2DNEA

Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
108
structure length
108
Chain Sequence
GSSGSSGQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
publication title Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
rcsb
source organism Homo sapiens
total genus 11
structure length 108
sequence length 108
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dneA00
3T51B 1H9KA 2A6EC 2IT1A 5BN3A 1K8MA 1Q1BA 4KKSA 3DXJC 3I4LA 1Y8PB 1HPCA 1TU2B 1GHKA 1B9MA 2A68D 5C0XH 1FYCA 3SE0A 1E2WA 2ZT9C 1BDOA 2AUKA 3VR3A 3FPPA 2B8GA 4TKOB 4KN7C 4KMUC 2A6HC 5BN5A 3GQBA 2QF7A 1DD2A 3OOCA 2R6GA 1LACA 4DK0A 2BE5C 1SMYC 2A6HD 3IKJA 2DNCA 4DNRB 3CRKC 2EJGC 1ZKOA 2BE5D 4XIGS 4G7HC 2AUJD 4H13C 2K32A 3PUYA 1CFMA 3WDNA 1VDZA 4TQUS 2LMCB 4GZYC 1Y8NB 2L5TA 2NN6G 3AB9A 3QG1A 3TZUA 1YNNC 5JEAH 1Y8OB 3A8KE 2D5DA 4KHZA 2K33A 3VR2A 3LNNA 4KI0A 1GJXA 3BDOA 3I73A 4HR7B 1O7LA 2A6ED 4BA1I 4LJZC 2AWOA 1H9SB 4KKUA 1VCIA 4BA2I 4H44C 3IFTA 1QJOA 2JEBI 1OXSC 4JBWA 1GUOA 3RLFA 3MXUA 1K8OA 1Z7TA 5KNCA 3P20A 1Q1EA 3D31A 2KA7A 2F1MA 1DXMA 2B8FA 3N6RA 4KN4C 3A8IE 3VR4A 1CI3M 3PUXA 4LK1C 2EVBA 2EJFC 4PV1C 1GHJA 1O78A 2JE6I 3BG3A 3M7NA 1A6XA 1OXTA 2BDOA 3FMCA 3PUVA 4RCNA 1E2ZA 1CTMA 2K7VA 4OO1H 4OGQC 2PNRC 2D2CC 2NN6H 3U9SA 1HQMC 2KCCA 3W3AA 1GUSA 3LWUA 2A69C 3ND9A 2O5JC 1V8QA 2Q8IB 2A69D 2CW0C 2EDGA 1G291 5C0XG 4DNTB 4XTCS 1H9SA 1VF5C 1EWHA 3D4RA 3PUZA 3EQLC 3T56B 2E75C 2DN8A 1VF7A 4G7ZC 2O5IC 5BN4A 1FR3A 3I72A 3M4YA 3NE5B 2JEAI 4H0LC 1IYUA 1H9JA 1Y69U 1GUTA 5K36G 1ZYRC 5A35A 1Z6HA 3A7LA 1Q90A 1H9RA 2E74C 4IFDG 1YNJC 5KNDA 3CRLC 4L8JA 1PMRA 3A7AB 5KNBA 3KLRA 1E2VA 3T53B 2PPBC 5JEAG 2PCFB 1ONLA 3OW7A 3PUWA 4DK1A 1B9NA 1T5EA 1OXUA 2A68C 3H94A 4G7OC 1I6VC 3SDZA 1LABA 1OXVA 3GD7A 3PV0A 4JK1C 3VR6A 1DCZA 3VA7A 2V4DA 1GUNA 3VR5A 1HTPA 3QIAA 2DNEA 1OXXK 2JXMB 3L7ZC 3MFYA 3HGBA 3OPOA 1IYVA 1Q12A 1TKWB 2NN6I 2D62A 1HCZA 3A8JE 4KKTA 3ND8A 3QJYA 1H9MA 2E76C 5K36H 1GUGA 2YYZA 4IQZA 4IFDH 1IW7C 4OO1G 2BA1A 3M85A 2BA0A 4I7ZC 1V43A 2EJMA 1IW7D
chains in the Genus database with same CATH superfamily
1G51A 3R8BA 1A3UA 4X6AH 4JV5Q 4RG1A 1CKNB 2NZOA 5IGFA 2NVTB 1PH1A 3DXJC 4FP5D 4A3GH 4V190 3CKIB 2JA9A 2VUMG 4XXEA 4GLXA 2K50A 4DV6Q 4DKAC 1YNXA 5ISRA 2I0QA 1Z9FA 2L4NA 1T5XD 1CK1A 4IJLA 3AQQA 1PLFA 3J7AF 1J5EL 3UE0A 3RLOA 1V1PA 2K32A 2FINB 5L37A 1U0LA 1SBBB 3HOVH 1LV9A 3TZUA 1EY7A 4OWWB 2K33A 4LNQA 1LTBD 2IHEA 4BA2I 3J81j 1HA6A 5FJ8G 3NQIA 4KN4C 1D1IA 5BR8L 5I9OA 1MGSA 1M90C 1LTLA 3GTGH 1LLRD 1XTCD 1XNRQ 1JOOA 1PXUA 2D2CC 2NN6H 4KHPL 4DR7L 5M3FB 1DOMA 1WTQA 3HOZG 3GTGB 2QEXA 4PZ8A 1U4MA 3EN2A 4TSSA 5LMNL 1I50H 4G7ZC 4DR2Q 1STGA 4K6LA 1H9JA 1LYLA 4LF8Q 1GUTA 5A35A 4C3HG 1H9RA 3A7AB 1I50B 2F0HA 2UUBQ 1I4XA 1XPRA 4A3DG 2IW3A 1EFWA 4RHSA 1IBLQ 4ILWA 3ONAB 4LF5L 1B8AA 1I6HH 2CWAA 3OMGA 3VYTA 1F2MA 4K2LA 3WOEA 4X65L 2IX0A 3E9IA 3IRBA 2WACA 1SE4A 5DEHA 2M2LA 1STYA 1JWUD 3MEHA 1Y1VG 5DAUA 4IQZA 4NPSA 3ERSX 1S72A 5IP7H 4DR5L 2IL8A 1BUVT 4U673 2MO1A 5IGCA 5M3MH 3D0FA 1SNQA 2OCEA 1B3QA 3D6WA 3HOYH 1KAWA 3PO3G 2ZJPA 1I94Q 5C5MA 1QWYA 4TKOB 3DHQA 1HNWQ 4FNFA 2R93G 1YHAA 2L1BA 1W3SA 1AEXA 3K6OA 4RHRA 1WTHA 5M3MB 1AN8A 3HOYB 3S14H 1NJIC 2K5QA 5FLXL 4LW1A 3X3MA 3VYSA 4B3MQ 4DV2L 4JW0A 2KCMA 4P2CB 4IUQA 4BA1I 4BY1H 2PI2A 3S14B 1CQVA 1WI5A 1C48A 2WKCA 2QCPX 4H44C 2IPKD 1DXMA 3A56A 2MQHA 1EFID 3CHBD 3MXNA 3K57A 4JYAQ 4BY1B 1TS5A 3FVQA 4EQNA 3M7NA 5EKIA 4DV0Q 1B3AA 4R4OA 4ZAIA 2HQLA 3J7A5 1F77A 2ID0A 2B2YC 4A4IA 3SK8A 2O2LD 1QNUA 1VQ8A 1IBKQ 2JA8G 2N88A 2XNAC 2OTLA 1AW7A 4A3IB 4JI5L 2F0UA 5ELEA 1KNEA 3D4RA 3T56B 2FFKB 2I5LX 1DJRD 5EKKA 3J81E 4HEDA 3R2TA 4J1MA 3ZJYC 5C5LA 2DY8A 2PPBC 1E22A 5CBAE 5JVH3 3D3RA 1C8CA 5COYA 2PYKA 2CH4A 4X62Q 4AYBG 1TWHH 3F8TA 1R4QB 3P1HA 1S5DD 1SNOA 5IGBA 2NZHA 3I7FA 1WTRA 4OIKA 2DNEA 3L7ZC 3PO2H 1IYVA 1S5CD 2KVMA 1TWHB 3Q24A 2WIIB 2LS01 1SYBA 4FXKC 1PYWD 1IW7C 1WJJA 1Y1WH 2CVRA 1BBWA 5CV4A 1RDPD 1S5ED 1YNJD 1BCPD 2AWNA 2JA7G 2AQ3B 2UUCQ 5M5YB 1Y8PB 4C3IG 3STBD 1PH3A 4OX9L 1B9MA 4JI0L 2NWGA 2A68D 3K81C 3NUCA 4YY3L 3TREA 1E2WA 2Q8TA 4ZK9B 4RFBA 4QUFA 3M3YH 2EZVA 3OOCA 4HJAA 3EROA 2DNCA 2EY1A 2EJGC 4ODGA 5M5WH 3BYTB 3PGZA 5IP9H 4B3SQ 4A3BG 1GD7A 3K58A 3M3YB 3B6YA 5DM63 4BBRG 4CBVA 3S1RB 3HOUB 4DV6L 5M5WB 4K0KQ 1WVLA 5IGGA 1EYCA 5IT9E 1E1TA 4A3EG 3KJPA 3LX0A 2BOSA 1OXSC 2E2JB 1HTLD 2EQSA 1X56A 3UE1A 3N6RA 1U4PA 1QOHA 5CV6A 2F0PA 1L0XB 3V05A 1SMYD 3PUVA 4DXGA 1AZPA 4HSPA 4A3CG 3P7JA 5E7NA 2FXQA 2Z9HA 1SFOH 4NKLA 2E2IH 4CJ0B 2A19A 2YU9H 2A69D 3QR8A 4BXXG 4KD4A 1DONA 1WFQA 3QOJA 4PMBA 2EYMA 4RGNA 1P8LA 1FR3A 1SFOB 1XNRL 1TWAH 2IHFA 1EU4A 2KCTA 2E2IB 5C4JH 5I6YA 3BZCA 1PRTF 1WOCA 2TSSA 4L5QA 1PA6A 3MHBA 1KD1C 1RKNA 3H0GG 4JOIA 2XVSA 4F7XA 1TWAB 1PDQA 4DFAA 5C4JB 4RCOA 1S5FD 4IPHA 4DR2L 2F3VA 4KD3A 1LTSD 1MSGA 1Q8IA 5C44H 2F4IA 4LF8L 3QOLA 1ENFA 1AE3A 4DV3Q 1L0WA 1F2ZA 2C9OA 1TKWB 2J0TD 4YIJA 3I8ZA 5EGTA 2UUBL 1JORA 5CR3A 4DV1Q 2XRQD 3AEVA 1IBLL 1VQ9A 3NBHA 5C44B 3M85A 2O4XA 4IPDA 2EYFA 3GTMB 1H9KA 1NUCA 2BH2A 2Q2HA 3M7GA 2RDGA 2KEDA 1WCMG 5GAGC 3VR3A 1CQFA 3T1YQ 1MJCA 1HZ9A 1VQMA 1QVGA 2ZTEA 1IXRA 4GN4B 4A3KG 2R7ZH 4TQUS 4GZYC 2XIWA 3L0OA 3I4MH 3KDFB 4IPGA 3T16A 1PH8A 4MIUA 4R8NA 3RMHA 2A74C 2E8GA 3K5MA 1I94L 2Z4IA 2SDFA 1XJVA 1HNWL 4C2MH 1MKHA 4IUNA 1H9SB 2R7ZB 4DAVA 1QJOA 2KQ3A 3UDFA 1HR0Q 5IIFA 2A5HA 3I4MB 1Q1EA 3BDLA 5D14A 3S15B 4N8X1 4P73A 3DM1A 4BBSG 1FJGQ 4K5XA 4PG3A 4C2MB 1W6JA 3BZDB 1OXTA 1RTNA 2KENA 3H3VC 3BZKA 4GOPC 4DR3Q 1EZ8A 3TRZA 1C7YA 2WAQB 2R92G 2VQFQ 1BNZA 4IPCA 1TS4A 1IL8A 3J80c 2ZXRA 4JYAL 1IKMA 4DV0L 1MJEA 5BN4A 2RHQB 5C3EH 4N9PA 4RGMA 4IUTA 4DF7A 3GTPB 4GNXB 2PQAA 3I91A 2WAQE 2F0OA 1JOQA 3H09A 1YNJC 2JYOA 1BCPC 1XTDA 3SXHA 1IBKL 1XX8A 2F0MA 1WTPA 3OW7A 3STBC 5C3EB 4UHVA 2A68C 4G7OC 5M5XH 1OXVA 1ICWA 3TS2A 2DUDA 1RD9D 5FOBB 5FLXE 3BJUA 1CA5A 4FF2A 3DEOA 1BBXC 4O0AA 3NBIA 2VY3A 2F0LA 1ASZA 1HXYD 4Q5VA 1ESFA 5M5XB 3FPUB 1QNKA 1X55A 2R3ZA 4I7AA 3HS0C 4X62L 4QGUA 1Q81C 2ATWA 3J80i 1EYDA 5J39A 1HNXQ 2AQ1B 4B9XA 3H6MA 2XWBB 2EXZA 1HA5A 4EQ5A 2PQEA 3GTKH 1JWMD 1PFNA 5IGEA 1BDOA 1EU3A 3QWNA 4RGTA 1K9MC 2SEBD 3W5OA 1SMYC 1KXLA 2MP1A 2WB1G 1A2TA 3GTKB 4EQOA 3HOWB 2UUCL 1EY5A 1UE7A 1NSNS 1PH4A 3NEMA 1QG7A 3LNNA 3BDOA 1FGUA 4XYQA 4KKUA 3NP8A 2VUMH 4HIKA 1PH2A 4HCSA 1C9OA 4K2KA 1NNXA 2B2VC 1GUOA 3S2HH 3MXUA 1EQVA 4APVA 3AYHB 4CGYB 3L2PA 4B3SL 1A3TA 1RJTA 2F3IA 4LK1C 1VQDA 2KECA 4C1NK 4X3KA 3CU7A 1MHWC 5J3BA 1E2ZA 1CTMA 2L11A 3MZ5A 1EYGA 4K0KL 1SNPA 1G6PA 3SK4A 1L2FA 4C3JB 3ND9A 2O5JC 2JJQA 2EYJA 4V0BA 4JBKA 3NTKA 5K5PA 4QQBX 4DNTB 3CQZB 5FJ8H 3J7AV 4M1UB 3M4YA 3TS0A 3K8AA 4OL7A 3S9WA 4XT1B 1SJHD 1ZYRD 5A2QL 3I2ZA 5G3LF 4R9WA 3PMFA 1CZWA 1PYBA 2B2UA 1SN8A 1HRJA 4JI2Q 3HOZH 1BF4A 2E5LQ 2NYZD 3MC0B 3KYHC 1JB3A 1KHIA 2CW0D 4JI6Q 2PNHA 1HUNA 5EBDA 3S16H 4ZUIA 3A8JE 1LTTD 2E76C 1V1PB 4DR4Q 1HZAA 2K5HA 2LY7A 2MHVA 2VS1A 4UP7A 4YWLA 2X6GA 3NWSA 3S16B 2F0SA 1L1OA 2I07B 3I4LA 1HPCA 1IL2A 4OONA 2Z0SA 1JWSD 4DV3L 3VYRA 2RSNA 1K83H 1FYCA 2F0IA 3SE0A 4AQYQ 1VQKA 4DV1L 2A6HC 5JOBA 2R6GA 4B3TQ 5CBEE 4XQNA 4UY8C 3W2DA 4PNYA 4P72A 4WJ3M 2NZ1D 1Y1VH 5IYCH 4HMIA 3IL8A 4RA8A 4R4TA 3CD6A 3HG9A 2RDFA 3HOXH 1I4HA 4O2DA 3CC2A 5KRUA 3K7AH 2MPMA 3RUZA 3T1YL 2F4VQ 2AWOA 2HUGA 4WRDA 1F9PA 3HKZG 3SGIA 3PO3H 3OWEB 2NUCA 5CV8A 4G57A 4PZ7A 3K59A 1EQRA 2TMPA 4A3JH 3CPWA 3HOXB 1PTOF 1CI3M 3K7AB 3GTJH 3S1QH 2LKVA 2EJFC 4K8JA 1O78A 3BG3A 4A3GB 1UE5A 2B29A 2L55A 2L15A 5D3DA 5F2DA 2DGYA 2PNRC 3U9SA 3SEBA 3W3AA 4A3JB 1K8GA 5C0XI 3GTJB 3S1QB 1HR0L 3FKIH 1KQSA 4JPBW 5GAEC 4IJHA 1TWCH 1HQRD 3TBIB 3KF6A 3OIQA 5I4DA 5KYLA 1UAPA 5JVG3 1FJGL 2F0FA 3HOVB 1EY9A 1TIID 4X66Q 1PFSA 1B1ZA 4Z9CB 2QGQA 2EY2A 3FKIB 1VQHA 4XQJA 5IWAQ 4DR3L 4KY7A 4BY7G 1UE6A 2B63H 1QUQA 1PZJD 4QY7A 2VQFL 4F87A 4I65A 4UAIA 4HIOA 3H94A 4QJFA 5E4XA 4EGVA 3SDZA 1HHVA 2B63B 3D4WA 3VA7A 2AQ2B 2OWOA 1F2YA 1SMXA 3A0JA 4FXDA 3S24A 5ELBA 3OPOA 1DM0B 2F0TA 1HCZA 4YCWA 2OTJA 2JA6G 4NW2A 1CKMA 3DWPA 1TWGH 5J1ZA 2IT1A 1GM5A 4JCVE 4OHJA 3H15A 2EXDA 1QZGA 1YI2A 3OMCA 5C0XH 1TWGB 2Q2UA 1LTRD 2BE5C 3H91A 3MXNB 1CT1D 3TQYA 1I5FA 1IKLA 2PI2E 1UNSA 1HNXL 1WD1A 2RKSA 1I6HB 4DU9A 3AB9A 3I56A 1Y8OB 3I4NG 2OQ0A 1ICFB 4N8FA 3TSSA 4C3IH 4A3MG 2HIXA 4JBWA 1YITA 3RZOH 1M1KC 1UUPA 1CZGA 4LMQD 4LF9Q 2Z6KC 2F0JA 4RH6A 1GHJA 3SR1A 2JE6I 4A76A 3J80L 3FHWA 3CMEA 1STNA 1XMQQ 4A3BH 3RZOB 1JB7A 1X9NA 1HQMC 4LF6Q 4BBRH 3BU2A 1AE2A 1EY6A 4CDDC 4EQPA 1JJCB 2WV6D 1SYDA 1PH7A 