4IPDA

Structure of the n-terminal domain of rpa70, e100r mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipdA00
5M5YH 1PH3A 2NZOA 3STBD 4DR3Q 2Q2UA 1IL2A 3U4VA 3HOWH 1L1OC 3S24A 3CP0A 4P75A 3CCJA 3RLFA 2Q2TA 2OWOA 5IWAQ 4X65L 1DGSA 4IPHA 4DR5L 4LF8Q 2K14A 3U58A 3K80C 4R4IA 1LM0A 4GKJQ 4L5RC 4JBMA 4UY8C 4GOPA 4DR7L 1EFWA 2MO0A 4A3FG 5GQOA 3ER0A 1E22A 3F1ZA 5AJ3Q 4PZ6A 2OTJA 1U0LA 1CKNA 5IP7H 5M5WH 3ZJYC 1LYLA 1KC8C 4FDBA 3CCQA 1XMQL 1SFOH 4OXPA 3HOXH 4LF7Q 2R7ZH 2PNHA 4JOIA 3T1YL 4IPCA 4GNXC 3FHWA 4LF4L 5IP9G 4DR2L 4C3JH 4H02A 3UDGA 5DLQE 2UU9L 4A3LH 4C3HH 2HHHQ 1GD7A 4NPSA 3I4NH 1YZ6A 1I94Q 4L5SA 1NMGA 4A3GG 1KHIA 3CCUA 1PH7A 4B3RQ 4R1JA 1Y14B 4LUVA 2VQEL 2JA6G 4B3ML 4K0KQ 2EIFA 4UP9A 4JG2A 1BVSA 3S1NH 2RF4A 5JEAG 1JJCB 3A5UA 1JB7A 1ASZA 3G48A 4IJLA 3K81C 5K36G 4YHHL 3HOYG 1Z47A 2E5LQ 4UP7A 5HGQA 2XTIA 3CCEA 4GKKQ 1M90C 1IZ6A 2A1AA 1VQFA 3EIVA 4X62Q 4EX5A 3A5ZB 5BR8L 1QZHA 4JV5Q 1XMOL 4R4TA 1PVOA 3I4OA 5EAYA 1VQMA 1UE1A 1X56A 3S1MH 2R93G 4GLVB 2RCNA 4P72A 5IYCH 4KHPQ 5M3FH 4GLAC 4B3SQ 3RZOH 4DV4Q 4DV5Q 2IT1A 4A3EH 4B3TL 1PH9A 2JEBI 3T1HL 3GTKH 1T9HA 3TS0A 3NEMA 3HOZH 4A3DH 4BA1I 1EOVA 2Y0SE 1VQCA 5C44G 4LF9L 1HNWQ 1VQ6A 4XIGS 1E7ZA 2WFWA 2VS1A 3KJOA 4GLXA 2NVQH 5JJKA 4HJ8A 1A62A 3CF5A 3BZKA 2MO1A 3HOXG 2JJQA 5C0XJ 3D31A 3KF6B 1VQPA 4YY3Q 3CCSA 1UE6A 1X6OA 2ID0A 3HKSA 4AYBG 1PH6A 1IBKL 1OTCA 3UE1A 3S17H 3PIOA 2UXCL 1N36L 1VQJA 1X3FA 4BY7G 1VQAA 1NBWA 3ERSX 4A76A 1TWAH 1WCMG 1QVFA 1SN8A 4JBWA 1X55A 1BBUA 2HT1A 2A19A 5IT9c 3NENA 5C0XI 4AQYL 3GO5A 1PH4A 5FLXc 3S1RH 4YWKA 2C35B 2VUMH 4DAYB 3NELA 2VQFL 1Q46A 3HOVG 3H15A 4X64L 2YTYA 3PUZA 3CW2C 1C9OA 4NXMQ 1HNXL 1H95A 4AYBE 4LFAL 3W5OA 2JA7G 3EBEA 4C2MH 1G6PA 4DR4Q 1IXRA 1JE5A 1XPRA 1K73C 3DM3A 1VQ5A 4IPGA 2WB1G 3VDYA 4YCUA 4XTCS 2JE6I 1JT8A 1N34Q 4JI2Q 1NJIC 3K7AH 3U4ZA 4POGA 3I4MG 1J6QA 1Y1WH 1P16A 4JI4L 4DR3L 4Y52H 4AH6A 1Y1VH 3M4OH 2QA4A 2FXQA 4DV1Q 2Z0SA 4A75A 4LF8L 2Z6KA 5M3MG 4HIOA 1K83H 1Q7YC 1OXTA 1TWGH 4JI0L 1OXVA 1AH9A 1WYDA 2WAQG 1V1QA 4P74A 1XNRQ 4GOPC 3H0GG 1X9NA 4DUYQ 4ALPA 2UXDQ 3CPFA 3CMAA 3PCOB 3J7ZC 1LUZA 3RLNA 1I50H 2PI2A 2PQAB 2B29A 4R4OA 2RHSB 2I5MX 3J81i 3PF5A 1L1OB 4WJ3M 1UWVA 1SE8A 1FJGQ 1XPOA 1WI5A 3IRBA 3NBHB 4OONA 1E1OA 4PG3A 4X66Q 3CMEA 4DKAC 3RN2A 2JA8H 1IBLQ 1Q8KA 1KXLA 2B63H 2VZAA 2WAQE 3M7NA 2JA5G 1SMXA 3CCMA 3S1QH 1P8LA 3OTOQ 3JC66 5FLMH 4O2DA 4HJAA 3W1BA 5FJ8H 2ZJRA 2R92G 1JJ2A 3KDFA 4DV0L 2XGTA 2VL6A 4KLKA 4BBRH 3JAMi 2PMZE 2N78A 2ZM6Q 3ULPA 1EQRA 3M3YH 1XNQL 3PO2H 1JMCA 1N33Q 3HFZB 4GNXB 4A3MH 3E9IA 5JJLA 2AWOA 1QVGA 4JI7Q 2CCZA 1FGUA 2KBNA 3G4SA 4JYAQ 2A8VA 5IYBH 3FP9A 1TXYA 2CQOA 2QGQA 3UE0A 4BBSH 4DPGA 2QEXA 4OX9L 4GS3A 3I56A 1S3OA 3PUWA 1HR0Q 4B3SL 4BY1H 1K8AC 1W3SA 2NVXH 4JI1L 1TWFH 1G291 1GVPA 1L0WA 3M85A 3GTOH 3ULLA 2UUAQ 3S16H 4LF6Q 2UXBL 4OWTB 2LXKA 3HOUH 3CQZH 3S14H 2AKWB 4DV3L 2CKZB 3U50C 2VW9A 2IY5B 3HKZG 2I5HA 1CSPA 4YWLA 3GTLH 4YCWA 5LMUQ 4A3CH 5C4XH 5IYDH 1CUKA 1I6HH 5E7NA 5LMNL 2NVYH 4LWCA 1PH2A 4DV6Q 1PV4A 4A3KH 1Q82C 4A3JH 1QUQA 3CCLA 4HIMA 3RR5A 2Y0SG 4A93H 3AQQA 1Q81C 3K8AA 1YHQA 1B70B 1VQHA 2CFMA 4R4QA 1HZAA 5FLMG 4JI3Q 4OO1G 1CSQA 4QQBX 5M5XH 1Z9FA 1IBMQ 4A3BH 3HOWG 3KOJA 1KL9A 3B6YA 3BZCA 3HKZE 1NY4A 3H3VI 3L7ZC 4LW1A 3W1GA 4BXXH 2HIVA 2JA9A 3J80c 1PH5A 2UUBQ 4IFDG 1CKMA 1KQSA 4DV2Q 1V9PA 2ZTEA 4DR1Q 4JI5Q 1VQDA 2AWNA 3A0JA 4MNOA 4P71A 3K7UC 4AIMA 2GN5A 3D0FA 2UUCL 1XTDA 5IP7G 1YJWA 3RN5A 5C4JH 4LFCQ 2I5LX 1YHAA 1YITA 4RMFA 2R7ZG 3LGJA 1PFSA 3M4PA 2F4VQ 3PO3H 4DNIA 2Q2HA 2K52A 4LFBL 4A3IH 2HQLA 1GM5A 1B8AA 2D0PA 3GTGH 1N9WA 3CC2A 4NXNL 3TRZA 3F2BA 1HNZL 4A3LG 3I4NG 2OCEA 4YCVA 3AFQA 5JEAJ 3TEHB 5C3EH 2PI2E 1RL2A 1K9MC 3K0XA 3CC4A 1OXXK 3AYHB 2B3GA 2Z6KC 1I5FA 1XNRL 1VQBA 4C3IH 5H1SE 1K8GA 2JEAI 2V1CC 2UXDL 4LF4Q 2NN6G 1VQ8A 3GDEA 4DR2Q 4NB3A 2IHFA 2UU9Q 1SLJA 4TVAB 4DV7L 2E2HH 3L2PA 1FJGL 2LSSA 1HZCA 1YJNA 3UDFA 1E1TA 2VQEQ 1X3GA 4JCVE 1IBLL 4HJ9A 1XJVA 1PH8A 3J7A5 3F2CA 1B7YB 4DK6C 1SROA 2JK8A 5IYCG 2F52A 4GN4B 1PYSB 1BBWA 1VQIA 5M3FG 4DUZL 3M4QA 5GADC 4UPAA 4A3EG 2YV5A 4GOPB 1HZBA 4L5TA 1N8RC 3HOZG 1EYGA 2NVTH 1J5EQ 2WP8J 1PHJA 4A3DG 5BR8Q 1AE2A 5IWAL 1EQQA 1XMOQ 2GVAA 3EN2A 3L0OA 5GAGC 4JBKA 4KI0A 1O7IA 1CKNB 4QJFA 1YI2A 4GKJL 2KCTA 1XPUA 1PA6A 2MQHA 3H3VH 2L15A 1D7QA 4A3IG 3FKIH 5AJ3L 4PZ7A 1X65A 1D8LA 1KRTA 1YEZA 3SGIA 4B3TQ 4GN5A 3T1HQ 1PH1A 4LF7L 3STBC 4DR6Q 4L5QA 4TQUS 1SR3A 2R7FA 4LF6L 5GAHC 1QZGA 2HHHL 2ASBA 1NTGA 2H5XA 2BA1A 2LXJA 1I94L 2VUMG 4A3FH 1E3PA 1S72A 4JI8Q 1W2BA 1IBKQ 2EXDA 4B3RL 4LF5Q 2D62A 3KFUA 4K0KL 2RHQB 2IX0A 3PUYA 3BU2A 4IJHA 2K5VA 1HH2P 3KF6A 3MEFA 4PZ8A 3TQYA 5IP9H 2E5LL 1FL0A 1YNXA 2KHJA 3PIPA 4AQYQ 2YTVA 4GKKL 2K50A 3CCRA 1AE3A 4X62L 4HJ7A 4JI3L 2BH8A 2VQFQ 4JV5L 2DGYA 1Q1EA 3E0EA 3E9HA 3PUVA 1Y1WG 1KD1C 3ULJA 2Q2IA 1IBML 3UDIA 4P73A 1Y1VG 2JA6H 3F8TA 5JJIA 4A4IA 3A74A 1HNXQ 4IO9A 2E2IH 3CD6A 3CPWA 4KHPL 2I0QA 1IYJB 3HOYH 2OQKA 4DV2L 1V43A 4DV4L 4DV5L 3PF4A 