3K7AH

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 20
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k7aH00
4NPSA 3RLFA 2ZM6L 1ASYA 4XTCS 3LGJA 3PSIA 3BJUA 4A3JG 4P75A 4BA1I 2A19A 2KBNA 4JI1L 3FKIH 1EQRA 1IZ6A 3HKZG 1QUQB 5IP7H 1W3SA 1NBWA 1WFQA 3I7FA 4LF4L 1PYBA 1YBYA 4YHHL 3J81c 4R1JA 4BBRH 1KC8C 3RN5A 2HIVA 3KDFA 5IYCH 1NJIC 1M1KC 1IBLL 2NVXH 2WB1E 5H1SE 3EIVA 1SFOH 4GKJL 2UXCL 1WCMH 1HNZQ 4DV6L 3BZCA 4DR3Q 1Q1BA 3GO5A 4IPHA 4BBRG 2AWOA 5IYCG 4JYAQ 5GROA 3S1MH 2PI2A 4DAYB 5IWAL 4HJ7A 2VQFL 2N8NA 4Y7NH 1KD1C 2UXDQ 2K5VA 3HFZB 1L1OA 1PVOA 1N34L 1YJNA 1N32L 4R4IA 4APVA 3GTJH 4DR2Q 4JI6Q 3KFUA 4LUOA 1E1TA 2D0PA 1S40A 2F4VQ 2WP8J 1IYJB 1YI2A 4JI2L 2R92G 1D8LA 3W5OA 2R93G 3FHWA 2B3GA 5IP9H 1UE6A 3CCRA 2JA9A 3S24A 5M5XH 1HH2P 1SN8A 2EIFA 4QIWE 4AIMA 3BU2A 1OXVA 1I94L 1QZHA 4A3DH 1Q7YC 2NZOA 1N9WA 2NN6G 4AQYL 3J81j 4R4CA 3OTOQ 4R4QA 3NELA 3PIOA 3KF6A 2VW9A 5IYDG 1QVGA 2NVTH 3HOWH 3AFQA 2ZJRA 3UDXA 3H0GG 1P8LA 3VDYA 3JAMi 3W1GA 4WJ3M 4DV1L 2BA0A 3K7UC 2C35B 3HKSA 4JCVE 3CCSA 4DV5L 3S14H 1EIYB 4NXNL 2UXBL 4WJ4A 1B8AA 1E1OA 2ZTDA 1E24A 2B29A 1N36L 2LSSA 4YWKA 4YCUA 1V43A 3CC2A 4LF7Q 1VCIA 4B3MQ 1HZ9A 2K75A 1CSPA 4BY7H 2N3SA 1A8VA 4POFA 2JK8A 2OWOA 3ERSX 5M5WH 5LMUL 4YWLA 3J81i 1OXSC 4P71A 1K8GA 1VQKA 2IX1A 2R7DA 5C44G 3PF4A 2NN6I 4UP9A 1CSQA 4X65Q 5J3BA 3PGZA 4LUVA 4BY7G 1XNQQ 2NVYH 3UDIA 3OW2A 1Y1WH 2JA6H 3K8AA 2PNHA 5JEAG 1PH4A 4Y52H 4B3TQ 3CCVA 3TQYA 2HHHQ 4TVAB 1YJWA 1VS0A 1VQPA 5C3EH 4LFBL 1HR0W 3B6YA 1MIUA 4C3HH 1Y1WG 2N49A 2IHFA 1VQ5A 2JA6G 2VUMH 3CPWA 3MXNB 1CUKA 2PQAA 1PH5A 2D62A 2PMZE 5EAYA 4DR6L 3CP0A 3HOXH 4DR7Q 4B3SQ 3UDFA 5C3EG 4A3FH 2B63G 1EUJA 3PUZA 5FJ8H 1PH1A 2E2JH 1PA6A 4JC0A 4A3CH 4EX5A 4JYAL 2VUMG 1Y14B 1XTDA 1BBUA 2UXDL 1Q86C 2AKWB 1X65A 4A3LH 3PO2H 4DUZQ 3S1NH 1HJPA 2IT1A 2KHIA 3TS2A 4A3FG 2YV5A 4LUZA 5FJ8G 4DR2L 4JI6L 1GD7A 1I6HH 2I5LX 2GVBA 1FGUA 3RZDH 2CFMA 3CQZH 1UE1A 5LMNW 4DR5L 3HOYH 4A3LG 3CC4A 3GTLH 1XPOA 3KLWA 3PO2G 1J6QA 2OCEA 3IRBA 2QA4A 2GVAA 1VQGA 4X64Q 4DV2L 1UE5A 2CQOA 4DR1Q 4A3MH 1NMGA 2YTXA 1G51A 3TEHB 1KHIA 2BA1A 1IBKQ 4QY7A 3HOYG 1XMQQ 4DV7L 1AE3A 4OWTB 3S17H 1YHQA 2UU9Q 4PG3A 3E9IA 4X66Q 2GN5A 4KLKA 1V1QA 1JJCB 1KAWA 4A3MG 4JBJA 4PZ6A 4IFDG 1I5FA 1Y1VG 3K7AH 1YIJA 2QGQA 3A0JA 3T1YQ 4KHPQ 2ZTCA 1SE8A 3I4MG 2AMCB 2WB1G 1JT8A 3FP9A 4JI0Q 1ASZA 3PO3H 1X54A 3GTKH 3M4PA 2JA7H 4X62Q 4DR4Q 4B3ML 2NVQH 1L1OC 3S2HH 4C2MH 3T1HQ 3J7ZC 3BZKA 3ULLA 1HNWQ 5JJIA 2MFIA 5JEAJ 3UDGA 1XPUA 3KJOA 2JJQA 3PO3G 2EXDA 1BVSA 4DV4L 2JEBI 2JA7G 4DV0L 5LMNQ 4X65L 1YITA 1PHJA 1SR3A 4LWCA 4JBKA 4DV3L 1W2BA 3E0EA 2N78A 4QL5A 4NXMQ 4BA2I 3I56A 1T9HA 2YTVA 2YYZA 1A63A 4IFDI 4DAMA 4B3TL 1LUZA 3AFPA 4MZ9A 2HHHL 4A93H 4B3RL 1HNXQ 4JI8Q 1JJGA 3M85A 2E2HH 2RHSB 1XPRA 2A1AA 4AH6A 1LM0A 1UEBA 3HOVH 2R92H 1KQSA 4DR7L 4JV5Q 5GQOA 4A93G 2R93H 4AYBE 1KIXA 4B3SL 1G6PA 2DGYA 4LFCQ 4JI4Q 3RLNA 1EIFA 3NEMA 2KCTA 1Z9FA 3S16H 5GAEC 4DUYQ 3HOVG 2UUAL 4K0KQ 4DUZL 4O0AA 5IYDH 2YTYA 1VQNA 1VQCA 1VQEA 4IO9A 3I4OA 3H0GH 3CCJA 3ZJYC 3KDFB 4UPAA 1HZCA 2E5LL 1AH9A 4IOAA 4YWMA 1VQDA 5IT9c 2EQSA 3F8TA 2AHOB 4BBSG 1EWIA 3J7A5 3M4OH 2OQKA 1IBMQ 1OXTA 3A74A 1MJCA 4X64L 4DR1L 1MKHA 2I0QA 4IFDJ 3I55A 2UUBL 4LF6Q 4IPGA 1PH9A 2ZJQA 1X3FA 4DK3C 1XMQL 1N8RC 2Y0SE 2UU9L 3KF8B 3JC66 1HR0L 1L1OB 1GO3E 4A3KH 4JI5Q 1VQ6A 1K3RA 5C44H 2K50A 4LF5L 1EOVA 2Q2UA 1FVIA 3T1YL 5IY0A 1N33Q 1OTCA 4A3KG 1XNRQ 5M3FG 1RL2A 1K0RA 4DR4L 3RR5A 4X62L 2CWAA 4QJFA 1TWFH 1CKOA 1X56A 4JG2A 4JI3Q 1WI5A 3STBC 3T1HL 1JJ2A 1K73C 2Q2IA 1HNWL 4QGUA 3KF6B 4JBWA 4HIMA 3CCMA 5GADC 4LW1A 4OO1G 5LMNL 2XGTA 2ZM6Q 1R9TH 1VQ7A 2B63H 1GM5A 1AE2A 4NXML 4LF9Q 1EFWA 4JI1Q 2R6GA 3E9HA 3MEFA 1LTLA 4FDBA 4HJAA 2ASBA 4OX9Q 1KL9A 4MTNA 1D7QA 2JQOA 3HOZH 5IE8A 3H3VI 1HNZL 1BBWA 4DR3L 4LF4Q 3F2DA 3M7NA 4A3GG 4DPGA 3PV0A 3G6EA 3CCEA 2AWNA 1NTGA 4BXXH 3S2DH 1FJGQ 3GDEA 4JV5L 1L2FA 1S3OA 3HOZG 2HQLA 4LFCL 1X9NA 1XJVA 4QQBX 4GOPA 2F4VL 3L2PA 4GNXA 2CWPA 4RG1A 2E8GA 4YCVA 1MJEA 5FLXc 2YU9H 4DUYL 4OO1I 4YY3Q 4R4TA 1SRUA 4BXXG 4K0KL 2VQFQ 4C3IH 1XMOQ 1KRSA 3OYYA 4GKKQ 4H02A 3PF5A 1Y1VH 1Q1EA 3M4QA 2PQAB 2H5XA 3OTOL 4IOCA 4UY8C 3GD7A 1TWAH 3I4MH 3CCUA 2BH8A 4JI2Q 2IY5B 4DKAC 2HIXA 2VS1A 4GLVB 4P72A 2CCZA 4HJ8A 4LF6L 3NBHB 3CW2C 4LFAQ 4GLXA 4A3IH 2WAQE 1WJJA 4AQYQ 3M9BA 1PH2A 4JI5L 3AQQA 4L5QA 1PH6A 1QUQA 3UE0A 4LF7L 2I5HA 3W1BA 3UE1A 4UP8A 1VQAA 5AJ3Q 4HIOA 1G291 3ULPA 3U58A 4A3IG 1EQQA 4NB3A 3U4ZA 1K9MC 1JB7A 4HJ9A 1SROA 1JE5A 4DV5Q 1SLJA 3I4NH 2Z6KA 4JOIA 2UXBQ 1IXRA 1IL2A 2MO1A 1RIPA 4O2DA 4AYBG 1NY4A 4LF8Q 1I3QH 2VY3A 4IPDA 1VQJA 3CMEA 1N36Q 1I50H 1HZAA 1XNQL 4JI3L 4A4IA 1PH3A 1PFSA 1QVFA 1PH7A 1M90C 3I4NG 1KXLA 1YEZA 4HIKA 3D0FA 4OONA 2UUCQ 1P16A 2K52A 4GN5A 1YHAA 1LYLA 4BY1H 5C0XG 1KRTA 1H95A 4YCWA 3L0OA 4LF9L 2BH2A 2JA5H 2OTJA 5BR8Q 3L7ZC 3S1RH 3GTGH 1A62A 1VQBA 5C4XH 1DGSA 1X6OA 4OX9L 3ICEA 4A3BH 2K4KA 3GTMH 4BY1G 5GAGC 3KYHC 1GKHA 4GS3A 4OWXB 4XIGS 2OTLA 3TS0A 3G48A 4LFBQ 2JA5G 2R7ZH 1GVPA 3K81C 2Y0SG 3FKIG 3STBD 2HT1A 4A3BG 5C4XG 1Q81C 1FJGL 1YJ9A 3U4VA 1J5EQ 1FL0A 2JEAI 5IP7G 3TRZA 5C4JH 4DK6C 3CD6A 1L0WA 3PIPA 4BBSH 2I5MX 4C3JH 4OWWB 4DR6Q 1UE7A 3AEVA 1E7ZA 4GN4B 5FLMH 2VL6A 2CKZB 4OXPA 3PUVA 2R7ZG 5JJLA 1V9PA 2OQ0A 4P73A 4TQUS 4YY3L 5HY6A 5C0XI 5JJKA 3D31A 1XMOL 5M3MH 3HKZE 4GKKL 2VQEQ 1WCMG 5FLMG 3K0XA 4JI7Q 1IBKL 2ID0A 4LNQA 1U0LA 3H3VH 1K83H 4HJ5A 4DR5Q 4X66L 5M5YH 5M3MG 1K8AC 3HOUH 2QEXA 3F2CA 3A5UA 2LXKA 3J80c 5M3FH 1Q46A 2ZJPA 1TXYA 4DV2Q 1QZGA 4LFAL 2A8VA 3I2ZA 4KHPL 3EN2A 4DNIA 1QVCA 3DLLA 3WWVA 2K5HA 3PUXA 1NE3A 4DV7Q 2IX0A 3U50C 3HOUG 4A3EH 1E3PA 1B70B 1TWGH 4JI0L 1A0IA 5IP9G 2WFWA 1VQMA 1B7YB 3PUYA 3Q8DA 2V1CC 3KJPA 5AJ3L 2Q2TA 4GLAC 3K80C 3A5ZB 4A3DG 1CKMA 1WOCA 5GAHC 1C9OA 4GOPC 5ELOA 4A3EG 4GNXC 2RF4A 1C7YA 3RZOH 2KENA 3DM3A 3CPFA 4LF8L 3HOWG 2R7FA 3AYHB 1X3EA 5C0XJ 4IJHA 2RCNA 3CC7A 1YVCA 1UWVA 3KOJA 2IHEA 3RLOA 4A3GH 3ER0A 2UUCL 1VQHA 3TREA 5IYBH 1HNXL 4JI8L 1PYSB 3RNUA 4DV4Q 2ZTEA 5E7NA 2DUDA 4YHHQ 4DV0Q 1YHBA 3ULJA 3SGIA 1C0AA 1Q82C 4DV3Q 4GN3B 4UP7A 1VQ4A 5BR8L 1IBLQ 4PMWA 1JMCA 3S15H 3G71A 3EBEA 5IYBG 3CMAA 3H15A 4A75A 3CF5A 3GTOH 1OXUA 1Z47A 3F2BA 4MNOA 1VQOA 4P74A 4JI4L 2L15A 4B3RQ 4GKJQ 2UXCQ 1TWCH 2MQHA 4DV6Q 2K14A 3PUWA 4L5SA 1U5KA 1VQFA 2WAQG 1Q8KA 1Q12A 3F1ZA 5ELNA 3CCQA 5IWAQ 2D0OA 1J5EL 1CKNA 4X6AH 2K5NA 4J15A 2JE6I 1X55A 2JA8H 4IPCA 2MNAA 2FXQA 2Z6KC 4RMFA 4JOIC 1N34Q 1VQ8A 2KCMA 1N32Q 1E22A 2RHQB 1YZ6A 3NENA 2PI2E 2ATWA 2KHJA 2F3IA 3J80i 1SMXA 2XTIA 2ALYB 2UUAQ 4PZ7A 3HOXG 1PH8A 1IBML 2JA8G 1BKBA 2VQEL 3GTPH 4L5RC 4JI7L 3M3YH 3S1QH 4A3CG 4L5TA 1I94Q 2E5LQ 1S72A 4HIDA 2Q2HA 4KHZA 1VQ9A 2MO0A 2F52A 4KI0A 3RN2A 3GTQH 4R4OA 5DLQE 2VZAA 4GOPB 4GNXB 3PCOB 4POGA 1TWHH 4EQ5A 2NZHA 2ES2A 2UUBQ 4DV1Q 1N33L 1WYDA 3CXCA 1OXXK 2Z0SA 4ALPA 1PV4A 1CKNB 4NXNQ 1XNRL 2LXJA 2VNUD 4JBMA 1HR0Q 1X3GA 1HZBA 3CAMA 3G4SA 5HGQA 3CCLA 1VQLA 4A3JH 4LF5Q 2E2IH 1NMFA 1EYGA 3JAMc 4IJLA 5K36G 1VQIA 1O7IA 1YNXA 4PZ8A 4A76A 5LMUQ 4ME3A
chains in the Genus database with same CATH superfamily
3BJUA 1B3AA 3FKIH 5EJWA 2ICEC 1SYEA 1W3SA 1NBWA 1ILQA 1J9OA 1RF2D 2L4NA 4RCNA 5EKKA 4C3JB 1SFOB 1D2BA 2XVSA 3RN5A 1NJIC 2ZXRA 3U9OA 3WOFA 2NVXH 2F0VA 4EQPA 1WCMH 2N88A 3GTJB 1EOTA 2XWJB 5GROA 2PMZB 3K5OA 2QDBA 4HJ7A 5M5YB 1DZ1A 3HOUB 4APVA 1PZID 4DR2Q 4JI6Q 4DAVA 3KFUA 1S40A 2WP8J 1X32A 1YI2A 1LV9A 4JI2L 1SNMA 2H4OA 2R93G 3SVMA 4V190 1ZXTA 1RTOA 1ZYRC 3CCRA 2MUYA 4OEMB 4PQXA 2B2VC 4MTKA 5CV5A 1Q7YC 2NN6G 3RZOB 3NELA 4KK7A 3KF6A 4ME5A 4WORA 1JOQA 1MI2A 2JYOA 1P8LA 3VDYA 2BA0A 1F2ZA 2C35B 3HKSA 4WJ4A 1EIYB 2F0QA 4NXNL 2ZTDA 2KQ3A 2E75C 3A8IE 1CSPA 2N3SA 2VB3X 2JK8A 2QEJC 5KRUA 4RCOA 2N55A 2NN6I 3EFXD 1CSQA 2A5HA 3I91A 1II3A 4ZYSA 2QILA 2OEOA 5JEAG 1PH4A 3C3LA 1ENAA 3HOXB 2JA8B 2IPKD 3EJIA 1VQPA 4LFBL 3A55A 5A35A 1Y1WG 2IHFA 4F87A 3MA2B 4FVMA 4XDXA 5EAYA 4B3SQ 4HMJA 4A3FH 2FFKB 2E2JH 3M3YB 2KCNA 1EFID 4K6LA 2KHIA 3OWFA 4IQZA 4DNRB 4DR2L 4JI6L 1GD7A 1I6HH 2Z1CA 2NUCA 2GVBA 2CFMA 3CQZH 4A3LG 3LX0A 3KLWA 1XPOA 1UNSA 4U673 1S5BD 2CH4W 4XQJA 4DV2L 4DR1Q 1NMGA 1QE6A 1G51A 3TEHB 3HOYG 4QY7A 1XMQQ 1AE3A 3CU7A 1KABA 4PG3A 4C3IG 3I8ZA 1TS4A 5AFWA 1H9JA 2ENBA 1KTKA 3OIPA 4JBJA 1PFNA 1EU4A 5EBCA 3GV6A 4CDCC 3K7AH 3MVVA 5CBAE 2ZTCA 1SE8A 4O1NA 3I4MG 2PW5A 1JT8A 1ONLA 3PO3H 1X54A 2JA7H 3HG9A 1RODA 1SNOA 1L1OC 3S2HH 4C2MH 3T1HQ 3ULLA 1HNWQ 3UDGA 2B2TC 2EYHA 2JEBI 4DV0L 4JBKA 1XWEA 4RAUC 4BA2I 3I56A 3VYUA 4Y7NB 1A63A 3AFPA 4NMZA 1JJGA 2RHSB 4K6DA 3SXHA 4RWSC 5GQOA 4B3SL 1G6PA 2XRSD 2A69D 4HCEA 5ELCA 1EIFA 2HQEA 2OT2A 3S16H 3D8GA 1GHJA 4DUYQ 3HOVG 4O0AA 1GUTA 2NVTB 4FP5D 1VQNA 3SK4A 3H0GH 2Q8RE 3ZJYC 3KDFB 4UPAA 5CYUA 2Z9HA 3TDQA 2E5LL 2AHOB 3Q23A 2OQKA 1MJCA 4DR1L 2MPMA 1X3FA 1XMQL 1I4RA 2Y0SE 3KF8B 1GO3E 4JI5Q 4ILWA 5C44H 4HMIA 3J80L 1LACA 1EOVA 3TP6A 1Y1WB 1UUPA 3ND9A 5IY0A 1OTCA 5E4WC 4A3KG 5M3FG 3NXWA 2AUJD 1K0RA 3RR5A 1TWFH 2JXMB 2EY5A 4JG2A 4C3HB 3T1HL 1BCPB 1K73C 1HNWL 3RUZA 4JBWA 2KOLA 3V96A 3CCMA 5GADC 2CHBD 4LW1A 2A6ED 1AE2A 1EFWA 1AEXA 1HTLD 2FMCA 4MTNA 3S1NB 3TN2A 4CHTB 1D7QA 3I70A 1V1OA 4LF4Q 2D5DA 5IODA 4CKCA 1LTTD 4RHRA 3R2IA 3HOYB 1E2WA 3G6EA 3DWAA 3GTLB 1EIHA 1ML0D 3S2DH 1L2FA 2EYJA 3I73A 1SMYD 2HQLA 3BYTB 4RKBA 4GOPA 3MXGA 4IUQA 4DUYL 1STAA 1ESRA 1MSGA 4ZLTF 5JJZA 1WTPA 2PCFB 4GKKQ 5CV6A 1Q1EA 1MGSA 