1Z6HA

Solution structure of bacillus subtilis blap biotinylated-form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biotin/Lipoyl Attachment Protein
publication title Identification and solution structures of a single domain biotin/lipoyl attachment protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1z6hA00
1E2VA 4L8JA 1O78A 3A7LA 3DXJC 1DXMA 3VR5A 2B8FA 2A6HD 2A6HC 1B9MA 4XIGS 3I73A 4IQZA 2EVBA 5K36H 1HQMC 2DNEA 5C0XH 1B9NA 1VDZA 1GHKA 1E2ZA 2KA7A 2B8GA 1IW7D 4G7OC 1IW7C 2BE5D 2EDGA 2BE5C 1OXXK 1K8OA 3VR6A 5C0XG 1H9MA 2CW0C 2E76C 3PUWA 3U9SA 3W3AA 5KNCA 1YNJC 2NN6I 1OXSC 2EJGC 4OO1G 3CRKC 4LJZC 3M4YA 1QJOA 1ZYRC 2AWOA 3IKJA 1BDOA 1HPCA 2JEAI 4H13C 4KMUC 1EWHA 2E75C 2BA1A 2A6ED 2A6EC 3A8JE 5KNBA 2EJMA 3A7AB 4KI0A 2O5IC 4GZYC 1GUNA 1K8MA 1T5EA 3L7ZC 1GUTA 1Y8NB 1CTMA 3VR3A 1Q90A 1Z7TA 2PCFB 3LNNA 1V8QA 4TKOB 3T51B 3T56B 2JXMB 1H9JA 1IYUA 2D2CC 2K7VA 4IFDH 3MFYA 5JEAH 2PPBC 3EQLC 5K36G 4RCNA 1FR3A 1O7LA 1TU2B 2LMCB 1GUSA 3I4LA 3MXUA 4DK0A 4OGQC 4KKUA 3GQBA 1Q1BA 4DNRB 3PUZA 3AB9A 3OPOA 2D5DA 4JK1C 4KKTA 5JEAG 1GUOA 2IT1A 1OXVA 2D62A 1LACA 5KNDA 3WDNA 3D4RA 4DK1A 2K32A 1ZKOA 3GD7A 1DD2A 1GUGA 5A35A 2BDOA 3N6RA 3A8KE 3P20A 2JEBI 3BG3A 4LK1C 3FMCA 3SDZA 1Y8OB 1CI3M 1G291 2F1MA 2DNCA 2JE6I 2A69D 2A69C 2YYZA 5BN5A 4KN7C 1V43A 3I72A 4KKSA 1LABA 2A68C 3M85A 3RLFA 4JBWA 1IYVA 3OOCA 3CRLC 4XTCS 5BN4A 1H9SB 1VF5C 4BA2I 3IFTA 1HCZA 2E74C 3QG1A 4IFDG 1I6VC 3PUXA 4HR7B 4KHZA 1OXUA 2BA0A 3OW7A 4I7ZC 4H0LC 1H9KA 3D31A 3VR4A 1H9SA 3KLRA 4TQUS 3SE0A 1E2WA 3PUYA 1OXTA 1FYCA 4DNTB 3TZUA 3QIAA 3VA7A 2K33A 4OO1H 4G7ZC 1VCIA 3QJYA 1Y8PB 3T53B 5BN3A 2AUJD 2NN6H 1Q12A 3HGBA 1Y69U 3PV0A 2O5JC 1ONLA 2AUKA 3FPPA 1PMRA 1HTPA 4KN4C 1Q1EA 2KCCA 2L5TA 2Q8IB 1VF7A 1YNNC 2A68D 3H94A 1CFMA 2EJFC 2V4DA 2NN6G 2ZT9C 3NE5B 2R6GA 3ND8A 3LWUA 1Z6HA 4H44C 3A8IE 2DN8A 1DCZA 1A6XA 1SMYC 1TKWB 3ND9A 1GHJA 4BA1I 1H9RA 3M7NA 1GJXA 2QF7A 3PUVA 4G7HC 3VR2A 3BDOA 4PV1C 2PNRC
chains in the Genus database with same CATH superfamily
1F2YA 2F0EA 3N52A 2WKCA 1J8IA 3DXJC 2MGSA 1STYA 1EY9A 4LF9Q 4DR5Q 1CK1A 1PA6A 1F2LA 2BE5D 3SEBA 2K5HA 3CU7A 4OO1I 1D1IA 4A93H 2CW0C 5D3IB 4DXGA 4MZ9A 5IP9G 4DV7L 1ZYRD 1IZ6A 1DYQA 3RZOH 2X69A 4DR3Q 1I4RA 2A1AA 4K6LA 3KF6B 4O0AA 1QZHA 2R7DA 3D3RA 3KLSX 2EQSA 5IGDA 3TS0A 4A76A 2ZTDA 1JOKA 1FL0A 1W2BA 1FGBD 5DLQE 3KLSA 1S5ED 1X32A 2PCFB 1H9JA 2JA6H 4CDCC 1AW7A 2X6LA 3OWEB 3J81E 5JEAH 4IFDH 3I55A 3C1FA 2PMZE 5IYDG 3Q0AA 3I2ZA 3KDFB 4ID6A 2NVQH 1WTHA 1OXVA 2SOBA 2HIXA 4UP7A 2L0CA 1UEBA 4C3IH 3MHBA 2JA7B 3K7UC 3FRPB 1E7ZA 1RTNA 4QUFA 4JW0A 2NVTH 3TP5A 3S1MB 1PYSB 1I5FA 4GKKL 5BN5A 3GTOB 3BVZA 1PH9A 2UXDL 1EQVA 2UUBQ 3D0FA 1CHPD 4JI6Q 1HNXQ 3BZCA 3O13A 5NUCA 4JVZA 4N9PA 1F2ZA 5JOBA 4EVOA 1H9KA 3IAYA 1E0BA 4OEMB 1E2WA 1PHJA 1PRTD 1B70B 5M3FH 3W2DA 4BXXG 3PIP3 1DOKA 4KN4C 1VQNA 4CHTB 2SNSA 4A3GH 1D1KA 1NTGA 1CKNA 1U4MA 2L11A 2NZ1D 1XTCD 3PUVA 1SNMA 1HRJA 3I56A 3F2CA 2PNRC 3CC4A 1D6EC 5J1ZA 2L1BA 2Z1CA 4MHEA 3ZYYX 3OHXC 2G9DA 1BCPF 2EVBA 5K36H 3GTJH 1Y1WG 1K0RA 1EZ6A 1VDZA 1NY4A 2N8NA 4NMZA 4FF3A 2HDLA 1AN8A 5CV4A 1K8OA 3F1ZA 1PXUA 3ER0A 4DR4Q 2EJGC 3TDQA 4HAEA 1SE8A 4PMCA 1JT8A 2H1EA 5I6WA 1MHWC 3HOVG 2GVAA 2Q2TA 2NTTA 1TWAB 3IFDA 5CYUA 1EY5A 4LF5L 1PTOD 4F8MA 1PTOB 2DY7A 1JORA 4FO2A 5IP7G 4KJOA 1E1OA 4H7BA 4KHVA 1YNXA 3K7AH 1VMPA 4NPSA 3A5UA 3R2TA 1HFGA 5FLXE 5JVG3 3CQZH 5IYCH 3FVQA 4HIKA 4YCWA 1NBWA 1K8AC 2K03A 3BJUA 4RCNA 1KDAA 1TU2B 1U0LA 1Q8KA 5E4WC 2JSOA 2Y0SB 1HNZL 2OT2A 3WDNA 3D4RA 4XQQA 2N49A 1Z47A 3P20A 4F87A 2WP8J 1YHQA 1FJGL 4ZQ3A 1CI3M 1N33Q 3K0XA 5C4JH 1YHAA 1KXLA 4A3BH 4K6DA 1SSOA 1B7YB 4JI8Q 4JI4Q 2A68C 1TQOA 1TWHH 2VQEQ 3S15B 4XTCS 3J7A5 4DF7A 3OTOL 5M9OA 2DGYA 4LUOA 3S9WA 2K6AA 4KHZA 2ZXRA 4I7ZC 4ALPA 2RHQB 2MHVA 2NUCA 4RH6A 1XJVA 1JJGA 1H9SA 2D0PA 2PQAA 2E8GA 2LS01 4G7ZC 2EXDA 3NQTA 1WCMG 3S17H 3QOLA 3S16B 4M1UB 3I4NB 2J7ZA 1HZ9A 1SNDA 3LWEA 1Q1EA 4YCUA 2CH4W 4C3HB 3K80C 5CV8A 4OELB 1NSNS 2LKVA 4OWWB 1DJRD 4IO9A 4RGMA 3DUZA 3S2DH 5FK9C 3CCLA 2VNUD 2KHJA 1PH8A 2ALYB 3K5LA 4B3MQ 1LTAD 1J5EQ 1AH9A 2WB1G 1B9NA 3FEWX 3VYTA 1HH2P 4UAIA 1VQ6A 2H5XA 3V96A 5EQ0A 3K58A 3KK7A 3CCVA 1C48A 5C0XG 4DK3C 2MPMA 4HJ8A 1WTWA 1I4HA 4JI5L 4O1NA 2XIWA 4DV0L 5JPMC 4BY7G 2A73B 1KD1C 4RA8A 1F9PA 2R7ZH 2A6EC 4IPGA 2CKZB 5C4XH 1K83B 1B8AA 3HOUB 1PYBA 4C3JH 1RTOA 1GUNA 4QUCA 4WFN3 1EYDA 4F88A 1F77A 2ZXOA 5A2QL 3J81j 5IGGA 2EY1A 2RDHA 1GVPA 2E2DC 3G71A 2JP1A 1R9TH 3CAMA 4DR6L 3MFYA 1FNWA 3X3MA 4WJ4A 1Y1VH 5M5YB 4HJ5A 1ET6A 1R4QB 2I5LX 4DNRB 5EBDA 3IL8A 3AB9A 3GTPH 2FMMA 2Q2IA 4IUVA 4LF8L 1F9SA 4DFAA 4RHSA 4KHPQ 1VQCA 3RNUA 2K32A 1VQ8A 3OW2A 1JMCA 3BG3A 3PF5A 1E3PA 4A3LG 4B08A 4HN7A 3DHQA 3DWPA 2H4OA 2VY3A 2BH8A 1T9HA 2K5NA 3RR5A 4FF2A 1AZQA 1PDQA 1KIXA 2UU9Q 4X6AH 4PG3A 3V05A 4BA2I 4EQNA 4BBRG 1OXUA 1DM0B 2VW9A 2K5DA 5M5XH 1KNAA 1NE3A 3CW2C 2WFWA 1EY4A 4UY8C 4PMBA 3HOZG 4QMGA 4LF6Q 3ICEA 3PO2H 1ML0D 2B63H 1MBYA 1STBA 3DEPA 3JAMc 1XPOA 1SYDA 3X3NA 1P8LA 3W1GA 3GTMH 1E22A 1I4PA 3D6WA 1XMOQ 1WTOA 2NVXH 4A3FG 3CCMA 1Q46A 1VQ7A 2DN8A 5FJ8G 2L12A 3HOXG 4A3CG 3J81L 2QF7A 3NENA 3ONAB 4GN3B 1PZJD 4B9XA 4JV5Q 1XNRQ 4DR4L 3PGZA 3HP3A 4ULLA 4JYAQ 3S1NH 3P1HA 2VB2X 1GXDC 5LMNQ 3T4AC 5JJZA 4L5RC 3NBHA 1TWGH 3HKSA 1XNQL 1EYGA 4P2CB 3ULJA 1KRSA 3A74A 1FNUA 4LFAL 1HPCA 4DR1Q 4A93G 1SYBA 3PSIA 2K75A 5L37A 1OTCA 2E75C 1E1TA 1D5MC 2G9HD 3M7GA 3OSOA 4OX9L 4IALA 3I8ZA 2EYOA 1HHVA 3DMUA 3A5ZB 2F0TA 3T16A 4POGA 2WAQE 2YTVA 3U50C 3T56B 3Q22A 3CCRA 4DNIA 5M3MB 3PO3G 2IY5B 4DR7L 2KEDA 4NKLA 4XYOA 3M3YH 4RGTA 4TRDA 3CCUA 1PH4A 1X9NA 3GQBA 4KD3A 1YZ6A 2JA6G 5KGUA 1QVGA 1KAWA 5JEAG 2OQ0A 4OIJA 5KNDA 3VA5A 3W5OA 1D5ZC 1ZKOA 2Z9HA 5F2DA 5FO9B 2B39A 2C35B 1X3FA 3MFGA 2KCNA 4LAAA 3SDZA 5E1FA 1LTLA 4C3IG 4OONA 2EXZA 2A69D 5IGBA 2UXBQ 1TS4A 1A3TA 4P75A 3B6YA 1KABA 2KCTA 2R61A 3EIVA 1LABA 5IODA 1WTVA 1AFPA 3AMUA 1HJPA 4IUUA 1X56A 1S5FD 1CM9A 3J81i 4X3SA 1ET9A 2BA0A 2XSCA 5C5MA 3MEFA 3P7JA 5GAHC 3L9AX 4PZ6A 3S2HB 4OO1H 3OMGA 5D14A 4IJHA 2F0PA 3KYHC 4LF4Q 1QVCA 1CZWA 4DAYB 3MXNB 5M3FG 2F0HA 5KIXA 2Q2UA 5I9OA 4KY5A 4B3ML 2M2LA 1W6JA 4P73A 1A6XA 4DPGA 1XTDA 5FLXL 5G3LF 1GHJA 3EROA 5CV5A 4Q0FA 5C4ZA 3M7NA 4GOPA 1QNKA 1STHA 3RLOA 1STNA 3A7LA 4R4QA 4BS9A 1HTLD 1B9MA 3E5SA 2NWGA 4N8X1 4J15A 1S5DD 3BYTB 4CBVA 2GVBA 1PLFA 3QB3A 1WCMB 4GOPC 2GN5A 2NN6I 3A0JA 5IIFA 1BQQT 2F0WA 4DK6C 4NXML 4FP5D 2X6GA 1S5BD 3DLLA 1IXRA 3HOWH 2KENA 2EJMA 3GTLH 2P5ZX 1LT3D 5LMNW 1LYLA 4ZYSA 1B3QA 4NP5A 4X64L 1MJEA 2BH2A 2DJGC 4BBSG 4B9WA 3PMFA 2F52A 1VQMA 2F0JA 1IYUA 1YEZA 3M4OH 2VS1A 1UE7A 4UPAA 1LV9A 5IYCG 4NB3A 4X65L 4QGUA 1GUOA 1B1ZA 4BY7B 3C46A 1ZEQX 1JQYD 2M9VA 4PZ8A 4DR2Q 1ASZA 4A3KH 1XX8A 2MO1A 1Q82C 2Z4IA 2ZM6L 1JOOA 4KKSA 1VQIA 3RLFA 5C44H 2OEOA 1PZID 5BN4A 2OTLA 4A3BG 1I6HH 1ESFA 3DM1A 4LF6L 4CJ0B 3EVQA 5M5WH 5C3EG 3D31A 1HA6A 1I94L 1OXTA 1TWCH 4GN5A 1UUPA 3GO5A 2K33A 3I7FA 4DKAC 4X3TA 1EEID 1SBBB 2JQOA 3Q23A 3H0GB 5JVH3 1SYGA 2JN4A 1CKNB 4A3JH 3PV0A 2TMPA 1EU4A 1S72A 2L15A 4YWKA 1LTBD 3PIOA 4UP8A 1ENCA 4Y7NB 3CC7A 3BZDB 1EY6A 3NPPA 3Q8DA 4HMIA 1YI2A 1IBKQ 3K59A 1CT1D 5A2QE 4BBRB 1O78A 1TWFB 3MAQA 1CSPA 1NJIC 1VQPA 3F2BA 1WI5A 2WINB 3T1YL 1N32Q 3KJPA 4A3MH 1E2ZA 2KA7A 4P71A 1EZ8A 3HOZB 2R92B 1QB5D 1WFQA 1GKHA 2V1CC 2QA4A 1EIHA 1JE4A 4OL7A 4QIWB 1WTRA 2E76C 3PUWA 4C56C 1OXSC 1PRTF 1SR3A 1HNWQ 2RDGA 1V1PB 4KMUC 1BNZA 4A3FB 2E5LL 1HZBA 1II3A 3HOXB 1SE2A 1A15A 4DUZQ 1HUNA 4U673 1IL2A 2F0LA 4XXEA 2JA8H 2R7ZG 2IPKD 1IYJB 3KFUA 3I3CA 3AYHB 1K0SA 1Z7TA 2RQXA 3T51B 2WAQB 1N34Q 2AQ1B 4C3JG 1VS0A 2HQEA 2C5CA 4R4CA 1L0WA 1N36Q 3H3VI 4DK0A 2D0OA 2BCOA 1B50A 2WACA 4JPBW 3T1HQ 4JK1C 4KKTA 3TREA 5LMUL 1I4GA 1ENAA 2PNHA 1Y1VG 4I7AA 2K4KA 1SNCA 2PW7A 4CKBA 2O2LD 1L1OA 1EUJA 4LK1C 2UXCQ 1IBLL 4GKJQ 1BUVT 2HUGA 1SMXA 2IJ0A 1GM5A 3CCQA 3J80E 2YU9H 3I72A 5CV7A 3UE0A 1X3QA 1PTOF 1ICWA 5EAYA 3PO3B 3H09A 3OOCA 1H9SB 1L1OC 2SDFA 3BDLA 3NBIA 2E2IH 2CQAA 1HCZA 2PQAB 2F0OA 1XMQQ 2HHHQ 4IUTA 1SFOH 2K28A 2JA6B 2M00A 3R2IA 3H15A 4JI3Q 1G2SA 4H0LC 1VQLA 4DNTB 1YJ9A 2E2HB 2NVQB 1JB3A 4APVA 1BVSA 1KDBA 2K52A 3KUPA 3FPPA 4DAVA 2PI2A 2Q8IB 2JA7H 1XWEA 1YNNC 3PO2G 3KJOA 3TEHB 2R6GA 4OIKA 3S1MH 3U4ZA 5IE8A 5HURA 2HCIA 1EIYB 3I4MH 1RL2A 1IL8A 4G7HC 4POFA 1EQTA 4JI2L 3MEHA 5I9PA 1HFNA 4X66Q 1HQMC 2F0FA 2AHOB 1XPUA 4HSVA 2QEJC 1AEXA 4HIDA 4ABNA 2EDGA 3VYUA 5C0XI 3HKZG 1KL9A 5IWAL 3U9SA 3J7AV 3W3AA 1YNJC 1XPRA 1L0YB 1G6PA 1SAPA 1QJOA 2AWOA 4AH6A 