3GTQH 4MTNA 2YYZA 1HNWL 1WOCA 1HR0W 4JI4Q 2IHEA 2ZJPA 3I7FA 1R9TH 3PGZA 2N8NA 4LFCL 2IX1A 1VQGA 3AFPA 2F4VL 5J3BA 3M9BA 1FVIA 2E8GA 2JQOA 4YY3L 1ASYA 2R93H 4WJ4A 3S2HH 1C0AA 4EQ5A 1A0IA 4Y7NH 1VQEA 4DK3C 1VQOA 1K3RA 4QGUA 1YIJA 2HIXA 4JI0Q 4OWWB 2N49A 5GROA 2R7DA 3I55A 5C44H 2JA8G 2B63G 1E24A 1UE7A 4YWMA 2K5HA 1SRUA 4JI6Q 5FJ8G 2KENA 1NE3A 4IOCA 1C7YA 1MJCA 3BJUA 4BBRG 4NXML 3KYHC 5C0XG 4HIKA 5IY0A 1N32Q 3PO2G 2K4KA 2YTXA 4BY7H 1OXSC 4A3MG 1EUJA 1WCMH 4DR4L 2PQAA 2D0OA 1YHBA 1L1OA 5ELNA 4LNQA 2AMCB 5IYBG 1OXUA 1N34L 1WFQA 4JI2L 4BBSG 2ZTDA 4O0AA 3RZDH 4BY1G 3UDXA 4DV0Q 3HOVH 1KIXA 2KCMA 1CKOA 1TWHH 1GO3E 2GVBA 2ALYB 1J5EL 1MJEA 1XNQQ 4OWXB 3CXCA 4X65Q 4PMWA 4DV1L 4DR5Q 1K0RA 2JA7H 4IPDA 1KRSA 1YJ9A 2E2JH 2YU9H 3HOUG 4DAMA 1HZ9A 3PUXA 4DR7Q 1Q12A 3OW2A 3J80i 4HJ5A 4X6AH 3CCVA 2BH2A 2MFIA 4GNXA 3CAMA 4OX9Q 1QVCA 4JBJA 3I4MH 5IYDG 4A3CG 5C4XG 1L2FA 4QIWE 1WJJA 1I3QH 4J15A 5IE8A 4DUYL 3Q8DA 4JI1Q 1XMQQ 4DR6L 3DLLA 3T1YQ 2ATWA 4A3KG 4A3JG 1TWCH 3PV0A 2CWPA 1EIYB 2UXBQ 5M3MH 4A93G 2BA0A 4KHZA 4DV3Q 1KAWA 4R4CA 1VQLA 1PYBA 2OQ0A 4JI8L 4X66L 1Q1BA 4QL5A 3KDFB 4LUOA 1GKHA 4B3MQ 4LF5L 1VQNA 4A3BG 3ICEA 4IFDJ 4APVA 3H0GH 3G6EA 1JJGA 2K5NA 5LMNQ 4BXXG 3OTOL 4OO1I 1X3EA 4IOAA 1VQ7A 1YBYA 4YHHQ 1MIUA 1VQKA 2ZM6L 3GTPH 3RLOA 5LMNW 3AEVA 3GTMH 1N33L 1G51A 1M1KC 4IFDI 4JI7L 4JYAL 1BKBA 2ES2A 2JA5H 1NMFA 1YVCA 3TREA 1S40A 4QY7A 3TS2A 3PO3G 2ZJQA 2N3SA 4HIDA 1VS0A 2R92H 1HR0L 4ME3A 5ELOA 1VQ4A 3I2ZA 4GN3B 5C3EG 1RIPA 1U5KA 4LF9Q 4MZ9A 2UUCQ 2UUAL 4RG1A 1A63A 1HJPA 3J81c 3KJPA 4POFA 4LFBQ 1QUQB 5LMUL 3GD7A 3KF8B 4NXNQ 2UXCQ 2KHIA 3OYYA 1N36Q 2R6GA 1HNZQ 1UE5A 2NN6I 5GAEC 4DV6L 4A3GH 2WB1E 3PSIA 2AHOB 4LUZA 1A8VA 2VNUD 3WWVA 1UEBA 2EQSA 3JAMc 4JI6L 2VY3A 2CWAA 1EWIA 2F3IA 5HY6A 2DUDA 3F2DA 3G71A 2K75A 2OTLA 4X64Q 4DV7Q 4JC0A 1X54A 3J81j 1N32L 1EIFA 1VCIA 3KLWA 2MNAA 4LFAQ 4JOIC 2NZHA 3MXNB 3S2DH 2UUBL 3GTJH 2ZTCA 3RNUA 1Q86C 4BA2I 3CC7A 1VQ9A 4UP8A 3S15H 4DR1L 4JI5L 1LTLA 3FKIG 4DUZQ 1MKHA
chains in the Genus database with same CATH superfamily
1CA5A 3STBD 2Q2UA 2WINB 3HOWH 1LTAD 2OWOA 3SHLA 3TZUA 1Z7TA 3IL8A 4LF8Q 4IFDH 1PRTD 4JBMA 4UY8C 4GOPA 1A3UA 1EFWA 3C3LA 5GQOA 5EKIA 1PTOD 5AJ3Q 4NMZA 2MHVA 2OTJA 1DOMA 5M5WH 3ZJYC 2PYKA 4FDBA 4LF7Q 4OXPA 4RA8A 2R7ZH 1EU3A 2PNHA 1B3AA 3T1YL 5IP9G 5IGEA 4H02A 5JVH3 3UDGA 1JWMD 1I4XA 1I50B 4K2LA 3AMUA 3SE0A 3CCUA 1E0BA 3D3RA 3NQIA 3S1NH 1QB5D 3HOYG 2E5LQ 4UP7A 5HGQA 2XTIA 1M90C 2B2YA 4KY5A 1VQFA 4X62Q 4DF7A 3A5ZB 1EYDA 5BR8L 1ILPA 1XMOL 3SK5A 5E4XA 1EZ6A 5I2YA 2H4OA 1S5ED 4L6TB 2HQEA 5IYCH 3SK6A 4B3SQ 2XNAC 2E2IB 3RZOH 2IT1A 1PH9A 3T1HL 4A3DH 3TS0A 4ZAIA 5C44G 1TT2A 1Y8NB 4XIGS 3KJOA 2ZXOA 4DXFA 4HJ8A 1O7LA 2JJQA 3D31A 1UE6A 1X6OA 3CRLC 4EQPA 1X3FA 1CQVA 2R93B 1VQAA 3BVMA 5C0XI 1IHZA 4AQYL 2VQFL 1Q46A 4YIJA 3H15A 4KTAA 4NXMQ 3PUZA 5JPNC 2F0VA 3CW2C 2JA7G 1D5XC 1G6PA 3Q22A 1TS3A 1FNVA 1XPRA 5CV9A 4BY7B 4K8JA 3LWUA 2JE6I 1JT8A 1V1PA 3K7AH 4ZQ3A 1Y1WH 4JI4L 1LTTD 1QJOA 4AH6A 4HSPA 2FXQA 2FMCA 4DV1Q 2Z0SA 3KLSA 3R3OA 2Q8RE 3IAYA 1K83H 4ZK9B 1Q7YC 4JI0L 3QO2A 1WYDA 3EFXD 2AQ2B 3TBIB 1TIID 1V1QA 4GOPC 2L12A 3H0GG 2Z4HA 2UXDQ 2EYPA 3CMAA 3I4MB 3J7ZC 1I50H 2PI2A 3J81i 5EPJA 1L1OB 4MIUA 1FJGQ 3IRBA 3NBHB 4IUTA 2JA8H 4DKAC 4RH6A 3RN2A 2A69D 2B63H 4H7BA 1STNA 1HFGA 3CCMA 3OTOQ 5FLMH 3W1BA 2ZJRA 2R92G 3KDFA 2B2VA 2N78A 1EQRA 1A3TA 1BF4A 1XNQL 3HFZB 4XDXA 4GNXB 1U4RA 5JJLA 2AWOA 3A56A 1QVGA 1FGUA 2B2YC 1TXYA 2MPMA 1IL8A 2PQEA 4BBSH 1SYBA 1HTLD 1HR0Q 4JI1L 1TWFH 2B2UC 1G291 2FJ2A 3ULLA 1EY9A 2A6HD 2LXKA 2AKWB 2F0QA 2B2TA 2I5HA 3C2PA 2RDFA 1IW7D 1I6HH 2BE5D 3VYRA 1HRJA 4RKLA 4DV6Q 4C56C 4HIMA 5A2QE 2Y0SG 3KF8A 4NW2A 5CV5A 1Q81C 1SSOA 1B70B 1KNAA 4OO1G 4QQBX 4A3BH 2MJ8A 3A7AB 3BZCA 3MHBA 3L7ZC 3W1GA 2HIVA 2UUBQ 1T5EA 1KQSA 2ZTEA 2Z4IA 1DYQA 2AWNA 3K7UC 3D4RA 4KJOA 3D6WA 1YJWA 4IQZA 3RN5A 5C4JH 2I5LX 4HCSA 4I7AA 1ENCA 1BBXC 3NTIA 1PFSA 3M4PA 2F4VQ 4LFBL 2F0LA 1GM5A 4C3JG 3CC2A 4A3LG 5C3EH 5JEAJ 3S2HB 3K0XA 3U9OA 3AYHB 2B3GA 3DEOA 4RFBA 1XNRL 3J7AV 1VQBA 4C3IH 5IIFA 5C44B 2I46A 2NN6G 4PMCA 4DR2Q 1JWSD 3MA2B 3H91A 2E2HH 3L2PA 2LSSA 4ZCKA 4K8IA 2VQEQ 4N8FA 1IBLL 3I4NB 2KCCA 4R8NA 4V190 1L0YB 4DK6C 2SOBA 4GN4B 1PYSB 5M3FG 1VQIA 2L1BA 2PO4A 3TN2A 3M4QA 1N8RC 4A3EG 1HZBA 4L5TA 5IWAL 2GVAA 3L0OA 4ILWA 2C5CA 1CKNB 4QJFA 2B2VC 3I72A 1XPUA 3F2UA 1WVLA 2L15A 4WFN3 2KHSA 4A3IG 3P1HA 2F03A 1SYGA 3SGIA 4GN5A 1HFNA 4L5QA 1SR3A 2R7FA 1S5CD 1SE3A 2DJFC 1QZGA 1ESRA 2HHHL 1E3PA 1S72A 4PQXA 4JI8Q 1IBKQ 2EXDA 3E0JA 5BN5A 5DNFA 1ML0D 3TQYA 5IP9H 1YNXA 1BCPC 4GKKL 3CCRA 1AE3A 4G7ZC 3T53B 2BH8A 1F77A 2DGYA 3E0EA 1KD1C 4XQQA 1WTPA 1NUCA 1IBML 1Y1VG 3S9WA 4A4IA 2ICEC 3A74A 1HNXQ 4IO9A 1A3VA 3A8IE 1EWHA 2CQAA 4DAYA 3RD4A 2I0QA 3HOYH 1WTHA 4DV2L 1V43A 2K5WA 1BDOA 2R92B 2YYZA 1BR9A 2F3WA 2IHEA 1R9TH 3CU7A 2N8NA 4LFCL 1PDQA 3ND8A 2IX1A 4K5VA 3AFPA 5K5PA 1GUTA 5J3BA 3M9BA 1F2MA 4YY3L 4WJ4A 1CHPD 2SDFA 1GOZA 3S2HH 4CJ2C 3R2TA 4Y7NH 