5IIFA

Crystal structure of staphylococcal nuclease variant delta+phs t62d at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFDKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS T62D at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2016-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5iifA00
2F0QA 1SYBA 4B9XA 5HURA 2QDBA 3NK9A 4ID6A 5IGGA 5KYIA 1U9RA 3D4DA 2F0HA 4NDXA 2EYPA 4ODGA 5C6AA 4QB4A 5EKLA 5CV5A 5IGFA 4NMZA 5ISRA 5KGUA 1SNPA 2M00A 3QOLA 5J1ZA 1STGA 3DMUA 4K6DA 2OEOA 4F7XA 1EY9A 2PW5A 3SK6A 1SYFA 3MEHA 3SXHA 2HQEA 3EVQA 5KIXA 2SNMA 4ME5A 5E1FA 2F0VA 1SNOA 2EYFA 5EGTA 3NQTA 4K5WA 1EY7A 3TP5A 1SNCA 4PMBA 4RKLA 5CR3A 2F0MA 2EYJA 4WRDA 5C3XA 5CGKA 3H6MA 4HTHA 3ERQA 5IGCA 4KY7A 5I9PA 1STNA 1STAA 1EYDA 4I65A 1TR5A 4J6HA 1JOKA 2ENBA 1SYDA 2KQ3A 5I6YA 5IIFA 4IZ8A 4KY5A 2F0EA 4KD4A 2PQEA 1STBA 5E3FA 5CV9A 4IUNA 5IODA 2EY1A 5IOCA 4K14A 1JOOA 2EY2A 3SK4A 3SK8A 3PMFA 3HZXA 2NUCA 1A2TA 4H7BA 3NP8A 1SYCA 4K5XA 4E6IA 2SNSA 4R8NA 5CV4A 1EY4A 3MXPA 4KJOA 5KYLA 2PZUA 3D6CA 3MVVA 3OWFA 4KV6A 5F2DA 4ZUJA 1EY5A 4KY6A 3RUZA 4KTAA 5J39A 1JOQA 1STHA 1EZ8A 2RKSA 4G57A 3C1EA 5CV6A 3TMEA 4YIJA 3OSOA 4K5VA 3QB3A 2PZWA 2RBMA 4QF4A 5NUCA 3MZ5A 3E5SA 4HMJA 3C1FA 4K8JA 4OL7A 5DEHA 3TP8A 4DGZA 4NP5A 4S3SA 1F2ZA 5K5PA 2F0WA 3T13A 4KJNA 3S9WA 4KHVA 5KRUA 4K2LA 5J22A 5DAUA 2F0JA 4WORA 1KABA 2F0TA 4LAAA 1KDBA 3NXWA 5HGTA 2F0IA 4N9TA 1KDAA 1EYCA 2F3VA 3ITPA 5C4HA 5I9OA 1SYGA 2SOBA 1SNDA 2LKVA 2OF1A 4EQPA 5C3WA 5IGEA 1EY6A 3EJIA 3BDCA 3LX0A 5EKKA 3V2TA 3DHQA 3P1HA 4PMCA 1EY0A 4PNYA 5M9OA 3HEJA 2F0UA 4DU9A 1II3A 1SNQA 2OXPA 5C4ZA 5I6WA 1A3TA 5CC4A 2F0LA 2RDFA 3SR1A 3U9OA 5IGBA 1KAAA 3NHHA 1KDCA 4K2KA 3OMGA 4KD3A 1EQVA 4TRDA 2O4XA 2EYHA 4J1MA 2F0SA 2PZTA 3P75A 4RKBA 4DFAA 1AEXA 1ENCA 1F2YA 2F0NA 2F0PA 2EYLA 1EY8A 3NUCA 3R3OA 3MHBA 5CV7A 2EYMA 1IHZA 3T16A 2F0FA 2F3WA 3EROA 3SHLA 4B9WA 2F0DA 4NKLA 5KEEA 4K8IA 4N9PA 4ZQ3A 1SYEA 1NUCA 3TP7A 2EXZA 4EQNA 2PW7A 1ENAA 4HMIA 1EYAA 2EY6A 2PYKA 1A3VA 4F8MA 4DF7A 1TT2A 1SNMA 3OMCA 1JORA 2F0KA 1NSNS 2EYOA 2EY5A 1EZ6A 3BDLA 4ZUIA 3VA5A 1TQOA 2KHSA 5JAVA 2F0OA 3D8GA 1F2MA 4EQOA 3D4WA 5CV8A 4EVOA 5JOBA 4IALA 2F0GA 4QMGA 5IGDA 1RKNA 5C5LA 3QOJA 1A3UA 2WACA 3SK5A 3TP6A 1A2UA 1STYA 5C5MA 4MIUA
chains in the Genus database with same CATH superfamily
1D5ZC 1L0YB 4UY8C 3MC0B 2K75A 1FYCA 5C0XI 3PIO3 5D65A 4HIMA 2B2WA 4MNOA 4DR7Q 3HOXB 1D6EC 1JWMD 2IPKD 2XNAC 3U50C 1P8LA 3JAMi 2Z6BA 4JI2Q 3K5NA 2K5WA 2F0MA 4A3EB 4JI1L 2N88A 1PTOD 4RHRA 3K81C 4HTHA 4DUZL 1TR5A 4CJ0B 4HSPA 2PQEA 5E3FA 4J8QA 1S5ED 4FDBA 1MI2A 4O1NA 1DZ1A 1SYCA 3NWSA 4KKTA 5K36G 1H9MA 2L55A 4A3JG 1MKHA 4IFDH 3O13A 4DK0A 2EDGA 2VUMH 3QB3A 4P73A 3J80c 4DGZA 5CYUA 2FMCA 2MHVA 2Y0SG 5AJ3Q 1IBKL 1S5BD 3FMCA 1XJVA 3NXWA 4DN4M 2E76C 4JI6Q 2OTLA 1SNDA 2MGSA 1Q46A 2K33A 4M8AA 2MFIA 2J0TD 3CCLA 3HOVG 1PFNA 1JWSD 1PZJD 2CCZA 1HR0L 2M2LA 1D1IA 2WB1B 1HQMC 1KAAA 2JA5G 2UU9Q 2A19A 4K2KA 3MXUA 5IP9H 3H0GB 3CCRA 2WB1E 1HXYD 3L3OC 1SEBD 3Q8DA 4F87A 1WJJA 3E3XA 1AH9A 1CQVA 3NBIA 4FO2A 1CTMA 3ULLA 1H9KA 2QKIC 3TP7A 3PF4A 1K8GA 4CHTB 2LMCB 3BYTB 1BKBA 1BUVT 4A3KH 3AMUA 4JBJA 3H09A 1PZKD 1TQOA 4FXDA 4QL5A 4HIDA 3NTHA 1QNUA 5M3MB 5LMUL 4GNXC 1M1KC 5LL6S 4DUZQ 5FJ8G 2KECA 3M7GA 2ZJRA 3K7AB 4YCWA 5COYA 3F2CA 2K7VA 1WI5A 4OWTB 1VQGA 5C44B 4JYAQ 3K6OA 4ZCKA 3TSSA 1GUWA 1B3AA 4NDXA 1B9NA 1KQSA 4ODGA 1A8VA 5GADC 5CV5A 5ISRA 1SNPA 4DXFA 3T1HQ 5C3EG 3SK6A 1CKNB 1JE4A 3BZDB 3M4OH 4BXXH 4U68A 1ILQA 4CDEC 1SNOA 5C0XG 2UUCQ 2K28A 3OTOL 5CGKA 3PUZA 4IZ8A 2OQ0A 4IUNA 4X66L 1HCZA 3CAMA 4Y7NH 2J7ZA 2E5LL 4L5RC 4E6IA 2IHEA 1B70B 1STEA 2UXDQ 1J5EL 1SFOH 2F4IA 1GM5A 1VQPA 1JOQA 3FDTA 3RUZA 2JJQA 1LTID 5M5WB 4KHVA 3J7AV 1HNXQ 1Q90A 3NPPA 4WORA 2PPBC 3MFYA 2FJ2A 3PIPA 3TRZA 5CMDA 5FOBB 4A93G 4TVAB 1V1PB 2GN5A 1Q81C 2ALYB 3F1ZA 4H44C 2AQ3B 2QA4A 1NE3A 2NVYH 1YJWA 3NHHA 1D8LA 4C1NK 2IY5B 1EY8A 1IL8A 5CV7A 3B6YA 2CWAA 3M3YH 4JBMA 4ZQ3A 3KYHC 2IX0A 1EYAA 3ICEA 4L5SA 3H94A 2E74C 2UUAL 2MPMA 4A76A 4FF2A 2IWHA 3OTOQ 1F2MA 4Q0FA 1N32L 2YTVA 4X3TA 4K6LA 5IGDA 1CK1A 1YIJA 3HOWB 4XT3B 5GROA 2Z4HA 1E0BA 4X66Q 1U0LA 4DV2Q 5IGGA 5HURA 1UE6A 2BA1A 1K3RA 1NMGA 4KHPL 3CRKC 1V1OA 2NB0A 4HCSA 1J5EQ 4NMZA 5KGUA 2I07B 2K50A 1BO0A 2K1BA 1GXDC 3GTOB 2RA4A 4L63B 1F9QA 4IPGA 3HFZB 1XPOA 3HS0C 1JJ2A 5DM63 1Q12A 1MJEA 2E2JB 3MXNB 2EE1A 2EYJA 5JVG3 2N55A 3I8ZA 4KLKA 2ZTEA 3HGBA 3S17H 1HUMA 2KQ3A 1N8RC 3W1BA 4LF9L 4LF4L 4DNIA 3WOFA 2HD3A 3TS0A 1K28A 1K8MA 3L7ZC 4LF5L 4L6TB 1L0XB 1A2TA 1WCMB 5CV4A 3AU7A 4KJOA 1QILA 3U9SA 3CKIB 4K0KL 1STHA 4HJAA 3I4OA 3TMEA 3I4MH 4QF4A 4POGA 4HMJA 1VMPA 2JYOA 5IE8A 4YHHL 3CW2C 1K83B 1I4HA 1CUKA 1KLGD 2F0WA 1B44D 1BCPC 1Q8IA 2VB2X 2JA6B 1D1KA 2WAQG 2R93H 1HTLD 1KABA 1PDQA 3ITPA 2BH2A 1QCBD 4RMFA 1AP0A 2V4DA 2ICEC 4LK1C 2ZM6L 1SROA 2AUKA 1SNQA 4B3MQ 3CMAA 1J6QA 1XTCD 4JCVE 3HOVB 4YCVA 3NQIA 4Y52H 2JA5B 3LNNA 2QILA 1NAPA 2R7ZB 2Z0SA 2A74C 2EY6A 1Q8KA 1B2TA 1N9WA 2L0CA 2SEBD 2ZXRA 3OMCA 1X3FA 2D2CC 2DN8A 5EJWA 3VA5A 2QEXA 4KKUA 4UAIA 1XYIA 2A1AA 5JAVA 2F0OA 2FMMA 4BY7H 3JC66 5D3IB 1CHPD 1OXVA 3CD6A 2GA4B 1AN8A 4IALA 5C0XJ 2IL8A 5KNCA 2Z4IA 1RL2A 4MIUA 1SYBA 1XMOQ 4ZYSA 5IWAL 1B1ZA 1W6KA 5HY6A 2E2IH 2ZT9C 3S2DB 1EIHA 1PLFA 3M4PA 1CZWA 3GP7A 2GVAA 1EEID 3S14B 3HP3A 3MEHA 3KUPA 3G4SA 1TWFB 2HQEA 4JW0A 3MAQA 2VW9A 2EYFA 4GKJL 1IYVA 1LT6D 4FP5D 3GTPH 1HA5A 1LT5D 1W6JA 3ERQA 4KY7A 4HJ8A 4LF8L 1KNEA 1V43A 4J6HA 4KKSA 4X3SA 1TWHB 3GTLH 2JA9A 4JG2A 3K7UC 1ML0D 1U4PA 5IP7G 3SK4A 3HOXG 1R9TB 3I7FA 4K5XA 2J4XA 1Z47A 4FXKC 5KYLA 3A0JA 3AQQA 4A3EG 2EJGC 3A74A 1J9OA 1QUQA 1PTOH 4ZK9B 3RZDH 1QVGA 1VQCA 1VQKA 4MTKA 3HOYB 5DAUA 1ZYRD 1PFBA 2DJFC 5C4HA 2I5LX 2B29A 4DKAC 3KJPA 1EYGA 4IPHA 3JAMc 1GHKA 3QWNA 1K9MC 2HDMA 1JICA 1PVOA 1YNNC 1CM9A 4X62L 3UDIA 2A68C 3SR1A 1KL9A 1LO5D 1EFWA 3OMGA 2F0SA 5IWAQ 1ESRA 3NUCA 1Q82C 3PUVA 2K01A 2KCTA 3CQZH 4BY1H 4GZYC 2CKZB 5ELBA 2F0DA 4NKLA 1M90C 2A69C 2NVTH 2HCCA 2HIXA 4R4CA 1L1OC 4C2MH 2F0KA 2WB1G 4AH6A 4DV7Q 3H0GG 3BVZA 4DUYQ 3U4VA 1XPRA 3FRPB 1K8OA 1RKNA 3TS2A 3URYA 1S72A 3QOJA 1A2UA 3G48A 3V96A 4ID6A 2G9HD 3J81c 2CHBD 4A3BG 2NTTA 2EYPA 1EQRA 1EWHA 2CQOA 3LGJA 1L2FA 4UP8A 4WFN3 2RVLA 2CH4A 3DMUA 2BH8A 4K6DA 2OEOA 1L1OA 3OWEB 5M3MG 1I3QB 1UAPA 2AUJD 3K8AA 3OOCA 5ELFA 3GTJH 4UPAA 3H15A 2A5HA 5FLMG 1WD1A 1VQAA 3R8BA 3NQTA 2KCNA 4PMWA 4WRDA 1BCPD 3RLFA 5C44G 1ZEQX 4LF7L 3CRLC 3CCEA 1EYDA 1LUZA 4F88A 4RGMA 4OO1I 4X3UA 3FPPA 4X62Q 3A5UA 2NUCA 3S16B 1Y8OB 3CPFA 1S3OA 2NWGA 4A3CH 1PH9A 1EY5A 4RCNA 1X3PA 2R61A 3OSOA 2RBMA 5NUCA 2KOLA 3MZ5A 4KHZA 2MUYA 1HHVA 1UE1A 3S9WA 1F2ZA 1NY4A 2FHTA 2QDLA 2JK8A 4RGNA 2K52A 4K2LA 1EWCA 4P72A 3C2PA 3I2ZA 3A8JE 1CQFA 4OIKA 1BNZA 1JE5A 2X69A 2KEDA 3KLSX 2LXKA 2NN6H 3BYYB 3D6WA 1X9NA 2F52A 3GTMB 5IYDH 2D5DA 1FNWA 3HEJA 4OGQC 1JB7A 1VQ8A 1QWYA 4BWGB 4DR7L 4DV6L 2B2VA 3S2HB 1YJNA 4DAPA 1ZKOA 2F0PA 1GHJA 2WV6D 2VZAA 3C3LA 3TDQA 5C4JB 2F0FA 3SHLA 2IJ0A 3W3AA 4B9WA 2XRQD 4DNRB 4ZKCB 1XNQQ 3M9BA 4OIJA 4JI2L 4EQNA 4ILWA 5JEAH 3D0FA 4F8MA 4TKOB 3BDOA 1TT2A 5A35A 3N52A 2FFKB 3IRBA 4A3IB 2KHSA 2MO0A 1CT1D 1EQTA 4C3HG 5JPNC 4UP9A 2PO4A 1YBYA 3S1MH 3OW2A 3HOZB 4RHSA 4A75A 3T56B 2JA7H 2NVXH 2A73B 2XGTA 4MN3A 2EVBA 4BBSB 1OTCA 1I6HB 4MZ9A 3ND9A 3NBHB 3PCOB 1FVIA 1STGA 1TY2A 4H0LC 4JI6L 1EY9A 1XWEA 2WIIB 2HCIA 2FINB 2B8FA 3SXHA 4QCLA 3HOWG 5L37A 4NXNQ 1LT4D 2KVMA 2K5QA 2R3ZA 5FO7B 1SNCA 5CR3A 4IOCA 1VQMA 2NVQH 5D3DA 1CA6A 4A3LH 1TWCB 3CCJA 2X6GA 1S5FD 2NZOA 3I91A 4PZ8A 1CKNA 1GJXA 2K05A 4IJHA 5CV9A 2EY1A 1YEZA 2YU9B 2EY2A 3E9HA 1A62A 1JMCA 3DWAA 1F2LA 4AIMA 2SNSA 1YNND 2CFMA 1LT3D 4DV6Q 4KN7C 2IT1A 1BDOA 2A68D 1YI2A 4A3MH 4A3DH 4OO1G 1C7YA 2UXCQ 1I4PA 4K8JA 1E2ZA 1GD7A 1EFID 2R92H 4DR6Q 4QUFA 3A5ZB 4DR1L 1W2BA 3V05A 3BU2A 5HGTA 5LMNW 4JI7Q 1LTLA 1WCMG 2B63H 2A69D 4ZAIA 3PUYA 1YHQA 1QOHA 5C3WA 4X3KA 4JYAL 3P1HA 2ZJQA 1EY0A 4V190 1HR0W 1PFSA 3ULPA 2HUGA 2RDFA 3K59A 1ASZA 2RF4A 3T1HL 4JI0L 3G6EA 1EQVA 2JA6G 3NE5B 1V1PA 4OXPA 1EOVA 2PI2E 2UUCL 1EIYB 4DR4Q 4A4IA 4DAYB 1ENAA 3I90A 1MSGA 2Z8LA 5JVH3 1CSQA 4A3FG 1EOTA 1I4GA 4DAMA 3I72A 2NZ1D 1K0RA 1X3EA 3VDYA 1IKMA 1TWGB 5TSSA 1WTWA 3S1NB 2UXBQ 1Y8NB 5CV8A 4JI3L 2UXDL 1PYSB 1JT8A 3EFXD 3RLOA 1JC7A 1DCZA 4IUPA 2VQFQ 2R7ZG 5K36H 1IBML 4A3JH 2DNCA 4NXML 1BF4A 2MP1A 2K6AA 3S1QB 1K73C 3I4NB 1HNXL 4QB4A 3CCUA 3GTGB 4A3BB 3QOLA 1MHWC 2YTXA 2K32A 2O2LD 4IUTA 2RCFA 2JA8B 1HNZL 4DR2Q 1QG7A 1G6ZA 4QQBX 2ZXPA 2JE6I 4R8IA 4PMBA 2RHSB 1T9HA 1V9PA 4DR1Q 3I70A 1PV4A 3H6MA 1SDFA 5I9PA 4DV3L 1GUOA 1STNA 1FD7D 3VYTA 