1Z6HA

Solution structure of bacillus subtilis blap biotinylated-form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and solution structures of a single domain biotin/lipoyl attachment protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Biosynthetic protein
molecule keywords Biotin/Lipoyl Attachment Protein
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1z6hA00
1TKWB 3MXUA 4KKUA 1Q1BA 1YNJC 2AUKA 1B9NA 1FR3A 3CRKC 4IQZA 5K36G 4LK1C 3DXJC 1ZYRC 4KN4C 1H9KA 1YNNC 1IYVA 4KMUC 4H0LC 5JEAG 2JE6I 4KKSA 2R6GA 3QJYA 4IFDH 2A6ED 2K7VA 1Z7TA 4I7ZC 3I73A 4GZYC 1GUOA 2JEAI 3BDOA 4G7HC 2NN6G 3VR2A 1H9SB 1G291 2NN6I 2KCCA 1GJXA 5KNBA 2DN8A 2O5IC 2L5TA 5BN4A 2BE5D 2V4DA 1DXMA 2BA0A 4DNRB 3M7NA 3VA7A 3FMCA 2F1MA 2O5JC 3GD7A 3IKJA 3W3AA 2JXMB 3SE0A 4BA2I 1O78A 1GUNA 1Y8NB 2E75C 1LACA 1I6VC 1OXSC 1HTPA 3FPPA 2K33A 3A8KE 1VF7A 4JK1C 1OXTA 3A7AB 3D4RA 3MFYA 3N6RA 2BE5C 2A6EC 3GQBA 4RCNA 5BN5A 4KN7C 4HR7B 2PPBC 1EWHA 1QJOA 3PUZA 3ND9A 3QG1A 1H9JA 1Q12A 1H9SA 2QF7A 3D31A 2K32A 4DK0A 1VF5C 4IFDG 3KLRA 3M4YA 4KKTA 2EDGA 4OGQC 4PV1C 1ZKOA 3RLFA 2NN6H 2E74C 2D2CC 4H44C 2Q8IB 3CRLC 1Q90A 4XIGS 1SMYC 2D62A 1TU2B 2LMCB 2EJGC 2IT1A 1K8OA 3I72A 2EJMA 3PUYA 1Y8PB 3A7LA 4H13C 4G7OC 2EVBA 1PMRA 1GHJA 4KHZA 4TQUS 3M85A 2CW0C 4G7ZC 1A6XA 2B8FA 1BDOA 3EQLC 5A35A 2BA1A 3VR4A 1GHKA 1CI3M 3TZUA 3QIAA 1O7LA 2YYZA 3PV0A 3I4LA 4XTCS 3VR3A 2PCFB 3A8JE 1Y69U 2KA7A 1E2VA 2A69C 1VDZA 1H9RA 1GUSA 1HCZA 4LJZC 1DD2A 1ONLA 3BG3A 1CTMA 3LWUA 3OOCA 3WDNA 5C0XG 1T5EA 3PUWA 3ND8A 2PNRC 1OXVA 1FYCA 2BDOA 4L8JA 3PUVA 1IW7D 1K8MA 4BA1I 1CFMA 1GUTA 1VCIA 5C0XH 1E2ZA 2A68D 2A69D 4OO1G 3L7ZC 2EJFC 4DK1A 1GUGA 1HPCA 3T51B 3IFTA 1Z6HA 5JEAH 1HQMC 3H94A 4TKOB 1E2WA 1OXUA 2DNCA 3T53B 2AWOA 2D5DA 1LABA 3HGBA 2A6HD 3LNNA 1V8QA 2ZT9C 4OO1H 2E76C 1IYUA 3VR6A 1IW7C 4KI0A 3SDZA 3OPOA 1DCZA 2JEBI 3NE5B 3A8IE 3PUXA 2DNEA 3VR5A 3U9SA 3OW7A 3AB9A 4DNTB 5KNDA 1Q1EA 2AUJD 1V43A 3P20A 2B8GA 1Y8OB 1H9MA 4JBWA 5BN3A 5KNCA 5K36H 3T56B 1OXXK 2A6HC 1B9MA 2A68C
chains in the Genus database with same CATH superfamily
5GQOA 4LF6Q 2AUKA 2B39A 3CP0A 3I2ZA 1RCVD 4KHPL 4K2LA 2F52A 2R6GA 4DXGA 1VQCA 1V1OA 3DLLA 3CCQA 3MXNA 1KD1C 1FJGQ 1N32Q 1XJVA 1NR4A 4KY5A 4YHHQ 4R4TA 2F03A 2KCTA 2DY7A 2JXMB 3GTQH 3MXGA 5DM63 4R4CA 1NTGA 2K28A 2K33A 2I5MX 4ZRZA 1E24A 3F2CA 1EIFA 2QEXA 1PH3A 4B3RQ 1EIYB 3P1HA 1FGBD 4F87A 5C4JB 1EWHA 3JAML 3HOYG 4DR6Q 2KUMA 2UUAL 1VQLA 1I4RA 1R4QB 3CCJA 1GD7A 1U4MA 1HA5A 3I4MG 4JC0A 2D62A 2LMCB 4TRDA 4ZK9B 1Q46A 4A3MH 2R93H 1PMRA 1I6HB 4OWXB 2XGTA 2B8FA 4YCWA 2KECA 1W3SA 1CQVA 1CKOA 1SROA 3G6JB 4LF4L 4AYBG 4GNXB 4I65A 3CC7A 3GTQB 1E2VA 1GUSA 4LJZC 2LXKA 1LV9A 4HAEA 5FO7B 2N78A 2NZ1D 1A3TA 3PUVA 5IGEA 3HOVG 2LSSA 4A93H 1VCIA 2JSOA 3SGIA 5C44H 1RL2A 5IYCH 4A3GB 1K9MC 2PW5A 3RZDB 1GOZA 4DK1A 2Z9HA 1I50H 2HQLA 4IUPA 4CDFC 1NR2A 2I5HA 1E2WA 1HR0L 3CCMA 2CQOA 2Z6KC 2HHHL 2F0JA 2G9HD 4R1JA 4DF7A 1K83B 1Q7YC 3HKSA 2LKVA 3T1HQ 3VR5A 3U9SA 5JVG3 1PH7A 4DNTB 3LX0A 1GM5A 1B50A 3C1FA 3HOZH 2WIIB 4MTKA 2EE1A 3M3YH 5CC4A 1PZID 4YY3Q 4JI8L 4YWMA 3PMFA 3UDFA 1TKWB 3A0JA 4P73A 1K0RA 2B63B 4NPSA 2F0SA 4JI2Q 3KBXA 2G5DA 1J9OA 2DJFC 3RNUA 5C4XG 1G291 1GKHA 1B1ZA 1BUVT 1YJWA 2F1MA 2WAQB 5CV5A 4XT1B 2FXQA 4EQOA 3I4OA 3K5MA 1PH6A 1LTAD 1KTKA 2RKSA 1IBKQ 4IOCA 4DR2Q 2E2HH 3E6ZX 3HKZE 1EY6A 2SNMA 3QG1A 1BF4A 2B63H 4IFDG 3Q8DA 4A3MG 1Q8KA 1NJIC 4KKTA 4LF5L 4B9XA 3KLSA 1ZKOA 3BVGA 2ENBA 2V1CC 3TP8A 5CGKA 1CUKA 3I72A 3MFGA 4JI0L 1BDOA 2UUCQ 4JOIC 1W6JA 3PO2B 4A3LG 2A8VA 1HNWL 5C4ZA 1PFSA 3KLSX 1AE3A 2YTVA 1ILPA 4L63B 2EXZA 2AQ1B 2PNRC 1WTQA 4DAVA 1G2SA 1EQVA 2PNHA 3J81E 3J7YW 5M5XB 4ID6A 2B63G 2IL8A 4QCLA 2Y0SG 4GLXA 3E0JA 1X3FA 3JAME 4X3TA 2R92H 3GTOB 2MO1A 2B2YC 1CZGA 1HQMC 3SR1A 3OWEB 3G48A 5EKKA 1J6QA 2A19A 4DV6L 3OW2A 1V8QA 4OL7A 1SN8A 1LTRD 4FXGC 4G4KA 3SDZA 3PSIA 1N34L 1NMGA 1I4GA 3GTKH 2EQSA 1NUCA 3NENA 4X3SA 4TSSA 1STNA 3T4AC 4GOPA 4BBRG 1VQIA 1A15A 1VMPA 5M5WH 5IYDH 4DV2L 3PQIA 2ZXOA 3ONAB 4ABNA 4GS3A 1II3A 2NVYH 1G2TA 3S2DB 1XNRQ 1G51A 3AU7A 4PMWA 5CORA 5LMNQ 1QUQA 1H9KA 1N36Q 2XVSA 2WV6D 4NW2A 5IWAQ 4DUZQ 2OTJA 2K7VA 1K3BC 2PQEA 2KCNA 2JK8A 2JA7H 5C0XJ 4A75A 5FJ8H 4Q5VA 2FMMA 2C9OA 4DAYA 2UUAQ 4EGVA 4R4OA 5G3LD 3T1YL 2BE5D 4B3TL 4M1UB 1U4LA 1ET6A 4B9WA 1AW7A 3AQQA 1LTLA 1EL0A 4BA2I 4X64Q 4DV1Q 2K4KA 4HIDA 1HNZL 1I6HH 1HXYD 2K75A 2UXBQ 3MWYW 2PPBC 1KDBA 4A3DB 1B2TA 3NQTA 3HFZB 1XTDA 4B3ML 2B2UA 4DAYB 1Y1VH 3S14B 3P75A 1PFBA 2E74C 2NZHA 1HFGA 3UDGA 1TU2B 2R7DA 3UDXA 1STBA 1O80A 3GTKB 1KHIA 5C3EH 1SBBB 3TMEA 1STGA 1N8RC 1HH2P 2AQ3B 1E0BA 3S1NB 2ZXPA 4UP7A 2NVQB 4DKAC 3RR5A 2B2WA 1XX8A 2F0PA 5DM73 5I6YA 3MHBA 1K83H 2BDOA 1OTCA 3MVVA 1XTCD 4C3JG 1KQSA 4N9PA 3OTOL 2PI2E 2BH2A 3C3LA 1YBYA 3W5OA 2EJFC 1HPCA 3IFTA 3TP5A 5IIFA 5E4XA 4LFCL 4DK3C 4TVAB 4MN3A 1LABA 3HGBA 1ENFA 4BY7H 3OPOA 2ICIA 1DCZA 2L9HA 4KTAA 1YNJD 4RAUC 1A8VA 2DJGC 3H0GH 4APVA 5FLMH 3I4NG 4IALA 4F88A 1Q1EA 5KNCA 4KJOA 2E8GA 1ENCA 4MNOA 2A6HC 3E0EA 4ULLA 3Q6SA 2L12A 1A0IA 4R4IA 4C56C 4KKUA 4A76A 5C3XA 1CT1D 5HURA 5K36G 1QVGA 2J4XA 3DXJC 4LF9L 1D8LA 4QUCA 5FJ8G 4JYAL 3OHXC 3MTSA 4KKSA 3QJYA 3TP7A 1MKHA 1DONA 1SRUA 1SSOA 2ZJQA 2CQAA 2M9VA 2F0DA 4C2MB 1GO3E 1UWVA 1KAWA 2HDLA 5ISRA 3BS1A 4A3DG 2UXCL 2AMCB 1EY9A 3GD7A 4LWCA 2ATWA 1VQKA 2B3GA 1MGSA 4DXFA 4O0AA 1K0SA 3A8KE 4PMCA 4LAAA 1YI2A 1HR0W 1IL8A 2KEEA 3OSOA 3RZOH 1YJ9A 2DGYA 2F0OA 4DR1Q 4HTHA 4DAPA 1BXTA 1SLJA 3CQZH 1LM0A 4R9WA 4K0KQ 4DFAA 1HQRD 3GTGH 4CHTB 1QILA 3FRPB 2RA4A 1DOMA 3RMHA 1PHJA 2Z6BA 5CBEE 3EBEA 4GKJL 3DEOA 2EJMA 1HRJA 1X56A 1Y14B 3M85A 1SJHD 1SYEA 3K8AA 2E5LQ 4LNQA 2BA1A 5HY6A 1MI2A 3W2DA 2K03A 1GHKA 2EOTA 5M3FG 1SE2A 4ZKCB 3PV0A 4XTCS 1MJCA 1TWHB 2HQEA 3S1QB 3J7ZC 1JOKA 3LWUA 3J81j 1T5EA 2C5CA 3HG9A 4AYBB 3PUWA 4OXPA 1JE4A 3KYHC 1RTNA 3CCSA 1BKBA 4RKLA 3UDIA 4GLVB 4QQBX 1SYBA 3OIQA 3KOJA 4A3CG 5GAGC 4DV2Q 2F0QA 3HOWH 4BY7G 2KJXA 3HOVH 1EQTA 1OXUA 3T53B 1IL2A 3I4NH 4X62L 1PFMA 4GOPC 1IW7C 4CJ1B 1QVCA 2JEBI 3VYSA 2XWBB 2K01A 3BJUA 2R93B 4DAMA 4DUZL 3BZKA 2L0CA 5IGBA 1EOTA 2EY5A 1PV4A 4OX9Q 4K14A 4A3KB 2TSSA 1KAAA 1LLRD 2L4NA 4KJNA 1YNJC 4DA2A 4Y7NB 4CBVA 4JI6L 1L2FA 3QWNA 5M5YH 4X64L 4OONA 3UE0A 1IXRA 1YVCA 2MGSA 4C1NK 4LUOA 3L2PA 1CKMA 1JOOA 5IODA 4A3IB 3AFQA 3F1ZA 3U50C 4DNIA 2UXBL 1H9SB 1JJCB 4IO9A 1TQOA 2E2JB 1VQAA 3RN5A 1ILQA 5EPLA 2R7ZB 3R93A 3W3AA 5ELCA 1S40A 3S14H 1KIXA 4LFAQ 1X65A 2FFKB 1XMQQ 1MHWC 1OXSC 3LWEA 1S72A 3MC0B 4A3JH 1RTOA 1LO5D 1H9SA 4DK0A 3DWQA 1I4HA 1VF5C 5G3LF 2LY7A 3SK5A 3JAMc 4OWWB 5I6WA 1KL9A 2NN6H 4H44C 4RG1A 3CRLC 2CVRA 3KDFA 1L0XB 4JPBW 3D8GA 3I56A 4A3DH 3R2IA 3G6EA 4JBKA 1O7LA 3S9WA 1B70B 1HCZA 1WTRA 3TQYA 5IT9c 1EUJA 1CTMA 2JA6G 4P75A 4F7XA 4PMBA 3EN2A 5ELFA 1A3VA 3EFXD 4X65L 4X3KA 4HJ8A 1X3QA 2H1EA 4CDEC 3SVMA 1SE8A 4A3FG 1SFOB 1I4PA 1EZ8A 1SE3A 1VQ6A 4JI5L 2KEDA 3NBHB 4HIMA 3TBIB 3J80c 1V9PA 5C5LA 1D1KA 2EY1A 1ET9A 1I3QB 4EVOA 4L5SA 1TWCH 3I90A 2OQKA 2RDHA 2MHVA 1VMCA 3D3RA 4EX5A 3HOUG 1HZ9A 2ZTDA 2ZJPA 4BY1B 1V43A 1LTID 3T56B 2F0TA 4DR4Q 1D5MC 3J7AV 4C2MH 2JA8B 3FHWA 4CJ0B 1QWYA 1XXGA 4NKLA 2WB1G 4P72A 4LFBL 1UAPA 3NBHA 3I70A 4H0LC 4DV3L 4IFDH 1Q86C 4A3FH 1B8AA 4PG3A 1KABA 3PIP3 1I50B 4F8MA 3K5LA 1MD2D 4WJ4A 5KNBA 3QB3A 3R3OA 4DV7L 2OQ0A 2RHSB 4YWLA 4QY7A 3CCUA 4DR5L 1EY4A 2MO0A 2P5ZX 3CQZB 2BDNA 3OMCA 1YZ6A 1J5EQ 3HOZG 4DUYL 3CW2C 4FXKC 4QB4A 1GUWA 1AP0A 4NXNQ 1HUMA 1BOSA 3K57A 3S1RB 3KJPA 4PZ6A 1STHA 3T16A 1JT8A 2KBNA 3I4MH 2VS1A 1X3GA 1KC8C 1HZCA 2F0EA 4EQ5A 2M2LA 1K73C 1VQGA 2HD3A 4RGNA 5LMUQ 2F0FA 4HCSA 5DNFA 1Y1VG 4DR3L 1M1KC 3S17H 5HGQA 4IFDI 5LL6S 3CCEA 1X3EA 1F77A 3HOUB 1IHZA 4K8JA 2E2HB 4DV4L 5CMDA 4LF7Q 1VQJA 5D65A 2B2TA 4O42A 4X62Q 1EQQA 3BG3A 4HMIA 1Y1WG 2RCNA 3WDNA 1O7IA 5C0XG 2JA5G 4PQXA 4A4IA 1C0AA 3I55A 5FKAC 2KHSA 3SEBA 1GUTA 2ZM6Q 2A68D 2OXPA 2A69D 4R8NA 1W2BA 2RHQB 3H94A 2OT2A 4DV0L 4K5VA 3WOEA 3LNNA 1MSHA 5FOBB 2E76C 1A63A 4IURA 3CPFA 3S15H 3ITPA 3DM3A 4GKKL 1B3AA 4PZ7A 3U4ZA 3CMEA 3X3MA 3JAMi 2GVBA 3P20A 1SJED 4KK7A 3A8JE 1Y69U 5FLMG 3LGJA 5I9PA 3OTOQ 4A3BH 2ZTCA 3E9HA 4JI3Q 2O2LD 1S5CD 3KJOA 2X6GA 1YNNC 3K7AH 1F9QA 5KRUA 3J7AF 4LFCQ 1SEBD 5EQ0A 4Q0FA 4GZYC 2CWAA 3URYA 2NVTH 4DK6C 1TXYA 2NN6I 3UE1A 1ZYRD 2K5QA 3BZCA 2ALYB 3M7NA 2WKCA 1EU4A 2D9UA 3HEJA 1EY8A 3ULJA 4BBRB 3S15B 4IZ8A 4IJHA 4ZUIA 4A3GG 1S5BD 5EAYA 1YEZA 2ZJRA 1JB7A 1N9WA 3U9OA 3BDCA 3D4RA 2QGQA 3CCRA 1V1PA 5EJWA 3NTIA 4N9TA 4OELB 1TWFB 1TWGB 2SOBA 1ML0D 