2GVAA

Refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna-binding (viral)
molecule keywords GENE V PROTEIN
total genus 5
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gvaA00
1XJVA 1PH9A 5IWAL 1K3RA 4LF5L 2PNHA 3TREA 1XNRQ 1VQEA 1JJ2A 1TWCH 4JI0Q 4DR2L 3EN2A 4ALPA 4JOIA 3S16H 3GTLH 4DR4L 2JE6I 2R6GA 4P72A 1S72A 1FJGL 1KRSA 4PMWA 4HJAA 1PH5A 1FVIA 1JT8A 2Q2TA 2UUCL 1SN8A 5IYDG 1W2BA 3M3YH 4A3BH 4DNIA 3RLFA 4EX5A 4LUOA 4NXMQ 1V9PA 4LF7Q 1X55A 3PUYA 2N78A 3PF5A 1N34Q 4IPDA 3M4PA 3A0JA 3PV0A 4X65L 1YHBA 4IPCA 4NB3A 4DUZL 4LF6Q 4DV0L 4L5SA 3GTGH 2R7FA 1XNQL 1AE3A 1VQCA 1SLJA 3PSIA 4POGA 2ZTCA 2WAQE 3KDFB 3K7UC 3W5OA 1VQNA 3E9HA 1E3PA 1VQ5A 1Q86C 4BBRH 3ERSX 4BY7G 1HZAA 1MJEA 1K83H 4C3HH 3I4OA 1JMCA 1LYLA 5J3BA 2D0OA 4KHPL 5IE8A 5C44G 1VQ4A 5IYCH 5IT9c 2HIVA 1Q12A 2UUBQ 3S15H 3F8TA 4GLAC 4A3JG 3H0GG 4IOAA 4LFAQ 2CQOA 5M3MH 4OXPA 1BVSA 4R4TA 1V1QA 4L5TA 1PH8A 1J5EL 5JJLA 1QZGA 2EIFA 2I5HA 5LMNW 4JI4L 1G291 1PFSA 2LXJA 3J80c 3RN2A 4XTCS 2UXDQ 1VQOA 3H3VH 1Q46A 2F52A 1LTLA 4GN4B 5C3EH 3HKZE 2F4VQ 2GVAA 3H3VI 3HOZG 1M90C 4QY7A 1Q8KA 4GNXB 3A5ZB 5IWAQ 3HOXH 2R7DA 1EQQA 4LF9Q 3AFQA 3CP0A 1HR0L 4B3MQ 1OXVA 1XNRL 3S2DH 4WJ4A 1TWHH 2KCMA 3ICEA 4X6AH 2D0PA 2ZJPA 4DR4Q 1KHIA 1UE1A 4OWWB 4LNQA 3CPFA 4JI5Q 3TQYA 3ZJYC 1NJIC 1MKHA 3PIPA 3GDEA 2Z6KC 2BH2A 2UUCQ 3HOYG 1NY4A 2MO0A 5GAEC 1TWGH 1K0RA 4DV4Q 4PZ8A 2FXQA 1N34L 2A1AA 4R4IA 4BA2I 1NMGA 2WB1E 2KHJA 1OTCA 1L1OB 1IBLL 3I4MG 4DUZQ 1N32Q 4JI7L 4X64L 3HOVH 1XNQQ 3CCLA 4IPHA 3H15A 3FKIG 4DV7L 4QGUA 1GM5A 1WI5A 4JBKA 2VUMH 4L5RC 1EIFA 4DR1Q 2VZAA 1X56A 3UDGA 1XMOQ 4IO9A 1GD7A 2B3GA 1VQGA 2BH8A 3KDFA 3CCMA 5EAYA 3J81c 3KJOA 5IP9G 3PO2H 2OQKA 4XIGS 2K5VA 3WWVA 4HIKA 4A3DH 3NELA 3PO3H 1L2FA 4K0KL 1EFWA 3I7FA 4H02A 2PI2A 2N3SA 4IOCA 4LFAL 4YWKA 2HQLA 1J5EQ 5LMUQ 2VQFL 1HNXL 4DR5L 3B6YA 3BU2A 3AEVA 1VQJA 5FJ8G 2YYZA 2VW9A 3OW2A 2PI2E 4MNOA 1AH9A 3S1NH 1E7ZA 2F4VL 3G4SA 4APVA 1XPUA 1X54A 3BZKA 2ID0A 4TQUS 3GTJH 2NVXH 4UPAA 4YCUA 3CCSA 4DV3L 3BZCA 3FHWA 4WJ3M 4DR7Q 4AQYL 1UEBA 4JI5L 2KENA 4NPSA 2MQHA 1KAWA 4OX9Q 5C4XG 2K5NA 1T9HA 1SROA 3IRBA 1I5FA 1IBMQ 4HIDA 2E2JH 3GTOH 3HOUG 1Q1BA 4HIOA 4JI8L 1Y1WG 3I4NG 4X66Q 4A3CG 2B63H 2MFIA 4A93G 1FL0A 4DV2Q 3D0FA 2ZM6Q 2A19A 3UDIA 5IP7G 1OXSC 4LWCA 3L2PA 1LUZA 1PH3A 4YCVA 1XPOA 3CF5A 4DV7Q 2JA7H 1UE5A 3G6EA 1NBWA 5FLXc 1YJ9A 4UY8C 1YHAA 3BJUA 1P8LA 4LUVA 4AYBE 4GNXA 1HZBA 1VQDA 2JA9A 1N32L 1IZ6A 2JQOA 5H1SE 4P75A 1O7IA 4NXNL 2R7ZH 2ATWA 3UE0A 3CC7A 1A63A 1B7YB 1NMFA 2JEBI 3CMEA 1CSQA 1QVGA 2E2IH 1PV4A 2HHHL 1MJCA 3GO5A 3KFUA 4A3EH 2YV5A 4A3IG 4DPGA 5M5WH 4K0KQ 1N33L 2VY3A 1VQ6A 1QVFA 4A3GG 2VQFQ 4BBSH 4C2MH 3KYHC 4YWLA 3TS0A 2QA4A 4A76A 4JOIC 1TWAH 3GTMH 5IYBG 2K4KA 1CKNA 4X62Q 5E7NA 5C0XJ 1KC8C 2ES2A 4DV1L 3HFZB 2KCTA 4DV3Q 4A3KH 3KOJA 2XGTA 3S2HH 2UXCL 1V43A 3J80i 3NENA 2RCNA 4YY3Q 3UDFA 4DR7L 1Q7YC 4AYBG 4JI6Q 4A3BG 3I2ZA 4KHZA 3HKZG 4JI1L 2UU9L 4LFCQ 4A3LG 4BXXG 5M3FG 3CW2C 1HJPA 4GKKL 2JA5G 2EQSA 4IFDJ 3S24A 1PYBA 1HNWQ 1Q82C 4DK6C 2YTXA 1CKNB 2LSSA 2C35B 2Y0SE 3CQZH 1VQMA 1IBKQ 4JI3Q 3J7A5 2DGYA 2I5LX 4IJHA 5AJ3L 3J7ZC 3CCUA 1HNZL 3AYHB 3EBEA 4RMFA 1CKMA 1C9OA 4LF4Q 4DV2L 1PHJA 2JEAI 3HOWH 1X6OA 1S3OA 4GN3B 4GOPB 2NZHA 4BBRG 4A75A 5FLMH 4BY7H 1UWVA 4LFBL 3TS2A 4L5QA 5M5XH 1OXUA 2D62A 3UE1A 3CCEA 2UUAL 4B3SQ 1PH4A 5JJKA 4HJ8A 2I5MX 3NBHB 5IYCG 4JI2L 3U58A 4NXNQ 1OXTA 1P16A 3STBD 2R93G 3HKSA 3KF6B 1UE6A 1BKBA 1VS0A 3H0GH 2IHFA 2Y0SG 5HGQA 3MEFA 2JA6G 1RL2A 2KBNA 2IX1A 3RZOH 3S1QH 3GTQH 4LF8Q 3M7NA 2RF4A 4A3MG 4GNXC 4UP7A 2CFMA 3M85A 3PF4A 2HIXA 3OTOL 2YU9H 3SGIA 3STBC 3TEHB 2LXKA 1IXRA 1VQLA 2K14A 1DGSA 5C3EG 4GKJL 2Q2HA 2N8NA 4DKAC 4B3TL 1JB7A 3Q8DA 3E0EA 3J81j 1HZCA 3ULPA 1J6QA 3PGZA 3ER0A 4AH6A 4B3RQ 1WYDA 1GO3E 2IX0A 5HY6A 1N36Q 3PUZA 4LW1A 2ZTDA 3W1BA 2VL6A 2K52A 5JEAG 1BBUA 1AE2A 4QL5A 1B8AA 2NZOA 3RNUA 1IL2A 3GTKH 2VQEQ 2CCZA 1I3QH 1BBWA 1CUKA 4GN5A 3CC2A 4BY1G 2R92H 4IJLA 4R4CA 3RN5A 2CKZB 4YCWA 1UE7A 3DM3A 1IBKL 3I4MH 3KF6A 1YJWA 3HOVG 4MTNA 4LF4L 3CC4A 3PUWA 4NXML 3RLNA 1C0AA 4LF7L 4Y7NH 3J81i 1VQ9A 1M1KC 2AMCB 4B3SL 2UUAQ 1Y1VG 1PH7A 1XTDA 4GOPA 3U4VA 4P74A 5IP9H 4JI2Q 3PCOB 2MO1A 3S14H 1CSPA 1S40A 4IPGA 3PO3G 5JJIA 1E24A 2ZJRA 4KLKA 1JJCB 4DV0Q 4RG1A 3MXNB 1QUQB 4LF6L 1YJNA 1A0IA 1VQIA 4DR6Q 4P73A 2OQ0A 1B70B 1WCMG 5FJ8H 2NN6I 3M9BA 1I94L 2K75A 1L0WA 4JCVE 1Z9FA 4GKJQ 2OTJA 1KIXA 2UUBL 1VQAA 4B3TQ 2NVQH 4DV6Q 1QVCA 2NVYH 4HIMA 4OWXB 3RZDH 4B3RL 2XTIA 4R4OA 4ME3A 4QQBX 4A3FG 4JI4Q 2EXDA 2AWNA 4A4IA 3T1YQ 3CCJA 2A8VA 1G51A 3NEMA 1KRTA 2VQEL 4POFA 3JC66 1HR0Q 2Q2UA 2UXDL 1FGUA 1HNWL 2N49A 3DLLA 2WAQG 4GKKQ 1HZ9A 1Y1WH 4LF9L 2JA8H 4JV5Q 1R9TH 5K36G 2B63G 1WOCA 4B3ML 4A93H 1HR0W 5IP7H 1EOVA 1YI2A 1VQ7A 2I0QA 2JA7G 4PG3A 2YTVA 1SFOH 2PQAB 4DAMA 5GQOA 4R1JA 4DV4L 2VS1A 1XPRA 1K73C 3AQQA 1K9MC 5M5YH 4Y52H 2DUDA 1WJJA 1RIPA 2R7ZG 1I50H 4PZ6A 1IBLQ 3S1MH 2JK8A 4EQ5A 4DUYL 4JBMA 4JI7Q 4X64Q 5JEAJ 5IYDH 3EIVA 1NE3A 4A3GH 5C0XG 3CPWA 4DR6L 3K7AH 3KF8B 1A62A 2JJQA 4UP8A 4DR1L 1XMOL 1I94Q 2OCEA 4JYAL 2ALYB 3K8AA 1E1OA 1Q1EA 1A8VA 1X3EA 1YEZA 4JBJA 4TVAB 1PA6A 5IYBH 3U4ZA 4YWMA 4DV6L 3CCQA 1SMXA 2MNAA 5LMUL 3G48A 3F2DA 4DR5Q 1G6PA 2IT1A 1YNXA 3PUXA 4A3KG 1KQSA 2WP8J 1PH2A 2Z0SA 3T1YL 4JC0A 1YBYA 5LMNQ 1YHQA 1HNXQ 4DR3Q 4BXXH 4A3LH 2ASBA 1YVCA 3CMAA 1U0LA 5M3FH 2E2HH 2JA5H 1VQKA 5C44H 3PUVA 3F2BA 4DV5L 1YZ6A 1L1OA 2BA1A 3K80C 1SE8A 4JV5L 4GLVB 5M3MG 4AQYQ 2OWOA 4KI0A 3HOWG 1W3SA 3U50C 4OX9L 2IHEA 5FLMG 1VCIA 2PQAA 5C0XI 3AFPA 1VQFA 2V1CC 3HOZH 1JJGA 2CWPA 2K50A 4JI8Q 3HOXG 4X66L 1CKOA 2OTLA 1IBML 1E22A 1SR3A 2BA0A 2R93H 2ZM6L 2UXCQ 4OONA 3FP9A 1EUJA 2JA6H 3OYYA 1EQRA 1LM0A 2GN5A 4YHHL 2L15A 3A74A 4IFDI 4O0AA 4BA1I 4DUYQ 1KD1C 2AWOA 2E8GA 4AIMA 1VQBA 1PYSB 4A3MH 5DLQE 3KJPA 3T1HQ 1ASYA 3HOYH 4QJFA 3ULJA 1IYJB 2KHIA 2F3IA 4JYAQ 2AHOB 3K81C 1TWFH 1D7QA 2E5LL 2RHQB 1H95A 1KXLA 4O2DA 3CCRA 1K8AC 2HHHQ 3FKIH 1YIJA 2VUMG 3F1ZA 3JAMc 3RR5A 1N33Q 4DK3C 1MIUA 2PMZE 5LMNL 1KL9A 4DR3L 5GROA 1K8GA 3KLWA 3I56A 4BY1H 2R92G 5GADC 4X62L 1Z47A 3GD7A 2H5XA 5BR8Q 3PO2G 2UXBL 4DV1Q 4GS3A 1HH2P 4DV5Q 1Q81C 3RLOA 2WB1G 3L0OA 4A3DG 1U5KA 4UP9A 4QIWE 3ULLA 4YY3L 3L7ZC 1X65A 5GAHC 1WFQA 4LFCL 1PH6A 4OO1I 1TXYA 1X3FA 3M4QA 2NN6G 3G71A 4GLXA 1Y14B 4FDBA 3E9IA 1PH1A 1YITA 4MZ9A 4JI6L 4LF5Q 4OO1G 2UU9Q 3I55A 4JI1Q 1Y1VH 1N8RC 3CXCA 2VNUD 4JI0L 2Q2IA 4DR2Q 1SRUA 4DAYB 4JI3L 1JE5A 4JG2A 3GTPH 1X9NA 2IY5B 1FJGQ 1N9WA 2NVTH 2WFWA 2GVBA 5AJ3Q 1HNZQ 4YHHQ 4JBWA 1OXXK 1E1TA 2YTYA 1WCMH 5C4XH 4HJ5A 1XMQQ 5GAGC 3T1HL 1VQHA 4LFBQ 1GKHA 1ASZA 2B29A 5ELOA 4HJ9A 5ELNA 3M4OH 4C3IH 3D31A 1QZHA 3S1RH 3HOUH 4X65Q 1VQPA 4LUZA 1GVPA 3F2CA 4OWTB 3I4NH 3VDYA 1VQ8A 4C3JH 4A3CH 4P71A 3UDXA 5C4JH 2E5LQ 2ZJQA 1XMQL 5IY0A 4LF8L 3TRZA 3LGJA 4A3FH 3A5UA 4A3JH 3CCVA 2ZTEA 2K5HA 1I6HH 3JAMi 1PVOA 1X3GA 3W1GA 3OTOQ 3S17H 2CWAA 4KHPQ 1C7YA 4J15A 4IFDG 3CAMA 2QEXA 2HT1A 1QUQA 5BR8L 2JA8G 2UXBQ 3CD6A 2QGQA 1NTGA 2Z6KA 4A3EG 4A3IH 3K0XA 1N36L 2AKWB 1D8LA 3PIOA 2RHSB 1EWIA 4PZ7A 4HJ7A 1EYGA 4BBSG 4GOPC 1EIYB 4R4QA 1L1OC
chains in the Genus database with same CATH superfamily
4A3FB 5IWAL 4LF5L 2PNHA 1WVLA 3TREA 1JJ2A 5EGTA 1TWCH 2HUGA 4ALPA 4DR4L 5DNFA 2KJXA 4KKTA 2BDNA 3MC0B 4PMWA 5FLXE 2UUCL 1W2BA 3VR6A 4LUOA 2M00A 1X55A 4ZKBB 4IUVA 2N78A 3M4PA 3DHQA 2D5DA 2R7FA 5D14A 4RHSA 1SLJA 2ZTCA 1O7YA 2WAQE 3KDFB 1VQNA 4KD4A 3E9HA 1VQ5A 3DWPA 1HA5A 4RHRA 4BY7G 2CW0D 4ZYSA 2F0TA 1F9RA 1B50A 3I4OA 1LYLA 1PMRA 2D0OA 1VQ4A 2RA4A 5IYCH 1JCKB 1MI2A 2HIVA 2UUBQ 4A3JG 4GLAC 3H0GG 2CQOA 2K05A 1B9NA 2EIFA 2LXJA 3JAME 3A8KE 4R8IA 3RN2A 1H9SA 4PMBA 2F4VQ 3HOZG 4LAAA 4GNXB 1Q8KA 3T4AC 3A5ZB 3HOXH 1EQQA 3HOVB 3AFQA 4WJ4A 1HR0L 4B3MQ 1BUVT 2NWGA 2PO4A 1TWHH 2KECA 2E2HB 4HSPA 1UE1A 4OEMB 2QDLA 3KUPA 2KVMA 2BH2A 4ABNA 1VF5C 1SJED 2HCIA 5GAEC 4DV4Q 1A2TA 1N34L 5I2XA 4BA2I 3IFDA 4G7OC 2KHJA 2X6LA 1PLFA 4E6IA 1N32Q 3G6JB 4DV7L 3HOUB 3Q0AA 4DR1Q 3GTPB 1BDOA 1VQGA 4A3JB 3CCMA 3VR2A 5EAYA 5JPNC 4ZQ3A 1L0YB 3WWVA 4HIKA 5M5YB 3OIQA 1MSGA 1EFWA 4H02A 2PI2A 1RCVD 1J9OA 4YWKA 2HQLA 4ODGA 5D3DA 1VQJA 2VW9A 1Y1WB 4MNOA 1AH9A 2HQEA 2VB3X 1X54A 4X3SA 3BZKA 4TQUS 2K5DA 3GTJH 4YCUA 2A74C 4DV3L 5EBCA 4AQYL 1UEBA 2PZTA 2ZXRA 4JI5L 3S14B 2CHBD 2QW7A 2EOTA 1SROA 1HUNA 3HOUG 1TR5A 3I4NG 3N52A 2NYZD 4F88A 4A93G 1FL0A 4DV2Q 2ZM6Q 1A3VA 5IP7G 3L2PA 4LWCA 1LABA 4YCVA 1XPOA 2JA7H 2EDGA 1UE5A 4EQPA 4UY8C 1GJXA 1P8LA 1HZBA 3S9WA 1IZ6A 4JVZA 4NXNL 4PQXA 3TDQA 1K0SA 3UE0A 1B7YB 3KLRA 2MP1A 2E2IH 2AQ1B 1K8OA 3URYA 3NP8A 3K5MA 5K5PA 1N33L 5CR3A 4G7ZC 1QVFA 2KCCA 3SK8A 2VQFQ 4RAUC 4PV1C 3C46A 3KYHC 4YWLA 4N8X1 4L6TB 5E7NA 5C0XJ 1PRTF 4DV1L 1QE6A 4ULLA 1HA6A 3NENA 4DN4M 2MJ8A 1Q7YC 4A3BG 2UU9L 4R9WA 5M3FG 5TSSA 2EQSA 2BE5C 1I4PA 3OMGA 1F2LA 1PYBA 1F2MA 2EYPA 2LSSA 3CRLC 2C35B 3CQZH 1VQMA 4IJHA 3J7ZC 3ONAB 1CKMA 1EY6A 1S3OA 5FLMH 3TBIB 4L5QA 3TMEA 5M5XH 5C5LA 4FYDA 3U58A 2QILA 4A3JH 3KF6B 2IHFA 5HGQA 5CV4A 3KBGA 3MXPA 4GNXC 1SYDA 3PF4A 2R61A 3OTOL 2YU9H 3SGIA 3STBC 3BDCA 5A35A 1DGSA 2EY2A 2EYFA 2PZUA 5IODA 2AQ3B 1QCBD 4BBRB 1XXGA 2L55A 3E0EA 3J81j 1JB7A 1WCMB 1STAA 3M4YA 4B3RQ 1WYDA 2K52A 2E76C 1BBUA 1B8AA 1RDPD 1IL2A 2CCZA 1PTOD 4EGVA 3DWQA 1IBKL 3I4MH 5CBEE 1HQMC 1GHKA 3CC4A 3HEJA 1B2TA 4NXML 5ELDA 2UUAQ 1PH7A 2EPBA 3BS1A 4KK7A 4NKLA 3PCOB 1CSPA 2MUYA 1JJCB 4DV0Q 3AMUA 1TWCB 