2DNEA

Solution structure of rsgi ruh-058, a lipoyl domain of human 2-oxoacid dehydrogenase
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGQKVPLPSLSPTMQAGTIARWEKKEGDKINEGDLIAEVETDKATVGFESLEECYMAKILVAEGTRDVPIGAIICITVGKPEDIEAFKNYTLDSSAASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrolipoyllysine-residue acetyltransferase component of p
publication title Solution Structure of RSGI RUH-058, a lipoyl domain of human 2-oxoacid dehydrogenase
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 11
structure length 108
sequence length 108
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dneA00
2BA0A 2A68C 3OOCA 1Z6HA 1Y8OB 1TU2B 2PNRC 3EQLC 1OXUA 1Q90A 2A68D 3GD7A 2IT1A 3I72A 1T5EA 2KA7A 3M85A 1B9MA 1IW7C 4KN4C 1Y8NB 3VR2A 2DNEA 2KCCA 1V43A 4RCNA 3D31A 1IW7D 3W3AA 2NN6H 2K32A 2D5DA 3ND8A 4OO1G 4TQUS 1I6VC 1LABA 2R6GA 1G291 2DN8A 2EJGC 2JXMB 3NE5B 1Q1BA 2K33A 1SMYC 4KI0A 1VF7A 1YNNC 3OPOA 4IFDG 1IYVA 4L8JA 2F1MA 1HQMC 3FPPA 2Q8IB 5BN3A 2A69C 1HPCA 3SE0A 4HR7B 1ZKOA 3DXJC 2A69D 1V8QA 3A7AB 3CRLC 5KNCA 2E76C 4I7ZC 1Y8PB 2A6HD 3D4RA 4JBWA 2E74C 1B9NA 4G7OC 4H0LC 1GHJA 2BA1A 3KLRA 4LK1C 2O5IC 4BA2I 3PUVA 3MXUA 3SDZA 2AUKA 3WDNA 2EDGA 1TKWB 1OXTA 1E2VA 1FYCA 3LWUA 4TKOB 3VR5A 3VA7A 5C0XH 5JEAG 3FMCA 1DXMA 2BE5D 3PUZA 2K7VA 1K8OA 2V4DA 3IKJA 4KN7C 2L5TA 2NN6G 4DK0A 1VDZA 3OW7A 3RLFA 2CW0C 1Y69U 3LNNA 4DNRB 3T56B 3ND9A 3A8JE 3VR4A 3QG1A 4G7ZC 4KKTA 2E75C 3U9SA 1YNJC 4KHZA 1CFMA 1O7LA 1CTMA 2A6HC 1DCZA 3GQBA 3HGBA 4JK1C 4KKSA 5K36G 3A8IE 4KMUC 5KNDA 5KNBA 3PUWA 4OO1H 3VR3A 2JEAI 2B8FA 4XTCS 1ZYRC 4H44C 3IFTA 2BE5C 1A6XA 2A6ED 1ONLA 4OGQC 5C0XG 2AUJD 1H9RA 3TZUA 1OXVA 1GUSA 2QF7A 4H13C 1GUNA 3AB9A 3M4YA 4IQZA 1GJXA 3L7ZC 3T53B 2D2CC 1QJOA 2EJFC 2NN6I 3N6RA 1K8MA 1GUOA 3BDOA 2PCFB 1H9SB 2JEBI 1VF5C 3I4LA 1LACA 1GUGA 4BA1I 1DD2A 2AWOA 2B8GA 4KKUA 3PUYA 3BG3A 2D62A 4DNTB 2JE6I 1Q1EA 5JEAH 3A7LA 3PUXA 2DNCA 4PV1C 5BN4A 1O78A 1EWHA 2LMCB 1PMRA 1H9SA 1IYUA 3H94A 3P20A 3QJYA 1Q12A 2A6EC 1H9MA 2EJMA 2ZT9C 5BN5A 4G7HC 2BDOA 1FR3A 3MFYA 1GHKA 3VR6A 1VCIA 2YYZA 4DK1A 4XIGS 1HTPA 4IFDH 3I73A 1GUTA 1BDOA 1OXSC 3A8KE 5A35A 1Z7TA 3PV0A 2O5JC 4GZYC 3T51B 1OXXK 1H9KA 1H9JA 3QIAA 1HCZA 3M7NA 2PPBC 1E2WA 1E2ZA 3CRKC 5K36H 2EVBA 1CI3M 4LJZC
chains in the Genus database with same CATH superfamily
4A3JH 1ENFA 1NBWA 4BBSB 2ZTCA 3HOUG 1LLRD 2NN6H 1WTHA 5T1IA 2QEXA 1MJCA 3KDFA 1CKOA 4EQOA 1TWFB 3I70A 4DR6L 4NXNQ 1SFOB 1QZGA 2JP1A 3SR1A 3ONAB 1I50B 3SE0A 1STEA 4GOPC 1LT3D 2A6HD 4YWMA 1QG7A 4GKKL 3AYHB 1T9HA 3MXUA 2A73B 4N9TA 2AUKA 2E8GA 1IBKL 1X3EA 4DR2L 3GTQB 2XWJB 2RF4A 1AP0A 1I4GA 2AMCB 2Z6KC 1NCVA 5IGFA 5NUCA 3RNUA 2NVQH 4L5QA 3S1RB 3S2DH 1IBLQ 3KF8B 3Q23A 2K52A 4R4QA 2E75C 4DN4M 1YNJC 1D5MC 4EVOA 1HR0W 5C3EH 1LTRD 3E3XA 3HOUH 1XNRL 5KNBA 3U58A 1YI2A 4P72A 1ML0D 3DWPA 1TWAH 1KLGD 3O13A 3CCQA 1K83B 2BE5C 1UNSA 3J81i 1ZYRD 1BCPC 2A6ED 1D1KA 5C5MA 5JPNC 3V96A 1L0WA 1OXVA 1AFPA 1Y1VB 4DV6Q 1HR0L 2RSNA 3H3VH 4DV7L 2B2YC 1IHZA 2Y0SE 1GKHA 4PNYA 3T53B 2EY5A 4JI2Q 4J8QA 3MHBA 3H91A 4IN3A 4KTAA 4MTNA 1IL2A 4YCWA 3AQQA 1YHBA 1XNQQ 1PLFA 4LF7L 4JI7Q 2K5HA 3DEPA 3S1MB 5CV4A 2V1CC 3DEOA 1B44D 2HDLA 1HFNA 3VR6A 2XWBB 5CV8A 1GUTA 2RCNA 1WVLA 2WAQE 1S40A 3AFPA 2DUDA 1OXXK 3FDTA 4DR4L 2Q2HA 4LFAQ 1E2WA 3OMCA 2GVAA 2MHVA 3CCRA 2YU9H 1NMFA 3FKIB 1RIPA 3BVGA 1OTCA 1C4QA 1XPOA 1E7ZA 2SEBD 1PYWD 1Y8OB 4ME3A 3K5MA 1XPRA 2XIWA 1MIUA 2RDHA 1PRTB 1A3VA 2XRQD 5A2QE 3S2HB 1HQRD 2D5DA 2JJQA 4DA2A 1B4OA 1KLUD 4KK7A 3JAME 3P75A 5JJKA 4KY6A 1NNXA 1TWGH 3FPPA 1SNCA 1HPCA 3NP8A 3OWEB 4IZ8A 4A3CG 1PZJD 1TS5A 5C5LA 2IPKD 4FF1A 4HMJA 4JBWA 2F0SA 3B6YA 4WRDA 4JYAQ 2D0OA 1J5EQ 1EQVA 1E1OA 4PMCA 3K8AA 3M4PA 4RG1A 1NTGA 4MIUA 1GM5A 3U4ZA 1TXYA 5D65A 2EYPA 5FJ8G 3PF5A 1Q82C 3Q22A 3CU7A 2KEEA 3X3NA 5J22A 5JVH3 1U5KA 3L0OA 1Q86C 1XJVA 4DV5L 1BUVT 1MHWC 1N9WA 4DAVA 5IWAQ 1TS3A 3DWQA 1PH5A 1F9SA 2F0FA 4IUQA 1TWCB 2ICEC 1EY9A 4PG3A 4X3KA 4DAMA 1O7ZA 2K50A 5GAHC 1H9RA 2FHTA 1S3OA 2R61A 3ZYYX 1EEFD 1EY4A 2R7FA 4IQZA 3RD4A 4A3CH 1R9TH 3PIOA 4C3JB 3EROA 4B9WA 1D8LA 3CXCA 1CSQA 4C2MH 4YIJA 2Y0SG 2JA8G 2DNCA 5FJ8H 2IY5B 1A2UA 2OQ0A 2BDOA 2E2DC 2X69A 3FP9A 2PMZB 1EWCA 1MGSA 3I3CA 2SNSA 4YCVA 4OWTB 4CDDC 2LY7A 5M5XB 1HH2P 1HUNA 3T1HL 3HFZB 5BR8Q 4LJZC 5E7NA 2F0LA 3CCSA 2VS1A 1SYGA 3GD7A 1G6ZA 4RA8A 3TMEA 2UXDQ 1T5EA 3HS0C 4RGNA 2FMMA 1BKBA 3D31A 4OWWB 4CKEA 5I6WA 5JJLA 4OHJA 3GTLB 2K28A 4EQPA 3OTOQ 2UUCQ 5I6YA 2KENA 5CV7A 1AE2A 3FHWA 1A63A 2Z9HA 5IP7G 1SXTA 1IZ6A 3LGJA 4UAIA 4BS9A 2JA8H 3D4RA 5FLMG 3HKSA 1TKWB 3E0EA 2UXCL 1EZ6A 2JA7G 5ELDA 3TP5A 5C4XG 1TQOA 2VQEQ 3MXPA 1VDZA 5EBDA 4RKBA 1WJJA 4AH6A 3RN2A 3M4OH 4UP7A 4AYBE 2KVMA 4KD4A 4HJAA 3A0JA 3CPWA 3TQYA 3RR5A 3NWSA 1ZYRC 1EIGA 4H44C 2A74C 4F88A 1HRJA 4APVA 3RZOH 1IYJB 1HNWQ 4A3GG 2XTIA 4EQ5A 3GTPB 3TREA 4LF6Q 4X3UA 1JOKA 1RJTA 4HSPA 4Y7NH 5D3IB 3NK9A 2L1BA 2WACA 5IP7H 2E5LL 1GD7A 4X6AH 1BNZA 5FLMH 1CSPA 5KIXA 3RZDH 2CHBD 4A3FB 3H15A 1SLJA 1A15A 4DNTB 1J6QA 2JA7H 3CW2C 5C4XH 4ZUJA 1MD2D 2KJXA 5IP9G 4R4IA 3E9HA 3F8TA 1UE6A 1X3PA 5JOBA 5DLQE 5HGQA 4O1NA 4OWXB 3W1BA 4DK1A 3PQIA 4IFDH 4K5XA 2FJ2A 1C7YA 3R3OA 5C3WA 4ZRZA 4F7XA 1SMYD 3HKZB 3KFUA 4RHRA 2G9HD 1E1TA 1WCMG 5CR3A 2YTVA 4G4KA 3I7FA 2IT1A 3T16A 1CA5A 4A3GH 1II3A 5C44G 2JA6G 2PI2A 3OSOA 3N52A 1CKMA 1I4QA 2GVBA 1EY0A 4YWKA 4X64Q 2K5QA 3HOVB 4G57A 4OO1G 1QB5D 1M90C 1PFNA 3KF6B 4U68A 3J81j 1QOHA 3VYSA 1Y14B 4LFBL 2F4VL 4C3HH 5F2DA 2YV5A 2HT1A 2R93B 3Q6SA 2VB2X 4X66L 3ULPA 4RGTA 1DOMA 5HY6A 3SK4A 4HTHA 2E76C 2HHHQ 1E0BA 5IP9H 1ICFB 2O5IC 3PUVA 3IL8A 1YZ6A 3GTKH 1JC7A 2I46A 1EYDA 2AQ1B 2CQOA 3VA7A 5C0XH 3JAMc 1XPUA 3FMCA 3VDYA 1ESRA 1MSGA 4N8X1 1QVFA 2K04A 1XMOQ 5EGTA 3SK5A 1Y1WG 1AH9A 1BOSA 1PZKD 4QIWB 1WCMH 4J15A 5ELBA 3QG1A 3BVZA 2F3IA 4LW1A 5LHY1 4YY3Q 4K0KQ 3PIPA 2JA6H 2AQ2B 3KF8A 5AJ3Q 1R4QB 4OO1H 4XTCS 2F3VA 2Q2UA 1PH9A 4A4IA 1WYDA 1SBBB 1EYAA 3UDXA 4AYBG 4WJ3M 1SNDA 1SE2A 4NKLA 3MEHA 2QDLA 3G6EA 1JOQA 5M3FG 4A93G 3BDCA 5I9PA 1U4LA 2B39A 1PTOB 1SJHD 3GDEA 4XDXA 3T1YQ 2F0NA 3OW2A 1PH1A 4R1JA 4A3DB 3J7AV 4PV1C 5C4JH 3TBIB 1IYUA 1N33Q 4IUVA 1WTQA 2MGSA 2LKVA 1I4XA 2IJ0A 2KCMA 3VYTA 1J9OA 4DAYB 1VCIA 2QA4A 4QF4A 4HIOA 1PH4A 1YITA 5A35A 4B3TL 4GZYC 4FXKC 3KJPA 2E2HH 3SGIA 1PV4A 2PPBC 1LYLA 3FVQA 4LWCA 2GN5A 4XXEA 4B3RQ 2PNRC 2I5LX 4QL5A 4R9WA 2A68D 3M3YH 1L0YB 1U4PA 1N32Q 2ICIA 1XX8A 1JJ2A 1B9MA 3RLOA 4X3TA 1P16A 3ULLA 5ISRA 1DGSA 4V0BA 4DR1Q 3D6WA 4MHEA 5FOBB 5M5YB 3C46A 4BY7G 5M3FH 4A93H 4FO2A 4BBRB 3OPOA 4GNXC 1EY6A 1E22A 2N78A 3I4MB 3BJUA 2ES2A 1K28A 1B9NA 2F0MA 2EE1A 3PIP3 3BZCA 3CF5A 2RSOA 5EBCA 2G9DA 1BQQT 2LXJA 3PO2B 3J7AF 5M3MB 3QWNA 4A3BG 2WINB 1SSOA 3Q24A 4WJWA 1CZWA 4GLXA 4XYOA 4OX9Q 1PA6A 3GP7A 4JI0L 2M2LA 3BYYB 1WTPA 1UE7A 3GV3A 2Q8TA 3WOEA 1W6JA 2Q8RE 3GQBA 4JK1C 1B7YB 4ABNA 3HOWB 5ELFA 3TP7A 4CJ2C 1YVCA 4IUNA 2SNMA 3M4QA 3PUWA 1VQMA 3VR3A 4A3MG 1VQJA 2B8FA 1NJIC 4N9PA 2YTYA 2PNHA 1HTLD 3I91A 4BY7H 1A6XA 2KCNA 4ODGA 1HZBA 5C4ZA 4X65L 4K6DA 2I07B 4WJ4A 2QF7A 5M5WB 1GUNA 1TIID 3OIQA 3M4YA 2UU9L 3JAML 2IL8A 1JT8A 4L63B 1LTSD 3MXGA 1N34L 1PRTC 1EOVA 4JW0A 1X65A 5J1ZA 4BWGB 1QUQB 3S14B 2FMCA 3PUYA 1B70B 1SEBD 5ELOA 4F87A 1VQDA 4A3BH 2NVXH 1EU4A 2EJMA 3HOZG 1LUZA 2XVSA 1UE5A 1SJED 1X3FA 1JWMD 4FNFA 2ZTDA 4KHPQ 4LAAA 1K8GA 4LUZA 3H09A 4R4TA 4ZK9B 1K3RA 4O42A 3M7NA 4LFCQ 5E3FA 4RCOA 4CKCA 1FD7D 4A3JB 4DV3Q 2BDNA 4A3MH 3K7AH 3BU2A 3SK6A 1SYCA 2H4OA 2NZHA 3R8BA 4L6TB 3VA5A 2F0TA 4GN5A 2EYFA 2K32A 1V1QA 3A56A 1EWIA 3NE5B 3GTMH 1OO9B 3BZDB 4YCUA 3T13A 2B3GA 3DWAA 3CCLA 1JE4A 2LFNA 1ZKOA 4DR7Q 2Z4HA 4GKJQ 2SOBA 4DUZQ 2E74C 3P1HA 5ELNA 3CC7A 1H95A 1ZEQX 5IY0A 4J1MA 5DAUA 1STYA 1G6PA 3HOZH 2VUMG 1ENAA 1NR2A 2CQAA 3I8ZA 4BBSG 1LO5D 3SEBA 5JEAG 2NVYB 4QCLA 1FGBD 3D8GA 3IKJA 4FDBA 5G3LD 4UY8C 2NVQB 1G91A 1EFWA 5E1FA 3OW7A 1X3QA 4DNRB 1KAAA 4A75A 1JJCB 2KHIA 1PTOD 2CFMA 5C3EB 3KLSA 1DCZA 3HGBA 1S5BD 3A5UA 1M4VA 3GTGB 3EN2A 3S9WA 4C56C 4UP9A 5KNDA 4IPCA 2HCIA 2BH2A 4H02A 1CKNB 2FFKB 2E2IB 1B2TA 2Z4IA 1D2BA 1UEAB 1HNXQ 1JORA 4DR6Q 3HG9A 4OGQC 3F1ZA 2ZJRA 1F2MA 4K6LA 1EFID 3S1QB 3NTIA 4H13C 3K81C 1EUJA 1F9PA 2EJFC 2H5XA 1NY4A 2F0DA 2LSSA 1UAPA 2EXZA 3HEJA 1X55A 2MFIA 5ELCA 4GLAC 1BVSA 4DUYQ 1NR4A 2K03A 4UPAA 4LF4Q 4DGZA 1IBKQ 1G2SA 2N8NA 4BBSH 5JEAH 3AEVA 5CORA 1AW7A 4P2CB 2VB3X 4XT3B 2PYKA 5KYIA 4RMFA 1F9QA 1TWFH 1Z7TA 2A8VA 1VQAA 3K0YA 1SFOH 3UE0A 1SAPA 4U673 4DU9A 1I50H 1XNRQ 4RHSA 2A68C 3K7UC 3VYRA 3CQZH 4K8IA 3C1FA 1Q90A 