3TREA 2NWGA 4C3JH 1H9JA 1WTXA 4IJLA 4UPAA 3GTMB 3D31A 1L1OC 1YHBA 3BVMA 1VQ4A 2KHIA 5GAEC 4V0BA 3PCOB 2AHOB 4JCVE 4OGQC 1UUPA 1RODA 2A73B 4XQQA 3D6WA 4DU9A 3HOZB 2I5LX 2UXCQ 1VQHA 2PZTA 4OIKA 4AYBE 3J81c 3PO3G 2D0OA 1UE6A 1PLFA 3BYYB 1FNWA 4JI4Q 2YYZA 1V1PB 2IX1A 3S1NH 2N55A 4AQYQ 3V2TA 4BXXH 3VYUA 2K1BA 5L37A 2XSCA 5EKLA 5I4DA 3L9AX 1AZQA 5AJ3L 3U4VA 4FNFA 1PH8A 1TWCB 1PFNA 4C3HG 4LF6L 1F2YA 5H1SE 1QCBD 1TWGH 3G4SA 1EFWA 1ENAA 3NTKA 4ALPA 2D0PA 1GUGA 2A5HA 1Z6HA 2MP1A 1BO0A 2F0VA 5C4JH 4KY7A 2K14A 5BR8Q 4BY1G 3WOFA 2JA9A 1MJEA 4BY7B 4JI1L 4BBRH 2O4XA 1I4XA 4LFBQ 1RDPD 3AFPA 3I8ZA 5IYBG 3G7LA 1U0LA 1T9HA 2B2TC 2N49A 4C3IB 3W1GA 2E2IH 1EYDA 4DR5Q 2IX3A 4YIJA 1J5EL 4DUYQ 1TS2A 1NNXA 4KN4C 3J81L 4NMZA 3PO3B 1U5KA 2A6ED 2Z4IA 1SNOA 1P16A 3ULLA 1WCMG 3O13A 1JCKB 1JWUD 2RCFA 5CV8A 4A3GH 4IPDA 3H0GG 1GJXA 2RVLA 3S1MH 2O5JC 4OX9L 2XNAC 2Q2IA 1DOLA 4G57A 2E75C 3IRBA 1GXDC 1IBMQ 1SMXA 1VF7A 4JK1C 3E3XA 5IT9E 3ZYYX 3GQBA 1RD9D 1I4QA 4KN7C 3PIOA 1IKLA 5GADC 3SK4A 1IKMA 4LW1A 4RGMA 2NUCA 3PIPA 3MA2B 1WTOA 4KLKA 2AWNA 3HOYH 4PV1C 3S1MB 3PO3H 1VQPA 3K5NA 5IP9G 2HHHQ 2K50A 3J80E 2RDFA 3S16H 1G6PA 1V1QA 3Q24A 1XMQL 2Q2HA 2R93G 4GNXA 2RF4A 3CXCA 2R7ZH 2F0NA 3H3VC 1DD2A 3PIO3 4A3KG 4WJWA 5JPMC 3HOXG 2LS01 2EYFA 2IW3A 2B2YA 1I3QH 2RSOA 4ME3A 4A3JB 1PH9A 3RZOB 4OO1G 1YNXA 4K5WA 1JWSD 4HJ9A 3G71A 4IPCA 5C6AA 3MEFA 1CHQD 4RCOA 3CMAA 3R2TA 4EQNA 1JORA 2LXJA 2VQFL 1PTOD 2PI2A 3OIPA 2BCOA 5GROA 1UE1A 2QA4A 4JI7L 3K7AB 1VQ9A 5M3FH 1NSNS 3PF5A 2PYKA 2YTYA 3AB9A 2B2VC 3KF6B 2AUJD 1D2BA 1NMFA 2BH8A 3NP8A 5J39A 5K36H 4OWTB 1OXXK 5ELOA 3RD4A 2EYLA 3Q23A 1KRSA 1Y1VB 4IN3A 2K5VA 4UHVA 2GN5A 4HMJA 3ZJYC 4EQPA 1YJNA 1B9NA 1FR3A 2K04A 1X32A 4IQZA 4X65Q 1M90C 1ZYRC 2WFWA 1JMCA 1IYVA 4ILWA 3HOWG 2YU9B 3T13A 4DPGA 1IZ6A 1BR9A 2J7ZA 3SK6A 4JI5Q 1Y1WB 2JA5B 1LTTD 1WOCA 1GUOA 3HOVB 4IUNA 2NN6G 3KF6A 3TSSA 4RGTA 2R7FA 1HZAA 2WB1B 2O5IC 2MQHA 2BA0A 4C3JB 3FMCA 3OWFA 4JI0Q 2IHFA 4FVMA 4J6HA 4MTNA 3FDTA 2SNSA 3SXHA 2ZTEA 3NK9A 3A7AB 2BE5C 4RCNA 2IPKD 5CV6A 1FJGL 1N32L 3K59A 1PRTF 4LF4Q 2AQ2B 3E9IA 3F2BA 2K32A 2UUBL 4L5RC 2CWPA 1KDAA 2NZOA 3NSWA 2KENA 4YCVA 3VYTA 4IFDJ 4NP5A 4ODGA 1EU3A 3KBGA 4XIGS 1K8OA 5C4XB 4NXML 2Z0SA 1K8AC 1QNKA 1XPRA 2R7ZG 2CW0C 1X6OA 3KF8B 4B3RL 1BCPF 2B2WC 2CH4W 5M3MG 2HT1A 1K3RA 1CSPA 3EA6A 3GTOH 1F9PA 5COYA 4DR6L 5TSSA 1PXUA 2I46A 1E1OA 1FVIA 3BU2A 4XXEA 1DM0B 1IW7D 1K8MA 5IT9L 3ULPA 1EOVA 2VZAA 1CK1A 1XNRL 4GN5A 1QG7A 4LF8Q 1SNQA 1NE3A 1DOKA 1RJTA 3DUZA 4YY3L 1XYIA 4A3EB 1S5DD 3HP3A 1BBUA 4CJ2C 3DEPA 5ELBA 1VS0A 1WI5A 3FPUB 3CKIB 1R4PB 1PDQA 4JI2L 3DWAA 3A8IE 5FO9B 3H91A 1VQBA 3CHBD 3T1YQ 1JR0D 4QGUA 5CYUA 3M4OH 2FJ2A 3J80L 2RSNA 4GOPB 2F3IA 2WAQE 1YIJA 5FLXc 2NTTA 2A68C 3IL8A 4DR7Q 2XIWA 3OMGA 1WVLA 1HNZQ 1IBLL 3S2HH 2Z4HA 2HCCA 1PTOC 1D5ZC 4JBMA 1QUQB 3PGZA 5IOCA 4DV0Q 1EWCA 3D0FA 1D1IA 2HDMA 1WFQA 3BDOA 1B4OA 2MUYA 1LUZA 5AFWA 3VR2A 4G7HC 2RBMA 4JI8Q 4GN4B 5CBAE 3S1QH 2A1AA 2AKWB 4FXDA 2JA7G 3AMUA 1A2UA 4C1NI 1RKNA 2B2VA 2PO4A 4HIOA 1Y8NB 4IPGA 2FMCA 3H15A 3TS2A 1F2MA 3S1RH 3N6RA 3I91A 1E22A 1S3OA 1HNWQ 2ZXRA 3ND9A 4XT3B 3TDQA 3L3OC 4FO2A 1SDFA 1G8ZD 4CDDC 5KGUA 5JVH3 1EY5A 1YITA 3KLWA 1EIGA 5IGFA 4X6AH 3DMUA 5M3MH 1D6EC 1VQOA 2H4OA 2BOSA 5FLXL 5FK9C 4TQUS 3EROA 1A6XA 3TN2A 1BCPC 3Q0AA 4DR2L 2ES2A 5A2QL 1NY4A 3TZUA 4K6DA 1CQFA 1Z9FA 3MXPA 1ONLA 4JI7Q 4UY8C 4MHEA 2JJQA 3D4DA 5EGTA 2N8NA 3K7UC 3L0OA 4JOIA 3K81C 3ND8A 1LTSD 3R8BA 3TRZA 3DM1A 4XQNA 2UUCL 1EIHA 1S4ZA 1PTOH 1R9TH 4M8AA 1XPOA 1EZ6A 4QL5A 2F0HA 3HOUH 1SNCA 4R4QA 2QKIC 5I9OA 2XRSD 4IPHA 1N36L 3NE5B 4A3LH 1BQQT 5LHY1 1YHQA 4DN4M 3I3CA 4B3SL 3K80C 3ERSX 4K8IA 4HIKA 1Y1WH 2JA5H 3A55A 3F2DA 2CFMA 3JC66 5EBDA 1ASYA 5CV9A 1J8IA 1Q1BA 2H5XA 2PMZE 4P71A 4KY6A 4C3IG 3S2DH 4BBSG 1HTLD 1STEA 3NELA 3A5ZB 1PTOF 1VQ8A 3TEHB 2MNAA 1N34Q 4K6LA 1NCVA 4NDXA 4DR1L 1HR0Q 1VQEA 5BR8L 4GN3B 2N3SA 3KK7A 4K0KL 1PTOB 1MIUA 4MZ9A 5D3DA 1BNZA 1EY0A 3A74A 4B3MQ 1B7YB 3VA7A 1L0YB 2L55A 2I07B 3SE0A 2QW7A 5LMNL 2G9DA 3QOJA 1PRTB 1HHVA 4NXMQ 2KOLA 4DV5Q 3ER0A 3DHQA 3IFDA 4RH6A 2IJ0A 4C3IH 1SE4A 2LFNA 2IHEA 4HSPA 1QJOA 4FF2A 1Q12A 2E2IB 3C1EA 2QF7A 1X3PA 3M9BA 3GTPH 2F3WA 2F0IA 3KLRA 3HZXA 5C4HA 4DV1L 2F0LA 4JW0A 4G7OC 1UE5A 1ESFA 2CH4A 2WP8J 2KHJA 2Y0SE 4FF4A 4FP5D 2CKZB 2QDBA 2EPBA 4LF8L 1SNPA 1CI3M 1TIID 5IP7H 3VR3A 1HJPA 3RLNA 3CD6A 3GV3A 4BBSB 2A69C 5E3FA 1IBKL 4JV5L 1SFOH 1BCPB 3BYTB 4P74A 5C3WA 4QF4A 3U58A 3GTPB 2XRQD 4A3MB 1DYQA 1FYCA 3TS0A 4QMGA 1PVOA 1XWEA 2IWHA 4AIMA 5IE8A 4LF5Q 4JI6Q 4J8QA 4DR7L 5D14A 3T51B 3NHHA 1EYGA 2NVXB 2A6HD 2KVMA 2EXDA 4FF1A 4OO1H 1CZWA 3GTJH 4KHVA 1L0WA 4Y52H 2JP1A 5M5YB 3W1BA 4CKCA 5FLXE 5IGCA 1MBYA 4V190 2EY2A 3OW7A 3RZDH 4A3BG 1DZ1A 4H02A 4A3IH 2UXDQ 2YTXA 1C48A 4BBSH 2HIXA 2R61A 1ICFB 1EYAA 2L1BA 2F4VQ 5T1GA 1TVXA 1SR3A 1CKNA 2WINB 4KD3A 3S17B 5I2XA 3C46A 2OEOA 5CV7A 4IOAA 2JA8G 2VQFQ 4DV6Q 1Z7TA 1QVFA 1RIPA 2XN9C 4I7AA 2K5HA 2GA4B 3AYHB 3QR8A 2K6AA 2MFIA 2YV5A 3V96A 1OO9B 5BN4A 1N33Q 2UU9Q 2NB0A 4HJ5A 1CKNB 2Z8LA 3KUPA 4JYAQ 1I6VC 1HTPA 1O7YA 3B6YA 3FPPA 3HKZB 1I94Q 1GVPA 1NBWA 1ZEQX 1Q82C 3MFYA 4XDXA 2A6EC 1JB3A 5JJZA 4KV6A 3J81i 1HZBA 4J1MA 3PUZA 3S24A 5K5PA 5IWAL 5ELNA 2K5DA 2XTIA 1LTBD 4A3JG 5C3EG 1M4VA 1RF2D 3D4WA 1JOQA 2YU9H 3GTJB 3K6OA 4FF3A 1T5XD 3NEMA 2VL6A 4RHSA 4GNXC 4B3TQ 1L1OB 3RN2A 3PUYA 3A7LA 4QIWB 2OCEA 4HCEA 2VW9A 1QZHA 4A3FB 3VR4A 2OF1A 3KDFB 1K8GA 5ELDA 4R8IA 2VUMG 2CHBD 2Y0SB 1TWAH 3OOCA 2K5NA 4WRDA 3CC2A 3CU7A 4L6TB 5CV4A 1AN8A 5M3MB 1OXVA 2JA7B 4GKJQ 4L8JA 4BA1I 2JA6H 3QO2A 4MIUA 1E2ZA 1L1OA 1STYA 4BY1H 2E5LL 1STAA 5LMNW 1U4PA 5JOBA 3X3NA 4A93G 1A62A 5IP9H 4POGA 2K05A 2JQOA 4A3EG 4XYOA 1WYDA 3C2PA 1TS5A 1YHAA 3FVQA 1AH9A 1C4QA 4ZCKA 2L15A 4DV7Q 5JJLA 2J0TD 2EYJA 1FNVA 1Y8OB 1QB5D 1QE6A 4NB3A 5M9OA 3GTMH 4A3KH 1S5FD 1B9MA 2JA6B 3HOXB 1D7QA 2E2DC 1KNEA 4YCUA 3A5UA 5KEEA 2IY5B 4HJ7A 2FINB 2EZVA 4ZUJA 1DJRD 4LK1C 1HFNA 3K0XA 3H0GB 4LFAL 5JEAG 5JPNC 5DAUA 1A2TA 1EQRA 1BBWA 3NWTA 5M5WB 2X69A 4CKEA 5M5XH 5CR3A 1KLUD 3H09A 4JBJA 2VQEL 5NUCA 1CM9A 1TY0A 5LMUL 2V4DA 1DXMA 2ICEC 3SK8A 1VQNA 1F9RA 1LT5D 1WD0A 2WKDA 4K5XA 4RMFA 3STBC 1GUNA 4IUVA 3RUZA 2A74C 2CW0D 1YNND 3GV6A 1IBLQ 4LF7L 4LF9Q 3OYYA 4A93B 4HR7B 4OIJA 5C44B 1SNMA 4XQJA 4WORA 2Q8RE 4L5QA 4LUVA 4JG2A 3RLFA 1LT3D 2HIVA 2WB1E 4XYQA 2QDLA 4ZQ3A 1G6ZA 3NXWA 4CDCC 2IT1A 5J22A 4U68A 2VUMH 1GHJA 3VA5A 5KYIA 1QNUA 3HKZG 3NPPA 1X54A 1PYWD 4POFA 3I4LA 3HOXH 1S5ED 3EVQA 1VDZA 4GLAC 2NVXH 1SYGA 3E5SA 3CPWA 2F0KA 2NTSA 5GAHC 3CC4A 5C0XH 2UXDL 2QILA 4IUQA 4QUFA 2VB3X 4CGYB 4A3EH 2ASBA 1BBXC 4H7BA 2F4VL 2CCZA 4A3BB 2EYPA 2VXWA 1IYUA 1E3PA 2R92G 2GVAA 4PZ8A 5C4XH 3Q22A 1X9NA 4DV3Q 5JJIA 3PUXA 4ZKBB 4BS9A 3J80i 5J1ZA 3VDYA 1PH4A 1XNQQ 5KNDA 4JBWA 1SYFA 2B29A 2EYHA 3P7JA 3KFUA 3H3VH 4CKBA 1C8CA 3TZDA 3FEWX 3GTGB 3RLOA 1TS4A 2X6LA 1SYCA 3MAQA 5C44G 5F2DA 1LTGD 1JICA 5KYLA 4P2CB 4JVZA 4KMUC 1B3QA 2VY3A 2TMPA 1I94L 3ICEA 2OTLA 1TR5A 3NBIA 3I73A 1PH1A 2JYOA 1VQ5A 1PYBA 1PZKD 1ASZA 4U673 2KCCA 3PF4A 1MSGA 3K58A 2Q2UA 2KQ3A 4B3SQ 2ID0A 2RDGA 4N8FA 4BWGB 4AH6A 1CA6A 1WTHA 5KIXA 3CF5A 1K28A 4RFBA 1LACA 1G91A 4DR3Q 5E7NA 3M7GA 1PA6A 3K5OA 1EYCA 5D3IB 4ZLTF 1O7ZA 2E2JH 2R92B 1JQYD 3I4MB 3M4YA 2EDGA 1E1TA 4HN7A 1RHPA 1HNXL 2D2CC 3QOLA 2MPMA 1SMYC 2RQXA 3EQLC 1WD1A 1HA6A 3QIAA 1Q3LA 2PCFB 2F0WA 2KA7A 2PW7A 3A54A 4DV5L 3T1HL 1PRTD 2HUGA 1EY7A 1SMYD 2DUDA 5IP7G 2C35B 4ME5A 3H3VI 1ZXTA 4GKKQ 4RWSC 1FGUA 1EEID 1HUNA 2K5WA 1I5FA 3NQIA 1PYSB 3FKIG 2WACA 1AFPA 3EIVA 4C3HH 1TWHH 4RGOS 4TKOB 3SHLA 1P8LA 1Z47A 2AWOA 3HS0C 3I7FA 1KRTA 3GP7A 1KXLA 3IAYA 3GO5A 4KI0A 4O2DA 2EIFA 3N52A 3GTLH 2DNEA 1Q8IA 2JN4A 3HOYB 1ESRA 1M8AA 5C0XI 4JV5Q 3D6CA 1TS3A 4IUTA 2HCIA 2ZM6L 1H9MA 2F0GA 1JJGA 1F2LA 4S3SA 4X66L 3J7A5 1XMOL 4X3UA 5J3BA 3MXUA 1B53A 3M4QA 3CRKC 3AEVA 4A3IG 1E7ZA 4E6IA 2F0UA 3MEHA 2NBFA 1AE2A 5E4WC 2F3VA 3A56A 1UEBA 4ZAIA 3CAMA 3BVZA 2JEAI 4C3HB 2DY8A 1UE7A 2F0MA 2NVTB 2DN8A 2JA8H 2L5TA 2I0QA 1C7YA 1JWMD 3MZ5A 4JI3L 1D5XC 1F2ZA 4UP9A 1UEAB 4KHPQ 5IYDG 4DR4L 3NTHA 4OEMB 2FHTA 1KNAA 2K52A 1C9OA 5EPKA 3UI2A 1A3UA 2VNUD 1QZGA 3S16B 4N8X1 4YHHL 4AQYL 1BCPD 1LT4D 3FKIB 3K0YA 1PZJD 1PH2A 3H6MA 5JAVA 4RA8A 1TWAB 5FO8B 3FP9A 5AJ3Q 5DLQE 1TT2A 1Q90A 2QCPX 1N33L 3TP6A 2UU9L 2EVBA 2B2UC 1EEFD 5T1IA 2N88A 4G7ZC 1WJJA 4UAIA 1FNUA 1SNDA 4WJ3M 4LUZA 3WWVA 1X55A 2NYZD 1BVSA 3EJIA 1WCMB 1H9RA 4NXNL 5HGTA 1IYJB 4JI1Q 1EFID 2NVYB 3FKIH 4QIWE 1QOHA 4WFN3 5M3FB 2EYMA 1CFMA 4DGZA 1XNQL 1AEXA 2WAQG 4RHRA 3DWPA 1WTWA 3L7ZC 4JI4L 1SAPA 1KLGD 2D5DA 1JJ2A 2PQAA 4FYDA 2XWJB 1WCMH 1CSQA 4B08A 1B44D 4DV4Q 2Z6KA 3ERQA 3GDEA 1VQMA 1JE5A 4BXXG 1XPUA 1Q81C 5A2QE 1LT6D 4IUUA 3CCLA 1SYDA 1PH5A 5JJKA 2PZWA 5IGDA 1U9RA 2PQAB 4HSVA 1JC7A 1VQ7A 2JE6I 1FD7D 1CA5A 4I7ZC 2UUBQ 3M3YB 2OWOA 5C3EB 4DNRB 4UP8A 4PNYA 5EPJA 3IKJA 4HJAA 1LYLA 4LMQD 1ICWA 1HNXQ 1O78A 4FDBA 5JEAJ 4O1NA 5LL6X 1H95A 2EYOA 1OXTA 2Q8TA 5EBCA 5ELEA 5BN5A 3HRZC 4HEDA 3PO2H 4Z9CB 1F9SA 1PRTC 4J15A 5IY0A 4OHJA 3STBD 3HOWB 2IX0A 1WTVA 2SDFA 4A3CH 5IGGA 2VQEQ 3CCVA 2Q8IB 4ZYSA 2EJGC 1IBML 4H13C 1Y8PB 3BZDB 4KHZA 2PMZB 1SXTA 3KF8A 1TWFH 5A35A 1CHPD 1NAPA 5EKIA 2Q2TA 2VB2X 5E1FA 1R9TB 2MJ8A 2L11A 2QEJC 3V05A 4Y7NH 3PO2G 3GTLB 4KD4A 1DGSA 2Z1CA 4UDUC 3M4OB 5C5MA 1KDCA 2EY6A 3VYRA 4X66Q 1TY2A 1UNSA 5JEAH 4YWKA 1XMOQ 2KCMA 2PZUA 1EWIA 4K2KA 4OO1I 4QJFA 5IYCG 1W6KA 2DNCA 2M00A 2NVQH 3NUCA 5IYBH 2R3ZA 2ZT9C 3S2HB 3I4NB 1VQDA 3VR6A 3NWSA 3F8TA 3BDLA 4L5TA 5I2YA 1FL0A 3MXNB 2VUMB 2SEBD 3F2UA 1VQFA 3M4PA 1WTPA 2B8GA 2F4IA 5BN3A 4RKBA 1U4RA 1AZPA 5DEHA