3HOVH 1PRTB 4HIKA 3J7A5 3MXNA 2PQAB 3PMFA 1XPUA 1BCPF 4JI0Q 1Y14B 4CBVA 2P5ZX 3T53B 4X65Q 4GLXA 3S1RB 1QE6A 2RKSA 2CW0D 2Z9HA 4A3GH 5EBDA 3J81j 3VR3A 4B3SL 2Z1CA 3C1FA 2K4KA 1EU4A 1SMYC 4OWWB 3FP9A 4KJNA 3J7AF 2BE5C 1WTRA 1DONA 3CC4A 3PIOA 1C0AA 1X3GA 1K8AC 2F3VA 1EYCA 1R4QB 1JR0D 3CCVA 1H9SB 3J7ZC 1PH3A 1WVLA 4DV2L 3RLNA 1E2VA 1FJGQ 3K57A 2D9UA 4JI3Q 1NR2A 2OXPA 3RN2A 4IQZA 3FKIB 2FXQA 3HOYG 4TRDA 1IBMQ 2R6GA 2PNHA 4P74A 3HKSA 1DXMA 3X3MA 4NXMQ 3GTKB 5IYBG 3T16A 5C3EH 5KEEA 2B3GA 3GD7A 4HMIA 5C0XH 1TWHH 1TIID 1HNZQ 1OXXK 2ZTCA 1KRTA 2MO1A 3RZOB 2DUDA 4CDFC 2C35B 2LSSA 3PO3G 1MIUA 3TREA 2HQLA 4DV3Q 1E1TA 1JB3A 1F9SA 2B8GA 1PH5A 4C3HB 4IO9A 2EIFA 3MFGA 3FEWX 3PSIA 3KDFA 1PHJA 1PFMA 4B3TQ 1ZYRC 3PO2B 2BCOA 5DLQE 1EIFA 2F0HA 1BR9A 2HHHL 3KLRA 4EGVA 2OWOA 2K5NA 1F77A 3CCSA 3GV3A 4B3SQ 1KLUD 1Y1VB 2QF7A 5G3LD 4L5QA 1RJTA 1DGSA 5KNDA 4TQUS 2XVSA 5EPKA 1L0WA 1EY7A 3H3VI 4A93H 4L8JA 4UHVA 4B3ML 4Z9CB 4IFDJ 1TU2B 4I65A 1I50H 3PF5A 3CU7A 4B3RQ 4IUVA 1BBUA 1MJCA 4RWSC 4ME3A 4LMQD 4CJ1B 2PCFB 5ELEA 1PYBA 1EZ8A 4AYBB 4C3JG 4QY7A 3HOUG 1LV9A 3J7YW 5DEHA 1KIXA 4AYBE 5C4XH 1Y1WH 1HZ9A 4KI0A 4JVZA 1W3SA 4G4KA 4JC0A 4C1NI 1M8AA 4HR7B 1A0IA 1KDAA 4YCUA 1ESFA 2Q2IA 4GN5A 3CF5A 1EY6A 1FGBD 3BVMA 2F4VQ 1XMOL 2VUMB 2QGQA 3V2TA 1JJGA 1PTOF 1HJPA 1OXSC 3S15H 3UDXA 5BR8Q 4NB3A 3SDZA 1KDCA 1VMCA 2Q8TA 3L0OA 3DM3A 1N33Q 3ONAB 1I3QH 4J1MA 4RKBA 3DXJC 5EAYA 1G51A 3M85A 1NMFA 1TWAH 3EIVA 1TY0A 4LWCA 2Q8IB 2HHHQ 2EZVA 1PH7A 1KTKA 5H1SE 2XRSD 4GNXB 2G9DA 2LS01 1MBYA 2N78A 2KJXA 3DUZA 1FGUA 4R1JA 2PYKA 4RGOS 3CXCA 3AFPA 4LJZC 2E75C 1WTHA 4ZUIA 5FLXL 5D14A 1RF2D 4A3FB 3VR5A 1GKHA 4BBRH 3DLLA 2TMPA 3D4WA 1Y8PB 4EVOA 3S16H 3HRZC 4FF3A 2DNEA 2YV5A 3W1GA 1A63A 4O42A 2JSOA 1XNRQ 5LHY1 4NW2A 1HZBA 3NK9A 4A3KB 4BY7G 4I7AA 3AFQA 4PZ7A 4IJLA 2VL6A 2E2HH 2LXJA 3E0JA 1SE2A 1LABA 3CPWA 4A3IG 3PUXA 4OX9L 1SYFA 2BOSA 5I2YA 3VR2A 4OELB 3AB9A 3HOZG 3UE0A 1RHPA 2XTIA 4GKKL 1TS3A 1SRUA 1SMYD 1U4LA 2BE5D 1C48A 1XMQL 3SGIA 4BBSG 1VQLA 4HIOA 1FNVA 2F0EA 1Q1EA 4YY3Q 4ZRZA 4QIWB 1RIPA 3K5OA 4QIWE 4R8NA 4KMUC 3GQBA 1EL0A 1QNKA 2G5DA 1SXTA 2JEBI 4DV7L 3WDNA 4Y7NB 5M5YH 2K14A 4DUYL 4B08A 2RDGA 4ALPA 3IFTA 4GOPB 1IL2A 2F0JA 2VXWA 4HEDA 2VQEQ 1KDBA 3Q0AA 1SFOB 1GUGA 3KF8B 5M5XH 4JI5Q 3E0EA 5IGEA 5EKKA 2SDFA 3A54A 2MNAA 4CDCC 2IW3A 1N36Q 1NNXA 4NPSA 1C4QA 3EA6A 2X6LA 3I55A 1CKMA 1PH6A 4DFAA 2Q2HA 1LYLA 1AEXA 4DR5Q 1N34Q 5EBCA 2ATWA 4ZLTF 1IHZA 4DPGA 3CC2A 2CH4W 1QJOA 1ET6A 1Y69U 4OX9Q 2PW7A 5A2QE 1A3VA 2GVBA 2NVYB 1G2SA 3K58A 3W5OA 1NBWA 4GKKQ 2WP8J 3BDLA 1GOZA 3PV0A 3D8GA 1WD0A 1XMQQ 5ELDA 1JQYD 3M3YB 5IP7H 3HOXH 5C5LA 3PO3B 2WACA 2BDOA 4MHEA 5C5MA 1SLJA 4RG1A 1G6PA 3H3VC 1YHAA 4B9XA 1D5XC 3GTQB 5KYIA 1SE8A 1KC8C 4A3EH 1B3QA 5IT9L 2M00A 3CHBD 1VQ5A 3I73A 4CJ2C 4P2CB 2D62A 4XXEA 1I5FA 3M7NA 5M3FG 3TP5A 5EGTA 1TVXA 4V0BA 3NBHA 3PQIA 4POFA 4FF4A 4HJ7A 2OT2A 3N6RA 5I6YA 5IIFA 1YNJD 5G3LF 1SYDA 5DM73 2IX1A 3I4NG 4OHJA 2EOTA 3T51B 2DY8A 2A8VA 3DWPA 1ZXTA 5FLXE 1XNQL 2JA8G 3UI2A 3OPOA 5E4XA 3NELA 3VA7A 1E22A 4KY6A 1JCKB 3TP8A 3E5SA 1KXLA 4S3SA 4UDUC 1TWGH 1Z6HA 4C3JB 3HOUB 2IX3A 2O5JC 3BZCA 4C3IG 3H0GH 2ASBA 1EUJA 2F0IA 5IYCG 1G291 4DNTB 1ET9A 2SOBA 4DV1L 2RCNA 1YZ6A 3LWUA 1I6VC 1HZCA 3I4MB 3BDCA 3LX0A 4R4TA 5DNFA 1J8IA 3HKZB 4QUCA 1CFMA 5M9OA 4IFDI 1G91A 1CA5A 5C4ZA 3HKZE 4A3BH 3U9OA 2R93B 2R7DA 2WKCA 5EPJA 2O4XA 1QZGA 2N49A 2PZTA 3Q23A 2B2VC 2L12A 3VYSA 4NXNL 5M3MH 5FKAC 1PXUA 2HIVA 2XN9C 2EPBA 4GLAC 3K7AH 2EXZA 5FLMH 2L1BA 1HZAA 1Q7YC 2PI2A 4BS9A 5C44H 3FKIG 2KHIA 1A6XA 1Q86C 1B8AA 2KUMA 1BQQT 4DAYA 2H1EA 2RQXA 1I4RA 2CW0C 4HAEA 1BVSA 1VCIA 1STYA 2TSSA 4RAUC 2F0QA 1IYUA 2OCEA 4XYOA 2UXCL 1VQIA 1U9RA 2XSCA 1NR4A 4DR6L 1LTRD 2L15A 3U58A 4BY7B 4DV0Q 2KA7A 1X3QA 4JI7L 3F2DA 1Q1BA 1E24A 1H9RA 1PRTC 2H4OA 2DJGC 5GAHC 1X56A 3P20A 1H95A 2F0VA 2UUBQ 5EPLA 2E2IB 1I94Q 3H91A 2C5CA 4CGYB 3PO2G 4DV1Q 1STAA 1UWVA 4XIGS 1AW7A 4KY5A 3MA2B 3I56A 2E8GA 1EQQA 3K0XA 3RD4A 3NTKA 5M5WH 2H5XA 5JPMC 1Y1VG 2LFNA 1BOSA 4H7BA 3NP8A 4DV5Q 4DR4L 1CI3M 3GTPB 3D6CA 4KV6A 3MVVA 3ZYYX 1SJED 4KTAA 3DEOA 3J80L 1IZ6A 1WTQA 2QCPX 3GTLB 2PQAA 3QR8A 2F1MA 5KRUA 2UXBL 5GQOA 1HPCA 2PNRC 5IT9E 1V8QA 2RDHA 3NEMA 3A8KE 1KRSA 2VQFL 1KNAA 3EN2A 2VS1A 1PTOB 4AQYQ 4PNYA 3RZDB 4AYBG 5T1GA 1RTNA 1CKOA 1IW7C 1PH8A 1VQ7A 2F0LA 1BBXC 1H9SA 4DK1A 3KF6B 2EYHA 2NYZD 2JP1A 1E7ZA 3I3CA 4DR2L 2A6HC 3R3OA 3ULJA 1GUTA 2F3WA 4IFDG 4OEMB 4ABNA 1PH1A 4K8IA 1MGSA 3HOWH 2VUMG 1P16A 3NSWA 1LTTD 4OWXB 1IBLL 1B9MA 4XQJA 1TS5A 3QG1A 2DY7A 3CQZB 3KBXA 4BY1B 1S5CD 3RNUA 3SVMA 2YYZA 2BDNA 2OTJA 4RFBA 3GTOH 4X65L 1I4XA 1VQDA 1IYJB 4G7HC 2EJMA 3CC7A 1AZQA 2NVTB 2E2JH 1IKLA 4C2MB 1LLRD 2KENA 5IP9G 5FO9B 4OO1H 3KFUA 3F2UA 5EKLA 1WFQA 4XDXA 3IKJA 5J1ZA 1DJRD 2D0PA 4HCEA 2K5HA 3PIP3 1X54A 4UP7A 2I5HA 2JEAI 4IN3A 1WCMH 3RR5A 1FJGL 1FR3A 4K5WA 4LFCL 1DM0B 1O78A 1HH2P 1NTGA 4A3KG 1GO3E 1PA6A 3VYUA 1AE3A 4LUOA 5M3FB 2CQAA 1OXTA 1YVCA 4MTNA 1TS2A 3GTJB 5LMNL 4X64L 1K83H 2LY7A 4K14A 1UNSA 2JA6H 1QB5D 1VQJA 3G7LA 3J81i 3IFDA 1HFGA 2L9HA 3DWQA 4JPBW 1E3PA 1V1QA 1LM0A 1DOLA 4HJ9A 1DYQA 3EBEA 4OL7A 1D2BA 4U673 4NP5A 4LNQA 3CMEA 4A3FH 4EQ5A 2KEEA 1QVCA 4RCOA 1Z7TA 1TKWB 2F0TA 3VYRA 4BXXG 2K5VA 4TSSA 4A3GG 4N9TA 1IBLQ 1T5XD 5GAEC 2JA5H 1PH4A 4JV5L 4C3IB 3EJIA 4B3TL 3DHQA 1HTPA 3P7JA 4PMCA 2R7ZH 3AEVA 4G7OC 1YNXA 5EQ0A 4JI1Q 1MD2D 4IPDA 5JEAJ 5CC4A 2Z6KC 1TXYA 4X6AH 4KD3A 4N8X1 3K80C 2WFWA 1S40A 4R4QA 1QVFA 3QO2A 3C46A 3RMHA 2WINB 3OIQA 3A56A 2F03A 5FK9C 1DOKA 5FJ8H 1G2TA 2B2UC 4B3RL 3MEFA 2CWPA 5BN3A 2ZTDA 1JORA 3J80E 3D3RA 1PRTD 3GV6A 4LFCQ 3S2DH 4GNXA 2AMCB 3BZKA 2Z6KA 1B7YB 1IBKQ 4RGTA 4QMGA 3S14H 1TWFH 4FXGC 5LMNQ 4X64Q 1HNWL 1PZID 1SSOA 5CBEE 5LL6X 1HQRD 2V1CC 1FNUA 3R93A 3U4ZA 1KD1C 1HR0Q 2B2UA 5BN5A 3S1MB 2PW5A 1XTDA 4DV4L 4YWKA 1LTAD 2JA7B 1RTOA 2NVXB 1GUSA 4M1UB 3EVQA 2F4VL 4XYQA 1R9TH 5BN4A 1HRJA 2N8NA 1UE5A 2EJFC 1LACA 1BBWA 1B53A 5C3XA 3BVGA 5BR8L 2K5DA 3T1YL 1N33L 2L5TA 1JOKA 2B2YC 4JV5Q 4KD4A 5I2XA 4J15A 5IOCA 5IODA 3K5LA 3R2TA 4JI8L 3HOYH 3HZXA 5LMUQ 1FL0A 4GOPC 2JQOA 3OW7A 5IYBH 4DK3C 1IW7D 2NVQB 3TBIB 3TZUA 3D4RA 4JBKA 3KK7A 1SR3A 5CV6A 4P71A 4YIJA 4K5VA 2NZHA 1BXTA 3DM1A 1F9PA 4L5TA 5K5PA 4CKEA 2A6HD 4DAVA 1DD2A 1X32A 2K04A 3UDGA 2O5IC 2WKDA 2A6EC 5CORA 2B2YA 3PO3H 1VF7A 1X65A 2ES2A 3SEBA 2KCCA 4FYDA 5C4XG 1XNRL 4A3MB 4RA8A 1Y1WG 3NTIA 1XX8A 3GTQH 4A3DB 1VQFA 5A2QL 4GOPA 2R92B 2VB3X 1NJIC 3E6ZX 1A3TA 5KNBA 3KF8A 4HSVA 2N3SA 1HNWQ 5CBAE 2B63B 4I7ZC 3Q6SA 2E5LQ 2NBFA 3NENA 4ZKBB 4HN7A 1YNJC 3I4MG 3ND8A 1RD9D 4DV4Q 3HKZG 2B2TC 3TEHB 2AWNA 3CCQA 2HT1A 3M4YA 3MWYW 4YY3L 1VQ6A 1EZ6A 2R93G 1OO9B 2KBNA 4EQOA 1F9RA 4FNFA 4LW1A 3T1YQ 2RSNA 3IL8A 1PYWD 3ZJYC 5JJLA 4CKCA 3TP6A 4XTCS 2C9OA 3AYHB 1WTXA 4JBWA 2YTYA 4BBRG 2QDBA 3ERSX 4JI8Q 4CDDC 4DXGA 3TQYA 1SE4A 3J80i 4G7ZC 1UEAB 5EKIA 4C3JH 5IGFA 3HOUH 2VQEL 1E2WA 1SE3A 2B2TA 2XIWA 3S24A 3PGZA 2IHFA 4JI5L 4RH6A 4R4OA 2JXMB 2NTSA 2SNMA 2KCMA 4A3JB 4FVMA 1VF5C 4O2DA 4HJ5A 1N36L 1VQBA 2AWOA 4QGUA 4WJ3M 3SE0A 2Y0SB 1LTGD 2ENBA 4KK7A 2UUAQ 4DR5L 2Y0SE 1N34L 3KOJA 3VR6A 1C9OA 3X3NA 2QEJC 3RN5A 4H02A 1N32Q 3CCMA 5F2DA 3Q22A 4G57A 1DOMA 2VY3A 4KN4C 1S5DD 1B4OA 3GTMH 1GUNA 3CP0A 1C8CA 1WYDA 1HFNA 4KHPQ 5J3BA 2ID0A 1ICWA 3OHXC 4WJ4A 4LAAA 2OQKA 1K3BC 1UUPA 3S2HH 4C56C 3JAML 2LKVA 4EQPA 4P75A 3M4OB 2EQSA 4JOIC 5C4JH 4A3GB 4H13C 3KDFB 3ER0A 4Q5VA 1ENFA 2F0UA 3STBC 4DU9A 1II3A 4PV1C 4R4IA 2AQ1B 4BA1I 3OYYA 1AE2A 1GVPA 5IGBA 4LF9Q 3P75A 4LF4Q 4XT1B 1RODA 2F0NA 1SN8A 3PUWA 4A3IH 2MJ8A 1VS0A 2EYMA 1LTSD 4LF5Q 1M4VA 3HOZH 1YJ9A 3I4LA 3QJYA 4K0KQ 2NN6I 1SJHD 4JOIA 1OXUA 4DK6C 4DA2A 1NSNS 3A8IE 4BBSH 4YHHQ 1K0SA 1I6HH 2I5MX 4LF6L 1VQNA 5FLXc 5C3EB 2KHJA 5JOBA 3H3VH 1A3UA 3SK5A 3J81L 1VQOA 1PRTF 3TZDA 5HGQA 1O80A 4APVA 2ZM6Q 3D4DA 4LUZA 2I0QA 1EWIA 1EU3A 5C6AA 1TWCH 3KLSA 4BY1G 2B39A 2F3IA 4QJFA 2YU9H 3LWEA 2XWBB 4ME5A 1NCVA 1Q3LA 1PMRA 4IURA 1QZHA 2A6ED 1VQ4A 1JWUD 4GN3B 1STBA 4IUUA 5E4WC 2K03A 2D0OA 4LFAL 1SBBB 4A93B 3MXPA 3VR4A 2PZUA 3UDFA 3KJOA 4ZUJA 4YWLA 5J39A 1A15A 4XQNA 3G71A 1I50B 4YWMA 1KHIA 5AFWA 2L11A 2VNUD 3D31A 5JJZA 1PTOC 4FF1A 5J22A 1UE7A 1ONLA 3IAYA 3NWTA 5JJKA 2DGYA 3R2IA 2OF1A 1D7QA 4JK1C 4LF6Q 1BCPB 1U4MA 4GKJQ 5C4XB 1EIGA 3F8TA 1AZPA 1X6OA 1Y1WB 2RSOA 3QIAA 4DV0L 3FVQA 5I6WA 2HDLA 4LF8Q 3S17B 4JI4L 1EEFD 1CZGA 2ZJPA 2XWJB 1ENCA 1F2YA 1RCVD 2EYLA 3MHBA 3DEPA 4A3CG 1O7LA 5ELNA 3S1NH 2UUBL 1MSHA 1H9JA 4N9PA 1I94L 1NUCA 2MQHA 4GN4B 4IPCA 1CHQD 2JN4A 5M3FH 3S15B 3KF6A 1WOCA 1UEBA 4DF7A 3FPUB 2EYOA 1D5MC 2EY5A 3S1QH 1TWAB 4R9WA 1R4PB 3I4NH 3GTGH 4ULLA 4DV5L 4LFBL 4GS3A 3A55A 3T4AC 2NN6G 5IY0A 1RDPD 2JA8H 3OIPA 5IYDG 2M9VA 3A7LA 4OONA 3WOEA 3JAME 2CVRA 4DR3L 4LFAQ 1S4ZA 2Q8RE 4PZ6A 2ZXOA 4BBRB 3WWVA 2AHOB 3FHWA 3HG9A 4PG3A 5IT9c 4F7XA 4C3IH 1VQ9A 3TN2A 3E9IA 5KIXA 5IYCH 5E1FA 2QW7A 5JEAG 4AQYL 3F2BA 1LTBD 4CKBA 1CSPA 4RKLA 5I4DA 1WTPA 2E2HB 5ELCA 1B50A 5ELOA 1SMXA 5IGCA 3S1RH 1O7IA 5GAGC 4IOAA 1VQHA 2WAQB 1QUQB 2AQ2B 1O7YA 1JOOA 3W2DA 2AKWB 3SK8A 4N8FA 2WAQE 3BS1A 2JA7G 5JJIA 1EY4A 3STBD 4O0AA 3OWFA 4JI4Q 3C1EA 2EXDA 2PZWA 3J81E 3L2PA 3G6JB 1YHBA 2I46A 3T13A 1PH2A 1I4QA 1VQEA 3GDEA 1JJCB 1ICFB 4XQQA 1XXGA 3FKIH 4GLVB 2Q2TA 5I9OA 1SYGA 1U4RA 5E7NA 1ASYA 3KLWA 1O7ZA 5FO8B 3GTKH 3BG3A 2E2DC 4A3LG 2L4NA 3MXGA 3M4QA 4LFBQ 3EQLC 1Z9FA 5M5YB 2R7FA 1ILPA 1E1OA 4LF7Q 2BA0A 1KAWA 3MTSA 5T1IA 1WTOA 3A7AB 3RZOH 3BJUA 1U5KA 3L9AX 5M5XB 4DR3Q 1AFPA 3K0YA 3EROA 2Q2UA 4EX5A 1VDZA 2PMZB 4A3MG 1SYEA 1WTVA 4A3DG 5AJ3L 2PMZE 4C3HH 1X55A 4IUQA 3Q24A 4LUVA 4BA2I 1G8ZD 2R92G 1SNMA 2B2WC 1HUNA 1IXRA 3PO2H 4PQXA 3KBGA 1TS4A 1T5EA 3UE1A 2B63G 2RHQB 2ICIA 4WJWA 2F0GA 1SAPA 3GO5A 1Y1VH 1YITA 3K5MA 2UU9L 1HA6A 1L1OB
