2GVAA

Refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna-binding (viral)
molecule keywords GENE V PROTEIN
total genus 5
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gvaA00
3GO5A 3PF5A 5JEAG 4JOIA 4A3MG 1VQ9A 2IT1A 3M85A 1Z9FA 4X66Q 4QJFA 5M5WH 1KXLA 1A62A 1GD7A 1PA6A 2JA8H 3PIPA 4LFAQ 1KIXA 4NXML 4R1JA 1EIYB 1XPUA 3H15A 1GKHA 1VQKA 1Q46A 3S1NH 3M4QA 3ERSX 1CUKA 1PV4A 1IL2A 2IY5B 4GOPC 2NN6I 5C0XJ 1RL2A 3TS0A 4AIMA 5IP7G 4X64Q 3J7A5 4LF8L 4QY7A 1X56A 2CCZA 3KLWA 2UUBL 2JA7H 4RG1A 3PO2H 3OYYA 1IBML 2UUCQ 1X54A 4P72A 5M3FH 2JA7G 3PO2G 3ER0A 3HOXG 4LF5L 1XMOQ 2B29A 2V1CC 2ZTCA 1VQ5A 1YJ9A 2N3SA 3E0EA 1SR3A 1KHIA 1PH5A 1G6PA 1D8LA 2XGTA 4DR7Q 2VQEL 1VQIA 1EFWA 3J80i 1FJGQ 5JJKA 1UE5A 2F4VL 3J80c 2I5MX 4YWKA 4BXXG 2NVQH 2UUCL 2ZM6Q 1X55A 3I4NH 1UE1A 2UXCL 5C4XG 3HKZG 2K4KA 4GLXA 1KL9A 3KJOA 4A3MH 1PYBA 4BY1H 4PG3A 3CXCA 4P74A 5M5YH 2JA8G 2NVTH 2Q2TA 1N36Q 1HNXL 3E9HA 1FVIA 4UP8A 4POGA 1XPRA 4A4IA 1TWGH 1BBUA 3CCJA 4DV0Q 4NXNQ 1H95A 5M5XH 1GVPA 4JYAQ 2WB1G 2CQOA 3HOZG 3CAMA 3NBHB 2YTVA 3HKSA 4P73A 2JA6H 2CWAA 4GN3B 4A3GG 4JBJA 3A5ZB 1KAWA 2JA6G 5H1SE 4A3GH 2IX1A 4B3RL 1N34L 1L0WA 1AE2A 4Y52H 4HJAA 1CKMA 1W3SA 4KHZA 1P16A 4IOCA 1Q7YC 2NZOA 1QZGA 4LF6L 3D0FA 2PI2A 4ALPA 1WJJA 3AQQA 3AFPA 2RHSB 4OONA 4YHHL 1G51A 1ASYA 4JI7L 1QVFA 4DR1Q 1XNRQ 3S1MH 4JBMA 2ATWA 3CCMA 3S16H 3S2HH 4LWCA 4JC0A 5IYCH 4DR7L 4BBRG 2JK8A 3AFQA 1N9WA 3CW2C 4BY1G 3CCVA 3ULJA 2ALYB 5C4XH 3J7ZC 5LMNL 2ZJQA 3I4NG 2OCEA 4HJ5A 4J15A 3ICEA 1VQHA 4BXXH 2ZJRA 3I7FA 1QUQB 2ZM6L 1NJIC 1JMCA 3L7ZC 2QGQA 3HOVG 4JI5L 1I3QH 3UE1A 1EYGA 2E5LQ 4JI6L 4JV5Q 1CSPA 4LNQA 2Y0SG 2UXDL 1N8RC 1OXSC 1LTLA 5GAEC 1B8AA 1J6QA 1TXYA 3HOXH 5AJ3L 5ELNA 1C0AA 5M3FG 1JT8A 2R7FA 2PQAA 4JG2A 2DUDA 2Q2HA 1RIPA 3CCUA 4JBKA 4DUYL 3DM3A 1E22A 2YTXA 5IP7H 2OTLA 2QEXA 3U58A 1J5EQ 1C7YA 2VQFQ 3A0JA 2BH2A 4DR6Q 1CKNB 3JAMi 4YCWA 5C0XI 4YWLA 3T1YQ 4IPGA 1O7IA 4HIDA 2JE6I 1IYJB 1HJPA 1YJWA 3VDYA 4NXMQ 4YHHQ 2VS1A 4C3IH 2E2JH 1EUJA 1X3FA 3KOJA 3S24A 4QGUA 3BZKA 2EQSA 4X62L 1HNZQ 1OXVA 1OTCA 3PUVA 3CCEA 4JI0Q 1YZ6A 2K75A 1Y1WH 3UDXA 4DV1Q 1VQ4A 1YJNA 4LF9Q 5HGQA 3CF5A 1UEBA 4GN4B 5FLMH 3Q8DA 4IO9A 1YEZA 1IBMQ 3UDIA 2DGYA 1IBLQ 1X6OA 1ASZA 2R92G 1VQBA 3MXNB 1PH3A 1R9TH 1PH9A 3CPWA 3H3VH 4DV4L 4IFDG 4MNOA 4Y7NH 1SROA 2PQAB 1YIJA 2VQEQ 1VQJA 1A8VA 2VY3A 5C3EH 1TWAH 4IPCA 4JBWA 1PHJA 3CC4A 3H0GG 4BY7H 4IOAA 1TWHH 5FLXc 4LF7Q 2AKWB 3K81C 4OWTB 2AHOB 3RNUA 1EOVA 4APVA 4BBSH 3NELA 3STBC 4GNXB 4LW1A 4LF4Q 1T9HA 4JCVE 2KCMA 3T1HQ 1VQEA 3KYHC 3PSIA 4HIOA 1QZHA 3KF6B 1VQNA 4DV6L 3KFUA 2YYZA 1L1OA 4H02A 4AH6A 3PUYA 2UU9Q 4JI4Q 1K3RA 3UDFA 2EXDA 4LUOA 2PI2E 3S2DH 2H5XA 4DK6C 3J81j 1HZBA 2KCTA 3CP0A 5FJ8H 5IP9G 4DR5Q 2N78A 5GQOA 2LSSA 1AE3A 4B3SQ 2I5HA 2HHHQ 4IPDA 1HZ9A 5K36G 1KRTA 1B7YB 4DV4Q 4DR1L 3CC7A 4DUZQ 1YITA 2WB1E 1XNQL 1D7QA 1M1KC 1C9OA 3NENA 1I94Q 4JI3Q 3RZOH 4A93H 1OXTA 3SGIA 5HY6A 2VW9A 1VQDA 3CCSA 1KC8C 3HOWH 2RHQB 1UWVA 3HOYG 2AWOA 1OXUA 2MQHA 5IY0A 1Y1VH 2K52A 4PZ7A 3TRZA 3A5UA 2JEAI 3TS2A 4DKAC 3TQYA 2K5VA 3FP9A 4ME3A 3H3VI 2UXBQ 1N32L 4OXPA 3HFZB 1SMXA 2HIXA 2I5LX 4JI5Q 4RMFA 4LF5Q 1L1OC 4JYAL 3J81c 4EQ5A 4JI6Q 1LUZA 1PH4A 2JA9A 4MTNA 4DUZL 2RF4A 1W2BA 1XNQQ 4AQYL 1JJ2A 1K8GA 3CC2A 4X65Q 3PGZA 1V9PA 3GTJH 3OW2A 3PF4A 3A74A 3RLNA 2PMZE 3NEMA 1B70B 4HIKA 4LF9L 4K0KQ 4A3EG 1UE7A 4KI0A 3ZJYC 4KHPL 4DV2Q 4C3JH 1Y14B 4JI7Q 4UY8C 4R4TA 3F2CA 1NY4A 1XNRL 4QIWE 4A3DG 1LM0A 4DR3L 2Q2IA 3RLOA 4A3FH 1HZAA 3ULPA 2D0OA 2JA5H 5GROA 2VL6A 1WYDA 4X65L 2GVAA 4DV7Q 3U50C 4DAMA 3PO3H 1WFQA 4DR2Q 5JJIA 2ID0A 2UUAL 4GNXC 2YTYA 1I94L 1U5KA 4JOIC 1DGSA 3I2ZA 2OQ0A 4A3KG 4DNIA 4HJ8A 1N34Q 1WOCA 4X66L 4B3MQ 3EIVA 4DV7L 1AH9A 3CPFA 1CSQA 4GNXA 3CMEA 4OX9Q 1N32Q 3BU2A 5E7NA 4B3TQ 1CKNA 2L15A 4DUYQ 2BA0A 4QQBX 1HH2P 1X65A 3K0XA 5C44G 2UXCQ 1N33Q 1PH1A 3EBEA 2PNHA 3EN2A 1V1QA 5GADC 3GTMH 2C35B 1VQMA 5BR8L 3F8TA 4A3JH 3KF8B 1Q82C 5IYDH 4HJ9A 4B3ML 3HOUH 1XMQQ 1VQ7A 4A3LG 5LMUL 3GTKH 1HR0W 3I4MG 2HHHL 4BA1I 1WCMG 1XMOL 5ELOA 2R7ZH 3K7AH 2CKZB 4FDBA 1VQCA 2BA1A 4OWXB 4JI3L 2R93H 1FJGL 1QUQA 3RN5A 2N8NA 4B3RQ 2VUMH 3FHWA 4C2MH 2EIFA 2GN5A 4GLVB 1PH7A 5LMUQ 1PH8A 1EQQA 3HKZE 2OQKA 2RCNA 1HR0Q 2NVXH 4R4CA 4R4QA 2VNUD 2WAQE 4LFCL 2N49A 3PV0A 3PUXA 4A3CG 2HQLA 1YVCA 4AQYQ 3FKIG 2R93G 3ULLA 1Q86C 1Q1BA 2BH8A 3K80C 4OWWB 2R7ZG 3GTPH 4GOPB 5GAHC 4OX9L 2B63G 4A3BG 1MJEA 1EQRA 1HNWQ 1JJGA 2NVYH 3S17H 1X9NA 1OXXK 3HOUG 1HNZL 1TWCH 4YWMA 5IYBH 2E2IH 1YHQA 2IHFA 2E8GA 4A3IH 3S15H 4DR3Q 2KHIA 1NE3A 3OTOL 4IJLA 2Z6KC 5AJ3Q 2KHJA 4DV6Q 1IBLL 1E24A 2AMCB 3LGJA 4L5QA 1EWIA 1U0LA 3F2BA 2D62A 1A63A 1SFOH 1J5EL 2B3GA 4POFA 5M3MG 5M3MH 1XTDA 1YBYA 3G48A 3B6YA 5IWAQ 4X64L 3M9BA 4A3KH 3T1YL 2XTIA 1JE5A 4P71A 1N36L 1VQFA 5JEAJ 1HNXQ 3G4SA 3W1GA 1HR0L 2OTJA 2Z6KA 3PO3G 2E5LL 2K5HA 3F1ZA 3I55A 2K5NA 3RZDH 1KQSA 4L5SA 4LF4L 1L2FA 1FL0A 2JA5G 4DV5Q 2K50A 4A3IG 4A3FG 1N33L 3AEVA 4WJ4A 4JI1Q 3IRBA 3U4ZA 3PUWA 5IYBG 2WP8J 1QVCA 4JI2Q 2F4VQ 4DV1L 4IJHA 1HNWL 1CKOA 3GTLH 4LUZA 1Z47A 1Q1EA 4L5TA 3CCLA 4NPSA 2Y0SE 1K73C 4OO1I 3TREA 3I4OA 1VCIA 3PIOA 2B63H 4A3BH 2VQFL 2AWNA 4YCUA 2NZHA 4PMWA 3FKIH 4DR5L 4DR6L 4A3CH 2A1AA 3CCRA 1S72A 1E1TA 4UP9A 1M90C 3RLFA 3D31A 2VZAA 4TVAB 1JB7A 4L5RC 4NXNL 4DV0L 4LF8Q 2Z0SA 1E3PA 1YI2A 4B3TL 4LF7L 3BJUA 2A8VA 3S1QH 3GTQH 3L0OA 4K0KL 4KHPQ 4YY3L 2VUMG 1KRSA 4GN5A 3RR5A 1IBKQ 1NBWA 4HJ7A 3PUZA 4JI0L 3HOWG 4JV5L 5IWAL 2YV5A 4DV3Q 2D0PA 4TQUS 1V43A 1QVGA 1VQ8A 1WCMH 4GKKL 1VS0A 3I4MH 4NB3A 4A3LH 2UU9L 5IYDG 2I0QA 4A3JG 1UE6A 4DK3C 3J81i 4DR4Q 1MKHA 4PZ8A 1SRUA 5FJ8G 5IP9H 1YNXA 2ES2A 5C44H 5LMNQ 3I56A 4LUVA 1IXRA 4B3SL 2CWPA 4A75A 1G291 1IZ6A 3STBD 4AYBG 3WWVA 1PH6A 2LXKA 1PH2A 1VQ6A 1K0RA 2JEBI 1X3GA 2UXDQ 1S40A 2WFWA 3G71A 3T1HL 1WI5A 5DLQE 5C0XG 1VQLA 3K8AA 1P8LA 3M7NA 3TEHB 3F2DA 1XMQL 2UXBL 2UUAQ 3H0GH 4BY7G 3AYHB 1I5FA 3GD7A 2MNAA 2LXJA 4DV5L 4A3DH 1XPOA 3M3YH 2CFMA 4GS3A 4LFBQ 1HZCA 3JAMc 2R92H 4A3EH 5J3BA 3CCQA 2R7DA 5FLMG 4DR4L 1YHBA 3JC66 3E9IA 3UDGA 1Q8KA 2KENA 1S3OA 1NTGA 3GDEA 5BR8Q 1BBWA 2K14A 4IFDI 2ZTEA 2NN6G 3U4VA 5IE8A 1Q81C 3M4OH 1TWFH 1PVOA 4OO1G 2MFIA 1Q12A 4LFAL 2QA4A 3KJPA 1K9MC 1XJVA 4DAYB 4JI4L 2HIVA 3GTGH 4AYBE 1VQAA 1Y1VG 4YY3Q 2HT1A 2IHEA 3HOYH 3CD6A 2IX0A 1KD1C 4XIGS 4A93G 2R6GA 3W1BA 3PCOB 5C4JH 4JI2L 3CMAA 4QL5A 4UP7A 1GM5A 3BZCA 3OTOQ 3S14H 3M4PA 4KLKA 4JI8L 4GKJL 4YCVA 4LFCQ 4DPGA 3KDFA 1YHAA 4GOPA 4BA2I 5JJLA 4R4OA 2Q2UA 1I50H 4X62Q 1VQOA 2KBNA 2FXQA 4P75A 4IFDJ 5LMNW 3RN2A 1NMGA 4O2DA 3HOVH 4LFBL 3UE0A 2E2HH 4PZ6A 4LF6Q 1SLJA 1Y1WG 4WJ3M 2WAQG 4UPAA 1IBKL 3DLLA 1X3EA 3MEFA 1PFSA 2OWOA 2F3IA 1JJCB 2GVBA 4BBRH 1L1OB 2ZTDA 5IYCG 4R4IA 5EAYA 4DV3L 4GKKQ 4JI1L 1E1OA 4BBSG 4A76A 1SE8A 2ZJPA 3S1RH 2UUBQ 1BVSA 2MO1A 3CQZH 4IPHA 4O0AA 1A0IA 1SN8A 3G6EA 2ASBA 4EX5A 2MO0A 1K83H 4GLAC 2JJQA 4DV2L 4X6AH 5C3EG 1GO3E 4C3HH 1E7ZA 1LYLA 1MJCA 1BKBA 2F52A 1EIFA 3KDFB 3L2PA 4XTCS 3W5OA 2JQOA 1K8AC 3HOZH 1MIUA 4JI8Q 1PYSB 4GKJQ 1I6HH 4DR2L 4HIMA 1VQGA 2YU9H 5IT9c 3GTOH 1NMFA 3K7UC 3KF6A 1VQPA 5GAGC 4MZ9A 2A19A 1FGUA
chains in the Genus database with same CATH superfamily
3BZDB 3PF5A 2KA7A 4A3MG 4QIWB 1VQ9A 4C3IG 2KECA 3PIPA 2SNSA 1EIYB 4K2KA 1GKHA 1VQKA 3M4QA 2IY5B 1HUNA 1G2SA 4X64Q 2EJFC 5M5WB 4ZK9B 4RH6A 1X54A 3PO2G 3ER0A 1YNND 3E0EA 1D8LA 2KQ3A 5KNDA 4U68A 2VQEL 2F4IA 5JJKA 1SBBB 3J80c 2B2UA 4LK1C 2CH4W 2UXCL 3TP8A 1PYBA 3HGBA 2R3ZA 3TDQA 2IL8A 4K5XA 1B1ZA 1N36Q 5HURA 3I4MB 1CK1A 1EQTA 3CCJA 1JR0D 5M5XH 1GVPA 4JYAQ 2CQOA 3HOZG 1BCPC 4P73A 2CWAA 3HKZB 1LT6D 3BG3A 1KAWA 2JA6G 4B3RL 1QZGA 1W3SA 4LF6L 4K14A 4BWGB 3D0FA 3AQQA 4JI7L 2K5QA 2AQ3B 2Y0SB 3C1EA 2B63B 1CHPD 1IL8A 4BY1G 3CCVA 5LMNL 3I4NG 1FNWA 5A2QE 4BXXH 1QNKA 1JMCA 1K83B 4CKEA 1SNQA 3UE1A 5LHY1 2E5LQ 2HDLA 4JV5Q 4LNQA 4ABNA 2IW3A 5GAEC 1TXYA 4ODGA 5AJ3L 2R7FA 2PQAA 1DD2A 1RIPA 1Q3LA 4JBKA 1DCZA 4DUYL 5EPLA 3SEBA 3R8BA 2OTLA 2QEXA 2A68D 3A0JA 1TWHB 2XVSA 3JAMi 4YCWA 4IPGA 1KNAA 3H91A 4L8JA 4DK1A 2XIWA 2E2JH 1X3FA 3KOJA 3QB3A 5CV5A 3T13A 4CDCC 3CCEA 3GV6A 2OEOA 1YZ6A 2K75A 4B9XA 2B2UC 1DXMA 4PMBA 4DV1Q 1VQ4A 4LF9Q 1D1KA 1SJED 3S1RB 4GN4B 2A6HC 5E4XA 2F0EA 3D3RA 2R92G 1VQBA 3IFDA 4XQJA 1R9TH 3H3VH 3X3MA 4IFDG 1BUVT 3EVQA 2CHBD 1VQJA 1A8VA 1LLRD 5C3EH 2RSNA 1HTPA 4BY7H 3H0GG 5ISRA 1SSOA 1CFMA 2A69C 3FDTA 3DWPA 3HOWB 2F0VA 2IX3A 1GOZA 1JOQA 1D5MC 4DAPA 3T1HQ 4HIOA 2YYZA 1L1OA 4AH6A 3PUYA 1ENCA 3QJYA 4ZKCB 4H44C 4U673 2NUCA 1PFBA 4RHRA 2PI2E 3S2DH 4FYDA 2H5XA 1HZBA 4KJNA 5KGUA 1VDZA 1U4PA 2WKCA 5GQOA 2G9HD 1HZ9A 3E3XA 1YNNC 1B7YB 4J6HA 5FOBB 1C9OA 3K5MA 1OXTA 1RTOA 2L9HA 5E1FA 3NWTA 5HY6A 3SGIA 5C3EB 3CCSA 1XYIA 3HOWH 3HOYG 3MXGA 5IY0A 2MUYA 2K52A 3TRZA 3A5UA 1L0YB 1A3TA 2K5VA 5E3FA 3H3VI 1SMXA 2DN8A 2I5LX 3IAYA 1HUMA 1IKMA 4JVZA 4FXKC 2JA9A 2K1BA 4MTNA 4AQYL 3V96A 3ZYYX 1CQVA 1LTSD 1V9PA 3GTJH 4QUCA 3RLNA 2J0TD 1B70B 4KHPL 1PDQA 3T16A 3J7YW 4DV2Q 1RDPD 4C1NK 4R4TA 5C4ZA 3G6JB 1G91A 4A3FH 3ULPA 1AN8A 5GROA 1ET9A 3VYRA 2QCPX 3A7AB 1WFQA 4R8NA 4KY7A 2UUAL 1I94L 1PTOC 4HJ8A 2X6GA 1A3VA 1WOCA 2B2YC 4K5VA 4HCEA 3RD4A 1JB3A 5IGDA 2PO4A 3BU2A 5E7NA 2EYMA 4YIJA 1HH2P 5C44G 2UXCQ 4HMIA 3K5OA 2PNHA 2EY6A 3GTMH 4XQQA 5BR8L 3F8TA 3KF8B 3KK7A 1Q90A 1IW7C 1VQ7A 1XMOL 4DA2A 2R7ZH 4FDBA 4NKLA 2BA1A 4DNRB 4JI3L 5I9OA 1QUQA 2RDHA 3A55A 1FGBD 4EQOA 4B3RQ 3L9AX 1GUGA 2Z1CA 3NBIA 