3K7AH

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k7aH00
2N78A 1W2BA 3TREA 4HIKA 4GN4B 4GLXA 3FP9A 3U4ZA 2NVQH 1Q82C 1UE6A 1J6QA 3KF8B 2VS1A 2VUMG 1D8LA 2D0PA 1E1TA 3OTOQ 5IYCG 4A3DG 2IHEA 3G6EA 2UUCQ 3CCRA 1A0IA 3PIOA 3HOXG 4A3IG 5H1SE 4POGA 1C0AA 3S24A 1MKHA 5C3EH 5M3FG 1IBLQ 1CKMA 1V1QA 4QIWE 5JEAJ 4JI1Q 3RLNA 1K0RA 2CFMA 2UU9Q 3H3VH 2JA8G 2YU9H 4JI8Q 1SROA 2B63H 4A3JG 5C0XI 2VQFL 5C4XG 1X65A 1FVIA 2NZOA 1OXTA 5J3BA 2R7ZH 3B6YA 4BXXG 3HKZG 3CCEA 3E0EA 4R4OA 2JA7H 3VDYA 3HKZE 3ICEA 3IRBA 1CSQA 4YCWA 4HJAA 1S72A 3F2BA 4B3TL 3PO3G 4IFDG 2K52A 2N49A 5HY6A 4JBKA 3PUZA 4JI4Q 4PMWA 1K8AC 1PYBA 1NBWA 1UWVA 2CKZB 4DR5Q 2F4VL 1PH8A 4HIDA 4JG2A 2BA0A 1KXLA 4C3HH 2VL6A 1EOVA 4OX9Q 2K14A 1G51A 5IWAL 4LF5Q 1E7ZA 1VQCA 1Z47A 4X62L 1XMOL 1QVFA 1Q1EA 2JEAI 3STBD 3W1GA 1WYDA 2NN6G 3RLFA 2IX0A 4EQ5A 4GOPC 3T1HQ 1Q81C 1PYSB 1CKOA 1WJJA 4AYBG 4DR6L 2JA9A 3G71A 2JJQA 3CPWA 1UE1A 1XPRA 4LFAL 4AYBE 5AJ3Q 1AE2A 3UE0A 3W5OA 1Q12A 1X6OA 5IYBH 1XMQL 1VQMA 4KI0A 1Q86C 2PQAB 1NMFA 2I5LX 2E8GA 2NVYH 3PO3H 2RHQB 2ALYB 4DV3L 4P73A 3RZOH 1PH5A 2UXDQ 2MQHA 4RG1A 4JV5Q 3JAMi 1PVOA 1VQKA 2N3SA 4OWWB 3A0JA 1K3RA 4A3LG 3GTJH 4LF4Q 4XIGS 1RL2A 2R7DA 1VQNA 1L0WA 4OXPA 5HGQA 3HOYG 1OXSC 1QUQA 5FJ8H 3F2CA 3RN2A 1QZHA 4L5TA 4X66Q 1YVCA 2YTYA 2K5NA 1Y1WH 4A3KG 3HOZG 1N8RC 3BJUA 1PH3A 1VQLA 2ID0A 1TWGH 4X65Q 2JA6H 4LFBQ 4KLKA 2AMCB 5DLQE 1N36Q 1EYGA 1I3QH 2A19A 1G291 4NXMQ 3EIVA 1HR0Q 1G6PA 5IP7H 4MTNA 2B3GA 3J81c 4GNXB 1RIPA 4JI6L 3HOVH 3K0XA 5C0XJ 2EIFA 2GVBA 4R1JA 3UE1A 1HNZQ 2F3IA 1GO3E 4XTCS 3I4NH 1NY4A 3KLWA 3KYHC 4LNQA 1TWCH 2K4KA 1LM0A 5M3MG 1HNWQ 1GM5A 3OTOL 1B70B 3RZDH 1N34Q 2UUCL 4JI2Q 2ZJRA 3S14H 1KAWA 3I4MH 2RHSB 2UXBQ 4P75A 5K36G 4ME3A 4HJ9A 1IBLL 2EQSA 1VQEA 1VQPA 4LFCQ 4LWCA 2UU9L 1A8VA 4JOIA 5IT9c 3NELA 1YHQA 3U50C 4WJ4A 4JI8L 1CKNB 2BA1A 2FXQA 3W1BA 1KIXA 3GTLH 4GN3B 3H0GH 4DR1Q 5IYDH 2K50A 2Q2TA 3E9HA 4C3IH 3PF5A 3BU2A 4NXNQ 4DPGA 4DUYQ 1YI2A 4IPDA 1A62A 1SRUA 1XPOA 3D0FA 4LW1A 3PUXA 1TWHH 4YHHQ 5M5YH 2AWNA 3J7A5 1L1OA 4LUOA 1J5EQ 4K0KQ 1EQRA 5C3EG 1Z9FA 4A4IA 4DR7Q 2H5XA 4JI4L 3A74A 5M3MH 2HHHL 2R6GA 1PHJA 4DR5L 4JI0Q 4PZ7A 1QZGA 4L5QA 3M7NA 4J15A 2B63G 4EX5A 2I0QA 1WFQA 5C44H 1PH4A 3CC7A 4OX9L 3RNUA 4GLAC 1EUJA 4KHPQ 2R7ZG 4IFDI 4LF5L 3I2ZA 3KJPA 1X9NA 3CCUA 3RN5A 2HIVA 3I7FA 3GTMH 4JI7Q 2JK8A 1XNQQ 1EIFA 4DV2Q 1OTCA 1TWFH 1VQBA 4A3GH 4DKAC 5AJ3L 1OXVA 3J80c 1QVCA 3ZJYC 4Y7NH 3ULPA 3AYHB 3CCVA 2QA4A 3S2DH 2KHJA 3CP0A 3FKIH 3J81i 2ZM6Q 4B3RQ 1YITA 2E2HH 2UXDL 4MNOA 1UE5A 2MO1A 3BZCA 2BH8A 3PSIA 4IPCA 4TVAB 4YY3Q 4PG3A 2NVXH 5EAYA 1VQ6A 1A63A 2MFIA 2PI2E 1SMXA 2E2IH 5IYBG 3T1YQ 1YJNA 1VQ7A 1GD7A 4X66L 1HZCA 2Q2UA 2IT1A 1K73C 1Y1VH 3KDFA 1JE5A 3L2PA 1K83H 1KC8C 2L15A 2DGYA 2R93H 4GNXC 4A3CG 2UUAQ 3K7AH 2KCMA 2N8NA 4L5SA 3J81j 2ES2A 1NE3A 4H02A 3HFZB 4X65L 1N36L 1M90C 1VCIA 2PI2A 4NPSA 2R7FA 3H15A 4JI5Q 1VQAA 1EWIA 1HR0L 5ELOA 5FJ8G 4NXML 4LF9Q 3AQQA 5BR8L 3FHWA 1XNRQ 4UP9A 3MEFA 3F2DA 1PA6A 1IBMQ 4BY1H 4ALPA 1Y1WG 1PH6A 1VQ4A 1P16A 1S3OA 3CCMA 2ATWA 1QUQB 4IJLA 1R9TH 3PUVA 4YCUA 4DV4Q 2HT1A 1JT8A 3U4VA 3TS2A 1HZ9A 1HNWL 2VW9A 4BY7H 4A3MH 2JA6G 4JI2L 5LMUQ 1SLJA 1V43A 2UXBL 5IP7G 3CF5A 3CCLA 4LUVA 4B3SQ 3EBEA 1KD1C 3HOVG 4JBJA 1L2FA 3GO5A 3CC2A 1FL0A 4DR3Q 4PZ6A 3M85A 2JE6I 1BBWA 5GQOA 4LFCL 2KCTA 3G4SA 4A76A 4DR2Q 3I4NG 2RF4A 2V1CC 4IFDJ 3CCSA 1E22A 4HIMA 1HZBA 3J7ZC 1IBKQ 4JYAQ 1SN8A 3F8TA 1YJWA 4GN5A 3K8AA 3KF6B 4NXNL 3M4PA 4A75A 1GVPA 4C3JH 1LUZA 4JC0A 1MIUA 4A3EH 4DK6C 3I4MG 3ERSX 2CWAA 1J5EL 1W3SA 2B29A 4C2MH 2ZTEA 4DR7L 5LMNQ 4A3CH 4DV1Q 1BKBA 4JI0L 1BBUA 3HKSA 2VQEQ 1K8GA 2QEXA 1SR3A 3OYYA 3CCQA 4AH6A 3H0GG 3M4QA 1N33Q 5JJLA 5IYDG 4AQYQ 2QGQA 5GADC 4BBRH 4DUZQ 2UUBQ 4HJ5A 1EQQA 4B3MQ 4HIOA 3EN2A 3JC66 4O0AA 4QY7A 4IOAA 4DV0Q 2VY3A 1HJPA 5E7NA 2OTJA 1Y14B 2K5HA 2YV5A 3NENA 4JCVE 3TQYA 4JI7L 1XNQL 1X54A 2NVTH 5M5WH 1L1OB 5IP9H 2OCEA 4YCVA 5ELNA 4BA1I 3I56A 5C44G 1M1KC 3DLLA 3STBC 3PO2H 4QL5A 4IO9A 4QQBX 1C7YA 1N32Q 2I5MX 1OXUA 3HOWH 5JJKA 2OTLA 4DNIA 2ZM6L 4B3RL 4JI1L 3L7ZC 3RR5A 2KENA 4P72A 4HJ8A 1SFOH 1P8LA 3CQZH 2WAQG 1XMOQ 4P74A 2WAQE 1EIYB 4A3GG 1CUKA 1Q1BA 3UDFA 1HNXQ 4LUZA 1NTGA 1O7IA 3Q8DA 4KHZA 3T1YL 3BZKA 2OQ0A 1WI5A 1YJ9A 1WCMH 4A3BH 4YWKA 1MJEA 2WP8J 1HZAA 2K75A 1HH2P 3FKIG 5FLMG 4FDBA 1Q7YC 4QJFA 4LF8Q 3E9IA 3RLOA 4NB3A 1UEBA 1E24A 2E2JH 3K7UC 4DV3Q 3SGIA 1I5FA 5IE8A 4X64Q 4PZ8A 4JI5L 1I6HH 3CXCA 4LF9L 2XGTA 1B7YB 2XTIA 1IBML 1JB7A 1Y1VG 2CQOA 4O2DA 3ULJA 1X3GA 4UPAA 2JQOA 1S40A 3T1HL 4DV4L 4OWXB 3ULLA 4JBWA 4DV5Q 2R93G 5JEAG 1KL9A 4LF6Q 4A93H 1JJGA 4GOPA 1BVSA 5M5XH 3CMAA 2HQLA 5LMUL 1VQ9A 5GAGC 4QGUA 1VQ8A 1YBYA 3TEHB 4WJ3M 2NN6I 4MZ9A 5C4JH 4B3SL 3GTGH 2JA5H 3A5ZB 2C35B 5FLMH 3CC4A 1FJGQ 2BH2A 4BY1G 4DR3L 4DR2L 4JV5L 5IY0A 5GAHC 4DV6Q 3AFPA 4JI3Q 4JI6Q 3HOUH 4LF4L 1IBKL 4JYAL 2YTVA 1I94Q 4BY7G 1SE8A 4A3MG 2WB1G 2VNUD 5FLXc 2R92H 2WB1E 3K80C 3PV0A 3DM3A 2ZTDA 3I4OA 1GKHA 3PGZA 4DV7Q 4X6AH 1ASZA 1IZ6A 2Z6KA 4DR4Q 4R4IA 5LMNL 4JOIC 2PNHA 1KHIA 4DV1L 1YZ6A 1X55A 2VQEL 4A3FH 1N33L 4LFBL 4OO1G 3KOJA 3LGJA 1Q46A 4AQYL 1YIJA 2ZJQA 2PMZE 4L5RC 3F1ZA 2AHOB 1PH1A 1E1OA 4DUZL 2UUBL 1EFWA 2Z0SA 4B3ML 3TRZA 2MNAA 3GTPH 1VQJA 2JEBI 3NEMA 4A3EG 3GTOH 1VQFA 1L1OC 5GROA 1HNZL 4DV0L 4RMFA 4UY8C 1KQSA 4GKJQ 4GKKQ 1FGUA 1XTDA 2Y0SG 2IHFA 2IY5B 3U58A 1K9MC 4R4QA 4LF7Q 1UE7A 2Y0SE 4IPHA 3GTQH 1N34L 1U5KA 1OXXK 1NMGA 2HIXA 3D31A 2VUMH 2HHHQ 4BBRG 3AEVA 5IYCH 4A3DH 1U0LA 3GDEA 1N32L 4HJ7A 1Q8KA 2NZHA 2Q2HA 2UXCQ 3UDIA 3HOXH 3PUWA 3M9BA 4A3IH 2E5LQ 3S1QH 5M3FH 2KHIA 2KBNA 2Q2IA 2YTXA 1B8AA 3GD7A 4DR1L 3CCJA 4BA2I 1XPUA 3K81C 2JA8H 5IP9G 2WFWA 3KJOA 1HNXL 1VQHA 4R4CA 2AWOA 4DUYL 4YWLA 2D62A 2F52A 5C4XH 4A3JH 1PH9A 5JJIA 1YNXA 3J80i 4YHHL 3PO2G 3CMEA 4K0KL 3HOWG 4BXXH 2OQKA 4GS3A 5C0XG 1ASYA 4LF8L 2GVAA 1H95A 4DAMA 1V9PA 4AIMA 3GTKH 4X64L 4BBSG 4APVA 2ASBA 2VZAA 4KHPL 2IX1A 1VQGA 2VQFQ 1D7QA 3H3VI 1E3PA 1WCMG 3S1MH 4A3BG 3S1NH 3ER0A 4OWTB 2Z6KC 3CAMA 4DV5L 4DV2L 2DUDA 1LTLA 3CW2C 4B3TQ 4LF6L 1VS0A 3L0OA 2A1AA 3S15H 4GLVB 2K5VA 2PQAA 4UP8A 2I5HA 1KRSA 2LXKA 2F4VQ 1JJ2A 1DGSA 3TS0A 1KRTA 1FJGL 1X3FA 1C9OA 2ZTCA 3M3YH 2AKWB 1VQDA 5IWAQ 5BR8Q 1AH9A 3OW2A 4DV6L 4JI3L 4YWMA 4YY3L 1YHAA 4X62Q 1TXYA 2LXJA 2EXDA 4BBSH 2D0OA 1I94L 3KF6A 4A93G 1VQ5A 1T9HA 4IJHA 3NBHB 4IOCA 4A3LH 2CCZA 4Y52H 4DR6Q 3I55A 1N9WA 3HOYH 1PV4A 4LFAQ 3PIPA 3A5UA 3CPFA 1PFSA 2JA5G 4GOPB 4DV7L 1XMQQ 1MJCA 2LSSA 3MXNB 3PUYA 1CSPA 4DR4L 3S2HH 2UUAL 4JBMA 3G48A 1TWAH 1VQIA 1X3EA 1PH7A 3HOUG 4A3KH 3S1RH 1IXRA 2MO0A 2ZJPA 4POFA 3S16H 4GNXA 3HOZH 1I50H 1XNRL 2A8VA 1X56A 1JMCA 3WWVA 5LMNW 2CWPA 2YYZA 1JJCB 3UDGA 2R92G 1WOCA 3M4OH 1YHBA 4IPGA 1PH2A 1IL2A 1XJVA 5GAEC 4P71A 1HR0W 2GN5A 2OWOA 3PCOB 4GKKL 4GKJL 3KFUA 4OO1I 4LF7L 1YEZA 3KDFB 3CD6A 4UP7A 4DK3C 4A3FG 4TQUS 3PF4A 1LYLA 2RCNA 4R4TA 3AFQA 1VQOA 2UXCL 4DAYB 4OONA 1CKNA 2E5LL 1AE3A 1IYJB 3JAMc 1NJIC 3S17H 2JA7G 1QVGA 3UDXA
chains in the Genus database with same CATH superfamily
2JYOA 2N78A 4G7ZC 1ICWA 1GHKA 3KF8B 3OTOQ 3DMUA 4FYDA 2UUCQ 3C1EA 3P75A 1MBYA 2QEJC 4POGA 3S24A 1MKHA 2HD3A 5M3FG 1CKMA 2RBMA 4QIWE 2PZUA 2CFMA 4CJ1B 2YU9H 1LABA 4A3JG 2VQFL 1STGA 2R3ZA 1TWGB 2KEEA 2K1BA 5CR3A 2B8GA 4YCWA 1S72A 3F2BA 4IFDG 4LMQD 3HOVB 1A3TA 4PMWA 4EQPA 1UWVA 3K58A 4JG2A 4ID6A 1G91A 2F1MA 1QCBD 5T1IA 1G51A 2EYFA 5IWAL 5J1ZA 3RZDB 4X62L 1XMOL 3EA6A 3S14B 2EYLA 3H3VC 2F0TA 3STBD 3W1GA 4U68A 3I4MB 3RLFA 2IX0A 3T1HQ 3X3NA 1DOMA 1UE1A 1F9QA 4AYBE 5AJ3Q 2K01A 3R2IA 1JORA 1LTSD 2O4XA 3H0GB 2I5LX 4R9WA 2A69C 3JAME 4JW0A 1R4QB 2ALYB 3RZOH 2UXDQ 1ILPA 3JAMi 1PVOA 1VQKA 1PRTD 2N3SA 4OWWB 1PTOH 4A3LG 2OT2A 1RL2A 2R7DA 1VQNA 5FJ8H 1QUQA 1B44D 1EY7A 1WTHA 2RDFA 4CDEC 3RN2A 1QZHA 4X66Q 1JWSD 3IL8A 1Y1WH 5C44B 4A3KG 3HOZG 1B50A 2CQAA 2OXPA 4DAVA 1EYCA 2XN9C 4KLKA 3EIVA 5IP7H 2F0PA 4R1JA 3UE1A 3J7AV 1SYFA 3I4NH 2FJ2A 1NY4A 3NK9A 2LFNA 1KAAA 1TWCH 1LM0A 3FKIB 3E3XA 1B4OA 1N34Q 1A3UA 2PNRC 4V190 1IYVA 1STHA 1QNUA 3D3RA 5K36G 1EL0A 4ME3A 4HJ9A 1IBLL 3W1BA 1Y1VB 5ELDA 3GTLH 2VB2X 2PW5A 3W2DA 3J80L 5ELBA 1F9SA 2Q2TA 2R93B 1BXTA 3WOFA 2L0CA 4OHJA 2J0TD 1XPOA 1SRUA 3D0FA 2LS01 4F8MA 1QOHA 3OWEB 4BY1B 1FD7D 4L5QA 1ZKOA 2B2YC 4OX9L 3SK6A 2R7ZG 2K32A 5C5MA 3T56B 4A3MB 4LF5L 3A55A 1X9NA 1HA6A 3RN5A 4OIKA 1EIFA 4DV2Q 1OTCA 4A3GH 4NDXA 4K8JA 1QVCA 5M3FB 1U4PA 2CH4A 4C3HG 5E4WC 1HFGA 2PCFB 3CHBD 4KV6A 2PMZB 2QA4A 3S2DH 2KHJA 1BNZA 5I2XA 4B3RQ 3EROA 2E2HH 2SEBD 1UE5A 5EKLA 2A6HD 2BH8A 3PSIA 4IPCA 1O7YA 4YY3Q 4RGMA 2L4NA 4UDUC 2MFIA 1PXUA 3D6CA 2E2IH 1VQ7A 1GD7A 4ZQ3A 3HS0C 2IT1A 1CK1A 3BZDB 1JE5A 1K83H 2A68C 2LY7A 2QILA 1F9PA 4GNXC 2UUAQ 3K7AH 2KCMA 1W6KA 4IUPA 1NE3A 4X65L 2PI2A 3H15A 4JI5Q 1VQAA 1EWIA 2EYJA 4PMCA 5ELOA 1X3QA 3MEHA 2NBFA 3AQQA 2NVTB 1EZ6A 1PA6A 1IBMQ 4N8FA 1B2TA 1PH6A 1S3OA 1JT8A 1MD2D 3HOWB 3BYYB 4BY7H 1ZXTA 3VYUA 2JA6G 4JI2L 5LMUQ 2UXBL 1VMCA 4LUVA 4BBSB 1XTCD 4JBJA 5ELEA 1PTOD 1BDOA 1PH4A 3M85A 3G4SA 2JE6I 4DR2Q 4IFDJ 4RHRA 4OO1H 3J7ZC 1AEXA 4DA2A 3KF6B 4NXNL 2E2JB 1GVPA 4C3JH 4M1UB 1HUNA 4DK6C 5CBAE 1W3SA 2EDGA 5EBDA 2ZTEA 1LTID 4DR7L 3QO2A 4P2CB 1DONA 4JI0L 3HKSA 2K6AA 2X69A 2B2UA 4C3IG 1HTPA 4KJNA 1VDZA 4QY7A 1X32A 2K5HA 2YV5A 2RDHA 1XNQL 4B08A 1X54A 5IP9H 1LLRD 2KA7A 4NMZA 1STEA 5IOCA 1S4ZA 2F0MA 1SNQA 4K2LA 1ZEQX 2EZVA 4K14A 3QOJA 4WJWA 3L7ZC 