2DNEA

Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
publication title Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 108
sequence length 108
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dneA00
1GUTA 4LJZC 3AB9A 1LACA 1IYUA 3TZUA 1T5EA 2B8GA 3IKJA 3VR5A 1GHKA 4H44C 4IFDG 3L7ZC 1VF5C 3MXUA 1Q90A 2O5JC 1V8QA 5KNDA 3D4RA 2EVBA 3DXJC 3HGBA 4KHZA 2K7VA 1QJOA 3IFTA 4GZYC 2NN6G 2K32A 1CFMA 2A69C 1GUOA 3CRKC 3FPPA 3VR6A 3A7AB 3T56B 2BA1A 5BN5A 2JEAI 2V4DA 2EJGC 3SDZA 1Z7TA 4PV1C 4TQUS 2IT1A 3ND8A 2PPBC 1Q1EA 2CW0C 3PV0A 2YYZA 3GD7A 3I73A 4KKUA 5K36H 2A6ED 1OXXK 4BA1I 5BN3A 1FYCA 1Z6HA 2D2CC 2R6GA 1GUNA 2EJMA 2K33A 3NE5B 2A69D 5C0XH 1ZYRC 4JBWA 2PCFB 2O5IC 1SMYC 1DD2A 1IYVA 4OO1H 2AUKA 1I6VC 1EWHA 2B8FA 2DNCA 2NN6I 4OGQC 3QIAA 4G7HC 1TU2B 3BG3A 2LMCB 1DXMA 3QJYA 5JEAH 5A35A 1H9MA 4RCNA 1Q12A 2A6EC 3CRLC 3VR4A 4DK1A 1V43A 1Y8OB 3VR2A 1BDOA 2AWOA 4KI0A 5KNBA 3T51B 1LABA 1YNNC 4LK1C 1B9NA 2QF7A 2ZT9C 4BA2I 3A8KE 1E2ZA 1VDZA 3RLFA 1GUGA 3OOCA 1B9MA 1CI3M 1GJXA 2JXMB 1Y8NB 2D62A 3H94A 1TKWB 5KNCA 3M85A 2A6HD 2D5DA 3M4YA 1FR3A 4G7OC 1IW7C 3PUVA 4JK1C 1ZKOA 3PUXA 4XTCS 2F1MA 1YNJC 2PNRC 3FMCA 4KMUC 3VA7A 1HQMC 1Y69U 1GUSA 3QG1A 3A7LA 3P20A 4I7ZC 5K36G 2A6HC 1H9SB 1Y8PB 3I72A 1HTPA 3PUZA 4DK0A 3M7NA 2L5TA 1E2WA 3LWUA 4KN7C 1PMRA 2A68D 3I4LA 3U9SA 2JEBI 1IW7D 4L8JA 5C0XG 1OXVA 1HPCA 3N6RA 3PUYA 1H9JA 2E74C 2DN8A 2E76C 2EDGA 3ND9A 2Q8IB 5BN4A 1H9SA 4KKTA 2BDOA 3LNNA 4XIGS 2EJFC 3SE0A 4KKSA 1DCZA 1H9KA 2E75C 1HCZA 3KLRA 3OW7A 4OO1G 1O78A 1CTMA 4IFDH 3A8IE 2JE6I 1G291 2BE5C 3D31A 2KCCA 2A68C 3BDOA 3MFYA 2AUJD 3A8JE 4H0LC 2KA7A 3W3AA 4G7ZC 1OXSC 3OPOA 1A6XA 2NN6H 1OXTA 1H9RA 3GQBA 3EQLC 4HR7B 4KN4C 1O7LA 4DNTB 1Q1BA 4H13C 1K8MA 1OXUA 3PUWA 2BE5D 3T53B 4DNRB 4TKOB 2BA0A 1GHJA 2DNEA 3VR3A 1E2VA 3WDNA 1K8OA 1VF7A 5JEAG 1ONLA 1VCIA 4IQZA
chains in the Genus database with same CATH superfamily
4LF6Q 5IYBG 3AB9A 1CA6A 1BR9A 1QCBD 3VYTA 3S14H 5GAEC 4I7AA 1PZJD 4IFDG 3JAMc 1CKOA 2O5JC 2FMMA 2Z8LA 4OIKA 3L9AX 2IY5B 4HCEA 3NWTA 4GZYC 2FJ2A 5LMUL 3BZDB 4A3LG 3CXCA 4NXML 2KEDA 1TWAB 5LMNL 4HJ8A 2EYFA 4NDXA 1L1OB 4HIDA 4FNFA 3TS0A 1VQEA 1E1OA 4H02A 2PPBC 2K5NA 4C3IG 2RSNA 4DV7L 5I2XA 3IL8A 3D6CA 1SSOA 3JAME 2RBMA 5I2YA 3FHWA 4C2MH 3H3VH 3TREA 1BF4A 3CCQA 4GOPC 5EGTA 1YNND 2B2WA 2JA9A 1C48A 3K59A 1NTGA 1A3VA 1MIUA 4IUVA 2AHOB 1C4QA 1HFGA 3M9BA 4KI0A 2R61A 1B9NA 1KRTA 1EU4A 4X3KA 4LFAQ 5KGUA 1HNWQ 2FHTA 1STHA 4OELB 4A3KH 4B08A 4L5RC 1B53A 4LF4Q 1E0BA 4A3CH 1KIXA 4A3BG 3ER0A 1Y1WH 5IP7G 5CV4A 2F0KA 4F88A 1VQIA 4H7BA 3OWEB 3FKIG 4DR2Q 3F8TA 4JYAL 1Y8PB 3OTOQ 4XT1B 1TWHH 4FXKC 2EE1A 1JJGA 4F87A 4X65L 4R4OA 2N8NA 3GTKB 2BH8A 4DV1L 4P72A 4XIGS 5IODA 4DV0L 5C5MA 3NTHA 1GKHA 1SE2A 1NBWA 1SJHD 1CZGA 4UP8A 3PIOA 1A6XA 1YNXA 1D1IA 1DM0B 4HMJA 3J7ZC 4GNXC 4FXDA 1NE3A 2ZM6L 1I4GA 1PH3A 3CHBD 2EY5A 1C0AA 3GTLH 1P8LA 3NBHB 1WFQA 4K0KL 1ESRA 2Q8TA 3GTJH 2F0PA 2GVBA 1JWUD 4EGVA 4X64L 5C6AA 3NELA 2AQ3B 3OSOA 1IYUA 3DEPA 2KUMA 4FP5D 2PMZB 3IKJA 1GHKA 1EEID 2CQAA 3NTIA 1VF5C 5ISRA 1V8QA 3TN2A 4NXNQ 4CBVA 1TXYA 5IYCH 1Y14B 3PGZA 1TWCH 3PSIA 1D5MC 4KHVA 3HOWG 1ET9A 2F0SA 4X3TA 2ES2A 2EJGC 4L63B 4HMIA 1Z7TA 4LNQA 1KC8C 3CCLA 2NVXB 2TSSA 2PZTA 4XYOA 4YWKA 1VMPA 3A55A 4PMBA 1Z6HA 1PH2A 1I6HB 4L5QA 1SE8A 4R8NA 4A93B 2PCFB 4MHEA 1Q7YC 1AE3A 1B4OA 1SDFA 1CA5A 3PO2H 1G51A 1K9MC 1VS0A 3CQZB 2K14A 4PZ7A 3I90A 4IUTA 2VB2X 4DV0Q 1CKMA 1RHPA 1SMXA 1STGA 1NNXA 1YNNC 4LK1C 2K75A 2MFIA 1QVFA 3N52A 2WINB 3OIPA 5IYDG 1B9MA 1RODA 2KHIA 5F2DA 1HNXQ 1Y8NB 1EZ6A 2A6HD 2JA5G 4K2LA 4UDUC 4K5WA 1WTXA 1EIHA 5KIXA 2NWGA 1KD1C 3LGJA 1HA6A 1KNEA 4I65A 2JK8A 2SDFA 2B2VA 2E2HH 1PZKD 1TS5A 1GO3E 4K0KQ 3W1BA 4C1NI 3PUYA 2L55A 2DN8A 2E76C 2MHVA 1JJ2A 4X64Q 2RQXA 4HJ9A 1S3OA 1DCZA 2JN4A 2KOLA 2C35B 3A5UA 3OMGA 3Q0AA 4B3ML 2CWPA 3MFYA 2J7ZA 3S1NB 1RJTA 1IXRA 3HOVH 3H6MA 2CH4A 1A62A 4RA8A 3FDTA 4X62Q 3GTPB 1XPUA 2F0IA 4EX5A 5C0XI 1HA5A 1QZHA 1RTOA 4FF4A 3Q8DA 4IOCA 4ZRZA 1OXUA 2F0EA 4JI2Q 2X69A 2BA0A 2HCCA 3AFPA 3CMAA 4C3IB 5DM73 4B3RL 2WB1B 3ZYYX 4LF5L 1ZXTA 3H3VC 3EVQA 1AP0A 4JI0L 1X55A 3MXUA 4WRDA 1D8LA 5CV8A 3HGBA 4N8X1 5TSSA 1UUPA 3HG9A 1TWGB 3J7AF 1EYGA 2E2DC 4MTKA 3VR6A 1W6KA 1MD2D 5M5YH 2F0MA 4A3GB 2EXZA 4PZ8A 1ICWA 1LTSD 2NVTH 3PV0A 2YYZA 3VYUA 3GTMB 4A3BB 1A2UA 2NZOA 4DFAA 2D2CC 3G6EA 2R6GA 1VQMA 4MIUA 3MFGA 3HZXA 2VL6A 2L0CA 2ZTCA 3FKIB 5CBEE 2XRSD 2TMPA 3T1YL 1SN8A 1KAWA 5FKAC 5A35A 5C4XB 2FFKB 3MTSA 5G3LD 2I5HA 4DK1A 5CV6A 3J7YW 4RWSC 1BDOA 1ENAA 3C46A 4K8IA 5IE8A 4IO9A 2K50A 1UAPA 4QMGA 1YHBA 4B3MQ 1PRTB 2MUYA 2JXMB 3G7LA 4N8FA 4MN3A 3PUXA 5CGKA 2GVAA 1HUMA 2WKDA 3KOJA 1AH9A 1IBML 2KCNA 3KBXA 2C9OA 2A6HC 1A2TA 3L0OA 3I72A 3PMFA 1IBLL 4N9PA 4AQYQ 5C0XG 2A68D 4C3JH 4A3DB 3CPWA 3N6RA 2HIXA 1B50A 2XWBB 5EPJA 1JOKA 3CCUA 5IP9G 1W6JA 4NPSA 3S2HB 3S2DB 1WTPA 3KLRA 1HCZA 5IWAL 1BNZA 3BVGA 3SGIA 1CTMA 4Q5VA 1XNRL 3D4WA 3J81i 4DUZQ 3TSSA 2QW7A 4H0LC 3P75A 3EROA 1EIGA 2NN6H 2MNAA 1CHPD 1LT6D 2PYKA 3H3VI 1A3TA 1VQ9A 2JA6G 2B2TC 3U58A 2SEBD 1K8MA 1F2YA 4O0AA 5E4XA 2BDNA 4LUVA 1K8GA 4RHRA 1FJGQ 4DR1L 1N36L 5J39A 1E2VA 1VQHA 2ZJRA 4DPGA 1R9TH 4RG1A 3NPPA 2WFWA 5D3DA 1BBXC 3S1MB 5JVG3 4LJZC 3F2UA 4OWTB 1T5EA 1YI2A 2AMCB 1XWEA 1STEA 1G2TA 4ALPA 3IFTA 4F7XA 2JA7H 1CFMA 1PFMA 2PZWA 5C3EH 2K6AA 5BN5A 4GKJQ 3OWFA 4DR4Q 3S1MH 2K01A 1B44D 2KBNA 2YTXA 2JA5B 4R1JA 4Y7NH 3CKIB 3GD7A 1TS4A 5M5WH 1F9QA 3RZDB 4O1NA 4XT3B 3T1HL 4DGZA 1ZEQX 4DV3L 4G7HC 4JI4Q 2IWHA 2CWAA 1H9MA 3ONAB 2B2YC 3CRLC 3GV6A 3UI2A 4HJ5A 5IWAQ 2K03A 2PZUA 3J80i 2AWOA 3P1HA 4RMFA 1XNRQ 1RKNA 2QF7A 1VDZA 1HTLD 1GUGA 3EJIA 2Z9HA 5ELDA 1X3QA 1EY0A 3M85A 1LTAD 2CH4W 5ELNA 2JSOA 1U4LA 1Q46A 2L11A 3DWPA 1OO9B 5GAHC 3PO3H 1TIID 2JA8B 3STBC 1Q8KA 4QIWE 1UE1A 1N36Q 4HIOA 1IW7D 4IPHA 4A3EH 2G9DA 2RDHA 1MSHA 3JC66 4X66Q 5H1SE 2EJFC 1HJPA 4IURA 3KFUA 1NJIC 2MO0A 3S1RH 2Q2IA 4DV6L 3D31A 2A68C 1SNOA 2JA8H 2R92H 2DGYA 2J0TD 4YY3L 3CC4A 4KD4A 4NP5A 4A3KG 2E5LL 1HFNA 2WV6D 3FVQA 5J22A 5DNFA 4A3CG 1Y1WG 2HDLA 3CCRA 2LKVA 2O4XA 3KUPA 3HOUH 1QB5D 5ELEA 4DR5Q 2KJXA 3MXPA 5T1IA 1S5CD 3GTQB 1TR5A 2N55A 2BOSA 2M9VA 4CKEA 1HHVA 2N78A 4B9XA 4QUFA 2UXDL 2EQSA 3NUCA 4MNOA 4DV3Q 3Q22A 1ESFA 1FVIA 1LLRD 1HR0Q 3DHQA 1ENFA 3L7ZC 4A3FH 4RGNA 1JCKB 5FLXc 2F0OA 1HUNA 2PQAA 3MEHA 3NQIA 3GTGB 4A3IB 1HZBA 2B3GA 2Z4HA 1BBUA 4Q0FA 3R93A 1UE5A 1IL2A 3BDLA 1PXUA 2JP1A 1X54A 5FLXE 3W1GA 2XN9C 4X3SA 1C7YA 5I9OA 1T5XD 3KJPA 2B8FA 2DNCA 3QB3A 2HT1A 1FNVA 3QIAA 1I50B 5C0XJ 2B63B 3HOZB 2RSOA 1X65A 5FOBB 4RGMA 5C44H 2HHHL 3CPFA 4DV4L 5I6YA 4YCUA 1VQCA 1J5EL 5IYCG 2XVSA 5FO9B 1EUJA 1FNUA 2AWNA 2Z0SA 3H94A 1WTWA 3K0YA 2F4VQ 4BY7H 1L1OA 1HR0W 4BXXG 3TP7A 2PI2A 3QR8A 2F3IA 3NBIA 2JA6B 1WD0A 1HXYD 4I7ZC 1I4RA 2ZTEA 4BBSH 2JEBI 4PMCA 4O42A 1H9JA 1NMGA 4S3SA 4DAVA 1PDQA 4ZAIA 3SE0A 3X3MA 5GAGC 1O78A 3S16H 5CR3A 5EKKA 1SFOB 2NVQH 1X3PA 4KK7A 3FP9A 1BCPC 4G7ZC 3Q6SA 5FO7B 2F0LA 1H9RA 2EY2A 2RA4A 4DUYL 4PZ6A 4JG2A 1PH5A 4DR6L 1PYBA 2WAQB 4H13C 3LWEA 4UHVA 3Q24A 2BCOA 1WYDA 1WTVA 3RLOA 2F0TA 3ERSX 1PHJA 3K80C 4A3MB 2Y0SB 1SYGA 1BOSA 4OX9L 1SJED 3PIPA 4LF9L 1STAA 2PQAB 2PW7A 1PH9A 1AFPA 1DGSA 5M5XH 3S14B 2OWOA 2K4KA 1Q81C 1RF2D 1EFID 1FGUA 3FPPA 2JEAI 3M7GA 1EY4A 4K6LA 4DR7L 2HCIA 4A3MH 5I6WA 1Q1EA 4HAEA 4FXGC 1V9PA 2NTTA 5IGGA 3PCOB 2P5ZX 1BBWA 2PMZE 3MXGA 1WTOA 3KLSA 1AW7A 1SXTA 2QEXA 3NTKA 2F0FA 1DD2A 4JV5Q 5C4ZA 1SE4A 2YTYA 4C2MB 2NN6I 4LUOA 1KNAA 1I3QH 1U4MA 1U9RA 2QEJC 1STYA 5I4DA 4LWCA 2KCTA 1X3FA 2D5DA 2X6GA 1FR3A 4IPDA 2YV5A 3DM3A 4JK1C 3G71A 1KQSA 3I7FA 1I4QA 1LTLA 4DK6C 1YNJC 3NWSA 3FMCA 4POFA 4ULLA 4DNIA 3ULPA 5KEEA 3T4AC 4A3KB 4DR6Q 2WB1G 5C3XA 5G3LF 1S5BD 3BVZA 3VYSA 1EY7A 1Y1WB 2VQEQ 4R4IA 4X6AH 5HGQA 2L5TA 1LO5D 1PMRA 3S15H 4DA2A 5BN4A 3JAMi 2E74C 3IRBA 4JCVE 5JJKA 4KKTA 1TWHB 4JI1L 1KLGD 2BH2A 1YIJA 2N3SA 3NXWA 4A3GG 3E6ZX 5C4JH 1U0LA 2BE5C 5BR8L 3DUZA 3AEVA 3A8JE 1Z47A 2KA7A 2IW3A 5ELOA 4B3SL 1MGSA 4KN4C 1QNKA 4Y52H 2YTVA 3R3OA 5JJLA 4FF2A 1LT5D 2XIWA 5C4XG 4ZLTF 1W2BA 5D65A 4R4QA 5ELCA 1CQFA 4FF1A 5JEAG 1V1PA 4KTAA 2NUCA 3ULLA 1ONLA 1HNZL 4C3JG 3GTLB 5CV7A 2F0UA 4IQZA 1UWVA 3GTJB 1A0IA 3KK7A 3VR5A 3C3LA 4H44C 3X3NA 3CF5A 5LMUQ 2ICIA 3I8ZA 2CW0D 4NXMQ 5LMNQ 4IPGA 3K57A 2NN6G 5C3WA 1WTQA 1A8VA 5A2QE 4RHSA 2YU9H 1B70B 1TS2A 4A3DG 2V4DA 4DV7Q 1BQQT 4TQUS 4OL7A 1I4HA 1TWCB 2WB1E 3P7JA 4UY8C 1YEZA 5K36H 2R7FA 2R3ZA 1S5DD 2ENBA 3HOYH 2L15A 4AYBB 5L37A 5CORA 3M4OH 