1KC8C 2EDGA 2CW0C 2CH4W 1GVPA 1LTAD 2RQXA 2Q2IA 2OF1A 4MNOA 2ZXPA 2J4XA 1STBA 1ET6A 3NE5B 4IN3A 5CC4A 1PV4A 2HD3A 5ELCA 1VQOA 5D65A 5G3LD 1VQFA 4HCEA 4NP5A 2K05A 1K73C 3PF4A 1T5EA 3E0EA 2R61A 2RCNA 1B2TA 4DV5Q 4POFA 4BXXH 2HDLA 4JI8Q 2RHSB 4MN3A 5FLMG 5M3FG 3CCUA 2UUAQ 3GDEA 2NBFA 4HAEA 4OO1I 5E3FA 4CJ1B 3SHLA 5C4XH 3J81c 3KF8A 1ENCA 1H9MA 1SSOA 4LFCQ 2GVAA 2PW5A 1RTOA 3F2UA 3GV6A 4WFN3 4JI2L 3T51B 4PMCA 5BN3A 3H0GH 1JR0D 2HIVA 5IYBG 1PFMA 5C4XB 5ELFA 4JI6L 4JI7Q 3RD4A 3NK9A 3CC4A 1YHBA 2A73B 1MI2A 5ELDA 2ENBA 1BVSA 2MFIA 3RLNA 4DK6C 3R3OA 2BDNA 3GQBA 4DR4L 2F52A 1JMCA 2HHHQ 4H13C 3QB3A 5HGQA 3GTOH 3PO2B 4FF3A 3VR2A 1YNND 4AQYL 4HJ8A 2N49A 4GLAC 5EJWA 3I70A 4IZ8A 1WCMH 1Y1WB 1PTOD 5KNCA 5A2QE 3GTOB 4B9WA 1FNUA 1TT2A 1PYSB 3LWEA 3EFXD 2F0EA 3SK6A 5I2YA 4A3KH 4RCNA 4JV5L 1CSQA 3PIPA 4H7BA 4L5SA 5JAVA 4OO1H 5IP7G 5CV9A 4Y52H 1XXGA 4FF1A 1X3QA 2F4VL 5AJ3Q 2A8VA 4LWCA 5M3MG 2KEEA 2Q8IB 3HOYG 4DV7Q 1NTGA 2Q8RE 1G291 4B3RQ 2K5VA 4XTCS 5IT9c 3CMAA 4GNXC 4K6DA 4A3LH 1RODA 1D6EC 3MWYW 2VL6A 1I4GA 1SE8A 1KABA 1LTID 4BBSH 5K36G 4ZCKA 3A7LA 1QCBD 1PRTB 3NBHB 1U9RA 2JA5H 1F2LA 2EY6A 2L0CA 5T1IA 1B9NA 4NXMQ 1VQ5A 4E6IA 4BY1G 1FGBD 1DOKA 4DAYA 3EIVA 2XN9C 4JK1C 4X66L 4ZKCB 3E6ZX 2JA5B 2V4DA 4JBMA 5C0XJ 3VR5A 5IWAL 4Y7NH 2JXMB 4A3FH 1JT8A 4ULLA 4GKJQ 3HGBA 1VMCA 2CHBD 5DM73 3BS1A 2YU9B 4A3IG 1ASYA 5E1FA 4DGZA 4JI1Q 1YJNA 2N55A 1HNZQ 1S40A 4Y7NB 2E2HH 1PFBA 4A3FB 2ZJQA 2L12A 3TP8A 1I4QA 1K8MA 1WTXA 3NQTA 1TU2B 2H4OA 1HR0W 5C6AA 1G91A 5ELNA 2QILA 1E3PA 1SDFA 4XDXA 2ZT9C 2AUKA 2E2HB 4KMUC 1XYIA 4ABNA 1RF2D 3AMUA 3S1MH 3OIPA 3IKJA 3KK7A 5I9PA 3FEWX 3KUPA 4KJNA 1LTGD 2LMCB 1VQCA 4RWSC 1VQ6A 5JEAH 3PQIA 1UEBA 2MGSA 4LAAA 4DAMA 4NMZA 1X3GA 3X3NA 4OXPA 4GKKQ 1GOZA 3CCLA 4NXNQ 3S1NH 3NPPA 1Z7TA 1XPOA 2K6AA 3E9HA 2B8FA 3VA5A 4XT3B 1GUWA 2PQAB 1C0AA 3NSWA 2ZXOA 1A6XA 3KJOA 3C46A 2UXCQ 2AMCB 2RVLA 4OEMB 4OGQC 2LXJA 1LT4D 4UPAA 4A93H 3AFQA 4LF9L 3U4VA 4QMGA 3PUZA 3HOUG 1STAA 5HGTA 2CWPA 4A93B 4YCUA 2F0GA 2FHTA 1A3VA 4LF6L 4B3ML 4IFDG 1IHZA 1N32Q 5EPKA 1CHPD 3W1BA 1TY2A 4JG2A 2PZWA 4LFAQ 1KDAA 1BOSA 1LABA 3BVZA 1AH9A 3GTQH 3KOJA 3EBEA 2B2YA 1Q82C 1QB5D 1EWCA 4GN5A 1E1OA 4ME3A 3CCQA 2EY5A 4FVMA 1ILPA 2C5CA 5IYDG 4LUZA 3BDCA 5BR8Q 4P71A 4JC0A 1SYGA 3VDYA 2FMCA 2WKDA 2MO0A 4K5VA 4M8AA 4DV5L 4DR1Q 1AZQA 2UU9Q 2AKWB 1ESRA 3V96A 1D8LA 4R1JA 4JI8L 2WFWA 4PMWA 1O7YA 2UUAL 3J80E 1GXDC 1XMOQ 2Y0SB 1Q3LA 1B44D 4LFCL 1RCVD 3OYYA 2QDBA 2KBNA 3MFGA 5LMNQ 5JPNC 1EQTA 2K5DA 3NELA 4HJ5A 4DNIA 3IFDA 4JI3Q 2Q2TA 3ULPA 4JI7L 1S4ZA 2Y0SE 2D5DA 3G6EA 4KHZA 1YZ6A 4KI0A 3UDIA 1GJXA 4HR7B 2EYLA 3D4DA 2A6ED 4NDXA 5C3XA 4J6HA 5C44G 4OELB 2LSSA 2HHHL 3K80C 1M8AA 1QE6A 1CA6A 3PCOB 2VZAA 4WORA 3GTLH 2WP8J 4R8IA 5IY0A 1F9QA 2A69C 3MTSA 4DR5Q 1O7ZA 3RN2A 1EY0A 1V1OA 2D9UA 1UE1A 3E0JA 3EQLC 4X3TA 1X3FA 5CYUA 1EYAA 2E75C 4G4KA 2K4KA 1DZ1A 4MZ9A 2R7ZG 4DN4M 2E74C 5AJ3L 5KNDA 5KNBA 2H5XA 2VUMB 2UXBQ 1E2VA 2K04A 2Z8LA 3T53B 3I4MG 3S2HB 4DV7L 5HURA 2F0DA 4DK1A 4POGA 4B3RL 5KEEA 1L1OB 1U4LA 1VS0A 1JICA 3JAMc 3L3OC 2EPBA 4LUOA 1SNMA 2PZTA 2WAQG 2HCIA 5E4WC 2D0OA 4H02A 1KRSA 1PRTD 5EPJA 3RZDH 3GO5A 3F2CA 4X3UA 4ZKBB 2I5MX 4BY7H 1EWIA 3CF5A 1A63A 2GVBA 4NXML 2BA0A 2SOBA 3OWFA 1E7ZA 1KTKA 1SJED 5JEAJ 1TQOA 3NHHA 3RZDB 3PF5A 4DUYQ 4RKBA 1U4RA 4GKJL 3G4SA 3J7ZC 2VQEQ 4IUUA 4KN7C 4DK3C 5C3EG 1DD2A 4JI1L 3S17H 1HNZL 2K5WA 2PZUA 3HOZB 1LT5D 4X64Q 2JA6H 3PIO3 1VDZA 1II3A 4AH6A 4C3HH 3HP3A 3HEJA 3JAMi 1K0SA 4A3DH 1PTOH 2KOLA 3ERQA 4UDUC 3KF6B 4C3HB 4FO2A 5LL6S 4OWXB 2JN4A 2Z1CA 1K8OA 3NTIA 3P20A 4P74A 2KA7A 4A3DB 1EY4A 1SE3A 1VQBA 4K5WA 3A8IE 2PMZE 1N36Q 1PTOB 3CXCA 1G2TA 5T1GA 3WOFA 1QUQB 2OT2A 2BDOA 4BWGB 5FO7B 5CMDA 1K83B 2D0PA 3HFZB 1A2UA 4RMFA 1ENAA 2IX3A 1VQNA 1X54A 3LWUA 3I4NH 1B4OA 4GKKL 3E3XA 1NR4A 1VQ7A 1KDBA 1I4RA 3NENA 3HOWG 1Y1VB 4YHHQ 1QVFA 1VQEA 4OX9Q 1GO3E 3OHXC 4JI0Q 4FYDA 2UXCL 2K75A 2NVTH 4J8QA 2R93H 1WTOA 3U9OA 1IYUA 2B2TA 2ES2A 1Y69U 4GS3A 2XTIA 1MD2D 4CDCC 1MIUA 1KL9A 4IO9A 4LUVA 5GQOA 3V2TA 3PO3B 3I55A 1JJ2A 2R93B 1S5BD 1BCPF 1JQYD 3K5LA 1DYQA 3ITPA 3PV0A 2ZTDA 2K14A 3D8GA 1WTVA 1WD0A 4GOPA 4O1NA 4UP9A 1AP0A 4QF4A 1VQ4A 5EKLA 1D2BA 4KY5A 4MTNA 1SE2A 2ZTCA 4C3JG 3MFYA 5IGDA 1N32L 2DJGC 1NR2A 3N52A 3Q8DA 3ND8A 1IBMQ 1GUGA 5FO8B 1B53A 1TWCB 3T4AC 4LFAL 1V43A 2F0WA 5D3IB 3CCVA 1IW7D 1K8AC 4F88A 3A74A 5H1SE 2A6EC 2RSOA 5JJZA 2RCFA 2JA8H 2HT1A 2EYOA 1EEID 1LM0A 4NB3A 3U50C 2CCZA 1A8VA 3M9BA 1KDCA 5FLMH 3I4OA 3I3CA 5M3FH 2DY7A 1LACA 2QEJC 4ME5A 3P75A 5GAHC 2JA8B 4EX5A 1R9TH 4DR1L 2UU9L 2XGTA 5LL6X 2ASBA 3WDNA 3QO2A 2YV5A 1BQQT 4WJ4A 2K01A 2L5TA 5FO9B 3IAYA 1CKNA 1JOKA 3DLLA 1N9WA 1XMOL 2DJFC 5IYBH 3U58A 1R9TB 3D6CA 1SYFA 1HJPA 3KLSA 2KJXA 3IFTA 1QILA 1LO5D 2QA4A 1STHA 3RLFA 3EVQA 2F1MA 5DNFA 1A0IA 4O42A 1Q8KA 1VQAA 1B50A 4JI3L 4AYBB 4PV1C 4QIWB 4JOIC 3MEFA 4ID6A 4RAUC 2OXPA 3TEHB 3DEPA 5EQ0A 3FDTA 4DV4Q 4HTHA 4CDFC 3Q23A 2R7FA 2JA7H 1B7YB 1V8QA 2F0NA 2K03A 3MA2B 4PQXA 3CP0A 2NB0A 4AYBE 4QIWE 4IUVA 1PRTC 2X6LA 4RGOS 2O5IC 2JA7B 3R93A 3I72A 3NXWA 4H0LC 2KCNA 3KF8B 1VQGA 1EIHA 1ZYRC 2B2VA 4C3IB 5IYCG 1E0BA 5C4HA 1ONLA 3HOXG 2KHJA 2IWHA 4OIJA 1YVCA 1PH5A 1N34Q 4A3GG 1I6VC 2NVYH 3VR6A 3J7YW 4LF7Q 2KHIA 4JVZA 2F0KA 1HZCA 2M00A 4A3BB 1SYEA 4A3EH 4GN3B 1WTWA 1HTPA 4A3JG 1ZXTA 4MTKA 4BBRB 1X6OA 3CCRA 1SROA 1IYJB 2UXBL 4YCVA 2OQKA 2NVYB 3JC66 4N9TA 5K36H 2B2WA 4CHTB 5IE8A 3F2BA 1LT6D 2BA1A 2B39A 4A3EB 3HOVG 4I7ZC 4KK7A 3OTOQ 3AFPA 1V9PA 4A3CH 5LHY1 1TVXA 3FKIG 3A54A 2YTVA 3ICEA 1JE5A 2P5ZX 3KLSX 1C4QA 1GHKA 1MSHA 1TWFH 2NTSA 3A5ZB 1ET9A 1WYDA 4ALPA 4KHVA 3NWTA 3VYUA 4HJ7A 3TP7A 2B8GA 3Q6SA 4KJOA 4CDEC 3BVGA 1XNQQ 2LFNA 1STEA 4DK0A 1N33Q 1JJGA 2B63G 1K3RA 4AIMA 4A3IH 1TWFB 1KRTA 1FVIA 2QW7A 4L63B 2MUYA 3C2PA 2NN6G 3BYYB 4DUYL 1SR3A 3KLWA 1KLGD 3A8KE 1TS2A 2E5LL 4CJ2C 2VQEL 1R4PB 3I73A 1SLJA 4LJZC 1VCIA 1UEAB 2JEBI 1CHQD 3OSOA 3DMUA 3K5OA 1NMFA 2SNSA 4IFDI 1Q86C 4X64L 5KIXA 4DXFA 3H0GB 3PUXA 2FJ2A 1FL0A 4F8MA 1EQQA 2ALYB 1A62A 3FMCA 5IODA 2K28A 1Q7YC 3TZDA 2A1AA 3CCEA 3LGJA 2G9HD 3EA6A 2HCCA 3FRPB 3T1HQ 1GUSA 2G9DA 4DAYB 2ZM6Q 5C0XG 2L9HA 1SNDA 4KV6A 3J81i 1VF5C 1N36L 4B3TL 4JI4Q 4IURA 4L5RC 5I6WA 1L0YB 3O13A 5M5YH 3HKSA 3M4PA 2K52A 3JAML 1Z47A 3CRLC 3M4QA 3KLRA 1WCMB 2N78A 1D5XC 2CQAA 3KFUA 1LT3D 3TN2A 4LF4Q 2IX1A 1D7QA 3CCJA 4DR6Q 4YHHL 2XRSD 1J6QA 1OXUA 1BXTA 1CSPA 1XWEA 3OW2A 1U5KA 3FP9A 1G6ZA 1DCZA 3HRZC 4A3KB 1NY4A 1YJ9A 4IOAA 1GUNA 3EJIA 1QZHA 5AFWA 1TR5A 3S1RH 1EUJA 1AFPA 1JC7A 2QKIC 4WJWA 3HOUH 2D62A 3G7LA 2I46A 3QJYA 2VXWA 1X3EA 2YYZA 4IFDH 3S2DH 2E2JH 1EIFA 4MHEA 2F0VA 5DLQE 3C1EA 1VQLA 1BBUA 4R4QA 3KBXA 2B3GA 3ULLA 3BVMA 2R92H 4BBSB 5J22A 3DWAA 1J8IA 3S2DB 2YTYA 1SNCA 3NTHA 2CFMA 5BN5A 4FF4A 4R4CA 1IBML 3CAMA 2QF7A 2M9VA 4LFBQ 2I5HA 1NAPA 1NMGA 1EEFD 4J15A 2R92B 4XIGS 5IYDH 2LXKA 3PUYA 4HIMA 1SYCA 2C35B 1OTCA 3UDXA 2AHOB 4RKLA 2HQEA 3MAQA 3UI2A 2CKZB 4BS9A 1A15A 4ZLTF 1FNWA 1O7LA 3SVMA 1VMPA 4FDBA 4CKEA 2MNAA 1TXYA 2OEOA 4Q0FA 3TMEA 3C3LA 2VNUD 2H1EA 1EZ6A 4HIDA 5C4XG 3GP7A 5CGKA 2BCOA 2B2UC 2RBMA 4QCLA 3CW2C 2F03A 3A5UA 1EIYB 4YWMA 2YTXA 2N8NA 5GROA 1VQJA 3S1MB 4C1NI 1FNVA 5IOCA 5LMUQ 4B08A 5KGUA 3GTMH 1YJWA 2DN8A 1VF7A 3PO2G 2GA4B 2K1BA 4DV4L 1L1OC 3K0YA 1Y1WG 5EPLA 4JBJA 2EOTA 1E24A 1M4VA 2PCFB 2Z6KA 5GADC 3S1NB 5CV5A 1KLUD 2UXDQ 1VQIA 3ULJA 4DUZQ 3CCMA 1CM9A 2PW7A 5TSSA 3M4OH 5JPMC 2WB1B 1O80A 3DUZA 5LMNW 2ICEC 4CKBA 1N8RC 1RHPA 1Q12A 1QVCA 1XMQL 1F9RA 5EBCA 3M4OB 4KKTA 1KAAA 5IP9G 1YHQA 1KIXA 4OO1G 1UWVA 4UP8A 2WB1E 1N34L 1BR9A 1J5EQ 4LF7L 3K0XA 3S15H 3AU7A 4XYOA 4DAPA 2KUMA 5ELOA 4A3LG 4P75A 2B2TC 2HDMA 4XQQA 4IUPA 1D5MC 4TVAB 3FPPA 2J7ZA 1ILQA 2RF4A 1GKHA 2JP1A 3PSIA 1EOTA 1DGSA 2A6HD 1W6KA 3R2IA 5JJLA 3OTOL 1T9HA 2JA5G 3TP6A 4G7HC 2AUJD 3GTQB 4GLVB 3PIOA 1CFMA 3PIP3 4S3SA 4TRDA 1YNNC 1EOVA 2JK8A 1HUMA 4QL5A 3GTPH 2EYPA 5FKAC 1EL0A 4X3SA 3F1ZA 4DA2A 4YWKA 2VW9A 4DR7Q 4KHPQ 4C56C 1XNQL 1PTOC 2ZJRA 1N33L 4CKCA 3E5SA 5C3WA 2WINB 4A3FG 4HSVA 4IALA 1BO0A 2G5DA 3D31A 3HZXA 5FLXc 4A75A 4R4IA 4ZYSA 3W1GA 1HZBA 3ER0A 5FK9C 4KY6A 1SXTA 2Z6BA 2K7VA 1RL2A 3K5NA 1JE4A 3KDFA 2F0QA 2Z4HA 5CV7A 2V1CC 1J9OA 2EYHA 1H9SA 5M9OA 5C4ZA 3MVVA 4HN7A 2ICIA 1V1QA 1X65A 4LF5Q 3WWVA 3G6JB 5EAYA 4X65Q 1Z6HA 3TDQA 3T1HL 3U4ZA 4IFDJ 1NCVA 5JEAG 2ZM6L 1S3OA 1X32A 1PH9A 5KYIA 4ZQ3A 1HFNA 3CPFA 4HJ9A 3C1FA 5JJKA 3T13A 4JI4L 1K28A 3GD7A 2EIFA 3HOWH 1G2SA 3H3VI 2IY5B 2NTTA 1Q46A 2NVQH 5CORA 3GTLB 1OXXK 2PO4A 1FD7D 3GV3A 1SEBD 3CCSA 3RR5A 4GNXA 1PVOA 4OWTB 3DWQA 1PH6A 4LF4L 1I3QH 1YEZA 4DR6L 1B70B 1YIJA 3Q0AA 3KBGA 2NVQB 3Q22A 3HKZB 2EJMA 2R7DA 3RNUA 1IZ6A 2FMMA 1D5ZC 3RN5A 4A93G 2VB2X 1EY8A 1Q1BA 3J81L 4KKSA 2CQOA 2JSOA 4DV2Q 1I3QB 3ZYYX 1H95A 1MBYA 1ML0D 2K5NA 1I4PA 3DM3A 1LUZA 3HKZE 1X3PA 1CKOA 3TP5A 4C3JH 4DNRB 3CRKC 1ZKOA 2BE5D 4KTAA 4U68A 5I2XA 4ZRZA 1PHJA 1NBWA 2VB3X 3URYA 1HFGA 3CQZH 1Y8NB 4PZ6A 1TY0A 3QG1A 4L6TB 5HY6A 2KHSA 2EE1A 1OO9B 4DPGA 4HMJA 1P16A 3JAME 4LFBL 4BY7B 2GN5A 2B2WC 3G71A 1YBYA 1RIPA 2XSCA 4K8IA 3A55A 5JJIA 2MJ8A 4IOCA 3MXPA 3SK5A 4JI5Q 3VR4A 1DOLA 1G8ZD 2EVBA 1TS3A 2IJ0A 1PZID 4KLKA 3H3VH 1F9SA 3K7UC 2E2DC 2Y0SG 3CC7A 1K0RA 4QUCA 2N3SA 2KCCA 1BKBA 2PMZB 1W2BA 3F2DA 3S17B 1Y14B 2JQOA 2RA4A 4GOPB 2JA6B 1EWHA 1NE3A 1D1KA 3MXGA 3I90A 2QDLA 5NUCA 2JEAI 2F3WA 3UDGA 1XPUA 5IT9L 1Q90A 1EIGA 4L8JA 1PMRA 4K14A 1CUKA 1SAPA 4EVOA 1VQPA 2XWJB 2RDHA 3PUWA 4FXGC 2NVXH 3G48A 4QB4A 1BCPB 5LMUL 1K3BC 4NXNL 1PZKD 4A3MH 1ZEQX 1SRUA 4L5TA 1O7IA 3QIAA 2NVXB 4YY3Q 3L9AX 3I4NB 1JCKB 2NN6I 2BH8A 2SNMA 2X69A 4ZUJA 2UXDL 4A3MB 1HH2P 4DUZL 1KNAA
