4N9TA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92s at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYSYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4n9tA00
3MZ5A 4IZ8A 3H6MA 1EQVA 1EY8A 4LAAA 4QF4A 4EQOA 4K6DA 3DHQA 1EY5A 4F7XA 5IGEA 2WACA 2F0TA 2M00A 3LX0A 5KRUA 5JAVA 3NK9A 2EXZA 1TQOA 4B9WA 4OL7A 1KDCA 1TR5A 4DU9A 1SYGA 2EY1A 5C4ZA 1STHA 2EYLA 3OMGA 5I6WA 1EY7A 1NSNS 2OF1A 2OXPA 4KD3A 3BDCA 3SK6A 3SR1A 5KYIA 3T16A 3S9WA 2PYKA 5E3FA 4S3SA 2PW5A 3BDLA 3OMCA 4ID6A 5IIFA 2RBMA 3C1FA 1STAA 1EY9A 5E1FA 1SNPA 4PMBA 3SK4A 5J22A 2F3VA 2PW7A 2SNMA 4K5VA 4IUNA 2F0FA 3NP8A 2KHSA 4KTAA 4KV6A 4NP5A 3D4WA 4PNYA 5CV6A 5CV9A 5JOBA 5K5PA 1EYCA 3TP7A 4KY6A 3TP8A 1KDBA 4KJOA 1SYEA 5IODA 1JORA 4R8NA 1IHZA 2EYOA 4KD4A 5F2DA 3TP6A 3D6CA 4K2KA 3QB3A 1SNMA 3SHLA 1SNOA 4J1MA 1STGA 3MVVA 4HMJA 3ITPA 3SXHA 3TP5A 3V2TA 5HURA 2EY2A 5C3WA 5I9OA 5KEEA 4NMZA 3NQTA 4RKBA 2F0UA 3NUCA 2F0LA 5C3XA 1AEXA 5IGBA 1STNA 2EYHA 4ZQ3A 5KIXA 2O4XA 1F2MA 3D8GA 1SNDA 2F0JA 4EQNA 4QB4A 4NDXA 2OEOA 1SNQA 1KABA 5EKLA 5J1ZA 1EY0A 3QOLA 2F0QA 2PZUA 2RDFA 1SYBA 3OSOA 1A2UA 2EYFA 3HZXA 4NKLA 5C6AA 4EQPA 2SNSA 4K2LA 5EKKA 1SYFA 4I65A 1EYDA 2F0IA 3HEJA 4K14A 2F0MA 2ENBA 4DF7A 2F0VA 2F3WA 4B9XA 2F0SA 4DFAA 3C1EA 5CV4A 4QMGA 1EYAA 4WORA 5J39A 1JOKA 2NUCA 4N9PA 4J6HA 3T13A 5IGDA 4KJNA 4K8IA 1SYDA 2EYPA 3U9OA 1II3A 3EROA 5IOCA 2F0PA 5CV7A 3TMEA 5KYLA 3QOJA 1STYA 4ODGA 2EYMA 2SOBA 3P1HA 3EJIA 3MHBA 1EZ8A 3E5SA 5C5MA 4MIUA 1SYCA 2LKVA 5DEHA 4RKLA 5NUCA 2F0DA 1U9RA 5ISRA 2PZTA 5CV8A 5CV5A 3VA5A 1KDAA 4K8JA 2KQ3A 1A2TA 5CC4A 2HQEA 1JOQA 4TRDA 1NUCA 2F0KA 3EVQA 1SNCA 1KAAA 2PZWA 1RKNA 3OWFA 2F0GA 4ZUIA 5CR3A 4HMIA 5M9OA 3NXWA 3MEHA 4WRDA 4KHVA 4KY7A 5KGUA 2RKSA 3PMFA 4HTHA 4EVOA 1EY6A 1A3UA 4ME5A 4YIJA 1F2YA 1JOOA 4N9TA 1F2ZA 1TT2A 5C5LA 5EGTA 1EZ6A 2QDBA 3D4DA 3SK8A 4ZUJA 4F8MA 2F0HA 4K5XA 3DMUA 3MXPA 4KY5A 4K5WA 5IGGA 5IGCA 1A3TA 1EY4A 3NHHA 4DGZA 4PMCA 2PQEA 1STBA 2EYJA 2F0EA 5C4HA 1ENCA 5CGKA 4E6IA 1A3VA 5I6YA 4IALA 3RUZA 1ENAA 2F0WA 4G57A 3ERQA 2EY6A 2F0OA 3R3OA 4H7BA 5HGTA 5IGFA 3P75A 2EY5A 5I9PA 5DAUA 3SK5A 2F0NA
chains in the Genus database with same CATH superfamily
2K05A 5FLMH 3H3VH 4LAAA 3M3YH 2WB1E 3T1HQ 2F0TA 1E0BA 1D1KA 3RMHA 5KRUA 3NK9A 4YWKA 1B7YB 1S5FD 2V4DA 4A3FG 1PXUA 5KYIA 2K50A 1NCVA 1A15A 3P20A 4L5SA 2EE1A 5FJ8H 4JI2Q 2ATWA 1HTPA 1JQYD 2JE6I 3SK4A 4LFCQ 1DYQA 1ILQA 4IUNA 5CV6A 4PNYA 1XWEA 4BXXH 2Q8TA 1QNKA 4OIJA 3CCUA 3URYA 1B9MA 1IHZA 1LV9A 1SNMA 1STGA 2PCFB 1VQ9A 5I9OA 4A3CH 2CCZA 1IYJB 2EPBA 3V96A 2AWNA 1AEXA 2E75C 5GAHC 4RGOS 1WFQA 3IAYA 1A62A 1V1PB 1GVPA 3A8KE 1TWCH 1A2UA 1IW7D 1FNVA 1SYFA 3U50C 3J7A5 4YCWA 1AN8A 1EYGA 3UDGA 2OCEA 1RTNA 1HA6A 3NTIA 1BBXC 4H02A 1DCZA 2RSOA 3HS0C 1E2WA 3DM3A 3AQQA 2Z0SA 4KHPL 3NBIA 3QWNA 1OXTA 2K6AA 3NENA 1ILPA 1UWVA 4DAMA 4DR4Q 1IKMA 1CM9A 3D3RA 1QVFA 4DXFA 1LACA 1SJED 4DR6Q 5EBDA 1UE6A 2K5DA 1T5EA 3KLRA 1TVXA 4LWCA 3I56A 3RNUA 2NVQH 1FNUA 1S5CD 2JA6G 1WTVA 4WRDA 4B3SQ 1FL0A 4XQQA 3PO3G 5BN4A 4IPCA 1P16A 3C2PA 1E1OA 1Y1WG 1WCMH 4TKOB 2EZVA 1NBWA 2K1BA 3Q8DA 1A3TA 1BR9A 1G91A 2GN5A 1A3VA 4RA8A 5I6YA 4UY8C 4V0BA 2EY6A 4C3IH 3TREA 3L0OA 1VQ4A 1LT6D 1M1KC 1MI2A 1D5XC 2BE5C 1IBMQ 2K5HA 3HOUB 3D6WA 1I4XA 2CKZB 3QR8A 1STHA 3CHBD 4KD3A 5GADC 3CCVA 3BDCA 2L4NA 4HJ8A 4IN3A 3WOEA 1AZPA 3N52A 1YHQA 1L1OC 4KK7A 3HOXG 3HKZE 1TWHH 1CQFA 1QVCA 4A3JG 3ICEA 1LT3D 4NP5A 1KXLA 3ULPA 5DNFA 1G8ZD 1BCPB 3QO2A 1KDBA 1DONA 2E2DC 3KYHC 4KD4A 5F2DA 2MHVA 5M5YB 3K59A 4MTKA 1LTRD 2F4VQ 5IT9E 2QEJC 1EUJA 2O4XA 4A3IB 1E3PA 1ONLA 3KF6B 2QEXA 4J8QA 3FKIB 5EKLA 1VQPA 4BY1B 1M90C 1IZ6A 4BBRG 4CKCA 2OQKA 1SMYC 2PQAB 3CC7A 4CDDC 4G7ZC 1EYDA 4OONA 1L0YB 4P72A 2BDOA 4HAEA 3SGIA 3UI2A 2ZTCA 1G2SA 3I4OA 4N9PA 1J5EQ 3R8BA 1XMOQ 4KJNA 2Q8RE 2V1CC 1RODA 3IRBA 2HUGA 4HN7A 4Y52H 4ODGA 1K8AC 1EZ8A 3I3CA 1A63A 3VR5A 4RKLA 2IX1A 1LT5D 2UUBL 4C3JH 3VR6A 4DR7L 3A74A 1KLGD 2Z6KC 3HOYB 3I72A 5A2QE 2E8GA 3JC66 1XNRQ 3RN5A 4JVZA 4JW0A 3NXWA 2XIWA 4H13C 3F2BA 5IYDH 1PH1A 1TY2A 1E24A 3K7AB 4LF6Q 4ZAIA 1VMPA 1LTLA 4Y7NB 3SK8A 1PRTB 1B1ZA 2MFIA 2QDBA 4B08A 2VQFL 4A93B 2R6GA 2IW3A 4KY5A 1PRTD 4AQYQ 2IX0A 1K73C 1B3QA 3CPWA 4ZK9B 1K0SA 1N34L 3CRLC 1GUGA 4NXNL 4EQ5A 1K28A 4XYQA 3OW2A 3I4NG 3CW2C 4BY7H 1U4LA 3UDIA 1SLJA 2QW7A 1VQ7A 2KHIA 1X32A 4DU9A 1ESRA 2B29A 1XMOL 3SK6A 1JJCB 4OGQC 2TSSA 2AUKA 2N49A 2KA7A 4A93H 4ID6A 2KVMA 3M9BA 5IIFA 1J9OA 2RBMA 2UUBQ 2CQOA 5IP9G 5FK9C 3A8JE 1YNND 1HQRD 1EWHA 3CQZB 3DWAA 4AIMA 1CHPD 3DLLA 2JSOA 3KK7A 2UXBL 2DY7A 1GUSA 3CKIB 2VQEL 1JORA 3OIPA 2OTLA 4X66L 4LF6L 1VDZA 2R61A 3GTKB 1XTCD 3KLWA 2Z8LA 3BVMA 1EIGA 2Z9HA 2D0PA 2A19A 4JBKA 2D2CC 1AE2A 5C0XH 4JI6Q 5J1ZA 2LXJA 4DR2L 1PLFA 4DK3C 1RIPA 5BN3A 3AB9A 2DNEA 1MJEA 3O13A 3GTQB 1VQ8A 3E3XA 1ICFB 3ND8A 3FHWA 3STBD 5J39A 2N88A 3PQIA 3ZYYX 3T13A 5FLXL 1Y1VG 2SEBD 3J80L 3QOJA 3P1HA 2KCNA 5ELNA 4O1NA 1I4HA 5C4XG 2F0DA 4XT3B 1RHPA 3MXNA 2KQ3A 1E2ZA 1WVLA 1S5BD 3PO2B 2JA5G 4DR5L 1QUQA 3I70A 4X66Q 1N32Q 3PMFA 1X54A 1X56A 4JI8Q 1SBBB 1RJTA 4X3TA 2C5CA 3HOWH 4A3MB 2KCMA 5AJ3Q 1CHQD 5IGGA 4GLXA 4YY3Q 5LMUL 1FVIA 1ENCA 3E0EA 4A3DG 3BG3A 2NVTH 1Y8PB 5IGFA 5CORA 1RCVD 4IUQA 4K6LA 5DAUA 5IYBH 4ALPA 4YWLA 4K6DA 1SFOB 4F7XA 1F9PA 1GUTA 1BCPC 1V8QA 2E2HH 1PZKD 1K9MC 3M4QA 3F2DA 5FLXE 1KL9A 3F1ZA 1PH2A 2OXPA 4OX9Q 4QCLA 5EKIA 2FINB 3FPPA 1S72A 4LF5Q 1ML0D 1NAPA 3S1QH 4B3TL 3NP8A 2NYZD 1FD7D 2L11A 2PPBC 3SVMA 1XPOA 1E2VA 4K2KA 4DV5Q 1B70B 1SNOA 1NMFA 3MVVA 2DY8A 4KN7C 1S4ZA 1TS4A 5D3IB 3G48A 4JBJA 2X69A 2R93B 4A3LH 3HOWG 4POFA 3HOZH 1S40A 1SNQA 1GO3E 3G6EA 1QG7A 1VQKA 2D0OA 1NE3A 5C6AA 4DUYL 5EPJA 2C9OA 4DV6L 5M3MH 4PZ6A 2F0MA 4JI1Q 1LTID 3FEWX 4B9XA 1KTKA 3L7ZC 3R93A 2MPMA 4CDFC 4DV3Q 1XPRA 4DV7L 3TQYA 4J6HA 1BCPF 2FHTA 3A55A 4A75A 4OO1G 4RFBA 2BA0A 4FNFA 1SXTA 3A7AB 3TBIB 4DAPA 1SE8A 5NUCA 4DV2Q 1BDOA 1UE7A 1U9RA 3BYTB 5CV5A 1WTRA 2HD3A 4HR7B 4DAYA 4GNXB 4H0LC 3ND9A 2WV6D 5JJKA 3HOVG 1LTBD 3D4RA 5M9OA 2K32A 3K81C 3MEHA 2AWOA 2HIXA 4RCOA 4CBVA 2HQLA 3T1YL 4FO2A 4JOIA 4EVOA 3RN2A 2RCFA 1XNQL 2TMPA 1XXGA 4MZ9A 5JJIA 5M5XH 4K5XA 2LFNA 2NTTA 1PFNA 1PYSB 4IQZA 1VF5C 1ZYRC 3TRZA 4RG1A 1Z7TA 1V1QA 1H9SA 4A3JB 4H7BA 2JQOA 2EOTA 4JI4L 2EY5A 2HHHL 4DV4Q 2HDMA 1H9JA 1HFNA 3H0GH 1TWFB 2CH4W 5FKAC 2H5XA 3ULJA 1HR0L 4A3GB 5EPLA 1VQEA 4DV7Q 1OO9B 4X3KA 1N36L 1U0LA 3OMGA 2P5ZX 1IBKQ 3SR1A 3VYUA 1PFSA 3VR4A 3VR3A 3T1HL 4JYAQ 4MHEA 2OWOA 3TZDA 3LNNA 1EU3A 4K5VA 4C3HB 2E5LL 4BBRB 1HNWQ 4LUVA 1SMYD 4LUOA 1LTTD 3E6ZX 1SN8A 1Q1BA 1VQNA 3TP5A 3V2TA 5FOBB 1K0RA 2Y0SE 3NEMA 1STNA 1JCKB 3Q0AA 2PQAA 3S1MB 1K83H 3EA6A 1V1OA 1Q86C 1KABA 2A8VA 1EWCA 2JEBI 4DR1Q 1O80A 2ZM6L 1JWSD 2EYFA 3CP0A 2JJQA 2EXDA 5EKKA 1Q81C 4H44C 1HXYD 3OPOA 1D7QA 4DUZL 3HP3A 4X62L 4DV0L 3T53B 2ALYB 2N3SA 3HKSA 3J81E 2UUAL 1BQQT 5C0XI 4XYOA 1PH3A 1MKHA 3EJIA 1QB5D 3VYSA 2XRSD 1PRTC 4A3DH 3HOWB 2I5LX 4QGUA 2UUCQ 1LTSD 3GD7A 4BY1H 4JI7Q 1HNWL 3HRZC 3TS0A 3A7LA 1NR2A 3BZDB 2GA4B 4L5TA 4CHTB 2L15A 1C7YA 1O7IA 3PO3B 4IURA 4DKAC 3EFXD 1ET9A 1YHAA 3RZOB 1IYUA 2ZM6Q 1VS0A 2VY3A 5IYCH 4RCNA 1ESFA 4YCUA 2E2IH 3F2UA 1SMXA 2I46A 1K3RA 2VUMH 1PZJD 2F0NA 2R7DA 3FDTA 3FPUB 3U58A 5BN5A 1WCMG 1ENFA 4CJ1B 1A6XA 1C9OA 1HPCA 4LF9L 4JC0A 1D8LA 5E3FA 3E9HA 1LABA 2QDLA 5C4XB 3S1NH 4NXML 4L6TB 4A3KH 4R4OA 2F0FA 1Q8IA 4JPBW 5KNCA 2A1AA 5K5PA 1EYCA 1TKWB 3GV3A 2VUMG 2JA8G 2VUMB 1X3EA 2WP8J 4R8NA 4JI2L 2DJGC 4C2MH 3S2DH 1N33L 4U68A 2L55A 2EY2A 1TWAH 3STBC 5A2QL 3NQTA 4RAUC 1PFMA 1YI2A 2ZTDA 3GV6A 1AH9A 5KIXA 5ELOA 5ELFA 5M5WB 3FKIG 4NDXA 2RQXA 5EAYA 3S15H 2SDFA 4UP8A 2B2YC 3R2IA 2BA1A 2F4VL 3I4LA 4HJ7A 1LUZA 4ABNA 4HIKA 1I4PA 5ELDA 5LL6S 1IBLQ 2DJFC 4LFAQ 1G291 4DNTB 3JAMc 1Q7YC 1JOKA 1GHJA 2KEEA 2NTSA 3S1RB 1FGUA 3K7AH 2IHEA 1VQHA 1Z47A 3CMEA 5M5WH 1MHWC 4HIDA 3DUZA 3E9IA 1N8RC 4DR3Q 1C48A 2WKDA 1ICWA 2Q2TA 5GQOA 4LF4Q 3OW7A 3PIP3 3M4OH 4GNXA 1M8AA 3PUZA 4MNOA 1BCPD 1N33Q 1B50A 3X3MA 4DNIA 1MSGA 1XJVA 1GJXA 2R93G 4B3SL 2BH8A 3Q6SA 4FVMA 4LF7Q 4O2DA 5IYCG 2LMCB 2EYJA 2MP1A 3NTHA 3PV0A 1E7ZA 2JA7H 2EJMA 4YHHL 3CCMA 3SK5A 1F9SA 5M3FB 3H6MA 4A3CG 4N8X1 2B8GA 1EY5A 2A69C 4C3HH 5JAVA 1CA6A 4XTCS 2KHJA 3J81c 1FJGQ 1HRJA 2MJ8A 1EY7A 1NSNS 5LHY1 1KIXA 5IE8A 4LW1A 3KF6A 3S9WA 1VCIA 4GKJQ 3IL8A 3A54A 2ZXOA 5IWAL 3FP9A 1IBML 1VMCA 2JA8B 4KN4C 5GAEC 2NVYB 2F3VA 5CV9A 2EDGA 4ZYSA 2VB3X 1YJWA 4AH6A 4BXXG 1VQDA 1CK1A 1L1OA 3W3AA 4KY6A 1F9RA 1E22A 1VQOA 3CMAA 1SYEA 5C44H 2XTIA 3D6CA 3QB3A 3SHLA 3I2ZA 5T1IA 4IUTA 1PFBA 1LT4D 3IKJA 4LMQD 1CSPA 2NB0A 4KI0A 2AKWB 