3E6ZX 1RJTA 5GROA 3J7YW 5C44H 1E24A 2O5JC 4QF4A 1TKWB 1MJCA 3D4WA 1TS2A 3BJUA 5C0XG 1H9MA 1ET9A 2EYJA 3PO2G 1OXSC 4KD3A 1EUJA 3MWYW 2TMPA 2HUGA 1CK1A 4CBVA 5CV7A 2ZTDA 3UDXA 3DEPA 1KIXA 2KCMA 2GVBA 1J5EL 3MVVA 3LWEA 4DK1A 4OWXB 3CXCA 2JA7H 1K0RA 4IPDA 1KRSA 1YJ9A 2E2JH 3M3YB 4U68A 4DR7Q 4A3MB 4X6AH 3CCVA 2MFIA 2E76C 4JBJA 2L4NA 1W6KA 1CTMA 1G91A 1I3QH 4G57A 1SMYD 4E6IA 2ATWA 4A3JG 3J80E 1EIYB 2UXBQ 1PFMA 2EYHA 2EYOA 3WOFA 2JYOA 1ZXTA 4Z9CB 3CQZB 4WJWA 4B3MQ 4LF5L 4IFDJ 1VQNA 3ICEA 1HUNA 3H0GH 2K5NA 1OO9B 1X3EA 5C4XB 1GUGA 4DFAA 3NWTA 1VQKA 5I9OA 2NVYB 3RLOA 5LMNW 4A3KB 3I4LA 1U4MA 1D5MC 2L55A 1BKBA 1EYCA 3TREA 3PO3G 1PRTB 3DWPA 5KNCA 2R92H 2JSOA 4TRDA 2QKIC 5ELOA 1D1IA 1PTOB 3I2ZA 1IYVA 4MZ9A 2UUAL 3T16A 3SK4A 1STYA 1TY0A 1YNND 2FFKB 3J7AF 1JC7A 4GZYC 2ENBA 3OYYA 5JVG3 1IKLA 5COYA 4A3IB 4CDFC 3PIO3 1PFBA 1A8VA 1PLFA 3WWVA 4DAPA 1EY8A 1HQRD 1UEBA 4KKSA 1D1KA 2MGSA 1EWIA 3URYA 1CT1D 2DUDA 3R93A 3F2DA 1WD0A 3S1RB 4X64Q 4DV7Q 3J81j 1LT4D 3C46A 3OHXC 3MXNB 2C9OA 3M4YA 3S2DH 1X3QA 4RGNA 3GTJH 1ET6A 1KDAA 1TR5A 1I4PA 1JOOA 4UP8A 3K6OA 5I9PA 2G9HD 1LTLA 1KNEA 2IWHA 1MKHA 4OO1H 3SK8A 2NZOA 3CCJA 3RLFA 4X65L 1DGSA 4DR5L 1Y1VB 3U58A 3K80C 1LM0A 4GKJQ 3S15B 5C3XA 2MO0A 1E22A 4XXEA 1A2UA 1ZEQX 5EPLA 1SFOH 3CCQA 1SJED 3NK9A 3HOXH 2PPBC 4IPCA 3FHWA 4J8QA 4C3JH 4ABNA 1L0XB 5DLQE 5L37A 4A3LH 4KKUA 1CZGA 2A73B 2KQ3A 4R1JA 1F2LA 4UP9A 4JG2A 3H09A 1STHA 1JB7A 3G48A 1FNUA 4IZ8A 1TS5A 2NN6H 4YHHL 2F4IA 4K14A 5DM73 3CCEA 1IZ6A 2A1AA 1F9SA 1ICFB 4R8IA 5CYUA 1SYDA 1QZHA 5D14A 4R4TA 5IT9L 2Z6BA 5FLXL 2L9HA 4KD4A 3PO2B 5EAYA 1VQMA 3K0YA 4A3GB 2JA6B 2R93G 2PW5A 3EROA 4KHPQ 5M3FH 4GLAC 4A3EH 4B3TL 3GTKH 4OIJA 3K5OA 4LMQD 4BA1I 1EOVA 2KVMA 3A8KE 1E7ZA 2WFWA 3BZKA 1HPCA 3DWAA 3KF6B 1F2ZA 3CCSA 2ID0A 1OTCA 1LT6D 3TSSA 3UE1A 3S17H 1WTQA 4QCLA 2UXCL 1N36L 1VQJA 2QW7A 4CJ1B 4BY7G 1TWAH 3MFGA 1BBUA 2R61A 2A19A 1HTPA 3NENA 1PH4A 3S1RH 4YWKA 2IL8A 2F0TA 2B8GA 4N9PA 2SNSA 2PCFB 1C9OA 3TP5A 3M7GA 4LFAL 4AYBB 4WRDA 5M5XB 3EBEA 1I4QA 4C2MH 1IXRA 2B39A 5C4ZA 4JI2Q 1NJIC 3U4ZA 3I4MG 1J6QA 2NTSA 4Y52H 1Y1VH 5CBEE 4LF8L 2KECA 1PRTF 2DNCA 2DY8A 2Z6KA 4HIOA 3Q6SA 3H94A 1I4GA 2YU9B 1PTOF 2F0UA 1DZ1A 4FF2A 1DOLA 2NWGA 2A6EC 3GQBA 3OWEB 4DUYQ 4RCOA 1X3PA 4ALPA 1LUZA 2PQAB 4R4OA 1O7YA 2B29A 5EKKA 2AUJD 2E75C 1TVXA 2EVBA 2JP1A 1SE8A 1UNSA 1XPOA 1ONLA 1SAPA 4G7OC 1SNOA 5FO9B 4PG3A 4X66Q 5M3MB 3ONAB 2VZAA 1GHJA 1SMXA 3S1QH 1JJ2A 4DV0L 3PQIA 2XGTA 1FR3A 2ZM6Q 1CA6A 2PMZE 3ULPA 4IUQA 3ERQA 5J1ZA 5C0XH 1SNDA 3PO2H 4FXKC 3VR2A 3GTPB 4JI7Q 2CCZA 2KBNA 4JYAQ 1B1ZA 1GUWA 2QEJC 3I73A 3JAME 2QGQA 2QEXA 4GS3A 3PUWA 4B3SL 1W3SA 3FPPA 3ITPA 1L0WA 3GTOH 1SBBB 4CKCA 4LF6Q 2K04A 4F88A 5FK9C 3S14H 2CKZB 2VW9A 1CSPA 2J7ZA 4YCWA 5LMUQ 1PZID 1AEXA 2CHBD 1CUKA 4EQNA 4FP5D 1Q82C 4A3JH 3CCLA 4TSSA 4KY7A 3K8AA 2LKVA 1LT3D 4JI3Q 1HZAA 3MTSA 1CSQA 5M5XH 1Z9FA 3KOJA 1KL9A 3H3VI 3AB9A 1LT5D 2B2UA 5NUCA 4FF4A 1TU2B 2QILA 3J80c 4JVZA 1CKMA 1MBYA 2PZUA 3DM1A 4DR1Q 4JI5Q 4AIMA 3P75A 1S5FD 4P71A 1YHAA 1YITA 3T56B 4DXGA 3BS1A 3PO3H 5M5YB 2Q2HA 2HQLA 1N9WA 3TRZA 3I4NG 2HDLA 2PI2E 3NHHA 2Z6KC 1CFMA 5EGTA 1RTOA 2UXDL 2P5ZX 3P7JA 5KRUA 4NB3A 1KDCA 5E4WC 4K6DA 4TVAB 3SDZA 1FJGL 1HZCA 1XTCD 4UHVA 4CDCC 1X3GA 3E5SA 4JCVE 1Y8PB 4C3HB 1BQQT 4EVOA 1H9RA 2G5DA 2LS01 5BN4A 4UPAA 2YV5A 4GOPB 5D3IB 2WP8J 4ZUIA 5BR8Q 1AE2A 1EQQA 1XMOQ 4FF1A 3A54A 5DAUA 5I6YA 1I4RA 1IKMA 4QUCA 4K6LA 4MHEA 5D3DA 1G2TA 3IFDA 3S1MB 3T1HQ 1PH1A 4DR6Q 3NWSA 3SXHA 1JB3A 3HOZB 1NTGA 2LXJA 1I94L 2NVQB 4B3RL 4XT3B 3Q0AA 3KFUA 4K0KL 1JOKA 2RHQB 2K5VA 3MEFA 5A2QL 4PZ8A 1FL0A 2KHJA 4AQYQ 2YTVA 2K50A 4ZKBB 1WTRA 2PMZB 4HJ7A 2VQFQ 4JV5L 1Q1EA 4HCEA 3UDIA 4P73A 5JJIA 2K05A 1JWUD 4Q0FA 2E2IH 2CH4A 5I6WA 3K57A 1DM0B 2F0IA 3CPWA 1IYJB 3QOJA 2OQKA 4ZKCB 4DK0A 4DV4L 3P20A 4DV5L 1AP0A 1GHKA 1HNWL 4JI4Q 2A6ED 1EQTA 3G7LA 1AZQA 4BS9A 2F4VL 2R93H 1HUMA 3M4OB 1A0IA 3L3OC 2Z8LA 4DK3C 3Q23A 1YIJA 1MSHA 4JI0Q 5IGCA 2KEEA 2A74C 2VB2X 1LTRD 4YWMA 2K5HA 1SYFA 2BCOA 4IOCA 2QDLA 1I6VC 4KN7C 4HIKA 5IY0A 1N32Q 2K4KA 2YTXA 1V1PB 4BY7H 4OHJA 4A3MG 4DR4L 3GV3A 2EZVA 4O1NA 1N34L 4X3UA 1E2VA 1UEAB 4X3TA 4DNRB 1G2SA 2LMCB 2KEDA 4RKBA 1XNQQ 4PMWA 4BBRB 1B4OA 3OIPA 2A68C 4PNYA 1LTGD 4HJ5A 3E3XA 2L11A 3I4MH 4A3CG 5IYDG 5C4XG 1JE4A 2RSOA 1WJJA 3MXUA 2LFNA 4OEMB 1XMQQ 4JI1Q 4BY1B 4FXGC 4A3KG 2J0TD 3PV0A 2CWPA 1J8IA 1SNCA 4ID6A 2NVXB 1KAWA 4R4CA 3HZXA 1VQLA 3NBIA 4C1NI 3S16B 2XRSD 2BDOA 4DGZA 1GUNA 2OQ0A 4JI8L 1Q1BA 3HOUB 3KDFB 4LUOA 1GKHA 4BXXG 3BDOA 4IOAA 1VQ7A 1YBYA 1MI2A 3R8BA 4CHTB 3L9AX 1J9OA 3TP6A 1LACA 1N33L 4A93B 3DXJC 5CGKA 4H0LC 1II3A 2F0FA 2ES2A 4QY7A 1BUVT 2HD3A 1CQFA 1RDPD 1K28A 1VQ4A 1Y8OB 3BYTB 4GN3B 1RIPA 2WKDA 4LF9Q 3Q24A 1EQVA 1SNQA 4RG1A 1BCPB 2XSCA 2G9DA 4POFA 4LFBQ 3BDLA 3KF8B 1SEBD 3NP8A 2KHIA 2E74C 5EKLA 1UE5A 2WB1E 3GTGB 5CMDA 2AHOB 1RTNA 4OGQC 3X3NA 3JAMc 2VY3A 5HY6A 2F3IA 1PYWD 1EZ8A 3BG3A 4DU9A 2K75A 2OTLA 4JC0A 1X54A 3KLWA 2FINB 3EVQA 