chains in the Genus database with same CATH topology
3R8BA 1A3UA 2NVTB 5IGFA 3DXJC 4FP5D 4V190 3CKIB 4XXEA 5ISRA 2L4NA 1T5XD 1CK1A 1PLFA 3J7AF 1V1PA 2K32A 2FINB 1SBBB 1LV9A 3TZUA 1EY7A 2K33A 1LTBD 4BA2I 1HA6A 3NQIA 4KN4C 1D1IA 5I9OA 1MGSA 1LLRD 1XTCD 1JOOA 1PXUA 2D2CC 2NN6H 5M3FB 1DOMA 1WTQA 3GTGB 1U4MA 4TSSA 4G7ZC 1STGA 4K6LA 1H9JA 1GUTA 5A35A 4C3HG 1H9RA 3A7AB 1I50B 2F0HA 1I4XA 2IW3A 4RHSA 4ILWA 3ONAB 3OMGA 3VYTA 1F2MA 4K2LA 3WOEA 2IX0A 2WACA 1SE4A 5DEHA 2M2LA 1STYA 1JWUD 3MEHA 5DAUA 4IQZA 2IL8A 1BUVT 4U673 5IGCA 1SNQA 3D6WA 5C5MA 1QWYA 4TKOB 3DHQA 4FNFA 2L1BA 1AEXA 3K6OA 4RHRA 5M3MB 1AN8A 3HOYB 2K5QA 5FLXL 3X3MA 3VYSA 4P2CB 4IUQA 4BA1I 3S14B 1CQVA 2WKCA 1C48A 2QCPX 4H44C 2IPKD 1DXMA 3A56A 1EFID 3CHBD 3MXNA 3K57A 4BY1B 1TS5A 3FVQA 4EQNA 3M7NA 5EKIA 1B3AA 4ZAIA 1F77A 2ID0A 2B2YC 3SK8A 2O2LD 1QNUA 2N88A 2XNAC 1AW7A 4A3IB 2F0UA 5ELEA 1KNEA 3D4RA 3T56B 2FFKB 1DJRD 5EKKA 3J81E 4HEDA 3R2TA 4J1MA 5C5LA 2DY8A 2PPBC 5CBAE 5JVH3 3D3RA 1C8CA 5COYA 2PYKA 1R4QB 3P1HA 1S5DD 1SNOA 5IGBA 1WTRA 4OIKA 2DNEA 3L7ZC 1IYVA 1S5CD 1TWHB 2KVMA 3Q24A 2WIIB 2LS01 1SYBA 4FXKC 1PYWD 1IW7C 2CVRA 5CV4A 1RDPD 1S5ED 1YNJD 1BCPD 2AWNA 2AQ3B 5M5YB 1Y8PB 4C3IG 1B9MA 2NWGA 2A68D 3NUCA 1E2WA 2Q8TA 4ZK9B 4RFBA 4QUFA 2EZVA 3OOCA 3EROA 2DNCA 2EY1A 2EJGC 4ODGA 3BYTB 3K58A 3M3YB 5DM63 4CBVA 3S1RB 3HOUB 5M5WB 1WVLA 5IGGA 1EYCA 5IT9E 3LX0A 2BOSA 1OXSC 2E2JB 1HTLD 3N6RA 1U4PA 1QOHA 5CV6A 2F0PA 1L0XB 3V05A 1SMYD 3PUVA 4DXGA 1AZPA 4HSPA 3P7JA 4NKLA 4CJ0B 2A69D 4KD4A 1DONA 3QOJA 4PMBA 2EYMA 4RGNA 1FR3A 1SFOB 2E2IB 1EU4A 5I6YA 1PRTF 2TSSA 3MHBA 1RKNA 2XVSA 4F7XA 1TWAB 1PDQA 4DFAA 5C4JB 4RCOA 1S5FD 2F3VA 4KD3A 1LTSD 1MSGA 1Q8IA 2F4IA 3QOLA 1ENFA 1F2ZA 2C9OA 1TKWB 2J0TD 4YIJA 3I8ZA 5EGTA 1JORA 5CR3A 2XRQD 3NBHA 5C44B 3M85A 2O4XA 2EYFA 3GTMB 1H9KA 1NUCA 3M7GA 2RDGA 2KEDA 3VR3A 1CQFA 4TQUS 4GZYC 2XIWA 3T16A 4MIUA 4R8NA 3RMHA 2A74C 3K5MA 2Z4IA 2SDFA 4IUNA 1H9SB 2R7ZB 4DAVA 1QJOA 2KQ3A 5IIFA 2A5HA 3I4MB 1Q1EA 3BDLA 5D14A 3S15B 3DM1A 4K5XA 4C2MB 1W6JA 3BZDB 1OXTA 1RTNA 3H3VC 1EZ8A 2WAQB 1BNZA 1TS4A 1IL8A 2ZXRA 1IKMA 5BN4A 4N9PA 4RGMA 4IUTA 4DF7A 3GTPB 3I91A 2F0OA 1JOQA 3H09A 1YNJC 2JYOA 1BCPC 3SXHA 1XX8A 2F0MA 1WTPA 3OW7A 5C3EB 2A68C 4G7OC 1OXVA 1ICWA 1RD9D 5FOBB 5FLXE 1CA5A 4FF2A 3DEOA 1BBXC 3NBIA 2F0LA 1HXYD 4Q5VA 1ESFA 5M5XB 3FPUB 1QNKA 2R3ZA 3HS0C 1EYDA 5J39A 2AQ1B 4B9XA 3H6MA 2XWBB 2EXZA 1HA5A 2PQEA 1JWMD 1PFNA 5IGEA 1BDOA 1EU3A 3QWNA 4RGTA 2SEBD 1SMYC 2MP1A 1A2TA 3GTKB 4EQOA 3HOWB 1EY5A 1NSNS 1QG7A 3LNNA 3BDOA 4XYQA 4KKUA 3NP8A 4HCSA 4K2KA 2B2VC 1GUOA 3MXUA 1EQVA 4CGYB 1A3TA 1RJTA 4LK1C 2KECA 4C1NK 4X3KA 3CU7A 1E2ZA 1CTMA 2L11A 3MZ5A 1SNPA 3SK4A 4C3JB 3ND9A 2O5JC 2EYJA 4V0BA 3NTKA 5K5PA 4DNTB 3CQZB 3J7AV 4M1UB 3M4YA 3S9WA 4OL7A 4XT1B 1SJHD 1ZYRD 5A2QL 5G3LF 4R9WA 3PMFA 1CZWA 2B2UA 1HRJA 1BF4A 2NYZD 3MC0B 1JB3A 2CW0D 1HUNA 5EBDA 4ZUIA 3A8JE 1LTTD 2E76C 1V1PB 2LY7A 2MHVA 2X6GA 3NWSA 3S16B 2F0SA 2I07B 3I4LA 1HPCA 1JWSD 3VYRA 2RSNA 1FYCA 2F0IA 3SE0A 2A6HC 5JOBA 2R6GA 5CBEE 4XQNA 3W2DA 4PNYA 2NZ1D 4HMIA 3IL8A 4RA8A 3HG9A 2RDFA 1I4HA 5KRUA 2MPMA 3RUZA 2AWOA 2HUGA 4WRDA 1F9PA 3OWEB 2NUCA 5CV8A 4G57A 3K59A 2TMPA 3HOXB 1PTOF 1CI3M 3K7AB 2LKVA 2EJFC 4K8JA 1O78A 3BG3A 4A3GB 2L55A 5D3DA 5F2DA 2PNRC 3U9SA 3SEBA 3W3AA 4A3JB 5C0XI 3GTJB 3S1QB 1HQRD 3TBIB 3OIQA 5I4DA 5KYLA 1UAPA 5JVG3 2F0FA 3HOVB 1EY9A 1TIID 1B1ZA 4Z9CB 2EY2A 3FKIB 4XQJA 4KY7A 1PZJD 4F87A 4I65A 4UAIA 3H94A 5E4XA 4EGVA 3SDZA 1HHVA 2B63B 3D4WA 3VA7A 2AQ2B 1F2YA 4FXDA 5ELBA 3OPOA 1DM0B 2F0TA 1HCZA 4NW2A 3DWPA 5J1ZA 2IT1A 4OHJA 3OMCA 5C0XH 1TWGB 1LTRD 2BE5C 3H91A 1CT1D 1IKLA 1UNSA 1WD1A 2RKSA 1I6HB 4DU9A 3AB9A 1Y8OB 3TSSA 4JBWA 1UUPA 1CZGA 4LMQD 2F0JA 4RH6A 1GHJA 3SR1A 2JE6I 3J80L 1STNA 3RZOB 1HQMC 1EY6A 4EQPA 2WV6D 1SYDA 2EDGA 2CW0C 1LTAD 2RQXA 2OF1A 2ZXPA 2J4XA 1STBA 1ET6A 3NE5B 4IN3A 5CC4A 5ELCA 5D65A 5G3LD 4HCEA 4NP5A 2K05A 1T5EA 2R61A 1B2TA 2HDLA 4MN3A 2NBFA 4HAEA 4OO1I 5E3FA 4CJ1B 3SHLA 3KF8A 1ENCA 1H9MA 1SSOA 2PW5A 1RTOA 3F2UA 3GV6A 4WFN3 3T51B 4PMCA 5BN3A 1JR0D 5C4XB 1PFMA 5ELFA 3RD4A 3NK9A 2A73B 1MI2A 5ELDA 2ENBA 3R3OA 2BDNA 3GQBA 4H13C 3QB3A 3PO2B 4FF3A 3VR2A 1YNND 5EJWA 3I70A 4IZ8A 1Y1WB 1PTOD 5KNCA 5A2QE 3GTOB 4B9WA 1FNUA 1TT2A 3LWEA 3EFXD 2F0EA 3SK6A 5I2YA 4RCNA 4H7BA 5JAVA 4OO1H 5CV9A 1XXGA 4FF1A 1X3QA 2KEEA 2Q8IB 2Q8RE 1G291 4XTCS 4K6DA 1RODA 1D6EC 3MWYW 1I4GA 1KABA 1LTID 5K36G 3A7LA 1QCBD 1PRTB 1U9RA 1F2LA 2EY6A 2L0CA 5T1IA 1B9NA 4E6IA 1FGBD 1DOKA 4DAYA 2XN9C 4JK1C 4ZKCB 3E6ZX 2JA5B 2V4DA 5C0XJ 3VR5A 2JXMB 4ULLA 3HGBA 1VMCA 2CHBD 5DM73 3BS1A 2YU9B 5E1FA 4DGZA 2N55A 4Y7NB 1PFBA 4A3FB 2L12A 3TP8A 1I4QA 1K8MA 1WTXA 3NQTA 1TU2B 2H4OA 5C6AA 1G91A 2QILA 1SDFA 4XDXA 2ZT9C 2AUKA 2E2HB 4KMUC 1XYIA 4ABNA 1RF2D 3AMUA 3OIPA 3IKJA 3KK7A 5I9PA 3FEWX 3KUPA 4KJNA 1LTGD 2LMCB 4RWSC 5JEAH 2MGSA 4LAAA 4NMZA 3X3NA 1GOZA 3NPPA 1Z7TA 2K6AA 2B8FA 3VA5A 4XT3B 1GUWA 3NSWA 2ZXOA 1A6XA 3C46A 2RVLA 4OGQC 1LT4D 4QMGA 3PUZA 1STAA 5HGTA 4A93B 2F0GA 2FHTA 1A3VA 4IFDG 1IHZA 5EPKA 1CHPD 1TY2A 2PZWA 1KDAA 1BOSA 1LABA 3BVZA 2B2YA 1QB5D 1EWCA 2EY5A 4FVMA 1ILPA 2C5CA 3BDCA 1SYGA 2FMCA 2WKDA 4K5VA 4M8AA 1AZQA 1ESRA 3V96A 4PMWA 1O7YA 3J80E 1GXDC 2Y0SB 1Q3LA 1B44D 1RCVD 2QDBA 3MFGA 5JPNC 1EQTA 2K5DA 3IFDA 1S4ZA 2D5DA 4KHZA 4KI0A 1GJXA 4HR7B 2EYLA 5C3XA 2A6ED 3D4DA 4NDXA 4J6HA 1M8AA 1QE6A 1CA6A 4WORA 2WP8J 4R8IA 1F9QA 2A69C 3MTSA 1O7ZA 1EY0A 1V1OA 2D9UA 3E0JA 3EQLC 4X3TA 5CYUA 1EYAA 2E75C 4G4KA 1DZ1A 4DN4M 2E74C 5KNDA 5KNBA 2VUMB 1E2VA 2K04A 2Z8LA 3T53B 3S2HB 5HURA 2F0DA 4DK1A 5KEEA 1U4LA 1JICA 3L3OC 2EPBA 1SNMA 2PZTA 2HCIA 5E4WC 1PRTD 5EPJA 3GO5A 4X3UA 4ZKBB 2BA0A 2SOBA 3OWFA 1KTKA 1SJED 5JEAJ 1TQOA 3NHHA 3RZDB 4RKBA 1U4RA 4IUUA 4KN7C 1DD2A 2K5WA 2PZUA 3HOZB 1LT5D 3PIO3 1VDZA 1II3A 3HP3A 3HEJA 1PTOH 2KOLA 3ERQA 4UDUC 4C3HB 4FO2A 5LL6S 2Z1CA 1K8OA 3NTIA 3P20A 2KA7A 4A3DB 1EY4A 1SE3A 4K5WA 3A8IE 1PTOB 1G2TA 5T1GA 3WOFA 2OT2A 2BDOA 4BWGB 5FO7B 5CMDA 1K83B 1A2UA 1ENAA 2IX3A 3LWUA 1B4OA 1NR4A 1KDBA 1I4RA 1Y1VB 3OHXC 4FYDA 4J8QA 1WTOA 3U9OA 1IYUA 2B2TA 1Y69U 1MD2D 3V2TA 3PO3B 2R93B 1S5BD 1BCPF 1JQYD 3K5LA 1DYQA 3ITPA 3PV0A 3D8GA 1WTVA 1WD0A 4O1NA 1AP0A 4QF4A 5EKLA 1D2BA 4KY5A 1SE2A 4C3JG 5IGDA 3MFYA 1NR2A 3N52A 3ND8A 1GUGA 5FO8B 1B53A 1TWCB 3T4AC 1V43A 2F0WA 5D3IB 1IW7D 4F88A 2A6EC 2RSOA 5JJZA 2EYOA 1EEID 1KDCA 3I3CA 2DY7A 1LACA 2QEJC 4ME5A 3P75A 2JA8B 5LL6X 3WDNA 3QO2A 1BQQT 2K01A 2L5TA 5FO9B 3IAYA 1JOKA 1R9TB 3D6CA 1SYFA 3KLSA 2KJXA 3IFTA 1QILA 1LO5D 1STHA 3RLFA 3EVQA 2F1MA 5DNFA 4O42A 1B50A 4AYBB 4PV1C 4QIWB 4ID6A 4RAUC 2OXPA 3DEPA 5EQ0A 3FDTA 4HTHA 3Q23A 2F0NA 1V8QA 2K03A 3MA2B 4PQXA 2NB0A 4IUVA 1PRTC 2X6LA 4RGOS 2O5IC 2JA7B 3R93A 3I72A 3NXWA 4H0LC 2KCNA 1EIHA 1ZYRC 2B2VA 4C3IB 1E0BA 5C4HA 1ONLA 2IWHA 4OIJA 1I6VC 3VR6A 3J7YW 2F0KA 2M00A 4A3BB 1SYEA 1WTWA 1HTPA 1ZXTA 4BBRB 4N9TA 2NVYB 5K36H 2B2WA 4CHTB 1LT6D 2BA1A 2B39A 4A3EB 4I7ZC 4KK7A 5LHY1 1TVXA 3A54A 3KLSX 1C4QA 1GHKA 1MSHA 2NTSA 1ET9A 4KHVA 3NWTA 3VYUA 3TP7A 2B8GA 3Q6SA 4KJOA 3BVGA 2LFNA 1STEA 4DK0A 1TWFB 4L63B 2MUYA 3C2PA 2NN6G 3BYYB 1KLGD 3A8KE 1TS2A 4CJ2C 1R4PB 3I73A 4LJZC 1VCIA 1UEAB 2JEBI 1CHQD 3OSOA 3DMUA 3K5OA 2SNSA 4IFDI 5KIXA 4DXFA 3H0GB 3PUXA 2FJ2A 4F8MA 3FMCA 5IODA 2K28A 3TZDA 2G9HD 3EA6A 2HCCA 3FRPB 1GUSA 2G9DA 5C0XG 2L9HA 1SNDA 4KV6A 1VF5C 4IURA 5I6WA 