3AQQA

Crystal structure of human crhsp-24
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
101
structure length
99
Chain Sequence
SPLPTRRTRTFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTYKMCSIKNEKLQAVEVVITHLAPGTKHETWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Calcium-regulated heat stable protein 1
publication title CRHSP-24 is a novel cargo adaptor trafficking between stress granules and processing bodies
rcsb
source organism Homo sapiens
total genus 22
structure length 99
sequence length 101
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3aqqA00
1IYJB 2Q2UA 5C4XH 2UUCQ 1EIFA 1HJPA 1YJWA 5LMNQ 5GQOA 3G4SA 4GLXA 4A93G 1M90C 4QIWE 1VQFA 1JMCA 1Q7YC 4R4CA 3TS0A 1SN8A 2PI2E 4LWCA 4MNOA 3KOJA 2UXCQ 5LMUL 3TS2A 4DV5L 1A62A 2PNHA 4GOPC 3T1YQ 4A3KG 3BZKA 2JEAI 5C44H 4NXNL 4YWLA 1SRUA 1R9TH 1CSPA 2WB1E 3RZOH 1OXTA 4A3MH 3PO2H 1K3RA 3HOVG 2BH2A 2AMCB 3AFPA 3D31A 3GTJH 4POGA 4P71A 1PVOA 4IO9A 1TXYA 2Z6KC 1HNWL 4H02A 1I94Q 3AEVA 3H3VH 2RF4A 3M85A 2Z0SA 3UDXA 2HIVA 3U50C 2UUBL 2MFIA 1X3GA 1L2FA 4IJHA 3S2HH 3B6YA 2PQAB 2DUDA 1HH2P 3PIOA 1MJEA 4JI5Q 1D8LA 3VDYA 3JAMc 4UPAA 5EAYA 2K4KA 3CC2A 4P73A 1PH8A 4B3TL 1G6PA 1L1OC 3KF6B 2Y0SG 4POFA 3KJOA 3G48A 3AYHB 4DR1L 4Y52H 4KI0A 1HZ9A 4MTNA 3HOZH 2F4VL 3E9IA 2HHHL 4LNQA 4KHZA 1UE6A 4JBJA 4YHHL 1VQ7A 4JI1L 2VQFL 1PH6A 2E2IH 3J81c 1IZ6A 2ATWA 5JJIA 4BBSH 3CPFA 3RR5A 4P75A 4DUYL 1Q86C 5IE8A 1OXSC 1PH3A 2CQOA 2WB1G 1PH4A 2E5LQ 2JA7G 4IFDJ 1XMQQ 1IBMQ 3ERSX 1N33Q 1WCMG 4ME3A 3NENA 2VY3A 4JI6Q 5GAGC 3GTKH 4A3DH 2JA8H 3TREA 2D0OA 3PUZA 4JI0Q 1Q82C 1K83H 1VQEA 2R7ZH 1OXXK 3DLLA 1PH2A 4A3EH 4DK3C 3PV0A 4DV2L 4DV4Q 4OX9Q 2IHFA 3CP0A 1TWFH 1CUKA 4O0AA 4YWMA 1PYSB 3TRZA 3CAMA 1HZAA 2VNUD 2UUCL 4P74A 4LFBQ 3GDEA 1L0WA 1QUQA 1Y1VG 4PMWA 3S1NH 2N78A 2OQ0A 3A0JA 5M3FG 3DM3A 4A3JH 3D0FA 1FGUA 1U0LA 1QVCA 4DR2Q 5GAHC 2R7DA 5FLXc 4EQ5A 3PUWA 4C3IH 3T1YL 4GLAC 1VQJA 4R4OA 5M5XH 5GADC 3LGJA 2IX0A 1EYGA 2GVAA 1YVCA 1A8VA 1NBWA 3W1BA 2UUAL 5LMNW 3T1HQ 4DV3Q 4LF5Q 1GKHA 3UE0A 3J7ZC 4JI8Q 4GNXC 3S17H 3OYYA 5C4XG 1I94L 5K36G 3UDGA 5IT9c 1P8LA 3CCQA 4OO1G 3PUXA 1XPRA 4IPDA 1ASZA 5FLMH 2KBNA 2R6GA 1X3EA 1BBWA 1YZ6A 4JI5L 3S16H 3MEFA 1XNQQ 2YU9H 4X65Q 5FJ8H 2QA4A 1Q46A 4B3MQ 1J6QA 1KC8C 1VQDA 1PA6A 1KHIA 1MJCA 1UEBA 5ELNA 3PIPA 1GM5A 1J5EQ 2JA6H 4K0KQ 1SLJA 1YI2A 3ICEA 1Q8KA 3JC66 2ASBA 5M3MH 3M9BA 4DV7Q 5IYDH 2H5XA 2K50A 1HNXQ 4JI4Q 4JI3Q 2VZAA 2HIXA 3J81j 2IX1A 1QUQB 4IOAA 2WAQE 4X64L 4PZ7A 2LXJA 3K80C 1BBUA 4IFDI 2E5LL 5JEAJ 3JAMi 4YCVA 1XMQL 5DLQE 3FKIH 1IBML 2PMZE 1EQRA 3RZDH 2NVXH 4DV0L 1Q12A 4GKJQ 1E22A 5JJKA 3HKSA 1EQQA 1PH9A 4JI0L 3I4NH 3KYHC 3CF5A 4XTCS 4DV4L 4OX9L 1GO3E 1LM0A 1CKNA 4DR5L 1C9OA 3CPWA 2YTYA 3J81i 2LSSA 1N9WA 2K52A 1NMFA 2D0PA 5IP9G 1YJ9A 1HR0Q 3CW2C 4YY3Q 3CC4A 3FHWA 5IYBH 4JBMA 3GO5A 2Q2TA 4L5RC 1O7IA 2IHEA 2I5MX 2K5HA 4FDBA 4JI7Q 3CCLA 3HOXG 3CCEA 4DR2L 1IBKQ 1EWIA 3GD7A 2B63H 1TWCH 2R7FA 4DR6L 2A1AA 4KHPQ 4DR4Q 2Y0SE 4AYBE 4WJ4A 4C2MH 4DR7L 2JQOA 2AWOA 3A74A 3PF5A 4IPCA 3PF4A 2NN6I 4BA1I 2R7ZG 1X56A 1XMOL 1VQ4A 1IXRA 4DV6Q 4BXXG 4A3EG 2WAQG 4GS3A 3S2DH 4JI8L 5AJ3Q 1XPOA 3CQZH 2ZM6Q 1YNXA 4LF7L 3KJPA 4A3LH 1UE7A 3W1GA 4GN4B 1HNZL 5JEAG 3CCUA 1MKHA 1Y14B 4A75A 1Y1WH 3GTPH 4HJ8A 5C0XJ 4QL5A 3HOUH 2HT1A 3PGZA 4WJ3M 2I0QA 3CXCA 4X65L 4R1JA 2KENA 1C0AA 1N32Q 3RLOA 1PH7A 3PSIA 3PUYA 1A0IA 1X3FA 2ZTCA 4YCWA 1CKNB 4LF8Q 1FL0A 4DV7L 3UE1A 2CFMA 3K7UC 1ASYA 3STBD 4X66Q 3GTGH 4AYBG 4LUOA 4A3BH 1JJ2A 2AWNA 2ZTDA 2VUMH 5JJLA 2A19A 1YHBA 3MXNB 1YJNA 5FLMG 1A63A 3L7ZC 4GKJL 1SR3A 1WYDA 5IP7H 4DUZQ 1QZGA 4DR3L 1S40A 2NVTH 5FJ8G 4B3RL 4PG3A 1I50H 3HOWH 2F3IA 4LFAL 3F1ZA 5E7NA 2I5HA 2JA6G 1VQAA 4BBRG 4DK6C 2EQSA 2CWPA 4JYAQ 4TVAB 4C3HH 1AH9A 5IYDG 3S24A 2B29A 2OWOA 2K14A 5C0XG 1S72A 3ULLA 2MO0A 1FJGL 4X6AH 1PYBA 4BY1G 3NBHB 3M4PA 1SMXA 1X54A 5IYCH 4KHPL 5LMNL 3HFZB 2KHIA 3G71A 3OW2A 3BU2A 1N36Q 3PO3H 1RIPA 5ELOA 4UP7A 5C4JH 1HR0W 3M4QA 2CCZA 2K5NA 4A3CH 2UXCL 4A3FH 1VCIA 4PZ6A 2AKWB 2RHQB 4B3SQ 4JV5Q 1VS0A 1E1OA 1E3PA 1VQBA 2ZM6L 4A93H 4A3GG 1EUJA 1JB7A 2VQEQ 3M4OH 2ZTEA 4GOPB 3I7FA 3S1MH 1Z47A 4OXPA 5IYBG 3K7AH 4BY7G 1WFQA 5C0XI 2N3SA 3HKZE 2K75A 1EFWA 1WJJA 3STBC 4A3KH 3S15H 4NB3A 1KAWA 3BJUA 5J3BA 2ZJRA 3GTMH 1G291 1FVIA 2YYZA 2B3GA 4JG2A 1SE8A 4O2DA 3CCSA 3CCVA 2ZJQA 4LUVA 4UY8C 4LFCQ 1SFOH 2ID0A 2RHSB 4J15A 3I56A 4DAMA 2OTJA 4RG1A 2WP8J 5C44G 4DAYB 1VQMA 1VQKA 2R93H 4X66L 3E9HA 2OCEA 3GTOH 2JA9A 4IJLA 3ULJA 1QVFA 3OTOQ 4JBWA 4HIKA 4HJ7A 4A3MG 1Y1WG 1EIYB 4JBKA 3PO2G 3FP9A 4JOIA 5BR8Q 1UE1A 1YHQA 1N8RC 1EOVA 3HOUG 1RL2A 2MO1A 3ULPA 2Q2HA 1JT8A 4OO1I 4JCVE 3K81C 4DPGA 1N33L 3I2ZA 2Q2IA 4JI6L 3HKZG 4LF6Q 1I6HH 3F8TA 3NELA 4APVA 1Q1EA 2E2JH 1LYLA 1K8AC 1PH1A 4Y7NH 1VQNA 2JA7H 3L0OA 2JJQA 3UDIA 3RNUA 2AHOB 5M5WH 1VQIA 4A3BG 1NTGA 5H1SE 1DGSA 3UDFA 3NEMA 3HOZG 3Q8DA 4LFBL 1KRSA 1WI5A 4B3TQ 4ALPA 4BBSG 4HIMA 3H3VI 4NPSA 3F2CA 1XPUA 4RMFA 4XIGS 4B3SL 4JV5L 2HHHQ 2JA5H 3SGIA 1WOCA 2NVYH 4A3DG 1Y1VH 1YHAA 4YHHQ 2A8VA 2VQFQ 2R92H 2JA8G 1OXVA 4DUYQ 1YEZA 2RCNA 1XNRQ 5GROA 3T1HL 3I4MH 3CMAA 1GVPA 1XTDA 4DV3L 4LF5L 1TWHH 5HGQA 3F2DA 2GN5A 4JI2Q 1N34Q 1T9HA 5IYCG 1KQSA 3GTLH 1VQHA 1JJGA 4GNXB 2KCMA 3HOYH 4DV2Q 3GTQH 2FXQA 4A3JG 3S14H 4A3CG 4OWWB 4A3FG 4IPHA 2YV5A 1TWGH 2XTIA 1XNQL 1SROA 4TQUS 3F2BA 1VQ8A 3KFUA 2ALYB 3KF8B 1BVSA 3W5OA 4A4IA 1VQOA 1YIJA 4B3ML 4C3JH 4NXMQ 5C3EH 4A3IH 4LUZA 2N8NA 4K0KL 1J5EL 3OTOL 1PV4A 2GVBA 1JE5A 5IWAQ 1BKBA 2HQLA 1IL2A 4HJ9A 2NVQH 5BR8L 5IY0A 2V1CC 3H0GH 3ZJYC 4QGUA 2KCTA 4IOCA 1HNXL 4JI3L 1VQ9A 4P72A 4GOPA 3PUVA 4JI4L 1PH5A 2UUAQ 1JJCB 3J80c 1K0RA 3G6EA 1GD7A 1U5KA 4EX5A 3RN5A 1YITA 4LF6L 1VQLA 4LF4Q 2ES2A 4YCUA 2VS1A 5GAEC 4DV1Q 2Z6KA 1G51A 4UP8A 1M1KC 4DKAC 1S3OA 2R93G 3U4VA 1V1QA 3IRBA 4KLKA 2NZHA 3EN2A 2JEBI 3I55A 4AQYQ 2IT1A 1HR0L 1UE5A 1LTLA 5M3MG 1B7YB 4QJFA 3EIVA 2CKZB 4YY3L 1QZHA 2DGYA 2XGTA 3AFQA 3RLFA 2BA0A 1UWVA 1IBLQ 2LXKA 1B70B 4JI7L 1L1OA 1E24A 1IBKL 3FKIG 3WWVA 5IP9H 1XJVA 4DR4L 2UXBQ 1VQGA 3U4ZA 4X62Q 4LF9Q 4GN5A 2I5LX 4AH6A 1Z9FA 3RN2A 1E7ZA 3I4NG 4X64Q 1XNRL 1VQPA 2CWAA 3HOXH 4DV6L 2UU9Q 2UXDQ 4DNIA 1TWAH 2NZOA 4HJAA 5AJ3L 2KHJA 2VW9A 4DV0Q 3KDFA 4PZ8A 1NMGA 2WFWA 3TEHB 4A76A 1QVGA 4JI2L 1N34L 3I4OA 3CC7A 1V9PA 4BXXH 1Q1BA 3S1RH 1Q81C 4DR5Q 1MIUA 1K73C 1X65A 2B63G 1I3QH 1I5FA 2JA5G 3BZCA 1VQ5A 4GKKQ 1AE3A 3PCOB 1KXLA 4UP9A 4NXML 1N32L 2R92G 3HOVH 2OTLA 2E2HH 4R4IA 3TQYA 3I4MG 2EXDA 5IWAL 1D7QA 4LF8L 1VQCA 4OWTB 1PHJA 1C7YA 4DR6Q 3H15A 3L2PA 3RLNA 1AE2A 4DR7Q 4YWKA 4A3LG 3ER0A 4L5TA 3E0EA 3M3YH 4JOIC 3U58A 1YBYA 1XMOQ 1NJIC 2YTXA 3HOYG 5LMUQ 4DV5Q 1L1OB 1X6OA 4IPGA 4R4QA 1KD1C 1CKMA 1LUZA 3CCRA 1W2BA 4LF4L 4NXNQ 1HZBA 4DUZL 4LF7Q 4GNXA 4DV1L 3K0XA 1HNZQ 4IFDG 3K8AA 3EBEA 4HIOA 4L5QA 1HZCA 4AIMA 5C3EG 2YTVA 4A3IG 2JK8A 1X55A 3AQQA 1NE3A 3S1QH 4OWXB 5HY6A 4MZ9A 4JYAL 1HNWQ 4AQYL 1OTCA 1P16A 3CCJA 3KDFB 3H0GG 1H95A 3J80i 3CMEA 2UUBQ 2QEXA 1CKOA 3A5UA 1IBLL 2VUMG 1WCMH 2VL6A 1W3SA 4BBRH 1KL9A 2UXBL 4X62L 4LF9L 2JE6I 2ZJPA 1N36L 5IP7G 2OQKA 1X9NA 3CCMA 4JC0A 2BH8A 3KLWA 4DR1Q 2UU9L 4BY1H 3CD6A 2UXDL 2L15A 5M5YH 3HOWG 2MQHA 2F4VQ 4OONA 1VQ6A 2K5VA 1PFSA 2C35B 1KRTA 2PI2A 4R4TA 4JI1Q 4L5SA 2VQEL 1B8AA 2NN6G 5M3FH 4DR3Q 1OXUA 2QGQA 1NY4A 4B3RQ 2D62A 2BA1A 4GLVB 2PQAA 3A5ZB 2F52A 4LW1A 2E8GA 4LFAQ 1K9MC 3J7A5 4BA2I 4A3GH 1V43A 2EIFA 2MNAA 1KIXA 3M7NA 1K8GA 3KF6A 4GKKL 4QQBX 4QY7A 1CSQA 4HIDA 1FJGQ 3PO3G 4BY7H 2N49A 4HJ5A 2IY5B 4GN3B 1E1TA 4LFCL
chains in the Genus database with same CATH superfamily
4XQJA 2A73B 2NWGA 1SYEA 2E2HB 5GQOA 1BCPD 1M90C 1VMPA 1Q7YC 1L0XB 2EY1A 4CJ1B 2A68C 3MHBA 3P75A 5BN5A 1SN8A 4LWCA 3TS0A 2UXCQ 3KOJA 4CBVA 5LMUL 3TS2A 1JR0D 1R9TH 1MSHA 2BDNA 1XWEA 3BS1A 2SNMA 1XXGA 5G3LF 4AYBB 4N9TA 3UI2A 1TS2A 1HNWL 1I94Q 3AEVA 3H3VH 1B9MA 2E2DC 2RF4A 4K6LA 1ENCA 2HIVA 3U50C 1I6HB 1F9QA 1X3GA 1AN8A 4IJHA 1LT5D 1G91A 2WB1B 1MJEA 1PTOB 3U9OA 4B3TL 2KUMA 1EIGA 2HQEA 3KJOA 3AYHB 4Y52H 3OHXC 4KI0A 3HGBA 2HHHL 3P1HA 1CHQD 2VQFL 5E4XA 3J81c 1IZ6A 3NTKA 5JJIA 2MHVA 4KKSA 1PH3A 5IE8A 1ONLA 3G7LA 3QOLA 2CQOA 2D9UA 2JA7G 4IFDJ 1EY6A 4OHJA 4N9PA 1IBMQ 2M2LA 1WCMG 3GTKH 3I91A 1CI3M 3PUZA 2TSSA 4JI0Q 1VQEA 5EBDA 1JOOA 3MAQA 4DV4Q 4CKBA 4OX9Q 5JVG3 3R93A 3CAMA 1H9SB 3P7JA 1HCZA 1QUQA 2F0DA 3SK4A 1E0BA 4C1NK 2OQ0A 5M3FG 3D0FA 1U0LA 2KVMA 5CORA 1DONA 2TMPA 4K5VA 5FLXc 4R4OA 1EYGA 3LGJA 1YVCA 2F0VA 1A8VA 4TRDA 3NPPA 3W1BA 2UUAL 5C44B 4RA8A 4DV3Q 1GKHA 3J7ZC 1G8ZD 4GNXC 4A3MB 2PW7A 1I94L 5C4XG 1SNDA 3DWQA 4HAEA 5IT9c 3GTJB 4OO1G 3PUXA 2AQ2B 1XPRA 3MEHA 1ASZA 1BBWA 2EYHA 3S16H 1QCBD 1VDZA 2YU9H 1F2YA 1Y8NB 5ELNA 1PMRA 1J5EQ 1J9OA 2JA6H 3ICEA 2OXPA 5M3MH 2EPBA 2H5XA 4EGVA 2K50A 4CDEC 4JI4Q 2HIXA 3OSOA 2IX1A 1QUQB 2WAQE 3SK8A 5CC4A 4FP5D 2E2IB 1FNWA 4B08A 2NVXH 3R2IA 1IBML 1GUSA 1JC7A 3HKSA 4JI0L 4BS9A 3I4NH 4CJ2C 1S4ZA 3KYHC 3CF5A 4DV4L 4OX9L 1CKNA 4DR5L 1C9OA 2R7ZB 1K83B 2D0PA 5IP9G 1YJ9A 3CW2C 1TWFB 3CC4A 4L5RC 2Q2TA 3QJYA 1O7IA 1TS5A 2K5HA 4FDBA 5EBCA 4JI7Q 3HOXG 1LO5D 5KIXA 2B63H 2A1AA 2A69C 4FXGC 4KN4C 2Y0SE 1QE6A 4IURA 2IW3A 3SR1A 1SDFA 2K28A 4C2MH 2A5HA 2AWOA 3PF4A 2IL8A 1D2BA 1LABA 4DXFA 4A3EG 4GS3A 1IYVA 4KJNA 4QUFA 2ZM6Q 1YNXA 1JICA 2F0LA 3HZXA 3S9WA 1O80A 1MKHA 4G57A 2F0PA 5C0XJ 3CU7A 3LWEA 2XNAC 5I4DA 5C3XA 4C3IG 3CXCA 3K57A 4R1JA 1C0AA 3AB9A 1PH7A 1WD1A 1A0IA 1CKNB 1CZGA 3E3XA 3UE1A 5JJLA 3BG3A 4KD4A 