4JOIC 1ENFA 3BVGA 4BA2I 3VA5A 2RQXA 4DR3Q 1IL2A 3U4VA 3CP0A 2K01A 2D2CC 5J22A 5IWAQ 1DJRD 4IPHA 1PZJD 5CV6A 2K14A 1F9QA 4R4IA 3QJYA 5C4HA 2NVTB 4OIKA 4DR7L 2SEBD 5CBAE 5LHY1 3ER0A 3F1ZA 4J6HA 2AQ3B 4IUPA 3K5LA 5IGGA 1VF7A 5IGFA 1LYLA 1KC8C 4H13C 1SDFA 3FKIB 3J80L 4K5XA 4LF4L 2J4XA 3NQTA 3SEBA 5C6AA 2UU9L 4IUUA 2V4DA 2HHHQ 1GD7A 3I4NH 3D6CA 3HP3A 4L5SA 4A3GG 2EY2A 1PH7A 1O78A 3OWFA 4HMIA 1Y14B 3C1FA 4LUVA 2ICIA 3VR3A 4B3ML 2JA6G 2EIFA 1BVSA 4A3FB 2RF4A 1ICWA 3A5UA 1ASZA 4IJLA 2AUKA 1E2WA 1Z47A 4HTHA 4GKKQ 1B53A 4C1NK 3OIQA 3N6RA 4B9XA 2EJMA 2JN4A 3I4OA 2K28A 4XYOA 3TDQA 1UE1A 2MUYA 3BVZA 2RCNA 4P72A 4FYDA 1DD2A 1S4ZA 1HQMC 2KUMA 1T9HA 3NEMA 1FNWA 2F0PA 3QIAA 1BNZA 4XYQA 1VQCA 1VQ6A 1GUOA 2VS1A 4GLXA 5JJKA 3GTQB 3CF5A 2MO1A 3RMHA 5C0XJ 1GJXA 2DNEA 3T51B 1VQPA 4KN4C 5JOBA 4YY3Q 4AYBG 3PIOA 1NBWA 3ERSX 4F7XA 4JBWA 1X55A 2HT1A 1ZYRC 4EQOA 3GO5A 2C35B 5DM63 4DAYB 3NELA 3EQLC 1Q90A 2QDBA 3HOVG 1F9RA 4X3SA 4ZRZA 2YTYA 4X64L 4F8MA 1QNKA 2B8FA 4AYBE 2A68D 2NZ1D 4S3SA 1JR0D 1JE5A 1VQ5A 3DM3A 4IPGA 4YCUA 2F0WA 1WCMB 1LTBD 4POGA 3HS0C 1P16A 1QILA 1D2BA 2F1MA 2NUCA 2QA4A 3RZDB 1B2TA 4L63B 4A75A 4FNFA 1TWHB 1M8AA 5M3MG 4RHRA 1OXTA 1OXVA 4UDUC 1A15A 2PW7A 1SE4A 2XRQD 1R4PB 2MP1A 2WB1B 4HMJA 4P74A 1X9NA 3CPFA 3PCOB 3RLNA 3VR6A 2I5MX 3V05A 3PF5A 1NCVA 2VXWA 4WJ3M 1UWVA 4N8X1 1WI5A 1TWCB 1EEID 2OXPA 2AQ1B 4OONA 1K3BC 3A7LA 1Q8KA 5ELCA 1O7ZA 3W2DA 3HGBA 2WAQB 3J81E 1P8LA 3JC66 4O2DA 1SNMA 4HJAA 4KK7A 5KNDA 1S5BD 3M3YH 1HCZA 2QCPX 3QG1A 1JMCA 1U4PA 4A3MH 2WIIB 3G4SA 3GTMB 3QOLA 3FP9A 1ILQA 3UE0A 1MD2D 4OX9L 3I56A 4IUNA 4QB4A 1K8AC 5HGTA 2K33A 1V8QA 1BCPD 1GVPA 2UUAQ 4RHSA 3SVMA 3CQZH 1G6ZA 4DV3L 2Z9HA 3AU7A 3BYYB 3ND9A 3U50C 2IY5B 3HKZG 4YWLA 1JCKB 4A3CH 5C4XH 5IYDH 5LMNL 2NVYH 2RDGA 1FD7D 4A3KH 1QUQA 2F0DA 3RR5A 4KMUC 3AQQA 1LV9A 3MXPA 1VQHA 3KK7A 5FLMG 3PIP3 3VYSA 3WOEA 3HKZE 2OF1A 1XWEA 4LW1A 2EXZA 1PTOH 4M1UB 4BXXH 1H9JA 3I3CA 1PH5A 1BXTA 5ELBA 5A35A 1V9PA 3A8JE 1KTKA 1VQDA 4MNOA 5AFWA 1STGA 1Z6HA 2GN5A 2UUCL 2XVSA 5IP7G 3O13A 3LGJA 4DNIA 2K52A 3V96A 4A3IH 3HOWB 5DEHA 1B8AA 2FHTA 2D0PA 4NXNL 4C3HG 3F2BA 1HNZL 2OCEA 3G6JB 5LL6X 3AFQA 4DN4M 3IFTA 1K9MC 3CC4A 1RF2D 2X6LA 1ESFA 5H1SE 1K8GA 2JXMB 2JEAI 5JAVA 3VYUA 3GDEA 4O42A 5M5WB 3T13A 2HDMA 2HCCA 2IHFA 4IN3A 1HA6A 1SLJA 2R7ZB 4LAAA 5E3FA 1YJNA 5KYIA 2IJ0A 1E1TA 3EJIA 4HJ9A 2D5DA 1V1OA 3KBXA 3NTHA 5G3LD 3TZDA 1BO0A 2JK8A 2F52A 4DUZL 1BBWA 3S1NB 5ELDA 5GADC 3HOZG 1EYGA 2E2DC 3S15H 3EN2A 5GAGC 4MTKA 3HOVB 4KI0A 1YI2A 5IT9E 2PZTA 2GA4B 5FLXE 1PA6A 2MQHA 3H3VH 5AJ3L 2EJGC 1TY2A 1X65A 4J1MA 1D8LA 1KRTA 4B3TQ 4LF7L 1ZYRD 1LO5D 3RZOB 1NR2A 1LTID 4LF6L 4A3DB 3MXGA 5ELFA 3GP7A 2ASBA 2K03A 2VUMG 2BA1A 1YNJC 1HHVA 2IX0A 2QF7A 3BU2A 4IJHA 5KNBA 1HH2P 4PV1C 3OMCA 3I70A 5IGDA 2E5LL 2B2WA 4X62L 3KBGA 4JI3L 4A3GH 3E9HA 2JA6H 3ULJA 4M8AA 4R9WA 4PMBA 3FVQA 1IW7C 1F9PA 1KLGD 4MTNA 3DMUA 1WOCA 1HR0W 2ZJPA 3OPOA 3PGZA 1SXTA 3NUCA 3K7AB 3TP7A 1HA5A 4OL7A 1Y1WB 1FVIA 2E8GA 2JQOA 1ASYA 5I2XA 2F0MA 1C0AA 4EQ5A 1VQEA 4OELB 4QGUA 4OWWB 2HIXA 1NAPA 3I55A 1K83B 1UE7A 1EIHA 2EDGA 3FRPB 1EEFD 1AN8A 4JI6Q 5FJ8G 1NE3A 1Q8IA 4RAUC 3TMEA 4BBRG 2SNMA 4NXML 3KYHC 5CV4A 2IPKD 3HKZB 1IYUA 2BDNA 1RODA 4EGVA 5FO8B 1L1OA 5ELNA 4CJ0B 2AMCB 5IYBG 2RDHA 1BOSA 3CHBD 1OXUA 2JA8B 1WFQA 3NBHA 2B63B 4BY1G 2EYLA 4DV0Q 3HOVH 5CR3A 2ALYB 1NSNS 1MJEA 5TSSA 4DV1L 2YU9H 3HOUG 1Q12A 5IODA 5KGUA 3J80i 3OW2A 2NTTA 3QR8A 4GNXA 1QVCA 2X6GA 4QIWB 3QWNA 4J15A 5IE8A 3CRKC 3Q8DA 4DR6L 4BBSB 2EE1A 1TS4A 5ISRA 2F0GA 3T1YQ 4HAEA 1KABA 1LLRD 5M3MH 4A93G 1TWFB 5C5LA 2WKCA 1C48A 4QL5A 3OSOA 4APVA 1T5XD 1JJGA 1MSGA 1VF5C 3K5NA 3OTOL 1C8CA 1MIUA 1I6HB 5M9OA 3GTPH 5E1FA 2N88A 3AEVA 4IFDI 1G51A 2NB0A 2B2WC 1K0SA 1DONA 1NMFA 1XYIA 3OMGA 1GXDC 4A3BB 1VS0A 2K5DA 3FPUB 3PMFA 2M2LA 1HR0L 1AW7A 3CKIB 5FOBB 4CDDC 1VDZA 4IUVA 1A63A 1HJPA 4HR7B 3J81c 3KJPA 5C4JB 1K8OA 3I90A 3GD7A 3WDNA 3KLRA 2XWJB 4KY6A 3K59A 1X32A 5GAEC 4DV6L 3PSIA 2EY1A 4UAIA 4B9WA 2VNUD 2K32A 5C3EB 2EQSA 2M9VA 4C3IB 3ZYYX 1VMPA 2VUMB 1N32L 1VCIA 2NZHA 1PZKD 1H9SA 2UUBL 3GV6A 1Q86C 3RNUA 2E2HB 2XWBB 3CC7A 1AZPA 3FKIG 1DCZA 5M5YH 1PH3A 1G8ZD 4DAVA 1WTOA 1L1OC 3S24A 1LTSD 4P75A 2Q2TA 1A2TA 1B9MA 1YNJD 4L5RC 2NYZD 2F0EA 3U9SA 4QUFA 4A3FG 4PZ6A 1U0LA 1TWGB 1CKNA 4IURA 5IP7H 3MC0B 1XMQL 5FO7B 4JOIA 4GNXC 4RGOS 1PFNA 4DR2L 3VA7A 4NDXA 1B44D 3EA6A 4C3HH 4NPSA 1YZ6A 3HEJA 4KKTA 1NMGA 1I94Q 3OW7A 1KHIA 3DUZA 4B3RQ 4JK1C 2VQEL 4ZYSA 4K0KQ 1JOQA 4WORA 4CDEC 1QG7A 5JEAG 1JJCB 5BN3A 3K81C 5K36G 1SMYC 3KUPA 3EIVA 3K58A 5FKAC 4EX5A 5CC4A 4JV5Q 1PVOA 3SR1A 1XX8A 3D8GA 4KV6A 5I4DA 1X56A 3S1MH 2LY7A 4GLVB 1SYEA 4DV4Q 4DV5Q 3HOZH 2JEBI 2Y0SE 3HOYB 4LF9L 1HNWQ 2NVQH 2EOTA 3DHQA 2F0JA 1A62A 1C4QA 3HOXG 3R2IA 4ME5A 1R9TB 3NTKA 1PH6A 3HKSA 1IBKL 3MFYA 1E2ZA 2PNRC 3GTLB 4A76A 2F0OA 1WCMG 1QVFA 1SN8A 4Y7NB 5IT9c 5FLXc 3H6MA 1LABA 1MGSA 2VUMH 5KEEA 2EY5A 1H9SB 1JQYD 1H95A 1YNNC 4MN3A 1HNXL 1F2YA 1B50A 3W5OA 