1LT6D 3HG9A 1WYDA 4C2MB 3R3OA 4JI1Q 1CZGA 4LFCL 1RKNA 4IPDA 4Q5VA 4KI0A 2E2JH 3C1EA 1D2BA 1LT4D 3RZDB 1V9PA 4TKOB 2K5VA 2EZVA 1G51A 4AIMA 1EYAA 5CV6A 3NELA 2Z0SA 1UEAB 4AQYQ 3MA2B 4MTNA 4HSPA 1CSQA 2TSSA 4B3SL 3SK4A 4K0KQ 3FKIH 1TVXA 4MIUA 2K14A 2DNCA 1WTPA 5JJIA 3E0JA 1TWAH 4BBSB 4QB4A 4B3TL 1VQEA 4WJWA 1PTOH 5FLMH 3K8AA 4DV6Q 1SJHD 2R7FA 1VF5C 5DM73 3WOFA 3J81c 2KUMA 2EYFA 2K5QA 5DNFA 3OIPA 2VB3X 1G8ZD 1JC7A 4X62L 3I4OA 1VCIA 5JJKA 3F2DA 5BN3A 3L2PA 4LF7Q 3S1RB 5AJ3L 3Q6SA 5D65A 4LUZA 1MSGA 2CWPA 4FXDA 1SMYC 4RWSC 5LHY1 4YY3L 4DV2Q 1GJXA 1F9RA 3NBHB 5CV9A 2EPBA 3G4SA 5HGTA 4JI0L 3S15H 1CUKA 5C3EB 2L55A 1HNWL 5C6AA 3I91A 1ESRA 1IW7D 4G7OC 2PO4A 2BE5C 2N78A 2ZTCA 3CRKC 1LTTD 1ILQA 4IUNA 1ZYRC 4LF9L 4DR5L 3S1QB 4RAUC 1N34L 1QG7A 1OO9B 1B4OA 1WTQA 3I4NH 3I70A 4C3HH 4CDDC 1IBMQ 4V190 5CC4A 2PW5A 1L0XB 3STBD 2RCFA 3HOWG 4DR3L 3S2DB 4K5XA 5EPLA 4YCVA 1UE6A 5ELBA 1VQBA 4CJ1B 2MJ8A 3FDTA 2VUMB 3K57A 2EYMA 3CP0A 5IT9E 1BCPB 5IYBH 1F2MA 3PUZA 4CDEC 3GV3A 2EOTA 3NWSA 3C2PA 3EBEA 1DOLA 1R4PB 4DK1A 4DV3Q 3A8KE 2WIIB 3CPWA 1SROA 1O7YA 3S14H 2R7ZB 1C9OA 2WB1E 2VQFQ 2KBNA 1K83H 5EJWA 3HOUH 4A3KG 2EYLA 3M85A 5EBCA 5IGEA 2PYKA 3F8TA 2IL8A 3SR1A 3CCSA 1QILA 3U9OA 4HR7B 4IOAA 1Y14B 5I2YA 5C44G 1Y1VB 3SE0A 1J6QA 2UUBL 1PRTC 4YHHQ 3A56A 1BOSA 3PF4A 1RIPA 1PFBA 3QJYA 1Y8PB 4UHVA 5IP9H 2KEEA 2NN6H 2NZHA 1HNXL 4JI6L 4JI7Q 2K01A 2HT1A 3DWAA 4GOPB 2KCCA 2F4VQ 4A3IG 2SNMA 4K2LA 4A3JG 3LWUA 2RHSB 4LFBQ 3K81C 2XRSD 5J3BA 1ZXTA 4DV4Q 1JB7A 3NHHA 4L8JA 4KV6A 3A54A 4DV5Q 4TVAB 3CMAA 2A6HD 2G5DA 1K3RA 1YVCA 1VQ5A 3TMEA 1GHKA 2B8GA 5M5XB 1PFNA 4LNQA 3VYRA 4ZKCB 5BR8Q 3H6MA 3RUZA 5C3XA 3J80L 2F0KA 3TZDA 4NXNQ 1QOHA 3HZXA 4KTAA 5HY6A 2CWAA 1PTOC 4DAPA 1Z9FA 4HJ9A 3M9BA 1S3OA 2NVXB 4GNXB 5CBAE 1LLRD 1Q90A 4R8IA 4IURA 1NUCA 3ITPA 2I5HA 3K5MA 1DONA 4DN4M 2K7VA 2JA8G 4QIWE 2N88A 1KNEA 3HKZB 3I4LA 1KQSA 1BBXC 1TS5A 4KKUA 3KF8A 1A2UA 2ZTEA 2NTSA 1PV4A 5CGKA 4PQXA 5FO7B 4GLXA 1VQAA 3GTGB 2QEXA 3FMCA 4L5TA 1H95A 5J22A 3CCJA 1KRTA 1I4XA 3K6OA 4XQJA 1K9MC 4R4OA 3W1BA 2UUAQ 1A3VA 4J1MA 3GTQH 1Y1WB 2F0DA 4HMJA 1NR2A 3A55A 4EQPA 1JICA 2F03A 2OXPA 4JBWA 4ZUJA 1EIGA 3BZKA 3SXHA 1N33L 4IFDG 1YJNA 1WD1A 4ZRZA 1UE5A 5M3MH 2B2YA 5FKAC 5C0XJ 3BS1A 3HOVB 3G6JB 4JI8L 4DU9A 3M3YB 4JI4L 2RVLA 3PUYA 3TS2A 1HR0Q 1I50B 2VQEL 5C3WA 2Z6KA 4A4IA 4L5SA 1RJTA 3HGBA 2ZJRA 4DV1Q 1PMRA 2K04A 1VF7A 2B2YC 2V4DA 2ZT9C 3GV6A 5LL6S 1BR9A 1MI2A 5JPNC 5ISRA 1K28A 2JA7G 1EOTA 4BA1I 2Z6KC 5IP7H 3VDYA 3M4PA 1U5KA 1L2FA 2K50A 1HA5A 1E2VA 5GAEC 1X54A 3I4MG 1KTKA 1J9OA 2HQLA 3HEJA 4ZUIA 1TS3A 3U58A 2FHTA 4HEDA 1SNQA 2JJQA 2CW0D 3MTSA 2JA5H 3S2HH 1MKHA 1J5EL 4WRDA 1PH3A 4WJ3M 1NCVA 2PZTA 3IKJA 3PQIA 2JEAI 4ZAIA 2QW7A 2I07B 3ERQA 2MP1A 4DA2A 1TY2A 2QILA 4BY1H 2IX3A 5T1IA 4XQNA 3EJIA 1EL0A 4A3GG 3J7ZC 2O5IC 5KRUA 1AP0A 1A8VA 3PCOB 4FXKC 1ENFA 1CTMA 3VR3A 4S3SA 3PIO3 2VXWA 5K36G 3MXGA 2AKWB 1FR3A 4QQBX 4FDBA 2N55A 4DGZA 3CF5A 3L0OA 2IHFA 4GKKQ 1PH6A 1ASYA 1RCVD 3RLNA 2A8VA 3MC0B 2UUCQ 2UXDQ 4YWMA 2CHBD 3QOJA 2NVYB 2AWNA 1D8LA 3FKIG 4KHPL 5GQOA 1FVIA 1V43A 3SK5A 1NAPA 2WB1B 2FXQA 3DWQA 1TR5A 1VQDA 4Z9CB 5IY0A 3CRLC 1TT2A 4ZCKA 4HJ7A 1GD7A 3NSWA 3GTKB 4NDXA 1I6VC 3NXWA 1EFWA 4OWTB 3OW7A 1QZGA 3HOYH 3URYA 3M4OB 2FMCA 1G6ZA 2UU9L 4ODGA 2IX1A 3TRZA 2MUYA 2I5MX 3QIAA 1LM0A 2PZUA 1STGA 4X3KA 2NZOA 1V1QA 1VQ9A 1SNOA 2Y0SG 1A0IA 3ND8A 2RCNA 1PH7A 1GOZA 4A3KB 5EGTA 1TKWB 5JAVA 1NMGA 3E0EA 4GLAC 1WTXA 2DJFC 1HR0W 5IT9L 1M1KC 4XIGS 1MD2D 3I73A 2EIFA 4ZKBB 1XMOL 4JBJA 3UI2A 4AYBG 5CBEE 5JEAJ 5CORA 2YTYA 2LY7A 5T1GA 4LF5Q 4JV5L 4YIJA 1XNRL 1FD7D 1HXYD 4JYAL 2F0SA 3H0GH 4KLKA 4A3IB 1Q81C 3CMEA 5LMNL 4A3JB 5TSSA 4IPHA 1BXTA 1HZCA 1PH5A 4GZYC 4HJAA 2LFNA 3AFQA 3I4NG 4IOCA 1HNZQ 1MSHA 4C3HG 4DR1L 2L4NA 1VQOA 4QL5A 1B2TA 1TWFH 2PPBC 5C4HA 2HD3A 2VZAA 1GUSA 2EY6A 1FJGQ 1LTID 3H91A 5KEEA 4FNFA 5D3DA 1LO5D 3UDXA 1DGSA 4A3EH 1SDFA 2R92H 1I4QA 4A3DH 1VQHA 1W3SA 4QCLA 2A5HA 4GLVB 1QUQA 5IYBG 1IKMA 1A63A 4K8IA 3OTOQ 2R93H 2HCCA 4B3RQ 1I3QB 2EYHA 2A69C 1AZPA 5C4XG 3F2UA 1DZ1A 3NTKA 4A3CH 1C8CA 1D5XC 1IYVA 1PH1A 2F0GA 2JA8B 3CCEA 3AQQA 4JG2A 3MXNA 4K5WA 3HOUG 2K1BA 3D4WA 2UXBL 3D4DA 4A93B 2Q8RE 1VQFA 1FYCA 4R1JA 2EYJA 2CFMA 3TZUA 1A2TA 2IHEA 3RZOB 1Q12A 2CCZA 1Y69U 3CPFA 3Q24A 2B29A 2A19A 1NMFA 1RODA 4R9WA 3BDCA 1SYCA 2F3IA 4JBMA 2NN6G 3QR8A 1RF2D 1TY0A 4K5VA 5I2XA 3LX0A 5ELNA 2QCPX 4HIOA 2YU9B 4LF4L 3GP7A 2QDLA 1DXMA 2B2WA 3VR5A 5FOBB 1PH2A 3PO3H 4JI5Q 4DV0Q 1EEFD 4RG1A 2E2IB 5HGQA 2PZWA 1SFOB 3BU2A 1Q3LA 4C3IB 1PFMA 2J0TD 3MVVA 1G2TA 2LXKA 1P16A 4LJZC 2ICIA 2B2WC 2ZJPA 2E2HH 1QE6A 2B63G 2NVTB 3EFXD 4C1NI 3GTOH 2A6ED 5E3FA 4DR6Q 3C3LA 3A7AB 1JCKB 4K8JA 3JC66 1TXYA 1DOMA 1K8MA 1RHPA 3I4MB 4LF8Q 4JCVE 1U9RA 2UUCL 1ICFB 2D2CC 2B2UA 3WOEA 4U68A 1EIFA 1O7LA 2LMCB 2I0QA 5M3FB 2SEBD 2N3SA 2D5DA 4LMQD 3R8BA 4JC0A 4IN3A 1EY0A 2L9HA 4RGNA 1YIJA 4IPCA 1PRTB 2B2UC 4RKLA 1K3BC 4KY6A 4A3GB 3K5OA 5EPKA 4C2MH 3KBXA 3KLWA 3G48A 4F7XA 3U4VA 2E2JB 3HKZE 4G57A 4O42A 3EA6A 3GTJB 4DR2L 1X55A 2E74C 3RZDH 1C0AA 3TQYA 2I46A 2VL6A 2EYPA 2F0QA 1LTRD 2MQHA 3CHBD 3NWTA 1PVOA 5LL6X 5I4DA 4RGOS 3KLRA 4TQUS 2F0UA 3BVMA 5M3MG 1VQGA 2XN9C 2AUKA 1XXGA 1BKBA 1T5XD 3FKIB 3NQIA 4IUPA 1WVLA 1RD9D 2FFKB 1U4LA 3NE5B 1SJED 4H44C 1N9WA 4N8FA 3J80c 3K7AB 1H9RA 1U4PA 2LXJA 2IX0A 1MGSA 1XNQQ 2OCEA 3L7ZC 4BBSH 4PV1C 3CQZB 4BWGB 1Q86C 5DEHA 1EWCA 1K8GA 1V1PA 4OWXB 4LFAQ 2XWBB 2MFIA 1IBKL 4DAMA 2KECA 1X65A 2RKSA 4OX9Q 4OO1G 2F4IA 4CKCA 1B53A 3M4YA 4M8AA 4GS3A 4ZK9B 2RSOA 4EQOA 4H13C 1N32L 5C4JB 3S1RH 1JE5A 2CQOA 3E9IA 4A3BB 1EFID 2BOSA 1EQQA 2JA5G 4DR7Q 3A8JE 4E6IA 1STEA 3NTIA 1HZAA 1TWHB 4L63B 1SRUA 2ICEC 5I6YA 5E4XA 3KF6A 4HCEA 4BY1G 1GUTA 2F3VA 1Y8NB 3KF8B 3TP7A 3UDIA 3KBGA 3ULLA 1LUZA 2KJXA 4AYBB 1K73C 3PIPA 3EQLC 3SGIA 4DUZL 4RMFA 2F3WA 3HRZC 1YHBA 4XDXA 5C3EH 5E7NA 2ZJQA 3ULPA 4B3RL 3S17B 4FVMA 2D62A 1LACA 3S16H 1SYFA 3EN2A 5DM63 5ELOA 1N8RC 1N36L 3M4QA 3JAME 2KVMA 3KDFA 1Y8OB 1G291 3S1QH 2JE6I 3T1HL 1CA6A 3ERSX 2IW3A 4PNYA 4QF4A 4QY7A 2XTIA 4CJ2C 4L5QA 1BCPD 2JA9A 1HQRD 2UXCL 2NYZD 1GO3E 4EX5A 3IFTA 4IFDI 4GKJL 3QG1A 1EOVA 3PUXA 5H1SE 2PQEA 4GN4B 4R4TA 1E24A 2IWHA 2RF4A 4PZ7A 2VUMH 1UE1A 3VA7A 4Y52H 1GUWA 2KHIA 3NEMA 2F0MA 5KYLA 1S40A 3HOYG 3RMHA 4FF4A 2J4XA 3G7LA 1XMQL 1BF4A 2HHHL 2O5JC 1EY7A 3CD6A 2MO0A 5C4XB 1MJCA 4JI3L 1CFMA 4C3JB 1UAPA 3FP9A 1JWMD 5COYA 2A74C 4YWLA 3S14B 2ASBA 3ND9A 5FLXc 1CQFA 3MXPA 3VR2A 1QWYA 3BDOA 1R9TB 5EPJA 1AE3A 3HFZB 1BO0A 2PI2E 5M5YH 4LW1A 1BBUA 1KLUD 2DNEA 4HTHA 2ENBA 3TN2A 4NXMQ 1WOCA 1CHQD 2B3GA 3GTPB 1OXXK 2EE1A 5EKKA 4P72A 2PMZB 2YTXA 2QKIC 4X64Q 1B3AA 3HS0C 4X66L 1EYCA 5EKLA 1IHZA 1Q8IA 1EWHA 1A62A 3BYYB 5KYIA 1FGUA 4FXGC 5KNBA 4R4IA 3H0GG 1S5CD 3K5NA 4J6HA 4X65Q 1T5EA 1EY8A 2XVSA 5IYDH 4A75A 3D6CA 3V2TA 2O4XA 3D8GA 1SNPA 4JI1L 4P74A 3RN5A 1VQKA 2WKDA 4A3MG 2K05A 1KAAA 1LTGD 1UNSA 4K14A 2JYOA 4RCOA 4CKEA 3PO2B 1SLJA 3E9HA 2ZM6Q 3K0YA 2B63B 3OWFA 1HUMA 5A35A 2BDOA 3N6RA 3DM3A 2JEBI 3AEVA 4A3EG 3GTMB 2R92G 4A3DG 3IRBA 4JOIA 2F1MA 4AQYL 4X3UA 2HIVA 2F0NA 3NUCA 4KN7C 2R93G 1ILPA 1I94Q 4K0KL 2AQ2B 3S1NB 4KJNA 4K2KA 1SYEA 4L6TB 2ATWA 4JOIC 1TWGB 1A3UA 2XWJB 4RFBA 1W6KA 2FJ2A 5DAUA 4BXXH 1KHIA 1U4RA 5IT9c 4DUYQ 5IGFA 4EQ5A 2KQ3A 4MNOA 2WAQG 4DV6L 2YV5A 4IJLA 2ES2A 1VQ4A 1STAA 3T53B 4XYQA 4LUVA 2OF1A 1F9QA 5ELCA 1SXTA 3GTGH 2L5TA 3CC2A 3SHLA 4ME3A 3RN2A 4FYDA 2RSNA 1DCZA 3T1YQ 1O80A 1X6OA 4LF7L 3GTQB 5K5PA 1Y1WH 5CR3A 1JWSD 4I65A 1JJCB 4NW2A 4N9TA 2MNAA 4CDFC 4IUQA 4IQZA 3LGJA 4ZLTF 4HIMA 2CH4A 2ID0A 3BVGA 2E5LQ 1IW7C 4DV2L 4KK7A 3UDFA 2BDNA 3E3XA 3HOVH 1RDPD 1H9MA 3S24A 1I50H 2XGTA 3NP8A 4UP9A 1JJ2A 2RBMA 3KOJA 1CKOA 1WD0A 3J80i 1CA5A 1JWUD 2BA1A 4TSSA 3TSSA 1TS2A 2R3ZA 4UDUC 4DV7Q 1O7IA 2OTJA 1B44D 3STBC 1V1OA 5LMUQ 3H3VH 3LNNA 2QDBA 1V8QA 2JXMB 3UDGA 2CVRA 1SE4A 1EU3A 1QUQB 3ZJYC 1IBML 1BCPC 1XYIA 1IBLQ 1Q1BA 3P75A 1Q7YC 3GD7A 3G6EA 1DD2A 1C4QA 3NTHA 1YJWA 2LSSA 5C5LA 1BBWA 4R8NA 5GAGC 2JA5B 1PZKD 1WJJA 1QVFA 1NNXA 5GROA 2AQ3B 4CGYB 3E6ZX 4BY1B 3SK6A 1X3GA 3MZ5A 3I90A 2Z6BA 4DV3L 4J8QA 2XNAC 1L1OB 3J7AF 2B2VA 3DEOA 1JR0D 1UWVA 1VMCA 2KHSA 5ELDA 1EWIA 4O2DA 4LWCA 5J39A 2EY5A 2VQFL 1WCMH 3T13A 5ELFA 4XT3B 2C9OA 3VR4A 4QJFA 1KLGD 2B2TA 3CXCA 2Z8LA 5EKIA 4FF1A 1PFSA 2HDMA 1QCBD 3OYYA 2B2VC 4KD4A 1LT5D 4JI2Q 1HTPA 3L3OC 3HOWB 4PMWA 1YNND 3H94A 2NVYH 3AU7A 2EJFC 3GTLB 5JJLA 2RA4A 4V0BA 4YHHL 4C1NK 2B2TC 1CKMA 3QWNA 4DXFA 5IOCA 4JI7L 2F0IA 1MIUA 3NK9A 1VQJA 5IWAQ 5FLMG 3TBIB 5ELEA 2F4VL 1D7QA 2B8FA 2A6HC 1YITA 5C0XH 3SVMA 1S4ZA 3GTKH 4LFBL 3HOYB 3OMCA 4BY7H 4LFCQ 4DV4L 3JAML 3VR6A 4GNXA 4H02A 1PYWD 2AMCB 5KNCA 1YNJD 4DV5L 4XT1B 2F0VA 1O7ZA 3MWYW 2KCMA 1BDOA 3GDEA 3TP6A 4MTKA 4ILWA 3AFPA 1LTSD 5FO8B 2DUDA 1CQVA 1TIID 3R93A 3OIQA 3SK8A 5C44B 3CKIB 4GNXC 1G91A 5BR8L 1I6HB 5AFWA 2ZXPA 4EGVA 4IFDJ 2OQKA 4B3SQ 4NXNL 2RDFA 5M5WB 4MN3A 2XRQD 1X3EA 3MXUA 1TWCB 4OGQC 4OXPA 4ME5A 2Y0SE 1FNVA 3OPOA 2DY8A 2IT1A 4A3LH 4RKBA 4B3TQ 3UE1A 1GUGA 4JBKA 1X3PA 2GA4B 1NR4A 4G4KA 1JOQA 2EY2A 1SEBD 3VYSA 4Y7NH 4A3IH 2OWOA 3TP8A 3RD4A 2YYZA 5G3LD 4RHRA 4AYBE 5CMDA 4DUYL 3WWVA 4BBRH 5GADC 1KDCA 2Z4HA 1M90C 4X62Q 1SN8A 2NB0A 2JK8A 2KOLA 4A3MB 1IKLA 4KY7A 5AJ3Q 2UUAL 3HOZH 1M8AA 1M4VA 3J7YW 3QO2A 1AE2A 4A3EB 2FINB 1KC8C 4YY3Q 2VUMG 4A3DB 2AUJD 4A3FH 4OHJA 1ONLA 5FJ8H 1C7YA 5IGCA 2Q8TA 3JAMi 3HOXH 1YBYA 2A68D 4JI0Q 3FPUB 4WORA 2NBFA 1HR0L 2R93B 1Z6HA 4HCSA 2Q2HA 3A8IE 3FHWA 4IZ8A 1SMYD 1I3QH 2WV6D 2QGQA 1QNUA 1EQRA 3H3VC 2K5WA 4DAYA 2D9UA 4DV1L 1SE3A