chains in the Genus database with same CATH topology
2AUKA 2B39A 1RCVD 4K2LA 2R6GA 4DXGA 1V1OA 3MXNA 1NR4A 4KY5A 2F03A 2DY7A 2JXMB 3MXGA 5DM63 2K28A 2K33A 4ZRZA 3P1HA 1FGBD 4F87A 5C4JB 1EWHA 3JAML 2KUMA 1I4RA 1R4QB 1U4MA 1HA5A 2D62A 2LMCB 4TRDA 4ZK9B 1PMRA 1I6HB 2B8FA 2KECA 1CQVA 3G6JB 4I65A 3GTQB 1E2VA 1GUSA 4LJZC 1LV9A 4HAEA 5FO7B 2NZ1D 1A3TA 3PUVA 5IGEA 1VCIA 2JSOA 4A3GB 2PW5A 3RZDB 1GOZA 4DK1A 4IUPA 1NR2A 1E2WA 2F0JA 2G9HD 4DF7A 1K83B 2LKVA 3VR5A 3U9SA 5JVG3 4DNTB 3LX0A 1B50A 3C1FA 2WIIB 2EE1A 5CC4A 1PZID 3PMFA 1TKWB 2B63B 2F0SA 3KBXA 1J9OA 1G291 1B1ZA 1BUVT 2F1MA 2WAQB 5CV5A 4XT1B 4EQOA 3K5MA 1LTAD 1KTKA 2RKSA 3E6ZX 1EY6A 2SNMA 3QG1A 1BF4A 4IFDG 4KKTA 4B9XA 3KLSA 1ZKOA 3BVGA 2ENBA 3TP8A 5CGKA 3I72A 3MFGA 1BDOA 1W6JA 3PO2B 5C4ZA 3KLSX 1ILPA 4L63B 2EXZA 2AQ1B 2PNRC 1WTQA 4DAVA 1G2SA 1EQVA 3J81E 3J7YW 5M5XB 4ID6A 2IL8A 4QCLA 3E0JA 3JAME 4X3TA 3GTOB 2B2YC 1CZGA 1HQMC 3SR1A 3OWEB 5EKKA 1V8QA 4G4KA 4OL7A 1LTRD 4FXGC 3SDZA 1I4GA 1NUCA 4X3SA 4TSSA 1STNA 3T4AC 1A15A 1VMPA 2ZXOA 3ONAB 4ABNA 1II3A 1G2TA 3S2DB 3AU7A 4PMWA 5CORA 1H9KA 2XVSA 2WV6D 4NW2A 2K7VA 2PQEA 2KCNA 5C0XJ 4Q5VA 2FMMA 2C9OA 4DAYA 4EGVA 5G3LD 2BE5D 4M1UB 1U4LA 1ET6A 4B9WA 1AW7A 1EL0A 4BA2I 1HXYD 3MWYW 2PPBC 1KDBA 4A3DB 1B2TA 3NQTA 2B2UA 3S14B 3P75A 1PFBA 2E74C 1HFGA 1TU2B 1STBA 1O80A 3GTKB 1SBBB 3TMEA 1STGA 2AQ3B 1E0BA 3S1NB 2ZXPA 2NVQB 2B2WA 1XX8A 2F0PA 5DM73 5I6YA 3MHBA 2BDOA 3MVVA 1XTCD 4C3JG 4N9PA 3C3LA 2EJFC 1HPCA 3IFTA 3TP5A 5IIFA 5E4XA 4MN3A 1LABA 3HGBA 1ENFA 3OPOA 2ICIA 1DCZA 2L9HA 4KTAA 1YNJD 4RAUC 4IALA 4F88A 1Q1EA 5KNCA 4KJOA 1ENCA 2A6HC 4ULLA 3Q6SA 2L12A 4C56C 4KKUA 5C3XA 1CT1D 5HURA 5K36G 2J4XA 3DXJC 4QUCA 3OHXC 3MTSA 4KKSA 3QJYA 3TP7A 1DONA 1SSOA 2CQAA 2M9VA 2F0DA 4C2MB 2HDLA 5ISRA 3BS1A 1EY9A 3GD7A 1MGSA 4DXFA 3A8KE 4PMCA 4LAAA 1IL8A 2KEEA 3OSOA 2F0OA 4HTHA 4DAPA 1BXTA 4R9WA 4DFAA 1HQRD 4CHTB 1QILA 3FRPB 2RA4A 1DOMA 3RMHA 5CBEE 3DEOA 2EJMA 1HRJA 3M85A 1SJHD 1SYEA 2BA1A 3W2DA 1MI2A 1GHKA 2K03A 2EOTA 1SE2A 4ZKCB 3PV0A 4XTCS 1TWHB 2HQEA 3S1QB 1JOKA 3LWUA 1T5EA 2C5CA 3HG9A 4AYBB 3PUWA 1JE4A 1RTNA 4RKLA 1SYBA 3OIQA 2F0QA 2KJXA 1EQTA 1OXUA 3T53B 1PFMA 1IW7C 4CJ1B 2JEBI 3VYSA 2XWBB 2K01A 2R93B 2L0CA 5IGBA 1EOTA 2EY5A 4K14A 4A3KB 2TSSA 1KAAA 1LLRD 2L4NA 4KJNA 1YNJC 4DA2A 4Y7NB 4CBVA 3QWNA 2MGSA 4C1NK 1JOOA 5IODA 4A3IB 1H9SB 1TQOA 2E2JB 1ILQA 5EPLA 2R7ZB 3R93A 3W3AA 5ELCA 2FFKB 1OXSC 3LWEA 3MC0B 1RTOA 1LO5D 1H9SA 4DK0A 3DWQA 1I4HA 1VF5C 5G3LF 2LY7A 3SK5A 5I6WA 2NN6H 4H44C 3CRLC 2CVRA 1L0XB 3D8GA 3R2IA 1O7LA 3S9WA 1WTRA 1HCZA 1CTMA 4F7XA 4PMBA 5ELFA 1A3VA 3EFXD 4X3KA 1X3QA 2H1EA 3SVMA 1SFOB 1I4PA 1EZ8A 1SE3A 2KEDA 3TBIB 5C5LA 1D1KA 2EY1A 1ET9A 1I3QB 4EVOA 3I90A 2RDHA 2MHVA 1VMCA 3D3RA 4BY1B 1V43A 1LTID 3T56B 2F0TA 1D5MC 3J7AV 2JA8B 4CJ0B 1QWYA 1XXGA 4NKLA 1UAPA 3NBHA 3I70A 4H0LC 4IFDH 1KABA 3PIP3 1I50B 4F8MA 3K5LA 1MD2D 5KNBA 3QB3A 3R3OA 1EY4A 3CQZB 2BDNA 3OMCA 4FXKC 4QB4A 1GUWA 1AP0A 1HUMA 1BOSA 3K57A 3S1RB 1STHA 3T16A 2F0EA 2M2LA 4RGNA 2F0FA 4HCSA 5DNFA 4IFDI 5LL6S 1F77A 3HOUB 1IHZA 4K8JA 2E2HB 5CMDA 5D65A 2B2TA 4O42A 3BG3A 4HMIA 3WDNA 5C0XG 4PQXA 5FKAC 2KHSA 3SEBA 1GUTA 2A68D 2OXPA 2A69D 4R8NA 3H94A 2OT2A 4K5VA 3WOEA 3LNNA 1MSHA 5FOBB 2E76C 4IURA 3ITPA 1B3AA 3X3MA 3P20A 1SJED 4KK7A 3A8JE 1Y69U 5I9PA 2O2LD 1S5CD 2X6GA 1YNNC 1F9QA 5KRUA 3J7AF 1SEBD 5EQ0A 4Q0FA 4GZYC 3URYA 2NN6I 1ZYRD 2K5QA 3M7NA 2WKCA 1EU4A 2D9UA 3HEJA 1EY8A 4BBRB 3S15B 4IZ8A 4ZUIA 1S5BD 3U9OA 3BDCA 3D4RA 1V1PA 5EJWA 3NTIA 1TWFB 1TWGB 2SOBA 4N9TA 1ML0D 2NWGA 1H9JA 1WTXA 3GTMB 3D31A 3BVMA 4V0BA 4OGQC 1UUPA 1RODA 2A73B 4XQQA 3D6WA 4DU9A 3HOZB 2PZTA 4OIKA 1PLFA 3BYYB 1FNWA 2YYZA 1V1PB 2IX1A 2N55A 3V2TA 3VYUA 2K1BA 2XSCA 5EKLA 5I4DA 3L9AX 1AZQA 4FNFA 1TWCB 1PFNA 4C3HG 1F2YA 1QCBD 1ENAA 3NTKA 1GUGA 2A5HA 1Z6HA 2MP1A 1BO0A 2F0VA 4KY7A 3WOFA 4BY7B 2O4XA 1I4XA 1RDPD 3I8ZA 3G7LA 2B2TC 4C3IB 1EYDA 2IX3A 4YIJA 1TS2A 4KN4C 3J81L 4NMZA 3PO3B 2A6ED 2Z4IA 1SNOA 3O13A 1JCKB 1JWUD 5CV8A 1GJXA 2RVLA 2O5JC 2XNAC 1DOLA 4G57A 2E75C 1GXDC 1VF7A 4JK1C 5IT9E 3ZYYX 3GQBA 1RD9D 1I4QA 4KN7C 1IKLA 3SK4A 1IKMA 4RGMA 2NUCA 3MA2B 1WTOA 2AWNA 4PV1C 3S1MB 3K5NA 3J80E 2RDFA 3Q24A 2F0NA 3H3VC 1DD2A 3PIO3 4WJWA 5JPMC 2LS01 2EYFA 2IW3A 2B2YA 2RSOA 4A3JB 3RZOB 4OO1G 4K5WA 1JWSD 5C6AA 1CHQD 4RCOA 4EQNA 3R2TA 1JORA 1PTOD 3OIPA 2BCOA 3K7AB 1NSNS 2PYKA 3AB9A 2B2VC 2AUJD 1D2BA 3NP8A 5J39A 5K36H 1OXXK 3RD4A 2EYLA 3Q23A 1Y1VB 4IN3A 4EQPA 4HMJA 1B9NA 1FR3A 2K04A 1X32A 4IQZA 1ZYRC 1IYVA 4ILWA 2YU9B 3T13A 1BR9A 2J7ZA 3SK6A 1Y1WB 2JA5B 1LTTD 1GUOA 3HOVB 4IUNA 2NN6G 3TSSA 4RGTA 2WB1B 2O5IC 2BA0A 4C3JB 3FMCA 3OWFA 4FVMA 4J6HA 3FDTA 2SNSA 3SXHA 3NK9A 3A7AB 2BE5C 4RCNA 2IPKD 5CV6A 3K59A 1PRTF 2AQ2B 2K32A 1KDAA 3NSWA 3VYTA 4IFDJ 4NP5A 4ODGA 1EU3A 3KBGA 4XIGS 1K8OA 5C4XB 1QNKA 2CW0C 1BCPF 2B2WC 3EA6A 1F9PA 5COYA 5TSSA 1PXUA 2I46A 4XXEA 1DM0B 1IW7D 1K8MA 5IT9L 1CK1A 1QG7A 1SNQA 3DUZA 1DOKA 1RJTA 1XYIA 4A3EB 1S5DD 3HP3A 4CJ2C 3DEPA 5ELBA 3FPUB 3CKIB 1R4PB 1PDQA 3DWAA 3A8IE 5FO9B 3H91A 3CHBD 1JR0D 5CYUA 2FJ2A 3J80L 2RSNA 2NTTA 2A68C 3IL8A 2XIWA 3OMGA 1WVLA 2Z4HA 2HCCA 1PTOC 1D5ZC 5IOCA 1EWCA 1D1IA 2HDMA 3BDOA 5AFWA 4G7HC 1B4OA 2MUYA 3VR2A 2RBMA 5CBAE 4FXDA 3AMUA 1A2UA 4C1NI 1RKNA 2B2VA 2PO4A 1Y8NB 2FMCA 1F2MA 3N6RA 3I91A 2ZXRA 3ND9A 4XT3B 3TDQA 3L3OC 4FO2A 1SDFA 1G8ZD 5JVH3 5KGUA 1EY5A 1EIGA 5IGFA 3DMUA 1D6EC 2H4OA 2BOSA 5FLXL 5FK9C 4TQUS 3EROA 1A6XA 3TN2A 1BCPC 3Q0AA 5A2QL 3TZUA 4K6DA 1CQFA 3MXPA 1ONLA 4MHEA 3D4DA 5EGTA 3ND8A 1LTSD 3R8BA 3DM1A 4XQNA 1EIHA 1S4ZA 1PTOH 4M8AA 1EZ6A 2F0HA 1SNCA 2QKIC 5I9OA 2XRSD 3NE5B 1BQQT 5LHY1 4DN4M 3I3CA 4K8IA 3A55A 5EBDA 5CV9A 1J8IA 1Q1BA 4KY6A 4C3IG 1HTLD 1STEA 1PTOF 4K6LA 1NCVA 4NDXA 3KK7A 1PTOB 5D3DA 1BNZA 1EY0A 3VA7A 1L0YB 2L55A 2I07B 3SE0A 2G9DA 3QOJA 1PRTB 1HHVA 2KOLA 3DHQA 3IFDA 4RH6A 2IJ0A 1SE4A 2LFNA 4HSPA 1QJOA 4FF2A 1Q12A 2E2IB 3C1EA 2QF7A 1X3PA 2F3WA 2F0IA 3KLRA 3HZXA 5C4HA 2F0LA 4G7OC 1ESFA 4FF4A 2WP8J 4FP5D 2QDBA 2EPBA 1SNPA 1CI3M 1TIID 3VR3A 3GV3A 4BBSB 2A69C 5E3FA 1BCPB 3BYTB 5C3WA 4QF4A 3GTPB 2XRQD 4A3MB 1DYQA 1FYCA 4QMGA 1XWEA 2IWHA 4J8QA 5D14A 3T51B 3NHHA 2NVXB 2A6HD 2KVMA 4FF1A 4OO1H 1CZWA 4KHVA 2JP1A 5M5YB 4CKCA 5FLXE 5IGCA 1MBYA 4V190 2EY2A 3OW7A 1DZ1A 1C48A 2R61A 1EYAA 2L1BA 5T1GA 1TVXA 2WINB 4KD3A 3S17B 5I2XA 3C46A 2OEOA 5CV7A 1Z7TA 2XN9C 2GA4B 2K6AA 3V96A 1OO9B 5BN4A 2NB0A 2Z8LA 3KUPA 1I6VC 1HTPA 1O7YA 3FPPA 3HKZB 1ZEQX 3MFYA 4XDXA 2A6EC 1JB3A 5JJZA 4KV6A 4J1MA 3PUZA 5K5PA 2K5DA 1LTBD 1M4VA 1RF2D 3D4WA 1JOQA 3GTJB 3K6OA 4FF3A 1T5XD 4RHSA 3PUYA 3A7LA 4QIWB 4HCEA 4A3FB 3VR4A 2OF1A 5ELDA 4R8IA 2CHBD 2Y0SB 3OOCA 4WRDA 3CU7A 4L6TB 5CV4A 1AN8A 5M3MB 1OXVA 2JA7B 4L8JA 4BA1I 3QO2A 4MIUA 1E2ZA 1STYA 1STAA 1U4PA 5JOBA 3X3NA 2K05A 4XYOA 3C2PA 1TS5A 3FVQA 1C4QA 2J0TD 2EYJA 1FNVA 1Y8OB 1QB5D 1QE6A 5M9OA 1S5FD 1B9MA 2JA6B 3HOXB 2E2DC 1KNEA 5KEEA 2FINB 2EZVA 4ZUJA 1DJRD 4LK1C 1HFNA 3H0GB 5JEAG 5JPNC 5DAUA 1A2TA 3NWTA 5M5WB 2X69A 4CKEA 5CR3A 1KLUD 3H09A 5NUCA 1CM9A 1TY0A 2V4DA 1DXMA 2ICEC 3SK8A 1F9RA 1LT5D 1WD0A 2WKDA 4K5XA 1GUNA 4IUVA 3RUZA 2A74C 2CW0D 1YNND 3GV6A 4A93B 4HR7B 4OIJA 5C44B 1SNMA 4XQJA 4WORA 2Q8RE 3RLFA 1LT3D 4XYQA 4ZQ3A 1G6ZA 3NXWA 2IT1A 5J22A 4U68A 1GHJA 3VA5A 5KYIA 1QNUA 3NPPA 1PYWD 3I4LA 1S5ED 3EVQA 1VDZA 1SYGA 3E5SA 2F0KA 2NTSA 5C0XH 2QILA 4IUQA 4QUFA 