4XT1B 4DAVA 4GLVB 1EQQA 3HKZE 2L11A 2VB3X 1QG7A 4A3CG 2HQLA 1YVCA 2EZVA 3GTPB 2R93G 2F03A 3W3AA 5GAHC 3KLSA 1C4QA 1EY8A 3C46A 1EQRA 1OXXK 1TWCH 2E2IH 3MTSA 1E2ZA 4OEMB 1DZ1A 1I4QA 1NE3A 5K5PA 2E75C 2Z6KC 2F0QA 5COYA 1E24A 1MSHA 2SOBA 4A3IB 5G3LD 1A63A 1J5EL 5M3MH 3G48A 3T51B 3M9BA 4KMUC 4ZQ3A 3T1YL 3CKIB 1VQFA 1MBYA 3W1GA 3A8IE 2Z6KA 4K6DA 3F1ZA 3I55A 2K5NA 2MJ8A 3RZDH 1KQSA 1A6XA 2XRQD 2JA5G 5CV6A 2K50A 4FF2A 3AEVA 4KKTA 3PUWA 3MAQA 2EDGA 4DV1L 1HNWL 1GHKA 4CKCA 4OO1I 3BVZA 2D2CC 3TZDA 3CRKC 4ZCKA 4DR6L 3FKIH 2A1AA 3CCRA 1AFPA 4UP9A 4TVAB 2WB1B 4NXNL 3DUZA 1YI2A 4B3TL 2EYLA 3L0OA 2ZT9C 4IUPA 5EPJA 3CQZB 2VUMG 4JI0L 3PUZA 1B44D 5IWAL 3BDOA 2YV5A 4F88A 4DV3Q 4TQUS 1MD2D 1PFMA 1SE3A 3QOJA 1HXYD 5IYDG 3I4LA 1RD9D 1MKHA 1PYWD 5LL6S 1NNXA 5IP9H 1AEXA 1YNXA 4MIUA 1A2TA 3RZOB 2DNCA 3HOVB 3VA7A 3OMGA 1IHZA 1R4QB 1VMCA 2JEBI 5C5LA 2EJGC 3OWEB 4XYQA 2C9OA 5I6YA 3K8AA 1P8LA 3TEHB 1XMQL 2UUAQ 3NTKA 2PMZB 4L6TB 2MNAA 4A3DH 4IURA 1KDAA 4GS3A 3M4YA 4LFBQ 4A3EH 3CCQA 2JYOA 3E9IA 2KENA 2RVLA 3GDEA 4IFDI 5BR8Q 2QKIC 3KBGA 3U4VA 3UI2A 3C2PA 4LFAL 3Q6SA 3NE5B 1ZYRC 2RA4A 1SNDA 1KD1C 4A93G 3NQIA 3NQTA 5C4JH 3OTOQ 2WINB 4KJOA 1WD0A 3S14H 1I6VC 5D65A 4JI8L 5I2YA 4DPGA 3VR2A 5KEEA 2Q2UA 4IFDJ 3RN2A 4O2DA 3R3OA 5JVH3 2HCCA 3HEJA 2H4OA 2WAQG 1IBKL 4X3UA 3K57A 1X3EA 3MEFA 1Y8PB 4BBRH 1L1OB 2QILA 4J8QA 5IYCG 5EAYA 2IJ0A 4JI1L 1S4ZA 4BBSG 3QR8A 2K32A 2MO1A 1I3QB 2L4NA 3G6EA 4EX5A 1HA6A 4DV2L 1PRTD 4CJ2C 3DXJC 2LMCB 1UEAB 4C3HH 5M9OA 1E7ZA 1LYLA 1MJCA 1BKBA 2F52A 3KDFB 2HUGA 2TSSA 3J7AF 1I6HH 2XN9C 4WFN3 3CRLC 1VF7A 4DR2L 2YU9H 3Q22A 1EOTA 3GTLB 3KF6A 3GTKB 5GAGC 2JA8H 1FGUA 4JOIA 3VYTA 4QJFA 5M5WH 1KXLA 4TSSA 1PA6A 1LTTD 1KIXA 3H15A 3GV3A 3ERSX 4IUQA 1PV4A 2PZWA 3I91A 4I65A 4GOPC 5EBCA 5IP7G 3J7A5 1SDFA 4LF8L 4QY7A 2CCZA 2JA7H 4RG1A 2UUCQ 3WDNA 4C3IB 4P72A 2JA7G 4MN3A 3HOXG 1XMOQ 2B29A 2V1CC 2ZTCA 2JSOA 3AMUA 4IUVA 1SFOB 1SR3A 4X3TA 2XNAC 1PTOH 1SYEA 2CQAA 2Z9HA 1PH5A 3X3NA 4C56C 1G6PA 1EFWA 1SYBA 5IGGA 4DU9A 1UE5A 3PQIA 4C3JB 1UE1A 5C4XG 2K4KA 4GLXA 4CDDC 3EFXD 1TS2A 3KBXA 2O5JC 5M5YH 2J4XA 2JA8G 3E0JA 1HNXL 1SXTA 1BBXC 4UP8A 3S17B 1XPRA 1BBUA 4DV0Q 2A68C 5CR3A 3CAMA 1KABA 2YTVA 4XQNA 3HKSA 4GN3B 1C8CA 4C3HG 3J80L 4A3GH 4DF7A 1STNA 5EGTA 3I73A 5D14A 1AE2A 2L5TA 1CKMA 4KHZA 1Q7YC 4ALPA 1WJJA 1B4OA 4ID6A 3AFPA 3OMCA 1QVFA 3ITPA 1LT3D 3S16H 3FMCA 3S2HH 4LWCA 5IYCH 4DR7L 3SK6A 4BBRG 5I9PA 1N9WA 3CW2C 3ULJA 2ALYB 3J7AV 3ICEA 1ZXTA 2ZJRA 1EY9A 3L7ZC 3LWUA 4WJWA 4XXEA 1EYGA 1CSPA 4PV1C 2Y0SG 2E2DC 1QCBD 1OXSC 1LTLA 1J6QA 2MPMA 3K6OA 5M3FG 1XX8A 4JG2A 2Q2HA 4ZLTF 4QF4A 2XWJB 3CCUA 4FVMA 4DR6Q 5E4WC 3CHBD 1H9SB 4HIDA 4RGOS 1HJPA 3VDYA 1CZWA 1B3AA 5JEAH 1OXVA 5KYLA 1Y1WH 3P75A 1YJNA 1JORA 1SMYD 5HGQA 2DGYA 1IBLQ 1X6OA 1ZEQX 1PH3A 4DV4L 3R2TA 4MNOA 1EY5A 2PQAB 3DEOA 3KUPA 1TWAH 4IPCA 4JBWA 1PHJA 4EGVA 3SXHA 3RMHA 1JCKB 1EOVA 1K28A 2M00A 3U9OA 4LW1A 4LF4Q 2KCMA 4R9WA 4H02A 1E2WA 3H0GB 3GTMB 4LUOA 3QIAA 1K0SA 4N8FA 1ET6A 4DK6C 3J81j 4DR5Q 5IP9G 4UHVA 2O2LD 4HCSA 1F77A 4B3SQ 1KRTA 4DR1L 1XNQL 4NMZA 1M1KC 1CZGA 4JI3Q 1DYQA 1VQDA 3BVMA 4O42A 1EYDA 2K7VA 1F2MA 2FFKB 3TS2A 4GZYC 3FP9A 2F0KA 2UXBQ 2NB0A 4A3DB 2KOLA 4JYAL 3J80E 1W2BA 3H3VC 1Q8IA 5CV9A 3TP5A 4LF9L 1NCVA 4R8IA 1UE7A 3K5LA 3K59A 3CU7A 2NVQB 4JI7Q 4UY8C 2EY5A 4QIWE 2B2WC 1LM0A 4DR3L 3MXNA 2Q2IA 3A8JE 3SE0A 1HZAA 2JA5H 2FJ2A 2VL6A 1I4HA 1EY4A 1GXDC 1WYDA 3NTIA 3U50C 2PPBC 4M1UB 4G57A 1PRTB 2ID0A 1NSNS 4GNXC 3MEHA 1X32A 1XTCD 3I2ZA 1EYAA 3SHLA 1N34Q 4X66L 4B3MQ 3CPFA 3E5SA 4B3TQ 1X65A 2JP1A 1O78A 3K0XA 1LT4D 1PH1A 5DNFA 5GADC 1DONA 5I6WA 2F0DA 1STBA 1Q82C 4A3LG 1HR0W 3I4MG 5ELOA 5LL6X 3NPPA 3K7AH 2CKZB 1VQCA 4OWXB 5C44B 2R93H 1HFNA 4B08A 3FHWA 1K8MA 2EIFA 1PH7A 1PH8A 3TBIB 5LMUQ 2VNUD 3RZDB 1ILPA 4AQYQ 3ULLA 2NVTB 2BH8A 2F0GA 3K80C 2R7ZG 1GUTA 1Z6HA 2B63G 4OX9L 1TWGB 1MJEA 2AQ2B 1HNWQ 1JJGA 1X9NA 3Q24A 5IYBH 4FP5D 1ILQA 4A3IH 4DN4M 3S15H 1H9MA 3IL8A 3OTOL 1LTAD 3AU7A 1IBLL 2AMCB 3LGJA 3P7JA 1EWIA 1U0LA 3VR3A 1GUSA 1L0XB 2B3GA 1B9NA 4OHJA 2XTIA 1HNXQ 2Z8LA 3TN2A 2OTJA 3D6WA 3VA5A 2EJMA 2ZXOA 1EL0A 2E5LL 2QF7A 4A3FG 4A3IG 1WTOA 3MC0B 2B2TC 3IRBA 3U4ZA 5IYBG 1EWHA 2WP8J 2F4VQ 1CHQD 4IJHA 4LUZA 3A54A 4L5TA 1I4GA 2Y0SE 1K73C 1TS4A 5EKKA 2K6AA 2B63H 3PIOA 4KN7C 1BQQT 4DR5L 3OWFA 1S72A 1S5FD 2BDNA 4DAYA 1R4PB 3T53B 3D31A 2VZAA 1JB7A 1E3PA 3Q23A 4LF7L 1WTVA 3C3LA 1SEBD 1DOMA 2RCFA 1KRSA 3AB9A 3EA6A 3HOWG 5FO9B 2D0PA 4X3KA 3I4MH 4A3LH 1RF2D 1M8AA 2I0QA 4DK3C 1SRUA 2ES2A 5LMNQ 3I56A 4LUVA 1DOKA 1STEA 3SK5A 1WD1A 4NP5A 4LAAA 4B3SL 1IZ6A 4AYBG 3WWVA 1PH6A 4ME5A 3HZXA 2LXKA 1EIHA 1VQ6A 1E0BA 4HSVA 3WOFA 3G71A 4WRDA 1VQLA 1STYA 1VMPA 1H9KA 1D6EC 4RCNA 3H0GH 4BY7G 2B8FA 1I5FA 3GD7A 1BDOA 3V2TA 2O5IC 2R92H 4ZRZA 5FO7B 3S9WA 2ICIA 3D4WA 1Q8KA 1CT1D 1S3OA 1BBWA 2IWHA 2ZTEA 5IE8A 1Q81C 1ICFB 3M4OH 1PVOA 2D5DA 1K9MC 4RKBA 3KJPA 5J39A 3LWEA 1XJVA 4YY3Q 2FHTA 2HT1A 2IHEA 4KY5A 4XIGS 3W1BA 3PIP3 3H09A 5DM63 4DXGA 1LTID 2LFNA 1YHAA 4GOPA 3NUCA 3OIPA 1I50H 4P75A 5LMNW 1TKWB 1O7LA 2E2HB 4PZ6A 1SLJA 1FR3A 2PNRC 4UPAA 3DLLA 4RGTA 1TQOA 1M4VA 4GKKQ 1E1OA 1YNJD 3S1RH 2EYOA 4IPHA 2UUBQ 1A0IA 1G2TA 2N55A 4X6AH 4F7XA 1GO3E 1V8QA 5DEHA 1UUPA 1EIFA 1BO0A 1I4RA 1QE6A 3OW7A 3L2PA 2B8GA 2K04A 3HOZH 1MIUA 4JI8Q 1PYSB 1I4PA 1DM0B 1A15A 5IT9c 3GTOH 1NMFA 5KIXA 4KTAA 1Y1WG 4N8X1 2HDMA 5JEAG 2A6ED 5CYUA 2IT1A 1Z9FA 4X66Q 1A62A 1GD7A 2J7ZA 5D3DA 4LFAQ 1V1PA 1XPUA 1Q46A 3A7LA 1IL2A 3GP7A 4XYOA 2NN6I 5C0XJ 3TS0A 3K5NA 4G7HC 1S5ED 3MXUA 3PO2H 3OYYA 5M3FH 5ELBA 4LF5L 2EE1A 4X3SA 1PRTF 1VQ5A 1YJ9A 1EZ6A 1RODA 1KHIA 2K28A 2XGTA 3OPOA 1KAAA 1VQIA 4DR7Q 2XSCA 3J80i 1FJGQ 3W2DA 2F4VL 3TP6A 4HTHA 4YWKA 2F0LA 1FYCA 2NVQH 3NWSA 5G3LF 4HAEA 5JPMC 1AW7A 4A3MH 2KVMA 4S3SA 5J22A 4PG3A 1TY0A 1SNMA 4P74A 1O80A 4C1NI 4POGA 3FPPA 1EYCA 1H95A 2RSOA 2WB1G 4NW2A 4A3GG 1IYVA 4JBJA 5H1SE 2IX1A 1IKLA 2CW0C 4Y52H 4HJAA 2JA8B 1P16A 3D8GA 4QMGA 2PI2A 3DWQA 4OONA 4YHHL 1ASYA 3S1MH 1XNRQ 4DR1Q 2RQXA 2CH4A 4JBMA 4IN3A 2MGSA 3CCMA 1UAPA 4A3BB 2JK8A 3AFQA 3DWAA 1MSGA 5C4XH 3J7ZC 2ZJQA 2OCEA 2A6EC 4J15A 1VQHA 3I7FA 1QUQB 4K8JA 2ZM6L 4F8MA 1SYDA 1JOOA 2QGQA 3HOVG 1I3QH 3SR1A 3ONAB 4E6IA 3QWNA 1J9OA 3HOXH 1TU2B 3R93A 5ELNA 1EY6A 3R2IA 4OELB 4G7OC 2DUDA 1B2TA 1E22A 1EWCA 5IP7H 1EEFD 1J5EQ 1C7YA 1BR9A 2N88A 2BH2A 3NK9A 4K2LA 1U4RA 1BNZA 1JC7A 4YWLA 3T1YQ 1YNJC 1O7IA 3I72A 1IYJB 3PO3B 2A5HA 4KD3A 5FK9C 4NXMQ 2EYFA 3M3YB 3S24A 2NN6H 3BZKA 2EQSA 3I8ZA 4X62L 4CBVA 3S14B 2QEJC 3U9SA 1UEBA 1EU3A 5FLMH 3Q8DA 2DJFC 1IBMQ 3PMFA 3UDIA 1ASZA 3IFTA 1DOLA 1EZ8A 4Y7NH 4EVOA 1SROA 1YIJA 2Z4IA 3FPUB 2BE5C 2CW0D 2OT2A 5FLXc 2AKWB 4OWTB 2AHOB 1HHVA 1PZKD 4BBSH 3NELA 3URYA 1PRTC 5C0XH 4GNXB 1T9HA 1TIID 3GQBA 3PIO3 1AP0A 1VQEA 3KYHC 3PSIA 2EPBA 1PMRA 2UU9Q 4JI4Q 3A56A 2L55A 2X6LA 2WAQB 2L1BA 2KCTA 5FJ8H 1SNCA 2G5DA 3S1QB 1ZKOA 2HHHQ 2KEDA 4IPDA 1D5ZC 2M9VA 4DV4Q 1YITA 4DUZQ 2WB1E 1D7QA 3RZOH 2TMPA 2F3VA 1QNUA 4A93H 1ESFA 1UWVA 2AWOA 2K5WA 4PZ7A 4B9WA 2JEAI 4MHEA 1GJXA 4DKAC 3TQYA 4ME3A 1SNOA 1N32L 4OXPA 4LF5Q 4JI5Q 4RMFA 1L1OC 3J81c 4JI6Q 2FMMA 1LUZA 2WACA 4DUZL 1ZYRD 1H9JA 5C3WA 1B53A 4RWSC 1RHPA 1A3UA 2WIIB 3PGZA 3OW2A 4OIJA 3A74A 3PF4A 3NEMA 4N9TA 4HIKA 2F0OA 4A3EG 2A73B 3IKJA 4C3JH 3F2CA 2GA4B 5CV4A 1NY4A 4XDXA 4A3DG 3M4OB 3OHXC 3NXWA 3RLOA 4BS9A 2PYKA 2LY7A 4DV7Q 3TZUA 4QCLA 3PO3H 4DR2Q 2DY8A 3TP7A 1U9RA 1U5KA 4JOIC 1DGSA 4A3KG 5JVG3 1ML0D 5KNBA 1AZPA 5D3IB 3MXPA 4DV7L 1PZID 2NVYB 3N52A 1WCMB 1CSQA 4GNXA 4OX9Q 2FMCA 4FF4A 1T5EA 1CKNA 1OO9B 4QQBX 2BA0A 1MI2A 4WORA 1V1QA 3EN2A 1KTKA 3WOEA 1TVXA 2NVXB 5IYDH 1G8ZD 5KRUA 3GTKH 5L37A 1I6HB 3QOLA 4KK7A 1Y8OB 2QDBA 1ICWA 4RFBA 3S1MB 1JE4A 2OXPA 3RN5A 4CKBA 1NUCA 2VUMH 1MHWC 3BYYB 2GN5A 2NVXH 2ICEC 5IOCA 4R4CA 2PQEA 1KLUD 2KCCA 2N49A 3PUXA 4IALA 2WKDA 3FKIG 1PZJD 3NTHA 2Z4HA 3GTPH 1LO5D 4BBRB 2B2VC 4L63B 2NVYH 3H6MA 3HOUG 4YWMA 2IHFA 5C6AA 4DR3Q 5C5MA 2KHIA 1S5BD 4IJLA 2F0HA 4ILWA 5AJ3Q 1MGSA 4DV6Q 2R7ZB 2DNEA 5M3FB 1HCZA 3F2BA 2D62A 1FNUA 4Q5VA 5CBEE 1F2ZA 4POFA 3K0YA 5M3MG 3B6YA 1YBYA 5CMDA 4PQXA 2AQ1B 5C4JB 1JE5A 1N36L 1D2BA 3G4SA 3PO2B 1HR0L 2RBMA 2KEEA 2K5DA 2K5HA 2EYPA 4ZUJA 4L5SA 1EEID 1L2FA 1N33L 4WJ4A 4DV5Q 4ZYSA 2I07B 5BN5A 4C2MB 3RUZA 1CKOA 1Q1EA 4K8IA 2IPKD 4H0LC 4I7AA 3I4OA 1VCIA 3HP3A 3TMEA 2QDLA 2VQFL 2AWNA 1JWSD 2KUMA 3L3OC 2MHVA 4PMWA 4A3CH 2Q8IB 1E1TA 4A3FB 1M90C 2F0JA 4DV0L 4LF8Q 2Z0SA 4A3JB 3S1QH 4K0KL 2A8VA 4OGQC 3GTQH 5IGFA 4YY3L 4GN5A 3RR5A 1NBWA 4JV5L 1B3QA 3GTJB 4Q0FA 3LX0A 4KKUA 4GKKL 1V43A 4QUFA 1HRJA 1VS0A 1VF5C 4IUTA 2WV6D 4NB3A 5K36H 1STAA 5AFWA 2UU9L 2EYJA 1UE6A 1EFID 3HS0C 3SVMA 1BCPF 3J81i 3I4NB 5C44H 4EQNA 1IXRA 4KN4C 4CDEC 5ELFA 3STBD 1TS5A 1U4LA 1PH2A 2PZTA 2EVBA 1K0RA 1X3GA 2JXMB 3MFGA 3P20A 2UXDQ 3BDCA 5DLQE 4FO2A 1LTBD 1DJRD 3DMUA 3M7NA 3S2DB 1PTOD 1AZQA 5IGBA 4IZ8A 4AYBB 2MP1A 1XPOA 3M3YH 3SDZA 4IUNA 5BN3A 4RKLA 1D5XC 1Y1VB 1HZCA 3JAMc 2Q8TA 1QOHA 1NR2A 2R7DA 4DR4L 4OL7A 3JC66 3UDGA 1LT5D 2VB2X 4BY7B 1JWMD 2K14A 1QJOA 2RDGA 1BXTA 1FD7D 4ULLA 2R92B 1TWFH 1KDBA 4H13C 4JI4L 1R9TB 1H9SA 1VQAA 3FEWX 4HR7B 4CDFC 1O7ZA 3HOYH 1CQFA 3CD6A 4TRDA 1EIGA 3PCOB 4JI2L 3CMAA 3SK4A 3M4PA 5IGCA 2HQEA 5JAVA 3D4RA 5ELDA 4GKJL 4YCVA 2Z6BA 4HSPA 3T56B 1W6KA 1XWEA 1CTMA 3KLSX 2PZUA 5JJLA 3D4DA 1VQOA 2KBNA 4KV6A 1WTRA 2FXQA 2Q8RE 4TKOB 1WTPA 3MWYW 3QG1A 