4IPDA

Structure of the n-terminal domain of rpa70, e100r mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipdA00
2JA6H 3EBEA 4R4CA 3PIOA 2VUMH 1EOVA 1QVFA 1Y1WH 4JI0L 1WCMH 5C44H 2NVTH 2A1AA 4BY1G 3K7UC 2MO1A 4DR2Q 3NBHB 1YJ9A 5FLMH 2K5NA 2VQEL 4GKKQ 2JQOA 2BA0A 3J81i 2UUBQ 4NB3A 4JI5Q 2HIVA 4B3RQ 4DR6L 3RN5A 1X55A 1HZCA 2HQLA 4IOAA 1RIPA 1UWVA 4YWKA 3W1GA 1GD7A 1NMGA 3OTOQ 2ZM6Q 3RN2A 3FP9A 2PI2E 3BZKA 3I4NH 4OXPA 3UDXA 1W3SA 1Q1BA 5FLXc 1N32Q 2JJQA 1XNRL 4DV5L 1H95A 2BA1A 3AEVA 1OXVA 3KFUA 2K14A 1WYDA 2AWOA 3M4QA 4H02A 4P71A 3H0GG 1K0RA 4HJ8A 3L7ZC 3J80c 1VQ8A 4JI3Q 2UUCQ 1E3PA 1XMOQ 1D7QA 4EX5A 2OQ0A 2N8NA 1VQ5A 3FKIH 3J7ZC 4NXNQ 2KHIA 1LUZA 4HJ9A 3JAMi 1TWAH 1XJVA 1OXXK 1XNQL 1UE1A 1IBLL 1N34Q 4QGUA 5E7NA 4GLXA 1XMQL 1L1OB 3JC66 1IZ6A 3HKZE 5C0XJ 3S17H 1PH1A 4LF7Q 1V43A 1X54A 3AFQA 3PGZA 3S24A 2HIXA 4HIKA 3S1QH 3I4MG 2JA9A 2WB1E 4TVAB 4DV2L 2HHHL 1S3OA 1TWCH 1NTGA 1E1TA 1X3EA 4LFCL 3CD6A 1B7YB 2KBNA 3GDEA 3HOZG 1Q86C 4A3EG 1I50H 3HKZG 1HNZL 2Q2TA 2B63H 1C9OA 4R4OA 3TEHB 1PH4A 4O0AA 4A3CG 4A3DG 1Z9FA 2Z6KA 3ZJYC 2WB1G 4DR5L 4DPGA 2XGTA 3CQZH 1L0WA 2JA5H 3HOWH 2K52A 1N33Q 2RHSB 3NENA 2Q2HA 4OWWB 3GTKH 1Q46A 4JYAQ 1K8GA 1EFWA 2CCZA 4OWXB 1KL9A 3CMEA 1P8LA 4JV5Q 1ASYA 1HNXQ 2Y0SG 1SN8A 3RZDH 2IY5B 4IPDA 5AJ3Q 4C3JH 5C3EG 1JJGA 5C4XH 1LYLA 3M4PA 4PZ7A 3J80i 1RL2A 3HOUH 1CKNA 2BH2A 3CCVA 2JK8A 1KC8C 2ID0A 3MEFA 1G51A 4A3GG 3CC2A 2F3IA 4OO1G 1LM0A 1YHBA 3I2ZA 1JB7A 1Y1VH 1CSPA 4QY7A 3T1HQ 1XPOA 2R92G 4DR1L 1UE5A 1EUJA 2R93G 4BBRG 4JBMA 4AH6A 1YEZA 3UE1A 3PSIA 1QVGA 1KHIA 1HR0Q 4IJHA 5M5YH 4ALPA 5JEAJ 3FHWA 3ULLA 4HJ7A 4IPCA 2ATWA 2JA6G 4A3BH 1VQLA 2VUMG 3M4OH 5IYCG 2JEAI 1SLJA 1BVSA 1SRUA 3AQQA 1WCMG 4OONA 5C0XG 4KI0A 1VQKA 1PFSA 1UEBA 3ULJA 5C44G 1PH8A 2E2JH 2R7ZH 4YCWA 4AQYL 2B29A 3ERSX 3I7FA 1QZHA 4LF9Q 1SROA 3GO5A 4JI6L 3CP0A 2OCEA 3RLFA 4JI4Q 1BBWA 1S72A 4QQBX 2ZJPA 1YHAA 4DV4Q 2MQHA 2ZJRA 2FXQA 2K50A 1UE6A 1YBYA 4PMWA 2AKWB 5IWAQ 3I56A 4X62L 5FJ8G 4P72A 4A3KH 3KDFB 3GTOH 2DGYA 2H5XA 1QZGA 3NEMA 4P73A 2I0QA 1A62A 4JI2Q 2UXCQ 1VS0A 5M3MG 5GROA 4X65Q 3CMAA 2A19A 1J5EL 3BJUA 2E2HH 4YY3L 4IPGA 1ASZA 1VQBA 4LFAQ 4R4QA 2CWPA 3W5OA 1PVOA 1Q7YC 3HOVH 4JI1L 4LF7L 4A93G 4LF6Q 1VQJA 5BR8L 4UPAA 4KLKA 3T1YL 3PUWA 3DLLA 1N36L 1YITA 3BU2A 4Y52H 3DM3A 1PH3A 4DV6Q 1K3RA 1GO3E 4DR4Q 2GVBA 2ALYB 2K75A 1PH7A 4HIDA 4BA2I 1HNWQ 2K5VA 2Z6KC 1I94L 2NN6I 4LF8L 3CCRA 2WFWA 3F2BA 1PA6A 3S1MH 4JC0A 1K73C 1A63A 3HOXG 2D0PA 1A0IA 4LUOA 1P16A 2HT1A 4IFDG 4B3SL 4GKJL 4LFBL 4A3IG 2NZHA 3B6YA 3KF6B 2XTIA 5JEAG 2OWOA 2R93H 2ZJQA 3S1NH 1OXTA 4YCVA 4A4IA 4DV0L 1L1OA 5ELNA 1VQPA 4JYAL 3IRBA 2PMZE 1O7IA 4PG3A 2IX1A 4DR7L 1WI5A 2E5LL 4K0KQ 4J15A 2UXDL 4IFDI 3GTJH 2LXKA 5IP9H 5IYDH 3HOWG 1G6PA 2Q2IA 2QEXA 4OX9L 2MFIA 3K7AH 5C4JH 2LSSA 2YV5A 3CC4A 1VQCA 3RNUA 3GTGH 4B3TQ 4OO1I 3KF8B 5M3FG 4DUZL 2UUAQ 2Q2UA 1VQMA 2D0OA 3T1HL 4GN3B 5HGQA 4A3LH 4POFA 2MNAA 5C4XG 1K9MC 1U0LA 2VQFQ 5LMNQ 3HOUG 1KRTA 1TWGH 4YCUA 4DR3L 2CFMA 4NPSA 4JI7L 2R6GA 1CKMA 1VQIA 1BKBA 1YJWA 4NXMQ 1XTDA 1E22A 1IBKQ 4Y7NH 1K8AC 2N49A 1NJIC 3E9IA 4JI8Q 1IXRA 4QL5A 3HFZB 2KCMA 4X64L 2UU9Q 4YWLA 4LF9L 3PV0A 4BBSH 4DV7Q 2JE6I 2A8VA 1IBML 2NZOA 4IO9A 3Q8DA 4XIGS 2C35B 4OWTB 2YU9H 5IYBG 1SMXA 3U4VA 3CAMA 4YWMA 4L5TA 4UP7A 4DV1Q 2NVQH 5GAGC 2GN5A 3VDYA 4LF5Q 2UXBQ 2F4VL 1PYSB 3OW2A 4DKAC 1V1QA 2PI2A 4R4IA 4JI2L 2UXCL 4BXXH 1W2BA 4DV3Q 4DUYQ 4APVA 4X65L 3UDGA 4XTCS 4UY8C 4A3JG 4ME3A 4JI0Q 1JE5A 1QUQB 1KQSA 4LFAL 5LMUL 2QGQA 4P75A 4KHPL 3MXNB 2VQEQ 4B3MQ 4HIMA 1EYGA 4DNIA 1YI2A 1C0AA 3ICEA 4FDBA 5DLQE 2VW9A 1GM5A 1VQAA 2AHOB 1L2FA 3PO3H 1OXUA 3H0GH 4DR6Q 4DR4L 3KDFA 4IFDJ 3HOVG 4DR2L 1KXLA 3KOJA 2PNHA 1AH9A 1YIJA 3G4SA 4JBWA 5EAYA 4GKKL 1GVPA 3PUVA 1N8RC 4R4TA 4HJAA 2OTLA 2UUBL 1XNRQ 3ER0A 4DV5Q 1Y1WG 1L1OC 3HKSA 2EQSA 4JI5L 4GN5A 2KCTA 3PO2H 3S16H 4B3RL 1J6QA 1G291 1NMFA 1KAWA 3K8AA 3E0EA 4L5QA 4LUZA 4P74A 1SR3A 3CCEA 1KD1C 3TS2A 2RF4A 4AIMA 5GAEC 5FLMG 3CW2C 4IJLA 3OTOL 2ZM6L 4POGA 1LTLA 2R7DA 2WAQE 3M85A 3U4ZA 3CCSA 4EQ5A 1CSQA 1N32L 5IP7H 1EWIA 3CCUA 2IHEA 3A74A 4MNOA 1FGUA 1VQOA 1EQQA 1IBLQ 1XMQQ 3NELA 1VQNA 3HOZH 4WJ3M 1M1KC 2IHFA 4JI3L 4JOIA 3UE0A 4C2MH 1AE2A 1YZ6A 1PHJA 1XMOL 1EIYB 5ELOA 2UUCL 4B3TL 2YTVA 2JA7H 3I4NG 2WAQG 4DK6C 1VCIA 1XPUA 4NXNL 1OTCA 5M5WH 1A8VA 4DV2Q 2HHHQ 2VS1A 5IP9G 5IYDG 3ULPA 4JG2A 3KF6A 3F2CA 1N34L 5IY0A 3OYYA 4O2DA 3CCQA 3PUYA 4L5SA 1HNZQ 4GLVB 3G6EA 2GVAA 3CPWA 2EXDA 2NN6G 2RCNA 2CQOA 5HY6A 1I6HH 2N3SA 3FKIG 4L5RC 4JI8L 2IX0A 4C3IH 4JV5L 5JJKA 2OTJA 3HOYH 4WJ4A 4A3MH 2UU9L 2YTYA 1OXSC 1X9NA 4GS3A 4LF4Q 2IT1A 3J7A5 1VQ9A 3LGJA 1SE8A 1PH2A 2ZTCA 1VQ4A 2PQAB 1X3FA 3G48A 4BY7H 4DV1L 1PH6A 1X56A 1CKOA 2R92H 1KRSA 5J3BA 4JCVE 1N33L 4BBSG 3KJOA 2KHJA 1TWFH 3S15H 2CKZB 3PUZA 4GN4B 2VL6A 4DV3L 2B63G 3I55A 4DUYL 1HZBA 4KHZA 3GTLH 1HNXL 3EN2A 1MJCA 1VQ7A 1HJPA 2LXJA 2YTXA 3STBD 4AYBE 5IYCH 4X66Q 5AJ3L 1MJEA 3H3VH 1JT8A 2JA5G 3RZOH 3RR5A 2F52A 4DR1Q 3S1RH 1EQRA 4PZ8A 4YHHQ 4UP8A 4C3HH 3H15A 3TRZA 1E1OA 1WOCA 2OQKA 1Q82C 4GNXB 1DGSA 1C7YA 1FJGQ 3CPFA 1BBUA 4BXXG 4B3ML 2N78A 5GAHC 1YHQA 1CUKA 1VQFA 4AYBG 3I4OA 3KLWA 1Z47A 1B70B 2L15A 2RHQB 2K5HA 2WP8J 5FJ8H 4RMFA 1FVIA 4AQYQ 2I5LX 1WJJA 1VQDA 3F2DA 4JI6Q 1IYJB 1X65A 4GOPB 1HR0L 2BH8A 2KENA 3GTPH 1D8LA 3M7NA 4A3FH 5M3MH 5IE8A 3CCLA 2EIFA 2K4KA 4JBKA 2JA8H 1SFOH 3K80C 1I3QH 1Y1VG 3PO3G 3RLOA 4X62Q 1QUQA 5JJIA 4A93H 1VQ6A 1HR0W 1T9HA 4A76A 1XPRA 1NE3A 1B8AA 1MKHA 3J81j 4JI4L 4A3BG 3UDFA 1JJ2A 1AE3A 2QA4A 3SGIA 4DV4L 1J5EQ 3PO2G 3KYHC 3K81C 4JOIC 4YY3Q 1K83H 5IWAL 3PCOB 1PV4A 2R7ZG 1U5KA 4BY1H 3G71A 1TWHH 4IPHA 2CWAA 4JI1Q 2AWNA 1QVCA 3TS0A 5BR8Q 3CXCA 4A75A 1JJCB 5H1SE 3PUXA 2V1CC 2R7FA 1HZ9A 3D31A 3HOXH 4HIOA 3T1YQ 3S2DH 1NY4A 3A5ZB 4MZ9A 5IP7G 3U58A 4A3IH 1N36Q 3GTQH 3F1ZA 1I5FA 1VQEA 4A3KG 1FL0A 4RG1A 3S2HH 4LF8Q 1I94Q 5GADC 2NVYH 4LF6L 4LUVA 2JA7G 2B3GA 2Y0SE 1X3GA 1TXYA 4UP9A 4GKJQ 4LFBQ 4BA1I 3L2PA 4B3SQ 1PH9A 3AYHB 4DK3C 4GNXC 1E24A 4DV0Q 1PYBA 4DV6L 1JMCA 4LF4L 3KJPA 3CCJA 1HNWL 4DR7Q 3S14H 2E5LQ 1E7ZA 5M3FH 3M9BA 2ASBA 2UXDQ 1VQHA 1VQGA 1IL2A 2ZTEA 3HOYG 4QJFA 2DUDA 4A3MG 3CF5A 3PF4A 4GOPC 3E9HA 4OX9Q 3UDIA 1V9PA 2ZTDA 3A0JA 4DUZQ 4K0KL 2Z0SA 4X66L 3I4MH 3EIVA 4BY7G 2YYZA 3STBC 5IT9c 2VZAA 4YHHL 1XNQQ 1UE7A 3K0XA 3CCMA 3GD7A 2I5MX 4DR3Q 4A3EH 1KIXA 1Q1EA 1FJGL 4JI7Q 2NVXH 2E8GA 4MTNA 4PZ6A 1M90C 4A3CH 2UUAL 1Q81C 4A3DH 5IYBH 2AMCB 2I5HA 3J81c 1X6OA 1GKHA 2PQAA 3L0OA 4GLAC 3CC7A 4LFCQ 1NBWA 4X64Q 5M5XH 4DAYB 3PIPA 2VQFL 1CKNB 5LMNL 2D62A 1IBMQ 4R1JA 3GTMH 1EIFA 4LNQA 2VY3A 2ES2A 4IOCA 4NXML 1HZAA 1N9WA 1Q12A 1WFQA 4DR5Q 1IBKL 2MO0A 4DAMA 4A3JH 3H3VI 5K36G 5C0XI 4A3LG 5C3EH 3F8TA 1YJNA 4LW1A 2F4VQ 4JBJA 5LMNW 1Y14B 1Q8KA 3BZCA 4DV7L 1YNXA 3WWVA 3D0FA 4LWCA 4GNXA 1S40A 3RLNA 4QIWE 4TQUS 5JJLA 4A3GH 4A3FG 2E2IH 2JA8G 3W1BA 3PF5A 3AFPA 1PH5A 3TQYA 1R9TH 3JAMc 4LF5L 2UXBL 1YVCA 3TREA 5LMUQ 5GQOA 4KHPQ 2JEBI 1HH2P 4BBRH 2VNUD 4HJ5A 3M3YH 3U50C 4X6AH 1MIUA 4GOPA 3A5UA
chains in the Genus database with same CATH superfamily
3EBEA 1LTAD 1TQOA 4H13C 5KGUA 1Y1WH 4M1UB 2A1AA 1EY6A 3K7UC 2MO1A 3NBHB 2JQOA 2UUBQ 1LT6D 2ZXRA 2EJGC 4JI5Q 4B3RQ 3I3CA 4DR6L 3RN5A 1X55A 1HZCA 2NUCA 2FINB 2HQLA 3GTLB 1GD7A 3OTOQ 1E0BA 3BVZA 5M9OA 3GTJB 3CRLC 1W3SA 1Q1BA 2JJQA 1H9JA 2RA4A 2BA1A 1QILA 1X3PA 3A8IE 2K14A 5I9PA 4P71A 3H0GG 1Q8IA 2NN6H 1D7QA 4EX5A 2N8NA 3EROA 2F4IA 4WJWA 1EEFD 5C3WA 1XNQL 1HQMC 4GLXA 4XT3B 5LL6S 3A55A 2QKIC 3C46A 1IZ6A 1XXGA 3NXWA 4N8X1 1V43A 1X54A 2PZUA 4HIKA 3S1QH 2WB1E 2HHHL 1S3OA 1TWCH 1KDAA 1NTGA 3CD6A 4LFCL 1B7YB 4A93B 3GDEA 3MC0B 1Q86C 4CDCC 3HKZG 1XTCD 3DEPA 4XQQA 2B63H 2KCNA 4O0AA 2Z6KA 2NVQB 3BDOA 1L0WA 3HOWH 1L0YB 4DXGA 4IUVA 4OWWB 2KEEA 4JYAQ 5CMDA 5A35A 2CCZA 3CMEA 1QE6A 2EPBA 2IY5B 3I91A 4R8IA 5AJ3Q 1PTOD 4C3JH 1JJGA 3EVQA 1LYLA 3M4PA 3S2HB 3J80i 2F0GA 4FNFA 3CCVA 2F0MA 1G51A 2PQEA 3LX0A 3I2ZA 3IAYA 3T1HQ 1XPOA 4AH6A 3S14B 5M3FB 3PSIA 1HR0Q 1TS5A 5E4WC 2ATWA 5KNDA 4KI0A 1UEBA 4J8QA 2E2JH 2R7ZH 2V4DA 3NPPA 2B29A 3ERSX 3E5SA 3I7FA 5IT9L 1SROA 2CH4A 1JE4A 4TKOB 3T16A 3C1EA 4JI4Q 1S72A 2ZJPA 4DV4Q 2MQHA 3SK8A 2K50A 4PMWA 3I56A 5J39A 2AKWB 3J81L 3HOZB 1JWSD 3KK7A 4KTAA 4C1NI 5FJ8G 1GOZA 1QZGA 2H5XA 3NEMA 4A3DB 2SEBD 3FRPB 3FPUB 3NHHA 5T1GA 4B9WA 3J7AV 4ZUJA 4X65Q 1PMRA 3R93A 2E2HH 4YY3L 1X32A 4EVOA 2XIWA 1Q7YC 4A93G 4CBVA 4UPAA 3BS1A 3QOJA 1L0XB 5C3EB 1LABA 3PUWA 3DLLA 1HTPA 3DM3A 1PH3A 1SE3A 2GVBA 4HIDA 1I94L 5JVH3 3CCRA 1HFNA 2WFWA 3F2BA 1PA6A 2Q8TA 2NWGA 3HOXG 1A0IA 4LUOA 5EKLA 4RKBA 2B2UA 4KKSA 3S1NH 5COYA 1OXTA 3GQBA 4JYAL 1O7IA 5ISRA 2VUMB 4DR7L 4X3SA 2K6AA 3TDQA 4F7XA 2JSOA 2G9HD 1ZYRD 2LXKA 5IYDH 1WTXA 3HOWG 4TSSA 3VR2A 4FF4A 4RH6A 2PZTA 2LSSA 2YV5A 3CC4A 4JPBW 2GA4B 5M3FG 2CH4W 2Q2UA 3T1HL 4GN3B 2PCFB 2F0EA 5HGQA 5FLXL 5IODA 2MNAA 4A3LH 1V1PB 2Z8LA 1EL0A 2CFMA 4HAEA 5M3MB 1VQIA 1BKBA 3NP8A 2NB0A 1QWYA 1XTDA 1ET9A 1IBKQ 1JC7A 2N49A 4QL5A 2KCMA 3K0YA 1ENFA 1DZ1A 2UU9Q 3CHBD 1IBML 2NZOA 1S5CD 4IO9A 3DEOA 1EY4A 4XIGS 4OO1H 2L4NA 5CV9A 2YU9H 4XQJA 1FD7D 5GAGC 4LF5Q 1TWHB 3OW2A 4DKAC 2DJGC 1SYFA 1V1QA 2A69C 4RFBA 2SDFA 4U673 4BXXH 1KDBA 3D6WA 4APVA 4X65L 4RKLA 1CK1A 1STHA 1I50B 1ENAA 1FNVA 5IIFA 4B3MQ 1F2MA 4ID6A 5IOCA 1C0AA 3UI2A 3GTKB 4FDBA 5DLQE 1H9MA 3PO3H 1JWMD 1B9MA 3DWAA 2CW0D 5I9OA 3A7AB 1ILQA 2PNHA 3RZDB 