chains in the Genus database with same CATH topology
1F2YA 2F0EA 3N52A 2WKCA 1J8IA 3DXJC 2MGSA 1STYA 1EY9A 1CK1A 1F2LA 2BE5D 3SEBA 3CU7A 4OO1I 1D1IA 2CW0C 5D3IB 4DXGA 1ZYRD 1DYQA 2X69A 1I4RA 4K6LA 3D3RA 3KLSX 5IGDA 1JOKA 1FGBD 3KLSA 1S5ED 1X32A 2PCFB 1H9JA 3J81E 1AW7A 2X6LA 3OWEB 4IFDH 5JEAH 3C1FA 3Q0AA 4ID6A 1OXVA 2SOBA 2L0CA 3MHBA 2JA7B 3FRPB 1RTNA 4QUFA 3S1MB 3TP5A 5BN5A 3GTOB 3BVZA 1EQVA 1CHPD 3O13A 5NUCA 4N9PA 5JOBA 1F2ZA 4EVOA 1H9KA 3IAYA 1E0BA 1E2WA 1PRTD 3W2DA 3PIP3 1DOKA 4KN4C 4CHTB 2SNSA 1D1KA 1U4MA 2L11A 2NZ1D 1XTCD 3PUVA 1SNMA 1HRJA 2PNRC 1D6EC 5J1ZA 2L1BA 2Z1CA 4MHEA 3ZYYX 3OHXC 2G9DA 1BCPF 2EVBA 5K36H 1EZ6A 1VDZA 4NMZA 4FF3A 2HDLA 1AN8A 5CV4A 1K8OA 1PXUA 2EJGC 3TDQA 4HAEA 4PMCA 2H1EA 5I6WA 2NTTA 1TWAB 3IFDA 5CYUA 1EY5A 1PTOD 4F8MA 1PTOB 2DY7A 1JORA 4FO2A 4KJOA 4H7BA 4KHVA 1VMPA 3R2TA 1HFGA 5FLXE 5JVG3 3FVQA 2K03A 4RCNA 1KDAA 1TU2B 5E4WC 2JSOA 2Y0SB 2OT2A 3WDNA 3D4RA 4XQQA 1Z47A 3P20A 4F87A 2WP8J 4ZQ3A 1CI3M 4K6DA 1SSOA 2A68C 1TQOA 3S15B 4XTCS 4DF7A 5M9OA 3S9WA 2K6AA 4KHZA 2ZXRA 4I7ZC 2MHVA 2NUCA 4RH6A 1H9SA 2LS01 4G7ZC 3NQTA 3QOLA 3S16B 4M1UB 3I4NB 2J7ZA 1SNDA 3LWEA 1Q1EA 4C3HB 5CV8A 1NSNS 2LKVA 1DJRD 4RGMA 3DUZA 5FK9C 2VNUD 3K5LA 1LTAD 1B9NA 3FEWX 3VYTA 4UAIA 3V96A 3K58A 5EQ0A 3KK7A 1C48A 5C0XG 2MPMA 1WTWA 1I4HA 4O1NA 2XIWA 5JPMC 2A73B 4RA8A 1F9PA 2A6EC 1K83B 3HOUB 4WFN3 1RTOA 1GUNA 4QUCA 1EYDA 4F88A 1F77A 2ZXOA 5A2QL 5IGGA 2EY1A 2RDHA 2E2DC 2JP1A 3MFYA 1FNWA 3X3MA 5M5YB 1ET6A 1R4QB 4DNRB 5EBDA 3IL8A 3AB9A 2FMMA 4IUVA 1F9SA 4DFAA 4RHSA 2K32A 3BG3A 4B08A 4HN7A 3DHQA 3DWPA 2H4OA 4FF2A 1AZQA 1PDQA 3V05A 4BA2I 4EQNA 1OXUA 1DM0B 2K5DA 1KNAA 1EY4A 4PMBA 4QMGA 1ML0D 1MBYA 1STBA 3DEPA 1SYDA 3X3NA 1I4PA 3D6WA 1WTOA 2DN8A 2L12A 3J81L 2QF7A 3ONAB 1PZJD 4B9XA 3HP3A 4ULLA 3P1HA 2VB2X 1GXDC 3T4AC 5JJZA 3NBHA 4P2CB 1FNUA 1HPCA 1SYBA 2E75C 1D5MC 2G9HD 3M7GA 3OSOA 4IALA 3I8ZA 2EYOA 1HHVA 3DMUA 3T16A 2F0TA 3T56B 3Q22A 5M3MB 2KEDA 4NKLA 4XYOA 4RGTA 4TRDA 3GQBA 4KD3A 5KGUA 5JEAG 4OIJA 5KNDA 3VA5A 1D5ZC 1ZKOA 5F2DA 5FO9B 2B39A 3MFGA 2KCNA 4LAAA 3SDZA 5E1FA 4C3IG 2EXZA 2A69D 5IGBA 1TS4A 1A3TA 1KABA 2R61A 1LABA 5IODA 1WTVA 1AFPA 3AMUA 4IUUA 1S5FD 1CM9A 4X3SA 1ET9A 2BA0A 2XSCA 5C5MA 3P7JA 3L9AX 3S2HB 4OO1H 3OMGA 5D14A 2F0PA 1CZWA 2F0HA 5KIXA 5I9OA 4KY5A 2M2LA 1W6JA 1A6XA 5FLXL 5G3LF 1GHJA 3EROA 5CV5A 4Q0FA 5C4ZA 3M7NA 1QNKA 1STHA 1STNA 3A7LA 4BS9A 1HTLD 1B9MA 3E5SA 2NWGA 1S5DD 3BYTB 4CBVA 1PLFA 3QB3A 1WCMB 2NN6I 5IIFA 1BQQT 2F0WA 4FP5D 2X6GA 1S5BD 2EJMA 1LT3D 4ZYSA 4NP5A 4B9WA 3PMFA 2F0JA 1IYUA 1LV9A 1GUOA 1B1ZA 4BY7B 3C46A 1ZEQX 1JQYD 2M9VA 1XX8A 2Z4IA 1JOOA 4KKSA 3RLFA 2OEOA 1PZID 5BN4A 1ESFA 3DM1A 4CJ0B 3EVQA 3D31A 1HA6A 1OXTA 1UUPA 3GO5A 2K33A 4X3TA 1EEID 1SBBB 3Q23A 5JVH3 3H0GB 1SYGA 3PV0A 2TMPA 1EU4A 1LTBD 1ENCA 4Y7NB 3BZDB 1EY6A 3NPPA 4HMIA 3K59A 1CT1D 5A2QE 4BBRB 1O78A 1TWFB 3MAQA 2WINB 1E2ZA 2KA7A 1EZ8A 3HOZB 2R92B 1QB5D 1EIHA 1JE4A 4OL7A 4QIWB 1WTRA 2E76C 3PUWA 4C56C 1OXSC 1PRTF 2RDGA 1V1PB 4KMUC 1BNZA 4A3FB 1II3A 3HOXB 1SE2A 1A15A 1HUNA 4U673 2F0LA 4XXEA 2IPKD 3I3CA 1Z7TA 2RQXA 3T51B 2WAQB 2AQ1B 4C3JG 2HQEA 2C5CA 4DK0A 2BCOA 1B50A 2WACA 4JK1C 4KKTA 1I4GA 1ENAA 1SNCA 2PW7A 4CKBA 2O2LD 4LK1C 1BUVT 2HUGA 2IJ0A 3J80E 3I72A 5CV7A 1X3QA 1PTOF 1ICWA 3PO3B 3H09A 3OOCA 1H9SB 2SDFA 3BDLA 3NBIA 2CQAA 1HCZA 2F0OA 4IUTA 2JA6B 2K28A 2M00A 3R2IA 1G2SA 4H0LC 4DNTB 2E2HB 2NVQB 1JB3A 1KDBA 3KUPA 3FPPA 4DAVA 2Q8IB 1XWEA 1YNNC 2R6GA 4OIKA 5HURA 2HCIA 1IL8A 4G7HC 1EQTA 3MEHA 5I9PA 1HFNA 1HQMC 2F0FA 4HSVA 2QEJC 1AEXA 4ABNA 2EDGA 3VYUA 5C0XI 3U9SA 3J7AV 3W3AA 1YNJC 1L0YB 1SAPA 1QJOA 2AWOA 1LT6D 3HG9A 4C2MB 3R3OA 1CZGA 1RKNA 4Q5VA 4KI0A 3C1EA 1D2BA 1LT4D 3RZDB 4TKOB 2EZVA 1EYAA 5CV6A 1UEAB 3MA2B 4HSPA 2TSSA 3SK4A 1TVXA 4MIUA 2DNCA 1WTPA 3E0JA 4BBSB 4QB4A 4WJWA 1PTOH 1SJHD 1VF5C 5DM73 3WOFA 2KUMA 2EYFA 2K5QA 5DNFA 3OIPA 2VB3X 1G8ZD 1JC7A 1VCIA 5BN3A 3S1RB 3Q6SA 5D65A 1MSGA 4FXDA 1SMYC 4RWSC 5LHY1 1GJXA 1F9RA 5CV9A 2EPBA 5HGTA 5C3EB 2L55A 5C6AA 3I91A 1ESRA 1IW7D 4G7OC 2PO4A 2BE5C 1LTTD 3CRKC 1ILQA 4IUNA 1ZYRC 3S1QB 4RAUC 1QG7A 1OO9B 1B4OA 1WTQA 3I70A 4V190 5CC4A 2PW5A 1L0XB 3S2DB 4K5XA 5EPLA 5ELBA 4CJ1B 2MJ8A 3FDTA 2VUMB 3K57A 2EYMA 5IT9E 1BCPB 1F2MA 3PUZA 3GV3A 2EOTA 3NWSA 3C2PA 1DOLA 1R4PB 4DK1A 3A8KE 2WIIB 1O7YA 2R7ZB 5EJWA 2EYLA 3M85A 5EBCA 5IGEA 2PYKA 2IL8A 3SR1A 3U9OA 1QILA 4HR7B 5I2YA 1Y1VB 3SE0A 1PRTC 3A56A 1BOSA 3QJYA 1PFBA 1Y8PB 2KEEA 2NN6H 2K01A 3DWAA 2KCCA 2SNMA 4K2LA 3LWUA 2XRSD 1ZXTA 3NHHA 4L8JA 4KV6A 3A54A 2A6HD 3TMEA 1GHKA 2B8GA 5M5XB 1PFNA 3VYRA 4ZKCB 3H6MA 3RUZA 5C3XA 3J80L 2F0KA 3TZDA 1QOHA 3HZXA 4KTAA 1PTOC 4DAPA 2NVXB 5CBAE 1LLRD 1Q90A 4R8IA 4IURA 1NUCA 3ITPA 3K5MA 1DONA 4DN4M 2K7VA 2N88A 1KNEA 3HKZB 3I4LA 1BBXC 1TS5A 4KKUA 3KF8A 1A2UA 2NTSA 5CGKA 4PQXA 5FO7B 3GTGB 3FMCA 5J22A 1I4XA 3K6OA 4XQJA 1A3VA 4J1MA 1Y1WB 2F0DA 4HMJA 1NR2A 3A55A 4EQPA 1JICA 2F03A 2OXPA 4JBWA 4ZUJA 1EIGA 3SXHA 4IFDG 1WD1A 4ZRZA 2B2YA 5FKAC 5C0XJ 3BS1A 3HOVB 3G6JB 4DU9A 3M3YB 2RVLA 3PUYA 1I50B 5C3WA 1RJTA 3HGBA 1PMRA 2K04A 1VF7A 2B2YC 2V4DA 2ZT9C 3GV6A 5LL6S 1BR9A 1MI2A 5JPNC 5ISRA 1EOTA 4BA1I 1HA5A 1E2VA 1KTKA 1J9OA 3HEJA 4ZUIA 1TS3A 2FHTA 4HEDA 1SNQA 2CW0D 3MTSA 4WRDA 1NCVA 2PZTA 3IKJA 2JEAI 4ZAIA 2I07B 3ERQA 2MP1A 4DA2A 1TY2A 2QILA 2IX3A 5T1IA 4XQNA 3EJIA 1EL0A 2O5IC 5KRUA 1AP0A 4FXKC 1ENFA 1CTMA 3VR3A 4S3SA 3PIO3 2VXWA 5K36G 3MXGA 1FR3A 2N55A 4DGZA 1RCVD 3MC0B 2CHBD 3QOJA 2NVYB 2AWNA 1V43A 3SK5A 1NAPA 2WB1B 3DWQA 1TR5A 4Z9CB 3CRLC 1TT2A 3NSWA 3GTKB 4NDXA 1I6VC 3NXWA 3OW7A 3URYA 3M4OB 2FMCA 1G6ZA 4ODGA 2IX1A 2MUYA 3QIAA 2PZUA 1STGA 4X3KA 1SNOA 3ND8A 1GOZA 4A3KB 5EGTA 1TKWB 5JAVA 1WTXA 5IT9L 4XIGS 1MD2D 3I73A 4ZKBB 3UI2A 5CBEE 5JEAJ 5CORA 2LY7A 5T1GA 4YIJA 1FD7D 1HXYD 2F0SA 4A3IB 4A3JB 5TSSA 1BXTA 4GZYC 2LFNA 1MSHA 4C3HG 2L4NA 1B2TA 2PPBC 5C4HA 1GUSA 2EY6A 1LTID 3H91A 5KEEA 4FNFA 5D3DA 1LO5D 1SDFA 1I4QA 4QCLA 2A5HA 1IKMA 4K8IA 2HCCA 1I3QB 2EYHA 2A69C 1AZPA 3F2UA 1DZ1A 3NTKA 1C8CA 1D5XC 1IYVA 2F0GA 2JA8B 4K5WA 3MXNA 2K1BA 3D4WA 3D4DA 4A93B 2Q8RE 1FYCA 2EYJA 3TZUA 1A2TA 3RZOB 1Q12A 1Y69U 3Q24A 1RODA 4R9WA 3BDCA 1SYCA 2NN6G 1RF2D 1TY0A 4K5VA 5I2XA 3LX0A 2QCPX 2YU9B 3GP7A 1DXMA 2B2WA 3VR5A 5FOBB 1EEFD 2E2IB 2PZWA 1SFOB 1Q3LA 4C3IB 1PFMA 2J0TD 3MVVA 1G2TA 4LJZC 2ICIA 2B2WC 1QE6A 2NVTB 3EFXD 4C1NI 2A6ED 5E3FA 3C3LA 3A7AB 1JCKB 4K8JA 1DOMA 1K8MA 1RHPA 3I4MB 1U9RA 2D2CC 2B2UA 3WOEA 4U68A 1O7LA 2LMCB 5M3FB 2SEBD 2D5DA 4LMQD 3R8BA 4IN3A 1EY0A 2L9HA 4RGNA 1PRTB 2B2UC 4RKLA 4KY6A 4A3GB 3K5OA 5EPKA 3KBXA 4F7XA 2E2JB 4G57A 4O42A 3EA6A 3GTJB 2E74C 2I46A 2EYPA 2F0QA 1LTRD 3CHBD 3NWTA 5LL6X 5I4DA 4RGOS 3KLRA 4TQUS 2F0UA 3BVMA 2XN9C 2AUKA 1XXGA 1T5XD 3FKIB 3NQIA 4IUPA 1WVLA 1RD9D 2FFKB 1U4LA 3NE5B 1SJED 4H44C 3K7AB 1H9RA 1U4PA 2IX0A 1MGSA 3L7ZC 4PV1C 3CQZB 4BWGB 5DEHA 1EWCA 1V1PA 2XWBB 2KECA 2RKSA 4OO1G 2F4IA 4CKCA 1B53A 3M4YA 4M8AA 4ZK9B 2RSOA 4EQOA 4H13C 5C4JB 4A3BB 1EFID 2BOSA 3A8JE 4E6IA 1STEA 3NTIA 4L63B 1TWHB 2ICEC 5I6YA 5E4XA 4HCEA 1GUTA 2F3VA 1Y8NB 3TP7A 3KBGA 2KJXA 4AYBB 3EQLC 2F3WA 3HRZC 4XDXA 3S17B 4FVMA 2D62A 1LACA 1SYFA 5DM63 3JAME 2KVMA 1Y8OB 1G291 2JE6I 1CA6A 2IW3A 4PNYA 4QF4A 4CJ2C 1BCPD 1HQRD 2NYZD 3IFTA 4IFDI 3QG1A 3PUXA 2PQEA 2IWHA 3VA7A 1GUWA 2F0MA 5KYLA 3RMHA 4FF4A 2J4XA 3G7LA 1BF4A 2O5JC 1EY7A 5C4XB 1CFMA 4C3JB 1UAPA 1JWMD 5COYA 2A74C 3S14B 3ND9A 1CQFA 