4N9TA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92s at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYSYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4n9tA00
4KJOA 3NXWA 3OWFA 3HEJA 5M9OA 2PYKA 1SYBA 3C1FA 4K8IA 3SR1A 4E6IA 1EY8A 4RKLA 5J39A 5IGCA 2SNMA 2NUCA 4KD4A 3SK6A 4K5XA 2F0IA 4NKLA 3D8GA 3NK9A 5ISRA 1STGA 3D6CA 5EKLA 3NQTA 5JOBA 3TP7A 4RKBA 3S9WA 1F2MA 2F0TA 3D4WA 5KYLA 5I6WA 1SYEA 1TQOA 2SOBA 4TRDA 4ME5A 2EY5A 4ZQ3A 3VA5A 4EQPA 4KY7A 5IGBA 1EZ6A 1STYA 5J22A 3MZ5A 4QF4A 1EYDA 5JAVA 3QOJA 2F3WA 5HURA 4DU9A 2ENBA 4KY5A 2SNSA 5CC4A 2EYLA 5C5LA 1SNDA 2EY6A 1JOKA 1U9RA 1EYCA 4KJNA 1II3A 3SK5A 5DAUA 5IGEA 1IHZA 4K6DA 2EY2A 4LAAA 4OL7A 4YIJA 1F2YA 1JOOA 1F2ZA 4IUNA 1KDAA 2PZWA 1STNA 1A3TA 3V2TA 2F0LA 2PZUA 5IGFA 2F0QA 4F8MA 5KRUA 3BDLA 5EKKA 3OMGA 2F0GA 4K2LA 5IGDA 5CV4A 2M00A 4DGZA 1JOQA 2F0JA 3SK4A 4I65A 5CR3A 3MVVA 1A2TA 4NDXA 4B9XA 4NP5A 1EQVA 4PMCA 3EVQA 1SYGA 5KIXA 5E3FA 2PZTA 3E5SA 4G57A 5E1FA 2LKVA 4WRDA 2EY1A 2F0FA 3BDCA 2F0HA 4K2KA 1SNMA 1STAA 3TP6A 5F2DA 5IODA 1EY5A 4J6HA 4ODGA 4EVOA 5C4ZA 2KHSA 5C3WA 4J1MA 5CV6A 1STHA 1A3VA 4HTHA 2F3VA 5KEEA 4KV6A 3SXHA 3QOLA 5C5MA 4DF7A 2F0OA 1NUCA 5CGKA 3NUCA 1ENAA 3SK8A 5KYIA 4QMGA 2OEOA 1KABA 5IIFA 1JORA 2F0NA 3MHBA 2RDFA 4WORA 3QB3A 4EQNA 3C1EA 5I9OA 1A3UA 4HMJA 4K14A 4IALA 1EY4A 1ENCA 2EXZA 3EJIA 2KQ3A 1EYAA 1EY6A 1KAAA 2EYJA 4HMIA 3T16A 5C3XA 2PQEA 4K8JA 3TP8A 2EYFA 1KDCA 2F0WA 4ID6A 5K5PA 3DHQA 4EQOA 2WACA 4N9TA 1EZ8A 3P1HA 4B9WA 3P75A 3MEHA 1A2UA 1AEXA 1NSNS 2RKSA 3NHHA 3D4DA 3HZXA 3MXPA 4KD3A 2EYOA 1RKNA 2EYHA 2QDBA 4PMBA 5CV7A 5CV5A 5J1ZA 5C4HA 3ITPA 5CV8A 5IOCA 1SYDA 2O4XA 4S3SA 2OXPA 5EGTA 2F0UA 3R3OA 5C6AA 2F0DA 1SYFA 1SNPA 2F0PA 4R8NA 5HGTA 1SNOA 2F0KA 3OMCA 1STBA 3H6MA 3TP5A 5IGGA 2RBMA 1SNCA 2F0VA 2F0EA 2PW7A 4PNYA 2EYMA 5DEHA 1TR5A 2F0MA 4NMZA 1TT2A 3DMUA 1EY0A 4ZUIA 3SHLA 5I9PA 1SYCA 5NUCA 4KY6A 4H7BA 1EY7A 2F0SA 3PMFA 1SNQA 3LX0A 2EYPA 4K5WA 5CV9A 4KTAA 1KDBA 3EROA 5KGUA 1EY9A 2OF1A 4DFAA 4IZ8A 4ZUJA 3U9OA 2PW5A 3TMEA 3OSOA 4K5VA 4MIUA 4F7XA 4N9PA 3NP8A 3ERQA 5I6YA 2HQEA 4KHVA 4QB4A 3T13A 3RUZA
chains in the Genus database with same CATH superfamily
4DV6L 1NBWA 4DR4Q 3C1FA 4PZ6A 4BBRH 2A73B 3CC7A 4DR1Q 2HIXA 1WTVA 1HJPA 2RA4A 4RKBA 3D4WA 5IGBA 1GUTA 1GOZA 1M1KC 3E0EA 2QILA 5ELNA 2K32A 1VQGA 2YYZA 4XIGS 1VMPA 3VYTA 3HOZH 5IYCH 4HJ7A 2IT1A 2BA1A 1AZPA 1SBBB 1EFWA 4FDBA 2HCIA 5M3FH 3KDFB 4WFN3 4AQYQ 4BY1B 2YTYA 4KLKA 2FFKB 1Y14B 1PTOH 2O5JC 3J80i 4BBRG 1TWAB 4FF3A 5EPLA 2UU9Q 1ZKOA 2DUDA 3H0GB 4PMCA 2Q2HA 3TQYA 3OHXC 5E1FA 5IT9L 3KJPA 2HHHQ 4IJLA 3T1YL 1JJCB 3GTPH 3HOZG 5IYCG 4KV6A 1PHJA 3U58A 3SE0A 1Q12A 3K0YA 3D31A 5T1IA 4BXXH 4B3SL 3CU7A 1FR3A 4WORA 1VQCA 2A6EC 4IURA 5M3FG 2E2IB 1JCKB 2KHIA 2LSSA 5I9OA 3AMUA 2L12A 2R92B 3M3YB 1Y8NB 3WOEA 2Z6KC 1CA6A 5C0XJ 4DK0A 1GM5A 3OW2A 1VMCA 2KCTA 1QVCA 5FLXL 1HNXQ 5IWAQ 5AFWA 4C2MH 1I4HA 2DJGC 2Y0SG 5CV8A 5CBEE 3F2UA 2JA5B 2GN5A 1VQPA 2F0DA 1YJ9A 3OMCA 4LFAL 3NENA 1K28A 4GLXA 3H3VH 1TXYA 3JAMc 1MI2A 3IFDA 3K5OA 4BXXG 3PMFA 4X62Q 2F4VQ 3N6RA 3VYUA 1QJOA 2LXKA 3L7ZC 3SGIA 4NXMQ 5BN3A 3KF8B 3TMEA 4K5VA 1U4RA 4MIUA 2AMCB 1EQQA 3OWEB 4KHVA 2B8GA 2PQAB 4P2CB 1EIYB 1MHWC 1F9PA 2IY5B 3NXWA 4APVA 3GTOB 2AQ1B 2L0CA 2K5WA 1X6OA 2JA6B 3W1BA 4QGUA 4A3BH 3TN2A 1F2MA 2D9UA 1TQOA 4GN4B 3KJOA 2J7ZA 2Y0SE 1YJNA 3GTLH 4A3FH 5KNDA 4NXNL 1S72A 1T5EA 1PFMA 4LJZC 1XNQQ 1V1OA 3PUVA 4DNTB 4KJNA 4DV4Q 1CT1D 4JI6L 1LACA 4NW2A 3GTGH 1R9TH 3T53B 2GA4B 4V0BA 2B2YC 5E4XA 3HKZB 4EQ5A 1DOKA 4TVAB 1K0SA 3I8ZA 2Z6KA 4IFDJ 2TMPA 2R93B 4YCVA 4A3BG 2LKVA 4WRDA 4R4IA 2D0OA 4L5RC 3S2HB 4RH6A 1ZYRD 5COYA 1EY5A 1Q86C 4DV6Q 4A3FG 4AIMA 1JJGA 4HJ9A 5IIFA 4RCNA 4EQNA 1Z6HA 1A3UA 3S16H 3VYRA 2ZM6Q 1PH2A 4K8JA 4RAUC 4IUTA 2AHOB 4EQOA 4C3JH 1EZ8A 4JI3L 4DV3Q 1VQ5A 1S5ED 1NE3A 1D7QA 4DK6C 4UY8C 4OHJA 3J7YW 2SEBD 2MJ8A 1WOCA 2K1BA 1O7LA 2XGTA 1STBA 4IOCA 4YWKA 1KNAA 3HOYH 3M4PA 1MGSA 1V1PB 4KY6A 2CHBD 3E9IA 3X3MA 1AW7A 5EKIA 4PG3A 1TWCB 2EYPA 4LK1C 1SEBD 1N8RC 1HTPA 3J80c 3HOUB 3OSOA 3HOVH 2YU9B 4QQBX 1WTXA 1IBML 1M8AA 1DOLA 5C3EB 3RUZA 4C3JG 2VUMB 4A3KB 3NWSA 1VQFA 1LT5D 4B3SQ 1MD2D 2GVAA 4BBSB 1FGUA 3SK6A 2B2YA 4KD4A 3K57A 4FXDA 4OONA 1JE4A 1Q1BA 2K75A 2KEDA 2JE6I 4Q5VA 5H1SE 3HOYG 3RLFA 3HOXB 2ALYB 4DAYA 1I5FA 2OQKA 3PO3H 4DV0L 4MNOA 1PYSB 3LWUA 5IGEA 4XYQA 4Y52H 3HOVG 3WDNA 2NB0A 4IUNA 2CH4A 1MBYA 3S1MH 1B53A 3BS1A 3M7NA 1LTGD 4DV1L 4F8MA 4GNXB 4FF1A 2PQAA 2Q2TA 1ML0D 3ER0A 4BWGB 5CBAE 4OXPA 4A3GH 1P16A 3AQQA 1VQMA 2VB2X 1Q90A 3S15B 1WFQA 4O2DA 5F2DA 5C4XH 5LMUL 2B39A 3CMEA 1B8AA 2F3VA 1YITA 1PTOD 1EUJA 2J4XA 5JJIA 1TS5A 3PO3G 3HGBA 3STBD 5M5YB 1GHKA 4L5SA 2F03A 2OCEA 4DV2Q 4NXNQ 1TWFB 4A3GG 3NTKA 1X32A 3NHHA 5CV7A 3S17H 5CV5A 5C4HA 1F77A 4DNIA 1HZAA 1XYIA 3K5LA 1DGSA 5EJWA 4A3IH 5C4XG 1SLJA 2F0KA 3A7LA 1SNCA 1JWSD 2B3GA 1CHPD 5ELDA 5CV9A 1D2BA 1D5MC 4LUVA 1Y1WB 3K7AH 5A2QE 5G3LF 1KD1C 3L9AX 2L9HA 3BYTB 1HFNA 1EU3A 3UDFA 1JB7A 4JW0A 2XNAC 1R4QB 4ZKCB 3M9BA 1LTAD 2EVBA 3DEPA 1SYBA 3FKIB 3RLNA 5M9OA 3E6ZX 4JBWA 4K0KQ 3AYHB 4AYBG 1MSHA 4KKTA 4P74A 4OWXB 2B2VC 3SVMA 3I70A 4KHPL 5I6WA 4A3IG 4FVMA 4JI3Q 4DXGA 1ET9A 1B50A 4QF4A 1AE2A 2L55A 3BDOA 4DV5Q 1Q81C 2SNSA 2EYLA 1XNRL 3HS0C 2NYZD 3SK5A 4GLAC 1IHZA 1OXSC 1WCMH 5IY0A 4JYAL 3GO5A 4DR7L 5EKKA 2VB3X 1MJEA 3ULLA 1AN8A 1L0YB 4L8JA 4MTNA 2NVTB 3S1QB 2IHFA 1PH1A 2C9OA 1CHQD 4JI0Q 1IBMQ 2KEEA 5C4ZA 4J1MA 4AYBE 1W6JA 3VA7A 5JJKA 1VF7A 2WKDA 4CBVA 1ZEQX 3UE0A 2ICIA 4DN4M 2K05A 3CRKC 3FDTA 3BZCA 4QUCA 2E2JH 4IOAA 1ICWA 1S4ZA 2BE5C 1WCMG 2FMCA 1S40A 2Z6BA 5K5PA 1DYQA 3MXGA 4N9TA 2BDOA 3P1HA 3Q8DA 1MSGA 4A3JB 1TS3A 4DV0Q 4LF6L 2UXBL 2WAQG 1SNPA 2CCZA 4GOPB 1W6KA 5FO9B 1QB5D 4DR4L 4DK3C 2F0EA 4OEMB 2B2VA 3D6WA 3LGJA 1TT2A 4DR1L 1Y1VH 1PH6A 2B2UC 2JA8H 2EZVA 4KTAA 4DPGA 1RL2A 5JEAH 3U9OA 5A35A 1TVXA 1K9MC 1ESFA 4N9PA 3T13A 3E3XA 1U4PA 5DNFA 2NTSA 1TWGB 1E1TA 4ZAIA 2WB1G 1K8GA 4NKLA 1VCIA 4AQYL 3R2IA 3T56B 1C48A 1AP0A 1AH9A 1L1OB 2K5NA 4KY7A 1RHPA 4L5QA 3L2PA 2UU9L 4UAIA 1X3FA 1QZHA 2WAQE 3MAQA 1KRTA 3I4NH 4HEDA 4JBKA 1Y1VG 3GTMH 4J8QA 2JA8G 1QE6A 3KUPA 2MHVA 5J3BA 4LF9L 3HOWB 1E7ZA 1SMYC 2EY6A 3CCMA 2LXJA 2HHHL 3WOFA 3SEBA 4X64L 2D0PA 5JEAG 2A8VA 1ASZA 4LAAA 2ZTDA 1EOTA 5IGFA 3GV3A 2YTVA 4CGYB 4DGZA 2UUCL 1A0IA 4OWTB 3FMCA 4MHEA 3IAYA 1LO5D 4G57A 1Y8OB 3MA2B 5IT9c 3GTQH 2WB1E 3OYYA 3A7AB 2RVLA 3I4NG 2JA9A 1HNXL 1SE3A 3TS2A 3JAMi 1B7YB 3SK8A 2Z1CA 3G6JB 2VNUD 2OEOA 1X55A 2K5VA 2G9DA 2O5IC 3CW2C 4QL5A 4K14A 4C1NI 4OO1H 2HUGA 2B2UA 1Z9FA 1PZID 3PGZA 1LTBD 1F9RA 1E24A 4XT1B 4OIKA 2E2HB 5FLXc 3FPUB 4LFBQ 1LT4D 4IUPA 4X62L 2HQLA 5BN5A 1S5CD 1LTSD 1R4PB 4NXML 3Q0AA 1L1OC 4IO9A 1FVIA 3M7GA 2DGYA 3A55A 1H9JA 3CC4A 2HDMA 4HSPA 2OXPA 3CC2A 4JYAQ 3GD7A 1MKHA 3I56A 3PQIA 4DR7Q 1OXUA 3R93A 1EYGA 1HR0Q 1E2ZA 1BF4A 1HR0W 1C7YA 5NUCA 2VXWA 1X65A 4QUFA 2H1EA 2N88A 3OOCA 5C4JH 4CDEC 2OF1A 3CXCA 3KF6B 4IZ8A 4OO1G 1ENFA 1SFOB 2R7ZB 3ERQA 5CYUA 1YVCA 4KJOA 3HKSA 3PO2B 1XNQL 2K4KA 4JBMA 2PMZE 2KOLA 3P20A 1LYLA 5DM73 1ASYA 1I94Q 4BY7B 3S9WA 4JOIC 2F0TA 1X3QA 1SYEA 1Q46A 2Q2IA 2N8NA 4XQJA 1KHIA 1EZ6A 4FP5D 4CKEA 2D5DA 4XQNA 2AWOA 2RCFA 5IP9H 5FO7B 2B2WC 2ENBA 2XIWA 3AU7A 3U50C 1VQOA 1BCPB 1ONLA 4KKSA 1BR9A 3RMHA 3E9HA 1TWHB 5M3MB 1JR0D 1FNVA 1HUMA 3PV0A 1F2YA 2R92H 1PVOA 2TSSA 1MJCA 5CV4A 2ID0A 4OO1I 2NVYB 3VR2A 4LF5Q 2OTJA 2ZM6L 2I5MX 5KIXA 4CDFC 3CRLC 1SJHD 1LTID 4K2KA 4ZRZA 1YNND 1L1OA 3BVGA 4DV3L 3MC0B 3CMAA 5IP9G 3BG3A 1SSOA 4JVZA 5KNCA 3PIO3 1A15A 4IN3A 4JV5Q 1EEFD 1ILQA 2B63B 2R92G 1GJXA 3PUYA 2AUKA 5DLQE 3ULJA 2X6GA 3VR5A 5GQOA 1J8IA 4LUZA 4ID6A 1BNZA 2MNAA 1EQTA 1G91A 4LF9Q 4A3MH 4C3HB 3BZDB 2HCCA 4IPCA 4X64Q 2QDBA 2ZJRA 2ICEC 1X3EA 3ND9A 1JQYD 4HIKA 2Q8IB 2N55A 5HGTA 4QIWE 2UUCQ 1SROA 2F0VA 2CH4W 4JOIA 5DEHA 2P5ZX 4NMZA 3ZYYX 2F3IA 5M5WH 1K73C 1J6QA 4K5WA 4O42A 3M85A 1ZYRC 2JA7H 1CSQA 2WV6D 2B2WA 1VS0A 1X9NA 3RR5A 1DCZA 5EPKA 1XTDA 2MUYA 3IL8A 3OW7A 2Q2UA 1PZKD 4A3MG 2K03A 4K8IA 3KLWA 3NQIA 3DEOA 1RJTA 1XPUA 1BBUA 2QW7A 2F0IA 1LTTD 1UE5A 3DUZA 2CW0D 2R93H 1PH7A 5T1GA 1KLUD 2RF4A 4YY3L 4A75A 4R4CA 5JAVA 2HT1A 3I4MB 5A2QL 3CCQA 1VQ8A 2RSNA 3HOZB 1EYCA 1F2LA 4EX5A 2JA7G 2QEXA 1XPOA 1T9HA 1SMXA 3KF6A 3Q23A 5M3FB 3V2TA 2F0LA 2K04A 3PIP3 2RCNA 3G48A 2XSCA 1HQMC 1JICA 2ZXRA 4MN3A 3GTKH 4IUUA 1PTOB 5AJ3Q 5K36H 3TRZA 3EVQA 2R93G 2MPMA 2R7DA 4FF4A 3VR3A 2F0FA 2K14A 1VQDA 2KENA 4DV2L 4ODGA 2Y0SB 4B3RL 2KECA 4NB3A 1MIUA 2JK8A 1E0BA 4CJ2C 3NUCA 3PCOB 3BVZA 3K7UC 1V1QA 1TWCH 2ZJPA 1VQKA 1BCPD 5D65A 