1Z6HA

Solution structure of bacillus subtilis blap biotinylated-form
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Biotin/Lipoyl Attachment Protein
publication title Identification and solution structures of a single domain biotin/lipoyl attachment protein from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 18
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1z6hA00
2Q8IB 5C0XG 1H9JA 2ZT9C 5C0XH 1HTPA 2V4DA 4KKSA 1GUSA 1I6VC 2JEBI 1IYVA 2EJGC 1K8OA 1BDOA 4JBWA 3WDNA 1Z6HA 2A6EC 3T53B 5BN5A 1EWHA 1GHKA 5BN4A 4KN7C 1HQMC 2NN6G 3P20A 1K8MA 1YNJC 3PUZA 2JXMB 3TZUA 3QJYA 2K33A 1QJOA 4KHZA 2F1MA 3A7LA 4BA1I 1H9KA 3IKJA 1LACA 2JE6I 2LMCB 1ONLA 1B9NA 2B8FA 3HGBA 1YNNC 3CRKC 2D5DA 1Q90A 1ZKOA 2PNRC 3PUYA 3VR5A 3D4RA 1VF7A 1GHJA 3QG1A 3M7NA 2DNCA 5JEAG 1TU2B 2AUJD 1OXUA 3M4YA 2NN6I 5JEAH 3A7AB 2E75C 5KNCA 1Z7TA 3I4LA 3I72A 1V8QA 2BA0A 2EDGA 3CRLC 4L8JA 1E2WA 3I73A 1Q1BA 4LJZC 3VR6A 2D2CC 1O7LA 3LWUA 2QF7A 2YYZA 1H9SA 4RCNA 4DNTB 4G7OC 1DCZA 2A6HD 1TKWB 3BDOA 3A8KE 2BA1A 4BA2I 4OO1G 1Q12A 2NN6H 3EQLC 1Y8PB 3RLFA 3OW7A 1DXMA 1HPCA 2K7VA 1IW7D 2A68D 3PUXA 4OO1H 1H9MA 2E76C 4KI0A 4KKUA 4TQUS 2O5JC 1GJXA 1IYUA 1HCZA 3KLRA 1H9SB 2KCCA 3OPOA 1E2ZA 3PV0A 3IFTA 1E2VA 2AUKA 1LABA 1GUGA 2O5IC 4IFDG 4KKTA 4XTCS 4LK1C 2A69D 3BG3A 4G7HC 2DNEA 1OXVA 3NE5B 2IT1A 1O78A 1GUOA 2A6HC 4H44C 1CFMA 1Y8OB 1ZYRC 2BE5C 4H13C 2CW0C 1B9MA 2K32A 4KN4C 2E74C 3PUWA 1CI3M 1IW7C 1FYCA 2A68C 3N6RA 4DK1A 4DK0A 2KA7A 3U9SA 1VDZA 2DN8A 4GZYC 1OXXK 4I7ZC 2PPBC 2BE5D 3T56B 3M85A 3OOCA 5KNDA 2B8GA 2D62A 3A8JE 4G7ZC 3VR4A 2A69C 3SDZA 3FPPA 3ND8A 5BN3A 1CTMA 1H9RA 1VCIA 4KMUC 3ND9A 2EJFC 3A8IE 3AB9A 2EVBA 1V43A 1DD2A 4JK1C 1Y8NB 4DNRB 1GUNA 4TKOB 1FR3A 4PV1C 1A6XA 3GD7A 5KNBA 3VA7A 3GQBA 3VR3A 3MXUA 1OXSC 4IFDH 2L5TA 4HR7B 2AWOA 3QIAA 2EJMA 3D31A 5K36G 3PUVA 3MFYA 4OGQC 3DXJC 3H94A 5K36H 4XIGS 1GUTA 3LNNA 4IQZA 1G291 2BDOA 2A6ED 3FMCA 3SE0A 1T5EA 3VR2A 3W3AA 5A35A 3L7ZC 1PMRA 2PCFB 2R6GA 1Q1EA 1SMYC 1VF5C 4H0LC 3T51B 1Y69U 2JEAI 1OXTA
chains in the Genus database with same CATH superfamily
4X3UA 1GUSA 2BDNA 1CKMA 1WTQA 4A3CH 1ET9A 4RAUC 3HOYB 1CZWA 5C3XA 2JXMB 1ILPA 3I4MB 2FFKB 1G51A 3Q6SA 4JYAQ 3SK4A 1HQRD 4EQPA 1HNZQ 3B6YA 4A75A 4X3KA 2NWGA 4H7BA 3I3CA 4F7XA 4L5TA 1PFNA 1E2WA 1Y1WG 1I50B 3IRBA 2YYZA 3D3RA 2F03A 2Q2TA 3HP3A 1TY2A 1I4XA 3EA6A 1FGBD 3F2UA 1AE2A 2FJ2A 1VS0A 2RBMA 4KKUA 1J5EQ 1LUZA 3K57A 4A3MG 3KK7A 2CWPA 4OWXB 2MO0A 3NE5B 4GLAC 4H44C 4CJ0B 4DUYL 1CFMA 4HCSA 4A3GB 2VW9A 1JB7A 4A93H 2RDHA 4DR2L 2WFWA 5HURA 3S24A 3T56B 1QVGA 2EOTA 2B2VC 3NBHA 1B70B 2AMCB 3NTIA 2EYMA 5IY0A 3QO2A 1XMQQ 4PV1C 2F0UA 4JI3Q 1MKHA 1CZGA 1M1KC 3GO5A 4DV0Q 4IFDH 4BBRH 3DHQA 3ITPA 1VQ6A 3RZDH 5JPNC 1AEXA 2K5NA 2KHSA 3ZYYX 1GUTA 1STNA 1K83H 1DOLA 5D3DA 3PCOB 3CCJA 1EFWA 1UEBA 3V96A 4XYQA 3CHBD 2NVQB 2R6GA 1G8ZD 1Y69U 1DONA 3RLNA 2V1CC 2IHEA 3S2HH 2QW7A 1I5FA 1DOMA 2YV5A 2VQFL 2CH4W 1YHAA 4JBWA 4HIKA 4ZUIA 5BN4A 1Y1VG 2PQEA 3P1HA 5JJZA 1YNJC 4RKBA 1XPOA 5AFWA 1PYBA 1BOSA 1D5ZC 5DLQE 3R8BA 1B2TA 5JJLA 2Y0SG 2D5DA 3PUYA 3R3OA 3M7NA 2RDGA 1EY7A 2TSSA 1OXUA 1PYSB 3M4YA 4C3JG 1S3OA 2E75C 3NWTA 1V8QA 4OX9L 2SNSA 2CQAA 3DWAA 1AW7A 3HKZB 2JP1A 1O80A 1AP0A 3GTKH 1Q12A 1EOTA 1DXMA 2WKDA 1N8RC 3PUXA 3NK9A 5F2DA 1K73C 4FF4A 4GOPA 3PV0A 1YJWA 5JJIA 1D1KA 2F0MA 2EY2A 4WRDA 4B9XA 4K6LA 4C3HH 5ELEA 4K8IA 4GOPB 1IW7C 1TWHB 4OXPA 2BH8A 1E0BA 3K5OA 3ONAB 4HJ9A 4JI0Q 3DEOA 1L2FA 1ESFA 2JA7H 2K5VA 2B8GA 4X3TA 4JI1Q 2A69C 4QJFA 2NTSA 1PTOH 1KHIA 3GTMB 3ND9A 3J7YW 3TREA 1YJ9A 2K28A 1ASZA 2YU9H 3HOUB 1NJIC 3GV6A 3VR3A 2FHTA 3ULJA 1EZ6A 1IXRA 2VQFQ 3RZOH 3K5NA 2SOBA 2K05A 4LF7L 1G91A 2I07B 3GTQH 2EY5A 4QCLA 1IYJB 1KIXA 4YHHQ 5ISRA 1A2UA 5IYCH 1TWGB 2ALYB 1KDAA 2KECA 5C3EH 2CWAA 3TRZA 2VXWA 3I55A 2VQEL 3TP6A 5D14A 1XPRA 4YCUA 4P74A 2F0PA 1EU3A 2RA4A 1E24A 3NUCA 2OCEA 1YIJA 2JEBI 5GROA 1EIHA 4FDBA 1UE1A 2Y0SE 4Z9CB 3E0EA 3S16B 3S1RB 3PUZA 4G4KA 4K6DA 1UNSA 4EQ5A 2XN9C 1A62A 3QOJA 4DV7L 3BVMA 4V190 1U4LA 3FDTA 1TT2A 2A73B 1X55A 1U0LA 4M1UB 2WACA 3KOJA 3D4RA 3Q0AA 1JQYD 1HZAA 3A56A 3AMUA 4C3JH 1CHPD 4OIJA 4DR7L 2RHSB 4HMIA 1S5ED 3K5MA 2R93B 4ZCKA 4DPGA 3K8AA 1SE3A 4KY5A 4MHEA 1TWFH 3HOXB 1ENAA 1Y8PB 3L0OA 1EYCA 4TQUS 4KHVA 4MTKA 4X65Q 4EQNA 4IUNA 3J80L 4ZRZA 2Z9HA 5ELDA 3KF8A 3PO2G 2ZTDA 5A2QE 1F9SA 3BU2A 3J80i 1O78A 2BE5C 4JI8Q 4DV4L 1HUNA 1B9MA 4MTNA 1EQQA 3SK6A 4IN3A 3U9SA 1YHBA 1EWIA 1SXTA 2XTIA 3TEHB 1XWEA 4LF7Q 3CKIB 3G4SA 3RN2A 2BE5D 4GOPC 3I90A 5FK9C 4C3IG 2JA9A 3SDZA 1UE6A 4RGNA 4AH6A 4KMUC 4IALA 2F0LA 4DNRB 2VQEQ 1NAPA 3S1QH 3TP5A 4CKCA 4IUUA 3GQBA 4YWMA 1BXTA 1OXSC 2UXCQ 1MGSA 1SMYD 1C9OA 1WCMB 2EIFA 3T4AC 5K36G 2DUDA 3PUVA 2NVYB 3DXJC 1UE5A 4NXMQ 1SYEA 2KEEA 2UXDQ 1SEBD 4PMCA 1NE3A 5COYA 3NEMA 5GAEC 2JEAI 2C35B 2Z1CA 3HOZH 4JI2Q 1VMCA 1R4QB 3STBD 1YNXA 4K0KL 1CA5A 2A6EC 2E8GA 1SJED 3NENA 4Y7NH 1IBML 2NN6G 2WAQB 1HR0Q 2JA5B 1LV9A 1E7ZA 1A3VA 1ML0D 4R4QA 4AQYQ 4DV5Q 2CQOA 1R9TH 1LACA 2G5DA 4JI5Q 1KC8C 2Z8LA 2NZOA 1LLRD 4K2KA 2O2LD 5C4JH 1WD0A 3K0XA 3HOVB 3AFQA 1IL8A 3I72A 1BVSA 4L8JA 1KDCA 2Q2IA 4DV4Q 1E3PA 2G9HD 4BY1B 4GLVB 3ZJYC 1H9MA 4DAYA 5LL6S 3LGJA 3UDFA 1E2ZA 2UUAQ 4YWLA 4DUZL 2LKVA 3NHHA 4KKTA 4XTCS 3MXPA 1TS4A 2VB3X 5IYBG 1SE2A 1QUQA 5EBCA 1EIGA 4DK1A 5M3MH 5IGDA 2MP1A 4KD3A 3S15H 3X3NA 1QUQB 4Q5VA 3I56A 1VQBA 3G71A 3FPPA 3SGIA 1KAWA 2EJFC 2K04A 3MVVA 3MC0B 4LUZA 4JI4L 2R7DA 1CQFA 2ENBA 2K52A 1FR3A 3PIO3 1PZJD 5E3FA 5GADC 5KNBA 2EQSA 2NVXH 3CC2A 4FF1A 4RHSA 4LUOA 4K5XA 4JBKA 2NB0A 1KNAA 3GTLH 3FP9A 4QL5A 2WIIB 5K36H 2QCPX 1IBMQ 4LF8Q 1PZID 2YTYA 4RHRA 4NDXA 3KF6A 3M3YH 2XWBB 3SE0A 2E2HH 3H09A 1X3PA 1Q1EA 2F0GA 4ZKBB 2WB1G 4OEMB 1Q82C 3M4OH 3KF6B 1ZEQX 2O4XA 3F8TA 2JA8G 4IUTA 4IUQA 4O42A 4KHPQ 4QY7A 5EKKA 4IPHA 2Q8RE 3H0GH 4NP5A 4KHZA 1A3UA 2F3VA 3A7LA 1WTXA 3C2PA 3A55A 2AQ2B 4X66L 3JAME 1X65A 4A93B 2IX0A 2NZ1D 4J1MA 1B9NA 3W1GA 1SBBB 3BJUA 1WOCA 3A0JA 4RCOA 2CCZA 1GHJA 4DUZQ 4RFBA 1T9HA 5IGGA 1TU2B 2R3ZA 3BZCA 5I6YA 1QCBD 4DV3Q 2GVBA 1VQ7A 1XNQQ 3E6ZX 1DJRD 2HCCA 1L0YB 3CRLC 4LJZC 1O7LA 1X3QA 1PH5A 4PZ6A 5C5LA 1O7ZA 5KGUA 4XT1B 5AJ3Q 1PFSA 3E9HA 4AYBG 4BBRB 2AQ1B 1I94Q 3RZDB 3ERQA 2R7ZH 1LT6D 4KI0A 2KCCA 4X64Q 1K83B 4QB4A 5KYIA 4X3SA 4C2MH 4BY7G 1D8LA 2LXKA 5IYBH 5DNFA 3PSIA 1WI5A 4DR1L 3VYSA 4DK0A 3TBIB 3S2HB 2FMMA 2AKWB 5C44G 2R92H 1X3GA 4A3KG 3BYTB 2ZJRA 3KJOA 3CCSA 4G7ZC 1VQDA 3QOLA 1PTOF 3ND8A 4O0AA 1CTMA 5E7NA 4OHJA 4E6IA 1H95A 1HNZL 5IYDG 4EVOA 3I2ZA 3I91A 1I4GA 2B2VA 1B7YB 1TWAH 5EBDA 4CDEC 1V1PB 1RD9D 1EQRA 3CCMA 2RDFA 3D31A 3J81E 1V1OA 1O7IA 2WB1E 3MFYA 1DM0B 4OONA 3BYYB 5JVG3 4A3EG 1T5EA 1Q8KA 1K3RA 4IURA 2KCNA 1VF5C 4ZKCB 4POGA 3GTKB 4Q0FA 4UP7A 4LFCL 3D0FA 3J7AF 3PO3G 3FEWX 3CC4A 4YWKA 4RMFA 4UY8C 3W1BA 2JA8H 2JYOA 3WDNA 2RSNA 2C5CA 3KFUA 2JN4A 1CKNA 2L0CA 5EAYA 4F8MA 2OTJA 3QJYA 3S1MH 2IY5B 4C3HB 2F1MA 1S5BD 1H9KA 2EYPA 1RHPA 1MD2D 5JEAJ 1JWMD 5M5WH 3NBIA 5G3LF 3HGBA 3CRKC 4BS9A 1XMQL 2JA7B 1CKNB 4DR3Q 4JI3L 2DNCA 4DV0L 2NN6I 4AYBE 2VY3A 1KLGD 1PTOB 4OO1I 3EJIA 2LFNA 2BA0A 1M90C 4LF6Q 4HTHA 1GM5A 2NYZD 3KBGA 3KUPA 1W6JA 2NBFA 4DR1Q 2YU9B 3PIPA 2X69A 2A6HD 3S14H 1AZPA 2B2UA 1S5CD 5IT9E 3RZOB 1BBWA 1NUCA 2A68D 1J9OA 5EPLA 2ATWA 5IGFA 1IYUA 1SYFA 2F0SA 2K4KA 3GTPH 1YJNA 2IJ0A 2KCMA 3GTQB 2PO4A 1B1ZA 1FVIA 5HY6A 1YVCA 1EWCA 2RVLA 2F3IA 5J1ZA 2MFIA 2DNEA 5C3EB 3J80E 1Y8OB 5IGBA 5IE8A 4MN3A 4CJ2C 5J39A 4GKJL 2KA7A 1MBYA 5C4HA 1WJJA 2ZTEA 1JR0D 3RMHA 2SNMA 5C44H 1YHQA 1RKNA 4A3KH 3WOEA 1F9RA 4M8AA 2EZVA 2NVTH 2NTTA 5K5PA 3I4NG 4JCVE 4DA2A 2RCFA 1NMFA 3DWPA 2PW7A 5I6WA 4MZ9A 4LFCQ 3VA7A 3VYRA 3L9AX 2QKIC 1JT8A 1KRSA 2Y0SB 5M3FH 4GLXA 2JQOA 4L6TB 4XIGS 4C3JB 1EIFA 1ILQA 2ZXOA 2OXPA 1B50A 4NKLA 4S3SA 4GNXB 3T51B 5DEHA 1X54A 1TWFB 1W2BA 2K75A 3O13A 5EPKA 1M4VA 2MNAA 1TY0A 1PH1A 1VQLA 5I2YA 3PO3H 1I6VC 5I2XA 2EYOA 3CMAA 1Z6HA 1XTDA 3DM1A 3TDQA 3IL8A 1EWHA 4HMJA 1VQNA 1HRJA 4QUCA 4JI0L 1JCKB 1IHZA 2EY1A 3E9IA 4JI1L 5BR8Q 4BA1I 1KAAA 3NP8A 1K28A 4NXNQ 3C3LA 3BVGA 3KDFA 1B3QA 3HOYG 1ZKOA 4DV2Q 2OTLA 3W2DA 1XXGA 3S17H 4R4OA 1T5XD 4NPSA 2EDGA 3KDFB 3S1QB 2CHBD 3AU7A 2XWJB 3GP7A 4RCNA 4DNTB 2K5QA 3D6WA 4GKJQ 2FMCA 2XVSA 4TVAB 3EQLC 4YHHL 3OW7A 3CCQA 4H02A 5LMUL 2EYHA 4BBSG 3DWQA 1HCZA 2QA4A 1PTOD 3J7ZC 1Q46A 2XIWA 1L0XB 2D0OA 5FLXE 2UUBL 4JI7Q 2MQHA 5EKLA 1NR4A 2I5HA 1TWCH 2B2UC 1PA6A 4QMGA 1D6EC 2AWNA 3PIOA 1EFID 4IO9A 3N6RA 5EJWA 4RH6A 3HOZB 4HSPA 1Y1WH 4OWTB 1VDZA 4EQOA 1HNXL 5FO8B 