2GVAA

Refined solution structure of the tyr 41--> his mutant of the m13 gene v protein. a comparison with the crystal structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
87
structure length
87
Chain Sequence
MIKVEIKPSQAQFTTRSGVSRQGKPYSLNEQLCYVDLGNEHPVLVKITLDEGQPAYAPGLYTVHLSSFKVGQFGSLMIDRLRLVPAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENE V PROTEIN
publication title Refined solution structure of the Tyr41-->His mutant of the M13 gene V protein. A comparison with the crystal structure.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Dna-binding (viral)
total genus 5
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 1995-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02303 Phage_DNA_bind Helix-destabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2gvaA00
1YHBA 2LXKA 2Q2HA 3RZOH 3PF4A 1HNWQ 4IJLA 4TVAB 5LMUL 4L5RC 5M3FH 2AHOB 4P72A 1P16A 5LMNQ 4GN5A 2MO0A 2PQAA 2E8GA 3CCMA 1M1KC 1P8LA 4X66L 3RNUA 1Q81C 5C44G 3PIPA 3J7A5 3CXCA 1CSQA 1MJCA 2WB1G 1PH6A 3KYHC 1SR3A 2R92H 1WCMG 2VQFL 2UXBQ 1MKHA 4YCUA 4NXML 4A3CG 1Q7YC 3HKZG 3RN5A 5LMUQ 4JC0A 4A4IA 2ZJQA 1BBWA 1SE8A 5GAEC 3UDXA 4MNOA 4DUYQ 1E7ZA 2N8NA 4X65L 1K8GA 1IBML 2N78A 1PH1A 3GTPH 1K8AC 4JG2A 2QGQA 3PIOA 1X65A 4JI5L 2UU9L 2PNHA 3BZKA 2AMCB 3ZJYC 4GKKL 3G6EA 4NXMQ 4IFDJ 1VQLA 1V9PA 3PV0A 3GTJH 4DV6L 1D7QA 4DV0Q 3U4ZA 3TS2A 4GN4B 4DV5L 2E2IH 1VQ5A 1MIUA 3K80C 4OWTB 1I6HH 3E9IA 2JE6I 2R7DA 4A3BG 5ELNA 3UDIA 4JI0L 1UE5A 5M5WH 1PH5A 3VDYA 2E2JH 1C9OA 1K83H 1R9TH 4A3GH 3PSIA 1X3EA 3PUYA 2GVAA 2B29A 2KCTA 5M5XH 2GVBA 3HOXH 2UU9Q 4H02A 2JA6H 2VQEQ 4HJ7A 2VY3A 5C3EG 3PUXA 1VQ7A 4A3LG 2ATWA 2JQOA 4DV6Q 1PH4A 1I94L 4IPGA 3S2HH 4A3KH 4DV2L 2Q2IA 1FJGQ 1GVPA 3HOWG 2B63G 5GADC 1EFWA 2ZTEA 1QUQB 4DV5Q 1PH3A 3L0OA 1UWVA 4LF5Q 2OQ0A 2Z0SA 5IE8A 3UDGA 2BA1A 2E2HH 1U5KA 4JBKA 4QY7A 4DR5Q 1PA6A 4O0AA 1QVFA 2R93G 3L7ZC 3HOZG 4OWXB 3KF6A 1J6QA 2OQKA 4DV7L 3FKIG 3OW2A 4OONA 4WJ3M 4HIMA 2OTJA 4C2MH 1SN8A 5C44H 3M4QA 5EAYA 2JA7G 2IT1A 3J81c 1WCMH 4AQYQ 2MO1A 2MNAA 4R1JA 4DV2Q 3HOUG 1BKBA 1VQEA 1XMOL 4A3CH 1VQ9A 2RHQB 3T1YQ 4L5TA 1J5EL 2F4VL 4LF8Q 1XPUA 4JI6Q 1PH9A 4POFA 2WAQE 4EX5A 4X62Q 3G48A 3EBEA 2R6GA 3KJPA 2HQLA 4DV7Q 5GAGC 4A3EG 4A3MG 3GTQH 3U4VA 4YHHL 3S1RH 3NBHB 3SGIA 3T1HL 2V1CC 4BBRG 4B3TL 2NZOA 4HJ5A 1A62A 2JA9A 4LUZA 4ME3A 5JJIA 4DV3L 4B3SL 4JI4L 4A93G 1VQAA 2K5VA 3I56A 1IBLQ 1TWFH 3DM3A 2AKWB 3CCLA 3M85A 3NEMA 2ZJPA 1KAWA 1HR0W 4JI2L 4JI7L 1J5EQ 4LW1A 2UXDL 1JE5A 5E7NA 2K52A 2ZTCA 1PYBA 4AH6A 4PZ7A 3PO2H 4IFDG 2UXCQ 1G6PA 2IY5B 1WYDA 2UUCL 4A3BH 1XTDA 4DR3Q 1L1OC 4DR2L 3S17H 1SRUA 1GKHA 4IOCA 1X55A 4B3TQ 4GLXA 1E1OA 4LNQA 4R4CA 5IYBG 2ZJRA 3W5OA 3PUZA 2KENA 3K7AH 1NJIC 1YZ6A 1JJ2A 3J80c 2JA8G 2EQSA 1U0LA 1VS0A 2Q2UA 4A3LH 4R4QA 2I5MX 1Y1WG 2VS1A 4JI7Q 5C4XH 3K7UC 3E9HA 5C4JH 4BBSG 2I5LX 1AH9A 2UUBL 1JT8A 4DUZL 4KLKA 1W3SA 3HOYG 4LFCQ 3L2PA 3TS0A 2UUCQ 2BA0A 4KI0A 2R93H 3IRBA 1Z47A 4DK3C 3HOZH 2NVTH 3K8AA 1E22A 2ALYB 3FKIH 4BY7G 1VCIA 1E3PA 2UUAQ 2MFIA 4DV1Q 4DR4L 5M3MG 1L1OA 1EQRA 4L5QA 2K5HA 3NENA 1Q8KA 1UE1A 3RLNA 4A3FG 2EXDA 1YJWA 4DV4Q 1VQ4A 4NXNQ 2JA7H 5AJ3L 3I4MH 1RIPA 5IYDH 3GDEA 2NN6G 1KXLA 1VQOA 1SMXA 2E5LL 4A3IG 4P74A 5IWAL 3ULPA 5M5YH 1S40A 1UEBA 3J81i 3CCEA 5HGQA 2PQAB 3STBC 1HR0L 1VQ6A 5IP9H 3HKSA 4A3EH 4A3MH 1YITA 4OX9L 3H0GH 2D62A 1GD7A 5JEAJ 4XIGS 2K75A 2XGTA 4BBRH 1QZGA 4IOAA 3AFPA 1HZ9A 1KD1C 4GNXC 1JB7A 2DGYA 1EYGA 4KHPL 5AJ3Q 1TXYA 1Z9FA 1HNZL 2L15A 1N9WA 1TWGH 4A93H 1IBKL 2KHJA 2KBNA 4C3JH 4IJHA 5FJ8H 1CKNA 3WWVA 4P73A 2F52A 2RHSB 2WFWA 4X66Q 3JAMc 2YU9H 4DR6L 1L2FA 2IHFA 1SLJA 4Y7NH 4DR7L 2VQFQ 1I3QH 4YCVA 4LFBL 2VL6A 4BY1H 5IP7G 5GAHC 4A3DG 1JJGA 1PYSB 4PZ8A 1IZ6A 4DPGA 3CCUA 4UP9A 1YHAA 5C0XI 4R4OA 5IYBH 4AYBG 4KHPQ 1B7YB 2OCEA 2CCZA 4DKAC 4X65Q 1IBMQ 1IBKQ 1DGSA 1LYLA 2JA8H 4GNXA 3F2BA 2N49A 4AIMA 1Y1WH 4JI5Q 5K36G 1Y1VG 4JOIC 4YWKA 3A74A 3KOJA 4BBSH 4DR7Q 5GROA 3I4OA 2Q2TA 4LF9L 1VQNA 4GKKQ 2A19A 4OO1G 3J80i 1QVCA 3GD7A 4A76A 1IL2A 1LUZA 3S1NH 3EN2A 1WFQA 5IY0A 3FP9A 3D31A 1AE2A 1K0RA 1VQBA 4GLVB 4YWLA 1S3OA 4UP8A 1SROA 3CCRA 2I5HA 4DR1L 4BY7H 2CWAA 4GKJL 1PFSA 1Q1BA 3BU2A 4A3FH 1PH2A 2AWOA 1IXRA 4JI0Q 1YIJA 1XMQL 3MXNB 4B3ML 1UE6A 3M4OH 2DUDA 4EQ5A 3S1QH 1WI5A 1BBUA 3CP0A 1I50H 3S24A 4A3JG 3EIVA 3Q8DA 1VQDA 4R4IA 1XJVA 4RG1A 1OXUA 1NMFA 3KF6B 3PUWA 1CKMA 4JOIA 2JK8A 1I94Q 4LF6L 1N36L 1X6OA 1HZBA 3KDFA 4APVA 4PZ6A 4DR1Q 1C7YA 4GKJQ 3TREA 2YYZA 4L5SA 3PCOB 2K4KA 1LTLA 3G4SA 1A8VA 4GLAC 1HNXL 2KCMA 3BZCA 3E0EA 2F3IA 4YY3L 2IX1A 5JEAG 4JV5L 1C0AA 1X3GA 5LMNW 4C3IH 2ASBA 1KRSA 1OXSC 3AQQA 3UE0A 5M3FG 4OXPA 3I7FA 1L0WA 2YTXA 1EOVA 2K14A 4LUVA 5BR8L 3CQZH 3OTOL 5FLXc 1FGUA 3CW2C 2LXJA 3H15A 1QVGA 3TRZA 4UP7A 1XMOQ 1K3RA 5IP7H 3JAMi 4A3DH 2F4VQ 2R7ZG 1NE3A 3CMAA 2PI2A 3U58A 2A8VA 3M7NA 4RMFA 2FXQA 1EUJA 3BJUA 3CC7A 4LWCA 4GS3A 1N34L 1FVIA 3J7ZC 3AFQA 2A1AA 3NELA 4YHHQ 4JCVE 1QZHA 2HT1A 3S2DH 3AEVA 4LFAL 3CCVA 3T1HQ 3S16H 5JJLA 3W1GA 2Z6KC 3TQYA 4MZ9A 5IYCG 4DV3Q 1A63A 3OTOQ 5BR8Q 4B3SQ 4JI4Q 4NPSA 5C0XJ 5C3EH 3ICEA 3I2ZA 2WP8J 2JJQA 4JI2Q 3GTMH 4HJ8A 2UXDQ 2HHHL 4GOPA 4IPHA 4MTNA 3HOWH 2B63H 1OXTA 1VQHA 2ZM6L 1N34Q 2Y0SE 2RCNA 2HIVA 2R7FA 1TWAH 2NVYH 3HKZE 4HJ9A 2YTVA 4DR2Q 5ELOA 1HJPA 4LFAQ 3PF5A 4B3RL 2ID0A 2WAQG 1NY4A 3ERSX 4LF4L 2H5XA 3RLFA 1AE3A 3RLOA 1HNWL 4A3JH 1VQPA 2Z6KA 3KFUA 3I4NG 4DNIA 1YVCA 1KHIA 4DK6C 3ULLA 5LMNL 3S1MH 1L1OB 3G71A 2UUBQ 4DUZQ 5HY6A 3HOUH 2BH8A 2QEXA 1K73C 2JA6G 4C3HH 2D0PA 4IO9A 3OYYA 2VUMG 1ASZA 5JJKA 4J15A 4JI3L 2RF4A 1VQGA 1CUKA 1D8LA 3DLLA 2UXBL 5J3BA 3HOVG 3A0JA 2NN6I 2JA5G 4DR4Q 1OXVA 1OXXK 3CCQA 2ZTDA 1UE7A 2ES2A 4HIDA 4PMWA 4YWMA 4JI1L 4X64L 1VQFA 2K5NA 1B8AA 3CAMA 4DUYL 1YHQA 2E5LQ 5IWAQ 3H3VH 2N3SA 1SFOH 2R7ZH 1CKOA 3RZDH 4HJAA 1VQJA 1YEZA 4QIWE 1CSPA 3GO5A 1HR0Q 4JI3Q 4HIOA 4GN3B 4X6AH 3UE1A 1CKNB 4ALPA 4OX9Q 1V1QA 2Y0SG 1GO3E 3D0FA 4JI8L 3CD6A 5IYCH 2CWPA 3KJOA 2IX0A 4DV0L 1N8RC 4JI1Q 4X64Q 4NB3A 2PMZE 1HNZQ 1N33L 3TEHB 2CKZB 1VQMA 2NVQH 1N32L 4DR6Q 3B6YA 1OTCA 5FLMG 4P71A 1YI2A 1Q82C 1X54A 1PVOA 3CCJA 2MQHA 5C0XG 3KLWA 4POGA 1Q1EA 3ULJA 3HOYH 4LFBQ 1BVSA 3ER0A 1EWIA 2VQEL 1KRTA 4GNXB 4UY8C 4BXXG 4K0KL 2HIXA 4JBMA 2IHEA 1XNRL 3S14H 4O2DA 4QGUA 4JI8Q 1H95A 1PH7A 1FJGL 1EIYB 3A5UA 5M3MH 4Y52H 3PO2G 4LF5L 4OO1I 4DAMA 1N33Q 3PUVA 4LUOA 1B70B 3GTLH 3I4NH 4DR5L 1N32Q 1V43A 2VZAA 3PGZA 1Q46A 4LF9Q 3A5ZB 1NBWA 1T9HA 2GN5A 4A3IH 1QUQA 1HZCA 1VQKA 3M4PA 4WJ4A 4K0KQ 1LM0A 1XNRQ 2VUMH 4IPDA 2I0QA 3PO3G 4OWWB 5C4XG 2OTLA 4AQYL 4QQBX 3HOVH 2JA5H 2QA4A 3FHWA 4JBWA 4P75A 5DLQE 2NVXH 3KF8B 3U50C 3T1YL 4LF8L 1XMQQ 4JI6L 1M90C 4B3MQ 3KDFB 1XNQL 3GTOH 1FL0A 4X62L 4DAYB 1KIXA 3CCSA 2JEBI 1VQ8A 1KL9A 1Y14B 3GTGH 1I5FA 1E1TA 1YBYA 1XPOA 3K81C 4LF6Q 2B3GA 1N36Q 3M9BA 3I4MG 3STBD 5IYDG 1YNXA 1VQIA 2AWNA 1VQCA 4GOPC 1WOCA 1S72A 3S15H 4JYAL 1IBLL 1Q86C 2XTIA 1EIFA 1O7IA 4KHZA 3J81j 1TWCH 2OWOA 3M3YH 2R92G 2LSSA 1HNXQ 1NMGA 1XNQQ 1MJEA 3F2DA 1Q12A 3F1ZA 5IP9G 4YY3Q 3CC2A 4JV5Q 2UXCL 2KHIA 2VNUD 3H0GG 4DR3L 3H3VI 1K9MC 5FLMH 1Y1VH 5H1SE 4IPCA 4FDBA 3GTKH 1PH8A 3F2CA 2D0OA 4IFDI 3F8TA 2YV5A 4JYAQ 1EQQA 4BXXH 5FJ8G 3CF5A 2BH2A 3AYHB 3LGJA 1JJCB 2WB1E 1RL2A 1XPRA 4BA2I 4A75A 3JC66 4UPAA 3UDFA 4LFCL 3RN2A 3CC4A 4LF7L 4BY1G 4PG3A 2NZHA 1TWHH 3CPFA 2C35B 3HFZB 4GOPB 2CFMA 2K50A 1YJ9A 1ASYA 3W1BA 1IYJB 1NTGA 4BA1I 3CMEA 3K0XA 1HZAA 4DV1L 4XTCS 1YJNA 2UUAL 3MEFA 3I55A 2EIFA 4NXNL 4R4TA 4DV4L 4TQUS 1KC8C 4QJFA 1WJJA 2CQOA 1KQSA 4QL5A 4A3GG 3HOXG 2HHHQ 2JEAI 3RR5A 3CPWA 3PO3H 1HH2P 1A0IA 2ZM6Q 5GQOA 1X9NA 1JMCA 1X56A 4JBJA 1PHJA 1W2BA 1GM5A 1X3FA 2VW9A 4YCWA 5IT9c 2PI2E 4LF7Q 1E24A 2YTYA 4HIKA 1PV4A 4B3RQ 1G51A 4A3KG 4LF4Q 1G291 4AYBE
chains in the Genus database with same CATH superfamily
3RD4A 3RZOH 1JCKB 3TDQA 2HD3A 4TVAB 4K2KA 3T4AC 2XSCA 1P16A 1BF4A 2QDBA 2E8GA 1CQFA 3J80L 2F0KA 2PPBC 1CSQA 1FNVA 2WB1G 1SR3A 2VQFL 3J7AF 2XIWA 3PMFA 1Q7YC 4G7ZC 2R7ZB 1BBWA 1G6ZA 3VYSA 1H9JA 4CJ2C 4DUYQ 1ZKOA 3NWTA 4X65L 1K8GA 3GTPH 1ENCA 3PIOA 4JI5L 2EDGA 2AMCB 5EPKA 2E2DC 3X3MA 1VQLA 3OMGA 3TS2A 1CK1A 2FMCA 4GN4B 2F0TA 3SE0A 4DV5L 1MIUA 4HMJA 4OWTB 3E9IA 2EVBA 5ELNA 3K5MA 1UE5A 1CTMA 1IHZA 2WAQB 4A3GH 3PUYA 1F2ZA 2GVBA 4H02A 2JA6H 2VQEQ 5C3EG 2F0IA 2ATWA 3MXNA 1SMYC 4DV2L 2Q2IA 1FJGQ 1GVPA 3HOWG 1JICA 1DXMA 5GADC 3L0OA 3TP5A 4LF5Q 2Z6BA 3UDGA 3K5OA 4DR5Q 4RH6A 4CKCA 3A54A 2OTJA 1EEFD 2MPMA 2JA7G 2IT1A 2LY7A 5C4ZA 4RKLA 4AQYQ 3I90A 3O13A 4R1JA 1QWYA 2K32A 1ILQA 4CJ1B 4L5TA 1D5ZC 4RGTA 2F0UA 1PH9A 2MJ8A 3NQTA 4POFA 3A56A 3KJPA 3EBEA 2R6GA 1LT3D 4DV7Q 4A3MG 2JYOA 4YHHL 1NAPA 1TWCB 3T1HL 2V1CC 2XRSD 4B3TL 2NZOA 2ICIA 4H0LC 4LUZA 5C0XH 4AYBB 1KTKA 4DV3L 4DU9A 1GUSA 3R2TA 4B3SL 4A93G 1VQAA 3I56A 1TWFH 3NEMA 1HR0W 4JI7L 1J5EQ 1Y1VB 3T51B 1UUPA 1PYBA 4FF2A 4PZ7A 1LTID 2ZXRA 1G6PA 1XTDA 3S17H 1SRUA 1U9RA 1X55A 2F0NA 3GV6A 4LNQA 4R4CA 2ZJRA 3PUZA 1NJIC 1O80A 1YZ6A 3NSWA 3IFDA 4I65A 1JJ2A 5LHY1 2EQSA 1TWHB 5C4XH 4XDXA 5FLXL 2O2LD 2IJ0A 2JP1A 4ABNA 3L2PA 1I4GA 2UUCQ 1ESFA 3BDCA 3K8AA 4BY7G 4DV1Q 3NENA 1Q8KA 1SNCA 2EXDA 3I4LA 4DV4Q 2NB0A 2JA7H 5AJ3L 1RIPA 3BYYB 5M3FB 4K8IA 3A7AB 3CCEA 1HR0L 4RKBA 2HCCA 4A3MH 1YITA 2D62A 4XIGS 1V8QA 2XGTA 1HZ9A 1KD1C 3VR6A 5I2YA 1EYGA 3Q23A 1A15A 1LTTD 1AZPA 4A93H 2R61A 2R3ZA 1O78A 1I6VC 5KNCA 5FJ8H 4KTAA 3JAMc 2RDFA 4F88A 3K5NA 4JPBW 4DR7L 4KKUA 2VQFQ 4LFBL 4A3DG 3P1HA 1EL0A 4PZ8A 5C0XI 4R4OA 4AYBG 