1JICA 4DR4Q 1K73C 2WB1G 2IX3A 5EQ0A 3VDYA 1B9NA 4XTCS 1N34Q 1CZWA 5IOCA 4I65A 1RCVD 4ZLTF 4IALA 4DR3L 2KOLA 3A55A 4RCNA 3M4OH 1KLUD 1Y69U 1ZKOA 3FMCA 3VR4A 1O80A 3V2TA 1TWGH 2JA7B 1AH9A 2O5IC 2WAQG 2E2JB 1XNRQ 1WTVA 1EFID 4ULLA 5HURA 2N55A 1W6JA 2RHSB 1I3QB 3UI2A 4K2KA 1E1OA 3MAQA 1KXLA 3CMEA 1IBLQ 1B3QA 1KDBA 2WAQE 4DA2A 3M7NA 2EPBA 2JA5G 1STAA 2L5TA 2B2TC 1STBA 5FJ8H 4N9TA 3NSWA 1PXUA 3H0GB 4X3KA 2VL6A 4KLKA 4NKLA 1NR4A 2RKSA 5C5MA 3VYTA 4BBRH 3JAMi 2BOSA 2EJFC 2O2LD 4KJNA 1N33Q 2EY6A 4LJZC 1QWYA 3E9IA 3LX0A 1A6XA 1TQOA 2A8VA 5IYBH 1R4QB 2CQOA 4DPGA 4ZUJA 2K5QA 1S3OA 4BY1H 3HRZC 1EU4A 1QNUA 3I8ZA 2NVXH 5CORA 3M85A 1Q3LA 4U673 3S16H 2UXBL 4OWTB 3HOUH 1QCBD 3FEWX 4RWSC 3GTLH 4KHVA 3LNNA 5E7NA 4LWCA 1PH2A 1PV4A 5LL6S 1EIGA 1KAAA 4A93H 1RD9D 1YHQA 4R4QA 1D6EC 2CFMA 1S5DD 1ENAA 2RCFA 3KLSX 1IBMQ 2XIWA 3X3MA 3HOWG 3B6YA 2X69A 1NY4A 4Q5VA 2ZXRA 1AFPA 2JA9A 4IFDG 4DV2Q 3S2DB 3A0JA 3GTJB 3MXNA 3D0FA 2Y0SB 4P2CB 1XTDA 5J39A 4LFCQ 1EY0A 4RMFA 5F2DA 2RA4A 2R7ZG 4FXDA 4HN7A 3GTGH 4HEDA 4FF3A 2WV6D 5KIXA 3I91A 4XQJA 4YCVA 3K5MA 1D5ZC 3TEHB 1RL2A 1OXXK 4L8JA 1RKNA 1I5FA 2WACA 2L0CA 1RHPA 2F0HA 2V1CC 1EY4A 4LF4Q 2XN9C 1VQ8A 1SFOB 3N52A 2UU9Q 3HOXB 4DV7L 3UDFA 4C3JB 1PMRA 2CW0C 1XJVA 1PH8A 3J81L 1CI3M 3J7A5 3F2CA 1B7YB 3IKJA 1SROA 5IYCG 1SE2A 2F0NA 5D65A 4A3DG 2NVTH 1J5EQ 1PHJA 1WTWA 4JBKA 1O7IA 4GKJL 3VR5A 2KCTA 5EPKA 4V0BA 1D7QA 3FKIH 5EJWA 4PZ7A 3C1EA 4FO2A 2PZWA 1YEZA 3STBC 1BCPF 4TQUS 5M3FB 1QE6A 1NNXA 4XT1B 4A3EB 3GTKB 1GUSA 5GAHC 2D9UA 2ZXPA 2H5XA 1PRTC 4A3FH 4BWGB 1W2BA 4LF5Q 2D62A 1PTOC 3PUYA 2R3ZA 1EY5A 3NE5B 2RSNA 3KF6A 1EYAA 3S17B 4JW0A 3PIPA 1WTXA 5CV8A 1TWAB 1QOHA 1UAPA 1Y1WG 3PUVA 1EL0A 2Q2IA 5T1GA 4CKEA 3F8TA 2A5HA 5JEAH 3CD6A 5JJZA 4KHPL 4TKOB 5K36H 1K8MA 2JA5B 3PF4A 5EBCA 2O4XA 4C2MB 3GTQH 4DNTB 3TP8A 2KCNA 3I7FA 1VQGA 1SJHD 4XQNA 4K5WA 1VQOA 2NBFA 1K3RA 1SYCA 2N49A 2R7DA 2JA8G 4QMGA 2K1BA 2B63G 3NPPA 1CM9A 2DY7A 1SRUA 2CVRA 2KENA 4ODGA 1C7YA 2HCIA 5C3WA 1EY6A 2H1EA 4RGMA 2EYMA 1WCMH 2PQAA 2D0OA 3H3VC 4CKBA 2K7VA 1YHBA 4LNQA 5G3LF 1JORA 3T4AC 4JI2L 4BBSG 4O0AA 3RZDH 3OOCA 2F3VA 3S1QB 4HSVA 1CKOA 1TWHH 1GO3E 4X65Q 4DR5Q 2F0KA 4DAMA 1HZ9A 3PUXA 2TSSA 4G4KA 1H9KA 2BH2A 2DN8A 3CAMA 4OX9Q 1L2FA 4QIWE 5ELEA 4DUYL 4CGYB 1WD1A 1XXGA 3DLLA 1TWCH 2KJXA 3BDCA 4B08A 4JPBW 2BA0A 2F0SA 4KHZA 4DV3Q 3GTOB 1U9RA 2I07B 1PYBA 4X66L 1I4HA 2DJGC 4A3BG 3S14B 2Q8TA 1HXYD 2Z1CA 3G6EA 5LMNQ 3MEHA 3QB3A 4OO1I 4YHHQ 2M00A 1CHQD 2ZM6L 2IW3A 4A3JB 1DOKA 3GTMH 4H44C 1FGBD 1M1KC 2CH4W 2KA7A 4JI7L 2OEOA 4I7ZC 4JYAL 1DXMA 3JAML 2JA5H 3TS2A 1YVCA 1S40A 2A69C 2ZJQA 2N3SA 4HIDA 4ME3A 4F87A 4G7HC 5C3EG 3FDTA 1U5KA 2UUCQ 5T1IA 2VB3X 4C3IG 2ZT9C 1EOTA 3RUZA 1EWCA 1QUQB 5LMUL 4LK1C 2RVLA 3NXWA 4NXNQ 2UXCQ 4NP5A 1N36Q 1HNZQ 2R6GA 3PO3B 2CW0D 1EY7A 2NN6I 5JPMC 1M4VA 3MZ5A 4LUZA 1SNPA 1MHWC 4RGTA 2FMMA 5EBDA 3D4DA 3BZDB 4JI6L 2A6HC 3W3AA 2OT2A 2CWAA 1VMCA 3G71A 4FVMA 1U4LA 1EIFA 2MNAA 4LFAQ 2K6AA 1STEA 3DWQA 2BE5C 5IGBA 2ZTCA 5KYLA 3HG9A 2RBMA 1FYCA 2Q8IB 1VQ9A 2EYFA 4DR1L 4JI5L 1UUPA 4DUZQ
chains in the Genus database with same CATH topology
5M5YH 1PH3A 2NZOA 3STBD 4DR3Q 2Q2UA 1IL2A 3U4VA 3HOWH 1L1OC 3S24A 3CP0A 4P75A 3CCJA 3RLFA 2Q2TA 2OWOA 5IWAQ 4X65L 1DGSA 4IPHA 4DR5L 4LF8Q 2K14A 3U58A 3K80C 4R4IA 1LM0A 4GKJQ 4L5RC 4JBMA 4UY8C 4GOPA 4DR7L 1EFWA 2MO0A 4A3FG 5GQOA 3ER0A 1E22A 3F1ZA 5AJ3Q 4PZ6A 2OTJA 1U0LA 1CKNA 5IP7H 5M5WH 3ZJYC 1LYLA 1KC8C 4FDBA 3CCQA 1XMQL 1SFOH 4OXPA 3HOXH 4LF7Q 2R7ZH 2PNHA 4JOIA 3T1YL 4IPCA 4GNXC 3FHWA 4LF4L 5IP9G 4DR2L 4C3JH 4H02A 3UDGA 5DLQE 2UU9L 4A3LH 4C3HH 2HHHQ 1GD7A 4NPSA 3I4NH 1YZ6A 1I94Q 4L5SA 1NMGA 4A3GG 1KHIA 3CCUA 1PH7A 4B3RQ 4R1JA 1Y14B 4LUVA 2VQEL 2JA6G 4B3ML 4K0KQ 2EIFA 4UP9A 4JG2A 1BVSA 3S1NH 2RF4A 5JEAG 1JJCB 3A5UA 1JB7A 1ASZA 3G48A 4IJLA 3K81C 5K36G 4YHHL 3HOYG 1Z47A 2E5LQ 4UP7A 5HGQA 2XTIA 3CCEA 4GKKQ 1M90C 1IZ6A 2A1AA 1VQFA 3EIVA 4X62Q 4EX5A 3A5ZB 5BR8L 1QZHA 4JV5Q 1XMOL 4R4TA 1PVOA 3I4OA 5EAYA 1VQMA 1UE1A 1X56A 3S1MH 2R93G 4GLVB 2RCNA 4P72A 5IYCH 4KHPQ 5M3FH 4GLAC 4B3SQ 3RZOH 4DV4Q 4DV5Q 2IT1A 4A3EH 4B3TL 1PH9A 2JEBI 3T1HL 3GTKH 1T9HA 3TS0A 3NEMA 3HOZH 4A3DH 4BA1I 1EOVA 2Y0SE 1VQCA 5C44G 4LF9L 1HNWQ 1VQ6A 4XIGS 1E7ZA 2WFWA 2VS1A 3KJOA 4GLXA 2NVQH 5JJKA 4HJ8A 1A62A 3CF5A 3BZKA 2MO1A 3HOXG 2JJQA 5C0XJ 3D31A 3KF6B 1VQPA 4YY3Q 3CCSA 1UE6A 1X6OA 2ID0A 3HKSA 4AYBG 1PH6A 1IBKL 1OTCA 3UE1A 3S17H 3PIOA 2UXCL 1N36L 1VQJA 1X3FA 4BY7G 1VQAA 1NBWA 3ERSX 4A76A 1TWAH 1WCMG 1QVFA 1SN8A 4JBWA 1X55A 1BBUA 2HT1A 2A19A 5IT9c 3NENA 5C0XI 4AQYL 3GO5A 1PH4A 5FLXc 3S1RH 4YWKA 2C35B 2VUMH 4DAYB 3NELA 2VQFL 1Q46A 3HOVG 3H15A 4X64L 2YTYA 3PUZA 3CW2C 1C9OA 4NXMQ 1HNXL 1H95A 4AYBE 4LFAL 3W5OA 2JA7G 3EBEA 4C2MH 1G6PA 4DR4Q 1IXRA 1JE5A 1XPRA 1K73C 3DM3A 1VQ5A 4IPGA 2WB1G 3VDYA 4YCUA 4XTCS 2JE6I 1JT8A 1N34Q 4JI2Q 1NJIC 3K7AH 3U4ZA 4POGA 3I4MG 1J6QA 1Y1WH 1P16A 4JI4L 4DR3L 4Y52H 4AH6A 1Y1VH 3M4OH 2QA4A 2FXQA 4DV1Q 2Z0SA 4A75A 