2DNEA

Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
108
structure length
108
Chain Sequence
GSSGSSGQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
total genus 11
structure length 108
sequence length 108
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dneA00
1GUOA 2BE5C 2E76C 2NN6I 1Q12A 2E75C 3A8JE 3ND8A 1Y69U 4GZYC 1H9RA 3FPPA 2A6HD 1A6XA 3U9SA 3MFYA 2BDOA 2O5IC 3T56B 4BA2I 3ND9A 2JXMB 4KKSA 2AWOA 3BG3A 5A35A 3EQLC 4KI0A 1E2VA 1Z7TA 4IFDH 1CTMA 1B9MA 1YNJC 2L5TA 3PV0A 4JK1C 3I4LA 2IT1A 1IYVA 3VR6A 1OXVA 3H94A 2F1MA 3MXUA 2QF7A 3GD7A 1CI3M 4I7ZC 2K7VA 2V4DA 1VDZA 2DNCA 1GUSA 3RLFA 1GUTA 4XIGS 4IQZA 5KNBA 1V8QA 3SE0A 4KN7C 3PUVA 3QIAA 2D62A 3A7AB 2Q8IB 3P20A 3A8IE 1Q1EA 2LMCB 2NN6H 4BA1I 5C0XH 2DN8A 2AUJD 3PUYA 3QJYA 5K36G 4LK1C 5KNDA 2EJMA 1ZYRC 2B8GA 3OOCA 3HGBA 4TQUS 3PUWA 2EJGC 5K36H 4LJZC 4G7ZC 3T51B 1K8MA 3FMCA 4DNTB 1IYUA 3PUZA 3I73A 3VR2A 2JEAI 4OO1H 4OO1G 1HQMC 2AUKA 1ONLA 3LNNA 1Y8PB 4H0LC 2NN6G 2A68D 2PCFB 1ZKOA 3OW7A 2BA1A 2KA7A 2E74C 5JEAH 1H9SA 1QJOA 2A69C 4XTCS 4H44C 3WDNA 1GHKA 1GJXA 1K8OA 1HCZA 3IFTA 2A68C 1G291 2EJFC 1CFMA 4DNRB 4DK0A 1GUNA 4DK1A 5KNCA 2A69D 2D2CC 3I72A 2A6EC 1DXMA 1IW7D 1VCIA 2JEBI 1E2ZA 1B9NA 4PV1C 1LABA 3GQBA 3VR4A 5JEAG 2B8FA 1LACA 2A6HC 5BN4A 3SDZA 1E2WA 1EWHA 3VR5A 3M85A 1IW7C 1Q1BA 5BN3A 3OPOA 2EVBA 4KKUA 3VA7A 3LWUA 1FR3A 1OXSC 2D5DA 3DXJC 2K33A 4KMUC 3VR3A 2R6GA 3T53B 2PPBC 4KHZA 1BDOA 1FYCA 4H13C 1V43A 1H9SB 3AB9A 3PUXA 4HR7B 1Y8NB 4L8JA 2ZT9C 4TKOB 5C0XG 4G7HC 1H9MA 3L7ZC 3KLRA 1OXUA 3A8KE 2CW0C 3NE5B 4JBWA 1GHJA 1DCZA 1Z6HA 3D4RA 1Y8OB 3N6RA 2O5JC 1DD2A 1Q90A 2JE6I 4G7OC 2K32A 1O78A 1T5EA 1YNNC 3A7LA 3CRLC 4IFDG 3TZUA 3CRKC 1PMRA 1VF7A 3QG1A 1GUGA 1I6VC 1OXXK 1HPCA 2DNEA 4RCNA 2YYZA 5BN5A 1VF5C 2BA0A 4KKTA 3BDOA 4OGQC 3D31A 2KCCA 4KN4C 1HTPA 1TKWB 1TU2B 3M4YA 2EDGA 1H9JA 2BE5D 3IKJA 1H9KA 3M7NA 1OXTA 3W3AA 2A6ED 2PNRC 1SMYC 1O7LA
chains in the Genus database with same CATH superfamily
2UU9Q 1VQ6A 1QVCA 2VQEQ 4WJWA 5CYUA 3M4PA 2RCFA 1FL0A 2JXMB 3K0YA 4KKSA 4A3DB 2A8VA 1DGSA 2L5TA 3I4LA 1IYVA 2FHTA 4A3KH 4M8AA 1UE1A 2AWNA 3TSSA 2E2HB 2CW0D 4OWTB 5J39A 4DV7L 1YHQA 3P1HA 2IHFA 4IUTA 1A2TA 2IY5B 2Q8IB 3P20A 1I5FA 2SNSA 3RZDB 2NVXH 1BVSA 1ZXTA 4JI3Q 2JA6G 1U4LA 4IN3A 4RKBA 4AQYQ 3K5NA 3I4NB 1WVLA 4LF7L 1WCMG 1L1OB 3NUCA 4K2LA 4C3JH 3PQIA 1XMQQ 1B2TA 3CXCA 4GKJL 1N8RC 1B8AA 2E74C 3TEHB 1QG7A 1S3OA 4TVAB 1JE4A 3PIOA 2IJ0A 3TP7A 1CFMA 1AN8A 4ZAIA 4IPDA 2D2CC 3RUZA 4DK1A 2WKDA 5E4XA 2EYLA 2A6EC 3UDGA 1NY4A 4ZYSA 5IGEA 1F2MA 2UXBL 2OQ0A 3DM1A 2F3VA 2UUBL 3BZDB 1PYWD 3I8ZA 4PZ7A 1YNJD 2NYZD 3S2HB 1PZID 1PH1A 4FO2A 2UXBQ 5CV8A 3FDTA 4DAMA 2X6GA 2PO4A 1AW7A 1E1TA 2NTSA 4NXNL 3S1MB 1GUWA 2X69A 1B4OA 2B2WA 3CCLA 3AYHB 3C46A 1GM5A 3FHWA 2K28A 4WRDA 2MQHA 3BDCA 1T5XD 3JAME 4NB3A 1O7YA 3A7LA 3CRLC 3ZJYC 1VF7A 3KUPA 1I6VC 1BXTA 2F0VA 2MPMA 2SNMA 1AFPA 4IOCA 5C44H 2B2VC 3PIO3 1AZPA 4Y52H 2CHBD 5C0XJ 3HFZB 1IXRA 1WTHA 4ZUIA 1RTOA 1VQGA 1TWHB 2OT2A 4L6TB 5F2DA 1GUOA 4LW1A 1SJED 1LTTD 2IL8A 4OX9Q 2K01A 2F03A 2F3IA 1QVGA 4XT3B 1SAPA 1L0WA 4CDFC 3MAQA 1SR3A 2Z1CA 1YNJC 2WACA 4TSSA 5D65A 5HGQA 1QE6A 1SRUA 5KYLA 4DV5L 1AH9A 1V1QA 1WTWA 1ET9A 2F52A 1AEXA 2F0FA 2RDGA 4X66Q 4YHHL 1GUSA 3D4WA 3GV6A 4P72A 4JI0L 3DWAA 2OCEA 3Q23A 4A3MH 3HOUB 1QNKA 3RZDH 1Q8KA 1B44D 4MIUA 1YEZA 5EPLA 3KOJA 4BY1B 4PNYA 1S4ZA 1I50H 2N55A 3E0JA 3KDFA 1IBLQ 3WOEA 2WV6D 3ICEA 1LO5D 3EJIA 1S5FD 1EEFD 4UHVA 3J81L 4JBKA 1B3AA 4A3KB 3KJPA 1Z47A 4YCUA 3V05A 2EYPA 4FF1A 2GA4B 2LKVA 5GAEC 1TWAB 3RLNA 4R4OA 1JORA 2JSOA 3GTMH 2HQLA 4X64L 1PRTC 1BO0A 1B9NA 1NAPA 1S5DD 5C5LA 2I5LX 5JEAG 3CQZH 3K5LA 4IO9A 3NSWA 1EWHA 4X65Q 4LUOA 1S5ED 2IX0A 3P75A 2YTXA 1PZKD 3I91A 4FYDA 2OF1A 4A3JG 2K33A 2Q2HA 4OXPA 3HKSA 5IGCA 4DNIA 1I3QB 5C0XG 4JI8L 2Z0SA 3F2DA 1YI2A 2FXQA 3ERSX 3A8KE 4HAEA 2BCOA 3MEHA 5L37A 4BY7H 2JE6I 4N8X1 4DR2L 5G3LD 5GROA 4NKLA 5BN5A 1WD1A 4CBVA 3E6ZX 2YTYA 4C3JB 3K58A 3FPUB 4LUVA 2EDGA 4DV1Q 4LF8L 1WCMB 2PW7A 1CKMA 3LWEA 4DV6Q 1WI5A 2YU9B 3DM3A 1Q12A 3A8JE 2F0QA 5C4JH 1H9RA 1HA5A 4RMFA 2B2UA 4EQNA 5CGKA 3J81E 5FK9C 1R4QB 5C4HA 3URYA 4CGYB 4QUCA 4O1NA 5H1SE 4A3IB 2YV5A 3U50C 3HG9A 1PTOF 4LFCL 3E9HA 5C3WA 1BBUA 3DWQA 4R4CA 1L0YB 1Y1WG 1J9OA 1STGA 2Q2UA 2F0DA 4YIJA 3NP8A 2JN4A 4DR2Q 3K8AA 4HSPA 2Y0SE 1L1OA 4EQOA 1VQ4A 3S16H 2KENA 2WB1B 2MHVA 5DNFA 3NEMA 3GTOB 1K8MA 1EOVA 2JEAI 3W1BA 4OO1H 3FP9A 3R8BA 3SEBA 1X3FA 4DV0Q 1QJOA 3AQQA 3UI2A 4BXXH 3SK4A 1K8OA 2B2TC 1VQNA 1PTOB 5FLMH 3CP0A 1LTLA 2EJFC 3DUZA 2LS01 5KNCA 2VNUD 4FDBA 4PZ6A 4V190 5M5XB 4JI5L 1EY9A 2AQ1B 1Q81C 3BJUA 4X64Q 5BN4A 3CCMA 2F0EA 2UXDL 5CMDA 1ICWA 3W5OA 3MXNA 4YWKA 1PTOC 1A3VA 1E24A 3NWSA 2F0LA 1OXSC 4CKEA 1YBYA 2VS1A 5GADC 4HEDA 4HIDA 4RHRA 2VXWA 1K3BC 5I6WA 3Q0AA 4OL7A 4LF5Q 1XNQQ 2X6LA 1OO9B 5NUCA 1GHJA 1Z9FA 1Y1WB 4C2MH 2CKZB 1CZGA 1RDPD 3NTHA 1II3A 3L2PA 1SLJA 1D5XC 3CRKC 1STAA 1VMPA 3OW2A 1CSQA 1F2ZA 5T1IA 3HOWB 2EIFA 3BDOA 5IY0A 4X66L 3CC2A 3S14H 1C8CA 1STBA 3UDXA 2KQ3A 2CCZA 3S15H 1HHVA 2LFNA 2ICEC 4A3DG 2F4VQ 1YZ6A 1U0LA 2PNRC 4GN4B 2BE5C 3FKIH 3GTGH 3H15A 5LL6X 4HIOA 4LWCA 1JMCA 1EQQA 4DUYL 4LFAQ 3NTIA 5C3EH 4BA2I 1YJ9A 5A35A 3CCUA 1HNZL 5JPMC 5IGDA 3HKZE 4OX9L 3NENA 3X3MA 4JI8Q 5JVH3 3VR6A 2E2JB 4IUVA 2R3ZA 1WJJA 1PH8A 3GD7A 1DYQA 2DNCA 1XNRL 1XJVA 1K3RA 2C35B 1YVCA 4DUZL 5J22A 2D62A 1CQVA 3NXWA 3OIPA 2QCPX 4LK1C 4ZQ3A 5EAYA 1N34L 5K36H 3CPWA 2HHHL 3FRPB 4QF4A 1IYUA 3ZYYX 1Y1VB 3HOWG 3JAMc 2A68D 1I94L 3CMAA 1ZKOA 4JOIA 4IUPA 3TMEA 2BA1A 2HCCA 1FD7D 4POFA 1D2BA 4JI6Q 4C56C 2K5VA 1HZCA 1HRJA 5E4WC 1NJIC 2F4IA 2MO0A 4GOPB 3TS0A 1I4HA 1AP0A 4I7AA 4DGZA 1D5MC 5BN3A 4MNOA 4B3TQ 1B1ZA 2EVBA 5IYCG 5C3EG 2VZAA 2Y0SG 1K28A 3J81c 4APVA 4ILWA 3QB3A 4J1MA 1VQ9A 2HT1A 1F2LA 2NVYH 4B9XA 4L5SA 4XIGS 2ZM6L 4N9PA 4QIWB 4DV4Q 4LNQA 3CMEA 2G9DA 4ZUJA 1CUKA 3GTMB 5M3FG 1IKMA 3NQIA 2C5CA 2K1BA 1E1OA 2ASBA 4A3CG 4FF4A 4Y7NB 2JA8B 1CZWA 4IFDI 2YYZA 1RKNA 2DY7A 4JW0A 1MBYA 4GOPC 2A5HA 1U4RA 5I9PA 2RCNA 4LF9L 3SXHA 1SE2A 2RHQB 3IKJA 2EY5A 2F0NA 4GKKL 3J7AV 2WB1G 1LYLA 4EGVA 4A3EH 4CJ1B 2K04A 1JB3A 2WB1E 2JA5B 3VYUA 2OQKA 2L1BA 2Z8LA 5EJWA 2E5LL 4IPHA 3L9AX 2AQ2B 2KEEA 4PMWA 2XSCA 4JYAQ 4JOIC 1EWCA 5IT9E 1PTOD 2CH4A 5M9OA 1ESFA 4CDDC 1OXVA 3PCOB 1SFOH 1TQOA 2OTJA 3HS0C 4QGUA 1QB5D 1SNMA 1WYDA 5EKKA 1EQVA 4ZK9B 1G6ZA 2I0QA 4DPGA 1QILA 3H91A 4A3GG 2ZJQA 5FJ8H 3E5SA 1JC7A 5LMNQ 1X54A 1WTQA 1K8AC 1HZBA 1YHAA 3GTKH 1NSNS 1VQJA 3HGBA 1TR5A 2N3SA 4IUNA 4RAUC 3PGZA 3I4MG 4G7ZC 1SSOA 1ZYRD 4AIMA 4U673 3HZXA 1D5ZC 3TDQA 4NP5A 4R4TA 1XMQL 4MZ9A 3WDNA 1KC8C 2R7ZH 1UEAB 2A68C 1M90C 1MSGA 2I07B 3I72A 4CJ2C 1XX8A 1HR0Q 1W2BA 2Q2IA 3SK6A 1NUCA 4KY6A 4BBRH 3BYYB 1PFBA 5M5WH 2OXPA 1BNZA 3KF8A 1SNPA 1K83H 2HD3A 5AJ3L 2R92H 1PH5A 3S2HH 5ELBA 1DM0B 2J0TD 1IL8A 4JC0A 5C3XA 1J5EQ 2VY3A 5DM63 3RZOB 3T53B 4DV4L 3I2ZA 1B70B 2C9OA 4HR7B 3M9BA 3GTQH 4HTHA 3H0GG 4XQQA 1YNNC 4R9WA 3BYTB 4B3TL 1O80A 3STBD 1A3TA 1DONA 5EBCA 2Z6KA 1F9RA 1ML0D 2L11A 3KBXA 1LTRD 2KCCA 4QB4A 5CR3A 3TREA 5AFWA 2BE5D 4A3FB 1W6JA 3I4NH 5IWAQ 1A2UA 2E76C 2ALYB 3K7AH 2Z6KC 2HQEA 4OIJA 1WTXA 2O5IC 3S1RB 1SNOA 2JJQA 2A1AA 5CV9A 4JVZA 3BZKA 3M3YB 2O4XA 2UXCQ 1B9MA 1CKNB 1NR4A 2JA6H 4A93B 2LXJA 2NVQH 5IODA 4DAPA 1RL2A 2F0TA 1S72A 1HJPA 4HIMA 1TY0A 3I4OA 2BOSA 1CKOA 1EIHA 3A74A 2E5LQ 3H6MA 4IQZA 3OTOQ 3S1NH 1P16A 3HP3A 4DUZQ 3EFXD 1Q1EA 4ME3A 4RGTA 3K5OA 2PI2E 1Q46A 4DN4M 4LF9Q 3OMCA 2HIVA 3I4NG 3NPPA 4OO1I 4DNTB 4QIWE 1HQMC 2DJFC 1SYBA 1W3SA 1X3PA 1Y8PB 5LMUL 1EIYB 4AH6A 2EXZA 4UDUC 3BVMA 4YY3Q 4A3MG 1SEBD 4K2KA 3MXNB 3T4AC 4DUYQ 2A69C 4H44C 1SYDA 4X3UA 1QVFA 1GJXA 2NZ1D 2FJ2A 1SROA 3K80C 1KDBA 1BOSA 3PF4A 1B3QA 5FLXE 4C2MB 2ZXOA 4C1NK 4RCOA 3RR5A 3OYYA 4DXGA 1Q82C 3S1QB 1LACA 4O0AA 1ESRA 3M7GA 1XMOQ 1JWSD 1PRTF 2R7DA 4OELB 2B2YC 4AYBB 1BCPB 1SE4A 3WWVA 1EYDA 4RH6A 5CV5A 3J80i 1VQ7A 4L63B 1FNWA 3VR3A 1SYCA 5IP7G 2XVSA 3A55A 3ULLA 4LF5L 2VUMH 1C9OA 3GTKB 2B2YA 3GTPB 2D0PA 3GTPH 2NZHA 1DCZA 1TS3A 1TWFH 1Q90A 1I4PA 1X3QA 5CORA 5CBAE 3TZUA 1O7IA 3BVZA 4RA8A 3J7A5 1EY0A 1RCVD 2FFKB 4ID6A 2UXDQ 1N34Q 5KGUA 1FNVA 1LV9A 5EKIA 3D0FA 4DFAA 4C3IG 2WINB 3DHQA 4BY1G 3M4YA 4DK3C 3KLSX 4Y7NH 2VQFL 5ELOA 3W3AA 2F0HA 1SMYC 4X3KA 2RQXA 1K9MC 1SDFA 4A3EB 4DR6L 5M3MH 4K5VA 1PHJA 1CQFA 4JI1L 2AWOA 4UP9A 3KFUA 2KVMA 4K8IA 3HOXH 3KF6A 1VQDA 4FNFA 3G6EA 3RN2A 1R9TH 2B2WC 1M8AA 2KOLA 1HNZQ 2IWHA 3Q22A 4OONA 3BVGA 1CA6A 4RGNA 5JJLA 1VDZA 3H0GH 