2VB3X 4CGYB 1BBXC 4H7BA 4A3BB 2EYPA 2VXWA 1IYUA 3Q22A 3PUXA 4ZKBB 4BS9A 5J1ZA 5KNDA 4JBWA 1SYFA 2EYHA 3P7JA 4CKBA 1C8CA 3TZDA 3FEWX 3GTGB 1TS4A 2X6LA 1SYCA 3MAQA 5F2DA 1LTGD 1JICA 5KYLA 4P2CB 4KMUC 2TMPA 1TR5A 3NBIA 3I73A 2JYOA 1PZKD 4U673 2KCCA 1MSGA 3K58A 2KQ3A 2ID0A 2RDGA 4BWGB 1CA6A 5KIXA 4RFBA 1LACA 1G91A 3M7GA 3K5OA 1EYCA 5D3IB 4ZLTF 1O7ZA 2R92B 1JQYD 3I4MB 3M4YA 2EDGA 4HN7A 1RHPA 2D2CC 2MPMA 3QOLA 1SMYC 2RQXA 3EQLC 1WD1A 1HA6A 3QIAA 1Q3LA 2PCFB 2F0WA 2KA7A 2PW7A 3A54A 1PRTD 2HUGA 1EY7A 1SMYD 4ME5A 1ZXTA 4RWSC 1EEID 1HUNA 2K5WA 3NQIA 2WACA 1AFPA 4RGOS 4TKOB 3SHLA 1Z47A 2AWOA 3HS0C 3GP7A 3IAYA 3GO5A 4KI0A 3N52A 2DNEA 1Q8IA 3HOYB 1ESRA 1M8AA 5C0XI 3D6CA 1TS3A 4IUTA 2HCIA 1H9MA 2F0GA 1F2LA 4S3SA 4X3UA 3MXUA 1B53A 3CRKC 4E6IA 2F0UA 3MEHA 2NBFA 5E4WC 2F3VA 3A56A 4ZAIA 3BVZA 2JEAI 4C3HB 2DY8A 2F0MA 2NVTB 2DN8A 2L5TA 1JWMD 3MZ5A 1D5XC 1F2ZA 1UEAB 3NTHA 2FHTA 1KNAA 5EPKA 3UI2A 1A3UA 2VNUD 3S16B 1BCPD 1LT4D 3FKIB 3K0YA 1PZJD 3H6MA 5JAVA 4RA8A 1TWAB 5FO8B 1TT2A 1Q90A 2QCPX 3TP6A 2EVBA 2B2UC 1EEFD 5T1IA 2N88A 4G7ZC 4UAIA 1FNUA 1SNDA 2NYZD 3EJIA 1WCMB 1H9RA 5HGTA 1EFID 2NVYB 1QOHA 4WFN3 5M3FB 2EYMA 1CFMA 4DGZA 1AEXA 4RHRA 3DWPA 1WTWA 3L7ZC 1SAPA 1KLGD 2D5DA 4FYDA 2XWJB 4B08A 1B44D 3ERQA 5A2QE 1LT6D 4IUUA 1SYDA 2PZWA 5IGDA 1U9RA 4HSVA 1JC7A 2JE6I 1FD7D 1CA5A 4I7ZC 3M3YB 5C3EB 4DNRB 4PNYA 5EPJA 3IKJA 4LMQD 1ICWA 1O78A 5JEAJ 4O1NA 5LL6X 2EYOA 1OXTA 2Q8TA 5EBCA 5ELEA 5BN5A 3HRZC 4HEDA 4Z9CB 1F9SA 1PRTC 4OHJA 3HOWB 2IX0A 1WTVA 2SDFA 5IGGA 2Q8IB 4ZYSA 2EJGC 4H13C 1Y8PB 3BZDB 4KHZA 2PMZB 1SXTA 3KF8A 5A35A 1CHPD 1NAPA 5EKIA 2VB2X 5E1FA 1R9TB 2MJ8A 2L11A 2QEJC 3V05A 3GTLB 4KD4A 2Z1CA 4UDUC 3M4OB 5C5MA 1KDCA 2EY6A 3VYRA 1TY2A 1UNSA 5JEAH 2PZUA 4K2KA 4OO1I 1W6KA 2DNCA 2M00A 3NUCA 2R3ZA 2ZT9C 3S2HB 3I4NB 3VR6A 3NWSA 3BDLA 5I2YA 2VUMB 2SEBD 3F2UA 1WTPA 2B8GA 2F4IA 5BN3A 4RKBA 1U4RA 1AZPA 5DEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TKW B;  3MXU A;  4KKU A;  1Q1B A;  1YNJ C;  2AUK A;  1B9N A;  1FR3 A;  3CRK C;  4IQZ A;  5K36 G;  4LK1 C;  3DXJ C;  1ZYR C;  4KN4 C;  1H9K A;  1YNN C;  1IYV A;  4KMU C;  4H0L C;  5JEA G;  2JE6 I;  4KKS A;  2R6G A;  3QJY A;  4IFD H;  2A6E D;  2K7V A;  1Z7T A;  4I7Z C;  3I73 A;  4GZY C;  1GUO A;  2JEA I;  3BDO A;  4G7H C;  2NN6 G;  3VR2 A;  1H9S B;  1G29 1;  2NN6 I;  2KCC A;  1GJX A;  5KNB A;  2DN8 A;  2O5I C;  2L5T A;  5BN4 A;  2BE5 D;  2V4D A;  1DXM A;  2BA0 A;  4DNR B;  3M7N A;  3VA7 A;  3FMC A;  2F1M A;  2O5J C;  3GD7 A;  3IKJ A;  3W3A A;  2JXM B;  3SE0 A;  4BA2 I;  1O78 A;  1GUN A;  1Y8N B;  2E75 C;  1LAC A;  1I6V C;  1OXS C;  1HTP A;  3FPP A;  2K33 A;  3A8K E;  1VF7 A;  4JK1 C;  1OXT A;  3A7A B;  3D4R A;  3MFY A;  3N6R A;  2BE5 C;  2A6E C;  3GQB A;  4RCN A;  5BN5 A;  4KN7 C;  4HR7 B;  2PPB C;  1EWH A;  1QJO A;  3PUZ A;  3ND9 A;  3QG1 A;  1H9J A;  1Q12 A;  1H9S A;  2QF7 A;  3D31 A;  2K32 A;  4DK0 A;  1VF5 C;  4IFD G;  3KLR A;  3M4Y A;  4KKT A;  2EDG A;  4OGQ C;  4PV1 C;  1ZKO A;  3RLF A;  2NN6 H;  2E74 C;  2D2C C;  4H44 C;  2Q8I B;  3CRL C;  1Q90 A;  4XIG S;  1SMY C;  2D62 A;  1TU2 B;  2LMC B;  2EJG C;  2IT1 A;  1K8O A;  3I72 A;  2EJM A;  3PUY A;  1Y8P B;  3A7L A;  4H13 C;  4G7O C;  2EVB A;  1PMR A;  1GHJ A;  4KHZ A;  4TQU S;  3M85 A;  2CW0 C;  4G7Z C;  1A6X A;  2B8F A;  1BDO A;  3EQL C;  5A35 A;  2BA1 A;  3VR4 A;  1GHK A;  1CI3 M;  3TZU A;  3QIA A;  1O7L A;  2YYZ A;  3PV0 A;  3I4L A;  4XTC S;  3VR3 A;  2PCF B;  3A8J E;  1Y69 U;  2KA7 A;  1E2V A;  2A69 C;  1VDZ A;  1H9R A;  1GUS A;  1HCZ A;  4LJZ C;  1DD2 A;  1ONL A;  3BG3 A;  1CTM A;  3LWU A;  3OOC A;  3WDN A;  5C0X G;  1T5E A;  3PUW A;  3ND8 A;  2PNR C;  1OXV A;  1FYC A;  2BDO A;  4L8J A;  3PUV A;  1IW7 D;  1K8M A;  4BA1 I;  1CFM A;  1GUT A;  1VCI A;  5C0X H;  1E2Z A;  2A68 D;  2A69 D;  4OO1 G;  3L7Z C;  2EJF C;  4DK1 A;  1GUG A;  1HPC A;  3T51 B;  3IFT A;  1Z6H A;  5JEA H;  1HQM C;  3H94 A;  4TKO B;  1E2W A;  1OXU A;  2DNC A;  3T53 B;  2AWO A;  2D5D A;  1LAB A;  3HGB A;  2A6H D;  3LNN A;  1V8Q A;  2ZT9 C;  4OO1 H;  2E76 C;  1IYU A;  3VR6 A;  1IW7 C;  4KI0 A;  3SDZ A;  3OPO A;  1DCZ A;  2JEB I;  3NE5 B;  3A8I E;  3PUX A;  2DNE A;  3VR5 A;  3U9S A;  3OW7 A;  3AB9 A;  4DNT B;  5KND A;  1Q1E A;  2AUJ D;  1V43 A;  3P20 A;  2B8G A;  1Y8O B;  1H9M A;  4JBW A;  5BN3 A;  5KNC A;  5K36 H;  3T56 B;  1OXX K;  2A6H C;  1B9M A;  2A68 C; 
#chains in the Genus database with same CATH topology
 5GQO A;  4LF6 Q;  2AUK A;  2B39 A;  3CP0 A;  3I2Z A;  1RCV D;  4KHP L;  4K2L A;  2F52 A;  2R6G A;  4DXG A;  1VQC A;  1V1O A;  3DLL A;  3CCQ A;  3MXN A;  1KD1 C;  1FJG Q;  1N32 Q;  1XJV A;  1NR4 A;  4KY5 A;  4YHH Q;  4R4T A;  2F03 A;  2KCT A;  2DY7 A;  2JXM B;  3GTQ H;  3MXG A;  5DM6 3;  4R4C A;  1NTG A;  2K28 A;  2K33 A;  2I5M X;  4ZRZ A;  1E24 A;  3F2C A;  1EIF A;  2QEX A;  1PH3 A;  4B3R Q;  1EIY B;  3P1H A;  1FGB D;  4F87 A;  5C4J B;  1EWH A;  3JAM L;  3HOY G;  4DR6 Q;  2KUM A;  2UUA L;  1VQL A;  1I4R A;  1R4Q B;  3CCJ A;  1GD7 A;  1U4M A;  1HA5 A;  3I4M G;  4JC0 A;  2D62 A;  2LMC B;  4TRD A;  4ZK9 B;  1Q46 A;  4A3M H;  2R93 H;  1PMR A;  1I6H B;  4OWX B;  2XGT A;  2B8F A;  4YCW A;  2KEC A;  1W3S A;  1CQV A;  1CKO A;  1SRO A;  3G6J B;  4LF4 L;  4AYB G;  4GNX B;  4I65 A;  3CC7 A;  3GTQ B;  1E2V A;  1GUS A;  4LJZ C;  2LXK A;  1LV9 A;  4HAE A;  5FO7 B;  2N78 A;  2NZ1 D;  1A3T A;  3PUV A;  5IGE A;  3HOV G;  2LSS A;  4A93 H;  1VCI A;  2JSO A;  3SGI A;  5C44 H;  1RL2 A;  5IYC H;  4A3G B;  1K9M C;  2PW5 A;  3RZD B;  1GOZ A;  4DK1 A;  2Z9H A;  1I50 H;  2HQL A;  4IUP A;  4CDF C;  1NR2 A;  2I5H A;  1E2W A;  1HR0 L;  3CCM A;  2CQO A;  2Z6K C;  2HHH L;  2F0J A;  2G9H D;  4R1J A;  4DF7 A;  1K83 B;  1Q7Y C;  3HKS A;  2LKV A;  3T1H Q;  3VR5 A;  3U9S A;  5JVG 3;  1PH7 A;  4DNT B;  3LX0 A;  1GM5 A;  1B50 A;  3C1F A;  3HOZ H;  2WII B;  4MTK A;  2EE1 A;  3M3Y H;  5CC4 A;  1PZI D;  4YY3 Q;  4JI8 L;  4YWM A;  3PMF A;  3UDF A;  1TKW B;  3A0J A;  4P73 A;  1K0R A;  2B63 B;  4NPS A;  2F0S A;  4JI2 Q;  3KBX A;  2G5D A;  1J9O A;  2DJF C;  3RNU A;  5C4X G;  1G29 1;  1GKH A;  1B1Z A;  1BUV T;  1YJW A;  2F1M A;  2WAQ B;  5CV5 A;  4XT1 B;  2FXQ A;  4EQO A;  3I4O A;  3K5M A;  1PH6 A;  1LTA D;  1KTK A;  2RKS A;  1IBK Q;  4IOC A;  4DR2 Q;  2E2H H;  3E6Z X;  3HKZ E;  1EY6 A;  2SNM A;  3QG1 A;  1BF4 A;  2B63 H;  4IFD G;  3Q8D A;  4A3M G;  1Q8K A;  1NJI C;  4KKT A;  4LF5 L;  4B9X A;  3KLS A;  1ZKO A;  3BVG A;  2ENB A;  2V1C C;  3TP8 A;  5CGK A;  1CUK A;  3I72 A;  3MFG A;  4JI0 L;  1BDO A;  2UUC Q;  4JOI C;  1W6J A;  3PO2 B;  4A3L G;  2A8V A;  1HNW L;  5C4Z A;  1PFS A;  3KLS X;  1AE3 A;  2YTV A;  1ILP A;  4L63 B;  2EXZ A;  2AQ1 B;  2PNR C;  1WTQ A;  4DAV A;  1G2S A;  1EQV A;  2PNH A;  3J81 E;  3J7Y W;  5M5X B;  4ID6 A;  2B63 G;  2IL8 A;  4QCL A;  2Y0S G;  4GLX A;  3E0J A;  1X3F A;  3JAM E;  4X3T A;  2R92 H;  3GTO B;  2MO1 A;  2B2Y C;  1CZG A;  1HQM C;  3SR1 A;  3OWE B;  3G48 A;  5EKK A;  1J6Q A;  2A19 A;  4DV6 L;  3OW2 A;  1V8Q A;  4OL7 A;  1SN8 A;  1LTR D;  4FXG C;  4G4K A;  3SDZ A;  3PSI A;  1N34 L;  1NMG A;  1I4G A;  3GTK H;  2EQS A;  1NUC A;  3NEN A;  4X3S A;  4TSS A;  1STN A;  3T4A C;  4GOP A;  4BBR G;  1VQI A;  1A15 A;  1VMP A;  5M5W H;  5IYD H;  4DV2 L;  3PQI A;  2ZXO A;  3ONA B;  4ABN A;  4GS3 A;  1II3 A;  2NVY H;  1G2T A;  3S2D B;  1XNR Q;  1G51 A;  3AU7 A;  4PMW A;  5COR A;  5LMN Q;  1QUQ A;  1H9K A;  1N36 Q;  2XVS A;  2WV6 D;  4NW2 A;  5IWA Q;  4DUZ Q;  2OTJ A;  2K7V A;  1K3B C;  2PQE A;  2KCN A;  2JK8 A;  2JA7 H;  5C0X J;  4A75 A;  5FJ8 H;  4Q5V A;  2FMM A;  2C9O A;  4DAY A;  2UUA Q;  4EGV A;  4R4O A;  5G3L D;  3T1Y L;  2BE5 D;  4B3T L;  4M1U B;  1U4L A;  1ET6 A;  4B9W A;  1AW7 A;  3AQQ A;  1LTL A;  1EL0 A;  4BA2 I;  4X64 Q;  4DV1 Q;  2K4K A;  4HID A;  1HNZ L;  1I6H H;  1HXY D;  2K75 A;  2UXB Q;  3MWY W;  2PPB C;  1KDB A;  4A3D B;  1B2T A;  3NQT A;  3HFZ B;  1XTD A;  4B3M L;  2B2U A;  4DAY B;  1Y1V H;  3S14 B;  3P75 A;  1PFB A;  2E74 C;  2NZH A;  1HFG A;  3UDG A;  1TU2 B;  2R7D A;  3UDX A;  1STB A;  1O80 A;  3GTK B;  1KHI A;  5C3E H;  1SBB B;  3TME A;  1STG A;  1N8R C;  1HH2 P;  2AQ3 B;  1E0B A;  3S1N B;  2ZXP A;  4UP7 A;  2NVQ B;  4DKA C;  3RR5 A;  2B2W A;  1XX8 A;  2F0P A;  5DM7 3;  5I6Y A;  3MHB A;  1K83 H;  2BDO A;  1OTC A;  3MVV A;  1XTC D;  4C3J G;  1KQS A;  4N9P A;  3OTO L;  2PI2 E;  2BH2 