3T4AC 5KYLA 1JJ2A 2A19A 1SMYC 4DFAA 1YJNA 5C4ZA 1PTOF 1ZXTA 5FO8B 2JN4A 2MPMA 4DUZQ 1QZGA 2EVBA 4DR3L 3RZDB 1S40A 4P2CB 2F3IA 4LFAL 1UEAB 3F1ZA 4HCSA 1TU2B 4BBRG 2B2VA 2EQSA 1ESFA 2PNRC 3ULLA 3NBHB 5JPNC 5IYCH 5LMNL 1QJOA 2KHIA 1HTPA 5ELOA 3PO3H 1HR0W 4PZ6A 2AKWB 4G7ZC 4UDUC 4ULLA 1VQBA 3SE0A 2ZM6L 1JB7A 1K28A 3DWPA 3FPPA 4HR7B 4OXPA 5IYBG 4RWSC 4BY7G 2N3SA 5LHY1 3VA5A 3I73A 1G291 1SNQA 2B3GA 2B2UA 3HOUB 2KECA 4LUVA 4L6TB 1SFOH 4FXDA 2EZVA 2OTJA 3SVMA 4IUPA 1CA5A 5EPJA 2OCEA 1HFGA 1B4OA 3OTOQ 1Y1WG 2K33A 4JOIA 4K6DA 1EOVA 1RL2A 4WFN3 2BDOA 1A2TA 4JVZA 1IW7C 4OO1I 1GOZA 5KYIA 1N33L 2KEDA 4PMBA 4JI6L 3HKZG 1I50B 1Q1EA 2E2JH 2SNSA 1X3PA 1VQNA 2JA7H 3L0OA 2JJQA 3NTHA 1CHPD 2AHOB 4QF4A 2DJFC 1HXYD 3NEMA 3HOZG 1A15A 3CHBD 2OT2A 1C8CA 4RKBA 2LS01 1RTOA 4CKCA 4DU9A 3FMCA 3C1EA 4RMFA 3SGIA 5C4JB 2NVYH 3A55A 4A3DG 2JA8G 1YNND 5KNDA 4DUYQ 4ZQ3A 3T1HL 3CMAA 5HGQA 1HPCA 3ND8A 3F2DA 3M4OB 1UNSA 4PV1C 1KQSA 1VQHA 1JJGA 4CDCC 2KCMA 1PRTC 4DV2Q 3GTQH 1GUGA 1TWGH 2XTIA 1SROA 3KFUA 4OO1H 3W5OA 1BVSA 4B3ML 1YIJA 1EU4A 3T53B 2EJMA 2N8NA 4LUZA 3PIO3 4K0KL 1EYDA 3OTOL 1PV4A 1IL2A 2NVQH 2R93B 3GTOB 3H0GH 1I4QA 4X3SA 4GOPA 1TKWB 2HDMA 1PH5A 1MHWC 1JJCB 3VR2A 2RSNA 3NWSA 1VQLA 1B50A 2EYJA 1G51A 1RD9D 5T1IA 3EJIA 1EIHA 1V1QA 1T5EA 2B2VC 2ICIA 2WV6D 2WKDA 3OIQA 3TBIB 2IT1A 4L8JA 1UE5A 5E4WC 3BVGA 4AQYQ 5M5WB 1G2TA 3TDQA 2L5TA 5IGFA 1L1OA 3AMUA 3TZDA 3WWVA 2PZTA 5IP9H 4DR4L 2UXBQ 1UAPA 4X62Q 3KLRA 3DMUA 5CV9A 4DAPA 4K14A 4X64Q 2F3VA 3HOXH 2NB0A 1TWAH 3VYSA 1ESRA 4HSPA 2KHJA 5AJ3L 4DV0Q 2CQAA 1QVGA 4LMQD 1TWHB 5JVH3 3CC7A 3KK7A 1F9SA 1K3BC 5COYA 5DNFA 2B2UC 3BZCA 3S14B 2R92G 3HOVH 4FF4A 2QW7A 4TKOB 4R4IA 3TQYA 4LF8L 1I4GA 4A3IB 3RLNA 5CYUA 3W2DA 1AE2A 4KK7A 4DR7Q 4A3LG 3IAYA 3DUZA 4L5TA 4JOIC 1NJIC 3HOYG 4DV5Q 1L1OB 4R4QA 3CCRA 5C6AA 2A6HD 4LF7Q 1I4HA 4IFDG 3NXWA 1BNZA 1HNZQ 4F88A 4HIOA 4C3JG 1U4RA 4XYOA 1Z7TA 4ZUIA 2SEBD 4AQYL 1OTCA 1Q8IA 1BCPB 1GHKA 3J80i 2QEXA 1CKOA 4C3HB 3A5UA 4BBRH 1HQRD 4V190 2UXBL 2MJ8A 4X62L 3A8IE 1N36L 1S5ED 3NHHA 2MQHA 4MN3A 1KNEA 4NMZA 3SK5A 1STBA 4H7BA 4JI1Q 4HEDA 2QDBA 5IGCA 2NN6G 1PZJD 1QNUA 4KKTA 1AZQA 1STYA 2EE1A 3Q23A 1NY4A 1WD0A 4B3RQ 3A54A 2XVSA 1SYFA 4A93B 2BA1A 2PQAA 2RVLA 4QCLA 4G7OC 2E8GA 4ZLTF 5KEEA 2WAQB 3KF6A 1TS3A 1WTRA 4QY7A 1CSQA 1FJGQ 4BY7H 3OMCA 4LFCL 1IYJB 2BE5C 1EIFA 1B2TA 2KCNA 5CV7A 3G4SA 4QIWE 3EFXD 1EWCA 2PI2E 1QWYA 2B2WA 4FNFA 4DV5L 4GOPC 4ZRZA 3BZKA 2CVRA 3M3YB 1CSPA 3IFTA 4N8X1 3F2UA 1K3RA 3IFDA 2BH2A 3AFPA 2Y0SB 3VYTA 4POGA 4RGMA 4IO9A 1J8IA 2Z0SA 3S1QB 3Q6SA 3D4DA 1DXMA 1L2FA 4KJOA 4Y7NB 1BUVT 2PQAB 3Q24A 2F03A 4JI5Q 1PFNA 1D8LA 5EAYA 2K4KA 4ZUJA 1L1OC 3KF6B 4POFA 3QIAA 1WTXA 4MTNA 3HOZH 5D3IB 5FO9B 2EYLA 4YHHL 4JI1L 2ATWA 1D5ZC 3RR5A 3QR8A 2EY6A 1OXSC 3NSWA 2WB1G 5IGDA 1PH4A 1STHA 5K5PA 1BCPC 3TP8A 3OMGA 1XMQQ 1DOLA 4A3DH 3NENA 3URYA 2JA8H 3TREA 3R3OA 1EQVA 3MZ5A 1PH2A 4A3GB 4DK3C 3PV0A 4F87A 3TRZA 4YWMA 1HZAA 3IKJA 1RKNA 3L3OC 4LFBQ 4DN4M 5JEAH 1EYCA 1B9NA 4PMWA 3S1NH 3A0JA 2ENBA 5EKKA 1IKMA 5GAHC 2R7DA 1SNOA 1NBWA 1R9TB 4LF5Q 4FF1A 3UE0A 1JWSD 3S17H 4RHSA 3KLSX 3CCQA 1AW7A 4IPDA 4DNRB 2C5CA 5FLMH 5A2QL 1EY9A 4JI5L 1XNQQ 5FJ8H 1KHIA 2LKVA 1UEBA 4RCNA 1PFMA 2F0IA 1YI2A 1Q8KA 3JC66 1CA6A 1HA5A 3M9BA 5BN4A 5IYDH 1HNXQ 1BCPF 3FVQA 3KBGA 4PZ7A 4IFDI 1I4XA 1FGBD 5JEAJ 1XMQL 3VYUA 4OGQC 4EQPA 1Q12A 2DJGC 5L37A 1PH9A 1LTAD 3GTKB 3R2TA 3J81i 1N9WA 4M8AA 1HR0Q 2FFKB 1L0YB 3K5MA 1KDCA 4XYQA 2SDFA 1QOHA 4JBMA 5FK9C 3K58A 1I3QB 1LT4D 3V2TA 1EWIA 3GD7A 2R7FA 2O5IC 2KHSA 4M1UB 1GUNA 1YNJD 1LV9A 1KNAA 2B2WC 4KY5A 2NN6I 4BA1I 2R7ZG 1XMOL 1VQ4A 1IXRA 4DV6Q 3VR5A 3S2DH 3WOEA 5CV8A 2R3ZA 4A3LH 3W1GA 4GN4B 2SOBA 3CCUA 4A75A 4ZKBB 3GTPH 3IL8A 1XYIA 3BDCA 1H9SA 3W3AA 4HJ8A 1K0SA 4QMGA 4MHEA 3FDTA 2HT1A 3PGZA 4BWGB 4WJ3M 2B2TA 1N32Q 3RLOA 3S16B 3PUYA 2YU9B 1K8OA 1SSOA 4ZKCB 1E2WA 1JQYD 2JA6B 1ZYRD 2PW5A 1W6KA 3STBD 1H9MA 3GTGH 4LUOA 4A3BH 1A3TA 2ZTDA 3R8BA 2RDFA 5M3MB 2PPBC 4B9WA 2I46A 1A63A 1TY0A 3L7ZC 4DF7A 5ELBA 1SR3A 3QB3A 1WYDA 2NVXB 1TT2A 2WINB 3H09A 2EYPA 2HCIA 2Q8TA 3I4NB 4DK6C 2CWPA 4TVAB 2NN6H 1AH9A 3Q22A 2B29A 2H1EA 2F0KA 2MO0A 3DEPA 4NDXA 4BY1G 4CKEA 2XWBB 1X54A 2L12A 3HFZB 3G71A 3NBIA 2A6ED 4UP7A 3M4QA 2UXCL 2K5NA 5ELCA 4A3FH 2RHQB 3GV3A 2KA7A 1E3PA 2ZXRA 2VQEQ 1BDOA 1U4LA 5DAUA 3S1MH 1O7YA 4RCOA 2EYFA 5C0XI 3HKZE 2K75A 1EFWA 3S15H 5F2DA 3J7YW 3BJUA 3PO2B 2PO4A 4JG2A 1EEID 2ZJQA 4UY8C 2ID0A 2IWHA 3TP6A 3I56A 2EOTA 5D65A 4J6HA 3ULJA 5HGTA 4HIKA 4HJ7A 1EZ6A 5BR8Q 2KQ3A 1N8RC 3HOUG 3C1FA 4RFBA 3V05A 1LTRD 1JT8A 3K81C 2L55A 4DPGA 5KNBA 4BBSB 1A6XA 1FYCA 1HFNA 4FO2A 1I6HH 1O7ZA 1K8AC 2O4XA 1PTOC 3UDIA 3RNUA 1VQIA 2NTTA 1CK1A 3I3CA 5H1SE 1ILPA 4ABNA 2X6GA 4JK1C 3X3MA 2B8GA 5NUCA 3TP5A 1KRSA 2FINB 4ALPA 2F0NA 4NPSA 1JOKA 3PO3B 4LAAA 3VA7A 2JA5H 1JCKB 3SEBA 4U68A 4KN7C 2RCNA 3I4MH 4X3UA 5M5XB 3WOFA 1XTDA 4DV3L 1BO0A 2JP1A 1H9RA 2E74C 3GTLH 1PYWD 3NBHA 4A3JG 4A3CG 2EY2A 4C56C 5I9PA 3JAME 2B2TC 4IN3A 3F2BA 1RODA 2ALYB 4A4IA 4NXMQ 1SFOB 5C3EH 4CJ0B 2EYOA 1J5EL 1A2UA 1W6JA 1JE5A 1BKBA 2K1BA 3PMFA 5BR8L 4QGUA 3ZJYC 5EKIA 4JI4L 4P72A 2AQ1B 1KDAA 1QB5D 4IZ8A 5C5MA 5CBAE 3G6EA 1YITA 1IHZA 1GD7A 4EX5A 4QIWB 1SNCA 2K03A 4DV1Q 2Z6KA 2IPKD 2R93G 5J39A 3K5NA 2E2JB 4DXGA 1YNNC 1G6ZA 2JA7B 1EEFD 2F0JA 4QJFA 3EIVA 3AFQA 1M4VA 3RLFA 1B53A 1IBLQ 2LXKA 1B70B 4JI7L 3FKIG 1XJVA 1VQGA 4LF9Q 1S5FD 1Z9FA 2HUGA 1TWCB 3E0JA 1VQPA 2NVYB 2ZXOA 1NMGA 3I4OA 2AUKA 1Q1BA 3S1RH 4RHRA 1B3AA 1EU3A 3CRKC 2KOLA 1I5FA 3GTQB 4GKKQ 1CT1D 1KXLA 4NXML 3NQIA 1TWGB 5DM73 2OTLA 4IUVA 2I07B 3MXPA 2EXDA 1D7QA 1VQCA 4OWTB 1C7YA 2KJXA 4KMUC 4DR6Q 3TMEA 3I90A 2NVQB 3ER0A 1ML0D 3H0GB 1YBYA 3C46A 1S5DD 1X3QA 1X6OA 1KD1C 1CKMA 3VR3A 3D6WA 4DUZL 1C4QA 4DV1L 4HTHA 2N88A 4L5QA 4AIMA 4A3IG 1Y8OB 4K8JA 1X55A 1LACA 4OWXB 5HY6A 2M00A 4OL7A 1HUNA 3OWEB 1IBLL 1HQMC 2VUMG 2PCFB 1WCMH 3MXUA 5FLXL 1KL9A 1AZPA 2L0CA 2F3WA 4LF9L 5IP7G 1EOTA 1U9RA 3GP7A 2F0FA 4JC0A 4DR1Q 4BY1H 3HOWG 4OONA 2M9VA 1VQ6A 1PFSA 1KAAA 1V1PB 4C3HG 1B8AA 5M3FH 1TWAB 3J7AV 1TS4A 2QGQA 4CDDC 2D62A 1AP0A 1EQTA 4BA2I 1O78A 2EIFA 1SAPA 1VF7A 2MNAA 4GKKL 2MP1A 3KLSA 4A3KB 4DA2A 1EY4A 2A6HC 4GN3B 1E1TA 2Q2UA 5C4XH 2UUCQ 3HOVB 1HJPA 4A93G 1VQFA 5EPLA 1WTQA 5E1FA 1ET6A 5TSSA 1SYCA 3A56A 4H0LC 1A62A 2PNHA 3T1YQ 3A8KE 2WB1E 3RZOH 3G6JB 1OXTA 1HRJA 1DYQA 3L9AX 3D31A 5AFWA 1RCVD 1A3UA 3ND9A 4P71A 1PVOA 1TXYA 2FMCA 2Z6KC 5D3DA 1EYAA 1H9JA 4XT1B 3UDXA 2MFIA 2IX3A 5JAVA 3S2HH 3PIOA 3JAMc 2CH4W 4UPAA 2A74C 4I7AA 3CC2A 1G6PA 2Y0SG 3G48A 4DR1L 1HZ9A 1ILQA 2XRQD 4LNQA 3SK6A 4JBJA 2LFNA 1VQ7A 1PH6A 3HEJA 3CPFA 3C2PA 4P75A 4DUYL 1Q86C 1E2VA 2QEJC 3OOCA 3ERSX 4ME3A 4QUCA 1SE4A 3VR6A 3OWFA 3I72A 4DV2L 4A3EH 3NWTA 4RGTA 3CP0A 5CV6A 1CUKA 4O0AA 4CDFC 1PYSB 2F0OA 2UUCL 5DM63 3GDEA 2D5DA 1LTBD 1Y1VG 3CRLC 2N78A 5FKAC 3D8GA 3RD4A 3DM3A 1RJTA 4A3JH 1FGUA 4DR2Q 3QWNA 5IGBA 1D5XC 3PUWA 4C3IH 3T1YL 4ZCKA 5GADC 2IX0A 2Q8RE 4WRDA 5LMNW 2NTSA 5C4HA 2FHTA 3OYYA 1STAA 3EA6A 5DEHA 1U4MA 1P8LA 1U4PA 1JE4A 2CHBD 2KBNA 4FYDA 1X3EA 2DN8A 1AFPA 3MEFA 2K05A 2QA4A 1Q46A 2FJ2A 1VQDA 1MJCA 1GM5A 2ASBA 3OIPA 3SDZA 4ZAIA 4DV7Q 2H4OA 2XWJB 4JI3Q 2VZAA 4IOAA 1BXTA 4X64L 4WJWA 2LXJA 4PQXA 1BBUA 5D14A 3FKIH 1STNA 2PMZE 1JORA 4DV0L 1XX8A 4GKJQ 5JJKA 1I4PA 4K5WA 3BYTB 3D4WA 4XTCS 1GO3E 2JA8B 1JOQA 3NQTA 2YTYA 1NMFA 3FRPB 4YY3Q 3DHQA 5KGUA 3FHWA 5IYBH 3ZYYX 3MXNA 1R4PB 2IHEA 1EZ8A 5EJWA 1EY0A 3OW7A 3CCLA 3CCEA 4DR2L 1IBKQ 3S1NB 4IUNA 2AQ3B 4DR7L 2JQOA 3PF5A 3ERQA 1EFID 1X56A 2BCOA 4BXXG 5CR3A 1NSNS 3T13A 3CQZH 1B3QA 1T5XD 4LF7L 3KJPA 1UE7A 1HNZL 5EKLA 3P20A 4OELB 1Y1WH 3S17B 1FD7D 1F2MA 4IUUA 3X3NA 2ZXPA 3QO2A 1EWHA 2AUJD 5I9OA 2R61A 1GJXA 2KENA 1LLRD 2OEOA 3PSIA 5ISRA 1X3FA 4YCWA 2KEEA 1D5MC 1FL0A 4KY7A 3A7AB 4DV7L 2NBFA 2CFMA 3K7UC 5I6WA 1ASYA 4AYBG 2VUMH 1NCVA 1WTOA 4ILWA 3MXNB 2PZUA 3I70A 2ZT9C 4GKJL 5IP7H 5M5YB 2NVTH 3O13A 4B3RL 3HOWH 1YNJC 5E7NA 2I5HA 2Z9HA 2JA6G 1ZEQX 1II3A 1H9KA 4JYAQ 3MA2B 4C3HH 4NW2A 2DNEA 4RAUC 3S24A 4X6AH 2K14A 5C0XG 1FJGL 5J22A 4TSSA 3M4PA 1B44D 3OW2A 1RIPA 2CCZA 1VCIA 3K59A 2F1MA 4B3SQ 4JV5Q 1E1OA 4A93H 1EUJA 4C1NI 1SE3A 1GUTA 2ZTEA 5BN3A 3S2DB 1TQOA 3I7FA 1Z47A 3K5OA 3K7AH 1ZYRC 2K5DA 1WJJA 3STBC 3Q0AA 3DWAA 4NB3A 5J3BA 2ZJRA 2XRSD 3GTMH 1FVIA 2YYZA 4O2DA 4ZK9B 3CCVA 1MGSA 4MIUA 1VF5C 2CW0D 1K8MA 5EQ0A 5CBEE 2RHSB 4J15A 4DAMA 4HN7A 4RG1A 2WP8J 1RDPD 4DAYB 5C44G 1VQMA 3E9HA 2K01A 1NAPA 4IJLA 1LTSD 4A3MG 3PO2G 1AEXA 4G4KA 4H44C 3FP9A 1SJED 4JPBW 1UE1A 3ITPA 3H91A 5CMDA 4A3BB 3C3LA 1SYDA 1DM0B 2Q2HA 4JCVE 4NP5A 2L4NA 4FF3A 2A6EC 5ELDA 4X3KA 3F8TA 4APVA 4Y7NH 2L11A 5IIFA 5IGGA 2MGSA 2G5DA 1DGSA 1PDQA 2HCCA 1IL8A 5JJZA 3Q8DA 4LFBL 1DZ1A 1WI5A 2L1BA 4B3TQ 2ICEC 4BBSG 2F0GA 3H3VI 3F2CA 1R4QB 4XIGS 4B3SL 3MTSA 3KBXA 2HHHQ 4JV5L 1WOCA 1Y1VH 4ID6A 4A3FB 2VQFQ 2R92H 1CQVA 1MI2A 1OXVA 3T51B 3T16A 2XIWA 1C48A 4LF5L 2EXZA 3S1MB 2GN5A 4JI2Q 1N34Q 1T9HA 5IYCG 3S15B 3BDOA 1BOSA 4GNXB 3LX0A 3HOYH 1IKLA 4XQQA 1SE2A 1F9RA 1O7LA 4KD3A 1XNQL 4IFDH 1WTPA 1VQ8A 3KF8B 1QVFA 4C3JH 2J4XA 2GVBA 5IWAQ 2V1CC 1VQ9A 4FF2A 4DK0A 1HNXL 3PUVA 1CM9A 3E5SA 2UUAQ 2EJFC 1G2SA 1K0RA 3RN5A 4LF4Q 3H3VC 2VS1A 1M1KC 4UP8A 4DKAC 4H13C 1S3OA 1ENAA 3IRBA 2VXWA 2QF7A 5C5LA 1QG7A 4K5XA 1HR0L 1B7YB 1D6EC 1KLUD 3NP8A 1DJRD 2BA0A 1UWVA 3DXJC 1BF4A 1E24A 2QCPX 2WIIB 2Z6BA 2RBMA 3U4ZA 1MD2D 2D2CC 4GN5A 2I5LX 4AH6A 1PZKD 2B63B 1E7ZA 