2KHSA 3OIQA 1LLRD 4KD4A 4ODGA 3A7AB 4LFCQ 1IBML 2AUJD 1N36Q 5C4JB 2NWGA 2NBFA 3DEPA 4OEMB 3STBC 4HJ8A 5D14A 3BS1A 3EROA 3SVMA 1WCMH 4FXKC 2AQ3B 4NDXA 4A3FH 3SR1A 3FMCA 4IPCA 2R92G 2EY2A 4DA2A 3OW7A 4BBRG 1QOHA 2XGTA 4FXDA 3DMUA 1SYGA 1A3UA 2Q8TA 1WTPA 3M4OB 5ISRA 1ENAA 2BDNA 1GXDC 5GQOA 2MO1A 2QDBA 4P73A 1A8VA 1DXMA 2M00A 4PV1C 2B8FA 2A6HC 3O13A 1XXGA 4B3RL 1MKHA 4K0KL 2DJGC 4K5WA 5DM73 1YJNA 4UPAA 1S5BD 3F8TA 1F9SA 4RHSA 3I4MH 1L0XB 4QMGA 2VB3X 5HGTA 4YY3L 3DXJC 5ELNA 1KQSA 3TS2A 4HJ7A 2PZTA 1K8GA 3CQZB 4A93G 1HH2P 2K5HA 1ILQA 3L7ZC 5C3EB 1G91A 3MXGA 2PMZB 4A3LH 3Q8DA 4C3HH 4DR1Q 3H0GB 4GN3B 4IFDG 1HA6A 4EX5A 1PFNA 3PF5A 5JJZA 1NTGA 4RCNA 3OTOL 1PH7A 2CQAA 5IP9H 5FOBB 4A3BH 2GVAA 3EN2A 3D31A 3HOWH 4J6HA 1LT5D 4U68A 1H9KA 3G7LA 2MFIA 1WTRA 3QWNA 1DOMA 3PO3G 2H1EA 1BKBA 4GZYC 3TP8A 3W1GA 4BWGB 4JV5Q 4A3EG 3U9SA 1JR0D 4BBSG 1MI2A 3ND9A 1BR9A 4A75A 2KCNA 3PV0A 4DKAC 2F0UA 4JK1C 1MIUA 1PLFA 3J81i 4H02A 1TWGH 3DWPA 3NQTA 1FJGL 4P2CB 1QUQA 4DR5L 2K5WA 2E2DC 4ZRZA 3UE0A 1TWFB 1U4MA 1BCPD 3SE0A 2OEOA 3PUVA 3QIAA 1XMOL 4JI0Q 4DF7A 1SNQA 4KY5A 3K6OA 4F8MA 5IE8A 4YHHQ 2ES2A 3U4VA 2R93G 5KNDA 1T9HA 5EPJA 4JI7Q 3K0XA 4BS9A 4ABNA 4DV5Q 4IOAA 2PQAA 4V0BA 2I46A 2B29A 3PUZA 3MVVA 1SFOB 2QILA 5FO9B 2NN6G 1K0RA 1UAPA 1MGSA 2PCFB 5IGFA 3TN2A 1TY2A 3KJOA 3AFPA 5E1FA 1HCZA 1Q7YC 1L2FA 2E8GA 1EL0A 3RLOA 1YIJA 4KY7A 4XYQA 3HOVB 2JA5G 1AZQA 1YJWA 4DAYA 4RWSC 1AE2A 1JE5A 1VMCA 3VR4A 1JWMD 1I4XA 2PZWA 1IKLA 5C5MA 3VR5A 3D4DA 1QWYA 4IUUA 3JAML 1FNUA 3CCRA 2M9VA 2WKCA 1JOKA 1Q3LA 3CW2C 1VQ5A 2F0JA 2HUGA 4HMJA 4C3HB 1Y8NB 1H9MA 1J8IA 4UAIA 1SYEA 1ZEQX 1VQPA 1Z6HA 3PIPA 3F2UA 1Y8OB 5I4DA 2UUCL 3S1NB 4QQBX 3KLWA 1O78A 2RVLA 4CDCC 2K50A 2NVYB 4XYOA 3NBIA 1RHPA 1HPCA 2UUBQ 1RD9D 4Z9CB 1TWCB 1VQBA 4KKTA 1U5KA 3QO2A 5LHY1 3PO2H 1PYBA 2KECA 1I6HB 3TQYA 4DK6C 3KBGA 3FKIG 3FPPA 2A6HD 2ATWA 1KLUD 3OMGA 2BDOA 3TP5A 4JCVE 2YU9H 4JYAL 3MHBA 3KLSA 1YNXA 2CFMA 2GN5A 3GTJB 2MUYA 5JJKA 2QKIC 1KRTA 4LF7Q 1P8LA 1HUNA 1HZ9A 1J5EL 2YTVA 1SMXA 4A76A 3PMFA 1BF4A 3MXPA 4KHPQ 4BY7B 4YWLA 3GTQB 4FVMA 4R1JA 5EKLA 4DV7Q 1CA5A 2WAQE 3HOZB 2EY1A 3CCSA 2O2LD 5C4ZA 1I3QH 3LX0A 1STEA 1HNWQ 4A4IA 1LUZA 1VS0A 1HNXQ 4ULLA 1KDCA 3D3RA 1VQ8A 1EFID 5J1ZA 3I56A 2ZM6Q 3S15B 4EQPA 5IOCA 2KA7A 1JCKB 4BBRB 2N78A 4EQ5A 4KLKA 1FGUA 4CKCA 2L55A 2F0PA 5T1GA 3G48A 2BH8A 5DLQE 3HOZH 5FLMG 5IYBG 2IHEA 4LF4L 4N8FA 1VCIA 2JEBI 3K7UC 2R7ZB 3T1HL 3F2BA 2XRSD 5C4XG 1I4QA 2XRQD 1W6KA 3OPOA 2HCIA 4A3JH 3R2TA 5FKAC 1I94Q 3UDFA 4F88A 4LF4Q 4KMUC 2UUCQ 2PPBC 3ERQA 1KL9A 3GTJH 1R4PB 3AB9A 1ENFA 4XQJA 2ZT9C 4ME5A 2KCTA 3VYRA 3A56A 1KABA 1EY7A 1RTNA 4UP7A 4GKJQ 2QW7A 4KD3A 4GNXC 4E6IA 1TWHH 4OIKA 2EYOA 2ID0A 1HNXL 4LF6Q 2H4OA 2NZOA 4AQYL 5IYDH 1M1KC 4JI3L 2CQOA 1EZ6A 3A0JA 1XTDA 4CKBA 1O7LA 2RDFA 4KHPL 2E75C 2WP8J 1AE3A 4XXEA 1PH9A 2J7ZA 4LFAL 4IFDH 1X65A 4A3LG 1G51A 5C44B 2F1MA 2EQSA 3S16B 4B08A 3S2DB 2K7VA 5EQ0A 4DV3L 3CC7A 2AKWB 2VQEL 1EYGA 2A19A 2ZJPA 2MNAA 4BY7G 1V8QA 5IYBH 1WTVA 2JA7B 3A8IE 3G71A 1F9QA 2QEXA 5C0XH 3A54A 3T13A 1XTCD 2L0CA 1BCPC 1FJGQ 2R93B 3GO5A 2EJMA 2B8GA 2CH4W 4DAYB 4TQUS 5ELEA 1XNQL 4LJZC 3RNUA 3T51B 1TVXA 4DV2L 2B3GA 1VQLA 2G9HD 3K57A 2NVQB 1EYAA 1LTAD 1SNCA 4KJNA 5KRUA 2PZUA 1CM9A 1JWUD 5JEAH 2Q8RE 4G4KA 1XPUA 1KRSA 2KBNA 3CC4A 3UE1A 1A0IA 5I6YA 4I65A 4LFBL 3K7AB 3K59A 3CPFA 1CK1A 1KHIA 1CSPA 2DY8A 1N33L 3C1FA 2CVRA 3GTLB 5JVG3 4WFN3 1EEID 4JI4L 3H3VC 2EZVA 1DOLA 5KYIA 4LAAA 1DJRD 2MJ8A 1XPRA 1NCVA 3GDEA 3J80c 3V96A 3HOYG 4LUZA 4KK7A 5CC4A 1UWVA 4OWWB 4UY8C 3S17H 2I5HA 5DAUA 3HOYH 1K0SA 4QCLA 4X62Q 1NR2A 4S3SA 2E2HH 3S2DH 1LT3D 3RZOH 3QG1A 1A62A 5M3MG 4B3SL 2E2JH 1YNND 5EPKA 2F4VL 1V1PA 2R92B 2B2UC 1Q86C 2WAQB 4C3JG 1H9JA 2Z4IA 1G2SA 4GNXB 4JI2Q 3M7NA 1Y14B 1TIID 4WJ3M 1U9RA 4R4QA 1QZGA 4B3MQ 1IL2A 3S9WA 4YCWA 2DUDA 3ND8A 1KTKA 2HIXA 1TS5A 3C1EA 4A3MB 3J7ZC 1D7QA 1N32Q 2SDFA 3CCEA 1CTMA 2EYJA 4J8QA 2F0WA 3QOLA 5FLXc 1A15A 2B63B 1ICFB 1VQEA 2Y0SB 5CV6A 1CI3M 5KEEA 1IBMQ 1SE8A 3GTLH 4P75A 1SJHD 1QNUA 4B3SQ 3OWEB 1WFQA 3K81C 2PNHA 2LMCB 3F1ZA 2Z9HA 4HJAA 1KNEA 1ZYRC 2ENBA 3A5UA 2Z6BA 1HTLD 1WOCA 4DV0L 2AUKA 3LNNA 4DR1L 4DR3L 4JI1Q 3EVQA 1DOKA 4P74A 4NW2A 4WJ4A 2XNAC 2IX3A 1H9SA 3RD4A 3G6JB 1K73C 2XTIA 2CWAA 4DNRB 2ZXPA 2R93H 3J81j 4NXML 1MHWC 4WORA 4GOPA 2VQFQ 3TRZA 3H3VH 2DGYA 3OHXC 1E2ZA 1LABA 1JQYD 3R93A 4PMCA 3GP7A 3AFQA 1NMGA 2NVTB 3W2DA 3E9IA 4IFDJ 2VB2X 1YITA 1EU4A 4B3RQ 1SYFA 5ELFA 4O2DA 4LMQD 4A3GB 5GAGC 2ZJRA 3HOXB 3HOYB 3TP6A 1PH3A 4HJ5A 1PH4A 1JJ2A 3C2PA 1IBLL 1TS4A 2CW0C 5JPNC 4PQXA 5D3IB 2F0MA 2I5MX 3N6RA 4KV6A 4QJFA 5I9OA 1EY8A 2BH2A 3HOVH 4A3CH 2MP1A 5JJIA 1T5EA 1Q8IA 1JT8A 1LT4D 4B9WA 1ENCA 4DV6L 1QCBD 3A5ZB 5IP9G 2F3WA 3I70A 3QOJA 4DV1L 3IAYA 4FF2A 1TKWB 1TU2B 1E22A 2XWBB 3KDFB 2JK8A 1N36L 1C7YA 2UUAQ 5FLXL 3TBIB 5C4XH 1L1OC 2OWOA 2PI2A 5EGTA 1IHZA 4X62L 3U58A 5CBEE 3T56B 1KAWA 1PH6A 1E2VA 2XWJB 4IJLA 1U4PA 1M4VA 5BR8Q 1TWCH 1D1KA 2B63H 2V4DA 5CV7A 4QUFA 4CDEC 1GUTA 1WTOA 4JI4Q 4P71A 1OTCA 2NVXB 1EWIA 3IL8A 5K36G 2RA4A 4K8JA 1E7ZA 1LTSD 2F0KA 3JAMi 3PUWA 4HCEA 4NMZA 1VQKA 4NXNQ 1G8ZD 1SNDA 3I73A 4H0LC 1VQOA 1IBKQ 4RGOS 4RGMA 4DU9A 5M5WB 3MWYW 4O42A 1KDAA 2KJXA 2SOBA 2K4KA 4DV2Q 5M3MB 5C6AA 1PRTD 2HDLA 1LT6D 3T1YQ 4DK0A 2B2VA 1YHBA 3FKIB 2B63G 3GTGB 1VQAA 1HFNA 3T1HQ 2RSNA 1E3PA 3I3CA 4RKLA 1TWAH 2PW5A 3VYTA 4M1UB 3CU7A 4DR4L 3BDLA 5FO7B 3LWUA 5LMNW 4IJHA 5A2QL 4N9TA 5FJ8G 2JA6B 1I50B 1WD0A 3HOXG 1IZ6A 4KHZA 2FMMA 1V43A 3CCVA 3S24A 4JBWA 4X6AH 3ITPA 2O5JC 3D4RA 1DD2A 1HNWL 1NE3A 4G7OC 3MA2B 4DXFA 2QEJC 1ET6A 2RBMA 2M2LA 1I6HH 1BBXC 1OXXK 2DNEA 4C3IH 2EE1A 1X3GA 5J3BA 2KHIA 1HTPA 3V2TA 4MTKA 2RF4A 3E3XA 1IYJB 1UEBA 1QUQB 4DAVA 1HZAA 2PQEA 3P7JA 2D0OA 4K6DA 3CF5A 4H7BA 2JA5H 1CHPD 1HUMA 3D8GA 2K6AA 5A2QE 2JA9A 2JA7H 1Z7TA 1PH2A 4PG3A 2IW3A 1STNA 1UUPA 1EOTA 1SBBB 1KD1C 3GTOH 2N8NA 3DEOA 2XIWA 4I7ZC 3FEWX 4GNXA 5IGGA 3HOUG 5IWAL 4KN7C 2LXKA 2WFWA 4KHVA 2K5DA 3PUYA 4HIKA 2PYKA 2Q2TA 4FF3A 2TMPA 5C0XI 1PRTB 2N49A 1XPOA 2JQOA 3NBHA 1MJCA 3I4MB 4RG1A 3VR2A 1F9PA 3NWTA 3I7FA 2QGQA 3HRZC 2E2IB 3M3YH 4HJ9A 1DZ1A 4HCSA 3KK7A 2EYMA 5IT9c 1RODA 2KEDA 4GKKQ 2N88A 1SMYD 2KCMA 3NK9A 1IW7D 1RF2D 3PO3H 2P5ZX 3GQBA 2VUMB 1MD2D 3SDZA 4HMIA 1MSHA 5IGBA 1CT1D 3FVQA 4A3BG 3LGJA 3AU7A 1PFMA 1A63A 1O7ZA 1HR0L 5D3DA 1FYCA 4L8JA 3CAMA 1H9SB 4TKOB 4JBMA 1EIGA 4C3HG 3I55A 3HKZB 4G7HC 3KLRA 4QL5A 1OXUA 1B50A 1X32A 1EFWA 4JI7L 2AHOB 1RJTA 5I2XA 3EIVA 4YWMA 1PA6A 1JJCB 1X3EA 5LL6S 1PMRA 2UU9L 1GUGA 4DR4Q 4ZKBB 4XT1B 1Y1VG 4PMBA 4OGQC 1PFSA 1EY6A 1S5CD 2F0SA 4BBSB 4IALA 4G57A 4A3DH 2A6ED 3E0EA 3KYHC 1KAAA 1SN8A 2ZTEA 2FINB 1HQRD 1A6XA 1B53A 5K5PA 3MZ5A 3ULPA 2WIIB 1IBKL 1JICA 2K75A 2NUCA 2HHHQ 3IFDA 3S14B 3U9OA 1MJEA 2K5NA 1HR0W 1TS2A 4XQNA 1TXYA 4OWXB 3R3OA 3CCJA 1X6OA 2QDLA 3RLFA 3G4SA 2Z4HA 4HN7A 2K5QA 2V1CC 5KNBA 1EIFA 5IIFA 2KUMA 1XNRQ 5M3FB 2DN8A 2LY7A 4GLAC 1PYSB 3M4OH 4MN3A 4JG2A 3AEVA 3NTKA 5BR8L 3J80L 4IPGA 2JA8G 3J7YW 1BCPF 4IURA 3PO2B 2F0IA 3CHBD 3ONAB 1QZHA 1ONLA 3TZDA 4BXXG 1TT2A 3PO3B 4IZ8A 5I2YA 2NB0A 5M5XH 1N9WA 4GLVB 2TSSA 4MHEA 3H3VI 1X55A 3B6YA 3MTSA 4ZCKA 2UUAL 2RKSA 1PTOH 2SEBD 4DR7Q 1H95A 2H5XA 3IRBA 1CHQD 2E2IH 3M85A 4AYBG 4FP5D 1FVIA 4PZ8A 4A3BB 5COYA 4DR5Q 2ZXRA 1D8LA 3KF8B 2JA8H 2L15A 1PXUA 2D5DA 5GAHC 2NVTH 2EYHA 2K52A 1I4GA 5HURA 1BDOA 3OWFA 3L0OA 1GOZA 3T1YL 2IPKD 4IUQA 5C44G 3J7AF 4FXGC 4JI6L 4X3TA 4YCVA 5IYDG 4K6LA 5M5YB 1GKHA 2AMCB 4JV5L 3T16A 1V1PB 2EYFA 1LM0A 5E3FA 1S40A 1LTGD 1ASYA 4EVOA 1G6PA 1ILPA 4C3IB 2A73B 1OXTA 5TSSA 2B39A 4JPBW 3S1RH 4NXMQ 1PV4A 3ULJA 1STHA 1XYIA 1C48A 1HXYD 3GV3A 3MFYA 4DR6Q 1EQTA 1J6QA 3BG3A 5DEHA 5EBDA 1BQQT 2JYOA 2IT1A 3VDYA 3J80E 1Y1VH 1CKNA 3F2CA 1UE6A 1TWGB 2F0OA 3BZCA 2QF7A 3CKIB 4A3JB 3HOZG 1G2TA 4HSVA 4K14A 4OHJA 4J15A 2EPBA 3S1QH 1NNXA 3C3LA 4UP8A 2JA7G 2ZTDA 4K0KQ 1KLGD 3QJYA 5HY6A 4ZLTF 1STYA 2RDHA 2WAQG 4XDXA 4BBSH 5E7NA 3R2IA 2EOTA 1N32L 1ASZA 1JOOA 4B3ML 3MEFA 2ZTCA 4GLXA 1HFGA 1EU3A 1B7YB 1GUNA 1RIPA 1V9PA 4KJOA 3S17B 3ER0A 4JI2L 1EYCA 3U4ZA 2RSOA 2G5DA 3CD6A 1IW7C 1Q1BA 2R61A 3UDIA 4QY7A 4KKUA 2PMZE 3QR8A 3VA7A 1FR3A 4RFBA 5LMUQ 4A93H 4JI5Q 3D6WA 4F7XA 2A74C 3MFGA 4CJ0B 2R6GA 2MGSA 2K03A 3NELA 4F87A 2D9UA 3PSIA 3PO2G 1D1IA 3HKZG 3NE5B 2OTLA 1E0BA 4R8IA 3HOUH 2PQAB 1EY5A 2K05A 4DR3Q 2FMCA 1KIXA 3VYSA 3HEJA 2QA4A 1C0AA 1SXTA 3Q24A 2VL6A 1VF5C 1GD7A 4X65L 1NBWA 3EBEA 1LTID 2HDMA 3M4QA 3BU2A 1KXLA 2EY6A 1BUVT 4C1NI 1C4QA 2NN6I 1Y69U 2UXCL 4L5TA 4K5XA 1EQRA 3SK5A 4A3FG 4Q0FA 1I4RA 2ICIA 5CV4A 3EQLC 4KI0A 4R8NA 2R7ZG 5C4XB 3I90A 2B2TA 3CCQA 2J4XA 3H94A 1D6EC 3MXUA 3VA5A 4GN5A 1R9TB 4MTNA 3D6CA 2L9HA 3NBHB 2VW9A 1JJGA 2L4NA 1V1OA 2GVBA 1BBWA 2JP1A 5M5YH 3SHLA 5JEAJ 1VQMA 2NN6H 4LF8Q 4BA1I 4AYBE 4DV3Q 1NMFA 3S1MH 3AMUA 4DR7L 4A3IG 4CHTB 1KNAA 1JOQA 5ELDA 5G3LF 3OOCA 4A3GH 5KIXA 4A3IH 2EJGC 3PIP3 4L5RC 2CWPA 2F0GA 1GVPA 1UNSA 2NTTA 4Q5VA 4OO1G 1GO3E 5FO8B 1EY4A 2LSSA 2XN9C 4XTCS 2EXDA 5AJ3Q 1GHKA 1LTBD 4TRDA 3IFTA 1G291 3X3NA 4BY1H 1JB7A 2A69D 1Y1WH 3HOVG 2KHJA 3WOFA 4X3SA 1UE7A 1PVOA 1EUJA 4ZKCB 4LF6L 1X56A 1F77A 1E2WA 1X9NA 2K14A 3RMHA 5ELCA 4R4IA 2RHSB 3DLLA 1PZJD 1VQCA 1N33Q 2VUMG 3KF6B 5IP7H 1UE5A 1VQFA 3NHHA 4H13C 4LFBQ 3PUXA 1SE3A 5M3FH 4JBJA 1EZ8A 1VQIA 4GS3A 5IT9L 1F2YA 3L3OC 2K32A 4A3KG 5LMNL 2R7FA 4ALPA 3MC0B 3RN5A 3SGIA 3K5MA 4POGA 3H09A 1VQHA 4NPSA 2BA0A 3SK8A 1K83B 5IYCH 3Q6SA 1FGBD 4KTAA 2IX1A 3JC66 4KN4C 5JOBA 1XWEA 3EA6A 5JAVA 4L5QA 3N52A 1PDQA 3OSOA 2L12A