4Z9CB 1Y1WB 4JI3Q 1R4QB 5I4DA 2B8FA 2RCNA 1EY0A 1SJHD 1SYBA 2GVBA 1PTOB 1WOCA 4EQPA 4FF3A 1BXTA 4I65A 5CBEE 1T9HA 4LNQA 3HOVB 1CA5A 4GLVB 4JI6L 4QMGA 3KUPA 1HQMC 3D31A 4A76A 5IGDA 2KBNA 4V190 2B63B 1SYDA 1NJIC 2B63G 4LFBQ 1TS3A 1YNXA 5DM63 1DZ1A 3E5SA 4M1UB 4MIUA 5DEHA 2FJ2A 5CV8A 1TWGH 4Y7NH 4FXDA 1IKLA 1JC7A 1J5EL 4JG2A 1BO0A 1ZYRD 5CMDA 1KLUD 3W2DA 1HNZQ 2RSNA 3ERSX 4BA2I 4HSVA 2WB1B 2D62A 2MO1A 4HMIA 2MGSA 1CKNA 3OOCA 5IP7H 2B2TA 2XVSA 3M7GA 4ZCKA 4YIJA 1JOOA 3T51B 1CSQA 1I4RA 3I90A 2K7VA 3WDNA 4OO1H 3BVGA 4B3ML 4JI3L 1M4VA 2KOLA 4A3BH 4BA1I 2NZHA 1OXSC 4C1NI 1F9QA 1NMGA 4G57A 2ASBA 4IFDJ 4DAYB 3MHBA 1I50B 4DV1L 5AJ3L 3K5NA 2K14A 3DHQA 2YTYA 2B2VA 2GVAA 3J81i 1WJJA 1CKNB 2WAQB 1TQOA 3CU7A 4B9WA 3EQLC 1KDCA 1SYGA 2E76C 3Q22A 4HJ9A 4S3SA 5M5XB 3CCSA 4DXGA 1TS5A 4F87A 1PHJA 5EPKA 1EY9A 2Y0SG 1R9TB 4XIGS 2JA5H 1I4QA 4F88A 3FMCA 1VQAA 2B2UC 5JEAH 1TWCB 1B8AA 5M3FG 2LS01 1IYVA 3KOJA 5ELEA 1RD9D 2YYZA 3SXHA 3EN2A 2A6HD 2HCCA 5IP7G 1TIID 2WB1G 2NN6I 1KRTA 2RDGA 2L0CA 3PIOA 1EWIA 3D8GA 3PUVA 3I7FA 4DAVA 1R9TH 1C8CA 4A3GG 5FJ8G 3G4SA 4LFCL 4GN4B 4KMUC 3J81j 1ASZA 3GTPH 3HEJA 4UDUC 3NBHA 4DN4M 1WTPA 2R3ZA 1VQMA 4R4CA 1UE1A 1K8GA 4WJ4A 5FLXc 1EEID 4ZKCB 1Y8OB 3EROA 3MXGA 2K5QA 1VQBA 3DWPA 4IUUA 2Q2HA 5JVH3 1X6OA 3K0YA 1DM0B 2K28A 4L5RC 3S2HB 2N78A 3VA5A 3M7NA 3AFPA 1EQQA 1HR0W 4TRDA 3EVQA 4IPGA 3MA2B 2PZWA 4A3BB 1RKNA 1WTHA 4K0KQ 3I73A 4HCSA 1CI3M 3TS2A 3M4PA 1QOHA 4KHVA 4C3IB 3NBHB 1G51A 1A3UA 1DOLA 1YIJA 5M3FH 4CDEC 1DD2A 3K8AA 4KHPQ 4A3LG 4F8MA 4ZUJA 2E74C 1TWHB 2RVLA 3IFDA 3CQZH 3T1YQ 3HOXB 1VQJA 2F0EA 1PVOA 1DGSA 3S16B 1F77A 1L1OB 2F0WA 4FXKC 3D0FA 3E0JA 3MZ5A 3PCOB 4NW2A 4CGYB 4IOCA 1T5XD 4OWWB 1B53A 2JEAI 3MTSA 3SEBA 2O5IC 2UXCL 1TR5A 3RD4A 5C4ZA 3GTOH 4R4TA 2IWHA 2QCPX 1MGSA 5HY6A 4TVAB 4DV4L 4A3IH 4X65Q 3BDLA 3OMCA 3J80i 2AMCB 5FO8B 1G6ZA 3S14H 1SNPA 3M3YB 3CCEA 1N36Q 1BOSA 1RL2A 2R93H 3QG1A 1B44D 2XWBB 3D4WA 3I4NH 4APVA 3CAMA 3N6RA 1EFID 3OTOQ 4JK1C 1Q82C 4R1JA 2ICEC 4B3TQ 2ES2A 1VQ5A 1QJOA 1JE4A 2NVXH 5CBAE 5G3LF 1YNJC 2JXMB 3GO5A 3GTOB 4ZKBB 1G6PA 2LSSA 2R7ZG 4O42A 1D5ZC 2HCIA 1X55A 1EIYB 2K4KA 2QA4A 2AUJD 1A8VA 2L1BA 2OT2A 4EQNA 1OXUA 3LGJA 5EBCA 3H09A 1Y8NB 3JAMi 4A3KB 2SNSA 2F0IA 4JI0Q 2EIFA 4DF7A 1Z6HA 3I4NB 4IFDI 2KJXA 1QZGA 3BDOA 5CV4A 2UXCQ 1CZWA 2NN6G 4A3EG 3HOZB 4K8IA 1Q1EA 4RH6A 5I2YA 4O0AA 2VS1A 3AYHB 5ELBA 1K83B 4Q0FA 3K5MA 2CQAA 3FKIH 5C3EH 1NUCA 1Q8KA 1SNCA 3NE5B 5LL6X 2VNUD 1FGBD 2O5JC 2KEDA 3MWYW 4BY7B 4BBSB 2XRQD 4BBSG 2IPKD 1KRSA 2N55A 3VR2A 2IX3A 2AHOB 3TEHB 1S5DD 4GKKL 2ID0A 3L3OC 1EY4A 4C1NK 2A73B 5COYA 2HDLA 4JCVE 4A93G 2QKIC 1ENAA 1GXDC 4DK1A 3P75A 2R92B 4QY7A 1PDQA 2ICIA 4HIMA 1XNRL 1EQVA 3S14B 5KNBA 1AFPA 2PMZE 2Z1CA 1BKBA 4ILWA 3CD6A 3A56A 4JI5L 1H9SB 4BY7G 1GOZA 5I6WA 2EYLA 4R8IA 4QUFA 1QZHA 4QL5A 1CTMA 1W2BA 3I91A 4JBWA 1SE4A 1JB3A 2EVBA 4OHJA 5AFWA 1FYCA 1HR0Q 5T1GA 1STAA 3GDEA 4N8FA 5JPMC 4WJWA 3RLOA 4PMBA 2WINB 2YTVA 5J22A 2E2JH 5EGTA 3RLNA 1N34Q 1DJRD 1Q46A 3ZJYC 4C3IG 1SFOH 2JA9A 3S24A 1PRTF 1SAPA 3K0XA 4RKBA 1YEZA 5C3XA 1QILA 1X3FA 2Z4IA 4ZQ3A 3AFQA 4RHRA 1PH8A 4BBRH 1U4MA 2HT1A 2JN4A 1KD1C 4AYBE 2JA8H 4R4QA 3PUXA 2PNHA 4L63B 4RHSA 4J15A 4LK1C 5JEAJ 2CH4A 4FYDA 1I4GA 4GN3B 4KKUA 5LMNW 4DR1L 1EYAA 1PTOC 1UNSA 1LLRD 4FXGC 5IYDG 3S1MH 2B2VC 4BBSH 2RF4A 1A0IA 5C4JH 4WFN3 3AU7A 2EYPA 2F0PA 1JT8A 2EYMA 1SYCA 2LKVA 4RGTA 5G3LD 2PZTA 4RMFA 4A3KG 4A3JH 5BR8L 2HQEA 4YWMA 3J81L 2JA6H 1CFMA 3A5UA 1QVGA 3RZDH 5CR3A 1K3BC 2NN6H 3K7UC 5LMNQ 2WAQG 1SRUA 1GUWA 5JVG3 3W5OA 3B6YA 2XN9C 2QF7A 4ULLA 2RDHA 2F4IA 5I2XA 3HOYH 3KDFA 4B3RL 1XYIA 2A6EC 5IGCA 4AYBB 1XX8A 3C46A 1UAPA 4IALA 1GKHA 2K03A 3ERQA 3ULLA 3R3OA 1B3AA 1EQRA 5GAGC 1SROA 4BY1G 3W1BA 2K33A 2NVQB 3PO3H 2WACA 3LX0A 2I5HA 2WIIB 1VQIA 3KBXA 3HKZB 4A4IA 4JI8L 3GTMH 4YHHQ 3HOXH 4JV5L 1WTQA 5IY0A 4QUCA 1AW7A 4A3EH 4BS9A 1V1PA 3C1FA 1O7YA 4JOIC 1U5KA 2PMZB 5E1FA 5BR8Q 5LMUQ 2HIVA 4EX5A 2VZAA 3LWUA 1D6EC 1V9PA 1RTOA 2WKCA 4KV6A 4YCVA 2JA7B 4GKJL 5E4XA 4GN5A 4NXMQ 1YBYA 1YJ9A 4HMJA 4RWSC 3KJOA 3MFYA 4NMZA 3NUCA 4GLAC 2F0LA 3CXCA 4FF2A 1BVSA 4OX9L 1BNZA 2EYHA 1SNDA 4UPAA 5E7NA 4P73A 5C4JB 3SE0A 3QOLA 2X6GA 4PZ8A 4POGA 2F0QA 3NTKA 3S17H 2CWPA 3MEFA 1HZCA 3BJUA 3G6JB 3UE0A 5HGQA 2ENBA 2F0VA 4DFAA 1HUMA 3PF4A 2K5VA 2K75A 4HIOA 2UU9Q 1SE2A 1XTDA 4WORA 2OQ0A 3RZDB 2NUCA 3H3VI 2A68C 4JV5Q 2JK8A 1RF2D 5CV7A 3J80E 5A35A 3CCRA 5ELCA 5C5MA 2G9HD 3CC4A 1QUQB 1KDAA 4K8JA 3CCQA 1GM5A 1ET6A 3HG9A 4IFDH 3PF5A 4NXNQ 5IYBG 1JMCA 1PH4A 3KFUA 4DUYQ 4JBMA 3GTPB 1JWUD 4JI1L 2Z6KA 2RKSA 1VQGA 4OXPA 1HFGA 4GNXC 4A3FB 4DV3L 1F2ZA 2L5TA 1PH7A 1TT2A 3H0GG 5C5LA 3H0GB 3D4DA 2UXDQ 3CCLA 1H9KA 3ONAB 2LY7A 3DMUA 1RDPD 4GOPC 4A3IG 1X65A 2BOSA 3I55A 4PMCA 2PQEA 1STBA 1FNWA 2A74C 4DV2L 2J7ZA 4U673 4A3DB 2UXBQ 3RUZA 3KF8A 3M4OB 1O7ZA 3S1QB 5I9PA 4IZ8A 4TQUS 1EY8A 4TSSA 1YVCA 5M5YH 4DA2A 2B39A 1J8IA 3NWSA 1DXMA 1VQFA 2M00A 1WTWA 4RGMA 2UU9L 1S3OA 5C0XJ 1AE3A 4X3UA 4OL7A 3L9AX 1HZ9A 2EY1A 4ZLTF 1XNQQ 5K36G 1B9NA 3T16A 4M8AA 1YNJD 1UE5A 4DV1Q 1ZKOA 4IO9A 1PH5A 4HSPA 3NELA 1KNAA 2PI2E 2R7ZB 1W6KA 1GUNA 1HTLD 3GQBA 4UHVA 4XDXA 1L0WA 1X3QA 3SDZA 5JOBA 1IW7C 4X64Q 4JI4Q 1MD2D 4IFDG 1I6VC 2A69D 5IODA 3DM1A 1S5ED 5CYUA 5KNDA 2CW0D 4IPHA 3U4ZA 3DXJC 2F03A 4EGVA 2UXDL 4HCEA 2DN8A 1JR0D 5K36H 1DOKA 1GHKA 1JJ2A 2ZXRA 2Z4HA 2B2WA 1ASYA 2RDFA 3HZXA 3WWVA 2NZOA 1EOTA 2E5LQ 1GUOA 4K14A 3H15A 2F3WA 1KHIA 5D3DA 1PH9A 1HH2P 4UP7A 1H9MA 1DOMA 2WAQE 1Q3LA 3NSWA 2NVXB 4A3MH 1HJPA 1WD1A 1EIFA 1YZ6A 5KYLA 3RZOH 2YU9H 1STYA 1O78A 3ER0A 2RHQB 3HOZG 2NVTB 5C0XG 1CKOA 3UE1A 3PUWA 1VF7A 4NPSA 2F0KA 1VQLA 1LTGD 1KAAA 4X64L 1SSOA 1KQSA 4KY7A 2KENA 2CHBD 2QGQA 2E2IB 4CKBA 3IFTA 4FF4A 4X62Q 1F2YA 1MBYA 4N9TA 4DV0Q 2MQHA 4GS3A 2FMMA 3T4AC 5EJWA 1I94L 3LWEA 2FMCA 2K52A 4LF5L 2YTXA 1JWMD 3S1RH 1I5FA 1STEA 2D9UA 2RHSB 3S2HH 4E6IA 4MTNA 2B2WC 4B3MQ 2K5WA 4JI7L 5C44B 2C35B 1NTGA 4CJ2C 2BCOA 5JJZA 2CWAA 3S2DB 1PV4A 5FO9B 2MNAA 1EEFD 3KLSA 2DUDA 2PW5A 3HOUG 1MJCA 3CF5A 3J80c 2SNMA 4FF1A 2KHSA 4I7AA 4X65L 3HOVH 4HJ5A 1I3QH 1L0XB 2DNCA 4KLKA 1C0AA 4J1MA 3DEPA 5HURA 5KEEA 2CVRA 1NR4A 3NQIA 1I94Q 4PG3A 2M2LA 5IGBA 2ZTEA 2Q8IB 1F2MA 4OWXB 2NBFA 3K5OA 4QB4A 1GD7A 4C3JG 2JA6B 2NZ1D 2I5MX 2ZJRA 4OEMB 1KAWA 1QE6A 5M3MG 1BF4A 2MO0A 4IPDA 4GZYC 4IJHA 4DR4L 3C1EA 2BDNA 2A6HC 4DR7Q 4DR6L 1IL2A 1MIUA 3BS1A 2EJGC 2FFKB 1J6QA 3OIQA 3J7YW 3GTKH 3TMEA 1HHVA 3Q23A 1TXYA 4I7ZC 1YJNA 3GTJH 2B2YA 5ISRA 2A6ED 1HZBA 3K58A 4FP5D 1JOQA 3H91A 2K5NA 2K04A 2PI2A 4P75A 2F0GA 2VQFQ 4UAIA 3OYYA 1IBLL 4ME5A 4LFAL 1LYLA 1IBKL 5J3BA 1OXVA 2KCCA 1Q90A 3HKZG 5IT9c 4R4IA 4QIWE 1U4PA 1EZ6A 3BZCA 3KBGA 1JE5A 3M85A 3T56B 4HEDA 4MN3A 4CDCC 4L5QA 4OELB 2G5DA 5IP9H 5C4HA 2JA5B 1XPUA 1PYBA 3PUYA 3TN2A 1UEAB 5HGTA 3VYRA 5JJLA 3PO2H 3P7JA 4GKKQ 2F52A 4QF4A 4LF4L 2XSCA 1EOVA 2EJFC 3G71A 1KC8C 1WCMB 2OTJA 5EQ0A 2OF1A 1JJGA 3S16H 2CFMA 2PYKA 3K80C 4FDBA 1W3SA 1NY4A 3RLFA 2VQEQ 2JP1A 3KDFB 4LF7L 1TY0A 1EL0A 2XNAC 3A5ZB 1EIHA 3TP7A 2AQ2B 4CKEA 5L37A 1PH6A 3TP6A 4KKSA 1P8LA 3ITPA 2R7FA 2ZJQA 5C3WA 2UUAQ 5C4XH 1FJGL 4WJ3M 2A68D 4XXEA 3UDXA 3HOYG 1Y1VH 3H3VC 1SR3A 1TWGB 3VDYA 1OTCA 1R4PB 2H1EA 2PZUA 2XGTA 3H94A 2XWJB 3OSOA 4ME3A 4NKLA 1BBWA 3U9SA 4C2MB 1LTAD 4K2LA 3PO2G 2QILA 5H1SE 4CJ0B 2B2UA 1TWAB 1N9WA 1UUPA 2FXQA 2KECA 1WI5A 1PMRA 3MXNB 2IL8A 1Y14B 4KKTA 1V43A 3S15B 5IOCA 3K5LA 2BH2A 5D14A 3J7ZC 2JA7G 4DR5Q 5DM73 1N32L 1QNUA 1ZXTA 3TZUA 3GTQH 4GOPB 4Q5VA 2KUMA 1SDFA 5FO7B 1TWFH 2PNRC 5M3MB 4AQYL 1YHBA 4HTHA 1EY6A 2YU9B 2DGYA 3V05A 3JAML 3PSIA 2WFWA 4LF9Q 4G7HC 3KLSX 2R7ZH 3MXPA 3GTGB 4IOAA 3AEVA 1I6HH 1CZGA 5LMNL 3GTMB 1CUKA 2K01A 4AYBG 1Y69U 4DGZA 2ZT9C 1PTOF 2G9DA 4RGNA 3PIO3 2NWGA 1K8OA 2H4OA 2B2TC 1ZEQX 2Q2IA 1W6JA 2F0OA 4R9WA 4X3SA 4GOPA 2J0TD 3JAME 4KHZA 4EQOA 3CCJA 5TSSA 4B3RQ 1CQVA 1QWYA 2LXKA 3X3NA 2IT1A 3KF8B 3RR5A 1I3QB 1LM0A 4P74A 1D5MC 2CW0C 5DLQE 1HNXL 4QQBX 3I8ZA 1WD0A 3J7AV 2VW9A 3MXUA 4JI5Q 4G7OC 1Z9FA 2AQ3B 3NWTA 1Y1WH 4KTAA 2F3IA 1D1IA 2E2HB 2RA4A 2IY5B 3S17B 2Y0SB 3I4MG 1PYWD 2BE5D 3QJYA 4L8JA 4IUPA 4DR2Q 1JICA 2B3GA 5IT9L 2X6LA 3HOUH 4NB3A 2F0UA 3WOFA 1CKMA 1TU2B 4LF8L 2AQ1B 3BYYB 2F0JA 3VYTA 3S1NB 3K57A 4ZRZA 4DR3L 2ZJPA 3PGZA 1X9NA 3DEOA 4QIWB 2VB2X 1AZQA 2A5HA 3FVQA 1PA6A 4PV1C 1K8MA 4UP9A 1FR3A 4X6AH 1HNXQ 2M9VA 3U9OA 1IL8A 3R2TA 2JYOA 1D2BA 4A3FH 4DNRB 5GROA 4DK0A 2L12A 1L2FA 5CC4A 3GTGH 3TSSA 1I6HB 1UEBA 4PMWA 3F8TA 5JEAG 1NNXA 3OWFA 1BBUA 2YV5A 1LO5D 1JB7A 2J4XA 2ZXPA 3CPFA 4C56C 1CT1D 1PTOD 1O7LA 3CRKC 4YY3L 4HJAA 3MFGA 3EBEA 3L2PA 4BWGB 4LF8Q 2F0HA 2Z6BA 5IWAQ 1X3PA 4PQXA 3NHHA 1PZID 5C3EG 2NVYH 1WYDA 3BVZA 2L9HA 4IJLA 1XMQL 1EU4A 3TDQA 1C4QA 4K0KL 1AP0A 5FLMG 2I0QA 3CC2A 5IGEA 4JYAL 2EXZA 1VQ6A 2F1MA 1YITA 3DWQA 1B2TA 5C44G 4XQJA 3VA7A 3U4VA 2EQSA 4G4KA 1KNEA 3AMUA 4OWTB 2R92G 1EQTA 1WTOA 4DV5L 3I4MB 1PTOH 1Y1VB 2PW7A 1HCZA 1HA5A 3J7AF 3TP8A 4KJOA 5E4WC 2EYOA 1E1TA 3OWEB 4OO1I 1U4RA 2KCTA 3MC0B 4A3EB 3G7LA 4LJZC 4C3HG 1QCBD 1TS2A 4LFBL 3GTJB 4DV6Q 2IJ0A 1MSHA 3FRPB 5JPNC 1G2TA 1YNNC 4DUZQ 2OEOA 4LUZA 1F2LA 3A0JA 3HGBA 2MUYA 2D5DA 3I4MH 1HNZL 2N8NA 1XMQQ 1OXXK 3C3LA 3UDFA 2E2JB 1BUVT 1H9RA 3BZKA 2IHFA 5C3EB 1H95A 3OTOL 2F0SA 3MAQA 3PIPA 1HZAA 3M4YA 1Q12A 3NPPA 3OHXC 3GP7A 3W1GA 1EFWA 3K6OA 3GTLH 2O2LD 2PO4A 2UUCL 3BU2A 1II3A 2Q2UA 3A8IE 2SOBA 3EIVA 4DK6C 4P71A 2I07B 1A2TA 2R92H 4OIKA 1VQCA 1I50H 4A3BG 1SEBD 4ZUIA 3Q24A 1IXRA 2VXWA 1HUNA 4JI0L 3F2CA 5KGUA 4XQNA 4A3MG 4A3GH 4DPGA 2VL6A 1SE3A 4XT1B 4QJFA 4IUVA 3GTLB 3KJPA 4C3JB 5D65A 1WTXA 2B63H 2HHHQ 1X3GA 4PZ7A 4K5WA 3QIAA 3HFZB 5CGKA 1B4OA 4P2CB