1DXMA 5FJ8H 2OXPA 4BBRH 3JAML 3PO2B 1EY5A 2RKSA 3K6OA 1GM5A 3BYTB 4L5SA 1FNWA 1U5KA 2JA7G 3I3CA 5IGEA 5C3EG 1MI2A 1VMCA 2DUDA 4KMUC 4LF7L 4JYAQ 3VYRA 1X3EA 1HZAA 4JOIC 4R8IA 5EPLA 1IBKL 1PH6A 1IL8A 2VNUD 5LMNW 1UNSA 1QVCA 4TSSA 4CGYB 4OONA 4X65Q 3LWUA 3U9SA 5FLMH 1ICFB 4DV1Q 4JVZA 2Q8IB 1VQOA 5T1GA 2E2HB 2I5LX 1I4XA 4DAMA 1TQOA 2I07B 1H9KA 4OWXB 4A3JH 2LXKA 1W3SA 2IX3A 2UUAL 3S17H 4JI6L 3HFZB 1UEAB 2KHSA 3KLWA 4GN5A 1B3AA 3FRPB 3UDGA 2ZM6Q 1RL2A 4FVMA 3M4PA 1XMOL 4AIMA 4DNTB 2B2UC 4NW2A 3MWYW 5IGCA 1BCPF 3HOVB 2KENA 1D5ZC 5EKIA 1V1PB 1EYDA 2Z4IA 4A75A 4DAYA 1N33L 4A76A 3CCEA 4ZYSA 2OT2A 2H1EA 3MEFA 4A3EG 1A3UA 1PFNA 1N34L 2PNHA 4IFDJ 1LUZA 5AJ3L 2K5DA 2JA8G 4C3HH 1VQJA 1Y1VH 2R92G 5M3FB 4GKKL 2K32A 1G8ZD 3BVMA 1L0XB 3OW2A 4B3TL 4EVOA 2OTLA 3FEWX 1C8CA 3K7AH 2R7ZB 1QVGA 1XPOA 2CW0C 3NQTA 4LF7Q 1IYJB 4DR3L 3E3XA 5M5YB 3G48A 4F8MA 2A6ED 3T13A 3I56A 3DWQA 2E2JH 2NVTB 1CSQA 3A54A 1IKMA 3HKZG 4P2CB 5M3FH 1EFWA 2FMCA 4K14A 4K5VA 4KD3A 4RCNA 1U4PA 1JQYD 1SNMA 4A3FG 2R7ZH 5IYBH 4QQBX 1PVOA 3CCMA 3T51B 1LABA 4HIKA 1O7YA 3TRZA 1XMOQ 1LTTD 1ZKOA 3M4QA 1FL0A 2QILA 1Y69U 1HQMC 2NVYH 4A3LH 4TRDA 4KV6A 3C1EA 3F2DA 1PTOF 2MGSA 1PLFA 2ZXRA 2N49A 3I4LA 3C2PA 5EKLA 5JEAJ 4A3IG 3LNNA 5KRUA 5CC4A 3NEMA 4C3JB 3STBD 5C44G 2HIVA 1V1QA 4JI8L 3KF8A 4FO2A 2CQOA 5CV5A 2G5DA 5HGTA 1OXSC 1DJRD 2CHBD 4DN4M 2F03A 4HCSA 2H4OA 1K83H 4JC0A 1MHWC 4DAYB 1X56A 2B63G 4OWWB 1HZCA 3HOZG 4DR3Q 5AFWA 3S1QH 3R2IA 2M00A 4GOPA 4BBSG 2VUMH 2VQFL 4B3RQ 5D3IB 5EBDA 1L0YB 3KJOA 4LF5Q 2MQHA 3HOXH 4JI0Q 3E0JA 1R9TB 4FYDA 4POGA 1S5FD 3I55A 1E1TA 3HEJA 1PYWD 3H91A 1GUOA 2F3VA 3SHLA 1SMYD 2L4NA 2JA7B 3SK8A 2VW9A 2IT1A 3NK9A 2QA4A 5C3EB 3IFDA 1VQAA 3U4ZA 2NZ1D 1SYCA 3I73A 2JJQA 3KYHC 1NAPA 1OXXK 1FYCA 3HKSA 3NE5B 3T1YQ 4Y7NB 4A4IA 2E8GA 5HY6A 1CQVA 4G57A 1EIYB 1VQNA 2AUKA 5M5WB 3UDFA 2AQ1B 3U4VA 4IN3A 1JOQA 4HJAA 2A6EC 1HZ9A 2WAQG 3VR4A 1Y8OB 2UXBL 2UU9L 1H95A 4IJHA 4YHHL 3RLFA 2Q2TA 3NHHA 4GNXA 4IOAA 5HURA 1IBMQ 5M3MH 3EIVA 1SAPA 5M9OA 1BO0A 2PNRC 2VY3A 1BVSA 1I5FA 3RR5A 4HSVA 4A3MG 2Y0SG 1PH7A 1GUSA 2B39A 4K5XA 1S4ZA 4LFCL 3HOWH 1IBLQ 1B8AA 3E5SA 4EQOA 1D7QA 1O80A 1JICA 1FGBD 3MC0B 4V0BA 3M7NA 3W5OA 3PO3B 4KN7C 2VQFQ 2Z1CA 1ET6A 2B2WC 3GTOH 4NKLA 3KF8B 1ASZA 2K05A 1UE7A 4KKSA 1JB7A 4UP7A 1N8RC 3J81L 1QZGA 1NY4A 1MJCA 1G291 4A3EB 2N88A 1PFSA 5EJWA 1WI5A 3GV3A 2M2LA 2OQKA 2I46A 3W3AA 5IIFA 3S1RB 3SR1A 2IX0A 1K73C 2R92B 4UPAA 4ME5A 5IYDH 4ME3A 4ODGA 4DR1Q 4GOPB 5J1ZA 2F0GA 1EL0A 1YHQA 2ICEC 2IL8A 4WFN3 2DNEA 1BCPD 3PIO3 4L5TA 1VQBA 3HOUB 2VXWA 1LYLA 5E7NA 3NENA 3L2PA 4BY1H 5JPNC 4PG3A 1JORA 1SYEA 1PTOH 3HKZB 4GN3B 3CC7A 3S24A 1XTCD 2KQ3A 2EIFA 4DAPA 2WAQE 2UXCL 1Q90A 1TWFH 4QB4A 4YHHQ 2KEEA 4UP9A 1AZPA 5D14A 4XYQA 1JE5A 4A3FB 2A69C 4YWLA 1YHAA 5IGBA 1BUVT 1E3PA 3U50C 3TDQA 5CYUA 2Y0SE 3I4MH 1M4VA 4AH6A 1IHZA 3T1HQ 2DY7A 4BA1I 5BN3A 5E4WC 3A5ZB 1V1OA 3ERQA 1DOMA 1SMYC 2K5QA 1I6VC 3RZOH 4WJ4A 1TY0A 4IALA 4MTNA 3OYYA 3J80L 1XMQL 2HQLA 4U68A 2L12A 3VA5A 4GNXB 4WJ3M 4RGTA 1BKBA 3G4SA 4PNYA 4BA2I 4JI7L 4LMQD 5C44B 4KHPL 5FO8B 1GJXA 1WD1A 1EQRA 5KNCA 1IZ6A 1X3GA 1QWYA 3CCJA 2XWJB 4IZ8A 1KAAA 1MSGA 3CC2A 2LXJA 4BY7B 2JQOA 2PW5A 3KLSX 1BXTA 4J8QA 5K36G 5JJIA 1PYSB 1E2WA 3HOYG 2ZXPA 3RN2A 2PQEA 4K6DA 1PH8A 3QOLA 1HPCA 2EDGA 1YNJD 4BBSB 1PTOD 2ASBA 2PI2E 4HIMA 4DV6Q 5FJ8G 3CW2C 1LTGD 3UDIA 4YY3Q 3A8IE 2JE6I 1JWMD 2E5LQ 1HH2P 3BDOA 4PMWA 1F9RA 5IGDA 3S16B 4C56C 2NVQB 1EEFD 1L2FA 2QDLA 2KHJA 4ABNA 1JJCB 1NUCA 1K0SA 5I9PA 4AYBG 3H15A 5GROA 1PRTC 2XTIA 2BE5D 2Q2UA 4DV5L 3PO2G 1DZ1A 2RF4A 1EYAA 2UXDQ 1VQDA 4E6IA 2C5CA 3BJUA 3H0GH 3GO5A 1TVXA 4ZCKA 1SEBD 3TZUA 1E7ZA 1STBA 4LF6L 4A3JG 3MAQA 1CM9A 2NBFA 2XRQD 1QNUA 1EYCA 5IP9H 1LT3D 2EVBA 1JE4A 2K7VA 1QJOA 3C1FA 1VQKA 3TBIB 4JI7Q 1ILPA 1DOLA 1F77A 4K2KA 5M5XB 3T56B 1ZYRD 2G9HD 3SDZA 1GUWA 4ZKBB 3K5NA 4FDBA 3RMHA 2NZHA 3G6JB 5E1FA 2FXQA 1PV4A 4OO1H 2MP1A 2HHHQ 1N32L 1VQ7A 4OGQC 1TU2B 1ENCA 4DV4Q 1QUQB 2F0DA 3MA2B 2I0QA 1J5EQ 3HOVG 1RTNA 1J9OA 1V43A 3I4NH 4XQNA 4KLKA 2ZT9C 4C3HG 5CBAE 1I3QB 3OOCA 3R8BA 1EWCA 1X32A 2D62A 1TKWB 3M4YA 4HSPA 1O7IA 2B2TA 4XTCS 1HNWL 3W2DA 2K04A 2OEOA 4LF4L 4AYBE 2LY7A 1J6QA 1VQ8A 3J7A5 2F52A 1VQLA 4QUCA 4APVA 3DMUA 1E22A 4DR2L 3HP3A 4HEDA 5M3FG 3RN5A 5ELBA 3OTOL 3K5MA 1S40A 4LF8L 4OXPA 1H9SA 1YBYA 2A73B 1PA6A 3QWNA 2E75C 4BS9A 4CDCC 1SYBA 3S15B 5C4HA 5KYLA 2R7ZG 2EY6A 2KCCA 1NR2A 4DUYQ 3HRZC 2ATWA 3DWAA 1PTOC 2F0NA 1R4PB 4QY7A 5C4JB 3BZKA 2AKWB 3EQLC 3PF5A 1G91A 3ICEA 2EXDA 4YIJA 1Q3LA 2R93H 1WTHA 1NR4A 1S72A 4WJWA 5IT9L 3ITPA 1AZQA 1F9PA 1LM0A 4CDEC 4OX9Q 4LF9Q 3S9WA 1LV9A 1KDAA 3QO2A 4RCOA 2B2YA 4FF3A 1N32Q 1CUKA 1EY6A 3ULJA 2B8GA 2EYJA 1LTRD 3AQQA 3CAMA 3SK6A 2L1BA 1B7YB 3DXJC 4KHZA 1TWAH 4YCVA 1EQQA 3I2ZA 4ZUIA 4NXNL 4DR7Q 4IJLA 1QG7A 1SLJA 3A7AB 2BA1A 4IUQA 4LFBL 2VS1A 2RDGA 2OF1A 3EA6A 3RNUA 4IUNA 2YU9B 3GP7A 3AMUA 4GS3A 3TMEA 2VUMG 1ZYRC 1SRUA 1QOHA 1IYVA 3HOXG 5GADC 4KJNA 2J4XA 3K81C 1NSNS 1WTRA 2LS01 2A5HA 1PZID 3K5OA 4L6TB 2IPKD 2LMCB 4LF8Q 1O7ZA 3HOYB 5GQOA 2E2IB 2DJFC 4DK3C 3D6WA 5EAYA 1VQ6A 2F0VA 3M4OB 1B2TA 2A1AA 2MPMA 2DJGC 3KBGA 3QOJA 4BBRB 1SE3A 1CI3M 1WCMB 1AN8A 5CMDA 3PUVA 3CD6A 1KHIA 2IJ0A 1HNXL 3WOFA 1SROA 1QILA 2E2IH 2GA4B 2VB3X 3D0FA 1JC7A 1H9SB 1UEBA 3PUZA 4DK0A 2EYHA 3GTKH 2R7DA 1B1ZA 4OEMB 4JI1Q 1OXVA 3MZ5A 2D9UA 4J6HA 1WCMH 4P71A 1XXGA 5BR8Q 1EU3A 3WOEA 4RGOS 1AE2A 1X6OA 4B3SQ 1WVLA 4DKAC 1D5XC 1XPRA 4A3JB 1E24A 1WOCA 1OXTA 3GQBA 4HR7B 3S17B 3F2BA 1C9OA 5M3MG 2ZJQA 2HDMA 3BYYB 1Q8IA 4X62L 4LFBQ 2A8VA 1XNQL 2KCMA 1HNZQ 1GHJA 3Q23A 4BXXH 3BDCA 3MHBA 4JI2L 1PRTF 1JOOA 1VF7A 1DONA 3VDYA 1XX8A 3CU7A 1LACA 1VQ5A 4V190 4HN7A 1M90C 1KDBA 1MJEA 2UUBL 3BZCA 2ZJPA 1EOVA 2MO1A 4GLVB 3URYA 4R4TA 3CRKC 3PO3G 2NVXH 3CCSA 4C3HB 1Y1VB 1ILQA 4K8JA 1VQFA 2D0PA 1WJJA 4RFBA 1I6HH 4QL5A 2OQ0A 4A93H 4RKLA 1A63A 4MZ9A 3K7AB 2Z6KC 5A2QL 2EJMA 4RKBA 1YZ6A 3CQZH 4JBWA 1UE6A 4CJ1B 4BY1G 2E2JB 3QJYA 3I91A 1K8AC 2PO4A 4JBMA 4JBKA 2MJ8A 1CK1A 1CSPA 3D3RA 3VR2A 1SBBB 4PQXA 2IHEA 2CKZB 4IUPA 4LAAA 4ZQ3A 2RDFA 5EBCA 3KF6A 1SYDA 1QE6A 3HOUG 2F0WA 1IBKQ 4DXGA 3SXHA 5CV9A 1EOTA 1M8AA 3QG1A 3I4MG 1GD7A 3A7LA 1XNQQ 5LL6S 2NVYB 2Q8RE 3TP6A 2EYOA 5E3FA 1YVCA 4YWMA 2EZVA 4AQYL 1SNDA 2D0OA 5COYA 3D4DA 2UUAQ 3OIQA 2HUGA 3S1NH 4QF4A 5IGFA 4JI6Q 1DOKA 4IFDH 5EPKA 2NB0A 4P73A 2UUBQ 3GTPH 3V05A 4BWGB 1GOZA 4QGUA 4DUZL 4EQNA 2WKCA 1DYQA 3A0JA 1SNQA 1GXDC 1II3A 4OO1I 1L1OC 1T9HA 4RAUC 1SNPA 4C3IH 1N33Q 1K83B 3E9IA 3BS1A 4JBJA 3VR3A 3TP8A 1N9WA 5JOBA 1FJGL 2GN5A 1LTID 2QGQA 1VCIA 3DEOA 3AU7A 1N34Q 3S1QB 1GUTA 3LX0A 5AJ3Q 2L9HA 1F2MA 2VUMB 4M8AA 3RLNA 5ELFA 3HOXB 1XYIA 1TWGH 1RIPA 3V2TA 4OHJA 4GKKQ 4BY7G 2FINB 3RUZA 1ML0D 4B3TQ 4YCWA 4A3GH 4R9WA 1OTCA 3J81c 1Z9FA 3AYHB 3GTMH 3PIP3 3K0XA 2NTSA 1VQPA 4A3BH 5LL6X 1TY2A 4PV1C 5IP7H 1EWIA 2RHSB 2SOBA 4GKJL 4DR4L 2K1BA 2WACA 3FKIH 5K5PA 3HKZE 3J81j 3I4OA 1GUNA 5JAVA 2A69D 4CKCA 3H0GG 2O5IC 5C4XH 1I4PA 3MXNA 3J81E 1Q82C 4KY7A 1RDPD 4CJ0B 1BCPB 5JEAH 2Z6BA 1Q12A 4JI4L 3KF6B 5KNBA 1FD7D 1E2ZA 3A8KE 4JI5L 3M3YB 2QDBA 2A19A 1KTKA 3EN2A 3EBEA 4WORA 3FPUB 1JB3A 3ZJYC 3DLLA 4GLXA 4G7OC 3SK5A 3PF4A 2F1MA 2XGTA 1STNA 5M3MB 3K5LA 4GN4B 4A3DH 1J8IA 4XQQA 3S2HH 3HOWB 3S2DH 4L8JA 3M3YH 1JT8A 1Q86C 4OO1G 2V1CC 1KL9A 4IUUA 3TS2A 2BDOA 4JI8Q 1K28A 1KLUD 3OW7A 2WIIB 5DEHA 3A56A 3CCVA 4U673 4DV2L 4X66L 3GTOB 5DLQE 3I4NG 4Z9CB 2KVMA 2A74C 2AUJD 2HQEA 4J1MA 3K7UC 1K3RA 1VQ4A 1CHQD 3RD4A 3J80c 2ALYB 4XDXA 1Q1BA 1MBYA 4GLAC 1SYFA 3PUWA 3V96A 4EQ5A 5IOCA 3O13A 1EQTA 4JI3L 1K8OA 5JPMC 4B9WA 2X6LA 4XXEA 4DR5L 4C1NK 1D1KA 1SR3A 4G4KA 3J80E 1G6PA 1KXLA 1PRTD 3I70A 4HTHA 2F3WA 2LSSA 4JW0A 4BY1B 2ZXOA 3D4RA 1HR0L 4NB3A 1PTOB 2SNSA 3K58A 1HRJA 4JI5Q 3E0EA 5KYIA 1XTDA 5DM63 1TWFB 4CDDC 2JA5H 4TVAB 2IHFA 2ZTDA 1HQRD 3SK4A 2R93G 4JOIA 4DXFA 3ND8A 3RZDH 4P74A 1K0RA 2H5XA 4KJOA 1I94L 1AEXA 3MXNB 4LW1A 1LTBD 2K33A 1P16A 3I4MB 4ID6A 5DAUA 3GDEA 1G6ZA 2EOTA 1EWHA 2ID0A 4IPCA 1TS3A 3BG3A 1YITA 1L0WA 2UXBQ 2UU9Q 4ZK9B 2CVRA 4R4CA 1LT4D 3RZOB 3PQIA 4DV2Q 2SNMA 2B29A 3KDFA 2QKIC 2HD3A 2K52A 1CKNA 1SNCA 3OMCA 4ZKCB 4JPBW 2B2UA 3TZDA 2WP8J 4KY6A 2RHQB 4LFCQ 3VA7A 4UAIA 2F4VL 2RCFA 2EYPA 1KDCA 5C5LA 1YJNA 2EPBA 1VQGA 2LFNA 4DF7A 3P20A 1CZWA 4J15A 1HTPA 1F2LA 4JI3Q 1KABA 2Z6KA 2UUCL 2O2LD 4RH6A 1U4RA 3OHXC 3WDNA 1QUQA 2KECA 5EQ0A 3IAYA 4XQJA 3A74A 4ZUJA 1TT2A 4P75A 3K8AA 3J7AV 3MVVA 3SEBA 3OPOA 4CJ2C 1X9NA 3NP8A 2CFMA 5FK9C 1NMFA 2EY1A 3TQYA 1M1KC 3GTQH 5LHY1 1GVPA 4TKOB 3F2CA 2JYOA 1I94Q 2OCEA 2IX1A 1EZ8A 4EQPA 3WWVA 5JJZA 3B6YA 4BBRG 2K5HA 2XNAC 3UDXA 4NMZA 1EY9A 1WCMG 2K5VA 2UXCQ 1YJWA 3H0GB 1R4QB 3EFXD 1KRSA 3GTGH 5KNDA 4A3IH 4N9TA 3SVMA 1NCVA 3BU2A 4M1UB 3H09A 1F9SA 3R2TA 1PH4A 1PH1A 2B2VC 5FLMG 2K5WA 1D6EC 3NSWA 2CCZA 3UE1A 3U9OA 2I5MX 4KKUA 1EY8A 4IFDI 2B63H 1I50H 3HOZH 1PFBA 5C0XH 1EIFA 5IT9c 1XMQQ 2UUCQ 4CDFC 3KDFB 2OTJA 4JV5L 1CT1D 2DY8A 3DM1A 4QIWB 1XJVA 1CKNB 4QJFA 4KHPQ 4KY5A 2QCPX 3I4NB 1JR0D 1IW7C 4X3UA 4LUZA 2JA6H 5IT9E 3D8GA 4O2DA 4CHTB 5NUCA 3E9HA 4CKBA 4A93G 2EYMA 2K28A 2Q2HA 1F2ZA 1S5ED 3CMEA 3AFQA 4HJ7A 3TP5A 1G2SA 1K3BC 2RCNA 2VQEL 5FLXL 3ND9A 2F4IA 3F1ZA 1SFOH 5IY0A 1IKLA 1Y1VG 4OIJA 4DU9A 1A15A 4QCLA 2EYLA 3HS0C 1ASYA 2XSCA 3UE0A 3L3OC 1JWSD 4LFAL 3CP0A 3T16A 2RVLA 1RD9D 2AQ2B 1B3QA 2F0JA 1O7LA 2NYZD 4DV5Q 5J3BA 3TEHB 2F0HA 2VZAA 3T53B 2F0QA 4DNRB 1D2BA 5JVH3 1RCVD 2R93B 1JMCA 1MKHA 4ILWA 1EQVA 3NBHA 1YJ9A