1A3VA 2EYMA 4KKUA 3S16H 1CA5A 1Y8OB 1K3BC 3E0EA 4IURA 1KTKA 1SR3A 4L5QA 3CCEA 3TS2A 2RF4A 2Q8IB 5GAEC 2ICIA 3M85A 3CCSA 3CCUA 2IHEA 3A74A 5M5YB 1Y69U 4RGTA 1M1KC 2KJXA 2IHFA 4C2MH 3M4OB 3I4NG 2WAQG 1VCIA 4XYQA 5M5WH 2QILA 5IYDG 4JG2A 1IYVA 3OIPA 1SMYC 3CCQA 2GVAA 1IKMA 2L0CA 5F2DA 2RCNA 2CQOA 1CZGA 4ZQ3A 1EOTA 3HOYH 2UU9L 2YTYA 1KABA 4KN7C 2F0QA 1JOOA 3J7A5 3KF8A 1SE8A 1I4XA 2DY7A 2PQAB 4H0LC 1PH6A 3R2IA 4JCVE 2B2TC 5ELDA 4ME5A 4OO1G 3MWYW 1HNXL 1VQ7A 5IYCH 2YTXA 4X66Q 1DM0B 2KVMA 2F52A 5KNCA 1EQRA 2A6EC 4C3HH 3C3LA 1E1OA 1WOCA 1I4PA 1FJGQ 4BXXG 4B3ML 1QNUA 2LKVA 4XYOA 4AYBG 4RMFA 4AQYQ 3NUCA 1WVLA 1PTOF 2HUGA 2F0JA 1X65A 4JI6Q 2D9UA 2BH8A 2KENA 3CCLA 2EIFA 1A6XA 1SFOH 2B2YC 3K5NA 3PO3G 3RLOA 2AUKA 1QUQA 1SYGA 1ICFB 1JR0D 1NCVA 3MXNA 4A76A 1NE3A 5BN4A 3UDFA 1AE3A 1HA6A 5E4XA 1J5EQ 1B3QA 3PCOB 3KBXA 3R2TA 5J1ZA 5I2YA 2CWAA 1LTBD 2IJ0A 4A75A 5H1SE 1W6KA 4M8AA 3PUXA 1HXYD 3T1YQ 1NY4A 1JOQA 1KNEA 2OF1A 4DNTB 4RG1A 2JYOA 4XQNA 4LUVA 2BE5C 1X3GA 2M00A 4GKJQ 2NYZD 1IW7C 4GNXC 3IFDA 4DV0Q 2R61A 3CCJA 1SE4A 1HNWL 3MTSA 2F1MA 1E7ZA 5DNFA 2UXDQ 1GXDC 1DYQA 1VQHA 2X6LA 1JCKB 1IL2A 3HOYG 4QJFA 2WINB 2K01A 4FF2A 1FR3A 1W6JA 1V9PA 2EJFC 3VR5A 1S5BD 4X66L 1SDFA 1Y1VB 3I4MH 1AP0A 1FJGL 4A3EH 5A2QE 4A3BB 1EU4A 4PZ6A 3BDCA 5IYBH 3Q22A 1X6OA 1AN8A 4C3HG 1PTOB 2D62A 4LNQA 2VY3A 1HZAA 1RD9D 4DR5Q 2KCCA 4LAAA 4A3JH 3OW7A 3Q23A 4V0BA 1O80A 1G2SA 1YNXA 3WWVA 1PRTC 1VMPA 3HZXA 4B9XA 5CV6A 1EY0A 4K6LA 1EU3A 3JAMc 4KHPQ 4BBRH 1D2BA 4I7AA 1PH4A 3H09A 2PW5A 3MA2B 2JA6H 2RDFA 1EWCA 3C2PA 4A3MB 1EOVA 4JI0L 1EY5A 1I4GA 5C44H 1SYDA 1BQQT 1YJ9A 2VQEL 4BY7B 3J81i 3KUPA 2R92B 1LACA 1B3AA 1B44D 4HSVA 5IGDA 1TWFB 3S15B 5C3XA 2L9HA 3KLSA 4IOAA 1UWVA 1YNJC 2ZM6Q 2PI2E 3UDXA 1XNRL 3A7LA 2Q8RE 1OXVA 4K2KA 3TBIB 3KFUA 1WYDA 2AWOA 4GZYC 5D65A 3I72A 3L7ZC 3GTGB 3NTIA 2UUCQ 1E3PA 2OQ0A 5KIXA 1S4ZA 3M4YA 4HJ9A 2XN9C 1XYIA 1TWAH 4NMZA 1JOKA 1UE1A 1N34Q 3OWEB 3ND8A 3SVMA 1AZPA 2IWHA 4A3FB 4LF7Q 3ONAB 3PGZA 1SE2A 1I4RA 3I4MG 2JA9A 2F0SA 1X3EA 3SR1A 4L6TB 1TT2A 2KBNA 2EE1A 2AUJD 2IPKD 4QIWB 4A3EG 1HNZL 3AU7A 1BCPC 3TEHB 4E6IA 3ZJYC 4DR5L 1K83B 4BWGB 3A54A 1WTPA 3TZUA 5EPKA 1K8GA 1TIID 4OWXB 1P8LA 4JV5Q 3X3NA 2Y0SG 1BNZA 4IPDA 4C3IG 2VB2X 3RD4A 3MXGA 5C4XH 5L37A 1RL2A 2NVYB 4DAYA 3HOUH 2BH2A 2JK8A 1PYWD 1RODA 3MEFA 3PMFA 3CC2A 2HDMA 1YHBA 2OEOA 4QY7A 5HURA 2R92G 3H6MA 4DR1L 5CGKA 1WD0A 4BBRG 1YEZA 1K0SA 1QVGA 4IJHA 4ALPA 5JEAJ 3ULLA 4HJ7A 2JA6G 1VQLA 4FXDA 3M7GA 4OL7A 2QEJC 1SLJA 1BVSA 5LHY1 5C0XG 5DM63 5C44G 5C4HA 3NBIA 3CP0A 2OCEA 1DOLA 5JPMC 2QF7A 1BBWA 4QQBX 4NP5A 2KOLA 3SEBA 1WTRA 3HKZB 2A69D 4X62L 2NVXB 2EY5A 3Q6SA 4A3KH 1A62A 2B39A 3GV3A 1SAPA 5GROA 5M5XB 2A19A 1D6EC 4L8JA 5IGCA 4LFAQ 1RHPA 2CWPA 4LF7L 4CJ0B 3J7AF 4HSPA 1NR2A 4NKLA 1NAPA 2C5CA 1N36L 3GTQB 4I7ZC 1I4QA 1K3RA 1GO3E 1SNMA 4JW0A 2K75A 4BA2I 1PH7A 2E2IB 4LF8L 2HT1A 4LFBL 4B3SL 2NZHA 4YCVA 3KLSX 4X3UA 1CFMA 2C9OA 2VB3X 1HTLD 2IX1A 2Z1CA 2E5LL 1UAPA 4G4KA 3GTJH 3MHBA 4F8MA 1FNUA 4LK1C 1G6PA 4OX9L 2MFIA 3K7AH 2F0VA 1VQCA 2Z4HA 2K7VA 2A68C 3KF8B 4DUZL 2UUAQ 2HCIA 5C5MA 3H94A 1VQMA 5KNBA 5C4XG 1SMYD 1IL8A 1PLFA 2J4XA 3W3AA 5LMNQ 3HOUG 4YCUA 5BN3A 1U4MA 5KYLA 3GTPB 2R6GA 1YJWA 2EYOA 4NXMQ 5ELEA 1E22A 4Y7NH 3NQIA 1DD2A 1H9SA 3A8JE 4X64L 4YWLA 3BZDB 2JE6I 4PMCA 3CKIB 1I6VC 3Q8DA 4G57A 2K33A 4ZUIA 2NVQH 4L5TA 4UP7A 2GN5A 4RWSC 2UXBQ 2EY1A 1DONA 1PYSB 5EPLA 1JB3A 4TRDA 3S1QB 3HOXB 4DV3Q 1TWCB 4DUYQ 1SYCA 1V8QA 4DK1A 3E0JA 2J7ZA 2A6ED 2BOSA 2ZXOA 1QUQB 1KQSA 4LFAL 2B63B 3MXNB 5JVG3 3OIQA 3HOWB 2PYKA 4N9PA 1GM5A 1L2FA 3K5LA 2TSSA 3KDFA 3KOJA 4ZK9B 3DMUA 1GVPA 4L63B 4WORA 4HJAA 2OTLA 2UUBL 4DV5Q 1Y1WG 1L1OC 3HKSA 1MD2D 4JI5L 1LTID 2KCTA 4B3RL 3O13A 2CQAA 4QB4A 4I65A 3BVMA 1KAWA 3OTOL 3CW2C 1PFMA 2R7DA 4CHTB 2KA7A 3U4ZA 1R4PB 1FGBD 4EQ5A 1S5ED 1NR4A 1VQOA 1EQQA 1FGUA 2MP1A 3VYUA 1IBLQ 1XMQQ 3HOZH 3SXHA 4WJ3M 3UE0A 2OXPA 1QCBD 1AE2A 1EIYB 5ELOA 5D3IB 4DK6C 1A8VA 4DV2Q 3U9OA 5DAUA 3VR6A 1ZEQX 3HS0C 3D4WA 3PUYA 4L5SA 1NSNS 2BE5D 2NN6G 2XSCA 1GUSA 2F0HA 4NW2A 1IW7D 3OPOA 1GJXA 2IX0A 2J0TD 4O42A 3I73A 4H44C 1OXSC 4LF4Q 2QCPX 1LT3D 2PPBC 3NTHA 4ZKCB 4K14A 1ICWA 3LGJA 1ONLA 2E2HB 1VQ4A 2LMCB 1PZID 5J3BA 1O7YA 3KJOA 2CKZB 1EY8A 1GUTA 4GN4B 4DV3L 2B63G 2O5JC 3I55A 4DUYL 3EN2A 5CYUA 1HJPA 2LXJA 2P5ZX 1BR9A 5AJ3L 3RZOH 3S1RH 3TRZA 4UP8A 5IT9E 1G6ZA 1AW7A 1DGSA 1ESRA 1B53A 1F9SA 2E75C 2N78A 4HMIA 1U4LA 1VMCA 3I4OA 3NTKA 2IX3A 3S1NB 1EZ6A 2L15A 3C1FA 4C3JG 3J81E 2K5HA 1DCZA 3F2DA 2EOTA 3I4NB 2WAQB 1HR0L 3GV6A 1CTMA 5ELFA 4RCNA 4O1NA 5M3MH 2JA8H 1I3QH 1PRTD 1ML0D 1HR0W 1T9HA 5EJWA 1B8AA 1H9RA 4JI4L 3WDNA 5G3LD 4DV4L 1A15A 3KYHC 1J9OA 1QB5D 4RGNA 2R7ZG 4BY1H 3ITPA 1SBBB 1TWHH 1RJTA 4JI1Q 2AWNA 3TS0A 5BR8Q 4ZCKA 1JJCB 1HZ9A 1PDQA 3D3RA 3S2DH 2AQ2B 4A3IH 5JEAH 5FK9C 3F1ZA 1I5FA 1VQEA 5KYIA 1FL0A 4QF4A 2YU9B 2M9VA 4KD3A 2B3GA 2Y0SE 4BA1I 3L2PA 1PH9A 4K5WA 4KMUC 1PYBA 5CV4A 1YNJD 4LF4L 3KJPA 3MFGA 4AYBB 3A56A 3HRZC 3M9BA 2ASBA 1VQGA 5FLXE 2DUDA 3PF4A 1PFBA 5IGBA 4K5VA 1FNWA 1GUOA 3UDIA 3MZ5A 1B4OA 1DXMA 3PO3B 1O7LA 5E3FA 1HUMA 3EIVA 1G8ZD 1UEAB 2JP1A 2VZAA 1UE7A 2G9DA 3CCMA 4DR3Q 5CORA 1KIXA 1Q1EA 1SJED 4X3KA 4JI7Q 4ZRZA 1Q81C 2AMCB 2I5HA 3S16B 3L0OA 3CC7A 1PZJD 4GLAC 4S3SA 4DK0A 2KHSA 4DAYB 1BCPD 4KN4C 4KJOA 3GTMH 1EIFA 1GUNA 1K28A 4KY6A 3K59A 1IBKL 2MO0A 4DAMA 3H3VI 4A3LG 3F8TA 1RKNA 4C2MB 4EQOA 1YJNA 2F4VQ 3BZCA 1Q8KA 5JOBA 3D0FA 4IQZA 1HRJA 4QIWE 5M5WB 5JJLA 3EJIA 4A3GH 1VDZA 2JA8G 3W1BA 3PF5A 2XRSD 1U9RA 1R9TH 1F2YA 2LY7A 2EZVA 4LF5L 5LMUQ 1LO5D 5GQOA 2VNUD 1HH2P 2Z4IA 5EKIA 2F03A 3M3YH 1SEBD 3U50C 3HEJA 4X6AH 1MIUA 2N88A 5CBAE 3A5UA 4GOPA 3DXJC 3HOYB 1QVFA 1WCMH 4DNRB 1J8IA 1PXUA 3TP6A 2NVTH 4BY1G 2B2WC 3N6RA 4DR2Q 5FLMH 4GKKQ 2BA0A 2KUMA 1BF4A 1XX8A 2HIVA 2PZWA 4CKCA 1NMGA 4OGQC 2H1EA 3KLRA 4OXPA 3EFXD 3TP7A 1CA6A 1N32Q 4C3HB 3AEVA 4FXKC 4H02A 3M4QA 1LT4D 1K0RA 4HJ8A 1CI3M 3J80c 4JI3Q 1TKWB 2RKSA 1IHZA 1XMOQ 4QMGA 3CU7A 4MN3A 1VQ5A 3FKIH 3J7ZC 3LWUA 4NXNQ 2KHIA 3D6CA 5LL6X 2IL8A 4HR7B 1TWGB 2R3ZA 3AMUA 4J1MA 2MHVA 3JC66 1CM9A 3HKZE 4FP5D 3S17H 4ULLA 1TS4A 2FHTA 3S24A 1SFOB 1BO0A 2HIXA 1AFPA 5EGTA 5K36H 4TVAB 1STYA 1E1TA 1WTHA 2JN4A 4MIUA 3G6JB 2EYFA 5JJZA 4R8NA 3MEHA 1C9OA 1Z9FA 2WB1G 1KLUD 4DPGA 2HDLA 2H4OA 3CQZH 2JA5H 3SHLA 1N33Q 3WOEA 3NENA 1Z7TA 2Q2HA 1Q46A 4CJ1B 1KL9A 2PW7A 3IL8A 3TMEA 1WTQA 2I46A 2EYJA 5DEHA 1H9SB 3SK5A 3GP7A 4PZ7A 5EQ0A 1E2VA 1DJRD 2A68D 5IGFA 1KC8C 2ID0A 3J80E 4A3GG 2K28A 1M4VA 2F3IA 1LM0A 1TY2A 1CSPA 1Y1VH 1D1KA 1EUJA 1KHIA 2BCOA 4OIKA 4A3BH 2B2UC 5IYCG 2XRQD 1MI2A 2JEAI 1SRUA 3AQQA 1WCMG 4OONA 3MVVA 2E2DC 3ULJA 2L55A 4AQYL 1RF2D 1EEID 5I6YA 4JI6L 3EA6A 3I4MB 3RLFA 3AB9A 3QWNA 2ZJRA 1UE6A 5IWAQ 4A3EB 3KDFB 1HPCA 3GTOH 2DGYA 2BDNA 2I0QA 4JI2Q 2UXCQ 1VS0A 3QG1A 3TP5A 3CMAA 1J5EL 3VYRA 2DJFC 4IPGA 2LFNA 1ASZA 1VQBA 3BVGA 3MXUA 3W5OA 3HOVH 4MHEA 2Y0SB 4LF6Q 1VQJA 2BDOA 1OO9B 4C3IB 4F87A 1PRTF 4HEDA 2FMCA 4KLKA 2SNMA 3T1YL 2WKCA 1YITA 3G7LA 3BU2A 1D5XC 4DV6Q 5G3LF 3JAML 4B08A 2EVBA 2EY6A 3FVQA 3KBGA 5FO9B 1STGA 3S1MH 4JC0A 5EBDA 4GKJL 3F2UA 1P16A 3T53B 4BBRB 4K8JA 1WTOA 2XTIA 5CV8A 2OWOA 2R93H 1B2TA 2ZJQA 4DV0L 4A4IA 1VQPA 1L1OA 1MSHA 5ELNA 4ABNA 3IRBA 2JA6B 3QIAA 4PG3A 1TU2B 2RQXA 1WI5A 4K0KQ 4J15A 1C48A 2UXDL 4IFDI 1EFID 3QJYA 5C44B 1SNQA 2QEXA 3NWSA 1WTVA 1B1ZA 5C4JH 4ZKBB 4IUNA 2DNCA 3RNUA 4KD4A 3GTGH 2ICEC 4OO1I 4IUPA 4HCEA 5J22A 1ESFA 1WTWA 4YIJA 1K9MC 1U0LA 2VQFQ 3FEWX 3DM1A 1KRTA 3P75A 1K8AC 3OOCA 3HFZB 1QG7A 1D5MC 2EXZA 4BBSH 4DV7Q 4HMJA 1TWAB 4KKTA 1R4QB 5IYBG 3CAMA 4FO2A 4DV1Q 1IYUA 4DF7A 3VDYA 4N8FA 4G7ZC 4R4IA 4JI2L 2UXCL 2LS01 1LV9A 1W2BA 1BUVT 3UDGA 1BCPF 4XTCS 4UY8C 4A3JG 4ME3A 1AEXA 1JE5A 4DGZA 3BYYB 2QGQA 5ELBA 4KHPL 3H3VC 4K8IA 4HIMA 1EYGA 4DNIA 5FOBB 2VW9A 1VQAA 2PMZB 4DR6Q 3H0GH 4IFDJ 3K58A 3HOVG 1KXLA 1AH9A 1KLGD 4FF3A 1QOHA 3G4SA 4JBWA 3PUVA 5C4XB 4Q0FA 3ER0A 1VF5C 3PO2H 3HOUB 1WD1A 1J6QA 1NMFA 3K8AA 4P74A 1KD1C 4EQNA 1MHWC 2EYPA 2ZM6L 4IJLA 1SJHD 1TY0A 2WAQE 1KDCA 2F0FA 5ELCA 5IP7H 1G91A 1C4QA 4J6HA 2R93G 4MNOA 4CKBA 1CHPD 1SXTA 4DN4M 2PO4A 1PHJA 2UUCL 2JA7H 3LWEA 1XPUA 2HHHQ 3ULPA 3KF6A 3QB3A 1N34L 4O2DA 1ZKOA 2MUYA 4GLVB 3G6EA 2EXDA 1K8MA 5HY6A 3QOLA 1I6HH 4L5RC 4A3KB 2OTJA 2L12A 3Q24A 1X9NA 2IT1A 2A6HC 4HTHA 1VQ9A 4G7HC 2A74C 2ZTCA 4DV1L 1X56A 1TR5A 2D2CC 2F0PA 2L11A 4BBSG 3A8KE 2KHJA 1M8AA 2NZ1D 2VL6A 4JV5L 3GTLH 1HZBA 1Y1WB 1BCPB 4P2CB 1RTNA 4AYBE 3H3VH 4IUQA 2F0IA 2OQKA 2OT2A 1HA5A 4CKEA 1JQYD 3T51B 1YHQA 2F0UA 1TS2A 5C6AA 3TSSA 5I4DA 2WIIB 2RHQB 2WP8J 5FJ8H 2I5LX 1WJJA 1VQDA 4OELB 1IYJB 4DAVA 4GOPB 3VYTA 3GTPH 1PZKD 3M7NA 2E74C 2K4KA 5FKAC 4JBKA 3K80C 4PQXA 3BYTB 3K7AB 4WFN3 4A93H 2K32A 1VQ6A 2ENBA 1SYBA 3J81j 1LTGD 1JJ2A 2QA4A 3SGIA 3MAQA 3PO2G 3K81C 4JOIC 4YY3Q 5CBEE 3PQIA 3OMCA 1BXTA 4IPHA 1ZXTA 4X3TA 1F9PA 4Y7NB 2B2VC 1A3TA 2NTSA 2B2TA 4F88A 4JVZA 2R7FA 3HOXH 4HN7A 4K5XA 4HIOA 1LT5D 5IP7G 3N52A 3U58A 1JWUD 4A3KG 1LLRD 3S2HH 2K03A 1D5ZC 1I94Q 2B2WA 1EY9A 2JA7G 1KNAA 2KEDA 4NDXA 1TXYA 2RDGA 4UP9A 5E1FA 4PNYA 4DK3C 1E24A 3J7YW 1CT1D 1HFGA 3HG9A 4DR7Q 3S14H 1EYCA 5M3FH 2XWBB 4C3JB 1CQVA 1H9KA 3CF5A 4CDFC 1RCVD 3E9HA 2EY2A 2B2YA 3QO2A 3A0JA 4QCLA 1Y8PB 1RDPD 4IALA 3V2TA 2A73B 2YYZA 3STBC 4KV6A 5IGGA 5IT9c 4V190 5CR3A 4FYDA 4ZLTF 3K0XA 1II3A 1YNNC 4MTNA 2K1BA 2AQ3B 1M90C 4A3CH 2B8FA 