chains in the Genus database with same CATH topology
2K05A 4LAAA 2F0TA 1E0BA 1D1KA 3RMHA 5KRUA 3NK9A 1S5FD 2V4DA 1PXUA 5KYIA 1NCVA 1A15A 3P20A 2EE1A 1HTPA 1JQYD 2JE6I 3SK4A 1DYQA 1ILQA 4IUNA 5CV6A 4PNYA 1XWEA 2Q8TA 1QNKA 4OIJA 3URYA 1B9MA 1IHZA 1LV9A 1SNMA 1STGA 2PCFB 5I9OA 2EPBA 3V96A 2AWNA 1AEXA 2E75C 4RGOS 3IAYA 1V1PB 3A8KE 1A2UA 1IW7D 1FNVA 1SYFA 1AN8A 1RTNA 1HA6A 3NTIA 1BBXC 1DCZA 2RSOA 3HS0C 1E2WA 3NBIA 3QWNA 1OXTA 2K6AA 1ILPA 1IKMA 1CM9A 3D3RA 4DXFA 1LACA 1SJED 5EBDA 2K5DA 1T5EA 3KLRA 1TVXA 1FNUA 1S5CD 1WTVA 4WRDA 4XQQA 5BN4A 3C2PA 4TKOB 2EZVA 2K1BA 1A3TA 1BR9A 1G91A 1A3VA 4RA8A 5I6YA 4V0BA 2EY6A 1LT6D 1MI2A 1D5XC 2BE5C 3HOUB 3D6WA 1I4XA 1STHA 3CHBD 4KD3A 3BDCA 2L4NA 4IN3A 3WOEA 1AZPA 3N52A 4KK7A 1CQFA 1LT3D 4NP5A 5DNFA 1G8ZD 1BCPB 3QO2A 1KDBA 1DONA 2E2DC 4KD4A 5F2DA 2MHVA 5M5YB 3K59A 1LTRD 5IT9E 2QEJC 2O4XA 4A3IB 1ONLA 4J8QA 3FKIB 5EKLA 4BY1B 4CKCA 1SMYC 4G7ZC 1EYDA 1L0YB 2BDOA 4HAEA 3UI2A 1G2SA 4N9PA 3R8BA 4KJNA 2Q8RE 1RODA 2HUGA 4HN7A 4ODGA 1EZ8A 3I3CA 3VR5A 4RKLA 2IX1A 1LT5D 3VR6A 1KLGD 3HOYB 3I72A 5A2QE 3NXWA 2XIWA 4H13C 1TY2A 3K7AB 4ZAIA 1VMPA 4Y7NB 3SK8A 1PRTB 1B1ZA 2QDBA 4B08A 4A93B 2R6GA 2IW3A 4KY5A 1PRTD 2IX0A 4ZK9B 3CRLC 1GUGA 4XYQA 1U4LA 1X32A 4DU9A 1ESRA 3SK6A 4OGQC 2TSSA 2AUKA 2KA7A 4ID6A 2KVMA 5IIFA 1J9OA 2RBMA 5FK9C 3A8JE 1YNND 1HQRD 1EWHA 3CQZB 3DWAA 1CHPD 2JSOA 3KK7A 2DY7A 1GUSA 3CKIB 1JORA 3OIPA 1VDZA 2R61A 3GTKB 1XTCD 2Z8LA 3BVMA 1EIGA 2D2CC 5C0XH 5J1ZA 1PLFA 5BN3A 3AB9A 2DNEA 3O13A 3GTQB 3ND8A 5J39A 2N88A 3ZYYX 3T13A 5FLXL 2SEBD 3J80L 3QOJA 3P1HA 2KCNA 4O1NA 1I4HA 2F0DA 4XT3B 1RHPA 3MXNA 2KQ3A 1E2ZA 1WVLA 1S5BD 3PO2B 3I70A 3PMFA 1SBBB 1RJTA 4X3TA 2C5CA 4A3MB 1CHQD 5IGGA 1ENCA 3BG3A 1Y8PB 5IGFA 5CORA 1RCVD 4IUQA 4K6LA 5DAUA 4K6DA 1SFOB 4F7XA 1F9PA 1GUTA 1BCPC 1V8QA 1PZKD 5FLXE 2OXPA 4QCLA 5EKIA 2FINB 3FPPA 1ML0D 1NAPA 3NP8A 2NYZD 1FD7D 2L11A 2PPBC 3SVMA 1E2VA 4K2KA 1SNOA 3MVVA 2DY8A 4KN7C 1S4ZA 1TS4A 5D3IB 2X69A 2R93B 1SNQA 1QG7A 5C6AA 5EPJA 2C9OA 2F0MA 1LTID 3FEWX 4B9XA 1KTKA 3L7ZC 3R93A 2MPMA 4J6HA 1BCPF 2FHTA 3A55A 4OO1G 4RFBA 2BA0A 1SXTA 4FNFA 3A7AB 3TBIB 4DAPA 5NUCA 1BDOA 1U9RA 3BYTB 5CV5A 1WTRA 4HR7B 4DAYA 4H0LC 3ND9A 2WV6D 1LTBD 3D4RA 5M9OA 2K32A 3MEHA 2AWOA 4RCOA 4CBVA 4FO2A 4EVOA 2TMPA 1XXGA 4K5XA 2LFNA 2NTTA 1PFNA 4IQZA 1VF5C 1ZYRC 1Z7TA 1H9SA 4A3JB 4H7BA 2EOTA 2EY5A 2HDMA 1H9JA 1HFNA 5FKAC 1TWFB 4A3GB 5EPLA 1OO9B 4X3KA 3OMGA 3SR1A 3VYUA 3VR4A 3VR3A 4MHEA 3TZDA 3LNNA 1EU3A 4K5VA 4C3HB 4BBRB 1SMYD 1LTTD 3E6ZX 1Q1BA 3TP5A 3V2TA 5FOBB 1STNA 1JCKB 3Q0AA 3S1MB 3EA6A 1V1OA 1KABA 1EWCA 2JEBI 1O80A 1JWSD 2EYFA 5EKKA 4H44C 1HXYD 3OPOA 3HP3A 3T53B 3J81E 1BQQT 5C0XI 4XYOA 3EJIA 1QB5D 3VYSA 2XRSD 1PRTC 3HOWB 1LTSD 3GD7A 3HRZC 3A7LA 1NR2A 3BZDB 2GA4B 4CHTB 3PO3B 4IURA 3EFXD 1ET9A 3RZOB 1IYUA 4RCNA 1ESFA 3F2UA 2I46A 1PZJD 2F0NA 3FDTA 3FPUB 5BN5A 1ENFA 4CJ1B 1A6XA 1HPCA 5E3FA 1LABA 5C4XB 4L6TB 2F0FA 1Q8IA 5KNCA 5K5PA 1EYCA 1TKWB 3GV3A 2VUMB 2WP8J 4R8NA 4U68A 2L55A 2EY2A 5A2QL 3NQTA 4RAUC 1PFMA 3GV6A 5KIXA 5ELFA 5M5WB 4NDXA 2RQXA 2SDFA 2B2YC 3R2IA 2BA1A 3I4LA 4ABNA 1I4PA 5ELDA 5LL6S 1G291 4DNTB 1JOKA 1GHJA 2KEEA 2NTSA 3S1RB 1Z47A 3DUZA 1C48A 2WKDA 1ICWA 3OW7A 3PIP3 1M8AA 3PUZA 1BCPD 1B50A 3X3MA 1MSGA 1GJXA 3Q6SA 4FVMA 2LMCB 2EYJA 2MP1A 3NTHA 3PV0A 2EJMA 3SK5A 1F9SA 5M3FB 3H6MA 2B8GA 1EY5A 2A69C 5JAVA 1CA6A 4XTCS 1HRJA 2MJ8A 1EY7A 1NSNS 5LHY1 3S9WA 1VCIA 3IL8A 3A54A 2ZXOA 1VMCA 2JA8B 4KN4C 2NVYB 2F3VA 5CV9A 2EDGA 4ZYSA 2VB3X 3W3AA 1CK1A 4KY6A 1F9RA 1SYEA 3D6CA 3QB3A 3SHLA 5T1IA 4IUTA 1PFBA 1LT4D 3IKJA 4LMQD 2NB0A 4KI0A 4Z9CB 1Y1WB 1R4QB 5I4DA 2B8FA 1EY0A 1SJHD 1SYBA 1PTOB 4EQPA 4FF3A 1BXTA 4I65A 5CBEE 3HOVB 1CA5A 4QMGA 3KUPA 1HQMC 3D31A 5IGDA 4V190 2B63B 1SYDA 1TS3A 5DM63 1DZ1A 3E5SA 4M1UB 4MIUA 5DEHA 2FJ2A 5CV8A 4FXDA 1IKLA 1JC7A 1BO0A 1ZYRD 5CMDA 1KLUD 3W2DA 2RSNA 4BA2I 4HSVA 2WB1B 2D62A 4HMIA 2MGSA 3OOCA 2B2TA 2XVSA 3M7GA 4YIJA 1JOOA 3T51B 1I4RA 3I90A 2K7VA 3WDNA 4OO1H 3BVGA 1M4VA 2KOLA 4BA1I 1OXSC 4C1NI 1F9QA 4G57A 4IFDJ 3MHBA 1I50B 3K5NA 3DHQA 2B2VA 2WAQB 1TQOA 4B9WA 3CU7A 3EQLC 1KDCA 1SYGA 2E76C 3Q22A 4S3SA 5M5XB 4DXGA 1TS5A 4F87A 5EPKA 1EY9A 1R9TB 4XIGS 1I4QA 4F88A 3FMCA 2B2UC 5JEAH 1TWCB 2LS01 1IYVA 5ELEA 1RD9D 3SXHA 2YYZA 2A6HD 2HCCA 1TIID 2NN6I 2RDGA 2L0CA 3D8GA 3PUVA 4DAVA 1C8CA 4KMUC 3HEJA 4UDUC 3NBHA 4DN4M 1WTPA 2R3ZA 1EEID 4ZKCB 1Y8OB 3EROA 3MXGA 2K5QA 3DWPA 4IUUA 5JVH3 3K0YA 1DM0B 2K28A 3S2HB 3M7NA 3VA5A 4TRDA 3EVQA 3MA2B 2PZWA 4A3BB 1RKNA 3I73A 4HCSA 1CI3M 1QOHA 4KHVA 4C3IB 1A3UA 1DOLA 1DD2A 4F8MA 4ZUJA 2E74C 1TWHB 2RVLA 3IFDA 3HOXB 2F0EA 3S16B 1F77A 2F0WA 4FXKC 3E0JA 3MZ5A 4NW2A 4CGYB 1T5XD 1B53A 2JEAI 3MTSA 3SEBA 2O5IC 1TR5A 3RD4A 5C4ZA 2IWHA 2QCPX 1MGSA 3BDLA 3OMCA 5FO8B 1G6ZA 1SNPA 3M3YB 1BOSA 3QG1A 1B44D 2XWBB 3D4WA 3N6RA 1EFID 4JK1C 2ICEC 1QJOA 1JE4A 5CBAE 5G3LF 1YNJC 2JXMB 3GO5A 3GTOB 4ZKBB 4O42A 1D5ZC 2HCIA 2AUJD 2L1BA 2OT2A 4EQNA 1OXUA 5EBCA 3H09A 1Y8NB 4A3KB 2SNSA 2F0IA 4DF7A 1Z6HA 3I4NB 4IFDI 2KJXA 3BDOA 5CV4A 1CZWA 2NN6G 3HOZB 4K8IA 1Q1EA 4RH6A 5I2YA 5ELBA 1K83B 4Q0FA 3K5MA 2CQAA 1NUCA 1SNCA 3NE5B 5LL6X 2VNUD 1FGBD 2O5JC 2KEDA 3MWYW 4BY7B 4BBSB 2XRQD 2IPKD 2N55A 3VR2A 2IX3A 1S5DD 2ID0A 3L3OC 1EY4A 4C1NK 2A73B 5COYA 2HDLA 2QKIC 1ENAA 1GXDC 4DK1A 3P75A 2R92B 1PDQA 2ICIA 1EQVA 3S14B 5KNBA 1AFPA 2Z1CA 4ILWA 3A56A 1H9SB 1GOZA 5I6WA 2EYLA 4R8IA 4QUFA 1CTMA 3I91A 4JBWA 1SE4A 1JB3A 2EVBA 4OHJA 5AFWA 1FYCA 5T1GA 1STAA 5JPMC 4WJWA 4PMBA 2WINB 5J22A 5EGTA 1DJRD 4C3IG 1PRTF 1SAPA 4RKBA 5C3XA 1QILA 2Z4IA 4ZQ3A 4RHRA 1U4MA 3PUXA 4L63B 4RHSA 4LK1C 5JEAJ 4FYDA 1I4GA 4KKUA 1EYAA 1PTOC 1UNSA 1LLRD 4FXGC 2B2VC 4WFN3 3AU7A 2EYPA 2F0PA 2EYMA 1SYCA 2LKVA 4RGTA 5G3LD 2PZTA 2HQEA 3J81L 1CFMA 5CR3A 2NN6H 1GUWA 5JVG3 2XN9C 2QF7A 4ULLA 2RDHA 2F4IA 5I2XA 1XYIA 2A6EC 5IGCA 4AYBB 1XX8A 3C46A 1UAPA 4IALA 2K03A 3ERQA 3R3OA 1B3AA 2K33A 2NVQB 2WACA 3LX0A 2WIIB 3KBXA 3HKZB 1WTQA 4QUCA 1AW7A 4BS9A 1V1PA 3C1FA 1O7YA 2PMZB 5E1FA 3LWUA 1D6EC 1RTOA 2WKCA 4KV6A 2JA7B 5E4XA 4HMJA 4RWSC 3MFYA 4NMZA 3NUCA 2F0LA 4FF2A 1BNZA 2EYHA 1SNDA 5C4JB 3SE0A 3QOLA 2X6GA 2F0QA 3NTKA 3G6JB 2ENBA 2F0VA 4DFAA 1HUMA 1SE2A 3RZDB 4WORA 2NUCA 2A68C 1RF2D 5CV7A 3J80E 5A35A 5ELCA 5C5MA 2G9HD 1KDAA 4K8JA 1ET6A 3HG9A 4IFDH 3GTPB 1JWUD 2RKSA 1HFGA 4A3FB 1F2ZA 2L5TA 1TT2A 5C5LA 3H0GB 3D4DA 1H9KA 3ONAB 2LY7A 3DMUA 1RDPD 2BOSA 4PMCA 2PQEA 1STBA 1FNWA 2A74C 2J7ZA 4U673 4A3DB 3RUZA 3KF8A 3M4OB 1O7ZA 3S1QB 5I9PA 4IZ8A 4TQUS 1EY8A 4TSSA 4DA2A 2B39A 1J8IA 3NWSA 1DXMA 2M00A 1WTWA 4RGMA 5C0XJ 4X3UA 3L9AX 4OL7A 2EY1A 4ZLTF 5K36G 1B9NA 3T16A 4M8AA 1YNJD 1ZKOA 4HSPA 1KNAA 2R7ZB 1W6KA 1GUNA 1HTLD 3GQBA 4XDXA 1X3QA 3SDZA 5JOBA 1IW7C 1MD2D 4IFDG 1I6VC 2A69D 5IODA 3DM1A 1S5ED 5CYUA 5KNDA 2CW0D 2F03A 3DXJC 4EGVA 4HCEA 2DN8A 1JR0D 5K36H 1DOKA 1GHKA 2ZXRA 2Z4HA 2B2WA 2RDFA 3HZXA 1EOTA 1GUOA 4K14A 2F3WA 5D3DA 1H9MA 1DOMA 1Q3LA 3NSWA 2NVXB 1WD1A 5KYLA 1STYA 1O78A 2NVTB 5C0XG 3PUWA 1VF7A 2F0KA 1LTGD 1KAAA 1SSOA 4KY7A 2CHBD 2E2IB 4CKBA 3IFTA 4FF4A 1F2YA 1MBYA 4N9TA 2FMMA 3T4AC 5EJWA 3LWEA 2FMCA 1JWMD 1STEA 2D9UA 4E6IA 2B2WC 2K5WA 5C44B 4CJ2C 2BCOA 5JJZA 3S2DB 5FO9B 1EEFD 3KLSA 2PW5A 2SNMA 4FF1A 2KHSA 1L0XB 2DNCA 4J1MA 3DEPA 5HURA 5KEEA 2CVRA 1NR4A 3NQIA 2M2LA 5IGBA 2Q8IB 1F2MA 2NBFA 3K5OA 4QB4A 4C3JG 2JA6B 2NZ1D 1QE6A 1BF4A 4GZYC 3C1EA 2BDNA 2A6HC 3BS1A 2EJGC 2FFKB 3OIQA 3J7YW 3TMEA 1HHVA 3Q23A 4I7ZC 2B2YA 5ISRA 2A6ED 3K58A 4FP5D 1JOQA 3H91A 