4N9TA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92s at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYSYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4n9tA00
5CV4A 3HEJA 5NUCA 4DGZA 1II3A 3LX0A 3U9OA 3NHHA 2EXZA 4KD4A 5IGEA 3R3OA 1EY5A 3C1FA 4K2LA 1ENCA 1SNCA 1STGA 2QDBA 4DFAA 1JOQA 1A3VA 4QB4A 3OWFA 1EY4A 5KYLA 5DAUA 3SK4A 4RKBA 5C4HA 5EGTA 5JOBA 1KDCA 5DEHA 4KV6A 5JAVA 1SYCA 2RKSA 3HZXA 2F0QA 2F0IA 3QOJA 1ENAA 3SK6A 4EQPA 5KGUA 1SYFA 1TR5A 2F0UA 2O4XA 4B9XA 3D4DA 3OMCA 2PW5A 3NP8A 4KJOA 5HGTA 1A3TA 4PMBA 4KY5A 3SK8A 5I9PA 4K5WA 2F0HA 2PZTA 4IUNA 1F2MA 2KQ3A 3NUCA 5I6WA 3EVQA 4H7BA 4I65A 4S3SA 2PZUA 1TQOA 3OSOA 3V2TA 5KYIA 5KEEA 3ITPA 1EYCA 3QB3A 1F2YA 5KIXA 3DHQA 4E6IA 2PQEA 2F0WA 2EYPA 4KY6A 4ODGA 2F0LA 2RBMA 4ME5A 1AEXA 1STAA 2LKVA 5CV9A 3DMUA 5I9OA 5CGKA 2F3VA 3QOLA 5C4ZA 1SNPA 3ERQA 1EZ8A 1U9RA 1F2ZA 2HQEA 3D4WA 5IGDA 2F0VA 2SOBA 3MHBA 1SYDA 2EYOA 4IALA 1NUCA 4EVOA 3VA5A 4DU9A 3D8GA 5EKKA 3EJIA 3PMFA 3MXPA 3P75A 4ID6A 4TRDA 5CC4A 2EYJA 4K5VA 4KY7A 4YIJA 4QF4A 5IOCA 3BDCA 2F0TA 3S9WA 1EY9A 2F3WA 3NK9A 2OEOA 3BDLA 4HMIA 5CV7A 4K14A 4ZQ3A 4F8MA 1RKNA 5ISRA 4B9WA 1EYDA 4ZUJA 2EY5A 2EYMA 4KJNA 3MVVA 4EQOA 1SNMA 3TP8A 5C3XA 2ENBA 4KTAA 5CV6A 4ZUIA 3SR1A 5IODA 1KABA 2F0GA 5C3WA 2RDFA 1SYGA 2PYKA 2EYFA 2OXPA 5HURA 2F0JA 4K8JA 4NMZA 5C5LA 3TP7A 4J1MA 4PNYA 3D6CA 5F2DA 3T16A 5C5MA 4F7XA 2F0SA 2F0PA 5KRUA 1A2TA 2F0NA 3SK5A 1SNQA 1EY7A 4J6HA 5J39A 1JORA 2F0DA 2EY1A 3P1HA 1SYEA 1SNOA 2F0EA 4K6DA 4N9TA 3TP5A 1STYA 1JOOA 2F0KA 5IIFA 1STHA 5IGBA 4IZ8A 5CR3A 5IGFA 5E3FA 5K5PA 1KDBA 2EY6A 1JOKA 3MEHA 1EY0A 2NUCA 2EYHA 5C6AA 2PW7A 4WORA 3TP6A 1EYAA 5M9OA 4DF7A 3EROA 2M00A 3NXWA 4HMJA 1EY6A 1EQVA 4KD3A 4NKLA 3MZ5A 3T13A 1EZ6A 2F0FA 3SHLA 2OF1A 4QMGA 4OL7A 4KHVA 4MIUA 1STNA 2PZWA 3OMGA 4WRDA 3TMEA 4LAAA 4N9PA 1A3UA 4RKLA 4G57A 4K8IA 5E1FA 5CV8A 5IGCA 2F0MA 2SNMA 4K5XA 3C1EA 4NDXA 3RUZA 1SNDA 5I6YA 1KDAA 2KHSA 4NP5A 3E5SA 4K2KA 1A2UA 5CV5A 2SNSA 3SXHA 1EY8A 1KAAA 2WACA 1NSNS 2EYLA 2F0OA 3H6MA 2EY2A 3NQTA 4HTHA 4PMCA 4EQNA 5IGGA 1SYBA 1TT2A 5EKLA 4R8NA 1IHZA 1STBA 5J22A 5J1ZA
chains in the Genus database with same CATH superfamily
4C3IG 2LXKA 1TWHH 5J3BA 4DK6C 2LMCB 1AN8A 5CMDA 4C3HB 4A3LG 4C3HG 5IWAL 2QDBA 2I0QA 4QB4A 5EKIA 3KLSA 2V1CC 3HP3A 2C35B 3F2UA 2CWPA 2Y0SE 1B3QA 2F0QA 2ICIA 1MBYA 3MEFA 3K58A 3MFGA 1IBLL 2F0UA 5C0XI 1AZPA 4OIJA 4B3TL 1PH3A 2JA6G 1Y1VB 1RIPA 1N33Q 1Y1VG 3EVQA 4ZYSA 3OSOA 1LTTD 1IYJB 4E6IA 4AYBB 2YU9H 3GTJB 4AYBG 5FJ8G 3TSSA 1I50B 1TWFB 5I9OA 1AZQA 3S16B 2IY5B 1U9RA 1O80A 4GLAC 1NUCA 2HDMA 4CDFC 2NVYB 4DV0Q 3D8GA 5JJZA 1PTOD 2P5ZX 4ID6A 1W2BA 2Y0SB 2CW0C 1H9SB 1EYDA 1E2VA 2EYMA 4JI1L 2RSOA 5AJ3L 5C4XB 3VR2A 5C4XG 2G9HD 2OXPA 4QIWE 1L1OC 1NTGA 3VA7A 5IT9E 4LF7Q 1IL2A 1E3PA 3T16A 1Q8IA 1SMYD 4R1JA 2NN6H 4YWKA 3R2TA 2F03A 3ULLA 1IW7D 2PNHA 1CTMA 1PH1A 1RTOA 4A3BH 3MEHA 1TWHB 1C0AA 3FPPA 1EYAA 3DLLA 4ZK9B 1SJHD 3ULJA 4AH6A 2F0FA 3MXNA 1PFSA 3RZOH 1YHAA 1NMFA 2A68D 4WJ4A 3HS0C 2HDLA 5FLMH 3UE0A 3TMEA 1TS3A 1QZHA 2PMZE 5IGCA 4I7AA 3A54A 3RD4A 3RUZA 2K01A 1BUVT 4G7HC 2PCFB 1WYDA 1NSNS 1OXXK 2B8FA 2EYLA 2EE1A 2F0OA 4QIWB 4EQNA 2OTLA 5J1ZA 1XX8A 1PH6A 2R61A 2YU9B 1EY5A 1SNCA 1SSOA 4DFAA 1Z47A 2I5MX 4Z9CB 4GZYC 3TBIB 3CMEA 4L5TA 1PTOH 2AWOA 1E24A 1FVIA 4A4IA 3H0GG 3CCJA 1B44D 1MJCA 4JC0A 3RLFA 4KJOA 3DEOA 4RGMA 2PMZB 1Q7YC 1PZJD 1O7YA 1ZYRD 2N88A 4IPCA 3J81E 1VQPA 4L6TB 1IBLQ 4DK1A 5EPLA 2JQOA 4LF9L 4P74A 2F0WA 3B6YA 5I2YA 5DM63 4ZKBB 3E6ZX 4C1NK 4JI0L 5L37A 4PV1C 1DD2A 3QOLA 2MGSA 4OO1I 4IN3A 2H5XA 1RCVD 2EYOA 2NN6G 4FF3A 3BU2A 3H3VC 2K7VA 5A2QE 1Q81C 4A3BB 4A3BG 4B3RL 1FD7D 4A3FG 4LF8Q 1VQEA 3I56A 3KLSX 2K28A 1SDFA 1QVCA 5CBAE 3RZOB 5ELNA 5ELDA 1HH2P 2JK8A 2BDNA 3OTOL 3QO2A 5FLMG 3CMAA 4JW0A 2NWGA 4R4CA 1EUJA 5M3MG 1J6QA 1XXGA 4UP8A 2B2YC 5E4XA 5IIFA 3AYHB 1EIGA 3CRLC 2AQ3B 2EQSA 1KDBA 3D31A 4CJ1B 1BBWA 2QCPX 1PH7A 1E1TA 3T51B 1S40A 1ET6A 1NAPA 2X6LA 3E0EA 3FP9A 4CDEC 3Q8DA 3PUZA 1QB5D 2RA4A 4X6AH 1TS2A 3A5ZB 5C4JH 4POFA 3AB9A 2SNMA 1PTOB 1ESFA 1C8CA 3VDYA 4YCUA 2SNSA 4HTHA 4RFBA 1EQRA 2D5DA 5E7NA 2A19A 3BDOA 1UE6A 1O7LA 2EIFA 4DAPA 4XQNA 4KKUA 1A15A 2CQAA 4UAIA 5C4HA 4GKJQ 2A6HC 1K28A 3VR4A 4HJ9A 2K52A 2WB1E 3NTIA 2Q8RE 4CJ2C 1EWCA 1LABA 4DAVA 5DNFA 4DR2L 3PO2H 2PPBC 4O0AA 3CC4A 2VNUD 3S1RH 4RWSC 3SGIA 4FXDA 4R8IA 4C3JG 1W3SA 1T5XD 4X3TA 2ES2A 3GV3A 4TVAB 1JJGA 2LS01 3BVZA 2Q8IB 1OTCA 2G9DA 1QNUA 2O5IC 1I6HH 4ALPA 1SNPA 2R6GA 1G291 2F0VA 1ZEQX 2PNRC 1GUWA 1KL9A 1EFID 3GV6A 1W6JA 4X65Q 3EJIA 4HEDA 1ESRA 3MAQA 3R2IA 2WB1B 5C3EB 5C3EG 2JA8H 5CV7A 4RAUC 3KDFA 4LF5Q 4B9WA 2EY5A 4XT3B 1SEBD 2XIWA 5EAYA 1C9OA 4RHSA 2Z4IA 3BYTB 5C4JB 2KHIA 1BXTA 1TY2A 2DNCA 2VW9A 1PFNA 1IZ6A 4FVMA 1I94L 3OTOQ 2XWJB 1M4VA 4ZRZA 3A7LA 1YVCA 2KEDA 4IZ8A 5CR3A 4G7ZC 3OW7A 1O7ZA 3WWVA 1Y8OB 2EY6A 3PUYA 1C48A 1XMOQ 2PW7A 2V4DA 2IHEA 3CAMA 2RF4A 4HMJA 3KJOA 2D0PA 1LTRD 3T13A 3N52A 2SDFA 4F88A 1XJVA 2N49A 5LHY1 1GUGA 1L0YB 5CBEE 3HG9A 3MXGA 3PO2B 4DV3L 4XDXA 3VR5A 3PO2G 1BBUA 1VF7A 1FGUA 3HOVH 3S1RB 1KIXA 3BVGA 1XTCD 2BDOA 2YTYA 5TSSA 2A69C 5GADC 1AE2A 1STBA 4A3DH 1TU2B 2RCNA 4LNQA 4HR7B 2EXZA 2ATWA 1PYBA 2XVSA 1E1OA 1JC7A 5M5XH 2GA4B 1PA6A 3T1YQ 3KDFB 5KNDA 1EY4A 3W3AA 1I6HB 3J81j 3T1HQ 5JVG3 5DEHA 4TSSA 3I4LA 4IUPA 4RCOA 5LMUL 1WTQA 1KRTA 4DV5L 2E5LQ 2B39A 3NTHA 2JA8B 2J0TD 2JA8G 1LTAD 4DR2Q 5I6WA 1UAPA 4GN5A 1LUZA 4DAYA 3V2TA 5KYIA 1MGSA 4JBJA 1F2YA 5FOBB 1EL0A 1PYSB 1EIYB 3OIPA 4GN3B 1JMCA 5BN5A 2F3VA 2IPKD 4HIMA 4IALA 2ZTDA 2ID0A 3CW2C 3BZDB 3TS2A 2MO1A 3WDNA 4TRDA 1I6VC 4K5VA 4YIJA 4IJHA 2FJ2A 1GOZA 2FINB 1OO9B 2K5NA 1G6PA 1L0WA 1RF2D 3BDLA 1DONA 3TEHB 3A8JE 1PFMA 3VYTA 2LXJA 1LT4D 5GAGC 5CV6A 2A74C 1JJ2A 1P16A 1T9HA 1D6EC 2RDHA 1IBML 2CH4W 5BR8L 2WINB 1NR4A 2ZTCA 1EY7A 1X9NA 3HOVB 1QWYA 3HOVG 4QUCA 5FLXc 1B7YB 5A35A 1STHA 1F9RA 2AUJD 2ICEC 5IGBA 4A3DB 2E2HH 2VS1A 4DXFA 1V1OA 1QCBD 1QJOA 3K59A 4JV5L 2YV5A 3A55A 5M5XB 3R93A 4A93H 3J80E 4DAYB 1Z7TA 4KHVA 1VQNA 4C2MH 1D5XC 1QILA 4N9PA 4HIDA 4L8JA 1Q3LA 1B9MA 4JI2L 1NBWA 3P7JA 4RCNA 1N32L 2EY2A 1YJWA 2C5CA 1V1QA 1SROA 4L5RC 2BA1A 1P8LA 1VQCA 4IUQA 4V0BA 1IYUA 3I91A 4ZAIA 5NUCA 3L3OC 3RZDH 1GUTA 4R9WA 3KLRA 1AE3A 1YNNC 1D2BA 1BVSA 3FVQA 3CF5A 2BH2A 3CPWA 1H9MA 1JJCB 1HJPA 2VXWA 3CU7A 4BY7H 3VYRA 2TSSA 5JPNC 1YBYA 5M3FH 2ZM6Q 3RR5A 3U4VA 3H09A 4RH6A 4KY5A 5ELFA 2QILA 3ZYYX 3E9HA 1VMCA 2K75A 4FP5D 3BZCA 4HJ5A 3GTKH 1UUPA 2D62A 4ODGA 1KNEA 4ME5A 1UWVA 3FKIH 1XNRQ 1EWIA 1M1KC 2JEBI 1VQ8A 1PTOF 3WOFA 2NB0A 1VQ9A 2B8GA 2B2TC 3A5UA 1N33L 3K5NA 2E2HB 1PRTD 2DGYA 3KYHC 3SE0A 2DJFC 2DY8A 4DR3Q 4JBMA 1VQDA 3JAME 1PH8A 4C2MB 3EBEA 2B29A 4DV0L 1LYLA 2ASBA 3HOZH 1LLRD 4HJ7A 5IP9G 1CKMA 2GVBA 2FHTA 3RLNA 2E2JH 1QNKA 2BE5D 2F3IA 2ZXOA 1KLUD 4RHRA 4ZLTF 1ICFB 3KFUA 4JBKA 1IBMQ 1G2SA 4BXXH 4Y7NH 2XN9C 3RZDB 4DF7A 3ICEA 1WFQA 4LF7L 2K5VA 1PFBA 2RQXA 1I4GA 3OMGA 4G4KA 4M8AA 4BY7B 1NJIC 3M3YH 3S17H 4BY7G 1F2LA 2QEXA 2Q2UA 5EPKA 3MC0B 1V8QA 3CXCA 3H91A 5M3FB 5M3FG 1U5KA 3ND9A 2G5DA 4PMCA 5JJLA 1HZ9A 2F4IA 2KA7A 4JI2Q 3S1NH 1UE5A 1I3QH 2L0CA 1EQTA 3GTKB 4JI8Q 5JVH3 1A6XA 4NW2A 2IW3A 3FKIB 3FKIG 4BBSH 1DYQA 2F4VQ 1CSPA 2D9UA 2JA9A 1ASZA 3CC2A 2CFMA 1KD1C 4JI7Q 2R3ZA 1HA6A 2EZVA 3U4ZA 5KGUA 3AEVA 3OMCA 2ALYB 1DGSA 3CD6A 3M7GA 4GN4B 2ZTEA 2B2WA 1BOSA 4UY8C 3I4MH 4DUYL 2LSSA 2PZUA 1TQOA 3D3RA 3MFYA 3AFPA 2B3GA 5IY0A 1A62A 1GJXA 5CV9A 3QIAA 3HOZB 2J4XA 5C4ZA 1IBKL 4A3JH 2E2JB 2K6AA 3HOWH 3JC66 3DEPA 2AMCB 4KLKA 4K6LA 1VCIA 4HAEA 3PQIA 3CCUA 3S9WA 1GUNA 4QF4A 2L4NA 4Y7NB 1FJGL 1GKHA 3UDGA 4IJLA 1HZCA 2WIIB 3NWTA 5ISRA 3J7AV 2GVAA 4JOIA 2K04A 3CCEA 5GAEC 1SYGA 5C5LA 3S17B 3ND8A 3M3YB 4NPSA 5EPJA 2VY3A 5C5MA 4F7XA 2F0PA 1X3EA 2NZHA 4LF8L 3GTGH 3DWAA 1SBBB 1PTOC 1VQJA 3NWSA 1C4QA 1F9QA 1JOOA 3ER0A 1XNQL 2B2UA 2CQOA 5E4WC 1JOKA 2KBNA 3LNNA 3S1NB 1I3QB 3QWNA 2Y0SG 1XPRA 1EQVA 1HQMC 3MZ5A 1VQ4A 1YHQA 1KNAA 1G6ZA 1GUSA 4BBSB 4BBSG 4OO1G 3J81L 4KHZA 4RKLA 5E1FA 3PF5A 4BY1H 3KJPA 3J81i 3F1ZA 4NP5A 1PRTB 3GTMH 1IW7C 1K8OA 2UUBQ 1JT8A 1SYBA 5HURA 4ZCKA 1A0IA 2CW0D 4H13C 3DXJC 1TY0A 3C1FA 3R3OA 3QG1A 1QVFA 3S1QH 4A3JB 4IPHA 2Z6KA 2JYOA 4A3JG 4HJ8A 4ME3A 4OWWB 1YNJD 1K0RA 3HOWB 1HR0Q 2N3SA 2VL6A 3U50C 4DK3C 1CHQD 4U68A 3GO5A 2BCOA 1PH9A 3I90A 2IJ0A 5HGTA 2MHVA 1JWUD 4QQBX 3BVMA 4IUNA 4PMWA 4GKKQ 4Y52H 4I65A 2UXCQ 3G7LA 2Z1CA 4HCSA 4GKJL 4IPDA 4FF1A 2MO0A 4DPGA 4DUYQ 2Z6BA 3NEMA 4YHHL 1W6KA 4B3ML 5KNBA 4BBRH 3AFQA 1X55A 3IKJA 2HCIA 4OWXB 4EVOA 2UUAQ 2YTVA 4MTNA 3E3XA 1IBKQ 2KCNA 4LF6Q 