2DNEA

Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
108
structure length
108
Chain Sequence
GSSGSSGQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
publication title Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 108
sequence length 108
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dneA00
1QJOA 3VR3A 5BN4A 5C0XH 2JE6I 2QF7A 3U9SA 3VA7A 1E2ZA 1IW7D 2BE5D 2PCFB 4I7ZC 5JEAG 1BDOA 4G7OC 2NN6H 1H9SB 2D5DA 2NN6I 1CFMA 4PV1C 3M85A 2L5TA 3ND8A 1SMYC 1Q90A 3ND9A 5BN5A 2F1MA 3W3AA 1GUGA 4KHZA 1FYCA 3PUWA 5K36G 1DD2A 3PUVA 3OPOA 2A68C 1IYUA 2CW0C 2KA7A 3A7LA 2K33A 3A8JE 3QIAA 3SDZA 4BA2I 4GZYC 3QJYA 1LABA 1I6VC 2O5IC 3VR5A 1GUOA 3SE0A 3PV0A 1EWHA 3FPPA 1Y69U 2EVBA 1GUNA 2BDOA 5KNDA 4XTCS 3CRKC 2O5JC 4LJZC 1GHKA 3QG1A 4BA1I 4G7HC 3MFYA 3T53B 5C0XG 1H9JA 1O7LA 3OOCA 1PMRA 2IT1A 2DN8A 5KNCA 3I72A 2NN6G 1OXSC 1ZKOA 2A69D 1IW7C 2BE5C 3LWUA 1DCZA 3DXJC 2JXMB 1FR3A 2B8FA 3M4YA 3VR6A 2A6HD 2Q8IB 1T5EA 3TZUA 4DNTB 3I4LA 1Y8PB 4IFDH 1K8MA 1Q12A 2PNRC 1Y8OB 4KKSA 4KKTA 4KI0A 1E2WA 1K8OA 2R6GA 1Z7TA 3T56B 1OXTA 3IKJA 2AUJD 1G291 2E74C 4OO1H 3FMCA 2E75C 5JEAH 3GD7A 1CI3M 1V43A 4H44C 1A6XA 1HTPA 1TU2B 1H9SA 4DNRB 1ZYRC 2BA0A 4TKOB 2D2CC 2JEBI 3HGBA 3NE5B 2K32A 2B8GA 5A35A 3CRLC 1V8QA 1VF5C 2EJGC 5BN3A 3M7NA 4XIGS 4IQZA 1GUTA 2E76C 3PUZA 1H9RA 1CTMA 1H9KA 3EQLC 3A8KE 3PUXA 4HR7B 4TQUS 1TKWB 1H9MA 1Z6HA 2BA1A 2A6ED 2EDGA 3IFTA 1GJXA 2A69C 2ZT9C 2EJMA 1OXVA 3A7AB 1VDZA 3LNNA 3T51B 1IYVA 4KMUC 1OXUA 1O78A 2AUKA 3D4RA 3L7ZC 1B9MA 2A6HC 3RLFA 1GHJA 4IFDG 1B9NA 3D31A 4KN4C 4L8JA 1LACA 3N6RA 1OXXK 3OW7A 1YNJC 2JEAI 3P20A 1E2VA 4DK1A 4KN7C 5KNBA 4OO1G 2KCCA 2AWOA 4JK1C 3KLRA 1ONLA 4OGQC 2DNCA 2PPBC 2EJFC 3MXUA 4G7ZC 3PUYA 1DXMA 3A8IE 4H0LC 2LMCB 3AB9A 3GQBA 1VCIA 1GUSA 4KKUA 3VR2A 1VF7A 2A68D 1Q1BA 5K36H 3BDOA 1YNNC 1HCZA 3BG3A 2YYZA 2V4DA 2K7VA 3H94A 4LK1C 1HPCA 4H13C 2A6EC 4JBWA 4RCNA 4DK0A 3I73A 3VR4A 1Q1EA 1HQMC 2D62A 3WDNA 1Y8NB 2DNEA
chains in the Genus database with same CATH superfamily
1QJOA 4RCOA 3HOVB 2UUAL 4FXDA 3H15A 5C4JB 4IJHA 4HJ9A 4QUFA 4QMGA 4K8IA 1ENAA 5I9PA 4OX9Q 1FNWA 2BOSA 4HMJA 1R4PB 2F0VA 1Y1WH 4NB3A 3OIPA 1VS0A 1B2TA 1RDPD 1S3OA 4QB4A 1HUMA 2VY3A 3EIVA 3S17B 1S5ED 1V1QA 4DAYB 4HSPA 2K28A 3E3XA 4OO1I 3V05A 3OWEB 1EFWA 1KABA 4PZ6A 4F8MA 2J0TD 4TRDA 3S24A 5D3IB 3KBXA 4DR3L 4YWKA 1JB3A 5IP9G 5IGCA 2NN6G 1OTCA 4X66Q 2BE5C 3WWVA 5LMNL 2UUCQ 1ET9A 3FPUB 1D5ZC 4LF9Q 1HXYD 5DEHA 4Y7NH 3I4LA 5C3XA 2WKDA 1HA6A 4BY7B 1P16A 5IOCA 3DWQA 1SYGA 3I91A 5JEAH 1WCMG 3NQIA 1RF2D 2UXDL 1H9SA 4DNRB 5I4DA 4YWMA 2D0OA 1A15A 1HA5A 1Y1VB 1HR0W 2WB1E 2EOTA 1GJXA 3I70A 2I07B 4A3KB 2PW7A 1PTOB 2EXDA 1D7QA 2M2LA 4R8NA 3PMFA 3F2DA 2K5WA 2HHHQ 3SXHA 1K83H 1SXTA 4L8JA 1EZ8A 4PG3A 3RLOA 3HOWB 1PH4A 3H3VC 1STGA 2WB1B 2AWOA 1LTID 4OGQC 4FF2A 1D5MC 1L1OB 4ZLTF 1G6ZA 1X3FA 4OL7A 1PRTF 2M00A 3RUZA 3K7UC 3CCEA 1E3PA 4LFAL 4YCVA 5IYBG 2HIXA 5JJZA 4BBSB 4N9TA 3ICEA 2K7VA 3OW2A 5FJ8G 2DUDA 1G91A 3J81L 3JAMc 2AQ3B 2KCNA 1VQNA 1QNUA 3IRBA 1J8IA 4LF5Q 2D62A 5CV9A 2AMCB 2I5LX 3QB3A 3VA7A 1WVLA 5ISRA 2SEBD 2Z4IA 4JV5Q 2ZXRA 2NN6I 1IYJB 4QF4A 4JI1Q 2IX0A 1Y1WB 2D9UA 2B2TC 4OXPA 2LS01 1A2TA 4LW1A 3HFZB 2EXZA 2EE1A 1VQ9A 1YHBA 4KY5A 3W1GA 4GNXC 2A19A 3PUVA 4ALPA 2CW0C 1AP0A 1XNRL 2JA8H 3CCMA 3QJYA 1HRJA 1P8LA 1JCKB 2DY8A 2RVLA 3BVZA 4LUZA 3HOXH 4X65L 2H1EA 1EQVA 2BDOA 3R8BA 2R7ZH 2JA5H 3MFYA 3A55A 4R4IA 3HOYH 2B2TA 2L9HA 3J81j 3CP0A 2NBFA 4GNXA 2K6AA 4Y7NB 4DV5L 4X62L 3DXJC 4JCVE 2G9HD 3M4YA 1J6QA 2A6HD 4K2KA 1O7YA 1CT1D 4GLAC 4DNTB 3QOLA 1SFOH 1K8MA 4OWXB 1K9MC 1K8OA 2NZ1D 2MO0A 2R3ZA 4RWSC 5IWAQ 1KDCA 3CCUA 2JP1A 1HTPA 1U4RA 1HNWQ 1XMQL 3I8ZA 4O1NA 1YJNA 1V8QA 1TQOA 4JOIC 3GTOH 2MUYA 4DV2Q 4IUVA 2ALYB 1NR2A 4BXXH 1K83B 5GAGC 1O78A 3E0JA 4DXGA 1B9MA 1CZWA 4HJ8A 3F1ZA 3FDTA 2VNUD 1DZ1A 1HHVA 2N55A 3PQIA 4KJNA 2RKSA 2XRSD 3D31A 2B63G 1K28A 3KLWA 2B2WC 4JI2Q 1VQ7A 1JB7A 1TWAH 1PYWD 2KCCA 1TT2A 3KLRA 1HTLD 4JOIA 3H3VH 4G7ZC 3CD6A 1EEFD 3RZOH 1VCIA 2UUBL 4A3IG 1O7ZA 3NPPA 2V4DA 1Q82C 4LF6L 1UE7A 3I4OA 2Z8LA 1C0AA 2B2WA 5ELOA 4PZ8A 1KD1C 1S5FD 2X6GA 4CDCC 5LMUL 3S1QH 1HR0Q 1ASYA 3N52A 5IT9E 5HGQA 3M85A 2F0MA 4K6LA 4IO9A 1N32L 4CGYB 2Z4HA 3HOZG 5BN5A 1AE3A 1Q8KA 4LWCA 2CCZA 2JA8B 2RHQB 2R7FA 4ZYSA 4A3GG 5JVH3 1JOKA 3HOXB 2KA7A 2Q2HA 3VDYA 1K0RA 4UP9A 2R7ZB 2JA5B 2JJQA 2UXBQ 3HOYB 3S2HH 4DR5Q 2HDMA 1JJCB 4FXKC 3EJIA 1GOZA 4NMZA 5G3LD 4B3RQ 4DXFA 5KNCA 1HFNA 4GOPC 1CKNA 3A74A 1SFOB 1DOMA 1MJCA 1RKNA 1ZEQX 2ZTCA 4JI0Q 4FVMA 4F87A 1WTQA 2HQEA 1VQPA 1ESRA 3TZUA 1NAPA 5KIXA 1XJVA 1XTDA 1Y8OB 2F0WA 4KKTA 1Z7TA 2G5DA 1OXTA 5M5WH 3IKJA 1RTNA 2ZJRA 1V43A 4K5VA 4F7XA 1PZID 1N34Q 1A6XA 1Q7YC 4BS9A 1MKHA 4GOPA 3GTOB 5A35A 1V1PB 1QILA 3STBC 2K4KA 2VS1A 2E76C 3ER0A 1D1KA 4GKKL 2F0UA 1PFSA 1SMXA 1H9MA 4LFBQ 1JOQA 1XPOA 3T51B 4DPGA 4H7BA 4A3JB 1TY2A 2QCPX 1TWAB 1ICWA 4DR4Q 2QDBA 3K6OA 5IT9c 3T1HQ 1YEZA 1AZQA 1Q8IA 3TN2A 5IY0A 3RZOB 3V96A 4B9WA 1HZCA 1CZGA 1BXTA 3H0GH 4DV3L 3MXUA 5NUCA 2AHOB 1RJTA 2KECA 4C3HH 2GN5A 2RHSB 1BNZA 1D8LA 1VQCA 3CKIB 4DV6Q 1EQTA 1UEAB 1C8CA 3H94A 2WAQG 4A3EH 1A3VA 4X3KA 3S1QB 4EVOA 5JPMC 3ZJYC 4EQ5A 4FF4A 1L0YB 3GO5A 4ID6A 1SSOA 4OONA 1E2ZA 1IW7D 1SE4A 4G7OC 5KRUA 3IFDA 2EZVA 1JMCA 4LFCQ 3J80i 1NE3A 1AEXA 4LF8Q 3S16H 1Y14B 1YHAA 2B3GA 2B39A 2HUGA 2ZJPA 3S2HB 1QWYA 1VQ6A 2UXCL 1IKLA 2A74C 3VR5A 3KLSA 1QE6A 1EWHA 4A75A 1IZ6A 2L1BA 5JAVA 4BA1I 4JG2A 5C4ZA 4DV4L 3DUZA 3EBEA 5FLXc 1IBKQ 5I9OA 3MTSA 2XWBB 5C4HA 1STEA 2DJFC 3D6CA 3GTGB 4KHPQ 2CQOA 3GV6A 1PLFA 3GTMH 2JN4A 4DAMA 1Y8PB 4IFDH 2KVMA 5M5WB 3DLLA 2VQFL 4A93H 3GTLH 3H91A 2HD3A 4CJ2C 2E74C 5AJ3L 4BY1H 3J7A5 1BCPD 3SK8A 2D2CC 1WTHA 4OIKA 1TS4A 1E1TA 1RL2A 2AQ1B 5CV6A 1S5DD 2WIIB 2IW3A 2Y0SE 4OX9L 2OTJA 4Q5VA 1U9RA 2K52A 2VUMH 1TKWB 3IFTA 1VQEA 1IYVA 4KMUC 1OXUA 3L3OC 1QVGA 1B9NA 1HNXL 4B3TL 4KN4C 3DMUA 2F4IA 3RN5A 2Y0SB 1HZBA 3H0GB 1E1OA 1YHQA 5KNBA 1SR3A 2R92G 3NTIA 4C3HB 3W2DA 4FXGC 1RTOA 3GTQH 3AB9A 4X66L 3E9IA 1I50H 1VF7A 4B3ML 3KUPA 2XRQD 4A3EB 2F0DA 4LF9L 4P71A 4JVZA 4LK1C 1HPCA 2Q2IA 4A3BH 1DGSA 3UDGA 4R4TA 2JA6H 2SNSA 2F3IA 3NWTA 4JI5Q 2QF7A 3IL8A 2SNMA 4K0KL 4YWLA 5HY6A 4I7ZC 4PV1C 3S16B 1D6EC 3ND9A 5H1SE 4JI8L 5A2QE 1VQBA 4AQYQ 3CAMA 3FEWX 2V1CC 2ZXPA 2KBNA 5K36G 2NVYH 4QJFA 5ELFA 3CXCA 2VW9A 2HHHL 2ZTEA 5EGTA 1DOKA 3SE0A 4X3TA 4CDEC 1LV9A 5EBCA 4H02A 2QA4A 3G6EA 5IYCG 1L0XB 1L1OA 3PO3G 1XWEA 4NPSA 1HNZL 1TVXA 5FLMH 4GOPB 2N3SA 2PQEA 3CPWA 3GTMB 5EBDA 3S2DH 1DCZA 4UPAA 1LO5D 2HQLA 4I7AA 3MEHA 4A93B 3GTLB 1B4OA 1MI2A 1JWMD 3TQYA 3ULLA 1SE8A 2PO4A 2PNRC 4KI0A 4BY1B 4FF1A 1IXRA 4IPGA 1I4XA 2GVBA 5CR3A 1GUWA 4QL5A 3HOUG 1K0SA 1HQRD 2JEBI 2IX1A 3KDFA 5BN3A 2VUMB 2VL6A 1F2ZA 1KAWA 1DYQA 4R4CA 4C3IG 1CTMA 1NJIC 2CKZB 3PUXA 4RKLA 3AU7A 3RLFA 1VQFA 1EY9A 1Z47A 2MO1A 4RG1A 2F0GA 2Q2UA 1YNJC 5C3EH 4ZUJA 4OO1G 3GTQB 3U58A 1SMYD 2HCIA 1XMOQ 1I50B 1G2TA 3CW2C 4TSSA 3UE1A 3MVVA 4YY3Q 4KD4A 4B3SQ 2K50A 2F0SA 3VYUA 4NKLA 4A3BB 2IHEA 3ULJA 2JA6B 3FKIH 4PMCA 1PRTC 2A6EC 4RCNA 3S15H 2RCNA 3M3YH 1HQMC 4LUOA 5IWAL 2EY5A 2K03A 1WFQA 3BYYB 3I4NH 1NY4A 1NMGA 5M3FG 1SLJA 1IBLQ 3DEOA 5JJLA 4A3FG 1ET6A 2NVYB 4M1UB 1STAA 4C1NI 2VB2X 4OELB 1Q86C 1A8VA 3A8JE 3A7LA 3BZKA 4J6HA 4AIMA 4AYBB 2TSSA 3T16A 2F0EA 2ZM6Q 2RQXA 3WOFA 4JI2L 1ZYRD 1NSNS 3QG1A 3MEFA 5CV7A 2QGQA 4JBKA 4CHTB 1HH2P 2R93H 1PMRA 4LF4L 1SNCA 1G8ZD 5IYBH 2RSNA 3K58A 4A3DH 1CM9A 4X3SA 1DONA 4CDFC 2F4VQ 3HOVG 4C3JH 1M4VA 1PTOD 5ELEA 3VR6A 1YIJA 1PYBA 4ODGA 1X3GA 1ICFB 1YJWA 5C44H 2R7DA 2E2JH 1I94Q 1N33Q 3LWEA 1J5EL 4A3MB 1XX8A 3T56B 5JJIA 4DF7A 4PMBA 3JAME 2ATWA 4TKOB 1AH9A 2B8GA 1V1OA 1UAPA 5FK9C 1H9RA 3LX0A 1C9OA 4HR7B 4R1JA 2X69A 2EYOA 4QQBX 4RFBA 3SK5A 3I3CA 3T4AC 3AYHB 1T5XD 4Z9CB 4UP7A 5C3EB 4L5TA 5J39A 3FHWA 5IT9L 1TS5A 2UXBL 1PHJA 4DR5L 1WTPA 3DM3A 3Q23A 4BY7G 2K05A 3S1RH 4O2DA 4OHJA 1PYSB 5J22A 3F2BA 3TBIB 5GAEC 5JPNC 2A68D 3FKIB 3PGZA 5C4XH 3AMUA 2NZHA 4RMFA 4KY6A 1HCZA 3BG3A 2YYZA 2EYLA 1G6PA 1EIYB 1EYDA 3L0OA 3S15B 3M3YB 3G4SA 1Y1VG 1LLRD 3I4NB 2LFNA 2NWGA 3WDNA 1I5FA 4A3KG 3C3LA 2N49A 2K5HA 1I4GA 1V1PA 3A5ZB 2QDLA 3R2TA 1GXDC 2KHSA 4P72A 2PCFB 2ES2A 1BDOA 5CORA 4B08A 3HOWG 3ND8A 5M3MH 4OWWB 4BBRH 1Q90A 4HEDA 1PH1A 2WB1G 4IUUA 4A3CG 2CWAA 1SEBD 2FMMA 2CQAA 4LFBL 1TIID 4N9PA 3CHBD 3CPFA 1G51A 2VB3X 2B63H 1STHA 1LABA 4RHRA 5GAHC 2IPKD 3BVGA 4KV6A 2K1BA 3HG9A 1Y69U 4BBSG 1EIFA 3D8GA 5KNDA 3OSOA 1ASZA 2R93B 4JI7L 2NB0A 4IPHA 4YHHL 3J7ZC 3O13A 