2K04A 2F0GA 4UAIA 4ME5A 1OXVA 2KCCA 1Q90A 1U4PA 1EZ6A 3KBGA 3M85A 3T56B 4HEDA 4MN3A 5C4HA 2JA5B 3PUYA 5HGTA 1UEAB 3TN2A 3VYRA 3P7JA 4QF4A 2XSCA 2EJFC 1WCMB 5EQ0A 2OF1A 2PYKA 3RLFA 2JP1A 1TY0A 1EL0A 2XNAC 1EIHA 3TP7A 2AQ2B 4CKEA 3TP6A 4KKSA 3ITPA 5C3WA 2A68D 4XXEA 3H3VC 1TWGB 1R4PB 2H1EA 2PZUA 3H94A 2XWJB 3OSOA 4NKLA 3U9SA 4C2MB 1LTAD 4K2LA 2QILA 4CJ0B 2B2UA 1TWAB 1UUPA 2KECA 1PMRA 2IL8A 4KKTA 1V43A 3S15B 5IOCA 3K5LA 5D14A 5DM73 1QNUA 1ZXTA 3TZUA 4Q5VA 2KUMA 1SDFA 5FO7B 2PNRC 5M3MB 4HTHA 1EY6A 2YU9B 3V05A 3JAML 4G7HC 3KLSX 3MXPA 3GTGB 1CZGA 3GTMB 2K01A 1Y69U 4DGZA 3PIO3 1PTOF 2G9DA 2ZT9C 4RGNA 2NWGA 1K8OA 2H4OA 2B2TC 1ZEQX 1W6JA 2F0OA 4R9WA 4X3SA 2J0TD 3JAME 4KHZA 4EQOA 5TSSA 1CQVA 1QWYA 3X3NA 2IT1A 1I3QB 1D5MC 2CW0C 3I8ZA 1WD0A 3J7AV 3MXUA 4G7OC 2AQ3B 3NWTA 4KTAA 1D1IA 2E2HB 2RA4A 3S17B 2Y0SB 1PYWD 2BE5D 3QJYA 4L8JA 4IUPA 1JICA 5IT9L 2X6LA 2F0UA 3WOFA 1TU2B 2AQ1B 3BYYB 2F0JA 3VYTA 3S1NB 3K57A 4ZRZA 3DEOA 4QIWB 2VB2X 1AZQA 2A5HA 3FVQA 4PV1C 1K8MA 1FR3A 2M9VA 3U9OA 1IL8A 3R2TA 2JYOA 1D2BA 4DNRB 4DK0A 2L12A 5CC4A 1I6HB 3TSSA 4PMWA 5JEAG 3OWFA 1LO5D 2J4XA 2ZXPA 4C56C 1CT1D 1PTOD 1O7LA 3CRKC 3MFGA 4BWGB 2F0HA 1X3PA 4PQXA 3NHHA 1PZID 3BVZA 2L9HA 1EU4A 3TDQA 1C4QA 1AP0A 5IGEA 2EXZA 2F1MA 3DWQA 1B2TA 4XQJA 3VA7A 4G4KA 1KNEA 3AMUA 1EQTA 1WTOA 3I4MB 1PTOH 1Y1VB 2PW7A 1HCZA 1HA5A 3J7AF 3TP8A 4KJOA 5E4WC 2EYOA 3OWEB 4OO1I 1U4RA 3MC0B 4A3EB 4C3HG 3G7LA 4LJZC 1QCBD 1TS2A 3GTJB 2IJ0A 1MSHA 3FRPB 5JPNC 1G2TA 1YNNC 2OEOA 1F2LA 3HGBA 2MUYA 2D5DA 1OXXK 3C3LA 2E2JB 1BUVT 1H9RA 5C3EB 2F0SA 3MAQA 3M4YA 1Q12A 3NPPA 3OHXC 3GP7A 3K6OA 2O2LD 2PO4A 1II3A 3A8IE 2SOBA 2I07B 1A2TA 4OIKA 1SEBD 4ZUIA 3Q24A 2VXWA 1HUNA 5KGUA 4XQNA 1SE3A 4XT1B 4IUVA 3GTLB 4C3JB 5D65A 1WTXA 4K5WA 3QIAA 5CGKA 1B4OA 4P2CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MZ5 A;  4IZ8 A;  3H6M A;  1EQV A;  1EY8 A;  4LAA A;  4QF4 A;  4EQO A;  4K6D A;  3DHQ A;  1EY5 A;  4F7X A;  5IGE A;  2WAC A;  2F0T A;  2M00 A;  3LX0 A;  5KRU A;  5JAV A;  3NK9 A;  2EXZ A;  1TQO A;  4B9W A;  4OL7 A;  1KDC A;  1TR5 A;  4DU9 A;  1SYG A;  2EY1 A;  5C4Z A;  1STH A;  2EYL A;  3OMG A;  5I6W A;  1EY7 A;  1NSN S;  2OF1 A;  2OXP A;  4KD3 A;  3BDC A;  3SK6 A;  3SR1 A;  5KYI A;  3T16 A;  3S9W A;  2PYK A;  5E3F A;  4S3S A;  2PW5 A;  3BDL A;  3OMC A;  4ID6 A;  5IIF A;  2RBM A;  3C1F A;  1STA A;  1EY9 A;  5E1F A;  1SNP A;  4PMB A;  3SK4 A;  5J22 A;  2F3V A;  2PW7 A;  2SNM A;  4K5V A;  4IUN A;  2F0F A;  3NP8 A;  2KHS A;  4KTA A;  4KV6 A;  4NP5 A;  3D4W A;  4PNY A;  5CV6 A;  5CV9 A;  5JOB A;  5K5P A;  1EYC A;  3TP7 A;  4KY6 A;  3TP8 A;  1KDB A;  4KJO A;  1SYE A;  5IOD A;  1JOR A;  4R8N A;  1IHZ A;  2EYO A;  4KD4 A;  5F2D A;  3TP6 A;  3D6C A;  4K2K A;  3QB3 A;  1SNM A;  3SHL A;  1SNO A;  4J1M A;  1STG A;  3MVV A;  4HMJ A;  3ITP A;  3SXH A;  3TP5 A;  3V2T A;  5HUR A;  2EY2 A;  5C3W A;  5I9O A;  5KEE A;  4NMZ A;  3NQT A;  4RKB A;  2F0U A;  3NUC A;  2F0L A;  5C3X A;  1AEX A;  5IGB A;  1STN A;  2EYH A;  4ZQ3 A;  5KIX A;  2O4X A;  1F2M A;  3D8G A;  1SND A;  2F0J A;  4EQN A;  4QB4 A;  4NDX A;  2OEO A;  1SNQ A;  1KAB A;  5EKL A;  5J1Z A;  1EY0 A;  3QOL A;  2F0Q A;  2PZU A;  2RDF A;  1SYB A;  3OSO A;  1A2U A;  2EYF A;  3HZX A;  4NKL A;  5C6A A;  4EQP A;  2SNS A;  4K2L A;  5EKK A;  1SYF A;  4I65 A;  1EYD A;  2F0I A;  3HEJ A;  4K14 A;  2F0M A;  2ENB A;  4DF7 A;  2F0V A;  2F3W A;  4B9X A;  2F0S A;  4DFA A;  3C1E A;  5CV4 A;  4QMG A;  1EYA A;  4WOR A;  5J39 A;  1JOK A;  2NUC A;  4N9P A;  4J6H A;  3T13 A;  5IGD A;  4KJN A;  4K8I A;  1SYD A;  2EYP A;  3U9O A;  1II3 A;  3ERO A;  5IOC A;  2F0P A;  5CV7 A;  3TME A;  5KYL A;  3QOJ A;  1STY A;  4ODG A;  2EYM A;  2SOB A;  3P1H A;  3EJI A;  3MHB A;  1EZ8 A;  3E5S A;  5C5M A;  4MIU A;  1SYC A;  2LKV A;  5DEH A;  4RKL A;  5NUC A;  2F0D A;  1U9R A;  5ISR A;  2PZT A;  5CV8 A;  5CV5 A;  3VA5 A;  1KDA A;  4K8J A;  2KQ3 A;  1A2T A;  5CC4 A;  2HQE A;  1JOQ A;  4TRD A;  1NUC A;  2F0K A;  3EVQ A;  1SNC A;  1KAA A;  2PZW A;  1RKN A;  3OWF A;  2F0G A;  4ZUI A;  5CR3 A;  4HMI A;  5M9O A;  3NXW A;  3MEH A;  4WRD A;  4KHV A;  4KY7 A;  5KGU A;  2RKS A;  3PMF A;  4HTH A;  4EVO A;  1EY6 A;  1A3U A;  4ME5 A;  4YIJ A;  1F2Y A;  1JOO A;  4N9T A;  1F2Z A;  1TT2 A;  5C5L A;  5EGT A;  1EZ6 A;  2QDB A;  3D4D A;  3SK8 A;  4ZUJ A;  4F8M A;  2F0H A;  4K5X A;  3DMU A;  3MXP A;  4KY5 A;  4K5W A;  5IGG A;  5IGC A;  1A3T A;  1EY4 A;  3NHH A;  4DGZ A;  4PMC A;  2PQE A;  1STB A;  2EYJ A;  2F0E A;  5C4H A;  1ENC A;  5CGK A;  4E6I A;  1A3V A;  5I6Y A;  4IAL A;  3RUZ A;  1ENA A;  2F0W A;  4G57 A;  3ERQ A;  2EY6 A;  2F0O A;  3R3O A;  4H7B A;  5HGT A;  5IGF A;  3P75 A;  2EY5 A;  5I9P A;  5DAU A;  3SK5 A;  2F0N A; 
#chains in the Genus database with same CATH topology
 2K05 A;  5FLM H;  3H3V H;  4LAA A;  3M3Y H;  2WB1 E;  3T1H Q;  2F0T A;  1E0B A;  1D1K A;  3RMH A;  5KRU A;  3NK9 A;  4YWK A;  1B7Y B;  1S5F D;  2V4D A;  4A3F G;  1PXU A;  5KYI A;  2K50 A;  1NCV A;  1A15 A;  3P20 A;  4L5S A;  2EE1 A;  5FJ8 H;  4JI2 Q;  2ATW A;  1HTP A;  1JQY D;  2JE6 I;  3SK4 A;  4LFC Q;  1DYQ A;  1ILQ A;  4IUN A;  5CV6 A;  4PNY A;  1XWE A;  4BXX H;  2Q8T A;  1QNK A;  4OIJ A;  3CCU A;  3URY A;  1B9M A;  1IHZ A;  1LV9 A;  1SNM A;  1STG A;  2PCF B;  1VQ9 A;  5I9O A;  4A3C H;  2CCZ A;  1IYJ B;  2EPB A;  3V96 A;  2AWN A;  1AEX A;  2E75 C;  5GAH C;  4RGO S;  1WFQ A;  3IAY A;  1A62 A;  1V1P B;  1GVP A;  3A8K E;  1TWC H;  1A2U A;  1IW7 D;  1FNV A;  1SYF A;  3U50 C;  3J7A 5;  4YCW A;  1AN8 A;  1EYG A;  3UDG A;  2OCE A;  1RTN A;  1HA6 A;  3NTI A;  1BBX C;  4H02 A;  1DCZ A;  2RSO A;  3HS0 C;  1E2W A;  3DM3 A;  3AQQ A;  2Z0S A;  4KHP L;  3NBI A;  3QWN A;  1OXT A;  2K6A A;  3NEN A;  1ILP A;  1UWV A;  4DAM A;  4DR4 Q;  1IKM A;  1CM9 A;  3D3R A;  1QVF A;  4DXF A;  1LAC A;  1SJE D;  4DR6 Q;  5EBD A;  1UE6 A;  2K5D A;  1T5E A;  3KLR A;  1TVX A;  4LWC A;  3I56 A;  3RNU A;  2NVQ H;  1FNU A;  1S5C D;  2JA6 G;  1WTV A;  4WRD A;  4B3S Q;  1FL0 A;  4XQQ A;  3PO3 G;  5BN4 A;  4IPC A;  1P16 A;  3C2P A;  1E1O A;  1Y1W G;  1WCM H;  4TKO B;  2EZV A;  1NBW A;  2K1B A;  3Q8D A;  1A3T A;  1BR9 A;  1G91 A;  2GN5 A;  1A3V A;  4RA8 A;  5I6Y A;  4UY8 C;  4V0B A;  2EY6 A;  4C3I H;  3TRE A;  3L0O A;  1VQ4 A;  1LT6 D;  1M1K C;  1MI2 A;  1D5X C;  2BE5 C;  1IBM Q;  2K5H A;  3HOU B;  3D6W A;  1I4X A;  2CKZ B;  3QR8 A;  1STH A;  3CHB D;  4KD3 A;  5GAD C;  3CCV A;  3BDC A;  2L4N A;  4HJ8 A;  4IN3 A;  3WOE A;  1AZP A;  3N52 A;  1YHQ A;  1L1O C;  4KK7 A;  3HOX G;  3HKZ E;  1TWH H;  1CQF A;  1QVC A;  4A3J G;  3ICE A;  1LT3 D;  4NP5 A;  1KXL A;  3ULP A;  5DNF A;  1G8Z D;  1BCP B;  3QO2 A;  1KDB A;  1DON A;  2E2D C;  3KYH C;  4KD4 A;  5F2D A;  2MHV A;  5M5Y B;  3K59 A;  4MTK A;  1LTR D;  2F4V Q;  5IT9 E;  2QEJ C;  1EUJ A;  2O4X A;  4A3I B;  1E3P A;  1ONL A;  3KF6 B;  2QEX A;  4J8Q A;  3FKI B;  5EKL A;  1VQP A;  4BY1 B;  1M90 C;  1IZ6 A;  4BBR G;  4CKC A;  2OQK A;  1SMY C;  2PQA B;  3CC7 A;  4CDD C;  4G7Z C;  1EYD A;  4OON A;  1L0Y B;  4P72 A;  2BDO A;  4HAE A;  3SGI A;  3UI2 A;  2ZTC A;  1G2S A;  3I4O A;  4N9P A;  1J5E Q;  3R8B A;  1XMO Q;  4KJN A;  2Q8R E;  2V1C C;  1ROD A;  3IRB A;  2HUG A;  4HN7 A;  4Y52 H;  4ODG A;  1K8A C;  1EZ8 A;  3I3C A;  1A63 A;  3VR5 A;  4RKL A;  2IX1 A;  1LT5 D;  2UUB L;  4C3J H;  3VR6 A;  4DR7 L;  3A74 A;  1KLG D;  2Z6K C;  3HOY B;  3I72 A;  5A2Q E;  2E8G A;  3JC6 6;  1XNR Q;  3RN5 A;  4JVZ A;  4JW0 A;  3NXW A;  2XIW A;  4H13 C;  3F2B A;  5IYD H;  1PH1 A;  1TY2 A;  1E24 A;  3K7A B;  4LF6 Q;  4ZAI A;  1VMP A;  1LTL A;  4Y7N B;  3SK8 A;  1PRT B;  1B1Z A;  2MFI A;  2QDB A;  4B08 A;  2VQF L;  4A93 B;  2R6G A;  2IW3 A;  4KY5 A;  1PRT D;  4AQY Q;  2IX0 A;  1K73 C;  1B3Q A;  3CPW A;  4ZK9 B;  1K0S A;  1N34 L;  3CRL C;  1GUG A;  4NXN L;  4EQ5 A;  1K28 A;  4XYQ A;  3OW2 A;  3I4N G;  3CW2 C;  4BY7 H;  1U4L A;  3UDI A;  1SLJ A;  2QW7 A;  1VQ7 A;  2KHI A;  1X32 A;  4DU9 A;  1ESR A;  2B29 A;  1XMO L;  3SK6 A;  1JJC B;  4OGQ C;  2TSS A;  2AUK A;  2N49 A;  2KA7 A;  4A93 H;  4ID6 A;  2KVM A;  3M9B A;  5IIF A;  1J9O A;  2RBM A;  2UUB Q;  2CQO A;  5IP9 G;  5FK9 C;  3A8J E;  1YNN D;  1HQR D;  1EWH A;  3CQZ B;  3DWA A;  4AIM A;  1CHP D;  3DLL A;  2JSO A;  3KK7 A;  2UXB L;  2DY7 A;  1GUS A;  3CKI B;  2VQE L;  1JOR A;  3OIP A;  2OTL A;  4X66 L;  4LF6 L;  1VDZ A;  2R61 A;  3GTK B;  1XTC D;  3KLW A;  2Z8L A;  3BVM A;  1EIG A;  2Z9H A;  2D0P