4RA8A 3F2UA 5FO8B 4LF6Q 1TWCB 2E2IB 3JAML 3SK8A 1PFSA 2F3IA 2GVBA 2PW5A 5JJZA 2ZTDA 2RKSA 4R4IA 2G9DA 4A76A 5ELEA 1SE8A 1F9SA 2ZJPA 1BVSA 4O0AA 1SN8A 2ASBA 2MO0A 1K83H 2JJQA 3MVVA 5C3EG 3HOYB 2AUJD 1D1IA 1F9RA 5NUCA 4A3MB 2NTTA 4IFDH 1EY7A 1SYGA 1LACA 3NBHA 1K8AC 3W5OA 1BOSA 2EYHA 4HIMA 1VQGA 1SNPA 2K05A 1VQPA 1WTQA 4MZ9A 1TWAB 5KYIA 3GO5A 3I70A 5CC4A 3M85A 5JOBA 5CGKA 4NXML 4R1JA 3TSSA 3S1NH 1CUKA 1JOKA 2NWGA 1RCVD 1RL2A 2F0MA 4QB4A 5EBDA 4AIMA 3HRZC 1WTXA 1Y1WB 1SJHD 2NZ1D 1X56A 3KLWA 4K5WA 2UUBL 5IT9L 2EXZA 1IBML 4XT3B 3ND8A 2K03A 2N3SA 2R61A 5T1GA 1HPCA 5IGEA 5FKAC 3HOZB 5DM73 2I5MX 4BXXG 2UUCL 2ZM6Q 1X55A 3I4NH 1STGA 3HKZG 3MA2B 4BY1H 1KL9A 5TSSA 3KJOA 2JA6B 3CXCA 1LTRD 4J1MA 2F0FA 2NVTH 2Q2TA 3OIQA 1K3BC 3E9HA 4DNTB 1FVIA 5BN4A 4A4IA 1TWGH 3EQLC 4NXNQ 3NHHA 1F2YA 5EKLA 3NBHB 2M2LA 2JA6H 4DK0A 1KNEA 2ZXPA 3VR4A 4BY1B 3A5ZB 1K8OA 4JK1C 3GTQB 1HQMC 1N34L 5F2DA 1L0WA 3S2HB 3E6ZX 4IOCA 2NZOA 1IYUA 1X3PA 2RHSB 1G51A 3C1FA 4RCOA 5I4DA 2ATWA 1I50B 3BVGA 4JC0A 2NBFA 4A3GB 4ZAIA 4KY6A 4MTKA 2PCFB 4HJ5A 3NSWA 1NJIC 1S5CD 4JI5L 1F9PA 4JI6L 4FF3A 3S1NB 2UXDL 4PNYA 1N8RC 1WVLA 1B8AA 3BS1A 1C0AA 3JAME 1JT8A 2B2WA 3DM3A 2YTXA 3U58A 2VQFQ 4KD4A 3VYUA 1CKNB 5C0XI 1UNSA 3D6CA 1RTNA 2JE6I 1CI3M 4HN7A 5C4HA 1YJWA 4FXDA 4YHHQ 2VS1A 4C3IH 1RJTA 1EUJA 2KCNA 4QGUA 1KDCA 5CORA 1HNZQ 1OTCA 3PUVA 4JI0Q 1EU4A 2L12A 3H94A 3UDXA 3CF5A 4IO9A 4DXFA 1YEZA 2X69A 2E74C 1E2VA 3DHQA 3MXNB 1BCPB 2E2JB 3VR5A 1PH9A 3CPWA 4RGNA 3MZ5A 2VQEQ 3I3CA 2LS01 1TR5A 2VY3A 5A2QL 3CC4A 1ONLA 4IOAA 1TWHH 1T5XD 4LF7Q 2VUMB 1LTGD 3K81C 2YU9B 3RNUA 4APVA 3A8KE 1Y8NB 3STBC 1GHJA 5A35A 1JWUD 4JCVE 2F0IA 5IT9E 4NDXA 1QZHA 3KF6B 1VQNA 4DV6L 3KFUA 1K3RA 3FRPB 3UDFA 2EXDA 1G6ZA 1S5DD 1TS3A 3CP0A 5FLXL 2N78A 4IQZA 3K58A 2F0NA 2LSSA 1TWFB 1AE3A 2I5HA 2QW7A 1A2UA 3M7GA 5K36G 5JPNC 3CC7A 4ZKBB 3G7LA 3NENA 1I94Q 5KNCA 1KC8C 1LV9A 1W6JA 1XXGA 2VW9A 2RHQB 1OXUA 2MQHA 2SDFA 1Y1VH 2CVRA 4HMJA 4IUUA 4ZUIA 4OO1H 3HFZB 2HIXA 3T4AC 1TY2A 4EQ5A 4G7ZC 5M5XB 1PH4A 1XNQQ 2RF4A 1JJ2A 5J1ZA 1K8GA 3CC2A 4X65Q 4WJ3M 1HTLD 2PMZE 4K0KQ 4KI0A 3ZJYC 4RHSA 2F0WA 1Y14B 3BDLA 3N6RA 2D9UA 1XNRL 4CJ0B 4OIKA 5DAUA 4DGZA 2D0OA 4X65L 2GVAA 4DAMA 4FF1A 4G4KA 3J81L 2DJGC 5JJIA 2YTYA 3S15B 2OF1A 2SEBD 1II3A 2OQ0A 3EROA 4DNIA 5IODA 2F0UA 1U4MA 2BDOA 3EIVA 1AH9A 3CMEA 1N32Q 2VXWA 2L15A 2XRSD 4DUYQ 1CA5A 1N33Q 1FNVA 3EBEA 2P5ZX 4JW0A 2C35B 4V0BA 1VQMA 4DFAA 4A3JH 4HJ9A 4B3ML 3HOUH 1XMQQ 5LMUL 2HHHL 4BA1I 1WCMG 4RGMA 1B9MA 2R93B 5EKIA 3K7AB 3V05A 4O1NA 2A74C 4BBSB 2HD3A 1FJGL 2N8NA 2JN4A 2KJXA 4C2MH 1HR0Q 1NAPA 2OQKA 2RCNA 4JPBW 4R4QA 2WAQE 4LFCL 3PV0A 4Z9CB 2ZXRA 1F2LA 4CGYB 1LABA 1QB5D 3MHBA 1Q86C 1Q1BA 4OWWB 2F3WA 1HA5A 4LJZC 3ERQA 4GOPB 4FXGC 4A3BG 3I90A 4CHTB 3S17H 2I46A 3KF8A 2B2TA 1HNZL 2SNMA 1YHQA 2E8GA 1H9RA 2B2VA 3KLRA 2F0SA 3FKIB 1HFGA 2KHJA 3O13A 4L5QA 2AUKA 4UAIA 2JA5B 1JICA 4PMCA 5FLXE 1PTOB 1SFOH 3HOUB 3HG9A 2EY1A 1XTDA 2B39A 2EY2A 4EQPA 5IWAQ 4X64L 4A3KH 3OOCA 4P71A 3OSOA 5JEAJ 2JA7B 2NTSA 5EJWA 3HOXB 2ENBA 3QO2A 4F87A 3GTGB 3PO3G 1B50A 4LF4L 1HQRD 1SAPA 1FL0A 1SYCA 4KHVA 4JI1Q 5M3MB 4JI2Q 1QVCA 4C3JG 3GTLH 5C4XB 1Z47A 3BYTB 4UDUC 5CV8A 3VR6A 4NPSA 3CCLA 3TREA 2BCOA 2H1EA 4A3BH 2FINB 4YCUA 2NZHA 1SYFA 4HEDA 3DEPA 5HGTA 1CA6A 1V1PB 3RLFA 4L5RC 3BJUA 2DY7A 2HCIA 4KHPQ 2NYZD 2PW7A 2KHSA 4C3HB 4HJ7A 1IBKQ 5CV7A 2K01A 2A69D 3J81E 3ND9A 1O7YA 1JQYD 4I7ZC 1QVGA 1VQ8A 1WCMH 5IIFA 2LKVA 1QWYA 1ENFA 1GUOA 4A3JG 4DR4Q 4PZ8A 5FJ8G 2XWBB 2BOSA 1I4XA 3DM1A 2CWPA 2V4DA 5I2XA 4A75A 1G291 2B2YA 1EQVA 1GUNA 3EJIA 1S40A 2WFWA 5EQ0A 1GUWA 3T1HL 1WI5A 5C0XG 2BE5D 1QILA 4N9PA 3F2DA 2UXBL 4M8AA 3VYSA 2L0CA 3P1HA 3AYHB 4LMQD 1J8IA 2F0TA 2LXJA 4DV5L 4P2CB 3FVQA 1Y69U 2CFMA 1Z7TA 1NR4A 3LNNA 5J3BA 4A3EB 5FLMG 1PFNA 4A93B 1YHBA 1CM9A 3GTOB 1NTGA 1ESRA 2NN6G 1C48A 4K6LA 4OO1G 2MFIA 1Q12A 4KKSA 2QA4A 4DAYB 1WTWA 2HIVA 4FNFA 1ENAA 4AYBE 1F9QA 1Y1VG 3GTGH 2E76C 2IX0A 3NP8A 2R6GA 4A3KB 4QL5A 4UP7A 1GM5A 3BZCA 1PXUA 4KLKA 4LFCQ 3KDFA 1PTOF 1STHA 2K33A 4BA2I 1BCPD 4R4OA 2RDFA 3S16B 3MFYA 4X62Q 1IW7D 1SMYC 2A6HD 4CJ1B 1NMGA 3HOVH 4H7BA 4LFBL 3UE0A 2EOTA 2E2HH 5ELCA 5CBAE 4Y7NB 1BF4A 1WTHA 2OWOA 1JJCB 1RKNA 5C3XA 1V1OA 2C5CA 4DV3L 1TT2A 2F0PA 5EPKA 1SE2A 4RAUC 3CQZH 1X3QA 4V190 4GLAC 5M5YB 1KLGD 2O4XA 3Q0AA 4XTCS 2JQOA 4GKJQ 2F1MA 1SE4A 1PLFA 5T1IA 3K7UC 1EY0A 2A19A
chains in the Genus database with same CATH topology
3GO5A 3PF5A 5JEAG 4JOIA 4A3MG 1VQ9A 2IT1A 3M85A 1Z9FA 4X66Q 4QJFA 5M5WH 1KXLA 1A62A 1GD7A 1PA6A 2JA8H 3PIPA 4LFAQ 1KIXA 4NXML 4R1JA 1EIYB 1XPUA 3H15A 1GKHA 1VQKA 1Q46A 3S1NH 3M4QA 3ERSX 1CUKA 1PV4A 1IL2A 2IY5B 4GOPC 2NN6I 5C0XJ 1RL2A 3TS0A 4AIMA 5IP7G 4X64Q 3J7A5 4LF8L 4QY7A 1X56A 2CCZA 3KLWA 2UUBL 2JA7H 4RG1A 3PO2H 3OYYA 1IBML 2UUCQ 1X54A 4P72A 5M3FH 2JA7G 3PO2G 3ER0A 3HOXG 4LF5L 1XMOQ 2B29A 2V1CC 2ZTCA 1VQ5A 1YJ9A 2N3SA 3E0EA 1SR3A 1KHIA 1PH5A 1G6PA 1D8LA 2XGTA 4DR7Q 2VQEL 1VQIA 1EFWA 3J80i 1FJGQ 5JJKA 1UE5A 2F4VL 3J80c 2I5MX 4YWKA 4BXXG 2NVQH 2UUCL 2ZM6Q 1X55A 3I4NH 1UE1A 2UXCL 5C4XG 3HKZG 2K4KA 4GLXA 1KL9A 3KJOA 4A3MH 1PYBA 4BY1H 4PG3A 3CXCA 4P74A 5M5YH 2JA8G 2NVTH 2Q2TA 1N36Q 1HNXL 3E9HA 1FVIA 4UP8A 4POGA 1XPRA 4A4IA 1TWGH 1BBUA 3CCJA 4DV0Q 4NXNQ 1H95A 5M5XH 1GVPA 4JYAQ 2WB1G 2CQOA 3HOZG 3CAMA 3NBHB 2YTVA 3HKSA 4P73A 2JA6H 2CWAA 4GN3B 4A3GG 4JBJA 3A5ZB 1KAWA 2JA6G 5H1SE 4A3GH 2IX1A 4B3RL 1N34L 1L0WA 1AE2A 4Y52H 4HJAA 1CKMA 1W3SA 4KHZA 1P16A 4IOCA 1Q7YC 2NZOA 1QZGA 4LF6L 3D0FA 2PI2A 4ALPA 1WJJA 3AQQA 3AFPA 2RHSB 4OONA 4YHHL 1G51A 1ASYA 4JI7L 1QVFA 4DR1Q 1XNRQ 3S1MH 4JBMA 2ATWA 3CCMA 3S16H 3S2HH 4LWCA 4JC0A 5IYCH 4DR7L 4BBRG 2JK8A 3AFQA 1N9WA 3CW2C 4BY1G 3CCVA 3ULJA 2ALYB 5C4XH 3J7ZC 5LMNL 2ZJQA 3I4NG 2OCEA 4HJ5A 4J15A 3ICEA 1VQHA 4BXXH 2ZJRA 3I7FA 1QUQB 2ZM6L 1NJIC 1JMCA 3L7ZC 2QGQA 3HOVG 4JI5L 1I3QH 3UE1A 1EYGA 2E5LQ 4JI6L 4JV5Q 1CSPA 4LNQA 2Y0SG 2UXDL 1N8RC 1OXSC 1LTLA 5GAEC 1B8AA 1J6QA 1TXYA 3HOXH 5AJ3L 5ELNA 1C0AA 5M3FG 1JT8A 2R7FA 2PQAA 4JG2A 2DUDA 2Q2HA 1RIPA 3CCUA 4JBKA 4DUYL 3DM3A 1E22A 2YTXA 5IP7H 2OTLA 2QEXA 3U58A 1J5EQ 1C7YA 2VQFQ 3A0JA 2BH2A 4DR6Q 1CKNB 3JAMi 4YCWA 5C0XI 4YWLA 3T1YQ 4IPGA 1O7IA 4HIDA 2JE6I 1IYJB 1HJPA 1YJWA 3VDYA 4NXMQ 4YHHQ 2VS1A 4C3IH 2E2JH 1EUJA 1X3FA 3KOJA 3S24A 4QGUA 3BZKA 2EQSA 4X62L 1HNZQ 1OXVA 1OTCA 3PUVA 3CCEA 4JI0Q 1YZ6A 2K75A 1Y1WH 3UDXA 4DV1Q 1VQ4A 1YJNA 4LF9Q 5HGQA 3CF5A 1UEBA 4GN4B 5FLMH 3Q8DA 4IO9A 1YEZA 1IBMQ 3UDIA 2DGYA 1IBLQ 1X6OA 1ASZA 2R92G 1VQBA 3MXNB 1PH3A 1R9TH 1PH9A 3CPWA 3H3VH 4DV4L 4IFDG 4MNOA 4Y7NH 1SROA 2PQAB 1YIJA 2VQEQ 1VQJA 1A8VA 2VY3A 5C3EH 1TWAH 4IPCA 4JBWA 1PHJA 3CC4A 3H0GG 4BY7H 4IOAA 1TWHH 5FLXc 4LF7Q 2AKWB 3K81C 4OWTB 2AHOB 3RNUA 1EOVA 4APVA 4BBSH 3NELA 3STBC 4GNXB 4LW1A 4LF4Q 1T9HA 4JCVE 2KCMA 3T1HQ 1VQEA 3KYHC 3PSIA 4HIOA 1QZHA 3KF6B 1VQNA 4DV6L 3KFUA 2YYZA 1L1OA 4H02A 4AH6A 3PUYA 2UU9Q 4JI4Q 1K3RA 3UDFA 2EXDA 4LUOA 2PI2E 3S2DH 2H5XA 4DK6C 3J81j 1HZBA 2KCTA 3CP0A 5FJ8H 5IP9G 4DR5Q 2N78A 5GQOA 2LSSA 1AE3A 4B3SQ 2I5HA 2HHHQ 4IPDA 1HZ9A 5K36G 1KRTA 1B7YB 4DV4Q 4DR1L 3CC7A 4DUZQ 1YITA 2WB1E 1XNQL 1D7QA 1M1KC 1C9OA 3NENA 1I94Q 4JI3Q 3RZOH 4A93H 1OXTA 3SGIA 5HY6A 2VW9A 1VQDA 3CCSA 1KC8C 3HOWH 2RHQB 1UWVA 3HOYG 2AWOA 1OXUA 2MQHA 5IY0A 1Y1VH 2K52A 4PZ7A 3TRZA 3A5UA 2JEAI 3TS2A 4DKAC 3TQYA 2K5VA 3FP9A 4ME3A 3H3VI 2UXBQ 1N32L 4OXPA 3HFZB 1SMXA 2HIXA 2I5LX 4JI5Q 4RMFA 4LF5Q 1L1OC 4JYAL 3J81c 4EQ5A 4JI6Q 1LUZA 1PH4A 2JA9A 4MTNA 4DUZL 2RF4A 1W2BA 1XNQQ 4AQYL 1JJ2A 1K8GA 3CC2A 4X65Q 3PGZA 1V9PA 3GTJH 3OW2A 3PF4A 3A74A 3RLNA 2PMZE 3NEMA 1B70B 4HIKA 4LF9L 4K0KQ 4A3EG 1UE7A 4KI0A 3ZJYC 4KHPL 4DV2Q 4C3JH 1Y14B 4JI7Q 4UY8C 4R4TA 3F2CA 1NY4A 1XNRL 4QIWE 4A3DG 1LM0A 4DR3L 2Q2IA 3RLOA 4A3FH 1HZAA 3ULPA 2D0OA 2JA5H 5GROA 2VL6A 1WYDA 4X65L 2GVAA 4DV7Q 3U50C 4DAMA 3PO3H 1WFQA 4DR2Q 5JJIA 2ID0A 2UUAL 4GNXC 2YTYA 1I94L 1U5KA 4JOIC 1DGSA 3I2ZA 2OQ0A 4A3KG 4DNIA 4HJ8A 1N34Q 1WOCA 4X66L 4B3MQ 3EIVA 4DV7L 1AH9A 3CPFA 1CSQA 4GNXA 3CMEA 4OX9Q 1N32Q 3BU2A 5E7NA 4B3TQ 1CKNA 2L15A 4DUYQ 2BA0A 4QQBX 1HH2P 1X65A 3K0XA 5C44G 2UXCQ 1N33Q 1PH1A 3EBEA 2PNHA 3EN2A 1V1QA 5GADC 3GTMH 2C35B 1VQMA 5BR8L 3F8TA 4A3JH 3KF8B 1Q82C 5IYDH 4HJ9A 4B3ML 3HOUH 1XMQQ 1VQ7A 4A3LG 5LMUL 3GTKH 1HR0W 3I4MG 2HHHL 4BA1I 1WCMG 1XMOL 5ELOA 2R7ZH 3K7AH 2CKZB 4FDBA 1VQCA 2BA1A 4OWXB 4JI3L 2R93H 1FJGL 1QUQA 3RN5A 2N8NA 4B3RQ 2VUMH 3FHWA 4C2MH 2EIFA 2GN5A 4GLVB 1PH7A 5LMUQ 1PH8A 1EQQA 3HKZE 2OQKA 2RCNA 1HR0Q 2NVXH 4R4CA 4R4QA 2VNUD 2WAQE 4LFCL 2N49A 3PV0A 3PUXA 4A3CG 2HQLA 1YVCA 4AQYQ 3FKIG 2R93G 3ULLA 1Q86C 1Q1BA 2BH8A 3K80C 4OWWB 2R7ZG 3GTPH 4GOPB 5GAHC 4OX9L 2B63G 4A3BG 1MJEA 1EQRA 1HNWQ 1JJGA 2NVYH 3S17H 1X9NA 1OXXK 3HOUG 1HNZL 1TWCH 4YWMA 5IYBH 2E2IH 1YHQA 2IHFA 2E8GA 4A3IH 3S15H 4DR3Q 2KHIA 1NE3A 3OTOL 4IJLA 2Z6KC 5AJ3Q 2KHJA 4DV6Q 1IBLL 1E24A 2AMCB 3LGJA 4L5QA 1EWIA 1U0LA 3F2BA 2D62A 1A63A 1SFOH 1J5EL 2B3GA 4POFA 5M3MG 5M3MH 1XTDA 1YBYA 3G48A 3B6YA 5IWAQ 4X64L 3M9BA 4A3KH 3T1YL 2XTIA 1JE5A 4P71A 1N36L 1VQFA 5JEAJ 1HNXQ 3G4SA 3W1GA 1HR0L 2OTJA 2Z6KA 3PO3G 2E5LL 2K5HA 3F1ZA 3I55A 2K5NA 3RZDH 1KQSA 4L5SA 4LF4L 1L2FA 1FL0A 2JA5G 4DV5Q 2K50A 4A3IG 4A3FG 1N33L 3AEVA 4WJ4A 4JI1Q 3IRBA 3U4ZA 3PUWA 5IYBG 2WP8J 1QVCA 4JI2Q 2F4VQ 4DV1L 4IJHA 1HNWL 1CKOA 3GTLH 4LUZA 1Z47A 1Q1EA 4L5TA 3CCLA 4NPSA 2Y0SE 1K73C 4OO1I 3TREA 3I4OA 1VCIA 