4JCVE 2EVBA 4MN3A 4CHTB 4JI3Q 2VUMH 4F8MA 4ZQ3A 5M5YH 2H4OA 1MIUA 1FJGQ 3HGBA 4UP7A 3SR1A 1HTPA 2BA0A 1BBXC 2F0GA 2A6ED 1PVOA 1BR9A 2EYFA 4FF2A 4X65L 4BY1B 1B53A 2F0SA 1BCPD 1WD0A 3GTLH 1SNQA 3O13A 5FLXL 3GTMB 3M9BA 1I4RA 3BS1A 2KECA 2EXDA 4LF5L 1Q90A 2CHBD 3K7AH 1WD1A 1ILQA 1X3GA 2Q2HA 1KRSA 4FNFA 4IUVA 4DV1L 4DV6L 5M5WH 3NXWA 1XNQQ 3PV0A 2Z0SA 5IE8A 4DXGA 1S5ED 1D1IA 4O2DA 4DAMA 1I4HA 3HOXH 3RN2A 1YJ9A 2I46A 3S2HH 3STBC 1ENFA 5GAHC 1WTVA 2OQKA 1SNDA 2K4KA 1IKLA 1CZGA 3T4AC 1XMOL 3SXHA 1KAAA 2A1AA 1RL2A 5HGQA 2K1BA 5KRUA 3SK5A 1D8LA 5CV4A 3U9OA 4HIOA 4KD4A 2QW7A 2RHSB 3X3MA 3OYYA 1JWSD 3ULPA 1ENCA 1HNWL 4LFAQ 5I4DA 5I2XA 1LACA 3SK4A 1TKWB 4BBRB 1V1PB 3HOYH 4BBRG 2D0OA 3L9AX 3HZXA 3SDZA 4AQYQ 4H44C 1A3TA 2XRQD 4K5WA 4GOPC 2VUMB 3T1YL 2VUMG 4QCLA 3IAYA 2Q2IA 5M5YB 3T1HL 2PQAA 2C9OA 1L2FA 1SE3A 1CQVA 1CQFA 1TWGH 2HUGA 3CPFA 1KQSA 2FMCA 1YEZA 2LKVA 5GROA 2E5LL 2IL8A 5D3IB 2HQEA 1SFOH 3SEBA 3GTLB 4KN7C 3VA5A 1WI5A 2AQ2B 4IFDI 2K05A 1JWMD 3K7AB 4YHHQ 4B3MQ 1M90C 4A3GH 4ILWA 2L9HA 1RDPD 2R92H 2L5TA 2DY7A 5M5WB 1L0XB 1E7ZA 1DXMA 2OWOA 1YI2A 5IODA 2WKCA 2A6HD 2EOTA 3T53B 5DM73 3HOXB 3S2HB 2X69A 3TP7A 3X3NA 4DR4L 4TKOB 4EX5A 4NXMQ 1CHPD 1VF5C 1D5ZC 2WP8J 4GNXC 2WAQE 2E75C 3PCOB 3G4SA 1UE1A 1RJTA 1EFWA 4X66L 3UDFA 2I5HA 1UE7A 2WB1G 3I4NH 2BOSA 1S5CD 2HT1A 5JEAJ 1EU4A 4RGOS 2OTJA 1I4QA 4LUZA 2NZ1D 2PQAB 4DV1Q 2QKIC 4DV6Q 2K33A 4QL5A 3BJUA 4WRDA 3HOYG 3HOYB 4C56C 5CV8A 2B2VC 5I6YA 1YIJA 1HRJA 3IFDA 3E5SA 1X6OA 1R9TH 4HSVA 3H6MA 4L5QA 1FGBD 4R8NA 1Q12A 5EJWA 3NHHA 4OELB 1TWGB 1NCVA 2B2YA 1DM0B 5FO7B 1H9RA 1SFOB 1BCPB 4Q0FA 1HNWQ 3J81c 2L11A 1HHVA 2RKSA 3DWQA 4LF4Q 2ZXRA 5IP7H 1SYFA 2O4XA 2NZOA 4B9XA 4A3GB 3SVMA 1MD2D 4A3CH 2R92B 2A5HA 3CCQA 2R92G 2NVTH 1HR0W 1ONLA 1EEFD 2VQFQ 1AW7A 3R8BA 3PSIA 2F0LA 1S5BD 2RBMA 1ICWA 1Q8KA 3OOCA 2NBFA 2QA4A 1PH4A 4DKAC 3K0XA 2ZM6L 5IGDA 1B50A 1D5MC 1YZ6A 1OXSC 3AQQA 1SYDA 2YTXA 1GHJA 2ZT9C 2HHHL 1PRTF 1CKOA 3MXPA 1WVLA 1VQLA 2QF7A 3BDCA 2N55A 1D1KA 2K14A 3I4NB 3ONAB 3FDTA 1EIFA 4K14A 1VQAA 3TZDA 1XNRL 1Y8NB 1SXTA 3C46A 4CDCC 4IPGA 4IOCA 1NMGA 4OEMB 1BQQT 1D7QA 5K36H 5H1SE 1R9TB 2EY1A 1XWEA 4DR4Q 4DR3L 1BKBA 2I07B 3CHBD 3RN5A 3FPUB 4F87A 3RMHA 1EY0A 3HFZB 2WKDA 5C6AA 1JB3A 3QR8A 1VQGA 4X66Q 2O2LD 2VQEL 1JQYD 1CM9A 3HKZE 1PLFA 1KHIA 4KKSA 1HTLD 1J8IA 1H9JA 3W2DA 5IP7G 2AWNA 2HIXA 4ULLA 2K5QA 4A3CG 3A74A 1U4MA 2Z8LA 4A3DG 3M4QA 4GLVB 2NVTB 3LX0A 1KC8C 1UEBA 2JA5H 3HRZC 4GLXA 1A3VA 3N6RA 3OWFA 1DOMA 1QG7A 3ERSX 1JE5A 3FRPB 4UDUC 4KV6A 2UXBL 4PZ7A 4XYQA 4X64L 3QOJA 1ENAA 2JXMB 1UNSA 2CWAA 1MSGA 3H3VI 3OIQA 1EYGA 3D4DA 3PUVA 3NP8A 3Q0AA 4FF4A 3K81C 1VQFA 2KCCA 4JI8L 3J7ZC 5JEAH 4QY7A 2F0HA 4IURA 1N8RC 2Q8TA 4L5SA 1MI2A 1T5EA 1XPOA 4DNRB 1DJRD 2XTIA 4OONA 5KEEA 1PDQA 2F4VL 1G91A 4JI7L 3W1BA 4A3MH 1F2ZA 3NBIA 2SOBA 1HPCA 1JICA 4CKBA 4P71A 4BS9A 4J8QA 2E2DC 3KLWA 2B63H 1K73C 1WTWA 5LL6S 1E0BA 4R4OA 2RSNA 3V05A 4KY7A 5IOCA 3Q24A 1MSHA 4R4IA 4P73A 5GQOA 1KAWA 2HHHQ 1N9WA 3K7UC 2HD3A 3GTQH 3LGJA 4KJNA 3GD7A 4YWMA 2M9VA 3PGZA 2TMPA 3UDIA 3L2PA 4HIKA 1VDZA 2F0JA 2E2IH 3FHWA 3CC7A 1EEID 3TREA 1EU3A 1HA5A 3S1MH 3A8KE 3P1HA 1B9NA 4DR5Q 2UXDQ 1U4RA 1N36Q 1E2WA 1YHBA 4IFDJ 4N8FA 1PZKD 3NTKA 4DV7Q 1PRTC 2L15A 4WORA 4CBVA 1VS0A 4CKCA 3K57A 2GN5A 2KOLA 5FO8B 2JA5B 4NKLA 4A93B 2O5JC 4DR7Q 1X54A 4A93G 4YCVA 5ELEA 1TWAH 4FXKC 4MIUA 3DWPA 1F77A 4LAAA 4LJZC 4PQXA 2J7ZA 4G57A 3GQBA 2VQEQ 5C44H 4JOIC 4QUFA 1QE6A 2BE5C 3PO3H 5JEAG 4C3IH 5JJIA 5IGEA 4K2LA 4A3LH 2B2UC 1PH5A 2AKWB 2KVMA 4BA1I 5JJKA 3LWEA 1MHWC 1AH9A 4XQJA 1GVPA 2RHQB 3KK7A 4QJFA 3PIP3 2UUBL 2IX0A 4LW1A 1X3QA 2HQLA 2UXBQ 5FO9B 4WJWA 4X64Q 2JA6H 1Y1VH 2VB3X 3NUCA 3GTQB 1OXUA 5KIXA 3QB3A 3UE1A 3DHQA 5FJ8H 4KY6A 1SE2A 2JN4A 1HR0L 4L63B 1LO5D 3NPPA 2E2IB 1FL0A 3MA2B 1EQQA 4KHPQ 3UDXA 2X6GA 5G3LF 2KCMA 2UU9L 1HUNA 2A8VA 2KEEA 1GXDC 4RG1A 4DU9A 3S1MB 1BO0A 4GKKL 3PMFA 5CC4A 2UXCL 1PV4A 2F52A 1FNVA 4CDDC 3K5MA 1LT5D 5IT9L 1K0SA 1DCZA 3V96A 3MVVA 1E22A 5C3XA 4MHEA 3S2DH 1TWAB 4KTAA 4ZUIA 1E2ZA 4YCWA 2UUAL 4M1UB 1AP0A 2PYKA 5D3DA 3I8ZA 4B3SL 1BCPF 3TZUA 3HOZG 1Y1WH 4POGA 5C44B 4LF6L 3PF4A 5C44G 3A7AB 3EQLC 4JI6Q 3D6CA 5F2DA 4DV2L 3Q22A 1A2TA 3D6WA 4JI3L 2IX3A 2F0DA 2L55A 1I4XA 3UI2A 3PO3B 4AYBE 3PO3G 3TP5A 5K5PA 4C3IB 3M85A 3IRBA 3HKSA 4BXXG 1RD9D 3W1GA 1WTPA 4KI0A 3TRZA 1CKNA 4FDBA 1VQKA 4OHJA 1TVXA 3KF8A 1Q1EA 2B2TA 2OF1A 2FMMA 3Q6SA 1TXYA 3I4OA 3MXUA 2PZWA 3F2DA 4B08A 3C1EA 4NDXA 1GO3E 1KXLA 4JG2A 2K5DA 1EOTA 1VQBA 2BH8A 2E74C 3I3CA 2L1BA 4KK7A 3M4OH 2JA6B 1GHKA 3EN2A 2RCFA 5CYUA 2RVLA 4MTKA 2MJ8A 1PH2A 3HEJA 4I7ZC 4DGZA 1II3A 2H1EA 3MWYW 3CCLA 3G6JB 1STGA 2R93H 4P2CB 5EQ0A 1CFMA 3NBHA 4LMQD 1SYCA 2AUKA 1HNZQ 2R7DA 1B2TA 3GTOH 1SMYC 3EFXD 4IFDH 2OT2A 3NE5B 3H0GH 3NENA 1LTGD 4RMFA 2XRSD 4LFAL 3TQYA 3I4MB 2KQ3A 3I4MG 1FR3A 3VYUA 1IYVA 4XTCS 4OX9Q 4RGTA 3J7AF 3S2DB 3L0OA 5IYDH 3MTSA 1SJED 2E8GA 2MNAA 2ZJQA 1CKNB 3DMUA 5A2QL 5EBCA 2NVXH 1Y1WB 1VQOA 1I5FA 5ELCA 1Y1WG 2A68C 3KF8B 2EDGA 1WTXA 3D4WA 1QUQA 4HJAA 1RODA 4AQYL 1YNJC 1N34Q 4FYDA 3HOWG 4NXNL 1G2TA 2JP1A 1U4LA 1WTHA 1Y8PB 5EKKA 3I7FA 3JAMc 5IYCH 4UPAA 2UU9Q 1QOHA 4A3FH 2OEOA 1QZGA 4HMIA 4DUZQ 4ZUJA 3PIPA 2QDLA 1YJNA 1VQMA 3E0JA 2AHOB 1VQ6A 2RDFA 5LMNQ 2CH4A 5M3MH 3QJYA 1DZ1A 2F0NA 3NBHB 4J6HA 5J39A 3GTGB 3F2BA 4B3SQ 3M4OB 5G3LD 1XMQQ 3G71A 2FXQA 4DV2Q 1WOCA 2ZJRA 4DV4L 4ABNA 4JPBW 1K3BC 3TP6A 1ZYRC 4CJ0B 3EROA 2KJXA 2R93B 2R93G 4NXML 3SHLA 1MKHA 4QMGA 1V1PA 2A6EC 1A8VA 1K8AC 2MP1A 1DOKA 3CCSA 2NYZD 3I2ZA 5IWAQ 3BYYB 3GTOB 4K5XA 2DNEA 4BY1G 4IFDG 1BCPC 3H0GB 3A0JA 4JK1C 1QUQB 1LV9A 1B3AA 1EWHA 5EKLA 4JYAL 4YY3L 4EGVA 1K83H 1S3OA 1Y14B 4DK0A 1IL8A 4B3TQ 5IYDG 1RHPA 1JOQA 4HCEA 1X32A 2NVXB 2E76C 3S1QB 3MXNB 5JOBA 4APVA 4A3KH 4A3IH 2N8NA 1PZID 5ELBA 2XNAC 1FNUA 5IYCG 2PO4A 1K9MC 4P72A 4FXGC 4A3FB 4BWGB 1KLGD 4R4TA 4C3JH 4DR1L 2PZTA 1F2MA 3I70A 1L1OA 3D4RA 1ASYA 1OXTA 3ITPA 1WTRA 1CSQA 2IHFA 3H94A 4LF4L 2AQ1B 1XTDA 3RNUA 3STBD 3LWUA 4LFCL 1NE3A 4JI1Q 4XIGS 3MHBA 5M3MB 5AJ3Q 1U0LA 4ZKCB 5COYA 1C7YA 5JPMC 2D2CC 1DOLA 2EPBA 1TIID 4TQUS 2F0TA 2VQFL 1YNXA 1X56A 4H0LC 5C3EH 4KMUC 3S15H 3U58A 1JE4A 4NXNQ 1CI3M 1HQRD 4C1NI 4KKTA 3FEWX 1SNMA 3TP8A 1BF4A 2XGTA 4RA8A 4LFBL 2YYZA 3CP0A 4K8JA 4V190 4J1MA 4PNYA 4K0KL 1HCZA 1U4PA 3KBGA 1S5DD 1LM0A 4WJ3M 1JORA 1RTNA 1OXVA 2L12A 3K5OA 1J9OA 5T1IA 4N9TA 5IGFA 2F0KA 3VR6A 1TWCH 2NUCA 4HN7A 1B1ZA 1K83B 5IT9c 1GD7A 5M9OA 4XXEA 5FLXE 2JEAI 1L1OB 4DV4Q 4AIMA 4A3KB 2VZAA 4A3KG 4A3IB 3HOXG 4K8IA 4A3IG 1AFPA 2PI2A 2QEJC 4JI4L 2QGQA 1K8GA 2NN6I 4QGUA 2XWBB 4KN4C 5CORA 3H3VH 1BDOA 1EY8A 5IGGA 3EIVA 4XQQA 4C3JB 1TT2A 2LFNA 5J22A 1J5EL 1Z9FA 3M4YA 4IUUA 2LY7A 3A56A 1JR0D 1HZBA 2VB2X 4JYAQ 3J7YW 1F9PA 1M8AA 3I55A 4YY3Q 2PI2E 5KYLA 5KNCA 4MNOA 4LF9Q 5EGTA 1V43A 5JAVA 2IT1A 3PIO3 4JI0Q 3SK6A 4H02A 1LTBD 4A3EH 1XYIA 3OHXC 3HOUH 2PW5A 5C0XJ 1Q82C 4LUVA 5I9PA 3S15B 3G6EA 1PXUA 4HSPA 1VQHA 4BA2I 2Z9HA 1B4OA 1EYCA 2WAQB 4B3RQ 1X65A 2WAQG 3W5OA 4DR1Q 1AEXA 5CGKA 4UP9A 2KHJA 2XSCA 4UHVA 1CT1D 1VQ7A 1LT6D 3TS0A 4X3UA 2R7ZH 3CCMA 4LFCQ 2EYJA 1TWCB 1NNXA 3K0YA 4A3GG 1IKMA 1PMRA 1ML0D 2MUYA 3AMUA 2K5WA 1JCKB 1X3FA 3OWEB 1LTSD 4DN4M 1CZWA 2N78A 4NB3A 2MFIA 5C3WA 1HNXL 2RDGA 1SE4A 3DUZA 2IWHA 1CUKA 1SLJA 4GOPA 1LTLA 1JB7A 2WFWA 4LFBQ 1MJEA 1X3PA 3TDQA 2JA7H 2F0EA 4K6DA 5FKAC 3J80L 4K0KQ 4A75A 2A69D 5E3FA 5LMNW 1LTID 2UUCL 2EYHA 3I4NG 3J80i 3BZKA 1G51A 3NQIA 1EY6A 3GDEA 2ZJPA 1B8AA 1EZ6A 2EJFC 3M7NA 1VQ5A 4OXPA 1HXYD 3RLOA 1STNA 4DR6L 2OQ0A 4DR5L 2UXDL 1N36L 1ZKOA 3U9SA 4DV7L 1UEAB 4A3EB 4A3EG 1GM5A 2Z4HA 1A2UA 3HOUB 3HOUG 2WACA 5D65A 4LK1C 4JI4Q 1S4ZA 3URYA 4DR7L 4OWTB 3GTPH 1V9PA 1K3RA 4CKEA 4X3SA 4YWLA 4GNXA 1J5EQ 2KCTA 4DNTB 5DAUA 4RKBA 4RGNA 1KDCA 3F2CA 2R7ZB 2R7ZG 2SEBD 3CQZH 5ELOA 4OGQC 3P20A 3CKIB 1S5FD 4N8X1 3CCRA 3K80C 1Q86C 1G8ZD 1TR5A 4GOPB 4XT1B 1XPUA 1WCMH 4PMBA 3SK8A 3IL8A 5BN3A 4S3SA 2Q2TA 1K8MA 2B2VA 2WV6D 3F8TA 3KF6A 5D14A 2JE6I 2A73B 2EJMA 1STAA 4IUTA 3C2PA 2NVQH 3VR3A 4DA2A 2ZXPA 1GUOA 3A8IE 4JVZA 5LL6X 3NELA 2JA7B 2KENA 1Q1BA 2JA7G 1PHJA 3P75A 4X62L 3JAML 3AU7A 2DN8A 3HKZB 4U673 3HKZG 1EY9A 2FFKB 1I94Q 5BN4A 4MZ9A 3JAMi 1RKNA 4GS3A 4EQOA 1S72A 3M4PA 1QVGA 4KHPL 3NSWA 2EJGC 2ENBA 3PIOA 4FO2A 2NTTA 1NY4A 1KABA 3E9IA 4NMZA 5IP9H 4GNXB 4WFN3 1CA5A 3BG3A 5C0XH 5K36G 1HNXQ 1SNOA 1LT3D 1WTOA 5FK9C 4DV3Q 1IXRA 3TN2A 1CK1A 5T1GA 3GTPB 1H9KA 3G48A 1YNND 5HY6A 1BNZA 2KUMA 4JI6L 2UUCQ 4OL7A 2B2WC 3KF6B 4JI5L 5EBDA 3CQZB 1A3UA 1EIHA 2M2LA 1O78A 1SR3A 1KTKA 1KDAA 1R4PB 2K32A 1Q46A 2DJGC 4K2KA 5CV5A 1WCMB 4DR6Q 1WCMG 2JJQA 4O42A 1SAPA 1ZXTA 2K50A 5LMUQ 1IHZA 4DV5Q 1I4PA 2DUDA 2IX1A 3H15A 2CKZB 4EQ5A 4J15A 4JBWA 2JA5G 2NVQB 1A63A 3WOEA 3Q23A 3DM3A 4LUOA 1HFGA 4PZ6A 3S24A 5DLQE 4P75A 1TS4A 2F0IA 1SN8A 4OIKA 1FNWA 4EQPA 2I5LX 2NTSA 3IFTA 5IYBH 2MPMA 3J7A5 3KUPA 1CA6A 1SRUA 4IOAA 3L7ZC 3S14H 4H7BA 2PQEA 2K03A 4C3HH 2EYPA 2F1MA 1B70B 1HNZL 4A76A 1VQIA 4A3MB 4A3MG 3PUWA 1SMXA 2R7FA 3ERQA 1EZ8A 4X3KA 1STEA 1H95A 5C0XG 2B63B 2B63G 4CGYB 3KBXA 3C3LA 3D0FA 3ZJYC 5BR8Q 4OX9L 2F3WA 1SE8A 4R4QA 3T56B 3NK9A 3EA6A 4Q5VA 2CVRA 4X62Q 3CCVA 4PG3A 3K8AA 1HFNA 4IO9A 4PZ8A 1HUMA 3GTJH 1VMPA 1N34L 4JV5Q 1I50H 1TS5A 1TWFH 3S16H 1Z6HA 4LWCA 1O7IA 1Y69U 4XYOA 1ET9A 3OW2A 2NVYH 1SYEA 4DUZL 1STYA 3I72A 1WJJA 2Z6KC 3K6OA 3OPOA 1HZAA 2CCZA 3K5LA 5AFWA 2MQHA 1EOVA 1N32Q 3PUXA 2M00A 5LMNL 4KD3A 3VYSA 4IQZA 2HCCA 3I73A 2K5HA 5C4XH 4OO1H 4DNIA 2HIVA 3FMCA 2F0MA 1XMQL 3CRKC 4O1NA 1R4QB 1YITA 3GP7A 4JI5Q 2KHSA 4G7OC 1F9SA 1ILPA 2JSOA 2OCEA 1NR2A 5IYBG 1FYCA 1PYWD 3NQTA 1H9SA 3J80c 3S14B 3KOJA 3DM1A
