3K7AH

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k7aH00
5HGQA 1R9TH 2UXDQ 2R7FA 3G48A 5M5YH 3S15H 4GOPC 4A3LG 1KRTA 4DAMA 4DV3Q 1NMFA 1XTDA 4LWCA 2YU9H 1XNQQ 4DR4Q 4JV5Q 4A93G 4DKAC 1C0AA 2WAQG 3B6YA 1KHIA 3PGZA 1IBLQ 3ER0A 2NVXH 4LF4Q 1AH9A 5GQOA 4PZ6A 5FJ8H 3M4OH 2OTJA 1RIPA 1PH2A 3GTPH 2KCTA 3G71A 5LMNW 1EQQA 2BA1A 4K0KQ 1X3EA 1VQDA 4DPGA 2KBNA 4DR3L 4JI8Q 2ES2A 3T1HL 4GN4B 4NXNQ 1PH4A 4QY7A 4R4IA 4X62Q 4Y7NH 2VQEL 4POGA 3PO2G 3H0GH 2CWAA 3K7AH 3CCVA 1UE7A 2LXKA 2B3GA 4HJ5A 2UU9L 4JI1Q 1NJIC 2E2JH 1QUQA 1VCIA 3GTGH 1IBKQ 3GTLH 2HHHL 3HFZB 4YCUA 1L2FA 4X66Q 5C4XH 3A5ZB 3UE0A 1Y1VH 4DAYB 1HZCA 3CMEA 4JI6L 3L7ZC 4GLXA 4IPGA 3KF6A 1XNRL 1CSPA 1VQJA 4C3IH 4A3KH 3E9HA 3I55A 5IY0A 5GADC 1CKOA 1EFWA 3BZCA 1OXVA 3IRBA 4GLAC 4OONA 5M3MG 4HIDA 3FKIH 2AWNA 2WP8J 1XNQL 4DR4L 4JV5L 3F2CA 4HIOA 4OX9L 2A8VA 2NVQH 1JJGA 2UXCL 2Q2TA 1VQKA 4B3TL 3I4MH 3PO3G 3L2PA 2JA6H 5M5XH 3PV0A 2H5XA 2MO1A 4L5QA 3CC2A 2L15A 2R92G 3KF8B 1VQ8A 5K36G 2Q2IA 3RLOA 5AJ3Q 4LFCQ 2OWOA 1TWAH 3RLFA 1IZ6A 1D8LA 4HJ8A 4A3CG 3KOJA 1IYJB 3NBHB 3D31A 2JA5H 5FLXc 3M85A 3ULJA 3ZJYC 1NY4A 4GKJL 4R4OA 2GVBA 2Y0SE 1YJWA 3HOXG 2ASBA 4LF5Q 4YWLA 3K81C 4JI1L 3UDXA 5IP9G 4DR5Q 3S16H 4TQUS 1S72A 4NPSA 4A3DH 3KJOA 4C3HH 4QL5A 2Z6KC 2ZM6Q 4L5RC 4ME3A 4JI0Q 4BBSG 3I7FA 1NMGA 3GDEA 5ELNA 1HR0Q 4UPAA 2KHIA 4A3FG 1QVGA 1WJJA 1TWHH 3TRZA 1VQFA 2NZOA 1IBKL 3CC4A 1PVOA 4JI2L 3HOZG 1L1OA 1X65A 3I4NG 3EBEA 2JJQA 1V1QA 4BY7H 1VQBA 3MEFA 4KLKA 3J7A5 4MTNA 4UP7A 1SN8A 1E1OA 1VQPA 3UE1A 1N36Q 1Q1BA 2EQSA 1N36L 1GO3E 1RL2A 3T1YL 2CFMA 4R1JA 2VQEQ 1PH7A 5JJKA 4GNXB 5LMNQ 1N34Q 1JJ2A 1X3FA 2JA9A 3CCJA 3E9IA 4A3BG 4LFBQ 1SMXA 1IL2A 1JMCA 1UE5A 2OTLA 3H3VI 1SFOH 4BBRH 3TREA 2IX0A 1HZ9A 1YHQA 2C35B 5C0XG 4HIKA 5C3EG 3J81i 3OTOQ 4A3IH 2PI2E 1YNXA 4HIMA 4IJHA 4GN5A 5JJLA 3STBC 1Q46A 1LM0A 3HOXH 1A63A 3H0GG 4DV3L 1VQIA 4DK6C 1JJCB 4AQYQ 4GNXA 4BXXH 4C2MH 4GKJQ 2K4KA 2BH2A 2JA5G 4A3DG 4OO1I 5IYCG 1PYSB 1YJNA 1XMQQ 1HNZL 1QVCA 1FL0A 2E2IH 3AYHB 1BBWA 3J80i 4BBRG 1W2BA 2ID0A 2ZJQA 4B3RQ 2RHQB 4IO9A 5JEAG 1L1OB 2GN5A 1Y1WH 3HOVH 4X64Q 2D0OA 4DV1Q 1G291 1VQ6A 2IHEA 1YEZA 2JE6I 2ZTDA 1YI2A 2AMCB 3GTJH 4GNXC 3T1HQ 2NVTH 4BA1I 1O7IA 2PQAB 2JQOA 4JI5Q 2IX1A 4JC0A 5C0XJ 2YV5A 1TWGH 4B3RL 2VY3A 5GAEC 1NTGA 4P72A 2R6GA 4XIGS 2AHOB 2AKWB 1M1KC 1MJEA 1C9OA 1XPOA 2F3IA 3HOVG 5JJIA 3LGJA 2EIFA 2E5LQ 2N3SA 1Y14B 2ZJPA 3JAMi 1B7YB 4UP9A 4X65L 2K52A 3RR5A 2QA4A 1N9WA 5FLMH 4DV6L 5C44H 3PUVA 4H02A 4NXML 2UXCQ 4JI3L 2JA8H 1P16A 1EWIA 5IYBH 4EX5A 4DUYQ 1S3OA 5JEAJ 1XPUA 1Y1VG 4O2DA 3S17H 5C4XG 1PFSA 2K5NA 4GLVB 5IWAL 2CCZA 4GOPA 3S1NH 5IWAQ 3K8AA 4YY3Q 3PUZA 1QZHA 2UUAQ 4BXXG 4GKKQ 1UWVA 4KHPQ 5E7NA 1N33Q 3HOWG 1E22A 5IYBG 3UDIA 2MFIA 3KLWA 1FVIA 2CWPA 4QGUA 2K5VA 2KENA 3GTQH 2R93H 4QJFA 2R92H 5M5WH 1G6PA 2QGQA 1FJGL 4YWMA 1X54A 5FLMG 4LF8Q 3NEMA 4FDBA 1H95A 4JYAL 3PO3H 3ERSX 3A74A 4X62L 2UUBL 1KD1C 1A8VA 3DM3A 4LF7L 3U50C 4B3SL 4B3MQ 1NE3A 4BY7G 1PH9A 2IY5B 3F2DA 1QUQB 1TWCH 4DR1L 4DR5L 2HIXA 2ALYB 5HY6A 1YVCA 3W1BA 1E7ZA 3RN2A 1Q86C 1BVSA 2DUDA 4A3KG 5IYDH 1IBML 3A0JA 2Q2HA 3RNUA 2IHFA 3WWVA 3U4VA 4OWWB 1AE3A 3FKIG 3HOYG 1IXRA 1KC8C 4LF5L 3FP9A 1K9MC 3HOUG 4UP8A 3JC66 4AYBG 3GTOH 4DV0Q 4JI7L 3JAMc 3CCQA 4A3MH 4P73A 1VQ9A 1V43A 4OO1G 4JOIC 1BKBA 3GD7A 4BBSH 4DV1L 5M3FG 4R4QA 5IP7G 3MXNB 2IT1A 2HQLA 1LUZA 2PI2A 1WCMH 4JI5L 5LMUQ 1K73C 1CKMA 4GS3A 4IPDA 4XTCS 1N8RC 4LNQA 5IYCH 1AE2A 1Q12A 4BA2I 3PUYA 3S1QH 3AFQA 4DR2Q 3RLNA 2VL6A 4JG2A 1HH2P 4JOIA 5IP7H 4A3GH 4X65Q 4QIWE 4HJAA 4A4IA 1UE6A 4LF7Q 4IJLA 2HT1A 2VQFL 4A3BH 2VS1A 1XJVA 1VQGA 1MKHA 4BY1G 1XNRQ 1B70B 1TXYA 4DR1Q 2CQOA 2ZTCA 4GOPB 1VQ4A 1K8GA 1IBMQ 4A93H 1XMOQ 2QEXA 4KI0A 3J81c 3H3VH 3BJUA 4C3JH 5IYDG 3PO2H 1Z9FA 2HIVA 2MQHA 1JB7A 3UDGA 2JA8G 2OQ0A 2K14A 4PMWA 4JI8L 2UUAL 2VUMH 3KYHC 2OCEA 4A3GG 4YWKA 4A75A 4JCVE 4DR6L 2N78A 1HR0W 1K8AC 1SRUA 3D0FA 1XPRA 1WOCA 2N49A 1VS0A 1L1OC 4IFDI 3NELA 3CCMA 2WFWA 3F2BA 3J80c 3CXCA 3VDYA 2ZM6L 4RMFA 1PV4A 2KCMA 1SLJA 2Z0SA 1OXTA 5LMNL 1N34L 2A1AA 2RF4A 4DK3C 4K0KL 1HR0L 4DV4L 1E3PA 2PQAA 3PSIA 4P75A 4ALPA 3HOWH 4A3MG 1HNWL 3CPWA 4IPCA 2GVAA 2D62A 1I5FA 1VQAA 3F1ZA 4DV7Q 2UUCL 1CKNB 3KFUA 5GAGC 4APVA 2K50A 4LW1A 2VQFQ 4DUZQ 4MNOA 3UDFA 4DV4Q 2NZHA 3CPFA 4AH6A 4EQ5A 1PH8A 4JI3Q 3STBD 5GAHC 4LFBL 2MO0A 2AWOA 3PCOB 4LFAQ 5C3EH 1N33L 2JA6G 3H15A 2B63H 1CSQA 3M4QA 3CF5A 1XMOL 3PUXA 1VQ5A 2JA7H 1FJGQ 3I2ZA 5J3BA 3G4SA 5M3MH 2UXDL 1KIXA 3FHWA 1YIJA 3OW2A 1KRSA 4YHHL 5DLQE 3CCRA 1P8LA 3GO5A 3KDFA 1X9NA 2R93G 4LF9Q 2NN6I 4GKKL 1Q8KA 1Q82C 1HNZQ 1YHBA 3J81j 2F4VQ 3S1MH 4QQBX 1MIUA 1ASZA 2UUBQ 3TS2A 1PH6A 3K0XA 4L5TA 1A0IA 1SR3A 2WAQE 3AFPA 1XMQL 1VQ7A 1YJ9A 4TVAB 3CAMA 2RHSB 5IP9H 3CD6A 1NBWA 1X3GA 1VQEA 2ZJRA 1HJPA 2JK8A 4R4CA 1QZGA 2A19A 3EIVA 2K5HA 1PYBA 4X64L 4B3ML 1Q81C 5IE8A 4B3SQ 3CCEA 1OXUA 1A62A 2EXDA 3NENA 4DV5Q 1PH1A 2ATWA 1PH3A 1Q7YC 3HKZG 4NXNL 4DR7Q 4DV7L 4A3EG 5C44G 4DUYL 4OXPA 4LUOA 3Q8DA 3HOYH 1HNWQ 3J7ZC 2RCNA 1UEBA 3GTMH 2PMZE 3S14H 4KHPL 1X55A 2NVYH 4P71A 1E1TA 1G51A 1VQCA 1WFQA 4IOCA 3RZOH 1EUJA 4O0AA 3SGIA 2PNHA 3TEHB 4JBWA 4LF8L 3ULPA 2UUCQ 4LUZA 4X6AH 1EQRA 2HHHQ 3CCUA 4LF6L 2YTXA 1V9PA 4POFA 4OWTB 2JEBI 2UXBL 4DV6Q 2B29A 2FXQA 4JBKA 4LF9L 4OWXB 4DR2L 2R7ZG 1TWFH 2BA0A 3G6EA 3M7NA 1I6HH 4A3FH 2XTIA 3GTKH 4DNIA 1KL9A 5EAYA 1I50H 1YZ6A 1K3RA 3PUWA 2WB1G 5H1SE 4IFDJ 3PF5A 4B3TQ 1J6QA 4IFDG 1N32L 3KF6B 2R7ZH 3ULLA 3K7UC 3HOUH 1WCMG 3PF4A 1VQHA 1U5KA 2Y0SG 2YTYA 4WJ3M 3CQZH 1QVFA 1D7QA 4GN3B 2XGTA 4UY8C 3S2DH 2VUMG 1N32Q 1ASYA 1M90C 2DGYA 1GKHA 4AYBE 1I94L 4R4TA 1Q1EA 3CMAA 2V1CC 4JI4Q 1C7YA 2JA7G 3U4ZA 1YBYA 5BR8L 1YITA 4A3JH 5BR8Q 1PH5A 3EN2A 3DLLA 2Z6KA 1EIFA 4PZ8A 4A3EH 4DV2Q 4P74A 3HKZE 4BY1H 1HNXL 1EYGA 2N8NA 1LYLA 3CW2C 1X6OA 3CC7A 4X66L 4HJ7A 4DUZL 3U58A 4JI4L 3I56A 3AEVA 3OTOL 1FGUA 3I4NH 3HOZH 3CP0A 2E8GA 4AIMA 3RN5A 3PIPA 1EIYB 3PIOA 3F8TA 1KAWA 3A5UA 1CUKA 1U0LA 3KDFB 4DR7L 2D0PA 1K83H 4JI2Q 5C0XI 4LF6Q 4AQYL 4OX9Q 2I5LX 1B8AA 1WI5A 2YYZA 2BH8A 3M9BA 4YY3L 1HZAA 2JEAI 1VQLA 2OQKA 3ICEA 3TQYA 3OYYA 3W1GA 4LUVA 4J15A 1VQMA 1HZBA 4JBMA 2I5HA 4YCWA 1PHJA 2F52A 3RZDH 1WYDA 4DR3Q 3BZKA 1GVPA 3CCSA 4A3CH 1GD7A 1Z47A 1S40A 2I0QA 1LTLA 1SE8A 1CKNA 2ZTEA 3S24A 4A76A 4A3LH 4LFCL 5FJ8G 1MJCA 2WB1E 5AJ3L 3S2HH 2E5LL 4A3JG 1VQNA 1EOVA 4JYAQ 5GROA 2I5MX 3L0OA 1HNXQ 2LXJA 1YHAA 4DR6Q 2VNUD 3BU2A 4DV5L 2B63G 4NXMQ 4PG3A 1KXLA 1UE1A 3HKSA 1K0RA 4LF4L 5IT9c 4DV2L 1Y1WG 3T1YQ 4DV0L 2R7DA 4JI7Q 3M3YH 4JI0L 4YCVA 5C4JH 1JE5A 4RG1A 2VW9A 2E2HH 3KJPA 1DGSA 3M4PA 4JBJA 2VZAA 4NB3A 1J5EL 2NN6G 5M3FH 5LMUL 4HJ9A 3TS0A 1I94Q 3W5OA 2Q2UA 4Y52H 1T9HA 1X56A 4IPHA 2MNAA 1I3QH 3K80C 3AQQA 4WJ4A 1GM5A 2UU9Q 2CKZB 3I4OA 1J5EQ 4LFAL 1W3SA 1SROA 3E0EA 1BBUA 1E24A 5ELOA 2F4VL 1PA6A 4L5SA 4PZ7A 1KQSA 3CCLA 1VQOA 3I4MG 1OTCA 2K75A 1JT8A 2LSSA 1IBLL 4JI6Q 4MZ9A 4YHHQ 1OXSC 4A3IG 1OXXK 4KHZA 3S1RH 2UXBQ 4IOAA 2YTVA 1L0WA 2KHJA
chains in the Genus database with same CATH superfamily
2R7FA 3G48A 1B50A 4A3LG 1XTDA 4LWCA 4V190 4A93G 1I6VC 1LT6D 5C4ZA 5KYIA 3B6YA 3SK4A 1DYQA 4LF4Q 1L0YB 5GQOA 2F0JA 1ZYRC 1SNMA 2OTJA 3HRZC 4DNTB 5LMNW 3MC0B 1X3EA 4DR3L 2KBNA 2F4IA 1PYWD 2R3ZA 4OGQC 1EL0A 3T1HL 4POGA 4QY7A 4FO2A 3PO2G 2O5JC 3H0GH 3CCVA 3K7AH 1SXTA 3K5MA 2BDNA 4A3DB 3A7LA 3BG3A 1VCIA 1L2FA 5C4XH 3A5ZB 3L7ZC 1R4QB 2Y0SB 3VA7A 3KF6A 3PQIA 1CKOA 4OONA 2AWNA 4CJ2C 5HURA 1F9RA 5D65A 1YNJC 4A3JB 4OELB 4B3TL 3PO3G 4QF4A 2H5XA 1PRTC 4L5QA 2CH4A 1U4LA 1PZKD 2R92G 4OHJA 4H44C 2Q2IA 1TWAH 1QG7A 3KOJA 1IYJB 3N52A 5FLXc 3ULJA 2JXMB 5C4XB 2JYOA 5M3FB 1HFNA 3UDXA 4DR5Q 1WTWA 2K05A 3QJYA 4QL5A 2Z6KC 4L5RC 4RHRA 4BBSG 3GDEA 3S1NB 4UPAA 3ITPA 1WJJA 2D9UA 2NZOA 5C0XH 3I4NG 2JJQA 1O78A 4BY7H 3J7A5 4KLKA 4UAIA 1N36Q 4PQXA 1EZ6A 1PTOH 3DWQA 1JICA 2CFMA 2KOLA 4A93B 3E9IA 4LFBQ 2RDHA 1SFOH 5JPNC 1HZ9A 2RKSA 5C0XG 2J7ZA 2BCOA 2BE5D 4CKEA 1ET9A 2PI2E 1YNXA 1NCVA 2GA4B 3DMUA 3ERQA 1Q46A 2ZT9C 1A63A 1VQIA 5ELCA 3S16B 2B2TC 2PZWA 4GKJQ 3NE5B 2NBFA 1FL0A 1EYCA 3A54A 3NSWA 3J80i 3R3OA 2ZJQA 2FJ2A 2RHQB 1Y1WH 5JEAG 5BN4A 2K28A 3X3NA 4A3IB 1A2UA 2IHEA 1EY0A 1YEZA 3Q24A 3S17H 2IX1A 2IW3A 5C0XJ 1TWGH 1NSNS 5GAEC 4XIGS 4IUVA 4ZKBB 5IIFA 2EIFA 5F2DA 2TMPA 5T1IA 3RR5A 2QA4A 3D6CA 1PLFA 2XSCA 5CMDA 1DXMA 2IPKD 2PPBC 2L12A 4RH6A 4ZUIA 1S4ZA 5IYBH 3MHBA 3NQTA 3W2DA 1S3OA 5JEAJ 4DUYQ 1H9RA 3K7AB 3S1NH 3K8AA 1S5DD 1N33Q 1VDZA 5ELFA 2EYFA 4G7ZC 2R93H 5FO8B 2SEBD 1FJGL 2X69A 3NEMA 2XRQD 4JYAL 3I4NB 3A74A 4X62L 4DAYA 1A8VA 3DM3A 2KCNA 1ZEQX 4BY7G 2IY5B 4N9PA 1GHJA 5E1FA 5DM63 4DR1L 4DR5L 2J4XA 2ALYB 2KA7A 3PO3B 2DUDA 1IBML 3A0JA 2Q2HA 3RNUA 2DNCA 2E74C 1CI3M 4LF5L 2HDMA 2DY8A 4UP8A 3JC66 1SE3A 3QIAA 4BS9A 2C5CA 4A3MH 2F0PA 1D1KA 4BBSH 3U9SA 1QB5D 4PNYA 4DA2A 5CV4A 5IP7G 2R7ZB 3G6JB 1T5XD 1LUZA 4JI5L 1B53A 1FNWA 5LMUQ 3BYYB 3FEWX 3KBGA 2Z4IA 1STYA 1AFPA 1Q12A 4A3FB 3PUYA 4S3SA 3AFQA 4DR2Q 4OIKA 2LY7A 3NHHA 1HTPA 4KHVA 1JOQA 4A4IA 2F0OA 2HT1A 1ZKOA 5J22A 5KRUA 4A3BH 2VS1A 1MKHA 3J7YW 2E76C 2QEXA 3H3VH 1SYEA 3H6MA 3SHLA 3UDGA 2JA8G 4ILWA 2OQ0A 4JI8L 2X6LA 1B1ZA 4ULLA 4FXKC 2TSSA 4YWKA 4A3GG 2F0WA 1K8MA 5DAUA 4XYOA 4KTAA 5BN5A 2M00A 3AB9A 1ESRA 3D0FA 2N49A 1D5MC 1WTQA 1MSHA 4RMFA 2Z0SA 1OXTA 2B8GA 4DK3C 2RSNA 1HR0L 1EFID 1SSOA 3PSIA 5D3DA 3HOWH 1HTLD 1CK1A 3GQBA 1HNWL 3CPWA 2GVAA 3F1ZA 