3G48A 3KK7A 4KY5A 2AKWB 1XNQL 1WD0A 2CVRA 4JI7L 1QZHA 3W3AA 1AEXA 4JV5Q 3HRZC 4QUFA 4DXFA 1QWYA 3I2ZA 4DFAA 3OMGA 1E3PA 3TP8A 4A3IG 1YNND 4QMGA 3KF6A 4IO9A 4LF7Q 4G7OC 1EEID 4H0LC 3FKIG 1QVGA 5GAGC 3SDZA 2EYJA 3VR5A 1TS2A 1K83H 1PVOA 3PO3B 1EYGA 1HNZL 1Y69U 4P73A 1DJRD 1PRTF 2MO0A 4KKTA 4E6IA 3V05A 1JICA 4KD3A 5EAYA 1D5ZC 4PMWA 3MVVA 4J6HA 1AZQA 1I4PA 5J39A 4O0AA 1WTXA 4JYAL 3KYHC 3LX0A 3IFTA 3S1MH 1LT6D 2NTSA 1KD1C 1VQGA 5IGDA 4A3IH 3QB3A 5COYA 3JAMi 1MSHA 5CV6A 5I2XA 1IKMA 3SVMA 1JOOA 3N6RA 4HJ5A 2PCFB 1A8VA 1H9SB 3FKIH 1JWSD 5E4XA 3WWVA 3D0FA 5IWAL 3S16B 2XRSD 2E2JH 5I4DA 1HA5A 1LT4D 4L5SA 1XTCD 1TS4A 1L1OB 3EIVA 1UWVA 1M8AA 1HTPA 3H6MA 2ENBA 1YBYA 4ID6A 2I5HA 4S3SA 3CRKC 4DAYA 3QOLA 4RWSC 4A3LG 2VY3A 1W6KA 4NXMQ 5EPLA 3CC4A 2KQ3A 2L12A 1RTNA 1WI5A 4RGOS 4C3JG 4GN4B 3M85A 1XXGA 1STBA 1QVCA 3EA6A 2IHFA 1JE5A 3JC66 3CD6A 2R6GA 2DN8A 4DV1Q 2RDGA 3S15H 1VQNA 2CKZB 4A3KB 1VF7A 4EQNA 4M8AA 1EIFA 3QOJA 1GO3E 1RTOA 1WOCA 2Y0SB 1FJGL 2RQXA 1I6HB 1LTGD 1RD9D 3CRLC 2H1EA 1N36L 2ZTEA 5FKAC 1EZ8A 1VQ8A 2BA1A 3D4DA 5K5PA 2F0KA 1EIHA 2UXDL 2PQAB 2EDGA 1CUKA 4TKOB 4X62Q 2OQKA 5IOCA 3BS1A 3QR8A 1LTLA 4FVMA 4PZ6A 4L5TA 4DK0A 3PCOB 3OTOL 3CCJA 1PFSA 4A3LH 3SXHA 3T1HQ 2MP1A 4B9XA 1PTOC 2WAQB 1B1ZA 4DR3L 2R3ZA 4C3JH 2F0HA 2IHEA 2K5VA 2OXPA 2VL6A 2QEJC 2A6HC 4YHHL 4JI8L 3D3RA 3GTOH 2WFWA 5TSSA 1I4RA 2EY2A 2B63G 2JEAI 1PH8A 3RZOB 1BCPF 4FXDA 4HIDA 4QIWE 3F2DA 2L11A 2WB1B 4BY1B 1CK1A 2UUBL 4QGUA 3NELA 2BOSA 2A5HA 2VQEL 1ZXTA 3OYYA 4HSVA 5M5XH 4CKBA 2BCOA 3RZDB 1K0SA 3K6OA 3PIO3 1TWHB 2OT2A 5IYCG 3J7A5 3I4LA 3MA2B 5T1GA 5IYBG 1KIXA 5D14A 2R7DA 4PZ7A 2UXCQ 5C4XB 4ZKBB 2KHSA 3L3OC 2A6EC 1EQTA 3ER0A 3GTLH 4H7BA 1QUQA 2M9VA 1DOKA 4DV0Q 2K75A 4CDFC 4A3EB 4V190 2G5DA 3QIAA 3OIPA 2N55A 4YWLA 2O2LD 1CI3M 2F0UA 3J80c 1BF4A 1CHQD 3RLNA 4NW2A 4LF9L 2B63H 5LMUQ 1FNUA 4A3GB 4ZCKA 2CH4W 2KCCA 1U4RA 1ESFA 5C4HA 1IW7D 2XGTA 4A3FG 2VQFL 3TRZA 1KNAA 2CWPA 1I94Q 3ERQA 4DV4Q 1J8IA 4HAEA 2E5LQ 2RKSA 2K33A 2ZXOA 5CV9A 1YNNC 2EXDA 1KAWA 4HJ7A 2CW0D 4C3HB 5IYCH 4JC0A 1QE6A 1SE8A 2NZ1D 5IYBH 1AE3A 4K5VA 1S5CD 2KCTA 2I5MX 1D1IA 1GHJA 2X6LA 1N8RC 4ZUIA 3CP0A 4DR5L 2XNAC 1WTWA 4P74A 3BDLA 1DXMA 4IUPA 1XMQQ 2HIXA 4KHVA 3HZXA 5FK9C 4X64L 5HGTA 4IPGA 1WCMB 1KDAA 1T5XD 3DM3A 3W2DA 3RLFA 2L15A 3HOVG 2B2TA 1ICWA 5IT9L 4KHZA 3IAYA 1FGUA 1CTMA 2NTTA 4A3FH 4KMUC 4LUVA 2DY8A 2XSCA 4Q0FA 4DK6C 2JA5G 1G8ZD 2HD3A 2VZAA 1Q46A 5EJWA 2AUJD 2ZJPA 1KC8C 4LFBQ 4JI5Q 3NENA 2K05A 3P7JA 3GO5A 1XMOL 4X66Q 2FXQA 1CKNA 1KNEA 1HZAA 2NN6I 3CCEA 2PW7A 1VQIA 4HCSA 3H0GB 5JAVA 2JEBI 5M9OA 1GUGA 3U50C 4YY3L 4K0KL 4KKUA 2NUCA 5C44H 5C4JB 2R7ZB 2C35B 4UHVA 3WOFA 5AJ3L 4NPSA 5CGKA 4LMQD 1KXLA 3P20A 5CBEE 2Q2TA 1SYBA 1U0LA 1F2YA 3HOVH 4AQYQ 1EU3A 4XIGS 4LF8L 1EQRA 4DAPA 4DV2Q 1QNKA 4C3IB 3CPFA 1I3QB 1PZID 1D7QA 2Z1CA 3ITPA 4C1NI 2B2TC 1KRSA 3CCUA 2JA5H 3CCMA 1V43A 4R8NA 4AYBB 4JI4Q 3TZDA 4POGA 3X3MA 3FRPB 1Y1WH 1N33L 1LABA 2JXMB 5LMNW 2EY6A 1UUPA 2UXBQ 1STGA 2F0QA 4JBJA 4DXGA 1LTID 3MFGA 2F1MA 1HQMC 1YJ9A 1KABA 4OIKA 2HDMA 2M00A 2B2WA 2JYOA 4O2DA 1IBMQ 4B3RL 5LMNL 4BA2I 4CHTB 2R92B 3HOXB 3J80L 2JA9A 3MZ5A 2A1AA 4IURA 4OELB 2K14A 2BE5D 3J81L 3K80C 1VQBA 3PSIA 1JCKB 1STHA 3GTJB 1KHIA 2EPBA 4P75A 4JI3L 2WIIB 4LF5Q 2PI2E 4IALA 5LL6S 3S17H 3U9SA 1SE4A 1E24A 2N49A 4KV6A 4BBRG 3T4AC 1HFGA 3K0XA 1TT2A 1PTOH 1S4ZA 2EYMA 1M1KC 2AWNA 2NVTH 3G4SA 2JQOA 4MTKA 4ZKCB 2K5WA 3I4MG 2L4NA 4BY7B 5J3BA 3E9IA 4IJHA 1BBXC 1GUSA 1SNPA 3PO2G 2VXWA 3AFQA 5GQOA 5M3MG 1SNOA 4OX9L 2NYZD 1VQKA 3DHQA 1QNUA 3KUPA 3NBHB 1AZPA 3ICEA 3I4NB 1LM0A 4JCVE 1EOTA 1W3SA 4BA1I 1B8AA 1L2FA 4MN3A 1SE3A 1FNWA 1Q1EA 4A3BB 3URYA 2B2WC 3HOWG 1VQEA 1H9SA 1PYBA 2PW5A 1H9MA 3U9OA 4JI1L 1GVPA 4MZ9A 2ZM6Q 1CQFA 3DM1A 5M5YH 4BBRH 2F0JA 2F4IA 1L1OA 4IOAA 2K6AA 1MJEA 1VQ4A 3K7AB 2VNUD 3I4MH 1RF2D 1HA6A 3EQLC 1VQ7A 3BVMA 4A76A 1BBWA 1IW7C 3HOYB 2DNEA 2CCZA 1SN8A 2PZWA 1HJPA 4B3ML 4X65Q 2UUAL 3PO2H 5M3MH 3VYUA 4DKAC 5HURA 1SDFA 3DUZA 2F0IA 2UU9Q 4K8JA 5IGGA 1SMYC 1U4MA 4KI0A 5IT9E 3CKIB 3S1NH 1N34Q 4KHPL 1KDBA 4KJNA 2K01A 1STNA 3NSWA 4LFCL 2B2UA 2K5DA 4IUTA 1Y8PB 3HOWH 4A3JG 4LK1C 4B3SQ 4L5RC 3NTHA 3I56A 4IPDA 1X3GA 3EFXD 3R2IA 1E2VA 2F0OA 4OXPA 2NN6G 1SROA 1VQCA 4JI6L 3E0JA 2PQAA 1S5FD 2GA4B 3LNNA 1KDCA 4OEMB 1YIJA 3Q8DA 2BH8A 4IFDJ 4GLVB 2ID0A 3J7ZC 5IODA 1X32A 3MEFA 3S14H 2ZXPA 4DUZL 4KJOA 3TEHB 1V1OA 4ZAIA 1TVXA 1VS0A 1C8CA 1ONLA 3KLWA 3S2DB 3AB9A 2ALYB 1YJWA 4DF7A 3F2CA 4NXNL 1DD2A 3TS2A 4K5WA 3HOUB 1VQPA 2JE6I 5DEHA 5C3EG 1TWAB 2B2UC 1YNXA 2B2YA 3TSSA 2SDFA 5BN5A 3H94A 3NHHA 4IUUA 3CCVA 1GHKA 5FLXL 1ILPA 1VQLA 2YYZA 4FYDA 3K5NA 2Q2IA 1HNXL 3I73A 3AMUA 5C0XJ 1TY2A 3OWFA 4WFN3 1FL0A 3T51B 2K5NA 3KBGA 1YEZA 1K8AC 4OONA 5DNFA 2EVBA 2MQHA 1IBLL 1KQSA 1U9RA 4GKKQ 3CQZB 2VW9A 2BA0A 2D0PA 2VUMH 4DUYL 5CC4A 4LF4L 4DR2Q 1A2TA 3J80E 3J7YW 1RODA 1SR3A 3J81E 2EYHA 2K1BA 2MJ8A 3C3LA 2J7ZA 2NVYH 1I6VC 2L0CA 1F9RA 4LUOA 1IYVA 4L8JA 3NEMA 4FF2A 4DV6L 2YU9B 2OTJA 2Q8IB 1X54A 5BN3A 2KECA 1DONA 2EY1A 1Y1VG 2MPMA 2I0QA 4HR7B 3DXJC 1V9PA 2A69D 4GNXB 1O80A 4IOCA 2K4KA 3A5ZB 4JI2L 1QILA 2F03A 4MNOA 5I2YA 3GTGH 1SNMA 4EX5A 3J80i 3MXNA 1NMGA 1OXTA 3LWUA 2PMZE 5EQ0A 1S72A 3FPUB 2DJGC 2E2IH 3GTQH 3E6ZX 1JJGA 2NB0A 1HR0Q 4JV5L 1KTKA 3R2TA 2L5TA 4DV7Q 4UP8A 3S1QH 1ET9A 3FEWX 3S1RH 2RHQB 1TWGB 3M7GA 4G7ZC 1CFMA 1SMXA 3I90A 4IFDI 1ET6A 4LFAL 1VMCA 3PGZA 4KKSA 5K36G 4QQBX 3GV6A 4HCEA 5C6AA 5JJIA 2A19A 2QDBA 2C5CA 2QKIC 3MC0B 4A3IB 1JR0D 1B50A 2MNAA 1HUMA 4RFBA 2JN4A 2WKDA 4DR4Q 1B3QA 4OIJA 1TY0A 1RDPD 1Y1VH 3PO3G 3I55A 1GUOA 3BDOA 5CBAE 4K2LA 1YHQA 3QO2A 4QJFA 2DGYA 1PFBA 2JK8A 3BG3A 3K59A 2D62A 2PQEA 2E2JB 1X9NA 2OWOA 2WB1E 2P5ZX 3G6JB 1O78A 1SYFA 4FF4A 1PMRA 1J5EL 3RUZA 4TVAB 3A74A 4DPGA 1HNZQ 4K14A 4M1UB 3A55A 1BDOA 1LTBD 1EIYB 4K2KA 5C0XI 1YHAA 1O7YA 1H9KA 1R9TB 1K0RA 1E2ZA 3E5SA 5K36H 4HIMA 1G51A 3C2PA 2TMPA 4QY7A 1CM9A 1WD1A 2KA7A 4C2MB 3VR2A 1MBYA 4WORA 3W1GA 2FINB 1PYSB 1GOZA 3MTSA 4GS3A 1C48A 1DM0B 1STAA 2AQ3B 2EQSA 4R4OA 3PO3H 3S15B 1L0XB 3S2HH 4TQUS 1Q8KA 2QILA 4OO1I 4DV5Q 3M9BA 4IJLA 3NXWA 3G7LA 5C3XA 1PXUA 4CDCC 4CJ1B 1XTDA 3CAMA 5EKLA 1Q81C 1A0IA 4NXML 1SYEA 3S24A 1ILQA 1BBUA 5CV5A 1X6OA 2RBMA 2J0TD 5DM63 2MO1A 3D6CA 2DJFC 5IT9c 4R8IA 2OF1A 1VQ5A 2ZJQA 3HKZE 3PF4A 1K73C 1K9MC 4DV1L 3NUCA 3HP3A 3T56B 5EKKA 3VR4A 1CT1D 5KEEA 4N8FA 4A3KG 3NQTA 1XWEA 3GTOB 2JA8B 3V2TA 1RHPA 2WP8J 5BR8L 3A8IE 1K3BC 4QUCA 1EQQA 1PDQA 2EOTA 2N88A 2IX3A 4GOPB 3S16H 2OCEA 1TWCH 4FP5D 1A3TA 5FLXE 4JG2A 5H1SE 2QW7A 4X62L 4XQNA 5IGBA 3F2UA 3IFDA 2HQEA 5AFWA 2MUYA 1RL2A 2UUCL 1V1PB 1Q7YC 1FJGQ 1QJOA 4R4CA 2RDFA 5KYLA 1QCBD 1N36Q 4CBVA 1MI2A 2IX1A 1VF5C 1VQFA 1LACA 3M4OB 3ERSX 4PZ8A 4XQQA 2TSSA 2WAQG 1KRTA 3IRBA 1JB7A 3NQIA 3NBHA 5KRUA 1LTTD 1EWHA 3QJYA 1C9OA 1Q8IA 2ZT9C 3CMAA 3MFYA 3F2BA 3A54A 1UEBA 2KEDA 5IE8A 3A8KE 4Y7NB 4DR3Q 2O5JC 4KY7A 4A3KH 1BCPB 1IKLA 2WB1G 4BY1G 2KUMA 1HCZA 3OHXC 5KGUA 4YHHQ 4ILWA 4JI8Q 5DM73 2KOLA 5JPMC 3KLSX 2B63B 1I6HH 3MWYW 1EYCA 3KDFB 4PQXA 1LT5D 2L55A 2JA7B 1G2TA 1Y8NB 4JPBW 2XN9C 4BXXG 2UUBQ 4TRDA 1G291 2PO4A 2Z0SA 4QB4A 1HNWL 1LV9A 4DV0L 1D6EC 1YJNA 1I4HA 4IFDG 4LF6L 4HN7A 1F2ZA 5JVG3 4A3EG 1WTVA 2A69C 4PMBA 3UDGA 1V8QA 2DY7A 3TS0A 4I7ZC 3W5OA 3J81c 3KOJA 5FO8B 4DNIA 5LMUL 2IW3A 3WDNA 1F77A 2CWAA 1WTRA 5FO9B 2B2VA 1K8OA 4ULLA 5JEAJ 1I94L 1JB3A 4BY1H 1HXYD 1KL9A 4CDEC 3I4OA 3NPPA 2ASBA 2HQLA 3TN2A 4DV4L 3ND9A 4TSSA 3L2PA 4LF9Q 3MXNB 1Q3LA 1TWHH 1PRTD 2QCPX 4C3HG 1ENCA 3AU7A 3HKZG 4JVZA 4FF3A 1WFQA 3TDQA 1JMCA 4BXXH 2VQFQ 1SYDA 1SNQA 5ELEA 3GTKB 2C9OA 2IWHA 5IYDG 2WKCA 5D3DA 3STBD 5C0XG 2EZVA 4A3EH 1XMQL 3GTPH 1F2LA 4ALPA 3L7ZC 2F0EA 2RVLA 1VQOA 3G71A 3BZKA 1K8MA 1PH2A 1HHVA 1EL0A 5C44B 1SRUA 2B8GA 2JA6B 4DR5Q 1XYIA 2RCFA 1CHPD 2EIFA 2R93G 2LXKA 1X56A 2RA4A 4JOIA 2HHHL 1FVIA 3PUXA 3UI2A 5GROA 4G7HC 1Q12A 3ULJA 1A3UA 2LS01 4FXGC 2F3WA 4NMZA 3CC2A 4CGYB 3PV0A 2F4VQ 4JI5L 1VQHA 1H9JA 2B2VC 1IL8A 1CZGA 3K5OA 5E4WC 3OOCA 1Z6HA 2JA5B 5IYDH 4POFA 1OXUA 3I72A 1I5FA 1EY7A 1BO0A 3H0GG 4NB3A 4I7AA 4RCNA 3UDFA 1Y1WB 3UE1A 2Z8LA 3RMHA 4ZYSA 3BYTB 2R7ZG 2EJGC 5CYUA 4AQYL 3NBIA 2E2HB 1HZ9A 4HIKA 4DV2L 1VQ6A 2HUGA 1LTAD 5CMDA 4C3IG 3A7AB 4AIMA 5KNCA 2R93H 4CJ0B 3M3YB 3KLRA 4P71A 2CH4A 3T1YL 2F0GA 4NDXA 1NE3A 5G3LF 4EGVA 3SK8A 2J4XA 4JI4L 4GNXA 4LF8Q 3PUZA 3UDIA 2KHJA 1NAPA 2N3SA 4IPHA 5IGEA 4A3DG 4KN7C 1FNVA 1R4PB 3KJOA 4JOIC 5M3FB 1ASZA 4A93B 1MKHA 3S17B 1PTOF 1EY5A 3CHBD 4HJ8A 1C0AA 3A8JE 2UXBL 1JQYD 1YNJD 1O7LA 