AWO A;  4LF8 Q;  1XNQ L;  3J81 j;  1Q82 C;  1QZG A;  1T9H A;  2ZTD A;  2VY3 A;  3KF6 A;  4ME3 A;  4JI5 Q;  4OO1 G;  3HOX H;  1WYD A;  1IXR A;  2KHJ A;  4IPD A;  3RR5 A;  4OWW B;  3E9I A;  1EQR A;  2EXD A;  1BVS A;  1MIU A;  1IL2 A;  2JA7 H;  4P71 A;  4LFA Q;  1HZB A;  2N8N A;  3K7U C;  5M5Y H;  3HOZ H;  4JI7 L;  2RHS B;  2UXB L;  1A8V A;  3HKZ E;  1X55 A;  1C0A A;  3RLF A;  3JC6 6;  1IBL L;  2R7Z H;  4LW1 A;  4P73 A;  2R6G A;  4DV7 L;  1YEZ A;  2QA4 A;  1J5E Q;  2F4V L;  4YHH Q;  1VQ6 A;  1KXL A;  3CCR A;  2MO1 A;  3S1N H;  4LF8 L;  1Y14 B;  3U58 A;  3G71 A;  1VQ9 A;  4UY8 C;  1YHA A;  4A3L G;  1V43 A;  1WCM G;  1VCI A;  1VS0 A;  1A0I A;  1XTD A;  5IP7 H;  1S3O A;  5IY0 A;  4A3E H;  4JI0 L;  1N32 Q;  4WJ4 A;  3K81 C;  3F2D A;  2Q2U A;  3A5U A;  4C3J H;  4DV2 Q;  4DKA C;  3DLL A;  2PNH A;  4JCV E;  2EQS A;  1VQM A;  1M90 C;  4LFA L;  3PSI A;  4LFB Q;  3CW2 C;  2VNU D;  1NY4 A;  1V9P A;  4LUZ A;  1AE3 A;  2F3I A;  2JE6 I;  4OON A;  5HGQ A;  1VQF A;  1GO3 E;  2CFM A;  5E7N A;  4A3G G;  1J5E L;  3Q8D A;  1JJC B;  1E22 A;  3HOX G;  1KC8 C;  2GN5 A;  1CKM A;  3A74 A;  3J80 c;  1X65 A;  1B70 B;  2K75 A;  5IP9 G;  1L1O B;  4LF4 Q;  3SGI A;  4L5S A;  4IO9 A;  1HNZ Q;  4JI1 Q;  1N32 L;  1Y1V H;  2D62 A;  1TWC H;  1XMO Q;  3G4S A;  4DR2 Q;  2JA8 H;  4A76 A;  5J3B A;  4Y7N H;  4DV2 L;  1IBK Q;  4POG A;  3M7N A;  3BZK A;  2R7Z G;  4LUO A;  3IRB A;  5C0X G;  1K8G A;  2VUM G;  4NXM Q;  4LFB L;  4YCW A;  5FLX c;  4IPC A;  4C3I H;  4B3R Q;  1E3P A;  2Y0S G;  1D8L A;  2MQH A;  2QGQ A;  5FJ8 H;  1KQS A;  1MJE A;  4KHZ A;  3J81 i;  1VQA A;  3JAM c;  1PHJ A;  5FLM H;  1QUQ A;  4NXN Q;  4A3D G;  3CC2 A;  2RCN A;  2F52 A;  2YTX A;  3PUX A;  4GOP B;  3HOV H;  1I6H H;  5ELN A;  2E2H H;  4GNX B;  1CSQ A;  3TS2 A;  2OTL A;  2YYZ A;  3FKI H;  4KLK A;  4OXP A;  4LF4 L;  1SMX A;  1HNZ L;  2H5X A;  4JI1 L;  1XMO L;  4BY7 H;  4A3M G;  4HJ9 A;  5GAH C;  4DR2 L;  3PUV A;  4A3J H;  2CWP A;  4JI6 Q;  1PFS A;  1IBK L;  2VZA A;  4YWK A;  4JI2 Q;  3J7A 5;  4O0A A;  3KOJ A;  1SLJ A;  5JEA G;  5IYB G;  5BR8 Q;  4A3F H;  1VQ7 A;  3I55 A;  2HQL A;  1YJ9 A;  1YIT A;  1B8A A;  4HIO A;  1K73 C;  3S24 A;  3H3V H;  3PO3 H;  4B3R L;  3UE0 A;  1EOV A;  2DGY A;  1VQH A;  5JJL A;  2WB1 E;  5M5W H;  1CKN A;  3AFQ A;  3F2C A;  1L2F A;  1N33 L;  3GTO H;  4NXN L;  4A3I H;  4JI4 Q;  5IYD H;  2NN6 I;  3D0F A;  1KL9 A;  5K36 G;  1PV4 A;  4JI8 Q;  1Q7Y C;  2YTV A;  3CC7 A;  3GTP H;  3ULL A;  1OXX K;  2R93 G;  4IJH A;  4JI6 L;  4JI2 L;  4A3B G;  1GM5 A;  1JJG A;  1VQC A;  5BR8 L;  4O2D A;  1U0L A;  1U5K A;  3DM3 A;  5M3F G;  1PH2 A;  3S15 H;  1UE1 A;  2N78 A;  3HOW G;  4IFD J;  5C4J H;  4X64 Q;  5AJ3 Q;  1S72 A;  4BBR G;  3ER0 A;  2K50 A;  1YI2 A;  3FKI G;  1HR0 W;  2NVX H;  4JI4 L;  2ATW A;  1E7Z A;  5C44 G;  1I5F A;  1UWV A;  2YV5 A;  1A62 A;  3L7Z C;  3ULJ A;  4BY7 G;  1V1Q A;  1Q86 C;  4PZ7 A;  4JI8 L;  3KJO A;  4A3J G;  2JEB I;  3K0X A;  3WWV A;  2R92 H;  1J6Q A;  1OXS C;  3S17 H;  4YY3 Q;  4A3K H;  4R4Q A;  1QVG A;  3I4O A;  1UE6 A;  4R4T A;  4YWM A;  4XTC S;  4PZ8 A;  4HJA A;  3I7F A;  2PMZ E;  2JA6 H;  4J15 A;  3H0G G;  1JE5 A;  5C4X H;  4OO1 I;  2ID0 A;  3S16 H;  1VQI A;  3FHW A;  4X64 L;  5AJ3 L;  1IBM Q;  2CQO A;  2CKZ B;  1VQ5 A;  1Q1E A;  2ES2 A;  1KHI A;  1I3Q H;  3CCJ A;  1IYJ B;  1Z47 A;  3CAM A;  4IPG A;  1EUJ A;  3OTO Q;  4LF9 Q;  1PYS B;  4RG1 A;  4WJ3 M;  1OTC A;  3NEM A;  3HOY H;  3ERS X;  2ALY B;  3CD6 A;  4A3C H;  4YY3 L;  5IYC H;  2K14 A;  1JMC A;  4DR6 Q;  2K5V A;  3KYH C;  5M3M H;  1N36 Q;  2YTY A;  1PVO A;  5ELO A;  4MNO A;  2BH2 A;  4BY1 G;  4DR4 Q;  1W3S A;  2KCM A;  4IPH A;  1RL2 A;  3UDX A;  5GAD C;  2NZH A;  1PH4 A;  2PI2 E;  3KLW A;  2JA5 G;  1NMF A;  4GLA C;  3KFU A;  2KHI A;  4DV5 Q;  4AQY Q;  1IBM L;  3HOU G;  4NPS A;  2PQA B;  3PF5 A;  1Q1B A;  1EYG A;  2AHO B;  2IY5 B;  3E0E A;  4A93 G;  4EX5 A;  1X56 A;  3OTO L;  4LF9 L;  3CPF A;  3UDI A;  4A3K G;  3A0J A;  3S14 H;  3TEH B;  3D31 A;  2IT1 A;  1HR0 Q;  3I56 A;  4LWC A;  4AYB G;  2AWN A;  4JYA L;  3PIO A;  4DR6 L;  2A19 A;  5LMN W;  1N36 L;  3RLN A;  2MO0 A;  4DR4 L;  3KDF B;  4BXX G;  4GKJ Q;  4P75 A;  1PH3 A;  3EBE A;  3T1H Q;  4AIM A;  1VQ8 A;  1YNX A;  1FL0 A;  1TWG H;  4DPG A;  5C3E H;  1Y1W H;  4KHP Q;  3AYH B;  4DV5 L;  1O7I A;  2Z6K C;  4TQU S;  4AQY L;  3K80 C;  2LSS A;  3G6E A;  4DV6 Q;  4GOP C;  3I4N H;  4X6A H;  4GS3 A;  2Q2I A;  4JBM A;  4GN3 B;  4GNX C;  1WJJ A;  1G6P A;  3F2B A;  2D0O A;  4YCV A;  2JQO A;  4JOI C;  4L5R C;  5C0X I;  1UE5 A;  2JA7 G;  3MXN B;  1N34 L;  1HR0 L;  4L5Q A;  1TWF H;  3HOZ G;  1E1O A;  2R7D A;  4P74 A;  1JB7 A;  3RN5 A;  1FJG Q;  4DR7 Q;  1UE7 A;  2OTJ A;  5IT9 c;  4DV1 Q;  1AH9 A;  4DK3 C;  1RIP A;  2B29 A;  4X66 L;  5H1S E;  1X54 A;  3KJP A;  1PH5 A;  2CWA A;  4GKJ L;  3AQQ A;  3BZC A;  4JI0 Q;  3FP9 A;  3T1H L;  3CCL A;  2WP8 J;  4HJ5 A;  4KHP L;  3CCS A;  4B3S Q;  3UDG A;  4DV0 Q;  4DV6 L;  3NEN A;  1N33 Q;  2Q2H A;  1LM0 A;  3HFZ B;  4QJF A;  5IP7 G;  4A3E G;  3J80 i;  1M1K C;  2BA0 A;  1A63 A;  2B63 H;  4NB3 A;  2B3G A;  2ZTC A;  2XGT A;  2N3S A;  3CQZ H;  2QEX A;  4BBS H;  4DR7 L;  1FJG L;  3PO2 H;  2KBN A;  2VS1 A;  1G51 A;  4LUV A;  4DV1 L;  1QVC A;  2OQ0 A;  5C3E G;  2YU9 H;  1E1T A;  4HIM A;  4QL5 A;  1EIY B;  3BU2 A;  2UUC Q;  2WFW A;  1YZ6 A;  1XNR Q; 