5KRUA 2UUAL 2F3VA 4A3DH 2Z6BA 3J81c 2E2JB 2R7ZB 3CRKC 2G5DA 4DFAA 3PIPA 5LMNL 4IUUA 1IBMQ 4R1JA 3R3OA 5JAVA 2ES2A 4IOCA 4NXML 3E6ZX 4WRDA 5C0XI 3ZYYX 2X6GA 5C3EH 3OWFA 3TN2A 2JXMB 3WOFA 2X69A 3HP3A 1O7ZA 2EDGA 5LMNW 1A2UA 4RCOA 4GNXA 4LWCA 5T1IA 1F9QA 1AZQA 4TQUS 1PH5A 2RCFA 2UXBL 1YVCA 3DWPA 4HJ5A 2K5WA 4R4CA 3PIOA 2VUMH 2N55A 3DWQA 2RBMA 4JK1C 3I90A 1ILPA 2K5NA 3VR4A 2RSNA 5EKKA 1STNA 4NB3A 2F0OA 1RIPA 4YWKA 3W1GA 3RN2A 3FP9A 3BZKA 3I4NH 1BDOA 1KAAA 3RZOB 3L3OC 5FLXc 1X3QA 3S1RB 4DV5L 1H95A 4Z9CB 1EWHA 4RHRA 1K8OA 1VQ8A 1GUWA 4CDEC 3MFYA 1LUZA 2AQ1B 4CGYB 3JAMi 1XJVA 2O4XA 1OXXK 1IBLL 4QGUA 5E7NA 1XMQL 1L1OB 1DOMA 2MPMA 5C0XJ 4IUTA 1PH1A 2JA8B 1A3UA 3AFQA 1I3QB 2QDLA 2TMPA 4IFDH 2EYHA 4DV2L 2MJ8A 3HOZG 2IW3A 1I50H 2Q2TA 4G7OC 4A3CG 1NNXA 1XWEA 4R4OA 4A3DG 4EGVA 2XGTA 3FPPA 4BY1B 1FYCA 2K52A 2L5TA 2K05A 2RHSB 3GTKH 4FXGC 1EFWA 3E3XA 3S2DB 1STEA 1ASYA 4A3IB 1HNXQ 3SDZA 1SN8A 4XXEA 2I07B 4XDXA 3RZDH 4RAUC 5C3EG 3NK9A 2L1BA 1CKNA 1EIHA 1F2LA 2E76C 3ERQA 1STBA 1JB7A 1QJOA 1UE5A 3TP8A 4JBMA 3UE1A 2M2LA 5M5YH 3FHWA 4IPCA 1A2TA 2Z9HA 2VXWA 2VUMG 1CHQD 3M4OH 1ENCA 4LJZC 4FVMA 1VQKA 1PFSA 1PH8A 4YCWA 4LF9Q 1QZHA 2O2LD 3GO5A 4ZYSA 3U9SA 3D8GA 3FMCA 3D4DA 1SNCA 4QUFA 1YHAA 5DM73 2FXQA 1YBYA 3NE5B 3P20A 4P72A 4LMQD 4P73A 3NBHA 2WB1B 5M3MG 1U4PA 1NUCA 2EYLA 5EBCA 3SE0A 3BJUA 3L9AX 4N9TA 3GTMB 4R4QA 3QR8A 1PVOA 4JI1L 2B8GA 2O5IC 3TZDA 5BR8L 2QDBA 1B9NA 1LTTD 4H7BA 4ODGA 1EY7A 4Y52H 3P7JA 4DR4Q 2K5DA 2RSOA 2ALYB 4A3GB 1HNWQ 2K5VA 2Z6KC 2NN6I 3VYSA 1A63A 2QW7A 1K73C 1R9TB 3OMGA 2D0PA 4IFDG 5TSSA 1Q3LA 3I4LA 3B6YA 3KF6B 4EQPA 5JEAG 4A3IG 1ET6A 5C5LA 1S5DD 3M3YB 1S5FD 2PMZE 2WV6D 2SNSA 4C56C 3H91A 1WCMB 5EPJA 2F0DA 2NVTB 3MXPA 5IP9H 2SOBA 1PTOC 2Q2IA 4IN3A 3ND9A 1Z6HA 3SK6A 2MGSA 3DUZA 1QNKA 4B3TQ 2D5DA 2XWJB 2D0OA 4POFA 4KY7A 4OIJA 1TWGH 2HCCA 4DR3L 2XNAC 1Q90A 1SYEA 1UUPA 4NPSA 4JI7L 2F3WA 1CKMA 3J80L 3URYA 1NJIC 3E9IA 4JI8Q 1IXRA 3LNNA 1DOKA 2RDHA 4LF9L 3PV0A 1C8CA 2A6HD 3FKIB 2A8VA 5A2QL 2WKDA 4XT1B 2C35B 4OWTB 3EQLC 1GUGA 1SMXA 4K6DA 3U4VA 4YWMA 3PIP3 1IKLA 3K6OA 2F4VL 3S17B 1LTRD 4ILWA 2PI2A 4KHVA 5D3DA 1HHVA 2CHBD 1F77A 5C4ZA 3V96A 5AFWA 4JI0Q 5HGTA 5LMUL 4P75A 1BBXC 1HQRD 2VQEQ 1RTOA 3CQZB 2WACA 1PFNA 2JA5B 2K04A 1YI2A 3P1HA 4PMBA 3ICEA 2AHOB 1OXUA 4DR4L 1GHKA 5CV5A 1STAA 3D4RA 2ZXPA 4DR2L 3K57A 3IKJA 3PIO3 1YIJA 4DA2A 4GKKL 5EAYA 3RUZA 1N8RC 4R4TA 1EQVA 1SSOA 1XNRQ 2EQSA 3NSWA 4GN5A 2EJMA 1G291 5JPNC 3FDTA 4LUZA 2NTTA 4OEMB 4AIMA 5FLMG 1MBYA 4POGA 1PTOH 1LTLA 4BS9A 3BG3A 1N32L 4UDUC 1CSQA 1ZYRC 1EWIA 2XVSA 3DHQA 3NELA 1VQNA 1JORA 4JI3L 4JOIA 1YZ6A 1XMOL 3VA5A 4B3TL 2A5HA 2YTVA 4CDDC 1EZ8A 4NXNL 1OTCA 2B2VA 3HGBA 2VS1A 5IP9G 5FO8B 3F2CA 1EYDA 5IY0A 3OYYA 5NUCA 3R8BA 1F2ZA 1HNZQ 3CPWA 1T5XD 4FF1A 1CQFA 4A3JB 2N3SA 3FKIG 1MSGA 3OHXC 4JI8L 4C3IH 2FMMA 1TS3A 5IGEA 5JJKA 3OSOA 5BN5A 4A3MH 3GTOB 4WJ4A 2KECA 3NWTA 1EIGA 4GS3A 3VA7A 3T56B 4UAIA 2DN8A 1PH2A 1G2TA 5K36G 1GHJA 1X3FA 3G48A 4BY7H 1CKOA 2R92H 1KRSA 3Q0AA 3HOVB 2K5QA 1N33L 1V1PA 1O78A 1TWFH 3S15H 5CV7A 1EQTA 3PUZA 4CJ2C 1BOSA 4KHZA 3K5OA 1MJCA 1MJEA 5D14A 3T4AC 3STBD 1JT8A 4C1NK 5C0XH 2PNRC 2JA5G 3RR5A 4DR1Q 4YHHQ 1YNND 4PZ8A 3H15A 1Q82C 5KEEA 4GNXB 1C7YA 3CPFA 3S1MB 1BBUA 4UHVA 5GAHC 1CUKA 1VQFA 2F0WA 2R93B 3KLWA 1Z47A 1B70B 3X3MA 3SK4A 4U68A 2ZT9C 1FVIA 4IZ8A 5FO7B 4MTKA 2F0LA 2CW0C 2HD3A 2NBFA 1D8LA 2FJ2A 1LTSD 5IE8A 4A3FH 1Y1VG 1CZWA 5C4JB 4X62Q 4RHSA 5I6WA 5JJIA 1F9RA 1VF7A 1XPRA 1MKHA 1U4RA 4A3BG 3BDLA 1SNDA 3V05A 5IWAL 1K83H 1PV4A 1U5KA 3JAME 3G71A 1QVCA 1E2ZA 2F0KA 3CXCA 2DNEA 2V1CC 3D31A 4PV1C 4MZ9A 3A5ZB 1N36Q 4BBSB 2KQ3A 4ZAIA 2CVRA 4DAPA 1EYAA 4LF8Q 5GADC 2NVYH 4K2LA 4LF6L 1UNSA 3T13A 1PRTB 3W2DA 4LFBQ 4B3SQ 3AYHB 1JMCA 4DV6L 1HUNA 1MGSA 2E5LQ 4RGOS 2ZTEA 4A3MG 1Y8NB 4RA8A 4DXFA 4GOPC 4OX9Q 1SNOA 1T5EA 2ZTDA 4DUZQ 4K0KL 2Z0SA 4KJNA 3I8ZA 4BY7G 1JICA 3H0GB 4QUCA 1I4HA 1XNQQ 4YHHL 5K5PA 5I2XA 1V1OA 2F0NA 3GD7A 2I5MX 2RVLA 4DU9A 1SNPA 2NVXH 2E8GA 2HQEA 3PO2B 1GKHA 2DY8A 2PQAA 4LFCQ 1NBWA 4X64Q 5M5XH 3VR3A 2VQFL 1CKNB 4R9WA 1D1IA 2FFKB 4KK7A 1N9WA 1Q12A 1WFQA 3IFTA 4KY5A 3K5MA 4HCSA 3NQTA 1B50A 5CC4A 4OHJA 4LW1A 2F0TA 4JBJA 3GTQH 1Y14B 4RGMA 3RMHA 4DV7L 2JA7B 1TVXA 1S40A 3RLNA 4A3FG 1E2WA 3S9WA 2E2IH 3AFPA 1HCZA 3TQYA 3I70A 3TREA 2JEBI 1I6HB 4Q5VA
chains in the Genus database with same CATH topology
2JA6H 3EBEA 4R4CA 3PIOA 2VUMH 1EOVA 1QVFA 1Y1WH 4JI0L 1WCMH 5C44H 2NVTH 2A1AA 4BY1G 3K7UC 2MO1A 4DR2Q 3NBHB 1YJ9A 5FLMH 2K5NA 2VQEL 4GKKQ 2JQOA 2BA0A 3J81i 2UUBQ 4NB3A 4JI5Q 2HIVA 4B3RQ 4DR6L 3RN5A 1X55A 1HZCA 2HQLA 4IOAA 1RIPA 1UWVA 4YWKA 3W1GA 1GD7A 1NMGA 3OTOQ 2ZM6Q 3RN2A 3FP9A 2PI2E 3BZKA 3I4NH 4OXPA 3UDXA 1W3SA 1Q1BA 5FLXc 1N32Q 2JJQA 1XNRL 4DV5L 1H95A 2BA1A 3AEVA 1OXVA 3KFUA 2K14A 1WYDA 2AWOA 3M4QA 4H02A 4P71A 3H0GG 1K0RA 4HJ8A 3L7ZC 3J80c 1VQ8A 4JI3Q 2UUCQ 1E3PA 1XMOQ 1D7QA 4EX5A 2OQ0A 2N8NA 1VQ5A 3FKIH 3J7ZC 4NXNQ 2KHIA 1LUZA 4HJ9A 3JAMi 1TWAH 1XJVA 1OXXK 1XNQL 1UE1A 1IBLL 1N34Q 4QGUA 5E7NA 4GLXA 1XMQL 1L1OB 3JC66 1IZ6A 3HKZE 5C0XJ 3S17H 1PH1A 4LF7Q 1V43A 1X54A 3AFQA 3PGZA 3S24A 2HIXA 4HIKA 3S1QH 3I4MG 2JA9A 2WB1E 4TVAB 4DV2L 2HHHL 1S3OA 1TWCH 1NTGA 1E1TA 1X3EA 4LFCL 3CD6A 1B7YB 2KBNA 3GDEA 3HOZG 1Q86C 4A3EG 1I50H 3HKZG 1HNZL 2Q2TA 2B63H 1C9OA 4R4OA 3TEHB 1PH4A 4O0AA 4A3CG 4A3DG 1Z9FA 2Z6KA 3ZJYC 2WB1G 4DR5L 4DPGA 2XGTA 3CQZH 1L0WA 2JA5H 3HOWH 2K52A 1N33Q 2RHSB 3NENA 2Q2HA 4OWWB 3GTKH 1Q46A 4JYAQ 1K8GA 1EFWA 2CCZA 4OWXB 1KL9A 3CMEA 1P8LA 4JV5Q 1ASYA 1HNXQ 2Y0SG 1SN8A 3RZDH 2IY5B 4IPDA 5AJ3Q 4C3JH 5C3EG 1JJGA 5C4XH 1LYLA 3M4PA 4PZ7A 3J80i 1RL2A 3HOUH 1CKNA 2BH2A 3CCVA 2JK8A 1KC8C 2ID0A 3MEFA 1G51A 4A3GG 3CC2A 2F3IA 4OO1G 1LM0A 1YHBA 3I2ZA 1JB7A 1Y1VH 1CSPA 4QY7A 3T1HQ 1XPOA 2R92G 4DR1L 1UE5A 1EUJA 2R93G 4BBRG 4JBMA 4AH6A 1YEZA 3UE1A 3PSIA 1QVGA 1KHIA 1HR0Q 4IJHA 5M5YH 4ALPA 5JEAJ 3FHWA 3ULLA 4HJ7A 4IPCA 2ATWA 2JA6G 4A3BH 1VQLA 2VUMG 3M4OH 5IYCG 2JEAI 1SLJA 1BVSA 1SRUA 3AQQA 1WCMG 4OONA 5C0XG 4KI0A 1VQKA 1PFSA 1UEBA 3ULJA 5C44G 1PH8A 2E2JH 2R7ZH 4YCWA 4AQYL 2B29A 3ERSX 3I7FA 1QZHA 4LF9Q 1SROA 3GO5A 4JI6L 3CP0A 2OCEA 3RLFA 4JI4Q 1BBWA 1S72A 4QQBX 2ZJPA 1YHAA 4DV4Q 2MQHA 2ZJRA 2FXQA 2K50A 1UE6A 1YBYA 4PMWA 2AKWB 5IWAQ 3I56A 4X62L 5FJ8G 4P72A 4A3KH 3KDFB 3GTOH 2DGYA 2H5XA 1QZGA 3NEMA 4P73A 2I0QA 1A62A 4JI2Q 2UXCQ 1VS0A 5M3MG 5GROA 4X65Q 3CMAA 2A19A 1J5EL 3BJUA 2E2HH 4YY3L 4IPGA 1ASZA 1VQBA 4LFAQ 4R4QA 2CWPA 3W5OA 1PVOA 1Q7YC 3HOVH 4JI1L 4LF7L 4A93G 4LF6Q 1VQJA 5BR8L 4UPAA 4KLKA 3T1YL 3PUWA 3DLLA 1N36L 1YITA 3BU2A 4Y52H 3DM3A 1PH3A 4DV6Q 1K3RA 1GO3E 4DR4Q 2GVBA 2ALYB 2K75A 1PH7A 4HIDA 4BA2I 1HNWQ 2K5VA 2Z6KC 1I94L 2NN6I 4LF8L 3CCRA 2WFWA 3F2BA 1PA6A 3S1MH 4JC0A 1K73C 1A63A 3HOXG 2D0PA 1A0IA 4LUOA 1P16A 2HT1A 4IFDG 4B3SL 4GKJL 4LFBL 4A3IG 2NZHA 3B6YA 3KF6B 2XTIA 5JEAG 2OWOA 2R93H 2ZJQA 3S1NH 1OXTA 4YCVA 4A4IA 4DV0L 1L1OA 5ELNA 1VQPA 4JYAL 3IRBA 2PMZE 1O7IA 4PG3A 2IX1A 4DR7L 1WI5A 2E5LL 4K0KQ 4J15A 2UXDL 4IFDI 3GTJH 2LXKA 5IP9H 5IYDH 3HOWG 1G6PA 2Q2IA 2QEXA 4OX9L 2MFIA 3K7AH 5C4JH 2LSSA 2YV5A 3CC4A 1VQCA 3RNUA 3GTGH 4B3TQ 4OO1I 3KF8B 5M3FG 4DUZL 2UUAQ 2Q2UA 1VQMA 2D0OA 3T1HL 4GN3B 5HGQA 4A3LH 4POFA 2MNAA 5C4XG 1K9MC 1U0LA 2VQFQ 5LMNQ 3HOUG 1KRTA 1TWGH 4YCUA 4DR3L 2CFMA 4NPSA 4JI7L 2R6GA 1CKMA 1VQIA 1BKBA 1YJWA 4NXMQ 1XTDA 1E22A 1IBKQ 4Y7NH 1K8AC 2N49A 1NJIC 3E9IA 4JI8Q 1IXRA 4QL5A 3HFZB 2KCMA 4X64L 2UU9Q 4YWLA 4LF9L 3PV0A 4BBSH 4DV7Q 2JE6I 2A8VA 1IBML 2NZOA 4IO9A 3Q8DA 4XIGS 2C35B 4OWTB 2YU9H 5IYBG 1SMXA 3U4VA 3CAMA 4YWMA 4L5TA 4UP7A 4DV1Q 2NVQH 5GAGC 2GN5A 3VDYA 4LF5Q 2UXBQ 2F4VL 1PYSB 3OW2A 4DKAC 1V1QA 2PI2A 4R4IA 4JI2L 2UXCL 4BXXH 1W2BA 4DV3Q 4DUYQ 4APVA 4X65L 3UDGA 4XTCS 4UY8C 4A3JG 4ME3A 4JI0Q 1JE5A 1QUQB 1KQSA 4LFAL 5LMUL 2QGQA 4P75A 4KHPL 3MXNB 2VQEQ 4B3MQ 4HIMA 1EYGA 4DNIA 1YI2A 1C0AA 3ICEA 4FDBA 5DLQE 2VW9A 1GM5A 1VQAA 2AHOB 1L2FA 3PO3H 1OXUA 3H0GH 4DR6Q 4DR4L 3KDFA 4IFDJ 3HOVG 4DR2L 1KXLA 3KOJA 2PNHA 1AH9A 1YIJA 3G4SA 4JBWA 5EAYA 4GKKL 1GVPA 3PUVA 1N8RC 4R4TA 4HJAA 2OTLA 2UUBL 1XNRQ 3ER0A 4DV5Q 1Y1WG 1L1OC 3HKSA 2EQSA 4JI5L 4GN5A 2KCTA 3PO2H 3S16H 4B3RL 1J6QA 1G291 1NMFA 1KAWA 3K8AA 3E0EA 4L5QA 4LUZA 4P74A 1SR3A 3CCEA 1KD1C 3TS2A 2RF4A 4AIMA 5GAEC 5FLMG 3CW2C 4IJLA 3OTOL 2ZM6L 4POGA 1LTLA 2R7DA 2WAQE 3M85A 3U4ZA 3CCSA 4EQ5A 1CSQA 1N32L 5IP7H 1EWIA 3CCUA 2IHEA 3A74A 4MNOA 1FGUA 1VQOA 1EQQA 1IBLQ 1XMQQ 3NELA 1VQNA 3HOZH 4WJ3M 1M1KC 2IHFA 4JI3L 4JOIA 3UE0A 4C2MH 1AE2A 1YZ6A 1PHJA 1XMOL 1EIYB 5ELOA 2UUCL 4B3TL 2YTVA 2JA7H 3I4NG 2WAQG 4DK6C 1VCIA 1XPUA 4NXNL 1OTCA 5M5WH 1A8VA 4DV2Q 2HHHQ 2VS1A 5IP9G 5IYDG 3ULPA 4JG2A 3KF6A 3F2CA 1N34L 5IY0A 3OYYA 4O2DA 3CCQA 3PUYA 4L5SA 1HNZQ 4GLVB 3G6EA 2GVAA 3CPWA 2EXDA 2NN6G 2RCNA 2CQOA 5HY6A 1I6HH 2N3SA 3FKIG 4L5RC 4JI8L 2IX0A 4C3IH 4JV5L 5JJKA 2OTJA 3HOYH 4WJ4A 4A3MH 2UU9L 2YTYA 1OXSC 1X9NA 4GS3A 4LF4Q 2IT1A 3J7A5 1VQ9A 3LGJA 1SE8A 1PH2A 2ZTCA 1VQ4A 2PQAB 1X3FA 3G48A 4BY7H 4DV1L 1PH6A 1X56A 1CKOA 2R92H 1KRSA 5J3BA 4JCVE 1N33L 4BBSG 3KJOA 2KHJA 1TWFH 3S15H 2CKZB 3PUZA 4GN4B 2VL6A 4DV3L 2B63G 3I55A 4DUYL 1HZBA 4KHZA 3GTLH 1HNXL 3EN2A 1MJCA 1VQ7A 1HJPA 2LXJA 2YTXA 3STBD 4AYBE 5IYCH 4X66Q 5AJ3L 1MJEA 3H3VH 1JT8A 2JA5G 3RZOH 3RR5A 2F52A 4DR1Q 3S1RH 1EQRA 4PZ8A 4YHHQ 4UP8A 4C3HH 3H15A 3TRZA 1E1OA 1WOCA 2OQKA 1Q82C 4GNXB 1DGSA 1C7YA 