2KEDA 4A3DB 1II3A 4C3JB 5IE8A 4K6DA 1ZKOA 2A69D 3KDFB 1L2FA 3OWFA 3OYYA 5C44B 1CQVA 4DUYL 2E2JB 4C1NK 3OMGA 4DV6L 2MJ8A 4V190 1Y1WG 4JBMA 1W6KA 4FDBA 4JI3Q 3NP8A 5COYA 5GQOA 4DV0Q 3E6ZX 4LAAA 3ERSX 3FMCA 4HJ7A 4LMQD 1FNUA 5TSSA 3HOZH 4NP5A 1QCBD 4IUPA 3H09A 4HN7A 3EQLC 2E5LQ 3A8KE 2EY6A 3Q24A 4XQQA 2YTVA 1PH2A 1TWHH 3D4RA 3IAYA 3VA5A 1DJRD 1LACA 2HT1A 1KL9A 1XPUA 3S1RB 3PF5A 4WORA 1WTXA 4CJ0B 3HKZE 5C4XB 2EJFC 4HIDA 1IBKL 2Z1CA 1ZXTA 3HS0C 3K5MA 2EIFA 4KHPL 2K5DA 5GROA 4MTNA 1PRTB 5IGBA 1SNOA 1YJ9A 3HKZB 5BR8Q 5CV5A 4C56C 3FP9A 1B7YB 2VQEQ 3MHBA 2CVRA 4XXEA 3VR3A 1SN8A 3VYTA 5M3MB 1PVOA 1EYCA 3NBIA 4BBRB 3SVMA 2BE5D 2WACA 2JA7H 3MA2B 1NCVA 1SNDA 3NWSA 1EY6A 4JI4Q 4FO2A 4GS3A 2B63B 1ENFA 4JC0A 2ENBA 4X6AH 1LTLA 4DV1Q 2DGYA 2RBMA 3W5OA 1BBUA 3M4PA 3K8AA 5D3DA 3M4QA 3PCOB 1PA6A 5JVG3 1XNQQ 3NK9A 1NBWA 4NXNQ 2C35B 3J81i 4KJOA 1OXSC 3MXPA 3TP6A 3LWUA 4J1MA 1R4QB 4EGVA 1FJGL 2B8FA 3QO2A 5DM73 4U68A 4IJLA 1VQ5A 3UDIA 5HURA 1GKHA 2NZOA 1Q46A 3C2PA 4K14A 1SYEA 4IURA 1EFID 3M4OH 2JA8G 4R8IA 3UI2A 1I4QA 2AUJD 5G3LF 1SNQA 2KCTA 1F2MA 2OQ0A 3HKSA 3TP5A 4DR7Q 3AEVA 1LTRD 2EQSA 4DR3Q 2KEEA 2R7ZG 3A54A 2JA5G 1EU3A 3RLNA 4U673 2ICEC 2XWJB 1EU4A 4NW2A 4AH6A 3HOYG 4A3LH 4IQZA 1PZJD 1KHIA 2OWOA 2O2LD 3NTHA 3PUZA 1TWFH 4XT1B 1TWHB 2I0QA 1Z6HA 3GTPH 3TREA 2JSOA 2LSSA 2F0HA 5M5XH 4X64Q 1FGUA 5C3WA 4RKBA 3KK7A 3TP8A 4RGMA 2JEAI 5IP7G 4GN3B 5A2QL 5LL6S 3U9OA 4XQNA 2DNCA 3I56A 4MZ9A 1EOTA 4MN3A 3NSWA 2RA4A 2CW0D 1SYDA 1YNNC 2HCCA 3RN2A 4RHSA 3ERQA 3K0XA 3PSIA 5FLXE 4BXXG 1VQKA 1EY0A 5AFWA 2X6LA 1STYA 3PF4A 2JA7B 3G48A 5C0XH 1SE3A 4A3JG 1HUNA 2WINB 1EYGA 1A3UA 1YZ6A 2SDFA 3OTOL 2Z9HA 4L5RC 1IBMQ 1R9TH 2XN9C 4LFAQ 1GUGA 1EY8A 3QOJA 4J8QA 4HCSA 2B2YC 1MJEA 3PIPA 5E4XA 3CRKC 4R9WA 4DR1L 4G7HC 4RA8A 3EFXD 4P2CB 1XMOL 1K73C 2IJ0A 5HGTA 3I72A 3NTKA 1CHQD 4YY3L 4B3SL 3KFUA 1LTAD 4DA2A 2FINB 1B1ZA 3M4OB 3KF6A 2DY7A 4GKJL 4RH6A 1EQQA 4UAIA 1B70B 5E3FA 4R4QA 1QZGA 4X65Q 2E2IH 2YTYA 3KYHC 5IYDH 1SYBA 2F0KA 3F2CA 1TXYA 2KHIA 1VQMA 3GD7A 5CV4A 3K5LA 1S5CD 2NVXH 1TWFB 2BA0A 1IBLL 2EJGC 3BS1A 3GTPB 4XIGS 4EX5A 4DV7L 1H9KA 5M5XB 1Z9FA 3C46A 5CV8A 3K80C 2EYHA 3A7AB 2PMZE 3DHQA 1SJED 4KTAA 3J81c 2RSOA 2N8NA 3ZYYX 3UDXA 2C9OA 1KXLA 3CF5A 5EAYA 2ZM6L 4Y52H 1BCPF 4QY7A 1JE5A 4ZK9B 2F0NA 3OIQA 4DK1A 5IGGA 4NXMQ 2F0IA 1XMQQ 2PYKA 4PZ7A 2IWHA 2PPBC 1XYIA 5D65A 3H3VI 4IN3A 2PMZB 4POFA 2LMCB 1EY7A 4WRDA 2KHJA 3BDOA 4L5SA 1I3QH 3K57A 2JQOA 5EPKA 1I94L 4JYAQ 3HP3A 4A76A 2FMCA 2A1AA 2EYMA 4XYOA 5BN4A 3J80E 3U4ZA 1R9TB 2L4NA 2H4OA 2I5MX 3K0YA 5CYUA 1IL8A 2D5DA 1LT3D 1CFMA 4C3IH 2BH2A 1EL0A 2Y0SG 1Q81C 3H0GG 2I5HA 4ZAIA 2UUCL 4C3HG 2WP8J 2ASBA 4LF6Q 1F2YA 3JAML 4P75A 1I6VC 4DGZA 4A3EG 1GUOA 3DEPA 3PV0A 2IL8A 2PZWA 5LMUQ 3PO2H 3STBD 2RDHA 2KCMA 1N32Q 3R93A 1SDFA 5T1IA 1X55A 4N8X1 2NTSA 1UWVA 4MIUA 1YVCA 2PZTA 2E2IB 1UE6A 1Q12A 3I7FA 1E2WA 1VQIA 3C1EA 5ELCA 1CUKA 4EQOA 4O0AA 3K81C 5EKKA 5EKLA 1A3TA 2NVXB 1G291 3RZDH 4DUZQ 1HJPA 1TU2B 4J15A 2UU9Q 2KQ3A 4P73A 3X3NA 3CRLC 3R2IA 4GLXA 1CSPA 1GUTA 5FO8B 1ML0D 4WJ3M 2F0FA 1PH7A 4DR2Q 4HIKA 4CKCA 1F9PA 5IGDA 4HMIA 3J80c 1GHJA 4IFDG 2OTLA 2EYJA 3I4MH 4A93G 4CDDC 1B3AA 4LF5L 1OXXK 5C0XI 4UHVA 1EWCA 1LT5D 2ZTDA 1W2BA 3TS0A 2OF1A 4MTKA 4JV5L 5LL6X 4OWTB 1E7ZA 4JI1L 4H0LC 4KKUA 3ITPA 4JW0A 2A8VA 4GKKQ 1I3QB 2CWPA 3GV3A 1LTSD 5EJWA 2VUMG 3S1MH 3CC7A 5CBEE 1U0LA 4IFDJ 1VQ8A 3CU7A 4KD3A 3I73A 2QKIC 1WTOA 5DAUA 2DNEA 2QILA 3K7AH 4KK7A 4LF7Q 2JE6I 5IP9H 1KIXA 4DV3Q 3A5UA 2NN6H 3BDCA 4G57A 1HZAA 1O7IA 3BVMA 1NNXA 4FYDA 1VQOA 1QZHA 2GVAA 4KHZA 5C6AA 4RAUC 4KY7A 3T13A 2E5LL 2A5HA 3T1YQ 3EROA 1CA6A 5IODA 2PI2E 3PO2B 3KF6B 3URYA 4A3BG 3FPPA 1WCMH 4GN5A 1XPRA 2JA6G 5JOBA 4ILWA 3Q6SA 1HNWL 3TZDA 4AYBE 1STNA 1K8AC 1AZPA 3E5SA 3NEMA 2L55A 3J7AF 4HCEA 4K5XA 4DV2L 1FL0A 2Q8IB 5EKIA 1Q3LA 2JA9A 5K5PA 2MP1A 4IFDI 5BR8L 1PFBA 1X56A 3RZDB 1UE1A 2JYOA 3MAQA 1N36Q 2R61A 3C1FA 2VQEL 2E75C 1GD7A 1X9NA 3GTKH 1S5BD 2Q8RE 5T1GA 2LY7A 3S2DB 1PTOF 1AN8A 5FLMG 5ELBA 4JI4L 3CMAA 1TR5A 1W3SA 1EZ6A 5FJ8H 4N8FA 2HIVA 3G6JB 1CKMA 3I4MB 2A6HC 3TP7A 1X3PA 5AJ3Q 4V0BA 1QVFA 3OW7A 4JBJA 1E2VA 3OHXC 2Z6BA 2PZUA 4WJWA 1ONLA 2CH4W 2Z0SA 1XNQL 4A3MG 1HR0L 1VQLA 1HZ9A 1E22A 1SNMA 4NXNL 4UY8C 1DXMA 3GQBA 4DK3C 3A0JA 5ELNA 3S1MB 1AFPA 1GVPA 1ILQA 1CKOA 3EN2A 1WD0A 1JJ2A 1KAAA 2VZAA 3K7AB 4JBWA 1HNXQ 3GTJH 4B3TQ 1MGSA 3MC0B 3P1HA 3VR4A 1EY5A 3M7GA 1SBBB 1QVCA 5DLQE 1BOSA 4DR7L 1QUQA 2MPMA 4K8JA 4FNFA 3S1NH 5C3EG 2CHBD 4B3RL 1QG7A 3KF8A 3R3OA 2L5TA 1SAPA 2L11A 1PV4A 2BCOA 1M90C 4B3MQ 4I65A 1EYAA 1MIUA 3KJPA 4JI0L 2VXWA 1JICA 1DD2A 3QIAA 2K33A 4IPDA 1WCMB 5J1ZA 4X64L 2EY2A 3FKIG 3MXNA 2HDLA 4HJAA 3ULPA 1GUNA 2EYPA 5F2DA 4K0KQ 2L0CA 1N34L 5DNFA 3I4NG 3TSSA 2IT1A 4JI8Q 1FVIA 3D0FA 2JXMB 3AFQA 2L15A 1TS2A 4IPCA 3NELA 4IUQA 4YCUA 1YBYA 2PQAB 3SR1A 1B3QA 1QB5D 1YI2A 5LMNW 2F0LA 4YCWA 1VQJA 1YNJD 3GTKB 2F03A 2NVQH 4DR4L 1BUVT 3CCVA 4QCLA 3T1HL 1AW7A 3NENA 1U4PA 1UNSA 2ICIA 3KBGA 1PH5A 4ZKCB 1HNZQ 2ZXOA 1KRTA 2FXQA 1IBML 4A3IH 5FLXL 2E2DC 3CCQA 2K01A 4ZUIA 2R93G 1TY0A 2MGSA 2RCFA 1PRTD 3QWNA 4A3DG 2BA1A 2A6ED 2EDGA 2E8GA 4F88A 2ZT9C 4C3JG 4DFAA 1VDZA 2RDFA 2TMPA 3EA6A 1JQYD 4HIOA 4QIWE 5C44G 3GP7A 2E2HH 5KYLA 1QOHA 3FVQA 4RGNA 4KHVA 4ABNA 1BQQT 2LKVA 5I2XA 1KTKA 1NTGA 3P20A 1AE2A 1S4ZA 3PIO3 4R4OA 1LT6D 1T9HA 4QIWB 4LFCL 1OO9B 3V2TA 1Q1BA 4A3GH 1V9PA 4LF8L 3GTJB 2AQ2B 2XSCA 4Q0FA 2MQHA 4LNQA 4IZ8A 3RMHA 1PXUA 2YV5A 1EIHA 4JI6Q 4ME5A 4E6IA 1RHPA 3S1NB 2K5QA 1PH8A 1JR0D 1UEBA 3X3MA 3CCRA 1X3EA 2L12A 5JEAG 4DK6C 2ID0A 2B29A 1PZKD 3ONAB 4XQJA 3QR8A 1CQFA 1SE2A 1SROA 2H5XA 3VYSA 5C4XG 4DR6Q 3SDZA 3KOJA 5CC4A 4GZYC 1ESFA 3D4WA 3W1BA 5IP7H 1F9SA 2EYFA 2K5VA 2O5JC 1RD9D 3HKZG 4NXML 1PFMA 3D6WA 3J7YW 2ZJQA 5JEAJ 1H9JA 5D14A 4DU9A 3MXGA 4ME3A 5KEEA 4PNYA 1JC7A 1IW7C 2I46A 5M3MG 1C4QA 4BBRG 2NVTH 1EUJA 2XTIA 2NVQB 2PNHA 1D1IA 4JYAL 2XGTA 1F9RA 1YNXA 2FFKB 2A73B 4A3JH 1VQAA 3NBHB 2K75A 2G9DA 2QW7A 4HAEA 4A3IB 3RR5A 2UUAQ 4TVAB 3D4DA 3HGBA 1JOOA 2K32A 4LF4Q 2F3WA 4DNIA 3F2UA 1VQGA 3LGJA 1NMFA 2E2HB 1OXVA 3LNNA 3J80L 1ILPA 1PDQA 2LXKA 1J5EQ 5EQ0A 1K8GA 3BZDB 1FGBD 1LTTD 4ZKBB 4JI5L 3HOZB 1KLUD 3HOXG 3U50C 2SOBA 5EPJA 2N88A 1QUQB 2OQKA 1F77A 1BCPC 1PFNA 5KGUA 3BYTB 4A3GB 3L2PA 3A8IE 1X54A 3KF8B 5LMNQ 5KYIA 2KUMA 1K3BC 4AQYL 1B44D 4MHEA 5FKAC 2PW5A 4H13C 3TEHB 2OT2A 3SK4A 1BF4A 3RNUA 1BBWA 5C5MA 1Y8NB 3MXNB 1M1KC 4DUZL 2UU9L 2MFIA 2UXDQ 2NTTA 2IX3A 1HFGA 4XT3B 1LUZA 3MZ5A 4IOCA 1H9SB 1MSGA 2MNAA 1NR4A 1B8AA 3W3AA 1X6OA 1TS3A 4DR2L 3S9WA 1JT8A 1RODA 2KJXA 3OPOA 2Q2TA 1IYUA 3JC66 4ZCKA 3GTGH 4BA2I 1EIGA 5IGEA 3I55A 1X65A 3P75A 3TMEA 5FO7B 2Z6KC 2BH8A 3A56A 5LHY1 1S72A 1BVSA 3I90A 1KNAA 3MFGA 4HJ5A 5E7NA 3J81E 1RIPA 1U5KA 1WYDA 4ZRZA 1O7LA 3OOCA 3AFPA 1PH6A 2NVTB 1STBA 2JA7G 1BBXC 1D2BA 4L5QA 2KENA 3CMEA 3AQQA 1MSHA 5I6YA 1A62A 3HEJA 1QNKA 1CK1A 5CMDA 1I4HA 1T5EA 2RDGA 3J7AV 4EQNA 1EQRA 2WAQE 2Z6KA 4KKSA 2B2VC 2AWNA 2F0JA 1SJHD 1F9QA 1KDBA 1JWUD 3WOEA 4GLVB 2R92H 5DM63 4JI7Q 4YHHQ 4LF7L 4H44C 4IOAA 4OEMB 3CQZH 3BDLA 4L6TB 4S3SA 4LUVA 3HZXA 3NE5B 3G71A 2CFMA 2NUCA 2WAQB 4DUYQ 2M9VA 4MNOA 2YU9H 3B6YA 1FNVA 4TQUS 3T1YL 3Q8DA 2B2VA 2B2YA 3KJOA 3CCLA 1XNRQ 1XXGA 4WJ4A 4DKAC 4HSVA 4APVA 3VYRA 5L37A 5FO9B 4CKBA 3K5OA 1TWCH 2F0TA 1MHWC 4KN7C 2MHVA 1G2SA 2PI2A 2OXPA 3L9AX 3H6MA 3BZCA 1PH9A 3UDFA 3VR2A 1KLGD 4A3LG 4DV5Q 2Q8TA 4X62Q 1KRSA 1WJJA 4GNXB 5K36H 1XTCD 4PMWA 1NUCA 1LYLA 5GADC 4BWGB 4PQXA 2B2UC 1ENCA 1KC8C 3I2ZA 2F0PA 2YTXA 1M8AA 1N36L 1Q1EA 1KDAA 3NXWA 5IYCH 4CJ1B 4IALA 3TS2A 3PO3H 1YITA 1N9WA 1JE4A 5IIFA 2EPBA 1EOVA 1SMYC 1FD7D 2J7ZA 1S40A 1FYCA 2F4VL 4UDUC 2B2UA 2AKWB 1H95A 2XIWA 1A2UA 1U4LA 3UE0A 1A63A 5CGKA 1N33L 2J4XA 1CHPD 2OEOA 2EVBA 3HOUH 3BU2A 3CC4A 1D5XC 1A0IA 4NDXA 1W6JA 2NYZD 2WKCA 5I6WA 1I4RA 5C0XG 3MWYW 1BKBA 3D3RA 2DN8A 3GDEA 3DWAA 2UUBQ 3K5NA 1LTBD 1C7YA 3SHLA 3NUCA 2O4XA 3TDQA 1LT4D 4DAYA 4HIMA 3G7LA 4XDXA 1B50A 1PH3A 2R92B 2K5NA 3NQTA 1L0WA 1I4PA 4HTHA 2R6GA 3CQZB 2IHFA 4OO1H 2WFWA 2N78A 1CI3M 4RGOS 4P74A 4B9XA 2LXJA 2K14A 5C0XJ 1X3QA 1ZYRC 1WTWA 2YU9B 5C5LA 1VF5C 3E0EA 1E0BA 1YNND 3HRZC 4FF3A 2WV6D 1FJGQ 4C2MH 2F0QA 2XNAC 1UUPA 1WTRA 5E1FA 2GA4B 2AUKA 1PTOC 1IHZA 1JWSD 1MBYA 2D0PA 1UE5A 1TWCB 2RF4A 2IY5B 3OMCA 3KLSX 4YIJA 5E4WC 5M3FH 1C48A 2F0OA 3FRPB 4IUNA 5IYDG 1J9OA 1B53A 4JK1C 3RD4A 3CC2A 2F3VA 1L1OC 1BCPB 4IUTA 4A3FH 3PUYA 3SEBA 1GUSA 4QGUA 1TWGH 3EVQA 1CKNB 2K04A 2PQAA 3PIP3 4CBVA 3Q0AA 3S14H 1SYCA 1LM0A 4DK0A 3PO3B 4DN4M 2P5ZX 1CSQA 1U4MA 4POGA 1SNPA 5M5YH 5IGFA 3U9SA 3P7JA 1I6HH 4BY1G 1VQHA 5EPLA 3HOVH 4K5WA 3SK6A 2F1MA 5C4JH 4GN4B 3PUWA 1WI5A 2A68C 3HOUB 1DOLA 3U4VA 5J3BA 2O5IC 1O80A 1IKMA 4JI3L 1SYFA 4DV0L 1VMPA 2QEXA 3S17H 4XTCS 4A3MH 4L63B 4LJZC 1GHKA 4C3IB 4A4IA 1BO0A 3T53B 5M9OA 3CCJA 1JORA 3OTOQ 3Q22A 4UP8A 1RCVD 1DM0B 1E24A 4KLKA 1FR3A 1GO3E 1KNEA 1WOCA 2QEJC 4K2LA 3SGIA 3NHHA 5JJKA 4QUCA 4JI6L 1K3RA 4DAVA 4DAPA 2JK8A 3BJUA 5I2YA 4G4KA 4JPBW 4DR1Q 4BY7H 2XVSA 4WFN3 3PO2G 3M9BA 4ULLA 4C2MB 1EY4A 3M7NA 2EY1A 2FHTA 2FJ2A 4CKEA 3JAMi 3TRZA 1IL2A 2BDNA 4XYQA 1Y1VH 2A69C 2EJMA 4EQPA 4DR6L 1SRUA 4GKJQ 3L7ZC 2CH4A 5M3FB 2UXCQ 1JJGA 1LTGD 4A3KH 1PTOH 1CA5A 3N6RA 3DWPA 1N8RC 2DJGC 1MD2D 4A3FB 1KQSA 1BR9A 4O42A 4AYBG 5FOBB 1TWGB 3HOWH 4DV4Q 3E9HA 1EWIA 4DV7Q 4A3CH 4OIJA 1VQ4A 1F2LA 3DM1A 5ELDA 1WTVA 3PIOA 1X32A 3S14B 3K59A 1VQDA 1GM5A 3F8TA 5CBAE 1VMCA 4DV1L 2F52A 4FP5D 2VQFQ 4BBSH 4RGTA 1EEID 4X3UA 4M8AA 1I6HB 5M5YB 2KOLA 3NBHA 3CCSA 1WD1A 4ZQ3A 2OCEA 2C5CA 3I4MG