3MXPA 3VR2A 1QWYA 3BDOA 1R9TB 5EPJA 1BO0A 4HTHA 1KLUD 2DNEA 3TN2A 2ENBA 1CHQD 3GTPB 1OXXK 2EE1A 5EKKA 2PMZB 2QKIC 1B3AA 3HS0C 1EYCA 5EKLA 1IHZA 1Q8IA 1EWHA 3BYYB 5KYIA 4FXGC 5KNBA 1S5CD 3K5NA 4J6HA 1T5EA 1EY8A 2XVSA 3D6CA 3V2TA 2O4XA 3D8GA 1SNPA 2WKDA 2K05A 1KAAA 1LTGD 1UNSA 4K14A 2JYOA 4RCOA 4CKEA 3PO2B 3K0YA 2B63B 3OWFA 1HUMA 5A35A 2BDOA 3N6RA 2JEBI 3GTMB 2F1MA 4X3UA 2F0NA 3NUCA 4KN7C 1ILPA 2AQ2B 3S1NB 4KJNA 4K2KA 1SYEA 4L6TB 1TWGB 1A3UA 2XWJB 4RFBA 1W6KA 2FJ2A 5DAUA 1U4RA 5IGFA 2KQ3A 1STAA 3T53B 4XYQA 2OF1A 1F9QA 5ELCA 1SXTA 2L5TA 3SHLA 4FYDA 2RSNA 1DCZA 1O80A 3GTQB 5K5PA 5CR3A 1JWSD 4I65A 4NW2A 4N9TA 4IUQA 4IQZA 4ZLTF 2ID0A 3BVGA 1IW7C 4KK7A 2BDNA 1RDPD 1H9MA 3NP8A 2RBMA 1WD0A 1CA5A 1JWUD 2BA1A 4TSSA 3TSSA 1TS2A 2R3ZA 4UDUC 1B44D 1V1OA 3LNNA 2QDBA 1V8QA 2JXMB 2CVRA 1SE4A 1EU3A 1BCPC 1XYIA 1Q1BA 3P75A 3GD7A 1DD2A 1C4QA 3NTHA 5C5LA 4R8NA 2JA5B 1PZKD 2AQ3B 4CGYB 3E6ZX 4BY1B 3SK6A 3MZ5A 3I90A 4J8QA 2XNAC 3J7AF 2B2VA 3DEOA 1JR0D 1VMCA 2KHSA 5ELDA 5J39A 2EY5A 3T13A 5ELFA 4XT3B 2C9OA 3VR4A 1KLGD 2B2TA 2Z8LA 5EKIA 4FF1A 2HDMA 1QCBD 2B2VC 4KD4A 1LT5D 1HTPA 3L3OC 3HOWB 4PMWA 1YNND 3H94A 3AU7A 2EJFC 3GTLB 2RA4A 4V0BA 4C1NK 2B2TC 3QWNA 4DXFA 5IOCA 2F0IA 3NK9A 3TBIB 5ELEA 2B8FA 2A6HC 5C0XH 3SVMA 1S4ZA 3HOYB 3OMCA 3JAML 3VR6A 5KNCA 1PYWD 1YNJD 4XT1B 2F0VA 1O7ZA 3MWYW 1BDOA 3TP6A 4ILWA 1LTSD 5FO8B 1CQVA 1TIID 3R93A 3OIQA 3SK8A 5C44B 3CKIB 1G91A 1I6HB 5AFWA 2ZXPA 4EGVA 4IFDJ 2RDFA 5M5WB 4MN3A 2XRQD 3MXUA 1TWCB 4OGQC 4ME5A 1FNVA 3OPOA 2DY8A 2IT1A 4RKBA 1GUGA 1X3PA 2GA4B 1NR4A 4G4KA 1JOQA 2EY2A 1SEBD 3VYSA 3TP8A 3RD4A 2YYZA 5G3LD 4RHRA 5CMDA 1KDCA 2Z4HA 2NB0A 2KOLA 4A3MB 1IKLA 4KY7A 1M8AA 1M4VA 3J7YW 3QO2A 4A3EB 2FINB 4A3DB 2AUJD 4OHJA 1ONLA 5IGCA 2Q8TA 2A68D 4WORA 3FPUB 2NBFA 2R93B 1Z6HA 4HCSA 3A8IE 4IZ8A 1SMYD 2WV6D 1QNUA 3H3VC 4DAYA 2K5WA 2D9UA 1SE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2V A;  4L8J A;  1O78 A;  3A7L A;  3DXJ C;  1DXM A;  3VR5 A;  2B8F A;  2A6H D;  2A6H C;  1B9M A;  4XIG S;  3I73 A;  4IQZ A;  2EVB A;  5K36 H;  1HQM C;  2DNE A;  5C0X H;  1B9N A;  1VDZ A;  1GHK A;  1E2Z A;  2KA7 A;  2B8G A;  1IW7 D;  4G7O C;  1IW7 C;  2BE5 D;  2EDG A;  2BE5 C;  1OXX K;  1K8O A;  3VR6 A;  5C0X G;  1H9M A;  2CW0 C;  2E76 C;  3PUW A;  3U9S A;  3W3A A;  5KNC A;  1YNJ C;  2NN6 I;  1OXS C;  2EJG C;  4OO1 G;  3CRK C;  4LJZ C;  3M4Y A;  1QJO A;  1ZYR C;  2AWO A;  3IKJ A;  1BDO A;  1HPC A;  2JEA I;  4H13 C;  4KMU C;  1EWH A;  2E75 C;  2BA1 A;  2A6E D;  2A6E C;  3A8J E;  5KNB A;  2EJM A;  3A7A B;  4KI0 A;  2O5I C;  4GZY C;  1GUN A;  1K8M A;  1T5E A;  3L7Z C;  1GUT A;  1Y8N B;  1CTM A;  3VR3 A;  1Q90 A;  1Z7T A;  2PCF B;  3LNN A;  1V8Q A;  4TKO B;  3T51 B;  3T56 B;  2JXM B;  1H9J A;  1IYU A;  2D2C C;  2K7V A;  4IFD H;  3MFY A;  5JEA H;  2PPB C;  3EQL C;  5K36 G;  4RCN A;  1FR3 A;  1O7L A;  1TU2 B;  2LMC B;  1GUS A;  3I4L A;  3MXU A;  4DK0 A;  4OGQ C;  4KKU A;  3GQB A;  1Q1B A;  4DNR B;  3PUZ A;  3AB9 A;  3OPO A;  2D5D A;  4JK1 C;  4KKT A;  5JEA G;  1GUO A;  2IT1 A;  1OXV A;  2D62 A;  1LAC A;  5KND A;  3WDN A;  3D4R A;  4DK1 A;  2K32 A;  1ZKO A;  3GD7 A;  1DD2 A;  1GUG A;  5A35 A;  2BDO A;  3N6R A;  3A8K E;  3P20 A;  2JEB I;  3BG3 A;  4LK1 C;  3FMC A;  3SDZ A;  1Y8O B;  1CI3 M;  1G29 1;  2F1M A;  2DNC A;  2JE6 I;  2A69 D;  2A69 C;  2YYZ A;  5BN5 A;  4KN7 C;  1V43 A;  3I72 A;  4KKS A;  1LAB A;  2A68 C;  3M85 A;  3RLF A;  4JBW A;  1IYV A;  3OOC A;  3CRL C;  4XTC S;  5BN4 A;  1H9S B;  1VF5 C;  4BA2 I;  3IFT A;  1HCZ A;  2E74 C;  3QG1 A;  4IFD G;  1I6V C;  3PUX A;  4HR7 B;  4KHZ A;  1OXU A;  2BA0 A;  3OW7 A;  4I7Z C;  4H0L C;  1H9K A;  3D31 A;  3VR4 A;  1H9S A;  3KLR A;  4TQU S;  3SE0 A;  1E2W A;  3PUY A;  1OXT A;  1FYC A;  4DNT B;  3TZU A;  3QIA A;  3VA7 A;  2K33 A;  4OO1 H;  4G7Z C;  1VCI A;  3QJY A;  1Y8P B;  3T53 B;  5BN3 A;  2AUJ D;  2NN6 H;  1Q12 A;  3HGB A;  1Y69 U;  3PV0 A;  2O5J C;  1ONL A;  2AUK A;  3FPP A;  1PMR A;  1HTP A;  4KN4 C;  1Q1E A;  2KCC A;  2L5T A;  2Q8I B;  1VF7 A;  1YNN C;  2A68 D;  3H94 A;  1CFM A;  2EJF C;  2V4D A;  2NN6 G;  2ZT9 C;  3NE5 B;  2R6G A;  3ND8 A;  3LWU A;  1Z6H A;  4H44 C;  3A8I E;  2DN8 A;  1DCZ A;  1A6X A;  1SMY C;  1TKW B;  3ND9 A;  1GHJ A;  4BA1 I;  1H9R A;  3M7N A;  1GJX A;  2QF7 A;  3PUV A;  4G7H C;  3VR2 A;  3BDO A;  4PV1 C;  2PNR C; 
#chains in the Genus database with same CATH topology
 1F2Y A;  2F0E A;  3N52 A;  2WKC A;  1J8I A;  3DXJ C;  2MGS A;  1STY A;  1EY9 A;  4LF9 Q;  4DR5 Q;  1CK1 A;  1PA6 A;  1F2L A;  2BE5 D;  3SEB A;  2K5H A;  3CU7 A;  4OO1 I;  1D1I A;  4A93 H;  2CW0 C;  5D3I B;  4DXG A;  4MZ9 A;  5IP9 G;  4DV7 L;  1ZYR D;  1IZ6 A;  1DYQ A;  3RZO H;  2X69 A;  4DR3 Q;  1I4R A;  2A1A A;  4K6L A;  3KF6 B;  4O0A A;  1QZH A;  2R7D A;  3D3R A;  3KLS X;  2EQS A;  5IGD A;  3TS0 A;  4A76 A;  2ZTD A;  1JOK A;  1FL0 A;  1W2B A;  1FGB D;  5DLQ E;  3KLS A;  1S5E D;  1X32 A;  2PCF B;  1H9J A;  2JA6 H;  4CDC C;  1AW7 A;  2X6L A;  3OWE B;  3J81 E;  5JEA H;  4IFD H;  3I55 A;  3C1F A;  2PMZ E;  5IYD G;  3Q0A A;  3I2Z A;  3KDF B;  4ID6 A;  2NVQ H;  1WTH A;  1OXV A;  2SOB A;  2HIX A;  4UP7 A;  2L0C A;  1UEB A;  4C3I H;  3MHB A;  2JA7 B;  3K7U C;  3FRP B;  1E7Z A;  1RTN A;  4QUF A;  4JW0 A;  2NVT H;  3TP5 A;  3S1M B;  1PYS B;  1I5F A;  4GKK L;  5BN5 A;  3GTO B;  3BVZ A;  1PH9 A;  2UXD L;  1EQV A;  2UUB Q;  3D0F A;  1CHP D;  4JI6 Q;  1HNX Q;  3BZC A;  3O13 A;  5NUC A;  4JVZ A;  4N9P A;  1F2Z A;  5JOB A;  4EVO A;  1H9K A;  3IAY A;  1E0B A;  4OEM B;  1E2W A;  1PHJ A;  1PRT D;  1B70 B;  5M3F H;  3W2D A;  4BXX G;  3PIP 3;  1DOK A;  4KN4 C;  1VQN A;  4CHT B;  2SNS A;  4A3G H;  1D1K A;  1NTG A;  1CKN A;  1U4M A;  2L11 A;  2NZ1 D;  1XTC D;  3PUV A;  1SNM A;  1HRJ A;  3I56 A;  3F2C A;  2PNR C;  3CC4 A;  1D6E C;  5J1Z A;  2L1B A;  2Z1C A;  4MHE A;  3ZYY X;  3OHX C;  2G9D A;  1BCP F;  2EVB A;  5K36 H;  3GTJ H;  1Y1W G;  1K0R A;  1EZ6 A;  1VDZ A;  1NY4 A;  2N8N A;  4NMZ A;  4FF3 A;  2HDL A;  1AN8 A;  5CV4 A;  1K8O A;  3F1Z A;  1PXU A;  3ER0 A;  4DR4 Q;  2EJG C;  3TDQ A;  4HAE A;  1SE8 A;  4PMC A;  1JT8 A;  2H1E A;  5I6W A;  1MHW C;  3HOV G;  2GVA A;  2Q2T A;  2NTT A;  1TWA B;  3IFD A;  5CYU A;  1EY5 A;  4LF5 L;  1PTO D;  4F8M A;  1PTO B;  2DY7 A;  1JOR A;  4FO2 A;  5IP7 G;  4KJO A;  1E1O A;  4H7B A;  4KHV A;  1YNX A;  3K7A H;  1VMP A;  4NPS A;  3A5U A;  3R2T A;  1HFG A;  5FLX E;  5JVG 3;  3CQZ H;  5IYC H;  3FVQ A;  4HIK A;  4YCW A;  1NBW A;  1K8A C;  2K03 A;  3BJU A;  4RCN A;  1KDA A;  1TU2 B;  1U0L A;  1Q8K A;  5E4W C;  2JSO A;  2Y0S B;  1HNZ L;  2OT2 A;  3WDN A;  3D4R A;  4XQQ A;  2N49 A;  1Z47 A;  3P20 A;  4F87 A;  2WP8 J;  1YHQ A;  1FJG L;  4ZQ3 A;  1CI3 M;  1N33 Q;  3K0X A;  5C4J H;  1YHA A;  1KXL A;  4A3B H;  4K6D A;  1SSO A;  1B7Y B;  4JI8 Q;  4JI4 Q;  2A68 C;  1TQO A;  1TWH H;  2VQE Q;  3S15 B;  4XTC S;  3J7A 5;  4DF7 A;  3OTO L;  5M9O A;  2DGY A;  4LUO A;  3S9W A;  2K6A A;  4KHZ A;  2ZXR A;  4I7Z C;  4ALP A;  2RHQ B;  2MHV A;  2NUC A;  4RH6 A;  1XJV A;  1JJG A;  1H9S A;  2D0P A;  2PQA A;  2E8G A;  2LS0 1;  4G7Z C;  2EXD A;  3NQT A;  1WCM G;  3S17 H;  3QOL A;  3S16 B;  4M1U B;  3I4N B;  2J7Z A;  1HZ9 A;  1SND A;  3LWE A;  1Q1E A;  4YCU A;  2CH4 W;  4C3H B;  3K80 C;  5CV8 A;  4OEL B;  1NSN S;  2LKV A;  4OWW B;  1DJR D;  4IO9 A;  4RGM A;  3DUZ A;  3S2D H;  5FK9 C;  3CCL A;  2VNU D;  2KHJ A;  1PH8 A;  2ALY B;  3K5L A;  4B3M Q;  1LTA D;  1J5E Q;  1AH9 A;  2WB1 G;  1B9N A;  3FEW X;  3VYT A;  1HH2 P;  4UAI A;  1VQ6 A;  2H5X A;  3V96 A;  5EQ0 A;  3K58 A;  3KK7 A;  3CCV A;  1C48 A;  5C0X G;  4DK3 C;  2MPM A;  4HJ8 A;  1WTW A;  1I4H A;  4JI5 L;  4O1N A;  2XIW A;  4DV0 L;  5JPM C;  4BY7 G;  2A73 B;  1KD1 C;  4RA8 A;  1F9P A;  2R7Z H;  2A6E C;  4IPG A;  2CKZ B;  5C4X H;  1K83 B;  1B8A A;  3HOU B;  1PYB A;  4C3J H;  1RTO A;  1GUN A;  4QUC A;  4WFN 3;  1EYD A;  4F88 A;  1F77 A;  2ZXO A;  5A2Q L;  3J81 j;  5IGG A;  2EY1 A;  2RDH A;  1GVP A;  2E2D C;  3G71 A;  2JP1 A;  1R9T H;  3CAM A;  4DR6 L;  3MFY A;  1FNW A;  3X3M A;  4WJ4 A;  1Y1V H;  5M5Y B;  4HJ5 A;  1ET6 A;  1R4Q B;  2I5L X;  4DNR B;  5EBD A;  3IL8 A;  3AB9 A;  3GTP H;  2FMM A;  2Q2I A;  4IUV A;  4LF8 L;  1F9S A;  4DFA A;  4RHS A;  4KHP Q;  1VQC A;  3RNU A;  2K32 A;  1VQ8 A;  3OW2 A;  1JMC A;  3BG3 A;  3PF5 A;  1E3P A;  4A3L G;  4B08 A;  4HN7 A;  3DHQ A;  