3H0GH 4C1NK 1AN8A 2AHOB 2HCCA 4RKLA 4LNQA 4Y52H 2NVTB 1DYQA 3EJIA 4XYQA 3H3VI 3K58A 1ASYA 5L37A 4DK3C 4ZQ3A 1GXDC 2NBFA 4HJ9A 1IBML 3SHLA 2R7ZH 1N32L 4JBKA 3H3VC 2F0WA 2EYLA 2R92G 3HOXG 1RCVD 1BCPD 3R93A 3TZUA 4B3TQ 1DOLA 1BXTA 3CMEA 4C3IH 4DR1L 1P8LA 2JSOA 1B53A 2D2CC 2HIVA 1Z47A 4LF5L 1I3QH 5GADC 5EKIA 3TP6A 1EY8A 5LMNQ 1BR9A 2F52A 4Z9CB 5FLXc 3A7LA 4Q5VA 5EPKA 4A3DH 1O7IA 2LMCB 1PH3A 4JI3Q 1FR3A 1OXSC 2ZXRA 4NP5A 3MAQA 2D9UA 4RH6A 5JJZA 3K57A 1TU2B 2O4XA 3I4NG 4KN4C 1S5DD 1PHJA 2R92H 2NVXB 1TR5A 3HOXH 3LWEA 4XQJA 3D4WA 3ND8A 2ATWA 4JI0Q 3GTJH 1Q1BA 3S1NB 2ZM6L 3K5LA 3RN5A 2PZTA 4A3MB 2NWGA 3PMFA 4GN3B 4JBMA 2B29A 2L9HA 2EYOA 3C1EA 4UDUC 4JI1Q 5I9OA 1FYCA 2F0VA 5A2QL 3HOYG 2K7VA 1Z9FA 1GUWA 1VMPA 2V4DA 5LL6X 3GTMB 2NZOA 1PH6A 2CW0C 3KBXA 4RGMA 4B08A 1W2BA 1PFMA 2PZUA 1DZ1A 1IXRA 1JWUD 3NWTA 4HEDA 1WTOA 1PH7A 2OEOA 3I4NH 3ZJYC 1S5ED 3NTKA 4X3SA 2X6GA 4DV3L 4B3MQ 2UUAQ 1NSNS 3HOZB 4HMIA 4B3SL 3STBC 1VQ9A 4XT1B 3DMUA 2IX0A 1NUCA 4GOPA 2KBNA 4ZLTF 4KLKA 2QGQA 4ME5A 5M5WH 1GJXA 2F0PA 2Z6BA 4I65A 4OL7A 1UE1A 5EPJA 4F8MA 2AWOA 3U4VA 1V1PA 1RKNA 1HZCA 1A62A 3L9AX 2Z6KA 4DR7L 4GKJL 3DLLA 1D5XC 2WV6D 5BN4A 3HOYH 1L1OC 2YTXA 3EVQA 5GAEC 2OTLA 4JI6Q 2RHSB 5IGCA 5FO7B 3EBEA 4RAUC 1B3AA 5IIFA 1CA6A 3Q0AA 1CQVA 2VUMB
chains in the Genus database with same CATH topology
1ENFA 4BBSB 1LLRD 2NN6H 5T1IA 4EQOA 1TWFB 3I70A 1SFOB 2JP1A 3SR1A 3ONAB 1I50B 3SE0A 1STEA 1LT3D 2A6HD 1QG7A 3MXUA 2A73B 4N9TA 2AUKA 3GTQB 2XWJB 1AP0A 1I4GA 1NCVA 5IGFA 5NUCA 3S1RB 3Q23A 2E75C 4DN4M 1YNJC 1D5MC 4EVOA 1LTRD 5KNBA 1ML0D 3DWPA 1KLGD 3O13A 1K83B 2BE5C 1UNSA 1ZYRD 1BCPC 2A6ED 1D1KA 5C5MA 5JPNC 3V96A 1OXVA 1AFPA 1Y1VB 2RSNA 2B2YC 1IHZA 3T53B 4PNYA 2EY5A 4J8QA 3MHBA 3H91A 4IN3A 4KTAA 1PLFA 3DEPA 3S1MB 5CV4A 3DEOA 1B44D 2HDLA 1HFNA 3VR6A 2XWBB 5CV8A 1GUTA 1WVLA 1OXXK 3FDTA 1E2WA 3OMCA 2MHVA 3FKIB 3BVGA 1C4QA 2SEBD 1PYWD 1Y8OB 3K5MA 2XIWA 2RDHA 1PRTB 1A3VA 2XRQD 5A2QE 3S2HB 1HQRD 2D5DA 4DA2A 1B4OA 1KLUD 4KK7A 3JAME 3P75A 4KY6A 3FPPA 1SNCA 1HPCA 3NP8A 3OWEB 4IZ8A 1PZJD 1TS5A 5C5LA 2IPKD 4FF1A 4HMJA 4JBWA 2F0SA 4WRDA 1EQVA 4PMCA 4MIUA 5D65A 2EYPA 3Q22A 3CU7A 2KEEA 3X3NA 5J22A 5JVH3 1BUVT 4DAVA 1TS3A 3DWQA 1F9SA 2F0FA 4IUQA 1TWCB 2ICEC 1EY9A 4X3KA 1O7ZA 1H9RA 2FHTA 2R61A 3ZYYX 1EEFD 1EY4A 4IQZA 3RD4A 4C3JB 3EROA 4B9WA 4YIJA 2DNCA 1A2UA 2BDOA 2E2DC 2X69A 2PMZB 1EWCA 1MGSA 3I3CA 2SNSA 2LY7A 5M5XB 1HUNA 4LJZC 2F0LA 1SYGA 3GD7A 1G6ZA 4RA8A 3TMEA 1T5EA 3HS0C 4RGNA 2FMMA 3D31A 4CKEA 5I6WA 4OHJA 3GTLB 2K28A 4EQPA 5I6YA 5CV7A 1SXTA 4UAIA 4BS9A 3D4RA 1TKWB 1EZ6A 5ELDA 3TP5A 1TQOA 3MXPA 1VDZA 5EBDA 4RKBA 2KVMA 4KD4A 3NWSA 1ZYRC 1EIGA 4H44C 2A74C 4F88A 1HRJA 3GTPB 4X3UA 1JOKA 1RJTA 4HSPA 5D3IB 3NK9A 2L1BA 2WACA 1BNZA 5KIXA 2CHBD 4A3FB 1A15A 4DNTB 4ZUJA 1MD2D 2KJXA 5JOBA 1X3PA 4O1NA 4DK1A 4IFDH 4K5XA 2FJ2A 3R3OA 5C3WA 4ZRZA 4F7XA 1SMYD 3HKZB 4RHRA 2G9HD 5CR3A 4G4KA 2IT1A 3T16A 1CA5A 1II3A 3N52A 3OSOA 1I4QA 1EY0A 2K5QA 3HOVB 4G57A 4OO1G 1QB5D 1PFNA 4U68A 1QOHA 3VYSA 5F2DA 2R93B 2VB2X 3Q6SA 4RGTA 1DOMA 3SK4A 4HTHA 2E76C 1E0BA 2O5IC 3PUVA 3IL8A 1JC7A 2I46A 1EYDA 2AQ1B 3VA7A 5C0XH 3FMCA 1ESRA 1MSGA 2K04A 5EGTA 3SK5A 1BOSA 1PZKD 4QIWB 5ELBA 3QG1A 3BVZA 5LHY1 2AQ2B 3KF8A 1R4QB 4OO1H 4XTCS 2F3VA 1SBBB 1EYAA 1SNDA 1SE2A 4NKLA 3MEHA 1JOQA 3BDCA 5I9PA 1U4LA 2B39A 1PTOB 1SJHD 4XDXA 2F0NA 4A3DB 3J7AV 4PV1C 3TBIB 1IYUA 4IUVA 1WTQA 2MGSA 2LKVA 1I4XA 2IJ0A 3VYTA 1J9OA 1VCIA 4QF4A 5A35A 4GZYC 4FXKC 2PPBC 3FVQA 4XXEA 2PNRC 4R9WA 2A68D 1L0YB 1U4PA 2ICIA 1XX8A 1B9MA 4X3TA 5ISRA 4V0BA 3D6WA 4MHEA 5FOBB 5M5YB 3C46A 4FO2A 4BBRB 3OPOA 1EY6A 3I4MB 1B9NA 2F0MA 2EE1A 3PIP3 2RSOA 5EBCA 2G9DA 1BQQT 3PO2B 3J7AF 5M3MB 3QWNA 2WINB 1SSOA 3Q24A 4WJWA 1CZWA 4XYOA 3GP7A 2M2LA 3BYYB 1WTPA 3GV3A 2Q8TA 3WOEA 1W6JA 2Q8RE 3GQBA 4JK1C 4ABNA 3HOWB 5ELFA 3TP7A 4CJ2C 4IUNA 2SNMA 3PUWA 3VR3A 2B8FA 4N9PA 1A6XA 1HTLD 3I91A 2KCNA 4ODGA 5C4ZA 4K6DA 2I07B 2QF7A 5M5WB 1GUNA 1TIID 3OIQA 3M4YA 3JAML 2IL8A 4L63B 1LTSD 3MXGA 1PRTC 5J1ZA 4BWGB 3S14B 2FMCA 3PUYA 1SEBD 4F87A 1EU4A 2EJMA 2XVSA 1SJED 1JWMD 4FNFA 4LAAA 3H09A 4ZK9B 4O42A 3M7NA 5E3FA 4RCOA 4CKCA 1FD7D 4A3JB 2BDNA 3SK6A 1SYCA 2H4OA 3R8BA 4L6TB 3VA5A 2F0TA 2EYFA 2K32A 3A56A 3NE5B 1OO9B 3BZDB 3T13A 3DWAA 1JE4A 2LFNA 1ZKOA 2Z4HA 2SOBA 2E74C 3P1HA 1ZEQX 4J1MA 5DAUA 1STYA 1ENAA 1NR2A 2CQAA 3I8ZA 1LO5D 3SEBA 5JEAG 2NVYB 4QCLA 1FGBD 3D8GA 3IKJA 5G3LD 2NVQB 1G91A 5E1FA 3OW7A 1X3QA 4DNRB 1KAAA 1PTOD 5C3EB 3KLSA 1DCZA 3HGBA 1S5BD 1M4VA 3GTGB 3S9WA 4C56C 5KNDA 2HCIA 2FFKB 2E2IB 1B2TA 2Z4IA 1D2BA 1UEAB 1JORA 3HG9A 4OGQC 1F2MA 4K6LA 1EFID 3S1QB 3NTIA 4H13C 1F9PA 2EJFC 2F0DA 1UAPA 2EXZA 3HEJA 5ELCA 1NR4A 2K03A 4DGZA 1G2SA 5JEAH 5CORA 1AW7A 4P2CB 2VB3X 4XT3B 2PYKA 5KYIA 1F9QA 1Z7TA 3K0YA 1SAPA 4U673 4DU9A 4RHSA 2A68C 3VYRA 4K8IA 3C1FA 1Q90A 3KK7A 4KY5A 1WD0A 2CVRA 3W3AA 1AEXA 3HRZC 4QUFA 4DXFA 1QWYA 4DFAA 3OMGA 3TP8A 1YNND 4QMGA 4G7OC 1EEID 4H0LC 3SDZA 2EYJA 3VR5A 1TS2A 3PO3B 1Y69U 1DJRD 1PRTF 4KKTA 4E6IA 3V05A 1JICA 4KD3A 1D5ZC 4PMWA 3MVVA 4J6HA 1AZQA 1I4PA 5J39A 1WTXA 3LX0A 3IFTA 1LT6D 2NTSA 5IGDA 3QB3A 5COYA 1MSHA 5CV6A 5I2XA 1IKMA 3SVMA 1JOOA 3N6RA 2PCFB 1H9SB 5E4XA 1JWSD 3S16B 2XRSD 5I4DA 1HA5A 1LT4D 1XTCD 1TS4A 1M8AA 1HTPA 3H6MA 2ENBA 4ID6A 4S3SA 3CRKC 4DAYA 3QOLA 4RWSC 1W6KA 5EPLA 2KQ3A 2L12A 1RTNA 4RGOS 4C3JG 3M85A 1XXGA 1STBA 3EA6A 2R6GA 2DN8A 2RDGA 4A3KB 1VF7A 4EQNA 4M8AA 3QOJA 1RTOA 2Y0SB 2RQXA 1I6HB 1LTGD 1RD9D 3CRLC 2H1EA 5FKAC 1EZ8A 2BA1A 3D4DA 5K5PA 2F0KA 1EIHA 2EDGA 4TKOB 5IOCA 3BS1A 4FVMA 4DK0A 3SXHA 2MP1A 4B9XA 1PTOC 2WAQB 1B1ZA 2R3ZA 2F0HA 2OXPA 2QEJC 2A6HC 3D3RA 5TSSA 1I4RA 2EY2A 2JEAI 3RZOB 1BCPF 4FXDA 2L11A 2WB1B 4BY1B 1CK1A 2BOSA 2A5HA 1ZXTA 4HSVA 4CKBA 2BCOA 3RZDB 3K6OA 3PIO3 1TWHB 2OT2A 3I4LA 3MA2B 5T1GA 5D14A 5C4XB 4ZKBB 2KHSA 3L3OC 2A6EC 1EQTA 4H7BA 2M9VA 1DOKA 4A3EB 4V190 3QIAA 3OIPA 2N55A 2O2LD 1CI3M 2F0UA 1BF4A 1CHQD 4NW2A 1FNUA 4A3GB 2KCCA 1U4RA 1ESFA 5C4HA 1IW7D 1KNAA 3ERQA 1J8IA 4HAEA 2RKSA 2K33A 2ZXOA 5CV9A 1YNNC 2CW0D 4C3HB 1QE6A 2NZ1D 4K5VA 1S5CD 1D1IA 1GHJA 2X6LA 4ZUIA 2XNAC 1WTWA 3BDLA 1DXMA 4IUPA 4KHVA 5FK9C 3HZXA 5HGTA 1WCMB 1KDAA 1T5XD 3W2DA 3RLFA 2B2TA 1ICWA 5IT9L 4KHZA 3IAYA 1CTMA 2NTTA 4KMUC 2DY8A 2XSCA 4Q0FA 1G8ZD 5EJWA 2AUJD 2K05A 3P7JA 3GO5A 1KNEA 2NN6I 2PW7A 4HCSA 3H0GB 5JAVA 2JEBI 5M9OA 1GUGA 4KKUA 2NUCA 5C4JB 2R7ZB 3WOFA 5CGKA 4LMQD 3P20A 5CBEE 1SYBA 1F2YA 1EU3A 4XIGS 4DAPA 1QNKA 4C3IB 1I3QB 1PZID 2Z1CA 3ITPA 4C1NI 2B2TC 1V43A 4R8NA 4AYBB 3TZDA 3X3MA 3FRPB 1LABA 2JXMB 2EY6A 1UUPA 1STGA 2F0QA 4DXGA 1LTID 3MFGA 2F1MA 1HQMC 1KABA 4OIKA 2HDMA 2M00A 2B2WA 2JYOA 4BA2I 4CHTB 2R92B 3HOXB 3J80L 3MZ5A 4IURA 2BE5D 3J81L 1JCKB 1STHA 3GTJB 2EPBA 2WIIB 4IALA 5LL6S 3U9SA 1SE4A 4KV6A 3T4AC 1HFGA 1TT2A 1PTOH 1S4ZA 2EYMA 2AWNA 4ZKCB 2K5WA 2L4NA 4BY7B 1BBXC 1SNPA 1GUSA 2VXWA 1SNOA 2NYZD 3DHQA 1QNUA 3KUPA 1AZPA 3I4NB 1EOTA 4BA1I 4MN3A 1SE3A 1FNWA 1Q1EA 4A3BB 3URYA 2B2WC 1H9SA 2PW5A 1H9MA 3U9OA 1CQFA 3DM1A 2F0JA 2F4IA 2K6AA 3K7AB 2VNUD 1RF2D 1HA6A 3EQLC 3BVMA 1IW7C 3HOYB 2DNEA 2PZWA 3VYUA 5HURA 1SDFA 3DUZA 2F0IA 4K8JA 5IGGA 1SMYC 1U4MA 4KI0A 5IT9E 3CKIB 1KDBA 4KJNA 2K01A 1STNA 3NSWA 2B2UA 2K5DA 4IUTA 1Y8PB 4LK1C 3NTHA 3EFXD 3R2IA 1E2VA 2F0OA 2NN6G 3E0JA 1S5FD 2GA4B 3LNNA 1KDCA 4IFDJ 2ID0A 5IODA 1X32A 2ZXPA 4KJOA 1V1OA 4ZAIA 1TVXA 1C8CA 1ONLA 3S2DB 3AB9A 4DF7A 1DD2A 4K5WA 3HOUB 2JE6I 5DEHA 1TWAB 2B2UC 2B2YA 3TSSA 2SDFA 5BN5A 3H94A 3NHHA 4IUUA 1GHKA 5FLXL 1ILPA 2YYZA 4FYDA 3K5NA 3I73A 3AMUA 5C0XJ 1TY2A 3OWFA 4WFN3 3T51B 3KBGA 5DNFA 2EVBA 1U9RA 3CQZB 2BA0A 5CC4A 1A2TA 3J80E 3J7YW 1RODA 3J81E 2EYHA 2K1BA 2MJ8A 3C3LA 2J7ZA 1I6VC 2L0CA 1F9RA 1IYVA 4L8JA 4FF2A 2YU9B 2Q8IB 5BN3A 2KECA 1DONA 2EY1A 2MPMA 4HR7B 3DXJC 2A69D 1O80A 1QILA 2F03A 5I2YA 1SNMA 3MXNA 1OXTA 3LWUA 5EQ0A 3FPUB 3E6ZX 2NB0A 1KTKA 3R2TA 2L5TA 1ET9A 3FEWX 3M7GA 1TWGB 4G7ZC 1CFMA 3I90A 4IFDI 1ET6A 1VMCA 4KKSA 5K36G 3GV6A 4HCEA 5C6AA 2QDBA 2C5CA 2QKIC 3MC0B 4A3IB 1JR0D 1B50A 1HUMA 4RFBA 2WKDA 4OIJA 1TY0A 1RDPD 1GUOA 3BDOA 5CBAE 4K2LA 3QO2A 1PFBA 3BG3A 3K59A 2D62A 2PQEA 2E2JB 3G6JB 4FF4A 1O78A 1SYFA 1PMRA 3RUZA 4K14A 4M1UB 3A55A 1BDOA 1LTBD 4K2KA 5C0XI 1R9TB 1O7YA 1H9KA 1E2ZA 3E5SA 5K36H 3C2PA 2TMPA 1CM9A 1WD1A 2KA7A 4C2MB 3VR2A 1MBYA 4WORA 2FINB 1GOZA 3MTSA 1C48A 1DM0B 1STAA 2AQ3B 3S15B 1L0XB 4TQUS 2QILA 4OO1I 3NXWA 3G7LA 5C3XA 1PXUA 4CJ1B 5EKLA 1SYEA 1ILQA 5CV5A 2RBMA 2J0TD 5DM63 3D6CA 4R8IA 2OF1A 3NUCA 3HP3A 3T56B 5EKKA 3VR4A 1CT1D 