#chains in the Genus database with same CATH topology
 5DLQ E;  3H0G B;  2NZ1 D;  3F1Z A;  2BA1 A;  5HY6 A;  4CKE A;  2K28 A;  3X3N A;  4DV0 L;  1D2B A;  5D3D A;  3MAQ A;  1SYB A;  1UEB A;  1Y1V G;  1SR3 A;  5F2D A;  5D14 A;  1D5Z C;  2CCZ A;  1K0S A;  3Q22 A;  2NVQ B;  5GRO A;  4CDD C;  4OL7 A;  4C3I G;  1B50 A;  4QQB X;  5E4W C;  5FJ8 G;  2Q2T A;  4BY1 B;  1K83 B;  5EGT A;  1XNR L;  1FNU A;  4B3T Q;  5FLM G;  3TSS A;  4HID A;  2NVT H;  4H13 C;  4DV3 L;  1PDQ A;  4DR3 Q;  2UUB L;  2NVY H;  1HZ9 A;  1I94 L;  3E9H A;  4A93 B;  1SN8 A;  3OMC A;  2ZM6 Q;  2RSN A;  1ESR A;  1S40 A;  2DY8 A;  1Q46 A;  1YIJ A;  3K58 A;  4WRD A;  4OO1 H;  4EGV A;  4POF A;  1X3F A;  4RKL A;  1VDZ A;  1PYB A;  4HJ7 A;  5KRU A;  3J80 E;  5IGC A;  4BS9 A;  3OIQ A;  4DR1 L;  1SE2 A;  4JI3 L;  5FO9 B;  1K8A C;  1H9K A;  1BF4 A;  1BXT A;  4R4C A;  4DK1 A;  4IFD G;  5M5Y B;  1F9P A;  4A4I A;  4KJO A;  2UUA Q;  2EIF A;  2JXM B;  3DWA A;  3CRK C;  4JBJ A;  1DXM A;  4OEM B;  4N8F A;  2NYZ D;  3IAY A;  3WOE A;  4GKK L;  1XMQ L;  4A3G H;  3U9O A;  3CME A;  2MFI A;  1BCP D;  3NBH B;  1RTO A;  4IUP A;  4DUY Q;  4Y52 H;  2WKC A;  2B8G A;  3GO5 A;  4X66 Q;  3HRZ C;  1R4P B;  1F9R A;  1B7Y B;  1PZI D;  1NR2 A;  2B2V A;  4IOA A;  3WDN A;  1QUQ B;  3MC0 B;  5C0X H;  2K04 A;  3VDY A;  1ICW A;  3M4P A;  2EPB A;  1YNJ D;  5IYC G;  1N8R C;  4K5V A;  1CT1 D;  2RHQ B;  1U4P A;  3CC4 A;  2WIN B;  2EDG A;  3T4A C;  1OXV A;  2F0I A;  2NBF A;  3M9B A;  3NEL A;  1B53 A;  1DGS A;  2HIX A;  1PRT B;  3C1F A;  5IYB H;  2JP1 A;  3LGJ A;  5A2Q E;  3J81 c;  1AN8 A;  1VQG A;  4CDC C;  4ZK9 B;  3FKI B;  1CA5 A;  5HGT A;  2OQK A;  2VW9 A;  1EU3 A;  4JW0 A;  4BY7 B;  1LTT D;  1HJP A;  3CCU A;  2KEE A;  3DHQ A;  3NWS A;  4PMW A;  1LT4 D;  2WB1 G;  3DMU A;  2VQF Q;  3I4N G;  5M5W B;  2XTI A;  3GTO B;  2QEJ C;  4A3B H;  3TQY A;  2HHH Q;  3JAM i;  1SJE D;  4DR5 Q;  3HOW H;  1X3G A;  2BOS A;  2SNM A;  5GAG C;  4OX9 Q;  4MHE A;  3J81 L;  4BBR H;  2ZJR A;  2EYF A;  4JV5 L;  2L11 A;  3HKZ B;  5C44 H;  1KIX A;  2C35 B;  2B2V C;  3EVQ A;  3I2Z A;  5A35 A;  1JE4 A;  5C4J B;  3K8A A;  3T1Y L;  3RZD H;  3GP7 A;  2NVX B;  5IE8 A;  3GTQ H;  2ZTE A;  1S5F D;  1HNW Q;  2NTS A;  4DV4 L;  1MBY A;  4JBW A;  3H0G H;  3SK6 A;  4GN4 B;  4JI3 Q;  5LMU Q;  3H3V I;  3MXU A;  3PO2 G;  4XIG S;  3TBI B;  3V2T A;  3PGZ A;  1VQK A;  4LFC L;  2JA6 B;  5BN4 A;  1X3E A;  1KLG D;  2JA9 A;  2AUJ D;  2NVQ H;  5IWA Q;  3S16 B;  4BY1 H;  3O13 A;  4LF6 L;  1CK1 A;  1K83 H;  1H95 A;  1XMQ Q;  2A73 B;  1HH2 P;  2Q8T A;  1KDB A;  4DXG A;  1K0R A;  1KLU D;  3J7Z C;  2OWO A;  4A93 H;  4DNI A;  1LYL A;  1M4V A;  3N52 A;  5JJI A;  1YNJ C;  1VQN A;  4A3L H;  2V1C C;  1JT8 A;  3PCO B;  1E0B A;  1KD1 C;  1YJN A;  1HNX L;  2F0N A;  1EQT A;  1IBL Q;  2IX3 A;  4BXX H;  2NTT A;  1EY9 A;  3J81 j;  1CA6 A;  4OO1 G;  1WYD A;  1AEX A;  2KHJ A;  1SE4 A;  1ICF B;  3E9I A;  2EYJ A;  1ILP A;  1JCK B;  1Y1W B;  3K7U C;  5M5Y H;  2RHS B;  1LTS D;  3HKZ E;  1X55 A;  1FD7 D;  4LW1 A;  2QA4 A;  1JB3 A;  1IHZ A;  1SYF A;  3NPP A;  1Y14 B;  4UY8 C;  1V43 A;  1QJO A;  1XTD A;  2PQE A;  1CI3 M;  4U68 A;  1Y69 U;  2Q2U A;  3H3V C;  3DLL A;  1ZYR D;  2K32 A;  2A69 D;  5ELC A;  1EYD A;  1PYW D;  4OON A;  1VQF A;  2CFM A;  4A3G G;  2B63 B;  3CQZ B;  1CKM A;  1EU4 A;  5EPL A;  4LF4 Q;  1EZ8 A;  4IO9 A;  4L5S A;  4JI1 Q;  1N32 L;  1D1K A;  3Q23 A;  1PRT F;  1K28 A;  3VA7 A;  4POG A;  1IBK Q;  3IRB A;  5C0X G;  1H9R A;  1K8G A;  4YCW A;  1E3P A;  3PQI A;  5E3F A;  3X3M A;  1B9M A;  3FDT A;  1XYI A;  1RF2 D;  4LMQ D;  1VQA A;  3JAM c;  3KF8 A;  3Q24 A;  3VR6 A;  2RCN A;  1OO9 B;  2YTX A;  3OPO A;  1CSQ A;  3FKI H;  2ZT9 C;  3NTH A;  3I70 A;  3NXW A;  2RDG A;  1XMO L;  2X6L A;  4BY7 H;  4HJ9 A;  1PFS A;  3QR8 A;  1VQ7 A;  1SLJ A;  5IYB G;  1DOM A;  2L5T A;  1I4H A;  2H4O A;  4J6H A;  4HIO A;  2NN6 H;  3PO3 H;  3UE0 A;  1VQH A;  5M5W H;  5IYD H;  3GTO H;  4NXN L;  2PZU A;  3D0F A;  1W6J A;  2Z1C A;  5K36 G;  4KY7 A;  3JAM L;  3M4O B;  5DNF A;  2YTV A;  4JVZ A;  3CC7 A;  1RKN A;  2PZW A;  4IJH A;  3R3O A;  4A3B G;  2HDM A;  3T16 A;  3HOW G;  4IFD J;  5C4J H;  4X64 Q;  5CGK A;  4BBR G;  4M8A A;  2FFK B;  1YI2 A;  2F0V A;  1HR0 W;  2NVX H;  4FO2 A;  1EY5 A;  5C44 G;  1UWV A;  3ULJ A;  1V1Q A;  4PZ7 A;  4JI8 L;  3KJO A;  1WCM B;  4A3J G;  3K0X A;  3ITP A;  1OXS C;  4YY3 Q;  3I4O A;  1UE6 A;  3BG3 A;  4QUF A;  1TVX