4N9TA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92s at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYSYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4n9tA00
2LKVA 3EJIA 5CV7A 3R3OA 3C1FA 4K8JA 3P1HA 3SK8A 4N9TA 2F0JA 1EYCA 2F0OA 4PMBA 1SNPA 4H7BA 3QOLA 3TP5A 4S3SA 4IZ8A 1EY8A 3TP8A 4EVOA 2F0WA 3NHHA 1EY9A 4NKLA 2QDBA 2KHSA 3DHQA 5DEHA 3D8GA 5J1ZA 3C1EA 1SNDA 5EGTA 5C4HA 4KD4A 5J22A 3SK4A 3VA5A 5C4ZA 2F0HA 4EQPA 5KGUA 1EYAA 1KABA 3BDLA 4K14A 5IODA 2F0GA 3MZ5A 5KYLA 3E5SA 4RKBA 5IGCA 4QB4A 2KQ3A 1EZ6A 3TP7A 3H6MA 3NQTA 4ZUJA 2F0NA 4HMIA 3OSOA 4PNYA 5CV5A 5CV9A 4ZUIA 1KDAA 4HTHA 5I6WA 2SOBA 2F0PA 4KY5A 3T16A 5K5PA 4DGZA 5EKLA 4IUNA 4K8IA 2F0UA 5CC4A 3T13A 1JOQA 2F0DA 1A3UA 1NSNS 1F2MA 1SYGA 4K5VA 3SK5A 5CGKA 1RKNA 3QB3A 4G57A 2EYOA 3HZXA 1KDCA 1TQOA 3MEHA 4WRDA 3U9OA 1NUCA 3QOJA 2F0MA 1A2UA 1EQVA 1SNMA 5CV4A 2EY5A 4DFAA 3NXWA 4B9WA 4IALA 2PZWA 4K6DA 2RBMA 1EY6A 4WORA 4ME5A 3SR1A 3PMFA 1JOOA 5E1FA 5I9OA 4NDXA 2EYHA 5F2DA 5C3WA 4I65A 5C3XA 1SYEA 1ENAA 1STAA 2SNSA 4LAAA 4N9PA 3RUZA 3TMEA 2PYKA 4DF7A 2EY2A 1SYBA 2EYJA 5HGTA 1STYA 4J1MA 3TP6A 5I6YA 1TT2A 3LX0A 4TRDA 5J39A 4J6HA 2EYPA 2F0QA 4NP5A 4QMGA 5C6AA 3D6CA 2F0FA 3D4DA 4KHVA 3OMGA 2EY1A 2ENBA 4KTAA 3NUCA 2WACA 2F0IA 2EY6A 3BDCA 3HEJA 1A3VA 4E6IA 4F7XA 5IOCA 3SK6A 1F2YA 5CR3A 3MXPA 1EZ8A 3SXHA 2PQEA 4ZQ3A 2NUCA 5EKKA 4B9XA 2PZUA 4KD3A 2F3VA 4K2KA 5KIXA 2OXPA 3DMUA 2PW5A 1AEXA 1STGA 3MHBA 5ISRA 5IGFA 1U9RA 2HQEA 3D4WA 2EXZA 4KV6A 5CV8A 2F0TA 5C5LA 5KRUA 4HMJA 4KY6A 4R8NA 4DU9A 5E3FA 1SNOA 1SYDA 1EY4A 3OMCA 2PZTA 1STNA 2EYFA 2EYMA 1KAAA 5CV6A 5KEEA 4YIJA 5I9PA 4MIUA 2F0EA 3OWFA 3ITPA 1A3TA 4OL7A 1A2TA 4F8MA 1F2ZA 2F0LA 3NP8A 2F0VA 4NMZA 2RKSA 5IGGA 5M9OA 1EY7A 1EYDA 4K2LA 3MVVA 5NUCA 3SHLA 5IGDA 1JOKA 4K5WA 3V2TA 5HURA 2PW7A 3ERQA 5KYIA 4ID6A 4KJOA 5IGEA 2OEOA 3NK9A 2SNMA 5IGBA 3EROA 1SNQA 4EQOA 1EY5A 2F0KA 1SYFA 5JAVA 4QF4A 4KJNA 1ENCA 1TR5A 2M00A 4KY7A 5C5MA 4RKLA 2O4XA 5IIFA 1STBA 1IHZA 3EVQA 4EQNA 1STHA 1SNCA 1JORA 4ODGA 4K5XA 2OF1A 5JOBA 1II3A 2F0SA 3P75A 3S9WA 5DAUA 2EYLA 2RDFA 1EY0A 1SYCA 2F3WA 1KDBA 4PMCA
chains in the Genus database with same CATH superfamily
3AFPA 2AUKA 1QNUA 1BCPB 2EDGA 3R93A 2JXMB 4KKTA 2NZ1D 1QE6A 3GTMB 4RHRA 5FLXc 3TP8A 4A3BH 3MXNA 4C1NK 1BUVT 1LTGD 2KHSA 1QCBD 3BVZA 1DOMA 4GNXC 1RJTA 3HOZB 3Q6SA 2KHJA 2QEJC 2B2VC 2F0GA 3QIAA 3E5SA 5CORA 4AH6A 1HZAA 3HKZG 3C46A 3EN2A 5I6WA 2F4VQ 4JI1L 2F0PA 5CMDA 4K8IA 3S15H 3J80L 1NSNS 1F2MA 1ENFA 1VQCA 3M9BA 2DY7A 3AMUA 4G57A 4WJ4A 2B63B 2ATWA 1O78A 4JBMA 1TWCH 2EY5A 3NXWA 2IX3A 5AFWA 2KBNA 4WORA 2R92B 4HN7A 3UDGA 2EYHA 4I65A 4E6IA 1Q8KA 2GN5A 1HNXL 2PYKA 2NWGA 1HR0Q 1D2BA 4J1MA 1Y1WH 1NR4A 4AYBB 3N52A 4A3JB 2A68C 2EYPA 2QCPX 3HFZB 3SDZA 4P71A 3RZDB 2QW7A 1AE3A 2F1MA 3I3CA 4MTNA 3T1YL 1Q8IA 2BH8A 1Q46A 2PZUA 5FLXL 1EQTA 4DV0Q 1PH1A 2JA7H 4O1NA 3DM3A 3I4OA 4LUZA 5C4JH 5E7NA 3RLNA 1VF5C 2K03A 5JVG3 2NN6I 1H9MA 2OCEA 1BCPF 4GLVB 1I6VC 4OX9L 4DUYQ 1EYGA 2BH2A 3T56B 4XYOA 4BBRH 4F8MA 3F2BA 4IJHA 3FKIH 1N36L 4C3IG 1IKMA 1S5DD 5KYIA 1B70B 1HJPA 1X3QA 4F87A 4EQOA 2I07B 4JI3L 3A8IE 3W3AA 3CPWA 5GAGC 4NXMQ 1II3A 3GV3A 2KENA 1LTBD 1ICFB 3RNUA 1UE7A 1TY0A 1Y8OB 3NSWA 5FO8B 5IY0A 2JA5H 1TWHH 1MIUA 1K83B 3VR4A 3RN5A 2F0OA 2NVTB 2NVQB 1WD1A 3J80i 4YWMA 1BXTA 1WTHA 3TS2A 1PA6A 2R61A 3C1EA 5C4HA 4POFA 3CCVA 1B53A 4RGOS 4EQPA 4F88A 2GVAA 1VQFA 1T5EA 5CBAE 4HIMA 1XMQQ 1TWAB 2M9VA 3CCJA 2E75C 2EZVA 3T16A 2VNUD 2K14A 1TWFH 1ZKOA 1KTKA 3CP0A 1JB7A 1JICA 1PTOB 4DR2Q 4RH6A 4UDUC 1EL0A 4DFAA 2N78A 5CV4A 2UUCL 5IT9c 1YBYA 1HCZA 2EY2A 1QVCA 1STYA 1MSHA 2B8FA 2R6GA 4JYAQ 3BZCA 5LMUL 1MI2A 1WCMG 3CQZB 1YHBA 3OOCA 3PQIA 4GOPA 3T53B 1M90C 5EQ0A 4DAMA 5CR3A 4A3EG 3S2DH 5I2XA 3DM1A 4RAUC 2ID0A 4DV1Q 1YJWA 2E76C 1CHQD 4DR7Q 4A76A 1UUPA 4A3FH 2L11A 2ZM6L 1KAAA 1PYWD 1ICWA 4YIJA 5JEAH 1IBKQ 4OWXB 1I6HB 4MIUA 3HOZG 1BCPC 2FINB 1MSGA 1MKHA 3I4NG 3NP8A 3O13A 1JWSD 1SROA 1EYDA 3SHLA 4OO1I 1EOVA 2E74C 2AHOB 3GTKH 2XTIA 3ERSX 1G6ZA 2A19A 1PRTD 5IT9L 2PQAB 3K80C 5EPLA 2B63G 4BY1B 2EJFC 1TWGH 3BYTB 3CW2C 3E3XA 1LT5D 1AZPA 1JORA 5EBCA 1AZQA 5T1IA 1YJ9A 2EE1A 1PTOF 2R92G 1I5FA 4QUCA 4B3ML 2UXCQ 2LY7A 4UP7A 3ER0A 4DR1L 1OXTA 5FK9C 1LYLA 1D5XC 1V1QA 2MGSA 3P1HA 4A3JG 2NTTA 2NVXB 2L15A 1CK1A 4P73A 3MTSA 1UEBA 4A3GB 4LWCA 4K14A 2K28A 1O7LA 3CPFA 4X3UA 4LF7L 3G48A 2WKDA 3CCSA 1LTRD 4KY5A 4QY7A 1IYVA 2F0UA 3GTOB 4PG3A 3EBEA 3AQQA 4K5VA 1EQQA 2PNRC 1LT6D 5BR8Q 2Z0SA 4DPGA 5IP7G 1A0IA 1NMFA 1FGBD 1NJIC 2HHHQ 3BDOA 1SMYC 3KLSX 3RZOH 5G3LD 5I9OA 3GP7A 3T51B 1STAA 4LF5L 2IJ0A 4K6LA 3E6ZX 4YCWA 4ZK9B 5FLMG 2JSOA 3STBD 2MO0A 3I8ZA 1HPCA 1Y14B 4TSSA 1G8ZD 2KCMA 2V1CC 2WB1E 3DEPA 2VUMB 3CXCA 3PIOA 2PQEA 4PMWA 1D6EC 1A63A 3F1ZA 2PCFB 4JV5L 3KJOA 1LTSD 4A3DB 2G9HD 3JAME 2EJMA 4JG2A 1XJVA 5JPMC 1PXUA 3S1NH 5JJZA 1V1PA 2DJFC 3EQLC 3Q8DA 2PNHA 3S24A 2R7ZB 1KL9A 1NTGA 4A93B 4NPSA 2F4IA 2O5JC 1VQBA 4DN4M 4DXGA 4RFBA 3S17H 4KJNA 1ENCA 2KHIA 4RKLA 2O4XA 5FO9B 4DV4Q 4EQNA 1HTPA 3A8JE 3S16B 1SNCA 2FHTA 1VQOA 4OWWB 4OIJA 1HTLD 1PH3A 2IL8A 1JQYD 2EYLA 3SE0A 3KF8A 4QIWE 1FGUA 1CI3M 1PTOC 4YY3L 2R3ZA 3T1HQ 1SJED 1EYCA 3GTPH 1VQLA 2RHSB 3KF6B 2GVBA 5J1ZA 4OGQC 1P8LA 2AWOA 1N34Q 4KD4A 3IFTA 1EFID 1EOTA 4IFDG 3H3VC 4KN4C 4A3IH 1A15A 3G71A 1YZ6A 4LFAQ 4QB4A 5IYDG 4PNYA 1N33L 1KDAA 2NVYB 4HTHA 2Z6KA 1XX8A 5K5PA 2N88A 1JCKB 5EKLA 1S5ED 2H1EA 2OT2A 2F0DA 3SK5A 5CGKA 1RKNA 2JA9A 2A6HC 2R7FA 1TQOA 2KCCA 5C0XG 1MD2D 3AU7A 3FVQA 1SNMA 3HGBA 2R7DA 4ME5A 3M85A 1SYEA 3RUZA 5M3MB 2E2HH 1LUZA 1I3QH 2JA6H 2F0FA 4R4IA 5HGQA 3FPPA 3I4MB 4DK1A 1PZJD 4RA8A 5DM63 1PV4A 2Q8TA 4ZAIA 4GNXA 4BY1G 3UI2A 5IYBG 2KCNA 2YYZA 2L5TA 5EAYA 3SXHA 5I4DA 2B2VA 1JB3A 1X32A 3H0GB 4NB3A 1HH2P 1VQ9A 4BBRG 3K0XA 5DLQE 1F9PA 2VQEL 1UE6A 2AQ1B 1TS3A 3MHBA 5GQOA 3PUVA 1I50B 4QUFA 1SYDA 3OMCA 4HJ8A 3HOXH 3A8KE 5CV6A 1PH5A 4KN7C 2F0EA 2CVRA 4A3GG 2EVBA 3N6RA 4DV6L 1XXGA 2F0LA 5IGGA 2N8NA 1UEAB 3V2TA 5HURA 2PW7A 4LF4Q 4ID6A 4Y7NH 2B39A 1U4RA 4KJOA 2RA4A 4C3JH 5K36H 3S14H 1EIGA 1SYFA 2D9UA 4DXFA 1EQRA 3J81L 3CCUA 5JJIA 1IHZA 3S9WA 3KDFB 2JA8B 2ZJRA 2NN6H 5IYCG 1PH7A 3HOWH 1MJEA 4BY7G 3I91A 2DNCA 4N9TA 2YU9H 1DCZA 4BBSG 3M4OB 1DGSA 5AJ3Q 1EY9A 5DEHA 4AQYL 2ZTCA 3SK4A 1KQSA 4B08A 2VUMG 1BVSA 4BA1I 1EFWA 4HCSA 1YNNC 4HMIA 4ZUIA 1K0SA 3F8TA 4A3DG 1YNJD 1Q86C 1SFOB 4OXPA 3VR3A 1X6OA 4DAYA 1YHQA 4A3MB 3PIPA 4B9WA 3QJYA 4PZ6A 4K6DA 1XNRL 1W2BA 1IBMQ 4A3LH 1KHIA 3M4YA 4CKCA 1I94L 1H95A 2R7ZG 2WAQB 1PH6A 5HGTA 1EIFA 2MQHA 4CDCC 1M4VA 1E1OA 1QWYA 2MO1A 1VQGA 2BDNA 4A93G 1SN8A 4DAYB 4J6HA 5C6AA 1XNQQ 3E0EA 2I5HA 3CMAA 4H0LC 5IP9G 4A3FG 3CC2A 3UDXA 4KHPQ 1D8LA 1WJJA 4DV2Q 1U4MA 1IW7D 4OEMB 1SE2A 3J7A5 3U58A 2AQ3B 5C0XJ 1JE4A 2L9HA 4KY6A 5E3FA 2NYZD 1ASZA 4NW2A 3J81i 3OYYA 1F2ZA 1EIHA 5NUCA 1UWVA 2CH4A 1PHJA 1K9MC 2F4VL 2H4OA 1BDOA 2HDMA 1BKBA 3BS1A 3TS0A 3KLRA 3L0OA 4NXNL 2RDHA 5JOBA 2WKCA 2HCIA 1PFMA 1IZ6A 1HNZL 3PIP3 2ALYB 1LT4D 4KK7A 5FOBB 3J80c 3PGZA 1WOCA 2EQSA 5M3MG 2V4DA 2VXWA 1YI2A 4JI5Q 3KBXA 4DUZL 1R9TB 5CYUA 3I70A 1PH8A 3CC7A 1HQMC 4JI0Q 1CKOA 4H7BA 3TP5A 3J7YW 2Q8IB 3KUPA 1RIPA 3K7UC 4OO1H 2FFKB 4PZ8A 5EGTA 2ZT9C 1Q82C 4H44C 1OXVA 3U4VA 3D6WA 1Z47A 3H0GG 5IGCA 4X64L 4A3EB 1QVFA 3G7LA 4FO2A 2J7ZA 1A3UA 2LMCB 4DR3L 2XGTA 3LWUA 4LF8Q 3MFYA 1HHVA 4WRDA 3GTQB 1XYIA 4DUYL 1FL0A 4C3HH 1K3BC 1CSPA 3X3MA 3PCOB 4OIKA 2WV6D 4DR4Q 1PFSA 4HJ9A 5C3XA 1BBUA 1CZGA 1ZYRD 1PVOA 5C44B 3I4NB 1QUQA 1U4PA 1U5KA 2A73B 2E2IB 1IBLQ 1N32L 1SSOA 4TQUS 4XQNA 1Y1VH 3P20A 4CGYB 4KHZA 1EU3A 3CU7A 3A5UA 3BDCA 2EY6A 2CW0D 2UUBQ 2YTXA 2ZTEA 1E24A 4IUTA 5M5XH 4X65Q 1EWCA 1QUQB 4LMQD 2JA8G 3WOEA 1C0AA 4L5TA 4KD3A 2XRQD 5M5WB 2R93B 1Q3LA 5FJ8H 3I55A 4MNOA 3RR5A 3ONAB 3WOFA 4EGVA 1XMOQ 2EXZA 2ZTDA 3GV6A 3E9HA 4MZ9A 4C2MH 4HMJA 4IOCA 2F03A 1F9QA 1FNVA 1SRUA 2EYMA 4XTCS 1WTWA 1D5MC 1ET9A 3DXJC 3OWFA 3PF5A 3TDQA 1HA6A 4X3SA 3BZKA 1XMQL 2C9OA 4LK1C 3H15A 3PO2B 3I4LA 4UP8A 3ERQA 4WFN3 1CTMA 1DOKA 1DXMA 3HOVH 2YTYA 3K7AH 3PO3B 5JEAJ 3S2HB 1GVPA 3TQYA 4QF4A 2ZJQA 3Q24A 4CBVA 4KY7A 5IWAL 4CJ1B 4A3MG 2K5HA 1GUTA 4K0KQ 2F0SA 1D5ZC 1L0YB 3CCEA 2RDFA 1YEZA 3RD4A 1FVIA 2WAQG 1IL8A 2RQXA 4JYAL 4L6TB 3S1QH 2K7VA 1PRTB 2K6AA 4UY8C 4R4OA 1K8GA 3OTOQ 1O7IA 1RF2D 4RMFA 1S40A 3RN2A 1S5CD 4QGUA 1TS4A 2A6ED 3HOYB 1QZGA 5M3FB 3T4AC 2JK8A 3M3YH 3K6OA 3H6MA 1TS5A 4R4CA 3VYRA 2EJGC 5H1SE 4DV1L 3KBGA 4JK1C 4IJLA 2F0MA 1VQIA 4JI1Q 2KA7A 3M7GA 4L63B 3GTLH 2AWNA 5C3WA 1IKLA 4BXXH 1G51A 2IW3A 2Z4IA 3UDIA 2EYJA 5C3EB 2BE5C 5I6YA 5EPJA 4A3KH 