3PIOA 2B63H 4A3BH 2VQFL 2AWNA 4YCUA 2NZHA 4PMWA 3FKIH 4DR5L 4DR6L 4A3CH 2A1AA 3CCRA 1S72A 1E1TA 4UP9A 1M90C 3RLFA 3D31A 2VZAA 4TVAB 1JB7A 4L5RC 4NXNL 4DV0L 4LF8Q 2Z0SA 1E3PA 1YI2A 4B3TL 4LF7L 3BJUA 2A8VA 3S1QH 3GTQH 3L0OA 4K0KL 4KHPQ 4YY3L 2VUMG 1KRSA 4GN5A 3RR5A 1IBKQ 1NBWA 4HJ7A 3PUZA 4JI0L 3HOWG 4JV5L 5IWAL 2YV5A 4DV3Q 2D0PA 4TQUS 1V43A 1QVGA 1VQ8A 1WCMH 4GKKL 1VS0A 3I4MH 4NB3A 4A3LH 2UU9L 5IYDG 2I0QA 4A3JG 1UE6A 4DK3C 3J81i 4DR4Q 1MKHA 4PZ8A 1SRUA 5FJ8G 5IP9H 1YNXA 2ES2A 5C44H 5LMNQ 3I56A 4LUVA 1IXRA 4B3SL 2CWPA 4A75A 1G291 1IZ6A 3STBD 4AYBG 3WWVA 1PH6A 2LXKA 1PH2A 1VQ6A 1K0RA 2JEBI 1X3GA 2UXDQ 1S40A 2WFWA 3G71A 3T1HL 1WI5A 5DLQE 5C0XG 1VQLA 3K8AA 1P8LA 3M7NA 3TEHB 3F2DA 1XMQL 2UXBL 2UUAQ 3H0GH 4BY7G 3AYHB 1I5FA 3GD7A 2MNAA 2LXJA 4DV5L 4A3DH 1XPOA 3M3YH 2CFMA 4GS3A 4LFBQ 1HZCA 3JAMc 2R92H 4A3EH 5J3BA 3CCQA 2R7DA 5FLMG 4DR4L 1YHBA 3JC66 3E9IA 3UDGA 1Q8KA 2KENA 1S3OA 1NTGA 3GDEA 5BR8Q 1BBWA 2K14A 4IFDI 2ZTEA 2NN6G 3U4VA 5IE8A 1Q81C 3M4OH 1TWFH 1PVOA 4OO1G 2MFIA 1Q12A 4LFAL 2QA4A 3KJPA 1K9MC 1XJVA 4DAYB 4JI4L 2HIVA 3GTGH 4AYBE 1VQAA 1Y1VG 4YY3Q 2HT1A 2IHEA 3HOYH 3CD6A 2IX0A 1KD1C 4XIGS 4A93G 2R6GA 3W1BA 3PCOB 5C4JH 4JI2L 3CMAA 4QL5A 4UP7A 1GM5A 3BZCA 3OTOQ 3S14H 3M4PA 4KLKA 4JI8L 4GKJL 4YCVA 4LFCQ 4DPGA 3KDFA 1YHAA 4GOPA 4BA2I 5JJLA 4R4OA 2Q2UA 1I50H 4X62Q 1VQOA 2KBNA 2FXQA 4P75A 4IFDJ 5LMNW 3RN2A 1NMGA 4O2DA 3HOVH 4LFBL 3UE0A 2E2HH 4PZ6A 4LF6Q 1SLJA 1Y1WG 4WJ3M 2WAQG 4UPAA 1IBKL 3DLLA 1X3EA 3MEFA 1PFSA 2OWOA 2F3IA 1JJCB 2GVBA 4BBRH 1L1OB 2ZTDA 5IYCG 4R4IA 5EAYA 4DV3L 4GKKQ 4JI1L 1E1OA 4BBSG 4A76A 1SE8A 2ZJPA 3S1RH 2UUBQ 1BVSA 2MO1A 3CQZH 4IPHA 4O0AA 1A0IA 1SN8A 3G6EA 2ASBA 4EX5A 2MO0A 1K83H 4GLAC 2JJQA 4DV2L 4X6AH 5C3EG 1GO3E 4C3HH 1E7ZA 1LYLA 1MJCA 1BKBA 2F52A 1EIFA 3KDFB 3L2PA 4XTCS 3W5OA 2JQOA 1K8AC 3HOZH 1MIUA 4JI8Q 1PYSB 4GKJQ 1I6HH 4DR2L 4HIMA 1VQGA 2YU9H 5IT9c 3GTOH 1NMFA 3K7UC 3KF6A 1VQPA 5GAGC 4MZ9A 2A19A 1FGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GO5 A;  3PF5 A;  5JEA G;  4JOI A;  4A3M G;  1VQ9 A;  2IT1 A;  3M85 A;  1Z9F A;  4X66 Q;  4QJF A;  5M5W H;  1KXL A;  1A62 A;  1GD7 A;  1PA6 A;  2JA8 H;  3PIP A;  4LFA Q;  1KIX A;  4NXM L;  4R1J A;  1EIY B;  1XPU A;  3H15 A;  1GKH A;  1VQK A;  1Q46 A;  3S1N H;  3M4Q A;  3ERS X;  1CUK A;  1PV4 A;  1IL2 A;  2IY5 B;  4GOP C;  2NN6 I;  5C0X J;  1RL2 A;  3TS0 A;  4AIM A;  5IP7 G;  4X64 Q;  3J7A 5;  4LF8 L;  4QY7 A;  1X56 A;  2CCZ A;  3KLW A;  2UUB L;  2JA7 H;  4RG1 A;  3PO2 H;  3OYY A;  1IBM L;  2UUC Q;  1X54 A;  4P72 A;  5M3F H;  2JA7 G;  3PO2 G;  3ER0 A;  3HOX G;  4LF5 L;  1XMO Q;  2B29 A;  2V1C C;  2ZTC A;  1VQ5 A;  1YJ9 A;  2N3S A;  3E0E A;  1SR3 A;  1KHI A;  1PH5 A;  1G6P A;  1D8L A;  2XGT A;  4DR7 Q;  2VQE L;  1VQI A;  1EFW A;  3J80 i;  1FJG Q;  5JJK A;  1UE5 A;  2F4V L;  3J80 c;  2I5M X;  4YWK A;  4BXX G;  2NVQ H;  2UUC L;  2ZM6 Q;  1X55 A;  3I4N H;  1UE1 A;  2UXC L;  5C4X G;  3HKZ G;  2K4K A;  4GLX A;  1KL9 A;  3KJO A;  4A3M H;  1PYB A;  4BY1 H;  4PG3 A;  3CXC A;  4P74 A;  5M5Y H;  2JA8 G;  2NVT H;  2Q2T A;  1N36 Q;  1HNX L;  3E9H A;  1FVI A;  4UP8 A;  4POG A;  1XPR A;  4A4I A;  1TWG H;  1BBU A;  3CCJ A;  4DV0 Q;  4NXN Q;  1H95 A;  5M5X H;  1GVP A;  4JYA Q;  2WB1 G;  2CQO A;  3HOZ G;  3CAM A;  3NBH B;  2YTV A;  3HKS A;  4P73 A;  2JA6 H;  2CWA A;  4GN3 B;  4A3G G;  4JBJ A;  3A5Z B;  1KAW A;  2JA6 G;  5H1S E;  4A3G H;  2IX1 A;  4B3R L;  1N34 L;  1L0W A;  1AE2 A;  4Y52 H;  4HJA A;  1CKM A;  1W3S A;  4KHZ A;  1P16 A;  4IOC A;  1Q7Y C;  2NZO A;  1QZG A;  4LF6 L;  3D0F A;  2PI2 A;  4ALP A;  1WJJ A;  3AQQ A;  3AFP A;  2RHS B;  4OON A;  4YHH L;  1G51 A;  1ASY A;  4JI7 L;  1QVF A;  4DR1 Q;  1XNR Q;  3S1M H;  4JBM A;  2ATW A;  3CCM A;  3S16 H;  3S2H H;  4LWC A;  4JC0 A;  5IYC H;  4DR7 L;  4BBR G;  2JK8 A;  3AFQ A;  1N9W A;  3CW2 C;  4BY1 G;  3CCV A;  3ULJ A;  2ALY B;  5C4X H;  3J7Z C;  5LMN L;  2ZJQ A;  3I4N G;  2OCE A;  4HJ5 A;  4J15 A;  3ICE A;  1VQH A;  4BXX H;  2ZJR A;  3I7F A;  1QUQ B;  2ZM6 L;  1NJI C;  1JMC A;  3L7Z C;  2QGQ A;  3HOV G;  4JI5 L;  1I3Q H;  3UE1 A;  1EYG A;  2E5L Q;  4JI6 L;  4JV5 Q;  1CSP A;  4LNQ A;  2Y0S G;  2UXD L;  1N8R C;  1OXS C;  1LTL A;  5GAE C;  1B8A A;  1J6Q A;  1TXY A;  3HOX H;  5AJ3 L;  5ELN A;  1C0A A;  5M3F G;  1JT8 A;  2R7F A;  2PQA A;  4JG2 A;  2DUD A;  2Q2H A;  1RIP A;  3CCU A;  4JBK A;  4DUY L;  3DM3 A;  1E22 A;  2YTX A;  5IP7 H;  2OTL A;  2QEX A;  3U58 A;  1J5E Q;  1C7Y A;  2VQF Q;  3A0J A;  2BH2 A;  4DR6 Q;  1CKN B;  3JAM i;  4YCW A;  5C0X I;  4YWL A;  3T1Y Q;  4IPG A;  1O7I A;  4HID A;  2JE6 I;  1IYJ B;  1HJP A;  1YJW A;  3VDY A;  4NXM Q;  4YHH Q;  2VS1 A;  4C3I H;  2E2J H;  1EUJ A;  1X3F A;  3KOJ A;  3S24 A;  4QGU A;  3BZK A;  2EQS A;  4X62 L;  1HNZ Q;  1OXV A;  1OTC A;  3PUV A;  3CCE A;  4JI0 Q;  1YZ6 A;  2K75 A;  1Y1W H;  3UDX A;  4DV1 Q;  1VQ4 A;  1YJN A;  4LF9 Q;  5HGQ A;  3CF5 A;  1UEB A;  4GN4 B;  5FLM H;  3Q8D A;  4IO9 A;  1YEZ A;  1IBM Q;  3UDI A;  2DGY A;  1IBL Q;  1X6O A;  1ASZ A;  2R92 G;  1VQB A;  3MXN B;  1PH3 A;  1R9T H;  1PH9 A;  3CPW A;  3H3V H;  4DV4 L;  4IFD G;  4MNO A;  4Y7N H;  1SRO A;  2PQA B;  1YIJ A;  2VQE Q;  1VQJ A;  1A8V A;  2VY3 A;  5C3E H;  1TWA H;  4IPC A;  4JBW A;  1PHJ A;  3CC4 A;  3H0G G;  4BY7 H;  4IOA A;  1TWH H;  5FLX c;  4LF7 Q;  2AKW B;  3K81 C;  4OWT B;  2AHO B;  3RNU A;  1EOV A;  4APV A;  4BBS H;  3NEL A;  3STB C;  4GNX B;  4LW1 A;  4LF4 Q;  1T9H A;  4JCV E;  2KCM A;  3T1H Q;  1VQE A;  3KYH C;  3PSI A;  4HIO A;  1QZH A;  3KF6 B;  1VQN A;  4DV6 L;  3KFU A;  2YYZ A;  1L1O A;  4H02 A;  4AH6 A;  3PUY A;  2UU9 Q;  4JI4 Q;  1K3R A;  3UDF A;  2EXD A;  4LUO A;  2PI2 E;  3S2D H;  2H5X A;  4DK6 C;  3J81 j;  1HZB A;  2KCT A;  3CP0 A;  5FJ8 H;  5IP9 G;  4DR5 Q;  2N78 A;  5GQO A;  2LSS A;  1AE3 A;  4B3S Q;  2I5H A;  2HHH Q;  4IPD A;  1HZ9 A;  5K36 G;  1KRT A;  1B7Y B;  4DV4 Q;  4DR1 L;  3CC7 A;  4DUZ Q;  1YIT A;  2WB1 E;  1XNQ L;  1D7Q A;  1M1K C;  1C9O A;  3NEN A;  1I94 Q;  4JI3 Q;  3RZO H;  4A93 H;  1OXT A;  3SGI A;  5HY6 A;  2VW9 A;  1VQD A;  3CCS A;  1KC8 C;  3HOW H;  2RHQ B;  1UWV A;  3HOY G;  2AWO A;  1OXU A;  2MQH A;  5IY0 A;  1Y1V H;  2K52 A;  4PZ7 A;  3TRZ A;  3A5U A;  2JEA I;  3TS2 A;  4DKA C;  3TQY A;  2K5V A;  3FP9 A;  4ME3 A;  3H3V I;  2UXB Q;  1N32 L;  4OXP A;  3HFZ B;  1SMX A;  2HIX A;  2I5L X;  4JI5 Q;  4RMF A;  4LF5 Q;  1L1O C;  4JYA L;  3J81 c;  4EQ5 A;  4JI6 Q;  1LUZ A;  1PH4 A;  2JA9 A;  4MTN A;  4DUZ L;  2RF4 A;  1W2B A;  1XNQ Q;  4AQY L;  1JJ2 A;  1K8G A;  3CC2 A;  4X65 Q;  3PGZ A;  1V9P A;  3GTJ H;  3OW2 A;  3PF4 A;  3A74 A;  3RLN A;  2PMZ E;  3NEM A;  1B70 B;  4HIK A;  4LF9 L;  4K0K Q;  4A3E G;  1UE7 A;  4KI0 A;  3ZJY C;  4KHP L;  4DV2 Q;  4C3J H;  1Y14 B;  4JI7 Q;  4UY8 C;  4R4T A;  3F2C A;  1NY4 A;  1XNR L;  4QIW E;  4A3D G;  1LM0 A;  4DR3 L;  2Q2I A;  3RLO A;  4A3F H;  1HZA A;  3ULP A;  2D0O A;  2JA5 H;  5GRO A;  2VL6 A;  1WYD A;  4X65 L;  2GVA A;  4DV7 Q;  3U50 C;  4DAM A;  3PO3 H;  1WFQ A;  4DR2 Q;  5JJI A;  2ID0 A;  2UUA L;  4GNX C;  2YTY A;  1I94 L;  1U5K A;  4JOI C;  1DGS A;  3I2Z A;  2OQ0 A;  4A3K G;  4DNI A;  4HJ8 A;  1N34 Q;  1WOC A;  4X66 L;  4B3M Q;  3EIV A;  4DV7 L;  1AH9 A;  3CPF A;  1CSQ A;  4GNX A;  3CME A;  4OX9 Q;  1N32 Q;  3BU2 A;  5E7N A;  4B3T Q;  1CKN A;  2L15 A;  4DUY Q;  2BA0 A;  4QQB X;  1HH2 P;  1X65 A;  3K0X A;  5C44 G;  2UXC Q;  1N33 Q;  1PH1 A;  3EBE A;  2PNH A;  3EN2 A;  1V1Q A;  5GAD C;  3GTM H;  2C35 B;  1VQM A;  5BR8 L;  3F8T A;  4A3J H;  3KF8 B;  1Q82 C;  5IYD H;  4HJ9 A;  4B3M L;  3HOU H;  1XMQ Q;  1VQ7 A;  4A3L G;  5LMU L;  3GTK H;  1HR0 W;  3I4M G;  2HHH L;  4BA1 I;  1WCM G;  1XMO L;  5ELO A;  2R7Z H;  3K7A H;  2CKZ B;  4FDB A;  1VQC A;  2BA1 A;  4OWX B;  4JI3 L;  2R93 H;  1FJG L;  1QUQ A;  3RN5 A;  2N8N A;  4B3R Q;  2VUM H;  3FHW A;  4C2M H;  2EIF A;  2GN5 A;  4GLV B;  1PH7 A;  5LMU Q;  1PH8 A;  1EQQ A;  3HKZ E;  2OQK A;  2RCN A;  1HR0 Q;  2NVX H;  4R4C A;  4R4Q A;  2VNU D;  2WAQ E;  4LFC L;  2N49 A;  3PV0 A;  3PUX A;  4A3C G;  2HQL A;  1YVC A;  4AQY Q;  3FKI G;  2R93 G;  3ULL A;  1Q86 C;  1Q1B A;  2BH8 A;  3K80 C;  4OWW B;  2R7Z G;  3GTP H;  4GOP B;  5GAH C;  4OX9 L;  2B63 G;  4A3B G;  1MJE A;  1EQR A;  1HNW Q;  1JJG A;  2NVY H;  3S17 H;  1X9N A;  1OXX K;  3HOU G;  1HNZ L;  1TWC H;  4YWM A;  5IYB H;  2E2I H;  1YHQ A;  2IHF A;  2E8G A;  4A3I H;  3S15 H;  4DR3 Q;  2KHI A;  1NE3 A;  3OTO L;  4IJL A;  2Z6K C;  5AJ3 Q;  2KHJ A;  4DV6 Q;  1IBL L;  1E24 A;  2AMC B;  3LGJ A;  4L5Q A;  1EWI A;  1U0L A;  3F2B A;  2D62 A;  1A63 A;  1SFO H;  1J5E L;  2B3G A;  4POF A;  5M3M G;  5M3M H;  1XTD A;  1YBY A;  3G48 A;  3B6Y A;  5IWA Q;  4X64 L;  3M9B A;  4A3K H;  3T1Y L;  2XTI A;  1JE5 A;  4P71 A;  1N36 L;  1VQF A;  5JEA J;  1HNX Q;  3G4S A;  3W1G A;  1HR0 L;  2OTJ A;  2Z6K A;  3PO3 G;  2E5L L;  2K5H A;  3F1Z A;  3I55 A;  2K5N A;  3RZD H;  1KQS A;  4L5S A;  4LF4 L;  1L2F A;  1FL0 A;  2JA5 G;  4DV5 Q;  2K50 A;  4A3I G;  4A3F G;  1N33 L;  3AEV A;  4WJ4 A;  4JI1 Q;  3IRB A;  3U4Z A;  3PUW A;  5IYB G;  2WP8 J;  1QVC A;  4JI2 Q;  2F4V Q;  4DV1 L;  4IJH A;  1HNW L;  1CKO A;  3GTL H;  4LUZ A;  1Z47 A;  1Q1E A;  4L5T A;  3CCL A;  4NPS A;  2Y0S E;  1K73 C;  4OO1 