3SVMA 1RHPA 2Z8LA 4BBRB 1EY8A 2KUMA 1Y8PB 1V1PA 3BDLA 4LW1A 4DUZQ 5DNFA 4JI4Q 3TRZA 2NZHA 4EQ5A 4K5XA 1BCPF 5C3EH 2ICEC 1N33L 2JA6G 5KYLA 1CSQA 3M4QA 4BY7B 2JA7H 1AN8A 2L5TA 1GUSA 1IKMA 5M3MH 4FP5D 3NBIA 5EBCA 4B9XA 1YIJA 1KRSA 4R8NA 1P8LA 2NN6I 3IFTA 4M8AA 3T53B 1Q82C 1YHBA 4AYBB 4N8X1 3S1MH 1STGA 1MIUA 2K7VA 4HMIA 1Z7TA 3D4RA 1U4RA 1PH6A 3AU7A 5D3IB 1EQTA 1SR3A 2EYOA 3AFPA 1VQ7A 4TVAB 2RHSB 3CD6A 1NBWA 1X3GA 2A6EC 2JK8A 2E2HB 1PFNA 1Q8IA 2F0HA 3PIP3 4B3ML 1Q81C 4O42A 2CVRA 3H94A 1PH1A 4IUTA 1STHA 3HOYH 1SE2A 1TWCB 1CFMA 1B4OA 2PMZE 2Z9HA 1X55A 2NVYH 4P71A 5FKAC 3GTMB 4JW0A 1VQCA 1WFQA 2L0CA 4IOCA 3I4LA 2LMCB 2WAQB 3RZOH 1EWHA 2J0TD 3ULPA 4X6AH 1F2LA 1STAA 2YTXA 1LTID 3SEBA 1LTAD 2UXBL 4GZYC 2FXQA 4JBKA 4LF9L 4XQNA 3G6EA 1I6HH 2XTIA 1K3BC 5EAYA 1I50H 1YZ6A 1U4PA 5FOBB 1K3RA 4IALA 1J6QA 2PMZB 2L4NA 3KF6B 3IAYA 2NVXB 2EYMA 3V05A 4K2KA 3PF4A 1VQHA 1A3UA 1HCZA 3A55A 2Y0SG 1D7QA 5A2QL 3K57A 2KHSA 2VUMG 3OHXC 1M90C 2DGYA 5M3MB 4R4TA 1KDBA 3CMAA 1C7YA 1JC7A 1DONA 3D3RA 5BR8L 4FF4A 3EQLC 5BR8Q 2I07B 2ZXRA 2Z6KA 3OW7A 1AP0A 5CV9A 4DXGA 1HNXL 2N8NA 3CW2C 3CC7A 4X66L 4DUZL 4JI4L 3OTOL 3PIOA 1CUKA 1U0LA 3KDFB 1K83H 3PO2B 4LF6Q 3D4WA 2PNRC 4OX9Q 4I7ZC 3M3YB 3U9OA 4QCLA 3TQYA 2F0TA 3A8KE 3W1GA 1EEFD 1U4MA 1JE4A 4YCWA 1SNOA 1WYDA 4IQZA 1Z47A 5C44B 4KY6A 3RZOB 2EDGA 2I0QA 4A3LH 2B2TA 4A3JG 4WJWA 3H3VC 1E2ZA 5ELBA 1HNXQ 2DNEA 3L0OA 1J8IA 1TWGB 4NXMQ 1UE1A 3JAML 1LO5D 4DV2L 4LF4L 3KLRA 2MP1A 2RCFA 3MXUA 2R7DA 2N55A 4CJ0B 5C4JH 1JE5A 4RFBA 3KJPA 1DGSA 4NB3A 2Q2UA 1JB3A 4L63B 3PMFA 1I94Q 3K0YA 1ML0D 1X56A 2MNAA 3K80C 4BBSB 5CYUA 3I4OA 4LFAL 3E0EA 1E24A 4DXFA 2F4VL 4L5SA 1VQOA 1F9PA 4A3EB 1LTRD 3S1RH 1OXXK 4KHZA 1L0WA 5HGQA 1HPCA 1LABA 1KDCA 5M5YH 3S15H 3N6RA 1KRTA 2JA7B 1NMFA 2YU9H 4DR4Q 3QOLA 1GJXA 2WAQG 3EROA 1NR2A 3ER0A 2NVXH 1AH9A 5FJ8H 4PZ6A 4X3TA 3M4OH 5EJWA 3J80E 2B2VC 1QNKA 4ZUJA 1KTKA 5CV6A 4K0KQ 1HQRD 3BVZA 4IFDH 1YNNC 4I7AA 2QEJC 3IL8A 2RVLA 4ZK9B 2OT2A 1PH4A 3H0GB 2CWAA 4Y7NB 1UE7A 2LXKA 2QKIC 2B3GA 4HJ5A 2UU9L 1NJIC 2B2VA 1QUQA 3V2TA 3GTLH 4K6DA 4X3UA 2HHHL 4X66Q 3UE0A 1Y1VH 2A6ED 1HZCA 3CMEA 1PZID 4GLXA 4K8JA 3Q6SA 3DEPA 4C1NI 5GADC 1EFWA 4GLAC 3IRBA 1GHKA 4DR4L 3T13A 3F2CA 2A8VA 1VQKA 3I4MH 4G4KA 2CW0C 5M5XH 2MPMA 3FMCA 2MO1A 1ILQA 3CC2A 2L15A 1VQ8A 1RJTA 2BE5C 1JQYD 3RLOA 5AJ3Q 4LFCQ 2OWOA 3RLFA 1D8LA 2BDOA 3M85A 3ZJYC 5IGGA 1RTNA 4R4OA 4MIUA 1YJWA 4X3SA 1ONLA 4CKCA 5M5WB 4YWLA 5CBEE 1E2VA 1SYBA 4TQUS 4A3DH 2F0IA 1ICFB 4F87A 2WKDA 3NTHA 4J8QA 5CGKA 4F7XA 5J39A 1NMGA 1HR0Q 2KHIA 4A3FG 1QVGA 1SMYC 1FGBD 1IBKL 1PVOA 3HOZG 3NWSA 1FYCA 4J6HA 1VQBA 1LV9A 4MTNA 1SN8A 1PFBA 1PTOB 4C3JB 1HA5A 1QCBD 1KLUD 2VQEQ 5JJKA 3KLSA 5LMNQ 5TSSA 1N34Q 5ELEA 1JJ2A 2JA9A 4HCEA 3HOYB 1SNPA 3VA5A 3H3VI 1K0SA 2QF7A 2IX0A 1YHQA 2C35B 3DWAA 1O7LA 3FDTA 3J81i 2F3WA 1II3A 4HIMA 1HRJA 1RODA 3STBC 1LM0A 4GNXA 4C2MH 3MWYW 3VYSA 4FXGC 4A3DG 5IGDA 4OO1I 1PYSB 1YJNA 4HEDA 3AYHB 1W2BA 2ID0A 1CZGA 2SOBA 2L11A 4IO9A 5EKLA 3K58A 4X64Q 2H1EA 2A74C 1G291 4K2LA 2ZTDA 2NVTH 3LX0A 3GTJH 4GNXC 1O7IA 2PQAB 2JQOA 4X3KA 1EY4A 4JC0A 3I3CA 3MXGA 4B3RL 1QOHA 1M1KC 2R6GA 5NUCA 1SFOB 1XPOA 1J9OA 2E5LQ 2P5ZX 2ZJPA 2L55A 1B7YB 2AUKA 4Q5VA 1LTTD 3NBHA 1BCPC 4H02A 1P16A 3H91A 3R2TA 4IUUA 5KGUA 1TIID 1Y1VG 1PFSA 1I6HB 4GOPA 5IWAQ 1XX8A 4A3MB 1ILPA 2NWGA 3HG9A 2RSOA 2OF1A 3VR5A 3M4YA 2K5VA 4HAEA 4QJFA 2R92H 1G6PA 2XWBB 3R8BA 1UEAB 3PO3H 1G8ZD 3ERSX 2WKCA 2UUBL 1PDQA 3U50C 1PH9A 1QUQB 1TWCH 1X3PA 1QE6A 1Q86C 3H09A 2AUJD 2EJFC 1BVSA 1I4GA 4EQPA 3KUPA 2IHFA 1SNQA 1QWYA 2A68C 1K9MC 2F0UA 4AYBG 4DV0Q 4JI7L 1V43A 5DEHA 3GD7A 4DV1L 1WD1A 4ODGA 5M3FG 4R4QA 4TRDA 3MXNB 2IT1A 2HQLA 2IX3A 4NW2A 4CHTB 3TZUA 4PV1C 3SR1A 4IPDA 1I50B 3WOFA 1N8RC 5IYCH 1AE2A 4JVZA 2JA5B 1TS5A 2EJMA 1HH2P 4X65Q 4HJAA 2A6HC 3E5SA 1UE6A 2XN9C 2EXZA 4LF7Q 1AZPA 4Q0FA 1STEA 3P20A 1VQGA 3HP3A 4BY1G 4KY5A 5IGFA 1XNRQ 1B70B 1TXYA 2ZTCA 1LTBD 5IYDG 3OOCA 5CV5A 1H9MA 4B08A 1JB7A 2UUAL 4KKSA 2OCEA 4TKOB 2CHBD 2VB3X 4DR6L 2N78A 1IL8A 1SRUA 4CBVA 2EVBA 3NELA 4DN4M 3CCMA 4ABNA 2B2WA 4QIWB 1PV4A 2KCMA 1HHVA 2RF4A 1R4PB 1TVXA 4DV4L 1E3PA 2PQAA 3A56A 3J7AF 5GAGC 4APVA 2K50A 4RKBA 2X6GA 3D4DA 4MN3A 2VQFQ 1GUOA 3TP5A 4LFBL 4QUCA 4JI3Q 3STBD 5GAHC 2MO0A 3SE0A 4LFAQ 4WFN3 2D5DA 4IURA 1UUPA 1TKWB 5KNDA 1EYAA 3IKJA 3H15A 2K33A 3UI2A 1XMOL 3PUXA 1VQ5A 2MUYA 5K36H 1FJGQ 4CDDC 2PW7A 1Y8OB 1KIXA 5KIXA 3IFDA 3GTJB 2F0FA 2B63B 1NUCA 1Q8KA 4C3IB 3FRPB 1Y1WB 4QQBX 2KEEA 3SXHA 1ASZA 2UUBQ 3TS2A 3K0XA 4L5TA 1A0IA 2PW5A 1XMQL 4HCSA 4C3HG 1VQEA 4R4CA 1BCPD 3TMEA 5CC4A 2K5HA 4X64L 5IE8A 1OXUA 3HKZG 5M5XB 4NXNL 2CQAA 3GV6A 3DHQA 4YIJA 3I4MB 5LHY1 4OXPA 3Q8DA 2G5DA 2NVYB 3GTMH 3S14B 1G51A 4OIJA 5HGTA 3EFXD 4C56C 1EUJA 3SGIA 1TY2A 3TEHB 4JBWA 4LF8L 1JWMD 2UUCQ 5JAVA 3CCUA 4RCNA 2E2JB 4POFA 2JEBI 4DV6Q 3NWTA 4QB4A 1B44D 2R7ZG 1TWFH 2BA0A 1LLRD 1PRTF 1KL9A 1VF7A 4U673 1GUNA 1EU4A 4B3TQ 3K5OA 3ULLA 2M9VA 2FINB 4NP5A 4UHVA 3RD4A 5AFWA 3CQZH 1QVFA 1ET6A 2XGTA 1N32Q 3S2DH 1ASYA 1DCZA 1RDPD 4XT3B 1I94L 1Q1EA 3MZ5A 2V1CC 5D14A 2JA7G 1BO0A 2K5QA 3SK6A 3EN2A 1BUVT 3DLLA 2NVTB 2SNSA 4WRDA 5CV8A 4PZ8A 4P74A 4BY1H 1EYGA 1RTOA 1O7ZA 3I56A 1XXGA 3HOZH 3CP0A 2E8GA 1DJRD 3A5UA 4DR7L 1F77A 2IWHA 2O5IC 2F0VA 5I4DA 2I5LX 2MGSA 2YYZA 2BH8A 1IYUA 3OYYA 1GUGA 1WD0A 1VQMA 3Q23A 4JBMA 5IT9L 5KNBA 4DR3Q 4ZRZA 3CCSA 4DAPA 2F0EA 4A76A 1MJCA 3S2HH 1STNA 2F0DA 1EOVA 1E0BA 5GROA 4JYAQ 2I5MX 5C3WA 4RKLA 2LXJA 3LWEA 4DR6Q 1PFMA 2VNUD 2F0QA 3OWFA 3LWUA 1Z6HA 3QR8A 1K0RA 1CA5A 5IT9c 5ISRA 3T1YQ 3KLSX 1MHWC 4JI0L 3M3YH 4RG1A 2QDBA 4N9TA 1WTHA 2VZAA 2NN6G 4Y52H 4FF2A 4FNFA 1HUNA 4M1UB 2UU9Q 1J5EQ 4MTKA 1H9JA 2EYPA 3LNNA 2HQEA 1PA6A 4PZ7A 3I4MG 2EY1A 1OTCA 2K75A 4QMGA 1T5EA 4H0LC 4JI6Q 4MZ9A 2NB0A 2YTVA 2D2CC 2R61A 3GTOH 1R9TH 4K14A 4GOPC 5JPMC 4DAMA 3QB3A 1XNQQ 4IN3A 2Q8IB 3BDCA 2DJGC 3FPPA 3MXNA 1WTVA 1RIPA 3G71A 1EQQA 2WIIB 3EA6A 1JWUD 3I72A 4JI8Q 4PMCA 3QG1A 4NXNQ 1I4PA 1TWFB 4R4IA 4X62Q 4Y7NH 2VQEL 2F03A 4LK1C 1EOTA 2E2JH 1S5BD 2F0KA 1F9SA 3GTGH 3NQIA 3HFZB 1WTOA 1FD7D 1AZQA 4DAYB 3M4OB 4JI6L 3I8ZA 2NUCA 1VQJA 2A68D 1TR5A 3E9HA 5JVH3 3I55A 1UAPA 4HIDA 1XNQL 3S15B 4HIOA 1HUMA 4OX9L 1D5ZC 2NVQH 1JJGA 1XTCD 3MTSA 2UXCL 2Q2TA 3NP8A 4H7BA 3L2PA 2NTTA 2AQ3B 2QW7A 5I2YA 5I9PA 5I2XA 4JPBW 1KNAA 3FKIB 1TT2A 4HJ8A 1IZ6A 4KV6A 4RHSA 3D31A 3M7GA 1QILA 1NY4A 4F8MA 2GVBA 2Y0SE 3OSOA 1HA6A 3HOXG 3MEHA 4LF5Q 4JI1L 4G7OC 2KECA 1S72A 4NPSA 1DM0B 4C3HH 4JI0Q 3I7FA 5ELNA 1BCPB 2RDFA 3W3AA 2H4OA 3CC4A 2SNMA 1EQVA 1X65A 1EY9A 3MEFA 4LJZC 1VQPA 3UE1A 2FFKB 1GO3E 1RL2A 2RQXA 5CBAE 4R1JA 2F0GA 1PH7A 4GNXB 4XQJA 1UE5A 1JMCA 2OTLA 3J80L 2V4DA 3GTOB 1A3VA 4N8FA 1EIGA 2F3VA 4B9WA 3OTOQ 3S1QB 1CHQD 4GN5A 1S5ED 2PO4A 3H0GG 3VYTA 4DK6C 4DV3L 1KABA 2EYHA 4AQYQ 1PTOD 3C3LA 2K4KA 1F2YA 2BH2A 2PZTA 1XMQQ 1HNZL 3VR4A 4IUQA 2E2IH 1YNJD 1BBWA 3MVVA 4BBRG 3NXWA 1L1OB 2GN5A 3HOVH 1MSGA 1ZXTA 2D0OA 4DV1Q 1VQ6A 5C6AA 2JE6I 1TY0A 3KK7A 4BA1I 4JI5Q 4P2CB 4DGZA 2VY3A 1MJEA 1GUWA 2AHOB 2AKWB 5EKKA 1F2MA 2NVQB 3GV3A 3SK5A 4MHEA 2F3IA 5E4WC 3HOVG 3S2DB 4L6TB 5JJIA 3CHBD 2EYJA 2N3SA 2XVSA 2EZVA 3JAMi 4UP9A 2K03A 3DUZA 4X65L 4A3GB 3BYTB 3K5NA 1N9WA 3OMGA 5FLMH 3MAQA 4NXML 2UXCQ 4JI3L 2JN4A 5CV7A 3T56B 1XPUA 4H13C 1B9NA 5C4XG 2K5NA 5IWAL 5C5MA 3X3MA 1LT5D 4BXXG 4GKKQ 2UUAQ 1IYVA 5E7NA 4C3HB 3UDIA 2MFIA 1NAPA 1FVIA 3J81E 4QGUA 1JCKB 2PZUA 2KENA 1D1IA 1S5FD 4YWMA 1X54A 5FLMG 1ENFA 5JVG3 4LF8Q 4FDBA 1H95A 1I4HA 1A3TA 4LF7L 4HN7A 4B3SL 1NE3A 3BZDB 3NTKA 2HD3A 1ESFA 1IBLL 2HIXA 1FNUA 5HY6A 1YVCA 3RN2A 4A3KG 5IYDH 1SAPA 3WWVA 3U4VA 2R92B 2ENBA 3FKIG 2R93B 1KC8C 4CDEC 3TN2A 3HOUG 5KNCA 2Q8RE 1VQ9A 4OO1G 1BKBA 1BQQT 5BN3A 2E2IB 1WCMH 2K1BA 4NKLA 4DU9A 1CKMA 4R8IA 4GS3A 1HFGA 4XTCS 2MJ8A 5L37A 4LNQA 1TS2A 4BA2I 3S1QH 3RLNA 4JG2A 1CHPD 4IOAA 1WVLA 2EE1A 2VQFL 2FMCA 4IUNA 1GUTA 1KLGD 2CQOA 4GOPB 1K8GA 2EYLA 2BOSA 1XMOQ 1A6XA 1SYDA 1G6ZA 4KI0A 3HOVB 4ZAIA 1Z9FA 2HIVA 2L9HA 2MQHA 3G7LA 1C8CA 4CJ1B 1NNXA 2K14A 3C1EA 2VUMH 3KYHC 5K5PA 4A75A 3VR6A 1HR0W 2A69D 5LL6S 1XPRA 4OEMB 1L1OC 4IFDI 2WFWA 2MHVA 3J80c 3CXCA 3VDYA 5KEEA 2ZXPA 2ZM6L 3BS1A 4R9WA 2A1AA 3Q22A 3SDZA 4K0KL 3K5LA 3T4AC 1C4QA 1LT3D 2D62A 1I5FA 1VQAA 4DV7Q 4EGVA 2UUCL 1CKNB 4XYQA 3KFUA 5EPJA 5FO7B 1TU2B 2WACA 5T1GA 4MNOA 3UDFA 4ZKCB 2JP1A 2K6AA 2B2YC 2B63H 3OMCA 3BVGA 5ELDA 5JOBA 3I2ZA 2UXDL 3FHWA 1G2TA 3OW2A 2L1BA 2DY7A 1X9NA 1SYCA 3HOUB 4FF3A 3J81j 2F4VQ 3EVQA 3E6ZX 1E2WA 4I65A 3FVQA 2WAQE 2NTSA 3CAMA 5IP9H 3HOWB 2ZJRA 1HJPA 3PIO3 3MA2B 4LMQD 2A19A 3EIVA 1QZGA 5C4JB 2A5HA 4EVOA 3CCEA 1SYGA 2VB2X 4ZLTF 4DV5Q 5IGBA 4A3EG 4DUYL 2G9HD 4LUOA 4RGOS 4L8JA 2PYKA 1HNWQ 2LKVA 2RCNA 1UEBA 3S14H 4KHPL 2M2LA 3E3XA 1E1TA 1XYIA 4RCOA 4ME5A 5CR3A 3C46A 1HXYD 2IL8A 5IODA 1K8OA 5EPLA 3TP6A 3Q0AA 2HHHQ 3KF8A 2E2DC 1EZ8A 1B9MA 1V1OA 1HQMC 4OWXB 4DR2L 3M7NA 4A3FH 1KAAA 3NK9A 4U68A 3QOJA 4NDXA 1Y8NB 3DM1A 3MXPA 3PUWA 2WB1G 4OO1H 3PF5A 4IFDG 3VYUA 1N32L 3NTIA 2OXPA 3K7UC 3HOUH 1U5KA 2N88A 4GN3B 3OWEB 4XXEA 4BY1B 1CQFA 1ICWA 3R93A 2K32A 3U4ZA 5I6WA 1YITA 2XNAC 1PH5A 2Z6BA 4A3EH 3HKZE 4BWGB 3V96A 1LYLA 1MGSA 1Q3LA 1SBBB 1GOZA 1X6OA 4XDXA 1K28A 3AEVA 1FGUA 4ID6A 4PMBA 3I4NH 1I3QB 1PTOF 3PIPA 1EIYB 2D0PA 1X3QA 3GTGB 4HSPA 1SDFA 1IKLA 3M9BA 2JEAI 1HZAA 5EPKA 1B3AA 1G2SA 1BR9A 2OQKA 4J15A 1MI2A 1W6JA 1WTPA 