4IPDA

Structure of the n-terminal domain of rpa70, e100r mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipdA00
4YY3L 1VQOA 1EYGA 3G4SA 4JYAQ 2DUDA 3F8TA 3BJUA 3MXNB 4QGUA 4IJHA 1OXSC 4A3FH 1X54A 4R4QA 4PZ7A 4HJ7A 1P8LA 2I0QA 2UUCQ 4ALPA 1KAWA 4BY1G 3FP9A 2VW9A 4DR1Q 1LYLA 1UE1A 1A0IA 4JI4L 1T9HA 3AQQA 3CMAA 1YI2A 1E3PA 2VL6A 2DGYA 1XNQL 4B3RL 1MJEA 1Q81C 4LF4Q 1U0LA 1HNXL 4TQUS 1PH2A 2R6GA 1VQDA 2Q2IA 4L5SA 4EQ5A 5ELOA 1CUKA 1HNZQ 3GTKH 4IJLA 3TREA 1VQMA 4UP8A 2ES2A 3CCQA 2HT1A 4NXMQ 3T1YQ 1SFOH 2OTJA 3STBC 1B7YB 3PV0A 4BY7G 1ASZA 1Q82C 5E7NA 3S1MH 4GKKL 3K7AH 4LFAQ 2PQAB 1XMOL 2UXCQ 2JK8A 2A8VA 4GKKQ 3UDXA 3S17H 2AMCB 3KJPA 4OO1G 4OX9Q 1GO3E 4JI0Q 3TS0A 4DR4L 1VQHA 1JT8A 4X66L 1PH9A 4PZ6A 3EN2A 2B63G 3KYHC 2UXBQ 1PYBA 3F2DA 4OWWB 1KHIA 2ZM6Q 1UE6A 4P75A 2E5LQ 4LF4L 4LFBQ 2N8NA 4B3RQ 1XNQQ 5GROA 2YTXA 4LUOA 5C44H 3CCRA 1K73C 3JC66 5IYDH 1WOCA 3A74A 4JI5Q 4KHPQ 2KCTA 2K5HA 3IRBA 4DR1L 1SRUA 4BY7H 2D0PA 3KF8B 3LGJA 4POFA 1NJIC 4YCWA 4JOIC 1M90C 2UU9Q 2JQOA 4A3DG 2R92G 3RZOH 4JI5L 3H15A 5FLXc 3PUZA 1IXRA 1P16A 3J7ZC 2KBNA 2CCZA 2PI2A 2ZM6L 2LSSA 2MQHA 1GKHA 2UXBL 1RIPA 3HOXG 5C44G 1VQ9A 4JI0L 5M5WH 5LMNL 2NZOA 5JJKA 3I4NH 1WCMH 3W1BA 4O2DA 1QZHA 3S16H 1H95A 3PUXA 4YWLA 1XMOQ 3K0XA 1IBLQ 4BY1H 1X3GA 4A75A 3AFQA 2Z6KA 1VQ5A 1JJCB 5LMNQ 3UDFA 1VQIA 2N78A 3T1YL 4HIMA 1YNXA 3S1RH 3H3VI 4IPDA 4LUVA 2R7DA 4LFCL 1G291 4QJFA 1YZ6A 2KHJA 1AH9A 3HOXH 3ERSX 4XTCS 1SLJA 4DKAC 2Z0SA 2VNUD 2D0OA 1EOVA 3KJOA 1UEBA 1PA6A 4GLVB 3KF6B 2K50A 4JI4Q 3GTGH 1NMGA 1S72A 4IFDI 1WCMG 2F4VQ 3GO5A 4JBJA 4A3KH 2UUCL 4YHHL 4C2MH 5C4JH 3AFPA 4DAMA 4P71A 4DPGA 1JB7A 4PZ8A 5HGQA 4YY3Q 3T1HQ 1BVSA 4DV1Q 4IPGA 3KOJA 1NY4A 3K80C 4A76A 3CC4A 4HJAA 1S40A 4P73A 3ZJYC 2KCMA 2F3IA 1QZGA 4DK6C 1WI5A 2HIVA 1K3RA 3L2PA 5JEAG 1HH2P 1VQLA 1SN8A 1L0WA 4WJ3M 5GAGC 4OO1I 2V1CC 1X55A 3EIVA 1NMFA 3JAMi 2UXCL 4FDBA 1B8AA 4A3EG 2E2HH 2HQLA 2OTLA 1VQPA 4LFAL 1EIYB 2BA1A 4GOPB 3GTQH 1MKHA 2JA7H 4UPAA 4NXML 3GTLH 4A3CH 1DGSA 1XJVA 5FJ8H 5LMUL 1HNZL 3DLLA 3PO2G 1HNXQ 1HZBA 2ID0A 4LWCA 4QQBX 4KLKA 4GS3A 4JI8L 4YWKA 1PH8A 2VZAA 2MO1A 2YTYA 2RHSB 3NENA 4B3TQ 1SE8A 4DR5Q 4A3GH 5M5XH 4R4IA 2R93H 3L7ZC 5IP9G 1TWAH 2UUBQ 1A63A 4A93G 1PFSA 4JG2A 4A3EH 2CQOA 1NE3A 4DV5Q 3RLFA 1SMXA 1Z9FA 1G51A 4LF9Q 3CCVA 3I7FA 3U58A 4NPSA 2JE6I 1PH1A 3I4OA 4A3BH 1J6QA 5M5YH 3I55A 1YJNA 2JA5G 4DV6Q 2K4KA 4AIMA 2VQEQ 4LF7L 1Y1WH 1CKNB 4JC0A 4LW1A 1E1TA 1XNRQ 4JBWA 4A3CG 1K9MC 3CQZH 4RG1A 4DV7Q 3PO3G 3PO2H 5FLMH 4ME3A 4DV3Q 1PYSB 3TRZA 3PUVA 3UE1A 5J3BA 2YYZA 1RL2A 5IWAQ 5C0XJ 4JI3Q 3CCSA 1Y1VG 1XPUA 4DR6Q 1N34L 2C35B 5IP7G 4A3GG 4WJ4A 5IYCG 4DV4Q 3WWVA 4X65L 3RN5A 1Y14B 2ZTCA 3CF5A 2Y0SE 4DUZQ 3AEVA 5DLQE 1I50H 2BA0A 1D7QA 3KF6A 3ER0A 1S3OA 1GVPA 2Z6KC 4L5QA 2ATWA 1C7YA 4RMFA 5C4XH 2L15A 4UP7A 3ULLA 4A3FG 1YIJA 1JJGA 2VS1A 4DAYB 2QGQA 4IOCA 1A8VA 1SROA 3RZDH 3G6EA 1HZ9A 3W1GA 5HY6A 3F2BA 1K83H 3EBEA 1YITA 4C3IH 1MJCA 3M4PA 2UUAL 4NXNQ 4IFDJ 4AQYQ 1CSPA 4OXPA 2WP8J 4JOIA 4BXXG 3CD6A 4DK3C 1SR3A 1QVGA 3S2HH 4GNXB 1YJWA 2PI2E 1VQAA 3CMEA 4B3SL 4JI7L 3HOVH 2VUMG 1OXTA 3KDFA 3AYHB 1Q86C 1FJGQ 5EAYA 3D0FA 2I5HA 1EFWA 4AH6A 1IBKL 4JI2L 4YWMA 1N36Q 3A5UA 1CSQA 1HNWL 1PH7A 2HHHQ 2ZJPA 2R7ZH 1GM5A 1FL0A 1VQBA 2VY3A 2CWAA 3PIOA 2MNAA 3CXCA 2K5VA 5IE8A 5IT9c 2GVAA 3CPFA 1EIFA 3GTPH 3M9BA 3K81C 4JI1Q 4LF8L 1TWGH 1A62A 1CKMA 2R93G 4B3MQ 3F1ZA 1KD1C 2H5XA 3CC7A 1EUJA 2R7FA 4DR3Q 3TS2A 5GAHC 4MTNA 1VQ8A 2JA5H 4IOAA 4QY7A 1VCIA 4DV2Q 4GN5A 1I94Q 4LF5Q 3OTOL 3M4QA 4X64Q 1X56A 4BBSG 1BBWA 1Q1BA 1CKNA 1L1OC 1W3SA 1X65A 2GN5A 2IHFA 2BH8A 1VQFA 4XIGS 3STBD 3CCJA 5BR8Q 1CKOA 2EXDA 5ELNA 4POGA 3RR5A 1QVFA 2ALYB 2AWOA 3G71A 1KRSA 4DR7Q 4LF6Q 1IBMQ 1FGUA 4R4CA 1V43A 3J81j 1AE2A 2VQFL 1V1QA 4YCUA 4DV0L 3H3VH 3A5ZB 2E2IH 1WYDA 3CAMA 2IT1A 1XMQL 1HZCA 5GQOA 1JE5A 4P72A 1Z47A 1JMCA 1E1OA 1QUQB 4P74A 3HOZH 3GTJH 5M3FH 2ZJQA 2N3SA 1N32L 2WFWA 4UP9A 3CP0A 2K14A 2QA4A 1J5EL 1HR0L 1L1OA 3HFZB 3CC2A 3S2DH 5K36G 4X62Q 1X6OA 4HIOA 2IX0A 4BXXH 2PMZE 2JA8H 5AJ3Q 1KC8C 3PUWA 5IYDG 5H1SE 4JI6L 2B3GA 3MEFA 1VQNA 2K75A 3PF5A 4GNXA 4A3KG 4PMWA 3S1NH 3GTOH 4A3DH 1XTDA 3OTOQ 3JAMc 4GN3B 4LF5L 3KDFB 4JI6Q 3TEHB 4A4IA 4Y52H 1UE7A 1I5FA 2Y0SG 1LTLA 3UDIA 4JV5Q 2K5NA 4BA2I 2LXKA 5AJ3L 1FVIA 2YU9H 5C3EG 2UXDL 2EQSA 3CCEA 2YTVA 2E2JH 4GKJL 2JA6G 4DUYQ 3M85A 2ZJRA 3S14H 3U4VA 2PQAA 3PCOB 2JA9A 1E22A 3M7NA 4IPHA 1OXUA 5IYBH 3PSIA 4GOPC 1VQ6A 2WB1E 1VQKA 4DV6L 1HNWQ 1N36L 3FHWA 4BBSH 4A3MH 3Q8DA 3U4ZA 2Q2UA 4JBMA 3I2ZA 1TWHH 3H0GG 2WAQG 1Q7YC 1YHQA 1N33Q 2XTIA 1YVCA 4L5TA 2OCEA 1EWIA 4DUYL 3I4MH 5JJIA 2VQFQ 2OWOA 3G48A 2MO0A 3J7A5 4A3JG 4LF6L 2NVQH 1X9NA 3J81c 1IYJB 3PIPA 4DR2Q 1PH3A 4L5RC 4AQYL 4JV5L 1QVCA 3ULJA 5BR8L 2UUAQ 3F2CA 1PV4A 1GD7A 3GTMH 1VQ4A 3KLWA 4UY8C 1UE5A 2IY5B 3CCLA 1VS0A 2NVYH 3TQYA 3U50C 1IZ6A 4X64L 4HJ5A 3UDGA 2NVXH 3UE0A 2R92H 1YHAA 4R4OA 3OYYA 1QUQA 2E8GA 4DR2L 4DR3L 2QEXA 1BBUA 4X65Q 3BZKA 4A3IG 1OXVA 2NN6I 4TVAB 2F52A 1HR0Q 1VQEA 1N33L 1K0RA 3RN2A 1Y1VH 5GAEC 1N32Q 2RHQB 2RF4A 4JCVE 5IWAL 4HJ8A 1M1KC 5IYCH 1LUZA 2A19A 1PVOA 3RLOA 2JA7G 2JEAI 1HZAA 1YBYA 4YCVA 4APVA 1R9TH 2JJQA 3PF4A 4DNIA 4HIDA 1PH5A 4B3SQ 2NVTH 1LM0A 5C0XI 1N9WA 4GKJQ 1IBML 3HOUG 1PHJA 5C3EH 2B63H 4DR7L 2UXDQ 1ASYA 5M3MG 3ICEA 1WFQA 4GLAC 1TWCH 4AYBG 3GDEA 1XPOA 4BA1I 2JA6H 4A3IH 3S15H 1D8LA 2ZTDA 3S24A 4JI8Q 1KRTA 1X3EA 5IYBG 4HIKA 1HJPA 4MZ9A 1JJ2A 2OQKA 2HIXA 3K8AA 1I94L 4A3LH 4A3BG 1IL2A 3H0GH 3K7UC 2BH2A 4OWXB 2VUMH 1KIXA 3M4OH 3RNUA 2AWNA 1VQJA 4LNQA 2I5MX 1C9OA 4DUZL 4B3ML 5IY0A 4GN4B 4KHZA 1YHBA 1TXYA 2CKZB 2CWPA 5M3MH 4X62L 1K8GA 2AKWB 4JI1L 3HOYH 4R1JA 1J5EQ 2D62A 2LXJA 1OXXK 4BBRG 4O0AA 4JI3L 1EQQA 1BKBA 4GOPA 5JJLA 5IP7H 3L0OA 3I4NG 2HHHL 1OTCA 2WAQE 1TWFH 4JI2Q 4DV7L 1PH4A 1B70B 4LUZA 2JEBI 3BZCA 4EX5A 1XMQQ 1XNRL 1UWVA 1AE3A 3HKZG 2ASBA 5C4XG 1Q1EA 2OQ0A 4DV0Q 4JI7Q 3T1HL 1L2FA 5FJ8G 2K52A 2KENA 4DV5L 1KQSA 3FKIG 1X3FA 4LF9L 4X6AH 1YEZA 3SGIA 1WJJA 3E9IA 2UUBL 3HOYG 1Q46A 1XPRA 2IHEA 1I6HH 1KXLA 4B3TL 3NEMA 4BBRH 3M3YH 5JEAJ 2MFIA 4K0KL 4IPCA 1VQCA 1Q8KA 3BU2A 4C3JH 4LFCQ 4A93H 4IO9A 4HJ9A 3GD7A 4DV2L 3NBHB 2RCNA 2N49A 5LMUQ 2GVBA 2FXQA 3I56A 3ULPA 3HOVG 1Y1WG 3HOUH 5LMNW 4DV4L 3FKIH 2IX1A 2R7ZG 3PO3H 5FLMG 3NELA 4LF8Q 4IFDG 1C0AA 3HOZG 5M3FG 1N34Q 4JYAL 3B6YA 3D31A 1NBWA 3CCMA 4R4TA 3KFUA 1EQRA 3HKZE 4DV3L 1K8AC 1IBKQ 3J80c 2ZTEA 1VQ7A 3CW2C 1FJGL 3RLNA 4Y7NH 5GADC 4A3LG 1VQGA 2VQEL 3W5OA 2YV5A 3J80i 1E24A 4AYBE 1YJ9A 2CFMA 4YHHQ 3OW2A 2EIFA 4K0KQ 2UU9L 1G6PA 4MNOA 4NXNL 1O7IA 4DR5L 3HOWH 4KHPL 3VDYA 5C0XG 4KI0A 2B29A 1NTGA 1U5KA 1PH6A 4QL5A 2KHIA 5IP9H 1I3QH 4H02A 2E5LL 4LFBL 4OWTB 4C3HH 2F4VL 1V9PA 1W2BA 4JBKA 4GLXA 4X66Q 2NN6G 2A1AA 3A0JA 4QIWE 1N8RC 4DR4Q 4GNXC 4OX9L 3PGZA 2Q2HA 1HR0W 3S1QH 3HKSA 1IBLL 2NZHA 1KL9A 2Q2TA 4A3MG 4DR6L 3CPWA 3E9HA 3DM3A 4J15A 1E7ZA 4PG3A 3I4MG 2I5LX 4NB3A 2AHOB 3CCUA 1Q12A 4A3JH 3HOWG 2JA8G 3E0EA 3J81i 2XGTA 2PNHA 1MIUA 2WB1G 1L1OB 4OONA 4DV1L 3PUYA 4LF7Q
chains in the Genus database with same CATH superfamily
3KBXA 2F0PA 2F0EA 3DM1A 3F8TA 4ZCKA 3HOVH 2B2YA 4IJHA 4R4QA 3DMUA 2UUCQ 5IGFA 4ALPA 1KAWA 5J39A 3FP9A 2VW9A 4DR1Q 3GTGB 4A3KB 1XNQL 1WTXA 1HNXL 2EYMA 3OSOA 1JC7A 5C6AA 3CCQA 2HT1A 4ZAIA 2SOBA 3HGBA 4BY7G 1LTTD 5E7NA 2PQAB 1QE6A 2BCOA 3A8IE 1ENCA 1JT8A 1VQHA 4Q0FA 2B63G 1EY0A 3QO2A 2X6LA 1KHIA 3MTSA 4P75A 4LF4L 4HTHA 2N8NA 4B3RQ 2CVRA 3OIPA 3CCRA 1BQQT 1EZ8A 1MSHA 3JC66 4JI5Q 5IYDH 1D1KA 2KCTA 2SNSA 3IRBA 4QUFA 1HUNA 3R2IA 4YCWA 4M1UB 1EY4A 3PMFA 3RZOH 4JI5L 3H15A 5G3LD 5FLXc 1IXRA 4HCSA 1EOTA 1K28A 4KHVA 2E2IB 3LWUA 5EKIA 4H7BA 5LMNL 3HOYB 1PLFA 3I4NH 5JJKA 4CDDC 3W1BA 5EPJA 3K0XA 4XQNA 1X3GA 2E75C 2B2UC 1VQ5A 1PFNA 1JJCB 1TWFB 3UDFA 1VQIA 1WVLA 1I50B 5E4WC 4XT3B 1KNEA 2LS01 4IPDA 1CA5A 4LUVA 2BE5D 4LFCL 3HOXH 1H9RA 3ERSX 4DKAC 2D0OA 1SDFA 2D2CC 3KF6B 1NMGA 1WCMG 4C3IB 3GV3A 4A3KH 2UUCL 3H94A 3A55A 4C3JB 4A93B 4DV1Q 2L0CA 1NY4A 1W6KA 1BCPD 1HPCA 3K80C 1ZYRD 4HJAA 3TP6A 4HEDA 2JN4A 4R9WA 3ZJYC 1SFOB 3FEWX 3NPPA 2IWHA 2DJFC 3L2PA 5FO7B 3FPPA 4J1MA 5GAGC 4CGYB 2K33A 2UXCL 1IW7D 3FRPB 4FDBA 4A3EG 4LFAL 2Y0SB 1MBYA 2HUGA 2L12A 1GUSA 2NVQB 1DGSA 5TSSA 4C56C 2Z8LA 3LX0A 1JOKA 4JI8L 2MO1A 3TZUA 4A3GH 1SE8A 4N9TA 2R93H 3L7ZC 1TWAH 1O7LA 4A93G 1ICWA 4K2KA 3CCVA 1PRTD 1EEFD 4HMJA 4NPSA 1PH1A 1I3QB 4LF7L 1YJNA 2F4VL 1M8AA 4AIMA 2B2WA 1CKNB 4U68A 2F03A 1E1TA 1DONA 3PIO3 3KLSX 2NTSA 2HDLA 3PO3G 4IUPA 3PO2H 5FLMH 4DV3Q 3MXGA 3TRZA 1GUOA 1BOSA 1Y1VG 1SEBD 5IP7G 1SYGA 3WWVA 2PZTA 5DLQE 1I50H 2EYHA 4LMQD 4MHEA 2ATWA 2Z6KC 4RMFA 1YIJA 3S15B 1V1PB 2EOTA 1SSOA 3J80L 2B8FA 3RZDH 4A3FB 3W1GA 1YITA 1TT2A 2L1BA 3M4PA 4A3DB 2CH4A 4AQYQ 1CSPA 2V4DA 4QCLA 3G6JB 4JOIA 1V1OA 4BXXG 1SR3A 2F0FA 1Y8PB 2EJFC 3SXHA 1VQAA 1YJWA 4B3SL 4JI7L 2VUMG 1QJOA 2PO4A 3KDFA 3NSWA 1FJGQ 2AUKA 5EAYA 1N36Q 1PH7A 2R7ZH 1VQBA 2CWAA 2XVSA 5IE8A 2GVAA 3FPUB 3CPFA 3GTPH 4JI1Q 4DNTB 3VR2A 1TWGH 4PV1C 3F1ZA 3CC7A 1YNND 1LT3D 4MTNA 2JA5H 3EQLC 2LMCB 4GN5A 3MFGA 4BBSG 1BBWA 2NUCA 1STGA 1AFPA 1L1OC 1W3SA 4ZUJA 1VQFA 3STBD 2B2TC 2EXDA 5ELNA 4ULLA 4POGA 4IN3A 2AWOA 3QJYA 5M5YB 1ILQA 1FGUA 3H3VH 1TR5A 1Y1WB 1AE2A 1K8MA 4DV0L 1EWHA 3A5ZB 1Q8IA 4KKUA 2E2IH 3MA2B 4QF4A 4HSVA 3PO3B 5CORA 2F0LA 1XWEA 4IUVA 3C46A 4P74A 1Z6HA 2ZJQA 1N32L 2K5QA 2WFWA 4DA2A 3J81E 2QA4A 1F9RA 