5KEEA 3NQTA 1XWEA 3GTOB 2JA8B 3V2TA 1RHPA 2WP8J 3A8IE 4QUCA 1PDQA 2EOTA 2N88A 2IX3A 4FP5D 1A3TA 5FLXE 4XQNA 5IGBA 3F2UA 3IFDA 2HQEA 5AFWA 2MUYA 1V1PB 1QJOA 2RDFA 5KYLA 1QCBD 4CBVA 1MI2A 2IX1A 1VF5C 1LACA 3M4OB 4XQQA 2TSSA 3NQIA 3NBHA 5KRUA 1LTTD 1EWHA 3QJYA 1Q8IA 2ZT9C 3MFYA 3A54A 2KEDA 3A8KE 4Y7NB 2O5JC 4KY7A 1BCPB 1IKLA 2KUMA 1HCZA 3OHXC 5KGUA 4ILWA 5DM73 2KOLA 5JPMC 3KLSX 2B63B 3MWYW 1EYCA 4PQXA 1LT5D 2L55A 2JA7B 1G2TA 1Y8NB 2XN9C 4TRDA 1G291 2PO4A 4QB4A 1LV9A 1D6EC 1I4HA 4IFDG 4HN7A 1F2ZA 5JVG3 1WTVA 2A69C 4PMBA 1V8QA 2DY7A 4I7ZC 5FO8B 2IW3A 3WDNA 1F77A 1WTRA 5FO9B 2B2VA 1K8OA 4ULLA 5JEAJ 1JB3A 1HXYD 3NPPA 3TN2A 3ND9A 4TSSA 1Q3LA 1PRTD 2QCPX 4C3HG 1ENCA 3AU7A 4FF3A 3TDQA 1SYDA 1SNQA 5ELEA 3GTKB 2C9OA 2IWHA 2WKCA 5D3DA 5C0XG 2EZVA 1F2LA 3L7ZC 2F0EA 2RVLA 1K8MA 1HHVA 1EL0A 5C44B 2B8GA 2JA6B 1XYIA 1CHPD 2RA4A 3PUXA 3UI2A 4G7HC 1Q12A 1A3UA 2LS01 4FXGC 2F3WA 4NMZA 4CGYB 3PV0A 1H9JA 2B2VC 1IL8A 1CZGA 3K5OA 5E4WC 3OOCA 1Z6HA 2JA5B 1OXUA 3I72A 1EY7A 1BO0A 4RCNA 1Y1WB 2Z8LA 3RMHA 4ZYSA 3BYTB 2EJGC 5CYUA 3NBIA 2E2HB 2HUGA 1LTAD 5CMDA 4C3IG 3A7AB 5KNCA 4CJ0B 3M3YB 3KLRA 2F0GA 4NDXA 5G3LF 4EGVA 3SK8A 2J4XA 3PUZA 1NAPA 5IGEA 4KN7C 1FNVA 1R4PB 5M3FB 4A93B 3S17B 1PTOF 1EY5A 3CHBD 3A8JE 1JQYD 1YNJD 1O7LA 4C1NK 1AN8A 4RKLA 2HCCA 2NVTB 1DYQA 3EJIA 4XYQA 3K58A 4ZQ3A 1GXDC 2NBFA 3SHLA 3H3VC 2F0WA 2EYLA 1RCVD 1BCPD 3R93A 3TZUA 1DOLA 1BXTA 2JSOA 1B53A 2D2CC 1Z47A 5EKIA 3TP6A 1EY8A 1BR9A 4Z9CB 3A7LA 4Q5VA 5EPKA 2LMCB 1FR3A 1OXSC 2ZXRA 4NP5A 3MAQA 2D9UA 4RH6A 5JJZA 3K57A 1TU2B 2O4XA 4KN4C 1S5DD 2NVXB 1TR5A 3LWEA 4XQJA 3D4WA 3ND8A 1Q1BA 3S1NB 3K5LA 2PZTA 4A3MB 2NWGA 3PMFA 2L9HA 2EYOA 3C1EA 4UDUC 5I9OA 1FYCA 2F0VA 5A2QL 1GUWA 2K7VA 1VMPA 2V4DA 5LL6X 3GTMB 2CW0C 3KBXA 4RGMA 4B08A 1PFMA 2PZUA 1DZ1A 1JWUD 3NWTA 4HEDA 1WTOA 2OEOA 1S5ED 3NTKA 4X3SA 2X6GA 3HOZB 1NSNS 4HMIA 4XT1B 3DMUA 2IX0A 1NUCA 4ZLTF 4ME5A 1GJXA 2F0PA 4I65A 4OL7A 5EPJA 4F8MA 2AWOA 1V1PA 1RKNA 3L9AX 1D5XC 2WV6D 5BN4A 3EVQA 5IGCA 5FO7B 4RAUC 1B3AA 5IIFA 1CA6A 3Q0AA 1CQVA 2VUMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  2A68 C;  3OOC A;  1Z6H A;  1Y8O B;  1TU2 B;  2PNR C;  3EQL C;  1OXU A;  1Q90 A;  2A68 D;  3GD7 A;  2IT1 A;  3I72 A;  1T5E A;  2KA7 A;  3M85 A;  1B9M A;  1IW7 C;  4KN4 C;  1Y8N B;  3VR2 A;  2DNE A;  2KCC A;  1V43 A;  4RCN A;  3D31 A;  1IW7 D;  3W3A A;  2NN6 H;  2K32 A;  2D5D A;  3ND8 A;  4OO1 G;  4TQU S;  1I6V C;  1LAB A;  2R6G A;  1G29 1;  2DN8 A;  2EJG C;  2JXM B;  3NE5 B;  1Q1B A;  2K33 A;  1SMY C;  4KI0 A;  1VF7 A;  1YNN C;  3OPO A;  4IFD G;  1IYV A;  4L8J A;  2F1M A;  1HQM C;  3FPP A;  2Q8I B;  5BN3 A;  2A69 C;  1HPC A;  3SE0 A;  4HR7 B;  1ZKO A;  3DXJ C;  2A69 D;  1V8Q A;  3A7A B;  3CRL C;  5KNC A;  2E76 C;  4I7Z C;  1Y8P B;  2A6H D;  3D4R A;  4JBW A;  2E74 C;  1B9N A;  4G7O C;  4H0L C;  1GHJ A;  2BA1 A;  3KLR A;  4LK1 C;  2O5I C;  4BA2 I;  3PUV A;  3MXU A;  3SDZ A;  2AUK A;  3WDN A;  2EDG A;  1TKW B;  1OXT A;  1E2V A;  1FYC A;  3LWU A;  4TKO B;  3VR5 A;  3VA7 A;  5C0X H;  5JEA G;  3FMC A;  1DXM A;  2BE5 D;  3PUZ A;  2K7V A;  1K8O A;  2V4D A;  3IKJ A;  4KN7 C;  2L5T A;  2NN6 G;  4DK0 A;  1VDZ A;  3OW7 A;  3RLF A;  2CW0 C;  1Y69 U;  3LNN A;  4DNR B;  3T56 B;  3ND9 A;  3A8J E;  3VR4 A;  3QG1 A;  4G7Z C;  4KKT A;  2E75 C;  3U9S A;  1YNJ C;  4KHZ A;  1CFM A;  1O7L A;  1CTM A;  2A6H C;  1DCZ A;  3GQB A;  3HGB A;  4JK1 C;  4KKS A;  5K36 G;  3A8I E;  4KMU C;  5KND A;  5KNB A;  3PUW A;  4OO1 H;  3VR3 A;  2JEA I;  2B8F A;  4XTC S;  1ZYR C;  4H44 C;  3IFT A;  2BE5 C;  1A6X A;  2A6E D;  1ONL A;  4OGQ C;  5C0X G;  2AUJ D;  1H9R A;  3TZU A;  1OXV A;  1GUS A;  2QF7 A;  4H13 C;  1GUN A;  3AB9 A;  3M4Y A;  4IQZ A;  1GJX A;  3L7Z C;  3T53 B;  2D2C C;  1QJO A;  2EJF C;  2NN6 I;  3N6R A;  1K8M A;  1GUO A;  3BDO A;  2PCF B;  1H9S B;  2JEB I;  1VF5 C;  3I4L A;  1LAC A;  1GUG A;  4BA1 I;  1DD2 A;  2AWO A;  2B8G A;  4KKU A;  3PUY A;  3BG3 A;  2D62 A;  4DNT B;  2JE6 I;  1Q1E A;  5JEA H;  3A7L A;  3PUX A;  2DNC A;  4PV1 C;  5BN4 A;  1O78 A;  1EWH A;  2LMC B;  1PMR A;  1H9S A;  1IYU A;  3H94 A;  3P20 A;  3QJY A;  1Q12 A;  2A6E C;  1H9M A;  2EJM A;  2ZT9 C;  5BN5 A;  4G7H C;  2BDO A;  1FR3 A;  3MFY A;  1GHK A;  3VR6 A;  1VCI A;  2YYZ A;  4DK1 A;  4XIG S;  1HTP A;  4IFD H;  3I73 A;  1GUT A;  1BDO A;  1OXS C;  3A8K E;  5A35 A;  1Z7T A;  3PV0 A;  2O5J C;  4GZY C;  3T51 B;  1OXX K;  1H9K A;  1H9J A;  3QIA A;  1HCZ A;  3M7N A;  2PPB C;  1E2W A;  1E2Z A;  3CRK C;  5K36 H;  2EVB A;  1CI3 M;  4LJZ C; 
#chains in the Genus database with same CATH topology
 4A3J H;  1ENF A;  1NBW A;  4BBS B;  2ZTC A;  3HOU G;  1LLR D;  2NN6 H;  1WTH A;  5T1I A;  2QEX A;  1MJC A;  3KDF A;  1CKO A;  4EQO A;  1TWF B;  3I70 A;  4DR6 L;  4NXN Q;  1SFO B;  1QZG A;  2JP1 A;  3SR1 A;  3ONA B;  1I50 B;  3SE0 A;  1STE A;  4GOP C;  1LT3 D;  2A6H D;  4YWM A;  1QG7 A;  4GKK L;  3AYH B;  1T9H A;  3MXU A;  2A73 B;  4N9T A;  2AUK A;  2E8G A;  1IBK L;  1X3E A;  4DR2 L;  3GTQ B;  2XWJ B;  2RF4 A;  1AP0 A;  1I4G A;  2AMC B;  2Z6K C;  1NCV A;  5IGF A;  5NUC A;  3RNU A;  2NVQ H;  4L5Q A;  3S1R B;  3S2D H;  1IBL Q;  3KF8 B;  3Q23 A;  2K52 A;  4R4Q A;  2E75 C;  4DN4 M;  1YNJ C;  1D5M C;  4EVO A;  1HR0 W;  5C3E H;  1LTR D;  3E3X A;  3HOU H;  1XNR L;  5KNB A;  3U58 A;  1YI2 A;  4P72 A;  1ML0 D;  3DWP A;  1TWA H;  1KLG D;  3O13 A;  3CCQ A;  1K83 B;  2BE5 C;  1UNS A;  3J81 i;  1ZYR D;  1BCP C;  2A6E D;  1D1K A;  5C5M A;  5JPN C;  3V96 A;  1L0W A;  1OXV A;  1AFP A;  1Y1V B;  4DV6 Q;  1HR0 L;  2RSN A;  3H3V H;  4DV7 L;  2B2Y C;  1IHZ A;  2Y0S E;  1GKH A;  4PNY A;  3T53 B;  2EY5 A;  4JI2 Q;  4J8Q A;  3MHB A;  3H91 A;  4IN3 A;  4KTA A;  4MTN A;  1IL2 A;  4YCW A;  3AQQ A;  1YHB A;  1XNQ Q;  1PLF A;  4LF7 L;  4JI7 Q;  2K5H A;  3DEP A;  3S1M B;  5CV4 A;  2V1C C;  3DEO A;  1B44 D;  2HDL A;  1HFN A;  3VR6 A;  2XWB B;  5CV8 A;  1GUT A;  2RCN A;  1WVL A;  2WAQ E;  1S40 A;  3AFP A;  2DUD A;  1OXX K;  3FDT A;  4DR4 L;  2Q2H A;  4LFA Q;  1E2W A;  3OMC A;  2GVA A;  2MHV A;  3CCR A;  2YU9 H;  1NMF A;  3FKI B;  1RIP A;  3BVG A;  1OTC A;  1C4Q A;  1XPO A;  1E7Z A;  2SEB D;  1PYW D;  1Y8O B;  4ME3 A;  3K5M A;  1XPR A;  2XIW A;  1MIU A;  2RDH A;  1PRT B;  1A3V A;  2XRQ D;  5A2Q E;  3S2H B;  1HQR D;  2D5D A;  2JJQ A;  4DA2 A;  1B4O A;  1KLU D;  4KK7 A;  3JAM E;  3P75 A;  5JJK A;  4KY6 A;  1NNX A;  1TWG H;  3FPP A;  1SNC A;  1HPC A;  3NP8 A;  3OWE B;  4IZ8 A;  4A3C G;  1PZJ D;  1TS5 A;  5C5L A;  2IPK D;  4FF1 A;  4HMJ A;  4JBW A;  2F0S A;  3B6Y A;  4WRD A;  4JYA Q;  2D0O A;  1J5E Q;  1EQV A;  1E1O A;  4PMC A;  3K8A A;  3M4P A;  4RG1 A;  1NTG A;  4MIU A;  1GM5 A;  3U4Z A;  1TXY A;  5D65 A;  2EYP A;  5FJ8 G;  3PF5 A;  1Q82 C;  3Q22 A;  3CU7 A;  2KEE A;  3X3N A;  5J22 A;  5JVH 3;  1U5K A;  3L0O A;  1Q86 C;  1XJV A;  4DV5 L;  1BUV T;  1MHW C;  1N9W A;  4DAV A;  5IWA Q;  1TS3 A;  3DWQ A;  1PH5 A;  1F9S A;  2F0F A;  4IUQ A;  1TWC B;  2ICE C;  1EY9 A;  4PG3 A;  4X3K A;  4DAM A;  1O7Z A;  2K50 A;  5GAH C;  1H9R A;  2FHT A;  1S3O A;  2R61 A;  3ZYY X;  1EEF D;  1EY4 A;  2R7F A;  4IQZ A;  3RD4 A;  4A3C H;  1R9T H;  3PIO A;  4C3J B;  3ERO A;  4B9W A;  1D8L A;  3CXC A;  1CSQ A;  4C2M H;  4YIJ A;  2Y0S G;  2JA8 G;  2DNC A;  5FJ8 H;  2IY5 B;  1A2U A;  2OQ0 A;  2BDO A;  2E2D C;  2X69 A;  3FP9 A;  2PMZ B;  1EWC A;  1MGS A;  3I3C A;  2SNS A;  4YCV A;  4OWT B;  4CDD C;  2LY7 A;  5M5X B;  1HH2 P;  1HUN A;  3T1H L;  3HFZ B;  5BR8 Q;  4LJZ C;  5E7N A;  2F0L A;  3CCS A;  2VS1 A;  1SYG A;  3GD7 A;  1G6Z A;  4RA8 A;  3TME A;  2UXD Q;  1T5E A;  3HS0 C;  4RGN A;  2FMM A;  1BKB A;  3D31 A;  4OWW B;  4CKE A;  5I6W A;  5JJL A;  4OHJ A;  3GTL B;  2K28 A;  4EQP A;  3OTO Q;  2UUC Q;  5I6Y A;  2KEN A;  5CV7 A;  1AE2 A;  3FHW A;  1A63 A;  2Z9H A;  5IP7 G;  1SXT A;  1IZ6 A;  3LGJ A;  4UAI A;  4BS9 A;  2JA8 H;  3D4R A;  5FLM G;  3HKS A;  1TKW B;  3E0E A;  2UXC L;  1EZ6 A;  2JA7 G;  5ELD A;  3TP5 A;  5C4X G;  1TQO A;  2VQE Q;  3MXP A;  1VDZ A;  5EBD A;  4RKB A;  1WJJ A;  4AH6 A;  3RN2 A;  3M4O H;  4UP7 A;  4AYB E;  2KVM A;  4KD4 A;  4HJA A;  3A0J A;  3CPW A;  3TQY A;  3RR5 A;  3NWS A;  1ZYR C;  1EIG A;  4H44 C;  2A74 C;  4F88 A;  1HRJ A;  4APV A;  3RZO H;  1IYJ B;  1HNW Q;  4A3G G;  2XTI A;  4EQ5 A;  3GTP B;  3TRE A;  4LF6 Q;  4X3U A;  1JOK A;  1RJT A;  4HSP A;  4Y7N H;  5D3I B;  3NK9 A;  2L1B A;  2WAC A;  5IP7 H;  