4LF8L 2Z6KA 5M3MG 4HIOA 1K83H 1Q7YC 1OXTA 1TWGH 4JI0L 1OXVA 1AH9A 1WYDA 2WAQG 1V1QA 4P74A 1XNRQ 4GOPC 3H0GG 1X9NA 4DUYQ 4ALPA 2UXDQ 3CPFA 3CMAA 3PCOB 3J7ZC 1LUZA 3RLNA 1I50H 2PI2A 2PQAB 2B29A 4R4OA 2RHSB 2I5MX 3J81i 3PF5A 1L1OB 4WJ3M 1UWVA 1SE8A 1FJGQ 1XPOA 1WI5A 3IRBA 3NBHB 4OONA 1E1OA 4PG3A 4X66Q 3CMEA 4DKAC 3RN2A 2JA8H 1IBLQ 1Q8KA 1KXLA 2B63H 2VZAA 2WAQE 3M7NA 2JA5G 1SMXA 3CCMA 3S1QH 1P8LA 3OTOQ 3JC66 5FLMH 4O2DA 4HJAA 3W1BA 5FJ8H 2ZJRA 2R92G 1JJ2A 3KDFA 4DV0L 2XGTA 2VL6A 4KLKA 4BBRH 3JAMi 2PMZE 2N78A 2ZM6Q 3ULPA 1EQRA 3M3YH 1XNQL 3PO2H 1JMCA 1N33Q 3HFZB 4GNXB 4A3MH 3E9IA 5JJLA 2AWOA 1QVGA 4JI7Q 2CCZA 1FGUA 2KBNA 3G4SA 4JYAQ 2A8VA 5IYBH 3FP9A 1TXYA 2CQOA 2QGQA 3UE0A 4BBSH 4DPGA 2QEXA 4OX9L 4GS3A 3I56A 1S3OA 3PUWA 1HR0Q 4B3SL 4BY1H 1K8AC 1W3SA 2NVXH 4JI1L 1TWFH 1G291 1GVPA 1L0WA 3M85A 3GTOH 3ULLA 2UUAQ 3S16H 4LF6Q 2UXBL 4OWTB 2LXKA 3HOUH 3CQZH 3S14H 2AKWB 4DV3L 2CKZB 3U50C 2VW9A 2IY5B 3HKZG 2I5HA 1CSPA 4YWLA 3GTLH 4YCWA 5LMUQ 4A3CH 5C4XH 5IYDH 1CUKA 1I6HH 5E7NA 5LMNL 2NVYH 4LWCA 1PH2A 4DV6Q 1PV4A 4A3KH 1Q82C 4A3JH 1QUQA 3CCLA 4HIMA 3RR5A 2Y0SG 4A93H 3AQQA 1Q81C 3K8AA 1YHQA 1B70B 1VQHA 2CFMA 4R4QA 1HZAA 5FLMG 4JI3Q 4OO1G 1CSQA 4QQBX 5M5XH 1Z9FA 1IBMQ 4A3BH 3HOWG 3KOJA 1KL9A 3B6YA 3BZCA 3HKZE 1NY4A 3H3VI 3L7ZC 4LW1A 3W1GA 4BXXH 2HIVA 2JA9A 3J80c 1PH5A 2UUBQ 4IFDG 1CKMA 1KQSA 4DV2Q 1V9PA 2ZTEA 4DR1Q 4JI5Q 1VQDA 2AWNA 3A0JA 4MNOA 4P71A 3K7UC 4AIMA 2GN5A 3D0FA 2UUCL 1XTDA 5IP7G 1YJWA 3RN5A 5C4JH 4LFCQ 2I5LX 1YHAA 1YITA 4RMFA 2R7ZG 3LGJA 1PFSA 3M4PA 2F4VQ 3PO3H 4DNIA 2Q2HA 2K52A 4LFBL 4A3IH 2HQLA 1GM5A 1B8AA 2D0PA 3GTGH 1N9WA 3CC2A 4NXNL 3TRZA 3F2BA 1HNZL 4A3LG 3I4NG 2OCEA 4YCVA 3AFQA 5JEAJ 3TEHB 5C3EH 2PI2E 1RL2A 1K9MC 3K0XA 3CC4A 1OXXK 3AYHB 2B3GA 2Z6KC 1I5FA 1XNRL 1VQBA 4C3IH 5H1SE 1K8GA 2JEAI 2V1CC 2UXDL 4LF4Q 2NN6G 1VQ8A 3GDEA 4DR2Q 4NB3A 2IHFA 2UU9Q 1SLJA 4TVAB 4DV7L 2E2HH 3L2PA 1FJGL 2LSSA 1HZCA 1YJNA 3UDFA 1E1TA 2VQEQ 1X3GA 4JCVE 1IBLL 4HJ9A 1XJVA 1PH8A 3J7A5 3F2CA 1B7YB 4DK6C 1SROA 2JK8A 5IYCG 2F52A 4GN4B 1PYSB 1BBWA 1VQIA 5M3FG 4DUZL 3M4QA 5GADC 4UPAA 4A3EG 2YV5A 4GOPB 1HZBA 4L5TA 1N8RC 3HOZG 1EYGA 2NVTH 1J5EQ 2WP8J 1PHJA 4A3DG 5BR8Q 1AE2A 5IWAL 1EQQA 1XMOQ 2GVAA 3EN2A 3L0OA 5GAGC 4JBKA 4KI0A 1O7IA 1CKNB 4QJFA 1YI2A 4GKJL 2KCTA 1XPUA 1PA6A 2MQHA 3H3VH 2L15A 1D7QA 4A3IG 3FKIH 5AJ3L 4PZ7A 1X65A 1D8LA 1KRTA 1YEZA 3SGIA 4B3TQ 4GN5A 3T1HQ 1PH1A 4LF7L 3STBC 4DR6Q 4L5QA 4TQUS 1SR3A 2R7FA 4LF6L 5GAHC 1QZGA 2HHHL 2ASBA 1NTGA 2H5XA 2BA1A 2LXJA 1I94L 2VUMG 4A3FH 1E3PA 1S72A 4JI8Q 1W2BA 1IBKQ 2EXDA 4B3RL 4LF5Q 2D62A 3KFUA 4K0KL 2RHQB 2IX0A 3PUYA 3BU2A 4IJHA 2K5VA 1HH2P 3KF6A 3MEFA 4PZ8A 3TQYA 5IP9H 2E5LL 1FL0A 1YNXA 2KHJA 3PIPA 4AQYQ 2YTVA 4GKKL 2K50A 3CCRA 1AE3A 4X62L 4HJ7A 4JI3L 2BH8A 2VQFQ 4JV5L 2DGYA 1Q1EA 3E0EA 3E9HA 3PUVA 1Y1WG 1KD1C 3ULJA 2Q2IA 1IBML 3UDIA 4P73A 1Y1VG 2JA6H 3F8TA 5JJIA 4A4IA 3A74A 1HNXQ 4IO9A 2E2IH 3CD6A 3CPWA 4KHPL 2I0QA 1IYJB 3HOYH 2OQKA 4DV2L 1V43A 4DV4L 4DV5L 3PF4A 3GTQH 4MTNA 2YYZA 1HNWL 1WOCA 1HR0W 4JI4Q 2IHEA 2ZJPA 3I7FA 1R9TH 3PGZA 2N8NA 4LFCL 2IX1A 1VQGA 3AFPA 2F4VL 5J3BA 3M9BA 1FVIA 2E8GA 2JQOA 4YY3L 1ASYA 2R93H 4WJ4A 3S2HH 1C0AA 4EQ5A 1A0IA 4Y7NH 1VQEA 4DK3C 1VQOA 1K3RA 4QGUA 1YIJA 2HIXA 4JI0Q 4OWWB 2N49A 5GROA 2R7DA 3I55A 5C44H 2JA8G 2B63G 1E24A 1UE7A 4YWMA 2K5HA 1SRUA 4JI6Q 5FJ8G 2KENA 1NE3A 4IOCA 1C7YA 1MJCA 3BJUA 4BBRG 4NXML 3KYHC 5C0XG 4HIKA 5IY0A 1N32Q 3PO2G 2K4KA 2YTXA 4BY7H 1OXSC 4A3MG 1EUJA 1WCMH 4DR4L 2PQAA 2D0OA 1YHBA 1L1OA 5ELNA 4LNQA 2AMCB 5IYBG 1OXUA 1N34L 1WFQA 4JI2L 4BBSG 2ZTDA 4O0AA 3RZDH 4BY1G 3UDXA 4DV0Q 3HOVH 1KIXA 2KCMA 1CKOA 1TWHH 1GO3E 2GVBA 2ALYB 1J5EL 1MJEA 1XNQQ 4OWXB 3CXCA 4X65Q 4PMWA 4DV1L 4DR5Q 1K0RA 2JA7H 4IPDA 1KRSA 1YJ9A 2E2JH 2YU9H 3HOUG 4DAMA 1HZ9A 3PUXA 4DR7Q 1Q12A 3OW2A 3J80i 4HJ5A 4X6AH 3CCVA 2BH2A 2MFIA 4GNXA 3CAMA 4OX9Q 1QVCA 4JBJA 3I4MH 5IYDG 4A3CG 5C4XG 1L2FA 4QIWE 1WJJA 1I3QH 4J15A 5IE8A 4DUYL 3Q8DA 4JI1Q 1XMQQ 4DR6L 3DLLA 3T1YQ 2ATWA 4A3KG 4A3JG 1TWCH 3PV0A 2CWPA 1EIYB 2UXBQ 5M3MH 4A93G 2BA0A 4KHZA 4DV3Q 1KAWA 4R4CA 1VQLA 1PYBA 2OQ0A 4JI8L 4X66L 1Q1BA 4QL5A 3KDFB 4LUOA 1GKHA 4B3MQ 4LF5L 1VQNA 4A3BG 3ICEA 4IFDJ 4APVA 3H0GH 3G6EA 1JJGA 2K5NA 5LMNQ 4BXXG 3OTOL 4OO1I 1X3EA 4IOAA 1VQ7A 1YBYA 4YHHQ 1MIUA 1VQKA 2ZM6L 3GTPH 3RLOA 5LMNW 3AEVA 3GTMH 1N33L 1G51A 1M1KC 4IFDI 4JI7L 4JYAL 1BKBA 2ES2A 2JA5H 1NMFA 1YVCA 3TREA 1S40A 4QY7A 3TS2A 3PO3G 2ZJQA 2N3SA 4HIDA 1VS0A 2R92H 1HR0L 4ME3A 5ELOA 1VQ4A 3I2ZA 4GN3B 5C3EG 1RIPA 1U5KA 4LF9Q 4MZ9A 2UUCQ 2UUAL 4RG1A 1A63A 1HJPA 3J81c 3KJPA 4POFA 4LFBQ 1QUQB 5LMUL 3GD7A 3KF8B 4NXNQ 2UXCQ 2KHIA 3OYYA 1N36Q 2R6GA 1HNZQ 1UE5A 2NN6I 5GAEC 4DV6L 4A3GH 2WB1E 3PSIA 2AHOB 4LUZA 1A8VA 2VNUD 3WWVA 1UEBA 2EQSA 3JAMc 4JI6L 2VY3A 2CWAA 1EWIA 2F3IA 5HY6A 2DUDA 3F2DA 3G71A 2K75A 2OTLA 4X64Q 4DV7Q 4JC0A 1X54A 3J81j 1N32L 1EIFA 1VCIA 3KLWA 2MNAA 4LFAQ 4JOIC 2NZHA 3MXNB 3S2DH 2UUBL 3GTJH 2ZTCA 3RNUA 1Q86C 4BA2I 3CC7A 