chains in the Genus database with same CATH topology
4WJWA 5CYUA 2JXMB 3K0YA 4KKSA 4A3DB 2L5TA 3I4LA 1IYVA 2FHTA 4M8AA 2AWNA 3TSSA 2E2HB 2CW0D 5J39A 3P1HA 4IUTA 1A2TA 2Q8IB 3P20A 2SNSA 3RZDB 1ZXTA 1U4LA 4IN3A 4RKBA 3K5NA 3I4NB 1WVLA 3NUCA 4K2LA 1B2TA 2E74C 1QG7A 1JE4A 2IJ0A 3TP7A 1CFMA 1AN8A 4ZAIA 4DK1A 2D2CC 3RUZA 2WKDA 5E4XA 2EYLA 2A6EC 4ZYSA 5IGEA 1F2MA 3DM1A 2F3VA 3BZDB 1PYWD 3I8ZA 1YNJD 2NYZD 3S2HB 1PZID 4FO2A 5CV8A 3FDTA 2X6GA 2PO4A 1AW7A 2NTSA 3S1MB 1GUWA 2X69A 1B4OA 2B2WA 3C46A 2K28A 4WRDA 3BDCA 1T5XD 3JAME 1O7YA 3A7LA 3CRLC 1VF7A 3KUPA 1I6VC 1BXTA 2F0VA 2MPMA 2SNMA 1AFPA 2B2VC 3PIO3 1AZPA 2CHBD 5C0XJ 4ZUIA 1RTOA 2OT2A 1TWHB 4L6TB 5F2DA 1GUOA 1SJED 1LTTD 2IL8A 2K01A 2F03A 4XT3B 1SAPA 3MAQA 2Z1CA 1YNJC 2WACA 4TSSA 5D65A 1QE6A 5KYLA 1WTWA 1ET9A 1AEXA 2F0FA 2RDGA 1GUSA 3D4WA 3GV6A 3DWAA 3Q23A 3HOUB 1QNKA 1B44D 4MIUA 5EPLA 4BY1B 4PNYA 1S4ZA 2N55A 3E0JA 3WOEA 2WV6D 1LO5D 3EJIA 1S5FD 1EEFD 3J81L 1B3AA 4A3KB 1Z47A 3V05A 2EYPA 4FF1A 2GA4B 2LKVA 1TWAB 1JORA 2JSOA 1PRTC 1BO0A 1B9NA 1NAPA 1S5DD 5C5LA 5JEAG 3K5LA 3NSWA 1EWHA 1S5ED 2IX0A 3P75A 1PZKD 3I91A 4FYDA 2OF1A 2K33A 5IGCA 1I3QB 5C0XG 4HAEA 3A8KE 2BCOA 3MEHA 2JE6I 5G3LD 4NKLA 5BN5A 1WD1A 4CBVA 3E6ZX 4C3JB 3K58A 3FPUB 2EDGA 1WCMB 2PW7A 3LWEA 2YU9B 1Q12A 3A8JE 2F0QA 1H9RA 1HA5A 2B2UA 4EQNA 5CGKA 3J81E 5FK9C 1R4QB 5C4HA 3URYA 4CGYB 4QUCA 4O1NA 4A3IB 3HG9A 1PTOF 5C3WA 3DWQA 1L0YB 1J9OA 1STGA 2F0DA 4YIJA 3NP8A 4HSPA 4EQOA 2WB1B 2MHVA 5DNFA 3GTOB 1K8MA 2JEAI 4OO1H 3R8BA 3SEBA 1QJOA 3UI2A 3SK4A 1K8OA 2B2TC 1PTOB 2EJFC 3DUZA 2LS01 5KNCA 2VNUD 4V190 5M5XB 1EY9A 2AQ1B 5BN4A 2F0EA 5CMDA 1ICWA 3MXNA 1PTOC 1A3VA 3NWSA 2F0LA 1OXSC 4CKEA 4HEDA 4RHRA 2VXWA 3Q0AA 5I6WA 4OL7A 2X6LA 1OO9B 5NUCA 1GHJA 1Y1WB 1CZGA 1RDPD 3NTHA 1II3A 1D5XC 3CRKC 1STAA 1VMPA 1F2ZA 5T1IA 3HOWB 3BDOA 1C8CA 1STBA 1HHVA 2KQ3A 2LFNA 2ICEC 2PNRC 2BE5C 5LL6X 3NTIA 4BA2I 5A35A 5JPMC 5IGDA 3X3MA 5JVH3 3VR6A 2E2JB 4IUVA 2R3ZA 3GD7A 1DYQA 2DNCA 5J22A 2D62A 1CQVA 3NXWA 3OIPA 2QCPX 4LK1C 4ZQ3A 5K36H 3FRPB 4QF4A 1IYUA 3ZYYX 1Y1VB 2A68D 1ZKOA 4IUPA 3TMEA 2BA1A 2HCCA 1FD7D 1D2BA 4C56C 1HRJA 5E4WC 2F4IA 1I4HA 1AP0A 4DGZA 1D5MC 5BN3A 1B1ZA 2EVBA 4ILWA 3QB3A 4J1MA 1F2LA 4B9XA 4XIGS 4N9PA 4QIWB 2G9DA 4ZUJA 3GTMB 1IKMA 2C5CA 3NQIA 2K1BA 4FF4A 4Y7NB 2JA8B 1CZWA 4IFDI 2YYZA 1RKNA 2DY7A 1MBYA 2A5HA 1U4RA 5I9PA 3SXHA 1SE2A 3IKJA 2EY5A 2F0NA 3J7AV 4EGVA 4CJ1B 2K04A 1JB3A 2JA5B 3VYUA 2Z8LA 2L1BA 5EJWA 3L9AX 2AQ2B 2KEEA 4PMWA 2XSCA 1EWCA 5IT9E 1PTOD 5M9OA 1ESFA 1OXVA 1TQOA 3HS0C 1QB5D 1SNMA 5EKKA 1EQVA 4ZK9B 1G6ZA 1QILA 3H91A 3E5SA 1JC7A 1WTQA 1NSNS 3HGBA 1TR5A 4IUNA 4RAUC 4G7ZC 1SSOA 1ZYRD 4U673 3HZXA 1D5ZC 3TDQA 4NP5A 3WDNA 1UEAB 2A68C 1MSGA 2I07B 3I72A 4CJ2C 1XX8A 3SK6A 1NUCA 4KY6A 3BYYB 1PFBA 2OXPA 1BNZA 3KF8A 1SNPA 5ELBA 1DM0B 2J0TD 1IL8A 3RZOB 5C3XA 5DM63 3T53B 2C9OA 4HR7B 4HTHA 4XQQA 1YNNC 4R9WA 3BYTB 1O80A 1A3TA 1DONA 5EBCA 1F9RA 1ML0D 2L11A 3KBXA 1LTRD 2KCCA 4QB4A 5CR3A 5AFWA 2BE5D 4A3FB 1W6JA 1A2UA 2E76C 2HQEA 4OIJA 1WTXA 2O5IC 3S1RB 1SNOA 5CV9A 3M3YB 2O4XA 1B9MA 1NR4A 4A93B 5IODA 4DAPA 2F0TA 1TY0A 2BOSA 1EIHA 3H6MA 4IQZA 3HP3A 3EFXD 1Q1EA 4RGTA 3K5OA 4DN4M 3OMCA 3NPPA 4OO1I 4DNTB 1HQMC 1SYBA 1X3PA 1Y8PB 2EXZA 4UDUC 3BVMA 1SEBD 4K2KA 3T4AC 2A69C 4H44C 1SYDA 4X3UA 1GJXA 2NZ1D 2FJ2A 1KDBA 1BOSA 5FLXE 4C2MB 2ZXOA 4C1NK 4RCOA 4DXGA 3S1QB 1LACA 1ESRA 3M7GA 1JWSD 1PRTF 2B2YC 4AYBB 1BCPB 1SE4A 1EYDA 4RH6A 5CV5A 4L63B 1FNWA 3VR3A 1SYCA 2XVSA 3A55A 3GTKB 2B2YA 3GTPB 1DCZA 1TS3A 1Q90A 1I4PA 1X3QA 5CORA 5CBAE 3TZUA 3BVZA 4RA8A 1EY0A 1RCVD 2FFKB 4ID6A 5KGUA 1FNVA 1LV9A 5EKIA 4DFAA 4C3IG 2WINB 3DHQA 3M4YA 3KLSX 3W3AA 2F0HA 1SMYC 4X3KA 2RQXA 1SDFA 4A3EB 4K5VA 1CQFA 2AWOA 2KVMA 4K8IA 4FNFA 2B2WC 1M8AA 2KOLA 2IWHA 3Q22A 3BVGA 1CA6A 4RGNA 1VDZA 2KHSA 3OIQA 1LLRD 4KD4A 4ODGA 3A7AB 2AUJD 5C4JB 2NWGA 2NBFA 3DEPA 5D14A 3BS1A 3EROA 3SVMA 4FXKC 2AQ3B 4NDXA 3SR1A 3FMCA 2EY2A 4DA2A 3OW7A 1QOHA 4FXDA 3DMUA 1SYGA 1A3UA 2Q8TA 1WTPA 3M4OB 5ISRA 1ENAA 2BDNA 1GXDC 2QDBA 1DXMA 2M00A 4PV1C 2B8FA 2A6HC 3O13A 1XXGA 4K5WA 5DM73 1S5BD 1F9SA 4RHSA 1L0XB 4QMGA 2VB3X 5HGTA 3DXJC 2PZTA 3CQZB 1ILQA 3L7ZC 5C3EB 1G91A 3MXGA 2PMZB 3H0GB 4IFDG 1HA6A 1PFNA 5JJZA 4RCNA 2CQAA 5FOBB 3D31A 4J6HA 1LT5D 4U68A 1H9KA 3G7LA 1WTRA 3QWNA 1DOMA 2H1EA 4GZYC 3TP8A 4BWGB 3U9SA 1JR0D 1MI2A 3ND9A 1BR9A 2KCNA 3PV0A 2F0UA 4JK1C 1PLFA 3DWPA 3NQTA 4P2CB 2K5WA 2E2DC 4ZRZA 1TWFB 1U4MA 1BCPD 3SE0A 2OEOA 3PUVA 3QIAA 4DF7A 1SNQA 4KY5A 3K6OA 4F8MA 5KNDA 5EPJA 4BS9A 4ABNA 4V0BA 2I46A 3PUZA 3MVVA 1SFOB 2QILA 5FO9B 2NN6G 1UAPA 1MGSA 2PCFB 5IGFA 3TN2A 1TY2A 5E1FA 1HCZA 1EL0A 4KY7A 4XYQA 3HOVB 1AZQA 4DAYA 4RWSC 1VMCA 3VR4A 1JWMD 1I4XA 2PZWA 1IKLA 5C5MA 3VR5A 3D4DA 1QWYA 4IUUA 3JAML 1FNUA 2M9VA 2WKCA 1JOKA 1Q3LA 2F0JA 2HUGA 4HMJA 4C3HB 1Y8NB 1H9MA 1J8IA 4UAIA 1SYEA 1ZEQX 1Z6HA 3F2UA 1Y8OB 5I4DA 3S1NB 1O78A 2RVLA 2NVYB 4XYOA 3NBIA 1RHPA 1HPCA 1RD9D 4Z9CB 1TWCB 4KKTA 3QO2A 5LHY1 2KECA 1I6HB 3KBGA 3FPPA 2A6HD 1KLUD 3OMGA 2BDOA 3TP5A 3MHBA 3KLSA 3GTJB 2MUYA 2QKIC 1HUNA 3PMFA 1BF4A 3MXPA 4BY7B 3GTQB 4FVMA 5EKLA 1CA5A 3HOZB 2EY1A 2O2LD 5C4ZA 3LX0A 1STEA 4ULLA 1KDCA 3D3RA 1EFID 5J1ZA 3S15B 4EQPA 5IOCA 2KA7A 1JCKB 4BBRB 4CKCA 2L55A 2F0PA 5T1GA 1VCIA 2JEBI 2R7ZB 2XRSD 1I4QA 2XRQD 1W6KA 3OPOA 2HCIA 3R2TA 5FKAC 4F88A 4KMUC 2PPBC 3ERQA 1R4PB 3AB9A 1ENFA 4XQJA 2ZT9C 4ME5A 3VYRA 3A56A 1KABA 1EY7A 1RTNA 4KD3A 4E6IA 4OIKA 2EYOA 2ID0A 2H4OA 1EZ6A 4CKBA 1O7LA 2RDFA 2E75C 2WP8J 4XXEA 2J7ZA 4IFDH 5C44B 2F1MA 3S16B 4B08A 3S2DB 2K7VA 5EQ0A 1V8QA 1WTVA 2JA7B 3A8IE 1F9QA 5C0XH 3A54A 3T13A 1XTCD 2L0CA 1BCPC 2R93B 3GO5A 2EJMA 2B8GA 4TQUS 5ELEA 4LJZC 3T51B 1TVXA 2G9HD 3K57A 2NVQB 1EYAA 1LTAD 1SNCA 4KJNA 5KRUA 2PZUA 1CM9A 1JWUD 5JEAH 2Q8RE 4G4KA 5I6YA 4I65A 3K7AB 3K59A 1CK1A 2DY8A 3C1FA 2CVRA 3GTLB 5JVG3 4WFN3 1EEID 3H3VC 2EZVA 1DOLA 5KYIA 4LAAA 1DJRD 2MJ8A 1NCVA 3V96A 4KK7A 5CC4A 5DAUA 4QCLA 1NR2A 4S3SA 1LT3D 3QG1A 1YNND 5EPKA 1V1PA 2R92B 2B2UC 2WAQB 4C3JG 1H9JA 2Z4IA 1G2SA 3M7NA 1TIID 1U9RA 3S9WA 3ND8A 1KTKA 1TS5A 3C1EA 4A3MB 2SDFA 1CTMA 2EYJA 4J8QA 2F0WA 3QOLA 1A15A 2B63B 2Y0SB 5CV6A 1CI3M 5KEEA 1SJHD 1QNUA 3OWEB 2LMCB 1KNEA 1ZYRC 2ENBA 1HTLD 2AUKA 3LNNA 3EVQA 1DOKA 4NW2A 2XNAC 2IX3A 1H9SA 3RD4A 3G6JB 4DNRB 2ZXPA 4WORA 3OHXC 1E2ZA 1LABA 1JQYD 3R93A 4PMCA 3GP7A 2NVTB 3W2DA 4IFDJ 2VB2X 1EU4A 1SYFA 5ELFA 4LMQD 4A3GB 3HOXB 3HOYB 3TP6A 3C2PA 1TS4A 2CW0C 5JPNC 4PQXA 5D3IB 2F0MA 3N6RA 4KV6A 5I9OA 1EY8A 2MP1A 1T5EA 1Q8IA 1LT4D 4B9WA 1ENCA 1QCBD 2F3WA 3I70A 3QOJA 4FF2A 3IAYA 1TKWB 1TU2B 2XWBB 5FLXL 3TBIB 5EGTA 1IHZA 5CBEE 3T56B 1E2VA 2XWJB 1U4PA 1M4VA 1D1KA 2V4DA 5CV7A 4QUFA 1WTOA 1GUTA 2NVXB 3IL8A 5K36G 2RA4A 4K8JA 1LTSD 2F0KA 3PUWA 4HCEA 4NMZA 1G8ZD 1SNDA 3I73A 4H0LC 4RGOS 5M5WB 4RGMA 4DU9A 3MWYW 4O42A 1KDAA 2KJXA 2SOBA 5M3MB 5C6AA 1PRTD 2HDLA 1LT6D 4DK0A 2B2VA 3FKIB 3GTGB 1HFNA 2RSNA 3I3CA 4RKLA 2PW5A 3VYTA 4M1UB 3CU7A 3BDLA 5FO7B 3LWUA 5A2QL 4N9TA 2JA6B 1I50B 1WD0A 4KHZA 2FMMA 1V43A 4JBWA 3ITPA 2O5JC 3D4RA 1DD2A 4G7OC 3MA2B 4DXFA 2QEJC 1ET6A 2RBMA 2M2LA 1BBXC 1OXXK 2DNEA 2EE1A 1HTPA 3V2TA 4DAVA 2PQEA 3P7JA 4K6DA 4H7BA 1CHPD 1HUMA 3D8GA 2K6AA 5A2QE 1Z7TA 2IW3A 1STNA 1UUPA 1EOTA 1SBBB 3DEOA 2XIWA 4I7ZC 3FEWX 5IGGA 4KN7C 4KHVA 2K5DA 3PUYA 2PYKA 4FF3A 2TMPA 5C0XI 1PRTB 3NBHA 3I4MB 3VR2A 1F9PA 3NWTA 3HRZC 2E2IB 1DZ1A 4HCSA 3KK7A 2EYMA 1RODA 2KEDA 2N88A 1SMYD 3NK9A 1IW7D 1RF2D 