1A0IA 1FNUA 4P73A 1B70B 1Q90A 1WCMG 2JA8B 1EEFD 3M9BA 4MTKA 3GP7A 1O7ZA 2B8GA 4GKJQ 1AEXA 3K59A 3T53B 1VQAA 2XVSA 2WKCA 1VMPA 4HIMA 5EBDA 4PMCA 3FDTA 4ME3A 5IGFA 4JI4Q 1A2UA 2AWNA 4HN7A 4A4IA 3CQZB 2A8VA 1STGA 2ICIA 1KRTA 1GUSA 4XT1B 2Q2UA 1PRTC 2LFNA 2JXMB 3LX0A 4B3ML 4IZ8A 5IP7H 3HS0C 1EOVA 2JA7G 4L63B 3TZUA 2PQAB 5E3FA 4DAMA 1G2SA 4FXGC 1K73C 2Z1CA 2OT2A 2HDMA 4PZ6A 4H44C 5M5XB 2JK8A 4OGQC 4EQ5A 4XXEA 4DUYL 4JI7Q 5IGEA 4ZRZA 4X64Q 4I7ZC 4XDXA 4WFN3 4HSVA 3CPWA 4DR1L 4ZCKA 4JYAL 2ALYB 3K8AA 5A2QE 3HOWB 1GUOA 4TVAB 4RGMA 1Z7TA 5C4XB 4ZK9B 3K58A 3F2DA 2IT1A 2B2TC 3ITPA 3I4MB 4A3IB 4BXXH 1B1ZA 4A3LH 1IW7D 4B9WA 2TMPA 3DUZA 2E2HH 5FK9C 3K80C 4JV5L 5M3MG 2OWOA 1W3SA 1JQYD 4KTAA 2F3WA 4OX9L 1PTOH 5FLMG 5EJWA 5C0XI 1JE4A 3BG3A 2V1CC 2K50A 1PDQA 3A7LA 4X3TA 1IBML 1SR3A 4U68A 4ZAIA 3FP9A 1EUJA 2JA5B 3CRKC 2GN5A 4DAVA 3A74A 2CVRA 4BA1I 2EY1A 2K33A 3PIO3 4A3MH 5DLQE 1PRTD 3I3CA 3T1HQ 5JPMC 1S4ZA 3FRPB 1KTKA 3TP7A 2CH4W 5LL6S 4XYQA 1J8IA 1TWFH 1JOQA 2RHQB 1LTTD 2NUCA 3J7AF 1FD7D 2HHHQ 3FKIH 1YIJA 2RDGA 3JAMc 1DZ1A 1PFNA 3GV6A 1S5ED 3BDOA 1K8GA 3KLWA 3I56A 5GADC 3PO2G 2H5XA 3SDZA 3H3VC 3FVQA 4A3DG 2WB1G 2SEBD 4QIWE 4YY3L 3J80L 1TWHB 1WTQA 1D5ZC 1AN8A 1Y14B 2UU9Q 1E0BA 1Y1VH 2VNUD 4A3GB 4DAYB 4JI3L 1JE5A 4F7XA 3GTPH 1EZ6A 3EJIA 1N9WA 2NVTH 2WFWA 3D6CA 5ELCA 5AJ3Q 4YHHQ 2A5HA 2F3VA 4JBWA 1OXXK 3SEBA 3S2DB 1D1IA 1YNND 4FO2A 2B29A 3J7YW 3KBXA 3QG1A 1QZHA 1VQPA 3F2CA 1VQ8A 1LT4D 3T16A 4C3JH 3IKJA 2QKIC 4A3FH 3A5UA 3SVMA 3CCVA 1STEA 4EQOA 3I73A 1I6HH 1B44D 3W1GA 3OTOQ 2F1MA 5E1FA 4IFDG 4WJWA 3CAMA 1H9KA 2A69D 1ZYRC 2MGSA 2QEXA 1Y69U 2UXBQ 3CD6A 2K03A 2PZWA 2Q8TA 4A3EG 2AKWB 1GUWA 1D8LA 2B2WA 1AZPA 1SYGA 3NBHA 4OL7A 1K3RA 4GZYC 2RQXA 4DR2L 4JOIA 2JE6I 2R6GA 1OO9B 3NQTA 1FVIA 1JT8A 3ERQA 3J81L 4DNIA 3RLFA 2F0NA 3NHHA 3PUYA 4K8JA 4IPDA 4BBSB 2IX3A 3GV3A 3PV0A 4HEDA 4X65L 1GUGA 4IPCA 3A8JE 4NB3A 4LF6Q 1R4PB 2WIIB 1EY4A 3NE5B 2MPMA 1E3PA 1Q86C 4BBRH 1A3UA 2A68D 1MJEA 2L11A 2B2TA 4DA2A 5IT9c 3J80E 5T1IA 3F8TA 3NUCA 5M3MH 4OXPA 2F0LA 1BVSA 4R4TA 3CU7A 3I90A 4H0LC 4L5TA 3TSSA 1PH8A 5JJLA 1QZGA 2I46A 2I5HA 1JOOA 4JI4L 1PFSA 4K2KA 5DAUA 3H3VH 2F52A 5C3EH 1CQFA 2GVAA 3H3VI 1LO5D 4QY7A 4GKKL 1TT2A 2LKVA 1OXVA 4MN3A 3CKIB 4O1NA 4C1NK 4Y7NB 1KHIA 4OWWB 4DR4Q 1BOSA 4LNQA 4QF4A 4JI5Q 3TQYA 1NJIC 3PIPA 2MO0A 1K0RA 2SOBA 4PZ8A 2FXQA 4R4IA 2YU9B 3Q23A 4RH6A 1IBLL 3MHBA 3HOXB 3HOVH 1K83B 2WAQB 4IPHA 4IUQA 5KYIA 3S1RB 2VUMH 4L5RC 4IO9A 3GTQB 2BH8A 1PXUA 3DEPA 5C4JB 4HAEA 3PO2H 3KJOA 1QB5D 4XIGS 3I7FA 3NK9A 2JSOA 2N3SA 1JB3A 4K5VA 1J5EQ 1CHQD 3M7GA 2K01A 2VQFL 1HNXL 3BU2A 1JORA 4KMUC 1D5MC 2YYZA 3DWAA 2PI2E 3S1NH 2F4VL 1GHJA 3G4SA 2B8FA 3V2TA 3VYTA 2NVXH 4UPAA 5JOBA 3WOFA 3CCSA 3BZCA 3FHWA 3AU7A 4NPSA 1E2ZA 2B2UA 4OX9Q 3UI2A 3NTKA 1KABA 3JAML 3D3RA 4HIDA 2Q8RE 4C3IG 2E2JH 1Q1BA 1Y1WG 2J7ZA 4C3JG 4K2LA 2MFIA 3S1NB 1PTOF 2XSCA 1SEBD 2UXCL 1OXSC 3PMFA 3CF5A 5FO7B 1NBWA 1SNQA 1KDBA 4LUVA 4AYBE 1VQDA 2JA9A 1ESRA 4P75A 3IFTA 2ATWA 1NMFA 1ZXTA 1CSQA 1HQRD 4K0KQ 4DPGA 5M5WH 2VY3A 1EYAA 2WACA 2O2LD 5C0XH 4BBSH 4C2MH 2G9DA 2QA4A 4A3MB 4A76A 4JOIC 1TWAH 3T56B 3R3OA 5IYBG 1O78A 1KC8C 3HZXA 4DV3Q 3S2HH 4DR7L 2E2IB 2RCNA 4YY3Q 2K32A 4RWSC 4AYBG 3J81E 5IOCA 4KHZA 4BXXG 4JI1L 4A3LG 4HMIA 3AB9A 1HJPA 3CW2C 1TQOA 1Q82C 1LV9A 1CKNB 2YTXA 2Y0SE 3TP8A 1BQQT 4JI3Q 1F9SA 2I5LX 3D6WA 5ELFA 3SXHA 1EOTA 3AYHB 5C3EB 4DV2L 1PHJA 3MWYW 1X6OA 1STYA 1CZGA 1UWVA 4LFBL 3I70A 3TS2A 4B3SQ 1OXUA 2D62A 3UE1A 2UUAL 2X6GA 4C3HG 4HJ8A 2K7VA 2XIWA 4NXNQ 1I6VC 1OXTA 2EYMA 5CBAE 2O4XA 4PNYA 1UE6A 1BKBA 1TS4A 2JA6G 1RL2A 4KV6A 5ELEA 3S1QH 1SE3A 4FF4A 2RF4A 4A3MG 1O80A 4UP7A 2HIXA 4M1UB 1IXRA 2ZXPA 4DKAC 3Q8DA 1PTOB 2N55A 1HZCA 1WD0A 3ULPA 3ER0A 5HURA 1N36Q 4CHTB 4AYBB 3M3YB 1CT1D 1ML0D 5C5MA 4F87A 2AQ2B 5JEAG 2E74C 1IYVA 4J1MA 2NZOA 3GTKH 2CH4A 3ND8A 1BBWA 1LT6D 3NTIA 1QILA 4IJLA 4R4CA 4V0BA 1FYCA 1K8MA 3DM3A 3KF6A 3TN2A 3HOVG 4MTNA 1HHVA 3J81i 1Y8NB 1JWSD 1QNKA 1RJTA 1Y1VG 1PRTB 4GOPA 3U4VA 4P74A 2V4DA 1X3QA 3KLSX 1UEAB 3PO3G 1DM0B 5LHY1 4KLKA 4LF6L 1LTAD 4RG1A 3R2TA 1QUQB 1BBXC 4DAYA 1SMYC 2LS01 1F2ZA 1VQIA 2RCFA 3SE0A 3HOZB 2ICEC 1DOKA 1M8AA 4JCVE 2OTJA 2UUBL 1SNMA 5CGKA 4B3TQ 1IHZA 2DJFC 1WTXA 2XTIA 4R4OA 3QOJA 3T1YQ 3GTMB 2R7ZB 1G51A 3NEMA 1HPCA 2VQEL 5EPJA 3JC66 4POFA 4ZKCB 2Z9HA 4CKEA 1FGUA 1HR0Q 2N49A 1HZ9A 1Y1WH 2JA8H 4JV5Q 4K5XA 5IIFA 1R9TH 2B63G 3FMCA 2OF1A 4H7BA 1DOMA 4ZUIA 2D9UA 4QB4A 4R1JA 1XYIA 3PO3B 2EE1A 1RIPA 4NP5A 3NBIA 2F0MA 4TKOB 1DCZA 4JBMA 1SNPA 2A6EC 4A3GH 5C0XG 4DR6L 2RKSA 3K7AH 1A62A 1EY8A 2JJQA 4UP8A 1DD2A 2Z8LA 1I94Q 2JA7B 1ZYRD 4JBJA 3Q24A 1PA6A 2BDOA 1WTVA 5IYBH 1TWGB 3H91A 3U4ZA 2PMZB 3ND9A 1SE2A 1SMXA 5LMUL 3OIPA 4CKBA 1YHQA 4DR3Q 1WTRA 2B63B 5F2DA 3CMAA 5M3FH 2JA5H 4EVOA 1EY7A 4RA8A 4GLVB 1IKMA 1I3QB 3HOWG 1G2TA 1EWCA 2IHEA 1EYCA 1VCIA 2PQAA 1S5FD 1VQFA 1ET6A 1ENAA 2F0HA 1TS2A 2BA0A 3QOLA 1PYWD 2ZM6L 4KY6A 2JA6H 1R4QB 4KD3A 2B2YC 1LM0A 2L15A 4OIJA 4O0AA 1KD1C 4AIMA 2B39A 5M3MB 5JVH3 4P2CB 2KHIA 4XT3B 4QCLA 4JYAQ 1PZJD 3S2HB 3K81C 4XQNA 1ILPA 3TP6A 4A3BB 3E3XA 2MHVA 1D2BA 5JEAH 1EY9A 5M3FB 1F2YA 2RDFA 3FPUB 2KQ3A 2DNCA 3VR4A 4DK3C 1O7LA 4RKLA 1DONA 5GROA 1KAAA 5BR8Q 1II3A 2KHSA 3GD7A 4ILWA 3EFXD 4DV1Q 1HH2P 4DV5Q 3RLOA 1CA5A 1U5KA 2P5ZX 3MXNA 2R3ZA 1UAPA 2BOSA 1LTID 1CA6A 5GAHC 4CGYB 1X3FA 3G71A 2JN4A 1ESFA 3E9IA 4OO1G 3CXCA 2SNSA 1SRUA 2NTSA 4FP5D 5EKKA 1FJGQ 4DXGA 2GVBA 3PO2B 1Q3LA 5KNBA 1E1TA 4J8QA 5DM73 3RMHA 4QUCA 1ZKOA 1WTHA 3T1HL 1GKHA 1ASZA 1VF7A 3S1RH 3I4NH 4BWGB 4DNRB 1WD1A 4ME5A 5C4JH 2E5LQ 2ZJQA 4LF8L 1XMQL 3TRZA 3V05A 1Z6HA 5E4XA 5CORA 4UAIA 2EJMA 5IGGA 3TP5A 1PVOA 3S17H 2CWAA 2G9HD 2EY6A 4J15A 2KCNA 1EL0A 2NTTA 3SK6A 2JA8G 1DXMA 2QGQA 3NPPA 4KJNA 2Z6KA 4RKBA 3HKZB 3M4OB 1LACA 2F0OA 2EYLA 4HJ7A 1EWIA 1EYDA 4GOPC 2DJGC 1EIYB 4J6HA 4G4KA 1NNXA 1XNRQ 4JI0Q 5C6AA 1SNOA 3EN2A 4OHJA 4P72A 1S72A 4HJAA 1EY0A 1PH5A 3H94A 5C44B 3SR1A 2OXPA 3VA5A 3M3YH 4A3BH 3X3MA 4KY7A 1V9PA 4LF7Q 1EWHA 3PF5A 2RBMA 2O5IC 1HFNA 3A0JA 2FMCA 1CI3M 4CDCC 1YHBA 4DV0L 4L5SA 4HTHA 1XNQL 3L3OC 1AE3A 4BY1B 4QIWB 3PSIA 4POGA 3W5OA 4L8JA 3QIAA 1LTRD 3ERSX 3GTLB 1HZAA 1SYEA 1EIHA 3S15H 1S5DD 4X3UA 2A6HD 3MEHA 3A54A 4LFAQ 5BN3A 1IKLA 1V1QA 1J5EL 5A2QL 3GTGB 1MGSA 4XTCS 1T5EA 4QMGA 4C56C 4GN4B 1LTLA 1HNWQ 3HKZE 1M90C 4LF9Q 2R7DA 3BZDB 1LLRD 3CP0A 2O5JC 2B2YA 1HRJA 3ICEA 4X6AH 1YNJC 2D0PA 2ZJPA 2B2WC 3ZJYC 1MKHA 2GA4B 2Z6KC 5IT9L 2A69C 1SNCA 1TWGH 3A8IE 4DFAA 1U4MA 4K14A 3WOEA 2WB1E 1OTCA 1L1OB 5KNDA 3I4MG 4DUZQ 4JI7L 4X64L 3OWFA 5HGTA 3FKIG 4O42A 4QGUA 1WI5A 4G7HC 1EIFA 2VZAA 3UDGA 1GD7A 2Z4HA 2E75C 4RGOS 3EQLC 2F0PA 1W6KA 4HMJA 3J81c 1CM9A 2F0DA 5FO8B 1ZEQX 3D4DA 2B2VC 4A3DH 4K0KL 1L2FA 5FOBB 4K6LA 3P1HA 4DNTB 2L5TA 5LMUQ 3Q22A 4DR5L 3B6YA 4X3KA 3AEVA 3BYTB 1R9TB 4OO1H 1KNEA 1E7ZA 2C5CA 3BVZA 1RTOA 3QR8A 1HUMA 4K8IA 4APVA 4I65A 3OMCA 1RODA 4DR7Q 2B2VA 1AP0A 2KENA 3MXGA 2WB1B 2MQHA 1IL8A 2QCPX 1QWYA 2K5NA 1T9HA 2KEEA 5KEEA 2A6HC 1G8ZD 1I5FA 3QWNA 1IBMQ 5I9OA 3FKIB 4A3CG 4JI8L 2B63H 4ZLTF 1JICA 5ISRA 3D0FA 3UDIA 1LUZA 2KEDA 3G6EA 1YJ9A 3W3AA 1D1KA 1YHAA 3BJUA 3C3LA 4GNXA 2L0CA 4KY5A 4IFDH 3CC7A 3CMEA 5JVG3 4Q5VA 4LMQD 2HHHL 3GO5A 3KFUA 4A3EH 1JOKA 1CTMA 1VQ6A 3WDNA 1BCPC 4A3GG 4C1NI 5CV9A 1C48A 3A55A 3GTMH 1CKNA 3E0JA 2KCTA 5I2YA 4A3KH 3KOJA 2XGTA 1V43A 5I6WA 2AUJD 3I2ZA 4LFCQ 3S15B 1PFBA 3S24A 3K5OA 1X32A 3E5SA 5AJ3L 1RD9D 4LF4Q 2R92B 4RMFA 1C9OA 1IW7C 3HOWH 2HDLA 2JEAI 4GOPB 4GN3B 2F0WA 2NZHA 4A75A 4BY7H 2L4NA 3CCEA 1ILQA 1GUTA 2I5MX 2FINB 2H4OA 5IYCG 4JI2L 1P16A 4B08A 3C2PA 2R93G 3MTSA 1VS0A 3H0GH 2IX1A 2Y0SG 1SYCA 2KBNA 3GTQH 3HG9A 4I7AA 4LF8Q 3M7NA 1HCZA 1U9RA 3M85A 2CFMA 2L9HA 3TEHB 1VQLA 2K14A 4IN3A 5C3EG 4JW0A 3C1FA 4B3TL 3R2IA 2K5QA 1LTGD 1J6QA 3SHLA 4AH6A 1GO3E 3PUZA 2ZTDA 2VL6A 1XX8A 3D8GA 1U4LA 1AE2A 4QL5A 4QUFA 1FNWA 2VQEQ 4G57A 1I3QH 1CFMA 1CUKA 4GN5A 5J1ZA 2Z4IA 3CC2A 1BCPF 3RN5A 2K04A 3V96A 1QG7A 1UE7A 2Q8IB 2KOLA 2PNRC 1KDCA 5IGBA 2XN9C 2H1EA 2XWBB 2E2JB 1UNSA 1C0AA 3RLNA 4Y7NH 1VQ9A 4B3SL 5KIXA 2WINB 3BVGA 2FJ2A 2MO1A 3S14H 1HXYD 1I6HB 4IPGA 1SYBA 1E24A 1RHPA 2ZJRA 3MXNB 1YJNA 3K6OA 4ID6A 2F0KA 4DR6Q 1CZWA 3K5LA 5FJ8H 4IQZA 3T51B 4CKCA 1I94L 2K75A 1L0WA 1Z9FA 1EIGA 3C1EA 5CV8A 2NVQH 3FEWX 2NVYH 3EVQA 2XRQD 1TY2A 1Y1VB 1YNNC 4A3FG 2PPBC 1U4RA 1I4GA 4IURA 1JR0D 1QNUA 3N6RA 1EU3A 1HNWL 2WAQG 4LF9L 4N9TA 2FHTA 3R93A 3OPOA 3RD4A 1BR9A 1SFOH 1BO0A 2VS1A 1K9MC 3AQQA 3S1QB 2NZ1D 2PQEA 2NVTB 2R7ZG 3OHXC 3S1MH 1IBLQ 4ZUJA 1FR3A 1CHPD 2LMCB 4BY7B 1RF2D 4DAPA 4C3IB 5IYDH 3BDLA 3EIVA 3RZDB 2DNEA 4FXKC 2CQAA 1E1OA 1Q1EA 3K5NA 5EKIA 1EU4A 2RVLA 3DXJC 1SJHD 5M9OA 4DV6L 3CCQA 2MNAA 1G6PA 1BXTA 5J39A 2WP8J 3MZ5A 3T1YL 4JC0A 3MAQA 5LMNQ 1S5CD 4C3JB 1YVCA 5LL6X 1VQKA 5C44H 4DV5L 1YZ6A 1L1OA 1L0XB 2DN8A 1MHWC 3A56A 4KI0A 3U50C 1DOLA 2F0UA 2DY8A 1H9SB 3HOZH 2CWPA 2HD3A 4X66L 2OTLA 1TU2B 2VUMB 1A15A 3T13A 2UXCQ 4OONA 4FF3A 1EQRA 2XRSD 4U673 1AW7A 1PYSB 5C4HA 3KJPA 3HOYH 5G3LD 3ULJA 2N88A 4CJ1B 2F3IA 1KNAA 2ZT9C 1D7QA 2E5LL 3P75A 1H95A 4KN4C 3CCRA 1K8AC 3F1ZA 1E2VA 4FNFA 3RR5A 5JJZA 1N33Q 2JA6B 1YNJD 2A68C 4CDDC 1KL9A 4DR3L 1TY0A 2NVXB 4RFBA 5CYUA 4X62L 1Z47A 1F9QA 1LTBD 4GS3A 1Q81C 3SK5A 1WTPA 3L0OA 4UP9A 3ULLA 1X65A 1ONLA 4S3SA 4OO1I 1TXYA 3M4QA 2NN6G 1C4QA 2F0GA 2DY7A 3NWTA 1PH1A 4LF5Q 4KKUA 3I55A 4A93B 1SFOB 