chains in the Genus database with same CATH topology
1D5ZC 1L0YB 3MC0B 1FYCA 5C0XI 3PIO3 5D65A 2B2WA 3HOXB 1D6EC 1JWMD 2IPKD 2XNAC 3K5NA 2K5WA 2F0MA 4A3EB 2N88A 1PTOD 4RHRA 4HTHA 1TR5A 4CJ0B 4HSPA 2PQEA 5E3FA 4J8QA 1S5ED 1MI2A 4O1NA 1DZ1A 1SYCA 3NWSA 4KKTA 5K36G 1H9MA 2L55A 4IFDH 3O13A 4DK0A 2EDGA 3QB3A 4DGZA 5CYUA 2FMCA 2MHVA 1S5BD 3FMCA 3NXWA 4DN4M 2E76C 1SNDA 2MGSA 2K33A 4M8AA 2J0TD 1PFNA 1JWSD 1PZJD 2M2LA 1D1IA 2WB1B 1HQMC 1KAAA 4K2KA 3MXUA 3H0GB 1HXYD 3L3OC 1SEBD 4F87A 1CQVA 3NBIA 4FO2A 1CTMA 1H9KA 2QKIC 3TP7A 4CHTB 2LMCB 3BYTB 1BUVT 3AMUA 3H09A 1PZKD 1TQOA 4FXDA 3NTHA 1QNUA 5M3MB 5LL6S 2KECA 3M7GA 3K7AB 5COYA 2K7VA 5C44B 1GUWA 3K6OA 3TSSA 1B3AA 4NDXA 1B9NA 4ODGA 5CV5A 5ISRA 1SNPA 4DXFA 3SK6A 1JE4A 3BZDB 4U68A 1ILQA 1SNOA 5C0XG 2K28A 5CGKA 3PUZA 4IZ8A 4IUNA 1HCZA 2J7ZA 4E6IA 1STEA 2F4IA 1JOQA 3FDTA 3RUZA 1LTID 5M5WB 4KHVA 3J7AV 1Q90A 3NPPA 4WORA 2PPBC 3MFYA 2FJ2A 5CMDA 5FOBB 1V1PB 4H44C 2AQ3B 3NHHA 4C1NK 1EY8A 1IL8A 5CV7A 4ZQ3A 2IX0A 1EYAA 3H94A 2E74C 2MPMA 4FF2A 2IWHA 1F2MA 4Q0FA 4X3TA 4K6LA 5IGDA 1CK1A 3HOWB 4XT3B 2Z4HA 1E0BA 5IGGA 5HURA 2BA1A 3CRKC 1V1OA 2NB0A 4HCSA 4NMZA 5KGUA 2I07B 1BO0A 2K1BA 1GXDC 3GTOB 2RA4A 4L63B 1F9QA 3HS0C 5DM63 1Q12A 2E2JB 2EE1A 2EYJA 5JVG3 2N55A 3I8ZA 3HGBA 1HUMA 2KQ3A 3WOFA 1K8MA 3L7ZC 4L6TB 1L0XB 1A2TA 1WCMB 5CV4A 3AU7A 4KJOA 1QILA 3U9SA 3CKIB 1STHA 3TMEA 4QF4A 4HMJA 1VMPA 2JYOA 1K83B 1I4HA 2F0WA 1KLGD 1B44D 1BCPC 1Q8IA 2VB2X 2JA6B 1D1KA 1HTLD 1KABA 1PDQA 3ITPA 1QCBD 1AP0A 2V4DA 2ICEC 4LK1C 2AUKA 1SNQA 1XTCD 3HOVB 3NQIA 2JA5B 3LNNA 2QILA 1NAPA 2R7ZB 2A74C 2EY6A 1B2TA 2L0CA 2SEBD 2ZXRA 3OMCA 2DN8A 2D2CC 5EJWA 3VA5A 4KKUA 4UAIA 1XYIA 5JAVA 2F0OA 2FMMA 5D3IB 1CHPD 1OXVA 2GA4B 1AN8A 4IALA 5C0XJ 2IL8A 5KNCA 2Z4IA 4MIUA 1SYBA 4ZYSA 1B1ZA 1W6KA 2ZT9C 3S2DB 1EIHA 1PLFA 1CZWA 3GP7A 1EEID 3S14B 3HP3A 3MEHA 3KUPA 1TWFB 2HQEA 3MAQA 2EYFA 1IYVA 1LT6D 4FP5D 1HA5A 1LT5D 1W6JA 3ERQA 4KY7A 1KNEA 1V43A 4J6HA 4KKSA 4X3SA 1TWHB 1ML0D 1U4PA 3SK4A 1R9TB 4K5XA 2J4XA 1Z47A 4FXKC 5KYLA 2EJGC 1J9OA 1PTOH 4ZK9B 3HOYB 5DAUA 1ZYRD 1PFBA 5C4HA 1GHKA 3QWNA 2HDMA 1JICA 1YNNC 1CM9A 2A68C 3SR1A 1LO5D 3OMGA 2F0SA 1ESRA 3NUCA 3PUVA 2K01A 4GZYC 5ELBA 2F0DA 4NKLA 2A69C 2HCCA 2F0KA 3BVZA 3FRPB 1K8OA 1RKNA 3URYA 3QOJA 1A2UA 3V96A 4ID6A 2G9HD 2CHBD 2NTTA 2EYPA 1EWHA 4WFN3 2RVLA 3DMUA 4K6DA 2OEOA 3OWEB 1I3QB 1UAPA 2AUJD 3OOCA 5ELFA 2A5HA 1WD1A 3R8BA 3NQTA 2KCNA 4PMWA 4WRDA 1BCPD 3RLFA 1ZEQX 3CRLC 1EYDA 4F88A 4RGMA 4OO1I 4X3UA 3FPPA 2NUCA 3S16B 1Y8OB 2NWGA 1EY5A 4RCNA 1X3PA 2R61A 3OSOA 2RBMA 5NUCA 2KOLA 3MZ5A 4KHZA 2MUYA 1HHVA 3S9WA 1F2ZA 2FHTA 4RGNA 4K2LA 1EWCA 3C2PA 3A8JE 1CQFA 4OIKA 1BNZA 2X69A 2KEDA 3KLSX 2NN6H 3BYYB 3D6WA 3GTMB 2D5DA 1FNWA 3HEJA 4OGQC 1QWYA 4BWGB 2B2VA 3S2HB 4DAPA 1ZKOA 2F0PA 1GHJA 2WV6D 3C3LA 3TDQA 5C4JB 2F0FA 3SHLA 2IJ0A 3W3AA 4B9WA 2XRQD 4DNRB 4ZKCB 4OIJA 4EQNA 4ILWA 5JEAH 4F8MA 4TKOB 3BDOA 1TT2A 5A35A 3N52A 2FFKB 4A3IB 2KHSA 1CT1D 1EQTA 4C3HG 5JPNC 2PO4A 3HOZB 4RHSA 3T56B 2A73B 4MN3A 2EVBA 4BBSB 1I6HB 3ND9A 1TY2A 1STGA 4H0LC 1EY9A 1XWEA 2WIIB 2HCIA 2FINB 2B8FA 3SXHA 4QCLA 1LT4D 2KVMA 2K5QA 2R3ZA 5FO7B 1SNCA 5CR3A 5D3DA 1CA6A 1TWCB 2X6GA 1S5FD 3I91A 1GJXA 2K05A 5CV9A 2EY1A 2YU9B 2EY2A 3DWAA 1F2LA 2SNSA 1YNND 1LT3D 4KN7C 2IT1A 1BDOA 2A68D 4OO1G 1I4PA 4K8JA 1E2ZA 1EFID 4QUFA 3V05A 5HGTA 2A69D 4ZAIA 3PUYA 1QOHA 5C3WA 4X3KA 3P1HA 1EY0A 4V190 2HUGA 2RDFA 3K59A 1EQVA 3NE5B 1V1PA 1ENAA 3I90A 1MSGA 2Z8LA 5JVH3 1EOTA 1I4GA 3I72A 2NZ1D 1IKMA 1TWGB 5TSSA 1WTWA 3S1NB 1Y8NB 5CV8A 3EFXD 1JC7A 1DCZA 4IUPA 5K36H 2DNCA 1BF4A 2MP1A 2K6AA 3S1QB 3I4NB 4QB4A 3GTGB 4A3BB 3QOLA 2K32A 2O2LD 4IUTA 2JA8B 1QG7A 1G6ZA 2ZXPA 2JE6I 4R8IA 4PMBA 3I70A 3H6MA 1SDFA 5I9PA 1GUOA 1STNA 1FD7D 3VYTA 1PRTB 3MXNA 3PMFA 1BCPF 4CBVA 3T53B 3S1RB 1QE6A 2RKSA 2CW0D 5EBDA 3VR3A 2Z1CA 3C1FA 1EU4A 1SMYC 4KJNA 3J7AF 2BE5C 1WTRA 1DONA 2F3VA 1EYCA 1R4QB 1JR0D 1H9SB 1WVLA 1E2VA 3K57A 2D9UA 1NR2A 2OXPA 4IQZA 3FKIB 4TRDA 2R6GA 1DXMA 3X3MA 3GTKB 3T16A 5KEEA 3GD7A 4HMIA 5C0XH 1TIID 1OXXK 3RZOB 1JB3A 1F9SA 2B8GA 4C3HB 3MFGA 3FEWX 1PFMA 1ZYRC 3PO2B 2BCOA 2F0HA 1BR9A 3KLRA 4EGVA 1F77A 3GV3A 1KLUD 1Y1VB 2QF7A 5G3LD 1RJTA 5KNDA 4TQUS 2XVSA 5EPKA 1EY7A 4L8JA 4Z9CB 4IFDJ 1TU2B 4I65A 3CU7A 4IUVA 4RWSC 4LMQD 4CJ1B 2PCFB 5ELEA 1EZ8A 4AYBB 4C3JG 1LV9A 3J7YW 5DEHA 4KI0A 4G4KA 4C1NI 1M8AA 4HR7B 1KDAA 1ESFA 1EY6A 1FGBD 3BVMA 2VUMB 3V2TA 1PTOF 1OXSC 3SDZA 1KDCA 1VMCA 2Q8TA 3ONAB 4J1MA 4RKBA 3DXJC 3M85A 1TY0A 2Q8IB 2EZVA 1KTKA 2XRSD 2G9DA 2LS01 1MBYA 2KJXA 3DUZA 2PYKA 4RGOS 4LJZC 2E75C 4ZUIA 5FLXL 5D14A 1RF2D 4A3FB 3VR5A 2TMPA 3D4WA 1Y8PB 4EVOA 3HRZC 4FF3A 2DNEA 4O42A 2JSOA 5LHY1 4NW2A 3NK9A 4A3KB 3E0JA 1SE2A 1LABA 3PUXA 1SYFA 2BOSA 5I2YA 3VR2A 3AB9A 1RHPA 1TS3A 1SMYD 1U4LA 2BE5D 1C48A 1FNVA 2F0EA 1Q1EA 4ZRZA 4QIWB 3K5OA 4R8NA 4KMUC 3GQBA 1EL0A 1QNKA 1SXTA 2JEBI 3WDNA 4Y7NB 4B08A 2RDGA 3IFTA 2F0JA 2VXWA 4HEDA 1KDBA 3Q0AA 1SFOB 1GUGA 5IGEA 5EKKA 2SDFA 3A54A 2IW3A 1C4QA 3EA6A 2X6LA 4DFAA 1AEXA 5EBCA 4ZLTF 1IHZA 1QJOA 1ET6A 1Y69U 2PW7A 5A2QE 1A3VA 2NVYB 1G2SA 3K58A 2WP8J 3BDLA 1GOZA 3PV0A 3D8GA 1WD0A 5ELDA 1JQYD 3M3YB 5C5LA 3PO3B 2WACA 2BDOA 4MHEA 5C5MA 3H3VC 4B9XA 1D5XC 3GTQB 5KYIA 5IT9L 2M00A 3CHBD 3I73A 4CJ2C 4P2CB 2D62A 4XXEA 3M7NA 3TP5A 5EGTA 1TVXA 4V0BA 3NBHA 4FF4A 2OT2A 3N6RA 5I6YA 5IIFA 1YNJD 5G3LF 1SYDA 5DM73 2IX1A 4OHJA 2EOTA 3T51B 2DY8A 3DWPA 1ZXTA 5FLXE 3UI2A 3OPOA 5E4XA 3VA7A 4KY6A 1JCKB 3TP8A 3E5SA 4S3SA 4UDUC 1Z6HA 4C3JB 3HOUB 2IX3A 2O5JC 4C3IG 2F0IA 1G291 4DNTB 1ET9A 2SOBA 3LWUA 1I6VC 3I4MB 3BDCA 3LX0A 5DNFA 1J8IA 3HKZB 4QUCA 1CFMA 5M9OA 4IFDI 1G91A 1CA5A 5C4ZA 3U9OA 2R93B 2WKCA 5EPJA 2O4XA 2PZTA 3Q23A 2B2VC 2L12A 3VYSA 5FKAC 1PXUA 2XN9C 2EPBA 2EXZA 2L1BA 4BS9A 1A6XA 2KUMA 1BQQT 4DAYA 2H1EA 2RQXA 1I4RA 2CW0C 4HAEA 1VCIA 1STYA 2TSSA 4RAUC 2F0QA 1IYUA 4XYOA 1U9RA 2XSCA 1NR4A 1LTRD 4BY7B 2KA7A 1X3QA 1Q1BA 1H9RA 1PRTC 2H4OA 3P20A 2F0VA 5EPLA 2E2IB 3H91A 2C5CA 4CGYB 1STAA 4XIGS 1AW7A 4KY5A 3MA2B 3RD4A 3NTKA 5JPMC 2LFNA 1BOSA 4H7BA 3NP8A 1CI3M 3GTPB 3D6CA 4KV6A 3MVVA 3ZYYX 1SJED 4KTAA 3DEOA 3J80L 1WTQA 2QCPX 3GTLB 2F1MA 5KRUA 1HPCA 2PNRC 5IT9E 1V8QA 2RDHA 3A8KE 1KNAA 1PTOB 4PNYA 3RZDB 5T1GA 1RTNA 1IW7C 2F0LA 1BBXC 1H9SA 4DK1A 2EYHA 2NYZD 2JP1A 3I3CA 2A6HC 3R3OA 1GUTA 2F3WA 4IFDG 4ABNA 4K8IA 1MGSA 3NSWA 1LTTD 1B9MA 4XQJA 1TS5A 3QG1A 2DY7A 3CQZB 3KBXA 4BY1B 1S5CD 3SVMA 2YYZA 2BDNA 4RFBA 1I4XA 4G7HC 2EJMA 1AZQA 2NVTB 1IKLA 4C2MB 1LLRD 5FO9B 4OO1H 3F2UA 5EKLA 4XDXA 3IKJA 5J1ZA 1DJRD 4HCEA 3PIP3 2JEAI 4IN3A 1FR3A 4K5WA 1DM0B 1O78A 3VYUA 5M3FB 2CQAA 1OXTA 1TS2A 3GTJB 2LY7A 4K14A 1UNSA 1QB5D 3G7LA 3IFDA 1HFGA 2L9HA 3DWQA 1DOLA 1DYQA 4OL7A 1D2BA 4U673 4NP5A 2KEEA 4RCOA 1Z7TA 1TKWB 2F0TA 3VYRA 4TSSA 4N9TA 1T5XD 4C3IB 3EJIA 3DHQA 1HTPA 3P7JA 4PMCA 4G7OC 5EQ0A 1MD2D 5JEAJ 5CC4A 4KD3A 3QO2A 3C46A 3RMHA 2WINB 3OIQA 3A56A 2F03A 5FK9C 1DOKA 1G2TA 2B2UC 5BN3A 1JORA 3J80E 3D3RA 1PRTD 3GV6A 4RGTA 4QMGA 4FXGC 1PZID 1SSOA 5CBEE 5LL6X 1HQRD 1FNUA 3R93A 2B2UA 5BN5A 3S1MB 2PW5A 1LTAD 2JA7B 1RTOA 2NVXB 1GUSA 4M1UB 3EVQA 4XYQA 5BN4A 1HRJA 2EJFC 1LACA 1B53A 5C3XA 3BVGA 2K5DA 2L5TA 1JOKA 2B2YC 4KD4A 5I2XA 5IODA 5IOCA 3K5LA 3R2TA 3HZXA 3OW7A 1IW7D 2NVQB 3TBIB 3TZUA 3D4RA 3KK7A 5CV6A 4YIJA 4K5VA 3DM1A 1BXTA 1F9PA 5K5PA 4CKEA 2A6HD 4DAVA 1DD2A 1X32A 2K04A 2O5IC 2WKDA 2A6EC 5CORA 2B2YA 1VF7A 