3J81E 1EYAA 4KHZA 2NZ1D 2M9VA 1NCVA 1B3AA 2A69C 1GVPA 2Z9HA 4A3KH 2WIIB 1BBXC 4B3ML 1BOSA 2FJ2A 3C2PA 5K36G 3MXPA 3A56A 2EYHA 2HD3A 4LNQA 2A1AA 3QIAA 3TZUA 2F0UA 1SYFA 5CMDA 4QJFA 1UWVA 2SDFA 1I3QH 4K0KL 1V8QA 1S5BD 2F0SA 1H9SB 3KDFA 2D2CC 4DR6L 4XTCS 1V43A 1PRTB 2NVQB 3EBEA 2DJFC 4HCEA 1XX8A 3A5UA 1QNKA 2FXQA 3RN2A 2PI2A 4DV5L 1I50B 4CKCA 4A3KG 2VZAA 1EIFA 1SAPA 1HCZA 3TBIB 1RD9D 1EWCA 1A63A 1EY8A 1IL8A 3KK7A 2I0QA 4DAVA 2F4IA 3NK9A 2XTIA 3D6CA 5G3LD 5JOBA 2OT2A 2FHTA 2F52A 2Z4IA 3NELA 4A3DH 3KLSX 2A5HA 4H02A 1TS4A 4KKUA 3K80C 4OX9Q 3RZDH 1GKHA 1KNEA 2R6GA 3GTLB 4ZYSA 1RCVD 4XDXA 4JI0L 4G7OC 4IPGA 1EEID 2L11A 3L3OC 1CM9A 2Z4HA 5I4DA 1KQSA 1RIPA 4POGA 4YIJA 2LS01 2VQEQ 1OXXK 2PZUA 4RA8A 3GTGB 1R9TB 3ICEA 2JYOA 1PDQA 4A3EB 1TWFH 4BA1I 4ABNA 1EU4A 1XMOQ 2QKIC 5I2YA 1SYGA 3K5MA 2FINB 2EY1A 4A3DG 4EVOA 1IYUA 1QOHA 1GUWA 1Q8KA 4RHRA 1RF2D 3A54A 5CGKA 3LWEA 1EIGA 4GLVB 4FYDA 4Y7NB 3KF8A 2NVXH 5C44H 3R2TA 1KRSA 2CVRA 1Y1WH 3S2DH 3CCRA 4YY3Q 3RZOH 3T16A 1EY6A 3D3RA 2KBNA 2PQEA 4P71A 4RMFA 3TP8A 1BBWA 1PFSA 2ZXOA 1WJJA 4LW1A 2I5LX 3FKIH 3D4DA 1FNUA 5IOCA 4A93B 1EL0A 5FKAC 1KIXA 4S3SA 3BZKA 5LMNQ 3R3OA 3F2BA 4JPBW 2EJMA 4C3IH 5LMNW 1VQHA 4R4OA 1C4QA 1FJGQ 3DXJC 3SHLA 3MXUA 4YWMA 1XWEA 1VQAA 5FK9C 4CDCC 5IYDH 1Z7TA 2QDLA 4PZ8A 2IWHA 5C44G 2VW9A 1JMCA 3HOYB 1S3OA 2K50A 1HNWQ 2N3SA 1CTMA 1Y1WG 4M1UB 1Y8PB 4B3RQ 2AKWB 2KJXA 1YI2A 4F7XA 4QB4A 2F1MA 3HOVB 3FKIG 4ILWA 3SR1A 4IPDA 1I6HH 4KMUC 1N36Q 1QVFA 4A3LH 3AFPA 4G7ZC 1IKMA 3TP7A 5FLMH 2JSOA 1B4OA 3A8IE 3ZJYC 1GD7A 4C3IG 4IJHA 2EY5A 1D6EC 4LF8L 1YNJC 4HSVA 4LF7Q 1EYDA 4B3MQ 4JG2A 1IW7C 5IYDG 2IX1A 1LM0A 4KY5A 4HIDA 2QEJC 4GNXC 2L15A 4PV1C 1HZBA 1VQJA 1QNUA 3H91A 1HNZQ 3C46A 2D62A 2EY2A 4OL7A 3PO3B 1KDAA 2UUBQ 3NEMA 3I3CA 2F0QA 1PRTD 3BDLA 3M4OH 4BS9A 1NR2A 3H94A 3S1MB 1DJRD 3I4OA 3TZDA 4DR2Q 4A3JH 4DR6Q 3I72A 4A3LG 4F88A 5ELBA 2L1BA 3TEHB 5E3FA 5FLMG 3PF4A 4A3GB 3CHBD 5ELOA 1SNMA 4X65L 1EFID 4J6HA 1Y69U 4KN4C 1HA5A 3S1RH 1V1PA 4DR5Q 4LFBL 1H9RA 2CKZB 3DWAA 5M5XB 4A76A 4KI0A 2MP1A 5GADC 2NZOA 3K81C 5BR8Q 5C4XB 2A6HC 3KYHC 1VQIA 2B2TC 1HUNA 2H5XA 1UEAB 3AFQA 1SR3A 4UPAA 1L0WA 2Z8LA 1WTHA 2OTLA 1HR0L 4UHVA 1CA5A 3D4RA 5C3XA 3X3NA 4LF4Q 1LTRD 3F2DA 4A3JG 1AEXA 4OWWB 2RKSA 2VY3A 1TWGH 3HZXA 4ZUIA 3V05A 1K3RA 1FNWA 3E0JA 3S17B 2YTXA 3TDQA 1WTQA 4AYBB 1UEBA 1IZ6A 2PW7A 1EY0A 3W5OA 4A3IB 4Z9CB 1NNXA 1I94L 1HZCA 2PCFB 1TKWB 2WFWA 2M2LA 2IL8A 1A6XA 1OO9B 1PV4A 3FVQA 4GNXA 5EAYA 1Q1EA 4J15A 1J9OA 3K7AB 2HQEA 1IYVA 2E76C 3KBGA 3G71A 1FGBD 3D8GA 1EWIA 1K0RA 5ISRA 4POFA 3GTJB 4ZK9B 3OIPA 4ZQ3A 1PH5A 1PYBA 1QG7A 1IXRA 2GVBA 4QY7A 4R9WA 2X69A 1B44D 4LF5L 1SE8A 3CCJA 1OXTA 1G2TA 4RCOA 1SNDA 4A3CH 1DD2A 2JN4A 5HY6A 1PXUA 4H0LC 1CK1A 2I07B 2LMCB 1D1KA 3I90A 2B2TA 2HDLA 1VQ9A 1STNA 2XVSA 1XPRA 1G291 1KTKA 2M00A 3JC66 5CR3A 3MVVA 4GKJL 1KXLA 1K83H 2KCCA 4JV5L 4Q0FA 4LWCA 2EPBA 1VQLA 1GO3E 3NWTA 2YV5A 2IX0A 1E1OA 1X3PA 4JI1Q 1JWUD 2K33A 1QVGA 3DM3A 5C3WA 3VR4A 3KLSA 3BYYB 5IYBH 3TSSA 1LT6D 3CD6A 3SXHA 2KHJA 1W3SA 1ENAA 1YHAA 5KYIA 4A3CG 3BU2A 4DV7L 2RHSB 4GN3B 3C1EA 4LF8Q 5IE8A 3S1NH 1I6VC 1EY4A 1X56A 4RG1A 1KDCA 2F0WA 3S14H 1SFOH 2R7ZH 3DHQA 4P75A 2WACA 4GOPC 1Z47A 1JB3A 1B2TA 4F87A 3DWPA 1NMFA 2XWBB 1VQNA 3DM1A 1J5EQ 3UDIA 2WB1B 1A8VA 3G7LA 4JBJA 3TP5A 5IYBG 2O2LD 3FRPB 1UE7A 1S5DD 2UXDL 4DK1A 2BOSA 4MZ9A 3A0JA 3J81L 2ZXPA 2A68D 3J7A5 4X65Q 1IL2A 1DONA 1HH2P 1CUKA 5M3MH 3CPWA 3PF5A 1D8LA 4L5TA 1YNNC 3I7FA 4DUZQ 2K5HA 2JA8B 1C0AA 4EGVA 2RDGA 5I6YA 2R7ZG 1D5ZC 1DM0B 3PUXA 3UI2A 2EDGA 3D0FA 4JC0A 1N34Q 4DAMA 2NVYH 2CQOA 1QZGA 4K5XA 1STGA 4I7AA 2QA4A 1DXMA 1ILPA 3CCLA 4EQPA 4ME5A 3J7ZC 3CQZB 1STYA 5C0XH 4R8IA 4P73A 1Q3LA 1OTCA 1EQRA 4A4IA 1YBYA 5LL6S 5AJ3L 5CC4A 4JI7Q 3I4NB 1HQRD 1K8OA 2EOTA 3MTSA 4G4KA 4BY1H 1U9RA 4RGNA 1TY2A 4YHHQ 1II3A 5M3MG 3OTOL 1QILA 1YNXA 1XXGA 4K6DA 1YEZA 3MFGA 4TSSA 2B63H 1TWAH 1UNSA 1LLRD 5FJ8H 4B3TQ 1G8ZD 4CDDC 3H0GH 5IGDA 4LUOA 3T1HL 1VF5C 4C3HH 4NDXA 3V96A 3NE5B 4NP5A 4X66Q 2EJGC 1F9SA 4GOPA 1X3GA 1RDPD 4GS3A 4ZKBB 5GAEC 3NBHB 5E4WC 5JEAJ 3EN2A 5D14A 4FXGC 5C0XG 1PFNA 2Q8TA 5CV6A 2UXCQ 3T4AC 4AH6A 5KEEA 3RNUA 2E2IH 3VYSA 2RHQB 4RGMA 3U4ZA 1CKNB 3B6YA 4H13C 2MGSA 2CW0C 4BY1G 1P8LA 3MWYW 3I4LA 3M3YH 4XYOA 3GV6A 1DOMA 1U5KA 2B63G 1ENCA 2IX3A 4HCSA 5FJ8G 5EBDA 3U4VA 3H0GG 1TY0A 5JPMC 3J80E 1WVLA 4C3HG 3L0OA 2JA5H 4IQZA 1N32L 4KD3A 2EYOA 4PMBA 4UP9A 5J1ZA 3K59A 3C3LA 2WINB 4HN7A 3G4SA 3O13A 2PNRC 2O4XA 3KLRA 2VL6A 1BXTA 1S5FD 3EIVA 3WWVA 4GZYC 3HP3A 4GKJQ 3SDZA 3LNNA 1TS2A 3I4MH 2BCOA 1QUQB 3ONAB 1EY7A 4IFDH 1B9MA 5C0XI 1B1ZA 1SNQA 3AEVA 5JJLA 4O1NA 4DKAC 4OX9L 4N8FA 1UE1A 2MO0A 1N33L 3GTOH 2K5DA 2EE1A 5C4JB 5E7NA 3I55A 1XMQL 2VQFL 3OWFA 2JA6H 2JA5G 2PI2E 4JI4Q 4O0AA 5J39A 4DV7Q 4HIOA 4LFCL 2B29A 1BCPC 2VQEL 1NR4A 4TRDA 1E2WA 4QIWB 5TSSA 1RODA 2IPKD 5J22A 1H9KA 1XMOL 4PQXA 3MEFA 4HJ8A 3I4MG 4IFDG 1V9PA 3FPPA 5GROA 5C5LA 2DN8A 1JOKA 5DAUA 1BQQT 5D3DA 3NSWA 1T5XD 4U68A 1IBKQ 1LABA 2UXDQ 2K5QA 2PNHA 1IBLQ 2JA6G 2F0GA 4BBRB 3S2HH 2E75C 1K3BC 1A2TA 3F2CA 4UDUC 3T51B 1O7ZA 1FD7D 5BN4A 3TP6A 2E8GA 4FF2A 2KHSA 4HJ5A 4JI5Q 3QG1A 1F9QA 3CKIB 2OQ0A 4IPHA 3QOLA 4DF7A 2F0OA 2PPBC 2F0NA 1GHJA 5LMNL 4DAYB 3M4QA 3HKZG 1YIJA 5LHY1 3RN5A 2NVQH 1FJGL 3W3AA 4IFDI 3R8BA 4HMIA 1HZ9A 1W2BA 1SXTA 1I50H 1A2UA 1HNWL 1VQ6A 1GUSA 2MQHA 2E5LL 3N52A 1PZJD 2QCPX 3OTOQ 1EIHA 1CSPA 2NWGA 1VDZA 1U0LA 3FEWX 4A3MB 5EGTA 5ELCA 2CWAA 5KNBA 3GTPB 3NBHA 1M4VA 1SNOA 2X6LA 3H15A 1WTPA 1EWHA 1LT3D 3T1HQ 2EYMA 1LUZA 1N36L 3GQBA 1NJIC 3K6OA 4CKBA 1TIID 2G5DA 1CKNA 3HOUH 1L0XB 5EPJA 4DR3L 2LFNA 2R61A 2YU9H 5M5WB 1YHQA 4RFBA 5C3EH 4R4QA 4ZUJA 1UAPA 3QJYA 4ZLTF 1GXDC 4DUYQ 2VUMH 4LF7L 2PO4A 2JA7B 4BBSH 3HKZE 2UUAQ 4A3EH 4C2MB 5FOBB 2A19A 4X6AH 1HNZL 2NUCA 1ESRA 3CF5A 4C56C 2MO1A 3CCVA 4PZ7A 2A6ED 2UUBL 1KC8C 2RSOA 4JI8L 3HOXH 2Z0SA 1VQBA 3UDGA 4DR2L 1N32Q 4WJ3M 2K28A 3J7AV 3QOJA 5HURA 1WD1A 4DU9A 2K6AA 1CFMA 2B8FA 2K7VA 3HOUG 1HA6A 1QUQA 1HPCA 4Y7NH 3DLLA 4DNRB 3F1ZA 5C3EG 2BH2A 2R3ZA 2VUMG 1PTOC 2ASBA 3MXNB 4DR5L 3J81i 3A8KE 1F2ZA 1PH8A 2PZWA 5I2XA 4BBSG 3H3VI 1SDFA 5BR8L 3K58A 2EQSA 3STBC 4K2LA 4A3EG 3IKJA 3S15H 4XQQA 4GKKL 3FHWA 1E2VA 1VQ7A 4A93H 4A3BB 1Q82C 1N33Q 4LF4L 3IRBA 3W2DA 2F0HA 4DXFA 1I4GA 3HOXG 1VQ4A 3GTKB 1O7IA 3TREA 3J7AF 1XMQQ 2VQFQ 1PFBA 4A3FB 1STHA 3P7JA 1A3VA 4HTHA 3ULPA 1WTWA 1BDOA 1BO0A 1CKOA 4LFCQ 1EOVA 1FL0A 1PH3A 4QMGA 5M5YH 1JORA 2BDNA 3QB3A 4NPSA 4L6TB 2JEAI 5IGCA 4KN7C 2JJQA 1JE5A 2MFIA 3CPFA 3CCUA 3T1YQ 2VS1A 2Q8RE 4HIMA 3MEHA 2DNCA 2WP8J 4LMQD 2QGQA 3S24A 3KBXA 3UE1A 1JT8A 4OIJA 2WKCA 4X3UA 4C1NK 4A93G 2K01A 4K6LA 1PLFA 4DA2A 3H3VC 1HHVA 3KFUA 1SRUA 4R8NA 1PRTC 1C9OA 1X54A 1ET6A 1LV9A 4PNYA 1TR5A 4HAEA 3JAML 4BA2I 1E22A 1I3QB 3QO2A 3S16B 5KGUA 2A69D 4ZCKA 3QWNA 3NTHA 2E2DC 2XN9C 4X3TA 1JJ2A 3F8TA 4C3JB 3I73A 2JXMB 3EQLC 1K8AC 1HTLD 4LFAQ 2PYKA 4JI2L 2KA7A 3PIOA 1LTLA 1SE4A 2IHEA 3Q6SA 4CHTB 3U9SA 4M8AA 1HXYD 4RHSA 4XXEA 2JQOA 4WJ4A 1CQFA 4A3DB 3ND8A 5IT9E 2E5LQ 5M5XH 4UP7A 1BCPF 3UDXA 1NMGA 3HG9A 2N78A 3RZDB 3HRZC 2L5TA 4JI1L 1PH9A 3CAMA 1DZ1A 1WI5A 3CCSA 2CWPA 2NVTH 1B3QA 3S1QH 1JOQA 2F0JA 4PMWA 4I65A 3K8AA 2NBFA 4DR3Q 3GP7A 4B9XA 1B70B 5IP7H 1H9MA 1NY4A 2ZT9C 4WJWA 2KUMA 5FLXE 1YZ6A 4JI6Q 3OPOA 1H9SA 2CFMA 1NUCA 3OIQA 2BH8A 3H09A 1G6PA 3I2ZA 4ALPA 3MHBA 1J5EL 3MFYA 4JI8Q 1M90C 4IALA 1WTRA 2EXZA 5C44B 2NVXB 3MXNA 1C8CA 1HRJA 2EYFA 1KLGD 3S2DB 2IJ0A 3RZOB 4B9WA 2QF7A 2C5CA 2NZHA 4CJ0B 1RKNA 5IP7G 1WTOA 2V4DA 3ITPA 4DUZL 4OELB 5DM63 3GTJH 2IW3A 2F0PA 2K52A 3NPPA 5IGGA 1XJVA 1A62A 3PIPA 1N34L 2AUJD 2OWOA 2F0MA 2LY7A 4GKKQ 2KCNA 4YCUA 4C3IB 3NTIA 4RGTA 3J81c 1KDBA 5LL6X 3EROA 3URYA 4MTKA 4DFAA 1STEA 4FNFA 1SE2A 3J80L 3HFZB 1CZWA 3Q22A 3NP8A 3EFXD 4HR7B 1HFGA 4ULLA 2L4NA 3CP0A 4JI7L 4E6IA 4RKLA 2EIFA 4YCWA 4YHHL 5GAGC 2SNMA 3CCEA 1PMRA 1JC7A 2AQ2B 4JK1C 3NQTA 1I6HB 1IKLA 4B3TL 3VA5A 2G9HD 2H4OA 4IUVA 4P72A 3MZ5A 4QCLA 3HOWH 1NTGA 4X66L 1N9WA 4G7HC 1GUGA 1K8MA 3KOJA 1AZQA 1KAWA 3TS0A 2UXCL 1JOOA 1QWYA 1G6ZA 1A3TA 5KRUA 5JVG3 2ATWA 3M4YA 3OMGA 1PYWD 2HIVA 2NTTA 3K0XA 4JCVE 3SK4A 1PTOF 2A68C 3W1GA 2C35B 3M4OB 3NBIA 4YWLA 1EQVA 1D5XC 1PH4A 1YNJD 2PZTA 3E5SA 1G51A 1IW7D 5JVH3 4TKOB 5IODA 4B08A 1RTOA 1CKMA 1I4PA 1G2SA 3HOWG 4JI2Q 3PUWA 2NN6H 3PUZA 5C5MA 4DV1Q 3S1RB 4GN5A 4UP8A 5HGQA 3IFTA 1BUVT 2I46A 3PSIA 2DY8A 1WCMB 4N8X1 3EJIA 2E2HH 1KAAA 1H95A 5EQ0A 1Q8IA 3K5NA 4I7ZC 3Q24A 1KL9A 1BKBA 1B9NA 3P75A 5LMUQ 1CQVA 5FO8B 1NSNS 1YHBA 2JEBI 1JWMD 2ES2A 3GDEA 2WAQB 1RTNA 2A6HD 2R7FA 3CQZH 2RBMA 2RQXA 3QR8A 4JI4L 2NN6G 2J0TD 5I9PA 4R1JA 1L2FA 3JAME 1CI3M 2E2JB 1PRTF 1FYCA 1AFPA 2XRQD 2A74C 1EY9A 2ZTCA 2XWJB 3BVMA 2PW5A 2DY7A 1I4RA 3PO2H 3DWQA 1I4XA 2CQAA 3HEJA 1O80A 4BY7H 3RLOA 3A74A 3VDYA 1O78A 5EKLA 2KCMA 4XT3B 1IBKL 5KYLA 2AWNA 2SOBA 1IBLL 2BE5D 5D3IB 3RD4A 2EJFC 2F3WA 1E3PA 1TWHH 1Y1VB 1SJED 4DAPA 1VQEA 3A5ZB 5ELEA 3FP9A 4X3SA 3A8JE 3I91A 5IWAL 2NN6I 2JP1A 1QCBD 4JI5L 1D1IA 4IUQA 1ICFB 3PO2G 1NAPA 4FXKC 4KHPQ 1BVSA 2FMMA 1AE3A 4BY7G 1TU2B 1GUNA 2BA0A 2V1CC 5L37A 1ZXTA 3BJUA 1XTCD 1XNRQ 2F4VL 3BDCA 3ERSX 5EBCA 1K83B 1STAA 1WYDA 4X3KA 3GTMB 5ELFA 4RGOS 3J81j 3EA6A 1KABA 1WD0A 2I5HA 2RDFA 1O7YA 3AB9A 2XRSD 3VR6A 1YJWA 4HMJA 2KVMA 2KQ3A 2EYJA 2PMZB 1PA6A 4RWSC 1OXVA 3S1NB 4FO2A 1UUPA 1U4MA 1CZGA 1SN8A 4H44C 3S14B 2N49A 2RDHA 1GUOA 4DUYL 1SYDA 1SMYD 4CJ1B 3GTQB 4DV4L 2ZTEA 5C6AA 2UUAL 4OGQC 5JJZA 3H6MA 4KK7A 1UE6A 4ME3A 4R4TA 2EXDA 4HJAA 3DMUA 1SYCA 4H7BA 3G6EA 5CORA 1Q7YC 5JPNC 3LX0A 1IYJB 5GAHC 4U673 1I4QA 2E74C 4TQUS 1U4LA 4L63B 4LF6Q 4V190 2UXBQ 2AQ3B 2ZJQA 2DNEA
