3K7AH

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k7aH00
1PH1A 2JA6G 1WOCA 2VZAA 1EUJA 1BKBA 3S17H 3HOZG 5M5YH 4P74A 5E7NA 5HGQA 1EWIA 4OWTB 2JA6H 4GKKL 2UXCQ 2MQHA 4DV5L 3PSIA 4XTCS 3M3YH 1N32Q 2MFIA 4HJAA 2JJQA 1GM5A 1A8VA 3CD6A 4GLXA 4C3HH 4JI5Q 3CMAA 2HIXA 3K0XA 3UDXA 1N33Q 4DR6L 4GNXC 3AEVA 1VQAA 2L15A 2VY3A 2PMZE 1FJGQ 1VQPA 5FJ8H 2Z0SA 1Y1VH 4JBWA 4YCUA 4GOPC 4LF4L 1HNWQ 2WP8J 2VS1A 1AE3A 2MO1A 1PYSB 2Y0SE 3Q8DA 1PH8A 4DR7Q 3G6EA 1YVCA 4A3JH 1N32L 2R93G 3BJUA 2AKWB 2WAQE 1N9WA 3L0OA 1GD7A 4IPDA 2QEXA 3CCVA 1HNZL 4JI4Q 1NMGA 3ULJA 3VDYA 1UE7A 1CUKA 4JI7Q 1IXRA 3HOYG 3K80C 3ER0A 5DLQE 3W1GA 4JC0A 3PO2H 2JA9A 2AMCB 3J81c 4A3BH 2K50A 4DKAC 1CSPA 3CC7A 3HOUH 4BXXH 4NXNL 1YHQA 1JMCA 4A4IA 4APVA 1OXXK 2NN6G 3I4OA 5IY0A 2V1CC 1HNXQ 2WB1G 3J81i 1GKHA 1QZGA 4HJ8A 1YJ9A 2R7ZH 4PZ8A 3HOWH 1UEBA 1XPRA 1OXUA 3PF5A 5FJ8G 1NMFA 3PO2G 4GKJL 5C44H 3EBEA 1VQHA 2N3SA 2E8GA 4LF7L 2ALYB 3I4MG 3PCOB 1WJJA 1KC8C 1UE5A 4B3TL 1XTDA 2CKZB 2VUMG 1JJCB 2IHEA 4DV4L 4UP7A 4QJFA 1LYLA 4JG2A 3MEFA 1HR0W 4RMFA 4DK6C 4LF8L 4A93H 4A93G 2ATWA 1XNQL 2JQOA 1KRSA 4GN3B 3RLFA 2Y0SG 2QGQA 3HKSA 1B7YB 4C3IH 5IYBG 4BY7G 4IFDI 1Y1VG 3ULLA 1BBWA 3LGJA 1PH4A 3I4MH 3JAMi 1VQNA 3CW2C 1X65A 4NXMQ 4B3ML 4O0AA 1TXYA 4JI3L 4A3CH 3PV0A 4LF9Q 2KCTA 2AWOA 1VQDA 4KLKA 2R93H 4R4CA 5LMNL 1SFOH 4JI2Q 2UU9Q 1Q81C 3UDGA 1EFWA 1N33L 3S14H 3A74A 1LUZA 4B3MQ 4X62Q 4IFDG 4QY7A 2UUBL 1L1OC 4LUVA 1QVFA 3HOVH 4DR2Q 2YTVA 1X6OA 1WCMG 2UXCL 3CCUA 4DV0Q 2VNUD 3OTOQ 4HIKA 2NZHA 1VCIA 1MJEA 2OCEA 1J5EQ 1XNQQ 1H95A 4YCWA 4UP8A 3PIOA 4OX9L 2I5LX 1W2BA 2Q2UA 1IBMQ 1S3OA 3I56A 2XGTA 4DK3C 4JI6L 3M4OH 2UXBL 2IY5B 1ASZA 1VQJA 3I2ZA 3SGIA 3ICEA 1JB7A 2C35B 4LFBL 1UE1A 2Z6KA 3FKIG 3OYYA 5LMUQ 1CKNA 1I6HH 4LFCL 1Q8KA 2RHSB 2AWNA 3A5ZB 3RN5A 2EQSA 4YWMA 1U0LA 3UE0A 4BBRH 2E5LQ 4IPHA 4Y52H 2HHHL 1QVGA 4IJHA 1VQ8A 4GNXB 2F4VQ 1XMOQ 4BA1I 2PQAA 1PH6A 2PI2A 1A0IA 4YCVA 4X66L 2A19A 2GVBA 4GNXA 2OWOA 5IYDG 1K8GA 3CCJA 4A3DG 4NXML 4JYAQ 4A3EH 1AH9A 1FL0A 4IO9A 4HJ7A 1C0AA 4WJ4A 4JI7L 4ME3A 2CFMA 1SE8A 1KHIA 1TWGH 1CKNB 4DV5Q 3J81j 1YBYA 3TS0A 1NJIC 1HNZQ 4EQ5A 4MTNA 4A3FG 2NVTH 4GS3A 2A8VA 3CCMA 1YZ6A 1SROA 2BA1A 3NELA 1W3SA 4XIGS 4UY8C 3H15A 4LF4Q 2F3IA 3HFZB 1BBUA 2JK8A 1HZAA 2JA8G 2VW9A 3FHWA 1JJ2A 3HOVG 4GKJQ 1OXVA 1SR3A 1VQEA 3CP0A 4DV7L 4QIWE 4A3KH 1KD1C 2K5HA 4YY3L 4BY1H 1KAWA 5IP7H 4LF6L 1NY4A 2H5XA 1VQKA 4L5QA 4A3KG 4JI8Q 1N36Q 4JBKA 4A3GH 4JI1L 2VUMH 2YV5A 1Z9FA 4KHPQ 4KHZA 4YHHL 4DV2L 1VQ4A 3NBHB 2VQFQ 1A62A 2BA0A 3S1MH 3CCLA 2CCZA 1TWCH 3W5OA 2KENA 1IL2A 3UDIA 2RF4A 3KJPA 1IBLQ 3U4ZA 1VQMA 3GTKH 4A3FH 1Z47A 3RLOA 3CCRA 4IOCA 4X6AH 1J6QA 1QVCA 5K36G 2IX1A 1C9OA 3IRBA 5M5WH 1LM0A 2B63G 2ID0A 1KIXA 4P75A 1OXSC 3BU2A 1C7YA 2UXDQ 3K8AA 5IWAL 4DV6L 2JA8H 3DLLA 1Y14B 2N8NA 5IWAQ 5M3MG 2JEAI 2R6GA 2OQKA 3CC2A 1YJNA 4AYBE 3U58A 3W1BA 1Q82C 2NVQH 1OXTA 4DR4L 3J80c 3S2HH 2EXDA 2K5NA 5C4XH 1N34L 3PO3H 4PZ7A 4POFA 3HOWG 1E1TA 1DGSA 1PFSA 3I7FA 4R4TA 1CKOA 1CSQA 3GTLH 1IBLL 4DPGA 4OONA 3M7NA 4IOAA 2UUCQ 1OTCA 1VQCA 4R4IA 4L5SA 5BR8Q 3J80i 3KJOA 4DV1L 2B29A 2F52A 4LUZA 4PZ6A 2ZM6Q 1AE2A 3T1YQ 1PYBA 2R92H 4DR3Q 3TRZA 2YTYA 4A3BG 1TWFH 2PQAB 5IP9H 3HOYH 4BBSG 2OTJA 5IE8A 3D0FA 1FGUA 1G6PA 4LNQA 3CCQA 2UUCL 1IYJB 2LXJA 1VQ5A 1JT8A 1X3EA 4YWLA 4FDBA 5C0XJ 3AQQA 1E24A 2VQEL 2HT1A 3T1HQ 1B70B 2OTLA 4MNOA 5M3FG 1UE6A 1X3FA 4EX5A 4DR4Q 4LFAQ 2CWAA 1P16A 1VQGA 5EAYA 1CKMA 4A75A 4AQYL 3RZDH 3K7AH 4DV6Q 4GN5A 2VL6A 1K0RA 4P73A 1K9MC 5GAGC 4LF5L 4A3MH 2KBNA 1YI2A 1K83H 1SRUA 3F1ZA 1E22A 1Q12A 4BA2I 1XNRQ 1B8AA 1VQBA 3A0JA 4C2MH 4Y7NH 4HIMA 1GO3E 2KHIA 1X9NA 1YIJA 2CQOA 5IYBH 4HIOA 1L0WA 2IHFA 5H1SE 1P8LA 4DR5L 3HOZH 3L7ZC 1N8RC 3WWVA 1XNRL 4JOIC 3L2PA 4B3SL 2D0OA 2E2JH 4OWWB 1X54A 1EIFA 2JEBI 2WB1E 4R1JA 4JI1Q 2F4VL 1VQ6A 3S16H 3G48A 1SLJA 2YYZA 3KOJA 1HH2P 3H3VH 1SMXA 2RCNA 4A3CG 1V1QA 1YHBA 4A3LH 3GDEA 4A3MG 2ZJRA 4OWXB 2YU9H 3KF8B 2KCMA 4GN4B 1MIUA 1RIPA 5ELOA 3CCEA 1PH2A 2BH2A 4NPSA 2MO0A 1EQQA 1X3GA 3KLWA 4JBJA 4LWCA 2ES2A 2JA5H 2R92G 4OO1I 2I5HA 1IBKL 4LFBQ 2Q2TA 3T1HL 2R7ZG 3KF6A 5J3BA 1FVIA 1VQFA 5HY6A 2JA7H 4IPGA 2DUDA 2IX0A 3BZCA 4DV3Q 1J5EL 4YHHQ 1KRTA 5JJKA 3T1YL 3OTOL 4MZ9A 1I94L 3GTPH 3I4NG 3S15H 4K0KL 5AJ3L 1XMQQ 1Q7YC 1N36L 3S1NH 1MJCA 4H02A 1RL2A 1U5KA 2A1AA 2K5VA 4DUYQ 4DR1Q 1V9PA 2N78A 3JC66 4BY7H 4B3RQ 1XJVA 3PGZA 1Q86C 2UU9L 3BZKA 1VQOA 4JI2L 3MXNB 3CCSA 1PH5A 2KHJA 1D8LA 1HR0Q 4BY1G 4JI0Q 4P71A 2HHHQ 3GTMH 1YNXA 1VQIA 1QZHA 2XTIA 1XPOA 1M90C 1HR0L 1YEZA 2JA5G 1WFQA 2CWPA 4JBMA 2UXDL 4AH6A 3F2CA 5LMNW 3CPWA 3RNUA 3UE1A 2DGYA 2JE6I 1BVSA 5LMUL 1HZBA 3I4NH 4B3RL 4DAYB 5GADC 3CAMA 1YJWA 1EYGA 4YWKA 4A3LG 1IZ6A 4JOIA 4DR1L 1PV4A 2AHOB 4TQUS 2UUAL 5GROA 1NTGA 3TQYA 5IYCH 3D31A 3S2DH 4A3GG 2UXBQ 2JA7G 2UUAQ 4QGUA 2EIFA 3FP9A 4K0KQ 4DV4Q 1IBML 1WYDA 3E9HA 3RZOH 2K75A 4JYAL 4JV5Q 4LW1A 4OO1G 4LF5Q 3HKZE 3NENA 4C3JH 1EIYB 4DV3L 4X66Q 3HOUG 2WFWA 4LUOA 3GO5A 4X65Q 2E2IH 4X64Q 1I50H 1UWVA 2NVYH 4DR2L 3GTOH 4JI8L 1Y1WG 4QL5A 4AIMA 3PO3G 3NEMA 2QA4A 1MKHA 3CC4A 2BH8A 3U4VA 4LFCQ 1PH7A 2B3GA 2PI2E 4P72A 4TVAB 3PUZA 5ELNA 3STBC 3J7A5 4DV7Q 4WJ3M 3GD7A 5LMNQ 3ULPA 1PH9A 5JJIA 3RN2A 1NE3A 4DUYL 1S72A 4POGA 1JJGA 4NXNQ 3HKZG 3G4SA 3M85A 5M3FH 4X64L 1VQLA 1I5FA 3ERSX 1R9TH 4KI0A 4X65L 3AFPA 2HQLA 3F2BA 5JEAJ 3JAMc 3HOXH 4HJ9A 4OX9Q 2R7DA 1S40A 3K7UC 3AYHB 1E7ZA 4O2DA 3GTGH 2GN5A 4DR5Q 5IYDH 4JV5L 1PH3A 1L2FA 3TREA 1X55A 2RHQB 4DR7L 3RR5A 5GAHC 1L1OA 1ASYA 1VQ7A 4LF8Q 1T9HA 5M3MH 2UUBQ 2ZJQA 1Q1BA 1G291 2ZJPA 4BBRG 1IBKQ 4IFDJ 2HIVA 1HNWL 3K81C 5JJLA 4X62L 3B6YA 4B3TQ 2ZTEA 2R7FA 2Q2HA 1EQRA 4DR6Q 5IP7G 1XMOL 3CMEA 4JI5L 2K4KA 3STBD 5FLMH 1A63A 2NVXH 3EIVA 4JI0L 2I5MX 5C3EG 2E5LL 1V43A 5C4XG 1G51A 1GVPA 5IYCG 5FLXc 1M1KC 4B3SQ 1HJPA 4NB3A 4AYBG 1XPUA 1WI5A 3KDFA 4L5RC 1PA6A 4DNIA 5IP9G 4IPCA 1TWAH 4HJ5A 4BBSH 1TWHH 3H0GG 2NZOA 1QUQB 1WCMH 1LTLA 3E0EA 4JI6Q 1YITA 1XMQL 1E3PA 4PG3A 5AJ3Q 2VQFL 2B63H 2Q2IA 1I94Q 3PF4A 4L5TA 4DV2Q 4DR3L 3GTQH 3H3VI 2MNAA 3TS2A 2YTXA 1KXLA 3CQZH 4DV1Q 4GOPB 1PVOA 5BR8L 3PUVA 1E1OA 4AQYQ 4DV0L 3EN2A 4LF6Q 2PNHA 1K73C 1O7IA 1I3QH 1NBWA 4A3IG 4DUZL 1X56A 3AFQA 1N34Q 1D7QA 2IT1A 3HOXG 1SN8A 2K52A 2ZTDA 4GOPA 2VQEQ 4HIDA 1PHJA 3FKIH 5JEAG 3DM3A 3E9IA 1FJGL 3TEHB 4LF9L 2D62A 2WAQG 5C0XG 4JI3Q 3KYHC 4OXPA 3RLNA 3OW2A 1QUQA 1Q1EA 4GLAC 3M9BA 2K14A 5IT9c 2ZTCA 3PUWA 2ZM6L 3S1QH 4BXXG 4JI4L 4A3DH 3H0GH 3U50C 3KDFB 3M4QA 3CXCA 4IJLA 4A3IH 5GQOA 4DAMA 4A76A 1Y1WH 3PUYA 5C44G 2LXKA 3S24A 3ZJYC 1Q46A 4RG1A 1JE5A 3CPFA 3F2DA 2ASBA 1EOVA 2FXQA 4R4QA 4JCVE 5M5XH 5C4JH 4J15A 5FLMG 3M4PA 4KHPL 5GAEC 2E2HH 2NN6I 2OQ0A 4GLVB 3KFUA 1K8AC 4LF7Q 1HZ9A 4DUZQ 3A5UA 3CF5A 3UDFA 3PUXA 4A3EG 1KL9A 3GTJH 3KF6B 3F8TA 3I55A 3G71A 1VS0A 1KQSA 1L1OB 4YY3Q 4LFAL 4UPAA 4ALPA 4QQBX 4R4OA 2I0QA 2LSSA 4PMWA 3S1RH 3PIPA 4GKKQ 2D0PA 1YHAA 2N49A 1K3RA 1HNXL 1VQ9A 1HZCA 2Z6KC 5C3EH 5C0XI 4UP9A 4A3JG 3J7ZC 2GVAA
chains in the Genus database with same CATH superfamily
2CH4W 2F0WA 1BKBA 5E4WC 1STEA 4P74A 4RCOA 4OWTB 2F0QA 2Z6BA 2F03A 5EKIA 4DV5L 4C3HB 3PSIA 3M3YH 1KDCA 4AYBB 2VB2X 4HJAA 1GM5A 1N32Q 1A3UA 4JI5Q 2K5DA 4IUVA 3UDXA 1BR9A 2OEOA 2PMZE 1VQPA 4BS9A 1Y1VH 4LF4L 2MO1A 5IOCA 1U4LA 3HZXA 2NZ1D 1KLGD 1SYCA 2B2TC 2QEXA 2BDOA 4JI4Q 4JI7Q 1K3BC 1UE7A 1IXRA 4A3MB 1SNPA 4BXXH 1DZ1A 2PW5A 5LL6S 1JMCA 4DNRB 3MXNA 1RCVD 1HNXQ 5M9OA 3IKJA 1SMYC 5J22A 3A8KE 1S5FD 1QZGA 5EJWA 1R4PB 4PZ8A 4DXFA 3HOWH 5HGTA 1I4GA 3PF5A 3A54A 3I4NB 3PO2G 4GKJL 3DWQA 2N3SA 2ALYB 4IUPA 3PCOB 2A68D 4K14A 3QJYA 4DV4L 5JVG3 5A35A 1HQMC 4JG2A 3N6RA 5J39A 4A93G 1Q90A 3I90A 2ATWA 4BY1B 2A6ED 2JA8B 1EYDA 5JEAH 3ULLA 1BBWA 3LGJA 5EBDA 2L0CA 3KF8A 4FXGC 3K59A 1IKMA 1PH4A 3D8GA 1B3AA 3TDQA 3I3CA 2NUCA 4DK1A 4JI3L 1TXYA 4WORA 3PV0A 3SDZA 4LF9Q 1TU2B 2R93H 2E2DC 3D4RA 4H7BA 1Q81C 1STNA 4B3MQ 1F9RA 2EPBA 1MD2D 4IFDG 2UUBL 3D4WA 3J80L 5C4HA 1U4RA 1ENFA 1EYCA 3K57A 2VNUD 3HOVB 2B2VC 2NZHA 1MJEA 3K5OA 1XNQQ 1H95A 4UP8A 3PIOA 2I5LX 4J1MA 2A6EC 1IBMQ 1FNUA 3S2HB 2RSNA 1STGA 2CVRA 5D14A 2XGTA 5F2DA 3I56A 4R9WA 2IY5B 2C35B 1D2BA 3RZOB 1VMCA 4C1NK 3FKIG 3K7AB 4DA2A 4RHRA 3PIP3 4IUUA 4A3JB 2AWNA 3RN5A 3QR8A 2EQSA 1K83B 5CV4A 4OELB 1QVGA 4IJHA 1VQ8A 4BBRB 2JXMB 1XMOQ 1SBBB 4KY6A 1ENAA 2GVBA 1F2ZA 4KKSA 4K5WA 3FPUB 5C5MA 4XQQA 1TWGH 1NJIC 1CKNB 1BF4A 1HNZQ 4ZUJA 1H9JA 1F77A 1G2SA 1W3SA 4XIGS 1WTVA 4UY8C 2KQ3A 2F3IA 1EY7A 1BBUA 1HZAA 1B9MA 4GKJQ 4RH6A 1B44D 5IP7H 1NY4A 3TSSA 1JB3A 5KYIA 4A3KG 4JBKA 4A3GH 4KHPQ 1CI3M 2LS01 1LTBD 3CCLA 1NUCA 3W5OA 4X6AH 1AW7A 1J6QA 5C6AA 5M5WH 3FDTA 5ELBA 1OXSC 3BU2A 2ZXRA 1KABA 4DV6L 3DLLA 1QOHA 4JK1C 1Y8OB 3KLRA 3NQTA 3CC2A 4AYBE 1Q82C 4OEMB 1LTRD 3J80c 2EYMA 2EXDA 1EEID 4PZ7A 4IOAA 2I07B 3M7NA 3C3LA 2UUCQ 1OTCA 1VQCA 2WV6D 4KN7C 3S14B 4L5SA 5BR8Q 2BDNA 1V1PA 4LUZA 2F52A 3OIQA 2RDHA 1AE2A 2XVSA 1TIID 1CFMA 1PYBA 2YTYA 3Q0AA 5IE8A 1TS5A 2E74C 1FGUA 1R4QB 2A69C 3CCQA 3L9AX 2B2YA 1VQ5A 1EY9A 5KRUA 2X69A 2HT1A 1E24A 2K5WA 1B70B 1KLUD 1UE6A 1X3FA 2HCCA 3DWPA 4X3TA 4QCLA 4IURA 5CYUA 3P7JA 1VQGA 5EAYA 1CKMA 3U9OA 3PMFA 1IW7C 2CQAA 2VL6A 1K0RA 2PO4A 5GAGC 2KBNA 1K83H 3QO2A 4R8NA 4UHVA 4MN3A 4X3KA 3E5SA 4Y7NH 4ZK9B 3MFYA 1YIJA 2CQOA 1L0WA 4R8IA 2IHFA 2XIWA 3E0JA 2E2JB 3HOZH 1K28A 3L7ZC 3TP6A 3WWVA 4OO1H 2D0OA 2E2JH 2EDGA 4HMJA 2JEBI 3C1FA 4JI1Q 