A;  3IFD A;  1C4Q A;  2JA6 H;  5I2X A;  3H0G G;  5KND A;  1JE5 A;  1MSH A;  4K14 A;  3J81 E;  1A3V A;  3S16 H;  5AJ3 L;  1IBM Q;  1GXD C;  2KHS A;  1QWY A;  2Z4H A;  4RG1 A;  4H0L C;  4WJ3 M;  3NEM A;  1LT6 D;  1TKW B;  1U9R A;  1SBB B;  5FK9 C;  3VYS A;  1ENA A;  4A3C H;  1JMC A;  4DR6 Q;  3NHH A;  2K5V A;  3KYH C;  3P7J A;  1N36 Q;  1WVL A;  4MNO A;  3R93 A;  1STB A;  4BY1 G;  4ZKC B;  4DR4 Q;  1SNC A;  2KCM A;  5GAD C;  2PI2 E;  4GLA C;  5IGB A;  3ZYY X;  2KHI A;  3FVQ A;  4AQY Q;  1EYG A;  4A3D B;  1GOZ A;  4A93 G;  3CPF A;  3C2P A;  4XYQ A;  2B2W A;  1LT3 D;  3I56 A;  4LWC A;  1F2Z A;  1KTK A;  2LKV A;  4J1M A;  3TZU A;  2F0K A;  3DWP A;  2EE1 A;  2A6E D;  3GV6 A;  1DOK A;  1EQV A;  4BXX G;  3EBE A;  2K5D A;  3T1H Q;  4CBV A;  1VQ8 A;  2MUY A;  1Y1W H;  4K5W A;  1O7I A;  4TQU S;  1A2T A;  4X6A H;  3K80 C;  3U9S A;  1S5D D;  3DWQ A;  4GS3 A;  2DNE A;  4CDE C;  1RTN A;  1G6P A;  1EYA A;  2JQO A;  3E3X A;  4JOI C;  5G3L F;  1G91 A;  1N34 L;  1HR0 L;  3NP8 A;  2R93 B;  4KD3 A;  1AH9 A;  3LWE A;  4DK3 C;  4KN4 C;  3GTK B;  1PH5 A;  1X54 A;  2R61 A;  1LTB D;  4JI0 Q;  5EKK A;  3CRL C;  1GUG A;  3TME A;  1DON A;  4B3S Q;  3UDG A;  4DV6 L;  3NEN A;  2Q2H A;  1LM0 A;  3HFZ B;  5KEE A;  1EOT A;  1ESF A;  2LFN A;  1M1K C;  3NUC A;  2B63 H;  2B3G A;  1GHK A;  3GTL B;  3CQZ H;  4M1U B;  2N3S A;  3TP6 A;  4DR7 L;  1KNA A;  2VS1 A;  4DV1 L;  1QVC A;  2OQ0 A;  5T1I A;  4QUC A;  4HIM A;  2A6H C;  1J9O A;  1RJT A;  1Z6H A;  2NVY B;  2D2C C;  3K6O A;  2IX1 A;  3STB C;  4X62 Q;  3VA5 A;  1P8L A;  1SYC A;  1GD7 A;  1I4R A;  1BBU A;  2B2U A;  2K7V A;  1LT5 D;  3H09 A;  2Q8I B;  1A2U A;  1L1O A;  3GTM H;  1PH9 A;  3PF4 A;  1NMG A;  2FXQ A;  4RGO S;  4N8X 1;  4B08 A;  1SFO H;  1TXY A;  1HRJ A;  2HT1 A;  1NBW A;  4G4K A;  3HOU B;  5EAY A;  2D0P A;  3S1M B;  3UDF A;  1UEA B;  4F87 A;  4P72 A;  4FF4 A;  4GOP A;  1I4P A;  2IHE A;  4FNF A;  2NWG A;  4GNX A;  3HP3 A;  4IUN A;  3M4O H;  2A68 D;  2NN6 G;  3PO3 G;  4BA2 I;  1GUT A;  5IYD G;  3CCE A;  4B3T L;  1II3 A;  3B6Y A;  1HCZ A;  2F0P A;  5GQO A;  4DR3 L;  2L55 A;  1OXU A;  3BS1 A;  3SK5 A;  3GV3 A;  4HJ8 A;  4AH6 A;  2ZM6 L;  1HFG A;  4CGY B;  1KRS A;  2QW7 A;  3HKZ G;  2ENB A;  1VMC A;  3TDQ A;  4DGZ A;  4FDB A;  1WCM H;  5LL6 S;  3PUZ A;  4ZYS A;  1VF5 C;  4J8Q A;  3OOC A;  2B2U C;  1EY0 A;  3M85 A;  2E8G A;  2MP1 A;  1N9W A;  4CJ0 B;  5GAE C;  1L1O C;  3MFY A;  3ULP A;  2DJG C;  1STA A;  2F0J A;  1G29 1;  3NK9 A;  3QB3 A;  1N34 Q;  3DEO A;  3OW7 A;  2JA6 G;  1C9O A;  1HA5 A;  1F77 A;  2ZJQ A;  1SJH D;  5KYL A;  2UUA L;  3D4D A;  1FNW A;  2K52 A;  1NTG A;  2G5D A;  5CV8 A;  3AB9 A;  1CQV A;  1FVI A;  1EY8 A;  1MD2 D;  3KF8 B;  1PMR A;  2L1B A;  3D3R A;  2I5H A;  2N49 A;  3ICE A;  3NE5 B;  5C0X J;  3VYT A;  4A3C G;  2JA8 B;  1T5E A;  1XPO A;  1FGU A;  4Y7N B;  4A3D H;  2B2T C;  4DUY L;  1TR5 A;  4R1J A;  3QJY A;  1JJ2 A;  3PUW A;  2E5L Q;  4Z9C B;  4QMG A;  1YHB A;  3L2P A;  3HOV B;  2E2H B;  4YHH L;  2PQA A;  3R8B A;  4APV A;  4A3J B;  4RH6 A;  1AFP A;  5JVH 3;  3I72 A;  3C3L A;  2AQ3 B;  1Y1W G;  2FMC A;  2JJQ A;  2L0C A;  1VMP A;  2R93 H;  4A3I B;  3GTK H;  3E0J A;  1NSN S;  1NE3 A;  4RFB A;  2O5I C;  4YCU A;  3NQI A;  2Z9H A;  2AKW B;  1P16 A;  1ET9 A;  1QE6 A;  2SOB A;  1S5C D;  1PTO B;  3MXN A;  5C3W A;  3EN2 A;  2GVB A;  2V4D A;  4RGN A;  3PIP 3;  2I0Q A;  3GTL H;  4HIK A;  2VQF L;  2HCI A;  4G57 A;  4NXM L;  2UXD Q;  2F0G A;  2HHH L;  4DR5 L;  2B63 G;  1TII D;  2R92 B;  4EQO A;  3S17 B;  4OX9 L;  1CM9 A;  1QG7 A;  4TRD A;  3RLO A;  2CHB D;  4ZAI A;  4QGU A;  4ME5 A;  2PI2 A;  3OW2 A;  2GVA A;  4NDX A;  1ONL A;  5EQ0 A;  3A8J E;  5IOD A;  1Y8O B;  3TRZ A;  2M2L A;  2Z0S A;  1HNW L;  1C8C A;  4IFD I;  4IUU A;  1XWE A;  5EPJ A;  4B9X A;  3HOY B;  1XNQ Q;  5LMU L;  5J1Z A;  2K5H A;  3HOU H;  2DUD A;  5TSS A;  1SRO A;  5M3M B;  3S1M H;  1VQE A;  4UP7 A;  4DK6 C;  2F0S A;  3T13 A;  4QY7 A;  4BA1 I;  5IWA L;  4JI7 Q;  2F3V A;  2HIV A;  4IN3 A;  1LUZ A;  1B1Z A;  1LAB A;  4XQQ A;  5EJW A;  1QZG A;  2VY3 A;  4IUR A;  4ME3 A;  2H1E A;  1XX8 A;  1Y8P B;  1HQM C;  1EQR A;  3OIP A;  2EXD A;  1MIU A;  1TWG B;  2MJ8 A;  4P71 A;  1I4X A;  1HZB A;  2B39 A;  1RCV D;  2XWJ B;  3JC6 6;  1IBL L;  1IYV A;  4YHH Q;  3CCR A;  1Z7T A;  3U58 A;  1JOK A;  1WCM G;  1VCI A;  1JOQ A;  5IP7 H;  4ILW A;  3MZ5 A;  4DV2 Q;  4DKA C;  1D5M C;  1SEB D;  3OMG A;  3CW2 C;  2VNU D;  2QDL A;  4LUZ A;  2F3I A;  2JE6 I;  3K59 A;  3SHL A;  1GO3 E;  5E7N A;  4RHS A;  1NCV A;  3S9W A;  3N6R A;  3A74 A;  3WOF A;  1B3A A;  1B70 B;  4RWS C;  4BBS B;  1O7Y A;  3MEH A;  1L1O B;  2PMZ B;  1HNZ Q;  2D62 A;  5K36 H;  3OHX C;  4RGM A;  1DJR D;  3G4S A;  2JA8 H;  1CHQ D;  5J3B A;  4Y7N H;  1EY7 A;  3M7N A;  3PO3 B;  4XQJ A;  2R7Z G;  2EVB A;  1D5X C;  4NXM Q;  2G9H D;  2QGQ A;  1KQS A;  1PHJ A;  4A3D G;  2F52 A;  4GOP