1VQ9A 4UP8A 3S15H 4DR1L 4JI5L 1LTLA 3FKIG 4DUZQ 1MKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5Y H;  1PH3 A;  2NZO A;  3STB D;  4DR3 Q;  2Q2U A;  1IL2 A;  3U4V A;  3HOW H;  1L1O C;  3S24 A;  3CP0 A;  4P75 A;  3CCJ A;  3RLF A;  2Q2T A;  2OWO A;  5IWA Q;  4X65 L;  1DGS A;  4IPH A;  4DR5 L;  4LF8 Q;  2K14 A;  3U58 A;  3K80 C;  4R4I A;  1LM0 A;  4GKJ Q;  4L5R C;  4JBM A;  4UY8 C;  4GOP A;  4DR7 L;  1EFW A;  2MO0 A;  4A3F G;  5GQO A;  3ER0 A;  1E22 A;  3F1Z A;  5AJ3 Q;  4PZ6 A;  2OTJ A;  1U0L A;  1CKN A;  5IP7 H;  5M5W H;  3ZJY C;  1LYL A;  1KC8 C;  4FDB A;  3CCQ A;  1XMQ L;  1SFO H;  4OXP A;  3HOX H;  4LF7 Q;  2R7Z H;  2PNH A;  4JOI A;  3T1Y L;  4IPC A;  4GNX C;  3FHW A;  4LF4 L;  5IP9 G;  4DR2 L;  4C3J H;  4H02 A;  3UDG A;  5DLQ E;  2UU9 L;  4A3L H;  4C3H H;  2HHH Q;  1GD7 A;  4NPS A;  3I4N H;  1YZ6 A;  1I94 Q;  4L5S A;  1NMG A;  4A3G G;  1KHI A;  3CCU A;  1PH7 A;  4B3R Q;  4R1J A;  1Y14 B;  4LUV A;  2VQE L;  2JA6 G;  4B3M L;  4K0K Q;  2EIF A;  4UP9 A;  4JG2 A;  1BVS A;  3S1N H;  2RF4 A;  5JEA G;  1JJC B;  3A5U A;  1JB7 A;  1ASZ A;  3G48 A;  4IJL A;  3K81 C;  5K36 G;  4YHH L;  3HOY G;  1Z47 A;  2E5L Q;  4UP7 A;  5HGQ A;  2XTI A;  3CCE A;  4GKK Q;  1M90 C;  1IZ6 A;  2A1A A;  1VQF A;  3EIV A;  4X62 Q;  4EX5 A;  3A5Z B;  5BR8 L;  1QZH A;  4JV5 Q;  1XMO L;  4R4T A;  1PVO A;  3I4O A;  5EAY A;  1VQM A;  1UE1 A;  1X56 A;  3S1M H;  2R93 G;  4GLV B;  2RCN A;  4P72 A;  5IYC H;  4KHP Q;  5M3F H;  4GLA C;  4B3S Q;  3RZO H;  4DV4 Q;  4DV5 Q;  2IT1 A;  4A3E H;  4B3T L;  1PH9 A;  2JEB I;  3T1H L;  3GTK H;  1T9H A;  3TS0 A;  3NEM A;  3HOZ H;  4A3D H;  4BA1 I;  1EOV A;  2Y0S E;  1VQC A;  5C44 G;  4LF9 L;  1HNW Q;  1VQ6 A;  4XIG S;  1E7Z A;  2WFW A;  2VS1 A;  3KJO A;  4GLX A;  2NVQ H;  5JJK A;  4HJ8 A;  1A62 A;  3CF5 A;  3BZK A;  2MO1 A;  3HOX G;  2JJQ A;  5C0X J;  3D31 A;  3KF6 B;  1VQP A;  4YY3 Q;  3CCS A;  1UE6 A;  1X6O A;  2ID0 A;  3HKS A;  4AYB G;  1PH6 A;  1IBK L;  1OTC A;  3UE1 A;  3S17 H;  3PIO A;  2UXC L;  1N36 L;  1VQJ A;  1X3F A;  4BY7 G;  1VQA A;  1NBW A;  3ERS X;  4A76 A;  1TWA H;  1WCM G;  1QVF A;  1SN8 A;  4JBW A;  1X55 A;  1BBU A;  2HT1 A;  2A19 A;  5IT9 c;  3NEN A;  5C0X I;  4AQY L;  3GO5 A;  1PH4 A;  5FLX c;  3S1R H;  4YWK A;  2C35 B;  2VUM H;  4DAY B;  3NEL A;  2VQF L;  1Q46 A;  3HOV G;  3H15 A;  4X64 L;  2YTY A;  3PUZ A;  3CW2 C;  1C9O A;  4NXM Q;  1HNX L;  1H95 A;  4AYB E;  4LFA L;  3W5O A;  2JA7 G;  3EBE A;  4C2M H;  1G6P A;  4DR4 Q;  1IXR A;  1JE5 A;  1XPR A;  1K73 C;  3DM3 A;  1VQ5 A;  4IPG A;  2WB1 G;  3VDY A;  4YCU A;  4XTC S;  2JE6 I;  1JT8 A;  1N34 Q;  4JI2 Q;  1NJI C;  3K7A H;  3U4Z A;  4POG A;  3I4M G;  1J6Q A;  1Y1W H;  1P16 A;  4JI4 L;  4DR3 L;  4Y52 H;  4AH6 A;  1Y1V H;  3M4O H;  2QA4 A;  2FXQ A;  4DV1 Q;  2Z0S A;  4A75 A;  4LF8 L;  2Z6K A;  5M3M G;  4HIO A;  1K83 H;  1Q7Y C;  1OXT A;  1TWG H;  4JI0 L;  1OXV A;  1AH9 A;  1WYD A;  2WAQ G;  1V1Q A;  4P74 A;  1XNR Q;  4GOP C;  3H0G G;  1X9N A;  4DUY Q;  4ALP A;  2UXD Q;  3CPF A;  3CMA A;  3PCO B;  3J7Z C;  1LUZ A;  3RLN A;  1I50 H;  2PI2 A;  2PQA B;  2B29 A;  4R4O A;  2RHS B;  2I5M X;  3J81 i;  3PF5 A;  1L1O B;  4WJ3 M;  1UWV A;  1SE8 A;  1FJG Q;  1XPO A;  1WI5 A;  3IRB A;  3NBH B;  4OON A;  1E1O A;  4PG3 A;  4X66 Q;  3CME A;  4DKA C;  3RN2 A;  2JA8 H;  1IBL Q;  1Q8K A;  1KXL A;  2B63 H;  2VZA A;  2WAQ E;  3M7N A;  2JA5 G;  1SMX A;  3CCM A;  3S1Q H;  1P8L A;  3OTO Q;  3JC6 6;  5FLM H;  4O2D A;  4HJA A;  3W1B A;  5FJ8 H;  2ZJR A;  2R92 G;  1JJ2 A;  3KDF A;  4DV0 L;  2XGT A;  2VL6 A;  4KLK A;  4BBR H;  3JAM i;  2PMZ E;  2N78 A;  2ZM6 Q;  3ULP A;  1EQR A;  3M3Y H;  1XNQ L;  3PO2 H;  1JMC A;  1N33 Q;  3HFZ B;  4GNX B;  4A3M H;  3E9I A;  5JJL A;  2AWO A;  1QVG A;  4JI7 Q;  2CCZ A;  1FGU A;  2KBN A;  3G4S A;  4JYA Q;  2A8V A;  5IYB H;  3FP9 A;  1TXY A;  2CQO A;  2QGQ A;  3UE0 A;  4BBS H;  4DPG A;  2QEX A;  4OX9 L;  4GS3 A;  3I56 A;  1S3O A;  3PUW A;  1HR0 Q;  4B3S L;  4BY1 H;  1K8A C;  1W3S A;  2NVX H;  4JI1 L;  1TWF H;  1G29 1;  1GVP A;  1L0W A;  3M85 A;  3GTO H;  3ULL A;  2UUA Q;  3S16 H;  4LF6 Q;  2UXB L;  4OWT B;  2LXK A;  3HOU H;  3CQZ H;  3S14 H;  2AKW B;  4DV3 L;  2CKZ B;  3U50 C;  2VW9 A;  2IY5 B;  3HKZ G;  2I5H A;  1CSP A;  4YWL A;  3GTL H;  4YCW A;  5LMU Q;  4A3C H;  5C4X H;  5IYD H;  1CUK A;  1I6H H;  5E7N A;  5LMN L;  2NVY H;  4LWC A;  1PH2 A;  4DV6 Q;  1PV4 A;  4A3K H;  1Q82 C;  4A3J H;  1QUQ A;  3CCL A;  4HIM A;  3RR5 A;  2Y0S G;  4A93 H;  3AQQ A;  1Q81 C;  3K8A A;  1YHQ A;  1B70 B;  1VQH A;  2CFM A;  4R4Q A;  1HZA A;  5FLM G;  4JI3 Q;  4OO1 G;  1CSQ A;  4QQB X;  5M5X H;  1Z9F A;  1IBM Q;  4A3B H;  3HOW G;  3KOJ A;  1KL9 A;  3B6Y A;  3BZC A;  3HKZ E;  1NY4 A;  3H3V I;  3L7Z C;  4LW1 A;  3W1G A;  4BXX H;  2HIV A;  2JA9 A;  3J80 c;  1PH5 A;  2UUB Q;  4IFD G;  1CKM A;  1KQS A;  4DV2 Q;  1V9P A;  2ZTE A;  4DR1 Q;  4JI5 Q;  