3D4WA 4DKAC 4X65Q 2IX3A 3BVZA 3GTJB 4AIMA 5EJWA 4JI5Q 1Y1VG 5GROA 2Q2TA 2BE5D 2A19A 4A76A 3KLSA 1LUZA 5M5WB 3S1NH 1R9TB 2I07B 5CV8A 3FP9A 3HOXB 4YWLA 5A2QE 3CCRA 4GKJL 5CORA 1RCVD 4BY7H 5DNFA 2RKSA 4FP5D 1XMQL 3MXNB 1UE6A 3S2HB 3D8GA 4EQ5A 1WI5A 3N6RA 1BBUA 1X32A 3CP0A 1I50H 4KJNA 3S24A 4R4IA 1VQDA 4NKLA 1NMFA 3NQIA 1AN8A 1TR5A 3VR5A 4APVA 4DR1Q 1CZWA 2YYZA 2F0EA 1DCZA 5ISRA 1A8VA 3NTHA 4GLAC 2KCMA 2F3IA 5JEAG 1ESRA 1KABA 3AQQA 5M3FG 2HDLA 1L0WA 1QVGA 1ET9A 4XXEA 3GTQB 4NP5A 1K3RA 3JAMi 4RA8A 4A3DH 1JR0D 1G91A 2FXQA 1EUJA 3BJUA 4LWCA 1N34L 5D14A 2PW7A 3G7LA 3NELA 3R2IA 3TZUA 4YHHQ 4RHRA 2HT1A 3AEVA 4LFAL 3CCVA 3T1HQ 4MZ9A 1HUMA 4DV3Q 3OTOQ 3SK4A 5BR8Q 4B3SQ 4NPSA 2WIIB 3J7YW 4IURA 1S5CD 3BDOA 3NP8A 2HHHL 4QUCA 2AUJD 2JN4A 2F1MA 2R7FA 1TWAH 5ELOA 4B3RL 3E0JA 5C4JB 1ICFB 4FVMA 2F0MA 2H5XA 3RLFA 4ULLA 3IL8A 5EKLA 1VQPA 3I4NG 1YVCA 4R9WA 3HOZB 1KHIA 4K5VA 2NVTB 3FKIB 1J9OA 3QOJA 4N8X1 3H3VC 1GUOA 5HY6A 2BH8A 1DD2A 1WTOA 3TP8A 4KMUC 4WRDA 1ASZA 5CV7A 5JJKA 4XT1B 3DLLA 3MZ5A 3A0JA 2JA5G 1A3UA 3CRLC 4CDEC 3V2TA 4DK1A 5JEAH 4J1MA 5M5YB 4PMWA 1HTLD 3E3XA 2K5DA 4ZRZA 4O42A 4NDXA 1QOHA 2N3SA 3RZDH 1JQYD 4QIWE 4KHVA 1HR0Q 4IFDH 4X6AH 4ALPA 1QILA 1GO3E 5IT9L 4JI8L 4Y7NB 3KJOA 1AFPA 1EZ8A 1I3QB 4X64Q 3Q24A 4BY1B 1AZQA 4RCOA 2NTSA 3JAME 2CKZB 1VQMA 1Z6HA 1X54A 3MHBA 2Z4HA 4RCNA 3HOYH 2XWBB 4PQXA 1BVSA 4LFBQ 2JA8B 4K0KL 3I3CA 1F2YA 1E2VA 4BBSB 1PMRA 2KECA 4KY7A 4Y52H 3MTSA 4DAMA 3PUVA 5JVG3 3GTLH 3I4NH 4L8JA 1N32Q 3VYUA 3A5ZB 1SDFA 2DN8A 4Q5VA 1QUQA 5J39A 3M4PA 2DJGC 4QQBX 2JA5H 2NVXH 1XMQQ 1B3AA 1XNQL 3GTOH 1I4RA 4JW0A 4KD4A 5CBAE 4UDUC 1LACA 2M9VA 3ERQA 1ZYRC 1IKMA 1I5FA 2AQ1B 1D6EC 5I6WA 5IYDG 1YNXA 1BNZA 2AWNA 1C8CA 1XX8A 1Q86C 1D5MC 1EIFA 1W6JA 4C3IB 1SYEA 2OWOA 1RF2D 3M3YH 1S5BD 1SYFA 2R92G 2LSSA 5C6AA 1MJEA 3F2DA 3J7AV 2UXCL 2JSOA 2KHIA 4DR3L 2RBMA 5C3XA 1K9MC 5K36H 2L1BA 1PTOF 5DAUA 4IFDI 1EQQA 1I4PA 2SDFA 4TRDA 3S16B 2C5CA 3AYHB 1RL2A 3J81L 2EYMA 3EA6A 4BA2I 1KNEA 4UPAA 4BY1G 2NZHA 1K8MA 3HFZB 1HQMC 2UUAL 1VMPA 4QJFA 1FNWA 3S9WA 4QL5A 2HHHQ 2N55A 1X9NA 1JMCA 4JBJA 1X3PA 1IYVA 1X3FA 1SEBD 2RVLA 3H91A 4B3RQ 1G51A 2PZUA 4A3KG 1B3QA 3CC2A 1TS2A 1F2MA 2FHTA 4IJLA 4L5RC 2AHOB 3L9AX 4P72A 1PRTB 4GN5A 4J6HA 2PQAA 1E0BA 3RZOB 3RNUA 1Q81C 3J7A5 1MJCA 4GZYC 5K5PA 2R92H 4KN4C 1MKHA 4A3CG 5D65A 1DOLA 4M1UB 3HKZG 2E76C 3RN5A 1EIHA 4JC0A 1NUCA 1U4LA 1QB5D 2B2TC 2KOLA 2ENBA 4MNOA 4B9WA 2N78A 1PH1A 2QGQA 1TIID 1EU4A 4NXMQ 1QCBD 4IUPA 3GTPB 4V190 1D7QA 3U4ZA 4X3KA 2E2IH 3SXHA 1VQ5A 5G3LF 1I6HH 3P20A 3H09A 1BCPB 2E2JH 2B2TA 1K83H 2WACA 1UEAB 1X3EA 2A6EC 2GVAA 2KCTA 1B2TA 5M5XH 2VY3A 1VQ7A 3PIO3 4DV6Q 4A3KH 3BVMA 4A3IB 1QUQB 1PH3A 1GOZA 3HP3A 2B2UC 2Z0SA 1E2WA 4JBKA 4QY7A 3VR3A 1KDBA 4O0AA 1QVFA 3OHXC 3L7ZC 2VUMB 1J6QA 4DV7L 3U9OA 3HOVB 3KLSX 1LTSD 4C2MH 1L0YB 4G7HC 3M4QA 5EAYA 3V96A 2MNAA 4A3CH 1XMOL 3GTGB 2RHQB 1EQVA 4OHJA 1J5EL 2F4VL 1XPUA 4K8JA 3EJIA 1G8ZD 3RUZA 5KGUA 5ELCA 2EJMA 4A3EG 3S15B 3OIQA 2H1EA 3U4VA 1G2TA 1YNND 1S5ED 4BBRG 1A62A 2JA9A 5JJIA 4ME3A 1IL8A 3EFXD 2K7VA 3DM3A 3CCLA 3M85A 4JI2L 1KAWA 3A8JE 4OELB 2Q8IB 4LW1A 2NUCA 2A6HD 1KLGD 4DK0A 2VB2X 3AB9A 1T5EA 1CA6A 2UXCQ 2IY5B 1WYDA 2UUCL 4DR3Q 3SHLA 1A2UA 2B39A 4GLXA 1Y8OB 1E1OA 1Q90A 2CVRA 1F77A 2KENA 3K7AH 3W3AA 1IYUA 1U0LA 1EY9A 4XYQA 2X6GA 2PW5A 3BDLA 2I5MX 4R4QA 2VS1A 1AH9A 1X3QA 1W3SA 3LWEA 1IW7C 1HTPA 4F7XA 1EYCA 4DK3C 2EE1A 1SE3A 3TSSA 2UUAQ 4DR4L 1SNDA 4N8FA 3RLNA 3T13A 1ZXTA 3I4MH 1SYCA 2F4IA 3GDEA 5J1ZA 1SMXA 4A3IG 3ULPA 1S40A 5HGQA 2PQAB 1VMCA 3K57A 3ONAB 1WTHA 3E5SA 2G9HD 5IP9H 3HKSA 4A3EH 1ONLA 1GUTA 1GD7A 3QB3A 2K75A 4BBRH 3OW7A 4GNXC 2DGYA 2V4DA 2L15A 1N9WA 1TWGH 2KHJA 2XRQD 4K2LA 4C3JH 1YIJA 4BWGB 2YU9H 4DR6L 1E2ZA 2IHFA 5I9PA 4YCVA 1Y69U 2F0LA 4ZYSA 3PIP3 3I8ZA 1B44D 5IP7G 4C1NI 5GAHC 1PYSB 4IUNA 2RQXA 1G2SA 1YHAA 3OIPA 4CGYB 1SYBA 3QG1A 3U9SA 4GNXA 1DONA 5L37A 1FNUA 3A74A 1AW7A 4HSPA 1VQNA 1HRJA 3GD7A 4HCEA 1FYCA 2HUGA 1D5XC 1SE4A 1K0RA 1VQBA 4DR1L 4TKOB 1SROA 2I5HA 2MHVA 1PFSA 1Q1BA 2L4NA 2A69C 5CR3A 3BS1A 1MBYA 3NHHA 2E74C 2CW0D 2C9OA 3MXUA 4QCLA 3Q22A 2E2HB 1OXUA 1SE2A 1R4PB 1X6OA 3VA5A 4NMZA 1C7YA 1XXGA 5C44B 3PCOB 1F9RA 1WCMB 1HNXL 3I72A 4YY3L 1WTXA 2IX1A 4JV5L 4ZKCB 2KHSA 2K33A 1KRSA 3NE5B 1OXSC 2A68D 3OWEB 3FRPB 2VB3X 4OXPA 2B2WA 5BR8L 2LKVA 3OTOL 1JJGA 1PTOH 3CQZH 3CW2C 2LXJA 1XMOQ 3S1RB 5IP7H 2F4VQ 2R7ZG 1NE3A 4IUUA 3CMAA 3M7NA 1WTWA 4DXFA 3CC7A 4FF3A 5D3DA 1JOKA 1QZHA 3S2DH 5BN4A 3W1GA 4RHSA 5IYCG 3HG9A 4RAUC 1NNXA 1A63A 2EPBA 3PO2B 1GUGA 5C0XJ 5C3EH 3ICEA 4A3BB 1LTGD 4JI2Q 3HOWH 2ZM6L 2QF7A 3BG3A 3QO2A 5DEHA 4K6DA 4QIWB 1AP0A 3MXPA 2WAQG 5EBDA 4KY5A 1C48A 1BR9A 3RLOA 4ZQ3A 1D1IA 2F0OA 3KFUA 5CV5A 4DF7A 5CV9A 2R93B 2LMCB 4ZK9B 3G71A 4X3SA 1K73C 2QEXA 4X3TA 1AEXA 1O7LA 2J0TD 2NZ1D 1UAPA 2WINB 3OYYA 2RF4A 1VQGA 1D8LA 2ZXOA 4DR4Q 1OXVA 1OXXK 3CCQA 4HIDA 2WKDA 4YWMA 1KNAA 5CGKA 4X64L 4PV1C 5D3IB 1STEA 1BXTA 1YHQA 3H0GB 2K04A 1B53A 1NSNS 5JJZA 1R4QB 2R7ZH 1CKOA 4HJAA 3IFTA 2QEJC 4UAIA 5KYIA 5FO7B 4HIOA 4GN3B 2HDMA 3UE1A 4K6LA 2F0JA 3D0FA 5IYCH 2CWPA 1N8RC 5AFWA 3SK8A 2PMZE 5FO8B 1S4ZA 5M9OA 3DHQA 1PZID 3TEHB 1N32L 4DR6Q 2MQHA 3FEWX 1LTBD 3AMUA 1KRTA 2KA7A 1B9MA 2IPKD 4GNXB 5LL6S 2IHEA 1Y1WB 1H95A 2F0GA 3A5UA 1LT4D 3PO2G 1BBXC 1N33Q 1CHPD 4ZUIA 1QNUA 1V43A 3SEBA 4G4KA 3QR8A 1Q46A 4A3FB 1T9HA 1DM0B 2A5HA 3TBIB 2WKCA 4WJ4A 3M4OB 4H44C 3S1QB 4P75A 4IUTA 3T1YL 5HURA 4LF8L 4JI6L 4K5WA 1STAA 5A2QL 5IODA 3DWQA 1LO5D 1Y14B 3MFGA 1WD1A 1XPOA 3K81C 4LJZC 4H7BA 3MEHA 3M9BA 2X69A 1HCZA 3STBD 1S72A 1VQIA 2O5JC 1VQCA 1WOCA 4HSVA 2RDHA 4KHZA 5C4HA 1TWCH 2K5WA 1HNXQ 4YY3Q 4JV5Q 3HS0C 4OEMB 2VNUD 1EY4A 3H0GG 1MI2A 4UHVA 3MAQA 1HUNA 2PZTA 1Y1VH 4HCSA 5H1SE 1PH8A 2D0OA 2F0WA 4JYAQ 3D6CA 5J22A 3CF5A 2BH2A 4RWSC 4QMGA 3K0YA 4K5XA 2IL8A 1PFMA 2BE5C 1PRTC 1YNJD 4LFCL 5FO9B 1TWHH 3GTMB 2CFMA 2K50A 1YJ9A 2B63B 1NTGA 1OO9B 3K0XA 1CHQD 2OEOA 2NVYB 4ZLTF 1KC8C 4TQUS 5LL6X 3HOXG 2JEAI 3RR5A 1TU2B 1QE6A 1HH2P 2ZM6Q 4CHTB 4A3JB 1X56A 1PHJA 1GM5A 4NW2A 4YCWA 1I4QA 1SXTA 1TS5A 2PI2E 2YTYA 4HIKA 1PV4A 1V1PA 2H4OA 3S1MB 1F9QA 3HOUB 1G291 4AYBE 2LXKA 4C3HB 1K0SA 5M3FH 1PTOD 2EYFA 3W2DA 4IALA 1UNSA 1M1KC 3NK9A 3SK6A 4X66L 4EQPA 1VF5C 4XQJA 3KYHC 1BCPC 1Y8NB 4NXML 1Y8PB 1EY7A 5ELDA 4CKEA 2EOTA 1SFOB 1U4MA 4CDDC 4ZCKA 5LMUQ 1M8AA 1SE8A 5IGBA 1TY2A 1HA5A 4H13C 3QIAA 1K8AC 4JG2A 1X65A 5DM73 4OGQC 2J7ZA 4GKKL 4IFDJ 2NVQB 2F0QA 1V9PA 3GTJH 4DV6L 1JB3A 1II3A 2F0SA 1J8IA 2EJFC 3K80C 2R7DA 3DWAA 3MC0B 3UDIA 4JI0L 5M5WH 3DEOA 1PXUA 3VDYA 3S14B 1R9TH 1Q8IA 3DM1A 3HOXH 3GP7A 2UU9Q 5M3MB 1RHPA 4HJ7A 2L9HA 1XWEA 3PUXA 3F2UA 4M8AA 3JAML 1BO0A 4A3LG 4Z9CB 4N9PA 1K83B 4IPGA 4O1NA 3S2HH 2P5ZX 5E1FA 4CDFC 2B63G 1EFWA 2ZTEA 3DEPA 1CM9A 2ICEC 1H9RA 1PA6A 3OOCA 3HOZG 4OWXB 3KF6A 2OQKA 5JOBA 3FKIG 3OW2A 1CI3M 4OONA 1F2LA 4WJ3M 2L12A 1SN8A 4G57A 3MWYW 5CC4A 1TQOA 2FJ2A 3V05A 2MGSA 3H6MA 3HOUG 1VQEA 4C2MB 4C3HG 3T1YQ 4LF8Q 1EU3A 4JI6Q 5G3LD 2F0FA 1STYA 1SNQA 1IKLA 2RCFA 5GAGC 2XN9C 3GTQH 4HTHA 1EFID 4R8IA 3HEJA 3SGIA 5EPLA 4HJ5A 3E6ZX 3VYTA 3K6OA 2K5VA 4QF4A 2KJXA 2K03A 2UXDL 3IAYA 2K52A 3GTKB 2ZTCA 3C46A 4AH6A 2CH4A 2NWGA 3NBIA 3OPOA 3K58A 1L1OC 2TSSA 1RDPD 4DR2L 2DNCA 2L5TA 5I9OA 4CJ0B 2K28A 3CU7A 4KD3A 1WD0A 3FVQA 1I4XA 4CBVA 5KEEA 3J80c 2JA8G 1TS3A 1RD9D 1VS0A 1EY5A 2Q2UA 4A3LH 2PCFB 4EQNA 3K7UC 3E9HA 2D9UA 5C4JH 4BBSG 4IZ8A 1PZKD 1MSGA 4QUFA 4LFCQ 1FD7D 1Z47A 3HOZH 3PO3B 2NVTH 1E22A 3FKIH 1VCIA 3MXGA 2MFIA 5M3MG 1L1OA 1EQRA 2EY2A 2K5HA 1UE1A 5CMDA 1YJWA 1VQ4A 1JWUD 1V1PB 3LX0A 5IYDH 1VQOA 2E5LL 4P74A 5M5YH 2K6AA 1UEBA 5KRUA 3I4MB 3TZDA 3TN2A 4LAAA 4EGVA 4MIUA 4ZKBB 1QZGA 3DMUA 4IOAA 3AFPA 2TMPA 3HZXA 1F9PA 1TXYA 1Z9FA 1A3TA 1DJRD 1HNZL 4IJHA 4X66Q 1CKNA 3WWVA 4C3IG 2F52A 2RHSB 1L2FA 4Y7NH 1SLJA 3MFYA 2QILA 1I3QH 3MA2B 4RGNA 3R3OA 3LWUA 1QJOA 2VL6A 4BY1H 1QG7A 2EYOA 4C3JB 4KY6A 3R93A 1IZ6A 1SNPA 4DPGA 3CCUA 4KHPQ 1B7YB 2OCEA 2CCZA 4FO2A 1IBKQ 2JA8H 1LYLA 2N49A 1D1KA 4YWKA 5EGTA 3KOJA 4BBSH 3H94A 4GKKQ 4OO1G 2EYPA 1QVCA 3J80i 2F0PA 3I70A 1IL2A 1DOKA 1WFQA 3KBXA 3D31A 1AE2A 3ZYYX 4A3GB 4GLVB 1S3OA 1A2TA 2JA6B 3Q0AA 1WTVA 3BU2A 1PH2A 5BN3A 1IXRA 4JI0Q 1STGA 2EYLA 4TSSA 4EQOA 4B3ML 4FF1A 4MTKA 3EIVA 2QKIC 3M4YA 2RA4A 3KF6B 1CKMA 3KF8A 4WFN3 4LF6L 1N36L 1HHVA 1HZBA 3KDFA 3TREA 1GUWA 4DAYA 1RJTA 3VR4A 3A7LA 2KEDA 2QCPX 1PLFA 3E0EA 1C0AA 1X3GA 5LMNW 4C3IH 3RMHA 2ASBA 5I4DA 4RGMA 2PYKA 2K14A 4LUVA 1I4HA 5FLXc 1FGUA 3H15A 1TS4A 1B4OA 3SK5A 2I46A 2PI2A 2A8VA 4RMFA 2SNMA 1A6XA 1B50A 4GS3A 3J7ZC 3NXWA 4LK1C 3AFQA 1TWFB 1WVLA 1SJHD 5JJLA 2BDNA 3S16H 2Z6KC 3TQYA 1ENFA 3C1EA 4P2CB 3I2ZA 3NUCA 4OO1H 1JWSD 3S17B 2JJQA 3T56B 3S2DB 2UXDQ 4GOPA 4IPHA 1OXTA 2Y0SE 2RCNA 3HKZE 4DR2Q 1LTRD 4RGOS 1HJPA 3PF5A 5C4XB 2ID0A 1RODA 2M2LA 5ELFA 4LF4L 1SSOA 2EY6A 1AE3A 5EBCA 5EPJA 1HNWL 1SJED 4OIKA 3J80E 1M4VA 2Z6KA 2K5QA 4S3SA 5LMNL 1U4RA 2PMZB 2KUMA 1L1OB 1SMYD 1RKNA 4ODGA 2JA6G 5I2XA 2Z4IA 4ID6A 3K59A 2A69D 2JA7B 2VUMG 3OMCA 1K28A 2UXBL 5J3BA 3HOVG 1D2BA 5E4XA 2ZTDA 1UE7A 3N52A 1JOQA 1TVXA 2K5NA 2CQAA 1B8AA 3CAMA 4A3MB 1YNNC 2EXZA 5IGEA 2E5LQ 4FXDA 3H3VH 1VQJA 1YEZA 4L6TB 1CSPA 3GO5A 2PO4A 4A93B 4JI3Q 5JVH3 1CKNB 1ICWA 2A6HC 5KNBA 1HA6A 4DV0L 4JI1Q 2M00A 1HNZQ 3DWPA 3NTKA 1WTRA 1N33L 3HRZC 3B6YA 5FLMG 4P71A 2D5DA 1YI2A 3D4DA 2HCIA 5C0XG 1GUNA 3KLWA 2NBFA 1JORA 1SYDA 2B8GA 4UY8C 5E3FA 4JBMA 4O2DA 1PH7A 1MD2D 4OO1I 3S1NB 1WTQA 