A;  3C3L A;  1YBY A;  3W5O A;  2EJF C;  1HPC A;  3IFT A;  3TP5 A;  5IIF A;  5E4X A;  4LFC L;  4DK3 C;  4TVA B;  4MN3 A;  1LAB A;  3HGB A;  1ENF A;  4BY7 H;  3OPO A;  2ICI A;  1DCZ A;  2L9H A;  4KTA A;  1YNJ D;  4RAU C;  1A8V A;  2DJG C;  3H0G H;  4APV A;  5FLM H;  3I4N G;  4IAL A;  4F88 A;  1Q1E A;  5KNC A;  4KJO A;  2E8G A;  1ENC A;  4MNO A;  2A6H C;  3E0E A;  4ULL A;  3Q6S A;  2L12 A;  1A0I A;  4R4I A;  4C56 C;  4KKU A;  4A76 A;  5C3X A;  1CT1 D;  5HUR A;  5K36 G;  1QVG A;  2J4X A;  3DXJ C;  4LF9 L;  1D8L A;  4QUC A;  5FJ8 G;  4JYA L;  3OHX C;  3MTS A;  4KKS A;  3QJY A;  3TP7 A;  1MKH A;  1DON A;  1SRU A;  1SSO A;  2ZJQ A;  2CQA A;  2M9V A;  2F0D A;  4C2M B;  1GO3 E;  1UWV A;  1KAW A;  2HDL A;  5ISR A;  3BS1 A;  4A3D G;  2UXC L;  2AMC B;  1EY9 A;  3GD7 A;  4LWC A;  2ATW A;  1VQK A;  2B3G A;  1MGS A;  4DXF A;  4O0A A;  1K0S A;  3A8K E;  4PMC A;  4LAA A;  1YI2 A;  1HR0 W;  1IL8 A;  2KEE A;  3OSO A;  3RZO H;  1YJ9 A;  2DGY A;  2F0O A;  4DR1 Q;  4HTH A;  4DAP A;  1BXT A;  1SLJ A;  3CQZ H;  1LM0 A;  4R9W A;  4K0K Q;  4DFA A;  1HQR D;  3GTG H;  4CHT B;  1QIL A;  3FRP B;  2RA4 A;  1DOM A;  3RMH A;  1PHJ A;  2Z6B A;  5CBE E;  3EBE A;  4GKJ L;  3DEO A;  2EJM A;  1HRJ A;  1X56 A;  1Y14 B;  3M85 A;  1SJH D;  1SYE A;  3K8A A;  2E5L Q;  4LNQ A;  2BA1 A;  5HY6 A;  1MI2 A;  3W2D A;  2K03 A;  1GHK A;  2EOT A;  5M3F G;  1SE2 A;  4ZKC B;  3PV0 A;  4XTC S;  1MJC A;  1TWH B;  2HQE A;  3S1Q B;  3J7Z C;  1JOK A;  3LWU A;  3J81 j;  1T5E A;  2C5C A;  3HG9 A;  4AYB B;  3PUW A;  4OXP A;  1JE4 A;  3KYH C;  1RTN A;  3CCS A;  1BKB A;  4RKL A;  3UDI A;  4GLV B;  4QQB X;  1SYB A;  3OIQ A;  3KOJ A;  4A3C G;  5GAG C;  4DV2 Q;  2F0Q A;  3HOW H;  4BY7 G;  2KJX A;  3HOV H;  1EQT A;  1OXU A;  3T53 B;  1IL2 A;  3I4N H;  4X62 L;  1PFM A;  4GOP C;  1IW7 C;  4CJ1 B;  1QVC A;  2JEB I;  3VYS A;  2XWB B;  2K01 A;  3BJU A;  2R93 B;  4DAM A;  4DUZ L;  3BZK A;  2L0C A;  5IGB A;  1EOT A;  2EY5 A;  1PV4 A;  4OX9 Q;  4K14 A;  4A3K B;  2TSS A;  1KAA A;  1LLR D;  2L4N A;  4KJN A;  1YNJ C;  4DA2 A;  4Y7N B;  4CBV A;  4JI6 L;  1L2F A;  3QWN A;  5M5Y H;  4X64 L;  4OON A;  3UE0 A;  1IXR A;  1YVC A;  2MGS A;  4C1N K;  4LUO A;  3L2P A;  1CKM A;  1JOO A;  5IOD A;  4A3I B;  3AFQ A;  3F1Z A;  3U50 C;  4DNI A;  2UXB L;  1H9S B;  1JJC B;  4IO9 A;  1TQO A;  2E2J B;  1VQA A;  3RN5 A;  1ILQ A;  5EPL A;  2R7Z B;  3R93 A;  3W3A A;  5ELC A;  1S40 A;  3S14 H;  1KIX A;  4LFA Q;  1X65 A;  2FFK B;  1XMQ Q;  1MHW C;  1OXS C;  3LWE A;  1S72 A;  3MC0 B;  4A3J H;  1RTO A;  1LO5 D;  1H9S A;  4DK0 A;  3DWQ A;  1I4H A;  1VF5 C;  5G3L F;  2LY7 A;  3SK5 A;  3JAM c;  4OWW B;  5I6W A;  1KL9 A;  2NN6 H;  4H44 C;  4RG1 A;  3CRL C;  2CVR A;  3KDF A;  1L0X B;  4JPB W;  3D8G A;  3I56 A;  4A3D H;  3R2I A;  3G6E A;  4JBK A;  1O7L A;  3S9W A;  1B70 B;  1HCZ A;  1WTR A;  3TQY A;  5IT9 c;  1EUJ A;  1CTM A;  2JA6 G;  4P75 A;  4F7X A;  4PMB A;  3EN2 A;  5ELF A;  1A3V A;  3EFX D;  4X65 L;  4X3K A;  4HJ8 A;  1X3Q A;  2H1E A;  4CDE C;  3SVM A;  1SE8 A;  4A3F G;  1SFO B;  1I4P A;  1EZ8 A;  1SE3 A;  1VQ6 A;  4JI5 L;  2KED A;  3NBH B;  4HIM A;  3TBI B;  3J80 c;  1V9P A;  5C5L A;  1D1K A;  2EY1 A;  1ET9 A;  1I3Q B;  4EVO A;  4L5S A;  1TWC H;  3I90 A;  2OQK A;  2RDH A;  2MHV A;  1VMC A;  3D3R A;  4EX5 A;  3HOU G;  1HZ9 A;  2ZTD A;  2ZJP A;  4BY1 B;  1V43 A;  1LTI D;  3T56 B;  2F0T A;  4DR4 Q;  1D5M C;  3J7A V;  4C2M H;  2JA8 B;  3FHW A;  4CJ0 B;  1QWY A;  1XXG A;  4NKL A;  2WB1 G;  4P72 A;  4LFB L;  1UAP A;  3NBH A;  3I70 A;  4H0L C;  4DV3 L;  4IFD H;  1Q86 C;  4A3F H;  1B8A A;  4PG3 A;  1KAB A;  3PIP 3;  1I50 B;  4F8M A;  3K5L A;  1MD2 D;  4WJ4 A;  5KNB A;  3QB3 A;  3R3O A;  4DV7 L;  2OQ0 A;  2RHS B;  4YWL A;  4QY7 A;  3CCU A;  4DR5 L;  1EY4 A;  2MO0 A;  2P5Z X;  3CQZ B;  2BDN A;  3OMC A;  1YZ6 A;  1J5E Q;  3HOZ G;  4DUY L;  3CW2 C;  4FXK C;  4QB4 A;  1GUW A;  1AP0 A;  4NXN Q;  1HUM A;  1BOS A;  3K57 A;  3S1R B;  3KJP A;  4PZ6 A;  1STH A;  3T16 A;  1JT8 A;  2KBN A;  3I4M H;  2VS1 A;  1X3G A;  1KC8 C;  1HZC A;  2F0E A;  4EQ5 A;  2M2L A;  1K73 C;  1VQG A;  2HD3 A;  4RGN A;  5LMU Q;  2F0F A;  4HCS A;  5DNF A;  1Y1V G;  4DR3 L;  1M1K C;  3S17 H;  5HGQ A;  4IFD I;  5LL6 S;  3CCE A;  1X3E A;  1F77 A;  3HOU B;  1IHZ A;  4K8J A;  2E2H B;  4DV4 L;  5CMD A;  4LF7 Q;  1VQJ A;  5D65 A;  2B2T A;  4O42 A;  4X62 Q;  1EQQ A;  3BG3 A;  4HMI A;  1Y1W G;  2RCN A;  3WDN A;  1O7I A;  5C0X G;  2JA5 G;  4PQX A;  4A4I A;  1C0A A;  3I55 A;  5FKA C;  2KHS A;  3SEB A;  1GUT A;  2ZM6 Q;  2A68 D;  2OXP A;  2A69 D;  4R8N A;  1W2B A;  2RHQ B;  3H94 A;  2OT2 A;  4DV0 L;  4K5V A;  3WOE A;  3LNN A;  1MSH A;  5FOB B;  2E76 C;  1A63 A;  4IUR A;  3CPF A;  3S15 H;  3ITP A;  3DM3 A;  4GKK L;  1B3A A;  4PZ7 A;  3U4Z A;  3CME A;  3X3M A;  3JAM i;  2GVB A;  3P20 A;  1SJE D;  4KK7 A;  3A8J E;  1Y69 U;  5FLM G;  3LGJ A;  5I9P A;  3OTO Q;  4A3B H;  2ZTC A;  3E9H A;  4JI3 Q;  2O2L D;  1S5C D;  3KJO A;  2X6G A;  1YNN C;  3K7A H;  1F9Q A;  5KRU A;  3J7A F;  4LFC Q;  1SEB D;  5EQ0 A;  4Q0F A;  4GZY C;  2CWA A;  3URY A;  2NVT H;  4DK6 C;  1TXY A;  2NN6 I;  3UE1 A;  1ZYR D;  2K5Q A;  3BZC A;  2ALY B;  3M7N A;  2WKC A;  1EU4 A;  2D9U A;  3HEJ A;  1EY8 A;  3ULJ A;  4BBR B;  3S15 B;  4IZ8 A;  4IJH A;  4ZUI A;  4A3G G;  1S5B D;  5EAY A;  1YEZ A;  2ZJR A;  1JB7 A;  1N9W A;  3U9O A;  3BDC A;  3D4R A;  2QGQ A;  3CCR A;  1V1P A;  5EJW A;  3NTI A;  4N9T A;  4OEL B;  1TWF B;  1TWG B;  2SOB A;  1ML0 D;  3TRE A;  2NWG A;  4C3J H;  1H9J A;  1WTX A;  4IJL A;  4UPA A;  3GTM B;  3D31 A;  1L1O C;  1YHB A;  3BVM A;  1VQ4 A;  2KHI A;  5GAE C;  4V0B A;  3PCO B;  2AHO B;  4JCV E;  4OGQ C;  1UUP A;  1ROD A;  2A73 B;  4XQQ A;  3D6W A;  4DU9 A;  3HOZ B;  2I5L X;  2UXC Q;  1VQH A;  2PZT A;  4OIK A;  4AYB E;  3J81 c;  3PO3 G;  2D0O A;  1UE6 A;  1PLF A;  3BYY B;  1FNW A;  4JI4 Q;  2YYZ A;  1V1P B;  2IX1 A;  3S1N H;  2N55 A;  4AQY Q;  3V2T A;  4BXX H;  3VYU A;  2K1B A;  5L37 A;  2XSC A;  5EKL A;  5I4D A;  3L9A X;  1AZQ A;  5AJ3 L;  3U4V A;  4FNF A;  1PH8 A;  1TWC B;  1PFN A;  4C3H G;  4LF6 L;  1F2Y A;  5H1S E;  1QCB D;  1TWG H;  3G4S A;  1EFW A;  1ENA A;  3NTK A;  4ALP A;  2D0P A;  1GUG A;  2A5H A;  1Z6H A;  2MP1 A;  1BO0 A;  2F0V A;  5C4J H;  4KY7 A;  2K14 A;  5BR8 Q;  4BY1 G;  3WOF A;  2JA9 A;  1MJE A;  4BY7 B;  4JI1 L;  4BBR H;  2O4X A;  1I4X A;  4LFB Q;  1RDP D;  3AFP A;  3I8Z A;  5IYB G;  3G7L A;  1U0L A;  1T9H A;  2B2T C;  2N49 A;  4C3I B;  3W1G A;  2E2I H;  1EYD A;  4DR5 Q;  2IX3 A;  4YIJ A;  1J5E L;  4DUY Q;  1TS2 A;  1NNX A;  4KN4 C;  3J81 L;  4NMZ A;  3PO3 B;  1U5K A;  2A6E D;  2Z4I A;  1SNO A;  1P16 A;  3ULL A;  1WCM G;  3O13 A;  1JCK B;  1JWU D;  2RCF A;  5CV8 A;  4A3G H;  4IPD A;  3H0G G;  1GJX A;  2RVL A;  3S1M H;  2O5J C;  4OX9 L;  2XNA C;  2Q2I A;  1DOL A;  4G57 A;  2E75 C;  3IRB A;  1GXD C;  1IBM Q;  1SMX A;  1VF7 A;  4JK1 C;  3E3X A;  5IT9 E;  3ZYY X;  3GQB A;  1RD9 D;  1I4Q A;  4KN7 C;  3PIO A;  1IKL A;  5GAD C;  3SK4 A;  1IKM A;  4LW1 A;  4RGM A;  2NUC A;  3PIP A;  3MA2 B;  1WTO A;  4KLK A;  2AWN A;  3HOY H;  4PV1 C;  3S1M B;  3PO3 H;  1VQP A;  3K5N A;  5IP9 G;  2HHH Q;  2K50 A;  3J80 E;  2RDF A;  3S16 H;  1G6P A;  1V1Q A;  3Q24 A;  1XMQ L;  2Q2H A;  2R93 G;  4GNX A;  2RF4 A;  3CXC A;  2R7Z H;  2F0N A;  3H3V C;  1DD2 A;  3PIO 3;  4A3K G;  4WJW A;  5JPM C;  3HOX G;  2LS0 1;  2EYF A;  2IW3 A;  2B2Y A;  1I3Q H;  2RSO A;  4ME3 A;  4A3J B;  1PH9 A;  3RZO B;  4OO1 G;  1YNX A;  4K5W A;  1JWS D;  4HJ9 A;  3G71 A;  4IPC A;  5C6A A;  3MEF A;  1CHQ D;  4RCO A;  3CMA A;  3R2T A;  4EQN A;  1JOR A;  2LXJ A;  2VQF L;  1PTO D;  2PI2 A;  3OIP A;  2BCO A;  5GRO A;  1UE1 A;  2QA4 A;  4JI7 L;  3K7A B;  1VQ9 A;  5M3F H;  1NSN S;  3PF5 A;  2PYK A;  2YTY A;  3AB9 A;  2B2V C;  3KF6 B;  2AUJ D;  1D2B A;  1NMF A;  2BH8 A;  3NP8 A;  5J39 A;  5K36 H;  4OWT B;  1OXX K;  5ELO A;  3RD4 A;  2EYL A;  3Q23 A;  1KRS A;  1Y1V B;  4IN3 A;  2K5V A;  4UHV A;  2GN5 A;  4HMJ A;  3ZJY C;  4EQP A;  1YJN A;  1B9N A;  1FR3 A;  2K04 A;  1X32 A;  4IQZ A;  4X65 Q;  1M90 C;  1ZYR C;  2WFW A;  1JMC A;  1IYV A;  4ILW A;  3HOW G;  2YU9 B;  3T13 A;  4DPG A;  1IZ6 A;  1BR9 A;  2J7Z A;  3SK6 A;  4JI5 Q;  1Y1W B;  2JA5 B;  1LTT D;  1WOC A;  1GUO A;  3HOV B;  4IUN A;  2NN6 G;  3KF6 A;  3TSS A;  4RGT A;  2R7F A;  1HZA A;  2WB1 B;  2O5I