chains in the Genus database with same CATH topology
4C3IG 2LMCB 1AN8A 5CMDA 4C3HB 4C3HG 2QDBA 4QB4A 5EKIA 3KLSA 3HP3A 3F2UA 2F0QA 2ICIA 1MBYA 3K58A 3MFGA 2F0UA 5C0XI 1AZPA 4OIJA 1Y1VB 3EVQA 4ZYSA 3OSOA 1LTTD 4E6IA 4AYBB 3GTJB 3TSSA 1I50B 1TWFB 5I9OA 1AZQA 3S16B 1U9RA 1O80A 1NUCA 2HDMA 2NVYB 3D8GA 5JJZA 1PTOD 4ID6A 2Y0SB 2CW0C 1H9SB 1EYDA 1E2VA 2EYMA 2RSOA 5C4XB 3VR2A 2G9HD 2OXPA 5IT9E 3VA7A 3T16A 1Q8IA 1SMYD 2NN6H 3R2TA 2F03A 1IW7D 1CTMA 1RTOA 3MEHA 1TWHB 3FPPA 1EYAA 4ZK9B 1SJHD 2F0FA 3MXNA 2A68D 3HS0C 2HDLA 3TMEA 1TS3A 5IGCA 3A54A 3RD4A 3RUZA 2K01A 1BUVT 4G7HC 2PCFB 1NSNS 1OXXK 2B8FA 2EYLA 2EE1A 2F0OA 4QIWB 4EQNA 5J1ZA 1XX8A 2R61A 2YU9B 1EY5A 1SNCA 1SSOA 4DFAA 1Z47A 4Z9CB 4GZYC 3TBIB 1PTOH 2AWOA 1B44D 3RLFA 4KJOA 3DEOA 4RGMA 2PMZB 1PZJD 1O7YA 1ZYRD 2N88A 3J81E 4L6TB 4DK1A 5EPLA 2F0WA 5I2YA 5DM63 4ZKBB 3E6ZX 4C1NK 4PV1C 1DD2A 3QOLA 2MGSA 4OO1I 4IN3A 1RCVD 2EYOA 2NN6G 4FF3A 3H3VC 2K7VA 5A2QE 4A3BB 1FD7D 3KLSX 2K28A 1SDFA 5CBAE 3RZOB 5ELDA 2BDNA 3QO2A 2NWGA 1XXGA 5E4XA 2B2YC 5IIFA 1EIGA 3CRLC 2AQ3B 3D31A 1KDBA 4CJ1B 2QCPX 3T51B 1ET6A 1NAPA 2X6LA 3PUZA 1QB5D 2RA4A 1TS2A 3AB9A 2SNMA 1PTOB 1ESFA 1C8CA 2SNSA 4HTHA 4RFBA 2D5DA 3BDOA 1O7LA 4DAPA 4XQNA 4KKUA 1A15A 2CQAA 4UAIA 5C4HA 2A6HC 3VR4A 3NTIA 2Q8RE 4CJ2C 1EWCA 1LABA 4DAVA 5DNFA 2PPBC 2VNUD 4RWSC 4FXDA 4R8IA 4C3JG 1T5XD 4X3TA 3GV3A 2LS01 3BVZA 2Q8IB 2G9DA 1QNUA 2O5IC 1SNPA 2R6GA 1G291 2F0VA 1ZEQX 2PNRC 1GUWA 1EFID 3GV6A 1W6JA 3EJIA 4HEDA 1ESRA 3MAQA 3R2IA 2WB1B 5C3EB 5CV7A 4RAUC 4B9WA 2EY5A 4XT3B 1SEBD 2XIWA 4RHSA 2Z4IA 3BYTB 5C4JB 1BXTA 1TY2A 2DNCA 1PFNA 4FVMA 2XWJB 1M4VA 4ZRZA 3A7LA 2KEDA 4IZ8A 5CR3A 4G7ZC 3OW7A 1O7ZA 1Y8OB 2EY6A 3PUYA 1C48A 2PW7A 2V4DA 4HMJA 1LTRD 3T13A 3N52A 2SDFA 4F88A 5LHY1 1GUGA 1L0YB 5CBEE 3HG9A 3MXGA 3PO2B 4XDXA 3VR5A 1VF7A 3S1RB 1XTCD 2BDOA 3BVGA 5TSSA 2A69C 1STBA 1TU2B 4HR7B 2EXZA 2XVSA 1JC7A 2GA4B 5KNDA 1EY4A 3W3AA 1I6HB 5JVG3 5DEHA 4TSSA 3I4LA 4IUPA 4RCOA 1WTQA 2B39A 3NTHA 2JA8B 2J0TD 1LTAD 5I6WA 1UAPA 4DAYA 3V2TA 5KYIA 1MGSA 1F2YA 5FOBB 1EL0A 3OIPA 5BN5A 2F3VA 2IPKD 4IALA 2ID0A 3BZDB 3WDNA 4TRDA 1I6VC 4K5VA 4YIJA 2FJ2A 1GOZA 2FINB 1OO9B 1RF2D 3BDLA 1DONA 3A8JE 1PFMA 3VYTA 1LT4D 5CV6A 2A74C 1D6EC 2RDHA 2WINB 1NR4A 3HOVB 1EY7A 1QWYA 4QUCA 5A35A 1STHA 1F9RA 2AUJD 2ICEC 5IGBA 4A3DB 4DXFA 1V1OA 1QCBD 1QJOA 3K59A 3A55A 5M5XB 3R93A 3J80E 1Z7TA 4KHVA 1D5XC 1QILA 4N9PA 4L8JA 1Q3LA 1B9MA 3P7JA 4RCNA 2EY2A 2C5CA 4IUQA 2BA1A 4V0BA 1IYUA 3I91A 4ZAIA 5NUCA 3L3OC 1GUTA 4R9WA 3KLRA 1D2BA 1YNNC 3FVQA 1H9MA 2VXWA 3CU7A 3VYRA 2TSSA 5JPNC 3H09A 4RH6A 4KY5A 5ELFA 2QILA 3ZYYX 1VMCA 4FP5D 1UUPA 2D62A 4ODGA 1KNEA 4ME5A 2JEBI 1PTOF 3WOFA 2NB0A 2B8GA 2B2TC 3K5NA 2E2HB 1PRTD 3SE0A 2DY8A 3JAME 4C2MB 1LLRD 2FHTA 1QNKA 2BE5D 2ZXOA 1KLUD 4RHRA 4ZLTF 1G2SA 2XN9C 3RZDB 4DF7A 1PFBA 2RQXA 1I4GA 3OMGA 4G4KA 4M8AA 4BY7B 1F2LA 5EPKA 3MC0B 1V8QA 3H91A 5M3FB 3ND9A 4PMCA 2F4IA 2KA7A 2L0CA 1EQTA 3GTKB 5JVH3 1A6XA 4NW2A 2IW3A 3FKIB 1DYQA 2D9UA 2R3ZA 1HA6A 2EZVA 5KGUA 3OMCA 3M7GA 2B2WA 1BOSA 2PZUA 3D3RA 1TQOA 3MFYA 1GJXA 5CV9A 3QIAA 3HOZB 2J4XA 5C4ZA 2E2JB 2K6AA 3DEPA 4K6LA 1VCIA 4HAEA 3S9WA 1GUNA 4QF4A 2L4NA 4Y7NB 2WIIB 3NWTA 5ISRA 3J7AV 2K04A 1SYGA 5C5LA 3S17B 3ND8A 3M3YB 5EPJA 5C5MA 4F7XA 2F0PA 3DWAA 1SBBB 1PTOC 3NWSA 1C4QA 1F9QA 1JOOA 2B2UA 5E4WC 1JOKA 3LNNA 3S1NB 1I3QB 3QWNA 1EQVA 1HQMC 3MZ5A 1KNAA 1G6ZA 1GUSA 4BBSB 4OO1G 3J81L 4KHZA 4RKLA 5E1FA 4NP5A 1PRTB 1IW7C 1K8OA 1SYBA 5HURA 2CW0D 4H13C 3DXJC 1TY0A 3C1FA 3R3OA 3QG1A 4A3JB 2JYOA 1YNJD 3HOWB 1CHQD 4U68A 3GO5A 2BCOA 3I90A 2IJ0A 5HGTA 2MHVA 1JWUD 3BVMA 4IUNA 4PMWA 4I65A 3G7LA 2Z1CA 4HCSA 4FF1A 1W6KA 5KNBA 3IKJA 2HCIA 4EVOA 2KCNA 2EVBA 4MN3A 4CHTB 4F8MA 4ZQ3A 2H4OA 3HGBA 3SR1A 1HTPA 2BA0A 1BBXC 2F0GA 2A6ED 1BR9A 2EYFA 4FF2A 4BY1B 1B53A 2F0SA 1BCPD 1WD0A 1SNQA 3O13A 5FLXL 3GTMB 1I4RA 3BS1A 2KECA 1Q90A 2CHBD 1WD1A 1ILQA 4FNFA 4IUVA 3NXWA 3PV0A 4DXGA 1S5ED 1D1IA 1I4HA 2I46A 1ENFA 1WTVA 1SNDA 3T4AC 1IKLA 1CZGA 3SXHA 1KAAA 2K1BA 5KRUA 3SK5A 5CV4A 3U9OA 4KD4A 3X3MA 1JWSD 1ENCA 5I4DA 5I2XA 1LACA 3SK4A 1TKWB 4BBRB 1V1PB 3L9AX 3HZXA 3SDZA 4H44C 1A3TA 2XRQD 4K5WA 2VUMB 4QCLA 3IAYA 5M5YB 2C9OA 1SE3A 1CQVA 1CQFA 2HUGA 2FMCA 2LKVA 2IL8A 5D3IB 2HQEA 3SEBA 3GTLB 4KN7C 3VA5A 2AQ2B 4IFDI 2K05A 1JWMD 3K7AB 4ILWA 2L9HA 1RDPD 2L5TA 2DY7A 5M5WB 1L0XB 1DXMA 5IODA 2WKCA 2A6HD 2EOTA 3T53B 5DM73 3HOXB 3S2HB 2X69A 3TP7A 3X3NA 4TKOB 1CHPD 1VF5C 1D5ZC 2WP8J 2E75C 1RJTA 2BOSA 1S5CD 5JEAJ 1EU4A 4RGOS 1I4QA 2NZ1D 2QKIC 2K33A 4WRDA 3HOYB 4C56C 5CV8A 2B2VC 5I6YA 1HRJA 3IFDA 3E5SA 4HSVA 3H6MA 1FGBD 4R8NA 1Q12A 5EJWA 3NHHA 1TWGB 1NCVA 2B2YA 1DM0B 5FO7B 1H9RA 1SFOB 1BCPB 4Q0FA 1HHVA 2L11A 2RKSA 3DWQA 2ZXRA 1SYFA 2O4XA 4B9XA 4A3GB 3SVMA 1MD2D 2R92B 2A5HA 1ONLA 1EEFD 1AW7A 3R8BA 2F0LA 1S5BD 2RBMA 1ICWA 3OOCA 2NBFA 5IGDA 1B50A 1D5MC 1OXSC 1SYDA 1GHJA 2ZT9C 1PRTF 1WVLA 3MXPA 2QF7A 3BDCA 2N55A 1D1KA 3I4NB 3ONAB 3FDTA 4K14A 3TZDA 1Y8NB 1SXTA 3C46A 1BQQT 5K36H 1R9TB 2EY1A 1XWEA 2I07B 3CHBD 3FPUB 4F87A 3RMHA 1EY0A 2WKDA 5C6AA 1JB3A 2O2LD 1JQYD 1CM9A 1PLFA 4KKSA 1HTLD 1J8IA 1H9JA 3W2DA 2AWNA 4ULLA 2K5QA 1U4MA 2Z8LA 2NVTB 3LX0A 3HRZC 1A3VA 3N6RA 3OWFA 1DOMA 1QG7A 4UDUC 3FRPB 4KV6A 4XYQA 3QOJA 1ENAA 2JXMB 1UNSA 1MSGA 3OIQA 3D4DA 3PUVA 3NP8A 3Q0AA 4FF4A 2KCCA 5JEAH 2F0HA 4IURA 2Q8TA 1MI2A 1T5EA 4DNRB 1DJRD 5KEEA 1PDQA 1G91A 1F2ZA 3NBIA 2SOBA 1HPCA 1JICA 4CKBA 4BS9A 4J8QA 2E2DC 1WTWA 5LL6S 1E0BA 2RSNA 3V05A 4KY7A 5IOCA 3Q24A 1MSHA 4KJNA 3GD7A 2M9VA 2TMPA 1VDZA 2F0JA 1EEID 1EU3A 1HA5A 3A8KE 3P1HA 1B9NA 1U4RA 1E2WA 4IFDJ 1PZKD 3NTKA 1PRTC 4WORA 4CBVA 4CKCA 3K57A 2KOLA 5FO8B 2JA5B 4NKLA 4A93B 2O5JC 5ELEA 4FXKC 4MIUA 3DWPA 1F77A 4LAAA 4LJZC 4PQXA 2J7ZA 4G57A 3GQBA 4QUFA 1QE6A 2BE5C 5JEAG 5IGEA 4K2LA 2B2UC 2KVMA 4BA1I 3LWEA 4XQJA 3KK7A 3PIP3 2IX0A 1X3QA 5FO9B 4WJWA 2VB3X 3NUCA 3GTQB 1OXUA 5KIXA 3QB3A 3DHQA 4KY6A 1SE2A 4L63B 1LO5D 3NPPA 2E2IB 3MA2B 2X6GA 5G3LF 1HUNA 2KEEA 1GXDC 3S1MB 4DU9A 1BO0A 3PMFA 5CC4A 1FNVA 3K5MA 1LT5D 5IT9L 1DCZA 3V96A 3MVVA 5C3XA 4MHEA 1TWAB 4KTAA 4ZUIA 1E2ZA 4M1UB 1AP0A 2PYKA 5D3DA 3I8ZA 1BCPF 3TZUA 5C44B 3A7AB 3EQLC 3D6CA 5F2DA 3Q22A 1A2TA 3D6WA 2IX3A 2F0DA 2L55A 1I4XA 3UI2A 3PO3B 3TP5A 5K5PA 4C3IB 3M85A 1RD9D 1WTPA 4KI0A 4OHJA 1TVXA 3KF8A 1Q1EA 2B2TA 2OF1A 2FMMA 3Q6SA 3MXUA 2PZWA 4B08A 3C1EA 4NDXA 2K5DA 1EOTA 2E74C 3I3CA 2L1BA 4KK7A 1GHKA 2JA6B 5CYUA 2RVLA 2MJ8A 3HEJA 4I7ZC 4DGZA 1II3A 2H1EA 3MWYW 3G6JB 1STGA 4P2CB 5EQ0A 1CFMA 3NBHA 4LMQD 1SYCA 2AUKA 1B2TA 1SMYC 3EFXD 4IFDH 2OT2A 3NE5B 1LTGD 2XRSD 3I4MB 2KQ3A 1FR3A 3VYUA 1IYVA 4XTCS 4RGTA 3J7AF 3S2DB 1SJED 3MTSA 3DMUA 5A2QL 5EBCA 1Y1WB 5ELCA 2A68C 1WTXA 2EDGA 3D4WA 1RODA 1YNJC 4FYDA 1G2TA 2JP1A 1U4LA 1Y8PB 5EKKA 1QOHA 2OEOA 4HMIA 4ZUJA 3E0JA 2RDFA 3QJYA 1DZ1A 2F0NA 4J6HA 5J39A 3GTGB 3M4OB 5G3LD 4ABNA 3TP6A 1ZYRC 4CJ0B 3EROA 2KJXA 2R93B 3SHLA 4QMGA 1V1PA 2A6EC 2MP1A 1DOKA 2NYZD 3BYYB 3GTOB 4K5XA 2DNEA 4IFDG 1BCPC 3H0GB 4JK1C 1LV9A 1B3AA 1EWHA 5EKLA 4EGVA 4DK0A 1IL8A 1RHPA 1JOQA 4HCEA 1X32A 2NVXB 2E76C 3S1QB 5JOBA 1PZID 5ELBA 2XNAC 1FNUA 2PO4A 4FXGC 4A3FB 4BWGB 1KLGD 2PZTA 1F2MA 3I70A 3D4RA 1OXTA 3ITPA 1WTRA 3H94A 2AQ1B 3LWUA 4XIGS 3MHBA 5M3MB 4ZKCB 5COYA 5JPMC 2D2CC 1DOLA 2EPBA 1TIID 4TQUS 2F0TA 4H0LC 4KMUC 1JE4A 1CI3M 1HQRD 4C1NI 4KKTA 3FEWX 1SNMA 3TP8A 1BF4A 4RA8A 2YYZA 4K8JA 4V190 4J1MA 4PNYA 1HCZA 1U4PA 3KBGA 1S5DD 1JORA 1RTNA 1OXVA 2L12A 3K5OA 1J9OA 5T1IA 4N9TA 5IGFA 2F0KA 3VR6A 