1B3QA 1WTRA 1RTNA 4L63B 4HJ8A 3ONAB 1SFOH 1P8LA 2X6LA 3MTSA 4OEMB 1XMOQ 1CM9A 4TRDA 4K8IA 1Q1BA 4NW2A 3UDFA 1NTGA 1S5FD 1EY8A 2R61A 3BZKA 4MTKA 1WCMH 3V2TA 1H9SA 4NB3A 4PNYA 4WFN3 5IE8A 4X64Q 4X3TA 4F88A 5EGTA 1Z6HA 2XGTA 1B7YB 2XTIA 2ENBA 4O2DA 3NTHA 4A3DB 4DV5Q 3OMCA 3CRLC 4JBWA 4KD3A 5JEAG 3KK7A 1QE6A 4A93H 4LF6Q 3UI2A 4MN3A 4A3IB 1BVSA 5M5XH 3CMAA 3MXNA 1VQ8A 2EPBA 1O80A 1SYCA 2C35B 3CC4A 4RKLA 1RD9D 4NKLA 3Q0AA 1BQQT 4DV6Q 3HOUH 1IBKL 4ZRZA 2YTVA 1SE8A 2WB1G 2A69D 2K7VA 2R92H 3LWEA 3PV0A 1BCPC 1BF4A 3PGZA 4DV7Q 3E5SA 2HQEA 4JOIC 4DV1L 2F0FA 4A3FH 1N33L 4FXGC 4LFBL 1Q46A 2ZJQA 2PMZE 4L5RC 3S1QH 1PH1A 4FF2A 2FMCA 2MNAA 4A3EG 1Y8NB 5EPLA 3MC0B 1U4RA 1M8AA 4UY8C 2OEOA 1XTDA 2Y0SG 5CGKA 4LF7Q 5NUCA 3IAYA 3GTQH 3A54A 1U5KA 2VUMH 4BBRG 2KVMA 4HJ7A 1Q8KA 2NZHA 2NTSA 3MFYA 5K5PA 3HOXH 1IW7D 3HOYB 4MHEA 3KLSX 2Q2IA 2YTXA 3I90A 4DR1L 1XPUA 2JA8H 5EPKA 2WFWA 3J80E 2RVLA 4YHHL 3J80i 3PO2G 1A2TA 2F0VA 1I50B 1PMRA 1H9RA 1RODA 2A5HA 3J81L 3CMEA 1WD1A 4GS3A 5JPMC 4LF8L 3M4OB 1V9PA 3OMGA 1SJED 1I4HA 2B2YA 4M8AA 4A3BG 1ML0D 5M3MB 4XDXA 4PMBA 3S1NH 4OWTB 4DK0A 3BVGA 1VS0A 1FNWA 1F2ZA 5IT9L 1V1PA 4UP8A 3TSSA 1PFMA 4EGVA 3TS0A 3SE0A 5D14A 3I91A 2NVQB 5EPJA 4DFAA 2ZTCA 4XQQA 1H9KA 4JI3L 1TXYA 1F2YA 2EXDA 4IOCA 3NBHB 2CCZA 5C3EB 1TR5A 1N9WA 3VYTA 1V1OA 1PRTC 3PIPA 3A5UA 1PV4A 1PFSA 2JA5G 4GOPB 1LACA 1EWHA 3J7AF 4ABNA 1CSPA 2G9HD 4DR4L 2AUJD 1CHQD 4JBMA 4DN4M 2A74C 3NPPA 1IXRA 3GP7A 4POFA 4GNXA 2PZTA 2A68D 1WOCA 1YHBA 1IL2A 1XJVA 5KIXA 4IZ8A 1E2ZA 4XT1B 1YEZA 4DK3C 3HG9A 3PF4A 3I4LA 4B9XA 3AFQA 3MXUA 4DAYB 1R9TB 4K6DA 2IW3A 1MSHA 2ZXPA 1ESFA 3OWFA 3TBIB 2CH4W 1W2BA 4C56C 3TREA 1SYBA 3BYTB 1Q82C 2XNAC 5IYCG 3PIP3 4QUFA 2JP1A 3ND9A 1A0IA 3NBIA 1NCVA 5H1SE 1C0AA 1GJXA 5JEAJ 3RLNA 1K0RA 2UU9Q 4RGTA 2L12A 2IL8A 3SVMA 5C0XI 3NSWA 2B63H 5C4XG 2NZOA 1SE3A 5EKKA 5J3BA 3HKZG 4R4OA 4HJAA 4B3TL 2AQ1B 3PUZA 2E76C 5IGDA 2F4VL 2CKZB 4KN4C 3MVVA 2FINB 1KXLA 2VL6A 4B9WA 2K14A 5M5WB 4HMIA 1Z47A 1QVFA 1FNUA 5FO9B 2JEAI 4EQ5A 1JWUD 3QR8A 3OIPA 5CMDA 4DR6L 2JJQA 4IUVA 4LFAL 1AE2A 3W5OA 2KHSA 1Q12A 1X6OA 5IYBH 3D8GA 1Q86C 5C5LA 1NMFA 1WTPA 3NQTA 2RHQB 1M4VA 1B53A 2L55A 1QWYA 4RG1A 4DU9A 1TWHB 1K3RA 3M7GA 1Z7TA 1L0WA 1MHWC 3QG1A 1OXSC 3DM1A 3NWTA 4L5TA 1EQVA 3Q23A 2YTYA 4ZYSA 3VYRA 2Q8RE 2IWHA 4DF7A 5ELFA 2ID0A 1TWGH 1W6JA 2I07B 4LFBQ 4ZAIA 2AMCB 4TSSA 2WAQB 1I3QH 3VR4A 1G291 1HR0Q 3J81c 3FPUB 1FNVA 1WTVA 3HOVH 2J7ZA 3K0XA 1A2UA 2GVBA 4HR7B 4XTCS 5C3XA 3KLWA 4H13C 2F0KA 3KYHC 4DNRB 3RZDH 1A15A 2ZJRA 3S14H 2NVXB 3DXJC 3I4MH 3T16A 2X6GA 4K5VA 1D1IA 4P75A 3DWPA 1VQEA 2TSSA 3OIQA 5FO7B 1TIID 4JOIA 1BCPD 3TP8A 5IT9c 4WJ4A 4JI8L 2B2VC 2BA1A 4GN3B 3H0GH 4DR1Q 3E9HA 4DPGA 1A62A 1AZQA 2Q8IB 2K28A 4YHHQ 2RCFA 2VXWA 1J5EQ 2LKVA 1Z9FA 4A4IA 4Q5VA 4JI4L 2D2CC 1PFNA 5ELCA 4DR5L 4PZ7A 3M7NA 1T5XD 4EX5A 1WFQA 4H7BA 5C44H 1TS5A 3RNUA 3I2ZA 3CCUA 2HIVA 3I7FA 1CI3M 1E2VA 3K5OA 3SEBA 2N55A 1VQBA 1ZYRC 4U673 1OXVA 1ENFA 3AYHB 3CCVA 3KUPA 3J81E 2EY6A 2EY2A 3CP0A 4HN7A 3FKIH 4KJOA 3VR3A 3J81i 4C1NI 1YITA 2WACA 1SSOA 1SDFA 1VQ6A 1EZ8A 3R8BA 3V96A 1HZCA 2Q2UA 1HRJA 3LWUA 1K73C 1Y1VH 3KDFA 1TS2A 4R8NA 2SNSA 1S5CD 3FRPB 2R93H 5IT9E 2PO4A 3J81j 2ES2A 4H02A 3MXGA 3HFZB 1M90C 1N36L 4NPSA 1VF7A 3OOCA 4X3KA 4NXML 5FJ8G 4LF9Q 1GUTA 5BR8L 3FHWA 2QDBA 3F2DA 4BY1H 4ALPA 1Y1WG 3VYSA 3N52A 1QUQB 4IJLA 1UUPA 3KF8A 2HT1A 3TN2A 2B39A 3U4VA 1HNWL 3DEOA 4A3MH 4RH6A 3CQZB 1SLJA 3NHHA 1DOLA 5IP7G 1DXMA 3A7AB 5BN3A 3EBEA 2OF1A 1FL0A 4LJZC 1LTGD 4LFCL 4A76A 5E1FA 3I4NG 3CCSA 4MIUA 4HIMA 1HZBA 1YJWA 3K8AA 2MGSA 3FEWX 5EJWA 1EWCA 3M4PA 4CGYB 1EOTA 1LUZA 1DM0B 4G57A 1GUOA 2CWAA 1I6HB 5LL6X 5HGTA 1Y8OB 1XWEA 2B29A 1CTMA 1KDBA 4J8QA 1EY9A 3K5MA 2VQEQ 1K8GA 1QG7A 2QEXA 1CA6A 5JJLA 4AQYQ 5GADC 2M2LA 2L9HA 2D5DA 2ICEC 2UUBQ 4B3MQ 2DJFC 1D1KA 3JC66 1B9NA 3A7LA 3A56A 1Y14B 4JCVE 3TQYA 2OTJA 4JI7L 1IW7C 2NVTH 2F4IA 2ZT9C 1M1KC 5BN5A 4QL5A 1RKNA 5I9PA 3ZYYX 4QQBX 1OXUA 3HOWH 4DNIA 2ZM6L 4JI1L 5C0XH 5CV6A 2KENA 4P72A 3QIAA 4KHVA 2WAQE 2DNEA 4A3GG 1SEBD 3HP3A 1O7IA 3T1YL 2OQ0A 3K6OA 1EQTA 1HH2P 4FDBA 1Q7YC 2O5IC 4QJFA 2EJMA 1UEBA 2E2JH 2XWBB 1I5FA 3L9AX 4PZ8A 5JVH3 2PPBC 4OIJA 2QKIC 1T5EA 3FVQA 3NUCA 5C3WA 2QW7A 1STNA 4WRDA 5AFWA 4XYQA 2JQOA 4DV4L 3SK5A 2FFKB 2G9DA 4FF1A 1VQ9A 1TY0A 4QGUA 3TEHB 2NN6I 4IALA 4B3SL 3A5ZB 1WVLA 2BH2A 3NE5B 4IN3A 4DR3L 1TQOA 5L37A 4A3JB 4JV5L 5EKIA 2Z9HA 3AFPA 4JYAL 4BY7G 1O7LA 2MJ8A 1Q8IA 1HCZA 3P1HA 1S5BD 5CBEE 3TP6A 2ZTDA 3MHBA 2Z6KA 4R4IA 5LMNL 1KHIA 1YZ6A 3CRKC 3TMEA 4JPBW 4OO1G 3TZDA 5T1GA 1F2MA 1QJOA 2AHOB 1E1OA 4DUZL 1EFWA 1KNEA 4C3JG 1VQJA 2N88A 3NEMA 3S15B 1HNZL 1L1OC 4DV0L 3P7JA 3DUZA 1ESRA 1KQSA 2B2WC 5C4HA 5CC4A 4GKKQ 2IHFA 3KLSA 4R4QA 4FF4A 2KECA 3C1FA 4IPHA 3M3YB 2WIIB 1CQFA 1NMGA 2F0GA 3D31A 5IIFA 3SK4A 4A3DH 1CFMA 1DCZA 1N32L 3TDQA 3SHLA 5LL6S 1BUVT 1TWCB 1SBBB 4A3IH 2L5TA 2KBNA 2NUCA 2P5ZX 3GD7A 3EQLC 1CQVA 5IP9G 3S2HB 1HTLD 3RUZA 1HNXL 4R4CA 2AWOA 2B2VA 5G3LF 1TWAB 5JJIA 4A3KB 3HOZB 3S16B 3AB9A 4BXXH 2OQKA 2RSOA 3K57A 3V05A 1H95A 3G7LA 4E6IA 3N6RA 4JK1C 2IX1A 2VQFQ 1D7QA 4KN7C 1WCMG 1JC7A 4FVMA 3CAMA 1GXDC 1PZJD 1FYCA 3OHXC 3J7YW 4DNTB 4GLVB 5F2DA 2PQAA 3BS1A 1KRSA 1H9SB 1STBA 2LXKA 3S17B 1FJGL 1X3FA 5A2QL 1C9OA 1EU4A 1LT3D 5IWAQ 5BR8Q 1AH9A 1ZYRD 1YHAA 3BVMA 1NR4A 4X62Q 2LXJA 1I94L 3KF6A 4A93G 2QF7A 1CA5A 4Y52H 1RDPD 1KABA 4G7OC 3HOYH 4C1NK 3TP5A 5CV4A 4I7AA 1MJCA 3MXNB 4FP5D 5D65A 3AMUA 1VQIA 1X3EA 1JB3A 3HOUG 2E2IB 2R7ZB 3S1RH 2ZJPA 1QB5D 1I50H 1XNRL 2A8VA 1B1ZA 2B8FA 2CWPA 2YYZA 1JJCB 3RMHA 2R92G 4RFBA 5IGFA 3M4OH 4CDCC 4RWSC 1PH2A 2OWOA 2GN5A 4GKJL 3PCOB 2Z8LA 4C3HB 4IUTA 1FGBD 3CD6A 3D4WA 4A3FG 4TQUS 1G6ZA 2RCNA 2K5DA 2XSCA 3Q24A 2UXCL 4OONA 1CKNA 4BWGB 2E5LL 3FDTA 5EBCA 2JA7G 3NXWA 1G2SA 4KY7A 4KKTA 4HIKA 3U4ZA 2NVQH 2NVYB 5CV8A 1J6QA 1XX8A 2VS1A 2VUMG 1E1TA 5IODA 2EE1A 4I65A 2IHEA 3G6EA 2HUGA 3PIOA 3HOXG 3GTJB 3MAQA 5C3EH 1IBLQ 2VB3X 4JI1Q 3ERQA 3QOLA 2JA8G 2NYZD 4R8IA 1SROA 3KBGA 1EY4A 1FVIA 1LO5D 1DOKA 5KNCA 3LX0A 3B6YA 1GOZA 3CCEA 4CDDC 3S9WA 2JA6B 2J4XA 3E0EA 2JA7H 3VDYA 1TS3A 3PO3G 4OGQC 2N49A 4JBKA 5E3FA 1E0BA 4Z9CB 1K8AC 1U4LA 1PYBA 2PQEA 1PZID 4Q0FA 5C6AA 2BA0A 3NTIA 4OX9Q 1AN8A 4RCNA 5FKAC 1NUCA 4LF5Q 1I4XA 3R2TA 1WYDA 2NN6G 2PW7A 1Q81C 1WJJA 1CKOA 1PRTF 4AYBG 2I46A 2JA9A 2JXMB 1SMYC 1GUGA 1XMQL 1AP0A 1SE2A 1V1PB 4KI0A 3PIO3 4EQOA 2CW0C 3P20A 2Q8TA 3PO3H 1EIHA 4C3IB 4DV3L 4F7XA 1PH5A 4JV5Q 3FPPA 1D5ZC 5M5YB 3A0JA 4XT3B 5C4ZA 5D3DA 2RA4A 4OXPA 5HGQA 2BCOA 3H6MA 1YVCA 2K5NA 1PZKD 2NN6H 1TS4A 1RHPA 1N8RC 1PH3A 1VQLA 4X65Q 5KYLA 3GTMB 5DLQE 4HMJA 5TSSA 1G6PA 2DJGC 1NAPA 4GNXB 2DN8A 4MTNA 1TWFB 1RIPA 2EIFA 4Y7NB 3DHQA 1HNZQ 1ICFB 1C48A 4LNQA 1JQYD 2K4KA 1GM5A 3OTOL 4ILWA 2XIWA 2UUCL 1EFID 4JI2Q 1KAWA 2UXBQ 2RHSB 1OO9B 3M4YA 2K5WA 2EQSA 1VQPA 1NSNS 4LWCA 5CYUA 4X6AH 3U50C 2FXQA 3H94A 5IYDH 2K50A 1RJTA 4NXNQ 4IPDA 2F0OA 4LW1A 3PUXA 1TWHH 1UNSA 2AWNA 2K33A 2SDFA 1L1OA 4LUOA 1EQRA 1Q3LA 2B2WA 1QILA 3WDNA 2H5XA 4DR7Q 2HHHL 2R6GA 3W3AA 1PHJA 4JI0Q 1GUSA 3KBXA 4FO2A 2BE5C 2B63G 4CKBA 4GLAC 1H9MA 2EYMA 4IFDI 2WB1B 3KJPA 1Y8PB 2HDMA 1XNQQ 1STYA 2XRSD 5AJ3L 3ZJYC 1LTAD 2XVSA 3A8KE 1TT2A 2GA4B 4DXGA 1ONLA 3H91A 1HXYD 4CJ2C 2UXDL 4MNOA 4TKOB 4A3EB 3BZCA 2NVXH 3AU7A 3ND8A 4TVAB 1A63A 4C2MB 3K59A 1EY0A 2Y0SB 2WINB 4RGNA 5IYBG 1YJNA 2EY1A 4QF4A 4X66L 4QMGA 4BBRB 1KC8C 5JJZA 2DGYA 4A3CG 4KK7A 2N8NA 1MGSA 2EVBA 3BG3A 4G7HC 1BR9A 1VCIA 5I4DA 2R7FA 4LAAA 1XNRQ 3PQIA 5A2QE 3MEFA 1SNPA 1PTOF 1P16A 3I3CA 2M00A 1VQ4A 2ATWA 3PO2B 3PUVA 4L6TB 4HCSA 2VW9A 4PV1C 1IKLA 2ICIA 3CF5A 3CCLA 1KD1C 3HOVG 1L2FA 3GO5A 4PZ6A 2IY5B 4A3CH 1H9JA 4DK1A 2RF4A 4J1MA 4O1NA 4A3BB 1JICA 1E22A 3O13A 1IBKQ 1KNAA 4GN5A 1KDAA 2EYPA 4JC0A 1MIUA 3I4MG 3ERSX 2E74C 2K03A 3NTKA 1EYAA 3G6JB 4DV1Q 5CV9A 2CVRA 1N33Q 1SR3A 3CCQA 4AH6A 3H0GG 3M4QA 1YNJC 4CKCA 3C3LA 2QGQA 1HA5A 4L8JA 1WTXA 3U9OA 4HJ5A 1EQQA 4HIOA 4O0AA 2C9OA 1PFBA 2VY3A 1HJPA 5E7NA 1DD2A 5C4JB 3GTGB 2JA5B 2M9VA 5I6WA 2F3VA 1WTWA 3DWQA 1E2WA 4BA1I 5ELNA 1C4QA 1A6XA 3I56A 5C44G 3DLLA 2L11A 1D6EC 2A6EC 1C7YA 2JSOA 2OTLA 4B3RL 2EYOA 3RR5A 2C5CA 5JPNC 3TZUA 2DNCA 3CQZH 1IL8A 1CUKA 3OPOA 4LUZA 4V0BA 2D9UA 2PZWA 3MWYW 4YWKA 1MJEA 2A73B 2PYKA 3PMFA 3T13A 3FKIG 5FLMG 4HTHA 1JE4A 3GTPB 3GTOB 4LF8Q 3MFGA 1XXGA 2F0WA 1AZPA 5FOBB 3K7UC 4RKBA 4DV3Q 2F0JA 4JI5L 1I6HH 1IBML 1JCKB 1Y1VG 4ZK9B 4UPAA 2R93G 1ENCA 1KL9A 5IGGA 3C46A 2HQLA 3DWAA 5LMUL 1WTQA 1YBYA 2EXZA 1L0XB 2BOSA 4MZ9A 4WJ3M 5FLMH 1Q90A 4BY1G 1I4QA 3SXHA 1UEAB 4DR2L 5C4XB 3CKIB 4JI3Q 1SMYD 4LF4L 3HKZB 4A3MG 2CW0D 2WB1E 3K80C 3GTKB 3DM3A 2AQ2B 3I4OA 1GKHA 3C2PA 1IZ6A 1D5MC 4G4KA 4DR4Q 2F0LA 2PNHA 1PRTB 3S1MB 2Z6BA 1BOSA 3KOJA 3LGJA 1YIJA 2V4DA 4DGZA 2JEBI 1SNMA 1GUNA 1VQFA 5GROA 5IGCA 3T4AC 1FGUA 2F0NA 3T53B 3U58A 2FHTA 2NB0A 1K9MC 1I3QB 4QUCA 4RGOS 1UE7A 2Y0SE 2K05A 5DEHA 1L0YB 1OXXK 2HHHQ 2RSNA 4ZLTF 3AEVA 3D4RA 3UDIA 1GHJA 3PUWA 3M9BA 1K8OA 5CORA 5M3FH 3QJYA 1B9MA 1B8AA 1TVXA 2IX3A 3CCJA 4BA2I 3KJOA 1VQHA 4DUYL 5CV5A 4A3JH 1LTTD 3X3MA 1D2BA 4K0KL 4OL7A 4PQXA 3HOWG 5C0XG 3VR2A 2E2DC 4AIMA 4IFDH 1KDCA 5IGBA 4X64L 4BBSG 2MP1A 4N8X1 4APVA 2ASBA 2VZAA 3EFXD 4KHPL 2EY5A 2Z1CA 1VQGA 1E3PA 2K04A 2SOBA 2BE5D 4DV5L 1ENAA 4LF6L 4B3TQ 1K28A 2RKSA 3L0OA 3S15H 2K5VA 2F4VQ 3BVZA 5D3IB 1KRTA 1SXTA 3M3YH 2AKWB 2KEDA 