3OTOL 4IOCA 1PRTC 4UY8C 1PTOH 3QG1A 5CORA 3CKIB 4ZUJA 3GTKB 1EY8A 3H3VC 4HJ8A 4GLXA 1WJJA 2EXZA 4JI5L 4TSSA 2HDMA 3UE0A 4FF1A 4N8FA 4UP8A 1VQAA 4A3IG 1SE2A 2NTTA 2VNUD 2B2UC 4NB3A 1JE5A 3HS0C 1JCKB 1I3QH 1N36Q 1VQJA 2E2HB 1XNQL 2G5DA 2KUMA 3TZDA 4A4IA 4QB4A 3I4NG 1CZGA 5KGUA 3HOVB 1G6ZA 4OONA 2K52A 3JAML 2O5IC 1YHAA 1LYLA 5KEEA 4YCWA 5LL6X 4MIUA 3TP5A 4KTAA 1ICWA 4J1MA 2EJMA 1A62A 4A3BH 1TIID 3KYHC 4GS3A 3TS0A 3G48A 3J81L 3STBD 3FKIG 3T56B 1I4PA 3CHBD 4S3SA 1YJ9A 3U4VA 2JEAI 2Z6BA 4DK6C 3CD6A 3M4OB 3ND8A 2A6HC 2QCPX 1UE7A 2KVMA 4WRDA 1V9PA 2PO4A 5COYA 2J0TD 5M3MH 4A3KB 4FNFA 5M3FB 4GKKL 3BVZA 1WCMG 1IYVA 2OXPA 3QIAA 1IW7D 2ID0A 1U0LA 1K83H 1PLFA 4HJ5A 4KKTA 2I46A 3D4RA 1VF7A 1PZKD 1SJHD 4J6HA 3J80c 5FO9B 3A5UA 2CH4A 4DNIA 3WWVA 2K33A 2F0NA 3PUXA 1PDQA 1B70B 1B2TA 2PZUA 1FNUA 1B7YB 4OO1H 2V1CC 3KJPA 1BBXC 1Z7TA 3ITPA 3A5ZB 4KKUA 2F0PA 1PFMA 2JP1A 3E5SA 5ELOA 4A3EG 3DM3A 2F0GA 1PRTF 1X3EA 1S5DD 4IJHA 1KDCA 3CC7A 4DGZA 3RLOA 4A3GH 5C5MA 3ER0A 2HD3A 1VQHA 1QOHA 3TREA 3MAQA 2K1BA 3RNUA 3A7AB 3R2TA 5E7NA 1F9QA 4GN3B 1JMCA 4PMWA 3S15H 1HTPA 4O42A 4A75A 3F2BA 4MNOA 1VQOA 4P74A 4B3RQ 2L15A 4GKJQ 1C8CA 1TWCH 2K14A 3PUWA 3MFYA 1VQFA 3DUZA 4RGMA 1E2ZA 5IWAQ 2K5NA 2JE6I 2MNAA 1N32Q 1EQVA 1JC7A 2RHQB 3NENA 3EVQA 4A3IB 2ATWA 3S9WA 4N8X1 1BQQT 1SMXA 1GXDC 4C1NK 3GTPH 2TMPA 4R8IA 2DY7A 1I94Q 3I4NB 3P75A 3T13A 4KHZA 3FEWX 1SYDA 2EOTA 4R4OA 4B9WA 3PCOB 2K28A 1TWHH 2R3ZA 4DV1Q 1PV4A 5K36H 2PQEA 2H1EA 4JBMA 1X3GA 2AUKA 4J8QA 3CAMA 1SYCA 3ZYYX 3CCLA 4A3JH 2Z4IA 1NMFA 3FKIB 3JAMc 1EYGA 1VQIA 5LMUQ 5CV8A 3GTMB 2ZM6L 5J39A 2FMMA 5I9OA 4JI1L 2Q8TA 3HKZG 4BBSB 5IP7H 1STEA 5I6WA 2A68D 1WCMB 4I7ZC 3J81c 1JE4A 1KC8C 4BBRH 2HIVA 2PW7A 5IYCH 3OW7A 2F03A 2WB1E 5C6AA 1TS5A 4GKJL 1HNZQ 5DEHA 3J7YW 4IPHA 3Q22A 4DR3Q 3SK8A 2AWOA 5IWAL 2N8NA 5IIFA 4CJ1B 1N32L 4QCLA 2E76C 2X6LA 2LY7A 1TS2A 2K7VA 2TSSA 1L0YB 1D8LA 4A3EB 1TWGB 5LL6S 4JPBW 4NP5A 5M5XH 3NQTA 4QIWE 4AIMA 3BU2A 1I94L 5DAUA 2NZOA 1N9WA 4AQYL 4WFN3 5J1ZA 2IL8A 4DK1A 2VW9A 1FGBD 3AFQA 4QUFA 3H0GG 3O13A 4BWGB 1JWMD 4WJ3M 4DV1L 4DV5L 3EA6A 2F1MA 1B8AA 1E1OA 2A73B 2B29A 4IALA 2LSSA 4YWKA 3J81E 4LF7Q 2SNSA 4IUVA 4BY7H 4I65A 4POFA 4K2KA 4L8JA 3ERSX 5M5WH 5LMUL 1OXSC 4P71A 1K8GA 5C44G 1EEFD 2NVYH 5KNCA 3K8AA 3ERQA 1NUCA 1D6EC 2PNHA 2K01A 2RVLA 1ESFA 4TVAB 2F0KA 1VQ5A 1MIUA 2JA6G 3OHXC 2N49A 3MXPA 2VUMH 1KNAA 2XRQD 2D62A 2EYFA 2PMZE 1HPCA 4DR6L 5C3EG 5E1FA 1AW7A 1EUJA 5FJ8H 1PH1A 1TR5A 2DNEA 1HCZA 1CTMA 1BBUA 5IGDA 2WINB 5BN4A 1GUGA 1CQVA 1ICFB 3SDZA 2I5LX 5FOBB 1FGUA 1ZEQX 5LMNW 1UE1A 2CW0D 4DR5L 2L1BA 3CC4A 1DONA 3PO2G 2OCEA 3IRBA 2O4XA 4X3UA 2GVAA 1VQGA 4X64Q 5K5PA 1IBKQ 1KHIA 2BA1A 3D4WA 1KNEA 4OWTB 3KUPA 3S17H 3S1RB 3HKZB 4X66Q 1Y8PB 2AQ1B 4KLKA 3H91A 1JJCB 4A3MG 4PZ6A 4IFDG 3T51B 5JOBA 2QGQA 4G4KA 4K8JA 1O80A 3D4DA 2ZXPA 3T1YQ 3QOJA 2EY1A 2ZXOA 3FPUB 3N6RA 3M4PA 1F9RA 4X62Q 1H9SB 2K32A 5CV9A 3BZKA 2EYMA 2MFIA 1G8ZD 4FF3A 2JJQA 3U9SA 1BVSA 4DV4L 1CA6A 1YITA 1PHJA 5I2YA 4LWCA 4ZRZA 5C5LA 1W2BA 5JVG3 3S1MB 1T9HA 2YTVA 1HFNA 2L0CA 4IFDI 4DAMA 4HEDA 4A93H 1HNXQ 1BCPC 2B2WA 5EQ0A 4C1NI 5FLXE 4AH6A 1CQFA 3P1HA 4N9PA 2R92H 4OL7A 5DM63 3AB9A 4AYBE 3CRLC 5CV7A 4A3DB 3VYTA 2HUGA 1EYAA 5IYDH 3I3CA 1VQEA 1QWYA 1TT2A 1HZCA 4CKBA 4Q0FA 3S14B 2L55A 3F8TA 1EWIA 3VR2A 1IBMQ 5C44B 3A74A 4X64L 1JOKA 3I55A 3FRPB 4LF6Q 1Q8IA 1PH9A 3D6WA 1N8RC 1LTAD 2XN9C 5CV4A 4RA8A 4LF5L 3A7LA 5EKLA 2JA6B 3T1YL 5C3WA 4XT1B 5FO7B 1C4QA 1XNRQ 4L6TB 1RL2A 4X62L 1RTNA 2BE5D 5C3EB 1CKOA 1DCZA 1LTGD 1X56A 3I72A 3GV3A 3NPPA 1WI5A 4QGUA 3KF6B 1M8AA 4KD3A 4OO1G 2XGTA 1VQ7A 2B63H 1GM5A 4KY7A 5D3IB 3E9HA 1LTLA 1Y8OB 3J7AF 2F0OA 3PO2B 4OX9Q 1KL9A 2QKIC 2HCIA 3HOZH 3HGBA 1BBWA 3F2DA 1FNVA 1UAPA 3RZDB 4A3GG 4ABNA 3PV0A 4CKEA 3FPPA 1X9NA 5E4XA 4A3MB 4QQBX 4GNXA 2CWPA 4RG1A 5D14A 4OO1I 4YY3Q 4R4TA 4BXXG 2VQFQ 2AQ2B 4NW2A 3OYYA 1K0SA 1XTCD 3SR1A 3QR8A 2ZT9C 1BCPF 2H5XA 3GD7A 4DKAC 2HIXA 4GLVB 1XYIA 4CJ2C 2NVQB 1HQMC 4LF6L 4X3SA 3CW2C 2QF7A 2WAQE 1HXYD 2D2CC 3AMUA 1PH6A 1QUQA 1D1KA 3UE1A 4HIOA 4G57A 3U58A 1EQQA 1K9MC 1JB7A 5C4ZA 3F2UA 2Z6KA 2UXBQ 1IXRA 4O2DA 5KYLA 2VY3A 4IPDA 1I50H 3DEPA 1PH3A 2L5TA 4DAYA 3BVMA 1YEZA 3T53B 2R93B 3BDLA 4G7HC 5C0XG 1QG7A 1KDBA 2BH2A 1JQYD 3GTGH 1IL8A 1X6OA 4IUPA 4OX9L 3ICEA 1HUNA 4BY1G 1NCVA 2M00A 2JA5G 1EY9A 1GVPA 2Y0SG 5C4XG 1Q81C 1EY6A 1FL0A 1ZKOA 5IP7G 3SE0A 5C4JH 1L0WA 3PIPA 4C3JH 2NB0A 1B4OA 5FLMH 2B2YC 2VL6A 2LKVA 3EROA 4OXPA 2R7ZG 2OQ0A 4TQUS 4YY3L 1K83B 5C0XI 3D31A 4QF4A 2AQ3B 2VQEQ 2B8GA 4RGTA 3H94A 3Q24A 2RSOA 1WD1A 2F0TA 1K3BC 4M8AA 1YNNC 5M5YH 1K8AC 3HOUH 2XNAC 2LXKA 2ZJPA 1TXYA 3V05A 1QZGA 3EN2A 1SE3A 2K5HA 3D6CA 2A74C 4DV7Q 5C4HA 2V4DA 1A0IA 3DHQA 2IJ0A 1R9TB 3P20A 2ICIA 1MHWC 2Q2TA 5I4DA 3H09A 1CKMA 4FXGC 4A3GB 1GUSA 1C9OA 3MXNA 3RZOH 2EZVA 2DJFC 1EY4A 2F0DA 4NDXA 5ELFA 1NSNS 1O78A 1A3TA 1G2SA 2WACA 1YVCA 3WDNA 1D5MC 1EU3A 2IHEA 4RHSA 1DM0B 3S15B 2B2VA 2EJGC 2PYKA 2DUDA 4YHHQ 1YHBA 1STYA 4DV3Q 1FD7D 2YU9B 2WKCA 1IBLQ 4U68A 4C3IB 5IYBG 3CMAA 3GTOH 1D5XC 2UXCQ 4DV6Q 5EPLA 1Q8KA 4EQOA 1ET9A 4KY6A 1TQOA 1TWAB 2MP1A 5I2XA 3I4MB 2O2LD 4J15A 1X55A 2JA8H 4RMFA 4JOIC 2KCMA 1KDAA 2PI2E 1CZWA 1WTRA 3J80i 1SNQA 5KNDA 1F9SA 1STBA 2UUAQ 2NZ1D 4PZ7A 1H9RA 2VQEL 1YNJD 2KHSA 4L5RC 1Z6HA 3M3YH 3BS1A 1TWHB 2NTSA 2X69A 3VR4A 4HIDA 3OMGA 1VQ9A 2MO0A 2NWGA 3RN2A 1I4QA 3GTQH 5DLQE 3BDOA 1SSOA 4GOPB 4POGA 1EYCA 2NZHA 3VA7A 1WTWA 2ES2A 1WTVA 2UUBQ 2EY6A 1OXXK 2Z0SA 4ALPA 2LXJA 4GZYC 2RKSA 1HR0Q 1E2VA 4BY1B 2MHVA 4YIJA 3G4SA 3PMFA 1AZPA 1PTOD 3TP8A 1RCVD 2JA5B 1SDFA 1GUOA 2Y0SB 4IJLA 5C4XB 1U4RA 1YNXA 4PZ8A 3QWNA 1ASYA 4XTCS 4FYDA 4P75A 4BA1I 2R7ZB 3HRZC 1GUNA 2EDGA 2X6GA 4LF4L 1PYBA 1YBYA 4YHHL 4R1JA 1EL0A 1IBLL 4DFAA 1K8MA 5KIXA 3OPOA 1SYFA 1SE4A 4RH6A 3EIVA 4CBVA 2UXCL 2K04A 1RKNA 4DV6L 1Q1BA 1V1PA 3GO5A 1F2LA 2PI2A 4R9WA 1KD1C 4Y7NH 2K5VA 3HFZB 3T16A 5M9OA 3Q0AA 1L1OA 5CBEE 1YJNA 4R4IA 5M5XB 4I7AA 2EPBA 4LUOA 2D0PA 2F3WA 3TMEA 5CMDA 2F4VQ 1IYJB 1EWHA 3R8BA 2B2TA 2R92G 3W5OA 3FHWA 4ZUIA 4TRDA 4F8MA 1UE6A 5IP9H 2JA9A 3S24A 1SN8A 1BUVT 1OXVA 1QZHA 1I4GA 3J81j 1LABA 1JWSD 5IT9L 5IYDG 2NVTH 3HOWH 3VYRA 2ZJRA 1VF5C 3UDXA 5JAVA 3JAMi 3W1GA 4JCVE 3NP8A 1AN8A 1B3QA 4K5VA 1N36L 5D65A 1F2YA 1V43A 1QJOA 3CC2A 1PZJD 4B3MQ 5FKAC 4KKSA 1S4ZA 4DA2A 2K75A 1BR9A 3NWSA 2NVYB 2QDLA 3C1FA 2HCCA 1DOLA 2F0IA 2OWOA 1CT1D 5JEAH 4YWLA 4PMBA 3J81i 3PIP3 1VQKA 2R7DA 4F88A 2KEDA 2A69C 1UEAB 1JOOA 5J3BA 3OW2A 3UDIA 1Y1WH 2I07B 2L9HA 3A56A 1LTSD 2RDHA 3GQBA 3CCVA 1T5XD 3TQYA 1VDZA 1YJWA 5IGBA 5E3FA 1HR0W 3B6YA 3WOEA 4C3HH 1EWCA 4NKLA 3CPWA 2PQAA 5IGFA 1CFMA 3CP0A 1CHQD 4DR7Q 3NTIA 1ILPA 1Y8NB 2F0SA 3KLSA 3UDFA 1QILA 2B63G 3J7AV 3S1QB 1PA6A 4JC0A 3NBHA 1XTDA 3Q6SA 1Q86C 2AKWB 2EE1A 3PIO3 5G3LF 4A3LH 4DUZQ 3URYA 3S1NH 2IT1A 3TS2A 4A3FG 4LUZA 1CM9A 3K6OA 3BZDB 2E74C 3HOYH 3GTLH 5FLXL 3S17B 4P2CB 2B8FA 2RDGA 5EKIA 2QA4A 3KBXA 2IX3A 1UE5A 2E2IB 2K03A 1B50A 1BF4A 2UU9Q 1JR0D 5C3XA 3BDCA 1KAWA 1J8IA 2A6EC 5IGGA 3SK5A 3NTKA 1EZ8A 1O7ZA 5KNBA 3A0JA 4KHPQ 2AMCB 2WB1G 1AFPA 3FP9A 4JI0Q 3SEBA 3GTKH 1B9NA 1EEID 4DR4Q 1ZYRD 4B3ML 3J7ZC 4K8IA 5JJIA 2BCOA 1B1ZA 5JEAJ 2NVXB 2RQXA 3PO3G 1SMYC 2EXDA 1RD9D 2JA7G 5LMNQ 4HSVA 2SDFA 3E0EA 5IGCA 1E0BA 4XQQA 1DOKA 2YYZA 1LUZA 4LJZC 4MZ9A 4B3RL 4JI8Q 3OIQA 3M85A 2E2HH 3QOLA 2A1AA 1U4MA 1UEBA 3HOVH 3NBIA 4DR7L 4JV5Q 1EYDA 1KIXA 2B2UA 2EVBA 4LFCQ 2BDNA 4JI4Q 2F0HA 1G2TA 5GAEC 4B08A 1B44D 4DUZL 1CHPD 2YTYA 4LMQD 1VQCA 3W2DA 3I4OA 1HRJA 3CCJA 1K28A 2Q8IB 1AH9A 5IT9c 4KV6A 5FK9C 3BVGA 3J7A5 3M4OH 1LT5D 1A2UA 4C3JG 1OXTA 3HP3A 5JVH3 4KJNA 5NUCA 2ZJQA 2F0LA 1SNDA 2UU9L 3MFGA 3JC66 1VQ6A 4A3KH 2DJGC 4WJWA 4KHVA 2M2LA 5ELEA 2OF1A 4ID6A 2Q2UA 1FVIA 1JORA 4CDDC 2K5DA 1YNND 1O7YA 1N33Q 5ISRA 1U4LA 4DR4L 2CWAA 4QJFA 3FDTA 1SBBB 2B63B 3STBC 1JJ2A 2Q2IA 1O7LA 5LMNL 2LFNA 2F0MA 3MWYW 4A3FB 2E2JB 1TS3A 3UI2A 4JK1C 3IL8A 3MEFA 4FDBA 3K58A 2ASBA 2FJ2A 2G9HD 4KN4C 1HNZL 2F0UA 4DR3L 1I6HB 1IW7C 3X3NA 3M7NA 3CQZB 5IT9E 1EY0A 1NTGA 3MC0B 4JV5L 1S3OA 1TVXA 3M7GA 4LFCL 3FVQA 1XJVA 2E8GA 4YCVA 2L12A 1MJEA 5FLXc 1SRUA 2WB1B 1XMOQ 5IOCA 3ONAB 2M9VA 1NAPA 2NBFA 4H02A 3PF5A 1Y1VH 3K7AB 5EPKA 3M4QA 5FO8B 1EY5A 3CCUA 2BH8A 4JI2Q 4TKOB 2IY5B 2VS1A 3PO3B 2JA7B 3KLSX 1SNCA 1L0XB 4A3IH 4C2MB 4XXEA 3S2HB 3HZXA 1PH2A 3AQQA 4L5QA 2K5WA 1PFBA 3C1EA 4OIKA 4LF7L 2NYZD 2EJFC 4QIWB 3ULPA 2PNRC 3I4NH 1A15A 1SLJA 2HDLA 5EBDA 2MO1A 2IW3A 4AYBG 4LF8Q 3CMEA 1STGA 2C9OA 1PH7A 1M90C 4IN3A 1KXLA 5EPJA 2UUCQ 4UDUC 4GN5A 1H95A 1KRTA 4K2LA 4EGVA 2SEBD 3L0OA 3S16B 1JB3A 2RCFA 5BR8Q 3MEHA 4DF7A 1DGSA 2P5ZX 3GTMH 5C4JB 5GAGC 1GKHA 1A3UA 4ULLA 4OWXB 3H0GB 4XIGS 4LFBQ 3IFTA 1SYBA 2HT1A 4A3BG 5CR3A 1J5EQ 4BBSH 1A6XA 3TRZA 1FR3A 1LT3D 4BS9A 1EY7A 4OWWB 1U4PA 2EYPA 1I4XA 4GN4B 3AEVA 1MSHA 3PUVA 1HQRD 4P73A 5HY6A 5JJKA 1XMOL 3IAYA 2MJ8A 1M4VA 3K0XA 4IUUA 4JI7Q 1IBKL 4LNQA 1KLGD 3H3VH 2VB2X 4X66L 5M3MG 2QEXA 3F2CA 2O5JC 1NR2A 1TWFB 4DV2Q 2XSCA 3MZ5A 2RDFA 1NE3A 4A3EH 1E3PA 1TWGH 3A8JE 5IP9G 2A68C 1VQMA 2JSOA 3DXJC 4GLAC 3K80C 4L63B 1WOCA 5GAHC 2EY2A 4GOPC 1PRTD 2RF4A 1C7YA 1QNUA 4LF8L 3CPFA 3HOWG 2R7FA 3AYHB 2F0EA 4OHJA 3KOJA 2J7ZA 1FYCA 1BDOA 3G7LA 3K0YA 2UUCL 3T4AC 3S2DB 3GTOB 1HNXL 2EYOA 4CDEC 4DV0Q 2RA4A 1IHZA 4FF2A 3ULJA 3SGIA 1C0AA 1Q82C 1GHKA 1RDPD 1SAPA 5BR8L 3G71A 3VR6A 3EBEA 3H15A 3CF5A 1OXUA 