1FJGQ 3CPFA 1BBUA 4BXXG 4B3ML 2N78A 5GAHC 1YHQA 1CUKA 1VQFA 4AYBG 3I4OA 3KLWA 1Z47A 1B70B 2L15A 2RHQB 2K5HA 2WP8J 5FJ8H 4RMFA 1FVIA 4AQYQ 2I5LX 1WJJA 1VQDA 3F2DA 4JI6Q 1IYJB 1X65A 4GOPB 1HR0L 2BH8A 2KENA 3GTPH 1D8LA 3M7NA 4A3FH 5M3MH 5IE8A 3CCLA 2EIFA 2K4KA 4JBKA 2JA8H 1SFOH 3K80C 1I3QH 1Y1VG 3PO3G 3RLOA 4X62Q 1QUQA 5JJIA 4A93H 1VQ6A 1HR0W 1T9HA 4A76A 1XPRA 1NE3A 1B8AA 1MKHA 3J81j 4JI4L 4A3BG 3UDFA 1JJ2A 1AE3A 2QA4A 3SGIA 4DV4L 1J5EQ 3PO2G 3KYHC 3K81C 4JOIC 4YY3Q 1K83H 5IWAL 3PCOB 1PV4A 2R7ZG 1U5KA 4BY1H 3G71A 1TWHH 4IPHA 2CWAA 4JI1Q 2AWNA 1QVCA 3TS0A 5BR8Q 3CXCA 4A75A 1JJCB 5H1SE 3PUXA 2V1CC 2R7FA 1HZ9A 3D31A 3HOXH 4HIOA 3T1YQ 3S2DH 1NY4A 3A5ZB 4MZ9A 5IP7G 3U58A 4A3IH 1N36Q 3GTQH 3F1ZA 1I5FA 1VQEA 4A3KG 1FL0A 4RG1A 3S2HH 4LF8Q 1I94Q 5GADC 2NVYH 4LF6L 4LUVA 2JA7G 2B3GA 2Y0SE 1X3GA 1TXYA 4UP9A 4GKJQ 4LFBQ 4BA1I 3L2PA 4B3SQ 1PH9A 3AYHB 4DK3C 4GNXC 1E24A 4DV0Q 1PYBA 4DV6L 1JMCA 4LF4L 3KJPA 3CCJA 1HNWL 4DR7Q 3S14H 2E5LQ 1E7ZA 5M3FH 3M9BA 2ASBA 2UXDQ 1VQHA 1VQGA 1IL2A 2ZTEA 3HOYG 4QJFA 2DUDA 4A3MG 3CF5A 3PF4A 4GOPC 3E9HA 4OX9Q 3UDIA 1V9PA 2ZTDA 3A0JA 4DUZQ 4K0KL 2Z0SA 4X66L 3I4MH 3EIVA 4BY7G 2YYZA 3STBC 5IT9c 2VZAA 4YHHL 1XNQQ 1UE7A 3K0XA 3CCMA 3GD7A 2I5MX 4DR3Q 4A3EH 1KIXA 1Q1EA 1FJGL 4JI7Q 2NVXH 2E8GA 4MTNA 4PZ6A 1M90C 4A3CH 2UUAL 1Q81C 4A3DH 5IYBH 2AMCB 2I5HA 3J81c 1X6OA 1GKHA 2PQAA 3L0OA 4GLAC 3CC7A 4LFCQ 1NBWA 4X64Q 5M5XH 4DAYB 3PIPA 2VQFL 1CKNB 5LMNL 2D62A 1IBMQ 4R1JA 3GTMH 1EIFA 4LNQA 2VY3A 2ES2A 4IOCA 4NXML 1HZAA 1N9WA 1Q12A 1WFQA 4DR5Q 1IBKL 2MO0A 4DAMA 4A3JH 3H3VI 5K36G 5C0XI 4A3LG 5C3EH 3F8TA 1YJNA 4LW1A 2F4VQ 4JBJA 5LMNW 1Y14B 1Q8KA 3BZCA 4DV7L 1YNXA 3WWVA 3D0FA 4LWCA 4GNXA 1S40A 3RLNA 4QIWE 4TQUS 5JJLA 4A3GH 4A3FG 2E2IH 2JA8G 3W1BA 3PF5A 3AFPA 1PH5A 3TQYA 1R9TH 3JAMc 4LF5L 2UXBL 1YVCA 3TREA 5LMUQ 5GQOA 4KHPQ 2JEBI 1HH2P 4BBRH 2VNUD 4HJ5A 3M3YH 3U50C 4X6AH 1MIUA 4GOPA 3A5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA6 H;  3EBE A;  4R4C A;  3PIO A;  2VUM H;  1EOV A;  1QVF A;  1Y1W H;  4JI0 L;  1WCM H;  5C44 H;  2NVT H;  2A1A A;  4BY1 G;  3K7U C;  2MO1 A;  4DR2 Q;  3NBH B;  1YJ9 A;  5FLM H;  2K5N A;  2VQE L;  4GKK Q;  2JQO A;  2BA0 A;  3J81 i;  2UUB Q;  4NB3 A;  4JI5 Q;  2HIV A;  4B3R Q;  4DR6 L;  3RN5 A;  1X55 A;  1HZC A;  2HQL A;  4IOA A;  1RIP A;  1UWV A;  4YWK A;  3W1G A;  1GD7 A;  1NMG A;  3OTO Q;  2ZM6 Q;  3RN2 A;  3FP9 A;  2PI2 E;  3BZK A;  3I4N H;  4OXP A;  3UDX A;  1W3S A;  1Q1B A;  5FLX c;  1N32 Q;  2JJQ A;  1XNR L;  4DV5 L;  1H95 A;  2BA1 A;  3AEV A;  1OXV A;  3KFU A;  2K14 A;  1WYD A;  2AWO A;  3M4Q A;  4H02 A;  4P71 A;  3H0G G;  1K0R A;  4HJ8 A;  3L7Z C;  3J80 c;  1VQ8 A;  4JI3 Q;  2UUC Q;  1E3P A;  1XMO Q;  1D7Q A;  4EX5 A;  2OQ0 A;  2N8N A;  1VQ5 A;  3FKI H;  3J7Z C;  4NXN Q;  2KHI A;  1LUZ A;  4HJ9 A;  3JAM i;  1TWA H;  1XJV A;  1OXX K;  1XNQ L;  1UE1 A;  1IBL L;  1N34 Q;  4QGU A;  5E7N A;  4GLX A;  1XMQ L;  1L1O B;  3JC6 6;  1IZ6 A;  3HKZ E;  5C0X J;  3S17 H;  1PH1 A;  4LF7 Q;  1V43 A;  1X54 A;  3AFQ A;  3PGZ A;  3S24 A;  2HIX A;  4HIK A;  3S1Q H;  3I4M G;  2JA9 A;  2WB1 E;  4TVA B;  4DV2 L;  2HHH L;  1S3O A;  1TWC H;  1NTG A;  1E1T A;  1X3E A;  4LFC L;  3CD6 A;  1B7Y B;  2KBN A;  3GDE A;  3HOZ G;  1Q86 C;  4A3E G;  1I50 H;  3HKZ G;  1HNZ L;  2Q2T A;  2B63 H;  1C9O A;  4R4O A;  3TEH B;  1PH4 A;  4O0A A;  4A3C G;  4A3D G;  1Z9F A;  2Z6K A;  3ZJY C;  2WB1 G;  4DR5 L;  4DPG A;  2XGT A;  3CQZ H;  1L0W A;  2JA5 H;  3HOW H;  2K52 A;  1N33 Q;  2RHS B;  3NEN A;  2Q2H A;  4OWW B;  3GTK H;  1Q46 A;  4JYA Q;  1K8G A;  1EFW A;  2CCZ A;  4OWX B;  1KL9 A;  3CME A;  1P8L A;  4JV5 Q;  1ASY A;  1HNX Q;  2Y0S G;  1SN8 A;  3RZD H;  2IY5 B;  4IPD A;  5AJ3 Q;  4C3J H;  5C3E G;  1JJG A;  5C4X H;  1LYL A;  3M4P A;  4PZ7 A;  3J80 i;  1RL2 A;  3HOU H;  1CKN A;  2BH2 A;  3CCV A;  2JK8 A;  1KC8 C;  2ID0 A;  3MEF A;  1G51 A;  4A3G G;  3CC2 A;  2F3I A;  4OO1 G;  1LM0 A;  1YHB A;  3I2Z A;  1JB7 A;  1Y1V H;  1CSP A;  4QY7 A;  3T1H Q;  1XPO A;  2R92 G;  4DR1 L;  1UE5 A;  1EUJ A;  2R93 G;  4BBR G;  4JBM A;  4AH6 A;  1YEZ A;  3UE1 A;  3PSI A;  1QVG A;  1KHI A;  1HR0 Q;  4IJH A;  5M5Y H;  4ALP A;  5JEA J;  3FHW A;  3ULL A;  4HJ7 A;  4IPC A;  2ATW A;  2JA6 G;  4A3B H;  1VQL A;  2VUM G;  3M4O H;  5IYC G;  2JEA I;  1SLJ A;  1BVS A;  1SRU A;  3AQQ A;  1WCM G;  4OON A;  5C0X G;  4KI0 A;  1VQK A;  1PFS A;  1UEB A;  3ULJ A;  5C44 G;  1PH8 A;  2E2J H;  2R7Z H;  4YCW A;  4AQY L;  2B29 A;  3ERS X;  3I7F A;  1QZH A;  4LF9 Q;  1SRO A;  3GO5 A;  4JI6 L;  3CP0 A;  2OCE A;  3RLF A;  4JI4 Q;  1BBW A;  1S72 A;  4QQB X;  2ZJP A;  1YHA A;  4DV4 Q;  2MQH A;  2ZJR A;  2FXQ A;  2K50 A;  1UE6 A;  1YBY A;  4PMW A;  2AKW B;  5IWA Q;  3I56 A;  4X62 L;  5FJ8 G;  4P72 A;  4A3K H;  3KDF B;  3GTO H;  2DGY A;  2H5X A;  1QZG A;  3NEM A;  4P73 A;  2I0Q A;  1A62 A;  4JI2 Q;  2UXC Q;  1VS0 A;  5M3M G;  5GRO A;  4X65 Q;  3CMA A;  2A19 A;  1J5E L;  3BJU A;  2E2H H;  4YY3 L;  4IPG A;  1ASZ A;  1VQB A;  4LFA Q;  4R4Q A;  2CWP A;  3W5O A;  1PVO A;  1Q7Y C;  3HOV H;  4JI1 L;  4LF7 L;  4A93 G;  4LF6 Q;  1VQJ A;  5BR8 L;  4UPA A;  4KLK A;  3T1Y L;  3PUW A;  3DLL A;  1N36 L;  1YIT A;  3BU2 A;  4Y52 H;  3DM3 A;  1PH3 A;  4DV6 Q;  1K3R A;  1GO3 E;  4DR4 Q;  2GVB A;  2ALY B;  2K75 A;  1PH7 A;  4HID A;  4BA2 I;  1HNW Q;  2K5V A;  2Z6K C;  1I94 L;  2NN6 I;  4LF8 L;  3CCR A;  2WFW A;  3F2B A;  1PA6 A;  3S1M H;  4JC0 A;  1K73 C;  1A63 A;  3HOX G;  2D0P A;  1A0I A;  4LUO A;  1P16 A;  2HT1 A;  4IFD G;  4B3S L;  4GKJ L;  4LFB L;  4A3I G;  2NZH A;  3B6Y A;  3KF6 B;  2XTI A;  5JEA G;  2OWO A;  2R93 H;  2ZJQ A;  3S1N H;  1OXT A;  4YCV A;  4A4I A;  4DV0 L;  1L1O A;  5ELN A;  1VQP A;  4JYA L;  3IRB A;  2PMZ E;  1O7I A;  4PG3 A;  2IX1 A;  4DR7 L;  1WI5 A;  2E5L L;  4K0K Q;  4J15 A;  2UXD L;  4IFD I;  3GTJ H;  2LXK A;  5IP9 H;  5IYD H;  3HOW G;  1G6P A;  2Q2I A;  2QEX A;  4OX9 L;  2MFI A;  3K7A H;  5C4J H;  2LSS A;  2YV5 A;  3CC4 A;  1VQC A;  3RNU A;  3GTG H;  4B3T Q;  4OO1 I;  3KF8 B;  5M3F G;  4DUZ L;  2UUA Q;  2Q2U A;  1VQM A;  2D0O A;  3T1H L;  4GN3 B;  5HGQ A;  4A3L H;  4POF A;  2MNA A;  5C4X G;  1K9M C;  1U0L A;  2VQF Q;  5LMN Q;  3HOU G;  1KRT A;  1TWG H;  4YCU A;  4DR3 L;  2CFM A;  4NPS A;  4JI7 L;  2R6G A;  1CKM A;  1VQI A;  1BKB A;  1YJW A;  4NXM Q;  1XTD A;  1E22 A;  1IBK Q;  4Y7N H;  1K8A C;  2N49 A;  1NJI C;  3E9I A;  4JI8 Q;  1IXR A;  4QL5 A;  3HFZ B;  2KCM A;  4X64 L;  2UU9 Q;  4YWL A;  4LF9 L;  3PV0 A;  4BBS H;  4DV7 Q;  2JE6 I;  2A8V A;  1IBM L;  2NZO A;  4IO9 A;  3Q8D A;  4XIG S;  2C35 B;  4OWT B;  2YU9 H;  5IYB G;  1SMX A;  3U4V A;  3CAM A;  4YWM A;  4L5T A;  4UP7 A;  4DV1 Q;  2NVQ H;  5GAG C;  2GN5 A;  3VDY A;  4LF5 Q;  2UXB Q;  2F4V L;  1PYS B;  3OW2 A;  4DKA C;  1V1Q A;  2PI2 A;  4R4I A;  4JI2 L;  2UXC L;  4BXX H;  1W2B A;  4DV3 Q;  4DUY Q;  4APV A;  4X65 L;  3UDG A;  4XTC S;  4UY8 C;  4A3J G;  4ME3 A;  4JI0 Q;  1JE5 A;  1QUQ B;  1KQS A;  4LFA L;  5LMU L;  2QGQ A;  4P75 A;  4KHP L;  3MXN B;  2VQE Q;  4B3M Q;  4HIM A;  1EYG A;  4DNI A;  1YI2 A;  1C0A A;  3ICE A;  4FDB A;  5DLQ E;  2VW9 A;  1GM5 A;  1VQA A;  2AHO B;  1L2F A;  3PO3 H;  1OXU A;  3H0G H;  4DR6 Q;  4DR4 L;  3KDF A;  4IFD J;  3HOV G;  4DR2 L;  1KXL A;  3KOJ A;  2PNH A;  1AH9 A;  1YIJ A;  3G4S A;  4JBW A;  5EAY A;  4GKK L;  1GVP A;  3PUV A;  1N8R C;  4R4T A;  4HJA A;  2OTL A;  2UUB L;  1XNR Q;  3ER0 A;  4DV5 Q;  1Y1W G;  1L1O C;  3HKS A;  2EQS A;  4JI5 L;  4GN5 A;  2KCT A;  3PO2 H;  3S16 H;  4B3R L;  1J6Q A;  1G29 1;  1NMF A;  1KAW A;  3K8A A;  3E0E A;  4L5Q A;  4LUZ A;  4P74 A;  1SR3 A;  3CCE A;  1KD1 C;  3TS2 A;  2RF4 A;  4AIM A;  5GAE C;  5FLM G;  3CW2 C;  4IJL A;  3OTO L;  2ZM6 L;  4POG A;  1LTL A;  2R7D A;  2WAQ E;  3M85 A;  3U4Z A;  3CCS A;  4EQ5 A;  1CSQ A;  1N32 L;  5IP7 H;  1EWI A;  3CCU A;  2IHE A;  3A74 A;  4MNO A;  1FGU A;  1VQO A;  1EQQ A;  1IBL Q;  1XMQ Q;  3NEL A;  1VQN A;  3HOZ H;  4WJ3 M;  1M1K C;  2IHF A;  4JI3 L;  4JOI A;  3UE0 A;  4C2M H;  1AE2 A;  1YZ6 A;  1PHJ A;  1XMO L;  1EIY B;  5ELO A;  2UUC L;  4B3T L;  2YTV A;  2JA7 H;  3I4N G;  2WAQ G;  4DK6 C;  1VCI A;  1XPU A;  4NXN L;  1OTC A;  5M5W H;  1A8V A;  4DV2 Q;  2HHH Q;  2VS1 A;  5IP9 G;  5IYD G;  3ULP A;  4JG2 A;  3KF6 A;  3F2C A;  1N34 L;  5IY0 A;  3OYY A;  4O2D A;  3CCQ A;  3PUY A;  4L5S A;  1HNZ Q;  4GLV B;  3G6E A;  2GVA A;  3CPW A;  2EXD A;  2NN6 G;  2RCN A;  2CQO A;  5HY6 A;  1I6H H;  2N3S A;  3FKI G;  4L5R C;  4JI8 L;  2IX0 A;  4C3I H;  4JV5 L;  5JJK A;  2OTJ A;  3HOY H;  4WJ4 A;  4A3M H;  2UU9 L;  2YTY A;  1OXS C;  1X9N A;  4GS3 A;  4LF4 Q;  2IT1 A;  3J7A 5;  1VQ9 A;  3LGJ A;  1SE8 A;  1PH2 A;  2ZTC A;  1VQ4 A;  2PQA B;  1X3F A;  3G48 A;  4BY7 H;  4DV1 L;  1PH6 A;  1X56 A;  1CKO A;  2R92 H;  1KRS A;  5J3B A;  4JCV E;  1N33 L;  4BBS G;  3KJO A;  2KHJ A;  1TWF H;  3S15 H;  2CKZ B;  3PUZ A;  4GN4 B;  2VL6 A;  4DV3 L;  2B63 G;  3I55 A;  4DUY L;  1HZB A;  4KHZ A;  3GTL H;  1HNX L;  3EN2 A;  1MJC A;  1VQ7 A;  1HJP A;  2LXJ A;  2YTX A;  3STB D;  4AYB E;  5IYC H;  4X66 Q;  5AJ3 L;  1MJE A;  3H3V H;  1JT8 A;  2JA5 G;  3RZO H;  3RR5 A;  2F52 A;  4DR1 Q;  3S1R H;  1EQR A;  4PZ8 A;  4YHH Q;  4UP8 A;  4C3H H;  3H15 A;  3TRZ A;  1E1O