chains in the Genus database with same CATH topology
1QJOA 4RCOA 3HOVB 4FXDA 5C4JB 4QUFA 4QMGA 4K8IA 1ENAA 5I9PA 1FNWA 2BOSA 4HMJA 1R4PB 2F0VA 3OIPA 1B2TA 1RDPD 4QB4A 1HUMA 3S17B 1S5ED 4HSPA 2K28A 4OO1I 3V05A 3OWEB 1KABA 4F8MA 2J0TD 4TRDA 5D3IB 3KBXA 1JB3A 5IGCA 2NN6G 2BE5C 1ET9A 3FPUB 1D5ZC 1HXYD 5DEHA 3I4LA 5C3XA 2WKDA 1HA6A 4BY7B 5IOCA 3DWQA 1SYGA 3I91A 5JEAH 3NQIA 1RF2D 1H9SA 4DNRB 5I4DA 1A15A 1HA5A 1Y1VB 2EOTA 1GJXA 3I70A 2I07B 4A3KB 2PW7A 1PTOB 2M2LA 4R8NA 3PMFA 2K5WA 3SXHA 1SXTA 4L8JA 1EZ8A 3HOWB 3H3VC 1STGA 2WB1B 2AWOA 1LTID 4OGQC 4FF2A 1D5MC 4ZLTF 1G6ZA 4OL7A 1PRTF 2M00A 3RUZA 5JJZA 4BBSB 4N9TA 2K7VA 1G91A 3J81L 2AQ3B 2KCNA 1QNUA 1J8IA 2D62A 5CV9A 3QB3A 3VA7A 1WVLA 5ISRA 2SEBD 2Z4IA 2ZXRA 2NN6I 4QF4A 2IX0A 1Y1WB 2D9UA 2B2TC 2LS01 1A2TA 2EXZA 2EE1A 4KY5A 3PUVA 2CW0C 1AP0A 3QJYA 1HRJA 1JCKB 2DY8A 2RVLA 3BVZA 2H1EA 1EQVA 2BDOA 3R8BA 3MFYA 3A55A 2B2TA 2L9HA 2NBFA 2K6AA 4Y7NB 3DXJC 2G9HD 3M4YA 2A6HD 4K2KA 1O7YA 1CT1D 4DNTB 3QOLA 1K8MA 1K8OA 2NZ1D 2R3ZA 4RWSC 1KDCA 2JP1A 1HTPA 1U4RA 3I8ZA 4O1NA 1V8QA 1TQOA 2MUYA 4IUVA 1NR2A 1K83B 1O78A 3E0JA 4DXGA 1B9MA 1CZWA 3FDTA 2VNUD 1DZ1A 1HHVA 2N55A 4KJNA 2RKSA 2XRSD 3D31A 2B2WC 1PYWD 2KCCA 1TT2A 3KLRA 1HTLD 4G7ZC 1EEFD 1VCIA 1O7ZA 3NPPA 2V4DA 2Z8LA 2B2WA 1S5FD 2X6GA 3N52A 5IT9E 3M85A 2F0MA 4K6LA 4CGYB 2Z4HA 5BN5A 2JA8B 4ZYSA 5JVH3 1JOKA 3HOXB 2KA7A 2R7ZB 2JA5B 3HOYB 2HDMA 4FXKC 3EJIA 1GOZA 4NMZA 5G3LD 4DXFA 5KNCA 1HFNA 1SFOB 1DOMA 1RKNA 1ZEQX 4FVMA 4F87A 1WTQA 2HQEA 1ESRA 3TZUA 1NAPA 5KIXA 1Y8OB 2F0WA 4KKTA 1Z7TA 1OXTA 3IKJA 1RTNA 1V43A 4K5VA 4F7XA 1PZID 1A6XA 4BS9A 3GTOB 5A35A 1V1PB 1QILA 2E76C 1D1KA 2F0UA 1H9MA 1JOQA 3T51B 4H7BA 4A3JB 1TY2A 2QCPX 1TWAB 1ICWA 2QDBA 3K6OA 1AZQA 1Q8IA 3TN2A 3RZOB 3V96A 4B9WA 1CZGA 1BXTA 3MXUA 5NUCA 1RJTA 2KECA 1BNZA 3CKIB 1EQTA 1UEAB 1C8CA 3H94A 1A3VA 4X3KA 3S1QB 4EVOA 5JPMC 4FF4A 1L0YB 3GO5A 4ID6A 1SSOA 1E2ZA 1IW7D 1SE4A 4G7OC 5KRUA 3IFDA 2EZVA 1AEXA 2B39A 2HUGA 3S2HB 1QWYA 1IKLA 2A74C 3VR5A 3KLSA 1QE6A 1EWHA 2L1BA 5JAVA 4BA1I 5C4ZA 3DUZA 5I9OA 3MTSA 2XWBB 5C4HA 1STEA 3D6CA 3GTGB 3GV6A 1PLFA 1Y8PB 4IFDH 2KVMA 5M5WB 3H91A 4CJ2C 2E74C 1BCPD 3SK8A 2D2CC 4OIKA 1TS4A 2AQ1B 5CV6A 1S5DD 2WIIB 2IW3A 4Q5VA 1U9RA 1TKWB 3IFTA 1IYVA 4KMUC 1OXUA 3L3OC 1B9NA 4KN4C 3DMUA 2F4IA 2Y0SB 3H0GB 5KNBA 3NTIA 4C3HB 3W2DA 4FXGC 1RTOA 3AB9A 1VF7A 3KUPA 2XRQD 4A3EB 2F0DA 4LK1C 1HPCA 2SNSA 3NWTA 2QF7A 3IL8A 2SNMA 4I7ZC 4PV1C 3S16B 1D6EC 3ND9A 5A2QE 3FEWX 2ZXPA 5K36G 5ELFA 5EGTA 1DOKA 3SE0A 4X3TA 1LV9A 5EBCA 1L0XB 1XWEA 1TVXA 2PQEA 3GTMB 5EBDA 1DCZA 1LO5D 3MEHA 4A93B 3GTLB 1B4OA 1MI2A 1JWMD 2PO4A 2PNRC 4KI0A 4BY1B 4FF1A 1I4XA 5CR3A 1GUWA 1HQRD 2JEBI 2IX1A 5BN3A 2VUMB 1F2ZA 1DYQA 4C3IG 1CTMA 3PUXA 4RKLA 3AU7A 3RLFA 1EY9A 1Z47A 2F0GA 1YNJC 4ZUJA 4OO1G 3GTQB 1SMYD 2HCIA 1I50B 1G2TA 4TSSA 3MVVA 4KD4A 3VYUA 2F0SA 4NKLA 4A3BB 2JA6B 4PMCA 1PRTC 2A6EC 4RCNA 1HQMC 2EY5A 2K03A 3BYYB 3DEOA 1ET6A 2NVYB 4M1UB 1STAA 4C1NI 2VB2X 3A8JE 3A7LA 4J6HA 4AYBB 2TSSA 3T16A 2F0EA 2RQXA 3WOFA 1ZYRD 1NSNS 3QG1A 5CV7A 4CHTB 1PMRA 1SNCA 1G8ZD 3K58A 2RSNA 1DONA 1CM9A 4X3SA 1M4VA 1PTOD 5ELEA 3VR6A 4ODGA 3LWEA 4A3MB 1XX8A 3T56B 4DF7A 4PMBA 3JAME 4TKOB 2B8GA 1V1OA 1UAPA 5FK9C 1H9RA 3LX0A 4HR7B 2X69A 2EYOA 4RFBA 3SK5A 3I3CA 3T4AC 1T5XD 4Z9CB 5C3EB 5J39A 5IT9L 1TS5A 1WTPA 3Q23A 2K05A 5J22A 4OHJA 3TBIB 5JPNC 2A68D 3FKIB 3AMUA 4KY6A 1HCZA 3BG3A 2YYZA 2EYLA 1EYDA 3S15B 3M3YB 1LLRD 3I4NB 2LFNA 2NWGA 3WDNA 3C3LA 1I4GA 1V1PA 3R2TA 1GXDC 2KHSA 2PCFB 1BDOA 5CORA 4B08A 3ND8A 1Q90A 4HEDA 4IUUA 1SEBD 2FMMA 2CQAA 1TIID 4N9PA 3CHBD 2VB3X 1STHA 1LABA 4RHRA 2IPKD 3BVGA 4KV6A 2K1BA 3HG9A 1Y69U 3D8GA 5KNDA 3OSOA 2R93B 2NB0A 3O13A 2KEDA 4A3DB 1II3A 4C3JB 4K6DA 1ZKOA 2A69D 3OWFA 5C44B 1CQVA 2E2JB 4C1NK 3OMGA 2MJ8A 4V190 1W6KA 3NP8A 5COYA 3E6ZX 4LAAA 3FMCA 4LMQD 1FNUA 5TSSA 4NP5A 1QCBD 4IUPA 3H09A 4HN7A 3EQLC 3A8KE 2EY6A 3Q24A 4XQQA 3D4RA 3IAYA 3VA5A 1DJRD 1LACA 3S1RB 4WORA 1WTXA 4CJ0B 5C4XB 2EJFC 2Z1CA 1ZXTA 3HS0C 3K5MA 2K5DA 1PRTB 5IGBA 1SNOA 3HKZB 5CV5A 4C56C 3MHBA 2CVRA 4XXEA 3VR3A 3VYTA 5M3MB 1EYCA 3NBIA 4BBRB 3SVMA 2BE5D 2WACA 3MA2B 1NCVA 1SNDA 3NWSA 1EY6A 4FO2A 2B63B 1ENFA 2ENBA 2RBMA 5D3DA 5JVG3 3NK9A 4KJOA 1OXSC 3MXPA 3TP6A 3LWUA 4J1MA 1R4QB 4EGVA 2B8FA 3QO2A 5DM73 4U68A 5HURA 3C2PA 4K14A 1SYEA 4IURA 1EFID 4R8IA 3UI2A 1I4QA 2AUJD 5G3LF 1SNQA 1F2MA 3TP5A 1LTRD 2KEEA 3A54A 1EU3A 4U673 2ICEC 2XWJB 1EU4A 4NW2A 4IQZA 1PZJD 2O2LD 3NTHA 3PUZA 4XT1B 1TWHB 1Z6HA 2JSOA 2F0HA 5C3WA 4RKBA 3KK7A 3TP8A 4RGMA 2JEAI 5A2QL 5LL6S 3U9OA 4XQNA 2DNCA 1EOTA 4MN3A 3NSWA 2RA4A 2CW0D 1SYDA 1YNNC 2HCCA 4RHSA 3ERQA 5FLXE 1EY0A 5AFWA 2X6LA 1STYA 2JA7B 5C0XH 1SE3A 1HUNA 2WINB 1A3UA 2SDFA 2XN9C 1GUGA 1EY8A 3QOJA 4J8QA 4HCSA 2B2YC 5E4XA 3CRKC 4R9WA 4G7HC 4RA8A 3EFXD 4P2CB 2IJ0A 5HGTA 3I72A 3NTKA 1CHQD 1LTAD 4DA2A 2FINB 1B1ZA 3M4OB 2DY7A 4RH6A 4UAIA 5E3FA 1SYBA 2F0KA 3GD7A 5CV4A 3K5LA 1S5CD 1TWFB 2BA0A 2EJGC 3BS1A 3GTPB 4XIGS 1H9KA 5M5XB 3C46A 5CV8A 2EYHA 3A7AB 3DHQA 1SJED 4KTAA 2RSOA 3ZYYX 2C9OA 1BCPF 4ZK9B 2F0NA 3OIQA 4DK1A 5IGGA 2F0IA 2PYKA 2IWHA 2PPBC 1XYIA 5D65A 4IN3A 2PMZB 2LMCB 1EY7A 4WRDA 3BDOA 3K57A 5EPKA 3HP3A 2FMCA 2EYMA 4XYOA 5BN4A 3J80E 1R9TB 2L4NA 2H4OA 3K0YA 5CYUA 1IL8A 2D5DA 1LT3D 1CFMA 1EL0A 4ZAIA 4C3HG 2WP8J 1F2YA 3JAML 1I6VC 4DGZA 1GUOA 3DEPA 3PV0A 2IL8A 2PZWA 2RDHA 3R93A 1SDFA 5T1IA 2NTSA 4MIUA 2PZTA 2E2IB 1Q12A 1E2WA 3C1EA 5ELCA 4EQOA 5EKKA 5EKLA 1A3TA 2NVXB 1G291 1TU2B 2KQ3A 3X3NA 3CRLC 3R2IA 1GUTA 5FO8B 1ML0D 2F0FA 4CKCA 1F9PA 5IGDA 4HMIA 1GHJA 4IFDG 2EYJA 1B3AA 1OXXK 5C0XI 1EWCA 1LT5D 2OF1A 5LL6X 4H0LC 4KKUA 3ITPA 1I3QB 3GV3A 1LTSD 5EJWA 5CBEE 4IFDJ 3CU7A 4KD3A 3I73A 2QKIC 1WTOA 5DAUA 2DNEA 2QILA 4KK7A 2JE6I 2NN6H 3BDCA 4G57A 3BVMA 4FYDA 4KHZA 5C6AA 4RAUC 4KY7A 3T13A 2A5HA 3EROA 1CA6A 5IODA 3PO2B 3URYA 3FPPA 5JOBA 4ILWA 3Q6SA 3TZDA 1STNA 1AZPA 3E5SA 2L55A 3J7AF 4HCEA 4K5XA 2Q8IB 5EKIA 1Q3LA 5K5PA 2MP1A 4IFDI 1PFBA 3RZDB 2JYOA 3MAQA 2R61A 3C1FA 2E75C 1S5BD 2Q8RE 5T1GA 2LY7A 3S2DB 1PTOF 1AN8A 5ELBA 1TR5A 1EZ6A 3G6JB 3I4MB 2A6HC 3TP7A 1X3PA 4V0BA 3OW7A 1E2VA 3OHXC 2PZUA 4WJWA 1ONLA 1SNMA 1DXMA 3GQBA 3S1MB 1AFPA 1ILQA 1WD0A 1KAAA 3K7AB 4JBWA 1MGSA 3MC0B 3P1HA 3VR4A 1EY5A 3M7GA 1SBBB 1BOSA 2MPMA 4K8JA 4FNFA 2CHBD 1QG7A 3KF8A 3R3OA 2L5TA 1SAPA 2L11A 2BCOA 4I65A 1EYAA 2VXWA 1JICA 1DD2A 3QIAA 2K33A 1WCMB 5J1ZA 2EY2A 3MXNA 2HDLA 1GUNA 2EYPA 5F2DA 2L0CA 5DNFA 3TSSA 2IT1A 2JXMB 1TS2A 4IUQA 3SR1A 1QB5D 2F0LA 1YNJD 3GTKB 2F03A 4QCLA 1BUVT 1AW7A 1U4PA 1UNSA 2ICIA 3KBGA 4ZKCB 2ZXOA 5FLXL 2E2DC 2K01A 4ZUIA 1TY0A 2MGSA 1PRTD 3QWNA 2BA1A 2A6ED 4F88A 2EDGA 2ZT9C 4C3JG 4DFAA 1VDZA 2RDFA 2TMPA 3EA6A 1JQYD 3GP7A 5KYLA 1QOHA 3FVQA 4RGNA 4ABNA 4KHVA 1BQQT 2LKVA 5I2XA 1KTKA 3P20A 1S4ZA 3PIO3 1LT6D 4QIWB 1OO9B 3V2TA 1Q1BA 3GTJB 2AQ2B 2XSCA 4Q0FA 4IZ8A 3RMHA 1PXUA 1EIHA 4ME5A 4E6IA 1RHPA 3S1NB 2K5QA 1JR0D 3X3MA 2L12A 5JEAG 2ID0A 3ONAB 1PZKD 4XQJA 1CQFA 1SE2A 3VYSA 3SDZA 5CC4A 4GZYC 1ESFA 3D4WA 1F9SA 2EYFA 2O5JC 1RD9D 1PFMA 3D6WA 3J7YW 5JEAJ 1H9JA 5D14A 4DU9A 3MXGA 5KEEA 4PNYA 1JC7A 1IW7C 2I46A 1C4QA 2NVQB 1D1IA 1F9RA 2FFKB 2A73B 2G9DA 4HAEA 4A3IB 3D4DA 3HGBA 1JOOA 2K32A 2F3WA 3F2UA 2E2HB 1OXVA 3LNNA 3J80L 1ILPA 1PDQA 5EQ0A 3BZDB 1FGBD 1LTTD 4ZKBB 3HOZB 1KLUD 2SOBA 5EPJA 2N88A 1F77A 1BCPC 1PFNA 5KGUA 3BYTB 4A3GB 3A8IE 5KYIA 2KUMA 1B44D 4MHEA 5FKAC 2PW5A 4H13C 2OT2A 