1B70B 2VZAA 2B2WC 4BY7B 4FXKC 1GHKA 4N9TA 1NBWA 2K05A 4CKBA 4A3IH 1LT6D 1HZCA 1XNRQ 2VUMH 4IPDA 2F03A 4OWWB 1O7ZA 5C4XG 1W6KA 3HOVH 1I50B 3KLRA 2QA4A 3FHWA 2AUKA 3KF8B 1M90C 4B3MQ 3KDFB 1FL0A 4X62L 2SOBA 4DAYB 1KIXA 2JEBI 1VQ8A 3GTGH 1E1TA 1YBYA 4LF6Q 2B3GA 1N36Q 4K14A 1HQRD 5EKKA 4JYAL 3S15H 1IBLL 1O7IA 3DUZA 3J81j 4XT3B 2OF1A 3FMCA 3NBHA 1NMGA 1B9NA 1TKWB 4CDCC 4A3DB 2EY1A 4OL7A 1U4PA 4C56C 2EJGC 3VYRA 3H3VI 1ILPA 5FLMH 3NTIA 4B08A 3WOFA 4IPCA 4FDBA 5FLXE 3X3NA 3F2CA 2LFNA 4HEDA 3F8TA 2A73B 2YV5A 1NR4A 4DN4M 5FJ8G 1JJCB 2WB1E 1XPRA 1ENAA 4OIJA 1TY0A 1HPCA 3DXJC 3K5LA 3PQIA 3QJYA 1B1ZA 3T16A 2B2VC 5I6YA 3RN2A 3FPPA 4JK1C 3GV3A 3CPFA 4GOPB 3TP7A 4RFBA 2CH4W 3W1BA 1ASYA 4FF4A 4BA1I 3CMEA 2EIFA 1TWAB 4NXNL 4R4TA 1WJJA 2CQOA 2CW0C 3D4RA 3ND9A 3CPWA 3IKJA 1A0IA 5GQOA 5C3WA 2A74C 4LF7Q 2VW9A 3QOLA 5IT9c 1E24A 2B2VA 1GHJA 4F8MA 4LF4Q 1YHBA 5C5MA 2Q2HA 1HNWQ 3PF4A 4U673 3WDNA 1EZ6A 5LMUL 2BCOA 5LMNQ 2MO0A 3CCMA 5JPMC 2KVMA 4XYOA 1P8LA 4KKTA 2A68C 5C44G 3PIPA 2O4XA 1CZGA 3CXCA 1PH6A 1WCMG 2UXBQ 4YCUA 3P7JA 3SR1A 1XTCD 2DJFC 3RZDB 4A4IA 2ZJQA 3WOEA 5GAEC 3UDXA 4PMCA 1E7ZA 2N8NA 1IBML 2XVSA 4G7OC 2Z1CA 2X6LA 2UU9L 2PNHA 3BZKA 5BN5A 3ZJYC 3G6EA 1DZ1A 2OXPA 4Q0FA 4J8QA 3PV0A 4B9XA 4DV0Q 4R8NA 1SNOA 3CKIB 3HOYB 2JE6I 4A3BG 1HFNA 1PH5A 1C9OA 1ZEQX 3PSIA 2B29A 2KQ3A 3CRKC 4FYDA 2Z9HA 1PRTD 3GTLB 3I4NB 2JQOA 1PH4A 1I94L 2VXWA 4HN7A 4DV5Q 1UWVA 2WV6D 2OQ0A 5IE8A 1HXYD 2BA1A 2E2HH 1U5KA 2R93G 1H9MA 3TP6A 2JA5B 1EEID 2DY8A 2KEEA 2L0CA 4HIMA 2NVXB 3TMEA 4ZUJA 5C44H 4JVZA 3GTOB 1S5FD 3J81c 3BZDB 3BVGA 1H9SA 1WCMH 2MO1A 3D6WA 4DV2Q 1BKBA 1VQ9A 1TT2A 3A55A 2Z8LA 4XQNA 2WAQE 4EX5A 1MGSA 3G48A 4X62Q 1PFBA 2HQLA 1CT1D 5KIXA 5T1GA 3S1RH 3NBHB 1EWCA 2QDLA 3M3YB 5KNDA 4JI4L 1BCPD 4MN3A 1IBLQ 2RSNA 2AKWB 2ZJPA 1JE5A 1BDOA 5E7NA 2K01A 4E6IA 1DOMA 2GA4B 1NCVA 4C1NK 3PO2H 4IFDG 3M7GA 4A3BH 4IOCA 1GKHA 4B3TQ 5IGDA 1EQTA 5IYBG 1PFNA 3W5OA 4ILWA 5TSSA 3VA7A 1XYIA 1Y1WG 4JI7Q 1KDCA 2I5LX 5CV4A 2UUBL 1JT8A 1V1OA 2LS01 2SNSA 4DUZL 4KLKA 3HOYG 3VR2A 4F87A 2BDOA 3TS0A 2BA0A 1FGBD 2CHBD 2D2CC 3IRBA 4KI0A 2R93H 2ALYB 1E3PA 1H9KA 3QWNA 4L5QA 4A3FG 4IUQA 4U68A 5ELBA 4NXNQ 1BQQT 2XNAC 2NN6G 4V0BA 2MP1A 1KXLA 3URYA 5IWAL 1GXDC 2EY5A 5IT9E 1PRTF 3J81i 2PZWA 3STBC 4L63B 1VQ6A 4DNTB 2Q8TA 4HAEA 4OX9L 3H0GH 2ZXPA 5JEAJ 1ZYRD 3A8KE 1VDZA 1JB7A 2R92B 2IW3A 4KHPL 5AJ3Q 2DNEA 1LABA 4WORA 1CQVA 1SNMA 5CYUA 1IBKL 2KBNA 4XQQA 4P73A 2WFWA 3FPUB 3C1FA 3KBGA 2ZT9C 1BOSA 3R8BA 3SVMA 1LT5D 4IQZA 4UP9A 3HGBA 5IYBH 1YNJC 2F0HA 1IBMQ 1DGSA 2B2YC 5IOCA 2NYZD 2B8FA 3KK7A 3F2BA 1Y1WH 5K36G 4JOIC 2E2IB 4DR7Q 3I4OA 1I6HB 5F2DA 4LF9L 1C4QA 4IUVA 1BCPF 2E2JB 3EN2A 5IY0A 4UP8A 5M5XB 1SYGA 2FINB 2CWAA 2IWHA 3KUPA 4A3FH 2AWOA 3P75A 5IGFA 5JPNC 1KDAA 1K3BC 3M4OH 1LV9A 2DUDA 4A3KB 4KN7C 2NN6H 3S1QH 2KCCA 2B2YA 4HR7B 4A3JG 3Q8DA 1PTOC 1XJVA 4DGZA 4RG1A 5EQ0A 1FR3A 1EYAA 3PUWA 4JOIA 2JK8A 4KKSA 3C2PA 1I94Q 1T5XD 3L3OC 4PZ6A 4BS9A 4GKJQ 2J4XA 1EOTA 4L5SA 2K4KA 1LTLA 1A3VA 1H9SB 3G4SA 4PNYA 1LLRD 3BZCA 2Y0SB 4EVOA 3HKZB 2O5IC 2G5DA 1LTAD 3UE0A 1CFMA 4X3UA 1JC7A 3CHBD 3I7FA 2YTXA 1EOVA 3J81E 2QW7A 3TRZA 4DA2A 2F0DA 4UP7A 4LMQD 3Q6SA 1RTOA 3U58A 2F3VA 3NWSA 2RSOA 1FVIA 2A1AA 4JCVE 4KK7A 2OT2A 1Z7TA 1JWMD 3EVQA 1Q3LA 4JI4Q 3LNNA 4MHEA 4I7AA 2E75C 2WP8J 1EWHA 4WJWA 4HJ8A 3GTMH 1KLUD 4DXGA 4MTNA 3K7AB 2B63H 1VQHA 1N34Q 1QNKA 2HIVA 2NVYH 4HJ9A 1DYQA 4KJOA 2YTVA 4LFAQ 3T53B 1NY4A 2FFKB 3ERSX 5ELEA 2A6ED 3EROA 4A3JH 4DNIA 3G6JB 4DK6C 3ULLA 3C3LA 2AQ2B 3S1MH 2UUBQ 4DUZQ 3HOUH 1NR2A 1SAPA 4C3HH 1BUVT 2D0PA 5JAVA 4IO9A 2F0VA 4J15A 4JI3L 1WTPA 1CUKA 2NN6I 4DFAA 2NTTA 2ES2A 1O7YA 4PMBA 3MVVA 4JI1L 1VQFA 5DM63 3BYTB 4A3EB 4DUYL 4QB4A 2AQ3B 5IWAQ 1KAAA 4BBRB 1SFOH 5IGCA 1EY8A 5NUCA 4KV6A 1TWGB 1JE4A 5FKAC 4OX9Q 1V1QA 2Y0SG 1K8OA 2YU9B 2KCNA 3EQLC 5FK9C 3CD6A 2IX0A 5C5LA 3OWFA 4NB3A 2EYJA 5KYLA 1EYDA 3I91A 4FNFA 2NVQH 2Q8RE 1OTCA 1Q82C 1PVOA 3CCJA 1MHWC 4ME5A 4POGA 1Q1EA 3FDTA 3ULJA 2N88A 5HGTA 1S5DD 1EWIA 1PYWD 3ER0A 2VQEL 1EY6A 5IIFA 4BXXG 5EKIA 2SEBD 2HIXA 1XNRL 3S14H 4QGUA 4JI8Q 1FJGL 3OSOA 1EIYB 5M3MH 3UI2A 4LF5L 2RDGA 2EYHA 4LUOA 4DR5L 1JOOA 3SDZA 3PGZA 3A8IE 4DAPA 4LF9Q 1CA5A 2GN5A 1VQKA 1IW7D 4K0KQ 4YIJA 1LM0A 2I0QA 2PNRC 3PO3G 2OTLA 4AQYL 1L0XB 4JBWA 5DLQE 1HFGA 5A35A 3U50C 2MUYA 2WB1B 4HMIA 5CV6A 1EIGA 1STBA 1GJXA 3CCSA 2FMMA 1KL9A 4IN3A 3I4MG 4GOPC 1PDQA 2XTIA 5FOBB 2G9DA 3ITPA 3I73A 1PTOB 3CQZB 1XNQQ 2PQEA 4DAVA 1Q12A 3F1ZA 5IP9G 2HQEA 2K1BA 2B2UA 2DY7A 3D3RA 2L55A 3GTKH 1SBBB 2F3WA 4BXXH 4C3JG 3LGJA 3GQBA 3AU7A 1PZJD 5T1IA 4A75A 5CBEE 5C3EB 1EY0A 3JC66 3UDFA 1ML0D 3CC4A 4LF7L 2EZVA 4PG3A 4ZAIA 2XWJB 2C35B 2L11A 5IGGA 4I7ZC 1ET6A 3HOWB 1IYJB 1RTNA 4FXGC 1YJNA 1HZAA 4DV1L 4XTCS 3MEFA 5E4WC 3I55A 1F9SA 1MSHA 1STNA 4DV4L 2BOSA 1KQSA 4A3GG 3PO3H 1STHA 3ND8A 4DNRB 3NPPA 1VF7A 2JXMB 1W2BA 5COYA
chains in the Genus database with same CATH topology
1YHBA 2LXKA 2Q2HA 3RZOH 3PF4A 1HNWQ 4IJLA 4TVAB 5LMUL 4L5RC 5M3FH 2AHOB 4P72A 1P16A 5LMNQ 4GN5A 2MO0A 2PQAA 2E8GA 3CCMA 1M1KC 1P8LA 4X66L 3RNUA 1Q81C 5C44G 3PIPA 3J7A5 3CXCA 1CSQA 1MJCA 2WB1G 1PH6A 3KYHC 1SR3A 2R92H 1WCMG 2VQFL 2UXBQ 1MKHA 4YCUA 4NXML 4A3CG 1Q7YC 3HKZG 3RN5A 5LMUQ 4JC0A 4A4IA 2ZJQA 1BBWA 1SE8A 5GAEC 3UDXA 4MNOA 4DUYQ 1E7ZA 2N8NA 4X65L 1K8GA 1IBML 2N78A 1PH1A 3GTPH 1K8AC 4JG2A 2QGQA 3PIOA 1X65A 4JI5L 2UU9L 2PNHA 3BZKA 2AMCB 3ZJYC 4GKKL 3G6EA 4NXMQ 4IFDJ 1VQLA 1V9PA 3PV0A 3GTJH 4DV6L 1D7QA 4DV0Q 3U4ZA 3TS2A 4GN4B 4DV5L 2E2IH 1VQ5A 1MIUA 3K80C 4OWTB 1I6HH 3E9IA 2JE6I 2R7DA 4A3BG 5ELNA 3UDIA 4JI0L 1UE5A 5M5WH 1PH5A 3VDYA 2E2JH 1C9OA 1K83H 1R9TH 4A3GH 3PSIA 1X3EA 3PUYA 2GVAA 2B29A 2KCTA 5M5XH 2GVBA 3HOXH 2UU9Q 4H02A 2JA6H 2VQEQ 4HJ7A 2VY3A 5C3EG 3PUXA 1VQ7A 4A3LG 2ATWA 2JQOA 4DV6Q 1PH4A 1I94L 4IPGA 3S2HH 4A3KH 4DV2L 2Q2IA 1FJGQ 1GVPA 3HOWG 2B63G 5GADC 1EFWA 2ZTEA 1QUQB 4DV5Q 1PH3A 3L0OA 1UWVA 4LF5Q 2OQ0A 2Z0SA 5IE8A 3UDGA 2BA1A 2E2HH 1U5KA 4JBKA 4QY7A 4DR5Q 1PA6A 4O0AA 1QVFA 2R93G 3L7ZC 3HOZG 4OWXB 3KF6A 1J6QA 2OQKA 4DV7L 3FKIG 3OW2A 4OONA 4WJ3M 4HIMA 2OTJA 4C2MH 1SN8A 5C44H 3M4QA 5EAYA 2JA7G 2IT1A 3J81c 1WCMH 4AQYQ 2MO1A 2MNAA 4R1JA 4DV2Q 3HOUG 1BKBA 1VQEA 1XMOL 4A3CH 1VQ9A 2RHQB 3T1YQ 4L5TA 1J5EL 2F4VL 4LF8Q 1XPUA 4JI6Q 1PH9A 4POFA 2WAQE 4EX5A 4X62Q 3G48A 3EBEA 2R6GA 3KJPA 2HQLA 4DV7Q 5GAGC 4A3EG 4A3MG 3GTQH 3U4VA 4YHHL 3S1RH 3NBHB 3SGIA 3T1HL 2V1CC 4BBRG 4B3TL 2NZOA 4HJ5A 1A62A 2JA9A 4LUZA 4ME3A 5JJIA 4DV3L 4B3SL 4JI4L 4A93G 1VQAA 2K5VA 3I56A 1IBLQ 1TWFH 3DM3A 2AKWB 3CCLA 3M85A 3NEMA 2ZJPA 1KAWA 1HR0W 4JI2L 4JI7L 1J5EQ 4LW1A 2UXDL 1JE5A 5E7NA 2K52A 2ZTCA 1PYBA 4AH6A 4PZ7A 3PO2H 4IFDG 2UXCQ 1G6PA 2IY5B 1WYDA 2UUCL 4A3BH 1XTDA 4DR3Q 1L1OC 4DR2L 3S17H 1SRUA 1GKHA 4IOCA 1X55A 4B3TQ 4GLXA 1E1OA 4LNQA 4R4CA 5IYBG 2ZJRA 3W5OA 3PUZA 2KENA 3K7AH 1NJIC 1YZ6A 1JJ2A 3J80c 2JA8G 2EQSA 1U0LA 1VS0A 2Q2UA 4A3LH 4R4QA 2I5MX 1Y1WG 2VS1A 4JI7Q 5C4XH 3K7UC 3E9HA 5C4JH 4BBSG 2I5LX 1AH9A 2UUBL 1JT8A 4DUZL 4KLKA 1W3SA 3HOYG 4LFCQ 3L2PA 3TS0A 2UUCQ 2BA0A 4KI0A 2R93H 3IRBA 1Z47A 4DK3C 3HOZH 2NVTH 3K8AA 1E22A 2ALYB 3FKIH 4BY7G 1VCIA 1E3PA 2UUAQ 2MFIA 4DV1Q 4DR4L 5M3MG 1L1OA 1EQRA 4L5QA 2K5HA 3NENA 1Q8KA 1UE1A 3RLNA 4A3FG 2EXDA 1YJWA 4DV4Q 1VQ4A 4NXNQ 2JA7H 5AJ3L 3I4MH 1RIPA 5IYDH 3GDEA 2NN6G 1KXLA 1VQOA 1SMXA 2E5LL 4A3IG 4P74A 5IWAL 3ULPA 5M5YH 1S40A 1UEBA 3J81i 3CCEA 5HGQA 2PQAB 3STBC 1HR0L 1VQ6A 5IP9H 3HKSA 4A3EH 4A3MH 1YITA 4OX9L 3H0GH 2D62A 1GD7A 5JEAJ 4XIGS 2K75A 2XGTA 4BBRH 1QZGA 4IOAA 3AFPA 1HZ9A 1KD1C 4GNXC 1JB7A 2DGYA 1EYGA 4KHPL 5AJ3Q 1TXYA 1Z9FA 1HNZL 2L15A 1N9WA 1TWGH 4A93H 1IBKL 2KHJA 2KBNA 4C3JH 4IJHA 5FJ8H 1CKNA 3WWVA 4P73A 2F52A 2RHSB 2WFWA 4X66Q 3JAMc 2YU9H 4DR6L 1L2FA 2IHFA 1SLJA 4Y7NH 4DR7L 2VQFQ 1I3QH 4YCVA 4LFBL 2VL6A 4BY1H 5IP7G 5GAHC 4A3DG 1JJGA 1PYSB 4PZ8A 1IZ6A 4DPGA 3CCUA 4UP9A 1YHAA 5C0XI 4R4OA 5IYBH 4AYBG 4KHPQ 1B7YB 2OCEA 2CCZA 4DKAC 4X65Q 1IBMQ 1IBKQ 1DGSA 1LYLA 2JA8H 4GNXA 3F2BA 2N49A 4AIMA 1Y1WH 4JI5Q 5K36G 1Y1VG 4JOIC 4YWKA 3A74A 3KOJA 4BBSH 4DR7Q 5GROA 3I4OA 2Q2TA 4LF9L 1VQNA 4GKKQ 2A19A 4OO1G 3J80i 1QVCA 3GD7A 4A76A 1IL2A 1LUZA 3S1NH 3EN2A 1WFQA 5IY0A 3FP9A 3D31A 1AE2A 1K0RA 1VQBA 4GLVB 4YWLA 1S3OA 4UP8A 1SROA 3CCRA 2I5HA 4DR1L 4BY7H 2CWAA 4GKJL 1PFSA 1Q1BA 3BU2A 4A3FH 1PH2A 2AWOA 1IXRA 4JI0Q 1YIJA 1XMQL 3MXNB 4B3ML 1UE6A 3M4OH 2DUDA 4EQ5A 3S1QH 1WI5A 1BBUA 3CP0A 1I50H 3S24A 4A3JG 3EIVA 3Q8DA 1VQDA 4R4IA 1XJVA 4RG1A 1OXUA 1NMFA 3KF6B 3PUWA 1CKMA 4JOIA 2JK8A 1I94Q 4LF6L 1N36L 1X6OA 1HZBA 3KDFA 4APVA 4PZ6A 4DR1Q 1C7YA 4GKJQ 3TREA 2YYZA 4L5SA 3PCOB 2K4KA 1LTLA 3G4SA 1A8VA 4GLAC 1HNXL 2KCMA 3BZCA 3E0EA 2F3IA 4YY3L 2IX1A 5JEAG 4JV5L 1C0AA 1X3GA 5LMNW 4C3IH 2ASBA 1KRSA 1OXSC 3AQQA 3UE0A 5M3FG 4OXPA 3I7FA 1L0WA 2YTXA 1EOVA 2K14A 4LUVA 5BR8L 3CQZH 3OTOL 5FLXc 1FGUA 3CW2C 2LXJA 3H15A 1QVGA 3TRZA 4UP7A 1XMOQ 1K3RA 5IP7H 3JAMi 4A3DH 2F4VQ 2R7ZG 1NE3A 3CMAA 2PI2A 3U58A 2A8VA 3M7NA 4RMFA 2FXQA 1EUJA 3BJUA 3CC7A 4LWCA 4GS3A 1N34L 1FVIA 3J7ZC 3AFQA 2A1AA 3NELA 4YHHQ 4JCVE 1QZHA 2HT1A 3S2DH 3AEVA 4LFAL 3CCVA 3T1HQ 3S16H 5JJLA 3W1GA 2Z6KC 3TQYA 4MZ9A 5IYCG 4DV3Q 1A63A 3OTOQ 5BR8Q 4B3SQ 4JI4Q 4NPSA 5C0XJ 5C3EH 3ICEA 3I2ZA 2WP8J 2JJQA 4JI2Q 3GTMH 4HJ8A 2UXDQ 2HHHL 4GOPA 4IPHA 4MTNA 3HOWH 2B63H 1OXTA 1VQHA 2ZM6L 1N34Q 2Y0SE 2RCNA 2HIVA 2R7FA 1TWAH 2NVYH 3HKZE 4HJ9A 2YTVA 4DR2Q 5ELOA 1HJPA 4LFAQ 3PF5A 4B3RL 2ID0A 2WAQG 1NY4A 3ERSX 4LF4L 2H5XA 3RLFA 