3GQBA 2VUMB 1MD2D 3SDZA 4HMIA 1MSHA 5IGBA 1CT1D 3FVQA 3AU7A 1PFMA 1O7ZA 5D3DA 1FYCA 4L8JA 1H9SB 4TKOB 1EIGA 4C3HG 4G7HC 3HKZB 3KLRA 1OXUA 1B50A 1X32A 1RJTA 5I2XA 5LL6S 1PMRA 1GUGA 4ZKBB 4XT1B 4PMBA 4OGQC 1EY6A 1S5CD 2F0SA 4BBSB 4IALA 4G57A 2A6ED 1KAAA 2FINB 1HQRD 1A6XA 1B53A 5K5PA 3MZ5A 2WIIB 1JICA 2NUCA 3IFDA 3S14B 3U9OA 1TS2A 4XQNA 3R3OA 3RLFA 2Z4HA 4HN7A 2K5QA 5KNBA 5IIFA 2KUMA 5M3FB 2DN8A 2LY7A 4MN3A 3NTKA 3J80L 3J7YW 1BCPF 4IURA 3PO2B 2F0IA 3CHBD 3ONAB 1ONLA 3TZDA 1TT2A 3PO3B 4IZ8A 5I2YA 2NB0A 4MHEA 2TSSA 3MTSA 2RKSA 1PTOH 2SEBD 1CHQD 3M85A 4FP5D 4A3BB 5COYA 2ZXRA 1PXUA 2D5DA 2EYHA 1I4GA 5HURA 1BDOA 3OWFA 1GOZA 2IPKD 4IUQA 3J7AF 4FXGC 4X3TA 4K6LA 5M5YB 3T16A 1V1PB 2EYFA 5E3FA 1LTGD 4EVOA 1ILPA 4C3IB 2A73B 1OXTA 5TSSA 2B39A 1STHA 1XYIA 1C48A 1HXYD 3GV3A 3MFYA 1EQTA 3BG3A 5DEHA 5EBDA 1BQQT 2JYOA 2IT1A 3J80E 1TWGB 2F0OA 2QF7A 3CKIB 4A3JB 1G2TA 4HSVA 4K14A 4OHJA 2EPBA 3C3LA 1KLGD 3QJYA 4ZLTF 1STYA 2RDHA 4XDXA 3R2IA 2EOTA 1JOOA 1HFGA 1EU3A 1GUNA 3S17B 4KJOA 1EYCA 2RSOA 1IW7C 1Q1BA 2R61A 4KKUA 3VA7A 1FR3A 4RFBA 3D6WA 4F7XA 2A74C 3MFGA 4CJ0B 2R6GA 2MGSA 2K03A 4F87A 2D9UA 1D1IA 3NE5B 1E0BA 4R8IA 1EY5A 2K05A 2FMCA 3VYSA 3HEJA 1SXTA 3Q24A 1VF5C 1LTID 2HDMA 2EY6A 1BUVT 4C1NI 1C4QA 2NN6I 1Y69U 4K5XA 3SK5A 4Q0FA 1I4RA 2ICIA 5CV4A 3EQLC 4KI0A 4R8NA 5C4XB 3I90A 2B2TA 2J4XA 3H94A 1D6EC 3MXUA 3VA5A 1R9TB 3D6CA 2L9HA 2L4NA 1V1OA 2JP1A 3SHLA 5JEAJ 2NN6H 4BA1I 3AMUA 4CHTB 1KNAA 1JOQA 5ELDA 5G3LF 3OOCA 5KIXA 2EJGC 3PIP3 2F0GA 1UNSA 2NTTA 4Q5VA 4OO1G 5FO8B 1EY4A 2XN9C 4XTCS 1GHKA 1LTBD 4TRDA 3IFTA 1G291 3X3NA 2A69D 3WOFA 4X3SA 4ZKCB 1F77A 1E2WA 3RMHA 5ELCA 1PZJD 3NHHA 4H13C 3PUXA 1SE3A 1EZ8A 5IT9L 1F2YA 3L3OC 2K32A 3MC0B 3K5MA 3H09A 2BA0A 3SK8A 1K83B 3Q6SA 1FGBD 4KTAA 2IX1A 4KN4C 5JOBA 1XWEA 3EA6A 5JAVA 3N52A 1PDQA 3OSOA 2L12A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUO A;  2BE5 C;  2E76 C;  2NN6 I;  1Q12 A;  2E75 C;  3A8J E;  3ND8 A;  1Y69 U;  4GZY C;  1H9R A;  3FPP A;  2A6H D;  1A6X A;  3U9S A;  3MFY A;  2BDO A;  2O5I C;  3T56 B;  4BA2 I;  3ND9 A;  2JXM B;  4KKS A;  2AWO A;  3BG3 A;  5A35 A;  3EQL C;  4KI0 A;  1E2V A;  1Z7T A;  4IFD H;  1CTM A;  1B9M A;  1YNJ C;  2L5T A;  3PV0 A;  4JK1 C;  3I4L A;  2IT1 A;  1IYV A;  3VR6 A;  1OXV A;  3H94 A;  2F1M A;  3MXU A;  2QF7 A;  3GD7 A;  1CI3 M;  4I7Z C;  2K7V A;  2V4D A;  1VDZ A;  2DNC A;  1GUS A;  3RLF A;  1GUT A;  4XIG S;  4IQZ A;  5KNB A;  1V8Q A;  3SE0 A;  4KN7 C;  3PUV A;  3QIA A;  2D62 A;  3A7A B;  2Q8I B;  3P20 A;  3A8I E;  1Q1E A;  2LMC B;  2NN6 H;  4BA1 I;  5C0X H;  2DN8 A;  2AUJ D;  3PUY A;  3QJY A;  5K36 G;  4LK1 C;  5KND A;  2EJM A;  1ZYR C;  2B8G A;  3OOC A;  3HGB A;  4TQU S;  3PUW A;  2EJG C;  5K36 H;  4LJZ C;  4G7Z C;  3T51 B;  1K8M A;  3FMC A;  4DNT B;  1IYU A;  3PUZ A;  3I73 A;  3VR2 A;  2JEA I;  4OO1 H;  4OO1 G;  1HQM C;  2AUK A;  1ONL A;  3LNN A;  1Y8P B;  4H0L C;  2NN6 G;  2A68 D;  2PCF B;  1ZKO A;  3OW7 A;  2BA1 A;  2KA7 A;  2E74 C;  5JEA H;  1H9S A;  1QJO A;  2A69 C;  4XTC S;  4H44 C;  3WDN A;  1GHK A;  1GJX A;  1K8O A;  1HCZ A;  3IFT A;  2A68 C;  1G29 1;  2EJF C;  1CFM A;  4DNR B;  4DK0 A;  1GUN A;  4DK1 A;  5KNC A;  2A69 D;  2D2C C;  3I72 A;  2A6E C;  1DXM A;  1IW7 D;  1VCI A;  2JEB I;  1E2Z A;  1B9N A;  4PV1 C;  1LAB A;  3GQB A;  3VR4 A;  5JEA G;  2B8F A;  1LAC A;  2A6H C;  5BN4 A;  3SDZ A;  1E2W A;  1EWH A;  3VR5 A;  3M85 A;  1IW7 C;  1Q1B A;  5BN3 A;  3OPO A;  2EVB A;  4KKU A;  3VA7 A;  3LWU A;  1FR3 A;  1OXS C;  2D5D A;  3DXJ C;  2K33 A;  4KMU C;  3VR3 A;  2R6G A;  3T53 B;  2PPB C;  4KHZ A;  1BDO A;  1FYC A;  4H13 C;  1V43 A;  1H9S B;  3AB9 A;  3PUX A;  4HR7 B;  1Y8N B;  4L8J A;  2ZT9 C;  4TKO B;  5C0X G;  4G7H C;  1H9M A;  3L7Z C;  3KLR A;  1OXU A;  3A8K E;  2CW0 C;  3NE5 B;  4JBW A;  1GHJ A;  1DCZ A;  1Z6H A;  3D4R A;  1Y8O B;  3N6R A;  2O5J C;  1DD2 A;  1Q90 A;  2JE6 I;  4G7O C;  2K32 A;  1O78 A;  1T5E A;  1YNN C;  3A7L A;  3CRL C;  4IFD G;  3TZU A;  3CRK C;  1PMR A;  1VF7 A;  3QG1 A;  1GUG A;  1I6V C;  1OXX K;  1HPC A;  2DNE A;  4RCN A;  2YYZ A;  5BN5 A;  1VF5 C;  2BA0 A;  4KKT A;  3BDO A;  4OGQ C;  3D31 A;  2KCC A;  4KN4 C;  1HTP A;  1TKW B;  1TU2 B;  3M4Y A;  2EDG A;  1H9J A;  2BE5 D;  3IKJ A;  1H9K A;  3M7N A;  1OXT A;  3W3A A;  2A6E D;  2PNR C;  1SMY C;  1O7L A; 
#chains in the Genus database with same CATH topology
 2UU9 Q;  1VQ6 A;  1QVC A;  2VQE Q;  4WJW A;  5CYU A;  3M4P A;  2RCF A;  1FL0 A;  2JXM B;  3K0Y A;  4KKS A;  4A3D B;  2A8V A;  1DGS A;  2L5T A;  3I4L A;  1IYV A;  2FHT A;  4A3K H;  4M8A A;  1UE1 A;  2AWN A;  3TSS A;  2E2H B;  2CW0 D;  4OWT B;  5J39 A;  4DV7 L;  1YHQ A;  3P1H A;  2IHF A;  4IUT A;  1A2T A;  2IY5 B;  2Q8I B;  3P20 A;  1I5F A;  2SNS A;  3RZD B;  2NVX H;  1BVS A;  1ZXT A;  4JI3 Q;  2JA6 G;  1U4L A;  4IN3 A;  4RKB A;  4AQY Q;  3K5N A;  3I4N B;  1WVL A;  4LF7 L;  1WCM G;  1L1O B;  3NUC A;  4K2L A;  4C3J H;  3PQI A;  1XMQ Q;  1B2T A;  3CXC A;  4GKJ L;  1N8R C;  1B8A A;  2E74 C;  3TEH B;  1QG7 A;  1S3O A;  4TVA B;  1JE4 A;  3PIO A;  2IJ0 A;  3TP7 A;  1CFM A;  1AN8 A;  4ZAI A;  4IPD A;  2D2C C;  3RUZ A;  4DK1 A;  2WKD A;  5E4X A;  2EYL A;  2A6E C;  3UDG A;  1NY4 A;  4ZYS A;  5IGE A;  1F2M A;  2UXB L;  2OQ0 A;  3DM1 A;  2F3V A;  2UUB L;  3BZD B;  1PYW D;  3I8Z A;  4PZ7 A;  1YNJ D;  2NYZ D;  3S2H B;  1PZI D;  1PH1 A;  4FO2 A;  2UXB Q;  5CV8 A;  3FDT A;  4DAM A;  2X6G A;  2PO4 A;  1AW7 A;  1E1T A;  2NTS A;  4NXN L;  3S1M B;  1GUW A;  2X69 A;  1B4O A;  2B2W A;  3CCL A;  3AYH B;  3C46 A;  1GM5 A;  3FHW A;  2K28 A;  4WRD A;  2MQH A;  3BDC A;  1T5X D;  3JAM E;  4NB3 A;  1O7Y A;  3A7L A;  3CRL C;  3ZJY C;  1VF7 A;  3KUP A;  1I6V C;  1BXT A;  2F0V A;  2MPM A;  2SNM A;  1AFP A;  4IOC A;  5C44 H;  2B2V C;  3PIO 3;  1AZP A;  4Y52 H;  2CHB D;  5C0X J;  3HFZ B;  1IXR A;  1WTH A;  4ZUI A;  1RTO A;  1VQG A;  1TWH B;  2OT2 A;  4L6T B;  5F2D A;  1GUO A;  4LW1 A;  1SJE D;  1LTT D;  2IL8 A;  4OX9 Q;  2K01 A;  2F03 A;  2F3I A;  1QVG A;  4XT3 B;  1SAP A;  1L0W A;  4CDF C;  3MAQ A;  1SR3 A;  2Z1C A;  1YNJ C;  2WAC A;  4TSS A;  5D65 A;  5HGQ A;  1QE6 A;  1SRU A;  5KYL A;  4DV5 L;  1AH9 A;  1V1Q A;  1WTW A;  1ET9 A;  2F52 A;  1AEX A;  2F0F A;  2RDG A;  4X66 Q;  4YHH L;  1GUS A;  3D4W A;  3GV6 A;  4P72 A;  4JI0 L;  3DWA A;  2OCE A;  3Q23 A;  4A3M H;  3HOU B;  1QNK A;  3RZD H;  1Q8K A;  1B44 D;  4MIU A;  1YEZ A;  5EPL A;  3KOJ A;  4BY1 B;  4PNY A;  1S4Z A;  1I50 H;  2N55 A;  3E0J A;  3KDF A;  1IBL Q;  3WOE A;  2WV6 D;  3ICE A;  1LO5 D;  3EJI A;  1S5F D;  1EEF D;  4UHV A;  3J81 L;  4JBK A;  1B3A A;  4A3K B;  3KJP A;  1Z47 A;  4YCU A;  3V05 A;  2EYP A;  4FF1 A;  2GA4 B;  2LKV A;  5GAE C;  1TWA B;  3RLN A;  4R4O A;  1JOR A;  2JSO A;  3GTM H;  2HQL A;  4X64 L;  1PRT C;  1BO0 A;  1B9N A;  1NAP A;  1S5D D;  5C5L A;  2I5L X;  5JEA G;  3CQZ H;  3K5L A;  4IO9 A;  3NSW A;  1EWH A;  4X65 Q;  4LUO A;  1S5E D;  2IX0 A;  3P75 A;  2YTX A;  1PZK D;  3I91 A;  4FYD A;  2OF1 A;  4A3J G;  2K33 A;  2Q2H A;  4OXP A;  3HKS A;  5IGC A;  4DNI A;  1I3Q B;  5C0X G;  4JI8 L;  2Z0S A;  3F2D A;  1YI2 A;  2FXQ A;  3ERS X;  3A8K E;  4HAE A;  2BCO A;  3MEH A;  5L37 A;  4BY7 H;  2JE6 I;  4N8X 1;  4DR2 L;  5G3L D;  5GRO A;  4NKL A;  5BN5 A;  1WD1 A;  4CBV A;  3E6Z X;  2YTY A;  4C3J B;  3K58 A;  3FPU B;  4LUV A;  2EDG A;  4DV1 Q;  4LF8 L;  1WCM B;  2PW7 A;  1CKM A;  3LWE A;  4DV6 Q;  1WI5 A;  2YU9 B;  3DM3 A;  1Q12 A;  3A8J E;  2F0Q A;  5C4J H;  1H9R A;  1HA5 A;  4RMF A;  2B2U A;  4EQN A;  5CGK A;  3J81 E;  5FK9 C;  1R4Q B;  5C4H A;  3URY A;  4CGY B;  4QUC A;  4O1N A;  5H1S E;  4A3I B;  2YV5 A;  3U50 C;  3HG9 A;  1PTO F;  4LFC L;  3E9H A;  5C3W A;  1BBU A;  3DWQ A;  4R4C A;  1L0Y B;  1Y1W G;  1J9O A;  1STG A;  2Q2U A;  2F0D A;  4YIJ A;  3NP8 A;  2JN4 A;  4DR2 Q;  3K8A A;  4HSP A;  2Y0S E;  1L1O A;  4EQO A;  1VQ4 A;  3S16 H;  2KEN A;  2WB1 B;  2MHV A;  5DNF A;  3NEM A;  3GTO B;  1K8M A;  1EOV A;  2JEA I;  3W1B A;  4OO1 H;  3FP9 A;  3R8B A;  3SEB A;  1X3F A;  4DV0 Q;  1QJO A;  3AQQ A;  3UI2 A;  4BXX H;  3SK4 A;  1K8O A;  2B2T C;  1VQN A;  1PTO B;  5FLM H;  3CP0 A;  1LTL A;  2EJF C;  3DUZ A;  2LS0 1;  5KNC A;  2VNU D;  4FDB A;  4PZ6 A;  4V19 0;  5M5X B;  4JI5 L;  1EY9 A;  2AQ1 B;  1Q81 C;  3BJU A;  4X64 Q;  5BN4 A;  3CCM A;  2F0E A;  2UXD L;  5CMD A;  1ICW A;  3W5O A;  3MXN A;  4YWK