1DYQA 3CC2A 1CHQD 4BWGB 4X62Q 4GZYC 1D1IA 1LT5D 4O1NA 3BG3A 1WTPA 2QDLA 4B9XA 1KC8C 3L3OC 3EVQA 4DU9A 3FMCA 5H1SE 3SE0A 3K57A 2K75A 4A3KG 4A3DH 4GN3B 5CBAE 3TZDA 1RD9D 3KDFB 2Y0SG 1LTLA 5EGTA 4CKEA 2PQEA 4CJ0B 2YU9H 3H0GB 2UXDL 2EQSA 2QILA 4C3HG 2E2JH 1ONLA 1WTRA 4XQJA 2JA9A 4K5VA 3M7NA 4V190 4IPHA 3PSIA 3K0YA 3K59A 5EJWA 1F2ZA 2KEEA 3H0GG 5KGUA 5JJIA 3G48A 3J7A5 4A3JG 2AUJD 1DOMA 1MI2A 2F0GA 4O42A 4JV5L 3F2CA 1UE5A 4RHRA 4KD3A 3TQYA 1F77A 3CRLC 1VMCA 1NR2A 5C5LA 3OYYA 4DR2L 4KV6A 4A3IG 2F0UA 2NN6I 3FKIB 4H44C 3K7AB 1Y1VH 3NE5B 5IWAL 5T1GA 3ND9A 1LT6D 4KD4A 1KTKA 1YBYA 5HGTA 1R9TH 4DNIA 4B3SQ 4Y7NB 5C0XI 1IBML 1CZGA 1IL8A 4GLAC 4FF2A 2JA6H 4BA1I 1W6JA 4N8FA 2FJ2A 2CH4W 1HCZA 5JPMC 1LTAD 1MD2D 1X3EA 5IYBG 5FLXL 1TS3A 4HIKA 2OQKA 1DOKA 2XWBB 4IUNA 3K7UC 2VUMH 4OWXB 1PZJD 2B2VC 1YHBA 1TXYA 4U673 5M3MH 4NW2A 3BVZA 1OXXK 4BBRG 5JJZA 5JJLA 4A3MB 1B1ZA 1D5MC 2X69A 4JI2Q 1PH4A 1B70B 2EY5A 3BZCA 4LUZA 4B08A 4IURA 1Q1EA 3QIAA 2KA7A 4HMIA 1L2FA 3I70A 1YEZA 3MVVA 5CV4A 1KXLA 2MFIA 1UNSA 4FNFA 3BU2A 4X3KA 4A93H 2BDOA 2N49A 4CJ2C 2FMMA 3I56A 4FXDA 1F2YA 3HOUH 4KY5A 3Q0AA 5JAVA 4DV4L 3PO3H 1C0AA 5FLMG 3IFDA 1U4LA 3A7AB 5KYIA 2Z4IA 3GTJB 3OMCA 1EQRA 3HKZE 2JA7B 1JICA 1K8AC 1IBKQ 1WD1A 3W5OA 2YV5A 3DEPA 1S5DD 2HD3A 1DCZA 5ELFA 1TKWB 3X3MA 4MNOA 2TSSA 3DEOA 2A6EC 4HCEA 4OIJA 1NTGA 3RZOB 5IP9H 2Z1CA 2E5LL 5COYA 4LFBL 1VDZA 4C3HH 3D6WA 2EY1A 4GLXA 4ZQ3A 3A0JA 1SNCA 3VYRA 1AN8A 1N8RC 3OIQA 3OHXC 2AQ1B 3ITPA 3VA5A 1VF5C 4K5XA 2A68C 2D5DA 4CDCC 3S16B 1JB3A 2AQ2B 2BOSA 1HA6A 4J15A 1XXGA 3R93A 1H9SB 4PG3A 4WRDA 5JVH3 3CCUA 4A3JH 2E2DC 2XGTA 4FF4A 2K6AA 1LLRD 1EYGA 2DUDA 3MXNB 1OXSC 4A3FH 3NBHA 4BY1G 3T51B 1UE1A 1JQYD 2IL8A 3WOEA 2VL6A 1D2BA 1STYA 1K3BC 3ND8A 4B3RL 1Q81C 4LF4Q 1U0LA 2R6GA 1SNQA 2QEJC 4EQ5A 1CUKA 3GTKH 3TREA 4ZKCB 4UP8A 1F9SA 1VQMA 3NK9A 1SFOH 1JE4A 1ET6A 2OTJA 5I2XA 1B7YB 1XMOL 1S5CD 3S17H 4OO1G 1GO3E 4JI0Q 4PZ6A 2UXBQ 3F2DA 2E5LQ 4LFBQ 1UE6A 1XNQQ 5GROA 5C44H 1K73C 3HRZC 1TWCB 2PW7A 4YIJA 4DR1L 4X3TA 3KF8B 1O7ZA 1LTRD 5LL6S 4JOIC 2JQOA 4A3DG 5BN5A 3OMGA 1SYDA 3PUZA 1P16A 2O2LD 2ZM6L 3MC0B 1GKHA 1TU2B 3M4OB 1SYEA 4QMGA 3BDOA 3A8KE 4JPBW 4H0LC 4KY6A 3S16H 1QZHA 2BE5C 1H95A 1I4GA 2D9UA 4WJWA 4K8JA 4RA8A 4YWLA 3AFQA 1G91A 1LV9A 2N78A 3T1YL 1A15A 2RBMA 1AZQA 3S1RH 3H3VI 3HKZB 4J6HA 1EY7A 1SLJA 1A3UA 5ISRA 1UEBA 1PA6A 4GLVB 4JI4Q 2LFNA 3IFTA 1Q3LA 5EBDA 4R8NA 1B4OA 4JBJA 4OL7A 4K0KL 4DAMA 4DPGA 1KABA 3W2DA 4DK1A 4YY3Q 5BN4A 2DY8A 1IW7C 2KOLA 3SK8A 3CC4A 3SK5A 1S40A 2KCMA 2F3IA 1QZGA 4KJNA 4DK6C 2AQ3B 4K5WA 5JEAG 2G9HD 3NBIA 1SMYD 1NMFA 3JAMi 2CW0D 4OGQC 1ET9A 1T5XD 1EIYB 3GTQH 4NXML 1BCPF 2A6HC 4A3CH 3E5SA 5FJ8H 5LMUL 1HNZL 1FNWA 3MFYA 3OPOA 1HZBA 2JA5B 2ID0A 4GS3A 1MSGA 1U9RA 3F2UA 4R4IA 5IP9G 2HDMA 1I4PA 1SMXA 4ZYSA 1BXTA 1RDPD 2EE1A 3CQZH 4RG1A 4DV7Q 4ME3A 5M9OA 4FXKC 5IWAQ 2A74C 3VR3A 2ICEC 3CCSA 1N34L 2C35B 3TMEA 2A69D 1Y14B 1LTSD 3LNNA 1HQRD 5ELCA 2PW5A 3ER0A 1S3OA 3DUZA 1SNPA 1C7YA 4A3FG 1HFNA 2G9DA 4DAYB 3MWYW 1A8VA 2HCIA 3UI2A 3M7GA 3G6EA 4WORA 1PFMA 3WDNA 1LTID 2F0QA 1K83H 3EBEA 4C3IH 4NXNQ 2F0NA 1T5EA 4KKSA 3CD6A 1LTBD 4DN4M 1QVGA 4GNXB 4RAUC 1WTHA 1OXTA 2E2JB 1QCBD 4NDXA 5M3MB 3D0FA 2F0VA 4G7HC 1QNUA 4PQXA 4YWMA 3ZYYX 2HHHQ 1NNXA 2ZJPA 1GM5A 4OO1H 2MNAA 2K5VA 5ELEA 3SK4A 3R8BA 3K81C 4ZK9B 4MTKA 2R93G 2F3WA 4B3MQ 1KD1C 2VB2X 4JVZA 4DR3Q 3TS2A 4QY7A 5E3FA 1I94Q 1SNOA 3A7LA 2RDFA 2XN9C 1Q1BA 1PRTF 3HP3A 1YNNC 3BVGA 3WOFA 2IHFA 2BH8A 1ILPA 1WTWA 2L55A 1CKOA 4ABNA 5AFWA 3RR5A 1QVFA 2ALYB 2KEDA 1C8CA 4LF6Q 1V43A 3J81j 4YCUA 4FXGC 1HRJA 2IT1A 1XMQL 2WB1B 5GQOA 3LWEA 1JMCA 4CDFC 1TS5A 1E1OA 2XRQD 3GQBA 5M3FH 1TIID 3W3AA 1HFGA 4ZKBB 1J5EL 1LABA 3HFZB 1X6OA 2RSOA 2IX0A 4BXXH 1G2SA 4FO2A 4OEMB 3RZDB 2B3GA 1FYCA 2E74C 1K83B 3S1NH 3GTOH 1GUGA 1ESFA 3I73A 4JI6Q 2LXKA 4C2MB 3S2HB 5JPNC 5C3EG 2CW0C 1I4HA 1EIGA 4GKJL 3AMUA 3I91A 1AZPA 1EYAA 3P75A 3U4VA 2QDBA 3GV6A 2PQAA 1TY2A 3V2TA 1E22A 1M4VA 2M9VA 4PMCA 1ZXTA 4GOPC 5KIXA 1N36L 1AP0A 4BBSH 1PTOF 4G4KA 1N33Q 3C1EA 1B9NA 1YHQA 2XTIA 4DUYL 2VQFQ 1R4QB 2NVQH 1E2VA 1IYJB 4DNRB 2JXMB 4AQYL 1PV4A 4UY8C 3KLWA 2IY5B 3CCLA 1VS0A 3HEJA 3EJIA 2XRSD 3U50C 4HJ5A 5CBEE 2NVXH 3UE0A 5I9PA 1F2LA 2E8GA 1X3QA 3GTKB 1NR4A 1U4RA 1HR0Q 2F52A 1N33L 1X3PA 2RF4A 4JCVE 3HOZB 1B44D 1G8ZD 1I4RA 1C4QA 1PVOA 1HZAA 4APVA 5FOBB 1FD7D 2JJQA 3PF4A 2RSNA 3NP8A 2QF7A 1STEA 2IJ0A 1N9WA 2K5DA 3K5OA 4GKJQ 4F87A 5KEEA 3BS1A 4RGTA 4DR7L 1ASYA 1TWCH 1O80A 1XPOA 3S15H 1LT4D 4JI8Q 2EPBA 5G3LF 1HJPA 3IAYA 1JJ2A 5IGCA 1JOQA 1B9MA 4A3BG 3H0GH 3NHHA 1NSNS 4C3HB 3T16A 3RNUA 2K7VA 2AWNA 1C9OA 2K04A 3SDZA 4RGOS 1K8GA 1D6EC 3HOYH 2AKWB 1J5EQ 2LY7A 2L11A 5NUCA 2I07B 1CQFA 1GJXA 2FHTA 3PQIA 1L0XB 1I6VC 1SYFA 2NYZD 3NWSA 5D65A 2KUMA 1XMQQ 3HKZG 1AE3A 5C4XG 5FJ8G 2K52A 1KDAA 1KQSA 4DV5L 4X6AH 5A35A 2UUBL 1XPRA 1EY9A 1V1PA 4B3TL 3M3YH 4DAYA 1RJTA 4IPCA 2KJXA 5C4JB 1XYIA 1Q8KA 5EPLA 4C3JH 4LFCQ 3NBHB 3D4RA 2FXQA 2XSCA 3ULPA 1GUTA 3FKIH 4L8JA 3NELA 5M3FG 2EJMA 5KYLA 1SE2A 5C0XH 3CCMA 3MXPA 4R4TA 5M3FB 4HSPA 1WTQA 2OEOA 2ENBA 2WAQB 2ZTEA 3CW2C 3RLNA 3S2DB 1H9MA 4Y7NH 2VQEL 4FF3A 3J80i 1UEAB 4YHHQ 2EIFA 2JA6B 1ML0D 4NXNL 1WD0A 4DR5L 4KI0A 2B29A 2BDNA 1DM0B 3E0JA 3PIP3 4H02A 4ZLTF 1PDQA 4OWTB 4TKOB 2YU9B 1V9PA 4IZ8A 2NN6G 2A1AA 3M4YA 4XYOA 2Q2HA 1HR0W 4ZRZA 3TSSA 2Q2TA 3DXJC 3CPWA 1CT1D 3R2TA 2I5LX 2AHOB 1Q12A 2F0KA 2RCFA 3E0EA 3J81i 3I4LA 2ES2A 3BVMA 1VQOA 4G7ZC 2L4NA 3G4SA 1EEID 4QGUA 2B8GA 4JYAQ 4AYBB 1X54A 4QIWB 4HJ7A 1WTOA 5CV6A 1FNUA 3DWQA 1ICFB 2SNMA 1LYLA 3DWPA 1A0IA 2IW3A 3AQQA 1CZWA 3CMAA 3QG1A 1E3PA 1YI2A 1S4ZA 2J7ZA 1Y69U 4CBVA 5ELBA 4G7OC 5CGKA 2Q2IA 3J7YW 4L5SA 3ONAB 1HNZQ 2A6ED 4NXMQ 2PYKA 5LHY1 3STBC 3IKJA 2F0HA 3S1MH 5IT9L 4GKKQ 2F4IA 1TWGB 1PYWD 5FK9C 4X66L 1PH9A 1PRTB 4ODGA 4UHVA 2WIIB 4OWWB 2NVTB 1FR3A 3EA6A 1S5ED 4JW0A 1WOCA 1BR9A 3A74A 2N55A 1BCPC 4KHPQ 2K5HA 4FYDA 1SRUA 4BY7H 1L1OB 4POFA 3AB9A 3BZDB 3OWEB 4A3GB 1GUNA 2R92G 3TDQA 1SAPA 4CJ1B 5E4XA 2EY6A 1JWUD 3J7ZC 2I46A 2KBNA 3OW7A 3SK6A 2LSSA 3J7AV 3HOXG 2KECA 2GA4B 4C1NK 1QB5D 1VQ9A 1WCMH 1UAPA 3CU7A 4S3SA 1IBLQ 4BY1H 4ME5A 2DY7A 4HIMA 1EQTA 1YNXA 3VR4A 2R7DA 1B3QA 1E2WA 1G291 4TRDA 4QJFA 1CQVA 2KHJA 1EU4A 4L6TB 1ZEQX 4XTCS 2VNUD 3H3VC 1RTOA 2ZT9C 2K50A 1UUPA 5A2QL 3GTGH 4DXFA 4BBRB 4RCNA 4IFDI 3V96A 3QWNA 4C2MH 5C4JH 3AFPA 4JYAL 5HGQA 3KOJA 3K58A 2NWGA 4CDEC 4P73A 3P20A 3E3XA 3KK7A 3JAME 1WI5A 1SN8A 1L0WA 5A2QE 2SEBD 3EROA 2R7ZB 2C5CA 1IKLA 4X3UA 3S17B 3U9SA 2OTLA 1STBA 1VQPA 2BA1A 4GOPB 1A2UA 2K5WA 1MKHA 4LK1C 1B3AA 4RWSC 3PO2G 2EXZA 2F0TA 4LWCA 3GTMB 2MPMA 4QQBX 4B9WA 1EYDA 1PH8A 2NTTA 2RHSB 4DR5Q 5M5XH 1AW7A 3EFXD 1H9KA 4JG2A 4A3EH 4LF9Q 1STAA 1G51A 1A3VA 5FO8B 3U58A 2JE6I 4A3BH 3VYSA 3I55A 5M5YH 2F0MA 2VQEQ 2O5JC 2PZWA 2HCCA 4LW1A 1Y1WH 1XNRQ 1G6ZA 4UAIA 1K9MC 2F0OA 1GUWA 1STNA 1PYSB 4EQNA 3UE1A 5J3BA 2YYZA 1RL2A 3K5MA 3RD4A 4JI3Q 4LAAA 4A3GG 4UDUC 5IYCG 4X65L 1EY6A 5IODA 2ZTCA 3CF5A 4MIUA 4DUZQ 2G5DA 1KNAA 2KHSA 2BA0A 4LJZC 3VYTA 4F88A 4A3JB 1D7QA 5C4XH 2L15A 2PCFB 4UP7A 2K05A 4CKBA 1JJGA 2VS1A 1BCPB 1SROA 4Q5VA 1QILA 1HZ9A 5HY6A 4XDXA 2NB0A 3F2BA 5JEAH 4IFDJ 2KQ3A 4OXPA 2WP8J 4C3JG 4DK3C 5KNCA 5DM63 3SHLA 3GP7A 1RODA 5I2YA 4AH6A 1IBKL 4E6IA 3A5UA 1CSQA 2K01A 3NXWA 3U9OA 1FNVA 2VY3A 2O5IC 3CXCA 3MHBA 1EIFA 3GTQB 3M9BA 1A62A 1CKMA 5D3IB 1SJED 5FKAC 2H5XA 4DK0A 1EUJA 2R7FA 3L9AX 2H1EA 1O7YA 5DEHA 5KNDA 5C44B 2NBFA 3M4QA 3OTOL 3T13A 4X64Q 1X56A 1PTOD 1D5XC 3CHBD 2F0JA 4XIGS 3CCJA 4A3EB 1DOLA 5BR8Q 3QOJA 4DR7Q 3DWAA 1A63A 1V1QA 1CTMA 4QUCA 1NUCA 3CAMA 2NN6H 4P72A 1Z47A 3VR6A 5CMDA 1H9SA 5C3XA 3GTJH 2N3SA 4UP9A 4C3IG 1HR0L 1L1OA 3S2DH 4HIOA 5EQ0A 4HN7A 2Z6BA 3D4DA 5AJ3Q 5IGBA 3PUWA 1I4QA 2F0SA 2O4XA 1Y8NB 4OIKA 3PF5A 4PMWA 4DFAA 4OELB 3JAMc 4LF5L 3QR8A 3A54A 3A56A 1I5FA 3UDIA 2K5NA 5AJ3L 2B2WC 1FVIA 4ID6A 1EQVA 3CCEA 2YTVA 4F8MA 4DUYQ 1HXYD 3PCOB 3TN2A 4XT1B 1OXUA 2N88A 1WTVA 1VQ6A 1KDBA 1VQKA 4DV6L 1HNWQ 5KRUA 4MN3A 4A3MH 3Q8DA 2Q2UA 1SXTA 3I2ZA 4KN4C 2VB3X 2WAQG 1YVCA 5I6WA 2OCEA 1EWIA 3HG9A 3I4MH 2OWOA 2MO0A 1BF4A 3PIPA 4DR2Q 4L5RC 3HOVB 1QVCA 4RGMA 4RKBA 5BR8L 2UUAQ 3KF8A 1GD7A 2K03A 1I6HB 4NP5A 3T53B 4X64L 4K2LA 4N9PA 2EYPA 1CI3M 2R92H 2RVLA 1QUQA 1STHA 4IUUA 2B2VA 1BBUA 2ZXPA 3FDTA 4EVOA 3NQTA 1R4PB 5I9OA 3PO2B 3MXUA 1K0RA 3RN2A 5GAEC 3Q23A 4HJ8A 1M1KC 5IYCH 2A19A 5DAUA 2JA7G 1ENAA 4YCVA 1CM9A 3O13A 3CKIB 1PH5A 4EQPA 2KCCA 2DN8A 1SYBA 5C3EH 2UXDQ 5M3MG 2WACA 5IGEA 3GDEA 4A3IH 1RKNA 1K0SA 3H6MA 4J8QA 5C3WA 3S24A 1KRTA 3E6ZX 4CKCA 3K8AA 3K5LA 1I94L 3J81L 1GHJA 1O78A 3C3LA 3J7AF 4A3LH 1IL2A 1JWMD 2BH2A 1HTPA 3M4OH 2EYOA 4LNQA 1VQJA 2I5MX 1TQOA 1H9JA 4DUZL 4B3ML 4KHZA 4X62L 2CKZB 2CWPA 5M5WB 2K1BA 3KLSA 4R1JA 2LXJA 2QW7A 1WCMB 3TP8A 4JI3L 1BKBA 4HR7B 4GOPA 3QB3A 2HHHL 1Y8OB 2WAQE 1QOHA 1VMPA 4P2CB 1PZID 2WKDA 1KDCA 1XNRL 1UWVA 3S1RB 2ASBA 1F2MA 2B2YC 4DV0Q 3T1HL 2KENA 4LF9L 3HOXB 1WJJA 5CV8A 1Q46A 2L5TA 1I6HH 3NEMA 4BBRH 1ZKOA 4JK1C 2PZUA 2MGSA 1VQCA 2NVXB 4IQZA 3GD7A 2RCNA 2L9HA 1BNZA 3HOVG 1Y1WG 1LO5D 3KBGA 2Q8IB 2IX1A 4IFDG 1N34Q 1KLUD 4I7ZC 2M2LA 3B6YA 2E2HB 2MUYA 2R61A 1ZYRC 5I6YA 1R9TB 2RDHA 3J80c 1VQ7A 1FJGL 2KVMA 5GADC 3K6OA 2B63B 4XYQA 1QNKA 2M00A 1E24A 4AYBE 1YJ9A 1RCVD 3OW2A 3DHQA 4A3IB 2UU9L 1TVXA 1O7IA 5M5XB 3BDLA 3HOWH 4BY7B 3MZ5A 3I3CA 3S1NB 1EWCA 2RA4A 2ZXOA 