C;  2MQH A;  2BA0 A;  4C3J B;  3FMC A;  3OWF A;  4JI0 Q;  2IHF A;  4FVM A;  4J6H A;  4MTN A;  3FDT A;  2SNS A;  3SXH A;  2ZTE A;  3NK9 A;  3A7A B;  2BE5 C;  4RCN A;  2IPK D;  5CV6 A;  1FJG L;  1N32 L;  3K59 A;  1PRT F;  4LF4 Q;  2AQ2 B;  3E9I A;  3F2B A;  2K32 A;  2UUB L;  4L5R C;  2CWP A;  1KDA A;  2NZO A;  3NSW A;  2KEN A;  4YCV A;  3VYT A;  4IFD J;  4NP5 A;  4ODG A;  1EU3 A;  3KBG A;  4XIG S;  1K8O A;  5C4X B;  4NXM L;  2Z0S A;  1K8A C;  1QNK A;  1XPR A;  2R7Z G;  2CW0 C;  1X6O A;  3KF8 B;  4B3R L;  1BCP F;  2B2W C;  2CH4 W;  5M3M G;  2HT1 A;  1K3R A;  1CSP A;  3EA6 A;  3GTO H;  1F9P A;  5COY A;  4DR6 L;  5TSS A;  1PXU A;  2I46 A;  1E1O A;  1FVI A;  3BU2 A;  4XXE A;  1DM0 B;  1IW7 D;  1K8M A;  5IT9 L;  3ULP A;  1EOV A;  2VZA A;  1CK1 A;  1XNR L;  4GN5 A;  1QG7 A;  4LF8 Q;  1SNQ A;  1NE3 A;  1DOK A;  1RJT A;  3DUZ A;  4YY3 L;  1XYI A;  4A3E B;  1S5D D;  3HP3 A;  1BBU A;  4CJ2 C;  3DEP A;  5ELB A;  1VS0 A;  1WI5 A;  3FPU B;  3CKI B;  1R4P B;  1PDQ A;  4JI2 L;  3DWA A;  3A8I E;  5FO9 B;  3H91 A;  1VQB A;  3CHB D;  3T1Y Q;  1JR0 D;  4QGU A;  5CYU A;  3M4O H;  2FJ2 A;  3J80 L;  2RSN A;  4GOP B;  2F3I A;  2WAQ E;  1YIJ A;  5FLX c;  2NTT A;  2A68 C;  3IL8 A;  4DR7 Q;  2XIW A;  3OMG A;  1WVL A;  1HNZ Q;  1IBL L;  3S2H H;  2Z4H A;  2HCC A;  1PTO C;  1D5Z C;  4JBM A;  1QUQ B;  3PGZ A;  5IOC A;  4DV0 Q;  1EWC A;  3D0F A;  1D1I A;  2HDM A;  1WFQ A;  3BDO A;  1B4O A;  2MUY A;  1LUZ A;  5AFW A;  3VR2 A;  4G7H C;  2RBM A;  4JI8 Q;  4GN4 B;  5CBA E;  3S1Q H;  2A1A A;  2AKW B;  4FXD A;  2JA7 G;  3AMU A;  1A2U A;  4C1N I;  1RKN A;  2B2V A;  2PO4 A;  4HIO A;  1Y8N B;  4IPG A;  2FMC A;  3H15 A;  3TS2 A;  1F2M A;  3S1R H;  3N6R A;  3I91 A;  1E22 A;  1S3O A;  1HNW Q;  2ZXR A;  3ND9 A;  4XT3 B;  3TDQ A;  3L3O C;  4FO2 A;  1SDF A;  1G8Z D;  4CDD C;  5KGU A;  5JVH 3;  1EY5 A;  1YIT A;  3KLW A;  1EIG A;  5IGF A;  4X6A H;  3DMU A;  5M3M H;  1D6E C;  1VQO A;  2H4O A;  2BOS A;  5FLX L;  5FK9 C;  4TQU S;  3ERO A;  1A6X A;  3TN2 A;  1BCP C;  3Q0A A;  4DR2 L;  2ES2 A;  5A2Q L;  1NY4 A;  3TZU A;  4K6D A;  1CQF A;  1Z9F A;  3MXP A;  1ONL A;  4JI7 Q;  4UY8 C;  4MHE A;  2JJQ A;  3D4D A;  5EGT A;  2N8N A;  3K7U C;  3L0O A;  4JOI A;  3K81 C;  3ND8 A;  1LTS D;  3R8B A;  3TRZ A;  3DM1 A;  4XQN A;  2UUC L;  1EIH A;  1S4Z A;  1PTO H;  1R9T H;  4M8A A;  1XPO A;  1EZ6 A;  4QL5 A;  2F0H A;  3HOU H;  1SNC A;  4R4Q A;  2QKI C;  5I9O A;  2XRS D;  4IPH A;  1N36 L;  3NE5 B;  4A3L H;  1BQQ T;  5LHY 1;  1YHQ A;  4DN4 M;  3I3C A;  4B3S L;  3K80 C;  3ERS X;  4K8I A;  4HIK A;  1Y1W H;  2JA5 H;  3A55 A;  3F2D A;  2CFM A;  3JC6 6;  5EBD A;  1ASY A;  5CV9 A;  1J8I A;  1Q1B A;  2H5X A;  2PMZ E;  4P71 A;  4KY6 A;  4C3I G;  3S2D H;  4BBS G;  1HTL D;  1STE A;  3NEL A;  3A5Z B;  1PTO F;  1VQ8 A;  3TEH B;  2MNA A;  1N34 Q;  4K6L A;  1NCV A;  4NDX A;  4DR1 L;  1HR0 Q;  1VQE A;  5BR8 L;  4GN3 B;  2N3S A;  3KK7 A;  4K0K L;  1PTO B;  1MIU A;  4MZ9 A;  5D3D A;  1BNZ A;  1EY0 A;  3A74 A;  4B3M Q;  1B7Y B;  3VA7 A;  1L0Y B;  2L55 A;  2I07 B;  3SE0 A;  2QW7 A;  5LMN L;  2G9D A;  3QOJ A;  1PRT B;  1HHV A;  4NXM Q;  2KOL A;  4DV5 Q;  3ER0 A;  3DHQ A;  3IFD A;  4RH6 A;  2IJ0 A;  4C3I H;  1SE4 A;  2LFN A;  2IHE A;  4HSP A;  1QJO A;  4FF2 A;  1Q12 A;  2E2I B;  3C1E A;  2QF7 A;  1X3P A;  3M9B A;  3GTP H;  2F3W A;  2F0I A;  3KLR A;  3HZX A;  5C4H A;  4DV1 L;  2F0L A;  4JW0 A;  4G7O C;  1UE5 A;  1ESF A;  2CH4 A;  2WP8 J;  2KHJ A;  2Y0S E;  4FF4 A;  4FP5 D;  2CKZ B;  2QDB A;  2EPB A;  4LF8 L;  1SNP A;  1CI3 M;  1TII D;  5IP7 H;  3VR3 A;  1HJP A;  3RLN A;  3CD6 A;  3GV3 A;  4BBS B;  2A69 C;  5E3F A;  1IBK L;  4JV5 L;  1SFO H;  1BCP B;  3BYT B;  4P74 A;  5C3W A;  4QF4 A;  3U58 A;  3GTP B;  2XRQ D;  4A3M B;  1DYQ A;  1FYC A;  3TS0 A;  4QMG A;  1PVO A;  1XWE A;  2IWH A;  4AIM A;  5IE8 A;  4LF5 Q;  4JI6 Q;  4J8Q A;  4DR7 L;  5D14 A;  3T51 B;  3NHH A;  1EYG A;  2NVX B;  2A6H D;  2KVM A;  2EXD A;  4FF1 A;  4OO1 H;  1CZW A;  3GTJ H;  4KHV A;  1L0W A;  4Y52 H;  2JP1 A;  5M5Y B;  3W1B A;  4CKC A;  5FLX E;  5IGC A;  1MBY A;  4V19 0;  2EY2 A;  3OW7 A;  3RZD H;  4A3B G;  1DZ1 A;  4H02 A;  4A3I H;  2UXD Q;  2YTX A;  1C48 A;  4BBS H;  2HIX A;  2R61 A;  1ICF B;  1EYA A;  2L1B A;  2F4V Q;  5T1G A;  1TVX A;  1SR3 A;  1CKN A;  2WIN B;  4KD3 A;  3S17 B;  5I2X A;  3C46 A;  2OEO A;  5CV7 A;  4IOA A;  2JA8 G;  2VQF Q;  4DV6 Q;  1Z7T A;  1QVF A;  1RIP A;  2XN9 C;  4I7A A;  2K5H A;  2GA4 B;  3AYH B;  3QR8 A;  2K6A A;  2MFI A;  2YV5 A;  3V96 A;  1OO9 B;  5BN4 A;  1N33 Q;  2UU9 Q;  2NB0 A;  4HJ5 A;  1CKN B;  2Z8L A;  3KUP A;  4JYA Q;  1I6V C;  1HTP A;  1O7Y A;  3B6Y A;  3FPP A;  3HKZ B;  1I94 Q;  1GVP A;  1NBW A;  1ZEQ X;  1Q82 C;  3MFY A;  4XDX A;  2A6E C;  1JB3 A;  5JJZ A;  4KV6 A;  3J81 i;  1HZB A;  4J1M A;  3PUZ A;  3S24 A;  5K5P A;  5IWA L;  5ELN A;  2K5D A;  2XTI A;  1LTB D;  4A3J G;  5C3E G;  1M4V A;  1RF2 D;  3D4W A;  1JOQ A;  2YU9 H;  3GTJ B;  3K6O A;  4FF3 A;  1T5X D;  3NEM A;  2VL6 A;  4RHS A;  4GNX C;  4B3T Q;  1L1O B;  3RN2 A;  3PUY A;  3A7L A;  4QIW B;  2OCE A;  4HCE A;  2VW9 A;  1QZH A;  4A3F B;  3VR4 A;  2OF1 A;  3KDF B;  1K8G A;  5ELD A;  4R8I A;  2VUM G;  2CHB D;  2Y0S B;  1TWA H;  3OOC A;  2K5N A;  4WRD A;  3CC2 A;  3CU7 A;  4L6T B;  5CV4 A;  1AN8 A;  5M3M B;  1OXV A;  2JA7 B;  4GKJ Q;  4L8J A;  4BA1 I;  2JA6 H;  3QO2 A;  4MIU A;  1E2Z A;  1L1O A;  1STY A;  4BY1 H;  2E5L L;  1STA A;  5LMN W;  1U4P A;  5JOB A;  3X3N A;  4A93 G;  1A62 A;  5IP9 H;  4POG A;  2K05 A;  2JQO A;  4A3E G;  4XYO A;  1WYD A;  3C2P A;  1TS5 A;  1YHA A;  3FVQ A;  1AH9 A;  1C4Q A;  4ZCK A;  2L15 A;  4DV7 Q;  5JJL A;  2J0T D;  2EYJ A;  1FNV A;  1Y8O B;  1QB5 D;  1QE6 A;  4NB3 A;  5M9O A;  3GTM H;  4A3K H;  1S5F D;  1B9M A;  2JA6 B;  3HOX B;  1D7Q A;  2E2D C;  1KNE A;  4YCU A;  3A5U A;  5KEE A;  2IY5 B;  4HJ7 A;  2FIN B;  2EZV A;  4ZUJ A;  1DJR D;  4LK1 C;  1HFN A;  3K0X A;  3H0G B;  4LFA L;  5JEA G;  5JPN C;  5DAU A;  1A2T A;  1EQR A;  1BBW A;  3NWT A;  5M5W B;  2X69 A;  4CKE A;  5M5X H;  5CR3 A;  1KLU D;  3H09 A;  4JBJ A;  2VQE L;  5NUC A;  1CM9 A;  1TY0 A;  5LMU L;  2V4D A;  1DXM A;  2ICE C;  3SK8 A;  1VQN A;  1F9R A;  1LT5 D;  1WD0 A;  2WKD A;  4K5X A;  4RMF A;  3STB C;  1GUN A;  4IUV A;  3RUZ A;  2A74 C;  2CW0 D;  1YNN D;  3GV6 A;  1IBL Q;  4LF7 L;  4LF9 Q;  3OYY A;  4A93 B;  4HR7 B;  4OIJ A;  5C44 B;  1SNM A;  4XQJ A;  4WOR A;  2Q8R E;  4L5Q A;  4LUV A;  4JG2 A;  3RLF A;  1LT3 D;  2HIV A;  2WB1 E;  4XYQ A;  2QDL A;  4ZQ3 A;  1G6Z A;  3NXW A;  4CDC C;  2IT1 A;  5J22 A;  4U68 A;  2VUM H;  1GHJ A;  3VA5 A;  5KYI A;  1QNU A;  3HKZ G;  3NPP A;  1X54 A;  1PYW D;  4POF A;  3I4L A;  3HOX H;  1S5E D;  3EVQ A;  1VDZ A;  4GLA C;  2NVX H;  1SYG A;  3E5S A;  3CPW A;  2F0K A;  2NTS A;  5GAH C;  3CC4 A;  5C0X H;  2UXD L;  2QIL A;  4IUQ A;  4QUF A;  2VB3 X;  4CGY B;  4A3E H;  2ASB A;  1BBX C;  4H7B A;  2F4V L;  2CCZ A;  4A3B B;  2EYP A;  2VXW A;  1IYU A;  1E3P A;  2R92 G;  2GVA A;  4PZ8 A;  5C4X H;  3Q22 A;  1X9N A;  4DV3 Q;  5JJI A;  3PUX A;  4ZKB B;  4BS9 A;  3J80 i;  5J1Z A;  3VDY A;  1PH4 A;  1XNQ Q;  5KND A;  4JBW A;  1SYF A;  2B29 A;  2EYH A;  3P7J A;  3KFU A;  3H3V H;  4CKB A;  1C8C A;  3TZD A;  3FEW X;  3GTG B;  3RLO A;  1TS4 A;  2X6L A;  1SYC A;  3MAQ A;  5C44 G;  5F2D A;  1LTG D;  1JIC A;  5KYL A;  4P2C B;  4JVZ A;  4KMU C;  1B3Q A;  2VY3 A;  2TMP A;  1I94 L;  3ICE A;  2OTL A;  1TR5 A;  3NBI A;  3I73 A;  1PH1 A;  2JYO A;  1VQ5 A;  1PYB A;  1PZK D;  1ASZ A;  4U67 3;  2KCC A;  3PF4 A;  1MSG A;  3K58 A;  2Q2U A;  2KQ3 A;  4B3S Q;  2ID0 A;  2RDG A;  4N8F A;  4BWG B;  4AH6 A;  1CA6 A;  1WTH A;  5KIX A;  3CF5 A;  1K28 A;  4RFB A;  1LAC A;  1G91 A;  4DR3 Q;  5E7N A;  3M7G A;  1PA6 A;  3K5O A;  1EYC A;  5D3I B;  4ZLT F;  1O7Z A;  2E2J H;  2R92 B;  1JQY D;  3I4M B;  3M4Y A;  2EDG A;  1E1T A;  4HN7 A;  1RHP A;  1HNX L;  2D2C C;  3QOL A;  2MPM A;  1SMY C;  2RQX A;  3EQL C;  1WD1 A;  1HA6 A;  3QIA A;  1Q3L A;  2PCF B;  2F0W A;  2KA7 A;  2PW7 A;  3A54 A;  4DV5 L;  3T1H L;  1PRT D;  2HUG A;  1EY7 A;  1SMY D;  2DUD A;  5IP7 G;  2C35 B;  4ME5 A;  3H3V I;  1ZXT A;  4GKK Q;  4RWS C;  1FGU A;  1EEI D;  1HUN A;  2K5W A;  1I5F A;  3NQI A;  1PYS B;  3FKI G;  2WAC A;  1AFP A;  3EIV A;  4C3H H;  1TWH H;  4RGO S;  4TKO B;  3SHL A;  1P8L A;  1Z47 A;  2AWO A;  