5T1GA 3A8KE 1R4PB 2WAQG 3F1ZA 1NNXA 1Q12A 1RJTA 1H9MA 1PTOB 1J5EL 1CKNA 2FINB 4X6AH 1B9MA 1N34Q 1VQ8A 5ELDA 3D3RA 4C3HG 1E22A 1YZ6A 4ZK9B 5G3LD 1IBML 1PH8A 4AYBB 4Z9CB 3GTQB 1FNWA 4DN4M 4JI7L 4HCSA 1K8OA 2E5LQ 2Z4HA 3NE5B 2IWHA 2F0JA 1I3QB 2A6HD 1LTID 4GNXB 4LK1C 3N52A 1LTBD 1WYDA 3QB3A 1CKNB 1XNRL 5A2QE 3DWQA 4LAAA 1LT4D 5HGQA 1VQLA 1DXMA 4A3BB 5K36G 2OTJA 2LMCB 4HTHA 3S1RH 4ME3A 4NPSA 4JW0A 2XWBB 3RLFA 4MN3A 1OO9B 3LGJA 3PSIA 5BN5A 4A3JG 2A19A 4IUTA 2KBNA 3OMCA 1EQRA 2KJXA 5D3DA 1IZ6A 2PZWA 1PXUA 1QUQB 1V8QA 4OIJA 1WFQA 3I7FA 3LWUA 3KDFA 1M1KC 2CW0C 1BXTA 4RKLA 2KEEA 5M3MB 5H1SE 1SFOH 1DJRD 1QB5D 3BZCA 2LS01 4BBRG 5IYCG 4HAEA 3S1MH 4JYAQ 4DAYB 5JPNC 3NK9A 2VQFL 2UXDQ 2Z8LA 3KF8A 1PVOA 4G7ZC 1N34L 4PNYA 3GTJH 1E1TA 3DEOA 3VA5A 1MD2D 1GUWA 3NSWA 2K6AA 4FXKC 3LNNA 4KD4A 2RBMA 3MTSA 2B3GA 3HOWB 1SNPA 4DU9A 1HH2P 2PZTA 2EIFA 3R93A 4A3DH 4R4CA 3OTOQ 4HR7B 4R4QA 3PIOA 1QVGA 2BOSA 1C48A 3K7UC 4CDFC 3CCSA 5F2DA 3S14H 3K5LA 2UXBL 4XQNA 1E24A 4YCUA 4ZAIA 1VCIA 5BN3A 4EVOA 1HZ9A 1F2MA 2WAQB 1A8VA 1KAAA 1W6JA 1DYQA 2IX1A 4FF4A 3PF4A 1TY0A 1TWCB 4UP9A 1ENCA 4X65Q 1STHA 3PGZA 4LUVA 4BY7G 1XNQQ 2JA6H 1HUMA 5EGTA 4Y52H 4B3TQ 2HHHQ 1STNA 1VS0A 1F77A 5C3EH 4PV1C 3MXNB 1CUKA 2R61A 1PH5A 1MBYA 1EZ6A 5HURA 3HOXH 3SHLA 3GTPB 4OELB 1Y69U 3PUZA 4A3CH 4EX5A 4JYAL 2VUMG 4Q5VA 1Y14B 3E0JA 2UXDL 1X65A 3PO2H 2WIIB 2K5QA 3I90A 1HJPA 3VR3A 2YV5A 5J22A 5FJ8G 3K57A 4FXDA 3RZDH 3DMUA 1T5EA 4M1UB 1IKLA 1J6QA 5CC4A 4K5XA 4X3TA 2BE5C 4A3MH 1TY2A 2CQOA 1X3QA 4A3JB 4IFDH 2YTXA 4UAIA 3K59A 4DV7L 2F3VA 1CI3M 3TZUA 1YHQA 4DK0A 3E9IA 2GN5A 1V1QA 5TSSA 1B53A 1I5FA 1RHPA 1Y1VG 1CA5A 1S5ED 4XYQA 1YIJA 3I4LA 1ASZA 4DXGA 2NVQH 4BBRB 2D9UA 3MHBA 1XPUA 3KJOA 4H0LC 4X65L 1SR3A 3BYYB 4DV3L 4NXMQ 2N78A 4QL5A 1AP0A 1IYUA 4B3TL 1WTOA 2HHHL 2PPBC 4H7BA 3OSOA 1W6KA 1XPRA 1SYGA 5CGKA 1LM0A 1KQSA 4A93G 2R93H 1LTRD 2DGYA 3RMHA 1BNZA 4ZQ3A 3RLNA 3NEMA 5HGTA 3QO2A 2KCTA 1Z9FA 1U9RA 2QW7A 3E3XA 2NN6H 3RD4A 2UUAL 4UHVA 4K0KQ 4DXFA 4IO9A 3AU7A 5I9PA 3NHHA 4IUNA 1SXTA 4OGQC 4IURA 4H13C 4IOAA 1DOMA 1VQDA 4MHEA 4YWMA 2XIWA 2EQSA 4BBSG 1V1PB 1Q3LA 1MKHA 1S5FD 2I0QA 1TKWB 4IFDJ 2UUBL 4BY7B 4K14A 4IPGA 4DK3C 1LLRD 2F0FA 3M4YA 5M5WB 1HR0L 1L1OB 1K3RA 2K50A 1AZQA 1CK1A 1HHVA 1S5CD 1SJED 4QUCA 2SNMA 4KMUC 4KY5A 1GOZA 3NTHA 2B2YA 3C46A 4XT3B 1LO5D 2B39A 3R3OA 1HA6A 3HEJA 4JI3Q 1WTHA 2VUMB 1SEBD 4XYOA 4HIMA 4E6IA 4G7OC 1LT6D 1R4QB 3MXUA 5T1IA 2ZM6Q 1R9TH 4IZ8A 4NXML 1VMCA 4LF9Q 4JI1Q 2R6GA 4HJAA 2JQOA 4DAPA 1BOSA 4RGNA 5IE8A 3H3VI 4RGOS 3W3AA 4C56C 1XX8A 4DPGA 3CCEA 1WD0A 3KLRA 2AWNA 4BXXH 1FJGQ 3GDEA 3KBGA 3HOZG 1XXGA 5ELBA 2KA7A 2F4VL 3L2PA 5KYIA 1Y1VB 3GP7A 1X3PA 2YU9H 4X3KA 4K0KL 4C3IH 3J80E 1KRSA 2J4XA 1BCPD 2PQAB 1EIGA 3I4MH 1TWAH 1ET6A 3L9AX 1QCBD 3A54A 4EQNA 4P72A 2CCZA 1JWUD 3NBHB 2VXWA 4LFAQ 2B2WC 3FMCA 4ZCKA 5L37A 4AQYQ 3BG3A 3M9BA 4CJ0B 1D5ZC 3PQIA 2I5HA 3DM1A 2CQAA 3W1BA 3K5NA 1DD2A 2DN8A 5AJ3Q 1G291 3U4ZA 4HJ9A 1SROA 4DV5Q 5DNFA 4JOIA 3P7JA 1IL2A 3QJYA 1RIPA 4HN7A 4QMGA 1NY4A 4A93B 5C0XH 1HZAA 4JI3L 1PFSA 1QVFA 2WV6D 3D0FA 4HIKA 2R92B 1P16A 4BY1H 4V0BA 5I6YA 4LF9L 4R8NA 1WTQA 2F0WA 2JA5H 3L7ZC 2EYLA 1VQBA 5C4XH 3NUCA 3NWTA 2K4KA 1YNJC 2OTLA 2JN4A 5DM73 2R7ZH 3K81C 3TP7A 1KLUD 3NQIA 4H44C 1IKMA 1FJGL 4DR6Q 2I5MX 1PRTB 1NR4A 1E7ZA 1Q90A 1A2TA 2CKZB 1WTXA 5JJLA 5LHY1 2KCCA 3HKZE 4N9TA 5FLMG 1PTOC 3H6MA 4DR5Q 4DNTB 3G6JB 3V2TA 4RFBA 5M3FH 1HA5A 1Q46A 4LFAL 3EQLC 2A8VA 3I2ZA 4KHPL 1QVCA 3JAME 4KN7C 3DLLA 1ENFA 2IX0A 3U50C 3HOUG 4JI0L 2DY8A 2WFWA 3PUYA 3Q8DA 5AJ3L 3L3OC 4A3DG 4ZKCB 5JPMC 1GJXA 1I4HA 1TU2B 4KJOA 4GNXC 2KENA 3HOZB 5C0XJ 4PMCA 2RCNA 2CVRA 1UWVA 1JICA 2GA4B 5IYBH 4JI8L 1HFGA 1PYSB 3VYSA 4DV4Q 2ZTEA 5A2QL 1PMRA 4ZKBB 4UP7A 1VQ4A 4HSPA 2E2DC 1EQTA 1Z47A 4JI4L 1QNKA 2MQHA 1D1IA 2BDOA 3IFDA 4L5SA 1U5KA 5ELNA 3CCQA 2K05A 2C5CA 2D0OA 4CGYB 2G9DA 2RSNA 2FHTA 4IPCA 2FXQA 2Z6KC 2KECA 2F4IA 3TBIB 2DNCA 1PYWD 3KK7A 3OWEB 3LWEA 2KHJA 2F3IA 2SOBA 3OOCA 3TSSA 4FO2A 4JVZA 2XTIA 2ALYB 4K5WA 3HOXG 2JA8G 1BKBA 3E6ZX 2MGSA 3S1QH 4A3CG 1A3VA 1H9SA 1I6VC 4L5TA 3IKJA 3C2PA 5IGEA 1S72A 1G91A 1VMPA 2Q2HA 2F52A 3DWPA 1F9PA 4KI0A 2VZAA 1I50B 4F7XA 4ODGA 2L11A 4EQ5A 2WKDA 1N33L 3SK6A 3CXCA 4B9XA 4NXNQ 3X3MA 3K5MA 1HZBA 1WVLA 3VR5A 1H9KA 4LF5Q 1BO0A 2E2IH 1PTOF 3GTGB 1O7IA 3CRKC 4A76A
chains in the Genus database with same CATH topology
4NPSA 3RLFA 2ZM6L 1ASYA 4XTCS 3LGJA 3PSIA 3BJUA 4A3JG 4P75A 4BA1I 2A19A 2KBNA 4JI1L 3FKIH 1EQRA 1IZ6A 3HKZG 1QUQB 5IP7H 1W3SA 1NBWA 1WFQA 3I7FA 4LF4L 1PYBA 1YBYA 4YHHL 3J81c 4R1JA 4BBRH 1KC8C 3RN5A 2HIVA 3KDFA 5IYCH 1NJIC 1M1KC 1IBLL 2NVXH 2WB1E 5H1SE 3EIVA 1SFOH 4GKJL 2UXCL 1WCMH 1HNZQ 4DV6L 3BZCA 4DR3Q 1Q1BA 3GO5A 4IPHA 4BBRG 2AWOA 5IYCG 4JYAQ 5GROA 3S1MH 2PI2A 4DAYB 5IWAL 4HJ7A 2VQFL 2N8NA 4Y7NH 1KD1C 2UXDQ 2K5VA 3HFZB 1L1OA 1PVOA 1N34L 1YJNA 1N32L 4R4IA 4APVA 3GTJH 4DR2Q 4JI6Q 3KFUA 4LUOA 1E1TA 2D0PA 1S40A 2F4VQ 2WP8J 1IYJB 1YI2A 4JI2L 2R92G 1D8LA 3W5OA 2R93G 3FHWA 2B3GA 5IP9H 1UE6A 3CCRA 2JA9A 3S24A 5M5XH 1HH2P 1SN8A 2EIFA 4QIWE 4AIMA 3BU2A 1OXVA 1I94L 1QZHA 4A3DH 1Q7YC 2NZOA 1N9WA 2NN6G 4AQYL 3J81j 4R4CA 3OTOQ 4R4QA 3NELA 3PIOA 3KF6A 2VW9A 5IYDG 1QVGA 2NVTH 3HOWH 3AFQA 2ZJRA 3UDXA 3H0GG 1P8LA 3VDYA 3JAMi 3W1GA 4WJ3M 4DV1L 2BA0A 3K7UC 2C35B 3HKSA 4JCVE 3CCSA 4DV5L 3S14H 1EIYB 4NXNL 2UXBL 4WJ4A 1B8AA 1E1OA 2ZTDA 1E24A 2B29A 1N36L 2LSSA 4YWKA 4YCUA 1V43A 3CC2A 4LF7Q 1VCIA 4B3MQ 1HZ9A 2K75A 1CSPA 4BY7H 2N3SA 1A8VA 4POFA 2JK8A 2OWOA 3ERSX 5M5WH 5LMUL 4YWLA 3J81i 1OXSC 4P71A 1K8GA 1VQKA 2IX1A 2R7DA 5C44G 3PF4A 2NN6I 4UP9A 1CSQA 4X65Q 5J3BA 3PGZA 4LUVA 4BY7G 1XNQQ 2NVYH 3UDIA 3OW2A 1Y1WH 2JA6H 3K8AA 2PNHA 5JEAG 1PH4A 4Y52H 4B3TQ 3CCVA 3TQYA 2HHHQ 4TVAB 1YJWA 1VS0A 1VQPA 5C3EH 4LFBL 1HR0W 3B6YA 1MIUA 4C3HH 1Y1WG 2N49A 2IHFA 1VQ5A 2JA6G 2VUMH 3CPWA 3MXNB 1CUKA 2PQAA 1PH5A 2D62A 2PMZE 5EAYA 4DR6L 3CP0A 3HOXH 4DR7Q 4B3SQ 3UDFA 5C3EG 4A3FH 2B63G 1EUJA 3PUZA 5FJ8H 1PH1A 2E2JH 1PA6A 4JC0A 4A3CH 4EX5A 4JYAL 2VUMG 1Y14B 1XTDA 1BBUA 2UXDL 1Q86C 2AKWB 1X65A 4A3LH 3PO2H 4DUZQ 3S1NH 1HJPA 2IT1A 2KHIA 3TS2A 4A3FG 2YV5A 4LUZA 5FJ8G 4DR2L 4JI6L 1GD7A 1I6HH 2I5LX 2GVBA 1FGUA 3RZDH 2CFMA 3CQZH 1UE1A 5LMNW 4DR5L 3HOYH 4A3LG 3CC4A 3GTLH 1XPOA 3KLWA 3PO2G 1J6QA 2OCEA 3IRBA 2QA4A 2GVAA 1VQGA 4X64Q 4DV2L 1UE5A 2CQOA 4DR1Q 4A3MH 1NMGA 2YTXA 1G51A 3TEHB 1KHIA 2BA1A 1IBKQ 4QY7A 3HOYG 1XMQQ 4DV7L 1AE3A 4OWTB 3S17H 1YHQA 2UU9Q 4PG3A 3E9IA 4X66Q 2GN5A 4KLKA 1V1QA 1JJCB 1KAWA 4A3MG 4JBJA 4PZ6A 4IFDG 1I5FA 1Y1VG 3K7AH 1YIJA 2QGQA 3A0JA 3T1YQ 4KHPQ 2ZTCA 1SE8A 3I4MG 2AMCB 2WB1G 1JT8A 3FP9A 4JI0Q 1ASZA 3PO3H 1X54A 3GTKH 3M4PA 2JA7H 4X62Q 4DR4Q 4B3ML 2NVQH 1L1OC 3S2HH 4C2MH 3T1HQ 3J7ZC 3BZKA 3ULLA 1HNWQ 5JJIA 2MFIA 5JEAJ 3UDGA 1XPUA 3KJOA 2JJQA 3PO3G 2EXDA 1BVSA 4DV4L 2JEBI 2JA7G 4DV0L 5LMNQ 4X65L 1YITA 1PHJA 1SR3A 4LWCA 4JBKA 4DV3L 1W2BA 3E0EA 2N78A 4QL5A 4NXMQ 4BA2I 3I56A 1T9HA 2YTVA 2YYZA 1A63A 4IFDI 4DAMA 4B3TL 1LUZA 3AFPA 4MZ9A 2HHHL 4A93H 4B3RL 1HNXQ 4JI8Q 1JJGA 3M85A 2E2HH 2RHSB 1XPRA 2A1AA 4AH6A 1LM0A 1UEBA 3HOVH 2R92H 1KQSA 4DR7L 4JV5Q 5GQOA 4A93G 2R93H 4AYBE 1KIXA 4B3SL 1G6PA 2DGYA 4LFCQ 4JI4Q 3RLNA 1EIFA 3NEMA 2KCTA 1Z9FA 3S16H 5GAEC 4DUYQ 3HOVG 2UUAL 4K0KQ 4DUZL 4O0AA 5IYDH 2YTYA 1VQNA 1VQCA 1VQEA 4IO9A 3I4OA 3H0GH 3CCJA 3ZJYC 3KDFB 4UPAA 1HZCA 2E5LL 1AH9A 4IOAA 4YWMA 1VQDA 5IT9c 2EQSA 3F8TA 2AHOB 4BBSG 1EWIA 3J7A5 3M4OH 2OQKA 1IBMQ 1OXTA 3A74A 1MJCA 4X64L 4DR1L 1MKHA 2I0QA 4IFDJ 3I55A 2UUBL 4LF6Q 4IPGA 1PH9A 2ZJQA 1X3FA 4DK3C 1XMQL 1N8RC 2Y0SE 2UU9L 3KF8B 3JC66 1HR0L 1L1OB 1GO3E 4A3KH 4JI5Q 1VQ6A 1K3RA 5C44H 2K50A 4LF5L 1EOVA 2Q2UA 1FVIA 3T1YL 5IY0A 1N33Q 1OTCA 4A3KG 1XNRQ 5M3FG 1RL2A 1K0RA 4DR4L 3RR5A 4X62L 2CWAA 4QJFA 1TWFH 1CKOA 1X56A 4JG2A 4JI3Q 1WI5A 3STBC 3T1HL 1JJ2A 1K73C 2Q2IA 1HNWL 4QGUA 3KF6B 4JBWA 4HIMA 3CCMA 5GADC 4LW1A 4OO1G 5LMNL 2XGTA 2ZM6Q 1R9TH 1VQ7A 2B63H 1GM5A 1AE2A 4NXML 4LF9Q 1EFWA 4JI1Q 2R6GA 3E9HA 3MEFA 1LTLA 4FDBA 4HJAA 2ASBA 4OX9Q 1KL9A 4MTNA 1D7QA 2JQOA 3HOZH 5IE8A 3H3VI 1HNZL 1BBWA 4DR3L 4LF4Q 3F2DA 3M7NA 4A3GG 4DPGA 3PV0A 3G6EA 3CCEA 2AWNA 1NTGA 4BXXH 3S2DH 1FJGQ 3GDEA 4JV5L 1L2FA 1S3OA 3HOZG 2HQLA 4LFCL 1X9NA 1XJVA 4QQBX 4GOPA 2F4VL 3L2PA 4GNXA 2CWPA 4RG1A 2E8GA 4YCVA 1MJEA 5FLXc 2YU9H 4DUYL 4OO1I 4YY3Q 4R4TA 1SRUA 4BXXG 4K0KL 2VQFQ 4C3IH 1XMOQ 1KRSA 3OYYA 4GKKQ 4H02A 3PF5A 1Y1VH 1Q1EA 3M4QA 2PQAB 2H5XA 3OTOL 4IOCA 4UY8C 3GD7A 1TWAH 3I4MH 3CCUA 2BH8A 4JI2Q 2IY5B 4DKAC 2HIXA 2VS1A 4GLVB 4P72A 2CCZA 4HJ8A 4LF6L 3NBHB 3CW2C 4LFAQ 4GLXA 4A3IH 2WAQE 1WJJA 4AQYQ 3M9BA 1PH2A 4JI5L 3AQQA 4L5QA 1PH6A 1QUQA 3UE0A 4LF7L 2I5HA 3W1BA 3UE1A 4UP8A 1VQAA 5AJ3Q 4HIOA 1G291 3ULPA 3U58A 4A3IG 1EQQA 4NB3A 3U4ZA 1K9MC 1JB7A 4HJ9A 1SROA 1JE5A 4DV5Q 1SLJA 3I4NH 2Z6KA 4JOIA 2UXBQ 1IXRA 1IL2A 2MO1A 1RIPA 4O2DA 4AYBG 1NY4A 4LF8Q 1I3QH 2VY3A 4IPDA 1VQJA 3CMEA 1N36Q 1I50H 1HZAA 1XNQL 4JI3L 4A4IA 1PH3A 1PFSA 1QVFA 1PH7A 1M90C 3I4NG 1KXLA 1YEZA 4HIKA 3D0FA 4OONA 2UUCQ 1P16A 2K52A 4GN5A 1YHAA 1LYLA 4BY1H 5C0XG 1KRTA 1H95A 4YCWA 3L0OA 4LF9L 2BH2A 2JA5H 2OTJA 5BR8Q 3L7ZC 3S1RH 3GTGH 1A62A 1VQBA 5C4XH 1DGSA 1X6OA 4OX9L 3ICEA 4A3BH 2K4KA 3GTMH 4BY1G 5GAGC 3KYHC 1GKHA 4GS3A 4OWXB 4XIGS 2OTLA 3TS0A 3G48A 4LFBQ 2JA5G 2R7ZH 1GVPA 3K81C 2Y0SG 3FKIG 3STBD 2HT1A 4A3BG 5C4XG 1Q81C 1FJGL 1YJ9A 3U4VA 