A;  1WOC A;  2OQK A;  1Q82 C;  4GNX B;  1DGS A;  1C7Y A;  1FJG Q;  3CPF A;  1BBU A;  4BXX G;  4B3M L;  2N78 A;  5GAH C;  1YHQ A;  1CUK A;  1VQF A;  4AYB G;  3I4O A;  3KLW A;  1Z47 A;  1B70 B;  2L15 A;  2RHQ B;  2K5H A;  2WP8 J;  5FJ8 H;  4RMF A;  1FVI A;  4AQY Q;  2I5L X;  1WJJ A;  1VQD A;  3F2D A;  4JI6 Q;  1IYJ B;  1X65 A;  4GOP B;  1HR0 L;  2BH8 A;  2KEN A;  3GTP H;  1D8L A;  3M7N A;  4A3F H;  5M3M H;  5IE8 A;  3CCL A;  2EIF A;  2K4K A;  4JBK A;  2JA8 H;  1SFO H;  3K80 C;  1I3Q H;  1Y1V G;  3PO3 G;  3RLO A;  4X62 Q;  1QUQ A;  5JJI A;  4A93 H;  1VQ6 A;  1HR0 W;  1T9H A;  4A76 A;  1XPR A;  1NE3 A;  1B8A A;  1MKH A;  3J81 j;  4JI4 L;  4A3B G;  3UDF A;  1JJ2 A;  1AE3 A;  2QA4 A;  3SGI A;  4DV4 L;  1J5E Q;  3PO2 G;  3KYH C;  3K81 C;  4JOI C;  4YY3 Q;  1K83 H;  5IWA L;  3PCO B;  1PV4 A;  2R7Z G;  1U5K A;  4BY1 H;  3G71 A;  1TWH H;  4IPH A;  2CWA A;  4JI1 Q;  2AWN A;  1QVC A;  3TS0 A;  5BR8 Q;  3CXC A;  4A75 A;  1JJC B;  5H1S E;  3PUX A;  2V1C C;  2R7F A;  1HZ9 A;  3D31 A;  3HOX H;  4HIO A;  3T1Y Q;  3S2D H;  1NY4 A;  3A5Z B;  4MZ9 A;  5IP7 G;  3U58 A;  4A3I H;  1N36 Q;  3GTQ H;  3F1Z A;  1I5F A;  1VQE A;  4A3K G;  1FL0 A;  4RG1 A;  3S2H H;  4LF8 Q;  1I94 Q;  5GAD C;  2NVY H;  4LF6 L;  4LUV A;  2JA7 G;  2B3G A;  2Y0S E;  1X3G A;  1TXY A;  4UP9 A;  4GKJ Q;  4LFB Q;  4BA1 I;  3L2P A;  4B3S Q;  1PH9 A;  3AYH B;  4DK3 C;  4GNX C;  1E24 A;  4DV0 Q;  1PYB A;  4DV6 L;  1JMC A;  4LF4 L;  3KJP A;  3CCJ A;  1HNW L;  4DR7 Q;  3S14 H;  2E5L Q;  1E7Z A;  5M3F H;  3M9B A;  2ASB A;  2UXD Q;  1VQH A;  1VQG A;  1IL2 A;  2ZTE A;  3HOY G;  4QJF A;  2DUD A;  4A3M G;  3CF5 A;  3PF4 A;  4GOP C;  3E9H A;  4OX9 Q;  3UDI A;  1V9P A;  2ZTD A;  3A0J A;  4DUZ Q;  4K0K L;  2Z0S A;  4X66 L;  3I4M H;  3EIV A;  4BY7 G;  2YYZ A;  3STB C;  5IT9 c;  2VZA A;  4YHH L;  1XNQ Q;  1UE7 A;  3K0X A;  3CCM A;  3GD7 A;  2I5M X;  4DR3 Q;  4A3E H;  1KIX A;  1Q1E A;  1FJG L;  4JI7 Q;  2NVX H;  2E8G A;  4MTN A;  4PZ6 A;  1M90 C;  4A3C H;  2UUA L;  1Q81 C;  4A3D H;  5IYB H;  2AMC B;  2I5H A;  3J81 c;  1X6O A;  1GKH A;  2PQA A;  3L0O A;  4GLA C;  3CC7 A;  4LFC Q;  1NBW A;  4X64 Q;  5M5X H;  4DAY B;  3PIP A;  2VQF L;  1CKN B;  5LMN L;  2D62 A;  1IBM Q;  4R1J A;  3GTM H;  1EIF A;  4LNQ A;  2VY3 A;  2ES2 A;  4IOC A;  4NXM L;  1HZA A;  1N9W A;  1Q12 A;  1WFQ A;  4DR5 Q;  1IBK L;  2MO0 A;  4DAM A;  4A3J H;  3H3V I;  5K36 G;  5C0X I;  4A3L G;  5C3E H;  3F8T A;  1YJN A;  4LW1 A;  2F4V Q;  4JBJ A;  5LMN W;  1Y14 B;  1Q8K A;  3BZC A;  4DV7 L;  1YNX A;  3WWV A;  3D0F A;  4LWC A;  4GNX A;  1S40 A;  3RLN A;  4QIW E;  4TQU S;  5JJL A;  4A3G H;  4A3F G;  2E2I H;  2JA8 G;  3W1B A;  3PF5 A;  3AFP A;  1PH5 A;  3TQY A;  1R9T H;  3JAM c;  4LF5 L;  2UXB L;  1YVC A;  3TRE A;  5LMU Q;  5GQO A;  4KHP Q;  2JEB I;  1HH2 P;  4BBR H;  2VNU D;  4HJ5 A;  3M3Y H;  3U50 C;  4X6A H;  1MIU A;  4GOP A;  3A5U A; 
#chains in the Genus database with same CATH topology
 3EBE A;  1LTA D;  1TQO A;  4H13 C;  5KGU A;  1Y1W H;  4M1U B;  2A1A A;  1EY6 A;  3K7U C;  2MO1 A;  3NBH B;  2JQO A;  2UUB Q;  1LT6 D;  2ZXR A;  2EJG C;  4JI5 Q;  4B3R Q;  3I3C A;  4DR6 L;  3RN5 A;  1X55 A;  1HZC A;  2NUC A;  2FIN B;  2HQL A;  3GTL B;  1GD7 A;  3OTO Q;  1E0B A;  3BVZ A;  5M9O A;  3GTJ B;  3CRL C;  1W3S A;  1Q1B A;  2JJQ A;  1H9J A;  2RA4 A;  2BA1 A;  1QIL A;  1X3P A;  3A8I E;  2K14 A;  5I9P A;  4P71 A;  3H0G G;  1Q8I A;  2NN6 H;  1D7Q A;  4EX5 A;  2N8N A;  3ERO A;  2F4I A;  4WJW A;  1EEF D;  5C3W A;  1XNQ L;  1HQM C;  4GLX A;  4XT3 B;  5LL6 S;  3A55 A;  2QKI C;  3C46 A;  1IZ6 A;  1XXG A;  3NXW A;  4N8X 1;  1V43 A;  1X54 A;  2PZU A;  4HIK A;  3S1Q H;  2WB1 E;  2HHH L;  1S3O A;  1TWC H;  1KDA A;  1NTG A;  3CD6 A;  4LFC L;  1B7Y B;  4A93 B;  3GDE A;  3MC0 B;  1Q86 C;  4CDC C;  3HKZ G;  1XTC D;  3DEP A;  4XQQ A;  2B63 H;  2KCN A;  4O0A A;  2Z6K A;  2NVQ B;  3BDO A;  1L0W A;  3HOW H;  1L0Y B;  4DXG A;  4IUV A;  4OWW B;  2KEE A;  4JYA Q;  5CMD A;  5A35 A;  2CCZ A;  3CME A;  1QE6 A;  2EPB A;  2IY5 B;  3I91 A;  4R8I A;  5AJ3 Q;  1PTO D;  4C3J H;  1JJG A;  3EVQ A;  1LYL A;  3M4P A;  3S2H B;  3J80 i;  2F0G A;  4FNF A;  3CCV A;  2F0M A;  1G51 A;  2PQE A;  3LX0 A;  3I2Z A;  3IAY A;  3T1H Q;  1XPO A;  4AH6 A;  3S14 B;  5M3F B;  3PSI A;  1HR0 Q;  1TS5 A;  5E4W C;  2ATW A;  5KND A;  4KI0 A;  1UEB A;  4J8Q A;  2E2J H;  2R7Z H;  2V4D A;  3NPP A;  2B29 A;  3ERS X;  3E5S A;  3I7F A;  5IT9 L;  1SRO A;  2CH4 A;  1JE4 A;  4TKO B;  3T16 A;  3C1E A;  4JI4 Q;  1S72 A;  2ZJP A;  4DV4 Q;  2MQH A;  3SK8 A;  2K50 A;  4PMW A;  3I56 A;  5J39 A;  2AKW B;  3J81 L;  3HOZ B;  1JWS D;  3KK7 A;  4KTA A;  4C1N I;  5FJ8 G;  1GOZ A;  1QZG A;  2H5X A;  3NEM A;  4A3D B;  2SEB D;  3FRP B;  3FPU B;  3NHH A;  5T1G A;  4B9W A;  3J7A V;  4ZUJ A;  4X65 Q;  1PMR A;  3R93 A;  2E2H H;  4YY3 L;  1X32 A;  4EVO A;  2XIW A;  1Q7Y C;  4A93 G;  4CBV A;  4UPA A;  3BS1 A;  3QOJ A;  1L0X B;  5C3E B;  1LAB A;  3PUW A;  3DLL A;  1HTP A;  3DM3 A;  1PH3 A;  1SE3 A;  2GVB A;  4HID A;  1I94 L;  5JVH 3;  3CCR A;  1HFN A;  2WFW A;  3F2B A;  1PA6 A;  2Q8T A;  2NWG A;  3HOX G;  1A0I A;  4LUO A;  5EKL A;  4RKB A;  2B2U A;  4KKS A;  3S1N H;  5COY A;  1OXT A;  3GQB A;  4JYA L;  1O7I A;  5ISR A;  2VUM B;  4DR7 L;  4X3S A;  2K6A A;  3TDQ A;  4F7X A;  2JSO A;  2G9H D;  1ZYR D;  2LXK A;  5IYD H;  1WTX A;  3HOW G;  4TSS A;  3VR2 A;  4FF4 A;  4RH6 A;  2PZT A;  2LSS A;  2YV5 A;  3CC4 A;  4JPB W;  2GA4 B;  5M3F G;  2CH4 W;  2Q2U A;  3T1H L;  4GN3 B;  2PCF B;  2F0E A;  5HGQ A;  5FLX L;  5IOD A;  2MNA A;  4A3L H;  1V1P B;  2Z8L A;  1EL0 A;  2CFM A;  4HAE A;  5M3M B;  1VQI A;  1BKB A;  3NP8 A;  2NB0 A;  1QWY A;  1XTD A;  1ET9 A;  1IBK Q;  1JC7 A;  2N49 A;  4QL5 A;  2KCM A;  3K0Y A;  1ENF A;  1DZ1 A;  2UU9 Q;  3CHB D;  1IBM L;  2NZO A;  1S5C D;  4IO9 A;  3DEO A;  1EY4 A;  4XIG S;  4OO1 H;  2L4N A;  5CV9 A;  2YU9 H;  4XQJ A;  1FD7 D;  5GAG C;  4LF5 Q;  1TWH B;  3OW2 A;  4DKA C;  2DJG C;  1SYF A;  1V1Q A;  2A69 C;  4RFB A;  2SDF A;  4U67 3;  4BXX H;  1KDB A;  3D6W A;  4APV A;  4X65 L;  4RKL A;  1CK1 A;  1STH A;  1I50 B;  1ENA A;  1FNV A;  5IIF A;  4B3M Q;  1F2M A;  4ID6 A;  5IOC A;  1C0A A;  3UI2 A;  3GTK B;  4FDB A;  5DLQ E;  1H9M A;  3PO3 H;  1JWM D;  1B9M A;  3DWA A;  2CW0 D;  5I9O A;  3A7A B;  1ILQ A;  2PNH A;  3RZD B;  1A3V A;  2EYM A;  4KKU A;  3S16 H;  1CA5 A;  1Y8O B;  1K3B C;  3E0E A;  4IUR A;  1KTK A;  1SR3 A;  4L5Q A;  3CCE A;  3TS2 A;  2RF4 A;  2Q8I B;  5GAE C;  2ICI A;  3M85 A;  3CCS A;  3CCU A;  2IHE A;  3A74 A;  5M5Y B;  1Y69 U;  4RGT A;  1M1K C;  2KJX A;  2IHF A;  4C2M H;  3M4O B;  3I4N G;  2WAQ G;  1VCI A;  4XYQ A;  5M5W H;  2QIL A;  5IYD G;  4JG2 A;  1IYV A;  3OIP A;  1SMY C;  3CCQ A;  2GVA A;  1IKM A;  2L0C A;  5F2D A;  2RCN A;  2CQO A;  1CZG A;  4ZQ3 A;  1EOT A;  3HOY H;  2UU9 L;  2YTY A;  1KAB A;  4KN7 C;  2F0Q A;  1JOO A;  3J7A 5;  3KF8 A;  1SE8 A;  1I4X A;  2DY7 A;  2PQA B;  4H0L C;  1PH6 A;  3R2I A;  4JCV E;  2B2T C;  5ELD A;  4ME5 A;  4OO1 G;  3MWY W;  1HNX L;  1VQ7 A;  5IYC H;  2YTX A;  4X66 Q;  1DM0 B;  2KVM A;  2F52 A;  5KNC A;  1EQR A;  2A6E C;  4C3H H;  3C3L A;  1E1O A;  1WOC A;  1I4P A;  1FJG Q;  4BXX G;  4B3M L;  1QNU A;  2LKV A;  4XYO A;  4AYB G;  4RMF A;  4AQY Q;  3NUC A;  1WVL A;  1PTO F;  2HUG A;  2F0J A;  1X65 A;  4JI6 Q;  2D9U A;  2BH8 A;  2KEN A;  3CCL A;  2EIF A;  1A6X A;  1SFO H;  2B2Y C;  3K5N A;  3PO3 G;  3RLO A;  2AUK A;  1QUQ A;  1SYG A;  1ICF B;  1JR0 D;  1NCV A;  3MXN A;  4A76 A;  1NE3 A;  5BN4 A;  3UDF A;  1AE3 A;  1HA6 A;  5E4X A;  1J5E Q;  1B3Q A;  3PCO B;  3KBX A;  3R2T A;  5J1Z A;  5I2Y A;  2CWA A;  1LTB D;  2IJ0 A;  4A75 A;  5H1S E;  1W6K A;  4M8A A;  3PUX A;  1HXY D;  3T1Y Q;  1NY4 A;  1JOQ A;  1KNE A;  2OF1 A;  4DNT B;  4RG1 A;  2JYO A;  4XQN A;  4LUV A;  2BE5 C;  1X3G A;  2M00 A;  4GKJ Q;  2NYZ D;  1IW7 C;  4GNX C;  3IFD A;  4DV0 Q;  2R61 A;  3CCJ A;  1SE4 A;  1HNW L;  3MTS A;  2F1M A;  1E7Z A;  5DNF A;  2UXD Q;  1GXD C;  1DYQ A;  1VQH A;  2X6L A;  1JCK B;  1IL2 A;  3HOY G;  4QJF A;  2WIN B;  2K01 A;  4FF2 A;  1FR3 A;  1W6J A;  1V9P A;  2EJF C;  3VR5 A;  1S5B D;  4X66 L;  1SDF A;  1Y1V B;  3I4M H;  1AP0 A;  1FJG L;  4A3E H;  5A2Q E;  4A3B B;  1EU4 A;  4PZ6 A;  3BDC A;  5IYB H;  3Q22 A;  1X6O A;  1AN8 A;  4C3H G;  1PTO B;  2D62 A;  4LNQ A;  2VY3 A;  1HZA A;  1RD9 D;  4DR5 Q;  2KCC A;  4LAA A;  4A3J H;  3OW7 A;  3Q23 A;  4V0B A;  1O80 A;  1G2S A;  1YNX A;  3WWV A;  1PRT C;  1VMP A;  3HZX A;  4B9X A;  5CV6 A;  1EY0 A;  4K6L A;  1EU3 A;  3JAM c;  4KHP Q;  4BBR H;  1D2B A;  4I7A A;  1PH4 A;  3H09 A;  2PW5 A;  3MA2 B;  2JA6 H;  2RDF A;  1EWC A;  3C2P A;  4A3M B;  1EOV A;  4JI0 L;  1EY5 A;  1I4G A;  5C44 H;  1SYD A;  1BQQ T;  1YJ9 A;  2VQE L;  4BY7 B;  3J81 i;  3KUP A;  2R92 B;  1LAC A;  1B3A A;  1B44 D;  4HSV A;  5IGD A;  1TWF B;  3S15 B;  5C3X A;  2L9H A;  3KLS A;  4IOA A;  1UWV A;  1YNJ C;  2ZM6 Q;  2PI2 E;  3UDX A;  1XNR L;  3A7L A;  2Q8R E;  1OXV A;  4K2K A;  3TBI B;  3KFU A;  1WYD A;  2AWO A;  4GZY C;  5D65 A;  3I72 A;  3L7Z C;  3GTG B;  3NTI A;  2UUC Q;  1E3P A;  2OQ0 A;  5KIX A;  1S4Z A;  3M4Y A;  4HJ9 A;  2XN9 C;  1XYI A;  1TWA H;  4NMZ A;  1JOK A;  1UE1 A;  