2NUCA 4HN7A 1B1ZA 1K83B 5M9OA 4XXEA 5FLXE 2JEAI 4A3KB 4A3IB 4K8IA 1AFPA 2QEJC 2NN6I 2XWBB 4KN4C 5CORA 1BDOA 1EY8A 5IGGA 4XQQA 4C3JB 1TT2A 2LFNA 5J22A 3M4YA 4IUUA 2LY7A 3A56A 1JR0D 2VB2X 3J7YW 1F9PA 1M8AA 5KYLA 5KNCA 5EGTA 1V43A 5JAVA 2IT1A 3PIO3 3SK6A 1LTBD 1XYIA 3OHXC 2PW5A 5C0XJ 5I9PA 3S15B 1PXUA 4HSPA 4BA2I 1B4OA 1EYCA 2WAQB 1AEXA 5CGKA 2XSCA 1CT1D 1LT6D 4X3UA 2EYJA 1TWCB 3K0YA 1IKMA 1PMRA 1ML0D 2MUYA 3AMUA 2K5WA 1JCKB 3OWEB 1LTSD 4DN4M 1CZWA 5C3WA 2RDGA 1SE4A 3DUZA 2IWHA 1X3PA 3TDQA 2F0EA 4K6DA 5FKAC 3J80L 2A69D 5E3FA 1LTID 2EYHA 3NQIA 1EY6A 1EZ6A 2EJFC 3M7NA 1HXYD 1STNA 1ZKOA 3U9SA 1UEAB 4A3EB 2Z4HA 1A2UA 3HOUB 2WACA 5D65A 4LK1C 1S4ZA 3URYA 4CKEA 4X3SA 4DNTB 5DAUA 4RKBA 4RGNA 1KDCA 2R7ZB 2SEBD 4OGQC 3P20A 3CKIB 1S5FD 1G8ZD 1TR5A 4XT1B 4PMBA 3SK8A 3IL8A 5BN3A 4S3SA 1K8MA 2B2VA 2WV6D 5D14A 2JE6I 2A73B 2EJMA 1STAA 4IUTA 3C2PA 3VR3A 4DA2A 2ZXPA 1GUOA 3A8IE 5LL6X 2JA7B 1Q1BA 3P75A 3JAML 3AU7A 2DN8A 3HKZB 4U673 1EY9A 2FFKB 5BN4A 1RKNA 4EQOA 3NSWA 2EJGC 2ENBA 4FO2A 2NTTA 1KABA 4NMZA 4WFN3 1CA5A 3BG3A 5C0XH 5K36G 1SNOA 1LT3D 1WTOA 5FK9C 3TN2A 1CK1A 5T1GA 3GTPB 1H9KA 1YNND 1BNZA 2KUMA 4OL7A 2B2WC 5EBDA 3CQZB 1A3UA 1EIHA 2M2LA 1O78A 1KTKA 1KDAA 1R4PB 2K32A 4K2KA 5CV5A 1WCMB 4O42A 1SAPA 1ZXTA 1IHZA 1I4PA 2IX1A 4JBWA 2NVQB 3WOEA 3Q23A 1HFGA 1TS4A 2F0IA 4OIKA 1FNWA 4EQPA 2NTSA 3IFTA 2MPMA 3KUPA 1CA6A 3L7ZC 4H7BA 2PQEA 2K03A 2EYPA 2F1MA 4A3MB 3PUWA 3ERQA 1EZ8A 4X3KA 1STEA 5C0XG 2B63B 4CGYB 3KBXA 3C3LA 2F3WA 3T56B 3NK9A 3EA6A 4Q5VA 2CVRA 1HFNA 1HUMA 1VMPA 1TS5A 1Z6HA 1Y69U 4XYOA 1ET9A 1SYEA 1STYA 3I72A 3K6OA 3OPOA 3K5LA 5AFWA 3PUXA 2M00A 4KD3A 3VYSA 4IQZA 2HCCA 3I73A 4OO1H 3FMCA 2F0MA 3CRKC 4O1NA 1R4QB 3GP7A 4G7OC 2KHSA 1F9SA 1ILPA 2JSOA 1NR2A 1FYCA 1PYWD 3NQTA 1H9SA 3S14B 3DM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV4 A;  3HEJ A;  5NUC A;  4DGZ A;  1II3 A;  3LX0 A;  3U9O A;  3NHH A;  2EXZ A;  4KD4 A;  5IGE A;  3R3O A;  1EY5 A;  3C1F A;  4K2L A;  1ENC A;  1SNC A;  1STG A;  2QDB A;  4DFA A;  1JOQ A;  1A3V A;  4QB4 A;  3OWF A;  1EY4 A;  5KYL A;  5DAU A;  3SK4 A;  4RKB A;  5C4H A;  5EGT A;  5JOB A;  1KDC A;  5DEH A;  4KV6 A;  5JAV A;  1SYC A;  2RKS A;  3HZX A;  2F0Q A;  2F0I A;  3QOJ A;  1ENA A;  3SK6 A;  4EQP A;  5KGU A;  1SYF A;  1TR5 A;  2F0U A;  2O4X A;  4B9X A;  3D4D A;  3OMC A;  2PW5 A;  3NP8 A;  4KJO A;  5HGT A;  1A3T A;  4PMB A;  4KY5 A;  3SK8 A;  5I9P A;  4K5W A;  2F0H A;  2PZT A;  4IUN A;  1F2M A;  2KQ3 A;  3NUC A;  5I6W A;  3EVQ A;  4H7B A;  4I65 A;  4S3S A;  2PZU A;  1TQO A;  3OSO A;  3V2T A;  5KYI A;  5KEE A;  3ITP A;  1EYC A;  3QB3 A;  1F2Y A;  5KIX A;  3DHQ A;  4E6I A;  2PQE A;  2F0W A;  2EYP A;  4KY6 A;  4ODG A;  2F0L A;  2RBM A;  4ME5 A;  1AEX A;  1STA A;  2LKV A;  5CV9 A;  3DMU A;  5I9O A;  5CGK A;  2F3V A;  3QOL A;  5C4Z A;  1SNP A;  3ERQ A;  1EZ8 A;  1U9R A;  1F2Z A;  2HQE A;  3D4W A;  5IGD A;  2F0V A;  2SOB A;  3MHB A;  1SYD A;  2EYO A;  4IAL A;  1NUC A;  4EVO A;  3VA5 A;  4DU9 A;  3D8G A;  5EKK A;  3EJI A;  3PMF A;  3MXP A;  3P75 A;  4ID6 A;  4TRD A;  5CC4 A;  2EYJ A;  4K5V A;  4KY7 A;  4YIJ A;  4QF4 A;  5IOC A;  3BDC A;  2F0T A;  3S9W A;  1EY9 A;  2F3W A;  3NK9 A;  2OEO A;  3BDL A;  4HMI A;  5CV7 A;  4K14 A;  4ZQ3 A;  4F8M A;  1RKN A;  5ISR A;  4B9W A;  1EYD A;  4ZUJ A;  2EY5 A;  2EYM A;  4KJN A;  3MVV A;  4EQO A;  1SNM A;  3TP8 A;  5C3X A;  2ENB A;  4KTA A;  5CV6 A;  4ZUI A;  3SR1 A;  5IOD A;  1KAB A;  2F0G A;  5C3W A;  2RDF A;  1SYG A;  2PYK A;  2EYF A;  2OXP A;  5HUR A;  2F0J A;  4K8J A;  4NMZ A;  5C5L A;  3TP7 A;  4J1M A;  4PNY A;  3D6C A;  5F2D A;  3T16 A;  5C5M A;  4F7X A;  2F0S A;  2F0P A;  5KRU A;  1A2T A;  2F0N A;  3SK5 A;  1SNQ A;  1EY7 A;  4J6H A;  5J39 A;  1JOR A;  2F0D A;  2EY1 A;  3P1H A;  1SYE A;  1SNO A;  2F0E A;  4K6D A;  4N9T A;  3TP5 A;  1STY A;  1JOO A;  2F0K A;  5IIF A;  1STH A;  5IGB A;  4IZ8 A;  5CR3 A;  5IGF A;  5E3F A;  5K5P A;  1KDB A;  2EY6 A;  1JOK A;  3MEH A;  1EY0 A;  2NUC A;  2EYH A;  5C6A A;  2PW7 A;  4WOR A;  3TP6 A;  1EYA A;  5M9O A;  4DF7 A;  3ERO A;  2M00 A;  3NXW A;  4HMJ A;  1EY6 A;  1EQV A;  4KD3 A;  4NKL A;  3MZ5 A;  3T13 A;  1EZ6 A;  2F0F A;  3SHL A;  2OF1 A;  4QMG A;  4OL7 A;  4KHV A;  4MIU A;  1STN A;  2PZW A;  3OMG A;  4WRD A;  3TME A;  4LAA A;  4N9P A;  1A3U A;  4RKL A;  4G57 A;  4K8I A;  5E1F A;  5CV8 A;  5IGC A;  2F0M A;  2SNM A;  4K5X A;  3C1E A;  4NDX A;  3RUZ A;  1SND A;  5I6Y A;  1KDA A;  2KHS A;  4NP5 A;  3E5S A;  4K2K A;  1A2U A;  5CV5 A;  2SNS A;  3SXH A;  1EY8 A;  1KAA A;  2WAC A;  1NSN S;  2EYL A;  2F0O A;  3H6M A;  2EY2 A;  3NQT A;  4HTH A;  4PMC A;  4EQN A;  5IGG A;  1SYB A;  1TT2 A;  5EKL A;  4R8N A;  1IHZ A;  1STB A;  5J22 A;  5J1Z A; 
#chains in the Genus database with same CATH topology
 4C3I G;  2LXK A;  1TWH H;  5J3B A;  4DK6 C;  2LMC B;  1AN8 A;  5CMD A;  4C3H B;  4A3L G;  4C3H G;  5IWA L;  2QDB A;  2I0Q A;  4QB4 A;  5EKI A;  3KLS A;  2V1C C;  3HP3 A;  2C35 B;  3F2U A;  2CWP A;  2Y0S E;  1B3Q A;  2F0Q A;  2ICI A;  1MBY A;  3MEF A;  3K58 A;  3MFG A;  1IBL L;  2F0U A;  5C0X I;  1AZP A;  4OIJ A;  4B3T L;  1PH3 A;  2JA6 G;  1Y1V B;  1RIP A;  1N33 Q;  1Y1V G;  3EVQ A;  4ZYS A;  3OSO A;  1LTT D;  1IYJ B;  4E6I A;  4AYB B;  2YU9 H;  3GTJ B;  4AYB G;  5FJ8 G;  3TSS A;  1I50 B;  1TWF B;  5I9O A;  1AZQ A;  3S16 B;  2IY5 B;  1U9R A;  1O80 A;  4GLA C;  1NUC A;  2HDM A;  4CDF C;  2NVY B;  4DV0 Q;  3D8G A;  5JJZ A;  1PTO D;  2P5Z X;  4ID6 A;  1W2B A;  2Y0S B;  2CW0 C;  1H9S B;  1EYD A;  1E2V A;  2EYM A;  4JI1 L;  2RSO A;  5AJ3 L;  5C4X B;  3VR2 A;  5C4X G;  2G9H D;  2OXP A;  4QIW E;  1L1O C;  1NTG A;  3VA7 A;  5IT9 E;  4LF7 Q;  1IL2 A;  1E3P A;  3T16 A;  1Q8I A;  1SMY D;  4R1J A;  2NN6 H;  4YWK A;  3R2T A;  2F03 A;  3ULL A;  1IW7 D;  2PNH A;  1CTM A;  1PH1 A;  1RTO A;  4A3B H;  3MEH A;  1TWH B;  1C0A A;  3FPP A;  1EYA A;  3DLL A;  4ZK9 B;  1SJH D;  3ULJ A;  4AH6 A;  2F0F A;  3MXN A;  1PFS A;  3RZO H;  1YHA A;  1NMF A;  2A68 D;  4WJ4 A;  3HS0 C;  2HDL A;  5FLM H;  3UE0 A;  3TME A;  1TS3 A;  1QZH A;  2PMZ E;  5IGC A;  4I7A A;  3A54 A;  3RD4 A;  3RUZ A;  2K01 A;  1BUV T;  4G7H C;  2PCF B;  1WYD A;  1NSN S;  1OXX K;  2B8F A;  2EYL A;  2EE1 A;  2F0O A;  4QIW B;  4EQN A;  2OTL A;  5J1Z A;  1XX8 A;  1PH6 A;  2R61 A;  2YU9 B;  1EY5 A;  1SNC A;  1SSO A;  4DFA A;  1Z47 A;  2I5M X;  4Z9C B;  4GZY C;  3TBI B;  3CME A;  4L5T A;  1PTO H;  2AWO A;  1E24 A;  1FVI A;  4A4I A;  3H0G G;  3CCJ A;  1B44 D;  1MJC A;  4JC0 A;  3RLF A;  4KJO A;  3DEO A;  4RGM A;  2PMZ B;  1Q7Y C;  1PZJ D;  1O7Y A;  1ZYR D;  2N88 A;  4IPC A;  3J81 E;  1VQP A;  4L6T B;  1IBL Q;  4DK1 A;  5EPL A;  2JQO A;  4LF9 L;  4P74 A;  2F0W A;  3B6Y A;  5I2Y A;  5DM6 3;  4ZKB B;  3E6Z X;  4C1N K;  4JI0 L;  5L37 A;  4PV1 C;  1DD2 A;  3QOL A;  2MGS A;  4OO1 I;  4IN3 A;  2H5X A;  1RCV D;  2EYO A;  2NN6 G;  4FF3 A;  3BU2 A;  3H3V C;  2K7V A;  5A2Q E;  1Q81 C;  4A3B B;  4A3B G;  4B3R L;  1FD7 D;  4A3F G;  4LF8 Q;  1VQE A;  3I56 A;  3KLS X;  2K28 A;  1SDF A;  1QVC A;  5CBA E;  3RZO B;  5ELN A;  5ELD A;  1HH2 P;  2JK8 A;  2BDN A;  3OTO L;  3QO2 A;  5FLM G;  3CMA A;  4JW0 A;  2NWG A;  4R4C A;  1EUJ A;  5M3M G;  1J6Q A;  1XXG A;  4UP8 A;  2B2Y C;  5E4X A;  5IIF A;  3AYH B;  1EIG A;  3CRL C;  2AQ3 B;  2EQS A;  1KDB A;  3D31 A;  4CJ1 B;  1BBW A;  2QCP X;  1PH7 A;  1E1T A;  3T51 B;  1S40 A;  1ET6 A;  1NAP A;  2X6L A;  3E0E A;  3FP9 A;  4CDE C;  3Q8D A;  3PUZ A;  1QB5 D;  2RA4 A;  4X6A H;  1TS2 A;  3A5Z B;  5C4J H;  4POF A;  3AB9 A;  2SNM A;  1PTO B;  1ESF A;  1C8C A;  3VDY A;  4YCU A;  2SNS A;  4HTH A;  4RFB A;  1EQR A;  2D5D A;  5E7N A;  2A19 A;  3BDO A;  1UE6 A;  1O7L A;  2EIF A;  4DAP A;  4XQN A;  4KKU A;  1A15 A;  2CQA A;  4UAI A;  5C4H A;  4GKJ Q;  2A6H C;  1K28 A;  3VR4 A;  4HJ9 A;  2K52 A;  2WB1 E;  3NTI A;  2Q8R E;  4CJ2 C;  1EWC A;  1LAB A;  4DAV A;  5DNF A;  4DR2 L;  3PO2 H;  2PPB C;  4O0A A;  3CC4 A;  2VNU D;  3S1R H;  4RWS C;  3SGI A;  4FXD A;  4R8I A;  4C3J G;  1W3S A;  1T5X D;  4X3T A;  2ES2 A;  3GV3 A;  4TVA B;  1JJG A;  2LS0 1;  3BVZ A;  2Q8I B;  1OTC A;  2G9D A;  1QNU A;  2O5I C;  1I6H H;  4ALP A;  1SNP A;  2R6G A;  1G29 1;  2F0V A;  1ZEQ X;  2PNR C;  1GUW A;  1KL9 A;  1EFI D;  3GV6 A;  1W6J A;  4X65 Q;  3EJI A;  4HED A;  1ESR A;  3MAQ A;  3R2I A;  2WB1 B;  5C3E B;  5C3E G;  2JA8 H;  5CV7 A;  4RAU C;  3KDF A;  4LF5 Q;  4B9W A;  2EY5 A;  4XT3 B;  1SEB D;  2XIW A;  