chains in the Genus database with same CATH topology
3C1FA 2A73B 1WTVA 2RA4A 4RKBA 3D4WA 5IGBA 1GUTA 1GOZA 2QILA 2K32A 2YYZA 4XIGS 1VMPA 3VYTA 2IT1A 2BA1A 1AZPA 1SBBB 2HCIA 4WFN3 4BY1B 2FFKB 1PTOH 2O5JC 1TWAB 4FF3A 5EPLA 1ZKOA 3H0GB 4PMCA 3OHXC 5E1FA 5IT9L 4KV6A 3SE0A 1Q12A 3K0YA 3D31A 5T1IA 3CU7A 1FR3A 4WORA 2A6EC 4IURA 2E2IB 1JCKB 5I9OA 3AMUA 2L12A 2R92B 3M3YB 1Y8NB 3WOEA 1CA6A 5C0XJ 4DK0A 1VMCA 5FLXL 5AFWA 1I4HA 5CV8A 5CBEE 3F2UA 2JA5B 2F0DA 3OMCA 1MI2A 3IFDA 3K5OA 3PMFA 3N6RA 3VYUA 1QJOA 3L7ZC 5BN3A 3TMEA 4K5VA 1U4RA 4MIUA 3OWEB 4KHVA 2B8GA 4P2CB 1F9PA 3NXWA 3GTOB 2AQ1B 2L0CA 2K5WA 2JA6B 3TN2A 1F2MA 2D9UA 1TQOA 2J7ZA 5KNDA 1T5EA 1PFMA 4LJZC 1V1OA 4DNTB 3PUVA 4KJNA 1CT1D 1LACA 4NW2A 3T53B 2GA4B 4V0BA 2B2YC 5E4XA 3HKZB 1DOKA 3I8ZA 4IFDJ 2TMPA 2R93B 2LKVA 4WRDA 3S2HB 4RH6A 1ZYRD 5COYA 1EY5A 5IIFA 4RCNA 4EQNA 1Z6HA 1A3UA 3VYRA 4K8JA 4RAUC 4IUTA 4EQOA 1EZ8A 1S5ED 4OHJA 3J7YW 2SEBD 2MJ8A 2K1BA 1O7LA 1STBA 1KNAA 1MGSA 1V1PB 4KY6A 2CHBD 3X3MA 1AW7A 5EKIA 1TWCB 2EYPA 4LK1C 1SEBD 1HTPA 3HOUB 3OSOA 2YU9B 1WTXA 1M8AA 1DOLA 5C3EB 3RUZA 4C3JG 2VUMB 4A3KB 3NWSA 1LT5D 1MD2D 4BBSB 3SK6A 2B2YA 4KD4A 3K57A 4FXDA 1JE4A 1Q1BA 2KEDA 2JE6I 4Q5VA 3RLFA 3HOXB 4DAYA 3LWUA 5IGEA 4XYQA 3WDNA 2NB0A 4IUNA 1MBYA 1B53A 3BS1A 3M7NA 1LTGD 4F8MA 4FF1A 1ML0D 4BWGB 5CBAE 2VB2X 1Q90A 3S15B 5F2DA 2B39A 2F3VA 1PTOD 2J4XA 1TS5A 3HGBA 5M5YB 1GHKA 2F03A 1TWFB 3NTKA 1X32A 3NHHA 5CV7A 5CV5A 5C4HA 1F77A 1XYIA 3K5LA 5EJWA 3A7LA 2F0KA 1SNCA 1JWSD 1CHPD 5ELDA 5CV9A 1D2BA 1D5MC 1Y1WB 5A2QE 5G3LF 3L9AX 2L9HA 3BYTB 1HFNA 1EU3A 2XNAC 1R4QB 4ZKCB 1LTAD 3DEPA 2EVBA 3FKIB 1SYBA 5M9OA 3E6ZX 4JBWA 1MSHA 4KKTA 2B2VC 3SVMA 3I70A 5I6WA 4FVMA 4DXGA 1ET9A 1B50A 4QF4A 2L55A 3BDOA 2SNSA 2EYLA 3HS0C 2NYZD 3SK5A 1IHZA 1OXSC 3GO5A 5EKKA 2VB3X 1AN8A 1L0YB 4L8JA 2NVTB 3S1QB 2C9OA 1CHQD 2KEEA 5C4ZA 4J1MA 3VA7A 1W6JA 1VF7A 2WKDA 4CBVA 1ZEQX 2ICIA 4DN4M 2K05A 3CRKC 3FDTA 4QUCA 1ICWA 1S4ZA 2BE5C 2FMCA 5K5PA 1DYQA 3MXGA 4N9TA 2BDOA 3P1HA 1MSGA 4A3JB 1TS3A 1SNPA 1W6KA 5FO9B 1QB5D 2F0EA 2B2VA 3D6WA 1TT2A 2B2UC 2EZVA 4KTAA 5JEAH 3U9OA 5A35A 1TVXA 1ESFA 4N9PA 3T13A 1U4PA 5DNFA 2NTSA 1TWGB 4ZAIA 4NKLA 1VCIA 3R2IA 3T56B 1C48A 1AP0A 4KY7A 1RHPA 4UAIA 3MAQA 4HEDA 4J8QA 1QE6A 3KUPA 2MHVA 3HOWB 1SMYC 2EY6A 3WOFA 3SEBA 5JEAG 4LAAA 1EOTA 5IGFA 3GV3A 4CGYB 4DGZA 3FMCA 4MHEA 3IAYA 1LO5D 4G57A 1Y8OB 3MA2B 3A7AB 2RVLA 1SE3A 3SK8A 2Z1CA 3G6JB 2VNUD 2OEOA 2G9DA 2O5IC 4K14A 4C1NI 4OO1H 2HUGA 2B2UA 1PZID 1LTBD 1F9RA 4XT1B 4OIKA 2E2HB 3FPUB 1LT4D 4IUPA 5BN5A 1S5CD 1LTSD 1R4PB 3Q0AA 3M7GA 3A55A 1H9JA 2HDMA 4HSPA 2OXPA 3GD7A 1OXUA 3R93A 1E2ZA 1BF4A 5NUCA 2VXWA 4QUFA 2H1EA 2N88A 3OOCA 2OF1A 4IZ8A 4OO1G 1ENFA 1SFOB 2R7ZB 3ERQA 5CYUA 4KJOA 3PO2B 2KOLA 3P20A 5DM73 4BY7B 3S9WA 2F0TA 1X3QA 1SYEA 4XQJA 1EZ6A 4FP5D 4CKEA 2D5DA 4XQNA 2AWOA 5FO7B 2B2WC 2ENBA 2XIWA 3AU7A 1BCPB 1ONLA 4KKSA 1BR9A 3RMHA 1TWHB 5M3MB 1JR0D 1FNVA 1HUMA 3PV0A 1F2YA 2TSSA 5CV4A 2ID0A 4OO1I 2NVYB 3VR2A 5KIXA 3CRLC 1SJHD 1LTID 4K2KA 4ZRZA 1YNND 3BVGA 3MC0B 3BG3A 1SSOA 5KNCA 3PIO3 1A15A 4IN3A 1EEFD 1ILQA 2B63B 1GJXA 3PUYA 2AUKA 3VR5A 2X6GA 1J8IA 4ID6A 1BNZA 1EQTA 1G91A 4C3HB 3BZDB 2HCCA 2QDBA 2ICEC 3ND9A 1JQYD 2Q8IB 2N55A 5HGTA 2F0VA 5DEHA 4NMZA 3ZYYX 4K5WA 4O42A 3M85A 1ZYRC 2WV6D 2B2WA 1DCZA 5EPKA 2MUYA 3IL8A 3OW7A 1PZKD 2K03A 4K8IA 3NQIA 3DEOA 1RJTA 2F0IA 1LTTD 3DUZA 2CW0D 5T1GA 1KLUD 5JAVA 3I4MB 5A2QL 2RSNA 3HOZB 1EYCA 1F2LA 3Q23A 5M3FB 3V2TA 2F0LA 2K04A 3PIP3 2XSCA 1HQMC 1JICA 2ZXRA 4MN3A 4IUUA 1PTOB 5K36H 3EVQA 2MPMA 4FF4A 3VR3A 2F0FA 4ODGA 2Y0SB 2KECA 1E0BA 4CJ2C 3NUCA 3BVZA 1BCPD 5D65A 3J81E 1EYAA 4KHZA 2NZ1D 2M9VA 1B3AA 1NCVA 2A69C 2WIIB 1BBXC 1BOSA 2FJ2A 3C2PA 5K36G 3MXPA 3A56A 2EYHA 3QIAA 3TZUA 2F0UA 1SYFA 5CMDA 2SDFA 1V8QA 1S5BD 2F0SA 1H9SB 2D2CC 4XTCS 1V43A 1PRTB 2NVQB 4HCEA 1XX8A 1QNKA 1I50B 4CKCA 1SAPA 1HCZA 3TBIB 1RD9D 1EWCA 1EY8A 1IL8A 3KK7A 4DAVA 2F4IA 3NK9A 3D6CA 5G3LD 5JOBA 2OT2A 2FHTA 2Z4IA 3KLSX 2A5HA 1TS4A 4KKUA 1KNEA 2R6GA 3GTLB 4ZYSA 1RCVD 4XDXA 4G7OC 1EEID 2L11A 3L3OC 1CM9A 2Z4HA 5I4DA 4YIJA 2LS01 1OXXK 2PZUA 4RA8A 3GTGB 1R9TB 2JYOA 1PDQA 4A3EB 4BA1I 4ABNA 1EU4A 2QKIC 5I2YA 1SYGA 3K5MA 2FINB 2EY1A 4EVOA 1IYUA 1QOHA 1GUWA 4RHRA 1RF2D 3A54A 5CGKA 3LWEA 1EIGA 4FYDA 4Y7NB 3KF8A 3R2TA 2CVRA 3T16A 1EY6A 3D3RA 2PQEA 3TP8A 2ZXOA 3D4DA 1FNUA 5IOCA 4A93B 1EL0A 5FKAC 4S3SA 3R3OA 2EJMA 1C4QA 3DXJC 3SHLA 3MXUA 1XWEA 5FK9C 1Z7TA 2IWHA 3HOYB 1CTMA 4M1UB 1Y8PB 2KJXA 4F7XA 4QB4A 2F1MA 3HOVB 4ILWA 3SR1A 4KMUC 4G7ZC 1IKMA 3TP7A 2JSOA 1B4OA 3A8IE 4C3IG 2EY5A 1D6EC 1YNJC 4HSVA 1EYDA 1IW7C 2IX1A 4KY5A 2QEJC 4PV1C 1QNUA 3H91A 3C46A 2D62A 2EY2A 4OL7A 3PO3B 1KDAA 3I3CA 2F0QA 1PRTD 3BDLA 4BS9A 1NR2A 3H94A 3S1MB 1DJRD 3TZDA 3I72A 4F88A 5ELBA 2L1BA 5E3FA 4A3GB 3CHBD 1SNMA 1EFID 4J6HA 1Y69U 4KN4C 1HA5A 1V1PA 1H9RA 3DWAA 5M5XB 4KI0A 2MP1A 5C4XB 2A6HC 2B2TC 1HUNA 1UEAB 2Z8LA 1CA5A 3D4RA 5C3XA 3X3NA 1LTRD 1AEXA 2RKSA 3HZXA 4ZUIA 3V05A 1FNWA 3E0JA 3S17B 3TDQA 1WTQA 4AYBB 2PW7A 1EY0A 4A3IB 4Z9CB 2PCFB 1TKWB 2M2LA 2IL8A 1A6XA 1OO9B 3FVQA 1Q1EA 1J9OA 3K7AB 2HQEA 1IYVA 2E76C 3KBGA 1FGBD 3D8GA 5ISRA 3GTJB 4ZK9B 3OIPA 4ZQ3A 1QG7A 4R9WA 2X69A 1B44D 1OXTA 1G2TA 4RCOA 1SNDA 1DD2A 1PXUA 4H0LC 1CK1A 2I07B 2LMCB 1D1KA 3I90A 2B2TA 2HDLA 1STNA 2XVSA 1G291 1KTKA 2M00A 5CR3A 3MVVA 2KCCA 4Q0FA 2EPBA 3NWTA 2IX0A 1X3PA 1JWUD 2K33A 5C3WA 3VR4A 3KLSA 3BYYB 3TSSA 1LT6D 3SXHA 1ENAA 5KYIA 3C1EA 1I6VC 1EY4A 1KDCA 2F0WA 3DHQA 2WACA 1Z47A 1JB3A 1B2TA 4F87A 3DWPA 2XWBB 3DM1A 2WB1B 3G7LA 3TP5A 2O2LD 3FRPB 1S5DD 4DK1A 2BOSA 3J81L 2ZXPA 2A68D 1DONA 2JA8B 1YNNC 4EGVA 2RDGA 5I6YA 1D5ZC 1DM0B 3PUXA 3UI2A 2EDGA 4K5XA 1STGA 1DXMA 1ILPA 4EQPA 4ME5A 3CQZB 1STYA 5C0XH 4R8IA 1Q3LA 5LL6S 5CC4A 3I4NB 1HQRD 1K8OA 2EOTA 3MTSA 4G4KA 1U9RA 4RGNA 1TY2A 1II3A 1QILA 4K6DA 1XXGA 4TSSA 3MFGA 1UNSA 1LLRD 1G8ZD 5IGDA 1VF5C 3V96A 4NDXA 3NE5B 4NP5A 2EJGC 1F9SA 1RDPD 4ZKBB 5E4WC 5JEAJ 5D14A 4FXGC 5C0XG 1PFNA 2Q8TA 5CV6A 3T4AC 5KEEA 3VYSA 4RGMA 4H13C 2MGSA 2CW0C 3MWYW 3I4LA 4XYOA 3GV6A 1DOMA 1ENCA 2IX3A 4HCSA 5EBDA 1TY0A 5JPMC 3J80E 1WVLA 4C3HG 4IQZA 4KD3A 2EYOA 4PMBA 5J1ZA 3K59A 3C3LA 2WINB 4HN7A 3O13A 2PNRC 2O4XA 3KLRA 1BXTA 1S5FD 4GZYC 3HP3A 3SDZA 3LNNA 1TS2A 2BCOA 3ONAB 1EY7A 4IFDH 1B9MA 5C0XI 1B1ZA 1SNQA 4O1NA 2K5DA 2EE1A 5C4JB 3OWFA 5J39A 1BCPC 1NR4A 4TRDA 1E2WA 4QIWB 5TSSA 1RODA 2IPKD 5J22A 1H9KA 4PQXA 4IFDG 3FPPA 5C5LA 2DN8A 1JOKA 5DAUA 1BQQT 5D3DA 3NSWA 1T5XD 4U68A 1LABA 2K5QA 2F0GA 4BBRB 2E75C 1A2TA 4UDUC 3T51B 1O7ZA 1FD7D 5BN4A 3TP6A 4FF2A 2KHSA 3QG1A 1F9QA 3CKIB 3QOLA 4DF7A 2F0OA 2PPBC 2F0NA 1GHJA 5LHY1 3W3AA 4IFDI 3R8BA 4HMIA 1SXTA 1A2UA 1GUSA 3N52A 1PZJD 2QCPX 1EIHA 2NWGA 1VDZA 3FEWX 4A3MB 5EGTA 5ELCA 5KNBA 3GTPB 3NBHA 1M4VA 1SNOA 2X6LA 1WTPA 1EWHA 1LT3D 2EYMA 3GQBA 3K6OA 4CKBA 1TIID 1L0XB 5EPJA 2LFNA 2R61A 5M5WB 4RFBA 4ZLTF 4ZUJA 1UAPA 3QJYA 1GXDC 2PO4A 2JA7B 4C2MB 5FOBB 2NUCA 1ESRA 4C56C 2A6ED 2RSOA 2K28A 3J7AV 3QOJA 5HURA 1WD1A 4DU9A 2K6AA 1CFMA 2B8FA 2K7VA 1HA6A 1HPCA 4DNRB 2R3ZA 1PTOC 3A8KE 1F2ZA 2PZWA 5I2XA 1SDFA 3K58A 4K2LA 3IKJA 4XQQA 1E2VA 4A3BB 3W2DA 2F0HA 4DXFA 1I4GA 3GTKB 3J7AF 1PFBA 4A3FB 1STHA 3P7JA 1A3VA 4HTHA 1WTWA 1BDOA 1BO0A 4QMGA 1JORA 2BDNA 3QB3A 4L6TB 2JEAI 5IGCA 4KN7C 2Q8RE 3MEHA 2DNCA 2WP8J 4LMQD 3KBXA 4OIJA 2WKCA 4X3UA 4C1NK 2K01A 4K6LA 1PLFA 4DA2A 3H3VC 1HHVA 4R8NA 1PRTC 1ET6A 1LV9A 4PNYA 1TR5A 4HAEA 3JAML 4BA2I 1I3QB 3QO2A 3S16B 5KGUA 2A69D 3QWNA 3NTHA 2E2DC 2XN9C 4X3TA 4C3JB 3I73A 2JXMB 3EQLC 1HTLD 2PYKA 2KA7A 1SE4A 3Q6SA 4CHTB 3U9SA 4M8AA 1HXYD 4RHSA 4XXEA 1CQFA 4A3DB 3ND8A 5IT9E 1BCPF 3HG9A 3RZDB 3HRZC 2L5TA 1DZ1A 1JOQA 2F0JA 4PMWA 4I65A 2NBFA 3GP7A 4B9XA 1H9MA 4WJWA 2ZT9C 2KUMA 5FLXE 3OPOA 1H9SA 1NUCA 3OIQA 3H09A 3MHBA 3MFYA 4IALA 1WTRA 2EXZA 5C44B 2NVXB 3MXNA 1C8CA 1HRJA 2EYFA 1KLGD 3S2DB 2IJ0A 3RZOB 4B9WA 2QF7A 2C5CA 4CJ0B 1RKNA 1WTOA 2V4DA 3ITPA 5DM63 2IW3A 2F0PA 3NPPA 5IGGA 2AUJD 2F0MA 2LY7A 2KCNA 4C3IB 3NTIA 4RGTA 1KDBA 5LL6X 3EROA 3URYA 4DFAA 1STEA 4FNFA 1SE2A 3J80L 1CZWA 3Q22A 3NP8A 3EFXD 4HR7B 1HFGA 4ULLA 2L4NA 4E6IA 4RKLA 2SNMA 1PMRA 1JC7A 2AQ2B 4JK1C 3NQTA 1I6HB 1IKLA 3VA5A 2G9HD 2H4OA 4IUVA 3MZ5A 4QCLA 4G7HC 1GUGA 1K8MA 1AZQA 1JOOA 1QWYA 1G6ZA 1A3TA 5KRUA 5JVG3 3M4YA 3OMGA 1PYWD 2NTTA 3SK4A 1PTOF 2A68C 3M4OB 3NBIA 1EQVA 1D5XC 1YNJD 2PZTA 3E5SA 1IW7D 5JVH3 4TKOB 5IODA 4B08A 1RTOA 1I4PA 1G2SA 3PUWA 2NN6H 3PUZA 5C5MA 3S1RB 3IFTA 1BUVT 2I46A 2DY8A 1WCMB 3EJIA 1KAAA 5EQ0A 1Q8IA 3K5NA 4I7ZC 3Q24A 1B9NA 3P75A 1CQVA 5FO8B 1NSNS 2JEBI 1JWMD 2WAQB 1RTNA 2A6HD 2RBMA 2RQXA 2NN6G 2J0TD 5I9PA 3JAME 1CI3M 2E2JB 1PRTF 1FYCA 1AFPA 2XRQD 2A74C 1EY9A 2XWJB 3BVMA 2PW5A 2DY7A 1I4RA 3DWQA 1I4XA 2CQAA 3HEJA 1O80A 1O78A 5EKLA 4XT3B 5KYLA 2AWNA 2SOBA 2BE5D 5D3IB 3RD4A 2EJFC 2F3WA 1Y1VB 1SJED 4DAPA 5ELEA 4X3SA 3A8JE 3I91A 2NN6I 2JP1A 1QCBD 1D1IA 4IUQA 1NAPA 4FXKC 2FMMA 1TU2B 1GUNA 2BA0A 1ZXTA 1XTCD 3BDCA 5EBCA 1K83B 1STAA 4X3KA 3GTMB 5ELFA 4RGOS 3EA6A 1KABA 1WD0A 2RDFA 1O7YA 3AB9A 2XRSD 3VR6A 4HMJA 2KVMA 2KQ3A 2EYJA 2PMZB 4RWSC 1OXVA 3S1NB 4FO2A 1UUPA 1U4MA 1CZGA 4H44C 3S14B 2RDHA 1GUOA 1SYDA 1SMYD 4CJ1B 3GTQB 5C6AA 4OGQC 5JJZA 3H6MA 4KK7A 3DMUA 1SYCA 4H7BA 5CORA 5JPNC 3LX0A 4U673 1I4QA 2E74C 4TQUS 1U4LA 4L63B 4V190 2AQ3B 2DNEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KJO A;  3NXW A;  3OWF A;  3HEJ A;  5M9O A;  2PYK A;  1SYB A;  3C1F A;  4K8I A;  3SR1 A;  4E6I A;  1EY8 A;  4RKL A;  5J39 A;  5IGC A;  2SNM A;  2NUC A;  4KD4 A;  3SK6 A;  4K5X A;  2F0I A;  4NKL A;  3D8G A;  3NK9 A;  5ISR A;  1STG A;  3D6C A;  5EKL A;  3NQT A;  5JOB A;  3TP7 A;  4RKB A;  3S9W A;  1F2M A;  2F0T A;  3D4W A;  5KYL A;  5I6W A;  1SYE A;  1TQO A;  2SOB A;  4TRD A;  4ME5 A;  2EY5 A;  4ZQ3 A;  3VA5 A;  4EQP A;  4KY7 A;  5IGB A;  1EZ6 A;  1STY A;  5J22 A;  3MZ5 A;  4QF4 A;  1EYD A;  5JAV A;  3QOJ A;  2F3W A;  5HUR A;  4DU9 A;  2ENB A;  4KY5 A;  2SNS A;  5CC4 A;  2EYL A;  5C5L A;  1SND A;  2EY6 A;  1JOK A;  1U9R A;  1EYC A;  4KJN A;  1II3 A;  3SK5 A;  5DAU A;  5IGE A;  1IHZ A;  4K6D A;  2EY2 A;  4LAA A;  4OL7 A;  4YIJ A;  1F2Y A;  1JOO A;  1F2Z A;  4IUN A;  1KDA A;  2PZW A;  1STN A;  1A3T A;  3V2T A;  2F0L A;  2PZU A;  5IGF A;  2F0Q A;  4F8M A;  5KRU A;  3BDL A;  5EKK A;  3OMG A;  2F0G A;  4K2L A;  5IGD A;  5CV4 A;  2M00 A;  4DGZ A;  1JOQ A;  2F0J A;  3SK4 A;  4I65 A;  5CR3 A;  3MVV A;  1A2T A;  4NDX A;  4B9X A;  4NP5 A;  1EQV A;  4PMC A;  3EVQ A;  1SYG A;  5KIX A;  5E3F A;  2PZT A;  3E5S A;  4G57 A;  5E1F A;  2LKV A;  4WRD A;  2EY1 A;  2F0F A;  3BDC A;  2F0H A;  4K2K A;  1SNM A;  1STA A;  3TP6 A;  5F2D A;  5IOD A;  1EY5 A;  4J6H A;  4ODG A;  4EVO A;  5C4Z A;  2KHS A;  5C3W A;  4J1M A;  5CV6 A;  1STH A;  1A3V A;  4HTH A;  2F3V A;  5KEE A;  4KV6 A;  3SXH A;  3QOL A;  5C5M A;  4DF7 A;  2F0O A;  1NUC A;  5CGK A;  3NUC A;  1ENA A;  3SK8 A;  5KYI A;  4QMG A;  2OEO A;  1KAB A;  5IIF A;  1JOR A;  2F0N A;  3MHB A;  2RDF A;  4WOR A;  3QB3 A;  4EQN A;  3C1E A;  5I9O A;  1A3U A;  4HMJ A;  4K14 A;  4IAL A;  1EY4 A;  1ENC A;  2EXZ A;  3EJI A;  2KQ3 A;  1EYA A;  1EY6 A;  1KAA A;  2EYJ A;  4HMI A;  3T16 A;  5C3X A;  2PQE A;  4K8J A;  3TP8 A;  2EYF A;  1KDC A;  2F0W A;  4ID6 A;  5K5P A;  3DHQ A;  4EQO A;  2WAC A;  4N9T A;  1EZ8 A;  3P1H A;  4B9W A;  3P75 A;  3MEH A;  1A2U A;  1AEX A;  1NSN S;  2RKS A;  3NHH A;  3D4D A;  3HZX A;  3MXP A;  4KD3 A;  2EYO A;  1RKN A;  2EYH A;  2QDB A;  4PMB A;  5CV7 A;  5CV5 A;  5J1Z A;  5C4H A;  3ITP A;  5CV8 A;  5IOC A;  1SYD A;  2O4X A;  4S3S A;  2OXP A;  5EGT A;  2F0U A;  3R3O A;  5C6A A;  2F0D A;  1SYF A;  1SNP A;  2F0P A;  4R8N A;  5HGT A;  1SNO A;  2F0K A;  3OMC A;  1STB A;  3H6M A;  3TP5 A;  5IGG A;  2RBM A;  1SNC A;  2F0V A;  2F0E A;  2PW7 A;  4PNY A;  2EYM A;  5DEH A;  1TR5 A;  2F0M A;  4NMZ A;  1TT2 A;  3DMU A;  1EY0 A;  4ZUI A;  3SHL A;  5I9P A;  1SYC A;  5NUC A;  4KY6 A;  4H7B A;  1EY7 A;  2F0S A;  3PMF A;  1SNQ A;  3LX0 A;  2EYP A;  4K5W A;  5CV9 A;  4KTA A;  1KDB A;  3ERO A;  5KGU A;  1EY9 A;  2OF1 A;  4DFA A;  4IZ8 A;  4ZUJ A;  3U9O A;  2PW5 A;  3TME A;  3OSO A;  4K5V A;  4MIU A;  4F7X A;  4N9P A;  3NP8 A;  3ERQ A;  5I6Y A;  2HQE A;  4KHV A;  4QB4 A;  3T13 A;  3RUZ A; 
#chains in the Genus database with same CATH topology
 4DV6 L;  1NBW A;  4DR4 Q;  3C1F A;  4PZ6 A;  4BBR H;  2A73 B;  3CC7 A;  4DR1 Q;  2HIX A;  1WTV A;  1HJP A;  2RA4 A;  4RKB A;  3D4W A;  5IGB A;  1GUT A;  1GOZ A;  1M1K C;  3E0E A;  2QIL A;  5ELN A;  2K32 A;  1VQG A;  2YYZ A;  4XIG S;  1VMP A;  3VYT A;  3HOZ H;  5IYC H;  4HJ7 A;  2IT1 A;  2BA1 A;  1AZP A;  1SBB B;  1EFW A;  4FDB A;  2HCI A;  5M3F H;  3KDF B;  4WFN 3;  4AQY Q;  4BY1 B;  2YTY A;  4KLK A;  2FFK B;  1Y14 B;  1PTO H;  2O5J C;  3J80 i;  4BBR G;  1TWA B;  4FF3 A;  5EPL A;  2UU9 Q;  1ZKO A;  2DUD A;  3H0G B;  4PMC A;  2Q2H A;  3TQY A;  3OHX C;  5E1F A;  5IT9 L;  3KJP A;  2HHH Q;  4IJL A;  3T1Y L;  1JJC B;  3GTP H;  3HOZ G;  5IYC G;  4KV6 A;  1PHJ A;  3U58 A;  3SE0 A;  1Q12 A;  3K0Y A;  3D31 A;  5T1I A;  4BXX H;  4B3S L;  3CU7 A;  1FR3 A;  4WOR A;  1VQC A;  2A6E C;  4IUR A;  5M3F G;  2E2I B;  1JCK B;  2KHI A;  2LSS A;  5I9O A;  3AMU A;  2L12 A;  2R92 B;  3M3Y B;  1Y8N B;  3WOE A;  2Z6K C;  1CA6 A;  5C0X J;  4DK0 A;  1GM5 A;  3OW2 A;  1VMC A;  2KCT A;  1QVC A;  5FLX L;  1HNX Q;  5IWA Q;  5AFW A;  4C2M H;  1I4H A;  2DJG C;  2Y0S G;  5CV8 A;  5CBE E;  3F2U A;  2JA5 B;  2GN5 A;  1VQP A;  2F0D A;  1YJ9 A;  3OMC A;  4LFA L;  3NEN A;  1K28 A;  4GLX A;  3H3V H;  1TXY A;  3JAM c;  1MI2 A;  3IFD A;  3K5O A;  4BXX G;  3PMF A;  4X62 Q;  2F4V Q;  3N6R A;  3VYU A;  1QJO A;  2LXK A;  3L7Z C;  3SGI A;  4NXM Q;  5BN3 A;  3KF8 B;  3TME A;  4K5V A;  1U4R A;  4MIU A;  2AMC B;  1EQQ A;  3OWE B;  4KHV A;  2B8G A;  2PQA B;  4P2C B;  1EIY B;  1MHW C;  1F9P A;  2IY5 B;  3NXW A;  4APV A;  3GTO B;  2AQ1 B;  2L0C A;  2K5W A;  1X6O A;  2JA6 B;  3W1B A;  4QGU A;  4A3B H;  3TN2 A;  1F2M A;  2D9U A;  1TQO A;  4GN4 B;  3KJO A;  2J7Z A;  2Y0S E;  1YJN A;  3GTL H;  4A3F H;  5KND A;  4NXN L;  1S72 A;  1T5E A;  1PFM A;  4LJZ C;  1XNQ Q;  1V1O A;  3PUV A;  4DNT B;  4KJN A;  4DV4 Q;  1CT1 D;  4JI6 L;  1LAC A;  4NW2 A;  3GTG H;  1R9T H;  3T53 B;  2GA4 B;  4V0B A;  2B2Y C;  5E4X A;  3HKZ B;  4EQ5 A;  1DOK A;  4TVA B;  1K0S A;  3I8Z A;  2Z6K A;  4IFD J;  2TMP A;  2R93 B;  4YCV A;  4A3B G;  2LKV A;  4WRD A;  4R4I A;  2D0O A;  4L5R C;  3S2H B;  4RH6 A;  1ZYR D;  5COY A;  1EY5 A;  1Q86 C;  4DV6 Q;  4A3F G;  4AIM A;  1JJG A;  4HJ9 A;  5IIF A;  4RCN A;  4EQN A;  1Z6H A;  1A3U A;  3S16 H;  3VYR A;  2ZM6 Q;  1PH2 A;  4K8J A;  4RAU C;  4IUT A;  2AHO B;  4EQO A;  4C3J H;  1EZ8 A;  4JI3 L;  4DV3 Q;  1VQ5 A;  1S5E D;  1NE3 A;  1D7Q A;  4DK6 C;  4UY8 C;  4OHJ A;  3J7Y W;  2SEB D;  2MJ8 A;  1WOC A;  2K1B A;  1O7L A;  2XGT A;  1STB A;  4IOC A;  4YWK A;  1KNA A;  3HOY H;  3M4P A;  1MGS A;  1V1P B;  4KY6 A;  2CHB D;  3E9I A;  3X3M A;  1AW7 A;  5EKI A;  4PG3 A;  1TWC B;  2EYP A;  4LK1 C;  1SEB D;  1N8R C;  1HTP A;  3J80 c;  3HOU B;  3OSO A;  3HOV H;  2YU9 B;  4QQB X;  1WTX A;  1IBM L;  1M8A A;  1DOL A;  5C3E B;  3RUZ A;  4C3J G;  2VUM B;  4A3K B;  3NWS A;  1VQF A;  1LT5 D;  4B3S Q;  1MD2 D;  2GVA A;  4BBS B;  1FGU A;  3SK6 A;  2B2Y A;  4KD4 A;  3K57 A;  4FXD A;  4OON A;  1JE4 A;  1Q1B A;  2K75 A;  2KED A;  2JE6 I;  4Q5V A;  5H1S E;  3HOY G;  3RLF A;  3HOX B;  2ALY B;  4DAY A;  1I5F A;  2OQK A;  3PO3 H;  4DV0 L;  4MNO A;  1PYS B;  3LWU A;  5IGE A;  4XYQ A;  4Y52 H;  3HOV G;  3WDN A;  2NB0 A;  4IUN A;  2CH4 A;  1MBY A;  3S1M H;  1B53 A;  3BS1 A;  3M7N A;  1LTG D;  4DV1 L;  4F8M A;  4GNX B;  4FF1 A;  2PQA A;  2Q2T A;  1ML0 D;  3ER0 A;  4BWG B;  5CBA E;  4OXP A;  4A3G H;  1P16 A;  3AQQ A;  1VQM A;  2VB2 X;  1Q90 A;  3S15 B;  1WFQ A;  4O2D A;  5F2D A;  5C4X H;  5LMU L;  2B39 A;  3CME A;  1B8A A;  2F3V A;  1YIT A;  1PTO D;  1EUJ A;  2J4X A;  5JJI A;  1TS5 A;  3PO3 G;  3HGB