1N34 Q;  3OWE B;  3ND8 A;  3SVM A;  1AZP A;  2IWH A;  4A3F B;  4LF7 Q;  3ONA B;  3PGZ A;  1SE2 A;  1I4R A;  3I4M G;  2JA9 A;  2F0S A;  1X3E A;  3SR1 A;  4L6T B;  1TT2 A;  2KBN A;  2EE1 A;  2AUJ D;  2IPK D;  4QIW B;  4A3E G;  1HNZ L;  3AU7 A;  1BCP C;  3TEH B;  4E6I A;  3ZJY C;  4DR5 L;  1K83 B;  4BWG B;  3A54 A;  1WTP A;  3TZU A;  5EPK A;  1K8G A;  1TII D;  4OWX B;  1P8L A;  4JV5 Q;  3X3N A;  2Y0S G;  1BNZ A;  4IPD A;  4C3I G;  2VB2 X;  3RD4 A;  3MXG A;  5C4X H;  5L37 A;  1RL2 A;  2NVY B;  4DAY A;  3HOU H;  2BH2 A;  2JK8 A;  1PYW D;  1ROD A;  3MEF A;  3PMF A;  3CC2 A;  2HDM A;  1YHB A;  2OEO A;  4QY7 A;  5HUR A;  2R92 G;  3H6M A;  4DR1 L;  5CGK A;  1WD0 A;  4BBR G;  1YEZ A;  1K0S A;  1QVG A;  4IJH A;  4ALP A;  5JEA J;  3ULL A;  4HJ7 A;  2JA6 G;  1VQL A;  4FXD A;  3M7G A;  4OL7 A;  2QEJ C;  1SLJ A;  1BVS A;  5LHY 1;  5C0X G;  5DM6 3;  5C44 G;  5C4H A;  3NBI A;  3CP0 A;  2OCE A;  1DOL A;  5JPM C;  2QF7 A;  1BBW A;  4QQB X;  4NP5 A;  2KOL A;  3SEB A;  1WTR A;  3HKZ B;  2A69 D;  4X62 L;  2NVX B;  2EY5 A;  3Q6S A;  4A3K H;  1A62 A;  2B39 A;  3GV3 A;  1SAP A;  5GRO A;  5M5X B;  2A19 A;  1D6E C;  4L8J A;  5IGC A;  4LFA Q;  1RHP A;  2CWP A;  4LF7 L;  4CJ0 B;  3J7A F;  4HSP A;  1NR2 A;  4NKL A;  1NAP A;  2C5C A;  1N36 L;  3GTQ B;  4I7Z C;  1I4Q A;  1K3R A;  1GO3 E;  1SNM A;  4JW0 A;  2K75 A;  4BA2 I;  1PH7 A;  2E2I B;  4LF8 L;  2HT1 A;  4LFB L;  4B3S L;  2NZH A;  4YCV A;  3KLS X;  4X3U A;  1CFM A;  2C9O A;  2VB3 X;  1HTL D;  2IX1 A;  2Z1C A;  2E5L L;  1UAP A;  4G4K A;  3GTJ H;  3MHB A;  4F8M A;  1FNU A;  4LK1 C;  1G6P A;  4OX9 L;  2MFI A;  3K7A H;  2F0V A;  1VQC A;  2Z4H A;  2K7V A;  2A68 C;  3KF8 B;  4DUZ L;  2UUA Q;  2HCI A;  5C5M A;  3H94 A;  1VQM A;  5KNB A;  5C4X G;  1SMY D;  1IL8 A;  1PLF A;  2J4X A;  3W3A A;  5LMN Q;  3HOU G;  4YCU A;  5BN3 A;  1U4M A;  5KYL A;  3GTP B;  2R6G A;  1YJW A;  2EYO A;  4NXM Q;  5ELE A;  1E22 A;  4Y7N H;  3NQI A;  1DD2 A;  1H9S A;  3A8J E;  4X64 L;  4YWL A;  3BZD B;  2JE6 I;  4PMC A;  3CKI B;  1I6V C;  3Q8D A;  4G57 A;  2K33 A;  4ZUI A;  2NVQ H;  4L5T A;  4UP7 A;  2GN5 A;  4RWS C;  2UXB Q;  2EY1 A;  1DON A;  1PYS B;  5EPL A;  1JB3 A;  4TRD A;  3S1Q B;  3HOX B;  4DV3 Q;  1TWC B;  4DUY Q;  1SYC A;  1V8Q A;  4DK1 A;  3E0J A;  2J7Z A;  2A6E D;  2BOS A;  2ZXO A;  1QUQ B;  1KQS A;  4LFA L;  2B63 B;  3MXN B;  5JVG 3;  3OIQ A;  3HOW B;  2PYK A;  4N9P A;  1GM5 A;  1L2F A;  3K5L A;  2TSS A;  3KDF A;  3KOJ A;  4ZK9 B;  3DMU A;  1GVP A;  4L63 B;  4WOR A;  4HJA A;  2OTL A;  2UUB L;  4DV5 Q;  1Y1W G;  1L1O C;  3HKS A;  1MD2 D;  4JI5 L;  1LTI D;  2KCT A;  4B3R L;  3O13 A;  2CQA A;  4QB4 A;  4I65 A;  3BVM A;  1KAW A;  3OTO L;  3CW2 C;  1PFM A;  2R7D A;  4CHT B;  2KA7 A;  3U4Z A;  1R4P B;  1FGB D;  4EQ5 A;  1S5E D;  1NR4 A;  1VQO A;  1EQQ A;  1FGU A;  2MP1 A;  3VYU A;  1IBL Q;  1XMQ Q;  3HOZ H;  3SXH A;  4WJ3 M;  3UE0 A;  2OXP A;  1QCB D;  1AE2 A;  1EIY B;  5ELO A;  5D3I B;  4DK6 C;  1A8V A;  4DV2 Q;  3U9O A;  5DAU A;  3VR6 A;  1ZEQ X;  3HS0 C;  3D4W A;  3PUY A;  4L5S A;  1NSN S;  2BE5 D;  2NN6 G;  2XSC A;  1GUS A;  2F0H A;  4NW2 A;  1IW7 D;  3OPO A;  1GJX A;  2IX0 A;  2J0T D;  4O42 A;  3I73 A;  4H44 C;  1OXS C;  4LF4 Q;  2QCP X;  1LT3 D;  2PPB C;  3NTH A;  4ZKC B;  4K14 A;  1ICW A;  3LGJ A;  1ONL A;  2E2H B;  1VQ4 A;  2LMC B;  1PZI D;  5J3B A;  1O7Y A;  3KJO A;  2CKZ B;  1EY8 A;  1GUT A;  4GN4 B;  4DV3 L;  2B63 G;  2O5J C;  3I55 A;  4DUY L;  3EN2 A;  5CYU A;  1HJP A;  2LXJ A;  2P5Z X;  1BR9 A;  5AJ3 L;  3RZO H;  3S1R H;  3TRZ A;  4UP8 A;  5IT9 E;  1G6Z A;  1AW7 A;  1DGS A;  1ESR A;  1B53 A;  1F9S A;  2E75 C;  2N78 A;  4HMI A;  1U4L A;  1VMC A;  3I4O A;  3NTK A;  2IX3 A;  3S1N B;  1EZ6 A;  2L15 A;  3C1F A;  4C3J G;  3J81 E;  2K5H A;  1DCZ A;  3F2D A;  2EOT A;  3I4N B;  2WAQ B;  1HR0 L;  3GV6 A;  1CTM A;  5ELF A;  4RCN A;  4O1N A;  5M3M H;  2JA8 H;  1I3Q H;  1PRT D;  1ML0 D;  1HR0 W;  1T9H A;  5EJW A;  1B8A A;  1H9R A;  4JI4 L;  3WDN A;  5G3L D;  4DV4 L;  1A15 A;  3KYH C;  1J9O A;  1QB5 D;  4RGN A;  2R7Z G;  4BY1 H;  3ITP A;  1SBB B;  1TWH H;  1RJT A;  4JI1 Q;  2AWN A;  3TS0 A;  5BR8 Q;  4ZCK A;  1JJC B;  1HZ9 A;  1PDQ A;  3D3R A;  3S2D H;  2AQ2 B;  4A3I H;  5JEA H;  5FK9 C;  3F1Z A;  1I5F A;  1VQE A;  5KYI A;  1FL0 A;  4QF4 A;  2YU9 B;  2M9V A;  4KD3 A;  2B3G A;  2Y0S E;  4BA1 I;  3L2P A;  1PH9 A;  4K5W A;  4KMU C;  1PYB A;  5CV4 A;  1YNJ D;  4LF4 L;  3KJP A;  3MFG A;  4AYB B;  3A56 A;  3HRZ C;  3M9B A;  2ASB A;  1VQG A;  5FLX E;  2DUD A;  3PF4 A;  1PFB A;  5IGB A;  4K5V A;  1FNW A;  1GUO A;  3UDI A;  3MZ5 A;  1B4O A;  1DXM A;  3PO3 B;  1O7L A;  5E3F A;  1HUM A;  3EIV A;  1G8Z D;  1UEA B;  2JP1 A;  2VZA A;  1UE7 A;  2G9D A;  3CCM A;  4DR3 Q;  5COR A;  1KIX A;  1Q1E A;  1SJE D;  4X3K A;  4JI7 Q;  4ZRZ A;  1Q81 C;  2AMC B;  2I5H A;  3S16 B;  3L0O A;  3CC7 A;  1PZJ D;  4GLA C;  4S3S A;  4DK0 A;  2KHS A;  4DAY B;  1BCP D;  4KN4 C;  4KJO A;  3GTM H;  1EIF A;  1GUN A;  1K28 A;  4KY6 A;  3K59 A;  1IBK L;  2MO0 A;  4DAM A;  3H3V I;  4A3L G;  3F8T A;  1RKN A;  4C2M B;  4EQO A;  1YJN A;  2F4V Q;  3BZC A;  1Q8K A;  5JOB A;  3D0F A;  4IQZ A;  1HRJ A;  4QIW E;  5M5W B;  5JJL A;  3EJI A;  4A3G H;  1VDZ A;  2JA8 G;  3W1B A;  3PF5 A;  2XRS D;  1U9R A;  1R9T H;  1F2Y A;  2LY7 A;  2EZV A;  4LF5 L;  5LMU Q;  1LO5 D;  5GQO A;  2VNU D;  1HH2 P;  2Z4I A;  5EKI A;  2F03 A;  3M3Y H;  1SEB D;  3U50 C;  3HEJ A;  4X6A H;  1MIU A;  2N88 A;  5CBA E;  3A5U A;  4GOP A;  3DXJ C;  3HOY B;  1QVF A;  1WCM H;  4DNR B;  1J8I A;  1PXU A;  3TP6 A;  2NVT H;  4BY1 G;  2B2W C;  3N6R A;  4DR2 Q;  5FLM H;  4GKK Q;  2BA0 A;  2KUM A;  1BF4 A;  1XX8 A;  2HIV A;  2PZW A;  4CKC A;  1NMG A;  4OGQ C;  2H1E A;  3KLR A;  4OXP A;  3EFX D;  3TP7 A;  1CA6 A;  1N32 Q;  4C3H B;  3AEV A;  4FXK C;  4H02 A;  3M4Q A;  1LT4 D;  1K0R A;  4HJ8 A;  1CI3 M;  3J80 c;  4JI3 Q;  1TKW B;  2RKS A;  1IHZ A;  1XMO Q;  4QMG A;  3CU7 A;  4MN3 A;  1VQ5 A;  3FKI H;  3J7Z C;  3LWU A;  4NXN Q;  2KHI A;  3D6C A;  5LL6 X;  2IL8 A;  4HR7 B;  1TWG B;  2R3Z A;  3AMU A;  4J1M A;  2MHV A;  3JC6 6;  1CM9 A;  3HKZ E;  4FP5 D;  3S17 H;  4ULL A;  1TS4 A;  2FHT A;  3S24 A;  1SFO B;  1BO0 A;  2HIX A;  1AFP A;  5EGT A;  5K36 H;  4TVA B;  1STY A;  1E1T A;  1WTH A;  2JN4 A;  4MIU A;  3G6J B;  2EYF A;  5JJZ A;  4R8N A;  3MEH A;  1C9O A;  1Z9F A;  2WB1 G;  1KLU D;  4DPG A;  2HDL A;  2H4O A;  3CQZ H;  2JA5 H;  3SHL A;  1N33 Q;  3WOE A;  3NEN A;  1Z7T A;  2Q2H A;  1Q46 A;  4CJ1 B;  1KL9 A;  2PW7 A;  3IL8 A;  3TME A;  1WTQ A;  2I46 A;  2EYJ A;  5DEH A;  1H9S B;  3SK5 A;  3GP7 A;  4PZ7 A;  5EQ0 A;  1E2V A;  1DJR D;  2A68 D;  5IGF A;  1KC8 C;  2ID0 A;  3J80 E;  4A3G G;  2K28 A;  1M4V A;  2F3I A;  1LM0 A;  1TY2 A;  1CSP A;  1Y1V H;  1D1K A;  1EUJ A;  1KHI A;  2BCO A;  4OIK A;  4A3B H;  2B2U C;  5IYC G;  2XRQ D;  1MI2 A;  2JEA I;  1SRU A;  3AQQ A;  1WCM G;  4OON A;  3MVV A;  2E2D C;  3ULJ A;  2L55 A;  4AQY L;  1RF2 D;  1EEI D;  5I6Y A;  4JI6 L;  3EA6 A;  3I4M B;  3RLF A;  3AB9 A;  3QWN A;  2ZJR A;  1UE6 A;  5IWA Q;  4A3E B;  3KDF B;  1HPC A;  3GTO H;  2DGY A;  2BDN A;  2I0Q A;  4JI2 Q;  2UXC Q;  1VS0 A;  3QG1 A;  3TP5 A;  3CMA A;  1J5E L;  3VYR A;  2DJF C;  4IPG A;  2LFN A;  1ASZ A;  1VQB A;  3BVG A;  3MXU A;  3W5O A;  3HOV H;  4MHE A;  2Y0S B;  4LF6 Q;  1VQJ A;  2BDO A;  1OO9 B;  4C3I B;  4F87 A;  1PRT F;  4HED A;  2FMC A;  4KLK A;  2SNM A;  3T1Y L;  2WKC A;  1YIT A;  3G7L A;  3BU2 A;  1D5X C;  4DV6 Q;  5G3L F;  3JAM L;  4B08 A;  2EVB A;  2EY6 A;  3FVQ A;  3KBG A;  5FO9 B;  1STG A;  3S1M H;  4JC0 A;  5EBD A;  4GKJ L;  3F2U A;  1P16 A;  3T53 B;  4BBR B;  4K8J A;  1WTO A;  2XTI A;  5CV8 A;  2OWO A;  2R93 H;  1B2T A;  2ZJQ A;  4DV0 L;  4A4I A;  1VQP A;  1L1O A;  1MSH A;  5ELN A;  4ABN A;  3IRB A;  2JA6 B;  3QIA A;  4PG3 A;  1TU2 B;  2RQX A;  1WI5 A;  4K0K Q;  4J15 A;  1C48 A;  2UXD L;  4IFD I;  1EFI D;  3QJY A;  5C44 B;  1SNQ A;  2QEX A;  3NWS A;  1WTV A;  1B1Z A;  5C4J H;  4ZKB B;  4IUN A;  2DNC A;  3RNU A;  4KD4 A;  3GTG H;  2ICE C;  4OO1 I;  4IUP A;  4HCE A;  5J22 A;  1ESF A;  1WTW A;  4YIJ A;  1K9M C;  1U0L A;  2VQF Q;  3FEW X;  3DM1 A;  1KRT A;  3P75 A;  1K8A C;  3OOC A;  3HFZ B;  1QG7 A;  1D5M C;  2EXZ A;  4BBS H;  4DV7 Q;  4HMJ A;  1TWA B;  4KKT A;  1R4Q B;  5IYB G;  3CAM A;  4FO2 A;  4DV1 Q;  1IYU A;  4DF7 A;  3VDY A;  4N8F A;  4G7Z C;  4R4I A;  4JI2 L;  2UXC L;  2LS0 1;  1LV9 A;  1W2B A;  1BUV T;  3UDG A;  1BCP F;  4XTC S;  4UY8 C;  4A3J G;  4ME3 A;  1AEX A;  1JE5 A;  4DGZ A;  3BYY B;  2QGQ A;  5ELB A;  4KHP L;  3H3V C;  4K8I A;  4HIM A;  1EYG A;  4DNI A;  5FOB B;  2VW9 A;  1VQA A;  2PMZ B;  4DR6 Q;  3H0G H;  4IFD J;  3K58 A;  3HOV G;  1KXL A;  1AH9 A;  1KLG D;  4FF3 A;  1QOH A;  3G4S A;  4JBW A;  3PUV A;  5C4X B;  4Q0F A;  3ER0 A;  1VF5 C;  3PO2 H;  3HOU B;  1WD1 A;  1J6Q A;  1NMF A;  3K8A A;  4P74 A;  1KD1 C;  4EQN A;  1MHW C;  2EYP A;  2ZM6 L;  4IJL A;  1SJH D;  1TY0 A;  2WAQ E;  1KDC A;  2F0F A;  5ELC A;  5IP7 H;  1G91 A;  1C4Q A;  4J6H A;  2R93 G;  4MNO A;  4CKB A;  1CHP D;  1SXT A;  4DN4 M;  2PO4 A;  1PHJ A;  2UUC L;  2JA7 H;  3LWE A;  1XPU A;  2HHH Q;  3ULP A;  3KF6 A;  3QB3 A;  1N34 L;  4O2D A;  