A;  2A19 A;  4JBK A;  2D2C C;  1AE2 A;  5C0X H;  4JI6 Q;  5J1Z A;  2LXJ A;  4DR2 L;  1PLF A;  4DK3 C;  1RIP A;  5BN3 A;  3AB9 A;  2DNE A;  1MJE A;  3O13 A;  3GTQ B;  1VQ8 A;  3E3X A;  1ICF B;  3ND8 A;  3FHW A;  3STB D;  5J39 A;  2N88 A;  3PQI A;  3ZYY X;  3T13 A;  5FLX L;  1Y1V G;  2SEB D;  3J80 L;  3QOJ A;  3P1H A;  2KCN A;  5ELN A;  4O1N A;  1I4H A;  5C4X G;  2F0D A;  4XT3 B;  1RHP A;  3MXN A;  2KQ3 A;  1E2Z A;  1WVL A;  1S5B D;  3PO2 B;  2JA5 G;  4DR5 L;  1QUQ A;  3I70 A;  4X66 Q;  1N32 Q;  3PMF A;  1X54 A;  1X56 A;  4JI8 Q;  1SBB B;  1RJT A;  4X3T A;  2C5C A;  3HOW H;  4A3M B;  2KCM A;  5AJ3 Q;  1CHQ D;  5IGG A;  4GLX A;  4YY3 Q;  5LMU L;  1FVI A;  1ENC A;  3E0E A;  4A3D G;  3BG3 A;  2NVT H;  1Y8P B;  5IGF A;  5COR A;  1RCV D;  4IUQ A;  4K6L A;  5DAU A;  5IYB H;  4ALP A;  4YWL A;  4K6D A;  1SFO B;  4F7X A;  1F9P A;  1GUT A;  1BCP C;  1V8Q A;  2E2H H;  1PZK D;  1K9M C;  3M4Q A;  3F2D A;  5FLX E;  1KL9 A;  3F1Z A;  1PH2 A;  2OXP A;  4OX9 Q;  4QCL A;  5EKI A;  2FIN B;  3FPP A;  1S72 A;  4LF5 Q;  1ML0 D;  1NAP A;  3S1Q H;  4B3T L;  3NP8 A;  2NYZ D;  1FD7 D;  2L11 A;  2PPB C;  3SVM A;  1XPO A;  1E2V A;  4K2K A;  4DV5 Q;  1B70 B;  1SNO A;  1NMF A;  3MVV A;  2DY8 A;  4KN7 C;  1S4Z A;  1TS4 A;  5D3I B;  3G48 A;  4JBJ A;  2X69 A;  2R93 B;  4A3L H;  3HOW G;  4POF A;  3HOZ H;  1S40 A;  1SNQ A;  1GO3 E;  3G6E A;  1QG7 A;  1VQK A;  2D0O A;  1NE3 A;  5C6A A;  4DUY L;  5EPJ A;  2C9O A;  4DV6 L;  5M3M H;  4PZ6 A;  2F0M A;  4JI1 Q;  1LTI D;  3FEW X;  4B9X A;  1KTK A;  3L7Z C;  3R93 A;  2MPM A;  4CDF C;  4DV3 Q;  1XPR A;  4DV7 L;  3TQY A;  4J6H A;  1BCP F;  2FHT A;  3A55 A;  4A75 A;  4OO1 G;  4RFB A;  2BA0 A;  4FNF A;  1SXT A;  3A7A B;  3TBI B;  4DAP A;  1SE8 A;  5NUC A;  4DV2 Q;  1BDO A;  1UE7 A;  1U9R A;  3BYT B;  5CV5 A;  1WTR A;  2HD3 A;  4HR7 B;  4DAY A;  4GNX B;  4H0L C;  3ND9 A;  2WV6 D;  5JJK A;  3HOV G;  1LTB D;  3D4R A;  5M9O A;  2K32 A;  3K81 C;  3MEH A;  2AWO A;  2HIX A;  4RCO A;  4CBV A;  2HQL A;  3T1Y L;  4FO2 A;  4JOI A;  4EVO A;  3RN2 A;  2RCF A;  1XNQ L;  2TMP A;  1XXG A;  4MZ9 A;  5JJI A;  5M5X H;  4K5X A;  2LFN A;  2NTT A;  1PFN A;  1PYS B;  4IQZ A;  1VF5 C;  1ZYR C;  3TRZ A;  4RG1 A;  1Z7T A;  1V1Q A;  1H9S A;  4A3J B;  4H7B A;  2JQO A;  2EOT A;  4JI4 L;  2EY5 A;  2HHH L;  4DV4 Q;  2HDM A;  1H9J A;  1HFN A;  3H0G H;  1TWF B;  2CH4 W;  5FKA C;  2H5X A;  3ULJ A;  1HR0 L;  4A3G B;  5EPL A;  1VQE A;  4DV7 Q;  1OO9 B;  4X3K A;  1N36 L;  1U0L A;  3OMG A;  2P5Z X;  1IBK Q;  3SR1 A;  3VYU A;  1PFS A;  3VR4 A;  3VR3 A;  3T1H L;  4JYA Q;  4MHE A;  2OWO A;  3TZD A;  3LNN A;  1EU3 A;  4K5V A;  4C3H B;  2E5L L;  4BBR B;  1HNW Q;  4LUV A;  1SMY D;  4LUO A;  1LTT D;  3E6Z X;  1SN8 A;  1Q1B A;  1VQN A;  3TP5 A;  3V2T A;  5FOB B;  1K0R A;  2Y0S E;  3NEM A;  1STN A;  1JCK B;  3Q0A A;  2PQA A;  3S1M B;  1K83 H;  3EA6 A;  1V1O A;  1Q86 C;  1KAB A;  2A8V A;  1EWC A;  2JEB I;  4DR1 Q;  1O80 A;  2ZM6 L;  1JWS D;  2EYF A;  3CP0 A;  2JJQ A;  2EXD A;  5EKK A;  1Q81 C;  4H44 C;  1HXY D;  3OPO A;  1D7Q A;  4DUZ L;  3HP3 A;  4X62 L;  4DV0 L;  3T53 B;  2ALY B;  2N3S A;  3HKS A;  3J81 E;  2UUA L;  1BQQ T;  5C0X I;  4XYO A;  1PH3 A;  1MKH A;  3EJI A;  1QB5 D;  3VYS A;  2XRS D;  1PRT C;  4A3D H;  3HOW B;  2I5L X;  4QGU A;  2UUC Q;  1LTS D;  3GD7 A;  4BY1 H;  4JI7 Q;  1HNW L;  3HRZ C;  3TS0 A;  3A7L A;  1NR2 A;  3BZD B;  2GA4 B;  4L5T A;  4CHT B;  2L15 A;  1C7Y A;  1O7I A;  3PO3 B;  4IUR A;  4DKA C;  3EFX D;  1ET9 A;  1YHA A;  3RZO B;  1IYU A;  2ZM6 Q;  1VS0 A;  2VY3 A;  5IYC H;  4RCN A;  1ESF A;  4YCU A;  2E2I H;  3F2U A;  1SMX A;  2I46 A;  1K3R A;  2VUM H;  1PZJ D;  2F0N A;  2R7D A;  3FDT A;  3FPU B;  3U58 A;  5BN5 A;  1WCM G;  1ENF A;  4CJ1 B;  1A6X A;  1C9O A;  1HPC A;  4LF9 L;  4JC0 A;  1D8L A;  5E3F A;  3E9H A;  1LAB A;  2QDL A;  5C4X B;  3S1N H;  4NXM L;  4L6T B;  4A3K H;  4R4O A;  2F0F A;  1Q8I A;  4JPB W;  5KNC A;  2A1A A;  5K5P A;  1EYC A;  1TKW B;  3GV3 A;  2VUM G;  2JA8 G;  2VUM B;  1X3E A;  2WP8 J;  4R8N A;  4JI2 L;  2DJG C;  4C2M H;  3S2D H;  1N33 L;  4U68 A;  2L55 A;  2EY2 A;  1TWA H;  3STB C;  5A2Q L;  3NQT A;  4RAU C;  1PFM A;  1YI2 A;  2ZTD A;  3GV6 A;  1AH9 A;  5KIX A;  5ELO A;  5ELF A;  5M5W B;  3FKI G;  4NDX A;  2RQX A;  5EAY A;  3S15 H;  2SDF A;  4UP8 A;  2B2Y C;  3R2I A;  2BA1 A;  2F4V L;  3I4L A;  4HJ7 A;  1LUZ A;  4ABN A;  4HIK A;  1I4P A;  5ELD A;  5LL6 S;  1IBL Q;  2DJF C;  4LFA Q;  1G29 1;  4DNT B;  3JAM c;  1Q7Y C;  1JOK A;  1GHJ A;  2KEE A;  2NTS A;  3S1R B;  1FGU A;  3K7A H;  2IHE A;  1VQH A;  1Z47 A;  3CME A;  5M5W H;  1MHW C;  4HID A;  3DUZ A;  3E9I A;  1N8R C;  4DR3 Q;  1C48 A;  2WKD A;  1ICW A;  2Q2T A;  5GQO A;  4LF4 Q;  3OW7 A;  3PIP 3;  3M4O H;  4GNX A;  1M8A A;  3PUZ A;  4MNO A;  1BCP D;  1N33 Q;  1B50 A;  3X3M A;  4DNI A;  1MSG A;  1XJV A;  1GJX A;  2R93 G;  4B3S L;  2BH8 A;  3Q6S A;  4FVM A;  4LF7 Q;  4O2D A;  5IYC G;  2LMC B;  2EYJ A;  2MP1 A;  3NTH A;  3PV0 A;  1E7Z A;  2JA7 H;  2EJM A;  4YHH L;  3CCM A;  3SK5 A;  1F9S A;  5M3F B;  3H6M A;  4A3C G;  4N8X 1;  2B8G A;  1EY5 A;  2A69 C;  4C3H H;  5JAV A;  1CA6 A;  4XTC S;  2KHJ A;  3J81 c;  1FJG Q;  1HRJ A;  2MJ8 A;  1EY7 A;  1NSN S;  5LHY 1;  1KIX A;  5IE8 A;  4LW1 A;  3KF6 A;  3S9W A;  1VCI A;  4GKJ Q;  3IL8 A;  3A54 A;  2ZXO A;  5IWA L;  3FP9 A;  1IBM L;  1VMC A;  2JA8 B;  4KN4 C;  5GAE C;  2NVY B;  2F3V A;  5CV9 A;  2EDG A;  4ZYS A;  2VB3 X;  1YJW A;  4AH6 A;  4BXX G;  1VQD A;  1CK1 A;  1L1O A;  3W3A A;  4KY6 A;  1F9R A;  1E22 A;  1VQO A;  3CMA A;  1SYE A;  5C44 H;  2XTI A;  3D6C A;  3QB3 A;  3SHL A;  3I2Z A;  5T1I A;  4IUT A;  1PFB A;  1LT4 D;  3IKJ A;  4LMQ D;  1CSP A;  2NB0 A;  4KI0 A;  2AKW B;  4Z9C B;  1Y1W B;  4JI3 Q;  1R4Q B;  5I4D A;  2B8F A;  2RCN A;  1EY0 A;  1SJH D;  1SYB A;  2GVB A;  1PTO B;  1WOC A;  4EQP A;  4FF3 A;  1BXT A;  4I65 A;  5CBE E;  1T9H A;  4LNQ A;  3HOV B;  1CA5 A;  4GLV B;  4JI6 L;  4QMG A;  3KUP A;  1HQM C;  3D31 A;  4A76 A;  5IGD A;  2KBN A;  4V19 0;  2B63 B;  1SYD A;  1NJI C;  2B63 G;  4LFB Q;  1TS3 A;  1YNX A;  5DM6 3;  1DZ1 A;  3E5S A;  4M1U B;  4MIU A;  5DEH A;  2FJ2 A;  5CV8 A;  1TWG H;  4Y7N H;  4FXD A;  1IKL A;  1JC7 A;  1J5E L;  4JG2 A;  1BO0 A;  1ZYR D;  5CMD A;  1KLU D;  3W2D A;  1HNZ Q;  2RSN A;  3ERS X;  4BA2 I;  4HSV A;  2WB1 B;  2D62 A;  2MO1 A;  4HMI A;  2MGS A;  1CKN A;  3OOC A;  5IP7 H;  2B2T A;  2XVS A;  3M7G A;  4ZCK A;  4YIJ A;  1JOO A;  3T51 B;  1CSQ A;  1I4R A;  3I90 A;  2K7V A;  3WDN A;  4OO1 H;  3BVG A;  4B3M L;  4JI3 L;  1M4V A;  2KOL A;  4A3B H;  4BA1 I;  2NZH A;  1OXS C;  4C1N I;  1F9Q A;  1NMG A;  4G57 A;  2ASB A;  4IFD J;  4DAY B;  3MHB A;  1I50 B;  4DV1 L;  5AJ3 L;  3K5N A;  2K14 A;  3DHQ A;  2YTY A;  2B2V A;  2GVA A;  3J81 i;  1WJJ A;  1CKN B;  2WAQ B;  1TQO A;  3CU7 A;  4B9W A;  3EQL C;  1KDC A;  1SYG A;  2E76 C;  3Q22 A;  4HJ9 A;  4S3S A;  5M5X B;  3CCS A;  4DXG A;  1TS5 A;  4F87 A;  1PHJ A;  5EPK A;  1EY9 A;  2Y0S G;  1R9T B;  4XIG S;  2JA5 H;  1I4Q A;  4F88 A;  3FMC A;  1VQA A;  2B2U C;  5JEA H;  1TWC B;  1B8A A;  5M3F G;  2LS0 1;  1IYV A;  3KOJ A;  5ELE A;  1RD9 D;  2YYZ A;  3SXH A;  3EN2 A;  2A6H D;  2HCC A;  5IP7 G;  1TII D;  2WB1 G;  2NN6 I;  1KRT A;  2RDG A;  2L0C A;  3PIO A;  1EWI A;  3D8G A;  3PUV A;  3I7F A;  4DAV A;  1R9T H;  1C8C A;  4A3G G;  5FJ8 G;  3G4S A;  4LFC L;  4GN4 B;  4KMU C;  3J81 j;  1ASZ A;  3GTP H;  3HEJ A;  4UDU C;  3NBH A;  4DN4 M;  1WTP A;  2R3Z A;  1VQM A;  4R4C A;  1UE1 A;  1K8G A;  4WJ4 A;  5FLX c;  1EEI D;  4ZKC B;  1Y8O B;  3ERO A;  3MXG A;  2K5Q A;  1VQB A;  3DWP A;  4IUU A;  2Q2H A;  5JVH 3;  1X6O A;  3K0Y A;  1DM0 B;  2K28 A;  4L5R C;  3S2H B;  2N78 A;  3VA5 A;  3M7N A;  3AFP A;  1EQQ A;  1HR0 W;  4TRD A;  3EVQ A;  4IPG A;  3MA2 B;  2PZW A;  4A3B B;  1RKN A;  1WTH A;  4K0K Q;  3I73 A;  4HCS A;  1CI3 M;  3TS2 A;  3M4P A;  1QOH A;  4KHV A;  4C3I B;  3NBH B;  1G51 A;  1A3U A;  1DOL A;  1YIJ A;  5M3F H;  4CDE C;  1DD2 A;  3K8A A;  4KHP Q;  4A3L G;  4F8M A;  4ZUJ A;  2E74 C;  1TWH B;  2RVL A;  3IFD A;  3CQZ H;  3T1Y Q;  3HOX B;  1VQJ A;  2F0E A;  1PVO A;  1DGS A;  3S16 B;  1F77 A;  1L1O B;  2F0W A;  4FXK C;  3D0F A;  3E0J A;  3MZ5 A;  3PCO B;  4NW2 A;  4CGY B;  4IOC A;  1T5X D;  4OWW B;  1B53 A;  2JEA I;  3MTS A;  3SEB A;  2O5I C;  2UXC L;  1TR5 A;  3RD4 A;  5C4Z A;  3GTO H;  4R4T A;  2IWH A;  2QCP X;  1MGS A;  5HY6 A;  4TVA