4JI0L 2F0QA 2QEJC 1I4QA 3E6ZX 2K1BA 2IY5B 5I4DA 1MSHA 5D3IB 2VXWA 1I50B 2YTYA 1JC7A 1V1PB 1VQHA 1HTLD 4HJ9A 2TSSA 3F2UA 3HOUH 1GVPA 4P71A 4KJOA 3UDXA 5CV5A 3LGJA 3PIP3 1HTPA 1TVXA 3NSWA 1X3GA 1NSNS 1D6EC 2PW5A 3NTHA 5D65A 3R8BA 1GOZA 2F0FA 3ZYYX 1QUQA 5BR8L 2RSOA 3NWSA 3I72A 2A73B 3PIOA 4PZ7A 1EYGA 2ZXOA 3RZOB 4R4QA 1XJVA 1PH9A 4IUTA 1VQEA 1H9MA 3S16H 3GTLH 2EYJA 1FJGL 1KRSA 1NR2A 2Q2TA 1STHA 1SN8A 5IYDG 1H9RA 4EX5A 4NXMQ 3LWUA 1C8CA 1AZQA 3H0GB 1N34Q 1ENFA 1I4HA 4C2MB 2CW0C 3GTKB 3HOYB 2WKDA 2F0EA 5BN5A 4DUZL 3GTGH 4K5WA 2OEOA 1VDZA 1VQCA 1CK1A 3K7UC 1PZKD 3H6MA 1NAPA 1A6XA 1K83H 4C3HH 3MXUA 1JMCA 5J3BA 4KHPL 5IE8A 5C44G 2F0JA 3SK4A 1Q12A 4IOAA 5IGDA 4CJ0B 1E2WA 2IW3A 4IUNA 5LMNW 1G291 5DEHA 4Z9CB 3J80c 5IT9E 3I91A 3VYUA 2UXDQ 1VQOA 1Q46A 2K5WA 5IWAQ 4KHVA 3S2DH 1XNRL 2EJFC 2K6AA 3MVVA 2KCMA 3BVMA 3CPFA 1Y8OB 3GDEA 2UUCQ 2IPKD 1NY4A 3HOYG 3IAYA 1EZ8A 1KDAA 3IL8A 3KLSA 2A1AA 1IYUA 1NMGA 3GQBA 3VYSA 1STBA 5KRUA 3Q6SA 2F0IA 1XNQQ 3CCLA 3H15A 1GM5A 4JBKA 4CDEC 5C3WA 1F77A 1K28A 1EQVA 1X56A 5DM63 1XMOQ 2B3GA 3KDFA 5C3XA 2SNMA 1BF4A 5IP9G 2OQKA 1NCVA 4XQQA 2K5VA 3NELA 3PO3H 2EJGC 3D4RA 4LFAL 4IOCA 2PW7A 3VA7A 1TWFB 3KF8A 3LWEA 4DK0A 3OW2A 5FJ8G 3I4NB 1S5BD 1BCPB 3VR3A 1Y8PB 1XPUA 4DK1A 5G3LF 2ID0A 3DMUA 1K3BC 3QO2A 4WJ3M 3MFYA 1KAWA 5C4XG 3S16B 5CC4A 3IRBA 3GTOH 3OOCA 1B4OA 4HIOA 4X66Q 1TS5A 1SE4A 1SNDA 5ELBA 2A19A 1N32L 1GUNA 1PH3A 2Z6BA 4DV7Q 4DF7A 5FLXc 4OIKA 1MD2D 1CQVA 4K6DA 4M8AA 2JQOA 3TZDA 5H1SE 1O7IA 1SXTA 4YIJA 5EPKA 2R7ZH 1HFGA 1A63A 1M4VA 2JEBI 1QVGA 5T1GA 1ICFB 1PV4A 1PTOC 1MJCA 2YV5A 1PZID 4A3IG 3GTOB 5E4WC 2F4IA 3DM1A 2PYKA 3TS0A 1LT3D 5CV6A 2F03A 2K4KA 4CBVA 4X62Q 2ES2A 1DYQA 3HFZB 4EQNA 1B3QA 1TKWB 3W2DA 4MIUA 3J80i 3UDFA 4JI6Q 1NR4A 4B9XA 3HKZG 4IFDJ 2JA5G 4V190 4IUPA 1GXDC 2K28A 2X69A 4DK6C 1IBKQ 3J7A5 2DGYA 3CCUA 1HNZL 5C4ZA 3EBEA 1NUCA 2NB0A 1QOHA 3U9SA 4BBRG 3P7JA 4N9PA 1B53A 5NUCA 1PH4A 5JJKA 5JAVA 3P20A 3I4LA 3NBHB 3PQIA 5BN4A 5I9PA 3STBD 2VB2X 3HKSA 1XMQQ 3MEFA 3RZOH 2WV6D 4TSSA 2LXKA 2ENBA 4UDUC 4GKJL 4A3DB 2Q2HA 2N8NA 3X3NA 5CMDA 2J0TD 5I6YA 4RGNA 1I4XA 2AUKA 3OWEB 3HRZC 3EA6A 3H09A 3PGZA 5HY6A 2IX0A 4LW1A 3W1BA 2EYHA 3DEOA 3MA2B 3RNUA 1H9JA 1UUPA 1SBBB 2BE5D 4BY1G 2R92H 1SSOA 2CKZB 4YCWA 3O13A 3OSOA 3BYYB 2B2UC 3I8ZA 1XWEA 4IALA 4LK1C 1YJWA 4LF4L 2M9VA 4KKSA 3PUWA 4LF7L 2NN6H 1V1PA 5M5WB 1M1KC 2XWJB 2AMCB 2G5DA 4HCSA 1XTDA 1FGBD 5IP9H 4CDFC 4JI2Q 2PCFB 1S40A 5JJIA 3KK7A 5FLXL 1G6ZA 1AFPA 2E2DC 4FF2A 2OQ0A 3FPPA 2NN6I 1KLUD 4A3EB 1KIXA 2EVBA 2L12A 1V1OA 4DV6Q 1QVCA 3RZDH 4OWXB 4B3RL 4QQBX 4DXFA 1ENCA 2EXDA 3CCJA 2C9OA 3J7AV 1F9PA 2UXDL 4A3KB 1BNZA 4RGTA 1ET9A 3DLLA 4GKKQ 5K36G 4DGZA 1WOCA 5J22A 4A93H 4XYOA 1HR0W 4HCEA 1YI2A 1VQ7A 2I0QA 4FVMA 4PG3A 2YTVA 1D5XC 5GQOA 1TWAB 4DV4L 5L37A 4WRDA 1XPRA 4Y52H 5M5YH 2DUDA 4LJZC 2IL8A 3HP3A 1WJJA 2KA7A 1I50H 4Q0FA 1WTWA 4JK1C 1QJOA 2QF7A 3QJYA 3A7AB 2F0VA 4RCOA 2M2LA 1VMCA 4F8MA 3EROA 5JEAJ 1SYFA 1NE3A 3KF8B 1LTSD 2NVYB 1XMOL 2OCEA 2EZVA 1YEZA 1A8VA 1X3EA 2NBFA 3MFGA 3S17B 4YWMA 1JWMD 1JWUD 3G48A 4DR5Q 1KLGD 1PFMA 1YNXA 3PUXA 4A3KG 1KQSA 1PH2A 2BCOA 2Z0SA 1YBYA 1HNXQ 1B3AA 2ASBA 1TIID 1U0LA 5AFWA 5KYLA 3PUVA 3F2BA 2HCCA 3NXWA 1EEID 2BA1A 1SE8A 4AQYQ 3HGBA 4TRDA 1LT5D 2A6ED 4RCNA 1RKNA 1T5XD 4FXDA 2LY7A 3AFPA 1W6JA 1JJGA 4WORA 4JI8Q 3RUZA 3HOXG 1CKOA 1RTNA 1E22A 2R93H 2IJ0A 5COYA 3OYYA 4OELB 4YHHL 1B9MA 4IFDI 3NQIA 4DUYQ 2JYOA 2AWOA 2E8GA 1VQBA 1ASYA 4QJFA 2F0SA 1V8QA 1IYJB 1U4PA 2AHOB 4NMZA 5FKAC 1KXLA 3U9OA 4O2DA 3VR5A 2VUMG 4MHEA 1EY5A 4NDXA 5FO9B 4XQJA 2Y0SB 1SDFA 1Q8IA 2EY5A 1MIUA 2PMZE 3LNNA 5LMNL 1WTOA 2KUMA 3L9AX 2RDHA 3GTJB 4BY1H 2R92G 2XNAC 5CV7A 2UXBL 1MBYA 2EXZA 5EPLA 3VYRA 3L7ZC 2EYOA 4BS9A 1WFQA 4LFCL 1PH6A 4GLXA 4KN7C 1BCPD 1EQTA 4FDBA 2R93B 1YITA 4MZ9A 4JI6L 4JI1Q 1N8RC 4H13C 3D4WA 2Q2IA 5EKLA 4DR2Q 4UHVA 2SDFA 4JG2A 1X9NA 4IUUA 5IGCA 1G91A 5KNCA 1HNZQ 3K0YA 2FFKB 3CHBD 5EQ0A 3S1MB 4HJ5A 5C4XH 1WCMH 4NW2A 5GAGC 4HR7B 4LFBQ 1X3PA 5ELOA 2JP1A 2I07B 1STNA 5ELNA 4C3IH 3M4OH 1I4RA 1SAPA 2L1BA 3D31A 4X65Q 4A3CH 4LUZA 4OWTB 4R8NA 3VDYA 1DJRD 1ICWA 1TS3A 2FMMA 2J4XA 4JPBW 5IY0A 1XTCD 1SMYD 2QDBA 3G7LA 2ZTEA 2K5HA 3JAMi 4KHPQ 1C7YA 3K57A 4CJ2C 2HT1A 4N8FA 5K36H 2RSNA 4C3HB 1A3TA 4FF1A 1NTGA 4A3IH 3K7AB 3K0XA 1N36L 1EFID 2D2CC 1FNVA 2IWHA 2NVQB 3QB3A 2RHSB 4DU9A 4BBSG 5KGUA 1L1OC 3OW7A
chains in the Genus database with same CATH topology
1XJVA 1PH9A 5IWAL 1K3RA 4LF5L 2PNHA 3TREA 1XNRQ 1VQEA 1JJ2A 1TWCH 4JI0Q 4DR2L 3EN2A 4ALPA 4JOIA 3S16H 3GTLH 4DR4L 2JE6I 2R6GA 4P72A 1S72A 1FJGL 1KRSA 4PMWA 4HJAA 1PH5A 1FVIA 1JT8A 2Q2TA 2UUCL 1SN8A 5IYDG 1W2BA 3M3YH 4A3BH 4DNIA 3RLFA 4EX5A 4LUOA 4NXMQ 1V9PA 4LF7Q 1X55A 3PUYA 2N78A 3PF5A 1N34Q 4IPDA 3M4PA 3A0JA 3PV0A 4X65L 1YHBA 4IPCA 4NB3A 4DUZL 4LF6Q 4DV0L 4L5SA 3GTGH 2R7FA 1XNQL 1AE3A 1VQCA 1SLJA 3PSIA 4POGA 2ZTCA 2WAQE 3KDFB 3K7UC 3W5OA 1VQNA 3E9HA 1E3PA 1VQ5A 1Q86C 4BBRH 3ERSX 4BY7G 1HZAA 1MJEA 1K83H 4C3HH 3I4OA 1JMCA 1LYLA 5J3BA 2D0OA 4KHPL 5IE8A 5C44G 1VQ4A 5IYCH 5IT9c 2HIVA 1Q12A 2UUBQ 3S15H 3F8TA 4GLAC 4A3JG 3H0GG 4IOAA 4LFAQ 2CQOA 5M3MH 4OXPA 1BVSA 4R4TA 1V1QA 4L5TA 1PH8A 1J5EL 5JJLA 1QZGA 2EIFA 2I5HA 5LMNW 4JI4L 1G291 1PFSA 2LXJA 3J80c 3RN2A 4XTCS 2UXDQ 1VQOA 3H3VH 1Q46A 2F52A 1LTLA 4GN4B 5C3EH 3HKZE 2F4VQ 2GVAA 3H3VI 3HOZG 1M90C 4QY7A 1Q8KA 4GNXB 3A5ZB 5IWAQ 3HOXH 2R7DA 1EQQA 4LF9Q 3AFQA 3CP0A 1HR0L 4B3MQ 1OXVA 1XNRL 3S2DH 4WJ4A 1TWHH 2KCMA 3ICEA 4X6AH 2D0PA 2ZJPA 4DR4Q 1KHIA 1UE1A 4OWWB 4LNQA 3CPFA 4JI5Q 3TQYA 3ZJYC 1NJIC 1MKHA 3PIPA 3GDEA 2Z6KC 2BH2A 2UUCQ 3HOYG 1NY4A 2MO0A 5GAEC 1TWGH 1K0RA 4DV4Q 4PZ8A 2FXQA 1N34L 2A1AA 4R4IA 4BA2I 1NMGA 2WB1E 2KHJA 1OTCA 1L1OB 1IBLL 3I4MG 4DUZQ 1N32Q 4JI7L 4X64L 3HOVH 1XNQQ 3CCLA 4IPHA 3H15A 3FKIG 4DV7L 4QGUA 1GM5A 1WI5A 4JBKA 2VUMH 4L5RC 1EIFA 4DR1Q 2VZAA 1X56A 3UDGA 1XMOQ 4IO9A 1GD7A 2B3GA 1VQGA 2BH8A 3KDFA 3CCMA 5EAYA 3J81c 3KJOA 5IP9G 3PO2H 2OQKA 4XIGS 2K5VA 3WWVA 4HIKA 4A3DH 3NELA 3PO3H 1L2FA 4K0KL 1EFWA 3I7FA 4H02A 2PI2A 2N3SA 4IOCA 4LFAL 4YWKA 2HQLA 1J5EQ 5LMUQ 2VQFL 1HNXL 4DR5L 3B6YA 3BU2A 3AEVA 1VQJA 5FJ8G 2YYZA 2VW9A 3OW2A 2PI2E 4MNOA 1AH9A 3S1NH 1E7ZA 2F4VL 3G4SA 4APVA 1XPUA 1X54A 3BZKA 2ID0A 4TQUS 3GTJH 2NVXH 4UPAA 4YCUA 3CCSA 4DV3L 3BZCA 3FHWA 4WJ3M 4DR7Q 4AQYL 1UEBA 4JI5L 2KENA 4NPSA 2MQHA 1KAWA 4OX9Q 5C4XG 2K5NA 1T9HA 1SROA 3IRBA 1I5FA 1IBMQ 4HIDA 2E2JH 3GTOH 3HOUG 1Q1BA 4HIOA 4JI8L 1Y1WG 3I4NG 4X66Q 4A3CG 2B63H 2MFIA 4A93G 1FL0A 4DV2Q 3D0FA 2ZM6Q 2A19A 3UDIA 5IP7G 1OXSC 4LWCA 3L2PA 1LUZA 1PH3A 4YCVA 1XPOA 3CF5A 4DV7Q 2JA7H 1UE5A 3G6EA 1NBWA 5FLXc 1YJ9A 4UY8C 1YHAA 3BJUA 1P8LA 4LUVA 4AYBE 4GNXA 1HZBA 1VQDA 2JA9A 1N32L 1IZ6A 2JQOA 5H1SE 4P75A 1O7IA 4NXNL 2R7ZH 2ATWA 3UE0A 3CC7A 1A63A 1B7YB 1NMFA 2JEBI 3CMEA 1CSQA 1QVGA 2E2IH 1PV4A 2HHHL 1MJCA 3GO5A 3KFUA 4A3EH 2YV5A 4A3IG 4DPGA 5M5WH 4K0KQ 1N33L 2VY3A 1VQ6A 1QVFA 4A3GG 2VQFQ 4BBSH 4C2MH 3KYHC 4YWLA 3TS0A 2QA4A 4A76A 4JOIC 1TWAH 3GTMH 5IYBG 2K4KA 1CKNA 4X62Q 5E7NA 5C0XJ 1KC8C 2ES2A 4DV1L 3HFZB 2KCTA 4DV3Q 4A3KH 3KOJA 2XGTA 3S2HH 2UXCL 1V43A 3J80i 3NENA 2RCNA 4YY3Q 3UDFA 4DR7L 1Q7YC 4AYBG 4JI6Q 4A3BG 3I2ZA 4KHZA 3HKZG 4JI1L 2UU9L 4LFCQ 4A3LG 4BXXG 5M3FG 3CW2C 1HJPA 4GKKL 2JA5G 2EQSA 4IFDJ 3S24A 1PYBA 1HNWQ 1Q82C 4DK6C 2YTXA 1CKNB 2LSSA 2C35B 2Y0SE 3CQZH 1VQMA 1IBKQ 4JI3Q 3J7A5 2DGYA 2I5LX 4IJHA 5AJ3L 3J7ZC 3CCUA 1HNZL 3AYHB 3EBEA 4RMFA 1CKMA 1C9OA 4LF4Q 4DV2L 1PHJA 2JEAI 3HOWH 1X6OA 1S3OA 4GN3B 4GOPB 2NZHA 4BBRG 4A75A 5FLMH 4BY7H 1UWVA 4LFBL 3TS2A 4L5QA 5M5XH 1OXUA 2D62A 3UE1A 3CCEA 2UUAL 4B3SQ 1PH4A 5JJKA 4HJ8A 2I5MX 3NBHB 5IYCG 4JI2L 3U58A 4NXNQ 1OXTA 1P16A 3STBD 2R93G 3HKSA 3KF6B 1UE6A 1BKBA 1VS0A 3H0GH 2IHFA 2Y0SG 5HGQA 3MEFA 2JA6G 1RL2A 2KBNA 2IX1A 3RZOH 3S1QH 3GTQH 4LF8Q 3M7NA 2RF4A 4A3MG 4GNXC 4UP7A 2CFMA 3M85A 3PF4A 2HIXA 3OTOL 2YU9H 3SGIA 3STBC 3TEHB 2LXKA 1IXRA 1VQLA 2K14A 1DGSA 5C3EG 4GKJL 2Q2HA 2N8NA 4DKAC 4B3TL 1JB7A 3Q8DA 3E0EA 3J81j 1HZCA 3ULPA 1J6QA 3PGZA 3ER0A 4AH6A 4B3RQ 1WYDA 1GO3E 2IX0A 5HY6A 1N36Q 3PUZA 4LW1A 2ZTDA 3W1BA 2VL6A 2K52A 5JEAG 1BBUA 1AE2A 4QL5A 1B8AA 2NZOA 3RNUA 1IL2A 3GTKH 2VQEQ 2CCZA 1I3QH 1BBWA 1CUKA 4GN5A 3CC2A 4BY1G 2R92H 4IJLA 4R4CA 3RN5A 2CKZB 4YCWA 1UE7A 3DM3A 1IBKL 3I4MH 3KF6A 1YJWA 3HOVG 4MTNA 4LF4L 3CC4A 3PUWA 4NXML 3RLNA 1C0AA 4LF7L 4Y7NH 3J81i 1VQ9A 1M1KC 2AMCB 4B3SL 2UUAQ 1Y1VG 1PH7A 1XTDA 4GOPA 3U4VA 4P74A 5IP9H 4JI2Q 3PCOB 2MO1A 3S14H 1CSPA 1S40A 4IPGA 3PO3G 5JJIA 1E24A 2ZJRA 4KLKA 1JJCB 4DV0Q 4RG1A 3MXNB 1QUQB 4LF6L 1YJNA 1A0IA 1VQIA 4DR6Q 4P73A 2OQ0A 1B70B 1WCMG 5FJ8H 2NN6I 3M9BA 1I94L 2K75A 1L0WA 4JCVE 1Z9FA 4GKJQ 2OTJA 1KIXA 2UUBL 1VQAA 4B3TQ 2NVQH 4DV6Q 1QVCA 2NVYH 4HIMA 4OWXB 3RZDH 4B3RL 2XTIA 4R4OA 4ME3A 4QQBX 4A3FG 4JI4Q 2EXDA 2AWNA 4A4IA 3T1YQ 3CCJA 2A8VA 1G51A 3NEMA 1KRTA 2VQEL 4POFA 3JC66 1HR0Q 2Q2UA 2UXDL 1FGUA 1HNWL 2N49A 3DLLA 2WAQG 4GKKQ 1HZ9A 1Y1WH 4LF9L 2JA8H 4JV5Q 1R9TH 5K36G 2B63G 1WOCA 4B3ML 4A93H 1HR0W 5IP7H 1EOVA 1YI2A 1VQ7A 2I0QA 2JA7G 4PG3A 2YTVA 1SFOH 2PQAB 4DAMA 5GQOA 4R1JA 4DV4L 2VS1A 1XPRA 1K73C 3AQQA 1K9MC 5M5YH 4Y52H 2DUDA 1WJJA 1RIPA 2R7ZG 1I50H 4PZ6A 1IBLQ 3S1MH 2JK8A 4EQ5A 4DUYL 4JBMA 4JI7Q 4X64Q 5JEAJ 5IYDH 3EIVA 1NE3A 4A3GH 5C0XG 3CPWA 4DR6L 3K7AH 3KF8B 1A62A 2JJQA 4UP8A 4DR1L 1XMOL 1I94Q 2OCEA 4JYAL 2ALYB 3K8AA 1E1OA 1Q1EA 1A8VA 