1ZKO A;  2MUY A;  4GLV B;  3G6E A;  2EXD A;  1K8M A;  5HY6 A;  3QOL A;  1I6H H;  4L5R C;  4A3K B;  2OTJ A;  2L12 A;  3Q24 A;  1X9N A;  2IT1 A;  2A6H C;  4HTH A;  1VQ9 A;  4G7H C;  2A74 C;  2ZTC A;  4DV1 L;  1X56 A;  1TR5 A;  2D2C C;  2F0P A;  2L11 A;  4BBS G;  3A8K E;  2KHJ A;  1M8A A;  2NZ1 D;  2VL6 A;  4JV5 L;  3GTL H;  1HZB A;  1Y1W B;  1BCP B;  4P2C B;  1RTN A;  4AYB E;  3H3V H;  4IUQ A;  2F0I A;  2OQK A;  2OT2 A;  1HA5 A;  4CKE A;  1JQY D;  3T51 B;  1YHQ A;  2F0U A;  1TS2 A;  5C6A A;  3TSS A;  5I4D A;  2WII B;  2RHQ B;  2WP8 J;  5FJ8 H;  2I5L X;  1WJJ A;  1VQD A;  4OEL B;  1IYJ B;  4DAV A;  4GOP B;  3VYT A;  3GTP H;  1PZK D;  3M7N A;  2E74 C;  2K4K A;  5FKA C;  4JBK A;  3K80 C;  4PQX A;  3BYT B;  3K7A B;  4WFN 3;  4A93 H;  2K32 A;  1VQ6 A;  2ENB A;  1SYB A;  3J81 j;  1LTG D;  1JJ2 A;  2QA4 A;  3SGI A;  3MAQ A;  3PO2 G;  3K81 C;  4JOI C;  4YY3 Q;  5CBE E;  3PQI A;  3OMC A;  1BXT A;  4IPH A;  1ZXT A;  4X3T A;  1F9P A;  4Y7N B;  2B2V C;  1A3T A;  2NTS A;  2B2T A;  4F88 A;  4JVZ A;  2R7F A;  3HOX H;  4HN7 A;  4K5X A;  4HIO A;  1LT5 D;  5IP7 G;  3N52 A;  3U58 A;  1JWU D;  4A3K G;  1LLR D;  3S2H H;  2K03 A;  1D5Z C;  1I94 Q;  2B2W A;  1EY9 A;  2JA7 G;  1KNA A;  2KED A;  4NDX A;  1TXY A;  2RDG A;  4UP9 A;  5E1F A;  4PNY A;  4DK3 C;  1E24 A;  3J7Y W;  1CT1 D;  1HFG A;  3HG9 A;  4DR7 Q;  3S14 H;  1EYC A;  5M3F H;  2XWB B;  4C3J B;  1CQV A;  1H9K A;  3CF5 A;  4CDF C;  1RCV D;  3E9H A;  2EY2 A;  2B2Y A;  3QO2 A;  3A0J A;  4QCL A;  1Y8P B;  1RDP D;  4IAL A;  3V2T A;  2A73 B;  2YYZ A;  3STB C;  4KV6 A;  5IGG A;  5IT9 c;  4V19 0;  5CR3 A;  4FYD A;  4ZLT F;  3K0X A;  1II3 A;  1YNN C;  4MTN A;  2K1B A;  2AQ3 B;  1M90 C;  4A3C H;  2B8F A;  5KRU A;  2UUA L;  2F3V A;  4A3D H;  2Z6B A;  3J81 c;  2E2J B;  2R7Z B;  3CRK C;  2G5D A;  4DFA A;  3PIP A;  5LMN L;  4IUU A;  1IBM Q;  4R1J A;  3R3O A;  5JAV A;  2ES2 A;  4IOC A;  4NXM L;  3E6Z X;  4WRD A;  5C0X I;  3ZYY X;  2X6G A;  5C3E H;  3OWF A;  3TN2 A;  2JXM B;  3WOF A;  2X69 A;  3HP3 A;  1O7Z A;  2EDG A;  5LMN W;  1A2U A;  4RCO A;  4GNX A;  4LWC A;  5T1I A;  1F9Q A;  1AZQ A;  4TQU S;  1PH5 A;  2RCF A;  2UXB L;  1YVC A;  3DWP A;  4HJ5 A;  2K5W A;  4R4C A;  3PIO A;  2VUM H;  2N55 A;  3DWQ A;  2RBM A;  4JK1 C;  3I90 A;  1ILP A;  2K5N A;  3VR4 A;  2RSN A;  5EKK A;  1STN A;  4NB3 A;  2F0O A;  1RIP A;  4YWK A;  3W1G A;  3RN2 A;  3FP9 A;  3BZK A;  3I4N H;  1BDO A;  1KAA A;  3RZO B;  3L3O C;  5FLX c;  1X3Q A;  3S1R B;  4DV5 L;  1H95 A;  4Z9C B;  1EWH A;  4RHR A;  1K8O A;  1VQ8 A;  1GUW A;  4CDE C;  3MFY A;  1LUZ A;  2AQ1 B;  4CGY B;  3JAM i;  1XJV A;  2O4X A;  1OXX K;  1IBL L;  4QGU A;  5E7N A;  1XMQ L;  1L1O B;  1DOM A;  2MPM A;  5C0X J;  4IUT A;  1PH1 A;  2JA8 B;  1A3U A;  3AFQ A;  1I3Q B;  2QDL A;  2TMP A;  4IFD H;  2EYH A;  4DV2 L;  2MJ8 A;  3HOZ G;  2IW3 A;  1I50 H;  2Q2T A;  4G7O C;  4A3C G;  1NNX A;  1XWE A;  4R4O A;  4A3D G;  4EGV A;  2XGT A;  3FPP A;  4BY1 B;  1FYC A;  2K52 A;  2L5T A;  2K05 A;  2RHS B;  3GTK H;  4FXG C;  1EFW A;  3E3X A;  3S2D B;  1STE A;  1ASY A;  4A3I B;  1HNX Q;  3SDZ A;  1SN8 A;  4XXE A;  2I07 B;  4XDX A;  3RZD H;  4RAU C;  5C3E G;  3NK9 A;  2L1B A;  1CKN A;  1EIH A;  1F2L A;  2E76 C;  3ERQ A;  1STB A;  1JB7 A;  1QJO A;  1UE5 A;  3TP8 A;  4JBM A;  3UE1 A;  2M2L A;  5M5Y H;  3FHW A;  4IPC A;  1A2T A;  2Z9H A;  2VXW A;  2VUM G;  1CHQ D;  3M4O H;  1ENC A;  4LJZ C;  4FVM A;  1VQK A;  1PFS A;  1PH8 A;  4YCW A;  4LF9 Q;  1QZH A;  2O2L D;  3GO5 A;  4ZYS A;  3U9S A;  3D8G A;  3FMC A;  3D4D A;  1SNC A;  4QUF A;  1YHA A;  5DM7 3;  2FXQ A;  1YBY A;  3NE5 B;  3P20 A;  4P72 A;  4LMQ D;  4P73 A;  3NBH A;  2WB1 B;  5M3M G;  1U4P A;  1NUC A;  2EYL A;  5EBC A;  3SE0 A;  3BJU A;  3L9A X;  4N9T A;  3GTM B;  4R4Q A;  3QR8 A;  1PVO A;  4JI1 L;  2B8G A;  2O5I C;  3TZD A;  5BR8 L;  2QDB A;  1B9N A;  1LTT D;  4H7B A;  4ODG A;  1EY7 A;  4Y52 H;  3P7J A;  4DR4 Q;  2K5D A;  2RSO A;  2ALY B;  4A3G B;  1HNW Q;  2K5V A;  2Z6K C;  2NN6 I;  3VYS A;  1A63 A;  2QW7 A;  1K73 C;  1R9T B;  3OMG A;  2D0P A;  4IFD G;  5TSS A;  1Q3L A;  3I4L A;  3B6Y A;  3KF6 B;  4EQP A;  5JEA G;  4A3I G;  1ET6 A;  5C5L A;  1S5D D;  3M3Y B;  1S5F D;  2PMZ E;  2WV6 D;  2SNS A;  4C56 C;  3H91 A;  1WCM B;  5EPJ A;  2F0D A;  2NVT B;  3MXP A;  5IP9 H;  2SOB A;  1PTO C;  2Q2I A;  4IN3 A;  3ND9 A;  1Z6H A;  3SK6 A;  2MGS A;  3DUZ A;  1QNK A;  4B3T Q;  2D5D A;  2XWJ B;  2D0O A;  4POF A;  4KY7 A;  4OIJ A;  1TWG H;  2HCC A;  4DR3 L;  2XNA C;  1Q90 A;  1SYE A;  1UUP A;  4NPS A;  4JI7 L;  2F3W A;  1CKM A;  3J80 L;  3URY A;  1NJI C;  3E9I A;  4JI8 Q;  1IXR A;  3LNN A;  1DOK A;  2RDH A;  4LF9 L;  3PV0 A;  1C8C A;  2A6H D;  3FKI B;  2A8V A;  5A2Q L;  2WKD A;  4XT1 B;  2C35 B;  4OWT B;  3EQL C;  1GUG A;  1SMX A;  4K6D A;  3U4V A;  4YWM A;  3PIP 3;  1IKL A;  3K6O A;  2F4V L;  3S17 B;  1LTR D;  4ILW A;  2PI2 A;  4KHV A;  5D3D A;  1HHV A;  2CHB D;  1F77 A;  5C4Z A;  3V96 A;  5AFW A;  4JI0 Q;  5HGT A;  5LMU L;  4P75 A;  1BBX C;  1HQR D;  2VQE Q;  1RTO A;  3CQZ B;  2WAC A;  1PFN A;  2JA5 B;  2K04 A;  1YI2 A;  3P1H A;  4PMB A;  3ICE A;  2AHO B;  1OXU A;  4DR4 L;  1GHK A;  5CV5 A;  1STA A;  3D4R A;  2ZXP A;  4DR2 L;  3K57 A;  3IKJ A;  3PIO 3;  1YIJ A;  4DA2 A;  4GKK L;  5EAY A;  3RUZ A;  1N8R C;  4R4T A;  1EQV A;  1SSO A;  1XNR Q;  2EQS A;  3NSW A;  4GN5 A;  2EJM A;  1G29 1;  5JPN C;  3FDT A;  4LUZ A;  2NTT A;  4OEM B;  4AIM A;  5FLM G;  1MBY A;  4POG A;  1PTO H;  1LTL A;  4BS9 A;  3BG3 A;  1N32 L;  4UDU C;  1CSQ A;  1ZYR C;  1EWI A;  2XVS A;  3DHQ A;  3NEL A;  1VQN A;  1JOR A;  4JI3 L;  4JOI A;  1YZ6 A;  1XMO L;  3VA5 A;  4B3T L;  2A5H A;  2YTV A;  4CDD C;  1EZ8 A;  4NXN L;  1OTC A;  2B2V A;  3HGB A;  2VS1 A;  5IP9 G;  5FO8 B;  3F2C A;  1EYD A;  5IY0 A;  3OYY A;  5NUC A;  3R8B A;  1F2Z A;  1HNZ Q;  3CPW A;  1T5X D;  4FF1 A;  1CQF A;  4A3J B;  2N3S A;  3FKI G;  1MSG A;  3OHX C;  4JI8 L;  4C3I H;  2FMM A;  1TS3 A;  5IGE A;  5JJK A;  3OSO A;  5BN5 A;  4A3M H;  3GTO B;  4WJ4 A;  2KEC A;  3NWT A;  1EIG A;  4GS3 A;  3VA7 A;  3T56 B;  4UAI A;  2DN8 A;  1PH2 A;  1G2T A;  5K36 G;  1GHJ A;  1X3F A;  3G48 A;  4BY7 H;  1CKO A;  2R92 H;  1KRS A;  3Q0A A;  3HOV B;  2K5Q A;  1N33 L;  1V1P A;  1O78 A;  1TWF H;  3S15 H;  5CV7 A;  1EQT A;  3PUZ A;  4CJ2 C;  1BOS A;  4KHZ A;  3K5O A;  1MJC A;  1MJE A;  5D14 A;  3T4A C;  3STB D;  1JT8 A;  4C1N K;  5C0X H;  2PNR C;  2JA5 G;  3RR5 A;  4DR1 Q;  4YHH Q;  1YNN D;  4PZ8 A;  3H15 A;  1Q82 C;  5KEE A;  4GNX B;  1C7Y A;  3CPF A;  3S1M B;  1BBU A;  4UHV A;  5GAH C;  1CUK A;  1VQF A;  2F0W A;  2R93 B;  3KLW A;  1Z47 A;  1B70 B;  3X3M A;  3SK4 A;  4U68 A;  2ZT9 C;  1FVI A;  4IZ8 A;  5FO7 B;  4MTK A;  2F0L A;  2CW0 C;  2HD3 A;  2NBF A;  1D8L A;  2FJ2 A;  1LTS D;  5IE8 A;  4A3F H;  1Y1V G;  1CZW A;  5C4J B;  4X62 Q;  4RHS A;  5I6W A;  5JJI A;  1F9R A;  1VF7 A;  1XPR A;  1MKH A;  1U4R A;  4A3B G;  3BDL A;  1SND A;  3V05 A;  5IWA L;  1K83 H;  1PV4 A;  1U5K A;  3JAM E;  3G71 A;  1QVC A;  1E2Z A;  2F0K A;  3CXC A;  2DNE A;  2V1C C;  3D31 A;  4PV1 C;  4MZ9 A;  3A5Z B;  1N36 Q;  4BBS B;  2KQ3 A;  4ZAI A;  2CVR A;  4DAP A;  1EYA A;  4LF8 Q;  5GAD C;  2NVY H;  4K2L A;  4LF6 L;  1UNS A;  3T13 A;  1PRT B;  3W2D A;  4LFB Q;  4B3S Q;  3AYH B;  1JMC A;  4DV6 L;  1HUN A;  1MGS A;  2E5L Q;  4RGO S;  2ZTE A;  4A3M G;  1Y8N B;  4RA8 A;  4DXF A;  4GOP C;  4OX9 Q;  1SNO A;  1T5E A;  2ZTD A;  4DUZ Q;  4K0K L;  2Z0S A;  4KJN A;  3I8Z A;  4BY7 G;  1JIC A;  3H0G B;  4QUC A;  1I4H A;  1XNQ Q;  4YHH L;  5K5P A;  5I2X A;  1V1O A;  2F0N A;  3GD7 A;  2I5M X;  2RVL A;  4DU9 A;  1SNP A;  2NVX H;  2E8G A;  2HQE A;  3PO2 B;  1GKH A;  2DY8 A;  2PQA A;  4LFC Q;  1NBW A;  4X64 Q;  5M5X H;  3VR3 A;  2VQF L;  1CKN B;  4R9W A;  1D1I A;  2FFK B;  4KK7 A;  1N9W A;  1Q12 A;  1WFQ A;  3IFT A;  4KY5 A;  3K5M A;  4HCS A;  3NQT A;  1B50 A;  5CC4 A;  4OHJ A;  4LW1 A;  2F0T A;  4JBJ A;  3GTQ H;  1Y14 B;  4RGM A;  3RMH A;  4DV7 L;  2JA7 B;  1TVX A;  1S40 A;  3RLN A;  4A3F G;  1E2W A;  3S9W A;  2E2I H;  3AFP A;  1HCZ A;  3TQY A;  3I70 A;  3TRE A;  2JEB I;  1I6H B;  4Q5V A; 
#chains in the Genus database with same CATH homology