2ZM6L 1SMXA 1EY9A 1JJCB 2SEBD 2CH4A 2QEJC 3NTHA 4A3GG 4N9TA 3FHWA 4Y7NB 1H9RA 1XNRQ 2IX1A 1G2SA 1Y8NB 1GUNA 4P71A 4A3MH 3I4NH 3EBEA 2RF4A 1M8AA 1BCPF 3U58A 3M9BA 1R9TB 1VQJA 1VQ5A 1BUVT 5GAGC 2ZXPA 1EQTA 5C4JB 4ZLTF 2HUGA 3P75A 2KUMA 2F0HA 3EIVA 1SLJA 3H94A 4WJ4A 2M2LA 1PZKD 1PV4A 4APVA 4DV1L 3DLLA 1I4PA 4X65L 1JORA 1EEID 1HTLD 4YY3Q 3HOWG 1AH9A 5G3LD 1ESRA 3KJPA 1KDBA 1LT3D 4C56C 4JI8L 1VQGA 1CQVA 4O1NA 3A5ZB 2CVRA 2Q8TA 1YZ6A 1K8MA 4GN4B 1K8AC 5T1GA 4DGZA 4HIOA 3SVMA 1XYIA 2N8NA 2LSSA 4LUVA 5LMUQ 5M3MB 1D2BA 2B8FA 3D4WA 4JC0A 3S15B 1JWSD 4A3DG 1CM9A 3CF5A 3UDGA 2VUMG 3I4OA 2UUBQ 1NR2A 2PMZB 1DZ1A 2UXCL 1ZXTA 1FJGQ 3K80C 1U9RA 1I4QA 4JV5L 4P73A 1BCPB 1QB5D 2DJFC 3U4ZA 2NVXB 1P16A 1B53A 1VQAA 2BA1A 4F87A 3GTOH 1Y1VH 1HNXQ 4NXML 4DR6L 3RLFA 2ZM6Q 3C1EA 1F2MA 2F0FA 2JJQA 1GJXA 2O5JC 2UXDL 3GTLB 2GN5A 2KEDA 4BBSH 4IFDJ 1I6HH 1JOQA 1IKMA 3K7AH 3HKZG 3IFTA 1J8IA 3M3YB 4A3LG 4JI2L 2Z0SA 1OXVA 1C7YA 4LF9Q 1JJ2A 2E2HB 4L5RC 2F0NA 1UWVA 3K0YA 3BVZA 3PUWA 1FNWA 1JC7A 2OT2A 4I65A 4QUFA 4A3JG 5J3BA 1LTGD 3VYTA 1BNZA 1TIID 1N34L 3M4OB 1BF4A 2DN8A 4A3FG 1HR0L 4L5SA 3H3VC 1HFNA 1S5FD 4AQYL 4DV5L 1MJEA 4K8JA 4JI5L 5H1SE 4DV1Q 4NB3A 5IP9G 2PQAA 1KQSA 5L37A 3H0GB 1SNOA 2JA6G 1PXUA 2F0DA 3PIP3 2PQAB 2EJMA 5CV8A 4EGVA 1SE8A 1L1OA 1STHA 5FJ8G 4DXGA 2EYFA 3WOFA 5C4XG 2EYLA 4XT3B 1GOZA 3PGZA 1WYDA 4DR4L 3OWEB 1X56A 1LTSD 2L1BA 1U5KA 1STBA 2H1EA 1L1OB 1SMYC 2UUAL 1N32Q 5EQ0A 3HOWH 2MO1A 1I3QH 3H6MA 4A3BG 2R7ZB 1OO9B 5IP7G 3NQIA 1Z47A 2WINB 2HIXA 2B29A 3KBXA 1YNND 1HUMA 4BXXG 2YTXA 2KVMA 2VZAA 4C2MB 1Q3LA 4JV5Q 5CC4A 1LTLA 1XX8A 2Q2HA 4DU9A 1ICFB 1N33L 2DGYA 4ALPA 5JJKA 4ZYSA 3N52A 4DR6Q 4HJ8A 3DEPA 4NW2A 2L15A 4LWCA 2R92B 2IWHA 2ICEC 3STBC 3CCUA 1VQ8A 1Q90A 1WTVA 1EEFD 2XGTA 4F88A 5JEAG 1XMOQ 4A3DH 4ABNA 1QVCA 4X62Q 1QNUA 3A7AB 1WTWA 3KLWA 1E22A 2VUMH 1QWYA 2ZTCA 5ELNA 2F0WA 4DKAC 1STAA 1SDFA 3T1YL 1VQFA 3MXGA 1A8VA 1II3A 4LF8L 3A8KE 5CR3A 1N34Q 1TWAB 4OO1G 3CU7A 4ME3A 3K59A 3IAYA 3KLRA 1R4PB 4A3IG 2ASBA 4FXGC 2D9UA 2QEXA 5JVH3 4CDCC 4ME5A 3PF5A 4A3LH 1BCPD 4DFAA 2KOLA 2K32A 4KHPL 3D6CA 1XTCD 2WB1B 4I7AA 1X32A 2F4IA 4A3JH 4LFAL 1SE4A 4A4IA 3S2DH 4A3FH 4RA8A 2C9OA 2JA8B 2D62A 2E2DC 2MHVA 4DR4Q 5JPMC 2B2YC 1TR5A 2F0OA 3Q22A 1PRTF 3AB9A 3E3XA 1DD2A 5IP9H 3S1MB 4HCEA 4U673 3AEVA 5FLMG 4DV3L 3PO2H 3MXUA 4ZK9B 5C5MA 2L5TA 1E1TA 1XNQL 2JA6H 5M5WB 2PMZE 1D1IA 1EYGA 4TRDA 1B8AA 3T1HQ 5AJ3L 1SNPA 5FJ8H 4LF5L 5C4XH 4OELB 1I94L 4CHTB 3UDIA 2HIVA 4IQZA 1N33Q 2L55A 3NTKA 1EY5A 3VR2A 2IL8A 4C3IH 2UXBL 4X64L 3S14B 3P7JA 3SR1A 1SNQA 5IIFA 4AYBB 5D3IB 3DMUA 4KKSA 4A3BH 1UUPA 1L1OC 3KLSA 5IP7H 3C46A 3EROA 3GTPB 1BDOA 3RLOA 4BXXH 4PMWA 4KN7C 3TP7A 2A1AA 2H5XA 3P20A 4IUVA 3T1YQ 4FXKC 1A0IA 2K33A 1TS3A 2A5HA 2B2WA 1QILA 5M9OA 4IPDA 4YCWA 1AFPA 3ER0A 2N78A 5C44B 1JWUD 2WAQG 1LM0A 1DYQA 4HJ7A 4A3KB 1PH6A 1IL2A 2JA5G 1NY4A 5JEAH 2PZTA 1LT4D 2NVTB 2K03A 3I73A 2VB2X 2I46A 1HNWQ 1ZYRD 4LFAQ 3HOVG 1HHVA 2NN6H 4OO1H 2K7VA 4IZ8A 4YIJA 2E76C 3MFGA 3MZ5A 4HAEA 1QE6A 5M3FB 1D5XC 1BR9A 4A3IH 3SK8A 4N8X1 1EY0A 3WWVA 1PDQA 1FGUA 2WV6D 1ENFA 4KN4C 3H3VI 3GV3A 5CV4A 3L2PA 5DM63 1ASYA 1OXXK 3TQYA 3PO3B 1MI2A 4GZYC 3I8ZA 1BQQT 4CJ1B 4LF5Q 5CV9A 3OIPA 3I7FA 3Q8DA 4XYOA 4JI6Q 5HGQA 1SNCA 1WFQA 4JK1C 2IX3A 4MNOA 2UXBQ 4DV6Q 1STEA 2NUCA 3JAMc 4DR3L 1RL2A 4HIDA 4P75A 1A2TA 3ULLA 5FLMH 4QQBX 4LF6L 1IBKL 2K01A 4CKBA 4A3CG 2AWOA 5IGCA 2F4VQ 1K9MC 4NMZA 1GO3E 2R61A 4CDDC 4A76A 3HZXA 3S17B 5C0XI 5DM73 2B2TA 5IWAL 4DAVA 5C0XJ 4PQXA 3R93A 3RR5A 1LTBD 1VQPA 1V1PA 3S1NH 3Q24A 4KJOA 1K0RA 3CAMA 4R4IA 2ZT9C 3ULPA 4CBVA 3GDEA 4UHVA 5KEEA 3S9WA 1QG7A 2DJGC 1F2ZA 2B63G 2F0VA 2G9DA 1GHKA 4DF7A 3SHLA 1P8LA 4IOAA 4GS3A 1V1QA 1EY6A 1ENCA 2UUCQ 4WJWA 2XRSD 1B4OA 1TWCB 3TZUA 2HQEA 5A2QL 2EXDA 1Y1WB 2LMCB 1ONLA 1JE5A 2UU9L 1C4QA 2Z6KA 2ID0A 3L3OC 4QIWE 4LMQD 1UAPA 2AUJD 3OIQA 4DAMA 3FKIG 5KNCA 1JMCA 1SYGA 2E5LQ 4IJHA 3SXHA 2PI2E 2RCNA 5I4DA 4A3MB 3I4NB 1X6OA 5CBAE 1PLFA 1HZBA 4JOIA 2QF7A 5ELBA 3OHXC 4YCVA 2B2WC 3U9OA 1VQKA 2E2IH 3U50C 1QZHA 2CW0D 3VDYA 3J81c 5DAUA 5E1FA 1QOHA 1HZCA 1S4ZA 2HHHQ 4DN4M 1V9PA 1Q86C 1PRTD 1E2VA 2J0TD 4RGOS 2L9HA 3UE1A 4IFDG 3HRZC 3SEBA 3BG3A 3K5LA 1KL9A 2A6HC 1EYDA 1LTAD 1F9PA 3JC66 3QR8A 1NMGA 3HG9A 1IBKQ 2A68C 2WP8J 1SNDA 3VA5A 4OIKA 4WFN3 2PPBC 3GTGH 3OTOL 2PW5A 5BR8L 4LFBL 3X3MA 1SR3A 1KNEA 3G6EA 4NXNL 1HA5A 2H4OA 2Z6BA 5IWAQ 1JOOA 2QDBA 1KRTA 5LMNW 1DGSA 1SYDA 2DY7A 3W5OA 4DV2L 3K81C 3HFZB 4N9PA 5GAHC 2VNUD 4KV6A 3AQQA 5M5YH 4PG3A 1PHJA 4BY7H 3DUZA 2ES2A 1PFMA 3MTSA 1J6QA 3E5SA 4ZAIA 4P72A 1GD7A 3A74A 5E4XA 1KXLA 1X3EA 1EQVA 4RG1A 2GA4B 2K50A 3SK5A 3LNNA 3TS2A 2J7ZA 3MAQA 3M4QA 4CDFC 2VL6A 2HDLA 5IT9c 4B3SQ 1TQOA 2PCFB 3CD6A 4H0LC 3CCEA 1QVFA 3GTOB 2F0EA 2UU9Q 1Y1VB 1A63A 4JI7L 3GTJH 2K6AA 5IYDH 2FINB 4BBSB 3OMGA 2YTVA 1I6HB 3URYA 2EJGC 3K7AB 2B63H 4IPCA 4BWGB 3J80c 1F77A 4CKEA 3EFXD 2B2TC 4J6HA 1RTNA 4GNXA 3PMFA 4B3RL 2F0IA 1KLUD 3H91A 1FD7D 1O7YA 1WTHA 3PQIA 3BZDB 1CT1D 2KHJA 1XNRL 4A3EH 5KYLA 1WVLA 2N49A 3VR5A 1AE3A 2RKSA 1KD1C 1CK1A 3H15A 4C3HG 2JSOA 3I4LA 5CV7A 3CXCA 2J4XA 3FKIH 5J22A 1D5MC 1W3SA 2JA7G 2EPBA 4AIMA 2XNAC 3OTOQ 2PNHA 2Z6KC 4JG2A 4LFBQ 1EU4A 2HDMA 3EN2A 4YY3L 3OPOA 3E0JA 4JVZA 5NUCA 3DM3A 4RKLA 3ERSX 1LT5D 1RF2D 1OTCA 2O5IC 1NTGA 5ELFA 4JOIC 3NBHB 1ET6A 3I4MG 1NNXA 3HOWB 1CI3M 3CQZH 3FVQA 1I3QB 2KQ3A 3TS0A 2LS01 1PTOC 2PZUA 5IYCG 1PH8A 5I9PA 5C3EG 1STGA 4XDXA 3K58A 1SRUA 1V43A 3UE0A 2BOSA 5M5XH 5GQOA 2ZJPA 4R4TA 1A6XA 5LHY1 3KLSX 1FJGL 3MXNA 2E2JH 3AYHB 1C8CA 4TSSA 4N8FA 4A3DB 2AQ3B 3JAML 1U4RA 1VQEA 1SFOH 3OW2A 2Z4IA 3M4PA 5TSSA 2VUMB 5FO7B 3MXNB 4XQJA 2RHQB 4B3RQ 5I9OA 3JAMi 4LNQA 4K14A 2QDLA 1GUWA 2TMPA 1YNJD 5IODA 3NPPA 1SROA 2MPMA 4KY6A 3OSOA 1TS5A 4ULLA 1H9JA 4LF9L 2HT1A 1HTPA 1PH2A 4DUYQ 3TMEA 5FLXc 1K8OA 4K5WA 3RNUA 4K5VA 1MIUA 2MJ8A 4DR2Q 2K5HA 3HKSA 3J7A5 2XSCA 4WJ3M 2BCOA 2PYKA 1CUKA 3K7UC 5CMDA 3PF4A 4KJNA 4LF4L 4KK7A 4A3JB 3CPFA 1HH2P 2IHFA 1VQIA 4XQQA 2ZJQA 3S2DB 1EZ8A 1PYWD 2FXQA 4A3FB 5FO9B 3F2BA 2K5DA 1EY4A 4G57A 3NELA 5JOBA 1EY8A 3Q23A 1TS2A 1RCVD 4GNXC 1SYBA 3V2TA 4IPGA 1BO0A 4RGMA 1H9SA 3A54A 1DCZA 3K6OA 2M9VA 3OWFA 1I4RA 3PO2B 3CC7A 4BA2I 2K1BA 1MSHA 2HD3A 1EYAA 2I5LX 3C1FA 1XPUA 2JA6B 1BKBA 1IW7D 4FF3A 3HS0C 4RGTA 1H9SB 1GVPA 1N32L 3MHBA 1TVXA 3J7AV 5C4XB 1JICA 1E1OA 1GUGA 5EGTA 1RDPD 2KHIA 2F3WA 3BZKA 2A69D 3J81L 3HOYH 4C3IB 3IFDA 2CFMA 2HCIA 2MGSA 2F0JA 1HFGA 2Z4HA 2E74C 1LTTD 5CGKA 3J81i 3I4MH 3FRPB 1YEZA 4IUPA 1HZ9A 3LWEA 1HXYD 4I7ZC 4A3BB 2RSOA 4QGUA 4IFDI 3LX0A 3VYUA 1LTID 2EVBA 3HOZG 5E4WC 1B3AA 1I50H 1UEAB 1Y14B 1BBUA 4R8NA 1XMOL 1CHQD 4X62L 2B2YA 2K5WA 1G6ZA 5LL6X 2BH2A 1MJCA 1SSOA 4HR7B 3RN5A 1JOKA 4OX9Q 5CV5A 5T1IA 2LXJA 2KCTA 1RTOA 4GN3B 1EUJA 1CSPA 4JBJA 4UP8A 2X6GA 3FMCA 4C1NI 1X9NA 1LYLA 2ZXRA 1PMRA 3L7ZC 3QWNA 5D65A 4LF4Q 4A3GH 3MA2B 3UDXA 5C0XG 4POFA 2V4DA 1IYVA 2CKZB 5IT9L 1NBWA 1S5DD 2IPKD 2OEOA 2VS1A 3I70A 5JAVA 4A3IB 2I5MX 1STYA 4L5QA 3TN2A 4IOCA 1CA6A 1SN8A 3HOUG 1QJOA 4UP9A 4PZ8A 2OQ0A 2EE1A 1YNNC 2XRQD 1G2TA 2N3SA 1VF7A 1PH7A 3CCVA 2HQLA 1FNUA 5M3MG 3VR6A 3HEJA 3MEHA 3T1HL 3KF8B 1HJPA 2IW3A 2NVQH 2KJXA 1TKWB 4HN7A 1PFBA 1VQOA 4FXDA 5CORA 3R2TA 4U68A 5EPJA 1UE7A 4XQNA 1W6KA 1B44D 4G7HC 3F2DA 4FNFA 2D0PA 4KTAA 4FP5D 1GUOA 3OMCA 1F2LA 1EL0A 3S1NB 1VQCA 1I4HA 4IJLA 4HJ5A 4Y52H 3HKZE 1IZ6A 2QILA 3G7LA 3NXWA 4R8IA 5ELCA 3T16A 5KNDA 2B39A 4HIMA 1FL0A 5BN3A 1BCPC 3H3VH 3V05A 4DV7Q 3CCLA 3A8IE 1SNMA 2R93G 4TKOB 5CV6A 1F9QA 1Q8IA 3GD7A 3J81j 1S40A 3HOXG 3G48A 2KBNA 4DR7Q 4ID6A 2A74C 3MEFA 1U4MA 4RWSC 1GXDC 2I0QA 3H0GG 1HNWL 5EKIA 3M7GA 2EY6A 1PH4A 5FOBB 4JW0A 2BDOA 2A6ED 4J15A 2PI2A 1G6PA 1HR0W 3TSSA 4QIWB 2E2IB 4KD4A 3TP8A 2EXZA 1TWHH 5C3WA 2Q8IB 2L11A 5C0XH 1KTKA 2F0QA 2NZHA 1AZQA 4FF2A 1PVOA 5BN5A 4LW1A 3T53B 1F2YA 4DNIA 1Q81C 2A8VA 4DXFA 3GTMH 4V0BA 3QB3A 4DAPA 4DK6C 3FPUB 3NSWA 1WD1A 4PNYA 2R7ZG 2R7FA 3NWSA 4OL7A 3HOUH 5FLXL 1EIYB 4JI6L 4P2CB 1WCMG 1YITA 4HSVA 4DV6L 1HA6A 2B3GA 4UDUC 3GTGB 2PNRC 2F0TA 3QG1A 3CCRA 4PZ7A 5CBEE 4DAYB 1Q7YC 1LTRD 4ODGA 2F4VL 1Q1BA 1XJVA 1TWGH 2D2CC 2R92G 3LWUA 2QGQA 3A5UA 4G7OC 4B3ML 4J8QA 1K8GA 3BDOA 1VMPA 5M5YB 4BY7B 4QF4A 4B08A 1MSGA 4UPAA 1JE4A 4OWWB 4GKKL 3T13A 1IBLL 2AUKA 3AFPA 1PH9A 1LABA 2KENA 4LK1C 2OWOA 4B3TL 1N36L 4DR5L 4JBMA 1EOVA 3S16H 3S1RH 1VQHA 1ZYRC 4KY7A 4H13C 4LAAA 4UAIA 5ELOA 3ICEA 1PRTB 4K0KQ 3RD4A 2A19A 1A3TA 5HGTA 1VQ4A 3GTJB 4R4CA 2UUCL 3BS1A 3CPWA 3CP0A 4R9WA 3OOCA 2B63B 4WORA 3F2CA 2OF1A 1VCIA 2ICIA 2SDFA 4FO2A 4GN5A 1WTPA 2F52A 1SAPA 2R93H 1QNKA 4BY1G 4FYDA 3OYYA 2E5LL 1QZGA 3HOXH 4A3EB 1S72A 2L4NA 1RIPA 1AN8A 3BDCA 2JK8A 2GVAA 3CMEA 3MWYW 4OGQC 1IKLA 3TZDA 4HJAA 4XXEA 3FKIB 1TXYA 1G291 2AHOB 2LY7A 2HHHL 5KRUA 4KLKA 3G6JB 1CSQA 5CYUA 3F1ZA 1OXTA 1YBYA 4CGYB 1RODA 1VQ9A 2P5ZX 5IGEA 4HEDA 1HQMC 3EVQA 5LMNL 5FKAC 4EX5A 1WTOA 1Z9FA 4B3MQ 4C1NK 1LO5D 3R2IA 4O2DA 3IKJA 3CQZB 2JE6I 1KABA 4JI4Q 1YI2A 1WCMH 4FVMA 2K14A 2OQKA 4GKKQ 4R1JA 1IBLQ 5C4ZA 2NVYH 1CKOA 2M00A 4B3TQ 1Z7TA 1N36Q 4DR5Q 1VQMA 4L63B 3U4VA 5M5XB 1GKHA 3UI2A 4B9WA 1WTRA 3BDLA 2E2JB 2WAQE 5C6AA 1HPCA 4B3SL 3NQTA 1K3BC 1SFOB 4JYAL 2EYJA 4ZUJA 4K2LA 2IT1A 2PZWA 1X3FA 2JA5H 4MIUA 5M3FG 2CW0C 5IOCA 4PMBA 4A93G 3D4DA 1JB3A 1FYCA 1ICWA 1N9WA 4DK3C 1L0WA 2DY8A 1NCVA 1U4PA 1PRTC 3M85A 3RUZA 2RQXA 3A8JE 4X6AH 1J5EL 3HOVH 3VR4A 4X66Q 2L12A 4ILWA 5KIXA 1C48A 1JJGA 3KYHC 1FNVA 4BY1H 4BBRG 2X6LA 4JPBW 3CW2C 2F0KA 2N88A 1PH3A 3QIAA 2N55A 4ZQ3A 2WKCA 2Q2UA 1NSNS 1SJHD 1K0SA 1DOKA 1A15A 5LMNQ 1C0AA 1MHWC 3D8GA 2MUYA 3W3AA 5A35A 1SYCA 1RJTA 1BBXC 1D7QA