1X3EA 1YEZA 4JBJA 4TVAB 1PA6A 5IYBH 3U4ZA 4YWMA 4DV6L 3CCQA 1SMXA 2MNAA 5LMUL 3G48A 3F2DA 4DR5Q 1G6PA 2IT1A 1YNXA 3PUXA 4A3KG 1KQSA 2WP8J 1PH2A 2Z0SA 3T1YL 4JC0A 1YBYA 5LMNQ 1YHQA 1HNXQ 4DR3Q 4BXXH 4A3LH 2ASBA 1YVCA 3CMAA 1U0LA 5M3FH 2E2HH 2JA5H 1VQKA 5C44H 3PUVA 3F2BA 4DV5L 1YZ6A 1L1OA 2BA1A 3K80C 1SE8A 4JV5L 4GLVB 5M3MG 4AQYQ 2OWOA 4KI0A 3HOWG 1W3SA 3U50C 4OX9L 2IHEA 5FLMG 1VCIA 2PQAA 5C0XI 3AFPA 1VQFA 2V1CC 3HOZH 1JJGA 2CWPA 2K50A 4JI8Q 3HOXG 4X66L 1CKOA 2OTLA 1IBML 1E22A 1SR3A 2BA0A 2R93H 2ZM6L 2UXCQ 4OONA 3FP9A 1EUJA 2JA6H 3OYYA 1EQRA 1LM0A 2GN5A 4YHHL 2L15A 3A74A 4IFDI 4O0AA 4BA1I 4DUYQ 1KD1C 2AWOA 2E8GA 4AIMA 1VQBA 1PYSB 4A3MH 5DLQE 3KJPA 3T1HQ 1ASYA 3HOYH 4QJFA 3ULJA 1IYJB 2KHIA 2F3IA 4JYAQ 2AHOB 3K81C 1TWFH 1D7QA 2E5LL 2RHQB 1H95A 1KXLA 4O2DA 3CCRA 1K8AC 2HHHQ 3FKIH 1YIJA 2VUMG 3F1ZA 3JAMc 3RR5A 1N33Q 4DK3C 1MIUA 2PMZE 5LMNL 1KL9A 4DR3L 5GROA 1K8GA 3KLWA 3I56A 4BY1H 2R92G 5GADC 4X62L 1Z47A 3GD7A 2H5XA 5BR8Q 3PO2G 2UXBL 4DV1Q 4GS3A 1HH2P 4DV5Q 1Q81C 3RLOA 2WB1G 3L0OA 4A3DG 1U5KA 4UP9A 4QIWE 3ULLA 4YY3L 3L7ZC 1X65A 5GAHC 1WFQA 4LFCL 1PH6A 4OO1I 1TXYA 1X3FA 3M4QA 2NN6G 3G71A 4GLXA 1Y14B 4FDBA 3E9IA 1PH1A 1YITA 4MZ9A 4JI6L 4LF5Q 4OO1G 2UU9Q 3I55A 4JI1Q 1Y1VH 1N8RC 3CXCA 2VNUD 4JI0L 2Q2IA 4DR2Q 1SRUA 4DAYB 4JI3L 1JE5A 4JG2A 3GTPH 1X9NA 2IY5B 1FJGQ 1N9WA 2NVTH 2WFWA 2GVBA 5AJ3Q 1HNZQ 4YHHQ 4JBWA 1OXXK 1E1TA 2YTYA 1WCMH 5C4XH 4HJ5A 1XMQQ 5GAGC 3T1HL 1VQHA 4LFBQ 1GKHA 1ASZA 2B29A 5ELOA 4HJ9A 5ELNA 3M4OH 4C3IH 3D31A 1QZHA 3S1RH 3HOUH 4X65Q 1VQPA 4LUZA 1GVPA 3F2CA 4OWTB 3I4NH 3VDYA 1VQ8A 4C3JH 4A3CH 4P71A 3UDXA 5C4JH 2E5LQ 2ZJQA 1XMQL 5IY0A 4LF8L 3TRZA 3LGJA 4A3FH 3A5UA 4A3JH 3CCVA 2ZTEA 2K5HA 1I6HH 3JAMi 1PVOA 1X3GA 3W1GA 3OTOQ 3S17H 2CWAA 4KHPQ 1C7YA 4J15A 4IFDG 3CAMA 2QEXA 2HT1A 1QUQA 5BR8L 2JA8G 2UXBQ 3CD6A 2QGQA 1NTGA 2Z6KA 4A3EG 4A3IH 3K0XA 1N36L 2AKWB 1D8LA 3PIOA 2RHSB 1EWIA 4PZ7A 4HJ7A 1EYGA 4BBSG 4GOPC 1EIYB 4R4QA 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XJV A;  1PH9 A;  5IWA L;  1K3R A;  4LF5 L;  2PNH A;  3TRE A;  1XNR Q;  1VQE A;  1JJ2 A;  1TWC H;  4JI0 Q;  4DR2 L;  3EN2 A;  4ALP A;  4JOI A;  3S16 H;  3GTL H;  4DR4 L;  2JE6 I;  2R6G A;  4P72 A;  1S72 A;  1FJG L;  1KRS A;  4PMW A;  4HJA A;  1PH5 A;  1FVI A;  1JT8 A;  2Q2T A;  2UUC L;  1SN8 A;  5IYD G;  1W2B A;  3M3Y H;  4A3B H;  4DNI A;  3RLF A;  4EX5 A;  4LUO A;  4NXM Q;  1V9P A;  4LF7 Q;  1X55 A;  3PUY A;  2N78 A;  3PF5 A;  1N34 Q;  4IPD A;  3M4P A;  3A0J A;  3PV0 A;  4X65 L;  1YHB A;  4IPC A;  4NB3 A;  4DUZ L;  4LF6 Q;  4DV0 L;  4L5S A;  3GTG H;  2R7F A;  1XNQ L;  1AE3 A;  1VQC A;  1SLJ A;  3PSI A;  4POG A;  2ZTC A;  2WAQ E;  3KDF B;  3K7U C;  3W5O A;  1VQN A;  3E9H A;  1E3P A;  1VQ5 A;  1Q86 C;  4BBR H;  3ERS X;  4BY7 G;  1HZA A;  1MJE A;  1K83 H;  4C3H H;  3I4O A;  1JMC A;  1LYL A;  5J3B A;  2D0O A;  4KHP L;  5IE8 A;  5C44 G;  1VQ4 A;  5IYC H;  5IT9 c;  2HIV A;  1Q12 A;  2UUB Q;  3S15 H;  3F8T A;  4GLA C;  4A3J G;  3H0G G;  4IOA A;  4LFA Q;  2CQO A;  5M3M H;  4OXP A;  1BVS A;  4R4T A;  1V1Q A;  4L5T A;  1PH8 A;  1J5E L;  5JJL A;  1QZG A;  2EIF A;  2I5H A;  5LMN W;  4JI4 L;  1G29 1;  1PFS A;  2LXJ A;  3J80 c;  3RN2 A;  4XTC S;  2UXD Q;  1VQO A;  3H3V H;  1Q46 A;  2F52 A;  1LTL A;  4GN4 B;  5C3E H;  3HKZ E;  2F4V Q;  2GVA A;  3H3V I;  3HOZ G;  1M90 C;  4QY7 A;  1Q8K A;  4GNX B;  3A5Z B;  5IWA Q;  3HOX H;  2R7D A;  1EQQ A;  4LF9 Q;  3AFQ A;  3CP0 A;  1HR0 L;  4B3M Q;  1OXV A;  1XNR L;  3S2D H;  4WJ4 A;  1TWH H;  2KCM A;  3ICE A;  4X6A H;  2D0P A;  2ZJP A;  4DR4 Q;  1KHI A;  1UE1 A;  4OWW B;  4LNQ A;  3CPF A;  4JI5 Q;  3TQY A;  3ZJY C;  1NJI C;  1MKH A;  3PIP A;  3GDE A;  2Z6K C;  2BH2 A;  2UUC Q;  3HOY G;  1NY4 A;  2MO0 A;  5GAE C;  1TWG H;  1K0R A;  4DV4 Q;  4PZ8 A;  2FXQ A;  1N34 L;  2A1A A;  4R4I A;  4BA2 I;  1NMG A;  2WB1 E;  2KHJ A;  1OTC A;  1L1O B;  1IBL L;  3I4M G;  4DUZ Q;  1N32 Q;  4JI7 L;  4X64 L;  3HOV H;  1XNQ Q;  3CCL A;  4IPH A;  3H15 A;  3FKI G;  4DV7 L;  4QGU A;  1GM5 A;  1WI5 A;  4JBK A;  2VUM H;  4L5R C;  1EIF A;  4DR1 Q;  2VZA A;  1X56 A;  3UDG A;  1XMO Q;  4IO9 A;  1GD7 A;  2B3G A;  1VQG A;  2BH8 A;  3KDF A;  3CCM A;  5EAY A;  3J81 c;  3KJO A;  5IP9 G;  3PO2 H;  2OQK A;  4XIG S;  2K5V A;  3WWV A;  4HIK A;  4A3D H;  3NEL A;  3PO3 H;  1L2F A;  4K0K L;  1EFW A;  3I7F A;  4H02 A;  2PI2 A;  2N3S A;  4IOC A;  4LFA L;  4YWK A;  2HQL A;  1J5E Q;  5LMU Q;  2VQF L;  1HNX L;  4DR5 L;  3B6Y A;  3BU2 A;  3AEV A;  1VQJ A;  5FJ8 G;  2YYZ A;  2VW9 A;  3OW2 A;  2PI2 E;  4MNO A;  1AH9 A;  3S1N H;  1E7Z A;  2F4V L;  3G4S A;  4APV A;  1XPU A;  1X54 A;  3BZK A;  2ID0 A;  4TQU S;  3GTJ H;  2NVX H;  4UPA A;  4YCU A;  3CCS A;  4DV3 L;  3BZC A;  3FHW A;  4WJ3 M;  4DR7 Q;  4AQY L;  1UEB A;  4JI5 L;  2KEN A;  4NPS A;  2MQH A;  1KAW A;  4OX9 Q;  5C4X G;  2K5N A;  1T9H A;  1SRO A;  3IRB A;  1I5F A;  1IBM Q;  4HID A;  2E2J H;  3GTO H;  3HOU G;  1Q1B A;  4HIO A;  4JI8 L;  1Y1W G;  3I4N G;  4X66 Q;  4A3C G;  2B63 H;  2MFI A;  4A93 G;  1FL0 A;  4DV2 Q;  3D0F A;  2ZM6 Q;  2A19 A;  3UDI A;  5IP7 G;  1OXS C;  4LWC A;  3L2P A;  1LUZ A;  1PH3 A;  4YCV A;  1XPO A;  3CF5 A;  4DV7 Q;  2JA7 H;  1UE5 A;  3G6E A;  1NBW A;  5FLX c;  1YJ9 A;  4UY8 C;  1YHA A;  3BJU A;  1P8L A;  4LUV A;  4AYB E;  4GNX A;  1HZB A;  1VQD A;  2JA9 A;  1N32 L;  1IZ6 A;  2JQO A;  5H1S E;  4P75 A;  1O7I A;  4NXN L;  2R7Z H;  2ATW A;  3UE0 A;  3CC7 A;  1A63 A;  1B7Y B;  1NMF A;  2JEB I;  3CME A;  1CSQ A;  1QVG A;  2E2I H;  1PV4 A;  2HHH L;  1MJC A;  3GO5 A;  3KFU A;  4A3E H;  2YV5 A;  4A3I G;  4DPG A;  5M5W H;  4K0K Q;  1N33 L;  2VY3 A;  1VQ6 A;  1QVF A;  4A3G G;  2VQF Q;  4BBS H;  4C2M H;  3KYH C;  4YWL A;  3TS0 A;  2QA4 A;  4A76 A;  4JOI C;  1TWA H;  3GTM H;  5IYB G;  2K4K A;  1CKN A;  4X62 Q;  5E7N A;  5C0X J;  1KC8 C;  2ES2 A;  4DV1 L;  3HFZ B;  2KCT A;  4DV3 Q;  4A3K H;  3KOJ A;  2XGT A;  3S2H H;  2UXC L;  1V43 A;  3J80 i;  3NEN A;  2RCN A;  4YY3 Q;  3UDF A;  4DR7 L;  1Q7Y C;  4AYB G;  4JI6 Q;  4A3B G;  3I2Z A;  4KHZ A;  3HKZ G;  4JI1 L;  2UU9 L;  4LFC Q;  4A3L G;  4BXX G;  5M3F G;  3CW2 C;  1HJP A;  4GKK L;  2JA5 G;  2EQS A;  4IFD J;  3S24 A;  1PYB A;  1HNW Q;  1Q82 C;  4DK6 C;  2YTX A;  1CKN B;  2LSS A;  2C35 B;  2Y0S E;  3CQZ H;  1VQM A;  1IBK Q;  4JI3 Q;  3J7A 5;  2DGY A;  2I5L X;  4IJH A;  5AJ3 L;  3J7Z C;  3CCU A;  1HNZ L;  3AYH B;  3EBE A;  4RMF A;  1CKM A;  1C9O A;  4LF4 Q;  4DV2 L;  1PHJ A;  2JEA I;  3HOW H;  1X6O A;  1S3O A;  4GN3 B;  4GOP B;  2NZH A;  4BBR G;  4A75 A;  5FLM H;  4BY7 H;  1UWV A;  4LFB L;  3TS2 A;  4L5Q A;  5M5X H;  1OXU A;  2D62 A;  3UE1 A;  3CCE A;  2UUA L;  4B3S Q;  1PH4 A;  5JJK A;  4HJ8 A;  2I5M X;  3NBH B;  5IYC G;  4JI2 L;  3U58 A;  4NXN Q;  1OXT A;  1P16 A;  3STB D;  2R93 G;  3HKS A;  3KF6 B;  1UE6 A;  1BKB A;  1VS0 A;  3H0G H;  2IHF A;  2Y0S G;  5HGQ A;  3MEF A;  2JA6 G;  1RL2 A;  2KBN A;  2IX1 A;  3RZO H;  3S1Q H;  3GTQ H;  4LF8 Q;  3M7N A;  2RF4 A;  4A3M G;  4GNX C;  4UP7 A;  2CFM A;  3M85 A;  3PF4 A;  2HIX A;  3OTO L;  2YU9 H;  3SGI A;  3STB C;  3TEH B;  2LXK A;  1IXR A;  1VQL A;  2K14 A;  1DGS A;  5C3E G;  4GKJ L;  2Q2H A;  2N8N A;  4DKA C;  4B3T L;  1JB7 A;  3Q8D A;  3E0E A;  3J81 j;  1HZC A;  3ULP A;  1J6Q A;  3PGZ A;  3ER0 A;  4AH6 A;  4B3R Q;  1WYD A;  1GO3 E;  2IX0 A;  5HY6 A;  1N36 Q;  3PUZ A;  4LW1 A;  2ZTD A;  3W1B A;  2VL6 A;  2K52 A;  5JEA G;  1BBU A;  1AE2 A;  4QL5 A;  1B8A A;  2NZO A;  3RNU A;  1IL2 A;  3GTK H;  2VQE Q;  2CCZ A;  1I3Q H;  1BBW A;  1CUK A;  4GN5 A;  3CC2 A;  4BY1 G;  2R92 H;  4IJL A;  4R4C A;  3RN5 A;  2CKZ B;  4YCW A;  1UE7 A;  3DM3 A;  1IBK L;  3I4M H;  3KF6 A;  1YJW A;  3HOV G;  4MTN A;  4LF4 L;  3CC4 A;  3PUW A;  4NXM L;  3RLN A;  1C0A A;  4LF7 L;  4Y7N H;  3J81 i;  1VQ9 A;  1M1K C;  2AMC B;  4B3S L;  2UUA Q;  1Y1V G;  1PH7 A;  1XTD A;  4GOP A;  3U4V A;  4P74 A;  5IP9 H;  4JI2 Q;  3PCO B;  2MO1 A;  3S14 H;  1CSP A;  1S40 A;  4IPG A;  3PO3 G;  5JJI A;  1E24 A;  2ZJR A;  4KLK A;  1JJC B;  4DV0 Q;  4RG1 A;  3MXN B;  1QUQ B;  4LF6 L;  1YJN A;  1A0I A;  1VQI A;  4DR6 Q;  4P73 A;  2OQ0 A;  1B70 B;  1WCM G;  5FJ8 H;  2NN6 I;  3M9B A;  1I94 L;  2K75 A;  1L0W A;  4JCV E;  1Z9F A;  4GKJ Q;  2OTJ A;  1KIX A;  2UUB L;  1VQA A;  4B3T Q;  2NVQ H;  4DV6 Q;  1QVC A;  2NVY H;  4HIM A;  4OWX B;  3RZD H;  4B3R L;  2XTI A;  4R4O A;  4ME3 A;  4QQB X;  4A3F G;  4JI4 Q;  2EXD A;  2AWN A;  4A4I A;  3T1Y Q;  3CCJ A;  2A8V A;  1G51 A;  3NEM A;  1KRT A;  2VQE L;  4POF A;  3JC6 6;  1HR0 Q;  2Q2U A;  2UXD L;  1FGU A;  1HNW L;  2N49 A;  3DLL A;  2WAQ G;  4GKK Q;  1HZ9 A;  1Y1W H;  4LF9 L;  2JA8 H;  4JV5 Q;  1R9T H;  5K36 G;  2B63 G;  1WOC A;  4B3M L;  4A93 H;  1HR0 W;  5IP7 H;  1EOV A;  1YI2 A;  1VQ7 A;  2I0Q A;  2JA7 G;  4PG3 A;  2YTV A;  1SFO H;  2PQA B;  4DAM A;  5GQO A;  4R1J A;  4DV4 L;  2VS1 A;  1XPR A;  1K73 C;  3AQQ A;  1K9M C;  5M5Y H;  4Y52 H;  2DUD A;  1WJJ A;  1RIP A;  2R7Z G;  1I50 H;  4PZ6 A;  1IBL Q;  3S1M H;  2JK8 A;  4EQ5 A;  4DUY L;  4JBM A;  4JI7 Q;  4X64 Q;  5JEA J;  5IYD H;  3EIV A;  1NE3 A;  4A3G H;  5C0X G;  3CPW A;  4DR6 L;  3K7A H;  3KF8 B;  1A62 A;  2JJQ A;  4UP8 A;  4DR1 L;  1XMO L;  1I94 Q;  2OCE A;  4JYA L;  2ALY B;  3K8A A;  1E1O