1B9MA 1V43A 3HOUH 2BOSA 3D6CA 3D4DA 4KHVA 2UU9L 4FNFA 1FNWA 1J5EL 2J4XA 2M2LA 3NWSA 4M8AA 1QZHA 2MUYA 1ZEQX 5DNFA 4A3BB 1AP0A 4RWSC 1NCVA 1GUNA 2I5MX 2F3VA 2UXCL 1QG7A 3DMUA 3T1YQ 1TKWB 1HA5A 3NE5B 5IGFA 3VR6A 5CV8A 1D1KA 3J7ZC 2MFIA 4GKKL 3S15B 5KEEA 4GLXA 1OTCA 2DGYA 1PZID 1PRTF 1B7YB 1A2TA 5JPNC 2D0PA 3A0JA 4UHVA 1D7QA 3CD6A 2IWHA 3BU2A 2F52A 1TWCB 5FLXE 1AE2A 4GKJL 4GZYC 1C4QA 2A5HA 5ELFA 3S1RH 4OX9Q 2VQFL 2SNMA 3I90A 1GM5A 4FF1A 3IFDA 4XQJA 1Y1WB 2KEEA 2HUGA 2E8GA 4H02A 4C1NI 4LNQA 1X3GA 1OXXK 4DV3L 1H9RA 4JI4L 4BA2I 3NENA 3P75A 3VR2A 2YV5A 1EY0A 3AYHB 1KDBA 2Z9HA 2WINB 1W3SA 2PQAA 3OHXC 4JI3Q 4IQZA 5C44G 1QNKA 3C1FA 4DA2A 2L0CA 5LMNL 4X3KA 1PLFA 4LF6L 1XTDA 2K5VA 2G5DA 2K1BA 2JA7B 1W6KA 1YIJA 5HY6A 5I9PA 5C4JB 2DUDA 1SNDA 2F0HA 4LFBL 1C9OA 1STEA 5JVH3 3OWEB 3K5LA 3JAML 3MZ5A 5D3DA 3K59A 2Q2HA 1L0WA 3OW2A 2K5NA 3UE1A 1PMRA 2R93G 1WTXA 5G3LF 4BBRB 4DV5L 3T13A 1I4QA 3FKIB 1K3RA 1X65A 1G6PA 1Q90A 1SE3A 3FRPB 1NBWA 3SR1A 4DR6Q 3L3OC 5EKIA 1LT3D 3LGJA 4DR5Q 2NB0A 3W1BA 5JJLA 3PO2G 3J81j 2UUCQ 1TU2B 1G2SA 5BN4A 4NP5A 4QMGA 2LSSA 3QG1A 1E2WA 3PO3G 2EY1A 1TWHB 2LS01 4HAEA 2JA5B 2O2LD 3GO5A 3L9AX 4IUVA 1BBXC 1E22A 4RCOA 5IE8A 4CJ0B 4HIOA 1XPOA 5LMUQ 3OIPA 4A3CG 3DWQA 3V05A 4APVA 2B2WA 4B3RQ 1PFBA 1SXTA 2EIFA 1STGA 5ISRA 4BY7B 3H3VI 3CHBD 4B3SL 4Q0FA 5A2QL 4P72A 3KFUA 4BBSB 1Q12A 2L12A 3ND9A 2E2JH 1TWFB 1SAPA 4OL7A 3X3NA 1KD1C 3HOYG 1X3EA 1PRTC 4IFDI 5M9OA 2RSOA 5M3FG 1SBBB 3EIVA 3MVVA 3DLLA 2IHFA 3M7NA 3KK7A 3EFXD 2HCCA 2WFWA 5IGBA 1GUWA 4DAVA 1X55A 4ILWA 5C4XH 4OO1G 2X6LA 2EPBA 1GXDC 2LFNA 1UE1A 3MXUA 3JAMi 4QJFA 3TSSA 3EJIA 1LACA 4YHHL 3Q23A 3K0YA 5C3EG 2B2TC 1LTAD 3S2DB 1NNXA 2HIXA 3G6EA 1CQVA 2MP1A 2XWJB 3QOLA 4DNRB 2WB1B 4EVOA 1ESRA 2UUAL 2KCTA 5IT9E 3MWYW 3TRZA 2VB3X 4X3TA 1S5BD 2JJQA 1EYAA 1ASYA 4JCVE 4A3BG 4A3FB 3F2UA 3W1GA 1F77A 3KF6A 1YITA 5ELBA 1OO9B 2Q2UA 2BDOA 5BN5A 1FJGQ 1TVXA 3MEHA 4XXEA 4LF7Q 3GTKB 1G2TA 2RHQB 3QWNA 3STBC 3J7AV 2QDLA 1TWGB 4DF7A 3PUXA 1TT2A 4G7ZC 3S1MH 1C8CA 3HKSA 2MPMA 3PIO3 2A69D 2F0QA 3GTGH 1BQQT 2CHBD 2DN8A 4KKUA 4RCNA 1CFMA 4LF9Q 1LV9A 4P74A 1Y1WG 3KJPA 4JI6L 4XDXA 2VL6A 1MGSA 4JI2L 4QIWB 4ZQ3A 2K5QA 2UXDL 4GS3A 1R4QB 5CBEE 4I7AA 3M4QA 3PSIA 3J81c 1G91A 3HOVG 4R8NA 3CCRA 2JA7G 1EEID 2FJ2A 1WVLA 2EYFA 4IPGA 4C3IH 1DD2A 1K8AC 1RL2A 4FVMA 4FP5D 2IX1A 3NTHA 1PH2A 4A75A 4KKSA 2CQOA 4L5RC 1V8QA 2ZJPA 1X54A 1M8AA 5IGDA 1MHWC 1OXUA 1E7ZA 1HZCA 4DKAC 3PUYA 2P5ZX 3FKIG 4HIDA 4UAIA 3IAYA 1WFQA 1STHA 4PQXA 5KNDA 2OF1A 3URYA 1VQNA 2HD3A 4Q5VA 2AKWB 1QOHA 1AH9A 4K8JA 2QILA 1CT1D 4R1JA 1VMCA 5ELEA 2K50A 2F0JA 3SGIA 4XYQA 2E5LL 2FMMA 4QCLA 3KDFA 5I2YA 4IPCA 4P75A 2JA5G 1XNQL 1CZWA 4CKBA 2K33A 1ZXTA 2L4NA 4YY3Q 1HNWL 1HUNA 3I72A 4HJAA 1K8MA 4DV2L 4DV7Q 1X3FA 1EZ6A 3S1NB 2O5IC 3MFGA 5EJWA 1I4XA 1FR3A 1ML0D 4ZKCB 3DWPA 1Q81C 2K01A 2HDLA 2JYOA 3NEMA 1R9TH 1N8RC 3HS0C 2HQLA 1PYSB 1A2UA 1EQVA 1EU4A 2QA4A 1HQRD 4CKEA 1N33Q 5M5YH 3S17B 1EY6A 3MC0B 3W2DA 2UXBQ 4ZRZA 1WCMH 1SYBA 1A62A 4FXKC 1UE5A 1LM0A 2TMPA 4R4QA 3VYTA 4XT3B 4QL5A 2XVSA 2B2WC 4A3EH 4LFCQ 3NBIA 3GTJH 2ENBA 4F7XA 3HEJA 2N49A 3GTPB 2B8GA 3H91A 3MXPA 3BVMA 4UP9A 1JJCB 1RD9D 4GN4B 1K73C 3GTMH 1WTPA 3OIQA 1KAWA 3E9IA 1F9RA 4POGA 4A3IB 4RG1A 2PW5A 4G7OC 3HOZH 1KNEA 1KXLA 1J9OA 4B3TQ 1SNOA 3I4NH 2WB1G 4DNIA 4XIGS 3ZJYC 1D1IA 1MBYA 2PPBC 5KNBA 3I56A 4O0AA 1Y8NB 1K0RA 3A7AB 4JI7L 2ZXRA 1EY7A 4X66Q 5JEAG 4RGTA 1QJOA 4JOIC 2B63H 3BJUA 1FNUA 1GO3E 2C35B 2PI2E 2E2HB 2R92H 1GOZA 1I3QB 3R2IA 3NPPA 4IURA 3K5NA 2KOLA 3E0JA 2JA6B 1T5XD 1CQFA 4CDDC 1B8AA 4A3JH 3TBIB 4DK0A 1BNZA 4X62Q 1B9NA 2FMCA 5CV7A 3RZDH 4R9WA 4KI0A 4PMBA 1VQHA 5LL6X 1S4ZA 1JJ2A 5GAEC 1Q1EA 2F0WA 1VQ5A 4NKLA 5D3IB 5KGUA 1KABA 4ZLTF 5L37A 2UUBL 1HZ9A 1SE4A 1YNJC 2K5WA 3CC4A 3HOXB 3VDYA 2K04A 1A8VA 3Q0AA 3OSOA 5IP7H 4AQYQ 4IUNA 2C5CA 1SYGA 3I73A 2BCOA 2CWPA 1KDCA 2EYOA 5LMNW 1YNXA 1HR0L 4C3JB 2CQAA 1Q7YC 2GA4B 4ZYSA 2JQOA 3S14B 4Y52H 2K4KA 5FLMH 2Z1CA 4OHJA 1RTNA 1VQJA 3TREA 4C56C 1SE8A 2PO4A 3TP6A 5ELOA 2CFMA 4TRDA 1EIYB 3K8AA 4DV0L 3HOWB 1IW7C 2JE6I 3NBHB 1I94Q 4ME3A 2F0IA 2KVMA 5IOCA 2YU9B 3R8BA 2A68D 1GUGA 4OONA 1RODA 1K83H 2A8VA 2XN9C 2NVTH 3KYHC 1O80A 1I4PA 2NVQH 1DJRD 3PUZA 5E4XA 1VQ7A 3PUWA 5LHY1 1GD7A 4R4TA 4CHTB 3EA6A 1VQPA 3K57A 1JMCA 1FYCA 1I4GA 1UAPA 4WJWA 2Q2IA 1TWAH 3OTOL 4G7HC 3NWTA 5GADC 3TEHB 1QB5D 3WDNA 4NMZA 2B29A 3IL8A 3FDTA 1PTOH 1AW7A 4MTKA 1H9SA 1MJCA 4NXML 3BVGA 1LLRD 2G9DA 5IGEA 2OEOA 1SR3A 4AYBE 3EROA 3CCLA 1SNQA 4LUVA 1EY5A 4JI8Q 3MAQA 1NR2A 1TR5A 2M00A 2NBFA 1VDZA 2B2YC 1WI5A 4BWGB 4ODGA 3H3VH 1P16A 3C2PA 4I7ZC 3ND8A 3MXNB 1H9SB 1TS2A 3CQZH 4NXNQ 1K8OA 3Q22A 1KLGD 3F2DA 4IFDH 4YWLA 1PH9A 1WTQA 1EY8A 1G291 3K5MA 1HNZQ 4PV1C 3DHQA 1LTTD 1VQDA 5IYDH 2Y0SE 1B1ZA 1SEBD 4DUZQ 3BDLA 1O7YA 3A54A 4DR2L 4LJZC 2KQ3A 4V190 3TP7A 4R8IA 5CV5A 5C0XH 1KRTA 3U9SA 2BE5D 4A3IG 1I6HH 1S3OA 1U4LA 2A1AA 1X3PA 4IPDA 1L0XB 3DWAA 3UE0A 4X64Q 3U9OA 1ZYRC 1PZKD 4LW1A 3VYSA 1VQMA 2RVLA 4DK3C 5ELNA 2RBMA 1JOOA 4DR3Q 3TMEA 2ZXOA 4TVAB 1CA6A 5BN3A 2JEAI 1E3PA 2B2TA 2Y0SB 2CW0C 4BY1H 5IYBH 3QR8A 1XWEA 2OQ0A 4FXGC 1LABA 2L1BA 2K52A 1L2FA 2Q8RE 2JA6G 3SK6A 1WTVA 3CRKC 4DR7L 1N32Q 1E2VA 2NUCA 1J8IA 4G4KA 1BF4A 1IYJB 3VA7A 1BO0A 2JEBI 3I2ZA 1IBKL 2NVXH 4JBWA 1F9SA 2OXPA 4YWKA 3RLFA 1AEXA 2BA0A 3BZDB 1Z9FA 4A3GH 2EXDA 2F3IA 1CKNA 2PZTA 1U0LA 3J80E 3FEWX 3A7LA 1TIID 1PFNA 4HR7B 2AMCB 3NQIA 1HNXQ 2F0VA 3HOXG 2RKSA 3GTOH 2RF4A 3WWVA 4FF4A 4C3HB 3TN2A 4FYDA 2VS1A 1BCPD 1DYQA 2CKZB 1CKNB 4IOAA 3NK9A 1HRJA 2F0KA 2N3SA 3H94A 4IUQA 5C5MA 1WYDA 3JAMc 5IIFA 5IYCH 1STBA 4BY7H 4C3JG 1VF7A 1Y1VB 4HJ7A 5K36G 1LTLA 2F3WA 1EWIA 4BBSH 4PMCA 1UNSA 1E0BA 4DR6L 1C48A 3JC66 1I4HA 3R3OA 5M5XB 4DR5L 2D5DA 5IWAQ 2VUMH 2NN6G 1SNPA 2JP1A 2A6EC 3PV0A 1NY4A 3FPUB 4IZ8A 4S3SA 3HOWG 3NHHA 3L2PA 3D8GA 3VA5A 3CAMA 1BOSA 2B2UA 4C2MB 4ULLA 5GROA 1C7YA 4A3DH 5ELDA 1Y69U 1N36Q 5BR8L 2XSCA 4V0BA 1DONA 2HHHL 4B3RL 2RSNA 4DGZA 2D2CC 3IKJA 4GN3B 4HCEA 4J8QA 1H9JA 3HOVB 2R7ZH 3K7AB 3FP9A 1GUSA 1JWMD 1JE5A 4A93H 2X6GA 3PMFA 5EBDA 1VCIA 2AUJD 3GQBA 2SNSA 4LAAA 4JW0A 4GOPB 2VY3A 2QGQA 1HUMA 1SMYD 2CH4W 5IP9H 4A3LG 3OPOA 3VYUA 3S16H 1KIXA 1XTCD 3RMHA 4CDEC 1KLUD 3BYYB 1CHPD 3CF5A 1JC7A 2NZHA 3NUCA 3SEBA 2AQ2B 2SEBD 3S1QB 3CRLC 4RGMA 1NE3A 2RCNA 4B9XA 2B3GA 4EX5A 2LXJA 2K32A 3BG3A 2UU9Q 1YJNA 1J5EQ 4FDBA 4XQQA 5T1GA 1TY2A 3M3YB 5KRUA 2RCFA 5C5LA 2PMZE 1DOLA 2OTJA 3D31A 4DK6C 1CA5A 2I0QA 1RCVD 2IX0A 1R4PB 2NVYH 1VQEA 4AYBG 2IPKD 4DV4L 4K2LA 3ZYYX 3A5ZB 4GKKQ 1B3AA 5COYA 1AN8A 3GTLB 4U673 1BR9A 3ULPA 1JJGA 2ZXPA 3FHWA 4A3KB 1FJGL 3TZDA 3T1HL 4GKJQ 3HOUB 5M3MH 1KC8C 2D0OA 1M1KC 3IRBA 2VQFQ 4EQ5A 1GJXA 2PMZB 5ELCA 2OWOA 2K05A 2DY8A 1N34L 4IUPA 1T9HA 3I4MH 4OELB 2Y0SG 4GN5A 3SK8A 4DV3Q 4JVZA 4JI4Q 1IXRA 1YHAA 4LFAL 3H0GH 5FKAC 2ZM6Q 1PTOD 5FO7B 3QO2A 4LF9L 3AB9A 3A74A 2CCZA 4KLKA 3GD7A 4ZKBB 5LMNQ 3J7AF 4GLAC 4LF6Q 2JN4A 1VQ6A 1I50H 1B3QA 4ZUJA 5C0XI 5CV9A 4JOIA 4IN3A 5E4WC 4LFBQ 5CC4A 3D0FA 1QVGA 4YCVA 1WTRA 3HZXA 1H9KA 1IL2A 1L1OA 3S1RB 2KUMA 3NTIA 4MN3A 2QEXA 2Q2TA 1ONLA 4B3MQ 4DV5Q 2A6HD 4NDXA 4U68A 5F2DA 5IODA 4DR1Q 5KNCA 3I7FA 2FXQA 2IHEA 1TXYA 3VR5A 3LX0A 4YCUA 4C3HG 5JJKA 1L1OB 3AEVA 3K5OA 2NTSA 3SVMA 2XWBB 4HSPA 2JA8H 1DM0B 4JPBW 1A6XA 1A3VA 2YTVA 1F2YA 1HR0W 1Y1VG 4MHEA 4KMUC 3KOJA 1PH4A 3PF4A 2ES2A 1Q1BA 4AIMA 1BBWA 3M4OH 2MJ8A 4IUUA 2X69A 1V1PB 5J3BA 3ULJA 1HZBA 2HQEA 4M1UB 1KNAA 2LXKA 1X9NA 3A55A 5FJ8G 1PYBA 3UDFA 4LF4L 3AFQA 3ITPA 4J15A 2KECA 1FD7D 3KLWA 3KLSA 1I4RA 4LF5Q 1NMGA 1HXYD 4B3SQ 4IPHA 1SFOH 4DV7L 5TSSA 2I46A 1W6JA 3MEFA 4LUOA 4A3MH 1SJHD 3KF8B 4OWTB 2VB2X 5JAVA 3CCQA 3D3RA 5A2QE 3EVQA 3G6JB 4O42A 4PZ7A 4HJ5A 3U4ZA 2XIWA 4JV5Q 5DAUA 4CJ2C 5AJ3L 1CKMA 3MA2B 3M4PA 2LKVA 2UXBL 2B2UC 2RDGA 3U50C 1GHKA 4Z9CB 1WTOA 2EOTA 2IT1A 4FF3A 4TKOB 3RZOB 4LFCL 3F2CA 5C4ZA 4YHHQ 4GOPC 1ILPA 1XPUA 1GKHA 5KYLA 2Z8LA 2E2JB 1WD0A 3NQTA 2UUAQ 1N9WA 1JWUD 1E1TA 1J6QA 2SOBA 1OXSC 2ASBA 1SLJA 3NELA 3CCMA 1IBML 1JOQA 1YNND 2CWAA 3HKZE 4DAPA 2N55A 4HEDA 5LL6S 1S72A 4B3TL 3R2TA 2B2YA 4X6AH 3QOJA 2MHVA 2PZWA 1SDFA 4RHSA 2A69C 3K81C 5C4XB 2QF7A 4GNXB 4JC0A 3LWEA 4X66L 4KHPL 2BA1A 4UPAA 4BXXG 2OTLA 3OMGA 1B2TA 2TSSA 1EWHA 4KTAA 3K58A 2WACA 4A3KG 3CKIB 3MXGA 2IY5B 1V1OA 2K5DA 3HOUG 1RTOA 1EZ8A 1CSQA 3HKZB 3P7JA 5GAHC 1O7ZA 4K2KA 3C3LA 4X62L 5D65A 1PDQA 4JI6Q 1EEFD 4JI2Q 3D4WA 4KV6A 2F0TA 1RDPD 4DU9A 1RHPA 2XNAC 1SMXA 2UXDQ 2DNEA 1VQ8A 2K75A 3DUZA 4ABNA 3A56A 2H5XA 1HFNA 1JOKA 3GTQH 1KRSA 1B44D 1QILA 1IYUA 2WAQE 2XRSD 4HSVA 4L8JA 2VZAA 3S1MB 4JI5L 3NTKA 3H09A 1V9PA 1X56A 4K5XA 5C44H 4JI0L 3GTGB 4WJ3M 2Z6BA 2E2IH 2WP8J 1B50A 1CUKA 4N8X1 1NAPA 2D62A 3D4RA 5DM73 4CDFC 2VQEQ 3HP3A 2KJXA 3CMEA 4ALPA 2OQKA 3B6YA 2DJGC 4H13C 5D14A 4N8FA 2QDBA 5A35A 5J22A 2KEDA 3DEOA 3GDEA 4DV6Q 4L5SA 5M5WH 2R93H 4BS9A 2NZOA 2HT1A 2E5LQ 4LF8L 1L1OC 4RKBA 2Z4HA 4C3IB 3FMCA 4DNTB 2F0NA 4IFDJ 1VS0A 4JBJA 3V96A 3L7ZC 1Z6HA 4A4IA 1E2ZA 1HNWQ 1B4OA 1LO5D 1K28A 1LTID 4DR4L 2PI2A 3QB3A 1HFGA 1Y8PB 1NUCA 4P2CB 1DZ1A 1IBLL 4QQBX 4IALA 3HRZC 2I5LX 3PO2H 1GUOA 5EPKA 4FXDA 5E1FA 1YVCA 3RLOA 2E2DC 1AFPA 1ENAA 3J81E 4N9PA 1F2LA 3W5OA 3PO3H 3S2HH 1JT8A 1JR0D 1S5FD 5J39A 4X65L 1CM9A 1XPRA 1GHJA 1VQ4A 4A3CH 2HIVA 4JI8L 3TZUA 4FF2A 1XMOL 5EKKA 4Y7NB 3LNNA 4O2DA 3NBHA 4IO9A 3ULLA 5KIXA 3OW7A 1U9RA 1VQAA 2J0TD 1EY4A 1ILQA 2A74C 3HOYH 2VW9A 1STNA 1VMPA 5M3FH 1ET6A 1EUJA 2SDFA 1XNRQ 1ESFA 4ZCKA 1A3TA 3HG9A 4L5QA 1VQKA 2QKIC 4K5WA 5M5YB 4K0KL 2Z6KC 3I4MG 3G4SA 3ICEA 1WCMB 2L55A 4XT1B 2MNAA 4JI7Q 2ICEC 4JBKA 2ICIA 5C3EH 2WIIB 1Z7TA 3GTJB 4RGNA 1SYCA 4HIKA 5C4XG