1J5EQ 1FL0A 2JEAI 5IP7G 3TRZA 5C4JH 4DK6C 3CD6A 1L0WA 3PIPA 4BBSH 2I5MX 4C3JH 4OWWB 4DR6Q 1UE7A 3AEVA 1E7ZA 4GN4B 5FLMH 2VL6A 2CKZB 4OXPA 3PUVA 2R7ZG 5JJLA 1V9PA 2OQ0A 4P73A 4TQUS 4YY3L 5HY6A 5C0XI 5JJKA 3D31A 1XMOL 5M3MH 3HKZE 4GKKL 2VQEQ 1WCMG 5FLMG 3K0XA 4JI7Q 1IBKL 2ID0A 4LNQA 1U0LA 3H3VH 1K83H 4HJ5A 4DR5Q 4X66L 5M5YH 5M3MG 1K8AC 3HOUH 2QEXA 3F2CA 3A5UA 2LXKA 3J80c 5M3FH 1Q46A 2ZJPA 1TXYA 4DV2Q 1QZGA 4LFAL 2A8VA 3I2ZA 4KHPL 3EN2A 4DNIA 1QVCA 3DLLA 3WWVA 2K5HA 3PUXA 1NE3A 4DV7Q 2IX0A 3U50C 3HOUG 4A3EH 1E3PA 1B70B 1TWGH 4JI0L 1A0IA 5IP9G 2WFWA 1VQMA 1B7YB 3PUYA 3Q8DA 2V1CC 3KJPA 5AJ3L 2Q2TA 4GLAC 3K80C 3A5ZB 4A3DG 1CKMA 1WOCA 5GAHC 1C9OA 4GOPC 5ELOA 4A3EG 4GNXC 2RF4A 1C7YA 3RZOH 2KENA 3DM3A 3CPFA 4LF8L 3HOWG 2R7FA 3AYHB 1X3EA 5C0XJ 4IJHA 2RCNA 3CC7A 1YVCA 1UWVA 3KOJA 2IHEA 3RLOA 4A3GH 3ER0A 2UUCL 1VQHA 3TREA 5IYBH 1HNXL 4JI8L 1PYSB 3RNUA 4DV4Q 2ZTEA 5E7NA 2DUDA 4YHHQ 4DV0Q 1YHBA 3ULJA 3SGIA 1C0AA 1Q82C 4DV3Q 4GN3B 4UP7A 1VQ4A 5BR8L 1IBLQ 4PMWA 1JMCA 3S15H 3G71A 3EBEA 5IYBG 3CMAA 3H15A 4A75A 3CF5A 3GTOH 1OXUA 1Z47A 3F2BA 4MNOA 1VQOA 4P74A 4JI4L 2L15A 4B3RQ 4GKJQ 2UXCQ 1TWCH 2MQHA 4DV6Q 2K14A 3PUWA 4L5SA 1U5KA 1VQFA 2WAQG 1Q8KA 1Q12A 3F1ZA 5ELNA 3CCQA 5IWAQ 2D0OA 1J5EL 1CKNA 4X6AH 2K5NA 4J15A 2JE6I 1X55A 2JA8H 4IPCA 2MNAA 2FXQA 2Z6KC 4RMFA 4JOIC 1N34Q 1VQ8A 2KCMA 1N32Q 1E22A 2RHQB 1YZ6A 3NENA 2PI2E 2ATWA 2KHJA 2F3IA 3J80i 1SMXA 2XTIA 2ALYB 2UUAQ 4PZ7A 3HOXG 1PH8A 1IBML 2JA8G 1BKBA 2VQEL 3GTPH 4L5RC 4JI7L 3M3YH 3S1QH 4A3CG 4L5TA 1I94Q 2E5LQ 1S72A 4HIDA 2Q2HA 4KHZA 1VQ9A 2MO0A 2F52A 4KI0A 3RN2A 3GTQH 4R4OA 5DLQE 2VZAA 4GOPB 4GNXB 3PCOB 4POGA 1TWHH 4EQ5A 2NZHA 2ES2A 2UUBQ 4DV1Q 1N33L 1WYDA 3CXCA 1OXXK 2Z0SA 4ALPA 1PV4A 1CKNB 4NXNQ 1XNRL 2LXJA 2VNUD 4JBMA 1HR0Q 1X3GA 1HZBA 3CAMA 3G4SA 5HGQA 3CCLA 1VQLA 4A3JH 4LF5Q 2E2IH 1NMFA 1EYGA 3JAMc 4IJLA 5K36G 1VQIA 1O7IA 1YNXA 4PZ8A 4A76A 5LMUQ 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPS A;  3RLF A;  2ZM6 L;  1ASY A;  4XTC S;  3LGJ A;  3PSI A;  3BJU A;  4A3J G;  4P75 A;  4BA1 I;  2A19 A;  2KBN A;  4JI1 L;  3FKI H;  1EQR A;  1IZ6 A;  3HKZ G;  1QUQ B;  5IP7 H;  1W3S A;  1NBW A;  1WFQ A;  3I7F A;  4LF4 L;  1PYB A;  1YBY A;  4YHH L;  3J81 c;  4R1J A;  4BBR H;  1KC8 C;  3RN5 A;  2HIV A;  3KDF A;  5IYC H;  1NJI C;  1M1K C;  1IBL L;  2NVX H;  2WB1 E;  5H1S E;  3EIV A;  1SFO H;  4GKJ L;  2UXC L;  1WCM H;  1HNZ Q;  4DV6 L;  3BZC A;  4DR3 Q;  1Q1B A;  3GO5 A;  4IPH A;  4BBR G;  2AWO A;  5IYC G;  4JYA Q;  5GRO A;  3S1M H;  2PI2 A;  4DAY B;  5IWA L;  4HJ7 A;  2VQF L;  2N8N A;  4Y7N H;  1KD1 C;  2UXD Q;  2K5V A;  3HFZ B;  1L1O A;  1PVO A;  1N34 L;  1YJN A;  1N32 L;  4R4I A;  4APV A;  3GTJ H;  4DR2 Q;  4JI6 Q;  3KFU A;  4LUO A;  1E1T A;  2D0P A;  1S40 A;  2F4V Q;  2WP8 J;  1IYJ B;  1YI2 A;  4JI2 L;  2R92 G;  1D8L A;  3W5O A;  2R93 G;  3FHW A;  2B3G A;  5IP9 H;  1UE6 A;  3CCR A;  2JA9 A;  3S24 A;  5M5X H;  1HH2 P;  1SN8 A;  2EIF A;  4QIW E;  4AIM A;  3BU2 A;  1OXV A;  1I94 L;  1QZH A;  4A3D H;  1Q7Y C;  2NZO A;  1N9W A;  2NN6 G;  4AQY L;  3J81 j;  4R4C A;  3OTO Q;  4R4Q A;  3NEL A;  3PIO A;  3KF6 A;  2VW9 A;  5IYD G;  1QVG A;  2NVT H;  3HOW H;  3AFQ A;  2ZJR A;  3UDX A;  3H0G G;  1P8L A;  3VDY A;  3JAM i;  3W1G A;  4WJ3 M;  4DV1 L;  2BA0 A;  3K7U C;  2C35 B;  3HKS A;  4JCV E;  3CCS A;  4DV5 L;  3S14 H;  1EIY B;  4NXN L;  2UXB L;  4WJ4 A;  1B8A A;  1E1O A;  2ZTD A;  1E24 A;  2B29 A;  1N36 L;  2LSS A;  4YWK A;  4YCU A;  1V43 A;  3CC2 A;  4LF7 Q;  1VCI A;  4B3M Q;  1HZ9 A;  2K75 A;  1CSP A;  4BY7 H;  2N3S A;  1A8V A;  4POF A;  2JK8 A;  2OWO A;  3ERS X;  5M5W H;  5LMU L;  4YWL A;  3J81 i;  1OXS C;  4P71 A;  1K8G A;  1VQK A;  2IX1 A;  2R7D A;  5C44 G;  3PF4 A;  2NN6 I;  4UP9 A;  1CSQ A;  4X65 Q;  5J3B A;  3PGZ A;  4LUV A;  4BY7 G;  1XNQ Q;  2NVY H;  3UDI A;  3OW2 A;  1Y1W H;  2JA6 H;  3K8A A;  2PNH A;  5JEA G;  1PH4 A;  4Y52 H;  4B3T Q;  3CCV A;  3TQY A;  2HHH Q;  4TVA B;  1YJW A;  1VS0 A;  1VQP A;  5C3E H;  4LFB L;  1HR0 W;  3B6Y A;  1MIU A;  4C3H H;  1Y1W G;  2N49 A;  2IHF A;  1VQ5 A;  2JA6 G;  2VUM H;  3CPW A;  3MXN B;  1CUK A;  2PQA A;  1PH5 A;  2D62 A;  2PMZ E;  5EAY A;  4DR6 L;  3CP0 A;  3HOX H;  4DR7 Q;  4B3S Q;  3UDF A;  5C3E G;  4A3F H;  2B63 G;  1EUJ A;  3PUZ A;  5FJ8 H;  1PH1 A;  2E2J H;  1PA6 A;  4JC0 A;  4A3C H;  4EX5 A;  4JYA L;  2VUM G;  1Y14 B;  1XTD A;  1BBU A;  2UXD L;  1Q86 C;  2AKW B;  1X65 A;  4A3L H;  3PO2 H;  4DUZ Q;  3S1N H;  1HJP A;  2IT1 A;  2KHI A;  3TS2 A;  4A3F G;  2YV5 A;  4LUZ A;  5FJ8 G;  4DR2 L;  4JI6 L;  1GD7 A;  1I6H H;  2I5L X;  2GVB A;  1FGU A;  3RZD H;  2CFM A;  3CQZ H;  1UE1 A;  5LMN W;  4DR5 L;  3HOY H;  4A3L G;  3CC4 A;  3GTL H;  1XPO A;  3KLW A;  3PO2 G;  1J6Q A;  2OCE A;  3IRB A;  2QA4 A;  2GVA A;  1VQG A;  4X64 Q;  4DV2 L;  1UE5 A;  2CQO A;  4DR1 Q;  4A3M H;  1NMG A;  2YTX A;  1G51 A;  3TEH B;  1KHI A;  2BA1 A;  1IBK Q;  4QY7 A;  3HOY G;  1XMQ Q;  4DV7 L;  1AE3 A;  4OWT B;  3S17 H;  1YHQ A;  2UU9 Q;  4PG3 A;  3E9I A;  4X66 Q;  2GN5 A;  4KLK A;  1V1Q A;  1JJC B;  1KAW A;  4A3M G;  4JBJ A;  4PZ6 A;  4IFD G;  1I5F A;  1Y1V G;  3K7A H;  1YIJ A;  2QGQ A;  3A0J A;  3T1Y Q;  4KHP Q;  2ZTC A;  1SE8 A;  3I4M G;  2AMC B;  2WB1 G;  1JT8 A;  3FP9 A;  4JI0 Q;  1ASZ A;  3PO3 H;  1X54 A;  3GTK H;  3M4P A;  2JA7 H;  4X62 Q;  4DR4 Q;  4B3M L;  2NVQ H;  1L1O C;  3S2H H;  4C2M H;  3T1H Q;  3J7Z C;  3BZK A;  3ULL A;  1HNW Q;  5JJI A;  2MFI A;  5JEA J;  3UDG A;  1XPU A;  3KJO A;  2JJQ A;  3PO3 G;  2EXD A;  1BVS A;  4DV4 L;  2JEB I;  2JA7 G;  4DV0 L;  5LMN Q;  4X65 L;  1YIT A;  1PHJ A;  1SR3 A;  4LWC A;  4JBK A;  4DV3 L;  1W2B A;  3E0E A;  2N78 A;  4QL5 A;  4NXM Q;  4BA2 I;  3I56 A;  1T9H A;  2YTV A;  2YYZ A;  1A63 A;  4IFD I;  4DAM A;  4B3T L;  1LUZ A;  3AFP A;  4MZ9 A;  2HHH L;  4A93 H;  4B3R L;  1HNX Q;  4JI8 Q;  1JJG A;  3M85 A;  2E2H H;  2RHS B;  1XPR A;  2A1A A;  4AH6 A;  1LM0 A;  1UEB A;  3HOV H;  2R92 H;  1KQS A;  4DR7 L;  4JV5 Q;  5GQO A;  4A93 G;  2R93 H;  4AYB E;  1KIX A;  4B3S L;  1G6P A;  2DGY A;  4LFC Q;  4JI4 Q;  3RLN A;  1EIF A;  3NEM A;  2KCT A;  1Z9F A;  3S16 H;  5GAE C;  4DUY Q;  3HOV G;  2UUA L;  4K0K Q;  4DUZ L;  4O0A A;  5IYD H;  2YTY A;  1VQN A;  1VQC A;  1VQE A;  4IO9 A;  3I4O A;  3H0G H;  3CCJ A;  3ZJY C;  3KDF B;  4UPA A;  1HZC A;  2E5L L;  1AH9 A;  4IOA A;  4YWM A;  1VQD A;  5IT9 c;  2EQS A;  3F8T A;  2AHO B;  4BBS G;  1EWI A;  3J7A 5;  3M4O H;  2OQK A;  1IBM Q;  1OXT A;  3A74 A;  1MJC A;  4X64 L;  4DR1 L;  1MKH A;  2I0Q A;  4IFD J;  3I55 A;  2UUB L;  4LF6 Q;  4IPG A;  1PH9 A;  2ZJQ A;  1X3F A;  4DK3 C;  1XMQ L;  1N8R C;  2Y0S E;  2UU9 L;  3KF8 B;  3JC6 6;  1HR0 L;  1L1O B;  1GO3 E;  4A3K H;  4JI5 Q;  1VQ6 A;  1K3R A;  5C44 H;  2K50 A;  4LF5 L;  1EOV A;  2Q2U A;  1FVI A;  3T1Y L;  5IY0 A;  1N33 Q;  1OTC A;  4A3K G;  1XNR Q;  5M3F G;  1RL2 A;  1K0R A;  4DR4 L;  3RR5 A;  4X62 L;  2CWA A;  4QJF A;  1TWF H;  1CKO A;  1X56 A;  4JG2 A;  4JI3 Q;  1WI5 A;  3STB C;  3T1H L;  1JJ2 A;  1K73 C;  2Q2I A;  1HNW L;  4QGU A;  3KF6 B;  4JBW A;  4HIM A;  3CCM A;  5GAD C;  4LW1 A;  4OO1 G;  5LMN L;  2XGT A;  2ZM6 Q;  1R9T H;  1VQ7 A;  2B63 H;  1GM5 A;  1AE2 A;  4NXM L;  4LF9 Q;  1EFW A;  4JI1 Q;  2R6G A;  3E9H A;  3MEF A;  1LTL A;  4FDB A;  4HJA A;  2ASB A;  4OX9 Q;  1KL9 A;  4MTN A;  1D7Q A;  2JQO A;  3HOZ H;  5IE8 A;  3H3V I;  1HNZ L;  1BBW A;  4DR3 L;  4LF4 Q;  3F2D A;  3M7N A;  4A3G G;  4DPG A;  3PV0 A;  3G6E A;  3CCE A;  2AWN A;  1NTG A;  4BXX H;  3S2D H;  1FJG Q;  3GDE A;  4JV5 L;  1L2F A;  1S3O A;  3HOZ G;  2HQL A;  4LFC L;  1X9N A;  1XJV A;  4QQB X;  4GOP A;  2F4V L;  3L2P A;  4GNX A;  2CWP A;  4RG1 A;  2E8G A;  4YCV A;  1MJE A;  5FLX c;  2YU9 H;  4DUY L;  4OO1 I;  4YY3 Q;  4R4T A;  1SRU A;  4BXX G;  4K0K L;  2VQF Q;  4C3I H;  1XMO Q;  1KRS A;  3OYY A;  4GKK Q;  4H02 A;  3PF5 A;  1Y1V H;  1Q1E A;  3M4Q A;  2PQA B;  2H5X A;  3OTO L;  4IOC A;  4UY8 C;  3GD7 A;  1TWA H;  3I4M H;  3CCU A;  2BH8 A;  4JI2 Q;  2IY5 B;  4DKA C;  2HIX A;  2VS1 A;  4GLV B;  4P72 A;  2CCZ A;  4HJ8 A;  4LF6 L;  3NBH B;  3CW2 C;  4LFA Q;  4GLX A;  4A3I H;  2WAQ E;  1WJJ A;  4AQY Q;  3M9B A;  1PH2 A;  4JI5 L;  3AQQ A;  4L5Q A;  1PH6 A;  1QUQ A;  3UE0 A;  4LF7 L;  2I5H A;  3W1B A;  3UE1 A;  4UP8 A;  1VQA A;  5AJ3 Q;  4HIO A;  1G29 1;  3ULP A;  3U58 A;  4A3I G;  1EQQ A;  4NB3 A;  3U4Z A;  1K9M C;  1JB7 A;  4HJ9 A;  1SRO A;  1JE5 A;  4DV5 Q;  1SLJ A;  3I4N H;  2Z6K A;  4JOI A;  2UXB Q;  1IXR A;  1IL2 A;  2MO1 A;  1RIP A;  4O2D A;  4AYB G;  1NY4 A;  4LF8 Q;  1I3Q H;  2VY3 A;  4IPD A;  1VQJ A;  3CME A;  1N36 Q;  1I50 H;  1HZA A;  1XNQ L;  4JI3 L;  4A4I A;  1PH3 A;  1PFS A;  1QVF A;  1PH7 A;  1M90 C;  3I4N G;  1KXL A;  1YEZ A;  4HIK A;  3D0F A;  4OON A;  2UUC Q;  1P16 A;  2K52 A;  4GN5 A;  1YHA A;  1LYL A;  4BY1 H;  5C0X G;  1KRT A;  1H95 A;  4YCW A;  3L0O A;  4LF9 L;  2BH2 A;  2JA5 H;  2OTJ A;  5BR8 Q;  3L7Z C;  3S1R H;  3GTG H;  1A62 A;  1VQB A;  5C4X H;  1DGS A;  1X6O A;  4OX9 L;  3ICE A;  4A3B H;  2K4K A;  3GTM H;  4BY1 G;  5GAG C;  3KYH C;  1GKH A;  4GS3 A;  4OWX B;  4XIG S;  2OTL A;  3TS0 A;  3G48 A;  4LFB Q;  2JA5 G;  2R7Z H;  1GVP A;  3K81 C;  2Y0S G;  3FKI G;  3STB D;  2HT1 A;  4A3B