5EKIA 2I5HA 3EJIA 1AW7A 1LACA 1U9RA 3RZDH 1UNSA 1GVPA 3BZKA 2FHTA 4DK0A 3HKZB 1GD7A 1S40A 1JOOA 4KJOA 2RDGA 4DAVA 1SE8A 1SE4A 3J7AV 4FYDA 2ZTEA 3S24A 5FJ8G 1VQNA 1SYFA 1VF5C 3A8JE 1YHAA 4KKUA 2QCPX 5FLXL 3BU2A 4DV5L 3HEJA 2B63G 4PG3A 1KXLA 1Y1WG 3KBXA 1RCVD 4DV0L 4JI7Q 5COYA 4YCVA 2KQ3A 2VW9A 1EU3A 2E2HH 2EOTA 2O4XA 5LMUL 4HJ9A 1PRTD 3HS0C 3W5OA 1T9HA 1H9SB 3WDNA 1I3QH 4K6LA 4JK1C 2JSOA 4WJ4A 1GM5A 2CKZB 1SROA 1BBUA 5I9OA 3CCLA 1JT8A 2LSSA 1OXSC 2K01A 4A3IG 2UXBQ 4O1NA 2Z4HA 2JA8H 4DF7A 2UXDQ 4DV3Q 4JV5Q 3E0JA 4KMUC 1PRTB 1SJED 4DKAC 1C0AA 1KHIA 1M8AA 2OEOA 3PGZA 1IBLQ 1PH2A 3GTPH 2KCTA 2BA1A 1VQDA 4DPGA 1I4QA 2HCIA 2ES2A 3CRLC 3GTKB 4GN4B 5C4HA 2F1MA 3WOEA 4JI1Q 3R2IA 5EGTA 1IBKQ 5IT9E 4YCUA 3JAME 1M4VA 1JOKA 1WCMB 2K04A 2DN8A 4IPGA 1XNRL 1CSPA 4C3IH 4A3KH 2VUMB 5IY0A 3BZCA 1OXVA 5M3MG 3FKIH 2WP8J 4RAUC 4JV5L 4KD4A 1DZ1A 3C2PA 3S1RB 1EIHA 2JA6H 3PV0A 1CQVA 3KF8B 5K36G 4Z9CB 2B2UA 1IW7C 3TZDA 1ZYRD 4WORA 1BNZA 1LTSD 2EY2A 4A3CG 1DOLA 1S5CD 3NBHB 5FO9B 2JA5H 1Y1VB 4GKJL 4F88A 1X32A 3OPOA 2SDFA 3VYRA 2ASBA 3K81C 5IP9G 3S16H 5FLXE 1Y69U 3S1MB 3C1FA 4KY7A 3KJOA 2ZM6Q 5A35A 4ME3A 4K8IA 1SJHD 1TWHH 1VQFA 4JI2L 1L1OA 3EBEA 1BF4A 1V1QA 4EQNA 3L3OC 4UP7A 1E1OA 1Q1BA 1FR3A 2B2WC 2EQSA 3T1YL 1N36L 3URYA 4DNRB 1WTRA 1X3FA 2K5DA 5FK9C 3CCJA 4A3BG 2A73B 2XWJB 1SMXA 4IUPA 1IL2A 4BBRH 3TREA 3OIQA 4KKTA 2AQ1B 5JEAH 4HIKA 5C3EG 3S17B 3P75A 4CKBA 2B2YA 4A3IH 4IJHA 2PCFB 5JJLA 3HOXH 4C1NK 1EYDA 2RBMA 3FPUB 1JJCB 4BXXH 2WV6D 2JA5G 4J1MA 1TS4A 2HDLA 5IYCG 1QVCA 1CT1D 2O2LD 2KCCA 1OO9B 1V1PB 3VR3A 1FNVA 4B3RQ 3MFGA 1VMPA 3TP8A 1YI2A 4ZCKA 2AMCB 3T1HQ 2JA6B 2YV5A 4KK7A 3GTQH 1AEXA 1NTGA 4P72A 1C48A 1C9OA 1B2TA 1KNEA 3LGJA 1Y14B 1SNDA 3CQZB 5EBDA 3I70A 2K52A 4G57A 1CZWA 1F2ZA 4DV6L 5C44H 3PUVA 4HR7B 4DK1A 3F2UA 1F9QA 1EWIA 2KEDA 4EX5A 4O2DA 1PXUA 4GLVB 2CCZA 1QZHA 4YY3Q 3PUZA 1UWVA 4KHPQ 3HOWG 1EY5A 1E22A 2RA4A 5IYBG 2LFNA 4K5VA 3KLWA 1GXDC 2CWPA 4KN7C 1TQOA 5M5WH 2Z1CA 2QGQA 4K5WA 2PQEA 2CH4W 1L0XB 1RKNA 3HOZB 1CA6A 3L9AX 2I46A 1KD1C 1WTXA 2ZXOA 3NUCA 4B3MQ 3F2DA 2IJ0A 3W1BA 4C3JG 1E7ZA 3QO2A 1VMCA 3GP7A 4OWWB 1AE3A 3HOYG 1IXRA 2A69C 3A8IE 3FP9A 1KDAA 1TWHB 3JAMc 3CCQA 1CM9A 4P73A 4JOIC 1O80A 2EY5A 2NN6H 3NPPA 2G9DA 2PI2A 1K73C 1D2BA 2XRSD 2NZ1D 4RWSC 3HZXA 1I4RA 5JJZA 2HUGA 2VL6A 5IP7H 4JOIA 4A3GH 4QIWE 4IJLA 3BVMA 4KD3A 1XJVA 2EPBA 3GTQB 4DR1Q 3QWNA 1JWSD 1VQ4A 3D8GA 2CW0D 1IBMQ 4A93H 3T16A 1H9SA 3J81c 3BJUA 4C3JH 1PMRA 4PMWA 1JR0D 4QUFA 5M5YB 4JCVE 3RZDB 5IOCA 4DFAA 1K8AC 1WOCA 3I90A 3AMUA 1CTMA 1VS0A 3GTLB 3F2BA 5A2QE 1IW7D 1SLJA 5E4XA 5LMNL 1N34L 4P75A 4ALPA 1D5XC 3OIPA 4A3MG 3J81L 4IPCA 4ZQ3A 3CRKC 5DM73 3HGBA 3GTPB 1PH8A 4DV4Q 3CPFA 4AH6A 4CDCC 1TWAB 1BOSA 2AWOA 3PCOB 1RD9D 1QNUA 3P1HA 4RGTA 4RA8A 4CGYB 4RGMA 3CF5A 1DOMA 2K5WA 4FF1A 3ND8A 3RMHA 2HCCA 4XT1B 2KVMA 3K6OA 5J3BA 3O13A 3G4SA 3TDQA 1PTOC 1EY6A 5LL6X 3D6WA 4YHHL 5DLQE 3CCRA 3GO5A 3S2HB 3KDFA 3ONAB 2R93G 4LF9Q 4GKKL 1HNZQ 3CU7A 4OL7A 5EQ0A 4E6IA 1ENAA 2A6HD 1BDOA 1RF2D 2EJGC 1YJ9A 2WINB 3TP7A 2QILA 3RUZA 2DJFC 4B3SQ 1PYBA 5IGEA 1A62A 2EXDA 3NENA 1Q90A 2ATWA 1PH3A 1Q7YC 4DR7Q 4DV7L 5C44G 4FVMA 1DD2A 1IHZA 3J7ZC 1LT4D 4UDUC 4A3KB 4O0AA 1R9TB 2JA8B 2PNHA 4CDFC 4LUZA 1DOKA 1EQRA 4LF6L 1V9PA 4OWTB 2E75C 2B29A 4ZYSA 1D6EC 3GTKH 4G7HC 4DNIA 1K83B 1LTGD 3K59A 5I6YA 5H1SE 4IFDJ 2R7ZH 1A15A 4TSSA 1WCMG 2B2UC 4HMJA 1TS3A 2YTYA 3A7AB 2VXWA 3CKIB 4V0BA 4WJ3M 1NR4A 3DXJC 4UY8C 1STBA 1H9KA 3SK8A 1GKHA 1QJOA 3ND9A 2F0SA 4AYBE 1YBYA 4A3JH 3VR2A 1EIFA 1A2TA 3ZYYX 4HSVA 4DV2Q 1SMYD 4HJ7A 1MBYA 3U58A 1EY7A 4C3IG 5IGCA 4AIMA 1EEID 3RN5A 3F8TA 1KAWA 3TSSA 1PZJD 4JI2Q 3MFYA 5C0XI 1G91A 4AQYL 1B8AA 2KJXA 3HOXB 1WI5A 1V8QA 5M9OA 4YY3L 1VQLA 3ICEA 1I4XA 1SNCA 4LUVA 4EQOA 1B3QA 1HZBA 1SEBD 1PHJA 2F52A 2QDLA 2F0NA 5C3XA 4A3CH 4KN4C 4KJNA 5C5LA 3T51B 4IZ8A 2LS01 1JORA 1BXTA 4NMZA 2EY6A 1LTLA 5CORA 3DWPA 1CKNA 1EWCA 1W6KA 5E3FA 4LFCL 5AJ3L 2WB1E 3P7JA 2E5LL 4HTHA 2YU9B 2FMMA 1MD2D 2NYZD 1ENCA 4A3BB 3HKSA 2B39A 4XQQA 4LAAA 2Q8TA 5C3EB 2F0MA 3S9WA 2AQ2B 2B8FA 3M4PA 4JBJA 1J5EL 3PO2H 5M3FH 3TS0A 1YNND 3DEOA 2C9OA 4IPHA 4C2MB 1O7YA 2XIWA 3AQQA 5G3LD 2ICIA 2WB1B 3BDOA 1W3SA 5ELOA 5G3LF 1KQSA 4FXDA 2F0LA 1BBXC 3I91A 5J1ZA 4YHHQ 3I73A 1XWEA 4RGNA 3TBIB 2KHJA
chains in the Genus database with same CATH topology
5HGQA 1R9TH 2UXDQ 2R7FA 3G48A 5M5YH 3S15H 4GOPC 4A3LG 1KRTA 4DAMA 4DV3Q 1NMFA 1XTDA 4LWCA 2YU9H 1XNQQ 4DR4Q 4JV5Q 4A93G 4DKAC 1C0AA 2WAQG 3B6YA 1KHIA 3PGZA 1IBLQ 3ER0A 2NVXH 4LF4Q 1AH9A 5GQOA 4PZ6A 5FJ8H 3M4OH 2OTJA 1RIPA 1PH2A 3GTPH 2KCTA 3G71A 5LMNW 1EQQA 2BA1A 4K0KQ 1X3EA 1VQDA 4DPGA 2KBNA 4DR3L 4JI8Q 2ES2A 3T1HL 4GN4B 4NXNQ 1PH4A 4QY7A 4R4IA 4X62Q 4Y7NH 2VQEL 4POGA 3PO2G 3H0GH 2CWAA 3K7AH 3CCVA 1UE7A 2LXKA 2B3GA 4HJ5A 2UU9L 4JI1Q 1NJIC 2E2JH 1QUQA 1VCIA 3GTGH 1IBKQ 3GTLH 2HHHL 3HFZB 4YCUA 1L2FA 4X66Q 5C4XH 3A5ZB 3UE0A 1Y1VH 4DAYB 1HZCA 3CMEA 4JI6L 3L7ZC 4GLXA 4IPGA 3KF6A 1XNRL 1CSPA 1VQJA 4C3IH 4A3KH 3E9HA 3I55A 5IY0A 5GADC 1CKOA 1EFWA 3BZCA 1OXVA 3IRBA 4GLAC 4OONA 5M3MG 4HIDA 3FKIH 2AWNA 2WP8J 1XNQL 4DR4L 4JV5L 3F2CA 4HIOA 4OX9L 2A8VA 2NVQH 1JJGA 2UXCL 2Q2TA 1VQKA 4B3TL 3I4MH 3PO3G 3L2PA 2JA6H 5M5XH 3PV0A 2H5XA 2MO1A 4L5QA 3CC2A 2L15A 2R92G 3KF8B 1VQ8A 5K36G 2Q2IA 3RLOA 5AJ3Q 4LFCQ 2OWOA 1TWAH 3RLFA 1IZ6A 1D8LA 4HJ8A 4A3CG 3KOJA 1IYJB 3NBHB 3D31A 2JA5H 5FLXc 3M85A 3ULJA 3ZJYC 1NY4A 4GKJL 4R4OA 2GVBA 2Y0SE 1YJWA 3HOXG 2ASBA 4LF5Q 4YWLA 3K81C 4JI1L 3UDXA 5IP9G 4DR5Q 3S16H 4TQUS 1S72A 4NPSA 4A3DH 3KJOA 4C3HH 4QL5A 2Z6KC 2ZM6Q 4L5RC 4ME3A 4JI0Q 4BBSG 3I7FA 1NMGA 3GDEA 5ELNA 1HR0Q 4UPAA 2KHIA 4A3FG 1QVGA 1WJJA 1TWHH 3TRZA 1VQFA 2NZOA 1IBKL 3CC4A 1PVOA 4JI2L 3HOZG 1L1OA 1X65A 3I4NG 3EBEA 2JJQA 1V1QA 4BY7H 1VQBA 3MEFA 4KLKA 3J7A5 4MTNA 4UP7A 1SN8A 1E1OA 1VQPA 3UE1A 1N36Q 1Q1BA 2EQSA 1N36L 1GO3E 1RL2A 3T1YL 2CFMA 4R1JA 2VQEQ 1PH7A 5JJKA 4GNXB 5LMNQ 1N34Q 1JJ2A 1X3FA 2JA9A 3CCJA 3E9IA 4A3BG 4LFBQ 1SMXA 1IL2A 1JMCA 1UE5A 2OTLA 3H3VI 1SFOH 4BBRH 3TREA 2IX0A 1HZ9A 1YHQA 2C35B 5C0XG 4HIKA 5C3EG 3J81i 3OTOQ 4A3IH 2PI2E 1YNXA 4HIMA 4IJHA 4GN5A 5JJLA 3STBC 1Q46A 1LM0A 3HOXH 1A63A 3H0GG 4DV3L 1VQIA 4DK6C 1JJCB 4AQYQ 4GNXA 4BXXH 4C2MH 4GKJQ 2K4KA 2BH2A 2JA5G 4A3DG 4OO1I 5IYCG 1PYSB 1YJNA 1XMQQ 1HNZL 1QVCA 1FL0A 2E2IH 3AYHB 1BBWA 3J80i 4BBRG 1W2BA 2ID0A 2ZJQA 4B3RQ 2RHQB 4IO9A 5JEAG 1L1OB 2GN5A 1Y1WH 3HOVH 4X64Q 2D0OA 4DV1Q 1G291 1VQ6A 2IHEA 1YEZA 2JE6I 2ZTDA 1YI2A 2AMCB 3GTJH 4GNXC 3T1HQ 2NVTH 4BA1I 1O7IA 2PQAB 2JQOA 4JI5Q 2IX1A 4JC0A 5C0XJ 2YV5A 1TWGH 4B3RL 2VY3A 5GAEC 1NTGA 4P72A 2R6GA 4XIGS 2AHOB 2AKWB 1M1KC 1MJEA 1C9OA 1XPOA 2F3IA 3HOVG 5JJIA 3LGJA 2EIFA 2E5LQ 2N3SA 1Y14B 2ZJPA 3JAMi 1B7YB 4UP9A 4X65L 2K52A 3RR5A 2QA4A 1N9WA 5FLMH 4DV6L 5C44H 3PUVA 4H02A 4NXML 2UXCQ 4JI3L 2JA8H 1P16A 1EWIA 5IYBH 4EX5A 4DUYQ 1S3OA 5JEAJ 1XPUA 1Y1VG 4O2DA 3S17H 5C4XG 1PFSA 2K5NA 4GLVB 5IWAL 2CCZA 4GOPA 3S1NH 5IWAQ 3K8AA 4YY3Q 3PUZA 1QZHA 2UUAQ 4BXXG 4GKKQ 1UWVA 4KHPQ 5E7NA 1N33Q 3HOWG 1E22A 5IYBG 3UDIA 2MFIA 3KLWA 1FVIA 2CWPA 4QGUA 2K5VA 2KENA 3GTQH 2R93H 4QJFA 2R92H 5M5WH 1G6PA 2QGQA 1FJGL 4YWMA 1X54A 5FLMG 4LF8Q 3NEMA 4FDBA 1H95A 4JYAL 3PO3H 3ERSX 3A74A 4X62L 2UUBL 1KD1C 1A8VA 3DM3A 4LF7L 3U50C 4B3SL 4B3MQ 1NE3A 4BY7G 1PH9A 2IY5B 3F2DA 1QUQB 1TWCH 4DR1L 4DR5L 2HIXA 2ALYB 5HY6A 1YVCA 3W1BA 1E7ZA 3RN2A 1Q86C 1BVSA 2DUDA 4A3KG 5IYDH 1IBML 3A0JA 2Q2HA 3RNUA 2IHFA 3WWVA 3U4VA 4OWWB 1AE3A 3FKIG 3HOYG 1IXRA 1KC8C 4LF5L 3FP9A 1K9MC 3HOUG 4UP8A 3JC66 4AYBG 3GTOH 4DV0Q 4JI7L 3JAMc 3CCQA 4A3MH 4P73A 1VQ9A 1V43A 4OO1G 4JOIC 1BKBA 3GD7A 4BBSH 4DV1L 5M3FG 4R4QA 5IP7G 3MXNB 2IT1A 2HQLA 1LUZA 2PI2A 1WCMH 4JI5L 5LMUQ 1K73C 1CKMA 4GS3A 4IPDA 4XTCS 1N8RC 4LNQA 5IYCH 1AE2A 1Q12A 4BA2I 3PUYA 3S1QH 3AFQA 4DR2Q 3RLNA 2VL6A 4JG2A 1HH2P 4JOIA 5IP7H 4A3GH 4X65Q 4QIWE 4HJAA 4A4IA 1UE6A 4LF7Q 4IJLA 2HT1A 2VQFL 4A3BH 2VS1A 1XJVA 1VQGA 1MKHA 4BY1G 1XNRQ 1B70B 1TXYA 4DR1Q 2CQOA 2ZTCA 4GOPB 1VQ4A 1K8GA 1IBMQ 4A93H 1XMOQ 2QEXA 4KI0A 3J81c 3H3VH 3BJUA 4C3JH 5IYDG 3PO2H 1Z9FA 2HIVA 2MQHA 1JB7A 3UDGA 2JA8G 2OQ0A 2K14A 4PMWA 4JI8L 2UUAL 2VUMH 3KYHC 2OCEA 4A3GG 4YWKA 4A75A 4JCVE 4DR6L 2N78A 1HR0W 1K8AC 1SRUA 3D0FA 1XPRA 1WOCA 2N49A 1VS0A 1L1OC 4IFDI 3NELA 3CCMA 2WFWA 3F2BA 3J80c 3CXCA 3VDYA 2ZM6L 4RMFA 1PV4A 2KCMA 1SLJA 2Z0SA 1OXTA 5LMNL 1N34L 2A1AA 2RF4A 4DK3C 4K0KL 1HR0L 4DV4L 1E3PA 2PQAA 3PSIA 4P75A 4ALPA 3HOWH 4A3MG 1HNWL 3CPWA 4IPCA 2GVAA 2D62A 1I5FA 1VQAA 3F1ZA 4DV7Q 2UUCL 1CKNB 3KFUA 5GAGC 4APVA 2K50A 4LW1A 2VQFQ 4DUZQ 4MNOA 3UDFA 4DV4Q 2NZHA 3CPFA 4AH6A 4EQ5A 1PH8A 4JI3Q 3STBD 5GAHC 4LFBL 2MO0A 2AWOA 3PCOB 4LFAQ 5C3EH 1N33L 2JA6G 3H15A 2B63H 1CSQA 3M4QA 3CF5A 1XMOL 3PUXA 1VQ5A 2JA7H 1FJGQ 3I2ZA 5J3BA 3G4SA 5M3MH 2UXDL 1KIXA 3FHWA 1YIJA 3OW2A 1KRSA 4YHHL 5DLQE 3CCRA 1P8LA 3GO5A 3KDFA 1X9NA 2R93G 4LF9Q 2NN6I 4GKKL 1Q8KA 1Q82C 1HNZQ 1YHBA 3J81j 2F4VQ 3S1MH 4QQBX 1MIUA 1ASZA 2UUBQ 3TS2A 1PH6A 3K0XA 4L5TA 1A0IA 1SR3A 2WAQE 3AFPA 1XMQL 1VQ7A 1YJ9A 4TVAB 3CAMA 2RHSB 5IP9H 3CD6A 1NBWA 1X3GA 1VQEA 2ZJRA 1HJPA 2JK8A 4R4CA 1QZGA 2A19A 3EIVA 2K5HA 1PYBA 4X64L 4B3ML 1Q81C 5IE8A 4B3SQ 3CCEA 1OXUA 1A62A 2EXDA 3NENA 4DV5Q 1PH1A 2ATWA 1PH3A 1Q7YC 3HKZG 4NXNL 4DR7Q 4DV7L 4A3EG 5C44G 4DUYL 4OXPA 4LUOA 3Q8DA 3HOYH 1HNWQ 3J7ZC 2RCNA 1UEBA 3GTMH 2PMZE 3S14H 4KHPL 1X55A 2NVYH 4P71A 