A;  1Q1E A;  1A8V A;  1X3E A;  1YEZ A;  4JBJ A;  4TVA B;  1PA6 A;  5IYB H;  3U4Z A;  4YWM A;  4DV6 L;  3CCQ A;  1SMX A;  2MNA A;  5LMU L;  3G48 A;  3F2D A;  4DR5 Q;  1G6P A;  2IT1 A;  1YNX A;  3PUX A;  4A3K G;  1KQS A;  2WP8 J;  1PH2 A;  2Z0S A;  3T1Y L;  4JC0 A;  1YBY A;  5LMN Q;  1YHQ A;  1HNX Q;  4DR3 Q;  4BXX H;  4A3L H;  2ASB A;  1YVC A;  3CMA A;  1U0L A;  5M3F H;  2E2H H;  2JA5 H;  1VQK A;  5C44 H;  3PUV A;  3F2B A;  4DV5 L;  1YZ6 A;  1L1O A;  2BA1 A;  3K80 C;  1SE8 A;  4JV5 L;  4GLV B;  5M3M G;  4AQY Q;  2OWO A;  4KI0 A;  3HOW G;  1W3S A;  3U50 C;  4OX9 L;  2IHE A;  5FLM G;  1VCI A;  2PQA A;  5C0X I;  3AFP A;  1VQF A;  2V1C C;  3HOZ H;  1JJG A;  2CWP A;  2K50 A;  4JI8 Q;  3HOX G;  4X66 L;  1CKO A;  2OTL A;  1IBM L;  1E22 A;  1SR3 A;  2BA0 A;  2R93 H;  2ZM6 L;  2UXC Q;  4OON A;  3FP9 A;  1EUJ A;  2JA6 H;  3OYY A;  1EQR A;  1LM0 A;  2GN5 A;  4YHH L;  2L15 A;  3A74 A;  4IFD I;  4O0A A;  4BA1 I;  4DUY Q;  1KD1 C;  2AWO A;  2E8G A;  4AIM A;  1VQB A;  1PYS B;  4A3M H;  5DLQ E;  3KJP A;  3T1H Q;  1ASY A;  3HOY H;  4QJF A;  3ULJ A;  1IYJ B;  2KHI A;  2F3I A;  4JYA Q;  2AHO B;  3K81 C;  1TWF H;  1D7Q A;  2E5L L;  2RHQ B;  1H95 A;  1KXL A;  4O2D A;  3CCR A;  1K8A C;  2HHH Q;  3FKI H;  1YIJ A;  2VUM G;  3F1Z A;  3JAM c;  3RR5 A;  1N33 Q;  4DK3 C;  1MIU A;  2PMZ E;  5LMN L;  1KL9 A;  4DR3 L;  5GRO A;  1K8G A;  3KLW A;  3I56 A;  4BY1 H;  2R92 G;  5GAD C;  4X62 L;  1Z47 A;  3GD7 A;  2H5X A;  5BR8 Q;  3PO2 G;  2UXB L;  4DV1 Q;  4GS3 A;  1HH2 P;  4DV5 Q;  1Q81 C;  3RLO A;  2WB1 G;  3L0O A;  4A3D G;  1U5K A;  4UP9 A;  4QIW E;  3ULL A;  4YY3 L;  3L7Z C;  1X65 A;  5GAH C;  1WFQ A;  4LFC L;  1PH6 A;  4OO1 I;  1TXY A;  1X3F A;  3M4Q A;  2NN6 G;  3G71 A;  4GLX A;  1Y14 B;  4FDB A;  3E9I A;  1PH1 A;  1YIT A;  4MZ9 A;  4JI6 L;  4LF5 Q;  4OO1 G;  2UU9 Q;  3I55 A;  4JI1 Q;  1Y1V H;  1N8R C;  3CXC A;  2VNU D;  4JI0 L;  2Q2I A;  4DR2 Q;  1SRU A;  4DAY B;  4JI3 L;  1JE5 A;  4JG2 A;  3GTP H;  1X9N A;  2IY5 B;  1FJG Q;  1N9W A;  2NVT H;  2WFW A;  2GVB A;  5AJ3 Q;  1HNZ Q;  4YHH Q;  4JBW A;  1OXX K;  1E1T A;  2YTY A;  1WCM H;  5C4X H;  4HJ5 A;  1XMQ Q;  5GAG C;  3T1H L;  1VQH A;  4LFB Q;  1GKH A;  1ASZ A;  2B29 A;  5ELO A;  4HJ9 A;  5ELN A;  3M4O H;  4C3I H;  3D31 A;  1QZH A;  3S1R H;  3HOU H;  4X65 Q;  1VQP A;  4LUZ A;  1GVP A;  3F2C A;  4OWT B;  3I4N H;  3VDY A;  1VQ8 A;  4C3J H;  4A3C H;  4P71 A;  3UDX A;  5C4J H;  2E5L Q;  2ZJQ A;  1XMQ L;  5IY0 A;  4LF8 L;  3TRZ A;  3LGJ A;  4A3F H;  3A5U A;  4A3J H;  3CCV A;  2ZTE A;  2K5H A;  1I6H H;  3JAM i;  1PVO A;  1X3G A;  3W1G A;  3OTO Q;  3S17 H;  2CWA A;  4KHP Q;  1C7Y A;  4J15 A;  4IFD G;  3CAM A;  2QEX A;  2HT1 A;  1QUQ A;  5BR8 L;  2JA8 G;  2UXB Q;  3CD6 A;  2QGQ A;  1NTG A;  2Z6K A;  4A3E G;  4A3I H;  3K0X A;  1N36 L;  2AKW B;  1D8L A;  3PIO A;  2RHS B;  1EWI A;  4PZ7 A;  4HJ7 A;  1EYG A;  4BBS G;  4GOP C;  1EIY B;  4R4Q A;  1L1O C; 
#chains in the Genus database with same CATH topology
 4A3F B;  5IWA L;  4LF5 L;  2PNH A;  1WVL A;  3TRE A;  1JJ2 A;  5EGT A;  1TWC H;  2HUG A;  4ALP A;  4DR4 L;  5DNF A;  2KJX A;  4KKT A;  2BDN A;  3MC0 B;  4PMW A;  5FLX E;  2UUC L;  1W2B A;  3VR6 A;  4LUO A;  2M00 A;  1X55 A;  4ZKB B;  4IUV A;  2N78 A;  3M4P A;  3DHQ A;  2D5D A;  2R7F A;  5D14 A;  4RHS A;  1SLJ A;  2ZTC A;  1O7Y A;  2WAQ E;  3KDF B;  1VQN A;  4KD4 A;  3E9H A;  1VQ5 A;  3DWP A;  1HA5 A;  4RHR A;  4BY7 G;  2CW0 D;  4ZYS A;  2F0T A;  1F9R A;  1B50 A;  3I4O A;  1LYL A;  1PMR A;  2D0O A;  1VQ4 A;  2RA4 A;  5IYC H;  1JCK B;  1MI2 A;  2HIV A;  2UUB Q;  4A3J G;  4GLA C;  3H0G G;  2CQO A;  2K05 A;  1B9N A;  2EIF A;  2LXJ A;  3JAM E;  3A8K E;  4R8I A;  3RN2 A;  1H9S A;  4PMB A;  2F4V Q;  3HOZ G;  4LAA A;  4GNX B;  1Q8K A;  3T4A C;  3A5Z B;  3HOX H;  1EQQ A;  3HOV B;  3AFQ A;  4WJ4 A;  1HR0 L;  4B3M Q;  1BUV T;  2NWG A;  2PO4 A;  1TWH H;  2KEC A;  2E2H B;  4HSP A;  1UE1 A;  4OEM B;  2QDL A;  3KUP A;  2KVM A;  2BH2 A;  4ABN A;  1VF5 C;  1SJE D;  2HCI A;  5GAE C;  4DV4 Q;  1A2T A;  1N34 L;  5I2X A;  4BA2 I;  3IFD A;  4G7O C;  2KHJ A;  2X6L A;  1PLF A;  4E6I A;  1N32 Q;  3G6J B;  4DV7 L;  3HOU B;  3Q0A A;  4DR1 Q;  3GTP B;  1BDO A;  1VQG A;  4A3J B;  3CCM A;  3VR2 A;  5EAY A;  5JPN C;  4ZQ3 A;  1L0Y B;  3WWV A;  4HIK A;  5M5Y B;  3OIQ A;  1MSG A;  1EFW A;  4H02 A;  2PI2 A;  1RCV D;  1J9O A;  4YWK A;  2HQL A;  4ODG A;  5D3D A;  1VQJ A;  2VW9 A;  1Y1W B;  4MNO A;  1AH9 A;  2HQE A;  2VB3 X;  1X54 A;  4X3S A;  3BZK A;  4TQU S;  2K5D A;  3GTJ H;  4YCU A;  2A74 C;  4DV3 L;  5EBC A;  4AQY L;  1UEB A;  2PZT A;  2ZXR A;  4JI5 L;  3S14 B;  2CHB D;  2QW7 A;  2EOT A;  1SRO A;  1HUN A;  3HOU G;  1TR5 A;  3I4N G;  3N52 A;  2NYZ D;  4F88 A;  4A93 G;  1FL0 A;  4DV2 Q;  2ZM6 Q;  1A3V A;  5IP7 G;  3L2P A;  4LWC A;  1LAB A;  4YCV A;  1XPO A;  2JA7 H;  2EDG A;  1UE5 A;  4EQP A;  4UY8 C;  1GJX A;  1P8L A;  1HZB A;  3S9W A;  1IZ6 A;  4JVZ A;  4NXN L;  4PQX A;  3TDQ A;  1K0S A;  3UE0 A;  1B7Y B;  3KLR A;  2MP1 A;  2E2I H;  2AQ1 B;  1K8O A;  3URY A;  3NP8 A;  3K5M A;  5K5P A;  1N33 L;  5CR3 A;  4G7Z C;  1QVF A;  2KCC A;  3SK8 A;  2VQF Q;  4RAU C;  4PV1 C;  3C46 A;  3KYH C;  4YWL A;  4N8X 1;  4L6T B;  5E7N A;  5C0X J;  1PRT F;  4DV1 L;  1QE6 A;  4ULL A;  1HA6 A;  3NEN A;  4DN4 M;  2MJ8 A;  1Q7Y C;  4A3B G;  2UU9 L;  4R9W A;  5M3F G;  5TSS A;  2EQS A;  2BE5 C;  1I4P A;  3OMG A;  1F2L A;  1PYB A;  1F2M A;  2EYP A;  2LSS A;  3CRL C;  2C35 B;  3CQZ H;  1VQM A;  4IJH A;  3J7Z C;  3ONA B;  1CKM A;  1EY6 A;  1S3O A;  5FLM H;  3TBI B;  4L5Q A;  3TME A;  5M5X H;  5C5L A;  4FYD A;  3U58 A;  2QIL A;  4A3J H;  3KF6 B;  2IHF A;  5HGQ A;  5CV4 A;  3KBG A;  3MXP A;  4GNX C;  1SYD A;  3PF4 A;  2R61 A;  3OTO L;  2YU9 H;  3SGI A;  3STB C;  3BDC A;  5A35 A;  1DGS A;  2EY2 A;  2EYF A;  2PZU A;  5IOD A;  2AQ3 B;  1QCB D;  4BBR B;  1XXG A;  2L55 A;  3E0E A;  3J81 j;  1JB7 A;  1WCM B;  1STA A;  3M4Y A;  4B3R Q;  1WYD A;  2K52 A;  2E76 C;  1BBU A;  1B8A A;  1RDP D;  1IL2 A;  2CCZ A;  1PTO D;  4EGV A;  3DWQ A;  1IBK L;  3I4M H;  5CBE E;  1HQM C;  1GHK A;  3CC4 A;  3HEJ A;  1B2T A;  4NXM L;  5ELD A;  2UUA Q;  1PH7 A;  2EPB A;  3BS1 A;  4KK7 A;  4NKL A;  3PCO B;  1CSP A;  2MUY A;  1JJC B;  4DV0 Q;  3AMU A;  1TWC B;  1A0I A;  1FNU A;  4P73 A;  1B70 B;  1Q90 A;  1WCM G;  2JA8 B;  1EEF D;  3M9B A;  4MTK A;  3GP7 A;  1O7Z A;  2B8G A;  4GKJ Q;  1AEX A;  3K59 A;  3T53 B;  1VQA A;  2XVS A;  2WKC A;  1VMP A;  4HIM A;  5EBD A;  4PMC A;  3FDT A;  4ME3 A;  5IGF A;  4JI4 Q;  1A2U A;  2AWN A;  4HN7 A;  4A4I A;  3CQZ B;  2A8V A;  1STG A;  2ICI A;  1KRT A;  1GUS A;  4XT1 B;  2Q2U A;  1PRT C;  2LFN A;  2JXM B;  3LX0 A;  4B3M L;  4IZ8 A;  5IP7 H;  3HS0 C;  1EOV A;  2JA7 G;  4L63 B;  3TZU A;  2PQA B;  5E3F A;  4DAM A;  1G2S A;  4FXG C;  1K73 C;  2Z1C A;  2OT2 A;  2HDM A;  4PZ6 A;  4H44 C;  5M5X B;  2JK8 A;  4OGQ C;  4EQ5 A;  4XXE A;  4DUY L;  4JI7 Q;  5IGE A;  4ZRZ A;  4X64 Q;  4I7Z C;  4XDX A;  4WFN 3;  4HSV A;  3CPW A;  4DR1 L;  4ZCK A;  4JYA L;  2ALY B;  3K8A A;  5A2Q E;  3HOW B;  1GUO A;  4TVA B;  4RGM A;  1Z7T A;  5C4X B;  4ZK9 B;  3K58 A;  3F2D A;  2IT1 A;  2B2T C;  3ITP A;  3I4M B;  4A3I B;  4BXX H;  1B1Z A;  4A3L H;  1IW7 D;  4B9W A;  2TMP A;  3DUZ A;  2E2H H;  5FK9 C;  3K80 C;  4JV5 L;  5M3M G;  2OWO A;  1W3S A;  1JQY D;  4KTA A;  2F3W A;  4OX9 L;  1PTO H;  5FLM G;  5EJW A;  5C0X I;  1JE4 A;  3BG3 A;  2V1C C;  2K50 A;  1PDQ A;  3A7L A;  4X3T A;  1IBM L;  1SR3 A;  4U68 A;  4ZAI A;  3FP9 A;  1EUJ A;  2JA5 B;  3CRK C;  2GN5 A;  4DAV A;  3A74 A;  2CVR A;  4BA1 I;  2EY1 A;  2K33 A;  3PIO 3;  4A3M H;  5DLQ E;  1PRT D;  3I3C A;  3T1H Q;  5JPM C;  1S4Z A;  3FRP B;  1KTK A;  3TP7 A;  2CH4 W;  5LL6 S;  4XYQ A;  1J8I A;  1TWF H;  1JOQ A;  2RHQ B;  1LTT D;  2NUC A;  3J7A F;  1FD7 D;  2HHH Q;  3FKI H;  1YIJ A;  2RDG A;  3JAM c;  1DZ1 A;  1PFN A;  3GV6 A;  1S5E D;  3BDO A;  1K8G A;  3KLW A;  3I56 A;  5GAD C;  3PO2 G;  2H5X A;  3SDZ A;  3H3V C;  3FVQ A;  4A3D G;  2WB1 G;  2SEB D;  4QIW E;  4YY3 L;  3J80 L;  1TWH B;  1WTQ A;  1D5Z C;  1AN8 A;  1Y14 B;  2UU9 Q;  1E0B A;  1Y1V H;  2VNU D;  4A3G B;  4DAY B;  4JI3 L;  1JE5 A;  4F7X A;  3GTP H;  1EZ6 A;  3EJI A;  1N9W A;  2NVT H;  2WFW A;  3D6C A;  5ELC A;  5AJ3 Q;  4YHH Q;  2A5H A;  2F3V A;  4JBW A;  1OXX K;  3SEB A;  3S2D B;  1D1I A;  1YNN D;  4FO2 A;  2B29 A;  3J7Y W;  3KBX A;  3QG1 A;  1QZH A;  1VQP A;  3F2C A;  1VQ8 A;  1LT4 D;  3T16 A;  4C3J H;  3IKJ A;  2QKI C;  4A3F H;  3A5U A;  3SVM A;  3CCV A;  1STE A;  4EQO A;  3I73 A;  1I6H H;  1B44 D;  3W1G A;  3OTO Q;  2F1M A;  5E1F A;  4IFD G;  4WJW A;  3CAM A;  1H9K A;  2A69 D;  1ZYR C;  2MGS A;  2QEX A;  1Y69 U;  2UXB Q;  3CD6 A;  2K03 A;  2PZW A;  2Q8T A;  4A3E G;  2AKW B;  1GUW A;  1D8L A;  2B2W A;  1AZP A;  1SYG A;  3NBH A;  4OL7 A;  1K3R A;  4GZY C;  2RQX A;  4DR2 L;  4JOI A;  2JE6 I;  2R6G A;  1OO9 B;  3NQT A;  1FVI A;  1JT8 A;  3ERQ A;  3J81 L;  4DNI A;  3RLF A;  2F0N A;  3NHH A;  3PUY A;  4K8J A;  4IPD A;  4BBS B;  2IX3 A;  3GV3 A;  3PV0 A;  4HED A;  4X65 L;  1GUG A;  4IPC A;  3A8J E;  4NB3 A;  4LF6 Q;  1R4P B;  2WII B;  1EY4 A;  3NE5 B;  2MPM A;  1E3P A;  1Q86 C;  4BBR H;  1A3U A;  2A68 