G;  5C4X G;  1Q81 C;  1FJG L;  1YJ9 A;  3U4V A;  1J5E Q;  1FL0 A;  2JEA I;  5IP7 G;  3TRZ A;  5C4J H;  4DK6 C;  3CD6 A;  1L0W A;  3PIP A;  4BBS H;  2I5M X;  4C3J H;  4OWW B;  4DR6 Q;  1UE7 A;  3AEV A;  1E7Z A;  4GN4 B;  5FLM H;  2VL6 A;  2CKZ B;  4OXP A;  3PUV A;  2R7Z G;  5JJL A;  1V9P A;  2OQ0 A;  4P73 A;  4TQU S;  4YY3 L;  5HY6 A;  5C0X I;  5JJK A;  3D31 A;  1XMO L;  5M3M H;  3HKZ E;  4GKK L;  2VQE Q;  1WCM G;  5FLM G;  3K0X A;  4JI7 Q;  1IBK L;  2ID0 A;  4LNQ A;  1U0L A;  3H3V H;  1K83 H;  4HJ5 A;  4DR5 Q;  4X66 L;  5M5Y H;  5M3M G;  1K8A C;  3HOU H;  2QEX A;  3F2C A;  3A5U A;  2LXK A;  3J80 c;  5M3F H;  1Q46 A;  2ZJP A;  1TXY A;  4DV2 Q;  1QZG A;  4LFA L;  2A8V A;  3I2Z A;  4KHP L;  3EN2 A;  4DNI A;  1QVC A;  3DLL A;  3WWV A;  2K5H A;  3PUX A;  1NE3 A;  4DV7 Q;  2IX0 A;  3U50 C;  3HOU G;  4A3E H;  1E3P A;  1B70 B;  1TWG H;  4JI0 L;  1A0I A;  5IP9 G;  2WFW A;  1VQM A;  1B7Y B;  3PUY A;  3Q8D A;  2V1C C;  3KJP A;  5AJ3 L;  2Q2T A;  4GLA C;  3K80 C;  3A5Z B;  4A3D G;  1CKM A;  1WOC A;  5GAH C;  1C9O A;  4GOP C;  5ELO A;  4A3E G;  4GNX C;  2RF4 A;  1C7Y A;  3RZO H;  2KEN A;  3DM3 A;  3CPF A;  4LF8 L;  3HOW G;  2R7F A;  3AYH B;  1X3E A;  5C0X J;  4IJH A;  2RCN A;  3CC7 A;  1YVC A;  1UWV A;  3KOJ A;  2IHE A;  3RLO A;  4A3G H;  3ER0 A;  2UUC L;  1VQH A;  3TRE A;  5IYB H;  1HNX L;  4JI8 L;  1PYS B;  3RNU A;  4DV4 Q;  2ZTE A;  5E7N A;  2DUD A;  4YHH Q;  4DV0 Q;  1YHB A;  3ULJ A;  3SGI A;  1C0A A;  1Q82 C;  4DV3 Q;  4GN3 B;  4UP7 A;  1VQ4 A;  5BR8 L;  1IBL Q;  4PMW A;  1JMC A;  3S15 H;  3G71 A;  3EBE A;  5IYB G;  3CMA A;  3H15 A;  4A75 A;  3CF5 A;  3GTO H;  1OXU A;  1Z47 A;  3F2B A;  4MNO A;  1VQO A;  4P74 A;  4JI4 L;  2L15 A;  4B3R Q;  4GKJ Q;  2UXC Q;  1TWC H;  2MQH A;  4DV6 Q;  2K14 A;  3PUW A;  4L5S A;  1U5K A;  1VQF A;  2WAQ G;  1Q8K A;  1Q12 A;  3F1Z A;  5ELN A;  3CCQ A;  5IWA Q;  2D0O A;  1J5E L;  1CKN A;  4X6A H;  2K5N A;  4J15 A;  2JE6 I;  1X55 A;  2JA8 H;  4IPC A;  2MNA A;  2FXQ A;  2Z6K C;  4RMF A;  4JOI C;  1N34 Q;  1VQ8 A;  2KCM A;  1N32 Q;  1E22 A;  2RHQ B;  1YZ6 A;  3NEN A;  2PI2 E;  2ATW A;  2KHJ A;  2F3I A;  3J80 i;  1SMX A;  2XTI A;  2ALY B;  2UUA Q;  4PZ7 A;  3HOX G;  1PH8 A;  1IBM L;  2JA8 G;  1BKB A;  2VQE L;  3GTP H;  4L5R C;  4JI7 L;  3M3Y H;  3S1Q H;  4A3C G;  4L5T A;  1I94 Q;  2E5L Q;  1S72 A;  4HID A;  2Q2H A;  4KHZ A;  1VQ9 A;  2MO0 A;  2F52 A;  4KI0 A;  3RN2 A;  3GTQ H;  4R4O A;  5DLQ E;  2VZA A;  4GOP B;  4GNX B;  3PCO B;  4POG A;  1TWH H;  4EQ5 A;  2NZH A;  2ES2 A;  2UUB Q;  4DV1 Q;  1N33 L;  1WYD A;  3CXC A;  1OXX K;  2Z0S A;  4ALP A;  1PV4 A;  1CKN B;  4NXN Q;  1XNR L;  2LXJ A;  2VNU D;  4JBM A;  1HR0 Q;  1X3G A;  1HZB A;  3CAM A;  3G4S A;  5HGQ A;  3CCL A;  1VQL A;  4A3J H;  4LF5 Q;  2E2I H;  1NMF A;  1EYG A;  3JAM c;  4IJL A;  5K36 G;  1VQI A;  1O7I A;  1YNX A;  4PZ8 A;  4A76 A;  5LMU Q;  4ME3 A; 
#chains in the Genus database with same CATH topology
 3BJU A;  1B3A A;  3FKI H;  5EJW A;  2ICE C;  1SYE A;  1W3S A;  1NBW A;  1ILQ A;  1J9O A;  1RF2 D;  2L4N A;  4RCN A;  5EKK A;  4C3J B;  1SFO B;  1D2B A;  2XVS A;  3RN5 A;  1NJI C;  2ZXR A;  3U9O A;  3WOF A;  2NVX H;  2F0V A;  4EQP A;  1WCM H;  2N88 A;  3GTJ B;  1EOT A;  2XWJ B;  5GRO A;  2PMZ B;  3K5O A;  2QDB A;  4HJ7 A;  5M5Y B;  1DZ1 A;  3HOU B;  4APV A;  1PZI D;  4DR2 Q;  4JI6 Q;  4DAV A;  3KFU A;  1S40 A;  2WP8 J;  1X32 A;  1YI2 A;  1LV9 A;  4JI2 L;  1SNM A;  2H4O A;  2R93 G;  3SVM A;  4V19 0;  1ZXT A;  1RTO A;  1ZYR C;  3CCR A;  2MUY A;  4OEM B;  4PQX A;  2B2V C;  4MTK A;  5CV5 A;  1Q7Y C;  2NN6 G;  3RZO B;  3NEL A;  4KK7 A;  3KF6 A;  4ME5 A;  4WOR A;  1JOQ A;  1MI2 A;  2JYO A;  1P8L A;  3VDY A;  2BA0 A;  1F2Z A;  2C35 B;  3HKS A;  4WJ4 A;  1EIY B;  2F0Q A;  4NXN L;  2ZTD A;  2KQ3 A;  2E75 C;  3A8I E;  1CSP A;  2N3S A;  2VB3 X;  2JK8 A;  2QEJ C;  5KRU A;  4RCO A;  2N55 A;  2NN6 I;  3EFX D;  1CSQ A;  2A5H A;  3I91 A;  1II3 A;  4ZYS A;  2QIL A;  2OEO A;  5JEA G;  1PH4 A;  3C3L A;  1ENA A;  3HOX B;  2JA8 B;  2IPK D;  3EJI A;  1VQP A;  4LFB L;  3A55 A;  5A35 A;  1Y1W G;  2IHF A;  4F87 A;  3MA2 B;  4FVM A;  4XDX A;  5EAY A;  4B3S Q;  4HMJ A;  4A3F H;  2FFK B;  2E2J H;  3M3Y B;  2KCN A;  1EFI D;  4K6L A;  2KHI A;  3OWF A;  4IQZ A;  4DNR B;  4DR2 L;  4JI6 L;  1GD7 A;  1I6H H;  2Z1C A;  2NUC A;  2GVB A;  2CFM A;  3CQZ H;  4A3L G;  3LX0 A;  3KLW A;  1XPO A;  1UNS A;  4U67 3;  1S5B D;  2CH4 W;  4XQJ A;  4DV2 L;  4DR1 Q;  1NMG A;  1QE6 A;  1G51 A;  3TEH B;  3HOY G;  4QY7 A;  1XMQ Q;  1AE3 A;  3CU7 A;  1KAB A;  4PG3 A;  4C3I G;  3I8Z A;  1TS4 A;  5AFW A;  1H9J A;  2ENB A;  1KTK A;  3OIP A;  4JBJ A;  1PFN A;  1EU4 A;  5EBC A;  3GV6 A;  4CDC C;  3K7A H;  3MVV A;  5CBA E;  2ZTC A;  1SE8 A;  4O1N A;  3I4M G;  2PW5 A;  1JT8 A;  1ONL A;  3PO3 H;  1X54 A;  2JA7 H;  3HG9 A;  1ROD A;  1SNO A;  1L1O C;  3S2H H;  4C2M H;  3T1H Q;  3ULL A;  1HNW Q;  3UDG A;  2B2T C;  2EYH A;  2JEB I;  4DV0 L;  4JBK A;  1XWE A;  4RAU C;  4BA2 I;  3I56 A;  3VYU A;  4Y7N B;  1A63 A;  3AFP A;  4NMZ A;  1JJG A;  2RHS B;  4K6D A;  3SXH A;  4RWS C;  5GQO A;  4B3S L;  1G6P A;  2XRS D;  2A69 D;  4HCE A;  5ELC A;  1EIF A;  2HQE A;  2OT2 A;  3S16 H;  3D8G A;  1GHJ A;  4DUY Q;  3HOV G;  4O0A A;  1GUT A;  2NVT B;  4FP5 D;  1VQN A;  3SK4 A;  3H0G H;  2Q8R E;  3ZJY C;  3KDF B;  4UPA A;  5CYU A;  2Z9H A;  3TDQ A;  2E5L L;  2AHO B;  3Q23 A;  2OQK A;  1MJC A;  4DR1 L;  2MPM A;  1X3F A;  1XMQ L;  1I4R A;  2Y0S E;  3KF8 B;  1GO3 E;  4JI5 Q;  4ILW A;  5C44 H;  4HMI A;  3J80 L;  1LAC A;  1EOV A;  3TP6 A;  1Y1W B;  1UUP A;  3ND9 A;  5IY0 A;  1OTC A;  5E4W C;  4A3K G;  5M3F G;  3NXW A;  2AUJ D;  1K0R A;  3RR5 A;  1TWF H;  2JXM B;  2EY5 A;  4JG2 A;  4C3H B;  3T1H L;  1BCP B;  1K73 C;  1HNW L;  3RUZ A;  4JBW A;  2KOL A;  3V96 A;  3CCM A;  5GAD C;  2CHB D;  4LW1 A;  2A6E D;  1AE2 A;  1EFW A;  1AEX A;  1HTL D;  2FMC A;  4MTN A;  3S1N B;  3TN2 A;  4CHT B;  1D7Q A;  3I70 A;  1V1O A;  4LF4 Q;  2D5D A;  5IOD A;  4CKC A;  1LTT D;  4RHR A;  3R2I A;  3HOY B;  1E2W A;  3G6E A;  3DWA A;  3GTL B;  1EIH A;  1ML0 D;  3S2D H;  1L2F A;  2EYJ A;  3I73 A;  1SMY D;  2HQL A;  3BYT B;  4RKB A;  4GOP A;  3MXG A;  4IUQ A;  4DUY L;  1STA A;  1ESR A;  1MSG A;  4ZLT F;  5JJZ A;  1WTP A;  2PCF B;  4GKK Q;  5CV6 A;  1Q1E A;  1MGS A;  3OTO L;  4IOC A;  1PRT C;  4UY8 C;  1PTO H;  3QG1 A;  5COR A;  3CKI B;  4ZUJ A;  3GTK B;  1EY8 A;  3H3V C;  4HJ8 A;  4GLX A;  1WJJ A;  2EXZ A;  4JI5 L;  4TSS A;  2HDM A;  3UE0 A;  4FF1 A;  4N8F A;  4UP8 A;  1VQA A;  4A3I G;  1SE2 A;  2NTT A;  2VNU D;  2B2U C;  4NB3 A;  1JE5 A;  3HS0 C;  1JCK B;  1I3Q H;  1N36 Q;  1VQJ A;  2E2H B;  1XNQ L;  2G5D A;  2KUM A;  3TZD A;  4A4I A;  4QB4 A;  3I4N G;  1CZG A;  5KGU A;  3HOV B;  1G6Z A;  4OON A;  2K52 A;  3JAM L;  2O5I C;  1YHA A;  1LYL A;  5KEE A;  4YCW A;  5LL6 X;  4MIU A;  3TP5 A;  4KTA A;  1ICW A;  4J1M A;  2EJM A;  1A62 A;  4A3B H;  1TII D;  3KYH C;  4GS3 A;  3TS0 A;  3G48 A;  3J81 L;  3STB D;  3FKI G;  3T56 B;  1I4P A;  3CHB D;  4S3S A;  1YJ9 A;  3U4V A;  2JEA I;  2Z6B A;  4DK6 C;  3CD6 A;  3M4O B;  3ND8 A;  2A6H C;  2QCP X;  1UE7 A;  2KVM A;  4WRD A;  1V9P A;  2PO4 A;  5COY A;  2J0T D;  5M3M H;  4A3K B;  4FNF A;  5M3F B;  4GKK L;  3BVZ A;  1WCM G;  1IYV A;  2OXP A;  3QIA A;  1IW7 D;  2ID0 A;  1U0L A;  1K83 H;  1PLF A;  4HJ5 A;  4KKT A;  2I46 A;  3D4R A;  1VF7 A;  1PZK D;  1SJH D;  4J6H A;  3J80 c;  5FO9 B;  3A5U A;  2CH4 A;  4DNI A;  3WWV A;  2K33 A;  2F0N A;  3PUX A;  1PDQ A;  1B70 B;  1B2T A;  2PZU A;  1FNU A;  1B7Y B;  4OO1 H;  2V1C C;  3KJP A;  1BBX C;  1Z7T A;  3ITP A;  3A5Z B;  4KKU A;  2F0P A;  1PFM A;  2JP1 A;  3E5S A;  5ELO A;  4A3E G;  3DM3 A;  2F0G A;  1PRT F;  1X3E A;  1S5D D;  4IJH A;  1KDC A;  3CC7 A;  4DGZ A;  3RLO A;  4A3G H;  5C5M A;  3ER0 A;  2HD3 A;  1VQH A;  1QOH A;  3TRE A;  3MAQ A;  2K1B A;  3RNU A;  3A7A B;  3R2T A;  5E7N A;  1F9Q A;  4GN3 B;  1JMC A;  4PMW A;  3S15 H;  1HTP A;  4O42 A;  4A75 A;  3F2B A;  4MNO A;  1VQO A;  4P74 A;  4B3R Q;  2L15 A;  4GKJ Q;  1C8C A;  1TWC H;  2K14 A;  3PUW A;  3MFY A;  1VQF A;  3DUZ A;  4RGM A;  1E2Z A;  5IWA Q;  2K5N A;  2JE6 I;  2MNA A;  1N32 Q;  1EQV A;  1JC7 A;  2RHQ B;  3NEN A;  3EVQ A;  4A3I B;  2ATW A;  3S9W A;  4N8X 1;  1BQQ T;  1SMX A;  1GXD C;  4C1N K;  3GTP H;  2TMP A;  4R8I A;  2DY7 A;  1I94 Q;  3I4N B;  3P75 A;  3T13 A;  4KHZ A;  3FEW X;  1SYD A;  2EOT A;  4R4O A;  4B9W A;  3PCO B;  2K28 A;  1TWH H;  2R3Z A;  4DV1 Q;  1PV4 A;  5K36 H;  2PQE A;  2H1E A;  4JBM A;  1X3G A;  2AUK A;  4J8Q A;  3CAM A;  1SYC A;  3ZYY X;  3CCL A;  4A3J H;  2Z4I A;  1NMF A;  3FKI B;  3JAM c;  1EYG A;  1VQI A;  5LMU Q;  5CV8 A;  3GTM B;  2ZM6 L;  5J39 A;  2FMM A;  5I9O A;  4JI1 L;  2Q8T A;  3HKZ G;  4BBS B;  5IP7 H;  1STE A;  5I6W A;  2A68 D;  1WCM B;  4I7Z C;  3J81 c;  1JE4 A;  1KC8 C;  4BBR H;  2HIV A;  2PW7 A;  5IYC H;  3OW7 A;  2F03 A;  2WB1 E;  5C6A A;  1TS5 A;  4GKJ L;  1HNZ Q;  5DEH A;  3J7Y W;  4IPH A;  3Q22 A;  4DR3 Q;  3SK8 A;  2AWO A;  5IWA L;  2N8N A;  5IIF A;  4CJ1 B;  1N32 L;  4QCL A;  2E76 C;  2X6L A;  2LY7 A;  1TS2 A;  2K7V A;  2TSS A;  1L0Y B;  1D8L A;  4A3E B;  1TWG B;  5LL6 S;  4JPB W;  4NP5 