B;  3PUX A;  3HOV H;  5ELN A;  2E2H H;  3K0Y A;  4GNX B;  4HCE A;  2OTL A;  2KUM A;  4LF4 L;  4JI1 L;  4K2K A;  3SXH A;  4A3J H;  4JI6 Q;  4DNT B;  1IBK L;  2VZA A;  3KLR A;  4YWK A;  3I90 A;  4JI2 Q;  4JK1 C;  3J7A 5;  5BR8 Q;  3GTJ B;  3C46 A;  3I55 A;  2HQL A;  1BOS A;  3E6Z X;  4OGQ C;  1B8A A;  2DGY A;  5JJL A;  1Q90 A;  4XQN A;  1VF7 A;  1CKN A;  2C9O A;  3F2C A;  1L2F A;  1PTO F;  4A3I H;  4JI4 Q;  1QOH A;  4F8M A;  3A8K E;  2TMP A;  2F4I A;  4MN3 A;  2R93 G;  1BCP C;  1K8O A;  2KQ3 A;  4KN7 C;  1PTO H;  3S15 H;  1UE1 A;  2N78 A;  1KAB A;  4C3H B;  1LTG D;  3DUZ A;  3F2U A;  1WTH A;  2K50 A;  3ER0 A;  4C1N I;  2ATW A;  1CQF A;  1TT2 A;  3L7Z C;  1Q86 C;  4DN4 M;  5FKA C;  2QIL A;  2R92 H;  1IYU A;  4CKC A;  1J6Q A;  3S17 H;  5CV4 A;  1TY2 A;  3CHB D;  3EJI A;  5JJZ A;  4HJA A;  4K2L A;  5COR A;  2PMZ E;  5DEH A;  3PIO 3;  4KJN A;  4OO1 I;  2ID0 A;  4CHT B;  3FHW A;  4X64 L;  5K5P A;  3BVM A;  2HD3 A;  1Z47 A;  1F9Q A;  4IPG A;  3OTO Q;  4LF9 Q;  1R9T B;  4FF3 A;  4CDF C;  3HOY H;  1TU2 B;  2EY2 A;  4YY3 L;  2K14 A;  4DK0 A;  4OHJ A;  2J0T D;  3URY A;  5EKI A;  5M3M H;  2SEB D;  2BH2 A;  1FGB D;  2F0W A;  4IPH A;  3D4R A;  2VUM B;  4HAE A;  2QKI C;  1NMF A;  5C5L A;  2EY6 A;  1DD2 A;  4DV5 Q;  1IBM L;  3HOU G;  4NPS A;  1SNO A;  2PQA B;  1Q1B A;  3KBG A;  5IGE A;  4EX5 A;  1X56 A;  1J8I A;  3A0J A;  3TEH B;  1XXG A;  2N55 A;  4KTA A;  4K8J A;  4RAU C;  2AWN A;  2EYM A;  3A56 A;  3VR2 A;  2A19 A;  4DR6 L;  5CBA E;  1N36 L;  5E4X A;  4DR4 L;  1AP0 A;  2DJF C;  3DEP A;  1B4O A;  2KOL A;  2LMC B;  2Z8L A;  4RGT A;  1L0Y B;  1A3T A;  1FL0 A;  1TWG H;  4G7H C;  3E5S A;  1CFM A;  2IW3 A;  2Z6K C;  4AQY L;  2LSS A;  1IL8 A;  4JBM A;  1U4L A;  2KJX A;  2Q2I A;  4KMU C;  3GTG B;  4QF4 A;  2CW0 D;  4L5R C;  4IZ8 A;  5I4D A;  5C0X I;  5ELE A;  2Z6B A;  2PO4 A;  3MXN B;  2P5Z X;  2K01 A;  2R7D A;  1JB7 A;  3EA6 A;  4K6L A;  1STE A;  1NUC A;  2NB0 A;  2CWA A;  1I4G A;  2F0T A;  3T1H L;  1WTP A;  2WP8 J;  2MGS A;  4HJ5 A;  5M5X B;  1LTI D;  3CCS A;  2OF1 A;  5COY A;  1EY4 A;  5J39 A;  1AZQ A;  5IP7 G;  2JYO A;  3J80 i;  5M9O A;  1TWA B;  3MWY W;  2IL8 A;  3GTM B;  1RDP D;  5C6A A;  2ZTC A;  4BBS H;  4IUT A;  1SFO B;  1STY A;  3AU7 A;  3HS0 C;  1E1T A;  1EIY B;  1NNX A;  2UUC Q;  4JI0 L;  2E2D C;  5T1G A;  5FO8 B;  1EWI A;  5I6W A;  5LMN Q;  4JBK A;  3AEV A;  1HZA A;  1WI5 A;  4PV1 C;  2K1B A;  3ND9 A;  5KIX A;  4B3S L;  5EBC A;  1IW7 D;  1BO0 A;  4HSP A;  4ZLT F;  4ZUI A;  3GD7 A;  2JA8 G;  4EQ5 A;  3CCQ A;  1EL0 A;  4DAV A;  2ICE C;  4DA2 A;  3I4M H;  4B3M Q;  1NJI C;  4UAI A;  2XNA C;  1WTO A;  2JA5 B;  1TS5 A;  3W1G A;  1YVC A;  5EBD A;  4LF7 Q;  1EZ6 A;  3HOV G;  1PH1 A;  3GTJ H;  2F03 A;  4X62 L;  4DUZ Q;  2O4X A;  1VQL A;  1CHP D;  4GN5 A;  4OWT B;  1MGS A;  3SR1 A;  2K5W A;  3LNN A;  3U4V A;  3H91 A;  4HSV A;  2M00 A;  3RZO B;  4JOI A;  4XXE A;  3CF5 A;  3D6W A;  2CVR A;  2UXC Q;  3SK8 A;  3NQT A;  4HN7 A;  3V05 A;  1EFW A;  2K5N A;  4A3I G;  3QWN A;  1VQB A;  1ZYR C;  2VQE Q;  4OEL B;  1G6Z A;  2A69 C;  4C3H H;  3H6M A;  2UU9 Q;  2KCC A;  3RD4 A;  3EIV A;  4NMZ A;  4X65 L;  3SE0 A;  3QOL A;  2EZV A;  3BYY B;  4ULL A;  1B9N A;  2R7Z B;  4MTN A;  2VXW A;  1BCP B;  2A1A A;  1MJC A;  3M7G A;  2R92 G;  1EQQ A;  3CXC A;  3DXJ C;  5JVG 3;  1AE2 A;  5I9O A;  1ML0 D;  1WOC A;  3UE1 A;  2LXJ A;  3MFG A;  1R9T H;  4N9T A;  4P2C B;  4R9W A;  3CMA A;  3VR4 A;  4ZCK A;  2L12 A;  1K3B C;  4QB4 A;  1W2B A;  3T51 B;  1PH7 A;  2VUM H;  1Q8I A;  4DFA A;  1PA6 A;  3HOY G;  1PFM A;  1FYC A;  3MEF A;  2NZO A;  1TWC B;  1GKH A;  2B8F A;  1VQJ A;  5M3M G;  2PW7 A;  4JI5 L;  2I46 A;  1IW7 C;  1SYE A;  3GDE A;  3TZD A;  3KLS X;  4KHV A;  1CZG A;  1Q12 A;  4IQZ A;  2HDL A;  4LF5 Q;  1KDC A;  1EIG A;  4ZRZ A;  1CKN B;  4IUV A;  1SMY D;  4A75 A;  2XSC A;  4PZ6 A;  2I5M X;  1BUV T;  3ONA B;  4E6I A;  3GTG H;  1X3P A;  1EWH A;  4A3F B;  1KDA A;  1K3R A;  1PRT D;  1YBY A;  2CQA A;  2A8V A;  2MNA A;  3RNU A;  2E5L L;  1SND A;  3RN2 A;  3Q6S A;  3A7A B;  3PV0 A;  4DF7 A;  5M5X H;  1SE8 A;  5DM6 3;  1Q8K A;  3GTP B;  2ZJP A;  5ISR A;  2F0E A;  2I07 B;  4RKB A;  4H02 A;  1TWA H;  3LWU A;  1R4Q B;  1QIL A;  4IAL A;  1QVF A;  4X3S A;  3I8Z A;  1EY6 A;  3CKI B;  1H9J A;  1ASZ A;  4K0K Q;  1KAW A;  4DAP A;  3K5L A;  5FO7 B;  2ASB A;  1BBW A;  1CSP A;  3VR3 A;  3FEW X;  2IX0 A;  3DM1 A;  2EJF C;  1STG A;  2J4X A;  4BBS G;  1GVP A;  3NWT A;  3W1B A;  4X65 Q;  1PH8 A;  5EPK A;  1E2V A;  4KI0 A;  2WAQ E;  3MA2 B;  5C4X B;  2CH4 A;  1G2T A;  2B2T A;  1HUM A;  2K33 A;  1HZC A;  4OWX B;  2UXD L;  2LS0 1;  1I3Q B;  3ERO A;  3BYT B;  4HED A;  1H9M A;  2A6E C;  4DAY A;  1PZJ D;  1LTR D;  2JA5 H;  2RDF A;  4UP9 A;  1IKL A;  1VQ4 A;  3I4M G;  3QG1 A;  3ZJY C;  5DM7 3;  3EQL C;  3PIP A;  4PG3 A;  5CV5 A;  2KCT A;  1JWU D;  2IWH A;  1V8Q A;  4V19 0;  4GLX