I;  3TRE A;  3I4O A;  1VCI A;  3PIO A;  2B63 H;  4A3B H;  2VQF L;  2AWN A;  4YCU A;  2NZH A;  4PMW A;  3FKI H;  4DR5 L;  4DR6 L;  4A3C H;  2A1A A;  3CCR A;  1S72 A;  1E1T A;  4UP9 A;  1M90 C;  3RLF A;  3D31 A;  2VZA A;  4TVA B;  1JB7 A;  4L5R C;  4NXN L;  4DV0 L;  4LF8 Q;  2Z0S A;  1E3P A;  1YI2 A;  4B3T L;  4LF7 L;  3BJU A;  2A8V A;  3S1Q H;  3GTQ H;  3L0O A;  4K0K L;  4KHP Q;  4YY3 L;  2VUM G;  1KRS A;  4GN5 A;  3RR5 A;  1IBK Q;  1NBW A;  4HJ7 A;  3PUZ A;  4JI0 L;  3HOW G;  4JV5 L;  5IWA L;  2YV5 A;  4DV3 Q;  2D0P A;  4TQU S;  1V43 A;  1QVG A;  1VQ8 A;  1WCM H;  4GKK L;  1VS0 A;  3I4M H;  4NB3 A;  4A3L H;  2UU9 L;  5IYD G;  2I0Q A;  4A3J G;  1UE6 A;  4DK3 C;  3J81 i;  4DR4 Q;  1MKH A;  4PZ8 A;  1SRU A;  5FJ8 G;  5IP9 H;  1YNX A;  2ES2 A;  5C44 H;  5LMN Q;  3I56 A;  4LUV A;  1IXR A;  4B3S L;  2CWP A;  4A75 A;  1G29 1;  1IZ6 A;  3STB D;  4AYB G;  3WWV A;  1PH6 A;  2LXK A;  1PH2 A;  1VQ6 A;  1K0R A;  2JEB I;  1X3G A;  2UXD Q;  1S40 A;  2WFW A;  3G71 A;  3T1H L;  1WI5 A;  5DLQ E;  5C0X G;  1VQL A;  3K8A A;  1P8L A;  3M7N A;  3TEH B;  3F2D A;  1XMQ L;  2UXB L;  2UUA Q;  3H0G H;  4BY7 G;  3AYH B;  1I5F A;  3GD7 A;  2MNA A;  2LXJ A;  4DV5 L;  4A3D H;  1XPO A;  3M3Y H;  2CFM A;  4GS3 A;  4LFB Q;  1HZC A;  3JAM c;  2R92 H;  4A3E H;  5J3B A;  3CCQ A;  2R7D A;  5FLM G;  4DR4 L;  1YHB A;  3JC6 6;  3E9I A;  3UDG A;  1Q8K A;  2KEN A;  1S3O A;  1NTG A;  3GDE A;  5BR8 Q;  1BBW A;  2K14 A;  4IFD I;  2ZTE A;  2NN6 G;  3U4V A;  5IE8 A;  1Q81 C;  3M4O H;  1TWF H;  1PVO A;  4OO1 G;  2MFI A;  1Q12 A;  4LFA L;  2QA4 A;  3KJP A;  1K9M C;  1XJV A;  4DAY B;  4JI4 L;  2HIV A;  3GTG H;  4AYB E;  1VQA A;  1Y1V G;  4YY3 Q;  2HT1 A;  2IHE A;  3HOY H;  3CD6 A;  2IX0 A;  1KD1 C;  4XIG S;  4A93 G;  2R6G A;  3W1B A;  3PCO B;  5C4J H;  4JI2 L;  3CMA A;  4QL5 A;  4UP7 A;  1GM5 A;  3BZC A;  3OTO Q;  3S14 H;  3M4P A;  4KLK A;  4JI8 L;  4GKJ L;  4YCV A;  4LFC Q;  4DPG A;  3KDF A;  1YHA A;  4GOP A;  4BA2 I;  5JJL A;  4R4O A;  2Q2U A;  1I50 H;  4X62 Q;  1VQO A;  2KBN A;  2FXQ A;  4P75 A;  4IFD J;  5LMN W;  3RN2 A;  1NMG A;  4O2D A;  3HOV H;  4LFB L;  3UE0 A;  2E2H H;  4PZ6 A;  4LF6 Q;  1SLJ A;  1Y1W G;  4WJ3 M;  2WAQ G;  4UPA A;  1IBK L;  3DLL A;  1X3E A;  3MEF A;  1PFS A;  2OWO A;  2F3I A;  1JJC B;  2GVB A;  4BBR H;  1L1O B;  2ZTD A;  5IYC G;  4R4I A;  5EAY A;  4DV3 L;  4GKK Q;  4JI1 L;  1E1O A;  4BBS G;  4A76 A;  1SE8 A;  2ZJP A;  3S1R H;  2UUB Q;  1BVS A;  2MO1 A;  3CQZ H;  4IPH A;  4O0A A;  1A0I A;  1SN8 A;  3G6E A;  2ASB A;  4EX5 A;  2MO0 A;  1K83 H;  4GLA C;  2JJQ A;  4DV2 L;  4X6A H;  5C3E G;  1GO3 E;  4C3H H;  1E7Z A;  1LYL A;  1MJC A;  1BKB A;  2F52 A;  1EIF A;  3KDF B;  3L2P A;  4XTC S;  3W5O A;  2JQO A;  1K8A C;  3HOZ H;  1MIU A;  4JI8 Q;  1PYS B;  4GKJ Q;  1I6H H;  4DR2 L;  4HIM A;  1VQG A;  2YU9 H;  5IT9 c;  3GTO H;  1NMF A;  3K7U C;  3KF6 A;  1VQP A;  5GAG C;  4MZ9 A;  2A19 A;  1FGU A; 
#chains in the Genus database with same CATH topology
 3BZD B;  3PF5 A;  2KA7 A;  4A3M G;  4QIW B;  1VQ9 A;  4C3I G;  2KEC A;  3PIP A;  2SNS A;  1EIY B;  4K2K A;  1GKH A;  1VQK A;  3M4Q A;  2IY5 B;  1HUN A;  1G2S A;  4X64 Q;  2EJF C;  5M5W B;  4ZK9 B;  4RH6 A;  1X54 A;  3PO2 G;  3ER0 A;  1YNN D;  3E0E A;  1D8L A;  2KQ3 A;  5KND A;  4U68 A;  2VQE L;  2F4I A;  5JJK A;  1SBB B;  3J80 c;  2B2U A;  4LK1 C;  2CH4 W;  2UXC L;  3TP8 A;  1PYB A;  3HGB A;  2R3Z A;  3TDQ A;  2IL8 A;  4K5X A;  1B1Z A;  1N36 Q;  5HUR A;  3I4M B;  1CK1 A;  1EQT A;  3CCJ A;  1JR0 D;  5M5X H;  1GVP A;  4JYA Q;  2CQO A;  3HOZ G;  1BCP C;  4P73 A;  2CWA A;  3HKZ B;  1LT6 D;  3BG3 A;  1KAW A;  2JA6 G;  4B3R L;  1QZG A;  1W3S A;  4LF6 L;  4K14 A;  4BWG B;  3D0F A;  3AQQ A;  4JI7 L;  2K5Q A;  2AQ3 B;  2Y0S B;  3C1E A;  2B63 B;  1CHP D;  1IL8 A;  4BY1 G;  3CCV A;  5LMN L;  3I4N G;  1FNW A;  5A2Q E;  4BXX H;  1QNK A;  1JMC A;  1K83 B;  4CKE A;  1SNQ A;  3UE1 A;  5LHY 1;  2E5L Q;  2HDL A;  4JV5 Q;  4LNQ A;  4ABN A;  2IW3 A;  5GAE C;  1TXY A;  4ODG A;  5AJ3 L;  2R7F A;  2PQA A;  1DD2 A;  1RIP A;  1Q3L A;  4JBK A;  1DCZ A;  4DUY L;  5EPL A;  3SEB A;  3R8B A;  2OTL A;  2QEX A;  2A68 D;  3A0J A;  1TWH B;  2XVS A;  3JAM i;  4YCW A;  4IPG A;  1KNA A;  3H91 A;  4L8J A;  4DK1 A;  2XIW A;  2E2J H;  1X3F A;  3KOJ A;  3QB3 A;  5CV5 A;  3T13 A;  4CDC C;  3CCE A;  3GV6 A;  2OEO A;  1YZ6 A;  2K75 A;  4B9X A;  2B2U C;  1DXM A;  4PMB A;  4DV1 Q;  1VQ4 A;  4LF9 Q;  1D1K A;  1SJE D;  3S1R B;  4GN4 B;  2A6H C;  5E4X A;  2F0E A;  3D3R A;  2R92 G;  1VQB A;  3IFD A;  4XQJ A;  1R9T H;  3H3V H;  3X3M A;  4IFD G;  1BUV T;  3EVQ A;  2CHB D;  1VQJ A;  1A8V A;  1LLR D;  5C3E H;  2RSN A;  1HTP A;  4BY7 H;  3H0G G;  5ISR A;  1SSO A;  1CFM A;  2A69 C;  3FDT A;  3DWP A;  3HOW B;  2F0V A;  2IX3 A;  1GOZ A;  1JOQ A;  1D5M C;  4DAP A;  3T1H Q;  4HIO A;  2YYZ A;  1L1O A;  4AH6 A;  3PUY A;  1ENC A;  3QJY A;  4ZKC B;  4H44 C;  4U67 3;  2NUC A;  1PFB A;  4RHR A;  2PI2 E;  3S2D H;  4FYD A;  2H5X A;  1HZB A;  4KJN A;  5KGU A;  1VDZ A;  1U4P A;  2WKC A;  5GQO A;  2G9H D;  1HZ9 A;  3E3X A;  1YNN C;  1B7Y B;  4J6H A;  5FOB B;  1C9O A;  3K5M A;  1OXT A;  1RTO A;  2L9H A;  5E1F A;  3NWT A;  5HY6 A;  3SGI A;  5C3E B;  3CCS A;  1XYI A;  3HOW H;  3HOY G;  3MXG A;  5IY0 A;  2MUY A;  2K52 A;  3TRZ A;  3A5U A;  1L0Y B;  1A3T A;  2K5V A;  5E3F A;  3H3V I;  1SMX A;  2DN8 A;  2I5L X;  3IAY A;  1HUM A;  1IKM A;  4JVZ A;  4FXK C;  2JA9 A;  2K1B A;  4MTN A;  4AQY L;  3V96 A;  3ZYY X;  1CQV A;  1LTS D;  1V9P A;  3GTJ H;  4QUC A;  3RLN A;  2J0T D;  1B70 B;  4KHP L;  1PDQ A;  3T16 A;  3J7Y W;  4DV2 Q;  1RDP D;  4C1N K;  4R4T A;  5C4Z A;  3G6J B;  1G91 A;  4A3F H;  3ULP A;  1AN8 A;  5GRO A;  1ET9 A;  3VYR A;  2QCP X;  3A7A B;  1WFQ A;  4R8N A;  4KY7 A;  2UUA L;  1I94 L;  1PTO C;  4HJ8 A;  2X6G A;  1A3V A;  1WOC A;  2B2Y C;  4K5V A;  4HCE A;  3RD4 A;  1JB3 A;  5IGD A;  2PO4 A;  3BU2 A;  5E7N A;  2EYM A;  4YIJ A;  1HH2 P;  5C44 G;  2UXC Q;  4HMI A;  3K5O A;  2PNH A;  2EY6 A;  3GTM H;  4XQQ A;  5BR8 L;  3F8T A;  3KF8 B;  3KK7 A;  1Q90 A;  1IW7 C;  1VQ7 A;  1XMO L;  4DA2 A;  2R7Z H;  4FDB A;  4NKL A;  2BA1 A;  4DNR B;  4JI3 L;  5I9O A;  1QUQ A;  2RDH A;  3A55 A;  1FGB D;  4EQO A;  4B3R Q;  3L9A X;  1GUG A;  2Z1C A;  3NBI A;  4XT1 B;  4DAV A;  4GLV B;  1EQQ A;  3HKZ E;  2L11 A;  2VB3 X;  1QG7 A;  4A3C G;  2HQL A;  1YVC A;  2EZV A;  3GTP B;  2R93 G;  2F03 A;  3W3A A;  5GAH C;  3KLS A;  1C4Q A;  1EY8 A;  3C46 A;  1EQR A;  1OXX K;  1TWC H;  2E2I H;  3MTS A;  1E2Z A;  4OEM B;  1DZ1 A;  1I4Q A;  1NE3 A;  5K5P A;  2E75 C;  2Z6K C;  2F0Q A;  5COY A;  1E24 A;  1MSH A;  2SOB A;  4A3I B;  5G3L D;  1A63 A;  1J5E L;  5M3M H;  3G48 A;  3T51 B;  3M9B A;  4KMU C;  4ZQ3 A;  3T1Y L;  3CKI B;  1VQF A;  1MBY A;  3W1G A;  3A8I E;  2Z6K A;  4K6D A;  3F1Z A;  3I55 A;  2K5N A;  2MJ8 A;  3RZD H;  1KQS A;  1A6X A;  2XRQ D;  2JA5 G;  5CV6 A;  2K50 A;  4FF2 A;  3AEV A;  4KKT A;  3PUW A;  3MAQ A;  2EDG A;  4DV1 L;  1HNW L;  1GHK A;  4CKC A;  4OO1 I;  3BVZ A;  2D2C C;  3TZD A;  3CRK C;  4ZCK A;  4DR6 L;  3FKI H;  2A1A A;  3CCR A;  1AFP A;  4UP9 A;  4TVA B;  2WB1 B;  4NXN L;  3DUZ A;  1YI2 A;  4B3T L;  2EYL A;  3L0O A;  2ZT9 C;  4IUP A;  5EPJ A;  3CQZ B;  2VUM G;  4JI0 L;  3PUZ A;  1B44 D;  5IWA L;  3BDO A;  2YV5 A;  4F88 A;  4DV3 Q;  4TQU S;  1MD2 D;  1PFM A;  1SE3 A;  3QOJ A;  1HXY D;  5IYD G;  3I4L A;  1RD9 D;  1MKH A;  1PYW D;  5LL6 S;  1NNX A;  5IP9 H;  1AEX A;  1YNX A;  4MIU A;  1A2T A;  3RZO B;  2DNC A;  3HOV B;  3VA7 A;  3OMG A;  1IHZ A;  1R4Q B;  1VMC A;  2JEB I;  5C5L A;  2EJG C;  3OWE B;  4XYQ A;  2C9O A;  5I6Y A;  3K8A A;  1P8L A;  3TEH B;  1XMQ L;  2UUA Q;  3NTK A;  2PMZ B;  4L6T B;  2MNA A;  4A3D H;  4IUR A;  1KDA A;  4GS3 A;  3M4Y A;  4LFB Q;  4A3E H;  3CCQ A;  2JYO A;  3E9I A;  2KEN A;  2RVL A;  3GDE A;  4IFD I;  5BR8 Q;  2QKI C;  3KBG A;  3U4V A;  3UI2 A;  3C2P A;  4LFA L;  3Q6S A;  3NE5 B;  1ZYR C;  2RA4 A;  1SND A;  1KD1 C;  4A93 G;  3NQI A;  3NQT A;  5C4J H;  3OTO Q;  2WIN B;  4KJO A;  1WD0 A;  3S14 H;  1I6V C;  5D65 A;  4JI8 L;  5I2Y A;  4DPG A;  3VR2 A;  5KEE A;  2Q2U A;  4IFD J;  3RN2 A;  4O2D A;  3R3O A;  5JVH 3;  2HCC A;  3HEJ A;  2H4O A;  2WAQ G;  1IBK L;  4X3U A;  3K57 A;  1X3E A;  3MEF A;  1Y8P B;  4BBR H;  1L1O B;  2QIL A;  4J8Q A;  5IYC G;  5EAY A;  2IJ0 A;  4JI1 L;  1S4Z A;  4BBS G;  3QR8 A;  2K32 A;  2MO1 A;  1I3Q B;  2L4N A;  3G6E A;  4EX5 A;  1HA6 A;  4DV2 L;  1PRT D;  4CJ2 C;  3DXJ C;  2LMC B;  1UEA B;  4C3H H;  5M9O A;  1E7Z A;  1LYL A;  1MJC A;  1BKB A;  2F52 A;  3KDF B;  2HUG A;  2TSS A;  3J7A F;  1I6H H;  2XN9 C;  4WFN 3;  3CRL C;  1VF7 A;  4DR2 L;  2YU9 H;  3Q22 A;  1EOT A;  3GTL B;  3KF6 A;  3GTK B;  5GAG C;  2JA8 H;  1FGU A;  4JOI A;  3VYT A;  4QJF A;  5M5W H;  1KXL A;  4TSS A;  1PA6 A;  1LTT D;  1KIX A;  3H15 A;  3GV3 A;  3ERS X;  4IUQ A;  1PV4 A;  2PZW A;  3I91 A;  4I65 A;  4GOP C;  5EBC A;  5IP7 G;  3J7A 5;  1SDF A;  4LF8 L;  4QY7 A;  2CCZ A;  2JA7 H;  4RG1 A;  2UUC Q;  3WDN A;  4C3I B;  4P72 A;  2JA7 G;  4MN3 A;  3HOX G;  1XMO Q;  2B29 A;  2V1C C;  2ZTC A;  2JSO A;  3AMU A;  4IUV A;  1SFO B;  1SR3 A;  4X3T A;  2XNA C;  1PTO H;  1SYE A;  2CQA A;  2Z9H A;  1PH5 A;  