2LY7A 3H3VH 1SMXA 1YHBA 1TWHB 3GDEA 5KYLA 1SNDA 2N88A 3HOYB 3KF8B 1RTNA 4GN4B 3WOEA 1RJTA 4X3UA 5CV7A 3HOYH 1JWMD 4OO1I 2R92G 4XYOA 1ILPA 4HEDA 3RMHA 4K6DA 5I2YA 5HY6A 2WB1B 1AEXA 2DUDA 3BZCA 2B2TA 5DM63 4MZ9A 1EY8A 5FOBB 1N36L 3S1NH 1CA6A 1V9PA 1SFOB 1Y69U 3PGZA 4BY7B 1ENCA 3MXNB 1PH5A 1G91A 1HR0Q 4P71A 5M5WB 2EE1A 1YNXA 2LKVA 1YEZA 4ZCKA 1WFQA 4JBMA 3UE1A 2DGYA 4B3RL 1BXTA 5GADC 1SNCA 4DXGA 1PV4A 1HFNA 3S2DH 5IYCH 3TZUA 3D31A 4A3GG 4C56C 4K0KQ 4DV4Q 4JYAL 2K75A 4JV5Q 3FRPB 4LF5Q 1EIYB 4FNFA 2NVYB 4LUOA 4X65Q 1I50H 2NVYH 3L3OC 1BBXC 3H0GB 3TP7A 2PYKA 2K1BA 2QA4A 1S5ED 4P72A 3PUZA 5TSSA 2VB3X 3ULPA 5JJIA 3AMUA 1S72A 3G4SA 1TWGB 1ZXTA 3HGBA 4X64L 2QCPX 2ZXPA 4HJ9A 4EQPA 3G6JB 1O7YA 3K7UC 5IYDH 2K04A 3SR1A 1FNVA 2XWBB 1X55A 2K32A 3S1RB 4LF8Q 2B8GA 2RBMA 1G291 2ZJPA 2HIVA 3QG1A 2B2UC 2J0TD 3NBIA 3TP8A 1KNEA 1B53A 1S4ZA 5DEHA 2PCFB 1XMOL 2Z8LA 4JI5L 2NVXH 2I5MX 2F0MA 3NWTA 2JA6B 3K5LA 1G6ZA 2BE5D 5FLXc 1E0BA 1TQOA 4QMGA 1PZID 4K5VA 2BOSA 2OXPA 1PA6A 4DNIA 1CT1D 5IP9G 4HJ5A 1TWAH 1STBA 5FLXE 1TWHH 1WTPA 4DNTB 1LTLA 3E0EA 2CH4A 1OO9B 1XMQL 1E3PA 2Q2IA 4A3EB 2L1BA 4DV2Q 4DR3L 3GTQH 1HFGA 1QG7A 4F7XA 5I9OA 3QB3A 2RSOA 1HUNA 1MHWC 4BWGB 1K73C 5JPNC 4A3IG 3K58A 2IT1A 3HOXG 1SN8A 2K52A 3IL8A 3KLSX 3QOLA 3VA7A 1QNKA 2M2LA 3DM3A 2BE5C 1ET9A 4LF9L 2Y0SB 4KD3A 1G8ZD 1U4PA 5C0XG 2A74C 3KYHC 4JI3Q 3BDCA 3H94A 3GTOB 3S1QH 1KTKA 4IUNA 4A3DH 3U50C 1SAPA 4IJLA 2SNMA 3S1QB 1LABA 2EOTA 3PUYA 3S24A 2FFKB 2ASBA 1EOVA 1D1KA 1ZEQX 2KECA 1ZYRC 4F8MA 2NN6I 5DM73 1TY0A 4ULLA 4WRDA 1HZ9A 3UDFA 2EJGC 4ALPA 3TZDA 2VXWA 4GKKQ 5CORA 1HNXL 1ET6A 1HZCA 4UP9A 5C3EB 1WTQA 2TMPA 1PH1A 2JA6G 4RGNA 3BZDB 1S5BD 5EKLA 1LT3D 5HGQA 4GKKL 4IALA 4DFAA 4XTCS 2JJQA 3CD6A 5HURA 2EY5A 5IT9L 1VQAA 2B8FA 1STHA 2N55A 1GUGA 4GOPC 1SJED 2WP8J 4MTKA 4LJZC 4PQXA 3MFGA 3K5NA 1PRTD 2Y0SE 3RUZA 1PH8A 3FEWX 4DR7Q 1I6HB 4A3JH 1N32L 4HCSA 4DAYA 1N9WA 3L0OA 3J81E 1HNZL 3CCVA 1F9SA 3EA6A 3R93A 2JA9A 3J81c 2K50A 3CC7A 1L0YB 4DU9A 4IFDH 4C1NI 1WD0A 5E1FA 3J81i 2Q8RE 4HJ8A 5KEEA 2R7ZH 1DOMA 1XPRA 1LTGD 1NMFA 2E8GA 3EBEA 3I4MG 1PRTC 4LK1C 4KKTA 1XTDA 1XYIA 3VYUA 5KGUA 2IHEA 1A15A 3GQBA 2B2YC 1GUNA 4DK6C 4A93H 4ODGA 3Q6SA 1XNQL 4GN3B 1HTPA 2QGQA 4NKLA 3MXPA 5A2QE 1MSHA 2VUMB 1VQNA 2MUYA 2ZT9C 2EY6A 5T1GA 1X65A 4NXMQ 4B3ML 4FO2A 2Q8IB 2AWOA 1VQDA 1E2ZA 2JP1A 1N33L 3S14H 3A74A 4IZ8A 1C48A 4QY7A 3MAQA 3HOVH 4DR2Q 1WCMG 2UXCL 1T5EA 3OTOQ 1VCIA 2DNCA 2OCEA 2EYHA 1J5EQ 3BS1A 2FMMA 1S3OA 1S5CD 2K6AA 2F3VA 3PO3B 4DK3C 3R3OA 4JI6L 1K0SA 2MJ8A 1LACA 1EYAA 5LMUQ 1LTTD 3E3XA 1Q8KA 1RD9D 4XT1B 2IWHA 1GXDC 2RHSB 1GUOA 2E5LQ 1A3VA 1GUWA 2HHHL 4FYDA 4GNXB 2F4VQ 4BBSB 2G9DA 3CRLC 4BA1I 3OMCA 2PI2A 1A0IA 4GNXA 4B9XA 1K8GA 3CCJA 1F9PA 4JYAQ 4A3EH 1AH9A 3Q23A 4IO9A 3R2TA 4JI7L 4MHEA 1KHIA 1PTOH 2WKDA 5EBCA 3TS0A 3V05A 5M3FB 4RGTA 3KBGA 4MTNA 3HOWB 1SE4A 3NK9A 1CK1A 4GS3A 1L0XB 1STAA 2O5JC 3NELA 3H15A 4LF4Q 3V2TA 3FHWA 3VR3A 1JJ2A 1OXVA 4QIWE 5C4ZA 4YY3L 1KAWA 4EGVA 4PMBA 2H5XA 1YNND 1N36Q 2RCFA 5FK9C 3GTPB 3S15B 2A6HC 5CBEE 3SK5A 3S1MB 2YV5A 1Z9FA 5D3IB 3NBHA 1Y1WB 4H0LC 3S1MH 1A62A 2EYLA 2E76C 4RFBA 2RF4A 1IBLQ 3U4ZA 1Z47A 1PYWD 1RDPD 1QVCA 5K36G 4CDCC 2IX1A 3GTKB 1DD2A 3ERQA 4P75A 1KIXA 3K8AA 5IWAL 2L11A 2JA8H 3NWSA 1Y14B 4OHJA 3BDOA 2JEAI 3U58A 2NVQH 3S2DB 3S2HH 1AP0A 3PO3H 1YNNC 4ZKCB 3BDLA 3CHBD 1CKOA 1CSQA 3GTLH 4DPGA 5CV5A 5T1IA 5I2XA 3I72A 1B2TA 4ZRZA 2NN6H 4DV1L 4PZ6A 3KBXA 3TRZA 1TWFH 2OTJA 4BBSG 3D0FA 3P1HA 2PPBC 2RVLA 4RAUC 3T4AC 1G6PA 4HTHA 4LNQA 1IYJB 1JT8A 2VQEL 1GHJA 4TRDA 1Z6HA 4DR4Q 2F0FA 1T5XD 2CWAA 4LAAA 4M8AA 3FVQA 3K7AH 2F0IA 1WVLA 2FMCA 4GN5A 3TP5A 3GTJB 4P73A 4QUCA 4A3MH 3WOFA 3F1ZA 1E22A 4BA2I 1B8AA 3A0JA 4C2MH 3MZ5A 1F9QA 1HUMA 4DR5L 2XRSD 4FF4A 3L2PA 4B3SL 4OWWB 2R7ZB 1LT4D 3G48A 1SLJA 2YYZA 3KOJA 4CKEA 1HH2P 2L12A 1KAAA 3S16B 2OT2A 1IYVA 1WTHA 4J8QA 1PLFA 5EQ0A 4A3MG 2YU9H 2KCMA 4DAPA 1STYA 3CCEA 2BH2A 1IYUA 4NPSA 1EQQA 1SYFA 4LFBQ 1IBKL 3T1HL 1IW7D 5JJZA 5J3BA 1FVIA 1ESRA 2JA7H 4KJNA 4IPGA 1PZKD 2EJMA 4DV3Q 2GA4B 2L9HA 1HA6A 4CHTB 5EGTA 3I4MB 5ELEA 3T1YL 1VF7A 3F2UA 1I94L 2AQ1B 3VYTA 5AJ3L 2ZXOA 1U5KA 4H44C 4DUYQ 2K5VA 4DR1Q 1AN8A 3JC66 4BY7H 4N8FA 2PZUA 1VQOA 2KHJA 1SNMA 4CGYB 2EY1A 1TS3A 4BY1G 2X6GA 3NHHA 3GTMH 1M90C 1G2TA 2JA5G 2CWPA 2ICEC 1AZPA 2UXDL 5LMNW 3F2CA 3RNUA 1HHVA 1V8QA 1I4QA 1EYGA 3CAMA 1PRTF 4YWKA 4DR1L 2UUAL 2AHOB 2JN4A 2WKCA 3TQYA 4CJ2C 2UXBQ 1RTOA 2JA7G 3TN2A 3RZOH 5IGDA 4OO1G 3HKZE 2KCCA 5NUCA 3T56B 4DV3L 1HCZA 1MGSA 4OIJA 1GHKA 1TS4A 2WFWA 4KV6A 5IGCA 2E2IH 3A8JE 3GTOH 1WTXA 4QL5A 4AIMA 3PO3G 3NEMA 3CC4A 1HQRD 1H9RA 2BH8A 1PH7A 3STBC 2B2WA 3SK4A 4WJ3M 4DV7Q 4JVZA 3GD7A 4CJ1B 5LMNQ 4XYQA 3RN2A 4V190 3SHLA 4NXNQ 3M85A 1TS2A 5IODA 3ERSX 1VQLA 4KI0A 3MTSA 3AFPA 3HOXH 3I4LA 1BUVT 1S40A 3AYHB 3H6MA 4DR5Q 3HOXB 1PH3A 1BNZA 3IFTA 2EYJA 5GAHC 1FR3A 1D5MC 2UUBQ 2J4XA 1CZGA 1LV9A 3K81C 3JAML 3R2IA 1F2MA 3M7GA 4HR7B 4RKLA 4B3TQ 2R7FA 1Q8IA 1FGBD 2Q2HA 1CQFA 2JA7B 4DR6Q 3QOJA 5M5YB 3STBD 2F0UA 3EIVA 4JI0L 3NPPA 1GVPA 5JOBA 3M3YB 3TMEA 1U4MA 4NB3A 1XPUA 4HCEA 1F2LA 4IPCA 3QIAA 1EU3A 2YU9B 3MVVA 4PG3A 2VQFL 2B63H 5CC4A 4UAIA 2MNAA 2YTXA 2SOBA 1SE3A 1JORA 3CQZH 4DV1Q 3IAYA 4GOPB 1PVOA 4LF6Q 3EN2A 2PNHA 4DUZL 1X56A 4TKOB 3H3VC 3D6CA 1BDOA 1PHJA 4P2CB 3U9SA 3HOUB 3FKIH 4K2LA 1FJGL 1KDAA 3TEHB 3SE0A 4XDXA 3OW2A 1Q1EA 4GLAC 2NTTA 2K14A 2F0OA 1MBYA 2ZM6L 1PTOF 4JI4L 3KDFB 1EWHA 3M4QA 4OL7A 5FO8B 3CXCA 5GQOA 4DAMA 1Y1WH 2V4DA 1ZKOA 3CPFA 3F2DA 4K8JA 1MI2A 2F0PA 3EFXD 4R4QA 1RHPA 4JCVE 1LTID 2E2HB 1U9RA 5FLMG 3NE5B 1UNSA 3M4PA 4GLVB 4HAEA 1C8CA 1UAPA 1KDBA 1AZQA 1JOKA 3KF6B 3I55A 1VS0A 3ZYYX 4YY3Q 1KQSA 4LFAL 4UPAA 1EFID 3NSWA 1JWUD 4PMWA 4CDDC 1YHAA 2N49A 1EU4A 1II3A 2G9HD 3DXJC 5C0XI 4A3JG 3J7ZC 2GVAA 5ELFA 2DJGC 5BN3A 2VZAA 3GP7A 2KA7A 2NVXB 1EWIA 4Q0FA 2HD3A 3C46A 1PZJD 1NCVA 2MFIA 1ILQA 4GLXA 4C3HH 4I7ZC 4RA8A 2JYOA 2KHSA 5E3FA 3CMAA 2HIXA 2NYZD 4GNXC 2L15A 2VY3A 1FJGQ 3MC0B 1W6JA 4JBWA 1A6XA 3OWEB 1O7LA 1HNWQ 1A2TA 3GV6A 1PYSB 1JOQA 4RCNA 3Q8DA 3P75A 1XX8A 2R93G 2AKWB 1GD7A 4IPDA 3HOUG 1WTWA 2K05A 3EVQA 3HOYG 3K80C 1QB5D 3OPOA 4JC0A 1QJOA 3PO2H 4A3BH 4L63B 1CSPA 3PO2B 1YHQA 3NQIA 1VDZA 4A4IA 4APVA 2NN6G 1SYDA 3I4OA 1WCMB 2V1CC 4Z9CB 5IGGA 5DNFA 1GKHA 2IPKD 1OXUA 4GZYC 5FJ8G 4XQNA 4ID6A 5C44H 4LF7L 1SYEA 3NTHA 4B3TL 1KC8C 1UE5A 2EYFA 1JJCB 2R3ZA 4UP7A 4QJFA 1LYLA 2KUMA 1HR0W 4FF1A 4RMFA 4MIUA 3O13A 2WINB 1E2VA 2AUJD 2Y0SG 4BY7G 4FF2A 1Y1VG 4KKUA 1J9OA 5JVH3 3I4MH 1EQVA 3JAMi 4A3DB 3H91A 3J7YW 3CW2C 4O0AA 5I9PA 4A3CH 1IHZA 2K5QA 2KCTA 4KLKA 5LMNL 1SFOH 4JI2Q 2UU9Q 3UDGA 2O5IC 1I4HA 1H9MA 1V1OA 1O80A 1L1OC 1BOSA 4DV0Q 2HUGA 2L4NA 2QEJC 1W2BA 2UXBL 4K6LA 3M4OH 1ASZA 3SGIA 1JB7A 2K28A 1UE1A 3OYYA 4NMZA 2F0HA 1CKNA 3KUPA 3A5ZB 3UE0A 4YWMA 1U0LA 4IPHA 3LWEA 1QILA 3W2DA 4PMCA 4FF3A 2PQAA 1PH6A 4X66L 2OWOA 5IYDG 1V1PB 5CBAE 1TT2A 2CW0C 1SYGA 4WJ4A 4ME3A 1SE8A 3J81j 5IGBA 2NVTB 4EQ5A 4NW2A 5KIXA 1EEFD 2NVTH 1D5XC 2A8VA 1HTLD 1SROA 3OHXC 3SXHA 1CM9A 1PXUA 2Z1CA 4K5XA 2RDFA 1JE4A 4KN4C 3VR6A 3OIPA 3HP3A 2JA8G 3MEHA 1FNWA 3T51B 3HOVG 4A3KH 1SR3A 1VQEA 3MWYW 1KD1C 1WD1A 5KNBA 4BY1H 1LT6D 4LF6L 1W6KA 4L5QA 4JI8Q 1B3QA 2VUMH 4KHZA 4YHHL 1VQ4A 2VQFQ 2BA0A 2H4OA 3MA2B 2CCZA 2KENA 5C4JB 3OMGA 1RKNA 3KJPA 1VQMA 3ITPA 3RLOA 2A73B 3CU7A 4IOCA 1IKLA 4FXDA 3IFDA 1JICA 2B63G 1PDQA 1D1IA 2SDFA 2EYOA 3J80E 2PNRC 2R6GA 2OQKA 1YJNA 3I91A 3T13A 5EPLA 4DR4L 2KCNA 1QCBD 5C4XH 4POFA 1MSGA 1PFSA 2A6HD 3I7FA 4R4TA 4OONA 5EPKA 2MGSA 2HDMA 4G4KA 1EOTA 3J80i 3KJOA 1EIHA 2B29A 2F4IA 2R92H 4DR3Q 5BN4A 2PQAB 5IP9H 1JCKB 1K8MA 1X32A 2D9UA 3T16A 1Y8PB 4V0BA 4YWLA 4FDBA 3T53B 2OTLA 4KHVA 2XSCA 5M3FG 4LFAQ 4AQYL 2MPMA 4A75A 4C3JB 1DOLA 1X3PA 1K9MC 1YI2A 2B2UA 3ND8A 3BYYB 2WIIB 1Q12A 1XNRQ 3TBIB 1NR2A 4HIMA 1GO3E 4A3KB 3BVMA 4HIOA 3A55A 2J7ZA 4IUTA 1N8RC 1XNRL 4JOIC 4HSVA 1EIFA 4A3GB 2WB1E 1VQ6A 2A5HA 3G7LA 2H1EA 1DM0B 1JOOA 2RCNA 4ZAIA 4K8IA 2LMCB 4OWXB 1PH2A 5ELOA 2MO0A 2NTSA 1X3GA 4LWCA 2JA5H 2ES2A 4H13C 2EY2A 3KF6A 4EVOA 3A8IE 1M4VA 2IX0A 2NBFA 1TVXA 5JJKA 4K0KL 3I4NG 1Q7YC 4H02A 1ONLA 4IN3A 1RL2A 1LT5D 1TWAB 2N78A 4B3RQ 1XJVA 2UU9L 4JI2L 3CCSA 1SE2A 4DGZA 1RODA 3CKIB 4HN7A 4JI0Q 2HHHQ 1VQIA 3CQZB 3N52A 1XPOA 1QZHA 1HR0L 1B50A 3GTMB 1CHQD 4AH6A 2JE6I 2EYPA 5LMUL 3I4NH 4A3LG 3J7AV 1NTGA 3EJIA 2EIFA 2PMZB 3FP9A 1SSOA 3E9HA 2LFNA 2RA4A 3RZDB 2NWGA 4XT3B 1UEAB 5FKAC 4DR2L 4JI8L 1Y1WG 4L6TB 1MKHA 4LFCQ 2PI2E 4TVAB 3J7A5 2F1MA 2WACA 1PH9A 1JJGA 3CRKC 1RF2D 1SEBD 1VF5C 4KD4A 1I5FA 1R9TH 3OW7A 3V96A 3R8BA 4OX9Q 5JEAJ 3JAMc 1R9TB 4EQOA 1E2WA 1GJXA 3GTGH 4O2DA 5KNCA 2KOLA 2GN5A 4KTAA 1L2FA 2AUKA 3TREA 4G7ZC 5CV9A 2K01A 3RR5A 1SXTA 1ASYA 2OF1A 1T9HA 5M3MH 2ZJQA 4IFDJ 1HNWL 5LL6X 4X62L 2SEBD 3B6YA 2KEEA 2X6LA 2ZTEA 4I65A 3EQLC 4YIJA 1EQRA 2XRQD 3EROA 5IP7G 3HOZB 1A63A 2EVBA 5C3EG 1V43A 2QDBA 3LWUA 5IYCG 1HJPA 5G3LD 1WI5A 3BVZA 3KDFA 4L5RC 4WJWA 3H0GG 5CGKA 5G3LF 2B63B 1YITA 3S9WA 5AJ3Q 4UDUC 1I94Q 4L5TA 2F0NA 2XNAC 1KXLA 5BN5A 5BR8L 2L55A 4ZUIA 1NSNS 3AB9A 4AQYQ 4DV0L 4RKBA 1HXYD 1O7IA 1I3QH 5ELCA 2ZTDA 4GOPA 5FO7B 4N9PA 3C2PA 3WDNA 5CV8A 2K03A 5JEAG 1K8OA 5C0XH 1PFBA 3I70A 3FKIB 1QUQA 1O7ZA 4ZQ3A 2ZTCA 4QUFA 1CA5A 4M1UB 2IL8A 1F2YA 1HPCA 1PTOD 3H0GH 4PV1C 2PQEA 4A3IH 5EKKA 3P20A 2NB0A 5C44G 2LXKA 2JSOA 1Q46A 4RG1A 2PZWA 