1L0YB 3O13A 3JAML 1Z47A 3CRLC 3KLRA 1WCMB 1D5XC 2CQAA 1LT3D 3TN2A 2IX1A 2XRSD 1OXUA 1BXTA 1XWEA 1G6ZA 1DCZA 3HRZC 4A3KB 1GUNA 3EJIA 5AFWA 1TR5A 1AFPA 1JC7A 2QKIC 4WJWA 2D62A 3G7LA 2I46A 3QJYA 2VXWA 2YYZA 4IFDH 4MHEA 2F0VA 3C1EA 3KBXA 3BVMA 4BBSB 5J22A 3DWAA 1J8IA 3S2DB 1SNCA 3NTHA 5BN5A 4FF4A 2QF7A 2M9VA 1NAPA 1EEFD 2R92B 4XIGS 3PUYA 1SYCA 4RKLA 2HQEA 3MAQA 3UI2A 4BS9A 1A15A 4ZLTF 1FNWA 1O7LA 3SVMA 1VMPA 4CKEA 2OEOA 4Q0FA 3TMEA 3C3LA 2VNUD 2H1EA 1EZ6A 3GP7A 5CGKA 2BCOA 2B2UC 2RBMA 4QCLA 2F03A 3S1MB 4C1NI 1FNVA 5IOCA 4B08A 5KGUA 2DN8A 1VF7A 2GA4B 2K1BA 3K0YA 5EPLA 2EOTA 1M4VA 2PCFB 3S1NB 5CV5A 1KLUD 1CM9A 2PW7A 5TSSA 5JPMC 2WB1B 1O80A 3DUZA 2ICEC 4CKBA 1RHPA 1Q12A 5EBCA 1F9RA 3M4OB 4KKTA 1KAAA 4OO1G 1BR9A 3AU7A 4XYOA 4DAPA 2KUMA 2B2TC 2HDMA 4XQQA 4IUPA 1D5MC 3FPPA 2J7ZA 1ILQA 2JP1A 1EOTA 2A6HD 1W6KA 3R2IA 3TP6A 4G7HC 2AUJD 3GTQB 1CFMA 3PIP3 4S3SA 4TRDA 1YNNC 1HUMA 2EYPA 5FKAC 1EL0A 4X3SA 4DA2A 4C56C 1PTOC 4CKCA 3E5SA 5C3WA 2WINB 4IALA 4HSVA 1BO0A 3D31A 3HZXA 4ZYSA 5FK9C 4KY6A 1SXTA 2K7VA 3K5NA 1JE4A 2F0QA 2Z4HA 5CV7A 1J9OA 2EYHA 1H9SA 5M9OA 5C4ZA 3MVVA 4HN7A 2ICIA 3G6JB 1Z6HA 3TDQA 4IFDJ 1NCVA 5JEAG 1X32A 5KYIA 4ZQ3A 1HFNA 3C1FA 3T13A 3GD7A 1G2SA 2NTTA 5CORA 3GTLB 1OXXK 2PO4A 1FD7D 3GV3A 1SEBD 3DWQA 3Q0AA 3KBGA 2NVQB 3Q22A 3HKZB 2EJMA 2FMMA 1D5ZC 2VB2X 1EY8A 1Q1BA 3J81L 4KKSA 2JSOA 1I3QB 3ZYYX 1MBYA 1ML0D 1I4PA 1X3PA 3TP5A 4DNRB 3CRKC 1ZKOA 2BE5D 4KTAA 4U68A 5I2XA 4ZRZA 2VB3X 3URYA 1HFGA 1Y8NB 1TY0A 3QG1A 4L6TB 2KHSA 2EE1A 1OO9B 4HMJA 3JAME 4BY7B 2B2WC 2XSCA 4K8IA 3A55A 2MJ8A 3MXPA 3SK5A 3VR4A 1DOLA 1G8ZD 2EVBA 1TS3A 2IJ0A 1PZID 1F9SA 2E2DC 4QUCA 2KCCA 2PMZB 3S17B 2RA4A 2JA6B 1EWHA 1D1KA 3MXGA 3I90A 5NUCA 2JEAI 2F3WA 5IT9L 1Q90A 1EIGA 4L8JA 1PMRA 4K14A 1SAPA 4EVOA 2XWJB 2RDHA 3PUWA 4FXGC 4QB4A 1BCPB 1PZKD 1ZEQX 3QIAA 2NVXB 3L9AX 3I4NB 1JCKB 2NN6I 2SNMA 2X69A 4ZUJA 4A3MB 1KNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T51 B;  1H9K A;  2A6E C;  2IT1 A;  5BN3 A;  1K8M A;  1Q1B A;  4KKS A;  3DXJ C;  3I4L A;  1Y8P B;  1HPC A;  1TU2 B;  1GHK A;  1B9M A;  2A68 D;  5C0X H;  1FYC A;  3SE0 A;  1E2W A;  2ZT9 C;  1BDO A;  2AUK A;  3VR3 A;  3FPP A;  2B8G A;  4TKO B;  4KN7 C;  4KMU C;  2A6H C;  5BN5 A;  3GQB A;  2QF7 A;  1DD2 A;  3OOC A;  2R6G A;  1LAC A;  4DK0 A;  2BE5 C;  1SMY C;  2A6H D;  3IKJ A;  2DNC A;  4DNR B;  3CRK C;  2EJG C;  1ZKO A;  2BE5 D;  4XIG S;  4G7H C;  2AUJ D;  4H13 C;  2K32 A;  3PUY A;  1CFM A;  3WDN A;  1VDZ A;  4TQU S;  2LMC B;  4GZY C;  1Y8N B;  2L5T A;  2NN6 G;  3AB9 A;  3QG1 A;  3TZU A;  1YNN C;  5JEA H;  1Y8O B;  3A8K E;  2D5D A;  4KHZ A;  2K33 A;  3VR2 A;  3LNN A;  4KI0 A;  1GJX A;  3BDO A;  3I73 A;  4HR7 B;  1O7L A;  2A6E D;  4BA1 I;  4LJZ C;  2AWO A;  1H9S B;  4KKU A;  1VCI A;  4BA2 I;  4H44 C;  3IFT A;  1QJO A;  2JEB I;  1OXS C;  4JBW A;  1GUO A;  3RLF A;  3MXU A;  1K8O A;  1Z7T A;  5KNC A;  3P20 A;  1Q1E A;  3D31 A;  2KA7 A;  2F1M A;  1DXM A;  2B8F A;  3N6R A;  4KN4 C;  3A8I E;  3VR4 A;  1CI3 M;  3PUX A;  4LK1 C;  2EVB A;  2EJF C;  4PV1 C;  1GHJ A;  1O78 A;  2JE6 I;  3BG3 A;  3M7N A;  1A6X A;  1OXT A;  2BDO A;  3FMC A;  3PUV A;  4RCN A;  1E2Z A;  1CTM A;  2K7V A;  4OO1 H;  4OGQ C;  2PNR C;  2D2C C;  2NN6 H;  3U9S A;  1HQM C;  2KCC A;  3W3A A;  1GUS A;  3LWU A;  2A69 C;  3ND9 A;  2O5J C;  1V8Q A;  2Q8I B;  2A69 D;  2CW0 C;  2EDG A;  1G29 1;  5C0X G;  4DNT B;  4XTC S;  1H9S A;  1VF5 C;  1EWH A;  3D4R A;  3PUZ A;  3EQL C;  3T56 B;  2E75 C;  2DN8 A;  1VF7 A;  4G7Z C;  2O5I C;  5BN4 A;  1FR3 A;  3I72 A;  3M4Y A;  3NE5 B;  2JEA I;  4H0L C;  1IYU A;  1H9J A;  1Y69 U;  1GUT A;  5K36 G;  1ZYR C;  5A35 A;  1Z6H A;  3A7L A;  1Q90 A;  1H9R A;  2E74 C;  4IFD G;  1YNJ C;  5KND A;  3CRL C;  4L8J A;  1PMR A;  3A7A B;  5KNB A;  3KLR A;  1E2V A;  3T53 B;  2PPB C;  5JEA G;  2PCF B;  1ONL A;  3OW7 A;  3PUW A;  4DK1 A;  1B9N A;  1T5E A;  1OXU A;  2A68 C;  3H94 A;  4G7O C;  1I6V C;  3SDZ A;  1LAB A;  1OXV A;  3GD7 A;  3PV0 A;  4JK1 C;  3VR6 A;  1DCZ A;  3VA7 A;  2V4D A;  1GUN A;  3VR5 A;  1HTP A;  3QIA A;  2DNE A;  1OXX K;  2JXM B;  3L7Z C;  3MFY A;  3HGB A;  3OPO A;  1IYV A;  1Q12 A;  1TKW B;  2NN6 I;  2D62 A;  1HCZ A;  3A8J E;  4KKT A;  3ND8 A;  3QJY A;  1H9M A;  2E76 C;  5K36 H;  1GUG A;  2YYZ A;  4IQZ A;  4IFD H;  1IW7 C;  4OO1 G;  2BA1 A;  3M85 A;  2BA0 A;  4I7Z C;  1V43 A;  2EJM A;  1IW7 D; 
#chains in the Genus database with same CATH topology
 1G51 A;  3R8B A;  1A3U A;  4X6A H;  4JV5 Q;  4RG1 A;  1CKN B;  2NZO A;  5IGF A;  2NVT B;  1PH1 A;  3DXJ C;  4FP5 D;  4A3G H;  4V19 0;  3CKI B;  2JA9 A;  2VUM G;  4XXE A;  4GLX A;  2K50 A;  4DV6 Q;  4DKA C;  1YNX A;  5ISR A;  2I0Q A;  1Z9F A;  2L4N A;  1T5X D;  1CK1 A;  4IJL A;  3AQQ A;  1PLF A;  3J7A F;  1J5E L;  3UE0 A;  3RLO A;  1V1P A;  2K32 A;  2FIN B;  5L37 A;  1U0L A;  1SBB B;  3HOV H;  1LV9 A;  3TZU A;  1EY7 A;  4OWW B;  2K33 A;  4LNQ A;  1LTB D;  2IHE A;  4BA2 I;  3J81 j;  1HA6 A;  5FJ8 G;  3NQI A;  4KN4 C;  1D1I A;  5BR8 L;  5I9O A;  1MGS A;  1M90 C;  1LTL A;  3GTG H;  1LLR D;  1XTC D;  1XNR Q;  1JOO A;  1PXU A;  2D2C C;  2NN6 H;  4KHP L;  4DR7 L;  5M3F B;  1DOM A;  1WTQ A;  3HOZ G;  3GTG B;  2QEX A;  4PZ8 A;  1U4M A;  3EN2 A;  4TSS A;  5LMN L;  1I50 H;  4G7Z C;  4DR2 Q;  1STG A;  4K6L A;  1H9J A;  1LYL A;  4LF8 Q;  1GUT A;  5A35 A;  4C3H G;  1H9R A;  3A7A B;  1I50 B;  2F0H A;  2UUB Q;  1I4X A;  1XPR A;  4A3D G;  2IW3 A;  1EFW A;  4RHS A;  1IBL Q;  4ILW A;  3ONA B;  4LF5 L;  1B8A A;  1I6H H;  2CWA A;  3OMG A;  3VYT A;  1F2M A;  4K2L A;  3WOE A;  4X65 L;  2IX0 A;  3E9I A;  3IRB A;  2WAC A;  1SE4 A;  5DEH A;  2M2L A;  1STY A;  1JWU D;  3MEH A;  1Y1V G;  5DAU A;  4IQZ A;  4NPS A;  3ERS X;  1S72 A;  5IP7 H;  4DR5 L;  2IL8 A;  1BUV T;  4U67 3;  2MO1 A;  5IGC A;  5M3M H;  3D0F A;  1SNQ A;  2OCE A;  1B3Q A;  3D6W A;  3HOY H;  1KAW A;  3PO3 G;  2ZJP A;  1I94 Q;  5C5M A;  1QWY A;  4TKO B;  3DHQ A;  1HNW Q;  4FNF A;  2R93 G;  1YHA A;  2L1B A;  1W3S A;  1AEX A;  3K6O A;  4RHR A;  1WTH A;  5M3M B;  1AN8 A;  3HOY B;  3S14 H;  1NJI C;  2K5Q A;  5FLX L;  4LW1 A;  3X3M A;  3VYS A;  4B3M Q;  4DV2 L;  4JW0 A;  2KCM A;  4P2C B;  4IUQ A;  4BA1 I;  4BY1 H;  2PI2 A;  3S14 B;  1CQV A;  1WI5 A;  1C48 A;  2WKC A;  2QCP X;  4H44 C;  2IPK D;  1DXM A;  3A56 A;  2MQH A;  1EFI D;  3CHB D;  3MXN A;  3K57 A;  4JYA Q;  4BY1 B;  1TS5 A;  3FVQ A;  4EQN A;  3M7N A;  5EKI A;  4DV0 Q;  1B3A A;  4R4O A;  4ZAI A;  2HQL A;  3J7A 5;  1F77 A;  2ID0 A;  2B2Y C;  4A4I A;  3SK8 A;  2O2L D;  1QNU A;  1VQ8 A;  1IBK Q;  2JA8 G;  2N88 A;  2XNA C;  2OTL A;  1AW7 A;  4A3I B;  4JI5 L;  2F0U A;  5ELE A;  1KNE A;  3D4R A;  3T56 B;  2FFK B;  2I5L X;  1DJR D;  5EKK A;  3J81 E;  4HED A;  3R2T A;  4J1M A;  3ZJY C;  5C5L A;  2DY8 A;  2PPB C;  1E22 A;  5CBA E;  5JVH 3;  3D3R A;  1C8C A;  5COY A;  2PYK A;  2CH4 A;  4X62 Q;  4AYB G;  1TWH H;  3F8T A;  1R4Q B;  3P1H A;  1S5D D;  1SNO A;  5IGB A;  2NZH A;  3I7F A;  1WTR A;  4OIK A;  2DNE A;  3L7Z C;  3PO2 H;  1IYV A;  1S5C D;  2KVM A;  1TWH B;  3Q24 A;  2WII B;  2LS0 1;  1SYB A;  4FXK C;  1PYW D;  1IW7 C;  1WJJ A;  1Y1W H;  2CVR A;  1BBW A;  5CV4 A;  1RDP D;  1S5E D;  1YNJ D;  1BCP D;  2AWN A;  2JA7 G;  2AQ3 B;  2UUC Q;  5M5Y B;  1Y8P B;  4C3I G;  3STB D;  1PH3 A;  4OX9 L;  1B9M A;  4JI0 L;  2NWG A;  2A68 D;  3K81 C;  3NUC A;  4YY3 L;  3TRE A;  1E2W A;  2Q8T A;  4ZK9 B;  4RFB A;  4QUF A;  3M3Y H;  2EZV A;  3OOC A;  4HJA A;  3ERO A;  2DNC A;  2EY1 A;  2EJG C;  4ODG A;  5M5W H;  3BYT B;  3PGZ A;  5IP9 H;  4B3S Q;  4A3B G;  1GD7 A;  3K58 A;  3M3Y B;  3B6Y A;  5DM6 3;  4BBR G;  4CBV A;  3S1R B;  3HOU B;  4DV6 L;  5M5W B;  4K0K Q;  1WVL A;  5IGG A;  1EYC A;  5IT9 E;  1E1T A;  4A3E G;  3KJP A;  3LX0 A;  2BOS A;  1OXS C;  2E2J B;  1HTL D;  2EQS A;  1X56 A;  3UE1 A;  3N6R A;  1U4P A;  1QOH A;  5CV6 A;  2F0P A;  1L0X B;  3V05 A;  1SMY D;  3PUV A;  4DXG A;  1AZP A;  4HSP A;  4A3C G;  3P7J A;  5E7N A;  2FXQ A;  2Z9H A;  1SFO H;  4NKL A;  2E2I H;  4CJ0 B;  2A19 A;  2YU9 H;  2A69 D;  3QR8 A;  4BXX G;  4KD4 A;  1DON A;  1WFQ A;  3QOJ A;  4PMB A;  2EYM A;  4RGN A;  1P8L A;  1FR3 A;  1SFO B;  1XNR L;  1TWA H;  2IHF A;  1EU4 A;  2KCT A;  2E2I B;  5C4J H;  5I6Y A;  3BZC A;  1PRT F;  1WOC A;  2TSS A;  4L5Q A;  1PA6 A;  3MHB A;  1KD1 C;  1RKN A;  3H0G G;  4JOI A;  2XVS A;  4F7X A;  1TWA B;  1PDQ A;  4DFA A;  5C4J B;  4RCO A;  1S5F D;  4IPH A;  4DR2 L;  2F3V A;  4KD3 A;  1LTS D;  1MSG A;  1Q8I A;  5C44 H;  2F4I A;  4LF8 L;  3QOL A;  1ENF A;  1AE3 A;  4DV3 Q;  1L0W A;  1F2Z A;  2C9O A;  1TKW B;  2J0T D;  4YIJ A;  3I8Z A;  5EGT A;  2UUB L;  1JOR A;  5CR3 A;  4DV1 Q;  2XRQ D;  3AEV A;  1IBL L;  1VQ9 A;  3NBH A;  5C44 B;  3M85 A;  2O4X A;  4IPD A;  2EYF A;  3GTM B;  1H9K A;  1NUC A;  2BH2 A;  2Q2H A;  3M7G A;  2RDG A;  2KED A;  1WCM G;  5GAG C;  3VR3 A;  1CQF A;  3T1Y Q;  1MJC A;  1HZ9 A;  1VQM A;  1QVG A;  2ZTE A;  1IXR A;  4GN4 B;  4A3K G;  2R7Z H;  4TQU S;  4GZY C;  2XIW A;  3L0O A;  3I4M H;  3KDF B;  4IPG A;  3T16 A;  1PH8 A;  4MIU A;  4R8N A;  3RMH A;  2A74 C;  2E8G A;  3K5M A;  1I94 L;  2Z4I A;  2SDF A;  1XJV A;  1HNW L;  4C2M H;  1MKH A;  4IUN A;  1H9S B;  2R7Z B;  4DAV A;  1QJO A;  2KQ3 A;  3UDF A;  1HR0 Q;  5IIF A;  2A5H A;  3I4M B;  1Q1E A;  3BDL A;  5D14 A;  3S15 B;  4N8X 1;  4P73 A;  3DM1 A;  4BBS G;  1FJG Q;  4K5X A;  4PG3 A;  4C2M B;  1W6J A;  3BZD B;  1OXT A;  1RTN A;  2KEN A;  3H3V C;  3BZK A;  4GOP C;  4DR3 Q;  1EZ8 A;  3TRZ A;  1C7Y A;  2WAQ B;  2R92 G;  2VQF Q;  1BNZ A;  4IPC A;  1TS4 A;  1IL8 A;  3J80 c;  2ZXR A;  4JYA L;  1IKM A;  4DV0 L;  1MJE A;  5BN4 A;  2RHQ B;  5C3E H;  4N9P A;  4RGM A;  4IUT A;  4DF7 A;  3GTP B;  4GNX B;  2PQA A;  3I91 A;  2WAQ E;  2F0O A;  1JOQ A;  3H09 A;  1YNJ C;  2JYO A;  1BCP C;  1XTD A;  3SXH A;  1IBK L;  1XX8 A;  2F0M A;  1WTP A;  3OW7 A;  3STB C;  5C3E B;  4UHV A;  2A68 C;  4G7O C;  5M5X H;  1OXV A;  1ICW A;  3TS2 A;  2DUD A;  1RD9 D;  5FOB B;  5FLX E;  3BJU A;  1CA5 A;  4FF2 A;  3DEO A;  1BBX C;  4O0A A;  3NBI A;  2VY3 A;  2F0L A;  1ASZ A;  1HXY D;  4Q5V A;  1ESF A;  5M5X B;  3FPU B;  1QNK A;  1X55 A;  2R3Z A;  4I7A A;  3HS0 C;  4X62 L;  4QGU A;  1Q81 C;  2ATW A;  3J80 i;  1EYD A;  5J39 A;  1HNX Q;  2AQ1 B;  4B9X A;  3H6M A;  2XWB B;  2EXZ A;  1HA5 A;  4EQ5 A;  2PQE A;  3GTK H;  1JWM D;  1PFN A;  5IGE A;  1BDO A;  1EU3 A;  3QWN A;  4RGT A;  1K9M C;  2SEB D;  3W5O A;  1SMY C;  1KXL A;  2MP1 A;  2WB1 G;  1A2T A;  3GTK B;  4EQO A;  3HOW B;  2UUC L;  1EY5 A;  1UE7 A;  1NSN S;  1PH4 A;  3NEM A;  1QG7 A;  3LNN A;  3BDO A;  1FGU A;  4XYQ A;  4KKU A;  3NP8 A;  2VUM H;  4HIK A;  1PH2 A;  4HCS A;  1C9O A;  4K2K A;  1NNX A;  2B2V C;  1GUO A;  3S2H H;  3MXU A;  1EQV A;  4APV A;  3AYH B;  4CGY B;  3L2P A;  4B3S L;  1A3T A;  1RJT A;  2F3I A;  4LK1 C;  1VQD A;  2KEC A;  4C1N K;  4X3K A;  3CU7 A;  1MHW C;  5J3B A;  1E2Z A;  1CTM A;  2L11 A;  3MZ5 A;  1EYG A;  4K0K L;  1SNP A;  1G6P A;  3SK4 A;  1L2F A;  4C3J B;  3ND9 A;  2O5J C;  2JJQ A;  2EYJ A;  4V0B A;  4JBK A;  3NTK A;  5K5P A;  4QQB X;  4DNT B;  3CQZ B;  5FJ8 H;  3J7A V;  4M1U B;  3M4Y A;  3TS0 A;  3K8A A;  4OL7 A;  3S9W A;  4XT1 B;  1SJH D;  1ZYR D;  5A2Q L;  3I2Z A;  5G3L F;  4R9W A;  3PMF A;  1CZW A;  1PYB A;  2B2U A;  1SN8 A;  1HRJ A;  4JI2 Q;  3HOZ H;  1BF4 A;  2E5L Q;  2NYZ D;  3MC0 B;  3KYH C;  1JB3 A;  1KHI A;  2CW0 D;  4JI6 Q;  2PNH A;  1HUN A;  5EBD A;  3S16 H;  4ZUI A;  3A8J E;  1LTT D;  2E76 C;  1V1P B;  4DR4 Q;  1HZA A;  2K5H A;  2LY7 A;  2MHV A;  2VS1 A;  4UP7 A;  4YWL A;  2X6G A;  3NWS A;  3S16 B;  2F0S A;  1L1O A;  2I07 B;  3I4L A;  1HPC A;  1IL2 A;  4OON A;  2Z0S A;  1JWS D;  4DV3 L;  3VYR A;  2RSN A;  1K83 H;  1FYC A;  2F0I A;  3SE0 A;  4AQY Q;  1VQK A;  4DV1 L;  2A6H C;  5JOB A;  2R6G A;  4B3T Q;  5CBE E;  4XQN A;  4UY8 C;  3W2D A;  4PNY A;  4P72 A;  4WJ3 M;  2NZ1 D;  1Y1V H;  5IYC H;  4HMI A;  3IL8 A;  4RA8 A;  4R4T A;  3CD6 A;  3HG9 A;  2RDF A;  3HOX H;  1I4H A;  4O2D A;  3CC2 A;  5KRU A;  3K7A H;  2MPM A;  3RUZ A;  3T1Y L;  2F4V Q;  2AWO A;  2HUG A;  4WRD A;  1F9P A;  3HKZ G;  3SGI A;  3PO3 H;  3OWE B;  2NUC A;  5CV8 A;  4G57 A;  4PZ7 A;  3K59 A;  1EQR A;  2TMP A;  4A3J H;  3CPW A;  3HOX B;  1PTO F;  1CI3 M;  3K7A B;  3GTJ H;  3S1Q H;  2LKV A;  2EJF C;  4K8J A;  1O78 A;  3BG3 A;  4A3G B;  1UE5 A;  2B29 A;  2L55 A;  2L15 A;  5D3D A;  5F2D A;  2DGY A;  2PNR C;  3U9S A;  3SEB A;  3W3A A;  4A3J B;  1K8G A;  5C0X I;  3GTJ B;  3S1Q B;  1HR0 L;  3FKI H;  1KQS A;  4JPB W;  5GAE C;  4IJH A;  1TWC H;  1HQR D;  3TBI B;  3KF6 A;  3OIQ A;  5I4D A;  5KYL A;  1UAP A;  5JVG 3;  1FJG L;  2F0F A;  3HOV B;  1EY9 A;  1TII D;  4X66 Q;  1PFS A;  1B1Z A;  4Z9C B;  2QGQ A;  2EY2 A;  3FKI B;  1VQH A;  4XQJ A;  5IWA Q;  4DR3 L;  4KY7 A;  4BY7 G;  1UE6 A;  2B63 H;  1QUQ A;  1PZJ D;  4QY7 A;  2VQF L;  4F87 A;  4I65 A;  4UAI A;  4HIO A;  3H94 A;  4QJF A;  5E4X A;  4EGV A;  3SDZ A;  1HHV A;  2B63 B;  3D4W A;  3VA7 A;  2AQ2 B;  2OWO A;  1F2Y A;  1SMX A;  3A0J A;  4FXD A;  3S24 A;  5ELB A;  3OPO A;  1DM0 B;  2F0T A;  1HCZ A;  4YCW A;  2OTJ A;  2JA6 G;  4NW2 A;  1CKM A;  3DWP A;  1TWG H;  5J1Z A;  2IT1 A;  1GM5 A;  4JCV E;  4OHJ A;  3H15 A;  2EXD A;  1QZG A;  1YI2 A;  3OMC A;  5C0X H;  1TWG B;  2Q2U A;  1LTR D;  2BE5 C;  3H91 A;  3MXN B;  1CT1 D;  3TQY A;  1I5F A;  1IKL A;  2PI2 E;  1UNS A;  1HNX L;  1WD1 A;  2RKS A;  1I6H B;  4DU9 A;  3AB9 A;  3I56 A;  1Y8O B;  3I4N G;  2OQ0 A;  1ICF B;  4N8F A;  3TSS A;  4C3I H;  4A3M G;  2HIX A;  4JBW A;  1YIT A;  3RZO H;  1M1K C;  1UUP A;  1CZG A;  4LMQ D;  4LF9 Q;  2Z6K C;  2F0J A;  4RH6 A;  1GHJ A;  3SR1 A;  2JE6 I;  4A76 A;  3J80 L;  3FHW A;  3CME A;  1STN A;  1XMQ Q;  4A3B H;  3RZO B;  1JB7 A;  1X9N A;  1HQM C;  4LF6 Q;  4BBR H;  3BU2 A;  1AE2 A;  1EY6 A;  4CDD C;  4EQP A;  1JJC B;  2WV6 D;  1SYD A;  1PH7 A;  1KC8 C;  2EDG A;  2CW0 C;  2CH4 W;  1GVP A;  1LTA D;  2RQX A;  2Q2I A;  2OF1 A;  4MNO A;  2ZXP A;  2J4X A;  1STB A;  1ET6 A;  3NE5 B;  4IN3 A;  5CC4 A;  1PV4 A;  2HD3 A;  5ELC A;  1VQO A;  5D65 A;  5G3L D;  1VQF A;  4HCE A;  4NP5 A;  2K05 A;  1K73 C;  3PF4 A;  1T5E A;  3E0E A;  2R61 A;  2RCN A;  1B2T A;  4DV5 Q;  4POF A;  4BXX H;  2HDL A;  4JI8 Q;  2RHS B;  4MN3 A;  5FLM G;  5M3F G;  3CCU A;  2UUA Q;  3GDE A;  2NBF A;  4HAE A;  4OO1 I;  5E3F A;  4CJ1 B;  3SHL A;  5C4X H;  3J81 c;  3KF8 A;  1ENC A;  1H9M A;  1SSO A;  4LFC Q;  2GVA A;  2PW5 A;  1RTO A;  3F2U A;  3GV6 A;  4WFN 3;  4JI2 L;  3T51 B;  4PMC A;  5BN3 A;  3H0G H;  1JR0 D;  2HIV A;  5IYB G;  1PFM A;  5C4X B;  5ELF A;  4JI6 L;  4JI7 Q;  3RD4 A;  3NK9 A;  3CC4 A;  1YHB A;  2A73 B;  1MI2 A;  5ELD A;  2ENB A;  1BVS A;  2MFI A;  3RLN A;  4DK6 C;  3R3O A;  2BDN A;  3GQB A;  4DR4 L;  2F52 A;  1JMC A;  2HHH Q;  4H13 C;  3QB3 A;  5HGQ A;  3GTO H;  3PO2 B;  4FF3 A;  3VR2 A;  1YNN D;  4AQY L;  4HJ8 A;  2N49 A;  4GLA C;  5EJW A;  3I70 A;  4IZ8 A;  1WCM H;  1Y1W B;  1PTO D;  5KNC A;  5A2Q E;  3GTO B;  4B9W A;  1FNU A;  1TT2 A;  1PYS B;  3LWE A;  3EFX D;  2F0E A;  3SK6 A;  5I2Y A;  4A3K H;  4RCN A;  4JV5 L;  1CSQ A;  3PIP A;  4H7B A;  4L5S A;  5JAV A;  4OO1 H;  5IP7 G;  5CV9 A;  4Y52 H;  1XXG A;  4FF1 A;  1X3Q A;  2F4V L;  5AJ3 Q;  2A8V A;  4LWC A;  5M3M G;  2KEE A;  2Q8I B;  3HOY G;  4DV7 Q;  1NTG A;  2Q8R E;  1G29 1;  4B3R Q;  2K5V A;  4XTC S;  5IT9 c;  3CMA A;  4GNX C;  4K6D A;  4A3L H;  1ROD A;  1D6E C;  3MWY W;  2VL6 A;  1I4G A;  1SE8 A;  1KAB A;  1LTI D;  4BBS H;  5K36 G;  4ZCK A;  3A7L A;  1QCB D;  1PRT B;  3NBH B;  1U9R A;  2JA5 H;  1F2L A;  2EY6 A;  2L0C A;  5T1I A;  1B9N A;  4NXM Q;  1VQ5 A;  4E6I A;  4BY1 G;  1FGB D;  1DOK A;  4DAY A;  3EIV A;  2XN9 C;  4JK1 C;  4X66 L;  4ZKC B;  3E6Z X;  2JA5 B;  2V4D A;  4JBM A;  5C0X J;  3VR5 A;  5IWA L;  4Y7N H;  2JXM B;  4A3F H;  1JT8 A;  4ULL A;  4GKJ Q;  3HGB A;  1VMC A;  2CHB D;  5DM7 3;  3BS1 A;  2YU9 B;  4A3I G;  1ASY A;  5E1F A;  4DGZ A;  4JI1 Q;  1YJN A;  2N55 A;  1HNZ Q;  1S40 A;  4Y7N B;  2E2H H;  1PFB A;  4A3F B;  2ZJQ A;  2L12 A;  3TP8 A;  1I4Q A;  1K8M A;  1WTX A;  3NQT A;  1TU2 B;  2H4O A;  1HR0 W;  5C6A A;  1G91 A;  5ELN A;  2QIL A;  1E3P A;  1SDF A;  4XDX A;  2ZT9 C;  2AUK A;  2E2H B;  4KMU C;  1XYI A;  4ABN A;  1RF2 D;  3AMU A;  3S1M H;  3OIP A;  3IKJ A;  3KK7 A;  5I9P A;  3FEW X;  3KUP A;  4KJN A;  1LTG D;  2LMC B;  1VQC A;  4RWS C;  1VQ6 A;  5JEA H;  3PQI A;  1UEB A;  2MGS A;  4LAA A;  4DAM A;  4NMZ A;  1X3G A;  3X3N A;  4OXP A;  4GKK Q;  1GOZ A;  3CCL A;  4NXN Q;  3S1N H;  3NPP A;  1Z7T A;  1XPO A;  2K6A A;  3E9H A;  2B8F A;  3VA5 A;  4XT3 B;  1GUW A;  2PQA B;  1C0A A;  3NSW A;  2ZXO A;  1A6X A;  3KJO A;  3C46 A;  2UXC Q;  2AMC B;  2RVL A;  4OEM B;  4OGQ C;  2LXJ A;  1LT4 D;  4UPA