A;  3STB D;  5M5Y B;  1GHK A;  4L5S A;  2F03 A;  2OCE A;  4DV2 Q;  4NXN Q;  1TWF B;  4A3G G;  3NTK A;  1X32 A;  3NHH A;  5CV7 A;  3S17 H;  5CV5 A;  5C4H A;  1F77 A;  4DNI A;  1HZA A;  1XYI A;  3K5L A;  1DGS A;  5EJW A;  4A3I H;  5C4X G;  1SLJ A;  2F0K A;  3A7L A;  1SNC A;  1JWS D;  2B3G A;  1CHP D;  5ELD A;  5CV9 A;  1D2B A;  1D5M C;  4LUV A;  1Y1W B;  3K7A H;  5A2Q E;  5G3L F;  1KD1 C;  3L9A X;  2L9H A;  3BYT B;  1HFN A;  1EU3 A;  3UDF A;  1JB7 A;  4JW0 A;  2XNA C;  1R4Q B;  4ZKC B;  3M9B A;  1LTA D;  2EVB A;  3DEP A;  1SYB A;  3FKI B;  3RLN A;  5M9O A;  3E6Z X;  4JBW A;  4K0K Q;  3AYH B;  4AYB G;  1MSH A;  4KKT A;  4P74 A;  4OWX B;  2B2V C;  3SVM A;  3I70 A;  4KHP L;  5I6W A;  4A3I G;  4FVM A;  4JI3 Q;  4DXG A;  1ET9 A;  1B50 A;  4QF4 A;  1AE2 A;  2L55 A;  3BDO A;  4DV5 Q;  1Q81 C;  2SNS A;  2EYL A;  1XNR L;  3HS0 C;  2NYZ D;  3SK5 A;  4GLA C;  1IHZ A;  1OXS C;  1WCM H;  5IY0 A;  4JYA L;  3GO5 A;  4DR7 L;  5EKK A;  2VB3 X;  1MJE A;  3ULL A;  1AN8 A;  1L0Y B;  4L8J A;  4MTN A;  2NVT B;  3S1Q B;  2IHF A;  1PH1 A;  2C9O A;  1CHQ D;  4JI0 Q;  1IBM Q;  2KEE A;  5C4Z A;  4J1M A;  4AYB E;  1W6J A;  3VA7 A;  5JJK A;  1VF7 A;  2WKD A;  4CBV A;  1ZEQ X;  3UE0 A;  2ICI A;  4DN4 M;  2K05 A;  3CRK C;  3FDT A;  3BZC A;  4QUC A;  2E2J H;  4IOA A;  1ICW A;  1S4Z A;  2BE5 C;  1WCM G;  2FMC A;  1S40 A;  2Z6B A;  5K5P A;  1DYQ A;  3MXG A;  4N9T A;  2BDO A;  3P1H A;  3Q8D A;  1MSG A;  4A3J B;  1TS3 A;  4DV0 Q;  4LF6 L;  2UXB L;  2WAQ G;  1SNP A;  2CCZ A;  4GOP B;  1W6K A;  5FO9 B;  1QB5 D;  4DR4 L;  4DK3 C;  2F0E A;  4OEM B;  2B2V A;  3D6W A;  3LGJ A;  1TT2 A;  4DR1 L;  1Y1V H;  1PH6 A;  2B2U C;  2JA8 H;  2EZV A;  4KTA A;  4DPG A;  1RL2 A;  5JEA H;  3U9O A;  5A35 A;  1TVX A;  1K9M C;  1ESF A;  4N9P A;  3T13 A;  3E3X A;  1U4P A;  5DNF A;  2NTS A;  1TWG B;  1E1T A;  4ZAI A;  2WB1 G;  1K8G A;  4NKL A;  1VCI A;  4AQY L;  3R2I A;  3T56 B;  1C48 A;  1AP0 A;  1AH9 A;  1L1O B;  2K5N A;  4KY7 A;  1RHP A;  4L5Q A;  3L2P A;  2UU9 L;  4UAI A;  1X3F A;  1QZH A;  2WAQ E;  3MAQ A;  1KRT A;  3I4N H;  4HED A;  4JBK A;  1Y1V G;  3GTM H;  4J8Q A;  2JA8 G;  1QE6 A;  3KUP A;  2MHV A;  5J3B A;  4LF9 L;  3HOW B;  1E7Z A;  1SMY C;  2EY6 A;  3CCM A;  2LXJ A;  2HHH L;  3WOF A;  3SEB A;  4X64 L;  2D0P A;  5JEA G;  2A8V A;  1ASZ A;  4LAA A;  2ZTD A;  1EOT A;  5IGF A;  3GV3 A;  2YTV A;  4CGY B;  4DGZ A;  2UUC L;  1A0I A;  4OWT B;  3FMC A;  4MHE A;  3IAY A;  1LO5 D;  4G57 A;  1Y8O B;  3MA2 B;  5IT9 c;  3GTQ H;  2WB1 E;  3OYY A;  3A7A B;  2RVL A;  3I4N G;  2JA9 A;  1HNX L;  1SE3 A;  3TS2 A;  3JAM i;  1B7Y B;  3SK8 A;  2Z1C A;  3G6J B;  2VNU D;  2OEO A;  1X55 A;  2K5V A;  2G9D A;  2O5I C;  3CW2 C;  4QL5 A;  4K14 A;  4C1N I;  4OO1 H;  2HUG A;  2B2U A;  1Z9F A;  1PZI D;  3PGZ A;  1LTB D;  1F9R A;  1E24 A;  4XT1 B;  4OIK A;  2E2H B;  5FLX c;  3FPU B;  4LFB Q;  1LT4 D;  4IUP A;  4X62 L;  2HQL A;  5BN5 A;  1S5C D;  1LTS D;  1R4P B;  4NXM L;  3Q0A A;  1L1O C;  4IO9 A;  1FVI A;  3M7G A;  2DGY A;  3A55 A;  1H9J A;  3CC4 A;  2HDM A;  4HSP A;  2OXP A;  3CC2 A;  4JYA Q;  3GD7 A;  1MKH A;  3I56 A;  3PQI A;  4DR7 Q;  1OXU A;  3R93 A;  1EYG A;  1HR0 Q;  1E2Z A;  1BF4 A;  1HR0 W;  1C7Y A;  5NUC A;  2VXW A;  1X65 A;  4QUF A;  2H1E A;  2N88 A;  3OOC A;  5C4J H;  4CDE C;  2OF1 A;  3CXC A;  3KF6 B;  4IZ8 A;  4OO1 G;  1ENF A;  1SFO B;  2R7Z B;  3ERQ A;  5CYU A;  1YVC A;  4KJO A;  3HKS A;  3PO2 B;  1XNQ L;  2K4K A;  4JBM A;  2PMZ E;  2KOL A;  3P20 A;  1LYL A;  5DM7 3;  1ASY A;  1I94 Q;  4BY7 B;  3S9W A;  4JOI C;  2F0T A;  1X3Q A;  1SYE A;  1Q46 A;  2Q2I A;  2N8N A;  4XQJ A;  1KHI A;  1EZ6 A;  4FP5 D;  4CKE A;  2D5D A;  4XQN A;  2AWO A;  2RCF A;  5IP9 H;  5FO7 B;  2B2W C;  2ENB A;  2XIW A;  3AU7 A;  3U50 C;  1VQO A;  1BCP B;  1ONL A;  4KKS A;  1BR9 A;  3RMH A;  3E9H A;  1TWH B;  5M3M B;  1JR0 D;  1FNV A;  1HUM A;  3PV0 A;  1F2Y A;  2R92 H;  1PVO A;  2TSS A;  1MJC A;  5CV4 A;  2ID0 A;  4OO1 I;  2NVY B;  3VR2 A;  4LF5 Q;  2OTJ A;  2ZM6 L;  2I5M X;  5KIX A;  4CDF C;  3CRL C;  1SJH D;  1LTI D;  4K2K A;  4ZRZ A;  1YNN D;  1L1O A;  3BVG A;  4DV3 L;  3MC0 B;  3CMA A;  5IP9 G;  3BG3 A;  1SSO A;  4JVZ A;  5KNC A;  3PIO 3;  1A15 A;  4IN3 A;  4JV5 Q;  1EEF D;  1ILQ A;  2B63 B;  2R92 G;  1GJX A;  3PUY A;  2AUK A;  5DLQ E;  3ULJ A;  2X6G A;  3VR5 A;  5GQO A;  1J8I A;  4LUZ A;  4ID6 A;  1BNZ A;  2MNA A;  1EQT A;  1G91 A;  4LF9 Q;  4A3M H;  4C3H B;  3BZD B;  2HCC A;  4IPC A;  4X64 Q;  2QDB A;  2ZJR A;  2ICE C;  1X3E A;  3ND9 A;  1JQY D;  4HIK A;  2Q8I B;  2N55 A;  5HGT A;  4QIW E;  2UUC Q;  1SRO A;  2F0V A;  2CH4 W;  4JOI A;  5DEH A;  2P5Z X;  4NMZ A;  3ZYY X;  2F3I A;  5M5W H;  1K73 C;  1J6Q A;  4K5W A;  4O42 A;  3M85 A;  1ZYR C;  2JA7 H;  1CSQ A;  2WV6 D;  2B2W A;  1VS0 A;  1X9N A;  3RR5 A;  1DCZ A;  5EPK A;  1XTD A;  2MUY A;  3IL8 A;  3OW7 A;  2Q2U A;  1PZK D;  4A3M G;  2K03 A;  4K8I A;  3KLW A;  3NQI A;  3DEO A;  1RJT A;  1XPU A;  1BBU A;  2QW7 A;  2F0I A;  1LTT D;  1UE5 A;  3DUZ A;  2CW0 D;  2R93 H;  1PH7 A;  5T1G A;  1KLU D;  2RF4 A;  4YY3 L;  4A75 A;  4R4C A;  5JAV A;  2HT1 A;  3I4M B;  5A2Q L;  3CCQ A;  1VQ8 A;  2RSN A;  3HOZ B;  1EYC A;  1F2L A;  4EX5 A;  2JA7 G;  2QEX A;  1XPO A;  1T9H A;  1SMX A;  3KF6 A;  3Q23 A;  5M3F B;  3V2T A;  2F0L A;  2K04 A;  3PIP 3;  2RCN A;  3G48 A;  2XSC A;  1HQM C;  1JIC A;  2ZXR A;  4MN3 A;  3GTK H;  4IUU A;  1PTO B;  5AJ3 Q;  5K36 H;  3TRZ A;  3EVQ A;  2R93 G;  2MPM A;  2R7D A;  4FF4 A;  3VR3 A;  2F0F A;  2K14 A;  1VQD A;  2KEN A;  4DV2 L;  4ODG A;  2Y0S B;  4B3R L;  2KEC A;  4NB3 A;  1MIU A;  2JK8 A;  1E0B A;  4CJ2 C;  3NUC A;  3PCO B;  3BVZ A;  3K7U C;  1V1Q A;  1TWC H;  2ZJP A;  1VQK A;  1BCP D;  5D65 A;  3J81 E;  1EYA A;  4KHZ A;  2NZ1 D;  2M9V A;  1NCV A;  1B3A A;  2A69 C;  1GVP A;  2Z9H A;  4A3K H;  2WII B;  1BBX C;  4B3M L;  1BOS A;  2FJ2 A;  3C2P A;  5K36 G;  3MXP A;  3A56 A;  2EYH A;  2HD3 A;  4LNQ A;  2A1A A;  3QIA A;  3TZU A;  2F0U A;  1SYF A;  5CMD A;  4QJF A;  1UWV A;  2SDF A;  1I3Q H;  4K0K L;  1V8Q A;  1S5B D;  2F0S A;  1H9S B;  3KDF A;  2D2C C;  4DR6 L;  4XTC S;  1V43 A;  1PRT B;  2NVQ B;  3EBE A;  2DJF C;  4HCE A;  1XX8 A;  3A5U A;  1QNK A;  2FXQ A;  3RN2 A;  2PI2 A;  4DV5 L;  1I50 B;  4CKC A;  4A3K G;  2VZA A;  1EIF A;  1SAP A;  1HCZ A;  3TBI B;  1RD9 D;  1EWC A;  1A63 A;  1EY8 A;  1IL8 A;  3KK7 A;  2I0Q A;  4DAV A;  2F4I A;  3NK9 A;  2XTI A;  3D6C A;  5G3L D;  5JOB A;  2OT2 A;  2FHT A;  2F52 A;  2Z4I A;  3NEL A;  4A3D H;  3KLS X;  2A5H A;  4H02 A;  1TS4 A;  4KKU A;  3K80 C;  4OX9 Q;  3RZD H;  1GKH A;  1KNE A;  2R6G A;  3GTL B;  4ZYS A;  1RCV D;  4XDX A;  4JI0 L;  4G7O C;  4IPG A;  1EEI D;  2L11 A;  3L3O C;  1CM9 A;  2Z4H A;  5I4D A;  1KQS A;  1RIP A;  4POG A;  4YIJ A;  2LS0 1;  2VQE Q;  1OXX K;  2PZU A;  4RA8 A;  3GTG B;  1R9T B;  3ICE A;  2JYO A;  1PDQ A;  4A3E B;  1TWF H;  4BA1 I;  4ABN A;  1EU4 A;  1XMO Q;  2QKI C;  5I2Y A;  1SYG A;  3K5M A;  2FIN B;  2EY1 A;  4A3D G;  4EVO A;  1IYU A;  1QOH A;  1GUW A;  1Q8K A;  4RHR A;  1RF2 D;  3A54 A;  5CGK A;  3LWE A;  1EIG A;  4GLV B;  4FYD A;  4Y7N B;  3KF8 A;  2NVX H;  5C44 H;  3R2T A;  1KRS A;  2CVR A;  1Y1W H;  3S2D H;  3CCR A;  4YY3 Q;  3RZO H;  3T16 A;  1EY6 A;  3D3R A;  2KBN A;  2PQE A;  4P71 A;  4RMF A;  3TP8 A;  1BBW A;  1PFS A;  2ZXO A;  1WJJ A;  4LW1 A;  2I5L X;  3FKI H;  3D4D A;  1FNU A;  5IOC A;  4A93 B;  1EL0 A;  5FKA C;  1KIX A;  4S3S A;  3BZK A;  5LMN Q;  3R3O A;  3F2B A;  4JPB W;  2EJM A;  4C3I H;  5LMN W;  1VQH A;  4R4O A;  1C4Q A;  1FJG Q;  3DXJ C;  3SHL A;  3MXU A;  4YWM A;  1XWE A;  1VQA A;  5FK9 C;  4CDC C;  5IYD H;  1Z7T A;  2QDL A;  4PZ8 A;  2IWH A;  5C44 G;  2VW9 A;  1JMC A;  3HOY B;  1S3O A;  2K50 A;  1HNW Q;  2N3S A;  1CTM A;  1Y1W G;  4M1U B;  1Y8P B;  4B3R Q;  2AKW B;  2KJX A;  1YI2 A;  4F7X A;  4QB4 A;  2F1M A;  3HOV B;  3FKI G;  4ILW A;  3SR1 A;  4IPD A;  1I6H H;  4KMU C;  1N36 Q;  1QVF A;  4A3L H;  3AFP A;  4G7Z C;  1IKM A;  3TP7 A;  5FLM H;  2JSO A;  1B4O A;  3A8I E;  3ZJY C;  1GD7 A;  4C3I G;  4IJH A;  2EY5 A;  1D6E C;  4LF8 L;  1YNJ C;  4HSV A;  4LF7 Q;  1EYD A;  4B3M Q;  4JG2 A;  1IW7 C;  5IYD G;  2IX1 A;  1LM0 A;  4KY5 A;  4HID A;  2QEJ C;  4GNX C;  2L15 A;  4PV1 C;  1HZB A;  1VQJ A;  1QNU A;  3H91 A;  1HNZ Q;  3C46 A;  2D62 A;  2EY2 A;  4OL7 A;  3PO3 B;  1KDA A;  2UUB Q;  3NEM A;  3I3C A;  2F0Q A;  1PRT D;  3BDL A;  3M4O H;  4BS9 