1E1TA 1G51A 1VQCA 1WFQA 4IOCA 3RZOH 1EUJA 4O0AA 3SGIA 2PNHA 3TEHB 4JBWA 4LF8L 3ULPA 2UUCQ 4LUZA 4X6AH 1EQRA 2HHHQ 3CCUA 4LF6L 2YTXA 1V9PA 4POFA 4OWTB 2JEBI 2UXBL 4DV6Q 2B29A 2FXQA 4JBKA 4LF9L 4OWXB 4DR2L 2R7ZG 1TWFH 2BA0A 3G6EA 3M7NA 1I6HH 4A3FH 2XTIA 3GTKH 4DNIA 1KL9A 5EAYA 1I50H 1YZ6A 1K3RA 3PUWA 2WB1G 5H1SE 4IFDJ 3PF5A 4B3TQ 1J6QA 4IFDG 1N32L 3KF6B 2R7ZH 3ULLA 3K7UC 3HOUH 1WCMG 3PF4A 1VQHA 1U5KA 2Y0SG 2YTYA 4WJ3M 3CQZH 1QVFA 1D7QA 4GN3B 2XGTA 4UY8C 3S2DH 2VUMG 1N32Q 1ASYA 1M90C 2DGYA 1GKHA 4AYBE 1I94L 4R4TA 1Q1EA 3CMAA 2V1CC 4JI4Q 1C7YA 2JA7G 3U4ZA 1YBYA 5BR8L 1YITA 4A3JH 5BR8Q 1PH5A 3EN2A 3DLLA 2Z6KA 1EIFA 4PZ8A 4A3EH 4DV2Q 4P74A 3HKZE 4BY1H 1HNXL 1EYGA 2N8NA 1LYLA 3CW2C 1X6OA 3CC7A 4X66L 4HJ7A 4DUZL 3U58A 4JI4L 3I56A 3AEVA 3OTOL 1FGUA 3I4NH 3HOZH 3CP0A 2E8GA 4AIMA 3RN5A 3PIPA 1EIYB 3PIOA 3F8TA 1KAWA 3A5UA 1CUKA 1U0LA 3KDFB 4DR7L 2D0PA 1K83H 4JI2Q 5C0XI 4LF6Q 4AQYL 4OX9Q 2I5LX 1B8AA 1WI5A 2YYZA 2BH8A 3M9BA 4YY3L 1HZAA 2JEAI 1VQLA 2OQKA 3ICEA 3TQYA 3OYYA 3W1GA 4LUVA 4J15A 1VQMA 1HZBA 4JBMA 2I5HA 4YCWA 1PHJA 2F52A 3RZDH 1WYDA 4DR3Q 3BZKA 1GVPA 3CCSA 4A3CH 1GD7A 1Z47A 1S40A 2I0QA 1LTLA 1SE8A 1CKNA 2ZTEA 3S24A 4A76A 4A3LH 4LFCL 5FJ8G 1MJCA 2WB1E 5AJ3L 3S2HH 2E5LL 4A3JG 1VQNA 1EOVA 4JYAQ 5GROA 2I5MX 3L0OA 1HNXQ 2LXJA 1YHAA 4DR6Q 2VNUD 3BU2A 4DV5L 2B63G 4NXMQ 4PG3A 1KXLA 1UE1A 3HKSA 1K0RA 4LF4L 5IT9c 4DV2L 1Y1WG 3T1YQ 4DV0L 2R7DA 4JI7Q 3M3YH 4JI0L 4YCVA 5C4JH 1JE5A 4RG1A 2VW9A 2E2HH 3KJPA 1DGSA 3M4PA 4JBJA 2VZAA 4NB3A 1J5EL 2NN6G 5M3FH 5LMUL 4HJ9A 3TS0A 1I94Q 3W5OA 2Q2UA 4Y52H 1T9HA 1X56A 4IPHA 2MNAA 1I3QH 3K80C 3AQQA 4WJ4A 1GM5A 2UU9Q 2CKZB 3I4OA 1J5EQ 4LFAL 1W3SA 1SROA 3E0EA 1BBUA 1E24A 5ELOA 2F4VL 1PA6A 4L5SA 4PZ7A 1KQSA 3CCLA 1VQOA 3I4MG 1OTCA 2K75A 1JT8A 2LSSA 1IBLL 4JI6Q 4MZ9A 4YHHQ 1OXSC 4A3IG 1OXXK 4KHZA 3S1RH 2UXBQ 4IOAA 2YTVA 1L0WA 2KHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGQ A;  1R9T H;  2UXD Q;  2R7F A;  3G48 A;  5M5Y H;  3S15 H;  4GOP C;  4A3L G;  1KRT A;  4DAM A;  4DV3 Q;  1NMF A;  1XTD A;  4LWC A;  2YU9 H;  1XNQ Q;  4DR4 Q;  4JV5 Q;  4A93 G;  4DKA C;  1C0A A;  2WAQ G;  3B6Y A;  1KHI A;  3PGZ A;  1IBL Q;  3ER0 A;  2NVX H;  4LF4 Q;  1AH9 A;  5GQO A;  4PZ6 A;  5FJ8 H;  3M4O H;  2OTJ A;  1RIP A;  1PH2 A;  3GTP H;  2KCT A;  3G71 A;  5LMN W;  1EQQ A;  2BA1 A;  4K0K Q;  1X3E A;  1VQD A;  4DPG A;  2KBN A;  4DR3 L;  4JI8 Q;  2ES2 A;  3T1H L;  4GN4 B;  4NXN Q;  1PH4 A;  4QY7 A;  4R4I A;  4X62 Q;  4Y7N H;  2VQE L;  4POG A;  3PO2 G;  3H0G H;  2CWA A;  3K7A H;  3CCV A;  1UE7 A;  2LXK A;  2B3G A;  4HJ5 A;  2UU9 L;  4JI1 Q;  1NJI C;  2E2J H;  1QUQ A;  1VCI A;  3GTG H;  1IBK Q;  3GTL H;  2HHH L;  3HFZ B;  4YCU A;  1L2F A;  4X66 Q;  5C4X H;  3A5Z B;  3UE0 A;  1Y1V H;  4DAY B;  1HZC A;  3CME A;  4JI6 L;  3L7Z C;  4GLX A;  4IPG A;  3KF6 A;  1XNR L;  1CSP A;  1VQJ A;  4C3I H;  4A3K H;  3E9H A;  3I55 A;  5IY0 A;  5GAD C;  1CKO A;  1EFW A;  3BZC A;  1OXV A;  3IRB A;  4GLA C;  4OON A;  5M3M G;  4HID A;  3FKI H;  2AWN A;  2WP8 J;  1XNQ L;  4DR4 L;  4JV5 L;  3F2C A;  4HIO A;  4OX9 L;  2A8V A;  2NVQ H;  1JJG A;  2UXC L;  2Q2T A;  1VQK A;  4B3T L;  3I4M H;  3PO3 G;  3L2P A;  2JA6 H;  5M5X H;  3PV0 A;  2H5X A;  2MO1 A;  4L5Q A;  3CC2 A;  2L15 A;  2R92 G;  3KF8 B;  1VQ8 A;  5K36 G;  2Q2I A;  3RLO A;  5AJ3 Q;  4LFC Q;  2OWO A;  1TWA H;  3RLF A;  1IZ6 A;  1D8L A;  4HJ8 A;  4A3C G;  3KOJ A;  1IYJ B;  3NBH B;  3D31 A;  2JA5 H;  5FLX c;  3M85 A;  3ULJ A;  3ZJY C;  1NY4 A;  4GKJ L;  4R4O A;  2GVB A;  2Y0S E;  1YJW A;  3HOX G;  2ASB A;  4LF5 Q;  4YWL A;  3K81 C;  4JI1 L;  3UDX A;  5IP9 G;  4DR5 Q;  3S16 H;  4TQU S;  1S72 A;  4NPS A;  4A3D H;  3KJO A;  4C3H H;  4QL5 A;  2Z6K C;  2ZM6 Q;  4L5R C;  4ME3 A;  4JI0 Q;  4BBS G;  3I7F A;  1NMG A;  3GDE A;  5ELN A;  1HR0 Q;  4UPA A;  2KHI A;  4A3F G;  1QVG A;  1WJJ A;  1TWH H;  3TRZ A;  1VQF A;  2NZO A;  1IBK L;  3CC4 A;  1PVO A;  4JI2 L;  3HOZ G;  1L1O A;  1X65 A;  3I4N G;  3EBE A;  2JJQ A;  1V1Q A;  4BY7 H;  1VQB A;  3MEF A;  4KLK A;  3J7A 5;  4MTN A;  4UP7 A;  1SN8 A;  1E1O A;  1VQP A;  3UE1 A;  1N36 Q;  1Q1B A;  2EQS A;  1N36 L;  1GO3 E;  1RL2 A;  3T1Y L;  2CFM A;  4R1J A;  2VQE Q;  1PH7 A;  5JJK A;  4GNX B;  5LMN Q;  1N34 Q;  1JJ2 A;  1X3F A;  2JA9 A;  3CCJ A;  3E9I A;  4A3B G;  4LFB Q;  1SMX A;  1IL2 A;  1JMC A;  1UE5 A;  2OTL A;  3H3V I;  1SFO H;  4BBR H;  3TRE A;  2IX0 A;  1HZ9 A;  1YHQ A;  2C35 B;  5C0X G;  4HIK A;  5C3E G;  3J81 i;  3OTO Q;  4A3I H;  2PI2 E;  1YNX A;  4HIM A;  4IJH A;  4GN5 A;  5JJL A;  3STB C;  1Q46 A;  1LM0 A;  3HOX H;  1A63 A;  3H0G G;  4DV3 L;  1VQI A;  4DK6 C;  1JJC B;  4AQY Q;  4GNX A;  4BXX H;  4C2M H;  4GKJ Q;  2K4K A;  2BH2 A;  2JA5 G;  4A3D G;  4OO1 I;  5IYC G;  1PYS B;  1YJN A;  1XMQ Q;  1HNZ L;  1QVC A;  1FL0 A;  2E2I H;  3AYH B;  1BBW A;  3J80 i;  4BBR G;  1W2B A;  2ID0 A;  2ZJQ A;  4B3R Q;  2RHQ B;  4IO9 A;  5JEA G;  1L1O B;  2GN5 A;  1Y1W H;  3HOV H;  4X64 Q;  2D0O A;  4DV1 Q;  1G29 1;  1VQ6 A;  2IHE A;  1YEZ A;  2JE6 I;  2ZTD A;  1YI2 A;  2AMC B;  3GTJ H;  4GNX C;  3T1H Q;  2NVT H;  4BA1 I;  1O7I A;  2PQA B;  2JQO A;  4JI5 Q;  2IX1 A;  4JC0 A;  5C0X J;  2YV5 A;  1TWG H;  4B3R L;  2VY3 A;  5GAE C;  1NTG A;  4P72 A;  2R6G A;  4XIG S;  2AHO B;  2AKW B;  1M1K C;  1MJE A;  1C9O A;  1XPO A;  2F3I A;  3HOV G;  5JJI A;  3LGJ A;  2EIF A;  2E5L Q;  2N3S A;  1Y14 B;  2ZJP A;  3JAM i;  1B7Y B;  4UP9 A;  4X65 L;  2K52 A;  3RR5 A;  2QA4 A;  1N9W A;  5FLM H;  4DV6 L;  5C44 H;  3PUV A;  4H02 A;  4NXM L;  2UXC Q;  4JI3 L;  2JA8 H;  1P16 A;  1EWI A;  5IYB H;  4EX5 A;  4DUY Q;  1S3O A;  5JEA J;  1XPU A;  1Y1V G;  4O2D A;  3S17 H;  5C4X G;  1PFS A;  2K5N A;  4GLV B;  5IWA L;  2CCZ A;  4GOP A;  3S1N H;  5IWA Q;  3K8A A;  4YY3 Q;  3PUZ A;  1QZH A;  2UUA Q;  4BXX G;  4GKK Q;  1UWV A;  4KHP Q;  5E7N A;  1N33 Q;  3HOW G;  1E22 A;  5IYB G;  3UDI A;  2MFI A;  3KLW A;  1FVI A;  2CWP A;  4QGU A;  2K5V A;  2KEN A;  3GTQ H;  2R93 H;  4QJF A;  2R92 H;  5M5W H;  1G6P A;  2QGQ A;  1FJG L;  4YWM A;  1X54 A;  5FLM G;  4LF8 Q;  3NEM A;  4FDB A;  1H95 A;  4JYA L;  3PO3 H;  3ERS X;  3A74 A;  4X62 L;  2UUB L;  1KD1 C;  1A8V A;  3DM3 A;  4LF7 L;  3U50 C;  4B3S L;  4B3M Q;  1NE3 A;  4BY7 G;  1PH9 A;  2IY5 B;  3F2D A;  1QUQ B;  1TWC H;  4DR1 L;  4DR5 L;  2HIX A;  2ALY B;  5HY6 A;  1YVC A;  3W1B A;  1E7Z A;  3RN2 A;  1Q86 C;  1BVS A;  2DUD A;  4A3K G;  5IYD H;  1IBM L;  3A0J A;  2Q2H A;  3RNU A;  2IHF A;  3WWV A;  3U4V A;  4OWW B;  1AE3 A;  3FKI G;  3HOY G;  1IXR A;  1KC8 C;  4LF5 L;  3FP9 A;  1K9M C;  3HOU G;  4UP8 A;  3JC6 6;  4AYB G;  3GTO H;  4DV0 Q;  4JI7 L;  3JAM c;  3CCQ A;  4A3M H;  4P73 A;  1VQ9 A;  1V43 A;  4OO1 G;  4JOI C;  1BKB A;  3GD7 A;  4BBS H;  4DV1 L;  5M3F G;  4R4Q A;  5IP7 G;  3MXN B;  2IT1 A;  2HQL A;  1LUZ A;  2PI2 A;  1WCM H;  4JI5 L;  5LMU Q;  1K73 C;  1CKM A;  4GS3 A;  4IPD A;  4XTC S;  1N8R C;  4LNQ A;  5IYC H;  1AE2 A;  1Q12 A;  4BA2 I;  3PUY A;  3S1Q H;  3AFQ A;  4DR2 Q;  3RLN A;  2VL6 A;  4JG2 A;  1HH2 P;  4JOI A;  5IP7 H;  4A3G H;  4X65 Q;  4QIW E;  4HJA A;  4A4I A;  1UE6 A;  4LF7 Q;  4IJL A;  2HT1 A;  2VQF L;  4A3B H;  2VS1 A;  1XJV A;  1VQG A;  1MKH A;  4BY1 G;  1XNR Q;  1B70 B;  1TXY A;  4DR1 Q;  2CQO A;  2ZTC A;  4GOP B;  1VQ4 A;  1K8G A;  1IBM Q;  4A93 H;  1XMO Q;  2QEX A;  4KI0 A;  3J81 c;  3H3V H;  3BJU A;  4C3J H;  5IYD G;  3PO2 H;  1Z9F A;  2HIV A;  2MQH A;  1JB7 A;  3UDG A;  2JA8 G;  2OQ0 A;  2K14 A;  4PMW A;  4JI8 L;  2UUA L;  2VUM H;  3KYH C;  2OCE A;  4A3G G;  4YWK A;  4A75 A;  4JCV E;  4DR6 L;  2N78 A;  1HR0 W;  1K8A C;  1SRU A;  3D0F A;  1XPR A;  1WOC A;  2N49 A;  1VS0 A;  1L1O C;  4IFD I;  3NEL A;  3CCM A;  2WFW A;  3F2B A;  3J80 c;  3CXC A;  3VDY A;  2ZM6 L;  4RMF A;  1PV4 A;  2KCM A;  1SLJ A;  2Z0S A;  1OXT A;  5LMN L;  1N34 L;  2A1A A;  2RF4 A;  4DK3 C;  4K0K L;  1HR0 L;  4DV4 L;  1E3P A;  2PQA A;  3PSI A;  4P75 A;  4ALP A;  3HOW H;  4A3M G;  1HNW L;  3CPW A;  4IPC A;  2GVA A;  2D62 A;  1I5F A;  1VQA A;  3F1Z A;  4DV7 Q;  2UUC L;  1CKN B;  3KFU A;  5GAG C;  4APV A;  2K50 A;  4LW1 A;  2VQF Q;  4DUZ Q;  4MNO A;  3UDF A;  4DV4 Q;  2NZH A;  3CPF A;  4AH6 A;  4EQ5 A;  1PH8 A;  4JI3 Q;  3STB D;  5GAH C;  4LFB L;  2MO0 A;  2AWO A;  3PCO B;  4LFA Q;  5C3E H;  1N33 L;  2JA6 G;  3H15 A;  2B63 H;  1CSQ A;  3M4Q A;  3CF5 A;  1XMO L;  3PUX A;  1VQ5 A;  2JA7 H;  1FJG Q;  3I2Z A;  5J3B A;  3G4S A;  5M3M H;  2UXD L;  1KIX A;  3FHW A;  1YIJ A;  3OW2 A;  1KRS A;  4YHH L;  5DLQ E;  3CCR A;  1P8L A;  3GO5 A;  3KDF A;  1X9N A;  2R93 G;  4LF9 Q;  2NN6 I;  4GKK L;  1Q8K A;  1Q82 C;  1HNZ Q;  1YHB A;  3J81 j;  2F4V Q;  3S1M H;  4QQB X;  1MIU A;  1ASZ A;  2UUB Q;  3TS2 A;  1PH6 A;  3K0X A;  4L5T A;  1A0I A;  1SR3 A;  2WAQ E;  3AFP A;  1XMQ L;  1VQ7 A;  1YJ9 A;  4TVA B;  3CAM A;  2RHS B;  5IP9 H;  3CD6 A;  1NBW A;  1X3G A;  1VQE A;  2ZJR A;  1HJP A;  2JK8 A;  4R4C A;  1QZG A;  2A19 A;  3EIV A;  2K5H A;  1PYB A;  4X64 L;  4B3M L;  1Q81 C;  5IE8 A;  4B3S Q;  3CCE A;  1OXU A;  1A62 A;  2EXD A;  3NEN A;  4DV5 Q;  1PH1 A;  2ATW A;  1PH3 A;  1Q7Y C;  3HKZ G;  4NXN L;  4DR7 Q;  4DV7 L;  4A3E G;  5C44 G;  4DUY L;  4OXP A;  4LUO A;  3Q8D A;  3HOY H;  1HNW Q;  3J7Z