B;  4DV4 L;  4A3I H;  4X65 Q;  3BDL A;  3OMC A;  3J80 i;  2AMC B;  5FO8 B;  1G6Z A;  3S14 H;  1SNP A;  3M3Y B;  3CCE A;  1N36 Q;  1BOS A;  1RL2 A;  2R93 H;  3QG1 A;  1B44 D;  2XWB B;  3D4W A;  3I4N H;  4APV A;  3CAM A;  3N6R A;  1EFI D;  3OTO Q;  4JK1 C;  1Q82 C;  4R1J A;  2ICE C;  4B3T Q;  2ES2 A;  1VQ5 A;  1QJO A;  1JE4 A;  2NVX H;  5CBA E;  5G3L F;  1YNJ C;  2JXM B;  3GO5 A;  3GTO B;  4ZKB B;  1G6P A;  2LSS A;  2R7Z G;  4O42 A;  1D5Z C;  2HCI A;  1X55 A;  1EIY B;  2K4K A;  2QA4 A;  2AUJ D;  1A8V A;  2L1B A;  2OT2 A;  4EQN A;  1OXU A;  3LGJ A;  5EBC A;  3H09 A;  1Y8N B;  3JAM i;  4A3K B;  2SNS A;  2F0I A;  4JI0 Q;  2EIF A;  4DF7 A;  1Z6H A;  3I4N B;  4IFD I;  2KJX A;  1QZG A;  3BDO A;  5CV4 A;  2UXC Q;  1CZW A;  2NN6 G;  4A3E G;  3HOZ B;  4K8I A;  1Q1E A;  4RH6 A;  5I2Y A;  4O0A A;  2VS1 A;  3AYH B;  5ELB A;  1K83 B;  4Q0F A;  3K5M A;  2CQA A;  3FKI H;  5C3E H;  1NUC A;  1Q8K A;  1SNC A;  3NE5 B;  5LL6 X;  2VNU D;  1FGB D;  2O5J C;  2KED A;  3MWY W;  4BY7 B;  4BBS B;  2XRQ D;  4BBS G;  2IPK D;  1KRS A;  2N55 A;  3VR2 A;  2IX3 A;  2AHO B;  3TEH B;  1S5D D;  4GKK L;  2ID0 A;  3L3O C;  1EY4 A;  4C1N K;  2A73 B;  5COY A;  2HDL A;  4JCV E;  4A93 G;  2QKI C;  1ENA A;  1GXD C;  4DK1 A;  3P75 A;  2R92 B;  4QY7 A;  1PDQ A;  2ICI A;  4HIM A;  1XNR L;  1EQV A;  3S14 B;  5KNB A;  1AFP A;  2PMZ E;  2Z1C A;  1BKB A;  4ILW A;  3CD6 A;  3A56 A;  4JI5 L;  1H9S B;  4BY7 G;  1GOZ A;  5I6W A;  2EYL A;  4R8I A;  4QUF A;  1QZH A;  4QL5 A;  1CTM A;  1W2B A;  3I91 A;  4JBW A;  1SE4 A;  1JB3 A;  2EVB A;  4OHJ A;  5AFW A;  1FYC A;  1HR0 Q;  5T1G A;  1STA A;  3GDE A;  4N8F A;  5JPM C;  4WJW A;  3RLO A;  4PMB A;  2WIN B;  2YTV A;  5J22 A;  2E2J H;  5EGT A;  3RLN A;  1N34 Q;  1DJR D;  1Q46 A;  3ZJY C;  4C3I G;  1SFO H;  2JA9 A;  3S24 A;  1PRT F;  1SAP A;  3K0X A;  4RKB A;  1YEZ A;  5C3X A;  1QIL A;  1X3F A;  2Z4I A;  4ZQ3 A;  3AFQ A;  4RHR A;  1PH8 A;  4BBR H;  1U4M A;  2HT1 A;  2JN4 A;  1KD1 C;  4AYB E;  2JA8 H;  4R4Q A;  3PUX A;  2PNH A;  4L63 B;  4RHS A;  4J15 A;  4LK1 C;  5JEA J;  2CH4 A;  4FYD A;  1I4G A;  4GN3 B;  4KKU A;  5LMN W;  4DR1 L;  1EYA A;  1PTO C;  1UNS A;  1LLR D;  4FXG C;  5IYD G;  3S1M H;  2B2V C;  4BBS H;  2RF4 A;  1A0I A;  5C4J H;  4WFN 3;  3AU7 A;  2EYP A;  2F0P A;  1JT8 A;  2EYM A;  1SYC A;  2LKV A;  4RGT A;  5G3L D;  2PZT A;  4RMF A;  4A3K G;  4A3J H;  5BR8 L;  2HQE A;  4YWM A;  3J81 L;  2JA6 H;  1CFM A;  3A5U A;  1QVG A;  3RZD H;  5CR3 A;  1K3B C;  2NN6 H;  3K7U C;  5LMN Q;  2WAQ G;  1SRU A;  1GUW A;  5JVG 3;  3W5O A;  3B6Y A;  2XN9 C;  2QF7 A;  4ULL A;  2RDH A;  2F4I A;  5I2X A;  3HOY H;  3KDF A;  4B3R L;  1XYI A;  2A6E C;  5IGC A;  4AYB B;  1XX8 A;  3C46 A;  1UAP A;  4IAL A;  1GKH A;  2K03 A;  3ERQ A;  3ULL A;  3R3O A;  1B3A A;  1EQR A;  5GAG C;  1SRO A;  4BY1 G;  3W1B A;  2K33 A;  2NVQ B;  3PO3 H;  2WAC A;  3LX0 A;  2I5H A;  2WII B;  1VQI A;  3KBX A;  3HKZ B;  4A4I A;  4JI8 L;  3GTM H;  4YHH Q;  3HOX H;  4JV5 L;  1WTQ A;  5IY0 A;  4QUC A;  1AW7 A;  4A3E H;  4BS9 A;  1V1P A;  3C1F A;  1O7Y A;  4JOI C;  1U5K A;  2PMZ B;  5E1F A;  5BR8 Q;  5LMU Q;  2HIV A;  4EX5 A;  2VZA A;  3LWU A;  1D6E C;  1V9P A;  1RTO A;  2WKC A;  4KV6 A;  4YCV A;  2JA7 B;  4GKJ L;  5E4X A;  4GN5 A;  4NXM Q;  1YBY A;  1YJ9 A;  4HMJ A;  4RWS C;  3KJO A;  3MFY A;  4NMZ A;  3NUC A;  4GLA C;  2F0L A;  3CXC A;  4FF2 A;  1BVS A;  4OX9 L;  1BNZ A;  2EYH A;  1SND A;  4UPA A;  5E7N A;  4P73 A;  5C4J B;  3SE0 A;  3QOL A;  2X6G A;  4PZ8 A;  4POG A;  2F0Q A;  3NTK A;  3S17 H;  2CWP A;  3MEF A;  1HZC A;  3BJU A;  3G6J B;  3UE0 A;  5HGQ A;  2ENB A;  2F0V A;  4DFA A;  1HUM A;  3PF4 A;  2K5V A;  2K75 A;  4HIO A;  2UU9 Q;  1SE2 A;  1XTD A;  4WOR A;  2OQ0 A;  3RZD B;  2NUC A;  3H3V I;  2A68 C;  4JV5 Q;  2JK8 A;  1RF2 D;  5CV7 A;  3J80 E;  5A35 A;  3CCR A;  5ELC A;  5C5M A;  2G9H D;  3CC4 A;  1QUQ B;  1KDA A;  4K8J A;  3CCQ A;  1GM5 A;  1ET6 A;  3HG9 A;  4IFD H;  3PF5 A;  4NXN Q;  5IYB G;  1JMC A;  1PH4 A;  3KFU A;  4DUY Q;  4JBM A;  3GTP B;  1JWU D;  4JI1 L;  2Z6K A;  2RKS A;  1VQG A;  4OXP A;  1HFG A;  4GNX C;  4A3F B;  4DV3 L;  1F2Z A;  2L5T A;  1PH7 A;  1TT2 A;  3H0G G;  5C5L A;  3H0G B;  3D4D A;  2UXD Q;  3CCL A;  1H9K A;  3ONA B;  2LY7 A;  3DMU A;  1RDP D;  4GOP C;  4A3I G;  1X65 A;  2BOS A;  3I55 A;  4PMC A;  2PQE A;  1STB A;  1FNW A;  2A74 C;  4DV2 L;  2J7Z A;  4U67 3;  4A3D B;  2UXB Q;  3RUZ A;  3KF8 A;  3M4O B;  1O7Z A;  3S1Q B;  5I9P A;  4IZ8 A;  4TQU S;  1EY8 A;  4TSS A;  1YVC A;  5M5Y H;  4DA2 A;  2B39 A;  1J8I A;  3NWS A;  1DXM A;  1VQF A;  2M00 A;  1WTW A;  4RGM A;  2UU9 L;  1S3O A;  5C0X J;  1AE3 A;  4X3U A;  4OL7 A;  3L9A X;  1HZ9 A;  2EY1 A;  4ZLT F;  1XNQ Q;  5K36 G;  1B9N A;  3T16 A;  4M8A A;  1YNJ D;  1UE5 A;  4DV1 Q;  1ZKO A;  4IO9 A;  1PH5 A;  4HSP A;  3NEL A;  1KNA A;  2PI2 E;  2R7Z B;  1W6K A;  1GUN A;  1HTL D;  3GQB A;  4UHV A;  4XDX A;  1L0W A;  1X3Q A;  3SDZ A;  5JOB A;  1IW7 C;  4X64 Q;  4JI4 Q;  1MD2 D;  4IFD G;  1I6V C;  2A69 D;  5IOD A;  3DM1 A;  1S5E D;  5CYU A;  5KND A;  2CW0 D;  4IPH A;  3U4Z A;  3DXJ C;  2F03 A;  4EGV A;  2UXD L;  4HCE A;  2DN8 A;  1JR0 D;  5K36 H;  1DOK A;  1GHK A;  1JJ2 A;  2ZXR A;  2Z4H A;  2B2W A;  1ASY A;  2RDF A;  3HZX A;  3WWV A;  2NZO A;  1EOT A;  2E5L Q;  1GUO A;  4K14 A;  3H15 A;  2F3W A;  1KHI A;  5D3D A;  1PH9 A;  1HH2 P;  4UP7 A;  1H9M A;  1DOM A;  2WAQ E;  1Q3L A;  3NSW A;  2NVX B;  4A3M H;  1HJP A;  1WD1 A;  1EIF A;  1YZ6 A;  5KYL A;  3RZO H;  2YU9 H;  1STY A;  1O78 A;  3ER0 A;  2RHQ B;  3HOZ G;  2NVT B;  5C0X G;  1CKO A;  3UE1 A;  3PUW A;  1VF7 A;  4NPS A;  2F0K A;  1VQL A;  1LTG D;  1KAA A;  4X64 L;  1SSO A;  1KQS A;  4KY7 A;  2KEN A;  2CHB D;  2QGQ A;  2E2I B;  4CKB A;  3IFT A;  4FF4 A;  4X62 Q;  1F2Y A;  1MBY A;  4N9T A;  4DV0 Q;  2MQH A;  4GS3 A;  2FMM A;  3T4A C;  5EJW A;  1I94 L;  3LWE A;  2FMC A;  2K52 A;  4LF5 L;  2YTX A;  1JWM D;  3S1R H;  1I5F A;  1STE A;  2D9U A;  2RHS B;  3S2H H;  4E6I A;  4MTN A;  2B2W C;  4B3M Q;  2K5W A;  4JI7 L;  5C44 B;  2C35 B;  1NTG A;  4CJ2 C;  2BCO A;  5JJZ A;  2CWA A;  3S2D B;  1PV4 A;  5FO9 B;  2MNA A;  1EEF D;  3KLS A;  2DUD A;  2PW5 A;  3HOU G;  1MJC A;  3CF5 A;  3J80 c;  2SNM A;  4FF1 A;  2KHS A;  4I7A A;  4X65 L;  3HOV H;  4HJ5 A;  1I3Q H;  1L0X B;  2DNC A;  4KLK A;  1C0A A;  4J1M A;  3DEP A;  5HUR A;  5KEE A;  2CVR A;  1NR4 A;  3NQI A;  1I94 Q;  4PG3 A;  2M2L A;  5IGB A;  2ZTE A;  2Q8I B;  1F2M A;  4OWX B;  2NBF A;  3K5O A;  4QB4 A;  1GD7 A;  4C3J G;  2JA6 B;  2NZ1 D;  2I5M X;  2ZJR A;  4OEM B;  1KAW A;  1QE6 A;  5M3M G;  1BF4 A;  2MO0 A;  4IPD A;  4GZY C;  4IJH A;  4DR4 L;  3C1E A;  2BDN A;  2A6H C;  4DR7 Q;  4DR6 L;  1IL2 A;  1MIU A;  3BS1 A;  2EJG C;  2FFK B;  1J6Q A;  3OIQ A;  3J7Y W;  3GTK H;  3TME A;  1HHV A;  3Q23 A;  1TXY A;  4I7Z C;  1YJN A;  3GTJ H;  2B2Y A;  5ISR A;  2A6E D;  1HZB A;  3K58 A;  4FP5 D;  1JOQ A;  3H91 A;  2K5N A;  2K04 A;  2PI2 A;  4P75 A;  2F0G A;  2VQF Q;  4UAI A;  3OYY A;  1IBL L;  4ME5 A;  4LFA L;  1LYL A;  1IBK L;  5J3B A;  1OXV A;  2KCC A;  1Q90 A;  3HKZ G;  5IT9 c;  4R4I A;  4QIW E;  1U4P A;  1EZ6 A;  3BZC A;  3KBG A;  1JE5 A;  3M85 A;  3T56 B;  4HED A;  4MN3 A;  4CDC C;  4L5Q A;  4OEL B;  2G5D A;  5IP9 H;  5C4H A;  2JA5 B;  1XPU A;  1PYB A;  3PUY A;  3TN2 A;  1UEA B;  5HGT A;  3VYR A;  5JJL A;  3PO2 H;  3P7J A;  4GKK Q;  2F52 A;  4QF4 A;  4LF4 L;  2XSC A;  1EOV A;  2EJF C;  3G71 A;  1KC8 C;  1WCM B;  2OTJ A;  5EQ0 A;  2OF1 A;  1JJG A;  3S16 H;  2CFM A;  2PYK A;  3K80 C;  4FDB A;  1W3S A;  1NY4 A;  3RLF A;  2VQE Q;  2JP1 A;  3KDF B;  4LF7 L;  1TY0 A;  1EL0 A;  2XNA C;  3A5Z B;  1EIH A;  3TP7 A;  2AQ2 B;  4CKE A;  5L37 A;  1PH6 A;  3TP6 A;  4KKS A;  1P8L A;  3ITP A;  2R7F A;  2ZJQ A;  5C3W A;  2UUA Q;  5C4X H;  1FJG L;  4WJ3 M;  2A68 D;  4XXE A;  3UDX A;  3HOY G;  1Y1V H;  3H3V C;  1SR3 A;  1TWG B;  3VDY A;  1OTC A;  1R4P B;  2H1E A;  2PZU A;  2XGT A;  3H94 A;  2XWJ B;  3OSO A;  4ME3 A;  4NKL A;  1BBW A;  3U9S A;  4C2M B;  1LTA D;  4K2L A;  3PO2 G;  2QIL A;  5H1S E;  4CJ0 B;  2B2U A;  1TWA B;  1N9W A;  1UUP A;  2FXQ A;  2KEC A;  1WI5 A;  1PMR A;  3MXN B;  2IL8 A;  1Y14 B;  4KKT A;  1V43 A;  3S15 B;  5IOC A;  3K5L A;  2BH2 A;  5D14 A;  3J7Z C;  2JA7 G;  4DR5 Q;  5DM7 3;  1N32 L;  1QNU A;  1ZXT A;  3TZU A;  3GTQ H;  4GOP B;  4Q5V A;  2KUM A;  1SDF A;  5FO7 B;  1TWF H;  2PNR C;  5M3M B;  4AQY