chains in the Genus database with same CATH topology
4X3UA 1GUSA 2BDNA 1WTQA 1ET9A 4RAUC 3HOYB 1CZWA 5C3XA 2JXMB 1ILPA 3I4MB 2FFKB 3Q6SA 3SK4A 1HQRD 4EQPA 4X3KA 2NWGA 4H7BA 3I3CA 4F7XA 1PFNA 1E2WA 1I50B 2YYZA 3D3RA 2F03A 3HP3A 1TY2A 1I4XA 3EA6A 1FGBD 3F2UA 2FJ2A 2RBMA 4KKUA 3K57A 3KK7A 3NE5B 4H44C 4CJ0B 1CFMA 4HCSA 4A3GB 2RDHA 5HURA 3T56B 2EOTA 2B2VC 3NBHA 3NTIA 2EYMA 3QO2A 4PV1C 2F0UA 1CZGA 3GO5A 4IFDH 3DHQA 3ITPA 5JPNC 1AEXA 2KHSA 3ZYYX 1GUTA 1STNA 1DOLA 5D3DA 3V96A 4XYQA 3CHBD 2NVQB 2R6GA 1G8ZD 1Y69U 1DONA 1DOMA 4JBWA 4ZUIA 5BN4A 2PQEA 3P1HA 5JJZA 1YNJC 4RKBA 5AFWA 1BOSA 1D5ZC 3R8BA 1B2TA 2D5DA 3PUYA 3R3OA 3M7NA 2RDGA 1EY7A 2TSSA 1OXUA 4C3JG 3M4YA 2E75C 3NWTA 1V8QA 2SNSA 2CQAA 3DWAA 1AW7A 3HKZB 2JP1A 1O80A 1AP0A 1Q12A 1EOTA 1DXMA 2WKDA 3PUXA 3NK9A 5F2DA 4FF4A 3PV0A 1D1KA 2F0MA 2EY2A 4WRDA 4B9XA 4K6LA 5ELEA 4K8IA 1IW7C 1TWHB 1E0BA 3K5OA 3ONAB 3DEOA 1ESFA 2B8GA 4X3TA 2A69C 2NTSA 1PTOH 3GTMB 3ND9A 3J7YW 2K28A 3HOUB 3GV6A 3VR3A 2FHTA 1EZ6A 3K5NA 2SOBA 2K05A 1G91A 2I07B 2EY5A 4QCLA 5ISRA 1A2UA 1TWGB 1KDAA 2KECA 2VXWA 3TP6A 5D14A 2F0PA 1EU3A 2RA4A 3NUCA 2JEBI 1EIHA 4Z9CB 3S16B 3S1RB 3PUZA 4G4KA 4K6DA 1UNSA 2XN9C 3QOJA 3BVMA 4V190 1U4LA 3FDTA 1TT2A 2A73B 4M1UB 2WACA 3D4RA 3Q0AA 1JQYD 3A56A 3AMUA 1CHPD 4OIJA 4HMIA 1S5ED 3K5MA 2R93B 1SE3A 4KY5A 4MHEA 3HOXB 1ENAA 1Y8PB 1EYCA 4TQUS 4KHVA 4EQNA 4IUNA 3J80L 4ZRZA 5ELDA 3KF8A 5A2QE 1F9SA 1O78A 2BE5C 1HUNA 1B9MA 3SK6A 4IN3A 3U9SA 1SXTA 1XWEA 3CKIB 2BE5D 3I90A 5FK9C 4C3IG 3SDZA 4RGNA 4KMUC 4IALA 2F0LA 4DNRB 1NAPA 3TP5A 4CKCA 4IUUA 3GQBA 1BXTA 1OXSC 1MGSA 1SMYD 1WCMB 3T4AC 5K36G 3PUVA 2NVYB 3DXJC 1SYEA 2KEEA 1SEBD 4PMCA 5COYA 2JEAI 2Z1CA 1VMCA 1R4QB 1CA5A 2A6EC 1SJED 2NN6G 2WAQB 2JA5B 1LV9A 1A3VA 1ML0D 1LACA 2Z8LA 1LLRD 4K2KA 2O2LD 1WD0A 3HOVB 1IL8A 3I72A 4L8JA 1KDCA 2G9HD 4BY1B 1H9MA 4DAYA 5LL6S 1E2ZA 2LKVA 3NHHA 4KKTA 4XTCS 3MXPA 1TS4A 2VB3X 1SE2A 5EBCA 1EIGA 4DK1A 5IGDA 2MP1A 4KD3A 3X3NA 4Q5VA 3FPPA 2EJFC 2K04A 3MVVA 3MC0B 1CQFA 2ENBA 3PIO3 1FR3A 1PZJD 5E3FA 5KNBA 4FF1A 4RHSA 4K5XA 2NB0A 1KNAA 2WIIB 5K36H 2QCPX 1PZID 4RHRA 4NDXA 2XWBB 3SE0A 1X3PA 3H09A 1Q1EA 2F0GA 4ZKBB 1ZEQX 2O4XA 4IUTA 4IUQA 4O42A 5EKKA 2Q8RE 4NP5A 4KHZA 1A3UA 2F3VA 3A7LA 1WTXA 3C2PA 3A55A 2AQ2B 3JAME 4A93B 2IX0A 2NZ1D 4J1MA 1B9NA 1SBBB 4RCOA 1GHJA 4RFBA 5IGGA 1TU2B 2R3ZA 5I6YA 1QCBD 3E6ZX 1DJRD 2HCCA 1L0YB 3CRLC 4LJZC 1O7LA 1X3QA 5C5LA 1O7ZA 5KGUA 4XT1B 4BBRB 2AQ1B 3RZDB 3ERQA 1LT6D 4KI0A 2KCCA 1K83B 4QB4A 5KYIA 4X3SA 5DNFA 3VYSA 4DK0A 3TBIB 3S2HB 2FMMA 3BYTB 4G7ZC 3QOLA 1PTOF 3ND8A 1CTMA 4E6IA 4OHJA 4EVOA 3I91A 1I4GA 2B2VA 5EBDA 1V1PB 1RD9D 2RDFA 3D31A 3J81E 1V1OA 3MFYA 1DM0B 3BYYB 5JVG3 1T5EA 4IURA 2KCNA 1VF5C 4ZKCB 3GTKB 4Q0FA 3J7AF 3FEWX 2JYOA 3WDNA 2RSNA 2C5CA 2L0CA 4F8MA 3QJYA 4C3HB 2F1MA 1S5BD 1H9KA 2EYPA 1RHPA 1MD2D 5JEAJ 1JWMD 3NBIA 5G3LF 3HGBA 3CRKC 4BS9A 2JA7B 2DNCA 2NN6I 1KLGD 1PTOB 4OO1I 3EJIA 2LFNA 2BA0A 4HTHA 2NYZD 3KBGA 3KUPA 1W6JA 2NBFA 2YU9B 2X69A 2A6HD 1AZPA 2B2UA 1S5CD 5IT9E 3RZOB 1NUCA 2A68D 1J9OA 5EPLA 5IGFA 1IYUA 1SYFA 2F0SA 2IJ0A 3GTQB 2PO4A 1B1ZA 1EWCA 2RVLA 5J1ZA 2DNEA 5C3EB 3J80E 1Y8OB 5IGBA 4MN3A 4CJ2C 5J39A 2KA7A 1MBYA 5C4HA 3RMHA 1JR0D 2SNMA 1RKNA 3WOEA 1F9RA 4M8AA 2EZVA 2NTTA 5K5PA 4DA2A 3DWPA 2PW7A 5I6WA 3VA7A 3VYRA 3L9AX 2QKIC 2Y0SB 4L6TB 4XIGS 4C3JB 1ILQA 2ZXOA 2OXPA 1B50A 4NKLA 4S3SA 3T51B 5DEHA 1TWFB 3O13A 5EPKA 1M4VA 1TY0A 5I2YA 1I6VC 5I2XA 2EYOA 1Z6HA 3DM1A 3TDQA 1HRJA 3IL8A 1EWHA 4HMJA 4QUCA 1JCKB 1IHZA 2EY1A 4BA1I 1KAAA 3NP8A 3C3LA 3BVGA 1ZKOA 3W2DA 1XXGA 1T5XD 2EDGA 3S1QB 2CHBD 3AU7A 2XWJB 3GP7A 4RCNA 4DNTB 2K5QA 3D6WA 2FMCA 2XVSA 3EQLC 3OW7A 2EYHA 3DWQA 1HCZA 1PTOD 2XIWA 1L0XB 5FLXE 5EKLA 1NR4A 2B2UC 4QMGA 1D6EC 2AWNA 1EFID 3N6RA 5EJWA 4RH6A 3HOZB 4HSPA 1VDZA 4EQOA 5FO8B 1EY9A 2SEBD 2QEJC 3NTHA 4N9TA 4Y7NB 1H9RA 2IX1A 1G2SA 1Y8NB 1GUNA 1M8AA 1BCPF 1R9TB 1BUVT 2ZXPA 1EQTA 5C4JB 4ZLTF 2HUGA 3P75A 2KUMA 2F0HA 3H94A 2M2LA 1PZKD 1I4PA 1JORA 1EEID 1HTLD 5G3LD 1ESRA 1KDBA 1LT3D 4C56C 1CQVA 4O1NA 2CVRA 2Q8TA 1K8MA 5T1GA 4DGZA 3SVMA 1XYIA 5M3MB 1D2BA 2B8FA 3D4WA 3S15B 1JWSD 1CM9A 1NR2A 2PMZB 1DZ1A 1ZXTA 1U9RA 1I4QA 1BCPB 1QB5D 2NVXB 1B53A 4F87A 2BA1A 3RLFA 3C1EA 1F2MA 2F0FA 1GJXA 2O5JC 3GTLB 2KEDA 4IFDJ 1JOQA 1IKMA 3IFTA 1J8IA 3M3YB 1OXVA 2E2HB 2F0NA 3K0YA 3BVZA 1FNWA 1JC7A 3PUWA 2OT2A 4I65A 4QUFA 3M4OB 1LTGD 3VYTA 1BNZA 1TIID 1BF4A 2DN8A 3H3VC 1HFNA 1S5FD 4K8JA 3H0GB 1SNOA 1PXUA 2F0DA 3PIP3 2EJMA 5CV8A 4EGVA 1STHA 4DXGA 2EYFA 3WOFA 2EYLA 4XT3B 1GOZA 3OWEB 1LTSD 2L1BA 1STBA 2H1EA 1SMYC 5EQ0A 3H6MA 2R7ZB 1OO9B 3NQIA 1Z47A 2WINB 3KBXA 1YNND 1HUMA 2KVMA 4C2MB 1Q3LA 5CC4A 1XX8A 4DU9A 4ZYSA 3N52A 3DEPA 4NW2A 2R92B 2IWHA 2ICEC 1Q90A 1WTVA 1EEFD 4F88A 5JEAG 4ABNA 1QNUA 3A7AB 1WTWA 1QWYA 2F0WA 1STAA 1SDFA 3MXGA 1II3A 3A8KE 5CR3A 1TWAB 4OO1G 3CU7A 3K59A 3IAYA 3KLRA 1R4PB 4FXGC 2D9UA 5JVH3 4ME5A 1BCPD 4DFAA 2KOLA 2K32A 3D6CA 1XTCD 2WB1B 1X32A 2F4IA 1SE4A 4RA8A 2C9OA 2JA8B 2D62A 2E2DC 2MHVA 5JPMC 2B2YC 1TR5A 2F0OA 3Q22A 1PRTF 3AB9A 1DD2A 3S1MB 4HCEA 4U673 3MXUA 4ZK9B 5C5MA 2L5TA 5M5WB 1D1IA 4TRDA 1SNPA 4CHTB 4IQZA 2L55A 3NTKA 1EY5A 3VR2A 2IL8A 3S14B 3P7JA 3SR1A 1SNQA 5IIFA 4AYBB 5D3IB 3DMUA 4KKSA 1UUPA 3KLSA 3C46A 3EROA 3GTPB 1BDOA 4PMWA 4KN7C 3TP7A 3P20A 4IUVA 4FXKC 2K33A 1TS3A 2A5HA 2B2WA 1QILA 5M9OA 1AFPA 5C44B 1JWUD 1DYQA 4A3KB 5JEAH 2PZTA 1LT4D 2NVTB 2K03A 3I73A 2VB2X 2I46A 1ZYRD 1HHVA 2NN6H 4OO1H 2K7VA 4IZ8A 4YIJA 2E76C 3MFGA 3MZ5A 4HAEA 1QE6A 5M3FB 1D5XC 1BR9A 3SK8A 1EY0A 1PDQA 2WV6D 1ENFA 4KN4C 3GV3A 5CV4A 5DM63 4GZYC 1OXXK 3PO3B 1MI2A 3I8ZA 1BQQT 4CJ1B 5CV9A 3OIPA 4XYOA 1SNCA 4JK1C 2IX3A 1STEA 2NUCA 1A2TA 2K01A 4CKBA 2AWOA 5IGCA 4NMZA 2R61A 3HZXA 3S17B 5C0XI 5DM73 2B2TA 4DAVA 5C0XJ 4PQXA 3R93A 1LTBD 1V1PA 3Q24A 4KJOA 2ZT9C 4CBVA 5KEEA 3S9WA 1QG7A 1F2ZA 2F0VA 2G9DA 1GHKA 4DF7A 3SHLA 1EY6A 1ENCA 4WJWA 2XRSD 1B4OA 1TWCB 3TZUA 2HQEA 5A2QL 1Y1WB 2LMCB 1ONLA 1C4QA 2ID0A 3L3OC 4LMQD 1UAPA 2AUJD 3OIQA 5KNCA 1SYGA 3SXHA 5I4DA 4A3MB 3I4NB 5CBAE 1PLFA 5ELBA 2QF7A 3OHXC 2B2WC 3U9OA 2CW0D 5DAUA 5E1FA 1QOHA 1S4ZA 4DN4M 1PRTD 1E2VA 2J0TD 4RGOS 2L9HA 4IFDG 3HRZC 3SEBA 3BG3A 3K5LA 2A6HC 1EYDA 1LTAD 1F9PA 3HG9A 2A68C 3VA5A 2WP8J 1SNDA 4OIKA 4WFN3 2PPBC 2PW5A 3X3MA 1KNEA 1HA5A 2H4OA 1JOOA 2QDBA 1SYDA 2DY7A 4N9PA 2VNUD 4KV6A 3DUZA 1PFMA 3MTSA 3E5SA 4ZAIA 5E4XA 1EQVA 2GA4B 3SK5A 3LNNA 2J7ZA 3MAQA 2HDLA 1TQOA 2PCFB 4H0LC 3GTOB 2F0EA 1Y1VB 2K6AA 2FINB 4BBSB 3OMGA 1I6HB 3URYA 2EJGC 3K7AB 4BWGB 1F77A 4CKEA 3EFXD 2B2TC 4J6HA 1RTNA 3PMFA 2F0IA 1KLUD 3H91A 1FD7D 1O7YA 3BZDB 1CT1D 5KYLA 1WVLA 3VR5A 2RKSA 1CK1A 4C3HG 2JSOA 3I4LA 5CV7A 2J4XA 5J22A 1D5MC 2EPBA 2XNAC 1EU4A 2HDMA 3OPOA 3E0JA 5NUCA 4RKLA 1LT5D 1RF2D 2O5IC 5ELFA 1ET6A 3HOWB 1CI3M 3FVQA 1I3QB 2KQ3A 2LS01 1PTOC 2PZUA 5I9PA 1STGA 4XDXA 3K58A 1V43A 2BOSA 1A6XA 5LHY1 3KLSX 3MXNA 1C8CA 4TSSA 4A3DB 2AQ3B 3JAML 1U4RA 2Z4IA 5TSSA 2VUMB 5FO7B 4XQJA 5I9OA 4K14A 1GUWA 5IODA 1YNJD 2TMPA 3NPPA 2MPMA 4KY6A 3OSOA 1TS5A 4ULLA 1H9JA 1HTPA 3TMEA 1K8OA 4K5WA 4K5VA 2MJ8A 2XSCA 2BCOA 2PYKA 5CMDA 4KJNA 4KK7A 4A3JB 4XQQA 3S2DB 1EZ8A 1PYWD 4A3FB 5FO9B 2K5DA 1EY4A 4G57A 5JOBA 3Q23A 1EY8A 1TS2A 1RCVD 1SYBA 3V2TA 1BO0A 4RGMA 1H9SA 3A54A 1DCZA 3K6OA 2M9VA 3OWFA 1I4RA 3PO2B 4BA2I 2K1BA 1MSHA 2JA6B 1EYAA 3C1FA 1IW7D 4FF3A 3HS0C 4RGTA 1H9SB 3MHBA 1TVXA 