3X3N A;  4C56 C;  1G6P A;  1EFW A;  1SYB A;  5IGG A;  4DU9 A;  1UE5 A;  3PQI A;  4C3J B;  1UE1 A;  5C4X G;  2K4K A;  4GLX A;  4CDD C;  3EFX D;  1TS2 A;  3KBX A;  2O5J C;  5M5Y H;  2J4X A;  2JA8 G;  3E0J A;  1HNX L;  1SXT A;  1BBX C;  4UP8 A;  3S17 B;  1XPR A;  1BBU A;  4DV0 Q;  2A68 C;  5CR3 A;  3CAM A;  1KAB A;  2YTV A;  4XQN A;  3HKS A;  4GN3 B;  1C8C A;  4C3H G;  3J80 L;  4A3G H;  4DF7 A;  1STN A;  5EGT A;  3I73 A;  5D14 A;  1AE2 A;  2L5T A;  1CKM A;  4KHZ A;  1Q7Y C;  4ALP A;  1WJJ A;  1B4O A;  4ID6 A;  3AFP A;  3OMC A;  1QVF A;  3ITP A;  1LT3 D;  3S16 H;  3FMC A;  3S2H H;  4LWC A;  5IYC H;  4DR7 L;  3SK6 A;  4BBR G;  5I9P A;  1N9W A;  3CW2 C;  3ULJ A;  2ALY B;  3J7A V;  3ICE A;  1ZXT A;  2ZJR A;  1EY9 A;  3L7Z C;  3LWU A;  4WJW A;  4XXE A;  1EYG A;  1CSP A;  4PV1 C;  2Y0S G;  2E2D C;  1QCB D;  1OXS C;  1LTL A;  1J6Q A;  2MPM A;  3K6O A;  5M3F G;  1XX8 A;  4JG2 A;  2Q2H A;  4ZLT F;  4QF4 A;  2XWJ B;  3CCU A;  4FVM A;  4DR6 Q;  5E4W C;  3CHB D;  1H9S B;  4HID A;  4RGO S;  1HJP A;  3VDY A;  1CZW A;  1B3A A;  5JEA H;  1OXV A;  5KYL A;  1Y1W H;  3P75 A;  1YJN A;  1JOR A;  1SMY D;  5HGQ A;  2DGY A;  1IBL Q;  1X6O A;  1ZEQ X;  1PH3 A;  4DV4 L;  3R2T A;  4MNO A;  1EY5 A;  2PQA B;  3DEO A;  3KUP A;  1TWA H;  4IPC A;  4JBW A;  1PHJ A;  4EGV A;  3SXH A;  3RMH A;  1JCK B;  1EOV A;  1K28 A;  2M00 A;  3U9O A;  4LW1 A;  4LF4 Q;  2KCM A;  4R9W A;  4H02 A;  1E2W A;  3H0G B;  3GTM B;  4LUO A;  3QIA A;  1K0S A;  4N8F A;  1ET6 A;  4DK6 C;  3J81 j;  4DR5 Q;  5IP9 G;  4UHV A;  2O2L D;  4HCS A;  1F77 A;  4B3S Q;  1KRT A;  4DR1 L;  1XNQ L;  4NMZ A;  1M1K C;  1CZG A;  4JI3 Q;  1DYQ A;  1VQD A;  3BVM A;  4O42 A;  1EYD A;  2K7V A;  1F2M A;  2FFK B;  3TS2 A;  4GZY C;  3FP9 A;  2F0K A;  2UXB Q;  2NB0 A;  4A3D B;  2KOL A;  4JYA L;  3J80 E;  1W2B A;  3H3V C;  1Q8I A;  5CV9 A;  3TP5 A;  4LF9 L;  1NCV A;  4R8I A;  1UE7 A;  3K5L A;  3K59 A;  3CU7 A;  2NVQ B;  4JI7 Q;  4UY8 C;  2EY5 A;  4QIW E;  2B2W C;  1LM0 A;  4DR3 L;  3MXN A;  2Q2I A;  3A8J E;  3SE0 A;  1HZA A;  2JA5 H;  2FJ2 A;  2VL6 A;  1I4H A;  1EY4 A;  1GXD C;  1WYD A;  3NTI A;  3U50 C;  2PPB C;  4M1U B;  4G57 A;  1PRT B;  2ID0 A;  1NSN S;  4GNX C;  3MEH A;  1X32 A;  1XTC D;  3I2Z A;  1EYA A;  3SHL A;  1N34 Q;  4X66 L;  4B3M Q;  3CPF A;  3E5S A;  4B3T Q;  1X65 A;  2JP1 A;  1O78 A;  3K0X A;  1LT4 D;  1PH1 A;  5DNF A;  5GAD C;  1DON A;  5I6W A;  2F0D A;  1STB A;  1Q82 C;  4A3L G;  1HR0 W;  3I4M G;  5ELO A;  5LL6 X;  3NPP A;  3K7A H;  2CKZ B;  1VQC A;  4OWX B;  5C44 B;  2R93 H;  1HFN A;  4B08 A;  3FHW A;  1K8M A;  2EIF A;  1PH7 A;  1PH8 A;  3TBI B;  5LMU Q;  2VNU D;  3RZD B;  1ILP A;  4AQY Q;  3ULL A;  2NVT B;  2BH8 A;  2F0G A;  3K80 C;  2R7Z G;  1GUT A;  1Z6H A;  2B63 G;  4OX9 L;  1TWG B;  1MJE A;  2AQ2 B;  1HNW Q;  1JJG A;  1X9N A;  3Q24 A;  5IYB H;  4FP5 D;  1ILQ A;  4A3I H;  4DN4 M;  3S15 H;  1H9M A;  3IL8 A;  3OTO L;  1LTA D;  3AU7 A;  1IBL L;  2AMC B;  3LGJ A;  3P7J A;  1EWI A;  1U0L A;  3VR3 A;  1GUS A;  1L0X B;  2B3G A;  1B9N A;  4OHJ A;  2XTI A;  1HNX Q;  2Z8L A;  3TN2 A;  2OTJ A;  3D6W A;  3VA5 A;  2EJM A;  2ZXO A;  1EL0 A;  2E5L L;  2QF7 A;  4A3F G;  4A3I G;  1WTO A;  3MC0 B;  2B2T C;  3IRB A;  3U4Z A;  5IYB G;  1EWH A;  2WP8 J;  2F4V Q;  1CHQ D;  4IJH A;  4LUZ A;  3A54 A;  4L5T A;  1I4G A;  2Y0S E;  1K73 C;  1TS4 A;  5EKK A;  2K6A A;  2B63 H;  3PIO A;  4KN7 C;  1BQQ T;  4DR5 L;  3OWF A;  1S72 A;  1S5F D;  2BDN A;  4DAY A;  1R4P B;  3T53 B;  3D31 A;  2VZA A;  1JB7 A;  1E3P A;  3Q23 A;  4LF7 L;  1WTV A;  3C3L A;  1SEB D;  1DOM A;  2RCF A;  1KRS A;  3AB9 A;  3EA6 A;  3HOW G;  5FO9 B;  2D0P A;  4X3K A;  3I4M H;  4A3L H;  1RF2 D;  1M8A A;  2I0Q A;  4DK3 C;  1SRU A;  2ES2 A;  5LMN Q;  3I56 A;  4LUV A;  1DOK A;  1STE A;  3SK5 A;  1WD1 A;  4NP5 A;  4LAA A;  4B3S L;  1IZ6 A;  4AYB G;  3WWV A;  1PH6 A;  4ME5 A;  3HZX A;  2LXK A;  1EIH A;  1VQ6 A;  1E0B A;  4HSV A;  3WOF A;  3G71 A;  4WRD A;  1VQL A;  1STY A;  1VMP A;  1H9K A;  1D6E C;  4RCN A;  3H0G H;  4BY7 G;  2B8F A;  1I5F A;  3GD7 A;  1BDO A;  3V2T A;  2O5I C;  2R92 H;  4ZRZ A;  5FO7 B;  3S9W A;  2ICI A;  3D4W A;  1Q8K A;  1CT1 D;  1S3O A;  1BBW A;  2IWH A;  2ZTE A;  5IE8 A;  1Q81 C;  1ICF B;  3M4O H;  1PVO A;  2D5D A;  1K9M C;  4RKB A;  3KJP A;  5J39 A;  3LWE A;  1XJV A;  4YY3 Q;  2FHT A;  2HT1 A;  2IHE A;  4KY5 A;  4XIG S;  3W1B A;  3PIP 3;  3H09 A;  5DM6 3;  4DXG A;  1LTI D;  2LFN A;  1YHA A;  4GOP A;  3NUC A;  3OIP A;  1I50 H;  4P75 A;  5LMN W;  1TKW B;  1O7L A;  2E2H B;  4PZ6 A;  1SLJ A;  1FR3 A;  2PNR C;  4UPA A;  3DLL A;  4RGT A;  1TQO A;  1M4V A;  4GKK Q;  1E1O A;  1YNJ D;  3S1R H;  2EYO A;  4IPH A;  2UUB Q;  1A0I A;  1G2T A;  2N55 A;  4X6A H;  4F7X A;  1GO3 E;  1V8Q A;  5DEH A;  1UUP A;  1EIF A;  1BO0 A;  1I4R A;  1QE6 A;  3OW7 A;  3L2P A;  2B8G A;  2K04 A;  3HOZ H;  1MIU A;  4JI8 Q;  1PYS B;  1I4P A;  1DM0 B;  1A15 A;  5IT9 c;  3GTO H;  1NMF A;  5KIX A;  4KTA A;  1Y1W G;  4N8X 1;  2HDM A;  5JEA G;  2A6E D;  5CYU A;  2IT1 A;  1Z9F A;  4X66 Q;  1A62 A;  1GD7 A;  2J7Z A;  5D3D A;  4LFA Q;  1V1P A;  1XPU A;  1Q46 A;  3A7L A;  1IL2 A;  3GP7 A;  4XYO A;  2NN6 I;  5C0X J;  3TS0 A;  3K5N A;  4G7H C;  1S5E D;  3MXU A;  3PO2 H;  3OYY A;  5M3F H;  5ELB A;  4LF5 L;  2EE1 A;  4X3S A;  1PRT F;  1VQ5 A;  1YJ9 A;  1EZ6 A;  1ROD A;  1KHI A;  2K28 A;  2XGT A;  3OPO A;  1KAA A;  1VQI A;  4DR7 Q;  2XSC A;  3J80 i;  1FJG Q;  3W2D A;  2F4V L;  3TP6 A;  4HTH A;  4YWK A;  2F0L A;  1FYC A;  2NVQ H;  3NWS A;  5G3L F;  4HAE A;  5JPM C;  1AW7 A;  4A3M H;  2KVM A;  4S3S A;  5J22 A;  4PG3 A;  1TY0 A;  1SNM A;  4P74 A;  1O80 A;  4C1N I;  4POG A;  3FPP A;  1EYC A;  1H95 A;  2RSO A;  2WB1 G;  4NW2 A;  4A3G G;  1IYV A;  4JBJ A;  5H1S E;  2IX1 A;  1IKL A;  2CW0 C;  4Y52 H;  4HJA A;  2JA8 B;  1P16 A;  3D8G A;  4QMG A;  2PI2 A;  3DWQ A;  4OON A;  4YHH L;  1ASY A;  3S1M H;  1XNR Q;  4DR1 Q;  2RQX A;  2CH4 A;  4JBM A;  4IN3 A;  2MGS A;  3CCM A;  1UAP A;  4A3B B;  2JK8 A;  3AFQ A;  3DWA A;  1MSG A;  5C4X H;  3J7Z C;  2ZJQ A;  2OCE A;  2A6E C;  4J15 A;  1VQH A;  3I7F A;  1QUQ B;  4K8J A;  2ZM6 L;  4F8M A;  1SYD A;  1JOO A;  2QGQ A;  3HOV G;  1I3Q H;  3SR1 A;  3ONA B;  4E6I A;  3QWN A;  1J9O A;  3HOX H;  1TU2 B;  3R93 A;  5ELN A;  1EY6 A;  3R2I A;  4OEL B;  4G7O C;  2DUD A;  1B2T A;  1E22 A;  1EWC A;  5IP7 H;  1EEF D;  1J5E Q;  1C7Y A;  1BR9 A;  2N88 A;  2BH2 A;  3NK9 A;  4K2L A;  1U4R A;  1BNZ A;  1JC7 A;  4YWL A;  3T1Y Q;  1YNJ C;  1O7I A;  3I72 A;  1IYJ B;  3PO3 B;  2A5H A;  4KD3 A;  5FK9 C;  4NXM Q;  2EYF A;  3M3Y B;  3S24 A;  2NN6 H;  3BZK A;  2EQS A;  3I8Z A;  4X62 L;  4CBV A;  3S14 B;  2QEJ C;  3U9S A;  1UEB A;  1EU3 A;  5FLM H;  3Q8D A;  2DJF C;  1IBM Q;  3PMF A;  3UDI A;  1ASZ A;  3IFT A;  1DOL A;  1EZ8 A;  4Y7N H;  4EVO A;  1SRO A;  1YIJ A;  2Z4I A;  3FPU B;  2BE5 C;  2CW0 D;  2OT2 A;  5FLX c;  2AKW B;  4OWT B;  2AHO B;  1HHV A;  1PZK D;  4BBS H;  3NEL A;  3URY A;  1PRT C;  5C0X H;  4GNX B;  1T9H A;  1TII D;  3GQB A;  3PIO 3;  1AP0 A;  1VQE A;  3KYH C;  3PSI A;  2EPB A;  1PMR A;  2UU9 Q;  4JI4 Q;  3A56 A;  2L55 A;  2X6L A;  2WAQ B;  2L1B A;  2KCT A;  5FJ8 H;  1SNC A;  2G5D A;  3S1Q B;  1ZKO A;  2HHH Q;  2KED A;  4IPD A;  1D5Z C;  2M9V A;  4DV4 Q;  1YIT A;  4DUZ Q;  2WB1 E;  1D7Q A;  3RZO H;  2TMP A;  2F3V A;  1QNU A;  4A93 H;  1ESF A;  1UWV A;  2AWO A;  2K5W A;  4PZ7 A;  4B9W A;  2JEA I;  4MHE A;  1GJX A;  4DKA C;  3TQY A;  4ME3 A;  1SNO A;  1N32 L;  4OXP A;  4LF5 Q;  4JI5 Q;  4RMF A;  1L1O C;  3J81 c;  4JI6 Q;  2FMM A;  1LUZ A;  2WAC A;  4DUZ L;  1ZYR D;  1H9J A;  5C3W A;  1B53 A;  4RWS C;  1RHP A;  1A3U A;  2WII B;  3PGZ A;  3OW2 A;  4OIJ A;  3A74 A;  3PF4 A;  3NEM A;  4N9T A;  4HIK A;  2F0O A;  4A3E G;  2A73 B;  3IKJ A;  4C3J H;  3F2C A;  2GA4 B;  5CV4 A;  1NY4 A;  4XDX A;  4A3D G;  3M4O B;  3OHX C;  3NXW A;  3RLO A;  4BS9 A;  2PYK A;  2LY7 A;  4DV7 Q;  3TZU A;  4QCL A;  3PO3 H;  4DR2 Q;  2DY8 A;  3TP7 A;  1U9R A;  1U5K A;  4JOI C;  1DGS A;  4A3K G;  5JVG 3;  1ML0 D;  5KNB A;  1AZP A;  5D3I B;  3MXP A;  4DV7 L;  1PZI D;  2NVY B;  3N52 A;  1WCM B;  1CSQ A;  4GNX A;  4OX9 Q;  2FMC A;  4FF4 A;  1T5E A;  1CKN A;  1OO9 B;  4QQB X;  2BA0 A;  1MI2 A;  4WOR A;  1V1Q A;  3EN2 A;  1KTK A;  3WOE A;  1TVX A;  2NVX B;  5IYD H;  1G8Z D;  5KRU A;  3GTK H;  5L37 A;  1I6H B;  3QOL A;  4KK7 A;  1Y8O B;  2QDB A;  1ICW A;  4RFB A;  3S1M B;  1JE4 A;  2OXP A;  3RN5 A;  4CKB A;  1NUC A;  2VUM H;  1MHW C;  3BYY B;  2GN5 A;  2NVX H;  2ICE C;  5IOC A;  4R4C A;  2PQE A;  1KLU D;  2KCC A;  2N49 A;  3PUX A;  4IAL A;  2WKD A;  3FKI G;  1PZJ D;  3NTH A;  2Z4H A;  3GTP H;  1LO5 D;  4BBR B;  2B2V C;  4L63 B;  2NVY H;  3H6M A;  3HOU G;  4YWM A;  2IHF A;  5C6A A;  4DR3 Q;  5C5M A;  2KHI A;  1S5B D;  4IJL A;  2F0H A;  4ILW A;  5AJ3 Q;  1MGS A;  4DV6 Q;  2R7Z B;  2DNE A;  5M3F B;  1HCZ A;  3F2B A;  2D62 A;  1FNU A;  4Q5V A;  5CBE E;  1F2Z A;  4POF A;  3K0Y A;  5M3M G;  3B6Y A;  1YBY A;  5CMD A;  4PQX A;  2AQ1 B;  5C4J B;  1JE5 A;  1N36 L;  1D2B A;  3G4S A;  3PO2 B;  1HR0 L;  2RBM A;  2KEE A;  2K5D A;  2K5H A;  2EYP A;  4ZUJ A;  4L5S A;  1EEI D;  1L2F A;  1N33 L;  4WJ4 A;  4DV5 Q;  4ZYS A;  2I07 B;  