2E5L L;  1GD7 A;  4X6A H;  1BNZ A;  5FLM H;  1CSP A;  5KIX A;  3RZD H;  2CHB D;  4A3F B;  3H15 A;  1SLJ A;  1A15 A;  4DNT B;  1J6Q A;  2JA7 H;  3CW2 C;  5C4X H;  4ZUJ A;  1MD2 D;  2KJX A;  5IP9 G;  4R4I A;  3E9H A;  3F8T A;  1UE6 A;  1X3P A;  5JOB A;  5DLQ E;  5HGQ A;  4O1N A;  4OWX B;  3W1B A;  4DK1 A;  3PQI A;  4IFD H;  4K5X A;  2FJ2 A;  1C7Y A;  3R3O A;  5C3W A;  4ZRZ A;  4F7X A;  1SMY D;  3HKZ B;  3KFU A;  4RHR A;  2G9H D;  1E1T A;  1WCM G;  5CR3 A;  2YTV A;  4G4K A;  3I7F A;  2IT1 A;  3T16 A;  1CA5 A;  4A3G H;  1II3 A;  5C44 G;  2JA6 G;  2PI2 A;  3OSO A;  3N52 A;  1CKM A;  1I4Q A;  2GVB A;  1EY0 A;  4YWK A;  4X64 Q;  2K5Q A;  3HOV B;  4G57 A;  4OO1 G;  1QB5 D;  1M90 C;  1PFN A;  3KF6 B;  4U68 A;  3J81 j;  1QOH A;  3VYS A;  1Y14 B;  4LFB L;  2F4V L;  4C3H H;  5F2D A;  2YV5 A;  2HT1 A;  2R93 B;  3Q6S A;  2VB2 X;  4X66 L;  3ULP A;  4RGT A;  1DOM A;  5HY6 A;  3SK4 A;  4HTH A;  2E76 C;  2HHH Q;  1E0B A;  5IP9 H;  1ICF B;  2O5I C;  3PUV A;  3IL8 A;  1YZ6 A;  3GTK H;  1JC7 A;  2I46 A;  1EYD A;  2AQ1 B;  2CQO A;  3VA7 A;  5C0X H;  3JAM c;  1XPU A;  3FMC A;  3VDY A;  1ESR A;  1MSG A;  4N8X 1;  1QVF A;  2K04 A;  1XMO Q;  5EGT A;  3SK5 A;  1Y1W G;  1AH9 A;  1BOS A;  1PZK D;  4QIW B;  1WCM H;  4J15 A;  5ELB A;  3QG1 A;  3BVZ A;  2F3I A;  4LW1 A;  5LHY 1;  4YY3 Q;  4K0K Q;  3PIP A;  2JA6 H;  2AQ2 B;  3KF8 A;  5AJ3 Q;  1R4Q B;  4OO1 H;  4XTC S;  2F3V A;  2Q2U A;  1PH9 A;  4A4I A;  1WYD A;  1SBB B;  1EYA A;  3UDX A;  4AYB G;  4WJ3 M;  1SND A;  1SE2 A;  4NKL A;  3MEH A;  2QDL A;  3G6E A;  1JOQ A;  5M3F G;  4A93 G;  3BDC A;  5I9P A;  1U4L A;  2B39 A;  1PTO B;  1SJH D;  3GDE A;  4XDX A;  3T1Y Q;  2F0N A;  3OW2 A;  1PH1 A;  4R1J A;  4A3D B;  3J7A V;  4PV1 C;  5C4J H;  3TBI B;  1IYU A;  1N33 Q;  4IUV A;  1WTQ A;  2MGS A;  2LKV A;  1I4X A;  2IJ0 A;  2KCM A;  3VYT A;  1J9O A;  4DAY B;  1VCI A;  2QA4 A;  4QF4 A;  4HIO A;  1PH4 A;  1YIT A;  5A35 A;  4B3T L;  4GZY C;  4FXK C;  3KJP A;  2E2H H;  3SGI A;  1PV4 A;  2PPB C;  1LYL A;  3FVQ A;  4LWC A;  2GN5 A;  4XXE A;  4B3R Q;  2PNR C;  2I5L X;  4QL5 A;  4R9W A;  2A68 D;  3M3Y H;  1L0Y B;  1U4P A;  1N32 Q;  2ICI A;  1XX8 A;  1JJ2 A;  1B9M A;  3RLO A;  4X3T A;  1P16 A;  3ULL A;  5ISR A;  1DGS A;  4V0B A;  4DR1 Q;  3D6W A;  4MHE A;  5FOB B;  5M5Y B;  3C46 A;  4BY7 G;  5M3F H;  4A93 H;  4FO2 A;  4BBR B;  3OPO A;  4GNX C;  1EY6 A;  1E22 A;  2N78 A;  3I4M B;  3BJU A;  2ES2 A;  1K28 A;  1B9N A;  2F0M A;  2EE1 A;  3PIP 3;  3BZC A;  3CF5 A;  2RSO A;  5EBC A;  2G9D A;  1BQQ T;  2LXJ A;  3PO2 B;  3J7A F;  5M3M B;  3QWN A;  4A3B G;  2WIN B;  1SSO A;  3Q24 A;  4WJW A;  1CZW A;  4GLX A;  4XYO A;  4OX9 Q;  1PA6 A;  3GP7 A;  4JI0 L;  2M2L A;  3BYY B;  1WTP A;  1UE7 A;  3GV3 A;  2Q8T A;  3WOE A;  1W6J A;  2Q8R E;  3GQB A;  4JK1 C;  1B7Y B;  4ABN A;  3HOW B;  5ELF A;  3TP7 A;  4CJ2 C;  1YVC A;  4IUN A;  2SNM A;  3M4Q A;  3PUW A;  1VQM A;  3VR3 A;  4A3M G;  1VQJ A;  2B8F A;  1NJI C;  4N9P A;  2YTY A;  2PNH A;  1HTL D;  3I91 A;  4BY7 H;  1A6X A;  2KCN A;  4ODG A;  1HZB A;  5C4Z A;  4X65 L;  4K6D A;  2I07 B;  4WJ4 A;  2QF7 A;  5M5W B;  1GUN A;  1TII D;  3OIQ A;  3M4Y A;  2UU9 L;  3JAM L;  2IL8 A;  1JT8 A;  4L63 B;  1LTS D;  3MXG A;  1N34 L;  1PRT C;  1EOV A;  4JW0 A;  1X65 A;  5J1Z A;  4BWG B;  1QUQ B;  3S14 B;  2FMC A;  3PUY A;  1B70 B;  1SEB D;  5ELO A;  4F87 A;  1VQD A;  4A3B H;  2NVX H;  1EU4 A;  2EJM A;  3HOZ G;  1LUZ A;  2XVS A;  1UE5 A;  1SJE D;  1X3F A;  1JWM D;  4FNF A;  2ZTD A;  4KHP Q;  4LAA A;  1K8G A;  4LUZ A;  3H09 A;  4R4T A;  4ZK9 B;  1K3R A;  4O42 A;  3M7N A;  4LFC Q;  5E3F A;  4RCO A;  4CKC A;  1FD7 D;  4A3J B;  4DV3 Q;  2BDN A;  4A3M H;  3K7A H;  3BU2 A;  3SK6 A;  1SYC A;  2H4O A;  2NZH A;  3R8B A;  4L6T B;  3VA5 A;  2F0T A;  4GN5 A;  2EYF A;  2K32 A;  1V1Q A;  3A56 A;  1EWI A;  3NE5 B;  3GTM H;  1OO9 B;  3BZD B;  4YCU A;  3T13 A;  2B3G A;  3DWA A;  3CCL A;  1JE4 A;  2LFN A;  1ZKO A;  4DR7 Q;  2Z4H A;  4GKJ Q;  2SOB A;  4DUZ Q;  2E74 C;  3P1H A;  5ELN A;  3CC7 A;  1H95 A;  1ZEQ X;  5IY0 A;  4J1M A;  5DAU A;  1STY A;  1G6P A;  3HOZ H;  2VUM G;  1ENA A;  1NR2 A;  2CQA A;  3I8Z A;  4BBS G;  1LO5 D;  3SEB A;  5JEA G;  2NVY B;  4QCL A;  1FGB D;  3D8G A;  3IKJ A;  4FDB A;  5G3L D;  4UY8 C;  2NVQ B;  1G91 A;  1EFW A;  5E1F A;  3OW7 A;  1X3Q A;  4DNR B;  1KAA A;  4A75 A;  1JJC B;  2KHI A;  1PTO D;  2CFM A;  5C3E B;  3KLS A;  1DCZ A;  3HGB A;  1S5B D;  3A5U A;  1M4V A;  3GTG B;  3EN2 A;  3S9W A;  4C56 C;  4UP9 A;  5KND A;  4IPC A;  2HCI A;  2BH2 A;  4H02 A;  1CKN B;  2FFK B;  2E2I B;  1B2T A;  2Z4I A;  1D2B A;  1UEA B;  1HNX Q;  1JOR A;  4DR6 Q;  3HG9 A;  4OGQ C;  3F1Z A;  2ZJR A;  1F2M A;  4K6L A;  1EFI D;  3S1Q B;  3NTI A;  4H13 C;  3K81 C;  1EUJ A;  1F9P A;  2EJF C;  2H5X A;  1NY4 A;  2F0D A;  2LSS A;  1UAP A;  2EXZ A;  3HEJ A;  1X55 A;  2MFI A;  5ELC A;  4GLA C;  1BVS A;  4DUY Q;  1NR4 A;  2K03 A;  4UPA A;  4LF4 Q;  4DGZ A;  1IBK Q;  1G2S A;  2N8N A;  4BBS H;  5JEA H;  3AEV A;  5COR A;  1AW7 A;  4P2C B;  2VB3 X;  4XT3 B;  2PYK A;  5KYI A;  4RMF A;  1F9Q A;  1TWF H;  1Z7T A;  2A8V A;  1VQA A;  3K0Y A;  1SFO H;  3UE0 A;  1SAP A;  4U67 3;  4DU9 A;  1I50 H;  1XNR Q;  4RHS A;  2A68 C;  3K7U C;  3VYR A;  3CQZ H;  4K8I A;  3C1F A;  1Q90 A;  3G48 A;  3KK7 A;  4KY5 A;  2AKW B;  1XNQ L;  1WD0 A;  2CVR A;  4JI7 L;  1QZH A;  3W3A A;  1AEX A;  4JV5 Q;  3HRZ C;  4QUF A;  4DXF A;  1QWY A;  3I2Z A;  4DFA A;  3OMG A;  1E3P A;  3TP8 A;  4A3I G;  1YNN D;  4QMG A;  3KF6 A;  4IO9 A;  4LF7 Q;  4G7O C;  1EEI D;  4H0L C;  3FKI G;  1QVG A;  5GAG C;  3SDZ A;  2EYJ A;  3VR5 A;  1TS2 A;  1K83 H;  1PVO A;  3PO3 B;  1EYG A;  1HNZ L;  1Y69 U;  4P73 A;  1DJR D;  1PRT F;  2MO0 A;  4KKT A;  4E6I A;  3V05 A;  1JIC A;  4KD3 A;  5EAY A;  1D5Z C;  4PMW A;  3MVV A;  4J6H A;  1AZQ A;  1I4P A;  5J39 A;  4O0A A;  1WTX A;  4JYA L;  3KYH C;  3LX0 A;  3IFT A;  3S1M H;  1LT6 D;  2NTS A;  1KD1 C;  1VQG A;  5IGD A;  4A3I H;  3QB3 A;  5COY A;  3JAM i;  1MSH A;  5CV6 A;  5I2X A;  1IKM A;  3SVM A;  1JOO A;  3N6R A;  4HJ5 A;  2PCF B;  1A8V A;  1H9S B;  3FKI H;  1JWS D;  5E4X A;  3WWV A;  3D0F A;  5IWA L;  3S16 B;  2XRS D;  2E2J H;  5I4D A;  1HA5 A;  1LT4 D;  4L5S A;  1XTC D;  1TS4 A;  1L1O B;  3EIV A;  1UWV A;  1M8A A;  1HTP A;  3H6M A;  2ENB A;  1YBY A;  4ID6 A;  2I5H A;  4S3S A;  3CRK C;  4DAY A;  3QOL A;  4RWS C;  4A3L G;  2VY3 A;  1W6K A;  4NXM Q;  5EPL A;  3CC4 A;  2KQ3 A;  2L12 A;  1RTN A;  1WI5 A;  4RGO S;  4C3J G;  4GN4 B;  3M85 A;  1XXG A;  1STB A;  1QVC A;  3EA6 A;  2IHF A;  1JE5 A;  3JC6 6;  3CD6 A;  2R6G A;  2DN8 A;  4DV1 Q;  2RDG A;  3S15 H;  1VQN A;  2CKZ B;  4A3K B;  1VF7 A;  4EQN A;  4M8A A;  1EIF A;  3QOJ A;  1GO3 E;  1RTO A;  1WOC A;  2Y0S B;  1FJG L;  2RQX A;  1I6H B;  1LTG D;  1RD9 D;  3CRL C;  2H1E A;  1N36 L;  2ZTE A;  5FKA C;  1EZ8 A;  1VQ8 A;  2BA1 A;  3D4D A;  5K5P A;  2F0K A;  1EIH A;  2UXD L;  2PQA B;  2EDG A;  1CUK A;  4TKO B;  4X62 Q;  2OQK A;  5IOC A;  3BS1 A;  3QR8 A;  1LTL A;  4FVM A;  4PZ6 A;  4L5T A;  4DK0 A;  3PCO B;  3OTO L;  3CCJ A;  1PFS A;  4A3L H;  3SXH A;  3T1H Q;  2MP1 A;  4B9X A;  1PTO C;  2WAQ B;  1B1Z A;  4DR3 L;  2R3Z A;  4C3J H;  2F0H A;  2IHE A;  2K5V A;  2OXP A;  2VL6 A;  2QEJ C;  2A6H C;  4YHH L;  4JI8 L;  3D3R A;  3GTO H;  2WFW A;  5TSS A;  1I4R A;  2EY2 A;  2B63 G;  2JEA I;  1PH8 A;  3RZO B;  1BCP F;  4FXD A;  4HID A;  4QIW E;  3F2D A;  2L11 A;  2WB1 B;  4BY1 B;  1CK1 A;  2UUB L;  4QGU A;  3NEL A;  2BOS A;  2A5H A;  2VQE L;  1ZXT A;  3OYY A;  4HSV A;  5M5X H;  4CKB A;  2BCO A;  3RZD B;  1K0S A;  3K6O A;  3PIO 3;  1TWH B;  2OT2 A;  5IYC G;  3J7A 5;  3I4L A;  3MA2 B;  5T1G A;  5IYB G;  1KIX A;  5D14 A;  2R7D A;  4PZ7 A;  2UXC Q;  5C4X B;  4ZKB B;  2KHS A;  3L3O C;  2A6E C;  1EQT A;  3ER0 A;  3GTL H;  4H7B A;  1QUQ A;  2M9V A;  1DOK A;  4DV0 Q;  2K75 A;  4CDF C;  4A3E B;  4V19 0;  2G5D A;  3QIA A;  3OIP A;  2N55 A;  4YWL A;  2O2L D;  1CI3 M;  2F0U A;  3J80 c;  1BF4 A;  1CHQ D;  3RLN A;  4NW2 A;  4LF9 L;  2B63 H;  5LMU Q;  1FNU A;  4A3G B;  4ZCK A;  2CH4 W;  2KCC A;  1U4R A;  1ESF A;  5C4H A;  1IW7 D;  2XGT A;  4A3F G;  2VQF L;  3TRZ A;  1KNA A;  2CWP A;  1I94 Q;  3ERQ A;  4DV4 Q;  1J8I A;  4HAE A;  2E5L Q;  2RKS A;  2K33 A;  2ZXO A;  5CV9 A;  1YNN C;  2EXD A;  1KAW A;  4HJ7 A;  2CW0 D;  4C3H B;  5IYC H;  4JC0 A;  1QE6 A;  1SE8 A;  