3SK4A 1BF4A 5C5MA 1Y8NB 2NTTA 2IX3A 1HFGA 4XT3B 3MZ5A 1H9SB 1MSGA 1NR4A 3W3AA 1TS3A 3S9WA 1RODA 2KJXA 3OPOA 1IYUA 4BA2I 1EIGA 5IGEA 3P75A 3TMEA 5FO7B 3A56A 5LHY1 3I90A 1KNAA 3MFGA 3J81E 4ZRZA 1O7LA 3OOCA 2NVTB 1STBA 1BBXC 1D2BA 1MSHA 5I6YA 3HEJA 1QNKA 1CK1A 5CMDA 1I4HA 1T5EA 2RDGA 3J7AV 4EQNA 4KKSA 2B2VC 2AWNA 2F0JA 1SJHD 1F9QA 1KDBA 1JWUD 3WOEA 5DM63 4H44C 3BDLA 4L6TB 4S3SA 3HZXA 3NE5B 2NUCA 2WAQB 2M9VA 1FNVA 4TQUS 2B2VA 2B2YA 1XXGA 4HSVA 3VYRA 5FO9B 4CKBA 3K5OA 2F0TA 4KN7C 2MHVA 1G2SA 2OXPA 3L9AX 3H6MA 3VR2A 1KLGD 2Q8TA 5K36H 1XTCD 4PMWA 1NUCA 4BWGB 4PQXA 2B2UC 1ENCA 2F0PA 1M8AA 1Q1EA 1KDAA 3NXWA 4CJ1B 4IALA 1JE4A 5IIFA 2EPBA 1SMYC 1FD7D 2J7ZA 1FYCA 4UDUC 2B2UA 2XIWA 1A2UA 1U4LA 5CGKA 2J4XA 1CHPD 2OEOA 2EVBA 1D5XC 4NDXA 1W6JA 2NYZD 2WKCA 5I6WA 1I4RA 5C0XG 3MWYW 3D3RA 2DN8A 3DWAA 3K5NA 1LTBD 3SHLA 3NUCA 2O4XA 3TDQA 1LT4D 4DAYA 3G7LA 4XDXA 1B50A 2R92B 3NQTA 1I4PA 4HTHA 2R6GA 3CQZB 4OO1H 1CI3M 4RGOS 4B9XA 5C0XJ 1X3QA 1ZYRC 1WTWA 2YU9B 5C5LA 1VF5C 1E0BA 1YNND 3HRZC 4FF3A 2WV6D 2F0QA 2XNAC 1UUPA 1WTRA 5E1FA 2GA4B 2AUKA 1PTOC 1IHZA 1JWSD 1MBYA 1TWCB 3OMCA 3KLSX 4YIJA 5E4WC 1C48A 2F0OA 3FRPB 4IUNA 1J9OA 1B53A 4JK1C 3RD4A 2F3VA 1BCPB 4IUTA 3PUYA 3SEBA 1GUSA 3EVQA 2K04A 3PIP3 4CBVA 3Q0AA 1SYCA 4DK0A 3PO3B 4DN4M 1U4MA 1SNPA 5IGFA 3U9SA 3P7JA 5EPLA 4K5WA 3SK6A 2F1MA 3PUWA 2A68C 3HOUB 1DOLA 2O5IC 1O80A 1IKMA 1SYFA 1VMPA 4XTCS 4L63B 4LJZC 1GHKA 4C3IB 1BO0A 3T53B 5M9OA 1JORA 3Q22A 1RCVD 1DM0B 1FR3A 1KNEA 2QEJC 4K2LA 3NHHA 4QUCA 4DAVA 4DAPA 5I2YA 4G4KA 2XVSA 4WFN3 4ULLA 4C2MB 1EY4A 3M7NA 2EY1A 4CKEA 2FHTA 2FJ2A 2BDNA 4XYQA 2A69C 2EJMA 4EQPA 3L7ZC 5M3FB 1LTGD 1PTOH 1CA5A 3N6RA 3DWPA 1MD2D 4A3FB 1BR9A 4O42A 5FOBB 1TWGB 4OIJA 1F2LA 3DM1A 5ELDA 1WTVA 1X32A 3S14B 3K59A 5CBAE 1VMCA 4FP5D 4RGTA 1EEID 4X3UA 4M8AA 1I6HB 5M5YB 2KOLA 3NBHA 1WD1A 4ZQ3A 2C5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QJO A;  3VR3 A;  5BN4 A;  5C0X H;  2JE6 I;  2QF7 A;  3U9S A;  3VA7 A;  1E2Z A;  1IW7 D;  2BE5 D;  2PCF B;  4I7Z C;  5JEA G;  1BDO A;  4G7O C;  2NN6 H;  1H9S B;  2D5D A;  2NN6 I;  1CFM A;  4PV1 C;  3M85 A;  2L5T A;  3ND8 A;  1SMY C;  1Q90 A;  3ND9 A;  5BN5 A;  2F1M A;  3W3A A;  1GUG A;  4KHZ A;  1FYC A;  3PUW A;  5K36 G;  1DD2 A;  3PUV A;  3OPO A;  2A68 C;  1IYU A;  2CW0 C;  2KA7 A;  3A7L A;  2K33 A;  3A8J E;  3QIA A;  3SDZ A;  4BA2 I;  4GZY C;  3QJY A;  1LAB A;  1I6V C;  2O5I C;  3VR5 A;  1GUO A;  3SE0 A;  3PV0 A;  1EWH A;  3FPP A;  1Y69 U;  2EVB A;  1GUN A;  2BDO A;  5KND A;  4XTC S;  3CRK C;  2O5J C;  4LJZ C;  1GHK A;  3QG1 A;  4BA1 I;  4G7H C;  3MFY A;  3T53 B;  5C0X G;  1H9J A;  1O7L A;  3OOC A;  1PMR A;  2IT1 A;  2DN8 A;  5KNC A;  3I72 A;  2NN6 G;  1OXS C;  1ZKO A;  2A69 D;  1IW7 C;  2BE5 C;  3LWU A;  1DCZ A;  3DXJ C;  2JXM B;  1FR3 A;  2B8F A;  3M4Y A;  3VR6 A;  2A6H D;  2Q8I B;  1T5E A;  3TZU A;  4DNT B;  3I4L A;  1Y8P B;  4IFD H;  1K8M A;  1Q12 A;  2PNR C;  1Y8O B;  4KKS A;  4KKT A;  4KI0 A;  1E2W A;  1K8O A;  2R6G A;  1Z7T A;  3T56 B;  1OXT A;  3IKJ A;  2AUJ D;  1G29 1;  2E74 C;  4OO1 H;  3FMC A;  2E75 C;  5JEA H;  3GD7 A;  1CI3 M;  1V43 A;  4H44 C;  1A6X A;  1HTP A;  1TU2 B;  1H9S A;  4DNR B;  1ZYR C;  2BA0 A;  4TKO B;  2D2C C;  2JEB I;  3HGB A;  3NE5 B;  2K32 A;  2B8G A;  5A35 A;  3CRL C;  1V8Q A;  1VF5 C;  2EJG C;  5BN3 A;  3M7N A;  4XIG S;  4IQZ A;  1GUT A;  2E76 C;  3PUZ A;  1H9R A;  1CTM A;  1H9K A;  3EQL C;  3A8K E;  3PUX A;  4HR7 B;  4TQU S;  1TKW B;  1H9M A;  1Z6H A;  2BA1 A;  2A6E D;  2EDG A;  3IFT A;  1GJX A;  2A69 C;  2ZT9 C;  2EJM A;  1OXV A;  3A7A B;  1VDZ A;  3LNN A;  3T51 B;  1IYV A;  4KMU C;  1OXU A;  1O78 A;  2AUK A;  3D4R A;  3L7Z C;  1B9M A;  2A6H C;  3RLF A;  1GHJ A;  4IFD G;  1B9N A;  3D31 A;  4KN4 C;  4L8J A;  1LAC A;  3N6R A;  1OXX K;  3OW7 A;  1YNJ C;  2JEA I;  3P20 A;  1E2V A;  4DK1 A;  4KN7 C;  5KNB A;  4OO1 G;  2KCC A;  2AWO A;  4JK1 C;  3KLR A;  1ONL A;  4OGQ C;  2DNC A;  2PPB C;  2EJF C;  3MXU A;  4G7Z C;  3PUY A;  1DXM A;  3A8I E;  4H0L C;  2LMC B;  3AB9 A;  3GQB A;  1VCI A;  1GUS A;  4KKU A;  3VR2 A;  1VF7 A;  2A68 D;  1Q1B A;  5K36 H;  3BDO A;  1YNN C;  1HCZ A;  3BG3 A;  2YYZ A;  2V4D A;  2K7V A;  3H94 A;  4LK1 C;  1HPC A;  4H13 C;  2A6E C;  4JBW A;  4RCN A;  4DK0 A;  3I73 A;  3VR4 A;  1Q1E A;  1HQM C;  2D62 A;  3WDN A;  1Y8N B;  2DNE A; 
#chains in the Genus database with same CATH topology
 1QJO A;  4RCO A;  3HOV B;  2UUA L;  4FXD A;  3H15 A;  5C4J B;  4IJH A;  4HJ9 A;  4QUF A;  4QMG A;  4K8I A;  1ENA A;  5I9P A;  4OX9 Q;  1FNW A;  2BOS A;  4HMJ A;  1R4P B;  2F0V A;  1Y1W H;  4NB3 A;  3OIP A;  1VS0 A;  1B2T A;  1RDP D;  1S3O A;  4QB4 A;  1HUM A;  2VY3 A;  3EIV A;  3S17 B;  1S5E D;  1V1Q A;  4DAY B;  4HSP A;  2K28 A;  3E3X A;  4OO1 I;  3V05 A;  3OWE B;  1EFW A;  1KAB A;  4PZ6 A;  4F8M A;  2J0T D;  4TRD A;  3S24 A;  5D3I B;  3KBX A;  4DR3 L;  4YWK A;  1JB3 A;  5IP9 G;  5IGC A;  2NN6 G;  1OTC A;  4X66 Q;  2BE5 C;  3WWV A;  5LMN L;  2UUC Q;  1ET9 A;  3FPU B;  1D5Z C;  4LF9 Q;  1HXY D;  5DEH A;  4Y7N H;  3I4L A;  5C3X A;  2WKD A;  1HA6 A;  4BY7 B;  1P16 A;  5IOC A;  3DWQ A;  1SYG A;  3I91 A;  5JEA H;  1WCM G;  3NQI A;  1RF2 D;  2UXD L;  1H9S A;  4DNR B;  5I4D A;  4YWM A;  2D0O A;  1A15 A;  1HA5 A;  1Y1V B;  1HR0 W;  2WB1 E;  2EOT A;  1GJX A;  3I70 A;  2I07 B;  4A3K B;  2PW7 A;  1PTO B;  2EXD A;  1D7Q A;  2M2L A;  4R8N A;  3PMF A;  3F2D A;  2K5W A;  2HHH Q;  3SXH A;  1K83 H;  1SXT A;  4L8J A;  1EZ8 A;  4PG3 A;  3RLO A;  3HOW B;  1PH4 A;  3H3V C;  1STG A;  2WB1 B;  2AWO A;  1LTI D;  4OGQ C;  4FF2 A;  1D5M C;  1L1O B;  4ZLT F;  1G6Z A;  1X3F A;  4OL7 A;  1PRT F;  2M00 A;  3RUZ A;  3K7U C;  3CCE A;  1E3P A;  4LFA L;  4YCV A;  5IYB G;  2HIX A;  5JJZ A;  4BBS B;  4N9T A;  3ICE A;  2K7V A;  3OW2 A;  5FJ8 G;  2DUD A;  1G91 A;  3J81 L;  3JAM c;  2AQ3 B;  2KCN A;  1VQN A;  1QNU A;  3IRB A;  1J8I A;  4LF5 Q;  2D62 A;  5CV9 A;  2AMC B;  2I5L X;  3QB3 A;  3VA7 A;  1WVL A;  5ISR A;  2SEB D;  2Z4I A;  4JV5 Q;  2ZXR A;  2NN6 I;  1IYJ B;  4QF4 A;  4JI1 Q;  2IX0 A;  1Y1W B;  2D9U A;  2B2T C;  4OXP A;  2LS0 1;  1A2T A;  4LW1 A;  3HFZ B;  2EXZ A;  2EE1 A;  1VQ9 A;  1YHB A;  4KY5 A;  3W1G A;  4GNX C;  2A19 A;  3PUV A;  4ALP A;  2CW0 C;  1AP0 A;  1XNR L;  2JA8 H;  3CCM A;  3QJY A;  1HRJ A;  1P8L A;  1JCK B;  2DY8 A;  2RVL A;  3BVZ A;  4LUZ A;  3HOX H;  4X65 L;  2H1E A;  1EQV A;  2BDO A;  3R8B A;  2R7Z H;  2JA5 H;  3MFY A;  3A55 A;  4R4I A;  3HOY H;  2B2T A;  2L9H A;  3J81 j;  3CP0 A;  2NBF A;  4GNX A;  2K6A A;  4Y7N B;  4DV5 L;  4X62 L;  3DXJ C;  4JCV E;  2G9H D;  3M4Y A;  1J6Q A;  2A6H D;  4K2K A;  1O7Y A;  1CT1 D;  4GLA C;  4DNT B;  3QOL A;  1SFO H;  1K8M A;  4OWX B;  1K9M C;  1K8O A;  2NZ1 D;  2MO0 A;  2R3Z A;  4RWS C;  5IWA Q;  1KDC A;  3CCU A;  2JP1 A;  1HTP A;  1U4R A;  1HNW Q;  1XMQ L;  3I8Z A;  4O1N A;  1YJN A;  1V8Q A;  1TQO A;  4JOI C;  3GTO H;  2MUY A;  4DV2 Q;  4IUV A;  2ALY B;  1NR2 A;  4BXX H;  1K83 B;  5GAG C;  1O78 A;  3E0J A;  4DXG A;  1B9M A;  1CZW A;  4HJ8 A;  3F1Z A;  3FDT A;  2VNU D;  1DZ1 A;  1HHV A;  2N55 A;  3PQI A;  4KJN A;  2RKS A;  2XRS D;  3D31 A;  2B63 G;  1K28 A;  3KLW A;  2B2W C;  4JI2 Q;  1VQ7 A;  1JB7 A;  1TWA H;  1PYW D;  2KCC A;  1TT2 A;  3KLR A;  1HTL D;  4JOI A;  3H3V H;  4G7Z C;  3CD6 A;  1EEF D;  3RZO H;  1VCI A;  2UUB L;  4A3I G;  1O7Z A;  3NPP A;  2V4D A;  1Q82 C;  4LF6 L;  1UE7 A;  3I4O A;  2Z8L A;  1C0A A;  2B2W A;  5ELO A;  4PZ8 A;  1KD1 C;  1S5F D;  2X6G A;  4CDC C;  5LMU L;  3S1Q H;  1HR0 Q;  1ASY A;  3N52 A;  5IT9 E;  5HGQ A;  3M85 A;  2F0M A;  4K6L A;  4IO9 A;  1N32 L;  4CGY B;  2Z4H A;  3HOZ G;  5BN5 A;  1AE3 A;  1Q8K A;  4LWC A;  2CCZ A;  2JA8 B;  2RHQ B;  2R7F A;  4ZYS A;  4A3G G;  5JVH 3;  1JOK A;  3HOX B;  2KA7 A;  2Q2H A;  3VDY A;  1K0R A;  4UP9 A;  2R7Z B;  2JA5 B;  2JJQ A;  2UXB Q;  3HOY B;  3S2H H;  4DR5 Q;  2HDM A;  1JJC B;  4FXK C;  3EJI A;  1GOZ A;  4NMZ A;  5G3L D;  4B3R Q;  4DXF A;  5KNC A;  1HFN A;  4GOP C;  1CKN A;  3A74 A;  1SFO B;  1DOM A;  1MJC A;  1RKN A;  1ZEQ X;  2ZTC A;  4JI0 Q;  4FVM A;  4F87 A;  1WTQ A;  2HQE A;  1VQP A;  1ESR A;  3TZU A;  1NAP A;  5KIX A;  1XJV A;  1XTD A;  1Y8O B;  2F0W A;  4KKT A;  1Z7T A;  2G5D A;  1OXT A;  5M5W H;  3IKJ A;  1RTN A;  2ZJR A;  1V43 A;  4K5V A;  4F7X A;  1PZI D;  1N34 Q;  1A6X A;  1Q7Y C;  4BS9 A;  1MKH A;  