2DJGC 1I3QH 2EYJA 1MGSA 1TS4A 1W2BA 4I7AA 1HQMC 4DR4Q 2F1MA 4OX9L 3PGZA 1DJRD 1E0BA 1IBLL 2NZHA 1JWSD 2RKSA 4KKTA 1HUMA 4A3MG 3E9HA 1S5BD 3K5NA 1CA6A 1GHKA 1ESRA 5FLXE 1E7ZA 3I4MG 4NB3A 1B2TA 2JA8G 3I4MB 2PNHA 2F4VQ 3PUYA 4LF7Q 1X32A 4YY3L 3AU7A 3BJUA 5J1ZA 4PZ7A 2I0QA 1P8LA 2EDGA 4BS9A 1EU3A 2XNAC 2A5HA 2MJ8A 1T9HA 4JI4L 3I8ZA 3SEBA 2EY2A 1MHWC 5L37A 2DGYA 4R8IA 1MJEA 3BYTB 4TQUS 4F7XA 1PH2A 1VQDA 5ELOA 4IJLA 3ERQA 3T1YQ 3C2PA 5IGDA 3PV0A 4GKKL 1ASZA 1Q82C 3K7AH 4LFAQ 2UXCQ 2H4OA 2JK8A 2A8VA 3UDXA 2AMCB 3KJPA 4OX9Q 1SYCA 4DR4L 3TS0A 4XQQA 1RHPA 1JCKB 4FF1A 3EN2A 3KYHC 1PYBA 2ZM6Q 3Q22A 1EY8A 2YTXA 4LUOA 5IOCA 1DZ1A 1PTOH 2QCPX 1SNMA 3HS0C 1CFMA 2D0PA 3LGJA 2UU9Q 1NJIC 3D3RA 1M90C 2K28A 1Z7TA 3SVMA 4ZUIA 2PI2A 2CCZA 4A3BB 2MQHA 3VA7A 2UXBL 4FP5D 3I90A 1VF7A 1LTGD 1RIPA 1RTNA 5C44G 4JI0L 1FGBD 3RUZA 2NZOA 3P1HA 5M5WH 3D4WA 4O2DA 3PUXA 4DF7A 1XMOQ 4A75A 5DM73 5CR3A 2Z6KA 2F0WA 4K14A 5LMNQ 2CHBD 3BDCA 1CHPD 5K36H 5C4XB 2B39A 1XTCD 1YZ6A 5EKLA 1AH9A 4DAPA 2DNEA 3P7JA 2Z0SA 1EOVA 3D8GA 3KJOA 1S72A 2FFKB 3GO5A 3NTHA 3HZXA 2E76C 4YHHL 1JB7A 4P71A 5IGGA 3G7LA 4PZ8A 3T1HQ 3URYA 3H91A 1BVSA 1B50A 1NCVA 1II3A 4IPGA 4DAVA 4A76A 4NKLA 2A69C 4IFDH 1BUVT 5F2DA 2ICIA 2X6GA 2HIVA 1K3RA 1HH2P 1VQLA 4WJ3M 3TP5A 1IHZA 4OO1I 3NTKA 3NTIA 2V1CC 1X55A 3EIVA 1B8AA 2RQXA 2E2HH 2HQLA 2PMZB 3GTPB 2JA7H 2F0DA 4RH6A 4UPAA 3GTLH 4ILWA 1XJVA 3DLLA 4X3SA 1HNXQ 1PRTC 4KLKA 4YWKA 1D5ZC 2VZAA 2NVYB 5CC4A 2YTYA 3CRKC 3NENA 4B3TQ 2A6HD 5D3DA 2F3VA 5IT9E 5ELDA 2UUBQ 4RFBA 1PFSA 2CQOA 1NE3A 3OWFA 2RDGA 3RLFA 1Z9FA 3KUPA 4RCOA 4I65A 4DV5Q 3I7FA 2Z4HA 3I4OA 5CV7A 2PNRC 1J6QA 2JA5G 4DV6Q 1NAPA 2K4KA 4A3CG 4JC0A 4JBWA 4N8X1 1KLGD 3S1QB 3N6RA 3PUVA 1SE4A 1DXMA 4EGVA 2QKIC 5C0XJ 1XPUA 4DR6Q 3T4AC 4WJ4A 1V8QA 4DV4Q 2CQAA 3RN5A 3OOCA 2Y0SE 3AEVA 1SBBB 3KF6A 1GVPA 2SDFA 4L5QA 2JA8B 4EQOA 3ULLA 1F9PA 2QGQA 4IOCA 2J4XA 3VR5A 5CV9A 4KTAA 1MJCA 2UUAL 3NUCA 2OF1A 3KLRA 3IL8A 2Q8RE 3S2HH 2PI2E 2EYFA 2TMPA 5C5MA 3CMEA 5J22A 1JR0D 2PPBC 3AYHB 1Q86C 3S14B 2I5HA 1EFWA 4JI2L 1A2TA 5T1IA 4IALA 1HNWL 3S1MB 1FL0A 5EKKA 3PIOA 3TP7A 5IT9c 1GOZA 2A73B 1U4PA 4LF8L 3Q24A 3GTLB 3T56B 2IX3A 2WV6D 1JOOA 2FMCA 4H13C 5GAHC 1VQ8A 4IOAA 1TY0A 1VCIA 4DV2Q 4LF5Q 2FINB 4KN7C 1PTOB 3M3YB 3MXNA 2KCNA 3V05A 1RF2D 4KY7A 1CKNA 4IUQA 1TWAB 1X65A 2GN5A 4IUTA 5C4ZA 3MAQA 3HOWG 1PXUA 1IYUA 3NWTA 2R92B 3G71A 1KRSA 4XXEA 1IBMQ 2VQFL 4R4CA 3Q6SA 1TS2A 4RKLA 3R3OA 3HOUB 1IYVA 1WYDA 1Q90A 3JAML 5EPKA 5HURA 1HZCA 2R3ZA 1JE5A 4G57A 1ENFA 1QUQB 3HOZH 2OT2A 3CP0A 2K14A 1QWYA 2EYLA 1HA5A 5K36G 4V0BA 2PMZE 2A68D 2JA8H 1XX8A 5C3EB 1EFID 5C4HA 5IYDG 4JI6L 1J9OA 3MEFA 1VQNA 4GNXA 1XTDA 3OTOQ 2WINB 3TEHB 2JSOA 4A4IA 4Y52H 1UE7A 5K5PA 4JV5Q 4BA2I 1YNJC 1EIHA 3D6CA 4QB4A 4HAEA 1L0YB 1PTOC 2JP1A 2JA6G 3M85A 2ZJRA 4DXGA 3S14H 1BO0A 1C48A 5IYBH 2WB1E 3TBIB 3FHWA 4CHTB 3U4ZA 4JBMA 1Q7YC 1TWHH 2Z9HA 4L5TA 1S5FD 1HTLD 4TSSA 4LF6L 1X9NA 2EZVA 3J81c 5CYUA 1PH3A 1F9QA 1EY5A 3ULJA 3VYUA 3GTMH 2JYOA 1VQ4A 1CK1A 2B2TA 2NVYH 3BYYB 1IZ6A 2Q8TA 3UDGA 4RHSA 1KAAA 4FVMA 1YHAA 4R4OA 4NMZA 4DR3L 1G2TA 2QEXA 4X65Q 3X3NA 3BZKA 1OXVA 4TVAB 3CQZB 1VQEA 5D14A 4C1NI 4DGZA 1N32Q 2RHQB 1LUZA 1EZ6A 1DD2A 5BN3A 3RLOA 4K6LA 4Z9CB 2JEAI 4HIDA 1A3TA 2NVTH 1LM0A 3HOUG 1PHJA 2B63H 5FO9B 3ICEA 1WFQA 1J8IA 4AYBG 1D8LA 4RGNA 2ZTDA 3GTOB 3HOWB 1SE3A 4MZ9A 1EYCA 3N52A 2C9OA 2DNCA 2HIXA 2XWJB 3A8JE 2MP1A 2OXPA 1KIXA 2F0IA 5IY0A 4GN4B 4JI1L 3RMHA 2D62A 1JORA 4O0AA 5EBCA 3NQIA 1EQQA 1A6XA 5IP7H 1QG7A 3L0OA 1U4MA 3I4NG 1OTCA 1TWHB 1TWFH 4DV7L 2JEBI 4EX5A 2OQ0A 4JI7Q 4M8AA 1K8OA 3FKIG 1X3FA 3SGIA 2K32A 3E9IA 1AEXA 3I72A 3J80E 3HOYG 2P5ZX 2IHEA 3QOLA 4PMBA 2WKCA 5CV5A 5JEAJ 4K8IA 1LACA 2LKVA 4KJOA 4IO9A 4HJ9A 4DV2L 5LMUQ 2GVBA 1HHVA 1BDOA 1EL0A 1E2ZA 3H09A 4OHJA 3C1FA 3FVQA 5LMNW 4K6DA 2R7ZG 1Y1VB 4LF8Q 5JOBA 3HOZG 1SJHD 5LL6X 5KNBA 3D31A 1NBWA 2J0TD 3KFUA 4DV3L 1PMRA 4A3LG 1VQGA 2CFMA 2XIWA 4K0KQ 1SMYC 1YNJD 2EVBA 2VXWA 1IKMA 1G6PA 4WFN3 1I4XA 1BBXC 2NZ1D 2R93B 4KHPL 2ZXRA 3VDYA 5C0XG 1OO9B 1U5KA 1PH6A 4QL5A 2KHIA 5E1FA 4L63B 2VUMB 5DNFA 3S9WA 4KMUC 4JBKA 2IPKD 5JVG3 4X66Q 3MEHA 4QIWE 2MHVA 4GNXC 3S1QH 1B53A 3HKSA 5IIFA 1KL9A 1SNDA 3I4NB 4DR6L 1PFBA 2B2UA 3DM3A 4BY1B 2HQEA 4BBSB 2EJGC 5I4DA 1PZKD 3SR1A 1GXDC 2WB1G 1MIUA 4PNYA 4KK7A 4OONA 4DV1L
chains in the Genus database with same CATH topology
4YY3L 1VQOA 1EYGA 3G4SA 4JYAQ 2DUDA 3F8TA 3BJUA 3MXNB 4QGUA 4IJHA 1OXSC 4A3FH 1X54A 4R4QA 4PZ7A 4HJ7A 1P8LA 2I0QA 2UUCQ 4ALPA 1KAWA 4BY1G 3FP9A 2VW9A 4DR1Q 1LYLA 1UE1A 1A0IA 4JI4L 1T9HA 3AQQA 3CMAA 1YI2A 1E3PA 2VL6A 2DGYA 1XNQL 4B3RL 1MJEA 1Q81C 4LF4Q 1U0LA 1HNXL 4TQUS 1PH2A 2R6GA 1VQDA 2Q2IA 4L5SA 4EQ5A 5ELOA 1CUKA 1HNZQ 3GTKH 4IJLA 3TREA 1VQMA 4UP8A 2ES2A 3CCQA 2HT1A 4NXMQ 3T1YQ 1SFOH 2OTJA 3STBC 1B7YB 3PV0A 4BY7G 1ASZA 1Q82C 5E7NA 3S1MH 4GKKL 3K7AH 4LFAQ 2PQAB 1XMOL 2UXCQ 2JK8A 2A8VA 4GKKQ 3UDXA 3S17H 2AMCB 3KJPA 4OO1G 4OX9Q 1GO3E 4JI0Q 3TS0A 4DR4L 1VQHA 1JT8A 4X66L 1PH9A 4PZ6A 3EN2A 2B63G 3KYHC 2UXBQ 1PYBA 3F2DA 4OWWB 1KHIA 2ZM6Q 1UE6A 4P75A 2E5LQ 4LF4L 4LFBQ 2N8NA 4B3RQ 1XNQQ 5GROA 2YTXA 4LUOA 5C44H 3CCRA 1K73C 3JC66 5IYDH 1WOCA 3A74A 4JI5Q 4KHPQ 2KCTA 2K5HA 3IRBA 4DR1L 1SRUA 4BY7H 2D0PA 3KF8B 3LGJA 4POFA 1NJIC 4YCWA 4JOIC 1M90C 2UU9Q 2JQOA 4A3DG 2R92G 3RZOH 4JI5L 3H15A 5FLXc 3PUZA 1IXRA 1P16A 3J7ZC 2KBNA 2CCZA 2PI2A 2ZM6L 2LSSA 2MQHA 1GKHA 2UXBL 1RIPA 3HOXG 5C44G 1VQ9A 4JI0L 5M5WH 5LMNL 2NZOA 5JJKA 3I4NH 1WCMH 3W1BA 4O2DA 1QZHA 3S16H 1H95A 3PUXA 4YWLA 1XMOQ 3K0XA 1IBLQ 4BY1H 1X3GA 4A75A 3AFQA 2Z6KA 1VQ5A 1JJCB 5LMNQ 3UDFA 1VQIA 2N78A 3T1YL 4HIMA 1YNXA 3S1RH 3H3VI 4IPDA 4LUVA 2R7DA 4LFCL 1G291 4QJFA 1YZ6A 2KHJA 1AH9A 3HOXH 3ERSX 4XTCS 1SLJA 4DKAC 2Z0SA 2VNUD 2D0OA 1EOVA 3KJOA 1UEBA 1PA6A 4GLVB 3KF6B 2K50A 4JI4Q 3GTGH 1NMGA 1S72A 4IFDI 1WCMG 2F4VQ 3GO5A 4JBJA 4A3KH 2UUCL 4YHHL 4C2MH 5C4JH 3AFPA 4DAMA 4P71A 4DPGA 1JB7A 4PZ8A 5HGQA 4YY3Q 3T1HQ 1BVSA 4DV1Q 4IPGA 3KOJA 1NY4A 3K80C 4A76A 3CC4A 4HJAA 1S40A 4P73A 3ZJYC 2KCMA 2F3IA 1QZGA 4DK6C 1WI5A 2HIVA 1K3RA 3L2PA 5JEAG 1HH2P 1VQLA 1SN8A 1L0WA 4WJ3M 5GAGC 4OO1I 2V1CC 1X55A 3EIVA 1NMFA 3JAMi 2UXCL 4FDBA 1B8AA 4A3EG 2E2HH 2HQLA 2OTLA 1VQPA 4LFAL 1EIYB 2BA1A 4GOPB 3GTQH 1MKHA 2JA7H 4UPAA 4NXML 3GTLH 4A3CH 1DGSA 1XJVA 5FJ8H 5LMUL 1HNZL 3DLLA 3PO2G 1HNXQ 1HZBA 2ID0A 4LWCA 4QQBX 4KLKA 4GS3A 4JI8L 4YWKA 1PH8A 2VZAA 2MO1A 2YTYA 2RHSB 3NENA 4B3TQ 1SE8A 4DR5Q 4A3GH 5M5XH 4R4IA 2R93H 3L7ZC 5IP9G 1TWAH 2UUBQ 1A63A 4A93G 1PFSA 4JG2A 4A3EH 2CQOA 1NE3A 4DV5Q 3RLFA 1SMXA 1Z9FA 1G51A 4LF9Q 3CCVA 3I7FA 3U58A 4NPSA 2JE6I 1PH1A 3I4OA 4A3BH 1J6QA 5M5YH 3I55A 1YJNA 2JA5G 4DV6Q 2K4KA 4AIMA 2VQEQ 4LF7L 1Y1WH 1CKNB 4JC0A 4LW1A 1E1TA 1XNRQ 4JBWA 4A3CG 1K9MC 3CQZH 4RG1A 4DV7Q 3PO3G 3PO2H 5FLMH 4ME3A 4DV3Q 1PYSB 3TRZA 3PUVA 3UE1A 5J3BA 2YYZA 1RL2A 5IWAQ 5C0XJ 4JI3Q 3CCSA 1Y1VG 1XPUA 4DR6Q 1N34L 2C35B 5IP7G 4A3GG 4WJ4A 5IYCG 4DV4Q 3WWVA 4X65L 3RN5A 1Y14B 2ZTCA 3CF5A 2Y0SE 4DUZQ 3AEVA 5DLQE 1I50H 2BA0A 1D7QA 3KF6A 3ER0A 1S3OA 1GVPA 2Z6KC 4L5QA 2ATWA 1C7YA 4RMFA 5C4XH 2L15A 4UP7A 3ULLA 4A3FG 1YIJA 1JJGA 2VS1A 4DAYB 2QGQA 4IOCA 1A8VA 1SROA 3RZDH 3G6EA 1HZ9A 3W1GA 5HY6A 3F2BA 1K83H 3EBEA 1YITA 4C3IH 1MJCA 3M4PA 2UUAL 4NXNQ 4IFDJ 4AQYQ 1CSPA 4OXPA 2WP8J 4JOIA 4BXXG 3CD6A 4DK3C 1SR3A 1QVGA 3S2HH 4GNXB 1YJWA 2PI2E 1VQAA 3CMEA 4B3SL 4JI7L 3HOVH 2VUMG 1OXTA 3KDFA 3AYHB 1Q86C 1FJGQ 5EAYA 3D0FA 2I5HA 1EFWA 4AH6A 1IBKL 4JI2L 4YWMA 1N36Q 3A5UA 1CSQA 1HNWL 1PH7A 2HHHQ 2ZJPA 2R7ZH 1GM5A 1FL0A 1VQBA 2VY3A 2CWAA 3PIOA 2MNAA 3CXCA 2K5VA 5IE8A 5IT9c 2GVAA 3CPFA 1EIFA 3GTPH 3M9BA 3K81C 4JI1Q 4LF8L 1TWGH 1A62A 1CKMA 2R93G 4B3MQ 3F1ZA 1KD1C 2H5XA 3CC7A 1EUJA 2R7FA 4DR3Q 3TS2A 5GAHC 4MTNA 1VQ8A 2JA5H 4IOAA 4QY7A 1VCIA 4DV2Q 4GN5A 1I94Q 4LF5Q 3OTOL 3M4QA 4X64Q 1X56A 4BBSG 1BBWA 1Q1BA 1CKNA 1L1OC 1W3SA 1X65A 2GN5A 2IHFA 2BH8A 1VQFA 4XIGS 3STBD 3CCJA 5BR8Q 1CKOA 2EXDA 5ELNA 4POGA 3RR5A 1QVFA 2ALYB 2AWOA 3G71A 1KRSA 4DR7Q 4LF6Q 1IBMQ 1FGUA 4R4CA 1V43A 3J81j 1AE2A 2VQFL 1V1QA 4YCUA 4DV0L 3H3VH 3A5ZB 2E2IH 1WYDA 3CAMA 2IT1A 1XMQL 1HZCA 5GQOA 1JE5A 4P72A 1Z47A 1JMCA 1E1OA 1QUQB 4P74A 3HOZH 3GTJH 5M3FH 2ZJQA 2N3SA 1N32L 2WFWA 4UP9A 3CP0A 2K14A 2QA4A 1J5EL 1HR0L 1L1OA 3HFZB 3CC2A 3S2DH 5K36G 4X62Q 1X6OA 4HIOA 2IX0A 4BXXH 2PMZE 2JA8H 5AJ3Q 1KC8C 3PUWA 5IYDG 5H1SE 4JI6L 2B3GA 3MEFA 1VQNA 2K75A 3PF5A 4GNXA 4A3KG 4PMWA 3S1NH 3GTOH 4A3DH 1XTDA 3OTOQ 3JAMc 4GN3B 4LF5L 3KDFB 4JI6Q 3TEHB 4A4IA 4Y52H 1UE7A 1I5FA 2Y0SG 1LTLA 3UDIA 4JV5Q 2K5NA 4BA2I 2LXKA 5AJ3L 1FVIA 2YU9H 5C3EG 2UXDL 2EQSA 3CCEA 2YTVA 2E2JH 4GKJL 2JA6G 4DUYQ 3M85A 2ZJRA 3S14H 3U4VA 2PQAA 3PCOB 2JA9A 1E22A 3M7NA 4IPHA 1OXUA 5IYBH 3PSIA 4GOPC 1VQ6A 2WB1E 1VQKA 4DV6L 1HNWQ 1N36L 3FHWA 4BBSH 4A3MH 3Q8DA 3U4ZA 2Q2UA 4JBMA 3I2ZA 1TWHH 3H0GG 2WAQG 1Q7YC 1YHQA 1N33Q 2XTIA 1YVCA 4L5TA 2OCEA 1EWIA 4DUYL 3I4MH 5JJIA 2VQFQ 2OWOA 3G48A 2MO0A 3J7A5 4A3JG 4LF6L 2NVQH 1X9NA 3J81c 1IYJB 3PIPA 4DR2Q 1PH3A 4L5RC 4AQYL 4JV5L 1QVCA 3ULJA 5BR8L 2UUAQ 3F2CA 1PV4A 1GD7A 3GTMH 1VQ4A 3KLWA 4UY8C 1UE5A 2IY5B 3CCLA 1VS0A 2NVYH 3TQYA 3U50C 1IZ6A 4X64L 4HJ5A 3UDGA 2NVXH 3UE0A 2R92H 1YHAA 4R4OA 3OYYA 1QUQA 2E8GA 4DR2L 4DR3L 2QEXA 1BBUA 4X65Q 3BZKA 4A3IG 1OXVA 2NN6I 4TVAB 2F52A 1HR0Q 1VQEA 1N33L 1K0RA 3RN2A 1Y1VH 5GAEC 1N32Q 2RHQB 2RF4A 4JCVE 5IWAL 4HJ8A 