A;  5M5X H;  3NQT A;  4QIW E;  4AIM A;  3BU2 A;  1I94 L;  5DAU A;  2NZO A;  1N9W A;  4AQY L;  4WFN 3;  5J1Z A;  2IL8 A;  4DK1 A;  2VW9 A;  1FGB D;  3AFQ A;  4QUF A;  3H0G G;  3O13 A;  4BWG B;  1JWM D;  4WJ3 M;  4DV1 L;  4DV5 L;  3EA6 A;  2F1M A;  1B8A A;  1E1O A;  2A73 B;  2B29 A;  4IAL A;  2LSS A;  4YWK A;  3J81 E;  4LF7 Q;  2SNS A;  4IUV A;  4BY7 H;  4I65 A;  4POF A;  4K2K A;  4L8J A;  3ERS X;  5M5W H;  5LMU L;  1OXS C;  4P71 A;  1K8G A;  5C44 G;  1EEF D;  2NVY H;  5KNC A;  3K8A A;  3ERQ A;  1NUC A;  1D6E C;  2PNH A;  2K01 A;  2RVL A;  1ESF A;  4TVA B;  2F0K A;  1VQ5 A;  1MIU A;  2JA6 G;  3OHX C;  2N49 A;  3MXP A;  2VUM H;  1KNA A;  2XRQ D;  2D62 A;  2EYF A;  2PMZ E;  1HPC A;  4DR6 L;  5C3E G;  5E1F A;  1AW7 A;  1EUJ A;  5FJ8 H;  1PH1 A;  1TR5 A;  2DNE A;  1HCZ A;  1CTM A;  1BBU A;  5IGD A;  2WIN B;  5BN4 A;  1GUG A;  1CQV A;  1ICF B;  3SDZ A;  2I5L X;  5FOB B;  1FGU A;  1ZEQ X;  5LMN W;  1UE1 A;  2CW0 D;  4DR5 L;  2L1B A;  3CC4 A;  1DON A;  3PO2 G;  2OCE A;  3IRB A;  2O4X A;  4X3U A;  2GVA A;  1VQG A;  4X64 Q;  5K5P A;  1IBK Q;  1KHI A;  2BA1 A;  3D4W A;  1KNE A;  4OWT B;  3KUP A;  3S17 H;  3S1R B;  3HKZ B;  4X66 Q;  1Y8P B;  2AQ1 B;  4KLK A;  3H91 A;  1JJC B;  4A3M G;  4PZ6 A;  4IFD G;  3T51 B;  5JOB A;  2QGQ A;  4G4K A;  4K8J A;  1O80 A;  3D4D A;  2ZXP A;  3T1Y Q;  3QOJ A;  2EY1 A;  2ZXO A;  3FPU B;  3N6R A;  3M4P A;  1F9R A;  4X62 Q;  1H9S B;  2K32 A;  5CV9 A;  3BZK A;  2EYM A;  2MFI A;  1G8Z D;  4FF3 A;  2JJQ A;  3U9S A;  1BVS A;  4DV4 L;  1CA6 A;  1YIT A;  1PHJ A;  5I2Y A;  4LWC A;  4ZRZ A;  5C5L A;  1W2B A;  5JVG 3;  3S1M B;  1T9H A;  2YTV A;  1HFN A;  2L0C A;  4IFD I;  4DAM A;  4HED A;  4A93 H;  1HNX Q;  1BCP C;  2B2W A;  5EQ0 A;  4C1N I;  5FLX E;  4AH6 A;  1CQF A;  3P1H A;  4N9P A;  2R92 H;  4OL7 A;  5DM6 3;  3AB9 A;  4AYB E;  3CRL C;  5CV7 A;  4A3D B;  3VYT A;  2HUG A;  1EYA A;  5IYD H;  3I3C A;  1VQE A;  1QWY A;  1TT2 A;  1HZC A;  4CKB A;  4Q0F A;  3S14 B;  2L55 A;  3F8T A;  1EWI A;  3VR2 A;  1IBM Q;  5C44 B;  3A74 A;  4X64 L;  1JOK A;  3I55 A;  3FRP B;  4LF6 Q;  1Q8I A;  1PH9 A;  3D6W A;  1N8R C;  1LTA D;  2XN9 C;  5CV4 A;  4RA8 A;  4LF5 L;  3A7L A;  5EKL A;  2JA6 B;  3T1Y L;  5C3W A;  4XT1 B;  5FO7 B;  1C4Q A;  1XNR Q;  4L6T B;  1RL2 A;  4X62 L;  1RTN A;  2BE5 D;  5C3E B;  1CKO A;  1DCZ A;  1LTG D;  1X56 A;  3I72 A;  3GV3 A;  3NPP A;  1WI5 A;  4QGU A;  3KF6 B;  1M8A A;  4KD3 A;  4OO1 G;  2XGT A;  1VQ7 A;  2B63 H;  1GM5 A;  4KY7 A;  5D3I B;  3E9H A;  1LTL A;  1Y8O B;  3J7A F;  2F0O A;  3PO2 B;  4OX9 Q;  1KL9 A;  2QKI C;  2HCI A;  3HOZ H;  3HGB A;  1BBW A;  3F2D A;  1FNV A;  1UAP A;  3RZD B;  4A3G G;  4ABN A;  3PV0 A;  4CKE A;  3FPP A;  1X9N A;  5E4X A;  4A3M B;  4QQB X;  4GNX A;  2CWP A;  4RG1 A;  5D14 A;  4OO1 I;  4YY3 Q;  4R4T A;  4BXX G;  2VQF Q;  2AQ2 B;  4NW2 A;  3OYY A;  1K0S A;  1XTC D;  3SR1 A;  3QR8 A;  2ZT9 C;  1BCP F;  2H5X A;  3GD7 A;  4DKA C;  2HIX A;  4GLV B;  1XYI A;  4CJ2 C;  2NVQ B;  1HQM C;  4LF6 L;  4X3S A;  3CW2 C;  2QF7 A;  2WAQ E;  1HXY D;  2D2C C;  3AMU A;  1PH6 A;  1QUQ A;  1D1K A;  3UE1 A;  4HIO A;  4G57 A;  3U58 A;  1EQQ A;  1K9M C;  1JB7 A;  5C4Z A;  3F2U A;  2Z6K A;  2UXB Q;  1IXR A;  4O2D A;  5KYL A;  2VY3 A;  4IPD A;  1I50 H;  3DEP A;  1PH3 A;  2L5T A;  4DAY A;  3BVM A;  1YEZ A;  3T53 B;  2R93 B;  3BDL A;  4G7H C;  5C0X G;  1QG7 A;  1KDB A;  2BH2 A;  1JQY D;  3GTG H;  1IL8 A;  1X6O A;  4IUP A;  4OX9 L;  3ICE A;  1HUN A;  4BY1 G;  1NCV A;  2M00 A;  2JA5 G;  1EY9 A;  1GVP A;  2Y0S G;  5C4X G;  1Q81 C;  1EY6 A;  1FL0 A;  1ZKO A;  5IP7 G;  3SE0 A;  5C4J H;  1L0W A;  3PIP A;  4C3J H;  2NB0 A;  1B4O A;  5FLM H;  2B2Y C;  2VL6 A;  2LKV A;  3ERO A;  4OXP A;  2R7Z G;  2OQ0 A;  4TQU S;  4YY3 L;  1K83 B;  5C0X I;  3D31 A;  4QF4 A;  2AQ3 B;  2VQE Q;  2B8G A;  4RGT A;  3H94 A;  3Q24 A;  2RSO A;  1WD1 A;  2F0T A;  1K3B C;  4M8A A;  1YNN C;  5M5Y H;  1K8A C;  3HOU H;  2XNA C;  2LXK A;  2ZJP A;  1TXY A;  3V05 A;  1QZG A;  3EN2 A;  1SE3 A;  2K5H A;  3D6C A;  2A74 C;  4DV7 Q;  5C4H A;  2V4D A;  1A0I A;  3DHQ A;  2IJ0 A;  1R9T B;  3P20 A;  2ICI A;  1MHW C;  2Q2T A;  5I4D A;  3H09 A;  1CKM A;  4FXG C;  4A3G B;  1GUS A;  1C9O A;  3MXN A;  3RZO H;  2EZV A;  2DJF C;  1EY4 A;  2F0D A;  4NDX A;  5ELF A;  1NSN S;  1O78 A;  1A3T A;  1G2S A;  2WAC A;  1YVC A;  3WDN A;  1D5M C;  1EU3 A;  2IHE A;  4RHS A;  1DM0 B;  3S15 B;  2B2V A;  2EJG C;  2PYK A;  2DUD A;  4YHH Q;  1YHB A;  1STY A;  4DV3 Q;  1FD7 D;  2YU9 B;  2WKC A;  1IBL Q;  4U68 A;  4C3I B;  5IYB G;  3CMA A;  3GTO H;  1D5X C;  2UXC Q;  4DV6 Q;  5EPL A;  1Q8K A;  4EQO A;  1ET9 A;  4KY6 A;  1TQO A;  1TWA B;  2MP1 A;  5I2X A;  3I4M B;  2O2L D;  4J15 A;  1X55 A;  2JA8 H;  4RMF A;  4JOI C;  2KCM A;  1KDA A;  2PI2 E;  1CZW A;  1WTR A;  3J80 i;  1SNQ A;  5KND A;  1F9S A;  1STB A;  2UUA Q;  2NZ1 D;  4PZ7 A;  1H9R A;  2VQE L;  1YNJ D;  2KHS A;  4L5R C;  1Z6H A;  3M3Y H;  3BS1 A;  1TWH B;  2NTS A;  2X69 A;  3VR4 A;  4HID A;  3OMG A;  1VQ9 A;  2MO0 A;  2NWG A;  3RN2 A;  1I4Q A;  3GTQ H;  5DLQ E;  3BDO A;  1SSO A;  4GOP B;  4POG A;  1EYC A;  2NZH A;  3VA7 A;  1WTW A;  2ES2 A;  1WTV A;  2UUB Q;  2EY6 A;  1OXX K;  2Z0S A;  4ALP A;  2LXJ A;  4GZY C;  2RKS A;  1HR0 Q;  1E2V A;  4BY1 B;  2MHV A;  4YIJ A;  3G4S A;  3PMF A;  1AZP A;  1PTO D;  3TP8 A;  1RCV D;  2JA5 B;  1SDF A;  1GUO A;  2Y0S B;  4IJL A;  5C4X B;  1U4R A;  1YNX A;  4PZ8 A;  3QWN A;  1ASY A;  4XTC S;  4FYD A;  4P75 A;  4BA1 I;  2R7Z B;  3HRZ C;  1GUN A;  2EDG A;  2X6G A;  4LF4 L;  1PYB A;  1YBY A;  4YHH L;  4R1J A;  1EL0 A;  1IBL L;  4DFA A;  1K8M A;  5KIX A;  3OPO A;  1SYF A;  1SE4 A;  4RH6 A;  3EIV A;  4CBV A;  2UXC L;  2K04 A;  1RKN A;  4DV6 L;  1Q1B A;  1V1P A;  3GO5 A;  1F2L A;  2PI2 A;  4R9W A;  1KD1 C;  4Y7N H;  2K5V A;  3HFZ B;  3T16 A;  5M9O A;  3Q0A A;  1L1O A;  5CBE E;  1YJN A;  4R4I A;  5M5X B;  4I7A A;  2EPB A;  4LUO A;  2D0P A;  2F3W A;  3TME A;  5CMD A;  2F4V Q;  1IYJ B;  1EWH A;  3R8B A;  2B2T A;  2R92 G;  3W5O A;  3FHW A;  4ZUI A;  4TRD A;  4F8M A;  1UE6 A;  5IP9 H;  2JA9 A;  3S24 A;  1SN8 A;  1BUV T;  1OXV A;  1QZH A;  1I4G A;  3J81 j;  1LAB A;  1JWS D;  5IT9 L;  5IYD G;  2NVT H;  3HOW H;  3VYR A;  2ZJR A;  1VF5 C;  3UDX A;  5JAV A;  3JAM i;  3W1G A;  4JCV E;  3NP8 A;  1AN8 A;  1B3Q A;  4K5V A;  1N36 L;  5D65 A;  1F2Y A;  1V43 A;  1QJO A;  3CC2 A;  1PZJ D;  4B3M Q;  5FKA C;  4KKS A;  1S4Z A;  4DA2 A;  2K75 A;  1BR9 A;  3NWS A;  2NVY B;  2QDL A;  3C1F A;  2HCC A;  1DOL A;  2F0I A;  2OWO A;  1CT1 D;  5JEA H;  4YWL A;  4PMB A;  3J81 i;  3PIP 3;  1VQK A;  2R7D A;  4F88 A;  2KED A;  2A69 C;  1UEA B;  1JOO A;  5J3B A;  3OW2 A;  3UDI A;  1Y1W H;  2I07 B;  2L9H A;  3A56 A;  1LTS D;  2RDH A;  3GQB A;  3CCV A;  1T5X D;  3TQY A;  1VDZ A;  1YJW A;  5IGB A;  5E3F A;  1HR0 W;  3B6Y A;  3WOE A;  4C3H H;  1EWC A;  4NKL A;  3CPW A;  2PQA A;  5IGF A;  1CFM A;  3CP0 A;  1CHQ D;  4DR7 Q;  3NTI A;  1ILP A;  1Y8N B;  2F0S A;  3KLS A;  3UDF A;  1QIL A;  2B63 G;  3J7A V;  3S1Q B;  1PA6 A;  4JC0 A;  3NBH A;  1XTD A;  3Q6S A;  1Q86 C;  2AKW B;  2EE1 A;  3PIO 3;  5G3L F;  4A3L H;  4DUZ Q;  3URY A;  3S1N H;  2IT1 A;  3TS2 A;  4A3F G;  4LUZ A;  1CM9 A;  3K6O A;  3BZD B;  2E74 C;  3HOY H;  3GTL H;  5FLX L;  3S17 B;  4P2C B;  2B8F A;  2RDG A;  5EKI A;  2QA4 A;  3KBX A;  2IX3 A;  1UE5 A;  2E2I B;  2K03 A;  1B50 A;  1BF4 A;  2UU9 Q;  1JR0 D;  5C3X A;  3BDC A;  1KAW A;  1J8I A;  2A6E C;  5IGG A;  3SK5 A;  3NTK A;  1EZ8 A;  1O7Z A;  5KNB A;  3A0J A;  4KHP Q;  2AMC B;  2WB1 G;  1AFP A;  3FP9 A;  4JI0 Q;  3SEB A;  3GTK H;  1B9N A;  1EEI D;  4DR4 Q;  1ZYR D;  4B3M L;  3J7Z C;  4K8I A;  5JJI A;  2BCO A;  1B1Z A;  5JEA J;  2NVX B;  2RQX A;  3PO3 G;  1SMY C;  2EXD A;  1RD9 D;  2JA7 G;  5LMN Q;  4HSV A;  2SDF A;  3E0E A;  5IGC A;  1E0B A;  4XQQ A;  1DOK A;  2YYZ A;  1LUZ A;  4LJZ C;  4MZ9 A;  4B3R L;  4JI8 Q;  3OIQ A;  3M85 A;  2E2H H;  3QOL A;  2A1A A;  1U4M A;  1UEB A;  3HOV H;  3NBI A;  4DR7 L;  4JV5 Q;  1EYD A;  1KIX A;  2B2U A;  2EVB A;  4LFC Q;  2BDN A;  4JI4 Q;  2F0H A;  1G2T A;  5GAE C;  4B08 A;  1B44 D;  4DUZ L;  1CHP D;  2YTY A;  4LMQ D;  1VQC A;  3W2D A;  3I4O A;  1HRJ A;  3CCJ A;  1K28 A;  2Q8I B;  1AH9 A;  5IT9 c;  4KV6 A;  5FK9 C;  3BVG A;  3J7A 5;  3M4O H;  1LT5 D;  1A2U A;  4C3J G;  1OXT A;  3HP3 A;  5JVH 3;  4KJN A;  5NUC A;  2ZJQ A;  2F0L A;  1SND A;  2UU9 L;  3MFG A;  3JC6 6;  1VQ6 A;  4A3K H;  2DJG C;  4WJW A;  4KHV A;  2M2L A;  5ELE A;  2OF1 A;  4ID6 A;  2Q2U A;  1FVI A;  1JOR A;  4CDD C;  2K5D A;  1YNN D;  1O7Y A;  1N33 Q;  5ISR A;  1U4L A;  4DR4 L;  2CWA A;  4QJF A;  3FDT A;  1SBB B;  2B63 B;  3STB C;  1JJ2 A;  2Q2I A;  1O7L A;  5LMN L;  2LFN A;  2F0M A;  3MWY W;  4A3F B;  2E2J B;  1TS3 A;  3UI2 A;  4JK1 C;  3IL8 A;  3MEF A;  4FDB A;  3K58 A;  2ASB A;  2FJ2 A;  2G9H D;  4KN4 C;  1HNZ L;  2F0U A;  4DR3 L;  1I6H B;  1IW7 C;  3X3N A;  3M7N A;  3CQZ B;  5IT9 E;  1EY0 A;  1NTG A;  3MC0 B;  4JV5 L;  1S3O A;  1TVX A;  3M7G A;  4LFC L;  3FVQ A;  1XJV A;  2E8G A;  4YCV A;  2L12 A;  1MJE A;  5FLX c;  1SRU A;  2WB1 B;  1XMO Q;  5IOC A;  3ONA B;  2M9V A;  1NAP A;  2NBF A;  4H02 A;  3PF5 A;  1Y1V H;  3K7A B;  5EPK