5M5XH 4EQNA 2P5ZX 5C4JH 4PNYA 3MXGA 3PIO3 4KHPL 5GAEC 2E2HH 4ME5A 2OQ0A 4LF7Q 4DUZQ 3CF5A 4G7OC 4IUQA 3PUXA 5IGEA 4A3EG 2MHVA 4KY7A 3G71A 1L1OB 5L37A 4WFN3 4QQBX 3OSOA 2I0QA 3KK7A 3E6ZX 2LSSA 4C2MB 3PIPA 2D0PA 1BQQT 1CHPD 2Z6KC 1VQ9A 5C3EH 3A7LA 4OIKA 1ML0D 2R61A 4G57A 1WOCA 1EUJA 5D65A 3S17H 3HOZG 5M5YH 5E7NA 2Z4IA 4KMUC 1WTRA 2JA6H 2UXCQ 2MQHA 2F3WA 3K0YA 1A8VA 1EY5A 1TWFB 1C4QA 4U68A 1SMYD 2XN9C 3K0XA 3W3AA 1N33Q 4DR6L 3AEVA 4N8X1 5FJ8H 2Z0SA 2DY8A 2SNSA 4YCUA 2QKIC 2I46A 2VS1A 1Y1VB 3NUCA 1AE3A 1WTOA 2QDLA 2A68C 3VR2A 2MP1A 3G6EA 1YVCA 1DJRD 3BJUA 3HEJA 2WAQE 3GV3A 1EZ8A 1NMGA 3ULJA 5C3XA 3VDYA 1CUKA 3ER0A 5DLQE 3W1GA 2AMCB 2O4XA 1NAPA 2Z4HA 4DKAC 3HOUH 2HQEA 2F0LA 5DAUA 4NXNL 1OXXK 5IY0A 2O2LD 2IW3A 1JR0D 2WB1G 1YJ9A 1BCPB 1UEBA 2F0DA 2Z9HA 5I4DA 1TWCB 2KVMA 2HCIA 1VQHA 3FMCA 1WJJA 2E75C 1I3QB 2CKZB 4FXKC 2VUMG 3MEFA 2FINB 1IL8A 4LF8L 5IT9E 3DM1A 3X3NA 1DCZA 4ZYSA 2JQOA 1KRSA 2M00A 4O42A 4CBVA 3RLFA 3Q24A 2BCOA 3HKSA 1B7YB 4C3IH 5IYBG 1I50B 4IFDI 1FD7D 4Q5VA 4DAVA 3LNNA 2R93B 1YNJC 2EJFC 4DF7A 3SEBA 5IIFA 2DN8A 4QB4A 4R4CA 1VMPA 1EFWA 5M5XB 1LUZA 4J6HA 4X62Q 4IQZA 1D6EC 1QVFA 4LUVA 4RWSC 1H9SA 2YTVA 1X6OA 3K6OA 3CCUA 3NTIA 4HIKA 1PFMA 4YCWA 5M3MB 4OX9L 1LTAD 1QNUA 1HA5A 2Q2UA 3A7AB 1ESFA 5C4XB 3VR4A 3SK6A 1VQJA 3I2ZA 5JPMC 3ICEA 4LFBL 3GTLB 4CKCA 2Z6KA 1I6HH 1YNJD 4LFCL 4KK7A 1TR5A 3J7AF 4CKBA 1B1ZA 4BBRH 4Y52H 4FVMA 1A3TA 5AFWA 2D5DA 3HRZC 4YCVA 2A19A 4A3DG 4NXML 1B4OA 1SDFA 1FL0A 1H9KA 3GTQB 2QF7A 4HJ7A 1C0AA 2DJFC 2CFMA 4DV5Q 3KLSA 1YBYA 4A3FG 3SK8A 4B9WA 3LX0A 5C3WA 3CCMA 1YZ6A 2AQ3B 2BA1A 2XWJB 1Y8NB 3URYA 2JA5B 3M4YA 4RGMA 2F0KA 2QILA 1SYBA 3HFZB 4RHSA 2JK8A 4L8JA 3VYRA 2VW9A 4A3BB 4A93B 3CP0A 4DK0A 4DV7L 2K5HA 3FPPA 2L5TA 3D6WA 1VQKA 3QWNA 1EY6A 4A3IB 4JI1L 2CW0D 4CJ0B 4DV2L 1PRTB 3NBHB 4KJOA 1TWCH 1PFNA 1IL2A 3NTKA 1CZWA 2FJ2A 3UDIA 1I6VC 3GTKH 4A3FH 4C3JG 1XTCD 3CCRA 1C9OA 1M8AA 3IRBA 2A69D 1LM0A 1DONA 3DUZA 3HKZB 2ID0A 2WAQB 1C7YA 5J1ZA 2UXDQ 2G5DA 3DEOA 4NP5A 4C3IB 2N8NA 3VR5A 5IWAQ 5JAVA 5M3MG 5COYA 3W1BA 1OXTA 2K5NA 1N34L 3HOWG 3VA5A 2B39A 1E1TA 1DGSA 3HS0C 4QIWB 4ZLTF 5LHY1 1IBLL 1ICFB 4ZKBB 1EQTA 3DHQA 4R4IA 5I6YA 2ZM6Q 1LLRD 3T1YQ 3PQIA 3D3RA 2RQXA 4A3BG 3C1EA 2R92B 2UUCL 1ICWA 2LXJA 1X3EA 5C0XJ 3AQQA 3T1HQ 2EXZA 3ND9A 4MNOA 4EX5A 3A56A 2B2WC 1P16A 2KJXA 3RZDH 1KNAA 1DOKA 4DV6Q 4OGQC 2E2IB 4LF5L 1SRUA 1D5ZC 1B9NA 3UI2A 1VQBA 2RKSA 1AFPA 3I8ZA 5CMDA 1H9SB 2KHIA 1X9NA 1EY0A 5FLXL 4C3IG 5IYBH 2IX3A 3JAME 5H1SE 1P8LA 3H09A 4LMQD 2HDLA 4ILWA 3BG3A 1EY4A 1X54A 4HSPA 4R1JA 2F4VL 1PTOB 3S16H 1SNOA 4A3CG 5C44B 1V1QA 4A3LH 4CDEC 2K7VA 2ZJRA 3AU7A 4O1NA 1MIUA 1RIPA 3DEPA 3KLWA 4JBJA 2I5HA 5ELDA 2Q2TA 2R7ZG 3MXUA 5K5PA 1VQFA 5E4XA 4DN4M 1PMRA 1QWYA 4S3SA 1J5EL 4YHHQ 3X3MA 2F0JA 1KRTA 3OTOL 3GTPH 5IGFA 3S15H 2C5CA 2M9VA 1XMQQ 1A2UA 1MJCA 1EIGA 2A1AA 1JC7A 2F0TA 3NXWA 1S5DD 4X3SA 1Q86C 3BVGA 3BZKA 3OOCA 3RD4A 1Q3LA 1LTSD 1D8LA 4A3FB 3BYTB 1BCPF 2F0SA 4FP5D 2XTIA 1BCPD 4F87A 1NNXA 3CPWA 2F0GA 1BVSA 1HZBA 1GOZA 4DAYB 1YJWA 1IZ6A 4JOIA 4TQUS 5GROA 3Q22A 1J8IA 4CDFC 4QGUA 2UUAQ 1IBML 1I4RA 1WYDA 1SNQA 4LW1A 3NENA 4B08A 4C3JH 4X66Q 3K5MA 1TY2A 4I7AA 3GO5A 2B2VA 4QF4A 4X64Q 1UWVA 5ISRA 2K33A 4HMIA 1EZ6A 1DYQA 3U4VA 5EPJA 2B3GA 1O78A 1NR4A 5ELNA 1XWEA 1I4PA 1BCPC 1NE3A 4DUYL 4POGA 3S17B 3HKZG 5M3FH 4F88A 3MHBA 4X65L 5K36H 2HQLA 2QW7A 2F0EA 2FHTA 3F2BA 2KEDA 5D3DA 2R7DA 1JQYD 1E7ZA 2F0VA 4JV5L 1Z7TA 2ENBA 1X3QA 2RHQB 4DR7L 1L1OA 4JPBW 1VQ7A 1LO5D 4N9TA 1Q1BA 4TSSA 1IBKQ 4BBRG 3ONAB 5JJLA 4KY5A 4Y7NB 3M4OB 1FYCA 3NP8A 3CMEA 2K4KA 5FLMH 3OWFA 5C5LA 2E5LL 1JWSD 5C4XG 1G51A 1M1KC 4B3SQ 4AYBG 4BBSH 2RDGA 1BO0A 2C9OA 2NZOA 2D2CC 1QUQB 1WCMH 2IJ0A 4JI6Q 4XXEA 4G7HC 1GUTA 3HG9A 3DWAA 3PF4A 3H3VI 1EL0A 3TS2A 3SVMA 2CHBD 3J81L 3PUVA 2ICIA 4RGOS 1ZYRD 5CV6A 5FO9B 1I4XA 1E1OA 5I6WA 2NVQB 5CR3A 4XQJA 1NBWA 3AFQA 1N34Q 1D7QA 3S1NB 2VQEQ 4JW0A 4HIDA 4E6IA 3E9IA 4NDXA 2D62A 1SJHD 2WAQG 3I73A 4OXPA 3RLNA 2Q8TA 1XXGA 3M9BA 5IT9c 2PZTA 3PUWA 1TKWB 4BXXG 1UUPA 2AQ2B 3VYSA 4A76A 3ZJYC 1GUSA 1EWCA 1JE5A 2FXQA 1DXMA 2PW7A 1QE6A 4J15A 4K2KA 3KFUA 1K8AC 2DNEA 5A2QL 2TSSA 3A5UA 4U673 3GTGB 1KL9A 3DMUA 3GTJH 3F8TA 1HRJA 3D4DA 4R4OA 5KNDA 1CTMA 3S1RH 1CQVA 4C3HG 2EZVA 1K3RA 2DY7A 4ABNA 1PTOC
chains in the Genus database with same CATH topology
1PH1A 2JA6G 1WOCA 2VZAA 1EUJA 1BKBA 3S17H 3HOZG 5M5YH 4P74A 5E7NA 5HGQA 1EWIA 4OWTB 2JA6H 4GKKL 2UXCQ 2MQHA 4DV5L 3PSIA 4XTCS 3M3YH 1N32Q 2MFIA 4HJAA 2JJQA 1GM5A 1A8VA 3CD6A 4GLXA 4C3HH 4JI5Q 3CMAA 2HIXA 3K0XA 3UDXA 1N33Q 4DR6L 4GNXC 3AEVA 1VQAA 2L15A 2VY3A 2PMZE 1FJGQ 1VQPA 5FJ8H 2Z0SA 1Y1VH 4JBWA 4YCUA 4GOPC 4LF4L 1HNWQ 2WP8J 2VS1A 1AE3A 2MO1A 1PYSB 2Y0SE 3Q8DA 1PH8A 4DR7Q 3G6EA 1YVCA 4A3JH 1N32L 2R93G 3BJUA 2AKWB 2WAQE 1N9WA 3L0OA 1GD7A 4IPDA 2QEXA 3CCVA 1HNZL 4JI4Q 1NMGA 3ULJA 3VDYA 1UE7A 1CUKA 4JI7Q 1IXRA 3HOYG 3K80C 3ER0A 5DLQE 3W1GA 4JC0A 3PO2H 2JA9A 2AMCB 3J81c 4A3BH 2K50A 4DKAC 1CSPA 3CC7A 3HOUH 4BXXH 4NXNL 1YHQA 1JMCA 4A4IA 4APVA 1OXXK 2NN6G 3I4OA 5IY0A 2V1CC 1HNXQ 2WB1G 3J81i 1GKHA 1QZGA 4HJ8A 1YJ9A 2R7ZH 4PZ8A 3HOWH 1UEBA 1XPRA 1OXUA 3PF5A 5FJ8G 1NMFA 3PO2G 4GKJL 5C44H 3EBEA 1VQHA 2N3SA 2E8GA 4LF7L 2ALYB 3I4MG 3PCOB 1WJJA 1KC8C 1UE5A 4B3TL 1XTDA 2CKZB 2VUMG 1JJCB 2IHEA 4DV4L 4UP7A 4QJFA 1LYLA 4JG2A 3MEFA 1HR0W 4RMFA 4DK6C 4LF8L 4A93H 4A93G 2ATWA 1XNQL 2JQOA 1KRSA 4GN3B 3RLFA 2Y0SG 2QGQA 3HKSA 1B7YB 4C3IH 5IYBG 4BY7G 4IFDI 1Y1VG 3ULLA 1BBWA 3LGJA 1PH4A 3I4MH 3JAMi 1VQNA 3CW2C 1X65A 4NXMQ 4B3ML 4O0AA 1TXYA 4JI3L 4A3CH 3PV0A 4LF9Q 2KCTA 2AWOA 1VQDA 4KLKA 2R93H 4R4CA 5LMNL 1SFOH 4JI2Q 2UU9Q 1Q81C 3UDGA 1EFWA 1N33L 3S14H 3A74A 1LUZA 4B3MQ 4X62Q 4IFDG 4QY7A 2UUBL 1L1OC 4LUVA 1QVFA 3HOVH 4DR2Q 2YTVA 1X6OA 1WCMG 2UXCL 3CCUA 4DV0Q 2VNUD 3OTOQ 4HIKA 2NZHA 1VCIA 1MJEA 2OCEA 1J5EQ 1XNQQ 1H95A 4YCWA 4UP8A 3PIOA 4OX9L 2I5LX 1W2BA 2Q2UA 1IBMQ 1S3OA 3I56A 2XGTA 4DK3C 4JI6L 3M4OH 2UXBL 2IY5B 1ASZA 1VQJA 3I2ZA 3SGIA 3ICEA 1JB7A 2C35B 4LFBL 1UE1A 2Z6KA 3FKIG 3OYYA 5LMUQ 1CKNA 1I6HH 4LFCL 1Q8KA 2RHSB 2AWNA 3A5ZB 3RN5A 2EQSA 4YWMA 1U0LA 3UE0A 4BBRH 2E5LQ 4IPHA 4Y52H 2HHHL 1QVGA 4IJHA 1VQ8A 4GNXB 2F4VQ 1XMOQ 4BA1I 2PQAA 1PH6A 2PI2A 1A0IA 4YCVA 4X66L 2A19A 2GVBA 4GNXA 2OWOA 5IYDG 1K8GA 3CCJA 4A3DG 4NXML 4JYAQ 4A3EH 1AH9A 1FL0A 4IO9A 4HJ7A 1C0AA 4WJ4A 4JI7L 4ME3A 2CFMA 1SE8A 1KHIA 1TWGH 1CKNB 4DV5Q 3J81j 1YBYA 3TS0A 1NJIC 1HNZQ 4EQ5A 4MTNA 4A3FG 2NVTH 4GS3A 2A8VA 3CCMA 1YZ6A 1SROA 2BA1A 3NELA 1W3SA 4XIGS 4UY8C 3H15A 4LF4Q 2F3IA 3HFZB 1BBUA 2JK8A 1HZAA 2JA8G 2VW9A 3FHWA 1JJ2A 3HOVG 4GKJQ 1OXVA 1SR3A 1VQEA 3CP0A 4DV7L 4QIWE 4A3KH 1KD1C 2K5HA 4YY3L 4BY1H 1KAWA 5IP7H 4LF6L 1NY4A 2H5XA 1VQKA 4L5QA 4A3KG 4JI8Q 1N36Q 4JBKA 4A3GH 4JI1L 2VUMH 2YV5A 1Z9FA 4KHPQ 4KHZA 4YHHL 4DV2L 1VQ4A 3NBHB 2VQFQ 1A62A 2BA0A 3S1MH 3CCLA 2CCZA 1TWCH 3W5OA 2KENA 1IL2A 3UDIA 2RF4A 3KJPA 1IBLQ 3U4ZA 1VQMA 3GTKH 4A3FH 1Z47A 3RLOA 3CCRA 4IOCA 4X6AH 1J6QA 1QVCA 5K36G 2IX1A 1C9OA 3IRBA 5M5WH 1LM0A 2B63G 2ID0A 1KIXA 4P75A 1OXSC 3BU2A 1C7YA 2UXDQ 3K8AA 5IWAL 4DV6L 2JA8H 3DLLA 1Y14B 2N8NA 5IWAQ 5M3MG 2JEAI 2R6GA 2OQKA 3CC2A 1YJNA 4AYBE 3U58A 3W1BA 1Q82C 2NVQH 1OXTA 4DR4L 3J80c 3S2HH 2EXDA 2K5NA 5C4XH 1N34L 3PO3H 4PZ7A 4POFA 3HOWG 1E1TA 1DGSA 1PFSA 3I7FA 4R4TA 1CKOA 1CSQA 3GTLH 1IBLL 4DPGA 4OONA 3M7NA 4IOAA 2UUCQ 1OTCA 1VQCA 4R4IA 4L5SA 5BR8Q 3J80i 3KJOA 4DV1L 2B29A 2F52A 4LUZA 4PZ6A 2ZM6Q 1AE2A 3T1YQ 1PYBA 2R92H 4DR3Q 3TRZA 2YTYA 4A3BG 1TWFH 2PQAB 5IP9H 3HOYH 4BBSG 2OTJA 5IE8A 3D0FA 1FGUA 1G6PA 4LNQA 3CCQA 2UUCL 1IYJB 2LXJA 1VQ5A 1JT8A 1X3EA 4YWLA 4FDBA 5C0XJ 3AQQA 1E24A 2VQEL 2HT1A 3T1HQ 1B70B 2OTLA 4MNOA 5M3FG 1UE6A 1X3FA 4EX5A 4DR4Q 4LFAQ 2CWAA 1P16A 1VQGA 5EAYA 1CKMA 4A75A 4AQYL 3RZDH 3K7AH 4DV6Q 4GN5A 2VL6A 1K0RA 4P73A 1K9MC 5GAGC 4LF5L 4A3MH 2KBNA 1YI2A 1K83H 1SRUA 3F1ZA 1E22A 1Q12A 4BA2I 1XNRQ 1B8AA 1VQBA 3A0JA 4C2MH 4Y7NH 4HIMA 1GO3E 2KHIA 1X9NA 1YIJA 2CQOA 5IYBH 4HIOA 1L0WA 2IHFA 5H1SE 1P8LA 4DR5L 3HOZH 3L7ZC 1N8RC 3WWVA 1XNRL 4JOIC 3L2PA 4B3SL 2D0OA 2E2JH 4OWWB 1X54A 1EIFA 2JEBI 2WB1E 4R1JA 4JI1Q 2F4VL 1VQ6A 3S16H 3G48A 1SLJA 2YYZA 3KOJA 1HH2P 3H3VH 1SMXA 2RCNA 4A3CG 1V1QA 1YHBA 4A3LH 3GDEA 4A3MG 2ZJRA 4OWXB 2YU9H 3KF8B 2KCMA 4GN4B 1MIUA 1RIPA 5ELOA 3CCEA 1PH2A 2BH2A 4NPSA 2MO0A 1EQQA 1X3GA 3KLWA 4JBJA 4LWCA 2ES2A 2JA5H 2R92G 4OO1I 2I5HA 1IBKL 4LFBQ 2Q2TA 3T1HL 2R7ZG 3KF6A 5J3BA 1FVIA 1VQFA 5HY6A 2JA7H 4IPGA 2DUDA 2IX0A 3BZCA 4DV3Q 1J5EL 4YHHQ 1KRTA 5JJKA 3T1YL 3OTOL 4MZ9A 1I94L 3GTPH 3I4NG 3S15H 4K0KL 5AJ3L 1XMQQ 1Q7YC 1N36L 3S1NH 1MJCA 4H02A 1RL2A 1U5KA 2A1AA 2K5VA 4DUYQ 4DR1Q 1V9PA 2N78A 3JC66 4BY7H 4B3RQ 1XJVA 3PGZA 1Q86C 2UU9L 3BZKA 1VQOA 4JI2L 3MXNB 3CCSA 1PH5A 2KHJA 1D8LA 1HR0Q 4BY1G 4JI0Q 4P71A 2HHHQ 3GTMH 1YNXA 1VQIA 1QZHA 2XTIA 1XPOA 1M90C 1HR0L 1YEZA 2JA5G 1WFQA 2CWPA 4JBMA 2UXDL 4AH6A 3F2CA 5LMNW 3CPWA 3RNUA 3UE1A 2DGYA 2JE6I 1BVSA 5LMUL 1HZBA 3I4NH 4B3RL 4DAYB 5GADC 3CAMA 1YJWA 1EYGA 4YWKA 4A3LG 1IZ6A 4JOIA 4DR1L 1PV4A 2AHOB 4TQUS 2UUAL 5GROA 1NTGA 3TQYA 5IYCH 3D31A 3S2DH 4A3GG 2UXBQ 2JA7G 2UUAQ 4QGUA 2EIFA 3FP9A 4K0KQ 4DV4Q 1IBML 1WYDA 3E9HA 3RZOH 2K75A 4JYAL 4JV5Q 4LW1A 4OO1G 4LF5Q 3HKZE 3NENA 4C3JH 1EIYB 4DV3L 4X66Q 3HOUG 2WFWA 4LUOA 3GO5A 4X65Q 2E2IH 4X64Q 1I50H 1UWVA 2NVYH 4DR2L 3GTOH 4JI8L 1Y1WG 4QL5A 4AIMA 3PO3G 3NEMA 2QA4A 