5EAY A;  1C9O A;  4RHS A;  2Z4I A;  3BYT B;  5C4J B;  2KHI A;  1BXT A;  1TY2 A;  2DNC A;  2VW9 A;  1PFN A;  1IZ6 A;  4FVM A;  1I94 L;  3OTO Q;  2XWJ B;  1M4V A;  4ZRZ A;  3A7L A;  1YVC A;  2KED A;  4IZ8 A;  5CR3 A;  4G7Z C;  3OW7 A;  1O7Z A;  3WWV A;  1Y8O B;  2EY6 A;  3PUY A;  1C48 A;  1XMO Q;  2PW7 A;  2V4D A;  2IHE A;  3CAM A;  2RF4 A;  4HMJ A;  3KJO A;  2D0P A;  1LTR D;  3T13 A;  3N52 A;  2SDF A;  4F88 A;  1XJV A;  2N49 A;  5LHY 1;  1GUG A;  1L0Y B;  5CBE E;  3HG9 A;  3MXG A;  3PO2 B;  4DV3 L;  4XDX A;  3VR5 A;  3PO2 G;  1BBU A;  1VF7 A;  1FGU A;  3HOV H;  3S1R B;  1KIX A;  3BVG A;  1XTC D;  2BDO A;  2YTY A;  5TSS A;  2A69 C;  5GAD C;  1AE2 A;  1STB A;  4A3D H;  1TU2 B;  2RCN A;  4LNQ A;  4HR7 B;  2EXZ A;  2ATW A;  1PYB A;  2XVS A;  1E1O A;  1JC7 A;  5M5X H;  2GA4 B;  1PA6 A;  3T1Y Q;  3KDF B;  5KND A;  1EY4 A;  3W3A A;  1I6H B;  3J81 j;  3T1H Q;  5JVG 3;  5DEH A;  4TSS A;  3I4L A;  4IUP A;  4RCO A;  5LMU L;  1WTQ A;  1KRT A;  4DV5 L;  2E5L Q;  2B39 A;  3NTH A;  2JA8 B;  2J0T D;  2JA8 G;  1LTA D;  4DR2 Q;  5I6W A;  1UAP A;  4GN5 A;  1LUZ A;  4DAY A;  3V2T A;  5KYI A;  1MGS A;  4JBJ A;  1F2Y A;  5FOB B;  1EL0 A;  1PYS B;  1EIY B;  3OIP A;  4GN3 B;  1JMC A;  5BN5 A;  2F3V A;  2IPK D;  4HIM A;  4IAL A;  2ZTD A;  2ID0 A;  3CW2 C;  3BZD B;  3TS2 A;  2MO1 A;  3WDN A;  4TRD A;  1I6V C;  4K5V A;  4YIJ A;  4IJH A;  2FJ2 A;  1GOZ A;  2FIN B;  1OO9 B;  2K5N A;  1G6P A;  1L0W A;  1RF2 D;  3BDL A;  1DON A;  3TEH B;  3A8J E;  1PFM A;  3VYT A;  2LXJ A;  1LT4 D;  5GAG C;  5CV6 A;  2A74 C;  1JJ2 A;  1P16 A;  1T9H A;  1D6E C;  2RDH A;  1IBM L;  2CH4 W;  5BR8 L;  2WIN B;  1NR4 A;  2ZTC A;  1EY7 A;  1X9N A;  3HOV B;  1QWY A;  3HOV G;  4QUC A;  5FLX c;  1B7Y B;  5A35 A;  1STH A;  1F9R A;  2AUJ D;  2ICE C;  5IGB A;  4A3D B;  2E2H H;  2VS1 A;  4DXF A;  1V1O A;  1QCB D;  1QJO A;  3K59 A;  4JV5 L;  2YV5 A;  3A55 A;  5M5X B;  3R93 A;  4A93 H;  3J80 E;  4DAY B;  1Z7T A;  4KHV A;  1VQN A;  4C2M H;  1D5X C;  1QIL A;  4N9P A;  4HID A;  4L8J A;  1Q3L A;  1B9M A;  4JI2 L;  1NBW A;  3P7J A;  4RCN A;  1N32 L;  2EY2 A;  1YJW A;  2C5C A;  1V1Q A;  1SRO A;  4L5R C;  2BA1 A;  1P8L A;  1VQC A;  4IUQ A;  4V0B A;  1IYU A;  3I91 A;  4ZAI A;  5NUC A;  3L3O C;  3RZD H;  1GUT A;  4R9W A;  3KLR A;  1AE3 A;  1YNN C;  1D2B A;  1BVS A;  3FVQ A;  3CF5 A;  2BH2 A;  3CPW A;  1H9M A;  1JJC B;  1HJP A;  2VXW A;  3CU7 A;  4BY7 H;  3VYR A;  2TSS A;  5JPN C;  1YBY A;  5M3F H;  2ZM6 Q;  3RR5 A;  3U4V A;  3H09 A;  4RH6 A;  4KY5 A;  5ELF A;  2QIL A;  3ZYY X;  3E9H A;  1VMC A;  2K75 A;  4FP5 D;  3BZC A;  4HJ5 A;  3GTK H;  1UUP A;  2D62 A;  4ODG A;  1KNE A;  4ME5 A;  1UWV A;  3FKI H;  1XNR Q;  1EWI A;  1M1K C;  2JEB I;  1VQ8 A;  1PTO F;  3WOF A;  2NB0 A;  1VQ9 A;  2B8G A;  2B2T C;  3A5U A;  1N33 L;  3K5N A;  2E2H B;  1PRT D;  2DGY A;  3KYH C;  3SE0 A;  2DJF C;  2DY8 A;  4DR3 Q;  4JBM A;  1VQD A;  3JAM E;  1PH8 A;  4C2M B;  3EBE A;  2B29 A;  4DV0 L;  1LYL A;  2ASB A;  3HOZ H;  1LLR D;  4HJ7 A;  5IP9 G;  1CKM A;  2GVB A;  2FHT A;  3RLN A;  2E2J H;  1QNK A;  2BE5 D;  2F3I A;  2ZXO A;  1KLU D;  4RHR A;  4ZLT F;  1ICF B;  3KFU A;  4JBK A;  1IBM Q;  1G2S A;  4BXX H;  4Y7N H;  2XN9 C;  3RZD B;  4DF7 A;  3ICE A;  1WFQ A;  4LF7 L;  2K5V A;  1PFB A;  2RQX A;  1I4G A;  3OMG A;  4G4K A;  4M8A A;  4BY7 B;  1NJI C;  3M3Y H;  3S17 H;  4BY7 G;  1F2L A;  2QEX A;  2Q2U A;  5EPK A;  3MC0 B;  1V8Q A;  3CXC A;  3H91 A;  5M3F B;  5M3F G;  1U5K A;  3ND9 A;  2G5D A;  4PMC A;  5JJL A;  1HZ9 A;  2F4I A;  2KA7 A;  4JI2 Q;  3S1N H;  1UE5 A;  1I3Q H;  2L0C A;  1EQT A;  3GTK B;  4JI8 Q;  5JVH 3;  1A6X A;  4NW2 A;  2IW3 A;  3FKI B;  3FKI G;  4BBS H;  1DYQ A;  2F4V Q;  1CSP A;  2D9U A;  2JA9 A;  1ASZ A;  3CC2 A;  2CFM A;  1KD1 C;  4JI7 Q;  2R3Z A;  1HA6 A;  2EZV A;  3U4Z A;  5KGU A;  3AEV A;  3OMC A;  2ALY B;  1DGS A;  3CD6 A;  3M7G A;  4GN4 B;  2ZTE A;  2B2W A;  1BOS A;  4UY8 C;  3I4M H;  4DUY L;  2LSS A;  2PZU A;  1TQO A;  3D3R A;  3MFY A;  3AFP A;  2B3G A;  5IY0 A;  1A62 A;  1GJX A;  5CV9 A;  3QIA A;  3HOZ B;  2J4X A;  5C4Z A;  1IBK L;  4A3J H;  2E2J B;  2K6A A;  3HOW H;  3JC6 6;  3DEP A;  2AMC B;  4KLK A;  4K6L A;  1VCI A;  4HAE A;  3PQI A;  3CCU A;  3S9W A;  1GUN A;  4QF4 A;  2L4N A;  4Y7N B;  1FJG L;  1GKH A;  3UDG A;  4IJL A;  1HZC A;  2WII B;  3NWT A;  5ISR A;  3J7A V;  2GVA A;  4JOI A;  2K04 A;  3CCE A;  5GAE C;  1SYG A;  5C5L A;  3S17 B;  3ND8 A;  3M3Y B;  4NPS A;  5EPJ A;  2VY3 A;  5C5M A;  4F7X A;  2F0P A;  1X3E A;  2NZH A;  4LF8 L;  3GTG H;  3DWA A;  1SBB B;  1PTO C;  1VQJ A;  3NWS A;  1C4Q A;  1F9Q A;  1JOO A;  3ER0 A;  1XNQ L;  2B2U A;  2CQO A;  5E4W C;  1JOK A;  2KBN A;  3LNN A;  3S1N B;  1I3Q B;  3QWN A;  2Y0S G;  1XPR A;  1EQV A;  1HQM C;  3MZ5 A;  1VQ4 A;  1YHQ A;  1KNA A;  1G6Z A;  1GUS A;  4BBS B;  4BBS G;  4OO1 G;  3J81 L;  4KHZ A;  4RKL A;  5E1F A;  3PF5 A;  4BY1 H;  3KJP A;  3J81 i;  3F1Z A;  4NP5 A;  1PRT B;  3GTM H;  1IW7 C;  1K8O A;  2UUB Q;  1JT8 A;  1SYB A;  5HUR A;  4ZCK A;  1A0I A;  2CW0 D;  4H13 C;  3DXJ C;  1TY0 A;  3C1F A;  3R3O A;  3QG1 A;  1QVF A;  3S1Q H;  4A3J B;  4IPH A;  2Z6K A;  2JYO A;  4A3J G;  4HJ8 A;  4ME3 A;  4OWW B;  1YNJ D;  1K0R A;  3HOW B;  1HR0 Q;  2N3S A;  2VL6 A;  3U50 C;  4DK3 C;  1CHQ D;  4U68 A;  3GO5 A;  2BCO A;  1PH9 A;  3I90 A;  2IJ0 A;  5HGT A;  2MHV A;  1JWU D;  4QQB X;  3BVM A;  4IUN A;  4PMW A;  4GKK Q;  4Y52 H;  4I65 A;  2UXC Q;  3G7L A;  2Z1C A;  4HCS A;  4GKJ L;  4IPD A;  4FF1 A;  2MO0 A;  4DPG A;  4DUY Q;  2Z6B A;  3NEM A;  4YHH L;  1W6K A;  4B3M L;  5KNB A;  4BBR H;  3AFQ A;  1X55 A;  3IKJ A;  2HCI A;  4OWX B;  4EVO A;  2UUA Q;  2YTV A;  4MTN A;  3E3X A;  1IBK Q;  2KCN A;  4LF6 Q;  4JCV E;  2EVB A;  4MN3 A;  4CHT B;  4JI3 Q;  2VUM H;  4F8M A;  4ZQ3 A;  5M5Y H;  2H4O A;  1MIU A;  1FJG Q;  3HGB A;  4UP7 A;  3SR1 A;  1HTP A;  2BA0 A;  1BBX C;  2F0G A;  2A6E D;  1PVO A;  1BR9 A;  2EYF A;  4FF2 A;  4X65 L;  4BY1 B;  1B53 A;  2F0S A;  1BCP D;  1WD0 A;  3GTL H;  1SNQ A;  3O13 A;  5FLX L;  3GTM B;  3M9B A;  1I4R A;  3BS1 A;  2KEC A;  2EXD A;  4LF5 L;  1Q90 A;  2CHB D;  3K7A H;  1WD1 A;  1ILQ A;  1X3G A;  2Q2H A;  1KRS A;  4FNF A;  4IUV A;  4DV1 L;  4DV6 L;  5M5W H;  3NXW A;  1XNQ Q;  3PV0 A;  2Z0S A;  5IE8 A;  4DXG A;  1S5E D;  1D1I A;  4O2D A;  4DAM A;  1I4H A;  3HOX H;  3RN2 A;  1YJ9 A;  2I46 A;  3S2H H;  3STB C;  1ENF A;  5GAH C;  1WTV A;  2OQK A;  1SND A;  2K4K A;  1IKL A;  1CZG A;  3T4A C;  1XMO L;  3SXH A;  1KAA A;  2A1A A;  1RL2 A;  5HGQ A;  2K1B A;  5KRU A;  3SK5 A;  1D8L A;  5CV4 A;  3U9O A;  4HIO A;  4KD4 A;  2QW7 A;  2RHS B;  3X3M A;  3OYY A;  1JWS D;  3ULP A;  1ENC A;  1HNW L;  4LFA Q;  5I4D A;  5I2X A;  1LAC A;  3SK4 A;  1TKW B;  4BBR B;  1V1P B;  3HOY H;  4BBR G;  2D0O A;  3L9A X;  3HZX A;  3SDZ A;  4AQY Q;  4H44 C;  1A3T A;  2XRQ D;  4K5W A;  4GOP C;  2VUM B;  3T1Y L;  2VUM G;  4QCL A;  3IAY A;  2Q2I A;  5M5Y B;  3T1H L;  2PQA A;  2C9O A;  1L2F A;  1SE3 A;  1CQV A;  1CQF A;  1TWG H;  2HUG A;  3CPF A;  1KQS A;  2FMC A;  1YEZ A;  2LKV A;  5GRO A;  2E5L L;  2IL8 A;  5D3I B;  2HQE A;  1SFO H;  3SEB A;  3GTL B;  4KN7 C;  3VA5 A;  1WI5 A;  2AQ2 B;  4IFD I;  2K05 A;  1JWM D;  3K7A B;  4YHH Q;  4B3M Q;  1M90 C;  4A3G H;  4ILW A;  2L9H A;  1RDP D;  2R92 H;  2L5T A;  2DY7 A;  5M5W B;  1L0X B;  1E7Z A;  1DXM A;  2OWO A;  1YI2 A;  5IOD A;  2WKC A;  2A6H D;  2EOT A;  3T53 B;  5DM7 3;  3HOX B;  3S2H B;  2X69 A;  3TP7 A;  3X3N A;  4DR4 L;  4TKO B;  4EX5 A;  4NXM Q;  1CHP D;  1VF5 C;  1D5Z C;  2WP8 J;  4GNX C;  2WAQ E;  2E75 C;  3PCO B;  3G4S A;  1UE1 A;  1RJT A;  1EFW A;  4X66 L;  3UDF A;  2I5H A;  1UE7 A;  2WB1 G;  3I4N H;  2BOS A;  1S5C D;  2HT1 A;  5JEA J;  1EU4 A;  4RGO S;  2OTJ A;  1I4Q A;  4LUZ A;  2NZ1 D;  2PQA B;  4DV1 Q;  2QKI C;  4DV6 Q;  2K33 A;  4QL5 A;  3BJU A;  4WRD A;  3HOY G;  3HOY B;  4C56 C;  5CV8 A;  2B2V C;  5I6Y A;  1YIJ A;  1HRJ A;  3IFD A;  3E5S A;  1X6O A;  1R9T H;  4HSV A;  3H6M A;  4L5Q A;  1FGB D;  4R8N A;  1Q12 A;  5EJW A;  3NHH A;  4OEL B;  1TWG B;  1NCV A;  2B2Y A;  1DM0 B;  5FO7 B;  1H9R A;  1SFO B;  1BCP B;  4Q0F A;  1HNW Q;  3J81 c;  2L11 A;  1HHV A;  2RKS A;  3DWQ A;  4LF4 Q;  2ZXR A;  5IP7 H;  1SYF A;  2O4X A;  2NZO A;  4B9X A;  4A3G B;  3SVM A;  1MD2 D;  4A3C H;  2R92 B;  2A5H A;  3CCQ A;  2R92 G;  2NVT H;  1HR0 W;  1ONL A;  1EEF D;  2VQF Q;  1AW7 A;  3R8B A;  3PSI A;  2F0L A;  