2GVAA

Refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding (viral)
molecule keywords GENE V PROTEIN
publication title Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.
pubmed doi rcsb
source organism Enterobacteria phage m13
total genus 5
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gvaA00
2N49A 1CSPA 1EIFA 2ZTEA 3Q8DA 1NTGA 3PSIA 3SGIA 4C3IH 2WP8J 1G291 4QY7A 4JBMA 4LFBL 2E2IH 1VQIA 1YBYA 4YY3Q 4DR5Q 2Q2HA 4DR1L 1XJVA 1N33Q 1ASZA 2LSSA 3HKZE 1N36L 3K0XA 4QGUA 4Y7NH 3I7FA 4DR2Q 1E22A 3CCMA 2IX0A 2RF4A 1PH8A 1SR3A 1HR0L 1CKMA 2H5XA 4RMFA 1A62A 1HR0W 5LMUQ 2JJQA 1LUZA 3KF6A 1KD1C 1SFOH 1K3RA 3KF6B 5C3EH 4TQUS 1SRUA 1YHQA 3NELA 5C3EG 1E3PA 4B3MQ 1XMOQ 2OTLA 3RZDH 4BY1H 3I55A 4BY1G 2BH8A 1YI2A 5GROA 3RNUA 1S72A 5HGQA 4GN5A 5IT9c 3BJUA 4JCVE 4DV0L 3GTPH 4X6AH 4IOAA 2JQOA 1I6HH 1JT8A 4JI1Q 4QQBX 1BKBA 1LTLA 3AFQA 1WI5A 3PO2H 3E9IA 1C9OA 4LUOA 4AQYL 1HZBA 3PO2G 2VQEL 4L5TA 1FL0A 3TQYA 1GO3E 2MO0A 1M90C 4LF7Q 2UUAQ 3K8AA 3PIOA 2E5LL 4YCWA 3DM3A 2HHHL 4X64Q 2CWPA 2LXKA 1BVSA 2Z6KC 4HJ7A 1A63A 1VQKA 4IPCA 2FXQA 4KHPQ 3K81C 2I5LX 3M4OH 3NEMA 3JAMi 1C7YA 4B3SL 1N32Q 1U5KA 5C44H 3S17H 4JV5L 1PH6A 1GM5A 1BBWA 5C44G 2Q2UA 1MIUA 4AIMA 1SN8A 1HZAA 3PGZA 4L5QA 1WFQA 3T1HQ 1KRSA 4OWXB 1PH7A 4OX9L 3F1ZA 3CCVA 1JMCA 1Y1VH 4GN4B 2HIVA 4YWMA 3G71A 1Y1VG 1WOCA 2V1CC 2ZJQA 5M3MH 4DV7L 1L2FA 5EAYA 5M3MG 3OW2A 4JI8L 1CUKA 1PA6A 1A8VA 4JI3L 4WJ4A 5J3BA 2KCMA 4DV2L 5GQOA 1IBMQ 2UUBQ 4EX5A 1E7ZA 3D31A 3G48A 3K80C 5AJ3L 4BA2I 1K9MC 1PH3A 5LMNL 2R6GA 3T1YQ 3H3VI 3J81j 4JYAQ 4X66L 1FVIA 3TS2A 4ME3A 3J80i 3UE0A 1VQGA 2C35B 3ULJA 4DUYQ 1NJIC 4A3BH 3PUZA 3FKIH 1P16A 4A3BG 3F2CA 3FKIG 1PH2A 4A3DH 4DR7Q 2RHQB 3S2HH 4A3DG 3A74A 2IX1A 1J5EQ 3RLNA 4UY8C 1KC8C 3CCUA 4P74A 3U4ZA 4LF8L 1C0AA 4MNOA 2N8NA 3JAMc 1OXTA 1YHBA 3HOVH 4GKKQ 4B3RL 3OTOQ 1PYBA 2RCNA 3HOVG 2GN5A 1GKHA 2ATWA 1CKNA 2ZTDA 4L5SA 4OO1G 1CKNB 4A4IA 5FLXc 1OXXK 4RG1A 1BBUA 1EIYB 3CF5A 4DR6Q 2R93H 3J7A5 1YEZA 3KFUA 2KHIA 2R93G 2KENA 1HJPA 2XGTA 3STBD 4DV1L 4LF9Q 1SMXA 1K8GA 4GKJQ 2UXBL 1S3OA 1VQFA 1NBWA 1JJGA 1SROA 1SE8A 4POGA 4JI0L 1UE5A 1P8LA 3CXCA 1IL2A 4DV6L 4NXNQ 2I0QA 4DV5Q 2K50A 3PUVA 4GLAC 1MJEA 5IYCH 2ZM6L 4PZ8A 2F3IA 5IYCG 2K5NA 5IP7H 1EQRA 1U0LA 4IJHA 3CCQA 4X62L 5IP7G 4LF4L 2NN6G 4GN3B 1VQBA 1HNZL 2A1AA 2YYZA 2JE6I 3HKSA 2IY5B 2VY3A 4A3KH 1OXUA 4A3KG 3J80c 2VQFL 3KF8B 4LFBQ 4JG2A 1XPUA 1XNRL 1VQDA 2XTIA 5E7NA 4DUZL 1YJNA 4DR1Q 1KXLA 2OQKA 3M4QA 1N36Q 2Q2IA 1I3QH 1VQOA 5K36G 4BBRH 3WWVA 1UE1A 1HR0Q 4A3FH 1Y14B 2OTJA 2WB1G 4BBRG 5C0XG 3M7NA 3BZCA 4A3FG 2WB1E 3BU2A 1EWIA 4KLKA 2AKWB 4PG3A 1E1OA 4JI7L 4DK3C 5JEAG 5M5YH 1IBLL 1X56A 1JB7A 1G51A 2AWOA 1K73C 1KIXA 3F2DA 4DV0Q 1IZ6A 2OCEA 4KI0A 5FJ8H 4GOPA 4DR4L 2N78A 2NZHA 4GOPB 3F8TA 5FJ8G 4HJAA 4R1JA 4A75A 3AYHB 1YITA 2JEAI 1YVCA 2PMZE 2QGQA 4YCUA 4AQYQ 4A3JH 4UPAA 2VQEQ 2NVTH 3K7AH 4A3JG 4LF6L 1HH2P 3CW2C 4QJFA 2R92H 2E5LQ 3F2BA 3S1QH 2HHHQ 2R92G 3A5ZB 2UXCL 5IYDH 4C3HH 3S1NH 3CC2A 4A3GH 4Y52H 2EQSA 4B3SQ 4A3GG 4A3IH 4JV5Q 4JBWA 4A3IG 4A3LH 4JBJA 4IOCA 1K8AC 4A3LG 1X3FA 3UDGA 1VQ5A 4OX9Q 3GTJH 4O0AA 2YTXA 3W5OA 4X65L 4BXXH 3VDYA 1PFSA 1OTCA 4NPSA 2ES2A 2UU9L 4DV3L 4P72A 4JI6L 1FJGL 3HOWH 2A19A 4BXXG 1LYLA 1X9NA 4DV7Q 3HOWG 1FGUA 2E2JH 5HY6A 3G4SA 4JI8Q 4K0KQ 3KJPA 4C3JH 4JI3Q 1SLJA 4LW1A 4DV2Q 1VQAA 2B3GA 1I94L 3TEHB 1VS0A 1S40A 3ER0A 1VQ9A 4HIMA 5BR8L 1RL2A 3CCLA 3L0OA 1PYSB 4L5RC 4IFDG 3ULPA 2E8GA 5AJ3Q 2A8VA 3AEVA 3EBEA 4NXML 1EQQA 1E24A 2D0PA 1L0WA 1VQ7A 4UP9A 4TVAB 5LMNQ 2Y0SG 1YZ6A 2Q2TA 2Y0SE 2K75A 4X66Q 4LF5L 1X3EA 2JA5H 1Q86C 3ZJYC 1YJ9A 2JA5G 1WCMH 4PZ7A 1XPOA 2QEXA 1WCMG 4MZ9A 1B7YB 2ASBA 3J7ZC 2NVQH 3GTLH 2F4VL 4OWTB 1Q12A 2WFWA 4HIKA 4JI4L 4OXPA 4LF8Q 4YCVA 3S14H 3HOZH 2VS1A 3HOZG 1X3GA 2E2HH 1VQCA 4B3RQ 4YWKA 3U50C 1QVGA 3ULLA 3KOJA 5C4JH 4ALPA 3M4PA 5ELNA 2MQHA 4C2MH 2F52A 2AHOB 5DLQE 4DV1Q 2WAQG 3CMAA 3M3YH 2WAQE 1EFWA 2UXBQ 3PUYA 4A3MH 3FP9A 2VW9A 1VQJA 4A3MG 2HIXA 4LFCL 3DLLA 1EYGA 1JJ2A 3CC7A 1XNQL 2JA8G 5JJIA 1PH1A 4JI0Q 3S1MH 4DV6Q 1JJCB 4IPHA 4UP8A 3M9BA 5FLMG 3GO5A 3GTQH 2ZM6Q 3CP0A 3I56A 4JBKA 1UWVA 1IXRA 5C0XJ 1VQPA 2YTVA 2AMCB 1HNZQ 4LF4Q 1YIJA 3E9HA 2HT1A 1KAWA 2MO1A 2NZOA 4JI5L 2VQFQ 4EQ5A 5JEAJ 1OXVA 5IWAL 3RN5A 1XNRQ 1PVOA 4DUZQ 4GLXA 1PH9A 1IBKL 2I5MX 4LFAL 1VQ6A 3RLFA 4OONA 2K5HA 1VCIA 2EIFA 4YHHL 1TXYA 1YJWA 2L15A 1N34Q 4JI2L 3PV0A 4AYBG 1PHJA 5H1SE 4AYBE 2HQLA 1NMGA 4JI7Q 4IJLA 3GDEA 1IBLQ 4R4TA 2KHJA 4A76A 1N8RC 3NENA 4DR4Q 4POFA 2BA0A 1MKHA 2MNAA 2ID0A 4AH6A 1NE3A 4GKKL 4B3TL 4DPGA 3S15H 2JK8A 3PUXA 4J15A 3I2ZA 4R4QA 1K0RA 2PI2A 5M3FH 1W3SA 4GOPC 4LF6Q 2JA7H 5M3FG 1ASYA 2JA7G 2BH2A 4DK6C 2UXCQ 1V9PA 4UP7A 1QVCA 3M85A 2CKZB 2VL6A 3KDFA 3LGJA 5GAGC 3KDFB 1HZCA 3TREA 2VNUD 4DR3L 4LUZA 3TRZA 1KHIA 1T9HA 2NVYH 4IPDA 4YWLA 1PH4A 3CCJA 3PCOB 3I4NH 1V43A 3I4NG 4X65Q 4PZ6A 4OO1I 1I50H 2UUCL 2CFMA 4IFDJ 2UU9Q 4DV3Q 1VQ8A 4JI6Q 1FJGQ 4O2DA 3UDXA 1MJCA 4XTCS 1QVFA 2UXDL 3RLOA 4IPGA 1HNXL 2KCTA 2GVAA 3K7UC 3CCRA 3B6YA 1I94Q 3GTKH 1KQSA 1XMQL 4DKAC 1V1QA 3HKZG 2D62A 1HZ9A 5BR8Q 1G6PA 3GD7A 4DV4L 2CCZA 3PUWA 3GTGH 4LNQA 1WYDA 1HNWL 4NXMQ 2YV5A 3HFZB 3H3VH 2QA4A 1TWGH 1Z9FA 1UE7A 3CAMA 1QZHA 4LF5Q 4HIDA 1X6OA 2NN6I 4BBSH 1H95A 4NB3A 2R7ZH 5C4XH 1Y1WH 4BBSG 1NY4A 2D0OA 4R4IA 1E1TA 2R7ZG 5C4XG 4GNXC 1Y1WG 2VZAA 2BA1A 3KYHC 4YY3L 3H15A 1J6QA 2IHFA 4QIWE 4DR5L 3PF4A 3MEFA 4WJ3M 1R9TH 2ZJPA 1N33L 2F4VQ 4LWCA 4A93H 4JI4Q 4DR2L 5JJKA 2DUDA 3GTOH 4A93G 1X55A 5IYBH 3FHWA 3CPWA 4GNXA 2VUMH 3HOUH 2PNHA 5IYBG 5C0XI 4GNXB 3EIVA 1KRTA 5LMUL 2VUMG 3HOUG 1VQEA 4GLVB 1IYJB 2CQOA 1QUQA 4B3ML 1XMOL 1QUQB 1XPRA 2N3SA 1UE6A 4BA1I 2RHSB 3PIPA 2B63H 3UDIA 4A3CH 2B63G 3RN2A 4APVA 3CC4A 2ZJRA 1B8AA 2CWAA 3W1BA 3I4MH 4A3CG 3G6EA 2K5VA 4JI1L 3I4MG 4LFCQ 1XNQQ 1N9WA 2Z6KA 5GAEC 2YU9H 1UEBA 3D0FA 1CSQA 3L7ZC 2JA9A 1AE2A 4LF7L 2GVBA 1A0IA 2UUAL 4PMWA 1NMFA 3CQZH 4X64L 5IY0A 5IP9H 1YHAA 5GADC 3J81i 1I5FA 5IP9G 3U58A 3GTMH 4KHPL 4K0KL 3KJOA 1N32L 4HIOA 3EN2A 3S24A 2MFIA 4OWWB 4JI5Q 4JOIC 2OQ0A 3S2DH 4LUVA 2JEBI 3ERSX 4H02A 5IWAQ 3T1HL 1VQMA 1VQNA 1IBKQ 1TWAH 1M1KC 1YNXA 4LFAQ 2PI2E 2YTYA 4P73A 3I4OA 5FLMH 2NVXH 2I5HA 4YHHQ 2K4KA 3S16H 4JI2Q 1XTDA 3OYYA 4DNIA 5LMNW 4JOIA 5GAHC 1Q46A 4X62Q 3ICEA 1Q82C 1VQHA 2JA8H 3RZOH 2ZTCA 1QZGA 3KLWA 3TS0A 1IBML 2LXJA 1OXSC 2UUBL 1JE5A 4A3EH 3AQQA 1B70B 2K52A 3E0EA 3RR5A 4DAYB 3UDFA 3CCEA 4A3EG 1Q8KA 1W2BA 1PH5A 4IFDI 1LM0A 1AH9A 3CPFA 3CMEA 1EUJA 1X65A 3W1GA 1TWCH 3BZKA 4R4CA 3T1YL 4B3TQ 4JYAL 4DUYL 4P75A 1KL9A 4DAMA 3S1RH 3NBHB 1VQLA 2JA6H 3A0JA 1AE3A 4DR7L 4HJ9A 4KHZA 1J5EL 2Z0SA 2JA6G 1Q1EA 4HJ5A 3J81c 2EXDA 2PQAA 4DR3Q 2PQAB 1L1OC 2K14A 4BY7H 4BY7G 5ELOA 3L2PA 1PV4A 1Q1BA 3OTOL 3H0GH 4R4OA 1D8LA 3H0GG 1Q7YC 5M5XH 1TWFH 2UUCQ 2R7FA 4QL5A 4DR6L 4MTNA 4P71A 1L1OA 1K83H 1Z47A 4JC0A 1L1OB 3U4VA 3UE1A 1RIPA 2IT1A 2UXDQ 4LF9L 1Q81C 2B29A 3HOXH 3AFPA 1HNXQ 3PO3H 4GKJL 5IE8A 4FDBA 5IYDG 3HOXG 3PO3G 2OWOA 1GD7A 3STBC 4HJ8A 2IHEA 1XMQQ 4GS3A 3CCSA 2ALYB 3PF5A 5JJLA 1DGSA 1GVPA 2DGYA 4NXNL 2R7DA 2KBNA 4DV4Q 1VQ4A 1HNWQ 4DV5L 1WJJA 1CKOA 1TWHH 3HOYH 1X54A 1N34L 3CD6A 5M5WH 1D7QA 4XIGS 3A5UA 3IRBA 2AWNA 3HOYG 4IO9A 3MXNB 3JC66 1EOVA 1O7IA
chains in the Genus database with same CATH superfamily
1WTPA 2H1EA 4HMIA 3Q8DA 3PSIA 3TMEA 3NXWA 1F9RA 2EYJA 3HKZE 1NCVA 4RKBA 5KIXA 4QGUA 5KGUA 4Y7NH 4FP5D 3CCMA 1PH8A 1BCPF 1A62A 1HR0W 1LUZA 3KF6B 4XQNA 3U9OA 1HFNA 3RMHA 1XMOQ 5GROA 3FMCA 5KYIA 2F0EA 4X6AH 4ZRZA 4IOAA 1R4PB 2JQOA 1I6HH 4JI1Q 2RBMA 3I73A 5CV9A 1LTLA 1WI5A 3HOXB 3E9IA 3PO2H 4AQYL 2F3VA 3PO2G 2AQ3B 2QKIC 1UNSA 3K8AA 3PIOA 1GUWA 3C1FA 4EQOA 2Z6KC 3M4OH 5FKAC 3JAMi 5C44H 3S17H 4JV5L 1PH6A 1DXMA 1O7LA 5C44G 1O7ZA 1MIUA 3VR3A 1HZAA 1QJOA 1EU3A 2IW3A 5E4XA 3CCVA 1JMCA 2HIVA 1Q3LA 3BYYB 1WOCA 2F0KA 1A8VA 1GJXA 2KCMA 4DV2L 1IBMQ 2P5ZX 2UUBQ 1E7ZA 2XRSD 4KKSA 1SNDA 2Z1CA 1QB5D 5LMNL 2R6GA 4Q5VA 4F87A 3T1YQ 3H3VI 1I6HB 4JYAQ 3DMUA 1Q90A 3E5SA 3TS2A 2JYOA 3PUZA 5HURA 1PYWD 1KLUD 1LLRD 3X3MA 3F2CA 4A3DH 4A3DG 2V4DA 3RLNA 1KC8C 3A8JE 4RGTA 4P74A 3U4ZA 1HTPA 1C0AA 5D3DA 3JAMc 2N8NA 1MD2D 3HOVH 4GKKQ 1X32A 1Y69U 1SNOA 1PYBA 2RCNA 3HOVG 1K0SA 4CGYB 1GKHA 2EY2A 2ATWA 4L5SA 2A73B 1CKNB 2VB2X 5FLXc 4RG1A 4CHTB 4IALA 3TP5A 2BDOA 1HJPA 2XGTA 3STBD 2F0GA 1KTKA 1RTOA 1SROA 4POGA 1RF2D 4UAIA 4JI0L 1ZXTA 1WCMB 4NXNQ 2J7ZA 4U68A 4N8X1 3G6JB 2I0QA 3Q24A 3PUVA 3VR4A 2K5DA 2ZXRA 1Y8NB 2F3IA 2NN6H 4IJHA 2LY7A 2NN6G 4GN3B 1VQBA 2A1AA 2JE6I 3TZUA 1OXUA 3KF8A 2OF1A 4QMGA 1B50A 4EQNA 5E7NA 3M4QA 1I3QH 3M3YB 3R93A 4DF7A 1HR0Q 3MTSA 2JA8B 4C56C 4R8IA 1EWIA 4KLKA 1PLFA 3DWAA 4PG3A 5M5YH 1K73C 3P7JA 4KI0A 4DR4L 5FJ8H 4DK1A 2F3WA 2NZHA 5FJ8G 2QDBA 4HJAA 1LT5D 3SK8A 2PMZE 5EQ0A 1NR4A 3BDCA 4YCUA 1SXTA 5KRUA 3Q23A 1NSNS 3F2BA 4K8JA 2HUGA 3CC2A 4Z9CB 4Y52H 2RSNA 4A3IH 4JBWA 4RHSA 4A3IG 4A3LH 2A68C 1K8AC 4A3LG 3UDGA 1XYIA 5FK9C 2SOBA 4O0AA 2YTXA 4ZUJA 4KY7A 3VDYA 1PFSA 5M9OA 1CZGA 1OTCA 3MXGA 3HOWH 1ZYRC 1FJGL 1I3QB 2A19A 3HOWG 4DV7Q 2E2JH 3IFTA 5HY6A 5KNDA 4JI3Q 3BVZA 1LV9A 4ZCKA 1QNUA 5COYA 1ET9A 1S5ED 1IL8A 2B2WA 3TEHB 1VQ9A 2GA4B 3JAML 1B4OA 5AJ3Q 1E24A 2D0PA 4LAAA 2Y0SG 4IUUA 2A6EC 2XNAC 1SMYD 2EYFA 4X66Q 5FLXL 3ZJYC 4CDEC 3GP7A 2QEXA 1B7YB 3L3OC 4H13C 3J7ZC 4OWTB 1Q12A 2M00A 2L55A 1KLGD 4I7AA 2NWGA 4A3IB 2OT2A 4KN4C 2G5DA 3U50C 2E76C 3NSWA 5C4JH 5ELNA 3GV6A 4OL7A 