 2JA6 H;  3EBE A;  4R4C A;  3PIO A;  2VUM H;  1EOV A;  1QVF A;  1Y1W H;  4JI0 L;  1WCM H;  5C44 H;  2NVT H;  2A1A A;  4BY1 G;  3K7U C;  2MO1 A;  4DR2 Q;  3NBH B;  1YJ9 A;  5FLM H;  2K5N A;  2VQE L;  4GKK Q;  2JQO A;  2BA0 A;  3J81 i;  2UUB Q;  4NB3 A;  4JI5 Q;  2HIV A;  4B3R Q;  4DR6 L;  3RN5 A;  1X55 A;  1HZC A;  2HQL A;  4IOA A;  1RIP A;  1UWV A;  4YWK A;  3W1G A;  1GD7 A;  1NMG A;  3OTO Q;  2ZM6 Q;  3RN2 A;  3FP9 A;  2PI2 E;  3BZK A;  3I4N H;  4OXP A;  3UDX A;  1W3S A;  1Q1B A;  5FLX c;  1N32 Q;  2JJQ A;  1XNR L;  4DV5 L;  1H95 A;  2BA1 A;  3AEV A;  1OXV A;  3KFU A;  2K14 A;  1WYD A;  2AWO A;  3M4Q A;  4H02 A;  4P71 A;  3H0G G;  1K0R A;  4HJ8 A;  3L7Z C;  3J80 c;  1VQ8 A;  4JI3 Q;  2UUC Q;  1E3P A;  1XMO Q;  1D7Q A;  4EX5 A;  2OQ0 A;  2N8N A;  1VQ5 A;  3FKI H;  3J7Z C;  4NXN Q;  2KHI A;  1LUZ A;  4HJ9 A;  3JAM i;  1TWA H;  1XJV A;  1OXX K;  1XNQ L;  1UE1 A;  1IBL L;  1N34 Q;  4QGU A;  5E7N A;  4GLX A;  1XMQ L;  1L1O B;  3JC6 6;  1IZ6 A;  3HKZ E;  5C0X J;  3S17 H;  1PH1 A;  4LF7 Q;  1V43 A;  1X54 A;  3AFQ A;  3PGZ A;  3S24 A;  2HIX A;  4HIK A;  3S1Q H;  3I4M G;  2JA9 A;  2WB1 E;  4TVA B;  4DV2 L;  2HHH L;  1S3O A;  1TWC H;  1NTG A;  1E1T A;  1X3E A;  4LFC L;  3CD6 A;  1B7Y B;  2KBN A;  3GDE A;  3HOZ G;  1Q86 C;  4A3E G;  1I50 H;  3HKZ G;  1HNZ L;  2Q2T A;  2B63 H;  1C9O A;  4R4O A;  3TEH B;  1PH4 A;  4O0A A;  4A3C G;  4A3D G;  1Z9F A;  2Z6K A;  3ZJY C;  2WB1 G;  4DR5 L;  4DPG A;  2XGT A;  3CQZ H;  1L0W A;  2JA5 H;  3HOW H;  2K52 A;  1N33 Q;  2RHS B;  3NEN A;  2Q2H A;  4OWW B;  3GTK H;  1Q46 A;  4JYA Q;  1K8G A;  1EFW A;  2CCZ A;  4OWX B;  1KL9 A;  3CME A;  1P8L A;  4JV5 Q;  1ASY A;  1HNX Q;  2Y0S G;  1SN8 A;  3RZD H;  2IY5 B;  4IPD A;  5AJ3 Q;  4C3J H;  5C3E G;  1JJG A;  5C4X H;  1LYL A;  3M4P A;  4PZ7 A;  3J80 i;  1RL2 A;  3HOU H;  1CKN A;  2BH2 A;  3CCV A;  2JK8 A;  1KC8 C;  2ID0 A;  3MEF A;  1G51 A;  4A3G G;  3CC2 A;  2F3I A;  4OO1 G;  1LM0 A;  1YHB A;  3I2Z A;  1JB7 A;  1Y1V H;  1CSP A;  4QY7 A;  3T1H Q;  1XPO A;  2R92 G;  4DR1 L;  1UE5 A;  1EUJ A;  2R93 G;  4BBR G;  4JBM A;  4AH6 A;  1YEZ A;  3UE1 A;  3PSI A;  1QVG A;  1KHI A;  1HR0 Q;  4IJH A;  5M5Y H;  4ALP A;  5JEA J;  3FHW A;  3ULL A;  4HJ7 A;  4IPC A;  2ATW A;  2JA6 G;  4A3B H;  1VQL A;  2VUM G;  3M4O H;  5IYC G;  2JEA I;  1SLJ A;  1BVS A;  1SRU A;  3AQQ A;  1WCM G;  4OON A;  5C0X G;  4KI0 A;  1VQK A;  1PFS A;  1UEB A;  3ULJ A;  5C44 G;  1PH8 A;  2E2J H;  2R7Z H;  4YCW A;  4AQY L;  2B29 A;  3ERS X;  3I7F A;  1QZH A;  4LF9 Q;  1SRO A;  3GO5 A;  4JI6 L;  3CP0 A;  2OCE A;  3RLF A;  4JI4 Q;  1BBW A;  1S72 A;  4QQB X;  2ZJP A;  1YHA A;  4DV4 Q;  2MQH A;  2ZJR A;  2FXQ A;  2K50 A;  1UE6 A;  1YBY A;  4PMW A;  2AKW B;  5IWA Q;  3I56 A;  4X62 L;  5FJ8 G;  4P72 A;  4A3K H;  3KDF B;  3GTO H;  2DGY A;  2H5X A;  1QZG A;  3NEM A;  4P73 A;  2I0Q A;  1A62 A;  4JI2 Q;  2UXC Q;  1VS0 A;  5M3M G;  5GRO A;  4X65 Q;  3CMA A;  2A19 A;  1J5E L;  3BJU A;  2E2H H;  4YY3 L;  4IPG A;  1ASZ A;  1VQB A;  4LFA Q;  4R4Q A;  2CWP A;  3W5O A;  1PVO A;  1Q7Y C;  3HOV H;  4JI1 L;  4LF7 L;  4A93 G;  4LF6 Q;  1VQJ A;  5BR8 L;  4UPA A;  4KLK A;  3T1Y L;  3PUW A;  3DLL A;  1N36 L;  1YIT A;  3BU2 A;  4Y52 H;  3DM3 A;  1PH3 A;  4DV6 Q;  1K3R A;  1GO3 E;  4DR4 Q;  2GVB A;  2ALY B;  2K75 A;  1PH7 A;  4HID A;  4BA2 I;  1HNW Q;  2K5V A;  2Z6K C;  1I94 L;  2NN6 I;  4LF8 L;  3CCR A;  2WFW A;  3F2B A;  1PA6 A;  3S1M H;  4JC0 A;  1K73 C;  1A63 A;  3HOX G;  2D0P A;  1A0I A;  4LUO A;  1P16 A;  2HT1 A;  4IFD G;  4B3S L;  4GKJ L;  4LFB L;  4A3I G;  2NZH A;  3B6Y A;  3KF6 B;  2XTI A;  5JEA G;  2OWO A;  2R93 H;  2ZJQ A;  3S1N H;  1OXT A;  4YCV A;  4A4I A;  4DV0 L;  1L1O A;  5ELN A;  1VQP A;  4JYA L;  3IRB A;  2PMZ E;  1O7I A;  4PG3 A;  2IX1 A;  4DR7 L;  1WI5 A;  2E5L L;  4K0K Q;  4J15 A;  2UXD L;  4IFD I;  3GTJ H;  2LXK A;  5IP9 H;  5IYD H;  3HOW G;  1G6P A;  2Q2I A;  2QEX A;  4OX9 L;  2MFI A;  3K7A H;  5C4J H;  2LSS A;  2YV5 A;  3CC4 A;  1VQC A;  3RNU A;  3GTG H;  4B3T Q;  4OO1 I;  3KF8 B;  5M3F G;  4DUZ L;  2UUA Q;  2Q2U A;  1VQM A;  2D0O A;  3T1H L;  4GN3 B;  5HGQ A;  4A3L H;  4POF A;  2MNA A;  5C4X G;  1K9M C;  1U0L A;  2VQF Q;  5LMN Q;  3HOU G;  1KRT A;  1TWG H;  4YCU A;  4DR3 L;  2CFM A;  4NPS A;  4JI7 L;  2R6G A;  1CKM A;  1VQI A;  1BKB A;  1YJW A;  4NXM Q;  1XTD A;  1E22 A;  1IBK Q;  4Y7N H;  1K8A C;  2N49 A;  1NJI C;  3E9I A;  4JI8 Q;  1IXR A;  4QL5 A;  3HFZ B;  2KCM A;  4X64 L;  2UU9 Q;  4YWL A;  4LF9 L;  3PV0 A;  4BBS H;  4DV7 Q;  2JE6 I;  2A8V A;  1IBM L;  2NZO A;  4IO9 A;  3Q8D A;  4XIG S;  2C35 B;  4OWT B;  2YU9 H;  5IYB G;  1SMX A;  3U4V A;  3CAM A;  4YWM A;  4L5T A;  4UP7 A;  4DV1 Q;  2NVQ H;  5GAG C;  2GN5 A;  3VDY A;  4LF5 Q;  2UXB Q;  2F4V L;  1PYS B;  3OW2 A;  4DKA C;  1V1Q A;  2PI2 A;  4R4I A;  4JI2 L;  2UXC L;  4BXX H;  1W2B A;  4DV3 Q;  4DUY Q;  4APV A;  4X65 L;  3UDG A;  4XTC S;  4UY8 C;  4A3J G;  4ME3 A;  4JI0 Q;  1JE5 A;  1QUQ B;  1KQS A;  4LFA L;  5LMU L;  2QGQ A;  4P75 A;  4KHP L;  3MXN B;  2VQE Q;  4B3M Q;  4HIM A;  1EYG A;  4DNI A;  1YI2 A;  1C0A A;  3ICE A;  4FDB A;  5DLQ E;  2VW9 A;  1GM5 A;  1VQA A;  2AHO B;  1L2F A;  3PO3 H;  1OXU A;  3H0G H;  4DR6 Q;  4DR4 L;  3KDF A;  4IFD J;  3HOV G;  4DR2 L;  1KXL A;  3KOJ A;  2PNH A;  1AH9 A;  1YIJ A;  3G4S A;  4JBW A;  5EAY A;  4GKK L;  1GVP A;  3PUV A;  1N8R C;  4R4T A;  4HJA A;  2OTL A;  2UUB L;  1XNR Q;  3ER0 A;  4DV5 Q;  1Y1W G;  1L1O C;  3HKS A;  2EQS A;  4JI5 L;  4GN5 A;  2KCT A;  3PO2 H;  3S16 H;  4B3R L;  1J6Q A;  1G29 1;  1NMF A;  1KAW A;  3K8A A;  3E0E A;  4L5Q A;  4LUZ A;  4P74 A;  1SR3 A;  3CCE A;  1KD1 C;  3TS2 A;  2RF4 A;  4AIM A;  5GAE C;  5FLM G;  3CW2 C;  4IJL A;  3OTO L;  2ZM6 L;  4POG A;  1LTL A;  2R7D A;  2WAQ E;  3M85 A;  3U4Z A;  3CCS A;  4EQ5 A;  1CSQ A;  1N32 L;  5IP7 H;  1EWI A;  3CCU A;  2IHE A;  3A74 A;  4MNO A;  1FGU A;  1VQO A;  1EQQ A;  1IBL Q;  1XMQ Q;  3NEL A;  1VQN A;  3HOZ H;  4WJ3 M;  1M1K C;  2IHF A;  4JI3 L;  4JOI A;  3UE0 A;  4C2M H;  1AE2 A;  1YZ6 A;  1PHJ A;  1XMO L;  1EIY B;  5ELO A;  2UUC L;  4B3T L;  2YTV A;  2JA7 H;  3I4N G;  2WAQ G;  4DK6 C;  1VCI A;  1XPU A;  4NXN L;  1OTC A;  5M5W H;  1A8V A;  4DV2 Q;  2HHH Q;  2VS1 A;  5IP9 G;  5IYD G;  3ULP A;  4JG2 A;  3KF6 A;  3F2C A;  1N34 L;  5IY0 A;  3OYY A;  4O2D A;  3CCQ A;  3PUY A;  4L5S A;  1HNZ Q;  4GLV B;  3G6E A;  2GVA A;  3CPW A;  2EXD A;  2NN6 G;  2RCN A;  2CQO A;  5HY6 A;  1I6H H;  2N3S A;  3FKI G;  4L5R C;  4JI8 L;  2IX0 A;  4C3I H;  4JV5 L;  5JJK A;  2OTJ A;  3HOY H;  4WJ4 A;  4A3M H;  2UU9 L;  2YTY A;  1OXS C;  1X9N A;  4GS3 A;  4LF4 Q;  2IT1 A;  3J7A 5;  1VQ9 A;  3LGJ A;  1SE8 A;  1PH2 A;  2ZTC A;  1VQ4 A;  2PQA B;  1X3F A;  3G48 A;  4BY7 H;  4DV1 L;  1PH6 A;  1X56 A;  1CKO A;  2R92 H;  1KRS A;  5J3B A;  4JCV E;  1N33 L;  4BBS G;  3KJO A;  2KHJ A;  1TWF H;  3S15 H;  2CKZ B;  3PUZ A;  4GN4 B;  2VL6 A;  4DV3 L;  2B63 G;  3I55 A;  4DUY L;  1HZB A;  4KHZ A;  3GTL H;  1HNX L;  3EN2 A;  1MJC A;  1VQ7 A;  1HJP A;  2LXJ A;  2YTX A;  3STB D;  4AYB E;  5IYC H;  4X66 Q;  5AJ3 L;  1MJE A;  3H3V H;  1JT8 A;  2JA5 G;  3RZO H;  3RR5 A;  2F52 A;  4DR1 Q;  3S1R H;  1EQR A;  4PZ8 A;  4YHH Q;  4UP8 A;  4C3H H;  3H15 A;  3TRZ A;  1E1O A;  1WOC A;  2OQK A;  1Q82 C;  4GNX B;  1DGS A;  1C7Y A;  1FJG Q;  3CPF A;  1BBU A;  4BXX G;  4B3M L;  2N78 A;  5GAH C;  1YHQ A;  1CUK A;  1VQF A;  4AYB G;  3I4O A;  3KLW A;  1Z47 A;  1B70 B;  2L15 A;  2RHQ B;  2K5H A;  2WP8 J;  5FJ8 H;  4RMF A;  1FVI A;  4AQY Q;  2I5L X;  1WJJ A;  1VQD A;  3F2D A;  4JI6 Q;  1IYJ B;  1X65 A;  4GOP B;  1HR0 L;  2BH8 A;  2KEN A;  3GTP H;  1D8L A;  3M7N A;  4A3F H;  5M3M H;  5IE8 A;  3CCL A;  2EIF A;  2K4K A;  4JBK A;  2JA8 H;  1SFO H;  3K80 C;  1I3Q H;  1Y1V G;  3PO3 G;  3RLO A;  4X62 Q;  1QUQ A;  5JJI A;  4A93 H;  1VQ6 A;  1HR0 W;  1T9H A;  4A76 A;  1XPR A;  1NE3 A;  1B8A A;  1MKH A;  3J81 j;  4JI4 L;  4A3B G;  3UDF A;  1JJ2 A;  1AE3 A;  2QA4 A;  3SGI A;  4DV4 L;  1J5E Q;  3PO2 G;  3KYH C;  3K81 C;  4JOI C;  4YY3 Q;  1K83 H;  5IWA L;  3PCO B;  1PV4 A;  2R7Z G;  1U5K A;  4BY1 H;  3G71 A;  1TWH H;  4IPH A;  2CWA A;  4JI1 Q;  2AWN A;  1QVC A;  3TS0 A;  5BR8 Q;  3CXC A;  4A75 A;  1JJC B;  5H1S E;  3PUX A;  2V1C C;  2R7F A;  1HZ9 A;  3D31 A;  3HOX H;  4HIO A;  3T1Y Q;  3S2D H;  1NY4 A;  3A5Z B;  4MZ9 A;  5IP7 G;  3U58 A;  4A3I H;  1N36 Q;  3GTQ H;  3F1Z A;  1I5F A;  1VQE A;  4A3K G;  1FL0 A;  4RG1 A;  3S2H H;  4LF8 Q;  1I94 Q;  5GAD C;  2NVY H;  4LF6 L;  4LUV A;  2JA7 G;  2B3G A;  2Y0S E;  1X3G A;  1TXY A;  4UP9 A;  4GKJ Q;  4LFB Q;  4BA1 I;  3L2P A;  4B3S Q;  1PH9 A;  3AYH B;  4DK3 C;  4GNX C;  1E24 A;  4DV0 Q;  1PYB A;  4DV6 L;  1JMC A;  4LF4 L;  3KJP A;  3CCJ A;  1HNW L;  4DR7 Q;  3S14 H;  2E5L Q;  1E7Z A;  5M3F H;  3M9B A;  2ASB A;  2UXD Q;  1VQH A;  1VQG A;  1IL2 A;  2ZTE A;  3HOY G;  4QJF A;  2DUD A;  4A3M G;  3CF5 A;  3PF4 A;  4GOP C;  3E9H A;  4OX9 Q;  3UDI A;  1V9P A;  2ZTD A;  3A0J A;  4DUZ Q;  4K0K L;  2Z0S A;  4X66 L;  3I4M H;  3EIV A;  4BY7 G;  2YYZ A;  3STB C;  5IT9 c;  2VZA A;  4YHH L;  1XNQ Q;  1UE7 A;  3K0X A;  3CCM A;  3GD7 A;  2I5M X;  4DR3 Q;  4A3E H;  1KIX A;  1Q1E A;  1FJG L;  4JI7 Q;  2NVX H;  2E8G A;  4MTN A;  4PZ6 A;  1M90 C;  4A3C H;  2UUA L;  1Q81 C;  4A3D H;  5IYB H;  2AMC B;  2I5H A;  3J81 c;  1X6O A;  1GKH A;  2PQA A;  3L0O A;  4GLA C;  3CC7 A;  4LFC Q;  1NBW A;  4X64 Q;  5M5X H;  4DAY B;  3PIP A;  2VQF L;  1CKN B;  5LMN L;  2D62 A;  1IBM Q;  4R1J A;  3GTM H;  1EIF A;  4LNQ A;  2VY3 A;  2ES2 A;  4IOC A;  4NXM L;  1HZA A;  1N9W A;  1Q12 A;  1WFQ A;  4DR5 Q;  1IBK L;  2MO0 A;  4DAM A;  4A3J H;  3H3V I;  5K36 G;  5C0X I;  4A3L G;  5C3E H;  3F8T A;  1YJN A;  4LW1 A;  2F4V Q;  4JBJ A;  5LMN W;  1Y14 B;  1Q8K A;  3BZC A;  4DV7 L;  1YNX A;  3WWV A;  3D0F A;  4LWC A;  4GNX A;  1S40 A;  3RLN A;  4QIW E;  4TQU S;  5JJL A;  4A3G H;  4A3F G;  2E2I H;  2JA8 G;  3W1B A;  3PF5 A;  3AFP A;  1PH5 A;  3TQY A;  1R9T H;  3JAM c;  4LF5 L;  2UXB L;  1YVC A;  3TRE A;  5LMU Q;  5GQO A;  4KHP Q;  2JEB I;  1HH2 P;  4BBR H;  2VNU D;  4HJ5 A;  3M3Y H;  3U50 C;  4X6A H;  1MIU A;  4GOP A;  3A5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...