2JA5B 2PQEA 4C2MB 4DV6L 5J1ZA 5G3LD 3J80L 4HJAA 2VW9A 3TEHB 2BOSA 2PYKA 1CQFA 3EVQA 4A76A 1WTVA 4JI2L 1N34L 4CHTB 3I4MB 1EL0A 5KNCA 4E6IA 2EY5A 1V9PA 4BXXH 3ONAB 4DR5Q 2B2YC 3GTLB 1MIUA 4PNYA 1K73C 2CH4A 1I3QH 1AE3A 3NUCA 4UP9A 1N32L 1WTWA 2E2HH 5IWAL 4UAIA 5C3EB 3H15A 4I7ZC 1TVXA 1SYGA 1ENFA 3HP3A 1ET9A 1SNPA 4IPGA 1W2BA 1LUZA 4LF4L 4NXNQ 1HZBA 5T1GA 3H94A 2RDGA 2NYZD 2O5JC 3EBEA 4YIJA 4K2LA 1UUPA 2JK8A 2F0TA 4X3TA 2N55A 2LMCB 2QILA 2A68D 4MZ9A 1P16A 3CCJA 2G9HD 3H0GG 3U9SA 1H95A 4ZYSA 4EQNA 1PTOH 2UUBQ 3GQBA 2VL6A 2MUYA 4RH6A 2JE6I 2ZJPA 1ZKOA 5C0XH 2FMMA 2OQKA 2JXMB 2X69A 3CCMA 1SNMA 2BH8A 3KLWA 4LJZC 1KDBA 1Q90A 2F4VQ 2K5VA 2O2LD 2C35B 2PI2A 4R4TA 3K6OA 1MBYA 2VQEL 4DR3Q 1OXUA 1TIID 4OEMB 1ICWA 1PLFA 4GLVB 4LW1A 4LFAQ 2F52A 1D1KA 4RGNA 2LY7A 3S1RB 1K8GA 4QQBX 1EY7A 4IUQA 4HIDA 1PXUA 2IJ0A 2PMZB 2RCFA 4HJ5A 2IY5B 2EYMA 2J7ZA 1X32A 2GA4B 1YJWA 5LMNQ 4GLXA 1TY2A 1JMCA 3K0YA 1I6VC 4R4CA 4MNOA 4A3KG 2JEAI 5C44H 4NXNL 4YWLA 1SRUA 4F7XA 4WORA 4A3MH 3PO2H 3HOVG 2Z4HA 2AMCB 2F0EA 3GTJH 2VB2X 4H02A 1FNVA 3M85A 2UUBL 5A2QE 3A8JE 4G7HC 1HA6A 3B6YA 2DUDA 1HH2P 1IYUA 2RDHA 4XXEA 3VDYA 4DK1A 1WCMB 4P73A 1PH8A 1CZWA 2RQXA 1LT6D 2DY7A 2F4VL 3E9IA 3GV6A 4KHZA 1UE6A 1OO9B 4BY1B 2E2IH 5M9OA 4BBSH 3M4YA 4V0BA 2E5LQ 1FNUA 5C3WA 5M3FB 1N33Q 2RA4A 2VY3A 4JI6Q 5GAGC 2Z8LA 4J8QA 4K2KA 2D0OA 5FOBB 3TP7A 1Q82C 1K83H 2R7ZH 1OXXK 3DLLA 1F9PA 2IHFA 2E75C 1TWFH 4DAVA 2VNUD 4Z9CB 1DD2A 4P74A 1PRTB 3CKIB 1LTTD 1L0WA 4KTAA 3BDLA 4LK1C 4Q0FA 5C4XB 1QVCA 1STGA 1V1PA 2B39A 4EQ5A 2C9OA 4GLAC 1PTOD 1VQJA 3PIP3 5M5XH 3LNNA 2K04A 3J81L 2GVAA 3SXHA 3T1HQ 1DOKA 4JI8Q 3RZOB 3WDNA 1GXDC 5K36G 3UDGA 4JW0A 1S5CD 3MVVA 4QB4A 1DCZA 2A69D 3MFGA 4R8IA 4S3SA 1RHPA 2R6GA 1YZ6A 2B8FA 4X65Q 5LL6S 4B3MQ 3S2HB 1J6QA 1KC8C 1RF2D 1PA6A 4I65A 3PIPA 4K0KQ 4O42A 1SLJA 5FO7B 3BZDB 1LTGD 3MWYW 3J81j 4DNTB 3K80C 1BR9A 2E5LL 2K5QA 3JAMi 4YCVA 5DLQE 3RZDH 1EQRA 1E22A 3HOXB 5IT9L 1EQQA 4NKLA 3H6MA 1LM0A 3CPWA 2WACA 2LSSA 2V4DA 2K52A 4A3EB 1SMYD 4R8NA 2KCCA 5LL6X 3GO5A 2I5MX 1TWCH 4DR6L 4KHPQ 3SHLA 4A3JB 4DR4Q 4AYBE 4WJ4A 1B1ZA 3A74A 4IPCA 1SXTA 4C3IB 5EPKA 4HCEA 3J80E 1Y8PB 3PQIA 2VB3X 2PZWA 2WAQG 5I2YA 4JI8L 3OPOA 5AJ3Q 1XPOA 3RUZA 3TSSA 5JEAG 1Y14B 4UHVA 2L9HA 4QL5A 3HOUH 5HURA 2I0QA 1SYBA 1JB3A 5E3FA 4X65L 1V8QA 3D4RA 3D6CA 5CV5A 5IGEA 2ZTCA 5CV4A 4LF8Q 1F77A 4BBRB 3K5LA 1I4RA 4HSVA 1PZID 4X66Q 2AWNA 1YHBA 5FLMG 1QNKA 1NUCA 3FKIB 3VYRA 5IOCA 5FJ8G 4PG3A 1I50H 4KHVA 2QKIC 3LWUA 1VQAA 2K6AA 1QILA 4RKLA 5IYDG 1GHJA 3FEWX 1BBXC 1KTKA 1S72A 4FXKC 2OWOA 1PYBA 2P5ZX 5I6YA 3BVMA 4BY7B 4KHPL 1SMXA 1IW7D 3BU2A 3N6RA 4IALA 1N36Q 3N52A 4IUTA 5C4JH 4A3CH 1GUWA 4KKUA 1PFBA 1VS0A 1PRTF 1HHVA 2NUCA 4A3GG 3M4OH 4GOPB 3KUPA 3CQZB 1WFQA 1MSGA 4A3KH 1KAWA 1Y1WB 3TZUA 1SE8A 4HMJA 3CCSA 2G9DA 2XSCA 1S5BD 3A7LA 5ELEA 1EY8A 5IODA 3I8ZA 4IQZA 4LFCQ 1TR5A 2X6LA 4HMIA 4KV6A 1VQKA 2R93H 4X66L 3HKZB 3GTOH 2JA9A 1WVLA 1E2ZA 1KABA 1Z6HA 4JBWA 4JBKA 1EIYB 1YHQA 1LTID 1PRTD 3NE5B 2VUMB 3M7GA 2MO1A 3HOZB 3ULPA 1VMCA 1Q3LA 1EY5A 5CGKA 3I2ZA 2NVTB 2Q2IA 1HUMA 4LF6Q 3NELA 3HOWB 1CFMA 1LYLA 1SJHD 4RGOS 5ELFA 1PH1A 4A3DB 5M5WH 4A3BG 1NTGA 3UDFA 5JOBA 4HIMA 1XPUA 1F2ZA 1YHAA 4YHHQ 2A8VA 2CW0C 2DY8A 5A35A 1YEZA 4J1MA 1XNRQ 5GROA 1GVPA 3D3RA 1TWHH 2F0UA 5EGTA 4N8FA 3K7AB 1ICFB 3HS0C 1HTLD 3MFYA 4XQNA 3J7AF 2FXQA 3S14H 3GTMB 4B9XA 4OWWB 4A3FG 4IPHA 2YV5A 1SEBD 5K36H 4TQUS 1VQOA 1RTNA 4A3IH 3RMHA 3VR4A 2HQLA 4HJ9A 4F8MA 1M8AA 3J81E 5IY0A 4IOCA 4Q5VA 2KCTA 2Z4IA 4JI3L 2HDLA 4OIKA 3BYYB 2RSOA 4EVOA 4EQOA 4R9WA 3I4LA 3J80c 4FVMA 1U5KA 1JWMD 4LF6L 2ES2A 4YCUA 5GAEC 1WTHA 2XN9C 3NTIA 4L63B 3U4VA 2RKSA 3QG1A 1Y69U 4KLKA 2NZHA 3EN2A 2JEBI 2F0HA 4DAYA 2HD3A 3I55A 4ME5A 5M3MG 1LTLA 4YY3L 2CKZB 1QZHA 2DGYA 2XGTA 1DOMA 3BVZA 5FLXE 1LT3D 3HG9A 4K8IA 1IBKL 4DGZA 3T56B 3AU7A 3DEOA 5I2XA 1F2LA 3RN2A 4XT3B 3I4NG 1NNXA 1XNRL 4PMCA 2CWAA 2UU9Q 1Y1VB 2UXDQ 4DNIA 2R92B 2NZOA 3KDFA 2NZ1D 2WKCA 2EJGC 2WFWA 4PZ8A 4KY6A 5IT9E 1FR3A 2F0WA 3TN2A 1Q81C 3E6ZX 1BQQT 4MTKA 1X65A 2F0MA 2B2YA 2B63G 3GTPB 3HOYB 3JAML 2JA5G 1VQ5A 3PCOB 2DNCA 1GUOA 1A3VA 3MC0B 3I4MG 2E76C 2Z1CA 1PHJA 4C3JB 3L2PA 2K32A 4YWKA 1STEA 2F0QA 3E0EA 3M3YH 3U58A 1XMOQ 2JSOA 2YTXA 5LMUQ 4CGYB 3GTGB 4GNXA 3K0XA 3K8AA 2BE5D 1HZCA 2F4IA 5C3EG 2YTVA 2K5WA 1KLGD 2K7VA 1NE3A 3AQQA 4OIJA 3S1QH 1HNWQ 4JYAL 3KF8A 3EROA 3KDFB 3DM1A 2JYOA 4XDXA 3CMEA 1W3SA 2QDLA 4ODGA 3EQLC 3V96A 2Q8IB 1XTCD 2J0TD 1X9NA 3QOJA 2UU9L 3CD6A 2OF1A 2UXDL 1NR2A 3HRZC 2L15A 1NR4A 5M5YH 1JWUD 1D1IA 1KRTA 4O1NA 4L5SA 2F0SA 1V1OA 3A5ZB 5KRUA 1K9MC 4GZYC 3J7A5 3FPUB 4A3GH 1V43A 1KIXA 3M7NA 2EDGA 1CTMA 4U673 3PO3G 1SBBB 2N49A 3MXGA 5JPMC 3NK9A
chains in the Genus database with same CATH topology
1IYJB 2Q2UA 5C4XH 2UUCQ 1EIFA 1HJPA 1YJWA 5LMNQ 5GQOA 3G4SA 4GLXA 4A93G 1M90C 4QIWE 1VQFA 1JMCA 1Q7YC 4R4CA 3TS0A 1SN8A 2PI2E 4LWCA 4MNOA 3KOJA 2UXCQ 5LMUL 3TS2A 4DV5L 1A62A 2PNHA 4GOPC 3T1YQ 4A3KG 3BZKA 2JEAI 5C44H 4NXNL 4YWLA 1SRUA 1R9TH 1CSPA 2WB1E 3RZOH 1OXTA 4A3MH 3PO2H 1K3RA 3HOVG 2BH2A 2AMCB 3AFPA 3D31A 3GTJH 4POGA 4P71A 1PVOA 4IO9A 1TXYA 2Z6KC 1HNWL 4H02A 1I94Q 3AEVA 3H3VH 2RF4A 3M85A 2Z0SA 3UDXA 2HIVA 3U50C 2UUBL 2MFIA 1X3GA 1L2FA 4IJHA 3S2HH 3B6YA 2PQAB 2DUDA 1HH2P 3PIOA 1MJEA 4JI5Q 1D8LA 3VDYA 3JAMc 4UPAA 5EAYA 2K4KA 3CC2A 4P73A 1PH8A 4B3TL 1G6PA 1L1OC 3KF6B 2Y0SG 4POFA 3KJOA 3G48A 3AYHB 4DR1L 4Y52H 4KI0A 1HZ9A 4MTNA 3HOZH 2F4VL 3E9IA 2HHHL 4LNQA 4KHZA 1UE6A 4JBJA 4YHHL 1VQ7A 4JI1L 2VQFL 1PH6A 2E2IH 3J81c 1IZ6A 2ATWA 5JJIA 4BBSH 3CPFA 3RR5A 4P75A 4DUYL 1Q86C 5IE8A 1OXSC 1PH3A 2CQOA 2WB1G 1PH4A 2E5LQ 2JA7G 4IFDJ 1XMQQ 1IBMQ 3ERSX 1N33Q 1WCMG 4ME3A 3NENA 2VY3A 4JI6Q 5GAGC 3GTKH 4A3DH 2JA8H 3TREA 2D0OA 3PUZA 4JI0Q 1Q82C 1K83H 1VQEA 2R7ZH 1OXXK 3DLLA 1PH2A 4A3EH 4DK3C 3PV0A 4DV2L 4DV4Q 4OX9Q 2IHFA 3CP0A 1TWFH 1CUKA 4O0AA 4YWMA 1PYSB 3TRZA 3CAMA 1HZAA 2VNUD 2UUCL 4P74A 4LFBQ 3GDEA 1L0WA 1QUQA 1Y1VG 4PMWA 3S1NH 2N78A 2OQ0A 3A0JA 5M3FG 3DM3A 4A3JH 3D0FA 1FGUA 1U0LA 1QVCA 4DR2Q 5GAHC 2R7DA 5FLXc 4EQ5A 3PUWA 4C3IH 3T1YL 4GLAC 1VQJA 4R4OA 5M5XH 5GADC 3LGJA 2IX0A 1EYGA 2GVAA 1YVCA 1A8VA 1NBWA 3W1BA 2UUAL 5LMNW 3T1HQ 4DV3Q 4LF5Q 1GKHA 3UE0A 3J7ZC 4JI8Q 4GNXC 3S17H 3OYYA 5C4XG 1I94L 5K36G 3UDGA 5IT9c 1P8LA 3CCQA 4OO1G 3PUXA 1XPRA 4IPDA 1ASZA 5FLMH 2KBNA 2R6GA 1X3EA 1BBWA 1YZ6A 4JI5L 3S16H 3MEFA 1XNQQ 2YU9H 4X65Q 5FJ8H 2QA4A 1Q46A 4B3MQ 1J6QA 1KC8C 1VQDA 1PA6A 1KHIA 1MJCA 1UEBA 5ELNA 3PIPA 1GM5A 1J5EQ 2JA6H 4K0KQ 1SLJA 1YI2A 3ICEA 1Q8KA 3JC66 2ASBA 5M3MH 3M9BA 4DV7Q 5IYDH 2H5XA 2K50A 1HNXQ 4JI4Q 4JI3Q 2VZAA 2HIXA 3J81j 2IX1A 1QUQB 4IOAA 2WAQE 4X64L 4PZ7A 2LXJA 3K80C 1BBUA 4IFDI 2E5LL 5JEAJ 3JAMi 4YCVA 1XMQL 5DLQE 3FKIH 1IBML 2PMZE 1EQRA 3RZDH 2NVXH 4DV0L 1Q12A 4GKJQ 1E22A 5JJKA 3HKSA 1EQQA 1PH9A 4JI0L 3I4NH 3KYHC 3CF5A 4XTCS 4DV4L 4OX9L 1GO3E 1LM0A 1CKNA 4DR5L 1C9OA 3CPWA 2YTYA 3J81i 2LSSA 1N9WA 2K52A 1NMFA 2D0PA 5IP9G 1YJ9A 1HR0Q 3CW2C 4YY3Q 3CC4A 3FHWA 5IYBH 4JBMA 3GO5A 2Q2TA 4L5RC 1O7IA 2IHEA 2I5MX 2K5HA 4FDBA 4JI7Q 3CCLA 3HOXG 3CCEA 4DR2L 1IBKQ 1EWIA 3GD7A 2B63H 1TWCH 2R7FA 4DR6L 2A1AA 4KHPQ 4DR4Q 2Y0SE 4AYBE 4WJ4A 4C2MH 4DR7L 2JQOA 2AWOA 3A74A 3PF5A 4IPCA 3PF4A 2NN6I 4BA1I 2R7ZG 1X56A 1XMOL 1VQ4A 1IXRA 4DV6Q 4BXXG 4A3EG 2WAQG 4GS3A 3S2DH 4JI8L 5AJ3Q 1XPOA 3CQZH 2ZM6Q 1YNXA 4LF7L 3KJPA 4A3LH 1UE7A 3W1GA 4GN4B 1HNZL 5JEAG 3CCUA 1MKHA 1Y14B 4A75A 1Y1WH 3GTPH 4HJ8A 5C0XJ 4QL5A 3HOUH 2HT1A 3PGZA 4WJ3M 2I0QA 3CXCA 4X65L 4R1JA 2KENA 1C0AA 1N32Q 3RLOA 1PH7A 3PSIA 3PUYA 1A0IA 1X3FA 2ZTCA 4YCWA 1CKNB 4LF8Q 1FL0A 4DV7L 3UE1A 2CFMA 3K7UC 1ASYA 3STBD 4X66Q 3GTGH 4AYBG 4LUOA 4A3BH 1JJ2A 2AWNA 2ZTDA 2VUMH 5JJLA 2A19A 1YHBA 3MXNB 1YJNA 5FLMG 1A63A 3L7ZC 4GKJL 1SR3A 1WYDA 5IP7H 4DUZQ 1QZGA 4DR3L 1S40A 2NVTH 5FJ8G 4B3RL 4PG3A 1I50H 3HOWH 2F3IA 4LFAL 3F1ZA 5E7NA 2I5HA 2JA6G 1VQAA 4BBRG 4DK6C 2EQSA 2CWPA 4JYAQ 4TVAB 4C3HH 1AH9A 5IYDG 3S24A 2B29A 2OWOA 2K14A 5C0XG 1S72A 3ULLA 2MO0A 1FJGL 4X6AH 1PYBA 4BY1G 3NBHB 3M4PA 1SMXA 1X54A 5IYCH 4KHPL 5LMNL 3HFZB 2KHIA 3G71A 3OW2A 3BU2A 1N36Q 3PO3H 1RIPA 5ELOA 4UP7A 5C4JH 1HR0W 3M4QA 2CCZA 2K5NA 4A3CH 2UXCL 4A3FH 1VCIA 4PZ6A 2AKWB 2RHQB 4B3SQ 4JV5Q 1VS0A 1E1OA 1E3PA 1VQBA 2ZM6L 4A93H 4A3GG 1EUJA 1JB7A 2VQEQ 3M4OH 2ZTEA 4GOPB 3I7FA 3S1MH 1Z47A 4OXPA 5IYBG 3K7AH 4BY7G 1WFQA 5C0XI 2N3SA 3HKZE 2K75A 1EFWA 1WJJA 3STBC 4A3KH 3S15H 4NB3A 1KAWA 3BJUA 5J3BA 2ZJRA 3GTMH 1G291 1FVIA 2YYZA 2B3GA 4JG2A 1SE8A 4O2DA 3CCSA 3CCVA 2ZJQA 4LUVA 4UY8C 4LFCQ 1SFOH 2ID0A 2RHSB 4J15A 3I56A 4DAMA 2OTJA 4RG1A 2WP8J 5C44G 4DAYB 1VQMA 1VQKA 2R93H 4X66L 3E9HA 2OCEA 3GTOH 2JA9A 4IJLA 3ULJA 1QVFA 3OTOQ 4JBWA 4HIKA 4HJ7A 4A3MG 1Y1WG 1EIYB 4JBKA 3PO2G 3FP9A 4JOIA 5BR8Q 1UE1A 1YHQA 1N8RC 1EOVA 3HOUG 1RL2A 2MO1A 3ULPA 2Q2HA 1JT8A 4OO1I 4JCVE 3K81C 4DPGA 1N33L 3I2ZA 2Q2IA 4JI6L 3HKZG 4LF6Q 1I6HH 3F8TA 3NELA 4APVA 1Q1EA 2E2JH 1LYLA 1K8AC 1PH1A 4Y7NH 1VQNA 2JA7H 3L0OA 2JJQA 3UDIA 3RNUA 2AHOB 5M5WH 1VQIA 4A3BG 1NTGA 5H1SE 1DGSA 3UDFA 3NEMA 3HOZG 3Q8DA 4LFBL 1KRSA 1WI5A 4B3TQ 4ALPA 4BBSG 4HIMA 3H3VI 4NPSA 3F2CA 1XPUA 4RMFA 4XIGS 4B3SL 4JV5L 2HHHQ 2JA5H 3SGIA 1WOCA 2NVYH 4A3DG 1Y1VH 1YHAA 4YHHQ 2A8VA 2VQFQ 2R92H 2JA8G 1OXVA 4DUYQ 1YEZA 2RCNA 1XNRQ 5GROA 3T1HL 3I4MH 3CMAA 1GVPA 1XTDA 4DV3L 4LF5L 1TWHH 5HGQA 3F2DA 2GN5A 4JI2Q 1N34Q 1T9HA 5IYCG 1KQSA 3GTLH 1VQHA 1JJGA 4GNXB 2KCMA 3HOYH 4DV2Q 3GTQH 2FXQA 4A3JG 