2Z4IA 2NTTA 3OW2A 4DV6L 3IFDA 4FNFA 2E75C 4BBSH 4XXEA 1T9HA 1NNXA 4IJHA 4A3LH 5KGUA 4CHTB 4DR6Q 4LFAQ 4DV7L 2YU9B 2LSSA 1STAA 3PUYA 1BO0A 3S2HH 2F0DA 3G48A 1TWAH 3I73A 2HCIA 4A3KH 3HOZH 3S16H 1MSGA 1JMCA 4X3SA 2H4OA 4IQZA 4IPGA 5GAEC 4P71A 1HR0W 3KFUA 4LF7L 2Z4HA 4UAIA 4KTAA 4IURA 1I4GA 5A35A 1LT4D 1LT5D 1VQOA 4HCEA 2EOTA 3K5LA 2H1EA 2F0UA 3NP8A 5K36H 1WD0A 3S17H 3UDXA 1EIGA 4GLXA 4XQNA 4GN4B 3FP9A 1UE6A 5BN4A 3RZOB 1D8LA 2D0PA 2EJFC 4A3DG 3CCRA 1DZ1A 1PTOB 2WV6D 1AFPA 3I8ZA 4CJ0B 5I2YA 4A3IG 1V1QA 3R93A 1LT6D 3H3VH 2EJGC 1HUMA 1Y1WB 4JI8Q 1CT1D 1X65A 1OXTA 2R7ZH 5DM63 2MUYA 4BXXG 3QB3A 1IYUA 5J22A 1YNJD 3HKZE 3ICEA 1HQRD 1CSQA 3IRBA 2K52A 5HY6A 2WKDA 4JI4Q 2K5QA 1NBWA 4DR5Q 3EJIA 1VMPA 1PH8A 4RA8A 4HIDA 3I4NB 4C3HH 1EOVA 2WKCA 1E7ZA 1VQCA 1Q1EA 1X3PA 5DAUA 2A6ED 4GOPC 2DY7A 1MI2A 1PYSB 3G71A 3CPWA 1XPRA 1IKMA 3UE0A 1VQMA 3GTLB 2PQAB 2E8GA 2NVYH 3BDLA 3RD4A 4LK1C 4P73A 3Q6SA 1J9OA 2MQHA 3OSOA 3KLRA 2KUMA 4JVZA 2B2TC 3GTJH 4LF4Q 1IHZA 4XIGS 1G8ZD 1CZWA 3HOYG 3F2CA 1YNNC 1CHPD 1D5XC 5DNFA 2XWJB 3HZXA 4EQNA 1S5ED 3HEJA 3BJUA 1EYDA 2JA6H 1EYGA 3EVQA 1CZGA 1U9RA 1N36Q 2A19A 4NXMQ 2B3GA 3GV3A 4A3GB 4JI6L 5C0XJ 4DAPA 2F3IA 1GO3E 3S2DB 1BCPF 5COYA 5M3MG 1HNWQ 2E2HB 1B70B 3WOEA 1K3BC 5CV7A 5M9OA 1SE4A 4LFCQ 2UU9L 1A8VA 1YHQA 3NELA 1SYDA 1CKNB 1KIXA 1SNCA 2BDNA 1K83B 2F0QA 2ZXRA 3TP7A 4C3IH 5I6YA 3PF5A 1I4PA 3BU2A 3K7AB 2KQ3A 4DUYQ 1YI2A 3J7A5 5M5YH 2EYHA 1JWMD 3MXPA 4K0KQ 5C3EG 3A74A 5M3MH 4CKEA 1ET9A 5EQ0A 4K5WA 1QZGA 4J15A 2I0QA 2F3WA 1SAPA 5FLXL 3CC7A 1EUJA 4KHPQ 4BY7B 4KKUA 2SNMA 3GTMH 4JI7Q 2JK8A 5KEEA 1TWFH 3I72A 4DKAC 3J80c 4Y7NH 1RTOA 3ULPA 2BDOA 2ZXOA 2ZM6Q 1EY6A 4KMUC 3E6ZX 4K6LA 4C3JB 2MO1A 1JR0D 1JOQA 1A3VA 2HDLA 4ME5A 4PG3A 5EAYA 5KNBA 4WORA 1TU2B 2PI2E 1SMXA 1KTKA 3T1YQ 5DM73 4ZCKA 1PLFA 3VR6A 2AUKA 3BDCA 2RDGA 3L2PA 2L15A 1BBXC 3K0YA 5JEAH 4BS9A 4OELB 4L5SA 2IJ0A 4FF3A 4QCLA 1EU3A 1HR0L 4UP9A 4DXFA 2QCPX 1XYIA 3CCMA 2AQ3B 4UHVA 1R9TH 3NQIA 4YCUA 4DV4Q 3TS2A 1HZ9A 1SYGA 1F2LA 4ULLA 1SFOB 1V43A 3OW7A 4HEDA 1UAPA 1C8CA 4B3SQ 3CC2A 4DR3Q 5GQOA 1BBWA 2F03A 2KCTA 2V1CC 1B3AA 1WCMB 3D4DA 4JYAQ 1SN8A 5JAVA 3F8TA 2FMMA 1WTOA 1ILQA 4A75A 4H44C 4A3EH 3S1RB 1J5EL 1V8QA 3URYA 4C2MH 5ISRA 5LMNQ 1BKBA 1BBUA 1HQMC 1LTRD 3OYYA 4HSVA 5IYDG 5J39A 4BBRH 1JOOA 3HGBA 4A93B 4DUZQ 1SNDA 3EN2A 5M5XB 4IOAA 3IFTA 5I9OA 5KYIA 5FO8B 3DEPA 4DV0Q 3IKJA 3NENA 3VA5A 1K0SA 1SNOA 3Q22A 5M5WH 1L1OB 2OCEA 4YCVA 3GV6A 5KNDA 2L1BA 1K8MA 2F0EA 3HOUB 2G5DA 3STBC 3E0JA 2QDLA 3PO2H 4XQJA 4IO9A 1N32Q 2I5MX 3K5NA 5JJKA 2DY8A 2R92B 1LV9A 1U4MA 1ET6A 1I6VC 2WAQG 4P74A 4K2KA 1EIYB 2F0SA 1HNXQ 3Q8DA 4KHZA 1FR3A 3I70A 4A3FB 1WI5A 1YJ9A 5JOBA 4A3BH 2WP8J 1HZAA 2K75A 3S1QB 4FXKC 4N9PA 3JAML 3SK8A 4IUNA 3E9IA 3RLOA 1E24A 4QB4A 2RQXA 3SGIA 2JA7B 3CXCA 3BDOA 4LF9L 1SJHD 3GTQB 1JB7A 2VUMB 4H0LC 2CQOA 3ULJA 5HURA 3NBHA 1X3GA 1S40A 1I4RA 1VF5C 3T1HL 1DJRD 1KLUD 4OWXB 3ULLA 4FXDA 4EVOA 4RCOA 1JJGA 3HOXB 4GOPA 4QIWB 2XRQD 1II3A 5GAGC 5C4JH 3GTGH 2JA5H 2JA8B 1FJGQ 3HRZC 1J8IA 5IY0A 3VR5A 5GAHC 1QNKA 4JI6Q 2KOLA 4XYOA 3SDZA 1I94Q 4RHSA 2B2TA 2VNUD 4ZKBB 3PO3B 5FLXc 4KY6A 4S3SA 3QWNA 1ASZA 4RAUC 1PDQA 3F2UA 3A8IE 4O42A 4J6HA 1X55A 3L3OC 1YNND 4ZUJA 3T51B 2VQEL 4DAYA 1G2TA 3S1NB 4AQYL 4KKSA 3F1ZA 2UUBL 2Z0SA 4B3ML 3TRZA 1F9RA 3GTOH 3GTPH 1HHVA 3NWSA 4AYBB 4RMFA 3ITPA 4GKJQ 2KCNA 2TMPA 1N34L 4I7ZC 4IUUA 2HIXA 2F0IA 4CBVA 2HCCA 5IYCH 1U0LA 2O2LD 3GDEA 2Q2HA 2UXCQ 3D6WA 1JOKA 5E4XA 4GZYC 2E5LQ 3H09A 2MHVA 2KHIA 5KRUA 2NZ1D 3K81C 4YWLA 2D62A 2F52A 5C4XH 1PH9A 1LTBD 1F77A 2O5JC 1GUWA 1YNXA 2A6HC 1S5DD 3MA2B 1AW7A 1ASYA 2GVAA 1BCPB 2CHBD 4DAMA 1HFNA 3GTKH 2F0HA 5G3LD 5JVG3 5FLXE 1R4PB 3H3VI 4HAEA 3S1MH 1EEFD 3ER0A 2Z6KC 4DV2L 2IPKD 1RCVD 2DUDA 1LTLA 3CW2C 1TY2A 2A1AA 2LMCB 2I5HA 4ZUIA 3LNNA 1JJ2A 5IGEA 1DGSA 1O78A 1VQDA 4KY5A 4YWMA 4YY3L 4ZKCB 2D0OA 3CU7A 1VQ5A 5LHY1 1PTOC 2KCCA 3FMCA 3I55A 4HSPA 1O7ZA 3CPFA 4KD4A 1RF2D 1XMQQ 4F87A 3MZ5A 2B63B 1Y69U 2UUAL 1PH7A 4N9TA 2MO0A 3SR1A 1EY5A 1X56A 3WWVA 3VA7A 5LMNW 4NP5A 3UDGA 3A8JE 4ODGA 1DYQA 4OO1I 3GQBA 1NR2A 4GKKL 2MPMA 1TKWB 2JN4A 4K5XA 3KDFB 2KJXA 4UP7A 3R3OA 1LYLA 2B2UC 4X3UA 4IUQA 3U9SA 5FK9C 1HPCA 1SYEA 4CDFC 1EEID 4R4TA 4YIJA 2NWGA 1KLGD 1AE3A 1IYJB 3JAMc 1NJIC 1QVGA 1PYWD
chains in the Genus database with same CATH topology
2N78A 1W2BA 3TREA 4HIKA 4GN4B 4GLXA 3FP9A 3U4ZA 2NVQH 1Q82C 1UE6A 1J6QA 3KF8B 2VS1A 2VUMG 1D8LA 2D0PA 1E1TA 3OTOQ 5IYCG 4A3DG 2IHEA 3G6EA 2UUCQ 3CCRA 1A0IA 3PIOA 3HOXG 4A3IG 5H1SE 4POGA 1C0AA 3S24A 1MKHA 5C3EH 5M3FG 1IBLQ 1CKMA 1V1QA 4QIWE 5JEAJ 4JI1Q 3RLNA 1K0RA 2CFMA 2UU9Q 3H3VH 2JA8G 2YU9H 4JI8Q 1SROA 2B63H 4A3JG 5C0XI 2VQFL 5C4XG 1X65A 1FVIA 2NZOA 1OXTA 5J3BA 2R7ZH 3B6YA 4BXXG 3HKZG 3CCEA 3E0EA 4R4OA 2JA7H 3VDYA 3HKZE 3ICEA 3IRBA 1CSQA 4YCWA 4HJAA 1S72A 3F2BA 4B3TL 3PO3G 4IFDG 2K52A 2N49A 5HY6A 4JBKA 3PUZA 4JI4Q 4PMWA 1K8AC 1PYBA 1NBWA 1UWVA 2CKZB 4DR5Q 2F4VL 1PH8A 4HIDA 4JG2A 2BA0A 1KXLA 4C3HH 2VL6A 1EOVA 4OX9Q 2K14A 1G51A 5IWAL 4LF5Q 1E7ZA 1VQCA 1Z47A 4X62L 1XMOL 1QVFA 1Q1EA 2JEAI 3STBD 3W1GA 1WYDA 2NN6G 3RLFA 2IX0A 4EQ5A 4GOPC 3T1HQ 1Q81C 1PYSB 1CKOA 1WJJA 4AYBG 4DR6L 2JA9A 3G71A 2JJQA 3CPWA 1UE1A 1XPRA 4LFAL 4AYBE 5AJ3Q 1AE2A 3UE0A 3W5OA 1Q12A 1X6OA 5IYBH 1XMQL 1VQMA 4KI0A 1Q86C 2PQAB 1NMFA 2I5LX 2E8GA 2NVYH 3PO3H 2RHQB 2ALYB 4DV3L 4P73A 3RZOH 1PH5A 2UXDQ 2MQHA 4RG1A 4JV5Q 3JAMi 1PVOA 1VQKA 2N3SA 4OWWB 3A0JA 1K3RA 4A3LG 3GTJH 4LF4Q 4XIGS 1RL2A 2R7DA 1VQNA 1L0WA 4OXPA 5HGQA 3HOYG 1OXSC 1QUQA 5FJ8H 3F2CA 3RN2A 1QZHA 4L5TA 4X66Q 1YVCA 2YTYA 2K5NA 1Y1WH 4A3KG 3HOZG 1N8RC 3BJUA 1PH3A 1VQLA 2ID0A 1TWGH 4X65Q 2JA6H 4LFBQ 4KLKA 2AMCB 5DLQE 1N36Q 1EYGA 1I3QH 2A19A 1G291 4NXMQ 3EIVA 1HR0Q 1G6PA 5IP7H 4MTNA 2B3GA 3J81c 4GNXB 1RIPA 4JI6L 3HOVH 3K0XA 5C0XJ 2EIFA 2GVBA 4R1JA 3UE1A 1HNZQ 2F3IA 1GO3E 4XTCS 3I4NH 1NY4A 3KLWA 3KYHC 4LNQA 1TWCH 2K4KA 1LM0A 5M3MG 1HNWQ 1GM5A 3OTOL 1B70B 3RZDH 1N34Q 2UUCL 4JI2Q 2ZJRA 3S14H 1KAWA 3I4MH 2RHSB 2UXBQ 4P75A 5K36G 4ME3A 4HJ9A 1IBLL 2EQSA 1VQEA 1VQPA 4LFCQ 4LWCA 2UU9L 1A8VA 4JOIA 5IT9c 3NELA 1YHQA 3U50C 4WJ4A 4JI8L 1CKNB 2BA1A 2FXQA 3W1BA 1KIXA 3GTLH 4GN3B 3H0GH 4DR1Q 5IYDH 2K50A 2Q2TA 3E9HA 4C3IH 3PF5A 3BU2A 4NXNQ 4DPGA 4DUYQ 1YI2A 4IPDA 1A62A 1SRUA 1XPOA 3D0FA 4LW1A 3PUXA 1TWHH 4YHHQ 5M5YH 2AWNA 3J7A5 1L1OA 4LUOA 1J5EQ 4K0KQ 1EQRA 5C3EG 1Z9FA 4A4IA 4DR7Q 2H5XA 4JI4L 3A74A 5M3MH 2HHHL 2R6GA 1PHJA 4DR5L 4JI0Q 4PZ7A 1QZGA 4L5QA 3M7NA 4J15A 2B63G 4EX5A 2I0QA 1WFQA 5C44H 1PH4A 3CC7A 4OX9L 3RNUA 4GLAC 1EUJA 4KHPQ 2R7ZG 4IFDI 4LF5L 3I2ZA 3KJPA 1X9NA 3CCUA 3RN5A 2HIVA 3I7FA 3GTMH 4JI7Q 2JK8A 1XNQQ 1EIFA 4DV2Q 1OTCA 1TWFH 1VQBA 4A3GH 4DKAC 5AJ3L 1OXVA 3J80c 1QVCA 3ZJYC 4Y7NH 3ULPA 3AYHB 3CCVA 2QA4A 3S2DH 2KHJA 3CP0A 3FKIH 3J81i 2ZM6Q 4B3RQ 1YITA 2E2HH 2UXDL 4MNOA 1UE5A 2MO1A 3BZCA 2BH8A 3PSIA 4IPCA 4TVAB 4YY3Q 4PG3A 2NVXH 5EAYA 1VQ6A 1A63A 2MFIA 2PI2E 1SMXA 2E2IH 5IYBG 3T1YQ 1YJNA 1VQ7A 1GD7A 4X66L 1HZCA 2Q2UA 2IT1A 1K73C 1Y1VH 3KDFA 1JE5A 3L2PA 1K83H 1KC8C 2L15A 2DGYA 2R93H 4GNXC 4A3CG 2UUAQ 3K7AH 2KCMA 2N8NA 4L5SA 3J81j 2ES2A 1NE3A 4H02A 3HFZB 4X65L 1N36L 1M90C 1VCIA 2PI2A 4NPSA 2R7FA 3H15A 4JI5Q 1VQAA 1EWIA 1HR0L 5ELOA 5FJ8G 4NXML 4LF9Q 3AQQA 5BR8L 3FHWA 1XNRQ 4UP9A 3MEFA 3F2DA 1PA6A 1IBMQ 4BY1H 4ALPA 1Y1WG 1PH6A 1VQ4A 1P16A 1S3OA 3CCMA 2ATWA 1QUQB 4IJLA 1R9TH 3PUVA 4YCUA 4DV4Q 2HT1A 1JT8A 3U4VA 3TS2A 1HZ9A 1HNWL 2VW9A 4BY7H 4A3MH 2JA6G 4JI2L 5LMUQ 1SLJA 1V43A 2UXBL 5IP7G 3CF5A 3CCLA 4LUVA 4B3SQ 3EBEA 1KD1C 3HOVG 4JBJA 1L2FA 3GO5A 3CC2A 1FL0A 4DR3Q 4PZ6A 3M85A 2JE6I 1BBWA 5GQOA 4LFCL 2KCTA 3G4SA 4A76A 4DR2Q 3I4NG 2RF4A 2V1CC 4IFDJ 3CCSA 1E22A 4HIMA 1HZBA 3J7ZC 1IBKQ 4JYAQ 1SN8A 3F8TA 1YJWA 4GN5A 3K8AA 3KF6B 4NXNL 3M4PA 4A75A 1GVPA 4C3JH 1LUZA 4JC0A 1MIUA 4A3EH 4DK6C 3I4MG 3ERSX 2CWAA 1J5EL 1W3SA 2B29A 4C2MH 2ZTEA 4DR7L 5LMNQ 4A3CH 4DV1Q 1BKBA 4JI0L 1BBUA 3HKSA 2VQEQ 1K8GA 2QEXA 1SR3A 3OYYA 3CCQA 4AH6A 3H0GG 3M4QA 1N33Q 5JJLA 5IYDG 4AQYQ 2QGQA 5GADC 4BBRH 4DUZQ 2UUBQ 4HJ5A 1EQQA 4B3MQ 4HIOA 3EN2A 3JC66 4O0AA 4QY7A 4IOAA 4DV0Q 2VY3A 1HJPA 5E7NA 2OTJA 1Y14B 2K5HA 2YV5A 3NENA 4JCVE 3TQYA 4JI7L 1XNQL 1X54A 2NVTH 5M5WH 1L1OB 5IP9H 2OCEA 4YCVA 5ELNA 4BA1I 3I56A 5C44G 1M1KC 3DLLA 3STBC 3PO2H 4QL5A 4IO9A 4QQBX 1C7YA 1N32Q 2I5MX 1OXUA 3HOWH 5JJKA 2OTLA 4DNIA 2ZM6L 4B3RL 4JI1L 3L7ZC 3RR5A 2KENA 4P72A 4HJ8A 1SFOH 1P8LA 3CQZH 2WAQG 1XMOQ 4P74A 2WAQE 1EIYB 4A3GG 1CUKA 1Q1BA 3UDFA 1HNXQ 4LUZA 1NTGA 1O7IA 3Q8DA 4KHZA 3T1YL 3BZKA 2OQ0A 1WI5A 1YJ9A 1WCMH 4A3BH 4YWKA 1MJEA 2WP8J 1HZAA 2K75A 1HH2P 3FKIG 5FLMG 4FDBA 1Q7YC 4QJFA 4LF8Q 3E9IA 3RLOA 4NB3A 1UEBA 1E24A 2E2JH 3K7UC 4DV3Q 3SGIA 1I5FA 5IE8A 4X64Q 4PZ8A 4JI5L 1I6HH 3CXCA 4LF9L 2XGTA 1B7YB 2XTIA 1IBML 1JB7A 1Y1VG 2CQOA 4O2DA 3ULJA 1X3GA 4UPAA 2JQOA 1S40A 3T1HL 4DV4L 4OWXB 3ULLA 4JBWA 4DV5Q 2R93G 5JEAG 1KL9A 4LF6Q 4A93H 1JJGA 4GOPA 1BVSA 5M5XH 3CMAA 2HQLA 5LMUL 1VQ9A 5GAGC 4QGUA 1VQ8A 1YBYA 3TEHB 4WJ3M 2NN6I 4MZ9A 5C4JH 4B3SL 3GTGH 2JA5H 3A5ZB 2C35B 5FLMH 3CC4A 1FJGQ 2BH2A 4BY1G 4DR3L 4DR2L 4JV5L 5IY0A 5GAHC 4DV6Q 3AFPA 4JI3Q 4JI6Q 3HOUH 4LF4L 1IBKL 4JYAL 2YTVA 1I94Q 4BY7G 1SE8A 4A3MG 2WB1G 2VNUD 5FLXc 2R92H 2WB1E 3K80C 3PV0A 3DM3A 2ZTDA 3I4OA 1GKHA 3PGZA 4DV7Q 4X6AH 1ASZA 1IZ6A 2Z6KA 4DR4Q 4R4IA 5LMNL 4JOIC 2PNHA 1KHIA 4DV1L 1YZ6A 1X55A 2VQEL 