1M1KC 5IYCH 1LUZA 2A19A 1PVOA 3RLOA 2JA7G 2JEAI 1HZAA 1YBYA 4YCVA 4APVA 1R9TH 2JJQA 3PF4A 4DNIA 4HIDA 1PH5A 4B3SQ 2NVTH 1LM0A 5C0XI 1N9WA 4GKJQ 1IBML 3HOUG 1PHJA 5C3EH 2B63H 4DR7L 2UXDQ 1ASYA 5M3MG 3ICEA 1WFQA 4GLAC 1TWCH 4AYBG 3GDEA 1XPOA 4BA1I 2JA6H 4A3IH 3S15H 1D8LA 2ZTDA 3S24A 4JI8Q 1KRTA 1X3EA 5IYBG 4HIKA 1HJPA 4MZ9A 1JJ2A 2OQKA 2HIXA 3K8AA 1I94L 4A3LH 4A3BG 1IL2A 3H0GH 3K7UC 2BH2A 4OWXB 2VUMH 1KIXA 3M4OH 3RNUA 2AWNA 1VQJA 4LNQA 2I5MX 1C9OA 4DUZL 4B3ML 5IY0A 4GN4B 4KHZA 1YHBA 1TXYA 2CKZB 2CWPA 5M3MH 4X62L 1K8GA 2AKWB 4JI1L 3HOYH 4R1JA 1J5EQ 2D62A 2LXJA 1OXXK 4BBRG 4O0AA 4JI3L 1EQQA 1BKBA 4GOPA 5JJLA 5IP7H 3L0OA 3I4NG 2HHHL 1OTCA 2WAQE 1TWFH 4JI2Q 4DV7L 1PH4A 1B70B 4LUZA 2JEBI 3BZCA 4EX5A 1XMQQ 1XNRL 1UWVA 1AE3A 3HKZG 2ASBA 5C4XG 1Q1EA 2OQ0A 4DV0Q 4JI7Q 3T1HL 1L2FA 5FJ8G 2K52A 2KENA 4DV5L 1KQSA 3FKIG 1X3FA 4LF9L 4X6AH 1YEZA 3SGIA 1WJJA 3E9IA 2UUBL 3HOYG 1Q46A 1XPRA 2IHEA 1I6HH 1KXLA 4B3TL 3NEMA 4BBRH 3M3YH 5JEAJ 2MFIA 4K0KL 4IPCA 1VQCA 1Q8KA 3BU2A 4C3JH 4LFCQ 4A93H 4IO9A 4HJ9A 3GD7A 4DV2L 3NBHB 2RCNA 2N49A 5LMUQ 2GVBA 2FXQA 3I56A 3ULPA 3HOVG 1Y1WG 3HOUH 5LMNW 4DV4L 3FKIH 2IX1A 2R7ZG 3PO3H 5FLMG 3NELA 4LF8Q 4IFDG 1C0AA 3HOZG 5M3FG 1N34Q 4JYAL 3B6YA 3D31A 1NBWA 3CCMA 4R4TA 3KFUA 1EQRA 3HKZE 4DV3L 1K8AC 1IBKQ 3J80c 2ZTEA 1VQ7A 3CW2C 1FJGL 3RLNA 4Y7NH 5GADC 4A3LG 1VQGA 2VQEL 3W5OA 2YV5A 3J80i 1E24A 4AYBE 1YJ9A 2CFMA 4YHHQ 3OW2A 2EIFA 4K0KQ 2UU9L 1G6PA 4MNOA 4NXNL 1O7IA 4DR5L 3HOWH 4KHPL 3VDYA 5C0XG 4KI0A 2B29A 1NTGA 1U5KA 1PH6A 4QL5A 2KHIA 5IP9H 1I3QH 4H02A 2E5LL 4LFBL 4OWTB 4C3HH 2F4VL 1V9PA 1W2BA 4JBKA 4GLXA 4X66Q 2NN6G 2A1AA 3A0JA 4QIWE 1N8RC 4DR4Q 4GNXC 4OX9L 3PGZA 2Q2HA 1HR0W 3S1QH 3HKSA 1IBLL 2NZHA 1KL9A 2Q2TA 4A3MG 4DR6L 3CPWA 3E9HA 3DM3A 4J15A 1E7ZA 4PG3A 3I4MG 2I5LX 4NB3A 2AHOB 3CCUA 1Q12A 4A3JH 3HOWG 2JA8G 3E0EA 3J81i 2XGTA 2PNHA 1MIUA 2WB1G 1L1OB 4OONA 4DV1L 3PUYA 4LF7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 L;  1VQO A;  1EYG A;  3G4S A;  4JYA Q;  2DUD A;  3F8T A;  3BJU A;  3MXN B;  4QGU A;  4IJH A;  1OXS C;  4A3F H;  1X54 A;  4R4Q A;  4PZ7 A;  4HJ7 A;  1P8L A;  2I0Q A;  2UUC Q;  4ALP A;  1KAW A;  4BY1 G;  3FP9 A;  2VW9 A;  4DR1 Q;  1LYL A;  1UE1 A;  1A0I A;  4JI4 L;  1T9H A;  3AQQ A;  3CMA A;  1YI2 A;  1E3P A;  2VL6 A;  2DGY A;  1XNQ L;  4B3R L;  1MJE A;  1Q81 C;  4LF4 Q;  1U0L A;  1HNX L;  4TQU S;  1PH2 A;  2R6G A;  1VQD A;  2Q2I A;  4L5S A;  4EQ5 A;  5ELO A;  1CUK A;  1HNZ Q;  3GTK H;  4IJL A;  3TRE A;  1VQM A;  4UP8 A;  2ES2 A;  3CCQ A;  2HT1 A;  4NXM Q;  3T1Y Q;  1SFO H;  2OTJ A;  3STB C;  1B7Y B;  3PV0 A;  4BY7 G;  1ASZ A;  1Q82 C;  5E7N A;  3S1M H;  4GKK L;  3K7A H;  4LFA Q;  2PQA B;  1XMO L;  2UXC Q;  2JK8 A;  2A8V A;  4GKK Q;  3UDX A;  3S17 H;  2AMC B;  3KJP A;  4OO1 G;  4OX9 Q;  1GO3 E;  4JI0 Q;  3TS0 A;  4DR4 L;  1VQH A;  1JT8 A;  4X66 L;  1PH9 A;  4PZ6 A;  3EN2 A;  2B63 G;  3KYH C;  2UXB Q;  1PYB A;  3F2D A;  4OWW B;  1KHI A;  2ZM6 Q;  1UE6 A;  4P75 A;  2E5L Q;  4LF4 L;  4LFB Q;  2N8N A;  4B3R Q;  1XNQ Q;  5GRO A;  2YTX A;  4LUO A;  5C44 H;  3CCR A;  1K73 C;  3JC6 6;  5IYD H;  1WOC A;  3A74 A;  4JI5 Q;  4KHP Q;  2KCT A;  2K5H A;  3IRB A;  4DR1 L;  1SRU A;  4BY7 H;  2D0P A;  3KF8 B;  3LGJ A;  4POF A;  1NJI C;  4YCW A;  4JOI C;  1M90 C;  2UU9 Q;  2JQO A;  4A3D G;  2R92 G;  3RZO H;  4JI5 L;  3H15 A;  5FLX c;  3PUZ A;  1IXR A;  1P16 A;  3J7Z C;  2KBN A;  2CCZ A;  2PI2 A;  2ZM6 L;  2LSS A;  2MQH A;  1GKH A;  2UXB L;  1RIP A;  3HOX G;  5C44 G;  1VQ9 A;  4JI0 L;  5M5W H;  5LMN L;  2NZO A;  5JJK A;  3I4N H;  1WCM H;  3W1B A;  4O2D A;  1QZH A;  3S16 H;  1H95 A;  3PUX A;  4YWL A;  1XMO Q;  3K0X A;  1IBL Q;  4BY1 H;  1X3G A;  4A75 A;  3AFQ A;  2Z6K A;  1VQ5 A;  1JJC B;  5LMN Q;  3UDF A;  1VQI A;  2N78 A;  3T1Y L;  4HIM A;  1YNX A;  3S1R H;  3H3V I;  4IPD A;  4LUV A;  2R7D A;  4LFC L;  1G29 1;  4QJF A;  1YZ6 A;  2KHJ A;  1AH9 A;  3HOX H;  3ERS X;  4XTC S;  1SLJ A;  4DKA C;  2Z0S A;  2VNU D;  2D0O A;  1EOV A;  3KJO A;  1UEB A;  1PA6 A;  4GLV B;  3KF6 B;  2K50 A;  4JI4 Q;  3GTG H;  1NMG A;  1S72 A;  4IFD I;  1WCM G;  2F4V Q;  3GO5 A;  4JBJ A;  4A3K H;  2UUC L;  4YHH L;  4C2M H;  5C4J H;  3AFP A;  4DAM A;  4P71 A;  4DPG A;  1JB7 A;  4PZ8 A;  5HGQ A;  4YY3 Q;  3T1H Q;  1BVS A;  4DV1 Q;  4IPG A;  3KOJ A;  1NY4 A;  3K80 C;  4A76 A;  3CC4 A;  4HJA A;  1S40 A;  4P73 A;  3ZJY C;  2KCM A;  2F3I A;  1QZG A;  4DK6 C;  1WI5 A;  2HIV A;  1K3R A;  3L2P A;  5JEA G;  1HH2 P;  1VQL A;  1SN8 A;  1L0W A;  4WJ3 M;  5GAG C;  4OO1 I;  2V1C C;  1X55 A;  3EIV A;  1NMF A;  3JAM i;  2UXC L;  4FDB A;  1B8A A;  4A3E G;  2E2H H;  2HQL A;  2OTL A;  1VQP A;  4LFA L;  1EIY B;  2BA1 A;  4GOP B;  3GTQ H;  1MKH A;  2JA7 H;  4UPA A;  4NXM L;  3GTL H;  4A3C H;  1DGS A;  1XJV A;  5FJ8 H;  5LMU L;  1HNZ L;  3DLL A;  3PO2 G;  1HNX Q;  1HZB A;  2ID0 A;  4LWC A;  4QQB X;  4KLK A;  4GS3 A;  4JI8 L;  4YWK A;  1PH8 A;  2VZA A;  2MO1 A;  2YTY A;  2RHS B;  3NEN A;  4B3T Q;  1SE8 A;  4DR5 Q;  4A3G H;  5M5X H;  4R4I A;  2R93 H;  3L7Z C;  5IP9 G;  1TWA H;  2UUB Q;  1A63 A;  4A93 G;  1PFS A;  4JG2 A;  4A3E H;  2CQO A;  1NE3 A;  4DV5 Q;  3RLF A;  1SMX A;  1Z9F A;  1G51 A;  4LF9 Q;  3CCV A;  3I7F A;  3U58 A;  4NPS A;  2JE6 I;  1PH1 A;  3I4O A;  4A3B H;  1J6Q A;  5M5Y H;  3I55 A;  1YJN A;  2JA5 G;  4DV6 Q;  2K4K A;  4AIM A;  2VQE Q;  4LF7 L;  1Y1W H;  1CKN B;  4JC0 A;  4LW1 A;  1E1T A;  1XNR Q;  4JBW A;  4A3C G;  1K9M C;  3CQZ H;  4RG1 A;  4DV7 Q;  3PO3 G;  3PO2 H;  5FLM H;  4ME3 A;  4DV3 Q;  1PYS B;  3TRZ A;  3PUV A;  3UE1 A;  5J3B A;  2YYZ A;  1RL2 A;  5IWA Q;  5C0X J;  4JI3 Q;  3CCS A;  1Y1V G;  1XPU A;  4DR6 Q;  1N34 L;  2C35 B;  5IP7 G;  4A3G G;  4WJ4 A;  5IYC G;  4DV4 Q;  3WWV A;  4X65 L;  3RN5 A;  1Y14 B;  2ZTC A;  3CF5 A;  2Y0S E;  4DUZ Q;  3AEV A;  5DLQ E;  1I50 H;  2BA0 A;  1D7Q A;  3KF6 A;  3ER0 A;  1S3O A;  1GVP A;  2Z6K C;  4L5Q A;  2ATW A;  1C7Y A;  4RMF A;  5C4X H;  2L15 A;  4UP7 A;  3ULL A;  4A3F G;  1YIJ A;  1JJG A;  2VS1 A;  4DAY B;  2QGQ A;  4IOC A;  1A8V A;  1SRO A;  3RZD H;  3G6E A;  1HZ9 A;  3W1G A;  5HY6 A;  3F2B A;  1K83 H;  3EBE A;  1YIT A;  4C3I H;  1MJC A;  3M4P A;  2UUA L;  4NXN Q;  4IFD J;  4AQY Q;  1CSP A;  4OXP A;  2WP8 J;  4JOI A;  4BXX G;  3CD6 A;  4DK3 C;  1SR3 A;  1QVG A;  3S2H H;  4GNX B;  1YJW A;  2PI2 E;  1VQA A;  3CME A;  4B3S L;  4JI7 L;  3HOV H;  2VUM G;  1OXT A;  3KDF A;  3AYH B;  1Q86 C;  1FJG Q;  5EAY A;  3D0F A;  2I5H A;  1EFW A;  4AH6 A;  1IBK L;  4JI2 L;  4YWM A;  1N36 Q;  3A5U A;  1CSQ A;  1HNW L;  1PH7 A;  2HHH Q;  2ZJP A;  2R7Z H;  1GM5 A;  1FL0 A;  1VQB A;  2VY3 A;  2CWA A;  3PIO A;  2MNA A;  3CXC A;  2K5V A;  5IE8 A;  5IT9 c;  2GVA A;  3CPF A;  1EIF A;  3GTP H;  3M9B A;  3K81 C;  4JI1 Q;  4LF8 L;  1TWG H;  1A62 A;  1CKM A;  2R93 G;  4B3M Q;  3F1Z A;  1KD1 C;  2H5X A;  3CC7 A;  1EUJ A;  2R7F A;  4DR3 Q;  3TS2 A;  5GAH C;  4MTN A;  1VQ8 A;  2JA5 H;  4IOA A;  4QY7 A;  1VCI A;  4DV2 Q;  4GN5 A;  1I94 Q;  4LF5 Q;  3OTO L;  3M4Q A;  4X64 Q;  1X56 A;  4BBS G;  1BBW A;  1Q1B A;  1CKN A;  1L1O C;  1W3S A;  1X65 A;  2GN5 A;  2IHF A;  2BH8 A;  1VQF A;  4XIG S;  3STB D;  3CCJ A;  5BR8 Q;  1CKO A;  2EXD A;  5ELN A;  4POG A;  3RR5 A;  1QVF A;  2ALY B;  2AWO A;  3G71 A;  1KRS A;  4DR7 Q;  4LF6 Q;  1IBM Q;  1FGU A;  4R4C A;  1V43 A;  3J81 j;  1AE2 A;  2VQF L;  1V1Q A;  4YCU A;  4DV0 L;  3H3V H;  3A5Z B;  2E2I H;  1WYD A;  3CAM A;  2IT1 A;  1XMQ L;  1HZC A;  5GQO A;  1JE5 A;  4P72 A;  1Z47 A;  1JMC A;  1E1O A;  1QUQ B;  4P74 A;  3HOZ H;  3GTJ H;  5M3F H;  2ZJQ A;  2N3S A;  1N32 L;  2WFW A;  4UP9 A;  3CP0 A;  2K14 A;  2QA4 A;  1J5E L;  1HR0 L;  1L1O A;  3HFZ B;  3CC2 A;  3S2D H;  5K36 G;  4X62 Q;  1X6O A;  4HIO A;  2IX0 A;  4BXX H;  2PMZ E;  2JA8 H;  5AJ3 Q;  1KC8 C;  3PUW A;  5IYD G;  5H1S E;  4JI6 L;  2B3G A;  3MEF A;  1VQN A;  2K75 A;  3PF5 A;  4GNX A;  4A3K G;  4PMW A;  3S1N H;  3GTO H;  4A3D H;  1XTD A;  3OTO Q;  3JAM c;  4GN3 B;  4LF5 L;  3KDF B;  4JI6 Q;  3TEH B;  4A4I A;  4Y52 H;  1UE7 A;  1I5F A;  2Y0S G;  1LTL A;  3UDI A;  4JV5 Q;  2K5N A;  4BA2 I;  2LXK A;  5AJ3 L;  1FVI A;  2YU9 H;  5C3E G;  2UXD L;  2EQS A;  3CCE A;  2YTV A;  2E2J H;  4GKJ L;  2JA6 G;  4DUY Q;  3M85 A;  2ZJR A;  3S14 H;  3U4V A;  2PQA A;  3PCO B;  2JA9 A;  1E22 A;  3M7N A;  4IPH A;  1OXU A;  5IYB H;  3PSI A;  4GOP C;  1VQ6 A;  2WB1 E;  1VQK A;  4DV6 L;  1HNW Q;  1N36 L;  3FHW A;  4BBS H;  4A3M H;  3Q8D A;  3U4Z A;  2Q2U A;  4JBM A;  3I2Z A;  1TWH H;  3H0G G;  2WAQ G;  1Q7Y C;  1YHQ A;  1N33 Q;  2XTI A;  1YVC A;  4L5T A;  2OCE A;  1EWI A;  4DUY L;  3I4M H;  5JJI A;  2VQF Q;  2OWO A;  3G48 A;  2MO0 A;  3J7A 5;  4A3J G;  4LF6 L;  2NVQ H;  1X9N A;  3J81 c;  1IYJ B;  3PIP A;  4DR2 Q;  1PH3 A;  4L5R C;  4AQY L;  4JV5 L;  1QVC A;  3ULJ A;  5BR8 L;  2UUA Q;  3F2C A;  1PV4 A;  1GD7 A;  3GTM H;  1VQ4 A;  3KLW A;  4UY8 C;  1UE5 A;  2IY5 B;  3CCL A;  1VS0 A;  2NVY H;  3TQY A;  3U50 C;  1IZ6 A;  4X64 L;  4HJ5 A;  3UDG A;  2NVX H;  3UE0 A;  2R92 H;  1YHA A;  4R4O A;  3OYY A;  1QUQ A;  2E8G A;  4DR2 L;  4DR3 L;  2QEX A;  1BBU A;  4X65 Q;  3BZK A;  4A3I G;  1OXV A;  2NN6 I;  4TVA B;  2F52 A;  1HR0 Q;  1VQE A;  1N33 L;  1K0R A;  3RN2 A;  1Y1V H;  5GAE C;  