1AE3A 3RLOA 1HNWL 4A3JH 1VQPA 2Z6KA 3KFUA 3I4NG 4DNIA 1YVCA 1KHIA 4DK6C 3ULLA 5LMNL 3S1MH 1L1OB 3G71A 2UUBQ 4DUZQ 5HY6A 3HOUH 2BH8A 2QEXA 1K73C 2JA6G 4C3HH 2D0PA 4IO9A 3OYYA 2VUMG 1ASZA 5JJKA 4J15A 4JI3L 2RF4A 1VQGA 1CUKA 1D8LA 3DLLA 2UXBL 5J3BA 3HOVG 3A0JA 2NN6I 2JA5G 4DR4Q 1OXVA 1OXXK 3CCQA 2ZTDA 1UE7A 2ES2A 4HIDA 4PMWA 4YWMA 4JI1L 4X64L 1VQFA 2K5NA 1B8AA 3CAMA 4DUYL 1YHQA 2E5LQ 5IWAQ 3H3VH 2N3SA 1SFOH 2R7ZH 1CKOA 3RZDH 4HJAA 1VQJA 1YEZA 4QIWE 1CSPA 3GO5A 1HR0Q 4JI3Q 4HIOA 4GN3B 4X6AH 3UE1A 1CKNB 4ALPA 4OX9Q 1V1QA 2Y0SG 1GO3E 3D0FA 4JI8L 3CD6A 5IYCH 2CWPA 3KJOA 2IX0A 4DV0L 1N8RC 4JI1Q 4X64Q 4NB3A 2PMZE 1HNZQ 1N33L 3TEHB 2CKZB 1VQMA 2NVQH 1N32L 4DR6Q 3B6YA 1OTCA 5FLMG 4P71A 1YI2A 1Q82C 1X54A 1PVOA 3CCJA 2MQHA 5C0XG 3KLWA 4POGA 1Q1EA 3ULJA 3HOYH 4LFBQ 1BVSA 3ER0A 1EWIA 2VQEL 1KRTA 4GNXB 4UY8C 4BXXG 4K0KL 2HIXA 4JBMA 2IHEA 1XNRL 3S14H 4O2DA 4QGUA 4JI8Q 1H95A 1PH7A 1FJGL 1EIYB 3A5UA 5M3MH 4Y52H 3PO2G 4LF5L 4OO1I 4DAMA 1N33Q 3PUVA 4LUOA 1B70B 3GTLH 3I4NH 4DR5L 1N32Q 1V43A 2VZAA 3PGZA 1Q46A 4LF9Q 3A5ZB 1NBWA 1T9HA 2GN5A 4A3IH 1QUQA 1HZCA 1VQKA 3M4PA 4WJ4A 4K0KQ 1LM0A 1XNRQ 2VUMH 4IPDA 2I0QA 3PO3G 4OWWB 5C4XG 2OTLA 4AQYL 4QQBX 3HOVH 2JA5H 2QA4A 3FHWA 4JBWA 4P75A 5DLQE 2NVXH 3KF8B 3U50C 3T1YL 4LF8L 1XMQQ 4JI6L 1M90C 4B3MQ 3KDFB 1XNQL 3GTOH 1FL0A 4X62L 4DAYB 1KIXA 3CCSA 2JEBI 1VQ8A 1KL9A 1Y14B 3GTGH 1I5FA 1E1TA 1YBYA 1XPOA 3K81C 4LF6Q 2B3GA 1N36Q 3M9BA 3I4MG 3STBD 5IYDG 1YNXA 1VQIA 2AWNA 1VQCA 4GOPC 1WOCA 1S72A 3S15H 4JYAL 1IBLL 1Q86C 2XTIA 1EIFA 1O7IA 4KHZA 3J81j 1TWCH 2OWOA 3M3YH 2R92G 2LSSA 1HNXQ 1NMGA 1XNQQ 1MJEA 3F2DA 1Q12A 3F1ZA 5IP9G 4YY3Q 3CC2A 4JV5Q 2UXCL 2KHIA 2VNUD 3H0GG 4DR3L 3H3VI 1K9MC 5FLMH 1Y1VH 5H1SE 4IPCA 4FDBA 3GTKH 1PH8A 3F2CA 2D0OA 4IFDI 3F8TA 2YV5A 4JYAQ 1EQQA 4BXXH 5FJ8G 3CF5A 2BH2A 3AYHB 3LGJA 1JJCB 2WB1E 1RL2A 1XPRA 4BA2I 4A75A 3JC66 4UPAA 3UDFA 4LFCL 3RN2A 3CC4A 4LF7L 4BY1G 4PG3A 2NZHA 1TWHH 3CPFA 2C35B 3HFZB 4GOPB 2CFMA 2K50A 1YJ9A 1ASYA 3W1BA 1IYJB 1NTGA 4BA1I 3CMEA 3K0XA 1HZAA 4DV1L 4XTCS 1YJNA 2UUAL 3MEFA 3I55A 2EIFA 4NXNL 4R4TA 4DV4L 4TQUS 1KC8C 4QJFA 1WJJA 2CQOA 1KQSA 4QL5A 4A3GG 3HOXG 2HHHQ 2JEAI 3RR5A 3CPWA 3PO3H 1HH2P 1A0IA 2ZM6Q 5GQOA 1X9NA 1JMCA 1X56A 4JBJA 1PHJA 1W2BA 1GM5A 1X3FA 2VW9A 4YCWA 5IT9c 2PI2E 4LF7Q 1E24A 2YTYA 4HIKA 1PV4A 4B3RQ 1G51A 4A3KG 4LF4Q 1G291 4AYBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHB A;  2LXK A;  2Q2H A;  3RZO H;  3PF4 A;  1HNW Q;  4IJL A;  4TVA B;  5LMU L;  4L5R C;  5M3F H;  2AHO B;  4P72 A;  1P16 A;  5LMN Q;  4GN5 A;  2MO0 A;  2PQA A;  2E8G A;  3CCM A;  1M1K C;  1P8L A;  4X66 L;  3RNU A;  1Q81 C;  5C44 G;  3PIP A;  3J7A 5;  3CXC A;  1CSQ A;  1MJC A;  2WB1 G;  1PH6 A;  3KYH C;  1SR3 A;  2R92 H;  1WCM G;  2VQF L;  2UXB Q;  1MKH A;  4YCU A;  4NXM L;  4A3C G;  1Q7Y C;  3HKZ G;  3RN5 A;  5LMU Q;  4JC0 A;  4A4I A;  2ZJQ A;  1BBW A;  1SE8 A;  5GAE C;  3UDX A;  4MNO A;  4DUY Q;  1E7Z A;  2N8N A;  4X65 L;  1K8G A;  1IBM L;  2N78 A;  1PH1 A;  3GTP H;  1K8A C;  4JG2 A;  2QGQ A;  3PIO A;  1X65 A;  4JI5 L;  2UU9 L;  2PNH A;  3BZK A;  2AMC B;  3ZJY C;  4GKK L;  3G6E A;  4NXM Q;  4IFD J;  1VQL A;  1V9P A;  3PV0 A;  3GTJ H;  4DV6 L;  1D7Q A;  4DV0 Q;  3U4Z A;  3TS2 A;  4GN4 B;  4DV5 L;  2E2I H;  1VQ5 A;  1MIU A;  3K80 C;  4OWT B;  1I6H H;  3E9I A;  2JE6 I;  2R7D A;  4A3B G;  5ELN A;  3UDI A;  4JI0 L;  1UE5 A;  5M5W H;  1PH5 A;  3VDY A;  2E2J H;  1C9O A;  1K83 H;  1R9T H;  4A3G H;  3PSI A;  1X3E A;  3PUY A;  2GVA A;  2B29 A;  2KCT A;  5M5X H;  2GVB A;  3HOX H;  2UU9 Q;  4H02 A;  2JA6 H;  2VQE Q;  4HJ7 A;  2VY3 A;  5C3E G;  3PUX A;  1VQ7 A;  4A3L G;  2ATW A;  2JQO A;  4DV6 Q;  1PH4 A;  1I94 L;  4IPG A;  3S2H H;  4A3K H;  4DV2 L;  2Q2I A;  1FJG Q;  1GVP A;  3HOW G;  2B63 G;  5GAD C;  1EFW A;  2ZTE A;  1QUQ B;  4DV5 Q;  1PH3 A;  3L0O A;  1UWV A;  4LF5 Q;  2OQ0 A;  2Z0S A;  5IE8 A;  3UDG A;  2BA1 A;  2E2H H;  1U5K A;  4JBK A;  4QY7 A;  4DR5 Q;  1PA6 A;  4O0A A;  1QVF A;  2R93 G;  3L7Z C;  3HOZ G;  4OWX B;  3KF6 A;  1J6Q A;  2OQK A;  4DV7 L;  3FKI G;  3OW2 A;  4OON A;  4WJ3 M;  4HIM A;  2OTJ A;  4C2M H;  1SN8 A;  5C44 H;  3M4Q A;  5EAY A;  2JA7 G;  2IT1 A;  3J81 c;  1WCM H;  4AQY Q;  2MO1 A;  2MNA A;  4R1J A;  4DV2 Q;  3HOU G;  1BKB A;  1VQE A;  1XMO L;  4A3C H;  1VQ9 A;  2RHQ B;  3T1Y Q;  4L5T A;  1J5E L;  2F4V L;  4LF8 Q;  1XPU A;  4JI6 Q;  1PH9 A;  4POF A;  2WAQ E;  4EX5 A;  4X62 Q;  3G48 A;  3EBE A;  2R6G A;  3KJP A;  2HQL A;  4DV7 Q;  5GAG C;  4A3E G;  4A3M G;  3GTQ H;  3U4V A;  4YHH L;  3S1R H;  3NBH B;  3SGI A;  3T1H L;  2V1C C;  4BBR G;  4B3T L;  2NZO A;  4HJ5 A;  1A62 A;  2JA9 A;  4LUZ A;  4ME3 A;  5JJI A;  4DV3 L;  4B3S L;  4JI4 L;  4A93 G;  1VQA A;  2K5V A;  3I56 A;  1IBL Q;  1TWF H;  3DM3 A;  2AKW B;  3CCL A;  3M85 A;  3NEM A;  2ZJP A;  1KAW A;  1HR0 W;  4JI2 L;  4JI7 L;  1J5E Q;  4LW1 A;  2UXD L;  1JE5 A;  5E7N A;  2K52 A;  2ZTC A;  1PYB A;  4AH6 A;  4PZ7 A;  3PO2 H;  4IFD G;  2UXC Q;  1G6P A;  2IY5 B;  1WYD A;  2UUC L;  4A3B H;  1XTD A;  4DR3 Q;  1L1O C;  4DR2 L;  3S17 H;  1SRU A;  1GKH A;  4IOC A;  1X55 A;  4B3T Q;  4GLX A;  1E1O A;  4LNQ A;  4R4C A;  5IYB G;  2ZJR A;  3W5O A;  3PUZ A;  2KEN A;  3K7A H;  1NJI C;  1YZ6 A;  1JJ2 A;  3J80 c;  2JA8 G;  2EQS A;  1U0L A;  1VS0 A;  2Q2U A;  4A3L H;  4R4Q A;  2I5M X;  1Y1W G;  2VS1 A;  4JI7 Q;  5C4X H;  3K7U C;  3E9H A;  5C4J H;  4BBS G;  2I5L X;  1AH9 A;  2UUB L;  1JT8 A;  4DUZ L;  4KLK A;  1W3S A;  3HOY G;  4LFC Q;  3L2P A;  3TS0 A;  2UUC Q;  2BA0 A;  4KI0 A;  2R93 H;  3IRB A;  1Z47 A;  4DK3 C;  3HOZ H;  2NVT H;  3K8A A;  1E22 A;  2ALY B;  3FKI H;  4BY7 G;  1VCI A;  1E3P A;  2UUA Q;  2MFI A;  4DV1 Q;  4DR4 L;  5M3M G;  1L1O A;  1EQR A;  4L5Q A;  2K5H A;  3NEN A;  1Q8K A;  1UE1 A;  3RLN A;  4A3F G;  2EXD A;  1YJW A;  4DV4 Q;  1VQ4 A;  4NXN Q;  2JA7 H;  5AJ3 L;  3I4M H;  1RIP A;  5IYD H;  3GDE A;  2NN6 G;  1KXL A;  1VQO A;  1SMX A;  2E5L L;  4A3I G;  4P74 A;  5IWA L;  3ULP A;  5M5Y H;  1S40 A;  1UEB A;  3J81 i;  3CCE A;  5HGQ A;  2PQA B;  3STB C;  1HR0 L;  1VQ6 A;  5IP9 H;  3HKS A;  4A3E H;  4A3M H;  1YIT A;  4OX9 L;  3H0G H;  2D62 A;  1GD7 A;  5JEA J;  4XIG S;  2K75 A;  2XGT A;  4BBR H;  1QZG A;  4IOA A;  3AFP A;  1HZ9 A;  1KD1 C;  4GNX C;  1JB7 A;  2DGY A;  1EYG A;  4KHP L;  5AJ3 Q;  1TXY A;  1Z9F A;  1HNZ L;  2L15 A;  1N9W A;  1TWG H;  4A93 H;  1IBK L;  2KHJ A;  2KBN A;  4C3J H;  4IJH A;  5FJ8 H;  1CKN A;  3WWV A;  4P73 A;  2F52 A;  2RHS B;  2WFW A;  4X66 Q;  3JAM c;  2YU9 H;  4DR6 L;  1L2F A;  2IHF A;  1SLJ A;  4Y7N H;  4DR7 L;  2VQF Q;  1I3Q H;  4YCV A;  4LFB L;  2VL6 A;  4BY1 H;  5IP7 G;  5GAH C;  4A3D G;  1JJG A;  1PYS B;  4PZ8 A;  1IZ6 A;  4DPG A;  3CCU A;  4UP9 A;  1YHA A;  5C0X I;  4R4O A;  5IYB H;  4AYB G;  4KHP Q;  1B7Y B;  2OCE A;  2CCZ A;  4DKA C;  4X65 Q;  1IBM Q;  1IBK Q;  1DGS A;  1LYL A;  2JA8 H;  4GNX A;  3F2B A;  2N49 A;  4AIM A;  1Y1W H;  4JI5 Q;  5K36 G;  1Y1V G;  4JOI C;  4YWK A;  3A74 A;  3KOJ A;  4BBS H;  4DR7 Q;  5GRO A;  3I4O A;  2Q2T A;  4LF9 L;  1VQN A;  4GKK Q;  2A19 A;  4OO1 G;  3J80 i;  1QVC A;  3GD7 A;  4A76 A;  1IL2 A;  1LUZ A;  3S1N H;  3EN2 A;  1WFQ A;  5IY0 A;  3FP9 A;  3D31 A;  1AE2 A;  1K0R A;  1VQB A;  4GLV B;  4YWL A;  1S3O A;  4UP8 A;  1SRO A;  3CCR A;  2I5H A;  4DR1 L;  4BY7 H;  2CWA A;  4GKJ L;  1PFS A;  1Q1B A;  3BU2 A;  4A3F H;  1PH2 A;  2AWO A;  1IXR A;  4JI0 Q;  1YIJ A;  1XMQ L;  3MXN B;  4B3M L;  1UE6 A;  3M4O H;  2DUD A;  4EQ5 A;  3S1Q H;  1WI5 A;  1BBU A;  3CP0 A;  1I50 H;  3S24 A;  4A3J G;  3EIV A;  3Q8D A;  1VQD A;  4R4I A;  1XJV A;  4RG1 A;  1OXU A;  1NMF A;  3KF6 B;  3PUW A;  1CKM A;  4JOI A;  2JK8 A;  1I94 Q;  4LF6 L;  1N36 L;  1X6O A;  1HZB A;  3KDF A;  4APV A;  4PZ6 A;  4DR1 Q;  1C7Y A;  4GKJ Q;  3TRE A;  2YYZ A;  4L5S A;  3PCO B;  2K4K A;  1LTL A;  3G4S A;  1A8V A;  4GLA C;  1HNX L;  2KCM A;  3BZC A;  3E0E A;  2F3I A;  4YY3 L;  2IX1 A;  5JEA G;  4JV5 L;  1C0A A;  1X3G A;  5LMN W;  4C3I H;  2ASB A;  1KRS A;  1OXS C;  3AQQ A;  3UE0 A;  5M3F G;  4OXP A;  3I7F A;  1L0W A;  2YTX A;  1EOV A;  2K14 A;  4LUV A;  5BR8 L;  3CQZ H;  3OTO L;  5FLX c;  1FGU A;  3CW2 C;  2LXJ A;  3H15 A;  1QVG A;  3TRZ A;  4UP7 A;  1XMO Q;  1K3R A;  5IP7 H;  3JAM i;  4A3D H;  2F4V Q;  2R7Z G;  1NE3 A;  3CMA A;  2PI2 A;  3U58 A;  2A8V A;  3M7N A;  4RMF A;  2FXQ A;  1EUJ A;  3BJU A;  3CC7 A;  4LWC A;  4GS3 A;  1N34 L;  1FVI A;  3J7Z C;  3AFQ A;  2A1A A;  3NEL A;  4YHH Q;  4JCV E;  1QZH A;  2HT1 A;  3S2D H;  3AEV A;  4LFA L;  3CCV A;  3T1H Q;  3S16 H;  5JJL A;  3W1G A;  2Z6K C;  3TQY A;  4MZ9 A;  5IYC G;  4DV3 Q;  1A63 A;  3OTO Q;  5BR8 Q;  4B3S Q;  4JI4 Q;  4NPS A;  5C0X J;  5C3E H;  3ICE A;  3I2Z A;  2WP8 J;  2JJQ A;  4JI2 Q;  3GTM H;  4HJ8 A;  2UXD Q;  2HHH L;  4GOP A;  4IPH A;  4MTN A;  3HOW H;  2B63 H;  1OXT A;  1VQH A;  2ZM6 L;  1N34 Q;  2Y0S E;  2RCN A;  2HIV A;  2R7F A;  1TWA H;  2NVY H;  3HKZ E;  4HJ9 A;  2YTV A;  4DR2 Q;  5ELO A;  1HJP A;  4LFA Q;  3PF5 A;  4B3R L;  2ID0 A;  2WAQ G;  1NY4 A;  3ERS X;  4LF4 L;  2H5X A;  3RLF A;  1AE3 A;  3RLO A;  1HNW L;  4A3J H;  1VQP A;  2Z6K A;  3KFU A;  3I4N G;  4DNI A;  1YVC A;  1KHI A;  4DK6 C;  3ULL A;  5LMN L;  3S1M H;  1L1O B;  3G71 A;  2UUB Q;  4DUZ Q;  5HY6 A;  3HOU H;  2BH8 A;  2QEX A;  1K73 C;  2JA6 G;  4C3H H;  2D0P A;  