chains in the Genus database with same CATH topology
3AB9A 1CA6A 1BR9A 1QCBD 3VYTA 1PZJD 4IFDG 2O5JC 2FMMA 2Z8LA 4OIKA 3L9AX 4HCEA 3NWTA 4GZYC 2FJ2A 3BZDB 2KEDA 1TWAB 2EYFA 4NDXA 4FNFA 2PPBC 4C3IG 2RSNA 5I2XA 3IL8A 3D6CA 1SSOA 3JAME 2RBMA 5I2YA 1BF4A 5EGTA 1YNND 2B2WA 1C48A 3K59A 1A3VA 4IUVA 1C4QA 1HFGA 4KI0A 2R61A 1B9NA 1EU4A 4X3KA 5KGUA 2FHTA 1STHA 4B08A 1B53A 1E0BA 5CV4A 2F0KA 4F88A 4H7BA 3OWEB 1Y8PB 4XT1B 4FXKC 2EE1A 4F87A 3GTKB 4XIGS 5IODA 5C5MA 3NTHA 1SE2A 1SJHD 1CZGA 1A6XA 1D1IA 1DM0B 4HMJA 4FXDA 1I4GA 3CHBD 2EY5A 1ESRA 2Q8TA 2F0PA 1JWUD 4EGVA 5C6AA 2AQ3B 3OSOA 1IYUA 3DEPA 2KUMA 4FP5D 2PMZB 3IKJA 1GHKA 1EEID 2CQAA 3NTIA 1VF5C 5ISRA 1V8QA 3TN2A 4CBVA 4KHVA 1D5MC 1ET9A 2F0SA 4X3TA 2EJGC 4L63B 4HMIA 1Z7TA 2NVXB 2TSSA 2PZTA 4XYOA 1VMPA 3A55A 4PMBA 1Z6HA 1I6HB 4R8NA 4A93B 2PCFB 4MHEA 1B4OA 1SDFA 1CA5A 3CQZB 3I90A 4IUTA 2VB2X 1RHPA 1STGA 1YNNC 4LK1C 3N52A 2WINB 3OIPA 1B9MA 1RODA 5F2DA 1Y8NB 1EZ6A 2A6HD 4K2LA 4UDUC 4K5WA 1WTXA 1EIHA 5KIXA 2NWGA 1HA6A 1KNEA 4I65A 2SDFA 2B2VA 1PZKD 1TS5A 4C1NI 3PUYA 2L55A 2DN8A 2E76C 2MHVA 2RQXA 1DCZA 2KOLA 3OMGA 3Q0AA 3MFYA 2J7ZA 3S1NB 1RJTA 3H6MA 4RA8A 3FDTA 3GTPB 2F0IA 5C0XI 1HA5A 1RTOA 4FF4A 4ZRZA 1OXUA 2F0EA 2X69A 2BA0A 2HCCA 4C3IB 5DM73 2WB1B 3ZYYX 1ZXTA 3H3VC 3EVQA 1AP0A 3MXUA 4WRDA 5CV8A 3HGBA 5TSSA 1UUPA 3HG9A 1TWGB 3J7AF 2E2DC 3VR6A 1W6KA 1MD2D 2F0MA 4A3GB 2EXZA 1ICWA 1LTSD 3PV0A 2YYZA 3VYUA 3GTMB 4A3BB 1A2UA 4DFAA 2D2CC 2R6GA 4MIUA 3MFGA 3HZXA 2L0CA 3FKIB 5CBEE 2XRSD 2TMPA 5FKAC 5A35A 5C4XB 2FFKB 3MTSA 5G3LD 4DK1A 5CV6A 3J7YW 4RWSC 1BDOA 1ENAA 3C46A 4K8IA 1UAPA 4QMGA 1PRTB 2MUYA 2JXMB 3G7LA 4MN3A 3PUXA 5CGKA 1HUMA 2WKDA 2KCNA 3KBXA 2C9OA 2A6HC 1A2TA 3PMFA 3I72A 4N9PA 5C0XG 2A68D 4A3DB 3N6RA 1B50A 2XWBB 5EPJA 1JOKA 1W6JA 3S2HB 3S2DB 1WTPA 3KLRA 1HCZA 1BNZA 3BVGA 1CTMA 4Q5VA 3D4WA 3TSSA 4H0LC 3P75A 3EROA 1EIGA 2NN6H 1CHPD 1LT6D 2PYKA 1A3TA 2B2TC 2SEBD 1K8MA 1F2YA 5E4XA 2BDNA 4RHRA 5J39A 1E2VA 3NPPA 1BBXC 5D3DA 3S1MB 5JVG3 4LJZC 3F2UA 1T5EA 1XWEA 1STEA 3IFTA 4F7XA 1CFMA 1PFMA 2PZWA 2K6AA 5BN5A 3OWFA 2K01A 1B44D 2JA5B 3CKIB 3GD7A 1TS4A 1F9QA 3RZDB 4O1NA 4XT3B 4DGZA 1ZEQX 4G7HC 2IWHA 1H9MA 3ONAB 2B2YC 3CRLC 3GV6A 3UI2A 2K03A 2PZUA 2AWOA 3P1HA 1RKNA 2QF7A 1VDZA 1HTLD 1GUGA 3EJIA 5ELDA 1X3QA 1EY0A 3M85A 1LTAD 2JSOA 1U4LA 2L11A 3DWPA 1OO9B 1TIID 2JA8B 1IW7D 2G9DA 2RDHA 1MSHA 2EJFC 4IURA 3D31A 2A68C 1SNOA 2J0TD 4KD4A 4NP5A 1HFNA 2WV6D 3FVQA 5J22A 5DNFA 2HDLA 2LKVA 2O4XA 3KUPA 1QB5D 5ELEA 2KJXA 3MXPA 5T1IA 1S5CD 3GTQB 1TR5A 2N55A 2BOSA 2M9VA 4CKEA 1HHVA 4B9XA 4QUFA 3NUCA 3Q22A 1ESFA 1LLRD 3DHQA 1ENFA 3L7ZC 4RGNA 1JCKB 2F0OA 1HUNA 3MEHA 3NQIA 3GTGB 4A3IB 2Z4HA 4Q0FA 3R93A 3BDLA 1PXUA 2JP1A 5FLXE 2XN9C 4X3SA 5I9OA 1T5XD 2B8FA 2DNCA 3QB3A 2B63B 1FNVA 3QIAA 1I50B 5C0XJ 3HOZB 2RSOA 5FOBB 4RGMA 5I6YA 2XVSA 5FO9B 1FNUA 2AWNA 3H94A 1WTWA 3K0YA 3TP7A 3NBIA 2JA6B 1WD0A 1HXYD 4I7ZC 1I4RA 2JEBI 4PMCA 4O42A 1H9JA 4S3SA 4DAVA 1PDQA 4ZAIA 3SE0A 3X3MA 1O78A 5CR3A 5EKKA 1SFOB 1X3PA 4KK7A 1BCPC 4G7ZC 3Q6SA 5FO7B 2F0LA 1H9RA 2EY2A 2RA4A 2WAQB 4H13C 3LWEA 3Q24A 2BCOA 1WTVA 2F0TA 4A3MB 2Y0SB 1SYGA 1BOSA 1SJED 1STAA 2PW7A 1AFPA 3S14B 1RF2D 1EFID 3FPPA 2JEAI 3M7GA 1EY4A 4K6LA 2HCIA 5I6WA 1Q1EA 4HAEA 4FXGC 2NTTA 5IGGA 3MXGA 1WTOA 3KLSA 1AW7A 1SXTA 3NTKA 2F0FA 1DD2A 5C4ZA 1SE4A 4C2MB 2NN6I 1KNAA 1U4MA 1U9RA 2QEJC 1STYA 5I4DA 2D5DA 2X6GA 1FR3A 4JK1C 1I4QA 1YNJC 3NWSA 3FMCA 4ULLA 4A3KB 5KEEA 3T4AC 5C3XA 5G3LF 1S5BD 3BVZA 3VYSA 1EY7A 1Y1WB 2L5TA 1LO5D 1PMRA 4DA2A 5BN4A 2E74C 4KKTA 1TWHB 1KLGD 3NXWA 3E6ZX 2BE5C 3DUZA 3A8JE 1Z47A 2KA7A 2IW3A 1MGSA 4KN4C 1QNKA 3R3OA 4FF2A 1LT5D 2XIWA 4ZLTF 5D65A 5ELCA 1CQFA 4FF1A 5JEAG 1V1PA 4KTAA 2NUCA 3GTLB 1ONLA 4C3JG 5CV7A 2F0UA 4IQZA 3GTJB 3KK7A 3VR5A 3C3LA 4H44C 3X3NA 2ICIA 3I8ZA 2CW0D 3K57A 2NN6G 5C3WA 1WTQA 5A2QE 4RHSA 1TS2A 2V4DA 1BQQT 4TQUS 4OL7A 1I4HA 1TWCB 3P7JA 5K36H 2R3ZA 1S5DD 2ENBA 4AYBB 5CORA 1DXMA 2OXPA 3JAML 3PO2B 1EY5A 2RKSA 3K6OA 3BYTB 1FNWA 3I3CA 5IGEA 1MI2A 1VMCA 4KMUC 3VYRA 4R8IA 5EPLA 1IL8A 2VNUD 1UNSA 4TSSA 4CGYB 3LWUA 3U9SA 2Q8IB 5T1GA 2E2HB 1I4XA 1TQOA 2I07B 1H9KA 2IX3A 1UEAB 2KHSA 1B3AA 3FRPB 4FVMA 4DNTB 2B2UC 4NW2A 3MWYW 5IGCA 1BCPF 3HOVB 1D5ZC 5EKIA 1V1PB 1EYDA 2Z4IA 4DAYA 4ZYSA 2OT2A 2H1EA 1A3UA 1PFNA 4IFDJ 2K5DA 5M3FB 2K32A 1G8ZD 3BVMA 1L0XB 4EVOA 3FEWX 1C8CA 2R7ZB 2CW0C 3NQTA 5M5YB 4F8MA 2A6ED 3T13A 2NVTB 3DWQA 3A54A 1IKMA 4P2CB 2FMCA 4K14A 4K5VA 4KD3A 4RCNA 1U4PA 1JQYD 1SNMA 3T51B 1LABA 1O7YA 1LTTD 1ZKOA 2QILA 1Y69U 1HQMC 4TRDA 4KV6A 3C1EA 1PTOF 2MGSA 1PLFA 2ZXRA 3I4LA 3C2PA 5EKLA 5JEAJ 3LNNA 5KRUA 5CC4A 4C3JB 3KF8A 4FO2A 5CV5A 5HGTA 1OXSC 1DJRD 2CHBD 4DN4M 2F03A 4HCSA 2H4OA 5AFWA 3R2IA 2M00A 5D3IB 5EBDA 1L0YB 3E0JA 1R9TB 4FYDA 1S5FD 3HEJA 1PYWD 3H91A 1GUOA 2F3VA 3SHLA 1SMYD 2L4NA 2JA7B 3SK8A 2IT1A 3NK9A 5C3EB 3IFDA 2NZ1D 1SYCA 3I73A 1NAPA 1OXXK 1FYCA 3NE5B 4Y7NB 1CQVA 4G57A 2AUKA 5M5WB 2AQ1B 1JOQA 4IN3A 2A6EC 3VR4A 1Y8OB 3RLFA 3NHHA 5HURA 5M9OA 1SAPA 1BO0A 2PNRC 4HSVA 1GUSA 2B39A 4K5XA 1S4ZA 3E5SA 4EQOA 1O80A 1JICA 1FGBD 3MC0B 4V0BA 3M7NA 3PO3B 4KN7C 2Z1CA 1ET6A 2B2WC 4NKLA 2K05A 4KKSA 3J81L 1G291 4A3EB 2N88A 5EJWA 3GV3A 2M2LA 3W3AA 2I46A 5IIFA 3S1RB 3SR1A 2IX0A 2R92B 4ME5A 4ODGA 5J1ZA 2F0GA 1EL0A 2ICEC 2IL8A 4WFN3 2DNEA 1BCPD 3PIO3 3HOUB 2VXWA 5JPNC 1JORA 1SYEA 1PTOH 3HKZB 1XTCD 2KQ3A 4DAPA 1Q90A 4QB4A 2KEEA 1AZPA 5D14A 4XYQA 4A3FB 2A69C 5IGBA 1BUVT 3TDQA 5CYUA 1M4VA 1IHZA 2DY7A 4BA1I 5BN3A 5E4WC 1V1OA 3ERQA 1DOMA 1SMYC 2K5QA 1I6VC 1TY0A 4IALA 3J80L 4U68A 2L12A 3VA5A 4RGTA 4PNYA 4BA2I 4LMQD 5C44B 5FO8B 1GJXA 1WD1A 5KNCA 1QWYA 2XWJB 4IZ8A 1KAAA 1MSGA 4BY7B 2PW5A 3KLSX 1BXTA 4J8QA 5K36G 1E2WA 2ZXPA 2PQEA 4K6DA 3QOLA 1HPCA 2EDGA 1YNJD 4BBSB 1PTOD 1LTGD 3A8IE 2JE6I 1JWMD 3BDOA 4PMWA 1F9RA 5IGDA 3S16B 4C56C 2NVQB 1EEFD 4ABNA 1NUCA 5I9PA 1PRTC 2BE5D 1DZ1A 1EYAA 4E6IA 2C5CA 3GO5A 1TVXA 1SEBD 3TZUA 1STBA 3MAQA 1CM9A 2NBFA 2XRQD 1QNUA 1EYCA 1LT3D 2EVBA 1JE4A 2K7VA 1QJOA 3C1FA 3TBIB 1ILPA 1DOLA 1F77A 4K2KA 5M5XB 3T56B 1ZYRD 2G9HD 3SDZA 1GUWA 4ZKBB 3K5NA 3RMHA 3G6JB 5E1FA 4OO1H 2MP1A 4OGQC 1TU2B 1ENCA 2F0DA 3MA2B 1RTNA 1J9OA 1V43A 4XQNA 2ZT9C 4C3HG 5CBAE 1I3QB 3OOCA 3R8BA 1EWCA 1X32A 2D62A 1TKWB 3M4YA 4HSPA 2B2TA 4XTCS 3W2DA 2K04A 2OEOA 2LY7A 4QUCA 3DMUA 3HP3A 4HEDA 5ELBA 3K5MA 1H9SA 2A73B 3QWNA 2E75C 4BS9A 1SYBA 3S15B 5C4HA 5KYLA 2EY6A 2KCCA 1NR2A 3HRZC 3DWAA 1PTOC 2F0NA 1R4PB 5C4JB 3EQLC 1G91A 4YIJA 1Q3LA 1NR4A 4WJWA 5IT9L 3ITPA 1AZQA 1F9PA 3S9WA 1LV9A 1KDAA 3QO2A 4RCOA 2B2YA 4FF3A 1EY6A 2B8GA 2EYJA 1LTRD 3SK6A 2L1BA 3DXJC 4KHZA 4ZUIA 1QG7A 3A7AB 2BA1A 4IUQA 2RDGA 2OF1A 3EA6A 2YU9B 4IUNA 3GP7A 3AMUA 3TMEA 1ZYRC 1QOHA 1IYVA 4KJNA 2J4XA 1NSNS 1WTRA 2LS01 2A5HA 1PZID 3K5OA 4L6TB 2IPKD 2LMCB 1G2TA 1O7ZA 3HOYB 2E2IB 3D6WA 2F0VA 3M4OB 1B2TA 2MPMA 4BBRB 3KBGA 3QOJA 1SE3A 1CI3M 1WCMB 1AN8A 5CMDA 3PUVA 2IJ0A 3WOFA 1QILA 2GA4B 2VB3X 1JC7A 1H9SB 3PUZA 4DK0A 2EYHA 1B1ZA 1OXVA 3MZ5A 2D9UA 4J6HA 1XXGA 1EU3A 3WOEA 4RGOS 1WVLA 1D5XC 4A3JB 1OXTA 3GQBA 4HR7B 3S17B 2HDMA 3BYYB 1Q8IA 1GHJA 3Q23A 3BDCA 3MHBA 1PRTF 1JOOA 1VF7A 1DONA 1XX8A 3CU7A 1LACA 4V190 4HN7A 1KDBA 3URYA 3CRKC 4C3HB 1Y1VB 1ILQA 4K8JA 4RFBA 4RKLA 3K7AB 5A2QL 2EJMA 4RKBA 4JBWA 4CJ1B 2E2JB 3QJYA 3I91A 2PO4A 2MJ8A 1CK1A 3D3RA 3VR2A 1SBBB 4PQXA 4IUPA 4LAAA 4ZQ3A 2RDFA 5EBCA 1SYDA 1QE6A 2F0WA 4DXGA 3SXHA 5CV9A 1EOTA 1M8AA 3QG1A 3A7LA 5LL6S 2NVYB 2Q8RE 3TP6A 2EYOA 5E3FA 2EZVA 1SNDA 5COYA 