chains in the Genus database with same CATH topology
2AUKA 1QNUA 1BCPB 2EDGA 3R93A 2JXMB 4KKTA 2NZ1D 1QE6A 3GTMB 4RHRA 3TP8A 3MXNA 4C1NK 1BUVT 1LTGD 2KHSA 1QCBD 3BVZA 1DOMA 1RJTA 3HOZB 3Q6SA 2QEJC 2B2VC 2F0GA 3QIAA 3E5SA 5CORA 3C46A 5I6WA 2F0PA 5CMDA 4K8IA 3J80L 1NSNS 1F2MA 1ENFA 3AMUA 2DY7A 4G57A 2B63B 1O78A 2EY5A 3NXWA 2IX3A 5AFWA 4WORA 2R92B 4HN7A 2EYHA 4I65A 4E6IA 2PYKA 2NWGA 1D2BA 4J1MA 1NR4A 4AYBB 3N52A 4A3JB 2A68C 2EYPA 2QCPX 3SDZA 3RZDB 2F1MA 3I3CA 1Q8IA 2PZUA 5FLXL 1EQTA 4O1NA 1VF5C 2K03A 5JVG3 2NN6I 1H9MA 1BCPF 1I6VC 3T56B 4XYOA 4F8MA 4C3IG 1IKMA 1S5DD 5KYIA 1X3QA 4F87A 4EQOA 2I07B 3A8IE 3W3AA 1II3A 3GV3A 1LTBD 1TY0A 1Y8OB 3NSWA 5FO8B 1K83B 3VR4A 2F0OA 2NVTB 2NVQB 1WD1A 1BXTA 2R61A 3C1EA 5C4HA 1B53A 4RGOS 4EQPA 4F88A 1T5EA 5CBAE 1TWAB 2M9VA 2E75C 2EZVA 3T16A 2VNUD 1ZKOA 1KTKA 1JICA 1PTOB 4RH6A 4UDUC 1EL0A 4DFAA 5CV4A 1HCZA 2EY2A 1STYA 1MSHA 2B8FA 2R6GA 1MI2A 3CQZB 3OOCA 3T53B 5EQ0A 5CR3A 5I2XA 3DM1A 4RAUC 2ID0A 2E76C 1CHQD 1UUPA 2L11A 1KAAA 1PYWD 1ICWA 4YIJA 5JEAH 1I6HB 4MIUA 1BCPC 2FINB 1MSGA 3NP8A 3O13A 1JWSD 1EYDA 3SHLA 4OO1I 2E74C 1G6ZA 1PRTD 5IT9L 5EPLA 4BY1B 2EJFC 3BYTB 1AZPA 1LT5D 1JORA 5EBCA 1AZQA 5T1IA 2EE1A 1PTOF 4QUCA 2LY7A 1OXTA 5FK9C 1D5XC 2MGSA 3P1HA 2NTTA 2NVXB 1CK1A 3MTSA 4A3GB 4K14A 2K28A 1O7LA 4X3UA 2WKDA 1LTRD 4KY5A 1IYVA 2F0UA 3GTOB 4K5VA 2PNRC 1LT6D 1FGBD 3BDOA 1SMYC 3KLSX 5G3LD 5I9OA 3GP7A 3T51B 1STAA 2IJ0A 4K6LA 3E6ZX 4ZK9B 2JSOA 3I8ZA 1HPCA 4TSSA 1G8ZD 3DEPA 2VUMB 2PQEA 4PMWA 1D6EC 2PCFB 1LTSD 4A3DB 2G9HD 3JAME 2EJMA 5JPMC 1PXUA 5JJZA 1V1PA 3EQLC 2R7ZB 4A93B 2F4IA 2O5JC 4DN4M 4DXGA 4RFBA 4KJNA 1ENCA 4RKLA 2O4XA 5FO9B 4EQNA 1HTPA 3A8JE 3S16B 1SNCA 2FHTA 4OIJA 1HTLD 2IL8A 1JQYD 2EYLA 3SE0A 3KF8A 1CI3M 1PTOC 2R3ZA 1SJED 1EYCA 5J1ZA 4OGQC 2AWOA 4KD4A 3IFTA 1EFID 1EOTA 4IFDG 3H3VC 4KN4C 1A15A 4QB4A 4PNYA 1KDAA 2NVYB 4HTHA 1XX8A 5K5PA 2N88A 1JCKB 5EKLA 1S5ED 2H1EA 2OT2A 2F0DA 3SK5A 5CGKA 1RKNA 2A6HC 1TQOA 2KCCA 5C0XG 1MD2D 3AU7A 3FVQA 1SNMA 3HGBA 4ME5A 3M85A 1SYEA 3RUZA 5M3MB 2F0FA 3FPPA 3I4MB 4DK1A 1PZJD 4RA8A 5DM63 2Q8TA 4ZAIA 3UI2A 2KCNA 2YYZA 2L5TA 3SXHA 5I4DA 2B2VA 1JB3A 1X32A 3H0GB 1F9PA 2AQ1B 1TS3A 3MHBA 3PUVA 1I50B 4QUFA 1SYDA 3OMCA 3A8KE 5CV6A 4KN7C 2F0EA 2CVRA 2EVBA 3N6RA 1XXGA 2F0LA 5IGGA 1UEAB 3V2TA 5HURA 2PW7A 4ID6A 2B39A 1U4RA 4KJOA 2RA4A 5K36H 1EIGA 1SYFA 2D9UA 4DXFA 3J81L 1IHZA 3S9WA 2JA8B 2NN6H 3I91A 2DNCA 4N9TA 1DCZA 3M4OB 1EY9A 5DEHA 3SK4A 4B08A 4BA1I 4HCSA 1YNNC 4HMIA 4ZUIA 1YNJD 1SFOB 3VR3A 4DAYA 4A3MB 4B9WA 3QJYA 4K6DA 3M4YA 4CKCA 2WAQB 5HGTA 1M4VA 1QWYA 2BDNA 4J6HA 5C6AA 4H0LC 1U4MA 1IW7D 1SE2A 2AQ3B 5C0XJ 1JE4A 2L9HA 4KY6A 5E3FA 2NYZD 4NW2A 1F2ZA 1EIHA 5NUCA 2H4OA 1BDOA 2HDMA 3BS1A 3KLRA 2RDHA 5JOBA 2WKCA 2HCIA 1PFMA 3PIP3 1LT4D 4KK7A 5FOBB 2V4DA 2VXWA 3KBXA 1R9TB 5CYUA 3I70A 1HQMC 4H7BA 3TP5A 3J7YW 2Q8IB 3KUPA 4OO1H 2FFKB 5EGTA 2ZT9C 4H44C 1OXVA 3D6WA 1Z47A 5IGCA 4A3EB 3G7LA 4FO2A 2J7ZA 1A3UA 2LMCB 3LWUA 3MFYA 1HHVA 4WRDA 3GTQB 1XYIA 3X3MA 4OIKA 2WV6D 5C3XA 1CZGA 1ZYRD 5C44B 3I4NB 1U4PA 2A73B 2E2IB 1SSOA 4TQUS 4XQNA 3P20A 4CGYB 4KHZA 1EU3A 3CU7A 3BDCA 2EY6A 2CW0D 4IUTA 1EWCA 4LMQD 3WOEA 4KD3A 2XRQD 5M5WB 2R93B 1Q3LA 3ONAB 3WOFA 4EGVA 2EXZA 3GV6A 4HMJA 2F03A 1F9QA 1FNVA 2EYMA 1WTWA 4XTCS 1D5MC 1ET9A 3DXJC 3OWFA 3TDQA 1HA6A 4X3SA 2C9OA 4LK1C 3PO2B 3I4LA 3ERQA 4WFN3 1CTMA 1DOKA 1DXMA 3PO3B 5JEAJ 3S2HB 4QF4A 3Q24A 4CBVA 4KY7A 4CJ1B 1GUTA 2F0SA 1D5ZC 1L0YB 2RDFA 3RD4A 1IL8A 2RQXA 4L6TB 2K7VA 1PRTB 2K6AA 1RF2D 1S5CD 1TS4A 2A6ED 3HOYB 5M3FB 3T4AC 3K6OA 3H6MA 1TS5A 3VYRA 2EJGC 3KBGA 4JK1C 2F0MA 2KA7A 3M7GA 4L63B 2AWNA 5C3WA 1IKLA 2IW3A 2Z4IA 2EYJA 5C3EB 2BE5C 5I6YA 5EPJA 1B9MA 1V43A 2BOSA 3D6CA 3D4DA 4KHVA 1FNWA 4FNFA 2J4XA 2M2LA 3NWSA 4M8AA 2MUYA 1ZEQX 5DNFA 4A3BB 1AP0A 4RWSC 1NCVA 1GUNA 2F3VA 1QG7A 3DMUA 1TKWB 1HA5A 3NE5B 5IGFA 3VR6A 5CV8A 1D1KA 3S15B 5KEEA 1PZID 1PRTF 1A2TA 5JPNC 2IWHA 1TWCB 5FLXE 4GZYC 1C4QA 2A5HA 5ELFA 2SNMA 3I90A 4FF1A 3IFDA 4XQJA 1Y1WB 2KEEA 2HUGA 4C1NI 1OXXK 4BA2I 1H9RA 3P75A 3VR2A 1EY0A 1KDBA 2WINB 3OHXC 4IQZA 1QNKA 3C1FA 4DA2A 2L0CA 4X3KA 1PLFA 2JA7B 2K1BA 1W6KA 5I9PA 5C4JB 1SNDA 2F0HA 1STEA 5JVH3 3OWEB 3K5LA 3JAML 3MZ5A 5D3DA 3K59A 1PMRA 1WTXA 5G3LF 4BBRB 3T13A 1I4QA 3FKIB 1Q90A 1SE3A 3FRPB 3SR1A 3L3OC 5EKIA 1LT3D 2NB0A 1TU2B 1G2SA 5BN4A 4NP5A 4QMGA 3QG1A 1E2WA 2EY1A 1TWHB 2LS01 4HAEA 2JA5B 2O2LD 3GO5A 3L9AX 4IUVA 1BBXC 4RCOA 4CJ0B 3OIPA 3DWQA 3V05A 2B2WA 1PFBA 1SXTA 1STGA 5ISRA 4BY7B 3CHBD 4Q0FA 5A2QL 4BBSB 1Q12A 2L12A 3ND9A 1TWFB 1SAPA 4OL7A 3X3NA 4IFDI 1PRTC 5M9OA 2RSOA 1SBBB 3MVVA 3M7NA 3EFXD 3KK7A 2HCCA 5IGBA 1GUWA 4DAVA 4ILWA 4OO1G 2X6LA 2EPBA 1GXDC 2LFNA 3MXUA 3TSSA 3EJIA 1LACA 3Q23A 3K0YA 2B2TC 1LTAD 3S2DB 1CQVA 2MP1A 2XWJB 3QOLA 4DNRB 2WB1B 4EVOA 1ESRA 5IT9E 3MWYW 2VB3X 4X3TA 1S5BD 1EYAA 4A3FB 3F2UA 1F77A 5ELBA 1OO9B 2BDOA 5BN5A 1TVXA 3MEHA 4XXEA 3GTKB 1G2TA 3QWNA 3J7AV 1TWGB 4DF7A 3PUXA 1TT2A 4G7ZC 1C8CA 2MPMA 3PIO3 2A69D 2F0QA 1BQQT 4RCNA 2CHBD 2DN8A 4KKUA 1CFMA 1LV9A 4XDXA 1MGSA 4QIWB 4ZQ3A 2K5QA 1R4QB 5CBEE 1G91A 4R8NA 1EEID 2FJ2A 1WVLA 2EYFA 1DD2A 4FVMA 4FP5D 2IX1A 3NTHA 4KKSA 1V8QA 1M8AA 5IGDA 1OXUA 3PUYA 4UAIA 3IAYA 1STHA 4PQXA 5KNDA 2OF1A 3URYA 4Q5VA 1QOHA 4K8JA 2QILA 1CT1D 1VMCA 5ELEA 4XYQA 2F0JA 2FMMA 4QCLA 5I2YA 1CZWA 4CKBA 2K33A 1ZXTA 2L4NA 1HUNA 3I72A 1K8MA 1EZ6A 3S1NB 2O5IC 3MFGA 5EJWA 1I4XA 1FR3A 1ML0D 4ZKCB 3DWPA 2K01A 2HDLA 2JYOA 3HS0C 1A2UA 1EQVA 1EU4A 1HQRD 4CKEA 3S17B 1EY6A 3MC0B 3W2DA 4ZRZA 1SYBA 4FXKC 2TMPA 3VYTA 4XT3B 2XVSA 2B2WC 3NBIA 2ENBA 4F7XA 3HEJA 3GTPB 2B8GA 3H91A 3MXPA 3BVMA 1RD9D 1WTPA 3OIQA 1F9RA 4A3IB 2PW5A 4G7OC 1KNEA 1J9OA 1SNOA 4XIGS 1D1IA 1MBYA 2PPBC 5KNBA 1Y8NB 3A7AB 2ZXRA 1EY7A 5JEAG 4RGTA 1QJOA 1FNUA 2E2HB 1GOZA 1I3QB 3R2IA 3NPPA 4IURA 3K5NA 2KOLA 3E0JA 2JA6B 1T5XD 1CQFA 3TBIB 4DK0A 1BNZA 1B9NA 2FMCA 5CV7A 4R9WA 4KI0A 4PMBA 5LL6X 1S4ZA 1Q1EA 2F0WA 4NKLA 5D3IB 5KGUA 1KABA 4ZLTF 1SE4A 1YNJC 2K5WA 3HOXB 2K04A 3Q0AA 3OSOA 4IUNA 2C5CA 1SYGA 3I73A 2BCOA 2EYOA 1KDCA 4C3JB 2CQAA 2GA4B 4ZYSA 3S14B 2Z1CA 4OHJA 1RTNA 4C56C 2PO4A 3TP6A 4TRDA 3HOWB 1IW7C 2JE6I 2F0IA 2KVMA 5IOCA 2YU9B 3R8BA 2A68D 1GUGA 1RODA 2XN9C 1O80A 1I4PA 1DJRD 3PUZA 5E4XA 3PUWA 5LHY1 4CHTB 3EA6A 3K57A 1FYCA 1I4GA 1UAPA 4WJWA 4G7HC 3NWTA 1QB5D 3WDNA 4NMZA 3IL8A 3FDTA 1PTOH 1AW7A 1H9SA 3BVGA 1LLRD 2G9DA 5IGEA 2OEOA 3EROA 1SNQA 1EY5A 3MAQA 1NR2A 1TR5A 2M00A 2NBFA 1VDZA 2B2YC 4BWGB 4ODGA 3C2PA 4I7ZC 3ND8A 1H9SB 1TS2A 1K8OA 3Q22A 1KLGD 4IFDH 1WTQA 1EY8A 1G291 3K5MA 4PV1C 3DHQA 1LTTD 1B1ZA 1SEBD 3BDLA 1O7YA 3A54A 4LJZC 2KQ3A 4V190 3TP7A 4R8IA 5CV5A 5C0XH 3U9SA 2BE5D 1U4LA 1X3PA 1L0XB 3DWAA 3U9OA 1ZYRC 1PZKD 3VYSA 2RVLA 2RBMA 1JOOA 3TMEA 2ZXOA 1CA6A 5BN3A 2JEAI 2B2TA 2Y0SB 2CW0C 1XWEA 4FXGC 1LABA 2L1BA 2Q8RE 3SK6A 1WTVA 3CRKC 1E2VA 2NUCA 1J8IA 4G4KA 1BF4A 3VA7A 1BO0A 2JEBI 4JBWA 1F9SA 2OXPA 3RLFA 1AEXA 2BA0A 3BZDB 2PZTA 3J80E 3FEWX 3A7LA 1TIID 1PFNA 4HR7B 3NQIA 2F0VA 2RKSA 4FF4A 4C3HB 3TN2A 4FYDA 1BCPD 1DYQA 3NK9A 1HRJA 2F0KA 3H94A 4IUQA 5C5MA 5IIFA 1STBA 4C3JG 1VF7A 1Y1VB 5K36G 2F3WA 4PMCA 1UNSA 1E0BA 1C48A 1I4HA 3R3OA 5M5XB 2D5DA 2NN6G 1SNPA 2JP1A 2A6EC 3PV0A 3FPUB 4IZ8A 4S3SA 3NHHA 3D8GA 3VA5A 1BOSA 2B2UA 4C2MB 4ULLA 5ELDA 1Y69U 2XSCA 4V0BA 1DONA 2RSNA 4DGZA 2D2CC 3IKJA 4HCEA 4J8QA 1H9JA 3HOVB 3K7AB 1GUSA 1JWMD 2X6GA 3PMFA 5EBDA 1VCIA 2AUJD 3GQBA 2SNSA 4LAAA 1HUMA 1SMYD 3OPOA 3VYUA 1XTCD 3RMHA 1KLUD 3BYYB 1CHPD 1JC7A 3NUCA 