4IO9 A;  3OYY A;  2VUM G;  1ASZ A;  5JJK A;  4J15 A;  4JI3 L;  2RF4 A;  1VQG A;  1CUK A;  1D8L A;  3DLL A;  2UXB L;  5J3B A;  3HOV G;  3A0J A;  2NN6 I;  2JA5 G;  4DR4 Q;  1OXV A;  1OXX K;  3CCQ A;  2ZTD A;  1UE7 A;  2ES2 A;  4HID A;  4PMW A;  4YWM A;  4JI1 L;  4X64 L;  1VQF A;  2K5N A;  1B8A A;  3CAM A;  4DUY L;  1YHQ A;  2E5L Q;  5IWA Q;  3H3V H;  2N3S A;  1SFO H;  2R7Z H;  1CKO A;  3RZD H;  4HJA A;  1VQJ A;  1YEZ A;  4QIW E;  1CSP A;  3GO5 A;  1HR0 Q;  4JI3 Q;  4HIO A;  4GN3 B;  4X6A H;  3UE1 A;  1CKN B;  4ALP A;  4OX9 Q;  1V1Q A;  2Y0S G;  1GO3 E;  3D0F A;  4JI8 L;  3CD6 A;  5IYC H;  2CWP A;  3KJO A;  2IX0 A;  4DV0 L;  1N8R C;  4JI1 Q;  4X64 Q;  4NB3 A;  2PMZ E;  1HNZ Q;  1N33 L;  3TEH B;  2CKZ B;  1VQM A;  2NVQ H;  1N32 L;  4DR6 Q;  3B6Y A;  1OTC A;  5FLM G;  4P71 A;  1YI2 A;  1Q82 C;  1X54 A;  1PVO A;  3CCJ A;  2MQH A;  5C0X G;  3KLW A;  4POG A;  1Q1E A;  3ULJ A;  3HOY H;  4LFB Q;  1BVS A;  3ER0 A;  1EWI A;  2VQE L;  1KRT A;  4GNX B;  4UY8 C;  4BXX G;  4K0K L;  2HIX A;  4JBM A;  2IHE A;  1XNR L;  3S14 H;  4O2D A;  4QGU A;  4JI8 Q;  1H95 A;  1PH7 A;  1FJG L;  1EIY B;  3A5U A;  5M3M H;  4Y52 H;  3PO2 G;  4LF5 L;  4OO1 I;  4DAM A;  1N33 Q;  3PUV A;  4LUO A;  1B70 B;  3GTL H;  3I4N H;  4DR5 L;  1N32 Q;  1V43 A;  2VZA A;  3PGZ A;  1Q46 A;  4LF9 Q;  3A5Z B;  1NBW A;  1T9H A;  2GN5 A;  4A3I H;  1QUQ A;  1HZC A;  1VQK A;  3M4P A;  4WJ4 A;  4K0K Q;  1LM0 A;  1XNR Q;  2VUM H;  4IPD A;  2I0Q A;  3PO3 G;  4OWW B;  5C4X G;  2OTL A;  4AQY L;  4QQB X;  3HOV H;  2JA5 H;  2QA4 A;  3FHW A;  4JBW A;  4P75 A;  5DLQ E;  2NVX H;  3KF8 B;  3U50 C;  3T1Y L;  4LF8 L;  1XMQ Q;  4JI6 L;  1M90 C;  4B3M Q;  3KDF B;  1XNQ L;  3GTO H;  1FL0 A;  4X62 L;  4DAY B;  1KIX A;  3CCS A;  2JEB I;  1VQ8 A;  1KL9 A;  1Y14 B;  3GTG H;  1I5F A;  1E1T A;  1YBY A;  1XPO A;  3K81 C;  4LF6 Q;  2B3G A;  1N36 Q;  3M9B A;  3I4M G;  3STB D;  5IYD G;  1YNX A;  1VQI A;  2AWN A;  1VQC A;  4GOP C;  1WOC A;  1S72 A;  3S15 H;  4JYA L;  1IBL L;  1Q86 C;  2XTI A;  1EIF A;  1O7I A;  4KHZ A;  3J81 j;  1TWC H;  2OWO A;  3M3Y H;  2R92 G;  2LSS A;  1HNX Q;  1NMG A;  1XNQ Q;  1MJE A;  3F2D A;  1Q12 A;  3F1Z A;  5IP9 G;  4YY3 Q;  3CC2 A;  4JV5 Q;  2UXC L;  2KHI A;  2VNU D;  3H0G G;  4DR3 L;  3H3V I;  1K9M C;  5FLM H;  1Y1V H;  5H1S E;  4IPC A;  4FDB A;  3GTK H;  1PH8 A;  3F2C A;  2D0O A;  4IFD I;  3F8T A;  2YV5 A;  4JYA Q;  1EQQ A;  4BXX H;  5FJ8 G;  3CF5 A;  2BH2 A;  3AYH B;  3LGJ A;  1JJC B;  2WB1 E;  1RL2 A;  1XPR A;  4BA2 I;  4A75 A;  3JC6 6;  4UPA A;  3UDF A;  4LFC L;  3RN2 A;  3CC4 A;  4LF7 L;  4BY1 G;  4PG3 A;  2NZH A;  1TWH H;  3CPF A;  2C35 B;  3HFZ B;  4GOP B;  2CFM A;  2K50 A;  1YJ9 A;  1ASY A;  3W1B A;  1IYJ B;  1NTG A;  4BA1 I;  3CME A;  3K0X A;  1HZA A;  4DV1 L;  4XTC S;  1YJN A;  2UUA L;  3MEF A;  3I55 A;  2EIF A;  4NXN L;  4R4T A;  4DV4 L;  4TQU S;  1KC8 C;  4QJF A;  1WJJ A;  2CQO A;  1KQS A;  4QL5 A;  4A3G G;  3HOX G;  2HHH Q;  2JEA I;  3RR5 A;  3CPW A;  3PO3 H;  1HH2 P;  1A0I A;  2ZM6 Q;  5GQO A;  1X9N A;  1JMC A;  1X56 A;  4JBJ A;  1PHJ A;  1W2B A;  1GM5 A;  1X3F A;  2VW9 A;  4YCW A;  5IT9 c;  2PI2 E;  4LF7 Q;  1E24 A;  2YTY A;  4HIK A;  1PV4 A;  4B3R Q;  1G51 A;  4A3K G;  4LF4 Q;  1G29 1;  4AYB E; 
#chains in the Genus database with same CATH topology
 3RD4 A;  3RZO H;  1JCK B;  3TDQ A;  2HD3 A;  4TVA B;  4K2K A;  3T4A C;  2XSC A;  1P16 A;  1BF4 A;  2QDB A;  2E8G A;  1CQF A;  3J80 L;  2F0K A;  2PPB C;  1CSQ A;  1FNV A;  2WB1 G;  1SR3 A;  2VQF L;  3J7A F;  2XIW A;  3PMF A;  1Q7Y C;  4G7Z C;  2R7Z B;  1BBW A;  1G6Z A;  3VYS A;  1H9J A;  4CJ2 C;  4DUY Q;  1ZKO A;  3NWT A;  4X65 L;  1K8G A;  3GTP H;  1ENC A;  3PIO A;  4JI5 L;  2EDG A;  2AMC B;  5EPK A;  2E2D C;  3X3M A;  1VQL A;  3OMG A;  3TS2 A;  1CK1 A;  2FMC A;  4GN4 B;  2F0T A;  3SE0 A;  4DV5 L;  1MIU A;  4HMJ A;  4OWT B;  3E9I A;  2EVB A;  5ELN A;  3K5M A;  1UE5 A;  1CTM A;  1IHZ A;  2WAQ B;  4A3G H;  3PUY A;  1F2Z A;  2GVB A;  4H02 A;  2JA6 H;  2VQE Q;  5C3E G;  2F0I A;  2ATW A;  3MXN A;  1SMY C;  4DV2 L;  2Q2I A;  1FJG Q;  1GVP A;  3HOW G;  1JIC A;  1DXM A;  5GAD C;  3L0O A;  3TP5 A;  4LF5 Q;  2Z6B A;  3UDG A;  3K5O A;  4DR5 Q;  4RH6 A;  4CKC A;  3A54 A;  2OTJ A;  1EEF D;  2MPM A;  2JA7 G;  2IT1 A;  2LY7 A;  5C4Z A;  4RKL A;  4AQY Q;  3I90 A;  3O13 A;  4R1J A;  1QWY A;  2K32 A;  1ILQ A;  4CJ1 B;  4L5T A;  1D5Z C;  4RGT A;  2F0U A;  1PH9 A;  2MJ8 A;  3NQT A;  4POF A;  3A56 A;  3KJP A;  3EBE A;  2R6G A;  1LT3 D;  4DV7 Q;  4A3M G;  2JYO A;  4YHH L;  1NAP A;  1TWC B;  3T1H L;  2V1C C;  2XRS D;  4B3T L;  2NZO A;  2ICI A;  4H0L C;  4LUZ A;  5C0X H;  4AYB B;  1KTK A;  4DV3 L;  4DU9 A;  1GUS A;  3R2T A;  4B3S L;  4A93 G;  1VQA A;  3I56 A;  1TWF H;  3NEM A;  1HR0 W;  4JI7 L;  1J5E Q;  1Y1V B;  3T51 B;  1UUP A;  1PYB A;  4FF2 A;  4PZ7 A;  1LTI D;  2ZXR A;  1G6P A;  1XTD A;  3S17 H;  1SRU A;  1U9R A;  1X55 A;  2F0N A;  3GV6 A;  4LNQ A;  4R4C A;  2ZJR A;  3PUZ A;  1NJI C;  1O80 A;  1YZ6 A;  3NSW A;  3IFD A;  4I65 A;  1JJ2 A;  5LHY 1;  2EQS A;  1TWH B;  5C4X H;  4XDX A;  5FLX L;  2O2L D;  2IJ0 A;  2JP1 A;  4ABN A;  3L2P A;  1I4G A;  2UUC Q;  1ESF A;  3BDC A;  3K8A A;  4BY7 G;  4DV1 Q;  3NEN A;  1Q8K A;  1SNC A;  2EXD A;  3I4L A;  4DV4 Q;  2NB0 A;  2JA7 H;  5AJ3 L;  1RIP A;  3BYY B;  5M3F B;  4K8I A;  3A7A B;  3CCE A;  1HR0 L;  4RKB A;  2HCC A;  4A3M H;  1YIT A;  2D62 A;  4XIG S;  1V8Q A;  2XGT A;  1HZ9 A;  1KD1 C;  3VR6 A;  5I2Y A;  1EYG A;  3Q23 A;  1A15 A;  1LTT D;  1AZP A;  4A93 H;  2R61 A;  2R3Z A;  1O78 A;  1I6V C;  5KNC A;  5FJ8 H;  4KTA A;  3JAM c;  2RDF A;  4F88 A;  3K5N A;  4JPB W;  4DR7 L;  4KKU A;  2VQF Q;  4LFB L;  4A3D G;  3P1H A;  1EL0 A;  4PZ8 A;  5C0X I;  4R4O A;  4AYB G;  3D4W A;  4DKA C;  4X65 Q;  2IX3 A;  3BVZ A;  3GTJ B;  4AIM A;  5EJW A;  4JI5 Q;  1Y1V G;  5GRO A;  2Q2T A;  2BE5 D;  2A19 A;  4A76 A;  3KLS A;  1LUZ A;  5M5W B;  3S1N H;  1R9T B;  2I07 B;  5CV8 A;  3FP9 A;  3HOX B;  4YWL A;  5A2Q E;  3CCR A;  4GKJ L;  5COR A;  1RCV D;  4BY7 H;  5DNF A;  2RKS A;  4FP5 D;  1XMQ L;  3MXN B;  1UE6 A;  3S2H B;  3D8G A;  4EQ5 A;  1WI5 A;  3N6R A;  1BBU A;  1X32 A;  3CP0 A;  1I50 H;  4KJN A;  3S24 A;  4R4I A;  1VQD A;  4NKL A;  1NMF A;  3NQI A;  1AN8 A;  1TR5 A;  3VR5 A;  4APV A;  4DR1 Q;  1CZW A;  2YYZ A;  2F0E A;  1DCZ A;  5ISR A;  1A8V A;  3NTH A;  4GLA C;  2KCM A;  2F3I A;  5JEA G;  1ESR A;  1KAB A;  3AQQ A;  5M3F G;  2HDL A;  1L0W A;  1QVG A;  1ET9 A;  4XXE A;  3GTQ B;  4NP5 A;  1K3R A;  3JAM i;  4RA8 A;  4A3D H;  1JR0 D;  1G91 A;  2FXQ A;  1EUJ A;  3BJU A;  4LWC A;  1N34 L;  5D14 A;  2PW7 A;  3G7L A;  3NEL A;  3R2I A;  3TZU A;  4YHH Q;  4RHR A;  2HT1 A;  3AEV A;  4LFA L;  3CCV A;  3T1H Q;  4MZ9 A;  1HUM A;  4DV3 Q;  3OTO Q;  3SK4 A;  5BR8 Q;  4B3S Q;  4NPS A;  2WII B;  3J7Y W;  4IUR A;  1S5C D;  3BDO A;  3NP8 A;  2HHH L;  4QUC A;  2AUJ D;  2JN4 A;  2F1M A;  2R7F A;  1TWA H;  5ELO A;  4B3R L;  3E0J A;  5C4J B;  1ICF B;  4FVM A;  2F0M A;  2H5X A;  3RLF A;  4ULL A;  3IL8 A;  5EKL A;  1VQP A;  3I4N G;  1YVC A;  4R9W A;  3HOZ B;  1KHI A;  4K5V A;  2NVT B;  3FKI B;  1J9O A;  3QOJ A;  4N8X 1;  3H3V C;  1GUO A;  5HY6 A;  2BH8 A;  1DD2 A;  1WTO A;  3TP8 A;  4KMU C;  4WRD A;  1ASZ A;  5CV7 A;  5JJK A;  4XT1 B;  3DLL A;  3MZ5 A;  3A0J A;  2JA5 G;  1A3U A;  3CRL C;  4CDE C;  3V2T A;  4DK1 A;  5JEA H;  4J1M A;  5M5Y B;  4PMW A;  1HTL D;  3E3X A;  2K5D A;  4ZRZ A;  4O42 A;  4NDX A;  1QOH A;  2N3S A;  3RZD H;  1JQY D;  4QIW E;  4KHV A;  1HR0 Q;  4IFD H;  4X6A H;  4ALP A;  1QIL A;  1GO3 E;  5IT9 L;  4JI8 L;  4Y7N B;  3KJO A;  1AFP A;  1EZ8 A;  1I3Q B;  4X64 Q;  3Q24 A;  4BY1 B;  1AZQ A;  4RCO A;  2NTS A;  3JAM E;  2CKZ B;  1VQM A;  1Z6H A;  1X54 A;  3MHB A;  2Z4H A;  4RCN A;  3HOY H;  2XWB B;  4PQX A;  1BVS A;  4LFB Q;  2JA8 B;  4K0K L;  3I3C A;  1F2Y A;  1E2V A;  4BBS B;  1PMR A;  2KEC A;  4KY7 A;  4Y52 H;  3MTS A;  4DAM A;  3PUV A;  5JVG 3;  3GTL H;  3I4N H;  4L8J A;  1N32 Q;  3VYU A;  3A5Z B;  1SDF A;  2DN8 A;  4Q5V A;  1QUQ A;  5J39 A;  3M4P A;  2DJG C;  4QQB X;  2JA5 H;  2NVX H;  1XMQ Q;  1B3A A;  1XNQ L;  3GTO H;  1I4R A;  4JW0 A;  4KD4 A;  5CBA E;  4UDU C;  1LAC A;  2M9V A;  3ERQ A;  1ZYR C;  1IKM A;  1I5F A;  2AQ1 B;  1D6E C;  5I6W A;  5IYD G;  1YNX A;  1BNZ A;  2AWN A;  1C8C A;  1XX8 A;  1Q86 C;  1D5M C;  1EIF A;  1W6J A;  4C3I B;  1SYE A;  2OWO A;  1RF2 D;  3M3Y H;  1S5B D;  1SYF A;  2R92 G;  2LSS A;  5C6A A;  1MJE A;  3F2D A;  3J7A V;  2UXC L;  2JSO A;  2KHI A;  4DR3 L;  2RBM A;  5C3X A;  1K9M C;  5K36 H;  2L1B A;  1PTO F;  5DAU A;  4IFD I;  1EQQ A;  1I4P A;  2SDF A;  4TRD A;  3S16 B;  2C5C A;  3AYH B;  1RL2 A;  3J81 L;  2EYM A;  3EA6 A;  4BA2 I;  1KNE A;  4UPA A;  4BY1 G;  2NZH A;  1K8M A;  3HFZ B;  1HQM C;  2UUA L;  1VMP A;  4QJF A;  1FNW A;  3S9W A;  4QL5 A;  2HHH Q;  2N55 A;  1X9N A;  1JMC A;  4JBJ A;  1X3P A;  1IYV A;  1X3F A;  1SEB D;  2RVL A;  3H91 A;  4B3R Q;  1G51 A;  2PZU A;  4A3K G;  1B3Q A;  3CC2 A;  1TS2 A;  1F2M A;  2FHT A;  4IJL A;  4L5R C;  2AHO B;  3L9A X;  4P72 A;  1PRT B;  4GN5 A;  4J6H A;  2PQA A;  1E0B A;  3RZO B;  3RNU A;  1Q81 C;  3J7A 5;  1MJC A;  4GZY C;  5K5P A;  2R92 H;  4KN4 C;  1MKH A;  4A3C G;  5D65 A;  1DOL A;  4M1U B;  3HKZ G;  2E76 C;  3RN5 A;  1EIH A;  4JC0 