5J1ZA 2F52A 1AZPA 1V8QA 4MN3A 1H9KA 1SNCA 4FO2A 2E2JB 3FP9A 1CM9A 1VQJA 1Y8PB 2HIXA 4LFCL 3DLLA 1JJ2A 3CC7A 1PH1A 4CJ0B 4DV6Q 1JJCB 3I8ZA 1U4RA 1R9TB 3GTQH 2ZM6Q 4JBKA 3MC0B 2QEJC 2Y0SB 4Q0FA 3R8BA 1ENFA 1C48A 4HCSA 2IX3A 2KVMA 4KN7C 2EJMA 3I4LA 2VQFQ 5IWAL 1CTMA 2EYHA 1BF4A 2B63B 5EJWA 4OONA 3N52A 4U673 1VCIA 2EIFA 2B8FA 1RDPD 1PHJA 4AYBE 5ELFA 2HQLA 1NMGA 1K3BC 3FRPB 1GUSA 4IJLA 3GDEA 4KD4A 5C4JB 2BA0A 1MKHA 4GKKL 4DPGA 2X69A 1I4XA 1W3SA 2JA7H 1ASYA 2IWHA 2JA7G 1H9SB 1DZ1A 4E6IA 1HXYD 3M85A 3GTQB 5KYLA 5IOCA 3TRZA 5ELBA 2NVYH 4YWLA 4DAVA 1JCKB 2MUYA 1QE6A 2XN9C 3D6WA 4X65Q 3JAME 1F77A 1D5XC 2CFMA 4DV3Q 4JI6Q 1V1PB 4K2LA 4O2DA 1O78A 4B9WA 1MJCA 1QNKA 4XTCS 1HNXL 5FLXE 2EYOA 3K7UC 1OO9B 2K5WA 1I94Q 4DKAC 3A7LA 3OIPA 5LL6S 2DY7A 4CJ2C 3H3VH 1Z9FA 2B2WC 1QZHA 4CKBA 4HIDA 1X6OA 1K8OA 5C4XH 1D6EC 3G7LA 5C4XG 4GNXC 3SE0A 2JA7B 1LTGD 2BA1A 2X6GA 4DR5L 2IHFA 4QIWE 1N33L 2F4VQ 4JI4Q 4DR2L 2DUDA 1BOSA 1X55A 5IYBH 2VUMH 2PNHA 5IYBG 4OGQC 4EQPA 2VUMG 2BOSA 2CQOA 1QUQA 1B44D 1HPCA 2RHSB 2F03A 3OOCA 2BE5D 3UDIA 4APVA 1WD1A 3CC4A 3W1BA 2CWAA 3G6EA 4QUFA 1BNZA 1A2TA 4G4KA 1XNQQ 1JQYD 1A0IA 1NMFA 4X64L 5IY0A 1KAAA 5GADC 2NBFA 2XIWA 1N32L 4FXGC 1ILPA 3WDNA 3T51B 1ENAA 4NW2A 2OQ0A 5C4XB 4LUVA 3T1HL 5EBCA 1M4VA 1IBKQ 1YNXA 3MXUA 4LFAQ 2PI2E 3I4OA 2L11A 1MSGA 4YHHQ 2K4KA 3S16H 5LMNW 1EYCA 2F0MA 4X62Q 2VUMB 3DWPA 5D65A 3ZYYX 1HUNA 1QZGA 3TS0A 1JE5A 3H91A 3AQQA 3RR5A 4IFDI 1Q8KA 3R3OA 3CMEA 4FF2A 1TWCH 3VA7A 1EIHA 2NZ1D 4RGOS 2JXMB 4L6TB 5CV6A 4G7ZC 1F9QA 1STNA 4P75A 1KL9A 2DNCA 3VR5A 2JA6H 4DR7L 1LTBD 4HJ9A 2JA6G 2Z0SA 4NMZA 1A15A 2SEBD 4BY7H 3SR1A 5FOBB 4BY7G 5EKKA 1Q1BA 3BVGA 3H0GH 4R4OA 2WINB 1PZKD 3H0GG 5M5XH 1PTOF 5JAVA 4IUQA 1EEID 3QG1A 2IT1A 4LF9L 1Q81C 4ZUIA 3AFPA 1GD7A 5KNCA 3CCSA 3PF5A 5JJLA 4DV4Q 2KBNA 1HNWQ 4DV5L 1TWHH 2FMCA 1SNQA 4FYDA 3A5UA 2AWNA 1BCPC 2A69C 1JC7A 1XWEA 1CSPA 1EIFA 1NTGA 1G291 3K59A 2KCNA 4JBMA 2E2IH 4YY3Q 4DR1L 1G2SA 1BO0A 3F2UA 4OEMB 3TSSA 1E22A 2IX0A 5BN5A 1SR3A 4XQQA 4L8JA 4RMFA 2QF7A 4DGZA 5DM73 5LMUQ 2JJQA 3CRKC 2ZXOA 1YHQA 1SRUA 2OTLA 3I55A 2OXPA 1ZEQX 1YI2A 4HEDA 1TQOA 4QUCA 2XWJB 1U4MA 2K04A 3BVMA 4GN5A 4DV0L 5C4HA 3K0YA 2EYPA 1JE4A 2WACA 4QQBX 1C9OA 2VQEL 4L5TA 1FL0A 3TQYA 3RD4A 2MO0A 1M90C 4LF7Q 2A6HC 2E2DC 4YCWA 2HHHL 1A63A 1FGBD 2CWPA 2LFNA 2LXKA 3D3RA 4TKOB 5LHY1 2WB1B 2EDGA 4BBRB 3IAYA 3T4AC 4KHPQ 2H4OA 1C7YA 1MSHA 1U5KA 2PZUA 1T5EA 1GM5A 2Q2UA 1U9RA 1AZQA 1SN8A 2FFKB 4L5QA 2Z8LA 1WFQA 1PH7A 4OX9L 1Y1VH 2AQ1B 4YWMA 5IIFA 3G71A 1Y1VG 1Z6HA 2K32A 2V1CC 1L2FA 5EAYA 4KKTA 3OW2A 4JI8L 3BDLA 2NVTB 1PA6A 3P1HA 5GQOA 1PTOH 1G2TA 3D31A 3NK9A 3K80C 3S1NB 3CKIB 2K28A 5C3XA 5CYUA 4UDUC 1ILQA 4FF4A 4ME3A 3J80i 3TP6A 1RHPA 1PFBA 2AUKA 2C35B 1TY2A 1PXUA 3OW7A 4DUYQ 1P16A 1EY8A 2RHQB 3S2HH 1J5EQ 2RKSA 1G8ZD 4MNOA 1PRTB 2RDGA 3NP8A 4RA8A 2AQ2B 4DFAA 1LTAD 4FF3A 4B3RL 3CRLC 2GN5A 4ME5A 2D2CC 1EIYB 1G6ZA 3CF5A 3SVMA 1GUOA 1CFMA 1EY5A 1TY0A 2KHIA 3KFUA 4DV1L 1GOZA 2PZTA 4GKJQ 2PPBC 1JJGA 1S5FD 3OMCA 1P8LA 1UE5A 1DD2A 3V2TA 4QF4A 3H6MA 2NVQB 5I2YA 3QO2A 3S14B 1ONLA 1U0LA 5CR3A 4X62L 4RGNA 4CDDC 1HNZL 2VY3A 2QILA 1RD9D 1E0BA 3J80c 3KF8B 4LFBQ 2K7VA 4JG2A 4XT1B 3SK4A 1XNRL 3SHLA 1YJNA 1KXLA 1EY7A 2KHSA 2C5CA 2WAQB 3I91A 2Q2IA 1VQOA 1A6XA 3R2IA 1DONA 2J4XA 5FO8B 5JEAH 4JI7L 1E1OA 5JEAG 2KUMA 4FNFA 1IBLL 1JB7A 1LT4D 1LT6D 2OTJA 1KIXA 1IZ6A 1I4GA 2OCEA 4GOPA 1EL0A 2PYKA 5IGFA 3OWFA 1YVCA 2QGQA 1EYDA 2KECA 4FXDA 3ONAB 2IPKD 3CW2C 4QJFA 2R92H 2E5LQ 2R92G 3A5ZB 3NUCA 4OELB 4B3SQ 2HD3A 1GUGA 4XYQA 4JBJA 4X3UA 1KDCA 3W5OA 1O7YA 3BYTB 3QJYA 3EROA 3IL8A 4LK1C 4NPSA 2UU9L 4P72A 1X9NA 1EIGA 1YNNC 4G7HC 3S15B 3M4YA 4LW1A 1S40A 3NTHA 1I4QA 3CCLA 5BR8L 4IFDH 3L0OA 4IFDG 3EBEA 4NXML 4UP9A 4K5WA 4TVAB 1PRTD 3GV3A 5J39A 2Y0SE 4LF5L 4F88A 2Q8TA 2F0NA 4KTAA 1WCMH 1XPOA 2R92B 1WCMG 4MZ9A 2EVBA 4V0BA 1EWHA 4LF8Q 4OXPA 1VQCA 4RGMA 1PTOD 3ULLA 1KNEA 3KOJA 4X3KA 4ALPA 2Q8RE 4KY5A 4KJOA 4DU9A 5DLQE 4F7XA 2KEDA 1A3TA 1U4LA 3M3YH 2UXBQ 4R8NA 3J80L 4BBSB 2JA8H 5JJIA 5JVG3 1E2VA 2JA8G 3AU7A 4IUNA 2F0HA 4CBVA 4J1MA 1JORA 2EZVA 2B8GA 2B2UC 4N9PA 4LF4Q 2G9DA 2AMCB 2YTVA 1HRJA 1YIJA 2JN4A 1KAWA 4G57A 5BN4A 2MO1A 4JI5L 1FD7D 4EQ5A 2F0UA 1PVOA 3I70A 1F2MA 4DUZQ 2EYMA 1VQ6A 3RLFA 2F4IA 2K5HA 2AUJD 4JI2L 1PZJD 4MIUA 4RCNA 4CJ1B 1SYDA 3WOFA 2Z4IA 1PMRA 1QOHA 2KHJA 4ABNA 1D5MC 4POFA 2R61A 2MNAA 2ID0A 1HUMA 4ZQ3A 1NE3A 5E1FA 3SK5A 4B3TL 1JOQA 4J15A 2ENBA 4R4QA 4GOPC 1K0RA 2PI2A 4LF6Q 2PNRC 3OHXC 2E74C 4KD3A 2UXCQ 4ZYSA 3MEHA 1V9PA 2VL6A 3LGJA 3TREA 1KHIA 3CCJA 2XVSA 1V43A 3MWYW 4OO1I 5HGTA 1WD0A 2WIIB 4IPGA 1IW7C 2KCTA 2XSCA 4KHVA 2QCPX 3NHHA 4RAUC 2PO4A 3HKZG 1KABA 3AB9A 1HZ9A 5EPLA 4FXKC 3K57A 1CHPD 4LNQA 3OMGA 1J9OA 3DM1A 1TWGH 4EGVA 3KLSX 1UE7A 2K05A 3CAMA 1N36L 3TP7A 1ET6A 4R4IA 3LX0A 1SYCA 3PF4A 5IGDA 4WJ3M 2DJFC 3MEFA 1R9TH 3LNNA 2NYZD 3J80E 3PO3B 3Q6SA 3CPWA 4GNXA 3HOUH 5C0XI 3EIVA 3HOUG 1VQEA 1IYJB 1SE4A 3QR8A 1F2LA 1XMOL 1QUQB 1XPRA 3EJIA 4HCEA 3N6RA 1LTID 3KBXA 4C1NI 1UAPA 1F2YA 3KLRA 2B63H 3HOYB 5M5WB 4WRDA 2B63G 1K8MA 3V05A 1B8AA 2G9HD 1HA5A 2K5VA 4JI1L 3I3CA 5C5LA 2L12A 4FVMA 1CSQA 3L7ZC 3HKZB 2GVBA 1S5CD 2ZT9C 5IP9H 1YHAA 3D4DA 3J81i 1I5FA 5IP9G 3C2PA 1JB3A 3KJOA 1TWGB 3EN2A 2C9OA 1SFOB 1YNJD 3DWQA 4OWWB 3RZDB 2JEBI 4H02A 3TZDA 1D1IA 5T1IA 1XTDA 3OYYA 2O2LD 4DNIA 5DM63 4RFBA 1Q46A 4KV6A 4TSSA 3HOUB 1VQHA 5DNFA 1X3QA 3RUZA 1IBML 5CV8A 4C1NK 5AFWA 2UUBL 5I6YA 4HSPA 4DAYA 1S5DD 5JOBA 3URYA 4K8IA 1EYAA 3UDFA 4K6LA 1DOMA 1B53A 3T1YL 5CV4A 4JYAL 2K01A 4DAMA 1STGA 1FNWA 4X3SA 4KHZA 4WORA 4BS9A 4JK1C 5M3MB 1Q1EA 2MHVA 3J81c 2PQAA 4DR3Q 1L1OC 1TS3A 2M2LA 1D8LA 1Q7YC 5A35A 4OIJA 2R7FA 2UUCQ 3UE1A 3A54A 2UXDQ 1CQFA 5FO9B 2B29A 5IYDH 3V96A 3VR2A 5IE8A 5IYDG 2OWOA 1STHA 2SNMA 3STBC 4A3BB 4HJ8A 2IHEA 1XMQQ 3FKIB 4NXNL 1VQ4A 1X54A 1SYGA 4XIGS 3K5LA 3MXNA 1JR0D 1O7IA 3TP8A 5IODA 3SGIA 4C3IH 3NWSA 4QY7A 1MBYA 1BUVT 4C3IG 1I4HA 5IGGA 1YBYA 2Q2HA 2R93B 1ASZA 1R4QB 2LSSA 3I7FA 1HR0L 2A6HD 1KD1C 5C3EH 1ESFA 4TQUS 5C3EG 4B3MQ 3MFYA 1S72A 2PQEA 3EFXD 3NWTA 5HGQA 5IT9c 3GTPH 1GHJA 3VYSA 3E6ZX 5CV7A 5BN3A 4ZKCB 3AFQA 4MTKA 1WTWA 4QCLA 1D1KA 3K5MA 1HZBA 1B2TA 1GO3E 4NKLA 2UUAQ 3PMFA 3DM3A 1RJTA 4HJ7A 1MGSA 4IPCA 2FXQA 3K81C 2I5LX 4A3FB 3NEMA 4NDXA 2EOTA 4M1UB 1HTLD 4B08A 4AIMA 4C3IB 2JP1A 1KRSA 4OWXB 5CBAE 3F1ZA 4GN4B 5TSSA 2PMZB 2F0DA 4DV7L 3T56B 1WVLA 1CUKA 3LWEA 4A3JB 4JI3L 3K7AB 4WJ4A 5J3BA 3NTIA 5C3EB 3NQIA 3P75A 1STEA 3S1QB 3R2TA 4EX5A 4C3HB 3J81L 5AJ3L 1QILA 5E3FA 3HP3A 3GTPB 4BA2I 1K9MC 1PH3A 3J81j 4X66L 2CW0D 1TR5A 3UE0A 3ULJA 1NJIC 3GTJB 1Z7TA 3MHBA 2LS01 3A8IE 3O13A 3A74A 2IX1A 4UY8C 1EQVA 5IGCA 3CCUA 2F0SA 1SSOA 3A56A 1OXTA 1YHBA 1TT2A 5FO7B 3OTOQ 3BDOA 1F2ZA 1PRTF 4OO1H 4OO1G 4PMCA 2B39A 1LTRD 4A4IA 1EY9A 1BBUA 4DR6Q 2FHTA 4JVZA 1IKMA 1SMXA 3SDZA 2K5QA 3QOJA 2HDMA 4ULLA 2ICEC 3CXCA 1IL2A 4DV6L 1I6VC 1KDAA 4LMQD 5EBDA 2CVRA 3GTLB 2B2YC 4GLAC 1MJEA 2L4NA 2PW5A 2ZM6L 3S9WA 5IP7H 1S5BD 1SJED 2F0OA 1RKNA 5IP7G 2YYZA 3HKSA 4JPBW 4K14A 5IT9L 2VQFL 5L37A 1XPUA 1DOKA 1VQDA 3FPUB 2OQKA 1N36Q 5K36H 2F0QA 5K36G 5C0XH 4BBRH 3WWVA 1UE1A 5K5PA 4A3MB 1Y14B 1TS2A 2WB1G 3CHBD 4BBRG 3BZCA 5C0XG 2AKWB 4R9WA 5IGEA 3S1MB 1SBBB 1X56A 2AWOA 3MXPA 1RCVD 1SYFA 2FINB 1FR3A 3F8TA 4GOPB 4A75A 2JEAI 3NBIA 2F0PA 4AQYQ 5DAUA 2NVTH 4HN7A 4EVOA 5D14A 1NNXA 2EY1A 3Q0AA 3EA6A 3SXHA 3S1NH 5DEHA 1BR9A 4DK0A 1AP0A 2EQSA 4AYBB 4JV5Q 4O1NA 1CZWA 4IOCA 1X3FA 5G3LD 4ZLTF 1VQ5A 3J81E 4X65L 4K2KA 1EZ8A 1K28A 1NUCA 2KQ3A 4BXXH 2ES2A 4BXXG 3W2DA 4DV3L 1KNAA 4JI6L 1FGUA 3G4SA 4K0KQ 3MA2B 2F0IA 4C3JH 4C3JG 4DV2Q 1VQAA 1I94L 1RL2A 2RDFA 1EQQA 1L0WA 5LMNQ 2Q2TA 1YZ6A 4IZ8A 1X3EA 1IYVA 1Q86C 1E2WA 1CA5A 1SYBA 1I50B 4PZ7A 4K5VA 1XXGA 2ASBA 2NVQH 4N8FA 2F4VL 4HIKA 4JI4L 3S14H 3HOZH 2K1BA 2VS1A 3HOZG 1GUTA 4IUVA 3DXJC 1TIID 1EZ6A 3DEPA 2D5DA 3M4PA 3MZ5A 3HZXA 2PCFB 4MHEA 2WAQG 3CMAA 3PUYA 5E4WC 2VW9A 2R7ZB 1Y1WB 1XNQL 5IT9E 4C3JB 4JI0Q 3SK6A 4QIWB 4IPHA 4UP8A 1GUNA 5FLMG 3GO5A 1PFMA 5I9PA 3OWEB 1STBA 4A93B 5ELEA 1B3QA 1UWVA 2X6LA 1VQPA 2O4XA 3E9HA 1SJHD 1LTSD 2NZOA 5JEAJ 3RN5A 3FDTA 1FYCA 1PH9A 4XT3B 1IBKL 2B2UA 2I5MX 4J8QA 4LFAL 3DHQA 4YHHL 1TXYA 3I4MB 1YJWA 1LO5D 2L15A 1N34Q 3HOZB 5NUCA 3H94A 1LT3D 3HEJA 4RKLA 2KJXA 4A76A 3CQZB 3NENA 4DR4Q 5C6AA 2B2TC 3LWUA 4X3TA 1EY6A 3S15H 2JK8A 3PUXA 1DOLA 3NTKA 3E0JA 3I2ZA 5I4DA 5M3FH 5I9OA 5IGBA 5M3FG 1TWAB 2BH2A 4DK6C 2KEEA 2CH4W 2A68D 2L9HA 3KDFA 1I4PA 4FF1A 1T9HA 3P20A 4IPDA 2RA4A 3RZOB 2LKVA 3A7AB 4TRDA 3PCOB 1ZYRD 5EGTA 1PFNA 4A3EB 1S4ZA 1HQMC 4IFDJ 1NAPA 1VQ8A 1FJGQ 1L0XB 1WTHA 3ND8A 4LJZC 1QVFA 2GVAA 3FVQA 5A2QL 1M8AA 3B6YA 4XDXA 3CCRA 1KQSA 3S1RB 1B3AA 1V1QA 2D62A 1G6PA 2A6ED 4DV4L 1QG7A 2CCZA 3PUWA 3GTGH 1HNWL 2YV5A 4KMUC 3HFZB 2QA4A 2EY6A 4OIKA 1EY4A 4BBSH 4NB3A 4BBSG 2VZAA 5M3FB 1TWFB 3KYHC 4YY3L 1J6QA 4LWCA 2KCCA 3GTOH 2NB0A 3PIP3 4GNXB 5LL6X 5LMUL 4GLVB 1BDOA 4NP5A 4UHVA 2FMMA 4L63B 4PNYA 2N3SA 4DNTB 4GZYC 3HS0C 4A3CH 2XRQD 4A3CG 2ZJRA 1AN8A 2K33A 2D9UA 4LFCQ 4HAEA 3QWNA 4PQXA 5GAEC 1RTNA 3H3VC 4B9XA 5KNBA 1EEFD 4RHRA 3T53B 2OEOA 4LF7L 1LABA 3AMUA 2RVLA 1FNVA 2F0FA 4Y7NB 3GTGB 1XTCD 4KHPL 3ITPA 2L5TA 4K0KL 1II3A 4HIOA 2MFIA 4PV1C 3K5NA 1EY0A 4JOIC 5IWAQ 1A3UA 1VQNA 2NTTA 1M1KC 2LMCB 2I5HA 4HMJA 2RSOA 3GTOB 4I65A 3PO2B 3QB3A 1Q82C 1U4PA 3BZDB 2IL8A 1G91A 2WKCA 4WFN3 3KLWA 3C1EA 2LXJA 