A;  4A93 H;  3AFQ A;  4LF9 L;  3U4V A;  4QMG A;  3PUZ A;  3HOU G;  1STA A;  5HGT A;  2CWP A;  4A93 B;  4YCU A;  2F0G A;  2FHT A;  1A3V A;  4LF6 L;  4B3M L;  4IFD G;  1IHZ A;  1N32 Q;  5EPK A;  1CHP D;  3W1B A;  1TY2 A;  4JG2 A;  2PZW A;  4LFA Q;  1KDA A;  1BOS A;  1LAB A;  3BVZ A;  1AH9 A;  3GTQ H;  3KOJ A;  3EBE A;  2B2Y A;  1Q82 C;  1QB5 D;  1EWC A;  4GN5 A;  1E1O A;  4ME3 A;  3CCQ A;  2EY5 A;  4FVM A;  1ILP A;  2C5C A;  5IYD G;  4LUZ A;  3BDC A;  5BR8 Q;  4P71 A;  4JC0 A;  1SYG A;  3VDY A;  2FMC A;  2WKD A;  2MO0 A;  4K5V A;  4M8A A;  4DV5 L;  4DR1 Q;  1AZQ A;  2UU9 Q;  2AKW B;  1ESR A;  3V96 A;  1D8L A;  4R1J A;  4JI8 L;  2WFW A;  4PMW A;  1O7Y A;  2UUA L;  3J80 E;  1GXD C;  1XMO Q;  2Y0S B;  1Q3L A;  1B44 D;  4LFC L;  1RCV D;  3OYY A;  2QDB A;  2KBN A;  3MFG A;  5LMN Q;  5JPN C;  1EQT A;  2K5D A;  3NEL A;  4HJ5 A;  4DNI A;  3IFD A;  4JI3 Q;  2Q2T A;  3ULP A;  4JI7 L;  1S4Z A;  2Y0S E;  2D5D A;  3G6E A;  4KHZ A;  1YZ6 A;  4KI0 A;  3UDI A;  1GJX A;  4HR7 B;  2EYL A;  3D4D A;  2A6E D;  4NDX A;  5C3X A;  4J6H A;  5C44 G;  4OEL B;  2LSS A;  2HHH L;  3K80 C;  1M8A A;  1QE6 A;  1CA6 A;  3PCO B;  2VZA A;  4WOR A;  3GTL H;  2WP8 J;  4R8I A;  5IY0 A;  1F9Q A;  2A69 C;  3MTS A;  4DR5 Q;  1O7Z A;  3RN2 A;  1EY0 A;  1V1O A;  2D9U A;  1UE1 A;  3E0J A;  3EQL C;  4X3T A;  1X3F A;  5CYU A;  1EYA A;  2E75 C;  4G4K A;  2K4K A;  1DZ1 A;  4MZ9 A;  2R7Z G;  4DN4 M;  2E74 C;  5AJ3 L;  5KND A;  5KNB A;  2H5X A;  2VUM B;  2UXB Q;  1E2V A;  2K04 A;  2Z8L A;  3T53 B;  3I4M G;  3S2H B;  4DV7 L;  5HUR A;  2F0D A;  4DK1 A;  4POG A;  4B3R L;  5KEE A;  1L1O B;  1U4L A;  1VS0 A;  1JIC A;  3JAM c;  3L3O C;  2EPB A;  4LUO A;  1SNM A;  2PZT A;  2WAQ G;  2HCI A;  5E4W C;  2D0O A;  4H02 A;  1KRS A;  1PRT D;  5EPJ A;  3RZD H;  3GO5 A;  3F2C A;  4X3U A;  4ZKB B;  2I5M X;  4BY7 H;  1EWI A;  3CF5 A;  1A63 A;  2GVB A;  4NXM L;  2BA0 A;  2SOB A;  3OWF A;  1E7Z A;  1KTK A;  1SJE D;  5JEA J;  1TQO A;  3NHH A;  3RZD B;  3PF5 A;  4DUY Q;  4RKB A;  1U4R A;  4GKJ L;  3G4S A;  3J7Z C;  2VQE Q;  4IUU A;  4KN7 C;  4DK3 C;  5C3E G;  1DD2 A;  4JI1 L;  3S17 H;  1HNZ L;  2K5W A;  2PZU A;  3HOZ B;  1LT5 D;  4X64 Q;  2JA6 H;  3PIO 3;  1VDZ A;  1II3 A;  4AH6 A;  4C3H H;  3HP3 A;  3HEJ A;  3JAM i;  1K0S A;  4A3D H;  1PTO H;  2KOL A;  3ERQ A;  4UDU C;  3KF6 B;  4C3H B;  4FO2 A;  5LL6 S;  4OWX B;  2JN4 A;  2Z1C A;  1K8O A;  3NTI A;  3P20 A;  4P74 A;  2KA7 A;  4A3D B;  1EY4 A;  1SE3 A;  1VQB A;  4K5W A;  3A8I E;  2PMZ E;  1N36 Q;  1PTO B;  3CXC A;  1G2T A;  5T1G A;  3WOF A;  1QUQ B;  2OT2 A;  2BDO A;  4BWG B;  5FO7 B;  5CMD A;  1K83 B;  2D0P A;  3HFZ B;  1A2U A;  4RMF A;  1ENA A;  2IX3 A;  1VQN A;  1X54 A;  3LWU A;  3I4N H;  1B4O A;  4GKK L;  3E3X A;  1NR4 A;  1VQ7 A;  1KDB A;  1I4R A;  3NEN A;  3HOW G;  1Y1V B;  4YHH Q;  1QVF A;  1VQE A;  4OX9 Q;  1GO3 E;  3OHX C;  4JI0 Q;  4FYD A;  2UXC L;  2K75 A;  2NVT H;  4J8Q A;  2R93 H;  1WTO A;  3U9O A;  1IYU A;  2B2T A;  2ES2 A;  1Y69 U;  4GS3 A;  2XTI A;  1MD2 D;  4CDC C;  1MIU A;  1KL9 A;  4IO9 A;  4LUV A;  5GQO A;  3V2T A;  3PO3 B;  3I55 A;  1JJ2 A;  2R93 B;  1S5B D;  1BCP F;  1JQY D;  3K5L A;  1DYQ A;  3ITP A;  3PV0 A;  2ZTD A;  2K14 A;  3D8G A;  1WTV A;  1WD0 A;  4GOP A;  4O1N A;  4UP9 A;  1AP0 A;  4QF4 A;  1VQ4 A;  5EKL A;  1D2B A;  4KY5 A;  4MTN A;  1SE2 A;  2ZTC A;  4C3J G;  3MFY A;  5IGD A;  1N32 L;  2DJG C;  1NR2 A;  3N52 A;  3Q8D A;  3ND8 A;  1IBM Q;  1GUG A;  5FO8 B;  1B53 A;  1TWC B;  3T4A C;  4LFA L;  1V43 A;  2F0W A;  5D3I B;  3CCV A;  1IW7 D;  1K8A C;  4F88 A;  3A74 A;  5H1S E;  2A6E C;  2RSO A;  5JJZ A;  2RCF A;  2JA8 H;  2HT1 A;  2EYO A;  1EEI D;  1LM0 A;  4NB3 A;  3U50 C;  2CCZ A;  1A8V A;  3M9B A;  1KDC A;  5FLM H;  3I4O A;  3I3C A;  5M3F H;  2DY7 A;  1LAC A;  2QEJ C;  4ME5 A;  3P75 A;  5GAH C;  2JA8 B;  4EX5 A;  1R9T H;  4DR1 L;  2UU9 L;  2XGT A;  5LL6 X;  2ASB A;  3WDN A;  3QO2 A;  2YV5 A;  1BQQ T;  4WJ4 A;  2K01 A;  2L5T A;  5FO9 B;  3IAY A;  1CKN A;  1JOK A;  3DLL A;  1N9W A;  1XMO L;  2DJF C;  5IYB H;  3U58 A;  1R9T B;  3D6C A;  1SYF A;  1HJP A;  3KLS A;  2KJX A;  3IFT A;  1QIL A;  1LO5 D;  2QA4 A;  1STH A;  3RLF A;  3EVQ A;  2F1M A;  5DNF A;  1A0I A;  4O42 A;  1Q8K A;  1VQA A;  1B50 A;  4JI3 L;  4AYB B;  4PV1 C;  4QIW B;  4JOI C;  3MEF A;  4ID6 A;  4RAU C;  2OXP A;  3TEH B;  3DEP A;  5EQ0 A;  3FDT A;  4DV4 Q;  4HTH A;  4CDF C;  3Q23 A;  2R7F A;  2JA7 H;  1B7Y B;  1V8Q A;  2F0N A;  2K03 A;  3MA2 B;  4PQX A;  3CP0 A;  2NB0 A;  4AYB E;  4QIW E;  4IUV A;  1PRT C;  2X6L A;  4RGO S;  2O5I C;  2JA7 B;  3R93 A;  3I72 A;  3NXW A;  4H0L C;  2KCN A;  3KF8 B;  1VQG A;  1EIH A;  1ZYR C;  2B2V A;  4C3I B;  5IYC G;  1E0B A;  5C4H A;  1ONL A;  3HOX G;  2KHJ A;  2IWH A;  4OIJ A;  1YVC A;  1PH5 A;  1N34 Q;  4A3G G;  1I6V C;  2NVY H;  3VR6 A;  3J7Y W;  4LF7 Q;  2KHI A;  4JVZ A;  2F0K A;  1HZC A;  2M00 A;  4A3B B;  1SYE A;  4A3E H;  4GN3 B;  1WTW A;  1HTP A;  4A3J G;  1ZXT A;  4MTK A;  4BBR B;  1X6O A;  3CCR A;  1SRO A;  1IYJ B;  2UXB L;  4YCV A;  2OQK A;  2NVY B;  3JC6 6;  4N9T A;  5K36 H;  2B2W A;  4CHT B;  5IE8 A;  3F2B A;  1LT6 D;  2BA1 A;  2B39 A;  4A3E B;  3HOV G;  4I7Z C;  4KK7 A;  3OTO Q;  3AFP A;  1V9P A;  4A3C H;  5LHY 1;  1TVX A;  3FKI G;  3A54 A;  2YTV A;  3ICE A;  1JE5 A;  2P5Z X;  3KLS X;  1C4Q A;  1GHK A;  1MSH A;  1TWF H;  2NTS A;  3A5Z B;  1ET9 A;  1WYD A;  4ALP A;  4KHV A;  3NWT A;  3VYU A;  4HJ7 A;  3TP7 A;  2B8G A;  3Q6S A;  4KJO A;  4CDE C;  3BVG A;  1XNQ Q;  2LFN A;  1STE A;  4DK0 A;  1N33 Q;  1JJG A;  2B63 G;  1K3R A;  4AIM A;  4A3I H;  1TWF B;  1KRT A;  1FVI A;  2QW7 A;  4L63 B;  2MUY A;  3C2P A;  2NN6 G;  3BYY B;  4DUY L;  1SR3 A;  3KLW A;  1KLG D;  3A8K E;  1TS2 A;  2E5L L;  4CJ2 C;  2VQE L;  1R4P B;  3I73 A;  1SLJ A;  4LJZ C;  1VCI A;  1UEA B;  2JEB I;  1CHQ D;  3OSO A;  3DMU A;  3K5O A;  1NMF A;  2SNS A;  4IFD I;  1Q86 C;  4X64 L;  5KIX A;  4DXF A;  3H0G B;  3PUX A;  2FJ2 A;  1FL0 A;  4F8M A;  1EQQ A;  2ALY B;  1A62 A;  3FMC A;  5IOD A;  2K28 A;  1Q7Y C;  3TZD A;  2A1A A;  3CCE A;  3LGJ A;  2G9H D;  3EA6 A;  2HCC A;  3FRP B;  3T1H Q;  1GUS A;  2G9D A;  4DAY B;  2ZM6 Q;  5C0X G;  2L9H A;  1SND A;  4KV6 A;  3J81 i;  1VF5 C;  1N36 L;  4B3T L;  4JI4 Q;  4IUR A;  4L5R C;  5I6W A;  1L0Y B;  3O13 A;  5M5Y H;  3HKS A;  3M4P A;  2K52 A;  3JAM L;  1Z47 A;  3CRL C;  3M4Q A;  3KLR A;  1WCM B;  2N78 A;  1D5X C;  2CQA A;  3KFU A;  1LT3 D;  3TN2 A;  4LF4 Q;  2IX1 A;  1D7Q A;  3CCJ A;  4DR6 Q;  4YHH L;  2XRS D;  1J6Q A;  1OXU A;  1BXT A;  1CSP A;  1XWE A;  3OW2 A;  1U5K A;  3FP9 A;  1G6Z A;  1DCZ A;  3HRZ C;  4A3K B;  1NY4 A;  1YJ9 A;  4IOA A;  1GUN A;  3EJI A;  1QZH A;  5AFW A;  1TR5 A;  3S1R H;  1EUJ A;  1AFP A;  1JC7 A;  2QKI C;  4WJW A;  3HOU H;  2D62 A;  3G7L A;  2I46 A;  3QJY A;  2VXW A;  1X3E A;  2YYZ A;  4IFD H;  3S2D H;  2E2J H;  1EIF A;  4MHE A;  2F0V A;  5DLQ E;  3C1E A;  1VQL A;  1BBU A;  4R4Q A;  3KBX A;  2B3G A;  3ULL A;  3BVM A;  2R92 H;  4BBS B;  5J22 A;  3DWA A;  1J8I A;  3S2D B;  2YTY A;  1SNC A;  3NTH A;  2CFM A;  5BN5 A;  4FF4 A;  4R4C A;  1IBM L;  3CAM A;  2QF7 A;  2M9V A;  4LFB Q;  2I5H A;  1NAP A;  1NMG A;  1EEF D;  4J15 A;  2R92 B;  4XIG S;  5IYD H;  2LXK A;  3PUY A;  4HIM A;  1SYC A;  2C35 B;  1OTC A;  3UDX A;  2AHO B;  4RKL A;  2HQE A;  3MAQ A;  3UI2 A;  2CKZ B;  4BS9 A;  1A15 A;  4ZLT F;  1FNW A;  1O7L A;  3SVM A;  1VMP A;  4FDB A;  4CKE A;  2MNA A;  1TXY A;  2OEO A;  4Q0F A;  3TME A;  3C3L A;  2VNU D;  2H1E A;  1EZ6 A;  4HID A;  5C4X G;  3GP7 A;  5CGK A;  2BCO A;  2B2U C;  2RBM A;  4QCL A;  3CW2 C;  2F03 A;  3A5U A;  1EIY B;  4YWM A;  2YTX A;  2N8N A;  5GRO A;  1VQJ A;  3S1M B;  4C1N I;  1FNV A;  5IOC A;  5LMU Q;  4B08 A;  5KGU A;  3GTM H;  1YJW A;  2DN8 A;  1VF7 A;  3PO2 G;  2GA4 B;  2K1B A;  4DV4 L;  1L1O C;  3K0Y A;  1Y1W G;  5EPL A;  4JBJ A;  2EOT A;  1E24 A;  1M4V A;  2PCF B;  2Z6K A;  5GAD C;  3S1N B;  5CV5 A;  1KLU D;  2UXD Q;  1VQI A;  3ULJ A;  4DUZ Q;  3CCM A;  1CM9 A;  2PW7 A;  5TSS A;  3M4O H;  5JPM C;  2WB1 B;  1O80 A;  3DUZ A;  5LMN W;  2ICE C;  4CKB A;  1N8R C;  1RHP A;  1Q12 A;  1QVC A;  1XMQ L;  1F9R A;  5EBC A;  3M4O B;  4KKT A;  1KAA A;  5IP9 G;  1YHQ A;  1KIX A;  4OO1 G;  1UWV A;  4UP8 A;  2WB1 E;  1N34 L;  1BR9 A;  1J5E Q;  4LF7 L;  3K0X A;  3S15 H;  3AU7 A;  4XYO A;  