2NZ1 D;  5IYB H;  1AE3 A;  4K5V A;  1S5C D;  2KCT A;  2I5M X;  1D1I A;  1GHJ A;  2X6L A;  1N8R C;  4ZUI A;  3CP0 A;  4DR5 L;  2XNA C;  1WTW A;  4P74 A;  3BDL A;  1DXM A;  4IUP A;  1XMQ Q;  2HIX A;  4KHV A;  3HZX A;  5FK9 C;  4X64 L;  5HGT A;  4IPG A;  1WCM B;  1KDA A;  1T5X D;  3DM3 A;  3W2D A;  3RLF A;  2L15 A;  3HOV G;  2B2T A;  1ICW A;  5IT9 L;  4KHZ A;  3IAY A;  1FGU A;  1CTM A;  2NTT A;  4A3F H;  4KMU C;  4LUV A;  2DY8 A;  2XSC A;  4Q0F A;  4DK6 C;  2JA5 G;  1G8Z D;  2HD3 A;  2VZA A;  1Q46 A;  5EJW A;  2AUJ D;  2ZJP A;  1KC8 C;  4LFB Q;  4JI5 Q;  3NEN A;  2K05 A;  3P7J A;  3GO5 A;  1XMO L;  4X66 Q;  2FXQ A;  1CKN A;  1KNE A;  1HZA A;  2NN6 I;  3CCE A;  2PW7 A;  1VQI A;  4HCS A;  3H0G B;  5JAV A;  2JEB I;  5M9O A;  1GUG A;  3U50 C;  4YY3 L;  4K0K L;  4KKU A;  2NUC A;  5C44 H;  5C4J B;  2R7Z B;  2C35 B;  4UHV A;  3WOF A;  5AJ3 L;  4NPS A;  5CGK A;  4LMQ D;  1KXL A;  3P20 A;  5CBE E;  2Q2T A;  1SYB A;  1U0L A;  1F2Y A;  3HOV H;  4AQY Q;  1EU3 A;  4XIG S;  4LF8 L;  1EQR A;  4DAP A;  4DV2 Q;  1QNK A;  4C3I B;  3CPF A;  1I3Q B;  1PZI D;  1D7Q A;  2Z1C A;  3ITP A;  4C1N I;  2B2T C;  1KRS A;  3CCU A;  2JA5 H;  3CCM A;  1V43 A;  4R8N A;  4AYB B;  4JI4 Q;  3TZD A;  4POG A;  3X3M A;  3FRP B;  1Y1W H;  1N33 L;  1LAB A;  2JXM B;  5LMN W;  2EY6 A;  1UUP A;  2UXB Q;  1STG A;  2F0Q A;  4JBJ A;  4DXG A;  1LTI D;  3MFG A;  2F1M A;  1HQM C;  1YJ9 A;  1KAB A;  4OIK A;  2HDM A;  2M00 A;  2B2W A;  2JYO A;  4O2D A;  1IBM Q;  4B3R L;  5LMN L;  4BA2 I;  4CHT B;  2R92 B;  3HOX B;  3J80 L;  2JA9 A;  3MZ5 A;  2A1A A;  4IUR A;  4OEL B;  2K14 A;  2BE5 D;  3J81 L;  3K80 C;  1VQB A;  3PSI A;  1JCK B;  1STH A;  3GTJ B;  1KHI A;  2EPB A;  4P75 A;  4JI3 L;  2WII B;  4LF5 Q;  2PI2 E;  4IAL A;  5LL6 S;  3S17 H;  3U9S A;  1SE4 A;  1E24 A;  2N49 A;  4KV6 A;  4BBR G;  3T4A C;  1HFG A;  3K0X A;  1TT2 A;  1PTO H;  1S4Z A;  2EYM A;  1M1K C;  2AWN A;  2NVT H;  3G4S A;  2JQO A;  4MTK A;  4ZKC B;  2K5W A;  3I4M G;  2L4N A;  4BY7 B;  5J3B A;  3E9I A;  4IJH A;  1BBX C;  1GUS A;  1SNP A;  3PO2 G;  2VXW A;  3AFQ A;  5GQO A;  5M3M G;  1SNO A;  4OX9 L;  2NYZ D;  1VQK A;  3DHQ A;  1QNU A;  3KUP A;  3NBH B;  1AZP A;  3ICE A;  3I4N B;  1LM0 A;  4JCV E;  1EOT A;  1W3S A;  4BA1 I;  1B8A A;  1L2F A;  4MN3 A;  1SE3 A;  1FNW A;  1Q1E A;  4A3B B;  3URY A;  2B2W C;  3HOW G;  1VQE A;  1H9S A;  1PYB A;  2PW5 A;  1H9M A;  3U9O A;  4JI1 L;  1GVP A;  4MZ9 A;  2ZM6 Q;  1CQF A;  3DM1 A;  5M5Y H;  4BBR H;  2F0J A;  2F4I A;  1L1O A;  4IOA A;  2K6A A;  1MJE A;  1VQ4 A;  3K7A B;  2VNU D;  3I4M H;  1RF2 D;  1HA6 A;  3EQL C;  1VQ7 A;  3BVM A;  4A76 A;  1BBW A;  1IW7 C;  3HOY B;  2DNE A;  2CCZ A;  1SN8 A;  2PZW A;  1HJP A;  4B3M L;  4X65 Q;  2UUA L;  3PO2 H;  5M3M H;  3VYU A;  4DKA C;  5HUR A;  1SDF A;  3DUZ A;  2F0I A;  2UU9 Q;  4K8J A;  5IGG A;  1SMY C;  1U4M A;  4KI0 A;  5IT9 E;  3CKI B;  3S1N H;  1N34 Q;  4KHP L;  1KDB A;  4KJN A;  2K01 A;  1STN A;  3NSW A;  4LFC L;  2B2U A;  2K5D A;  4IUT A;  1Y8P B;  3HOW H;  4A3J G;  4LK1 C;  4B3S Q;  4L5R C;  3NTH A;  3I56 A;  4IPD A;  1X3G A;  3EFX D;  3R2I A;  1E2V A;  2F0O A;  4OXP A;  2NN6 G;  1SRO A;  1VQC A;  4JI6 L;  3E0J A;  2PQA A;  1S5F D;  2GA4 B;  3LNN A;  1KDC A;  4OEM B;  1YIJ A;  3Q8D A;  2BH8 A;  4IFD J;  4GLV B;  2ID0 A;  3J7Z C;  5IOD A;  1X32 A;  3MEF A;  3S14 H;  2ZXP A;  4DUZ L;  4KJO A;  3TEH B;  1V1O A;  4ZAI A;  1TVX A;  1VS0 A;  1C8C A;  1ONL A;  3KLW A;  3S2D B;  3AB9 A;  2ALY B;  1YJW A;  4DF7 A;  3F2C A;  4NXN L;  1DD2 A;  3TS2 A;  4K5W A;  3HOU B;  1VQP A;  2JE6 I;  5DEH A;  5C3E G;  1TWA B;  2B2U C;  1YNX A;  2B2Y A;  3TSS A;  2SDF A;  5BN5 A;  3H94 A;  3NHH A;  4IUU A;  3CCV A;  1GHK A;  5FLX L;  1ILP A;  1VQL A;  2YYZ A;  4FYD A;  3K5N A;  2Q2I A;  1HNX L;  3I73 A;  3AMU A;  5C0X J;  1TY2 A;  3OWF A;  4WFN 3;  1FL0 A;  3T51 B;  2K5N A;  3KBG A;  1YEZ A;  1K8A C;  4OON A;  5DNF A;  2EVB A;  2MQH A;  1IBL L;  1KQS A;  1U9R A;  4GKK Q;  3CQZ B;  2VW9 A;  2BA0 A;  2D0P A;  2VUM H;  4DUY L;  5CC4 A;  4LF4 L;  4DR2 Q;  1A2T A;  3J80 E;  3J7Y W;  1ROD A;  1SR3 A;  3J81 E;  2EYH A;  2K1B A;  2MJ8 A;  3C3L A;  2J7Z A;  2NVY H;  1I6V C;  2L0C A;  1F9R A;  4LUO A;  1IYV A;  4L8J A;  3NEM A;  4FF2 A;  4DV6 L;  2YU9 B;  2OTJ A;  2Q8I B;  1X54 A;  5BN3 A;  2KEC A;  1DON A;  2EY1 A;  1Y1V G;  2MPM A;  2I0Q A;  4HR7 B;  3DXJ C;  1V9P A;  2A69 D;  4GNX B;  1O80 A;  4IOC A;  2K4K A;  3A5Z B;  4JI2 L;  1QIL A;  2F03 A;  4MNO A;  5I2Y A;  3GTG H;  1SNM A;  4EX5 A;  3J80 i;  3MXN A;  1NMG A;  1OXT A;  3LWU A;  2PMZ E;  5EQ0 A;  1S72 A;  3FPU B;  2DJG C;  2E2I H;  3GTQ H;  3E6Z X;  1JJG A;  2NB0 A;  1HR0 Q;  4JV5 L;  1KTK A;  3R2T A;  2L5T A;  4DV7 Q;  4UP8 A;  3S1Q H;  1ET9 A;  3FEW X;  3S1R H;  2RHQ B;  1TWG B;  3M7G A;  4G7Z C;  1CFM A;  1SMX A;  3I90 A;  4IFD I;  1ET6 A;  4LFA L;  1VMC A;  3PGZ A;  4KKS A;  5K36 G;  4QQB X;  3GV6 A;  4HCE A;  5C6A A;  5JJI A;  2A19 A;  2QDB A;  2C5C A;  2QKI C;  3MC0 B;  4A3I B;  1JR0 D;  1B50 A;  2MNA A;  1HUM A;  4RFB A;  2JN4 A;  2WKD A;  4DR4 Q;  1B3Q A;  4OIJ A;  1TY0 A;  1RDP D;  1Y1V H;  3PO3 G;  3I55 A;  1GUO A;  3BDO A;  5CBA E;  4K2L A;  1YHQ A;  3QO2 A;  4QJF A;  2DGY A;  1PFB A;  2JK8 A;  3BG3 A;  3K59 A;  2D62 A;  2PQE A;  2E2J B;  1X9N A;  2OWO A;  2WB1 E;  2P5Z X;  3G6J B;  1O78 A;  1SYF A;  4FF4 A;  1PMR A;  1J5E L;  3RUZ A;  4TVA B;  3A74 A;  4DPG A;  1HNZ Q;  4K14 A;  4M1U B;  3A55 A;  1BDO A;  1LTB D;  1EIY B;  4K2K A;  5C0X I;  1YHA A;  1O7Y A;  1H9K A;  1R9T B;  1K0R A;  1E2Z A;  3E5S A;  5K36 H;  4HIM A;  1G51 A;  3C2P A;  2TMP A;  4QY7 A;  1CM9 A;  1WD1 A;  2KA7 A;  4C2M B;  3VR2 A;  1MBY A;  4WOR A;  3W1G A;  2FIN B;  1PYS B;  1GOZ A;  3MTS A;  4GS3 A;  1C48 A;  1DM0 B;  1STA A;  2AQ3 B;  2EQS A;  4R4O A;  3PO3 H;  3S15 B;  1L0X B;  3S2H H;  4TQU S;  1Q8K A;  2QIL A;  4OO1 I;  4DV5 Q;  3M9B A;  4IJL A;  3NXW A;  3G7L A;  5C3X A;  1PXU A;  4CDC C;  4CJ1 B;  1XTD A;  3CAM A;  5EKL A;  1Q81 C;  1A0I A;  4NXM L;  1SYE A;  3S24 A;  1ILQ A;  1BBU A;  5CV5 A;  1X6O A;  2RBM A;  2J0T D;  5DM6 3;  2MO1 A;  3D6C A;  2DJF C;  5IT9 c;  4R8I A;  2OF1 A;  1VQ5 A;  2ZJQ A;  3HKZ E;  3PF4 A;  1K73 C;  1K9M C;  4DV1 L;  3NUC A;  3HP3 A;  3T56 B;  5EKK A;  3VR4 A;  1CT1 D;  5KEE A;  4N8F A;  4A3K G;  3NQT A;  1XWE A;  3GTO B;  2JA8 B;  3V2T A;  1RHP A;  2WP8 J;  5BR8 L;  3A8I E;  1K3B C;  4QUC A;  1EQQ A;  1PDQ A;  2EOT A;  2N88 A;  2IX3 A;  4GOP B;  3S16 H;  2OCE A;  1TWC H;  4FP5 D;  1A3T A;  5FLX E;  4JG2 A;  5H1S E;  2QW7 A;  4X62 L;  4XQN A;  5IGB A;  3F2U A;  3IFD A;  2HQE A;  5AFW A;  2MUY A;  1RL2 A;  2UUC L;  1V1P B;  1Q7Y C;  1FJG Q;  1QJO A;  4R4C A;  2RDF A;  5KYL A;  1QCB D;  1N36 Q;  4CBV A;  1MI2 A;  2IX1 A;  1VF5 C;  1VQF A;  1LAC A;  3M4O B;  3ERS X;  4PZ8 A;  4XQQ A;  2TSS A;  2WAQ G;  1KRT A;  3IRB A;  1JB7 A;  3NQI A;  3NBH A;  5KRU A;  1LTT D;  1EWH A;  3QJY A;  1C9O A;  1Q8I A;  2ZT9 C;  3CMA A;  3MFY A;  3F2B A;  3A54 A;  1UEB A;  2KED A;  5IE8 A;  3A8K E;  4Y7N B;  4DR3 Q;  2O5J C;  4KY7 A;  4A3K H;  1BCP B;  1IKL A;  2WB1 G;  4BY1 G;  2KUM A;  1HCZ A;  3OHX C;  5KGU A;  4YHH Q;  4ILW A;  4JI8 Q;  5DM7 3;  2KOL A;  5JPM C;  3KLS X;  2B63 B;  1I6H H;  3MWY W;  1EYC A;  3KDF B;  4PQX A;  1LT5 D;  2L55 A;  2JA7 B;  1G2T A;  1Y8N B;  4JPB W;  2XN9 C;  4BXX G;  2UUB Q;  4TRD A;  1G29 1;  2PO4 A;  2Z0S A;  4QB4 A;  1HNW L;  1LV9 A;  4DV0 L;  1D6E C;  1YJN A;  1I4H A;  4IFD G;  4LF6 L;  4HN7 A;  1F2Z A;  5JVG 3;  4A3E G;  1WTV A;  2A69 C;  4PMB A;  3UDG A;  1V8Q A;  2DY7 A;  3TS0 A;  4I7Z C;  3W5O A;  3J81 c;  3KOJ A;  5FO8 B;  4DNI A;  5LMU L;  2IW3 A;  3WDN A;  1F77 A;  2CWA A;  1WTR A;  5FO9 B;  2B2V A;  1K8O A;  4ULL A;  5JEA J;  1I94 L;  1JB3 A;  4BY1 H;  1HXY D;  1KL9 A;  4CDE C;  3I4O A;  3NPP A;  2ASB A;  2HQL A;  3TN2 A;  4DV4 L;  3ND9 A;  4TSS A;  3L2P A;  4LF9 Q;  3MXN B;  1Q3L A;  1TWH H;  1PRT D;  2QCP X;  4C3H G;  1ENC A;  3AU7 A;  3HKZ G;  4JVZ A;  4FF3 A;  1WFQ A;  3TDQ A;  1JMC A;  4BXX H;  2VQF Q;  1SYD A;  1SNQ A;  5ELE A;  3GTK B;  2C9O A;  2IWH A;  5IYD G;  2WKC A;  5D3D A;  3STB D;  5C0X G;  2EZV A;  4A3E H;  1XMQ L;  3GTP H;  1F2L A;  4ALP A;  3L7Z C;  2F0E A;  2RVL A;  1VQO A;  3G71 A;  3BZK A;  1K8M A;  1PH2 A;  1HHV A;  1EL0 A;  5C44 B;  1SRU A;  2B8G A;  2JA6 B;  4DR5 Q;  1XYI A;  