A;  1NUC A;  1U4L A;  1QB5 D;  2B2T C;  2KOL A;  2ENB A;  4MNO A;  4B9W A;  2N78 A;  1PH1 A;  2QGQ A;  1TII D;  1EU4 A;  4NXM Q;  1QCB D;  4IUP A;  3GTP B;  4V19 0;  1D7Q A;  3U4Z A;  4X3K A;  2E2I H;  3SXH A;  1VQ5 A;  5G3L F;  1I6H H;  3P20 A;  3H09 A;  1BCP B;  2E2J H;  2B2T A;  1K83 H;  2WAC A;  1UEA B;  1X3E A;  2A6E C;  2GVA A;  2KCT A;  1B2T A;  5M5X H;  2VY3 A;  1VQ7 A;  3PIO 3;  4DV6 Q;  4A3K H;  3BVM A;  4A3I B;  1QUQ B;  1PH3 A;  1GOZ A;  3HP3 A;  2B2U C;  2Z0S A;  1E2W A;  4JBK A;  4QY7 A;  3VR3 A;  1KDB A;  4O0A A;  1QVF A;  3OHX C;  3L7Z C;  2VUM B;  1J6Q A;  4DV7 L;  3U9O A;  3HOV B;  3KLS X;  1LTS D;  4C2M H;  1L0Y B;  4G7H C;  3M4Q A;  5EAY A;  3V96 A;  2MNA A;  4A3C H;  1XMO L;  3GTG B;  2RHQ B;  1EQV A;  4OHJ A;  1J5E L;  2F4V L;  1XPU A;  4K8J A;  3EJI A;  1G8Z D;  3RUZ A;  5KGU A;  5ELC A;  2EJM A;  4A3E G;  3S15 B;  3OIQ A;  2H1E A;  3U4V A;  1G2T A;  1YNN D;  1S5E D;  4BBR G;  1A62 A;  2JA9 A;  5JJI A;  4ME3 A;  1IL8 A;  3EFX D;  2K7V A;  3DM3 A;  3CCL A;  3M85 A;  4JI2 L;  1KAW A;  3A8J E;  4OEL B;  2Q8I B;  4LW1 A;  2NUC A;  2A6H D;  1KLG D;  4DK0 A;  2VB2 X;  3AB9 A;  1T5E A;  1CA6 A;  2UXC Q;  2IY5 B;  1WYD A;  2UUC L;  4DR3 Q;  3SHL A;  1A2U A;  2B39 A;  4GLX A;  1Y8O B;  1E1O A;  1Q90 A;  2CVR A;  1F77 A;  2KEN A;  3K7A H;  3W3A A;  1IYU A;  1U0L A;  1EY9 A;  4XYQ A;  2X6G A;  2PW5 A;  3BDL A;  2I5M X;  4R4Q A;  2VS1 A;  1AH9 A;  1X3Q A;  1W3S A;  3LWE A;  1IW7 C;  1HTP A;  4F7X A;  1EYC A;  4DK3 C;  2EE1 A;  1SE3 A;  3TSS A;  2UUA Q;  4DR4 L;  1SND A;  4N8F A;  3RLN A;  3T13 A;  1ZXT A;  3I4M H;  1SYC A;  2F4I A;  3GDE A;  5J1Z A;  1SMX A;  4A3I G;  3ULP A;  1S40 A;  5HGQ A;  2PQA B;  1VMC A;  3K57 A;  3ONA B;  1WTH A;  3E5S A;  2G9H D;  5IP9 H;  3HKS A;  4A3E H;  1ONL A;  1GUT A;  1GD7 A;  3QB3 A;  2K75 A;  4BBR H;  3OW7 A;  4GNX C;  2DGY A;  2V4D A;  2L15 A;  1N9W A;  1TWG H;  2KHJ A;  2XRQ D;  4K2L A;  4C3J H;  1YIJ A;  4BWG B;  2YU9 H;  4DR6 L;  1E2Z A;  2IHF A;  5I9P A;  4YCV A;  1Y69 U;  2F0L A;  4ZYS A;  3PIP 3;  3I8Z A;  1B44 D;  5IP7 G;  4C1N I;  5GAH C;  1PYS B;  4IUN A;  2RQX A;  1G2S A;  1YHA A;  3OIP A;  4CGY B;  1SYB A;  3QG1 A;  3U9S A;  4GNX A;  1DON A;  5L37 A;  1FNU A;  3A74 A;  1AW7 A;  4HSP A;  1VQN A;  1HRJ A;  3GD7 A;  4HCE A;  1FYC A;  2HUG A;  1D5X C;  1SE4 A;  1K0R A;  1VQB A;  4DR1 L;  4TKO B;  1SRO A;  2I5H A;  2MHV A;  1PFS A;  1Q1B A;  2L4N A;  2A69 C;  5CR3 A;  3BS1 A;  1MBY A;  3NHH A;  2E74 C;  2CW0 D;  2C9O A;  3MXU A;  4QCL A;  3Q22 A;  2E2H B;  1OXU A;  1SE2 A;  1R4P B;  1X6O A;  3VA5 A;  4NMZ A;  1C7Y A;  1XXG A;  5C44 B;  3PCO B;  1F9R A;  1WCM B;  1HNX L;  3I72 A;  4YY3 L;  1WTX A;  2IX1 A;  4JV5 L;  4ZKC B;  2KHS A;  2K33 A;  1KRS A;  3NE5 B;  1OXS C;  2A68 D;  3OWE B;  3FRP B;  2VB3 X;  4OXP A;  2B2W A;  5BR8 L;  2LKV A;  3OTO L;  1JJG A;  1PTO H;  3CQZ H;  3CW2 C;  2LXJ A;  1XMO Q;  3S1R B;  5IP7 H;  2F4V Q;  2R7Z G;  1NE3 A;  4IUU A;  3CMA A;  3M7N A;  1WTW A;  4DXF A;  3CC7 A;  4FF3 A;  5D3D A;  1JOK A;  1QZH A;  3S2D H;  5BN4 A;  3W1G A;  4RHS A;  5IYC G;  3HG9 A;  4RAU C;  1NNX A;  1A63 A;  2EPB A;  3PO2 B;  1GUG A;  5C0X J;  5C3E H;  3ICE A;  4A3B B;  1LTG D;  4JI2 Q;  3HOW H;  2ZM6 L;  2QF7 A;  3BG3 A;  3QO2 A;  5DEH A;  4K6D A;  4QIW B;  1AP0 A;  3MXP A;  2WAQ G;  5EBD A;  4KY5 A;  1C48 A;  1BR9 A;  3RLO A;  4ZQ3 A;  1D1I A;  2F0O A;  3KFU A;  5CV5 A;  4DF7 A;  5CV9 A;  2R93 B;  2LMC B;  4ZK9 B;  3G71 A;  4X3S A;  1K73 C;  2QEX A;  4X3T A;  1AEX A;  1O7L A;  2J0T D;  2NZ1 D;  1UAP A;  2WIN B;  3OYY A;  2RF4 A;  1VQG A;  1D8L A;  2ZXO A;  4DR4 Q;  1OXV A;  1OXX K;  3CCQ A;  4HID A;  2WKD A;  4YWM A;  1KNA A;  5CGK A;  4X64 L;  4PV1 C;  5D3I B;  1STE A;  1BXT A;  1YHQ A;  3H0G B;  2K04 A;  1B53 A;  1NSN S;  5JJZ A;  1R4Q B;  2R7Z H;  1CKO A;  4HJA A;  3IFT A;  2QEJ C;  4UAI A;  5KYI A;  5FO7 B;  4HIO A;  4GN3 B;  2HDM A;  3UE1 A;  4K6L A;  2F0J A;  3D0F A;  5IYC H;  2CWP A;  1N8R C;  5AFW A;  3SK8 A;  2PMZ E;  5FO8 B;  1S4Z A;  5M9O A;  3DHQ A;  1PZI D;  3TEH B;  1N32 L;  4DR6 Q;  2MQH A;  3FEW X;  1LTB D;  3AMU A;  1KRT A;  2KA7 A;  1B9M A;  2IPK D;  4GNX B;  5LL6 S;  2IHE A;  1Y1W B;  1H95 A;  2F0G A;  3A5U A;  1LT4 D;  3PO2 G;  1BBX C;  1N33 Q;  1CHP D;  4ZUI A;  1QNU A;  1V43 A;  3SEB A;  4G4K A;  3QR8 A;  1Q46 A;  4A3F B;  1T9H A;  1DM0 B;  2A5H A;  3TBI B;  2WKC A;  4WJ4 A;  3M4O B;  4H44 C;  3S1Q B;  4P75 A;  4IUT A;  3T1Y L;  5HUR A;  4LF8 L;  4JI6 L;  4K5W A;  1STA A;  5A2Q L;  5IOD A;  3DWQ A;  1LO5 D;  1Y14 B;  3MFG A;  1WD1 A;  1XPO A;  3K81 C;  4LJZ C;  4H7B A;  3MEH A;  3M9B A;  2X69 A;  1HCZ A;  3STB D;  1S72 A;  1VQI A;  2O5J C;  1VQC A;  1WOC A;  4HSV A;  2RDH A;  4KHZ A;  5C4H A;  1TWC H;  2K5W A;  1HNX Q;  4YY3 Q;  4JV5 Q;  3HS0 C;  4OEM B;  2VNU D;  1EY4 A;  3H0G G;  1MI2 A;  4UHV A;  3MAQ A;  1HUN A;  2PZT A;  1Y1V H;  4HCS A;  5H1S E;  1PH8 A;  2D0O A;  2F0W A;  4JYA Q;  3D6C A;  5J22 A;  3CF5 A;  2BH2 A;  4RWS C;  4QMG A;  3K0Y A;  4K5X A;  2IL8 A;  1PFM A;  2BE5 C;  1PRT C;  1YNJ D;  4LFC L;  5FO9 B;  1TWH H;  3GTM B;  2CFM A;  2K50 A;  1YJ9 A;  2B63 B;  1NTG A;  1OO9 B;  3K0X A;  1CHQ D;  2OEO A;  2NVY B;  4ZLT F;  1KC8 C;  4TQU S;  5LL6 X;  3HOX G;  2JEA I;  3RR5 A;  1TU2 B;  1QE6 A;  1HH2 P;  2ZM6 Q;  4CHT B;  4A3J B;  1X56 A;  1PHJ A;  1GM5 A;  4NW2 A;  4YCW A;  1I4Q A;  1SXT A;  1TS5 A;  2PI2 E;  2YTY A;  4HIK A;  1PV4 A;  1V1P A;  2H4O A;  3S1M B;  1F9Q A;  3HOU B;  1G29 1;  4AYB E;  2LXK A;  4C3H B;  1K0S A;  5M3F H;  1PTO D;  2EYF A;  3W2D A;  4IAL A;  1UNS A;  1M1K C;  3NK9 A;  3SK6 A;  4X66 L;  4EQP A;  1VF5 C;  4XQJ A;  3KYH C;  1BCP C;  1Y8N B;  4NXM L;  1Y8P B;  1EY7 A;  5ELD A;  4CKE A;  2EOT A;  1SFO B;  1U4M A;  4CDD C;  4ZCK A;  5LMU Q;  1M8A A;  1SE8 A;  5IGB A;  1TY2 A;  1HA5 A;  4H13 C;  3QIA A;  1K8A C;  4JG2 A;  1X65 A;  5DM7 3;  4OGQ C;  2J7Z A;  4GKK L;  4IFD J;  2NVQ B;  2F0Q A;  1V9P A;  3GTJ H;  4DV6 L;  1JB3 A;  1II3 A;  2F0S A;  1J8I A;  2EJF C;  3K80 C;  2R7D A;  3DWA A;  3MC0 B;  3UDI A;  4JI0 L;  5M5W H;  3DEO A;  1PXU A;  3VDY A;  3S14 B;  1R9T H;  1Q8I A;  3DM1 A;  3HOX H;  3GP7 A;  2UU9 Q;  5M3M B;  1RHP A;  4HJ7 A;  2L9H A;  1XWE A;  3PUX A;  3F2U A;  4M8A A;  3JAM L;  1BO0 A;  4A3L G;  4Z9C B;  4N9P A;  1K83 B;  4IPG A;  4O1N A;  3S2H H;  2P5Z X;  5E1F A;  4CDF C;  2B63 G;  1EFW A;  2ZTE A;  3DEP A;  1CM9 A;  2ICE C;  1H9R A;  1PA6 A;  3OOC A;  3HOZ G;  4OWX B;  3KF6 A;  2OQK A;  5JOB A;  3FKI G;  3OW2 A;  1CI3 M;  4OON A;  1F2L A;  4WJ3 M;  2L12 A;  1SN8 A;  4G57 A;  3MWY W;  5CC4 A;  1TQO A;  2FJ2 A;  3V05 A;  2MGS A;  3H6M A;  3HOU G;  1VQE A;  4C2M B;  4C3H G;  3T1Y Q;  4LF8 Q;  1EU3 A;  4JI6 Q;  5G3L D;  2F0F A;  1STY A;  1SNQ A;  1IKL A;  2RCF A;  5GAG C;  2XN9 C;  3GTQ H;  4HTH A;  1EFI D;  4R8I A;  3HEJ A;  3SGI A;  5EPL A;  4HJ5 A;  3E6Z X;  3VYT A;  3K6O A;  2K5V A;  4QF4 A;  2KJX A;  2K03 A;  2UXD L;  3IAY A;  2K52 A;  3GTK B;  2ZTC A;  3C46 A;  4AH6 A;  2CH4 A;  2NWG A;  3NBI A;  3OPO A;  3K58 A;  1L1O C;  2TSS A;  1RDP D;  4DR2 L;  2DNC A;  2L5T A;  5I9O A;  4CJ0 B;  2K28 A;  3CU7 A;  4KD3 A;  1WD0 A;  3FVQ A;  1I4X A;  4CBV A;  5KEE A;  3J80 c;  2JA8 G;  1TS3 A;  1RD9 D;  1VS0 A;  1EY5 A;  2Q2U A;  4A3L H;  2PCF B;  4EQN A;  3K7U C;  3E9H A;  2D9U A;  5C4J H;  4BBS G;  4IZ8 A;  1PZK D;  1MSG A;  4QUF A;  4LFC Q;  1FD7 D;  1Z47 A;  3HOZ H;  3PO3 B;  2NVT H;  1E22 A;  3FKI H;  1VCI A;  3MXG A;  2MFI A;  5M3M G;  1L1O A;  1EQR A;  2EY2 A;  2K5H A;  1UE1 A;  5CMD A;  1YJW A;  1VQ4 A;  1JWU D;  1V1P B;  3LX0 A;  5IYD H;  1VQO A;  2E5L L;  4P74 A;  5M5Y H;  2K6A A;  1UEB A;  5KRU A;  3I4M B;  3TZD A;  3TN2 A;  4LAA A;  4EGV A;  4MIU A;  4ZKB B;  1QZG A;  3DMU A;  4IOA A;  3AFP A;  2TMP A;  3HZX A;  1F9P A;  1TXY A;  1Z9F A;  1A3T A;  1DJR D;  1HNZ L;  4IJH A;  4X66 Q;  1CKN A;  3WWV A;  4C3I G;  2F52 A;  2RHS B;  1L2F A;  4Y7N H;  1SLJ A;  3MFY A;  2QIL A;  1I3Q H;  3MA2 B;  4RGN A;  3R3O A;  3LWU A;  1QJO A;  2VL6 A;  4BY1 H;  1QG7 A;  2EYO A;  4C3J B;  4KY6 A;  3R93 A;  1IZ6 A;  1SNP A;  4DPG A;  3CCU A;  4KHP Q;  1B7Y B;  2OCE A;  2CCZ A;  4FO2 A;  1IBK Q;  2JA8 H;  1LYL A;  2N49 A;  1D1K A;  4YWK A;  5EGT A;  3KOJ A;  4BBS H;  3H94 A;  4GKK Q;  4OO1 G;  2EYP A;  1QVC A;  3J80 i;  2F0P A;  3I70 A;  1IL2 A;  1DOK A;  1WFQ A;  3KBX A;  3D31 A;  1AE2 A;  3ZYY X;  4A3G B;  4GLV B;  1S3O A;  1A2T A;  2JA6 B;  3Q0A A;  1WTV A;  3BU2 A;  1PH2 A;  5BN3 A;  1IXR A;  4JI0 Q;  1STG A;  2EYL A;  4TSS A;  4EQO A;  4B3M L;  4FF1 A;  4MTK A;  3EIV A;  2QKI C;  3M4Y A;  2RA4 A;  3KF6 B;  1CKM A;  3KF8 A;  4WFN 3;  4LF6 L;  1N36 L;  1HHV A;  1HZB A;  3KDF A;  3TRE A;  1GUW A;  4DAY A;  1RJT A;  3VR4 A;  3A7L A;  2KED A;  2QCP X;  1PLF A;  3E0E A;  1C0A A;  1X3G A;  5LMN W;  4C3I H;  3RMH A;  2ASB A;  5I4D A;  4RGM A;  2PYK A;  2K14 A;  4LUV A;  1I4H A;  5FLX c;  1FGU A;  3H15 A;  1TS4 A;  1B4O A;  3SK5 A;  2I46 A;  2PI2 A;  2A8V A;  4RMF A;  2SNM A;  1A6X A;  1B50 A;  4GS3 A;  3J7Z C;  3NXW A;  4LK1 C;  3AFQ A;  1TWF B;  1WVL A;  1SJH D;  5JJL A;  2BDN A;  3S16 H;  2Z6K C;  3TQY A;  1ENF A;  3C1E A;  4P2C B;  3I2Z A;  3NUC A;  4OO1 H;  1JWS D;  3S17 B;  2JJQ A;  3T56 B;  