4DAP A;  2KUM A;  5ELO A;  4A3L G;  4P75 A;  2B2T C;  2HDM A;  4XQQ A;  4IUP A;  1D5M C;  4TVA B;  3FPP A;  2J7Z A;  1ILQ A;  2RF4 A;  1GKH A;  2JP1 A;  3PSI A;  1EOT A;  1DGS A;  2A6H D;  1W6K A;  3R2I A;  5JJL A;  3OTO L;  1T9H A;  2JA5 G;  3TP6 A;  4G7H C;  2AUJ D;  3GTQ B;  4GLV B;  3PIO A;  1CFM A;  3PIP 3;  4S3S A;  4TRD A;  1YNN C;  1EOV A;  2JK8 A;  1HUM A;  4QL5 A;  3GTP H;  2EYP A;  5FKA C;  1EL0 A;  4X3S A;  3F1Z A;  4DA2 A;  4YWK A;  2VW9 A;  4DR7 Q;  4KHP Q;  4C56 C;  1XNQ L;  1PTO C;  2ZJR A;  1N33 L;  4CKC A;  3E5S A;  5C3W A;  2WIN B;  4A3F G;  4HSV A;  4IAL A;  1BO0 A;  2G5D A;  3D31 A;  3HZX A;  5FLX c;  4A75 A;  4R4I A;  4ZYS A;  3W1G A;  1HZB A;  3ER0 A;  5FK9 C;  4KY6 A;  1SXT A;  2Z6B A;  2K7V A;  1RL2 A;  3K5N A;  1JE4 A;  3KDF A;  2F0Q A;  2Z4H A;  5CV7 A;  2V1C C;  1J9O A;  2EYH A;  1H9S A;  5M9O A;  5C4Z A;  3MVV A;  4HN7 A;  2ICI A;  1V1Q A;  1X65 A;  4LF5 Q;  3WWV A;  3G6J B;  5EAY A;  4X65 Q;  1Z6H A;  3TDQ A;  3T1H L;  3U4Z A;  4IFD J;  1NCV A;  5JEA G;  2ZM6 L;  1S3O A;  1X32 A;  1PH9 A;  5KYI A;  4ZQ3 A;  1HFN A;  3CPF A;  4HJ9 A;  3C1F A;  5JJK A;  3T13 A;  4JI4 L;  1K28 A;  3GD7 A;  2EIF A;  3HOW H;  1G2S A;  3H3V I;  2IY5 B;  2NTT A;  1Q46 A;  2NVQ H;  5COR A;  3GTL B;  1OXX K;  2PO4 A;  1FD7 D;  3GV3 A;  1SEB D;  3CCS A;  3RR5 A;  4GNX A;  1PVO A;  4OWT B;  3DWQ A;  1PH6 A;  4LF4 L;  1I3Q H;  1YEZ A;  4DR6 L;  1B70 B;  1YIJ A;  3Q0A A;  3KBG A;  2NVQ B;  3Q22 A;  3HKZ B;  2EJM A;  2R7D A;  3RNU A;  1IZ6 A;  2FMM A;  1D5Z C;  3RN5 A;  4A93 G;  2VB2 X;  1EY8 A;  1Q1B A;  3J81 L;  4KKS A;  2CQO A;  2JSO A;  4DV2 Q;  1I3Q B;  3ZYY X;  1H95 A;  1MBY A;  1ML0 D;  2K5N A;  1I4P A;  3DM3 A;  1LUZ A;  3HKZ E;  1X3P A;  1CKO A;  3TP5 A;  4C3J H;  4DNR B;  3CRK C;  1ZKO A;  2BE5 D;  4KTA A;  4U68 A;  5I2X A;  4ZRZ A;  1PHJ A;  1NBW A;  2VB3 X;  3URY A;  1HFG A;  3CQZ H;  1Y8N B;  4PZ6 A;  1TY0 A;  3QG1 A;  4L6T B;  5HY6 A;  2KHS A;  2EE1 A;  1OO9 B;  4DPG A;  4HMJ A;  1P16 A;  3JAM E;  4LFB L;  4BY7 B;  2GN5 A;  2B2W C;  3G71 A;  1YBY A;  1RIP A;  2XSC A;  4K8I A;  3A55 A;  5JJI A;  2MJ8 A;  4IOC A;  3MXP A;  3SK5 A;  4JI5 Q;  3VR4 A;  1DOL A;  1G8Z D;  2EVB A;  1TS3 A;  2IJ0 A;  1PZI D;  4KLK A;  3H3V H;  1F9S A;  3K7U C;  2E2D C;  2Y0S G;  3CC7 A;  1K0R A;  4QUC A;  2N3S A;  2KCC A;  1BKB A;  2PMZ B;  1W2B A;  3F2D A;  3S17 B;  1Y14 B;  2JQO A;  2RA4 A;  4GOP B;  2JA6 B;  1EWH A;  1NE3 A;  1D1K A;  3MXG A;  3I90 A;  2QDL A;  5NUC A;  2JEA I;  2F3W A;  3UDG A;  1XPU A;  5IT9 L;  1Q90 A;  1EIG A;  4L8J A;  1PMR A;  4K14 A;  1CUK A;  1SAP A;  4EVO A;  1VQP A;  2XWJ B;  2RDH A;  3PUW A;  4FXG C;  2NVX H;  3G48 A;  4QB4 A;  1BCP B;  5LMU L;  1K3B C;  4NXN L;  1PZK D;  4A3M H;  1ZEQ X;  1SRU A;  4L5T A;  1O7I A;  3QIA A;  2NVX B;  4YY3 Q;  3L9A X;  3I4N B;  1JCK B;  2NN6 I;  2BH8 A;  2SNM A;  2X69 A;  4ZUJ A;  2UXD L;  4A3M B;  1HH2 P;  4DUZ L;  1KNA A; 
#chains in the Genus database with same CATH homology
 3R8B A;  1A3U A;  2NVT B;  5IGF A;  3DXJ C;  4FP5 D;  4V19 0;  3CKI B;  4XXE A;  5ISR A;  2L4N A;  1T5X D;  1CK1 A;  1PLF A;  3J7A F;  1V1P A;  2K32 A;  2FIN B;  1SBB B;  1LV9 A;  3TZU A;  1EY7 A;  2K33 A;  1LTB D;  4BA2 I;  1HA6 A;  3NQI A;  4KN4 C;  1D1I A;  5I9O A;  1MGS A;  1LLR D;  1XTC D;  1JOO A;  1PXU A;  2D2C C;  2NN6 H;  5M3F B;  1DOM A;  1WTQ A;  3GTG B;  1U4M A;  4TSS A;  4G7Z C;  1STG A;  4K6L A;  1H9J A;  1GUT A;  5A35 A;  4C3H G;  1H9R A;  3A7A B;  1I50 B;  2F0H A;  1I4X A;  2IW3 A;  4RHS A;  4ILW A;  3ONA B;  3OMG A;  3VYT A;  1F2M A;  4K2L A;  3WOE A;  2IX0 A;  2WAC A;  1SE4 A;  5DEH A;  2M2L A;  1STY A;  1JWU D;  3MEH A;  5DAU A;  4IQZ A;  2IL8 A;  1BUV T;  4U67 3;  5IGC A;  1SNQ A;  3D6W A;  5C5M A;  1QWY A;  4TKO B;  3DHQ A;  4FNF A;  2L1B A;  1AEX A;  3K6O A;  4RHR A;  5M3M B;  1AN8 A;  3HOY B;  2K5Q A;  5FLX L;  3X3M A;  3VYS A;  4P2C B;  4IUQ A;  4BA1 I;  3S14 B;  1CQV A;  2WKC A;  1C48 A;  2QCP X;  4H44 C;  2IPK D;  1DXM A;  3A56 A;  1EFI D;  3CHB D;  3MXN A;  3K57 A;  4BY1 B;  1TS5 A;  3FVQ A;  4EQN A;  3M7N A;  5EKI A;  1B3A A;  4ZAI A;  1F77 A;  2ID0 A;  2B2Y C;  3SK8 A;  2O2L D;  1QNU A;  2N88 A;  2XNA C;  1AW7 A;  4A3I B;  2F0U A;  5ELE A;  1KNE A;  3D4R A;  3T56 B;  2FFK B;  1DJR D;  5EKK A;  3J81 E;  4HED A;  3R2T A;  4J1M A;  5C5L A;  2DY8 A;  2PPB C;  5CBA E;  5JVH 3;  3D3R A;  1C8C A;  5COY A;  2PYK A;  1R4Q B;  3P1H A;  1S5D D;  1SNO A;  5IGB A;  1WTR A;  4OIK A;  2DNE A;  3L7Z C;  1IYV A;  1S5C D;  1TWH B;  2KVM A;  3Q24 A;  2WII B;  2LS0 1;  1SYB A;  4FXK C;  1PYW D;  1IW7 C;  2CVR A;  5CV4 A;  1RDP D;  1S5E D;  1YNJ D;  1BCP D;  2AWN A;  2AQ3 B;  5M5Y B;  1Y8P B;  4C3I G;  1B9M A;  2NWG A;  2A68 D;  3NUC A;  1E2W A;  2Q8T A;  4ZK9 B;  4RFB A;  4QUF A;  2EZV A;  3OOC A;  3ERO A;  2DNC A;  2EY1 A;  2EJG C;  4ODG A;  3BYT B;  3K58 A;  3M3Y B;  5DM6 3;  4CBV A;  3S1R B;  3HOU B;  5M5W B;  1WVL A;  5IGG A;  1EYC A;  5IT9 E;  3LX0 A;  2BOS A;  1OXS C;  2E2J B;  1HTL D;  3N6R A;  1U4P A;  1QOH A;  5CV6 A;  2F0P A;  1L0X B;  3V05 A;  1SMY D;  3PUV A;  4DXG A;  1AZP A;  4HSP A;  3P7J A;  4NKL A;  4CJ0 B;  2A69 D;  4KD4 A;  1DON A;  3QOJ A;  4PMB A;  2EYM A;  4RGN A;  1FR3 A;  1SFO B;  2E2I B;  1EU4 A;  5I6Y A;  1PRT F;  2TSS A;  3MHB A;  1RKN A;  2XVS A;  4F7X A;  1TWA B;  1PDQ A;  4DFA A;  5C4J B;  4RCO A;  1S5F D;  2F3V A;  4KD3 A;  1LTS D;  1MSG A;  1Q8I A;  2F4I A;  3QOL A;  1ENF A;  1F2Z A;  2C9O A;  1TKW B;  2J0T D;  4YIJ A;  3I8Z A;  5EGT A;  1JOR A;  5CR3 A;  2XRQ D;  3NBH A;  5C44 B;  3M85 A;  2O4X A;  2EYF A;  3GTM B;  1H9K A;  1NUC A;  3M7G A;  2RDG A;  2KED A;  3VR3 A;  1CQF A;  4TQU S;  4GZY C;  2XIW A;  3T16 A;  4MIU A;  4R8N A;  3RMH A;  2A74 C;  3K5M A;  2Z4I A;  2SDF A;  4IUN A;  1H9S B;  2R7Z B;  4DAV A;  1QJO A;  2KQ3 A;  5IIF A;  2A5H A;  3I4M B;  1Q1E A;  3BDL A;  5D14 A;  3S15 B;  3DM1 A;  4K5X A;  4C2M B;  1W6J A;  3BZD B;  1OXT A;  1RTN A;  3H3V C;  1EZ8 A;  2WAQ B;  1BNZ A;  1TS4 A;  1IL8 A;  2ZXR A;  1IKM A;  5BN4 A;  4N9P A;  4RGM A;  4IUT A;  4DF7 A;  3GTP B;  3I91 A;  2F0O A;  1JOQ A;  3H09 A;  1YNJ C;  2JYO A;  1BCP C;  3SXH A;  1XX8 A;  2F0M A;  1WTP A;  3OW7 A;  5C3E B;  2A68 C;  4G7O C;  1OXV A;  1ICW A;  1RD9 D;  5FOB B;  5FLX E;  1CA5 A;  4FF2 A;  3DEO A;  1BBX C;  3NBI A;  2F0L A;  1HXY D;  4Q5V A;  1ESF A;  5M5X B;  3FPU B;  1QNK A;  2R3Z A;  3HS0 C;  1EYD A;  5J39 A;  2AQ1 B;  4B9X A;  3H6M A;  2XWB B;  2EXZ A;  1HA5 A;  2PQE A;  1JWM D;  1PFN A;  5IGE A;  1BDO A;  1EU3 A;  3QWN A;  4RGT A;  2SEB D;  1SMY C;  2MP1 A;  1A2T A;  3GTK B;  4EQO A;  3HOW B;  1EY5 A;  1NSN S;  1QG7 A;  3LNN A;  3BDO A;  4XYQ A;  4KKU A;  3NP8 A;  4HCS A;  4K2K A;  2B2V C;  1GUO A;  3MXU A;  1EQV A;  4CGY B;  1A3T A;  1RJT A;  4LK1 C;  2KEC A;  4C1N K;  4X3K A;  3CU7 A;  1E2Z A;  1CTM A;  2L11 A;  3MZ5 A;  1SNP A;  3SK4 A;  4C3J B;  3ND9 A;  2O5J C;  2EYJ A;  4V0B A;  3NTK A;  5K5P A;  4DNT B;  3CQZ B;  3J7A V;  4M1U B;  3M4Y A;  3S9W A;  4OL7 A;  4XT1 B;  1SJH D;  1ZYR D;  5A2Q L;  5G3L F;  4R9W A;  3PMF A;  1CZW A;  2B2U A;  1HRJ A;  1BF4 A;  2NYZ D;  3MC0 B;  1JB3 A;  2CW0 D;  1HUN A;  5EBD A;  4ZUI A;  3A8J E;  1LTT D;  2E76 C;  1V1P B;  2LY7 A;  2MHV A;  2X6G A;  3NWS A;  3S16 B;  2F0S A;  2I07 B;  3I4L A;  1HPC A;  1JWS D;  3VYR A;  2RSN A;  1FYC A;  2F0I A;  3SE0 A;  2A6H C;  5JOB A;  2R6G A;  5CBE E;  4XQN A;  3W2D A;  4PNY A;  2NZ1 D;  4HMI A;  3IL8 A;  4RA8 A;  3HG9 A;  2RDF A;  1I4H A;  5KRU A;  2MPM A;  3RUZ A;  2AWO A;  2HUG A;  4WRD A;  1F9P A;  3OWE B;  2NUC A;  5CV8 A;  4G57 A;  3K59 A;  2TMP A;  3HOX B;  1PTO F;  1CI3 M;  3K7A B;  2LKV A;  2EJF C;  4K8J A;  1O78 A;  3BG3 A;  4A3G B;  2L55 A;  5D3D A;  5F2D A;  2PNR C;  3U9S A;  3SEB A;  3W3A A;  4A3J B;  5C0X I;  3GTJ B;  3S1Q B;  1HQR D;  3TBI B;  3OIQ A;  5I4D A;  5KYL A;  1UAP A;  5JVG 3;  2F0F A;  3HOV B;  1EY9 A;  1TII D;  1B1Z A;  4Z9C B;  2EY2 A;  3FKI B;  4XQJ A;  4KY7 A;  1PZJ D;  4F87 A;  4I65 A;  4UAI A;  3H94 A;  5E4X A;  4EGV A;  3SDZ A;  1HHV A;  2B63 B;  3D4W A;  3VA7 A;  2AQ2 B;  1F2Y A;  4FXD A;  5ELB A;  3OPO A;  1DM0 B;  2F0T A;  1HCZ A;  4NW2 A;  3DWP A;  5J1Z A;  2IT1 A;  4OHJ A;  3OMC A;  5C0X H;  1TWG B;  1LTR D;  2BE5 C;  3H91 A;  1CT1 D;  1IKL A;  1UNS A;  1WD1 