3S14H 4A3CG 4OWWB 4A3FG 4IPHA 2YV5A 1TWGH 2XTIA 1XNQL 1SROA 4TQUS 3F2BA 1VQ8A 3KFUA 2ALYB 3KF8B 1BVSA 3W5OA 4A4IA 1VQOA 1YIJA 4B3ML 4C3JH 4NXMQ 5C3EH 4A3IH 4LUZA 2N8NA 4K0KL 1J5EL 3OTOL 1PV4A 2GVBA 1JE5A 5IWAQ 1BKBA 2HQLA 1IL2A 4HJ9A 2NVQH 5BR8L 5IY0A 2V1CC 3H0GH 3ZJYC 4QGUA 2KCTA 4IOCA 1HNXL 4JI3L 1VQ9A 4P72A 4GOPA 3PUVA 4JI4L 1PH5A 2UUAQ 1JJCB 3J80c 1K0RA 3G6EA 1GD7A 1U5KA 4EX5A 3RN5A 1YITA 4LF6L 1VQLA 4LF4Q 2ES2A 4YCUA 2VS1A 5GAEC 4DV1Q 2Z6KA 1G51A 4UP8A 1M1KC 4DKAC 1S3OA 2R93G 3U4VA 1V1QA 3IRBA 4KLKA 2NZHA 3EN2A 2JEBI 3I55A 4AQYQ 2IT1A 1HR0L 1UE5A 1LTLA 5M3MG 1B7YB 4QJFA 3EIVA 2CKZB 4YY3L 1QZHA 2DGYA 2XGTA 3AFQA 3RLFA 2BA0A 1UWVA 1IBLQ 2LXKA 1B70B 4JI7L 1L1OA 1E24A 1IBKL 3FKIG 3WWVA 5IP9H 1XJVA 4DR4L 2UXBQ 1VQGA 3U4ZA 4X62Q 4LF9Q 4GN5A 2I5LX 4AH6A 1Z9FA 3RN2A 1E7ZA 3I4NG 4X64Q 1XNRL 1VQPA 2CWAA 3HOXH 4DV6L 2UU9Q 2UXDQ 4DNIA 1TWAH 2NZOA 4HJAA 5AJ3L 2KHJA 2VW9A 4DV0Q 3KDFA 4PZ8A 1NMGA 2WFWA 3TEHB 4A76A 1QVGA 4JI2L 1N34L 3I4OA 3CC7A 1V9PA 4BXXH 1Q1BA 3S1RH 1Q81C 4DR5Q 1MIUA 1K73C 1X65A 2B63G 1I3QH 1I5FA 2JA5G 3BZCA 1VQ5A 4GKKQ 1AE3A 3PCOB 1KXLA 4UP9A 4NXML 1N32L 2R92G 3HOVH 2OTLA 2E2HH 4R4IA 3TQYA 3I4MG 2EXDA 5IWAL 1D7QA 4LF8L 1VQCA 4OWTB 1PHJA 1C7YA 4DR6Q 3H15A 3L2PA 3RLNA 1AE2A 4DR7Q 4YWKA 4A3LG 3ER0A 4L5TA 3E0EA 3M3YH 4JOIC 3U58A 1YBYA 1XMOQ 1NJIC 2YTXA 3HOYG 5LMUQ 4DV5Q 1L1OB 1X6OA 4IPGA 4R4QA 1KD1C 1CKMA 1LUZA 3CCRA 1W2BA 4LF4L 4NXNQ 1HZBA 4DUZL 4LF7Q 4GNXA 4DV1L 3K0XA 1HNZQ 4IFDG 3K8AA 3EBEA 4HIOA 4L5QA 1HZCA 4AIMA 5C3EG 2YTVA 4A3IG 2JK8A 1X55A 3AQQA 1NE3A 3S1QH 4OWXB 5HY6A 4MZ9A 4JYAL 1HNWQ 4AQYL 1OTCA 1P16A 3CCJA 3KDFB 3H0GG 1H95A 3J80i 3CMEA 2UUBQ 2QEXA 1CKOA 3A5UA 1IBLL 2VUMG 1WCMH 2VL6A 1W3SA 4BBRH 1KL9A 2UXBL 4X62L 4LF9L 2JE6I 2ZJPA 1N36L 5IP7G 2OQKA 1X9NA 3CCMA 4JC0A 2BH8A 3KLWA 4DR1Q 2UU9L 4BY1H 3CD6A 2UXDL 2L15A 5M5YH 3HOWG 2MQHA 2F4VQ 4OONA 1VQ6A 2K5VA 1PFSA 2C35B 1KRTA 2PI2A 4R4TA 4JI1Q 4L5SA 2VQEL 1B8AA 2NN6G 5M3FH 4DR3Q 1OXUA 2QGQA 1NY4A 4B3RQ 2D62A 2BA1A 4GLVB 2PQAA 3A5ZB 2F52A 4LW1A 2E8GA 4LFAQ 1K9MC 3J7A5 4BA2I 4A3GH 1V43A 2EIFA 2MNAA 1KIXA 3M7NA 1K8GA 3KF6A 4GKKL 4QQBX 4QY7A 1CSQA 4HIDA 1FJGQ 3PO3G 4BY7H 2N49A 4HJ5A 2IY5B 4GN3B 1E1TA 4LFCL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IYJ B;  2Q2U A;  5C4X H;  2UUC Q;  1EIF A;  1HJP A;  1YJW A;  5LMN Q;  5GQO A;  3G4S A;  4GLX A;  4A93 G;  1M90 C;  4QIW E;  1VQF A;  1JMC A;  1Q7Y C;  4R4C A;  3TS0 A;  1SN8 A;  2PI2 E;  4LWC A;  4MNO A;  3KOJ A;  2UXC Q;  5LMU L;  3TS2 A;  4DV5 L;  1A62 A;  2PNH A;  4GOP C;  3T1Y Q;  4A3K G;  3BZK A;  2JEA I;  5C44 H;  4NXN L;  4YWL A;  1SRU A;  1R9T H;  1CSP A;  2WB1 E;  3RZO H;  1OXT A;  4A3M H;  3PO2 H;  1K3R A;  3HOV G;  2BH2 A;  2AMC B;  3AFP A;  3D31 A;  3GTJ H;  4POG A;  4P71 A;  1PVO A;  4IO9 A;  1TXY A;  2Z6K C;  1HNW L;  4H02 A;  1I94 Q;  3AEV A;  3H3V H;  2RF4 A;  3M85 A;  2Z0S A;  3UDX A;  2HIV A;  3U50 C;  2UUB L;  2MFI A;  1X3G A;  1L2F A;  4IJH A;  3S2H H;  3B6Y A;  2PQA B;  2DUD A;  1HH2 P;  3PIO A;  1MJE A;  4JI5 Q;  1D8L A;  3VDY A;  3JAM c;  4UPA A;  5EAY A;  2K4K A;  3CC2 A;  4P73 A;  1PH8 A;  4B3T L;  1G6P A;  1L1O C;  3KF6 B;  2Y0S G;  4POF A;  3KJO A;  3G48 A;  3AYH B;  4DR1 L;  4Y52 H;  4KI0 A;  1HZ9 A;  4MTN A;  3HOZ H;  2F4V L;  3E9I A;  2HHH L;  4LNQ A;  4KHZ A;  1UE6 A;  4JBJ A;  4YHH L;  1VQ7 A;  4JI1 L;  2VQF L;  1PH6 A;  2E2I H;  3J81 c;  1IZ6 A;  2ATW A;  5JJI A;  4BBS H;  3CPF A;  3RR5 A;  4P75 A;  4DUY L;  1Q86 C;  5IE8 A;  1OXS C;  1PH3 A;  2CQO A;  2WB1 G;  1PH4 A;  2E5L Q;  2JA7 G;  4IFD J;  1XMQ Q;  1IBM Q;  3ERS X;  1N33 Q;  1WCM G;  4ME3 A;  3NEN A;  2VY3 A;  4JI6 Q;  5GAG C;  3GTK H;  4A3D H;  2JA8 H;  3TRE A;  2D0O A;  3PUZ A;  4JI0 Q;  1Q82 C;  1K83 H;  1VQE A;  2R7Z H;  1OXX K;  3DLL A;  1PH2 A;  4A3E H;  4DK3 C;  3PV0 A;  4DV2 L;  4DV4 Q;  4OX9 Q;  2IHF A;  3CP0 A;  1TWF H;  1CUK A;  4O0A A;  4YWM A;  1PYS B;  3TRZ A;  3CAM A;  1HZA A;  2VNU D;  2UUC L;  4P74 A;  4LFB Q;  3GDE A;  1L0W A;  1QUQ A;  1Y1V G;  4PMW A;  3S1N H;  2N78 A;  2OQ0 A;  3A0J A;  5M3F G;  3DM3 A;  4A3J H;  3D0F A;  1FGU A;  1U0L A;  1QVC A;  4DR2 Q;  5GAH C;  2R7D A;  5FLX c;  4EQ5 A;  3PUW A;  4C3I H;  3T1Y L;  4GLA C;  1VQJ A;  4R4O A;  5M5X H;  5GAD C;  3LGJ A;  2IX0 A;  1EYG A;  2GVA A;  1YVC A;  1A8V A;  1NBW A;  3W1B A;  2UUA L;  5LMN W;  3T1H Q;  4DV3 Q;  4LF5 Q;  1GKH A;  3UE0 A;  3J7Z C;  4JI8 Q;  4GNX C;  3S17 H;  3OYY A;  5C4X G;  1I94 L;  5K36 G;  3UDG A;  5IT9 c;  1P8L A;  3CCQ A;  4OO1 G;  3PUX A;  1XPR A;  4IPD A;  1ASZ A;  5FLM H;  2KBN A;  2R6G A;  1X3E A;  1BBW A;  1YZ6 A;  4JI5 L;  3S16 H;  3MEF A;  1XNQ Q;  2YU9 H;  4X65 Q;  5FJ8 H;  2QA4 A;  1Q46 A;  4B3M Q;  1J6Q A;  1KC8 C;  1VQD A;  1PA6 A;  1KHI A;  1MJC A;  1UEB A;  5ELN A;  3PIP A;  1GM5 A;  1J5E Q;  2JA6 H;  4K0K Q;  1SLJ A;  1YI2 A;  3ICE A;  1Q8K A;  3JC6 6;  2ASB A;  5M3M H;  3M9B A;  4DV7 Q;  5IYD H;  2H5X A;  2K50 A;  1HNX Q;  4JI4 Q;  4JI3 Q;  2VZA A;  2HIX A;  3J81 j;  2IX1 A;  1QUQ B;  4IOA A;  2WAQ E;  4X64 L;  4PZ7 A;  2LXJ A;  3K80 C;  1BBU A;  4IFD I;  2E5L L;  5JEA J;  3JAM i;  4YCV A;  1XMQ L;  5DLQ E;  3FKI H;  1IBM L;  2PMZ E;  1EQR A;  3RZD H;  2NVX H;  4DV0 L;  1Q12 A;  4GKJ Q;  1E22 A;  5JJK A;  3HKS A;  1EQQ A;  1PH9 A;  4JI0 L;  3I4N H;  3KYH C;  3CF5 A;  4XTC S;  4DV4 L;  4OX9 L;  1GO3 E;  1LM0 A;  1CKN A;  4DR5 L;  1C9O A;  3CPW A;  2YTY A;  3J81 i;  2LSS A;  1N9W A;  2K52 A;  1NMF A;  2D0P A;  5IP9 G;  1YJ9 A;  1HR0 Q;  3CW2 C;  4YY3 Q;  3CC4 A;  3FHW A;  5IYB H;  4JBM A;  3GO5 A;  2Q2T A;  4L5R C;  1O7I A;  2IHE A;  2I5M X;  2K5H A;  4FDB A;  4JI7 Q;  3CCL A;  3HOX G;  3CCE A;  4DR2 L;  1IBK Q;  1EWI A;  3GD7 A;  2B63 H;  1TWC H;  2R7F A;  4DR6 L;  2A1A A;  4KHP Q;  4DR4 Q;  2Y0S E;  4AYB E;  4WJ4 A;  4C2M H;  4DR7 L;  2JQO A;  2AWO A;  3A74 A;  3PF5 A;  4IPC A;  3PF4 A;  2NN6 I;  4BA1 I;  2R7Z G;  1X56 A;  1XMO L;  1VQ4 A;  1IXR A;  4DV6 Q;  4BXX G;  4A3E G;  2WAQ G;  4GS3 A;  3S2D H;  4JI8 L;  5AJ3 Q;  1XPO A;  3CQZ H;  2ZM6 Q;  1YNX A;  4LF7 L;  3KJP A;  4A3L H;  1UE7 A;  3W1G A;  4GN4 B;  1HNZ L;  5JEA G;  3CCU A;  1MKH A;  1Y14 B;  4A75 A;  1Y1W H;  3GTP H;  4HJ8 A;  5C0X J;  4QL5 A;  3HOU H;  2HT1 A;  3PGZ A;  4WJ3 M;  2I0Q A;  3CXC A;  4X65 L;  4R1J A;  2KEN A;  1C0A A;  1N32 Q;  3RLO A;  1PH7 A;  3PSI A;  3PUY A;  1A0I A;  1X3F A;  2ZTC A;  4YCW A;  1CKN B;  4LF8 Q;  1FL0 A;  4DV7 L;  3UE1 A;  2CFM A;  3K7U C;  1ASY A;  3STB D;  4X66 Q;  3GTG H;  4AYB G;  4LUO A;  4A3B H;  1JJ2 A;  2AWN A;  2ZTD A;  2VUM H;  5JJL A;  2A19 A;  1YHB A;  3MXN B;  1YJN A;  5FLM G;  1A63 A;  3L7Z C;  4GKJ L;  1SR3 A;  1WYD A;  5IP7 H;  4DUZ Q;  1QZG A;  4DR3 L;  1S40 A;  2NVT H;  5FJ8 G;  4B3R L;  4PG3 A;  1I50 H;  3HOW H;  2F3I A;  4LFA L;  3F1Z A;  5E7N A;  2I5H A;  2JA6 G;  1VQA A;  4BBR G;  4DK6 C;  2EQS A;  2CWP A;  4JYA Q;  4TVA B;  4C3H H;  1AH9 A;  5IYD G;  3S24 A;  2B29 A;  2OWO A;  2K14 A;  5C0X G;  1S72 A;  3ULL A;  2MO0 A;  1FJG L;  4X6A H;  1PYB A;  4BY1 G;  3NBH B;  3M4P A;  1SMX A;  1X54 A;  5IYC H;  4KHP L;  5LMN L;  3HFZ B;  2KHI A;  3G71 A;  3OW2 A;  3BU2 A;  1N36 Q;  3PO3 H;  1RIP A;  5ELO A;  4UP7 A;  5C4J H;  1HR0 W;  3M4Q A;  2CCZ A;  2K5N A;  4A3C H;  2UXC L;  4A3F H;  1VCI A;  4PZ6 A;  2AKW B;  2RHQ B;  4B3S Q;  4JV5 Q;  1VS0 A;  1E1O A;  1E3P A;  1VQB A;  2ZM6 L;  4A93 H;  4A3G G;  1EUJ A;  1JB7 A;  2VQE Q;  3M4O H;  2ZTE A;  4GOP B;  3I7F A;  3S1M H;  1Z47 A;  4OXP A;  5IYB G;  3K7A H;  4BY7 G;  1WFQ A;  5C0X I;  2N3S A;  3HKZ E;  2K75 A;  1EFW A;  1WJJ A;  3STB C;  4A3K H;  3S15 H;  4NB3 A;  1KAW A;  3BJU A;  5J3B A;  2ZJR A;  3GTM H;  1G29 1;  1FVI A;  2YYZ A;  2B3G A;  4JG2 A;  1SE8 A;  4O2D A;  3CCS A;  3CCV A;  2ZJQ A;  4LUV A;  4UY8 C;  4LFC Q;  1SFO H;  2ID0 A;  2RHS B;  4J15 A;  3I56 A;  4DAM A;  2OTJ A;  4RG1 A;  2WP8 J;  5C44 G;  4DAY B;  1VQM A;  1VQK A;  2R93 H;  4X66 L;  3E9H A;  2OCE A;  3GTO H;  2JA9 A;  4IJL A;  3ULJ A;  1QVF A;  3OTO Q;  4JBW A;  4HIK A;  4HJ7 A;  4A3M G;  1Y1W G;  1EIY B;  4JBK A;  3PO2 G;  3FP9 A;  4JOI A;  5BR8 Q;  1UE1 A;  1YHQ A;  1N8R C;  1EOV A;  3HOU G;  1RL2 A;  2MO1 A;  3ULP A;  2Q2H A;  1JT8 A;  4OO1 I;  4JCV E;  3K81 C;  4DPG A;  1N33 L;  3I2Z A;  2Q2I A;  4JI6 L;  3HKZ G;  4LF6 Q;  1I6H H;  3F8T A;  3NEL A;  4APV A;  1Q1E A;  2E2J H;  1LYL A;  1K8A C;  1PH1 A;  4Y7N H;  1VQN A;  2JA7 H;  3L0O A;  2JJQ A;  3UDI A;  3RNU A;  2AHO B;  5M5W H;  1VQI A;  4A3B G;  1NTG A;  5H1S E;  1DGS A;  3UDF A;  3NEM A;  3HOZ G;  3Q8D A;  4LFB L;  1KRS A;  1WI5 A;  4B3T Q;  4ALP A;  4BBS G;  4HIM A;  3H3V I;  4NPS A;  3F2C A;  1XPU A;  4RMF A;  4XIG S;  4B3S L;  4JV5 L;  2HHH Q;  2JA5 H;  3SGI A;  1WOC A;  2NVY H;  4A3D G;  1Y1V H;  1YHA A;  4YHH Q;  2A8V A;  2VQF Q;  2R92 H;  2JA8 G;  1OXV A;  4DUY Q;  1YEZ A;  2RCN A;  1XNR Q;  5GRO A;  3T1H L;  3I4M H;  3CMA A;  1GVP A;  1XTD A;  4DV3 L;  4LF5 L;  1TWH H;  5HGQ A;  3F2D A;  2GN5 A;  4JI2 Q;  1N34 Q;  1T9H A;  5IYC G;  1KQS A;  3GTL H;  1VQH A;  1JJG A;  4GNX B;  2KCM A;  3HOY H;  4DV2 Q;  3GTQ H;  2FXQ A;  4A3J G;  3S14 H;  4A3C G;  4OWW B;  4A3F G;  4IPH A;  2YV5 A;  1TWG H;  2XTI A;  1XNQ L;  1SRO A;  4TQU S;  3F2B A;  1VQ8 A;  3KFU A;  2ALY B;  3KF8 B;  