1OXSC 4WJWA 1UUPA 4DAYB 2K52A 3CCEA 3M4OB 1AH9A 4DA2A 1QCBD 3CPFA 4KKUA 1EUJA 3W1GA 1DCZA 1JOKA 4IN3A 3BZKA 4R4CA 5C44B 3S17B 1ESRA 2SNSA 2N88A 2ZXPA 2QDLA 4OHJA 1D2BA 1MHWC 4DUYL 3HGBA 3NBHA 1WTXA 4ILWA 3A0JA 1J5EL 3TN2A 2K03A 2EXDA 1EFID 2PQAB 4DXGA 5A2QE 1STAA 4KK7A 3L2PA 1PV4A 4HSVA 1SE2A 4IURA 1JOOA 4QL5A 1TU2B 1L1OA 1K83H 1O80A 4JC0A 3U4VA 2EY5A 1AFPA 1RIPA 3BG3A 1HNXQ 3PO3H 4GKJL 3SEBA 3PO3G 1QWYA 4DXFA 2CH4A 1SNPA 2XWBB 3TDQA 1GVPA 1VDZA 4A3DB 5J22A 1WJJA 1CKOA 3HOYH 1N34L 3CD6A 5M5WH 1VMCA 3IRBA 4ID6A 4DN4M 4IO9A 3HOYG 3MXNB 3JC66 3HOVB 1RODA 2N49A 2ZTEA 2EJFC 2I46A 2WP8J 5JVH3 4LFBL 1VQIA 4DAPA 4DR5Q 3NE5B 1XJVA 1BCPB 1N33Q 1H9MA 3K0XA 4DR2Q 2RF4A 1GXDC 1CKMA 2H5XA 3OSOA 1JWSD 3KF6A 1SFOH 1K3RA 3NELA 3HG9A 3NPPA 4KJNA 1E3PA 4KY6A 4BY1H 3RZDH 4BY1G 2BH8A 2MJ8A 3RNUA 3BJUA 4JCVE 3J7AF 1K83B 3PIO3 1JT8A 2N55A 1BKBA 5C5MA 2E75C 1AEXA 4LUOA 2O5IC 3T13A 3J7YW 2E5LL 4H7BA 4X64Q 1BVSA 2RQXA 1VQKA 4J6HA 1Y8OB 4CKCA 2FJ2A 4B3SL 1N32Q 1BBWA 2J0TD 1CA6A 1DYQA 2VXWA 3PGZA 4IUTA 3T1HQ 5M5YB 1NR2A 4H0LC 4IQZA 3X3NA 2ZJQA 5M3MH 5M3MG 2NUCA 2DY8A 1LACA 4BY1B 3M7GA 3G48A 2KA7A 4YIJA 5CBEE 5G3LF 3IKJA 1DJRD 1JWMD 1ICWA 1A3VA 2TSSA 2HDLA 1L0YB 1FVIA 2MP1A 1VQGA 3C3LA 1PRTC 4A3BH 3FKIH 4V190 4A3BG 3FKIG 1PH2A 4DR7Q 1SE3A 3HOWB 3VYUA 4LF8L 2IJ0A 1CKNA 2ZTDA 5C4ZA 1OXXK 2R93H 3J7A5 1YEZA 1PTOC 2R93G 2SDFA 2KENA 3PQIA 4LF9Q 1K8GA 1STYA 2UXBL 1S3OA 1PZID 1VQFA 1NBWA 1CK1A 3KK7A 1SE8A 1EOTA 1EU4A 1BCPD 2A69D 5EKLA 4DV5Q 2K50A 1W6JA 2PZWA 5IYCH 2MGSA 4PZ8A 5IYCG 2K5NA 1JWUD 1EQRA 3CCQA 4LF4L 3MVVA 2IY5B 3OPOA 4A3KH 3NQTA 1WTRA 4A3KG 1IHZA 2B2YA 5CGKA 2XTIA 1ML0D 4DUZL 4F8MA 3I90A 4DR1Q 2NTSA 4A3FH 3M7NA 4A3FG 2WB1E 3BU2A 2Z9HA 1HQRD 1E2ZA 4BWGB 4DK3C 5CMDA 2RDHA 4ZAIA 4K5XA 4O42A 2L1BA 1G51A 3K5OA 3W3AA 3F2DA 4DV0Q 2N78A 3MFGA 4R1JA 1BXTA 3AYHB 1YITA 2F0LA 3A8KE 4CKEA 3D6CA 4A3JH 4UPAA 2VQEQ 1C8CA 3K7AH 2CQAA 4A3JG 1MI2A 4LF6L 1HH2P 3S1QH 2HHHQ 2UXCL 4C3HH 2HCIA 4C3HG 4A3GH 3D4RA 3TBIB 4A3GG 1ZKOA 2Q8IB 2WKDA 4A3KB 1CT1D 4OX9Q 3GTJH 3KBGA 3MAQA 2ICIA 5ISRA 4K6DA 1TKWB 1LYLA 4JI8Q 4JW0A 3KJPA 1SLJA 3EVQA 2B3GA 2EYLA 2B2VA 1VS0A 3ER0A 1SDFA 2CHBD 4HIMA 1DM0B 1PYSB 4L5RC 3ULPA 2E8GA 2A8VA 3AEVA 1VQ7A 1ENCA 2K75A 2NVYB 1WTVA 1F9PA 2JA5H 1YJ9A 2JA5G 2TMPA 3ERQA 5CC4A 3GTLH 1X3PA 2WFWA 1T5XD 4YCVA 4A3GB 1X3GA 5CV5A 1UEAB 2E2HH 4B3RQ 4YWKA 1QVGA 2EJGC 2BDNA 4HTHA 2MQHA 4C2MH 3T16A 1SMYC 4DNRB 2AHOB 3IFDA 4ZK9B 4DV1Q 3GQBA 2WAQE 1EFWA 4A3MH 4A3MG 1EYGA 5EPJA 1TVXA 3S1MH 2VB3X 3DUZA 5JPMC 3M9BA 2DNEA 3CP0A 3I56A 1VMPA 1D5ZC 2O5JC 1BQQT 1FNUA 3FPPA 1IXRA 1TS5A 2WV6D 5C0XJ 3K58A 1WTOA 1HNZQ 5KEEA 3UI2A 2HT1A 1ICFB 3CU7A 4I7ZC 4PMBA 1OXVA 1XNRQ 2JA5B 4GLXA 4H44C 5T1GA 1YNJC 2BCOA 4CDCC 3K6OA 2EXZA 3A55A 2L0CA 2F0WA 4HR7B 3PV0A 3KLSA 4AYBG 3D4WA 5H1SE 2HCCA 4JI7Q 2E2HB 1IBLQ 1KDBA 4R4TA 3ND9A 1N8RC 4C2MB 3J7AV 4AH6A 1HCZA 3VR6A 1H9SA 5F2DA 2F0TA 4ZKBB 2B2TA 4UP7A 1QVCA 3S16B 2CKZB 5GAGC 5JJZA 2M9VA 3KDFB 4ODGA 1HZCA 2Z6BA 2VNUD 4DR3L 4LUZA 5C3WA 1PH4A 2EPBA 3I4NH 3I4NG 1IYUA 4CDFC 4PZ6A 1I50H 2UUCL 1YNND 2UU9Q 1V1PA 3UDXA 1TWCB 1BBXC 2UXDL 5I2XA 3RLOA 3D8GA 1GHKA 3C46A 3GTKH 1XMQL 2MPMA 2I07B 2HQEA 5BR8Q 3GD7A 2JA6B 1WYDA 4NXMQ 2B2VC 3QIAA 5JPNC 4BY7B 4LF5Q 2NN6I 1H95A 2R7ZH 1Y1WH 1NY4A 2D0OA 1E1TA 2R7ZG 3H0GB 1Y1WG 1VF7A 1XX8A 5M5XB 3EQLC 2DN8A 3H15A 4M8AA 4RCOA 2ZJPA 2K6AA 1HHVA 4A93H 5JJKA 4A93G 2F0VA 3FHWA 3WOEA 1PDQA 1KRTA 1B9MA 1SEBD 4B3ML 3E3XA 2A5HA 4XXEA 3I4NB 1UE6A 1SYEA 4BA1I 1SNMA 3PIPA 1IKLA 1TWHB 2QW7A 3RN2A 3FEWX 4G7OC 3I4MH 4QB4A 1CI3M 3I4MG 4RH6A 1N9WA 2Z6KA 1JICA 2YU9H 1UEBA 3D0FA 3KUPA 2JA9A 2E2IB 1AE2A 3GTKB 2UUAL 1A2UA 4RWSC 4PMWA 3U9SA 1V1OA 3CQZH 1WTQA 4P2CB 5ELDA 3BS1A 3GTMH 2Z4HA 3U58A 1LTTD 3S24A 5D3IB 4N9TA 4JI5Q 2BE5C 3S2DH 2JSOA 3ERSX 2RCFA 1VQMA 1TWAH 2YTYA 4P73A 1C4QA 5FLMH 2NVXH 4JI2Q 2F0JA 4JOIA 4XQJA 5GAHC 1AW7A 3ICEA 3H09A 3RZOH 3L9AX 2KOLA 1F9SA 2ZTCA 4A3EH 3OIQA 4S3SA 1B70B 1W6KA 3E0EA 4A3EG 1W2BA 1CHQD 1PH5A 1LM0A 1X65A 2R3ZA 4B3TQ 1CQVA 2YU9B 3DEOA 3S1RH 3NBHB 1Y1VB 1SAPA 2A74C 2CW0C 1VQLA 1AE3A 2EE1A 4HJ5A 4IUPA 3GTMB 1TS4A 1HA6A 1Q8IA 2K14A 1EWCA 1B1ZA 5ELOA 5EPKA 1B9NA 1VF5C 2DJGC 5ELCA 3OTOL 2PW7A 1PTOB 3VYTA 3S2DB 5CORA 5EKIA 1TWFH 1HFGA 3Q22A 4DR6L 4MTNA 1IW7D 4P71A 1Z47A 2NVXB 1L1OB 3I72A 3HOXH 1H9RA 3HRZC 4FDBA 3HOXG 4XYOA 4GS3A 1I4RA 2ALYB 3VA5A 1DGSA 2DGYA 3QOLA 2R7DA 3S2HB 5I6WA 1D7QA 3VYRA 1J8IA 1H9JA 1EOVA 1EQTA 2F1MA
chains in the Genus database with same CATH topology
2N49A 1CSPA 1EIFA 2ZTEA 3Q8DA 1NTGA 3PSIA 3SGIA 4C3IH 2WP8J 1G291 4QY7A 4JBMA 4LFBL 2E2IH 1VQIA 1YBYA 4YY3Q 4DR5Q 2Q2HA 4DR1L 1XJVA 1N33Q 1ASZA 2LSSA 3HKZE 1N36L 3K0XA 4QGUA 4Y7NH 3I7FA 4DR2Q 1E22A 3CCMA 2IX0A 2RF4A 1PH8A 1SR3A 1HR0L 1CKMA 2H5XA 4RMFA 1A62A 1HR0W 5LMUQ 2JJQA 1LUZA 3KF6A 1KD1C 1SFOH 1K3RA 3KF6B 5C3EH 4TQUS 1SRUA 1YHQA 3NELA 5C3EG 1E3PA 4B3MQ 1XMOQ 2OTLA 3RZDH 4BY1H 3I55A 4BY1G 2BH8A 1YI2A 5GROA 3RNUA 1S72A 5HGQA 4GN5A 5IT9c 3BJUA 4JCVE 4DV0L 3GTPH 4X6AH 4IOAA 2JQOA 1I6HH 1JT8A 4JI1Q 4QQBX 1BKBA 1LTLA 3AFQA 1WI5A 3PO2H 3E9IA 1C9OA 4LUOA 4AQYL 1HZBA 3PO2G 2VQEL 4L5TA 1FL0A 3TQYA 1GO3E 2MO0A 1M90C 4LF7Q 2UUAQ 3K8AA 3PIOA 2E5LL 4YCWA 3DM3A 2HHHL 4X64Q 2CWPA 2LXKA 1BVSA 2Z6KC 4HJ7A 1A63A 1VQKA 4IPCA 2FXQA 4KHPQ 3K81C 2I5LX 3M4OH 3NEMA 3JAMi 1C7YA 4B3SL 1N32Q 1U5KA 5C44H 3S17H 4JV5L 1PH6A 1GM5A 1BBWA 5C44G 2Q2UA 1MIUA 4AIMA 1SN8A 1HZAA 3PGZA 4L5QA 1WFQA 3T1HQ 1KRSA 4OWXB 1PH7A 4OX9L 3F1ZA 3CCVA 1JMCA 1Y1VH 4GN4B 2HIVA 4YWMA 3G71A 1Y1VG 1WOCA 2V1CC 2ZJQA 5M3MH 4DV7L 1L2FA 5EAYA 5M3MG 3OW2A 4JI8L 1CUKA 1PA6A 1A8VA 4JI3L 4WJ4A 5J3BA 2KCMA 4DV2L 5GQOA 1IBMQ 2UUBQ 4EX5A 1E7ZA 3D31A 3G48A 3K80C 5AJ3L 4BA2I 1K9MC 1PH3A 5LMNL 2R6GA 3T1YQ 3H3VI 3J81j 4JYAQ 4X66L 1FVIA 3TS2A 4ME3A 3J80i 3UE0A 1VQGA 2C35B 3ULJA 4DUYQ 1NJIC 4A3BH 3PUZA 3FKIH 1P16A 4A3BG 3F2CA 3FKIG 1PH2A 4A3DH 4DR7Q 2RHQB 3S2HH 4A3DG 3A74A 2IX1A 1J5EQ 3RLNA 4UY8C 1KC8C 3CCUA 4P74A 3U4ZA 4LF8L 1C0AA 4MNOA 2N8NA 3JAMc 1OXTA 1YHBA 3HOVH 4GKKQ 4B3RL 3OTOQ 1PYBA 2RCNA 3HOVG 2GN5A 1GKHA 2ATWA 1CKNA 2ZTDA 4L5SA 4OO1G 1CKNB 4A4IA 5FLXc 1OXXK 4RG1A 1BBUA 1EIYB 3CF5A 4DR6Q 2R93H 3J7A5 1YEZA 3KFUA 2KHIA 2R93G 2KENA 1HJPA 2XGTA 3STBD 4DV1L 4LF9Q 1SMXA 1K8GA 4GKJQ 2UXBL 1S3OA 1VQFA 1NBWA 1JJGA 1SROA 1SE8A 4POGA 4JI0L 1UE5A 1P8LA 3CXCA 1IL2A 4DV6L 4NXNQ 2I0QA 4DV5Q 2K50A 3PUVA 4GLAC 1MJEA 5IYCH 2ZM6L 4PZ8A 2F3IA 5IYCG 2K5NA 5IP7H 1EQRA 1U0LA 4IJHA 3CCQA 4X62L 5IP7G 4LF4L 2NN6G 4GN3B 1VQBA 1HNZL 2A1AA 2YYZA 2JE6I 3HKSA 2IY5B 2VY3A 4A3KH 1OXUA 4A3KG 3J80c 2VQFL 3KF8B 4LFBQ 4JG2A 1XPUA 1XNRL 1VQDA 2XTIA 5E7NA 4DUZL 1YJNA 4DR1Q 1KXLA 2OQKA 3M4QA 1N36Q 2Q2IA 1I3QH 1VQOA 5K36G 4BBRH 3WWVA 1UE1A 1HR0Q 4A3FH 1Y14B 2OTJA 2WB1G 4BBRG 5C0XG 3M7NA 3BZCA 4A3FG 2WB1E 3BU2A 1EWIA 4KLKA 2AKWB 4PG3A 1E1OA 4JI7L 4DK3C 5JEAG 5M5YH 1IBLL 1X56A 1JB7A 1G51A 2AWOA 1K73C 1KIXA 3F2DA 4DV0Q 1IZ6A 2OCEA 4KI0A 5FJ8H 4GOPA 4DR4L 2N78A 2NZHA 4GOPB 3F8TA 5FJ8G 4HJAA 4R1JA 4A75A 3AYHB 1YITA 2JEAI 1YVCA 2PMZE 2QGQA 4YCUA 4AQYQ 4A3JH 4UPAA 2VQEQ 2NVTH 3K7AH 4A3JG 4LF6L 1HH2P 3CW2C 4QJFA 2R92H 2E5LQ 3F2BA 3S1QH 2HHHQ 2R92G 3A5ZB 2UXCL 5IYDH 4C3HH 3S1NH 3CC2A 4A3GH 4Y52H 2EQSA 4B3SQ 4A3GG 4A3IH 4JV5Q 4JBWA 4A3IG 4A3LH 4JBJA 4IOCA 1K8AC 4A3LG 1X3FA 3UDGA 1VQ5A 4OX9Q 3GTJH 4O0AA 2YTXA 3W5OA 4X65L 4BXXH 3VDYA 1PFSA 1OTCA 4NPSA 2ES2A 2UU9L 4DV3L 4P72A 4JI6L 1FJGL 3HOWH 2A19A 4BXXG 1LYLA 1X9NA 4DV7Q 3HOWG 1FGUA 2E2JH 5HY6A 3G4SA 4JI8Q 4K0KQ 3KJPA 4C3JH 4JI3Q 1SLJA 4LW1A 4DV2Q 1VQAA 2B3GA 1I94L 3TEHB 1VS0A 1S40A 3ER0A 1VQ9A 4HIMA 5BR8L 1RL2A 3CCLA 3L0OA 1PYSB 4L5RC 4IFDG 3ULPA 2E8GA 5AJ3Q 2A8VA 3AEVA 3EBEA 4NXML 1EQQA 1E24A 2D0PA 1L0WA 1VQ7A 4UP9A 4TVAB 5LMNQ 2Y0SG 1YZ6A 2Q2TA 2Y0SE 2K75A 4X66Q 4LF5L 1X3EA 2JA5H 1Q86C 3ZJYC 1YJ9A 2JA5G 1WCMH 4PZ7A 1XPOA 2QEXA 1WCMG 4MZ9A 1B7YB 2ASBA 3J7ZC 2NVQH 3GTLH 2F4VL 4OWTB 1Q12A 2WFWA 4HIKA 4JI4L 4OXPA 4LF8Q 4YCVA 3S14H 3HOZH 2VS1A 3HOZG 1X3GA 2E2HH 1VQCA 4B3RQ 4YWKA 3U50C 1QVGA 3ULLA 3KOJA 5C4JH 4ALPA 3M4PA 5ELNA 2MQHA 4C2MH 2F52A 2AHOB 5DLQE 4DV1Q 2WAQG 3CMAA 3M3YH 2WAQE 1EFWA 2UXBQ 3PUYA 4A3MH 3FP9A 2VW9A 1VQJA 4A3MG 2HIXA 4LFCL 3DLLA 1EYGA 1JJ2A 3CC7A 1XNQL 2JA8G 5JJIA 1PH1A 4JI0Q 3S1MH 4DV6Q 1JJCB 4IPHA 4UP8A 3M9BA 5FLMG 3GO5A 3GTQH 2ZM6Q 3CP0A 3I56A 4JBKA 1UWVA 1IXRA 5C0XJ 1VQPA 2YTVA 2AMCB 1HNZQ 4LF4Q 1YIJA 3E9HA 2HT1A 1KAWA 2MO1A 2NZOA 4JI5L 2VQFQ 4EQ5A 5JEAJ 1OXVA 5IWAL 3RN5A 1XNRQ 1PVOA 4DUZQ 4GLXA 1PH9A 1IBKL 2I5MX 4LFAL 1VQ6A 3RLFA 4OONA 2K5HA 1VCIA 2EIFA 4YHHL 1TXYA 1YJWA 2L15A 1N34Q 4JI2L 3PV0A 4AYBG 1PHJA 5H1SE 4AYBE 2HQLA 1NMGA 4JI7Q 4IJLA 3GDEA 1IBLQ 4R4TA 2KHJA 4A76A 1N8RC 3NENA 4DR4Q 4POFA 2BA0A 1MKHA 2MNAA 2ID0A 4AH6A 1NE3A 4GKKL 4B3TL 4DPGA 3S15H 2JK8A 3PUXA 4J15A 3I2ZA 4R4QA 1K0RA 2PI2A 5M3FH 1W3SA 4GOPC 4LF6Q 2JA7H 5M3FG 1ASYA 2JA7G 2BH2A 4DK6C 2UXCQ 1V9PA 4UP7A 1QVCA 3M85A 2CKZB 2VL6A 3KDFA 3LGJA 5GAGC 3KDFB 1HZCA 3TREA 2VNUD 4DR3L 4LUZA 3TRZA 1KHIA 1T9HA 2NVYH 4IPDA 4YWLA 1PH4A 3CCJA 3PCOB 3I4NH 1V43A 3I4NG 4X65Q 4PZ6A 4OO1I 1I50H 2UUCL 2CFMA 4IFDJ 2UU9Q 4DV3Q 1VQ8A 4JI6Q 1FJGQ 4O2DA 3UDXA 1MJCA 4XTCS 1QVFA 2UXDL 3RLOA 4IPGA 1HNXL 2KCTA 2GVAA 3K7UC 3CCRA 3B6YA 1I94Q 3GTKH 1KQSA 1XMQL 4DKAC 1V1QA 3HKZG 2D62A 1HZ9A 5BR8Q 1G6PA 3GD7A 4DV4L 2CCZA 3PUWA 3GTGH 4LNQA 1WYDA 1HNWL 4NXMQ 