3SEBA 2KCCA 4FYDA 4A3MB 4RA8A 3NTIA 1XX8A 4A3DB 5A2QL 2R92B 2VB3X 3E6ZX 1A3TA 5KNBA 3KF8A 4HSVA 5CBAE 2B63B 4I7ZC 3Q6SA 2NBFA 4ZKBB 4HN7A 1YNJC 3ND8A 1RD9D 2B2TC 2AWNA 3M4YA 3MWYW 1EZ6A 1OO9B 4EQOA 1F9RA 4FNFA 2RSNA 3IL8A 1PYWD 4CKCA 3TP6A 4XTCS 2C9OA 1WTXA 4JBWA 2QDBA 4DXGA 1SE4A 4G7ZC 1UEAB 5EKIA 5IGFA 1E2WA 1SE3A 2B2TA 2XIWA 4RH6A 2JXMB 2NTSA 2SNMA 4A3JB 4FVMA 1VF5C 2AWOA 3SE0A 2Y0SB 1LTGD 2ENBA 4KK7A 3VR6A 3X3NA 2QEJC 5F2DA 3Q22A 4G57A 1DOMA 4KN4C 1S5DD 1B4OA 1GUNA 1C8CA 1HFNA 2ID0A 1ICWA 3OHXC 4LAAA 1UUPA 4C56C 3JAML 2LKVA 4EQPA 3M4OB 4A3GB 4H13C 4Q5VA 1ENFA 2F0UA 4DU9A 1II3A 4PV1C 4BA1I 2AQ1B 5IGBA 3P75A 4XT1B 1RODA 2F0NA 3PUWA 2MJ8A 2EYMA 1LTSD 1M4VA 3I4LA 3QJYA 2NN6I 1SJHD 1OXUA 4DA2A 1NSNS 3A8IE 5C3EB 5JOBA 1A3UA 3SK5A 3J81L 1PRTF 3TZDA 1O80A 3D4DA 1EU3A 5C6AA 3KLSA 2B39A 3LWEA 2XWBB 4ME5A 1NCVA 1Q3LA 1PMRA 4IURA 2A6ED 1JWUD 1STBA 4IUUA 5E4WC 2K03A 1SBBB 4A93B 3MXPA 3VR4A 2PZUA 4ZUJA 5J39A 1A15A 4XQNA 1I50B 5AFWA 2L11A 2VNUD 3D31A 5JJZA 1PTOC 4FF1A 5J22A 1ONLA 3IAYA 3NWTA 3R2IA 2OF1A 4JK1C 1BCPB 1U4MA 5C4XB 1EIGA 1AZPA 1Y1WB 2RSOA 3QIAA 3FVQA 5I6WA 2HDLA 3S17B 1EEFD 1CZGA 2XWJB 1ENCA 1F2YA 1RCVD 2EYLA 3MHBA 3DEPA 1O7LA 1MSHA 1H9JA 4N9PA 1NUCA 1CHQD 3S15B 4DF7A 3FPUB 2EYOA 1D5MC 2EY5A 1TWAB 4R9WA 1R4PB 4ULLA 3A55A 3T4AC 2NN6G 1RDPD 3OIPA 2M9VA 3A7LA 3WOEA 3JAME 2CVRA 1S4ZA 2Q8RE 2ZXOA 4BBRB 3HG9A 4F7XA 3TN2A 5KIXA 5E1FA 5JEAG 1LTBD 4CKBA 4RKLA 5I4DA 1WTPA 2E2HB 5ELCA 1B50A 5IGCA 2WAQB 2AQ2B 1O7YA 1JOOA 3W2DA 3SK8A 3BS1A 1EY4A 3OWFA 3C1EA 2PZWA 3J81E 3G6JB 2I46A 3T13A 1I4QA 4XQQA 1XXGA 5I9OA 1SYGA 1U4RA 1O7ZA 5FO8B 3BG3A 2E2DC 2L4NA 3MXGA 3EQLC 5M5YB 1ILPA 2BA0A 3MTSA 5T1IA 1WTOA 3A7AB 3L9AX 5M5XB 1AFPA 3K0YA 3EROA 1VDZA 2PMZB 1SYEA 1WTVA 4IUQA 3Q24A 4BA2I 1G8ZD 1SNMA 2B2WC 1HUNA 4PQXA 3KBGA 1TS4A 1T5EA 2ICIA 4WJWA 2F0GA 1SAPA 3GO5A 3K5MA 1HA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0Q A;  1SYB A;  4B9X A;  5HUR A;  2QDB A;  3NK9 A;  4ID6 A;  5IGG A;  5KYI A;  1U9R A;  3D4D A;  2F0H A;  4NDX A;  2EYP A;  4ODG A;  5C6A A;  4QB4 A;  5EKL A;  5CV5 A;  5IGF A;  4NMZ A;  5ISR A;  5KGU A;  1SNP A;  2M00 A;  3QOL A;  5J1Z A;  1STG A;  3DMU A;  4K6D A;  2OEO A;  4F7X A;  1EY9 A;  2PW5 A;  3SK6 A;  1SYF A;  3MEH A;  3SXH A;  2HQE A;  3EVQ A;  5KIX A;  2SNM A;  4ME5 A;  5E1F A;  2F0V A;  1SNO A;  2EYF A;  5EGT A;  3NQT A;  4K5W A;  1EY7 A;  3TP5 A;  1SNC A;  4PMB A;  4RKL A;  5CR3 A;  2F0M A;  2EYJ A;  4WRD A;  5C3X A;  5CGK A;  3H6M A;  4HTH A;  3ERQ A;  5IGC A;  4KY7 A;  5I9P A;  1STN A;  1STA A;  1EYD A;  4I65 A;  1TR5 A;  4J6H A;  1JOK A;  2ENB A;  1SYD A;  2KQ3 A;  5I6Y A;  5IIF A;  4IZ8 A;  4KY5 A;  2F0E A;  4KD4 A;  2PQE A;  1STB A;  5E3F A;  5CV9 A;  4IUN A;  5IOD A;  2EY1 A;  5IOC A;  4K14 A;  1JOO A;  2EY2 A;  3SK4 A;  3SK8 A;  3PMF A;  3HZX A;  2NUC A;  1A2T A;  4H7B A;  3NP8 A;  1SYC A;  4K5X A;  4E6I A;  2SNS A;  4R8N A;  5CV4 A;  1EY4 A;  3MXP A;  4KJO A;  5KYL A;  2PZU A;  3D6C A;  3MVV A;  3OWF A;  4KV6 A;  5F2D A;  4ZUJ A;  1EY5 A;  4KY6 A;  3RUZ A;  4KTA A;  5J39 A;  1JOQ A;  1STH A;  1EZ8 A;  2RKS A;  4G57 A;  3C1E A;  5CV6 A;  3TME A;  4YIJ A;  3OSO A;  4K5V A;  3QB3 A;  2PZW A;  2RBM A;  4QF4 A;  5NUC A;  3MZ5 A;  3E5S A;  4HMJ A;  3C1F A;  4K8J A;  4OL7 A;  5DEH A;  3TP8 A;  4DGZ A;  4NP5 A;  4S3S A;  1F2Z A;  5K5P A;  2F0W A;  3T13 A;  4KJN A;  3S9W A;  4KHV A;  5KRU A;  4K2L A;  5J22 A;  5DAU A;  2F0J A;  4WOR A;  1KAB A;  2F0T A;  4LAA A;  1KDB A;  3NXW A;  5HGT A;  2F0I A;  4N9T A;  1KDA A;  1EYC A;  2F3V A;  3ITP A;  5C4H A;  5I9O A;  1SYG A;  2SOB A;  1SND A;  2LKV A;  2OF1 A;  4EQP A;  5C3W A;  5IGE A;  1EY6 A;  3EJI A;  3BDC A;  3LX0 A;  5EKK A;  3V2T A;  3DHQ A;  3P1H A;  4PMC A;  1EY0 A;  4PNY A;  5M9O A;  3HEJ A;  2F0U A;  4DU9 A;  1II3 A;  1SNQ A;  2OXP A;  5C4Z A;  5I6W A;  1A3T A;  5CC4 A;  2F0L A;  2RDF A;  3SR1 A;  3U9O A;  5IGB A;  1KAA A;  3NHH A;  1KDC A;  4K2K A;  3OMG A;  4KD3 A;  1EQV A;  4TRD A;  2O4X A;  2EYH A;  4J1M A;  2F0S A;  2PZT A;  3P75 A;  4RKB A;  4DFA A;  1AEX A;  1ENC A;  1F2Y A;  2F0N A;  2F0P A;  2EYL A;  1EY8 A;  3NUC A;  3R3O A;  3MHB A;  5CV7 A;  2EYM A;  1IHZ A;  3T16 A;  2F0F A;  2F3W A;  3ERO A;  3SHL A;  4B9W A;  2F0D A;  4NKL A;  5KEE A;  4K8I A;  4N9P A;  4ZQ3 A;  1SYE A;  1NUC A;  3TP7 A;  2EXZ A;  4EQN A;  2PW7 A;  1ENA A;  4HMI A;  1EYA A;  2EY6 A;  2PYK A;  1A3V A;  4F8M A;  4DF7 A;  1TT2 A;  1SNM A;  3OMC A;  1JOR A;  2F0K A;  1NSN S;  2EYO A;  2EY5 A;  1EZ6 A;  3BDL A;  4ZUI A;  3VA5 A;  1TQO A;  2KHS A;  5JAV A;  2F0O A;  3D8G A;  1F2M A;  4EQO A;  3D4W A;  5CV8 A;  4EVO A;  5JOB A;  4IAL A;  2F0G A;  4QMG A;  5IGD A;  1RKN A;  5C5L A;  3QOJ A;  1A3U A;  2WAC A;  3SK5 A;  3TP6 A;  1A2U A;  1STY A;  5C5M A;  4MIU A; 
#chains in the Genus database with same CATH topology
 1D5Z C;  1L0Y B;  4UY8 C;  3MC0 B;  2K75 A;  1FYC A;  5C0X I;  3PIO 3;  5D65 A;  4HIM A;  2B2W A;  4MNO A;  4DR7 Q;  3HOX B;  1D6E C;  1JWM D;  2IPK D;  2XNA C;  3U50 C;  1P8L A;  3JAM i;  2Z6B A;  4JI2 Q;  3K5N A;  2K5W A;  2F0M A;  4A3E B;  4JI1 L;  2N88 A;  1PTO D;  4RHR A;  3K81 C;  4HTH A;  4DUZ L;  1TR5 A;  4CJ0 B;  4HSP A;  2PQE A;  5E3F A;  4J8Q A;  1S5E D;  4FDB A;  1MI2 A;  4O1N A;  1DZ1 A;  1SYC A;  3NWS A;  4KKT A;  5K36 G;  1H9M A;  2L55 A;  4A3J G;  1MKH A;  4IFD H;  3O13 A;  4DK0 A;  2EDG A;  2VUM H;  3QB3 A;  4P73 A;  3J80 c;  4DGZ A;  5CYU A;  2FMC A;  2MHV A;  2Y0S G;  5AJ3 Q;  1IBK L;  1S5B D;  3FMC A;  1XJV A;  3NXW A;  4DN4 M;  2E76 C;  4JI6 Q;  2OTL A;  1SND A;  2MGS A;  1Q46 A;  2K33 A;  4M8A A;  2MFI A;  2J0T D;  3CCL A;  3HOV G;  1PFN A;  1JWS D;  1PZJ D;  2CCZ A;  1HR0 L;  2M2L A;  1D1I A;  2WB1 B;  1HQM C;  1KAA A;  2JA5 G;  2UU9 Q;  2A19 A;  4K2K A;  3MXU A;  5IP9 H;  3H0G B;  3CCR A;  2WB1 E;  1HXY D;  3L3O C;  1SEB D;  3Q8D A;  4F87 A;  1WJJ A;  3E3X A;  1AH9 A;  1CQV A;  3NBI A;  4FO2 A;  1CTM A;  3ULL A;  1H9K A;  2QKI C;  3TP7 A;  3PF4 A;  1K8G A;  4CHT B;  2LMC B;  3BYT B;  1BKB A;  1BUV T;  4A3K H;  3AMU A;  4JBJ A;  3H09 A;  1PZK D;  1TQO A;  4FXD A;  4QL5 A;  4HID A;  3NTH A;  1QNU A;  5M3M B;  5LMU L;  4GNX C;  1M1K C;  5LL6 S;  4DUZ Q;  5FJ8 G;  2KEC A;  3M7G A;  2ZJR A;  3K7A B;  4YCW A;  5COY A;  3F2C A;  2K7V A;  1WI5 A;  4OWT B;  1VQG A;  5C44 B;  4JYA Q;  3K6O A;  4ZCK A;  3TSS A;  1GUW A;  1B3A A;  4NDX A;  1B9N A;  1KQS A;  4ODG A;  1A8V A;  5GAD C;  5CV5 A;  5ISR A;  1SNP A;  4DXF A;  3T1H Q;  5C3E G;  3SK6 A;  1CKN B;  1JE4 A;  3BZD B;  3M4O H;  4BXX H;  4U68 A;  1ILQ A;  4CDE C;  1SNO A;  5C0X G;  2UUC Q;  2K28 A;  3OTO L;  5CGK A;  3PUZ A;  4IZ8 A;  2OQ0 A;  4IUN A;  4X66 L;  1HCZ A;  3CAM A;  4Y7N H;  2J7Z A;  2E5L L;  4L5R C;  4E6I A;  2IHE A;  1B70 B;  1STE A;  2UXD Q;  1J5E L;  1SFO H;  2F4I A;  1GM5 A;  1VQP A;  1JOQ A;  3FDT A;  3RUZ A;  2JJQ A;  1LTI D;  5M5W B;  4KHV A;  3J7A V;  1HNX Q;  1Q90 A;  3NPP A;  4WOR A;  2PPB C;  3MFY A;  2FJ2 A;  3PIP A;  3TRZ A;  5CMD A;  5FOB B;  4A93 G;  4TVA B;  1V1P B;  2GN5 A;  1Q81 C;  2ALY B;  3F1Z A;  4H44 C;  2AQ3 B;  2QA4 A;  1NE3 A;  2NVY H;  1YJW A;  3NHH A;  1D8L A;  4C1N K;  2IY5 B;  1EY8 A;  1IL8 A;  5CV7 A;  3B6Y A;  2CWA A;  3M3Y H;  4JBM A;  4ZQ3 A;  3KYH C;  2IX0 A;  1EYA A;  3ICE A;  4L5S A;  3H94 A;  2E74 C;  2UUA L;  2MPM A;  4A76 A;  4FF2 A;  2IWH A;  3OTO Q;  1F2M A;  4Q0F A;  1N32 L;  2YTV A;  4X3T A;  4K6L A;  5IGD A;  1CK1 A;  1YIJ A;  3HOW B;  4XT3 B;  5GRO A;  2Z4H A;  1E0B A;  4X66 Q;  1U0L A;  4DV2 Q;  5IGG A;  5HUR A;  1UE6 A;  2BA1 A;  1K3R A;  1NMG A;  4KHP L;  3CRK C;  1V1O A;  2NB0 A;  4HCS A;  1J5E Q;  4NMZ A;  5KGU A;  2I07 B;  2K50 A;  1BO0 A;  2K1B A;  1GXD C;  3GTO B;  2RA4 A;  4L63 B;  1F9Q A;  4IPG A;  3HFZ B;  1XPO A;  3HS0 C;  1JJ2 A;  5DM6 3;  1Q12 A;  1MJE A;  2E2J B;  3MXN B;  2EE1 A;  2EYJ A;  5JVG 3;  2N55 A;  3I8Z A;  4KLK A;  2ZTE A;  3HGB A;  3S17 H;  1HUM A;  2KQ3 A;  1N8R C;  3W1B A;  4LF9 L;  4LF4 L;  4DNI A;  3WOF A;  2HD3 A;  3TS0 A;  1K28 A;  1K8M A;  3L7Z C;  4LF5 L;  4L6T B;  1L0X B;  1A2T A;  1WCM B;  5CV4 A;  3AU7 A;  4KJO A;  1QIL A;  3U9S A;  3CKI B;  4K0K L;  1STH A;  4HJA A;  3I4O A;  3TME A;  3I4M H;  4QF4 A;  4POG A;  4HMJ A;  1VMP A;  2JYO A;  5IE8 A;  4YHH L;  3CW2 C;  1K83 B;  1I4H A;  1CUK A;  1KLG D;  2F0W A;  1B44 D;  1BCP C;  1Q8I A;  2VB2 X;  2JA6 B;  1D1K A;  2WAQ G;  2R93 H;  1HTL D;  1KAB