5BN5 A;  4C2M B;  3RUZ A;  1CKO A;  1Q1E A;  4K8I A;  2IPK D;  4H0L C;  4I7A A;  3I4O A;  1VCI A;  3HP3 A;  3TME A;  2QDL A;  2VQF L;  2AWN A;  1JWS D;  2KUM A;  3L3O C;  2MHV A;  4PMW A;  4A3C H;  2Q8I B;  1E1T A;  4A3F B;  1M90 C;  2F0J A;  4DV0 L;  4LF8 Q;  2Z0S A;  4A3J B;  3S1Q H;  4K0K L;  2A8V A;  4OGQ C;  3GTQ H;  5IGF A;  4YY3 L;  4GN5 A;  3RR5 A;  1NBW A;  4JV5 L;  1B3Q A;  3GTJ B;  4Q0F A;  3LX0 A;  4KKU A;  4GKK L;  1V43 A;  4QUF A;  1HRJ A;  1VS0 A;  1VF5 C;  4IUT A;  2WV6 D;  4NB3 A;  5K36 H;  1STA A;  5AFW A;  2UU9 L;  2EYJ A;  1UE6 A;  1EFI D;  3HS0 C;  3SVM A;  1BCP F;  3J81 i;  3I4N B;  5C44 H;  4EQN A;  1IXR A;  4KN4 C;  4CDE C;  5ELF A;  3STB D;  1TS5 A;  1U4L A;  1PH2 A;  2PZT A;  2EVB A;  1K0R A;  1X3G A;  2JXM B;  3MFG A;  3P20 A;  2UXD Q;  3BDC A;  5DLQ E;  4FO2 A;  1LTB D;  1DJR D;  3DMU A;  3M7N A;  3S2D B;  1PTO D;  1AZQ A;  5IGB A;  4IZ8 A;  4AYB B;  2MP1 A;  1XPO A;  3M3Y H;  3SDZ A;  4IUN A;  5BN3 A;  4RKL A;  1D5X C;  1Y1V B;  1HZC A;  3JAM c;  2Q8T A;  1QOH A;  1NR2 A;  2R7D A;  4DR4 L;  4OL7 A;  3JC6 6;  3UDG A;  1LT5 D;  2VB2 X;  4BY7 B;  1JWM D;  2K14 A;  1QJO A;  2RDG A;  1BXT A;  1FD7 D;  4ULL A;  2R92 B;  1TWF H;  1KDB A;  4H13 C;  4JI4 L;  1R9T B;  1H9S A;  1VQA A;  3FEW X;  4HR7 B;  4CDF C;  1O7Z A;  3HOY H;  1CQF A;  3CD6 A;  4TRD A;  1EIG A;  3PCO B;  4JI2 L;  3CMA A;  3SK4 A;  3M4P A;  5IGC A;  2HQE A;  5JAV A;  3D4R A;  5ELD A;  4GKJ L;  4YCV A;  2Z6B A;  4HSP A;  3T56 B;  1W6K A;  1XWE A;  1CTM A;  3KLS X;  2PZU A;  5JJL A;  3D4D A;  1VQO A;  2KBN A;  4KV6 A;  1WTR A;  2FXQ A;  2Q8R E;  4TKO B;  1WTP A;  3MWY W;  3QG1 A;  4RA8 A;  3F2U A;  5FO8 B;  4LF6 Q;  1TWC B;  2E2I B;  3JAM L;  3SK8 A;  1PFS A;  2F3I A;  2GVB A;  2PW5 A;  5JJZ A;  2ZTD A;  2RKS A;  4R4I A;  2G9D A;  4A76 A;  5ELE A;  1SE8 A;  1F9S A;  2ZJP A;  1BVS A;  4O0A A;  1SN8 A;  2ASB A;  2MO0 A;  1K83 H;  2JJQ A;  3MVV A;  5C3E G;  3HOY B;  2AUJ D;  1D1I A;  1F9R A;  5NUC A;  4A3M B;  2NTT A;  4IFD H;  1EY7 A;  1SYG A;  1LAC A;  3NBH A;  1K8A C;  3W5O A;  1BOS A;  2EYH A;  4HIM A;  1VQG A;  1SNP A;  2K05 A;  1VQP A;  1WTQ A;  4MZ9 A;  1TWA B;  5KYI A;  3GO5 A;  3I70 A;  5CC4 A;  3M85 A;  5JOB A;  5CGK A;  4NXM L;  4R1J A;  3TSS A;  3S1N H;  1CUK A;  1JOK A;  2NWG A;  1RCV D;  1RL2 A;  2F0M A;  4QB4 A;  5EBD A;  4AIM A;  3HRZ C;  1WTX A;  1Y1W B;  1SJH D;  2NZ1 D;  1X56 A;  3KLW A;  4K5W A;  2UUB L;  5IT9 L;  2EXZ A;  1IBM L;  4XT3 B;  3ND8 A;  2K03 A;  2N3S A;  2R61 A;  5T1G A;  1HPC A;  5IGE A;  5FKA C;  3HOZ B;  5DM7 3;  2I5M X;  4BXX G;  2UUC L;  2ZM6 Q;  1X55 A;  3I4N H;  1STG A;  3HKZ G;  3MA2 B;  4BY1 H;  1KL9 A;  5TSS A;  3KJO A;  2JA6 B;  3CXC A;  1LTR D;  4J1M A;  2F0F A;  2NVT H;  2Q2T A;  3OIQ A;  1K3B C;  3E9H A;  4DNT B;  1FVI A;  5BN4 A;  4A4I A;  1TWG H;  3EQL C;  4NXN Q;  3NHH A;  1F2Y A;  5EKL A;  3NBH B;  2M2L A;  2JA6 H;  4DK0 A;  1KNE A;  2ZXP A;  3VR4 A;  4BY1 B;  3A5Z B;  1K8O A;  4JK1 C;  3GTQ B;  1HQM C;  1N34 L;  5F2D A;  1L0W A;  3S2H B;  3E6Z X;  4IOC A;  2NZO A;  1IYU A;  1X3P A;  2RHS B;  1G51 A;  3C1F A;  4RCO A;  5I4D A;  2ATW A;  1I50 B;  3BVG A;  4JC0 A;  2NBF A;  4A3G B;  4ZAI A;  4KY6 A;  4MTK A;  2PCF B;  4HJ5 A;  3NSW A;  1NJI C;  1S5C D;  4JI5 L;  1F9P A;  4JI6 L;  4FF3 A;  3S1N B;  2UXD L;  4PNY A;  1N8R C;  1WVL A;  1B8A A;  3BS1 A;  1C0A A;  3JAM E;  1JT8 A;  2B2W A;  3DM3 A;  2YTX A;  3U58 A;  2VQF Q;  4KD4 A;  3VYU A;  1CKN B;  5C0X I;  1UNS A;  3D6C A;  1RTN A;  2JE6 I;  1CI3 M;  4HN7 A;  5C4H A;  1YJW A;  4FXD A;  4YHH Q;  2VS1 A;  4C3I H;  1RJT A;  1EUJ A;  2KCN A;  4QGU A;  1KDC A;  5COR A;  1HNZ Q;  1OTC A;  3PUV A;  4JI0 Q;  1EU4 A;  2L12 A;  3H94 A;  3UDX A;  3CF5 A;  4IO9 A;  4DXF A;  1YEZ A;  2X69 A;  2E74 C;  1E2V A;  3DHQ A;  3MXN B;  1BCP B;  2E2J B;  3VR5 A;  1PH9 A;  3CPW A;  4RGN A;  3MZ5 A;  2VQE Q;  3I3C A;  2LS0 1;  1TR5 A;  2VY3 A;  5A2Q L;  3CC4 A;  1ONL A;  4IOA A;  1TWH H;  1T5X D;  4LF7 Q;  2VUM B;  1LTG D;  3K81 C;  2YU9 B;  3RNU A;  4APV A;  3A8K E;  1Y8N B;  3STB C;  1GHJ A;  5A35 A;  1JWU D;  4JCV E;  2F0I A;  5IT9 E;  4NDX A;  1QZH A;  3KF6 B;  1VQN A;  4DV6 L;  3KFU A;  1K3R A;  3FRP B;  3UDF A;  2EXD A;  1G6Z A;  1S5D D;  1TS3 A;  3CP0 A;  5FLX L;  2N78 A;  4IQZ A;  3K58 A;  2F0N A;  2LSS A;  1TWF B;  1AE3 A;  2I5H A;  2QW7 A;  1A2U A;  3M7G A;  5K36 G;  5JPN C;  3CC7 A;  4ZKB B;  3G7L A;  3NEN A;  1I94 Q;  5KNC A;  1KC8 C;  1LV9 A;  1W6J A;  1XXG A;  2VW9 A;  2RHQ B;  1OXU A;  2MQH A;  2SDF A;  1Y1V H;  2CVR A;  4HMJ A;  4IUU A;  4ZUI A;  4OO1 H;  3HFZ B;  2HIX A;  3T4A C;  1TY2 A;  4EQ5 A;  4G7Z C;  5M5X B;  1PH4 A;  1XNQ Q;  2RF4 A;  1JJ2 A;  5J1Z A;  1K8G A;  3CC2 A;  4X65 Q;  4WJ3 M;  1HTL D;  2PMZ E;  4K0K Q;  4KI0 A;  3ZJY C;  4RHS A;  2F0W A;  1Y14 B;  3BDL A;  3N6R A;  2D9U A;  1XNR L;  4CJ0 B;  4OIK A;  5DAU A;  4DGZ A;  2D0O A;  4X65 L;  2GVA A;  4DAM A;  4FF1 A;  4G4K A;  3J81 L;  2DJG C;  5JJI A;  2YTY A;  3S15 B;  2OF1 A;  2SEB D;  1II3 A;  2OQ0 A;  3ERO A;  4DNI A;  5IOD A;  2F0U A;  1U4M A;  2BDO A;  3EIV A;  1AH9 A;  3CME A;  1N32 Q;  2VXW A;  2L15 A;  2XRS D;  4DUY Q;  1CA5 A;  1N33 Q;  1FNV A;  3EBE A;  2P5Z X;  4JW0 A;  2C35 B;  4V0B A;  1VQM A;  4DFA A;  4A3J H;  4HJ9 A;  4B3M L;  3HOU H;  1XMQ Q;  5LMU L;  2HHH L;  4BA1 I;  1WCM G;  4RGM A;  1B9M A;  2R93 B;  5EKI A;  3K7A B;  3V05 A;  4O1N A;  2A74 C;  4BBS B;  2HD3 A;  1FJG L;  2N8N A;  2JN4 A;  2KJX A;  4C2M H;  1HR0 Q;  1NAP A;  2OQK A;  2RCN A;  4JPB W;  4R4Q A;  2WAQ E;  4LFC L;  3PV0 A;  4Z9C B;  2ZXR A;  1F2L A;  4CGY B;  1LAB A;  1QB5 D;  3MHB A;  1Q86 C;  1Q1B A;  4OWW B;  2F3W A;  1HA5 A;  4LJZ C;  3ERQ A;  4GOP B;  4FXG C;  4A3B G;  3I90 A;  4CHT B;  3S17 H;  2I46 A;  3KF8 A;  2B2T A;  1HNZ L;  2SNM A;  1YHQ A;  2E8G A;  1H9R A;  2B2V A;  3KLR A;  2F0S A;  3FKI B;  1HFG A;  2KHJ A;  3O13 A;  4L5Q A;  2AUK A;  4UAI A;  2JA5 B;  1JIC A;  4PMC A;  5FLX E;  1PTO B;  1SFO H;  3HOU B;  3HG9 A;  2EY1 A;  1XTD A;  2B39 A;  2EY2 A;  4EQP A;  5IWA Q;  4X64 L;  4A3K H;  3OOC A;  4P71 A;  3OSO A;  5JEA J;  2JA7 B;  2NTS A;  5EJW A;  3HOX B;  2ENB A;  3QO2 A;  4F87 A;  3GTG B;  3PO3 G;  1B50 A;  4LF4 L;  1HQR D;  1SAP A;  1FL0 A;  1SYC A;  4KHV A;  4JI1 Q;  5M3M B;  4JI2 Q;  1QVC A;  4C3J G;  3GTL H;  5C4X B;  1Z47 A;  3BYT B;  4UDU C;  5CV8 A;  3VR6 A;  4NPS A;  3CCL A;  3TRE A;  2BCO A;  2H1E A;  4A3B H;  2FIN B;  4YCU A;  2NZH A;  1SYF A;  4HED A;  3DEP A;  5HGT A;  1CA6 A;  1V1P B;  3RLF A;  4L5R C;  3BJU A;  2DY7 A;  2HCI A;  4KHP Q;  2NYZ D;  2PW7 A;  2KHS A;  4C3H B;  4HJ7 A;  1IBK Q;  5CV7 A;  2K01 A;  2A69 D;  3J81 E;  3ND9 A;  1O7Y A;  1JQY D;  4I7Z C;  1QVG A;  1VQ8 A;  1WCM H;  5IIF A;  2LKV A;  1QWY A;  1ENF A;  1GUO A;  4A3J G;  4DR4 Q;  4PZ8 A;  5FJ8 G;  2XWB B;  2BOS A;  1I4X A;  3DM1 A;  2CWP A;  2V4D A;  5I2X A;  4A75 A;  1G29 1;  2B2Y A;  1EQV A;  1GUN A;  3EJI A;  1S40 A;  2WFW A;  5EQ0 A;  1GUW A;  3T1H L;  1WI5 A;  5C0X G;  2BE5 D;  1QIL A;  4N9P A;  3F2D A;  2UXB L;  4M8A A;  3VYS A;  2L0C A;  3P1H A;  3AYH B;  4LMQ D;  1J8I A;  2F0T A;  2LXJ A;  4DV5 L;  4P2C B;  3FVQ A;  1Y69 U;  2CFM A;  1Z7T A;  1NR4 A;  3LNN A;  5J3B A;  4A3E B;  5FLM G;  1PFN A;  4A93 B;  1YHB A;  1CM9 A;  3GTO B;  1NTG A;  1ESR A;  2NN6 G;  1C48 A;  4K6L A;  4OO1 G;  2MFI A;  1Q12 A;  4KKS A;  2QA4 A;  4DAY B;  1WTW A;  2HIV A;  4FNF A;  1ENA A;  4AYB E;  1F9Q A;  1Y1V G;  3GTG H;  2E76 C;  2IX0 A;  3NP8 A;  2R6G A;  4A3K B;  4QL5 A;  4UP7 A;  1GM5 A;  3BZC A;  1PXU A;  4KLK A;  4LFC Q;  3KDF A;  1PTO F;  1STH A;  2K33 A;  4BA2 I;  1BCP D;  4R4O A;  2RDF A;  3S16 B;  3MFY A;  4X62 Q;  1IW7 D;  1SMY C;  2A6H D;  4CJ1 B;  1NMG A;  3HOV H;  4H7B A;  4LFB L;  3UE0 A;  2EOT A;  2E2H H;  5ELC A;  5CBA E;  4Y7N B;  1BF4 A;  1WTH A;  2OWO A;  1JJC B;  1RKN A;  5C3X A;  1V1O A;  2C5C A;  4DV3 L;  1TT2 A;  2F0P A;  5EPK A;  1SE2 A;  4RAU C;  3CQZ H;  1X3Q A;  4V19 0;  4GLA C;  5M5Y B;  1KLG D;  2O4X A;  3Q0A A;  4XTC S;  2JQO A;  4GKJ Q;  2F1M A;  1SE4 A;  1PLF A;  5T1I A;  3K7U C;  1EY0 A;  2A19 A; 
#chains in the Genus database with same CATH homology