4GOP A;  3GTO B;  5A35 A;  1V1P B;  1QIL A;  3STB C;  2K4K A;  2VS1 A;  2E76 C;  3ER0 A;  1D1K A;  4GKK L;  2F0U A;  1PFS A;  1SMX A;  1H9M A;  4LFB Q;  1JOQ A;  1XPO A;  3T51 B;  4DPG A;  4H7B A;  4A3J B;  1TY2 A;  2QCP X;  1TWA B;  1ICW A;  4DR4 Q;  2QDB A;  3K6O A;  5IT9 c;  3T1H Q;  1YEZ A;  1AZQ A;  1Q8I A;  3TN2 A;  5IY0 A;  3RZO B;  3V96 A;  4B9W A;  1HZC A;  1CZG A;  1BXT A;  3H0G H;  4DV3 L;  3MXU A;  5NUC A;  2AHO B;  1RJT A;  2KEC A;  4C3H H;  2GN5 A;  2RHS B;  1BNZ A;  1D8L A;  1VQC A;  3CKI B;  4DV6 Q;  1EQT A;  1UEA B;  1C8C A;  3H94 A;  2WAQ G;  4A3E H;  1A3V A;  4X3K A;  3S1Q B;  4EVO A;  5JPM C;  3ZJY C;  4EQ5 A;  4FF4 A;  1L0Y B;  3GO5 A;  4ID6 A;  1SSO A;  4OON A;  1E2Z A;  1IW7 D;  1SE4 A;  4G7O C;  5KRU A;  3IFD A;  2EZV A;  1JMC A;  4LFC Q;  3J80 i;  1NE3 A;  1AEX A;  4LF8 Q;  3S16 H;  1Y14 B;  1YHA A;  2B3G A;  2B39 A;  2HUG A;  2ZJP A;  3S2H B;  1QWY A;  1VQ6 A;  2UXC L;  1IKL A;  2A74 C;  3VR5 A;  3KLS A;  1QE6 A;  1EWH A;  4A75 A;  1IZ6 A;  2L1B A;  5JAV A;  4BA1 I;  4JG2 A;  5C4Z A;  4DV4 L;  3DUZ A;  3EBE A;  5FLX c;  1IBK Q;  5I9O A;  3MTS A;  2XWB B;  5C4H A;  1STE A;  2DJF C;  3D6C A;  3GTG B;  4KHP Q;  2CQO A;  3GV6 A;  1PLF A;  3GTM H;  2JN4 A;  4DAM A;  1Y8P B;  4IFD H;  2KVM A;  5M5W B;  3DLL A;  2VQF L;  4A93 H;  3GTL H;  3H91 A;  2HD3 A;  4CJ2 C;  2E74 C;  5AJ3 L;  4BY1 H;  3J7A 5;  1BCP D;  3SK8 A;  2D2C C;  1WTH A;  4OIK A;  1TS4 A;  1E1T A;  1RL2 A;  2AQ1 B;  5CV6 A;  1S5D D;  2WII B;  2IW3 A;  2Y0S E;  4OX9 L;  2OTJ A;  4Q5V A;  1U9R A;  2K52 A;  2VUM H;  1TKW B;  3IFT A;  1VQE A;  1IYV A;  4KMU C;  1OXU A;  3L3O C;  1QVG A;  1B9N A;  1HNX L;  4B3T L;  4KN4 C;  3DMU A;  2F4I A;  3RN5 A;  2Y0S B;  1HZB A;  3H0G B;  1E1O A;  1YHQ A;  5KNB A;  1SR3 A;  2R92 G;  3NTI A;  4C3H B;  3W2D A;  4FXG C;  1RTO A;  3GTQ H;  3AB9 A;  4X66 L;  3E9I A;  1I50 H;  1VF7 A;  4B3M L;  3KUP A;  2XRQ D;  4A3E B;  2F0D A;  4LF9 L;  4P71 A;  4JVZ A;  4LK1 C;  1HPC A;  2Q2I A;  4A3B H;  1DGS A;  3UDG A;  4R4T A;  2JA6 H;  2SNS A;  2F3I A;  3NWT A;  4JI5 Q;  2QF7 A;  3IL8 A;  2SNM A;  4K0K L;  4YWL A;  5HY6 A;  4I7Z C;  4PV1 C;  3S16 B;  1D6E C;  3ND9 A;  5H1S E;  4JI8 L;  5A2Q E;  1VQB A;  4AQY Q;  3CAM A;  3FEW X;  2V1C C;  2ZXP A;  2KBN A;  5K36 G;  2NVY H;  4QJF A;  5ELF A;  3CXC A;  2VW9 A;  2HHH L;  2ZTE A;  5EGT A;  1DOK A;  3SE0 A;  4X3T A;  4CDE C;  1LV9 A;  5EBC A;  4H02 A;  2QA4 A;  3G6E A;  5IYC G;  1L0X B;  1L1O A;  3PO3 G;  1XWE A;  4NPS A;  1HNZ L;  1TVX A;  5FLM H;  4GOP B;  2N3S A;  2PQE A;  3CPW A;  3GTM B;  5EBD A;  3S2D H;  1DCZ A;  4UPA A;  1LO5 D;  2HQL A;  4I7A A;  3MEH A;  4A93 B;  3GTL B;  1B4O A;  1MI2 A;  1JWM D;  3TQY A;  3ULL A;  1SE8 A;  2PO4 A;  2PNR C;  4KI0 A;  4BY1 B;  4FF1 A;  1IXR A;  4IPG A;  1I4X A;  2GVB A;  5CR3 A;  1GUW A;  4QL5 A;  3HOU G;  1K0S A;  1HQR D;  2JEB I;  2IX1 A;  3KDF A;  5BN3 A;  2VUM B;  2VL6 A;  1F2Z A;  1KAW A;  1DYQ A;  4R4C A;  4C3I G;  1CTM A;  1NJI C;  2CKZ B;  3PUX A;  4RKL A;  3AU7 A;  3RLF A;  1VQF A;  1EY9 A;  1Z47 A;  2MO1 A;  4RG1 A;  2F0G A;  2Q2U A;  1YNJ C;  5C3E H;  4ZUJ A;  4OO1 G;  3GTQ B;  3U58 A;  1SMY D;  2HCI A;  1XMO Q;  1I50 B;  1G2T A;  3CW2 C;  4TSS A;  3UE1 A;  3MVV A;  4YY3 Q;  4KD4 A;  4B3S Q;  2K50 A;  2F0S A;  3VYU A;  4NKL A;  4A3B B;  2IHE A;  3ULJ A;  2JA6 B;  3FKI H;  4PMC A;  1PRT C;  2A6E C;  4RCN A;  3S15 H;  2RCN A;  3M3Y H;  1HQM C;  4LUO A;  5IWA L;  2EY5 A;  2K03 A;  1WFQ A;  3BYY B;  3I4N H;  1NY4 A;  1NMG A;  5M3F G;  1SLJ A;  1IBL Q;  3DEO A;  5JJL A;  4A3F G;  1ET6 A;  2NVY B;  4M1U B;  1STA A;  4C1N I;  2VB2 X;  4OEL B;  1Q86 C;  1A8V A;  3A8J E;  3A7L A;  3BZK A;  4J6H A;  4AIM A;  4AYB B;  2TSS A;  3T16 A;  2F0E A;  2ZM6 Q;  2RQX A;  3WOF A;  4JI2 L;  1ZYR D;  1NSN S;  3QG1 A;  3MEF A;  5CV7 A;  2QGQ A;  4JBK A;  4CHT B;  1HH2 P;  2R93 H;  1PMR A;  4LF4 L;  1SNC A;  1G8Z D;  5IYB H;  2RSN A;  3K58 A;  4A3D H;  1CM9 A;  4X3S A;  1DON A;  4CDF C;  2F4V Q;  3HOV G;  4C3J H;  1M4V A;  1PTO D;  5ELE A;  3VR6 A;  1YIJ A;  1PYB A;  4ODG A;  1X3G A;  1ICF B;  1YJW A;  5C44 H;  2R7D A;  2E2J H;  1I94 Q;  1N33 Q;  3LWE A;  1J5E L;  4A3M B;  1XX8 A;  3T56 B;  5JJI A;  4DF7 A;  4PMB A;  3JAM E;  2ATW A;  4TKO B;  1AH9 A;  2B8G A;  1V1O A;  1UAP A;  5FK9 C;  1H9R A;  3LX0 A;  1C9O A;  4HR7 B;  4R1J A;  2X69 A;  2EYO A;  4QQB X;  4RFB A;  3SK5 A;  3I3C A;  3T4A C;  3AYH B;  1T5X D;  4Z9C B;  4UP7 A;  5C3E B;  4L5T A;  5J39 A;  3FHW A;  5IT9 L;  1TS5 A;  2UXB L;  1PHJ A;  4DR5 L;  1WTP A;  3DM3 A;  3Q23 A;  4BY7 G;  2K05 A;  3S1R H;  4O2D A;  4OHJ A;  1PYS B;  5J22 A;  3F2B A;  3TBI B;  5GAE C;  5JPN C;  2A68 D;  3FKI B;  3PGZ A;  5C4X H;  3AMU A;  2NZH A;  4RMF A;  4KY6 A;  1HCZ A;  3BG3 A;  2YYZ A;  2EYL A;  1G6P A;  1EIY B;  1EYD A;  3L0O A;  3S15 B;  3M3Y B;  3G4S A;  1Y1V G;  1LLR D;  3I4N B;  2LFN A;  2NWG A;  3WDN A;  1I5F A;  4A3K G;  3C3L A;  2N49 A;  2K5H A;  1I4G A;  1V1P A;  3A5Z B;  2QDL A;  3R2T A;  1GXD C;  2KHS A;  4P72 A;  2PCF B;  2ES2 A;  1BDO A;  5COR A;  4B08 A;  3HOW G;  3ND8 A;  5M3M H;  4OWW B;  4BBR H;  1Q90 A;  4HED A;  1PH1 A;  2WB1 G;  4IUU A;  4A3C G;  2CWA A;  1SEB D;  2FMM A;  2CQA A;  4LFB L;  1TII D;  4N9P A;  3CHB D;  3CPF A;  1G51 A;  2VB3 X;  2B63 H;  1STH A;  1LAB A;  4RHR A;  5GAH C;  2IPK D;  3BVG A;  4KV6 A;  2K1B A;  3HG9 A;  1Y69 U;  4BBS G;  1EIF A;  3D8G A;  5KND A;  3OSO A;  1ASZ A;  2R93 B;  4JI7 L;  2NB0 A;  4IPH A;  4YHH L;  3J7Z C;  3O13 A;  2KED A;  4A3D B;  1II3 A;  4C3J B;  5IE8 A;  4K6D A;  1ZKO A;  2A69 D;  3KDF B;  1L2F A;  3OWF A;  3OYY A;  5C44 B;  1CQV A;  4DUY L;  2E2J B;  4C1N K;  3OMG A;  4DV6 L;  2MJ8 A;  4V19 0;  1Y1W G;  4JBM A;  1W6K A;  4FDB A;  4JI3 Q;  3NP8 A;  5COY A;  5GQO A;  4DV0 Q;  3E6Z X;  4LAA A;  3ERS X;  3FMC A;  4HJ7 A;  4LMQ D;  1FNU A;  5TSS A;  3HOZ H;  4NP5 A;  1QCB D;  4IUP A;  3H09 A;  4HN7 A;  3EQL C;  2E5L Q;  3A8K E;  2EY6 A;  3Q24 A;  4XQQ A;  2YTV A;  1PH2 A;  1TWH H;  3D4R A;  3IAY A;  3VA5 A;  1DJR D;  1LAC A;  2HT1 A;  1KL9 A;  1XPU A;  3S1R B;  3PF5 A;  4WOR A;  1WTX A;  4CJ0 B;  3HKZ E;  5C4X B;  2EJF C;  4HID A;  1IBK L;  2Z1C A;  1ZXT A;  3HS0 C;  3K5M A;  2EIF A;  4KHP L;  2K5D A;  5GRO A;  4MTN A;  1PRT B;  5IGB A;  1SNO A;  1YJ9 A;  3HKZ B;  5BR8 Q;  5CV5 A;  4C56 C;  3FP9 A;  1B7Y B;  2VQE Q;  3MHB A;  2CVR A;  4XXE A;  3VR3 A;  1SN8 A;  3VYT A;  5M3M B;  1PVO A;  1EYC A;  3NBI A;  4BBR B;  3SVM A;  2BE5 D;  2WAC A;  2JA7 H;  3MA2 B;  1NCV A;  1SND A;  3NWS A;  1EY6 A;  4JI4 Q;  4FO2 A;  4GS3 A;  2B63 B;  1ENF A;  4JC0 A;  2ENB A;  4X6A H;  1LTL A;  4DV1 Q;  2DGY A;  2RBM A;  3W5O A;  1BBU A;  3M4P A;  3K8A A;  5D3D A;  3M4Q A;  3PCO B;  1PA6 A;  5JVG 3;  1XNQ Q;  3NK9 A;  1NBW A;  4NXN Q;  2C35 B;  3J81 i;  4KJO A;  1OXS C;  3MXP A;  3TP6 A;  3LWU A;  4J1M A;  1R4Q B;  4EGV A;  1FJG L;  2B8F A;  3QO2 A;  5DM7 3;  4U68 A;  4IJL A;  1VQ5 A;  3UDI A;  5HUR A;  1GKH A;  2NZO A;  1Q46 A;  3C2P A;  4K14 A;  1SYE A;  4IUR A;  1EFI D;  3M4O H;  2JA8 G;  4R8I A;  3UI2 A;  1I4Q A;  2AUJ D;  5G3L F;  1SNQ A;  2KCT A;  1F2M A;  2OQ0 A;  3HKS A;  3TP5 A;  4DR7 Q;  3AEV A;  1LTR D;  2EQS A;  4DR3 Q;  2KEE A;  2R7Z G;  3A54 A;  2JA5 G;  1EU3 A;  3RLN A;  4U67 3;  2ICE C;  2XWJ B;  1EU4 A;  4NW2 A;  4AH6 A;  3HOY G;  4A3L H;  4IQZ A;  1PZJ D;  1KHI A;  2OWO A;  2O2L D;  3NTH A;  3PUZ A;  1TWF H;  4XT1 B;  1TWH B;  2I0Q A;  1Z6H A;  3GTP H;  3TRE A;  2JSO A;  2LSS A;  2F0H A;  5M5X H;  4X64 Q;  1FGU A;  5C3W A;  4RKB A;  3KK7 A;  3TP8 A;  4RGM A;  2JEA I;  5IP7 G;  4GN3 B;  5A2Q L;  5LL6 S;  3U9O A;  4XQN A;  2DNC A;  3I56 A;  4MZ9 A;  1EOT A;  4MN3 A;  3NSW A;  2RA4 A;  2CW0 D;  1SYD A;  1YNN C;  2HCC A;  3RN2 A;  4RHS A;  3ERQ A;  3K0X A;  3PSI A;  5FLX E;  4BXX G;  1VQK A;  1EY0 A;  5AFW A;  2X6L A;  1STY A;  3PF4 A;  2JA7 B;  3G48 A;  5C0X H;  1SE3 A;  4A3J G;  1HUN A;  2WIN B;  1EYG A;  1A3U A;  1YZ6 A;  2SDF A;  3OTO L;  2Z9H A;  4L5R C;  1IBM Q;  1R9T H;  2XN9 C;  4LFA Q;  1GUG A;  1EY8 A;  3QOJ A;  4J8Q A;  4HCS A;  2B2Y C;  1MJE A;  3PIP A;  5E4X A;  3CRK C;  4R9W A;  4DR1 L;  4G7H C;  4RA8 A;  3EFX D;  4P2C B;  1XMO L;  1K73 C;  2IJ0 A;  5HGT A;  3I72 A;  3NTK A;  1CHQ D;  4YY3 L;  4B3S L;  3KFU A;  1LTA D;  4DA2 A;  