4A3FH 1N33L 4LFBL 4OO1G 3KOJA 3LGJA 1Q46A 4AQYL 1YIJA 2ZJQA 2PMZE 4L5RC 3F1ZA 2AHOB 1PH1A 1E1OA 4DUZL 2UUBL 1EFWA 2Z0SA 4B3ML 3TRZA 2MNAA 3GTPH 1VQJA 2JEBI 3NEMA 4A3EG 3GTOH 1VQFA 1L1OC 5GROA 1HNZL 4DV0L 4RMFA 4UY8C 1KQSA 4GKJQ 4GKKQ 1FGUA 1XTDA 2Y0SG 2IHFA 2IY5B 3U58A 1K9MC 4R4QA 4LF7Q 1UE7A 2Y0SE 4IPHA 3GTQH 1N34L 1U5KA 1OXXK 1NMGA 2HIXA 3D31A 2VUMH 2HHHQ 4BBRG 3AEVA 5IYCH 4A3DH 1U0LA 3GDEA 1N32L 4HJ7A 1Q8KA 2NZHA 2Q2HA 2UXCQ 3UDIA 3HOXH 3PUWA 3M9BA 4A3IH 2E5LQ 3S1QH 5M3FH 2KHIA 2KBNA 2Q2IA 2YTXA 1B8AA 3GD7A 4DR1L 3CCJA 4BA2I 1XPUA 3K81C 2JA8H 5IP9G 2WFWA 3KJOA 1HNXL 1VQHA 4R4CA 2AWOA 4DUYL 4YWLA 2D62A 2F52A 5C4XH 4A3JH 1PH9A 5JJIA 1YNXA 3J80i 4YHHL 3PO2G 3CMEA 4K0KL 3HOWG 4BXXH 2OQKA 4GS3A 5C0XG 1ASYA 4LF8L 2GVAA 1H95A 4DAMA 1V9PA 4AIMA 3GTKH 4X64L 4BBSG 4APVA 2ASBA 2VZAA 4KHPL 2IX1A 1VQGA 2VQFQ 1D7QA 3H3VI 1E3PA 1WCMG 3S1MH 4A3BG 3S1NH 3ER0A 4OWTB 2Z6KC 3CAMA 4DV5L 4DV2L 2DUDA 1LTLA 3CW2C 4B3TQ 4LF6L 1VS0A 3L0OA 2A1AA 3S15H 4GLVB 2K5VA 2PQAA 4UP8A 2I5HA 1KRSA 2LXKA 2F4VQ 1JJ2A 1DGSA 3TS0A 1KRTA 1FJGL 1X3FA 1C9OA 2ZTCA 3M3YH 2AKWB 1VQDA 5IWAQ 5BR8Q 1AH9A 3OW2A 4DV6L 4JI3L 4YWMA 4YY3L 1YHAA 4X62Q 1TXYA 2LXJA 2EXDA 4BBSH 2D0OA 1I94L 3KF6A 4A93G 1VQ5A 1T9HA 4IJHA 3NBHB 4IOCA 4A3LH 2CCZA 4Y52H 4DR6Q 3I55A 1N9WA 3HOYH 1PV4A 4LFAQ 3PIPA 3A5UA 3CPFA 1PFSA 2JA5G 4GOPB 4DV7L 1XMQQ 1MJCA 2LSSA 3MXNB 3PUYA 1CSPA 4DR4L 3S2HH 2UUAL 4JBMA 3G48A 1TWAH 1VQIA 1X3EA 1PH7A 3HOUG 4A3KH 3S1RH 1IXRA 2MO0A 2ZJPA 4POFA 3S16H 4GNXA 3HOZH 1I50H 1XNRL 2A8VA 1X56A 1JMCA 3WWVA 5LMNW 2CWPA 2YYZA 1JJCB 3UDGA 2R92G 1WOCA 3M4OH 1YHBA 4IPGA 1PH2A 1IL2A 1XJVA 5GAEC 4P71A 1HR0W 2GN5A 2OWOA 3PCOB 4GKKL 4GKJL 3KFUA 4OO1I 4LF7L 1YEZA 3KDFB 3CD6A 4UP7A 4DK3C 4A3FG 4TQUS 3PF4A 1LYLA 2RCNA 4R4TA 3AFQA 1VQOA 2UXCL 4DAYB 4OONA 1CKNA 2E5LL 1AE3A 1IYJB 3JAMc 1NJIC 3S17H 2JA7G 1QVGA 3UDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N78 A;  1W2B A;  3TRE A;  4HIK A;  4GN4 B;  4GLX A;  3FP9 A;  3U4Z A;  2NVQ H;  1Q82 C;  1UE6 A;  1J6Q A;  3KF8 B;  2VS1 A;  2VUM G;  1D8L A;  2D0P A;  1E1T A;  3OTO Q;  5IYC G;  4A3D G;  2IHE A;  3G6E A;  2UUC Q;  3CCR A;  1A0I A;  3PIO A;  3HOX G;  4A3I G;  5H1S E;  4POG A;  1C0A A;  3S24 A;  1MKH A;  5C3E H;  5M3F G;  1IBL Q;  1CKM A;  1V1Q A;  4QIW E;  5JEA J;  4JI1 Q;  3RLN A;  1K0R A;  2CFM A;  2UU9 Q;  3H3V H;  2JA8 G;  2YU9 H;  4JI8 Q;  1SRO A;  2B63 H;  4A3J G;  5C0X I;  2VQF L;  5C4X G;  1X65 A;  1FVI A;  2NZO A;  1OXT A;  5J3B A;  2R7Z H;  3B6Y A;  4BXX G;  3HKZ G;  3CCE A;  3E0E A;  4R4O A;  2JA7 H;  3VDY A;  3HKZ E;  3ICE A;  3IRB A;  1CSQ A;  4YCW A;  4HJA A;  1S72 A;  3F2B A;  4B3T L;  3PO3 G;  4IFD G;  2K52 A;  2N49 A;  5HY6 A;  4JBK A;  3PUZ A;  4JI4 Q;  4PMW A;  1K8A C;  1PYB A;  1NBW A;  1UWV A;  2CKZ B;  4DR5 Q;  2F4V L;  1PH8 A;  4HID A;  4JG2 A;  2BA0 A;  1KXL A;  4C3H H;  2VL6 A;  1EOV A;  4OX9 Q;  2K14 A;  1G51 A;  5IWA L;  4LF5 Q;  1E7Z A;  1VQC A;  1Z47 A;  4X62 L;  1XMO L;  1QVF A;  1Q1E A;  2JEA I;  3STB D;  3W1G A;  1WYD A;  2NN6 G;  3RLF A;  2IX0 A;  4EQ5 A;  4GOP C;  3T1H Q;  1Q81 C;  1PYS B;  1CKO A;  1WJJ A;  4AYB G;  4DR6 L;  2JA9 A;  3G71 A;  2JJQ A;  3CPW A;  1UE1 A;  1XPR A;  4LFA L;  4AYB E;  5AJ3 Q;  1AE2 A;  3UE0 A;  3W5O A;  1Q12 A;  1X6O A;  5IYB H;  1XMQ L;  1VQM A;  4KI0 A;  1Q86 C;  2PQA B;  1NMF A;  2I5L X;  2E8G A;  2NVY H;  3PO3 H;  2RHQ B;  2ALY B;  4DV3 L;  4P73 A;  3RZO H;  1PH5 A;  2UXD Q;  2MQH A;  4RG1 A;  4JV5 Q;  3JAM i;  1PVO A;  1VQK A;  2N3S A;  4OWW B;  3A0J A;  1K3R A;  4A3L G;  3GTJ H;  4LF4 Q;  4XIG S;  1RL2 A;  2R7D A;  1VQN A;  1L0W A;  4OXP A;  5HGQ A;  3HOY G;  1OXS C;  1QUQ A;  5FJ8 H;  3F2C A;  3RN2 A;  1QZH A;  4L5T A;  4X66 Q;  1YVC A;  2YTY A;  2K5N A;  1Y1W H;  4A3K G;  3HOZ G;  1N8R C;  3BJU A;  1PH3 A;  1VQL A;  2ID0 A;  1TWG H;  4X65 Q;  2JA6 H;  4LFB Q;  4KLK A;  2AMC B;  5DLQ E;  1N36 Q;  1EYG A;  1I3Q H;  2A19 A;  1G29 1;  4NXM Q;  3EIV A;  1HR0 Q;  1G6P A;  5IP7 H;  4MTN A;  2B3G A;  3J81 c;  4GNX B;  1RIP A;  4JI6 L;  3HOV H;  3K0X A;  5C0X J;  2EIF A;  2GVB A;  4R1J A;  3UE1 A;  1HNZ Q;  2F3I A;  1GO3 E;  4XTC S;  3I4N H;  1NY4 A;  3KLW A;  3KYH C;  4LNQ A;  1TWC H;  2K4K A;  1LM0 A;  5M3M G;  1HNW Q;  1GM5 A;  3OTO L;  1B70 B;  3RZD H;  1N34 Q;  2UUC L;  4JI2 Q;  2ZJR A;  3S14 H;  1KAW A;  3I4M H;  2RHS B;  2UXB Q;  4P75 A;  5K36 G;  4ME3 A;  4HJ9 A;  1IBL L;  2EQS A;  1VQE A;  1VQP A;  4LFC Q;  4LWC A;  2UU9 L;  1A8V A;  4JOI A;  5IT9 c;  3NEL A;  1YHQ A;  3U50 C;  4WJ4 A;  4JI8 L;  1CKN B;  2BA1 A;  2FXQ A;  3W1B A;  1KIX A;  3GTL H;  4GN3 B;  3H0G H;  4DR1 Q;  5IYD H;  2K50 A;  2Q2T A;  3E9H A;  4C3I H;  3PF5 A;  3BU2 A;  4NXN Q;  4DPG A;  4DUY Q;  1YI2 A;  4IPD A;  1A62 A;  1SRU A;  1XPO A;  3D0F A;  4LW1 A;  3PUX A;  1TWH H;  4YHH Q;  5M5Y H;  2AWN A;  3J7A 5;  1L1O A;  4LUO A;  1J5E Q;  4K0K Q;  1EQR A;  5C3E G;  1Z9F A;  4A4I A;  4DR7 Q;  2H5X A;  4JI4 L;  3A74 A;  5M3M H;  2HHH L;  2R6G A;  1PHJ A;  4DR5 L;  4JI0 Q;  4PZ7 A;  1QZG A;  4L5Q A;  3M7N A;  4J15 A;  2B63 G;  4EX5 A;  2I0Q A;  1WFQ A;  5C44 H;  1PH4 A;  3CC7 A;  4OX9 L;  3RNU A;  4GLA C;  1EUJ A;  4KHP Q;  2R7Z G;  4IFD I;  4LF5 L;  3I2Z A;  3KJP A;  1X9N A;  3CCU A;  3RN5 A;  2HIV A;  3I7F A;  3GTM H;  4JI7 Q;  2JK8 A;  1XNQ Q;  1EIF A;  4DV2 Q;  1OTC A;  1TWF H;  1VQB A;  4A3G H;  4DKA C;  5AJ3 L;  1OXV A;  3J80 c;  1QVC A;  3ZJY C;  4Y7N H;  3ULP A;  3AYH B;  3CCV A;  2QA4 A;  3S2D H;  2KHJ A;  3CP0 A;  3FKI H;  3J81 i;  2ZM6 Q;  4B3R Q;  1YIT A;  2E2H H;  2UXD L;  4MNO A;  1UE5 A;  2MO1 A;  3BZC A;  2BH8 A;  3PSI A;  4IPC A;  4TVA B;  4YY3 Q;  4PG3 A;  2NVX H;  5EAY A;  1VQ6 A;  1A63 A;  2MFI A;  2PI2 E;  1SMX A;  2E2I H;  5IYB G;  3T1Y Q;  1YJN A;  1VQ7 A;  1GD7 A;  4X66 L;  1HZC A;  2Q2U A;  2IT1 A;  1K73 C;  1Y1V H;  3KDF A;  1JE5 A;  3L2P A;  1K83 H;  1KC8 C;  2L15 A;  2DGY A;  2R93 H;  4GNX C;  4A3C G;  2UUA Q;  3K7A H;  2KCM A;  2N8N A;  4L5S A;  3J81 j;  2ES2 A;  1NE3 A;  4H02 A;  3HFZ B;  4X65 L;  1N36 L;  1M90 C;  1VCI A;  2PI2 A;  4NPS A;  2R7F A;  3H15 A;  4JI5 Q;  1VQA A;  1EWI A;  1HR0 L;  5ELO A;  5FJ8 G;  4NXM L;  4LF9 Q;  3AQQ A;  5BR8 L;  3FHW A;  1XNR Q;  4UP9 A;  3MEF A;  3F2D A;  1PA6 A;  1IBM Q;  4BY1 H;  4ALP A;  1Y1W G;  1PH6 A;  1VQ4 A;  1P16 A;  1S3O A;  3CCM A;  2ATW A;  1QUQ B;  4IJL A;  1R9T H;  3PUV A;  4YCU A;  4DV4 Q;  2HT1 A;  1JT8 A;  3U4V A;  3TS2 A;  1HZ9 A;  1HNW L;  2VW9 A;  4BY7 H;  4A3M H;  2JA6 G;  4JI2 L;  5LMU Q;  1SLJ A;  1V43 A;  2UXB L;  5IP7 G;  3CF5 A;  3CCL A;  4LUV A;  4B3S Q;  3EBE A;  1KD1 C;  3HOV G;  4JBJ A;  1L2F A;  3GO5 A;  3CC2 A;  1FL0 A;  4DR3 Q;  4PZ6 A;  3M85 A;  2JE6 I;  1BBW A;  5GQO A;  4LFC L;  2KCT A;  3G4S A;  4A76 A;  4DR2 Q;  3I4N G;  2RF4 A;  2V1C C;  4IFD J;  3CCS A;  1E22 A;  4HIM A;  1HZB A;  3J7Z C;  1IBK Q;  4JYA Q;  1SN8 A;  3F8T A;  1YJW A;  4GN5 A;  3K8A A;  3KF6 B;  4NXN L;  3M4P A;  4A75 A;  1GVP A;  4C3J H;  1LUZ A;  4JC0 A;  1MIU A;  4A3E H;  4DK6 C;  3I4M G;  3ERS X;  2CWA A;  1J5E L;  1W3S A;  2B29 A;  4C2M H;  2ZTE A;  4DR7 L;  5LMN Q;  4A3C H;  4DV1 Q;  1BKB A;  4JI0 L;  1BBU A;  3HKS A;  2VQE Q;  1K8G A;  2QEX A;  1SR3 A;  3OYY A;  3CCQ A;  4AH6 A;  3H0G G;  3M4Q A;  1N33 Q;  5JJL A;  5IYD G;  4AQY Q;  2QGQ A;  5GAD C;  4BBR H;  4DUZ Q;  2UUB Q;  4HJ5 A;  1EQQ A;  4B3M Q;  4HIO A;  3EN2 A;  3JC6 6;  4O0A A;  4QY7 A;  4IOA A;  4DV0 Q;  2VY3 A;  1HJP A;  5E7N A;  2OTJ A;  1Y14 B;  2K5H A;  2YV5 A;  3NEN A;  4JCV E;  3TQY A;  4JI7 L;  1XNQ L;  1X54 A;  2NVT H;  5M5W H;  1L1O B;  5IP9 H;  2OCE A;  4YCV A;  5ELN A;  4BA1 I;  3I56 A;  5C44 G;  1M1K C;  3DLL A;  3STB C;  3PO2 H;  4QL5 A;  4IO9 A;  4QQB X;  1C7Y A;  1N32 Q;  2I5M X;  1OXU A;  3HOW H;  5JJK A;  2OTL A;  4DNI A;  2ZM6 L;  4B3R L;  4JI1 L;  3L7Z C;  3RR5 A;  2KEN A;  4P72 A;  4HJ8 A;  1SFO H;  1P8L A;  3CQZ H;  2WAQ G;  1XMO Q;  4P74 A;  2WAQ E;  1EIY B;  4A3G G;  1CUK A;  1Q1B A;  3UDF A;  1HNX Q;  4LUZ A;  1NTG A;  1O7I A;  3Q8D A;  4KHZ A;  3T1Y L;  3BZK A;  2OQ0 A;  1WI5 A;  1YJ9 A;  1WCM H;  4A3B H;  4YWK A;  1MJE A;  2WP8 J;  1HZA A;  2K75 A;  1HH2 P;  3FKI G;  5FLM G;  4FDB A;  1Q7Y C;  4QJF A;  4LF8 Q;  3E9I A;  3RLO A;  4NB3 A;  1UEB A;  1E24 A;  2E2J H;  3K7U C;  4DV3 Q;  3SGI A;  1I5F A;  5IE8 A;  4X64 Q;  4PZ8 A;  4JI5 L;  1I6H H;  3CXC A;  4LF9 L;  2XGT A;  1B7Y B;  2XTI A;  1IBM L;  1JB7 A;  1Y1V G;  2CQO A;  4O2D A;  3ULJ A;  1X3G A;  4UPA A;  2JQO A;  1S40 A;  3T1H L;  4DV4 L;  4OWX B;  3ULL A;  4JBW A;  4DV5 Q;  2R93 G;  5JEA G;  1KL9 A;  4LF6 Q;  4A93 H;  1JJG A;  4GOP A;  1BVS A;  5M5X H;  3CMA A;  2HQL A;  5LMU L;  1VQ9 A;  5GAG C;  4QGU A;  1VQ8 A;  1YBY A;  3TEH B;  4WJ3 M;  2NN6 I;  4MZ9 A;  5C4J H;  4B3S L;  3GTG H;  2JA5 H;  3A5Z B;  2C35 B;  5FLM H;  3CC4 A;  1FJG Q;  2BH2 A;  4BY1 G;  4DR3 L;  4DR2 L;  4JV5 L;  5IY0 A;  5GAH C;  4DV6 Q;  3AFP A;  4JI3 Q;  4JI6 Q;  3HOU H;  4LF4 L;  1IBK L;  4JYA L;  2YTV A;  1I94 Q;  4BY7 G;  1SE8 A;  4A3M G;  2WB1 G;  2VNU D;  5FLX c;  2R92 H;  2WB1 E;  3K80 C;  3PV0 A;  3DM3 A;  2ZTD A;  3I4O A;  1GKH A;  3PGZ A;  4DV7 Q;  4X6A H;  1ASZ A;  1IZ6 A;  2Z6K A;  4DR4 