C;  2RCN A;  1UEB A;  3GTM H;  2PMZ E;  3S14 H;  4KHP L;  1X55 A;  2NVY H;  4P71 A;  1E1T A;  1G51 A;  1VQC A;  1WFQ A;  4IOC A;  3RZO H;  1EUJ A;  4O0A A;  3SGI A;  2PNH A;  3TEH B;  4JBW A;  4LF8 L;  3ULP A;  2UUC Q;  4LUZ A;  4X6A H;  1EQR A;  2HHH Q;  3CCU A;  4LF6 L;  2YTX A;  1V9P A;  4POF A;  4OWT B;  2JEB I;  2UXB L;  4DV6 Q;  2B29 A;  2FXQ A;  4JBK A;  4LF9 L;  4OWX B;  4DR2 L;  2R7Z G;  1TWF H;  2BA0 A;  3G6E A;  3M7N A;  1I6H H;  4A3F H;  2XTI A;  3GTK H;  4DNI A;  1KL9 A;  5EAY A;  1I50 H;  1YZ6 A;  1K3R A;  3PUW A;  2WB1 G;  5H1S E;  4IFD J;  3PF5 A;  4B3T Q;  1J6Q A;  4IFD G;  1N32 L;  3KF6 B;  2R7Z H;  3ULL A;  3K7U C;  3HOU H;  1WCM G;  3PF4 A;  1VQH A;  1U5K A;  2Y0S G;  2YTY A;  4WJ3 M;  3CQZ H;  1QVF A;  1D7Q A;  4GN3 B;  2XGT A;  4UY8 C;  3S2D H;  2VUM G;  1N32 Q;  1ASY A;  1M90 C;  2DGY A;  1GKH A;  4AYB E;  1I94 L;  4R4T A;  1Q1E A;  3CMA A;  2V1C C;  4JI4 Q;  1C7Y A;  2JA7 G;  3U4Z A;  1YBY A;  5BR8 L;  1YIT A;  4A3J H;  5BR8 Q;  1PH5 A;  3EN2 A;  3DLL A;  2Z6K A;  1EIF A;  4PZ8 A;  4A3E H;  4DV2 Q;  4P74 A;  3HKZ E;  4BY1 H;  1HNX L;  1EYG A;  2N8N A;  1LYL A;  3CW2 C;  1X6O A;  3CC7 A;  4X66 L;  4HJ7 A;  4DUZ L;  3U58 A;  4JI4 L;  3I56 A;  3AEV A;  3OTO L;  1FGU A;  3I4N H;  3HOZ H;  3CP0 A;  2E8G A;  4AIM A;  3RN5 A;  3PIP A;  1EIY B;  3PIO A;  3F8T A;  1KAW A;  3A5U A;  1CUK A;  1U0L A;  3KDF B;  4DR7 L;  2D0P A;  1K83 H;  4JI2 Q;  5C0X I;  4LF6 Q;  4AQY L;  4OX9 Q;  2I5L X;  1B8A A;  1WI5 A;  2YYZ A;  2BH8 A;  3M9B A;  4YY3 L;  1HZA A;  2JEA I;  1VQL A;  2OQK A;  3ICE A;  3TQY A;  3OYY A;  3W1G A;  4LUV A;  4J15 A;  1VQM A;  1HZB A;  4JBM A;  2I5H A;  4YCW A;  1PHJ A;  2F52 A;  3RZD H;  1WYD A;  4DR3 Q;  3BZK A;  1GVP A;  3CCS A;  4A3C H;  1GD7 A;  1Z47 A;  1S40 A;  2I0Q A;  1LTL A;  1SE8 A;  1CKN A;  2ZTE A;  3S24 A;  4A76 A;  4A3L H;  4LFC L;  5FJ8 G;  1MJC A;  2WB1 E;  5AJ3 L;  3S2H H;  2E5L L;  4A3J G;  1VQN A;  1EOV A;  4JYA Q;  5GRO A;  2I5M X;  3L0O A;  1HNX Q;  2LXJ A;  1YHA A;  4DR6 Q;  2VNU D;  3BU2 A;  4DV5 L;  2B63 G;  4NXM Q;  4PG3 A;  1KXL A;  1UE1 A;  3HKS A;  1K0R A;  4LF4 L;  5IT9 c;  4DV2 L;  1Y1W G;  3T1Y Q;  4DV0 L;  2R7D A;  4JI7 Q;  3M3Y H;  4JI0 L;  4YCV A;  5C4J H;  1JE5 A;  4RG1 A;  2VW9 A;  2E2H H;  3KJP A;  1DGS A;  3M4P A;  4JBJ A;  2VZA A;  4NB3 A;  1J5E L;  2NN6 G;  5M3F H;  5LMU L;  4HJ9 A;  3TS0 A;  1I94 Q;  3W5O A;  2Q2U A;  4Y52 H;  1T9H A;  1X56 A;  4IPH A;  2MNA A;  1I3Q H;  3K80 C;  3AQQ A;  4WJ4 A;  1GM5 A;  2UU9 Q;  2CKZ B;  3I4O A;  1J5E Q;  4LFA L;  1W3S A;  1SRO A;  3E0E A;  1BBU A;  1E24 A;  5ELO A;  2F4V L;  1PA6 A;  4L5S A;  4PZ7 A;  1KQS A;  3CCL A;  1VQO A;  3I4M G;  1OTC A;  2K75 A;  1JT8 A;  2LSS A;  1IBL L;  4JI6 Q;  4MZ9 A;  4YHH Q;  1OXS C;  4A3I G;  1OXX K;  4KHZ A;  3S1R H;  2UXB Q;  4IOA A;  2YTV A;  1L0W A;  2KHJ A; 
#chains in the Genus database with same CATH topology
 2R7F A;  3G48 A;  1B50 A;  4A3L G;  1XTD A;  4LWC A;  4V19 0;  4A93 G;  1I6V C;  1LT6 D;  5C4Z A;  5KYI A;  3B6Y A;  3SK4 A;  1DYQ A;  4LF4 Q;  1L0Y B;  5GQO A;  2F0J A;  1ZYR C;  1SNM A;  2OTJ A;  3HRZ C;  4DNT B;  5LMN W;  3MC0 B;  1X3E A;  4DR3 L;  2KBN A;  2F4I A;  1PYW D;  2R3Z A;  4OGQ C;  1EL0 A;  3T1H L;  4POG A;  4QY7 A;  4FO2 A;  3PO2 G;  2O5J C;  3H0G H;  3CCV A;  3K7A H;  1SXT A;  3K5M A;  2BDN A;  4A3D B;  3A7L A;  3BG3 A;  1VCI A;  1L2F A;  5C4X H;  3A5Z B;  3L7Z C;  1R4Q B;  2Y0S B;  3VA7 A;  3KF6 A;  3PQI A;  1CKO A;  4OON A;  2AWN A;  4CJ2 C;  5HUR A;  1F9R A;  5D65 A;  1YNJ C;  4A3J B;  4OEL B;  4B3T L;  3PO3 G;  4QF4 A;  2H5X A;  1PRT C;  4L5Q A;  2CH4 A;  1U4L A;  1PZK D;  2R92 G;  4OHJ A;  4H44 C;  2Q2I A;  1TWA H;  1QG7 A;  3KOJ A;  1IYJ B;  3N52 A;  5FLX c;  3ULJ A;  2JXM B;  5C4X B;  2JYO A;  5M3F B;  1HFN A;  3UDX A;  4DR5 Q;  1WTW A;  2K05 A;  3QJY A;  4QL5 A;  2Z6K C;  4L5R C;  4RHR A;  4BBS G;  3GDE A;  3S1N B;  4UPA A;  3ITP A;  1WJJ A;  2D9U A;  2NZO A;  5C0X H;  3I4N G;  2JJQ A;  1O78 A;  4BY7 H;  3J7A 5;  4KLK A;  4UAI A;  1N36 Q;  4PQX A;  1EZ6 A;  1PTO H;  3DWQ A;  1JIC A;  2CFM A;  2KOL A;  4A93 B;  3E9I A;  4LFB Q;  2RDH A;  1SFO H;  5JPN C;  1HZ9 A;  2RKS A;  5C0X G;  2J7Z A;  2BCO A;  2BE5 D;  4CKE A;  1ET9 A;  2PI2 E;  1YNX A;  1NCV A;  2GA4 B;  3DMU A;  3ERQ A;  1Q46 A;  2ZT9 C;  1A63 A;  1VQI A;  5ELC A;  3S16 B;  2B2T C;  2PZW A;  4GKJ Q;  3NE5 B;  2NBF A;  1FL0 A;  1EYC A;  3A54 A;  3NSW A;  3J80 i;  3R3O A;  2ZJQ A;  2FJ2 A;  2RHQ B;  1Y1W H;  5JEA G;  5BN4 A;  2K28 A;  3X3N A;  4A3I B;  1A2U A;  2IHE A;  1EY0 A;  1YEZ A;  3Q24 A;  3S17 H;  2IX1 A;  2IW3 A;  5C0X J;  1TWG H;  1NSN S;  5GAE C;  4XIG S;  4IUV A;  4ZKB B;  5IIF A;  2EIF A;  5F2D A;  2TMP A;  5T1I A;  3RR5 A;  2QA4 A;  3D6C A;  1PLF A;  2XSC A;  5CMD A;  1DXM A;  2IPK D;  2PPB C;  2L12 A;  4RH6 A;  4ZUI A;  1S4Z A;  5IYB H;  3MHB A;  3NQT A;  3W2D A;  1S3O A;  5JEA J;  4DUY Q;  1H9R A;  3K7A B;  3S1N H;  3K8A A;  1S5D D;  1N33 Q;  1VDZ A;  5ELF A;  2EYF A;  4G7Z C;  2R93 H;  5FO8 B;  2SEB D;  1FJG L;  2X69 A;  3NEM A;  2XRQ D;  4JYA L;  3I4N B;  3A74 A;  4X62 L;  4DAY A;  1A8V A;  3DM3 A;  2KCN A;  1ZEQ X;  4BY7 G;  2IY5 B;  4N9P A;  1GHJ A;  5E1F A;  5DM6 3;  4DR1 L;  4DR5 L;  2J4X A;  2ALY B;  2KA7 A;  3PO3 B;  2DUD A;  1IBM L;  3A0J A;  2Q2H A;  3RNU A;  2DNC A;  2E74 C;  1CI3 M;  4LF5 L;  2HDM A;  2DY8 A;  4UP8 A;  3JC6 6;  1SE3 A;  3QIA A;  4BS9 A;  2C5C A;  4A3M H;  2F0P A;  1D1K A;  4BBS H;  3U9S A;  1QB5 D;  4PNY A;  4DA2 A;  5CV4 A;  5IP7 G;  2R7Z B;  3G6J B;  1T5X D;  1LUZ A;  4JI5 L;  1B53 A;  1FNW A;  5LMU Q;  3BYY B;  3FEW X;  3KBG A;  2Z4I A;  1STY A;  1AFP A;  1Q12 A;  4A3F B;  3PUY A;  4S3S A;  3AFQ A;  4DR2 Q;  4OIK A;  2LY7 A;  3NHH A;  1HTP A;  4KHV A;  1JOQ A;  4A4I A;  2F0O A;  2HT1 A;  1ZKO A;  5J22 A;  5KRU A;  4A3B H;  2VS1 A;  1MKH A;  3J7Y W;  2E76 C;  2QEX A;  3H3V H;  1SYE A;  3H6M A;  3SHL A;  3UDG A;  2JA8 G;  4ILW A;  2OQ0 A;  4JI8 L;  2X6L A;  1B1Z A;  4ULL A;  4FXK C;  2TSS A;  4YWK A;  4A3G G;  2F0W A;  1K8M A;  5DAU A;  4XYO A;  4KTA A;  5BN5 A;  2M00 A;  3AB9 A;  1ESR A;  3D0F A;  2N49 A;  1D5M C;  1WTQ A;  1MSH A;  4RMF A;  2Z0S A;  1OXT A;  2B8G A;  4DK3 C;  2RSN A;  1HR0 L;  1EFI D;  1SSO A;  3PSI A;  5D3D A;  3HOW H;  1HTL D;  1CK1 A;  3GQB A;  1HNW L;  3CPW A;  2GVA A;  3F1Z A;  3SVM A;  1RHP A;  2Z8L A;  4BBR B;  1EY8 A;  2KUM A;  1Y8P B;  1V1P A;  3BDL A;  4LW1 A;  4DUZ Q;  5DNF A;  4JI4 Q;  3TRZ A;  2NZH A;  4EQ5 A;  4K5X A;  1BCP F;  5C3E H;  2ICE C;  1N33 L;  2JA6 G;  5KYL A;  1CSQ A;  3M4Q A;  4BY7 B;  2JA7 H;  1AN8 A;  2L5T A;  1GUS A;  1IKM A;  5M3M H;  4FP5 D;  3NBI A;  5EBC A;  4B9X A;  1YIJ A;  1KRS A;  4R8N A;  1P8L A;  2NN6 I;  3IFT A;  4M8A A;  3T53 B;  1Q82 C;  1YHB A;  4AYB B;  4N8X 1;  3S1M H;  1STG A;  1MIU A;  2K7V A;  4HMI A;  1Z7T A;  3D4R A;  1U4R A;  1PH6 A;  3AU7 A;  5D3I B;  1EQT A;  1SR3 A;  2EYO A;  3AFP A;  1VQ7 A;  4TVA B;  2RHS B;  3CD6 A;  1NBW A;  1X3G A;  2A6E C;  2JK8 A;  2E2H B;  1PFN A;  1Q8I A;  2F0H A;  3PIP 3;  4B3M L;  1Q81 C;  4O42 A;  2CVR A;  3H94 A;  1PH1 A;  4IUT A;  1STH A;  3HOY H;  1SE2 A;  1TWC B;  1CFM A;  1B4O A;  2PMZ E;  2Z9H A;  1X55 A;  2NVY H;  4P71 A;  5FKA C;  3GTM B;  4JW0 A;  1VQC A;  1WFQ A;  2L0C A;  4IOC A;  3I4L A;  2LMC B;  2WAQ B;  3RZO H;  1EWH A;  2J0T D;  3ULP A;  4X6A H;  1F2L A;  1STA A;  2YTX A;  1LTI D;  3SEB A;  1LTA D;  2UXB L;  4GZY C;  2FXQ A;  4JBK A;  4LF9 L;  4XQN A;  3G6E A;  1I6H H;  2XTI A;  1K3B C;  5EAY A;  1I50 H;  1YZ6 A;  1U4P A;  5FOB B;  1K3R A;  4IAL A;  1J6Q A;  2PMZ B;  2L4N A;  3KF6 B;  3IAY A;  2NVX B;  2EYM A;  3V05 A;  4K2K A;  3PF4 A;  1VQH A;  1A3U A;  1HCZ A;  3A55 A;  2Y0S G;  1D7Q A;  5A2Q L;  3K57 A;  2KHS A;  2VUM G;  3OHX C;  1M90 C;  2DGY A;  5M3M B;  4R4T A;  1KDB A;  3CMA A;  1C7Y A;  1JC7 A;  1DON A;  3D3R A;  5BR8 L;  4FF4 A;  3EQL C;  5BR8 Q;  2I07 B;  2ZXR A;  2Z6K A;  3OW7 A;  1AP0 A;  5CV9 A;  4DXG A;  1HNX L;  2N8N A;  3CW2 C;  3CC7 A;  4X66 L;  4DUZ L;  4JI4 L;  3OTO L;  3PIO A;  1CUK A;  1U0L A;  3KDF B;  1K83 H;  3PO2 B;  4LF6 Q;  3D4W A;  2PNR C;  4OX9 Q;  4I7Z C;  3M3Y B;  3U9O A;  4QCL A;  3TQY A;  2F0T A;  3A8K E;  3W1G A;  1EEF D;  1U4M A;  1JE4 A;  4YCW A;  1SNO A;  1WYD A;  4IQZ A;  1Z47 A;  5C44 B;  4KY6 A;  3RZO B;  2EDG A;  2I0Q A;  4A3L H;  2B2T A;  4A3J G;  4WJW A;  3H3V C;  1E2Z A;  5ELB A;  1HNX Q;  2DNE A;  3L0O A;  1J8I A;  1TWG B;  4NXM Q;  1UE1 A;  3JAM L;  1LO5 D;  4DV2 L;  4LF4 L;  3KLR A;  2MP1 A;  2RCF A;  3MXU A;  2R7D A;  2N55 A;  4CJ0 B;  5C4J H;  1JE5 A;  4RFB A;  3KJP A;  1DGS A;  4NB3 A;  2Q2U A;  1JB3 A;  4L63 B;  3PMF A;  1I94 Q;  3K0Y A;  1ML0 D;  1X56 A;  2MNA A;  3K80 C;  4BBS B;  5CYU A;  3I4O A;  4LFA L;  3E0E A;  1E24 A;  4DXF A;  2F4V L;  4L5S A;  1VQO A;  1F9P A;  4A3E B;  1LTR D;  3S1R H;  1OXX K;  4KHZ A;  1L0W A;  5HGQ A;  1HPC A;  1LAB A;  1KDC A;  5M5Y H;  3S15 H;  3N6R A;  1KRT A;  2JA7 B;  1NMF A;  2YU9 H;  4DR4 Q;  3QOL A;  1GJX A;  2WAQ G;  3ERO A;  1NR2 A;  3ER0 A;  2NVX H;  1AH9 A;  5FJ8 H;  4PZ6 A;  4X3T A;  3M4O H;  5EJW A;  3J80 E;  2B2V C;  1QNK A;  