A;  1PTO C;  1A3V A;  1E24 A;  3NWS A;  2F0L A;  1OXS C;  4CKE A;  1YBY A;  2VS1 A;  5GAD C;  4HED A;  4HID A;  4RHR A;  2VXW A;  1K3B C;  5I6W A;  3Q0A A;  4OL7 A;  4LF5 Q;  1XNQ Q;  2X6L A;  1OO9 B;  5NUC A;  1GHJ A;  1Z9F A;  1Y1W B;  4C2M H;  2CKZ B;  1CZG A;  1RDP D;  3NTH A;  1II3 A;  3L2P A;  1SLJ A;  1D5X C;  3CRK C;  1STA A;  1VMP A;  3OW2 A;  1CSQ A;  1F2Z A;  5T1I A;  3HOW B;  2EIF A;  3BDO A;  5IY0 A;  4X66 L;  3CC2 A;  3S14 H;  1C8C A;  1STB A;  3UDX A;  2KQ3 A;  2CCZ A;  3S15 H;  1HHV A;  2LFN A;  2ICE C;  4A3D G;  2F4V Q;  1YZ6 A;  1U0L A;  2PNR C;  4GN4 B;  2BE5 C;  3FKI H;  3GTG H;  3H15 A;  5LL6 X;  4HIO A;  4LWC A;  1JMC A;  1EQQ A;  4DUY L;  4LFA Q;  3NTI A;  5C3E H;  4BA2 I;  1YJ9 A;  5A35 A;  3CCU A;  1HNZ L;  5JPM C;  5IGD A;  3HKZ E;  4OX9 L;  3NEN A;  3X3M A;  4JI8 Q;  5JVH 3;  3VR6 A;  2E2J B;  4IUV A;  2R3Z A;  1WJJ A;  1PH8 A;  3GD7 A;  1DYQ A;  2DNC A;  1XNR L;  1XJV A;  1K3R A;  2C35 B;  1YVC A;  4DUZ L;  5J22 A;  2D62 A;  1CQV A;  3NXW A;  3OIP A;  2QCP X;  4LK1 C;  4ZQ3 A;  5EAY A;  1N34 L;  5K36 H;  3CPW A;  2HHH L;  3FRP B;  4QF4 A;  1IYU A;  3ZYY X;  1Y1V B;  3HOW G;  3JAM c;  2A68 D;  1I94 L;  3CMA A;  1ZKO A;  4JOI A;  4IUP A;  3TME A;  2BA1 A;  2HCC A;  1FD7 D;  4POF A;  1D2B A;  4JI6 Q;  4C56 C;  2K5V A;  1HZC A;  1HRJ A;  5E4W C;  1NJI C;  2F4I A;  2MO0 A;  4GOP B;  3TS0 A;  1I4H A;  1AP0 A;  4I7A A;  4DGZ A;  1D5M C;  5BN3 A;  4MNO A;  4B3T Q;  1B1Z A;  2EVB A;  5IYC G;  5C3E G;  2VZA A;  2Y0S G;  1K28 A;  3J81 c;  4APV A;  4ILW A;  3QB3 A;  4J1M A;  1VQ9 A;  2HT1 A;  1F2L A;  2NVY H;  4B9X A;  4L5S A;  4XIG S;  2ZM6 L;  4N9P A;  4QIW B;  4DV4 Q;  4LNQ A;  3CME A;  2G9D A;  4ZUJ A;  1CUK A;  3GTM B;  5M3F G;  1IKM A;  3NQI A;  2C5C A;  2K1B A;  1E1O A;  2ASB A;  4A3C G;  4FF4 A;  4Y7N B;  2JA8 B;  1CZW A;  4IFD I;  2YYZ A;  1RKN A;  2DY7 A;  4JW0 A;  1MBY A;  4GOP C;  2A5H A;  1U4R A;  5I9P A;  2RCN A;  4LF9 L;  3SXH A;  1SE2 A;  2RHQ B;  3IKJ A;  2EY5 A;  2F0N A;  4GKK L;  3J7A V;  2WB1 G;  1LYL A;  4EGV A;  4A3E H;  4CJ1 B;  2K04 A;  1JB3 A;  2WB1 E;  2JA5 B;  3VYU A;  2OQK A;  2L1B A;  2Z8L A;  5EJW A;  2E5L L;  4IPH A;  3L9A X;  2AQ2 B;  2KEE A;  4PMW A;  2XSC A;  4JYA Q;  4JOI C;  1EWC A;  5IT9 E;  1PTO D;  2CH4 A;  5M9O A;  1ESF A;  4CDD C;  1OXV A;  3PCO B;  1SFO H;  1TQO A;  2OTJ A;  3HS0 C;  4QGU A;  1QB5 D;  1SNM A;  1WYD A;  5EKK A;  1EQV A;  4ZK9 B;  1G6Z A;  2I0Q A;  4DPG A;  1QIL A;  3H91 A;  4A3G G;  2ZJQ A;  5FJ8 H;  3E5S A;  1JC7 A;  5LMN Q;  1X54 A;  1WTQ A;  1K8A C;  1HZB A;  1YHA A;  3GTK H;  1NSN S;  1VQJ A;  3HGB A;  1TR5 A;  2N3S A;  4IUN A;  4RAU C;  3PGZ A;  3I4M G;  4G7Z C;  1SSO A;  1ZYR D;  4AIM A;  4U67 3;  3HZX A;  1D5Z C;  3TDQ A;  4NP5 A;  4R4T A;  1XMQ L;  4MZ9 A;  3WDN A;  1KC8 C;  2R7Z H;  1UEA B;  2A68 C;  1M90 C;  1MSG A;  2I07 B;  3I72 A;  4CJ2 C;  1XX8 A;  1HR0 Q;  1W2B A;  2Q2I A;  3SK6 A;  1NUC A;  4KY6 A;  4BBR H;  3BYY B;  1PFB A;  5M5W H;  2OXP A;  1BNZ A;  3KF8 A;  1SNP A;  1K83 H;  2HD3 A;  5AJ3 L;  2R92 H;  1PH5 A;  3S2H H;  5ELB A;  1DM0 B;  2J0T D;  1IL8 A;  4JC0 A;  5C3X A;  1J5E Q;  2VY3 A;  5DM6 3;  3RZO B;  3T53 B;  4DV4 L;  3I2Z A;  1B70 B;  2C9O A;  4HR7 B;  3M9B A;  3GTQ H;  4HTH A;  3H0G G;  4XQQ A;  1YNN C;  4R9W A;  3BYT B;  4B3T L;  1O80 A;  3STB D;  1A3T A;  1DON A;  5EBC A;  2Z6K A;  1F9R A;  1ML0 D;  2L11 A;  3KBX A;  1LTR D;  2KCC A;  4QB4 A;  5CR3 A;  3TRE A;  5AFW A;  2BE5 D;  4A3F B;  1W6J A;  3I4N H;  5IWA Q;  1A2U A;  2E76 C;  2ALY B;  3K7A H;  2Z6K C;  2HQE A;  4OIJ A;  1WTX A;  2O5I C;  3S1R B;  1SNO A;  2JJQ A;  2A1A A;  5CV9 A;  4JVZ A;  3BZK A;  3M3Y B;  2O4X A;  2UXC Q;  1B9M A;  1CKN B;  1NR4 A;  2JA6 H;  4A93 B;  2LXJ A;  2NVQ H;  5IOD A;  4DAP A;  1RL2 A;  2F0T A;  1S72 A;  1HJP A;  4HIM A;  1TY0 A;  3I4O A;  2BOS A;  1CKO A;  1EIH A;  3A74 A;  2E5L Q;  3H6M A;  4IQZ A;  3OTO Q;  3S1N H;  1P16 A;  3HP3 A;  4DUZ Q;  3EFX D;  1Q1E A;  4ME3 A;  4RGT A;  3K5O A;  2PI2 E;  1Q46 A;  4DN4 M;  4LF9 Q;  3OMC A;  2HIV A;  3I4N G;  3NPP A;  4OO1 I;  4DNT B;  4QIW E;  1HQM C;  2DJF C;  1SYB A;  1W3S A;  1X3P A;  1Y8P B;  5LMU L;  1EIY B;  4AH6 A;  2EXZ A;  4UDU C;  3BVM A;  4YY3 Q;  4A3M G;  1SEB D;  4K2K A;  3MXN B;  3T4A C;  4DUY Q;  2A69 C;  4H44 C;  1SYD A;  4X3U A;  1QVF A;  1GJX A;  2NZ1 D;  2FJ2 A;  1SRO A;  3K80 C;  1KDB A;  1BOS A;  3PF4 A;  1B3Q A;  5FLX E;  4C2M B;  2ZXO A;  4C1N K;  4RCO A;  3RR5 A;  3OYY A;  4DXG A;  1Q82 C;  3S1Q B;  1LAC A;  4O0A A;  1ESR A;  3M7G A;  1XMO Q;  1JWS D;  1PRT F;  2R7D A;  4OEL B;  2B2Y C;  4AYB B;  1BCP B;  1SE4 A;  3WWV A;  1EYD A;  4RH6 A;  5CV5 A;  3J80 i;  1VQ7 A;  4L63 B;  1FNW A;  3VR3 A;  1SYC A;  5IP7 G;  2XVS A;  3A55 A;  3ULL A;  4LF5 L;  2VUM H;  1C9O A;  3GTK B;  2B2Y A;  3GTP B;  2D0P A;  3GTP H;  2NZH A;  1DCZ A;  1TS3 A;  1TWF H;  1Q90 A;  1I4P A;  1X3Q A;  5COR A;  5CBA E;  3TZU A;  1O7I A;  3BVZ A;  4RA8 A;  3J7A 5;  1EY0 A;  1RCV D;  2FFK B;  4ID6 A;  2UXD Q;  1N34 Q;  5KGU A;  1FNV A;  1LV9 A;  5EKI A;  3D0F A;  4DFA A;  4C3I G;  2WIN B;  3DHQ A;  4BY1 G;  3M4Y A;  4DK3 C;  3KLS X;  4Y7N H;  2VQF L;  5ELO A;  3W3A A;  2F0H A;  1SMY C;  4X3K A;  2RQX A;  1K9M C;  1SDF A;  4A3E B;  4DR6 L;  5M3M H;  4K5V A;  1PHJ A;  1CQF A;  4JI1 L;  2AWO A;  4UP9 A;  3KFU A;  2KVM A;  4K8I A;  3HOX H;  3KF6 A;  1VQD A;  4FNF A;  3G6E A;  3RN2 A;  1R9T H;  2B2W C;  1M8A A;  2KOL A;  1HNZ Q;  2IWH A;  3Q22 A;  4OON A;  3BVG A;  1CA6 A;  4RGN A;  5JJL A;  1VDZ A;  3H0G H;  2KHS A;  3OIQ A;  1LLR D;  4KD4 A;  4ODG A;  3A7A B;  4LFC Q;  1IBM L;  2AUJ D;  1N36 Q;  5C4J B;  2NWG A;  2NBF A;  3DEP A;  4OEM B;  3STB C;  4HJ8 A;  5D14 A;  3BS1 A;  3ERO A;  3SVM A;  1WCM H;  4FXK C;  2AQ3 B;  4NDX A;  4A3F H;  3SR1 A;  3FMC A;  4IPC A;  2R92 G;  2EY2 A;  4DA2 A;  3OW7 A;  4BBR G;  1QOH A;  2XGT A;  4FXD A;  3DMU A;  1SYG A;  1A3U A;  2Q8T A;  1WTP A;  3M4O B;  5ISR A;  1ENA A;  2BDN A;  1GXD C;  5GQO A;  2MO1 A;  2QDB A;  4P73 A;  1A8V A;  1DXM A;  2M00 A;  4PV1 C;  2B8F A;  2A6H C;  3O13 A;  1XXG A;  4B3R L;  1MKH A;  4K0K L;  2DJG C;  4K5W A;  5DM7 3;  1YJN A;  4UPA A;  1S5B D;  3F8T A;  1F9S A;  4RHS A;  3I4M H;  1L0X B;  4QMG A;  2VB3 X;  5HGT A;  4YY3 L;  3DXJ C;  5ELN A;  1KQS A;  3TS2 A;  4HJ7 A;  2PZT A;  1K8G A;  3CQZ B;  4A93 G;  1HH2 P;  2K5H A;  1ILQ A;  3L7Z C;  5C3E B;  1G91 A;  3MXG A;  2PMZ B;  4A3L H;  3Q8D A;  4C3H H;  4DR1 Q;  3H0G B;  4GN3 B;  4IFD G;  1HA6 A;  4EX5 A;  1PFN A;  3PF5 A;  5JJZ A;  1NTG A;  4RCN A;  3OTO L;  1PH7 A;  2CQA A;  5IP9 H;  5FOB B;  4A3B H;  2GVA A;  3EN2 A;  3D31 A;  3HOW H;  4J6H A;  1LT5 D;  4U68 A;  1H9K A;  3G7L A;  2MFI A;  1WTR A;  3QWN A;  1DOM A;  3PO3 G;  2H1E A;  1BKB A;  4GZY C;  3TP8 A;  3W1G A;  4BWG B;  4JV5 Q;  4A3E G;  3U9S A;  1JR0 D;  4BBS G;  1MI2 A;  3ND9 A;  1BR9 A;  4A75 A;  2KCN A;  3PV0 A;  4DKA C;  2F0U A;  4JK1 C;  1MIU A;  1PLF A;  3J81 i;  4H02 A;  1TWG H;  3DWP A;  3NQT A;  1FJG L;  4P2C B;  1QUQ A;  4DR5 L;  2K5W A;  2E2D C;  4ZRZ A;  3UE0 A;  1TWF B;  1U4M A;  1BCP D;  3SE0 A;  2OEO A;  3PUV A;  3QIA A;  1XMO L;  4JI0 Q;  4DF7 A;  1SNQ A;  4KY5 A;  3K6O A;  4F8M A;  5IE8 A;  4YHH Q;  2ES2 A;  3U4V A;  2R93 G;  5KND A;  1T9H A;  5EPJ A;  4JI7 Q;  3K0X A;  4BS9 A;  4ABN A;  4DV5 Q;  4IOA A;  2PQA A;  4V0B A;  2I46 A;  2B29 A;  3PUZ A;  3MVV A;  1SFO B;  2QIL A;  5FO9 B;  2NN6 G;  1K0R A;  1UAP A;  1MGS A;  2PCF B;  5IGF A;  3TN2 A;  1TY2 A;  3KJO A;  3AFP A;  5E1F A;  1HCZ A;  1Q7Y C;  1L2F A;  2E8G A;  1EL0 A;  3RLO A;  1YIJ A;  4KY7 A;  4XYQ A;  3HOV B;  2JA5 G;  1AZQ A;  1YJW A;  4DAY A;  4RWS C;  1AE2 A;  1JE5 A;  1VMC A;  3VR4 A;  1JWM D;  1I4X A;  2PZW A;  1IKL A;  5C5M A;  3VR5 A;  3D4D A;  1QWY A;  4IUU A;  3JAM L;  1FNU A;  3CCR A;  2M9V A;  2WKC A;  1JOK A;  1Q3L A;  3CW2 C;  1VQ5 A;  2F0J A;  2HUG A;  4HMJ A;  4C3H B;  1Y8N B;  1H9M A;  1J8I A;  4UAI A;  1SYE A;  1ZEQ X;  1VQP A;  1Z6H A;  3PIP A;  3F2U A;  1Y8O B;  5I4D A;  2UUC L;  3S1N B;  4QQB X;  3KLW A;  1O78 A;  2RVL A;  4CDC C;  2K50 A;  2NVY B;  4XYO A;  3NBI A;  1RHP A;  1HPC A;  2UUB Q;  1RD9 D;  4Z9C B;  1TWC B;  1VQB A;  4KKT A;  1U5K A;  3QO2 A;  5LHY 1;  3PO2 H;  1PYB A;  2KEC A;  1I6H B;  3TQY A;  4DK6 C;  3KBG