A;  1NR2 A;  3H94 A;  3S1M B;  1DJR D;  3I4O A;  3TZD A;  4DR2 Q;  4A3J H;  4DR6 Q;  3I72 A;  4A3L G;  4F88 A;  5ELB A;  2L1B A;  3TEH B;  5E3F A;  5FLM G;  3PF4 A;  4A3G B;  3CHB D;  5ELO A;  1SNM A;  4X65 L;  1EFI D;  4J6H A;  1Y69 U;  4KN4 C;  1HA5 A;  3S1R H;  1V1P A;  4DR5 Q;  4LFB L;  1H9R A;  2CKZ B;  3DWA A;  5M5X B;  4A76 A;  4KI0 A;  2MP1 A;  5GAD C;  2NZO A;  3K81 C;  5BR8 Q;  5C4X B;  2A6H C;  3KYH C;  1VQI A;  2B2T C;  1HUN A;  2H5X A;  1UEA B;  3AFQ A;  1SR3 A;  4UPA A;  1L0W A;  2Z8L A;  1WTH A;  2OTL A;  1HR0 L;  4UHV A;  1CA5 A;  3D4R A;  5C3X A;  3X3N A;  4LF4 Q;  1LTR D;  3F2D A;  4A3J G;  1AEX A;  4OWW B;  2RKS A;  2VY3 A;  1TWG H;  3HZX A;  4ZUI A;  3V05 A;  1K3R A;  1FNW A;  3E0J A;  3S17 B;  2YTX A;  3TDQ A;  1WTQ A;  4AYB B;  1UEB A;  1IZ6 A;  2PW7 A;  1EY0 A;  3W5O A;  4A3I B;  4Z9C B;  1NNX A;  1I94 L;  1HZC A;  2PCF B;  1TKW B;  2WFW A;  2M2L A;  2IL8 A;  1A6X A;  1OO9 B;  1PV4 A;  3FVQ A;  4GNX A;  5EAY A;  1Q1E A;  4J15 A;  1J9O A;  3K7A B;  2HQE A;  1IYV A;  2E76 C;  3KBG A;  3G71 A;  1FGB D;  3D8G A;  1EWI A;  1K0R A;  5ISR A;  4POF A;  3GTJ B;  4ZK9 B;  3OIP A;  4ZQ3 A;  1PH5 A;  1PYB A;  1QG7 A;  1IXR A;  2GVB A;  4QY7 A;  4R9W A;  2X69 A;  1B44 D;  4LF5 L;  1SE8 A;  3CCJ A;  1OXT A;  1G2T A;  4RCO A;  1SND A;  4A3C H;  1DD2 A;  2JN4 A;  5HY6 A;  1PXU A;  4H0L C;  1CK1 A;  2I07 B;  2LMC B;  1D1K A;  3I90 A;  2B2T A;  2HDL A;  1VQ9 A;  1STN A;  2XVS A;  1XPR A;  1G29 1;  1KTK A;  2M00 A;  3JC6 6;  5CR3 A;  3MVV A;  4GKJ L;  1KXL A;  1K83 H;  2KCC A;  4JV5 L;  4Q0F A;  4LWC A;  2EPB A;  1VQL A;  1GO3 E;  3NWT A;  2YV5 A;  2IX0 A;  1E1O A;  1X3P A;  4JI1 Q;  1JWU D;  2K33 A;  1QVG A;  3DM3 A;  5C3W A;  3VR4 A;  3KLS A;  3BYY B;  5IYB H;  3TSS A;  1LT6 D;  3CD6 A;  3SXH A;  2KHJ A;  1W3S A;  1ENA A;  1YHA A;  5KYI A;  4A3C G;  3BU2 A;  4DV7 L;  2RHS B;  4GN3 B;  3C1E A;  4LF8 Q;  5IE8 A;  3S1N H;  1I6V C;  1EY4 A;  1X56 A;  4RG1 A;  1KDC A;  2F0W A;  3S14 H;  1SFO H;  2R7Z H;  3DHQ A;  4P75 A;  2WAC A;  4GOP C;  1Z47 A;  1JB3 A;  1B2T A;  4F87 A;  3DWP A;  1NMF A;  2XWB B;  1VQN A;  3DM1 A;  1J5E Q;  3UDI A;  2WB1 B;  1A8V A;  3G7L A;  4JBJ A;  3TP5 A;  5IYB G;  2O2L D;  3FRP B;  1UE7 A;  1S5D D;  2UXD L;  4DK1 A;  2BOS A;  4MZ9 A;  3A0J A;  3J81 L;  2ZXP A;  2A68 D;  3J7A 5;  4X65 Q;  1IL2 A;  1DON A;  1HH2 P;  1CUK A;  5M3M H;  3CPW A;  3PF5 A;  1D8L A;  4L5T A;  1YNN C;  3I7F A;  4DUZ Q;  2K5H A;  2JA8 B;  1C0A A;  4EGV A;  2RDG A;  5I6Y A;  2R7Z G;  1D5Z C;  1DM0 B;  3PUX A;  3UI2 A;  2EDG A;  3D0F A;  4JC0 A;  1N34 Q;  4DAM A;  2NVY H;  2CQO A;  1QZG A;  4K5X A;  1STG A;  4I7A A;  2QA4 A;  1DXM A;  1ILP A;  3CCL A;  4EQP A;  4ME5 A;  3J7Z C;  3CQZ B;  1STY A;  5C0X H;  4R8I A;  4P73 A;  1Q3L A;  1OTC A;  1EQR A;  4A4I A;  1YBY A;  5LL6 S;  5AJ3 L;  5CC4 A;  4JI7 Q;  3I4N B;  1HQR D;  1K8O A;  2EOT A;  3MTS A;  4G4K A;  4BY1 H;  1U9R A;  4RGN A;  1TY2 A;  4YHH Q;  1II3 A;  5M3M G;  3OTO L;  1QIL A;  1YNX A;  1XXG A;  4K6D A;  1YEZ A;  3MFG A;  4TSS A;  2B63 H;  1TWA H;  1UNS A;  1LLR D;  5FJ8 H;  4B3T Q;  1G8Z D;  4CDD C;  3H0G H;  5IGD A;  4LUO A;  3T1H L;  1VF5 C;  4C3H H;  4NDX A;  3V96 A;  3NE5 B;  4NP5 A;  4X66 Q;  2EJG C;  1F9S A;  4GOP A;  1X3G A;  1RDP D;  4GS3 A;  4ZKB B;  5GAE C;  3NBH B;  5E4W C;  5JEA J;  3EN2 A;  5D14 A;  4FXG C;  5C0X G;  1PFN A;  2Q8T A;  5CV6 A;  2UXC Q;  3T4A C;  4AH6 A;  5KEE A;  3RNU A;  2E2I H;  3VYS A;  2RHQ B;  4RGM A;  3U4Z A;  1CKN B;  3B6Y A;  4H13 C;  2MGS A;  2CW0 C;  4BY1 G;  1P8L A;  3MWY W;  3I4L A;  3M3Y H;  4XYO A;  3GV6 A;  1DOM A;  1U5K A;  2B63 G;  1ENC A;  2IX3 A;  4HCS A;  5FJ8 G;  5EBD A;  3U4V A;  3H0G G;  1TY0 A;  5JPM C;  3J80 E;  1WVL A;  4C3H G;  3L0O A;  2JA5 H;  4IQZ A;  1N32 L;  4KD3 A;  2EYO A;  4PMB A;  4UP9 A;  5J1Z A;  3K59 A;  3C3L A;  2WIN B;  4HN7 A;  3G4S A;  3O13 A;  2PNR C;  2O4X A;  3KLR A;  2VL6 A;  1BXT A;  1S5F D;  3EIV A;  3WWV A;  4GZY C;  3HP3 A;  4GKJ Q;  3SDZ A;  3LNN A;  1TS2 A;  3I4M H;  2BCO A;  1QUQ B;  3ONA B;  1EY7 A;  4IFD H;  1B9M A;  5C0X I;  1B1Z A;  1SNQ A;  3AEV A;  5JJL A;  4O1N A;  4DKA C;  4OX9 L;  4N8F A;  1UE1 A;  2MO0 A;  1N33 L;  3GTO H;  2K5D A;  2EE1 A;  5C4J B;  5E7N A;  3I55 A;  1XMQ L;  2VQF L;  3OWF A;  2JA6 H;  2JA5 G;  2PI2 E;  4JI4 Q;  4O0A A;  5J39 A;  4DV7 Q;  4HIO A;  4LFC L;  2B29 A;  1BCP C;  2VQE L;  1NR4 A;  4TRD A;  1E2W A;  4QIW B;  5TSS A;  1ROD A;  2IPK D;  5J22 A;  1H9K A;  1XMO L;  4PQX A;  3MEF A;  4HJ8 A;  3I4M G;  4IFD G;  1V9P A;  3FPP A;  5GRO A;  5C5L A;  2DN8 A;  1JOK A;  5DAU A;  1BQQ T;  5D3D A;  3NSW A;  1T5X D;  4U68 A;  1IBK Q;  1LAB A;  2UXD Q;  2K5Q A;  2PNH A;  1IBL Q;  2JA6 G;  2F0G A;  4BBR B;  3S2H H;  2E75 C;  1K3B C;  1A2T A;  3F2C A;  4UDU C;  3T51 B;  1O7Z A;  1FD7 D;  5BN4 A;  3TP6 A;  2E8G A;  4FF2 A;  2KHS A;  4HJ5 A;  4JI5 Q;  3QG1 A;  1F9Q A;  3CKI B;  2OQ0 A;  4IPH A;  3QOL A;  4DF7 A;  2F0O A;  2PPB C;  2F0N A;  1GHJ A;  5LMN L;  4DAY B;  3M4Q A;  3HKZ G;  1YIJ A;  5LHY 1;  3RN5 A;  2NVQ H;  1FJG L;  3W3A A;  4IFD I;  3R8B A;  4HMI A;  1HZ9 A;  1W2B A;  1SXT A;  1I50 H;  1A2U A;  1HNW L;  1VQ6 A;  1GUS A;  2MQH A;  2E5L L;  3N52 A;  1PZJ D;  2QCP X;  3OTO Q;  1EIH A;  1CSP A;  2NWG A;  1VDZ A;  1U0L A;  3FEW X;  4A3M B;  5EGT A;  5ELC A;  2CWA A;  5KNB A;  3GTP B;  3NBH A;  1M4V A;  1SNO A;  2X6L A;  3H15 A;  1WTP A;  1EWH A;  1LT3 D;  3T1H Q;  2EYM A;  1LUZ A;  1N36 L;  3GQB A;  1NJI C;  3K6O A;  4CKB A;  1TII D;  2G5D A;  1CKN A;  3HOU H;  1L0X B;  5EPJ A;  4DR3 L;  2LFN A;  2R61 A;  2YU9 H;  5M5W B;  1YHQ A;  4RFB A;  5C3E H;  4R4Q A;  4ZUJ A;  1UAP A;  3QJY A;  4ZLT F;  1GXD C;  4DUY Q;  2VUM H;  4LF7 L;  2PO4 A;  2JA7 B;  4BBS H;  3HKZ E;  2UUA Q;  4A3E H;  4C2M B;  5FOB B;  2A19 A;  4X6A H;  1HNZ L;  2NUC A;  1ESR A;  3CF5 A;  4C56 C;  2MO1 A;  3CCV A;  4PZ7 A;  2A6E D;  2UUB L;  1KC8 C;  2RSO A;  4JI8 L;  3HOX H;  2Z0S A;  1VQB A;  3UDG A;  4DR2 L;  1N32 Q;  4WJ3 M;  2K28 A;  3J7A V;  3QOJ A;  5HUR A;  1WD1 A;  4DU9 A;  2K6A A;  1CFM A;  2B8F A;  2K7V A;  3HOU G;  1HA6 A;  1QUQ A;  1HPC A;  4Y7N H;  3DLL A;  4DNR B;  3F1Z A;  5C3E G;  2BH2 A;  2R3Z A;  2VUM G;  1PTO C;  2ASB A;  3MXN B;  4DR5 L;  3J81 i;  3A8K E;  1F2Z A;  1PH8 A;  2PZW A;  5I2X A;  4BBS G;  3H3V I;  1SDF A;  5BR8 L;  3K58 A;  2EQS A;  3STB C;  4K2L A;  4A3E G;  3IKJ A;  3S15 H;  4XQQ A;  4GKK L;  3FHW A;  1E2V A;  1VQ7 A;  4A93 H;  4A3B B;  1Q82 C;  1N33 Q;  4LF4 L;  3IRB A;  3W2D A;  2F0H A;  4DXF A;  1I4G A;  3HOX G;  1VQ4 A;  3GTK B;  1O7I A;  3TRE A;  3J7A F;  1XMQ Q;  2VQF Q;  1PFB A;  4A3F B;  1STH A;  3P7J A;  1A3V A;  4HTH A;  3ULP A;  1WTW A;  1BDO A;  1BO0 A;  1CKO A;  4LFC Q;  1EOV A;  1FL0 A;  1PH3 A;  4QMG A;  5M5Y H;  1JOR A;  2BDN A;  3QB3 A;  4NPS A;  4L6T B;  2JEA I;  5IGC A;  4KN7 C;  2JJQ A;  1JE5 A;  2MFI A;  3CPF A;  3CCU A;  3T1Y Q;  2VS1 A;  2Q8R E;  4HIM A;  3MEH A;  2DNC A;  2WP8 J;  4LMQ D;  2QGQ A;  3S24 A;  3KBX A;  3UE1 A;  1JT8 A;  4OIJ A;  2WKC A;  4X3U A;  4C1N K;  4A93 G;  2K01 A;  4K6L A;  1PLF A;  4DA2 A;  3H3V C;  1HHV A;  3KFU A;  1SRU A;  4R8N A;  1PRT C;  1C9O A;  1X54 A;  1ET6 A;  1LV9 A;  4PNY A;  1TR5 A;  4HAE A;  3JAM L;  4BA2 I;  1E22 A;  1I3Q B;  3QO2 A;  3S16 B;  5KGU A;  2A69 D;  4ZCK A;  3QWN A;  3NTH A;  2E2D C;  2XN9 C;  4X3T A;  1JJ2 A;  3F8T A;  4C3J B;  3I73 A;  2JXM B;  3EQL C;  1K8A C;  1HTL D;  4LFA Q;  2PYK A;  4JI2 L;  2KA7 A;  3PIO A;  1LTL A;  1SE4 A;  2IHE A;  3Q6S A;  4CHT B;  3U9S A;  4M8A A;  1HXY D;  4RHS A;  4XXE A;  2JQO A;  4WJ4 A;  1CQF A;  4A3D B;  3ND8 A;  5IT9 E;  2E5L Q;  5M5X H;  4UP7 A;  1BCP F;  3UDX A;  1NMG A;  3HG9 A;  2N78 A;  3RZD B;  3HRZ C;  2L5T A;  4JI1 L;  1PH9 A;  3CAM A;  1DZ1 A;  1WI5 A;  3CCS A;  2CWP A;  2NVT H;  1B3Q A;  3S1Q H;  1JOQ A;  2F0J A;  4PMW A;  4I65 A;  3K8A A;  2NBF A;  4DR3 Q;  3GP7 A;  4B9X A;  1B70 B;  5IP7 H;  1H9M A;  1NY4 A;  2ZT9 C;  4WJW A;  2KUM A;  5FLX E;  1YZ6 A;  4JI6 Q;  3OPO A;  1H9S A;  2CFM A;  1NUC A;  3OIQ A;  2BH8 A;  3H09 A;  1G6P A;  3I2Z A;  4ALP A;  3MHB A;  1J5E L;  3MFY A;  4JI8 Q;  1M90 C;  4IAL A;  1WTR A;  2EXZ A;  5C44 B;  2NVX B;  3MXN A;  1C8C A;  1HRJ A;  2EYF A;  1KLG D;  3S2D B;  2IJ0 A;  3RZO B;  4B9W A;  2QF7 A;  2C5C A;  2NZH A;  4CJ0 B;  1RKN A;  5IP7 G;  1WTO A;  2V4D A;  3ITP A;  4DUZ L;  4OEL B;  5DM6 3;  3GTJ H;  2IW3 A;  2F0P A;  2K52 A;  3NPP A;  5IGG A;  1XJV A;  1A62 A;  3PIP A;  1N34 L;  2AUJ D;  2OWO A;  2F0M A;  2LY7 A;  4GKK Q;  2KCN A;  4YCU A;  4C3I B;  3NTI A;  4RGT A;  3J81 c;  1KDB A;  5LL6 X;  3ERO A;  3URY A;  4MTK A;  4DFA A;  1STE A;  4FNF A;  1SE2 A;  3J80 L;  3HFZ B;  1CZW A;  3Q22 A;  3NP8 A;  3EFX D;  4HR7 B;  1HFG A;  4ULL A;  2L4N A;  3CP0 A;  4JI7 L;  4E6I A;  4RKL A;  2EIF A;  4YCW A;  4YHH L;  5GAG C;  2SNM A;  3CCE A;  1PMR A;  1JC7 A;  2AQ2 B;  4JK1 C;  3NQT A;  1I6H B;  1IKL A;  4B3T L;  3VA5 A;  2G9H D;  2H4O A;  4IUV A;  4P72 A;  3MZ5 A;  4QCL A;  3HOW H;  1NTG A;  4X66 L;  1N9W A;  4G7H C;  1GUG A;  1K8M A;  3KOJ A;  1AZQ A;  1KAW A;  3TS0 A;  2UXC L;  1JOO A;  1QWY A;  1G6Z A;  1A3T A;  5KRU A;  5JVG 3;  2ATW A;  3M4Y A;  3OMG A;  1PYW D;  2HIV A;  2NTT A;  3K0X A;  4JCV E;  3SK4 A;  1PTO F;  2A68 C;  3W1G A;  2C35 B;  3M4O B;  3NBI A;  4YWL A;  1EQV A;  1D5X C;  1PH4 A;  1YNJ D;  2PZT A;  3E5S A;  1G51 A;  1IW7 D;  5JVH 3;  4TKO B;  5IOD A;  4B08 A;  1RTO A;  1CKM A;  1I4P A;  1G2S A;  3HOW G;  4JI2 Q;  3PUW A;  2NN6 H;  3PUZ A;  5C5M A;  4DV1 Q;  3S1R B;  4GN5 A;  4UP8 A;  5HGQ A;  3IFT A;  1BUV T;  2I46 A;  3PSI A;  2DY8 A;  1WCM B;  4N8X 1;  3EJI A;  2E2H H;  1KAA A;  1H95 A;  5EQ0 A;  1Q8I A;  3K5N A;  4I7Z C;  3Q24 A;  1KL9 A;  1BKB A;  1B9N A;  3P75 A;  5LMU Q;  1CQV A;  5FO8 B;  1NSN S;  1YHB A;  2JEB I;  1JWM D;  2ES2 A;  3GDE A;  2WAQ B;  1RTN A;  2A6H D;  2R7F A;  3CQZ H;  2RBM A;  2RQX A;  3QR8 A;  4JI4 L;  2NN6 G;  2J0T D;  5I9P A;  4R1J A;  1L2F A;  3JAM E;  1CI3 M;  2E2J B;  1PRT F;  1FYC A;  1AFP A;  2XRQ D;  2A74 C;  1EY9 A;  2ZTC A;  2XWJ B;  3BVM A;  2PW5 A;  2DY7 A;  1I4R A;  3PO2 H;  3DWQ A;  1I4X A;  2CQA A;  3HEJ A;  1O80 A;  4BY7 H;  3RLO A;  3A74 A;  3VDY A;  1O78 A;  5EKL A;  2KCM A;  4XT3 B;  1IBK L;  5KYL A;  2AWN A;  2SOB A;  1IBL L;  2BE5 D;  5D3I B;  3RD4 A;  2EJF C;  2F3W A;  1E3P A;  1TWH H;  1Y1V B;  1SJE D;  4DAP A;  1VQE A;  3A5Z B;  5ELE A;  3FP9 A;  4X3S A;  3A8J E;  3I91 A;  5IWA L;  2NN6 I;  2JP1 A;  1QCB D;  4JI5 L;  1D1I A;  4IUQ A;  1ICF B;  3PO2 G;  1NAP A;  4FXK C;  4KHP Q;  1BVS A;  2FMM A;  1AE3 A;  4BY7 G;  1TU2 B;  1GUN A;  2BA0 A;  2V1C C;  5L37 A;  1ZXT A;  3BJU A;  1XTC D;  1XNR Q;  2F4V L;  3BDC A;  3ERS X;  5EBC A;  1K83 B;  1STA A;  1WYD A;  4X3K A;  3GTM B;  5ELF A;  4RGO S;  3J81 j;  3EA6 A;  1KAB A;  1WD0 A;  2I5H A;  2RDF A;  1O7Y A;  3AB9 A;  2XRS D;  3VR6 A;  1YJW A;  4HMJ A;  2KVM A;  2KQ3 A;  2EYJ A;  2PMZ B;  1PA6 A;  4RWS C;  1OXV A;  3S1N B;  4FO2 A;  1UUP A;  1U4M A;  1CZG A;  1SN8 A;  4H44 C;  3S14 B;  2N49 A;  2RDH A;  1GUO A;  4DUY L;  1SYD A;  1SMY D;  4CJ1 B;  3GTQ B;  4DV4 L;  2ZTE A;  5C6A A;  2UUA L;  4OGQ C;  5JJZ A;  3H6M A;  4KK7 A;  1UE6 A;  4ME3 A;  4R4T A;  2EXD A;  4HJA A;  3DMU A;  1SYC A;  4H7B A;  3G6E A;  5COR A;  1Q7Y C;  5JPN C;  3LX0 A;  1IYJ B;  5GAH C;  4U67 3;  1I4Q A;  2E74 C;  4TQU S;  1U4L A;  4L63 B;  4LF6 Q;  4V19 0;  2UXB Q;  2AQ3 B;  2ZJQ A;  2DNE A; 
#chains in the Genus database with same CATH homology
 3C1F A;  2A73 B;  1WTV A;  2RA4 A;  4RKB A;  3D4W A;  5IGB A;  1GUT A;  1GOZ A;  2QIL A;  2K32 A;  2YYZ A;  4XIG S;  1VMP A;  3VYT A;  2IT1 A;  2BA1 A;  1AZP A;  1SBB B;  2HCI A;  4WFN 3;  4BY1 B;  2FFK B;  1PTO H;  2O5J C;  1TWA B;  4FF3 A;  5EPL A;  1ZKO A;  3H0G B;  4PMC A;  3OHX C;  5E1F A;  5IT9 L;  4KV6 A;  3SE0 A;  1Q12 A;  3K0Y A;  3D31 A;  5T1I A;  3CU7 A;  1FR3 A;  4WOR A;  2A6E C;  4IUR A;  2E2I B;  1JCK B;  5I9O A;  3AMU A;  2L12 A;  2R92 B;  3M3Y B;  1Y8N B;  3WOE A;  1CA6 A;  5C0X J;  4DK0 A;  1VMC A;  5FLX L;  5AFW A;  1I4H A;  5CV8 A;  5CBE E;  3F2U A;  2JA5 B;  2F0D A;  3OMC A;  1MI2 A;  3IFD A;  3K5O A;  3PMF A;  3N6R A;  3VYU A;  1QJO A;  3L7Z C;  5BN3 A;  3TME A;  4K5V A;  1U4R A;  4MIU A;  3OWE B;  4KHV A;  2B8G A;  4P2C B;  1F9P A;  3NXW A;  3GTO B;  2AQ1 B;  2L0C A;  2K5W A;  2JA6 B;  3TN2 A;  1F2M A;  2D9U A;  1TQO A;  2J7Z A;  5KND A;  1T5E A;  1PFM A;  4LJZ C;  1V1O A;  4DNT B;  3PUV A;  4KJN A;  1CT1 D;  1LAC A;  4NW2 A;  3T53 B;  2GA4 B;  4V0B A;  2B2Y C;  5E4X A;  3HKZ B;  1DOK A;  3I8Z A;  4IFD J;  2TMP A;  2R93 B;  2LKV A;  4WRD A;  3S2H B;  4RH6 A;  1ZYR D;  5COY A;  1EY5 A;  5IIF A;  4RCN A;  4EQN A;  1Z6H A;  1A3U A;  3VYR A;  4K8J A;  4RAU C;  4IUT A;  4EQO A;  1EZ8 A;  1S5E D;  4OHJ A;  3J7Y W;  2SEB D;  2MJ8 A;  2K1B A;  1O7L A;  1STB A;  1KNA A;  1MGS A;  1V1P B;  4KY6 A;  2CHB D;  3X3M A;  1AW7 A;  5EKI A;  1TWC B;  2EYP A;  4LK1 C;  1SEB D;  1HTP A;  3HOU B;  3OSO A;  2YU9 B;  1WTX A;  1M8A A;  1DOL A;  5C3E B;  3RUZ A;  4C3J G;  2VUM B;  4A3K B;  3NWS A;  1LT5 D;  1MD2 D;  4BBS B;  3SK6 A;  2B2Y A;  4KD4 A;  3K57 A;  4FXD A;  1JE4 A;  1Q1B A;  2KED A;  2JE6 I;  4Q5V A;  3RLF A;  3HOX B;  4DAY A;  3LWU A;  5IGE A;  4XYQ A;  3WDN A;  2NB0 A;  4IUN A;  1MBY A;  1B53 A;  3BS1 A;  3M7N A;  1LTG D;  4F8M A;  4FF1 A;  1ML0 D;  4BWG B;  5CBA E;  2VB2 X;  1Q90 A;  3S15 B;  5F2D A;  2B39 A;  2F3V A;  1PTO D;  2J4X A;  1TS5 A;  3HGB A;  5M5Y B;  1GHK A;  2F03 A;  1TWF B;  3NTK A;  1X32 A;  3NHH A;  5CV7 A;  5CV5 A;  5C4H A;  1F77 A;  1XYI A;  3K5L A;  5EJW A;  3A7L A;  2F0K A;  1SNC A;  1JWS D;  1CHP D;  5ELD A;  5CV9 A;  1D2B A;  1D5M C;  1Y1W B;  5A2Q E;  5G3L F;  3L9A X;  2L9H A;  3BYT B;  1HFN A;  1EU3 A;  2XNA C;  1R4Q B;  4ZKC B;  1LTA D;  3DEP A;  2EVB A;  3FKI B;  1SYB A;  5M9O A;  3E6Z X;  4JBW A;  1MSH A;  4KKT A;  2B2V C;  3SVM A;  3I70 A;  5I6W A;  4FVM A;  4DXG A;  1ET9 A;  1B50 A;  4QF4 A;  2L55 A;  3BDO A;  2SNS A;  2EYL A;  3HS0 C;  2NYZ D;  3SK5 A;  1IHZ A;  1OXS C;  3GO5 A;  5EKK A;  2VB3 X;  1AN8 A;  1L0Y B;  4L8J A;  2NVT B;  3S1Q B;  2C9O A;  1CHQ D;  2KEE A;  5C4Z A;  4J1M A;  3VA7 A;  1W6J A;  1VF7 A;  2WKD A;  4CBV A;  1ZEQ X;  2ICI A;  4DN4 M;  2K05 A;  3CRK C;  3FDT A;  4QUC A;  1ICW A;  1S4Z A;  2BE5 C;  2FMC A;  5K5P A;  1DYQ A;  3MXG A;  4N9T A;  2BDO A;  3P1H A;  1MSG A;  4A3J B;  1TS3 A;  1SNP A;  1W6K A;  5FO9 B;  1QB5 D;  2F0E A;  2B2V A;  3D6W A;  1TT2 A;  2B2U C;  2EZV A;  4KTA A;  5JEA H;  3U9O A;  5A35 A;  1TVX A;  1ESF A;  4N9P A;  3T13 A;  1U4P A;  5DNF A;  2NTS A;  1TWG B;  4ZAI A;  4NKL A;  1VCI A;  3R2I A;  3T56 B;  1C48 A;  1AP0 A;  4KY7 A;  1RHP A;  4UAI A;  3MAQ A;  4HED A;  4J8Q A;  1QE6 A;  3KUP A;  2MHV A;  3HOW B;  1SMY C;  2EY6 A;  3WOF A;  3SEB A;  5JEA G;  4LAA A;  1EOT A;  5IGF A;  3GV3 A;  4CGY B;  4DGZ A;  3FMC A;  4MHE A;  3IAY A;  1LO5 D;  4G57 A;  1Y8O B;  3MA2 B;  3A7A B;  2RVL A;  1SE3 A;  3SK8 A;  2Z1C A;  3G6J B;  2VNU D;  2OEO A;  2G9D A;  2O5I C;  4K14 A;  4C1N I;  4OO1 H;  2HUG A;  2B2U A;  1PZI D;  1LTB D;  1F9R A;  4XT1 B;  4OIK A;  2E2H B;  3FPU B;  1LT4 D;  4IUP A;  5BN5 A;  1S5C D;  1LTS D;  1R4P B;  3Q0A A;  3M7G A;  3A55 A;  1H9J A;  2HDM A;  4HSP A;  2OXP A;  3GD7 A;  1OXU A;  3R93 A;  1E2Z A;  1BF4 A;  5NUC A;  2VXW A;  4QUF A;  2H1E A;  2N88 A;  3OOC A;  2OF1 A;  4IZ8 A;  4OO1 G;  1ENF A;  1SFO B;  2R7Z B;  3ERQ A;  5CYU A;  4KJO A;  3PO2 B;  2KOL A;  3P20 A;  5DM7 3;  4BY7 B;  3S9W A;  2F0T A;  1X3Q A;  1SYE A;  4XQJ A;  1EZ6 A;  4FP5 D;  4CKE A;  2D5D A;  4XQN A;  2AWO A;  5FO7 B;  2B2W C;  2ENB A;  2XIW A;  3AU7 A;  1BCP B;  1ONL A;  4KKS A;  1BR9 A;  3RMH A;  1TWH B;  5M3M B;  1JR0 D;  1FNV A;  1HUM A;  3PV0 A;  1F2Y A;  2TSS A;  5CV4 A;  2ID0 A;  4OO1 I;  2NVY B;  3VR2 A;  5KIX A;  3CRL C;  1SJH D;  1LTI D;  4K2K A;  4ZRZ A;  1YNN D;  3BVG A;  3MC0 B;  3BG3 A;  1SSO A;  5KNC A;  3PIO 3;  1A15 A;  4IN3 A;  1EEF D;  1ILQ A;  2B63 B;  1GJX A;  3PUY A;  2AUK A;  3VR5 A;  2X6G A;  1J8I A;  4ID6 A;  1BNZ A;  1EQT A;  1G91 A;  4C3H B;  3BZD B;  2HCC A;  2QDB A;  2ICE C;  3ND9 A;  1JQY D;  2Q8I B;  2N55 A;  5HGT A;  2F0V A;  5DEH A;  4NMZ A;  3ZYY X;  4K5W A;  4O42 A;  3M85 A;  1ZYR C;  2WV6 D;  2B2W A;  1DCZ A;  5EPK A;  2MUY A;  3IL8 A;  3OW7 A;  1PZK D;  2K03 A;  4K8I A;  3NQI A;  3DEO A;  1RJT A;  2F0I A;  1LTT D;  3DUZ A;  2CW0 D;  5T1G A;  1KLU D;  5JAV A;  3I4M B;  5A2Q L;  2RSN A;  3HOZ B;  1EYC A;  1F2L A;  3Q23 A;  5M3F B;  3V2T A;  2F0L A;  2K04 A;  3PIP 3;  2XSC A;  1HQM C;  1JIC A;  2ZXR A;  4MN3 A;  4IUU A;  1PTO B;  5K36 H;  3EVQ A;  2MPM A;  4FF4 A;  3VR3 A;  2F0F A;  4ODG A;  2Y0S B;  2KEC A;  1E0B A;  4CJ2 C;  3NUC