1MKHA 3CC4A 2BH8A 3U4VA 4LFCQ 1PH7A 2B3GA 2PI2E 4P72A 4TVAB 3PUZA 5ELNA 3STBC 3J7A5 4DV7Q 4WJ3M 3GD7A 5LMNQ 3ULPA 1PH9A 5JJIA 3RN2A 1NE3A 4DUYL 1S72A 4POGA 1JJGA 4NXNQ 3HKZG 3G4SA 3M85A 5M3FH 4X64L 1VQLA 1I5FA 3ERSX 1R9TH 4KI0A 4X65L 3AFPA 2HQLA 3F2BA 5JEAJ 3JAMc 3HOXH 4HJ9A 4OX9Q 2R7DA 1S40A 3K7UC 3AYHB 1E7ZA 4O2DA 3GTGH 2GN5A 4DR5Q 5IYDH 4JV5L 1PH3A 1L2FA 3TREA 1X55A 2RHQB 4DR7L 3RR5A 5GAHC 1L1OA 1ASYA 1VQ7A 4LF8Q 1T9HA 5M3MH 2UUBQ 2ZJQA 1Q1BA 1G291 2ZJPA 4BBRG 1IBKQ 4IFDJ 2HIVA 1HNWL 3K81C 5JJLA 4X62L 3B6YA 4B3TQ 2ZTEA 2R7FA 2Q2HA 1EQRA 4DR6Q 5IP7G 1XMOL 3CMEA 4JI5L 2K4KA 3STBD 5FLMH 1A63A 2NVXH 3EIVA 4JI0L 2I5MX 5C3EG 2E5LL 1V43A 5C4XG 1G51A 1GVPA 5IYCG 5FLXc 1M1KC 4B3SQ 1HJPA 4NB3A 4AYBG 1XPUA 1WI5A 3KDFA 4L5RC 1PA6A 4DNIA 5IP9G 4IPCA 1TWAH 4HJ5A 4BBSH 1TWHH 3H0GG 2NZOA 1QUQB 1WCMH 1LTLA 3E0EA 4JI6Q 1YITA 1XMQL 1E3PA 4PG3A 5AJ3Q 2VQFL 2B63H 2Q2IA 1I94Q 3PF4A 4L5TA 4DV2Q 4DR3L 3GTQH 3H3VI 2MNAA 3TS2A 2YTXA 1KXLA 3CQZH 4DV1Q 4GOPB 1PVOA 5BR8L 3PUVA 1E1OA 4AQYQ 4DV0L 3EN2A 4LF6Q 2PNHA 1K73C 1O7IA 1I3QH 1NBWA 4A3IG 4DUZL 1X56A 3AFQA 1N34Q 1D7QA 2IT1A 3HOXG 1SN8A 2K52A 2ZTDA 4GOPA 2VQEQ 4HIDA 1PHJA 3FKIH 5JEAG 3DM3A 3E9IA 1FJGL 3TEHB 4LF9L 2D62A 2WAQG 5C0XG 4JI3Q 3KYHC 4OXPA 3RLNA 3OW2A 1QUQA 1Q1EA 4GLAC 3M9BA 2K14A 5IT9c 2ZTCA 3PUWA 2ZM6L 3S1QH 4BXXG 4JI4L 4A3DH 3H0GH 3U50C 3KDFB 3M4QA 3CXCA 4IJLA 4A3IH 5GQOA 4DAMA 4A76A 1Y1WH 3PUYA 5C44G 2LXKA 3S24A 3ZJYC 1Q46A 4RG1A 1JE5A 3CPFA 3F2DA 2ASBA 1EOVA 2FXQA 4R4QA 4JCVE 5M5XH 5C4JH 4J15A 5FLMG 3M4PA 4KHPL 5GAEC 2E2HH 2NN6I 2OQ0A 4GLVB 3KFUA 1K8AC 4LF7Q 1HZ9A 4DUZQ 3A5UA 3CF5A 3UDFA 3PUXA 4A3EG 1KL9A 3GTJH 3KF6B 3F8TA 3I55A 3G71A 1VS0A 1KQSA 1L1OB 4YY3Q 4LFAL 4UPAA 4ALPA 4QQBX 4R4OA 2I0QA 2LSSA 4PMWA 3S1RH 3PIPA 4GKKQ 2D0PA 1YHAA 2N49A 1K3RA 1HNXL 1VQ9A 1HZCA 2Z6KC 5C3EH 5C0XI 4UP9A 4A3JG 3J7ZC 2GVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH1 A;  2JA6 G;  1WOC A;  2VZA A;  1EUJ A;  1BKB A;  3S17 H;  3HOZ G;  5M5Y H;  4P74 A;  5E7N A;  5HGQ A;  1EWI A;  4OWT B;  2JA6 H;  4GKK L;  2UXC Q;  2MQH A;  4DV5 L;  3PSI A;  4XTC S;  3M3Y H;  1N32 Q;  2MFI A;  4HJA A;  2JJQ A;  1GM5 A;  1A8V A;  3CD6 A;  4GLX A;  4C3H H;  4JI5 Q;  3CMA A;  2HIX A;  3K0X A;  3UDX A;  1N33 Q;  4DR6 L;  4GNX C;  3AEV A;  1VQA A;  2L15 A;  2VY3 A;  2PMZ E;  1FJG Q;  1VQP A;  5FJ8 H;  2Z0S A;  1Y1V H;  4JBW A;  4YCU A;  4GOP C;  4LF4 L;  1HNW Q;  2WP8 J;  2VS1 A;  1AE3 A;  2MO1 A;  1PYS B;  2Y0S E;  3Q8D A;  1PH8 A;  4DR7 Q;  3G6E A;  1YVC A;  4A3J H;  1N32 L;  2R93 G;  3BJU A;  2AKW B;  2WAQ E;  1N9W A;  3L0O A;  1GD7 A;  4IPD A;  2QEX A;  3CCV A;  1HNZ L;  4JI4 Q;  1NMG A;  3ULJ A;  3VDY A;  1UE7 A;  1CUK A;  4JI7 Q;  1IXR A;  3HOY G;  3K80 C;  3ER0 A;  5DLQ E;  3W1G A;  4JC0 A;  3PO2 H;  2JA9 A;  2AMC B;  3J81 c;  4A3B H;  2K50 A;  4DKA C;  1CSP A;  3CC7 A;  3HOU H;  4BXX H;  4NXN L;  1YHQ A;  1JMC A;  4A4I A;  4APV A;  1OXX K;  2NN6 G;  3I4O A;  5IY0 A;  2V1C C;  1HNX Q;  2WB1 G;  3J81 i;  1GKH A;  1QZG A;  4HJ8 A;  1YJ9 A;  2R7Z H;  4PZ8 A;  3HOW H;  1UEB A;  1XPR A;  1OXU A;  3PF5 A;  5FJ8 G;  1NMF A;  3PO2 G;  4GKJ L;  5C44 H;  3EBE A;  1VQH A;  2N3S A;  2E8G A;  4LF7 L;  2ALY B;  3I4M G;  3PCO B;  1WJJ A;  1KC8 C;  1UE5 A;  4B3T L;  1XTD A;  2CKZ B;  2VUM G;  1JJC B;  2IHE A;  4DV4 L;  4UP7 A;  4QJF A;  1LYL A;  4JG2 A;  3MEF A;  1HR0 W;  4RMF A;  4DK6 C;  4LF8 L;  4A93 H;  4A93 G;  2ATW A;  1XNQ L;  2JQO A;  1KRS A;  4GN3 B;  3RLF A;  2Y0S G;  2QGQ A;  3HKS A;  1B7Y B;  4C3I H;  5IYB G;  4BY7 G;  4IFD I;  1Y1V G;  3ULL A;  1BBW A;  3LGJ A;  1PH4 A;  3I4M H;  3JAM i;  1VQN A;  3CW2 C;  1X65 A;  4NXM Q;  4B3M L;  4O0A A;  1TXY A;  4JI3 L;  4A3C H;  3PV0 A;  4LF9 Q;  2KCT A;  2AWO A;  1VQD A;  4KLK A;  2R93 H;  4R4C A;  5LMN L;  1SFO H;  4JI2 Q;  2UU9 Q;  1Q81 C;  3UDG A;  1EFW A;  1N33 L;  3S14 H;  3A74 A;  1LUZ A;  4B3M Q;  4X62 Q;  4IFD G;  4QY7 A;  2UUB L;  1L1O C;  4LUV A;  1QVF A;  3HOV H;  4DR2 Q;  2YTV A;  1X6O A;  1WCM G;  2UXC L;  3CCU A;  4DV0 Q;  2VNU D;  3OTO Q;  4HIK A;  2NZH A;  1VCI A;  1MJE A;  2OCE A;  1J5E Q;  1XNQ Q;  1H95 A;  4YCW A;  4UP8 A;  3PIO A;  4OX9 L;  2I5L X;  1W2B A;  2Q2U A;  1IBM Q;  1S3O A;  3I56 A;  2XGT A;  4DK3 C;  4JI6 L;  3M4O H;  2UXB L;  2IY5 B;  1ASZ A;  1VQJ A;  3I2Z A;  3SGI A;  3ICE A;  1JB7 A;  2C35 B;  4LFB L;  1UE1 A;  2Z6K A;  3FKI G;  3OYY A;  5LMU Q;  1CKN A;  1I6H H;  4LFC L;  1Q8K A;  2RHS B;  2AWN A;  3A5Z B;  3RN5 A;  2EQS A;  4YWM A;  1U0L A;  3UE0 A;  4BBR H;  2E5L Q;  4IPH A;  4Y52 H;  2HHH L;  1QVG A;  4IJH A;  1VQ8 A;  4GNX B;  2F4V Q;  1XMO Q;  4BA1 I;  2PQA A;  1PH6 A;  2PI2 A;  1A0I A;  4YCV A;  4X66 L;  2A19 A;  2GVB A;  4GNX A;  2OWO A;  5IYD G;  1K8G A;  3CCJ A;  4A3D G;  4NXM L;  4JYA Q;  4A3E H;  1AH9 A;  1FL0 A;  4IO9 A;  4HJ7 A;  1C0A A;  4WJ4 A;  4JI7 L;  4ME3 A;  2CFM A;  1SE8 A;  1KHI A;  1TWG H;  1CKN B;  4DV5 Q;  3J81 j;  1YBY A;  3TS0 A;  1NJI C;  1HNZ Q;  4EQ5 A;  4MTN A;  4A3F G;  2NVT H;  4GS3 A;  2A8V A;  3CCM A;  1YZ6 A;  1SRO A;  2BA1 A;  3NEL A;  1W3S A;  4XIG S;  4UY8 C;  3H15 A;  4LF4 Q;  2F3I A;  3HFZ B;  1BBU A;  2JK8 A;  1HZA A;  2JA8 G;  2VW9 A;  3FHW A;  1JJ2 A;  3HOV G;  4GKJ Q;  1OXV A;  1SR3 A;  1VQE A;  3CP0 A;  4DV7 L;  4QIW E;  4A3K H;  1KD1 C;  2K5H A;  4YY3 L;  4BY1 H;  1KAW A;  5IP7 H;  4LF6 L;  1NY4 A;  2H5X A;  1VQK A;  4L5Q A;  4A3K G;  4JI8 Q;  1N36 Q;  4JBK A;  4A3G H;  4JI1 L;  2VUM H;  2YV5 A;  1Z9F A;  4KHP Q;  4KHZ A;  4YHH L;  4DV2 L;  1VQ4 A;  3NBH B;  2VQF Q;  1A62 A;  2BA0 A;  3S1M H;  3CCL A;  2CCZ A;  1TWC H;  3W5O A;  2KEN A;  1IL2 A;  3UDI A;  2RF4 A;  3KJP A;  1IBL Q;  3U4Z A;  1VQM A;  3GTK H;  4A3F H;  1Z47 A;  3RLO A;  3CCR A;  4IOC A;  4X6A H;  1J6Q A;  1QVC A;  5K36 G;  2IX1 A;  1C9O A;  3IRB A;  5M5W H;  1LM0 A;  2B63 G;  2ID0 A;  1KIX A;  4P75 A;  1OXS C;  3BU2 A;  1C7Y A;  2UXD Q;  3K8A A;  5IWA L;  4DV6 L;  2JA8 H;  3DLL A;  1Y14 B;  2N8N A;  5IWA Q;  5M3M G;  2JEA I;  2R6G A;  2OQK A;  3CC2 A;  1YJN A;  4AYB E;  3U58 A;  3W1B A;  1Q82 C;  2NVQ H;  1OXT A;  4DR4 L;  3J80 c;  3S2H H;  2EXD A;  2K5N A;  5C4X H;  1N34 L;  3PO3 H;  4PZ7 A;  4POF A;  3HOW G;  1E1T A;  1DGS A;  1PFS A;  3I7F A;  4R4T A;  1CKO A;  1CSQ A;  3GTL H;  1IBL L;  4DPG A;  4OON A;  3M7N A;  4IOA A;  2UUC Q;  1OTC A;  1VQC A;  4R4I A;  4L5S A;  5BR8 Q;  3J80 i;  3KJO A;  4DV1 L;  2B29 A;  2F52 A;  4LUZ A;  4PZ6 A;  2ZM6 Q;  1AE2 A;  3T1Y Q;  1PYB A;  2R92 H;  4DR3 Q;  3TRZ A;  2YTY A;  4A3B G;  1TWF H;  2PQA B;  5IP9 H;  3HOY H;  4BBS G;  2OTJ A;  5IE8 A;  3D0F A;  1FGU A;  1G6P A;  4LNQ A;  3CCQ A;  2UUC L;  1IYJ B;  2LXJ A;  1VQ5 A;  1JT8 A;  1X3E A;  4YWL A;  4FDB A;  5C0X J;  3AQQ A;  1E24 A;  2VQE L;  2HT1 A;  3T1H Q;  1B70 B;  2OTL A;  4MNO A;  5M3F G;  1UE6 A;  1X3F A;  4EX5 A;  4DR4 Q;  4LFA Q;  2CWA A;  1P16 A;  1VQG A;  5EAY A;  1CKM A;  4A75 A;  4AQY L;  3RZD H;  3K7A H;  4DV6 Q;  4GN5 A;  2VL6 A;  1K0R A;  4P73 A;  1K9M C;  5GAG C;  4LF5 L;  4A3M H;  2KBN A;  1YI2 A;  1K83 H;  1SRU A;  3F1Z A;  1E22 A;  1Q12 A;  4BA2 I;  1XNR Q;  1B8A A;  1VQB A;  3A0J A;  4C2M H;  4Y7N H;  4HIM A;  1GO3 E;  2KHI A;  1X9N A;  1YIJ A;  2CQO A;  5IYB H;  4HIO A;  1L0W A;  2IHF A;  5H1S E;  1P8L A;  4DR5 L;  3HOZ H;  3L7Z C;  1N8R C;  3WWV A;  1XNR L;  4JOI C;  3L2P A;  4B3S L;  2D0O A;  2E2J H;  4OWW B;  1X54 A;  1EIF A;  2JEB I;  2WB1 E;  4R1J A;  4JI1 Q;  2F4V L;  1VQ6 A;  3S16 H;  3G48 A;  1SLJ A;  2YYZ A;  3KOJ A;  1HH2 P;  3H3V H;  1SMX A;  2RCN A;  4A3C G;  1V1Q A;  1YHB A;  4A3L H;  3GDE A;  4A3M G;  2ZJR A;  4OWX B;  2YU9 H;  3KF8 B;  2KCM A;  4GN4 B;  1MIU A;  1RIP A;  5ELO A;  3CCE A;  1PH2 A;  2BH2 A;  4NPS A;  2MO0 A;  1EQQ A;  1X3G A;  3KLW A;  4JBJ A;  4LWC A;  2ES2 A;  2JA5 H;  2R92 G;  4OO1 I;  2I5H A;  1IBK L;  4LFB Q;  2Q2T A;  3T1H L;  2R7Z G;  3KF6 A;  5J3B A;  1FVI A;  1VQF A;  5HY6 A;  2JA7 H;  4IPG A;  2DUD A;  2IX0 A;  3BZC A;  4DV3 Q;  1J5E L;  4YHH Q;  1KRT A;  5JJK A;  3T1Y L;  3OTO L;  4MZ9 A;  1I94 L;  3GTP H;  3I4N G;  3S15 H;  4K0K L;  5AJ3 L;  1XMQ Q;  1Q7Y C;  1N36 L;  3S1N H;  1MJC A;  4H02 A;  1RL2 A;  1U5K A;  2A1A A;  2K5V A;  4DUY Q;  4DR1 Q;  1V9P A;  2N78 A;  3JC6 6;  4BY7 H;  4B3R Q;  1XJV A;  3PGZ A;  1Q86 C;  2UU9 L;  3BZK A;  1VQO A;  4JI2 L;  3MXN B;  3CCS A;  1PH5 A;  2KHJ A;  1D8L A;  1HR0 Q;  4BY1 G;  4JI0 Q;  4P71 A;  2HHH Q;  3GTM H;  1YNX A;  1VQI A;  1QZH A;  2XTI A;  1XPO A;  1M90 C;  1HR0 L;  1YEZ A;  2JA5 G;  1WFQ A;  2CWP A;  4JBM A;  2UXD L;  4AH6 A;  3F2C A;  5LMN W;  3CPW A;  3RNU A;  3UE1 A;  2DGY A;  2JE6 I;  1BVS A;  5LMU L;  1HZB A;  3I4N H;  4B3R L;  4DAY B;  5GAD C;  3CAM A;  1YJW A;  1EYG A;  4YWK A;  4A3L G;  1IZ6 A;  4JOI A;  4DR1 L;  1PV4 A;  2AHO B;  4TQU S;  2UUA L;  5GRO A;  1NTG A;  3TQY A;  5IYC H;  3D31 A;  3S2D H;  4A3G G;  2UXB Q;  2JA7 G;  2UUA Q;  4QGU A;  2EIF A;  3FP9 A;  4K0K Q;  4DV4 Q;  1IBM L;  1WYD A;  3E9H A;  3RZO H;  2K75 A;  4JYA L;  4JV5 Q;  4LW1 A;  4OO1 G;  4LF5 Q;  3HKZ E;  3NEN A;  4C3J H;  1EIY B;  4DV3 L;  4X66 Q;  3HOU G;  2WFW A;  4LUO A;  3GO5 A;  4X65 Q;  2E2I H;  4X64 Q;  1I50 H;  1UWV A;  2NVY