3J7AV 5C4XB 1JICA 1GUGA 5EGTA 1RDPD 2F3WA 2A69D 3J81L 4C3IB 3IFDA 2HCIA 2MGSA 2F0JA 1HFGA 2Z4HA 2E74C 1LTTD 5CGKA 3FRPB 4IUPA 3LWEA 1HXYD 4I7ZC 4A3BB 2RSOA 4IFDI 3LX0A 3VYUA 1LTID 2EVBA 5E4WC 1B3AA 1UEAB 4R8NA 1CHQD 2B2YA 2K5WA 1G6ZA 5LL6X 1SSOA 4HR7B 1JOKA 5CV5A 5T1IA 1RTOA 2X6GA 3FMCA 4C1NI 2ZXRA 3L7ZC 1PMRA 3QWNA 5D65A 3MA2B 5C0XG 2V4DA 1IYVA 5IT9L 1S5DD 2IPKD 2OEOA 5JAVA 3I70A 4A3IB 1STYA 3TN2A 1CA6A 1QJOA 2EE1A 1YNNC 2XRQD 1G2TA 1VF7A 1FNUA 3VR6A 3HEJA 3MEHA 2IW3A 2KJXA 1TKWB 4HN7A 1PFBA 4FXDA 5CORA 3R2TA 4U68A 5EPJA 4XQNA 1W6KA 1B44D 4G7HC 4FNFA 4KTAA 4FP5D 1GUOA 3OMCA 1F2LA 1EL0A 3S1NB 1I4HA 2QILA 3G7LA 3NXWA 4R8IA 5ELCA 3T16A 5KNDA 2B39A 5BN3A 1BCPC 3V05A 3A8IE 1SNMA 4TKOB 5CV6A 1F9QA 1Q8IA 3GD7A 4ID6A 2A74C 4RWSC 1U4MA 1GXDC 5EKIA 3M7GA 2EY6A 5FOBB 2BDOA 2A6ED 3TSSA 4QIWB 2E2IB 4KD4A 3TP8A 2EXZA 5C3WA 2Q8IB 2L11A 5C0XH 1KTKA 2F0QA 1AZQA 4FF2A 5BN5A 3T53B 1F2YA 4DXFA 4V0BA 4DAPA 3QB3A 3FPUB 3NSWA 1WD1A 4PNYA 3NWSA 4OL7A 5FLXL 4P2CB 4HSVA 1HA6A 4UDUC 3GTGB 2PNRC 2F0TA 3QG1A 5CBEE 1LTRD 4ODGA 1Q1BA 2D2CC 3LWUA 4G7OC 4J8QA 3BDOA 1VMPA 5M5YB 4BY7B 4QF4A 4B08A 1MSGA 1JE4A 3T13A 2AUKA 1LABA 4LK1C 1ZYRC 4KY7A 4LAAA 4H13C 4UAIA 1PRTB 3RD4A 1A3TA 5HGTA 3GTJB 3BS1A 4R9WA 3OOCA 2B63B 4WORA 2OF1A 1VCIA 2ICIA 2SDFA 4FO2A 1WTPA 1SAPA 1QNKA 4FYDA 4A3EB 2L4NA 1AN8A 3BDCA 3MWYW 4OGQC 1IKLA 3TZDA 4XXEA 3FKIB 1G291 2LY7A 5KRUA 3G6JB 5CYUA 1OXTA 4CGYB 1RODA 5IGEA 4HEDA 1HQMC 3EVQA 5FKAC 1WTOA 4C1NK 1LO5D 3R2IA 3IKJA 3CQZB 2JE6I 1KABA 4FVMA 5C4ZA 2M00A 1Z7TA 4L63B 5M5XB 3UI2A 4B9WA 1WTRA 3BDLA 2E2JB 5C6AA 1HPCA 3NQTA 1SFOB 2EYJA 4ZUJA 4K2LA 2IT1A 2PZWA 4MIUA 2CW0C 5IOCA 4PMBA 3D4DA 1JB3A 1FYCA 1ICWA 2DY8A 1NCVA 1U4PA 1PRTC 3M85A 3RUZA 2RQXA 3A8JE 3VR4A 2L12A 4ILWA 5KIXA 1C48A 1FNVA 2X6LA 2F0KA 2N88A 3QIAA 2N55A 4ZQ3A 2WKCA 1NSNS 1SJHD 1DOKA 1A15A 3D8GA 2MUYA 3W3AA 5A35A 1SYCA 1RJTA 1BBXC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8I B;  5C0X G;  1H9J A;  2ZT9 C;  5C0X H;  1HTP A;  2V4D A;  4KKS A;  1GUS A;  1I6V C;  2JEB I;  1IYV A;  2EJG C;  1K8O A;  1BDO A;  4JBW A;  3WDN A;  1Z6H A;  2A6E C;  3T53 B;  5BN5 A;  1EWH A;  1GHK A;  5BN4 A;  4KN7 C;  1HQM C;  2NN6 G;  3P20 A;  1K8M A;  1YNJ C;  3PUZ A;  2JXM B;  3TZU A;  3QJY A;  2K33 A;  1QJO A;  4KHZ A;  2F1M A;  3A7L A;  4BA1 I;  1H9K A;  3IKJ A;  1LAC A;  2JE6 I;  2LMC B;  1ONL A;  1B9N A;  2B8F A;  3HGB A;  1YNN C;  3CRK C;  2D5D A;  1Q90 A;  1ZKO A;  2PNR C;  3PUY A;  3VR5 A;  3D4R A;  1VF7 A;  1GHJ A;  3QG1 A;  3M7N A;  2DNC A;  5JEA G;  1TU2 B;  2AUJ D;  1OXU A;  3M4Y A;  2NN6 I;  5JEA H;  3A7A B;  2E75 C;  5KNC A;  1Z7T A;  3I4L A;  3I72 A;  1V8Q A;  2BA0 A;  2EDG A;  3CRL C;  4L8J A;  1E2W A;  3I73 A;  1Q1B A;  4LJZ C;  3VR6 A;  2D2C C;  1O7L A;  3LWU A;  2QF7 A;  2YYZ A;  1H9S A;  4RCN A;  4DNT B;  4G7O C;  1DCZ A;  2A6H D;  1TKW B;  3BDO A;  3A8K E;  2BA1 A;  4BA2 I;  4OO1 G;  1Q12 A;  2NN6 H;  3EQL C;  1Y8P B;  3RLF A;  3OW7 A;  1DXM A;  1HPC A;  2K7V A;  1IW7 D;  2A68 D;  3PUX A;  4OO1 H;  1H9M A;  2E76 C;  4KI0 A;  4KKU A;  4TQU S;  2O5J C;  1GJX A;  1IYU A;  1HCZ A;  3KLR A;  1H9S B;  2KCC A;  3OPO A;  1E2Z A;  3PV0 A;  3IFT A;  1E2V A;  2AUK A;  1LAB A;  1GUG A;  2O5I C;  4IFD G;  4KKT A;  4XTC S;  4LK1 C;  2A69 D;  3BG3 A;  4G7H C;  2DNE A;  1OXV A;  3NE5 B;  2IT1 A;  1O78 A;  1GUO A;  2A6H C;  4H44 C;  1CFM A;  1Y8O B;  1ZYR C;  2BE5 C;  4H13 C;  2CW0 C;  1B9M A;  2K32 A;  4KN4 C;  2E74 C;  3PUW A;  1CI3 M;  1IW7 C;  1FYC A;  2A68 C;  3N6R A;  4DK1 A;  4DK0 A;  2KA7 A;  3U9S A;  1VDZ A;  2DN8 A;  4GZY C;  1OXX K;  4I7Z C;  2PPB C;  2BE5 D;  3T56 B;  3M85 A;  3OOC A;  5KND A;  2B8G A;  2D62 A;  3A8J E;  4G7Z C;  3VR4 A;  2A69 C;  3SDZ A;  3FPP A;  3ND8 A;  5BN3 A;  1CTM A;  1H9R A;  1VCI A;  4KMU C;  3ND9 A;  2EJF C;  3A8I E;  3AB9 A;  2EVB A;  1V43 A;  1DD2 A;  4JK1 C;  1Y8N B;  4DNR B;  1GUN A;  4TKO B;  1FR3 A;  4PV1 C;  1A6X A;  3GD7 A;  5KNB A;  3VA7 A;  3GQB A;  3VR3 A;  3MXU A;  1OXS C;  4IFD H;  2L5T A;  4HR7 B;  2AWO A;  3QIA A;  2EJM A;  3D31 A;  5K36 G;  3PUV A;  3MFY A;  4OGQ C;  3DXJ C;  3H94 A;  5K36 H;  4XIG S;  1GUT A;  3LNN A;  4IQZ A;  1G29 1;  2BDO A;  2A6E D;  3FMC A;  3SE0 A;  1T5E A;  3VR2 A;  3W3A A;  5A35 A;  3L7Z C;  1PMR A;  2PCF B;  2R6G A;  1Q1E A;  1SMY C;  1VF5 C;  4H0L C;  3T51 B;  1Y69 U;  2JEA I;  1OXT A; 
#chains in the Genus database with same CATH topology
 4X3U A;  1GUS A;  2BDN A;  1CKM A;  1WTQ A;  4A3C H;  1ET9 A;  4RAU C;  3HOY B;  1CZW A;  5C3X A;  2JXM B;  1ILP A;  3I4M B;  2FFK B;  1G51 A;  3Q6S A;  4JYA Q;  3SK4 A;  1HQR D;  4EQP A;  1HNZ Q;  3B6Y A;  4A75 A;  4X3K A;  2NWG A;  4H7B A;  3I3C A;  4F7X A;  4L5T A;  1PFN A;  1E2W A;  1Y1W G;  1I50 B;  3IRB A;  2YYZ A;  3D3R A;  2F03 A;  2Q2T A;  3HP3 A;  1TY2 A;  1I4X A;  3EA6 A;  1FGB D;  3F2U A;  1AE2 A;  2FJ2 A;  1VS0 A;  2RBM A;  4KKU A;  1J5E Q;  1LUZ A;  3K57 A;  4A3M G;  3KK7 A;  2CWP A;  4OWX B;  2MO0 A;  3NE5 B;  4GLA C;  4H44 C;  4CJ0 B;  4DUY L;  1CFM A;  4HCS A;  4A3G B;  2VW9 A;  1JB7 A;  4A93 H;  2RDH A;  4DR2 L;  2WFW A;  5HUR A;  3S24 A;  3T56 B;  1QVG A;  2EOT A;  2B2V C;  3NBH A;  1B70 B;  2AMC B;  3NTI A;  2EYM A;  5IY0 A;  3QO2 A;  1XMQ Q;  4PV1 C;  2F0U A;  4JI3 Q;  1MKH A;  1CZG A;  1M1K C;  3GO5 A;  4DV0 Q;  4IFD H;  4BBR H;  3DHQ A;  3ITP A;  1VQ6 A;  3RZD H;  5JPN C;  1AEX A;  2K5N A;  2KHS A;  3ZYY X;  1GUT A;  1STN A;  1K83 H;  1DOL A;  5D3D A;  3PCO B;  3CCJ A;  1EFW A;  1UEB A;  3V96 A;  4XYQ A;  3CHB D;  2NVQ B;  2R6G A;  1G8Z D;  1Y69 U;  1DON A;  3RLN A;  2V1C C;  2IHE A;  3S2H H;  2QW7 A;  1I5F A;  1DOM A;  2YV5 A;  2VQF L;  2CH4 W;  1YHA A;  4JBW A;  4HIK A;  4ZUI A;  5BN4 A;  1Y1V G;  2PQE A;  3P1H A;  5JJZ A;  1YNJ C;  4RKB A;  1XPO A;  5AFW A;  1PYB A;  1BOS A;  1D5Z C;  5DLQ E;  3R8B A;  1B2T A;  5JJL A;  2Y0S G;  2D5D A;  3PUY A;  3R3O A;  3M7N A;  2RDG A;  1EY7 A;  2TSS A;  1OXU A;  1PYS B;  3M4Y A;  4C3J G;  1S3O A;  2E75 C;  3NWT A;  1V8Q A;  4OX9 L;  2SNS A;  2CQA A;  3DWA A;  1AW7 A;  3HKZ B;  2JP1 A;  1O80 A;  1AP0 A;  3GTK H;  1Q12 A;  1EOT A;  1DXM A;  2WKD A;  1N8R C;  3PUX A;  3NK9 A;  5F2D A;  1K73 C;  4FF4 A;  4GOP A;  3PV0 A;  1YJW A;  5JJI A;  1D1K A;  2F0M A;  2EY2 A;  4WRD A;  4B9X A;  4K6L A;  4C3H H;  5ELE A;  4K8I A;  4GOP B;  1IW7 C;  1TWH B;  4OXP A;  2BH8 A;  1E0B A;  3K5O A;  3ONA B;  4HJ9 A;  4JI0 Q;  3DEO A;  1L2F A;  1ESF A;  2JA7 H;  2K5V A;  2B8G A;  4X3T A;  4JI1 Q;  2A69 C;  4QJF A;  2NTS A;  1PTO H;  1KHI A;  3GTM B;  3ND9 A;  3J7Y W;  3TRE A;  1YJ9 A;  2K28 A;  1ASZ A;  2YU9 H;  3HOU B;  1NJI C;  3GV6 A;  3VR3 A;  2FHT A;  3ULJ A;  1EZ6 A;  1IXR A;  2VQF Q;  3RZO H;  3K5N A;  2SOB A;  2K05 A;  4LF7 L;  1G91 A;  2I07 B;  3GTQ H;  2EY5 A;  4QCL A;  1IYJ B;  1KIX A;  4YHH Q;  5ISR A;  1A2U A;  5IYC H;  1TWG B;  2ALY B;  1KDA A;  2KEC A;  5C3E H;  2CWA A;  3TRZ A;  2VXW A;  3I55 A;  2VQE L;  3TP6 A;  5D14 A;  1XPR A;  4YCU A;  4P74 A;  2F0P A;  1EU3 A;  2RA4 A;  1E24 A;  3NUC A;  2OCE A;  1YIJ A;  2JEB I;  5GRO A;  1EIH A;  4FDB A;  1UE1 A;  2Y0S E;  4Z9C B;  3E0E A;  3S16 B;  3S1R B;  3PUZ A;  4G4K A;  4K6D A;  1UNS A;  4EQ5 A;  2XN9 C;  1A62 A;  3QOJ A;  4DV7 L;  3BVM A;  4V19 0;  1U4L A;  3FDT A;  1TT2 A;  2A73 B;  1X55 A;  1U0L A;  4M1U B;  2WAC A;  3KOJ A;  3D4R A;  3Q0A A;  1JQY D;  1HZA A;  3A56 A;  3AMU A;  4C3J H;  1CHP D;  4OIJ A;  4DR7 L;  2RHS B;  4HMI A;  1S5E D;  3K5M A;  2R93 B;  4ZCK A;  4DPG A;  3K8A A;  1SE3 A;  4KY5 A;  4MHE A;  1TWF H;  3HOX B;  1ENA A;  1Y8P B;  3L0O A;  1EYC A;  4TQU S;  4KHV A;  4MTK A;  4X65 Q;  4EQN A;  4IUN A;  3J80 L;  4ZRZ A;  2Z9H A;  5ELD A;  3KF8 A;  3PO2 G;  2ZTD A;  5A2Q E;  1F9S A;  3BU2 A;  3J80 i;  1O78 A;  2BE5 C;  4JI8 Q;  4DV4 L;  1HUN A;  1B9M A;  4MTN A;  1EQQ A;  3SK6 A;  4IN3 A;  3U9S A;  1YHB A;  1EWI A;  1SXT A;  2XTI A;  3TEH B;  1XWE A;  4LF7 Q;  3CKI B;  3G4S A;  3RN2 A;  2BE5 D;  4GOP C;  3I90 A;  5FK9 C;  4C3I G;  2JA9 A;  3SDZ A;  1UE6 A;  4RGN A;  4AH6 A;  4KMU C;  4IAL A;  2F0L A;  4DNR B;  2VQE Q;  1NAP A;  3S1Q H;  3TP5 A;  4CKC A;  4IUU A;  3GQB A;  4YWM A;  1BXT A;  1OXS C;  2UXC Q;  1MGS A;  1SMY D;  1C9O A;  1WCM B;  2EIF A;  3T4A C;  5K36 G;  2DUD A;  3PUV A;  2NVY B;  3DXJ C;  1UE5 A;  4NXM Q;  1SYE A;  2KEE A;  2UXD Q;  1SEB