A;  3M4Q A;  5FO8 B;  1EY5 A;  3CCU A;  2BH8 A;  4JI2 Q;  4TKO B;  2IY5 B;  2VS1 A;  3PO3 B;  2JA7 B;  3KLS X;  1SNC A;  1L0X B;  4A3I H;  4C2M B;  4XXE A;  3S2H B;  3HZX A;  1PH2 A;  3AQQ A;  4L5Q A;  2K5W A;  1PFB A;  3C1E A;  4OIK A;  4LF7 L;  2NYZ D;  2EJF C;  4QIW B;  3ULP A;  2PNR C;  3I4N H;  1A15 A;  1SLJ A;  2HDL A;  5EBD A;  2MO1 A;  2IW3 A;  4AYB G;  4LF8 Q;  3CME A;  1STG A;  2C9O A;  1PH7 A;  1M90 C;  4IN3 A;  1KXL A;  5EPJ A;  2UUC Q;  4UDU C;  4GN5 A;  1H95 A;  1KRT A;  4K2L A;  4EGV A;  2SEB D;  3L0O A;  3S16 B;  1JB3 A;  2RCF A;  5BR8 Q;  3MEH A;  4DF7 A;  1DGS A;  2P5Z X;  3GTM H;  5C4J B;  5GAG C;  1GKH A;  1A3U A;  4ULL A;  4OWX B;  3H0G B;  4XIG S;  4LFB Q;  3IFT A;  1SYB A;  2HT1 A;  4A3B G;  5CR3 A;  1J5E Q;  4BBS H;  1A6X A;  3TRZ A;  1FR3 A;  1LT3 D;  4BS9 A;  1EY7 A;  4OWW B;  1U4P A;  2EYP A;  1I4X A;  4GN4 B;  3AEV A;  1MSH A;  3PUV A;  1HQR D;  4P73 A;  5HY6 A;  5JJK A;  1XMO L;  3IAY A;  2MJ8 A;  1M4V A;  3K0X A;  4IUU A;  4JI7 Q;  1IBK L;  4LNQ A;  1KLG D;  3H3V H;  2VB2 X;  4X66 L;  5M3M G;  2QEX A;  3F2C A;  2O5J C;  1NR2 A;  1TWF B;  4DV2 Q;  2XSC A;  3MZ5 A;  2RDF A;  1NE3 A;  4A3E H;  1E3P A;  1TWG H;  3A8J E;  5IP9 G;  2A68 C;  1VQM A;  2JSO A;  3DXJ C;  4GLA C;  3K80 C;  4L63 B;  1WOC A;  5GAH C;  2EY2 A;  4GOP C;  1PRT D;  2RF4 A;  1C7Y A;  1QNU A;  4LF8 L;  3CPF A;  3HOW G;  2R7F A;  3AYH B;  2F0E A;  4OHJ A;  3KOJ A;  2J7Z A;  1FYC A;  1BDO A;  3G7L A;  3K0Y A;  2UUC L;  3T4A C;  3S2D B;  3GTO B;  1HNX L;  2EYO A;  4CDE C;  4DV0 Q;  2RA4 A;  1IHZ A;  4FF2 A;  3ULJ A;  3SGI A;  1C0A A;  1Q82 C;  1GHK A;  1RDP D;  1SAP A;  5BR8 L;  3G71 A;  3VR6 A;  3EBE A;  3H15 A;  3CF5 A;  1OXU A;  5T1G A;  3A8K E;  1R4P B;  2WAQ G;  3F1Z A;  1NNX A;  1Q12 A;  1RJT A;  1H9M A;  1PTO B;  1J5E L;  1CKN A;  2FIN B;  4X6A H;  1B9M A;  1N34 Q;  1VQ8 A;  5ELD A;  3D3R A;  4C3H G;  1E22 A;  1YZ6 A;  4ZK9 B;  5G3L D;  1IBM L;  1PH8 A;  4AYB B;  4Z9C B;  3GTQ B;  1FNW A;  4DN4 M;  4JI7 L;  4HCS A;  1K8O A;  2E5L Q;  2Z4H A;  3NE5 B;  2IWH A;  2F0J A;  1I3Q B;  2A6H D;  1LTI D;  4GNX B;  4LK1 C;  3N52 A;  1LTB D;  1WYD A;  3QB3 A;  1CKN B;  1XNR L;  5A2Q E;  3DWQ A;  4LAA A;  1LT4 D;  5HGQ A;  1VQL A;  1DXM A;  4A3B B;  5K36 G;  2OTJ A;  2LMC B;  4HTH A;  3S1R H;  4ME3 A;  4NPS A;  4JW0 A;  2XWB B;  3RLF A;  4MN3 A;  1OO9 B;  3LGJ A;  3PSI A;  5BN5 A;  4A3J G;  2A19 A;  4IUT A;  2KBN A;  3OMC A;  1EQR A;  2KJX A;  5D3D A;  1IZ6 A;  2PZW A;  1PXU A;  1QUQ B;  1V8Q A;  4OIJ A;  1WFQ A;  3I7F A;  3LWU A;  3KDF A;  1M1K C;  2CW0 C;  1BXT A;  4RKL A;  2KEE A;  5M3M B;  5H1S E;  1SFO H;  1DJR D;  1QB5 D;  3BZC A;  2LS0 1;  4BBR G;  5IYC G;  4HAE A;  3S1M H;  4JYA Q;  4DAY B;  5JPN C;  3NK9 A;  2VQF L;  2UXD Q;  2Z8L A;  3KF8 A;  1PVO A;  4G7Z C;  1N34 L;  4PNY A;  3GTJ H;  1E1T A;  3DEO A;  3VA5 A;  1MD2 D;  1GUW A;  3NSW A;  2K6A A;  4FXK C;  3LNN A;  4KD4 A;  2RBM A;  3MTS A;  2B3G A;  3HOW B;  1SNP A;  4DU9 A;  1HH2 P;  2PZT A;  2EIF A;  3R93 A;  4A3D H;  4R4C A;  3OTO Q;  4HR7 B;  4R4Q A;  3PIO A;  1QVG A;  2BOS A;  1C48 A;  3K7U C;  4CDF C;  3CCS A;  5F2D A;  3S14 H;  3K5L A;  2UXB L;  4XQN A;  1E24 A;  4YCU A;  4ZAI A;  1VCI A;  5BN3 A;  4EVO A;  1HZ9 A;  1F2M A;  2WAQ B;  1A8V A;  1KAA A;  1W6J A;  1DYQ A;  2IX1 A;  4FF4 A;  3PF4 A;  1TY0 A;  1TWC B;  4UP9 A;  1ENC A;  4X65 Q;  1STH A;  3PGZ A;  4LUV A;  4BY7 G;  1XNQ Q;  2JA6 H;  1HUM A;  5EGT A;  4Y52 H;  4B3T Q;  2HHH Q;  1STN A;  1VS0 A;  1F77 A;  5C3E H;  4PV1 C;  3MXN B;  1CUK A;  2R61 A;  1PH5 A;  1MBY A;  1EZ6 A;  5HUR A;  3HOX H;  3SHL A;  3GTP B;  4OEL B;  1Y69 U;  3PUZ A;  4A3C H;  4EX5 A;  4JYA L;  2VUM G;  4Q5V A;  1Y14 B;  3E0J A;  2UXD L;  1X65 A;  3PO2 H;  2WII B;  2K5Q A;  3I90 A;  1HJP A;  3VR3 A;  2YV5 A;  5J22 A;  5FJ8 G;  3K57 A;  4FXD A;  3RZD H;  3DMU A;  1T5E A;  4M1U B;  1IKL A;  1J6Q A;  5CC4 A;  4K5X A;  4X3T A;  2BE5 C;  4A3M H;  1TY2 A;  2CQO A;  1X3Q A;  4A3J B;  4IFD H;  2YTX A;  4UAI A;  3K59 A;  4DV7 L;  2F3V A;  1CI3 M;  3TZU A;  1YHQ A;  4DK0 A;  3E9I A;  2GN5 A;  1V1Q A;  5TSS A;  1B53 A;  1I5F A;  1RHP A;  1Y1V G;  1CA5 A;  1S5E D;  4XYQ A;  1YIJ A;  3I4L A;  1ASZ A;  4DXG A;  2NVQ H;  4BBR B;  2D9U A;  3MHB A;  1XPU A;  3KJO A;  4H0L C;  4X65 L;  1SR3 A;  3BYY B;  4DV3 L;  4NXM Q;  2N78 A;  4QL5 A;  1AP0 A;  1IYU A;  4B3T L;  1WTO A;  2HHH L;  2PPB C;  4H7B A;  3OSO A;  1W6K A;  1XPR A;  1SYG A;  5CGK A;  1LM0 A;  1KQS A;  4A93 G;  2R93 H;  1LTR D;  2DGY A;  3RMH A;  1BNZ A;  4ZQ3 A;  3RLN A;  3NEM A;  5HGT A;  3QO2 A;  2KCT A;  1Z9F A;  1U9R A;  2QW7 A;  3E3X A;  2NN6 H;  3RD4 A;  2UUA L;  4UHV A;  4K0K Q;  4DXF A;  4IO9 A;  3AU7 A;  5I9P A;  3NHH A;  4IUN A;  1SXT A;  4OGQ C;  4IUR A;  4H13 C;  4IOA A;  1DOM A;  1VQD A;  4MHE A;  4YWM A;  2XIW A;  2EQS A;  4BBS G;  1V1P B;  1Q3L A;  1MKH A;  1S5F D;  2I0Q A;  1TKW B;  4IFD J;  2UUB L;  4BY7 B;  4K14 A;  4IPG A;  4DK3 C;  1LLR D;  2F0F A;  3M4Y A;  5M5W B;  1HR0 L;  1L1O B;  1K3R A;  2K50 A;  1AZQ A;  1CK1 A;  1HHV A;  1S5C D;  1SJE D;  4QUC A;  2SNM A;  4KMU C;  4KY5 A;  1GOZ A;  3NTH A;  2B2Y A;  3C46 A;  4XT3 B;  1LO5 D;  2B39 A;  3R3O A;  1HA6 A;  3HEJ A;  4JI3 Q;  1WTH A;  2VUM B;  1SEB D;  4XYO A;  4HIM A;  4E6I A;  4G7O C;  1LT6 D;  1R4Q B;  3MXU A;  5T1I A;  2ZM6 Q;  1R9T H;  4IZ8 A;  4NXM L;  1VMC A;  4LF9 Q;  4JI1 Q;  2R6G A;  4HJA A;  2JQO A;  4DAP A;  1BOS A;  4RGN A;  5IE8 A;  3H3V I;  4RGO S;  3W3A A;  4C56 C;  1XX8 A;  4DPG A;  3CCE A;  1WD0 A;  3KLR A;  2AWN A;  4BXX H;  1FJG Q;  3GDE A;  3KBG A;  3HOZ G;  1XXG A;  5ELB A;  2KA7 A;  2F4V L;  3L2P A;  5KYI A;  1Y1V B;  3GP7 A;  1X3P A;  2YU9 H;  4X3K A;  4K0K L;  4C3I H;  3J80 E;  1KRS A;  2J4X A;  1BCP D;  2PQA B;  1EIG A;  3I4M H;  1TWA H;  1ET6 A;  3L9A X;  1QCB D;  3A54 A;  4EQN A;  4P72 A;  2CCZ A;  1JWU D;  3NBH B;  2VXW A;  4LFA Q;  2B2W C;  3FMC A;  4ZCK A;  5L37 A;  4AQY Q;  3BG3 A;  3M9B A;  4CJ0 B;  1D5Z C;  3PQI A;  2I5H A;  3DM1 A;  2CQA A;  3W1B A;  3K5N A;  1DD2 A;  2DN8 A;  5AJ3 Q;  1G29 1;  3U4Z A;  4HJ9 A;  1SRO A;  4DV5 Q;  5DNF A;  4JOI A;  3P7J A;  1IL2 A;  3QJY A;  1RIP A;  4HN7 A;  4QMG A;  1NY4 A;  4A93 B;  5C0X H;  1HZA A;  4JI3 L;  1PFS A;  1QVF A;  2WV6 D;  3D0F A;  4HIK A;  2R92 B;  1P16 A;  4BY1 H;  4V0B A;  5I6Y A;  4LF9 L;  4R8N A;  1WTQ A;  2F0W A;  2JA5 H;  3L7Z C;  2EYL A;  1VQB A;  5C4X H;  3NUC A;  3NWT A;  2K4K A;  1YNJ C;  2OTL A;  2JN4 A;  5DM7 3;  2R7Z H;  3K81 C;  3TP7 A;  1KLU D;  3NQI A;  4H44 C;  1IKM A;  1FJG L;  4DR6 Q;  2I5M X;  1PRT B;  1NR4 A;  1E7Z A;  1Q90 A;  1A2T A;  2CKZ B;  1WTX A;  5JJL A;  5LHY 1;  2KCC A;  3HKZ E;  4N9T A;  5FLM G;  1PTO C;  3H6M A;  4DR5 Q;  4DNT B;  3G6J B;  3V2T A;  4RFB A;  5M3F H;  1HA5 A;  1Q46 A;  4LFA L;  3EQL C;  2A8V A;  3I2Z A;  4KHP L;  1QVC A;  3JAM E;  4KN7 C;  3DLL A;  1ENF A;  2IX0 A;  3U50 C;  3HOU G;  4JI0 L;  2DY8 A;  2WFW A;  3PUY A;  3Q8D A;  5AJ3 L;  3L3O C;  4A3D G;  4ZKC B;  5JPM C;  1GJX A;  1I4H A;  1TU2 B;  4KJO A;  4GNX C;  2KEN A;  3HOZ B;  5C0X J;  4PMC A;  2RCN A;  2CVR A;  1UWV A;  1JIC A;  2GA4 B;  5IYB H;  4JI8 L;  1HFG A;  1PYS B;  3VYS A;  4DV4 Q;  2ZTE A;  5A2Q L;  1PMR A;  4ZKB B;  4UP7 A;  1VQ4 A;  4HSP A;  2E2D C;  1EQT A;  1Z47 A;  4JI4 L;  1QNK A;  2MQH A;  1D1I A;  2BDO A;  3IFD A;  4L5S A;  1U5K A;  5ELN A;  3CCQ A;  2K05 A;  2C5C A;  2D0O A;  4CGY B;  2G9D A;  2RSN A;  2FHT A;  4IPC A;  2FXQ A;  2Z6K C;  2KEC A;  2F4I A;  3TBI B;  2DNC A;  1PYW D;  3KK7 A;  3OWE B;  3LWE A;  2KHJ A;  2F3I A;  2SOB A;  3OOC A;  3TSS A;  4FO2 A;  4JVZ A;  2XTI A;  2ALY B;  4K5W A;  3HOX G;  2JA8 G;  1BKB A;  3E6Z X;  2MGS A;  3S1Q H;  4A3C G;  1A3V A;  1H9S A;  1I6V C;  4L5T A;  3IKJ A;  3C2P A;  5IGE A;  1S72 A;  1G91 A;  1VMP A;  2Q2H A;  2F52 A;  3DWP A;  1F9P A;  4KI0 A;  2VZA A;  1I50 B;  4F7X A;  4ODG A;  2L11 A;  4EQ5 A;  2WKD A;  1N33 L;  3SK6 A;  3CXC A;  4B9X A;  4NXN Q;  3X3M A;  3K5M A;  1HZB A;  1WVL A;  3VR5 A;  1H9K A;  4LF5 Q;  1BO0 A;  2E2I H;  1PTO F;  3GTG B;  1O7I A;  3CRK C;  4A76 A; 
#chains in the Genus database with same CATH homology