A;  3BVZ A;  1BCP D;  5D65 A;  3J81 E;  1EYA A;  4KHZ A;  2NZ1 D;  2M9V A;  1B3A A;  1NCV A;  2A69 C;  2WII B;  1BBX C;  1BOS A;  2FJ2 A;  3C2P A;  5K36 G;  3MXP A;  3A56 A;  2EYH A;  3QIA A;  3TZU A;  2F0U A;  1SYF A;  5CMD A;  2SDF A;  1V8Q A;  1S5B D;  2F0S A;  1H9S B;  2D2C C;  4XTC S;  1V43 A;  1PRT B;  2NVQ B;  4HCE A;  1XX8 A;  1QNK A;  1I50 B;  4CKC A;  1SAP A;  1HCZ A;  3TBI B;  1RD9 D;  1EWC A;  1EY8 A;  1IL8 A;  3KK7 A;  4DAV A;  2F4I A;  3NK9 A;  3D6C A;  5G3L D;  5JOB A;  2OT2 A;  2FHT A;  2Z4I A;  3KLS X;  2A5H A;  1TS4 A;  4KKU A;  1KNE A;  2R6G A;  3GTL B;  4ZYS A;  1RCV D;  4XDX A;  4G7O C;  1EEI D;  2L11 A;  3L3O C;  1CM9 A;  2Z4H A;  5I4D A;  4YIJ A;  2LS0 1;  1OXX K;  2PZU A;  4RA8 A;  3GTG B;  1R9T B;  2JYO A;  1PDQ A;  4A3E B;  4BA1 I;  4ABN A;  1EU4 A;  2QKI C;  5I2Y A;  1SYG A;  3K5M A;  2FIN B;  2EY1 A;  4EVO A;  1IYU A;  1QOH A;  1GUW A;  4RHR A;  1RF2 D;  3A54 A;  5CGK A;  3LWE A;  1EIG A;  4FYD A;  4Y7N B;  3KF8 A;  3R2T A;  2CVR A;  3T16 A;  1EY6 A;  3D3R A;  2PQE A;  3TP8 A;  2ZXO A;  3D4D A;  1FNU A;  5IOC A;  4A93 B;  1EL0 A;  5FKA C;  4S3S A;  3R3O A;  2EJM A;  1C4Q A;  3DXJ C;  3SHL A;  3MXU A;  1XWE A;  5FK9 C;  1Z7T A;  2IWH A;  3HOY B;  1CTM A;  4M1U B;  1Y8P B;  2KJX A;  4F7X A;  4QB4 A;  2F1M A;  3HOV B;  4ILW A;  3SR1 A;  4KMU C;  4G7Z C;  1IKM A;  3TP7 A;  2JSO A;  1B4O A;  3A8I E;  4C3I G;  2EY5 A;  1D6E C;  1YNJ C;  4HSV A;  1EYD A;  1IW7 C;  2IX1 A;  4KY5 A;  2QEJ C;  4PV1 C;  1QNU A;  3H91 A;  3C46 A;  2D62 A;  2EY2 A;  4OL7 A;  3PO3 B;  1KDA A;  3I3C A;  2F0Q A;  1PRT D;  3BDL A;  4BS9 A;  1NR2 A;  3H94 A;  3S1M B;  1DJR D;  3TZD A;  3I72 A;  4F88 A;  5ELB A;  2L1B A;  5E3F A;  4A3G B;  3CHB D;  1SNM A;  1EFI D;  4J6H A;  1Y69 U;  4KN4 C;  1HA5 A;  1V1P A;  1H9R A;  3DWA A;  5M5X B;  4KI0 A;  2MP1 A;  5C4X B;  2A6H C;  2B2T C;  1HUN A;  1UEA B;  2Z8L A;  1CA5 A;  3D4R A;  5C3X A;  3X3N A;  1LTR D;  1AEX A;  2RKS A;  3HZX A;  4ZUI A;  3V05 A;  1FNW A;  3E0J A;  3S17 B;  3TDQ A;  1WTQ A;  4AYB B;  2PW7 A;  1EY0 A;  4A3I B;  4Z9C B;  2PCF B;  1TKW B;  2M2L A;  2IL8 A;  1A6X A;  1OO9 B;  3FVQ A;  1Q1E A;  1J9O A;  3K7A B;  2HQE A;  1IYV A;  2E76 C;  3KBG A;  1FGB D;  3D8G A;  5ISR A;  3GTJ B;  4ZK9 B;  3OIP A;  4ZQ3 A;  1QG7 A;  4R9W A;  2X69 A;  1B44 D;  1OXT A;  1G2T A;  4RCO A;  1SND A;  1DD2 A;  1PXU A;  4H0L C;  1CK1 A;  2I07 B;  2LMC B;  1D1K A;  3I90 A;  2B2T A;  2HDL A;  1STN A;  2XVS A;  1G29 1;  1KTK A;  2M00 A;  5CR3 A;  3MVV A;  2KCC A;  4Q0F A;  2EPB A;  3NWT A;  2IX0 A;  1X3P A;  1JWU D;  2K33 A;  5C3W A;  3VR4 A;  3KLS A;  3BYY B;  3TSS A;  1LT6 D;  3SXH A;  1ENA A;  5KYI A;  3C1E A;  1I6V C;  1EY4 A;  1KDC A;  2F0W A;  3DHQ A;  2WAC A;  1Z47 A;  1JB3 A;  1B2T A;  4F87 A;  3DWP A;  2XWB B;  3DM1 A;  2WB1 B;  3G7L A;  3TP5 A;  2O2L D;  3FRP B;  1S5D D;  4DK1 A;  2BOS A;  3J81 L;  2ZXP A;  2A68 D;  1DON A;  2JA8 B;  1YNN C;  4EGV A;  2RDG A;  5I6Y A;  1D5Z C;  1DM0 B;  3PUX A;  3UI2 A;  2EDG A;  4K5X A;  1STG A;  1DXM A;  1ILP A;  4EQP A;  4ME5 A;  3CQZ B;  1STY A;  5C0X H;  4R8I A;  1Q3L A;  5LL6 S;  5CC4 A;  3I4N B;  1HQR D;  1K8O A;  2EOT A;  3MTS A;  4G4K A;  1U9R A;  4RGN A;  1TY2 A;  1II3 A;  1QIL A;  4K6D A;  1XXG A;  4TSS A;  3MFG A;  1UNS A;  1LLR D;  1G8Z D;  5IGD A;  1VF5 C;  3V96 A;  4NDX A;  3NE5 B;  4NP5 A;  2EJG C;  1F9S A;  1RDP D;  4ZKB B;  5E4W C;  5JEA J;  5D14 A;  4FXG C;  5C0X G;  1PFN A;  2Q8T A;  5CV6 A;  3T4A C;  5KEE A;  3VYS A;  4RGM A;  4H13 C;  2MGS A;  2CW0 C;  3MWY W;  3I4L A;  4XYO A;  3GV6 A;  1DOM A;  1ENC A;  2IX3 A;  4HCS A;  5EBD A;  1TY0 A;  5JPM C;  3J80 E;  1WVL A;  4C3H G;  4IQZ A;  4KD3 A;  2EYO A;  4PMB A;  5J1Z A;  3K59 A;  3C3L A;  2WIN B;  4HN7 A;  3O13 A;  2PNR C;  2O4X A;  3KLR A;  1BXT A;  1S5F D;  4GZY C;  3HP3 A;  3SDZ A;  3LNN A;  1TS2 A;  2BCO A;  3ONA B;  1EY7 A;  4IFD H;  1B9M A;  5C0X I;  1B1Z A;  1SNQ A;  4O1N A;  2K5D A;  2EE1 A;  5C4J B;  3OWF A;  5J39 A;  1BCP C;  1NR4 A;  4TRD A;  1E2W A;  4QIW B;  5TSS A;  1ROD A;  2IPK D;  5J22 A;  1H9K A;  4PQX A;  4IFD G;  3FPP A;  5C5L A;  2DN8 A;  1JOK A;  5DAU A;  1BQQ T;  5D3D A;  3NSW A;  1T5X D;  4U68 A;  1LAB A;  2K5Q A;  2F0G A;  4BBR B;  2E75 C;  1A2T A;  4UDU C;  3T51 B;  1O7Z A;  1FD7 D;  5BN4 A;  3TP6 A;  4FF2 A;  2KHS A;  3QG1 A;  1F9Q A;  3CKI B;  3QOL A;  4DF7 A;  2F0O A;  2PPB C;  2F0N A;  1GHJ A;  5LHY 1;  3W3A A;  4IFD I;  3R8B A;  4HMI A;  1SXT A;  1A2U A;  1GUS A;  3N52 A;  1PZJ D;  2QCP X;  1EIH A;  2NWG A;  1VDZ A;  3FEW X;  4A3M B;  5EGT A;  5ELC A;  5KNB A;  3GTP B;  3NBH A;  1M4V A;  1SNO A;  2X6L A;  1WTP A;  1EWH A;  1LT3 D;  2EYM A;  3GQB A;  3K6O A;  4CKB A;  1TII D;  1L0X B;  5EPJ A;  2LFN A;  2R61 A;  5M5W B;  4RFB A;  4ZLT F;  4ZUJ A;  1UAP A;  3QJY A;  1GXD C;  2PO4 A;  2JA7 B;  4C2M B;  5FOB B;  2NUC A;  1ESR A;  4C56 C;  2A6E D;  2RSO A;  2K28 A;  3J7A V;  3QOJ A;  5HUR A;  1WD1 A;  4DU9 A;  2K6A A;  1CFM A;  2B8F A;  2K7V A;  1HA6 A;  1HPC A;  4DNR B;  2R3Z A;  1PTO C;  3A8K E;  1F2Z A;  2PZW A;  5I2X A;  1SDF A;  3K58 A;  4K2L A;  3IKJ A;  4XQQ A;  1E2V A;  4A3B B;  3W2D A;  2F0H A;  4DXF A;  1I4G A;  3GTK B;  3J7A F;  1PFB A;  4A3F B;  1STH A;  3P7J A;  1A3V A;  4HTH A;  1WTW A;  1BDO A;  1BO0 A;  4QMG A;  1JOR A;  2BDN A;  3QB3 A;  4L6T B;  2JEA I;  5IGC A;  4KN7 C;  2Q8R E;  3MEH A;  2DNC A;  2WP8 J;  4LMQ D;  3KBX A;  4OIJ A;  2WKC A;  4X3U A;  4C1N K;  2K01 A;  4K6L A;  1PLF A;  4DA2 A;  3H3V C;  1HHV A;  4R8N A;  1PRT C;  1ET6 A;  1LV9 A;  4PNY A;  1TR5 A;  4HAE A;  3JAM L;  4BA2 I;  1I3Q B;  3QO2 A;  3S16 B;  5KGU A;  2A69 D;  3QWN A;  3NTH A;  2E2D C;  2XN9 C;  4X3T A;  4C3J B;  3I73 A;  2JXM B;  3EQL C;  1HTL D;  2PYK A;  2KA7 A;  1SE4 A;  3Q6S A;  4CHT B;  3U9S A;  4M8A A;  1HXY D;  4RHS A;  4XXE A;  1CQF A;  4A3D B;  3ND8 A;  5IT9 E;  1BCP F;  3HG9 A;  3RZD B;  3HRZ C;  2L5T A;  1DZ1 A;  1JOQ A;  2F0J A;  4PMW A;  4I65 A;  2NBF A;  3GP7 A;  4B9X A;  1H9M A;  4WJW A;  2ZT9 C;  2KUM A;  5FLX E;  3OPO A;  1H9S A;  1NUC A;  3OIQ A;  3H09 A;  3MHB A;  3MFY A;  4IAL A;  1WTR A;  2EXZ A;  5C44 B;  2NVX B;  3MXN A;  1C8C A;  1HRJ A;  2EYF A;  1KLG D;  3S2D B;  2IJ0 A;  3RZO B;  4B9W A;  2QF7 A;  2C5C A;  4CJ0 B;  1RKN A;  1WTO A;  2V4D A;  3ITP A;  5DM6 3;  2IW3 A;  2F0P A;  3NPP A;  5IGG A;  2AUJ D;  2F0M A;  2LY7 A;  2KCN A;  4C3I B;  3NTI A;  4RGT A;  1KDB A;  5LL6 X;  3ERO A;  3URY A;  4DFA A;  1STE A;  4FNF A;  1SE2 A;  3J80 L;  1CZW A;  3Q22 A;  3NP8 A;  3EFX D;  4HR7 B;  1HFG A;  4ULL A;  2L4N A;  4E6I A;  4RKL A;  2SNM A;  1PMR A;  1JC7 A;  2AQ2 B;  4JK1 C;  3NQT A;  1I6H B;  1IKL A;  3VA5 A;  2G9H D;  2H4O A;  4IUV A;  3MZ5 A;  4QCL A;  4G7H C;  1GUG A;  1K8M A;  1AZQ A;  1JOO A;  1QWY A;  1G6Z A;  1A3T A;  5KRU A;  5JVG 3;  3M4Y A;  3OMG A;  1PYW D;  2NTT A;  3SK4 A;  1PTO F;  2A68 C;  3M4O B;  3NBI A;  1EQV A;  1D5X C;  1YNJ D;  2PZT A;  3E5S A;  1IW7 D;  5JVH 3;  4TKO B;  5IOD A;  4B08 A;  1RTO A;  1I4P A;  1G2S A;  3PUW A;  2NN6 H;  3PUZ A;  5C5M A;  3S1R B;  3IFT A;  1BUV T;  2I46 A;  2DY8 A;  1WCM B;  3EJI A;  1KAA A;  5EQ0 A;  1Q8I A;  3K5N A;  4I7Z C;  3Q24 A;  1B9N A;  3P75 A;  1CQV A;  5FO8 B;  1NSN S;  2JEB I;  1JWM D;  2WAQ B;  1RTN A;  2A6H D;  2RBM A;  2RQX A;  2NN6 G;  2J0T D;  5I9P A;  3JAM E;  1CI3 M;  2E2J B;  1PRT F;  1FYC A;  1AFP A;  2XRQ D;  2A74 C;  1EY9 A;  2XWJ B;  3BVM A;  2PW5 A;  2DY7 A;  1I4R A;  3DWQ A;  1I4X A;  2CQA A;  3HEJ A;  1O80 A;  1O78 A;  5EKL A;  4XT3 B;  5KYL A;  2AWN A;  2SOB A;  2BE5 D;  5D3I B;  3RD4 A;  2EJF C;  2F3W A;  1Y1V B;  1SJE D;  4DAP A;  5ELE A;  4X3S A;  3A8J E;  3I91 A;  2NN6 I;  2JP1 A;  1QCB D;  1D1I A;  4IUQ A;  1NAP A;  4FXK C;  2FMM A;  1TU2 B;  1GUN A;  2BA0 A;  1ZXT A;  1XTC D;  3BDC A;  5EBC A;  1K83 B;  1STA A;  4X3K A;  3GTM B;  5ELF A;  4RGO S;  3EA6 A;  1KAB A;  1WD0 A;  2RDF A;  1O7Y A;  3AB9 A;  2XRS D;  3VR6 A;  4HMJ A;  2KVM A;  2KQ3 A;  2EYJ A;  2PMZ B;  4RWS C;  1OXV A;  3S1N B;  4FO2 A;  1UUP A;  1U4M A;  1CZG A;  4H44 C;  3S14 B;  2RDH A;  1GUO A;  1SYD A;  1SMY D;  4CJ1 B;  3GTQ B;  5C6A A;  4OGQ C;  5JJZ A;  3H6M A;  4KK7 A;  3DMU A;  1SYC A;  4H7B A;  5COR A;  5JPN C;  3LX0 A;  4U67 3;  1I4Q A;  2E74 C;  4TQU S;  1U4L A;  4L63 B;  4V19 0;  2AQ3 B;  2DNE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...