A;  1PDQ A;  3ITP A;  2BH2 A;  1QCB D;  4RMF A;  1AP0 A;  2V4D A;  2ICE C;  4LK1 C;  2ZM6 L;  1SRO A;  2AUK A;  1SNQ A;  4B3M Q;  3CMA A;  1J6Q A;  1XTC D;  4JCV E;  3HOV B;  4YCV A;  3NQI A;  4Y52 H;  2JA5 B;  3LNN A;  2QIL A;  1NAP A;  2R7Z B;  2Z0S A;  2A74 C;  2EY6 A;  1Q8K A;  1B2T A;  1N9W A;  2L0C A;  2SEB D;  2ZXR A;  3OMC A;  1X3F A;  2D2C C;  2DN8 A;  5EJW A;  3VA5 A;  2QEX A;  4KKU A;  4UAI A;  1XYI A;  2A1A A;  5JAV A;  2F0O A;  2FMM A;  4BY7 H;  3JC6 6;  5D3I B;  1CHP D;  1OXV A;  3CD6 A;  2GA4 B;  1AN8 A;  4IAL A;  5C0X J;  2IL8 A;  5KNC A;  2Z4I A;  1RL2 A;  4MIU A;  1SYB A;  1XMO Q;  4ZYS A;  5IWA L;  1B1Z A;  1W6K A;  5HY6 A;  2E2I H;  2ZT9 C;  3S2D B;  1EIH A;  1PLF A;  3M4P A;  1CZW A;  3GP7 A;  2GVA A;  1EEI D;  3S14 B;  3HP3 A;  3MEH A;  3KUP A;  3G4S A;  1TWF B;  2HQE A;  4JW0 A;  3MAQ A;  2VW9 A;  2EYF A;  4GKJ L;  1IYV A;  1LT6 D;  4FP5 D;  3GTP H;  1HA5 A;  1LT5 D;  1W6J A;  3ERQ A;  4KY7 A;  4HJ8 A;  4LF8 L;  1KNE A;  1V43 A;  4J6H A;  4KKS A;  4X3S A;  1TWH B;  3GTL H;  2JA9 A;  4JG2 A;  3K7U C;  1ML0 D;  1U4P A;  5IP7 G;  3SK4 A;  3HOX G;  1R9T B;  3I7F A;  4K5X A;  2J4X A;  1Z47 A;  4FXK C;  5KYL A;  3A0J A;  3AQQ A;  4A3E G;  2EJG C;  3A74 A;  1J9O A;  1QUQ A;  1PTO H;  4ZK9 B;  3RZD H;  1QVG A;  1VQC A;  1VQK A;  4MTK A;  3HOY B;  5DAU A;  1ZYR D;  1PFB A;  2DJF C;  5C4H A;  2I5L X;  2B29 A;  4DKA C;  3KJP A;  1EYG A;  4IPH A;  3JAM c;  1GHK A;  3QWN A;  1K9M C;  2HDM A;  1JIC A;  1PVO A;  1YNN C;  1CM9 A;  4X62 L;  3UDI A;  2A68 C;  3SR1 A;  1KL9 A;  1LO5 D;  1EFW A;  3OMG A;  2F0S A;  5IWA Q;  1ESR A;  3NUC A;  1Q82 C;  3PUV A;  2K01 A;  2KCT A;  3CQZ H;  4BY1 H;  4GZY C;  2CKZ B;  5ELB A;  2F0D A;  4NKL A;  1M90 C;  2A69 C;  2NVT H;  2HCC A;  2HIX A;  4R4C A;  1L1O C;  4C2M H;  2F0K A;  2WB1 G;  4AH6 A;  4DV7 Q;  3H0G G;  3BVZ A;  4DUY Q;  3U4V A;  1XPR A;  3FRP B;  1K8O A;  1RKN A;  3TS2 A;  3URY A;  1S72 A;  3QOJ A;  1A2U A;  3G48 A;  3V96 A;  4ID6 A;  2G9H D;  3J81 c;  2CHB D;  4A3B G;  2NTT A;  2EYP A;  1EQR A;  1EWH A;  2CQO A;  3LGJ A;  1L2F A;  4UP8 A;  4WFN 3;  2RVL A;  2CH4 A;  3DMU A;  2BH8 A;  4K6D A;  2OEO A;  1L1O A;  3OWE B;  5M3M G;  1I3Q B;  1UAP A;  2AUJ D;  3K8A A;  3OOC A;  5ELF A;  3GTJ H;  4UPA A;  3H15 A;  2A5H A;  5FLM G;  1WD1 A;  1VQA A;  3R8B A;  3NQT A;  2KCN A;  4PMW A;  4WRD A;  1BCP D;  3RLF A;  5C44 G;  1ZEQ X;  4LF7 L;  3CRL C;  3CCE A;  1EYD A;  1LUZ A;  4F88 A;  4RGM A;  4OO1 I;  4X3U A;  3FPP A;  4X62 Q;  3A5U A;  2NUC A;  3S16 B;  1Y8O B;  3CPF A;  1S3O A;  2NWG A;  4A3C H;  1PH9 A;  1EY5 A;  4RCN A;  1X3P A;  2R61 A;  3OSO A;  2RBM A;  5NUC A;  2KOL A;  3MZ5 A;  4KHZ A;  2MUY A;  1HHV A;  1UE1 A;  3S9W A;  1F2Z A;  1NY4 A;  2FHT A;  2QDL A;  2JK8 A;  4RGN A;  2K52 A;  4K2L A;  1EWC A;  4P72 A;  3C2P A;  3I2Z A;  3A8J E;  1CQF A;  4OIK A;  1BNZ A;  1JE5 A;  2X69 A;  2KED A;  3KLS X;  2LXK A;  2NN6 H;  3BYY B;  3D6W A;  1X9N A;  2F52 A;  3GTM B;  5IYD H;  2D5D A;  1FNW A;  3HEJ A;  4OGQ C;  1JB7 A;  1VQ8 A;  1QWY A;  4BWG B;  4DR7 L;  4DV6 L;  2B2V A;  3S2H B;  1YJN A;  4DAP A;  1ZKO A;  2F0P A;  1GHJ A;  2WV6 D;  2VZA A;  3C3L A;  3TDQ A;  5C4J B;  2F0F A;  3SHL A;  2IJ0 A;  3W3A A;  4B9W A;  2XRQ D;  4DNR B;  4ZKC B;  1XNQ Q;  3M9B A;  4OIJ A;  4JI2 L;  4EQN A;  4ILW A;  5JEA H;  3D0F A;  4F8M A;  4TKO B;  3BDO A;  1TT2 A;  5A35 A;  3N52 A;  2FFK B;  3IRB A;  4A3I B;  2KHS A;  2MO0 A;  1CT1 D;  1EQT A;  4C3H G;  5JPN C;  4UP9 A;  2PO4 A;  1YBY A;  3S1M H;  3OW2 A;  3HOZ B;  4RHS A;  4A75 A;  3T56 B;  2JA7 H;  2NVX H;  2A73 B;  2XGT A;  4MN3 A;  2EVB A;  4BBS B;  1OTC A;  1I6H B;  4MZ9 A;  3ND9 A;  3NBH B;  3PCO B;  1FVI A;  1STG A;  1TY2 A;  4H0L C;  4JI6 L;  1EY9 A;  1XWE A;  2WII B;  2HCI A;  2FIN B;  2B8F A;  3SXH A;  4QCL A;  3HOW G;  5L37 A;  4NXN Q;  1LT4 D;  2KVM A;  2K5Q A;  2R3Z A;  5FO7 B;  1SNC A;  5CR3 A;  4IOC A;  1VQM A;  2NVQ H;  5D3D A;  1CA6 A;  4A3L H;  1TWC B;  3CCJ A;  2X6G A;  1S5F D;  2NZO A;  3I91 A;  4PZ8 A;  1CKN A;  1GJX A;  2K05 A;  4IJH A;  5CV9 A;  2EY1 A;  1YEZ A;  2YU9 B;  2EY2 A;  3E9H A;  1A62 A;  1JMC A;  3DWA A;  1F2L A;  4AIM A;  2SNS A;  1YNN D;  2CFM A;  1LT3 D;  4DV6 Q;  4KN7 C;  2IT1 A;  1BDO A;  2A68 D;  1YI2 A;  4A3M H;  4A3D H;  4OO1 G;  1C7Y A;  2UXC Q;  1I4P A;  4K8J A;  1E2Z A;  1GD7 A;  1EFI D;  2R92 H;  4DR6 Q;  4QUF A;  3A5Z B;  4DR1 L;  1W2B A;  3V05 A;  3BU2 A;  5HGT A;  5LMN W;  4JI7 Q;  1LTL A;  1WCM G;  2B63 H;  2A69 D;  4ZAI A;  3PUY A;  1YHQ A;  1QOH A;  5C3W A;  4X3K A;  4JYA L;  3P1H A;  2ZJQ A;  1EY0 A;  4V19 0;  1HR0 W;  1PFS A;  3ULP A;  2HUG A;  2RDF A;  3K59 A;  1ASZ A;  2RF4 A;  3T1H L;  4JI0 L;  3G6E A;  1EQV A;  2JA6 G;  3NE5 B;  1V1P A;  4OXP A;  1EOV A;  2PI2 E;  2UUC L;  1EIY B;  4DR4 Q;  4A4I A;  4DAY B;  1ENA A;  3I90 A;  1MSG A;  2Z8L A;  5JVH 3;  1CSQ A;  4A3F G;  1EOT A;  1I4G A;  4DAM A;  3I72 A;  2NZ1 D;  1K0R A;  1X3E A;  3VDY A;  1IKM A;  1TWG B;  5TSS A;  1WTW A;  3S1N B;  2UXB Q;  1Y8N B;  5CV8 A;  4JI3 L;  2UXD L;  1PYS B;  1JT8 A;  3EFX D;  3RLO A;  1JC7 A;  1DCZ A;  4IUP A;  2VQF Q;  2R7Z G;  5K36 H;  1IBM L;  4A3J H;  2DNC A;  4NXM L;  1BF4 A;  2MP1 A;  2K6A A;  3S1Q B;  1K73 C;  3I4N B;  1HNX L;  4QB4 A;  3CCU A;  3GTG B;  4A3B B;  3QOL A;  1MHW C;  2YTX A;  2K32 A;  2O2L D;  4IUT A;  2RCF A;  2JA8 B;  1HNZ L;  4DR2 Q;  1QG7 A;  1G6Z A;  4QQB X;  2ZXP A;  2JE6 I;  4R8I A;  4PMB A;  2RHS B;  1T9H A;  1V9P A;  4DR1 Q;  3I70 A;  1PV4 A;  3H6M A;  1SDF A;  5I9P A;  4DV3 L;  1GUO A;  1STN A;  1FD7 D;  3VYT A;  3HOV H;  1PRT B;  4HIK A;  3J7A 5;  3MXN A;  2PQA B;  3PMF A;  1XPU A;  1BCP F;  4JI0 Q;  1Y14 B;  4CBV A;  2P5Z X;  3T53 B;  4X65 Q;  4GLX A;  3S1R B;  1QE6 A;  2RKS A;  2CW0 D;  2Z9H A;  4A3G H;  5EBD A;  3J81 j;  3VR3 A;  4B3S L;  2Z1C A;  3C1F A;  2K4K A;  1EU4 A;  1SMY C;  4OWW B;  3FP9 A;  4KJN A;  3J7A F;  2BE5 C;  1WTR A;  1DON A;  3CC4 A;  3PIO A;  1C0A A;  1X3G A;  1K8A C;  2F3V A;  1EYC A;  1R4Q B;  1JR0 D;  3CCV A;  1H9S B;  3J7Z C;  1PH3 A;  1WVL A;  4DV2 L;  3RLN A;  1E2V A;  1FJG Q;  3K57 A;  2D9U A;  4JI3 Q;  1NR2 A;  2OXP A;  3RN2 A;  4IQZ A;  3FKI B;  2FXQ A;  3HOY G;  4TRD A;  1IBM Q;  2R6G A;  2PNH A;  4P74 A;  3HKS A;  1DXM A;  3X3M A;  4NXM Q;  3GTK B;  5IYB G;  3T16 A;  5C3E H;  5KEE A;  2B3G A;  3GD7 A;  4HMI A;  5C0X H;  1TWH H;  1TII D;  1HNZ Q;  1OXX K;  2ZTC A;  1KRT A;  2MO1 A;  3RZO B;  2DUD A;  4CDF C;  2C35 B;  2LSS A;  3PO3 G;  1MIU A;  3TRE A;  2HQL A;  4DV3 Q;  1E1T A;  1JB3 A;  1F9S A;  2B8G A;  1PH5 A;  4C3H B;  4IO9 A;  2EIF A;  3MFG A;  3FEW X;  3PSI A;  3KDF A;  1PHJ A;  1PFM A;  4B3T Q;  1ZYR C;  3PO2 B;  2BCO A;  5DLQ E;  1EIF A;  2F0H A;  1BR9 A;  2HHH L;  3KLR A;  4EGV A;  2OWO A;  2K5N A;  1F77 A;  3CCS A;  3GV3 A;  4B3S Q;  1KLU D;  1Y1V B;  2QF7 A;  5G3L D;  4L5Q A;  1RJT A;  1DGS A;  5KND A;  4TQU S;  2XVS A;  5EPK A;  1L0W A;  1EY7 A;  3H3V I;  4A93 H;  4L8J A;  4UHV A;  4B3M L;  4Z9C B;  4IFD J;  1TU2 B;  4I65 A;  1I50 H;  3PF5 A;  3CU7 A;  4B3R Q;  4IUV A;  1BBU A;  1MJC A;  4RWS C;  4ME3 A;  4LMQ D;  4CJ1 B;  2PCF B;  5ELE A;  1PYB A;  1EZ8 A;  4AYB B;  4C3J G;  4QY7 A;  3HOU G;  1LV9 A;  3J7Y W;  5DEH A;  1KIX A;  4AYB E;  5C4X H;  1Y1W H;  1HZ9 A;  4KI0 A;  4JVZ A;  1W3S A;  4G4K A;  4JC0 A;  4C1N I;  1M8A A;  4HR7 B;  1A0I A;  1KDA A;  4YCU A;  1ESF A;  2Q2I A;  4GN5 A;  3CF5 A;  1EY6 A;  1FGB D;  3BVM A;  2F4V Q;  1XMO L;  2VUM B;  2QGQ A;  3V2T A;  1JJG A;  1PTO F;  1HJP A;  1OXS C;  3S15 H;  3UDX A;  5BR8 Q;  4NB3 A;  3SDZ A;  1KDC A;  1VMC A;  2Q8T A;  3L0O A;  3DM3 A;  1N33 Q;  3ONA B;  1I3Q H;  4J1M A;  4RKB A;  3DXJ C;  5EAY A;  1G51 A;  3M85 A;  1NMF A;  1TWA H;  3EIV A;  1TY0 A;  4LWC A;  2Q8I B;  2HHH Q;  2EZV A;  1PH7 A;  1KTK A;  5H1S E;  2XRS D;  4GNX B;  2G9D A;  2LS0 1;  1MBY A;  2N78 A;  2KJX A;  3DUZ A;  1FGU A;  4R1J A;  2PYK A;  4RGO S;  3CXC A;  3AFP A;  4LJZ C;  2E75 C;  1WTH A;  4ZUI A;  5FLX L;  5D14 A;  1RF2 D;  4A3F B;  3VR5 A;  1GKH A;  4BBR H;  3DLL A;  2TMP A;  3D4W A;  1Y8P B;  4EVO A;  3S16 H;  3HRZ C;  4FF3 A;  2DNE A;  2YV5 A;  3W1G A;  1A63 A;  4O42 A;  2JSO A;  1XNR Q;  5LHY 1;  4NW2 A;  1HZB A;  3NK9 A;  4A3K B;  4BY7 G;  4I7A A;  3AFQ A;  4PZ7 A;  4IJL A;  2VL6 A;  2E2H H;  2LXJ A;  3E0J A;  1SE2 A;  1LAB A;  3CPW A;  4A3I G;  3PUX A;  4OX9 L;  1SYF A;  