4ZUJ A;  1KTK A;  5CV6 A;  4K0K Q;  1HQR D;  3BVZ A;  4IFD H;  1YNN C;  4I7A A;  2QEJ C;  3IL8 A;  2RVL A;  4ZK9 B;  2OT2 A;  1PH4 A;  3H0G B;  2CWA A;  4Y7N B;  1UE7 A;  2LXK A;  2QKI C;  2B3G A;  4HJ5 A;  2UU9 L;  1NJI C;  2B2V A;  1QUQ A;  3V2T A;  3GTL H;  4K6D A;  4X3U A;  2HHH L;  4X66 Q;  3UE0 A;  1Y1V H;  2A6E D;  1HZC A;  3CME A;  1PZI D;  4GLX A;  4K8J A;  3Q6S A;  3DEP A;  4C1N I;  5GAD C;  1EFW A;  4GLA C;  3IRB A;  1GHK A;  4DR4 L;  3T13 A;  3F2C A;  2A8V A;  1VQK A;  3I4M H;  4G4K A;  2CW0 C;  5M5X H;  2MPM A;  3FMC A;  2MO1 A;  1ILQ A;  3CC2 A;  2L15 A;  1VQ8 A;  1RJT A;  2BE5 C;  1JQY D;  3RLO A;  5AJ3 Q;  4LFC Q;  2OWO A;  3RLF A;  1D8L A;  2BDO A;  3M85 A;  3ZJY C;  5IGG A;  1RTN A;  4R4O A;  4MIU A;  1YJW A;  4X3S A;  1ONL A;  4CKC A;  5M5W B;  4YWL A;  5CBE E;  1E2V A;  1SYB A;  4TQU S;  4A3D H;  2F0I A;  1ICF B;  4F87 A;  2WKD A;  3NTH A;  4J8Q A;  5CGK A;  4F7X A;  5J39 A;  1NMG A;  1HR0 Q;  2KHI A;  4A3F G;  1QVG A;  1SMY C;  1FGB D;  1IBK L;  1PVO A;  3HOZ G;  3NWS A;  1FYC A;  4J6H A;  1VQB A;  1LV9 A;  4MTN A;  1SN8 A;  1PFB A;  1PTO B;  4C3J B;  1HA5 A;  1QCB D;  1KLU D;  2VQE Q;  5JJK A;  3KLS A;  5LMN Q;  5TSS A;  1N34 Q;  5ELE A;  1JJ2 A;  2JA9 A;  4HCE A;  3HOY B;  1SNP A;  3VA5 A;  3H3V I;  1K0S A;  2QF7 A;  2IX0 A;  1YHQ A;  2C35 B;  3DWA A;  1O7L A;  3FDT A;  3J81 i;  2F3W A;  1II3 A;  4HIM A;  1HRJ A;  1ROD A;  3STB C;  1LM0 A;  4GNX A;  4C2M H;  3MWY W;  3VYS A;  4FXG C;  4A3D G;  5IGD A;  4OO1 I;  1PYS B;  1YJN A;  4HED A;  3AYH B;  1W2B A;  2ID0 A;  1CZG A;  2SOB A;  2L11 A;  4IO9 A;  5EKL A;  3K58 A;  4X64 Q;  2H1E A;  2A74 C;  1G29 1;  4K2L A;  2ZTD A;  2NVT H;  3LX0 A;  3GTJ H;  4GNX C;  1O7I A;  2PQA B;  2JQO A;  4X3K A;  1EY4 A;  4JC0 A;  3I3C A;  3MXG A;  4B3R L;  1QOH A;  1M1K C;  2R6G A;  5NUC A;  1SFO B;  1XPO A;  1J9O A;  2E5L Q;  2P5Z X;  2ZJP A;  2L55 A;  1B7Y B;  2AUK A;  4Q5V A;  1LTT D;  3NBH A;  1BCP C;  4H02 A;  1P16 A;  3H91 A;  3R2T A;  4IUU A;  5KGU A;  1TII D;  1Y1V G;  1PFS A;  1I6H B;  4GOP A;  5IWA Q;  1XX8 A;  4A3M B;  1ILP A;  2NWG A;  3HG9 A;  2RSO A;  2OF1 A;  3VR5 A;  3M4Y A;  2K5V A;  4HAE A;  4QJF A;  2R92 H;  1G6P A;  2XWB B;  3R8B A;  1UEA B;  3PO3 H;  1G8Z D;  3ERS X;  2WKC A;  2UUB L;  1PDQ A;  3U50 C;  1PH9 A;  1QUQ B;  1TWC H;  1X3P A;  1QE6 A;  1Q86 C;  3H09 A;  2AUJ D;  2EJF C;  1BVS A;  1I4G A;  4EQP A;  3KUP A;  2IHF A;  1SNQ A;  1QWY A;  2A68 C;  1K9M C;  2F0U A;  4AYB G;  4DV0 Q;  4JI7 L;  1V43 A;  5DEH A;  3GD7 A;  4DV1 L;  1WD1 A;  4ODG A;  5M3F G;  4R4Q A;  4TRD A;  3MXN B;  2IT1 A;  2HQL A;  2IX3 A;  4NW2 A;  4CHT B;  3TZU A;  4PV1 C;  3SR1 A;  4IPD A;  1I50 B;  3WOF A;  1N8R C;  5IYC H;  1AE2 A;  4JVZ A;  2JA5 B;  1TS5 A;  2EJM A;  1HH2 P;  4X65 Q;  4HJA A;  2A6H C;  3E5S A;  1UE6 A;  2XN9 C;  2EXZ A;  4LF7 Q;  1AZP A;  4Q0F A;  1STE A;  3P20 A;  1VQG A;  3HP3 A;  4BY1 G;  4KY5 A;  5IGF A;  1XNR Q;  1B70 B;  1TXY A;  2ZTC A;  1LTB D;  5IYD G;  3OOC A;  5CV5 A;  1H9M A;  4B08 A;  1JB7 A;  2UUA L;  4KKS A;  2OCE A;  4TKO B;  2CHB D;  2VB3 X;  4DR6 L;  2N78 A;  1IL8 A;  1SRU A;  4CBV A;  2EVB A;  3NEL A;  4DN4 M;  3CCM A;  4ABN A;  2B2W A;  4QIW B;  1PV4 A;  2KCM A;  1HHV A;  2RF4 A;  1R4P B;  1TVX A;  4DV4 L;  1E3P A;  2PQA A;  3A56 A;  3J7A F;  5GAG C;  4APV A;  2K50 A;  4RKB A;  2X6G A;  3D4D A;  4MN3 A;  2VQF Q;  1GUO A;  3TP5 A;  4LFB L;  4QUC A;  4JI3 Q;  3STB D;  5GAH C;  2MO0 A;  3SE0 A;  4LFA Q;  4WFN 3;  2D5D A;  4IUR A;  1UUP A;  1TKW B;  5KND A;  1EYA A;  3IKJ A;  3H15 A;  2K33 A;  3UI2 A;  1XMO L;  3PUX A;  1VQ5 A;  2MUY A;  5K36 H;  1FJG Q;  4CDD C;  2PW7 A;  1Y8O B;  1KIX A;  5KIX A;  3IFD A;  3GTJ B;  2F0F A;  2B63 B;  1NUC A;  1Q8K A;  4C3I B;  3FRP B;  1Y1W B;  4QQB X;  2KEE A;  3SXH A;  1ASZ A;  2UUB Q;  3TS2 A;  3K0X A;  4L5T A;  1A0I A;  2PW5 A;  1XMQ L;  4HCS A;  4C3H G;  1VQE A;  4R4C A;  1BCP D;  3TME A;  5CC4 A;  2K5H A;  4X64 L;  5IE8 A;  1OXU A;  3HKZ G;  5M5X B;  4NXN L;  2CQA A;  3GV6 A;  3DHQ A;  4YIJ A;  3I4M B;  5LHY 1;  4OXP A;  3Q8D A;  2G5D A;  2NVY B;  3GTM H;  3S14 B;  1G51 A;  4OIJ A;  5HGT A;  3EFX D;  4C56 C;  1EUJ A;  3SGI A;  1TY2 A;  3TEH B;  4JBW A;  4LF8 L;  1JWM D;  2UUC Q;  5JAV A;  3CCU A;  4RCN A;  2E2J B;  4POF A;  2JEB I;  4DV6 Q;  3NWT A;  4QB4 A;  1B44 D;  2R7Z G;  1TWF H;  2BA0 A;  1LLR D;  1PRT F;  1KL9 A;  1VF7 A;  4U67 3;  1GUN A;  1EU4 A;  4B3T Q;  3K5O A;  3ULL A;  2M9V A;  2FIN B;  4NP5 A;  4UHV A;  3RD4 A;  5AFW A;  3CQZ H;  1QVF A;  1ET6 A;  2XGT A;  1N32 Q;  3S2D H;  1ASY A;  1DCZ A;  1RDP D;  4XT3 B;  1I94 L;  1Q1E A;  3MZ5 A;  2V1C C;  5D14 A;  2JA7 G;  1BO0 A;  2K5Q A;  3SK6 A;  3EN2 A;  1BUV T;  3DLL A;  2NVT B;  2SNS A;  4WRD A;  5CV8 A;  4PZ8 A;  4P74 A;  4BY1 H;  1EYG A;  1RTO A;  1O7Z A;  3I56 A;  1XXG A;  3HOZ H;  3CP0 A;  2E8G A;  1DJR D;  3A5U A;  4DR7 L;  1F77 A;  2IWH A;  2O5I C;  2F0V A;  5I4D A;  2I5L X;  2MGS A;  2YYZ A;  2BH8 A;  1IYU A;  3OYY A;  1GUG A;  1WD0 A;  1VQM A;  3Q23 A;  4JBM A;  5IT9 L;  5KNB A;  4DR3 Q;  4ZRZ A;  3CCS A;  4DAP A;  2F0E A;  4A76 A;  1MJC A;  3S2H H;  1STN A;  2F0D A;  1EOV A;  1E0B A;  5GRO A;  4JYA Q;  2I5M X;  5C3W A;  4RKL A;  2LXJ A;  3LWE A;  4DR6 Q;  1PFM A;  2VNU D;  2F0Q A;  3OWF A;  3LWU A;  1Z6H A;  3QR8 A;  1K0R A;  1CA5 A;  5IT9 c;  5ISR A;  3T1Y Q;  3KLS X;  1MHW C;  4JI0 L;  3M3Y H;  4RG1 A;  2QDB A;  4N9T A;  1WTH A;  2VZA A;  2NN6 G;  4Y52 H;  4FF2 A;  4FNF A;  1HUN A;  4M1U B;  2UU9 Q;  1J5E Q;  4MTK A;  1H9J A;  2EYP A;  3LNN A;  2HQE A;  1PA6 A;  4PZ7 A;  3I4M G;  2EY1 A;  1OTC A;  2K75 A;  4QMG A;  1T5E A;  4H0L C;  4JI6 Q;  4MZ9 A;  2NB0 A;  2YTV A;  2D2C C;  2R61 A;  3GTO H;  1R9T H;  4K14 A;  4GOP C;  5JPM C;  4DAM A;  3QB3 A;  1XNQ Q;  4IN3 A;  2Q8I B;  3BDC A;  2DJG C;  3FPP A;  3MXN A;  1WTV A;  1RIP A;  3G71 A;  1EQQ A;  2WII B;  3EA6 A;  1JWU D;  3I72 A;  4JI8 Q;  4PMC A;  3QG1 A;  4NXN Q;  1I4P A;  1TWF B;  4R4I A;  4X62 Q;  4Y7N H;  2VQE L;  2F03 A;  4LK1 C;  1EOT A;  2E2J H;  1S5B D;  2F0K A;  1F9S A;  3GTG H;  3NQI A;  3HFZ B;  1WTO A;  1FD7 D;  1AZQ A;  4DAY B;  3M4O B;  4JI6 L;  3I8Z A;  2NUC A;  1VQJ A;  2A68 D;  1TR5 A;  3E9H A;  5JVH 3;  3I55 A;  1UAP A;  4HID A;  1XNQ L;  3S15 B;  4HIO A;  1HUM A;  4OX9 L;  1D5Z C;  2NVQ H;  1JJG A;  1XTC D;  3MTS A;  2UXC L;  2Q2T A;  3NP8 A;  4H7B A;  3L2P A;  2NTT A;  2AQ3 B;  2QW7 A;  5I2Y A;  5I9P A;  5I2X A;  4JPB W;  1KNA A;  3FKI B;  1TT2 A;  4HJ8 A;  1IZ6 A;  4KV6 A;  4RHS A;  3D31 A;  3M7G A;  1QIL A;  1NY4 A;  4F8M A;  2GVB A;  2Y0S E;  3OSO A;  1HA6 A;  3HOX G;  3MEH A;  4LF5 Q;  4JI1 L;  4G7O C;  2KEC A;  1S72 A;  4NPS A;  1DM0 B;  4C3H H;  4JI0 Q;  3I7F A;  5ELN A;  1BCP B;  2RDF A;  3W3A A;  2H4O A;  3CC4 A;  2SNM A;  1EQV A;  1X65 A;  1EY9 A;  3MEF A;  4LJZ C;  1VQP A;  3UE1 A;  2FFK B;  1GO3 E;  1RL2 A;  2RQX A;  5CBA E;  4R1J A;  2F0G A;  1PH7 A;  4GNX B;  4XQJ A;  1UE5 A;  1JMC A;  2OTL A;  3J80 L;  2V4D A;  3GTO B;  1A3V A;  4N8F A;  1EIG A;  2F3V A;  4B9W A;  3OTO Q;  3S1Q B;  1CHQ D;  4GN5 A;  1S5E D;  2PO4 A;  3H0G G;  3VYT A;  4DK6 C;  4DV3 L;  1KAB A;  2EYH A;  4AQY Q;  1PTO D;  3C3L A;  2K4K A;  1F2Y A;  2BH2 A;  2PZT A;  1XMQ Q;  1HNZ L;  3VR4 A;  4IUQ A;  2E2I H;  1YNJ D;  1BBW A;  3MVV A;  4BBR G;  3NXW A;  1L1O B;  2GN5 A;  3HOV H;  1MSG A;  1ZXT A;  2D0O A;  4DV1 Q;  1VQ6 A;  5C6A A;  2JE6 I;  1TY0 A;  3KK7 A;  4BA1 I;  4JI5 Q;  4P2C B;  4DGZ A;  2VY3 A;  1MJE A;  1GUW A;  2AHO B;  2AKW B;  5EKK A;  1F2M A;  2NVQ B;  3GV3 A;  3SK5 A;  4MHE A;  2F3I A;  5E4W C;  3HOV G;  3S2D B;  4L6T B;  5JJI A;  3CHB D;  2EYJ A;  2N3S A;  2XVS A;  2EZV A;  3JAM i;  4UP9 A;  2K03 A;  3DUZ A;  4X65 L;  4A3G B;  3BYT B;  3K5N A;  1N9W A;  3OMG A;  5FLM H;  3MAQ A;  4NXM L;  2UXC Q;  4JI3 L;  2JN4 A;  5CV7 A;  3T56 B;  1XPU A;  4H13 C;  1B9N A;  5C4X G;  2K5N A;  5IWA L;  5C5M A;  3X3M A;  1LT5 D;  4BXX G;  4GKK Q;  2UUA Q;  1IYV A;  5E7N A;  4C3H B;  3UDI A;  2MFI A;  1NAP A;  1FVI A;  3J81 E;  4QGU A;  1JCK B;  2PZU A;  2KEN A;  1D1I A;  1S5F D;  4YWM A;  1X54 A;  5FLM G;  1ENF A;  5JVG 3;  4LF8 Q;  4FDB A;  1H95 A;  1I4H A;  1A3T A;  4LF7 L;  4HN7 A;  4B3S L;  1NE3 A;  3BZD B;  3NTK A;  2HD3 A;  1ESF A;  1IBL L;  2HIX A;  1FNU A;  5HY6 A;  1YVC A;  3RN2 A;  4A3K G;  5IYD H;  1SAP A;  3WWV A;  3U4V A;  2R92 B;  2ENB A;  3FKI G;  2R93 B;  1KC8 C;  4CDE C;  3TN2 A;  3HOU G;  5KNC A;  2Q8R E;  1VQ9 A;  4OO1 G;  1BKB A;  1BQQ T;  5BN3 A;  2E2I B;  1WCM H;  2K1B A;  4NKL A;  4DU9 A;  1CKM A;  4R8I A;  4GS3 A;  1HFG A;  4XTC S;  2MJ8 A;  5L37 A;  4LNQ A;  1TS2 A;  4BA2 I;  3S1Q H;  3RLN A;  4JG2 A;  1CHP D;  4IOA A;  1WVL A;  2EE1 A;  2VQF L;  2FMC A;  4IUN A;  1GUT A;  1KLG D;  2CQO A;  4GOP B;  1K8G A;  2EYL A;  2BOS A;  1XMO Q;  1A6X A;  1SYD A;  1G6Z A;  4KI0 A;  3HOV B;  4ZAI A;  1Z9F A;  2HIV A;  2L9H A;  2MQH A;  3G7L A;  1C8C A;  4CJ1 B;  1NNX A;  2K14 A;  3C1E A;  2VUM H;  3KYH C;  5K5P A;  4A75 A;  3VR6 A;  1HR0 W;  2A69 D;  5LL6 S;  1XPR A;  4OEM B;  1L1O C;  4IFD I;  2WFW A;  2MHV A;  3J80 c;  3CXC A;  3VDY A;  5KEE A;  2ZXP A;  2ZM6 