A;  1XTC D;  1PXU A;  2UXB Q;  3RZO H;  1JWS D;  3JAM E;  3TRE A;  4DV7 Q;  3H15 A;  1WTQ A;  4U67 3;  2F4V Q;  3S14 B;  1L0W A;  2E74 C;  4LF8 Q;  4JPB W;  1XNQ L;  4H44 C;  2OXP A;  1T9H A;  1SMY C;  3KF6 A;  4JI5 Q;  2PPB C;  3D8G A;  1IXR A;  1HPC A;  4IPD A;  4OWW B;  1ILQ A;  4LFA Q;  1B2T A;  4K8I A;  1PRT C;  4JI7 L;  2L4N A;  4C3H G;  4O1N A;  3RLF A;  2R7Z H;  4HR7 B;  1VQ6 A;  1YEZ A;  1J5E Q;  2CH4 W;  2XN9 C;  1LAC A;  1TWF B;  3G71 A;  1C48 A;  1YHA A;  1A15 A;  3FRP B;  1CTM A;  1S3O A;  5IY0 A;  4WJ4 A;  1SNM A;  1X32 A;  3F2D A;  3OWE B;  4L63 B;  3HEJ A;  2PNH A;  4JCV E;  4N9P A;  2EQS A;  1M90 C;  1AZP A;  1O7Z A;  3SEB A;  4LFB Q;  1V9P A;  3QIA A;  1SDF A;  2D5D A;  1JJC B;  5LL6 X;  3HOX G;  3GQB A;  5IGG A;  5JOB A;  1PFN A;  1X65 A;  5G3L D;  3SGI A;  2KEC A;  2A5H A;  1TWC H;  3I91 A;  4DR2 Q;  4A76 A;  4DV2 L;  2VB2 X;  4LUO A;  2VUM G;  3RMH A;  5ELD A;  1F2M A;  5FLX c;  2LY7 A;  2A68 C;  4B3R Q;  2MQH A;  1MJE A;  3NTK A;  3J81 i;  5CR3 A;  3CC2 A;  2HCC A;  2YYZ A;  4OXP A;  4KKU A;  1HNZ L;  2FMM A;  3IL8 A;  3S15 B;  1LO5 D;  4O0A A;  5JEA G;  4A3F H;  5IIF A;  1F2Y A;  2ZXO A;  3TP7 A;  2MHV A;  3H3V H;  2F0F A;  4X3U A;  5I6Y A;  1JOR A;  5FLX L;  1N33 L;  1MSG A;  1D1I A;  2R3Z A;  5E1F A;  5IGF A;  1PV4 A;  5BN5 A;  4Q5V A;  2DY7 A;  3GTP H;  2KCN A;  1OXX K;  4NKL A;  4ODG A;  4JI6 L;  4JI2 L;  5BR8 L;  1U0L A;  1U5K A;  1PH2 A;  3L3O C;  3K5N A;  1BQQ T;  1NAP A;  1I50 B;  3KBX A;  1GUN A;  4PMB A;  4JI4 L;  1E7Z A;  2PNR C;  1I5F A;  2F0U A;  2YV5 A;  4HMI A;  1A62 A;  1I6V C;  1JOO A;  3WWV A;  3KUP A;  2RDH A;  1SE3 A;  4KKS A;  2K5Q A;  4R4Q A;  3P20 A;  1QVG A;  4YWM A;  4R4T A;  4XTC S;  1SXT A;  4K6D A;  1O7L A;  3I7F A;  3J7A V;  4CKB A;  4J15 A;  4DU9 A;  2RBM A;  5C4X H;  1WTX A;  1VQ5 A;  2ES2 A;  2CKZ B;  4WFN 3;  1I3Q H;  1EUJ A;  2FIN B;  5D3I B;  4L6T B;  3G7L A;  2ALY B;  3CD6 A;  2F0D A;  1WTR A;  3A8I E;  1PVO A;  1B3Q A;  1W3S A;  3UDX A;  1RL2 A;  3S2H B;  1PH4 A;  2NZH A;  5KGU A;  3I4L A;  2JA5 G;  3M3Y B;  5LHY 1;  2Y0S B;  3KFU A;  1W6K A;  3PF5 A;  5KNC A;  4PNY A;  1SSO A;  3OTO L;  4LF9 L;  3BZD B;  4A3K G;  3S14 H;  3D31 A;  1DM0 B;  1DOL A;  3D6C A;  4JYA L;  3PIO A;  1NR4 A;  4A3M B;  4I65 A;  3IFT A;  5LMN W;  3S1Q B;  4GKJ Q;  3SDZ A;  2E2I B;  2EXZ A;  2JN4 A;  4KHP Q;  4DV5 L;  3FPU B;  2IY5 B;  4G7O C;  2ICI A;  1WJJ A;  4DXF A;  3HGB A;  2D0O A;  4YCV A;  3IKJ A;  4PMC A;  2L9H A;  1UE5 A;  1WTV A;  1TWF H;  1FJG Q;  4P74 A;  3RN5 A;  1Q3L A;  1UE7 A;  2OTJ A;  5IT9 c;  3L9A X;  1RIP A;  2B29 A;  5H1S E;  3KJP A;  4EVO A;  2E2J B;  3A54 A;  5ELF A;  3BZC A;  5M3F B;  3FMC A;  3FP9 A;  4ZKB B;  1HA6 A;  1O80 A;  2TSS A;  3T56 B;  1HHV A;  4DV0 Q;  1N33 Q;  5KYI A;  4EQN A;  3NTI A;  3I4M B;  2RCF A;  3A55 A;  1A63 A;  3ND8 A;  4C2M B;  4NB3 A;  2HQE A;  2F0M A;  2QDB A;  2QEX A;  2XGT A;  5CYU A;  4ZQ3 A;  1UNS A;  2GA4 B;  2M9V A;  4NW2 A;  4LUV A;  5I9P A;  5C3E G;  2PCF B;  5JPN C;  2O2L D;  3BU2 A;  5IT9 L;  2WFW A;  5CV6 A;  1XNR Q;  1HFN A;  4DAY B;  4LNQ A;  1ZXT A;  3M4Y A;  1E24 A;  4DV3 Q;  2UUB Q;  1CZW A;  1I94 Q;  2RA4 A;  2X6G A;  2WAQ G;  3MHB A;  3S2D B;  2BDN A;  2RKS A;  4NP5 A;  1GHJ A;  1D7Q A;  2Y0S E;  2PZT A;  4ALP A;  1ROD A;  1JC7 A;  1EFI D;  4WOR A;  1KNE A;  3S1R B;  1ET6 A;  2UUC L;  3VYR A;  1QCB D;  2JK8 A;  5LMN L;  3W5O A;  3K7A B;  1TWH B;  1WFQ A;  4DR1 Q;  3W2D A;  1IZ6 A;  1LTA D;  5JJK A;  3KF6 B;  2I5L X;  1JR0 D;  2Z6K A;  4DNR B;  4OIJ A;  1HUN A;  4IOC A;  4AYB B;  4A3F G;  2F0L A;  3OSO A;  1M8A A;  4B3M L;  4TVA B;  3C1E A;  4UDU C;  1LTL A;  5CV9 A;  3U50 C;  4LK1 C;  3BVG A;  4LF7 L;  3TS0 A;  1TS4 A;  4R4O A;  3OYY A;  4DUZ L;  4GKK Q;  5L37 A;  1I50 H;  3HOX B;  1BKB A;  1Z9F A;  1CKO A;  4KY5 A;  1E2W A;  2JA7 B;  4DAM A;  1DYQ A;  2RF4 A;  4KY6 A;  3HOZ B;  4JYA Q;  2EY5 A;  1ZEQ X;  1QZH A;  4RCO A;  4QIW B;  1BBX C;  4UP8 A;  5FLX E;  2UXC L;  2L15 A;  2JEA I;  1ASY A;  3AFP A;  3W3A A;  3S1N B;  3KK7 A;  2VQE L;  5CBE E;  3MXP A;  2FJ2 A;  4A3E B;  1WTW A;  3K5O A;  2UU9 L;  4L8J A;  4C3J B;  5J22 A;  1PZK D;  4R4I A;  1GUO A;  2VL6 A;  5IP9 H;  3R2T A;  1WD0 A;  1VQO A;  5C4X G;  2IHF A;  2OCE A;  3L0O A;  1LV9 A;  1U4M A;  1KAA A;  3MTS A;  2AQ2 B;  5C3X A;  2EYL A;  2MPM A;  1PFB A;  3S2H H;  2SNS A;  2E75 C;  3M3Y H;  1C7Y A;  1Y1V B;  1CUK A;  2WKD A;  3TP5 A;  1V1O A;  3CPW A;  5CMD A;  2K6A A;  1XPU A;  1H9S A;  1YHQ A;  2EYH A;  2G9D A;  3MVV A;  1SNQ A;  4C3I B;  3VR5 A;  1DZ1 A;  2BH8 A;  1BDO A;  2XWB B;  4F88 A;  4A3M H;  1WD1 A;  1QNU A;  2LXK A;  1S5E D;  4AYB E;  3S1Q H;  5EKL A;  3CP0 A;  1IKM A;  1I6H B;  1E2Z A;  4FP5 D;  4JG2 A;  4YWL A;  4KV6 A;  2E2I H;  1PH6 A;  1MKH A;  1SRU A;  5JEA J;  4XYO A;  4XT3 B;  1EYC A;  5CC4 A;  1MI2 A;  4JV5 Q;  4S3S A;  4XDX A;  4JC0 A;  4LJZ C;  4UPA A;  3CCM A;  1B44 D;  5JPM C;  4FVM A;  4B9W A;  3J7Y W;  3T1Y Q;  3I73 A;  1VQP A;  4LF5 L;  2OEO A;  3KDF A;  4L5T A;  2KEN A;  2E2J H;  4DV4 Q;  3QOJ A;  5M3F H;  4QIW E;  5D65 A;  1DCZ A;  4HMJ A;  4F7X A;  3NSW A;  1K9M C;  1V1P A;  2WAC A;  4C56 C;  3R2I A;  2AMC B;  1X6O A;  2WII B;  1EWC A;  4LFC Q;  4MZ9 A;  4C2M H;  1LLR D;  1F2L A;  3U4Z A;  5AFW A;  4CJ2 C;  5FOB B;  3A5Z B;  1S5B D;  1STN A;  3CCV A;  4LF6 Q;  4FXD A;  1SYG A;  1PTO D;  5I2Y A;  4TSS A;  4A3K B;  3PUY A;  3F8T A;  4KKT A;  3BDC A;  4CJ1 B;  1QB5 D;  2PYK A;  3S2D H;  4I7A A;  3VYU A;  3G6J B;  1XJV A;  2PW5 A;  3NBI A;  3D4W A;  1BR9 A;  1U4R A;  4PQX A;  1HNX Q;  1HXY D;  1ZKO A;  4K0K L;  1YNN D;  3EFX D;  1VQD A;  1T5X D;  3S1R H;  3G48 A;  3QO2 A;  1BNZ A;  4C1N K;  3SK4 A;  3T53 B;  3K7A H;  4LAA A;  1YJW A;  1TWH H;  2K4K A;  3M4Q A;  1JQY D;  5IT9 E;  2A6H D;  2CW0 C;  4FF1 A;  1JWM D;  5DAU A;  3BJU A;  1KRT A;  1Q81 C;  4RMF A;  1HTL D;  4X3T A;  2E76 C;  3STB D;  2EJM A;  3J7A F;  1EIF A;  3HKS A;  1X9N A;  1TS2 A;  2KVM A;  2R7F A;  4GLV B;  1EIH A;  2RQX A;  1GUS A;  4RHR A;  1XPR A;  1OXT A;  4IJL A;  4IUQ A;  4HTH A;  2AWO A;  4GZY C;  1Q82 C;  3UI2 A;  4RCN A;  3PMF A;  2ZTD A;  4KK7 A;  3TP8 A;  3HOX H;  3RR5 A;  2DN8 A;  2JA7 H;  1BVS A;  2WB1 B;  1IL2 A;  5C3E B;  3OWF A;  3HOZ H;  2N8N A;  2UXB L;  3I4N B;  2O5J C;  2IJ0 A;  1A8V A;  3LX0 A;  1STH A;  2ZXR A;  1C0A A;  2F0O A;  2SDF A;  3MXG A;  4P73 A;  2R6G A;  4DV7 L;  2F4V L;  1KXL A;  1K8M A;  2MO1 A;  3S1N H;  4LF8 L;  2WAQ B;  1VQ9 A;  4A3L G;  1VS0 A;  1A0I A;  4A3E H;  1N32 Q;  4FXK C;  3K81 C;  1GJX A;  5CV7 A;  4C3J H;  3A5U A;  2EJG C;  5KNB A;  4H7B A;  4LFA L;  1VQM A;  4FYD A;  3PSI A;  1NY4 A;  2KED A;  1AE3 A;  1L0X B;  5HGQ A;  5JEA H;  1QNK A;  1F9S A;  1SAP A;  1J5E L;  3Q8D A;  1E22 A;  4MIU A;  1KC8 C;  2GN5 A;  3P75 A;  1G2S A;  3J80 c;  1SNP A;  2K75 A;  5IP9 G;  3PO2 B;  1X3Q A;  3Q0A A;  1PTO C;  1GUW A;  1Y1V H;  2YU9 B;  4ID6 A;  1XMO Q;  1FNV A;  3NBH A;  3BZK A;  4LFB L;  1A6X A;  4IPC A;  4C3I H;  2D9U A;  2Y0S G;  1D8L A;  4RA8 A;  2Z4I A;  5FJ8 H;  5ELB A;  3V96 A;  4KHZ A;  5C5M A;  4NXN Q;  5FLM H;  1QUQ A;  1YNN C;  2JSO A;  4WJW A;  1I6H H;  1TS3 A;  3TS2 A;  4KLK A;  1SMX A;  3J80 L;  2H5X A;  3FPP A;  1ENF A;  4Q0F A;  4A3M G;  5GAH C;  4DR2 L;  3PUV A;  2CWP A;  2ZXP A;  3KOJ A;  1HQR D;  2NVT B;  3A7L A;  3BDO A;  4XT1 B;  1YJ9 A;  2QCP X;  1YIT A;  1K73 C;  3S24 A;  4B3R L;  1EOV A;  3H94 A;  2B2W C;  1JIC A;  2WB1 E;  3AFQ A;  2HUG A;  2XVS A;  2BE5 D;  2NN6 I;  1KL9 A;  4I7Z C;  4X3K A;  4JI8 Q;  1Q7Y C;  2NUC A;  4OIK A;  4R8I A;  3ULL A;  5JAV A;  2QF7 A;  1GM5 A;  1JJG A;  1VQC A;  4IFD H;  4O2D A;  3HG9 A;  3DM3 A;  4UHV A;  5M3F G;  4K5X A;  4HCS A;  2EOT A;  5AJ3 Q;  1RD9 D;  1S72 A;  3KLS A;  1TQO A;  2EYP A;  3FKI G;  2EY1 A;  2J7Z A;  1SYD A;  2X69 A;  3BVZ A;  4BY7 G;  1FR3 A;  4O42 A;  2C5C A;  2JEB I;  4KD4 A;  2F3W A;  2RVL A;  4A3K H;  2BCO A;  5BN3 A;  2K03 A;  4PZ8 A;  5IGD A;  2FHT A;  5C4H A;  3I3C A;  1VQI A;  1RHP A;  3ERQ A;  2CQO A;  4QCL A;  1Q1E A;  1O78 A;  4A3G B;  1KHI A;  2AQ1 B;  2DNC A;  3CCJ A;  4BWG B;  1IYJ B;  3CAM A;  1PYS B;  1OTC A;  1H9S B;  3P1H A;  3ERS X;  2EYO A;  1BCP F;  1TY0 A;  5A2Q L;  1I4Q A;  2WV6 D;  5IYC H;  2A74 C;  5HUR A;  2B2Y A;  2YTY A;  5ELO A;  3BDL A;  4TKO B;  3K57 A;  3KLW A;  3HZX A;  4R8N A;  1PLF A;  2AHO B;  1AW7 A;  3E0E A;  4FXG C;  1EEF D;  3RUZ A;  3UDI A;  2OT2 A;  2IT1 A;  2F0Q A;  3K5M A;  1HR0 Q;  4AYB G;  1G8Z D;  4ZUJ A;  4FF2 A;  1ENC A;  1HTP A;  3RLN A;  2MO0 A;  3KDF B;  4P75 A;  1MHW C;  1PH3 A;  1UUP A;  4AIM A;  1YNX A;  4DPG A;  5C3E H;  2N88 A;  3AYH B;  2K05 A;  3I4N H;  3G6E A;  4DV6 Q;  4GOP C;  2XRS D;  2Q8R E;  1V1P B;  4GN3 B;  4GNX C;  1A3U A;  1EEI D;  2XIW A;  1UAP A;  3F2B A;  1S4Z A;  4G7Z C;  2JA7 G;  2BE5 C;  1Y8N B;  4L5Q A;  5IOC A;  3HOZ G;  4DR7 Q;  1E1O A;  2AUK A;  2KA7 A;  4DV1 Q;  4V0B A;  4X66 L;  4GKJ L;  4A3B B;  3AQQ A;  3AMU A;  2VB3 X;  3SVM A;  2BDO A;  3CCL A;  3HOW B;  2IPK D;  4KHP L;  5C4Z A;  4BBR B;  2RSO A;  4QJF A;  4A3E G;  5C44 B;  2BA0 A;  4C3J G;  3TN2 A;  2B2Y C;  2F0H A;  3CU7 A;  4EQP A;  4MTK A;  1FJG L;  3PO2 H;  2KBN A;  1G51 A;  2XRQ D;  4YIJ A;  5NUC A;  4ABN A;  3RZD B;  2F1M A;  2YU9 H;  4QL5 A;  3GTQ B;  1YZ6 A;  1D6E C; 
#chains in the Genus database with same CATH homology