H;  4DR2 L;  3GTO H;  4JI8 L;  1Y1W G;  4QL5 A;  4AIM A;  3PO3 G;  3NEM A;  2QA4 A;  1MKH A;  3CC4 A;  2BH8 A;  3U4V A;  4LFC Q;  1PH7 A;  2B3G A;  2PI2 E;  4P72 A;  4TVA B;  3PUZ A;  5ELN A;  3STB C;  3J7A 5;  4DV7 Q;  4WJ3 M;  3GD7 A;  5LMN Q;  3ULP A;  1PH9 A;  5JJI A;  3RN2 A;  1NE3 A;  4DUY L;  1S72 A;  4POG A;  1JJG A;  4NXN Q;  3HKZ G;  3G4S A;  3M85 A;  5M3F H;  4X64 L;  1VQL A;  1I5F A;  3ERS X;  1R9T H;  4KI0 A;  4X65 L;  3AFP A;  2HQL A;  3F2B A;  5JEA J;  3JAM c;  3HOX H;  4HJ9 A;  4OX9 Q;  2R7D A;  1S40 A;  3K7U C;  3AYH B;  1E7Z A;  4O2D A;  3GTG H;  2GN5 A;  4DR5 Q;  5IYD H;  4JV5 L;  1PH3 A;  1L2F A;  3TRE A;  1X55 A;  2RHQ B;  4DR7 L;  3RR5 A;  5GAH C;  1L1O A;  1ASY A;  1VQ7 A;  4LF8 Q;  1T9H A;  5M3M H;  2UUB Q;  2ZJQ A;  1Q1B A;  1G29 1;  2ZJP A;  4BBR G;  1IBK Q;  4IFD J;  2HIV A;  1HNW L;  3K81 C;  5JJL A;  4X62 L;  3B6Y A;  4B3T Q;  2ZTE A;  2R7F A;  2Q2H A;  1EQR A;  4DR6 Q;  5IP7 G;  1XMO L;  3CME A;  4JI5 L;  2K4K A;  3STB D;  5FLM H;  1A63 A;  2NVX H;  3EIV A;  4JI0 L;  2I5M X;  5C3E G;  2E5L L;  1V43 A;  5C4X G;  1G51 A;  1GVP A;  5IYC G;  5FLX c;  1M1K C;  4B3S Q;  1HJP A;  4NB3 A;  4AYB G;  1XPU A;  1WI5 A;  3KDF A;  4L5R C;  1PA6 A;  4DNI A;  5IP9 G;  4IPC A;  1TWA H;  4HJ5 A;  4BBS H;  1TWH H;  3H0G G;  2NZO A;  1QUQ B;  1WCM H;  1LTL A;  3E0E A;  4JI6 Q;  1YIT A;  1XMQ L;  1E3P A;  4PG3 A;  5AJ3 Q;  2VQF L;  2B63 H;  2Q2I A;  1I94 Q;  3PF4 A;  4L5T A;  4DV2 Q;  4DR3 L;  3GTQ H;  3H3V I;  2MNA A;  3TS2 A;  2YTX A;  1KXL A;  3CQZ H;  4DV1 Q;  4GOP B;  1PVO A;  5BR8 L;  3PUV A;  1E1O A;  4AQY Q;  4DV0 L;  3EN2 A;  4LF6 Q;  2PNH A;  1K73 C;  1O7I A;  1I3Q H;  1NBW A;  4A3I G;  4DUZ L;  1X56 A;  3AFQ A;  1N34 Q;  1D7Q A;  2IT1 A;  3HOX G;  1SN8 A;  2K52 A;  2ZTD A;  4GOP A;  2VQE Q;  4HID A;  1PHJ A;  3FKI H;  5JEA G;  3DM3 A;  3E9I A;  1FJG L;  3TEH B;  4LF9 L;  2D62 A;  2WAQ G;  5C0X G;  4JI3 Q;  3KYH C;  4OXP A;  3RLN A;  3OW2 A;  1QUQ A;  1Q1E A;  4GLA C;  3M9B A;  2K14 A;  5IT9 c;  2ZTC A;  3PUW A;  2ZM6 L;  3S1Q H;  4BXX G;  4JI4 L;  4A3D H;  3H0G H;  3U50 C;  3KDF B;  3M4Q A;  3CXC A;  4IJL A;  4A3I H;  5GQO A;  4DAM A;  4A76 A;  1Y1W H;  3PUY A;  5C44 G;  2LXK A;  3S24 A;  3ZJY C;  1Q46 A;  4RG1 A;  1JE5 A;  3CPF A;  3F2D A;  2ASB A;  1EOV A;  2FXQ A;  4R4Q A;  4JCV E;  5M5X H;  5C4J H;  4J15 A;  5FLM G;  3M4P A;  4KHP L;  5GAE C;  2E2H H;  2NN6 I;  2OQ0 A;  4GLV B;  3KFU A;  1K8A C;  4LF7 Q;  1HZ9 A;  4DUZ Q;  3A5U A;  3CF5 A;  3UDF A;  3PUX A;  4A3E G;  1KL9 A;  3GTJ H;  3KF6 B;  3F8T A;  3I55 A;  3G71 A;  1VS0 A;  1KQS A;  1L1O B;  4YY3 Q;  4LFA L;  4UPA A;  4ALP A;  4QQB X;  4R4O A;  2I0Q A;  2LSS A;  4PMW A;  3S1R H;  3PIP A;  4GKK Q;  2D0P A;  1YHA A;  2N49 A;  1K3R A;  1HNX L;  1VQ9 A;  1HZC A;  2Z6K C;  5C3E H;  5C0X I;  4UP9 A;  4A3J G;  3J7Z C;  2GVA A; 
#chains in the Genus database with same CATH topology
 2CH4 W;  2F0W A;  1BKB A;  5E4W C;  1STE A;  4P74 A;  4RCO A;  4OWT B;  2F0Q A;  2Z6B A;  2F03 A;  5EKI A;  4DV5 L;  4C3H B;  3PSI A;  3M3Y H;  1KDC A;  4AYB B;  2VB2 X;  4HJA A;  1GM5 A;  1N32 Q;  1A3U A;  4JI5 Q;  2K5D A;  4IUV A;  3UDX A;  1BR9 A;  2OEO A;  2PMZ E;  1VQP A;  4BS9 A;  1Y1V H;  4LF4 L;  2MO1 A;  5IOC A;  1U4L A;  3HZX A;  2NZ1 D;  1KLG D;  1SYC A;  2B2T C;  2QEX A;  2BDO A;  4JI4 Q;  4JI7 Q;  1K3B C;  1UE7 A;  1IXR A;  4A3M B;  1SNP A;  4BXX H;  1DZ1 A;  2PW5 A;  5LL6 S;  1JMC A;  4DNR B;  3MXN A;  1RCV D;  1HNX Q;  5M9O A;  3IKJ A;  1SMY C;  5J22 A;  3A8K E;  1S5F D;  1QZG A;  5EJW A;  1R4P B;  4PZ8 A;  4DXF A;  3HOW H;  5HGT A;  1I4G A;  3PF5 A;  3A54 A;  3I4N B;  3PO2 G;  4GKJ L;  3DWQ A;  2N3S A;  2ALY B;  4IUP A;  3PCO B;  2A68 D;  4K14 A;  3QJY A;  4DV4 L;  5JVG 3;  5A35 A;  1HQM C;  4JG2 A;  3N6R A;  5J39 A;  4A93 G;  1Q90 A;  3I90 A;  2ATW A;  4BY1 B;  2A6E D;  2JA8 B;  1EYD A;  5JEA H;  3ULL A;  1BBW A;  3LGJ A;  5EBD A;  2L0C A;  3KF8 A;  4FXG C;  3K59 A;  1IKM A;  1PH4 A;  3D8G A;  1B3A A;  3TDQ A;  3I3C A;  2NUC A;  4DK1 A;  4JI3 L;  1TXY A;  4WOR A;  3PV0 A;  3SDZ A;  4LF9 Q;  1TU2 B;  2R93 H;  2E2D C;  3D4R A;  4H7B A;  1Q81 C;  1STN A;  4B3M Q;  1F9R A;  2EPB A;  1MD2 D;  4IFD G;  2UUB L;  3D4W A;  3J80 L;  5C4H A;  1U4R A;  1ENF A;  1EYC A;  3K57 A;  2VNU D;  3HOV B;  2B2V C;  2NZH A;  1MJE A;  3K5O A;  1XNQ Q;  1H95 A;  4UP8 A;  3PIO A;  2I5L X;  4J1M A;  2A6E C;  1IBM Q;  1FNU A;  3S2H B;  2RSN A;  1STG A;  2CVR A;  5D14 A;  2XGT A;  5F2D A;  3I56 A;  4R9W A;  2IY5 B;  2C35 B;  1D2B A;  3RZO B;  1VMC A;  4C1N K;  3FKI G;  3K7A B;  4DA2 A;  4RHR A;  3PIP 3;  4IUU A;  4A3J B;  2AWN A;  3RN5 A;  3QR8 A;  2EQS A;  1K83 B;  5CV4 A;  4OEL B;  1QVG A;  4IJH A;  1VQ8 A;  4BBR B;  2JXM B;  1XMO Q;  1SBB B;  4KY6 A;  1ENA A;  2GVB A;  1F2Z A;  4KKS A;  4K5W A;  3FPU B;  5C5M A;  4XQQ A;  1TWG H;  1NJI C;  1CKN B;  1BF4 A;  1HNZ Q;  4ZUJ A;  1H9J A;  1F77 A;  1G2S A;  1W3S A;  4XIG S;  1WTV A;  4UY8 C;  2KQ3 A;  2F3I A;  1EY7 A;  1BBU A;  1HZA A;  1B9M A;  4GKJ Q;  4RH6 A;  1B44 D;  5IP7 H;  1NY4 A;  3TSS A;  1JB3 A;  5KYI A;  4A3K G;  4JBK A;  4A3G H;  4KHP Q;  1CI3 M;  2LS0 1;  1LTB D;  3CCL A;  1NUC A;  3W5O A;  4X6A H;  1AW7 A;  1J6Q A;  5C6A A;  5M5W H;  3FDT A;  5ELB A;  1OXS C;  3BU2 A;  2ZXR A;  1KAB A;  4DV6 L;  3DLL A;  1QOH A;  4JK1 C;  1Y8O B;  3KLR A;  3NQT A;  3CC2 A;  4AYB E;  1Q82 C;  4OEM B;  1LTR D;  3J80 c;  2EYM A;  2EXD A;  1EEI D;  4PZ7 A;  4IOA A;  2I07 B;  3M7N A;  3C3L A;  2UUC Q;  1OTC A;  1VQC A;  2WV6 D;  4KN7 C;  3S14 B;  4L5S A;  5BR8 Q;  2BDN A;  1V1P A;  4LUZ A;  2F52 A;  3OIQ A;  2RDH A;  1AE2 A;  2XVS A;  1TII D;  1CFM A;  1PYB A;  2YTY A;  3Q0A A;  5IE8 A;  1TS5 A;  2E74 C;  1FGU A;  1R4Q B;  2A69 C;  3CCQ A;  3L9A X;  2B2Y A;  1VQ5 A;  1EY9 A;  5KRU A;  2X69 A;  2HT1 A;  1E24 A;  2K5W A;  1B70 B;  1KLU D;  1UE6 A;  1X3F A;  2HCC A;  3DWP A;  4X3T A;  4QCL A;  4IUR A;  5CYU A;  3P7J A;  1VQG A;  5EAY A;  1CKM A;  3U9O A;  3PMF A;  1IW7 C;  2CQA A;  2VL6 A;  1K0R A;  2PO4 A;  5GAG C;  2KBN A;  1K83 H;  3QO2 A;  4R8N A;  4UHV A;  4MN3 A;  4X3K A;  3E5S A;  4Y7N H;  4ZK9 B;  3MFY A;  1YIJ A;  2CQO A;  1L0W A;  4R8I A;  2IHF A;  2XIW A;  3E0J A;  2E2J B;  3HOZ H;  1K28 A;  3L7Z C;  3TP6 A;  3WWV A;  4OO1 H;  2D0O A;  2E2J H;  2EDG A;  4HMJ A;  2JEB I;  3C1F A;  4JI1 Q;  2LY7 A;  3H3V H;  1SMX A;  1YHB A;  1TWH B;  3GDE A;  5KYL A;  1SND A;  2N88 A;  3HOY B;  3KF8 B;  1RTN A;  4GN4 B;  3WOE A;  1RJT A;  4X3U A;  5CV7 A;  3HOY H;  1JWM D;  4OO1 I;  2R92 G;  4XYO A;  1ILP A;  4HED A;  3RMH A;  4K6D A;  5I2Y A;  5HY6 A;  2WB1 B;  1AEX A;  2DUD A;  3BZC A;  2B2T A;  5DM6 3;  4MZ9 A;  1EY8 A;  5FOB B;  1N36 L;  3S1N H;  1CA6 A;  1V9P A;  1SFO B;  1Y69 U;  3PGZ A;  4BY7 B;  1ENC A;  3MXN B;  1PH5 A;  1G91 A;  1HR0 Q;  4P71 A;  5M5W B;  2EE1 A;  1YNX A;  2LKV A;  1YEZ A;  4ZCK A;  1WFQ A;  4JBM A;  3UE1 A;  2DGY A;  4B3R L;  1BXT A;  5GAD C;  1SNC A;  4DXG A;  1PV4 A;  1HFN A;  3S2D H;  5IYC H;  3TZU A;  3D31 A;  4A3G G;  4C56 C;  4K0K Q;  4DV4 Q;  4JYA L;  2K75 A;  4JV5 Q;  3FRP B;  4LF5 Q;  1EIY B;  4FNF A;  2NVY B;  4LUO A;  4X65 Q;  1I50 H;  2NVY H;  3L3O C;  1BBX C;  3H0G B;  3TP7 A;  2PYK A;  2K1B A;  2QA4 A;  1S5E D;  4P72 A;  3PUZ A;  5TSS A;  2VB3 X;  3ULP A;  5JJI A;  3AMU A;  1S72 A;  3G4S A;  1TWG B;  1ZXT A;  3HGB A;  4X64 L;  2QCP X;  2ZXP A;  4HJ9 A;  4EQP A;  3G6J B;  1O7Y A;  3K7U C;  5IYD H;  2K04 A;  3SR1 A;  1FNV A;  2XWB B;  1X55 A;  2K32 A;  3S1R B;  4LF8 Q;  2B8G A;  2RBM A;  1G29 1;  2ZJP A;  2HIV A;  3QG1 A;  2B2U C;  2J0T D;  3NBI A;  3TP8 A;  1KNE A;  1B53 A;  1S4Z A;  5DEH A;  2PCF B;  1XMO L;  2Z8L A;  4JI5 L;  2NVX H;  2I5M X;  2F0M A;  3NWT A;  2JA6 B;  3K5L A;  1G6Z A;  2BE5 D;  5FLX c;  1E0B A;  1TQO A;  4QMG A;  1PZI D;  4K5V A;  2BOS A;  2OXP A;  1PA6 A;  4DNI A;  1CT1 D;  5IP9 G;  4HJ5 A;  1TWA H;  1STB A;  5FLX E;  1TWH H;  1WTP A;  4DNT B;  1LTL A;  3E0E A;  2CH4 A;  1OO9 B;  1XMQ L;  1E3P A;  2Q2I A;  4A3E B;  2L1B A;  4DV2 Q;  4DR3 L;  3GTQ H;  1HFG A;  1QG7 A;  4F7X A;  5I9O A;  3QB3 A;  2RSO A;  1HUN A;  1MHW C;  4BWG B;  1K73 C;  5JPN C;  4A3I G;  3K58 A;  2IT1 A;  3HOX G;  1SN8 A;  2K52 A;  3IL8 A;  3KLS X;  3QOL A;  3VA7 A;  1QNK A;  2M2L A;  3DM3 A;  2BE5 C;  1ET9 A;  4LF9 L;  2Y0S B;  4KD3 A;  1G8Z D;  1U4P A;  5C0X G;  2A74 C;  3KYH C;  4JI3 Q;  3BDC A;  3H94 A;  3GTO B;  3S1Q H;  1KTK A;  4IUN A;  4A3D H;  3U50 C;  1SAP A;  4IJL A;  2SNM A;  3S1Q B;  1LAB A;  2EOT A;  3PUY A;  3S24 A;  2FFK B;  2ASB A;  1EOV A;  1D1K A;  1ZEQ X;  2KEC A;  1ZYR C;  4F8M A;  2NN6 I;  5DM7 3;  1TY0 A;  4ULL A;  4WRD A;  1HZ9 A;  3UDF A;  2EJG C;  4ALP A;  3TZD A;  2VXW A;  4GKK Q;  5COR A;  1HNX L;  1ET6 A;  1HZC A;  4UP9 A;  5C3E B;  1WTQ A;  2TMP A;  1PH1 A;  2JA6 G;  4RGN A;  3BZD B;  1S5B D;  5EKL A;  1LT3 D;  5HGQ A;  4GKK L;  4IAL A;  4DFA A;  4XTC S;  2JJQ A;  3CD6 A;  5HUR A;  2EY5 A;  5IT9 L;  1VQA A;  2B8F A;  1STH A;  2N55 A;  1GUG A;  4GOP C;  1SJE D;  2WP8 J;  4MTK A;  4LJZ C;  4PQX A;  3MFG A;  3K5N A;  1PRT D;  2Y0S E;  3RUZ A;  1PH8 A;  3FEW X;  4DR7 Q;  1I6H B;  4A3J H;  