Q;  4R4I A;  5LMN L;  4JOI C;  2PNH A;  1KHI A;  4DV1 L;  1YZ6 A;  1X55 A;  2VQE L;  4A3F H;  1N33 L;  4LFB L;  4OO1 G;  3KOJ A;  3LGJ A;  1Q46 A;  4AQY L;  1YIJ A;  2ZJQ A;  2PMZ E;  4L5R C;  3F1Z A;  2AHO B;  1PH1 A;  1E1O A;  4DUZ L;  2UUB L;  1EFW A;  2Z0S A;  4B3M L;  3TRZ A;  2MNA A;  3GTP H;  1VQJ A;  2JEB I;  3NEM A;  4A3E G;  3GTO H;  1VQF A;  1L1O C;  5GRO A;  1HNZ L;  4DV0 L;  4RMF A;  4UY8 C;  1KQS A;  4GKJ Q;  4GKK Q;  1FGU A;  1XTD A;  2Y0S G;  2IHF A;  2IY5 B;  3U58 A;  1K9M C;  4R4Q A;  4LF7 Q;  1UE7 A;  2Y0S E;  4IPH A;  3GTQ H;  1N34 L;  1U5K A;  1OXX K;  1NMG A;  2HIX A;  3D31 A;  2VUM H;  2HHH Q;  4BBR G;  3AEV A;  5IYC H;  4A3D H;  1U0L A;  3GDE A;  1N32 L;  4HJ7 A;  1Q8K A;  2NZH A;  2Q2H A;  2UXC Q;  3UDI A;  3HOX H;  3PUW A;  3M9B A;  4A3I H;  2E5L Q;  3S1Q H;  5M3F H;  2KHI A;  2KBN A;  2Q2I A;  2YTX A;  1B8A A;  3GD7 A;  4DR1 L;  3CCJ A;  4BA2 I;  1XPU A;  3K81 C;  2JA8 H;  5IP9 G;  2WFW A;  3KJO A;  1HNX L;  1VQH A;  4R4C A;  2AWO A;  4DUY L;  4YWL A;  2D62 A;  2F52 A;  5C4X H;  4A3J H;  1PH9 A;  5JJI A;  1YNX A;  3J80 i;  4YHH L;  3PO2 G;  3CME A;  4K0K L;  3HOW G;  4BXX H;  2OQK A;  4GS3 A;  5C0X G;  1ASY A;  4LF8 L;  2GVA A;  1H95 A;  4DAM A;  1V9P A;  4AIM A;  3GTK H;  4X64 L;  4BBS G;  4APV A;  2ASB A;  2VZA A;  4KHP L;  2IX1 A;  1VQG A;  2VQF Q;  1D7Q A;  3H3V I;  1E3P A;  1WCM G;  3S1M H;  4A3B G;  3S1N H;  3ER0 A;  4OWT B;  2Z6K C;  3CAM A;  4DV5 L;  4DV2 L;  2DUD A;  1LTL A;  3CW2 C;  4B3T Q;  4LF6 L;  1VS0 A;  3L0O A;  2A1A A;  3S15 H;  4GLV B;  2K5V A;  2PQA A;  4UP8 A;  2I5H A;  1KRS A;  2LXK A;  2F4V Q;  1JJ2 A;  1DGS A;  3TS0 A;  1KRT A;  1FJG L;  1X3F A;  1C9O A;  2ZTC A;  3M3Y H;  2AKW B;  1VQD A;  5IWA Q;  5BR8 Q;  1AH9 A;  3OW2 A;  4DV6 L;  4JI3 L;  4YWM A;  4YY3 L;  1YHA A;  4X62 Q;  1TXY A;  2LXJ A;  2EXD A;  4BBS H;  2D0O A;  1I94 L;  3KF6 A;  4A93 G;  1VQ5 A;  1T9H A;  4IJH A;  3NBH B;  4IOC A;  4A3L H;  2CCZ A;  4Y52 H;  4DR6 Q;  3I55 A;  1N9W A;  3HOY H;  1PV4 A;  4LFA Q;  3PIP A;  3A5U A;  3CPF A;  1PFS A;  2JA5 G;  4GOP B;  4DV7 L;  1XMQ Q;  1MJC A;  2LSS A;  3MXN B;  3PUY A;  1CSP A;  4DR4 L;  3S2H H;  2UUA L;  4JBM A;  3G48 A;  1TWA H;  1VQI A;  1X3E A;  1PH7 A;  3HOU G;  4A3K H;  3S1R H;  1IXR A;  2MO0 A;  2ZJP A;  4POF A;  3S16 H;  4GNX A;  3HOZ H;  1I50 H;  1XNR L;  2A8V A;  1X56 A;  1JMC A;  3WWV A;  5LMN W;  2CWP A;  2YYZ A;  1JJC B;  3UDG A;  2R92 G;  1WOC A;  3M4O H;  1YHB A;  4IPG A;  1PH2 A;  1IL2 A;  1XJV A;  5GAE C;  4P71 A;  1HR0 W;  2GN5 A;  2OWO A;  3PCO B;  4GKK L;  4GKJ L;  3KFU A;  4OO1 I;  4LF7 L;  1YEZ A;  3KDF B;  3CD6 A;  4UP7 A;  4DK3 C;  4A3F G;  4TQU S;  3PF4 A;  1LYL A;  2RCN A;  4R4T A;  3AFQ A;  1VQO A;  2UXC L;  4DAY B;  4OON A;  1CKN A;  2E5L L;  1AE3 A;  1IYJ B;  3JAM c;  1NJI C;  3S17 H;  2JA7 G;  1QVG A;  3UDX A; 
#chains in the Genus database with same CATH topology
 2JYO A;  2N78 A;  4G7Z C;  1ICW A;  1GHK A;  3KF8 B;  3OTO Q;  3DMU A;  4FYD A;  2UUC Q;  3C1E A;  3P75 A;  1MBY A;  2QEJ C;  4POG A;  3S24 A;  1MKH A;  2HD3 A;  5M3F G;  1CKM A;  2RBM A;  4QIW E;  2PZU A;  2CFM A;  4CJ1 B;  2YU9 H;  1LAB A;  4A3J G;  2VQF L;  1STG A;  2R3Z A;  1TWG B;  2KEE A;  2K1B A;  5CR3 A;  2B8G A;  4YCW A;  1S72 A;  3F2B A;  4IFD G;  4LMQ D;  3HOV B;  1A3T A;  4PMW A;  4EQP A;  1UWV A;  3K58 A;  4JG2 A;  4ID6 A;  1G91 A;  2F1M A;  1QCB D;  5T1I A;  1G51 A;  2EYF A;  5IWA L;  5J1Z A;  3RZD B;  4X62 L;  1XMO L;  3EA6 A;  3S14 B;  2EYL A;  3H3V C;  2F0T A;  3STB D;  3W1G A;  4U68 A;  3I4M B;  3RLF A;  2IX0 A;  3T1H Q;  3X3N A;  1DOM A;  1UE1 A;  1F9Q A;  4AYB E;  5AJ3 Q;  2K01 A;  3R2I A;  1JOR A;  1LTS D;  2O4X A;  3H0G B;  2I5L X;  4R9W A;  2A69 C;  3JAM E;  4JW0 A;  1R4Q B;  2ALY B;  3RZO H;  2UXD Q;  1ILP A;  3JAM i;  1PVO A;  1VQK A;  1PRT D;  2N3S A;  4OWW B;  1PTO H;  4A3L G;  2OT2 A;  1RL2 A;  2R7D A;  1VQN A;  5FJ8 H;  1QUQ A;  1B44 D;  1EY7 A;  1WTH A;  2RDF A;  4CDE C;  3RN2 A;  1QZH A;  4X66 Q;  1JWS D;  3IL8 A;  1Y1W H;  5C44 B;  4A3K G;  3HOZ G;  1B50 A;  2CQA A;  2OXP A;  4DAV A;  1EYC A;  2XN9 C;  4KLK A;  3EIV A;  5IP7 H;  2F0P A;  4R1J A;  3UE1 A;  3J7A V;  1SYF A;  3I4N H;  2FJ2 A;  1NY4 A;  3NK9 A;  2LFN A;  1KAA A;  1TWC H;  1LM0 A;  3FKI B;  3E3X A;  1B4O A;  1N34 Q;  1A3U A;  2PNR C;  4V19 0;  1IYV A;  1STH A;  1QNU A;  3D3R A;  5K36 G;  1EL0 A;  4ME3 A;  4HJ9 A;  1IBL L;  3W1B A;  1Y1V B;  5ELD A;  3GTL H;  2VB2 X;  2PW5 A;  3W2D A;  3J80 L;  5ELB A;  1F9S A;  2Q2T A;  2R93 B;  1BXT A;  3WOF A;  2L0C A;  4OHJ A;  2J0T D;  1XPO A;  1SRU A;  3D0F A;  2LS0 1;  4F8M A;  1QOH A;  3OWE B;  4BY1 B;  1FD7 D;  4L5Q A;  1ZKO A;  2B2Y C;  4OX9 L;  3SK6 A;  2R7Z G;  2K32 A;  5C5M A;  3T56 B;  4A3M B;  4LF5 L;  3A55 A;  1X9N A;  1HA6 A;  3RN5 A;  4OIK A;  1EIF A;  4DV2 Q;  1OTC A;  4A3G H;  4NDX A;  4K8J A;  1QVC A;  5M3F B;  1U4P A;  2CH4 A;  4C3H G;  5E4W C;  1HFG A;  2PCF B;  3CHB D;  4KV6 A;  2PMZ B;  2QA4 A;  3S2D H;  2KHJ A;  1BNZ A;  5I2X A;  4B3R Q;  3ERO A;  2E2H H;  2SEB D;  1UE5 A;  5EKL A;  2A6H D;  2BH8 A;  3PSI A;  4IPC A;  1O7Y A;  4YY3 Q;  4RGM A;  2L4N A;  4UDU C;  2MFI A;  1PXU A;  3D6C A;  2E2I H;  1VQ7 A;  1GD7 A;  4ZQ3 A;  3HS0 C;  2IT1 A;  1CK1 A;  3BZD B;  1JE5 A;  1K83 H;  2A68 C;  2LY7 A;  2QIL A;  1F9P A;  4GNX C;  2UUA Q;  3K7A H;  2KCM A;  1W6K A;  4IUP A;  1NE3 A;  4X65 L;  2PI2 A;  3H15 A;  4JI5 Q;  1VQA A;  1EWI A;  2EYJ A;  4PMC A;  5ELO A;  1X3Q A;  3MEH A;  2NBF A;  3AQQ A;  2NVT B;  1EZ6 A;  1PA6 A;  1IBM Q;  4N8F A;  1B2T A;  1PH6 A;  1S3O A;  1JT8 A;  1MD2 D;  3HOW B;  3BYY B;  4BY7 H;  1ZXT A;  3VYU A;  2JA6 G;  4JI2 L;  5LMU Q;  2UXB L;  1VMC A;  4LUV A;  4BBS B;  1XTC D;  4JBJ A;  5ELE A;  1PTO D;  1BDO A;  1PH4 A;  3M85 A;  3G4S A;  2JE6 I;  4DR2 Q;  4IFD J;  4RHR A;  4OO1 H;  3J7Z C;  1AEX A;  4DA2 A;  3KF6 B;  4NXN L;  2E2J B;  1GVP A;  4C3J H;  4M1U B;  1HUN A;  4DK6 C;  5CBA E;  1W3S A;  2EDG A;  5EBD A;  2ZTE A;  1LTI D;  4DR7 L;  3QO2 A;  4P2C B;  1DON A;  4JI0 L;  3HKS A;  2K6A A;  2X69 A;  2B2U A;  4C3I G;  1HTP A;  4KJN A;  1VDZ A;  4QY7 A;  1X32 A;  2K5H A;  2YV5 A;  2RDH A;  1XNQ L;  4B08 A;  1X54 A;  5IP9 H;  1LLR D;  2KA7 A;  4NMZ A;  1STE A;  5IOC A;  1S4Z A;  2F0M A;  1SNQ A;  4K2L A;  1ZEQ X;  2EZV A;  4K14 A;  3QOJ A;  4WJW A;  3L7Z C;  1B3Q A;  1WTR A;  1RTN A;  4L63 B;  4HJ8 A;  3ONA B;  1SFO H;  1P8L A;  2X6L A;  3MTS A;  4OEM B;  1XMO Q;  1CM9 A;  4TRD A;  4K8I A;  1Q1B A;  4NW2 A;  3UDF A;  1NTG A;  1S5F D;  1EY8 A;  2R61 A;  3BZK A;  4MTK A;  1WCM H;  3V2T A;  1H9S A;  4NB3 A;  4PNY A;  4WFN 3;  5IE8 A;  4X64 Q;  4X3T A;  4F88 A;  5EGT A;  1Z6H A;  2XGT A;  1B7Y B;  2XTI A;  2ENB A;  4O2D A;  3NTH A;  4A3D B;  4DV5 Q;  3OMC A;  3CRL C;  4JBW A;  4KD3 A;  5JEA G;  3KK7 A;  1QE6 A;  4A93 H;  4LF6 Q;  3UI2 A;  4MN3 A;  4A3I B;  1BVS A;  5M5X H;  3CMA A;  3MXN A;  1VQ8 A;  2EPB A;  1O80 A;  1SYC A;  2C35 B;  3CC4 A;  4RKL A;  1RD9 D;  4NKL A;  3Q0A A;  1BQQ T;  4DV6 Q;  3HOU H;  1IBK L;  4ZRZ A;  2YTV A;  1SE8 A;  2WB1 G;  2A69 D;  2K7V A;  2R92 H;  3LWE A;  3PV0 A;  1BCP C;  1BF4 A;  3PGZ A;  4DV7 Q;  3E5S A;  2HQE A;  4JOI C;  4DV1 L;  2F0F A;  4A3F H;  1N33 L;  4FXG C;  4LFB L;  1Q46 A;  2ZJQ A;  2PMZ E;  4L5R C;  3S1Q H;  1PH1 A;  4FF2 A;  2FMC A;  2MNA A;  4A3E G;  1Y8N B;  5EPL A;  3MC0 B;  1U4R A;  1M8A A;  4UY8 C;  2OEO A;  1XTD A;  2Y0S G;  5CGK A;  4LF7 Q;  5NUC A;  3IAY A;  3GTQ H;  3A54 A;  1U5K A;  2VUM H;  4BBR G;  2KVM A;  4HJ7 A;  1Q8K A;  2NZH A;  2NTS A;  3MFY A;  5K5P A;  3HOX H;  1IW7 D;  3HOY B;  4MHE A;  3KLS X;  2Q2I A;  2YTX A;  3I90 A;  4DR1 L;  1XPU A;  2JA8 H;  5EPK A;  2WFW A;  3J80 E;  2RVL A;  4YHH L;  3J80 i;  3PO2 G;  1A2T A;  2F0V A;  1I50 B;  1PMR A;  1H9R A;  1ROD A;  2A5H A;  3J81 L;  3CME A;  1WD1 A;  4GS3 A;  5JPM C;  4LF8 L;  3M4O B;  1V9P A;  3OMG A;  1SJE D;  1I4H A;  2B2Y A;  4M8A A;  4A3B G;  1ML0 D;  5M3M B;  4XDX A;  4PMB A;  3S1N H;  4OWT B;  4DK0 A;  3BVG A;  1VS0 A;  1FNW A;  1F2Z A;  5IT9 L;  1V1P A;  4UP8 A;  3TSS A;  1PFM A;  4EGV A;  3TS0 A;  3SE0 A;  5D14 A;  3I91 A;  2NVQ B;  5EPJ A;  4DFA A;  2ZTC A;  4XQQ A;  1H9K A;  4JI3 L;  1TXY A;  1F2Y A;  2EXD A;  4IOC A;  3NBH B;  2CCZ A;  5C3E B;  1TR5 A;  1N9W A;  3VYT A;  1V1O A;  1PRT C;  3PIP A;  3A5U A;  1PV4 A;  1PFS A;  2JA5 G;  4GOP B;  1LAC A;  1EWH A;  3J7A F;  4ABN A;  1CSP A;  2G9H D;  4DR4 L;  2AUJ D;  1CHQ D;  4JBM A;  4DN4 M;  2A74 C;  3NPP A;  1IXR A;  3GP7 A;  4POF A;  4GNX A;  2PZT A;  2A68 D;  1WOC A;  1YHB A;  1IL2 A;  1XJV A;  5KIX A;  4IZ8 A;  1E2Z A;  4XT1 B;  1YEZ A;  4DK3 C;  3HG9 A;  3PF4 A;  3I4L A;  4B9X A;  3AFQ A;  3MXU A;  4DAY B;  1R9T B;  4K6D A;  2IW3 A;  1MSH A;  2ZXP A;  1ESF A;  3OWF A;  3TBI B;  2CH4 W;  1W2B A;  4C56 C;  3TRE A;  1SYB A;  3BYT B;  1Q82 C;  2XNA C;  5IYC G;  3PIP 3;  4QUF A;  2JP1 A;  3ND9 A;  1A0I A;  3NBI A;  1NCV A;  5H1S E;  1C0A A;  1GJX A;  5JEA J;  3RLN A;  1K0R A;  2UU9 Q;  4RGT A;  2L12 A;  2IL8 A;  3SVM A;  5C0X I;  3NSW A;  2B63 H;  5C4X G;  2NZO A;  1SE3 A;  5EKK A;  5J3B A;  3HKZ G;  4R4O A;  4HJA A;  4B3T L;  