3D4DA 3OIQA 2HUGA 4QF4A 5IGFA 4IFDH 1DOKA 5EPKA 2NB0A 3V05A 4BWGB 1GOZA 4EQNA 2WKCA 1DYQA 1SNQA 1GXDC 1II3A 4OO1I 4RAUC 1SNPA 1K83B 3BS1A 3VR3A 3TP8A 5JOBA 1LTID 1VCIA 3DEOA 3AU7A 3S1QB 1GUTA 3LX0A 2L9HA 1F2MA 2VUMB 4M8AA 5ELFA 3HOXB 1XYIA 3V2TA 4OHJA 2FINB 3RUZA 1ML0D 4R9WA 3PIP3 2NTSA 5LL6X 1TY2A 4PV1C 2SOBA 2K1BA 2WACA 5K5PA 1GUNA 5JAVA 2A69D 4CKCA 2O5IC 1I4PA 3MXNA 3J81E 4KY7A 1RDPD 4CJ0B 1BCPB 5JEAH 1Q12A 5KNBA 1FD7D 1E2ZA 3A8KE 3M3YB 2QDBA 1KTKA 4WORA 3FPUB 1JB3A 4G7OC 3SK5A 2F1MA 1STNA 5M3MB 3K5LA 1J8IA 4XQQA 3HOWB 4L8JA 4OO1G 4IUUA 2BDOA 1KLUD 3OW7A 5DEHA 2WIIB 3A56A 4U673 3GTOB 4Z9CB 2KVMA 2A74C 2AUJD 2HQEA 4J1MA 1CHQD 3RD4A 4XDXA 1Q1BA 1MBYA 1SYFA 3PUWA 3V96A 5IOCA 3O13A 1EQTA 1K8OA 5JPMC 4B9WA 2X6LA 4XXEA 4C1NK 1D1KA 4G4KA 3J80E 1PRTD 3I70A 4HTHA 2F3WA 4BY1B 2ZXOA 3D4RA 1PTOB 2SNSA 3K58A 1HRJA 5KYIA 5DM63 1TWFB 1HQRD 3SK4A 4DXFA 3ND8A 4KJOA 1AEXA 1LTBD 2K33A 3I4MB 4ID6A 5DAUA 1G6ZA 2EOTA 1EWHA 2ID0A 1TS3A 3BG3A 4ZK9B 2CVRA 1LT4D 3RZOB 2SNMA 2QKIC 1SNCA 3OMCA 4ZKCB 2B2UA 3TZDA 2WP8J 4KY6A 3VA7A 4UAIA 2EYPA 1KDCA 5C5LA 2EPBA 2LFNA 4DF7A 3P20A 1CZWA 1HTPA 1F2LA 1KABA 2O2LD 4RH6A 1U4RA 3OHXC 3WDNA 2KECA 5EQ0A 3IAYA 4XQJA 4ZUJA 1TT2A 3J7AV 3MVVA 3SEBA 3OPOA 4CJ2C 3NP8A 5FK9C 2EY1A 5LHY1 4TKOB 2JYOA 2IX1A 1EZ8A 4EQPA 5JJZA 2XNAC 4NMZA 1EY9A 3H0GB 1R4QB 3EFXD 5KNDA 4N9TA 3SVMA 1NCVA 4M1UB 3H09A 1F9SA 3R2TA 2B2VC 2K5WA 1D6EC 3NSWA 3U9OA 4KKUA 1EY8A 4IFDI 1PFBA 5C0XH 1CT1D 2DY8A 3DM1A 4QIWB 4KY5A 2QCPX 3I4NB 1JR0D 1IW7C 4X3UA 5IT9E 3D8GA 4CHTB 5NUCA 4CKBA 2EYMA 2K28A 1F2ZA 1S5ED 3TP5A 1G2SA 5FLXL 3ND9A 2F4IA 1IKLA 4OIJA 4DU9A 1A15A 4QCLA 2EYLA 3HS0C 2XSCA 3L3OC 1JWSD 3T16A 2RVLA 1RD9D 2AQ2B 2F0JA 1O7LA 2NYZD 2F0HA 3T53B 2F0QA 4DNRB 1D2BA 5JVH3 1RCVD 2R93B 4ILWA 1EQVA 3NBHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUT A;  4LJZ C;  3AB9 A;  1LAC A;  1IYU A;  3TZU A;  1T5E A;  2B8G A;  3IKJ A;  3VR5 A;  1GHK A;  4H44 C;  4IFD G;  3L7Z C;  1VF5 C;  3MXU A;  1Q90 A;  2O5J C;  1V8Q A;  5KND A;  3D4R A;  2EVB A;  3DXJ C;  3HGB A;  4KHZ A;  2K7V A;  1QJO A;  3IFT A;  4GZY C;  2NN6 G;  2K32 A;  1CFM A;  2A69 C;  1GUO A;  3CRK C;  3FPP A;  3VR6 A;  3A7A B;  3T56 B;  2BA1 A;  5BN5 A;  2JEA I;  2V4D A;  2EJG C;  3SDZ A;  1Z7T A;  4PV1 C;  4TQU S;  2IT1 A;  3ND8 A;  2PPB C;  1Q1E A;  2CW0 C;  3PV0 A;  2YYZ A;  3GD7 A;  3I73 A;  4KKU A;  5K36 H;  2A6E D;  1OXX K;  4BA1 I;  5BN3 A;  1FYC A;  1Z6H A;  2D2C C;  2R6G A;  1GUN A;  2EJM A;  2K33 A;  3NE5 B;  2A69 D;  5C0X H;  1ZYR C;  4JBW A;  2PCF B;  2O5I C;  1SMY C;  1DD2 A;  1IYV A;  4OO1 H;  2AUK A;  1I6V C;  1EWH A;  2B8F A;  2DNC A;  2NN6 I;  4OGQ C;  3QIA A;  4G7H C;  1TU2 B;  3BG3 A;  2LMC B;  1DXM A;  3QJY A;  5JEA H;  5A35 A;  1H9M A;  4RCN A;  1Q12 A;  2A6E C;  3CRL C;  3VR4 A;  4DK1 A;  1V43 A;  1Y8O B;  3VR2 A;  1BDO A;  2AWO A;  4KI0 A;  5KNB A;  3T51 B;  1LAB A;  1YNN C;  4LK1 C;  1B9N A;  2QF7 A;  2ZT9 C;  4BA2 I;  3A8K E;  1E2Z A;  1VDZ A;  3RLF A;  1GUG A;  3OOC A;  1B9M A;  1CI3 M;  1GJX A;  2JXM B;  1Y8N B;  2D62 A;  3H94 A;  1TKW B;  5KNC A;  3M85 A;  2A6H D;  2D5D A;  3M4Y A;  1FR3 A;  4G7O C;  1IW7 C;  3PUV A;  4JK1 C;  1ZKO A;  3PUX A;  4XTC S;  2F1M A;  1YNJ C;  2PNR C;  3FMC A;  4KMU C;  3VA7 A;  1HQM C;  1Y69 U;  1GUS A;  3QG1 A;  3A7L A;  3P20 A;  4I7Z C;  5K36 G;  2A6H C;  1H9S B;  1Y8P B;  3I72 A;  1HTP A;  3PUZ A;  4DK0 A;  3M7N A;  2L5T A;  1E2W A;  3LWU A;  4KN7 C;  1PMR A;  2A68 D;  3I4L A;  3U9S A;  2JEB I;  1IW7 D;  4L8J A;  5C0X G;  1OXV A;  1HPC A;  3N6R A;  3PUY A;  1H9J A;  2E74 C;  2DN8 A;  2E76 C;  2EDG A;  3ND9 A;  2Q8I B;  5BN4 A;  1H9S A;  4KKT A;  2BDO A;  3LNN A;  4XIG S;  2EJF C;  3SE0 A;  4KKS A;  1DCZ A;  1H9K A;  2E75 C;  1HCZ A;  3KLR A;  3OW7 A;  4OO1 G;  1O78 A;  1CTM A;  4IFD H;  3A8I E;  2JE6 I;  1G29 1;  2BE5 C;  3D31 A;  2KCC A;  2A68 C;  3BDO A;  3MFY A;  2AUJ D;  3A8J E;  4H0L C;  2KA7 A;  3W3A A;  4G7Z C;  1OXS C;  3OPO A;  1A6X A;  2NN6 H;  1OXT A;  1H9R A;  3GQB A;  3EQL C;  4HR7 B;  4KN4 C;  1O7L A;  4DNT B;  1Q1B A;  4H13 C;  1K8M A;  1OXU A;  3PUW A;  2BE5 D;  3T53 B;  4DNR B;  4TKO B;  2BA0 A;  1GHJ A;  2DNE A;  3VR3 A;  1E2V A;  3WDN A;  1K8O A;  1VF7 A;  5JEA G;  1ONL A;  1VCI A;  4IQZ A; 
#chains in the Genus database with same CATH topology
 4LF6 Q;  5IYB G;  3AB9 A;  1CA6 A;  1BR9 A;  1QCB D;  3VYT A;  3S14 H;  5GAE C;  4I7A A;  1PZJ D;  4IFD G;  3JAM c;  1CKO A;  2O5J C;  2FMM A;  2Z8L A;  4OIK A;  3L9A X;  2IY5 B;  4HCE A;  3NWT A;  4GZY C;  2FJ2 A;  5LMU L;  3BZD B;  4A3L G;  3CXC A;  4NXM L;  2KED A;  1TWA B;  5LMN L;  4HJ8 A;  2EYF A;  4NDX A;  1L1O B;  4HID A;  4FNF A;  3TS0 A;  1VQE A;  1E1O A;  4H02 A;  2PPB C;  2K5N A;  4C3I G;  2RSN A;  4DV7 L;  5I2X A;  3IL8 A;  3D6C A;  1SSO A;  3JAM E;  2RBM A;  5I2Y A;  3FHW A;  4C2M H;  3H3V H;  3TRE A;  1BF4 A;  3CCQ A;  4GOP C;  5EGT A;  1YNN D;  2B2W A;  2JA9 A;  1C48 A;  3K59 A;  1NTG A;  1A3V A;  1MIU A;  4IUV A;  2AHO B;  1C4Q A;  1HFG A;  3M9B A;  4KI0 A;  2R61 A;  1B9N A;  1KRT A;  1EU4 A;  4X3K A;  4LFA Q;  5KGU A;  1HNW Q;  2FHT A;  1STH A;  4OEL B;  4A3K H;  4B08 A;  4L5R C;  1B53 A;  4LF4 Q;  1E0B A;  4A3C H;  1KIX A;  4A3B G;  3ER0 A;  1Y1W H;  5IP7 G;  5CV4 A;  2F0K A;  4F88 A;  1VQI A;  4H7B A;  3OWE B;  3FKI G;  4DR2 Q;  3F8T A;  4JYA L;  1Y8P B;  3OTO Q;  4XT1 B;  1TWH H;  4FXK C;  2EE1 A;  1JJG A;  4F87 A;  4X65 L;  4R4O A;  2N8N A;  3GTK B;  2BH8 A;  4DV1 L;  4P72 A;  4XIG S;  5IOD A;  4DV0 L;  5C5M A;  3NTH A;  1GKH A;  1SE2 A;  1NBW A;  1SJH D;  1CZG A;  4UP8 A;  3PIO A;  1A6X A;  1YNX A;  1D1I A;  1DM0 B;  4HMJ A;  3J7Z C;  4GNX C;  4FXD A;  1NE3 A;  2ZM6 L;  1I4G A;  1PH3 A;  3CHB D;  2EY5 A;  1C0A A;  3GTL H;  1P8L A;  3NBH B;  1WFQ A;  4K0K L;  1ESR A;  2Q8T A;  3GTJ H;  2F0P A;  2GVB A;  1JWU D;  4EGV A;  4X64 L;  5C6A A;  3NEL A;  2AQ3 B;  3OSO A;  1IYU A;  3DEP A;  2KUM A;  4FP5 D;  2PMZ B;  3IKJ A;  1GHK A;  1EEI D;  2CQA A;  3NTI A;  1VF5 C;  5ISR A;  1V8Q A;  3TN2 A;  4NXN Q;  4CBV A;  1TXY A;  5IYC H;  1Y14 B;  3PGZ A;  1TWC H;  3PSI A;  1D5M C;  4KHV A;  3HOW G;  1ET9 A;  2F0S A;  4X3T A;  2ES2 A;  2EJG C;  4L63 B;  4HMI A;  1Z7T A;  4LNQ A;  1KC8 C;  3CCL A;  2NVX B;  2TSS A;  2PZT A;  4XYO A;  4YWK A;  1VMP A;  3A55 A;  4PMB A;  1Z6H A;  1PH2 A;  1I6H B;  4L5Q A;  1SE8 A;  4R8N A;  4A93 B;  2PCF B;  4MHE A;  1Q7Y C;  1AE3 A;  1B4O A;  1SDF A;  1CA5 A;  3PO2 H;  1G51 A;  1K9M C;  1VS0 A;  3CQZ B;  2K14 A;  4PZ7 A;  3I90 A;  4IUT A;  2VB2 X;  4DV0 Q;  1CKM A;  1RHP A;  1SMX A;  1STG A;  1NNX A;  1YNN C;  4LK1 C;  2K75 A;  2MFI A;  1QVF A;  3N52 A;  2WIN B;  3OIP A;  5IYD G;  1B9M A;  1ROD A;  2KHI A;  5F2D A;  1HNX Q;  1Y8N B;  1EZ6 A;  2A6H D;  2JA5 G;  4K2L A;  4UDU C;  4K5W A;  1WTX A;  1EIH A;  5KIX A;  2NWG A;  1KD1 C;  3LGJ A;  1HA6 A;  1KNE A;  4I65 A;  2JK8 A;  2SDF A;  2B2V A;  2E2H H;  1PZK D;  1TS5 A;  1GO3 E;  4K0K Q;  3W1B A;  4C1N I;  3PUY A;  2L55 A;  2DN8 A;  2E76 C;  2MHV A;  1JJ2 A;  4X64 Q;  2RQX A;  4HJ9 A;  1S3O A;  1DCZ A;  2JN4 A;  2KOL A;  2C35 B;  3A5U A;  3OMG A;  3Q0A A;  4B3M L;  2CWP A;  3MFY A;  2J7Z A;  3S1N B;  1RJT A;  1IXR A;  3HOV H;  3H6M A;  2CH4 A;  1A62 A;  4RA8 A;  3FDT A;  4X62 Q;  3GTP B;  1XPU A;  2F0I A;  4EX5 A;  5C0X I;  1HA5 A;  1QZH A;  1RTO A;  4FF4 A;  3Q8D A;  4IOC A;  4ZRZ A;  1OXU A;  2F0E A;  4JI2 Q;  2X69 A;  2BA0 A;  2HCC A;  3AFP A;  3CMA A;  4C3I B;  5DM7 3;  4B3R L;  2WB1 B;  3ZYY X;  4LF5 L;  1ZXT A;  3H3V C;  3EVQ A;  1AP0 A;  4JI0 L;  1X55 A;  3MXU A;  4WRD A;  1D8L A;  5CV8 A;  3HGB A;  4N8X 1;  5TSS A;  1UUP A;  3HG9 A;  1TWG B;  3J7A F;  1EYG A;  2E2D C;  4MTK A;  3VR6 A;  1W6K A;  1MD2 D;  5M5Y H;  2F0M A;  4A3G B;  2EXZ A;  4PZ8 A;  1ICW A;  1LTS D;  2NVT H;  3PV0 A;  2YYZ A;  3VYU A;  3GTM B;  4A3B B;  1A2U A;  2NZO A;  4DFA A;  2D2C C;  3G6E A;  2R6G A;  1VQM A;  4MIU A;  3MFG A;  3HZX A;  2VL6 A;  2L0C A;  2ZTC A;  3FKI B;  5CBE E;  2XRS D;  2TMP A;  3T1Y L;  1SN8 A;  1KAW A;  5FKA C;  5A35 A;  5C4X B;  2FFK B;  3MTS A;  5G3L D;  2I5H A;  4DK1 A;  5CV6 A;  3J7Y W;  4RWS C;  1BDO A;  1ENA A;  3C46 A;  4K8I A;  5IE8 A;  4IO9 A;  2K50 A;  1UAP A;  4QMG A;  1YHB A;  4B3M Q;  1PRT B;  2MUY A;  2JXM B;  3G7L A;  4N8F A;  4MN3 A;  3PUX A;  5CGK A;  