D;  4PMC A;  1NE3 A;  5COY A;  3NEM A;  5GAE C;  2JEA I;  2C35 B;  2Z1C A;  3HOZ H;  4JI2 Q;  1VMC A;  1R4Q B;  3STB D;  1YNX A;  4K0K L;  1CA5 A;  2A6E C;  2E8G A;  1SJE D;  3NEN A;  4Y7N H;  1IBM L;  2NN6 G;  2WAQ B;  1HR0 Q;  2JA5 B;  1LV9 A;  1E7Z A;  1A3V A;  1ML0 D;  4R4Q A;  4AQY Q;  4DV5 Q;  2CQO A;  1R9T H;  1LAC A;  2G5D A;  4JI5 Q;  1KC8 C;  2Z8L A;  2NZO A;  1LLR D;  4K2K A;  2O2L D;  5C4J H;  1WD0 A;  3K0X A;  3HOV B;  3AFQ A;  1IL8 A;  3I72 A;  1BVS A;  4L8J A;  1KDC A;  2Q2I A;  4DV4 Q;  1E3P A;  2G9H D;  4BY1 B;  4GLV B;  3ZJY C;  1H9M A;  4DAY A;  5LL6 S;  3LGJ A;  3UDF A;  1E2Z A;  2UUA Q;  4YWL A;  4DUZ L;  2LKV A;  3NHH A;  4KKT A;  4XTC S;  3MXP A;  1TS4 A;  2VB3 X;  5IYB G;  1SE2 A;  1QUQ A;  5EBC A;  1EIG A;  4DK1 A;  5M3M H;  5IGD A;  2MP1 A;  4KD3 A;  3S15 H;  3X3N A;  1QUQ B;  4Q5V A;  3I56 A;  1VQB A;  3G71 A;  3FPP A;  3SGI A;  1KAW A;  2EJF C;  2K04 A;  3MVV A;  3MC0 B;  4LUZ A;  4JI4 L;  2R7D A;  1CQF A;  2ENB A;  2K52 A;  1FR3 A;  3PIO 3;  1PZJ D;  5E3F A;  5GAD C;  5KNB A;  2EQS A;  2NVX H;  3CC2 A;  4FF1 A;  4RHS A;  4LUO A;  4K5X A;  4JBK A;  2NB0 A;  1KNA A;  3GTL H;  3FP9 A;  4QL5 A;  2WII B;  5K36 H;  2QCP X;  1IBM Q;  4LF8 Q;  1PZI D;  2YTY A;  4RHR A;  4NDX A;  3KF6 A;  3M3Y H;  2XWB B;  3SE0 A;  2E2H H;  3H09 A;  1X3P A;  1Q1E A;  2F0G A;  4ZKB B;  2WB1 G;  4OEM B;  1Q82 C;  3M4O H;  3KF6 B;  1ZEQ X;  2O4X A;  3F8T A;  2JA8 G;  4IUT A;  4IUQ A;  4O42 A;  4KHP Q;  4QY7 A;  5EKK A;  4IPH A;  2Q8R E;  3H0G H;  4NP5 A;  4KHZ A;  1A3U A;  2F3V A;  3A7L A;  1WTX A;  3C2P A;  3A55 A;  2AQ2 B;  4X66 L;  3JAM E;  1X65 A;  4A93 B;  2IX0 A;  2NZ1 D;  4J1M A;  1B9N A;  3W1G A;  1SBB B;  3BJU A;  1WOC A;  3A0J A;  4RCO A;  2CCZ A;  1GHJ A;  4DUZ Q;  4RFB A;  1T9H A;  5IGG A;  1TU2 B;  2R3Z A;  3BZC A;  5I6Y A;  1QCB D;  4DV3 Q;  2GVB A;  1VQ7 A;  1XNQ Q;  3E6Z X;  1DJR D;  2HCC A;  1L0Y B;  3CRL C;  4LJZ C;  1O7L A;  1X3Q A;  1PH5 A;  4PZ6 A;  5C5L A;  1O7Z A;  5KGU A;  4XT1 B;  5AJ3 Q;  1PFS A;  3E9H A;  4AYB G;  4BBR B;  2AQ1 B;  1I94 Q;  3RZD B;  3ERQ A;  2R7Z H;  1LT6 D;  4KI0 A;  2KCC A;  4X64 Q;  1K83 B;  4QB4 A;  5KYI A;  4X3S A;  4C2M H;  4BY7 G;  1D8L A;  2LXK A;  5IYB H;  5DNF A;  3PSI A;  1WI5 A;  4DR1 L;  3VYS A;  4DK0 A;  3TBI B;  3S2H B;  2FMM A;  2AKW B;  5C44 G;  2R92 H;  1X3G A;  4A3K G;  3BYT B;  2ZJR A;  3KJO A;  3CCS A;  4G7Z C;  1VQD A;  3QOL A;  1PTO F;  3ND8 A;  4O0A A;  1CTM A;  5E7N A;  4OHJ A;  4E6I A;  1H95 A;  1HNZ L;  5IYD G;  4EVO A;  3I2Z A;  3I91 A;  1I4G A;  2B2V A;  1B7Y B;  1TWA H;  5EBD A;  4CDE C;  1V1P B;  1RD9 D;  1EQR A;  3CCM A;  2RDF A;  3D31 A;  3J81 E;  1V1O A;  1O7I A;  2WB1 E;  3MFY A;  1DM0 B;  4OON A;  3BYY B;  5JVG 3;  4A3E G;  1T5E A;  1Q8K A;  1K3R A;  4IUR A;  2KCN A;  1VF5 C;  4ZKC B;  4POG A;  3GTK B;  4Q0F A;  4UP7 A;  4LFC L;  3D0F A;  3J7A F;  3PO3 G;  3FEW X;  3CC4 A;  4YWK A;  4RMF A;  4UY8 C;  3W1B A;  2JA8 H;  2JYO A;  3WDN A;  2RSN A;  2C5C A;  3KFU A;  2JN4 A;  1CKN A;  2L0C A;  5EAY A;  4F8M A;  2OTJ A;  3QJY A;  3S1M H;  2IY5 B;  4C3H B;  2F1M A;  1S5B D;  1H9K A;  2EYP A;  1RHP A;  1MD2 D;  5JEA J;  1JWM D;  5M5W H;  3NBI A;  5G3L F;  3HGB A;  3CRK C;  4BS9 A;  1XMQ L;  2JA7 B;  1CKN B;  4DR3 Q;  4JI3 L;  2DNC A;  4DV0 L;  2NN6 I;  4AYB E;  2VY3 A;  1KLG D;  1PTO B;  4OO1 I;  3EJI A;  2LFN A;  2BA0 A;  1M90 C;  4LF6 Q;  4HTH A;  1GM5 A;  2NYZ D;  3KBG A;  3KUP A;  1W6J A;  2NBF A;  4DR1 Q;  2YU9 B;  3PIP A;  2X69 A;  2A6H D;  3S14 H;  1AZP A;  2B2U A;  1S5C D;  5IT9 E;  3RZO B;  1BBW A;  1NUC A;  2A68 D;  1J9O A;  5EPL A;  2ATW A;  5IGF A;  1IYU A;  1SYF A;  2F0S A;  2K4K A;  3GTP H;  1YJN A;  2IJ0 A;  2KCM A;  3GTQ B;  2PO4 A;  1B1Z A;  1FVI A;  5HY6 A;  1YVC A;  1EWC A;  2RVL A;  2F3I A;  5J1Z A;  2MFI A;  2DNE A;  5C3E B;  3J80 E;  1Y8O B;  5IGB A;  5IE8 A;  4MN3 A;  4CJ2 C;  5J39 A;  4GKJ L;  2KA7 A;  1MBY A;  5C4H A;  1WJJ A;  2ZTE A;  1JR0 D;  3RMH A;  2SNM A;  5C44 H;  1YHQ A;  1RKN A;  4A3K H;  3WOE A;  1F9R A;  4M8A A;  2EZV A;  2NVT H;  2NTT A;  5K5P A;  3I4N G;  4JCV E;  4DA2 A;  2RCF A;  1NMF A;  3DWP A;  2PW7 A;  5I6W A;  4MZ9 A;  4LFC Q;  3VA7 A;  3VYR A;  3L9A X;  2QKI C;  1JT8 A;  1KRS A;  2Y0S B;  5M3F H;  4GLX A;  2JQO A;  4L6T B;  4XIG S;  4C3J B;  1EIF A;  1ILQ A;  2ZXO A;  2OXP A;  1B50 A;  4NKL A;  4S3S A;  4GNX B;  3T51 B;  5DEH A;  1X54 A;  1TWF B;  1W2B A;  2K75 A;  3O13 A;  5EPK A;  1M4V A;  2MNA A;  1TY0 A;  1PH1 A;  1VQL A;  5I2Y A;  3PO3 H;  1I6V C;  5I2X A;  2EYO A;  3CMA A;  1Z6H A;  1XTD A;  3DM1 A;  3TDQ A;  3IL8 A;  1EWH A;  4HMJ A;  1VQN A;  1HRJ A;  4QUC A;  4JI0 L;  1JCK B;  1IHZ A;  2EY1 A;  3E9I A;  4JI1 L;  5BR8 Q;  4BA1 I;  1KAA A;  3NP8 A;  1K28 A;  4NXN Q;  3C3L A;  3BVG A;  3KDF A;  1B3Q A;  3HOY G;  1ZKO A;  4DV2 Q;  2OTL A;  3W2D A;  1XXG A;  3S17 H;  4R4O A;  1T5X D;  4NPS A;  2EDG A;  3KDF B;  3S1Q B;  2CHB D;  3AU7 A;  2XWJ B;  3GP7 A;  4RCN A;  4DNT B;  2K5Q A;  3D6W A;  4GKJ Q;  2FMC A;  2XVS A;  4TVA B;  3EQL C;  4YHH L;  3OW7 A;  3CCQ A;  4H02 A;  5LMU L;  2EYH A;  4BBS G;  3DWQ A;  1HCZ A;  2QA4 A;  1PTO D;  3J7Z C;  1Q46 A;  2XIW A;  1L0X B;  2D0O A;  5FLX E;  2UUB L;  4JI7 Q;  2MQH A;  5EKL A;  1NR4 A;  2I5H A;  1TWC H;  2B2U C;  1PA6 A;  4QMG A;  1D6E C;  2AWN A;  3PIO A;  1EFI D;  4IO9 A;  3N6R A;  5EJW A;  4RH6 A;  3HOZ B;  4HSP A;  1Y1W H;  4OWT B;  1VDZ A;  4EQO A;  1HNX L;  5FO8 B;  2ZM6 L;  1SMX A;  1EY9 A;  1JJC B;  2SEB D;  2CH4 A;  2QEJ C;  3NTH A;  4A3G G;  4N9T A;  3FHW A;  4Y7N B;  1H9R A;  1XNR Q;  2IX1 A;  1G2S A;  1Y8N B;  1GUN A;  4P71 A;  4A3M H;  3I4N H;  3EBE A;  2RF4 A;  1M8A A;  1BCP F;  3U58 A;  3M9B A;  1R9T B;  1VQJ A;  1VQ5 A;  1BUV T;  5GAG C;  2ZXP A;  1EQT A;  5C4J B;  4ZLT F;  2HUG A;  3P75 A;  2KUM A;  2F0H A;  3EIV A;  1SLJ A;  3H94 A;  4WJ4 A;  2M2L A;  1PZK D;  1PV4 A;  4APV A;  4DV1 L;  3DLL A;  1I4P A;  4X65 L;  1JOR A;  1EEI D;  1HTL D;  4YY3 Q;  3HOW G;  1AH9 A;  5G3L D;  1ESR A;  3KJP A;  1KDB A;  1LT3 D;  4C56 C;  4JI8 L;  1VQG A;  1CQV A;  4O1N A;  3A5Z B;  2CVR A;  2Q8T A;  1YZ6 A;  1K8M A;  4GN4 B;  1K8A C;  5T1G A;  4DGZ A;  4HIO A;  3SVM A;  1XYI A;  2N8N A;  2LSS A;  4LUV A;  5LMU Q;  5M3M B;  1D2B A;  2B8F A;  3D4W A;  4JC0 A;  3S15 B;  1JWS D;  4A3D G;  1CM9 A;  3CF5 A;  3UDG A;  2VUM G;  3I4O A;  2UUB Q;  1NR2 A;  2PMZ B;  1DZ1 A;  2UXC L;  1ZXT A;  1FJG Q;  3K80 C;  1U9R A;  1I4Q A;  4JV5 L;  4P73 A;  1BCP B;  1QB5 D;  2DJF C;  3U4Z A;  2NVX B;  1P16 A;  1B53 A;  1VQA A;  2BA1 A;  4F87 A;  3GTO H;  1Y1V H;  1HNX Q;  4NXM L;  4DR6 L;  3RLF A;  2ZM6 Q;  3C1E A;  1F2M A;  2F0F A;  2JJQ A;  1GJX A;  2O5J C;  2UXD L;  3GTL B;  2GN5 A;  2KED A;  4BBS H;  4IFD J;  1I6H H;  1JOQ A;  1IKM A;  3K7A H;  3HKZ G;  3IFT A;  1J8I A;  3M3Y B;  4A3L G;  4JI2 L;  2Z0S A;  1OXV A;  1C7Y A;  4LF9 Q;  1JJ2 A;  2E2H B;  4L5R C;  2F0N A;  1UWV A;  3K0Y A;  3BVZ A;  3PUW A;  1FNW A;  1JC7 A;  2OT2 A;  4I65 A;  4QUF A;  4A3J G;  5J3B A;  1LTG D;  3VYT A;  1BNZ A;  1TII D;  1N34 L;  3M4O B;  1BF4 A;  2DN8 A;  4A3F G;  1HR0 L;  4L5S A;  3H3V C;  1HFN A;  1S5F D;  4AQY L;  4DV5 L;  1MJE A;  4K8J A;  4JI5 L;  5H1S E;  4DV1 Q;  4NB3 A;  5IP9 G;  2PQA A;  1KQS A;  5L37 A;  3H0G B;  1SNO A;  2JA6 G;  1PXU A;  2F0D A;  3PIP 3;  2PQA B;  2EJM A;  5CV8 A;  4EGV A;  1SE8 A;  1L1O A;  1STH A;  5FJ8 G;  4DXG A;  2EYF A;  3WOF A;  5C4X G;  2EYL A;  4XT3 B;  1GOZ A;  3PGZ A;  1WYD A;  4DR4 L;  3OWE B;  1X56 A;  1LTS D;  2L1B A;  1U5K A;  1STB A;  2H1E A;  1L1O B;  1SMY C;  2UUA L;  1N32 Q;  5EQ0 A;  3HOW H;  2MO1 A;  1I3Q H;  3H6M A;  4A3B G;  2R7Z B;  1OO9 B;  5IP7 G;  3NQI A;  1Z47 A;  2WIN B;  2HIX A;  2B29 A;  3KBX A;  1YNN D;  1HUM A;  4BXX G;  2YTX A;  2KVM A;  2VZA A;  4C2M B;  1Q3L A;  4JV5 Q;  5CC4 A;  1LTL A;  1XX8 A;  2Q2H A;  4DU9 A;  1ICF B;  1N33 L;  2DGY A;  4ALP A;  5JJK A;  4ZYS A;  3N52 A;  4DR6 Q;  4HJ8 A;  3DEP A;  4NW2 A;  2L15 A;  4LWC A;  2R92 B;  2IWH A;  2ICE C;  3STB C;  3CCU A;  1VQ8 A;  1Q90 A;  1WTV A;  1EEF D;  2XGT A;  4F88 A;  5JEA G;  1XMO Q;  4A3D H;  4ABN A;  1QVC A;  4X62 Q;  1QNU A;  3A7A B;  1WTW A;  3KLW A;  1E22 A;  2VUM H;  1QWY A;  2ZTC A;  5ELN A;  2F0W A;  4DKA C;  1STA A;  1SDF A;  3T1Y L;  1VQF A;  3MXG A;  1A8V A;  1II3 