1N32 Q;  2RHQ B;  2RF4 A;  4JCV E;  5IWA L;  4HJ8 A;  1M1K C;  5IYC H;  1LUZ A;  2A19 A;  1PVO A;  3RLO A;  2JA7 G;  2JEA I;  1HZA A;  1YBY A;  4YCV A;  4APV A;  1R9T H;  2JJQ A;  3PF4 A;  4DNI A;  4HID A;  1PH5 A;  4B3S Q;  2NVT H;  1LM0 A;  5C0X I;  1N9W A;  4GKJ Q;  1IBM L;  3HOU G;  1PHJ A;  5C3E H;  2B63 H;  4DR7 L;  2UXD Q;  1ASY A;  5M3M G;  3ICE A;  1WFQ A;  4GLA C;  1TWC H;  4AYB G;  3GDE A;  1XPO A;  4BA1 I;  2JA6 H;  4A3I H;  3S15 H;  1D8L A;  2ZTD A;  3S24 A;  4JI8 Q;  1KRT A;  1X3E A;  5IYB G;  4HIK A;  1HJP A;  4MZ9 A;  1JJ2 A;  2OQK A;  2HIX A;  3K8A A;  1I94 L;  4A3L H;  4A3B G;  1IL2 A;  3H0G H;  3K7U C;  2BH2 A;  4OWX B;  2VUM H;  1KIX A;  3M4O H;  3RNU A;  2AWN A;  1VQJ A;  4LNQ A;  2I5M X;  1C9O A;  4DUZ L;  4B3M L;  5IY0 A;  4GN4 B;  4KHZ A;  1YHB A;  1TXY A;  2CKZ B;  2CWP A;  5M3M H;  4X62 L;  1K8G A;  2AKW B;  4JI1 L;  3HOY H;  4R1J A;  1J5E Q;  2D62 A;  2LXJ A;  1OXX K;  4BBR G;  4O0A A;  4JI3 L;  1EQQ A;  1BKB A;  4GOP A;  5JJL A;  5IP7 H;  3L0O A;  3I4N G;  2HHH L;  1OTC A;  2WAQ E;  1TWF H;  4JI2 Q;  4DV7 L;  1PH4 A;  1B70 B;  4LUZ A;  2JEB I;  3BZC A;  4EX5 A;  1XMQ Q;  1XNR L;  1UWV A;  1AE3 A;  3HKZ G;  2ASB A;  5C4X G;  1Q1E A;  2OQ0 A;  4DV0 Q;  4JI7 Q;  3T1H L;  1L2F A;  5FJ8 G;  2K52 A;  2KEN A;  4DV5 L;  1KQS A;  3FKI G;  1X3F A;  4LF9 L;  4X6A H;  1YEZ A;  3SGI A;  1WJJ A;  3E9I A;  2UUB L;  3HOY G;  1Q46 A;  1XPR A;  2IHE A;  1I6H H;  1KXL A;  4B3T L;  3NEM A;  4BBR H;  3M3Y H;  5JEA J;  2MFI A;  4K0K L;  4IPC A;  1VQC A;  1Q8K A;  3BU2 A;  4C3J H;  4LFC Q;  4A93 H;  4IO9 A;  4HJ9 A;  3GD7 A;  4DV2 L;  3NBH B;  2RCN A;  2N49 A;  5LMU Q;  2GVB A;  2FXQ A;  3I56 A;  3ULP A;  3HOV G;  1Y1W G;  3HOU H;  5LMN W;  4DV4 L;  3FKI H;  2IX1 A;  2R7Z G;  3PO3 H;  5FLM G;  3NEL A;  4LF8 Q;  4IFD G;  1C0A A;  3HOZ G;  5M3F G;  1N34 Q;  4JYA L;  3B6Y A;  3D31 A;  1NBW A;  3CCM A;  4R4T A;  3KFU A;  1EQR A;  3HKZ E;  4DV3 L;  1K8A C;  1IBK Q;  3J80 c;  2ZTE A;  1VQ7 A;  3CW2 C;  1FJG L;  3RLN A;  4Y7N H;  5GAD C;  4A3L G;  1VQG A;  2VQE L;  3W5O A;  2YV5 A;  3J80 i;  1E24 A;  4AYB E;  1YJ9 A;  2CFM A;  4YHH Q;  3OW2 A;  2EIF A;  4K0K Q;  2UU9 L;  1G6P A;  4MNO A;  4NXN L;  1O7I A;  4DR5 L;  3HOW H;  4KHP L;  3VDY A;  5C0X G;  4KI0 A;  2B29 A;  1NTG A;  1U5K A;  1PH6 A;  4QL5 A;  2KHI A;  5IP9 H;  1I3Q H;  4H02 A;  2E5L L;  4LFB L;  4OWT B;  4C3H H;  2F4V L;  1V9P A;  1W2B A;  4JBK A;  4GLX A;  4X66 Q;  2NN6 G;  2A1A A;  3A0J A;  4QIW E;  1N8R C;  4DR4 Q;  4GNX C;  4OX9 L;  3PGZ A;  2Q2H A;  1HR0 W;  3S1Q H;  3HKS A;  1IBL L;  2NZH A;  1KL9 A;  2Q2T A;  4A3M G;  4DR6 L;  3CPW A;  3E9H A;  3DM3 A;  4J15 A;  1E7Z A;  4PG3 A;  3I4M G;  2I5L X;  4NB3 A;  2AHO B;  3CCU A;  1Q12 A;  4A3J H;  3HOW G;  2JA8 G;  3E0E A;  3J81 i;  2XGT A;  2PNH A;  1MIU A;  2WB1 G;  1L1O B;  4OON A;  4DV1 L;  3PUY A;  4LF7 Q; 
#chains in the Genus database with same CATH topology
 3KBX A;  2F0P A;  2F0E A;  3DM1 A;  3F8T A;  4ZCK A;  3HOV H;  2B2Y A;  4IJH A;  4R4Q A;  3DMU A;  2UUC Q;  5IGF A;  4ALP A;  1KAW A;  5J39 A;  3FP9 A;  2VW9 A;  4DR1 Q;  3GTG B;  4A3K B;  1XNQ L;  1WTX A;  1HNX L;  2EYM A;  3OSO A;  1JC7 A;  5C6A A;  3CCQ A;  2HT1 A;  4ZAI A;  2SOB A;  3HGB A;  4BY7 G;  1LTT D;  5E7N A;  2PQA B;  1QE6 A;  2BCO A;  3A8I E;  1ENC A;  1JT8 A;  1VQH A;  4Q0F A;  2B63 G;  1EY0 A;  3QO2 A;  2X6L A;  1KHI A;  3MTS A;  4P75 A;  4LF4 L;  4HTH A;  2N8N A;  4B3R Q;  2CVR A;  3OIP A;  3CCR A;  1BQQ T;  1EZ8 A;  1MSH A;  3JC6 6;  4JI5 Q;  5IYD H;  1D1K A;  2KCT A;  2SNS A;  3IRB A;  4QUF A;  1HUN A;  3R2I A;  4YCW A;  4M1U B;  1EY4 A;  3PMF A;  3RZO H;  4JI5 L;  3H15 A;  5G3L D;  5FLX c;  1IXR A;  4HCS A;  1EOT A;  1K28 A;  4KHV A;  2E2I B;  3LWU A;  5EKI A;  4H7B A;  5LMN L;  3HOY B;  1PLF A;  3I4N H;  5JJK A;  4CDD C;  3W1B A;  5EPJ A;  3K0X A;  4XQN A;  1X3G A;  2E75 C;  2B2U C;  1VQ5 A;  1PFN A;  1JJC B;  1TWF B;  3UDF A;  1VQI A;  1WVL A;  1I50 B;  5E4W C;  4XT3 B;  1KNE A;  2LS0 1;  4IPD A;  1CA5 A;  4LUV A;  2BE5 D;  4LFC L;  3HOX H;  1H9R A;  3ERS X;  4DKA C;  2D0O A;  1SDF A;  2D2C C;  3KF6 B;  1NMG A;  1WCM G;  4C3I B;  3GV3 A;  4A3K H;  2UUC L;  3H94 A;  3A55 A;  4C3J B;  4A93 B;  4DV1 Q;  2L0C A;  1NY4 A;  1W6K A;  1BCP D;  1HPC A;  3K80 C;  1ZYR D;  4HJA A;  3TP6 A;  4HED A;  2JN4 A;  4R9W A;  3ZJY C;  1SFO B;  3FEW X;  3NPP A;  2IWH A;  2DJF C;  3L2P A;  5FO7 B;  3FPP A;  4J1M A;  5GAG C;  4CGY B;  2K33 A;  2UXC L;  1IW7 D;  3FRP B;  4FDB A;  4A3E G;  4LFA L;  2Y0S B;  1MBY A;  2HUG A;  2L12 A;  1GUS A;  2NVQ B;  1DGS A;  5TSS A;  4C56 C;  2Z8L A;  3LX0 A;  1JOK A;  4JI8 L;  2MO1 A;  3TZU A;  4A3G H;  1SE8 A;  4N9T A;  2R93 H;  3L7Z C;  1TWA H;  1O7L A;  4A93 G;  1ICW A;  4K2K A;  3CCV A;  1PRT D;  1EEF D;  4HMJ A;  4NPS A;  1PH1 A;  1I3Q B;  4LF7 L;  1YJN A;  2F4V L;  1M8A A;  4AIM A;  2B2W A;  1CKN B;  4U68 A;  2F03 A;  1E1T A;  1DON A;  3PIO 3;  3KLS X;  2NTS A;  2HDL A;  3PO3 G;  4IUP A;  3PO2 H;  5FLM H;  4DV3 Q;  3MXG A;  3TRZ A;  1GUO A;  1BOS A;  1Y1V G;  1SEB D;  5IP7 G;  1SYG A;  3WWV A;  2PZT A;  5DLQ E;  1I50 H;  2EYH A;  4LMQ D;  4MHE A;  2ATW A;  2Z6K C;  4RMF A;  1YIJ A;  3S15 B;  1V1P B;  2EOT A;  1SSO A;  3J80 L;  2B8F A;  3RZD H;  4A3F B;  3W1G A;  1YIT A;  1TT2 A;  2L1B A;  3M4P A;  4A3D B;  2CH4 A;  4AQY Q;  1CSP A;  2V4D A;  4QCL A;  3G6J B;  4JOI A;  1V1O A;  4BXX G;  1SR3 A;  2F0F A;  1Y8P B;  2EJF C;  3SXH A;  1VQA A;  1YJW A;  4B3S L;  4JI7 L;  2VUM G;  1QJO A;  2PO4 A;  3KDF A;  3NSW A;  1FJG Q;  2AUK A;  5EAY A;  1N36 Q;  1PH7 A;  2R7Z H;  1VQB A;  2CWA A;  2XVS A;  5IE8 A;  2GVA A;  3FPU B;  3CPF A;  3GTP H;  4JI1 Q;  4DNT B;  3VR2 A;  1TWG H;  4PV1 C;  3F1Z A;  3CC7 A;  1YNN D;  1LT3 D;  4MTN A;  2JA5 H;  3EQL C;  2LMC B;  4GN5 A;  3MFG A;  4BBS G;  1BBW A;  2NUC A;  1STG A;  1AFP A;  1L1O C;  1W3S A;  4ZUJ A;  1VQF A;  3STB D;  2B2T C;  2EXD A;  5ELN A;  4ULL A;  4POG A;  4IN3 A;  2AWO A;  3QJY A;  5M5Y B;  1ILQ A;  1FGU A;  3H3V H;  1TR5 A;  1Y1W B;  1AE2 A;  1K8M A;  4DV0 L;  1EWH A;  3A5Z B;  1Q8I A;  4KKU A;  2E2I H;  3MA2 B;  4QF4 A;  4HSV A;  3PO3 B;  5COR A;  2F0L A;  1XWE A;  4IUV A;  3C46 A;  4P74 A;  1Z6H A;  2ZJQ A;  1N32 L;  2K5Q A;  2WFW A;  4DA2 A;  3J81 E;  2QA4 A;  1F9R A;  1DYQ A;  3CC2 A;  1CHQ D;  4BWG B;  4X62 Q;  4GZY C;  1D1I A;  1LT5 D;  4O1N A;  3BG3 A;  1WTP A;  2QDL A;  4B9X A;  1KC8 C;  3L3O C;  3EVQ A;  4DU9 A;  3FMC A;  5H1S E;  3SE0 A;  3K57 A;  2K75 A;  4A3K G;  4A3D H;  4GN3 B;  5CBA E;  3TZD A;  1RD9 D;  3KDF B;  2Y0S G;  1LTL A;  5EGT A;  4CKE A;  2PQE A;  4CJ0 B;  2YU9 H;  3H0G B;  2UXD L;  2EQS A;  2QIL A;  4C3H G;  2E2J H;  1ONL A;  1WTR A;  4XQJ A;  2JA9 A;  4K5V A;  3M7N A;  4V19 0;  4IPH A;  3PSI A;  3K0Y A;  3K59 A;  5EJW A;  1F2Z A;  2KEE A;  3H0G G;  5KGU A;  5JJI A;  3G48 A;  3J7A 5;  4A3J G;  2AUJ D;  1DOM A;  1MI2 A;  2F0G A;  4O42 A;  4JV5 L;  3F2C A;  1UE5 A;  4RHR A;  4KD3 A;  3TQY A;  1F77 A;  3CRL C;  1VMC A;  1NR2 A;  5C5L A;  3OYY A;  4DR2 L;  4KV6 A;  4A3I G;  2F0U A;  2NN6 I;  3FKI B;  4H44 C;  3K7A B;  1Y1V H;  3NE5 B;  5IWA L;  5T1G A;  3ND9 A;  1LT6 D;  4KD4 A;  1KTK A;  1YBY A;  5HGT A;  1R9T H;  4DNI A;  4B3S Q;  4Y7N B;  5C0X I;  1IBM L;  1CZG A;  1IL8 A;  4GLA C;  4FF2 A;  2JA6 H;  4BA1 I;  1W6J A;  4N8F A;  2FJ2 A;  2CH4 W;  1HCZ A;  5JPM C;  1LTA D;  1MD2 D;  1X3E A;  5IYB G;  5FLX L;  1TS3 A;  4HIK A;  2OQK A;  1DOK A;  2XWB B;  4IUN A;  3K7U C;  2VUM H;  4OWX B;  1PZJ D;  2B2V C;  1YHB A;  1TXY A;  4U67 3;  5M3M H;  4NW2 A;  3BVZ A;  1OXX K;  4BBR G;  5JJZ A;  5JJL A;  4A3M B;  1B1Z A;  1D5M C;  2X69 A;  4JI2 Q;  1PH4 A;  1B70 B;  2EY5 A;  3BZC A;  4LUZ A;  4B08 A;  4IUR A;  1Q1E A;  3QIA A;  2KA7 A;  4HMI A;  1L2F A;  3I70 A;  1YEZ A;  3MVV A;  5CV4 A;  1KXL A;  2MFI A;  1UNS A;  4FNF A;  3BU2 A;  4X3K A;  4A93 H;  2BDO A;  2N49 A;  4CJ2 C;  2FMM A;  3I56 A;  4FXD A;  1F2Y A;  3HOU H;  4KY5 A;  3Q0A A;  5JAV A;  4DV4 L;  3PO3 H;  1C0A A;  5FLM G;  3IFD A;  1U4L A;  3A7A B;  5KYI A;  2Z4I A;  3GTJ B;  3OMC A;  1EQR A;  3HKZ E;  2JA7 B;  1JIC A;  1K8A C;  1IBK Q;  1WD1 A;  3W5O A;  2YV5 A;  3DEP A;  1S5D D;  2HD3 A;  1DCZ A;  5ELF A;  1TKW B;  3X3M A;  4MNO A;  2TSS A;  3DEO A;  2A6E C;  4HCE A;  4OIJ A;  1NTG A;  3RZO B;  5IP9 H;  2Z1C A;  2E5L L;  5COY A;  4LFB L;  1VDZ A;  4C3H H;  3D6W A;  2EY1 A;  4GLX A;  4ZQ3 A;  3A0J A;  1SNC A;  3VYR A;  1AN8 A;  1N8R C;  3OIQ A;  3OHX C;  2AQ1 B;  3ITP A;  3VA5 A;  1VF5 C;  4K5X A;  2A68 C;  2D5D A;  4CDC C;  3S16 B;  1JB3 A;  2AQ2 B;  2BOS A;  1HA6 A;  4J15 A;  1XXG A;  3R93 A;  1H9S B;  4PG3 A;  4WRD A;  5JVH 3;  3CCU A;  4A3J H;  2E2D C;  2XGT A;  4FF4 A;  2K6A A;  1LLR D;  1EYG A;  2DUD A;  3MXN B;  1OXS C;  4A3F H;  3NBH A;  4BY1 G;  3T51 B;  1UE1 A;  1JQY D;  2IL8 A;  3WOE A;  2VL6 A;  1D2B A;  1STY A;  1K3B C;  3ND8 A;  4B3R L;  1Q81 C;  4LF4 Q;  1U0L A;  2R6G A;  1SNQ A;  2QEJ C;  4EQ5 A;  1CUK A;  3GTK H;  3TRE A;  4ZKC B;  4UP8 A;  1F9S A;  1VQM A;  3NK9 A;  1SFO H;  1JE4 A;  1ET6 A;  2OTJ A;  5I2X A;  1B7Y B;  1XMO L;  1S5C D;  3S17 H;  4OO1 G;  1GO3 E;  4JI0 Q;  