 4NPS A;  3RLF A;  2ZM6 L;  1ASY A;  4XTC S;  3LGJ A;  3PSI A;  3BJU A;  4A3J G;  4P75 A;  4BA1 I;  2A19 A;  2KBN A;  4JI1 L;  3FKI H;  1EQR A;  1IZ6 A;  3HKZ G;  1QUQ B;  5IP7 H;  1W3S A;  1NBW A;  1WFQ A;  3I7F A;  4LF4 L;  1PYB A;  1YBY A;  4YHH L;  3J81 c;  4R1J A;  4BBR H;  1KC8 C;  3RN5 A;  2HIV A;  3KDF A;  5IYC H;  1NJI C;  1M1K C;  1IBL L;  2NVX H;  2WB1 E;  5H1S E;  3EIV A;  1SFO H;  4GKJ L;  2UXC L;  1WCM H;  1HNZ Q;  4DV6 L;  3BZC A;  4DR3 Q;  1Q1B A;  3GO5 A;  4IPH A;  4BBR G;  2AWO A;  5IYC G;  4JYA Q;  5GRO A;  3S1M H;  2PI2 A;  4DAY B;  5IWA L;  4HJ7 A;  2VQF L;  2N8N A;  4Y7N H;  1KD1 C;  2UXD Q;  2K5V A;  3HFZ B;  1L1O A;  1PVO A;  1N34 L;  1YJN A;  1N32 L;  4R4I A;  4APV A;  3GTJ H;  4DR2 Q;  4JI6 Q;  3KFU A;  4LUO A;  1E1T A;  2D0P A;  1S40 A;  2F4V Q;  2WP8 J;  1IYJ B;  1YI2 A;  4JI2 L;  2R92 G;  1D8L A;  3W5O A;  2R93 G;  3FHW A;  2B3G A;  5IP9 H;  1UE6 A;  3CCR A;  2JA9 A;  3S24 A;  5M5X H;  1HH2 P;  1SN8 A;  2EIF A;  4QIW E;  4AIM A;  3BU2 A;  1OXV A;  1I94 L;  1QZH A;  4A3D H;  1Q7Y C;  2NZO A;  1N9W A;  2NN6 G;  4AQY L;  3J81 j;  4R4C A;  3OTO Q;  4R4Q A;  3NEL A;  3PIO A;  3KF6 A;  2VW9 A;  5IYD G;  1QVG A;  2NVT H;  3HOW H;  3AFQ A;  2ZJR A;  3UDX A;  3H0G G;  1P8L A;  3VDY A;  3JAM i;  3W1G A;  4WJ3 M;  4DV1 L;  2BA0 A;  3K7U C;  2C35 B;  3HKS A;  4JCV E;  3CCS A;  4DV5 L;  3S14 H;  1EIY B;  4NXN L;  2UXB L;  4WJ4 A;  1B8A A;  1E1O A;  2ZTD A;  1E24 A;  2B29 A;  1N36 L;  2LSS A;  4YWK A;  4YCU A;  1V43 A;  3CC2 A;  4LF7 Q;  1VCI A;  4B3M Q;  1HZ9 A;  2K75 A;  1CSP A;  4BY7 H;  2N3S A;  1A8V A;  4POF A;  2JK8 A;  2OWO A;  3ERS X;  5M5W H;  5LMU L;  4YWL A;  3J81 i;  1OXS C;  4P71 A;  1K8G A;  1VQK A;  2IX1 A;  2R7D A;  5C44 G;  3PF4 A;  2NN6 I;  4UP9 A;  1CSQ A;  4X65 Q;  5J3B A;  3PGZ A;  4LUV A;  4BY7 G;  1XNQ Q;  2NVY H;  3UDI A;  3OW2 A;  1Y1W H;  2JA6 H;  3K8A A;  2PNH A;  5JEA G;  1PH4 A;  4Y52 H;  4B3T Q;  3CCV A;  3TQY A;  2HHH Q;  4TVA B;  1YJW A;  1VS0 A;  1VQP A;  5C3E H;  4LFB L;  1HR0 W;  3B6Y A;  1MIU A;  4C3H H;  1Y1W G;  2N49 A;  2IHF A;  1VQ5 A;  2JA6 G;  2VUM H;  3CPW A;  3MXN B;  1CUK A;  2PQA A;  1PH5 A;  2D62 A;  2PMZ E;  5EAY A;  4DR6 L;  3CP0 A;  3HOX H;  4DR7 Q;  4B3S Q;  3UDF A;  5C3E G;  4A3F H;  2B63 G;  1EUJ A;  3PUZ A;  5FJ8 H;  1PH1 A;  2E2J H;  1PA6 A;  4JC0 A;  4A3C H;  4EX5 A;  4JYA L;  2VUM G;  1Y14 B;  1XTD A;  1BBU A;  2UXD L;  1Q86 C;  2AKW B;  1X65 A;  4A3L H;  3PO2 H;  4DUZ Q;  3S1N H;  1HJP A;  2IT1 A;  2KHI A;  3TS2 A;  4A3F G;  2YV5 A;  4LUZ A;  5FJ8 G;  4DR2 L;  4JI6 L;  1GD7 A;  1I6H H;  2I5L X;  2GVB A;  1FGU A;  3RZD H;  2CFM A;  3CQZ H;  1UE1 A;  5LMN W;  4DR5 L;  3HOY H;  4A3L G;  3CC4 A;  3GTL H;  1XPO A;  3KLW A;  3PO2 G;  1J6Q A;  2OCE A;  3IRB A;  2QA4 A;  2GVA A;  1VQG A;  4X64 Q;  4DV2 L;  1UE5 A;  2CQO A;  4DR1 Q;  4A3M H;  1NMG A;  2YTX A;  1G51 A;  3TEH B;  1KHI A;  2BA1 A;  1IBK Q;  4QY7 A;  3HOY G;  1XMQ Q;  4DV7 L;  1AE3 A;  4OWT B;  3S17 H;  1YHQ A;  2UU9 Q;  4PG3 A;  3E9I A;  4X66 Q;  2GN5 A;  4KLK A;  1V1Q A;  1JJC B;  1KAW A;  4A3M G;  4JBJ A;  4PZ6 A;  4IFD G;  1I5F A;  1Y1V G;  3K7A H;  1YIJ A;  2QGQ A;  3A0J A;  3T1Y Q;  4KHP Q;  2ZTC A;  1SE8 A;  3I4M G;  2AMC B;  2WB1 G;  1JT8 A;  3FP9 A;  4JI0 Q;  1ASZ A;  3PO3 H;  1X54 A;  3GTK H;  3M4P A;  2JA7 H;  4X62 Q;  4DR4 Q;  4B3M L;  2NVQ H;  1L1O C;  3S2H H;  4C2M H;  3T1H Q;  3J7Z C;  3BZK A;  3ULL A;  1HNW Q;  5JJI A;  2MFI A;  5JEA J;  3UDG A;  1XPU A;  3KJO A;  2JJQ A;  3PO3 G;  2EXD A;  1BVS A;  4DV4 L;  2JEB I;  2JA7 G;  4DV0 L;  5LMN Q;  4X65 L;  1YIT A;  1PHJ A;  1SR3 A;  4LWC A;  4JBK A;  4DV3 L;  1W2B A;  3E0E A;  2N78 A;  4QL5 A;  4NXM Q;  4BA2 I;  3I56 A;  1T9H A;  2YTV A;  2YYZ A;  1A63 A;  4IFD I;  4DAM A;  4B3T L;  1LUZ A;  3AFP A;  4MZ9 A;  2HHH L;  4A93 H;  4B3R L;  1HNX Q;  4JI8 Q;  1JJG A;  3M85 A;  2E2H H;  2RHS B;  1XPR A;  2A1A A;  4AH6 A;  1LM0 A;  1UEB A;  3HOV H;  2R92 H;  1KQS A;  4DR7 L;  4JV5 Q;  5GQO A;  4A93 G;  2R93 H;  4AYB E;  1KIX A;  4B3S L;  1G6P A;  2DGY A;  4LFC Q;  4JI4 Q;  3RLN A;  1EIF A;  3NEM A;  2KCT A;  1Z9F A;  3S16 H;  5GAE C;  4DUY Q;  3HOV G;  2UUA L;  4K0K Q;  4DUZ L;  4O0A A;  5IYD H;  2YTY A;  1VQN A;  1VQC A;  1VQE A;  4IO9 A;  3I4O A;  3H0G H;  3CCJ A;  3ZJY C;  3KDF B;  4UPA A;  1HZC A;  2E5L L;  1AH9 A;  4IOA A;  4YWM A;  1VQD A;  5IT9 c;  2EQS A;  3F8T A;  2AHO B;  4BBS G;  1EWI A;  3J7A 5;  3M4O H;  2OQK A;  1IBM Q;  1OXT A;  3A74 A;  1MJC A;  4X64 L;  4DR1 L;  1MKH A;  2I0Q A;  4IFD J;  3I55 A;  2UUB L;  4LF6 Q;  4IPG A;  1PH9 A;  2ZJQ A;  1X3F A;  4DK3 C;  1XMQ L;  1N8R C;  2Y0S E;  2UU9 L;  3KF8 B;  3JC6 6;  1HR0 L;  1L1O B;  1GO3 E;  4A3K H;  4JI5 Q;  1VQ6 A;  1K3R A;  5C44 H;  2K50 A;  4LF5 L;  1EOV A;  2Q2U A;  1FVI A;  3T1Y L;  5IY0 A;  1N33 Q;  1OTC A;  4A3K G;  1XNR Q;  5M3F G;  1RL2 A;  1K0R A;  4DR4 L;  3RR5 A;  4X62 L;  2CWA A;  4QJF A;  1TWF H;  1CKO A;  1X56 A;  4JG2 A;  4JI3 Q;  1WI5 A;  3STB C;  3T1H L;  1JJ2 A;  1K73 C;  2Q2I A;  1HNW L;  4QGU A;  3KF6 B;  4JBW A;  4HIM A;  3CCM A;  5GAD C;  4LW1 A;  4OO1 G;  5LMN L;  2XGT A;  2ZM6 Q;  1R9T H;  1VQ7 A;  2B63 H;  1GM5 A;  1AE2 A;  4NXM L;  4LF9 Q;  1EFW A;  4JI1 Q;  2R6G A;  3E9H A;  3MEF A;  1LTL A;  4FDB A;  4HJA A;  2ASB A;  4OX9 Q;  1KL9 A;  4MTN A;  1D7Q A;  2JQO A;  3HOZ H;  5IE8 A;  3H3V I;  1HNZ L;  1BBW A;  4DR3 L;  4LF4 Q;  3F2D A;  3M7N A;  4A3G G;  4DPG A;  3PV0 A;  3G6E A;  3CCE A;  2AWN A;  1NTG A;  4BXX H;  3S2D H;  1FJG Q;  3GDE A;  4JV5 L;  1L2F A;  1S3O A;  3HOZ G;  2HQL A;  4LFC L;  1X9N A;  1XJV A;  4QQB X;  4GOP A;  2F4V L;  3L2P A;  4GNX A;  2CWP A;  4RG1 A;  2E8G A;  4YCV A;  1MJE A;  5FLX c;  2YU9 H;  4DUY L;  4OO1 I;  4YY3 Q;  4R4T A;  1SRU A;  4BXX G;  4K0K L;  2VQF Q;  4C3I H;  1XMO Q;  1KRS A;  3OYY A;  4GKK Q;  4H02 A;  3PF5 A;  1Y1V H;  1Q1E A;  3M4Q A;  2PQA B;  2H5X A;  3OTO L;  4IOC A;  4UY8 C;  3GD7 A;  1TWA H;  3I4M H;  3CCU A;  2BH8 A;  4JI2 Q;  2IY5 B;  4DKA C;  2HIX A;  2VS1 A;  4GLV B;  4P72 A;  2CCZ A;  4HJ8 A;  4LF6 L;  3NBH B;  3CW2 C;  4LFA Q;  4GLX A;  4A3I H;  2WAQ E;  1WJJ A;  4AQY Q;  3M9B A;  1PH2 A;  4JI5 L;  3AQQ A;  4L5Q A;  1PH6 A;  1QUQ A;  3UE0 A;  4LF7 L;  2I5H A;  3W1B A;  3UE1 A;  4UP8 A;  1VQA A;  5AJ3 Q;  4HIO A;  1G29 1;  3ULP A;  3U58 A;  4A3I G;  1EQQ A;  4NB3 A;  3U4Z A;  1K9M C;  1JB7 A;  4HJ9 A;  1SRO A;  1JE5 A;  4DV5 Q;  1SLJ A;  3I4N H;  2Z6K A;  4JOI A;  2UXB Q;  1IXR A;  1IL2 A;  2MO1 A;  1RIP A;  4O2D A;  4AYB G;  1NY4 A;  4LF8 Q;  1I3Q H;  2VY3 A;  4IPD A;  1VQJ A;  3CME A;  1N36 Q;  1I50 H;  1HZA A;  1XNQ L;  4JI3 L;  4A4I A;  1PH3 A;  1PFS A;  1QVF A;  1PH7 A;  1M90 C;  3I4N G;  1KXL A;  1YEZ A;  4HIK A;  3D0F A;  4OON A;  2UUC Q;  1P16 A;  2K52 A;  4GN5 A;  1YHA A;  1LYL A;  4BY1 H;  5C0X G;  1KRT A;  1H95 A;  4YCW A;  3L0O A;  4LF9 L;  2BH2 A;  2JA5 H;  2OTJ A;  5BR8 Q;  3L7Z C;  3S1R H;  3GTG H;  1A62 A;  1VQB A;  5C4X H;  1DGS A;  1X6O A;  4OX9 L;  3ICE A;  4A3B H;  2K4K A;  3GTM H;  4BY1 G;  5GAG C;  3KYH C;  1GKH A;  4GS3 A;  4OWX B;  4XIG S;  2OTL A;  3TS0 A;  3G48 A;  4LFB Q;  2JA5 G;  2R7Z H;  1GVP A;  3K81 C;  2Y0S G;  3FKI G;  3STB D;  2HT1 A;  4A3B G;  5C4X G;  1Q81 C;  1FJG L;  1YJ9 A;  3U4V A;  1J5E Q;  1FL0 A;  2JEA I;  5IP7 G;  3TRZ A;  5C4J H;  4DK6 C;  3CD6 A;  1L0W A;  3PIP A;  4BBS H;  2I5M X;  4C3J H;  4OWW B;  4DR6 Q;  1UE7 A;  3AEV A;  1E7Z A;  4GN4 B;  5FLM H;  2VL6 A;  2CKZ B;  4OXP A;  3PUV A;  2R7Z G;  5JJL A;  1V9P A;  2OQ0 A;  4P73 A;  4TQU S;  4YY3 L;  5HY6 A;  5C0X I;  5JJK A;  3D31 A;  1XMO L;  5M3M H;  3HKZ E;  4GKK L;  2VQE Q;  1WCM G;  5FLM G;  3K0X A;  4JI7 Q;  1IBK L;  2ID0 A;  4LNQ A;  1U0L A;  3H3V H;  1K83 H;  4HJ5 A;  4DR5 Q;  4X66 L;  5M5Y H;  5M3M G;  1K8A C;  3HOU H;  2QEX A;  3F2C A;  3A5U A;  2LXK A;  3J80 c;  5M3F H;  1Q46 A;  2ZJP A;  1TXY A;  4DV2 Q;  1QZG A;  4LFA L;  2A8V A;  3I2Z A;  4KHP L;  3EN2 A;  4DNI A;  1QVC A;  3DLL A;  3WWV A;  2K5H A;  3PUX A;  1NE3 A;  4DV7 Q;  2IX0 A;  3U50 C;  3HOU G;  4A3E H;  1E3P A;  1B70 B;  1TWG H;  4JI0 L;  1A0I A;  5IP9 G;  2WFW A;  1VQM A;  1B7Y B;  3PUY A;  3Q8D A;  2V1C C;  3KJP A;  5AJ3 L;  2Q2T A;  4GLA C;  3K80 C;  3A5Z B;  4A3D G;  1CKM A;  1WOC A;  5GAH C;  1C9O A;  4GOP C;  5ELO A;  4A3E G;  4GNX C;  2RF4 A;  1C7Y A;  3RZO H;  2KEN A;  3DM3 A;  3CPF A;  4LF8 L;  3HOW G;  2R7F A;  3AYH B;  1X3E A;  5C0X J;  4IJH A;  2RCN A;  3CC7 A;  1YVC A;  1UWV A;  3KOJ A;  2IHE A;  3RLO A;  4A3G H;  3ER0 A;  2UUC L;  1VQH A;  3TRE A;  5IYB H;  1HNX L;  4JI8 L;  1PYS B;  3RNU A;  4DV4 Q;  2ZTE A;  5E7N A;  2DUD A;  4YHH Q;  4DV0 Q;  1YHB A;  3ULJ A;  3SGI A;  1C0A A;  1Q82 C;  4DV3 Q;  4GN3 B;  4UP7 A;  1VQ4 A;  5BR8 L;  1IBL Q;  4PMW A;  1JMC A;  3S15 H;  3G71 A;  3EBE A;  5IYB G;  3CMA A;  3H15 A;  4A75 A;  3CF5 A;  3GTO H;  1OXU A;  1Z47 A;  3F2B A;  4MNO A;  1VQO A;  4P74 A;  4JI4 L;  2L15 A;  4B3R Q;  4GKJ Q;  2UXC Q;  1TWC H;  2MQH A;  4DV6 Q;  2K14 A;  3PUW A;  4L5S A;  1U5K A;  1VQF A;  2WAQ G;  1Q8K A;  1Q12 A;  3F1Z A;  5ELN A;  3CCQ A;  5IWA Q;  2D0O A;  1J5E L;  1CKN A;  4X6A H;  2K5N A;  4J15 A;  2JE6 I;  1X55 A;  2JA8 H;  4IPC A;  2MNA A;  2FXQ A;  2Z6K C;  4RMF A;  4JOI C;  1N34 Q;  1VQ8 A;  2KCM A;  1N32 Q;  1E22 A;  2RHQ B;  1YZ6 A;  3NEN A;  2PI2 E;  2ATW A;  2KHJ A;  2F3I A;  3J80 i;  1SMX A;  2XTI A;  2ALY B;  2UUA Q;  4PZ7 A;  3HOX G;  1PH8 A;  1IBM L;  2JA8 G;  1BKB A;  2VQE L;  3GTP H;  4L5R C;  4JI7 L;  3M3Y H;  3S1Q H;  4A3C G;  4L5T A;  1I94 Q;  2E5L Q;  1S72 A;  4HID A;  2Q2H A;  4KHZ A;  1VQ9 A;  2MO0 A;  2F52 A;  4KI0 A;  3RN2 A;  3GTQ H;  4R4O A;  5DLQ E;  2VZA A;  4GOP B;  4GNX B;  3PCO B;  4POG A;  1TWH H;  4EQ5 A;  2NZH A;  2ES2 A;  2UUB Q;  4DV1 Q;  1N33 L;  1WYD A;  3CXC A;  1OXX K;  2Z0S A;  4ALP A;  1PV4 A;  1CKN B;  4NXN Q;  1XNR L;  2LXJ A;  2VNU D;  4JBM A;  1HR0 Q;  1X3G A;  1HZB A;  3CAM A;  3G4S A;  5HGQ A;  3CCL A;  1VQL A;  4A3J H;  4LF5 Q;  2E2I H;  1NMF A;  1EYG A;  3JAM c;  4IJL A;  5K36 G;  1VQI A;  1O7I A;  1YNX A;  4PZ8 A;  4A76 A;  5LMU Q;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...