3HS0 C;  3I7F A;  1KRT A;  3GP7 A;  1KXL A;  3IAY A;  3GO5 A;  4KI0 A;  4O2D A;  2EIF A;  3N52 A;  3GTL H;  2DNE A;  1Q8I A;  2JN4 A;  3HOY B;  1ESR A;  1M8A A;  5C0X I;  4JV5 Q;  3D6C A;  1TS3 A;  4IUT A;  2HCI A;  2ZM6 L;  1H9M A;  2F0G A;  1JJG A;  1F2L A;  4S3S A;  4X66 L;  3J7A 5;  1XMO L;  4X3U A;  5J3B A;  3MXU A;  1B53 A;  3M4Q A;  3CRK C;  3AEV A;  4A3I G;  1E7Z A;  4E6I A;  2F0U A;  3MEH A;  2NBF A;  1AE2 A;  5E4W C;  2F3V A;  3A56 A;  1UEB A;  4ZAI A;  3CAM A;  3BVZ A;  2JEA I;  4C3H B;  2DY8 A;  1UE7 A;  2F0M A;  2NVT B;  2DN8 A;  2JA8 H;  2L5T A;  2I0Q A;  1C7Y A;  1JWM D;  3MZ5 A;  4JI3 L;  1D5X C;  1F2Z A;  4UP9 A;  1UEA B;  4KHP Q;  5IYD G;  4DR4 L;  3NTH A;  4OEM B;  2FHT A;  1KNA A;  2K52 A;  1C9O A;  5EPK A;  3UI2 A;  1A3U A;  2VNU D;  1QZG A;  3S16 B;  4N8X 1;  4YHH L;  4AQY L;  1BCP D;  1LT4 D;  3FKI B;  3K0Y A;  1PZJ D;  1PH2 A;  3H6M A;  5JAV A;  4RA8 A;  1TWA B;  5FO8 B;  3FP9 A;  5AJ3 Q;  5DLQ E;  1TT2 A;  1Q90 A;  2QCP X;  1N33 L;  3TP6 A;  2UU9 L;  2EVB A;  2B2U C;  1EEF D;  5T1I A;  2N88 A;  4G7Z C;  1WJJ A;  4UAI A;  1FNU A;  1SND A;  4WJ3 M;  4LUZ A;  3WWV A;  1X55 A;  2NYZ D;  1BVS A;  3EJI A;  1WCM B;  1H9R A;  4NXN L;  5HGT A;  1IYJ B;  4JI1 Q;  1EFI D;  2NVY B;  3FKI H;  4QIW E;  1QOH A;  4WFN 3;  5M3F B;  2EYM A;  1CFM A;  4DGZ A;  1XNQ L;  1AEX A;  2WAQ G;  4RHR A;  3DWP A;  1WTW A;  3L7Z C;  4JI4 L;  1SAP A;  1KLG D;  2D5D A;  1JJ2 A;  2PQA A;  4FYD A;  2XWJ B;  1WCM H;  1CSQ A;  4B08 A;  1B44 D;  4DV4 Q;  2Z6K A;  3ERQ A;  3GDE A;  1VQM A;  1JE5 A;  4BXX G;  1XPU A;  1Q81 C;  5A2Q E;  1LT6 D;  4IUU A;  3CCL A;  1SYD A;  1PH5 A;  5JJK A;  2PZW A;  5IGD A;  1U9R A;  2PQA B;  4HSV A;  1JC7 A;  1VQ7 A;  2JE6 I;  1FD7 D;  1CA5 A;  4I7Z C;  2UUB Q;  3M3Y B;  2OWO A;  5C3E B;  4DNR B;  4UP8 A;  4PNY A;  5EPJ A;  3IKJ A;  4HJA A;  1LYL A;  4LMQ D;  1ICW A;  1HNX Q;  1O78 A;  4FDB A;  5JEA J;  4O1N A;  5LL6 X;  1H95 A;  2EYO A;  1OXT A;  2Q8T A;  5EBC A;  5ELE A;  5BN5 A;  3HRZ C;  4HED A;  3PO2 H;  4Z9C B;  1F9S A;  1PRT C;  4J15 A;  5IY0 A;  4OHJ A;  3STB D;  3HOW B;  2IX0 A;  1WTV A;  2SDF A;  4A3C H;  5IGG A;  2VQE Q;  3CCV A;  2Q8I B;  4ZYS A;  2EJG C;  1IBM L;  4H13 C;  1Y8P B;  3BZD B;  4KHZ A;  2PMZ B;  1SXT A;  3KF8 A;  1TWF H;  5A35 A;  1CHP D;  1NAP A;  5EKI A;  2Q2T A;  2VB2 X;  5E1F A;  1R9T B;  2MJ8 A;  2L11 A;  2QEJ C;  3V05 A;  4Y7N H;  3PO2 G;  3GTL B;  4KD4 A;  1DGS A;  2Z1C A;  4UDU C;  3M4O B;  5C5M A;  1KDC A;  2EY6 A;  3VYR A;  4X66 Q;  1TY2 A;  1UNS A;  5JEA H;  4YWK A;  1XMO Q;  2KCM A;  2PZU A;  1EWI A;  4K2K A;  4OO1 I;  4QJF A;  5IYC G;  1W6K A;  2DNC A;  2M00 A;  2NVQ H;  3NUC A;  5IYB H;  2R3Z A;  2ZT9 C;  3S2H B;  3I4N B;  1VQD A;  3VR6 A;  3NWS A;  3F8T A;  3BDL A;  4L5T A;  5I2Y A;  1FL0 A;  3MXN B;  2VUM B;  2SEB D;  3F2U A;  1VQF A;  3M4P A;  1WTP A;  2B8G A;  2F4I A;  5BN3 A;  4RKB A;  1U4R A;  1AZP A;  5DEH A; 
#chains in the Genus database with same CATH homology
 2AUK A;  2B39 A;  1RCV D;  4K2L A;  2R6G A;  4DXG A;  1V1O A;  3MXN A;  1NR4 A;  4KY5 A;  2F03 A;  2DY7 A;  2JXM B;  3MXG A;  5DM6 3;  2K28 A;  2K33 A;  4ZRZ A;  3P1H A;  1FGB D;  4F87 A;  5C4J B;  1EWH A;  3JAM L;  2KUM A;  1I4R A;  1R4Q B;  1U4M A;  1HA5 A;  2D62 A;  2LMC B;  4TRD A;  4ZK9 B;  1PMR A;  1I6H B;  2B8F A;  2KEC A;  1CQV A;  3G6J B;  4I65 A;  3GTQ B;  1E2V A;  1GUS A;  4LJZ C;  1LV9 A;  4HAE A;  5FO7 B;  2NZ1 D;  1A3T A;  3PUV A;  5IGE A;  1VCI A;  2JSO A;  4A3G B;  2PW5 A;  3RZD B;  1GOZ A;  4DK1 A;  4IUP A;  1NR2 A;  1E2W A;  2F0J A;  2G9H D;  4DF7 A;  1K83 B;  2LKV A;  3VR5 A;  3U9S A;  5JVG 3;  4DNT B;  3LX0 A;  1B50 A;  3C1F A;  2WII B;  2EE1 A;  5CC4 A;  1PZI D;  3PMF A;  1TKW B;  2B63 B;  2F0S A;  3KBX A;  1J9O A;  1G29 1;  1B1Z A;  1BUV T;  2F1M A;  2WAQ B;  5CV5 A;  4XT1 B;  4EQO A;  3K5M A;  1LTA D;  1KTK A;  2RKS A;  3E6Z X;  1EY6 A;  2SNM A;  3QG1 A;  1BF4 A;  4IFD G;  4KKT A;  4B9X A;  3KLS A;  1ZKO A;  3BVG A;  2ENB A;  3TP8 A;  5CGK A;  3I72 A;  3MFG A;  1BDO A;  1W6J A;  3PO2 B;  5C4Z A;  3KLS X;  1ILP A;  4L63 B;  2EXZ A;  2AQ1 B;  2PNR C;  1WTQ A;  4DAV A;  1G2S A;  1EQV A;  3J81 E;  3J7Y W;  5M5X B;  4ID6 A;  2IL8 A;  4QCL A;  3E0J A;  3JAM E;  4X3T A;  3GTO B;  2B2Y C;  1CZG A;  1HQM C;  3SR1 A;  3OWE B;  5EKK A;  1V8Q A;  4G4K A;  4OL7 A;  1LTR D;  4FXG C;  3SDZ A;  1I4G A;  1NUC A;  4X3S A;  4TSS A;  1STN A;  3T4A C;  1A15 A;  1VMP A;  2ZXO A;  3ONA B;  4ABN A;  1II3 A;  1G2T A;  3S2D B;  3AU7 A;  4PMW A;  5COR A;  1H9K A;  2XVS A;  2WV6 D;  4NW2 A;  2K7V A;  2PQE A;  2KCN A;  5C0X J;  4Q5V A;  2FMM A;  2C9O A;  4DAY A;  4EGV A;  5G3L D;  2BE5 D;  4M1U B;  1U4L A;  1ET6 A;  4B9W A;  1AW7 A;  1EL0 A;  4BA2 I;  1HXY D;  3MWY W;  2PPB C;  1KDB A;  4A3D B;  1B2T A;  3NQT A;  2B2U A;  3S14 B;  3P75 A;  1PFB A;  2E74 C;  1HFG A;  1TU2 B;  1STB A;  1O80 A;  3GTK B;  1SBB B;  3TME A;  1STG A;  2AQ3 B;  1E0B A;  3S1N B;  2ZXP A;  2NVQ B;  2B2W A;  1XX8 A;  2F0P A;  5DM7 3;  5I6Y A;  3MHB A;  2BDO A;  3MVV A;  1XTC D;  4C3J G;  4N9P A;  3C3L A;  2EJF C;  1HPC A;  3IFT A;  3TP5 A;  5IIF A;  5E4X A;  4MN3 A;  1LAB A;  3HGB A;  1ENF A;  3OPO A;  2ICI A;  1DCZ A;  2L9H A;  4KTA A;  1YNJ D;  4RAU C;  4IAL A;  4F88 A;  1Q1E A;  5KNC A;  4KJO A;  1ENC A;  2A6H C;  4ULL A;  3Q6S A;  2L12 A;  4C56 C;  4KKU A;  5C3X A;  1CT1 D;  5HUR A;  5K36 G;  2J4X A;  3DXJ C;  4QUC A;  3OHX C;  3MTS A;  4KKS A;  3QJY A;  3TP7 A;  1DON A;  1SSO A;  2CQA A;  2M9V A;  2F0D A;  4C2M B;  2HDL A;  5ISR A;  3BS1 A;  1EY9 A;  3GD7 A;  1MGS A;  4DXF A;  3A8K E;  4PMC A;  4LAA A;  1IL8 A;  2KEE A;  3OSO A;  2F0O A;  4HTH A;  4DAP A;  1BXT A;  4R9W A;  4DFA A;  1HQR D;  4CHT B;  1QIL A;  3FRP B;  2RA4 A;  1DOM A;  3RMH A;  5CBE E;  3DEO A;  2EJM A;  1HRJ A;  3M85 A;  1SJH D;  1SYE A;  2BA1 A;  3W2D A;  1MI2 A;  1GHK A;  2K03 A;  2EOT A;  1SE2 A;  4ZKC B;  3PV0 A;  4XTC S;  1TWH B;  2HQE A;  3S1Q B;  1JOK A;  3LWU A;  1T5E A;  2C5C A;  3HG9 A;  4AYB B;  3PUW A;  1JE4 A;  1RTN A;  4RKL A;  1SYB A;  3OIQ A;  2F0Q A;  2KJX A;  1EQT A;  1OXU A;  3T53 B;  1PFM A;  1IW7 C;  4CJ1 B;  2JEB I;  3VYS A;  2XWB B;  2K01 A;  2R93 B;  2L0C A;  5IGB A;  1EOT A;  2EY5 A;  4K14 A;  4A3K B;  2TSS A;  1KAA A;  1LLR D;  2L4N A;  4KJN A;  1YNJ C;  4DA2 A;  4Y7N B;  4CBV A;  3QWN A;  2MGS A;  4C1N K;  1JOO A;  5IOD A;  4A3I B;  1H9S B;  1TQO A;  2E2J B;  1ILQ A;  5EPL A;  2R7Z B;  3R93 A;  3W3A A;  5ELC A;  2FFK B;  1OXS C;  3LWE A;  3MC0 B;  1RTO A;  1LO5 D;  1H9S A;  4DK0 A;  3DWQ A;  1I4H A;  1VF5 C;  5G3L F;  2LY7 A;  3SK5 A;  5I6W A;  2NN6 H;  4H44 C;  3CRL C;  2CVR A;  1L0X B;  3D8G A;  3R2I A;  1O7L A;  3S9W A;  1WTR A;  1HCZ A;  1CTM A;  4F7X A;  4PMB A;  5ELF A;  1A3V A;  3EFX D;  4X3K A;  1X3Q A;  2H1E A;  3SVM A;  1SFO B;  1I4P A;  1EZ8 A;  1SE3 A;  2KED A;  3TBI B;  5C5L A;  1D1K A;  2EY1 A;  1ET9 A;  1I3Q B;  4EVO A;  3I90 A;  2RDH A;  2MHV A;  1VMC A;  3D3R A;  4BY1 B;  1V43 A;  1LTI D;  3T56 B;  2F0T A;  1D5M C;  3J7A V;  2JA8 B;  4CJ0 B;  1QWY A;  1XXG A;  4NKL A;  1UAP A;  3NBH A;  3I70 A;  4H0L C;  4IFD H;  1KAB A;  3PIP 3;  1I50 B;  4F8M A;  3K5L A;  1MD2 D;  5KNB A;  3QB3 A;  3R3O A;  1EY4 A;  3CQZ B;  2BDN A;  3OMC A;  4FXK C;  4QB4 A;  1GUW A;  1AP0 A;  1HUM A;  1BOS A;  3K57 A;  3S1R B;  1STH A;  3T16 A;  2F0E A;  2M2L A;  4RGN A;  2F0F A;  4HCS A;  5DNF A;  4IFD I;  5LL6 S;  1F77 A;  3HOU B;  1IHZ A;  4K8J A;  2E2H B;  5CMD A;  5D65 A;  2B2T A;  4O42 A;  3BG3 A;  4HMI A;  3WDN A;  5C0X G;  4PQX A;  5FKA C;  2KHS A;  3SEB A;  1GUT A;  2A68 D;  2OXP A;  2A69 D;  4R8N A;  3H94 A;  2OT2 A;  4K5V A;  3WOE A;  3LNN A;  1MSH A;  5FOB B;  2E76 C;  4IUR A;  3ITP A;  1B3A A;  3X3M A;  3P20 A;  1SJE D;  4KK7 A;  3A8J E;  1Y69 U;  5I9P A;  2O2L D;  1S5C D;  2X6G A;  1YNN C;  1F9Q A;  5KRU A;  3J7A F;  1SEB D;  5EQ0 A;  4Q0F A;  4GZY C;  3URY A;  2NN6 I;  1ZYR D;  2K5Q A;  3M7N A;  2WKC A;  1EU4 A;  2D9U A;  3HEJ A;  1EY8 A;  4BBR B;  3S15 B;  4IZ8 A;  4ZUI A;  1S5B D;  3U9O A;  3BDC A;  3D4R A;  1V1P A;  5EJW A;  3NTI A;  1TWF B;  1TWG B;  2SOB A;  4N9T A;  1ML0 D;  2NWG A;  1H9J A;  1WTX A;  3GTM B;  3D31 A;  3BVM A;  4V0B A;  4OGQ C;  1UUP A;  1ROD A;  2A73 B;  4XQQ A;  3D6W A;  4DU9 A;  3HOZ B;  2PZT A;  4OIK A;  