A;  3FKI G;  3FPP A;  2A6H D;  2ATW A;  1KLU D;  3OMG A;  2BDO A;  3TP5 A;  4JCV E;  2YU9 H;  4JYA L;  3MHB A;  3KLS A;  1YNX A;  2CFM A;  2GN5 A;  3GTJ B;  2MUY A;  5JJK A;  2QKI C;  1KRT A;  4LF7 Q;  1P8L A;  1HUN A;  1HZ9 A;  1J5E L;  2YTV A;  1SMX A;  4A76 A;  3PMF A;  1BF4 A;  3MXP A;  4KHP Q;  4BY7 B;  4YWL A;  3GTQ B;  4FVM A;  4R1J A;  5EKL A;  4DV7 Q;  1CA5 A;  2WAQ E;  3HOZ B;  2EY1 A;  3CCS A;  2O2L D;  5C4Z A;  1I3Q H;  3LX0 A;  1STE A;  1HNW Q;  4A4I A;  1LUZ A;  1VS0 A;  1HNX Q;  4ULL A;  1KDC A;  3D3R A;  1VQ8 A;  1EFI D;  5J1Z A;  3I56 A;  2ZM6 Q;  3S15 B;  4EQP A;  5IOC A;  2KA7 A;  1JCK B;  4BBR B;  2N78 A;  4EQ5 A;  4KLK A;  1FGU A;  4CKC A;  2L55 A;  2F0P A;  5T1G A;  3G48 A;  2BH8 A;  5DLQ E;  3HOZ H;  5FLM G;  5IYB G;  2IHE A;  4LF4 L;  4N8F A;  1VCI A;  2JEB I;  3K7U C;  2R7Z B;  3T1H L;  3F2B A;  2XRS D;  5C4X G;  1I4Q A;  2XRQ D;  1W6K A;  3OPO A;  2HCI A;  4A3J H;  3R2T A;  5FKA C;  1I94 Q;  3UDF A;  4F88 A;  4LF4 Q;  4KMU C;  2UUC Q;  2PPB C;  3ERQ A;  1KL9 A;  3GTJ H;  1R4P B;  3AB9 A;  1ENF A;  4XQJ A;  2ZT9 C;  4ME5 A;  2KCT A;  3VYR A;  3A56 A;  1KAB A;  1EY7 A;  1RTN A;  4UP7 A;  4GKJ Q;  2QW7 A;  4KD3 A;  4GNX C;  4E6I A;  1TWH H;  4OIK A;  2EYO A;  2ID0 A;  1HNX L;  4LF6 Q;  2H4O A;  2NZO A;  4AQY L;  5IYD H;  1M1K C;  4JI3 L;  2CQO A;  1EZ6 A;  3A0J A;  1XTD A;  4CKB A;  1O7L A;  2RDF A;  4KHP L;  2E75 C;  2WP8 J;  1AE3 A;  4XXE A;  1PH9 A;  2J7Z A;  4LFA L;  4IFD H;  1X65 A;  4A3L G;  1G51 A;  5C44 B;  2F1M A;  2EQS A;  3S16 B;  4B08 A;  3S2D B;  2K7V A;  5EQ0 A;  4DV3 L;  3CC7 A;  2AKW B;  2VQE L;  1EYG A;  2A19 A;  2ZJP A;  2MNA A;  4BY7 G;  1V8Q A;  5IYB H;  1WTV A;  2JA7 B;  3A8I E;  3G71 A;  1F9Q A;  2QEX A;  5C0X H;  3A54 A;  3T13 A;  1XTC D;  2L0C A;  1BCP C;  1FJG Q;  2R93 B;  3GO5 A;  2EJM A;  2B8G A;  2CH4 W;  4DAY B;  4TQU S;  5ELE A;  1XNQ L;  4LJZ C;  3RNU A;  3T51 B;  1TVX A;  4DV2 L;  2B3G A;  1VQL A;  2G9H D;  3K57 A;  2NVQ B;  1EYA A;  1LTA D;  1SNC A;  4KJN A;  5KRU A;  2PZU A;  1CM9 A;  1JWU D;  5JEA H;  2Q8R E;  4G4K A;  1XPU A;  1KRS A;  2KBN A;  3CC4 A;  3UE1 A;  1A0I A;  5I6Y A;  4I65 A;  4LFB L;  3K7A B;  3K59 A;  3CPF A;  1CK1 A;  1KHI A;  1CSP A;  2DY8 A;  1N33 L;  3C1F A;  2CVR A;  3GTL B;  5JVG 3;  4WFN 3;  1EEI D;  4JI4 L;  3H3V C;  2EZV A;  1DOL A;  5KYI A;  4LAA A;  1DJR D;  2MJ8 A;  1XPR A;  1NCV A;  3GDE A;  3J80 c;  3V96 A;  3HOY G;  4LUZ A;  4KK7 A;  5CC4 A;  1UWV A;  4OWW B;  4UY8 C;  3S17 H;  2I5H A;  5DAU A;  3HOY H;  1K0S A;  4QCL A;  4X62 Q;  1NR2 A;  4S3S A;  2E2H H;  3S2D H;  1LT3 D;  3RZO H;  3QG1 A;  1A62 A;  5M3M G;  4B3S L;  2E2J H;  1YNN D;  5EPK A;  2F4V L;  1V1P A;  2R92 B;  2B2U C;  1Q86 C;  2WAQ B;  4C3J G;  1H9J A;  2Z4I A;  1G2S A;  4GNX B;  4JI2 Q;  3M7N A;  1Y14 B;  1TII D;  4WJ3 M;  1U9R A;  4R4Q A;  1QZG A;  4B3M Q;  1IL2 A;  3S9W A;  4YCW A;  2DUD A;  3ND8 A;  1KTK A;  2HIX A;  1TS5 A;  3C1E A;  4A3M B;  3J7Z C;  1D7Q A;  1N32 Q;  2SDF A;  3CCE A;  1CTM A;  2EYJ A;  4J8Q A;  2F0W A;  3QOL A;  5FLX c;  1A15 A;  2B63 B;  1ICF B;  1VQE A;  2Y0S B;  5CV6 A;  1CI3 M;  5KEE A;  1IBM Q;  1SE8 A;  3GTL H;  4P75 A;  1SJH D;  1QNU A;  4B3S Q;  3OWE B;  1WFQ A;  3K81 C;  2PNH A;  2LMC B;  3F1Z A;  2Z9H A;  4HJA A;  1KNE A;  1ZYR C;  2ENB A;  3A5U A;  2Z6B A;  1HTL D;  1WOC A;  4DV0 L;  2AUK A;  3LNN A;  4DR1 L;  4DR3 L;  4JI1 Q;  3EVQ A;  1DOK A;  4P74 A;  4NW2 A;  4WJ4 A;  2XNA C;  2IX3 A;  1H9S A;  3RD4 A;  3G6J B;  1K73 C;  2XTI A;  2CWA A;  4DNR B;  2ZXP A;  2R93 H;  3J81 j;  4NXM L;  1MHW C;  4WOR A;  4GOP A;  2VQF Q;  3TRZ A;  3H3V H;  2DGY A;  3OHX C;  1E2Z A;  1LAB A;  1JQY D;  3R93 A;  4PMC A;  3GP7 A;  3AFQ A;  1NMG A;  2NVT B;  3W2D A;  3E9I A;  4IFD J;  2VB2 X;  1YIT A;  1EU4 A;  4B3R Q;  1SYF A;  5ELF A;  4O2D A;  4LMQ D;  4A3G B;  5GAG C;  2ZJR A;  3HOX B;  3HOY B;  3TP6 A;  1PH3 A;  4HJ5 A;  1PH4 A;  1JJ2 A;  3C2P A;  1IBL L;  1TS4 A;  2CW0 C;  5JPN C;  4PQX A;  5D3I B;  2F0M A;  2I5M X;  3N6R A;  4KV6 A;  4QJF A;  5I9O A;  1EY8 A;  2BH2 A;  3HOV H;  4A3C H;  2MP1 A;  5JJI A;  1T5E A;  1Q8I A;  1JT8 A;  1LT4 D;  4B9W A;  1ENC A;  4DV6 L;  1QCB D;  3A5Z B;  5IP9 G;  2F3W A;  3I70 A;  3QOJ A;  4DV1 L;  3IAY A;  4FF2 A;  1TKW B;  1TU2 B;  1E22 A;  2XWB B;  3KDF B;  2JK8 A;  1N36 L;  1C7Y A;  2UUA Q;  5FLX L;  3TBI B;  5C4X H;  1L1O C;  2OWO A;  2PI2 A;  5EGT A;  1IHZ A;  4X62 L;  3U58 A;  5CBE E;  3T56 B;  1KAW A;  1PH6 A;  1E2V A;  2XWJ B;  4IJL A;  1U4P A;  1M4V A;  5BR8 Q;  1TWC H;  1D1K A;  2B63 H;  2V4D A;  5CV7 A;  4QUF A;  4CDE C;  1GUT A;  1WTO A;  4JI4 Q;  4P71 A;  1OTC A;  2NVX B;  1EWI A;  3IL8 A;  5K36 G;  2RA4 A;  4K8J A;  1E7Z A;  1LTS D;  2F0K A;  3JAM i;  3PUW A;  4HCE A;  4NMZ A;  1VQK A;  4NXN Q;  1G8Z D;  1SND A;  3I73 A;  4H0L C;  1VQO A;  1IBK Q;  4RGO S;  4RGM A;  4DU9 A;  5M5W B;  3MWY W;  4O42 A;  1KDA A;  2KJX A;  2SOB A;  2K4K A;  4DV2 Q;  5M3M B;  5C6A A;  1PRT D;  2HDL A;  1LT6 D;  3T1Y Q;  4DK0 A;  2B2V A;  1YHB A;  3FKI B;  2B63 G;  3GTG B;  1VQA A;  1HFN A;  3T1H Q;  2RSN A;  1E3P A;  3I3C A;  4RKL A;  1TWA H;  2PW5 A;  3VYT A;  4M1U B;  3CU7 A;  4DR4 L;  3BDL A;  5FO7 B;  3LWU A;  5LMN W;  4IJH A;  5A2Q L;  4N9T A;  5FJ8 G;  2JA6 B;  1I50 B;  1WD0 A;  3HOX G;  1IZ6 A;  4KHZ A;  2FMM A;  1V43 A;  3CCV A;  3S24 A;  4JBW A;  4X6A H;  3ITP A;  2O5J C;  3D4R A;  1DD2 A;  1HNW L;  1NE3 A;  4G7O C;  3MA2 B;  4DXF A;  2QEJ C;  1ET6 A;  2RBM A;  2M2L A;  1I6H H;  1BBX C;  1OXX K;  2DNE A;  4C3I H;  2EE1 A;  1X3G A;  5J3B A;  2KHI A;  1HTP A;  3V2T A;  4MTK A;  2RF4 A;  3E3X A;  1IYJ B;  1UEB A;  1QUQ B;  4DAV A;  1HZA A;  2PQE A;  3P7J A;  2D0O A;  4K6D A;  3CF5 A;  4H7B A;  2JA5 H;  1CHP D;  1HUM A;  3D8G A;  2K6A A;  5A2Q E;  2JA9 A;  2JA7 H;  1Z7T A;  1PH2 A;  4PG3 A;  2IW3 A;  1STN A;  1UUP A;  1EOT A;  1SBB B;  1KD1 C;  3GTO H;  2N8N A;  3DEO A;  2XIW A;  4I7Z C;  3FEW X;  4GNX A;  5IGG A;  3HOU G;  5IWA L;  4KN7 C;  2LXK A;  2WFW A;  4KHV A;  2K5D A;  3PUY A;  4HIK A;  2PYK A;  2Q2T A;  4FF3 A;  2TMP A;  5C0X I;  1PRT B;  2N49 A;  1XPO A;  2JQO A;  3NBH A;  1MJC A;  3I4M B;  4RG1 A;  3VR2 A;  1F9P A;  3NWT A;  3I7F A;  2QGQ A;  3HRZ C;  2E2I B;  3M3Y H;  4HJ9 A;  1DZ1 A;  4HCS A;  3KK7 A;  2EYM A;  5IT9 c;  1ROD A;  2KED A;  4GKK Q;  2N88 A;  1SMY D;  2KCM A;  3NK9 A;  1IW7 D;  1RF2 D;  3PO3 H;  2P5Z X;  3GQB A;  2VUM B;  1MD2 D;  3SDZ A;  4HMI A;  1MSH A;  5IGB A;  1CT1 D;  3FVQ A;  4A3B G;  3LGJ A;  3AU7 A;  1PFM A;  1A63 A;  1O7Z A;  1HR0 L;  5D3D A;  1FYC A;  4L8J A;  3CAM A;  1H9S B;  4TKO B;  4JBM A;  1EIG A;  4C3H G;  3I55 A;  3HKZ B;  4G7H C;  3KLR A;  4QL5 A;  1OXU A;  1B50 A;  1X32 A;  1EFW A;  4JI7 L;  2AHO B;  1RJT A;  5I2X A;  3EIV A;  4YWM A;  1PA6 A;  1JJC B;  1X3E A;  5LL6 S;  1PMR A;  2UU9 L;  1GUG A;  4DR4 Q;  4ZKB B;  4XT1 B;  1Y1V G;  4PMB A;  4OGQ C;  1PFS A;  1EY6 A;  1S5C D;  2F0S A;  4BBS B;  4IAL A;  4G57 A;  4A3D H;  2A6E D;  3E0E A;  3KYH C;  1KAA A;  1SN8 A;  2ZTE A;  2FIN B;  1HQR D;  1A6X A;  1B53 A;  5K5P A;  3MZ5 A;  3ULP A;  2WII B;  1IBK L;  1JIC A;  2K75 A;  2NUC A;  2HHH Q;  3IFD A;  3S14 B;  3U9O A;  1MJE A;  2K5N A;  1HR0 W;  1TS2 A;  4XQN A;  1TXY A;  4OWX B;  3R3O A;  3CCJ A;  1X6O A;  2QDL A;  3RLF A;  3G4S A;  2Z4H A;  4HN7 A;  2K5Q A;  2V1C C;  5KNB A;  1EIF A;  5IIF A;  2KUM A;  1XNR Q;  5M3F B;  2DN8 A;  2LY7 A;  4GLA C;  1PYS B;  3M4O H;  4MN3 A;  4JG2 A;  3AEV A;  3NTK A;  5BR8 L;  3J80 L;  4IPG A;  2JA8 G;  3J7Y W;  1BCP F;  4IUR A;  3PO2 B;  2F0I A;  3CHB D;  3ONA B;  1QZH A;  1ONL A;  3TZD A;  4BXX G;  1TT2 A;  3PO3 B;  4IZ8 A;  5I2Y A;  2NB0 A;  5M5X H;  1N9W A;  4GLV B;  2TSS A;  4MHE A;  3H3V I;  1X55 A;  3B6Y A;  3MTS A;  4ZCK A;  2UUA L;  2RKS A;  1PTO H;  2SEB D;  4DR7 Q;  1H95 A;  2H5X A;  3IRB A;  1CHQ D;  2E2I H;  3M85 A;  4AYB G;  4FP5 D;  1FVI A;  4PZ8 A;  4A3B B;  5COY A;  4DR5 Q;  2ZXR A;  1D8L A;  3KF8 B;  2JA8 H;  2L15 A;  1PXU A;  2D5D A;  5GAH C;  2NVT H;  2EYH A;  2K52 A;  1I4G A;  5HUR A;  1BDO A;  3OWF A;  3L0O A;  1GOZ A;  3T1Y L;  2IPK D;  4IUQ A;  5C44 G;  3J7A F;  4FXG C;  4JI6 L;  4X3T A;  4YCV A;  5IYD G;  4K6L A;  5M5Y B;  1GKH A;  2AMC B;  4JV5 L;  3T16 A;  1V1P B;  2EYF A;  1LM0 A;  5E3F A;  1S40 A;  1LTG D;  