1S5B D;  2RBM A;  1ICW A;  1Q8K A;  3OOC A;  2NBF A;  2QA4 A;  1PH4 A;  4DKA C;  3K0X A;  2ZM6 L;  5IGD A;  1B50 A;  1D5M C;  1YZ6 A;  1OXS C;  3AQQ A;  1SYD A;  2YTX A;  1GHJ A;  2ZT9 C;  2HHH L;  1PRT F;  1CKO A;  3MXP A;  1WVL A;  1VQL A;  2QF7 A;  3BDC A;  2N55 A;  1D1K A;  2K14 A;  3I4N B;  3ONA B;  3FDT A;  1EIF A;  4K14 A;  1VQA A;  3TZD A;  1XNR L;  1Y8N B;  1SXT A;  3C46 A;  4CDC C;  4IPG A;  4IOC A;  1NMG A;  4OEM B;  1BQQ T;  1D7Q A;  5K36 H;  5H1S E;  1R9T B;  2EY1 A;  1XWE A;  4DR4 Q;  4DR3 L;  1BKB A;  2I07 B;  3CHB D;  3RN5 A;  3FPU B;  4F87 A;  3RMH A;  1EY0 A;  3HFZ B;  2WKD A;  5C6A A;  1JB3 A;  3QR8 A;  1VQG A;  4X66 Q;  2O2L D;  2VQE L;  1JQY D;  1CM9 A;  3HKZ E;  1PLF A;  1KHI A;  4KKS A;  1HTL D;  1J8I A;  1H9J A;  3W2D A;  5IP7 G;  2AWN A;  2HIX A;  4ULL A;  2K5Q A;  4A3C G;  3A74 A;  1U4M A;  2Z8L A;  4A3D G;  3M4Q A;  4GLV B;  2NVT B;  3LX0 A;  1KC8 C;  1UEB A;  2JA5 H;  3HRZ C;  4GLX A;  1A3V A;  3N6R A;  3OWF A;  1DOM A;  1QG7 A;  3ERS X;  1JE5 A;  3FRP B;  4UDU C;  4KV6 A;  2UXB L;  4PZ7 A;  4XYQ A;  4X64 L;  3QOJ A;  1ENA A;  2JXM B;  1UNS A;  2CWA A;  1MSG A;  3H3V I;  3OIQ A;  1EYG A;  3D4D A;  3PUV A;  3NP8 A;  3Q0A A;  4FF4 A;  3K81 C;  1VQF A;  2KCC A;  4JI8 L;  3J7Z C;  5JEA H;  4QY7 A;  2F0H A;  4IUR A;  1N8R C;  2Q8T A;  4L5S A;  1MI2 A;  1T5E A;  1XPO A;  4DNR B;  1DJR D;  2XTI A;  4OON A;  5KEE A;  1PDQ A;  2F4V L;  1G91 A;  4JI7 L;  3W1B A;  4A3M H;  1F2Z A;  3NBI A;  2SOB A;  1HPC A;  1JIC A;  4CKB A;  4P71 A;  4BS9 A;  4J8Q A;  2E2D C;  3KLW A;  2B63 H;  1K73 C;  1WTW A;  5LL6 S;  1E0B A;  4R4O A;  2RSN A;  3V05 A;  4KY7 A;  5IOC A;  3Q24 A;  1MSH A;  4R4I A;  4P73 A;  5GQO A;  1KAW A;  2HHH Q;  1N9W A;  3K7U C;  2HD3 A;  3GTQ H;  3LGJ A;  4KJN A;  3GD7 A;  4YWM A;  2M9V A;  3PGZ A;  2TMP A;  3UDI A;  3L2P A;  4HIK A;  1VDZ A;  2F0J A;  2E2I H;  3FHW A;  3CC7 A;  1EEI D;  3TRE A;  1EU3 A;  1HA5 A;  3S1M H;  3A8K E;  3P1H A;  1B9N A;  4DR5 Q;  2UXD Q;  1U4R A;  1N36 Q;  1E2W A;  1YHB A;  4IFD J;  4N8F A;  1PZK D;  3NTK A;  4DV7 Q;  1PRT C;  2L15 A;  4WOR A;  4CBV A;  1VS0 A;  4CKC A;  3K57 A;  2GN5 A;  2KOL A;  5FO8 B;  2JA5 B;  4NKL A;  4A93 B;  2O5J C;  4DR7 Q;  1X54 A;  4A93 G;  4YCV A;  5ELE A;  1TWA H;  4FXK C;  4MIU A;  3DWP A;  1F77 A;  4LAA A;  4LJZ C;  4PQX A;  2J7Z A;  4G57 A;  3GQB A;  2VQE Q;  5C44 H;  4JOI C;  4QUF A;  1QE6 A;  2BE5 C;  3PO3 H;  5JEA G;  4C3I H;  5JJI A;  5IGE A;  4K2L A;  4A3L H;  2B2U C;  1PH5 A;  2AKW B;  2KVM A;  4BA1 I;  5JJK A;  3LWE A;  1MHW C;  1AH9 A;  4XQJ A;  1GVP A;  2RHQ B;  3KK7 A;  4QJF A;  3PIP 3;  2UUB L;  2IX0 A;  4LW1 A;  1X3Q A;  2HQL A;  2UXB Q;  5FO9 B;  4WJW A;  4X64 Q;  2JA6 H;  1Y1V H;  2VB3 X;  3NUC A;  3GTQ B;  1OXU A;  5KIX A;  3QB3 A;  3UE1 A;  3DHQ A;  5FJ8 H;  4KY6 A;  1SE2 A;  2JN4 A;  1HR0 L;  4L63 B;  1LO5 D;  3NPP A;  2E2I B;  1FL0 A;  3MA2 B;  1EQQ A;  4KHP Q;  3UDX A;  2X6G A;  5G3L F;  2KCM A;  2UU9 L;  1HUN A;  2A8V A;  2KEE A;  1GXD C;  4RG1 A;  4DU9 A;  3S1M B;  1BO0 A;  4GKK L;  3PMF A;  5CC4 A;  2UXC L;  1PV4 A;  2F52 A;  1FNV A;  4CDD C;  3K5M A;  1LT5 D;  5IT9 L;  1K0S A;  1DCZ A;  3V96 A;  3MVV A;  1E22 A;  5C3X A;  4MHE A;  3S2D H;  1TWA B;  4KTA A;  4ZUI A;  1E2Z A;  4YCW A;  2UUA L;  4M1U B;  1AP0 A;  2PYK A;  5D3D A;  3I8Z A;  4B3S L;  1BCP F;  3TZU A;  3HOZ G;  1Y1W H;  4POG A;  5C44 B;  4LF6 L;  3PF4 A;  5C44 G;  3A7A B;  3EQL C;  4JI6 Q;  3D6C A;  5F2D A;  4DV2 L;  3Q22 A;  1A2T A;  3D6W A;  4JI3 L;  2IX3 A;  2F0D A;  2L55 A;  1I4X A;  3UI2 A;  3PO3 B;  4AYB E;  3PO3 G;  3TP5 A;  5K5P A;  4C3I B;  3M85 A;  3IRB A;  3HKS A;  4BXX G;  1RD9 D;  3W1G A;  1WTP A;  4KI0 A;  3TRZ A;  1CKN A;  4FDB A;  1VQK A;  4OHJ A;  1TVX A;  3KF8 A;  1Q1E A;  2B2T A;  2OF1 A;  2FMM A;  3Q6S A;  1TXY A;  3I4O A;  3MXU A;  2PZW A;  3F2D A;  4B08 A;  3C1E A;  4NDX A;  1GO3 E;  1KXL A;  4JG2 A;  2K5D A;  1EOT A;  1VQB A;  2BH8 A;  2E74 C;  3I3C A;  2L1B A;  4KK7 A;  3M4O H;  2JA6 B;  1GHK A;  3EN2 A;  2RCF A;  5CYU A;  2RVL A;  4MTK A;  2MJ8 A;  1PH2 A;  3HEJ A;  4I7Z C;  4DGZ A;  1II3 A;  2H1E A;  3MWY W;  3CCL A;  3G6J B;  1STG A;  2R93 H;  4P2C B;  5EQ0 A;  1CFM A;  3NBH A;  4LMQ D;  1SYC A;  2AUK A;  1HNZ Q;  2R7D A;  1B2T A;  3GTO H;  1SMY C;  3EFX D;  4IFD H;  2OT2 A;  3NE5 B;  3H0G H;  3NEN A;  1LTG D;  4RMF A;  2XRS D;  4LFA L;  3TQY A;  3I4M B;  2KQ3 A;  3I4M G;  1FR3 A;  3VYU A;  1IYV A;  4XTC S;  4OX9 Q;  4RGT A;  3J7A F;  3S2D B;  3L0O A;  5IYD H;  3MTS A;  1SJE D;  2E8G A;  2MNA A;  2ZJQ A;  1CKN B;  3DMU A;  5A2Q L;  5EBC A;  2NVX H;  1Y1W B;  1VQO A;  1I5F A;  5ELC A;  1Y1W G;  2A68 C;  3KF8 B;  2EDG A;  1WTX A;  3D4W A;  1QUQ A;  4HJA A;  1ROD A;  4AQY L;  1YNJ C;  1N34 Q;  4FYD A;  3HOW G;  4NXN L;  1G2T A;  2JP1 A;  1U4L A;  1WTH A;  1Y8P B;  5EKK A;  3I7F A;  3JAM c;  5IYC H;  4UPA A;  2UU9 Q;  1QOH A;  4A3F H;  2OEO A;  1QZG A;  4HMI A;  4DUZ Q;  4ZUJ A;  3PIP A;  2QDL A;  1YJN A;  1VQM A;  3E0J A;  2AHO B;  1VQ6 A;  2RDF A;  5LMN Q;  2CH4 A;  5M3M H;  3QJY A;  1DZ1 A;  2F0N A;  3NBH B;  4J6H A;  5J39 A;  3GTG B;  3F2B A;  4B3S Q;  3M4O B;  5G3L D;  1XMQ Q;  3G71 A;  2FXQ A;  4DV2 Q;  1WOC A;  2ZJR A;  4DV4 L;  4ABN A;  4JPB W;  1K3B C;  3TP6 A;  1ZYR C;  4CJ0 B;  3ERO A;  2KJX A;  2R93 B;  2R93 G;  4NXM L;  3SHL A;  1MKH A;  4QMG A;  1V1P A;  2A6E C;  1A8V A;  1K8A C;  2MP1 A;  1DOK A;  3CCS A;  2NYZ D;  3I2Z A;  5IWA Q;  3BYY B;  3GTO B;  4K5X A;  2DNE A;  4BY1 G;  4IFD G;  1BCP C;  3H0G B;  3A0J A;  4JK1 C;  1QUQ B;  1LV9 A;  1B3A A;  1EWH A;  5EKL A;  4JYA L;  4YY3 L;  4EGV A;  1K83 H;  1S3O A;  1Y14 B;  4DK0 A;  1IL8 A;  4B3T Q;  5IYD G;  1RHP A;  1JOQ A;  4HCE A;  1X32 A;  2NVX B;  2E76 C;  3S1Q B;  3MXN B;  5JOB A;  4APV A;  4A3K H;  4A3I H;  2N8N A;  1PZI D;  5ELB A;  2XNA C;  1FNU A;  5IYC G;  2PO4 A;  1K9M C;  4P72 A;  4FXG C;  4A3F B;  4BWG B;  1KLG D;  4R4T A;  4C3J H;  4DR1 L;  2PZT A;  1F2M A;  3I70 A;  1L1O A;  3D4R A;  1ASY A;  1OXT A;  3ITP A;  1WTR A;  1CSQ A;  2IHF A;  3H94 A;  4LF4 L;  2AQ1 B;  1XTD A;  3RNU A;  3STB D;  3LWU A;  4LFC L;  1NE3 A;  4JI1 Q;  4XIG S;  3MHB A;  5M3M B;  5AJ3 Q;  1U0L A;  4ZKC B;  5COY A;  1C7Y A;  5JPM C;  2D2C C;  1DOL A;  2EPB A;  1TII D;  4TQU S;  2F0T A;  2VQF L;  1YNX A;  1X56 A;  4H0L C;  5C3E H;  4KMU C;  3S15 H;  3U58 A;  1JE4 A;  4NXN Q;  1CI3 M;  1HQR D;  4C1N I;  4KKT A;  3FEW X;  1SNM A;  3TP8 A;  1BF4 A;  2XGT A;  4RA8 A;  4LFB L;  2YYZ A;  3CP0 A;  4K8J A;  4V19 0;  4J1M A;  4PNY A;  4K0K L;  1HCZ A;  1U4P A;  3KBG A;  1S5D D;  1LM0 A;  4WJ3 M;  1JOR A;  1RTN A;  1OXV A;  2L12 A;  3K5O A;  1J9O A;  5T1I A;  4N9T A;  5IGF A;  2F0K A;  3VR6 A;  1TWC H;  2NUC A;  4HN7 A;  1B1Z A;  1K83 B;  5IT9 c;  1GD7 A;  5M9O A;  4XXE A;  5FLX E;  2JEA I;  1L1O B;  4DV4 Q;  4AIM A;  4A3K B;  2VZA A;  4A3K G;  4A3I B;  3HOX G;  4K8I A;  4A3I G;  1AFP A;  2PI2 A;  2QEJ C;  4JI4 L;  2QGQ A;  1K8G A;  2NN6 I;  4QGU A;  2XWB B;  4KN4 C;  5COR A;  3H3V H;  1BDO A;  1EY8 A;  5IGG A;  3EIV A;  4XQQ A;  4C3J B;  1TT2 A;  2LFN A;  5J22 A;  1J5E L;  1Z9F A;  3M4Y A;  4IUU A;  2LY7 A;  3A56 A;  1JR0 D;  1HZB A;  2VB2 X;  4JYA Q;  3J7Y W;  1F9P A;  1M8A A;  3I55 A;  4YY3 Q;  2PI2 E;  5KYL A;  5KNC A;  4MNO A;  4LF9 Q;  5EGT A;  1V43 A;  5JAV A;  2IT1 A;  3PIO 3;  4JI0 Q;  3SK6 A;  4H02 A;  1LTB D;  4A3E H;  1XYI A;  3OHX C;  3HOU H;  2PW5 A;  5C0X J;  1Q82 C;  4LUV A;  5I9P A;  3S15 B;  3G6E A;  1PXU A;  4HSP A;  1VQH A;  4BA2 I;  2Z9H A;  1B4O A;  1EYC A;  2WAQ B;  4B3R Q;  1X65 A;  2WAQ G;  3W5O A;  4DR1 Q;  1AEX A;  5CGK A;  4UP9 A;  2KHJ A;  2XSC A;  4UHV A;  1CT1 D;  1VQ7 A;  1LT6 D;  3TS0 A;  4X3U A;  2R7Z H;  3CCM A;  4LFC Q;  2EYJ A;  1TWC B;  1NNX A;  3K0Y A;  4A3G G;  1IKM A;  1PMR A;  1ML0 D;  2MUY A;  3AMU A;  2K5W A;  1JCK B;  1X3F A;  3OWE B;  1LTS D;  4DN4 M;  1CZW A;  2N78 A;  4NB3 A;  2MFI A;  5C3W A;  1HNX L;  2RDG A;  1SE4 A;  3DUZ A;  2IWH A;  1CUK A;  1SLJ A;  4GOP A;  1LTL A;  1JB7 A;  2WFW A;  4LFB Q;  1MJE A;  1X3P A;  3TDQ A;  2JA7 H;  2F0E A;  4K6D A;  5FKA C;  3J80 L;  4K0K Q;  4A75 A;  2A69 D;  5E3F A;  5LMN W;  1LTI D;  2UUC L;  2EYH A;  3I4N G;  3J80 i;  3BZK A;  1G51 A;  3NQI A;  1EY6 A;  3GDE A;  2ZJP A;  1B8A A;  1EZ6 A;  2EJF C;  3M7N A;  1VQ5 A;  4OXP A;  1HXY D;  3RLO A;  1STN A;  4DR6 L;  2OQ0 