2BOS A;  5I2Y A;  3VR2 A;  4OEL B;  3AB9 A;  3HOZ G;  3UE0 A;  1RHP A;  2XTI A;  4GKK L;  1TS3 A;  1SRU A;  1SMY D;  1U4L A;  2BE5 D;  1C48 A;  1XMQ L;  3SGI A;  4BBS G;  1VQL A;  4HIO A;  1FNV A;  2F0E A;  1Q1E A;  4YY3 Q;  4ZRZ A;  4QIW B;  1RIP A;  3K5O A;  4QIW E;  4R8N A;  4KMU C;  3GQB A;  1EL0 A;  1QNK A;  2G5D A;  1SXT A;  2JEB I;  4DV7 L;  3WDN A;  4Y7N B;  5M5Y H;  2K14 A;  4DUY L;  4B08 A;  2RDG A;  4ALP A;  3IFT A;  4GOP B;  1IL2 A;  2F0J A;  2VXW A;  4HED A;  2VQE Q;  1KDB A;  3Q0A A;  1SFO B;  1GUG A;  3KF8 B;  5M5X H;  4JI5 Q;  3E0E A;  5IGE A;  5EKK A;  2SDF A;  3A54 A;  2MNA A;  4CDC C;  2IW3 A;  1N36 Q;  1NNX A;  4NPS A;  1C4Q A;  3EA6 A;  2X6L A;  3I55 A;  1CKM A;  1PH6 A;  4DFA A;  2Q2H A;  1LYL A;  1AEX A;  4DR5 Q;  1N34 Q;  5EBC A;  2ATW A;  4ZLT F;  1IHZ A;  4DPG A;  3CC2 A;  2CH4 W;  1QJO A;  1ET6 A;  1Y69 U;  4OX9 Q;  2PW7 A;  5A2Q E;  1A3V A;  2GVB A;  2NVY B;  1G2S A;  3K58 A;  3W5O A;  1NBW A;  4GKK Q;  2WP8 J;  3BDL A;  1GOZ A;  3PV0 A;  3D8G A;  1WD0 A;  1XMQ Q;  5ELD A;  1JQY D;  3M3Y B;  5IP7 H;  3HOX H;  5C5L A;  3PO3 B;  2WAC A;  2BDO A;  4MHE A;  5C5M A;  1SLJ A;  4RG1 A;  1G6P A;  3H3V C;  1YHA A;  4B9X A;  1D5X C;  3GTQ B;  5KYI A;  1SE8 A;  1KC8 C;  4A3E H;  1B3Q A;  5IT9 L;  2M00 A;  3CHB D;  1VQ5 A;  3I73 A;  4CJ2 C;  4P2C B;  2D62 A;  4XXE A;  1I5F A;  3M7N A;  5M3F G;  3TP5 A;  5EGT A;  1TVX A;  4V0B A;  3NBH A;  3PQI A;  4POF A;  4FF4 A;  4HJ7 A;  2OT2 A;  3N6R A;  5I6Y A;  5IIF A;  1YNJ D;  5G3L F;  1SYD A;  5DM7 3;  2IX1 A;  3I4N G;  4OHJ A;  2EOT A;  3T51 B;  2DY8 A;  2A8V A;  3DWP A;  1ZXT A;  5FLX E;  1XNQ L;  2JA8 G;  3UI2 A;  3OPO A;  5E4X A;  3NEL A;  3VA7 A;  1E22 A;  4KY6 A;  1JCK B;  3TP8 A;  3E5S A;  1KXL A;  4S3S A;  4UDU C;  1TWG H;  1Z6H A;  4C3J B;  3HOU B;  2IX3 A;  2O5J C;  3BZC A;  4C3I G;  3H0G H;  2ASB A;  1EUJ A;  2F0I A;  5IYC G;  1G29 1;  4DNT B;  1ET9 A;  2SOB A;  4DV1 L;  2RCN A;  1YZ6 A;  3LWU A;  1I6V C;  1HZC A;  3I4M B;  3BDC A;  3LX0 A;  4R4T A;  5DNF A;  1J8I A;  3HKZ B;  4QUC A;  1CFM A;  5M9O A;  4IFD I;  1G91 A;  1CA5 A;  5C4Z A;  3HKZ E;  4A3B H;  3U9O A;  2R93 B;  2R7D A;  2WKC A;  5EPJ A;  2O4X A;  1QZG A;  2N49 A;  2PZT A;  3Q23 A;  2B2V C;  2L12 A;  3VYS A;  4NXN L;  5M3M H;  5FKA C;  1PXU A;  2HIV A;  2XN9 C;  2EPB A;  4GLA C;  3K7A H;  2EXZ A;  5FLM H;  2L1B A;  1HZA A;  1Q7Y C;  2PI2 A;  4BS9 A;  5C44 H;  3FKI G;  2KHI A;  1A6X A;  1Q86 C;  1B8A A;  2KUM A;  1BQQ T;  4DAY A;  2H1E A;  2RQX A;  1I4R A;  2CW0 C;  4HAE A;  1BVS A;  1VCI A;  1STY A;  2TSS A;  4RAU C;  2F0Q A;  1IYU A;  2OCE A;  4XYO A;  2UXC L;  1VQI A;  1U9R A;  2XSC A;  1NR4 A;  4DR6 L;  1LTR D;  2L15 A;  3U58 A;  4BY7 B;  4DV0 Q;  2KA7 A;  1X3Q A;  4JI7 L;  3F2D A;  1Q1B A;  1E24 A;  1H9R A;  1PRT C;  2H4O A;  2DJG C;  5GAH C;  1X56 A;  3P20 A;  1H95 A;  2F0V A;  2UUB Q;  5EPL A;  2E2I B;  1I94 Q;  3H91 A;  2C5C A;  4CGY B;  3PO2 G;  4DV1 Q;  1STA A;  1UWV A;  4XIG S;  1AW7 A;  4KY5 A;  3MA2 B;  3I56 A;  2E8G A;  1EQQ A;  3K0X A;  3RD4 A;  3NTK A;  5M5W H;  2H5X A;  5JPM C;  1Y1V G;  2LFN A;  1BOS A;  4H7B A;  3NP8 A;  4DV5 Q;  4DR4 L;  1CI3 M;  3GTP B;  3D6C A;  4KV6 A;  3MVV A;  3ZYY X;  1SJE D;  4KTA A;  3DEO A;  3J80 L;  1IZ6 A;  1WTQ A;  2QCP X;  3GTL B;  2PQA A;  3QR8 A;  2F1M A;  5KRU A;  2UXB L;  5GQO A;  1HPC A;  2PNR C;  5IT9 E;  1V8Q A;  2RDH A;  3NEM A;  3A8K E;  1KRS A;  2VQF L;  1KNA A;  3EN2 A;  2VS1 A;  1PTO B;  4AQY Q;  4PNY A;  3RZD B;  4AYB G;  5T1G A;  1RTN A;  1CKO A;  1IW7 C;  1PH8 A;  1VQ7 A;  2F0L A;  1BBX C;  1H9S A;  4DK1 A;  3KF6 B;  2EYH A;  2NYZ D;  2JP1 A;  1E7Z A;  3I3C A;  4DR2 L;  2A6H C;  3R3O A;  3ULJ A;  1GUT A;  2F3W A;  4IFD G;  4OEM B;  4ABN A;  1PH1 A;  4K8I A;  1MGS A;  3HOW H;  2VUM G;  1P16 A;  3NSW A;  1LTT D;  4OWX B;  1IBL L;  1B9M A;  4XQJ A;  1TS5 A;  3QG1 A;  2DY7 A;  3CQZ B;  3KBX A;  4BY1 B;  1S5C D;  3RNU A;  3SVM A;  2YYZ A;  2BDN A;  2OTJ A;  4RFB A;  3GTO H;  4X65 L;  1I4X A;  1VQD A;  1IYJ B;  4G7H C;  2EJM A;  3CC7 A;  1AZQ A;  2NVT B;  2E2J H;  1IKL A;  4C2M B;  1LLR D;  2KEN A;  5IP9 G;  5FO9 B;  4OO1 H;  3KFU A;  3F2U A;  5EKL A;  1WFQ A;  4XDX A;  3IKJ A;  5J1Z A;  1DJR D;  2D0P A;  4HCE A;  2K5H A;  3PIP 3;  1X54 A;  4UP7 A;  2I5H A;  2JEA I;  4IN3 A;  1WCM H;  3RR5 A;  1FJG L;  1FR3 A;  4K5W A;  4LFC L;  1DM0 B;  1O78 A;  1HH2 P;  1NTG A;  4A3K G;  1GO3 E;  1PA6 A;  3VYU A;  1AE3 A;  4LUO A;  5M3F B;  2CQA A;  1OXT A;  1YVC A;  4MTN A;  1TS2 A;  3GTJ B;  5LMN L;  4X64 L;  1K83 H;  2LY7 A;  4K14 A;  1UNS A;  2JA6 H;  1QB5 D;  1VQJ A;  3G7L A;  3J81 i;  3IFD A;  1HFG A;  2L9H A;  3DWQ A;  4JPB W;  1E3P A;  1V1Q A;  1LM0 A;  1DOL A;  4HJ9 A;  1DYQ A;  3EBE A;  4OL7 A;  1D2B A;  4U67 3;  4NP5 A;  4LNQ A;  3CME A;  4A3F H;  4EQ5 A;  2KEE A;  1QVC A;  4RCO A;  1Z7T A;  1TKW B;  2F0T A;  3VYR A;  4BXX G;  2K5V A;  4TSS A;  4A3G G;  4N9T A;  1IBL Q;  1T5X D;  5GAE C;  2JA5 H;  1PH4 A;  4JV5 L;  4C3I B;  3EJI A;  4B3T L;  3DHQ A;  1HTP A;  3P7J A;  4PMC A;  2R7Z H;  3AEV A;  4G7O C;  1YNX A;  5EQ0 A;  4JI1 Q;  1MD2 D;  4IPD A;  5JEA J;  5CC4 A;  2Z6K C;  1TXY A;  4X6A H;  4KD3 A;  4N8X 1;  3K80 C;  2WFW A;  1S40 A;  4R4Q A;  1QVF A;  3QO2 A;  3C46 A;  3RMH A;  2WIN B;  3OIQ A;  3A56 A;  2F03 A;  5FK9 C;  1DOK A;  5FJ8 H;  1G2T A;  2B2U C;  4B3R L;  3MEF A;  2CWP A;  5BN3 A;  2ZTD A;  1JOR A;  3J80 E;  3D3R A;  1PRT D;  3GV6 A;  4LFC Q;  3S2D H;  4GNX A;  2AMC B;  3BZK A;  2Z6K A;  1B7Y B;  1IBK Q;  4RGT A;  4QMG A;  3S14 H;  1TWF H;  4FXG C;  5LMN Q;  4X64 Q;  1HNW L;  1PZI D;  1SSO A;  5CBE E;  5LL6 X;  1HQR D;  2V1C C;  1FNU A;  3R93 A;  3U4Z A;  1KD1 C;  1HR0 Q;  2B2U A;  5BN5 A;  3S1M B;  2PW5 A;  1XTD A;  4DV4 L;  4YWK A;  1LTA D;  2JA7 B;  1RTO A;  2NVX B;  1GUS A;  4M1U B;  3EVQ A;  2F4V L;  4XYQ A;  1R9T H;  5BN4 A;  1HRJ A;  2N8N A;  1UE5 A;  2EJF C;  1LAC A;  1BBW A;  1B53 A;  5C3X A;  3BVG A;  5BR8 L;  2K5D A;  3T1Y L;  1N33 L;  2L5T A;  1JOK A;  2B2Y C;  4JV5 Q;  4KD4 A;  5I2X A;  4J15 A;  5IOC A;  5IOD A;  3K5L A;  3R2T A;  4JI8 L;  3HOY H;  3HZX A;  5LMU Q;  1FL0 A;  4GOP C;  2JQO A;  3OW7 A;  5IYB H;  4DK3 C;  1IW7 D;  2NVQ B;  3TBI B;  3TZU A;  3D4R A;  4JBK A;  3KK7 A;  1SR3 A;  5CV6 A;  4P71 A;  4YIJ A;  4K5V A;  2NZH A;  1BXT A;  3DM1 A;  1F9P A;  4L5T A;  5K5P A;  4CKE A;  2A6H D;  4DAV A;  1DD2 A;  1X32 A;  2K04 A;  3UDG A;  2O5I C;  2WKD A;  2A6E C;  5COR A;  2B2Y A;  3PO3 H;  1VF7 A;  1X65 A;  2ES2 A;  3SEB A;  2KCC A;  4FYD A;  5C4X G;  1XNR L;  4A3M B;  4RA8 A;  1Y1W G;  3NTI A;  1XX8 A;  3GTQ H;  4A3D B;  1VQF A;  5A2Q L;  4GOP A;  2R92 B;  2VB3 X;  1NJI C;  3E6Z X;  1A3T A;  5KNB A;  3KF8 A;  4HSV A;  2N3S A;  1HNW Q;  5CBA E;  2B63 B;  4I7Z C;  3Q6S A;  2E5L Q;  2NBF A;  3NEN A;  4ZKB B;  4HN7 A;  1YNJ C;  3I4M G;  3ND8 A;  1RD9 D;  4DV4 Q;  3HKZ G;  2B2T C;  3TEH B;  2AWN A;  3CCQ A;  2HT1 A;  3M4Y A;  3MWY W;  4YY3 L;  1VQ6 A;  1EZ6 A;  2R93 G;  1OO9 B;  2KBN A;  4EQO A;  1F9R A;  4FNF A;  4LW1 A;  3T1Y Q;  2RSN A;  3IL8 A;  1PYW D;  3ZJY C;  5JJL A;  4CKC A;  3TP6 A;  4XTC S;  2C9O A;  3AYH B;  1WTX A;  4JBW A;  2YTY A;  4BBR G;  2QDB A;  3ERS X;  4JI8 Q;  4CDD C;  4DXG A;  3TQY A;  1SE4 A;  3J80 i;  4G7Z C;  1UEA B;  5EKI A;  4C3J H;  5IGF A;  3HOU H;  2VQE L;  1E2W A;  1SE3 A;  2B2T A;  2XIW A;  3S24 A;  3PGZ A;  2IHF A;  4JI5 L;  4RH6 A;  4R4O A;  2JXM B;  2NTS A;  2SNM A;  2KCM A;  4A3J B;  4FVM A;  1VF5 C;  4O2D A;  4HJ5 A;  1N36 L;  1VQB A;  2AWO A;  4QGU A;  4WJ3 M;  3SE0 A;  2Y0S B;  1LTG D;  2ENB A;  4KK7 A;  2UUA Q;  4DR5 L;  2Y0S E;  1N34 L;  3KOJ A;  3VR6 A;  1C9O A;  3X3N A;  2QEJ C;  3RN5 A;  4H02 A;  1N32 Q;  3CCM A;  5F2D A;  3Q22 A;  4G57 A;  1DOM A;  2VY3 A;  4KN4 C;  1S5D D;  1B4O A;  3GTM H;  1GUN A;  3CP0 A;  1C8C A;  1WYD A;  1HFN A;  4KHP Q;  5J3B A;  2ID0 A;  1ICW A;  3OHX C;  4WJ4 A;  4LAA A;  2OQK A;  1K3B C;  1UUP A;  3S2H H;  4C56 C;  3JAM L;  2LKV A;  4EQP A;  4P75 A;  3M4O B;  2EQS A;  4JOI C;  5C4J H;  4A3G B;  4H13 C;  3KDF B;  3ER0 A;  4Q5V A;  1ENF A;  2F0U A;  3STB C;  4DU9 A;  1II3 A;  4PV1 C;  4R4I A;  2AQ1 B;  4BA1 I;  3OYY A;  1AE2 A;  1GVP A;  5IGB A;  4LF9 Q;  3P75 A;  4LF4 Q;  4XT1 B;  1ROD A;  2F0N A;  1SN8 A;  3PUW A;  4A3I H;  2MJ8 A;  1VS0 A;  2EYM A;  1LTS D;  4LF5 Q;  1M4V A;  3HOZ H;  1YJ9 A;  3I4L A;  3QJY A;  4K0K Q;  