3SEBA 2AQ2B 2SEBD 3S1QB 3CRLC 4RGMA 4B9XA 3BG3A 2K32A 4XQQA 5T1GA 1TY2A 3M3YB 5KRUA 5C5LA 1DOLA 3D31A 1CA5A 1RCVD 2IX0A 1R4PB 2IPKD 4K2LA 3ZYYX 1B3AA 5COYA 1AN8A 3GTLB 4U673 1BR9A 2ZXPA 4A3KB 3TZDA 3HOUB 1GJXA 2PMZB 5ELCA 2K05A 2DY8A 4IUPA 3SK8A 5FKAC 1PTOD 5FO7B 3QO2A 3AB9A 3GD7A 4ZKBB 3J7AF 4ZUJA 5C0XI 5CV9A 4IN3A 5E4WC 5CC4A 1WTRA 3HZXA 1H9KA 3S1RB 2KUMA 3NTIA 4MN3A 1ONLA 2A6HD 4NDXA 4U68A 5F2DA 5IODA 5KNCA 3VR5A 3LX0A 4C3HG 3K5OA 2NTSA 3SVMA 2XWBB 4HSPA 1DM0B 1A6XA 1A3VA 1F2YA 4MHEA 4KMUC 1Q1BA 2MJ8A 4IUUA 2X69A 1V1PB 2HQEA 4M1UB 1KNAA 3A55A 3ITPA 2KECA 1FD7D 3KLSA 1I4RA 1HXYD 5TSSA 2I46A 1W6JA 1SJHD 2VB2X 5JAVA 3D3RA 5A2QE 3EVQA 3G6JB 4O42A 2XIWA 5DAUA 4CJ2C 3MA2B 2LKVA 2B2UC 2RDGA 1GHKA 4Z9CB 1WTOA 2EOTA 2IT1A 4FF3A 4TKOB 3RZOB 5C4ZA 1ILPA 5KYLA 2Z8LA 2E2JB 1WD0A 3NQTA 1JWUD 2SOBA 1OXSC 1JOQA 1YNND 4DAPA 2N55A 4HEDA 5LL6S 3R2TA 2B2YA 3QOJA 2MHVA 2PZWA 1SDFA 4RHSA 2A69C 5C4XB 2QF7A 3LWEA 2BA1A 3OMGA 1B2TA 2TSSA 1EWHA 4KTAA 3K58A 2WACA 3CKIB 3MXGA 1V1OA 2K5DA 1RTOA 1EZ8A 3HKZB 3P7JA 1O7ZA 4K2KA 3C3LA 5D65A 1PDQA 1EEFD 3D4WA 4KV6A 2F0TA 1RDPD 4DU9A 1RHPA 2XNAC 2DNEA 3DUZA 4ABNA 3A56A 1HFNA 1JOKA 1B44D 1QILA 1IYUA 2XRSD 4HSVA 4L8JA 3S1MB 3NTKA 3H09A 4K5XA 3GTGB 2WP8J 1B50A 1NAPA 2D62A 3D4RA 5DM73 3HP3A 2KJXA 4H13C 5D14A 2QDBA 5A35A 5J22A 2KEDA 3DEOA 4BS9A 4RKBA 2Z4HA 4C3IB 3FMCA 4DNTB 2F0NA 4IFDJ 3V96A 3L7ZC 1Z6HA 1E2ZA 1B4OA 1LO5D 1LTID 3QB3A 1HFGA 1Y8PB 1NUCA 4P2CB 1DZ1A 4IALA 3HRZC 1GUOA 5EPKA 4FXDA 5E1FA 2E2DC 1AFPA 1ENAA 3J81E 4N9PA 1F2LA 1JR0D 1S5FD 5J39A 1CM9A 1GHJA 3TZUA 4FF2A 5EKKA 4Y7NB 3LNNA 3NBHA 5KIXA 3OW7A 1U9RA 2J0TD 1EY4A 1ILQA 2A74C 1STNA 1VMPA 1ET6A 2SDFA 1ESFA 1A3TA 3HG9A 2QKIC 4K5WA 5M5YB 1WCMB 2L55A 4XT1B 2ICEC 2ICIA 2WIIB 1Z7TA 3GTJB 4RGNA 1SYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LKV A;  3EJI A;  5CV7 A;  3R3O A;  3C1F A;  4K8J A;  3P1H A;  3SK8 A;  4N9T A;  2F0J A;  1EYC A;  2F0O A;  4PMB A;  1SNP A;  4H7B A;  3QOL A;  3TP5 A;  4S3S A;  4IZ8 A;  1EY8 A;  3TP8 A;  4EVO A;  2F0W A;  3NHH A;  1EY9 A;  4NKL A;  2QDB A;  2KHS A;  3DHQ A;  5DEH A;  3D8G A;  5J1Z A;  3C1E A;  1SND A;  5EGT A;  5C4H A;  4KD4 A;  5J22 A;  3SK4 A;  3VA5 A;  5C4Z A;  2F0H A;  4EQP A;  5KGU A;  1EYA A;  1KAB A;  3BDL A;  4K14 A;  5IOD A;  2F0G A;  3MZ5 A;  5KYL A;  3E5S A;  4RKB A;  5IGC A;  4QB4 A;  2KQ3 A;  1EZ6 A;  3TP7 A;  3H6M A;  3NQT A;  4ZUJ A;  2F0N A;  4HMI A;  3OSO A;  4PNY A;  5CV5 A;  5CV9 A;  4ZUI A;  1KDA A;  4HTH A;  5I6W A;  2SOB A;  2F0P A;  4KY5 A;  3T16 A;  5K5P A;  4DGZ A;  5EKL A;  4IUN A;  4K8I A;  2F0U A;  5CC4 A;  3T13 A;  1JOQ A;  2F0D A;  1A3U A;  1NSN S;  1F2M A;  1SYG A;  4K5V A;  3SK5 A;  5CGK A;  1RKN A;  3QB3 A;  4G57 A;  2EYO A;  3HZX A;  1KDC A;  1TQO A;  3MEH A;  4WRD A;  3U9O A;  1NUC A;  3QOJ A;  2F0M A;  1A2U A;  1EQV A;  1SNM A;  5CV4 A;  2EY5 A;  4DFA A;  3NXW A;  4B9W A;  4IAL A;  2PZW A;  4K6D A;  2RBM A;  1EY6 A;  4WOR A;  4ME5 A;  3SR1 A;  3PMF A;  1JOO A;  5E1F A;  5I9O A;  4NDX A;  2EYH A;  5F2D A;  5C3W A;  4I65 A;  5C3X A;  1SYE A;  1ENA A;  1STA A;  2SNS A;  4LAA A;  4N9P A;  3RUZ A;  3TME A;  2PYK A;  4DF7 A;  2EY2 A;  1SYB A;  2EYJ A;  5HGT A;  1STY A;  4J1M A;  3TP6 A;  5I6Y A;  1TT2 A;  3LX0 A;  4TRD A;  5J39 A;  4J6H A;  2EYP A;  2F0Q A;  4NP5 A;  4QMG A;  5C6A A;  3D6C A;  2F0F A;  3D4D A;  4KHV A;  3OMG A;  2EY1 A;  2ENB A;  4KTA A;  3NUC A;  2WAC A;  2F0I A;  2EY6 A;  3BDC A;  3HEJ A;  1A3V A;  4E6I A;  4F7X A;  5IOC A;  3SK6 A;  1F2Y A;  5CR3 A;  3MXP A;  1EZ8 A;  3SXH A;  2PQE A;  4ZQ3 A;  2NUC A;  5EKK A;  4B9X A;  2PZU A;  4KD3 A;  2F3V A;  4K2K A;  5KIX A;  2OXP A;  3DMU A;  2PW5 A;  1AEX A;  1STG A;  3MHB A;  5ISR A;  5IGF A;  1U9R A;  2HQE A;  3D4W A;  2EXZ A;  4KV6 A;  5CV8 A;  2F0T A;  5C5L A;  5KRU A;  4HMJ A;  4KY6 A;  4R8N A;  4DU9 A;  5E3F A;  1SNO A;  1SYD A;  1EY4 A;  3OMC A;  2PZT A;  1STN A;  2EYF A;  2EYM A;  1KAA A;  5CV6 A;  5KEE A;  4YIJ A;  5I9P A;  4MIU A;  2F0E A;  3OWF A;  3ITP A;  1A3T A;  4OL7 A;  1A2T A;  4F8M A;  1F2Z A;  2F0L A;  3NP8 A;  2F0V A;  4NMZ A;  2RKS A;  5IGG A;  5M9O A;  1EY7 A;  1EYD A;  4K2L A;  3MVV A;  5NUC A;  3SHL A;  5IGD A;  1JOK A;  4K5W A;  3V2T A;  5HUR A;  2PW7 A;  3ERQ A;  5KYI A;  4ID6 A;  4KJO A;  5IGE A;  2OEO A;  3NK9 A;  2SNM A;  5IGB A;  3ERO A;  1SNQ A;  4EQO A;  1EY5 A;  2F0K A;  1SYF A;  5JAV A;  4QF4 A;  4KJN A;  1ENC A;  1TR5 A;  2M00 A;  4KY7 A;  5C5M A;  4RKL A;  2O4X A;  5IIF A;  1STB A;  1IHZ A;  3EVQ A;  4EQN A;  1STH A;  1SNC A;  1JOR A;  4ODG A;  4K5X A;  2OF1 A;  5JOB A;  1II3 A;  2F0S A;  3P75 A;  3S9W A;  5DAU A;  2EYL A;  2RDF A;  1EY0 A;  1SYC A;  2F3W A;  1KDB A;  4PMC A; 
#chains in the Genus database with same CATH topology
 3AFP A;  2AUK A;  1QNU A;  1BCP B;  2EDG A;  3R93 A;  2JXM B;  4KKT A;  2NZ1 D;  1QE6 A;  3GTM B;  4RHR A;  5FLX c;  3TP8 A;  4A3B H;  3MXN A;  4C1N K;  1BUV T;  1LTG D;  2KHS A;  1QCB D;  3BVZ A;  1DOM A;  4GNX C;  1RJT A;  3HOZ B;  3Q6S A;  2KHJ A;  2QEJ C;  2B2V C;  2F0G A;  3QIA A;  3E5S A;  5COR A;  4AH6 A;  1HZA A;  3HKZ G;  3C46 A;  3EN2 A;  5I6W A;  2F4V Q;  4JI1 L;  2F0P A;  5CMD A;  4K8I A;  3S15 H;  3J80 L;  1NSN S;  1F2M A;  1ENF A;  1VQC A;  3M9B A;  2DY7 A;  3AMU A;  4G57 A;  4WJ4 A;  2B63 B;  2ATW A;  1O78 A;  4JBM A;  1TWC H;  2EY5 A;  3NXW A;  2IX3 A;  5AFW A;  2KBN A;  4WOR A;  2R92 B;  4HN7 A;  3UDG A;  2EYH A;  4I65 A;  4E6I A;  1Q8K A;  2GN5 A;  1HNX L;  2PYK A;  2NWG A;  1HR0 Q;  1D2B A;  4J1M A;  1Y1W H;  1NR4 A;  4AYB B;  3N52 A;  4A3J B;  2A68 C;  2EYP A;  2QCP X;  3HFZ B;  3SDZ A;  4P71 A;  3RZD B;  2QW7 A;  1AE3 A;  2F1M A;  3I3C A;  4MTN A;  3T1Y L;  1Q8I A;  2BH8 A;  1Q46 A;  2PZU A;  5FLX L;  1EQT A;  4DV0 Q;  1PH1 A;  2JA7 H;  4O1N A;  3DM3 A;  3I4O A;  4LUZ A;  5C4J H;  5E7N A;  3RLN A;  1VF5 C;  2K03 A;  5JVG 3;  2NN6 I;  1H9M A;  2OCE A;  1BCP F;  4GLV B;  1I6V C;  4OX9 L;  4DUY Q;  1EYG A;  2BH2 A;  3T56 B;  4XYO A;  4BBR H;  4F8M A;  3F2B A;  4IJH A;  3FKI H;  1N36 L;  4C3I G;  1IKM A;  1S5D D;  5KYI A;  1B70 B;  1HJP A;  1X3Q A;  4F87 A;  4EQO A;  2I07 B;  4JI3 L;  3A8I E;  3W3A A;  3CPW A;  5GAG C;  4NXM Q;  1II3 A;  3GV3 A;  2KEN A;  1LTB D;  1ICF B;  3RNU A;  1UE7 A;  1TY0 A;  1Y8O B;  3NSW A;  5FO8 B;  5IY0 A;  2JA5 H;  1TWH H;  1MIU A;  1K83 B;  3VR4 A;  3RN5 A;  2F0O A;  2NVT B;  2NVQ B;  1WD1 A;  3J80 i;  4YWM A;  1BXT A;  1WTH A;  3TS2 A;  1PA6 A;  2R61 A;  3C1E A;  5C4H A;  4POF A;  3CCV A;  1B53 A;  4RGO S;  4EQP A;  4F88 A;  2GVA A;  1VQF A;  1T5E A;  5CBA E;  4HIM A;  1XMQ Q;  1TWA B;  2M9V A;  3CCJ A;  2E75 C;  2EZV A;  3T16 A;  2VNU D;  2K14 A;  1TWF H;  1ZKO A;  1KTK A;  3CP0 A;  1JB7 A;  1JIC A;  1PTO B;  4DR2 Q;  4RH6 A;  4UDU C;  1EL0 A;  4DFA A;  2N78 A;  5CV4 A;  2UUC L;  5IT9 c;  1YBY A;  1HCZ A;  2EY2 A;  1QVC A;  1STY A;  1MSH A;  2B8F A;  2R6G A;  4JYA Q;  3BZC A;  5LMU L;  1MI2 A;  1WCM G;  3CQZ B;  1YHB A;  3OOC A;  3PQI A;  4GOP A;  3T53 B;  1M90 C;  5EQ0 A;  4DAM A;  5CR3 A;  4A3E G;  3S2D H;  5I2X A;  3DM1 A;  4RAU C;  2ID0 A;  4DV1 Q;  1YJW A;  2E76 C;  1CHQ D;  4DR7 Q;  4A76 A;  1UUP A;  4A3F H;  2L11 A;  2ZM6 L;  1KAA A;  1PYW D;  1ICW A;  4YIJ A;  5JEA H;  1IBK Q;  4OWX B;  1I6H B;  4MIU A;  3HOZ G;  1BCP C;  2FIN B;  1MSG A;  1MKH A;  3I4N G;  3NP8 A;  3O13 A;  1JWS D;  1SRO A;  1EYD A;  3SHL A;  4OO1 I;  1EOV A;  2E74 C;  2AHO B;  3GTK H;  2XTI A;  3ERS X;  1G6Z A;  2A19 A;  1PRT D;  5IT9 L;  2PQA B;  3K80 C;  5EPL A;  2B63 G;  4BY1 B;  2EJF C;  1TWG H;  3BYT B;  3CW2 C;  3E3X A;  1LT5 D;  1AZP A;  1JOR A;  5EBC A;  1AZQ A;  5T1I A;  1YJ9 A;  2EE1 A;  1PTO F;  2R92 G;  1I5F A;  4QUC A;  4B3M L;  2UXC Q;  2LY7 A;  4UP7 A;  3ER0 A;  4DR1 L;  1OXT A;  5FK9 C;  1LYL A;  1D5X C;  1V1Q A;  2MGS A;  3P1H A;  4A3J G;  2NTT A;  2NVX B;  2L15 A;  1CK1 A;  4P73 A;  3MTS A;  1UEB A;  4A3G B;  4LWC A;  4K14 A;  2K28 A;  1O7L A;  3CPF A;  4X3U A;  4LF7 L;  3G48 A;  2WKD A;  3CCS A;  1LTR D;  4KY5 A;  4QY7 A;  1IYV A;  2F0U A;  3GTO B;  4PG3 A;  3EBE A;  3AQQ A;  4K5V A;  1EQQ A;  2PNR C;  1LT6 D;  5BR8 Q;  2Z0S A;  4DPG A;  5IP7 G;  1A0I A;  1NMF A;  1FGB D;  1NJI C;  2HHH Q;  3BDO A;  1SMY C;  3KLS X;  3RZO H;  5G3L D;  5I9O A;  3GP7 A;  3T51 B;  1STA A;  4LF5 L;  2IJ0 A;  4K6L A;  3E6Z X;  4YCW A;  4ZK9 B;  5FLM G;  2JSO A;  3STB D;  2MO0 A;  3I8Z A;  1HPC