4PZ6 A;  2UXB Q;  3F2D A;  2E5L Q;  4LFB Q;  1UE6 A;  1XNQ Q;  5GRO A;  5C44 H;  1K73 C;  3HRZ C;  1TWC B;  2PW7 A;  4YIJ A;  4DR1 L;  4X3T A;  3KF8 B;  1O7Z A;  1LTR D;  5LL6 S;  4JOI C;  2JQO A;  4A3D G;  5BN5 A;  3OMG A;  1SYD A;  3PUZ A;  1P16 A;  2O2L D;  2ZM6 L;  3MC0 B;  1GKH A;  1TU2 B;  3M4O B;  1SYE A;  4QMG A;  3BDO A;  3A8K E;  4JPB W;  4H0L C;  4KY6 A;  3S16 H;  1QZH A;  2BE5 C;  1H95 A;  1I4G A;  2D9U A;  4WJW A;  4K8J A;  4RA8 A;  4YWL A;  3AFQ A;  1G91 A;  1LV9 A;  2N78 A;  3T1Y L;  1A15 A;  2RBM A;  1AZQ A;  3S1R H;  3H3V I;  3HKZ B;  4J6H A;  1EY7 A;  1SLJ A;  1A3U A;  5ISR A;  1UEB A;  1PA6 A;  4GLV B;  4JI4 Q;  2LFN A;  3IFT A;  1Q3L A;  5EBD A;  4R8N A;  1B4O A;  4JBJ A;  4OL7 A;  4K0K L;  4DAM A;  4DPG A;  1KAB A;  3W2D A;  4DK1 A;  4YY3 Q;  5BN4 A;  2DY8 A;  1IW7 C;  2KOL A;  3SK8 A;  3CC4 A;  3SK5 A;  1S40 A;  2KCM A;  2F3I A;  1QZG A;  4KJN A;  4DK6 C;  2AQ3 B;  4K5W A;  5JEA G;  2G9H D;  3NBI A;  1SMY D;  1NMF A;  3JAM i;  2CW0 D;  4OGQ C;  1ET9 A;  1T5X D;  1EIY B;  3GTQ H;  4NXM L;  1BCP F;  2A6H C;  4A3C H;  3E5S A;  5FJ8 H;  5LMU L;  1HNZ L;  1FNW A;  3MFY A;  3OPO A;  1HZB A;  2JA5 B;  2ID0 A;  4GS3 A;  1MSG A;  1U9R A;  3F2U A;  4R4I A;  5IP9 G;  2HDM A;  1I4P A;  1SMX A;  4ZYS A;  1BXT A;  1RDP D;  2EE1 A;  3CQZ H;  4RG1 A;  4DV7 Q;  4ME3 A;  5M9O A;  4FXK C;  5IWA Q;  2A74 C;  3VR3 A;  2ICE C;  3CCS A;  1N34 L;  2C35 B;  3TME A;  2A69 D;  1Y14 B;  1LTS D;  3LNN A;  1HQR D;  5ELC A;  2PW5 A;  3ER0 A;  1S3O A;  3DUZ A;  1SNP A;  1C7Y A;  4A3F G;  1HFN A;  2G9D A;  4DAY B;  3MWY W;  1A8V A;  2HCI A;  3UI2 A;  3M7G A;  3G6E A;  4WOR A;  1PFM A;  3WDN A;  1LTI D;  2F0Q A;  1K83 H;  3EBE A;  4C3I H;  4NXN Q;  2F0N A;  1T5E A;  4KKS A;  3CD6 A;  1LTB D;  4DN4 M;  1QVG A;  4GNX B;  4RAU C;  1WTH A;  1OXT A;  2E2J B;  1QCB D;  4NDX A;  5M3M B;  3D0F A;  2F0V A;  4G7H C;  1QNU A;  4PQX A;  4YWM A;  3ZYY X;  2HHH Q;  1NNX A;  2ZJP A;  1GM5 A;  4OO1 H;  2MNA A;  2K5V A;  5ELE A;  3SK4 A;  3R8B A;  3K81 C;  4ZK9 B;  4MTK A;  2R93 G;  2F3W A;  4B3M Q;  1KD1 C;  2VB2 X;  4JVZ A;  4DR3 Q;  3TS2 A;  4QY7 A;  5E3F A;  1I94 Q;  1SNO A;  3A7L A;  2RDF A;  2XN9 C;  1Q1B A;  1PRT F;  3HP3 A;  1YNN C;  3BVG A;  3WOF A;  2IHF A;  2BH8 A;  1ILP A;  1WTW A;  2L55 A;  1CKO A;  4ABN A;  5AFW A;  3RR5 A;  1QVF A;  2ALY B;  2KED A;  1C8C A;  4LF6 Q;  1V43 A;  3J81 j;  4YCU A;  4FXG C;  1HRJ A;  2IT1 A;  1XMQ L;  2WB1 B;  5GQO A;  3LWE A;  1JMC A;  4CDF C;  1TS5 A;  1E1O A;  2XRQ D;  3GQB A;  5M3F H;  1TII D;  3W3A A;  1HFG A;  4ZKB B;  1J5E L;  1LAB A;  3HFZ B;  1X6O A;  2RSO A;  2IX0 A;  4BXX H;  1G2S A;  4FO2 A;  4OEM B;  3RZD B;  2B3G A;  1FYC A;  2E74 C;  1K83 B;  3S1N H;  3GTO H;  1GUG A;  1ESF A;  3I73 A;  4JI6 Q;  2LXK A;  4C2M B;  3S2H B;  5JPN C;  5C3E G;  2CW0 C;  1I4H A;  1EIG A;  4GKJ L;  3AMU A;  3I91 A;  1AZP A;  1EYA A;  3P75 A;  3U4V A;  2QDB A;  3GV6 A;  2PQA A;  1TY2 A;  3V2T A;  1E22 A;  1M4V A;  2M9V A;  4PMC A;  1ZXT A;  4GOP C;  5KIX A;  1N36 L;  1AP0 A;  4BBS H;  1PTO F;  4G4K A;  1N33 Q;  3C1E A;  1B9N A;  1YHQ A;  2XTI A;  4DUY L;  2VQF Q;  1R4Q B;  2NVQ H;  1E2V A;  1IYJ B;  4DNR B;  2JXM B;  4AQY L;  1PV4 A;  4UY8 C;  3KLW A;  2IY5 B;  3CCL A;  1VS0 A;  3HEJ A;  3EJI A;  2XRS D;  3U50 C;  4HJ5 A;  5CBE E;  2NVX H;  3UE0 A;  5I9P A;  1F2L A;  2E8G A;  1X3Q A;  3GTK B;  1NR4 A;  1U4R A;  1HR0 Q;  2F52 A;  1N33 L;  1X3P A;  2RF4 A;  4JCV E;  3HOZ B;  1B44 D;  1G8Z D;  1I4R A;  1C4Q A;  1PVO A;  1HZA A;  4APV A;  5FOB B;  1FD7 D;  2JJQ A;  3PF4 A;  2RSN A;  3NP8 A;  2QF7 A;  1STE A;  2IJ0 A;  1N9W A;  2K5D A;  3K5O A;  4GKJ Q;  4F87 A;  5KEE A;  3BS1 A;  4RGT A;  4DR7 L;  1ASY A;  1TWC H;  1O80 A;  1XPO A;  3S15 H;  1LT4 D;  4JI8 Q;  2EPB A;  5G3L F;  1HJP A;  3IAY A;  1JJ2 A;  5IGC A;  1JOQ A;  1B9M A;  4A3B G;  3H0G H;  3NHH A;  1NSN S;  4C3H B;  3T16 A;  3RNU A;  2K7V A;  2AWN A;  1C9O A;  2K04 A;  3SDZ A;  4RGO S;  1K8G A;  1D6E C;  3HOY H;  2AKW B;  1J5E Q;  2LY7 A;  2L11 A;  5NUC A;  2I07 B;  1CQF A;  1GJX A;  2FHT A;  3PQI A;  1L0X B;  1I6V C;  1SYF A;  2NYZ D;  3NWS A;  5D65 A;  2KUM A;  1XMQ Q;  3HKZ G;  1AE3 A;  5C4X G;  5FJ8 G;  2K52 A;  1KDA A;  1KQS A;  4DV5 L;  4X6A H;  5A35 A;  2UUB L;  1XPR A;  1EY9 A;  1V1P A;  4B3T L;  3M3Y H;  4DAY A;  1RJT A;  4IPC A;  2KJX A;  5C4J B;  1XYI A;  1Q8K A;  5EPL A;  4C3J H;  4LFC Q;  3NBH B;  3D4R A;  2FXQ A;  2XSC A;  3ULP A;  1GUT A;  3FKI H;  4L8J A;  3NEL A;  5M3F G;  2EJM A;  5KYL A;  1SE2 A;  5C0X H;  3CCM A;  3MXP A;  4R4T A;  5M3F B;  4HSP A;  1WTQ A;  2OEO A;  2ENB A;  2WAQ B;  2ZTE A;  3CW2 C;  3RLN A;  3S2D B;  1H9M A;  4Y7N H;  2VQE L;  4FF3 A;  3J80 i;  1UEA B;  4YHH Q;  2EIF A;  2JA6 B;  1ML0 D;  4NXN L;  1WD0 A;  4DR5 L;  4KI0 A;  2B29 A;  2BDN A;  1DM0 B;  3E0J A;  3PIP 3;  4H02 A;  4ZLT F;  1PDQ A;  4OWT B;  4TKO B;  2YU9 B;  1V9P A;  4IZ8 A;  2NN6 G;  2A1A A;  3M4Y A;  4XYO A;  2Q2H A;  1HR0 W;  4ZRZ A;  3TSS A;  2Q2T A;  3DXJ C;  3CPW A;  1CT1 D;  3R2T A;  2I5L X;  2AHO B;  1Q12 A;  2F0K A;  2RCF A;  3E0E A;  3J81 i;  3I4L A;  2ES2 A;  3BVM A;  1VQO A;  4G7Z C;  2L4N A;  3G4S A;  1EEI D;  4QGU A;  2B8G A;  4JYA Q;  4AYB B;  1X54 A;  4QIW B;  4HJ7 A;  1WTO A;  5CV6 A;  1FNU A;  3DWQ A;  1ICF B;  2SNM A;  1LYL A;  3DWP A;  1A0I A;  2IW3 A;  3AQQ A;  1CZW A;  3CMA A;  3QG1 A;  1E3P A;  1YI2 A;  1S4Z A;  2J7Z A;  1Y69 U;  4CBV A;  5ELB A;  4G7O C;  5CGK A;  2Q2I A;  3J7Y W;  4L5S A;  3ONA B;  1HNZ Q;  2A6E D;  4NXM Q;  2PYK A;  5LHY 1;  3STB C;  3IKJ A;  2F0H A;  3S1M H;  5IT9 L;  4GKK Q;  2F4I A;  1TWG B;  1PYW D;  5FK9 C;  4X66 L;  1PH9 A;  1PRT B;  4ODG A;  4UHV A;  2WII B;  4OWW B;  2NVT B;  1FR3 A;  3EA6 A;  1S5E D;  4JW0 A;  1WOC A;  1BR9 A;  3A74 A;  2N55 A;  1BCP C;  4KHP Q;  2K5H A;  4FYD A;  1SRU A;  4BY7 H;  1L1O B;  4POF A;  3AB9 A;  3BZD B;  3OWE B;  4A3G B;  1GUN A;  2R92 G;  3TDQ A;  1SAP A;  4CJ1 B;  5E4X A;  2EY6 A;  1JWU D;  3J7Z C;  2I46 A;  2KBN A;  3OW7 A;  3SK6 A;  2LSS A;  3J7A V;  3HOX G;  2KEC A;  2GA4 B;  4C1N K;  1QB5 D;  1VQ9 A;  1WCM H;  1UAP A;  3CU7 A;  4S3S A;  1IBL Q;  4BY1 H;  4ME5 A;  2DY7 A;  4HIM A;  1EQT A;  1YNX A;  3VR4 A;  2R7D A;  1B3Q A;  1E2W A;  1G29 1;  4TRD A;  4QJF A;  1CQV A;  2KHJ A;  1EU4 A;  4L6T B;  1ZEQ X;  4XTC S;  2VNU D;  3H3V C;  1RTO A;  2ZT9 C;  2K50 A;  1UUP A;  5A2Q L;  3GTG H;  4DXF A;  4BBR B;  4RCN A;  4IFD I;  3V96 A;  3QWN A;  4C2M H;  5C4J H;  3AFP A;  4JYA L;  5HGQ A;  3KOJ A;  3K58 A;  2NWG A;  4CDE C;  4P73 A;  3P20 A;  3E3X A;  3KK7 A;  3JAM E;  1WI5 A;  1SN8 A;  1L0W A;  5A2Q E;  2SEB D;  3ERO A;  2R7Z B;  2C5C A;  1IKL A;  4X3U A;  3S17 B;  3U9S A;  2OTL A;  1STB A;  1VQP A;  2BA1 A;  4GOP B;  1A2U A;  2K5W A;  1MKH A;  4LK1 C;  1B3A A;  4RWS C;  3PO2 G;  2EXZ A;  2F0T A;  4LWC A;  3GTM B;  2MPM A;  4QQB X;  4B9W A;  1EYD A;  1PH8 A;  2NTT A;  2RHS B;  4DR5 Q;  5M5X H;  1AW7 A;  3EFX D;  1H9K A;  4JG2 A;  4A3E H;  4LF9 Q;  1STA A;  1G51 A;  1A3V A;  5FO8 B;  3U58 A;  2JE6 I;  4A3B H;  3VYS A;  3I55 A;  5M5Y H;  2F0M A;  2VQE Q;  2O5J C;  2PZW A;  2HCC A;  4LW1 A;  1Y1W H;  1XNR Q;  1G6Z A;  4UAI A;  1K9M C;  2F0O A;  1GUW A;  1STN A;  1PYS B;  4EQN A;  3UE1 A;  5J3B A;  2YYZ A;  1RL2 A;  3K5M A;  3RD4 A;  4JI3 Q;  4LAA A;  4A3G G;  4UDU C;  5IYC G;  4X65 L;  1EY6 A;  5IOD A;  2ZTC A;  3CF5 A;  4MIU A;  4DUZ Q;  2G5D A;  1KNA A;  2KHS A;  2BA0 A;  4LJZ C;  3VYT A;  4F88 A;  4A3J B;  1D7Q A;  5C4X H;  2L15 A;  2PCF B;  4UP7 A;  2K05 A;  4CKB A;  1JJG A;  2VS1 A;  1BCP B;  1SRO A;  4Q5V A;  1QIL A;  1HZ9 A;  5HY6 A;  4XDX A;  2NB0 A;  3F2B A;  5JEA H;  4IFD J;  2KQ3 A;  4OXP A;  2WP8 J;  4C3J G;  4DK3 C;  5KNC A;  5DM6 3;  3SHL A;  3GP7 A;  1ROD A;  5I2Y A;  4AH6 A;  1IBK L;  4E6I A;  3A5U A;  1CSQ A;  2K01 A;  3NXW A;  3U9O A;  1FNV A;  2VY3 A;  2O5I C;  3CXC A;  3MHB A;  1EIF A;  3GTQ B;  3M9B A;  1A62 A;  1CKM A;  5D3I B;  1SJE D;  5FKA C;  2H5X A;  4DK0 A;  1EUJ A;  2R7F A;  3L9A X;  2H1E A;  1O7Y A;  5DEH A;  5KND A;  5C44 B;  2NBF A;  3M4Q A;  3OTO L;  3T13 A;  4X64 Q;  1X56 A;  1PTO D;  1D5X C;  3CHB D;  2F0J A;  4XIG S;  3CCJ A;  4A3E B;  1DOL A;  5BR8 Q;  3QOJ A;  4DR7 Q;  3DWA A;  1A63 A;  1V1Q A;  1CTM A;  4QUC A;  1NUC A;  3CAM A;  2NN6 H;  4P72 A;  1Z47 A;  3VR6 A;  5CMD A;  1H9S A;  5C3X A;  3GTJ H;  2N3S A;  4UP9 A;  4C3I G;  1HR0 L;  1L1O A;  3S2D H;  4HIO A;  5EQ0 A;  4HN7 A;  2Z6B A;  3D4D A;  5AJ3 Q;  5IGB A;  3PUW A;  1I4Q A;  2F0S A;  2O4X A;  1Y8N B;  4OIK A;  3PF5 A;  4PMW A;  4DFA A;  4OEL B;  3JAM c;  4LF5 L;  3QR8 A;  3A54 A;  3A56 A;  1I5F A;  3UDI A;  2K5N A;  5AJ3 L;  2B2W C;  1FVI A;  4ID6 A;  1EQV A;  3CCE A;  2YTV A;  4F8M A;  4DUY Q;  1HXY D;  3PCO B;  3TN2 A;  4XT1 B;  1OXU A;  2N88 A;  1WTV A;  1VQ6 A;  1KDB A;  1VQK A;  4DV6 L;  1HNW Q;  5KRU A;  4MN3 A;  4A3M H;  3Q8D A;  2Q2U A;  1SXT A;  3I2Z A;  4KN4 C;  2VB3 X;  2WAQ G;  1YVC A;  5I6W A;  2OCE A;  1EWI A;  3HG9 A;  3I4M H;  2OWO A;  2MO0 A;  1BF4 A;  3PIP A;  4DR2 Q;  4L5R C;  3HOV B;  1QVC A;  4RGM A;  4RKB A;  5BR8 L;  2UUA Q;  3KF8 A;  1GD7 A;  2K03 A;  1I6H B;  