L;  3BS1 A;  4R9W A;  2A1A A;  3Q22 A;  3SDZ A;  4K0K L;  3K5L A;  3T4A C;  1C4Q A;  1LT3 D;  2D62 A;  1I5F A;  1VQA A;  4DV7 Q;  4EGV A;  2UUC L;  1CKN B;  4XYQ A;  3KFU A;  5EPJ A;  5FO7 B;  1TU2 B;  2WAC A;  5T1G A;  4MNO A;  3UDF A;  4ZKC B;  2JP1 A;  2K6A A;  2B2Y C;  2B63 H;  3OMC A;  3BVG A;  5ELD A;  5JOB A;  3I2Z A;  2UXD L;  3FHW A;  1G2T A;  3OW2 A;  2L1B A;  2DY7 A;  1X9N A;  1SYC A;  3HOU B;  4FF3 A;  3J81 j;  2F4V Q;  3EVQ A;  3E6Z X;  1E2W A;  4I65 A;  3FVQ A;  2WAQ E;  2NTS A;  3CAM A;  5IP9 H;  3HOW B;  2ZJR A;  1HJP A;  3PIO 3;  3MA2 B;  4LMQ D;  2A19 A;  3EIV A;  1QZG A;  5C4J B;  2A5H A;  4EVO A;  3CCE A;  1SYG A;  2VB2 X;  4ZLT F;  4DV5 Q;  5IGB A;  4A3E G;  4DUY L;  2G9H D;  4LUO A;  4RGO S;  4L8J A;  2PYK A;  1HNW Q;  2LKV A;  2RCN A;  1UEB A;  3S14 H;  4KHP L;  2M2L A;  3E3X A;  1E1T A;  1XYI A;  4RCO A;  4ME5 A;  5CR3 A;  3C46 A;  1HXY D;  2IL8 A;  5IOD A;  1K8O A;  5EPL A;  3TP6 A;  3Q0A A;  2HHH Q;  3KF8 A;  2E2D C;  1EZ8 A;  1B9M A;  1V1O A;  1HQM C;  4OWX B;  4DR2 L;  3M7N A;  4A3F H;  1KAA A;  3NK9 A;  4U68 A;  3QOJ A;  4NDX A;  1Y8N B;  3DM1 A;  3MXP A;  3PUW A;  2WB1 G;  4OO1 H;  3PF5 A;  4IFD G;  3VYU A;  1N32 L;  3NTI A;  2OXP A;  3K7U C;  3HOU H;  1U5K A;  2N88 A;  4GN3 B;  3OWE B;  4XXE A;  4BY1 B;  1CQF A;  1ICW A;  3R93 A;  2K32 A;  3U4Z A;  5I6W A;  1YIT A;  2XNA C;  1PH5 A;  2Z6B A;  4A3E H;  3HKZ E;  4BWG B;  3V96 A;  1LYL A;  1MGS A;  1Q3L A;  1SBB B;  1GOZ A;  1X6O A;  4XDX A;  1K28 A;  3AEV A;  1FGU A;  4ID6 A;  4PMB A;  3I4N H;  1I3Q B;  1PTO F;  3PIP A;  1EIY B;  2D0P A;  1X3Q A;  3GTG B;  4HSP A;  1SDF A;  1IKL A;  3M9B A;  2JEA I;  1HZA A;  5EPK A;  1B3A A;  1G2S A;  1BR9 A;  2OQK A;  4J15 A;  1MI2 A;  1W6J A;  1WTP A;  5EKI A;  2I5H A;  3EJI A;  1AW7 A;  1LAC A;  1U9R A;  3RZD H;  1UNS A;  1GVP A;  3BZK A;  2FHT A;  4DK0 A;  3HKZ B;  1GD7 A;  1S40 A;  1JOO A;  4KJO A;  2RDG A;  4DAV A;  1SE8 A;  1SE4 A;  3J7A V;  4FYD A;  2ZTE A;  3S24 A;  5FJ8 G;  1VQN A;  1SYF A;  1VF5 C;  3A8J E;  1YHA A;  4KKU A;  2QCP X;  5FLX L;  3BU2 A;  4DV5 L;  3HEJ A;  2B63 G;  4PG3 A;  1KXL A;  1Y1W G;  3KBX A;  1RCV D;  4DV0 L;  4JI7 Q;  5COY A;  4YCV A;  2KQ3 A;  2VW9 A;  1EU3 A;  2E2H H;  2EOT A;  2O4X A;  5LMU L;  4HJ9 A;  1PRT D;  3HS0 C;  3W5O A;  1T9H A;  1H9S B;  3WDN A;  1I3Q H;  4K6L A;  4JK1 C;  2JSO A;  4WJ4 A;  1GM5 A;  2CKZ B;  1SRO A;  1BBU A;  5I9O A;  3CCL A;  1JT8 A;  2LSS A;  1OXS C;  2K01 A;  4A3I G;  2UXB Q;  4O1N A;  2Z4H A;  2JA8 H;  4DF7 A;  2UXD Q;  4DV3 Q;  4JV5 Q;  3E0J A;  4KMU C;  1PRT B;  1SJE D;  4DKA C;  1C0A A;  1KHI A;  1M8A A;  2OEO A;  3PGZ A;  1IBL Q;  1PH2 A;  3GTP H;  2KCT A;  2BA1 A;  1VQD A;  4DPG A;  1I4Q A;  2HCI A;  2ES2 A;  3CRL C;  3GTK B;  4GN4 B;  5C4H A;  2F1M A;  3WOE A;  4JI1 Q;  3R2I A;  5EGT A;  1IBK Q;  5IT9 E;  4YCU A;  3JAM E;  1M4V A;  1JOK A;  1WCM B;  2K04 A;  2DN8 A;  4IPG A;  1XNR L;  1CSP A;  4C3I H;  4A3K H;  2VUM B;  5IY0 A;  3BZC A;  1OXV A;  5M3M G;  3FKI H;  2WP8 J;  4RAU C;  4JV5 L;  4KD4 A;  1DZ1 A;  3C2P A;  3S1R B;  1EIH A;  2JA6 H;  3PV0 A;  1CQV A;  3KF8 B;  5K36 G;  4Z9C B;  2B2U A;  1IW7 C;  3TZD A;  1ZYR D;  4WOR A;  1BNZ A;  1LTS D;  2EY2 A;  4A3C G;  1DOL A;  1S5C D;  3NBH B;  5FO9 B;  2JA5 H;  1Y1V B;  4GKJ L;  4F88 A;  1X32 A;  3OPO A;  2SDF A;  3VYR A;  2ASB A;  3K81 C;  5IP9 G;  3S16 H;  5FLX E;  1Y69 U;  3S1M B;  3C1F A;  4KY7 A;  3KJO A;  2ZM6 Q;  5A35 A;  4ME3 A;  4K8I A;  1SJH D;  1TWH H;  1VQF A;  4JI2 L;  1L1O A;  3EBE A;  1BF4 A;  1V1Q A;  4EQN A;  3L3O C;  4UP7 A;  1E1O A;  1Q1B A;  1FR3 A;  2B2W C;  2EQS A;  3T1Y L;  1N36 L;  3URY A;  4DNR B;  1WTR A;  1X3F A;  2K5D A;  5FK9 C;  3CCJ A;  4A3B G;  2A73 B;  2XWJ B;  1SMX A;  4IUP A;  1IL2 A;  4BBR H;  3TRE A;  3OIQ A;  4KKT A;  2AQ1 B;  5JEA H;  4HIK A;  5C3E G;  3S17 B;  3P75 A;  4CKB A;  2B2Y A;  4A3I H;  4IJH A;  2PCF B;  5JJL A;  3HOX H;  4C1N K;  1EYD A;  2RBM A;  3FPU B;  1JJC B;  4BXX H;  2WV6 D;  2JA5 G;  4J1M A;  1TS4 A;  2HDL A;  5IYC G;  1QVC A;  1CT1 D;  2O2L D;  2KCC A;  1OO9 B;  1V1P B;  3VR3 A;  1FNV A;  4B3R Q;  3MFG A;  1VMP A;  3TP8 A;  1YI2 A;  4ZCK A;  2AMC B;  3T1H Q;  2JA6 B;  2YV5 A;  4KK7 A;  3GTQ H;  1AEX A;  1NTG A;  4P72 A;  1C48 A;  1C9O A;  1B2T A;  1KNE A;  3LGJ A;  1Y14 B;  1SND A;  3CQZ B;  5EBD A;  3I70 A;  2K52 A;  4G57 A;  1CZW A;  1F2Z A;  4DV6 L;  5C44 H;  3PUV A;  4HR7 B;  4DK1 A;  3F2U A;  1F9Q A;  1EWI A;  2KED A;  4EX5 A;  4O2D A;  1PXU A;  4GLV B;  2CCZ A;  1QZH A;  4YY3 Q;  3PUZ A;  1UWV A;  4KHP Q;  3HOW G;  1EY5 A;  1E22 A;  2RA4 A;  5IYB G;  2LFN A;  4K5V A;  3KLW A;  1GXD C;  2CWP A;  4KN7 C;  1TQO A;  5M5W H;  2Z1C A;  2QGQ A;  4K5W A;  2PQE A;  2CH4 W;  1L0X B;  1RKN A;  3HOZ B;  1CA6 A;  3L9A X;  2I46 A;  1KD1 C;  1WTX A;  2ZXO A;  3NUC A;  4B3M Q;  3F2D A;  2IJ0 A;  3W1B A;  4C3J G;  1E7Z A;  3QO2 A;  1VMC A;  3GP7 A;  4OWW B;  1AE3 A;  3HOY G;  1IXR A;  2A69 C;  3A8I E;  3FP9 A;  1KDA A;  1TWH B;  3JAM c;  3CCQ A;  1CM9 A;  4P73 A;  4JOI C;  1O80 A;  2EY5 A;  2NN6 H;  3NPP A;  2G9D A;  2PI2 A;  1K73 C;  1D2B A;  2XRS D;  2NZ1 D;  4RWS C;  3HZX A;  1I4R A;  5JJZ A;  2HUG A;  2VL6 A;  5IP7 H;  4JOI A;  4A3G H;  4QIW E;  4IJL A;  3BVM A;  4KD3 A;  1XJV A;  2EPB A;  3GTQ B;  4DR1 Q;  3QWN A;  1JWS D;  1VQ4 A;  3D8G A;  2CW0 D;  1IBM Q;  4A93 H;  3T16 A;  1H9S A;  3J81 c;  3BJU A;  4C3J H;  1PMR A;  4PMW A;  1JR0 D;  4QUF A;  5M5Y B;  4JCV E;  3RZD B;  5IOC A;  4DFA A;  1K8A C;  1WOC A;  3I90 A;  3AMU A;  1CTM A;  1VS0 A;  3GTL B;  3F2B A;  5A2Q E;  1IW7 D;  1SLJ A;  5E4X A;  5LMN L;  1N34 L;  4P75 A;  4ALP A;  1D5X C;  3OIP A;  4A3M G;  3J81 L;  4IPC A;  4ZQ3 A;  3CRK C;  5DM7 3;  3HGB A;  3GTP B;  1PH8 A;  4DV4 Q;  3CPF A;  4AH6 A;  4CDC C;  1TWA B;  1BOS A;  2AWO A;  3PCO B;  1RD9 D;  1QNU A;  3P1H A;  4RGT A;  4RA8 A;  4CGY B;  4RGM A;  3CF5 A;  1DOM A;  2K5W A;  4FF1 A;  3ND8 A;  3RMH A;  2HCC A;  4XT1 B;  2KVM A;  3K6O A;  5J3B A;  3O13 A;  3G4S A;  3TDQ A;  1PTO C;  1EY6 A;  5LL6 X;  3D6W A;  4YHH L;  5DLQ E;  3CCR A;  3GO5 A;  3S2H B;  3KDF A;  3ONA B;  2R93 G;  4LF9 Q;  4GKK L;  1HNZ Q;  3CU7 A;  4OL7 A;  5EQ0 A;  4E6I A;  1ENA A;  2A6H D;  1BDO A;  1RF2 D;  2EJG C;  1YJ9 A;  2WIN B;  3TP7 A;  2QIL A;  3RUZ A;  2DJF C;  4B3S Q;  1PYB A;  5IGE A;  1A62 A;  2EXD A;  3NEN A;  1Q90 A;  2ATW A;  1PH3 A;  1Q7Y C;  4DR7 Q;  4DV7 L;  5C44 G;  4FVM A;  1DD2 A;  1IHZ A;  3J7Z C;  1LT4 D;  4UDU C;  4A3K B;  4O0A A;  1R9T B;  2JA8 B;  2PNH A;  4CDF C;  4LUZ A;  1DOK A;  1EQR A;  4LF6 L;  1V9P A;  4OWT B;  2E75 C;  2B29 A;  4ZYS A;  1D6E C;  3GTK H;  4G7H C;  4DNI A;  1K83 B;  1LTG D;  3K59 A;  5I6Y A;  5H1S E;  4IFD J;  2R7Z H;  1A15 A;  4TSS A;  1WCM G;  2B2U C;  4HMJ A;  1TS3 A;  2YTY A;  3A7A B;  2VXW A;  3CKI B;  4V0B A;  4WJ3 M;  1NR4 A;  3DXJ C;  4UY8 C;  1STB A;  1H9K A;  3SK8 A;  1GKH A;  1QJO A;  3ND9 A;  2F0S A;  4AYB E;  1YBY A;  4A3J H;  3VR2 A;  1EIF A;  1A2T A;  3ZYY X;  4HSV A;  4DV2 Q;  1SMY D;  4HJ7 A;  1MBY A;  3U58 A;  1EY7 A;  4C3I G;  5IGC A;  4AIM A;  1EEI D;  3RN5 A;  3F8T A;  1KAW A;  3TSS A;  1PZJ D;  4JI2 Q;  3MFY A;  5C0X I;  1G91 A;  4AQY L;  1B8A A;  2KJX A;  3HOX B;  1WI5 A;  1V8Q A;  5M9O A;  4YY3 L;  1VQL A;  3ICE A;  1I4X A;  1SNC A;  4LUV A;  4EQO A;  1B3Q A;  1HZB A;  1SEB D;  1PHJ A;  2F52 A;  2QDL A;  2F0N A;  5C3X A;  4A3C H;  4KN4 C;  4KJN A;  5C5L A;  3T51 B;  4IZ8 A;  2LS0 1;  1JOR A;  1BXT A;  4NMZ A;  2EY6 A;  1LTL A;  5COR A;  3DWP A;  1CKN A;  1EWC A;  1W6K A;  5E3F A;  4LFC L;  5AJ3 L;  2WB1 E;  3P7J A;  2E5L L;  4HTH A;  2YU9 B;  2FMM A;  1MD2 D;  2NYZ D;  1ENC A;  4A3B B;  3HKS A;  2B39 A;  4XQQ A;  4LAA A;  2Q8T A;  5C3E B;  2F0M A;  3S9W A;  2AQ2 B;  2B8F A;  3M4P A;  4JBJ A;  1J5E L;  3PO2 H;  5M3F H;  3TS0 A;  1YNN D;  3DEO A;  2C9O A;  4IPH A;  4C2M B;  1O7Y A;  2XIW A;  3AQQ A;  5G3L D;  2ICI A;  2WB1 B;  3BDO A;  1W3S A;  5ELO A;  5G3L F;  1KQS A;  4FXD A;  2F0L A;  1BBX C;  3I91 A;  5J1Z A;  4YHH Q;  3I73 A;  1XWE A;  4RGN A;  3TBI B;  2KHJ A; 
#chains in the Genus database with same CATH homology