3S2D B;  2UXD Q;  4GOP A;  4IPH A;  1OXT A;  2Y0S E;  2RCN A;  3HKZ E;  4DR2 Q;  1LTR D;  4RGO S;  1HJP A;  3PF5 A;  5C4X B;  2ID0 A;  1ROD A;  2M2L A;  5ELF A;  4LF4 L;  1SSO A;  2EY6 A;  1AE3 A;  5EBC A;  5EPJ A;  1HNW L;  1SJE D;  4OIK A;  3J80 E;  1M4V A;  2Z6K A;  2K5Q A;  4S3S A;  5LMN L;  1U4R A;  2PMZ B;  2KUM A;  1L1O B;  1SMY D;  1RKN A;  4ODG A;  2JA6 G;  5I2X A;  2Z4I A;  4ID6 A;  3K59 A;  2A69 D;  2JA7 B;  2VUM G;  3OMC A;  1K28 A;  2UXB L;  5J3B A;  3HOV G;  1D2B A;  5E4X A;  2ZTD A;  1UE7 A;  3N52 A;  1JOQ A;  1TVX A;  2K5N A;  2CQA A;  1B8A A;  3CAM A;  4A3M B;  1YNN C;  2EXZ A;  5IGE A;  2E5L Q;  4FXD A;  3H3V H;  1VQJ A;  1YEZ A;  4L6T B;  1CSP A;  3GO5 A;  2PO4 A;  4A93 B;  4JI3 Q;  5JVH 3;  1CKN B;  1ICW A;  2A6H C;  5KNB A;  1HA6 A;  4DV0 L;  4JI1 Q;  2M00 A;  1HNZ Q;  3DWP A;  3NTK A;  1WTR A;  1N33 L;  3HRZ C;  3B6Y A;  5FLM G;  4P71 A;  2D5D A;  1YI2 A;  3D4D A;  2HCI A;  5C0X G;  1GUN A;  3KLW A;  2NBF A;  1JOR A;  1SYD A;  2B8G A;  4UY8 C;  5E3F A;  4JBM A;  4O2D A;  1PH7 A;  1MD2 D;  4OO1 I;  3S1N B;  1WTQ A;  1B70 B;  2VZA A;  2B2W C;  4BY7 B;  4FXK C;  1GHK A;  4N9T A;  1NBW A;  2K05 A;  4CKB A;  4A3I H;  1LT6 D;  1HZC A;  1XNR Q;  2VUM H;  4IPD A;  2F03 A;  4OWW B;  1O7Z A;  5C4X G;  1W6K A;  3HOV H;  1I50 B;  3KLR A;  2QA4 A;  3FHW A;  2AUK A;  3KF8 B;  1M90 C;  4B3M Q;  3KDF B;  1FL0 A;  4X62 L;  2SOB A;  4DAY B;  1KIX A;  2JEB I;  1VQ8 A;  3GTG H;  1E1T A;  1YBY A;  4LF6 Q;  2B3G A;  1N36 Q;  4K14 A;  1HQR D;  5EKK A;  4JYA L;  3S15 H;  1IBL L;  1O7I A;  3DUZ A;  3J81 j;  4XT3 B;  2OF1 A;  3FMC A;  3NBH A;  1NMG A;  1B9N A;  1TKW B;  4CDC C;  4A3D B;  2EY1 A;  4OL7 A;  1U4P A;  4C56 C;  2EJG C;  3VYR A;  3H3V I;  1ILP A;  5FLM H;  3NTI A;  4B08 A;  3WOF A;  4IPC A;  4FDB A;  5FLX E;  3X3N A;  3F2C A;  2LFN A;  4HED A;  3F8T A;  2A73 B;  2YV5 A;  1NR4 A;  4DN4 M;  5FJ8 G;  1JJC B;  2WB1 E;  1XPR A;  1ENA A;  4OIJ A;  1TY0 A;  1HPC A;  3DXJ C;  3K5L A;  3PQI A;  3QJY A;  1B1Z A;  3T16 A;  2B2V C;  5I6Y A;  3RN2 A;  3FPP A;  4JK1 C;  3GV3 A;  3CPF A;  4GOP B;  3TP7 A;  4RFB A;  2CH4 W;  3W1B A;  1ASY A;  4FF4 A;  4BA1 I;  3CME A;  2EIF A;  1TWA B;  4NXN L;  4R4T A;  1WJJ A;  2CQO A;  2CW0 C;  3D4R A;  3ND9 A;  3CPW A;  3IKJ A;  1A0I A;  5GQO A;  5C3W A;  2A74 C;  4LF7 Q;  2VW9 A;  3QOL A;  5IT9 c;  1E24 A;  2B2V A;  1GHJ A;  4F8M A;  4LF4 Q;  1YHB A;  5C5M A;  2Q2H A;  1HNW Q;  3PF4 A;  4U67 3;  3WDN A;  1EZ6 A;  5LMU L;  2BCO A;  5LMN Q;  2MO0 A;  3CCM A;  5JPM C;  2KVM A;  4XYO A;  1P8L A;  4KKT A;  2A68 C;  5C44 G;  3PIP A;  2O4X A;  1CZG A;  3CXC A;  1PH6 A;  1WCM G;  2UXB Q;  4YCU A;  3P7J A;  3SR1 A;  1XTC D;  2DJF C;  3RZD B;  4A4I A;  2ZJQ A;  3WOE A;  5GAE C;  3UDX A;  4PMC A;  1E7Z A;  2N8N A;  1IBM L;  2XVS A;  4G7O C;  2Z1C A;  2X6L A;  2UU9 L;  2PNH A;  3BZK A;  5BN5 A;  3ZJY C;  3G6E A;  1DZ1 A;  2OXP A;  4Q0F A;  4J8Q A;  3PV0 A;  4B9X A;  4DV0 Q;  4R8N A;  1SNO A;  3CKI B;  3HOY B;  2JE6 I;  4A3B G;  1HFN A;  1PH5 A;  1C9O A;  1ZEQ X;  3PSI A;  2B29 A;  2KQ3 A;  3CRK C;  4FYD A;  2Z9H A;  1PRT D;  3GTL B;  3I4N B;  2JQO A;  1PH4 A;  1I94 L;  2VXW A;  4HN7 A;  4DV5 Q;  1UWV A;  2WV6 D;  2OQ0 A;  5IE8 A;  1HXY D;  2BA1 A;  2E2H H;  1U5K A;  2R93 G;  1H9M A;  3TP6 A;  2JA5 B;  1EEI D;  2DY8 A;  2KEE A;  2L0C A;  4HIM A;  2NVX B;  3TME A;  4ZUJ A;  5C44 H;  4JVZ A;  3GTO B;  1S5F D;  3J81 c;  3BZD B;  3BVG A;  1H9S A;  1WCM H;  2MO1 A;  3D6W A;  4DV2 Q;  1BKB A;  1VQ9 A;  1TT2 A;  3A55 A;  2Z8L A;  4XQN A;  2WAQ E;  4EX5 A;  1MGS A;  3G48 A;  4X62 Q;  1PFB A;  2HQL A;  1CT1 D;  5KIX A;  5T1G A;  3S1R H;  3NBH B;  1EWC A;  2QDL A;  3M3Y B;  5KND A;  4JI4 L;  1BCP D;  4MN3 A;  1IBL Q;  2RSN A;  2AKW B;  2ZJP A;  1JE5 A;  1BDO A;  5E7N A;  2K01 A;  4E6I A;  1DOM A;  2GA4 B;  1NCV A;  4C1N K;  3PO2 H;  4IFD G;  3M7G A;  4A3B H;  4IOC A;  1GKH A;  4B3T Q;  5IGD A;  1EQT A;  5IYB G;  1PFN A;  3W5O A;  4ILW A;  5TSS A;  3VA7 A;  1XYI A;  1Y1W G;  4JI7 Q;  1KDC A;  2I5L X;  5CV4 A;  2UUB L;  1JT8 A;  1V1O A;  2LS0 1;  2SNS A;  4DUZ L;  4KLK A;  3HOY G;  3VR2 A;  4F87 A;  2BDO A;  3TS0 A;  2BA0 A;  1FGB D;  2CHB D;  2D2C C;  3IRB A;  4KI0 A;  2R93 H;  2ALY B;  1E3P A;  1H9K A;  3QWN A;  4L5Q A;  4A3F G;  4IUQ A;  4U68 A;  5ELB A;  4NXN Q;  1BQQ T;  2XNA C;  2NN6 G;  4V0B A;  2MP1 A;  1KXL A;  3URY A;  5IWA L;  1GXD C;  2EY5 A;  5IT9 E;  1PRT F;  3J81 i;  2PZW A;  3STB C;  4L63 B;  1VQ6 A;  4DNT B;  2Q8T A;  4HAE A;  4OX9 L;  3H0G H;  2ZXP A;  5JEA J;  1ZYR D;  3A8K E;  1VDZ A;  1JB7 A;  2R92 B;  2IW3 A;  4KHP L;  5AJ3 Q;  2DNE A;  1LAB A;  4WOR A;  1CQV A;  1SNM A;  5CYU A;  1IBK L;  2KBN A;  4XQQ A;  4P73 A;  2WFW A;  3FPU B;  3C1F A;  3KBG A;  2ZT9 C;  1BOS A;  3R8B A;  3SVM A;  1LT5 D;  4IQZ A;  4UP9 A;  3HGB A;  5IYB H;  1YNJ C;  2F0H A;  1IBM Q;  1DGS A;  2B2Y C;  5IOC A;  2NYZ D;  2B8F A;  3KK7 A;  3F2B A;  1Y1W H;  5K36 G;  4JOI C;  2E2I B;  4DR7 Q;  3I4O A;  1I6H B;  5F2D A;  4LF9 L;  1C4Q A;  4IUV A;  1BCP F;  2E2J B;  3EN2 A;  5IY0 A;  4UP8 A;  5M5X B;  1SYG A;  2FIN B;  2CWA A;  2IWH A;  3KUP A;  4A3F H;  2AWO A;  3P75 A;  5IGF A;  5JPN C;  1KDA A;  1K3B C;  3M4O H;  1LV9 A;  2DUD A;  4A3K B;  4KN7 C;  2NN6 H;  3S1Q H;  2KCC A;  2B2Y A;  4HR7 B;  4A3J G;  3Q8D A;  1PTO C;  1XJV A;  4DGZ A;  4RG1 A;  5EQ0 A;  1FR3 A;  1EYA A;  3PUW A;  4JOI A;  2JK8 A;  4KKS A;  3C2P A;  1I94 Q;  1T5X D;  3L3O C;  4PZ6 A;  4BS9 A;  4GKJ Q;  2J4X A;  1EOT A;  4L5S A;  2K4K A;  1LTL A;  1A3V A;  1H9S B;  3G4S A;  4PNY A;  1LLR D;  3BZC A;  2Y0S B;  4EVO A;  3HKZ B;  2O5I C;  2G5D A;  1LTA D;  3UE0 A;  1CFM A;  4X3U A;  1JC7 A;  3CHB D;  3I7F A;  2YTX A;  1EOV A;  3J81 E;  2QW7 A;  3TRZ A;  4DA2 A;  2F0D A;  4UP7 A;  4LMQ D;  3Q6S A;  1RTO A;  3U58 A;  2F3V A;  3NWS A;  2RSO A;  1FVI A;  2A1A A;  4JCV E;  4KK7 A;  2OT2 A;  1Z7T A;  1JWM D;  3EVQ A;  1Q3L A;  4JI4 Q;  3LNN A;  4MHE A;  4I7A A;  2E75 C;  2WP8 J;  1EWH A;  4WJW A;  4HJ8 A;  3GTM H;  1KLU D;  4DXG A;  4MTN A;  3K7A B;  2B63 H;  1VQH A;  1N34 Q;  1QNK A;  2HIV A;  2NVY H;  4HJ9 A;  1DYQ A;  4KJO A;  2YTV A;  4LFA Q;  3T53 B;  1NY4 A;  2FFK B;  3ERS X;  5ELE A;  2A6E D;  3ERO A;  4A3J H;  4DNI A;  3G6J B;  4DK6 C;  3ULL A;  3C3L A;  2AQ2 B;  3S1M H;  2UUB Q;  4DUZ Q;  3HOU H;  1NR2 A;  1SAP A;  4C3H H;  1BUV T;  2D0P A;  5JAV A;  4IO9 A;  2F0V A;  4J15 A;  4JI3 L;  1WTP A;  1CUK A;  2NN6 I;  4DFA A;  2NTT A;  2ES2 A;  1O7Y A;  4PMB A;  3MVV A;  4JI1 L;  1VQF A;  5DM6 3;  3BYT B;  4A3E B;  4DUY L;  4QB4 A;  2AQ3 B;  5IWA Q;  1KAA A;  4BBR B;  1SFO H;  5IGC A;  1EY8 A;  5NUC A;  4KV6 A;  1TWG B;  1JE4 A;  5FKA C;  4OX9 Q;  1V1Q A;  2Y0S G;  1K8O A;  2YU9 B;  2KCN A;  3EQL C;  5FK9 C;  3CD6 A;  2IX0 A;  5C5L A;  3OWF A;  4NB3 A;  2EYJ A;  5KYL A;  1EYD A;  3I91 A;  4FNF A;  2NVQ H;  2Q8R E;  1OTC A;  1Q82 C;  1PVO A;  3CCJ A;  1MHW C;  4ME5 A;  4POG A;  1Q1E A;  3FDT A;  3ULJ A;  2N88 A;  5HGT A;  1S5D D;  1EWI A;  1PYW D;  3ER0 A;  2VQE L;  1EY6 A;  5IIF A;  4BXX G;  5EKI A;  2SEB D;  2HIX A;  1XNR L;  3S14 H;  4QGU A;  4JI8 Q;  1FJG L;  3OSO A;  1EIY B;  5M3M H;  3UI2 A;  4LF5 L;  2RDG A;  2EYH A;  4LUO A;  4DR5 L;  1JOO A;  3SDZ A;  3PGZ A;  3A8I E;  4DAP A;  4LF9 Q;  1CA5 A;  2GN5 A;  1VQK A;  1IW7 D;  4K0K Q;  4YIJ A;  1LM0 A;  2I0Q A;  2PNR C;  3PO3 G;  2OTL A;  4AQY L;  1L0X B;  4JBW A;  5DLQ E;  1HFG A;  5A35 A;  3U50 C;  2MUY A;  2WB1 B;  4HMI A;  5CV6 A;  1EIG A;  1STB A;  1GJX A;  3CCS A;  2FMM A;  1KL9 A;  4IN3 A;  3I4M G;  4GOP C;  1PDQ A;  2XTI A;  5FOB B;  2G9D A;  3ITP A;  3I73 A;  1PTO B;  3CQZ B;  1XNQ Q;  2PQE A;  4DAV A;  1Q12 A;  3F1Z A;  5IP9 G;  2HQE A;  2K1B A;  2B2U A;  2DY7 A;  3D3R A;  2L55 A;  3GTK H;  1SBB B;  2F3W A;  4BXX H;  4C3J G;  3LGJ A;  3GQB A;  3AU7 A;  1PZJ D;  5T1I A;  4A75 A;  5CBE E;  5C3E B;  1EY0 A;  3JC6 6;  3UDF A;  1ML0 D;  3CC4 A;  4LF7 L;  2EZV A;  4PG3 A;  4ZAI A;  2XWJ B;  2C35 B;  2L11 A;  5IGG A;  4I7Z C;  1ET6 A;  3HOW B;  1IYJ B;  1RTN A;  4FXG C;  1YJN A;  1HZA A;  4DV1 L;  4XTC S;  3MEF A;  5E4W C;  3I55 A;  1F9S A;  1MSH A;  1STN A;  4DV4 L;  2BOS A;  1KQS A;  4A3G G;  3PO3 H;  1STH A;  3ND8 A;  4DNR B;  3NPP A;  1VF7 A;  2JXM B;  1W2B A;  5COY A; 
#chains in the Genus database with same CATH homology