2GVA A;  1HUM A;  2WKD A;  3KOJ A;  1AH9 A;  1IBM L;  2KCN A;  3KBX A;  2C9O A;  2A6H C;  1A2T A;  3L0O A;  3I72 A;  3PMF A;  1IBL L;  4N9P A;  4AQY Q;  5C0X G;  2A68 D;  4C3J H;  4A3D B;  3CPW A;  3N6R A;  2HIX A;  1B50 A;  2XWB B;  5EPJ A;  1JOK A;  3CCU A;  5IP9 G;  1W6J A;  4NPS A;  3S2H B;  3S2D B;  1WTP A;  3KLR A;  1HCZ A;  5IWA L;  1BNZ A;  3BVG A;  3SGI A;  1CTM A;  4Q5V A;  1XNR L;  3D4W A;  3J81 i;  4DUZ Q;  3TSS A;  2QW7 A;  4H0L C;  3P75 A;  3ERO A;  1EIG A;  2NN6 H;  2MNA A;  1CHP D;  1LT6 D;  2PYK A;  3H3V I;  1A3T A;  1VQ9 A;  2JA6 G;  2B2T C;  3U58 A;  2SEB D;  1K8M A;  1F2Y A;  4O0A A;  5E4X A;  2BDN A;  4LUV A;  1K8G A;  4RHR A;  1FJG Q;  4DR1 L;  1N36 L;  5J39 A;  1E2V A;  1VQH A;  2ZJR A;  4DPG A;  1R9T H;  4RG1 A;  3NPP A;  2WFW A;  5D3D A;  1BBX C;  3S1M B;  5JVG 3;  4LJZ C;  3F2U A;  4OWT B;  1T5E A;  1YI2 A;  2AMC B;  1XWE A;  1STE A;  1G2T A;  4ALP A;  3IFT A;  4F7X A;  2JA7 H;  1CFM A;  1PFM A;  2PZW A;  5C3E H;  2K6A A;  5BN5 A;  4GKJ Q;  3OWF A;  4DR4 Q;  3S1M H;  2K01 A;  1B44 D;  2KBN A;  2YTX A;  2JA5 B;  4R1J A;  4Y7N H;  3CKI B;  3GD7 A;  1TS4 A;  5M5W H;  1F9Q A;  3RZD B;  4O1N A;  4XT3 B;  3T1H L;  4DGZ A;  1ZEQ X;  4DV3 L;  4G7H C;  4JI4 Q;  2IWH A;  2CWA A;  1H9M A;  3ONA B;  2B2Y C;  3CRL C;  3GV6 A;  3UI2 A;  4HJ5 A;  5IWA Q;  2K03 A;  2PZU A;  3J80 i;  2AWO A;  3P1H A;  4RMF A;  1XNR Q;  1RKN A;  2QF7 A;  1VDZ A;  1HTL D;  1GUG A;  3EJI A;  2Z9H A;  5ELD A;  1X3Q A;  1EY0 A;  3M85 A;  1LTA D;  2CH4 W;  5ELN A;  2JSO A;  1U4L A;  1Q46 A;  2L11 A;  3DWP A;  1OO9 B;  5GAH C;  3PO3 H;  1TII D;  2JA8 B;  3STB C;  1Q8K A;  4QIW E;  1UE1 A;  1N36 Q;  4HIO A;  1IW7 D;  4IPH A;  4A3E H;  2G9D A;  2RDH A;  1MSH A;  3JC6 6;  4X66 Q;  5H1S E;  2EJF C;  1HJP A;  4IUR A;  3KFU A;  1NJI C;  2MO0 A;  3S1R H;  2Q2I A;  4DV6 L;  3D31 A;  2A68 C;  1SNO A;  2JA8 H;  2R92 H;  2DGY A;  2J0T D;  4YY3 L;  3CC4 A;  4KD4 A;  4NP5 A;  4A3K G;  2E5L L;  1HFN A;  2WV6 D;  3FVQ A;  5J22 A;  5DNF A;  4A3C G;  1Y1W G;  2HDL A;  3CCR A;  2LKV A;  2O4X A;  3KUP A;  3HOU H;  1QB5 D;  5ELE A;  4DR5 Q;  2KJX A;  3MXP A;  5T1I A;  1S5C D;  3GTQ B;  1TR5 A;  2N55 A;  2BOS A;  2M9V A;  4CKE A;  1HHV A;  2N78 A;  4B9X A;  4QUF A;  2UXD L;  2EQS A;  3NUC A;  4MNO A;  4DV3 Q;  3Q22 A;  1ESF A;  1FVI A;  1LLR D;  1HR0 Q;  3DHQ A;  1ENF A;  3L7Z C;  4A3F H;  4RGN A;  1JCK B;  5FLX c;  2F0O A;  1HUN A;  2PQA A;  3MEH A;  3NQI A;  3GTG B;  4A3I B;  1HZB A;  2B3G A;  2Z4H A;  1BBU A;  4Q0F A;  3R93 A;  1UE5 A;  1IL2 A;  3BDL A;  1PXU A;  2JP1 A;  1X54 A;  5FLX E;  3W1G A;  2XN9 C;  4X3S A;  1C7Y A;  5I9O A;  1T5X D;  3KJP A;  2B8F A;  2DNC A;  3QB3 A;  2HT1 A;  1FNV A;  3QIA A;  1I50 B;  5C0X J;  2B63 B;  3HOZ B;  2RSO A;  1X65 A;  5FOB B;  4RGM A;  5C44 H;  2HHH L;  3CPF A;  4DV4 L;  5I6Y A;  4YCU A;  1VQC A;  1J5E L;  5IYC G;  2XVS A;  5FO9 B;  1EUJ A;  1FNU A;  2AWN A;  2Z0S A;  3H94 A;  1WTW A;  3K0Y A;  2F4V Q;  4BY7 H;  1L1O A;  1HR0 W;  4BXX G;  3TP7 A;  2PI2 A;  3QR8 A;  2F3I A;  3NBI A;  2JA6 B;  1WD0 A;  1HXY D;  4I7Z C;  1I4R A;  2ZTE A;  4BBS H;  2JEB I;  4PMC A;  4O42 A;  1H9J A;  1NMG A;  4S3S A;  4DAV A;  1PDQ A;  4ZAI A;  3SE0 A;  3X3M A;  5GAG C;  1O78 A;  3S16 H;  5CR3 A;  5EKK A;  1SFO B;  2NVQ H;  1X3P A;  4KK7 A;  3FP9 A;  1BCP C;  4G7Z C;  3Q6S A;  5FO7 B;  2F0L A;  1H9R A;  2EY2 A;  2RA4 A;  4DUY L;  4PZ6 A;  4JG2 A;  1PH5 A;  4DR6 L;  1PYB A;  2WAQ B;  4H13 C;  3LWE A;  4UHV A;  3Q24 A;  2BCO A;  1WYD A;  1WTV A;  3RLO A;  2F0T A;  3ERS X;  1PHJ A;  3K80 C;  4A3M B;  2Y0S B;  1SYG A;  1BOS A;  4OX9 L;  1SJE D;  3PIP A;  4LF9 L;  1STA A;  2PQA B;  2PW7 A;  1PH9 A;  1AFP A;  1DGS A;  5M5X H;  3S14 B;  2OWO A;  2K4K A;  1Q81 C;  1RF2 D;  1EFI D;  1FGU A;  3FPP A;  2JEA I;  3M7G A;  1EY4 A;  4K6L A;  4DR7 L;  2HCI A;  4A3M H;  5I6W A;  1Q1E A;  4HAE A;  4FXG C;  1V9P A;  2NTT A;  5IGG A;  3PCO B;  2P5Z X;  1BBW A;  2PMZ E;  3MXG A;  1WTO A;  3KLS A;  1AW7 A;  1SXT A;  2QEX A;  3NTK A;  2F0F A;  1DD2 A;  4JV5 Q;  5C4Z A;  1SE4 A;  2YTY A;  4C2M B;  2NN6 I;  4LUO A;  1KNA A;  1I3Q H;  1U4M A;  1U9R A;  2QEJ C;  1STY A;  5I4D A;  4LWC A;  2KCT A;  1X3F A;  2D5D A;  2X6G A;  1FR3 A;  4IPD A;  2YV5 A;  3DM3 A;  4JK1 C;  3G71 A;  1KQS A;  3I7F A;  1I4Q A;  1LTL A;  4DK6 C;  1YNJ C;  3NWS A;  3FMC A;  4POF A;  4ULL A;  4DNI A;  3ULP A;  5KEE A;  3T4A C;  4A3K B;  4DR6 Q;  2WB1 G;  5C3X A;  5G3L F;  1S5B D;  3BVZ A;  3VYS A;  1EY7 A;  1Y1W B;  2VQE Q;  4R4I A;  4X6A H;  5HGQ A;  2L5T A;  1LO5 D;  1PMR A;  3S15 H;  4DA2 A;  5BN4 A;  3JAM i;  2E74 C;  3IRB A;  4JCV E;  5JJK A;  4KKT A;  1TWH B;  4JI1 L;  1KLG D;  2BH2 A;  1YIJ A;  2N3S A;  3NXW A;  4A3G G;  3E6Z X;  5C4J H;  1U0L A;  2BE5 C;  5BR8 L;  3DUZ A;  3AEV A;  3A8J E;  1Z47 A;  2KA7 A;  2IW3 A;  5ELO A;  4B3S L;  1MGS A;  4KN4 C;  1QNK A;  4Y52 H;  2YTV A;  3R3O A;  5JJL A;  4FF2 A;  1LT5 D;  2XIW A;  5C4X G;  4ZLT F;  1W2B A;  5D65 A;  4R4Q A;  5ELC A;  1CQF A;  4FF1 A;  5JEA G;  1V1P A;  4KTA A;  2NUC A;  3ULL A;  1ONL A;  1HNZ L;  4C3J G;  3GTL B;  5CV7 A;  2F0U A;  4IQZ A;  1UWV A;  3GTJ B;  1A0I A;  3KK7 A;  3VR5 A;  3C3L A;  4H44 C;  3X3N A;  3CF5 A;  5LMU Q;  2ICI A;  3I8Z A;  2CW0 D;  4NXM Q;  5LMN Q;  4IPG A;  3K57 A;  2NN6 G;  5C3W A;  1WTQ A;  1A8V A;  5A2Q E;  4RHS A;  2YU9 H;  1B70 B;  1TS2 A;  4A3D G;  2V4D A;  4DV7 Q;  1BQQ T;  4TQU S;  4OL7 A;  1I4H A;  1TWC B;  2WB1 E;  3P7J A;  4UY8 C;  1YEZ A;  5K36 H;  2R7F A;  2R3Z A;  1S5D D;  2ENB A;  3HOY H;  2L15 A;  4AYB B;  5L37 A;  5COR A;  3M4O H;  1DXM A;  5FJ8 H;  2OXP A;  4BBR H;  3JAM L;  3PO2 B;  1EY5 A;  2RKS A;  3K6O A;  1GM5 A;  3BYT B;  4L5S A;  1FNW A;  1U5K A;  2JA7 G;  3I3C A;  5IGE A;  5C3E G;  1MI2 A;  1VMC A;  2DUD A;  4KMU C;  4LF7 L;  4JYA Q;  3VYR A;  1X3E A;  1HZA A;  4JOI C;  4R8I A;  5EPL A;  1IBK L;  1PH6 A;  1IL8 A;  2VNU D;  5LMN W;  1UNS A;  1QVC A;  4TSS A;  4CGY B;  4OON A;  4X65 Q;  3LWU A;  3U9S A;  5FLM H;  1ICF B;  4DV1 Q;  4JVZ A;  2Q8I B;  1VQO A;  5T1G A;  2E2H B;  2I5L X;  1I4X A;  4DAM A;  1TQO A;  2I07 B;  1H9K A;  4OWX B;  4A3J H;  2LXK A;  1W3S A;  2IX3 A;  2UUA L;  3S17 H;  4JI6 L;  3HFZ B;  1UEA B;  2KHS A;  3KLW A;  4GN5 A;  1B3A A;  3FRP B;  3UDG A;  2ZM6 Q;  1RL2 A;  4FVM A;  3M4P A;  1XMO L;  4AIM A;  4DNT B;  2B2U C;  4NW2 A;  3MWY W;  5IGC A;  1BCP F;  3HOV B;  2KEN A;  1D5Z C;  5EKI A;  1V1P B;  1EYD A;  2Z4I A;  4A75 A;  4DAY A;  1N33 L;  4A76 A;  3CCE A;  4ZYS A;  2OT2 A;  2H1E A;  3MEF A;  4A3E G;  1A3U A;  1PFN A;  1N34 L;  2PNH A;  4IFD J;  1LUZ A;  5AJ3 L;  2K5D A;  2JA8 G;  4C3H H;  1VQJ A;  1Y1V H;  2R92 G;  5M3F B;  4GKK L;  2K32 A;  1G8Z D;  3BVM A;  1L0X B;  3OW2 A;  4B3T L;  4EVO A;  2OTL A;  3FEW X;  1C8C A;  3K7A H;  2R7Z B;  1QVG A;  1XPO A;  2CW0 C;  3NQT A;  4LF7 Q;  1IYJ B;  4DR3 L;  3E3X A;  5M5Y B;  3G48 A;  4F8M A;  2A6E D;  3T13 A;  3I56 A;  3DWQ A;  2E2J H;  2NVT B;  1CSQ A;  3A54 A;  1IKM A;  3HKZ G;  4P2C B;  5M3F H;  1EFW A;  2FMC A;  4K14 A;  4K5V A;  4KD3 A;  4RCN A;  1U4P A;  1JQY D;  1SNM A;  4A3F G;  2R7Z H;  5IYB H;  4QQB X;  1PVO A;  3CCM A;  3T51 B;  1LAB A;  4HIK A;  1O7Y A;  3TRZ A;  1XMO Q;  1LTT D;  1ZKO A;  3M4Q A;  1FL0 A;  2QIL A;  1Y69 U;  1HQM C;  2NVY H;  4A3L H;  4TRD A;  4KV6 A;  3C1E A;  3F2D A;  1PTO F;  2MGS A;  1PLF A;  2ZXR A;  2N49 A;  3I4L A;  3C2P A;  5EKL A;  5JEA J;  4A3I G;  3LNN A;  5KRU A;  5CC4 A;  3NEM A;  4C3J B;  3STB D;  5C44 G;  2HIV A;  1V1Q A;  4JI8 L;  3KF8 A;  4FO2 A;  2CQO A;  5CV5 A;  2G5D A;  5HGT A;  1OXS C;  1DJR D;  2CHB D;  4DN4 M;  2F03 A;  4HCS A;  2H4O A;  1K83 H;  4JC0 A;  1MHW C;  4DAY B;  1X56 A;  2B63 G;  4OWW B;  1HZC A;  3HOZ G;  4DR3 Q;  5AFW A;  3S1Q H;  3R2I A;  2M00 A;  4GOP A;  4BBS G;  2VUM H;  2VQF L;  4B3R Q;  5D3I B;  5EBD A;  1L0Y B;  3KJO A;  4LF5 Q;  2MQH A;  3HOX H;  4JI0 Q;  3E0J A;  1R9T B;  4FYD A;  4POG A;  1S5F D;  3I55 A;  1E1T A;  3HEJ A;  1PYW D;  3H91 A;  1GUO A;  2F3V A;  3SHL A;  1SMY D;  2L4N A;  2JA7 B;  3SK8 A;  2VW9 A;  2IT1 A;  3NK9 A;  2QA4 A;  5C3E B;  3IFD A;  1VQA A;  3U4Z A;  2NZ1 D;  1SYC A;  3I73 A;  2JJQ A;  3KYH C;  1NAP A;  1OXX K;  1FYC A;  3HKS A;  3NE5 B;  3T1Y Q;  4Y7N B;  4A4I A;  2E8G A;  5HY6 A;  1CQV