1ASY A;  4EVO A;  1G6P A;  1ILP A;  4C3I B;  2A73 B;  1OXT A;  5TSS A;  2B39 A;  4JPB W;  3S1R H;  4NXM Q;  1PV4 A;  3ULJ A;  1STH A;  1XYI A;  1C48 A;  1HXY D;  3GV3 A;  3MFY A;  4DR6 Q;  1EQT A;  1J6Q A;  3BG3 A;  5DEH A;  5EBD A;  1BQQ T;  2JYO A;  2IT1 A;  3VDY A;  3J80 E;  1Y1V H;  1CKN A;  3F2C A;  1UE6 A;  1TWG B;  2F0O A;  3BZC A;  2QF7 A;  3CKI B;  4A3J B;  3HOZ G;  1G2T A;  4HSV A;  4K14 A;  4OHJ A;  4J15 A;  2EPB A;  3S1Q H;  1NNX A;  3C3L A;  4UP8 A;  2JA7 G;  2ZTD A;  4K0K Q;  1KLG D;  3QJY A;  5HY6 A;  4ZLT F;  1STY A;  2RDH A;  2WAQ G;  4XDX A;  4BBS H;  5E7N A;  3R2I A;  2EOT A;  1N32 L;  1ASZ A;  1JOO A;  4B3M L;  3MEF A;  2ZTC A;  4GLX A;  1HFG A;  1EU3 A;  1B7Y B;  1GUN A;  1RIP A;  1V9P A;  4KJO A;  3S17 B;  3ER0 A;  4JI2 L;  1EYC A;  3U4Z A;  2RSO A;  2G5D A;  3CD6 A;  1IW7 C;  1Q1B A;  2R61 A;  3UDI A;  4QY7 A;  4KKU A;  2PMZ E;  3QR8 A;  3VA7 A;  1FR3 A;  4RFB A;  5LMU Q;  4A93 H;  4JI5 Q;  3D6W A;  4F7X A;  2A74 C;  3MFG A;  4CJ0 B;  2R6G A;  2MGS A;  2K03 A;  3NEL A;  4F87 A;  2D9U A;  3PSI A;  3PO2 G;  1D1I A;  3HKZ G;  3NE5 B;  2OTL A;  1E0B A;  4R8I A;  3HOU H;  2PQA B;  1EY5 A;  2K05 A;  4DR3 Q;  2FMC A;  1KIX A;  3VYS A;  3HEJ A;  2QA4 A;  1C0A A;  1SXT A;  3Q24 A;  2VL6 A;  1VF5 C;  1GD7 A;  4X65 L;  1NBW A;  3EBE A;  1LTI D;  2HDM A;  3M4Q A;  3BU2 A;  1KXL A;  2EY6 A;  1BUV T;  4C1N I;  1C4Q A;  2NN6 I;  1Y69 U;  2UXC L;  4L5T A;  4K5X A;  1EQR A;  3SK5 A;  4A3F G;  4Q0F A;  1I4R A;  2ICI A;  5CV4 A;  3EQL C;  4KI0 A;  4R8N A;  2R7Z G;  5C4X B;  3I90 A;  2B2T A;  3CCQ A;  2J4X A;  3H94 A;  1D6E C;  3MXU A;  3VA5 A;  4GN5 A;  1R9T B;  4MTN A;  3D6C A;  2L9H A;  3NBH B;  2VW9 A;  1JJG A;  2L4N A;  1V1O A;  2GVB A;  1BBW A;  2JP1 A;  5M5Y H;  3SHL A;  5JEA J;  1VQM A;  2NN6 H;  4LF8 Q;  4BA1 I;  4AYB E;  4DV3 Q;  1NMF A;  3S1M H;  3AMU A;  4DR7 L;  4A3I G;  4CHT B;  1KNA A;  1JOQ A;  5ELD A;  5G3L F;  3OOC A;  4A3G H;  5KIX A;  4A3I H;  2EJG C;  3PIP 3;  4L5R C;  2CWP A;  2F0G A;  1GVP A;  1UNS A;  2NTT A;  4Q5V A;  4OO1 G;  1GO3 E;  5FO8 B;  1EY4 A;  2LSS A;  2XN9 C;  4XTC S;  2EXD A;  5AJ3 Q;  1GHK A;  1LTB D;  4TRD A;  3IFT A;  1G29 1;  3X3N A;  4BY1 H;  1JB7 A;  2A69 D;  1Y1W H;  3HOV G;  2KHJ A;  3WOF A;  4X3S A;  1UE7 A;  1PVO A;  1EUJ A;  4ZKC B;  4LF6 L;  1X56 A;  1F77 A;  1E2W A;  1X9N A;  2K14 A;  3RMH A;  5ELC A;  4R4I A;  2RHS B;  3DLL A;  1PZJ D;  1VQC A;  1N33 Q;  2VUM G;  3KF6 B;  5IP7 H;  1UE5 A;  1VQF A;  3NHH A;  4H13 C;  4LFB Q;  3PUX A;  1SE3 A;  5M3F H;  4JBJ A;  1EZ8 A;  1VQI A;  4GS3 A;  5IT9 L;  1F2Y A;  3L3O C;  2K32 A;  4A3K G;  5LMN L;  2R7F A;  4ALP A;  3MC0 B;  3RN5 A;  3SGI A;  3K5M A;  4POG A;  3H09 A;  1VQH A;  4NPS A;  2BA0 A;  3SK8 A;  1K83 B;  5IYC H;  3Q6S A;  1FGB D;  4KTA A;  2IX1 A;  3JC6 6;  4KN4 C;  5JOB A;  1XWE A;  3EA6 A;  5JAV A;  4L5Q A;  3N52 A;  1PDQ A;  3OSO A;  2L12 A; 
#chains in the Genus database with same CATH homology
 4WJW A;  5CYU A;  2JXM B;  3K0Y A;  4KKS A;  4A3D B;  2L5T A;  3I4L A;  1IYV A;  2FHT A;  4M8A A;  2AWN A;  3TSS A;  2E2H B;  2CW0 D;  5J39 A;  3P1H A;  4IUT A;  1A2T A;  2Q8I B;  3P20 A;  2SNS A;  3RZD B;  1ZXT A;  1U4L A;  4IN3 A;  4RKB A;  3K5N A;  3I4N B;  1WVL A;  3NUC A;  4K2L A;  1B2T A;  2E74 C;  1QG7 A;  1JE4 A;  2IJ0 A;  3TP7 A;  1CFM A;  1AN8 A;  4ZAI A;  4DK1 A;  2D2C C;  3RUZ A;  2WKD A;  5E4X A;  2EYL A;  2A6E C;  4ZYS A;  5IGE A;  1F2M A;  3DM1 A;  2F3V A;  3BZD B;  1PYW D;  3I8Z A;  1YNJ D;  2NYZ D;  3S2H B;  1PZI D;  4FO2 A;  5CV8 A;  3FDT A;  2X6G A;  2PO4 A;  1AW7 A;  2NTS A;  3S1M B;  1GUW A;  2X69 A;  1B4O A;  2B2W A;  3C46 A;  2K28 A;  4WRD A;  3BDC A;  1T5X D;  3JAM E;  1O7Y A;  3A7L A;  3CRL C;  1VF7 A;  3KUP A;  1I6V C;  1BXT A;  2F0V A;  2MPM A;  2SNM A;  1AFP A;  2B2V C;  3PIO 3;  1AZP A;  2CHB D;  5C0X J;  4ZUI A;  1RTO A;  2OT2 A;  1TWH B;  4L6T B;  5F2D A;  1GUO A;  1SJE D;  1LTT D;  2IL8 A;  2K01 A;  2F03 A;  4XT3 B;  1SAP A;  3MAQ A;  2Z1C A;  1YNJ C;  2WAC A;  4TSS A;  5D65 A;  1QE6 A;  5KYL A;  1WTW A;  1ET9 A;  1AEX A;  2F0F A;  2RDG A;  1GUS A;  3D4W A;  3GV6 A;  3DWA A;  3Q23 A;  3HOU B;  1QNK A;  1B44 D;  4MIU A;  5EPL A;  4BY1 B;  4PNY A;  1S4Z A;  2N55 A;  3E0J A;  3WOE A;  2WV6 D;  1LO5 D;  3EJI A;  1S5F D;  1EEF D;  3J81 L;  1B3A A;  4A3K B;  1Z47 A;  3V05 A;  2EYP A;  4FF1 A;  2GA4 B;  2LKV A;  1TWA B;  1JOR A;  2JSO A;  1PRT C;  1BO0 A;  1B9N A;  1NAP A;  1S5D D;  5C5L A;  5JEA G;  3K5L A;  3NSW A;  1EWH A;  1S5E D;  2IX0 A;  3P75 A;  1PZK D;  3I91 A;  4FYD A;  2OF1 A;  2K33 A;  5IGC A;  1I3Q B;  5C0X G;  4HAE A;  3A8K E;  2BCO A;  3MEH A;  2JE6 I;  5G3L D;  4NKL A;  5BN5 A;  1WD1 A;  4CBV A;  3E6Z X;  4C3J B;  3K58 A;  3FPU B;  2EDG A;  1WCM B;  2PW7 A;  3LWE A;  2YU9 B;  1Q12 A;  3A8J E;  2F0Q A;  1H9R A;  1HA5 A;  2B2U A;  4EQN A;  5CGK A;  3J81 E;  5FK9 C;  1R4Q B;  5C4H A;  3URY A;  4CGY B;  4QUC A;  4O1N A;  4A3I B;  3HG9 A;  1PTO F;  5C3W A;  3DWQ A;  1L0Y B;  1J9O A;  1STG A;  2F0D A;  4YIJ A;  3NP8 A;  4HSP A;  4EQO A;  2WB1 B;  2MHV A;  5DNF A;  3GTO B;  1K8M A;  2JEA I;  4OO1 H;  3R8B A;  3SEB A;  1QJO A;  3UI2 A;  3SK4 A;  1K8O A;  2B2T C;  1PTO B;  2EJF C;  3DUZ A;  2LS0 1;  5KNC A;  2VNU D;  4V19 0;  5M5X B;  1EY9 A;  2AQ1 B;  5BN4 A;  2F0E A;  5CMD A;  1ICW A;  3MXN A;  1PTO C;  1A3V A;  3NWS A;  2F0L A;  1OXS C;  4CKE A;  4HED A;  4RHR A;  2VXW A;  3Q0A A;  5I6W A;  4OL7 A;  2X6L A;  1OO9 B;  5NUC A;  1GHJ A;  1Y1W B;  1CZG A;  1RDP D;  3NTH A;  1II3 A;  1D5X C;  3CRK C;  1STA A;  1VMP A;  1F2Z A;  5T1I A;  3HOW B;  3BDO A;  1C8C A;  1STB A;  1HHV A;  2KQ3 A;  2LFN A;  2ICE C;  2PNR C;  2BE5 C;  5LL6 X;  3NTI A;  4BA2 I;  5A35 A;  5JPM C;  5IGD A;  3X3M A;  5JVH 3;  3VR6 A;  2E2J B;  4IUV A;  2R3Z A;  3GD7 A;  1DYQ A;  2DNC A;  5J22 A;  2D62 A;  1CQV A;  3NXW A;  3OIP A;  2QCP X;  4LK1 C;  4ZQ3 A;  5K36 H;  3FRP B;  4QF4 A;  1IYU A;  3ZYY X;  1Y1V B;  2A68 D;  1ZKO A;  4IUP A;  3TME A;  2BA1 A;  2HCC A;  1FD7 D;  1D2B A;  4C56 C;  1HRJ A;  5E4W C;  2F4I A;  1I4H A;  1AP0 A;  4DGZ A;  1D5M C;  5BN3 A;  1B1Z A;  2EVB A;  4ILW A;  3QB3 A;  4J1M A;  1F2L A;  4B9X A;  4XIG S;  4N9P A;  4QIW B;  2G9D A;  4ZUJ A;  3GTM B;  1IKM A;  2C5C A;  3NQI A;  2K1B A;  4FF4 A;  4Y7N B;  2JA8 B;  1CZW A;  4IFD I;  2YYZ A;  1RKN A;  2DY7 A;  1MBY A;  2A5H A;  1U4R A;  5I9P A;  3SXH A;  1SE2 A;  3IKJ A;  2EY5 A;  2F0N A;  3J7A V;  4EGV A;  4CJ1 B;  2K04 A;  1JB3 A;  2JA5 B;  3VYU A;  2Z8L A;  2L1B A;  5EJW A;  3L9A X;  2AQ2 B;  2KEE A;  4PMW A;  2XSC A;  1EWC A;  5IT9 E;  1PTO D;  5M9O A;  1ESF A;  1OXV A;  1TQO A;  3HS0 C;  1QB5 D;  1SNM A;  5EKK A;  1EQV A;  4ZK9 B;  1G6Z A;  1QIL A;  3H91 A;  3E5S A;  1JC7 A;  1WTQ A;  1NSN S;  3HGB A;  1TR5 A;  4IUN A;  4RAU C;  4G7Z C;  1SSO A;  1ZYR D;  4U67 3;  3HZX A;  1D5Z C;  3TDQ A;  4NP5 A;  3WDN A;  1UEA B;  2A68 C;  1MSG A;  2I07 B;  3I72 A;  4CJ2 C;  1XX8 A;  3SK6 A;  1NUC A;  4KY6 A;  3BYY B;  1PFB A;  2OXP A;  1BNZ A;  3KF8 A;  1SNP A;  5ELB A;  1DM0 B;  2J0T D;  1IL8 A;  3RZO B;  5C3X A;  5DM6 3;  3T53 B;  2C9O A;  4HR7 B;  4HTH A;  4XQQ A;  1YNN C;  4R9W A;  3BYT B;  1O80 A;  1A3T A;  1DON A;  5EBC A;  1F9R A;  1ML0 D;  2L11 A;  3KBX A;  1LTR D;  2KCC A;  4QB4 A;  5CR3 A;  5AFW A;  2BE5 D;  4A3F B;  1W6J A;  1A2U A;  2E76 C;  2HQE A;  4OIJ A;  1WTX A;  2O5I C;  3S1R B;  1SNO A;  5CV9 A;  3M3Y B;  2O4X A;  1B9M A;  1NR4 A;  4A93 B;  5IOD A;  4DAP A;  2F0T A;  1TY0 A;  2BOS A;  1EIH A;  3H6M A;  4IQZ A;  3HP3 A;  3EFX D;  1Q1E A;  4RGT A;  3K5O A;  4DN4 M;  3OMC A;  3NPP A;  4OO1 I;  4DNT B;  1HQM C;  1SYB A;  1X3P A;  1Y8P B;  2EXZ A;  4UDU C;  3BVM A;  1SEB D;  4K2K A;  3T4A C;  2A69 C;  4H44 C;  1SYD A;  4X3U A;  1GJX A;  2NZ1 D;  2FJ2 A;  1KDB A;  1BOS A;  5FLX E;  4C2M B;  2ZXO A;  4C1N K;  4RCO A;  4DXG A;  3S1Q B;  1LAC A;  1ESR A;  3M7G A;  1JWS D;  1PRT F;  2B2Y C;  4AYB B;  1BCP B;  1SE4 A;  1EYD A;  4RH6 A;  5CV5 A;  4L63 B;  1FNW A;  3VR3 A;  1SYC A;  2XVS A;  3A55 A;  3GTK B;  2B2Y A;  3GTP B;  1DCZ A;  1TS3 A;  1Q90 A;  1I4P A;  1X3Q A;  5COR A;  5CBA E;  3TZU A;  3BVZ A;  4RA8 A;  1EY0 A;  1RCV D;  2FFK B;  4ID6 A;  5KGU A;  1FNV A;  1LV9 A;  5EKI A;  4DFA A;  4C3I G;  2WIN B;  3DHQ A;  3M4Y A;  3KLS X;  3W3A