2FIN B;  1B1Z A;  3M4O B;  3KF6 A;  2DY7 A;  4GKJ L;  4RH6 A;  1EQQ A;  4UAI A;  1B70 B;  5E3F A;  4R4Q A;  1QZG A;  4X65 Q;  2E2I H;  2YTY A;  3KYH C;  5IYD H;  1SYB A;  2F0K A;  3F2C A;  1TXY A;  2KHI A;  1VQM A;  3GD7 A;  5CV4 A;  3K5L A;  1S5C D;  2NVX H;  1TWF B;  2BA0 A;  1IBL L;  2EJG C;  3BS1 A;  3GTP B;  4XIG S;  4EX5 A;  4DV7 L;  1H9K A;  5M5X B;  1Z9F A;  3C46 A;  5CV8 A;  3K80 C;  2EYH A;  3A7A B;  2PMZ E;  3DHQ A;  1SJE D;  4KTA A;  3J81 c;  2RSO A;  2N8N A;  3ZYY X;  3UDX A;  2C9O A;  1KXL A;  3CF5 A;  5EAY A;  2ZM6 L;  4Y52 H;  1BCP F;  4QY7 A;  1JE5 A;  4ZK9 B;  2F0N A;  3OIQ A;  4DK1 A;  5IGG A;  4NXM Q;  2F0I A;  1XMQ Q;  2PYK A;  4PZ7 A;  2IWH A;  2PPB C;  1XYI A;  5D65 A;  3H3V I;  4IN3 A;  2PMZ B;  4POF A;  2LMC B;  1EY7 A;  4WRD A;  2KHJ A;  3BDO A;  4L5S A;  1I3Q H;  3K57 A;  2JQO A;  5EPK A;  1I94 L;  4JYA Q;  3HP3 A;  4A76 A;  2FMC A;  2A1A A;  2EYM A;  4XYO A;  5BN4 A;  3J80 E;  3U4Z A;  1R9T B;  2L4N A;  2H4O A;  2I5M X;  3K0Y A;  5CYU A;  1IL8 A;  2D5D A;  1LT3 D;  1CFM A;  4C3I H;  2BH2 A;  1EL0 A;  2Y0S G;  1Q81 C;  3H0G G;  2I5H A;  4ZAI A;  2UUC L;  4C3H G;  2WP8 J;  2ASB A;  4LF6 Q;  1F2Y A;  3JAM L;  4P75 A;  1I6V C;  4DGZ A;  4A3E G;  1GUO A;  3DEP A;  3PV0 A;  2IL8 A;  2PZW A;  5LMU Q;  3PO2 H;  3STB D;  2RDH A;  2KCM A;  1N32 Q;  3R93 A;  1SDF A;  5T1I A;  1X55 A;  4N8X 1;  2NTS A;  1UWV A;  4MIU A;  1YVC A;  2PZT A;  2E2I B;  1UE6 A;  1Q12 A;  3I7F A;  1E2W A;  1VQI A;  3C1E A;  5ELC A;  1CUK A;  4EQO A;  4O0A A;  3K81 C;  5EKK A;  5EKL A;  1A3T A;  2NVX B;  1G29 1;  3RZD H;  4DUZ Q;  1HJP A;  1TU2 B;  4J15 A;  2UU9 Q;  2KQ3 A;  4P73 A;  3X3N A;  3CRL C;  3R2I A;  4GLX A;  1CSP A;  1GUT A;  5FO8 B;  1ML0 D;  4WJ3 M;  2F0F A;  1PH7 A;  4DR2 Q;  4HIK A;  4CKC A;  1F9P A;  5IGD A;  4HMI A;  3J80 c;  1GHJ A;  4IFD G;  2OTL A;  2EYJ A;  3I4M H;  4A93 G;  4CDD C;  1B3A A;  4LF5 L;  1OXX K;  5C0X I;  4UHV A;  1EWC A;  1LT5 D;  2ZTD A;  1W2B A;  3TS0 A;  2OF1 A;  4MTK A;  4JV5 L;  5LL6 X;  4OWT B;  1E7Z A;  4JI1 L;  4H0L C;  4KKU A;  3ITP A;  4JW0 A;  2A8V A;  4GKK Q;  1I3Q B;  2CWP A;  3GV3 A;  1LTS D;  5EJW A;  2VUM G;  3S1M H;  3CC7 A;  5CBE E;  1U0L A;  4IFD J;  1VQ8 A;  3CU7 A;  4KD3 A;  3I73 A;  2QKI C;  1WTO A;  5DAU A;  2DNE A;  2QIL A;  3K7A H;  4KK7 A;  4LF7 Q;  2JE6 I;  5IP9 H;  1KIX A;  4DV3 Q;  3A5U A;  2NN6 H;  3BDC A;  4G57 A;  1HZA A;  1O7I A;  3BVM A;  1NNX A;  4FYD A;  1VQO A;  1QZH A;  2GVA A;  4KHZ A;  5C6A A;  4RAU C;  4KY7 A;  3T13 A;  2E5L L;  2A5H A;  3T1Y Q;  3ERO A;  1CA6 A;  5IOD A;  2PI2 E;  3PO2 B;  3KF6 B;  3URY A;  4A3B G;  3FPP A;  1WCM H;  4GN5 A;  1XPR A;  2JA6 G;  5JOB A;  4ILW A;  3Q6S A;  1HNW L;  3TZD A;  4AYB E;  1STN A;  1K8A C;  1AZP A;  3E5S A;  3NEM A;  2L55 A;  3J7A F;  4HCE A;  4K5X A;  4DV2 L;  1FL0 A;  2Q8I B;  5EKI A;  1Q3L A;  2JA9 A;  5K5P A;  2MP1 A;  4IFD I;  5BR8 L;  1PFB A;  1X56 A;  3RZD B;  1UE1 A;  2JYO A;  3MAQ A;  1N36 Q;  2R61 A;  3C1F A;  2VQE L;  2E75 C;  1GD7 A;  1X9N A;  3GTK H;  1S5B D;  2Q8R E;  5T1G A;  2LY7 A;  3S2D B;  1PTO F;  1AN8 A;  5FLM G;  5ELB A;  4JI4 L;  3CMA A;  1TR5 A;  1W3S A;  1EZ6 A;  5FJ8 H;  4N8F A;  2HIV A;  3G6J B;  1CKM A;  3I4M B;  2A6H C;  3TP7 A;  1X3P A;  5AJ3 Q;  4V0B A;  1QVF A;  3OW7 A;  4JBJ A;  1E2V A;  3OHX C;  2Z6B A;  2PZU A;  4WJW A;  1ONL A;  2CH4 W;  2Z0S A;  1XNQ L;  4A3M G;  1HR0 L;  1VQL A;  1HZ9 A;  1E22 A;  1SNM A;  4NXN L;  4UY8 C;  1DXM A;  3GQB A;  4DK3 C;  3A0J A;  5ELN A;  3S1M B;  1AFP A;  1GVP A;  1ILQ A;  1CKO A;  3EN2 A;  1WD0 A;  1JJ2 A;  1KAA A;  2VZA A;  3K7A B;  4JBW A;  1HNX Q;  3GTJ H;  4B3T Q;  1MGS A;  3MC0 B;  3P1H A;  3VR4 A;  1EY5 A;  3M7G A;  1SBB B;  1QVC A;  5DLQ E;  1BOS A;  4DR7 L;  1QUQ A;  2MPM A;  4K8J A;  4FNF A;  3S1N H;  5C3E G;  2CHB D;  4B3R L;  1QG7 A;  3KF8 A;  3R3O A;  2L5T A;  1SAP A;  2L11 A;  1PV4 A;  2BCO A;  1M90 C;  4B3M Q;  4I65 A;  1EYA A;  1MIU A;  3KJP A;  4JI0 L;  2VXW A;  1JIC A;  1DD2 A;  3QIA A;  2K33 A;  4IPD A;  1WCM B;  5J1Z A;  4X64 L;  2EY2 A;  3FKI G;  3MXN A;  2HDL A;  4HJA A;  3ULP A;  1GUN A;  2EYP A;  5F2D A;  4K0K Q;  2L0C A;  1N34 L;  5DNF A;  3I4N G;  3TSS A;  2IT1 A;  4JI8 Q;  1FVI A;  3D0F A;  2JXM B;  3AFQ A;  2L15 A;  1TS2 A;  4IPC A;  3NEL A;  4IUQ A;  4YCU A;  1YBY A;  2PQA B;  3SR1 A;  1B3Q A;  1QB5 D;  1YI2 A;  5LMN W;  2F0L A;  4YCW A;  1VQJ A;  1YNJ D;  3GTK B;  2F03 A;  2NVQ H;  4DR4 L;  1BUV T;  3CCV A;  4QCL A;  3T1H L;  1AW7 A;  3NEN A;  1U4P A;  1UNS A;  2ICI A;  3KBG A;  1PH5 A;  4ZKC B;  1HNZ Q;  2ZXO A;  1KRT A;  2FXQ A;  1IBM L;  4A3I H;  5FLX L;  2E2D C;  3CCQ A;  2K01 A;  4ZUI A;  2R93 G;  1TY0 A;  2MGS A;  2RCF A;  1PRT D;  3QWN A;  4A3D G;  2BA1 A;  2A6E D;  2EDG A;  2E8G A;  4F88 A;  2ZT9 C;  4C3J G;  4DFA A;  1VDZ A;  2RDF A;  2TMP A;  3EA6 A;  1JQY D;  4HIO A;  4QIW E;  5C44 G;  3GP7 A;  2E2H H;  5KYL A;  1QOH A;  3FVQ A;  4RGN A;  4KHV A;  4ABN A;  1BQQ T;  2LKV A;  5I2X A;  1KTK A;  1NTG A;  3P20 A;  1AE2 A;  1S4Z A;  3PIO 3;  4R4O A;  1LT6 D;  1T9H A;  4QIW B;  4LFC L;  1OO9 B;  3V2T A;  1Q1B A;  4A3G H;  1V9P A;  4LF8 L;  3GTJ B;  2AQ2 B;  2XSC A;  4Q0F A;  2MQH A;  4LNQ A;  4IZ8 A;  3RMH A;  1PXU A;  2YV5 A;  1EIH A;  4JI6 Q;  4ME5 A;  4E6I A;  1RHP A;  3S1N B;  2K5Q A;  1PH8 A;  1JR0 D;  1UEB A;  3X3M A;  3CCR A;  1X3E A;  2L12 A;  5JEA G;  4DK6 C;  2ID0 A;  2B29 A;  1PZK D;  3ONA B;  4XQJ A;  3QR8 A;  1CQF A;  1SE2 A;  1SRO A;  2H5X A;  3VYS A;  5C4X G;  4DR6 Q;  3SDZ A;  3KOJ A;  5CC4 A;  4GZY C;  1ESF A;  3D4W A;  3W1B A;  5IP7 H;  1F9S A;  2EYF A;  2K5V A;  2O5J C;  1RD9 D;  3HKZ G;  4NXM L;  1PFM A;  3D6W A;  3J7Y W;  2ZJQ A;  5JEA J;  1H9J A;  5D14 A;  4DU9 A;  3MXG A;  4ME3 A;  5KEE A;  4PNY A;  1JC7 A;  1IW7 C;  2I46 A;  5M3M G;  1C4Q A;  4BBR G;  2NVT H;  1EUJ A;  2XTI A;  2NVQ B;  2PNH A;  1D1I A;  4JYA L;  2XGT A;  1F9R A;  1YNX A;  2FFK B;  2A73 B;  4A3J H;  1VQA A;  3NBH B;  2K75 A;  2G9D A;  2QW7 A;  4HAE A;  4A3I B;  3RR5 A;  2UUA Q;  4TVA B;  3D4D A;  3HGB A;  1JOO A;  2K32 A;  4LF4 Q;  2F3W A;  4DNI A;  3F2U A;  1VQG A;  3LGJ A;  1NMF A;  2E2H B;  1OXV A;  3LNN A;  3J80 L;  1ILP A;  1PDQ A;  2LXK A;  1J5E Q;  5EQ0 A;  1K8G A;  3BZD B;  1FGB D;  1LTT D;  4ZKB B;  4JI5 L;  3HOZ B;  1KLU D;  3HOX G;  3U50 C;  2SOB A;  5EPJ A;  2N88 A;  1QUQ B;  2OQK A;  1F77 A;  1BCP C;  1PFN A;  5KGU A;  3BYT B;  4A3G B;  3L2P A;  3A8I E;  1X54 A;  3KF8 B;  5LMN Q;  5KYI A;  2KUM A;  1K3B C;  4AQY L;  1B44 D;  4MHE A;  5FKA C;  2PW5 A;  4H13 C;  3TEH B;  2OT2 A;  3SK4 A;  1BF4 A;  3RNU A;  1BBW A;  5C5M A;  1Y8N B;  3MXN B;  1M1K C;  4DUZ L;  2UU9 L;  2MFI A;  2UXD Q;  2NTT A;  2IX3 A;  1HFG A;  4XT3 B;  1LUZ A;  3MZ5 A;  4IOC A;  1H9S B;  1MSG A;  2MNA A;  1NR4 A;  1B8A A;  3W3A A;  1X6O A;  1TS3 A;  4DR2 L;  3S9W A;  1JT8 A;  1ROD A;  2KJX A;  3OPO A;  2Q2T A;  1IYU A;  3JC6 6;  4ZCK A;  3GTG H;  4BA2 I;  1EIG A;  5IGE A;  3I55 A;  1X65 A;  3P75 A;  3TME A;  5FO7 B;  2Z6K C;  2BH8 A;  3A56 A;  5LHY 1;  1S72 A;  1BVS A;  3I90 A;  1KNA A;  3MFG A;  4HJ5 A;  5E7N A;  3J81 E;  1RIP A;  1U5K A;  1WYD A;  4ZRZ A;  1O7L A;  3OOC A;  3AFP A;  1PH6 A;  2NVT B;  1STB A;  2JA7 G;  1BBX C;  1D2B A;  4L5Q A;  2KEN A;  3CME A;  3AQQ A;  1MSH A;  5I6Y A;  1A62 A;  3HEJ A;  1QNK A;  1CK1 A;  5CMD A;  1I4H A;  1T5E A;  2RDG A;  3J7A V;  4EQN A;  1EQR A;  2WAQ E;  2Z6K A;  4KKS A;  2B2V C;  2AWN A;  2F0J A;  1SJH D;  1F9Q A;  1KDB A;  1JWU D;  3WOE A;  4GLV B;  2R92 H;  5DM6 3;  4JI7 Q;  4YHH Q;  4LF7 L;  4H44 C;  4IOA A;  4OEM B;  3CQZ H;  3BDL A;  4L6T B;  4S3S A;  4LUV A;  3HZX A;  3NE5 B;  3G71 A;  2CFM A;  2NUC A;  2WAQ B;  4DUY Q;  2M9V A;  4MNO A;  2YU9 H;  3B6Y A;  1FNV A;  4TQU S;  3T1Y L;  3Q8D A;  2B2V A;  2B2Y A;  3KJO A;  3CCL A;  1XNR Q;  1XXG A;  4WJ4 A;  4DKA C;  4HSV A;  4APV A;  3VYR A;  5L37 A;  5FO9 B;  4CKB A;  3K5O A;  1TWC H;  2F0T A;  1MHW C;  4KN7 C;  2MHV A;  1G2S A;  2PI2 A;  2OXP A;  3L9A X;  3H6M A;  3BZC A;  1PH9 A;  3UDF A;  3VR2 A;  1KLG D;  4A3L G;  4DV5 Q;  2Q8T A;  4X62 Q;  1KRS A;  1WJJ A;  4GNX B;  5K36 H;  1XTC D;  4PMW A;  1NUC A;  1LYL A;  5GAD C;  4BWG B;  4PQX A;  2B2U C;  1ENC A;  1KC8 C;  3I2Z A;  2F0P A;  2YTX A;  1M8A A;  1N36 L;  1Q1E A;  1KDA A;  3NXW A;  