2YV5A 3HFZB 3H3VH 2QA4A 1TWGH 1Z9FA 1UE7A 3CAMA 1QZHA 4LF5Q 4HIDA 1X6OA 2NN6I 4BBSH 1H95A 4NB3A 2R7ZH 5C4XH 1Y1WH 4BBSG 1NY4A 2D0OA 4R4IA 1E1TA 2R7ZG 5C4XG 4GNXC 1Y1WG 2VZAA 2BA1A 3KYHC 4YY3L 3H15A 1J6QA 2IHFA 4QIWE 4DR5L 3PF4A 3MEFA 4WJ3M 1R9TH 2ZJPA 1N33L 2F4VQ 4LWCA 4A93H 4JI4Q 4DR2L 5JJKA 2DUDA 3GTOH 4A93G 1X55A 5IYBH 3FHWA 3CPWA 4GNXA 2VUMH 3HOUH 2PNHA 5IYBG 5C0XI 4GNXB 3EIVA 1KRTA 5LMUL 2VUMG 3HOUG 1VQEA 4GLVB 1IYJB 2CQOA 1QUQA 4B3ML 1XMOL 1QUQB 1XPRA 2N3SA 1UE6A 4BA1I 2RHSB 3PIPA 2B63H 3UDIA 4A3CH 2B63G 3RN2A 4APVA 3CC4A 2ZJRA 1B8AA 2CWAA 3W1BA 3I4MH 4A3CG 3G6EA 2K5VA 4JI1L 3I4MG 4LFCQ 1XNQQ 1N9WA 2Z6KA 5GAEC 2YU9H 1UEBA 3D0FA 1CSQA 3L7ZC 2JA9A 1AE2A 4LF7L 2GVBA 1A0IA 2UUAL 4PMWA 1NMFA 3CQZH 4X64L 5IY0A 5IP9H 1YHAA 5GADC 3J81i 1I5FA 5IP9G 3U58A 3GTMH 4KHPL 4K0KL 3KJOA 1N32L 4HIOA 3EN2A 3S24A 2MFIA 4OWWB 4JI5Q 4JOIC 2OQ0A 3S2DH 4LUVA 2JEBI 3ERSX 4H02A 5IWAQ 3T1HL 1VQMA 1VQNA 1IBKQ 1TWAH 1M1KC 1YNXA 4LFAQ 2PI2E 2YTYA 4P73A 3I4OA 5FLMH 2NVXH 2I5HA 4YHHQ 2K4KA 3S16H 4JI2Q 1XTDA 3OYYA 4DNIA 5LMNW 4JOIA 5GAHC 1Q46A 4X62Q 3ICEA 1Q82C 1VQHA 2JA8H 3RZOH 2ZTCA 1QZGA 3KLWA 3TS0A 1IBML 2LXJA 1OXSC 2UUBL 1JE5A 4A3EH 3AQQA 1B70B 2K52A 3E0EA 3RR5A 4DAYB 3UDFA 3CCEA 4A3EG 1Q8KA 1W2BA 1PH5A 4IFDI 1LM0A 1AH9A 3CPFA 3CMEA 1EUJA 1X65A 3W1GA 1TWCH 3BZKA 4R4CA 3T1YL 4B3TQ 4JYAL 4DUYL 4P75A 1KL9A 4DAMA 3S1RH 3NBHB 1VQLA 2JA6H 3A0JA 1AE3A 4DR7L 4HJ9A 4KHZA 1J5EL 2Z0SA 2JA6G 1Q1EA 4HJ5A 3J81c 2EXDA 2PQAA 4DR3Q 2PQAB 1L1OC 2K14A 4BY7H 4BY7G 5ELOA 3L2PA 1PV4A 1Q1BA 3OTOL 3H0GH 4R4OA 1D8LA 3H0GG 1Q7YC 5M5XH 1TWFH 2UUCQ 2R7FA 4QL5A 4DR6L 4MTNA 4P71A 1L1OA 1K83H 1Z47A 4JC0A 1L1OB 3U4VA 3UE1A 1RIPA 2IT1A 2UXDQ 4LF9L 1Q81C 2B29A 3HOXH 3AFPA 1HNXQ 3PO3H 4GKJL 5IE8A 4FDBA 5IYDG 3HOXG 3PO3G 2OWOA 1GD7A 3STBC 4HJ8A 2IHEA 1XMQQ 4GS3A 3CCSA 2ALYB 3PF5A 5JJLA 1DGSA 1GVPA 2DGYA 4NXNL 2R7DA 2KBNA 4DV4Q 1VQ4A 1HNWQ 4DV5L 1WJJA 1CKOA 1TWHH 3HOYH 1X54A 1N34L 3CD6A 5M5WH 1D7QA 4XIGS 3A5UA 3IRBA 2AWNA 3HOYG 4IO9A 3MXNB 3JC66 1EOVA 1O7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N49 A;  1CSP A;  1EIF A;  2ZTE A;  3Q8D A;  1NTG A;  3PSI A;  3SGI A;  4C3I H;  2WP8 J;  1G29 1;  4QY7 A;  4JBM A;  4LFB L;  2E2I H;  1VQI A;  1YBY A;  4YY3 Q;  4DR5 Q;  2Q2H A;  4DR1 L;  1XJV A;  1N33 Q;  1ASZ A;  2LSS A;  3HKZ E;  1N36 L;  3K0X A;  4QGU A;  4Y7N H;  3I7F A;  4DR2 Q;  1E22 A;  3CCM A;  2IX0 A;  2RF4 A;  1PH8 A;  1SR3 A;  1HR0 L;  1CKM A;  2H5X A;  4RMF A;  1A62 A;  1HR0 W;  5LMU Q;  2JJQ A;  1LUZ A;  3KF6 A;  1KD1 C;  1SFO H;  1K3R A;  3KF6 B;  5C3E H;  4TQU S;  1SRU A;  1YHQ A;  3NEL A;  5C3E G;  1E3P A;  4B3M Q;  1XMO Q;  2OTL A;  3RZD H;  4BY1 H;  3I55 A;  4BY1 G;  2BH8 A;  1YI2 A;  5GRO A;  3RNU A;  1S72 A;  5HGQ A;  4GN5 A;  5IT9 c;  3BJU A;  4JCV E;  4DV0 L;  3GTP H;  4X6A H;  4IOA A;  2JQO A;  1I6H H;  1JT8 A;  4JI1 Q;  4QQB X;  1BKB A;  1LTL A;  3AFQ A;  1WI5 A;  3PO2 H;  3E9I A;  1C9O A;  4LUO A;  4AQY L;  1HZB A;  3PO2 G;  2VQE L;  4L5T A;  1FL0 A;  3TQY A;  1GO3 E;  2MO0 A;  1M90 C;  4LF7 Q;  2UUA Q;  3K8A A;  3PIO A;  2E5L L;  4YCW A;  3DM3 A;  2HHH L;  4X64 Q;  2CWP A;  2LXK A;  1BVS A;  2Z6K C;  4HJ7 A;  1A63 A;  1VQK A;  4IPC A;  2FXQ A;  4KHP Q;  3K81 C;  2I5L X;  3M4O H;  3NEM A;  3JAM i;  1C7Y A;  4B3S L;  1N32 Q;  1U5K A;  5C44 H;  3S17 H;  4JV5 L;  1PH6 A;  1GM5 A;  1BBW A;  5C44 G;  2Q2U A;  1MIU A;  4AIM A;  1SN8 A;  1HZA A;  3PGZ A;  4L5Q A;  1WFQ A;  3T1H Q;  1KRS A;  4OWX B;  1PH7 A;  4OX9 L;  3F1Z A;  3CCV A;  1JMC A;  1Y1V H;  4GN4 B;  2HIV A;  4YWM A;  3G71 A;  1Y1V G;  1WOC A;  2V1C C;  2ZJQ A;  5M3M H;  4DV7 L;  1L2F A;  5EAY A;  5M3M G;  3OW2 A;  4JI8 L;  1CUK A;  1PA6 A;  1A8V A;  4JI3 L;  4WJ4 A;  5J3B A;  2KCM A;  4DV2 L;  5GQO A;  1IBM Q;  2UUB Q;  4EX5 A;  1E7Z A;  3D31 A;  3G48 A;  3K80 C;  5AJ3 L;  4BA2 I;  1K9M C;  1PH3 A;  5LMN L;  2R6G A;  3T1Y Q;  3H3V I;  3J81 j;  4JYA Q;  4X66 L;  1FVI A;  3TS2 A;  4ME3 A;  3J80 i;  3UE0 A;  1VQG A;  2C35 B;  3ULJ A;  4DUY Q;  1NJI C;  4A3B H;  3PUZ A;  3FKI H;  1P16 A;  4A3B G;  3F2C A;  3FKI G;  1PH2 A;  4A3D H;  4DR7 Q;  2RHQ B;  3S2H H;  4A3D G;  3A74 A;  2IX1 A;  1J5E Q;  3RLN A;  4UY8 C;  1KC8 C;  3CCU A;  4P74 A;  3U4Z A;  4LF8 L;  1C0A A;  4MNO A;  2N8N A;  3JAM c;  1OXT A;  1YHB A;  3HOV H;  4GKK Q;  4B3R L;  3OTO Q;  1PYB A;  2RCN A;  3HOV G;  2GN5 A;  1GKH A;  2ATW A;  1CKN A;  2ZTD A;  4L5S A;  4OO1 G;  1CKN B;  4A4I A;  5FLX c;  1OXX K;  4RG1 A;  1BBU A;  1EIY B;  3CF5 A;  4DR6 Q;  2R93 H;  3J7A 5;  1YEZ A;  3KFU A;  2KHI A;  2R93 G;  2KEN A;  1HJP A;  2XGT A;  3STB D;  4DV1 L;  4LF9 Q;  1SMX A;  1K8G A;  4GKJ Q;  2UXB L;  1S3O A;  1VQF A;  1NBW A;  1JJG A;  1SRO A;  1SE8 A;  4POG A;  4JI0 L;  1UE5 A;  1P8L A;  3CXC A;  1IL2 A;  4DV6 L;  4NXN Q;  2I0Q A;  4DV5 Q;  2K50 A;  3PUV A;  4GLA C;  1MJE A;  5IYC H;  2ZM6 L;  4PZ8 A;  2F3I A;  5IYC G;  2K5N A;  5IP7 H;  1EQR A;  1U0L A;  4IJH A;  3CCQ A;  4X62 L;  5IP7 G;  4LF4 L;  2NN6 G;  4GN3 B;  1VQB A;  1HNZ L;  2A1A A;  2YYZ A;  2JE6 I;  3HKS A;  2IY5 B;  2VY3 A;  4A3K H;  1OXU A;  4A3K G;  3J80 c;  2VQF L;  3KF8 B;  4LFB Q;  4JG2 A;  1XPU A;  1XNR L;  1VQD A;  2XTI A;  5E7N A;  4DUZ L;  1YJN A;  4DR1 Q;  1KXL A;  2OQK A;  3M4Q A;  1N36 Q;  2Q2I A;  1I3Q H;  1VQO A;  5K36 G;  4BBR H;  3WWV A;  1UE1 A;  1HR0 Q;  4A3F H;  1Y14 B;  2OTJ A;  2WB1 G;  4BBR G;  5C0X G;  3M7N A;  3BZC A;  4A3F G;  2WB1 E;  3BU2 A;  1EWI A;  4KLK A;  2AKW B;  4PG3 A;  1E1O A;  4JI7 L;  4DK3 C;  5JEA G;  5M5Y H;  1IBL L;  1X56 A;  1JB7 A;  1G51 A;  2AWO A;  1K73 C;  1KIX A;  3F2D A;  4DV0 Q;  1IZ6 A;  2OCE A;  4KI0 A;  5FJ8 H;  4GOP A;  4DR4 L;  2N78 A;  2NZH A;  4GOP B;  3F8T A;  5FJ8 G;  4HJA A;  4R1J A;  4A75 A;  3AYH B;  1YIT A;  2JEA I;  1YVC A;  2PMZ E;  2QGQ A;  4YCU A;  4AQY Q;  4A3J H;  4UPA A;  2VQE Q;  2NVT H;  3K7A H;  4A3J G;  4LF6 L;  1HH2 P;  3CW2 C;  4QJF A;  2R92 H;  2E5L Q;  3F2B A;  3S1Q H;  2HHH Q;  2R92 G;  3A5Z B;  2UXC L;  5IYD H;  4C3H H;  3S1N H;  3CC2 A;  4A3G H;  4Y52 H;  2EQS A;  4B3S Q;  4A3G G;  4A3I H;  4JV5 Q;  4JBW A;  4A3I G;  4A3L H;  4JBJ A;  4IOC A;  1K8A C;  4A3L G;  1X3F A;  3UDG A;  1VQ5 A;  4OX9 Q;  3GTJ H;  4O0A A;  2YTX A;  3W5O A;  4X65 L;  4BXX H;  3VDY A;  1PFS A;  1OTC A;  4NPS A;  2ES2 A;  2UU9 L;  4DV3 L;  4P72 A;  4JI6 L;  1FJG L;  3HOW H;  2A19 A;  4BXX G;  1LYL A;  1X9N A;  4DV7 Q;  3HOW G;  1FGU A;  2E2J H;  5HY6 A;  3G4S A;  4JI8 Q;  4K0K Q;  3KJP A;  4C3J H;  4JI3 Q;  1SLJ A;  4LW1 A;  4DV2 Q;  1VQA A;  2B3G A;  1I94 L;  3TEH B;  1VS0 A;  1S40 A;  3ER0 A;  1VQ9 A;  4HIM A;  5BR8 L;  1RL2 A;  3CCL A;  3L0O A;  1PYS B;  4L5R C;  4IFD G;  3ULP A;  2E8G A;  5AJ3 Q;  2A8V A;  3AEV A;  3EBE A;  4NXM L;  1EQQ A;  1E24 A;  2D0P A;  1L0W A;  1VQ7 A;  4UP9 A;  4TVA B;  5LMN Q;  2Y0S G;  1YZ6 A;  2Q2T A;  2Y0S E;  2K75 A;  4X66 Q;  4LF5 L;  1X3E A;  2JA5 H;  1Q86 C;  3ZJY C;  1YJ9 A;  2JA5 G;  1WCM H;  4PZ7 A;  1XPO A;  2QEX A;  1WCM G;  4MZ9 A;  1B7Y B;  2ASB A;  3J7Z C;  2NVQ H;  3GTL H;  2F4V L;  4OWT B;  1Q12 A;  2WFW A;  4HIK A;  4JI4 L;  4OXP A;  4LF8 Q;  4YCV A;  3S14 H;  3HOZ H;  2VS1 A;  3HOZ G;  1X3G A;  2E2H H;  1VQC A;  4B3R Q;  4YWK A;  3U50 C;  1QVG A;  3ULL A;  3KOJ A;  5C4J H;  4ALP A;  3M4P A;  5ELN A;  2MQH A;  4C2M H;  2F52 A;  2AHO B;  5DLQ E;  4DV1 Q;  2WAQ G;  3CMA A;  3M3Y H;  2WAQ E;  1EFW A;  2UXB Q;  3PUY A;  4A3M H;  3FP9 A;  2VW9 A;  1VQJ A;  4A3M G;  2HIX A;  4LFC L;  3DLL A;  1EYG A;  1JJ2 A;  3CC7 A;  1XNQ L;  2JA8 G;  5JJI A;  1PH1 A;  4JI0 Q;  3S1M H;  4DV6 Q;  1JJC B;  4IPH A;  4UP8 A;  3M9B A;  5FLM G;  3GO5 A;  3GTQ H;  2ZM6 Q;  3CP0 A;  3I56 A;  4JBK A;  1UWV A;  1IXR A;  5C0X J;  1VQP A;  2YTV A;  2AMC B;  1HNZ Q;  4LF4 Q;  1YIJ A;  3E9H A;  2HT1 A;  1KAW A;  2MO1 A;  2NZO A;  4JI5 L;  2VQF Q;  4EQ5 A;  5JEA J;  1OXV A;  5IWA L;  3RN5 A;  1XNR Q;  1PVO A;  4DUZ Q;  4GLX A;  1PH9 A;  1IBK L;  2I5M X;  4LFA L;  1VQ6 A;  3RLF A;  4OON A;  2K5H A;  1VCI A;  2EIF A;  4YHH L;  1TXY A;  1YJW A;  2L15 A;  1N34 Q;  4JI2 L;  3PV0 A;  4AYB G;  1PHJ A;  5H1S E;  4AYB E;  2HQL A;  1NMG A;  4JI7 Q;  4IJL A;  3GDE A;  1IBL Q;  4R4T A;  2KHJ A;  4A76 A;  1N8R C;  3NEN A;  4DR4 Q;  4POF A;  2BA0 A;  1MKH A;  2MNA A;  2ID0 A;  4AH6 A;  1NE3 A;  4GKK L;  4B3T L;  4DPG A;  3S15 H;  2JK8 A;  3PUX A;  4J15 A;  3I2Z A;  4R4Q A;  1K0R A;  2PI2 A;  5M3F H;  1W3S A;  4GOP C;  4LF6 Q;  2JA7 H;  5M3F G;  1ASY A;  2JA7 G;  2BH2 A;  4DK6 C;  2UXC Q;  1V9P A;  4UP7 A;  1QVC A;  3M85 A;  2CKZ B;  2VL6 A;  3KDF A;  3LGJ A;  5GAG C;  3KDF B;  1HZC A;  3TRE A;  2VNU D;  4DR3 L;  4LUZ A;  3TRZ A;  1KHI A;  1T9H A;  2NVY H;  4IPD A;  4YWL A;  1PH4 A;  3CCJ A;  3PCO B;  3I4N H;  1V43 A;  3I4N G;  4X65 Q;  4PZ6 A;  4OO1 I;  1I50 H;  2UUC L;  2CFM A;  4IFD J;  2UU9 Q;  4DV3 Q;  1VQ8 A;  4JI6 Q;  1FJG Q;  4O2D A;  3UDX A;  1MJC A;  4XTC S;  1QVF A;  2UXD L;  3RLO A;  4IPG A;  1HNX L;  2KCT A;  2GVA A;  3K7U C;  3CCR A;  3B6Y A;  1I94 Q;  3GTK H;  1KQS A;  1XMQ L;  4DKA C;  1V1Q A;  3HKZ G;  2D62 A;  1HZ9 A;  5BR8 Q;  1G6P A;  3GD7 A;  4DV4 L;  2CCZ A;  3PUW A;  3GTG H;  4LNQ A;  1WYD A;  1HNW L;  4NXM Q;  2YV5 A;  3HFZ B;  3H3V H;  