D;  1MJE A;  2L11 A;  2B2T A;  4DA2 A;  5IT9 c;  3J80 E;  5T1I A;  3F8T A;  3NUC A;  5M3M H;  4OXP A;  2F0L A;  1BVS A;  4R4T A;  3CU7 A;  3I90 A;  4H0L C;  4L5T A;  3TSS A;  1PH8 A;  5JJL A;  1QZG A;  2I46 A;  2I5H A;  1JOO A;  4JI4 L;  1PFS A;  4K2K A;  5DAU A;  3H3V H;  2F52 A;  5C3E H;  1CQF A;  2GVA A;  3H3V I;  1LO5 D;  4QY7 A;  4GKK L;  1TT2 A;  2LKV A;  1OXV A;  4MN3 A;  3CKI B;  4O1N A;  4C1N K;  4Y7N B;  1KHI A;  4OWW B;  4DR4 Q;  1BOS A;  4LNQ A;  4QF4 A;  4JI5 Q;  3TQY A;  1NJI C;  3PIP A;  2MO0 A;  1K0R A;  2SOB A;  4PZ8 A;  2FXQ A;  4R4I A;  2YU9 B;  3Q23 A;  4RH6 A;  1IBL L;  3MHB A;  3HOX B;  3HOV H;  1K83 B;  2WAQ B;  4IPH A;  4IUQ A;  5KYI A;  3S1R B;  2VUM H;  4L5R C;  4IO9 A;  3GTQ B;  2BH8 A;  1PXU A;  3DEP A;  5C4J B;  4HAE A;  3PO2 H;  3KJO A;  1QB5 D;  4XIG S;  3I7F A;  3NK9 A;  2JSO A;  2N3S A;  1JB3 A;  4K5V A;  1J5E Q;  1CHQ D;  3M7G A;  2K01 A;  2VQF L;  1HNX L;  3BU2 A;  1JOR A;  4KMU C;  1D5M C;  2YYZ A;  3DWA A;  2PI2 E;  3S1N H;  2F4V L;  1GHJ A;  3G4S A;  2B8F A;  3V2T A;  3VYT A;  2NVX H;  4UPA A;  5JOB A;  3WOF A;  3CCS A;  3BZC A;  3FHW A;  3AU7 A;  4NPS A;  1E2Z A;  2B2U A;  4OX9 Q;  3UI2 A;  3NTK A;  1KAB A;  3JAM L;  3D3R A;  4HID A;  2Q8R E;  4C3I G;  2E2J H;  1Q1B A;  1Y1W G;  2J7Z A;  4C3J G;  4K2L A;  2MFI A;  3S1N B;  1PTO F;  2XSC A;  1SEB D;  2UXC L;  1OXS C;  3PMF A;  3CF5 A;  5FO7 B;  1NBW A;  1SNQ A;  1KDB A;  4LUV A;  4AYB E;  1VQD A;  2JA9 A;  1ESR A;  4P75 A;  3IFT A;  2ATW A;  1NMF A;  1ZXT A;  1CSQ A;  1HQR D;  4K0K Q;  4DPG A;  5M5W H;  2VY3 A;  1EYA A;  2WAC A;  2O2L D;  5C0X H;  4BBS H;  4C2M H;  2G9D A;  2QA4 A;  4A3M B;  4A76 A;  4JOI C;  1TWA H;  3T56 B;  3R3O A;  5IYB G;  1O78 A;  1KC8 C;  3HZX A;  4DV3 Q;  3S2H H;  4DR7 L;  2E2I B;  2RCN A;  4YY3 Q;  2K32 A;  4RWS C;  4AYB G;  3J81 E;  5IOC A;  4KHZ A;  4BXX G;  4JI1 L;  4A3L G;  4HMI A;  3AB9 A;  1HJP A;  3CW2 C;  1TQO A;  1Q82 C;  1LV9 A;  1CKN B;  2YTX A;  2Y0S E;  3TP8 A;  1BQQ T;  4JI3 Q;  1F9S A;  2I5L X;  3D6W A;  5ELF A;  3SXH A;  1EOT A;  3AYH B;  5C3E B;  4DV2 L;  1PHJ A;  3MWY W;  1X6O A;  1STY A;  1CZG A;  1UWV A;  4LFB L;  3I70 A;  3TS2 A;  4B3S Q;  1OXU A;  2D62 A;  3UE1 A;  2UUA L;  2X6G A;  4C3H G;  4HJ8 A;  2K7V A;  2XIW A;  4NXN Q;  1I6V C;  1OXT A;  2EYM A;  5CBA E;  2O4X A;  4PNY A;  1UE6 A;  1BKB A;  1TS4 A;  2JA6 G;  1RL2 A;  4KV6 A;  5ELE A;  3S1Q H;  1SE3 A;  4FF4 A;  2RF4 A;  4A3M G;  1O80 A;  4UP7 A;  2HIX A;  4M1U B;  1IXR A;  2ZXP A;  4DKA C;  3Q8D A;  1PTO B;  2N55 A;  1HZC A;  1WD0 A;  3ULP A;  3ER0 A;  5HUR A;  1N36 Q;  4CHT B;  4AYB B;  3M3Y B;  1CT1 D;  1ML0 D;  5C5M A;  4F87 A;  2AQ2 B;  5JEA G;  2E74 C;  1IYV A;  4J1M A;  2NZO A;  3GTK H;  2CH4 A;  3ND8 A;  1BBW A;  1LT6 D;  3NTI A;  1QIL A;  4IJL A;  4R4C A;  4V0B A;  1FYC A;  1K8M A;  3DM3 A;  3KF6 A;  3TN2 A;  3HOV G;  4MTN A;  1HHV A;  3J81 i;  1Y8N B;  1JWS D;  1QNK A;  1RJT A;  1Y1V G;  1PRT B;  4GOP A;  3U4V A;  4P74 A;  2V4D A;  1X3Q A;  3KLS X;  1UEA B;  3PO3 G;  1DM0 B;  5LHY 1;  4KLK A;  4LF6 L;  1LTA D;  4RG1 A;  3R2T A;  1QUQ B;  1BBX C;  4DAY A;  1SMY C;  2LS0 1;  1F2Z A;  1VQI A;  2RCF A;  3SE0 A;  3HOZ B;  2ICE C;  1DOK A;  1M8A A;  4JCV E;  2OTJ A;  2UUB L;  1SNM A;  5CGK A;  4B3T Q;  1IHZ A;  2DJF C;  1WTX A;  2XTI A;  4R4O A;  3QOJ A;  3T1Y Q;  3GTM B;  2R7Z B;  1G51 A;  3NEM A;  1HPC A;  2VQE L;  5EPJ A;  3JC6 6;  4POF A;  4ZKC B;  2Z9H A;  4CKE A;  1FGU A;  1HR0 Q;  2N49 A;  1HZ9 A;  1Y1W H;  2JA8 H;  4JV5 Q;  4K5X A;  5IIF A;  1R9T H;  2B63 G;  3FMC A;  2OF1 A;  4H7B A;  1DOM A;  4ZUI A;  2D9U A;  4QB4 A;  4R1J A;  1XYI A;  3PO3 B;  2EE1 A;  1RIP A;  4NP5 A;  3NBI A;  2F0M A;  4TKO B;  1DCZ A;  4JBM A;  1SNP A;  2A6E C;  4A3G H;  5C0X G;  4DR6 L;  2RKS A;  3K7A H;  1A62 A;  1EY8 A;  2JJQ A;  4UP8 A;  1DD2 A;  2Z8L A;  1I94 Q;  2JA7 B;  1ZYR D;  4JBJ A;  3Q24 A;  1PA6 A;  2BDO A;  1WTV A;  5IYB H;  1TWG B;  3H91 A;  3U4Z A;  2PMZ B;  3ND9 A;  1SE2 A;  1SMX A;  5LMU L;  3OIP A;  4CKB A;  1YHQ A;  4DR3 Q;  1WTR A;  2B63 B;  5F2D A;  3CMA A;  5M3F H;  2JA5 H;  4EVO A;  1EY7 A;  4RA8 A;  4GLV B;  1IKM A;  1I3Q B;  3HOW G;  1G2T A;  1EWC A;  2IHE A;  1EYC A;  1VCI A;  2PQA A;  1S5F D;  1VQF A;  1ET6 A;  1ENA A;  2F0H A;  1TS2 A;  2BA0 A;  3QOL A;  1PYW D;  2ZM6 L;  4KY6 A;  2JA6 H;  1R4Q B;  4KD3 A;  2B2Y C;  1LM0 A;  2L15 A;  4OIJ A;  4O0A A;  1KD1 C;  4AIM A;  2B39 A;  5M3M B;  5JVH 3;  4P2C B;  2KHI A;  4XT3 B;  4QCL A;  4JYA Q;  1PZJ D;  3S2H B;  3K81 C;  4XQN A;  1ILP A;  3TP6 A;  4A3B B;  3E3X A;  2MHV A;  1D2B A;  5JEA H;  1EY9 A;  5M3F B;  1F2Y A;  2RDF A;  3FPU B;  2KQ3 A;  2DNC A;  3VR4 A;  4DK3 C;  1O7L A;  4RKL A;  1DON A;  5GRO A;  1KAA A;  5BR8 Q;  1II3 A;  2KHS A;  3GD7 A;  4ILW A;  3EFX D;  4DV1 Q;  1HH2 P;  4DV5 Q;  3RLO A;  1CA5 A;  1U5K A;  2P5Z X;  3MXN A;  2R3Z A;  1UAP A;  2BOS A;  1LTI D;  1CA6 A;  5GAH C;  4CGY B;  1X3F A;  3G71 A;  2JN4 A;  1ESF A;  3E9I A;  4OO1 G;  3CXC A;  2SNS A;  1SRU A;  2NTS A;  4FP5 D;  5EKK A;  1FJG Q;  4DXG A;  2GVB A;  3PO2 B;  1Q3L A;  5KNB A;  1E1T A;  4J8Q A;  5DM7 3;  3RMH A;  4QUC A;  1ZKO A;  1WTH A;  3T1H L;  1GKH A;  1ASZ A;  1VF7 A;  3S1R H;  3I4N H;  4BWG B;  4DNR B;  1WD1 A;  4ME5 A;  5C4J H;  2E5L Q;  2ZJQ A;  4LF8 L;  1XMQ L;  3TRZ A;  3V05 A;  1Z6H A;  5E4X A;  5COR A;  4UAI A;  2EJM A;  5IGG A;  3TP5 A;  1PVO A;  3S17 H;  2CWA A;  2G9H D;  2EY6 A;  4J15 A;  2KCN A;  1EL0 A;  2NTT A;  3SK6 A;  2JA8 G;  1DXM A;  2QGQ A;  3NPP A;  4KJN A;  2Z6K A;  4RKB A;  3HKZ B;  3M4O B;  1LAC A;  2F0O A;  2EYL A;  4HJ7 A;  1EWI A;  1EYD A;  4GOP C;  2DJG C;  1EIY B;  4J6H A;  4G4K A;  1NNX A;  1XNR Q;  4JI0 Q;  5C6A A;  1SNO A;  3EN2 A;  4OHJ A;  4P72 A;  1S72 A;  4HJA A;  1EY0 A;  1PH5 A;  3H94 A;  5C44 B;  3SR1 A;  2OXP A;  3VA5 A;  3M3Y H;  4A3B H;  3X3M A;  4KY7 A;  1V9P A;  4LF7 Q;  1EWH A;  3PF5 A;  2RBM A;  2O5I C;  1HFN A;  3A0J A;  2FMC A;  1CI3 M;  4CDC C;  1YHB A;  4DV0 L;  4L5S A;  4HTH A;  1XNQ L;  3L3O C;  1AE3 A;  4BY1 B;  4QIW B;  3PSI A;  4POG A;  3W5O A;  4L8J A;  3QIA A;  1LTR D;  3ERS X;  3GTL B;  1HZA A;  1SYE A;  1EIH A;  3S15 H;  1S5D D;  4X3U A;  2A6H D;  3MEH A;  3A54 A;  4LFA Q;  5BN3 A;  1IKL A;  1V1Q A;  1J5E L;  5A2Q L;  3GTG B;  1MGS A;  4XTC S;  1T5E A;  4QMG A;  4C56 C;  4GN4 B;  1LTL A;  1HNW Q;  3HKZ E;  1M90 C;  4LF9 Q;  2R7D A;  3BZD B;  1LLR D;  3CP0 A;  2O5J C;  2B2Y A;  1HRJ A;  3ICE A;  4X6A H;  1YNJ C;  2D0P A;  2ZJP A;  2B2W C;  3ZJY C;  1MKH A;  2GA4 B;  2Z6K C;  5IT9 L;  2A69 C;  1SNC A;  1TWG H;  3A8I E;  4DFA A;  1U4M A;  4K14 A;  3WOE A;  2WB1 E;  1OTC A;  1L1O B;  5KND A;  3I4M G;  4DUZ Q;  4JI7 L;  4X64 L;  3OWF A;  5HGT A;  3FKI G;  4O42 A;  4QGU A;  1WI5 A;  4G7H C;  1EIF A;  2VZA A;  3UDG A;  1GD7 A;  2Z4H A;  2E75 C;  4RGO S;  3EQL C;  2F0P A;  1W6K A;  4HMJ A;  3J81 c;  1CM9 A;  2F0D A;  5FO8 B;  1ZEQ X;  3D4D A;  2B2V C;  4A3D H;  4K0K L;  1L2F A;  5FOB B;  4K6L A;  3P1H A;  4DNT B;  2L5T A;  5LMU Q;  3Q22 A;  4DR5 L;  3B6Y A;  4X3K A;  3AEV A;  3BYT B;  1R9T B;  4OO1 H;  1KNE A;  1E7Z A;  2C5C A;  3BVZ A;  1RTO A;  3QR8 A;  1HUM A;  4K8I A;  4APV A;  4I65 A;  3OMC A;  1ROD A;  4DR7 Q;  2B2V A;  1AP0 A;  2KEN A;  3MXG A;  2WB1 B;  2MQH A;  1IL8 A;  2QCP X;  1QWY A;  2K5N A;  1T9H A;  2KEE A;  5KEE A;  2A6H C;  1G8Z D;  1I5F A;  3QWN A;  1IBM Q;  5I9O A;  3FKI B;  4A3C G;  4JI8 L;  2B63 H;  4ZLT F;  1JIC A;  5ISR A;  3D0F A;  3UDI A;  1LUZ A;  2KED A;  3G6E A;  1YJ9 A;  3W3A A;  1D1K A;  1YHA A;  3BJU A;  3C3L A;  4GNX A;  2L0C A;  4KY5 A;  4IFD H;  3CC7 A;  3CME A;  5JVG 3;  4Q5V A;  4LMQ D;  2HHH L;  3GO5 A;  3KFU A;  4A3E H;  1JOK A;  1CTM A;  1VQ6 A;  3WDN A;  1BCP C;  4A3G G;  4C1N I;  5CV9 A;  1C48 A;  3A55 A;  3GTM H;  1CKN A;  3E0J A;  2KCT A;  5I2Y A;  4A3K H;  3KOJ A;  2XGT A;  1V43 A;  5I6W A;  2AUJ D;  3I2Z A;  4LFC Q;  3S15 B;  1PFB A;  3S24 A;  3K5O A;  1X32 A;  3E5S A;  5AJ3 L;  1RD9 D;  4LF4 Q;  2R92 B;  4RMF A;  1C9O A;  1IW7 C;  3HOW H;  2HDL A;  2JEA I;  4GOP B;  4GN3 B;  2F0W A;  2NZH A;  4A75 A;  4BY7 H;  2L4N A;  3CCE A;  1ILQ A;  1GUT A;  2I5M X;  2FIN B;  2H4O A;  5IYC G;  4JI2 L;  1P16 A;  4B08 A;  3C2P A;  2R93 G;  3MTS A;  1VS0 A;  3H0G H;  2IX1 A;  2Y0S G;  1SYC A;  2KBN A;  3GTQ H;  3HG9 A;  4I7A A;  4LF8 Q;  3M7N A;  1HCZ A;  1U9R A;  3M85 A;  2CFM A;  2L9H A;  3TEH B;  1VQL A;  2K14 A;  4IN3 A;  5C3E G;  4JW0 A;  3C1F A;  4B3T L;  3R2I A;  2K5Q A;  1LTG D;  1J6Q A;  3SHL A;  4AH6 A;  1GO3 E;  3PUZ A;  2ZTD A;  2VL6 A;  1XX8 A;  3D8G A;  1U4L A;  1AE2 A;  4QL5 A;  4QUF A;  1FNW A;  2VQE Q;  4G57 A;  1I3Q H;  1CFM A;  1CUK A;  4GN5 A;  5J1Z A;  2Z4I A;  3CC2 A;  1BCP F;  3RN5 A;  2K04 A;  3V96 A;  1QG7 A;  1UE7 A;  2Q8I B;  2KOL A;  2PNR C;  1KDC A;  5IGB A;  2XN9 C;  2H1E A;  2XWB B;  2E2J B;  1UNS A;  1C0A A;  3RLN A;  4Y7N H;  1VQ9 A;  4B3S L;  5KIX A;  2WIN B;  3BVG A;  2FJ2 A;  2MO1 A;  3S14 H;  1HXY D;  1I6H B;  4IPG A;  1SYB A;  1E24 A;  1RHP A;  2ZJR A;  3MXN B;  1YJN A;  3K6O A;  4ID6 A;  2F0K A;  4DR6 Q;  1CZW A;  3K5L A;  5FJ8 H;  4IQZ A;  3T51 B;  4CKC A;  1I94 L;  2K75 A;  