2RCF A;  1CHP D;  2EIF A;  2R93 G;  2LXK A;  1X56 A;  2RA4 A;  4JOI A;  2HHH L;  1FVI A;  3PUX A;  3UI2 A;  5GRO A;  4G7H C;  1Q12 A;  3ULJ A;  1A3U A;  2LS0 1;  4FXG C;  2F3W A;  4NMZ A;  3CC2 A;  4CGY B;  3PV0 A;  2F4V Q;  4JI5 L;  1VQH A;  1H9J A;  2B2V C;  1IL8 A;  1CZG A;  3K5O A;  5E4W C;  3OOC A;  1Z6H A;  2JA5 B;  5IYD H;  4POF A;  1OXU A;  3I72 A;  1I5F A;  1EY7 A;  1BO0 A;  3H0G G;  4NB3 A;  4I7A A;  4RCN A;  3UDF A;  1Y1W B;  3UE1 A;  2Z8L A;  3RMH A;  4ZYS A;  3BYT B;  2R7Z G;  2EJG C;  5CYU A;  4AQY L;  3NBI A;  2E2H B;  1HZ9 A;  4HIK A;  4DV2 L;  1VQ6 A;  2HUG A;  1LTA D;  5CMD A;  4C3I G;  3A7A B;  4AIM A;  5KNC A;  2R93 H;  4CJ0 B;  3M3Y B;  3KLR A;  4P71 A;  2CH4 A;  3T1Y L;  2F0G A;  4NDX A;  1NE3 A;  5G3L F;  4EGV A;  3SK8 A;  2J4X A;  4JI4 L;  4GNX A;  4LF8 Q;  3PUZ A;  3UDI A;  2KHJ A;  1NAP A;  2N3S A;  4IPH A;  5IGE A;  4A3D G;  4KN7 C;  1FNV A;  1R4P B;  3KJO A;  4JOI C;  5M3F B;  1ASZ A;  4A93 B;  1MKH A;  3S17 B;  1PTO F;  1EY5 A;  3CHB D;  4HJ8 A;  1C0A A;  3A8J E;  2UXB L;  1JQY D;  1YNJ D;  1O7L A;  3H0G H;  4C1N K;  1AN8 A;  2AHO B;  2HCC A;  4RKL A;  4LNQ A;  4Y52 H;  2NVT B;  1DYQ A;  3EJI A;  4XYQ A;  3H3V I;  3K58 A;  1ASY A;  5L37 A;  4DK3 C;  4ZQ3 A;  1GXD C;  2NBF A;  4HJ9 A;  1IBM L;  3SHL A;  2R7Z H;  1N32 L;  4JBK A;  3H3V C;  2F0W A;  2EYL A;  2R92 G;  3HOX G;  1RCV D;  1BCP D;  3R93 A;  3TZU A;  4B3T Q;  1DOL A;  1BXT A;  3CME A;  4C3I H;  4DR1 L;  1P8L A;  2JSO A;  1B53 A;  2D2C C;  2HIV A;  1Z47 A;  4LF5 L;  1I3Q H;  5GAD C;  5EKI A;  3TP6 A;  1EY8 A;  5LMN Q;  1BR9 A;  2F52 A;  4Z9C B;  5FLX c;  3A7L A;  4Q5V A;  5EPK A;  4A3D H;  1O7I A;  2LMC B;  1PH3 A;  4JI3 Q;  1FR3 A;  1OXS C;  2ZXR A;  4NP5 A;  3MAQ A;  2D9U A;  4RH6 A;  5JJZ A;  3K57 A;  1TU2 B;  2O4X A;  3I4N G;  4KN4 C;  1S5D D;  1PHJ A;  2R92 H;  2NVX B;  1TR5 A;  3HOX H;  3LWE A;  4XQJ A;  3D4W A;  3ND8 A;  2ATW A;  4JI0 Q;  3GTJ H;  1Q1B A;  3S1N B;  2ZM6 L;  3K5L A;  3RN5 A;  2PZT A;  4A3M B;  2NWG A;  3PMF A;  4GN3 B;  4JBM A;  2B29 A;  2L9H A;  2EYO A;  3C1E A;  4UDU C;  4JI1 Q;  5I9O A;  1FYC A;  2F0V A;  5A2Q L;  3HOY G;  2K7V A;  1Z9F A;  1GUW A;  1VMP A;  2V4D A;  5LL6 X;  3GTM B;  2NZO A;  1PH6 A;  2CW0 C;  3KBX A;  4RGM A;  4B08 A;  1W2B A;  1PFM A;  2PZU A;  1DZ1 A;  1IXR A;  1JWU D;  3NWT A;  4HED A;  1WTO A;  1PH7 A;  2OEO A;  3I4N H;  3ZJY C;  1S5E D;  3NTK A;  4X3S A;  2X6G A;  4DV3 L;  4B3M Q;  2UUA Q;  1NSN S;  3HOZ B;  4HMI A;  4B3S L;  3STB C;  1VQ9 A;  4XT1 B;  3DMU A;  2IX0 A;  1NUC A;  4GOP A;  2KBN A;  4ZLT F;  4KLK A;  2QGQ A;  4ME5 A;  5M5W H;  1GJX A;  2F0P A;  2Z6B A;  4I65 A;  4OL7 A;  1UE1 A;  5EPJ A;  4F8M A;  2AWO A;  3U4V A;  1V1P A;  1RKN A;  1HZC A;  1A62 A;  3L9A X;  2Z6K A;  4DR7 L;  4GKJ L;  3DLL A;  1D5X C;  2WV6 D;  5BN4 A;  3HOY H;  1L1O C;  2YTX A;  3EVQ A;  5GAE C;  2OTL A;  4JI6 Q;  2RHS B;  5IGC A;  5FO7 B;  3EBE A;  4RAU C;  1B3A A;  5IIF A;  1CA6 A;  3Q0A A;  1CQV A;  2VUM B; 
#chains in the Genus database with same CATH homology
 1ENF A;  4BBS B;  1LLR D;  2NN6 H;  5T1I A;  4EQO A;  1TWF B;  3I70 A;  1SFO B;  2JP1 A;  3SR1 A;  3ONA B;  1I50 B;  3SE0 A;  1STE A;  1LT3 D;  2A6H D;  1QG7 A;  3MXU A;  2A73 B;  4N9T A;  2AUK A;  3GTQ B;  2XWJ B;  1AP0 A;  1I4G A;  1NCV A;  5IGF A;  5NUC A;  3S1R B;  3Q23 A;  2E75 C;  4DN4 M;  1YNJ C;  1D5M C;  4EVO A;  1LTR D;  5KNB A;  1ML0 D;  3DWP A;  1KLG D;  3O13 A;  1K83 B;  2BE5 C;  1UNS A;  1ZYR D;  1BCP C;  2A6E D;  1D1K A;  5C5M A;  5JPN C;  3V96 A;  1OXV A;  1AFP A;  1Y1V B;  2RSN A;  2B2Y C;  1IHZ A;  3T53 B;  4PNY A;  2EY5 A;  4J8Q A;  3MHB A;  3H91 A;  4IN3 A;  4KTA A;  1PLF A;  3DEP A;  3S1M B;  5CV4 A;  3DEO A;  1B44 D;  2HDL A;  1HFN A;  3VR6 A;  2XWB B;  5CV8 A;  1GUT A;  1WVL A;  1OXX K;  3FDT A;  1E2W A;  3OMC A;  2MHV A;  3FKI B;  3BVG A;  1C4Q A;  2SEB D;  1PYW D;  1Y8O B;  3K5M A;  2XIW A;  2RDH A;  1PRT B;  1A3V A;  2XRQ D;  5A2Q E;  3S2H B;  1HQR D;  2D5D A;  4DA2 A;  1B4O A;  1KLU D;  4KK7 A;  3JAM E;  3P75 A;  4KY6 A;  3FPP A;  1SNC A;  1HPC A;  3NP8 A;  3OWE B;  4IZ8 A;  1PZJ D;  1TS5 A;  5C5L A;  2IPK D;  4FF1 A;  4HMJ A;  4JBW A;  2F0S A;  4WRD A;  1EQV A;  4PMC A;  4MIU A;  5D65 A;  2EYP A;  3Q22 A;  3CU7 A;  2KEE A;  3X3N A;  5J22 A;  5JVH 3;  1BUV T;  4DAV A;  1TS3 A;  3DWQ A;  1F9S A;  2F0F A;  4IUQ A;  1TWC B;  2ICE C;  1EY9 A;  4X3K A;  1O7Z A;  1H9R A;  2FHT A;  2R61 A;  3ZYY X;  1EEF D;  1EY4 A;  4IQZ A;  3RD4 A;  4C3J B;  3ERO A;  4B9W A;  4YIJ A;  2DNC A;  1A2U A;  2BDO A;  2E2D C;  2X69 A;  2PMZ B;  1EWC A;  1MGS A;  3I3C A;  2SNS A;  2LY7 A;  5M5X B;  1HUN A;  4LJZ C;  2F0L A;  1SYG A;  3GD7 A;  1G6Z A;  4RA8 A;  3TME A;  1T5E A;  3HS0 C;  4RGN A;  2FMM A;  3D31 A;  4CKE A;  5I6W A;  4OHJ A;  3GTL B;  2K28 A;  4EQP A;  5I6Y A;  5CV7 A;  1SXT A;  4UAI A;  4BS9 A;  3D4R A;  1TKW B;  1EZ6 A;  5ELD A;  3TP5 A;  1TQO A;  3MXP A;  1VDZ A;  5EBD A;  4RKB A;  2KVM A;  4KD4 A;  3NWS A;  1ZYR C;  1EIG A;  4H44 C;  2A74 C;  4F88 A;  1HRJ A;  3GTP B;  4X3U A;  1JOK A;  1RJT A;  4HSP A;  5D3I B;  3NK9 A;  2L1B A;  2WAC A;  1BNZ A;  5KIX A;  2CHB D;  4A3F B;  1A15 A;  4DNT B;  4ZUJ A;  1MD2 D;  2KJX A;  5JOB A;  1X3P A;  4O1N A;  4DK1 A;  4IFD H;  4K5X A;  2FJ2 A;  3R3O A;  5C3W A;  4ZRZ A;  4F7X A;  1SMY D;  3HKZ B;  4RHR A;  2G9H D;  5CR3 A;  4G4K A;  2IT1 A;  3T16 A;  1CA5 A;  1II3 A;  3N52 A;  3OSO A;  1I4Q A;  1EY0 A;  2K5Q A;  3HOV B;  4G57 A;  4OO1 G;  1QB5 D;  1PFN A;  4U68 A;  1QOH A;  3VYS A;  5F2D A;  2R93 B;  2VB2 X;  3Q6S A;  4RGT A;  1DOM A;  3SK4 A;  4HTH A;  2E76 C;  1E0B A;  2O5I C;  3PUV A;  3IL8 A;  1JC7 A;  2I46 A;  1EYD A;  2AQ1 B;  3VA7 A;  5C0X H;  3FMC A;  1ESR A;  1MSG A;  2K04 A;  5EGT A;  3SK5 A;  1BOS A;  1PZK D;  4QIW B;  5ELB A;  3QG1 A;  3BVZ A;  5LHY 1;  2AQ2 B;  3KF8 A;  1R4Q B;  4OO1 H;  4XTC S;  2F3V A;  1SBB B;  1EYA A;  1SND A;  1SE2 A;  4NKL A;  3MEH A;  1JOQ A;  3BDC A;  5I9P A;  1U4L A;  2B39 A;  1PTO B;  1SJH D;  4XDX A;  2F0N A;  4A3D B;  3J7A V;  4PV1 C;  3TBI B;  1IYU A;  4IUV A;  1WTQ A;  2MGS A;  2LKV A;  1I4X A;  2IJ0 A;  3VYT A;  1J9O A;  1VCI A;  4QF4 A;  5A35 A;  4GZY C;  4FXK C;  2PPB C;  3FVQ A;  4XXE A;  2PNR C;  4R9W A;  2A68 D;  1L0Y B;  1U4P A;  2ICI A;  1XX8 A;  1B9M A;  4X3T A;  5ISR A;  4V0B A;  3D6W A;  4MHE A;  5FOB B;  5M5Y B;  3C46 A;  4FO2 A;  4BBR B;  3OPO A;  1EY6 A;  3I4M B;  1B9N A;  2F0M A;  2EE1 A;  3PIP 3;  2RSO A;  5EBC A;  2G9D A;  1BQQ T;  3PO2 B;  3J7A F;  5M3M B;  3QWN A;  2WIN B;  1SSO A;  3Q24 A;  4WJW A;  1CZW A;  4XYO A;  3GP7 A;  2M2L A;  3BYY B;  1WTP A;  3GV3 A;  2Q8T A;  3WOE A;  1W6J A;  2Q8R E;  3GQB A;  4JK1 C;  4ABN A;  3HOW B;  5ELF A;  3TP7 A;  4CJ2 C;  4IUN A;  2SNM A;  3PUW A;  3VR3 A;  2B8F A;  4N9P A;  1A6X A;  1HTL D;  3I91 A;  2KCN A;  4ODG A;  5C4Z A;  4K6D A;  2I07 B;  2QF7 A;  5M5W B;  1GUN A;  1TII D;  3OIQ A;  3M4Y A;  3JAM L;  2IL8 A;  4L63 B;  1LTS D;  3MXG A;  1PRT C;  5J1Z A;  4BWG B;  3S14 B;  2FMC A;  3PUY A;  1SEB D;  4F87 A;  1EU4 A;  2EJM A;  2XVS A;  1SJE D;  1JWM D;  4FNF A;  4LAA A;  3H09 A;  4ZK9 B;  4O42 A;  3M7N A;  5E3F A;  4RCO A;  4CKC A;  1FD7 D;  4A3J B;  2BDN A;  3SK6 A;  1SYC A;  2H4O A;  3R8B A;  4L6T B;  3VA5 A;  2F0T A;  2EYF A;  2K32 A;  3A56 A;  3NE5 B;  1OO9 B;  3BZD B;  3T13 A;  3DWA A;  1JE4 A;  2LFN A;  1ZKO A;  2Z4H A;  2SOB A;  2E74 C;  3P1H A;  1ZEQ X;  4J1M A;  5DAU A;  1STY A;  1ENA A;  1NR2 A;  2CQA A;  3I8Z A;  1LO5 D;  3SEB A;  5JEA G;  2NVY B;  4QCL A;  1FGB D;  3D8G A;  3IKJ A;  5G3L D;  2NVQ B;  1G91 A;  5E1F A;  3OW7 A;  1X3Q A;  4DNR B;  1KAA A;  1PTO D;  5C3E B;  3KLS A;  1DCZ A;  3HGB A;  1S5B D;  1M4V A;  3GTG B;  3S9W A;  4C56 C;  5KND A;  2HCI A;  2FFK B;  2E2I B;  1B2T A;  2Z4I A;  1D2B A;  1UEA B;  1JOR A;  3HG9 A;  4OGQ C;  1F2M A;  4K6L A;  1EFI D;  3S1Q B;  3NTI A;  4H13 C;  1F9P A;  2EJF C;  2F0D A;  1UAP A;  2EXZ A;  3HEJ A;  5ELC A;  1NR4 A;  2K03 A;  4DGZ A;  1G2S A;  5JEA H;  5COR A;  1AW7 A;  4P2C B;  2VB3 X;  4XT3 B;  2PYK A;  5KYI A;  1F9Q A;  1Z7T A;  3K0Y A;  1SAP A;  4U67 3;  4DU9 A;  4RHS A;  2A68 C;  3VYR A;  4K8I A;  3C1F A;  1Q90 A;  3KK7 A;  4KY5 A;  1WD0 A;  2CVR A;  3W3A A;  1AEX A;  3HRZ C;  4QUF A;  4DXF A;  1QWY A;  4DFA A;  3OMG A;  3TP8 A;  1YNN D;  4QMG A;  4G7O