L;  1YHB A;  4HTH A;  1EY6 A;  2YU9 B;  2DGY A;  3V05 A;  3JAM L;  3PSI A;  2WFW A;  4LF9 Q;  4G7H C;  3KLS X;  2R7Z H;  3MXP A;  3GTG B;  4IOA A;  3AEV A;  1I6H H;  1CZG A;  5LMN L;  3GTM B;  1CUK A;  2K01 A;  4AYB G;  1Y69 U;  4DGZ A;  2ZT9 C;  1PTO F;  2G9D A;  4RGN A;  3PIO 3;  2NWG A;  1K8O A;  2H4O A;  2B2T C;  1ZEQ X;  2Q2I A;  1W6J A;  2F0O A;  4R9W A;  4X3S A;  4GOP A;  2J0T D;  3JAM E;  4KHZ A;  4EQO A;  3CCJ A;  5TSS A;  4B3R Q;  1CQV A;  1QWY A;  2LXK A;  3X3N A;  2IT1 A;  3KF8 B;  3RR5 A;  1I3Q B;  1LM0 A;  4P74 A;  1D5M C;  2CW0 C;  5DLQ E;  1HNX L;  4QQB X;  3I8Z A;  1WD0 A;  3J7A V;  2VW9 A;  3MXU A;  4JI5 Q;  4G7O C;  1Z9F A;  2AQ3 B;  3NWT A;  1Y1W H;  4KTA A;  2F3I A;  1D1I A;  2E2H B;  2RA4 A;  2IY5 B;  3S17 B;  2Y0S B;  3I4M G;  1PYW D;  2BE5 D;  3QJY A;  4L8J A;  4IUP A;  4DR2 Q;  1JIC A;  2B3G A;  5IT9 L;  2X6L A;  3HOU H;  4NB3 A;  2F0U A;  3WOF A;  1CKM A;  1TU2 B;  4LF8 L;  2AQ1 B;  3BYY B;  2F0J A;  3VYT A;  3S1N B;  3K57 A;  4ZRZ A;  4DR3 L;  2ZJP A;  3PGZ A;  1X9N A;  3DEO A;  4QIW B;  2VB2 X;  1AZQ A;  2A5H A;  3FVQ A;  1PA6 A;  4PV1 C;  1K8M A;  4UP9 A;  1FR3 A;  4X6A H;  1HNX Q;  2M9V A;  3U9O A;  1IL8 A;  3R2T A;  2JYO A;  1D2B A;  4A3F H;  4DNR B;  5GRO A;  4DK0 A;  2L12 A;  1L2F A;  5CC4 A;  3GTG H;  3TSS A;  1I6H B;  1UEB A;  4PMW A;  3F8T A;  5JEA G;  1NNX A;  3OWF A;  1BBU A;  2YV5 A;  1LO5 D;  1JB7 A;  2J4X A;  2ZXP A;  3CPF A;  4C56 C;  1CT1 D;  1PTO D;  1O7L A;  3CRK C;  4YY3 L;  4HJA A;  3MFG A;  3EBE A;  3L2P A;  4BWG B;  4LF8 Q;  2F0H A;  2Z6B A;  5IWA Q;  1X3P A;  4PQX A;  3NHH A;  1PZI D;  5C3E G;  2NVY H;  1WYD A;  3BVZ A;  2L9H A;  4IJL A;  1XMQ L;  1EU4 A;  3TDQ A;  1C4Q A;  4K0K L;  1AP0 A;  5FLM G;  2I0Q A;  3CC2 A;  5IGE A;  4JYA L;  2EXZ A;  1VQ6 A;  2F1M A;  1YIT A;  3DWQ A;  1B2T A;  5C44 G;  4XQJ A;  3VA7 A;  3U4V A;  2EQS A;  4G4K A;  1KNE A;  3AMU A;  4OWT B;  2R92 G;  1EQT A;  1WTO A;  4DV5 L;  3I4M B;  1PTO H;  1Y1V B;  2PW7 A;  1HCZ A;  1HA5 A;  3J7A F;  3TP8 A;  4KJO A;  5E4W C;  2EYO A;  1E1T A;  3OWE B;  4OO1 I;  1U4R A;  2KCT A;  3MC0 B;  4A3E B;  3G7L A;  4LJZ C;  4C3H G;  1QCB D;  1TS2 A;  4LFB L;  3GTJ B;  4DV6 Q;  2IJ0 A;  1MSH A;  3FRP B;  5JPN C;  1G2T A;  1YNN C;  4DUZ Q;  2OEO A;  4LUZ A;  1F2L A;  3A0J A;  3HGB A;  2MUY A;  2D5D A;  3I4M H;  1HNZ L;  2N8N A;  1XMQ Q;  1OXX K;  3C3L A;  3UDF A;  2E2J B;  1BUV T;  1H9R A;  3BZK A;  2IHF A;  5C3E B;  1H95 A;  3OTO L;  2F0S A;  3MAQ A;  3PIP A;  1HZA A;  3M4Y A;  1Q12 A;  3NPP A;  3OHX C;  3GP7 A;  3W1G A;  1EFW A;  3K6O A;  3GTL H;  2O2L D;  2PO4 A;  2UUC L;  3BU2 A;  1II3 A;  2Q2U A;  3A8I E;  2SOB A;  3EIV A;  4DK6 C;  4P71 A;  2I07 B;  1A2T A;  2R92 H;  4OIK A;  1VQC A;  1I50 H;  4A3B G;  1SEB D;  4ZUI A;  3Q24 A;  1IXR A;  2VXW A;  1HUN A;  4JI0 L;  3F2C A;  5KGU A;  4XQN A;  4A3M G;  4A3G H;  4DPG A;  2VL6 A;  1SE3 A;  4XT1 B;  4QJF A;  4IUV A;  3GTL B;  3KJP A;  4C3J B;  5D65 A;  1WTX A;  2B63 H;  2HHH Q;  1X3G A;  4PZ7 A;  4K5W A;  3QIA A;  3HFZ B;  5CGK A;  1B4O A;  4P2C B; 
#chains in the Genus database with same CATH homology
 2K05 A;  4LAA A;  2F0T A;  1E0B A;  1D1K A;  3RMH A;  5KRU A;  3NK9 A;  1S5F D;  2V4D A;  1PXU A;  5KYI A;  1NCV A;  1A15 A;  3P20 A;  2EE1 A;  1HTP A;  1JQY D;  2JE6 I;  3SK4 A;  1DYQ A;  1ILQ A;  4IUN A;  5CV6 A;  4PNY A;  1XWE A;  2Q8T A;  1QNK A;  4OIJ A;  3URY A;  1B9M A;  1IHZ A;  1LV9 A;  1SNM A;  1STG A;  2PCF B;  5I9O A;  2EPB A;  3V96 A;  2AWN A;  1AEX A;  2E75 C;  4RGO S;  3IAY A;  1V1P B;  3A8K E;  1A2U A;  1IW7 D;  1FNV A;  1SYF A;  1AN8 A;  1RTN A;  1HA6 A;  3NTI A;  1BBX C;  1DCZ A;  2RSO A;  3HS0 C;  1E2W A;  3NBI A;  3QWN A;  1OXT A;  2K6A A;  1ILP A;  1IKM A;  1CM9 A;  3D3R A;  4DXF A;  1LAC A;  1SJE D;  5EBD A;  2K5D A;  1T5E A;  3KLR A;  1TVX A;  1FNU A;  1S5C D;  1WTV A;  4WRD A;  4XQQ A;  5BN4 A;  3C2P A;  4TKO B;  2EZV A;  2K1B A;  1A3T A;  1BR9 A;  1G91 A;  1A3V A;  4RA8 A;  5I6Y A;  4V0B A;  2EY6 A;  1LT6 D;  1MI2 A;  1D5X C;  2BE5 C;  3HOU B;  3D6W A;  1I4X A;  1STH A;  3CHB D;  4KD3 A;  3BDC A;  2L4N A;  4IN3 A;  3WOE A;  1AZP A;  3N52 A;  4KK7 A;  1CQF A;  1LT3 D;  4NP5 A;  5DNF A;  1G8Z D;  1BCP B;  3QO2 A;  1KDB A;  1DON A;  2E2D C;  4KD4 A;  5F2D A;  2MHV A;  5M5Y B;  3K59 A;  1LTR D;  5IT9 E;  2QEJ C;  2O4X A;  4A3I B;  1ONL A;  4J8Q A;  3FKI B;  5EKL A;  4BY1 B;  4CKC A;  1SMY C;  4G7Z C;  1EYD A;  1L0Y B;  2BDO A;  4HAE A;  3UI2 A;  1G2S A;  4N9P A;  3R8B A;  4KJN A;  2Q8R E;  1ROD A;  2HUG A;  4HN7 A;  4ODG A;  1EZ8 A;  3I3C A;  3VR5 A;  4RKL A;  2IX1 A;  1LT5 D;  3VR6 A;  1KLG D;  3HOY B;  3I72 A;  5A2Q E;  3NXW A;  2XIW A;  4H13 C;  1TY2 A;  3K7A B;  4ZAI A;  1VMP A;  4Y7N B;  3SK8 A;  1PRT B;  1B1Z A;  2QDB A;  4B08 A;  4A93 B;  2R6G A;  2IW3 A;  4KY5 A;  1PRT D;  2IX0 A;  4ZK9 B;  3CRL C;  1GUG A;  4XYQ A;  1U4L A;  1X32 A;  4DU9 A;  1ESR A;  3SK6 A;  4OGQ C;  2TSS A;  2AUK A;  2KA7 A;  4ID6 A;  2KVM A;  5IIF A;  1J9O A;  2RBM A;  5FK9 C;  3A8J E;  1YNN D;  1HQR D;  1EWH A;  3CQZ B;  3DWA A;  1CHP D;  2JSO A;  3KK7 A;  2DY7 A;  1GUS A;  3CKI B;  1JOR A;  3OIP A;  1VDZ A;  2R61 A;  3GTK B;  1XTC D;  2Z8L A;  3BVM A;  1EIG A;  2D2C C;  5C0X H;  5J1Z A;  1PLF A;  5BN3 A;  3AB9 A;  2DNE A;  3O13 A;  3GTQ B;  3ND8 A;  5J39 A;  2N88 A;  3ZYY X;  3T13 A;  5FLX L;  2SEB D;  3J80 L;  3QOJ A;  3P1H A;  2KCN A;  4O1N A;  1I4H A;  2F0D A;  4XT3 B;  1RHP A;  3MXN A;  2KQ3 A;  1E2Z A;  1WVL A;  1S5B D;  3PO2 B;  3I70 A;  3PMF A;  1SBB B;  1RJT A;  4X3T A;  2C5C A;  4A3M B;  1CHQ D;  5IGG A;  1ENC A;  3BG3 A;  1Y8P B;  5IGF A;  5COR A;  1RCV D;  4IUQ A;  4K6L A;  5DAU A;  4K6D A;  1SFO B;  4F7X A;  1F9P A;  1GUT A;  1BCP C;  1V8Q A;  1PZK D;  5FLX E;  2OXP A;  4QCL A;  5EKI A;  2FIN B;  3FPP A;  1ML0 D;  1NAP A;  3NP8 A;  2NYZ D;  1FD7 D;  2L11 A;  2PPB C;  3SVM A;  1E2V A;  4K2K A;  1SNO A;  3MVV A;  2DY8 A;  4KN7 C;  1S4Z A;  1TS4 A;  5D3I B;  2X69 A;  2R93 B;  1SNQ A;  1QG7 A;  5C6A A;  5EPJ A;  2C9O A;  2F0M A;  1LTI D;  3FEW X;  4B9X A;  1KTK A;  3L7Z C;  3R93 A;  2MPM A;  4J6H A;  1BCP F;  2FHT A;  3A55 A;  4OO1 G;  4RFB A;  2BA0 A;  1SXT A;  4FNF A;  3A7A B;  3TBI B;  4DAP A;  5NUC A;  1BDO A;  1U9R A;  3BYT B;  5CV5 A;  1WTR A;  4HR7 B;  4DAY A;  4H0L C;  3ND9 A;  2WV6 D;  1LTB D;  3D4R A;  5M9O A;  2K32 A;  3MEH A;  2AWO A;  4RCO A;  4CBV A;  4FO2 A;  4EVO A;  2TMP A;  1XXG A;  4K5X A;  2LFN A;  2NTT A;  1PFN A;  4IQZ A;  1VF5 C;  1ZYR C;  1Z7T A;  1H9S A;  4A3J B;  4H7B A;  2EOT A;  2EY5 A;  2HDM A;  1H9J A;  1HFN A;  5FKA C;  1TWF B;  4A3G B;  5EPL A;  1OO9 B;  4X3K A;  3OMG A;  3SR1 A;  3VYU A;  3VR4 A;  3VR3 A;  4MHE A;  3TZD A;  3LNN A;  1EU3 A;  4K5V A;  4C3H B;  4BBR B;  1SMY D;  1LTT D;  3E6Z X;  1Q1B A;  3TP5 A;  3V2T A;  5FOB B;  1STN A;  1JCK B;  3Q0A A;  3S1M B;  3EA6 A;  1V1O A;  1KAB A;  1EWC A;  2JEB I;  1O80 A;  1JWS D;  2EYF A;  5EKK A;  4H44 C;  1HXY D;  3OPO A;  3HP3 A;  3T53 B;  3J81 E;  1BQQ T;  5C0X I;  4XYO A;  3EJI A;  1QB5 D;  3VYS A;  2XRS D;  1PRT C;  3HOW B;  1LTS D;  3GD7 A;  3HRZ C;  3A7L A;  1NR2 A;  3BZD B;  2GA4 B;  4CHT B;  3PO3 B;  4IUR A;  3EFX D;  1ET9 A;  3RZO B;  1IYU A;  4RCN A;  1ESF A;  3F2U A;  2I46 A;  1PZJ D;  2F0N A;  3FDT A;  3FPU B;  5BN5 A;  1ENF A;  4CJ1 B;  1A6X A;  1HPC A;  5E3F A;  1LAB A;  5C4X B;  4L6T B;  2F0F A;  1Q8I A;  5KNC A;  5K5P A;  1EYC A;  1TKW B;  3GV3 A;  2VUM B;  2WP8 J;  4R8N A;  4U68 A;  2L55 A;  2EY2 A;  5A2Q L;  3NQT A;  4RAU C;  1PFM A;  3GV6 A;  5KIX A;  5ELF A;  5M5W B;  4NDX A;  2RQX A;  2SDF A;  2B2Y C;  3R2I A;  2BA1 A;  3I4L A;  4ABN A;  1I4P A;  5ELD A;  5LL6 S;  1G29 1;  4DNT B;  1JOK A;  1GHJ A;  2KEE A;  2NTS A;  3S1R B;  1Z47 A;  3DUZ A;  1C48 A;  2WKD A;  1ICW A;  3OW7 A;  3PIP 3;  1M8A A;  3PUZ A;  1BCP D;  1B50 A;  3X3M A;  1MSG A;  1GJX A;  3Q6S A;  4FVM A;  2LMC B;  2EYJ A;  2MP1 A;  3NTH A;  3PV0 A;  2EJM A;  3SK5 A;  1F9S A;  5M3F B;  3H6M A;  2B8G A;  1EY5 A;  2A69 C;  5JAV A;  1CA6 A;  4XTC S;  1HRJ A;  2MJ8 A;  1EY7 A;  1NSN S;  5LHY 1;  3S9W A;  1VCI A;  3IL8 A;  3A54 A;  2ZXO A;  1VMC A;  2JA8 B;  4KN4 C;  2NVY B;  2F3V A;  5CV9 A;  2EDG A;  4ZYS A;  2VB3 X;  3W3A A;  1CK1 A;  4KY6 A;  1F9R A;  1SYE A;  3D6C A;  3QB3 A;  3SHL A;  5T1I A;  4IUT A;  1PFB A;  1LT4 D;  3IKJ A;  4LMQ D;  2NB0 A;  4KI0 A;  4Z9C