A;  4DR5 L;  2UXD L;  1N36 L;  1ZKO A;  3U9S A;  4DV7 L;  1UEA B;  4A3E B;  4A3E G;  1GM5 A;  2Z4H A;  1A2U A;  3HOU B;  3HOU G;  2WAC A;  5D65 A;  4LK1 C;  4JI4 Q;  1S4Z A;  3URY A;  4DR7 L;  4OWT B;  3GTP H;  1V9P A;  1K3R A;  4CKE A;  4X3S A;  4YWL A;  4GNX A;  1J5E Q;  2KCT A;  4DNT B;  5DAU A;  4RKB A;  4RGN A;  1KDC A;  3F2C A;  2R7Z B;  2R7Z G;  2SEB D;  3CQZ H;  5ELO A;  4OGQ C;  3P20 A;  3CKI B;  1S5F D;  4N8X 1;  3CCR A;  3K80 C;  1Q86 C;  1G8Z D;  1TR5 A;  4GOP B;  4XT1 B;  1XPU A;  1WCM H;  4PMB A;  3SK8 A;  3IL8 A;  5BN3 A;  4S3S A;  2Q2T A;  1K8M A;  2B2V A;  2WV6 D;  3F8T A;  3KF6 A;  5D14 A;  2JE6 I;  2A73 B;  2EJM A;  1STA A;  4IUT A;  3C2P A;  2NVQ H;  3VR3 A;  4DA2 A;  2ZXP A;  1GUO A;  3A8I E;  4JVZ A;  5LL6 X;  3NEL A;  2JA7 B;  2KEN A;  1Q1B A;  2JA7 G;  1PHJ A;  3P75 A;  4X62 L;  3JAM L;  3AU7 A;  2DN8 A;  3HKZ B;  4U67 3;  3HKZ G;  1EY9 A;  2FFK B;  1I94 Q;  5BN4 A;  4MZ9 A;  3JAM i;  1RKN A;  4GS3 A;  4EQO A;  1S72 A;  3M4P A;  1QVG A;  4KHP L;  3NSW A;  2EJG C;  2ENB A;  3PIO A;  4FO2 A;  2NTT A;  1NY4 A;  1KAB A;  3E9I A;  4NMZ A;  5IP9 H;  4GNX B;  4WFN 3;  1CA5 A;  3BG3 A;  5C0X H;  5K36 G;  1HNX Q;  1SNO A;  1LT3 D;  1WTO A;  5FK9 C;  4DV3 Q;  1IXR A;  3TN2 A;  1CK1 A;  5T1G A;  3GTP B;  1H9K A;  3G48 A;  1YNN D;  5HY6 A;  1BNZ A;  2KUM A;  4JI6 L;  2UUC Q;  4OL7 A;  2B2W C;  3KF6 B;  4JI5 L;  5EBD A;  3CQZ B;  1A3U A;  1EIH A;  2M2L A;  1O78 A;  1SR3 A;  1KTK A;  1KDA A;  1R4P B;  2K32 A;  1Q46 A;  2DJG C;  4K2K A;  5CV5 A;  1WCM B;  4DR6 Q;  1WCM G;  2JJQ A;  4O42 A;  1SAP A;  1ZXT A;  2K50 A;  5LMU Q;  1IHZ A;  4DV5 Q;  1I4P A;  2DUD A;  2IX1 A;  3H15 A;  2CKZ B;  4EQ5 A;  4J15 A;  4JBW A;  2JA5 G;  2NVQ B;  1A63 A;  3WOE A;  3Q23 A;  3DM3 A;  4LUO A;  1HFG A;  4PZ6 A;  3S24 A;  5DLQ E;  4P75 A;  1TS4 A;  2F0I A;  1SN8 A;  4OIK A;  1FNW A;  4EQP A;  2I5L X;  2NTS A;  3IFT A;  5IYB H;  2MPM A;  3J7A 5;  3KUP A;  1CA6 A;  1SRU A;  4IOA A;  3L7Z C;  3S14 H;  4H7B A;  2PQE A;  2K03 A;  4C3H H;  2EYP A;  2F1M A;  1B70 B;  1HNZ L;  4A76 A;  1VQI A;  4A3M B;  4A3M G;  3PUW A;  1SMX A;  2R7F A;  3ERQ A;  1EZ8 A;  4X3K A;  1STE A;  1H95 A;  5C0X G;  2B63 B;  2B63 G;  4CGY B;  3KBX A;  3C3L A;  3D0F A;  3ZJY C;  5BR8 Q;  4OX9 L;  2F3W A;  1SE8 A;  4R4Q A;  3T56 B;  3NK9 A;  3EA6 A;  4Q5V A;  2CVR A;  4X62 Q;  3CCV A;  4PG3 A;  3K8A A;  1HFN A;  4IO9 A;  4PZ8 A;  1HUM A;  3GTJ H;  1VMP A;  1N34 L;  4JV5 Q;  1I50 H;  1TS5 A;  1TWF H;  3S16 H;  1Z6H A;  4LWC A;  1O7I A;  1Y69 U;  4XYO A;  1ET9 A;  3OW2 A;  2NVY H;  1SYE A;  4DUZ L;  1STY A;  3I72 A;  1WJJ A;  2Z6K C;  3K6O A;  3OPO A;  1HZA A;  2CCZ A;  3K5L A;  5AFW A;  2MQH A;  1EOV A;  1N32 Q;  3PUX A;  2M00 A;  5LMN L;  4KD3 A;  3VYS A;  4IQZ A;  2HCC A;  3I73 A;  2K5H A;  5C4X H;  4OO1 H;  4DNI A;  2HIV A;  3FMC A;  2F0M A;  1XMQ L;  3CRK C;  4O1N A;  1R4Q B;  1YIT A;  3GP7 A;  4JI5 Q;  2KHS A;  4G7O C;  1F9S A;  1ILP A;  2JSO A;  2OCE A;  1NR2 A;  5IYB G;  1FYC A;  1PYW D;  3NQT A;  1H9S A;  3J80 c;  3S14 B;  3KOJ A;  3DM1 A; 
#chains in the Genus database with same CATH homology
 4C3I G;  2LMC B;  1AN8 A;  5CMD A;  4C3H B;  4C3H G;  2QDB A;  4QB4 A;  5EKI A;  3KLS A;  3HP3 A;  3F2U A;  2F0Q A;  2ICI A;  1MBY A;  3K58 A;  3MFG A;  2F0U A;  5C0X I;  1AZP A;  4OIJ A;  1Y1V B;  3EVQ A;  4ZYS A;  3OSO A;  1LTT D;  4E6I A;  4AYB B;  3GTJ B;  3TSS A;  1I50 B;  1TWF B;  5I9O A;  1AZQ A;  3S16 B;  1U9R A;  1O80 A;  1NUC A;  2HDM A;  2NVY B;  3D8G A;  5JJZ A;  1PTO D;  4ID6 A;  2Y0S B;  2CW0 C;  1H9S B;  1EYD A;  1E2V A;  2EYM A;  2RSO A;  5C4X B;  3VR2 A;  2G9H D;  2OXP A;  5IT9 E;  3VA7 A;  3T16 A;  1Q8I A;  1SMY D;  2NN6 H;  3R2T A;  2F03 A;  1IW7 D;  1CTM A;  1RTO A;  3MEH A;  1TWH B;  3FPP A;  1EYA A;  4ZK9 B;  1SJH D;  2F0F A;  3MXN A;  2A68 D;  3HS0 C;  2HDL A;  3TME A;  1TS3 A;  5IGC A;  3A54 A;  3RD4 A;  3RUZ A;  2K01 A;  1BUV T;  4G7H C;  2PCF B;  1NSN S;  1OXX K;  2B8F A;  2EYL A;  2EE1 A;  2F0O A;  4QIW B;  4EQN A;  5J1Z A;  1XX8 A;  2R61 A;  2YU9 B;  1EY5 A;  1SNC A;  1SSO A;  4DFA A;  1Z47 A;  4Z9C B;  4GZY C;  3TBI B;  1PTO H;  2AWO A;  1B44 D;  3RLF A;  4KJO A;  3DEO A;  4RGM A;  2PMZ B;  1PZJ D;  1O7Y A;  1ZYR D;  2N88 A;  3J81 E;  4L6T B;  4DK1 A;  5EPL A;  2F0W A;  5I2Y A;  5DM6 3;  4ZKB B;  3E6Z X;  4C1N K;  4PV1 C;  1DD2 A;  3QOL A;  2MGS A;  4OO1 I;  4IN3 A;  1RCV D;  2EYO A;  2NN6 G;  4FF3 A;  3H3V C;  2K7V A;  5A2Q E;  4A3B B;  1FD7 D;  3KLS X;  2K28 A;  1SDF A;  5CBA E;  3RZO B;  5ELD A;  2BDN A;  3QO2 A;  2NWG A;  1XXG A;  5E4X A;  2B2Y C;  5IIF A;  1EIG A;  3CRL C;  2AQ3 B;  3D31 A;  1KDB A;  4CJ1 B;  2QCP X;  3T51 B;  1ET6 A;  1NAP A;  2X6L A;  3PUZ A;  1QB5 D;  2RA4 A;  1TS2 A;  3AB9 A;  2SNM A;  1PTO B;  1ESF A;  1C8C A;  2SNS A;  4HTH A;  4RFB A;  2D5D A;  3BDO A;  1O7L A;  4DAP A;  4XQN A;  4KKU A;  1A15 A;  2CQA A;  4UAI A;  5C4H A;  2A6H C;  3VR4 A;  3NTI A;  2Q8R E;  4CJ2 C;  1EWC A;  1LAB A;  4DAV A;  5DNF A;  2PPB C;  2VNU D;  4RWS C;  4FXD A;  4R8I A;  4C3J G;  1T5X D;  4X3T A;  3GV3 A;  2LS0 1;  3BVZ A;  2Q8I B;  2G9D A;  1QNU A;  2O5I C;  1SNP A;  2R6G A;  1G29 1;  2F0V A;  1ZEQ X;  2PNR C;  1GUW A;  1EFI D;  3GV6 A;  1W6J A;  3EJI A;  4HED A;  1ESR A;  3MAQ A;  3R2I A;  2WB1 B;  5C3E B;  5CV7 A;  4RAU C;  4B9W A;  2EY5 A;  4XT3 B;  1SEB D;  2XIW A;  4RHS A;  2Z4I A;  3BYT B;  5C4J B;  1BXT A;  1TY2 A;  2DNC A;  1PFN A;  4FVM A;  2XWJ B;  1M4V A;  4ZRZ A;  3A7L A;  2KED A;  4IZ8 A;  5CR3 A;  4G7Z C;  3OW7 A;  1O7Z A;  1Y8O B;  2EY6 A;  3PUY A;  1C48 A;  2PW7 A;  2V4D A;  4HMJ A;  1LTR D;  3T13 A;  3N52 A;  2SDF A;  4F88 A;  5LHY 1;  1GUG A;  1L0Y B;  5CBE E;  3HG9 A;  3MXG A;  3PO2 B;  4XDX A;  3VR5 A;  1VF7 A;  3S1R B;  1XTC D;  2BDO A;  3BVG A;  5TSS A;  2A69 C;  1STB A;  1TU2 B;  4HR7 B;  2EXZ A;  2XVS A;  1JC7 A;  2GA4 B;  5KND A;  1EY4 A;  3W3A A;  1I6H B;  5JVG 3;  5DEH A;  4TSS A;  3I4L A;  4IUP A;  4RCO A;  1WTQ A;  2B39 A;  3NTH A;  2JA8 B;  2J0T D;  1LTA D;  5I6W A;  1UAP A;  4DAY A;  3V2T A;  5KYI A;  1MGS A;  1F2Y A;  5FOB B;  1EL0 A;  3OIP A;  5BN5 A;  2F3V A;  2IPK D;  4IAL A;  2ID0 A;  3BZD B;  3WDN A;  4TRD A;  1I6V C;  4K5V A;  4YIJ A;  2FJ2 A;  1GOZ A;  2FIN B;  1OO9 B;  1RF2 D;  3BDL A;  1DON A;  3A8J E;  1PFM A;  3VYT A;  1LT4 D;  5CV6 A;  2A74 C;  1D6E C;  2RDH A;  2WIN B;  1NR4 A;  3HOV B;  1EY7 A;  1QWY A;  4QUC A;  5A35 A;  1STH A;  1F9R A;  2AUJ D;  2ICE C;  5IGB A;  4A3D B;  4DXF A;  1V1O A;  1QCB D;  1QJO A;  3K59 A;  3A55 A;  5M5X B;  3R93 A;  3J80 E;  1Z7T A;  4KHV A;  1D5X C;  1QIL A;  4N9P A;  4L8J A;  1Q3L A;  1B9M A;  3P7J A;  4RCN A;  2EY2 A;  2C5C A;  4IUQ A;  2BA1 A;  4V0B A;  1IYU A;  3I91 A;  4ZAI A;  5NUC A;  3L3O C;  1GUT A;  4R9W A;  3KLR A;  1D2B A;  1YNN C;  3FVQ A;  1H9M A;  2VXW A;  3CU7 A;  3VYR A;  2TSS A;  5JPN C;  3H09 A;  4RH6 A;  4KY5 A;  5ELF A;  2QIL A;  3ZYY X;  1VMC A;  4FP5 D;  1UUP A;  2D62 A;  4ODG A;  1KNE A;  4ME5 A;  2JEB I;  1PTO F;  3WOF A;  2NB0 A;  2B8G A;  2B2T C;  3K5N A;  2E2H B;  1PRT D;  3SE0 A;  2DY8 A;  3JAM E;  4C2M B;  1LLR D;  2FHT A;  1QNK A;  2BE5 D;  2ZXO A;  1KLU D;  4RHR A;  4ZLT F;  1G2S A;  2XN9 C;  3RZD B;  4DF7 A;  1PFB A;  2RQX A;  1I4G A;  3OMG A;  4G4K A;  4M8A A;  4BY7 B;  1F2L A;  5EPK A;  3MC0 B;  1V8Q A;  3H91 A;  5M3F B;  3ND9 A;  4PMC A;  2F4I A;  2KA7 A;  2L0C A;  1EQT A;  3GTK B;  5JVH 3;  1A6X A;  4NW2 A;  2IW3 A;  3FKI B;  1DYQ A;  2D9U A;  2R3Z A;  1HA6 A;  2EZV A;  5KGU A;  3OMC A;  3M7G A;  2B2W A;  1BOS A;  2PZU A;  3D3R A;  1TQO A;  3MFY A;  1GJX A;  5CV9 A;  3QIA A;  3HOZ B;  2J4X A;  5C4Z A;  2E2J B;  2K6A A;  3DEP A;  4K6L A;  1VCI A;  4HAE A;  3S9W A;  1GUN A;  4QF4 A;  2L4N A;  4Y7N B;  2WII B;  3NWT A;  5ISR A;  3J7A V;  2K04 A;  1SYG A;  5C5L A;  3S17 B;  3ND8 A;  3M3Y B;  5EPJ A;  5C5M A;  4F7X A;  2F0P A;  3DWA A;  1SBB B;  1PTO C;  3NWS A;  1C4Q A;  1F9Q A;  1JOO A;  2B2U A;  5E4W C;  1JOK A;  3LNN A;  3S1N B;  1I3Q B;  3QWN A;  1EQV A;  1HQM C;  3MZ5 A;  1KNA A;  1G6Z A;  1GUS A;  4BBS B;  4OO1 G;  3J81 L;  4KHZ A;  4RKL A;  5E1F A;  4NP5 A;  1PRT B;  1IW7 C;  1K8O A;  1SYB A;  5HUR A;  2CW0 D;  4H13 C;  3DXJ C;  1TY0 A;  3C1F A;  3R3O A;  3QG1 A;  4A3J B;  2JYO A;  1YNJ D;  3HOW B;  1CHQ D;  4U68 A;  3GO5 A;  2BCO A;  3I90 A;  2IJ0 A;  5HGT A;  2MHV A;  1JWU D;  3BVM