A;  4LF8 L;  3A8K E;  5CR3 A;  1N34 Q;  1TWA B;  4OO1 G;  3CU7 A;  4ME3 A;  3K59 A;  3IAY A;  3KLR A;  1R4P B;  4A3I G;  2ASB A;  4FXG C;  2D9U A;  2QEX A;  5JVH 3;  4CDC C;  4ME5 A;  3PF5 A;  4A3L H;  1BCP D;  4DFA A;  2KOL A;  2K32 A;  4KHP L;  3D6C A;  1XTC D;  2WB1 B;  4I7A A;  1X32 A;  2F4I A;  4A3J H;  4LFA L;  1SE4 A;  4A4I A;  3S2D H;  4A3F H;  4RA8 A;  2C9O A;  2JA8 B;  2D62 A;  2E2D C;  2MHV A;  4DR4 Q;  5JPM C;  2B2Y C;  1TR5 A;  2F0O A;  3Q22 A;  1PRT F;  3AB9 A;  3E3X A;  1DD2 A;  5IP9 H;  3S1M B;  4HCE A;  4U67 3;  3AEV A;  5FLM G;  4DV3 L;  3PO2 H;  3MXU A;  4ZK9 B;  5C5M A;  2L5T A;  1E1T A;  1XNQ L;  2JA6 H;  5M5W B;  2PMZ E;  1D1I A;  1EYG A;  4TRD A;  1B8A A;  3T1H Q;  5AJ3 L;  1SNP A;  5FJ8 H;  4LF5 L;  5C4X H;  4OEL B;  1I94 L;  4CHT B;  3UDI A;  2HIV A;  4IQZ A;  1N33 Q;  2L55 A;  3NTK A;  1EY5 A;  3VR2 A;  2IL8 A;  4C3I H;  2UXB L;  4X64 L;  3S14 B;  3P7J A;  3SR1 A;  1SNQ A;  5IIF A;  4AYB B;  5D3I B;  3DMU A;  4KKS A;  4A3B H;  1UUP A;  1L1O C;  3KLS A;  5IP7 H;  3C46 A;  3ERO A;  3GTP B;  1BDO A;  3RLO A;  4BXX H;  4PMW A;  4KN7 C;  3TP7 A;  2A1A A;  2H5X A;  3P20 A;  4IUV A;  3T1Y Q;  4FXK C;  1A0I A;  2K33 A;  1TS3 A;  2A5H A;  2B2W A;  1QIL A;  5M9O A;  4IPD A;  4YCW A;  1AFP A;  3ER0 A;  2N78 A;  5C44 B;  1JWU D;  2WAQ G;  1LM0 A;  1DYQ A;  4HJ7 A;  4A3K B;  1PH6 A;  1IL2 A;  2JA5 G;  1NY4 A;  5JEA H;  2PZT A;  1LT4 D;  2NVT B;  2K03 A;  3I73 A;  2VB2 X;  2I46 A;  1HNW Q;  1ZYR D;  4LFA Q;  3HOV G;  1HHV A;  2NN6 H;  4OO1 H;  2K7V A;  4IZ8 A;  4YIJ A;  2E76 C;  3MFG A;  3MZ5 A;  4HAE A;  1QE6 A;  5M3F B;  1D5X C;  1BR9 A;  4A3I H;  3SK8 A;  4N8X 1;  1EY0 A;  3WWV A;  1PDQ A;  1FGU A;  2WV6 D;  1ENF A;  4KN4 C;  3H3V I;  3GV3 A;  5CV4 A;  3L2P A;  5DM6 3;  1ASY A;  1OXX K;  3TQY A;  3PO3 B;  1MI2 A;  4GZY C;  3I8Z A;  1BQQ T;  4CJ1 B;  4LF5 Q;  5CV9 A;  3OIP A;  3I7F A;  3Q8D A;  4XYO A;  4JI6 Q;  5HGQ A;  1SNC A;  1WFQ A;  4JK1 C;  2IX3 A;  4MNO A;  2UXB Q;  4DV6 Q;  1STE A;  2NUC A;  3JAM c;  4DR3 L;  1RL2 A;  4HID A;  4P75 A;  1A2T A;  3ULL A;  5FLM H;  4QQB X;  4LF6 L;  1IBK L;  2K01 A;  4CKB A;  4A3C G;  2AWO A;  5IGC A;  2F4V Q;  1K9M C;  4NMZ A;  1GO3 E;  2R61 A;  4CDD C;  4A76 A;  3HZX A;  3S17 B;  5C0X I;  5DM7 3;  2B2T A;  5IWA L;  4DAV A;  5C0X J;  4PQX A;  3R93 A;  3RR5 A;  1LTB D;  1VQP A;  1V1P A;  3S1N H;  3Q24 A;  4KJO A;  1K0R A;  3CAM A;  4R4I A;  2ZT9 C;  3ULP A;  4CBV A;  3GDE A;  4UHV A;  5KEE A;  3S9W A;  1QG7 A;  2DJG C;  1F2Z A;  2B63 G;  2F0V A;  2G9D A;  1GHK A;  4DF7 A;  3SHL A;  1P8L A;  4IOA A;  4GS3 A;  1V1Q A;  1EY6 A;  1ENC A;  2UUC Q;  4WJW A;  2XRS D;  1B4O A;  1TWC B;  3TZU A;  2HQE A;  5A2Q L;  2EXD A;  1Y1W B;  2LMC B;  1ONL A;  1JE5 A;  2UU9 L;  1C4Q A;  2Z6K A;  2ID0 A;  3L3O C;  4QIW E;  4LMQ D;  1UAP A;  2AUJ D;  3OIQ A;  4DAM A;  3FKI G;  5KNC A;  1JMC A;  1SYG A;  2E5L Q;  4IJH A;  3SXH A;  2PI2 E;  2RCN A;  5I4D A;  4A3M B;  3I4N B;  1X6O A;  5CBA E;  1PLF A;  1HZB A;  4JOI A;  2QF7 A;  5ELB A;  3OHX C;  4YCV A;  2B2W C;  3U9O A;  1VQK A;  2E2I H;  3U50 C;  1QZH A;  2CW0 D;  3VDY A;  3J81 c;  5DAU A;  5E1F A;  1QOH A;  1HZC A;  1S4Z A;  2HHH Q;  4DN4 M;  1V9P A;  1Q86 C;  1PRT D;  1E2V A;  2J0T D;  4RGO S;  2L9H A;  3UE1 A;  4IFD G;  3HRZ C;  3SEB A;  3BG3 A;  3K5L A;  1KL9 A;  2A6H C;  1EYD A;  1LTA D;  1F9P A;  3JC6 6;  3QR8 A;  1NMG A;  3HG9 A;  1IBK Q;  2A68 C;  2WP8 J;  1SND A;  3VA5 A;  4OIK A;  4WFN 3;  2PPB C;  3GTG H;  3OTO L;  2PW5 A;  5BR8 L;  4LFB L;  3X3M A;  1SR3 A;  1KNE A;  3G6E A;  4NXN L;  1HA5 A;  2H4O A;  2Z6B A;  5IWA Q;  1JOO A;  2QDB A;  1KRT A;  5LMN W;  1DGS A;  1SYD A;  2DY7 A;  3W5O A;  4DV2 L;  3K81 C;  3HFZ B;  4N9P A;  5GAH C;  2VNU D;  4KV6 A;  3AQQ A;  5M5Y H;  4PG3 A;  1PHJ A;  4BY7 H;  3DUZ A;  2ES2 A;  1PFM A;  3MTS A;  1J6Q A;  3E5S A;  4ZAI A;  4P72 A;  1GD7 A;  3A74 A;  5E4X A;  1KXL A;  1X3E A;  1EQV A;  4RG1 A;  2GA4 B;  2K50 A;  3SK5 A;  3LNN A;  3TS2 A;  2J7Z A;  3MAQ A;  3M4Q A;  4CDF C;  2VL6 A;  2HDL A;  5IT9 c;  4B3S Q;  1TQO A;  2PCF B;  3CD6 A;  4H0L C;  3CCE A;  1QVF A;  3GTO B;  2F0E A;  2UU9 Q;  1Y1V B;  1A63 A;  4JI7 L;  3GTJ H;  2K6A A;  5IYD H;  2FIN B;  4BBS B;  3OMG A;  2YTV A;  1I6H B;  3URY A;  2EJG C;  3K7A B;  2B63 H;  4IPC A;  4BWG B;  3J80 c;  1F77 A;  4CKE A;  3EFX D;  2B2T C;  4J6H A;  1RTN A;  4GNX A;  3PMF A;  4B3R L;  2F0I A;  1KLU D;  3H91 A;  1FD7 D;  1O7Y A;  1WTH A;  3PQI A;  3BZD B;  1CT1 D;  2KHJ A;  1XNR L;  4A3E H;  5KYL A;  1WVL A;  2N49 A;  3VR5 A;  1AE3 A;  2RKS A;  1KD1 C;  1CK1 A;  3H15 A;  4C3H G;  2JSO A;  3I4L A;  5CV7 A;  3CXC A;  2J4X A;  3FKI H;  5J22 A;  1D5M C;  1W3S A;  2JA7 G;  2EPB A;  4AIM A;  2XNA C;  3OTO Q;  2PNH A;  2Z6K C;  4JG2 A;  4LFB Q;  1EU4 A;  2HDM A;  3EN2 A;  4YY3 L;  3OPO A;  3E0J A;  4JVZ A;  5NUC A;  3DM3 A;  4RKL A;  3ERS X;  1LT5 D;  1RF2 D;  1OTC A;  2O5I C;  1NTG A;  5ELF A;  4JOI C;  3NBH B;  1ET6 A;  3I4M G;  1NNX A;  3HOW B;  1CI3 M;  3CQZ H;  3FVQ A;  1I3Q B;  2KQ3 A;  3TS0 A;  2LS0 1;  1PTO C;  2PZU A;  5IYC G;  1PH8 A;  5I9P A;  5C3E G;  1STG A;  4XDX A;  3K58 A;  1SRU A;  1V43 A;  3UE0 A;  2BOS A;  5M5X H;  5GQO A;  2ZJP A;  4R4T A;  1A6X A;  5LHY 1;  3KLS X;  1FJG L;  3MXN A;  2E2J H;  3AYH B;  1C8C A;  4TSS A;  4N8F A;  4A3D B;  2AQ3 B;  3JAM L;  1U4R A;  1VQE A;  1SFO H;  3OW2 A;  2Z4I A;  3M4P A;  5TSS A;  2VUM B;  5FO7 B;  3MXN B;  4XQJ A;  2RHQ B;  4B3R Q;  5I9O A;  3JAM i;  4LNQ A;  4K14 A;  2QDL A;  1GUW A;  2TMP A;  1YNJ D;  5IOD A;  3NPP A;  1SRO A;  2MPM A;  4KY6 A;  3OSO A;  1TS5 A;  4ULL A;  1H9J A;  4LF9 L;  2HT1 A;  1HTP A;  1PH2 A;  4DUY Q;  3TME A;  5FLX c;  1K8O A;  4K5W A;  3RNU A;  4K5V A;  1MIU A;  2MJ8 A;  4DR2 Q;  2K5H A;  3HKS A;  3J7A 5;  2XSC A;  4WJ3 M;  2BCO A;  2PYK A;  1CUK A;  3K7U C;  5CMD A;  3PF4 A;  4KJN A;  4LF4 L;  4KK7 A;  4A3J B;  3CPF A;  1HH2 P;  2IHF A;  1VQI A;  4XQQ A;  2ZJQ A;  3S2D B;  1EZ8 A;  1PYW D;  2FXQ A;  4A3F B;  5FO9 B;  3F2B A;  2K5D A;  1EY4 A;  4G57 A;  3NEL A;  5JOB A;  1EY8 A;  3Q23 A;  1TS2 A;  1RCV D;  4GNX C;  1SYB A;  3V2T A;  4IPG A;  1BO0 A;  4RGM A;  1H9S A;  3A54 A;  1DCZ A;  3K6O A;  2M9V A;  3OWF A;  1I4R A;  3PO2 B;  3CC7 A;  4BA2 I;  2K1B A;  1MSH A;  2HD3 A;  1EYA A;  2I5L X;  3C1F A;  1XPU A;  2JA6 B;  1BKB A;  1IW7 D;  4FF3 A;  3HS0 C;  4RGT A;  1H9S B;  1GVP A;  1N32 L;  3MHB A;  1TVX A;  3J7A V;  5C4X B;  1JIC A;  1E1O A;  1GUG A;  5EGT A;  1RDP D;  2KHI A;  2F3W A;  3BZK A;  2A69 D;  3J81 L;  3HOY H;  4C3I B;  3IFD A;  2CFM A;  2HCI A;  2MGS A;  2F0J A;  1HFG A;  2Z4H A;  2E74 C;  1LTT D;  5CGK A;  3J81 i;  3I4M H;  3FRP B;  1YEZ A;  4IUP A;  1HZ9 A;  3LWE A;  1HXY D;  4I7Z C;  4A3B B;  2RSO A;  4QGU A;  4IFD I;  3LX0 A;  3VYU A;  1LTI D;  2EVB A;  3HOZ G;  5E4W C;  1B3A A;  1I50 H;  1UEA B;  1Y14 B;  1BBU A;  4R8N A;  1XMO L;  1CHQ D;  4X62 L;  2B2Y A;  2K5W A;  1G6Z A;  5LL6 X;  2BH2 A;  1MJC A;  1SSO A;  4HR7 B;  3RN5 A;  1JOK A;  4OX9 Q;  5CV5 A;  5T1I A;  2LXJ A;  2KCT A;  1RTO A;  4GN3 B;  1EUJ A;  1CSP A;  4JBJ A;  4UP8 A;  2X6G A;  3FMC A;  4C1N I;  1X9N A;  1LYL A;  2ZXR A;  1PMR A;  3L7Z C;  3QWN A;  5D65 A;  4LF4 Q;  4A3G H;  3MA2 B;  3UDX A;  5C0X G;  4POF A;  2V4D A;  1IYV A;  2CKZ B;  5IT9 L;  1NBW A;  1S5D D;  2IPK D;  2OEO A;  2VS1 A;  3I70 A;  5JAV A;  4A3I B;  2I5M X;  1STY A;  4L5Q A;  3TN2 A;  4IOC A;  1CA6 A;  1SN8 A;  3HOU G;  1QJO A;  4UP9 A;  4PZ8 A;  2OQ0 A;  2EE1 A;  1YNN C;  2XRQ D;  1G2T A;  2N3S A;  1VF7 A;  1PH7 A;  3CCV A;  2HQL A;  1FNU A;  5M3M G;  3VR6 A;  3HEJ A;  3MEH A;  3T1H L;  3KF8 B;  1HJP A;  2IW3 A;  2NVQ H;  2KJX A;  1TKW B;  4HN7 A;  1PFB A;  1VQO A;  4FXD A;  5COR A;  3R2T A;  4U68 A;  5EPJ A;  1UE7 A;  4XQN A;  1W6K A;  1B44 D;  4G7H C;  3F2D A;  4FNF A;  2D0P A;  4KTA A;  4FP5 D;  1GUO A;  3OMC A;  1F2L A;  1EL0 A;  3S1N B;  1VQC A;  1I4H A;  4IJL A;  4HJ5 A;  4Y52 H;  3HKZ E;  1IZ6 A;  2QIL A;  3G7L A;  3NXW A;  4R8I A;  5ELC A;  3T16 A;  5KND A;  2B39 A;  4HIM A;  1FL0 A;  5BN3 A;  1BCP C;  3H3V H;  3V05 A;  4DV7 Q;  3CCL A;  3A8I E;  1SNM A;  2R93 G;  4TKO B;  5CV6 A;  1F9Q A;  1Q8I A;  3GD7 A;  3J81 j;  1S40 A;  3HOX G;  3G48 A;  2KBN A;  4DR7 Q;  4ID6 A;  2A74 C;  3MEF A;  1U4M A;  4RWS C;  1GXD C;  