3DWP A;  2H4O A;  2VY3 A;  2BH8 A;  1T9H A;  2K5N A;  3RR5 A;  4FF2 A;  1AZQ A;  1PDQ A;  1KIX A;  2UU9 Q;  4X6A H;  4PG3 A;  3V05 A;  4BA2 I;  4EQN A;  4BBR G;  1OXU A;  1DM0 B;  2VW9 A;  2K5D A;  5M5X H;  1KNA A;  1NE3 A;  3CW2 C;  2WFW A;  1EY4 A;  4UY8 C;  4PMB A;  3HOZ G;  4QMG A;  4LF6 Q;  3ICE A;  3PO2 H;  1ML0 D;  2B63 H;  1MBY A;  1STB A;  3DEP A;  3JAM c;  1XPO A;  1SYD A;  3X3N A;  1P8L A;  3W1G A;  3GTM H;  1E22 A;  1I4P A;  3D6W A;  1XMO Q;  1WTO A;  2NVX H;  4A3F G;  3CCM A;  1Q46 A;  1VQ7 A;  2DN8 A;  5FJ8 G;  2L12 A;  3HOX G;  4A3C G;  3J81 L;  2QF7 A;  3NEN A;  3ONA B;  4GN3 B;  1PZJ D;  4B9X A;  4JV5 Q;  1XNR Q;  4DR4 L;  3PGZ A;  3HP3 A;  4ULL A;  4JYA Q;  3S1N H;  3P1H A;  2VB2 X;  1GXD C;  5LMN Q;  3T4A C;  5JJZ A;  4L5R C;  3NBH A;  1TWG H;  3HKS A;  1XNQ L;  1EYG A;  4P2C B;  3ULJ A;  1KRS A;  3A74 A;  1FNU A;  4LFA L;  1HPC A;  4DR1 Q;  4A93 G;  1SYB A;  3PSI A;  2K75 A;  5L37 A;  1OTC A;  2E75 C;  1E1T A;  1D5M C;  2G9H D;  3M7G A;  3OSO A;  4OX9 L;  4IAL A;  3I8Z A;  2EYO A;  1HHV A;  3DMU A;  3A5Z B;  2F0T A;  3T16 A;  4POG A;  2WAQ E;  2YTV A;  3U50 C;  3T56 B;  3Q22 A;  3CCR A;  4DNI A;  5M3M B;  3PO3 G;  2IY5 B;  4DR7 L;  2KED A;  4NKL A;  4XYO A;  3M3Y H;  4RGT A;  4TRD A;  3CCU A;  1PH4 A;  1X9N A;  3GQB A;  4KD3 A;  1YZ6 A;  2JA6 G;  5KGU A;  1QVG A;  1KAW A;  5JEA G;  2OQ0 A;  4OIJ A;  5KND A;  3VA5 A;  3W5O A;  1D5Z C;  1ZKO A;  2Z9H A;  5F2D A;  5FO9 B;  2B39 A;  2C35 B;  1X3F A;  3MFG A;  2KCN A;  4LAA A;  3SDZ A;  5E1F A;  1LTL A;  4C3I G;  4OON A;  2EXZ A;  2A69 D;  5IGB A;  2UXB Q;  1TS4 A;  1A3T A;  4P75 A;  3B6Y A;  1KAB A;  2KCT A;  2R61 A;  3EIV A;  1LAB A;  5IOD A;  1WTV A;  1AFP A;  3AMU A;  1HJP A;  4IUU A;  1X56 A;  1S5F D;  1CM9 A;  3J81 i;  4X3S A;  1ET9 A;  2BA0 A;  2XSC A;  5C5M A;  3MEF A;  3P7J A;  5GAH C;  3L9A X;  4PZ6 A;  3S2H B;  4OO1 H;  3OMG A;  5D14 A;  4IJH A;  2F0P A;  3KYH C;  4LF4 Q;  1QVC A;  1CZW A;  4DAY B;  3MXN B;  5M3F G;  2F0H A;  5KIX A;  2Q2U A;  5I9O A;  4KY5 A;  4B3M L;  2M2L A;  1W6J A;  4P73 A;  1A6X A;  4DPG A;  1XTD A;  5FLX L;  5G3L F;  1GHJ A;  3ERO A;  5CV5 A;  4Q0F A;  5C4Z A;  3M7N A;  4GOP A;  1QNK A;  1STH A;  3RLO A;  1STN A;  3A7L A;  4R4Q A;  4BS9 A;  1HTL D;  1B9M A;  3E5S A;  2NWG A;  4N8X 1;  4J15 A;  1S5D D;  3BYT B;  4CBV A;  2GVB A;  1PLF A;  3QB3 A;  1WCM B;  4GOP C;  2GN5 A;  2NN6 I;  3A0J A;  5IIF A;  1BQQ T;  2F0W A;  4DK6 C;  4NXM L;  4FP5 D;  2X6G A;  1S5B D;  3DLL A;  1IXR A;  3HOW H;  2KEN A;  2EJM A;  3GTL H;  2P5Z X;  1LT3 D;  5LMN W;  1LYL A;  4ZYS A;  1B3Q A;  4NP5 A;  4X64 L;  1MJE A;  2BH2 A;  2DJG C;  4BBS G;  4B9W A;  3PMF A;  2F52 A;  1VQM A;  2F0J A;  1IYU A;  1YEZ A;  3M4O H;  2VS1 A;  1UE7 A;  4UPA A;  1LV9 A;  5IYC G;  4NB3 A;  4X65 L;  4QGU A;  1GUO A;  1B1Z A;  4BY7 B;  3C46 A;  1ZEQ X;  1JQY D;  2M9V A;  4PZ8 A;  4DR2 Q;  1ASZ A;  4A3K H;  1XX8 A;  2MO1 A;  1Q82 C;  2Z4I A;  2ZM6 L;  1JOO A;  4KKS A;  1VQI A;  3RLF A;  5C44 H;  2OEO A;  1PZI D;  5BN4 A;  2OTL A;  4A3B G;  1I6H H;  1ESF A;  3DM1 A;  4LF6 L;  4CJ0 B;  3EVQ A;  5M5W H;  5C3E G;  3D31 A;  1HA6 A;  1I94 L;  1OXT A;  1TWC H;  4GN5 A;  1UUP A;  3GO5 A;  2K33 A;  3I7F A;  4DKA C;  4X3T A;  1EEI D;  1SBB B;  2JQO A;  3Q23 A;  3H0G B;  5JVH 3;  1SYG A;  2JN4 A;  1CKN B;  4A3J H;  3PV0 A;  2TMP A;  1EU4 A;  1S72 A;  2L15 A;  4YWK A;  1LTB D;  3PIO A;  4UP8 A;  1ENC A;  4Y7N B;  3CC7 A;  3BZD B;  1EY6 A;  3NPP A;  3Q8D A;  4HMI A;  1YI2 A;  1IBK Q;  3K59 A;  1CT1 D;  5A2Q E;  4BBR B;  1O78 A;  1TWF B;  3MAQ A;  1CSP A;  1NJI C;  1VQP A;  3F2B A;  1WI5 A;  2WIN B;  3T1Y L;  1N32 Q;  3KJP A;  4A3M H;  1E2Z A;  2KA7 A;  4P71 A;  1EZ8 A;  3HOZ B;  2R92 B;  1QB5 D;  1WFQ A;  1GKH A;  2V1C C;  2QA4 A;  1EIH A;  1JE4 A;  4OL7 A;  4QIW B;  1WTR A;  2E76 C;  3PUW A;  4C56 C;  1OXS C;  1PRT F;  1SR3 A;  1HNW Q;  2RDG A;  1V1P B;  4KMU C;  1BNZ A;  4A3F B;  2E5L L;  1HZB A;  1II3 A;  3HOX B;  1SE2 A;  1A15 A;  4DUZ Q;  1HUN A;  4U67 3;  1IL2 A;  2F0L A;  4XXE A;  2JA8 H;  2R7Z G;  2IPK D;  1IYJ B;  3KFU A;  3I3C A;  3AYH B;  1K0S A;  1Z7T A;  2RQX A;  3T51 B;  2WAQ B;  1N34 Q;  2AQ1 B;  4C3J G;  1VS0 A;  2HQE A;  2C5C A;  4R4C A;  1L0W A;  1N36 Q;  3H3V I;  4DK0 A;  2D0O A;  2BCO A;  1B50 A;  2WAC A;  4JPB W;  3T1H Q;  4JK1 C;  4KKT A;  3TRE A;  5LMU L;  1I4G A;  1ENA A;  2PNH A;  1Y1V G;  4I7A A;  2K4K A;  1SNC A;  2PW7 A;  4CKB A;  2O2L D;  1L1O A;  1EUJ A;  4LK1 C;  2UXC Q;  1IBL L;  4GKJ Q;  1BUV T;  2HUG A;  1SMX A;  2IJ0 A;  1GM5 A;  3CCQ A;  3J80 E;  2YU9 H;  3I72 A;  5CV7 A;  3UE0 A;  1X3Q A;  1PTO F;  1ICW A;  5EAY A;  3PO3 B;  3H09 A;  3OOC A;  1H9S B;  1L1O C;  2SDF A;  3BDL A;  3NBI A;  2E2I H;  2CQA A;  1HCZ A;  2PQA B;  2F0O A;  1XMQ Q;  2HHH Q;  4IUT A;  1SFO H;  2K28 A;  2JA6 B;  2M00 A;  3R2I A;  3H15 A;  4JI3 Q;  1G2S A;  4H0L C;  1VQL A;  4DNT B;  1YJ9 A;  2E2H B;  2NVQ B;  1JB3 A;  4APV A;  1BVS A;  1KDB A;  2K52 A;  3KUP A;  3FPP A;  4DAV A;  2PI2 A;  2Q8I B;  2JA7 H;  1XWE A;  1YNN C;  3PO2 G;  3KJO A;  3TEH B;  2R6G A;  4OIK A;  3S1M H;  3U4Z A;  5IE8 A;  5HUR A;  2HCI A;  1EIY B;  3I4M H;  1RL2 A;  1IL8 A;  4G7H C;  4POF A;  1EQT A;  4JI2 L;  3MEH A;  5I9P A;  1HFN A;  4X66 Q;  1HQM C;  2F0F A;  2AHO B;  1XPU A;  4HSV A;  2QEJ C;  1AEX A;  4HID A;  4ABN A;  2EDG A;  3VYU A;  5C0X I;  3HKZ G;  1KL9 A;  5IWA L;  3U9S A;  3J7A V;  3W3A A;  1YNJ C;  1XPR A;  1L0Y B;  1G6P A;  1SAP A;  1QJO A;  2AWO A;  4AH6 A;  1LT6 D;  3HG9 A;  1WYD A;  4C2M B;  3R3O A;  4JI1 Q;  1CZG A;  4LFC L;  1RKN A;  4IPD A;  4Q5V A;  4KI0 A;  2E2J H;  3C1E A;  1D2B A;  1LT4 D;  3RZD B;  1V9P A;  4TKO B;  2K5V A;  2EZV A;  1G51 A;  4AIM A;  1EYA A;  5CV6 A;  3NEL A;  2Z0S A;  1UEA B;  4AQY Q;  3MA2 B;  4MTN A;  4HSP A;  1CSQ A;  2TSS A;  4B3S L;  3SK4 A;  4K0K Q;  3FKI H;  1TVX A;  4MIU A;  2K14 A;  2DNC A;  1WTP A;  5JJI A;  3E0J A;  1TWA H;  4BBS B;  4QB4 A;  4B3T L;  1VQE A;  4WJW A;  1PTO H;  5FLM H;  3K8A A;  4DV6 Q;  1SJH D;  2R7F A;  1VF5 C;  5DM7 3;  3WOF A;  3J81 c;  2KUM A;  2EYF A;  2K5Q A;  5DNF A;  3OIP A;  2VB3 X;  1G8Z D;  1JC7 A;  4X62 L;  3I4O A;  1VCI A;  5JJK A;  3F2D A;  5BN3 A;  3L2P A;  4LF7 Q;  3S1R B;  5AJ3 L;  3Q6S A;  5D65 A;  4LUZ A;  1MSG A;  2CWP A;  4FXD A;  1SMY C;  4RWS C;  5LHY 1;  4YY3 L;  4DV2 Q;  1GJX A;  1F9R A;  3NBH B;  5CV9 A;  2EPB A;  3G4S A;  5HGT A;  4JI0 L;  3S15 H;  1CUK A;  5C3E B;  2L55 A;  1HNW L;  5C6A A;  3I91 A;  1ESR A;  1IW7 D;  4G7O C;  2PO4 A;  2BE5 C;  2N78 A;  2ZTC A;  3CRK C;  1LTT D;  1ILQ A;  4IUN A;  1ZYR C;  4LF9 L;  4DR5 L;  3S1Q B;  4RAU C;  1N34 L;  1QG7 A;  1OO9 B;  1B4O A;  1WTQ A;  3I4N H;  3I70 A;  4C3H H;  4CDD C;  1IBM Q;  4V19 0;  5CC4 A;  2PW5 A;  1L0X B;  3STB D;  2RCF A;  3HOW G;  4DR3 L;  3S2D B;  4K5X A;  5EPL A;  4YCV A;  1UE6 A;  5ELB A;  1VQB A;  4CJ1 B;  2MJ8 A;  3FDT A;  2VUM B;  3K57 A;  2EYM A;  3CP0 A;  5IT9 E;  1BCP B;  5IYB H;  1F2M A;  3PUZ A;  4CDE C;  3GV3 A;  2EOT A;  3NWS A;  3C2P A;  3EBE A;  1DOL A;  1R4P B;  4DK1 A;  4DV3 Q;  3A8K E;  2WII B;  3CPW A;  1SRO A;  1O7Y A;  3S14 H;  2R7Z B;  1C9O A;  2WB1 E;  2VQF Q;  2KBN A;  1K83 H;  5EJW A;  3HOU H;  4A3K G;  2EYL A;  3M85 A;  5EBC A;  5IGE A;  2PYK A;  3F8T A;  2IL8 A;  3SR1 A;  3CCS A;  1QIL A;  3U9O A;  4HR7 B;  4IOA A;  1Y14 B;  5I2Y A;  5C44 G;  1Y1V B;  3SE0 A;  1J6Q A;  2UUB L;  1PRT C;  4YHH Q;  3A56 A;  1BOS A;  3PF4 A;  1RIP A;  1PFB A;  3QJY A;  1Y8P B;  4UHV A;  5IP9 H;  2KEE A;  2NN6 H;  2NZH A;  1HNX L;  4JI6 L;  4JI7 Q;  2K01 A;  2HT1 A;  3DWA A;  4GOP B;  2KCC A;  2F4V Q;  4A3I G;  2SNM A;  4K2L A;  4A3J G;  3LWU A;  2RHS B;  4LFB Q;  3K81 C;  2XRS D;  5J3B A;  1ZXT A;  4DV4 Q;  1JB7 A;  3NHH A;  4L8J A;  4KV6 A;  3A54 A;  4DV5 Q;  4TVA B;  3CMA A;  2A6H D;  2G5D A;  1K3R A;  1YVC A;  1VQ5 A;  3TME A;  1GHK A;  2B8G A;  5M5X B;  1PFN A;  4LNQ A;  3VYR A;  4ZKC B;  5BR8 Q;  3H6M A;  3RUZ A;  5C3X A;  3J80 L;  2F0K A;  3TZD A;  4NXN Q;  1QOH A;  3HZX A;  4KTA A;  5HY6 A;  2CWA A;  1PTO C;  4DAP A;  1Z9F A;  4HJ9 A;  3M9B A;  1S3O A;  2NVX B;  4GNX B;  5CBA E;  1LLR D;  1Q90 A;  4R8I A;  4IUR A;  1NUC A;  3ITP A;  2I5H A;  3K5M A;  1DON A;  4DN4 M;  2K7V A;  2JA8 G;  4QIW E;  2N88 A;  1KNE A;  3HKZ B;  