1N32 L;  4HCS A;  4DAY A;  1N9W A;  3L0O A;  3J81 E;  1HNZ L;  3CCV A;  1F9S A;  3EA6 A;  3R93 A;  2JA9 A;  3J81 c;  2K50 A;  3CC7 A;  1L0Y B;  4DU9 A;  4IFD H;  4C1N I;  1WD0 A;  5E1F A;  3J81 i;  2Q8R E;  4HJ8 A;  5KEE A;  2R7Z H;  1DOM A;  1XPR A;  1LTG D;  1NMF A;  2E8G A;  3EBE A;  3I4M G;  1PRT C;  4LK1 C;  4KKT A;  1XTD A;  1XYI A;  3VYU A;  5KGU A;  2IHE A;  1A15 A;  3GQB A;  2B2Y C;  1GUN A;  4DK6 C;  4A93 H;  4ODG A;  3Q6S A;  1XNQ L;  4GN3 B;  1HTP A;  2QGQ A;  4NKL A;  3MXP A;  5A2Q E;  1MSH A;  2VUM B;  1VQN A;  2MUY A;  2ZT9 C;  2EY6 A;  5T1G A;  1X65 A;  4NXM Q;  4B3M L;  4FO2 A;  2Q8I B;  2AWO A;  1VQD A;  1E2Z A;  2JP1 A;  1N33 L;  3S14 H;  3A74 A;  4IZ8 A;  1C48 A;  4QY7 A;  3MAQ A;  3HOV H;  4DR2 Q;  1WCM G;  2UXC L;  1T5E A;  3OTO Q;  1VCI A;  2DNC A;  2OCE A;  2EYH A;  1J5E Q;  3BS1 A;  2FMM A;  1S3O A;  1S5C D;  2K6A A;  2F3V A;  3PO3 B;  4DK3 C;  3R3O A;  4JI6 L;  1K0S A;  2MJ8 A;  1LAC A;  1EYA A;  5LMU Q;  1LTT D;  3E3X A;  1Q8K A;  1RD9 D;  4XT1 B;  2IWH A;  1GXD C;  2RHS B;  1GUO A;  2E5L Q;  1A3V A;  1GUW A;  2HHH L;  4FYD A;  4GNX B;  2F4V Q;  4BBS B;  2G9D A;  3CRL C;  4BA1 I;  3OMC A;  2PI2 A;  1A0I A;  4GNX A;  4B9X A;  1K8G A;  3CCJ A;  1F9P A;  4JYA Q;  4A3E H;  1AH9 A;  3Q23 A;  4IO9 A;  3R2T A;  4JI7 L;  4MHE A;  1KHI A;  1PTO H;  2WKD A;  5EBC A;  3TS0 A;  3V05 A;  5M3F B;  4RGT A;  3KBG A;  4MTN A;  3HOW B;  1SE4 A;  3NK9 A;  1CK1 A;  4GS3 A;  1L0X B;  1STA A;  2O5J C;  3NEL A;  3H15 A;  4LF4 Q;  3V2T A;  3FHW A;  3VR3 A;  1JJ2 A;  1OXV A;  4QIW E;  5C4Z A;  4YY3 L;  1KAW A;  4EGV A;  4PMB A;  2H5X A;  1YNN D;  1N36 Q;  2RCF A;  5FK9 C;  3GTP B;  3S15 B;  2A6H C;  5CBE E;  3SK5 A;  3S1M B;  2YV5 A;  1Z9F A;  5D3I B;  3NBH A;  1Y1W B;  4H0L C;  3S1M H;  1A62 A;  2EYL A;  2E76 C;  4RFB A;  2RF4 A;  1IBL Q;  3U4Z A;  1Z47 A;  1PYW D;  1RDP D;  1QVC A;  5K36 G;  4CDC C;  2IX1 A;  3GTK B;  1DD2 A;  3ERQ A;  4P75 A;  1KIX A;  3K8A A;  5IWA L;  2L11 A;  2JA8 H;  3NWS A;  1Y14 B;  4OHJ A;  3BDO A;  2JEA I;  3U58 A;  2NVQ H;  3S2D B;  3S2H H;  1AP0 A;  3PO3 H;  1YNN C;  4ZKC B;  3BDL A;  3CHB D;  1CKO A;  1CSQ A;  3GTL H;  4DPG A;  5CV5 A;  5T1I A;  5I2X A;  3I72 A;  1B2T A;  4ZRZ A;  2NN6 H;  4DV1 L;  4PZ6 A;  3KBX A;  3TRZ A;  1TWF H;  2OTJ A;  4BBS G;  3D0F A;  3P1H A;  2PPB C;  2RVL A;  4RAU C;  3T4A C;  1G6P A;  4HTH A;  4LNQ A;  1IYJ B;  1JT8 A;  2VQE L;  1GHJ A;  4TRD A;  1Z6H A;  4DR4 Q;  2F0F A;  1T5X D;  2CWA A;  4LAA A;  4M8A A;  3FVQ A;  3K7A H;  2F0I A;  1WVL A;  2FMC A;  4GN5 A;  3TP5 A;  3GTJ B;  4P73 A;  4QUC A;  4A3M H;  3WOF A;  3F1Z A;  1E22 A;  4BA2 I;  1B8A A;  3A0J A;  4C2M H;  3MZ5 A;  1F9Q A;  1HUM A;  4DR5 L;  2XRS D;  4FF4 A;  3L2P A;  4B3S L;  4OWW B;  2R7Z B;  1LT4 D;  3G48 A;  1SLJ A;  2YYZ A;  3KOJ A;  4CKE A;  1HH2 P;  2L12 A;  1KAA A;  3S16 B;  2OT2 A;  1IYV A;  1WTH A;  4J8Q A;  1PLF A;  5EQ0 A;  4A3M G;  2YU9 H;  2KCM A;  4DAP A;  1STY A;  3CCE A;  2BH2 A;  1IYU A;  4NPS A;  1EQQ A;  1SYF A;  4LFB Q;  1IBK L;  3T1H L;  1IW7 D;  5JJZ A;  5J3B A;  1FVI A;  1ESR A;  2JA7 H;  4KJN A;  4IPG A;  1PZK D;  2EJM A;  4DV3 Q;  2GA4 B;  2L9H A;  1HA6 A;  4CHT B;  5EGT A;  3I4M B;  5ELE A;  3T1Y L;  1VF7 A;  3F2U A;  1I94 L;  2AQ1 B;  3VYT A;  5AJ3 L;  2ZXO A;  1U5K A;  4H44 C;  4DUY Q;  2K5V A;  4DR1 Q;  1AN8 A;  3JC6 6;  4BY7 H;  4N8F A;  2PZU A;  1VQO A;  2KHJ A;  1SNM A;  4CGY B;  2EY1 A;  1TS3 A;  4BY1 G;  2X6G A;  3NHH A;  3GTM H;  1M90 C;  1G2T A;  2JA5 G;  2CWP A;  2ICE C;  1AZP A;  2UXD L;  5LMN W;  3F2C A;  3RNU A;  1HHV A;  1V8Q A;  1I4Q A;  1EYG A;  3CAM A;  1PRT F;  4YWK A;  4DR1 L;  2UUA L;  2AHO B;  2JN4 A;  2WKC A;  3TQY A;  4CJ2 C;  2UXB Q;  1RTO A;  2JA7 G;  3TN2 A;  3RZO H;  5IGD A;  4OO1 G;  3HKZ E;  2KCC A;  5NUC A;  3T56 B;  4DV3 L;  1HCZ A;  1MGS A;  4OIJ A;  1GHK A;  1TS4 A;  2WFW A;  4KV6 A;  5IGC A;  2E2I H;  3A8J E;  3GTO H;  1WTX A;  4QL5 A;  4AIM A;  3PO3 G;  3NEM A;  3CC4 A;  1HQR D;  1H9R A;  2BH8 A;  1PH7 A;  3STB C;  2B2W A;  3SK4 A;  4WJ3 M;  4DV7 Q;  4JVZ A;  3GD7 A;  4CJ1 B;  5LMN Q;  4XYQ A;  3RN2 A;  4V19 0;  3SHL A;  4NXN Q;  3M85 A;  1TS2 A;  5IOD A;  3ERS X;  1VQL A;  4KI0 A;  3MTS A;  3AFP A;  3HOX H;  3I4L A;  1BUV T;  1S40 A;  3AYH B;  3H6M A;  4DR5 Q;  3HOX B;  1PH3 A;  1BNZ A;  3IFT A;  2EYJ A;  5GAH C;  1FR3 A;  1D5M C;  2UUB Q;  2J4X A;  1CZG A;  1LV9 A;  3K81 C;  3JAM L;  3R2I A;  1F2M A;  3M7G A;  4HR7 B;  4RKL A;  4B3T Q;  2R7F A;  1Q8I A;  1FGB D;  2Q2H A;  1CQF A;  2JA7 B;  4DR6 Q;  3QOJ A;  5M5Y B;  3STB D;  2F0U A;  3EIV A;  4JI0 L;  3NPP A;  1GVP A;  5JOB A;  3M3Y B;  3TME A;  1U4M A;  4NB3 A;  1XPU A;  4HCE A;  1F2L A;  4IPC A;  3QIA A;  1EU3 A;  2YU9 B;  3MVV A;  4PG3 A;  2VQF L;  2B63 H;  5CC4 A;  4UAI A;  2MNA A;  2YTX A;  2SOB A;  1SE3 A;  1JOR A;  3CQZ H;  4DV1 Q;  3IAY A;  4GOP B;  1PVO A;  4LF6 Q;  3EN2 A;  2PNH A;  4DUZ L;  1X56 A;  4TKO B;  3H3V C;  3D6C A;  1BDO A;  1PHJ A;  4P2C B;  3U9S A;  3HOU B;  3FKI H;  4K2L A;  1FJG L;  1KDA A;  3TEH B;  3SE0 A;  4XDX A;  3OW2 A;  1Q1E A;  4GLA C;  2NTT A;  2K14 A;  2F0O A;  1MBY A;  2ZM6 L;  1PTO F;  4JI4 L;  3KDF B;  1EWH A;  3M4Q A;  4OL7 A;  5FO8 B;  3CXC A;  5GQO A;  4DAM A;  1Y1W H;  2V4D A;  1ZKO A;  3CPF A;  3F2D A;  4K8J A;  1MI2 A;  2F0P A;  3EFX D;  4R4Q A;  1RHP A;  4JCV E;  1LTI D;  2E2H B;  1U9R A;  5FLM G;  3NE5 B;  1UNS A;  3M4P A;  4GLV B;  4HAE A;  1C8C A;  1UAP A;  1KDB A;  1AZQ A;  1JOK A;  3KF6 B;  3I55 A;  1VS0 A;  3ZYY X;  4YY3 Q;  1KQS A;  4LFA L;  4UPA A;  1EFI D;  3NSW A;  1JWU D;  4PMW A;  4CDD C;  1YHA A;  2N49 A;  1EU4 A;  1II3 A;  2G9H D;  3DXJ C;  5C0X I;  4A3J G;  3J7Z C;  2GVA A;  5ELF A;  2DJG C;  5BN3 A;  2VZA A;  3GP7 A;  2KA7 A;  2NVX B;  1EWI A;  4Q0F A;  2HD3 A;  3C46 A;  1PZJ D;  1NCV A;  2MFI A;  1ILQ A;  4GLX A;  4C3H H;  4I7Z C;  4RA8 A;  2JYO A;  2KHS A;  5E3F A;  3CMA A;  2HIX A;  2NYZ D;  4GNX C;  2L15 A;  2VY3 A;  1FJG Q;  3MC0 B;  1W6J A;  4JBW A;  1A6X A;  3OWE B;  1O7L A;  1HNW Q;  1A2T A;  3GV6 A;  1PYS B;  1JOQ A;  4RCN A;  3Q8D A;  3P75 A;  1XX8 A;  2R93 G;  2AKW B;  1GD7 A;  4IPD A;  3HOU G;  1WTW A;  2K05 A;  3EVQ A;  3HOY G;  3K80 C;  1QB5 D;  3OPO A;  4JC0 A;  1QJO A;  3PO2 H;  4A3B H;  4L63 B;  1CSP A;  3PO2 B;  1YHQ A;  3NQI A;  1VDZ A;  4A4I A;  4APV A;  2NN6 G;  1SYD A;  3I4O A;  1WCM B;  2V1C C;  4Z9C B;  5IGG A;  5DNF A;  1GKH A;  2IPK D;  1OXU A;  4GZY C;  5FJ8 G;  4XQN A;  4ID6 A;  5C44 H;  4LF7 L;  1SYE A;  3NTH A;  4B3T L;  1KC8 C;  1UE5 A;  2EYF A;  1JJC B;  2R3Z A;  4UP7 A;  4QJF A;  1LYL A;  2KUM A;  1HR0 W;  4FF1 A;  4RMF A;  4MIU A;  3O13 A;  2WIN B;  1E2V A;  2AUJ D;  2Y0S G;  4BY7 G;  4FF2 A;  1Y1V G;  4KKU A;  1J9O A;  5JVH 3;  3I4M H;  1EQV A;  3JAM i;  4A3D B;  3H91 A;  3J7Y W;  3CW2 C;  4O0A A;  5I9P A;  4A3C H;  1IHZ A;  2K5Q A;  2KCT A;  4KLK A;  5LMN L;  1SFO H;  4JI2 Q;  2UU9 Q;  3UDG A;  2O5I C;  1I4H A;  1H9M A;  1V1O A;  1O80 A;  1L1O C;  1BOS A;  4DV0 Q;  2HUG A;  2L4N A;  2QEJ C;  1W2B A;  2UXB L;  4K6L A;  3M4O H;  1ASZ A;  3SGI A;  1JB7 A;  2K28 A;  1UE1 A;  3OYY A;  4NMZ A;  2F0H A;  1CKN A;  3KUP A;  3A5Z B;  3UE0 A;  4YWM A;  1U0L A;  4IPH A;  3LWE A;  1QIL A;  3W2D A;  4PMC A;  4FF3 A;  2PQA A;  1PH6 A;  4X66 L;  2OWO A;  5IYD G;  1V1P B;  5CBA E;  1TT2 A;  2CW0 C;  1SYG A;  4WJ4 A;  4ME3 A;  1SE8 A;  3J81 j;  5IGB A;  2NVT B;  4EQ5 A;  4NW2 A;  5KIX A;  1EEF D;  2NVT H;  1D5X C;  2A8V A;  1HTL D;  1SRO A;  3OHX C;  3SXH A;  1CM9 A;  1PXU A;  2Z1C A;  4K5X A;  2RDF A;  1JE4 A;  4KN4 C;  3VR6 A;  3OIP A;  3HP3 A;  2JA8 G;  3MEH A;  1FNW A;  3T51 B;  3HOV G;  4A3K H;  1SR3 A;  1VQE A;  3MWY W;  1KD1 C;  1WD1 A;  5KNB A;  4BY1 H;  1LT6 D;  4LF6 L;  1W6K A;  4L5Q A;  4JI8 Q;  1B3Q A;  2VUM H;  4KHZ A;  4YHH L;  1VQ4 A;  2VQF Q;  2BA0 A;  2H4O A;  3MA2 B;  2CCZ A;  2KEN A;  5C4J B;  3OMG A;  1RKN A;  3KJP A;  1VQM A;  3ITP A;  3RLO A;  2A73 B;  3CU7 A;  4IOC A;  1IKL A;  4FXD A;  3IFD A;  1JIC A;  2B63 G;  1PDQ A;  1D1I A;  2SDF A;  2EYO A;  3J80 E;  2PNR C;  2R6G A;  2OQK A;  1YJN A;  3I91 A;  3T13 A;  5EPL A;  4DR4 L;  2KCN A;  1QCB D;  5C4X H;  4POF A;  1MSG A;  1PFS A;  2A6H D;  3I7F A;  4R4T A;  4OON A;  5EPK A;  2MGS A;  2HDM A;  4G4K A;  1EOT A;  3J80 i;  3KJO A;  1EIH A;  2B29 A;  2F4I A;  2R92 H;  4DR3 Q;  5BN4 A;  2PQA B;  5IP9 H;  1JCK B;  1K8M A;  1X32 A;  2D9U A;  3T16 A;  1Y8P B;  4V0B A;  4YWL A;  4FDB A;  3T53 B;  2OTL A;  4KHV A;  2XSC A;  5M3F G;  4LFA Q;  4AQY L;  2MPM A;  4A75 A;  4C3J B;  1DOL A;  1X3P A;  1K9M C;  1YI2 A;  2B2U A;  3ND8 A;  3BYY B;  2WII B;  1Q12 A;  1XNR Q;  3TBI B;  1NR2 A;  4HIM A;  1GO3 E;  4A3K B;  3BVM A;  4HIO A;  3A55 A;  2J7Z A;  4IUT A;  1N8R C;  1XNR L;  4JOI C;  4HSV A;  1EIF A;  4A3G B;  2WB1 E;  1VQ6 A;  2A5H A;  3G7L A;  2H1E A;  1DM0 B;  1JOO A;  2RCN A;  4ZAI A;  4K8I A;  2LMC B;  4OWX B;  1PH2 A;  5ELO A;  2MO0 A;  2NTS A;  1X3G A;  4LWC A;  2JA5 H;  2ES2 A;  4H13 C;  2EY2 A;  3KF6 A;  4EVO A;  3A8I E;  1M4V A;  2IX0 A;  2NBF A;  1TVX A;  5JJK A;  4K0K L;  3I4N G;  1Q7Y C;  4H02 A;  1ONL A;  4IN3 A;  1RL2 A;  1LT5 D;  1TWA B;  2N78 A;  4B3R Q;  1XJV A;  2UU9 L;  4JI2 L;  3CCS A;  1SE2 A;  4DGZ A;  1ROD A;  3CKI B;  4HN7 A;  4JI0 Q;  2HHH Q;  1VQI A;  3CQZ B;  3N52 A;  1XPO A;  1QZH A;  1HR0 L;  1B50 A;  3GTM B;  1CHQ D;  4AH6 A;  2JE6 I;  2EYP A;  5LMU L;  3I4N H;  4A3L G;  3J7A V;  1NTG A;  3EJI A;  2EIF A;  2PMZ B;  3FP9 A;  1SSO A;  3E9H A;  2LFN A;  2RA4 A;  3RZD B;  2NWG A;  4XT3 B;  1UEA B;  5FKA C;  4DR2 L;  4JI8 L;  1Y1W G;  4L6T B;  1MKH A;  4LFC Q;  2PI2 E;  4TVA B;  3J7A 5;  2F1M A;  2WAC A;  1PH9 A;  1JJG A;  3CRK C;  1RF2 D;  1SEB D;  1VF5 C;  4KD4 A;  1I5F A;  1R9T H;  3OW7 A;  3V96 A;  3R8B A;  4OX9 Q;  5JEA J;  3JAM c;  1R9T B;  4EQO A;  1E2W A;  1GJX A;  3GTG H;  4O2D A;  5KNC A;  2KOL A;  2GN5 A;  4KTA A;  1L2F A;  2AUK A;  3TRE A;  4G7Z C;  5CV9 A;  2K01 A;  3RR5 A;  1SXT A;  1ASY A;  2OF1 A;  1T9H A;  5M3M H;  2ZJQ A;  4IFD J;  1HNW L;  5LL6 X;  4X62 L;  2SEB D;  3B6Y A;  2KEE A;  2X6L A;  2ZTE A;  4I65 A;  3EQL C;  4YIJ A;  1EQR A;  2XRQ D;  3ERO A;  5IP7 G;  3HOZ B;  1A63 A;  2EVB A;  5C3E G;  1V43 A;  2QDB A;  3LWU A;  5IYC G;  1HJP A;  5G3L D;  1WI5 A;  3BVZ A;  3KDF A;  4L5R C;  4WJW A;  3H0G G;  5CGK A;  5G3L F;  2B63 B;  1YIT A;  3S9W A;  5AJ3 Q;  4UDU C;  1I94 Q;  4L5T A;  2F0N A;  2XNA C;  1KXL A;  5BN5 A;  5BR8 L;  2L55 A;  4ZUI A;  1NSN S;  3AB9 A;  4AQY Q;  4DV0 L;  4RKB A;  1HXY D;  1O7I A;  1I3Q H;  5ELC A;  2ZTD A;  4GOP A;  5FO7 B;  4N9P A;  3C2P A;  3WDN A;  5CV8 A;  2K03 A;  5JEA G;  1K8O A;  5C0X H;  1PFB A;  3I70 A;  3FKI B;  1QUQ A;  1O7Z A;  4ZQ3 A;  2ZTC A;  4QUF A;  1CA5 A;  4M1U B;  2IL8 A;  1F2Y A;  1HPC A;  1PTO D;  3H0G H;  4PV1 C;  2PQE A;  4A3I H;  5EKK A;  3P20 A;  2NB0 A;  5C44 G;  2LXK A;  2JSO A;  1Q46 A;  4RG1 A;  2PZW A;  5M5X H;  4EQN A;  2P5Z X;  5C4J H;  4PNY A;  3MXG A;  3PIO 3;  4KHP L;  5GAE C;  2E2H H;  4ME5 A;  2OQ0 A;  4LF7 Q;  4DUZ Q;  3CF5 A;  4G7O C;  4IUQ A;  3PUX A;  5IGE A;  4A3E G;  2MHV A;  4KY7 A;  3G71 A;  1L1O B;  5L37 A;  4WFN 3;  4QQB X;  3OSO A;  2I0Q A;  3KK7 A;  3E6Z X;  2LSS A;  4C2M B;  3PIP A;  2D0P A;  1BQQ T;  1CHP D;  2Z6K C;  1VQ9 A;  5C3E H;  3A7L A;  4OIK A;  1ML0 D;  2R61 A;  4G57 A;  1WOC A;  1EUJ A;  5D65 A;  3S17 H;  3HOZ G;  5M5Y H;  5E7N A;  2Z4I A;  4KMU C;  1WTR A;  2JA6 H;  2UXC Q;  2MQH A;  2F3W A;  3K0Y A;  1A8V A;  1EY5 A;  1TWF B;  1C4Q A;  4U68 A;  1SMY D;  2XN9 C;  3K0X A;  3W3A A;  1N33 Q;  4DR6 L;  3AEV A;  4N8X 1;  5FJ8 H;  2Z0S A;  2DY8 A;  2SNS A;  4YCU A;  2QKI C;  2I46 A;  2VS1 A;  1Y1V B;  3NUC A;  1AE3 A;  1WTO A;  2QDL A;  2A68 C;  3VR2 A;  2MP1 A;  3G6E A;  1YVC A;  1DJR D;  3BJU A;  3HEJ A;  2WAQ E;  3GV3 A;  1EZ8 A;  1NMG A;  3ULJ A;  5C3X A;  3VDY A;  1CUK A;  3ER0 A;  5DLQ E;  3W1G A;  2AMC B;  2O4X A;  1NAP A;  2Z4H A;  4DKA C;  3HOU H;  2HQE A;  2F0L A;  5DAU A;  4NXN L;  1OXX K;  5IY0 A;  2O2L D;  2IW3 A;  1JR0 D;  2WB1 G;  1YJ9 A;  1BCP B;  1UEB A;  2F0D A;  2Z9H A;  5I4D A;  1TWC B;  2KVM A;  2HCI A;  1VQH A;  3FMC A;  1WJJ A;  2E75 C;  1I3Q B;  2CKZ B;  4FXK C;  2VUM G;  3MEF A;  2FIN B;  1IL8 A;  4LF8 L;  5IT9 E;  3DM1 A;  3X3N A;  1DCZ A;  4ZYS A;  2JQO A;  1KRS A;  2M00 A;  4O42 A;  4CBV A;  3RLF A;  3Q24 A;  2BCO A;  3HKS A;  1B7Y B;  4C3I H;  5IYB G;  1I50 B;  4IFD I;  1FD7 D;  4Q5V A;  4DAV A;  3LNN A;  2R93 B;  1YNJ C;  2EJF C;  4DF7 A;  3SEB A;  5IIF A;  2DN8 A;  4QB4 A;  4R4C A;  1VMP A;  1EFW A;  5M5X B;  1LUZ A;  4J6H A;  4X62 Q;  4IQZ A;  1D6E C;  1QVF A;  4LUV A;  4RWS C;  1H9S A;  2YTV A;  1X6O A;  3K6O A;  3CCU A;  3NTI A;  4HIK A;  1PFM A;  4YCW A;  5M3M B;  4OX9 L;  1LTA D;  1QNU A;  1HA5 A;  2Q2U A;  3A7A B;  1ESF A;  5C4X B;  3VR4 A;  3SK6 A;  1VQJ A;  3I2Z A;  5JPM C;  3ICE A;  4LFB L;  3GTL B;  4CKC A;  2Z6K A;  1I6H H;  1YNJ D;  4LFC L;  4KK7 A;  1TR5 A;  3J7A F;  4CKB A;  1B1Z A;  4BBR H;  4Y52 H;  4FVM A;  1A3T A;  5AFW A;  2D5D A;  3HRZ C;  4YCV A;  2A19 A;  4A3D G;  4NXM L;  1B4O A;  1SDF A;  1FL0 A;  1H9K A;  3GTQ B;  2QF7 A;  4HJ7 A;  1C0A A;  2DJF C;  2CFM A;  4DV5 Q;  3KLS A;  1YBY A;  4A3F G;  3SK8 A;  4B9W A;  3LX0 A;  5C3W A;  3CCM A;  1YZ6 A;  2AQ3 B;  2BA1 A;  2XWJ B;  1Y8N B;  3URY A;  2JA5 B;  3M4Y A;  4RGM A;  2F0K A;  2QIL A;  1SYB A;  3HFZ B;  4RHS A;  2JK8 A;  4L8J A;  3VYR A;  2VW9 A;  4A3B B;  4A93 B;  3CP0 A;  4DK0 A;  4DV7 L;  2K5H A;  3FPP A;  2L5T A;  3D6W A;  1VQK A;  3QWN A;  1EY6 A;  4A3I B;  4JI1 L;  2CW0 D;  4CJ0 B;  4DV2 L;  1PRT B;  3NBH B;  4KJO A;  1TWC H;  1PFN A;  1IL2 A;  3NTK A;  1CZW A;  2FJ2 A;  3UDI A;  1I6V C;  3GTK H;  4A3F H;  4C3J G;  1XTC D;  3CCR A;  1C9O A;  1M8A A;  3IRB A;  2A69 D;  1LM0 A;  1DON A;  3DUZ A;  3HKZ B;  2ID0 A;  2WAQ B;  1C7Y A;  5J1Z A;  2UXD Q;  2G5D A;  3DEO A;  4NP5 A;  4C3I B;  2N8N A;  3VR5 A;  5IWA Q;  5JAV A;  5M3M G;  5COY A;  3W1B A;  1OXT A;  2K5N A;  1N34 L;  3HOW G;  3VA5 A;  2B39 A;  1E1T A;  1DGS A;  3HS0 C;  4QIW B;  4ZLT F;  5LHY 1;  1IBL L;  1ICF B;  4ZKB B;  1EQT A;  3DHQ A;  4R4I A;  5I6Y A;  2ZM6 Q;  1LLR D;  3T1Y Q;  3PQI A;  3D3R A;  2RQX A;  4A3B G;  3C1E A;  2R92 B;  2UUC L;  1ICW A;  2LXJ A;  1X3E A;  5C0X J;  3AQQ A;  3T1H Q;  2EXZ A;  3ND9 A;  4MNO A;  4EX5 A;  3A56 A;  2B2W C;  1P16 A;  2KJX A;  3RZD H;  1KNA A;  1DOK A;  4DV6 Q;  4OGQ C;  2E2I B;  4LF5 L;  1SRU A;  1D5Z C;  1B9N A;  3UI2 A;  1VQB A;  2RKS A;  1AFP A;  3I8Z A;  5CMD A;  1H9S B;  2KHI A;  1X9N A;  1EY0 A;  5FLX L;  4C3I G;  5IYB H;  2IX3 A;  3JAM E;  5H1S E;  1P8L A;  3H09 A;  4LMQ D;  2HDL A;  4ILW A;  3BG3 A;  1EY4 A;  1X54 A;  4HSP A;  4R1J A;  2F4V L;  1PTO B;  3S16 H;  1SNO A;  4A3C G;  5C44 B;  1V1Q A;  4A3L H;  4CDE C;  2K7V A;  2ZJR A;  3AU7 A;  4O1N A;  1MIU A;  1RIP A;  3DEP A;  3KLW A;  4JBJ A;  2I5H A;  5ELD A;  2Q2T A;  2R7Z G;  3MXU A;  5K5P A;  1VQF A;  5E4X A;  4DN4 M;  1PMR A;  1QWY A;  4S3S A;  1J5E L;  4YHH Q;  3X3M A;  2F0J A;  1KRT A;  3OTO L;  3GTP H;  5IGF A;  3S15 H;  2C5C A;  2M9V A;  1XMQ Q;  1A2U A;  1MJC A;  1EIG A;  2A1A A;  1JC7 A;  2F0T A;  3NXW A;  1S5D D;  4X3S A;  1Q86 C;  3BVG A;  3BZK A;  3OOC A;  3RD4 A;  1Q3L A;  1LTS D;  1D8L A;  4A3F B;  3BYT B;  1BCP F;  2F0S A;  4FP5 D;  2XTI A;  1BCP D;  4F87 A;  1NNX A;  3CPW A;  2F0G A;  1BVS A;  1HZB A;  1GOZ A;  4DAY B;  1YJW A;  1IZ6 A;  4JOI A;  4TQU S;  5GRO A;  3Q22 A;  1J8I A;  4CDF C;  4QGU A;  2UUA Q;  1IBM L;  1I4R A;  1WYD A;  1SNQ A;  4LW1 A;  3NEN A;  4B08 A;  4C3J H;  4X66 Q;  3K5M A;  1TY2 A;  4I7A A;  3GO5 A;  2B2V A;  4QF4 A;  4X64 Q;  1UWV A;  5ISR A;  2K33 A;  4HMI A;  1EZ6 A;  1DYQ A;  3U4V A;  5EPJ A;  2B3G A;  1O78 A;  1NR4 A;  5ELN A;  1XWE A;  1I4P A;  1BCP C;  1NE3 A;  4DUY L;  4POG A;  3S17 B;  3HKZ G;  5M3F H;  4F88 A;  3MHB A;  4X65 L;  5K36 H;  2HQL A;  2QW7 A;  2F0E A;  2FHT A;  3F2B A;  2KED A;  5D3D A;  2R7D A;  1JQY D;  1E7Z A;  2F0V A;  4JV5 L;  1Z7T A;  2ENB A;  1X3Q A;  2RHQ B;  4DR7 L;  1L1O A;  4JPB W;  1VQ7 A;  1LO5 D;  4N9T A;  1Q1B A;  4TSS A;  1IBK Q;  4BBR G;  3ONA B;  5JJL A;  4KY5 A;  4Y7N B;  3M4O B;  1FYC A;  3NP8 A;  3CME A;  2K4K A;  5FLM H;  3OWF A;  5C5L A;  2E5L L;  1JWS D;  5C4X G;  1G51 A;  1M1K C;  4B3S Q;  4AYB G;  4BBS H;  2RDG A;  1BO0 A;  2C9O A;  2NZO A;  2D2C C;  1QUQ B;  1WCM H;  2IJ0 A;  4JI6 Q;  4XXE A;  4G7H C;  1GUT A;  3HG9 A;  3DWA A;  3PF4 A;  3H3V I;  1EL0 A;  3TS2 A;  3SVM A;  2CHB D;  3J81 L;  3PUV A;  2ICI A;  4RGO S;  1ZYR D;  5CV6 A;  5FO9 B;  1I4X A;  1E1O A;  5I6W A;  2NVQ B;  5CR3 A;  4XQJ A;  1NBW A;  3AFQ A;  1N34 Q;  1D7Q A;  3S1N B;  2VQE Q;  4JW0 A;  4HID A;  4E6I A;  3E9I A;  4NDX A;  2D62 A;  1SJH D;  2WAQ G;  3I73 A;  4OXP A;  3RLN A;  2Q8T A;  1XXG A;  3M9B A;  5IT9 c;  2PZT A;  3PUW A;  1TKW B;  4BXX G;  1UUP A;  2AQ2 B;  3VYS A;  4A76 A;  3ZJY C;  1GUS A;  1EWC A;  1JE5 A;  2FXQ A;  1DXM A;  2PW7 A;  1QE6 A;  4J15 A;  4K2K A;  3KFU A;  1K8A C;  2DNE A;  5A2Q L;  2TSS A;  3A5U A;  4U67 3;  3GTG B;  1KL9 A;  3DMU A;  3GTJ H;  3F8T A;  1HRJ A;  3D4D A;  4R4O A;  5KND A;  1CTM A;  3S1R H;  1CQV A;  4C3H G;  2EZV A;  1K3R A;  2DY7 A;  4ABN A;  1PTO C; 
#chains in the Genus database with same CATH homology