1L0W A;  1Z9F A;  1EIG A;  3C1E A;  5CV8 A;  2NVQ H;  3FEW X;  2NVY H;  3EVQ A;  2XRQ D;  1TY2 A;  1Y1V B;  1YNN C;  4A3F G;  2PPB C;  1U4R A;  1I4G A;  4IUR A;  1JR0 D;  1QNU A;  3N6R A;  1EU3 A;  1HNW L;  2WAQ G;  4LF9 L;  4N9T A;  2FHT A;  3R93 A;  3OPO A;  3RD4 A;  1BR9 A;  1SFO H;  1BO0 A;  2VS1 A;  1K9M C;  3AQQ A;  3S1Q B;  2NZ1 D;  2PQE A;  2NVT B;  2R7Z G;  3OHX C;  3S1M H;  1IBL Q;  4ZUJ A;  1FR3 A;  1CHP D;  2LMC B;  4BY7 B;  1RF2 D;  4DAP A;  4C3I B;  5IYD H;  3BDL A;  3EIV A;  3RZD B;  2DNE A;  4FXK C;  2CQA A;  1E1O A;  1Q1E A;  3K5N A;  5EKI A;  1EU4 A;  2RVL A;  3DXJ C;  1SJH D;  5M9O A;  4DV6 L;  3CCQ A;  2MNA A;  1G6P A;  1BXT A;  5J39 A;  2WP8 J;  3MZ5 A;  3T1Y L;  4JC0 A;  3MAQ A;  5LMN Q;  1S5C D;  4C3J B;  1YVC A;  5LL6 X;  1VQK A;  5C44 H;  4DV5 L;  1YZ6 A;  1L1O A;  1L0X B;  2DN8 A;  1MHW C;  3A56 A;  4KI0 A;  3U50 C;  1DOL A;  2F0U A;  2DY8 A;  1H9S B;  3HOZ H;  2CWP A;  2HD3 A;  4X66 L;  2OTL A;  1TU2 B;  2VUM B;  1A15 A;  3T13 A;  2UXC Q;  4OON A;  4FF3 A;  1EQR A;  2XRS D;  4U67 3;  1AW7 A;  1PYS B;  5C4H A;  3KJP A;  3HOY H;  5G3L D;  3ULJ A;  2N88 A;  4CJ1 B;  2F3I A;  1KNA A;  2ZT9 C;  1D7Q A;  2E5L L;  3P75 A;  1H95 A;  4KN4 C;  3CCR A;  1K8A C;  3F1Z A;  1E2V A;  4FNF A;  3RR5 A;  5JJZ A;  1N33 Q;  2JA6 B;  1YNJ D;  2A68 C;  4CDD C;  1KL9 A;  4DR3 L;  1TY0 A;  2NVX B;  4RFB A;  5CYU A;  4X62 L;  1Z47 A;  1F9Q A;  1LTB D;  4GS3 A;  1Q81 C;  3SK5 A;  1WTP A;  3L0O A;  4UP9 A;  3ULL A;  1X65 A;  1ONL A;  4S3S A;  4OO1 I;  1TXY A;  3M4Q A;  2NN6 G;  1C4Q A;  2F0G A;  2DY7 A;  3NWT A;  1PH1 A;  4LF5 Q;  4KKU A;  3I55 A;  4A93 B;  1SFO B;  4JI0 L;  2F0Q A;  2QEJ C;  1I4Q A;  3E6Z X;  2K1B A;  2IY5 B;  5I4D A;  1MSH A;  5D3I B;  2VXW A;  1I50 B;  2YTY A;  1JC7 A;  1V1P B;  1VQH A;  1HTL D;  4HJ9 A;  2TSS A;  3F2U A;  3HOU H;  1GVP A;  4P71 A;  4KJO A;  3UDX A;  5CV5 A;  3LGJ A;  3PIP 3;  1HTP A;  1TVX A;  3NSW A;  1X3G A;  1NSN S;  1D6E C;  2PW5 A;  3NTH A;  5D65 A;  3R8B A;  1GOZ A;  2F0F A;  3ZYY X;  1QUQ A;  5BR8 L;  2RSO A;  3NWS A;  3I72 A;  2A73 B;  3PIO A;  4PZ7 A;  1EYG A;  2ZXO A;  3RZO B;  4R4Q A;  1XJV A;  1PH9 A;  4IUT A;  1VQE A;  1H9M A;  3S16 H;  3GTL H;  2EYJ A;  1FJG L;  1KRS A;  1NR2 A;  2Q2T A;  1STH A;  1SN8 A;  5IYD G;  1H9R A;  4EX5 A;  4NXM Q;  3LWU A;  1C8C A;  1AZQ A;  3H0G B;  1N34 Q;  1ENF A;  1I4H A;  4C2M B;  2CW0 C;  3GTK B;  3HOY B;  2WKD A;  2F0E A;  5BN5 A;  4DUZ L;  3GTG H;  4K5W A;  2OEO A;  1VDZ A;  1VQC A;  1CK1 A;  3K7U C;  1PZK D;  3H6M A;  1NAP A;  1A6X A;  1K83 H;  4C3H H;  3MXU A;  1JMC A;  5J3B A;  4KHP L;  5IE8 A;  5C44 G;  2F0J A;  3SK4 A;  1Q12 A;  4IOA A;  5IGD A;  4CJ0 B;  1E2W A;  2IW3 A;  4IUN A;  5LMN W;  1G29 1;  5DEH A;  4Z9C B;  3J80 c;  5IT9 E;  3I91 A;  3VYU A;  2UXD Q;  1VQO A;  1Q46 A;  2K5W A;  5IWA Q;  4KHV A;  3S2D H;  1XNR L;  2EJF C;  2K6A A;  3MVV A;  2KCM A;  3BVM A;  3CPF A;  1Y8O B;  3GDE A;  2UUC Q;  2IPK D;  1NY4 A;  3HOY G;  3IAY A;  1EZ8 A;  1KDA A;  3IL8 A;  3KLS A;  2A1A A;  1IYU A;  1NMG A;  3GQB A;  3VYS A;  1STB A;  5KRU A;  3Q6S A;  2F0I A;  1XNQ Q;  3CCL A;  3H15 A;  1GM5 A;  4JBK A;  4CDE C;  5C3W A;  1F77 A;  1K28 A;  1EQV A;  1X56 A;  5DM6 3;  1XMO Q;  2B3G A;  3KDF A;  5C3X A;  2SNM A;  1BF4 A;  5IP9 G;  2OQK A;  1NCV A;  4XQQ A;  2K5V A;  3NEL A;  3PO3 H;  2EJG C;  3D4R A;  4LFA L;  4IOC A;  2PW7 A;  3VA7 A;  1TWF B;  3KF8 A;  3LWE A;  4DK0 A;  3OW2 A;  5FJ8 G;  3I4N B;  1S5B D;  1BCP B;  3VR3 A;  1Y8P B;  1XPU A;  4DK1 A;  5G3L F;  2ID0 A;  3DMU A;  1K3B C;  3QO2 A;  4WJ3 M;  3MFY A;  1KAW A;  5C4X G;  3S16 B;  5CC4 A;  3IRB A;  3GTO H;  3OOC A;  1B4O A;  4HIO A;  4X66 Q;  1TS5 A;  1SE4 A;  1SND A;  5ELB A;  2A19 A;  1N32 L;  1GUN A;  1PH3 A;  2Z6B A;  4DV7 Q;  4DF7 A;  5FLX c;  4OIK A;  1MD2 D;  1CQV A;  4K6D A;  4M8A A;  2JQO A;  3TZD A;  5H1S E;  1O7I A;  1SXT A;  4YIJ A;  5EPK A;  2R7Z H;  1HFG A;  1A63 A;  1M4V A;  2JEB I;  1QVG A;  5T1G A;  1ICF B;  1PV4 A;  1PTO C;  1MJC A;  2YV5 A;  1PZI D;  4A3I G;  3GTO B;  5E4W C;  2F4I A;  3DM1 A;  2PYK A;  3TS0 A;  1LT3 D;  5CV6 A;  2F03 A;  2K4K A;  4CBV A;  4X62 Q;  2ES2 A;  1DYQ A;  3HFZ B;  4EQN A;  1B3Q A;  1TKW B;  3W2D A;  4MIU A;  3J80 i;  3UDF A;  4JI6 Q;  1NR4 A;  4B9X A;  3HKZ G;  4IFD J;  2JA5 G;  4V19 0;  4IUP A;  1GXD C;  2K28 A;  2X69 A;  4DK6 C;  1IBK Q;  3J7A 5;  2DGY A;  3CCU A;  1HNZ L;  5C4Z A;  3EBE A;  1NUC A;  2NB0 A;  1QOH A;  3U9S A;  4BBR G;  3P7J A;  4N9P A;  1B53 A;  5NUC A;  1PH4 A;  5JJK A;  5JAV A;  3P20 A;  3I4L A;  3NBH B;  3PQI A;  5BN4 A;  5I9P A;  3STB D;  2VB2 X;  3HKS A;  1XMQ Q;  3MEF A;  3RZO H;  2WV6 D;  4TSS A;  2LXK A;  2ENB A;  4UDU C;  4GKJ L;  4A3D B;  2Q2H A;  2N8N A;  3X3N A;  5CMD A;  2J0T D;  5I6Y A;  4RGN A;  1I4X A;  2AUK A;  3OWE B;  3HRZ C;  3EA6 A;  3H09 A;  3PGZ A;  5HY6 A;  2IX0 A;  4LW1 A;  3W1B A;  2EYH A;  3DEO A;  3MA2 B;  3RNU A;  1H9J A;  1UUP A;  1SBB B;  2BE5 D;  4BY1 G;  2R92 H;  1SSO A;  2CKZ B;  4YCW A;  3O13 A;  3OSO A;  3BYY B;  2B2U C;  3I8Z A;  1XWE A;  4IAL A;  4LK1 C;  1YJW A;  4LF4 L;  2M9V A;  4KKS A;  3PUW A;  4LF7 L;  2NN6 H;  1V1P A;  5M5W B;  1M1K C;  2XWJ B;  2AMC B;  2G5D A;  4HCS A;  1XTD A;  1FGB D;  5IP9 H;  4CDF C;  4JI2 Q;  2PCF B;  1S40 A;  5JJI A;  3KK7 A;  5FLX L;  1G6Z A;  1AFP A;  2E2D C;  4FF2 A;  2OQ0 A;  3FPP A;  2NN6 I;  1KLU D;  4A3E B;  1KIX A;  2EVB A;  2L12 A;  1V1O A;  4DV6 Q;  1QVC A;  3RZD H;  4OWX B;  4B3R L;  4QQB X;  4DXF A;  1ENC A;  2EXD A;  3CCJ A;  2C9O A;  3J7A V;  1F9P A;  2UXD L;  4A3K B;  1BNZ A;  4RGT A;  1ET9 A;  3DLL A;  4GKK Q;  5K36 G;  4DGZ A;  1WOC A;  5J22 A;  4A93 H;  4XYO A;  1HR0 W;  4HCE A;  1YI2 A;  1VQ7 A;  2I0Q A;  4FVM A;  4PG3 A;  2YTV A;  1D5X C;  5GQO A;  1TWA B;  4DV4 L;  5L37 A;  4WRD A;  1XPR A;  4Y52 H;  5M5Y H;  2DUD A;  4LJZ C;  2IL8 A;  3HP3 A;  1WJJ A;  2KA7 A;  1I50 H;  4Q0F A;  1WTW A;  4JK1 C;  1QJO A;  2QF7 A;  3QJY A;  3A7A B;  2F0V A;  4RCO A;  2M2L A;  1VMC A;  4F8M A;  3ERO A;  5JEA J;  1SYF A;  1NE3 A;  3KF8 B;  1LTS D;  2NVY B;  1XMO L;  2OCE A;  2EZV A;  1YEZ A;  1A8V A;  1X3E A;  2NBF A;  3MFG A;  3S17 B;  4YWM A;  1JWM D;  1JWU D;  3G48 A;  4DR5 Q;  1KLG D;  1PFM A;  1YNX A;  3PUX A;  4A3K G;  1KQS A;  1PH2 A;  2BCO A;  2Z0S A;  1YBY A;  1HNX Q;  1B3A A;  2ASB A;  1TII D;  1U0L A;  5AFW A;  5KYL A;  3PUV A;  3F2B A;  2HCC A;  3NXW A;  1EEI D;  2BA1 A;  1SE8 A;  4AQY Q;  3HGB A;  4TRD A;  1LT5 D;  2A6E D;  4RCN A;  1RKN A;  1T5X D;  4FXD A;  2LY7 A;  3AFP A;  1W6J A;  1JJG A;  4WOR A;  4JI8 Q;  3RUZ A;  3HOX G;  1CKO A;  1RTN A;  1E22 A;  2R93 H;  2IJ0 A;  5COY A;  3OYY A;  4OEL B;  4YHH L;  1B9M A;  4IFD I;  3NQI A;  4DUY Q;  2JYO A;  2AWO A;  2E8G A;  1VQB A;  1ASY A;  4QJF A;  2F0S A;  1V8Q A;  1IYJ B;  1U4P A;  2AHO B;  4NMZ A;  5FKA C;  1KXL A;  3U9O A;  4O2D A;  3VR5 A;  2VUM G;  4MHE A;  1EY5 A;  4NDX A;  5FO9 B;  4XQJ A;  2Y0S B;  1SDF A;  1Q8I A;  2EY5 A;  1MIU A;  2PMZ E;  3LNN A;  5LMN L;  1WTO A;  2KUM A;  3L9A X;  2RDH A;  3GTJ B;  4BY1 H;  2R92 G;  2XNA C;  5CV7 A;  2UXB L;  1MBY A;  2EXZ A;  5EPL A;  3VYR A;  3L7Z C;  2EYO A;  4BS9 A;  1WFQ A;  4LFC L;  1PH6 A;  4GLX A;  4KN7 C;  1BCP D;  1EQT A;  4FDB A;  2R93 B;  1YIT A;  4MZ9 A;  4JI6 L;  4JI1 Q;  1N8R C;  4H13 C;  3D4W A;  2Q2I A;  5EKL A;  4DR2 Q;  4UHV A;  2SDF A;  4JG2 A;  1X9N A;  4IUU A;  5IGC A;  1G91 A;  5KNC A;  1HNZ Q;  3K0Y A;  2FFK B;  3CHB D;  5EQ0 A;  3S1M B;  4HJ5 A;  5C4X H;  1WCM H;  4NW2 A;  5GAG C;  4HR7 B;  4LFB Q;  1X3P A;  5ELO A;  2JP1 A;  2I07 B;  1STN A;  5ELN A;  4C3I H;  3M4O H;  1I4R A;  1SAP A;  2L1B A;  3D31 A;  4X65 Q;  4A3C H;  4LUZ A;  4OWT B;  4R8N A;  3VDY A;  1DJR D;  1ICW A;  1TS3 A;  2FMM A;  2J4X A;  4JPB W;  5IY0 A;  1XTC D;  1SMY D;  2QDB A;  3G7L A;  2ZTE A;  2K5H A;  3JAM i;  4KHP Q;  1C7Y A;  3K57 A;  4CJ2 C;  2HT1 A;  4N8F A;  5K36 H;  2RSN A;  4C3H B;  1A3T A;  4FF1 A;  1NTG A;  4A3I H;  3K7A B;  3K0X A;  1N36 L;  1EFI D;  2D2C C;  1FNV A;  2IWH A;  2NVQ B;  3QB3 A;  2RHS B;  4DU9 A;  4BBS G;  5KGU A;  1L1O C;  3OW7 A; 
#chains in the Genus database with same CATH homology