A;  4G57 A;  1EIY B;  1VQN A;  2AUK A;  5M5W B;  3UDF A;  2AQ1 B;  3U4V A;  4IN3 A;  1JOQ A;  4HJA A;  2A6E C;  1HZ9 A;  2WAQ G;  3VR4 A;  1Y8O B;  2UXB L;  2UU9 L;  1H95 A;  4IJH A;  4YHH L;  3RLF A;  2Q2T A;  3NHH A;  4GNX A;  4IOA A;  5HUR A;  1IBM Q;  5M3M H;  3EIV A;  1SAP A;  5M9O A;  1BO0 A;  2PNR C;  2VY3 A;  1BVS A;  1I5F A;  3RR5 A;  4HSV A;  4A3M G;  2Y0S G;  1PH7 A;  1GUS A;  2B39 A;  4K5X A;  1S4Z A;  4LFC L;  3HOW H;  1IBL Q;  1B8A A;  3E5S A;  4EQO A;  1D7Q A;  1O80 A;  1JIC A;  1FGB D;  3MC0 B;  4V0B A;  3M7N A;  3W5O A;  3PO3 B;  4KN7 C;  2VQF Q;  2Z1C A;  1ET6 A;  2B2W C;  3GTO H;  4NKL A;  3KF8 B;  1ASZ A;  2K05 A;  1UE7 A;  4KKS A;  1JB7 A;  4UP7 A;  1N8R C;  3J81 L;  1QZG A;  1NY4 A;  1MJC A;  1G29 1;  4A3E B;  2N88 A;  1PFS A;  5EJW A;  1WI5 A;  3GV3 A;  2M2L A;  2OQK A;  2I46 A;  3W3A A;  5IIF A;  3S1R B;  3SR1 A;  2IX0 A;  1K73 C;  2R92 B;  4UPA A;  4ME5 A;  5IYD H;  4ME3 A;  4ODG A;  4DR1 Q;  4GOP B;  5J1Z A;  2F0G A;  1EL0 A;  1YHQ A;  2ICE C;  2IL8 A;  4WFN 3;  2DNE A;  1BCP D;  3PIO 3;  4L5T A;  1VQB A;  3HOU B;  2VXW A;  1LYL A;  5E7N A;  3NEN A;  3L2P A;  4BY1 H;  5JPN C;  4PG3 A;  1JOR A;  1SYE A;  1PTO H;  3HKZ B;  4GN3 B;  3CC7 A;  3S24 A;  1XTC D;  2KQ3 A;  2EIF A;  4DAP A;  2WAQ E;  2UXC L;  1Q90 A;  1TWF H;  4QB4 A;  4YHH Q;  2KEE A;  4UP9 A;  1AZP A;  5D14 A;  4XYQ A;  1JE5 A;  4A3F B;  2A69 C;  4YWL A;  1YHA A;  5IGB A;  1BUV T;  1E3P A;  3U50 C;  3TDQ A;  5CYU A;  2Y0S E;  3I4M H;  1M4V A;  4AH6 A;  1IHZ A;  3T1H Q;  2DY7 A;  4BA1 I;  5BN3 A;  5E4W C;  3A5Z B;  1V1O A;  3ERQ A;  1DOM A;  1SMY C;  2K5Q A;  1I6V C;  3RZO H;  4WJ4 A;  1TY0 A;  4IAL A;  4MTN A;  3OYY A;  3J80 L;  1XMQ L;  2HQL A;  4U68 A;  2L12 A;  3VA5 A;  4GNX B;  4WJ3 M;  4RGT A;  1BKB A;  3G4S A;  4PNY A;  4BA2 I;  4JI7 L;  4LMQ D;  5C44 B;  4KHP L;  5FO8 B;  1GJX A;  1WD1 A;  1EQR A;  5KNC A;  1IZ6 A;  1X3G A;  1QWY A;  3CCJ A;  2XWJ B;  4IZ8 A;  1KAA A;  1MSG A;  3CC2 A;  2LXJ A;  4BY7 B;  2JQO A;  2PW5 A;  3KLS X;  1BXT A;  4J8Q A;  5K36 G;  5JJI A;  1PYS B;  1E2W A;  3HOY G;  2ZXP A;  3RN2 A;  2PQE A;  4K6D A;  1PH8 A;  3QOL A;  1HPC A;  2EDG A;  1YNJ D;  4BBS B;  1PTO D;  2ASB A;  2PI2 E;  4HIM A;  4DV6 Q;  5FJ8 G;  3CW2 C;  1LTG D;  3UDI A;  4YY3 Q;  3A8I E;  2JE6 I;  1JWM D;  2E5L Q;  1HH2 P;  3BDO A;  4PMW A;  1F9R A;  5IGD A;  3S16 B;  4C56 C;  2NVQ B;  1EEF D;  1L2F A;  2QDL A;  2KHJ A;  4ABN A;  1JJC B;  1NUC A;  1K0S A;  5I9P A;  4AYB G;  3H15 A;  5GRO A;  1PRT C;  2XTI A;  2BE5 D;  2Q2U A;  4DV5 L;  3PO2 G;  1DZ1 A;  2RF4 A;  1EYA A;  2UXD Q;  1VQD A;  4E6I A;  2C5C A;  3BJU A;  3H0G H;  3GO5 A;  1TVX A;  4ZCK A;  1SEB D;  3TZU A;  1E7Z A;  1STB A;  4LF6 L;  4A3J G;  3MAQ A;  1CM9 A;  2NBF A;  2XRQ D;  1QNU A;  1EYC A;  5IP9 H;  1LT3 D;  2EVB A;  1JE4 A;  2K7V A;  1QJO A;  3C1F A;  1VQK A;  3TBI B;  4JI7 Q;  1ILP A;  1DOL A;  1F77 A;  4K2K A;  5M5X B;  3T56 B;  1ZYR D;  2G9H D;  3SDZ A;  1GUW A;  4ZKB B;  3K5N A;  4FDB A;  3RMH A;  2NZH A;  3G6J B;  5E1F A;  2FXQ A;  1PV4 A;  4OO1 H;  2MP1 A;  2HHH Q;  1N32 L;  1VQ7 A;  4OGQ C;  1TU2 B;  1ENC A;  4DV4 Q;  1QUQ B;  2F0D A;  3MA2 B;  2I0Q A;  1J5E Q;  3HOV G;  1RTN A;  1J9O A;  1V43 A;  3I4N H;  4XQN A;  4KLK A;  2ZT9 C;  4C3H G;  5CBA E;  1I3Q B;  3OOC A;  3R8B A;  1EWC A;  1X32 A;  2D62 A;  1TKW B;  3M4Y A;  4HSP A;  1O7I A;  2B2T A;  4XTC S;  1HNW L;  3W2D A;  2K04 A;  2OEO A;  4LF4 L;  4AYB E;  2LY7 A;  1J6Q A;  1VQ8 A;  3J7A 5;  2F52 A;  1VQL A;  4QUC A;  4APV A;  3DMU A;  1E22 A;  4DR2 L;  3HP3 A;  4HED A;  5M3F G;  3RN5 A;  5ELB A;  3OTO L;  3K5M A;  1S40 A;  4LF8 L;  4OXP A;  1H9S A;  1YBY A;  2A73 B;  1PA6 A;  3QWN A;  2E75 C;  4BS9 A;  4CDC C;  1SYB A;  3S15 B;  5C4H A;  5KYL A;  2R7Z G;  2EY6 A;  2KCC A;  1NR2 A;  4DUY Q;  3HRZ C;  2ATW A;  3DWA A;  1PTO C;  2F0N A;  1R4P B;  4QY7 A;  5C4J B;  3BZK A;  2AKW B;  3EQL C;  3PF5 A;  1G91 A;  3ICE A;  2EXD A;  4YIJ A;  1Q3L A;  2R93 H;  1WTH A;  1NR4 A;  1S72 A;  4WJW A;  5IT9 L;  3ITP A;  1AZQ A;  1F9P A;  1LM0 A;  4CDE C;  4OX9 Q;  4LF9 Q;  3S9W A;  1LV9 A;  1KDA A;  3QO2 A;  4RCO A;  2B2Y A;  4FF3 A;  1N32 Q;  1CUK A;  1EY6 A;  3ULJ A;  2B8G A;  2EYJ A;  1LTR D;  3AQQ A;  3CAM A;  3SK6 A;  2L1B A;  1B7Y B;  3DXJ C;  4KHZ A;  1TWA H;  4YCV A;  1EQQ A;  3I2Z A;  4ZUI A;  4NXN L;  4DR7 Q;  4IJL A;  1QG7 A;  1SLJ A;  3A7A B;  2BA1 A;  4IUQ A;  4LFB L;  2VS1 A;  2RDG A;  2OF1 A;  3EA6 A;  3RNU A;  4IUN A;  2YU9 B;  3GP7 A;  3AMU A;  4GS3 A;  3TME A;  2VUM G;  1ZYR C;  1SRU A;  1QOH A;  1IYV A;  3HOX G;  5GAD C;  4KJN A;  2J4X A;  3K81 C;  1NSN S;  1WTR A;  2LS0 1;  2A5H A;  1PZI D;  3K5O A;  4L6T B;  2IPK D;  2LMC B;  4LF8 Q;  1O7Z A;  3HOY B;  5GQO A;  2E2I B;  2DJF C;  4DK3 C;  3D6W A;  5EAY A;  1VQ6 A;  2F0V A;  3M4O B;  1B2T A;  2A1A A;  2MPM A;  2DJG C;  3KBG A;  3QOJ A;  4BBR B;  1SE3 A;  1CI3 M;  1WCM B;  1AN8 A;  5CMD A;  3PUV A;  3CD6 A;  1KHI A;  2IJ0 A;  1HNX L;  3WOF A;  1SRO A;  1QIL A;  2E2I H;  2GA4 B;  2VB3 X;  3D0F A;  1JC7 A;  1H9S B;  1UEB A;  3PUZ A;  4DK0 A;  2EYH A;  3GTK H;  2R7D A;  1B1Z A;  4OEM B;  4JI1 Q;  1OXV A;  3MZ5 A;  2D9U A;  4J6H A;  1WCM H;  4P71 A;  1XXG A;  5BR8 Q;  1EU3 A;  3WOE A;  4RGO S;  1AE2 A;  1X6O A;  4B3S Q;  1WVL A;  4DKA C;  1D5X C;  1XPR A;  4A3J B;  1E24 A;  1WOC A;  1OXT A;  3GQB A;  4HR7 B;  3S17 B;  3F2B A;  1C9O A;  5M3M G;  2ZJQ A;  2HDM A;  3BYY B;  1Q8I A;  4X62 L;  4LFB Q;  2A8V A;  1XNQ L;  2KCM A;  1HNZ Q;  1GHJ A;  3Q23 A;  4BXX H;  3BDC A;  3MHB A;  4JI2 L;  1PRT F;  1JOO A;  1VF7 A;  1DON A;  3VDY A;  1XX8 A;  3CU7 A;  1LAC A;  1VQ5 A;  4V19 0;  4HN7 A;  1M90 C;  1KDB A;  1MJE A;  2UUB L;  3BZC A;  2ZJP A;  1EOV A;  2MO1 A;  4GLV B;  3URY A;  4R4T A;  3CRK C;  3PO3 G;  2NVX H;  3CCS A;  4C3H B;  1Y1V B;  1ILQ A;  4K8J A;  1VQF A;  2D0P A;  1WJJ A;  4RFB A;  1I6H H;  4QL5 A;  2OQ0 A;  4A93 H;  4RKL A;  1A63 A;  4MZ9 A;  3K7A B;  2Z6K C;  5A2Q L;  2EJM A;  4RKB A;  1YZ6 A;  3CQZ H;  4JBW A;  1UE6 A;  4CJ1 B;  4BY1 G;  2E2J B;  3QJY A;  3I91 A;  1K8A C;  2PO4 A;  4JBM A;  4JBK A;  2MJ8 A;  1CK1 A;  1CSP A;  3D3R A;  3VR2 A;  1SBB B;  4PQX A;  2IHE A;  2CKZ B;  4IUP A;  4LAA A;  4ZQ3 A;  2RDF A;  5EBC A;  3KF6 A;  1SYD A;  1QE6 A;  3HOU G;  2F0W A;  1IBK Q;  4DXG A;  3SXH A;  5CV9 A;  1EOT A;  1M8A A;  3QG1 A;  3I4M G;  1GD7 A;  3A7L A;  1XNQ Q;  5LL6 S;  2NVY B;  2Q8R E;  3TP6 A;  2EYO A;  5E3F A;  1YVC A;  4YWM A;  2EZV A;  4AQY L;  1SND A;  2D0O A;  5COY A;  3D4D A;  2UUA Q;  3OIQ A;  2HUG A;  3S1N H;  4QF4 A;  5IGF A;  4JI6 Q;  1DOK A;  4IFD H;  5EPK A;  2NB0 A;  4P73 A;  2UUB Q;  3GTP H;  3V05 A;  4BWG B;  1GOZ A;  4QGU A;  4DUZ L;  4EQN A;  2WKC A;  1DYQ A;  3A0J A;  1SNQ A;  1GXD C;  1II3 A;  4OO1 I;  1L1O C;  1T9H A;  4RAU C;  1SNP A;  4C3I H;  1N33 Q;  1K83 B;  3E9I A;  3BS1 A;  4JBJ A;  3VR3 A;  3TP8 A;  1N9W A;  5JOB A;  1FJG L;  2GN5 A;  1LTI D;  2QGQ A;  1VCI A;  3DEO A;  3AU7 A;  1N34 Q;  3S1Q B;  1GUT A;  3LX0 A;  5AJ3 Q;  2L9H A;  1F2M A;  2VUM B;  4M8A A;  3RLN A;  5ELF A;  3HOX B;  1XYI A;  1TWG H;  1RIP A;  3V2T A;  4OHJ A;  4GKK Q;  4BY7 G;  2FIN B;  3RUZ A;  1ML0 D;  4B3T Q;  4YCW A;  4A3G H;  4R9W A;  1OTC A;  3J81 c;  1Z9F A;  3AYH B;  3GTM H;  3PIP 3;  3K0X A;  2NTS A;  1VQP A;  4A3B H;  5LL6 X;  1TY2 A;  4PV1 C;  5IP7 H;  1EWI A;  2RHS B;  2SOB A;  4GKJ L;  4DR4 L;  2K1B A;  2WAC A;  3FKI H;  5K5P A;  3HKZ E;  3J81 j;  3I4O A;  1GUN A;  5JAV A;  2A69 D;  4CKC A;  3H0G G;  2O5I C;  5C4X H;  1I4P A;  3MXN A;  3J81 E;  1Q82 C;  4KY7 A;  1RDP D;  4CJ0 B;  1BCP B;  5JEA H;  2Z6B A;  1Q12 A;  4JI4 L;  3KF6 B;  5KNB A;  1FD7 D;  1E2Z A;  3A8K E;  4JI5 L;  3M3Y B;  2QDB A;  2A19 A;  1KTK A;  3EN2 A;  3EBE A;  4WOR A;  3FPU B;  1JB3 A;  3ZJY C;  3DLL A;  4GLX A;  4G7O C;  3SK5 A;  3PF4 A;  2F1M A;  2XGT A;  1STN A;  5M3M B;  3K5L A;  4GN4 B;  4A3D H;  1J8I A;  4XQQ A;  3S2H H;  3HOW B;  3S2D H;  4L8J A;  3M3Y H;  1JT8 A;  1Q86 C;  4OO1 G;  2V1C C;  1KL9 A;  4IUU A;  3TS2 A;  2BDO A;  4JI8 Q;  1K28 A;  1KLU D;  3OW7 A;  2WII B;  5DEH A;  3A56 A;  3CCV A;  4U67 3;  4DV2 L;  4X66 L;  3GTO B;  5DLQ E;  3I4N G;  4Z9C B;  2KVM A;  2A74 C;  2AUJ D;  2HQE A;  4J1M A;  3K7U C;  1K3R A;  1VQ4 A;  1CHQ D;  3RD4 A;  