 1PH1 A;  2JA6 G;  1WOC A;  2VZA A;  1EUJ A;  1BKB A;  3S17 H;  3HOZ G;  5M5Y H;  4P74 A;  5E7N A;  5HGQ A;  1EWI A;  4OWT B;  2JA6 H;  4GKK L;  2UXC Q;  2MQH A;  4DV5 L;  3PSI A;  4XTC S;  3M3Y H;  1N32 Q;  2MFI A;  4HJA A;  2JJQ A;  1GM5 A;  1A8V A;  3CD6 A;  4GLX A;  4C3H H;  4JI5 Q;  3CMA A;  2HIX A;  3K0X A;  3UDX A;  1N33 Q;  4DR6 L;  4GNX C;  3AEV A;  1VQA A;  2L15 A;  2VY3 A;  2PMZ E;  1FJG Q;  1VQP A;  5FJ8 H;  2Z0S A;  1Y1V H;  4JBW A;  4YCU A;  4GOP C;  4LF4 L;  1HNW Q;  2WP8 J;  2VS1 A;  1AE3 A;  2MO1 A;  1PYS B;  2Y0S E;  3Q8D A;  1PH8 A;  4DR7 Q;  3G6E A;  1YVC A;  4A3J H;  1N32 L;  2R93 G;  3BJU A;  2AKW B;  2WAQ E;  1N9W A;  3L0O A;  1GD7 A;  4IPD A;  2QEX A;  3CCV A;  1HNZ L;  4JI4 Q;  1NMG A;  3ULJ A;  3VDY A;  1UE7 A;  1CUK A;  4JI7 Q;  1IXR A;  3HOY G;  3K80 C;  3ER0 A;  5DLQ E;  3W1G A;  4JC0 A;  3PO2 H;  2JA9 A;  2AMC B;  3J81 c;  4A3B H;  2K50 A;  4DKA C;  1CSP A;  3CC7 A;  3HOU H;  4BXX H;  4NXN L;  1YHQ A;  1JMC A;  4A4I A;  4APV A;  1OXX K;  2NN6 G;  3I4O A;  5IY0 A;  2V1C C;  1HNX Q;  2WB1 G;  3J81 i;  1GKH A;  1QZG A;  4HJ8 A;  1YJ9 A;  2R7Z H;  4PZ8 A;  3HOW H;  1UEB A;  1XPR A;  1OXU A;  3PF5 A;  5FJ8 G;  1NMF A;  3PO2 G;  4GKJ L;  5C44 H;  3EBE A;  1VQH A;  2N3S A;  2E8G A;  4LF7 L;  2ALY B;  3I4M G;  3PCO B;  1WJJ A;  1KC8 C;  1UE5 A;  4B3T L;  1XTD A;  2CKZ B;  2VUM G;  1JJC B;  2IHE A;  4DV4 L;  4UP7 A;  4QJF A;  1LYL A;  4JG2 A;  3MEF A;  1HR0 W;  4RMF A;  4DK6 C;  4LF8 L;  4A93 H;  4A93 G;  2ATW A;  1XNQ L;  2JQO A;  1KRS A;  4GN3 B;  3RLF A;  2Y0S G;  2QGQ A;  3HKS A;  1B7Y B;  4C3I H;  5IYB G;  4BY7 G;  4IFD I;  1Y1V G;  3ULL A;  1BBW A;  3LGJ A;  1PH4 A;  3I4M H;  3JAM i;  1VQN A;  3CW2 C;  1X65 A;  4NXM Q;  4B3M L;  4O0A A;  1TXY A;  4JI3 L;  4A3C H;  3PV0 A;  4LF9 Q;  2KCT A;  2AWO A;  1VQD A;  4KLK A;  2R93 H;  4R4C A;  5LMN L;  1SFO H;  4JI2 Q;  2UU9 Q;  1Q81 C;  3UDG A;  1EFW A;  1N33 L;  3S14 H;  3A74 A;  1LUZ A;  4B3M Q;  4X62 Q;  4IFD G;  4QY7 A;  2UUB L;  1L1O C;  4LUV A;  1QVF A;  3HOV H;  4DR2 Q;  2YTV A;  1X6O A;  1WCM G;  2UXC L;  3CCU A;  4DV0 Q;  2VNU D;  3OTO Q;  4HIK A;  2NZH A;  1VCI A;  1MJE A;  2OCE A;  1J5E Q;  1XNQ Q;  1H95 A;  4YCW A;  4UP8 A;  3PIO A;  4OX9 L;  2I5L X;  1W2B A;  2Q2U A;  1IBM Q;  1S3O A;  3I56 A;  2XGT A;  4DK3 C;  4JI6 L;  3M4O H;  2UXB L;  2IY5 B;  1ASZ A;  1VQJ A;  3I2Z A;  3SGI A;  3ICE A;  1JB7 A;  2C35 B;  4LFB L;  1UE1 A;  2Z6K A;  3FKI G;  3OYY A;  5LMU Q;  1CKN A;  1I6H H;  4LFC L;  1Q8K A;  2RHS B;  2AWN A;  3A5Z B;  3RN5 A;  2EQS A;  4YWM A;  1U0L A;  3UE0 A;  4BBR H;  2E5L Q;  4IPH A;  4Y52 H;  2HHH L;  1QVG A;  4IJH A;  1VQ8 A;  4GNX B;  2F4V Q;  1XMO Q;  4BA1 I;  2PQA A;  1PH6 A;  2PI2 A;  1A0I A;  4YCV A;  4X66 L;  2A19 A;  2GVB A;  4GNX A;  2OWO A;  5IYD G;  1K8G A;  3CCJ A;  4A3D G;  4NXM L;  4JYA Q;  4A3E H;  1AH9 A;  1FL0 A;  4IO9 A;  4HJ7 A;  1C0A A;  4WJ4 A;  4JI7 L;  4ME3 A;  2CFM A;  1SE8 A;  1KHI A;  1TWG H;  1CKN B;  4DV5 Q;  3J81 j;  1YBY A;  3TS0 A;  1NJI C;  1HNZ Q;  4EQ5 A;  4MTN A;  4A3F G;  2NVT H;  4GS3 A;  2A8V A;  3CCM A;  1YZ6 A;  1SRO A;  2BA1 A;  3NEL A;  1W3S A;  4XIG S;  4UY8 C;  3H15 A;  4LF4 Q;  2F3I A;  3HFZ B;  1BBU A;  2JK8 A;  1HZA A;  2JA8 G;  2VW9 A;  3FHW A;  1JJ2 A;  3HOV G;  4GKJ Q;  1OXV A;  1SR3 A;  1VQE A;  3CP0 A;  4DV7 L;  4QIW E;  4A3K H;  1KD1 C;  2K5H A;  4YY3 L;  4BY1 H;  1KAW A;  5IP7 H;  4LF6 L;  1NY4 A;  2H5X A;  1VQK A;  4L5Q A;  4A3K G;  4JI8 Q;  1N36 Q;  4JBK A;  4A3G H;  4JI1 L;  2VUM H;  2YV5 A;  1Z9F A;  4KHP Q;  4KHZ A;  4YHH L;  4DV2 L;  1VQ4 A;  3NBH B;  2VQF Q;  1A62 A;  2BA0 A;  3S1M H;  3CCL A;  2CCZ A;  1TWC H;  3W5O A;  2KEN A;  1IL2 A;  3UDI A;  2RF4 A;  3KJP A;  1IBL Q;  3U4Z A;  1VQM A;  3GTK H;  4A3F H;  1Z47 A;  3RLO A;  3CCR A;  4IOC A;  4X6A H;  1J6Q A;  1QVC A;  5K36 G;  2IX1 A;  1C9O A;  3IRB A;  5M5W H;  1LM0 A;  2B63 G;  2ID0 A;  1KIX A;  4P75 A;  1OXS C;  3BU2 A;  1C7Y A;  2UXD Q;  3K8A A;  5IWA L;  4DV6 L;  2JA8 H;  3DLL A;  1Y14 B;  2N8N A;  5IWA Q;  5M3M G;  2JEA I;  2R6G A;  2OQK A;  3CC2 A;  1YJN A;  4AYB E;  3U58 A;  3W1B A;  1Q82 C;  2NVQ H;  1OXT A;  4DR4 L;  3J80 c;  3S2H H;  2EXD A;  2K5N A;  5C4X H;  1N34 L;  3PO3 H;  4PZ7 A;  4POF A;  3HOW G;  1E1T A;  1DGS A;  1PFS A;  3I7F A;  4R4T A;  1CKO A;  1CSQ A;  3GTL H;  1IBL L;  4DPG A;  4OON A;  3M7N A;  4IOA A;  2UUC Q;  1OTC A;  1VQC A;  4R4I A;  4L5S A;  5BR8 Q;  3J80 i;  3KJO A;  4DV1 L;  2B29 A;  2F52 A;  4LUZ A;  4PZ6 A;  2ZM6 Q;  1AE2 A;  3T1Y Q;  1PYB A;  2R92 H;  4DR3 Q;  3TRZ A;  2YTY A;  4A3B G;  1TWF H;  2PQA B;  5IP9 H;  3HOY H;  4BBS G;  2OTJ A;  5IE8 A;  3D0F A;  1FGU A;  1G6P A;  4LNQ A;  3CCQ A;  2UUC L;  1IYJ B;  2LXJ A;  1VQ5 A;  1JT8 A;  1X3E A;  4YWL A;  4FDB A;  5C0X J;  3AQQ A;  1E24 A;  2VQE L;  2HT1 A;  3T1H Q;  1B70 B;  2OTL A;  4MNO A;  5M3F G;  1UE6 A;  1X3F A;  4EX5 A;  4DR4 Q;  4LFA Q;  2CWA A;  1P16 A;  1VQG A;  5EAY A;  1CKM A;  4A75 A;  4AQY L;  3RZD H;  3K7A H;  4DV6 Q;  4GN5 A;  2VL6 A;  1K0R A;  4P73 A;  1K9M C;  5GAG C;  4LF5 L;  4A3M H;  2KBN A;  1YI2 A;  1K83 H;  1SRU A;  3F1Z A;  1E22 A;  1Q12 A;  4BA2 I;  1XNR Q;  1B8A A;  1VQB A;  3A0J A;  4C2M H;  4Y7N H;  4HIM A;  1GO3 E;  2KHI A;  1X9N A;  1YIJ A;  2CQO A;  5IYB H;  4HIO A;  1L0W A;  2IHF A;  5H1S E;  1P8L A;  4DR5 L;  3HOZ H;  3L7Z C;  1N8R C;  3WWV A;  1XNR L;  4JOI C;  3L2P A;  4B3S L;  2D0O A;  2E2J H;  4OWW B;  1X54 A;  1EIF A;  2JEB I;  2WB1 E;  4R1J A;  4JI1 Q;  2F4V L;  1VQ6 A;  3S16 H;  3G48 A;  1SLJ A;  2YYZ A;  3KOJ A;  1HH2 P;  3H3V H;  1SMX A;  2RCN A;  4A3C G;  1V1Q A;  1YHB A;  4A3L H;  3GDE A;  4A3M G;  2ZJR A;  4OWX B;  2YU9 H;  3KF8 B;  2KCM A;  4GN4 B;  1MIU A;  1RIP A;  5ELO A;  3CCE A;  1PH2 A;  2BH2 A;  4NPS A;  2MO0 A;  1EQQ A;  1X3G A;  3KLW A;  4JBJ A;  4LWC A;  2ES2 A;  2JA5 H;  2R92 G;  4OO1 I;  2I5H A;  1IBK L;  4LFB Q;  2Q2T A;  3T1H L;  2R7Z G;  3KF6 A;  5J3B A;  1FVI A;  1VQF A;  5HY6 A;  2JA7 H;  4IPG A;  2DUD A;  2IX0 A;  3BZC A;  4DV3 Q;  1J5E L;  4YHH Q;  1KRT A;  5JJK A;  3T1Y L;  3OTO L;  4MZ9 A;  1I94 L;  3GTP H;  3I4N G;  3S15 H;  4K0K L;  5AJ3 L;  1XMQ Q;  1Q7Y C;  1N36 L;  3S1N H;  1MJC A;  4H02 A;  1RL2 A;  1U5K A;  2A1A A;  2K5V A;  4DUY Q;  4DR1 Q;  1V9P A;  2N78 A;  3JC6 6;  4BY7 H;  4B3R Q;  1XJV A;  3PGZ A;  1Q86 C;  2UU9 L;  3BZK A;  1VQO A;  4JI2 L;  3MXN B;  3CCS A;  1PH5 A;  2KHJ A;  1D8L A;  1HR0 Q;  4BY1 G;  4JI0 Q;  4P71 A;  2HHH Q;  3GTM H;  1YNX A;  1VQI A;  1QZH A;  2XTI A;  1XPO A;  1M90 C;  1HR0 L;  1YEZ A;  2JA5 G;  1WFQ A;  2CWP A;  4JBM A;  2UXD L;  4AH6 A;  3F2C A;  5LMN W;  3CPW A;  3RNU A;  3UE1 A;  2DGY A;  2JE6 I;  1BVS A;  5LMU L;  1HZB A;  3I4N H;  4B3R L;  4DAY B;  5GAD C;  3CAM A;  1YJW A;  1EYG A;  4YWK A;  4A3L G;  1IZ6 A;  4JOI A;  4DR1 L;  1PV4 A;  2AHO B;  4TQU S;  2UUA L;  5GRO A;  1NTG A;  3TQY A;  5IYC H;  3D31 A;  3S2D H;  4A3G G;  2UXB Q;  2JA7 G;  2UUA Q;  4QGU A;  2EIF A;  3FP9 A;  4K0K Q;  4DV4 Q;  1IBM L;  1WYD A;  3E9H A;  3RZO H;  2K75 A;  4JYA L;  4JV5 Q;  4LW1 A;  4OO1 G;  4LF5 Q;  3HKZ E;  3NEN A;  4C3J H;  1EIY B;  4DV3 L;  4X66 Q;  3HOU G;  2WFW A;  4LUO A;  3GO5 A;  4X65 Q;  2E2I H;  4X64 Q;  1I50 H;  1UWV A;  2NVY H;  4DR2 L;  3GTO H;  4JI8 L;  1Y1W G;  4QL5 A;  4AIM A;  3PO3 G;  3NEM A;  2QA4 A;  1MKH A;  3CC4 A;  2BH8 A;  3U4V A;  4LFC Q;  1PH7 A;  2B3G A;  2PI2 E;  4P72 A;  4TVA B;  3PUZ A;  5ELN A;  3STB C;  3J7A 5;  4DV7 Q;  4WJ3 M;  3GD7 A;  5LMN Q;  3ULP A;  1PH9 A;  5JJI A;  3RN2 A;  1NE3 A;  4DUY L;  1S72 A;  4POG A;  1JJG A;  4NXN Q;  3HKZ G;  3G4S A;  3M85 A;  5M3F H;  4X64 L;  1VQL A;  1I5F A;  3ERS X;  1R9T H;  4KI0 A;  4X65 L;  3AFP A;  2HQL A;  3F2B A;  5JEA J;  3JAM c;  3HOX H;  4HJ9 A;  4OX9 Q;  2R7D A;  1S40 A;  3K7U C;  3AYH B;  1E7Z A;  4O2D A;  3GTG H;  2GN5 A;  4DR5 Q;  5IYD H;  4JV5 L;  1PH3 A;  1L2F A;  3TRE A;  1X55 A;  2RHQ B;  4DR7 L;  3RR5 A;  5GAH C;  1L1O A;  1ASY A;  1VQ7 A;  4LF8 Q;  1T9H A;  5M3M H;  2UUB Q;  2ZJQ A;  1Q1B A;  1G29 1;  2ZJP A;  4BBR G;  1IBK Q;  4IFD J;  2HIV A;  1HNW L;  3K81 C;  5JJL A;  4X62 L;  3B6Y A;  4B3T Q;  2ZTE A;  2R7F A;  2Q2H A;  1EQR A;  4DR6 Q;  5IP7 G;  1XMO L;  3CME A;  4JI5 L;  2K4K A;  3STB D;  5FLM H;  1A63 A;  2NVX H;  3EIV A;  4JI0 L;  2I5M X;  5C3E G;  2E5L L;  1V43 A;  5C4X G;  1G51 A;  1GVP A;  5IYC G;  5FLX c;  1M1K C;  4B3S Q;  1HJP A;  4NB3 A;  4AYB G;  1XPU A;  1WI5 A;  3KDF A;  4L5R C;  1PA6 A;  4DNI A;  5IP9 G;  4IPC A;  1TWA H;  4HJ5 A;  4BBS H;  1TWH H;  3H0G G;  2NZO A;  1QUQ B;  1WCM H;  1LTL A;  3E0E A;  4JI6 Q;  1YIT A;  1XMQ L;  1E3P A;  4PG3 A;  5AJ3 Q;  2VQF L;  2B63 H;  2Q2I A;  1I94 Q;  3PF4 A;  4L5T A;  4DV2 Q;  4DR3 L;  3GTQ H;  3H3V I;  2MNA A;  3TS2 A;  2YTX A;  1KXL A;  3CQZ H;  4DV1 Q;  4GOP B;  1PVO A;  5BR8 L;  3PUV A;  1E1O A;  4AQY Q;  4DV0 L;  3EN2 A;  4LF6 Q;  2PNH A;  1K73 C;  1O7I A;  1I3Q H;  1NBW A;  4A3I G;  4DUZ L;  1X56 A;  3AFQ A;  1N34 Q;  1D7Q A;  2IT1 A;  3HOX G;  1SN8 A;  2K52 A;  2ZTD A;  4GOP A;  2VQE Q;  4HID A;  1PHJ A;  3FKI H;  5JEA G;  3DM3 A;  3E9I A;  1FJG L;  3TEH B;  4LF9 L;  2D62 A;  2WAQ G;  5C0X G;  4JI3 Q;  3KYH C;  4OXP A;  3RLN A;  3OW2 A;  1QUQ A;  1Q1E A;  4GLA C;  3M9B A;  2K14 A;  5IT9 c;  2ZTC A;  3PUW A;  2ZM6 L;  3S1Q H;  4BXX G;  4JI4 L;  4A3D H;  3H0G H;  3U50 C;  3KDF B;  3M4Q A;  3CXC A;  4IJL A;  4A3I H;  5GQO A;  4DAM A;  4A76 A;  1Y1W H;  3PUY A;  5C44 G;  2LXK A;  3S24 A;  3ZJY C;  1Q46 A;  4RG1 A;  1JE5 A;  3CPF A;  3F2D A;  2ASB A;  1EOV A;  2FXQ A;  4R4Q A;  4JCV E;  5M5X H;  5C4J H;  4J15 A;  5FLM G;  3M4P A;  4KHP L;  5GAE C;  2E2H H;  2NN6 I;  2OQ0 A;  4GLV B;  3KFU A;  1K8A C;  4LF7 Q;  1HZ9 A;  4DUZ Q;  3A5U A;  3CF5 A;  3UDF A;  3PUX A;  4A3E G;  1KL9 A;  3GTJ H;  3KF6 B;  3F8T A;  3I55 A;  3G71 A;  1VS0 A;  1KQS A;  1L1O B;  4YY3 Q;  4LFA L;  4UPA A;  4ALP A;  4QQB X;  4R4O A;  2I0Q A;  2LSS A;  4PMW A;  3S1R H;  3PIP A;  4GKK Q;  2D0P A;  1YHA A;  2N49 A;  1K3R A;  1HNX L;  1VQ9 A;  1HZC A;  2Z6K C;  5C3E H;  5C0X I;  4UP9 A;  4A3J G;  3J7Z C;  2GVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...