2I0Q A;  3H0G G;  1HNW L;  5EKI A;  3M7G A;  2EY6 A;  1PH4 A;  5FOB B;  4JW0 A;  2BDO A;  2A6E D;  4J15 A;  2PI2 A;  1G6P A;  1HR0 W;  3TSS A;  4QIW B;  2E2I B;  4KD4 A;  3TP8 A;  2EXZ A;  1TWH H;  5C3W A;  2Q8I B;  2L11 A;  5C0X H;  1KTK A;  2F0Q A;  2NZH A;  1AZQ A;  4FF2 A;  1PVO A;  5BN5 A;  4LW1 A;  3T53 B;  1F2Y A;  4DNI A;  1Q81 C;  2A8V A;  4DXF A;  3GTM H;  4V0B A;  3QB3 A;  4DAP A;  4DK6 C;  3FPU B;  3NSW A;  1WD1 A;  4PNY A;  2R7Z G;  2R7F A;  3NWS A;  4OL7 A;  3HOU H;  5FLX L;  1EIY B;  4JI6 L;  4P2C B;  1WCM G;  1YIT A;  4HSV A;  4DV6 L;  1HA6 A;  2B3G A;  4UDU C;  3GTG B;  2PNR C;  2F0T A;  3QG1 A;  3CCR A;  4PZ7 A;  5CBE E;  4DAY B;  1Q7Y C;  1LTR D;  4ODG A;  2F4V L;  1Q1B A;  1XJV A;  1TWG H;  2D2C C;  2R92 G;  3LWU A;  2QGQ A;  3A5U A;  4G7O C;  4B3M L;  4J8Q A;  1K8G A;  3BDO A;  1VMP A;  5M5Y B;  4BY7 B;  4QF4 A;  4B08 A;  1MSG A;  4UPA A;  1JE4 A;  4OWW B;  4GKK L;  3T13 A;  1IBL L;  2AUK A;  3AFP A;  1PH9 A;  1LAB A;  2KEN A;  4LK1 C;  2OWO A;  4B3T L;  1N36 L;  4DR5 L;  4JBM A;  1EOV A;  3S16 H;  3S1R H;  1VQH A;  1ZYR C;  4KY7 A;  4H13 C;  4LAA A;  4UAI A;  5ELO A;  3ICE A;  1PRT B;  4K0K Q;  3RD4 A;  2A19 A;  1A3T A;  5HGT A;  1VQ4 A;  3GTJ B;  4R4C A;  2UUC L;  3BS1 A;  3CPW A;  3CP0 A;  4R9W A;  3OOC A;  2B63 B;  4WOR A;  3F2C A;  2OF1 A;  1VCI A;  2ICI A;  2SDF A;  4FO2 A;  4GN5 A;  1WTP A;  2F52 A;  1SAP A;  2R93 H;  1QNK A;  4BY1 G;  4FYD A;  3OYY A;  2E5L L;  1QZG A;  3HOX H;  4A3E B;  1S72 A;  2L4N A;  1RIP A;  1AN8 A;  3BDC A;  2JK8 A;  2GVA A;  3CME A;  3MWY W;  4OGQ C;  1IKL A;  3TZD A;  4HJA A;  4XXE A;  3FKI B;  1TXY A;  1G29 1;  2AHO B;  2LY7 A;  2HHH L;  5KRU A;  4KLK A;  3G6J B;  1CSQ A;  5CYU A;  3F1Z A;  1OXT A;  1YBY A;  4CGY B;  1ROD A;  1VQ9 A;  2P5Z X;  5IGE A;  4HED A;  1HQM C;  3EVQ A;  5LMN L;  5FKA C;  4EX5 A;  1WTO A;  1Z9F A;  4B3M Q;  4C1N K;  1LO5 D;  3R2I A;  4O2D A;  3IKJ A;  3CQZ B;  2JE6 I;  1KAB A;  4JI4 Q;  1YI2 A;  1WCM H;  4FVM A;  2K14 A;  2OQK A;  4GKK Q;  4R1J A;  1IBL Q;  5C4Z A;  2NVY H;  1CKO A;  2M00 A;  4B3T Q;  1Z7T A;  1N36 Q;  4DR5 Q;  1VQM A;  4L63 B;  3U4V A;  5M5X B;  1GKH A;  3UI2 A;  4B9W A;  1WTR A;  3BDL A;  2E2J B;  2WAQ E;  5C6A A;  1HPC A;  4B3S L;  3NQT A;  1K3B C;  1SFO B;  4JYA L;  2EYJ A;  4ZUJ A;  4K2L A;  2IT1 A;  2PZW A;  1X3F A;  2JA5 H;  4MIU A;  5M3F G;  2CW0 C;  5IOC A;  4PMB A;  4A93 G;  3D4D A;  1JB3 A;  1FYC A;  1ICW A;  1N9W A;  4DK3 C;  1L0W A;  2DY8 A;  1NCV A;  1U4P A;  1PRT C;  3M85 A;  3RUZ A;  2RQX A;  3A8J E;  4X6A H;  1J5E L;  3HOV H;  3VR4 A;  4X66 Q;  2L12 A;  4ILW A;  5KIX A;  1C48 A;  1JJG A;  3KYH C;  1FNV A;  4BY1 H;  4BBR G;  2X6L A;  4JPB W;  3CW2 C;  2F0K A;  2N88 A;  1PH3 A;  3QIA A;  2N55 A;  4ZQ3 A;  2WKC A;  2Q2U A;  1NSN S;  1SJH D;  1K0S A;  1DOK A;  1A15 A;  5LMN Q;  1C0A A;  1MHW C;  3D8G A;  2MUY A;  3W3A A;  5A35 A;  1SYC A;  1RJT A;  1BBX C;  1D7Q A; 
#chains in the Genus database with same CATH homology
 4X3U A;  1GUS A;  2BDN A;  1WTQ A;  1ET9 A;  4RAU C;  3HOY B;  1CZW A;  5C3X A;  2JXM B;  1ILP A;  3I4M B;  2FFK B;  3Q6S A;  3SK4 A;  1HQR D;  4EQP A;  4X3K A;  2NWG A;  4H7B A;  3I3C A;  4F7X A;  1PFN A;  1E2W A;  1I50 B;  2YYZ A;  3D3R A;  2F03 A;  3HP3 A;  1TY2 A;  1I4X A;  3EA6 A;  1FGB D;  3F2U A;  2FJ2 A;  2RBM A;  4KKU A;  3K57 A;  3KK7 A;  3NE5 B;  4H44 C;  4CJ0 B;  1CFM A;  4HCS A;  4A3G B;  2RDH A;  5HUR A;  3T56 B;  2EOT A;  2B2V C;  3NBH A;  3NTI A;  2EYM A;  3QO2 A;  4PV1 C;  2F0U A;  1CZG A;  3GO5 A;  4IFD H;  3DHQ A;  3ITP A;  5JPN C;  1AEX A;  2KHS A;  3ZYY X;  1GUT A;  1STN A;  1DOL A;  5D3D A;  3V96 A;  4XYQ A;  3CHB D;  2NVQ B;  2R6G A;  1G8Z D;  1Y69 U;  1DON A;  1DOM A;  4JBW A;  4ZUI A;  5BN4 A;  2PQE A;  3P1H A;  5JJZ A;  1YNJ C;  4RKB A;  5AFW A;  1BOS A;  1D5Z C;  3R8B A;  1B2T A;  2D5D A;  3PUY A;  3R3O A;  3M7N A;  2RDG A;  1EY7 A;  2TSS A;  1OXU A;  4C3J G;  3M4Y A;  2E75 C;  3NWT A;  1V8Q A;  2SNS A;  2CQA A;  3DWA A;  1AW7 A;  3HKZ B;  2JP1 A;  1O80 A;  1AP0 A;  1Q12 A;  1EOT A;  1DXM A;  2WKD A;  3PUX A;  3NK9 A;  5F2D A;  4FF4 A;  3PV0 A;  1D1K A;  2F0M A;  2EY2 A;  4WRD A;  4B9X A;  4K6L A;  5ELE A;  4K8I A;  1IW7 C;  1TWH B;  1E0B A;  3K5O A;  3ONA B;  3DEO A;  1ESF A;  2B8G A;  4X3T A;  2A69 C;  2NTS A;  1PTO H;  3GTM B;  3ND9 A;  3J7Y W;  2K28 A;  3HOU B;  3GV6 A;  3VR3 A;  2FHT A;  1EZ6 A;  3K5N A;  2SOB A;  2K05 A;  1G91 A;  2I07 B;  2EY5 A;  4QCL A;  5ISR A;  1A2U A;  1TWG B;  1KDA A;  2KEC A;  2VXW A;  3TP6 A;  5D14 A;  2F0P A;  1EU3 A;  2RA4 A;  3NUC A;  2JEB I;  1EIH A;  4Z9C B;  3S16 B;  3S1R B;  3PUZ A;  4G4K A;  4K6D A;  1UNS A;  2XN9 C;  3QOJ A;  3BVM A;  4V19 0;  1U4L A;  3FDT A;  1TT2 A;  2A73 B;  4M1U B;  2WAC A;  3D4R A;  3Q0A A;  1JQY D;  3A56 A;  3AMU A;  1CHP D;  4OIJ A;  4HMI A;  1S5E D;  3K5M A;  2R93 B;  1SE3 A;  4KY5 A;  4MHE A;  3HOX B;  1ENA A;  1Y8P B;  1EYC A;  4TQU S;  4KHV A;  4EQN A;  4IUN A;  3J80 L;  4ZRZ A;  5ELD A;  3KF8 A;  5A2Q E;  1F9S A;  1O78 A;  2BE5 C;  1HUN A;  1B9M A;  3SK6 A;  4IN3 A;  3U9S A;  1SXT A;  1XWE A;  3CKI B;  2BE5 D;  3I90 A;  5FK9 C;  4C3I G;  3SDZ A;  4RGN A;  4KMU C;  4IAL A;  2F0L A;  4DNR B;  1NAP A;  3TP5 A;  4CKC A;  4IUU A;  3GQB A;  1BXT A;  1OXS C;  1MGS A;  1SMY D;  1WCM B;  3T4A C;  5K36 G;  3PUV A;  2NVY B;  3DXJ C;  1SYE A;  2KEE A;  1SEB D;  4PMC A;  5COY A;  2JEA I;  2Z1C A;  1VMC A;  1R4Q B;  1CA5 A;  2A6E C;  1SJE D;  2NN6 G;  2WAQ B;  2JA5 B;  1LV9 A;  1A3V A;  1ML0 D;  1LAC A;  2Z8L A;  1LLR D;  4K2K A;  2O2L D;  1WD0 A;  3HOV B;  1IL8 A;  3I72 A;  4L8J A;  1KDC A;  2G9H D;  4BY1 B;  1H9M A;  4DAY A;  5LL6 S;  1E2Z A;  2LKV A;  3NHH A;  4KKT A;  4XTC S;  3MXP A;  1TS4 A;  2VB3 X;  1SE2 A;  5EBC A;  1EIG A;  4DK1 A;  5IGD A;  2MP1 A;  4KD3 A;  3X3N A;  4Q5V A;  3FPP A;  2EJF C;  2K04 A;  3MVV A;  3MC0 B;  1CQF A;  2ENB A;  3PIO 3;  1FR3 A;  1PZJ D;  5E3F A;  5KNB A;  4FF1 A;  4RHS A;  4K5X A;  2NB0 A;  1KNA A;  2WII B;  5K36 H;  2QCP X;  1PZI D;  4RHR A;  4NDX A;  2XWB B;  3SE0 A;  1X3P A;  3H09 A;  1Q1E A;  2F0G A;  4ZKB B;  1ZEQ X;  2O4X A;  4IUT A;  4IUQ A;  4O42 A;  5EKK A;  2Q8R E;  4NP5 A;  4KHZ A;  1A3U A;  2F3V A;  3A7L A;  1WTX A;  3C2P A;  3A55 A;  2AQ2 B;  3JAM E;  4A93 B;  2IX0 A;  2NZ1 D;  4J1M A;  1B9N A;  1SBB B;  4RCO A;  1GHJ A;  4RFB A;  5IGG A;  1TU2 B;  2R3Z A;  5I6Y A;  1QCB D;  3E6Z X;  1DJR D;  2HCC A;  1L0Y B;  3CRL C;  4LJZ C;  1O7L A;  1X3Q A;  5C5L A;  1O7Z A;  5KGU A;  4XT1 B;  4BBR B;  2AQ1 B;  3RZD B;  3ERQ A;  1LT6 D;  4KI0 A;  2KCC A;  1K83 B;  4QB4 A;  5KYI A;  4X3S A;  5DNF A;  3VYS A;  4DK0 A;  3TBI B;  3S2H B;  2FMM A;  3BYT B;  4G7Z C;  3QOL A;  1PTO F;  3ND8 A;  1CTM A;  4E6I A;  4OHJ A;  4EVO A;  3I91 A;  1I4G A;  2B2V A;  5EBD A;  1V1P B;  1RD9 D;  2RDF A;  3D31 A;  3J81 E;  1V1O A;  3MFY A;  1DM0 B;  3BYY B;  5JVG 3;  1T5E A;  4IUR A;  2KCN A;  1VF5 C;  4ZKC B;  3GTK B;  4Q0F A;  3J7A F;  3FEW X;  2JYO A;  3WDN A;  2RSN A;  2C5C A;  2L0C A;  4F8M A;  3QJY A;  4C3H B;  2F1M A;  1S5B D;  1H9K A;  2EYP A;  1RHP A;  1MD2 D;  5JEA J;  1JWM D;  3NBI A;  5G3L F;  3HGB A;  3CRK C;  4BS9 A;  2JA7 B;  2DNC A;  2NN6 I;  1KLG D;  1PTO B;  4OO1 I;  3EJI A;  2LFN A;  2BA0 A;  4HTH A;  2NYZ D;  3KBG A;  3KUP A;  1W6J A;  2NBF A;  2YU9 B;  2X69 A;  2A6H D;  1AZP A;  2B2U A;  1S5C D;  5IT9 E;  3RZO B;  1NUC A;  2A68 D;  1J9O A;  5EPL A;  5IGF A;  1IYU A;  1SYF A;  2F0S A;  2IJ0 A;  3GTQ B;  2PO4 A;  1B1Z A;  1EWC A;  2RVL A;  5J1Z A;  2DNE A;  5C3E B;  3J80 E;  1Y8O B;  5IGB A;  4MN3 A;  4CJ2 C;  5J39 A;  2KA7 A;  1MBY A;  5C4H A;  3RMH A;  1JR0 D;  2SNM A;  1RKN A;  3WOE A;  1F9R A;  4M8A A;  2EZV A;  2NTT A;  5K5P A;  4DA2 A;  3DWP A;  2PW7 A;  5I6W A;  3VA7 A;  3VYR A;  3L9A X;  2QKI C;  2Y0S B;  4L6T B;  4XIG S;  4C3J B;  1ILQ A;  2ZXO A;  2OXP A;  1B50 A;  4NKL A;  4S3S A;  3T51 B;  5DEH A;  1TWF B;  3O13 A;  5EPK A;  1M4V A;  1TY0 A;  5I2Y A;  1I6V C;  5I2X A;  2EYO A;  1Z6H A;  3DM1 A;  3TDQ A;  1HRJ A;  3IL8 A;  1EWH A;  4HMJ A;  4QUC A;  1JCK B;  1IHZ A;  2EY1 A;  4BA1 I;  1KAA A;  3NP8 A;  3C3L A;  3BVG A;  1ZKO A;  3W2D A;  1XXG A;  1T5X D;  2EDG A;  3S1Q B;  2CHB D;  3AU7 A;  2XWJ B;  3GP7 A;  4RCN A;  4DNT B;  2K5Q A;  3D6W A;  2FMC A;  2XVS A;  3EQL C;  