3I4L A;  1KQS A;  1BBX C;  1TS5 A;  4KKU A;  3KF8 A;  1A2U A;  2ZTE A;  2NTS A;  1PV4 A;  5CGK A;  4PQX A;  5FO7 B;  4GLX A;  1VQA A;  3GTG B;  2QEX A;  3FMC A;  4L5T A;  1H95 A;  5J22 A;  3CCJ A;  1KRT A;  1I4X A;  3K6O A;  4XQJ A;  1K9M C;  4R4O A;  3W1B A;  2UUA Q;  1A3V A;  4J1M A;  3GTQ H;  1Y1W B;  2F0D A;  4HMJ A;  1NR2 A;  3A55 A;  4EQP A;  1JIC A;  2F03 A;  2OXP A;  4JBW A;  4ZUJ A;  1EIG A;  3BZK A;  3SXH A;  1N33 L;  4IFD G;  1YJN A;  1WD1 A;  4ZRZ A;  1UE5 A;  5M3M H;  2B2Y A;  5FKA C;  5C0X J;  3BS1 A;  3HOV B;  3G6J B;  4JI8 L;  4DU9 A;  3M3Y B;  4JI4 L;  2RVL A;  3PUY A;  3TS2 A;  1HR0 Q;  1I50 B;  2VQE L;  5C3W A;  2Z6K A;  4A4I A;  4L5S A;  1RJT A;  3HGB A;  2ZJR A;  4DV1 Q;  1PMR A;  2K04 A;  1VF7 A;  2B2Y C;  2V4D A;  2ZT9 C;  3GV6 A;  5LL6 S;  1BR9 A;  1MI2 A;  5JPN C;  5ISR A;  1K28 A;  2JA7 G;  1EOT A;  4BA1 I;  2Z6K C;  5IP7 H;  3VDY A;  3M4P A;  1U5K A;  1L2F A;  2K50 A;  1HA5 A;  1E2V A;  5GAE C;  1X54 A;  3I4M G;  1KTK A;  1J9O A;  2HQL A;  3HEJ A;  4ZUI A;  1TS3 A;  3U58 A;  2FHT A;  4HED A;  1SNQ A;  2JJQ A;  2CW0 D;  3MTS A;  2JA5 H;  3S2H H;  1MKH A;  1J5E L;  4WRD A;  1PH3 A;  4WJ3 M;  1NCV A;  2PZT A;  3IKJ A;  3PQI A;  2JEA I;  4ZAI A;  2QW7 A;  2I07 B;  3ERQ A;  2MP1 A;  4DA2 A;  1TY2 A;  2QIL A;  4BY1 H;  2IX3 A;  5T1I A;  4XQN A;  3EJI A;  1EL0 A;  4A3G G;  3J7Z C;  2O5I C;  5KRU A;  1AP0 A;  1A8V A;  3PCO B;  4FXK C;  1ENF A;  1CTM A;  3VR3 A;  4S3S A;  3PIO 3;  2VXW A;  5K36 G;  3MXG A;  2AKW B;  1FR3 A;  4QQB X;  4FDB A;  2N55 A;  4DGZ A;  3CF5 A;  3L0O A;  2IHF A;  4GKK Q;  1PH6 A;  1ASY A;  1RCV D;  3RLN A;  2A8V A;  3MC0 B;  2UUC Q;  2UXD Q;  4YWM A;  2CHB D;  3QOJ A;  2NVY B;  2AWN A;  1D8L A;  3FKI G;  4KHP L;  5GQO A;  1FVI A;  1V43 A;  3SK5 A;  1NAP A;  2WB1 B;  2FXQ A;  3DWQ A;  1TR5 A;  1VQD A;  4Z9C B;  5IY0 A;  3CRL C;  1TT2 A;  4ZCK A;  4HJ7 A;  1GD7 A;  3NSW A;  3GTK B;  4NDX A;  1I6V C;  3NXW A;  1EFW A;  4OWT B;  3OW7 A;  1QZG A;  3HOY H;  3URY A;  3M4O B;  2FMC A;  1G6Z A;  2UU9 L;  4ODG A;  2IX1 A;  3TRZ A;  2MUY A;  2I5M X;  3QIA A;  1LM0 A;  2PZU A;  1STG A;  4X3K A;  2NZO A;  1V1Q A;  1VQ9 A;  1SNO A;  2Y0S G;  1A0I A;  3ND8 A;  2RCN A;  1PH7 A;  1GOZ A;  4A3K B;  5EGT A;  1TKW B;  5JAV A;  1NMG A;  3E0E A;  4GLA C;  1WTX A;  2DJF C;  1HR0 W;  5IT9 L;  1M1K C;  4XIG S;  1MD2 D;  3I73 A;  2EIF A;  4ZKB B;  1XMO L;  4JBJ A;  3UI2 A;  4AYB G;  5CBE E;  5JEA J;  5COR A;  2YTY A;  2LY7 A;  5T1G A;  4LF5 Q;  4JV5 L;  4YIJ A;  1XNR L;  1FD7 D;  1HXY D;  4JYA L;  2F0S A;  3H0G H;  4KLK A;  4A3I B;  1Q81 C;  3CME A;  5LMN L;  4A3J B;  5TSS A;  4IPH A;  1BXT A;  1HZC A;  1PH5 A;  4GZY C;  4HJA A;  2LFN A;  3AFQ A;  3I4N G;  4IOC A;  1HNZ Q;  1MSH A;  4C3H G;  4DR1 L;  2L4N A;  1VQO A;  4QL5 A;  1B2T A;  1TWF H;  2PPB C;  5C4H A;  2HD3 A;  2VZA A;  1GUS A;  2EY6 A;  1FJG Q;  1LTI D;  3H91 A;  5KEE A;  4FNF A;  5D3D A;  1LO5 D;  3UDX A;  1DGS A;  4A3E H;  1SDF A;  2R92 H;  1I4Q A;  4A3D H;  1VQH A;  1W3S A;  4QCL A;  2A5H A;  4GLV B;  1QUQ A;  5IYB G;  1IKM A;  1A63 A;  4K8I A;  3OTO Q;  2R93 H;  2HCC A;  4B3R Q;  1I3Q B;  2EYH A;  2A69 C;  1AZP A;  5C4X G;  3F2U A;  1DZ1 A;  3NTK A;  4A3C H;  1C8C A;  1D5X C;  1IYV A;  1PH1 A;  2F0G A;  2JA8 B;  3CCE A;  3AQQ A;  4JG2 A;  3MXN A;  4K5W A;  3HOU G;  2K1B A;  3D4W A;  2UXB L;  3D4D A;  4A93 B;  2Q8R E;  1VQF A;  1FYC A;  4R1J A;  2EYJ A;  2CFM A;  3TZU A;  1A2T A;  2IHE A;  3RZO B;  1Q12 A;  2CCZ A;  1Y69 U;  3CPF A;  3Q24 A;  2B29 A;  2A19 A;  1NMF A;  1ROD A;  4R9W A;  3BDC A;  1SYC A;  2F3I A;  4JBM A;  2NN6 G;  3QR8 A;  1RF2 D;  1TY0 A;  4K5V A;  5I2X A;  3LX0 A;  5ELN A;  2QCP X;  4HIO A;  2YU9 B;  4LF4 L;  3GP7 A;  2QDL A;  1DXM A;  2B2W A;  3VR5 A;  5FOB B;  1PH2 A;  3PO3 H;  4JI5 Q;  4DV0 Q;  1EEF D;  4RG1 A;  2E2I B;  5HGQ A;  2PZW A;  1SFO B;  3BU2 A;  1Q3L A;  4C3I B;  1PFM A;  2J0T D;  3MVV A;  1G2T A;  2LXK A;  1P16 A;  4LJZ C;  2ICI A;  2B2W C;  2ZJP A;  2E2H H;  1QE6 A;  2B63 G;  2NVT B;  3EFX D;  4C1N I;  3GTO H;  2A6E D;  5E3F A;  4DR6 Q;  3C3L A;  3A7A B;  1JCK B;  4K8J A;  3JC6 6;  1TXY A;  1DOM A;  1K8M A;  1RHP A;  3I4M B;  4LF8 Q;  4JCV E;  1U9R A;  2UUC L;  1ICF B;  2D2C C;  2B2U A;  3WOE A;  4U68 A;  1EIF A;  1O7L A;  2LMC B;  2I0Q A;  5M3F B;  2SEB D;  2N3S A;  2D5D A;  4LMQ D;  3R8B A;  4JC0 A;  4IN3 A;  1EY0 A;  2L9H A;  4RGN A;  1YIJ A;  4IPC A;  1PRT B;  2B2U C;  4RKL A;  1K3B C;  4KY6 A;  4A3G B;  3K5O A;  5EPK A;  4C2M H;  3KBX A;  3KLW A;  3G48 A;  4F7X A;  3U4V A;  2E2J B;  3HKZ E;  4G57 A;  4O42 A;  3EA6 A;  3GTJ B;  4DR2 L;  1X55 A;  2E74 C;  3RZD H;  1C0A A;  3TQY A;  2I46 A;  2VL6 A;  2EYP A;  2F0Q A;  1LTR D;  2MQH A;  3CHB D;  3NWT A;  1PVO A;  5LL6 X;  5I4D A;  4RGO S;  3KLR A;  4TQU S;  2F0U A;  3BVM A;  5M3M G;  1VQG A;  2XN9 C;  2AUK A;  1XXG A;  1BKB A;  1T5X D;  3FKI B;  3NQI A;  4IUP A;  1WVL A;  1RD9 D;  2FFK B;  1U4L A;  3NE5 B;  1SJE D;  4H44 C;  1N9W A;  4N8F A;  3J80 c;  3K7A B;  1H9R A;  1U4P A;  2LXJ A;  2IX0 A;  1MGS A;  1XNQ Q;  2OCE A;  3L7Z C;  4BBS H;  4PV1 C;  3CQZ B;  4BWG B;  1Q86 C;  5DEH A;  1EWC A;  1K8G A;  1V1P A;  4OWX B;  4LFA Q;  2XWB B;  2MFI A;  1IBK L;  4DAM A;  2KEC A;  1X65 A;  2RKS A;  4OX9 Q;  4OO1 G;  2F4I A;  4CKC A;  1B53 A;  3M4Y A;  4M8A A;  4GS3 A;  4ZK9 B;  2RSO A;  4EQO A;  4H13 C;  1N32 L;  5C4J B;  3S1R H;  1JE5 A;  2CQO A;  3E9I A;  4A3B B;  1EFI D;  2BOS A;  1EQQ A;  2JA5 G;  4DR7 Q;  3A8J E;  4E6I A;  1STE A;  3NTI A;  1HZA A;  1TWH B;  4L63 B;  1SRU A;  2ICE C;  5I6Y A;  5E4X A;  3KF6 A;  4HCE A;  4BY1 G;  1GUT A;  2F3V A;  1Y8N B;  3KF8 B;  3TP7 A;  3UDI A;  3KBG A;  3ULL A;  1LUZ A;  2KJX A;  4AYB B;  1K73 C;  3PIP A;  3EQL C;  3SGI A;  4DUZ L;  4RMF A;  2F3W A;  3HRZ C;  1YHB A;  4XDX A;  5C3E H;  5E7N A;  2ZJQ A;  3ULP A;  4B3R L;  3S17 B;  4FVM A;  2D62 A;  1LAC A;  3S16 H;  1SYF A;  3EN2 A;  5DM6 3;  5ELO A;  1N8R C;  1N36 L;  3M4Q A;  3JAM E;  2KVM A;  3KDF A;  1Y8O B;  1G29 1;  3S1Q H;  2JE6 I;  3T1H L;  1CA6 A;  3ERS X;  2IW3 A;  4PNY A;  4QF4 A;  4QY7 A;  2XTI A;  4CJ2 C;  4L5Q A;  1BCP D;  2JA9 A;  1HQR D;  2UXC L;  2NYZ D;  1GO3 E;  4EX5 A;  3IFT A;  4IFD I;  4GKJ L;  3QG1 A;  1EOV A;  3PUX A;  5H1S E;  2PQE A;  4GN4 B;  4R4T A;  1E24 A;  2IWH A;  2RF4 A;  4PZ7 A;  2VUM H;  1UE1 A;  3VA7 A;  4Y52 H;  1GUW A;  2KHI A;  3NEM A;  2F0M A;  5KYL A;  1S40 A;  3HOY G;  3RMH A;  4FF4 A;  2J4X A;  3G7L A;  1XMQ L;  1BF4 A;  2HHH L;  2O5J C;  1EY7 A;  3CD6 A;  2MO0 A;  5C4X B;  1MJC A;  4JI3 L;  1CFM A;  4C3J B;  1UAP A;  3FP9 A;  1JWM D;  5COY A;  2A74 C;  4YWL A;  3S14 B;  2ASB A;  3ND9 A;  5FLX c;  1CQF A;  3MXP A;  3VR2 A;  1QWY A;  3BDO A;  1R9T B;  5EPJ A;  1AE3 A;  3HFZ B;  1BO0 A;  2PI2 E;  5M5Y H;  4LW1 A;  1BBU A;  1KLU D;  2DNE A;  4HTH A;  2ENB A;  3TN2 A;  4NXM Q;  1WOC A;  1CHQ D;  2B3G A;  3GTP B;  1OXX K;  2EE1 A;  5EKK A;  4P72 A;  2PMZ B;  2YTX A;  2QKI C;  4X64 Q;  1B3A A;  3HS0 C;  4X66 L;  1EYC A;  5EKL A;  1IHZ A;  1Q8I A;  1EWH A;  1A62 A;  3BYY B;  5KYI A;  1FGU A;  4FXG C;  5KNB A;  4R4I A;  3H0G G;  1S5C D;  3K5N A;  4J6H A;  4X65 Q;  1T5E A;  1EY8 A;  2XVS A;  5IYD H;  4A75 A;  3D6C A;  3V2T A;  2O4X A;  3D8G A;  1SNP A;  4JI1 L;  4P74 A;  3RN5 A;  1VQK A;  2WKD A;  4A3M G;  2K05 A;  1KAA A;  1LTG D;  1UNS A;  4K14 A;  2JYO A;  4RCO A;  4CKE A;  3PO2 B;  1SLJ A;  3E9H A;  2ZM6 Q;  3K0Y A;  2B63 B;  3OWF A;  1HUM A;  5A35 A;  2BDO A;  3N6R A;  3DM3 A;  2JEB I;  3AEV A;  4A3E G;  3GTM B;  2R92 G;  4A3D G;  3IRB A;  4JOI A;  2F1M A;  4AQY L;  4X3U A;  2HIV A;  2F0N A;  3NUC A;  4KN7 C;  2R93 G;  1ILP A;  1I94 Q;  4K0K L;  2AQ2 B;  3S1N B;  4KJN A;  4K2K A;  1SYE A;  4L6T B;  2ATW A;  4JOI C;  1TWG B;  1A3U A;  2XWJ B;  4RFB A;  1W6K A;  2FJ2 A;  5DAU A;  4BXX H;  1KHI A;  1U4R A;  5IT9 c;  4DUY Q;  5IGF A;  4EQ5 A;  2KQ3 A;  4MNO A;  2WAQ G;  4DV6 L;  2YV5 A;  4IJL A;  2ES2 A;  1VQ4 A;  1STA A;  3T53 B;  4XYQ A;  4LUV A;  2OF1 A;  1F9Q A;  5ELC A;  1SXT A;  3GTG H;  2L5T A;  3CC2 A;  3SHL A;  4ME3 A;  3RN2 A;  4FYD A;  2RSN A;  1DCZ A;  3T1Y Q;  1O80 A;  1X6O A;  4LF7 L;  3GTQ B;  5K5P A;  1Y1W H;  5CR3 A;  1JWS D;  4I65 A;  1JJC B;  4NW2 A;  4N9T A;  2MNA A;  4CDF C;  4IUQ A;  4IQZ A;  3LGJ A;  4ZLT F;  