A;  1Y14 B;  4TSS A;  1G8Z D;  2KCM A;  2V1C C;  2WB1 E;  3DEP A;  2VUM B;  3CXC A;  3PIO A;  2PQE A;  4PMW A;  1D6E C;  1A63 A;  3F1Z A;  2PCF B;  4JV5 L;  3KJO A;  1LTS D;  4A3D B;  2G9H D;  3JAM E;  2EJM A;  4JG2 A;  1XJV A;  5JPM C;  1PXU A;  3S1N H;  5JJZ A;  1V1P A;  2DJF C;  3EQL C;  3Q8D A;  2PNH A;  3S24 A;  2R7Z B;  1KL9 A;  1NTG A;  4A93 B;  4NPS A;  2F4I A;  2O5J C;  1VQB A;  4DN4 M;  4DXG A;  4RFB A;  3S17 H;  4KJN A;  1ENC A;  2KHI A;  4RKL A;  2O4X A;  5FO9 B;  4DV4 Q;  4EQN A;  1HTP A;  3A8J E;  3S16 B;  1SNC A;  2FHT A;  1VQO A;  4OWW B;  4OIJ A;  1HTL D;  1PH3 A;  2IL8 A;  1JQY D;  2EYL A;  3SE0 A;  3KF8 A;  4QIW E;  1FGU A;  1CI3 M;  1PTO C;  4YY3 L;  2R3Z A;  3T1H Q;  1SJE D;  1EYC A;  3GTP H;  1VQL A;  2RHS B;  3KF6 B;  2GVB A;  5J1Z A;  4OGQ C;  1P8L A;  2AWO A;  1N34 Q;  4KD4 A;  3IFT A;  1EFI D;  1EOT A;  4IFD G;  3H3V C;  4KN4 C;  4A3I H;  1A15 A;  3G71 A;  1YZ6 A;  4LFA Q;  4QB4 A;  5IYD G;  4PNY A;  1N33 L;  1KDA A;  2NVY B;  4HTH A;  2Z6K A;  1XX8 A;  5K5P A;  2N88 A;  1JCK B;  5EKL A;  1S5E D;  2H1E A;  2OT2 A;  2F0D A;  3SK5 A;  5CGK A;  1RKN A;  2JA9 A;  2A6H C;  2R7F A;  1TQO A;  2KCC A;  5C0X G;  1MD2 D;  3AU7 A;  3FVQ A;  1SNM A;  3HGB A;  2R7D A;  4ME5 A;  3M85 A;  1SYE A;  3RUZ A;  5M3M B;  2E2H H;  1LUZ A;  1I3Q H;  2JA6 H;  2F0F A;  4R4I A;  5HGQ A;  3FPP A;  3I4M B;  4DK1 A;  1PZJ D;  4RA8 A;  5DM6 3;  1PV4 A;  2Q8T A;  4ZAI A;  4GNX A;  4BY1 G;  3UI2 A;  5IYB G;  2KCN A;  2YYZ A;  2L5T A;  5EAY A;  3SXH A;  5I4D A;  2B2V A;  1JB3 A;  1X32 A;  3H0G B;  4NB3 A;  1HH2 P;  1VQ9 A;  4BBR G;  3K0X A;  5DLQ E;  1F9P A;  2VQE L;  1UE6 A;  2AQ1 B;  1TS3 A;  3MHB A;  5GQO A;  3PUV A;  1I50 B;  4QUF A;  1SYD A;  3OMC A;  4HJ8 A;  3HOX H;  3A8K E;  5CV6 A;  1PH5 A;  4KN7 C;  2F0E A;  2CVR A;  4A3G G;  2EVB A;  3N6R A;  4DV6 L;  1XXG A;  2F0L A;  5IGG A;  2N8N A;  1UEA B;  3V2T A;  5HUR A;  2PW7 A;  4LF4 Q;  4ID6 A;  4Y7N H;  2B39 A;  1U4R A;  4KJO A;  2RA4 A;  4C3J H;  5K36 H;  3S14 H;  1EIG A;  1SYF A;  2D9U A;  4DXF A;  1EQR A;  3J81 L;  3CCU A;  5JJI A;  1IHZ A;  3S9W A;  3KDF B;  2JA8 B;  2ZJR A;  2NN6 H;  5IYC G;  1PH7 A;  3HOW H;  1MJE A;  4BY7 G;  3I91 A;  2DNC A;  4N9T A;  2YU9 H;  1DCZ A;  4BBS G;  3M4O B;  1DGS A;  5AJ3 Q;  1EY9 A;  5DEH A;  4AQY L;  2ZTC A;  3SK4 A;  1KQS A;  4B08 A;  2VUM G;  1BVS A;  4BA1 I;  1EFW A;  4HCS A;  1YNN C;  4HMI A;  4ZUI A;  1K0S A;  3F8T A;  4A3D G;  1YNJ D;  1Q86 C;  1SFO B;  4OXP A;  3VR3 A;  1X6O A;  4DAY A;  1YHQ A;  4A3M B;  3PIP A;  4B9W A;  3QJY A;  4PZ6 A;  4K6D A;  1XNR L;  1W2B A;  1IBM Q;  4A3L H;  1KHI A;  3M4Y A;  4CKC A;  1I94 L;  1H95 A;  2R7Z G;  2WAQ B;  1PH6 A;  5HGT A;  1EIF A;  2MQH A;  4CDC C;  1M4V A;  1E1O A;  1QWY A;  2MO1 A;  1VQG A;  2BDN A;  4A93 G;  1SN8 A;  4DAY B;  4J6H A;  5C6A A;  1XNQ Q;  3E0E A;  2I5H A;  3CMA A;  4H0L C;  5IP9 G;  4A3F G;  3CC2 A;  3UDX A;  4KHP Q;  1D8L A;  1WJJ A;  4DV2 Q;  1U4M A;  1IW7 D;  4OEM B;  1SE2 A;  3J7A 5;  3U58 A;  2AQ3 B;  5C0X J;  1JE4 A;  2L9H A;  4KY6 A;  5E3F A;  2NYZ D;  1ASZ A;  4NW2 A;  3J81 i;  3OYY A;  1F2Z A;  1EIH A;  5NUC A;  1UWV A;  2CH4 A;  1PHJ A;  1K9M C;  2F4V L;  2H4O A;  1BDO A;  2HDM A;  1BKB A;  3BS1 A;  3TS0 A;  3KLR A;  3L0O A;  4NXN L;  2RDH A;  5JOB A;  2WKC A;  2HCI A;  1PFM A;  1IZ6 A;  1HNZ L;  3PIP 3;  2ALY B;  1LT4 D;  4KK7 A;  5FOB B;  3J80 c;  3PGZ A;  1WOC A;  2EQS A;  5M3M G;  2V4D A;  2VXW A;  1YI2 A;  4JI5 Q;  3KBX A;  4DUZ L;  1R9T B;  5CYU A;  3I70 A;  1PH8 A;  3CC7 A;  1HQM C;  4JI0 Q;  1CKO A;  4H7B A;  3TP5 A;  3J7Y W;  2Q8I B;  3KUP A;  1RIP A;  3K7U C;  4OO1 H;  2FFK B;  4PZ8 A;  5EGT A;  2ZT9 C;  1Q82 C;  4H44 C;  1OXV A;  3U4V A;  3D6W A;  1Z47 A;  3H0G G;  5IGC A;  4X64 L;  4A3E B;  1QVF A;  3G7L A;  4FO2 A;  2J7Z A;  1A3U A;  2LMC B;  4DR3 L;  2XGT A;  3LWU A;  4LF8 Q;  3MFY A;  1HHV A;  4WRD A;  3GTQ B;  1XYI A;  4DUY L;  1FL0 A;  4C3H H;  1K3B C;  1CSP A;  3X3M A;  3PCO B;  4OIK A;  2WV6 D;  4DR4 Q;  1PFS A;  4HJ9 A;  5C3X A;  1BBU A;  1CZG A;  1ZYR D;  1PVO A;  5C44 B;  3I4N B;  1QUQ A;  1U4P A;  1U5K A;  2A73 B;  2E2I B;  1IBL Q;  1N32 L;  1SSO A;  4TQU S;  4XQN A;  1Y1V H;  3P20 A;  4CGY B;  4KHZ A;  1EU3 A;  3CU7 A;  3A5U A;  3BDC A;  2EY6 A;  2CW0 D;  2UUB Q;  2YTX A;  2ZTE A;  1E24 A;  4IUT A;  5M5X H;  4X65 Q;  1EWC A;  1QUQ B;  4LMQ D;  2JA8 G;  3WOE A;  1C0A A;  4L5T A;  4KD3 A;  2XRQ D;  5M5W B;  2R93 B;  1Q3L A;  5FJ8 H;  3I55 A;  4MNO A;  3RR5 A;  3ONA B;  3WOF A;  4EGV A;  1XMO Q;  2EXZ A;  2ZTD A;  3GV6 A;  3E9H A;  4MZ9 A;  4C2M H;  4HMJ A;  4IOC A;  2F03 A;  1F9Q A;  1FNV A;  1SRU A;  2EYM A;  4XTC S;  1WTW A;  1D5M C;  1ET9 A;  3DXJ C;  3OWF A;  3PF5 A;  3TDQ A;  1HA6 A;  4X3S A;  3BZK A;  1XMQ L;  2C9O A;  4LK1 C;  3H15 A;  3PO2 B;  3I4L A;  4UP8 A;  3ERQ A;  4WFN 3;  1CTM A;  1DOK A;  1DXM A;  3HOV H;  2YTY A;  3K7A H;  3PO3 B;  5JEA J;  3S2H B;  1GVP A;  3TQY A;  4QF4 A;  2ZJQ A;  3Q24 A;  4CBV A;  4KY7 A;  5IWA L;  4CJ1 B;  4A3M G;  2K5H A;  1GUT A;  4K0K Q;  2F0S A;  1D5Z C;  1L0Y B;  3CCE A;  2RDF A;  1YEZ A;  3RD4 A;  1FVI A;  2WAQ G;  1IL8 A;  2RQX A;  4JYA L;  4L6T B;  3S1Q H;  2K7V A;  1PRT B;  2K6A A;  4UY8 C;  4R4O A;  1K8G A;  3OTO Q;  1O7I A;  1RF2 D;  4RMF A;  1S40 A;  3RN2 A;  1S5C D;  4QGU A;  1TS4 A;  2A6E D;  3HOY B;  1QZG A;  5M3F B;  3T4A C;  2JK8 A;  3M3Y H;  3K6O A;  3H6M A;  1TS5 A;  4R4C A;  3VYR A;  2EJG C;  5H1S E;  4DV1 L;  3KBG A;  4JK1 C;  4IJL A;  2F0M A;  1VQI A;  4JI1 Q;  2KA7 A;  3M7G A;  4L63 B;  3GTL H;  2AWN A;  5C3W A;  1IKL A;  4BXX H;  1G51 A;  2IW3 A;  2Z4I A;  3UDI A;  2EYJ A;  5C3E B;  2BE5 C;  5I6Y A;  5EPJ A;  4A3K H;  1B9M A;  1V43 A;  3HOU H;  2BOS A;  3D6C A;  3D4D A;  4KHV A;  2UU9 L;  4FNF A;  1FNW A;  1J5E L;  2J4X A;  2M2L A;  3NWS A;  4M8A A;  1QZH A;  2MUY A;  1ZEQ X;  5DNF A;  4A3B B;  1AP0 A;  4RWS C;  1NCV A;  1GUN A;  2I5M X;  2F3V A;  2UXC L;  1QG7 A;  3DMU A;  3T1Y Q;  1TKW B;  1HA5 A;  3NE5 B;  5IGF A;  3VR6 A;  5CV8 A;  1D1K A;  3J7Z C;  2MFI A;  4GKK L;  3S15 B;  5KEE A;  4GLX A;  1OTC A;  2DGY A;  1PZI D;  1PRT F;  1B7Y B;  1A2T A;  5JPN C;  2D0P A;  3A0J A;  4UHV A;  1D7Q A;  3CD6 A;  2IWH A;  3BU2 A;  2F52 A;  1TWC B;  5FLX E;  1AE2 A;  4GKJ L;  4GZY C;  1C4Q A;  2A5H A;  5ELF A;  3S1R H;  4OX9 Q;  2VQF L;  2SNM A;  3I90 A;  1GM5 A;  4FF1 A;  3IFD A;  4XQJ A;  1Y1W B;  2KEE A;  2HUG A;  2E8G A;  4H02 A;  4C1N I;  4LNQ A;  1X3G A;  1OXX K;  4DV3 L;  1H9R A;  4JI4 L;  4BA2 I;  3NEN A;  3P75 A;  3VR2 A;  2YV5 A;  1EY0 A;  3AYH B;  1KDB A;  2Z9H A;  2WIN B;  1W3S A;  2PQA A;  3OHX C;  4JI3 Q;  4IQZ A;  5C44 G;  1QNK A;  3C1F A;  4DA2 A;  2L0C A;  5LMN L;  4X3K A;  1PLF A;  4LF6 L;  1XTD A;  2K5V A;  2G5D A;  2K1B A;  2JA7 B;  1W6K A;  1YIJ A;  5HY6 A;  5I9P A;  5C4J B;  2DUD A;  1SND A;  2F0H A;  4LFB L;  1C9O A;  1STE A;  5JVH 3;  3OWE B;  3K5L A;  3JAM L;  3MZ5 A;  5D3D A;  3K59 A;  2Q2H A;  1L0W A;  3OW2 A;  2K5N A;  3UE1 A;  1PMR A;  2R93 G;  1WTX A;  5G3L F;  4BBR B;  4DV5 L;  3T13 A;  1I4Q A;  3FKI B;  1K3R A;  1X65 A;  1G6P A;  1Q90 A;  1SE3 A;  3FRP B;  1NBW A;  3SR1 A;  4DR6 Q;  3L3O C;  5EKI A;  1LT3 D;  3LGJ A;  4DR5 Q;  2NB0 A;  3W1B A;  5JJL A;  3PO2 G;  3J81 j;  2UUC Q;  1TU2 B;  1G2S A;  5BN4 A;  4NP5 A;  4QMG A;  2LSS A;  3QG1 A;  1E2W A;  3PO3 G;  2EY1 A;  1TWH B;  2LS0 1;  4HAE A;  2JA5 B;  2O2L D;  3GO5 A;  3L9A X;  4IUV A;  1BBX C;  1E22 A;  4RCO A;  5IE8 A;  4CJ0 B;  4HIO A;  1XPO A;  5LMU Q;  3OIP A;  4A3C G;  3DWQ A;  3V05 A;  4APV A;  2B2W A;  4B3R Q;  1PFB A;  1SXT A;  2EIF A;  1STG A;  5ISR A;  4BY7 B;  3H3V I;  3CHB D;  4B3S L;  4Q0F A;  5A2Q L;  4P72 A;  3KFU A;  4BBS B;  1Q12 A;  2L12 A;  3ND9 A;  2E2J H;  1TWF B;  1SAP A;  4OL7 A;  3X3N A;  1KD1 C;  3HOY G;  1X3E A;  1PRT C;  4IFD I;  5M9O A;  2RSO A;  5M3F G;  1SBB B;  3EIV A;  3MVV A;  3DLL A;  2IHF A;  3M7N A;  3KK7 A;  3EFX D;  2HCC A;  2WFW A;  5IGB A;  1GUW A;  4DAV A;  1X55 A;  4ILW A;  5C4X H;  4OO1 G;  2X6L A;  2EPB A;  1GXD C;  2LFN A;  1UE1 A;  3MXU A;  3JAM i;  4QJF A;  3TSS A;  3EJI A;  1LAC A;  4YHH L;  3Q23 A;  3K0Y A;  5C3E G;  2B2T C;  1LTA D;  3S2D B;  1NNX A;  2HIX A;  3G6E A;  1CQV A;  2MP1 A;  2XWJ B;  3QOL A;  4DNR B;  2WB1 B;  4EVO A;  1ESR A;  2UUA L;  2KCT A;  5IT9 E;  3MWY W;  3TRZ A;  2VB3 X;  4X3T A;  1S5B D;  2JJQ A;  1EYA A;  1ASY A;  4JCV E;  4A3B G;  4A3F B;  3F2U A;  3W1G A;  1F77 A;  3KF6 A;  1YIT A;  5ELB A;  1OO9 B;  2Q2U A;  2BDO A;  5BN5 A;  1FJG Q;  1TVX A;  3MEH A;  4XXE A;  4LF7 Q;  3GTK B;  1G2T A;  2RHQ B;  3QWN A;  3STB C;  3J7A V;  2QDL A;  1TWG B;  4DF7 A;  3PUX A;  1TT2 A;  4G7Z C;  3S1M H;  1C8C A;  3HKS A;  2MPM A;  3PIO 3;  2A69 D;  2F0Q A;  3GTG H;  1BQQ T;  2CHB D;  2DN8 A;  4KKU A;  4RCN A;  1CFM A;  4LF9 Q;  1LV9 A;  4P74 A;  1Y1W G;  3KJP A;  4JI6 L;  4XDX A;  2VL6 A;  1MGS A;  4JI2 L;  4QIW B;  4ZQ3 A;  2K5Q A;  2UXD L;  4GS3 A;  1R4Q B;  5CBE E;  4I7A A;  3M4Q A;  3PSI A;  3J81 c;  1G91 A;  3HOV G;  4R8N A;  3CCR A;  2JA7 G;  1EEI D;  2FJ2 A;  1WVL A;  2EYF A;  4IPG A;  4C3I H;  1DD2 A;  1K8A C;  1RL2 A;  4FVM A;  4FP5 D;  2IX1 A;  3NTH A;  1PH2 A;  4A75 A;  4KKS A;  2CQO A;  4L5R C;  1V8Q A;  2ZJP A;  1X54 A;  1M8A A;  5IGD A;  1MHW C;  1OXU A;  1E7Z A;  1HZC A;  4DKA C;  3PUY A;  2P5Z X;  3FKI G;  4HID A;  4UAI A;  3IAY A;  1WFQ A;  1STH A;  4PQX A;  5KND A;  2OF1 A;  3URY A;  1VQN A;  2HD3 A;  4Q5V A;  2AKW B;  1QOH A;  1AH9 A;  4K8J A;  2QIL A;  1CT1 D;  4R1J A;  1VMC A;  5ELE A;  2K50 A;  2F0J A;  3SGI A;  4XYQ A;  2E5L L;  2FMM A;  4QCL A;  3KDF A;  5I2Y A;  4IPC A;  4P75 A;  2JA5 G;  1XNQ L;  1CZW A;  4CKB A;  2K33 A;  1ZXT A;  2L4N A;  4YY3 Q;  1HNW L;  1HUN A;  3I72 A;  4HJA A;  1K8M A;  4DV2 L;  4DV7 Q;  1X3F A;  1EZ6 A;  3S1N B;  2O5I C;  3MFG A;  5EJW A;  1I4X A;  1FR3 A;  1ML0 D;  4ZKC B;  3DWP A;  1Q81 C;  2K01 A;  2HDL A;  2JYO A;  3NEM A;  1R9T H;  1N8R C;  3HS0 C;  2HQL A;  1PYS B;  1A2U A;  1EQV A;  1EU4 A;  2QA4 A;  1HQR D;  4CKE A;  1N33 Q;  5M5Y H;  3S17 B;  1EY6 A;  3MC0 B;  3W2D A;  2UXB Q;  4ZRZ A;  1WCM H;  1SYB A;  1A62 A;  4FXK C;  1UE5 A;  1LM0 A;  2TMP A;  4R4Q A;  3VYT A;  4XT3 B;  4QL5 A;  2XVS A;  2B2W C;  4A3E H;  4LFC Q;  3NBI A;  3GTJ H;  2ENB A;  4F7X A;  3HEJ A;  2N49 A;  3GTP B;  2B8G A;  3H91 A;  3MXP A;  3BVM A;  4UP9 A;  1JJC B;  1RD9 D;  4GN4 B;  1K73 C;  3GTM H;  1WTP A;  3OIQ A;  1KAW A;  3E9I A;  1F9R A;  4POG A;  4A3I B;  4RG1 A;  2PW5 A;  4G7O C;  3HOZ H;  1KNE A;  1KXL A;  1J9O A;  4B3T Q;  1SNO A;  3I4N H;  2WB1 G;  4DNI A;  4XIG S;  3ZJY C;  1D1I A;  1MBY A;  2PPB C;  5KNB A;  3I56 A;  4O0A A;  1Y8N B;  1K0R A;  3A7A B;  4JI7 L;  2ZXR A;  1EY7 A;  4X66 Q;  5JEA G;  4RGT A;  1QJO A;  4JOI C;  2B63 H;  3BJU A;  1FNU A;  1GO3 E;  2C35 B;  2PI2 E;  2E2H B;  2R92 H;  1GOZ A;  1I3Q B;  3R2I A;  3NPP A;  4IUR A;  3K5N A;  2KOL A;  3E0J A;  2JA6 B;  1T5X D;  1CQF A;  4CDD C;  1B8A A;  4A3J H;  3TBI B;  4DK0 A;  1BNZ A;  4X62 Q;  1B9N A;  2FMC A;  5CV7 A;  3RZD H;  4R9W A;  4KI0 A;  4PMB A;  1VQH A;  5LL6 X;  1S4Z A;  1JJ2 A;  5GAE C;  1Q1E A;  2F0W A;  1VQ5 A;  4NKL A;  5D3I B;  5KGU A;  1KAB A;  4ZLT F;  5L37 A;  2UUB L;  1HZ9 A;  1SE4 A;  1YNJ C;  2K5W A;  3CC4 A;  3HOX B;  3VDY A;  2K04 A;  1A8V A;  3Q0A A;  3OSO A;  5IP7 H;  4AQY Q;  4IUN A;  2C5C A;  1SYG A;  3I73 A;  2BCO A;  2CWP A;  1KDC A;  2EYO A;  5LMN W;  1YNX A;  1HR0 L;  4C3J B;  2CQA A;  1Q7Y C;  2GA4 B;  4ZYS A;  2JQO A;  3S14 B;  4Y52 H;  2K4K A;  5FLM H;  2Z1C A;  4OHJ A;  1RTN A;  1VQJ A;  3TRE A;  4C56 C;  1SE8 A;  2PO4 A;  3TP6 A;  5ELO A;  2CFM A;  4TRD A;  1EIY B;  3K8A A;  4DV0 L;  3HOW B;  1IW7 C;  2JE6 I;  3NBH B;  1I94 Q;  4ME3 A;  2F0I A;  2KVM A;  5IOC A;  2YU9 B;  3R8B A;  2A68 D;  1GUG A;  4OON A;  1ROD A;  1K83 H;  2A8V A;  2XN9 C;  2NVT H;  3KYH C;  1O80 A;  1I4P A;  2NVQ H;  1DJR D;  3PUZ A;  5E4X A;  1VQ7 A;  3PUW A;  5LHY 1;  1GD7 A;  4R4T A;  4CHT B;  3EA6 A;  1VQP A;  3K57 A;  1JMC A;  1FYC A;  1I4G A;  1UAP A;  4WJW A;  2Q2I A;  1TWA H;  3OTO L;  4G7H C;  3NWT A;  5GAD C;  3TEH B;  1QB5 D;  3WDN A;  4NMZ A;  2B29 A;  3IL8 A;  3FDT A;  1PTO H;  1AW7 A;  4MTK A;  1H9S A;  1MJC A;  4NXM L;  3BVG A;  1LLR D;  2G9D A;  5IGE A;  2OEO A;  1SR3 A;  4AYB E;  3ERO A;  3CCL A;  1SNQ A;  4LUV A;  1EY5 A;  4JI8 Q;  3MAQ A;  1NR2 A;  1TR5 A;  2M00 A;  2NBF A;  1VDZ A;  2B2Y C;  1WI5 A;  4BWG B;  4ODG A;  3H3V H;  1P16 A;  3C2P A;  4I7Z C;  3ND8 A;  3MXN B;  1H9S B;  1TS2 A;  3CQZ H;  4NXN Q;  1K8O A;  3Q22 A;  1KLG D;  3F2D A;  4IFD H;  4YWL A;  1PH9 A;  1WTQ A;  1EY8 A;  1G29 1;  3K5M A;  1HNZ Q;  4PV1 C;  3DHQ A;  1LTT D;  1VQD A;  5IYD H;  2Y0S E;  1B1Z A;  1SEB D;  4DUZ Q;  3BDL A;  1O7Y A;  3A54 A;  4DR2 L;  4LJZ C;  2KQ3 A;  4V19 0;  3TP7 A;  4R8I A;  5CV5 A;  5C0X H;  1KRT A;  3U9S A;  2BE5 D;  4A3I G;  1I6H H;  1S3O A;  1U4L A;  2A1A A;  1X3P A;  4IPD A;  1L0X B;  3DWA A;  3UE0 A;  4X64 Q;  3U9O A;  1ZYR C;  1PZK D;  4LW1 A;  3VYS A;  1VQM A;  2RVL A;  4DK3 C;  5ELN A;  2RBM A;  1JOO A;  4DR3 Q;  3TME A;  2ZXO A;  4TVA B;  1CA6 A;  5BN3 A;  2JEA I;  1E3P A;  2B2T A;  2Y0S B;  2CW0 C;  4BY1 H;  5IYB H;  3QR8 A;  1XWE A;  2OQ0 A;  4FXG C;  1LAB A;  2L1B A;  2K52 A;  1L2F A;  2Q8R E;  2JA6 G;  3SK6 A;  1WTV A;  3CRK C;  4DR7 L;  1N32 Q;  1E2V A;  2NUC A;  1J8I A;  4G4K A;  1BF4 A;  1IYJ B;  3VA7 A;  1BO0 A;  2JEB I;  3I2Z A;  1IBK L;  2NVX H;  4JBW A;  1F9S A;  2OXP A;  4YWK A;  3RLF A;  1AEX A;  2BA0 A;  3BZD B;  1Z9F A;  4A3G H;  2EXD A;  2F3I A;  1CKN A;  2PZT A;  1U0L A;  3J80 E;  3FEW X;  3A7L A;  1TII D;  1PFN A;  4HR7 B;  2AMC B;  3NQI A;  1HNX Q;  2F0V A;  3HOX G;  2RKS A;  3GTO H;  2RF4 A;  3WWV A;  4FF4 A;  4C3H B;  3TN2 A;  4FYD A;  2VS1 A;  1BCP D;  1DYQ A;  2CKZ B;  1CKN B;  4IOA A;  3NK9 A;  1HRJ A;  2F0K A;  2N3S A;  3H94 A;  4IUQ A;  5C5M A;  1WYD A;  3JAM c;  5IIF A;  5IYC H;  1STB A;  4BY7 H;  4C3J G;  1VF7 A;  1Y1V B;  4HJ7 A;  5K36 G;  1LTL A;  2F3W A;  1EWI A;  4BBS H;  4PMC A;  1UNS A;  1E0B A;  4DR6 L;  1C48 A;  3JC6 6;  1I4H A;  3R3O A;  5M5X B;  4DR5 L;  2D5D A;  5IWA Q;  2VUM H;  2NN6 G;  1SNP A;  2JP1 A;  2A6E C;  3PV0 A;  1NY4 A;  3FPU B;  4IZ8 A;  4S3S A;  3HOW G;  3NHH A;  3L2P A;  3D8G A;  3VA5 A;  3CAM A;  1BOS A;  2B2U A;  4C2M B;  4ULL A;  5GRO A;  1C7Y A;  4A3D H;  5ELD A;  1Y69 U;  1N36 Q;  5BR8 L;  2XSC A;  4V0B A;  1DON A;  2HHH L;  4B3R L;  2RSN A;  4DGZ A;  2D2C C;  3IKJ A;  4GN3 B;  4HCE A;  4J8Q A;  1H9J A;  3HOV B;  2R7Z H;  3K7A B;  3FP9 A;  1GUS A;  1JWM D;  1JE5 A;  4A93 H;  2X6G A;  3PMF A;  5EBD A;  1VCI A;  2AUJ D;  3GQB A;  2SNS A;  4LAA A;  4JW0 A;  4GOP B;  2VY3 A;  2QGQ A;  1HUM A;  1SMY D;  2CH4 W;  5IP9 H;  4A3L G;  3OPO A;  3VYU A;  3S16 H;  1KIX A;  1XTC D;  3RMH A;  4CDE C;  1KLU D;  3BYY B;  1CHP D;  3CF5 A;  1JC7 A;  2NZH A;  3NUC A;  3SEB A;  2AQ2 B;  2SEB D;  3S1Q B;  3CRL C;  4RGM A;  1NE3 A;  2RCN A;  4B9X A;  2B3G A;  4EX5 A;  2LXJ A;  2K32 A;  3BG3 A;  2UU9 Q;  1YJN A;  1J5E Q;  4FDB A;  4XQQ A;  5T1G A;  1TY2 A;  3M3Y B;  5KRU A;  2RCF A;  5C5L A;  2PMZ E;  1DOL A;  2OTJ A;  3D31 A;  4DK6 C;  1CA5 A;  2I0Q A;  1RCV D;  2IX0 A;  1R4P B;  2NVY H;  1VQE A;  4AYB G;  2IPK D;  4DV4 L;  4K2L A;  3ZYY X;  3A5Z B;  4GKK Q;  1B3A A;  5COY A;  1AN8 A;  3GTL B;  4U67 3;  1BR9 A;  3ULP A;  1JJG A;  2ZXP A;  3FHW A;  4A3K B;  1FJG L;  3TZD A;  3T1H L;  4GKJ Q;  3HOU B;  5M3M H;  1KC8 C;  2D0O A;  1M1K C;  3IRB A;  2VQF Q;  4EQ5 A;  1GJX A;  2PMZ B;  5ELC A;  2OWO A;  2K05 A;  2DY8 A;  1N34 L;  4IUP A;  1T9H A;  3I4M H;  4OEL B;  2Y0S G;  4GN5 A;  3SK8 A;  4DV3 Q;  4JVZ A;  4JI4 Q;  1IXR A;  1YHA A;  4LFA L;  3H0G H;  5FKA C;  2ZM6 Q;  1PTO D;  5FO7 B;  3QO2 A;  4LF9 L;  3AB9 A;  3A74 A;  2CCZ A;  4KLK A;  3GD7 A;  4ZKB B;  5LMN Q;  3J7A F;  4GLA C;  4LF6 Q;  2JN4 A;  1VQ6 A;  1I50 H;  1B3Q A;  4ZUJ A;  5C0X I;  5CV9 A;  4JOI A;  4IN3 A;  5E4W C;  4LFB Q;  5CC4 A;  3D0F A;  1QVG A;  4YCV A;  1WTR A;  3HZX A;  1H9K A;  1IL2 A;  1L1O A;  3S1R B;  2KUM A;  3NTI A;  4MN3 A;  2QEX A;  2Q2T A;  1ONL A;  4B3M Q;  4DV5 Q;  2A6H D;  4NDX A;  4U68 A;  5F2D A;  5IOD A;  4DR1 Q;  5KNC A;  3I7F A;  2FXQ A;  2IHE A;  1TXY A;  3VR5 A;  3LX0 A;  4YCU A;  4C3H G;  5JJK A;  1L1O B;  3AEV A;  3K5O A;  2NTS A;  3SVM A;  2XWB B;  4HSP A;  2JA8 H;  1DM0 B;  4JPB W;  1A6X A;  1A3V A;  2YTV A;  1F2Y A;  1HR0 W;  1Y1V G;  4MHE A;  4KMU C;  3KOJ A;  1PH4 A;  3PF4 A;  2ES2 A;  1Q1B A;  4AIM A;  1BBW A;  3M4O H;  2MJ8 A;  4IUU A;  2X69 A;  1V1P B;  5J3B A;  3ULJ A;  1HZB A;  2HQE A;  4M1U B;  1KNA A;  2LXK A;  1X9N A;  3A55 A;  5FJ8 G;  1PYB A;  3UDF A;  4LF4 L;  3AFQ A;  3ITP A;  4J15 A;  2KEC A;  1FD7 D;  3KLW A;  3KLS