 5DLQ E;  4DAY B;  1EWI A;  5LMN Q;  4LNQ A;  3F1Z A;  4JBK A;  2IX1 A;  1HZA A;  3AEV A;  3STB C;  1WI5 A;  2BA1 A;  1E24 A;  5HY6 A;  4X62 Q;  4DV3 Q;  4B3S L;  2UUB Q;  4DV0 L;  1P8L A;  1I94 Q;  2WAQ G;  1UEB A;  1GD7 A;  1Y1V G;  1BBU A;  1SR3 A;  3GD7 A;  2JA8 G;  1D7Q A;  4EQ5 A;  3CCQ A;  2CCZ A;  2Y0S E;  1L1O A;  4ALP A;  3I4M H;  5GRO A;  3GTM H;  4B3M Q;  1NJI C;  1PH9 A;  4QQB X;  5FJ8 G;  2Q2T A;  3PF4 A;  2UUC L;  1XNR L;  1NMG A;  2FXQ A;  2JK8 A;  1YVC A;  3W1G A;  5FLM G;  3W5O A;  5LMN L;  1SFO H;  4B3T Q;  4LF7 Q;  1TXY A;  1PH1 A;  3HOV G;  4HID A;  2HT1 A;  3GTJ H;  2NVT H;  4X62 L;  4DV3 L;  1NBW A;  4DR3 Q;  2UUB L;  4DUZ Q;  2NVY H;  2D0P A;  5EAY A;  1VQL A;  1WFQ A;  4DR1 Q;  3UDF A;  1HZ9 A;  1I94 L;  3E9H A;  1IZ6 A;  4GN5 A;  4OWT B;  5JJK A;  3KF6 B;  1SN8 A;  2ZM6 Q;  4P72 A;  2I5L X;  2Z6K A;  3U4V A;  4GOP A;  1S40 A;  2IHE A;  4GNX A;  4IOC A;  4A3F G;  1Q46 A;  3M4O H;  1YIJ A;  4JOI A;  4B3M L;  4TVA B;  3CF5 A;  4POF A;  2NN6 G;  1LTL A;  1X3F A;  3PO3 G;  2UXC Q;  4BA2 I;  3U50 C;  5IYD G;  1EFW A;  3CCE A;  2K5N A;  1PYB A;  4A3I G;  4B3T L;  4HJ7 A;  4LF7 L;  3TS0 A;  3B6Y A;  1VQB A;  2VQE Q;  4R4O A;  5GQO A;  3OYY A;  4DR3 L;  4DUZ L;  4GKK Q;  4C3H H;  1I50 H;  1OXU A;  4DR1 L;  4JI3 L;  2UU9 Q;  4HJ8 A;  1BKB A;  3EIV A;  4AH6 A;  1Z9F A;  2ZM6 L;  1CKO A;  1K8A C;  1KRS A;  3HKZ G;  4DAM A;  4R4C A;  4X65 L;  2RF4 A;  4JYA Q;  4IFD G;  4FDB A;  4A4I A;  1WCM H;  1QZH A;  3PUZ A;  2UUA Q;  2EIF A;  4UP8 A;  2UXC L;  2L15 A;  4MTN A;  2JEA I;  2A1A A;  1ASY A;  3AFP A;  4JBJ A;  1MJC A;  3M85 A;  2VQE L;  2E8G A;  4GKK L;  1XMQ L;  2R92 G;  1N9W A;  5GAE C;  3CXC A;  1L1O C;  3ULP A;  1EQQ A;  2UU9 L;  1AE2 A;  4A3G H;  3CME A;  1G29 1;  1N34 Q;  2MFI A;  4R4I A;  2VL6 A;  1WOC A;  3NBH B;  3UE1 A;  2LXJ A;  4DUY Q;  1R9T H;  5IP9 H;  4Y52 H;  2JA6 G;  1C9O A;  2ZJQ A;  1VQO A;  3CMA A;  2IHF A;  2OCE A;  3GO5 A;  2K52 A;  4X66 Q;  1NTG A;  3L0O A;  2UUA L;  1B7Y B;  1FVI A;  1W2B A;  4IOA A;  3KF8 B;  1QUQ B;  3S2H H;  1PH7 A;  3VDY A;  2VUM H;  2I5H A;  3M3Y H;  1PA6 A;  3HOY G;  2N49 A;  1C7Y A;  3ICE A;  3M4P A;  1CUK A;  2NZO A;  3MEF A;  5C0X J;  5IYC G;  1GKH A;  3CPW A;  4A3C G;  1VQJ A;  1N8R C;  5M3M G;  4JI5 L;  1XPO A;  1FGU A;  1XPU A;  4A3D H;  2RHQ B;  3GDE A;  4DUY L;  3CC4 A;  1YHQ A;  1Q12 A;  4R1J A;  1JJ2 A;  1OXV A;  3PUW A;  2BH8 A;  2E5L Q;  4A3M H;  4LF5 Q;  3M9B A;  2LXK A;  1YHB A;  1DGS A;  3NEL A;  2HIX A;  4AYB E;  3L2P A;  1CKN B;  3S1Q H;  3CP0 A;  5IYB H;  3LGJ A;  4JG2 A;  4YWL A;  4YHH L;  1VQG A;  3J81 c;  4A75 A;  2E2I H;  1PH6 A;  2OQK A;  1MKH A;  1SRU A;  2PQA A;  4PZ6 A;  5JEA J;  2I5M X;  2VW9 A;  4APV A;  4JV5 Q;  3GTG H;  1HJP A;  3CCU A;  1K3R A;  4PMW A;  1YBY A;  4JC0 A;  2A8V A;  4UPA A;  2WB1 G;  3CCM A;  2MNA A;  1Y1W G;  2JJQ A;  2VQF Q;  3RNU A;  2E5L L;  3T1Y Q;  3I4N G;  1VQP A;  2R93 H;  4LF5 L;  3KDF A;  2XTI A;  4L5T A;  3GTK H;  2KEN A;  3RN2 A;  4A3B H;  3TQY A;  2E2J H;  2HHH Q;  4DV4 Q;  3JAM i;  5M3F H;  4QIW E;  1NE3 A;  4DR5 Q;  3PV0 A;  1X3G A;  4YCU A;  3HOW H;  5M5X H;  1SE8 A;  5GAG C;  1K9M C;  1Q8K A;  4OX9 Q;  2AKW B;  2ZJP A;  4BBR H;  2ZJR A;  1P16 A;  4JV5 L;  2AMC B;  1X6O A;  4H02 A;  1TWA H;  5C44 H;  4LFC Q;  4MZ9 A;  1KIX A;  2C35 B;  4C2M H;  3EN2 A;  2GVB A;  3I2Z A;  1QVF A;  2I0Q A;  3GTL H;  1ASZ A;  4HIK A;  2VQF L;  3K8A A;  3T1Y L;  3U4Z A;  4NXM L;  4K0K Q;  2UXD Q;  1KAW A;  3RZD H;  5IE8 A;  3A5Z B;  3GTQ H;  2HHH L;  2ZTE A;  3CCV A;  4LF6 Q;  2ASB A;  4DV4 L;  1HNW Q;  1BBW A;  1CSP A;  4JBW A;  4DR5 L;  2B63 G;  3H0G H;  4GN4 B;  2IX0 A;  4JI3 Q;  5LMU Q;  3H3V I;  4BBS G;  4OX9 L;  1GVP A;  3PO2 G;  3PUY A;  4XIG S;  3RLO A;  3F8T A;  3W1B A;  3PGZ A;  4X65 Q;  1PH8 A;  4QGU A;  1VQK A;  4LFC L;  3S2D H;  2PI2 A;  1X3E A;  3OW2 A;  4KI0 A;  2GVA A;  2WAQ E;  2JA9 A;  1XJV A;  2NVQ H;  5IWA Q;  1HZC A;  3TRZ A;  1HNX Q;  4OWX B;  4K0K L;  2UXD L;  1VQD A;  4BY1 H;  3S1R H;  3G48 A;  2Z0S A;  4LF6 L;  1K83 H;  4IFD I;  1HNW L;  1H95 A;  2JA5 H;  1XMQ Q;  4UP9 A;  3K7A H;  1XNQ Q;  1HH2 P;  5LMU L;  1YJW A;  2K5H A;  1VQ4 A;  3I4M G;  3ZJY C;  3HOU H;  2DUD A;  1TWH H;  2K4K A;  3M4Q A;  1SRO A;  1K0R A;  3J7Z C;  3S1M H;  3PIP A;  2OWO A;  4PG3 A;  4DNI A;  4A93 H;  1LYL A;  5JJI A;  2KCT A;  1VQN A;  4A3L H;  1VQE A;  2V1C C;  4UP7 A;  4DK6 C;  1JT8 A;  3PCO B;  3BJU A;  1KRT A;  4QY7 A;  4BA1 I;  4RMF A;  4GLX A;  1Q81 C;  3STB D;  5IWA L;  4JI7 Q;  2UXB Q;  1EIF A;  3HKS A;  1X9N A;  1YJN A;  1KD1 C;  2HIV A;  2R7F A;  1HNX L;  4GLV B;  3RZO H;  1LUZ A;  3TRE A;  1IBL Q;  4BXX H;  5C4X G;  4DV7 Q;  3H15 A;  1XPR A;  1OXT A;  2F4V Q;  4IJL A;  1L0W A;  2AWO A;  4LF8 Q;  1XNQ L;  3J81 j;  1Q82 C;  1QZG A;  1T9H A;  2ZTD A;  2VY3 A;  3KF6 A;  4ME3 A;  4JI5 Q;  4OO1 G;  3HOX H;  1WYD A;  1IXR A;  2KHJ A;  4IPD A;  3RR5 A;  4OWW B;  3E9I A;  1EQR A;  2EXD A;  1BVS A;  1MIU A;  1IL2 A;  2JA7 H;  4P71 A;  4LFA Q;  1HZB A;  2N8N A;  3K7U C;  5M5Y H;  3HOZ H;  4JI7 L;  2RHS B;  2UXB L;  1A8V A;  3HKZ E;  1X55 A;  1C0A A;  3RLF A;  3JC6 6;  1IBL L;  2R7Z H;  4LW1 A;  4P73 A;  2R6G A;  4DV7 L;  1YEZ A;  2QA4 A;  1J5E Q;  2F4V L;  4YHH Q;  1VQ6 A;  