2QA4 A;  1TWG H;  1Z9F A;  1UE7 A;  3CAM A;  1QZH A;  4LF5 Q;  4HID A;  1X6O A;  2NN6 I;  4BBS H;  1H95 A;  4NB3 A;  2R7Z H;  5C4X H;  1Y1W H;  4BBS G;  1NY4 A;  2D0O A;  4R4I A;  1E1T A;  2R7Z G;  5C4X G;  4GNX C;  1Y1W G;  2VZA A;  2BA1 A;  3KYH C;  4YY3 L;  3H15 A;  1J6Q A;  2IHF A;  4QIW E;  4DR5 L;  3PF4 A;  3MEF A;  4WJ3 M;  1R9T H;  2ZJP A;  1N33 L;  2F4V Q;  4LWC A;  4A93 H;  4JI4 Q;  4DR2 L;  5JJK A;  2DUD A;  3GTO H;  4A93 G;  1X55 A;  5IYB H;  3FHW A;  3CPW A;  4GNX A;  2VUM H;  3HOU H;  2PNH A;  5IYB G;  5C0X I;  4GNX B;  3EIV A;  1KRT A;  5LMU L;  2VUM G;  3HOU G;  1VQE A;  4GLV B;  1IYJ B;  2CQO A;  1QUQ A;  4B3M L;  1XMO L;  1QUQ B;  1XPR A;  2N3S A;  1UE6 A;  4BA1 I;  2RHS B;  3PIP A;  2B63 H;  3UDI A;  4A3C H;  2B63 G;  3RN2 A;  4APV A;  3CC4 A;  2ZJR A;  1B8A A;  2CWA A;  3W1B A;  3I4M H;  4A3C G;  3G6E A;  2K5V A;  4JI1 L;  3I4M G;  4LFC Q;  1XNQ Q;  1N9W A;  2Z6K A;  5GAE C;  2YU9 H;  1UEB A;  3D0F A;  1CSQ A;  3L7Z C;  2JA9 A;  1AE2 A;  4LF7 L;  2GVB A;  1A0I A;  2UUA L;  4PMW A;  1NMF A;  3CQZ H;  4X64 L;  5IY0 A;  5IP9 H;  1YHA A;  5GAD C;  3J81 i;  1I5F A;  5IP9 G;  3U58 A;  3GTM H;  4KHP L;  4K0K L;  3KJO A;  1N32 L;  4HIO A;  3EN2 A;  3S24 A;  2MFI A;  4OWW B;  4JI5 Q;  4JOI C;  2OQ0 A;  3S2D H;  4LUV A;  2JEB I;  3ERS X;  4H02 A;  5IWA Q;  3T1H L;  1VQM A;  1VQN A;  1IBK Q;  1TWA H;  1M1K C;  1YNX A;  4LFA Q;  2PI2 E;  2YTY A;  4P73 A;  3I4O A;  5FLM H;  2NVX H;  2I5H A;  4YHH Q;  2K4K A;  3S16 H;  4JI2 Q;  1XTD A;  3OYY A;  4DNI A;  5LMN W;  4JOI A;  5GAH C;  1Q46 A;  4X62 Q;  3ICE A;  1Q82 C;  1VQH A;  2JA8 H;  3RZO H;  2ZTC A;  1QZG A;  3KLW A;  3TS0 A;  1IBM L;  2LXJ A;  1OXS C;  2UUB L;  1JE5 A;  4A3E H;  3AQQ A;  1B70 B;  2K52 A;  3E0E A;  3RR5 A;  4DAY B;  3UDF A;  3CCE A;  4A3E G;  1Q8K A;  1W2B A;  1PH5 A;  4IFD I;  1LM0 A;  1AH9 A;  3CPF A;  3CME A;  1EUJ A;  1X65 A;  3W1G A;  1TWC H;  3BZK A;  4R4C A;  3T1Y L;  4B3T Q;  4JYA L;  4DUY L;  4P75 A;  1KL9 A;  4DAM A;  3S1R H;  3NBH B;  1VQL A;  2JA6 H;  3A0J A;  1AE3 A;  4DR7 L;  4HJ9 A;  4KHZ A;  1J5E L;  2Z0S A;  2JA6 G;  1Q1E A;  4HJ5 A;  3J81 c;  2EXD A;  2PQA A;  4DR3 Q;  2PQA B;  1L1O C;  2K14 A;  4BY7 H;  4BY7 G;  5ELO A;  3L2P A;  1PV4 A;  1Q1B A;  3OTO L;  3H0G H;  4R4O A;  1D8L A;  3H0G G;  1Q7Y C;  5M5X H;  1TWF H;  2UUC Q;  2R7F A;  4QL5 A;  4DR6 L;  4MTN A;  4P71 A;  1L1O A;  1K83 H;  1Z47 A;  4JC0 A;  1L1O B;  3U4V A;  3UE1 A;  1RIP A;  2IT1 A;  2UXD Q;  4LF9 L;  1Q81 C;  2B29 A;  3HOX H;  3AFP A;  1HNX Q;  3PO3 H;  4GKJ L;  5IE8 A;  4FDB A;  5IYD G;  3HOX G;  3PO3 G;  2OWO A;  1GD7 A;  3STB C;  4HJ8 A;  2IHE A;  1XMQ Q;  4GS3 A;  3CCS A;  2ALY B;  3PF5 A;  5JJL A;  1DGS A;  1GVP A;  2DGY A;  4NXN L;  2R7D A;  2KBN A;  4DV4 Q;  1VQ4 A;  1HNW Q;  4DV5 L;  1WJJ A;  1CKO A;  1TWH H;  3HOY H;  1X54 A;  1N34 L;  3CD6 A;  5M5W H;  1D7Q A;  4XIG S;  3A5U A;  3IRB A;  2AWN A;  3HOY G;  4IO9 A;  3MXN B;  3JC6 6;  1EOV A;  1O7I A; 
#chains in the Genus database with same CATH topology
 1WTP A;  2H1E A;  4HMI A;  3Q8D A;  3PSI A;  3TME A;  3NXW A;  1F9R A;  2EYJ A;  3HKZ E;  1NCV A;  4RKB A;  5KIX A;  4QGU A;  5KGU A;  4Y7N H;  4FP5 D;  3CCM A;  1PH8 A;  1BCP F;  1A62 A;  1HR0 W;  1LUZ A;  3KF6 B;  4XQN A;  3U9O A;  1HFN A;  3RMH A;  1XMO Q;  5GRO A;  3FMC A;  5KYI A;  2F0E A;  4X6A H;  4ZRZ A;  4IOA A;  1R4P B;  2JQO A;  1I6H H;  4JI1 Q;  2RBM A;  3I73 A;  5CV9 A;  1LTL A;  1WI5 A;  3HOX B;  3E9I A;  3PO2 H;  4AQY L;  2F3V A;  3PO2 G;  2AQ3 B;  2QKI C;  1UNS A;  3K8A A;  3PIO A;  1GUW A;  3C1F A;  4EQO A;  2Z6K C;  3M4O H;  5FKA C;  3JAM i;  5C44 H;  3S17 H;  4JV5 L;  1PH6 A;  1DXM A;  1O7L A;  5C44 G;  1O7Z A;  1MIU A;  3VR3 A;  1HZA A;  1QJO A;  1EU3 A;  2IW3 A;  5E4X A;  3CCV A;  1JMC A;  2HIV A;  1Q3L A;  3BYY B;  1WOC A;  2F0K A;  1A8V A;  1GJX A;  2KCM A;  4DV2 L;  1IBM Q;  2P5Z X;  2UUB Q;  1E7Z A;  2XRS D;  4KKS A;  1SND A;  2Z1C A;  1QB5 D;  5LMN L;  2R6G A;  4Q5V A;  4F87 A;  3T1Y Q;  3H3V I;  1I6H B;  4JYA Q;  3DMU A;  1Q90 A;  3E5S A;  3TS2 A;  2JYO A;  3PUZ A;  5HUR A;  1PYW D;  1KLU D;  1LLR D;  3X3M A;  3F2C A;  4A3D H;  4A3D G;  2V4D A;  3RLN A;  1KC8 C;  3A8J E;  4RGT A;  4P74 A;  3U4Z A;  1HTP A;  1C0A A;  5D3D A;  3JAM c;  2N8N A;  1MD2 D;  3HOV H;  4GKK Q;  1X32 A;  1Y69 U;  1SNO A;  1PYB A;  2RCN A;  3HOV G;  1K0S A;  4CGY B;  1GKH A;  2EY2 A;  2ATW A;  4L5S A;  2A73 B;  1CKN B;  2VB2 X;  5FLX c;  4RG1 A;  4CHT B;  4IAL A;  3TP5 A;  2BDO A;  1HJP A;  2XGT A;  3STB D;  2F0G A;  1KTK A;  1RTO A;  1SRO A;  4POG A;  1RF2 D;  4UAI A;  4JI0 L;  1ZXT A;  1WCM B;  4NXN Q;  2J7Z A;  4U68 A;  4N8X 1;  3G6J B;  2I0Q A;  3Q24 A;  3PUV A;  3VR4 A;  2K5D A;  2ZXR A;  1Y8N B;  2F3I A;  2NN6 H;  4IJH A;  2LY7 A;  2NN6 G;  4GN3 B;  1VQB A;  2A1A A;  2JE6 I;  3TZU A;  1OXU A;  3KF8 A;  2OF1 A;  4QMG A;  1B50 A;  4EQN A;  5E7N A;  3M4Q A;  1I3Q H;  3M3Y B;  3R93 A;  4DF7 A;  1HR0 Q;  3MTS A;  2JA8 B;  4C56 C;  4R8I A;  1EWI A;  4KLK A;  1PLF A;  3DWA A;  4PG3 A;  5M5Y H;  1K73 C;  3P7J A;  4KI0 A;  4DR4 L;  5FJ8 H;  4DK1 A;  2F3W A;  2NZH A;  5FJ8 G;  2QDB A;  4HJA A;  1LT5 D;  3SK8 A;  2PMZ E;  5EQ0 A;  1NR4 A;  3BDC A;  4YCU A;  1SXT A;  5KRU A;  3Q23 A;  1NSN S;  3F2B A;  4K8J A;  2HUG A;  3CC2 A;  4Z9C B;  4Y52 H;  2RSN A;  4A3I H;  4JBW A;  4RHS A;  4A3I G;  4A3L H;  2A68 C;  1K8A C;  4A3L G;  3UDG A;  1XYI A;  5FK9 C;  2SOB A;  4O0A A;  2YTX A;  4ZUJ A;  4KY7 A;  3VDY A;  1PFS A;  5M9O A;  1CZG A;  1OTC A;  3MXG A;  3HOW H;  1ZYR C;  1FJG L;  1I3Q B;  2A19 A;  3HOW G;  4DV7 Q;  2E2J H;  3IFT A;  5HY6 A;  5KND A;  4JI3 Q;  3BVZ A;  1LV9 A;  4ZCK A;  1QNU A;  5COY A;  1ET9 A;  1S5E D;  1IL8 A;  2B2W A;  3TEH B;  1VQ9 A;  2GA4 B;  3JAM L;  1B4O A;  5AJ3 Q;  1E24 A;  2D0P A;  4LAA A;  2Y0S G;  4IUU A;  2A6E C;  2XNA C;  1SMY D;  2EYF A;  4X66 Q;  5FLX L;  3ZJY C;  4CDE C;  3GP7 A;  2QEX A;  1B7Y B;  3L3O C;  4H13 C;  3J7Z C;  4OWT B;  1Q12 A;  2M00 A;  2L55 A;  1KLG D;  4I7A A;  2NWG A;  4A3I B;  2OT2 A;  4KN4 C;  2G5D A;  3U50 C;  2E76 C;  3NSW A;  5C4J H;  5ELN A;  3GV6 A;  4OL7 A;  5J1Z A;  2F52 A;  1AZP A;  1V8Q A;  4MN3 A;  1H9K A;  1SNC A;  4FO2 A;  2E2J B;  3FP9 A;  1CM9 A;  1VQJ A;  1Y8P B;  2HIX A;  4LFC L;  3DLL A;  1JJ2 A;  3CC7 A;  1PH1 A;  4CJ0 B;  4DV6 Q;  1JJC B;  3I8Z A;  1U4R A;  1R9T B;  3GTQ H;  2ZM6 Q;  4JBK A;  3MC0 B;  2QEJ C;  2Y0S B;  4Q0F A;  3R8B A;  1ENF A;  1C48 A;  4HCS A;  2IX3 A;  2KVM A;  4KN7 C;  2EJM A;  3I4L A;  2VQF Q;  5IWA L;  1CTM A;  2EYH A;  1BF4 A;  2B63 B;  5EJW A;  4OON A;  3N52 A;  4U67 3;  1VCI A;  2EIF A;  2B8F A;  1RDP D;  1PHJ A;  4AYB E;  5ELF A;  2HQL A;  1NMG A;  1K3B C;  3FRP B;  1GUS A;  4IJL A;  3GDE A;  4KD4 A;  5C4J B;  2BA0 A;  1MKH A;  4GKK L;  4DPG A;  2X69 A;  1I4X A;  1W3S A;  2JA7 H;  1ASY A;  2IWH A;  2JA7 G;  1H9S B;  1DZ1 A;  4E6I A;  1HXY D;  3M85 A;  3GTQ B;  5KYL A;  5IOC A;  3TRZ A;  5ELB A;  2NVY H;  4YWL A;  4DAV A;  1JCK B;  2MUY A;  1QE6 A;  2XN9 C;  3D6W A;  4X65 Q;  3JAM E;  1F77 A;  1D5X C;  2CFM A;  4DV3 Q;  4JI6 Q;  1V1P B;  4K2L A;  4O2D A;  1O78 A;  4B9W A;  1MJC A;  1QNK A;  4XTC S;  1HNX L;  5FLX E;  2EYO A;  3K7U C;  1OO9 B;  2K5W A;  1I94 Q;  4DKA C;  3A7L A;  3OIP A;  5LL6 S;  2DY7 A;  4CJ2 C;  3H3V H;  1Z9F A;  2B2W C;  1QZH A;  4CKB A;  4HID A;  1X6O A;  1K8O A;  5C4X H;  1D6E C;  3G7L A;  5C4X G;  4GNX C;  3SE0 A;  2JA7 B;  1LTG D;  2BA1 A;  2X6G A;  4DR5 L;  2IHF A;  4QIW E;  1N33 L;  2F4V Q;  4JI4 Q;  4DR2 L;  2DUD A;  1BOS A;  1X55 A;  5IYB H;  2VUM H;  2PNH A;  5IYB G;  4OGQ C;  4EQP A;  2VUM G;  2BOS A;  2CQO A;  1QUQ A;  1B44 D;  1HPC A;  2RHS B;  2F03 A;  3OOC A;  2BE5 D;  3UDI A;  4APV A;  1WD1 A;  3CC4 A;  3W1B A;  2CWA A;  3G6E A;  4QUF A;  1BNZ A;  1A2T A;  4G4K A;  1XNQ Q;  1JQY D;  1A0I A;  1NMF A;  4X64 L;  5IY0 A;  1KAA A;  5GAD C;  2NBF A;  2XIW A;  1N32 L;  4FXG C;  1ILP A;  3WDN A;  3T51 B;  1ENA A;  4NW2 A;  2OQ0 A;  5C4X B;  4LUV A;  3T1H L;  5EBC A;  1M4V A;  1IBK Q;  1YNX A;  3MXU A;  4LFA Q;  2PI2 E;  3I4O A;  2L11 A;  1MSG A;  4YHH Q;  2K4K A;  3S16 H;  5LMN W;  1EYC A;  2F0M A;  4X62 Q;  2VUM B;  3DWP A;  5D65 A;  3ZYY X;  1HUN A;  1QZG A;  3TS0 A;  1JE5 A;  3H91 A;  3AQQ A;  3RR5 A;  4IFD I;  1Q8K A;  3R3O A;  3CME A;  4FF2 A;  1TWC H;  3VA7 A;  1EIH A;  2NZ1 D;  4RGO S;  2JXM B;  4L6T B;  5CV6 A;  4G7Z C;  1F9Q A;  1STN A;  4P75 A;  1KL9 A;  2DNC A;  3VR5 A;  2JA6 H;  4DR7 L;  1LTB D;  4HJ9 A;  2JA6 G;  2Z0S A;  4NMZ A;  1A15 A;  2SEB D;  4BY7 H;  3SR1 A;  5FOB B;  4BY7 G;  5EKK A;  1Q1B A;  3BVG A;  3H0G H;  4R4O A;  2WIN B;  1PZK D;  3H0G G;  5M5X H;  1PTO F;  5JAV A;  4IUQ A;  1EEI D;  3QG1 A;  2IT1 A;  4LF9 L;  1Q81 C;  4ZUI A;  3AFP A;  1GD7 A;  5KNC A;  3CCS A;  3PF5 A;  5JJL A;  4DV4 Q;  2KBN A;  1HNW Q;  4DV5 L;  1TWH H;  2FMC A;  1SNQ A;  4FYD A;  3A5U A;  2AWN A;  1BCP C;  2A69 C;  1JC7 A;  1XWE A;  1CSP A;  1EIF A;  1NTG A;  1G29 1;  3K59 A;  2KCN A;  4JBM A;  2E2I H;  4YY3 Q;  4DR1 L;  1G2S A;  1BO0 A;  3F2U A;  4OEM B;  3TSS A;  1E22 A;  2IX0 A;  5BN5 A;  1SR3 A;  4XQQ A;  4L8J A;  4RMF A;  2QF7 A;  4DGZ A;  5DM7 3;  5LMU Q;  