 5HGQ A;  1R9T H;  2UXD Q;  2R7F A;  3G48 A;  5M5Y H;  3S15 H;  4GOP C;  4A3L G;  1KRT A;  4DAM A;  4DV3 Q;  1NMF A;  1XTD A;  4LWC A;  2YU9 H;  1XNQ Q;  4DR4 Q;  4JV5 Q;  4A93 G;  4DKA C;  1C0A A;  2WAQ G;  3B6Y A;  1KHI A;  3PGZ A;  1IBL Q;  3ER0 A;  2NVX H;  4LF4 Q;  1AH9 A;  5GQO A;  4PZ6 A;  5FJ8 H;  3M4O H;  2OTJ A;  1RIP A;  1PH2 A;  3GTP H;  2KCT A;  3G71 A;  5LMN W;  1EQQ A;  2BA1 A;  4K0K Q;  1X3E A;  1VQD A;  4DPG A;  2KBN A;  4DR3 L;  4JI8 Q;  2ES2 A;  3T1H L;  4GN4 B;  4NXN Q;  1PH4 A;  4QY7 A;  4R4I A;  4X62 Q;  4Y7N H;  2VQE L;  4POG A;  3PO2 G;  3H0G H;  2CWA A;  3K7A H;  3CCV A;  1UE7 A;  2LXK A;  2B3G A;  4HJ5 A;  2UU9 L;  4JI1 Q;  1NJI C;  2E2J H;  1QUQ A;  1VCI A;  3GTG H;  1IBK Q;  3GTL H;  2HHH L;  3HFZ B;  4YCU A;  1L2F A;  4X66 Q;  5C4X H;  3A5Z B;  3UE0 A;  1Y1V H;  4DAY B;  1HZC A;  3CME A;  4JI6 L;  3L7Z C;  4GLX A;  4IPG A;  3KF6 A;  1XNR L;  1CSP A;  1VQJ A;  4C3I H;  4A3K H;  3E9H A;  3I55 A;  5IY0 A;  5GAD C;  1CKO A;  1EFW A;  3BZC A;  1OXV A;  3IRB A;  4GLA C;  4OON A;  5M3M G;  4HID A;  3FKI H;  2AWN A;  2WP8 J;  1XNQ L;  4DR4 L;  4JV5 L;  3F2C A;  4HIO A;  4OX9 L;  2A8V A;  2NVQ H;  1JJG A;  2UXC L;  2Q2T A;  1VQK A;  4B3T L;  3I4M H;  3PO3 G;  3L2P A;  2JA6 H;  5M5X H;  3PV0 A;  2H5X A;  2MO1 A;  4L5Q A;  3CC2 A;  2L15 A;  2R92 G;  3KF8 B;  1VQ8 A;  5K36 G;  2Q2I A;  3RLO A;  5AJ3 Q;  4LFC Q;  2OWO A;  1TWA H;  3RLF A;  1IZ6 A;  1D8L A;  4HJ8 A;  4A3C G;  3KOJ A;  1IYJ B;  3NBH B;  3D31 A;  2JA5 H;  5FLX c;  3M85 A;  3ULJ A;  3ZJY C;  1NY4 A;  4GKJ L;  4R4O A;  2GVB A;  2Y0S E;  1YJW A;  3HOX G;  2ASB A;  4LF5 Q;  4YWL A;  3K81 C;  4JI1 L;  3UDX A;  5IP9 G;  4DR5 Q;  3S16 H;  4TQU S;  1S72 A;  4NPS A;  4A3D H;  3KJO A;  4C3H H;  4QL5 A;  2Z6K C;  2ZM6 Q;  4L5R C;  4ME3 A;  4JI0 Q;  4BBS G;  3I7F A;  1NMG A;  3GDE A;  5ELN A;  1HR0 Q;  4UPA A;  2KHI A;  4A3F G;  1QVG A;  1WJJ A;  1TWH H;  3TRZ A;  1VQF A;  2NZO A;  1IBK L;  3CC4 A;  1PVO A;  4JI2 L;  3HOZ G;  1L1O A;  1X65 A;  3I4N G;  3EBE A;  2JJQ A;  1V1Q A;  4BY7 H;  1VQB A;  3MEF A;  4KLK A;  3J7A 5;  4MTN A;  4UP7 A;  1SN8 A;  1E1O A;  1VQP A;  3UE1 A;  1N36 Q;  1Q1B A;  2EQS A;  1N36 L;  1GO3 E;  1RL2 A;  3T1Y L;  2CFM A;  4R1J A;  2VQE Q;  1PH7 A;  5JJK A;  4GNX B;  5LMN Q;  1N34 Q;  1JJ2 A;  1X3F A;  2JA9 A;  3CCJ A;  3E9I A;  4A3B G;  4LFB Q;  1SMX A;  1IL2 A;  1JMC A;  1UE5 A;  2OTL A;  3H3V I;  1SFO H;  4BBR H;  3TRE A;  2IX0 A;  1HZ9 A;  1YHQ A;  2C35 B;  5C0X G;  4HIK A;  5C3E G;  3J81 i;  3OTO Q;  4A3I H;  2PI2 E;  1YNX A;  4HIM A;  4IJH A;  4GN5 A;  5JJL A;  3STB C;  1Q46 A;  1LM0 A;  3HOX H;  1A63 A;  3H0G G;  4DV3 L;  1VQI A;  4DK6 C;  1JJC B;  4AQY Q;  4GNX A;  4BXX H;  4C2M H;  4GKJ Q;  2K4K A;  2BH2 A;  2JA5 G;  4A3D G;  4OO1 I;  5IYC G;  1PYS B;  1YJN A;  1XMQ Q;  1HNZ L;  1QVC A;  1FL0 A;  2E2I H;  3AYH B;  1BBW A;  3J80 i;  4BBR G;  1W2B A;  2ID0 A;  2ZJQ A;  4B3R Q;  2RHQ B;  4IO9 A;  5JEA G;  1L1O B;  2GN5 A;  1Y1W H;  3HOV H;  4X64 Q;  2D0O A;  4DV1 Q;  1G29 1;  1VQ6 A;  2IHE A;  1YEZ A;  2JE6 I;  2ZTD A;  1YI2 A;  2AMC B;  3GTJ H;  4GNX C;  3T1H Q;  2NVT H;  4BA1 I;  1O7I A;  2PQA B;  2JQO A;  4JI5 Q;  2IX1 A;  4JC0 A;  5C0X J;  2YV5 A;  1TWG H;  4B3R L;  2VY3 A;  5GAE C;  1NTG A;  4P72 A;  2R6G A;  4XIG S;  2AHO B;  2AKW B;  1M1K C;  1MJE A;  1C9O A;  1XPO A;  2F3I A;  3HOV G;  5JJI A;  3LGJ A;  2EIF A;  2E5L Q;  2N3S A;  1Y14 B;  2ZJP A;  3JAM i;  1B7Y B;  4UP9 A;  4X65 L;  2K52 A;  3RR5 A;  2QA4 A;  1N9W A;  5FLM H;  4DV6 L;  5C44 H;  3PUV A;  4H02 A;  4NXM L;  2UXC Q;  4JI3 L;  2JA8 H;  1P16 A;  1EWI A;  5IYB H;  4EX5 A;  4DUY Q;  1S3O A;  5JEA J;  1XPU A;  1Y1V G;  4O2D A;  3S17 H;  5C4X G;  1PFS A;  2K5N A;  4GLV B;  5IWA L;  2CCZ A;  4GOP A;  3S1N H;  5IWA Q;  3K8A A;  4YY3 Q;  3PUZ A;  1QZH A;  2UUA Q;  4BXX G;  4GKK Q;  1UWV A;  4KHP Q;  5E7N A;  1N33 Q;  3HOW G;  1E22 A;  5IYB G;  3UDI A;  2MFI A;  3KLW A;  1FVI A;  2CWP A;  4QGU A;  2K5V A;  2KEN A;  3GTQ H;  2R93 H;  4QJF A;  2R92 H;  5M5W H;  1G6P A;  2QGQ A;  1FJG L;  4YWM A;  1X54 A;  5FLM G;  4LF8 Q;  3NEM A;  4FDB A;  1H95 A;  4JYA L;  3PO3 H;  3ERS X;  3A74 A;  4X62 L;  2UUB L;  1KD1 C;  1A8V A;  3DM3 A;  4LF7 L;  3U50 C;  4B3S L;  4B3M Q;  1NE3 A;  4BY7 G;  1PH9 A;  2IY5 B;  3F2D A;  1QUQ B;  1TWC H;  4DR1 L;  4DR5 L;  2HIX A;  2ALY B;  5HY6 A;  1YVC A;  3W1B A;  1E7Z A;  3RN2 A;  1Q86 C;  1BVS A;  2DUD A;  4A3K G;  5IYD H;  1IBM L;  3A0J A;  2Q2H A;  3RNU A;  2IHF A;  3WWV A;  3U4V A;  4OWW B;  1AE3 A;  3FKI G;  3HOY G;  1IXR A;  1KC8 C;  4LF5 L;  3FP9 A;  1K9M C;  3HOU G;  4UP8 A;  3JC6 6;  4AYB G;  3GTO H;  4DV0 Q;  4JI7 L;  3JAM c;  3CCQ A;  4A3M H;  4P73 A;  1VQ9 A;  1V43 A;  4OO1 G;  4JOI C;  1BKB A;  3GD7 A;  4BBS H;  4DV1 L;  5M3F G;  4R4Q A;  5IP7 G;  3MXN B;  2IT1 A;  2HQL A;  1LUZ A;  2PI2 A;  1WCM H;  4JI5 L;  5LMU Q;  1K73 C;  1CKM A;  4GS3 A;  4IPD A;  4XTC S;  1N8R C;  4LNQ A;  5IYC H;  1AE2 A;  1Q12 A;  4BA2 I;  3PUY A;  3S1Q H;  3AFQ A;  4DR2 Q;  3RLN A;  2VL6 A;  4JG2 A;  1HH2 P;  4JOI A;  5IP7 H;  4A3G H;  4X65 Q;  4QIW E;  4HJA A;  4A4I A;  1UE6 A;  4LF7 Q;  4IJL A;  2HT1 A;  2VQF L;  4A3B H;  2VS1 A;  1XJV A;  1VQG A;  1MKH A;  4BY1 G;  1XNR Q;  1B70 B;  1TXY A;  4DR1 Q;  2CQO A;  2ZTC A;  4GOP B;  1VQ4 A;  1K8G A;  1IBM Q;  4A93 H;  1XMO Q;  2QEX A;  4KI0 A;  3J81 c;  3H3V H;  3BJU A;  4C3J H;  5IYD G;  3PO2 H;  1Z9F A;  2HIV A;  2MQH A;  1JB7 A;  3UDG A;  2JA8 G;  2OQ0 A;  2K14 A;  4PMW A;  4JI8 L;  2UUA L;  2VUM H;  3KYH C;  2OCE A;  4A3G G;  4YWK A;  4A75 A;  4JCV E;  4DR6 L;  2N78 A;  1HR0 W;  1K8A C;  1SRU A;  3D0F A;  1XPR A;  1WOC A;  2N49 A;  1VS0 A;  1L1O C;  4IFD I;  3NEL A;  3CCM A;  2WFW A;  3F2B A;  3J80 c;  3CXC A;  3VDY A;  2ZM6 L;  4RMF A;  1PV4 A;  2KCM A;  1SLJ A;  2Z0S A;  1OXT A;  5LMN L;  1N34 L;  2A1A A;  2RF4 A;  4DK3 C;  4K0K L;  1HR0 L;  4DV4 L;  1E3P A;  2PQA A;  3PSI A;  4P75 A;  4ALP A;  3HOW H;  4A3M G;  1HNW L;  3CPW A;  4IPC A;  2GVA A;  2D62 A;  1I5F A;  1VQA A;  3F1Z A;  4DV7 Q;  2UUC L;  1CKN B;  3KFU A;  5GAG C;  4APV A;  2K50 A;  4LW1 A;  2VQF Q;  4DUZ Q;  4MNO A;  3UDF A;  4DV4 Q;  2NZH A;  3CPF A;  4AH6 A;  4EQ5 A;  1PH8 A;  4JI3 Q;  3STB D;  5GAH C;  4LFB L;  2MO0 A;  2AWO A;  3PCO B;  4LFA Q;  5C3E H;  1N33 L;  2JA6 G;  3H15 A;  2B63 H;  1CSQ A;  3M4Q A;  3CF5 A;  1XMO L;  3PUX A;  1VQ5 A;  2JA7 H;  1FJG Q;  3I2Z A;  5J3B A;  3G4S A;  5M3M H;  2UXD L;  1KIX A;  3FHW A;  1YIJ A;  3OW2 A;  1KRS A;  4YHH L;  5DLQ E;  3CCR A;  1P8L A;  3GO5 A;  3KDF A;  1X9N A;  2R93 G;  4LF9 Q;  2NN6 I;  4GKK L;  1Q8K A;  1Q82 C;  1HNZ Q;  1YHB A;  3J81 j;  2F4V Q;  3S1M H;  4QQB X;  1MIU A;  1ASZ A;  2UUB Q;  3TS2 A;  1PH6 A;  3K0X A;  4L5T A;  1A0I A;  1SR3 A;  2WAQ E;  3AFP A;  1XMQ L;  1VQ7 A;  1YJ9 A;  4TVA B;  3CAM A;  2RHS B;  5IP9 H;  3CD6 A;  1NBW A;  1X3G A;  1VQE A;  2ZJR A;  1HJP A;  2JK8 A;  4R4C A;  1QZG A;  2A19 A;  3EIV A;  2K5H A;  1PYB A;  4X64 L;  4B3M L;  1Q81 C;  5IE8 A;  4B3S Q;  3CCE A;  1OXU A;  1A62 A;  2EXD A;  3NEN A;  4DV5 Q;  1PH1 A;  2ATW A;  1PH3 A;  1Q7Y C;  3HKZ G;  4NXN L;  4DR7 Q;  4DV7 L;  4A3E G;  5C44 G;  4DUY L;  4OXP A;  4LUO A;  3Q8D A;  3HOY H;  1HNW Q;  3J7Z C;  2RCN A;  1UEB A;  3GTM H;  2PMZ E;  3S14 H;  4KHP L;  1X55 A;  2NVY H;  4P71 A;  1E1T A;  1G51 A;  1VQC A;  1WFQ A;  4IOC A;  3RZO H;  1EUJ A;  4O0A A;  3SGI A;  2PNH A;  3TEH B;  4JBW A;  4LF8 L;  3ULP A;  2UUC Q;  4LUZ A;  4X6A H;  1EQR A;  2HHH Q;  3CCU A;  4LF6 L;  2YTX A;  1V9P A;  4POF A;  4OWT B;  2JEB I;  2UXB L;  4DV6 Q;  2B29 A;  2FXQ A;  4JBK A;  4LF9 L;  4OWX B;  4DR2 L;  2R7Z G;  1TWF H;  2BA0 A;  3G6E A;  3M7N A;  1I6H H;  4A3F H;  2XTI A;  3GTK H;  4DNI A;  1KL9 A;  5EAY A;  1I50 H;  1YZ6 A;  1K3R A;  3PUW A;  2WB1 G;  5H1S E;  4IFD J;  3PF5 A;  4B3T Q;  1J6Q A;  4IFD G;  1N32 L;  3KF6 B;  2R7Z H;  3ULL A;  3K7U C;  3HOU H;  1WCM G;  3PF4 A;  1VQH A;  1U5K A;  2Y0S G;  2YTY A;  4WJ3 M;  3CQZ H;  1QVF A;  1D7Q A;  4GN3 B;  2XGT A;  4UY8 C;  3S2D H;  2VUM G;  1N32 Q;  1ASY A;  1M90 C;  2DGY A;  1GKH A;  4AYB E;  1I94 L;  4R4T A;  1Q1E A;  3CMA A;  2V1C C;  4JI4 Q;  1C7Y A;  2JA7 G;  3U4Z A;  1YBY A;  5BR8 L;  1YIT A;  4A3J H;  5BR8 Q;  1PH5 A;  3EN2 A;  3DLL A;  2Z6K A;  1EIF A;  4PZ8 A;  4A3E H;  4DV2 Q;  4P74 A;  3HKZ E;  4BY1 H;  1HNX L;  1EYG A;  2N8N A;  1LYL A;  3CW2 C;  1X6O A;  3CC7 A;  4X66 L;  4HJ7 A;  4DUZ L;  3U58 A;  4JI4 L;  3I56 A;  3AEV A;  3OTO L;  1FGU A;  3I4N H;  3HOZ H;  3CP0 A;  2E8G A;  4AIM A;  3RN5 A;  3PIP A;  1EIY B;  3PIO A;  3F8T A;  1KAW A;  3A5U A;  1CUK A;  1U0L A;  3KDF B;  4DR7 L;  2D0P A;  1K83 H;  4JI2 Q;  5C0X I;  4LF6 Q;  4AQY L;  4OX9 Q;  2I5L X;  1B8A A;  1WI5 A;  2YYZ A;  2BH8 A;  3M9B A;  4YY3 L;  1HZA A;  2JEA I;  1VQL A;  2OQK A;  3ICE A;  3TQY A;  3OYY A;  3W1G A;  4LUV A;  4J15 A;  1VQM A;  1HZB A;  4JBM A;  2I5H A;  4YCW A;  1PHJ A;  2F52 A;  3RZD H;  1WYD A;  4DR3 Q;  3BZK A;  1GVP A;  3CCS A;  4A3C H;  1GD7 A;  1Z47 A;  1S40 A;  2I0Q A;  1LTL A;  1SE8 A;  1CKN A;  2ZTE A;  3S24 A;  4A76 A;  4A3L H;  4LFC L;  5FJ8 G;  1MJC A;  2WB1 E;  5AJ3 L;  3S2H H;  2E5L L;  4A3J G;  1VQN A;  1EOV A;  4JYA Q;  5GRO A;  2I5M X;  3L0O A;  1HNX Q;  2LXJ A;  1YHA A;  4DR6 Q;  2VNU D;  3BU2 A;  4DV5 L;  2B63 G;  4NXM Q;  4PG3 A;  1KXL A;  1UE1 A;  3HKS A;  1K0R A;  4LF4 L;  5IT9 c;  4DV2 L;  1Y1W G;  3T1Y Q;  4DV0 L;  2R7D A;  4JI7 Q;  3M3Y H;  4JI0 L;  4YCV A;  5C4J H;  1JE5 A;  4RG1 A;  2VW9 A;  2E2H H;  3KJP A;  1DGS A;  3M4P A;  4JBJ A;  2VZA A;  4NB3 A;  1J5E L;  2NN6 G;  5M3F H;  5LMU L;  4HJ9 A;  3TS0 A;  1I94 Q;  3W5O A;  2Q2U A;  4Y52 H;  1T9H A;  1X56 A;  4IPH A;  2MNA A;  1I3Q H;  3K80 C;  3AQQ A;  4WJ4 A;  1GM5 A;  2UU9 Q;  2CKZ B;  3I4O A;  1J5E Q;  4LFA L;  1W3S A;  1SRO A;  3E0E A;  1BBU A;  1E24 A;  5ELO A;  2F4V L;  1PA6 A;  4L5S A;  4PZ7 A;  1KQS A;  3CCL A;  1VQO A;  3I4M G;  1OTC A;  2K75 A;  1JT8 A;  2LSS A;  1IBL L;  4JI6 Q;  4MZ9 A;  4YHH Q;  1OXS C;  4A3I G;  1OXX K;  4KHZ A;  3S1R H;  2UXB Q;  4IOA A;  2YTV A;  1L0W A;  2KHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...