4HIM A;  2CH4 A;  2ID0 A;  3BVG A;  2E5L Q;  1IW7 C;  4DV2 L;  4KK7 A;  3UDF A;  2BDN A;  3E3X A;  3HOV H;  1RDP D;  1H9M A;  3S24 A;  1I50 H;  2XGT A;  3NP8 A;  4UP9 A;  1JJ2 A;  2RBM A;  3KOJ A;  1CKO A;  1WD0 A;  3J80 i;  1CA5 A;  1JWU D;  2BA1 A;  4TSS A;  3TSS A;  1TS2 A;  2R3Z A;  4UDU C;  4DV7 Q;  1O7I A;  2OTJ A;  1B44 D;  3STB C;  1V1O A;  5LMU Q;  3H3V H;  3LNN A;  2QDB A;  1V8Q A;  2JXM B;  3UDG A;  2CVR A;  1SE4 A;  1EU3 A;  1QUQ B;  3ZJY C;  1IBM L;  1BCP C;  1XYI A;  1IBL Q;  1Q1B A;  3P75 A;  1Q7Y C;  3GD7 A;  3G6E A;  1DD2 A;  1C4Q A;  3NTH A;  1YJW A;  2LSS A;  5C5L A;  1BBW A;  4R8N A;  5GAG C;  2JA5 B;  1PZK D;  1WJJ A;  1QVF A;  1NNX A;  5GRO A;  2AQ3 B;  4CGY B;  3E6Z X;  4BY1 B;  3SK6 A;  1X3G A;  3MZ5 A;  3I90 A;  2Z6B A;  4DV3 L;  4J8Q A;  2XNA C;  1L1O B;  3J7A F;  2B2V A;  3DEO A;  1JR0 D;  1UWV A;  1VMC A;  2KHS A;  5ELD A;  1EWI A;  4O2D A;  4LWC A;  5J39 A;  2EY5 A;  2VQF L;  1WCM H;  3T13 A;  5ELF A;  4XT3 B;  2C9O A;  3VR4 A;  4QJF A;  1KLG D;  2B2T A;  3CXC A;  2Z8L A;  5EKI A;  4FF1 A;  1PFS A;  2HDM A;  1QCB D;  3OYY A;  2B2V C;  4KD4 A;  1LT5 D;  4JI2 Q;  1HTP A;  3L3O C;  3HOW B;  4PMW A;  1YNN D;  3H94 A;  2NVY H;  3AU7 A;  2EJF C;  3GTL B;  5JJL A;  2RA4 A;  4V0B A;  4YHH L;  4C1N K;  2B2T C;  1CKM A;  3QWN A;  4DXF A;  5IOC A;  4JI7 L;  2F0I A;  1MIU A;  3NK9 A;  1VQJ A;  5IWA Q;  5FLM G;  3TBI B;  5ELE A;  2F4V L;  1D7Q A;  2B8F A;  2A6H C;  1YIT A;  5C0X H;  3SVM A;  1S4Z A;  3GTK H;  4LFB L;  3HOY B;  3OMC A;  4BY7 H;  4LFC Q;  4DV4 L;  3JAM L;  3VR6 A;  4GNX A;  4H02 A;  1PYW D;  2AMC B;  5KNC A;  1YNJ D;  4DV5 L;  4XT1 B;  2F0V A;  1O7Z A;  3MWY W;  2KCM A;  1BDO A;  3GDE A;  3TP6 A;  4MTK A;  4ILW A;  3AFP A;  1LTS D;  5FO8 B;  2DUD A;  1CQV A;  1TII D;  3R93 A;  3OIQ A;  3SK8 A;  5C44 B;  3CKI B;  4GNX C;  1G91 A;  5BR8 L;  1I6H B;  5AFW A;  2ZXP A;  4EGV A;  4IFD J;  2OQK A;  4B3S Q;  4NXN L;  2RDF A;  5M5W B;  4MN3 A;  2XRQ D;  1X3E A;  3MXU A;  1TWC B;  4OGQ C;  4OXP A;  4ME5 A;  2Y0S E;  1FNV A;  3OPO A;  2DY8 A;  2IT1 A;  4A3L H;  4RKB A;  4B3T Q;  3UE1 A;  1GUG A;  4JBK A;  1X3P A;  2GA4 B;  1NR4 A;  4G4K A;  1JOQ A;  2EY2 A;  1SEB D;  3VYS A;  4Y7N H;  4A3I H;  2OWO A;  3TP8 A;  3RD4 A;  2YYZ A;  5G3L D;  4RHR A;  4AYB E;  5CMD A;  4DUY L;  3WWV A;  4BBR H;  5GAD C;  1KDC A;  2Z4H A;  1M90 C;  4X62 Q;  1SN8 A;  2NB0 A;  2JK8 A;  2KOL A;  4A3M B;  1IKL A;  4KY7 A;  5AJ3 Q;  2UUA L;  3HOZ H;  1M8A A;  1M4V A;  3J7Y W;  3QO2 A;  1AE2 A;  4A3E B;  2FIN B;  1KC8 C;  4YY3 Q;  2VUM G;  4A3D B;  2AUJ D;  4A3F H;  4OHJ A;  1ONL A;  5FJ8 H;  1C7Y A;  5IGC A;  2Q8T A;  3JAM i;  3HOX H;  1YBY A;  2A68 D;  4JI0 Q;  3FPU B;  4WOR A;  2NBF A;  1HR0 L;  2R93 B;  1Z6H A;  4HCS A;  2Q2H A;  3A8I E;  3FHW A;  4IZ8 A;  1SMY D;  1I3Q H;  2WV6 D;  2QGQ A;  1QNU A;  1EQR A;  3H3V C;  2K5W A;  4DAY A;  2D9U A;  4DV1 L;  1SE3 A; 
#chains in the Genus database with same CATH homology
 1F2Y A;  2F0E A;  3N52 A;  2WKC A;  1J8I A;  3DXJ C;  2MGS A;  1STY A;  1EY9 A;  1CK1 A;  1F2L A;  2BE5 D;  3SEB A;  3CU7 A;  4OO1 I;  1D1I A;  2CW0 C;  5D3I B;  4DXG A;  1ZYR D;  1DYQ A;  2X69 A;  1I4R A;  4K6L A;  3D3R A;  3KLS X;  5IGD A;  1JOK A;  1FGB D;  3KLS A;  1S5E D;  1X32 A;  2PCF B;  1H9J A;  3J81 E;  1AW7 A;  2X6L A;  3OWE B;  4IFD H;  5JEA H;  3C1F A;  3Q0A A;  4ID6 A;  1OXV A;  2SOB A;  2L0C A;  3MHB A;  2JA7 B;  3FRP B;  1RTN A;  4QUF A;  3S1M B;  3TP5 A;  5BN5 A;  3GTO B;  3BVZ A;  1EQV A;  1CHP D;  3O13 A;  5NUC A;  4N9P A;  5JOB A;  1F2Z A;  4EVO A;  1H9K A;  3IAY A;  1E0B A;  1E2W A;  1PRT D;  3W2D A;  3PIP 3;  1DOK A;  4KN4 C;  4CHT B;  2SNS A;  1D1K A;  1U4M A;  2L11 A;  2NZ1 D;  1XTC D;  3PUV A;  1SNM A;  1HRJ A;  2PNR C;  1D6E C;  5J1Z A;  2L1B A;  2Z1C A;  4MHE A;  3ZYY X;  3OHX C;  2G9D A;  1BCP F;  2EVB A;  5K36 H;  1EZ6 A;  1VDZ A;  4NMZ A;  4FF3 A;  2HDL A;  1AN8 A;  5CV4 A;  1K8O A;  1PXU A;  2EJG C;  3TDQ A;  4HAE A;  4PMC A;  2H1E A;  5I6W A;  2NTT A;  1TWA B;  3IFD A;  5CYU A;  1EY5 A;  1PTO D;  4F8M A;  1PTO B;  2DY7 A;  1JOR A;  4FO2 A;  4KJO A;  4H7B A;  4KHV A;  1VMP A;  3R2T A;  1HFG A;  5FLX E;  5JVG 3;  3FVQ A;  2K03 A;  4RCN A;  1KDA A;  1TU2 B;  5E4W C;  2JSO A;  2Y0S B;  2OT2 A;  3WDN A;  3D4R A;  4XQQ A;  1Z47 A;  3P20 A;  4F87 A;  2WP8 J;  4ZQ3 A;  1CI3 M;  4K6D A;  1SSO A;  2A68 C;  1TQO A;  3S15 B;  4XTC S;  4DF7 A;  5M9O A;  3S9W A;  2K6A A;  4KHZ A;  2ZXR A;  4I7Z C;  2MHV A;  2NUC A;  4RH6 A;  1H9S A;  2LS0 1;  4G7Z C;  3NQT A;  3QOL A;  3S16 B;  4M1U B;  3I4N B;  2J7Z A;  1SND A;  3LWE A;  1Q1E A;  4C3H B;  5CV8 A;  1NSN S;  2LKV A;  1DJR D;  4RGM A;  3DUZ A;  5FK9 C;  2VNU D;  3K5L A;  1LTA D;  1B9N A;  3FEW X;  3VYT A;  4UAI A;  3V96 A;  3K58 A;  5EQ0 A;  3KK7 A;  1C48 A;  5C0X G;  2MPM A;  1WTW A;  1I4H A;  4O1N A;  2XIW A;  5JPM C;  2A73 B;  4RA8 A;  1F9P A;  2A6E C;  1K83 B;  3HOU B;  4WFN 3;  1RTO A;  1GUN A;  4QUC A;  1EYD A;  4F88 A;  1F77 A;  2ZXO A;  5A2Q L;  5IGG A;  2EY1 A;  2RDH A;  2E2D C;  2JP1 A;  3MFY A;  1FNW A;  3X3M A;  5M5Y B;  1ET6 A;  1R4Q B;  4DNR B;  5EBD A;  3IL8 A;  3AB9 A;  2FMM A;  4IUV A;  1F9S A;  4DFA A;  4RHS A;  2K32 A;  3BG3 A;  4B08 A;  4HN7 A;  3DHQ A;  3DWP A;  2H4O A;  4FF2 A;  1AZQ A;  1PDQ A;  3V05 A;  4BA2 I;  4EQN A;  1OXU A;  1DM0 B;  2K5D A;  1KNA A;  1EY4 A;  4PMB A;  4QMG A;  1ML0 D;  1MBY A;  1STB A;  3DEP A;  1SYD A;  3X3N A;  1I4P A;  3D6W A;  1WTO A;  2DN8 A;  2L12 A;  3J81 L;  2QF7 A;  3ONA B;  1PZJ D;  4B9X A;  3HP3 A;  4ULL A;  3P1H A;  2VB2 X;  1GXD C;  3T4A C;  5JJZ A;  3NBH A;  4P2C B;  1FNU A;  1HPC A;  1SYB A;  2E75 C;  1D5M C;  2G9H D;  3M7G A;  3OSO A;  4IAL A;  3I8Z A;  2EYO A;  1HHV A;  3DMU A;  3T16 A;  2F0T A;  3T56 B;  3Q22 A;  5M3M B;  2KED A;  4NKL A;  4XYO A;  4RGT A;  4TRD A;  3GQB A;  4KD3 A;  5KGU A;  5JEA G;  4OIJ A;  5KND A;  3VA5 A;  1D5Z C;  1ZKO A;  5F2D A;  5FO9 B;  2B39 A;  3MFG A;  2KCN A;  4LAA A;  3SDZ A;  5E1F A;  4C3I G;  2EXZ A;  2A69 D;  5IGB A;  1TS4 A;  1A3T A;  1KAB A;  2R61 A;  1LAB A;  5IOD A;  1WTV A;  1AFP A;  3AMU A;  4IUU A;  1S5F D;  1CM9 A;  4X3S A;  1ET9 A;  2BA0 A;  2XSC A;  5C5M A;  3P7J A;  3L9A X;  3S2H B;  4OO1 H;  3OMG A;  5D14 A;  2F0P A;  1CZW A;  2F0H A;  5KIX A;  5I9O A;  4KY5 A;  2M2L A;  1W6J A;  1A6X A;  5FLX L;  5G3L F;  1GHJ A;  3ERO A;  5CV5 A;  4Q0F A;  5C4Z A;  3M7N A;  1QNK A;  1STH A;  1STN A;  3A7L A;  4BS9 A;  1HTL D;  1B9M A;  3E5S A;  2NWG A;  1S5D D;  3BYT B;  4CBV A;  1PLF A;  3QB3 A;  1WCM B;  2NN6 I;  5IIF A;  1BQQ T;  2F0W A;  4FP5 D;  2X6G A;  1S5B D;  2EJM A;  1LT3 D;  4ZYS A;  4NP5 A;  4B9W A;  3PMF A;  2F0J A;  1IYU A;  1LV9 A;  1GUO A;  1B1Z A;  4BY7 B;  3C46 A;  1ZEQ X;  1JQY D;  2M9V A;  1XX8 A;  2Z4I A;  1JOO A;  4KKS A;  3RLF A;  2OEO A;  1PZI D;  5BN4 A;  1ESF A;  3DM1 A;  4CJ0 B;  3EVQ A;  3D31 A;  1HA6 A;  1OXT A;  1UUP A;  3GO5 A;  2K33 A;  4X3T A;  1EEI D;  1SBB B;  3Q23 A;  5JVH 3;  3H0G B;  1SYG A;  3PV0 A;  2TMP A;  1EU4 A;  1LTB D;  1ENC A;  4Y7N B;  3BZD B;  1EY6 A;  3NPP A;  4HMI A;  3K59 A;  1CT1 D;  5A2Q E;  4BBR B;  1O78 A;  1TWF B;  3MAQ A;  2WIN B;  1E2Z A;  2KA7 A;  1EZ8 A;  3HOZ B;  2R92 B;  1QB5 D;  1EIH A;  1JE4 A;  4OL7 A;  4QIW B;  1WTR A;  2E76 C;  3PUW A;  4C56 C;  1OXS C;  1PRT F;  2RDG A;  1V1P B;  4KMU C;  1BNZ A;  4A3F B;  1II3 A;  3HOX B;  1SE2 A;  1A15 A;  1HUN A;  4U67 3;  2F0L A;  4XXE A;  2IPK D;  3I3C A;  1Z7T A;  2RQX A;  3T51 B;  2WAQ B;  2AQ1 B;  4C3J G;  2HQE A;  2C5C A;  4DK0 A;  2BCO A;  1B50 A;  2WAC A;  4JK1 C;  4KKT A;  1I4G A;  1ENA A;  1SNC A;  2PW7 A;  4CKB A;  2O2L D;  4LK1 C;  1BUV T;  2HUG A;  2IJ0 A;  3J80 E;  3I72 A;  5CV7 A;  1X3Q A;  1PTO F;  1ICW A;  3PO3 B;  3H09 A;  3OOC A;  1H9S B;  2SDF A;  3BDL A;  3NBI A;  2CQA A;  1HCZ A;  2F0O A;  4IUT A;  2JA6 B;  2K28 A;  2M00 A;  3R2I A;  1G2S A;  4H0L C;  4DNT B;  2E2H B;  2NVQ B;  1JB3 A;  1KDB A;  3KUP A;  3FPP A;  4DAV A;  2Q8I B;  1XWE A;  1YNN C;  2R6G A;  4OIK A;  5HUR A;  2HCI A;  1IL8 A;  4G7H C;  1EQT A;  3MEH A;  5I9P A;  1HFN A;  1HQM C;  2F0F A;  4HSV A;  2QEJ C;  1AEX A;  4ABN A;  2EDG A;  3VYU A;  5C0X I;  3U9S A;  3J7A V;  3W3A A;  1YNJ C;  1L0Y B;  1SAP A;  1QJO A;  2AWO A;  1LT6 D;  3HG9 A;  4C2M B;  3R3O