 3GO5 A;  3PF5 A;  5JEA G;  4JOI A;  4A3M G;  1VQ9 A;  2IT1 A;  3M85 A;  1Z9F A;  4X66 Q;  4QJF A;  5M5W H;  1KXL A;  1A62 A;  1GD7 A;  1PA6 A;  2JA8 H;  3PIP A;  4LFA Q;  1KIX A;  4NXM L;  4R1J A;  1EIY B;  1XPU A;  3H15 A;  1GKH A;  1VQK A;  1Q46 A;  3S1N H;  3M4Q A;  3ERS X;  1CUK A;  1PV4 A;  1IL2 A;  2IY5 B;  4GOP C;  2NN6 I;  5C0X J;  1RL2 A;  3TS0 A;  4AIM A;  5IP7 G;  4X64 Q;  3J7A 5;  4LF8 L;  4QY7 A;  1X56 A;  2CCZ A;  3KLW A;  2UUB L;  2JA7 H;  4RG1 A;  3PO2 H;  3OYY A;  1IBM L;  2UUC Q;  1X54 A;  4P72 A;  5M3F H;  2JA7 G;  3PO2 G;  3ER0 A;  3HOX G;  4LF5 L;  1XMO Q;  2B29 A;  2V1C C;  2ZTC A;  1VQ5 A;  1YJ9 A;  2N3S A;  3E0E A;  1SR3 A;  1KHI A;  1PH5 A;  1G6P A;  1D8L A;  2XGT A;  4DR7 Q;  2VQE L;  1VQI A;  1EFW A;  3J80 i;  1FJG Q;  5JJK A;  1UE5 A;  2F4V L;  3J80 c;  2I5M X;  4YWK A;  4BXX G;  2NVQ H;  2UUC L;  2ZM6 Q;  1X55 A;  3I4N H;  1UE1 A;  2UXC L;  5C4X G;  3HKZ G;  2K4K A;  4GLX A;  1KL9 A;  3KJO A;  4A3M H;  1PYB A;  4BY1 H;  4PG3 A;  3CXC A;  4P74 A;  5M5Y H;  2JA8 G;  2NVT H;  2Q2T A;  1N36 Q;  1HNX L;  3E9H A;  1FVI A;  4UP8 A;  4POG A;  1XPR A;  4A4I A;  1TWG H;  1BBU A;  3CCJ A;  4DV0 Q;  4NXN Q;  1H95 A;  5M5X H;  1GVP A;  4JYA Q;  2WB1 G;  2CQO A;  3HOZ G;  3CAM A;  3NBH B;  2YTV A;  3HKS A;  4P73 A;  2JA6 H;  2CWA A;  4GN3 B;  4A3G G;  4JBJ A;  3A5Z B;  1KAW A;  2JA6 G;  5H1S E;  4A3G H;  2IX1 A;  4B3R L;  1N34 L;  1L0W A;  1AE2 A;  4Y52 H;  4HJA A;  1CKM A;  1W3S A;  4KHZ A;  1P16 A;  4IOC A;  1Q7Y C;  2NZO A;  1QZG A;  4LF6 L;  3D0F A;  2PI2 A;  4ALP A;  1WJJ A;  3AQQ A;  3AFP A;  2RHS B;  4OON A;  4YHH L;  1G51 A;  1ASY A;  4JI7 L;  1QVF A;  4DR1 Q;  1XNR Q;  3S1M H;  4JBM A;  2ATW A;  3CCM A;  3S16 H;  3S2H H;  4LWC A;  4JC0 A;  5IYC H;  4DR7 L;  4BBR G;  2JK8 A;  3AFQ A;  1N9W A;  3CW2 C;  4BY1 G;  3CCV A;  3ULJ A;  2ALY B;  5C4X H;  3J7Z C;  5LMN L;  2ZJQ A;  3I4N G;  2OCE A;  4HJ5 A;  4J15 A;  3ICE A;  1VQH A;  4BXX H;  2ZJR A;  3I7F A;  1QUQ B;  2ZM6 L;  1NJI C;  1JMC A;  3L7Z C;  2QGQ A;  3HOV G;  4JI5 L;  1I3Q H;  3UE1 A;  1EYG A;  2E5L Q;  4JI6 L;  4JV5 Q;  1CSP A;  4LNQ A;  2Y0S G;  2UXD L;  1N8R C;  1OXS C;  1LTL A;  5GAE C;  1B8A A;  1J6Q A;  1TXY A;  3HOX H;  5AJ3 L;  5ELN A;  1C0A A;  5M3F G;  1JT8 A;  2R7F A;  2PQA A;  4JG2 A;  2DUD A;  2Q2H A;  1RIP A;  3CCU A;  4JBK A;  4DUY L;  3DM3 A;  1E22 A;  2YTX A;  5IP7 H;  2OTL A;  2QEX A;  3U58 A;  1J5E Q;  1C7Y A;  2VQF Q;  3A0J A;  2BH2 A;  4DR6 Q;  1CKN B;  3JAM i;  4YCW A;  5C0X I;  4YWL A;  3T1Y Q;  4IPG A;  1O7I A;  4HID A;  2JE6 I;  1IYJ B;  1HJP A;  1YJW A;  3VDY A;  4NXM Q;  4YHH Q;  2VS1 A;  4C3I H;  2E2J H;  1EUJ A;  1X3F A;  3KOJ A;  3S24 A;  4QGU A;  3BZK A;  2EQS A;  4X62 L;  1HNZ Q;  1OXV A;  1OTC A;  3PUV A;  3CCE A;  4JI0 Q;  1YZ6 A;  2K75 A;  1Y1W H;  3UDX A;  4DV1 Q;  1VQ4 A;  1YJN A;  4LF9 Q;  5HGQ A;  3CF5 A;  1UEB A;  4GN4 B;  5FLM H;  3Q8D A;  4IO9 A;  1YEZ A;  1IBM Q;  3UDI A;  2DGY A;  1IBL Q;  1X6O A;  1ASZ A;  2R92 G;  1VQB A;  3MXN B;  1PH3 A;  1R9T H;  1PH9 A;  3CPW A;  3H3V H;  4DV4 L;  4IFD G;  4MNO A;  4Y7N H;  1SRO A;  2PQA B;  1YIJ A;  2VQE Q;  1VQJ A;  1A8V A;  2VY3 A;  5C3E H;  1TWA H;  4IPC A;  4JBW A;  1PHJ A;  3CC4 A;  3H0G G;  4BY7 H;  4IOA A;  1TWH H;  5FLX c;  4LF7 Q;  2AKW B;  3K81 C;  4OWT B;  2AHO B;  3RNU A;  1EOV A;  4APV A;  4BBS H;  3NEL A;  3STB C;  4GNX B;  4LW1 A;  4LF4 Q;  1T9H A;  4JCV E;  2KCM A;  3T1H Q;  1VQE A;  3KYH C;  3PSI A;  4HIO A;  1QZH A;  3KF6 B;  1VQN A;  4DV6 L;  3KFU A;  2YYZ A;  1L1O A;  4H02 A;  4AH6 A;  3PUY A;  2UU9 Q;  4JI4 Q;  1K3R A;  3UDF A;  2EXD A;  4LUO A;  2PI2 E;  3S2D H;  2H5X A;  4DK6 C;  3J81 j;  1HZB A;  2KCT A;  3CP0 A;  5FJ8 H;  5IP9 G;  4DR5 Q;  2N78 A;  5GQO A;  2LSS A;  1AE3 A;  4B3S Q;  2I5H A;  2HHH Q;  4IPD A;  1HZ9 A;  5K36 G;  1KRT A;  1B7Y B;  4DV4 Q;  4DR1 L;  3CC7 A;  4DUZ Q;  1YIT A;  2WB1 E;  1XNQ L;  1D7Q A;  1M1K C;  1C9O A;  3NEN A;  1I94 Q;  4JI3 Q;  3RZO H;  4A93 H;  1OXT A;  3SGI A;  5HY6 A;  2VW9 A;  1VQD A;  3CCS A;  1KC8 C;  3HOW H;  2RHQ B;  1UWV A;  3HOY G;  2AWO A;  1OXU A;  2MQH A;  5IY0 A;  1Y1V H;  2K52 A;  4PZ7 A;  3TRZ A;  3A5U A;  2JEA I;  3TS2 A;  4DKA C;  3TQY A;  2K5V A;  3FP9 A;  4ME3 A;  3H3V I;  2UXB Q;  1N32 L;  4OXP A;  3HFZ B;  1SMX A;  2HIX A;  2I5L X;  4JI5 Q;  4RMF A;  4LF5 Q;  1L1O C;  4JYA L;  3J81 c;  4EQ5 A;  4JI6 Q;  1LUZ A;  1PH4 A;  2JA9 A;  4MTN A;  4DUZ L;  2RF4 A;  1W2B A;  1XNQ Q;  4AQY L;  1JJ2 A;  1K8G A;  3CC2 A;  4X65 Q;  3PGZ A;  1V9P A;  3GTJ H;  3OW2 A;  3PF4 A;  3A74 A;  3RLN A;  2PMZ E;  3NEM A;  1B70 B;  4HIK A;  4LF9 L;  4K0K Q;  4A3E G;  1UE7 A;  4KI0 A;  3ZJY C;  4KHP L;  4DV2 Q;  4C3J H;  1Y14 B;  4JI7 Q;  4UY8 C;  4R4T A;  3F2C A;  1NY4 A;  1XNR L;  4QIW E;  4A3D G;  1LM0 A;  4DR3 L;  2Q2I A;  3RLO A;  4A3F H;  1HZA A;  3ULP A;  2D0O A;  2JA5 H;  5GRO A;  2VL6 A;  1WYD A;  4X65 L;  2GVA A;  4DV7 Q;  3U50 C;  4DAM A;  3PO3 H;  1WFQ A;  4DR2 Q;  5JJI A;  2ID0 A;  2UUA L;  4GNX C;  2YTY A;  1I94 L;  1U5K A;  4JOI C;  1DGS A;  3I2Z A;  2OQ0 A;  4A3K G;  4DNI A;  4HJ8 A;  1N34 Q;  1WOC A;  4X66 L;  4B3M Q;  3EIV A;  4DV7 L;  1AH9 A;  3CPF A;  1CSQ A;  4GNX A;  3CME A;  4OX9 Q;  1N32 Q;  3BU2 A;  5E7N A;  4B3T Q;  1CKN A;  2L15 A;  4DUY Q;  2BA0 A;  4QQB X;  1HH2 P;  1X65 A;  3K0X A;  5C44 G;  2UXC Q;  1N33 Q;  1PH1 A;  3EBE A;  2PNH A;  3EN2 A;  1V1Q A;  5GAD C;  3GTM H;  2C35 B;  1VQM A;  5BR8 L;  3F8T A;  4A3J H;  3KF8 B;  1Q82 C;  5IYD H;  4HJ9 A;  4B3M L;  3HOU H;  1XMQ Q;  1VQ7 A;  4A3L G;  5LMU L;  3GTK H;  1HR0 W;  3I4M G;  2HHH L;  4BA1 I;  1WCM G;  1XMO L;  5ELO A;  2R7Z H;  3K7A H;  2CKZ B;  4FDB A;  1VQC A;  2BA1 A;  4OWX B;  4JI3 L;  2R93 H;  1FJG L;  1QUQ A;  3RN5 A;  2N8N A;  4B3R Q;  2VUM H;  3FHW A;  4C2M H;  2EIF A;  2GN5 A;  4GLV B;  1PH7 A;  5LMU Q;  1PH8 A;  1EQQ A;  3HKZ E;  2OQK A;  2RCN A;  1HR0 Q;  2NVX H;  4R4C A;  4R4Q A;  2VNU D;  2WAQ E;  4LFC L;  2N49 A;  3PV0 A;  3PUX A;  4A3C G;  2HQL A;  1YVC A;  4AQY Q;  3FKI G;  2R93 G;  3ULL A;  1Q86 C;  1Q1B A;  2BH8 A;  3K80 C;  4OWW B;  2R7Z G;  3GTP H;  4GOP B;  5GAH C;  4OX9 L;  2B63 G;  4A3B G;  1MJE A;  1EQR A;  1HNW Q;  1JJG A;  2NVY H;  3S17 H;  1X9N A;  1OXX K;  3HOU G;  1HNZ L;  1TWC H;  4YWM A;  5IYB H;  2E2I H;  1YHQ A;  2IHF A;  2E8G A;  4A3I H;  3S15 H;  4DR3 Q;  2KHI A;  1NE3 A;  3OTO L;  4IJL A;  2Z6K C;  5AJ3 Q;  2KHJ A;  4DV6 Q;  1IBL L;  1E24 A;  2AMC B;  3LGJ A;  4L5Q A;  1EWI A;  1U0L A;  3F2B A;  2D62 A;  1A63 A;  1SFO H;  1J5E L;  2B3G A;  4POF A;  5M3M G;  5M3M H;  1XTD A;  1YBY A;  3G48 A;  3B6Y A;  5IWA Q;  4X64 L;  3M9B A;  4A3K H;  3T1Y L;  2XTI A;  1JE5 A;  4P71 A;  1N36 L;  1VQF A;  5JEA J;  1HNX Q;  3G4S A;  3W1G A;  1HR0 L;  2OTJ A;  2Z6K A;  3PO3 G;  2E5L L;  2K5H A;  3F1Z A;  3I55 A;  2K5N A;  3RZD H;  1KQS A;  4L5S A;  4LF4 L;  1L2F A;  1FL0 A;  2JA5 G;  4DV5 Q;  2K50 A;  4A3I G;  4A3F G;  1N33 L;  3AEV A;  4WJ4 A;  4JI1 Q;  3IRB A;  3U4Z A;  3PUW A;  5IYB G;  2WP8 J;  1QVC A;  4JI2 Q;  2F4V Q;  4DV1 L;  4IJH A;  1HNW L;  1CKO A;  3GTL H;  4LUZ A;  1Z47 A;  1Q1E A;  4L5T A;  3CCL A;  4NPS A;  2Y0S E;  1K73 C;  4OO1 I;  3TRE A;  3I4O A;  1VCI A;  3PIO A;  2B63 H;  4A3B H;  2VQF L;  2AWN A;  4YCU A;  2NZH A;  4PMW A;  3FKI H;  4DR5 L;  4DR6 L;  4A3C H;  2A1A A;  3CCR A;  1S72 A;  1E1T A;  4UP9 A;  1M90 C;  3RLF A;  3D31 A;  2VZA A;  4TVA B;  1JB7 A;  4L5R C;  4NXN L;  4DV0 L;  4LF8 Q;  2Z0S A;  1E3P A;  1YI2 A;  4B3T L;  4LF7 L;  3BJU A;  2A8V A;  3S1Q H;  3GTQ H;  3L0O A;  4K0K L;  4KHP Q;  4YY3 L;  2VUM G;  1KRS A;  4GN5 A;  3RR5 A;  1IBK Q;  1NBW A;  4HJ7 A;  3PUZ A;  4JI0 L;  3HOW G;  4JV5 L;  5IWA L;  2YV5 A;  4DV3 Q;  2D0P A;  4TQU S;  1V43 A;  1QVG A;  1VQ8 A;  1WCM H;  4GKK L;  1VS0 A;  3I4M H;  4NB3 A;  4A3L H;  2UU9 L;  5IYD G;  2I0Q A;  4A3J G;  1UE6 A;  4DK3 C;  3J81 i;  4DR4 Q;  1MKH A;  4PZ8 A;  1SRU A;  5FJ8 G;  5IP9 H;  1YNX A;  2ES2 A;  5C44 H;  5LMN Q;  3I56 A;  4LUV A;  1IXR A;  4B3S L;  2CWP A;  4A75 A;  1G29 1;  1IZ6 A;  3STB D;  4AYB G;  3WWV A;  1PH6 A;  2LXK A;  1PH2 A;  1VQ6 A;  1K0R A;  2JEB I;  1X3G A;  2UXD Q;  1S40 A;  2WFW A;  3G71 A;  3T1H L;  1WI5 A;  5DLQ E;  5C0X G;  1VQL A;  3K8A A;  1P8L A;  3M7N A;  3TEH B;  3F2D A;  1XMQ L;  2UXB L;  2UUA Q;  3H0G H;  4BY7 G;  3AYH B;  1I5F A;  3GD7 A;  2MNA A;  2LXJ A;  4DV5 L;  4A3D H;  1XPO A;  3M3Y H;  2CFM A;  4GS3 A;  4LFB Q;  1HZC A;  3JAM c;  2R92 H;  4A3E H;  5J3B A;  3CCQ A;  2R7D A;  5FLM G;  4DR4 L;  1YHB A;  3JC6 6;  3E9I A;  3UDG A;  1Q8K A;  2KEN A;  1S3O A;  1NTG A;  3GDE A;  5BR8 Q;  1BBW A;  2K14 A;  4IFD I;  2ZTE A;  2NN6 G;  3U4V A;  5IE8 A;  1Q81 C;  3M4O H;  1TWF H;  1PVO A;  4OO1 G;  2MFI A;  1Q12 A;  4LFA L;  2QA4 A;  3KJP A;  1K9M C;  1XJV A;  4DAY B;  4JI4 L;  2HIV A;  3GTG H;  4AYB E;  1VQA A;  1Y1V G;  4YY3 Q;  2HT1 A;  2IHE A;  3HOY H;  3CD6 A;  2IX0 A;  1KD1 C;  4XIG S;  4A93 G;  2R6G A;  3W1B A;  3PCO B;  5C4J H;  4JI2 L;  3CMA A;  4QL5 A;  4UP7 A;  1GM5 A;  3BZC A;  3OTO Q;  3S14 H;  3M4P A;  4KLK A;  4JI8 L;  4GKJ L;  4YCV A;  4LFC Q;  4DPG A;  3KDF A;  1YHA A;  4GOP A;  4BA2 I;  5JJL A;  4R4O A;  2Q2U A;  1I50 H;  4X62 Q;  1VQO A;  2KBN A;  2FXQ A;  4P75 A;  4IFD J;  5LMN W;  3RN2 A;  1NMG A;  4O2D A;  3HOV H;  4LFB L;  3UE0 A;  2E2H H;  4PZ6 A;  4LF6 Q;  1SLJ A;  1Y1W G;  4WJ3 M;  2WAQ G;  4UPA A;  1IBK L;  3DLL A;  1X3E A;  3MEF A;  1PFS A;  2OWO A;  2F3I A;  1JJC B;  2GVB A;  4BBR H;  1L1O B;  2ZTD A;  5IYC G;  4R4I A;  5EAY A;  4DV3 L;  4GKK Q;  4JI1 L;  1E1O A;  4BBS G;  4A76 A;  1SE8 A;  2ZJP A;  3S1R H;  2UUB Q;  1BVS A;  2MO1 A;  3CQZ H;  4IPH A;  4O0A A;  1A0I A;  1SN8 A;  3G6E A;  2ASB A;  4EX5 A;  2MO0 A;  1K83 H;  4GLA C;  2JJQ A;  4DV2 L;  4X6A H;  5C3E G;  1GO3 E;  4C3H H;  1E7Z A;  1LYL A;  1MJC A;  1BKB A;  2F52 A;  1EIF A;  3KDF B;  3L2P A;  4XTC S;  3W5O A;  2JQO A;  1K8A C;  3HOZ H;  1MIU A;  4JI8 Q;  1PYS B;  4GKJ Q;  1I6H H;  4DR2 L;  4HIM A;  1VQG A;  2YU9 H;  5IT9 c;  3GTO H;  1NMF A;  3K7U C;  3KF6 A;  1VQP A;  5GAG C;  4MZ9 A;  2A19 A;  1FGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...