1BVS A;  3W5O A;  4A4I A;  1VQO A;  1YIJ A;  4B3M L;  4C3J H;  4NXM Q;  5C3E H;  4A3I H;  4LUZ A;  2N8N A;  4K0K L;  1J5E L;  3OTO L;  1PV4 A;  2GVB A;  1JE5 A;  5IWA Q;  1BKB A;  2HQL A;  1IL2 A;  4HJ9 A;  2NVQ H;  5BR8 L;  5IY0 A;  2V1C C;  3H0G H;  3ZJY C;  4QGU A;  2KCT A;  4IOC A;  1HNX L;  4JI3 L;  1VQ9 A;  4P72 A;  4GOP A;  3PUV A;  4JI4 L;  1PH5 A;  2UUA Q;  1JJC B;  3J80 c;  1K0R A;  3G6E A;  1GD7 A;  1U5K A;  4EX5 A;  3RN5 A;  1YIT A;  4LF6 L;  1VQL A;  4LF4 Q;  2ES2 A;  4YCU A;  2VS1 A;  5GAE C;  4DV1 Q;  2Z6K A;  1G51 A;  4UP8 A;  1M1K C;  4DKA C;  1S3O A;  2R93 G;  3U4V A;  1V1Q A;  3IRB A;  4KLK A;  2NZH A;  3EN2 A;  2JEB I;  3I55 A;  4AQY Q;  2IT1 A;  1HR0 L;  1UE5 A;  1LTL A;  5M3M G;  1B7Y B;  4QJF A;  3EIV A;  2CKZ B;  4YY3 L;  1QZH A;  2DGY A;  2XGT A;  3AFQ A;  3RLF A;  2BA0 A;  1UWV A;  1IBL Q;  2LXK A;  1B70 B;  4JI7 L;  1L1O A;  1E24 A;  1IBK L;  3FKI G;  3WWV A;  5IP9 H;  1XJV A;  4DR4 L;  2UXB Q;  1VQG A;  3U4Z A;  4X62 Q;  4LF9 Q;  4GN5 A;  2I5L X;  4AH6 A;  1Z9F A;  3RN2 A;  1E7Z A;  3I4N G;  4X64 Q;  1XNR L;  1VQP A;  2CWA A;  3HOX H;  4DV6 L;  2UU9 Q;  2UXD Q;  4DNI A;  1TWA H;  2NZO A;  4HJA A;  5AJ3 L;  2KHJ A;  2VW9 A;  4DV0 Q;  3KDF A;  4PZ8 A;  1NMG A;  2WFW A;  3TEH B;  4A76 A;  1QVG A;  4JI2 L;  1N34 L;  3I4O A;  3CC7 A;  1V9P A;  4BXX H;  1Q1B A;  3S1R H;  1Q81 C;  4DR5 Q;  1MIU A;  1K73 C;  1X65 A;  2B63 G;  1I3Q H;  1I5F A;  2JA5 G;  3BZC A;  1VQ5 A;  4GKK Q;  1AE3 A;  3PCO B;  1KXL A;  4UP9 A;  4NXM L;  1N32 L;  2R92 G;  3HOV H;  2OTL A;  2E2H H;  4R4I A;  3TQY A;  3I4M G;  2EXD A;  5IWA L;  1D7Q A;  4LF8 L;  1VQC A;  4OWT B;  1PHJ A;  1C7Y A;  4DR6 Q;  3H15 A;  3L2P A;  3RLN A;  1AE2 A;  4DR7 Q;  4YWK A;  4A3L G;  3ER0 A;  4L5T A;  3E0E A;  3M3Y H;  4JOI C;  3U58 A;  1YBY A;  1XMO Q;  1NJI C;  2YTX A;  3HOY G;  5LMU Q;  4DV5 Q;  1L1O B;  1X6O A;  4IPG A;  4R4Q A;  1KD1 C;  1CKM A;  1LUZ A;  3CCR A;  1W2B A;  4LF4 L;  4NXN Q;  1HZB A;  4DUZ L;  4LF7 Q;  4GNX A;  4DV1 L;  3K0X A;  1HNZ Q;  4IFD G;  3K8A A;  3EBE A;  4HIO A;  4L5Q A;  1HZC A;  4AIM A;  5C3E G;  2YTV A;  4A3I G;  2JK8 A;  1X55 A;  3AQQ A;  1NE3 A;  3S1Q H;  4OWX B;  5HY6 A;  4MZ9 A;  4JYA L;  1HNW Q;  4AQY L;  1OTC A;  1P16 A;  3CCJ A;  3KDF B;  3H0G G;  1H95 A;  3J80 i;  3CME A;  2UUB Q;  2QEX A;  1CKO A;  3A5U A;  1IBL L;  2VUM G;  1WCM H;  2VL6 A;  1W3S A;  4BBR H;  1KL9 A;  2UXB L;  4X62 L;  4LF9 L;  2JE6 I;  2ZJP A;  1N36 L;  5IP7 G;  2OQK A;  1X9N A;  3CCM A;  4JC0 A;  2BH8 A;  3KLW A;  4DR1 Q;  2UU9 L;  4BY1 H;  3CD6 A;  2UXD L;  2L15 A;  5M5Y H;  3HOW G;  2MQH A;  2F4V Q;  4OON A;  1VQ6 A;  2K5V A;  1PFS A;  2C35 B;  1KRT A;  2PI2 A;  4R4T A;  4JI1 Q;  4L5S A;  2VQE L;  1B8A A;  2NN6 G;  5M3F H;  4DR3 Q;  1OXU A;  2QGQ A;  1NY4 A;  4B3R Q;  2D62 A;  2BA1 A;  4GLV B;  2PQA A;  3A5Z B;  2F52 A;  4LW1 A;  2E8G A;  4LFA Q;  1K9M C;  3J7A 5;  4BA2 I;  4A3G H;  1V43 A;  2EIF A;  2MNA A;  1KIX A;  3M7N A;  1K8G A;  3KF6 A;  4GKK L;  4QQB X;  4QY7 A;  1CSQ A;  4HID A;  1FJG Q;  3PO3 G;  4BY7 H;  2N49 A;  4HJ5 A;  2IY5 B;  4GN3 B;  1E1T A;  4LFC L; 
#chains in the Genus database with same CATH topology
 4XQJ A;  2A73 B;  2NWG A;  1SYE A;  2E2H B;  5GQO A;  1BCP D;  1M90 C;  1VMP A;  1Q7Y C;  1L0X B;  2EY1 A;  4CJ1 B;  2A68 C;  3MHB A;  3P75 A;  5BN5 A;  1SN8 A;  4LWC A;  3TS0 A;  2UXC Q;  3KOJ A;  4CBV A;  5LMU L;  3TS2 A;  1JR0 D;  1R9T H;  1MSH A;  2BDN A;  1XWE A;  3BS1 A;  2SNM A;  1XXG A;  5G3L F;  4AYB B;  4N9T A;  3UI2 A;  1TS2 A;  1HNW L;  1I94 Q;  3AEV A;  3H3V H;  1B9M A;  2E2D C;  2RF4 A;  4K6L A;  1ENC A;  2HIV A;  3U50 C;  1I6H B;  1F9Q A;  1X3G A;  1AN8 A;  4IJH A;  1LT5 D;  1G91 A;  2WB1 B;  1MJE A;  1PTO B;  3U9O A;  4B3T L;  2KUM A;  1EIG A;  2HQE A;  3KJO A;  3AYH B;  4Y52 H;  3OHX C;  4KI0 A;  3HGB A;  2HHH L;  3P1H A;  1CHQ D;  2VQF L;  5E4X A;  3J81 c;  1IZ6 A;  3NTK A;  5JJI A;  2MHV A;  4KKS A;  1PH3 A;  5IE8 A;  1ONL A;  3G7L A;  3QOL A;  2CQO A;  2D9U A;  2JA7 G;  4IFD J;  1EY6 A;  4OHJ A;  4N9P A;  1IBM Q;  2M2L A;  1WCM G;  3GTK H;  3I91 A;  1CI3 M;  3PUZ A;  2TSS A;  4JI0 Q;  1VQE A;  5EBD A;  1JOO A;  3MAQ A;  4DV4 Q;  4CKB A;  4OX9 Q;  5JVG 3;  3R93 A;  3CAM A;  1H9S B;  3P7J A;  1HCZ A;  1QUQ A;  2F0D A;  3SK4 A;  1E0B A;  4C1N K;  2OQ0 A;  5M3F G;  3D0F A;  1U0L A;  2KVM A;  5COR A;  1DON A;  2TMP A;  4K5V A;  5FLX c;  4R4O A;  1EYG A;  3LGJ A;  1YVC A;  2F0V A;  1A8V A;  4TRD A;  3NPP A;  3W1B A;  2UUA L;  5C44 B;  4RA8 A;  4DV3 Q;  1GKH A;  3J7Z C;  1G8Z D;  4GNX C;  4A3M B;  2PW7 A;  1I94 L;  5C4X G;  1SND A;  3DWQ A;  4HAE A;  5IT9 c;  3GTJ B;  4OO1 G;  3PUX A;  2AQ2 B;  1XPR A;  3MEH A;  1ASZ A;  1BBW A;  2EYH A;  3S16 H;  1QCB D;  1VDZ A;  2YU9 H;  1F2Y A;  1Y8N B;  5ELN A;  1PMR A;  1J5E Q;  1J9O A;  2JA6 H;  3ICE A;  2OXP A;  5M3M H;  2EPB A;  2H5X A;  4EGV A;  2K50 A;  4CDE C;  4JI4 Q;  2HIX A;  3OSO A;  2IX1 A;  1QUQ B;  2WAQ E;  3SK8 A;  5CC4 A;  4FP5 D;  2E2I B;  1FNW A;  4B08 A;  2NVX H;  3R2I A;  1IBM L;  1GUS A;  1JC7 A;  3HKS A;  4JI0 L;  4BS9 A;  3I4N H;  4CJ2 C;  1S4Z A;  3KYH C;  3CF5 A;  4DV4 L;  4OX9 L;  1CKN A;  4DR5 L;  1C9O A;  2R7Z B;  1K83 B;  2D0P A;  5IP9 G;  1YJ9 A;  3CW2 C;  1TWF B;  3CC4 A;  4L5R C;  2Q2T A;  3QJY A;  1O7I A;  1TS5 A;  2K5H A;  4FDB A;  5EBC A;  4JI7 Q;  3HOX G;  1LO5 D;  5KIX A;  2B63 H;  2A1A A;  2A69 C;  4FXG C;  4KN4 C;  2Y0S E;  1QE6 A;  4IUR A;  2IW3 A;  3SR1 A;  1SDF A;  2K28 A;  4C2M H;  2A5H A;  2AWO A;  3PF4 A;  2IL8 A;  1D2B A;  1LAB A;  4DXF A;  4A3E G;  4GS3 A;  1IYV A;  4KJN A;  4QUF A;  2ZM6 Q;  1YNX A;  1JIC A;  2F0L A;  3HZX A;  3S9W A;  1O80 A;  1MKH A;  4G57 A;  2F0P A;  5C0X J;  3CU7 A;  3LWE A;  2XNA C;  5I4D A;  5C3X A;  4C3I G;  3CXC A;  3K57 A;  4R1J A;  1C0A A;  3AB9 A;  1PH7 A;  1WD1 A;  1A0I A;  1CKN B;  1CZG A;  3E3X A;  3UE1 A;  5JJL A;  3BG3 A;  4KD4 A;  3T4A C;  5KYL A;  1JJ2 A;  2A19 A;  1SMY C;  4DFA A;  1YJN A;  5C4Z A;  1PTO F;  1ZXT A;  5FO8 B;  2JN4 A;  2MPM A;  4DUZ Q;  1QZG A;  2EVB A;  4DR3 L;  3RZD B;  1S40 A;  4P2C B;  2F3I A;  4LFA L;  1UEA B;  3F1Z A;  4HCS A;  1TU2 B;  4BBR G;  2B2V A;  2EQS A;  1ESF A;  2PNR C;  3ULL A;  3NBH B;  5JPN C;  5IYC H;  5LMN L;  1QJO A;  2KHI A;  1HTP A;  5ELO A;  3PO3 H;  1HR0 W;  4PZ6 A;  2AKW B;  4G7Z C;  4UDU C;  4ULL A;  1VQB A;  3SE0 A;  2ZM6 L;  1JB7 A;  1K28 A;  3DWP A;  3FPP A;  4HR7 B;  4OXP A;  5IYB G;  4RWS C;  4BY7 G;  2N3S A;  5LHY 1;  3VA5 A;  3I73 A;  1G29 1;  1SNQ A;  2B3G A;  2B2U A;  3HOU B;  2KEC A;  4LUV A;  4L6T B;  1SFO H;  4FXD A;  2EZV A;  2OTJ A;  3SVM A;  4IUP A;  1CA5 A;  5EPJ A;  2OCE A;  1HFG A;  1B4O A;  3OTO Q;  1Y1W G;  2K33 A;  4JOI A;  4K6D A;  1EOV A;  1RL2 A;  4WFN 3;  2BDO A;  1A2T A;  4JVZ A;  1IW7 C;  4OO1 I;  1GOZ A;  5KYI A;  1N33 L;  2KED A;  4PMB A;  4JI6 L;  3HKZ G;  1I50 B;  1Q1E A;  2E2J H;  2SNS A;  1X3P A;  1VQN A;  2JA7 H;  3L0O A;  2JJQ A;  3NTH A;  1CHP D;  2AHO B;  4QF4 A;  2DJF C;  1HXY D;  3NEM A;  3HOZ G;  1A15 A;  3CHB D;  2OT2 A;  1C8C A;  4RKB A;  2LS0 1;  1RTO A;  4CKC A;  4DU9 A;  3FMC A;  3C1E A;  4RMF A;  3SGI A;  5C4J B;  2NVY H;  3A55 A;  4A3D G;  2JA8 G;  1YNN D;  5KND A;  4DUY Q;  4ZQ3 A;  3T1H L;  3CMA A;  5HGQ A;  1HPC A;  3ND8 A;  3F2D A;  3M4O B;  1UNS A;  4PV1 C;  1KQS A;  1VQH A;  1JJG A;  4CDC C;  2KCM A;  1PRT C;  4DV2 Q;  3GTQ H;  1GUG A;  1TWG H;  2XTI A;  1SRO A;  3KFU A;  4OO1 H;  3W5O A;  1BVS A;  4B3M L;  1YIJ A;  1EU4 A;  3T53 B;  2EJM A;  2N8N A;  4LUZ A;  3PIO 3;  4K0K L;  1EYD A;  3OTO L;  1PV4 A;  1IL2 A;  2NVQ H;  2R93 B;  3GTO B;  3H0G H;  1I4Q A;  4X3S A;  4GOP A;  1TKW B;  2HDM A;  1PH5 A;  1MHW C;  1JJC B;  3VR2 A;  2RSN A;  3NWS A;  1VQL A;  1B50 A;  2EYJ A;  1G51 A;  1RD9 D;  5T1I A;  3EJI A;  1EIH A;  1V1Q A;  1T5E A;  2B2V C;  2ICI A;  2WV6 D;  2WKD A;  3OIQ A;  3TBI B;  2IT1 A;  4L8J A;  1UE5 A;  5E4W C;  3BVG A;  4AQY Q;  5M5W B;  1G2T A;  3TDQ A;  2L5T A;  5IGF A;  1L1O A;  3AMU A;  3TZD A;  3WWV A;  2PZT A;  5IP9 H;  4DR4 L;  2UXB Q;  1UAP A;  4X62 Q;  3KLR A;  3DMU A;  5CV9 A;  4DAP A;  4K14 A;  4X64 Q;  2F3V A;  3HOX H;  2NB0 A;  1TWA H;  3VYS A;  1ESR A;  4HSP A;  2KHJ A;  5AJ3 L;  4DV0 Q;  2CQA A;  1QVG A;  4LMQ D;  1TWH B;  5JVH 3;  3CC7 A;  3KK7 A;  1F9S A;  1K3B C;  5COY A;  5DNF A;  2B2U C;  3BZC A;  3S14 B;  2R92 G;  3HOV H;  4FF4 A;  2QW7 A;  4TKO B;  4R4I A;  3TQY A;  4LF8 L;  1I4G A;  4A3I B;  3RLN A;  5CYU A;  3W2D A;  1AE2 A;  4KK7 A;  4DR7 Q;  4A3L G;  3IAY A;  3DUZ A;  4L5T A;  4JOI C;  1NJI C;  3HOY G;  4DV5 Q;  1L1O B;  4R4Q A;  3CCR A;  5C6A A;  2A6H D;  4LF7 Q;  1I4H A;  4IFD G;  3NXW A;  1BNZ A;  1HNZ Q;  4F88 A;  4HIO A;  4C3J G;  1U4R A;  4XYO A;  1Z7T A;  4ZUI A;  2SEB D;  4AQY L;  1OTC A;  1Q8I A;  1BCP B;  1GHK A;  3J80 i;  2QEX A;  1CKO A;  4C3H B;  3A5U A;  4BBR H;  1HQR D;  4V19 0;  2UXB L;  2MJ8 A;  4X62 L;  3A8I E;  1N36 L;  1S5E D;  3NHH A;  2MQH A;  4MN3 A;  1KNE A;  4NMZ A;  3SK5 A;  1STB A;  4H7B A;  4JI1 Q;  4HED A;  2QDB A;  5IGC A;  2NN6 G;  1PZJ D;  1QNU A;  4KKT A;  1AZQ A;  1STY A;  2EE1 A;  3Q23 A;  1NY4 A;  1WD0 A;  4B3R Q;  3A54 A;  2XVS A;  1SYF A;  4A93 B;  2BA1 A;  2PQA A;  2RVL