A;  1CZG A;  1RKN A;  4Q5V A;  4KI0 A;  3C1E A;  1D2B A;  1LT4 D;  3RZD B;  4TKO B;  2EZV A;  1EYA A;  5CV6 A;  1UEA B;  3MA2 B;  4HSP A;  2TSS A;  3SK4 A;  1TVX A;  4MIU A;  2DNC A;  1WTP A;  3E0J A;  4BBS B;  4QB4 A;  4WJW A;  1PTO H;  1SJH D;  1VF5 C;  5DM7 3;  3WOF A;  2KUM A;  2EYF A;  2K5Q A;  5DNF A;  3OIP A;  2VB3 X;  1G8Z D;  1JC7 A;  1VCI A;  5BN3 A;  3S1R B;  3Q6S A;  5D65 A;  1MSG A;  4FXD A;  1SMY C;  4RWS C;  5LHY 1;  1GJX A;  1F9R A;  5CV9 A;  2EPB A;  5HGT A;  5C3E B;  2L55 A;  5C6A A;  3I91 A;  1ESR A;  1IW7 D;  4G7O C;  2PO4 A;  2BE5 C;  1LTT D;  3CRK C;  1ILQ A;  4IUN A;  1ZYR C;  3S1Q B;  4RAU C;  1QG7 A;  1OO9 B;  1B4O A;  1WTQ A;  3I70 A;  4V19 0;  5CC4 A;  2PW5 A;  1L0X B;  3S2D B;  4K5X A;  5EPL A;  5ELB A;  4CJ1 B;  2MJ8 A;  3FDT A;  2VUM B;  3K57 A;  2EYM A;  5IT9 E;  1BCP B;  1F2M A;  3PUZ A;  3GV3 A;  2EOT A;  3NWS A;  3C2P A;  1DOL A;  1R4P B;  4DK1 A;  3A8K E;  2WII B;  1O7Y A;  2R7Z B;  5EJW A;  2EYL A;  3M85 A;  5EBC A;  5IGE A;  2PYK A;  2IL8 A;  3SR1 A;  3U9O A;  1QIL A;  4HR7 B;  5I2Y A;  1Y1V B;  3SE0 A;  1PRT C;  3A56 A;  1BOS A;  3QJY A;  1PFB A;  1Y8P B;  2KEE A;  2NN6 H;  2K01 A;  3DWA A;  2KCC A;  2SNM A;  4K2L A;  3LWU A;  2XRS D;  1ZXT A;  3NHH A;  4L8J A;  4KV6 A;  3A54 A;  2A6H D;  3TME A;  1GHK A;  2B8G A;  5M5X B;  1PFN A;  3VYR A;  4ZKC B;  3H6M A;  3RUZ A;  5C3X A;  3J80 L;  2F0K A;  3TZD A;  1QOH A;  3HZX A;  4KTA A;  1PTO C;  4DAP A;  2NVX B;  5CBA E;  1LLR D;  1Q90 A;  4R8I A;  4IUR A;  1NUC A;  3ITP A;  3K5M A;  1DON A;  4DN4 M;  2K7V A;  2N88 A;  1KNE A;  3HKZ B;  3I4L A;  1BBX C;  1TS5 A;  4KKU A;  3KF8 A;  1A2U A;  2NTS A;  5CGK A;  4PQX A;  5FO7 B;  3GTG B;  3FMC A;  5J22 A;  1I4X A;  3K6O A;  4XQJ A;  1A3V A;  4J1M A;  1Y1W B;  2F0D A;  4HMJ A;  1NR2 A;  3A55 A;  4EQP A;  1JIC A;  2F03 A;  2OXP A;  4JBW A;  4ZUJ A;  1EIG A;  3SXH A;  4IFD G;  1WD1 A;  4ZRZ A;  2B2Y A;  5FKA C;  5C0X J;  3BS1 A;  3HOV B;  3G6J B;  4DU9 A;  3M3Y B;  2RVL A;  3PUY A;  1I50 B;  5C3W A;  1RJT A;  3HGB A;  1PMR A;  2K04 A;  1VF7 A;  2B2Y C;  2V4D A;  2ZT9 C;  3GV6 A;  5LL6 S;  1BR9 A;  1MI2 A;  5JPN C;  5ISR A;  1EOT A;  4BA1 I;  1HA5 A;  1E2V A;  1KTK A;  1J9O A;  3HEJ A;  4ZUI A;  1TS3 A;  2FHT A;  4HED A;  1SNQ A;  2CW0 D;  3MTS A;  4WRD A;  1NCV A;  2PZT A;  3IKJ A;  2JEA I;  4ZAI A;  2I07 B;  3ERQ A;  2MP1 A;  4DA2 A;  1TY2 A;  2QIL A;  2IX3 A;  5T1I A;  4XQN A;  3EJI A;  1EL0 A;  2O5I C;  5KRU A;  1AP0 A;  4FXK C;  1ENF A;  1CTM A;  3VR3 A;  4S3S A;  3PIO 3;  2VXW A;  5K36 G;  3MXG A;  1FR3 A;  2N55 A;  4DGZ A;  1RCV D;  3MC0 B;  2CHB D;  3QOJ A;  2NVY B;  2AWN A;  1V43 A;  3SK5 A;  1NAP A;  2WB1 B;  3DWQ A;  1TR5 A;  4Z9C B;  3CRL C;  1TT2 A;  3NSW A;  3GTK B;  4NDX A;  1I6V C;  3NXW A;  3OW7 A;  3URY A;  3M4O B;  2FMC A;  1G6Z A;  4ODG A;  2IX1 A;  2MUY A;  3QIA A;  2PZU A;  1STG A;  4X3K A;  1SNO A;  3ND8 A;  1GOZ A;  4A3K B;  5EGT A;  1TKW B;  5JAV A;  1WTX A;  5IT9 L;  4XIG S;  1MD2 D;  3I73 A;  4ZKB B;  3UI2 A;  5CBE E;  5JEA J;  5COR A;  2LY7 A;  5T1G A;  4YIJ A;  1FD7 D;  1HXY D;  2F0S A;  4A3I B;  4A3J B;  5TSS A;  1BXT A;  4GZY C;  2LFN A;  1MSH A;  4C3H G;  2L4N A;  1B2T A;  2PPB C;  5C4H A;  1GUS A;  2EY6 A;  1LTI D;  3H91 A;  5KEE A;  4FNF A;  5D3D A;  1LO5 D;  1SDF A;  1I4Q A;  4QCL A;  2A5H A;  1IKM A;  4K8I A;  2HCC A;  1I3Q B;  2EYH A;  2A69 C;  1AZP A;  3F2U A;  1DZ1 A;  3NTK A;  1C8C A;  1D5X C;  1IYV A;  2F0G A;  2JA8 B;  4K5W A;  3MXN A;  2K1B A;  3D4W A;  3D4D A;  4A93 B;  2Q8R E;  1FYC A;  2EYJ A;  3TZU A;  1A2T A;  3RZO B;  1Q12 A;  1Y69 U;  3Q24 A;  1ROD A;  4R9W A;  3BDC A;  1SYC A;  2NN6 G;  1RF2 D;  1TY0 A;  4K5V A;  5I2X A;  3LX0 A;  2QCP X;  2YU9 B;  3GP7 A;  1DXM A;  2B2W A;  3VR5 A;  5FOB B;  1EEF D;  2E2I B;  2PZW A;  1SFO B;  1Q3L A;  4C3I B;  1PFM A;  2J0T D;  3MVV A;  1G2T A;  4LJZ C;  2ICI A;  2B2W C;  1QE6 A;  2NVT B;  3EFX D;  4C1N I;  2A6E D;  5E3F A;  3C3L A;  3A7A B;  1JCK B;  4K8J A;  1DOM A;  1K8M A;  1RHP A;  3I4M B;  1U9R A;  2D2C C;  2B2U A;  3WOE A;  4U68 A;  1O7L A;  2LMC B;  5M3F B;  2SEB D;  2D5D A;  4LMQ D;  3R8B A;  4IN3 A;  1EY0 A;  2L9H A;  4RGN A;  1PRT B;  2B2U C;  4RKL A;  4KY6 A;  4A3G B;  3K5O A;  5EPK A;  3KBX A;  4F7X A;  2E2J B;  4G57 A;  4O42 A;  3EA6 A;  3GTJ B;  2E74 C;  2I46 A;  2EYP A;  2F0Q A;  1LTR D;  3CHB D;  3NWT A;  5LL6 X;  5I4D A;  4RGO S;  3KLR A;  4TQU S;  2F0U A;  3BVM A;  2XN9 C;  2AUK A;  1XXG A;  1T5X D;  3FKI B;  3NQI A;  4IUP A;  1WVL A;  1RD9 D;  2FFK B;  1U4L A;  3NE5 B;  1SJE D;  4H44 C;  3K7A B;  1H9R A;  1U4P A;  2IX0 A;  1MGS A;  3L7Z C;  4PV1 C;  3CQZ B;  4BWG B;  5DEH A;  1EWC A;  1V1P A;  2XWB B;  2KEC A;  2RKS A;  4OO1 G;  2F4I A;  4CKC A;  1B53 A;  3M4Y A;  4M8A A;  4ZK9 B;  2RSO A;  4EQO A;  4H13 C;  5C4J B;  4A3B B;  1EFI D;  2BOS A;  3A8J E;  4E6I A;  1STE A;  3NTI A;  4L63 B;  1TWH B;  2ICE C;  5I6Y A;  5E4X A;  4HCE A;  1GUT A;  2F3V A;  1Y8N B;  3TP7 A;  3KBG A;  2KJX A;  4AYB B;  3EQL C;  2F3W A;  3HRZ C;  4XDX A;  3S17 B;  4FVM A;  2D62 A;  1LAC A;  1SYF A;  5DM6 3;  3JAM E;  2KVM A;  1Y8O B;  1G29 1;  2JE6 I;  1CA6 A;  2IW3 A;  4PNY A;  4QF4 A;  4CJ2 C;  1BCP D;  1HQR D;  2NYZ D;  3IFT A;  4IFD I;  3QG1 A;  3PUX A;  2PQE A;  2IWH A;  3VA7 A;  1GUW A;  2F0M A;  5KYL A;  3RMH A;  4FF4 A;  2J4X A;  3G7L A;  1BF4 A;  2O5J C;  1EY7 A;  5C4X B;  1CFM A;  4C3J B;  1UAP A;  1JWM D;  5COY A;  2A74 C;  3S14 B;  3ND9 A;  1CQF A;  3MXP A;  3VR2 A;  1QWY A;  3BDO A;  1R9T B;  5EPJ A;  1BO0 A;  4HTH A;  1KLU D;  2DNE A;  3TN2 A;  2ENB A;  1CHQ D;  3GTP B;  1OXX K;  2EE1 A;  5EKK A;  2PMZ B;  2QKI C;  1B3A A;  3HS0 C;  1EYC A;  5EKL A;  1IHZ A;  1Q8I A;  1EWH A;  3BYY B;  5KYI A;  4FXG C;  5KNB A;  1S5C D;  3K5N A;  4J6H A;  1T5E A;  1EY8 A;  2XVS A;  3D6C A;  3V2T A;  2O4X A;  3D8G A;  1SNP A;  2WKD A;  2K05 A;  1KAA A;  1LTG D;  1UNS A;  4K14 A;  2JYO A;  4RCO A;  4CKE A;  3PO2 B;  3K0Y A;  2B63 B;  3OWF A;  1HUM A;  5A35 A;  2BDO A;  3N6R A;  2JEB I;  3GTM B;  2F1M A;  4X3U A;  2F0N A;  3NUC A;  4KN7 C;  1ILP A;  2AQ2 B;  3S1N B;  4KJN A;  4K2K A;  1SYE A;  4L6T B;  1TWG B;  1A3U A;  2XWJ B;  4RFB A;  1W6K A;  2FJ2 A;  5DAU A;  1U4R A;  5IGF A;  2KQ3 A;  1STA A;  3T53 B;  4XYQ A;  2OF1 A;  1F9Q A;  5ELC A;  1SXT A;  2L5T A;  3SHL A;  4FYD A;  2RSN A;  1DCZ A;  1O80 A;  3GTQ B;  5K5P A;  5CR3 A;  1JWS D;  4I65 A;  4NW2 A;  4N9T A;  4IUQ A;  4IQZ A;  4ZLT F;  2ID0 A;  3BVG A;  1IW7 C;  4KK7 A;  2BDN A;  1RDP D;  1H9M A;  3NP8 A;  2RBM A;  1WD0 A;  1CA5 A;  1JWU D;  2BA1 A;  4TSS A;  3TSS A;  1TS2 A;  2R3Z A;  4UDU C;  1B44 D;  1V1O A;  3LNN A;  2QDB A;  1V8Q A;  2JXM B;  2CVR A;  1SE4 A;  1EU3 A;  1BCP C;  1XYI A;  1Q1B A;  3P75 A;  3GD7 A;  1DD2 A;  1C4Q A;  3NTH A;  5C5L A;  4R8N A;  2JA5 B;  1PZK D;  2AQ3 B;  4CGY B;  3E6Z X;  4BY1 B;  3SK6 A;  3MZ5 A;  3I90 A;  4J8Q A;  2XNA C;  3J7A F;  2B2V A;  3DEO A;  1JR0 D;  1VMC A;  2KHS A;  5ELD A;  5J39 A;  2EY5 A;  3T13 A;  5ELF A;  4XT3 B;  2C9O A;  3VR4 A;  1KLG D;  2B2T A;  2Z8L A;  5EKI A;  4FF1 A;  2HDM A;  1QCB D;  2B2V C;  4KD4 A;  1LT5 D;  1HTP A;  3L3O C;  3HOW B;  4PMW A;  1YNN D;  3H94 A;  3AU7 A;  2EJF C;  3GTL B;  2RA4 A;  4V0B A;  4C1N K;  2B2T C;  3QWN A;  4DXF A;  5IOC A;  2F0I A;  3NK9 A;  3TBI B;  5ELE A;  2B8F A;  2A6H C;  5C0X H;  3SVM A;  1S4Z A;  3HOY B;  3OMC A;  3JAM L;  3VR6 A;  5KNC A;  1PYW D;  1YNJ D;  4XT1 B;  2F0V A;  1O7Z A;  3MWY W;  1BDO A;  3TP6 A;  4ILW A;  1LTS D;  5FO8 B;  1CQV A;  1TII D;  3R93 A;  3OIQ A;  3SK8 A;  5C44 B;  3CKI B;  1G91 A;  1I6H B;  5AFW A;  2ZXP A;  4EGV A;  4IFD J;  2RDF A;  5M5W B;  4MN3 A;  2XRQ D;  3MXU A;  1TWC B;  4OGQ C;  4ME5 A;  1FNV A;  3OPO A;  2DY8 A;  2IT1 A;  4RKB A;  1GUG A;  1X3P A;  2GA4 B;  1NR4 A;  4G4K A;  1JOQ A;  2EY2 A;  1SEB D;  3VYS A;  3TP8 A;  3RD4 A;  2YYZ A;  5G3L D;  4RHR A;  5CMD A;  1KDC A;  2Z4H A;  2NB0 A;  2KOL A;  4A3M B;  1IKL A;  4KY7 A;  1M8A A;  1M4V A;  3J7Y W;  3QO2 A;  4A3E B;  2FIN B;  4A3D B;  2AUJ D;  4OHJ A;  1ONL A;  5IGC A;  2Q8T A;  2A68 D;  4WOR A;  3FPU B;  2NBF A;  2R93 B;  1Z6H A;  4HCS A;  3A8I E;  4IZ8 A;  1SMY D;  2WV6 D;  1QNU A;  3H3V C;  4DAY A;  2K5W A;  2D9U A;  1SE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...