4NP5 A;  3T53 B;  4X64 L;  4K2L A;  4N9P A;  2EYP A;  1CI3 M;  2R92 H;  2RVL A;  1QUQ A;  1STH A;  4IUU A;  2B2V A;  1BBU A;  2ZXP A;  3FDT A;  4EVO A;  3NQT A;  1R4P B;  5I9O A;  3PO2 B;  3MXU A;  1K0R A;  3RN2 A;  5GAE C;  3Q23 A;  4HJ8 A;  1M1K C;  5IYC H;  2A19 A;  5DAU A;  2JA7 G;  1ENA A;  4YCV A;  1CM9 A;  3O13 A;  3CKI B;  1PH5 A;  4EQP A;  2KCC A;  2DN8 A;  1SYB A;  5C3E H;  2UXD Q;  5M3M G;  2WAC A;  5IGE A;  3GDE A;  4A3I H;  1RKN A;  1K0S A;  3H6M A;  4J8Q A;  5C3W A;  3S24 A;  1KRT A;  3E6Z X;  4CKC A;  3K8A A;  3K5L A;  1I94 L;  3J81 L;  1GHJ A;  1O78 A;  3C3L A;  3J7A F;  4A3L H;  1IL2 A;  1JWM D;  2BH2 A;  1HTP A;  3M4O H;  2EYO A;  4LNQ A;  1VQJ A;  2I5M X;  1TQO A;  1H9J A;  4DUZ L;  4B3M L;  4KHZ A;  4X62 L;  2CKZ B;  2CWP A;  5M5W B;  2K1B A;  3KLS A;  4R1J A;  2LXJ A;  2QW7 A;  1WCM B;  3TP8 A;  4JI3 L;  1BKB A;  4HR7 B;  4GOP A;  3QB3 A;  2HHH L;  1Y8O B;  2WAQ E;  1QOH A;  1VMP A;  4P2C B;  1PZI D;  2WKD A;  1KDC A;  1XNR L;  1UWV A;  3S1R B;  2ASB A;  1F2M A;  2B2Y C;  4DV0 Q;  3T1H L;  2KEN A;  4LF9 L;  3HOX B;  1WJJ A;  5CV8 A;  1Q46 A;  2L5T A;  1I6H H;  3NEM A;  4BBR H;  1ZKO A;  4JK1 C;  2PZU A;  2MGS A;  1VQC A;  2NVX B;  4IQZ A;  3GD7 A;  2RCN A;  2L9H A;  1BNZ A;  3HOV G;  1Y1W G;  1LO5 D;  3KBG A;  2Q8I B;  2IX1 A;  4IFD G;  1N34 Q;  1KLU D;  4I7Z C;  2M2L A;  3B6Y A;  2E2H B;  2MUY A;  2R61 A;  1ZYR C;  5I6Y A;  1R9T B;  2RDH A;  3J80 c;  1VQ7 A;  1FJG L;  2KVM A;  5GAD C;  3K6O A;  2B63 B;  4XYQ A;  1QNK A;  2M00 A;  1E24 A;  4AYB E;  1YJ9 A;  1RCV D;  3OW2 A;  3DHQ A;  4A3I B;  2UU9 L;  1TVX A;  1O7I A;  5M5X B;  3BDL A;  3HOW H;  4BY7 B;  3MZ5 A;  3I3C A;  3S1N B;  1EWC A;  2RA4 A;  2ZXO A;  2DJG C;  1I3Q H;  2EYJ A;  1MGS A;  1TS4 A;  1W2B A;  4I7A A;  1HQM C;  4DR4 Q;  2F1M A;  4OX9 L;  3PGZ A;  1DJR D;  1E0B A;  1IBL L;  2NZH A;  1JWS D;  2RKS A;  4KKT A;  1HUM A;  4A3M G;  3E9H A;  1S5B D;  3K5N A;  1CA6 A;  1GHK A;  1ESR A;  5FLX E;  1E7Z A;  3I4M G;  4NB3 A;  1B2T A;  2JA8 G;  3I4M B;  2PNH A;  2F4V Q;  3PUY A;  4LF7 Q;  1X32 A;  4YY3 L;  3AU7 A;  3BJU A;  5J1Z A;  4PZ7 A;  2I0Q A;  1P8L A;  2EDG A;  4BS9 A;  1EU3 A;  2XNA C;  2A5H A;  2MJ8 A;  1T9H A;  4JI4 L;  3I8Z A;  3SEB A;  2EY2 A;  1MHW C;  5L37 A;  2DGY A;  4R8I A;  1MJE A;  3BYT B;  4TQU S;  4F7X A;  1PH2 A;  1VQD A;  5ELO A;  4IJL A;  3ERQ A;  3T1Y Q;  3C2P A;  5IGD A;  3PV0 A;  4GKK L;  1ASZ A;  1Q82 C;  3K7A H;  4LFA Q;  2UXC Q;  2H4O A;  2JK8 A;  2A8V A;  3UDX A;  2AMC B;  3KJP A;  4OX9 Q;  1SYC A;  4DR4 L;  3TS0 A;  4XQQ A;  1RHP A;  1JCK B;  4FF1 A;  3EN2 A;  3KYH C;  1PYB A;  2ZM6 Q;  3Q22 A;  1EY8 A;  2YTX A;  4LUO A;  5IOC A;  1DZ1 A;  1PTO H;  2QCP X;  1SNM A;  3HS0 C;  1CFM A;  2D0P A;  3LGJ A;  2UU9 Q;  1NJI C;  3D3R A;  1M90 C;  2K28 A;  1Z7T A;  3SVM A;  4ZUI A;  2PI2 A;  2CCZ A;  4A3B B;  2MQH A;  3VA7 A;  2UXB L;  4FP5 D;  3I90 A;  1VF7 A;  1LTG D;  1RIP A;  1RTN A;  5C44 G;  4JI0 L;  1FGB D;  3RUZ A;  2NZO A;  3P1H A;  5M5W H;  3D4W A;  4O2D A;  3PUX A;  4DF7 A;  1XMO Q;  4A75 A;  5DM7 3;  5CR3 A;  2Z6K A;  2F0W A;  4K14 A;  5LMN Q;  2CHB D;  3BDC A;  1CHP D;  5K36 H;  5C4X B;  2B39 A;  1XTC D;  1YZ6 A;  5EKL A;  1AH9 A;  4DAP A;  2DNE A;  3P7J A;  2Z0S A;  1EOV A;  3D8G A;  3KJO A;  1S72 A;  2FFK B;  3GO5 A;  3NTH A;  3HZX A;  2E76 C;  4YHH L;  1JB7 A;  4P71 A;  5IGG A;  3G7L A;  4PZ8 A;  3T1H Q;  3URY A;  3H91 A;  1BVS A;  1B50 A;  1NCV A;  1II3 A;  4IPG A;  4DAV A;  4A76 A;  4NKL A;  2A69 C;  4IFD H;  1BUV T;  5F2D A;  2ICI A;  2X6G A;  2HIV A;  1K3R A;  1HH2 P;  1VQL A;  4WJ3 M;  3TP5 A;  1IHZ A;  4OO1 I;  3NTK A;  3NTI A;  2V1C C;  1X55 A;  3EIV A;  1B8A A;  2RQX A;  2E2H H;  2HQL A;  2PMZ B;  3GTP B;  2JA7 H;  2F0D A;  4RH6 A;  4UPA A;  3GTL H;  4ILW A;  1XJV A;  3DLL A;  4X3S A;  1HNX Q;  1PRT C;  4KLK A;  4YWK A;  1D5Z C;  2VZA A;  2NVY B;  5CC4 A;  2YTY A;  3CRK C;  3NEN A;  4B3T Q;  2A6H D;  5D3D A;  2F3V A;  5IT9 E;  5ELD A;  2UUB Q;  4RFB A;  1PFS A;  2CQO A;  1NE3 A;  3OWF A;  2RDG A;  3RLF A;  1Z9F A;  3KUP A;  4RCO A;  4I65 A;  4DV5 Q;  3I7F A;  2Z4H A;  3I4O A;  5CV7 A;  2PNR C;  1J6Q A;  2JA5 G;  4DV6 Q;  1NAP A;  2K4K A;  4A3C G;  4JC0 A;  4JBW A;  4N8X 1;  1KLG D;  3S1Q B;  3N6R A;  3PUV A;  1SE4 A;  1DXM A;  4EGV A;  2QKI C;  5C0X J;  1XPU A;  4DR6 Q;  3T4A C;  4WJ4 A;  1V8Q A;  4DV4 Q;  2CQA A;  3RN5 A;  3OOC A;  2Y0S E;  3AEV A;  1SBB B;  3KF6 A;  1GVP A;  2SDF A;  4L5Q A;  2JA8 B;  4EQO A;  3ULL A;  1F9P A;  2QGQ A;  4IOC A;  2J4X A;  3VR5 A;  5CV9 A;  4KTA A;  1MJC A;  2UUA L;  3NUC A;  2OF1 A;  3KLR A;  3IL8 A;  2Q8R E;  3S2H H;  2PI2 E;  2EYF A;  2TMP A;  5C5M A;  3CME A;  5J22 A;  1JR0 D;  2PPB C;  3AYH B;  1Q86 C;  3S14 B;  2I5H A;  1EFW A;  4JI2 L;  1A2T A;  5T1I A;  4IAL A;  1HNW L;  3S1M B;  1FL0 A;  5EKK A;  3PIO A;  3TP7 A;  5IT9 c;  1GOZ A;  2A73 B;  1U4P A;  4LF8 L;  3Q24 A;  3GTL B;  3T56 B;  2IX3 A;  2WV6 D;  1JOO A;  2FMC A;  4H13 C;  5GAH C;  1VQ8 A;  4IOA A;  1TY0 A;  1VCI A;  4DV2 Q;  4LF5 Q;  2FIN B;  4KN7 C;  1PTO B;  3M3Y B;  3MXN A;  2KCN A;  3V05 A;  1RF2 D;  4KY7 A;  1CKN A;  4IUQ A;  1TWA B;  1X65 A;  2GN5 A;  4IUT A;  5C4Z A;  3MAQ A;  3HOW G;  1PXU A;  1IYU A;  3NWT A;  2R92 B;  3G71 A;  1KRS A;  4XXE A;  1IBM Q;  2VQF L;  4R4C A;  3Q6S A;  1TS2 A;  4RKL A;  3R3O A;  3HOU B;  1IYV A;  1WYD A;  1Q90 A;  3JAM L;  5EPK A;  5HUR A;  1HZC A;  2R3Z A;  1JE5 A;  4G57 A;  1ENF A;  1QUQ B;  3HOZ H;  2OT2 A;  3CP0 A;  2K14 A;  1QWY A;  2EYL A;  1HA5 A;  5K36 G;  4V0B A;  2PMZ E;  2A68 D;  2JA8 H;  1XX8 A;  5C3E B;  1EFI D;  5C4H A;  5IYD G;  4JI6 L;  1J9O A;  3MEF A;  1VQN A;  4GNX A;  1XTD A;  3OTO Q;  2WIN B;  3TEH B;  2JSO A;  4A4I A;  4Y52 H;  1UE7 A;  5K5P A;  4JV5 Q;  4BA2 I;  1YNJ C;  1EIH A;  3D6C A;  4QB4 A;  4HAE A;  1L0Y B;  1PTO C;  2JP1 A;  2JA6 G;  3M85 A;  2ZJR A;  4DXG A;  3S14 H;  1BO0 A;  1C48 A;  5IYB H;  2WB1 E;  3TBI B;  3FHW A;  4CHT B;  3U4Z A;  4JBM A;  1Q7Y C;  1TWH H;  2Z9H A;  4L5T A;  1S5F D;  1HTL D;  4TSS A;  4LF6 L;  1X9N A;  2EZV A;  3J81 c;  5CYU A;  1PH3 A;  1F9Q A;  1EY5 A;  3ULJ A;  3VYU A;  3GTM H;  2JYO A;  1VQ4 A;  1CK1 A;  2B2T A;  2NVY H;  3BYY B;  1IZ6 A;  2Q8T A;  3UDG A;  4RHS A;  1KAA A;  4FVM A;  1YHA A;  4R4O A;  4NMZ A;  4DR3 L;  1G2T A;  2QEX A;  4X65 Q;  3X3N A;  3BZK A;  1OXV A;  4TVA B;  3CQZ B;  1VQE A;  5D14 A;  4C1N I;  4DGZ A;  1N32 Q;  2RHQ B;  1LUZ A;  1EZ6 A;  1DD2 A;  5BN3 A;  3RLO A;  4K6L A;  4Z9C B;  2JEA I;  4HID A;  1A3T A;  2NVT H;  1LM0 A;  3HOU G;  1PHJ A;  2B63 H;  5FO9 B;  3ICE A;  1WFQ A;  1J8I A;  4AYB G;  1D8L A;  4RGN A;  2ZTD A;  3GTO B;  3HOW B;  1SE3 A;  4MZ9 A;  1EYC A;  3N52 A;  2C9O A;  2DNC A;  2HIX A;  2XWJ B;  3A8J E;  2MP1 A;  2OXP A;  1KIX A;  2F0I A;  5IY0 A;  4GN4 B;  4JI1 L;  3RMH A;  2D62 A;  1JOR A;  4O0A A;  5EBC A;  3NQI A;  1EQQ A;  1A6X A;  5IP7 H;  1QG7 A;  3L0O A;  1U4M A;  3I4N G;  1OTC A;  1TWH B;  1TWF H;  4DV7 L;  2JEB I;  4EX5 A;  2OQ0 A;  4JI7 Q;  4M8A A;  1K8O A;  3FKI G;  1X3F A;  3SGI A;  2K32 A;  3E9I A;  1AEX A;  3I72 A;  3J80 E;  3HOY G;  2P5Z X;  2IHE A;  3QOL A;  4PMB A;  2WKC A;  5CV5 A;  5JEA J;  4K8I A;  1LAC A;  2LKV A;  4KJO A;  4IO9 A;  4HJ9 A;  4DV2 L;  5LMU Q;  2GVB A;  1HHV A;  1BDO A;  1EL0 A;  1E2Z A;  3H09 A;  4OHJ A;  3C1F A;  3FVQ A;  5LMN W;  4K6D A;  2R7Z G;  1Y1V B;  4LF8 Q;  5JOB A;  3HOZ G;  1SJH D;  5LL6 X;  5KNB A;  3D31 A;  1NBW A;  2J0T D;  3KFU A;  4DV3 L;  1PMR A;  4A3L G;  1VQG A;  2CFM A;  2XIW A;  4K0K Q;  1SMY C;  1YNJ D;  2EVB A;  2VXW A;  1IKM A;  1G6P A;  4WFN 3;  1I4X A;  1BBX C;  2NZ1 D;  2R93 B;  4KHP L;  2ZXR A;  3VDY A;  5C0X G;  1OO9 B;  1U5K A;  1PH6 A;  4QL5 A;  2KHI A;  5E1F A;  4L63 B;  2VUM B;  5DNF A;  3S9W A;  4KMU C;  4JBK A;  2IPK D;  5JVG 3;  4X66 Q;  3MEH A;  4QIW E;  2MHV A;  4GNX C;  3S1Q H;  1B53 A;  3HKS A;  5IIF A;  1KL9 A;  1SND A;  3I4N B;  4DR6 L;  1PFB A;  2B2U A;  3DM3 A;  4BY1 B;  2HQE A;  4BBS B;  2EJG C;  5I4D A;  1PZK D;  3SR1 A;  1GXD C;  2WB1 G;  1MIU A;  4PNY A;  4KK7 A;  4OON A;  4DV1 L; 
#chains in the Genus database with same CATH homology