1PLF A;  3BYY B;  1FNW A;  2YYZ A;  1V1P B;  2IX1 A;  2N55 A;  3V2T A;  3VYU A;  2K1B A;  2XSC A;  5EKL A;  5I4D A;  3L9A X;  1AZQ A;  4FNF A;  1TWC B;  1PFN A;  4C3H G;  1F2Y A;  1QCB D;  1ENA A;  3NTK A;  1GUG A;  2A5H A;  1Z6H A;  2MP1 A;  1BO0 A;  2F0V A;  4KY7 A;  3WOF A;  4BY7 B;  2O4X A;  1I4X A;  1RDP D;  3I8Z A;  3G7L A;  2B2T C;  4C3I B;  1EYD A;  2IX3 A;  4YIJ A;  1TS2 A;  4KN4 C;  3J81 L;  4NMZ A;  3PO3 B;  2A6E D;  2Z4I A;  1SNO A;  3O13 A;  1JCK B;  1JWU D;  5CV8 A;  1GJX A;  2RVL A;  2O5J C;  2XNA C;  1DOL A;  4G57 A;  2E75 C;  1GXD C;  1VF7 A;  4JK1 C;  5IT9 E;  3ZYY X;  3GQB A;  1RD9 D;  1I4Q A;  4KN7 C;  1IKL A;  3SK4 A;  1IKM A;  4RGM A;  2NUC A;  3MA2 B;  1WTO A;  2AWN A;  4PV1 C;  3S1M B;  3K5N A;  3J80 E;  2RDF A;  3Q24 A;  2F0N A;  3H3V C;  1DD2 A;  3PIO 3;  4WJW A;  5JPM C;  2LS0 1;  2EYF A;  2IW3 A;  2B2Y A;  2RSO A;  4A3J B;  3RZO B;  4OO1 G;  4K5W A;  1JWS D;  5C6A A;  1CHQ D;  4RCO A;  4EQN A;  3R2T A;  1JOR A;  1PTO D;  3OIP A;  2BCO A;  3K7A B;  1NSN S;  2PYK A;  3AB9 A;  2B2V C;  2AUJ D;  1D2B A;  3NP8 A;  5J39 A;  5K36 H;  1OXX K;  3RD4 A;  2EYL A;  3Q23 A;  1Y1V B;  4IN3 A;  4EQP A;  4HMJ A;  1B9N A;  1FR3 A;  2K04 A;  1X32 A;  4IQZ A;  1ZYR C;  1IYV A;  4ILW A;  2YU9 B;  3T13 A;  1BR9 A;  2J7Z A;  3SK6 A;  1Y1W B;  2JA5 B;  1LTT D;  1GUO A;  3HOV B;  4IUN A;  2NN6 G;  3TSS A;  4RGT A;  2WB1 B;  2O5I C;  2BA0 A;  4C3J B;  3FMC A;  3OWF A;  4FVM A;  4J6H A;  3FDT A;  2SNS A;  3SXH A;  3NK9 A;  3A7A B;  2BE5 C;  4RCN A;  2IPK D;  5CV6 A;  3K59 A;  1PRT F;  2AQ2 B;  2K32 A;  1KDA A;  3NSW A;  3VYT A;  4IFD J;  4NP5 A;  4ODG A;  1EU3 A;  3KBG A;  4XIG S;  1K8O A;  5C4X B;  1QNK A;  2CW0 C;  1BCP F;  2B2W C;  3EA6 A;  1F9P A;  5COY A;  5TSS A;  1PXU A;  2I46 A;  4XXE A;  1DM0 B;  1IW7 D;  1K8M A;  5IT9 L;  1CK1 A;  1QG7 A;  1SNQ A;  3DUZ A;  1DOK A;  1RJT A;  1XYI A;  4A3E B;  1S5D D;  3HP3 A;  4CJ2 C;  3DEP A;  5ELB A;  3FPU B;  3CKI B;  1R4P B;  1PDQ A;  3DWA A;  3A8I E;  5FO9 B;  3H91 A;  3CHB D;  1JR0 D;  5CYU A;  2FJ2 A;  3J80 L;  2RSN A;  2NTT A;  2A68 C;  3IL8 A;  2XIW A;  3OMG A;  1WVL A;  2Z4H A;  2HCC A;  1PTO C;  1D5Z C;  5IOC A;  1EWC A;  1D1I A;  2HDM A;  3BDO A;  5AFW A;  4G7H C;  1B4O A;  2MUY A;  3VR2 A;  2RBM A;  5CBA E;  4FXD A;  3AMU A;  1A2U A;  4C1N I;  1RKN A;  2B2V A;  2PO4 A;  1Y8N B;  2FMC A;  1F2M A;  3N6R A;  3I91 A;  2ZXR A;  3ND9 A;  4XT3 B;  3TDQ A;  3L3O C;  4FO2 A;  1SDF A;  1G8Z D;  5JVH 3;  5KGU A;  1EY5 A;  1EIG A;  5IGF A;  3DMU A;  1D6E C;  2H4O A;  2BOS A;  5FLX L;  5FK9 C;  4TQU S;  3ERO A;  1A6X A;  3TN2 A;  1BCP C;  3Q0A A;  5A2Q L;  3TZU A;  4K6D A;  1CQF A;  3MXP A;  1ONL A;  4MHE A;  3D4D A;  5EGT A;  3ND8 A;  1LTS D;  3R8B A;  3DM1 A;  4XQN A;  1EIH A;  1S4Z A;  1PTO H;  4M8A A;  1EZ6 A;  2F0H A;  1SNC A;  2QKI C;  5I9O A;  2XRS D;  3NE5 B;  1BQQ T;  5LHY 1;  4DN4 M;  3I3C A;  4K8I A;  3A55 A;  5EBD A;  5CV9 A;  1J8I A;  1Q1B A;  4KY6 A;  4C3I G;  1HTL D;  1STE A;  1PTO F;  4K6L A;  1NCV A;  4NDX A;  3KK7 A;  1PTO B;  5D3D A;  1BNZ A;  1EY0 A;  3VA7 A;  1L0Y B;  2L55 A;  2I07 B;  3SE0 A;  2G9D A;  3QOJ A;  1PRT B;  1HHV A;  2KOL A;  3DHQ A;  3IFD A;  4RH6 A;  2IJ0 A;  1SE4 A;  2LFN A;  4HSP A;  1QJO A;  4FF2 A;  1Q12 A;  2E2I B;  3C1E A;  2QF7 A;  1X3P A;  2F3W A;  2F0I A;  3KLR A;  3HZX A;  5C4H A;  2F0L A;  4G7O C;  1ESF A;  4FF4 A;  2WP8 J;  4FP5 D;  2QDB A;  2EPB A;  1SNP A;  1CI3 M;  1TII D;  3VR3 A;  3GV3 A;  4BBS B;  2A69 C;  5E3F A;  1BCP B;  3BYT B;  5C3W A;  4QF4 A;  3GTP B;  2XRQ D;  4A3M B;  1DYQ A;  1FYC A;  4QMG A;  1XWE A;  2IWH A;  4J8Q A;  5D14 A;  3T51 B;  3NHH A;  2NVX B;  2A6H D;  2KVM A;  4FF1 A;  4OO1 H;  1CZW A;  4KHV A;  2JP1 A;  5M5Y B;  4CKC A;  5FLX E;  5IGC A;  1MBY A;  4V19 0;  2EY2 A;  3OW7 A;  1DZ1 A;  1C48 A;  2R61 A;  1EYA A;  2L1B A;  5T1G A;  1TVX A;  2WIN B;  4KD3 A;  3S17 B;  5I2X A;  3C46 A;  2OEO A;  5CV7 A;  1Z7T A;  2XN9 C;  2GA4 B;  2K6A A;  3V96 A;  1OO9 B;  5BN4 A;  2NB0 A;  2Z8L A;  3KUP A;  1I6V C;  1HTP A;  1O7Y A;  3FPP A;  3HKZ B;  1ZEQ X;  3MFY A;  4XDX A;  2A6E C;  1JB3 A;  5JJZ A;  4KV6 A;  4J1M A;  3PUZ A;  5K5P A;  2K5D A;  1LTB D;  1M4V A;  1RF2 D;  3D4W A;  1JOQ A;  3GTJ B;  3K6O A;  4FF3 A;  1T5X D;  4RHS A;  3PUY A;  3A7L A;  4QIW B;  4HCE A;  4A3F B;  3VR4 A;  2OF1 A;  5ELD A;  4R8I A;  2CHB D;  2Y0S B;  3OOC A;  4WRD A;  3CU7 A;  4L6T B;  5CV4 A;  1AN8 A;  5M3M B;  1OXV A;  2JA7 B;  4L8J A;  4BA1 I;  3QO2 A;  4MIU A;  1E2Z A;  1STY A;  1STA A;  1U4P A;  5JOB A;  3X3N A;  2K05 A;  4XYO A;  3C2P A;  1TS5 A;  3FVQ A;  1C4Q A;  2J0T D;  2EYJ A;  1FNV A;  1Y8O B;  1QB5 D;  1QE6 A;  5M9O A;  1S5F D;  1B9M A;  2JA6 B;  3HOX B;  2E2D C;  1KNE A;  5KEE A;  2FIN B;  2EZV A;  4ZUJ A;  1DJR D;  4LK1 C;  1HFN A;  3H0G B;  5JEA G;  5JPN C;  5DAU A;  1A2T A;  3NWT A;  5M5W B;  2X69 A;  4CKE A;  5CR3 A;  1KLU D;  3H09 A;  5NUC A;  1CM9 A;  1TY0 A;  2V4D A;  1DXM A;  2ICE C;  3SK8 A;  1F9R A;  1LT5 D;  1WD0 A;  2WKD A;  4K5X A;  1GUN A;  4IUV A;  3RUZ A;  2A74 C;  2CW0 D;  1YNN D;  3GV6 A;  4A93 B;  4HR7 B;  4OIJ A;  5C44 B;  1SNM A;  4XQJ A;  4WOR A;  2Q8R E;  3RLF A;  1LT3 D;  4XYQ A;  4ZQ3 A;  1G6Z A;  3NXW A;  2IT1 A;  5J22 A;  4U68 A;  1GHJ A;  3VA5 A;  5KYI A;  1QNU A;  3NPP A;  1PYW D;  3I4L A;  1S5E D;  3EVQ A;  1VDZ A;  1SYG A;  3E5S A;  2F0K A;  2NTS A;  5C0X H;  2QIL A;  4IUQ A;  4QUF A;  2VB3 X;  4CGY B;  1BBX C;  4H7B A;  4A3B B;  2EYP A;  2VXW A;  1IYU A;  3Q22 A;  3PUX A;  4ZKB B;  4BS9 A;  5J1Z A;  5KND A;  4JBW A;  1SYF A;  2EYH A;  3P7J A;  4CKB A;  1C8C A;  3TZD A;  3FEW X;  3GTG B;  1TS4 A;  2X6L A;  1SYC A;  3MAQ A;  5F2D A;  1LTG D;  1JIC A;  5KYL A;  4P2C B;  4KMU C;  2TMP A;  1TR5 A;  3NBI A;  3I73 A;  2JYO A;  1PZK D;  4U67 3;  2KCC A;  1MSG A;  3K58 A;  2KQ3 A;  2ID0 A;  2RDG A;  4BWG B;  1CA6 A;  5KIX A;  4RFB A;  1LAC A;  1G91 A;  3M7G A;  3K5O A;  1EYC A;  5D3I B;  4ZLT F;  1O7Z A;  2R92 B;  1JQY D;  3I4M B;  3M4Y A;  2EDG A;  4HN7 A;  1RHP A;  2D2C C;  2MPM A;  3QOL A;  1SMY C;  2RQX A;  3EQL C;  1WD1 A;  1HA6 A;  3QIA A;  1Q3L A;  2PCF B;  2F0W A;  2KA7 A;  2PW7 A;  3A54 A;  1PRT D;  2HUG A;  1EY7 A;  1SMY D;  4ME5 A;  1ZXT A;  4RWS C;  1EEI D;  1HUN A;  2K5W A;  3NQI A;  2WAC A;  1AFP A;  4RGO S;  4TKO B;  3SHL A;  1Z47 A;  2AWO A;  3HS0 C;  3GP7 A;  3IAY A;  3GO5 A;  4KI0 A;  3N52 A;  2DNE A;  1Q8I A;  3HOY B;  1ESR A;  1M8A A;  5C0X I;  3D6C A;  1TS3 A;  4IUT A;  2HCI A;  1H9M A;  2F0G A;  1F2L A;  4S3S A;  4X3U A;  3MXU A;  1B53 A;  3CRK C;  4E6I A;  2F0U A;  3MEH A;  2NBF A;  5E4W C;  2F3V A;  3A56 A;  4ZAI A;  3BVZ A;  2JEA I;  4C3H B;  2DY8 A;  2F0M A;  2NVT B;  2DN8 A;  2L5T A;  1JWM D;  3MZ5 A;  1D5X C;  1F2Z A;  1UEA B;  3NTH A;  2FHT A;  1KNA A;  5EPK A;  3UI2 A;  1A3U A;  2VNU D;  3S16 B;  1BCP D;  1LT4 D;  3FKI B;  3K0Y A;  1PZJ D;  3H6M A;  5JAV A;  4RA8 A;  1TWA B;  5FO8 B;  1TT2 A;  1Q90 A;  2QCP X;  3TP6 A;  2EVB A;  2B2U C;  1EEF D;  5T1I A;  2N88 A;  4G7Z C;  4UAI A;  1FNU A;  1SND A;  2NYZ D;  3EJI A;  1WCM B;  1H9R A;  5HGT A;  1EFI D;  2NVY B;  1QOH A;  4WFN 3;  5M3F B;  2EYM A;  1CFM A;  4DGZ A;  1AEX A;  4RHR A;  3DWP A;  1WTW A;  3L7Z C;  1SAP A;  1KLG D;  2D5D A;  4FYD A;  2XWJ B;  4B08 A;  1B44 D;  3ERQ A;  5A2Q E;  1LT6 D;  4IUU A;  1SYD A;  2PZW A;  5IGD A;  1U9R A;  4HSV A;  1JC7 A;  2JE6 I;  1FD7 D;  1CA5 A;  4I7Z C;  3M3Y B;  5C3E B;  4DNR B;  4PNY A;  5EPJ A;  3IKJ A;  4LMQ D;  1ICW A;  1O78 A;  5JEA J;  4O1N A;  5LL6 X;  2EYO A;  1OXT A;  2Q8T A;  5EBC A;  5ELE A;  5BN5 A;  3HRZ C;  4HED A;  4Z9C B;  1F9S A;  1PRT C;  4OHJ A;  3HOW B;  2IX0 A;  1WTV A;  2SDF A;  5IGG A;  2Q8I B;  4ZYS A;  2EJG C;  4H13 C;  1Y8P B;  3BZD B;  4KHZ A;  2PMZ B;  1SXT A;  3KF8 A;  5A35 A;  1CHP D;  1NAP A;  5EKI A;  2VB2 X;  5E1F A;  1R9T B;  2MJ8 A;  2L11 A;  2QEJ C;  3V05 A;  3GTL B;  4KD4 A;  2Z1C A;  4UDU C;  3M4O B;  5C5M A;  1KDC A;  2EY6 A;  3VYR A;  1TY2 A;  1UNS A;  5JEA H;  2PZU A;  4K2K A;  4OO1 I;  1W6K A;  2DNC A;  2M00 A;  3NUC A;  2R3Z A;  2ZT9 C;  3S2H B;  3I4N B;  3VR6 A;  3NWS A;  3BDL A;  5I2Y A;  2VUM B;  2SEB D;  3F2U A;  1WTP A;  2B8G A;  2F4I A;  5BN3 A;  4RKB A;  1U4R A;  1AZP A;  5DEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...