2NN6 I;  1SJH D;  4JOI A;  1OXU A;  4DK6 C;  4DA2 A;  1NSN S;  3A8I E;  4BBS H;  4YHH Q;  1K0S A;  1I6H H;  2I5M X;  4LF6 L;  1VQN A;  5FLX c;  5C3E B;  2KHJ A;  5JOB A;  3H3V H;  1A3U A;  3SK5 A;  3J81 L;  1VQO A;  1PRT F;  3TZD A;  5HGQ A;  1O80 A;  4APV A;  2ZM6 Q;  3D4D A;  4LUZ A;  2I0Q A;  1EWI A;  1EU3 A;  5C6A A;  1TWC H;  3KLS A;  4BY1 G;  2B39 A;  2F3I A;  4QJF A;  2YU9 H;  3LWE A;  2XWB B;  4ME5 A;  1NCV A;  1Q3L A;  1PMR A;  4IUR A;  1QZH A;  2A6E D;  1VQ4 A;  1JWU D;  4GN3 B;  1STB A;  4IUU A;  5E4W C;  2K03 A;  2D0O A;  4LFA L;  1SBB B;  4A93 B;  3MXP A;  3VR4 A;  2PZU A;  3UDF A;  3KJO A;  4ZUJ A;  4YWL A;  5J39 A;  1A15 A;  4XQN A;  3G71 A;  1I50 B;  4YWM A;  1KHI A;  5AFW A;  2L11 A;  2VNU D;  3D31 A;  5JJZ A;  1PTO C;  4FF1 A;  5J22 A;  1UE7 A;  1ONL A;  3IAY A;  3NWT A;  5JJK A;  2DGY A;  3R2I A;  2OF1 A;  1D7Q A;  4JK1 C;  4LF6 Q;  1BCP B;  1U4M A;  4GKJ Q;  5C4X B;  1EIG A;  3F8T A;  1AZP A;  1X6O A;  1Y1W B;  2RSO A;  3QIA A;  4DV0 L;  3FVQ A;  5I6W A;  2HDL A;  4LF8 Q;  3S17 B;  4JI4 L;  1EEF D;  1CZG A;  2ZJP A;  2XWJ B;  1ENC A;  1F2Y A;  1RCV D;  2EYL A;  3MHB A;  3DEP A;  4A3C G;  1O7L A;  5ELN A;  3S1N H;  2UUB L;  1MSH A;  1H9J A;  4N9P A;  1I94 L;  1NUC A;  2MQH A;  4GN4 B;  4IPC A;  1CHQ D;  2JN4 A;  5M3F H;  3S15 B;  3KF6 A;  1WOC A;  1UEB A;  4DF7 A;  3FPU B;  2EYO A;  1D5M C;  2EY5 A;  3S1Q H;  1TWA B;  4R9W A;  1R4P B;  3I4N H;  3GTG H;  4ULL A;  4DV5 L;  4LFB L;  4GS3 A;  3A55 A;  3T4A C;  2NN6 G;  5IY0 A;  1RDP D;  2JA8 H;  3OIP A;  5IYD G;  2M9V A;  3A7L A;  4OON A;  3WOE A;  3JAM E;  2CVR A;  4DR3 L;  4LFA Q;  1S4Z A;  2Q8R E;  4PZ6 A;  2ZXO A;  4BBR B;  3WWV A;  2AHO B;  3FHW A;  3HG9 A;  4PG3 A;  5IT9 c;  4F7X A;  4C3I H;  1VQ9 A;  3TN2 A;  3E9I A;  5KIX A;  5IYC H;  5E1F A;  2QW7 A;  5JEA G;  4AQY L;  3F2B A;  1LTB D;  4CKB A;  1CSP A;  4RKL A;  5I4D A;  1WTP A;  2E2H B;  5ELC A;  1B50 A;  5ELO A;  1SMX A;  5IGC A;  3S1R H;  1O7I A;  5GAG C;  4IOA A;  1VQH A;  2WAQ B;  1QUQ B;  2AQ2 B;  1O7Y A;  1JOO A;  3W2D A;  2AKW B;  3SK8 A;  4N8F A;  2WAQ E;  3BS1 A;  2JA7 G;  5JJI A;  1EY4 A;  3STB D;  4O0A A;  3OWF A;  4JI4 Q;  3C1E A;  2EXD A;  2PZW A;  3J81 E;  3L2P A;  3G6J B;  1YHB A;  2I46 A;  3T13 A;  1PH2 A;  1I4Q A;  1VQE A;  3GDE A;  1JJC B;  1ICF B;  4XQQ A;  1XXG A;  3FKI H;  4GLV B;  2Q2T A;  5I9O A;  1SYG A;  1U4R A;  5E7N A;  1ASY A;  3KLW A;  1O7Z A;  5FO8 B;  3GTK H;  3BG3 A;  2E2D C;  4A3L G;  2L4N A;  3MXG A;  3M4Q A;  4LFB Q;  3EQL C;  1Z9F A;  5M5Y B;  2R7F A;  1ILP A;  1E1O A;  4LF7 Q;  2BA0 A;  1KAW A;  3MTS A;  5T1I A;  1WTO A;  3A7A B;  3RZO H;  3BJU A;  1U5K A;  3L9A X;  5M5X B;  4DR3 Q;  1AFP A;  3K0Y A;  3ERO A;  2Q2U A;  4EX5 A;  1VDZ A;  2PMZ B;  4A3M G;  1SYE A;  1WTV A;  4A3D G;  5AJ3 L;  2PMZ E;  4C3H H;  1X55 A;  4IUQ A;  3Q24 A;  4LUV A;  4BA2 I;  1G8Z D;  2R92 G;  1SNM A;  2B2W C;  1HUN A;  1IXR A;  3PO2 H;  4PQX A;  3KBG A;  1TS4 A;  1T5E A;  3UE1 A;  2B63 G;  2RHQ B;  2ICI A;  4WJW A;  2F0G A;  1SAP A;  3GO5 A;  1Y1V H;  1YIT A;  3K5M A;  2UU9 L;  1HA6 A;  1L1O B; 
#chains in the Genus database with same CATH homology
 1D5Z C;  1L0Y B;  3MC0 B;  1FYC A;  5C0X I;  3PIO 3;  5D65 A;  2B2W A;  3HOX B;  1D6E C;  1JWM D;  2IPK D;  2XNA C;  3K5N A;  2K5W A;  2F0M A;  4A3E B;  2N88 A;  1PTO D;  4RHR A;  4HTH A;  1TR5 A;  4CJ0 B;  4HSP A;  2PQE A;  5E3F A;  4J8Q A;  1S5E D;  1MI2 A;  4O1N A;  1DZ1 A;  1SYC A;  3NWS A;  4KKT A;  5K36 G;  1H9M A;  2L55 A;  4IFD H;  3O13 A;  4DK0 A;  2EDG A;  3QB3 A;  4DGZ A;  5CYU A;  2FMC A;  2MHV A;  1S5B D;  3FMC A;  3NXW A;  4DN4 M;  2E76 C;  1SND A;  2MGS A;  2K33 A;  4M8A A;  2J0T D;  1PFN A;  1JWS D;  1PZJ D;  2M2L A;  1D1I A;  2WB1 B;  1HQM C;  1KAA A;  4K2K A;  3MXU A;  3H0G B;  1HXY D;  3L3O C;  1SEB D;  4F87 A;  1CQV A;  3NBI A;  4FO2 A;  1CTM A;  1H9K A;  2QKI C;  3TP7 A;  4CHT B;  2LMC B;  3BYT B;  1BUV T;  3AMU A;  3H09 A;  1PZK D;  1TQO A;  4FXD A;  3NTH A;  1QNU A;  5M3M B;  5LL6 S;  2KEC A;  3M7G A;  3K7A B;  5COY A;  2K7V A;  5C44 B;  1GUW A;  3K6O A;  3TSS A;  1B3A A;  4NDX A;  1B9N A;  4ODG A;  5CV5 A;  5ISR A;  1SNP A;  4DXF A;  3SK6 A;  1JE4 A;  3BZD B;  4U68 A;  1ILQ A;  1SNO A;  5C0X G;  2K28 A;  5CGK A;  3PUZ A;  4IZ8 A;  4IUN A;  1HCZ A;  2J7Z A;  4E6I A;  1STE A;  2F4I A;  1JOQ A;  3FDT A;  3RUZ A;  1LTI D;  5M5W B;  4KHV A;  3J7A V;  1Q90 A;  3NPP A;  4WOR A;  2PPB C;  3MFY A;  2FJ2 A;  5CMD A;  5FOB B;  1V1P B;  4H44 C;  2AQ3 B;  3NHH A;  4C1N K;  1EY8 A;  1IL8 A;  5CV7 A;  4ZQ3 A;  2IX0 A;  1EYA A;  3H94 A;  2E74 C;  2MPM A;  4FF2 A;  2IWH A;  1F2M A;  4Q0F A;  4X3T A;  4K6L A;  5IGD A;  1CK1 A;  3HOW B;  4XT3 B;  2Z4H A;  1E0B A;  5IGG A;  5HUR A;  2BA1 A;  3CRK C;  1V1O A;  2NB0 A;  4HCS A;  4NMZ A;  5KGU A;  2I07 B;  1BO0 A;  2K1B A;  1GXD C;  3GTO B;  2RA4 A;  4L63 B;  1F9Q A;  3HS0 C;  5DM6 3;  1Q12 A;  2E2J B;  2EE1 A;  2EYJ A;  5JVG 3;  2N55 A;  3I8Z A;  3HGB A;  1HUM A;  2KQ3 A;  3WOF A;  1K8M A;  3L7Z C;  4L6T B;  1L0X B;  1A2T A;  1WCM B;  5CV4 A;  3AU7 A;  4KJO A;  1QIL A;  3U9S A;  3CKI B;  1STH A;  3TME A;  4QF4 A;  4HMJ A;  1VMP A;  2JYO A;  1K83 B;  1I4H A;  2F0W A;  1KLG D;  1B44 D;  1BCP C;  1Q8I A;  2VB2 X;  2JA6 B;  1D1K A;  1HTL D;  1KAB A;  1PDQ A;  3ITP A;  1QCB D;  1AP0 A;  2V4D A;  2ICE C;  4LK1 C;  2AUK A;  1SNQ A;  1XTC D;  3HOV B;  3NQI A;  2JA5 B;  3LNN A;  2QIL A;  1NAP A;  2R7Z B;  2A74 C;  2EY6 A;  1B2T A;  2L0C A;  2SEB D;  2ZXR A;  3OMC A;  2DN8 A;  2D2C C;  5EJW A;  3VA5 A;  4KKU A;  4UAI A;  1XYI A;  5JAV A;  2F0O A;  2FMM A;  5D3I B;  1CHP D;  1OXV A;  2GA4 B;  1AN8 A;  4IAL A;  5C0X J;  2IL8 A;  5KNC A;  2Z4I A;  4MIU A;  1SYB A;  4ZYS A;  1B1Z A;  1W6K A;  2ZT9 C;  3S2D B;  1EIH A;  1PLF A;  1CZW A;  3GP7 A;  1EEI D;  3S14 B;  3HP3 A;  3MEH A;  3KUP A;  1TWF B;  2HQE A;  3MAQ A;  2EYF A;  1IYV A;  1LT6 D;  4FP5 D;  1HA5 A;  1LT5 D;  1W6J A;  3ERQ A;  4KY7 A;  1KNE A;  1V43 A;  4J6H A;  4KKS A;  4X3S A;  1TWH B;  1ML0 D;  1U4P A;  3SK4 A;  1R9T B;  4K5X A;  2J4X A;  1Z47 A;  4FXK C;  5KYL A;  2EJG C;  1J9O A;  1PTO H;  4ZK9 B;  3HOY B;  5DAU A;  1ZYR D;  1PFB A;  5C4H A;  1GHK A;  3QWN A;  2HDM A;  1JIC A;  1YNN C;  1CM9 A;  2A68 C;  3SR1 A;  1LO5 D;  3OMG A;  2F0S A;  1ESR A;  3NUC A;  3PUV A;  2K01 A;  4GZY C;  5ELB A;  2F0D A;  4NKL A;  2A69 C;  2HCC A;  2F0K A;  3BVZ A;  3FRP B;  1K8O A;  1RKN A;  3URY A;  3QOJ A;  1A2U A;  3V96 A;  4ID6 A;  2G9H D;  2CHB D;  2NTT A;  2EYP A;  1EWH A;  4WFN 3;  2RVL A;  3DMU A;  4K6D A;  2OEO A;  3OWE B;  1I3Q B;  1UAP A;  2AUJ D;  3OOC A;  5ELF A;  2A5H A;  1WD1 A;  3R8B A;  3NQT A;  2KCN A;  4PMW A;  4WRD A;  1BCP D;  3RLF A;  1ZEQ X;  3CRL C;  1EYD A;  4F88 A;  4RGM A;  4OO1 I;  4X3U A;  3FPP A;  2NUC A;  3S16 B;  1Y8O B;  2NWG A;  1EY5 A;  4RCN A;  1X3P A;  2R61 A;  3OSO A;  2RBM A;  5NUC A;  2KOL A;  3MZ5 A;  4KHZ A;  2MUY A;  1HHV A;  3S9W A;  1F2Z A;  2FHT A;  4RGN A;  4K2L A;  1EWC A;  3C2P A;  3A8J E;  1CQF A;  4OIK A;  1BNZ A;  2X69 A;  2KED A;  3KLS X;  2NN6 H;  3BYY B;  3D6W A;  3GTM B;  2D5D A;  1FNW A;  3HEJ A;  4OGQ C;  1QWY A;  4BWG B;  2B2V A;  3S2H B;  4DAP A;  1ZKO A;  2F0P A;  1GHJ A;  2WV6 D;  3C3L A;  3TDQ A;  5C4J B;  2F0F A;  3SHL A;  2IJ0 A;  3W3A A;  4B9W A;  2XRQ D;  4DNR B;  4ZKC B;  4OIJ A;  4EQN A;  4ILW A;  5JEA H;  4F8M A;  4TKO B;  3BDO A;  1TT2 A;  5A35 A;  3N52 A;  2FFK B;  4A3I B;  2KHS A;  1CT1 D;  1EQT A;  4C3H G;  5JPN C;  2PO4 A;  3HOZ B;  4RHS A;  3T56 B;  2A73 B;  4MN3 A;  2EVB A;  4BBS B;  1I6H B;  3ND9 A;  1TY2 A;  1STG A;  4H0L C;  1EY9 A;  1XWE A;  2WII B;  2HCI A;  2FIN B;  2B8F A;  3SXH A;  4QCL A;  1LT4 D;  2KVM A;  2K5Q A;  2R3Z A;  5FO7 B;  1SNC A;  5CR3 A;  5D3D A;  1CA6 A;  1TWC B;  2X6G A;  1S5F D;  3I91 A;  1GJX A;  2K05 A;  5CV9 A;  2EY1 A;  2YU9 B;  2EY2 A;  3DWA A;  1F2L A;  2SNS A;  1YNN D;  1LT3 D;  4KN7 C;  2IT1 A;  1BDO A;  2A68 D;  4OO1 G;  1I4P A;  4K8J A;  1E2Z A;  1EFI D;  4QUF A;  3V05 A;  5HGT A;  2A69 D;  4ZAI A;  3PUY A;  1QOH A;  5C3W A;  4X3K A;  3P1H A;  1EY0 A;  4V19 0;  2HUG A;  2RDF A;  3K59 A;  1EQV A;  3NE5 B;  1V1P A;  1ENA A;  3I90 A;  1MSG A;  2Z8L A;  5JVH 3;  1EOT A;  1I4G A;  3I72 A;  2NZ1 D;  1IKM A;  1TWG B;  5TSS A;  1WTW A;  3S1N B;  1Y8N B;  5CV8 A;  3EFX D;  1JC7 A;  1DCZ A;  4IUP A;  5K36 H;  2DNC A;  1BF4 A;  2MP1 