2JJQ A;  3CRK C;  2ZXO A;  1YHQ A;  1SRU A;  2OTL A;  3I55 A;  2OXP A;  1ZEQ X;  1YI2 A;  4HED A;  1TQO A;  4QUC A;  2XWJ B;  1U4M A;  2K04 A;  3BVM A;  4GN5 A;  4DV0 L;  5C4H A;  3K0Y A;  2EYP A;  1JE4 A;  2WAC A;  4QQB X;  1C9O A;  2VQE L;  4L5T A;  1FL0 A;  3TQY A;  3RD4 A;  2MO0 A;  1M90 C;  4LF7 Q;  2A6H C;  2E2D C;  4YCW A;  2HHH L;  1A63 A;  1FGB D;  2CWP A;  2LFN A;  2LXK A;  3D3R A;  4TKO B;  5LHY 1;  2WB1 B;  2EDG A;  4BBR B;  3IAY A;  3T4A C;  4KHP Q;  2H4O A;  1C7Y A;  1MSH A;  1U5K A;  2PZU A;  1T5E A;  1GM5 A;  2Q2U A;  1U9R A;  1AZQ A;  1SN8 A;  2FFK B;  4L5Q A;  2Z8L A;  1WFQ A;  1PH7 A;  4OX9 L;  1Y1V H;  2AQ1 B;  4YWM A;  5IIF A;  3G71 A;  1Y1V G;  1Z6H A;  2K32 A;  2V1C C;  1L2F A;  5EAY A;  4KKT A;  3OW2 A;  4JI8 L;  3BDL A;  2NVT B;  1PA6 A;  3P1H A;  5GQO A;  1PTO H;  1G2T A;  3D31 A;  3NK9 A;  3K80 C;  3S1N B;  3CKI B;  2K28 A;  5C3X A;  5CYU A;  4UDU C;  1ILQ A;  4FF4 A;  4ME3 A;  3J80 i;  3TP6 A;  1RHP A;  1PFB A;  2AUK A;  2C35 B;  1TY2 A;  1PXU A;  3OW7 A;  4DUY Q;  1P16 A;  1EY8 A;  2RHQ B;  3S2H H;  1J5E Q;  2RKS A;  1G8Z D;  4MNO A;  1PRT B;  2RDG A;  3NP8 A;  4RA8 A;  2AQ2 B;  4DFA A;  1LTA D;  4FF3 A;  4B3R L;  3CRL C;  2GN5 A;  4ME5 A;  2D2C C;  1EIY B;  1G6Z A;  3CF5 A;  3SVM A;  1GUO A;  1CFM A;  1EY5 A;  1TY0 A;  2KHI A;  3KFU A;  4DV1 L;  1GOZ A;  2PZT A;  4GKJ Q;  2PPB C;  1JJG A;  1S5F D;  3OMC A;  1P8L A;  1UE5 A;  1DD2 A;  3V2T A;  4QF4 A;  3H6M A;  2NVQ B;  5I2Y A;  3QO2 A;  3S14 B;  1ONL A;  1U0L A;  5CR3 A;  4X62 L;  4RGN A;  4CDD C;  1HNZ L;  2VY3 A;  2QIL A;  1RD9 D;  1E0B A;  3J80 c;  3KF8 B;  4LFB Q;  2K7V A;  4JG2 A;  4XT1 B;  3SK4 A;  1XNR L;  3SHL A;  1YJN A;  1KXL A;  1EY7 A;  2KHS A;  2C5C A;  2WAQ B;  3I91 A;  2Q2I A;  1VQO A;  1A6X A;  3R2I A;  1DON A;  2J4X A;  5FO8 B;  5JEA H;  4JI7 L;  1E1O A;  5JEA G;  2KUM A;  4FNF A;  1IBL L;  1JB7 A;  1LT4 D;  1LT6 D;  2OTJ A;  1KIX A;  1IZ6 A;  1I4G A;  2OCE A;  4GOP A;  1EL0 A;  2PYK A;  5IGF A;  3OWF A;  1YVC A;  2QGQ A;  1EYD A;  2KEC A;  4FXD A;  3ONA B;  2IPK D;  3CW2 C;  4QJF A;  2R92 H;  2E5L Q;  2R92 G;  3A5Z B;  3NUC A;  4OEL B;  4B3S Q;  2HD3 A;  1GUG A;  4XYQ A;  4JBJ A;  4X3U A;  1KDC A;  3W5O A;  1O7Y A;  3BYT B;  3QJY A;  3ERO A;  3IL8 A;  4LK1 C;  4NPS A;  2UU9 L;  4P72 A;  1X9N A;  1EIG A;  1YNN C;  4G7H C;  3S15 B;  3M4Y A;  4LW1 A;  1S40 A;  3NTH A;  1I4Q A;  3CCL A;  5BR8 L;  4IFD H;  3L0O A;  4IFD G;  3EBE A;  4NXM L;  4UP9 A;  4K5W A;  4TVA B;  1PRT D;  3GV3 A;  5J39 A;  2Y0S E;  4LF5 L;  4F88 A;  2Q8T A;  2F0N A;  4KTA A;  1WCM H;  1XPO A;  2R92 B;  1WCM G;  4MZ9 A;  2EVB A;  4V0B A;  1EWH A;  4LF8 Q;  4OXP A;  1VQC A;  4RGM A;  1PTO D;  3ULL A;  1KNE A;  3KOJ A;  4X3K A;  4ALP A;  2Q8R E;  4KY5 A;  4KJO A;  4DU9 A;  5DLQ E;  4F7X A;  2KED A;  1A3T A;  1U4L A;  3M3Y H;  2UXB Q;  4R8N A;  3J80 L;  4BBS B;  2JA8 H;  5JJI A;  5JVG 3;  1E2V A;  2JA8 G;  3AU7 A;  4IUN A;  2F0H A;  4CBV A;  4J1M A;  1JOR A;  2EZV A;  2B8G A;  2B2U C;  4N9P A;  4LF4 Q;  2G9D A;  2AMC B;  2YTV A;  1HRJ A;  1YIJ A;  2JN4 A;  1KAW A;  4G57 A;  5BN4 A;  2MO1 A;  4JI5 L;  1FD7 D;  4EQ5 A;  2F0U A;  1PVO A;  3I70 A;  1F2M A;  4DUZ Q;  2EYM A;  1VQ6 A;  3RLF A;  2F4I A;  2K5H A;  2AUJ D;  4JI2 L;  1PZJ D;  4MIU A;  4RCN A;  4CJ1 B;  1SYD A;  3WOF A;  2Z4I A;  1PMR A;  1QOH A;  2KHJ A;  4ABN A;  1D5M C;  4POF A;  2R61 A;  2MNA A;  2ID0 A;  1HUM A;  4ZQ3 A;  1NE3 A;  5E1F A;  3SK5 A;  4B3T L;  1JOQ A;  4J15 A;  2ENB A;  4R4Q A;  4GOP C;  1K0R A;  2PI2 A;  4LF6 Q;  2PNR C;  3OHX C;  2E74 C;  4KD3 A;  2UXC Q;  4ZYS A;  3MEH A;  1V9P A;  2VL6 A;  3LGJ A;  3TRE A;  1KHI A;  3CCJ A;  2XVS A;  1V43 A;  3MWY W;  4OO1 I;  5HGT A;  1WD0 A;  2WII B;  4IPG A;  1IW7 C;  2KCT A;  2XSC A;  4KHV A;  2QCP X;  3NHH A;  4RAU C;  2PO4 A;  3HKZ G;  1KAB A;  3AB9 A;  1HZ9 A;  5EPL A;  4FXK C;  3K57 A;  1CHP D;  4LNQ A;  3OMG A;  1J9O A;  3DM1 A;  1TWG H;  4EGV A;  3KLS X;  1UE7 A;  2K05 A;  3CAM A;  1N36 L;  3TP7 A;  1ET6 A;  4R4I A;  3LX0 A;  1SYC A;  3PF4 A;  5IGD A;  4WJ3 M;  2DJF C;  3MEF A;  1R9T H;  3LNN A;  2NYZ D;  3J80 E;  3PO3 B;  3Q6S A;  3CPW A;  4GNX A;  3HOU H;  5C0X I;  3EIV A;  3HOU G;  1VQE A;  1IYJ B;  1SE4 A;  3QR8 A;  1F2L A;  1XMO L;  1QUQ B;  1XPR A;  3EJI A;  4HCE A;  3N6R A;  1LTI D;  3KBX A;  4C1N I;  1UAP A;  1F2Y A;  3KLR A;  2B63 H;  3HOY B;  5M5W B;  4WRD A;  2B63 G;  1K8M A;  3V05 A;  1B8A A;  2G9H D;  1HA5 A;  2K5V A;  4JI1 L;  3I3C A;  5C5L A;  2L12 A;  4FVM A;  1CSQ A;  3L7Z C;  3HKZ B;  2GVB A;  1S5C D;  2ZT9 C;  5IP9 H;  1YHA A;  3D4D A;  3J81 i;  1I5F A;  5IP9 G;  3C2P A;  1JB3 A;  3KJO A;  1TWG B;  3EN2 A;  2C9O A;  1SFO B;  1YNJ D;  3DWQ A;  4OWW B;  3RZD B;  2JEB I;  4H02 A;  3TZD A;  1D1I A;  5T1I A;  1XTD A;  3OYY A;  2O2L D;  4DNI A;  5DM6 3;  4RFB A;  1Q46 A;  4KV6 A;  4TSS A;  3HOU B;  1VQH A;  5DNF A;  1X3Q A;  3RUZ A;  1IBM L;  5CV8 A;  4C1N K;  5AFW A;  2UUB L;  5I6Y A;  4HSP A;  4DAY A;  1S5D D;  5JOB A;  3URY A;  4K8I A;  1EYA A;  3UDF A;  4K6L A;  1DOM A;  1B53 A;  3T1Y L;  5CV4 A;  4JYA L;  2K01 A;  4DAM A;  1STG A;  1FNW A;  4X3S A;  4KHZ A;  4WOR A;  4BS9 A;  4JK1 C;  5M3M B;  1Q1E A;  2MHV A;  3J81 c;  2PQA A;  4DR3 Q;  1L1O C;  1TS3 A;  2M2L A;  1D8L A;  1Q7Y C;  5A35 A;  4OIJ A;  2R7F A;  2UUC Q;  3UE1 A;  3A54 A;  2UXD Q;  1CQF A;  5FO9 B;  2B29 A;  5IYD H;  3V96 A;  3VR2 A;  5IE8 A;  5IYD G;  2OWO A;  1STH A;  2SNM A;  3STB C;  4A3B B;  4HJ8 A;  2IHE A;  1XMQ Q;  3FKI B;  4NXN L;  1VQ4 A;  1X54 A;  1SYG A;  4XIG S;  3K5L A;  3MXN A;  1JR0 D;  1O7I A;  3TP8 A;  5IOD A;  3SGI A;  4C3I H;  3NWS A;  4QY7 A;  1MBY A;  1BUV T;  4C3I G;  1I4H A;  5IGG A;  1YBY A;  2Q2H A;  2R93 B;  1ASZ A;  1R4Q B;  2LSS A;  3I7F A;  1HR0 L;  2A6H D;  1KD1 C;  5C3E H;  1ESF A;  4TQU S;  5C3E G;  4B3M Q;  3MFY A;  1S72 A;  2PQE A;  3EFX D;  3NWT A;  5HGQ A;  5IT9 c;  3GTP H;  1GHJ A;  3VYS A;  3E6Z X;  5CV7 A;  5BN3 A;  4ZKC B;  3AFQ A;  4MTK A;  1WTW A;  4QCL A;  1D1K A;  3K5M A;  1HZB A;  1B2T A;  1GO3 E;  4NKL A;  2UUA Q;  3PMF A;  3DM3 A;  1RJT A;  4HJ7 A;  1MGS A;  4IPC A;  2FXQ A;  3K81 C;  2I5L X;  4A3F B;  3NEM A;  4NDX A;  2EOT A;  4M1U B;  1HTL D;  4B08 A;  4AIM A;  4C3I B;  2JP1 A;  1KRS A;  4OWX B;  5CBA E;  3F1Z A;  4GN4 B;  5TSS A;  2PMZ B;  2F0D A;  4DV7 L;  3T56 B;  1WVL A;  1CUK A;  3LWE A;  4A3J B;  4JI3 L;  3K7A B;  4WJ4 A;  5J3B A;  3NTI A;  5C3E B;  3NQI A;  3P75 A;  1STE A;  3S1Q B;  3R2T A;  4EX5 A;  4C3H B;  3J81 L;  5AJ3 L;  1QIL A;  5E3F A;  3HP3 A;  3GTP B;  4BA2 I;  1K9M C;  1PH3 A;  3J81 j;  4X66 L;  2CW0 D;  1TR5 A;  3UE0 A;  3ULJ A;  1NJI C;  3GTJ B;  1Z7T A;  3MHB A;  2LS0 1;  3A8I E;  3O13 A;  3A74 A;  2IX1 A;  4UY8 C;  1EQV A;  5IGC A;  3CCU A;  2F0S A;  1SSO A;  3A56 A;  1OXT A;  1YHB A;  1TT2 A;  5FO7 B;  3OTO Q;  3BDO A;  1F2Z A;  1PRT F;  4OO1 H;  4OO1 G;  4PMC A;  2B39 A;  1LTR D;  4A4I A;  1EY9 A;  1BBU A;  4DR6 Q;  2FHT A;  4JVZ A;  1IKM A;  1SMX A;  3SDZ A;  2K5Q A;  3QOJ A;  2HDM A;  4ULL A;  2ICE C;  3CXC A;  1IL2 A;  4DV6 L;  1I6V C;  1KDA A;  4LMQ D;  5EBD A;  2CVR A;  3GTL B;  2B2Y C;  4GLA C;  1MJE A;  2L4N A;  2PW5 A;  2ZM6 L;  3S9W A;  5IP7 H;  1S5B D;  1SJE D;  2F0O A;  1RKN A;  5IP7 G;  2YYZ A;  3HKS A;  4JPB W;  4K14 A;  5IT9 L;  2VQF L;  5L37 A;  1XPU A;  1DOK A;  1VQD A;  3FPU B;  2OQK A;  1N36 Q;  5K36 H;  2F0Q A;  5K36 G;  5C0X H;  4BBR H;  3WWV A;  1UE1 A;  5K5P A;  4A3M B;  1Y14 B;  1TS2 A;  2WB1 G;  3CHB D;  4BBR G;  3BZC A;  5C0X G;  2AKW B;  4R9W A;  5IGE A;  3S1M B;  1SBB B;  1X56 A;  2AWO A;  3MXP A;  1RCV D;  1SYF A;  2FIN B;  1FR3 A;  3F8T A;  4GOP B;  4A75 A;  2JEA I;  3NBI A;  2F0P A;  4AQY Q;  5DAU A;  2NVT H;  4HN7 A;  4EVO A;  5D14 A;  1NNX A;  2EY1 A;  3Q0A A;  3EA6 A;  3SXH A;  3S1N H;  5DEH A;  1BR9 A;  4DK0 A;  1AP0 A;  2EQS A;  4AYB B;  4JV5 Q;  4O1N A;  1CZW A;  4IOC A;  1X3F A;  5G3L D;  4ZLT F;  1VQ5 A;  3J81 E;  4X65 L;  4K2K A;  1EZ8 A;  1K28 A;  1NUC A;  2KQ3 A;  4BXX H;  2ES2 A;  4BXX G;  3W2D A;  4DV3 L;  1KNA A;  4JI6 L;  1FGU A;  3G4S A;  4K0K Q;  3MA2 B;  2F0I A;  4C3J H;  4C3J G;  4DV2 Q;  1VQA A;  1I94 L;  1RL2 A;  2RDF A;  1EQQ A;  1L0W A;  5LMN Q;  2Q2T A;  1YZ6 A;  4IZ8 A;  1X3E A;  1IYV A;  1Q86 C;  1E2W A;  1CA5 A;  1SYB A;  1I50 B;  4PZ7 A;  4K5V A;  1XXG A;  2ASB A;  2NVQ H;  4N8F A;  2F4V L;  4HIK A;  4JI4 L;  3S14 H;  3HOZ H;  2K1B A;  2VS1 A;  3HOZ G;  1GUT A;  4IUV A;  3DXJ C;  1TII D;  1EZ6 A;  3DEP A;  2D5D A;  3M4P A;  3MZ5 A;  3HZX A;  2PCF B;  4MHE A;  2WAQ G;  3CMA A;  3PUY A;  5E4W C;  2VW9 A;  2R7Z B;  1Y1W B;  1XNQ L;  5IT9 E;  4C3J B;  4JI0 Q;  3SK6 A;  4QIW B;  4IPH A;  4UP8 A;  1GUN A;  5FLM G;  3GO5 A;  1PFM A;  5I9P A;  3OWE B;  1STB A;  4A93 B;  5ELE A;  1B3Q A;  1UWV A;  2X6L A;  1VQP A;  2O4X A;  3E9H A;  1SJH D;  1LTS D;  2NZO A;  5JEA J;  3RN5 A;  3FDT A;  1FYC A;  1PH9 A;  4XT3 B;  1IBK L;  2B2U A;  2I5M X;  4J8Q A;  4LFA L;  3DHQ A;  4YHH L;  1TXY A;  3I4M B;  1YJW A;  1LO5 D;  2L15 A;  1N34 Q;  3HOZ B;  5NUC A;  3H94 A;  1LT3 D;  3HEJ A;  4RKL A;  2KJX A;  4A76 A;  3CQZ B;  3NEN A;  4DR4 Q;  5C6A A;  2B2T C;  3LWU A;  4X3T