A;  4QCL A;  4G7O C;  2E8G A;  4ZLT F;  5KEE A;  2WAQ B;  3KF6 A;  1TS3 A;  1WTR A;  4QY7 A;  1CSQ A;  1FJG Q;  4BY7 H;  3OMC A;  4LFC L;  1IYJ B;  2BE5 C;  1EIF A;  1B2T A;  2KCN A;  5CV7 A;  3G4S A;  4QIW E;  3EFX D;  1EWC A;  2PI2 E;  1QWY A;  2B2W A;  4FNF A;  4DV5 L;  4GOP C;  4ZRZ A;  3BZK A;  2CVR A;  3M3Y B;  1CSP A;  3IFT A;  4N8X 1;  3F2U A;  1K3R A;  3IFD A;  2BH2 A;  3AFP A;  2Y0S B;  3VYT A;  4POG A;  4RGM A;  4IO9 A;  1J8I A;  2Z0S A;  3S1Q B;  3Q6S A;  3D4D A;  1DXM A;  1L2F A;  4KJO A;  4Y7N B;  1BUV T;  2PQA B;  3Q24 A;  2F03 A;  4JI5 Q;  1PFN A;  1D8L A;  5EAY A;  2K4K A;  4ZUJ A;  1L1O C;  3KF6 B;  4POF A;  3QIA A;  1WTX A;  4MTN A;  3HOZ H;  5D3I B;  5FO9 B;  2EYL A;  4YHH L;  4JI1 L;  2ATW A;  1D5Z C;  3RR5 A;  3QR8 A;  2EY6 A;  1OXS C;  3NSW A;  2WB1 G;  5IGD A;  1PH4 A;  1STH A;  5K5P A;  1BCP C;  3TP8 A;  3OMG A;  1XMQ Q;  1DOL A;  4A3D H;  3NEN A;  3URY A;  2JA8 H;  3TRE A;  3R3O A;  1EQV A;  3MZ5 A;  1PH2 A;  4A3G B;  4DK3 C;  3PV0 A;  4F87 A;  3TRZ A;  4YWM A;  1HZA A;  3IKJ A;  1RKN A;  3L3O C;  4LFB Q;  4DN4 M;  5JEA H;  1EYC A;  1B9N A;  4PMW A;  3S1N H;  3A0J A;  2ENB A;  5EKK A;  1IKM A;  5GAH C;  2R7D A;  1SNO A;  1NBW A;  1R9T B;  4LF5 Q;  4FF1 A;  3UE0 A;  1JWS D;  3S17 H;  4RHS A;  3KLS X;  3CCQ A;  1AW7 A;  4IPD A;  4DNR B;  2C5C A;  5FLM H;  5A2Q L;  1EY9 A;  4JI5 L;  1XNQ Q;  5FJ8 H;  1KHI A;  2LKV A;  1UEB A;  4RCN A;  1PFM A;  2F0I A;  1YI2 A;  1Q8K A;  3JC6 6;  1CA6 A;  1HA5 A;  3M9B A;  5BN4 A;  5IYD H;  1HNX Q;  1BCP F;  3FVQ A;  3KBG A;  4PZ7 A;  4IFD I;  1I4X A;  1FGB D;  5JEA J;  1XMQ L;  3VYU A;  4OGQ C;  4EQP A;  1Q12 A;  2DJG C;  5L37 A;  1PH9 A;  1LTA D;  3GTK B;  3R2T A;  3J81 i;  1N9W A;  4M8A A;  1HR0 Q;  2FFK B;  1L0Y B;  3K5M A;  1KDC A;  4XYQ A;  2SDF A;  1QOH A;  4JBM A;  5FK9 C;  3K58 A;  1I3Q B;  1LT4 D;  3V2T A;  1EWI A;  3GD7 A;  2R7F A;  2O5I C;  2KHS A;  4M1U B;  1GUN A;  1YNJ D;  1LV9 A;  1KNA A;  2B2W C;  4KY5 A;  2NN6 I;  4BA1 I;  2R7Z G;  1XMO L;  1VQ4 A;  1IXR A;  4DV6 Q;  3VR5 A;  3S2D H;  3WOE A;  5CV8 A;  2R3Z A;  4A3L H;  3W1G A;  4GN4 B;  2SOB A;  3CCU A;  4A75 A;  4ZKB B;  3GTP H;  3IL8 A;  1XYI A;  3BDC A;  1H9S A;  3W3A A;  4HJ8 A;  1K0S A;  4QMG A;  4MHE A;  3FDT A;  2HT1 A;  3PGZ A;  4BWG B;  4WJ3 M;  2B2T A;  1N32 Q;  3RLO A;  3S16 B;  3PUY A;  2YU9 B;  1K8O A;  1SSO A;  4ZKC B;  1E2W A;  1JQY D;  2JA6 B;  1ZYR D;  2PW5 A;  1W6K A;  3STB D;  1H9M A;  3GTG H;  4LUO A;  4A3B H;  1A3T A;  2ZTD A;  3R8B A;  2RDF A;  5M3M B;  2PPB C;  4B9W A;  2I46 A;  1A63 A;  1TY0 A;  3L7Z C;  4DF7 A;  5ELB A;  1SR3 A;  3QB3 A;  1WYD A;  2NVX B;  1TT2 A;  2WIN B;  3H09 A;  2EYP A;  2HCI A;  2Q8T A;  3I4N B;  4DK6 C;  2CWP A;  4TVA B;  2NN6 H;  1AH9 A;  3Q22 A;  2B29 A;  2H1E A;  2F0K A;  2MO0 A;  3DEP A;  4NDX A;  4BY1 G;  4CKE A;  2XWB B;  1X54 A;  2L12 A;  3HFZ B;  3G71 A;  3NBI A;  2A6E D;  4UP7 A;  3M4Q A;  2UXC L;  2K5N A;  5ELC A;  4A3F H;  2RHQ B;  3GV3 A;  2KA7 A;  1E3P A;  2ZXR A;  2VQE Q;  1BDO A;  1U4L A;  5DAU A;  3S1M H;  1O7Y A;  4RCO A;  2EYF A;  5C0X I;  3HKZ E;  2K75 A;  1EFW A;  3S15 H;  5F2D A;  3J7Y W;  3BJU A;  3PO2 B;  2PO4 A;  4JG2 A;  1EEI D;  2ZJQ A;  4UY8 C;  2ID0 A;  2IWH A;  3TP6 A;  3I56 A;  2EOT A;  5D65 A;  4J6H A;  3ULJ A;  5HGT A;  4HIK A;  4HJ7 A;  1EZ6 A;  5BR8 Q;  2KQ3 A;  1N8R C;  3HOU G;  3C1F A;  4RFB A;  3V05 A;  1LTR D;  1JT8 A;  3K81 C;  2L55 A;  4DPG A;  5KNB A;  4BBS B;  1A6X A;  1FYC A;  1HFN A;  4FO2 A;  1I6H H;  1O7Z A;  1K8A C;  2O4X A;  1PTO C;  3UDI A;  3RNU A;  1VQI A;  2NTT A;  1CK1 A;  3I3C A;  5H1S E;  1ILP A;  4ABN A;  2X6G A;  4JK1 C;  3X3M A;  2B8G A;  5NUC A;  3TP5 A;  1KRS A;  2FIN B;  4ALP A;  2F0N A;  4NPS A;  1JOK A;  3PO3 B;  4LAA A;  3VA7 A;  2JA5 H;  1JCK B;  3SEB A;  4U68 A;  4KN7 C;  2RCN A;  3I4M H;  4X3U A;  5M5X B;  3WOF A;  1XTD A;  4DV3 L;  1BO0 A;  2JP1 A;  1H9R A;  2E74 C;  3GTL H;  1PYW D;  3NBH A;  4A3J G;  4A3C G;  2EY2 A;  4C56 C;  5I9P A;  3JAM E;  2B2T C;  4IN3 A;  3F2B A;  1ROD A;  2ALY B;  4A4I A;  4NXM Q;  1SFO B;  5C3E H;  4CJ0 B;  2EYO A;  1J5E L;  1A2U A;  1W6J A;  1JE5 A;  1BKB A;  2K1B A;  3PMF A;  5BR8 L;  4QGU A;  3ZJY C;  5EKI A;  4JI4 L;  4P72 A;  2AQ1 B;  1KDA A;  1QB5 D;  4IZ8 A;  5C5M A;  5CBA E;  3G6E A;  1YIT A;  1IHZ A;  1GD7 A;  4EX5 A;  4QIW B;  1SNC A;  2K03 A;  4DV1 Q;  2Z6K A;  2IPK D;  2R93 G;  5J39 A;  3K5N A;  2E2J B;  4DXG A;  1YNN C;  1G6Z A;  2JA7 B;  1EEF D;  2F0J A;  4QJF A;  3EIV A;  3AFQ A;  1M4V A;  3RLF A;  1B53 A;  1IBL Q;  2LXK A;  1B70 B;  4JI7 L;  3FKI G;  1XJV A;  1VQG A;  4LF9 Q;  1S5F D;  1Z9F A;  2HUG A;  1TWC B;  3E0J A;  1VQP A;  2NVY B;  2ZXO A;  1NMG A;  3I4O A;  2AUK A;  1Q1B A;  3S1R H;  4RHR A;  1B3A A;  1EU3 A;  3CRK C;  2KOL A;  1I5F A;  3GTQ B;  4GKK Q;  1CT1 D;  1KXL A;  4NXM L;  3NQI A;  1TWG B;  5DM7 3;  2OTL A;  4IUV A;  2I07 B;  3MXP A;  2EXD A;  1D7Q A;  1VQC A;  4OWT B;  1C7Y A;  2KJX A;  4KMU C;  4DR6 Q;  3TME A;  3I90 A;  2NVQ B;  3ER0 A;  1ML0 D;  3H0G B;  1YBY A;  3C46 A;  1S5D D;  1X3Q A;  1X6O A;  1KD1 C;  1CKM A;  3VR3 A;  3D6W A;  4DUZ L;  1C4Q A;  4DV1 L;  4HTH A;  2N88 A;  4L5Q A;  4AIM A;  4A3I G;  1Y8O B;  4K8J A;  1X55 A;  1LAC A;  4OWX B;  5HY6 A;  2M00 A;  4OL7 A;  1HUN A;  3OWE B;  1IBL L;  1HQM C;  2VUM G;  2PCF B;  1WCM H;  3MXU A;  5FLX L;  1KL9 A;  1AZP A;  2L0C A;  2F3W A;  4LF9 L;  5IP7 G;  1EOT A;  1U9R A;  3GP7 A;  2F0F A;  4JC0 A;  4DR1 Q;  4BY1 H;  3HOW G;  4OON A;  2M9V A;  1VQ6 A;  1PFS A;  1KAA A;  1V1P B;  4C3H G;  1B8A A;  5M3F H;  1TWA B;  3J7A V;  1TS4 A;  2QGQ A;  4CDD C;  2D62 A;  1AP0 A;  1EQT A;  4BA2 I;  1O78 A;  2EIF A;  1SAP A;  1VF7 A;  2MNA A;  4GKK L;  2MP1 A;  3KLS A;  4A3K B;  4DA2 A;  1EY4 A;  2A6H C;  4GN3 B;  1E1T A;  2Q2U A;  5C4X H;  2UUC Q;  3HOV B;  1HJP A;  4A93 G;  1VQF A;  5EPL A;  1WTQ A;  5E1F A;  1ET6 A;  5TSS A;  1SYC A;  3A56 A;  4H0L C;  1A62 A;  2PNH A;  3T1Y Q;  3A8K E;  2WB1 E;  3RZO H;  3G6J B;  1OXT A;  1HRJ A;  1DYQ A;  3L9A X;  3D31 A;  5AFW A;  1RCV D;  1A3U A;  3ND9 A;  4P71 A;  1PVO A;  1TXY A;  2FMC A;  2Z6K C;  5D3D A;  1EYA A;  1H9J A;  4XT1 B;  3UDX A;  2MFI A;  2IX3 A;  5JAV A;  3S2H H;  3PIO A;  3JAM c;  2CH4 W;  4UPA A;  2A74 C;  4I7A A;  3CC2 A;  1G6P A;  2Y0S G;  3G48 A;  4DR1 L;  1HZ9 A;  1ILQ A;  2XRQ D;  4LNQ A;  3SK6 A;  4JBJ A;  2LFN A;  1VQ7 A;  1PH6 A;  3HEJ A;  3CPF A;  3C2P A;  4P75 A;  4DUY L;  1Q86 C;  1E2V A;  2QEJ C;  3OOC A;  3ERS X;  4ME3 A;  4QUC A;  1SE4 A;  3VR6 A;  3OWF A;  3I72 A;  4DV2 L;  4A3E H;  3NWT A;  4RGT A;  3CP0 A;  5CV6 A;  1CUK A;  4O0A A;  4CDF C;  1PYS B;  2F0O A;  2UUC L;  5DM6 3;  3GDE A;  2D5D A;  1LTB D;  1Y1V G;  3CRL C;  2N78 A;  5FKA C;  3D8G A;  3RD4 A;  3DM3 A;  1RJT A;  4A3J H;  1FGU A;  4DR2 Q;  3QWN A;  5IGB A;  1D5X C;  3PUW A;  4C3I H;  3T1Y L;  4ZCK A;  5GAD C;  2IX0 A;  2Q8R E;  4WRD A;  5LMN W;  2NTS A;  5C4H A;  2FHT A;  3OYY A;  1STA A;  3EA6 A;  5DEH A;  1U4M A;  1P8L A;  1U4P A;  1JE4 A;  2CHB D;  2KBN A;  4FYD A;  1X3E A;  2DN8 A;  1AFP A;  3MEF A;  2K05 A;  2QA4 A;  1Q46 A;  2FJ2 A;  1VQD A;  1MJC A;  1GM5 A;  2ASB A;  3OIP A;  3SDZ A;  4ZAI A;  4DV7 Q;  2H4O A;  2XWJ B;  4JI3 Q;  2VZA A;  4IOA A;  1BXT A;  4X64 L;  4WJW A;  2LXJ A;  4PQX A;  1BBU A;  5D14 A;  3FKI H;  1STN A;  2PMZ E;  1JOR A;  4DV0 L;  1XX8 A;  4GKJ Q;  5JJK A;  1I4P A;  4K5W A;  3BYT B;  3D4W A;  4XTC S;  1GO3 E;  2JA8 B;  1JOQ A;  3NQT A;  2YTY A;  1NMF A;  3FRP B;  4YY3 Q;  3DHQ A;  5KGU A;  3FHW A;  5IYB H;  3ZYY X;  3MXN A;  1R4P B;  2IHE A;  1EZ8 A;  5EJW A;  1EY0 A;  3OW7 A;  3CCL A;  3CCE A;  4DR2 L;  1IBK Q;  3S1N B;  4IUN A;  2AQ3 B;  4DR7 L;  2JQO A;  3PF5 A;  3ERQ A;  1EFI D;  1X56 A;  2BCO A;  4BXX G;  5CR3 A;  1NSN S;  3T13 A;  3CQZ H;  1B3Q A;  1T5X D;  4LF7 L;  3KJP A;  1UE7 A;  1HNZ L;  5EKL A;  3P20 A;  4OEL B;  1Y1W H;  3S17 B;  1FD7 D;  1F2M A;  4IUU A;  3X3N A;  2ZXP A;  3QO2 A;  1EWH A;  2AUJ D;  5I9O A;  2R61 A;  1GJX A;  2KEN A;  1LLR D;  2OEO A;  3PSI A;  5ISR A;  1X3F A;  4YCW A;  2KEE A;  1D5M C;  1FL0 A;  4KY7 A;  3A7A B;  4DV7 L;  2NBF A;  2CFM A;  3K7U C;  5I6W A;  1ASY A;  4AYB G;  2VUM H;  1NCV A;  1WTO A;  4ILW A;  3MXN B;  2PZU A;  3I70 A;  2ZT9 C;  4GKJ L;  5IP7 H;  5M5Y B;  2NVT H;  3O13 A;  4B3R L;  3HOW H;  1YNJ C;  5E7N A;  2I5H A;  2Z9H A;  2JA6 G;  1ZEQ X;  1II3 A;  1H9K A;  4JYA Q;  3MA2 B;  4C3H H;  4NW2 A;  2DNE A;  4RAU C;  3S24 A;  4X6A H;  2K14 A;  5C0X G;  1FJG L;  5J22 A;  4TSS A;  3M4P A;  1B44 D;  3OW2 A;  1RIP A;  2CCZ A;  1VCI A;  3K59 A;  2F1M A;  4B3S Q;  4JV5 Q;  1E1O A;  4A93 H;  1EUJ A;  4C1N I;  1SE3 A;  1GUT A;  2ZTE A;  5BN3 A;  3S2D B;  1TQO A;  3I7F A;  1Z47 A;  3K5O A;  3K7A H;  1ZYR C;  2K5D A;  1WJJ A;  3STB C;  3Q0A A;  3DWA A;  4NB3 A;  5J3B A;  2ZJR A;  2XRS D;  3GTM H;  1FVI A;  2YYZ A;  4O2D A;  4ZK9 B;  3CCV A;  1MGS A;  4MIU A;  1VF5 C;  2CW0 D;  1K8M A;  5EQ0 A;  5CBE E;  2RHS B;  4J15 A;  4DAM A;  4HN7 A;  4RG1 A;  2WP8 J;  1RDP D;  4DAY B;  5C44 G;  1VQM A;  3E9H A;  2K01 A;  1NAP A;  4IJL A;  1LTS D;  4A3M G;  3PO2 G;  1AEX A;  4G4K A;  4H44 C;  3FP9 A;  1SJE D;  4JPB W;  1UE1 A;  3ITP A;  3H91 A;  5CMD