A;  2RKS A;  1I6H B;  4DU9 A;  3AB9 A;  1Y8O B;  3TSS A;  4JBW A;  1UUP A;  1CZG A;  4LMQ D;  2F0J A;  4RH6 A;  1GHJ A;  3SR1 A;  2JE6 I;  3J80 L;  1STN A;  3RZO B;  1HQM C;  1EY6 A;  4EQP A;  2WV6 D;  1SYD A;  2EDG A;  2CW0 C;  1LTA D;  2RQX A;  2OF1 A;  2ZXP A;  2J4X A;  1STB A;  1ET6 A;  3NE5 B;  4IN3 A;  5CC4 A;  5ELC A;  5D65 A;  5G3L D;  4HCE A;  4NP5 A;  2K05 A;  1T5E A;  2R61 A;  1B2T A;  2HDL A;  4MN3 A;  2NBF A;  4HAE A;  4OO1 I;  5E3F A;  4CJ1 B;  3SHL A;  3KF8 A;  1ENC A;  1H9M A;  1SSO A;  2PW5 A;  1RTO A;  3F2U A;  3GV6 A;  4WFN 3;  3T51 B;  4PMC A;  5BN3 A;  1JR0 D;  5C4X B;  1PFM A;  5ELF A;  3RD4 A;  3NK9 A;  2A73 B;  1MI2 A;  5ELD A;  2ENB A;  3R3O A;  2BDN A;  3GQB A;  4H13 C;  3QB3 A;  3PO2 B;  4FF3 A;  3VR2 A;  1YNN D;  5EJW A;  3I70 A;  4IZ8 A;  1Y1W B;  1PTO D;  5KNC A;  5A2Q E;  3GTO B;  4B9W A;  1FNU A;  1TT2 A;  3LWE A;  3EFX D;  2F0E A;  3SK6 A;  5I2Y A;  4RCN A;  4H7B A;  5JAV A;  4OO1 H;  5CV9 A;  1XXG A;  4FF1 A;  1X3Q A;  2KEE A;  2Q8I B;  2Q8R E;  1G29 1;  4XTC S;  4K6D A;  1ROD A;  1D6E C;  3MWY W;  1I4G A;  1KAB A;  1LTI D;  5K36 G;  3A7L A;  1QCB D;  1PRT B;  1U9R A;  1F2L A;  2EY6 A;  2L0C A;  5T1I A;  1B9N A;  4E6I A;  1FGB D;  1DOK A;  4DAY A;  2XN9 C;  4JK1 C;  4ZKC B;  3E6Z X;  2JA5 B;  2V4D A;  5C0X J;  3VR5 A;  2JXM B;  4ULL A;  3HGB A;  1VMC A;  2CHB D;  5DM7 3;  3BS1 A;  2YU9 B;  5E1F A;  4DGZ A;  2N55 A;  4Y7N B;  1PFB A;  4A3F B;  2L12 A;  3TP8 A;  1I4Q A;  1K8M A;  1WTX A;  3NQT A;  1TU2 B;  2H4O A;  5C6A A;  1G91 A;  2QIL A;  1SDF A;  4XDX A;  2ZT9 C;  2AUK A;  2E2H B;  4KMU C;  1XYI A;  4ABN A;  1RF2 D;  3AMU A;  3OIP A;  3IKJ A;  3KK7 A;  5I9P A;  3FEW X;  3KUP A;  4KJN A;  1LTG D;  2LMC B;  4RWS C;  5JEA H;  2MGS A;  4LAA A;  4NMZ A;  3X3N A;  1GOZ A;  3NPP A;  1Z7T A;  2K6A A;  2B8F A;  3VA5 A;  4XT3 B;  1GUW A;  3NSW A;  2ZXO A;  1A6X A;  3C46 A;  2RVL A;  4OGQ C;  1LT4 D;  4QMG A;  3PUZ A;  1STA A;  5HGT A;  4A93 B;  2F0G A;  2FHT A;  1A3V A;  4IFD G;  1IHZ A;  5EPK A;  1CHP D;  1TY2 A;  2PZW A;  1KDA A;  1BOS A;  1LAB A;  3BVZ A;  2B2Y A;  1QB5 D;  1EWC A;  2EY5 A;  4FVM A;  1ILP A;  2C5C A;  3BDC A;  1SYG A;  2FMC A;  2WKD A;  4K5V A;  4M8A A;  1AZQ A;  1ESR A;  3V96 A;  4PMW A;  1O7Y A;  3J80 E;  1GXD C;  2Y0S B;  1Q3L A;  1B44 D;  1RCV D;  2QDB A;  3MFG A;  5JPN C;  1EQT A;  2K5D A;  3IFD A;  1S4Z A;  2D5D A;  4KHZ A;  4KI0 A;  1GJX A;  4HR7 B;  2EYL A;  5C3X A;  2A6E D;  3D4D A;  4NDX A;  4J6H A;  1M8A A;  1QE6 A;  1CA6 A;  4WOR A;  2WP8 J;  4R8I A;  1F9Q A;  2A69 C;  3MTS A;  1O7Z A;  1EY0 A;  1V1O A;  2D9U A;  3E0J A;  3EQL C;  4X3T A;  5CYU A;  1EYA A;  2E75 C;  4G4K A;  1DZ1 A;  4DN4 M;  2E74 C;  5KND A;  5KNB A;  2VUM B;  1E2V A;  2K04 A;  2Z8L A;  3T53 B;  3S2H B;  5HUR A;  2F0D A;  4DK1 A;  5KEE A;  1U4L A;  1JIC A;  3L3O C;  2EPB A;  1SNM A;  2PZT A;  2HCI A;  5E4W C;  1PRT D;  5EPJ A;  3GO5 A;  4X3U A;  4ZKB B;  2BA0 A;  2SOB A;  3OWF A;  1KTK A;  1SJE D;  5JEA J;  1TQO A;  3NHH A;  3RZD B;  4RKB A;  1U4R A;  4IUU A;  4KN7 C;  1DD2 A;  2K5W A;  2PZU A;  3HOZ B;  1LT5 D;  3PIO 3;  1VDZ A;  1II3 A;  3HP3 A;  3HEJ A;  1PTO H;  2KOL A;  3ERQ A;  4UDU C;  4C3H B;  4FO2 A;  5LL6 S;  2Z1C A;  1K8O A;  3NTI A;  3P20 A;  2KA7 A;  4A3D B;  1EY4 A;  1SE3 A;  4K5W A;  3A8I E;  1PTO B;  1G2T A;  5T1G A;  3WOF A;  2OT2 A;  2BDO A;  4BWG B;  5FO7 B;  5CMD A;  1K83 B;  1A2U A;  1ENA A;  2IX3 A;  3LWU A;  1B4O A;  1NR4 A;  1KDB A;  1I4R A;  1Y1V B;  3OHX C;  4FYD A;  4J8Q A;  1WTO A;  3U9O A;  1IYU A;  2B2T A;  1Y69 U;  1MD2 D;  3V2T A;  3PO3 B;  2R93 B;  1S5B D;  1BCP F;  1JQY D;  3K5L A;  1DYQ A;  3ITP A;  3PV0 A;  3D8G A;  1WTV A;  1WD0 A;  4O1N A;  1AP0 A;  4QF4 A;  5EKL A;  1D2B A;  4KY5 A;  1SE2 A;  4C3J G;  5IGD A;  3MFY A;  1NR2 A;  3N52 A;  3ND8 A;  1GUG A;  5FO8 B;  1B53 A;  1TWC B;  3T4A C;  1V43 A;  2F0W A;  5D3I B;  1IW7 D;  4F88 A;  2A6E C;  2RSO A;  5JJZ A;  2EYO A;  1EEI D;  1KDC A;  3I3C A;  2DY7 A;  1LAC A;  2QEJ C;  4ME5 A;  3P75 A;  2JA8 B;  5LL6 X;  3WDN A;  3QO2 A;  1BQQ T;  2K01 A;  2L5T A;  5FO9 B;  3IAY A;  1JOK A;  1R9T B;  3D6C A;  1SYF A;  3KLS A;  2KJX A;  3IFT A;  1QIL A;  1LO5 D;  1STH A;  3RLF A;  3EVQ A;  2F1M A;  5DNF A;  4O42 A;  1B50 A;  4AYB B;  4PV1 C;  4QIW B;  4ID6 A;  4RAU C;  2OXP A;  3DEP A;  5EQ0 A;  3FDT A;  4HTH A;  3Q23 A;  2F0N A;  1V8Q A;  2K03 A;  3MA2 B;  4PQX A;  2NB0 A;  4IUV A;  1PRT C;  2X6L A;  4RGO S;  2O5I C;  2JA7 B;  3R93 A;  3I72 A;  3NXW A;  4H0L C;  2KCN A;  1EIH A;  1ZYR C;  2B2V A;  4C3I B;  1E0B A;  5C4H A;  1ONL A;  2IWH A;  4OIJ A;  1I6V C;  3VR6 A;  3J7Y W;  2F0K A;  2M00 A;  4A3B B;  1SYE A;  1WTW A;  1HTP A;  1ZXT A;  4BBR B;  4N9T A;  2NVY B;  5K36 H;  2B2W A;  4CHT B;  1LT6 D;  2BA1 A;  2B39 A;  4A3E B;  4I7Z C;  4KK7 A;  5LHY 1;  1TVX A;  3A54 A;  3KLS X;  1C4Q A;  1GHK A;  1MSH A;  2NTS A;  1ET9 A;  4KHV A;  3NWT A;  3VYU A;  3TP7 A;  2B8G A;  3Q6S A;  4KJO A;  3BVG A;  2LFN A;  1STE A;  4DK0 A;  1TWF B;  4L63 B;  2MUY A;  3C2P A;  2NN6 G;  3BYY B;  1KLG D;  3A8K E;  1TS2 A;  4CJ2 C;  1R4P B;  3I73 A;  4LJZ C;  1VCI A;  1UEA B;  2JEB I;  1CHQ D;  3OSO A;  3DMU A;  3K5O A;  2SNS A;  4IFD I;  5KIX A;  4DXF A;  3H0G B;  3PUX A;  2FJ2 A;  4F8M A;  3FMC A;  5IOD A;  2K28 A;  3TZD A;  2G9H D;  3EA6 A;  2HCC A;  3FRP B;  1GUS A;  2G9D A;  5C0X G;  2L9H A;  1SND A;  4KV6 A;  1VF5 C;  4IUR A;  5I6W A;  1L0Y B;  3O13 A;  3JAM L;  1Z47 A;  3CRL C;  3KLR A;  1WCM B;  1D5X C;  2CQA A;  1LT3 D;  3TN2 A;  2IX1 A;  2XRS D;  1OXU A;  1BXT A;  1XWE A;  1G6Z A;  1DCZ A;  3HRZ C;  4A3K B;  1GUN A;  3EJI A;  5AFW A;  1TR5 A;  1AFP A;  1JC7 A;  2QKI C;  4WJW A;  2D62 A;  3G7L A;  2I46 A;  3QJY A;  2VXW A;  2YYZ A;  4IFD H;  4MHE A;  2F0V A;  3C1E A;  3KBX A;  3BVM A;  4BBS B;  5J22 A;  3DWA A;  1J8I A;  3S2D B;  1SNC A;  3NTH A;  5BN5 A;  4FF4 A;  2QF7 A;  2M9V A;  1NAP A;  1EEF D;  2R92 B;  4XIG S;  3PUY A;  1SYC A;  4RKL A;  2HQE A;  3MAQ A;  3UI2 A;  4BS9 A;  1A15 A;  4ZLT F;  1FNW A;  1O7L A;  3SVM A;  1VMP A;  4CKE A;  2OEO A;  4Q0F A;  3TME A;  3C3L A;  2VNU D;  2H1E A;  1EZ6 A;  3GP7 A;  5CGK A;  2BCO A;  2B2U C;  2RBM A;  4QCL A;  2F03 A;  3S1M B;  4C1N I;  1FNV A;  5IOC A;  4B08 A;  5KGU A;  2DN8 A;  1VF7 A;  2GA4 B;  2K1B A;  3K0Y A;  5EPL A;  2EOT A;  1M4V A;  2PCF B;  3S1N B;  5CV5 A;  1KLU D;  1CM9 A;  2PW7 A;  5TSS A;  5JPM C;  2WB1 B;  1O80 A;  3DUZ A;  2ICE C;  4CKB A;  1RHP A;  1Q12 A;  5EBC A;  1F9R A;  3M4O B;  4KKT A;  1KAA A;  4OO1 G;  1BR9 A;  3AU7 A;  4XYO A;  4DAP A;  2KUM A;  2B2T C;  2HDM A;  4XQQ A;  4IUP A;  1D5M C;  3FPP A;  2J7Z A;  1ILQ A;  2JP1 A;  1EOT A;  2A6H D;  1W6K A;  3R2I A;  3TP6 A;  4G7H C;  2AUJ D;  3GTQ B;  1CFM A;  3PIP 3;  4S3S A;  4TRD A;  1YNN C;  1HUM A;  2EYP A;  5FKA C;  1EL0 A;  4X3S A;  4DA2 A;  4C56 C;  1PTO C;  4CKC A;  3E5S A;  5C3W A;  2WIN B;  4IAL A;  4HSV A;  1BO0 A;  3D31 A;  3HZX A;  4ZYS A;  5FK9 C;  4KY6 A;  1SXT A;  2K7V A;  3K5N A;  1JE4 A;  2F0Q A;  2Z4H A;  5CV7 A;  1J9O A;  2EYH A;  1H9S A;  5M9O A;  5C4Z A;  3MVV A;  4HN7 A;  2ICI A;  3G6J B;  1Z6H A;  3TDQ A;  4IFD J;  1NCV A;  5JEA G;  1X32 A;  5KYI A;  4ZQ3 A;  1HFN A;  3C1F A;  3T13 A;  3GD7 A;  1G2S A;  2NTT A;  5COR A;  3GTL B;  1OXX K;  2PO4 A;  1FD7 D;  3GV3 A;  1SEB D;  3DWQ A;  3Q0A A;  3KBG A;  2NVQ B;  3Q22 A;  3HKZ B;  2EJM A;  2FMM A;  1D5Z C;  2VB2 X;  1EY8 A;  1Q1B A;  3J81 L;  4KKS A;  2JSO A;  1I3Q B;  3ZYY X;  1MBY A;  1ML0 D;  1I4P A;  1X3P A;  3TP5 A;  4DNR B;  3CRK C;  1ZKO A;  2BE5 D;  4KTA A;  4U68 A;  5I2X A;  4ZRZ A;  2VB3 X;  3URY A;  1HFG A;  1Y8N B;  1TY0 A;  3QG1 A;  4L6T B;  2KHS A;  2EE1 A;  1OO9 B;  4HMJ A;  3JAM E;  4BY7 B;  2B2W C;  2XSC A;  4K8I A;  3A55 A;  2MJ8 A;  3MXP A;  3SK5 A;  3VR4 A;  1DOL A;  1G8Z D;  2EVB A;  1TS3 A;  2IJ0 A;  1PZI D;  1F9S A;  2E2D C;  4QUC A;  2KCC A;  2PMZ B;  3S17 B;  2RA4 A;  2JA6 B;  1EWH A;  1D1K A;  3MXG A;  3I90 A;  5NUC A;  2JEA I;  2F3W A;  5IT9 L;  1Q90 A;  1EIG A;  4L8J A;  1PMR A;  4K14 A;  1SAP A;  4EVO A;  2XWJ B;  2RDH A;  3PUW A;  4FXG C;  4QB4 A;  1BCP B;  1PZK D;  1ZEQ X;  3QIA A;  2NVX B;  3L9A X;  3I4N B;  1JCK B;  2NN6 I;  2SNM A;  2X69 A;  4ZUJ A;  4A3M B;  1KNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...