3J80 c;  2ALY B;  4XDX A;  1Q1B A;  1MBY A;  4GLA C;  1SYF A;  3PUW A;  3V96 A;  4EQ5 A;  5IOC A;  3O13 A;  1EQT A;  4JI3 L;  1K8O A;  5JPM C;  4B9W A;  2X6L A;  4XXE A;  4DR5 L;  4C1N K;  1D1K A;  1SR3 A;  4G4K A;  3J80 E;  1G6P A;  1KXL A;  1PRT D;  3I70 A;  4HTH A;  2F3W A;  2LSS A;  4JW0 A;  4BY1 B;  2ZXO A;  3D4R A;  1HR0 L;  4NB3 A;  1PTO B;  2SNS A;  3K58 A;  1HRJ A;  4JI5 Q;  3E0E A;  5KYI A;  1XTD A;  5DM6 3;  1TWF B;  4CDD C;  2JA5 H;  4TVA B;  2IHF A;  2ZTD A;  1HQR D;  3SK4 A;  2R93 G;  4JOI A;  4DXF A;  3ND8 A;  3RZD H;  4P74 A;  1K0R A;  2H5X A;  4KJO A;  1I94 L;  1AEX A;  3MXN B;  4LW1 A;  1LTB D;  2K33 A;  1P16 A;  3I4M B;  4ID6 A;  5DAU A;  3GDE A;  1G6Z A;  2EOT A;  1EWH A;  2ID0 A;  4IPC A;  1TS3 A;  3BG3 A;  1YIT A;  1L0W A;  2UXB Q;  2UU9 Q;  4ZK9 B;  2CVR A;  4R4C A;  1LT4 D;  3RZO B;  3PQI A;  4DV2 Q;  2SNM A;  2B29 A;  3KDF A;  2QKI C;  2HD3 A;  2K52 A;  1CKN A;  1SNC A;  3OMC A;  4ZKC B;  4JPB W;  2B2U A;  3TZD A;  2WP8 J;  4KY6 A;  2RHQ B;  4LFC Q;  3VA7 A;  4UAI A;  2F4V L;  2RCF A;  2EYP A;  1KDC A;  5C5L A;  1YJN A;  2EPB A;  1VQG A;  2LFN A;  4DF7 A;  3P20 A;  1CZW A;  4J15 A;  1HTP A;  1F2L A;  4JI3 Q;  1KAB A;  2Z6K A;  2UUC L;  2O2L D;  4RH6 A;  1U4R A;  3OHX C;  3WDN A;  1QUQ A;  2KEC A;  5EQ0 A;  3IAY A;  4XQJ A;  3A74 A;  4ZUJ A;  1TT2 A;  4P75 A;  3K8A A;  3J7A V;  3MVV A;  3SEB A;  3OPO A;  4CJ2 C;  1X9N A;  3NP8 A;  2CFM A;  5FK9 C;  1NMF A;  2EY1 A;  3TQY A;  1M1K C;  3GTQ H;  5LHY 1;  1GVP A;  4TKO B;  3F2C A;  2JYO A;  1I94 Q;  2OCE A;  2IX1 A;  1EZ8 A;  4EQP A;  3WWV A;  5JJZ A;  3B6Y A;  4BBR G;  2K5H A;  2XNA C;  3UDX A;  4NMZ A;  1EY9 A;  1WCM G;  2K5V A;  2UXC Q;  1YJW A;  3H0G B;  1R4Q B;  3EFX D;  1KRS A;  3GTG H;  5KND A;  4A3I H;  4N9T A;  3SVM A;  1NCV A;  3BU2 A;  4M1U B;  3H09 A;  1F9S A;  3R2T A;  1PH4 A;  1PH1 A;  2B2V C;  5FLM G;  2K5W A;  1D6E C;  3NSW A;  2CCZ A;  3UE1 A;  3U9O A;  2I5M X;  4KKU A;  1EY8 A;  4IFD I;  2B63 H;  1I50 H;  3HOZ H;  1PFB A;  5C0X H;  1EIF A;  5IT9 c;  1XMQ Q;  2UUC Q;  4CDF C;  3KDF B;  2OTJ A;  4JV5 L;  1CT1 D;  2DY8 A;  3DM1 A;  4QIW B;  1XJV A;  1CKN B;  4QJF A;  4KHP Q;  4KY5 A;  2QCP X;  3I4N B;  1JR0 D;  1IW7 C;  4X3U A;  4LUZ A;  2JA6 H;  5IT9 E;  3D8G A;  4O2D A;  4CHT B;  5NUC A;  3E9H A;  4CKB A;  4A93 G;  2EYM A;  2K28 A;  2Q2H A;  1F2Z A;  1S5E D;  3CME A;  3AFQ A;  4HJ7 A;  3TP5 A;  1G2S A;  1K3B C;  2RCN A;  2VQE L;  5FLX L;  3ND9 A;  2F4I A;  3F1Z A;  1SFO H;  5IY0 A;  1IKL A;  1Y1V G;  4OIJ A;  4DU9 A;  1A15 A;  4QCL A;  2EYL A;  3HS0 C;  1ASY A;  2XSC A;  3UE0 A;  3L3O C;  1JWS D;  4LFA L;  3CP0 A;  3T16 A;  2RVL A;  1RD9 D;  2AQ2 B;  1B3Q A;  2F0J A;  1O7L A;  2NYZ D;  4DV5 Q;  5J3B A;  3TEH B;  2F0H A;  2VZA A;  3T53 B;  2F0Q A;  4DNR B;  1D2B A;  5JVH 3;  1RCV D;  2R93 B;  1JMC A;  1MKH A;  4ILW A;  1EQV A;  3NBH A;  1YJ9 A; 
#chains in the Genus database with same CATH homology
 3AB9 A;  1CA6 A;  1BR9 A;  1QCB D;  3VYT A;  1PZJ D;  4IFD G;  2O5J C;  2FMM A;  2Z8L A;  4OIK A;  3L9A X;  4HCE A;  3NWT A;  4GZY C;  2FJ2 A;  3BZD B;  2KED A;  1TWA B;  2EYF A;  4NDX A;  4FNF A;  2PPB C;  4C3I G;  2RSN A;  5I2X A;  3IL8 A;  3D6C A;  1SSO A;  3JAM E;  2RBM A;  5I2Y A;  1BF4 A;  5EGT A;  1YNN D;  2B2W A;  1C48 A;  3K59 A;  1A3V A;  4IUV A;  1C4Q A;  1HFG A;  4KI0 A;  2R61 A;  1B9N A;  1EU4 A;  4X3K A;  5KGU A;  2FHT A;  1STH A;  4B08 A;  1B53 A;  1E0B A;  5CV4 A;  2F0K A;  4F88 A;  4H7B A;  3OWE B;  1Y8P B;  4XT1 B;  4FXK C;  2EE1 A;  4F87 A;  3GTK B;  4XIG S;  5IOD A;  5C5M A;  3NTH A;  1SE2 A;  1SJH D;  1CZG A;  1A6X A;  1D1I A;  1DM0 B;  4HMJ A;  4FXD A;  1I4G A;  3CHB D;  2EY5 A;  1ESR A;  2Q8T A;  2F0P A;  1JWU D;  4EGV A;  5C6A A;  2AQ3 B;  3OSO A;  1IYU A;  3DEP A;  2KUM A;  4FP5 D;  2PMZ B;  3IKJ A;  1GHK A;  1EEI D;  2CQA A;  3NTI A;  1VF5 C;  5ISR A;  1V8Q A;  3TN2 A;  4CBV A;  4KHV A;  1D5M C;  1ET9 A;  2F0S A;  4X3T A;  2EJG C;  4L63 B;  4HMI A;  1Z7T A;  2NVX B;  2TSS A;  2PZT A;  4XYO A;  1VMP A;  3A55 A;  4PMB A;  1Z6H A;  1I6H B;  4R8N A;  4A93 B;  2PCF B;  4MHE A;  1B4O A;  1SDF A;  1CA5 A;  3CQZ B;  3I90 A;  4IUT A;  2VB2 X;  1RHP A;  1STG A;  1YNN C;  4LK1 C;  3N52 A;  2WIN B;  3OIP A;  1B9M A;  1ROD A;  5F2D A;  1Y8N B;  1EZ6 A;  2A6H D;  4K2L A;  4UDU C;  4K5W A;  1WTX A;  1EIH A;  5KIX A;  2NWG A;  1HA6 A;  1KNE A;  4I65 A;  2SDF A;  2B2V A;  1PZK D;  1TS5 A;  4C1N I;  3PUY A;  2L55 A;  2DN8 A;  2E76 C;  2MHV A;  2RQX A;  1DCZ A;  2KOL A;  3OMG A;  3Q0A A;  3MFY A;  2J7Z A;  3S1N B;  1RJT A;  3H6M A;  4RA8 A;  3FDT A;  3GTP B;  2F0I A;  5C0X I;  1HA5 A;  1RTO A;  4FF4 A;  4ZRZ A;  1OXU A;  2F0E A;  2X69 A;  2BA0 A;  2HCC A;  4C3I B;  5DM7 3;  2WB1 B;  3ZYY X;  1ZXT A;  3H3V C;  3EVQ A;  1AP0 A;  3MXU A;  4WRD A;  5CV8 A;  3HGB A;  5TSS A;  1UUP A;  3HG9 A;  1TWG B;  3J7A F;  2E2D C;  3VR6 A;  1W6K A;  1MD2 D;  2F0M A;  4A3G B;  2EXZ A;  1ICW A;  1LTS D;  3PV0 A;  2YYZ A;  3VYU A;  3GTM B;  4A3B B;  1A2U A;  4DFA A;  2D2C C;  2R6G A;  4MIU A;  3MFG A;  3HZX A;  2L0C A;  3FKI B;  5CBE E;  2XRS D;  2TMP A;  5FKA C;  5A35 A;  5C4X B;  2FFK B;  3MTS A;  5G3L D;  4DK1 A;  5CV6 A;  3J7Y W;  4RWS C;  1BDO A;  1ENA A;  3C46 A;  4K8I A;  1UAP A;  4QMG A;  1PRT B;  2MUY A;  2JXM B;  3G7L A;  4MN3 A;  3PUX A;  5CGK A;  1HUM A;  2WKD A;  2KCN A;  3KBX A;  2C9O A;  2A6H C;  1A2T A;  3PMF A;  3I72 A;  4N9P A;  5C0X G;  2A68 D;  4A3D B;  3N6R A;  1B50 A;  2XWB B;  5EPJ A;  1JOK A;  1W6J A;  3S2H B;  3S2D B;  1WTP A;  3KLR A;  1HCZ A;  1BNZ A;  3BVG A;  1CTM A;  4Q5V A;  3D4W A;  3TSS A;  4H0L C;  3P75 A;  3ERO A;  1EIG A;  2NN6 H;  1CHP D;  1LT6 D;  2PYK A;  1A3T A;  2B2T C;  2SEB D;  1K8M A;  1F2Y A;  5E4X A;  2BDN A;  4RHR A;  5J39 A;  1E2V A;  3NPP A;  1BBX C;  5D3D A;  3S1M B;  5JVG 3;  4LJZ C;  3F2U A;  1T5E A;  1XWE A;  1STE A;  3IFT A;  4F7X A;  1CFM A;  1PFM A;  2PZW A;  2K6A A;  5BN5 A;  3OWF A;  2K01 A;  1B44 D;  2JA5 B;  3CKI B;  3GD7 A;  1TS4 A;  1F9Q A;  3RZD B;  4O1N A;  4XT3 B;  4DGZ A;  1ZEQ X;  4G7H C;  2IWH A;  1H9M A;  3ONA B;  2B2Y C;  3CRL C;  3GV6 A;  3UI2 A;  2K03 A;  2PZU A;  2AWO A;  3P1H A;  1RKN A;  2QF7 A;  1VDZ A;  1HTL D;  1GUG A;  3EJI A;  5ELD A;  1X3Q A;  1EY0 A;  3M85 A;  1LTA D;  2JSO A;  1U4L A;  2L11 A;  3DWP A;  1OO9 B;  1TII D;  2JA8 B;  1IW7 D;  2G9D A;  2RDH A;  1MSH A;  2EJF C;  4IUR A;  3D31 A;  2A68 C;  1SNO A;  2J0T D;  4KD4 A;  4NP5 A;  1HFN A;  2WV6 D;  3FVQ A;  5J22 A;  5DNF A;  2HDL A;  2LKV A;  2O4X A;  3KUP A;  1QB5 D;  5ELE A;  2KJX A;  3MXP A;  5T1I A;  1S5C D;  3GTQ B;  1TR5 A;  2N55 A;  2BOS A;  2M9V A;  4CKE A;  1HHV A;  4B9X A;  4QUF A;  3NUC A;  3Q22 A;  1ESF A;  1LLR D;  3DHQ A;  1ENF A;  3L7Z C;  4RGN A;  1JCK B;  2F0O A;  1HUN A;  3MEH A;  3NQI A;  3GTG B;  4A3I B;  2Z4H A;  4Q0F A;  3R93 A;  3BDL A;  1PXU A;  2JP1 A;  5FLX E;  2XN9 C;  4X3S A;  5I9O A;  1T5X D;  2B8F A;  2DNC A;  3QB3 A;  2B63 B;  1FNV A;  3QIA A;  1I50 B;  5C0X J;  3HOZ B;  2RSO A;  5FOB B;  4RGM A;  5I6Y A;  2XVS A;  5FO9 B;  1FNU A;  2AWN A;  3H94 A;  1WTW A;  3K0Y A;  3TP7 A;  3NBI A;  2JA6 B;  1WD0 A;  1HXY D;  4I7Z C;  1I4R A;  2JEB I;  4PMC A;  4O42 A;  1H9J A;  4S3S A;  4DAV A;  1PDQ A;  4ZAI A;  3SE0 A;  3X3M A;  1O78 A;  5CR3 A;  5EKK A;  1SFO B;  1X3P A;  4KK7 A;  1BCP C;  4G7Z C;  3Q6S A;  5FO7 B;  2F0L A;  1H9R A;  2EY2 A;  2RA4 A;  2WAQ B;  4H13 C;  3LWE A;  3Q24 A;  2BCO A;  1WTV A;  2F0T A;  4A3M B;  2Y0S B;  1SYG A;  1BOS A;  1SJE D;  1STA A;  2PW7 A;  1AFP A;  3S14 B;  1RF2 D;  1EFI D;  3FPP A;  2JEA I;  3M7G A;  1EY4 A;  4K6L A;  2HCI A;  5I6W A;  1Q1E A;  4HAE A;  4FXG C;  2NTT A;  5IGG A;  3MXG A;  1WTO A;  3KLS A;  1AW7 A;  1SXT A;  3NTK A;  2F0F A;  1DD2 A;  5C4Z A;  1SE4 A;  4C2M B;  2NN6 I;  1KNA A;  1U4M A;  1U9R A;  2QEJ C;  1STY A;  5I4D A;  2D5D A;  2X6G A;  1FR3 A;  4JK1 C;  1I4Q A;  1YNJ C;  3NWS A;  3FMC A;  4ULL A;  4A3K B;  5KEE A;  3T4A C;  5C3X A;  5G3L F;  1S5B D;  3BVZ A;  3VYS A;  1EY7 A;  1Y1W B;  2L5T A;  1LO5 D;  1PMR A;  4DA2 A;  5BN4 A;  2E74 C;  4KKT A;  1TWH B;  1KLG D;  3NXW A;  3E6Z X;  2BE5 C;  3DUZ A;  3A8J E;  1Z47 A;  2KA7 A;  2IW3 A;  1MGS A;  4KN4 C;  1QNK A;  3R3O A;  4FF2 A;  1LT5 D;  2XIW A;  4ZLT F;  5D65 A;  