C;  1EEI D;  4H0L C;  3SDZ A;  2EYJ A;  3VR5 A;  1TS2 A;  3PO3 B;  1Y69 U;  1DJR D;  1PRT F;  4KKT A;  4E6I A;  3V05 A;  1JIC A;  4KD3 A;  1D5Z C;  4PMW A;  3MVV A;  4J6H A;  1AZQ A;  1I4P A;  5J39 A;  1WTX A;  3LX0 A;  3IFT A;  1LT6 D;  2NTS A;  5IGD A;  3QB3 A;  5COY A;  1MSH A;  5CV6 A;  5I2X A;  1IKM A;  3SVM A;  1JOO A;  3N6R A;  2PCF B;  1H9S B;  5E4X A;  1JWS D;  3S16 B;  2XRS D;  5I4D A;  1HA5 A;  1LT4 D;  1XTC D;  1TS4 A;  1M8A A;  1HTP A;  3H6M A;  2ENB A;  4ID6 A;  4S3S A;  3CRK C;  4DAY A;  3QOL A;  4RWS C;  1W6K A;  5EPL A;  2KQ3 A;  2L12 A;  1RTN A;  4RGO S;  4C3J G;  3M85 A;  1XXG A;  1STB A;  3EA6 A;  2R6G A;  2DN8 A;  2RDG A;  4A3K B;  1VF7 A;  4EQN A;  4M8A A;  3QOJ A;  1RTO A;  2Y0S B;  2RQX A;  1I6H B;  1LTG D;  1RD9 D;  3CRL C;  2H1E A;  5FKA C;  1EZ8 A;  2BA1 A;  3D4D A;  5K5P A;  2F0K A;  1EIH A;  2EDG A;  4TKO B;  5IOC A;  3BS1 A;  4FVM A;  4DK0 A;  3SXH A;  2MP1 A;  4B9X A;  1PTO C;  2WAQ B;  1B1Z A;  2R3Z A;  2F0H A;  2OXP A;  2QEJ C;  2A6H C;  3D3R A;  5TSS A;  1I4R A;  2EY2 A;  2JEA I;  3RZO B;  1BCP F;  4FXD A;  2L11 A;  2WB1 B;  4BY1 B;  1CK1 A;  2BOS A;  2A5H A;  1ZXT A;  4HSV A;  4CKB A;  2BCO A;  3RZD B;  3K6O A;  3PIO 3;  1TWH B;  2OT2 A;  3I4L A;  3MA2 B;  5T1G A;  5D14 A;  5C4X B;  4ZKB B;  2KHS A;  3L3O C;  2A6E C;  1EQT A;  4H7B A;  2M9V A;  1DOK A;  4A3E B;  4V19 0;  3QIA A;  3OIP A;  2N55 A;  2O2L D;  1CI3 M;  2F0U A;  1BF4 A;  1CHQ D;  4NW2 A;  1FNU A;  4A3G B;  2KCC A;  1U4R A;  1ESF A;  5C4H A;  1IW7 D;  1KNA A;  3ERQ A;  1J8I A;  4HAE A;  2RKS A;  2K33 A;  2ZXO A;  5CV9 A;  1YNN C;  2CW0 D;  4C3H B;  1QE6 A;  2NZ1 D;  4K5V A;  1S5C D;  1D1I A;  1GHJ A;  2X6L A;  4ZUI A;  2XNA C;  1WTW A;  3BDL A;  1DXM A;  4IUP A;  4KHV A;  5FK9 C;  3HZX A;  5HGT A;  1WCM B;  1KDA A;  1T5X D;  3W2D A;  3RLF A;  2B2T A;  1ICW A;  5IT9 L;  4KHZ A;  3IAY A;  1CTM A;  2NTT A;  4KMU C;  2DY8 A;  2XSC A;  4Q0F A;  1G8Z D;  5EJW A;  2AUJ D;  2K05 A;  3P7J A;  3GO5 A;  1KNE A;  2NN6 I;  2PW7 A;  4HCS A;  3H0G B;  5JAV A;  2JEB I;  5M9O A;  1GUG A;  4KKU A;  2NUC A;  5C4J B;  2R7Z B;  3WOF A;  5CGK A;  4LMQ D;  3P20 A;  5CBE E;  1SYB A;  1F2Y A;  1EU3 A;  4XIG S;  4DAP A;  1QNK A;  4C3I B;  1I3Q B;  1PZI D;  2Z1C A;  3ITP A;  4C1N I;  2B2T C;  1V43 A;  4R8N A;  4AYB B;  3TZD A;  3X3M A;  3FRP B;  1LAB A;  2JXM B;  2EY6 A;  1UUP A;  1STG A;  2F0Q A;  4DXG A;  1LTI D;  3MFG A;  2F1M A;  1HQM C;  1KAB A;  4OIK A;  2HDM A;  2M00 A;  2B2W A;  2JYO A;  4BA2 I;  4CHT B;  2R92 B;  3HOX B;  3J80 L;  3MZ5 A;  4IUR A;  2BE5 D;  3J81 L;  1JCK B;  1STH A;  3GTJ B;  2EPB A;  2WII B;  4IAL A;  5LL6 S;  3U9S A;  1SE4 A;  4KV6 A;  3T4A C;  1HFG A;  1TT2 A;  1PTO H;  1S4Z A;  2EYM A;  2AWN A;  4ZKC B;  2K5W A;  2L4N A;  4BY7 B;  1BBX C;  1SNP A;  1GUS A;  2VXW A;  1SNO A;  2NYZ D;  3DHQ A;  1QNU A;  3KUP A;  1AZP A;  3I4N B;  1EOT A;  4BA1 I;  4MN3 A;  1SE3 A;  1FNW A;  1Q1E A;  4A3B B;  3URY A;  2B2W C;  1H9S A;  2PW5 A;  1H9M A;  3U9O A;  1CQF A;  3DM1 A;  2F0J A;  2F4I A;  2K6A A;  3K7A B;  2VNU D;  1RF2 D;  1HA6 A;  3EQL C;  3BVM A;  1IW7 C;  3HOY B;  2DNE A;  2PZW A;  3VYU A;  5HUR A;  1SDF A;  3DUZ A;  2F0I A;  4K8J A;  5IGG A;  1SMY C;  1U4M A;  4KI0 A;  5IT9 E;  3CKI B;  1KDB A;  4KJN A;  2K01 A;  1STN A;  3NSW A;  2B2U A;  2K5D A;  4IUT A;  1Y8P B;  4LK1 C;  3NTH A;  3EFX D;  3R2I A;  1E2V A;  2F0O A;  2NN6 G;  3E0J A;  1S5F D;  2GA4 B;  3LNN A;  1KDC A;  4IFD J;  2ID0 A;  5IOD A;  1X32 A;  2ZXP A;  4KJO A;  1V1O A;  4ZAI A;  1TVX A;  1C8C A;  1ONL A;  3S2D B;  3AB9 A;  4DF7 A;  1DD2 A;  4K5W A;  3HOU B;  2JE6 I;  5DEH A;  1TWA B;  2B2U C;  2B2Y A;  3TSS A;  2SDF A;  5BN5 A;  3H94 A;  3NHH A;  4IUU A;  1GHK A;  5FLX L;  1ILP A;  2YYZ A;  4FYD A;  3K5N A;  3I73 A;  3AMU A;  5C0X J;  1TY2 A;  3OWF A;  4WFN 3;  3T51 B;  3KBG A;  5DNF A;  2EVB A;  1U9R A;  3CQZ B;  2BA0 A;  5CC4 A;  1A2T A;  3J80 E;  3J7Y W;  1ROD A;  3J81 E;  2EYH A;  2K1B A;  2MJ8 A;  3C3L A;  2J7Z A;  1I6V C;  2L0C A;  1F9R A;  1IYV A;  4L8J A;  4FF2 A;  2YU9 B;  2Q8I B;  5BN3 A;  2KEC A;  1DON A;  2EY1 A;  2MPM A;  4HR7 B;  3DXJ C;  2A69 D;  1O80 A;  1QIL A;  2F03 A;  5I2Y A;  1SNM A;  3MXN A;  1OXT A;  3LWU A;  5EQ0 A;  3FPU B;  3E6Z X;  2NB0 A;  1KTK A;  3R2T A;  2L5T A;  1ET9 A;  3FEW X;  3M7G A;  1TWG B;  4G7Z C;  1CFM A;  3I90 A;  4IFD I;  1ET6 A;  1VMC A;  4KKS A;  5K36 G;  3GV6 A;  4HCE A;  5C6A A;  2QDB A;  2C5C A;  2QKI C;  3MC0 B;  4A3I B;  1JR0 D;  1B50 A;  1HUM A;  4RFB A;  2WKD A;  4OIJ A;  1TY0 A;  1RDP D;  1GUO A;  3BDO A;  5CBA E;  4K2L A;  3QO2 A;  1PFB A;  3BG3 A;  3K59 A;  2D62 A;  2PQE A;  2E2J B;  3G6J B;  4FF4 A;  1O78 A;  1SYF A;  1PMR A;  3RUZ A;  4K14 A;  4M1U B;  3A55 A;  1BDO A;  1LTB D;  4K2K A;  5C0X I;  1R9T B;  1O7Y A;  1H9K A;  1E2Z A;  3E5S A;  5K36 H;  3C2P A;  2TMP A;  1CM9 A;  1WD1 A;  2KA7 A;  4C2M B;  3VR2 A;  1MBY A;  4WOR A;  2FIN B;  1GOZ A;  3MTS A;  1C48 A;  1DM0 B;  1STA A;  2AQ3 B;  3S15 B;  1L0X B;  4TQU S;  2QIL A;  4OO1 I;  3NXW A;  3G7L A;  5C3X A;  1PXU A;  4CJ1 B;  5EKL A;  1SYE A;  1ILQ A;  5CV5 A;  2RBM A;  2J0T D;  5DM6 3;  3D6C A;  4R8I A;  2OF1 A;  3NUC A;  3HP3 A;  3T56 B;  5EKK A;  3VR4 A;  1CT1 D;  5KEE A;  3NQT A;  1XWE A;  3GTO B;  2JA8 B;  3V2T A;  1RHP A;  2WP8 J;  3A8I E;  4QUC A;  1PDQ A;  2EOT A;  2N88 A;  2IX3 A;  4FP5 D;  1A3T A;  5FLX E;  4XQN A;  5IGB A;  3F2U A;  3IFD A;  2HQE A;  5AFW A;  2MUY A;  1V1P B;  1QJO A;  2RDF A;  5KYL A;  1QCB D;  4CBV A;  1MI2 A;  2IX1 A;  1VF5 C;  1LAC A;  3M4O B;  4XQQ A;  2TSS A;  3NQI A;  3NBH A;  5KRU A;  1LTT D;  1EWH A;  3QJY A;  1Q8I A;  2ZT9 C;  3MFY A;  3A54 A;  2KED A;  3A8K E;  4Y7N B;  2O5J C;  4KY7 A;  1BCP B;  1IKL A;  2KUM A;  1HCZ A;  3OHX C;  5KGU A;  4ILW A;  5DM7 3;  2KOL A;  5JPM C;  3KLS X;  2B63 B;  3MWY W;  1EYC A;  4PQX A;  1LT5 D;  2L55 A;  2JA7 B;  1G2T A;  1Y8N B;  2XN9 C;  4TRD A;  1G29 1;  2PO4 A;  4QB4 A;  1LV9 A;  1D6E C;  1I4H A;  4IFD G;  4HN7 A;  1F2Z A;  5JVG 3;  1WTV A;  2A69 C;  4PMB A;  1V8Q A;  2DY7 A;  4I7Z C;  5FO8 B;  2IW3 A;  3WDN A;  1F77 A;  1WTR A;  5FO9 B;  2B2V A;  1K8O A;  4ULL A;  5JEA J;  1JB3 A;  1HXY D;  3NPP A;  3TN2 A;  3ND9 A;  4TSS A;  1Q3L A;  1PRT D;  2QCP X;  4C3H G;  1ENC A;  3AU7 A;  4FF3 A;  3TDQ A;  1SYD A;  1SNQ A;  5ELE A;  3GTK B;  2C9O A;  2IWH A;  2WKC A;  5D3D A;  5C0X G;  2EZV A;  1F2L A;  3L7Z C;  2F0E A;  2RVL A;  1K8M A;  1HHV A;  1EL0 A;  5C44 B;  2B8G A;  2JA6 B;  1XYI A;  1CHP D;  2RA4 A;  3PUX A;  3UI2 A;  4G7H C;  1Q12 A;  1A3U A;  2LS0 1;  4FXG C;  2F3W A;  4NMZ A;  4CGY B;  3PV0 A;  1H9J A;  2B2V C;  1IL8 A;  1CZG A;  3K5O A;  5E4W C;  3OOC A;  1Z6H A;  2JA5 B;  1OXU A;  3I72 A;  1EY7 A;  1BO0 A;  4RCN A;  1Y1W B;  2Z8L A;  3RMH A;  4ZYS A;  3BYT B;  2EJG C;  5CYU A;  3NBI A;  2E2H B;  2HUG A;  1LTA D;  5CMD A;  4C3I G;  3A7A B;  5KNC A;  4CJ0 B;  3M3Y B;  3KLR A;  2F0G A;  4NDX A;  5G3L F;  4EGV A;  3SK8 A;  2J4X A;  3PUZ A;  1NAP A;  5IGE A;  4KN7 C;  1FNV A;  1R4P B;  5M3F B;  4A93 B;  3S17 B;  1PTO F;  1EY5 A;  3CHB D;  3A8J E;  1JQY D;  1YNJ D;  1O7L A;  4C1N K;  1AN8 A;  4RKL A;  2HCC A;  2NVT B;  1DYQ A;  3EJI A;  4XYQ A;  3K58 A;  4ZQ3 A;  1GXD C;  2NBF A;  3SHL A;  3H3V C;  2F0W A;  2EYL A;  1RCV D;  1BCP D;  3R93 A;  3TZU A;  1DOL A;  1BXT A;  2JSO A;  1B53 A;  2D2C C;  1Z47 A;  5EKI A;  3TP6 A;  1EY8 A;  1BR9 A;  4Z9C B;  3A7L A;  4Q5V A;  5EPK A;  2LMC B;  1FR3 A;  1OXS C;  2ZXR A;  4NP5 A;  3MAQ A;  2D9U A;  4RH6 A;  5JJZ A;  3K57 A;  1TU2 B;  2O4X A;  4KN4 C;  1S5D D;  2NVX B;  1TR5 A;  3LWE A;  4XQJ A;  3D4W A;  3ND8 A;  1Q1B A;  3S1N B;  3K5L A;  2PZT A;  4A3M B;  2NWG A;  3PMF A;  2L9H A;  2EYO A;  3C1E A;  4UDU C;  5I9O A;  1FYC A;  2F0V A;  5A2Q L;  1GUW A;  2K7V A;  1VMP A;  2V4D A;  5LL6 X;  3GTM B;  2CW0 C;  3KBX A;  4RGM A;  4B08 A;  1PFM A;  2PZU A;  1DZ1 A;  1JWU D;  3NWT A;  4HED A;  1WTO A;  2OEO A;  1S5E D;  3NTK A;  4X3S A;  2X6G A;  3HOZ B;  1NSN S;  4HMI A;  4XT1 B;  3DMU A;  2IX0 A;  1NUC A;  4ZLT F;  4ME5 A;  1GJX A;  2F0P A;  4I65 A;  4OL7 A;  5EPJ A;  4F8M A;  2AWO A;  1V1P A;  1RKN A;  3L9A X;  1D5X C;  2WV6 D;  5BN4 A;  3EVQ A;  5IGC A;  5FO7 B;  4RAU C;  1B3A A;  5IIF A;  1CA6 A;  3Q0A A;  1CQV A;  2VUM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...