A;  1I4R A;  4LF5 Q;  1NMG A;  1HXY D;  4B3S Q;  4IPH A;  1SFO H;  4DV7 L;  5TSS A;  2I46 A;  1W6J A;  3MEF A;  4LUO A;  4A3M H;  1SJH D;  3KF8 B;  4OWT B;  2VB2 X;  5JAV A;  3CCQ A;  3D3R A;  5A2Q E;  3EVQ A;  3G6J B;  4O42 A;  4PZ7 A;  4HJ5 A;  3U4Z A;  2XIW A;  4JV5 Q;  5DAU A;  4CJ2 C;  5AJ3 L;  1CKM A;  3MA2 B;  3M4P A;  2LKV A;  2UXB L;  2B2U C;  2RDG A;  3U50 C;  1GHK A;  4Z9C B;  1WTO A;  2EOT A;  2IT1 A;  4FF3 A;  4TKO B;  3RZO B;  4LFC L;  3F2C A;  5C4Z A;  4YHH Q;  4GOP C;  1ILP A;  1XPU A;  1GKH A;  5KYL A;  2Z8L A;  2E2J B;  1WD0 A;  3NQT A;  2UUA Q;  1N9W A;  1JWU D;  1E1T A;  1J6Q A;  2SOB A;  1OXS C;  2ASB A;  1SLJ A;  3NEL A;  3CCM A;  1IBM L;  1JOQ A;  1YNN D;  2CWA A;  3HKZ E;  4DAP A;  2N55 A;  4HED A;  5LL6 S;  1S72 A;  4B3T L;  3R2T A;  2B2Y A;  4X6A H;  3QOJ A;  2MHV A;  2PZW A;  1SDF A;  4RHS A;  2A69 C;  3K81 C;  5C4X B;  2QF7 A;  4GNX B;  4JC0 A;  3LWE A;  4X66 L;  4KHP L;  2BA1 A;  4UPA A;  4BXX G;  2OTL A;  3OMG A;  1B2T A;  2TSS A;  1EWH A;  4KTA A;  3K58 A;  2WAC A;  4A3K G;  3CKI B;  3MXG A;  2IY5 B;  1V1O A;  2K5D A;  3HOU G;  1RTO A;  1EZ8 A;  1CSQ A;  3HKZ B;  3P7J A;  5GAH C;  1O7Z A;  4K2K A;  3C3L A;  4X62 L;  5D65 A;  1PDQ A;  4JI6 Q;  1EEF D;  4JI2 Q;  3D4W A;  4KV6 A;  2F0T A;  1RDP D;  4DU9 A;  1RHP A;  2XNA C;  1SMX A;  2UXD Q;  2DNE A;  1VQ8 A;  2K75 A;  3DUZ A;  4ABN A;  3A56 A;  2H5X A;  1HFN A;  1JOK A;  3GTQ H;  1KRS A;  1B44 D;  1QIL A;  1IYU A;  2WAQ E;  2XRS D;  4HSV A;  4L8J A;  2VZA A;  3S1M B;  4JI5 L;  3NTK A;  3H09 A;  1V9P A;  1X56 A;  4K5X A;  5C44 H;  4JI0 L;  3GTG B;  4WJ3 M;  2Z6B A;  2E2I H;  2WP8 J;  1B50 A;  1CUK A;  4N8X 1;  1NAP A;  2D62 A;  3D4R A;  5DM7 3;  4CDF C;  2VQE Q;  3HP3 A;  2KJX A;  3CME A;  4ALP A;  2OQK A;  3B6Y A;  2DJG C;  4H13 C;  5D14 A;  4N8F A;  2QDB A;  5A35 A;  5J22 A;  2KED A;  3DEO A;  3GDE A;  4DV6 Q;  4L5S A;  5M5W H;  2R93 H;  4BS9 A;  2NZO A;  2HT1 A;  2E5L Q;  4LF8 L;  1L1O C;  4RKB A;  2Z4H A;  4C3I B;  3FMC A;  4DNT B;  2F0N A;  4IFD J;  1VS0 A;  4JBJ A;  3V96 A;  3L7Z C;  1Z6H A;  4A4I A;  1E2Z A;  1HNW Q;  1B4O A;  1LO5 D;  1K28 A;  1LTI D;  4DR4 L;  2PI2 A;  3QB3 A;  1HFG A;  1Y8P B;  1NUC A;  4P2C B;  1DZ1 A;  1IBL L;  4QQB X;  4IAL A;  3HRZ C;  2I5L X;  3PO2 H;  1GUO A;  5EPK A;  4FXD A;  5E1F A;  1YVC A;  3RLO A;  2E2D C;  1AFP A;  1ENA A;  3J81 E;  4N9P A;  1F2L A;  3W5O A;  3PO3 H;  3S2H H;  1JT8 A;  1JR0 D;  1S5F D;  5J39 A;  4X65 L;  1CM9 A;  1XPR A;  1GHJ A;  1VQ4 A;  4A3C H;  2HIV A;  4JI8 L;  3TZU A;  4FF2 A;  1XMO L;  5EKK A;  4Y7N B;  3LNN A;  4O2D A;  3NBH A;  4IO9 A;  3ULL A;  5KIX A;  3OW7 A;  1U9R A;  1VQA A;  2J0T D;  1EY4 A;  1ILQ A;  2A74 C;  3HOY H;  2VW9 A;  1STN A;  1VMP A;  5M3F H;  1ET6 A;  1EUJ A;  2SDF A;  1XNR Q;  1ESF A;  4ZCK A;  1A3T A;  3HG9 A;  4L5Q A;  1VQK A;  2QKI C;  4K5W A;  5M5Y B;  4K0K L;  2Z6K C;  3I4M G;  3G4S A;  3ICE A;  1WCM B;  2L55 A;  4XT1 B;  2MNA A;  4JI7 Q;  2ICE C;  4JBK A;  2ICI A;  5C3E H;  2WII B;  1Z7T A;  3GTJ B;  4RGN A;  1SYC A;  4HIK A;  5C4X G; 
#chains in the Genus database with same CATH homology
 2AUK A;  1QNU A;  1BCP B;  2EDG A;  3R93 A;  2JXM B;  4KKT A;  2NZ1 D;  1QE6 A;  3GTM B;  4RHR A;  3TP8 A;  3MXN A;  4C1N K;  1BUV T;  1LTG D;  2KHS A;  1QCB D;  3BVZ A;  1DOM A;  1RJT A;  3HOZ B;  3Q6S A;  2QEJ C;  2B2V C;  2F0G A;  3QIA A;  3E5S A;  5COR A;  3C46 A;  5I6W A;  2F0P A;  5CMD A;  4K8I A;  3J80 L;  1NSN S;  1F2M A;  1ENF A;  3AMU A;  2DY7 A;  4G57 A;  2B63 B;  1O78 A;  2EY5 A;  3NXW A;  2IX3 A;  5AFW A;  4WOR A;  2R92 B;  4HN7 A;  2EYH A;  4I65 A;  4E6I A;  2PYK A;  2NWG A;  1D2B A;  4J1M A;  1NR4 A;  4AYB B;  3N52 A;  4A3J B;  2A68 C;  2EYP A;  2QCP X;  3SDZ A;  3RZD B;  2F1M A;  3I3C A;  1Q8I A;  2PZU A;  5FLX L;  1EQT A;  4O1N A;  1VF5 C;  2K03 A;  5JVG 3;  2NN6 I;  1H9M A;  1BCP F;  1I6V C;  3T56 B;  4XYO A;  4F8M A;  4C3I G;  1IKM A;  1S5D D;  5KYI A;  1X3Q A;  4F87 A;  4EQO A;  2I07 B;  3A8I E;  3W3A A;  1II3 A;  3GV3 A;  1LTB D;  1TY0 A;  1Y8O B;  3NSW A;  5FO8 B;  1K83 B;  3VR4 A;  2F0O A;  2NVT B;  2NVQ B;  1WD1 A;  1BXT A;  2R61 A;  3C1E A;  5C4H A;  1B53 A;  4RGO S;  4EQP A;  4F88 A;  1T5E A;  5CBA E;  1TWA B;  2M9V A;  2E75 C;  2EZV A;  3T16 A;  2VNU D;  1ZKO A;  1KTK A;  1JIC A;  1PTO B;  4RH6 A;  4UDU C;  1EL0 A;  4DFA A;  5CV4 A;  1HCZ A;  2EY2 A;  1STY A;  1MSH A;  2B8F A;  2R6G A;  1MI2 A;  3CQZ B;  3OOC A;  3T53 B;  5EQ0 A;  5CR3 A;  5I2X A;  3DM1 A;  4RAU C;  2ID0 A;  2E76 C;  1CHQ D;  1UUP A;  2L11 A;  1KAA A;  1PYW D;  1ICW A;  4YIJ A;  5JEA H;  1I6H B;  4MIU A;  1BCP C;  2FIN B;  1MSG A;  3NP8 A;  3O13 A;  1JWS D;  1EYD A;  3SHL A;  4OO1 I;  2E74 C;  1G6Z A;  1PRT D;  5IT9 L;  5EPL A;  4BY1 B;  2EJF C;  3BYT B;  1AZP A;  1LT5 D;  1JOR A;  5EBC A;  1AZQ A;  5T1I A;  2EE1 A;  1PTO F;  4QUC A;  2LY7 A;  1OXT A;  5FK9 C;  1D5X C;  2MGS A;  3P1H A;  2NTT A;  2NVX B;  1CK1 A;  3MTS A;  4A3G B;  4K14 A;  2K28 A;  1O7L A;  4X3U A;  2WKD A;  1LTR D;  4KY5 A;  1IYV A;  2F0U A;  3GTO B;  4K5V A;  2PNR C;  1LT6 D;  1FGB D;  3BDO A;  1SMY C;  3KLS X;  5G3L D;  5I9O A;  3GP7 A;  3T51 B;  1STA A;  2IJ0 A;  4K6L A;  3E6Z X;  4ZK9 B;  2JSO A;  3I8Z A;  1HPC A;  4TSS A;  1G8Z D;  3DEP A;  2VUM B;  2PQE A;  4PMW A;  1D6E C;  2PCF B;  1LTS D;  4A3D B;  2G9H D;  3JAM E;  2EJM A;  5JPM C;  1PXU A;  5JJZ A;  1V1P A;  3EQL C;  2R7Z B;  4A93 B;  2F4I A;  2O5J C;  4DN4 M;  4DXG A;  4RFB A;  4KJN A;  1ENC A;  4RKL A;  2O4X A;  5FO9 B;  4EQN A;  1HTP A;  3A8J E;  3S16 B;  1SNC A;  2FHT A;  4OIJ A;  1HTL D;  2IL8 A;  1JQY D;  2EYL A;  3SE0 A;  3KF8 A;  1CI3 M;  1PTO C;  2R3Z A;  1SJE D;  1EYC A;  5J1Z A;  4OGQ C;  2AWO A;  4KD4 A;  3IFT A;  1EFI D;  1EOT A;  4IFD G;  3H3V C;  4KN4 C;  1A15 A;  4QB4 A;  4PNY A;  1KDA A;  2NVY B;  4HTH A;  1XX8 A;  5K5P A;  2N88 A;  1JCK B;  5EKL A;  1S5E D;  2H1E A;  2OT2 A;  2F0D A;  3SK5 A;  5CGK A;  1RKN A;  2A6H C;  1TQO A;  2KCC A;  5C0X G;  1MD2 D;  3AU7 A;  3FVQ A;  1SNM A;  3HGB A;  4ME5 A;  3M85 A;  1SYE A;  3RUZ A;  5M3M B;  2F0F A;  3FPP A;  3I4M B;  4DK1 A;  1PZJ D;  4RA8 A;  5DM6 3;  2Q8T A;  4ZAI A;  3UI2 A;  2KCN A;  2YYZ A;  2L5T A;  3SXH A;  5I4D A;  2B2V A;  1JB3 A;  1X32 A;  3H0G B;  1F9P A;  2AQ1 B;  1TS3 A;  3MHB A;  3PUV A;  1I50 B;  4QUF A;  1SYD A;  3OMC A;  3A8K E;  5CV6 A;  4KN7 C;  2F0E A;  2CVR A;  2EVB A;  3N6R A;  1XXG A;  2F0L A;  5IGG A;  1UEA B;  3V2T A;  5HUR A;  2PW7 A;  4ID6 A;  2B39 A;  1U4R A;  4KJO A;  2RA4 A;  5K36 H;  1EIG A;  1SYF A;  2D9U A;  4DXF A;  3J81 L;  1IHZ A;  3S9W A;  2JA8 B;  2NN6 H;  3I91 A;  2DNC A;  4N9T A;  1DCZ A;  3M4O B;  1EY9 A;  5DEH A;  3SK4 A;  4B08 A;  4BA1 I;  4HCS A;  1YNN C;  4HMI A;  4ZUI A;  1YNJ D;  1SFO B;  3VR3 A;  4DAY A;  4A3M B;  4B9W A;  3QJY A;  4K6D A;  3M4Y A;  4CKC A;  2WAQ B;  5HGT A;  1M4V A;  1QWY A;  2BDN A;  4J6H A;  5C6A A;  4H0L C;  1U4M A;  1IW7 D;  1SE2 A;  2AQ3 B;  5C0X J;  1JE4 A;  2L9H A;  4KY6 A;  5E3F A;  2NYZ D;  4NW2 A;  1F2Z A;  1EIH A;  5NUC A;  2H4O A;  1BDO A;  2HDM A;  3BS1 A;  3KLR A;  2RDH A;  5JOB A;  2WKC A;  2HCI A;  1PFM A;  3PIP 3;  1LT4 D;  4KK7 A;  5FOB B;  2V4D A;  2VXW A;  3KBX A;  1R9T B;  5CYU A;  3I70 A;  1HQM C;  4H7B A;  3TP5 A;  3J7Y W;  2Q8I B;  3KUP A;  4OO1 H;  2FFK B;  5EGT A;  2ZT9 C;  4H44 C;  1OXV A;  3D6W A;  1Z47 A;  5IGC A;  4A3E B;  3G7L A;  4FO2 A;  2J7Z A;  1A3U A;  2LMC B;  3LWU A;  3MFY A;  1HHV A;  4WRD A;  3GTQ B;  1XYI A;  3X3M A;  4OIK A;  2WV6 D;  5C3X A;  1CZG A;  1ZYR D;  5C44 B;  3I4N B;  1U4P A;  2A73 B;  2E2I B;  1SSO A;  4TQU S;  4XQN A;  3P20 A;  4CGY B;  4KHZ A;  1EU3 A;  3CU7 A;  3BDC A;  2EY6 A;  2CW0 D;  4IUT A;  1EWC A;  4LMQ D;  3WOE A;  4KD3 A;  2XRQ D;  5M5W B;  2R93 B;  1Q3L A;  3ONA B;  3WOF A;  4EGV A;  2EXZ A;  3GV6 A;  4HMJ A;  2F03 A;  1F9Q A;  1FNV A;  2EYM A;  1WTW A;  4XTC S;  1D5M C;  1ET9 A;  3DXJ C;  3OWF A;  3TDQ A;  1HA6 A;  4X3S A;  2C9O A;  4LK1 C;  3PO2 B;  3I4L A;  3ERQ A;  4WFN 3;  1CTM A;  1DOK A;  1DXM A;  3PO3 B;  5JEA J;  3S2H B;  4QF4 A;  3Q24 A;  4CBV A;  4KY7 A;  4CJ1 B;  1GUT A;  2F0S A;  1D5Z C;  1L0Y B;  2RDF A;  3RD4 A;  1IL8 A;  2RQX A;  4L6T B;  2K7V A;  1PRT B;  2K6A A;  1RF2 D;  1S5C D;  1TS4 A;  2A6E D;  3HOY B;  5M3F B;  3T4A C;  3K6O A;  3H6M A;  1TS5 A;  3VYR A;  2EJG C;  3KBG A;  4JK1 C;  2F0M A;  2KA7 