A;  1EY6 A;  3S15 H;  2JK8 A;  3PUX A;  1DOL A;  3NTK A;  3E0J A;  3I2Z A;  5I4D A;  5M3F H;  5I9O A;  5IGB A;  5M3F G;  1TWA B;  2BH2 A;  4DK6 C;  2KEE A;  2CH4 W;  2A68 D;  2L9H A;  3KDF A;  1I4P A;  4FF1 A;  1T9H A;  3P20 A;  4IPD A;  2RA4 A;  3RZO B;  2LKV A;  3A7A B;  4TRD A;  3PCO B;  1ZYR D;  5EGT A;  1PFN A;  4A3E B;  1S4Z A;  1HQM C;  4IFD J;  1NAP A;  1VQ8 A;  1FJG Q;  1L0X B;  1WTH A;  3ND8 A;  4LJZ C;  1QVF A;  2GVA A;  3FVQ A;  5A2Q L;  1M8A A;  3B6Y A;  4XDX A;  3CCR A;  1KQS A;  3S1R B;  1B3A A;  1V1Q A;  2D62 A;  1G6P A;  2A6E D;  4DV4 L;  1QG7 A;  2CCZ A;  3PUW A;  3GTG H;  1HNW L;  2YV5 A;  4KMU C;  3HFZ B;  2QA4 A;  2EY6 A;  4OIK A;  1EY4 A;  4BBS H;  4NB3 A;  4BBS G;  2VZA A;  5M3F B;  1TWF B;  3KYH C;  4YY3 L;  1J6Q A;  4LWC A;  2KCC A;  3GTO H;  2NB0 A;  3PIP 3;  4GNX B;  5LL6 X;  5LMU L;  4GLV B;  1BDO A;  4NP5 A;  4UHV A;  2FMM A;  4L63 B;  4PNY A;  2N3S A;  4DNT B;  4GZY C;  3HS0 C;  4A3C H;  2XRQ D;  4A3C G;  2ZJR A;  1AN8 A;  2K33 A;  2D9U A;  4LFC Q;  4HAE A;  3QWN A;  4PQX A;  5GAE C;  1RTN A;  3H3V C;  4B9X A;  5KNB A;  1EEF D;  4RHR A;  3T53 B;  2OEO A;  4LF7 L;  1LAB A;  3AMU A;  2RVL A;  1FNV A;  2F0F A;  4Y7N B;  3GTG B;  1XTC D;  4KHP L;  3ITP A;  2L5T A;  4K0K L;  1II3 A;  4HIO A;  2MFI A;  4PV1 C;  3K5N A;  1EY0 A;  4JOI C;  5IWA Q;  1A3U A;  1VQN A;  2NTT A;  1M1K C;  2LMC B;  2I5H A;  4HMJ A;  2RSO A;  3GTO B;  4I65 A;  3PO2 B;  3QB3 A;  1Q82 C;  1U4P A;  3BZD B;  2IL8 A;  1G91 A;  2WKC A;  4WFN 3;  3KLW A;  3C1E A;  2LXJ A;  1OXS C;  4WJW A;  1UUP A;  4DAY B;  2K52 A;  3CCE A;  3M4O B;  1AH9 A;  4DA2 A;  1QCB D;  3CPF A;  4KKU A;  1EUJ A;  3W1G A;  1DCZ A;  1JOK A;  4IN3 A;  3BZK A;  4R4C A;  5C44 B;  3S17 B;  1ESR A;  2SNS A;  2N88 A;  2ZXP A;  2QDL A;  4OHJ A;  1D2B A;  1MHW C;  4DUY L;  3HGB A;  3NBH A;  1WTX A;  4ILW A;  3A0J A;  1J5E L;  3TN2 A;  2K03 A;  2EXD A;  1EFI D;  2PQA B;  4DXG A;  5A2Q E;  1STA A;  4KK7 A;  3L2P A;  1PV4 A;  4HSV A;  1SE2 A;  4IUR A;  1JOO A;  4QL5 A;  1TU2 B;  1L1O A;  1K83 H;  1O80 A;  4JC0 A;  3U4V A;  2EY5 A;  1AFP A;  1RIP A;  3BG3 A;  1HNX Q;  3PO3 H;  4GKJ L;  3SEB A;  3PO3 G;  1QWY A;  4DXF A;  2CH4 A;  1SNP A;  2XWB B;  3TDQ A;  1GVP A;  1VDZ A;  4A3D B;  5J22 A;  1WJJ A;  1CKO A;  3HOY H;  1N34 L;  3CD6 A;  5M5W H;  1VMC A;  3IRB A;  4ID6 A;  4DN4 M;  4IO9 A;  3HOY G;  3MXN B;  3JC6 6;  3HOV B;  1ROD A;  2N49 A;  2ZTE A;  2EJF C;  2I46 A;  2WP8 J;  5JVH 3;  4LFB L;  1VQI A;  4DAP A;  4DR5 Q;  3NE5 B;  1XJV A;  1BCP B;  1N33 Q;  1H9M A;  3K0X A;  4DR2 Q;  2RF4 A;  1GXD C;  1CKM A;  2H5X A;  3OSO A;  1JWS D;  3KF6 A;  1SFO H;  1K3R A;  3NEL A;  3HG9 A;  3NPP A;  4KJN A;  1E3P A;  4KY6 A;  4BY1 H;  3RZD H;  4BY1 G;  2BH8 A;  2MJ8 A;  3RNU A;  3BJU A;  4JCV E;  3J7A F;  1K83 B;  3PIO 3;  1JT8 A;  2N55 A;  1BKB A;  5C5M A;  2E75 C;  1AEX A;  4LUO A;  2O5I C;  3T13 A;  3J7Y W;  2E5L L;  4H7B A;  4X64 Q;  1BVS A;  2RQX A;  1VQK A;  4J6H A;  1Y8O B;  4CKC A;  2FJ2 A;  4B3S L;  1N32 Q;  1BBW A;  2J0T D;  1CA6 A;  1DYQ A;  2VXW A;  3PGZ A;  4IUT A;  3T1H Q;  5M5Y B;  1NR2 A;  4H0L C;  4IQZ A;  3X3N A;  2ZJQ A;  5M3M H;  5M3M G;  2NUC A;  2DY8 A;  1LAC A;  4BY1 B;  3M7G A;  3G48 A;  2KA7 A;  4YIJ A;  5CBE E;  5G3L F;  3IKJ A;  1DJR D;  1JWM D;  1ICW A;  1A3V A;  2TSS A;  2HDL A;  1L0Y B;  1FVI A;  2MP1 A;  1VQG A;  3C3L A;  1PRT C;  4A3B H;  3FKI H;  4V19 0;  4A3B G;  3FKI G;  1PH2 A;  4DR7 Q;  1SE3 A;  3HOW B;  3VYU A;  4LF8 L;  2IJ0 A;  1CKN A;  2ZTD A;  5C4Z A;  1OXX K;  2R93 H;  3J7A 5;  1YEZ A;  1PTO C;  2R93 G;  2SDF A;  2KEN A;  3PQI A;  4LF9 Q;  1K8G A;  1STY A;  2UXB L;  1S3O A;  1PZI D;  1VQF A;  1NBW A;  1CK1 A;  3KK7 A;  1SE8 A;  1EOT A;  1EU4 A;  1BCP D;  2A69 D;  5EKL A;  4DV5 Q;  2K50 A;  1W6J A;  2PZW A;  5IYC H;  2MGS A;  4PZ8 A;  5IYC G;  2K5N A;  1JWU D;  1EQR A;  3CCQ A;  4LF4 L;  3MVV A;  2IY5 B;  3OPO A;  4A3K H;  3NQT A;  1WTR A;  4A3K G;  1IHZ A;  2B2Y A;  5CGK A;  2XTI A;  1ML0 D;  4DUZ L;  4F8M A;  3I90 A;  4DR1 Q;  2NTS A;  4A3F H;  3M7N A;  4A3F G;  2WB1 E;  3BU2 A;  2Z9H A;  1HQR D;  1E2Z A;  4BWG B;  4DK3 C;  5CMD A;  2RDH A;  4ZAI A;  4K5X A;  4O42 A;  2L1B A;  1G51 A;  3K5O A;  3W3A A;  3F2D A;  4DV0 Q;  2N78 A;  3MFG A;  4R1J A;  1BXT A;  3AYH B;  1YIT A;  2F0L A;  3A8K E;  4CKE A;  3D6C A;  4A3J H;  4UPA A;  2VQE Q;  1C8C A;  3K7A H;  2CQA A;  4A3J G;  1MI2 A;  4LF6 L;  1HH2 P;  3S1Q H;  2HHH Q;  2UXC L;  4C3H H;  2HCI A;  4C3H G;  4A3G H;  3D4R A;  3TBI B;  4A3G G;  1ZKO A;  2Q8I B;  2WKD A;  4A3K B;  1CT1 D;  4OX9 Q;  3GTJ H;  3KBG A;  3MAQ A;  2ICI A;  5ISR A;  4K6D A;  1TKW B;  1LYL A;  4JI8 Q;  4JW0 A;  3KJP A;  1SLJ A;  3EVQ A;  2B3G A;  2EYL A;  2B2V A;  1VS0 A;  3ER0 A;  1SDF A;  2CHB D;  4HIM A;  1DM0 B;  1PYS B;  4L5R C;  3ULP A;  2E8G A;  2A8V A;  3AEV A;  1VQ7 A;  1ENC A;  2K75 A;  2NVY B;  1WTV A;  1F9P A;  2JA5 H;  1YJ9 A;  2JA5 G;  2TMP A;  3ERQ A;  5CC4 A;  3GTL H;  1X3P A;  2WFW A;  1T5X D;  4YCV A;  4A3G B;  1X3G A;  5CV5 A;  1UEA B;  2E2H H;  4B3R Q;  4YWK A;  1QVG A;  2EJG C;  2BDN A;  4HTH A;  2MQH A;  4C2M H;  3T16 A;  1SMY C;  4DNR B;  2AHO B;  3IFD A;  4ZK9 B;  4DV1 Q;  3GQB A;  2WAQ E;  1EFW A;  4A3M H;  4A3M G;  1EYG A;  5EPJ A;  1TVX A;  3S1M H;  2VB3 X;  3DUZ A;  5JPM C;  3M9B A;  2DNE A;  3CP0 A;  3I56 A;  1VMP A;  1D5Z C;  2O5J C;  1BQQ T;  1FNU A;  3FPP A;  1IXR A;  1TS5 A;  2WV6 D;  5C0X J;  3K58 A;  1WTO A;  1HNZ Q;  5KEE A;  3UI2 A;  2HT1 A;  1ICF B;  3CU7 A;  4I7Z C;  4PMB A;  1OXV A;  1XNR Q;  2JA5 B;  4GLX A;  4H44 C;  5T1G A;  1YNJ C;  2BCO A;  4CDC C;  3K6O A;  2EXZ A;  3A55 A;  2L0C A;  2F0W A;  4HR7 B;  3PV0 A;  3KLS A;  4AYB G;  3D4W A;  5H1S E;  2HCC A;  4JI7 Q;  2E2H B;  1IBL Q;  1KDB A;  4R4T A;  3ND9 A;  1N8R C;  4C2M B;  3J7A V;  4AH6 A;  1HCZ A;  3VR6 A;  1H9S A;  5F2D A;  2F0T A;  4ZKB B;  2B2T A;  4UP7 A;  1QVC A;  3S16 B;  2CKZ B;  5GAG C;  5JJZ A;  2M9V A;  3KDF B;  4ODG A;  1HZC A;  2Z6B A;  2VNU D;  4DR3 L;  4LUZ A;  5C3W A;  1PH4 A;  2EPB A;  3I4N H;  3I4N G;  1IYU A;  4CDF C;  4PZ6 A;  1I50 H;  2UUC L;  1YNN D;  2UU9 Q;  1V1P A;  3UDX A;  1TWC B;  1BBX C;  2UXD L;  5I2X A;  3RLO A;  3D8G A;  1GHK A;  3C46 A;  3GTK H;  1XMQ L;  2MPM A;  2I07 B;  2HQE A;  5BR8 Q;  3GD7 A;  2JA6 B;  1WYD A;  4NXM Q;  2B2V C;  3QIA A;  5JPN C;  4BY7 B;  4LF5 Q;  2NN6 I;  1H95 A;  2R7Z H;  1Y1W H;  1NY4 A;  2D0O A;  1E1T A;  2R7Z G;  3H0G B;  1Y1W G;  1VF7 A;  1XX8 A;  5M5X B;  3EQL C;  2DN8 A;  3H15 A;  4M8A A;  4RCO A;  2ZJP A;  2K6A A;  1HHV A;  4A93 H;  5JJK A;  4A93 G;  2F0V A;  3FHW A;  3WOE A;  1PDQ A;  1KRT A;  1B9M A;  1SEB D;  4B3M L;  3E3X A;  2A5H A;  4XXE A;  3I4N B;  1UE6 A;  1SYE A;  4BA1 I;  1SNM A;  3PIP A;  1IKL A;  1TWH B;  2QW7 A;  3RN2 A;  3FEW X;  4G7O C;  3I4M H;  4QB4 A;  1CI3 M;  3I4M G;  4RH6 A;  1N9W A;  2Z6K A;  1JIC A;  2YU9 H;  1UEB A;  3D0F A;  3KUP A;  2JA9 A;  2E2I B;  1AE2 A;  3GTK B;  2UUA L;  1A2U A;  4RWS C;  4PMW A;  3U9S A;  1V1O A;  3CQZ H;  1WTQ A;  4P2C B;  5ELD A;  3BS1 A;  3GTM H;  2Z4H A;  3U58 A;  1LTT D;  3S24 A;  5D3I B;  4N9T A;  4JI5 Q;  2BE5 C;  3S2D H;  2JSO A;  3ERS X;  2RCF A;  1VQM A;  1TWA H;  2YTY A;  4P73 A;  1C4Q A;  5FLM H;  2NVX H;  4JI2 Q;  2F0J A;  4JOI A;  4XQJ A;  5GAH C;  1AW7 A;  3ICE A;  3H09 A;  3RZO H;  3L9A X;  2KOL A;  1F9S A;  2ZTC A;  4A3E H;  3OIQ A;  4S3S A;  1B70 B;  1W6K A;  3E0E A;  4A3E G;  1W2B A;  1CHQ D;  1PH5 A;  1LM0 A;  1X65 A;  2R3Z A;  4B3T Q;  1CQV A;  2YU9 B;  3DEO A;  3S1R H;  3NBH B;  1Y1V B;  1SAP A;  2A74 C;  2CW0 C;  1VQL A;  1AE3 A;  2EE1 A;  4HJ5 A;  4IUP A;  3GTM B;  1TS4 A;  1HA6 A;  1Q8I A;  2K14 A;  1EWC A;  1B1Z A;  5ELO A;  5EPK A;  1B9N A;  1VF5 C;  2DJG C;  5ELC A;  3OTO L;  2PW7 A;  1PTO B;  3VYT A;  3S2D B;  5COR A;  5EKI A;  1TWF H;  1HFG A;  3Q22 A;  4DR6 L;  4MTN A;  1IW7 D;  4P71 A;  1Z47 A;  2NVX B;  1L1O B;  3I72 A;  3HOX H;  1H9R A;  3HRZ C;  4FDB A;  3HOX G;  4XYO A;  4GS3 A;  1I4R A;  2ALY B;  3VA5 A;  1DGS A;  2DGY A;  3QOL A;  2R7D A;  3S2H B;  5I6W A;  1D7Q A;  3VYR A;  1J8I A;  1H9J A;  1EOV A;  1EQT A;  2F1M A; 
#chains in the Genus database with same CATH homology