3OW7 A;  2EYH A;  3DWQ A;  1HCZ A;  1PTO D;  2XIW A;  1L0X B;  5FLX E;  5EKL A;  1NR4 A;  2B2U C;  4QMG A;  1D6E C;  2AWN A;  1EFI D;  3N6R A;  5EJW A;  4RH6 A;  3HOZ B;  4HSP A;  1VDZ A;  4EQO A;  5FO8 B;  1EY9 A;  2SEB D;  2QEJ C;  3NTH A;  4N9T A;  4Y7N B;  1H9R A;  2IX1 A;  1G2S A;  1Y8N B;  1GUN A;  1M8A A;  1BCP F;  1R9T B;  1BUV T;  2ZXP A;  1EQT A;  5C4J B;  4ZLT F;  2HUG A;  3P75 A;  2KUM A;  2F0H A;  3H94 A;  2M2L A;  1PZK D;  1I4P A;  1JOR A;  1EEI D;  1HTL D;  5G3L D;  1ESR A;  1KDB A;  1LT3 D;  4C56 C;  1CQV A;  4O1N A;  2CVR A;  2Q8T A;  1K8M A;  5T1G A;  4DGZ A;  3SVM A;  1XYI A;  5M3M B;  1D2B A;  2B8F A;  3D4W A;  3S15 B;  1JWS D;  1CM9 A;  1NR2 A;  2PMZ B;  1DZ1 A;  1ZXT A;  1U9R A;  1I4Q A;  1BCP B;  1QB5 D;  2NVX B;  1B53 A;  4F87 A;  2BA1 A;  3RLF A;  3C1E A;  1F2M A;  2F0F A;  1GJX A;  2O5J C;  3GTL B;  2KED A;  4IFD J;  1JOQ A;  1IKM A;  3IFT A;  1J8I A;  3M3Y B;  1OXV A;  2E2H B;  2F0N A;  3K0Y A;  3BVZ A;  1FNW A;  1JC7 A;  3PUW A;  2OT2 A;  4I65 A;  4QUF A;  3M4O B;  1LTG D;  3VYT A;  1BNZ A;  1TII D;  1BF4 A;  2DN8 A;  3H3V C;  1HFN A;  1S5F D;  4K8J A;  3H0G B;  1SNO A;  1PXU A;  2F0D A;  3PIP 3;  2EJM A;  5CV8 A;  4EGV A;  1STH A;  4DXG A;  2EYF A;  3WOF A;  2EYL A;  4XT3 B;  1GOZ A;  3OWE B;  1LTS D;  2L1B A;  1STB A;  2H1E A;  1SMY C;  5EQ0 A;  3H6M A;  2R7Z B;  1OO9 B;  3NQI A;  1Z47 A;  2WIN B;  3KBX A;  1YNN D;  1HUM A;  2KVM A;  4C2M B;  1Q3L A;  5CC4 A;  1XX8 A;  4DU9 A;  4ZYS A;  3N52 A;  3DEP A;  4NW2 A;  2R92 B;  2IWH A;  2ICE C;  1Q90 A;  1WTV A;  1EEF D;  4F88 A;  5JEA G;  4ABN A;  1QNU A;  3A7A B;  1WTW A;  1QWY A;  2F0W A;  1STA A;  1SDF A;  3MXG A;  1II3 A;  3A8K E;  5CR3 A;  1TWA B;  4OO1 G;  3CU7 A;  3K59 A;  3IAY A;  3KLR A;  1R4P B;  4FXG C;  2D9U A;  5JVH 3;  4ME5 A;  1BCP D;  4DFA A;  2KOL A;  2K32 A;  3D6C A;  1XTC D;  2WB1 B;  1X32 A;  2F4I A;  1SE4 A;  4RA8 A;  2C9O A;  2JA8 B;  2D62 A;  2E2D C;  2MHV A;  5JPM C;  2B2Y C;  1TR5 A;  2F0O A;  3Q22 A;  1PRT F;  3AB9 A;  1DD2 A;  3S1M B;  4HCE A;  4U67 3;  3MXU A;  4ZK9 B;  5C5M A;  2L5T A;  5M5W B;  1D1I A;  4TRD A;  1SNP A;  4CHT B;  4IQZ A;  2L55 A;  3NTK A;  1EY5 A;  3VR2 A;  2IL8 A;  3S14 B;  3P7J A;  3SR1 A;  1SNQ A;  5IIF A;  4AYB B;  5D3I B;  3DMU A;  4KKS A;  1UUP A;  3KLS A;  3C46 A;  3ERO A;  3GTP B;  1BDO A;  4PMW A;  4KN7 C;  3TP7 A;  3P20 A;  4IUV A;  4FXK C;  2K33 A;  1TS3 A;  2A5H A;  2B2W A;  1QIL A;  5M9O A;  1AFP A;  5C44 B;  1JWU D;  1DYQ A;  4A3K B;  5JEA H;  2PZT A;  1LT4 D;  2NVT B;  2K03 A;  3I73 A;  2VB2 X;  2I46 A;  1ZYR D;  1HHV A;  2NN6 H;  4OO1 H;  2K7V A;  4IZ8 A;  4YIJ A;  2E76 C;  3MFG A;  3MZ5 A;  4HAE A;  1QE6 A;  5M3F B;  1D5X C;  1BR9 A;  3SK8 A;  1EY0 A;  1PDQ A;  2WV6 D;  1ENF A;  4KN4 C;  3GV3 A;  5CV4 A;  5DM6 3;  4GZY C;  1OXX K;  3PO3 B;  1MI2 A;  3I8Z A;  1BQQ T;  4CJ1 B;  5CV9 A;  3OIP A;  4XYO A;  1SNC A;  4JK1 C;  2IX3 A;  1STE A;  2NUC A;  1A2T A;  2K01 A;  4CKB A;  2AWO A;  5IGC A;  4NMZ A;  2R61 A;  3HZX A;  3S17 B;  5C0X I;  5DM7 3;  2B2T A;  4DAV A;  5C0X J;  4PQX A;  3R93 A;  1LTB D;  1V1P A;  3Q24 A;  4KJO A;  2ZT9 C;  4CBV A;  5KEE A;  3S9W A;  1QG7 A;  1F2Z A;  2F0V A;  2G9D A;  1GHK A;  4DF7 A;  3SHL A;  1EY6 A;  1ENC A;  4WJW A;  2XRS D;  1B4O A;  1TWC B;  3TZU A;  2HQE A;  5A2Q L;  1Y1W B;  2LMC B;  1ONL A;  1C4Q A;  2ID0 A;  3L3O C;  4LMQ D;  1UAP A;  2AUJ D;  3OIQ A;  5KNC A;  1SYG A;  3SXH A;  5I4D A;  4A3M B;  3I4N B;  5CBA E;  1PLF A;  5ELB A;  2QF7 A;  3OHX C;  2B2W C;  3U9O A;  2CW0 D;  5DAU A;  5E1F A;  1QOH A;  1S4Z A;  4DN4 M;  1PRT D;  1E2V A;  2J0T D;  4RGO S;  2L9H A;  4IFD G;  3HRZ C;  3SEB A;  3BG3 A;  3K5L A;  2A6H C;  1EYD A;  1LTA D;  1F9P A;  3HG9 A;  2A68 C;  3VA5 A;  2WP8 J;  1SND A;  4OIK A;  4WFN 3;  2PPB C;  2PW5 A;  3X3M A;  1KNE A;  1HA5 A;  2H4O A;  1JOO A;  2QDB A;  1SYD A;  2DY7 A;  4N9P A;  2VNU D;  4KV6 A;  3DUZ A;  1PFM A;  3MTS A;  3E5S A;  4ZAI A;  5E4X A;  1EQV A;  2GA4 B;  3SK5 A;  3LNN A;  2J7Z A;  3MAQ A;  2HDL A;  1TQO A;  2PCF B;  4H0L C;  3GTO B;  2F0E A;  1Y1V B;  2K6A A;  2FIN B;  4BBS B;  3OMG A;  1I6H B;  3URY A;  2EJG C;  3K7A B;  4BWG B;  1F77 A;  4CKE A;  3EFX D;  2B2T C;  4J6H A;  1RTN A;  3PMF A;  2F0I A;  1KLU D;  3H91 A;  1FD7 D;  1O7Y A;  3BZD B;  1CT1 D;  5KYL A;  1WVL A;  3VR5 A;  2RKS A;  1CK1 A;  4C3H G;  2JSO A;  3I4L A;  5CV7 A;  2J4X A;  5J22 A;  1D5M C;  2EPB A;  2XNA C;  1EU4 A;  2HDM A;  3OPO A;  3E0J A;  5NUC A;  4RKL A;  1LT5 D;  1RF2 D;  2O5I C;  5ELF A;  1ET6 A;  3HOW B;  1CI3 M;  3FVQ A;  1I3Q B;  2KQ3 A;  2LS0 1;  1PTO C;  2PZU A;  5I9P A;  1STG A;  4XDX A;  3K58 A;  1V43 A;  2BOS A;  1A6X A;  5LHY 1;  3KLS X;  3MXN A;  1C8C A;  4TSS A;  4A3D B;  2AQ3 B;  3JAM L;  1U4R A;  2Z4I A;  5TSS A;  2VUM B;  5FO7 B;  4XQJ A;  5I9O A;  4K14 A;  1GUW A;  5IOD A;  1YNJ D;  2TMP A;  3NPP A;  2MPM A;  4KY6 A;  3OSO A;  1TS5 A;  4ULL A;  1H9J A;  1HTP A;  3TME A;  1K8O A;  4K5W A;  4K5V A;  2MJ8 A;  2XSC A;  2BCO A;  2PYK A;  5CMD A;  4KJN A;  4KK7 A;  4A3J B;  4XQQ A;  3S2D B;  1EZ8 A;  1PYW D;  4A3F B;  5FO9 B;  2K5D A;  1EY4 A;  4G57 A;  5JOB A;  3Q23 A;  1EY8 A;  1TS2 A;  1RCV D;  1SYB A;  3V2T A;  1BO0 A;  4RGM A;  1H9S A;  3A54 A;  1DCZ A;  3K6O A;  2M9V A;  3OWF A;  1I4R A;  3PO2 B;  4BA2 I;  2K1B A;  1MSH A;  2JA6 B;  1EYA A;  3C1F A;  1IW7 D;  4FF3 A;  3HS0 C;  4RGT A;  1H9S B;  3MHB A;  1TVX A;  3J7A V;  5C4X B;  1JIC A;  1GUG A;  5EGT A;  1RDP D;  2F3W A;  2A69 D;  3J81 L;  4C3I B;  3IFD A;  2HCI A;  2MGS A;  2F0J A;  1HFG A;  2Z4H A;  2E74 C;  1LTT D;  5CGK A;  3FRP B;  4IUP A;  3LWE A;  1HXY D;  4I7Z C;  4A3B B;  2RSO A;  4IFD I;  3LX0 A;  3VYU A;  1LTI D;  2EVB A;  5E4W C;  1B3A A;  1UEA B;  4R8N A;  1CHQ D;  2B2Y A;  2K5W A;  1G6Z A;  5LL6 X;  1SSO A;  4HR7 B;  1JOK A;  5CV5 A;  5T1I A;  1RTO A;  2X6G A;  3FMC A;  4C1N I;  2ZXR A;  3L7Z C;  1PMR A;  3QWN A;  5D65 A;  3MA2 B;  5C0X G;  2V4D A;  1IYV A;  5IT9 L;  1S5D D;  2IPK D;  2OEO A;  5JAV A;  3I70 A;  4A3I B;  1STY A;  3TN2 A;  1CA6 A;  1QJO A;  2EE1 A;  1YNN C;  2XRQ D;  1G2T A;  1VF7 A;  1FNU A;  3VR6 A;  3HEJ A;  3MEH A;  2IW3 A;  2KJX A;  1TKW B;  4HN7 A;  1PFB A;  4FXD A;  5COR A;  3R2T A;  4U68 A;  5EPJ A;  4XQN A;  1W6K A;  1B44 D;  4G7H C;  4FNF A;  4KTA A;  4FP5 D;  1GUO A;  3OMC A;  1F2L A;  1EL0 A;  3S1N B;  1I4H A;  2QIL A;  3G7L A;  3NXW A;  4R8I A;  5ELC A;  3T16 A;  5KND A;  2B39 A;  5BN3 A;  1BCP C;  3V05 A;  3A8I E;  1SNM A;  4TKO B;  5CV6 A;  1F9Q A;  1Q8I A;  3GD7 A;  4ID6 A;  2A74 C;  4RWS C;  1U4M A;  1GXD C;  5EKI A;  3M7G A;  2EY6 A;  5FOB B;  2BDO A;  2A6E D;  3TSS A;  4QIW B;  2E2I B;  4KD4 A;  3TP8 A;  2EXZ A;  5C3W A;  2Q8I B;  2L11 A;  5C0X H;  1KTK A;  2F0Q A;  1AZQ A;  4FF2 A;  5BN5 A;  3T53 B;  1F2Y A;  4DXF A;  4V0B A;  4DAP A;  3QB3 A;  3FPU B;  3NSW A;  1WD1 A;  4PNY A;  3NWS A;  4OL7 A;  5FLX L;  4P2C B;  4HSV A;  1HA6 A;  4UDU C;  3GTG B;  2PNR C;  2F0T A;  3QG1 A;  5CBE E;  1LTR D;  4ODG A;  1Q1B A;  2D2C C;  3LWU A;  4G7O C;  4J8Q A;  3BDO A;  1VMP A;  5M5Y B;  4BY7 B;  4QF4 A;  4B08 A;  1MSG A;  1JE4 A;  3T13 A;  2AUK A;  1LAB A;  4LK1 C;  1ZYR C;  4KY7 A;  4LAA A;  4H13 C;  4UAI A;  1PRT B;  3RD4 A;  1A3T A;  5HGT A;  3GTJ B;  3BS1 A;  4R9W A;  3OOC A;  2B63 B;  4WOR A;  2OF1 A;  1VCI A;  2ICI A;  2SDF A;  4FO2 A;  1WTP A;  1SAP A;  1QNK A;  4FYD A;  4A3E B;  2L4N A;  1AN8 A;  3BDC A;  3MWY W;  4OGQ C;  1IKL A;  3TZD A;  4XXE A;  3FKI B;  1G29 1;  2LY7 A;  5KRU A;  3G6J B;  5CYU A;  1OXT A;  4CGY B;  1ROD A;  5IGE A;  4HED A;  1HQM C;  3EVQ A;  5FKA C;  1WTO A;  4C1N K;  1LO5 D;  3R2I A;  3IKJ A;  3CQZ B;  2JE6 I;  1KAB A;  4FVM A;  5C4Z A;  2M00 A;  1Z7T A;  4L63 B;  5M5X B;  3UI2 A;  4B9W A;  1WTR A;  3BDL A;  2E2J B;  5C6A A;  1HPC A;  3NQT A;  1SFO B;  2EYJ A;  4ZUJ A;  4K2L A;  2IT1 A;  2PZW A;  4MIU A;  2CW0 C;  5IOC A;  4PMB A;  3D4D A;  1JB3 A;  1FYC A;  1ICW A;  2DY8 A;  1NCV A;  1U4P A;  1PRT C;  3M85 A;  3RUZ A;  2RQX A;  3A8J E;  3VR4 A;  2L12 A;  4ILW A;  5KIX A;  1C48 A;  1FNV A;  2X6L A;  2F0K A;  2N88 A;  3QIA A;  2N55 A;  4ZQ3 A;  2WKC A;  1NSN S;  1SJH D;  1DOK A;  1A15 A;  3D8G A;  2MUY A;  3W3A A;  5A35 A;  1SYC A;  1RJT A;  1BBX C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...