A;  3M7G A;  4L63 B;  2AWN A;  5C3W A;  1IKL A;  2IW3 A;  2Z4I A;  2EYJ A;  5C3E B;  2BE5 C;  5I6Y A;  5EPJ A;  1B9M A;  1V43 A;  2BOS A;  3D6C A;  3D4D A;  4KHV A;  1FNW A;  4FNF A;  2J4X A;  2M2L A;  3NWS A;  4M8A A;  2MUY A;  1ZEQ X;  5DNF A;  4A3B B;  1AP0 A;  4RWS C;  1NCV A;  1GUN A;  2F3V A;  1QG7 A;  3DMU A;  1TKW B;  1HA5 A;  3NE5 B;  5IGF A;  3VR6 A;  5CV8 A;  1D1K A;  3S15 B;  5KEE A;  1PZI D;  1PRT F;  1A2T A;  5JPN C;  2IWH A;  1TWC B;  5FLX E;  4GZY C;  1C4Q A;  2A5H A;  5ELF A;  2SNM A;  3I90 A;  4FF1 A;  3IFD A;  4XQJ A;  1Y1W B;  2KEE A;  2HUG A;  4C1N I;  1OXX K;  4BA2 I;  1H9R A;  3P75 A;  3VR2 A;  1EY0 A;  1KDB A;  2WIN B;  3OHX C;  4IQZ A;  1QNK A;  3C1F A;  4DA2 A;  2L0C A;  4X3K A;  1PLF A;  2JA7 B;  2K1B A;  1W6K A;  5I9P A;  5C4J B;  1SND A;  2F0H A;  1STE A;  5JVH 3;  3OWE B;  3K5L A;  3JAM L;  3MZ5 A;  5D3D A;  3K59 A;  1PMR A;  1WTX A;  5G3L F;  4BBR B;  3T13 A;  1I4Q A;  3FKI B;  1Q90 A;  1SE3 A;  3FRP B;  3SR1 A;  3L3O C;  5EKI A;  1LT3 D;  2NB0 A;  1TU2 B;  1G2S A;  5BN4 A;  4NP5 A;  4QMG A;  3QG1 A;  1E2W A;  2EY1 A;  1TWH B;  2LS0 1;  4HAE A;  2JA5 B;  2O2L D;  3GO5 A;  3L9A X;  4IUV A;  1BBX C;  4RCO A;  4CJ0 B;  3OIP A;  3DWQ A;  3V05 A;  2B2W A;  1PFB A;  1SXT A;  1STG A;  5ISR A;  4BY7 B;  3CHB D;  4Q0F A;  5A2Q L;  4BBS B;  1Q12 A;  2L12 A;  3ND9 A;  1TWF B;  1SAP A;  4OL7 A;  3X3N A;  4IFD I;  1PRT C;  5M9O A;  2RSO A;  1SBB B;  3MVV A;  3M7N A;  3EFX D;  3KK7 A;  2HCC A;  5IGB A;  1GUW A;  4DAV A;  4ILW A;  4OO1 G;  2X6L A;  2EPB A;  1GXD C;  2LFN A;  3MXU A;  3TSS A;  3EJI A;  1LAC A;  3Q23 A;  3K0Y A;  2B2T C;  1LTA D;  3S2D B;  1CQV A;  2MP1 A;  2XWJ B;  3QOL A;  4DNR B;  2WB1 B;  4EVO A;  1ESR A;  5IT9 E;  3MWY W;  2VB3 X;  4X3T A;  1S5B D;  1EYA A;  4A3F B;  3F2U A;  1F77 A;  5ELB A;  1OO9 B;  2BDO A;  5BN5 A;  1TVX A;  3MEH A;  4XXE A;  3GTK B;  1G2T A;  3QWN A;  3J7A V;  1TWG B;  4DF7 A;  3PUX A;  1TT2 A;  4G7Z C;  1C8C A;  2MPM A;  3PIO 3;  2A69 D;  2F0Q A;  1BQQ T;  4RCN A;  2CHB D;  2DN8 A;  4KKU A;  1CFM A;  1LV9 A;  4XDX A;  1MGS A;  4QIW B;  4ZQ3 A;  2K5Q A;  1R4Q B;  5CBE E;  1G91 A;  4R8N A;  1EEI D;  2FJ2 A;  1WVL A;  2EYF A;  1DD2 A;  4FVM A;  4FP5 D;  2IX1 A;  3NTH A;  4KKS A;  1V8Q A;  1M8A A;  5IGD A;  1OXU A;  3PUY A;  4UAI A;  3IAY A;  1STH A;  4PQX A;  5KND A;  2OF1 A;  3URY A;  4Q5V A;  1QOH A;  4K8J A;  2QIL A;  1CT1 D;  1VMC A;  5ELE A;  4XYQ A;  2F0J A;  2FMM A;  4QCL A;  5I2Y A;  1CZW A;  4CKB A;  2K33 A;  1ZXT A;  2L4N A;  1HUN A;  3I72 A;  1K8M A;  1EZ6 A;  3S1N B;  2O5I C;  3MFG A;  5EJW A;  1I4X A;  1FR3 A;  1ML0 D;  4ZKC B;  3DWP A;  2K01 A;  2HDL A;  2JYO A;  3HS0 C;  1A2U A;  1EQV A;  1EU4 A;  1HQR D;  4CKE A;  3S17 B;  1EY6 A;  3MC0 B;  3W2D A;  4ZRZ A;  1SYB A;  4FXK C;  2TMP A;  3VYT A;  4XT3 B;  2XVS A;  2B2W C;  3NBI A;  2ENB A;  4F7X A;  3HEJ A;  3GTP B;  2B8G A;  3H91 A;  3MXP A;  3BVM A;  1RD9 D;  1WTP A;  3OIQ A;  1F9R A;  4A3I B;  2PW5 A;  4G7O C;  1KNE A;  1J9O A;  1SNO A;  4XIG S;  1D1I A;  1MBY A;  2PPB C;  5KNB A;  1Y8N B;  3A7A B;  2ZXR A;  1EY7 A;  5JEA G;  4RGT A;  1QJO A;  1FNU A;  2E2H B;  1GOZ A;  1I3Q B;  3R2I A;  3NPP A;  4IUR A;  3K5N A;  2KOL A;  3E0J A;  2JA6 B;  1T5X D;  1CQF A;  3TBI B;  4DK0 A;  1BNZ A;  1B9N A;  2FMC A;  5CV7 A;  4R9W A;  4KI0 A;  4PMB A;  5LL6 X;  1S4Z A;  1Q1E A;  2F0W A;  4NKL A;  5D3I B;  5KGU A;  1KAB A;  4ZLT F;  1SE4 A;  1YNJ C;  2K5W A;  3HOX B;  2K04 A;  3Q0A A;  3OSO A;  4IUN A;  2C5C A;  1SYG A;  3I73 A;  2BCO A;  2EYO A;  1KDC A;  4C3J B;  2CQA A;  2GA4 B;  4ZYS A;  3S14 B;  2Z1C A;  4OHJ A;  1RTN A;  4C56 C;  2PO4 A;  3TP6 A;  4TRD A;  3HOW B;  1IW7 C;  2JE6 I;  2F0I A;  2KVM A;  5IOC A;  2YU9 B;  3R8B A;  2A68 D;  1GUG A;  1ROD A;  2XN9 C;  1O80 A;  1I4P A;  1DJR D;  3PUZ A;  5E4X A;  3PUW A;  5LHY 1;  4CHT B;  3EA6 A;  3K57 A;  1FYC A;  1I4G A;  1UAP A;  4WJW A;  4G7H C;  3NWT A;  1QB5 D;  3WDN A;  4NMZ A;  3IL8 A;  3FDT A;  1PTO H;  1AW7 A;  1H9S A;  3BVG A;  1LLR D;  2G9D A;  5IGE A;  2OEO A;  3ERO A;  1SNQ A;  1EY5 A;  3MAQ A;  1NR2 A;  1TR5 A;  2M00 A;  2NBF A;  1VDZ A;  2B2Y C;  4BWG B;  4ODG A;  3C2P A;  4I7Z C;  3ND8 A;  1H9S B;  1TS2 A;  1K8O A;  3Q22 A;  1KLG D;  4IFD H;  1WTQ A;  1EY8 A;  1G29 1;  3K5M A;  4PV1 C;  3DHQ A;  1LTT D;  1B1Z A;  1SEB D;  3BDL A;  1O7Y A;  3A54 A;  4LJZ C;  2KQ3 A;  4V19 0;  3TP7 A;  4R8I A;  5CV5 A;  5C0X H;  3U9S A;  2BE5 D;  1U4L A;  1X3P A;  1L0X B;  3DWA A;  3U9O A;  1ZYR C;  1PZK D;  3VYS A;  2RVL A;  2RBM A;  1JOO A;  3TME A;  2ZXO A;  1CA6 A;  5BN3 A;  2JEA I;  2B2T A;  2Y0S B;  2CW0 C;  1XWE A;  4FXG C;  1LAB A;  2L1B A;  2Q8R E;  3SK6 A;  1WTV A;  3CRK C;  1E2V A;  2NUC A;  1J8I A;  4G4K A;  1BF4 A;  3VA7 A;  1BO0 A;  2JEB I;  4JBW A;  1F9S A;  2OXP A;  3RLF A;  1AEX A;  2BA0 A;  3BZD B;  2PZT A;  3J80 E;  3FEW X;  3A7L A;  1TII D;  1PFN A;  4HR7 B;  3NQI A;  2F0V A;  2RKS A;  4FF4 A;  4C3H B;  3TN2 A;  4FYD A;  1BCP D;  1DYQ A;  3NK9 A;  1HRJ A;  2F0K A;  3H94 A;  4IUQ A;  5C5M A;  5IIF A;  1STB A;  4C3J G;  1VF7 A;  1Y1V B;  5K36 G;  2F3W A;  4PMC A;  1UNS A;  1E0B A;  1C48 A;  1I4H A;  3R3O A;  5M5X B;  2D5D A;  2NN6 G;  1SNP A;  2JP1 A;  2A6E C;  3PV0 A;  3FPU B;  4IZ8 A;  4S3S A;  3NHH A;  3D8G A;  3VA5 A;  1BOS A;  2B2U A;  4C2M B;  4ULL A;  5ELD A;  1Y69 U;  2XSC A;  4V0B A;  1DON A;  2RSN A;  4DGZ A;  2D2C C;  3IKJ A;  4HCE A;  4J8Q A;  1H9J A;  3HOV B;  3K7A B;  1GUS A;  1JWM D;  2X6G A;  3PMF A;  5EBD A;  1VCI A;  2AUJ D;  3GQB A;  2SNS A;  4LAA A;  1HUM A;  1SMY D;  3OPO A;  3VYU A;  1XTC D;  3RMH A;  1KLU D;  3BYY B;  1CHP D;  1JC7 A;  3NUC A;  3SEB A;  2AQ2 B;  2SEB D;  3S1Q B;  3CRL C;  4RGM A;  4B9X A;  3BG3 A;  2K32 A;  4XQQ A;  5T1G A;  1TY2 A;  3M3Y B;  5KRU A;  5C5L A;  1DOL A;  3D31 A;  1CA5 A;  1RCV D;  2IX0 A;  1R4P B;  2IPK D;  4K2L A;  3ZYY X;  1B3A A;  5COY A;  1AN8 A;  3GTL B;  4U67 3;  1BR9 A;  2ZXP A;  4A3K B;  3TZD A;  3HOU B;  1GJX A;  2PMZ B;  5ELC A;  2K05 A;  2DY8 A;  4IUP A;  3SK8 A;  5FKA C;  1PTO D;  5FO7 B;  3QO2 A;  3AB9 A;  3GD7 A;  4ZKB B;  3J7A F;  4ZUJ A;  5C0X I;  5CV9 A;  4IN3 A;  5E4W C;  5CC4 A;  1WTR A;  3HZX A;  1H9K A;  3S1R B;  2KUM A;  3NTI A;  4MN3 A;  1ONL A;  2A6H D;  4NDX A;  4U68 A;  5F2D A;  5IOD A;  5KNC A;  3VR5 A;  3LX0 A;  4C3H G;  3K5O A;  2NTS A;  3SVM A;  2XWB B;  4HSP A;  1DM0 B;  1A6X A;  1A3V A;  1F2Y A;  4MHE A;  4KMU C;  1Q1B A;  2MJ8 A;  4IUU A;  2X69 A;  1V1P B;  2HQE A;  4M1U B;  1KNA A;  3A55 A;  3ITP A;  2KEC A;  1FD7 D;  3KLS A;  1I4R A;  1HXY D;  5TSS A;  2I46 A;  1W6J A;  1SJH D;  2VB2 X;  5JAV A;  3D3R A;  5A2Q E;  3EVQ A;  3G6J B;  4O42 A;  2XIW A;  5DAU A;  4CJ2 C;  3MA2 B;  2LKV A;  2B2U C;  2RDG A;  1GHK A;  4Z9C B;  1WTO A;  2EOT A;  2IT1 A;  4FF3 A;  4TKO B;  3RZO B;  5C4Z A;  1ILP A;  5KYL A;  2Z8L A;  2E2J B;  1WD0 A;  3NQT A;  1JWU D;  2SOB A;  1OXS C;  1JOQ A;  1YNN D;  4DAP A;  2N55 A;  4HED A;  5LL6 S;  3R2T A;  2B2Y A;  3QOJ A;  2MHV A;  2PZW A;  1SDF A;  4RHS A;  2A69 C;  5C4X B;  2QF7 A;  3LWE A;  2BA1 A;  3OMG A;  1B2T A;  2TSS A;  1EWH A;  4KTA A;  3K58 A;  2WAC A;  3CKI B;  3MXG A;  1V1O A;  2K5D A;  1RTO A;  1EZ8 A;  3HKZ B;  3P7J A;  1O7Z A;  4K2K A;  3C3L A;  5D65 A;  1PDQ A;  1EEF D;  3D4W A;  4KV6 A;  2F0T A;  1RDP D;  4DU9 A;  1RHP A;  2XNA C;  2DNE A;  3DUZ A;  4ABN A;  3A56 A;  1HFN A;  1JOK A;  1B44 D;  1QIL A;  1IYU A;  2XRS D;  4HSV A;  4L8J A;  3S1M B;  3NTK A;  3H09 A;  4K5X A;  3GTG B;  2WP8 J;  1B50 A;  1NAP A;  2D62 A;  3D4R A;  5DM7 3;  3HP3 A;  2KJX A;  4H13 C;  5D14 A;  2QDB A;  5A35 A;  5J22 A;  2KED A;  3DEO A;  4BS9 A;  4RKB A;  2Z4H A;  4C3I B;  3FMC A;  4DNT B;  2F0N A;  4IFD J;  3V96 A;  3L7Z C;  1Z6H A;  1E2Z A;  1B4O A;  1LO5 D;  1LTI D;  3QB3 A;  1HFG A;  1Y8P B;  1NUC A;  4P2C B;  1DZ1 A;  4IAL A;  3HRZ C;  1GUO A;  5EPK A;  4FXD A;  5E1F A;  2E2D C;  1AFP A;  1ENA A;  3J81 E;  4N9P A;  1F2L A;  1JR0 D;  1S5F D;  5J39 A;  1CM9 A;  1GHJ A;  3TZU A;  4FF2 A;  5EKK A;  4Y7N B;  3LNN A;  3NBH A;  5KIX A;  3OW7 A;  1U9R A;  2J0T D;  1EY4 A;  1ILQ A;  2A74 C;  1STN A;  1VMP A;  1ET6 A;  2SDF A;  1ESF A;  1A3T A;  3HG9 A;  2QKI C;  4K5W A;  5M5Y B;  1WCM B;  2L55 A;  4XT1 B;  2ICE C;  2ICI A;  2WII B;  1Z7T A;  3GTJ B;  4RGN A;  1SYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...