1KXL A;  3CCR A;  2MO1 A;  3S1N H;  4LF8 L;  1Y14 B;  3U58 A;  3G71 A;  1VQ9 A;  4UY8 C;  1YHA A;  4A3L G;  1V43 A;  1WCM G;  1VCI A;  1VS0 A;  1A0I A;  1XTD A;  5IP7 H;  1S3O A;  5IY0 A;  4A3E H;  4JI0 L;  1N32 Q;  4WJ4 A;  3K81 C;  3F2D A;  2Q2U A;  3A5U A;  4C3J H;  4DV2 Q;  4DKA C;  3DLL A;  2PNH A;  4JCV E;  2EQS A;  1VQM A;  1M90 C;  4LFA L;  3PSI A;  4LFB Q;  3CW2 C;  2VNU D;  1NY4 A;  1V9P A;  4LUZ A;  1AE3 A;  2F3I A;  2JE6 I;  4OON A;  5HGQ A;  1VQF A;  1GO3 E;  2CFM A;  5E7N A;  4A3G G;  1J5E L;  3Q8D A;  1JJC B;  1E22 A;  3HOX G;  1KC8 C;  2GN5 A;  1CKM A;  3A74 A;  3J80 c;  1X65 A;  1B70 B;  2K75 A;  5IP9 G;  1L1O B;  4LF4 Q;  3SGI A;  4L5S A;  4IO9 A;  1HNZ Q;  4JI1 Q;  1N32 L;  1Y1V H;  2D62 A;  1TWC H;  1XMO Q;  3G4S A;  4DR2 Q;  2JA8 H;  4A76 A;  5J3B A;  4Y7N H;  4DV2 L;  1IBK Q;  4POG A;  3M7N A;  3BZK A;  2R7Z G;  4LUO A;  3IRB A;  5C0X G;  1K8G A;  2VUM G;  4NXM Q;  4LFB L;  4YCW A;  5FLX c;  4IPC A;  4C3I H;  4B3R Q;  1E3P A;  2Y0S G;  1D8L A;  2MQH A;  2QGQ A;  5FJ8 H;  1KQS A;  1MJE A;  4KHZ A;  3J81 i;  1VQA A;  3JAM c;  1PHJ A;  5FLM H;  1QUQ A;  4NXN Q;  4A3D G;  3CC2 A;  2RCN A;  2F52 A;  2YTX A;  3PUX A;  4GOP B;  3HOV H;  1I6H H;  5ELN A;  2E2H H;  4GNX B;  1CSQ A;  3TS2 A;  2OTL A;  2YYZ A;  3FKI H;  4KLK A;  4OXP A;  4LF4 L;  1SMX A;  1HNZ L;  2H5X A;  4JI1 L;  1XMO L;  4BY7 H;  4A3M G;  4HJ9 A;  5GAH C;  4DR2 L;  3PUV A;  4A3J H;  2CWP A;  4JI6 Q;  1PFS A;  1IBK L;  2VZA A;  4YWK A;  4JI2 Q;  3J7A 5;  4O0A A;  3KOJ A;  1SLJ A;  5JEA G;  5IYB G;  5BR8 Q;  4A3F H;  1VQ7 A;  3I55 A;  2HQL A;  1YJ9 A;  1YIT A;  1B8A A;  4HIO A;  1K73 C;  3S24 A;  3H3V H;  3PO3 H;  4B3R L;  3UE0 A;  1EOV A;  2DGY A;  1VQH A;  5JJL A;  2WB1 E;  5M5W H;  1CKN A;  3AFQ A;  3F2C A;  1L2F A;  1N33 L;  3GTO H;  4NXN L;  4A3I H;  4JI4 Q;  5IYD H;  2NN6 I;  3D0F A;  1KL9 A;  5K36 G;  1PV4 A;  4JI8 Q;  1Q7Y C;  2YTV A;  3CC7 A;  3GTP H;  3ULL A;  1OXX K;  2R93 G;  4IJH A;  4JI6 L;  4JI2 L;  4A3B G;  1GM5 A;  1JJG A;  1VQC A;  5BR8 L;  4O2D A;  1U0L A;  1U5K A;  3DM3 A;  5M3F G;  1PH2 A;  3S15 H;  1UE1 A;  2N78 A;  3HOW G;  4IFD J;  5C4J H;  4X64 Q;  5AJ3 Q;  1S72 A;  4BBR G;  3ER0 A;  2K50 A;  1YI2 A;  3FKI G;  1HR0 W;  2NVX H;  4JI4 L;  2ATW A;  1E7Z A;  5C44 G;  1I5F A;  1UWV A;  2YV5 A;  1A62 A;  3L7Z C;  3ULJ A;  4BY7 G;  1V1Q A;  1Q86 C;  4PZ7 A;  4JI8 L;  3KJO A;  4A3J G;  2JEB I;  3K0X A;  3WWV A;  2R92 H;  1J6Q A;  1OXS C;  3S17 H;  4YY3 Q;  4A3K H;  4R4Q A;  1QVG A;  3I4O A;  1UE6 A;  4R4T A;  4YWM A;  4XTC S;  4PZ8 A;  4HJA A;  3I7F A;  2PMZ E;  2JA6 H;  4J15 A;  3H0G G;  1JE5 A;  5C4X H;  4OO1 I;  2ID0 A;  3S16 H;  1VQI A;  3FHW A;  4X64 L;  5AJ3 L;  1IBM Q;  2CQO A;  2CKZ B;  1VQ5 A;  1Q1E A;  2ES2 A;  1KHI A;  1I3Q H;  3CCJ A;  1IYJ B;  1Z47 A;  3CAM A;  4IPG A;  1EUJ A;  3OTO Q;  4LF9 Q;  1PYS B;  4RG1 A;  4WJ3 M;  1OTC A;  3NEM A;  3HOY H;  3ERS X;  2ALY B;  3CD6 A;  4A3C H;  4YY3 L;  5IYC H;  2K14 A;  1JMC A;  4DR6 Q;  2K5V A;  3KYH C;  5M3M H;  1N36 Q;  2YTY A;  1PVO A;  5ELO A;  4MNO A;  2BH2 A;  4BY1 G;  4DR4 Q;  1W3S A;  2KCM A;  4IPH A;  1RL2 A;  3UDX A;  5GAD C;  2NZH A;  1PH4 A;  2PI2 E;  3KLW A;  2JA5 G;  1NMF A;  4GLA C;  3KFU A;  2KHI A;  4DV5 Q;  4AQY Q;  1IBM L;  3HOU G;  4NPS A;  2PQA B;  3PF5 A;  1Q1B A;  1EYG A;  2AHO B;  2IY5 B;  3E0E A;  4A93 G;  4EX5 A;  1X56 A;  3OTO L;  4LF9 L;  3CPF A;  3UDI A;  4A3K G;  3A0J A;  3S14 H;  3TEH B;  3D31 A;  2IT1 A;  1HR0 Q;  3I56 A;  4LWC A;  4AYB G;  2AWN A;  4JYA L;  3PIO A;  4DR6 L;  2A19 A;  5LMN W;  1N36 L;  3RLN A;  2MO0 A;  4DR4 L;  3KDF B;  4BXX G;  4GKJ Q;  4P75 A;  1PH3 A;  3EBE A;  3T1H Q;  4AIM A;  1VQ8 A;  1YNX A;  1FL0 A;  1TWG H;  4DPG A;  5C3E H;  1Y1W H;  4KHP Q;  3AYH B;  4DV5 L;  1O7I A;  2Z6K C;  4TQU S;  4AQY L;  3K80 C;  2LSS A;  3G6E A;  4DV6 Q;  4GOP C;  3I4N H;  4X6A H;  4GS3 A;  2Q2I A;  4JBM A;  4GN3 B;  4GNX C;  1WJJ A;  1G6P A;  3F2B A;  2D0O A;  4YCV A;  2JQO A;  4JOI C;  4L5R C;  5C0X I;  1UE5 A;  2JA7 G;  3MXN B;  1N34 L;  1HR0 L;  4L5Q A;  1TWF H;  3HOZ G;  1E1O A;  2R7D A;  4P74 A;  1JB7 A;  3RN5 A;  1FJG Q;  4DR7 Q;  1UE7 A;  2OTJ A;  5IT9 c;  4DV1 Q;  1AH9 A;  4DK3 C;  1RIP A;  2B29 A;  4X66 L;  5H1S E;  1X54 A;  3KJP A;  1PH5 A;  2CWA A;  4GKJ L;  3AQQ A;  3BZC A;  4JI0 Q;  3FP9 A;  3T1H L;  3CCL A;  2WP8 J;  4HJ5 A;  4KHP L;  3CCS A;  4B3S Q;  3UDG A;  4DV0 Q;  4DV6 L;  3NEN A;  1N33 Q;  2Q2H A;  1LM0 A;  3HFZ B;  4QJF A;  5IP7 G;  4A3E G;  3J80 i;  1M1K C;  2BA0 A;  1A63 A;  2B63 H;  4NB3 A;  2B3G A;  2ZTC A;  2XGT A;  2N3S A;  3CQZ H;  2QEX A;  4BBS H;  4DR7 L;  1FJG L;  3PO2 H;  2KBN A;  2VS1 A;  1G51 A;  4LUV A;  4DV1 L;  1QVC A;  2OQ0 A;  5C3E G;  2YU9 H;  1E1T A;  4HIM A;  4QL5 A;  1EIY B;  3BU2 A;  2UUC Q;  2WFW A;  1YZ6 A;  1XNR Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...