A;  4A3B B;  3C3L A;  1SYD A;  1DM0 B;  2Q2H A;  4JCV E;  4NP5 A;  2L4N A;  4FF3 A;  2A6E C;  5ELD A;  4X3K A;  3F8T A;  4APV A;  4Y7N H;  2L11 A;  5IIF A;  5IGG A;  2MGS A;  2G5D A;  1DGS A;  1PDQ A;  2HCC A;  1IL8 A;  5JJZ A;  3Q8D A;  4LFB L;  1DZ1 A;  1WI5 A;  2L1B A;  4B3T Q;  2ICE C;  4BBS G;  2F0G A;  3H3V I;  3F2C A;  1R4Q B;  4XIG S;  4B3S L;  3MTS A;  3KBX A;  2HHH Q;  4JV5 L;  1WOC A;  1Y1V H;  4ID6 A;  4A3F B;  2VQF Q;  2R92 H;  1CQV A;  1MI2 A;  1OXV A;  3T51 B;  3T16 A;  2XIW A;  1C48 A;  4LF5 L;  2EXZ A;  3S1M B;  2GN5 A;  4JI2 Q;  1N34 Q;  1T9H A;  5IYC G;  3S15 B;  3BDO A;  1BOS A;  4GNX B;  3LX0 A;  3HOY H;  1IKL A;  4XQQ A;  1SE2 A;  1F9R A;  1O7L A;  4KD3 A;  1XNQ L;  4IFD H;  1WTP A;  1VQ8 A;  3KF8 B;  1QVF A;  4C3J H;  2J4X A;  2GVB A;  5IWA Q;  2V1C C;  1VQ9 A;  4FF2 A;  4DK0 A;  1HNX L;  3PUV A;  1CM9 A;  3E5S A;  2UUA Q;  2EJF C;  1G2S A;  1K0R A;  3RN5 A;  4LF4 Q;  3H3V C;  2VS1 A;  1M1K C;  4UP8 A;  4DKA C;  4H13 C;  1S3O A;  1ENA A;  3IRB A;  2VXW A;  2QF7 A;  5C5L A;  1QG7 A;  4K5X A;  1HR0 L;  1B7Y B;  1D6E C;  1KLU D;  3NP8 A;  1DJR D;  2BA0 A;  1UWV A;  3DXJ C;  1BF4 A;  1E24 A;  2QCP X;  2WII B;  2Z6B A;  2RBM A;  3U4Z A;  1MD2 D;  2D2C C;  4GN5 A;  2I5L X;  4AH6 A;  1PZK D;  2B63 B;  1E7Z A;  2JA5 B;  2PQE A;  4C2M B;  4DV6 L;  5J1Z A;  5G3L D;  3J80 L;  4HJA A;  2VW9 A;  3TEH B;  2BOS A;  2PYK A;  1CQF A;  3EVQ A;  4A76 A;  1WTV A;  4JI2 L;  1N34 L;  4CHT B;  3I4M B;  1EL0 A;  5KNC A;  4E6I A;  2EY5 A;  1V9P A;  4BXX H;  3ONA B;  4DR5 Q;  2B2Y C;  3GTL B;  1MIU A;  4PNY A;  1K73 C;  2CH4 A;  1I3Q H;  1AE3 A;  3NUC A;  4UP9 A;  1N32 L;  1WTW A;  2E2H H;  5IWA L;  4UAI A;  5C3E B;  3H15 A;  4I7Z C;  1TVX A;  1SYG A;  1ENF A;  3HP3 A;  1ET9 A;  1SNP A;  4IPG A;  1W2B A;  1LUZ A;  4LF4 L;  4NXN Q;  1HZB A;  5T1G A;  3H94 A;  2RDG A;  2NYZ D;  2O5J C;  3EBE A;  4YIJ A;  4K2L A;  1UUP A;  2JK8 A;  2F0T A;  4X3T A;  2N55 A;  2LMC B;  2QIL A;  2A68 D;  4MZ9 A;  1P16 A;  3CCJ A;  2G9H D;  3H0G G;  3U9S A;  1H95 A;  4ZYS A;  4EQN A;  1PTO H;  2UUB Q;  3GQB A;  2VL6 A;  2MUY A;  4RH6 A;  2JE6 I;  2ZJP A;  1ZKO A;  5C0X H;  2FMM A;  2OQK A;  2JXM B;  2X69 A;  3CCM A;  1SNM A;  2BH8 A;  3KLW A;  4LJZ C;  1KDB A;  1Q90 A;  2F4V Q;  2K5V A;  2O2L D;  2C35 B;  2PI2 A;  4R4T A;  3K6O A;  1MBY A;  2VQE L;  4DR3 Q;  1OXU A;  1TII D;  4OEM B;  1ICW A;  1PLF A;  4GLV B;  4LW1 A;  4LFA Q;  2F52 A;  1D1K A;  4RGN A;  2LY7 A;  3S1R B;  1K8G A;  4QQB X;  1EY7 A;  4IUQ A;  4HID A;  1PXU A;  2IJ0 A;  2PMZ B;  2RCF A;  4HJ5 A;  2IY5 B;  2EYM A;  2J7Z A;  1X32 A;  2GA4 B;  1YJW A;  5LMN Q;  4GLX A;  1TY2 A;  1JMC A;  3K0Y A;  1I6V C;  4R4C A;  4MNO A;  4A3K G;  2JEA I;  5C44 H;  4NXN L;  4YWL A;  1SRU A;  4F7X A;  4WOR A;  4A3M H;  3PO2 H;  3HOV G;  2Z4H A;  2AMC B;  2F0E A;  3GTJ H;  2VB2 X;  4H02 A;  1FNV A;  3M85 A;  2UUB L;  5A2Q E;  3A8J E;  4G7H C;  1HA6 A;  3B6Y A;  2DUD A;  1HH2 P;  1IYU A;  2RDH A;  4XXE A;  3VDY A;  4DK1 A;  1WCM B;  4P73 A;  1PH8 A;  1CZW A;  2RQX A;  1LT6 D;  2DY7 A;  2F4V L;  3E9I A;  3GV6 A;  4KHZ A;  1UE6 A;  1OO9 B;  4BY1 B;  2E2I H;  5M9O A;  4BBS H;  3M4Y A;  4V0B A;  2E5L Q;  1FNU A;  5C3W A;  5M3F B;  1N33 Q;  2RA4 A;  2VY3 A;  4JI6 Q;  5GAG C;  2Z8L A;  4J8Q A;  4K2K A;  2D0O A;  5FOB B;  3TP7 A;  1Q82 C;  1K83 H;  2R7Z H;  1OXX K;  3DLL A;  1F9P A;  2IHF A;  2E75 C;  1TWF H;  4DAV A;  2VNU D;  4Z9C B;  1DD2 A;  4P74 A;  1PRT B;  3CKI B;  1LTT D;  1L0W A;  4KTA A;  3BDL A;  4LK1 C;  4Q0F A;  5C4X B;  1QVC A;  1STG A;  1V1P A;  2B39 A;  4EQ5 A;  2C9O A;  4GLA C;  1PTO D;  1VQJ A;  3PIP 3;  5M5X H;  3LNN A;  2K04 A;  3J81 L;  2GVA A;  3SXH A;  3T1H Q;  1DOK A;  4JI8 Q;  3RZO B;  3WDN A;  1GXD C;  5K36 G;  3UDG A;  4JW0 A;  1S5C D;  3MVV A;  4QB4 A;  1DCZ A;  2A69 D;  3MFG A;  4R8I A;  4S3S A;  1RHP A;  2R6G A;  1YZ6 A;  2B8F A;  4X65 Q;  5LL6 S;  4B3M Q;  3S2H B;  1J6Q A;  1KC8 C;  1RF2 D;  1PA6 A;  4I65 A;  3PIP A;  4K0K Q;  4O42 A;  1SLJ A;  5FO7 B;  3BZD B;  1LTG D;  3MWY W;  3J81 j;  4DNT B;  3K80 C;  1BR9 A;  2E5L L;  2K5Q A;  3JAM i;  4YCV A;  5DLQ E;  3RZD H;  1EQR A;  1E22 A;  3HOX B;  5IT9 L;  1EQQ A;  4NKL A;  3H6M A;  1LM0 A;  3CPW A;  2WAC A;  2LSS A;  2V4D A;  2K52 A;  4A3E B;  1SMY D;  4R8N A;  2KCC A;  5LL6 X;  3GO5 A;  2I5M X;  1TWC H;  4DR6 L;  4KHP Q;  3SHL A;  4A3J B;  4DR4 Q;  4AYB E;  4WJ4 A;  1B1Z A;  3A74 A;  4IPC A;  1SXT A;  4C3I B;  5EPK A;  4HCE A;  3J80 E;  1Y8P B;  3PQI A;  2VB3 X;  2PZW A;  2WAQ G;  5I2Y A;  4JI8 L;  3OPO A;  5AJ3 Q;  1XPO A;  3RUZ A;  3TSS A;  5JEA G;  1Y14 B;  4UHV A;  2L9H A;  4QL5 A;  3HOU H;  5HUR A;  2I0Q A;  1SYB A;  1JB3 A;  5E3F A;  4X65 L;  1V8Q A;  3D4R A;  3D6C A;  5CV5 A;  5IGE A;  2ZTC A;  5CV4 A;  4LF8 Q;  1F77 A;  4BBR B;  3K5L A;  1I4R A;  4HSV A;  1PZI D;  4X66 Q;  2AWN A;  1YHB A;  5FLM G;  1QNK A;  1NUC A;  3FKI B;  3VYR A;  5IOC A;  5FJ8 G;  4PG3 A;  1I50 H;  4KHV A;  2QKI C;  3LWU A;  1VQA A;  2K6A A;  1QIL A;  4RKL A;  5IYD G;  1GHJ A;  3FEW X;  1BBX C;  1KTK A;  1S72 A;  4FXK C;  2OWO A;  1PYB A;  2P5Z X;  5I6Y A;  3BVM A;  4BY7 B;  4KHP L;  1SMX A;  1IW7 D;  3BU2 A;  3N6R A;  4IAL A;  1N36 Q;  3N52 A;  4IUT A;  5C4J H;  4A3C H;  1GUW A;  4KKU A;  1PFB A;  1VS0 A;  1PRT F;  1HHV A;  2NUC A;  4A3G G;  3M4O H;  4GOP B;  3KUP A;  3CQZ B;  1WFQ A;  1MSG A;  4A3K H;  1KAW A;  1Y1W B;  3TZU A;  1SE8 A;  4HMJ A;  3CCS A;  2G9D A;  2XSC A;  1S5B D;  3A7L A;  5ELE A;  1EY8 A;  5IOD A;  3I8Z A;  4IQZ A;  4LFC Q;  1TR5 A;  2X6L A;  4HMI A;  4KV6 A;  1VQK A;  2R93 H;  4X66 L;  3HKZ B;  3GTO H;  2JA9 A;  1WVL A;  1E2Z A;  1KAB A;  1Z6H A;  4JBW A;  4JBK A;  1EIY B;  1YHQ A;  1LTI D;  1PRT D;  3NE5 B;  2VUM B;  3M7G A;  2MO1 A;  3HOZ B;  3ULP A;  1VMC A;  1Q3L A;  1EY5 A;  5CGK A;  3I2Z A;  2NVT B;  2Q2I A;  1HUM A;  4LF6 Q;  3NEL A;  3HOW B;  1CFM A;  1LYL A;  1SJH D;  4RGO S;  5ELF A;  1PH1 A;  4A3D B;  5M5W H;  4A3B G;  1NTG A;  3UDF A;  5JOB A;  4HIM A;  1XPU A;  1F2Z A;  1YHA A;  4YHH Q;  2A8V A;  2CW0 C;  2DY8 A;  5A35 A;  1YEZ A;  4J1M A;  1XNR Q;  5GRO A;  1GVP A;  3D3R A;  1TWH H;  2F0U A;  5EGT A;  4N8F A;  3K7A B;  1ICF B;  3HS0 C;  1HTL D;  3MFY A;  4XQN A;  3J7A F;  2FXQ A;  3S14 H;  3GTM B;  4B9X A;  4OWW B;  4A3F G;  4IPH A;  2YV5 A;  1SEB D;  5K36 H;  4TQU S;  1VQO A;  1RTN A;  4A3I H;  3RMH A;  3VR4 A;  2HQL A;  4HJ9 A;  4F8M A;  1M8A A;  3J81 E;  5IY0 A;  4IOC A;  4Q5V A;  2KCT A;  2Z4I A;  4JI3 L;  2HDL A;  4OIK A;  3BYY B;  2RSO A;  4EVO A;  4EQO A;  4R9W A;  3I4L A;  3J80 c;  4FVM A;  1U5K A;  1JWM D;  4LF6 L;  2ES2 A;  4YCU A;  5GAE C;  1WTH A;  2XN9 C;  3NTI A;  4L63 B;  3U4V A;  2RKS A;  3QG1 A;  1Y69 U;  4KLK A;  2NZH A;  3EN2 A;  2JEB I;  2F0H A;  4DAY A;  2HD3 A;  3I55 A;  4ME5 A;  5M3M G;  1LTL A;  4YY3 L;  2CKZ B;  1QZH A;  2DGY A;  2XGT A;  1DOM A;  3BVZ A;  5FLX E;  1LT3 D;  3HG9 A;  4K8I A;  1IBK L;  4DGZ A;  3T56 B;  3AU7 A;  3DEO A;  5I2X A;  1F2L A;  3RN2 A;  4XT3 B;  3I4N G;  1NNX A;  1XNR L;  4PMC A;  2CWA A;  2UU9 Q;  1Y1V B;  2UXD Q;  4DNI A;  2R92 B;  2NZO A;  3KDF A;  2NZ1 D;  2WKC A;  2EJG C;  2WFW A;  4PZ8 A;  4KY6 A;  5IT9 E;  1FR3 A;  2F0W A;  3TN2 A;  1Q81 C;  3E6Z X;  1BQQ T;  4MTK A;  1X65 A;  2F0M A;  2B2Y A;  2B63 G;  3GTP B;  3HOY B;  3JAM L;  2JA5 G;  1VQ5 A;  3PCO B;  2DNC A;  1GUO A;  1A3V A;  3MC0 B;  3I4M G;  2E76 C;  2Z1C A;  1PHJ A;  4C3J B;  3L2P A;  2K32 A;  4YWK A;  1STE A;  2F0Q A;  3E0E A;  3M3Y H;  3U58 A;  1XMO Q;  2JSO A;  2YTX A;  5LMU Q;  4CGY B;  3GTG B;  4GNX A;  3K0X A;  3K8A A;  2BE5 D;  1HZC A;  2F4I A;  5C3E G;  2YTV A;  2K5W A;  1KLG D;  2K7V A;  1NE3 A;  3AQQ A;  4OIJ A;  3S1Q H;  1HNW Q;  4JYA L;  3KF8 A;  3ERO A;  3KDF B;  3DM1 A;  2JYO A;  4XDX A;  3CME A;  1W3S A;  2QDL A;  4ODG A;  3EQL C;  3V96 A;  2Q8I B;  1XTC D;  2J0T D;  1X9N A;  3QOJ A;  2UU9 L;  3CD6 A;  2OF1 A;  2UXD L;  1NR2 A;  3HRZ C;  2L15 A;  1NR4 A;  5M5Y H;  1JWU D;  1D1I A;  1KRT A;  4O1N A;  4L5S A;  2F0S A;  1V1O A;  3A5Z B;  5KRU A;  1K9M C;  4GZY C;  3J7A 5;  3FPU B;  4A3G H;  1V43 A;  1KIX A;  3M7N A;  2EDG A;  1CTM A;  4U67 3;  3PO3 G;  1SBB B;  2N49 A;  3MXG A;  5JPM C;  3NK9 A; 
#chains in the Genus database with same CATH homology