A;  2F0H A;  1SMY C;  4X3K A;  2RQX A;  1SDF A;  4A3E B;  4K5V A;  1CQF A;  2AWO A;  2KVM A;  4K8I A;  4FNF A;  2B2W C;  1M8A A;  2KOL A;  2IWH A;  3Q22 A;  3BVG A;  1CA6 A;  4RGN A;  1VDZ A;  2KHS A;  3OIQ A;  1LLR D;  4KD4 A;  4ODG A;  3A7A B;  2AUJ D;  5C4J B;  2NWG A;  2NBF A;  3DEP A;  5D14 A;  3BS1 A;  3ERO A;  3SVM A;  4FXK C;  2AQ3 B;  4NDX A;  3SR1 A;  3FMC A;  2EY2 A;  4DA2 A;  3OW7 A;  1QOH A;  4FXD A;  3DMU A;  1SYG A;  1A3U A;  2Q8T A;  1WTP A;  3M4O B;  5ISR A;  1ENA A;  2BDN A;  1GXD C;  2QDB A;  1DXM A;  2M00 A;  4PV1 C;  2B8F A;  2A6H C;  3O13 A;  1XXG A;  4K5W A;  5DM7 3;  1S5B D;  1F9S A;  4RHS A;  1L0X B;  4QMG A;  2VB3 X;  5HGT A;  3DXJ C;  2PZT A;  3CQZ B;  1ILQ A;  3L7Z C;  5C3E B;  1G91 A;  3MXG A;  2PMZ B;  3H0G B;  4IFD G;  1HA6 A;  1PFN A;  5JJZ A;  4RCN A;  2CQA A;  5FOB B;  3D31 A;  4J6H A;  1LT5 D;  4U68 A;  1H9K A;  3G7L A;  1WTR A;  3QWN A;  1DOM A;  2H1E A;  4GZY C;  3TP8 A;  4BWG B;  3U9S A;  1JR0 D;  1MI2 A;  3ND9 A;  1BR9 A;  2KCN A;  3PV0 A;  2F0U A;  4JK1 C;  1PLF A;  3DWP A;  3NQT A;  4P2C B;  2K5W A;  2E2D C;  4ZRZ A;  1TWF B;  1U4M A;  1BCP D;  3SE0 A;  2OEO A;  3PUV A;  3QIA A;  4DF7 A;  1SNQ A;  4KY5 A;  3K6O A;  4F8M A;  5KND A;  5EPJ A;  4BS9 A;  4ABN A;  4V0B A;  2I46 A;  3PUZ A;  3MVV A;  1SFO B;  2QIL A;  5FO9 B;  2NN6 G;  1UAP A;  1MGS A;  2PCF B;  5IGF A;  3TN2 A;  1TY2 A;  5E1F A;  1HCZ A;  1EL0 A;  4KY7 A;  4XYQ A;  3HOV B;  1AZQ A;  4DAY A;  4RWS C;  1VMC A;  3VR4 A;  1JWM D;  1I4X A;  2PZW A;  1IKL A;  5C5M A;  3VR5 A;  3D4D A;  1QWY A;  4IUU A;  3JAM L;  1FNU A;  2M9V A;  2WKC A;  1JOK A;  1Q3L A;  2F0J A;  2HUG A;  4HMJ A;  4C3H B;  1Y8N B;  1H9M A;  1J8I A;  4UAI A;  1SYE A;  1ZEQ X;  1Z6H A;  3F2U A;  1Y8O B;  5I4D A;  3S1N B;  1O78 A;  2RVL A;  2NVY B;  4XYO A;  3NBI A;  1RHP A;  1HPC A;  1RD9 D;  4Z9C B;  1TWC B;  4KKT A;  3QO2 A;  5LHY 1;  2KEC A;  1I6H B;  3KBG A;  3FPP A;  2A6H D;  1KLU D;  3OMG A;  2BDO A;  3TP5 A;  3MHB A;  3KLS A;  3GTJ B;  2MUY A;  2QKI C;  1HUN A;  3PMF A;  1BF4 A;  3MXP A;  4BY7 B;  3GTQ B;  4FVM A;  5EKL A;  1CA5 A;  3HOZ B;  2EY1 A;  2O2L D;  5C4Z A;  3LX0 A;  1STE A;  4ULL A;  1KDC A;  3D3R A;  1EFI D;  5J1Z A;  3S15 B;  4EQP A;  5IOC A;  2KA7 A;  1JCK B;  4BBR B;  4CKC A;  2L55 A;  2F0P A;  5T1G A;  1VCI A;  2JEB I;  2R7Z B;  2XRS D;  1I4Q A;  2XRQ D;  1W6K A;  3OPO A;  2HCI A;  3R2T A;  5FKA C;  4F88 A;  4KMU C;  2PPB C;  3ERQ A;  1R4P B;  3AB9 A;  1ENF A;  4XQJ A;  2ZT9 C;  4ME5 A;  3VYR A;  3A56 A;  1KAB A;  1EY7 A;  1RTN A;  4KD3 A;  4E6I A;  4OIK A;  2EYO A;  2ID0 A;  2H4O A;  1EZ6 A;  4CKB A;  1O7L A;  2RDF A;  2E75 C;  2WP8 J;  4XXE A;  2J7Z A;  4IFD H;  5C44 B;  2F1M A;  3S16 B;  4B08 A;  3S2D B;  2K7V A;  5EQ0 A;  1V8Q A;  1WTV A;  2JA7 B;  3A8I E;  1F9Q A;  5C0X H;  3A54 A;  3T13 A;  1XTC D;  2L0C A;  1BCP C;  2R93 B;  3GO5 A;  2EJM A;  2B8G A;  4TQU S;  5ELE A;  4LJZ C;  3T51 B;  1TVX A;  2G9H D;  3K57 A;  2NVQ B;  1EYA A;  1LTA D;  1SNC A;  4KJN A;  5KRU A;  2PZU A;  1CM9 A;  1JWU D;  5JEA H;  2Q8R E;  4G4K A;  5I6Y A;  4I65 A;  3K7A B;  3K59 A;  1CK1 A;  2DY8 A;  3C1F A;  2CVR A;  3GTL B;  5JVG 3;  4WFN 3;  1EEI D;  3H3V C;  2EZV A;  1DOL A;  5KYI A;  4LAA A;  1DJR D;  2MJ8 A;  1NCV A;  3V96 A;  4KK7 A;  5CC4 A;  5DAU A;  4QCL A;  1NR2 A;  4S3S A;  1LT3 D;  3QG1 A;  1YNN D;  5EPK A;  1V1P A;  2R92 B;  2B2U C;  2WAQ B;  4C3J G;  1H9J A;  2Z4I A;  1G2S A;  3M7N A;  1TII D;  1U9R A;  3S9W A;  3ND8 A;  1KTK A;  1TS5 A;  3C1E A;  4A3M B;  2SDF A;  1CTM A;  2EYJ A;  4J8Q A;  2F0W A;  3QOL A;  1A15 A;  2B63 B;  2Y0S B;  5CV6 A;  1CI3 M;  5KEE A;  1SJH D;  1QNU A;  3OWE B;  2LMC B;  1KNE A;  1ZYR C;  2ENB A;  1HTL D;  2AUK A;  3LNN A;  3EVQ A;  1DOK A;  4NW2 A;  2XNA C;  2IX3 A;  1H9S A;  3RD4 A;  3G6J B;  4DNR B;  2ZXP A;  4WOR A;  3OHX C;  1E2Z A;  1LAB A;  1JQY D;  3R93 A;  4PMC A;  3GP7 A;  2NVT B;  3W2D A;  4IFD J;  2VB2 X;  1EU4 A;  1SYF A;  5ELF A;  4LMQ D;  4A3G B;  3HOX B;  3HOY B;  3TP6 A;  3C2P A;  1TS4 A;  2CW0 C;  5JPN C;  4PQX A;  5D3I B;  2F0M A;  3N6R A;  4KV6 A;  5I9O A;  1EY8 A;  2MP1 A;  1T5E A;  1Q8I A;  1LT4 D;  4B9W A;  1ENC A;  1QCB D;  2F3W A;  3I70 A;  3QOJ A;  4FF2 A;  3IAY A;  1TKW B;  1TU2 B;  2XWB B;  5FLX L;  3TBI B;  5EGT A;  1IHZ A;  5CBE E;  3T56 B;  1E2V A;  2XWJ B;  1U4P A;  1M4V A;  1D1K A;  2V4D A;  5CV7 A;  4QUF A;  1WTO A;  1GUT A;  2NVX B;  3IL8 A;  5K36 G;  2RA4 A;  4K8J A;  1LTS D;  2F0K A;  3PUW A;  4HCE A;  4NMZ A;  1G8Z D;  1SND A;  3I73 A;  4H0L C;  4RGO S;  5M5W B;  4RGM A;  4DU9 A;  3MWY W;  4O42 A;  1KDA A;  2KJX A;  2SOB A;  5M3M B;  5C6A A;  1PRT D;  2HDL A;  1LT6 D;  4DK0 A;  2B2V A;  3FKI B;  3GTG B;  1HFN A;  2RSN A;  3I3C A;  4RKL A;  2PW5 A;  3VYT A;  4M1U B;  3CU7 A;  3BDL A;  5FO7 B;  3LWU A;  5A2Q L;  4N9T A;  2JA6 B;  1I50 B;  1WD0 A;  4KHZ A;  2FMM A;  1V43 A;  4JBW A;  3ITP A;  2O5J C;  3D4R A;  1DD2 A;  4G7O C;  3MA2 B;  4DXF A;  2QEJ C;  1ET6 A;  2RBM A;  2M2L A;  1BBX C;  1OXX K;  2DNE A;  2EE1 A;  1HTP A;  3V2T A;  4DAV A;  2PQE A;  3P7J A;  4K6D A;  4H7B A;  1CHP D;  1HUM A;  3D8G A;  2K6A A;  5A2Q E;  1Z7T A;  2IW3 A;  1STN A;  1UUP A;  1EOT A;  1SBB B;  3DEO A;  2XIW A;  4I7Z C;  3FEW X;  5IGG A;  4KN7 C;  4KHV A;  2K5D A;  3PUY A;  2PYK A;  4FF3 A;  2TMP A;  5C0X I;  1PRT B;  3NBH A;  3I4M B;  3VR2 A;  1F9P A;  3NWT A;  3HRZ C;  2E2I B;  1DZ1 A;  4HCS A;  3KK7 A;  2EYM A;  1ROD A;  2KED A;  2N88 A;  1SMY D;  3NK9 A;  1IW7 D;  1RF2 D;  3GQB A;  2VUM B;  1MD2 D;  3SDZ A;  4HMI A;  1MSH A;  5IGB A;  1CT1 D;  3FVQ A;  3AU7 A;  1PFM A;  1O7Z A;  5D3D A;  1FYC A;  4L8J A;  1H9S B;  4TKO B;  1EIG A;  4C3H G;  4G7H C;  3HKZ B;  3KLR A;  1OXU A;  1B50 A;  1X32 A;  1RJT A;  5I2X A;  5LL6 S;  1PMR A;  1GUG A;  4ZKB B;  4XT1 B;  4PMB A;  4OGQ C;  1EY6 A;  1S5C D;  2F0S A;  4BBS B;  4IAL A;  4G57 A;  2A6E D;  1KAA A;  2FIN B;  1HQR D;  1A6X A;  1B53 A;  5K5P A;  3MZ5 A;  2WII B;  1JIC A;  2NUC A;  3IFD A;  3S14 B;  3U9O A;  1TS2 A;  4XQN A;  3R3O A;  3RLF A;  2Z4H A;  4HN7 A;  2K5Q A;  5KNB A;  5IIF A;  2KUM A;  5M3F B;  2DN8 A;  2LY7 A;  4MN3 A;  3NTK A;  3J80 L;  3J7Y W;  1BCP F;  4IUR A;  3PO2 B;  2F0I A;  3CHB D;  3ONA B;  1ONL A;  3TZD A;  1TT2 A;  3PO3 B;  4IZ8 A;  5I2Y A;  2NB0 A;  4MHE A;  2TSS A;  3MTS A;  2RKS A;  1PTO H;  2SEB D;  1CHQ D;  3M85 A;  4FP5 D;  4A3B B;  5COY A;  2ZXR A;  1PXU A;  2D5D A;  2EYH A;  1I4G A;  5HUR A;  1BDO A;  3OWF A;  1GOZ A;  2IPK D;  4IUQ A;  3J7A F;  4FXG C;  4X3T A;  4K6L A;  5M5Y B;  3T16 A;  1V1P B;  2EYF A;  5E3F A;  1LTG D;  4EVO A;  1ILP A;  4C3I B;  2A73 B;  1OXT A;  5TSS A;  2B39 A;  1STH A;  1XYI A;  1C48 A;  1HXY D;  3GV3 A;  3MFY A;  1EQT A;  3BG3 A;  5DEH A;  5EBD A;  1BQQ T;  2JYO A;  2IT1 A;  3J80 E;  1TWG B;  2F0O A;  2QF7 A;  3CKI B;  4A3J B;  1G2T A;  4HSV A;  4K14 A;  4OHJ A;  2EPB A;  3C3L A;  1KLG D;  3QJY A;  4ZLT F;  1STY A;  2RDH A;  4XDX A;  3R2I A;  2EOT A;  1JOO A;  1HFG A;  1EU3 A;  1GUN A;  3S17 B;  4KJO A;  1EYC A;  2RSO A;  1IW7 C;  1Q1B A;  2R61 A;  4KKU A;  3VA7 A;  1FR3 A;  4RFB A;  3D6W A;  4F7X A;  2A74 C;  3MFG A;  4CJ0 B;  2R6G A;  2MGS A;  2K03 A;  4F87 A;  2D9U A;  1D1I A;  3NE5 B;  1E0B A;  4R8I A;  1EY5 A;  2K05 A;  2FMC A;  3VYS A;  3HEJ A;  1SXT A;  3Q24 A;  1VF5 C;  1LTI D;  2HDM A;  2EY6 A;  1BUV T;  4C1N I;  1C4Q A;  2NN6 I;  1Y69 U;  4K5X A;  3SK5 A;  4Q0F A;  1I4R A;  2ICI A;  5CV4 A;  3EQL C;  4KI0 A;  4R8N A;  5C4X B;  3I90 A;  2B2T A;  2J4X A;  3H94 A;  1D6E C;  3MXU A;  3VA5 A;  1R9T B;  3D6C A;  2L9H A;  2L4N A;  1V1O A;  2JP1 A;  3SHL A;  5JEA J;  2NN6 H;  4BA1 I;  3AMU A;  4CHT B;  1KNA A;  1JOQ A;  5ELD A;  5G3L F;  3OOC A;  5KIX A;  2EJG C;  3PIP 3;  2F0G A;  1UNS A;  2NTT A;  4Q5V A;  4OO1 G;  5FO8 B;  1EY4 A;  2XN9 C;  4XTC S;  1GHK A;  1LTB D;  4TRD A;  3IFT A;  1G29 1;  3X3N A;  2A69 D;  3WOF A;  4X3S A;  4ZKC B;  1F77 A;  1E2W A;  3RMH A;  5ELC A;  1PZJ D;  3NHH A;  4H13 C;  3PUX A;  1SE3 A;  1EZ8 A;  5IT9 L;  1F2Y A;  3L3O C;  2K32 A;  3MC0 B;  3K5M A;  3H09 A;  2BA0 A;  3SK8 A;  1K83 B;  3Q6S A;  1FGB D;  4KTA A;  2IX1 A;  4KN4 C;  5JOB A;  1XWE A;  3EA6 A;  5JAV A;  3N52 A;  1PDQ A;  3OSO A;  2L12 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...