B;  1Y1W B;  1R4Q B;  5I4D A;  2B8F A;  1EY0 A;  1SJH D;  1SYB A;  1PTO B;  4EQP A;  4FF3 A;  1BXT A;  4I65 A;  5CBE E;  3HOV B;  1CA5 A;  4QMG A;  3KUP A;  1HQM C;  3D31 A;  5IGD A;  4V19 0;  2B63 B;  1SYD A;  1TS3 A;  5DM6 3;  1DZ1 A;  3E5S A;  4M1U B;  4MIU A;  5DEH A;  2FJ2 A;  5CV8 A;  4FXD A;  1IKL A;  1JC7 A;  1BO0 A;  1ZYR D;  5CMD A;  1KLU D;  3W2D A;  2RSN A;  4BA2 I;  4HSV A;  2WB1 B;  2D62 A;  4HMI A;  2MGS A;  3OOC A;  2B2T A;  2XVS A;  3M7G A;  4YIJ A;  1JOO A;  3T51 B;  1I4R A;  3I90 A;  2K7V A;  3WDN A;  4OO1 H;  3BVG A;  1M4V A;  2KOL A;  4BA1 I;  1OXS C;  4C1N I;  1F9Q A;  4G57 A;  4IFD J;  3MHB A;  1I50 B;  3K5N A;  3DHQ A;  2B2V A;  2WAQ B;  1TQO A;  4B9W A;  3CU7 A;  3EQL C;  1KDC A;  1SYG A;  2E76 C;  3Q22 A;  4S3S A;  5M5X B;  4DXG A;  1TS5 A;  4F87 A;  5EPK A;  1EY9 A;  1R9T B;  4XIG S;  1I4Q A;  4F88 A;  3FMC A;  2B2U C;  5JEA H;  1TWC B;  2LS0 1;  1IYV A;  5ELE A;  1RD9 D;  3SXH A;  2YYZ A;  2A6H D;  2HCC A;  1TII D;  2NN6 I;  2RDG A;  2L0C A;  3D8G A;  3PUV A;  4DAV A;  1C8C A;  4KMU C;  3HEJ A;  4UDU C;  3NBH A;  4DN4 M;  1WTP A;  2R3Z A;  1EEI D;  4ZKC B;  1Y8O B;  3ERO A;  3MXG A;  2K5Q A;  3DWP A;  4IUU A;  5JVH 3;  3K0Y A;  1DM0 B;  2K28 A;  3S2H B;  3M7N A;  3VA5 A;  4TRD A;  3EVQ A;  3MA2 B;  2PZW A;  4A3B B;  1RKN A;  3I73 A;  4HCS A;  1CI3 M;  1QOH A;  4KHV A;  4C3I B;  1A3U A;  1DOL A;  1DD2 A;  4F8M A;  4ZUJ A;  2E74 C;  1TWH B;  2RVL A;  3IFD A;  3HOX B;  2F0E A;  3S16 B;  1F77 A;  2F0W A;  4FXK C;  3E0J A;  3MZ5 A;  4NW2 A;  4CGY B;  1T5X D;  1B53 A;  2JEA I;  3MTS A;  3SEB A;  2O5I C;  1TR5 A;  3RD4 A;  5C4Z A;  2IWH A;  2QCP X;  1MGS A;  3BDL A;  3OMC A;  5FO8 B;  1G6Z A;  1SNP A;  3M3Y B;  1BOS A;  3QG1 A;  1B44 D;  2XWB B;  3D4W A;  3N6R A;  1EFI D;  4JK1 C;  2ICE C;  1QJO A;  1JE4 A;  5CBA E;  5G3L F;  1YNJ C;  2JXM B;  3GO5 A;  3GTO B;  4ZKB B;  4O42 A;  1D5Z C;  2HCI A;  2AUJ D;  2L1B A;  2OT2 A;  4EQN A;  1OXU A;  5EBC A;  3H09 A;  1Y8N B;  4A3K B;  2SNS A;  2F0I A;  4DF7 A;  1Z6H A;  3I4N B;  4IFD I;  2KJX A;  3BDO A;  5CV4 A;  1CZW A;  2NN6 G;  3HOZ B;  4K8I A;  1Q1E A;  4RH6 A;  5I2Y A;  5ELB A;  1K83 B;  4Q0F A;  3K5M A;  2CQA A;  1NUC A;  1SNC A;  3NE5 B;  5LL6 X;  2VNU D;  1FGB D;  2O5J C;  2KED A;  3MWY W;  4BY7 B;  4BBS B;  2XRQ D;  2IPK D;  2N55 A;  3VR2 A;  2IX3 A;  1S5D D;  2ID0 A;  3L3O C;  1EY4 A;  4C1N K;  2A73 B;  5COY A;  2HDL A;  2QKI C;  1ENA A;  1GXD C;  4DK1 A;  3P75 A;  2R92 B;  1PDQ A;  2ICI A;  1EQV A;  3S14 B;  5KNB A;  1AFP A;  2Z1C A;  4ILW A;  3A56 A;  1H9S B;  1GOZ A;  5I6W A;  2EYL A;  4R8I A;  4QUF A;  1CTM A;  3I91 A;  4JBW A;  1SE4 A;  1JB3 A;  2EVB A;  4OHJ A;  5AFW A;  1FYC A;  5T1G A;  1STA A;  5JPM C;  4WJW A;  4PMB A;  2WIN B;  5J22 A;  5EGT A;  1DJR D;  4C3I G;  1PRT F;  1SAP A;  4RKB A;  5C3X A;  1QIL A;  2Z4I A;  4ZQ3 A;  4RHR A;  1U4M A;  3PUX A;  4L63 B;  4RHS A;  4LK1 C;  5JEA J;  4FYD A;  1I4G A;  4KKU A;  1EYA A;  1PTO C;  1UNS A;  1LLR D;  4FXG C;  2B2V C;  4WFN 3;  3AU7 A;  2EYP A;  2F0P A;  2EYM A;  1SYC A;  2LKV A;  4RGT A;  5G3L D;  2PZT A;  2HQE A;  3J81 L;  1CFM A;  5CR3 A;  2NN6 H;  1GUW A;  5JVG 3;  2XN9 C;  2QF7 A;  4ULL A;  2RDH A;  2F4I A;  5I2X A;  1XYI A;  2A6E C;  5IGC A;  4AYB B;  1XX8 A;  3C46 A;  1UAP A;  4IAL A;  2K03 A;  3ERQ A;  3R3O A;  1B3A A;  2K33 A;  2NVQ B;  2WAC A;  3LX0 A;  2WII B;  3KBX A;  3HKZ B;  1WTQ A;  4QUC A;  1AW7 A;  4BS9 A;  1V1P A;  3C1F A;  1O7Y A;  2PMZ B;  5E1F A;  3LWU A;  1D6E C;  1RTO A;  2WKC A;  4KV6 A;  2JA7 B;  5E4X A;  4HMJ A;  4RWS C;  3MFY A;  4NMZ A;  3NUC A;  2F0L A;  4FF2 A;  1BNZ A;  2EYH A;  1SND A;  5C4J B;  3SE0 A;  3QOL A;  2X6G A;  2F0Q A;  3NTK A;  3G6J B;  2ENB A;  2F0V A;  4DFA A;  1HUM A;  1SE2 A;  3RZD B;  4WOR A;  2NUC A;  2A68 C;  1RF2 D;  5CV7 A;  3J80 E;  5A35 A;  5ELC A;  5C5M A;  2G9H D;  1KDA A;  4K8J A;  1ET6 A;  3HG9 A;  4IFD H;  3GTP B;  1JWU D;  2RKS A;  1HFG A;  4A3F B;  1F2Z A;  2L5T A;  1TT2 A;  5C5L A;  3H0G B;  3D4D A;  1H9K A;  3ONA B;  2LY7 A;  3DMU A;  1RDP D;  2BOS A;  4PMC A;  2PQE A;  1STB A;  1FNW A;  2A74 C;  2J7Z A;  4U67 3;  4A3D B;  3RUZ A;  3KF8 A;  3M4O B;  1O7Z A;  3S1Q B;  5I9P A;  4IZ8 A;  4TQU S;  1EY8 A;  4TSS A;  4DA2 A;  2B39 A;  1J8I A;  3NWS A;  1DXM A;  2M00 A;  1WTW A;  4RGM A;  5C0X J;  4X3U A;  3L9A X;  4OL7 A;  2EY1 A;  4ZLT F;  5K36 G;  1B9N A;  3T16 A;  4M8A A;  1YNJ D;  1ZKO A;  4HSP A;  1KNA A;  2R7Z B;  1W6K A;  1GUN A;  1HTL D;  3GQB A;  4XDX A;  1X3Q A;  3SDZ A;  5JOB A;  1IW7 C;  1MD2 D;  4IFD G;  1I6V C;  2A69 D;  5IOD A;  3DM1 A;  1S5E D;  5CYU A;  5KND A;  2CW0 D;  2F03 A;  3DXJ C;  4EGV A;  4HCE A;  2DN8 A;  1JR0 D;  5K36 H;  1DOK A;  1GHK A;  2ZXR A;  2Z4H A;  2B2W A;  2RDF A;  3HZX A;  1EOT A;  1GUO A;  4K14 A;  2F3W A;  5D3D A;  1H9M A;  1DOM A;  1Q3L A;  3NSW A;  2NVX B;  1WD1 A;  5KYL A;  1STY A;  1O78 A;  2NVT B;  5C0X G;  3PUW A;  1VF7 A;  2F0K A;  1LTG D;  1KAA A;  1SSO A;  4KY7 A;  2CHB D;  2E2I B;  4CKB A;  3IFT A;  4FF4 A;  1F2Y A;  1MBY A;  4N9T A;  2FMM A;  3T4A C;  5EJW A;  3LWE A;  2FMC A;  1JWM D;  1STE A;  2D9U A;  4E6I A;  2B2W C;  2K5W A;  5C44 B;  4CJ2 C;  2BCO A;  5JJZ A;  3S2D B;  5FO9 B;  1EEF D;  3KLS A;  2PW5 A;  2SNM A;  4FF1 A;  2KHS A;  1L0X B;  2DNC A;  4J1M A;  3DEP A;  5HUR A;  5KEE A;  2CVR A;  1NR4 A;  3NQI A;  2M2L A;  5IGB A;  2Q8I B;  1F2M A;  2NBF A;  3K5O A;  4QB4 A;  4C3J G;  2JA6 B;  2NZ1 D;  1QE6 A;  1BF4 A;  4GZY C;  3C1E A;  2BDN A;  2A6H C;  3BS1 A;  2EJG C;  2FFK B;  3OIQ A;  3J7Y W;  3TME A;  1HHV A;  3Q23 A;  4I7Z C;  2B2Y A;  5ISR A;  2A6E D;  3K58 A;  4FP5 D;  1JOQ A;  3H91 A;  2K04 A;  2F0G A;  4UAI A;  4ME5 A;  1OXV A;  2KCC A;  1Q90 A;  1U4P A;  1EZ6 A;  3KBG A;  3M85 A;  3T56 B;  4HED A;  4MN3 A;  5C4H A;  2JA5 B;  3PUY A;  5HGT A;  1UEA B;  3TN2 A;  3VYR A;  3P7J A;  4QF4 A;  2XSC A;  2EJF C;  1WCM B;  5EQ0 A;  2OF1 A;  2PYK A;  3RLF A;  2JP1 A;  1TY0 A;  1EL0 A;  2XNA C;  1EIH A;  3TP7 A;  2AQ2 B;  4CKE A;  3TP6 A;  4KKS A;  3ITP A;  5C3W A;  2A68 D;  4XXE A;  3H3V C;  1TWG B;  1R4P B;  2H1E A;  2PZU A;  3H94 A;  2XWJ B;  3OSO A;  4NKL A;  3U9S A;  4C2M B;  1LTA D;  4K2L A;  2QIL A;  4CJ0 B;  2B2U A;  1TWA B;  1UUP A;  2KEC A;  1PMR A;  2IL8 A;  4KKT A;  1V43 A;  3S15 B;  5IOC A;  3K5L A;  5D14 A;  5DM7 3;  1QNU A;  1ZXT A;  3TZU A;  4Q5V A;  2KUM A;  1SDF A;  5FO7 B;  2PNR C;  5M3M B;  4HTH A;  1EY6 A;  2YU9 B;  3V05 A;  3JAM L;  4G7H C;  3KLS X;  3MXP A;  3GTG B;  1CZG A;  3GTM B;  2K01 A;  1Y69 U;  4DGZ A;  3PIO 3;  1PTO F;  2G9D A;  2ZT9 C;  4RGN A;  2NWG A;  1K8O A;  2H4O A;  2B2T C;  1ZEQ X;  1W6J A;  2F0O A;  4R9W A;  4X3S A;  2J0T D;  3JAM E;  4KHZ A;  4EQO A;  5TSS A;  1CQV A;  1QWY A;  3X3N A;  2IT1 A;  1I3Q B;  1D5M C;  2CW0 C;  3I8Z A;  1WD0 A;  3J7A V;  3MXU A;  4G7O C;  2AQ3 B;  3NWT A;  4KTA A;  1D1I A;  2E2H B;  2RA4 A;  3S17 B;  2Y0S B;  1PYW D;  2BE5 D;  3QJY A;  4L8J A;  4IUP A;  1JIC A;  5IT9 L;  2X6L A;  2F0U A;  3WOF A;  1TU2 B;  2AQ1 B;  3BYY B;  2F0J A;  3VYT A;  3S1N B;  3K57 A;  4ZRZ A;  3DEO A;  4QIW B;  2VB2 X;  1AZQ A;  2A5H A;  3FVQ A;  4PV1 C;  1K8M A;  1FR3 A;  2M9V A;  3U9O A;  1IL8 A;  3R2T A;  2JYO A;  1D2B A;  4DNR B;  4DK0 A;  2L12 A;  5CC4 A;  1I6H B;  3TSS A;  4PMW A;  5JEA G;  3OWF A;  1LO5 D;  2J4X A;  2ZXP A;  4C56 C;  1CT1 D;  1PTO D;  1O7L A;  3CRK C;  3MFG A;  4BWG B;  2F0H A;  1X3P A;  4PQX A;  3NHH A;  1PZI D;  3BVZ A;  2L9H A;  1EU4 A;  3TDQ A;  1C4Q A;  1AP0 A;  5IGE A;  2EXZ A;  2F1M A;  3DWQ A;  1B2T A;  4XQJ A;  3VA7 A;  4G4K A;  1KNE A;  3AMU A;  1EQT A;  1WTO A;  3I4M B;  1PTO H;  1Y1V B;  2PW7 A;  1HCZ A;  1HA5 A;  3J7A F;  3TP8 A;  4KJO A;  5E4W C;  2EYO A;  3OWE B;  4OO1 I;  1U4R A;  3MC0 B;  4A3E B;  4C3H G;  3G7L A;  4LJZ C;  1QCB D;  1TS2 A;  3GTJ B;  2IJ0 A;  1MSH A;  3FRP B;  5JPN C;  1G2T A;  1YNN C;  2OEO A;  1F2L A;  3HGB A;  2MUY A;  2D5D A;  1OXX K;  3C3L A;  2E2J B;  1BUV T;  1H9R A;  5C3E B;  2F0S A;  3MAQ A;  3M4Y A;  1Q12 A;  3NPP A;  3OHX C;  3GP7 A;  3K6O A;  2O2L D;  2PO4 A;  1II3 A;  3A8I E;  2SOB A;  2I07 B;  1A2T A;  4OIK A;  1SEB D;  4ZUI A;  3Q24 A;  2VXW A;  1HUN A;  5KGU A;  4XQN A;  1SE3 A;  4XT1 B;  4IUV A;  3GTL B;  4C3J B;  5D65 A;  1WTX A;  4K5W A;  3QIA A;  5CGK A;  1B4O A;  4P2C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...