2AQ1 B;  3PUZ A;  2E76 C;  5IGD A;  2F4V L;  2CKZ B;  4KN4 C;  3MVV A;  2FIN B;  1KXL A;  2VL6 A;  4B9W A;  2K14 A;  5M5W B;  4HMI A;  1Z47 A;  1QVF A;  1FNU A;  5FO9 B;  2JEA I;  4EQ5 A;  1JWU D;  3QR8 A;  3OIP A;  5CMD A;  4DR6 L;  2JJQ A;  4IUV A;  4LFA L;  1AE2 A;  3W5O A;  2KHS A;  1Q12 A;  1X6O A;  5IYB H;  3D8G A;  1Q86 C;  5C5L A;  1NMF A;  1WTP A;  3NQT A;  2RHQ B;  1M4V A;  1B53 A;  2L55 A;  1QWY A;  4RG1 A;  4DU9 A;  1TWH B;  1K3R A;  3M7G A;  1Z7T A;  1L0W A;  1MHW C;  3QG1 A;  1OXS C;  3DM1 A;  3NWT A;  4L5T A;  1EQV A;  3Q23 A;  2YTY A;  4ZYS A;  3VYR A;  2Q8R E;  2IWH A;  4DF7 A;  5ELF A;  2ID0 A;  1TWG H;  1W6J A;  2I07 B;  4LFB Q;  4ZAI A;  2AMC B;  4TSS A;  2WAQ B;  1I3Q H;  3VR4 A;  1G29 1;  1HR0 Q;  3J81 c;  3FPU B;  1FNV A;  1WTV A;  3HOV H;  2J7Z A;  3K0X A;  1A2U A;  2GVB A;  4HR7 B;  4XTC S;  5C3X A;  3KLW A;  4H13 C;  2F0K A;  3KYH C;  4DNR B;  3RZD H;  1A15 A;  2ZJR A;  3S14 H;  2NVX B;  3DXJ C;  3I4M H;  3T16 A;  2X6G A;  4K5V A;  1D1I A;  4P75 A;  3DWP A;  1VQE A;  2TSS A;  3OIQ A;  5FO7 B;  1TII D;  4JOI A;  1BCP D;  3TP8 A;  5IT9 c;  4WJ4 A;  4JI8 L;  2B2V C;  2BA1 A;  4GN3 B;  3H0G H;  4DR1 Q;  3E9H A;  4DPG A;  1A62 A;  1AZQ A;  2Q8I B;  2K28 A;  4YHH Q;  2RCF A;  2VXW A;  1J5E Q;  2LKV A;  1Z9F A;  4A4I A;  4Q5V A;  4JI4 L;  2D2C C;  1PFN A;  5ELC A;  4DR5 L;  4PZ7 A;  3M7N A;  1T5X D;  4EX5 A;  1WFQ A;  4H7B A;  5C44 H;  1TS5 A;  3RNU A;  3I2Z A;  3CCU A;  2HIV A;  3I7F A;  1CI3 M;  1E2V A;  3K5O A;  3SEB A;  2N55 A;  1VQB A;  1ZYR C;  4U67 3;  1OXV A;  1ENF A;  3AYH B;  3CCV A;  3KUP A;  3J81 E;  2EY6 A;  2EY2 A;  3CP0 A;  4HN7 A;  3FKI H;  4KJO A;  3VR3 A;  3J81 i;  4C1N I;  1YIT A;  2WAC A;  1SSO A;  1SDF A;  1VQ6 A;  1EZ8 A;  3R8B A;  3V96 A;  1HZC A;  2Q2U A;  1HRJ A;  3LWU A;  1K73 C;  1Y1V H;  3KDF A;  1TS2 A;  4R8N A;  2SNS A;  1S5C D;  3FRP B;  2R93 H;  5IT9 E;  2PO4 A;  3J81 j;  2ES2 A;  4H02 A;  3MXG A;  3HFZ B;  1M90 C;  1N36 L;  4NPS A;  1VF7 A;  3OOC A;  4X3K A;  4NXM L;  5FJ8 G;  4LF9 Q;  1GUT A;  5BR8 L;  3FHW A;  2QDB A;  3F2D A;  4BY1 H;  4ALP A;  1Y1W G;  3VYS A;  3N52 A;  1QUQ B;  4IJL A;  1UUP A;  3KF8 A;  2HT1 A;  3TN2 A;  2B39 A;  3U4V A;  1HNW L;  3DEO A;  4A3M H;  4RH6 A;  3CQZ B;  1SLJ A;  3NHH A;  1DOL A;  5IP7 G;  1DXM A;  3A7A B;  5BN3 A;  3EBE A;  2OF1 A;  1FL0 A;  4LJZ C;  1LTG D;  4LFC L;  4A76 A;  5E1F A;  3I4N G;  3CCS A;  4MIU A;  4HIM A;  1HZB A;  1YJW A;  3K8A A;  2MGS A;  3FEW X;  5EJW A;  1EWC A;  3M4P A;  4CGY B;  1EOT A;  1LUZ A;  1DM0 B;  4G57 A;  1GUO A;  2CWA A;  1I6H B;  5LL6 X;  5HGT A;  1Y8O B;  1XWE A;  2B29 A;  1CTM A;  1KDB A;  4J8Q A;  1EY9 A;  3K5M A;  2VQE Q;  1K8G A;  1QG7 A;  2QEX A;  1CA6 A;  5JJL A;  4AQY Q;  5GAD C;  2M2L A;  2L9H A;  2D5D A;  2ICE C;  2UUB Q;  4B3M Q;  2DJF C;  1D1K A;  3JC6 6;  1B9N A;  3A7L A;  3A56 A;  1Y14 B;  4JCV E;  3TQY A;  2OTJ A;  4JI7 L;  1IW7 C;  2NVT H;  2F4I A;  2ZT9 C;  1M1K C;  5BN5 A;  4QL5 A;  1RKN A;  5I9P A;  3ZYY X;  4QQB X;  1OXU A;  3HOW H;  4DNI A;  2ZM6 L;  4JI1 L;  5C0X H;  5CV6 A;  2KEN A;  4P72 A;  3QIA A;  4KHV A;  2WAQ E;  2DNE A;  4A3G G;  1SEB D;  3HP3 A;  1O7I A;  3T1Y L;  2OQ0 A;  3K6O A;  1EQT A;  1HH2 P;  4FDB A;  1Q7Y C;  2O5I C;  4QJF A;  2EJM A;  1UEB A;  2E2J H;  2XWB B;  1I5F A;  3L9A X;  4PZ8 A;  5JVH 3;  2PPB C;  4OIJ A;  2QKI C;  1T5E A;  3FVQ A;  3NUC A;  5C3W A;  2QW7 A;  1STN A;  4WRD A;  5AFW A;  4XYQ A;  2JQO A;  4DV4 L;  3SK5 A;  2FFK B;  2G9D A;  4FF1 A;  1VQ9 A;  1TY0 A;  4QGU A;  3TEH B;  2NN6 I;  4IAL A;  4B3S L;  3A5Z B;  1WVL A;  2BH2 A;  3NE5 B;  4IN3 A;  4DR3 L;  1TQO A;  5L37 A;  4A3J B;  4JV5 L;  5EKI A;  2Z9H A;  3AFP A;  4JYA L;  4BY7 G;  1O7L A;  2MJ8 A;  1Q8I A;  1HCZ A;  3P1H A;  1S5B D;  5CBE E;  3TP6 A;  2ZTD A;  3MHB A;  2Z6K A;  4R4I A;  5LMN L;  1KHI A;  1YZ6 A;  3CRK C;  3TME A;  4JPB W;  4OO1 G;  3TZD A;  5T1G A;  1F2M A;  1QJO A;  2AHO B;  1E1O A;  4DUZ L;  1EFW A;  1KNE A;  4C3J G;  1VQJ A;  2N88 A;  3NEM A;  3S15 B;  1HNZ L;  1L1O C;  4DV0 L;  3P7J A;  3DUZ A;  1ESR A;  1KQS A;  2B2W C;  5C4H A;  5CC4 A;  4GKK Q;  2IHF A;  3KLS A;  4R4Q A;  4FF4 A;  2KEC A;  3C1F A;  4IPH A;  3M3Y B;  2WII B;  1CQF A;  1NMG A;  2F0G A;  3D31 A;  5IIF A;  3SK4 A;  4A3D H;  1CFM A;  1DCZ A;  1N32 L;  3TDQ A;  3SHL A;  5LL6 S;  1BUV T;  1TWC B;  1SBB B;  4A3I H;  2L5T A;  2KBN A;  2NUC A;  2P5Z X;  3GD7 A;  3EQL C;  1CQV A;  5IP9 G;  3S2H B;  1HTL D;  3RUZ A;  1HNX L;  4R4C A;  2AWO A;  2B2V A;  5G3L F;  1TWA B;  5JJI A;  4A3K B;  3HOZ B;  3S16 B;  3AB9 A;  4BXX H;  2OQK A;  2RSO A;  3K57 A;  3V05 A;  1H95 A;  3G7L A;  4E6I A;  3N6R A;  4JK1 C;  2IX1 A;  2VQF Q;  1D7Q A;  4KN7 C;  1WCM G;  1JC7 A;  4FVM A;  3CAM A;  1GXD C;  1PZJ D;  1FYC A;  3OHX C;  3J7Y W;  4DNT B;  4GLV B;  5F2D A;  2PQA A;  3BS1 A;  1KRS A;  1H9S B;  1STB A;  2LXK A;  3S17 B;  1FJG L;  1X3F A;  5A2Q L;  1C9O A;  1EU4 A;  1LT3 D;  5IWA Q;  5BR8 Q;  1AH9 A;  1ZYR D;  1YHA A;  3BVM A;  1NR4 A;  4X62 Q;  2LXJ A;  1I94 L;  3KF6 A;  4A93 G;  2QF7 A;  1CA5 A;  4Y52 H;  1RDP D;  1KAB A;  4G7O C;  3HOY H;  4C1N K;  3TP5 A;  5CV4 A;  4I7A A;  1MJC A;  3MXN B;  4FP5 D;  5D65 A;  3AMU A;  1VQI A;  1X3E A;  1JB3 A;  3HOU G;  2E2I B;  2R7Z B;  3S1R H;  2ZJP A;  1QB5 D;  1I50 H;  1XNR L;  2A8V A;  1B1Z A;  2B8F A;  2CWP A;  2YYZ A;  1JJC B;  3RMH A;  2R92 G;  4RFB A;  5IGF A;  3M4O H;  4CDC C;  4RWS C;  1PH2 A;  2OWO A;  2GN5 A;  4GKJ L;  3PCO B;  2Z8L A;  4C3H B;  4IUT A;  1FGB D;  3CD6 A;  3D4W A;  4A3F G;  4TQU S;  1G6Z A;  2RCN A;  2K5D A;  2XSC A;  3Q24 A;  2UXC L;  4OON A;  1CKN A;  4BWG B;  2E5L L;  3FDT A;  5EBC A;  2JA7 G;  3NXW A;  1G2S A;  4KY7 A;  4KKT A;  4HIK A;  3U4Z A;  2NVQ H;  2NVY B;  5CV8 A;  1J6Q A;  1XX8 A;  2VS1 A;  2VUM G;  1E1T A;  5IOD A;  2EE1 A;  4I65 A;  2IHE A;  3G6E A;  2HUG A;  3PIO A;  3HOX G;  3GTJ B;  3MAQ A;  5C3E H;  1IBL Q;  2VB3 X;  4JI1 Q;  3ERQ A;  3QOL A;  2JA8 G;  2NYZ D;  4R8I A;  1SRO A;  3KBG A;  1EY4 A;  1FVI A;  1LO5 D;  1DOK A;  5KNC A;  3LX0 A;  3B6Y A;  1GOZ A;  3CCE A;  4CDD C;  3S9W A;  2JA6 B;  2J4X A;  3E0E A;  2JA7 H;  3VDY A;  1TS3 A;  3PO3 G;  4OGQ C;  2N49 A;  4JBK A;  5E3F A;  1E0B A;  4Z9C B;  1K8A C;  1U4L A;  1PYB A;  2PQE A;  1PZI D;  4Q0F A;  5C6A A;  2BA0 A;  3NTI A;  4OX9 Q;  1AN8 A;  4RCN A;  5FKA C;  1NUC A;  4LF5 Q;  1I4X A;  3R2T A;  1WYD A;  2NN6 G;  2PW7 A;  1Q81 C;  1WJJ A;  1CKO A;  1PRT F;  4AYB G;  2I46 A;  2JA9 A;  2JXM B;  1SMY C;  1GUG A;  1XMQ L;  1AP0 A;  1SE2 A;  1V1P B;  4KI0 A;  3PIO 3;  4EQO A;  2CW0 C;  3P20 A;  2Q8T A;  3PO3 H;  1EIH A;  4C3I B;  4DV3 L;  4F7X A;  1PH5 A;  4JV5 Q;  3FPP A;  1D5Z C;  5M5Y B;  3A0J A;  4XT3 B;  5C4Z A;  5D3D A;  2RA4 A;  4OXP A;  5HGQ A;  2BCO A;  3H6M A;  1YVC A;  2K5N A;  1PZK D;  2NN6 H;  1TS4 A;  1RHP A;  1N8R C;  1PH3 A;  1VQL A;  4X65 Q;  5KYL A;  3GTM B;  5DLQ E;  4HMJ A;  5TSS A;  1G6P A;  2DJG C;  1NAP A;  4GNX B;  2DN8 A;  4MTN A;  1TWF B;  1RIP A;  2EIF A;  4Y7N B;  3DHQ A;  1HNZ Q;  1ICF B;  1C48 A;  4LNQ A;  1JQY D;  2K4K A;  1GM5 A;  3OTO L;  4ILW A;  2XIW A;  2UUC L;  1EFI D;  4JI2 Q;  1KAW A;  2UXB Q;  2RHS B;  1OO9 B;  3M4Y A;  2K5W A;  2EQS A;  1VQP A;  1NSN S;  4LWC A;  5CYU A;  4X6A H;  3U50 C;  2FXQ A;  3H94 A;  5IYD H;  2K50 A;  1RJT A;  4NXN Q;  4IPD A;  2F0O A;  4LW1 A;  3PUX A;  1TWH H;  1UNS A;  2AWN A;  2K33 A;  2SDF A;  1L1O A;  4LUO A;  1EQR A;  1Q3L A;  2B2W A;  1QIL A;  3WDN A;  2H5X A;  4DR7 Q;  2HHH L;  2R6G A;  3W3A A;  1PHJ A;  4JI0 Q;  1GUS A;  3KBX A;  4FO2 A;  2BE5 C;  2B63 G;  4CKB A;  4GLA C;  1H9M A;  2EYM A;  4IFD I;  2WB1 B;  3KJP A;  1Y8P B;  2HDM A;  1XNQ Q;  1STY A;  2XRS D;  5AJ3 L;  3ZJY C;  1LTA D;  2XVS A;  3A8K E;  1TT2 A;  2GA4 B;  4DXG A;  1ONL A;  3H91 A;  1HXY D;  4CJ2 C;  2UXD L;  4MNO A;  4TKO B;  4A3E B;  3BZC A;  2NVX H;  3AU7 A;  3ND8 A;  4TVA B;  1A63 A;  4C2M B;  3K59 A;  1EY0 A;  2Y0S B;  2WIN B;  4RGN A;  5IYB G;  1YJN A;  2EY1 A;  4QF4 A;  4X66 L;  4QMG A;  4BBR B;  1KC8 C;  5JJZ A;  2DGY A;  4A3C G;  4KK7 A;  2N8N A;  1MGS A;  2EVB A;  3BG3 A;  4G7H C;  1BR9 A;  1VCI A;  5I4D A;  2R7F A;  4LAA A;  1XNR Q;  3PQI A;  5A2Q E;  3MEF A;  1SNP A;  1PTO F;  1P16 A;  3I3C A;  2M00 A;  1VQ4 A;  2ATW A;  3PO2 B;  3PUV A;  4L6T B;  4HCS A;  2VW9 A;  4PV1 C;  1IKL A;  2ICI A;  3CF5 A;  3CCL A;  1KD1 C;  3HOV G;  1L2F A;  3GO5 A;  4PZ6 A;  2IY5 B;  4A3C H;  1H9J A;  4DK1 A;  2RF4 A;  4J1M A;  4O1N A;  4A3B B;  1JIC A;  1E22 A;  3O13 A;  1IBK Q;  1KNA A;  4GN5 A;  1KDA A;  2EYP A;  4JC0 A;  1MIU A;  3I4M G;  3ERS X;  2E74 C;  2K03 A;  3NTK A;  1EYA A;  3G6J B;  4DV1 Q;  5CV9 A;  2CVR A;  1N33 Q;  1SR3 A;  3CCQ A;  4AH6 A;  3H0G G;  3M4Q A;  1YNJ C;  4CKC A;  3C3L A;  2QGQ A;  1HA5 A;  4L8J A;  1WTX A;  3U9O A;  4HJ5 A;  1EQQ A;  4HIO A;  4O0A A;  2C9O A;  1PFB A;  2VY3 A;  1HJP A;  5E7N A;  1DD2 A;  5C4J B;  3GTG B;  2JA5 B;  2M9V A;  5I6W A;  2F3V A;  1WTW A;  3DWQ A;  1E2W A;  4BA1 I;  5ELN A;  1C4Q A;  1A6X A;  3I56 A;  5C44 G;  3DLL A;  2L11 A;  1D6E C;  2A6E C;  1C7Y A;  2JSO A;  2OTL A;  4B3R L;  2EYO A;  3RR5 A;  2C5C