5ELC A;  1CQF A;  4FF1 A;  5JEA G;  1V1P A;  4KTA A;  2NUC A;  3GTL B;  1ONL A;  4C3J G;  5CV7 A;  2F0U A;  4IQZ A;  3GTJ B;  3KK7 A;  3VR5 A;  3C3L A;  4H44 C;  3X3N A;  2ICI A;  3I8Z A;  2CW0 D;  3K57 A;  2NN6 G;  5C3W A;  1WTQ A;  5A2Q E;  4RHS A;  1TS2 A;  2V4D A;  1BQQ T;  4TQU S;  4OL7 A;  1I4H A;  1TWC B;  3P7J A;  5K36 H;  2R3Z A;  1S5D D;  2ENB A;  4AYB B;  5COR A;  1DXM A;  2OXP A;  3JAM L;  3PO2 B;  1EY5 A;  2RKS A;  3K6O A;  3BYT B;  1FNW A;  3I3C A;  5IGE A;  1MI2 A;  1VMC A;  4KMU C;  3VYR A;  4R8I A;  5EPL A;  1IL8 A;  2VNU D;  1UNS A;  4TSS A;  4CGY B;  3LWU A;  3U9S A;  2Q8I B;  5T1G A;  2E2H B;  1I4X A;  1TQO A;  2I07 B;  1H9K A;  2IX3 A;  1UEA B;  2KHS A;  1B3A A;  3FRP B;  4FVM A;  4DNT B;  2B2U C;  4NW2 A;  3MWY W;  5IGC A;  1BCP F;  3HOV B;  1D5Z C;  5EKI A;  1V1P B;  1EYD A;  2Z4I A;  4DAY A;  4ZYS A;  2OT2 A;  2H1E A;  1A3U A;  1PFN A;  4IFD J;  2K5D A;  5M3F B;  2K32 A;  1G8Z D;  3BVM A;  1L0X B;  4EVO A;  3FEW X;  1C8C A;  2R7Z B;  2CW0 C;  3NQT A;  5M5Y B;  4F8M A;  2A6E D;  3T13 A;  2NVT B;  3DWQ A;  3A54 A;  1IKM A;  4P2C B;  2FMC A;  4K14 A;  4K5V A;  4KD3 A;  4RCN A;  1U4P A;  1JQY D;  1SNM A;  3T51 B;  1LAB A;  1O7Y A;  1LTT D;  1ZKO A;  2QIL A;  1Y69 U;  1HQM C;  4TRD A;  4KV6 A;  3C1E A;  1PTO F;  2MGS A;  1PLF A;  2ZXR A;  3I4L A;  3C2P A;  5EKL A;  5JEA J;  3LNN A;  5KRU A;  5CC4 A;  4C3J B;  3KF8 A;  4FO2 A;  5CV5 A;  5HGT A;  1OXS C;  1DJR D;  2CHB D;  4DN4 M;  2F03 A;  4HCS A;  2H4O A;  5AFW A;  3R2I A;  2M00 A;  5D3I B;  5EBD A;  1L0Y B;  3E0J A;  1R9T B;  4FYD A;  1S5F D;  3HEJ A;  1PYW D;  3H91 A;  1GUO A;  2F3V A;  3SHL A;  1SMY D;  2L4N A;  2JA7 B;  3SK8 A;  2IT1 A;  3NK9 A;  5C3E B;  3IFD A;  2NZ1 D;  1SYC A;  3I73 A;  1NAP A;  1OXX K;  1FYC A;  3NE5 B;  4Y7N B;  1CQV A;  4G57 A;  2AUK A;  5M5W B;  2AQ1 B;  1JOQ A;  4IN3 A;  2A6E C;  3VR4 A;  1Y8O B;  3RLF A;  3NHH A;  5HUR A;  5M9O A;  1SAP A;  1BO0 A;  2PNR C;  4HSV A;  1GUS A;  2B39 A;  4K5X A;  1S4Z A;  3E5S A;  4EQO A;  1O80 A;  1JIC A;  1FGB D;  3MC0 B;  4V0B A;  3M7N A;  3PO3 B;  4KN7 C;  2Z1C A;  1ET6 A;  2B2W C;  4NKL A;  2K05 A;  4KKS A;  3J81 L;  1G29 1;  4A3E B;  2N88 A;  5EJW A;  3GV3 A;  2M2L A;  3W3A A;  2I46 A;  5IIF A;  3S1R B;  3SR1 A;  2IX0 A;  2R92 B;  4ME5 A;  4ODG A;  5J1Z A;  2F0G A;  1EL0 A;  2ICE C;  2IL8 A;  4WFN 3;  2DNE A;  1BCP D;  3PIO 3;  3HOU B;  2VXW A;  5JPN C;  1JOR A;  1SYE A;  1PTO H;  3HKZ B;  1XTC D;  2KQ3 A;  4DAP A;  1Q90 A;  4QB4 A;  2KEE A;  1AZP A;  5D14 A;  4XYQ A;  4A3F B;  2A69 C;  5IGB A;  1BUV T;  3TDQ A;  5CYU A;  1M4V A;  1IHZ A;  2DY7 A;  4BA1 I;  5BN3 A;  5E4W C;  1V1O A;  3ERQ A;  1DOM A;  1SMY C;  2K5Q A;  1I6V C;  1TY0 A;  4IAL A;  3J80 L;  4U68 A;  2L12 A;  3VA5 A;  4RGT A;  4PNY A;  4BA2 I;  4LMQ D;  5C44 B;  5FO8 B;  1GJX A;  1WD1 A;  5KNC A;  1QWY A;  2XWJ B;  4IZ8 A;  1KAA A;  1MSG A;  4BY7 B;  2PW5 A;  3KLS X;  1BXT A;  4J8Q A;  5K36 G;  1E2W A;  2ZXP A;  2PQE A;  4K6D A;  3QOL A;  1HPC A;  2EDG A;  1YNJ D;  4BBS B;  1PTO D;  1LTG D;  3A8I E;  2JE6 I;  1JWM D;  3BDO A;  4PMW A;  1F9R A;  5IGD A;  3S16 B;  4C56 C;  2NVQ B;  1EEF D;  4ABN A;  1NUC A;  5I9P A;  1PRT C;  2BE5 D;  1DZ1 A;  1EYA A;  4E6I A;  2C5C A;  3GO5 A;  1TVX A;  1SEB D;  3TZU A;  1STB A;  3MAQ A;  1CM9 A;  2NBF A;  2XRQ D;  1QNU A;  1EYC A;  1LT3 D;  2EVB A;  1JE4 A;  2K7V A;  1QJO A;  3C1F A;  3TBI B;  1ILP A;  1DOL A;  1F77 A;  4K2K A;  5M5X B;  3T56 B;  1ZYR D;  2G9H D;  3SDZ A;  1GUW A;  4ZKB B;  3K5N A;  3RMH A;  3G6J B;  5E1F A;  4OO1 H;  2MP1 A;  4OGQ C;  1TU2 B;  1ENC A;  2F0D A;  3MA2 B;  1RTN A;  1J9O A;  1V43 A;  4XQN A;  2ZT9 C;  4C3H G;  5CBA E;  1I3Q B;  3OOC A;  3R8B A;  1EWC A;  1X32 A;  2D62 A;  1TKW B;  3M4Y A;  4HSP A;  2B2T A;  4XTC S;  3W2D A;  2K04 A;  2OEO A;  2LY7 A;  4QUC A;  3DMU A;  3HP3 A;  4HED A;  5ELB A;  3K5M A;  1H9S A;  2A73 B;  3QWN A;  2E75 C;  4BS9 A;  1SYB A;  3S15 B;  5C4H A;  5KYL A;  2EY6 A;  2KCC A;  1NR2 A;  3HRZ C;  3DWA A;  1PTO C;  2F0N A;  1R4P B;  5C4J B;  3EQL C;  1G91 A;  4YIJ A;  1Q3L A;  1NR4 A;  4WJW A;  5IT9 L;  3ITP A;  1AZQ A;  1F9P A;  3S9W A;  1LV9 A;  1KDA A;  3QO2 A;  4RCO A;  2B2Y A;  4FF3 A;  1EY6 A;  2B8G A;  2EYJ A;  1LTR D;  3SK6 A;  2L1B A;  3DXJ C;  4KHZ A;  4ZUI A;  1QG7 A;  3A7A B;  2BA1 A;  4IUQ A;  2RDG A;  2OF1 A;  3EA6 A;  2YU9 B;  4IUN A;  3GP7 A;  3AMU A;  3TME A;  1ZYR C;  1QOH A;  1IYV A;  4KJN A;  2J4X A;  1NSN S;  1WTR A;  2LS0 1;  2A5H A;  1PZI D;  3K5O A;  4L6T B;  2IPK D;  2LMC B;  1G2T A;  1O7Z A;  3HOY B;  2E2I B;  3D6W A;  2F0V A;  3M4O B;  1B2T A;  2MPM A;  4BBR B;  3KBG A;  3QOJ A;  1SE3 A;  1CI3 M;  1WCM B;  1AN8 A;  5CMD A;  3PUV A;  2IJ0 A;  3WOF A;  1QIL A;  2GA4 B;  2VB3 X;  1JC7 A;  1H9S B;  3PUZ A;  4DK0 A;  2EYH A;  1B1Z A;  1OXV A;  3MZ5 A;  2D9U A;  4J6H A;  1XXG A;  1EU3 A;  3WOE A;  4RGO S;  1WVL A;  1D5X C;  4A3J B;  1OXT A;  3GQB A;  4HR7 B;  3S17 B;  2HDM A;  3BYY B;  1Q8I A;  1GHJ A;  3Q23 A;  3BDC A;  3MHB A;  1PRT F;  1JOO A;  1VF7 A;  1DON A;  1XX8 A;  3CU7 A;  1LAC A;  4V19 0;  4HN7 A;  1KDB A;  3URY A;  3CRK C;  4C3H B;  1Y1V B;  1ILQ A;  4K8J A;  4RFB A;  4RKL A;  3K7A B;  5A2Q L;  2EJM A;  4RKB A;  4JBW A;  4CJ1 B;  2E2J B;  3QJY A;  3I91 A;  2PO4 A;  2MJ8 A;  1CK1 A;  3D3R A;  3VR2 A;  1SBB B;  4PQX A;  4IUP A;  4LAA A;  4ZQ3 A;  2RDF A;  5EBC A;  1SYD A;  1QE6 A;  2F0W A;  4DXG A;  3SXH A;  5CV9 A;  1EOT A;  1M8A A;  3QG1 A;  3A7L A;  5LL6 S;  2NVY B;  2Q8R E;  3TP6 A;  2EYO A;  5E3F A;  2EZV A;  1SND A;  5COY A;  3D4D A;  3OIQ A;  2HUG A;  4QF4 A;  5IGF A;  4IFD H;  1DOK A;  5EPK A;  2NB0 A;  3V05 A;  4BWG B;  1GOZ A;  4EQN A;  2WKC A;  1DYQ A;  1SNQ A;  1GXD C;  1II3 A;  4OO1 I;  4RAU C;  1SNP A;  1K83 B;  3BS1 A;  3VR3 A;  3TP8 A;  5JOB A;  1LTI D;  1VCI A;  3DEO A;  3AU7 A;  3S1Q B;  1GUT A;  3LX0 A;  2L9H A;  1F2M A;  2VUM B;  4M8A A;  5ELF A;  3HOX B;  1XYI A;  3V2T A;  4OHJ A;  2FIN B;  3RUZ A;  1ML0 D;  4R9W A;  3PIP 3;  2NTS A;  5LL6 X;  1TY2 A;  4PV1 C;  2SOB A;  2K1B A;  2WAC A;  5K5P A;  1GUN A;  5JAV A;  2A69 D;  4CKC A;  2O5I C;  1I4P A;  3MXN A;  3J81 E;  4KY7 A;  1RDP D;  4CJ0 B;  1BCP B;  5JEA H;  1Q12 A;  5KNB A;  1FD7 D;  1E2Z A;  3A8K E;  3M3Y B;  2QDB A;  1KTK A;  4WOR A;  3FPU B;  1JB3 A;  4G7O C;  3SK5 A;  2F1M A;  1STN A;  5M3M B;  3K5L A;  1J8I A;  4XQQ A;  3HOW B;  4L8J A;  4OO1 G;  4IUU A;  2BDO A;  1KLU D;  3OW7 A;  5DEH A;  2WII B;  3A56 A;  4U67 3;  3GTO B;  4Z9C B;  2KVM A;  2A74 C;  2AUJ D;  2HQE A;  4J1M A;  1CHQ D;  3RD4 A;  4XDX A;  1Q1B A;  1MBY A;  1SYF A;  3PUW A;  3V96 A;  5IOC A;  3O13 A;  1EQT A;  1K8O A;  5JPM C;  4B9W A;  2X6L A;  4XXE A;  4C1N K;  1D1K A;  4G4K A;  3J80 E;  1PRT D;  3I70 A;  4HTH A;  2F3W A;  4BY1 B;  2ZXO A;  3D4R A;  1PTO B;  2SNS A;  3K58 A;  1HRJ A;  5KYI A;  5DM6 3;  1TWF B;  1HQR D;  3SK4 A;  4DXF A;  3ND8 A;  4KJO A;  1AEX A;  1LTB D;  2K33 A;  3I4M B;  4ID6 A;  5DAU A;  1G6Z A;  2EOT A;  1EWH A;  2ID0 A;  1TS3 A;  3BG3 A;  4ZK9 B;  2CVR A;  1LT4 D;  3RZO B;  2SNM A;  2QKI C;  1SNC A;  3OMC A;  4ZKC B;  2B2U A;  3TZD A;  2WP8 J;  4KY6 A;  3VA7 A;  4UAI A;  2EYP A;  1KDC A;  5C5L A;  2EPB A;  2LFN A;  4DF7 A;  3P20 A;  1CZW A;  1HTP A;  1F2L A;  1KAB A;  2O2L D;  4RH6 A;  1U4R A;  3OHX C;  3WDN A;  2KEC A;  5EQ0 A;  3IAY A;  4XQJ A;  4ZUJ A;  1TT2 A;  3J7A V;  3MVV A;  3SEB A;  3OPO A;  4CJ2 C;  3NP8 A;  5FK9 C;  2EY1 A;  5LHY 1;  4TKO B;  2JYO A;  2IX1 A;  1EZ8 A;  4EQP A;  5JJZ A;  2XNA C;  4NMZ A;  1EY9 A;  3H0G B;  1R4Q B;  3EFX D;  5KND A;  4N9T A;  3SVM A;  1NCV A;  4M1U B;  3H09 A;  1F9S A;  3R2T A;  2B2V C;  2K5W A;  1D6E C;  3NSW A;  3U9O A;  4KKU A;  1EY8 A;  4IFD I;  1PFB A;  5C0X H;  1CT1 D;  2DY8 A;  3DM1 A;  4QIW B;  4KY5 A;  2QCP X;  3I4N B;  1JR0 D;  1IW7 C;  4X3U A;  5IT9 E;  3D8G A;  4CHT B;  5NUC A;  4CKB A;  2EYM A;  2K28 A;  1F2Z A;  1S5E D;  3TP5 A;  1G2S A;  5FLX L;  3ND9 A;  2F4I A;  1IKL A;  4OIJ A;  4DU9 A;  1A15 A;  4QCL A;  2EYL A;  3HS0 C;  2XSC A;  3L3O C;  1JWS D;  3T16 A;  2RVL A;  1RD9 D;  2AQ2 B;  2F0J A;  1O7L A;  2NYZ D;  2F0H A;  3T53 B;  2F0Q A;  4DNR B;  1D2B A;  5JVH 3;  1RCV D;  2R93 B;  4ILW A;  1EQV A;  3NBH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...