 1YHB A;  2LXK A;  2Q2H A;  3RZO H;  3PF4 A;  1HNW Q;  4IJL A;  4TVA B;  5LMU L;  4L5R C;  5M3F H;  2AHO B;  4P72 A;  1P16 A;  5LMN Q;  4GN5 A;  2MO0 A;  2PQA A;  2E8G A;  3CCM A;  1M1K C;  1P8L A;  4X66 L;  3RNU A;  1Q81 C;  5C44 G;  3PIP A;  3J7A 5;  3CXC A;  1CSQ A;  1MJC A;  2WB1 G;  1PH6 A;  3KYH C;  1SR3 A;  2R92 H;  1WCM G;  2VQF L;  2UXB Q;  1MKH A;  4YCU A;  4NXM L;  4A3C G;  1Q7Y C;  3HKZ G;  3RN5 A;  5LMU Q;  4JC0 A;  4A4I A;  2ZJQ A;  1BBW A;  1SE8 A;  5GAE C;  3UDX A;  4MNO A;  4DUY Q;  1E7Z A;  2N8N A;  4X65 L;  1K8G A;  1IBM L;  2N78 A;  1PH1 A;  3GTP H;  1K8A C;  4JG2 A;  2QGQ A;  3PIO A;  1X65 A;  4JI5 L;  2UU9 L;  2PNH A;  3BZK A;  2AMC B;  3ZJY C;  4GKK L;  3G6E A;  4NXM Q;  4IFD J;  1VQL A;  1V9P A;  3PV0 A;  3GTJ H;  4DV6 L;  1D7Q A;  4DV0 Q;  3U4Z A;  3TS2 A;  4GN4 B;  4DV5 L;  2E2I H;  1VQ5 A;  1MIU A;  3K80 C;  4OWT B;  1I6H H;  3E9I A;  2JE6 I;  2R7D A;  4A3B G;  5ELN A;  3UDI A;  4JI0 L;  1UE5 A;  5M5W H;  1PH5 A;  3VDY A;  2E2J H;  1C9O A;  1K83 H;  1R9T H;  4A3G H;  3PSI A;  1X3E A;  3PUY A;  2GVA A;  2B29 A;  2KCT A;  5M5X H;  2GVB A;  3HOX H;  2UU9 Q;  4H02 A;  2JA6 H;  2VQE Q;  4HJ7 A;  2VY3 A;  5C3E G;  3PUX A;  1VQ7 A;  4A3L G;  2ATW A;  2JQO A;  4DV6 Q;  1PH4 A;  1I94 L;  4IPG A;  3S2H H;  4A3K H;  4DV2 L;  2Q2I A;  1FJG Q;  1GVP A;  3HOW G;  2B63 G;  5GAD C;  1EFW A;  2ZTE A;  1QUQ B;  4DV5 Q;  1PH3 A;  3L0O A;  1UWV A;  4LF5 Q;  2OQ0 A;  2Z0S A;  5IE8 A;  3UDG A;  2BA1 A;  2E2H H;  1U5K A;  4JBK A;  4QY7 A;  4DR5 Q;  1PA6 A;  4O0A A;  1QVF A;  2R93 G;  3L7Z C;  3HOZ G;  4OWX B;  3KF6 A;  1J6Q A;  2OQK A;  4DV7 L;  3FKI G;  3OW2 A;  4OON A;  4WJ3 M;  4HIM A;  2OTJ A;  4C2M H;  1SN8 A;  5C44 H;  3M4Q A;  5EAY A;  2JA7 G;  2IT1 A;  3J81 c;  1WCM H;  4AQY Q;  2MO1 A;  2MNA A;  4R1J A;  4DV2 Q;  3HOU G;  1BKB A;  1VQE A;  1XMO L;  4A3C H;  1VQ9 A;  2RHQ B;  3T1Y Q;  4L5T A;  1J5E L;  2F4V L;  4LF8 Q;  1XPU A;  4JI6 Q;  1PH9 A;  4POF A;  2WAQ E;  4EX5 A;  4X62 Q;  3G48 A;  3EBE A;  2R6G A;  3KJP A;  2HQL A;  4DV7 Q;  5GAG C;  4A3E G;  4A3M G;  3GTQ H;  3U4V A;  4YHH L;  3S1R H;  3NBH B;  3SGI A;  3T1H L;  2V1C C;  4BBR G;  4B3T L;  2NZO A;  4HJ5 A;  1A62 A;  2JA9 A;  4LUZ A;  4ME3 A;  5JJI A;  4DV3 L;  4B3S L;  4JI4 L;  4A93 G;  1VQA A;  2K5V A;  3I56 A;  1IBL Q;  1TWF H;  3DM3 A;  2AKW B;  3CCL A;  3M85 A;  3NEM A;  2ZJP A;  1KAW A;  1HR0 W;  4JI2 L;  4JI7 L;  1J5E Q;  4LW1 A;  2UXD L;  1JE5 A;  5E7N A;  2K52 A;  2ZTC A;  1PYB A;  4AH6 A;  4PZ7 A;  3PO2 H;  4IFD G;  2UXC Q;  1G6P A;  2IY5 B;  1WYD A;  2UUC L;  4A3B H;  1XTD A;  4DR3 Q;  1L1O C;  4DR2 L;  3S17 H;  1SRU A;  1GKH A;  4IOC A;  1X55 A;  4B3T Q;  4GLX A;  1E1O A;  4LNQ A;  4R4C A;  5IYB G;  2ZJR A;  3W5O A;  3PUZ A;  2KEN A;  3K7A H;  1NJI C;  1YZ6 A;  1JJ2 A;  3J80 c;  2JA8 G;  2EQS A;  1U0L A;  1VS0 A;  2Q2U A;  4A3L H;  4R4Q A;  2I5M X;  1Y1W G;  2VS1 A;  4JI7 Q;  5C4X H;  3K7U C;  3E9H A;  5C4J H;  4BBS G;  2I5L X;  1AH9 A;  2UUB L;  1JT8 A;  4DUZ L;  4KLK A;  1W3S A;  3HOY G;  4LFC Q;  3L2P A;  3TS0 A;  2UUC Q;  2BA0 A;  4KI0 A;  2R93 H;  3IRB A;  1Z47 A;  4DK3 C;  3HOZ H;  2NVT H;  3K8A A;  1E22 A;  2ALY B;  3FKI H;  4BY7 G;  1VCI A;  1E3P A;  2UUA Q;  2MFI A;  4DV1 Q;  4DR4 L;  5M3M G;  1L1O A;  1EQR A;  4L5Q A;  2K5H A;  3NEN A;  1Q8K A;  1UE1 A;  3RLN A;  4A3F G;  2EXD A;  1YJW A;  4DV4 Q;  1VQ4 A;  4NXN Q;  2JA7 H;  5AJ3 L;  3I4M H;  1RIP A;  5IYD H;  3GDE A;  2NN6 G;  1KXL A;  1VQO A;  1SMX A;  2E5L L;  4A3I G;  4P74 A;  5IWA L;  3ULP A;  5M5Y H;  1S40 A;  1UEB A;  3J81 i;  3CCE A;  5HGQ A;  2PQA B;  3STB C;  1HR0 L;  1VQ6 A;  5IP9 H;  3HKS A;  4A3E H;  4A3M H;  1YIT A;  4OX9 L;  3H0G H;  2D62 A;  1GD7 A;  5JEA J;  4XIG S;  2K75 A;  2XGT A;  4BBR H;  1QZG A;  4IOA A;  3AFP A;  1HZ9 A;  1KD1 C;  4GNX C;  1JB7 A;  2DGY A;  1EYG A;  4KHP L;  5AJ3 Q;  1TXY A;  1Z9F A;  1HNZ L;  2L15 A;  1N9W A;  1TWG H;  4A93 H;  1IBK L;  2KHJ A;  2KBN A;  4C3J H;  4IJH A;  5FJ8 H;  1CKN A;  3WWV A;  4P73 A;  2F52 A;  2RHS B;  2WFW A;  4X66 Q;  3JAM c;  2YU9 H;  4DR6 L;  1L2F A;  2IHF A;  1SLJ A;  4Y7N H;  4DR7 L;  2VQF Q;  1I3Q H;  4YCV A;  4LFB L;  2VL6 A;  4BY1 H;  5IP7 G;  5GAH C;  4A3D G;  1JJG A;  1PYS B;  4PZ8 A;  1IZ6 A;  4DPG A;  3CCU A;  4UP9 A;  1YHA A;  5C0X I;  4R4O A;  5IYB H;  4AYB G;  4KHP Q;  1B7Y B;  2OCE A;  2CCZ A;  4DKA C;  4X65 Q;  1IBM Q;  1IBK Q;  1DGS A;  1LYL A;  2JA8 H;  4GNX A;  3F2B A;  2N49 A;  4AIM A;  1Y1W H;  4JI5 Q;  5K36 G;  1Y1V G;  4JOI C;  4YWK A;  3A74 A;  3KOJ A;  4BBS H;  4DR7 Q;  5GRO A;  3I4O A;  2Q2T A;  4LF9 L;  1VQN A;  4GKK Q;  2A19 A;  4OO1 G;  3J80 i;  1QVC A;  3GD7 A;  4A76 A;  1IL2 A;  1LUZ A;  3S1N H;  3EN2 A;  1WFQ A;  5IY0 A;  3FP9 A;  3D31 A;  1AE2 A;  1K0R A;  1VQB A;  4GLV B;  4YWL A;  1S3O A;  4UP8 A;  1SRO A;  3CCR A;  2I5H A;  4DR1 L;  4BY7 H;  2CWA A;  4GKJ L;  1PFS A;  1Q1B A;  3BU2 A;  4A3F H;  1PH2 A;  2AWO A;  1IXR A;  4JI0 Q;  1YIJ A;  1XMQ L;  3MXN B;  4B3M L;  1UE6 A;  3M4O H;  2DUD A;  4EQ5 A;  3S1Q H;  1WI5 A;  1BBU A;  3CP0 A;  1I50 H;  3S24 A;  4A3J G;  3EIV A;  3Q8D A;  1VQD A;  4R4I A;  1XJV A;  4RG1 A;  1OXU A;  1NMF A;  3KF6 B;  3PUW A;  1CKM A;  4JOI A;  2JK8 A;  1I94 Q;  4LF6 L;  1N36 L;  1X6O A;  1HZB A;  3KDF A;  4APV A;  4PZ6 A;  4DR1 Q;  1C7Y A;  4GKJ Q;  3TRE A;  2YYZ A;  4L5S A;  3PCO B;  2K4K A;  1LTL A;  3G4S A;  1A8V A;  4GLA C;  1HNX L;  2KCM A;  3BZC A;  3E0E A;  2F3I A;  4YY3 L;  2IX1 A;  5JEA G;  4JV5 L;  1C0A A;  1X3G A;  5LMN W;  4C3I H;  2ASB A;  1KRS A;  1OXS C;  3AQQ A;  3UE0 A;  5M3F G;  4OXP A;  3I7F A;  1L0W A;  2YTX A;  1EOV A;  2K14 A;  4LUV A;  5BR8 L;  3CQZ H;  3OTO L;  5FLX c;  1FGU A;  3CW2 C;  2LXJ A;  3H15 A;  1QVG A;  3TRZ A;  4UP7 A;  1XMO Q;  1K3R A;  5IP7 H;  3JAM i;  4A3D H;  2F4V Q;  2R7Z G;  1NE3 A;  3CMA A;  2PI2 A;  3U58 A;  2A8V A;  3M7N A;  4RMF A;  2FXQ A;  1EUJ A;  3BJU A;  3CC7 A;  4LWC A;  4GS3 A;  1N34 L;  1FVI A;  3J7Z C;  3AFQ A;  2A1A A;  3NEL A;  4YHH Q;  4JCV E;  1QZH A;  2HT1 A;  3S2D H;  3AEV A;  4LFA L;  3CCV A;  3T1H Q;  3S16 H;  5JJL A;  3W1G A;  2Z6K C;  3TQY A;  4MZ9 A;  5IYC G;  4DV3 Q;  1A63 A;  3OTO Q;  5BR8 Q;  4B3S Q;  4JI4 Q;  4NPS A;  5C0X J;  5C3E H;  3ICE A;  3I2Z A;  2WP8 J;  2JJQ A;  4JI2 Q;  3GTM H;  4HJ8 A;  2UXD Q;  2HHH L;  4GOP A;  4IPH A;  4MTN A;  3HOW H;  2B63 H;  1OXT A;  1VQH A;  2ZM6 L;  1N34 Q;  2Y0S E;  2RCN A;  2HIV A;  2R7F A;  1TWA H;  2NVY H;  3HKZ E;  4HJ9 A;  2YTV A;  4DR2 Q;  5ELO A;  1HJP A;  4LFA Q;  3PF5 A;  4B3R L;  2ID0 A;  2WAQ G;  1NY4 A;  3ERS X;  4LF4 L;  2H5X A;  3RLF A;  1AE3 A;  3RLO A;  1HNW L;  4A3J H;  1VQP A;  2Z6K A;  3KFU A;  3I4N G;  4DNI A;  1YVC A;  1KHI A;  4DK6 C;  3ULL A;  5LMN L;  3S1M H;  1L1O B;  3G71 A;  2UUB Q;  4DUZ Q;  5HY6 A;  3HOU H;  2BH8 A;  2QEX A;  1K73 C;  2JA6 G;  4C3H H;  2D0P A;  4IO9 A;  3OYY A;  2VUM G;  1ASZ A;  5JJK A;  4J15 A;  4JI3 L;  2RF4 A;  1VQG A;  1CUK A;  1D8L A;  3DLL A;  2UXB L;  5J3B A;  3HOV G;  3A0J A;  2NN6 I;  2JA5 G;  4DR4 Q;  1OXV A;  1OXX K;  3CCQ A;  2ZTD A;  1UE7 A;  2ES2 A;  4HID A;  4PMW A;  4YWM A;  4JI1 L;  4X64 L;  1VQF A;  2K5N A;  1B8A A;  3CAM A;  4DUY L;  1YHQ A;  2E5L Q;  5IWA Q;  3H3V H;  2N3S A;  1SFO H;  2R7Z H;  1CKO A;  3RZD H;  4HJA A;  1VQJ A;  1YEZ A;  4QIW E;  1CSP A;  3GO5 A;  1HR0 Q;  4JI3 Q;  4HIO A;  4GN3 B;  4X6A H;  3UE1 A;  1CKN B;  4ALP A;  4OX9 Q;  1V1Q A;  2Y0S G;  1GO3 E;  3D0F A;  4JI8 L;  3CD6 A;  5IYC H;  2CWP A;  3KJO A;  2IX0 A;  4DV0 L;  1N8R C;  4JI1 Q;  4X64 Q;  4NB3 A;  2PMZ E;  1HNZ Q;  1N33 L;  3TEH B;  2CKZ B;  1VQM A;  2NVQ H;  1N32 L;  4DR6 Q;  3B6Y A;  1OTC A;  5FLM G;  4P71 A;  1YI2 A;  1Q82 C;  1X54 A;  1PVO A;  3CCJ A;  2MQH A;  5C0X G;  3KLW A;  4POG A;  1Q1E A;  3ULJ A;  3HOY H;  4LFB Q;  1BVS A;  3ER0 A;  1EWI A;  2VQE L;  1KRT A;  4GNX B;  4UY8 C;  4BXX G;  4K0K L;  2HIX A;  4JBM A;  2IHE A;  1XNR L;  3S14 H;  4O2D A;  4QGU A;  4JI8 Q;  1H95 A;  1PH7 A;  1FJG L;  1EIY B;  3A5U A;  5M3M H;  4Y52 H;  3PO2 G;  4LF5 L;  4OO1 I;  4DAM A;  1N33 Q;  3PUV A;  4LUO A;  1B70 B;  3GTL H;  3I4N H;  4DR5 L;  1N32 Q;  1V43 A;  2VZA A;  3PGZ A;  1Q46 A;  4LF9 Q;  3A5Z B;  1NBW A;  1T9H A;  2GN5 A;  4A3I H;  1QUQ A;  1HZC A;  1VQK A;  3M4P A;  4WJ4 A;  4K0K Q;  1LM0 A;  1XNR Q;  2VUM H;  4IPD A;  2I0Q A;  3PO3 G;  4OWW B;  5C4X G;  2OTL A;  4AQY L;  4QQB X;  3HOV H;  2JA5 H;  2QA4 A;  3FHW A;  4JBW A;  4P75 A;  5DLQ E;  2NVX H;  3KF8 B;  3U50 C;  3T1Y L;  4LF8 L;  1XMQ Q;  4JI6 L;  1M90 C;  4B3M Q;  3KDF B;  1XNQ L;  3GTO H;  1FL0 A;  4X62 L;  4DAY B;  1KIX A;  3CCS A;  2JEB I;  1VQ8 A;  1KL9 A;  1Y14 B;  3GTG H;  1I5F A;  1E1T A;  1YBY A;  1XPO A;  3K81 C;  4LF6 Q;  2B3G A;  1N36 Q;  3M9B A;  3I4M G;  3STB D;  5IYD G;  1YNX A;  1VQI A;  2AWN A;  1VQC A;  4GOP C;  1WOC A;  1S72 A;  3S15 H;  4JYA L;  1IBL L;  1Q86 C;  2XTI A;  1EIF A;  1O7I A;  4KHZ A;  3J81 j;  1TWC H;  2OWO A;  3M3Y H;  2R92 G;  2LSS A;  1HNX Q;  1NMG A;  1XNQ Q;  1MJE A;  3F2D A;  1Q12 A;  3F1Z A;  5IP9 G;  4YY3 Q;  3CC2 A;  4JV5 Q;  2UXC L;  2KHI A;  2VNU D;  3H0G G;  4DR3 L;  3H3V I;  1K9M C;  5FLM H;  1Y1V H;  5H1S E;  4IPC A;  4FDB A;  3GTK H;  1PH8 A;  3F2C A;  2D0O A;  4IFD I;  3F8T A;  2YV5 A;  4JYA Q;  1EQQ A;  4BXX H;  5FJ8 G;  3CF5 A;  2BH2 A;  3AYH B;  3LGJ A;  1JJC B;  2WB1 E;  1RL2 A;  1XPR A;  4BA2 I;  4A75 A;  3JC6 6;  4UPA A;  3UDF A;  4LFC L;  3RN2 A;  3CC4 A;  4LF7 L;  4BY1 G;  4PG3 A;  2NZH A;  1TWH H;  3CPF A;  2C35 B;  3HFZ B;  4GOP B;  2CFM A;  2K50 A;  1YJ9 A;  1ASY A;  3W1B A;  1IYJ B;  1NTG A;  4BA1 I;  3CME A;  3K0X A;  1HZA A;  4DV1 L;  4XTC S;  1YJN A;  2UUA L;  3MEF A;  3I55 A;  2EIF A;  4NXN L;  4R4T A;  4DV4 L;  4TQU S;  1KC8 C;  4QJF A;  1WJJ A;  2CQO A;  1KQS A;  4QL5 A;  4A3G G;  3HOX G;  2HHH Q;  2JEA I;  3RR5 A;  3CPW A;  3PO3 H;  1HH2 P;  1A0I A;  2ZM6 Q;  5GQO A;  1X9N A;  1JMC A;  1X56 A;  4JBJ A;  1PHJ A;  1W2B A;  1GM5 A;  1X3F A;  2VW9 A;  4YCW A;  5IT9 c;  2PI2 E;  4LF7 Q;  1E24 A;  2YTY A;  4HIK A;  1PV4 A;  4B3R Q;  1G51 A;  4A3K G;  4LF4 Q;  1G29 1;  4AYB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...