A;  5JPN C;  3TZU A;  2DNC A;  3CQZ H;  1IL8 A;  1CUK A;  3OPO A;  4LUZ A;  4V0B A;  2D9U A;  2PZW A;  3MWY W;  4YWK A;  1MJE A;  2A73 B;  2PYK A;  3PMF A;  3T13 A;  3FKI G;  5FLM G;  4HTH A;  1JE4 A;  3GTP B;  3GTO B;  4LF8 Q;  3MFG A;  1XXG A;  2F0W A;  1AZP A;  5FOB B;  3K7U C;  4RKB A;  4DV3 Q;  2F0J A;  4JI5 L;  1I6H H;  1IBM L;  1JCK B;  1Y1V G;  4ZK9 B;  4UPA A;  2R93 G;  1ENC A;  1KL9 A;  5IGG A;  3C46 A;  2HQL A;  3DWA A;  5LMU L;  1WTQ A;  1YBY A;  2EXZ A;  1L0X B;  2BOS A;  4MZ9 A;  4WJ3 M;  5FLM H;  1Q90 A;  4BY1 G;  1I4Q A;  3SXH A;  1UEA B;  4DR2 L;  5C4X B;  3CKI B;  4JI3 Q;  1SMY D;  4LF4 L;  3HKZ B;  4A3M G;  2CW0 D;  2WB1 E;  3K80 C;  3GTK B;  3DM3 A;  2AQ2 B;  3I4O A;  1GKH A;  3C2P A;  1IZ6 A;  1D5M C;  4G4K A;  4DR4 Q;  2F0L A;  2PNH A;  1PRT B;  3S1M B;  2Z6B A;  1BOS A;  3KOJ A;  3LGJ A;  1YIJ A;  2V4D A;  4DGZ A;  2JEB I;  1SNM A;  1GUN A;  1VQF A;  5GRO A;  5IGC A;  3T4A C;  1FGU A;  2F0N A;  3T53 B;  3U58 A;  2FHT A;  2NB0 A;  1K9M C;  1I3Q B;  4QUC A;  4RGO S;  1UE7 A;  2Y0S E;  2K05 A;  5DEH A;  1L0Y B;  1OXX K;  2HHH Q;  2RSN A;  4ZLT F;  3AEV A;  3D4R A;  3UDI A;  1GHJ A;  3PUW A;  3M9B A;  1K8O A;  5COR A;  5M3F H;  3QJY A;  1B9M A;  1B8A A;  1TVX A;  2IX3 A;  3CCJ A;  4BA2 I;  3KJO A;  1VQH A;  4DUY L;  5CV5 A;  4A3J H;  1LTT D;  3X3M A;  1D2B A;  4K0K L;  4OL7 A;  4PQX A;  3HOW G;  5C0X G;  3VR2 A;  2E2D C;  4AIM A;  4IFD H;  1KDC A;  5IGB A;  4X64 L;  4BBS G;  2MP1 A;  4N8X 1;  4APV A;  2ASB A;  2VZA A;  3EFX D;  4KHP L;  2EY5 A;  2Z1C A;  1VQG A;  1E3P A;  2K04 A;  2SOB A;  2BE5 D;  4DV5 L;  1ENA A;  4LF6 L;  4B3T Q;  1K28 A;  2RKS A;  3L0O A;  3S15 H;  2K5V A;  2F4V Q;  3BVZ A;  5D3I B;  1KRT A;  1SXT A;  3M3Y H;  2AKW B;  2KED A;  2Z4I A;  2NTT A;  3OW2 A;  4DV6 L;  3IFD A;  4FNF A;  2E75 C;  4BBS H;  4XXE A;  1T9H A;  1NNX A;  4IJH A;  4A3L H;  5KGU A;  4CHT B;  4DR6 Q;  4LFA Q;  4DV7 L;  2YU9 B;  2LSS A;  1STA A;  3PUY A;  1BO0 A;  3S2H H;  2F0D A;  3G48 A;  1TWA H;  3I73 A;  2HCI A;  4A3K H;  3HOZ H;  3S16 H;  1MSG A;  1JMC A;  4X3S A;  2H4O A;  4IQZ A;  4IPG A;  5GAE C;  4P71 A;  1HR0 W;  3KFU A;  4LF7 L;  2Z4H A;  4UAI A;  4KTA A;  4IUR A;  1I4G A;  5A35 A;  1LT4 D;  1LT5 D;  1VQO A;  4HCE A;  2EOT A;  3K5L A;  2H1E A;  2F0U A;  3NP8 A;  5K36 H;  1WD0 A;  3S17 H;  3UDX A;  1EIG A;  4GLX A;  4XQN A;  4GN4 B;  3FP9 A;  1UE6 A;  5BN4 A;  3RZO B;  1D8L A;  2D0P A;  2EJF C;  4A3D G;  3CCR A;  1DZ1 A;  1PTO B;  2WV6 D;  1AFP A;  3I8Z A;  4CJ0 B;  5I2Y A;  4A3I G;  1V1Q A;  3R93 A;  1LT6 D;  3H3V H;  2EJG C;  1HUM A;  1Y1W B;  4JI8 Q;  1CT1 D;  1X65 A;  1OXT A;  2R7Z H;  5DM6 3;  2MUY A;  4BXX G;  3QB3 A;  1IYU A;  5J22 A;  1YNJ D;  3HKZ E;  3ICE A;  1HQR D;  1CSQ A;  3IRB A;  2K52 A;  5HY6 A;  2WKD A;  4JI4 Q;  2K5Q A;  1NBW A;  4DR5 Q;  3EJI A;  1VMP A;  1PH8 A;  4RA8 A;  4HID A;  3I4N B;  4C3H H;  1EOV A;  2WKC A;  1E7Z A;  1VQC A;  1Q1E A;  1X3P A;  5DAU A;  2A6E D;  4GOP C;  2DY7 A;  1MI2 A;  1PYS B;  3G71 A;  3CPW A;  1XPR A;  1IKM A;  3UE0 A;  1VQM A;  3GTL B;  2PQA B;  2E8G A;  2NVY H;  3BDL A;  3RD4 A;  4LK1 C;  4P73 A;  3Q6S A;  1J9O A;  2MQH A;  3OSO A;  3KLR A;  2KUM A;  4JVZ A;  2B2T C;  3GTJ H;  4LF4 Q;  1IHZ A;  4XIG S;  1G8Z D;  1CZW A;  3HOY G;  3F2C A;  1YNN C;  1CHP D;  1D5X C;  5DNF A;  2XWJ B;  3HZX A;  4EQN A;  1S5E D;  3HEJ A;  3BJU A;  1EYD A;  2JA6 H;  1EYG A;  3EVQ A;  1CZG A;  1U9R A;  1N36 Q;  2A19 A;  4NXM Q;  2B3G A;  3GV3 A;  4A3G B;  4JI6 L;  5C0X J;  4DAP A;  2F3I A;  1GO3 E;  3S2D B;  1BCP F;  5COY A;  5M3M G;  1HNW Q;  2E2H B;  1B70 B;  3WOE A;  1K3B C;  5CV7 A;  5M9O A;  1SE4 A;  4LFC Q;  2UU9 L;  1A8V A;  1YHQ A;  3NEL A;  1SYD A;  1CKN B;  1KIX A;  1SNC A;  2BDN A;  1K83 B;  2F0Q A;  2ZXR A;  3TP7 A;  4C3I H;  5I6Y A;  3PF5 A;  1I4P A;  3BU2 A;  3K7A B;  2KQ3 A;  4DUY Q;  1YI2 A;  3J7A 5;  5M5Y H;  2EYH A;  1JWM D;  3MXP A;  4K0K Q;  5C3E G;  3A74 A;  5M3M H;  4CKE A;  1ET9 A;  5EQ0 A;  4K5W A;  1QZG A;  4J15 A;  2I0Q A;  2F3W A;  1SAP A;  5FLX L;  3CC7 A;  1EUJ A;  4KHP Q;  4BY7 B;  4KKU A;  2SNM A;  3GTM H;  4JI7 Q;  2JK8 A;  5KEE A;  1TWF H;  3I72 A;  4DKA C;  3J80 c;  4Y7N H;  1RTO A;  3ULP A;  2BDO A;  2ZXO A;  2ZM6 Q;  1EY6 A;  4KMU C;  3E6Z X;  4K6L A;  4C3J B;  2MO1 A;  1JR0 D;  1JOQ A;  1A3V A;  2HDL A;  4ME5 A;  4PG3 A;  5EAY A;  5KNB A;  4WOR A;  1TU2 B;  2PI2 E;  1SMX A;  1KTK A;  3T1Y Q;  5DM7 3;  4ZCK A;  1PLF A;  3VR6 A;  2AUK A;  3BDC A;  2RDG A;  3L2P A;  2L15 A;  1BBX C;  3K0Y A;  5JEA H;  4BS9 A;  4OEL B;  4L5S A;  2IJ0 A;  4FF3 A;  4QCL A;  1EU3 A;  1HR0 L;  4UP9 A;  4DXF A;  2QCP X;  1XYI A;  3CCM A;  2AQ3 B;  4UHV A;  1R9T H;  3NQI A;  4YCU A;  4DV4 Q;  3TS2 A;  1HZ9 A;  1SYG A;  1F2L A;  4ULL A;  1SFO B;  1V43 A;  3OW7 A;  4HED A;  1UAP A;  1C8C A;  4B3S Q;  3CC2 A;  4DR3 Q;  5GQO A;  1BBW A;  2F03 A;  2KCT A;  2V1C C;  1B3A A;  1WCM B;  3D4D A;  4JYA Q;  1SN8 A;  5JAV A;  3F8T A;  2FMM A;  1WTO A;  1ILQ A;  4A75 A;  4H44 C;  4A3E H;  3S1R B;  1J5E L;  1V8Q A;  3URY A;  4C2M H;  5ISR A;  5LMN Q;  1BKB A;  1BBU A;  1HQM C;  1LTR D;  3OYY A;  4HSV A;  5IYD G;  5J39 A;  4BBR H;  1JOO A;  3HGB A;  4A93 B;  4DUZ Q;  1SND A;  3EN2 A;  5M5X B;  4IOA A;  3IFT A;  5I9O A;  5KYI A;  5FO8 B;  3DEP A;  4DV0 Q;  3IKJ A;  3NEN A;  3VA5 A;  1K0S A;  1SNO A;  3Q22 A;  5M5W H;  1L1O B;  2OCE A;  4YCV A;  3GV6 A;  5KND A;  2L1B A;  1K8M A;  2F0E A;  3HOU B;  2G5D A;  3STB C;  3E0J A;  2QDL A;  3PO2 H;  4XQJ A;  4IO9 A;  1N32 Q;  2I5M X;  3K5N A;  5JJK A;  2DY8 A;  2R92 B;  1LV9 A;  1U4M A;  1ET6 A;  1I6V C;  2WAQ G;  4P74 A;  4K2K A;  1EIY B;  2F0S A;  1HNX Q;  3Q8D A;  4KHZ A;  1FR3 A;  3I70 A;  4A3F B;  1WI5 A;  1YJ9 A;  5JOB A;  4A3B H;  2WP8 J;  1HZA A;  2K75 A;  3S1Q B;  4FXK C;  4N9P A;  3JAM L;  3SK8 A;  4IUN A;  3E9I A;  3RLO A;  1E24 A;  4QB4 A;  2RQX A;  3SGI A;  2JA7 B;  3CXC A;  3BDO A;  4LF9 L;  1SJH D;  3GTQ B;  1JB7 A;  2VUM B;  4H0L C;  2CQO A;  3ULJ A;  5HUR A;  3NBH A;  1X3G A;  1S40 A;  1I4R A;  1VF5 C;  3T1H L;  1DJR D;  1KLU D;  4OWX B;  3ULL A;  4FXD A;  4EVO A;  4RCO A;  1JJG A;  3HOX B;  4GOP A;  4QIW B;  2XRQ D;  1II3 A;  5GAG C;  5C4J H;  3GTG H;  2JA5 H;  2JA8 B;  1FJG Q;  3HRZ C;  1J8I A;  5IY0 A;  3VR5 A;  5GAH C;  1QNK A;  4JI6 Q;  2KOL A;  4XYO A;  3SDZ A;  1I94 Q;  4RHS A;  2B2T A;  2VNU D;  4ZKB B;  3PO3 B;  5FLX c;  4KY6 A;  4S3S A;  3QWN A;  1ASZ A;  4RAU C;  1PDQ A;  3F2U A;  3A8I E;  4O42 A;  4J6H A;  1X55 A;  3L3O C;  1YNN D;  4ZUJ A;  3T51 B;  2VQE L;  4DAY A;  1G2T A;  3S1N B;  4AQY L;  4KKS A;  3F1Z A;  2UUB L;  2Z0S A;  4B3M L;  3TRZ A;  1F9R A;  3GTO H;  3GTP H;  1HHV A;  3NWS A;  4AYB B;  4RMF A;  3ITP A;  4GKJ Q;  2KCN A;  2TMP A;  1N34 L;  4I7Z C;  4IUU A;  2HIX A;  2F0I A;  4CBV A;  2HCC A;  5IYC H;  1U0L A;  2O2L D;  3GDE A;  2Q2H A;  2UXC Q;  3D6W A;  1JOK A;  5E4X A;  4GZY C;  2E5L Q;  3H09 A;  2MHV A;  2KHI A;  5KRU A;  2NZ1 D;  3K81 C;  4YWL A;  2D62 A;  2F52 A;  5C4X H;  1PH9 A;  1LTB D;  1F77 A;  2O5J C;  1GUW A;  1YNX A;  2A6H C;  1S5D D;  3MA2 B;  1AW7 A;  1ASY A;  2GVA A;  1BCP B;  2CHB D;  4DAM A;  1HFN A;  3GTK H;  2F0H A;  5G3L D;  5JVG 3;  5FLX E;  1R4P B;  3H3V I;  4HAE A;  3S1M H;  1EEF D;  3ER0 A;  2Z6K C;  4DV2 L;  2IPK D;  1RCV D;  2DUD A;  1LTL A;  3CW2 C;  1TY2 A;  2A1A A;  2LMC B;  2I5H A;  4ZUI A;  3LNN A;  1JJ2 A;  5IGE A;  1DGS A;  1O78 A;  1VQD A;  4KY5 A;  4YWM A;  4YY3 L;  4ZKC B;  2D0O A;  3CU7 A;  1VQ5 A;  5LHY 1;  1PTO C;  2KCC A;  3FMC A;  3I55 A;  4HSP A;  1O7Z A;  3CPF A;  4KD4 A;  1RF2 D;  1XMQ Q;  4F87 A;  3MZ5 A;  2B63 B;  1Y69 U;  2UUA L;  1PH7 A;  4N9T A;  2MO0 A;  3SR1 A;  1EY5 A;  1X56 A;  3WWV A;  3VA7 A;  5LMN W;  4NP5 A;  3UDG A;  3A8J E;  4ODG A;  1DYQ A;  4OO1 I;  3GQB A;  1NR2 A;  4GKK L;  2MPM A;  1TKW B;  2JN4 A;  4K5X A;  3KDF B;  2KJX A;  4UP7 A;  3R3O A;  1LYL A;  2B2U C;  4X3U A;  4IUQ A;  3U9S A;  5FK9 C;  1HPC A;  1SYE A;  4CDF C;  1EEI D;  4R4T A;  4YIJ A;  2NWG A;  1KLG D;  1AE3 A;  1IYJ B;  3JAM c;  1NJI C;  1QVG A;  1PYW D; 
#chains in the Genus database with same CATH homology