5IYC H;  4CJ1 B;  4IAL A;  3TS2 A;  3PO3 H;  1YIT A;  1N9W A;  1JE4 A;  5IIF A;  2EPB A;  1EOV A;  1SMY C;  1FD7 D;  2J7Z A;  1S40 A;  1FYC A;  2F4V L;  4UDU C;  2B2U A;  2AKW B;  1H95 A;  2XIW A;  1A2U A;  1U4L A;  3UE0 A;  1A63 A;  5CGK A;  1N33 L;  2J4X A;  1CHP D;  2OEO A;  2EVB A;  3HOU H;  3BU2 A;  3CC4 A;  1D5X C;  1A0I A;  4NDX A;  1W6J A;  2NYZ D;  2WKC A;  5I6W A;  1I4R A;  5C0X G;  3MWY W;  1BKB A;  3D3R A;  2DN8 A;  3GDE A;  3DWA A;  2UUB Q;  3K5N A;  1LTB D;  1C7Y A;  3SHL A;  3NUC A;  2O4X A;  3TDQ A;  1LT4 D;  4DAY A;  4HIM A;  3G7L A;  4XDX A;  1B50 A;  1PH3 A;  2R92 B;  2K5N A;  3NQT A;  1L0W A;  1I4P A;  4HTH A;  2R6G A;  3CQZ B;  2IHF A;  4OO1 H;  2WFW A;  2N78 A;  1CI3 M;  4RGO S;  4P74 A;  4B9X A;  2LXJ A;  2K14 A;  5C0X J;  1X3Q A;  1ZYR C;  1WTW A;  2YU9 B;  5C5L A;  1VF5 C;  3E0E A;  1E0B A;  1YNN D;  3HRZ C;  4FF3 A;  2WV6 D;  1FJG Q;  4C2M H;  2F0Q A;  2XNA C;  1UUP A;  1WTR A;  5E1F A;  2GA4 B;  2AUK A;  1PTO C;  1IHZ A;  1JWS D;  1MBY A;  2D0P A;  1UE5 A;  1TWC B;  2RF4 A;  2IY5 B;  3OMC A;  3KLS X;  4YIJ A;  5E4W C;  5M3F H;  1C48 A;  2F0O A;  3FRP B;  4IUN A;  5IYD G;  1J9O A;  1B53 A;  4JK1 C;  3RD4 A;  3CC2 A;  2F3V A;  1L1O C;  1BCP B;  4IUT A;  4A3F H;  3PUY A;  3SEB A;  1GUS A;  4QGU A;  1TWG H;  3EVQ A;  1CKN B;  2K04 A;  2PQA A;  3PIP 3;  4CBV A;  3Q0A A;  3S14 H;  1SYC A;  1LM0 A;  4DK0 A;  3PO3 B;  4DN4 M;  2P5Z X;  1CSQ A;  1U4M A;  4POG A;  1SNP A;  5M5Y H;  5IGF A;  3U9S A;  3P7J A;  1I6H H;  4BY1 G;  1VQH A;  5EPL A;  3HOV H;  4K5W A;  3SK6 A;  2F1M A;  5C4J H;  4GN4 B;  3PUW A;  1WI5 A;  2A68 C;  3HOU B;  1DOL A;  3U4V A;  5J3B A;  2O5I C;  1O80 A;  1IKM A;  4JI3 L;  1SYF A;  4DV0 L;  1VMP A;  2QEX A;  3S17 H;  4XTC S;  4A3M H;  4L63 B;  4LJZ C;  1GHK A;  4C3I B;  4A4I A;  1BO0 A;  3T53 B;  5M9O A;  3CCJ A;  1JOR A;  3OTO Q;  3Q22 A;  4UP8 A;  1RCV D;  1DM0 B;  1E24 A;  4KLK A;  1FR3 A;  1GO3 E;  1KNE A;  1WOC A;  2QEJ C;  4K2L A;  3SGI A;  3NHH A;  5JJK A;  4QUC A;  4JI6 L;  1K3R A;  4DAV A;  4DAP A;  2JK8 A;  3BJU A;  5I2Y A;  4G4K A;  4JPB W;  4DR1 Q;  4BY7 H;  2XVS A;  4WFN 3;  3PO2 G;  3M9B A;  4ULL A;  4C2M B;  1EY4 A;  3M7N A;  2EY1 A;  2FHT A;  2FJ2 A;  4CKE A;  3JAM i;  3TRZ A;  1IL2 A;  2BDN A;  4XYQ A;  1Y1V H;  2A69 C;  2EJM A;  4EQP A;  4DR6 L;  1SRU A;  4GKJ Q;  3L7Z C;  2CH4 A;  5M3F B;  2UXC Q;  1JJG A;  1LTG D;  4A3K H;  1PTO H;  1CA5 A;  3N6R A;  3DWP A;  1N8R C;  2DJG C;  1MD2 D;  4A3F B;  1KQS A;  1BR9 A;  4O42 A;  4AYB G;  5FOB B;  1TWG B;  3HOW H;  4DV4 Q;  3E9H A;  1EWI A;  4DV7 Q;  4A3C H;  4OIJ A;  1VQ4 A;  1F2L A;  3DM1 A;  5ELD A;  1WTV A;  3PIO A;  1X32 A;  3S14 B;  3K59 A;  1VQD A;  1GM5 A;  3F8T A;  5CBA E;  1VMC A;  4DV1 L;  2F52 A;  4FP5 D;  2VQF Q;  4BBS H;  4RGT A;  1EEI D;  4X3U A;  4M8A A;  1I6H B;  5M5Y B;  2KOL A;  3NBH A;  3CCS A;  1WD1 A;  4ZQ3 A;  2OCE A;  2C5C A;  3I4M G; 
#chains in the Genus database with same CATH homology
 1QJO A;  4RCO A;  3HOV B;  4FXD A;  5C4J B;  4QUF A;  4QMG A;  4K8I A;  1ENA A;  5I9P A;  1FNW A;  2BOS A;  4HMJ A;  1R4P B;  2F0V A;  3OIP A;  1B2T A;  1RDP D;  4QB4 A;  1HUM A;  3S17 B;  1S5E D;  4HSP A;  2K28 A;  4OO1 I;  3V05 A;  3OWE B;  1KAB A;  4F8M A;  2J0T D;  4TRD A;  5D3I B;  3KBX A;  1JB3 A;  5IGC A;  2NN6 G;  2BE5 C;  1ET9 A;  3FPU B;  1D5Z C;  1HXY D;  5DEH A;  3I4L A;  5C3X A;  2WKD A;  1HA6 A;  4BY7 B;  5IOC A;  3DWQ A;  1SYG A;  3I91 A;  5JEA H;  3NQI A;  1RF2 D;  1H9S A;  4DNR B;  5I4D A;  1A15 A;  1HA5 A;  1Y1V B;  2EOT A;  1GJX A;  3I70 A;  2I07 B;  4A3K B;  2PW7 A;  1PTO B;  2M2L A;  4R8N A;  3PMF A;  2K5W A;  3SXH A;  1SXT A;  4L8J A;  1EZ8 A;  3HOW B;  3H3V C;  1STG A;  2WB1 B;  2AWO A;  1LTI D;  4OGQ C;  4FF2 A;  1D5M C;  4ZLT F;  1G6Z A;  4OL7 A;  1PRT F;  2M00 A;  3RUZ A;  5JJZ A;  4BBS B;  4N9T A;  2K7V A;  1G91 A;  3J81 L;  2AQ3 B;  2KCN A;  1QNU A;  1J8I A;  2D62 A;  5CV9 A;  3QB3 A;  3VA7 A;  1WVL A;  5ISR A;  2SEB D;  2Z4I A;  2ZXR A;  2NN6 I;  4QF4 A;  2IX0 A;  1Y1W B;  2D9U A;  2B2T C;  2LS0 1;  1A2T A;  2EXZ A;  2EE1 A;  4KY5 A;  3PUV A;  2CW0 C;  1AP0 A;  3QJY A;  1HRJ A;  1JCK B;  2DY8 A;  2RVL A;  3BVZ A;  2H1E A;  1EQV A;  2BDO A;  3R8B A;  3MFY A;  3A55 A;  2B2T A;  2L9H A;  2NBF A;  2K6A A;  4Y7N B;  3DXJ C;  2G9H D;  3M4Y A;  2A6H D;  4K2K A;  1O7Y A;  1CT1 D;  4DNT B;  3QOL A;  1K8M A;  1K8O A;  2NZ1 D;  2R3Z A;  4RWS C;  1KDC A;  2JP1 A;  1HTP A;  1U4R A;  3I8Z A;  4O1N A;  1V8Q A;  1TQO A;  2MUY A;  4IUV A;  1NR2 A;  1K83 B;  1O78 A;  3E0J A;  4DXG A;  1B9M A;  1CZW A;  3FDT A;  2VNU D;  1DZ1 A;  1HHV A;  2N55 A;  4KJN A;  2RKS A;  2XRS D;  3D31 A;  2B2W C;  1PYW D;  2KCC A;  1TT2 A;  3KLR A;  1HTL D;  4G7Z C;  1EEF D;  1VCI A;  1O7Z A;  3NPP A;  2V4D A;  2Z8L A;  2B2W A;  1S5F D;  2X6G A;  3N52 A;  5IT9 E;  3M85 A;  2F0M A;  4K6L A;  4CGY B;  2Z4H A;  5BN5 A;  2JA8 B;  4ZYS A;  5JVH 3;  1JOK A;  3HOX B;  2KA7 A;  2R7Z B;  2JA5 B;  3HOY B;  2HDM A;  4FXK C;  3EJI A;  1GOZ A;  4NMZ A;  5G3L D;  4DXF A;  5KNC A;  1HFN A;  1SFO B;  1DOM A;  1RKN A;  1ZEQ X;  4FVM A;  4F87 A;  1WTQ A;  2HQE A;  1ESR A;  3TZU A;  1NAP A;  5KIX A;  1Y8O B;  2F0W A;  4KKT A;  1Z7T A;  1OXT A;  3IKJ A;  1RTN A;  1V43 A;  4K5V A;  4F7X A;  1PZI D;  1A6X A;  4BS9 A;  3GTO B;  5A35 A;  1V1P B;  1QIL A;  2E76 C;  1D1K A;  2F0U A;  1H9M A;  1JOQ A;  3T51 B;  4H7B A;  4A3J B;  1TY2 A;  2QCP X;  1TWA B;  1ICW A;  2QDB A;  3K6O A;  1AZQ A;  1Q8I A;  3TN2 A;  3RZO B;  3V96 A;  4B9W A;  1CZG A;  1BXT A;  3MXU A;  5NUC A;  1RJT A;  2KEC A;  1BNZ A;  3CKI B;  1EQT A;  1UEA B;  1C8C A;  3H94 A;  1A3V A;  4X3K A;  3S1Q B;  4EVO A;  5JPM C;  4FF4 A;  1L0Y B;  3GO5 A;  4ID6 A;  1SSO A;  1E2Z A;  1IW7 D;  1SE4 A;  4G7O C;  5KRU A;  3IFD A;  2EZV A;  1AEX A;  2B39 A;  2HUG A;  3S2H B;  1QWY A;  1IKL A;  2A74 C;  3VR5 A;  3KLS A;  1QE6 A;  1EWH A;  2L1B A;  5JAV A;  4BA1 I;  5C4Z A;  3DUZ A;  5I9O A;  3MTS A;  2XWB B;  5C4H A;  1STE A;  3D6C A;  3GTG B;  3GV6 A;  1PLF A;  1Y8P B;  4IFD H;  2KVM A;  5M5W B;  3H91 A;  4CJ2 C;  2E74 C;  1BCP D;  3SK8 A;  2D2C C;  4OIK A;  1TS4 A;  2AQ1 B;  5CV6 A;  1S5D D;  2WII B;  2IW3 A;  4Q5V A;  1U9R A;  1TKW B;  3IFT A;  1IYV A;  4KMU C;  1OXU A;  3L3O C;  1B9N A;  4KN4 C;  3DMU A;  2F4I A;  2Y0S B;  3H0G B;  5KNB A;  3NTI A;  4C3H B;  3W2D A;  4FXG C;  1RTO A;  3AB9 A;  1VF7 A;  3KUP A;  2XRQ D;  4A3E B;  2F0D A;  4LK1 C;  1HPC A;  2SNS A;  3NWT A;  2QF7 A;  3IL8 A;  2SNM A;  4I7Z C;  4PV1 C;  3S16 B;  1D6E C;  3ND9 A;  5A2Q E;  3FEW X;  2ZXP A;  5K36 G;  5ELF A;  5EGT A;  1DOK A;  3SE0 A;  4X3T A;  1LV9 A;  5EBC A;  1L0X B;  1XWE A;  1TVX A;  2PQE A;  3GTM B;  5EBD A;  1DCZ A;  1LO5 D;  3MEH A;  4A93 B;  3GTL B;  1B4O A;  1MI2 A;  1JWM D;  2PO4 A;  2PNR C;  4KI0 A;  4BY1 B;  4FF1 A;  1I4X A;  5CR3 A;  1GUW A;  1HQR D;  2JEB I;  2IX1 A;  5BN3 A;  2VUM B;  1F2Z A;  1DYQ A;  4C3I G;  1CTM A;  3PUX A;  4RKL A;  3AU7 A;  3RLF A;  1EY9 A;  1Z47 A;  2F0G A;  1YNJ C;  4ZUJ A;  4OO1 G;  3GTQ B;  1SMY D;  2HCI A;  1I50 B;  1G2T A;  4TSS A;  3MVV A;  4KD4 A;  3VYU A;  2F0S A;  4NKL A;  4A3B B;  2JA6 B;  4PMC A;  1PRT C;  2A6E C;  4RCN A;  1HQM C;  2EY5 A;  2K03 A;  3BYY B;  3DEO A;  1ET6 A;  2NVY B;  4M1U B;  1STA A;  4C1N I;  2VB2 X;  3A8J E;  3A7L A;  4J6H A;  4AYB B;  2TSS A;  3T16 A;  2F0E A;  2RQX A;  3WOF A;  1ZYR D;  1NSN S;  3QG1 A;  5CV7 A;  4CHT B;  1PMR A;  1SNC A;  1G8Z D;  3K58 A;  2RSN A;  1DON A;  1CM9 A;  4X3S A;  1M4V A;  1PTO D;  5ELE A;  3VR6 A;  4ODG A;  3LWE A;  4A3M B;  1XX8 A;  3T56 B;  4DF7 A;  4PMB A;  3JAM E;  4TKO B;  2B8G A;  1V1O A;  1UAP A;  5FK9 C;  1H9R A;  3LX0 A;  4HR7 B;  2X69 A;  2EYO A;  4RFB A;  3SK5 A;  3I3C A;  3T4A C;  1T5X D;  4Z9C B;  5C3E B;  5J39 A;  5IT9 L;  1TS5 A;  1WTP A;  3Q23 A;  2K05 A;  5J22 A;  4OHJ A;  3TBI B;  5JPN C;  2A68 D;  3FKI B;  3AMU A;  4KY6 A;  1HCZ A;  3BG3 A;  2YYZ A;  2EYL A;  1EYD A;  3S15 B;  3M3Y B;  1LLR D;  3I4N B;  2LFN A;  2NWG A;  3WDN A;  3C3L A;  1I4G A;  1V1P A;  3R2T A;  1GXD C;  2KHS A;  2PCF B;  1BDO A;  5COR A;  4B08 A;  3ND8 A;  1Q90 A;  4HED A;  4IUU A;  1SEB D;  2FMM A;  2CQA A;  1TII D;  4N9P A;  3CHB D;  2VB3 X;  1STH A;  1LAB A;  4RHR A;  2IPK D;  3BVG A;  4KV6 A;  2K1B A;  3HG9 A;  1Y69 