A;  4IUN A;  4PMW A;  4I65 A;  3G7L A;  2Z1C A;  4HCS A;  4FF1 A;  1W6K A;  5KNB A;  3IKJ A;  2HCI A;  4EVO A;  2KCN A;  2EVB A;  4MN3 A;  4CHT B;  4F8M A;  4ZQ3 A;  2H4O A;  3HGB A;  3SR1 A;  1HTP A;  2BA0 A;  1BBX C;  2F0G A;  2A6E D;  1BR9 A;  2EYF A;  4FF2 A;  4BY1 B;  1B53 A;  2F0S A;  1BCP D;  1WD0 A;  1SNQ A;  3O13 A;  5FLX L;  3GTM B;  1I4R A;  3BS1 A;  2KEC A;  1Q90 A;  2CHB D;  1WD1 A;  1ILQ A;  4FNF A;  4IUV A;  3NXW A;  3PV0 A;  4DXG A;  1S5E D;  1D1I A;  1I4H A;  2I46 A;  1ENF A;  1WTV A;  1SND A;  3T4A C;  1IKL A;  1CZG A;  3SXH A;  1KAA A;  2K1B A;  5KRU A;  3SK5 A;  5CV4 A;  3U9O A;  4KD4 A;  3X3M A;  1JWS D;  1ENC A;  5I4D A;  5I2X A;  1LAC A;  3SK4 A;  1TKW B;  4BBR B;  1V1P B;  3L9A X;  3HZX A;  3SDZ A;  4H44 C;  1A3T A;  2XRQ D;  4K5W A;  2VUM B;  4QCL A;  3IAY A;  5M5Y B;  2C9O A;  1SE3 A;  1CQV A;  1CQF A;  2HUG A;  2FMC A;  2LKV A;  2IL8 A;  5D3I B;  2HQE A;  3SEB A;  3GTL B;  4KN7 C;  3VA5 A;  2AQ2 B;  4IFD I;  2K05 A;  1JWM D;  3K7A B;  4ILW A;  2L9H A;  1RDP D;  2L5T A;  2DY7 A;  5M5W B;  1L0X B;  1DXM A;  5IOD A;  2WKC A;  2A6H D;  2EOT A;  3T53 B;  5DM7 3;  3HOX B;  3S2H B;  2X69 A;  3TP7 A;  3X3N A;  4TKO B;  1CHP D;  1VF5 C;  1D5Z C;  2WP8 J;  2E75 C;  1RJT A;  2BOS A;  1S5C D;  5JEA J;  1EU4 A;  4RGO S;  1I4Q A;  2NZ1 D;  2QKI C;  2K33 A;  4WRD A;  3HOY B;  4C56 C;  5CV8 A;  2B2V C;  5I6Y A;  1HRJ A;  3IFD A;  3E5S A;  4HSV A;  3H6M A;  1FGB D;  4R8N A;  1Q12 A;  5EJW A;  3NHH A;  1TWG B;  1NCV A;  2B2Y A;  1DM0 B;  5FO7 B;  1H9R A;  1SFO B;  1BCP B;  4Q0F A;  1HHV A;  2L11 A;  2RKS A;  3DWQ A;  2ZXR A;  1SYF A;  2O4X A;  4B9X A;  4A3G B;  3SVM A;  1MD2 D;  2R92 B;  2A5H A;  1ONL A;  1EEF D;  1AW7 A;  3R8B A;  2F0L A;  1S5B D;  2RBM A;  1ICW A;  3OOC A;  2NBF A;  5IGD A;  1B50 A;  1D5M C;  1OXS C;  1SYD A;  1GHJ A;  2ZT9 C;  1PRT F;  1WVL A;  3MXP A;  2QF7 A;  3BDC A;  2N55 A;  1D1K A;  3I4N B;  3ONA B;  3FDT A;  4K14 A;  3TZD A;  1Y8N B;  1SXT A;  3C46 A;  1BQQ T;  5K36 H;  1R9T B;  2EY1 A;  1XWE A;  2I07 B;  3CHB D;  3FPU B;  4F87 A;  3RMH A;  1EY0 A;  2WKD A;  5C6A A;  1JB3 A;  2O2L D;  1JQY D;  1CM9 A;  1PLF A;  4KKS A;  1HTL D;  1J8I A;  1H9J A;  3W2D A;  2AWN A;  4ULL A;  2K5Q A;  1U4M A;  2Z8L A;  2NVT B;  3LX0 A;  3HRZ C;  1A3V A;  3N6R A;  3OWF A;  1DOM A;  1QG7 A;  4UDU C;  3FRP B;  4KV6 A;  4XYQ A;  3QOJ A;  1ENA A;  2JXM B;  1UNS A;  1MSG A;  3OIQ A;  3D4D A;  3PUV A;  3NP8 A;  3Q0A A;  4FF4 A;  2KCC A;  5JEA H;  2F0H A;  4IUR A;  2Q8T A;  1MI2 A;  1T5E A;  4DNR B;  1DJR D;  5KEE A;  1PDQ A;  1G91 A;  1F2Z A;  3NBI A;  2SOB A;  1HPC A;  1JIC A;  4CKB A;  4BS9 A;  4J8Q A;  2E2D C;  1WTW A;  5LL6 S;  1E0B A;  2RSN A;  3V05 A;  4KY7 A;  5IOC A;  3Q24 A;  1MSH A;  4KJN A;  3GD7 A;  2M9V A;  2TMP A;  1VDZ A;  2F0J A;  1EEI D;  1EU3 A;  1HA5 A;  3A8K E;  3P1H A;  1B9N A;  1U4R A;  1E2W A;  4IFD J;  1PZK D;  3NTK A;  1PRT C;  4WOR A;  4CBV A;  4CKC A;  3K57 A;  2KOL A;  5FO8 B;  2JA5 B;  4NKL A;  4A93 B;  2O5J C;  5ELE A;  4FXK C;  4MIU A;  3DWP A;  1F77 A;  4LAA A;  4LJZ C;  4PQX A;  2J7Z A;  4G57 A;  3GQB A;  4QUF A;  1QE6 A;  2BE5 C;  5JEA G;  5IGE A;  4K2L A;  2B2U C;  2KVM A;  4BA1 I;  3LWE A;  4XQJ A;  3KK7 A;  3PIP 3;  2IX0 A;  1X3Q A;  5FO9 B;  4WJW A;  2VB3 X;  3NUC A;  3GTQ B;  1OXU A;  5KIX A;  3QB3 A;  3DHQ A;  4KY6 A;  1SE2 A;  4L63 B;  1LO5 D;  3NPP A;  2E2I B;  3MA2 B;  2X6G A;  5G3L F;  1HUN A;  2KEE A;  1GXD C;  3S1M B;  4DU9 A;  1BO0 A;  3PMF A;  5CC4 A;  1FNV A;  3K5M A;  1LT5 D;  5IT9 L;  1DCZ A;  3V96 A;  3MVV A;  5C3X A;  4MHE A;  1TWA B;  4KTA A;  4ZUI A;  1E2Z A;  4M1U B;  1AP0 A;  2PYK A;  5D3D A;  3I8Z A;  1BCP F;  3TZU A;  5C44 B;  3A7A B;  3EQL C;  3D6C A;  5F2D A;  3Q22 A;  1A2T A;  3D6W A;  2IX3 A;  2F0D A;  2L55 A;  1I4X A;  3UI2 A;  3PO3 B;  3TP5 A;  5K5P A;  4C3I B;  3M85 A;  1RD9 D;  1WTP A;  4KI0 A;  4OHJ A;  1TVX A;  3KF8 A;  1Q1E A;  2B2T A;  2OF1 A;  2FMM A;  3Q6S A;  3MXU A;  2PZW A;  4B08 A;  3C1E A;  4NDX A;  2K5D A;  1EOT A;  2E74 C;  3I3C A;  2L1B A;  4KK7 A;  1GHK A;  2JA6 B;  5CYU A;  2RVL A;  2MJ8 A;  3HEJ A;  4I7Z C;  4DGZ A;  1II3 A;  2H1E A;  3MWY W;  3G6J B;  1STG A;  4P2C B;  5EQ0 A;  1CFM A;  3NBH A;  4LMQ D;  1SYC A;  2AUK A;  1B2T A;  1SMY C;  3EFX D;  4IFD H;  2OT2 A;  3NE5 B;  1LTG D;  2XRS D;  3I4M B;  2KQ3 A;  1FR3 A;  3VYU A;  1IYV A;  4XTC S;  4RGT A;  3J7A F;  3S2D B;  1SJE D;  3MTS A;  3DMU A;  5A2Q L;  5EBC A;  1Y1W B;  5ELC A;  2A68 C;  1WTX A;  2EDG A;  3D4W A;  1ROD A;  1YNJ C;  4FYD A;  1G2T A;  2JP1 A;  1U4L A;  1Y8P B;  5EKK A;  1QOH A;  2OEO A;  4HMI A;  4ZUJ A;  3E0J A;  2RDF A;  3QJY A;  1DZ1 A;  2F0N A;  4J6H A;  5J39 A;  3GTG B;  3M4O B;  5G3L D;  4ABN A;  3TP6 A;  1ZYR C;  4CJ0 B;  3ERO A;  2KJX A;  2R93 B;  3SHL A;  4QMG A;  1V1P A;  2A6E C;  2MP1 A;  1DOK A;  2NYZ D;  3BYY B;  3GTO B;  4K5X A;  2DNE A;  4IFD G;  1BCP C;  3H0G B;  4JK1 C;  1LV9 A;  1B3A A;  1EWH A;  5EKL A;  4EGV A;  4DK0 A;  1IL8 A;  1RHP A;  1JOQ A;  4HCE A;  1X32 A;  2NVX B;  2E76 C;  3S1Q B;  5JOB A;  1PZI D;  5ELB A;  2XNA C;  1FNU A;  2PO4 A;  4FXG C;  4A3F B;  4BWG B;  1KLG D;  2PZT A;  1F2M A;  3I70 A;  3D4R A;  1OXT A;  3ITP A;  1WTR A;  3H94 A;  2AQ1 B;  3LWU A;  4XIG S;  3MHB A;  5M3M B;  4ZKC B;  5COY A;  5JPM C;  2D2C C;  1DOL A;  2EPB A;  1TII D;  4TQU S;  2F0T A;  4H0L C;  4KMU C;  1JE4 A;  1CI3 M;  1HQR D;  4C1N I;  4KKT A;  3FEW X;  1SNM A;  3TP8 A;  1BF4 A;  4RA8 A;  2YYZ A;  4K8J A;  4V19 0;  4J1M A;  4PNY A;  1HCZ A;  1U4P A;  3KBG A;  1S5D D;  1JOR A;  1RTN A;  1OXV A;  2L12 A;  3K5O A;  1J9O A;  5T1I A;  4N9T A;  5IGF A;  2F0K A;  3VR6 A;  2NUC A;  4HN7 A;  1B1Z A;  1K83 B;  5M9O A;  4XXE A;  5FLX E;  2JEA I;  4A3K B;  4A3I B;  4K8I A;  1AFP A;  2QEJ C;  2NN6 I;  2XWB B;  4KN4 C;  5COR A;  1BDO A;  1EY8 A;  5IGG A;  4XQQ A;  4C3J B;  1TT2 A;  2LFN A;  5J22 A;  3M4Y A;  4IUU A;  2LY7 A;  3A56 A;  1JR0 D;  2VB2 X;  3J7Y W;  1F9P A;  1M8A A;  5KYL A;  5KNC A;  5EGT A;  1V43 A;  5JAV A;  2IT1 A;  3PIO 3;  3SK6 A;  1LTB D;  1XYI A;  3OHX C;  2PW5 A;  5C0X J;  5I9P A;  3S15 B;  1PXU A;  4HSP A;  4BA2 I;  1B4O A;  1EYC A;  2WAQ B;  1AEX A;  5CGK A;  2XSC A;  1CT1 D;  1LT6 D;  4X3U A;  2EYJ A;  1TWC B;  3K0Y A;  1IKM A;  1PMR A;  1ML0 D;  2MUY A;  3AMU A;  2K5W A;  1JCK B;  3OWE B;  1LTS D;  4DN4 M;  1CZW A;  5C3W A;  2RDG A;  1SE4 A;  3DUZ A;  2IWH A;  1X3P A;  3TDQ A;  2F0E A;  4K6D A;  5FKA C;  3J80 L;  2A69 D;  5E3F A;  1LTI D;  2EYH A;  3NQI A;  1EY6 A;  1EZ6 A;  2EJF C;  3M7N A;  1HXY D;  1STN A;  1ZKO A;  3U9S A;  1UEA B;  4A3E B;  2Z4H A;  1A2U A;  3HOU B;  2WAC A;  5D65 A;  4LK1 C;  1S4Z A;  3URY A;  4CKE A;  4X3S A;  4DNT B;  5DAU A;  4RKB A;  4RGN A;  1KDC A;  2R7Z B;  2SEB D;  4OGQ C;  3P20 A;  3CKI B;  1S5F D;  1G8Z D;  1TR5 A;  4XT1 B;  4PMB A;  3SK8 A;  3IL8 A;  5BN3 A;  4S3S A;  1K8M A;  2B2V A;  2WV6 D;  5D14 A;  2JE6 I;  2A73 B;  2EJM A;  1STA A;  4IUT A;  3C2P A;  3VR3 A;  4DA2 A;  2ZXP A;  1GUO A;  3A8I E;  5LL6 X;  2JA7 B;  1Q1B A;  3P75 A;  3JAM L;  3AU7 A;  2DN8 A;  3HKZ B;  4U67 3;  1EY9 A;  2FFK B;  5BN4 A;  1RKN A;  4EQO A;  3NSW A;  2EJG C;  2ENB A;  4FO2 A;  2NTT A;  1KAB A;  4NMZ A;  4WFN 3;  1CA5 A;  3BG3 A;  5C0X H;  5K36 G;  1SNO A;  1LT3 D;  1WTO A;  5FK9 C;  3TN2 A;  1CK1 A;  5T1G A;  3GTP B;  1H9K A;  1YNN D;  1BNZ A;  2KUM A;  4OL7 A;  2B2W C;  5EBD A;  3CQZ B;  1A3U A;  1EIH A;  2M2L A;  1O78 A;  1KTK A;  1KDA A;  1R4P B;  2K32 A;  4K2K A;  5CV5 A;  1WCM B;  4O42 A;  1SAP A;  1ZXT A;  1IHZ A;  1I4P A;  2IX1 A;  4JBW A;  2NVQ B;  3WOE A;  3Q23 A;  1HFG A;  1TS4 A;  2F0I A;  4OIK A;  1FNW A;  4EQP A;  2NTS A;  3IFT A;  2MPM A;  3KUP A;  1CA6 A;  3L7Z C;  4H7B A;  2PQE A;  2K03 A;  2EYP A;  2F1M A;  4A3M B;  3PUW A;  3ERQ A;  1EZ8 A;  4X3K A;  1STE A;  5C0X G;  2B63 B;  4CGY B;  3KBX A;  3C3L A;  2F3W A;  3T56 B;  3NK9 A;  3EA6 A;  4Q5V A;  2CVR A;  1HFN A;  1HUM A;  1VMP A;  1TS5 A;  1Z6H A;  1Y69 U;  4XYO A;  1ET9 A;  1SYE A;  1STY A;  3I72 A;  3K6O A;  3OPO A;  3K5L A;  5AFW A;  3PUX A;  2M00 A;  4KD3 A;  3VYS A;  4IQZ A;  2HCC A;  3I73 A;  4OO1 H;  3FMC A;  2F0M A;  3CRK C;  4O1N A;  1R4Q B;  3GP7 A;  4G7O C;  2KHS A;  1F9S A;  1ILP A;  2JSO A;  1NR2 A;  1FYC A;  1PYW D;  3NQT A;  1H9S A;  3S14 B;  3DM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...