 4YY3 L;  1VQO A;  1EYG A;  3G4S A;  4JYA Q;  2DUD A;  3F8T A;  3BJU A;  3MXN B;  4QGU A;  4IJH A;  1OXS C;  4A3F H;  1X54 A;  4R4Q A;  4PZ7 A;  4HJ7 A;  1P8L A;  2I0Q A;  2UUC Q;  4ALP A;  1KAW A;  4BY1 G;  3FP9 A;  2VW9 A;  4DR1 Q;  1LYL A;  1UE1 A;  1A0I A;  4JI4 L;  1T9H A;  3AQQ A;  3CMA A;  1YI2 A;  1E3P A;  2VL6 A;  2DGY A;  1XNQ L;  4B3R L;  1MJE A;  1Q81 C;  4LF4 Q;  1U0L A;  1HNX L;  4TQU S;  1PH2 A;  2R6G A;  1VQD A;  2Q2I A;  4L5S A;  4EQ5 A;  5ELO A;  1CUK A;  1HNZ Q;  3GTK H;  4IJL A;  3TRE A;  1VQM A;  4UP8 A;  2ES2 A;  3CCQ A;  2HT1 A;  4NXM Q;  3T1Y Q;  1SFO H;  2OTJ A;  3STB C;  1B7Y B;  3PV0 A;  4BY7 G;  1ASZ A;  1Q82 C;  5E7N A;  3S1M H;  4GKK L;  3K7A H;  4LFA Q;  2PQA B;  1XMO L;  2UXC Q;  2JK8 A;  2A8V A;  4GKK Q;  3UDX A;  3S17 H;  2AMC B;  3KJP A;  4OO1 G;  4OX9 Q;  1GO3 E;  4JI0 Q;  3TS0 A;  4DR4 L;  1VQH A;  1JT8 A;  4X66 L;  1PH9 A;  4PZ6 A;  3EN2 A;  2B63 G;  3KYH C;  2UXB Q;  1PYB A;  3F2D A;  4OWW B;  1KHI A;  2ZM6 Q;  1UE6 A;  4P75 A;  2E5L Q;  4LF4 L;  4LFB Q;  2N8N A;  4B3R Q;  1XNQ Q;  5GRO A;  2YTX A;  4LUO A;  5C44 H;  3CCR A;  1K73 C;  3JC6 6;  5IYD H;  1WOC A;  3A74 A;  4JI5 Q;  4KHP Q;  2KCT A;  2K5H A;  3IRB A;  4DR1 L;  1SRU A;  4BY7 H;  2D0P A;  3KF8 B;  3LGJ A;  4POF A;  1NJI C;  4YCW A;  4JOI C;  1M90 C;  2UU9 Q;  2JQO A;  4A3D G;  2R92 G;  3RZO H;  4JI5 L;  3H15 A;  5FLX c;  3PUZ A;  1IXR A;  1P16 A;  3J7Z C;  2KBN A;  2CCZ A;  2PI2 A;  2ZM6 L;  2LSS A;  2MQH A;  1GKH A;  2UXB L;  1RIP A;  3HOX G;  5C44 G;  1VQ9 A;  4JI0 L;  5M5W H;  5LMN L;  2NZO A;  5JJK A;  3I4N H;  1WCM H;  3W1B A;  4O2D A;  1QZH A;  3S16 H;  1H95 A;  3PUX A;  4YWL A;  1XMO Q;  3K0X A;  1IBL Q;  4BY1 H;  1X3G A;  4A75 A;  3AFQ A;  2Z6K A;  1VQ5 A;  1JJC B;  5LMN Q;  3UDF A;  1VQI A;  2N78 A;  3T1Y L;  4HIM A;  1YNX A;  3S1R H;  3H3V I;  4IPD A;  4LUV A;  2R7D A;  4LFC L;  1G29 1;  4QJF A;  1YZ6 A;  2KHJ A;  1AH9 A;  3HOX H;  3ERS X;  4XTC S;  1SLJ A;  4DKA C;  2Z0S A;  2VNU D;  2D0O A;  1EOV A;  3KJO A;  1UEB A;  1PA6 A;  4GLV B;  3KF6 B;  2K50 A;  4JI4 Q;  3GTG H;  1NMG A;  1S72 A;  4IFD I;  1WCM G;  2F4V Q;  3GO5 A;  4JBJ A;  4A3K H;  2UUC L;  4YHH L;  4C2M H;  5C4J H;  3AFP A;  4DAM A;  4P71 A;  4DPG A;  1JB7 A;  4PZ8 A;  5HGQ A;  4YY3 Q;  3T1H Q;  1BVS A;  4DV1 Q;  4IPG A;  3KOJ A;  1NY4 A;  3K80 C;  4A76 A;  3CC4 A;  4HJA A;  1S40 A;  4P73 A;  3ZJY C;  2KCM A;  2F3I A;  1QZG A;  4DK6 C;  1WI5 A;  2HIV A;  1K3R A;  3L2P A;  5JEA G;  1HH2 P;  1VQL A;  1SN8 A;  1L0W A;  4WJ3 M;  5GAG C;  4OO1 I;  2V1C C;  1X55 A;  3EIV A;  1NMF A;  3JAM i;  2UXC L;  4FDB A;  1B8A A;  4A3E G;  2E2H H;  2HQL A;  2OTL A;  1VQP A;  4LFA L;  1EIY B;  2BA1 A;  4GOP B;  3GTQ H;  1MKH A;  2JA7 H;  4UPA A;  4NXM L;  3GTL H;  4A3C H;  1DGS A;  1XJV A;  5FJ8 H;  5LMU L;  1HNZ L;  3DLL A;  3PO2 G;  1HNX Q;  1HZB A;  2ID0 A;  4LWC A;  4QQB X;  4KLK A;  4GS3 A;  4JI8 L;  4YWK A;  1PH8 A;  2VZA A;  2MO1 A;  2YTY A;  2RHS B;  3NEN A;  4B3T Q;  1SE8 A;  4DR5 Q;  4A3G H;  5M5X H;  4R4I A;  2R93 H;  3L7Z C;  5IP9 G;  1TWA H;  2UUB Q;  1A63 A;  4A93 G;  1PFS A;  4JG2 A;  4A3E H;  2CQO A;  1NE3 A;  4DV5 Q;  3RLF A;  1SMX A;  1Z9F A;  1G51 A;  4LF9 Q;  3CCV A;  3I7F A;  3U58 A;  4NPS A;  2JE6 I;  1PH1 A;  3I4O A;  4A3B H;  1J6Q A;  5M5Y H;  3I55 A;  1YJN A;  2JA5 G;  4DV6 Q;  2K4K A;  4AIM A;  2VQE Q;  4LF7 L;  1Y1W H;  1CKN B;  4JC0 A;  4LW1 A;  1E1T A;  1XNR Q;  4JBW A;  4A3C G;  1K9M C;  3CQZ H;  4RG1 A;  4DV7 Q;  3PO3 G;  3PO2 H;  5FLM H;  4ME3 A;  4DV3 Q;  1PYS B;  3TRZ A;  3PUV A;  3UE1 A;  5J3B A;  2YYZ A;  1RL2 A;  5IWA Q;  5C0X J;  4JI3 Q;  3CCS A;  1Y1V G;  1XPU A;  4DR6 Q;  1N34 L;  2C35 B;  5IP7 G;  4A3G G;  4WJ4 A;  5IYC G;  4DV4 Q;  3WWV A;  4X65 L;  3RN5 A;  1Y14 B;  2ZTC A;  3CF5 A;  2Y0S E;  4DUZ Q;  3AEV A;  5DLQ E;  1I50 H;  2BA0 A;  1D7Q A;  3KF6 A;  3ER0 A;  1S3O A;  1GVP A;  2Z6K C;  4L5Q A;  2ATW A;  1C7Y A;  4RMF A;  5C4X H;  2L15 A;  4UP7 A;  3ULL A;  4A3F G;  1YIJ A;  1JJG A;  2VS1 A;  4DAY B;  2QGQ A;  4IOC A;  1A8V A;  1SRO A;  3RZD H;  3G6E A;  1HZ9 A;  3W1G A;  5HY6 A;  3F2B A;  1K83 H;  3EBE A;  1YIT A;  4C3I H;  1MJC A;  3M4P A;  2UUA L;  4NXN Q;  4IFD J;  4AQY Q;  1CSP A;  4OXP A;  2WP8 J;  4JOI A;  4BXX G;  3CD6 A;  4DK3 C;  1SR3 A;  1QVG A;  3S2H H;  4GNX B;  1YJW A;  2PI2 E;  1VQA A;  3CME A;  4B3S L;  4JI7 L;  3HOV H;  2VUM G;  1OXT A;  3KDF A;  3AYH B;  1Q86 C;  1FJG Q;  5EAY A;  3D0F A;  2I5H A;  1EFW A;  4AH6 A;  1IBK L;  4JI2 L;  4YWM A;  1N36 Q;  3A5U A;  1CSQ A;  1HNW L;  1PH7 A;  2HHH Q;  2ZJP A;  2R7Z H;  1GM5 A;  1FL0 A;  1VQB A;  2VY3 A;  2CWA A;  3PIO A;  2MNA A;  3CXC A;  2K5V A;  5IE8 A;  5IT9 c;  2GVA A;  3CPF A;  1EIF A;  3GTP H;  3M9B A;  3K81 C;  4JI1 Q;  4LF8 L;  1TWG H;  1A62 A;  1CKM A;  2R93 G;  4B3M Q;  3F1Z A;  1KD1 C;  2H5X A;  3CC7 A;  1EUJ A;  2R7F A;  4DR3 Q;  3TS2 A;  5GAH C;  4MTN A;  1VQ8 A;  2JA5 H;  4IOA A;  4QY7 A;  1VCI A;  4DV2 Q;  4GN5 A;  1I94 Q;  4LF5 Q;  3OTO L;  3M4Q A;  4X64 Q;  1X56 A;  4BBS G;  1BBW A;  1Q1B A;  1CKN A;  1L1O C;  1W3S A;  1X65 A;  2GN5 A;  2IHF A;  2BH8 A;  1VQF A;  4XIG S;  3STB D;  3CCJ A;  5BR8 Q;  1CKO A;  2EXD A;  5ELN A;  4POG A;  3RR5 A;  1QVF A;  2ALY B;  2AWO A;  3G71 A;  1KRS A;  4DR7 Q;  4LF6 Q;  1IBM Q;  1FGU A;  4R4C A;  1V43 A;  3J81 j;  1AE2 A;  2VQF L;  1V1Q A;  4YCU A;  4DV0 L;  3H3V H;  3A5Z B;  2E2I H;  1WYD A;  3CAM A;  2IT1 A;  1XMQ L;  1HZC A;  5GQO A;  1JE5 A;  4P72 A;  1Z47 A;  1JMC A;  1E1O A;  1QUQ B;  4P74 A;  3HOZ H;  3GTJ H;  5M3F H;  2ZJQ A;  2N3S A;  1N32 L;  2WFW A;  4UP9 A;  3CP0 A;  2K14 A;  2QA4 A;  1J5E L;  1HR0 L;  1L1O A;  3HFZ B;  3CC2 A;  3S2D H;  5K36 G;  4X62 Q;  1X6O A;  4HIO A;  2IX0 A;  4BXX H;  2PMZ E;  2JA8 H;  5AJ3 Q;  1KC8 C;  3PUW A;  5IYD G;  5H1S E;  4JI6 L;  2B3G A;  3MEF A;  1VQN A;  2K75 A;  3PF5 A;  4GNX A;  4A3K G;  4PMW A;  3S1N H;  3GTO H;  4A3D H;  1XTD A;  3OTO Q;  3JAM c;  4GN3 B;  4LF5 L;  3KDF B;  4JI6 Q;  3TEH B;  4A4I A;  4Y52 H;  1UE7 A;  1I5F A;  2Y0S G;  1LTL A;  3UDI A;  4JV5 Q;  2K5N A;  4BA2 I;  2LXK A;  5AJ3 L;  1FVI A;  2YU9 H;  5C3E G;  2UXD L;  2EQS A;  3CCE A;  2YTV A;  2E2J H;  4GKJ L;  2JA6 G;  4DUY Q;  3M85 A;  2ZJR A;  3S14 H;  3U4V A;  2PQA A;  3PCO B;  2JA9 A;  1E22 A;  3M7N A;  4IPH A;  1OXU A;  5IYB H;  3PSI A;  4GOP C;  1VQ6 A;  2WB1 E;  1VQK A;  4DV6 L;  1HNW Q;  1N36 L;  3FHW A;  4BBS H;  4A3M H;  3Q8D A;  3U4Z A;  2Q2U A;  4JBM A;  3I2Z A;  1TWH H;  3H0G G;  2WAQ G;  1Q7Y C;  1YHQ A;  1N33 Q;  2XTI A;  1YVC A;  4L5T A;  2OCE A;  1EWI A;  4DUY L;  3I4M H;  5JJI A;  2VQF Q;  2OWO A;  3G48 A;  2MO0 A;  3J7A 5;  4A3J G;  4LF6 L;  2NVQ H;  1X9N A;  3J81 c;  1IYJ B;  3PIP A;  4DR2 Q;  1PH3 A;  4L5R C;  4AQY L;  4JV5 L;  1QVC A;  3ULJ A;  5BR8 L;  2UUA Q;  3F2C A;  1PV4 A;  1GD7 A;  3GTM H;  1VQ4 A;  3KLW A;  4UY8 C;  1UE5 A;  2IY5 B;  3CCL A;  1VS0 A;  2NVY H;  3TQY A;  3U50 C;  1IZ6 A;  4X64 L;  4HJ5 A;  3UDG A;  2NVX H;  3UE0 A;  2R92 H;  1YHA A;  4R4O A;  3OYY A;  1QUQ A;  2E8G A;  4DR2 L;  4DR3 L;  2QEX A;  1BBU A;  4X65 Q;  3BZK A;  4A3I G;  1OXV A;  2NN6 I;  4TVA B;  2F52 A;  1HR0 Q;  1VQE A;  1N33 L;  1K0R A;  3RN2 A;  1Y1V H;  5GAE C;  1N32 Q;  2RHQ B;  2RF4 A;  4JCV E;  5IWA L;  4HJ8 A;  1M1K C;  5IYC H;  1LUZ A;  2A19 A;  1PVO A;  3RLO A;  2JA7 G;  2JEA I;  1HZA A;  1YBY A;  4YCV A;  4APV A;  1R9T H;  2JJQ A;  3PF4 A;  4DNI A;  4HID A;  1PH5 A;  4B3S Q;  2NVT H;  1LM0 A;  5C0X I;  1N9W A;  4GKJ Q;  1IBM L;  3HOU G;  1PHJ A;  5C3E H;  2B63 H;  4DR7 L;  2UXD Q;  1ASY A;  5M3M G;  3ICE A;  1WFQ A;  4GLA C;  1TWC H;  4AYB G;  3GDE A;  1XPO A;  4BA1 I;  2JA6 H;  4A3I H;  3S15 H;  1D8L A;  2ZTD A;  3S24 A;  4JI8 Q;  1KRT A;  1X3E A;  5IYB G;  4HIK A;  1HJP A;  4MZ9 A;  1JJ2 A;  2OQK A;  2HIX A;  3K8A A;  1I94 L;  4A3L H;  4A3B G;  1IL2 A;  3H0G H;  3K7U C;  2BH2 A;  4OWX B;  2VUM H;  1KIX A;  3M4O H;  3RNU A;  2AWN A;  1VQJ A;  4LNQ A;  2I5M X;  1C9O A;  4DUZ L;  4B3M L;  5IY0 A;  4GN4 B;  4KHZ A;  1YHB A;  1TXY A;  2CKZ B;  2CWP A;  5M3M H;  4X62 L;  1K8G A;  2AKW B;  4JI1 L;  3HOY H;  4R1J A;  1J5E Q;  2D62 A;  2LXJ A;  1OXX K;  4BBR G;  4O0A A;  4JI3 L;  1EQQ A;  1BKB A;  4GOP A;  5JJL A;  5IP7 H;  3L0O A;  3I4N G;  2HHH L;  1OTC A;  2WAQ E;  1TWF H;  4JI2 Q;  4DV7 L;  1PH4 A;  1B70 B;  4LUZ A;  2JEB I;  3BZC A;  4EX5 A;  1XMQ Q;  1XNR L;  1UWV A;  1AE3 A;  3HKZ G;  2ASB A;  5C4X G;  1Q1E A;  2OQ0 A;  4DV0 Q;  4JI7 Q;  3T1H L;  1L2F A;  5FJ8 G;  2K52 A;  2KEN A;  4DV5 L;  1KQS A;  3FKI G;  1X3F A;  4LF9 L;  4X6A H;  1YEZ A;  3SGI A;  1WJJ A;  3E9I A;  2UUB L;  3HOY G;  1Q46 A;  1XPR A;  2IHE A;  1I6H H;  1KXL A;  4B3T L;  3NEM A;  4BBR H;  3M3Y H;  5JEA J;  2MFI A;  4K0K L;  4IPC A;  1VQC A;  1Q8K A;  3BU2 A;  4C3J H;  4LFC Q;  4A93 H;  4IO9 A;  4HJ9 A;  3GD7 A;  4DV2 L;  3NBH B;  2RCN A;  2N49 A;  5LMU Q;  2GVB A;  2FXQ A;  3I56 A;  3ULP A;  3HOV G;  1Y1W G;  3HOU H;  5LMN W;  4DV4 L;  3FKI H;  2IX1 A;  2R7Z G;  3PO3 H;  5FLM G;  3NEL A;  4LF8 Q;  4IFD G;  1C0A A;  3HOZ G;  5M3F G;  1N34 Q;  4JYA L;  3B6Y A;  3D31 A;  1NBW A;  3CCM A;  4R4T A;  3KFU A;  1EQR A;  3HKZ E;  4DV3 L;  1K8A C;  1IBK Q;  3J80 c;  2ZTE A;  1VQ7 A;  3CW2 C;  1FJG L;  3RLN A;  4Y7N H;  5GAD C;  4A3L G;  1VQG A;  2VQE L;  3W5O A;  2YV5 A;  3J80 i;  1E24 A;  4AYB E;  1YJ9 A;  2CFM A;  4YHH Q;  3OW2 A;  2EIF A;  4K0K Q;  2UU9 L;  1G6P A;  4MNO A;  4NXN L;  1O7I A;  4DR5 L;  3HOW H;  4KHP L;  3VDY A;  5C0X G;  4KI0 A;  2B29 A;  1NTG A;  1U5K A;  1PH6 A;  4QL5 A;  2KHI A;  5IP9 H;  1I3Q H;  4H02 A;  2E5L L;  4LFB L;  4OWT B;  4C3H H;  2F4V L;  1V9P A;  1W2B A;  4JBK A;  4GLX A;  4X66 Q;  2NN6 G;  2A1A A;  3A0J A;  4QIW E;  1N8R C;  4DR4 Q;  4GNX C;  4OX9 L;  3PGZ A;  2Q2H A;  1HR0 W;  3S1Q H;  3HKS A;  1IBL L;  2NZH A;  1KL9 A;  2Q2T A;  4A3M G;  4DR6 L;  3CPW A;  3E9H A;  3DM3 A;  4J15 A;  1E7Z A;  4PG3 A;  3I4M G;  2I5L X;  4NB3 A;  2AHO B;  3CCU A;  1Q12 A;  4A3J H;  3HOW G;  2JA8 G;  3E0E A;  3J81 i;  2XGT A;  2PNH A;  1MIU A;  2WB1 G;  1L1O B;  4OON A;  4DV1 L;  3PUY A;  4LF7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...