 1XJV A;  1PH9 A;  5IWA L;  1K3R A;  4LF5 L;  2PNH A;  3TRE A;  1XNR Q;  1VQE A;  1JJ2 A;  1TWC H;  4JI0 Q;  4DR2 L;  3EN2 A;  4ALP A;  4JOI A;  3S16 H;  3GTL H;  4DR4 L;  2JE6 I;  2R6G A;  4P72 A;  1S72 A;  1FJG L;  1KRS A;  4PMW A;  4HJA A;  1PH5 A;  1FVI A;  1JT8 A;  2Q2T A;  2UUC L;  1SN8 A;  5IYD G;  1W2B A;  3M3Y H;  4A3B H;  4DNI A;  3RLF A;  4EX5 A;  4LUO A;  4NXM Q;  1V9P A;  4LF7 Q;  1X55 A;  3PUY A;  2N78 A;  3PF5 A;  1N34 Q;  4IPD A;  3M4P A;  3A0J A;  3PV0 A;  4X65 L;  1YHB A;  4IPC A;  4NB3 A;  4DUZ L;  4LF6 Q;  4DV0 L;  4L5S A;  3GTG H;  2R7F A;  1XNQ L;  1AE3 A;  1VQC A;  1SLJ A;  3PSI A;  4POG A;  2ZTC A;  2WAQ E;  3KDF B;  3K7U C;  3W5O A;  1VQN A;  3E9H A;  1E3P A;  1VQ5 A;  1Q86 C;  4BBR H;  3ERS X;  4BY7 G;  1HZA A;  1MJE A;  1K83 H;  4C3H H;  3I4O A;  1JMC A;  1LYL A;  5J3B A;  2D0O A;  4KHP L;  5IE8 A;  5C44 G;  1VQ4 A;  5IYC H;  5IT9 c;  2HIV A;  1Q12 A;  2UUB Q;  3S15 H;  3F8T A;  4GLA C;  4A3J G;  3H0G G;  4IOA A;  4LFA Q;  2CQO A;  5M3M H;  4OXP A;  1BVS A;  4R4T A;  1V1Q A;  4L5T A;  1PH8 A;  1J5E L;  5JJL A;  1QZG A;  2EIF A;  2I5H A;  5LMN W;  4JI4 L;  1G29 1;  1PFS A;  2LXJ A;  3J80 c;  3RN2 A;  4XTC S;  2UXD Q;  1VQO A;  3H3V H;  1Q46 A;  2F52 A;  1LTL A;  4GN4 B;  5C3E H;  3HKZ E;  2F4V Q;  2GVA A;  3H3V I;  3HOZ G;  1M90 C;  4QY7 A;  1Q8K A;  4GNX B;  3A5Z B;  5IWA Q;  3HOX H;  2R7D A;  1EQQ A;  4LF9 Q;  3AFQ A;  3CP0 A;  1HR0 L;  4B3M Q;  1OXV A;  1XNR L;  3S2D H;  4WJ4 A;  1TWH H;  2KCM A;  3ICE A;  4X6A H;  2D0P A;  2ZJP A;  4DR4 Q;  1KHI A;  1UE1 A;  4OWW B;  4LNQ A;  3CPF A;  4JI5 Q;  3TQY A;  3ZJY C;  1NJI C;  1MKH A;  3PIP A;  3GDE A;  2Z6K C;  2BH2 A;  2UUC Q;  3HOY G;  1NY4 A;  2MO0 A;  5GAE C;  1TWG H;  1K0R A;  4DV4 Q;  4PZ8 A;  2FXQ A;  1N34 L;  2A1A A;  4R4I A;  4BA2 I;  1NMG A;  2WB1 E;  2KHJ A;  1OTC A;  1L1O B;  1IBL L;  3I4M G;  4DUZ Q;  1N32 Q;  4JI7 L;  4X64 L;  3HOV H;  1XNQ Q;  3CCL A;  4IPH A;  3H15 A;  3FKI G;  4DV7 L;  4QGU A;  1GM5 A;  1WI5 A;  4JBK A;  2VUM H;  4L5R C;  1EIF A;  4DR1 Q;  2VZA A;  1X56 A;  3UDG A;  1XMO Q;  4IO9 A;  1GD7 A;  2B3G A;  1VQG A;  2BH8 A;  3KDF A;  3CCM A;  5EAY A;  3J81 c;  3KJO A;  5IP9 G;  3PO2 H;  2OQK A;  4XIG S;  2K5V A;  3WWV A;  4HIK A;  4A3D H;  3NEL A;  3PO3 H;  1L2F A;  4K0K L;  1EFW A;  3I7F A;  4H02 A;  2PI2 A;  2N3S A;  4IOC A;  4LFA L;  4YWK A;  2HQL A;  1J5E Q;  5LMU Q;  2VQF L;  1HNX L;  4DR5 L;  3B6Y A;  3BU2 A;  3AEV A;  1VQJ A;  5FJ8 G;  2YYZ A;  2VW9 A;  3OW2 A;  2PI2 E;  4MNO A;  1AH9 A;  3S1N H;  1E7Z A;  2F4V L;  3G4S A;  4APV A;  1XPU A;  1X54 A;  3BZK A;  2ID0 A;  4TQU S;  3GTJ H;  2NVX H;  4UPA A;  4YCU A;  3CCS A;  4DV3 L;  3BZC A;  3FHW A;  4WJ3 M;  4DR7 Q;  4AQY L;  1UEB A;  4JI5 L;  2KEN A;  4NPS A;  2MQH A;  1KAW A;  4OX9 Q;  5C4X G;  2K5N A;  1T9H A;  1SRO A;  3IRB A;  1I5F A;  1IBM Q;  4HID A;  2E2J H;  3GTO H;  3HOU G;  1Q1B A;  4HIO A;  4JI8 L;  1Y1W G;  3I4N G;  4X66 Q;  4A3C G;  2B63 H;  2MFI A;  4A93 G;  1FL0 A;  4DV2 Q;  3D0F A;  2ZM6 Q;  2A19 A;  3UDI A;  5IP7 G;  1OXS C;  4LWC A;  3L2P A;  1LUZ A;  1PH3 A;  4YCV A;  1XPO A;  3CF5 A;  4DV7 Q;  2JA7 H;  1UE5 A;  3G6E A;  1NBW A;  5FLX c;  1YJ9 A;  4UY8 C;  1YHA A;  3BJU A;  1P8L A;  4LUV A;  4AYB E;  4GNX A;  1HZB A;  1VQD A;  2JA9 A;  1N32 L;  1IZ6 A;  2JQO A;  5H1S E;  4P75 A;  1O7I A;  4NXN L;  2R7Z H;  2ATW A;  3UE0 A;  3CC7 A;  1A63 A;  1B7Y B;  1NMF A;  2JEB I;  3CME A;  1CSQ A;  1QVG A;  2E2I H;  1PV4 A;  2HHH L;  1MJC A;  3GO5 A;  3KFU A;  4A3E H;  2YV5 A;  4A3I G;  4DPG A;  5M5W H;  4K0K Q;  1N33 L;  2VY3 A;  1VQ6 A;  1QVF A;  4A3G G;  2VQF Q;  4BBS H;  4C2M H;  3KYH C;  4YWL A;  3TS0 A;  2QA4 A;  4A76 A;  4JOI C;  1TWA H;  3GTM H;  5IYB G;  2K4K A;  1CKN A;  4X62 Q;  5E7N A;  5C0X J;  1KC8 C;  2ES2 A;  4DV1 L;  3HFZ B;  2KCT A;  4DV3 Q;  4A3K H;  3KOJ A;  2XGT A;  3S2H H;  2UXC L;  1V43 A;  3J80 i;  3NEN A;  2RCN A;  4YY3 Q;  3UDF A;  4DR7 L;  1Q7Y C;  4AYB G;  4JI6 Q;  4A3B G;  3I2Z A;  4KHZ A;  3HKZ G;  4JI1 L;  2UU9 L;  4LFC Q;  4A3L G;  4BXX G;  5M3F G;  3CW2 C;  1HJP A;  4GKK L;  2JA5 G;  2EQS A;  4IFD J;  3S24 A;  1PYB A;  1HNW Q;  1Q82 C;  4DK6 C;  2YTX A;  1CKN B;  2LSS A;  2C35 B;  2Y0S E;  3CQZ H;  1VQM A;  1IBK Q;  4JI3 Q;  3J7A 5;  2DGY A;  2I5L X;  4IJH A;  5AJ3 L;  3J7Z C;  3CCU A;  1HNZ L;  3AYH B;  3EBE A;  4RMF A;  1CKM A;  1C9O A;  4LF4 Q;  4DV2 L;  1PHJ A;  2JEA I;  3HOW H;  1X6O A;  1S3O A;  4GN3 B;  4GOP B;  2NZH A;  4BBR G;  4A75 A;  5FLM H;  4BY7 H;  1UWV A;  4LFB L;  3TS2 A;  4L5Q A;  5M5X H;  1OXU A;  2D62 A;  3UE1 A;  3CCE A;  2UUA L;  4B3S Q;  1PH4 A;  5JJK A;  4HJ8 A;  2I5M X;  3NBH B;  5IYC G;  4JI2 L;  3U58 A;  4NXN Q;  1OXT A;  1P16 A;  3STB D;  2R93 G;  3HKS A;  3KF6 B;  1UE6 A;  1BKB A;  1VS0 A;  3H0G H;  2IHF A;  2Y0S G;  5HGQ A;  3MEF A;  2JA6 G;  1RL2 A;  2KBN A;  2IX1 A;  3RZO H;  3S1Q H;  3GTQ H;  4LF8 Q;  3M7N A;  2RF4 A;  4A3M G;  4GNX C;  4UP7 A;  2CFM A;  3M85 A;  3PF4 A;  2HIX A;  3OTO L;  2YU9 H;  3SGI A;  3STB C;  3TEH B;  2LXK A;  1IXR A;  1VQL A;  2K14 A;  1DGS A;  5C3E G;  4GKJ L;  2Q2H A;  2N8N A;  4DKA C;  4B3T L;  1JB7 A;  3Q8D A;  3E0E A;  3J81 j;  1HZC A;  3ULP A;  1J6Q A;  3PGZ A;  3ER0 A;  4AH6 A;  4B3R Q;  1WYD A;  1GO3 E;  2IX0 A;  5HY6 A;  1N36 Q;  3PUZ A;  4LW1 A;  2ZTD A;  3W1B A;  2VL6 A;  2K52 A;  5JEA G;  1BBU A;  1AE2 A;  4QL5 A;  1B8A A;  2NZO A;  3RNU A;  1IL2 A;  3GTK H;  2VQE Q;  2CCZ A;  1I3Q H;  1BBW A;  1CUK A;  4GN5 A;  3CC2 A;  4BY1 G;  2R92 H;  4IJL A;  4R4C A;  3RN5 A;  2CKZ B;  4YCW A;  1UE7 A;  3DM3 A;  1IBK L;  3I4M H;  3KF6 A;  1YJW A;  3HOV G;  4MTN A;  4LF4 L;  3CC4 A;  3PUW A;  4NXM L;  3RLN A;  1C0A A;  4LF7 L;  4Y7N H;  3J81 i;  1VQ9 A;  1M1K C;  2AMC B;  4B3S L;  2UUA Q;  1Y1V G;  1PH7 A;  1XTD A;  4GOP A;  3U4V A;  4P74 A;  5IP9 H;  4JI2 Q;  3PCO B;  2MO1 A;  3S14 H;  1CSP A;  1S40 A;  4IPG A;  3PO3 G;  5JJI A;  1E24 A;  2ZJR A;  4KLK A;  1JJC B;  4DV0 Q;  4RG1 A;  3MXN B;  1QUQ B;  4LF6 L;  1YJN A;  1A0I A;  1VQI A;  4DR6 Q;  4P73 A;  2OQ0 A;  1B70 B;  1WCM G;  5FJ8 H;  2NN6 I;  3M9B A;  1I94 L;  2K75 A;  1L0W A;  4JCV E;  1Z9F A;  4GKJ Q;  2OTJ A;  1KIX A;  2UUB L;  1VQA A;  4B3T Q;  2NVQ H;  4DV6 Q;  1QVC A;  2NVY H;  4HIM A;  4OWX B;  3RZD H;  4B3R L;  2XTI A;  4R4O A;  4ME3 A;  4QQB X;  4A3F G;  4JI4 Q;  2EXD A;  2AWN A;  4A4I A;  3T1Y Q;  3CCJ A;  2A8V A;  1G51 A;  3NEM A;  1KRT A;  2VQE L;  4POF A;  3JC6 6;  1HR0 Q;  2Q2U A;  2UXD L;  1FGU A;  1HNW L;  2N49 A;  3DLL A;  2WAQ G;  4GKK Q;  1HZ9 A;  1Y1W H;  4LF9 L;  2JA8 H;  4JV5 Q;  1R9T H;  5K36 G;  2B63 G;  1WOC A;  4B3M L;  4A93 H;  1HR0 W;  5IP7 H;  1EOV A;  1YI2 A;  1VQ7 A;  2I0Q A;  2JA7 G;  4PG3 A;  2YTV A;  1SFO H;  2PQA B;  4DAM A;  5GQO A;  4R1J A;  4DV4 L;  2VS1 A;  1XPR A;  1K73 C;  3AQQ A;  1K9M C;  5M5Y H;  4Y52 H;  2DUD A;  1WJJ A;  1RIP A;  2R7Z G;  1I50 H;  4PZ6 A;  1IBL Q;  3S1M H;  2JK8 A;  4EQ5 A;  4DUY L;  4JBM A;  4JI7 Q;  4X64 Q;  5JEA J;  5IYD H;  3EIV A;  1NE3 A;  4A3G H;  5C0X G;  3CPW A;  4DR6 L;  3K7A H;  3KF8 B;  1A62 A;  2JJQ A;  4UP8 A;  4DR1 L;  1XMO L;  1I94 Q;  2OCE A;  4JYA L;  2ALY B;  3K8A A;  1E1O A;  1Q1E A;  1A8V A;  1X3E A;  1YEZ A;  4JBJ A;  4TVA B;  1PA6 A;  5IYB H;  3U4Z A;  4YWM A;  4DV6 L;  3CCQ A;  1SMX A;  2MNA A;  5LMU L;  3G48 A;  3F2D A;  4DR5 Q;  1G6P A;  2IT1 A;  1YNX A;  3PUX A;  4A3K G;  1KQS A;  2WP8 J;  1PH2 A;  2Z0S A;  3T1Y L;  4JC0 A;  1YBY A;  5LMN Q;  1YHQ A;  1HNX Q;  4DR3 Q;  4BXX H;  4A3L H;  2ASB A;  1YVC A;  3CMA A;  1U0L A;  5M3F H;  2E2H H;  2JA5 H;  1VQK A;  5C44 H;  3PUV A;  3F2B A;  4DV5 L;  1YZ6 A;  1L1O A;  2BA1 A;  3K80 C;  1SE8 A;  4JV5 L;  4GLV B;  5M3M G;  4AQY Q;  2OWO A;  4KI0 A;  3HOW G;  1W3S A;  3U50 C;  4OX9 L;  2IHE A;  5FLM G;  1VCI A;  2PQA A;  5C0X I;  3AFP A;  1VQF A;  2V1C C;  3HOZ H;  1JJG A;  2CWP A;  2K50 A;  4JI8 Q;  3HOX G;  4X66 L;  1CKO A;  2OTL A;  1IBM L;  1E22 A;  1SR3 A;  2BA0 A;  2R93 H;  2ZM6 L;  2UXC Q;  4OON A;  3FP9 A;  1EUJ A;  2JA6 H;  3OYY A;  1EQR A;  1LM0 A;  2GN5 A;  4YHH L;  2L15 A;  3A74 A;  4IFD I;  4O0A A;  4BA1 I;  4DUY Q;  1KD1 C;  2AWO A;  2E8G A;  4AIM A;  1VQB A;  1PYS B;  4A3M H;  5DLQ E;  3KJP A;  3T1H Q;  1ASY A;  3HOY H;  4QJF A;  3ULJ A;  1IYJ B;  2KHI A;  2F3I A;  4JYA Q;  2AHO B;  3K81 C;  1TWF H;  1D7Q A;  2E5L L;  2RHQ B;  1H95 A;  1KXL A;  4O2D A;  3CCR A;  1K8A C;  2HHH Q;  3FKI H;  1YIJ A;  2VUM G;  3F1Z A;  3JAM c;  3RR5 A;  1N33 Q;  4DK3 C;  1MIU A;  2PMZ E;  5LMN L;  1KL9 A;  4DR3 L;  5GRO A;  1K8G A;  3KLW A;  3I56 A;  4BY1 H;  2R92 G;  5GAD C;  4X62 L;  1Z47 A;  3GD7 A;  2H5X A;  5BR8 Q;  3PO2 G;  2UXB L;  4DV1 Q;  4GS3 A;  1HH2 P;  4DV5 Q;  1Q81 C;  3RLO A;  2WB1 G;  3L0O A;  4A3D G;  1U5K A;  4UP9 A;  4QIW E;  3ULL A;  4YY3 L;  3L7Z C;  1X65 A;  5GAH C;  1WFQ A;  4LFC L;  1PH6 A;  4OO1 I;  1TXY A;  1X3F A;  3M4Q A;  2NN6 G;  3G71 A;  4GLX A;  1Y14 B;  4FDB A;  3E9I A;  1PH1 A;  1YIT A;  4MZ9 A;  4JI6 L;  4LF5 Q;  4OO1 G;  2UU9 Q;  3I55 A;  4JI1 Q;  1Y1V H;  1N8R C;  3CXC A;  2VNU D;  4JI0 L;  2Q2I A;  4DR2 Q;  1SRU A;  4DAY B;  4JI3 L;  1JE5 A;  4JG2 A;  3GTP H;  1X9N A;  2IY5 B;  1FJG Q;  1N9W A;  2NVT H;  2WFW A;  2GVB A;  5AJ3 Q;  1HNZ Q;  4YHH Q;  4JBW A;  1OXX K;  1E1T A;  2YTY A;  1WCM H;  5C4X H;  4HJ5 A;  1XMQ Q;  5GAG C;  3T1H L;  1VQH A;  4LFB Q;  1GKH A;  1ASZ A;  2B29 A;  5ELO A;  4HJ9 A;  5ELN A;  3M4O H;  4C3I H;  3D31 A;  1QZH A;  3S1R H;  3HOU H;  4X65 Q;  1VQP A;  4LUZ A;  1GVP A;  3F2C A;  4OWT B;  3I4N H;  3VDY A;  1VQ8 A;  4C3J H;  4A3C H;  4P71 A;  3UDX A;  5C4J H;  2E5L Q;  2ZJQ A;  1XMQ L;  5IY0 A;  4LF8 L;  3TRZ A;  3LGJ A;  4A3F H;  3A5U A;  4A3J H;  3CCV A;  2ZTE A;  2K5H A;  1I6H H;  3JAM i;  1PVO A;  1X3G A;  3W1G A;  3OTO Q;  3S17 H;  2CWA A;  4KHP Q;  1C7Y A;  4J15 A;  4IFD G;  3CAM A;  2QEX A;  2HT1 A;  1QUQ A;  5BR8 L;  2JA8 G;  2UXB Q;  3CD6 A;  2QGQ A;  1NTG A;  2Z6K A;  4A3E G;  4A3I H;  3K0X A;  1N36 L;  2AKW B;  1D8L A;  3PIO A;  2RHS B;  1EWI A;  4PZ7 A;  4HJ7 A;  1EYG A;  4BBS G;  4GOP C;  1EIY B;  4R4Q A;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...