A;  2K6A A;  3S1Q B;  3I4N B;  4QB4 A;  3GTG B;  4A3B B;  3QOL A;  2K32 A;  2O2L D;  4IUT A;  2JA8 B;  1QG7 A;  1G6Z A;  2ZXP A;  2JE6 I;  4R8I A;  4PMB A;  3I70 A;  3H6M A;  1SDF A;  5I9P A;  1GUO A;  1STN A;  1FD7 D;  3VYT A;  1PRT B;  3MXN A;  3PMF A;  1BCP F;  4CBV A;  3T53 B;  3S1R B;  1QE6 A;  2RKS A;  2CW0 D;  5EBD A;  3VR3 A;  2Z1C A;  3C1F A;  1EU4 A;  1SMY C;  4KJN A;  3J7A F;  2BE5 C;  1WTR A;  1DON A;  2F3V A;  1EYC A;  1R4Q B;  1JR0 D;  1H9S B;  1WVL A;  1E2V A;  3K57 A;  2D9U A;  1NR2 A;  2OXP A;  4IQZ A;  3FKI B;  4TRD A;  2R6G A;  1DXM A;  3X3M A;  3GTK B;  3T16 A;  5KEE A;  3GD7 A;  4HMI A;  5C0X H;  1TII D;  1OXX K;  3RZO B;  1JB3 A;  1F9S A;  2B8G A;  4C3H B;  3MFG A;  3FEW X;  1PFM A;  1ZYR C;  3PO2 B;  2BCO A;  2F0H A;  1BR9 A;  3KLR A;  4EGV A;  1F77 A;  3GV3 A;  1KLU D;  1Y1V B;  2QF7 A;  5G3L D;  1RJT A;  5KND A;  4TQU S;  2XVS A;  5EPK A;  1EY7 A;  4L8J A;  4Z9C B;  4IFD J;  1TU2 B;  4I65 A;  3CU7 A;  4IUV A;  4RWS C;  4LMQ D;  4CJ1 B;  2PCF B;  5ELE A;  1EZ8 A;  4AYB B;  4C3J G;  1LV9 A;  3J7Y W;  5DEH A;  4KI0 A;  4G4K A;  4C1N I;  1M8A A;  4HR7 B;  1KDA A;  1ESF A;  1EY6 A;  1FGB D;  3BVM A;  2VUM B;  3V2T A;  1PTO F;  1OXS C;  3SDZ A;  1KDC A;  1VMC A;  2Q8T A;  3ONA B;  4J1M A;  4RKB A;  3DXJ C;  3M85 A;  1TY0 A;  2Q8I B;  2EZV A;  1KTK A;  2XRS D;  2G9D A;  2LS0 1;  1MBY A;  2KJX A;  3DUZ A;  2PYK A;  4RGO S;  4LJZ C;  2E75 C;  4ZUI A;  5FLX L;  5D14 A;  1RF2 D;  4A3F B;  3VR5 A;  2TMP A;  3D4W A;  1Y8P B;  4EVO A;  3HRZ C;  4FF3 A;  2DNE A;  4O42 A;  2JSO A;  5LHY 1;  4NW2 A;  3NK9 A;  4A3K B;  3E0J A;  1SE2 A;  1LAB A;  3PUX A;  1SYF A;  2BOS A;  5I2Y A;  3VR2 A;  3AB9 A;  1RHP A;  1TS3 A;  1SMY D;  1U4L A;  2BE5 D;  1C48 A;  1FNV A;  2F0E A;  1Q1E A;  4ZRZ A;  4QIW B;  3K5O A;  4R8N A;  4KMU C;  3GQB A;  1EL0 A;  1QNK A;  1SXT A;  2JEB I;  3WDN A;  4Y7N B;  4B08 A;  2RDG A;  3IFT A;  2F0J A;  2VXW A;  4HED A;  1KDB A;  3Q0A A;  1SFO B;  1GUG A;  5IGE A;  5EKK A;  2SDF A;  3A54 A;  2IW3 A;  1C4Q A;  3EA6 A;  2X6L A;  4DFA A;  1AEX A;  5EBC A;  4ZLT F;  1IHZ A;  1QJO A;  1ET6 A;  1Y69 U;  2PW7 A;  5A2Q E;  1A3V A;  2NVY B;  1G2S A;  3K58 A;  2WP8 J;  3BDL A;  1GOZ A;  3PV0 A;  3D8G A;  1WD0 A;  5ELD A;  1JQY D;  3M3Y B;  5C5L A;  3PO3 B;  2WAC A;  2BDO A;  4MHE A;  5C5M A;  3H3V C;  4B9X A;  1D5X C;  3GTQ B;  5KYI A;  5IT9 L;  2M00 A;  3CHB D;  3I73 A;  4CJ2 C;  4P2C B;  2D62 A;  4XXE A;  3M7N A;  3TP5 A;  5EGT A;  1TVX A;  4V0B A;  3NBH A;  4FF4 A;  2OT2 A;  3N6R A;  5I6Y A;  5IIF A;  1YNJ D;  5G3L F;  1SYD A;  5DM7 3;  2IX1 A;  4OHJ A;  2EOT A;  3T51 B;  2DY8 A;  3DWP A;  1ZXT A;  5FLX E;  3UI2 A;  3OPO A;  5E4X A;  3VA7 A;  4KY6 A;  1JCK B;  3TP8 A;  3E5S A;  4S3S A;  4UDU C;  1Z6H A;  4C3J B;  3HOU B;  2IX3 A;  2O5J C;  4C3I G;  2F0I A;  1G29 1;  4DNT B;  1ET9 A;  2SOB A;  3LWU A;  1I6V C;  3I4M B;  3BDC A;  3LX0 A;  5DNF A;  1J8I A;  3HKZ B;  4QUC A;  1CFM A;  5M9O A;  4IFD I;  1G91 A;  1CA5 A;  5C4Z A;  3U9O A;  2R93 B;  2WKC A;  5EPJ A;  2O4X A;  2PZT A;  3Q23 A;  2B2V C;  2L12 A;  3VYS A;  5FKA C;  1PXU A;  2XN9 C;  2EPB A;  2EXZ A;  2L1B A;  4BS9 A;  1A6X A;  2KUM A;  1BQQ T;  4DAY A;  2H1E A;  2RQX A;  1I4R A;  2CW0 C;  4HAE A;  1VCI A;  1STY A;  2TSS A;  4RAU C;  2F0Q A;  1IYU A;  4XYO A;  1U9R A;  2XSC A;  1NR4 A;  1LTR D;  4BY7 B;  2KA7 A;  1X3Q A;  1Q1B A;  1H9R A;  1PRT C;  2H4O A;  3P20 A;  2F0V A;  5EPL A;  2E2I B;  3H91 A;  2C5C A;  4CGY B;  1STA A;  4XIG S;  1AW7 A;  4KY5 A;  3MA2 B;  3RD4 A;  3NTK A;  5JPM C;  2LFN A;  1BOS A;  4H7B A;  3NP8 A;  1CI3 M;  3GTP B;  3D6C A;  4KV6 A;  3MVV A;  3ZYY X;  1SJE D;  4KTA A;  3DEO A;  3J80 L;  1WTQ A;  2QCP X;  3GTL B;  2F1M A;  5KRU A;  1HPC A;  2PNR C;  5IT9 E;  1V8Q A;  2RDH A;  3A8K E;  1KNA A;  1PTO B;  4PNY A;  3RZD B;  5T1G A;  1RTN A;  1IW7 C;  2F0L A;  1BBX C;  1H9S A;  4DK1 A;  2EYH A;  2NYZ D;  2JP1 A;  3I3C A;  2A6H C;  3R3O A;  1GUT A;  2F3W A;  4IFD G;  4ABN A;  4K8I A;  1MGS A;  3NSW A;  1LTT D;  1B9M A;  4XQJ A;  1TS5 A;  3QG1 A;  2DY7 A;  3CQZ B;  3KBX A;  4BY1 B;  1S5C D;  3SVM A;  2YYZ A;  2BDN A;  4RFB A;  1I4X A;  4G7H C;  2EJM A;  1AZQ A;  2NVT B;  1IKL A;  4C2M B;  1LLR D;  5FO9 B;  4OO1 H;  3F2U A;  5EKL A;  4XDX A;  3IKJ A;  5J1Z A;  1DJR D;  4HCE A;  3PIP 3;  2JEA I;  4IN3 A;  1FR3 A;  4K5W A;  1DM0 B;  1O78 A;  3VYU A;  5M3F B;  2CQA A;  1OXT A;  1TS2 A;  3GTJ B;  2LY7 A;  4K14 A;  1UNS A;  1QB5 D;  3G7L A;  3IFD A;  1HFG A;  2L9H A;  3DWQ A;  1DOL A;  1DYQ A;  4OL7 A;  1D2B A;  4U67 3;  4NP5 A;  2KEE A;  4RCO A;  1Z7T A;  1TKW B;  2F0T A;  3VYR A;  4TSS A;  4N9T A;  1T5X D;  4C3I B;  3EJI A;  3DHQ A;  1HTP A;  3P7J A;  4PMC A;  4G7O C;  5EQ0 A;  1MD2 D;  5JEA J;  5CC4 A;  4KD3 A;  3QO2 A;  3C46 A;  3RMH A;  2WIN B;  3OIQ A;  3A56 A;  2F03 A;  5FK9 C;  1DOK A;  1G2T A;  2B2U C;  5BN3 A;  1JOR A;  3J80 E;  3D3R A;  1PRT D;  3GV6 A;  4RGT A;  4QMG A;  4FXG C;  1PZI D;  1SSO A;  5CBE E;  5LL6 X;  1HQR D;  1FNU A;  3R93 A;  2B2U A;  5BN5 A;  3S1M B;  2PW5 A;  1LTA D;  2JA7 B;  1RTO A;  2NVX B;  1GUS A;  4M1U B;  3EVQ A;  4XYQ A;  5BN4 A;  1HRJ A;  2EJF C;  1LAC A;  1B53 A;  5C3X A;  3BVG A;  2K5D A;  2L5T A;  1JOK A;  2B2Y C;  4KD4 A;  5I2X A;  5IOD A;  5IOC A;  3K5L A;  3R2T A;  3HZX A;  3OW7 A;  1IW7 D;  2NVQ B;  3TBI B;  3TZU A;  3D4R A;  3KK7 A;  5CV6 A;  4YIJ A;  4K5V A;  3DM1 A;  1BXT A;  1F9P A;  5K5P A;  4CKE A;  2A6H D;  4DAV A;  1DD2 A;  1X32 A;  2K04 A;  2O5I C;  2WKD A;  2A6E C;  5COR A;  2B2Y A;  1VF7 A;  3SEB A;  2KCC A;  4FYD A;  4A3M B;  4RA8 A;  3NTI A;  1XX8 A;  4A3D B;  5A2Q L;  2R92 B;  2VB3 X;  3E6Z X;  1A3T A;  5KNB A;  3KF8 A;  4HSV A;  5CBA E;  2B63 B;  4I7Z C;  3Q6S A;  2NBF A;  4ZKB B;  4HN7 A;  1YNJ C;  3ND8 A;  1RD9 D;  2B2T C;  2AWN A;  3M4Y A;  3MWY W;  1EZ6 A;  1OO9 B;  4EQO A;  1F9R A;  4FNF A;  2RSN A;  3IL8 A;  1PYW D;  4CKC A;  3TP6 A;  4XTC S;  2C9O A;  1WTX A;  4JBW A;  2QDB A;  4DXG A;  1SE4 A;  4G7Z C;  1UEA B;  5EKI A;  5IGF A;  1E2W A;  1SE3 A;  2B2T A;  2XIW A;  4RH6 A;  2JXM B;  2NTS A;  2SNM A;  4A3J B;  4FVM A;  1VF5 C;  2AWO A;  3SE0 A;  2Y0S B;  1LTG D;  2ENB A;  4KK7 A;  3VR6 A;  3X3N A;  2QEJ C;  5F2D A;  3Q22 A;  4G57 A;  1DOM A;  4KN4 C;  1S5D D;  1B4O A;  1GUN A;  1C8C A;  1HFN A;  2ID0 A;  1ICW A;  3OHX C;  4LAA A;  1UUP A;  4C56 C;  3JAM L;  2LKV A;  4EQP A;  3M4O B;  4A3G B;  4H13 C;  4Q5V A;  1ENF A;  2F0U A;  4DU9 A;  1II3 A;  4PV1 C;  4BA1 I;  2AQ1 B;  5IGB A;  3P75 A;  4XT1 B;  1ROD A;  2F0N A;  3PUW A;  2MJ8 A;  2EYM A;  1LTS D;  1M4V A;  3I4L A;  3QJY A;  2NN6 I;  1SJH D;  1OXU A;  4DA2 A;  1NSN S;  3A8I E;  5C3E B;  5JOB A;  1A3U A;  3SK5 A;  3J81 L;  1PRT F;  3TZD A;  1O80 A;  3D4D A;  1EU3 A;  5C6A A;  3KLS A;  2B39 A;  3LWE A;  2XWB B;  4ME5 A;  1NCV A;  1Q3L A;  1PMR A;  4IUR A;  2A6E D;  1JWU D;  1STB A;  4IUU A;  5E4W C;  2K03 A;  1SBB B;  4A93 B;  3MXP A;  3VR4 A;  2PZU A;  4ZUJ A;  5J39 A;  1A15 A;  4XQN A;  1I50 B;  5AFW A;  2L11 A;  2VNU D;  3D31 A;  5JJZ A;  1PTO C;  4FF1 A;  5J22 A;  1ONL A;  3IAY A;  3NWT A;  3R2I A;  2OF1 A;  4JK1 C;  1BCP B;  1U4M A;  5C4X B;  1EIG A;  1AZP A;  1Y1W B;  2RSO A;  3QIA A;  3FVQ A;  5I6W A;  2HDL A;  3S17 B;  1EEF D;  1CZG A;  2XWJ B;  1ENC A;  1F2Y A;  1RCV D;  2EYL A;  3MHB A;  3DEP A;  1O7L A;  1MSH A;  1H9J A;  4N9P A;  1NUC A;  1CHQ D;  3S15 B;  4DF7 A;  3FPU B;  2EYO A;  1D5M C;  2EY5 A;  1TWA B;  4R9W A;  1R4P B;  4ULL A;  3A55 A;  3T4A C;  2NN6 G;  1RDP D;  3OIP A;  2M9V A;  3A7L A;  3WOE A;  3JAM E;  2CVR A;  1S4Z A;  2Q8R E;  2ZXO A;  4BBR B;  3HG9 A;  4F7X A;  3TN2 A;  5KIX A;  5E1F A;  5JEA G;  1LTB D;  4CKB A;  4RKL A;  5I4D A;  1WTP A;  2E2H B;  5ELC A;  1B50 A;  5IGC A;  2WAQ B;  2AQ2 B;  1O7Y A;  1JOO A;  3W2D A;  3SK8 A;  3BS1 A;  1EY4 A;  3OWF A;  3C1E A;  2PZW A;  3J81 E;  3G6J B;  2I46 A;  3T13 A;  1I4Q A;  4XQQ A;  1XXG A;  5I9O A;  1SYG A;  1U4R A;  1O7Z A;  5FO8 B;  3BG3 A;  2E2D C;  2L4N A;  3MXG A;  3EQL C;  5M5Y B;  1ILP A;  2BA0 A;  3MTS A;  5T1I A;  1WTO A;  3A7A B;  3L9A X;  5M5X B;  1AFP A;  3K0Y A;  3ERO A;  1VDZ A;  2PMZ B;  1SYE A;  1WTV A;  4IUQ A;  3Q24 A;  4BA2 I;  1G8Z D;  1SNM A;  2B2W C;  1HUN A;  4PQX A;  3KBG A;  1TS4 A;  1T5E A;  2ICI A;  4WJW A;  2F0G A;  1SAP A;  3GO5 A;  3K5M A;  1HA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...