U;  3D8G A;  5KND A;  3OSO A;  2R93 B;  2NB0 A;  3O13 A;  2KED A;  4A3D B;  1II3 A;  4C3J B;  4K6D A;  1ZKO A;  2A69 D;  3OWF A;  5C44 B;  1CQV A;  2E2J B;  4C1N K;  3OMG A;  2MJ8 A;  4V19 0;  1W6K A;  3NP8 A;  5COY A;  3E6Z X;  4LAA A;  3FMC A;  4LMQ D;  1FNU A;  5TSS A;  4NP5 A;  1QCB D;  4IUP A;  3H09 A;  4HN7 A;  3EQL C;  3A8K E;  2EY6 A;  3Q24 A;  4XQQ A;  3D4R A;  3IAY A;  3VA5 A;  1DJR D;  1LAC A;  3S1R B;  4WOR A;  1WTX A;  4CJ0 B;  5C4X B;  2EJF C;  2Z1C A;  1ZXT A;  3HS0 C;  3K5M A;  2K5D A;  1PRT B;  5IGB A;  1SNO A;  3HKZ B;  5CV5 A;  4C56 C;  3MHB A;  2CVR A;  4XXE A;  3VR3 A;  3VYT A;  5M3M B;  1EYC A;  3NBI A;  4BBR B;  3SVM A;  2BE5 D;  2WAC A;  3MA2 B;  1NCV A;  1SND A;  3NWS A;  1EY6 A;  4FO2 A;  2B63 B;  1ENF A;  2ENB A;  2RBM A;  5D3D A;  5JVG 3;  3NK9 A;  4KJO A;  1OXS C;  3MXP A;  3TP6 A;  3LWU A;  4J1M A;  1R4Q B;  4EGV A;  2B8F A;  3QO2 A;  5DM7 3;  4U68 A;  5HUR A;  3C2P A;  4K14 A;  1SYE A;  4IUR A;  1EFI D;  4R8I A;  3UI2 A;  1I4Q A;  2AUJ D;  5G3L F;  1SNQ A;  1F2M A;  3TP5 A;  1LTR D;  2KEE A;  3A54 A;  1EU3 A;  4U67 3;  2ICE C;  2XWJ B;  1EU4 A;  4NW2 A;  4IQZ A;  1PZJ D;  2O2L D;  3NTH A;  3PUZ A;  4XT1 B;  1TWH B;  1Z6H A;  2JSO A;  2F0H A;  5C3W A;  4RKB A;  3KK7 A;  3TP8 A;  4RGM A;  2JEA I;  5A2Q L;  5LL6 S;  3U9O A;  4XQN A;  2DNC A;  1EOT A;  4MN3 A;  3NSW A;  2RA4 A;  2CW0 D;  1SYD A;  1YNN C;  2HCC A;  4RHS A;  3ERQ A;  5FLX E;  1EY0 A;  5AFW A;  2X6L A;  1STY A;  2JA7 B;  5C0X H;  1SE3 A;  1HUN A;  2WIN B;  1A3U A;  2SDF A;  2XN9 C;  1GUG A;  1EY8 A;  3QOJ A;  4J8Q A;  4HCS A;  2B2Y C;  5E4X A;  3CRK C;  4R9W A;  4G7H C;  4RA8 A;  3EFX D;  4P2C B;  2IJ0 A;  5HGT A;  3I72 A;  3NTK A;  1CHQ D;  1LTA D;  4DA2 A;  2FIN B;  1B1Z A;  3M4O B;  2DY7 A;  4RH6 A;  4UAI A;  5E3F A;  1SYB A;  2F0K A;  3GD7 A;  5CV4 A;  3K5L A;  1S5C D;  1TWF B;  2BA0 A;  2EJG C;  3BS1 A;  3GTP B;  4XIG S;  1H9K A;  5M5X B;  3C46 A;  5CV8 A;  2EYH A;  3A7A B;  3DHQ A;  1SJE D;  4KTA A;  2RSO A;  3ZYY X;  2C9O A;  1BCP F;  4ZK9 B;  2F0N A;  3OIQ A;  4DK1 A;  5IGG A;  2F0I A;  2PYK A;  2IWH A;  2PPB C;  1XYI A;  5D65 A;  4IN3 A;  2PMZ B;  2LMC B;  1EY7 A;  4WRD A;  3BDO A;  3K57 A;  5EPK A;  3HP3 A;  2FMC A;  2EYM A;  4XYO A;  5BN4 A;  3J80 E;  1R9T B;  2L4N A;  2H4O A;  3K0Y A;  5CYU A;  1IL8 A;  2D5D A;  1LT3 D;  1CFM A;  1EL0 A;  4ZAI A;  4C3H G;  2WP8 J;  1F2Y A;  3JAM L;  1I6V C;  4DGZ A;  1GUO A;  3DEP A;  3PV0 A;  2IL8 A;  2PZW A;  2RDH A;  3R93 A;  1SDF A;  5T1I A;  2NTS A;  4MIU A;  2PZT A;  2E2I B;  1Q12 A;  1E2W A;  3C1E A;  5ELC A;  4EQO A;  5EKK A;  5EKL A;  1A3T A;  2NVX B;  1G29 1;  1TU2 B;  2KQ3 A;  3X3N A;  3CRL C;  3R2I A;  1GUT A;  5FO8 B;  1ML0 D;  2F0F A;  4CKC A;  1F9P A;  5IGD A;  4HMI A;  1GHJ A;  4IFD G;  2EYJ A;  1B3A A;  1OXX K;  5C0X I;  1EWC A;  1LT5 D;  2OF1 A;  5LL6 X;  4H0L C;  4KKU A;  3ITP A;  1I3Q B;  3GV3 A;  1LTS D;  5EJW A;  5CBE E;  4IFD J;  3CU7 A;  4KD3 A;  3I73 A;  2QKI C;  1WTO A;  5DAU A;  2DNE A;  2QIL A;  4KK7 A;  2JE6 I;  2NN6 H;  3BDC A;  4G57 A;  3BVM A;  4FYD A;  4KHZ A;  5C6A A;  4RAU C;  4KY7 A;  3T13 A;  2A5H A;  3ERO A;  1CA6 A;  5IOD A;  3PO2 B;  3URY A;  3FPP A;  5JOB A;  4ILW A;  3Q6S A;  3TZD A;  1STN A;  1AZP A;  3E5S A;  2L55 A;  3J7A F;  4HCE A;  4K5X A;  2Q8I B;  5EKI A;  1Q3L A;  5K5P A;  2MP1 A;  4IFD I;  1PFB A;  3RZD B;  2JYO A;  3MAQ A;  2R61 A;  3C1F A;  2E75 C;  1S5B D;  2Q8R E;  5T1G A;  2LY7 A;  3S2D B;  1PTO F;  1AN8 A;  5ELB A;  1TR5 A;  1EZ6 A;  3G6J B;  3I4M B;  2A6H C;  3TP7 A;  1X3P A;  4V0B A;  3OW7 A;  1E2V A;  3OHX C;  2PZU A;  4WJW A;  1ONL A;  1SNM A;  1DXM A;  3GQB A;  3S1M B;  1AFP A;  1ILQ A;  1WD0 A;  1KAA A;  3K7A B;  4JBW A;  1MGS A;  3MC0 B;  3P1H A;  3VR4 A;  1EY5 A;  3M7G A;  1SBB B;  1BOS A;  2MPM A;  4K8J A;  4FNF A;  2CHB D;  1QG7 A;  3KF8 A;  3R3O A;  2L5T A;  1SAP A;  2L11 A;  2BCO A;  4I65 A;  1EYA A;  2VXW A;  1JIC A;  1DD2 A;  3QIA A;  2K33 A;  1WCM B;  5J1Z A;  2EY2 A;  3MXN A;  2HDL A;  1GUN A;  2EYP A;  5F2D A;  2L0C A;  5DNF A;  3TSS A;  2IT1 A;  2JXM B;  1TS2 A;  4IUQ A;  3SR1 A;  1QB5 D;  2F0L A;  1YNJ D;  3GTK B;  2F03 A;  4QCL A;  1BUV T;  1AW7 A;  1U4P A;  1UNS A;  2ICI A;  3KBG A;  4ZKC B;  2ZXO A;  5FLX L;  2E2D C;  2K01 A;  4ZUI A;  1TY0 A;  2MGS A;  1PRT D;  3QWN A;  2BA1 A;  2A6E D;  4F88 A;  2EDG A;  2ZT9 C;  4C3J G;  4DFA A;  1VDZ A;  2RDF A;  2TMP A;  3EA6 A;  1JQY D;  3GP7 A;  5KYL A;  1QOH A;  3FVQ A;  4RGN A;  4ABN A;  4KHV A;  1BQQ T;  2LKV A;  5I2X A;  1KTK A;  3P20 A;  1S4Z A;  3PIO 3;  1LT6 D;  4QIW B;  1OO9 B;  3V2T A;  1Q1B A;  3GTJ B;  2AQ2 B;  2XSC A;  4Q0F A;  4IZ8 A;  3RMH A;  1PXU A;  1EIH A;  4ME5 A;  4E6I A;  1RHP A;  3S1N B;  2K5Q A;  1JR0 D;  3X3M A;  2L12 A;  5JEA G;  2ID0 A;  3ONA B;  1PZK D;  4XQJ A;  1CQF A;  1SE2 A;  3VYS A;  3SDZ A;  5CC4 A;  4GZY C;  1ESF A;  3D4W A;  1F9S A;  2EYF A;  2O5J C;  1RD9 D;  1PFM A;  3D6W A;  3J7Y W;  5JEA J;  1H9J A;  5D14 A;  4DU9 A;  3MXG A;  5KEE A;  4PNY A;  1JC7 A;  1IW7 C;  2I46 A;  1C4Q A;  2NVQ B;  1D1I A;  1F9R A;  2FFK B;  2A73 B;  2G9D A;  4HAE A;  4A3I B;  3D4D A;  3HGB A;  1JOO A;  2K32 A;  2F3W A;  3F2U A;  2E2H B;  1OXV A;  3LNN A;  3J80 L;  1ILP A;  1PDQ A;  5EQ0 A;  3BZD B;  1FGB D;  1LTT D;  4ZKB B;  3HOZ B;  1KLU D;  2SOB A;  5EPJ A;  2N88 A;  1F77 A;  1BCP C;  1PFN A;  5KGU A;  3BYT B;  4A3G B;  3A8I E;  5KYI A;  2KUM A;  1B44 D;  4MHE A;  5FKA C;  2PW5 A;  4H13 C;  2OT2 A;  3SK4 A;  1BF4 A;  5C5M A;  1Y8N B;  2NTT A;  2IX3 A;  1HFG A;  4XT3 B;  3MZ5 A;  1H9S B;  1MSG A;  1NR4 A;  3W3A A;  1TS3 A;  3S9W A;  1ROD A;  2KJX A;  3OPO A;  1IYU A;  4BA2 I;  1EIG A;  5IGE A;  3P75 A;  3TME A;  5FO7 B;  3A56 A;  5LHY 1;  3I90 A;  1KNA A;  3MFG A;  3J81 E;  4ZRZ A;  1O7L A;  3OOC A;  2NVT B;  1STB A;  1BBX C;  1D2B A;  1MSH A;  5I6Y A;  3HEJ A;  1QNK A;  1CK1 A;  5CMD A;  1I4H A;  1T5E A;  2RDG A;  3J7A V;  4EQN A;  4KKS A;  2B2V C;  2AWN A;  2F0J A;  1SJH D;  1F9Q A;  1KDB A;  1JWU D;  3WOE A;  5DM6 3;  4H44 C;  3BDL A;  4L6T B;  4S3S A;  3HZX A;  3NE5 B;  2NUC A;  2WAQ B;  2M9V A;  1FNV A;  4TQU S;  2B2V A;  2B2Y A;  1XXG A;  4HSV A;  3VYR A;  5FO9 B;  4CKB A;  3K5O A;  2F0T A;  4KN7 C;  2MHV A;  1G2S A;  2OXP A;  3L9A X;  3H6M A;  3VR2 A;  1KLG D;  2Q8T A;  5K36 H;  1XTC D;  4PMW A;  1NUC A;  4BWG B;  4PQX A;  2B2U C;  1ENC A;  2F0P A;  1M8A A;  1Q1E A;  1KDA A;  3NXW A;  4CJ1 B;  4IAL A;  1JE4 A;  5IIF A;  2EPB A;  1SMY C;  1FD7 D;  2J7Z A;  1FYC A;  4UDU C;  2B2U A;  2XIW A;  1A2U A;  1U4L A;  5CGK A;  2J4X A;  1CHP D;  2OEO A;  2EVB A;  1D5X C;  4NDX A;  1W6J A;  2NYZ D;  2WKC A;  5I6W A;  1I4R A;  5C0X G;  3MWY W;  3D3R A;  2DN8 A;  3DWA A;  3K5N A;  1LTB D;  3SHL A;  3NUC A;  2O4X A;  3TDQ A;  1LT4 D;  4DAY A;  3G7L A;  4XDX A;  1B50 A;  2R92 B;  3NQT A;  1I4P A;  4HTH A;  2R6G A;  3CQZ B;  4OO1 H;  1CI3 M;  4RGO S;  4B9X A;  5C0X J;  1X3Q A;  1ZYR C;  1WTW A;  2YU9 B;  5C5L A;  1VF5 C;  1E0B A;  1YNN D;  3HRZ C;  4FF3 A;  2WV6 D;  2F0Q A;  2XNA C;  1UUP A;  1WTR A;  5E1F A;  2GA4 B;  2AUK A;  1PTO C;  1IHZ A;  1JWS D;  1MBY A;  1TWC B;  3OMC A;  3KLS X;  4YIJ A;  5E4W C;  1C48 A;  2F0O A;  3FRP B;  4IUN A;  1J9O A;  1B53 A;  4JK1 C;  3RD4 A;  2F3V A;  1BCP B;  4IUT A;  3PUY A;  3SEB A;  1GUS A;  3EVQ A;  2K04 A;  3PIP 3;  4CBV A;  3Q0A A;  1SYC A;  4DK0 A;  3PO3 B;  4DN4 M;  1U4M A;  1SNP A;  5IGF A;  3U9S A;  3P7J A;  5EPL A;  4K5W A;  3SK6 A;  2F1M A;  3PUW A;  2A68 C;  3HOU B;  1DOL A;  2O5I C;  1O80 A;  1IKM A;  1SYF A;  1VMP A;  4XTC S;  4L63 B;  4LJZ C;  1GHK A;  4C3I B;  1BO0 A;  3T53 B;  5M9O A;  1JOR A;  3Q22 A;  1RCV D;  1DM0 B;  1FR3 A;  1KNE A;  2QEJ C;  4K2L A;  3NHH A;  4QUC A;  4DAV A;  4DAP A;  5I2Y A;  4G4K A;  2XVS A;  4WFN 3;  4ULL A;  4C2M B;  1EY4 A;  3M7N A;  2EY1 A;  4CKE A;  2FHT A;  2FJ2 A;  2BDN A;  4XYQ A;  2A69 C;  2EJM A;  4EQP A;  3L7Z C;  5M3F B;  1LTG D;  1PTO H;  1CA5 A;  3N6R A;  3DWP A;  1MD2 D;  4A3F B;  1BR9 A;  4O42 A;  5FOB B;  1TWG B;  4OIJ A;  1F2L A;  3DM1 A;  5ELD A;  1WTV A;  1X32 A;  3S14 B;  3K59 A;  5CBA E;  1VMC A;  4FP5 D;  4RGT A;  1EEI D;  4X3U A;  4M8A A;  1I6H B;  5M5Y B;  2KOL A;  3NBH A;  1WD1 A;  4ZQ3 A;  2C5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...