 2N78 A;  1W2B A;  3TRE A;  4HIK A;  4GN4 B;  4GLX A;  3FP9 A;  3U4Z A;  2NVQ H;  1Q82 C;  1UE6 A;  1J6Q A;  3KF8 B;  2VS1 A;  2VUM G;  1D8L A;  2D0P A;  1E1T A;  3OTO Q;  5IYC G;  4A3D G;  2IHE A;  3G6E A;  2UUC Q;  3CCR A;  1A0I A;  3PIO A;  3HOX G;  4A3I G;  5H1S E;  4POG A;  1C0A A;  3S24 A;  1MKH A;  5C3E H;  5M3F G;  1IBL Q;  1CKM A;  1V1Q A;  4QIW E;  5JEA J;  4JI1 Q;  3RLN A;  1K0R A;  2CFM A;  2UU9 Q;  3H3V H;  2JA8 G;  2YU9 H;  4JI8 Q;  1SRO A;  2B63 H;  4A3J G;  5C0X I;  2VQF L;  5C4X G;  1X65 A;  1FVI A;  2NZO A;  1OXT A;  5J3B A;  2R7Z H;  3B6Y A;  4BXX G;  3HKZ G;  3CCE A;  3E0E A;  4R4O A;  2JA7 H;  3VDY A;  3HKZ E;  3ICE A;  3IRB A;  1CSQ A;  4YCW A;  4HJA A;  1S72 A;  3F2B A;  4B3T L;  3PO3 G;  4IFD G;  2K52 A;  2N49 A;  5HY6 A;  4JBK A;  3PUZ A;  4JI4 Q;  4PMW A;  1K8A C;  1PYB A;  1NBW A;  1UWV A;  2CKZ B;  4DR5 Q;  2F4V L;  1PH8 A;  4HID A;  4JG2 A;  2BA0 A;  1KXL A;  4C3H H;  2VL6 A;  1EOV A;  4OX9 Q;  2K14 A;  1G51 A;  5IWA L;  4LF5 Q;  1E7Z A;  1VQC A;  1Z47 A;  4X62 L;  1XMO L;  1QVF A;  1Q1E A;  2JEA I;  3STB D;  3W1G A;  1WYD A;  2NN6 G;  3RLF A;  2IX0 A;  4EQ5 A;  4GOP C;  3T1H Q;  1Q81 C;  1PYS B;  1CKO A;  1WJJ A;  4AYB G;  4DR6 L;  2JA9 A;  3G71 A;  2JJQ A;  3CPW A;  1UE1 A;  1XPR A;  4LFA L;  4AYB E;  5AJ3 Q;  1AE2 A;  3UE0 A;  3W5O A;  1Q12 A;  1X6O A;  5IYB H;  1XMQ L;  1VQM A;  4KI0 A;  1Q86 C;  2PQA B;  1NMF A;  2I5L X;  2E8G A;  2NVY H;  3PO3 H;  2RHQ B;  2ALY B;  4DV3 L;  4P73 A;  3RZO H;  1PH5 A;  2UXD Q;  2MQH A;  4RG1 A;  4JV5 Q;  3JAM i;  1PVO A;  1VQK A;  2N3S A;  4OWW B;  3A0J A;  1K3R A;  4A3L G;  3GTJ H;  4LF4 Q;  4XIG S;  1RL2 A;  2R7D A;  1VQN A;  1L0W A;  4OXP A;  5HGQ A;  3HOY G;  1OXS C;  1QUQ A;  5FJ8 H;  3F2C A;  3RN2 A;  1QZH A;  4L5T A;  4X66 Q;  1YVC A;  2YTY A;  2K5N A;  1Y1W H;  4A3K G;  3HOZ G;  1N8R C;  3BJU A;  1PH3 A;  1VQL A;  2ID0 A;  1TWG H;  4X65 Q;  2JA6 H;  4LFB Q;  4KLK A;  2AMC B;  5DLQ E;  1N36 Q;  1EYG A;  1I3Q H;  2A19 A;  1G29 1;  4NXM Q;  3EIV A;  1HR0 Q;  1G6P A;  5IP7 H;  4MTN A;  2B3G A;  3J81 c;  4GNX B;  1RIP A;  4JI6 L;  3HOV H;  3K0X A;  5C0X J;  2EIF A;  2GVB A;  4R1J A;  3UE1 A;  1HNZ Q;  2F3I A;  1GO3 E;  4XTC S;  3I4N H;  1NY4 A;  3KLW A;  3KYH C;  4LNQ A;  1TWC H;  2K4K A;  1LM0 A;  5M3M G;  1HNW Q;  1GM5 A;  3OTO L;  1B70 B;  3RZD H;  1N34 Q;  2UUC L;  4JI2 Q;  2ZJR A;  3S14 H;  1KAW A;  3I4M H;  2RHS B;  2UXB Q;  4P75 A;  5K36 G;  4ME3 A;  4HJ9 A;  1IBL L;  2EQS A;  1VQE A;  1VQP A;  4LFC Q;  4LWC A;  2UU9 L;  1A8V A;  4JOI A;  5IT9 c;  3NEL A;  1YHQ A;  3U50 C;  4WJ4 A;  4JI8 L;  1CKN B;  2BA1 A;  2FXQ A;  3W1B A;  1KIX A;  3GTL H;  4GN3 B;  3H0G H;  4DR1 Q;  5IYD H;  2K50 A;  2Q2T A;  3E9H A;  4C3I H;  3PF5 A;  3BU2 A;  4NXN Q;  4DPG A;  4DUY Q;  1YI2 A;  4IPD A;  1A62 A;  1SRU A;  1XPO A;  3D0F A;  4LW1 A;  3PUX A;  1TWH H;  4YHH Q;  5M5Y H;  2AWN A;  3J7A 5;  1L1O A;  4LUO A;  1J5E Q;  4K0K Q;  1EQR A;  5C3E G;  1Z9F A;  4A4I A;  4DR7 Q;  2H5X A;  4JI4 L;  3A74 A;  5M3M H;  2HHH L;  2R6G A;  1PHJ A;  4DR5 L;  4JI0 Q;  4PZ7 A;  1QZG A;  4L5Q A;  3M7N A;  4J15 A;  2B63 G;  4EX5 A;  2I0Q A;  1WFQ A;  5C44 H;  1PH4 A;  3CC7 A;  4OX9 L;  3RNU A;  4GLA C;  1EUJ A;  4KHP Q;  2R7Z G;  4IFD I;  4LF5 L;  3I2Z A;  3KJP A;  1X9N A;  3CCU A;  3RN5 A;  2HIV A;  3I7F A;  3GTM H;  4JI7 Q;  2JK8 A;  1XNQ Q;  1EIF A;  4DV2 Q;  1OTC A;  1TWF H;  1VQB A;  4A3G H;  4DKA C;  5AJ3 L;  1OXV A;  3J80 c;  1QVC A;  3ZJY C;  4Y7N H;  3ULP A;  3AYH B;  3CCV A;  2QA4 A;  3S2D H;  2KHJ A;  3CP0 A;  3FKI H;  3J81 i;  2ZM6 Q;  4B3R Q;  1YIT A;  2E2H H;  2UXD L;  4MNO A;  1UE5 A;  2MO1 A;  3BZC A;  2BH8 A;  3PSI A;  4IPC A;  4TVA B;  4YY3 Q;  4PG3 A;  2NVX H;  5EAY A;  1VQ6 A;  1A63 A;  2MFI A;  2PI2 E;  1SMX A;  2E2I H;  5IYB G;  3T1Y Q;  1YJN A;  1VQ7 A;  1GD7 A;  4X66 L;  1HZC A;  2Q2U A;  2IT1 A;  1K73 C;  1Y1V H;  3KDF A;  1JE5 A;  3L2P A;  1K83 H;  1KC8 C;  2L15 A;  2DGY A;  2R93 H;  4GNX C;  4A3C G;  2UUA Q;  3K7A H;  2KCM A;  2N8N A;  4L5S A;  3J81 j;  2ES2 A;  1NE3 A;  4H02 A;  3HFZ B;  4X65 L;  1N36 L;  1M90 C;  1VCI A;  2PI2 A;  4NPS A;  2R7F A;  3H15 A;  4JI5 Q;  1VQA A;  1EWI A;  1HR0 L;  5ELO A;  5FJ8 G;  4NXM L;  4LF9 Q;  3AQQ A;  5BR8 L;  3FHW A;  1XNR Q;  4UP9 A;  3MEF A;  3F2D A;  1PA6 A;  1IBM Q;  4BY1 H;  4ALP A;  1Y1W G;  1PH6 A;  1VQ4 A;  1P16 A;  1S3O A;  3CCM A;  2ATW A;  1QUQ B;  4IJL A;  1R9T H;  3PUV A;  4YCU A;  4DV4 Q;  2HT1 A;  1JT8 A;  3U4V A;  3TS2 A;  1HZ9 A;  1HNW L;  2VW9 A;  4BY7 H;  4A3M H;  2JA6 G;  4JI2 L;  5LMU Q;  1SLJ A;  1V43 A;  2UXB L;  5IP7 G;  3CF5 A;  3CCL A;  4LUV A;  4B3S Q;  3EBE A;  1KD1 C;  3HOV G;  4JBJ A;  1L2F A;  3GO5 A;  3CC2 A;  1FL0 A;  4DR3 Q;  4PZ6 A;  3M85 A;  2JE6 I;  1BBW A;  5GQO A;  4LFC L;  2KCT A;  3G4S A;  4A76 A;  4DR2 Q;  3I4N G;  2RF4 A;  2V1C C;  4IFD J;  3CCS A;  1E22 A;  4HIM A;  1HZB A;  3J7Z C;  1IBK Q;  4JYA Q;  1SN8 A;  3F8T A;  1YJW A;  4GN5 A;  3K8A A;  3KF6 B;  4NXN L;  3M4P A;  4A75 A;  1GVP A;  4C3J H;  1LUZ A;  4JC0 A;  1MIU A;  4A3E H;  4DK6 C;  3I4M G;  3ERS X;  2CWA A;  1J5E L;  1W3S A;  2B29 A;  4C2M H;  2ZTE A;  4DR7 L;  5LMN Q;  4A3C H;  4DV1 Q;  1BKB A;  4JI0 L;  1BBU A;  3HKS A;  2VQE Q;  1K8G A;  2QEX A;  1SR3 A;  3OYY A;  3CCQ A;  4AH6 A;  3H0G G;  3M4Q A;  1N33 Q;  5JJL A;  5IYD G;  4AQY Q;  2QGQ A;  5GAD C;  4BBR H;  4DUZ Q;  2UUB Q;  4HJ5 A;  1EQQ A;  4B3M Q;  4HIO A;  3EN2 A;  3JC6 6;  4O0A A;  4QY7 A;  4IOA A;  4DV0 Q;  2VY3 A;  1HJP A;  5E7N A;  2OTJ A;  1Y14 B;  2K5H A;  2YV5 A;  3NEN A;  4JCV E;  3TQY A;  4JI7 L;  1XNQ L;  1X54 A;  2NVT H;  5M5W H;  1L1O B;  5IP9 H;  2OCE A;  4YCV A;  5ELN A;  4BA1 I;  3I56 A;  5C44 G;  1M1K C;  3DLL A;  3STB C;  3PO2 H;  4QL5 A;  4IO9 A;  4QQB X;  1C7Y A;  1N32 Q;  2I5M X;  1OXU A;  3HOW H;  5JJK A;  2OTL A;  4DNI A;  2ZM6 L;  4B3R L;  4JI1 L;  3L7Z C;  3RR5 A;  2KEN A;  4P72 A;  4HJ8 A;  1SFO H;  1P8L A;  3CQZ H;  2WAQ G;  1XMO Q;  4P74 A;  2WAQ E;  1EIY B;  4A3G G;  1CUK A;  1Q1B A;  3UDF A;  1HNX Q;  4LUZ A;  1NTG A;  1O7I A;  3Q8D A;  4KHZ A;  3T1Y L;  3BZK A;  2OQ0 A;  1WI5 A;  1YJ9 A;  1WCM H;  4A3B H;  4YWK A;  1MJE A;  2WP8 J;  1HZA A;  2K75 A;  1HH2 P;  3FKI G;  5FLM G;  4FDB A;  1Q7Y C;  4QJF A;  4LF8 Q;  3E9I A;  3RLO A;  4NB3 A;  1UEB A;  1E24 A;  2E2J H;  3K7U C;  4DV3 Q;  3SGI A;  1I5F A;  5IE8 A;  4X64 Q;  4PZ8 A;  4JI5 L;  1I6H H;  3CXC A;  4LF9 L;  2XGT A;  1B7Y B;  2XTI A;  1IBM L;  1JB7 A;  1Y1V G;  2CQO A;  4O2D A;  3ULJ A;  1X3G A;  4UPA A;  2JQO A;  1S40 A;  3T1H L;  4DV4 L;  4OWX B;  3ULL A;  4JBW A;  4DV5 Q;  2R93 G;  5JEA G;  1KL9 A;  4LF6 Q;  4A93 H;  1JJG A;  4GOP A;  1BVS A;  5M5X H;  3CMA A;  2HQL A;  5LMU L;  1VQ9 A;  5GAG C;  4QGU A;  1VQ8 A;  1YBY A;  3TEH B;  4WJ3 M;  2NN6 I;  4MZ9 A;  5C4J H;  4B3S L;  3GTG H;  2JA5 H;  3A5Z B;  2C35 B;  5FLM H;  3CC4 A;  1FJG Q;  2BH2 A;  4BY1 G;  4DR3 L;  4DR2 L;  4JV5 L;  5IY0 A;  5GAH C;  4DV6 Q;  3AFP A;  4JI3 Q;  4JI6 Q;  3HOU H;  4LF4 L;  1IBK L;  4JYA L;  2YTV A;  1I94 Q;  4BY7 G;  1SE8 A;  4A3M G;  2WB1 G;  2VNU D;  5FLX c;  2R92 H;  2WB1 E;  3K80 C;  3PV0 A;  3DM3 A;  2ZTD A;  3I4O A;  1GKH A;  3PGZ A;  4DV7 Q;  4X6A H;  1ASZ A;  1IZ6 A;  2Z6K A;  4DR4 Q;  4R4I A;  5LMN L;  4JOI C;  2PNH A;  1KHI A;  4DV1 L;  1YZ6 A;  1X55 A;  2VQE L;  4A3F H;  1N33 L;  4LFB L;  4OO1 G;  3KOJ A;  3LGJ A;  1Q46 A;  4AQY L;  1YIJ A;  2ZJQ A;  2PMZ E;  4L5R C;  3F1Z A;  2AHO B;  1PH1 A;  1E1O A;  4DUZ L;  2UUB L;  1EFW A;  2Z0S A;  4B3M L;  3TRZ A;  2MNA A;  3GTP H;  1VQJ A;  2JEB I;  3NEM A;  4A3E G;  3GTO H;  1VQF A;  1L1O C;  5GRO A;  1HNZ L;  4DV0 L;  4RMF A;  4UY8 C;  1KQS A;  4GKJ Q;  4GKK Q;  1FGU A;  1XTD A;  2Y0S G;  2IHF A;  2IY5 B;  3U58 A;  1K9M C;  4R4Q A;  4LF7 Q;  1UE7 A;  2Y0S E;  4IPH A;  3GTQ H;  1N34 L;  1U5K A;  1OXX K;  1NMG A;  2HIX A;  3D31 A;  2VUM H;  2HHH Q;  4BBR G;  3AEV A;  5IYC H;  4A3D H;  1U0L A;  3GDE A;  1N32 L;  4HJ7 A;  1Q8K A;  2NZH A;  2Q2H A;  2UXC Q;  3UDI A;  3HOX H;  3PUW A;  3M9B A;  4A3I H;  2E5L Q;  3S1Q H;  5M3F H;  2KHI A;  2KBN A;  2Q2I A;  2YTX A;  1B8A A;  3GD7 A;  4DR1 L;  3CCJ A;  4BA2 I;  1XPU A;  3K81 C;  2JA8 H;  5IP9 G;  2WFW A;  3KJO A;  1HNX L;  1VQH A;  4R4C A;  2AWO A;  4DUY L;  4YWL A;  2D62 A;  2F52 A;  5C4X H;  4A3J H;  1PH9 A;  5JJI A;  1YNX A;  3J80 i;  4YHH L;  3PO2 G;  3CME A;  4K0K L;  3HOW G;  4BXX H;  2OQK A;  4GS3 A;  5C0X G;  1ASY A;  4LF8 L;  2GVA A;  1H95 A;  4DAM A;  1V9P A;  4AIM A;  3GTK H;  4X64 L;  4BBS G;  4APV A;  2ASB A;  2VZA A;  4KHP L;  2IX1 A;  1VQG A;  2VQF Q;  1D7Q A;  3H3V I;  1E3P A;  1WCM G;  3S1M H;  4A3B G;  3S1N H;  3ER0 A;  4OWT B;  2Z6K C;  3CAM A;  4DV5 L;  4DV2 L;  2DUD A;  1LTL A;  3CW2 C;  4B3T Q;  4LF6 L;  1VS0 A;  3L0O A;  2A1A A;  3S15 H;  4GLV B;  2K5V A;  2PQA A;  4UP8 A;  2I5H A;  1KRS A;  2LXK A;  2F4V Q;  1JJ2 A;  1DGS A;  3TS0 A;  1KRT A;  1FJG L;  1X3F A;  1C9O A;  2ZTC A;  3M3Y H;  2AKW B;  1VQD A;  5IWA Q;  5BR8 Q;  1AH9 A;  3OW2 A;  4DV6 L;  4JI3 L;  4YWM A;  4YY3 L;  1YHA A;  4X62 Q;  1TXY A;  2LXJ A;  2EXD A;  4BBS H;  2D0O A;  1I94 L;  3KF6 A;  4A93 G;  1VQ5 A;  1T9H A;  4IJH A;  3NBH B;  4IOC A;  4A3L H;  2CCZ A;  4Y52 H;  4DR6 Q;  3I55 A;  1N9W A;  3HOY H;  1PV4 A;  4LFA Q;  3PIP A;  3A5U A;  3CPF A;  1PFS A;  2JA5 G;  4GOP B;  4DV7 L;  1XMQ Q;  1MJC A;  2LSS A;  3MXN B;  3PUY A;  1CSP A;  4DR4 L;  3S2H H;  2UUA L;  4JBM A;  3G48 A;  1TWA H;  1VQI A;  1X3E A;  1PH7 A;  3HOU G;  4A3K H;  3S1R H;  1IXR A;  2MO0 A;  2ZJP A;  4POF A;  3S16 H;  4GNX A;  3HOZ H;  1I50 H;  1XNR L;  2A8V A;  1X56 A;  1JMC A;  3WWV A;  5LMN W;  2CWP A;  2YYZ A;  1JJC B;  3UDG A;  2R92 G;  1WOC A;  3M4O H;  1YHB A;  4IPG A;  1PH2 A;  1IL2 A;  1XJV A;  5GAE C;  4P71 A;  1HR0 W;  2GN5 A;  2OWO A;  3PCO B;  4GKK L;  4GKJ L;  3KFU A;  4OO1 I;  4LF7 L;  1YEZ A;  3KDF B;  3CD6 A;  4UP7 A;  4DK3 C;  4A3F G;  4TQU S;  3PF4 A;  1LYL A;  2RCN A;  4R4T A;  3AFQ A;  1VQO A;  2UXC L;  4DAY B;  4OON A;  1CKN A;  2E5L L;  1AE3 A;  1IYJ B;  3JAM c;  1NJI C;  3S17 H;  2JA7 G;  1QVG A;  3UDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...