 1IYJ B;  2Q2U A;  5C4X H;  2UUC Q;  1EIF A;  1HJP A;  1YJW A;  5LMN Q;  5GQO A;  3G4S A;  4GLX A;  4A93 G;  1M90 C;  4QIW E;  1VQF A;  1JMC A;  1Q7Y C;  4R4C A;  3TS0 A;  1SN8 A;  2PI2 E;  4LWC A;  4MNO A;  3KOJ A;  2UXC Q;  5LMU L;  3TS2 A;  4DV5 L;  1A62 A;  2PNH A;  4GOP C;  3T1Y Q;  4A3K G;  3BZK A;  2JEA I;  5C44 H;  4NXN L;  4YWL A;  1SRU A;  1R9T H;  1CSP A;  2WB1 E;  3RZO H;  1OXT A;  4A3M H;  3PO2 H;  1K3R A;  3HOV G;  2BH2 A;  2AMC B;  3AFP A;  3D31 A;  3GTJ H;  4POG A;  4P71 A;  1PVO A;  4IO9 A;  1TXY A;  2Z6K C;  1HNW L;  4H02 A;  1I94 Q;  3AEV A;  3H3V H;  2RF4 A;  3M85 A;  2Z0S A;  3UDX A;  2HIV A;  3U50 C;  2UUB L;  2MFI A;  1X3G A;  1L2F A;  4IJH A;  3S2H H;  3B6Y A;  2PQA B;  2DUD A;  1HH2 P;  3PIO A;  1MJE A;  4JI5 Q;  1D8L A;  3VDY A;  3JAM c;  4UPA A;  5EAY A;  2K4K A;  3CC2 A;  4P73 A;  1PH8 A;  4B3T L;  1G6P A;  1L1O C;  3KF6 B;  2Y0S G;  4POF A;  3KJO A;  3G48 A;  3AYH B;  4DR1 L;  4Y52 H;  4KI0 A;  1HZ9 A;  4MTN A;  3HOZ H;  2F4V L;  3E9I A;  2HHH L;  4LNQ A;  4KHZ A;  1UE6 A;  4JBJ A;  4YHH L;  1VQ7 A;  4JI1 L;  2VQF L;  1PH6 A;  2E2I H;  3J81 c;  1IZ6 A;  2ATW A;  5JJI A;  4BBS H;  3CPF A;  3RR5 A;  4P75 A;  4DUY L;  1Q86 C;  5IE8 A;  1OXS C;  1PH3 A;  2CQO A;  2WB1 G;  1PH4 A;  2E5L Q;  2JA7 G;  4IFD J;  1XMQ Q;  1IBM Q;  3ERS X;  1N33 Q;  1WCM G;  4ME3 A;  3NEN A;  2VY3 A;  4JI6 Q;  5GAG C;  3GTK H;  4A3D H;  2JA8 H;  3TRE A;  2D0O A;  3PUZ A;  4JI0 Q;  1Q82 C;  1K83 H;  1VQE A;  2R7Z H;  1OXX K;  3DLL A;  1PH2 A;  4A3E H;  4DK3 C;  3PV0 A;  4DV2 L;  4DV4 Q;  4OX9 Q;  2IHF A;  3CP0 A;  1TWF H;  1CUK A;  4O0A A;  4YWM A;  1PYS B;  3TRZ A;  3CAM A;  1HZA A;  2VNU D;  2UUC L;  4P74 A;  4LFB Q;  3GDE A;  1L0W A;  1QUQ A;  1Y1V G;  4PMW A;  3S1N H;  2N78 A;  2OQ0 A;  3A0J A;  5M3F G;  3DM3 A;  4A3J H;  3D0F A;  1FGU A;  1U0L A;  1QVC A;  4DR2 Q;  5GAH C;  2R7D A;  5FLX c;  4EQ5 A;  3PUW A;  4C3I H;  3T1Y L;  4GLA C;  1VQJ A;  4R4O A;  5M5X H;  5GAD C;  3LGJ A;  2IX0 A;  1EYG A;  2GVA A;  1YVC A;  1A8V A;  1NBW A;  3W1B A;  2UUA L;  5LMN W;  3T1H Q;  4DV3 Q;  4LF5 Q;  1GKH A;  3UE0 A;  3J7Z C;  4JI8 Q;  4GNX C;  3S17 H;  3OYY A;  5C4X G;  1I94 L;  5K36 G;  3UDG A;  5IT9 c;  1P8L A;  3CCQ A;  4OO1 G;  3PUX A;  1XPR A;  4IPD A;  1ASZ A;  5FLM H;  2KBN A;  2R6G A;  1X3E A;  1BBW A;  1YZ6 A;  4JI5 L;  3S16 H;  3MEF A;  1XNQ Q;  2YU9 H;  4X65 Q;  5FJ8 H;  2QA4 A;  1Q46 A;  4B3M Q;  1J6Q A;  1KC8 C;  1VQD A;  1PA6 A;  1KHI A;  1MJC A;  1UEB A;  5ELN A;  3PIP A;  1GM5 A;  1J5E Q;  2JA6 H;  4K0K Q;  1SLJ A;  1YI2 A;  3ICE A;  1Q8K A;  3JC6 6;  2ASB A;  5M3M H;  3M9B A;  4DV7 Q;  5IYD H;  2H5X A;  2K50 A;  1HNX Q;  4JI4 Q;  4JI3 Q;  2VZA A;  2HIX A;  3J81 j;  2IX1 A;  1QUQ B;  4IOA A;  2WAQ E;  4X64 L;  4PZ7 A;  2LXJ A;  3K80 C;  1BBU A;  4IFD I;  2E5L L;  5JEA J;  3JAM i;  4YCV A;  1XMQ L;  5DLQ E;  3FKI H;  1IBM L;  2PMZ E;  1EQR A;  3RZD H;  2NVX H;  4DV0 L;  1Q12 A;  4GKJ Q;  1E22 A;  5JJK A;  3HKS A;  1EQQ A;  1PH9 A;  4JI0 L;  3I4N H;  3KYH C;  3CF5 A;  4XTC S;  4DV4 L;  4OX9 L;  1GO3 E;  1LM0 A;  1CKN A;  4DR5 L;  1C9O A;  3CPW A;  2YTY A;  3J81 i;  2LSS A;  1N9W A;  2K52 A;  1NMF A;  2D0P A;  5IP9 G;  1YJ9 A;  1HR0 Q;  3CW2 C;  4YY3 Q;  3CC4 A;  3FHW A;  5IYB H;  4JBM A;  3GO5 A;  2Q2T A;  4L5R C;  1O7I A;  2IHE A;  2I5M X;  2K5H A;  4FDB A;  4JI7 Q;  3CCL A;  3HOX G;  3CCE A;  4DR2 L;  1IBK Q;  1EWI A;  3GD7 A;  2B63 H;  1TWC H;  2R7F A;  4DR6 L;  2A1A A;  4KHP Q;  4DR4 Q;  2Y0S E;  4AYB E;  4WJ4 A;  4C2M H;  4DR7 L;  2JQO A;  2AWO A;  3A74 A;  3PF5 A;  4IPC A;  3PF4 A;  2NN6 I;  4BA1 I;  2R7Z G;  1X56 A;  1XMO L;  1VQ4 A;  1IXR A;  4DV6 Q;  4BXX G;  4A3E G;  2WAQ G;  4GS3 A;  3S2D H;  4JI8 L;  5AJ3 Q;  1XPO A;  3CQZ H;  2ZM6 Q;  1YNX A;  4LF7 L;  3KJP A;  4A3L H;  1UE7 A;  3W1G A;  4GN4 B;  1HNZ L;  5JEA G;  3CCU A;  1MKH A;  1Y14 B;  4A75 A;  1Y1W H;  3GTP H;  4HJ8 A;  5C0X J;  4QL5 A;  3HOU H;  2HT1 A;  3PGZ A;  4WJ3 M;  2I0Q A;  3CXC A;  4X65 L;  4R1J A;  2KEN A;  1C0A A;  1N32 Q;  3RLO A;  1PH7 A;  3PSI A;  3PUY A;  1A0I A;  1X3F A;  2ZTC A;  4YCW A;  1CKN B;  4LF8 Q;  1FL0 A;  4DV7 L;  3UE1 A;  2CFM A;  3K7U C;  1ASY A;  3STB D;  4X66 Q;  3GTG H;  4AYB G;  4LUO A;  4A3B H;  1JJ2 A;  2AWN A;  2ZTD A;  2VUM H;  5JJL A;  2A19 A;  1YHB A;  3MXN B;  1YJN A;  5FLM G;  1A63 A;  3L7Z C;  4GKJ L;  1SR3 A;  1WYD A;  5IP7 H;  4DUZ Q;  1QZG A;  4DR3 L;  1S40 A;  2NVT H;  5FJ8 G;  4B3R L;  4PG3 A;  1I50 H;  3HOW H;  2F3I A;  4LFA L;  3F1Z A;  5E7N A;  2I5H A;  2JA6 G;  1VQA A;  4BBR G;  4DK6 C;  2EQS A;  2CWP A;  4JYA Q;  4TVA B;  4C3H H;  1AH9 A;  5IYD G;  3S24 A;  2B29 A;  2OWO A;  2K14 A;  5C0X G;  1S72 A;  3ULL A;  2MO0 A;  1FJG L;  4X6A H;  1PYB A;  4BY1 G;  3NBH B;  3M4P A;  1SMX A;  1X54 A;  5IYC H;  4KHP L;  5LMN L;  3HFZ B;  2KHI A;  3G71 A;  3OW2 A;  3BU2 A;  1N36 Q;  3PO3 H;  1RIP A;  5ELO A;  4UP7 A;  5C4J H;  1HR0 W;  3M4Q A;  2CCZ A;  2K5N A;  4A3C H;  2UXC L;  4A3F H;  1VCI A;  4PZ6 A;  2AKW B;  2RHQ B;  4B3S Q;  4JV5 Q;  1VS0 A;  1E1O A;  1E3P A;  1VQB A;  2ZM6 L;  4A93 H;  4A3G G;  1EUJ A;  1JB7 A;  2VQE Q;  3M4O H;  2ZTE A;  4GOP B;  3I7F A;  3S1M H;  1Z47 A;  4OXP A;  5IYB G;  3K7A H;  4BY7 G;  1WFQ A;  5C0X I;  2N3S A;  3HKZ E;  2K75 A;  1EFW A;  1WJJ A;  3STB C;  4A3K H;  3S15 H;  4NB3 A;  1KAW A;  3BJU A;  5J3B A;  2ZJR A;  3GTM H;  1G29 1;  1FVI A;  2YYZ A;  2B3G A;  4JG2 A;  1SE8 A;  4O2D A;  3CCS A;  3CCV A;  2ZJQ A;  4LUV A;  4UY8 C;  4LFC Q;  1SFO H;  2ID0 A;  2RHS B;  4J15 A;  3I56 A;  4DAM A;  2OTJ A;  4RG1 A;  2WP8 J;  5C44 G;  4DAY B;  1VQM A;  1VQK A;  2R93 H;  4X66 L;  3E9H A;  2OCE A;  3GTO H;  2JA9 A;  4IJL A;  3ULJ A;  1QVF A;  3OTO Q;  4JBW A;  4HIK A;  4HJ7 A;  4A3M G;  1Y1W G;  1EIY B;  4JBK A;  3PO2 G;  3FP9 A;  4JOI A;  5BR8 Q;  1UE1 A;  1YHQ A;  1N8R C;  1EOV A;  3HOU G;  1RL2 A;  2MO1 A;  3ULP A;  2Q2H A;  1JT8 A;  4OO1 I;  4JCV E;  3K81 C;  4DPG A;  1N33 L;  3I2Z A;  2Q2I A;  4JI6 L;  3HKZ G;  4LF6 Q;  1I6H H;  3F8T A;  3NEL A;  4APV A;  1Q1E A;  2E2J H;  1LYL A;  1K8A C;  1PH1 A;  4Y7N H;  1VQN A;  2JA7 H;  3L0O A;  2JJQ A;  3UDI A;  3RNU A;  2AHO B;  5M5W H;  1VQI A;  4A3B G;  1NTG A;  5H1S E;  1DGS A;  3UDF A;  3NEM A;  3HOZ G;  3Q8D A;  4LFB L;  1KRS A;  1WI5 A;  4B3T Q;  4ALP A;  4BBS G;  4HIM A;  3H3V I;  4NPS A;  3F2C A;  1XPU A;  4RMF A;  4XIG S;  4B3S L;  4JV5 L;  2HHH Q;  2JA5 H;  3SGI A;  1WOC A;  2NVY H;  4A3D G;  1Y1V H;  1YHA A;  4YHH Q;  2A8V A;  2VQF Q;  2R92 H;  2JA8 G;  1OXV A;  4DUY Q;  1YEZ A;  2RCN A;  1XNR Q;  5GRO A;  3T1H L;  3I4M H;  3CMA A;  1GVP A;  1XTD A;  4DV3 L;  4LF5 L;  1TWH H;  5HGQ A;  3F2D A;  2GN5 A;  4JI2 Q;  1N34 Q;  1T9H A;  5IYC G;  1KQS A;  3GTL H;  1VQH A;  1JJG A;  4GNX B;  2KCM A;  3HOY H;  4DV2 Q;  3GTQ H;  2FXQ A;  4A3J G;  3S14 H;  4A3C G;  4OWW B;  4A3F G;  4IPH A;  2YV5 A;  1TWG H;  2XTI A;  1XNQ L;  1SRO A;  4TQU S;  3F2B A;  1VQ8 A;  3KFU A;  2ALY B;  3KF8 B;  1BVS A;  3W5O A;  4A4I A;  1VQO A;  1YIJ A;  4B3M L;  4C3J H;  4NXM Q;  5C3E H;  4A3I H;  4LUZ A;  2N8N A;  4K0K L;  1J5E L;  3OTO L;  1PV4 A;  2GVB A;  1JE5 A;  5IWA Q;  1BKB A;  2HQL A;  1IL2 A;  4HJ9 A;  2NVQ H;  5BR8 L;  5IY0 A;  2V1C C;  3H0G H;  3ZJY C;  4QGU A;  2KCT A;  4IOC A;  1HNX L;  4JI3 L;  1VQ9 A;  4P72 A;  4GOP A;  3PUV A;  4JI4 L;  1PH5 A;  2UUA Q;  1JJC B;  3J80 c;  1K0R A;  3G6E A;  1GD7 A;  1U5K A;  4EX5 A;  3RN5 A;  1YIT A;  4LF6 L;  1VQL A;  4LF4 Q;  2ES2 A;  4YCU A;  2VS1 A;  5GAE C;  4DV1 Q;  2Z6K A;  1G51 A;  4UP8 A;  1M1K C;  4DKA C;  1S3O A;  2R93 G;  3U4V A;  1V1Q A;  3IRB A;  4KLK A;  2NZH A;  3EN2 A;  2JEB I;  3I55 A;  4AQY Q;  2IT1 A;  1HR0 L;  1UE5 A;  1LTL A;  5M3M G;  1B7Y B;  4QJF A;  3EIV A;  2CKZ B;  4YY3 L;  1QZH A;  2DGY A;  2XGT A;  3AFQ A;  3RLF A;  2BA0 A;  1UWV A;  1IBL Q;  2LXK A;  1B70 B;  4JI7 L;  1L1O A;  1E24 A;  1IBK L;  3FKI G;  3WWV A;  5IP9 H;  1XJV A;  4DR4 L;  2UXB Q;  1VQG A;  3U4Z A;  4X62 Q;  4LF9 Q;  4GN5 A;  2I5L X;  4AH6 A;  1Z9F A;  3RN2 A;  1E7Z A;  3I4N G;  4X64 Q;  1XNR L;  1VQP A;  2CWA A;  3HOX H;  4DV6 L;  2UU9 Q;  2UXD Q;  4DNI A;  1TWA H;  2NZO A;  4HJA A;  5AJ3 L;  2KHJ A;  2VW9 A;  4DV0 Q;  3KDF A;  4PZ8 A;  1NMG A;  2WFW A;  3TEH B;  4A76 A;  1QVG A;  4JI2 L;  1N34 L;  3I4O A;  3CC7 A;  1V9P A;  4BXX H;  1Q1B A;  3S1R H;  1Q81 C;  4DR5 Q;  1MIU A;  1K73 C;  1X65 A;  2B63 G;  1I3Q H;  1I5F A;  2JA5 G;  3BZC A;  1VQ5 A;  4GKK Q;  1AE3 A;  3PCO B;  1KXL A;  4UP9 A;  4NXM L;  1N32 L;  2R92 G;  3HOV H;  2OTL A;  2E2H H;  4R4I A;  3TQY A;  3I4M G;  2EXD A;  5IWA L;  1D7Q A;  4LF8 L;  1VQC A;  4OWT B;  1PHJ A;  1C7Y A;  4DR6 Q;  3H15 A;  3L2P A;  3RLN A;  1AE2 A;  4DR7 Q;  4YWK A;  4A3L G;  3ER0 A;  4L5T A;  3E0E A;  3M3Y H;  4JOI C;  3U58 A;  1YBY A;  1XMO Q;  1NJI C;  2YTX A;  3HOY G;  5LMU Q;  4DV5 Q;  1L1O B;  1X6O A;  4IPG A;  4R4Q A;  1KD1 C;  1CKM A;  1LUZ A;  3CCR A;  1W2B A;  4LF4 L;  4NXN Q;  1HZB A;  4DUZ L;  4LF7 Q;  4GNX A;  4DV1 L;  3K0X A;  1HNZ Q;  4IFD G;  3K8A A;  3EBE A;  4HIO A;  4L5Q A;  1HZC A;  4AIM A;  5C3E G;  2YTV A;  4A3I G;  2JK8 A;  1X55 A;  3AQQ A;  1NE3 A;  3S1Q H;  4OWX B;  5HY6 A;  4MZ9 A;  4JYA L;  1HNW Q;  4AQY L;  1OTC A;  1P16 A;  3CCJ A;  3KDF B;  3H0G G;  1H95 A;  3J80 i;  3CME A;  2UUB Q;  2QEX A;  1CKO A;  3A5U A;  1IBL L;  2VUM G;  1WCM H;  2VL6 A;  1W3S A;  4BBR H;  1KL9 A;  2UXB L;  4X62 L;  4LF9 L;  2JE6 I;  2ZJP A;  1N36 L;  5IP7 G;  2OQK A;  1X9N A;  3CCM A;  4JC0 A;  2BH8 A;  3KLW A;  4DR1 Q;  2UU9 L;  4BY1 H;  3CD6 A;  2UXD L;  2L15 A;  5M5Y H;  3HOW G;  2MQH A;  2F4V Q;  4OON A;  1VQ6 A;  2K5V A;  1PFS A;  2C35 B;  1KRT A;  2PI2 A;  4R4T A;  4JI1 Q;  4L5S A;  2VQE L;  1B8A A;  2NN6 G;  5M3F H;  4DR3 Q;  1OXU A;  2QGQ A;  1NY4 A;  4B3R Q;  2D62 A;  2BA1 A;  4GLV B;  2PQA A;  3A5Z B;  2F52 A;  4LW1 A;  2E8G A;  4LFA Q;  1K9M C;  3J7A 5;  4BA2 I;  4A3G H;  1V43 A;  2EIF A;  2MNA A;  1KIX A;  3M7N A;  1K8G A;  3KF6 A;  4GKK L;  4QQB X;  4QY7 A;  1CSQ A;  4HID A;  1FJG Q;  3PO3 G;  4BY7 H;  2N49 A;  4HJ5 A;  2IY5 B;  4GN3 B;  1E1T A;  4LFC L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...