 2N49 A;  1CSP A;  1EIF A;  2ZTE A;  3Q8D A;  1NTG A;  3PSI A;  3SGI A;  4C3I H;  2WP8 J;  1G29 1;  4QY7 A;  4JBM A;  4LFB L;  2E2I H;  1VQI A;  1YBY A;  4YY3 Q;  4DR5 Q;  2Q2H A;  4DR1 L;  1XJV A;  1N33 Q;  1ASZ A;  2LSS A;  3HKZ E;  1N36 L;  3K0X A;  4QGU A;  4Y7N H;  3I7F A;  4DR2 Q;  1E22 A;  3CCM A;  2IX0 A;  2RF4 A;  1PH8 A;  1SR3 A;  1HR0 L;  1CKM A;  2H5X A;  4RMF A;  1A62 A;  1HR0 W;  5LMU Q;  2JJQ A;  1LUZ A;  3KF6 A;  1KD1 C;  1SFO H;  1K3R A;  3KF6 B;  5C3E H;  4TQU S;  1SRU A;  1YHQ A;  3NEL A;  5C3E G;  1E3P A;  4B3M Q;  1XMO Q;  2OTL A;  3RZD H;  4BY1 H;  3I55 A;  4BY1 G;  2BH8 A;  1YI2 A;  5GRO A;  3RNU A;  1S72 A;  5HGQ A;  4GN5 A;  5IT9 c;  3BJU A;  4JCV E;  4DV0 L;  3GTP H;  4X6A H;  4IOA A;  2JQO A;  1I6H H;  1JT8 A;  4JI1 Q;  4QQB X;  1BKB A;  1LTL A;  3AFQ A;  1WI5 A;  3PO2 H;  3E9I A;  1C9O A;  4LUO A;  4AQY L;  1HZB A;  3PO2 G;  2VQE L;  4L5T A;  1FL0 A;  3TQY A;  1GO3 E;  2MO0 A;  1M90 C;  4LF7 Q;  2UUA Q;  3K8A A;  3PIO A;  2E5L L;  4YCW A;  3DM3 A;  2HHH L;  4X64 Q;  2CWP A;  2LXK A;  1BVS A;  2Z6K C;  4HJ7 A;  1A63 A;  1VQK A;  4IPC A;  2FXQ A;  4KHP Q;  3K81 C;  2I5L X;  3M4O H;  3NEM A;  3JAM i;  1C7Y A;  4B3S L;  1N32 Q;  1U5K A;  5C44 H;  3S17 H;  4JV5 L;  1PH6 A;  1GM5 A;  1BBW A;  5C44 G;  2Q2U A;  1MIU A;  4AIM A;  1SN8 A;  1HZA A;  3PGZ A;  4L5Q A;  1WFQ A;  3T1H Q;  1KRS A;  4OWX B;  1PH7 A;  4OX9 L;  3F1Z A;  3CCV A;  1JMC A;  1Y1V H;  4GN4 B;  2HIV A;  4YWM A;  3G71 A;  1Y1V G;  1WOC A;  2V1C C;  2ZJQ A;  5M3M H;  4DV7 L;  1L2F A;  5EAY A;  5M3M G;  3OW2 A;  4JI8 L;  1CUK A;  1PA6 A;  1A8V A;  4JI3 L;  4WJ4 A;  5J3B A;  2KCM A;  4DV2 L;  5GQO A;  1IBM Q;  2UUB Q;  4EX5 A;  1E7Z A;  3D31 A;  3G48 A;  3K80 C;  5AJ3 L;  4BA2 I;  1K9M C;  1PH3 A;  5LMN L;  2R6G A;  3T1Y Q;  3H3V I;  3J81 j;  4JYA Q;  4X66 L;  1FVI A;  3TS2 A;  4ME3 A;  3J80 i;  3UE0 A;  1VQG A;  2C35 B;  3ULJ A;  4DUY Q;  1NJI C;  4A3B H;  3PUZ A;  3FKI H;  1P16 A;  4A3B G;  3F2C A;  3FKI G;  1PH2 A;  4A3D H;  4DR7 Q;  2RHQ B;  3S2H H;  4A3D G;  3A74 A;  2IX1 A;  1J5E Q;  3RLN A;  4UY8 C;  1KC8 C;  3CCU A;  4P74 A;  3U4Z A;  4LF8 L;  1C0A A;  4MNO A;  2N8N A;  3JAM c;  1OXT A;  1YHB A;  3HOV H;  4GKK Q;  4B3R L;  3OTO Q;  1PYB A;  2RCN A;  3HOV G;  2GN5 A;  1GKH A;  2ATW A;  1CKN A;  2ZTD A;  4L5S A;  4OO1 G;  1CKN B;  4A4I A;  5FLX c;  1OXX K;  4RG1 A;  1BBU A;  1EIY B;  3CF5 A;  4DR6 Q;  2R93 H;  3J7A 5;  1YEZ A;  3KFU A;  2KHI A;  2R93 G;  2KEN A;  1HJP A;  2XGT A;  3STB D;  4DV1 L;  4LF9 Q;  1SMX A;  1K8G A;  4GKJ Q;  2UXB L;  1S3O A;  1VQF A;  1NBW A;  1JJG A;  1SRO A;  1SE8 A;  4POG A;  4JI0 L;  1UE5 A;  1P8L A;  3CXC A;  1IL2 A;  4DV6 L;  4NXN Q;  2I0Q A;  4DV5 Q;  2K50 A;  3PUV A;  4GLA C;  1MJE A;  5IYC H;  2ZM6 L;  4PZ8 A;  2F3I A;  5IYC G;  2K5N A;  5IP7 H;  1EQR A;  1U0L A;  4IJH A;  3CCQ A;  4X62 L;  5IP7 G;  4LF4 L;  2NN6 G;  4GN3 B;  1VQB A;  1HNZ L;  2A1A A;  2YYZ A;  2JE6 I;  3HKS A;  2IY5 B;  2VY3 A;  4A3K H;  1OXU A;  4A3K G;  3J80 c;  2VQF L;  3KF8 B;  4LFB Q;  4JG2 A;  1XPU A;  1XNR L;  1VQD A;  2XTI A;  5E7N A;  4DUZ L;  1YJN A;  4DR1 Q;  1KXL A;  2OQK A;  3M4Q A;  1N36 Q;  2Q2I A;  1I3Q H;  1VQO A;  5K36 G;  4BBR H;  3WWV A;  1UE1 A;  1HR0 Q;  4A3F H;  1Y14 B;  2OTJ A;  2WB1 G;  4BBR G;  5C0X G;  3M7N A;  3BZC A;  4A3F G;  2WB1 E;  3BU2 A;  1EWI A;  4KLK A;  2AKW B;  4PG3 A;  1E1O A;  4JI7 L;  4DK3 C;  5JEA G;  5M5Y H;  1IBL L;  1X56 A;  1JB7 A;  1G51 A;  2AWO A;  1K73 C;  1KIX A;  3F2D A;  4DV0 Q;  1IZ6 A;  2OCE A;  4KI0 A;  5FJ8 H;  4GOP A;  4DR4 L;  2N78 A;  2NZH A;  4GOP B;  3F8T A;  5FJ8 G;  4HJA A;  4R1J A;  4A75 A;  3AYH B;  1YIT A;  2JEA I;  1YVC A;  2PMZ E;  2QGQ A;  4YCU A;  4AQY Q;  4A3J H;  4UPA A;  2VQE Q;  2NVT H;  3K7A H;  4A3J G;  4LF6 L;  1HH2 P;  3CW2 C;  4QJF A;  2R92 H;  2E5L Q;  3F2B A;  3S1Q H;  2HHH Q;  2R92 G;  3A5Z B;  2UXC L;  5IYD H;  4C3H H;  3S1N H;  3CC2 A;  4A3G H;  4Y52 H;  2EQS A;  4B3S Q;  4A3G G;  4A3I H;  4JV5 Q;  4JBW A;  4A3I G;  4A3L H;  4JBJ A;  4IOC A;  1K8A C;  4A3L G;  1X3F A;  3UDG A;  1VQ5 A;  4OX9 Q;  3GTJ H;  4O0A A;  2YTX A;  3W5O A;  4X65 L;  4BXX H;  3VDY A;  1PFS A;  1OTC A;  4NPS A;  2ES2 A;  2UU9 L;  4DV3 L;  4P72 A;  4JI6 L;  1FJG L;  3HOW H;  2A19 A;  4BXX G;  1LYL A;  1X9N A;  4DV7 Q;  3HOW G;  1FGU A;  2E2J H;  5HY6 A;  3G4S A;  4JI8 Q;  4K0K Q;  3KJP A;  4C3J H;  4JI3 Q;  1SLJ A;  4LW1 A;  4DV2 Q;  1VQA A;  2B3G A;  1I94 L;  3TEH B;  1VS0 A;  1S40 A;  3ER0 A;  1VQ9 A;  4HIM A;  5BR8 L;  1RL2 A;  3CCL A;  3L0O A;  1PYS B;  4L5R C;  4IFD G;  3ULP A;  2E8G A;  5AJ3 Q;  2A8V A;  3AEV A;  3EBE A;  4NXM L;  1EQQ A;  1E24 A;  2D0P A;  1L0W A;  1VQ7 A;  4UP9 A;  4TVA B;  5LMN Q;  2Y0S G;  1YZ6 A;  2Q2T A;  2Y0S E;  2K75 A;  4X66 Q;  4LF5 L;  1X3E A;  2JA5 H;  1Q86 C;  3ZJY C;  1YJ9 A;  2JA5 G;  1WCM H;  4PZ7 A;  1XPO A;  2QEX A;  1WCM G;  4MZ9 A;  1B7Y B;  2ASB A;  3J7Z C;  2NVQ H;  3GTL H;  2F4V L;  4OWT B;  1Q12 A;  2WFW A;  4HIK A;  4JI4 L;  4OXP A;  4LF8 Q;  4YCV A;  3S14 H;  3HOZ H;  2VS1 A;  3HOZ G;  1X3G A;  2E2H H;  1VQC A;  4B3R Q;  4YWK A;  3U50 C;  1QVG A;  3ULL A;  3KOJ A;  5C4J H;  4ALP A;  3M4P A;  5ELN A;  2MQH A;  4C2M H;  2F52 A;  2AHO B;  5DLQ E;  4DV1 Q;  2WAQ G;  3CMA A;  3M3Y H;  2WAQ E;  1EFW A;  2UXB Q;  3PUY A;  4A3M H;  3FP9 A;  2VW9 A;  1VQJ A;  4A3M G;  2HIX A;  4LFC L;  3DLL A;  1EYG A;  1JJ2 A;  3CC7 A;  1XNQ L;  2JA8 G;  5JJI A;  1PH1 A;  4JI0 Q;  3S1M H;  4DV6 Q;  1JJC B;  4IPH A;  4UP8 A;  3M9B A;  5FLM G;  3GO5 A;  3GTQ H;  2ZM6 Q;  3CP0 A;  3I56 A;  4JBK A;  1UWV A;  1IXR A;  5C0X J;  1VQP A;  2YTV A;  2AMC B;  1HNZ Q;  4LF4 Q;  1YIJ A;  3E9H A;  2HT1 A;  1KAW A;  2MO1 A;  2NZO A;  4JI5 L;  2VQF Q;  4EQ5 A;  5JEA J;  1OXV A;  5IWA L;  3RN5 A;  1XNR Q;  1PVO A;  4DUZ Q;  4GLX A;  1PH9 A;  1IBK L;  2I5M X;  4LFA L;  1VQ6 A;  3RLF A;  4OON A;  2K5H A;  1VCI A;  2EIF A;  4YHH L;  1TXY A;  1YJW A;  2L15 A;  1N34 Q;  4JI2 L;  3PV0 A;  4AYB G;  1PHJ A;  5H1S E;  4AYB E;  2HQL A;  1NMG A;  4JI7 Q;  4IJL A;  3GDE A;  1IBL Q;  4R4T A;  2KHJ A;  4A76 A;  1N8R C;  3NEN A;  4DR4 Q;  4POF A;  2BA0 A;  1MKH A;  2MNA A;  2ID0 A;  4AH6 A;  1NE3 A;  4GKK L;  4B3T L;  4DPG A;  3S15 H;  2JK8 A;  3PUX A;  4J15 A;  3I2Z A;  4R4Q A;  1K0R A;  2PI2 A;  5M3F H;  1W3S A;  4GOP C;  4LF6 Q;  2JA7 H;  5M3F G;  1ASY A;  2JA7 G;  2BH2 A;  4DK6 C;  2UXC Q;  1V9P A;  4UP7 A;  1QVC A;  3M85 A;  2CKZ B;  2VL6 A;  3KDF A;  3LGJ A;  5GAG C;  3KDF B;  1HZC A;  3TRE A;  2VNU D;  4DR3 L;  4LUZ A;  3TRZ A;  1KHI A;  1T9H A;  2NVY H;  4IPD A;  4YWL A;  1PH4 A;  3CCJ A;  3PCO B;  3I4N H;  1V43 A;  3I4N G;  4X65 Q;  4PZ6 A;  4OO1 I;  1I50 H;  2UUC L;  2CFM A;  4IFD J;  2UU9 Q;  4DV3 Q;  1VQ8 A;  4JI6 Q;  1FJG Q;  4O2D A;  3UDX A;  1MJC A;  4XTC S;  1QVF A;  2UXD L;  3RLO A;  4IPG A;  1HNX L;  2KCT A;  2GVA A;  3K7U C;  3CCR A;  3B6Y A;  1I94 Q;  3GTK H;  1KQS A;  1XMQ L;  4DKA C;  1V1Q A;  3HKZ G;  2D62 A;  1HZ9 A;  5BR8 Q;  1G6P A;  3GD7 A;  4DV4 L;  2CCZ A;  3PUW A;  3GTG H;  4LNQ A;  1WYD A;  1HNW L;  4NXM Q;  2YV5 A;  3HFZ B;  3H3V H;  2QA4 A;  1TWG H;  1Z9F A;  1UE7 A;  3CAM A;  1QZH A;  4LF5 Q;  4HID A;  1X6O A;  2NN6 I;  4BBS H;  1H95 A;  4NB3 A;  2R7Z H;  5C4X H;  1Y1W H;  4BBS G;  1NY4 A;  2D0O A;  4R4I A;  1E1T A;  2R7Z G;  5C4X G;  4GNX C;  1Y1W G;  2VZA A;  2BA1 A;  3KYH C;  4YY3 L;  3H15 A;  1J6Q A;  2IHF A;  4QIW E;  4DR5 L;  3PF4 A;  3MEF A;  4WJ3 M;  1R9T H;  2ZJP A;  1N33 L;  2F4V Q;  4LWC A;  4A93 H;  4JI4 Q;  4DR2 L;  5JJK A;  2DUD A;  3GTO H;  4A93 G;  1X55 A;  5IYB H;  3FHW A;  3CPW A;  4GNX A;  2VUM H;  3HOU H;  2PNH A;  5IYB G;  5C0X I;  4GNX B;  3EIV A;  1KRT A;  5LMU L;  2VUM G;  3HOU G;  1VQE A;  4GLV B;  1IYJ B;  2CQO A;  1QUQ A;  4B3M L;  1XMO L;  1QUQ B;  1XPR A;  2N3S A;  1UE6 A;  4BA1 I;  2RHS B;  3PIP A;  2B63 H;  3UDI A;  4A3C H;  2B63 G;  3RN2 A;  4APV A;  3CC4 A;  2ZJR A;  1B8A A;  2CWA A;  3W1B A;  3I4M H;  4A3C G;  3G6E A;  2K5V A;  4JI1 L;  3I4M G;  4LFC Q;  1XNQ Q;  1N9W A;  2Z6K A;  5GAE C;  2YU9 H;  1UEB A;  3D0F A;  1CSQ A;  3L7Z C;  2JA9 A;  1AE2 A;  4LF7 L;  2GVB A;  1A0I A;  2UUA L;  4PMW A;  1NMF A;  3CQZ H;  4X64 L;  5IY0 A;  5IP9 H;  1YHA A;  5GAD C;  3J81 i;  1I5F A;  5IP9 G;  3U58 A;  3GTM H;  4KHP L;  4K0K L;  3KJO A;  1N32 L;  4HIO A;  3EN2 A;  3S24 A;  2MFI A;  4OWW B;  4JI5 Q;  4JOI C;  2OQ0 A;  3S2D H;  4LUV A;  2JEB I;  3ERS X;  4H02 A;  5IWA Q;  3T1H L;  1VQM A;  1VQN A;  1IBK Q;  1TWA H;  1M1K C;  1YNX A;  4LFA Q;  2PI2 E;  2YTY A;  4P73 A;  3I4O A;  5FLM H;  2NVX H;  2I5H A;  4YHH Q;  2K4K A;  3S16 H;  4JI2 Q;  1XTD A;  3OYY A;  4DNI A;  5LMN W;  4JOI A;  5GAH C;  1Q46 A;  4X62 Q;  3ICE A;  1Q82 C;  1VQH A;  2JA8 H;  3RZO H;  2ZTC A;  1QZG A;  3KLW A;  3TS0 A;  1IBM L;  2LXJ A;  1OXS C;  2UUB L;  1JE5 A;  4A3E H;  3AQQ A;  1B70 B;  2K52 A;  3E0E A;  3RR5 A;  4DAY B;  3UDF A;  3CCE A;  4A3E G;  1Q8K A;  1W2B A;  1PH5 A;  4IFD I;  1LM0 A;  1AH9 A;  3CPF A;  3CME A;  1EUJ A;  1X65 A;  3W1G A;  1TWC H;  3BZK A;  4R4C A;  3T1Y L;  4B3T Q;  4JYA L;  4DUY L;  4P75 A;  1KL9 A;  4DAM A;  3S1R H;  3NBH B;  1VQL A;  2JA6 H;  3A0J A;  1AE3 A;  4DR7 L;  4HJ9 A;  4KHZ A;  1J5E L;  2Z0S A;  2JA6 G;  1Q1E A;  4HJ5 A;  3J81 c;  2EXD A;  2PQA A;  4DR3 Q;  2PQA B;  1L1O C;  2K14 A;  4BY7 H;  4BY7 G;  5ELO A;  3L2P A;  1PV4 A;  1Q1B A;  3OTO L;  3H0G H;  4R4O A;  1D8L A;  3H0G G;  1Q7Y C;  5M5X H;  1TWF H;  2UUC Q;  2R7F A;  4QL5 A;  4DR6 L;  4MTN A;  4P71 A;  1L1O A;  1K83 H;  1Z47 A;  4JC0 A;  1L1O B;  3U4V A;  3UE1 A;  1RIP A;  2IT1 A;  2UXD Q;  4LF9 L;  1Q81 C;  2B29 A;  3HOX H;  3AFP A;  1HNX Q;  3PO3 H;  4GKJ L;  5IE8 A;  4FDB A;  5IYD G;  3HOX G;  3PO3 G;  2OWO A;  1GD7 A;  3STB C;  4HJ8 A;  2IHE A;  1XMQ Q;  4GS3 A;  3CCS A;  2ALY B;  3PF5 A;  5JJL A;  1DGS A;  1GVP A;  2DGY A;  4NXN L;  2R7D A;  2KBN A;  4DV4 Q;  1VQ4 A;  1HNW Q;  4DV5 L;  1WJJ A;  1CKO A;  1TWH H;  3HOY H;  1X54 A;  1N34 L;  3CD6 A;  5M5W H;  1D7Q A;  4XIG S;  3A5U A;  3IRB A;  2AWN A;  3HOY G;  4IO9 A;  3MXN B;  3JC6 6;  1EOV A;  1O7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...