1VQD A;  2AWN A;  3A0J A;  4MNO A;  4P71 A;  3K7U C;  4AIM A;  2GN5 A;  3D0F A;  2UUC L;  1XTD A;  5IP7 G;  1YJW A;  3RN5 A;  5C4J H;  4LFC Q;  2I5L X;  1YHA A;  1YIT A;  4RMF A;  2R7Z G;  3LGJ A;  1PFS A;  3M4P A;  2F4V Q;  3PO3 H;  4DNI A;  2Q2H A;  2K52 A;  4LFB L;  4A3I H;  2HQL A;  1GM5 A;  1B8A A;  2D0P A;  3GTG H;  1N9W A;  3CC2 A;  4NXN L;  3TRZ A;  3F2B A;  1HNZ L;  4A3L G;  3I4N G;  2OCE A;  4YCV A;  3AFQ A;  5JEA J;  3TEH B;  5C3E H;  2PI2 E;  1RL2 A;  1K9M C;  3K0X A;  3CC4 A;  1OXX K;  3AYH B;  2B3G A;  2Z6K C;  1I5F A;  1XNR L;  1VQB A;  4C3I H;  5H1S E;  1K8G A;  2JEA I;  2V1C C;  2UXD L;  4LF4 Q;  2NN6 G;  1VQ8 A;  3GDE A;  4DR2 Q;  4NB3 A;  2IHF A;  2UU9 Q;  1SLJ A;  4TVA B;  4DV7 L;  2E2H H;  3L2P A;  1FJG L;  2LSS A;  1HZC A;  1YJN A;  3UDF A;  1E1T A;  2VQE Q;  1X3G A;  4JCV E;  1IBL L;  4HJ9 A;  1XJV A;  1PH8 A;  3J7A 5;  3F2C A;  1B7Y B;  4DK6 C;  1SRO A;  2JK8 A;  5IYC G;  2F52 A;  4GN4 B;  1PYS B;  1BBW A;  1VQI A;  5M3F G;  4DUZ L;  3M4Q A;  5GAD C;  4UPA A;  4A3E G;  2YV5 A;  4GOP B;  1HZB A;  4L5T A;  1N8R C;  3HOZ G;  1EYG A;  2NVT H;  1J5E Q;  2WP8 J;  1PHJ A;  4A3D G;  5BR8 Q;  1AE2 A;  5IWA L;  1EQQ A;  1XMO Q;  2GVA A;  3EN2 A;  3L0O A;  5GAG C;  4JBK A;  4KI0 A;  1O7I A;  1CKN B;  4QJF A;  1YI2 A;  4GKJ L;  2KCT A;  1XPU A;  1PA6 A;  2MQH A;  3H3V H;  2L15 A;  1D7Q A;  4A3I G;  3FKI H;  5AJ3 L;  4PZ7 A;  1X65 A;  1D8L A;  1KRT A;  1YEZ A;  3SGI A;  4B3T Q;  4GN5 A;  3T1H Q;  1PH1 A;  4LF7 L;  3STB C;  4DR6 Q;  4L5Q A;  4TQU S;  1SR3 A;  2R7F A;  4LF6 L;  5GAH C;  1QZG A;  2HHH L;  2ASB A;  1NTG A;  2H5X A;  2BA1 A;  2LXJ A;  1I94 L;  2VUM G;  4A3F H;  1E3P A;  1S72 A;  4JI8 Q;  1W2B A;  1IBK Q;  2EXD A;  4B3R L;  4LF5 Q;  2D62 A;  3KFU A;  4K0K L;  2RHQ B;  2IX0 A;  3PUY A;  3BU2 A;  4IJH A;  2K5V A;  1HH2 P;  3KF6 A;  3MEF A;  4PZ8 A;  3TQY A;  5IP9 H;  2E5L L;  1FL0 A;  1YNX A;  2KHJ A;  3PIP A;  4AQY Q;  2YTV A;  4GKK L;  2K50 A;  3CCR A;  1AE3 A;  4X62 L;  4HJ7 A;  4JI3 L;  2BH8 A;  2VQF Q;  4JV5 L;  2DGY A;  1Q1E A;  3E0E A;  3E9H A;  3PUV A;  1Y1W G;  1KD1 C;  3ULJ A;  2Q2I A;  1IBM L;  3UDI A;  4P73 A;  1Y1V G;  2JA6 H;  3F8T A;  5JJI A;  4A4I A;  3A74 A;  1HNX Q;  4IO9 A;  2E2I H;  3CD6 A;  3CPW A;  4KHP L;  2I0Q A;  1IYJ B;  3HOY H;  2OQK A;  4DV2 L;  1V43 A;  4DV4 L;  4DV5 L;  3PF4 A;  3GTQ H;  4MTN A;  2YYZ A;  1HNW L;  1WOC A;  1HR0 W;  4JI4 Q;  2IHE A;  2ZJP A;  3I7F A;  1R9T H;  3PGZ A;  2N8N A;  4LFC L;  2IX1 A;  1VQG A;  3AFP A;  2F4V L;  5J3B A;  3M9B A;  1FVI A;  2E8G A;  2JQO A;  4YY3 L;  1ASY A;  2R93 H;  4WJ4 A;  3S2H H;  1C0A A;  4EQ5 A;  1A0I A;  4Y7N H;  1VQE A;  4DK3 C;  1VQO A;  1K3R A;  4QGU A;  1YIJ A;  2HIX A;  4JI0 Q;  4OWW B;  2N49 A;  5GRO A;  2R7D A;  3I55 A;  5C44 H;  2JA8 G;  2B63 G;  1E24 A;  1UE7 A;  4YWM A;  2K5H A;  1SRU A;  4JI6 Q;  5FJ8 G;  2KEN A;  1NE3 A;  4IOC A;  1C7Y A;  1MJC A;  3BJU A;  4BBR G;  4NXM L;  3KYH C;  5C0X G;  4HIK A;  5IY0 A;  1N32 Q;  3PO2 G;  2K4K A;  2YTX A;  4BY7 H;  1OXS C;  4A3M G;  1EUJ A;  1WCM H;  4DR4 L;  2PQA A;  2D0O A;  1YHB A;  1L1O A;  5ELN A;  4LNQ A;  2AMC B;  5IYB G;  1OXU A;  1N34 L;  1WFQ A;  4JI2 L;  4BBS G;  2ZTD A;  4O0A A;  3RZD H;  4BY1 G;  3UDX A;  4DV0 Q;  3HOV H;  1KIX A;  2KCM A;  1CKO A;  1TWH H;  1GO3 E;  2GVB A;  2ALY B;  1J5E L;  1MJE A;  1XNQ Q;  4OWX B;  3CXC A;  4X65 Q;  4PMW A;  4DV1 L;  4DR5 Q;  1K0R A;  2JA7 H;  4IPD A;  1KRS A;  1YJ9 A;  2E2J H;  2YU9 H;  3HOU G;  4DAM A;  1HZ9 A;  3PUX A;  4DR7 Q;  1Q12 A;  3OW2 A;  3J80 i;  4HJ5 A;  4X6A H;  3CCV A;  2BH2 A;  2MFI A;  4GNX A;  3CAM A;  4OX9 Q;  1QVC A;  4JBJ A;  3I4M H;  5IYD G;  4A3C G;  5C4X G;  1L2F A;  4QIW E;  1WJJ A;  1I3Q H;  4J15 A;  5IE8 A;  4DUY L;  3Q8D A;  4JI1 Q;  1XMQ Q;  4DR6 L;  3DLL A;  3T1Y Q;  2ATW A;  4A3K G;  4A3J G;  1TWC H;  3PV0 A;  2CWP A;  1EIY B;  2UXB Q;  5M3M H;  4A93 G;  2BA0 A;  4KHZ A;  4DV3 Q;  1KAW A;  4R4C A;  1VQL A;  1PYB A;  2OQ0 A;  4JI8 L;  4X66 L;  1Q1B A;  4QL5 A;  3KDF B;  4LUO A;  1GKH A;  4B3M Q;  4LF5 L;  1VQN A;  4A3B G;  3ICE A;  4IFD J;  4APV A;  3H0G H;  3G6E A;  1JJG A;  2K5N A;  5LMN Q;  4BXX G;  3OTO L;  4OO1 I;  1X3E A;  4IOA A;  1VQ7 A;  1YBY A;  4YHH Q;  1MIU A;  1VQK A;  2ZM6 L;  3GTP H;  3RLO A;  5LMN W;  3AEV A;  3GTM H;  1N33 L;  1G51 A;  1M1K C;  4IFD I;  4JI7 L;  4JYA L;  1BKB A;  2ES2 A;  2JA5 H;  1NMF A;  1YVC A;  3TRE A;  1S40 A;  4QY7 A;  3TS2 A;  3PO3 G;  2ZJQ A;  2N3S A;  4HID A;  1VS0 A;  2R92 H;  1HR0 L;  4ME3 A;  5ELO A;  1VQ4 A;  3I2Z A;  4GN3 B;  5C3E G;  1RIP A;  1U5K A;  4LF9 Q;  4MZ9 A;  2UUC Q;  2UUA L;  4RG1 A;  1A63 A;  1HJP A;  3J81 c;  3KJP A;  4POF A;  4LFB Q;  1QUQ B;  5LMU L;  3GD7 A;  3KF8 B;  4NXN Q;  2UXC Q;  2KHI A;  3OYY A;  1N36 Q;  2R6G A;  1HNZ Q;  1UE5 A;  2NN6 I;  5GAE C;  4DV6 L;  4A3G H;  2WB1 E;  3PSI A;  2AHO B;  4LUZ A;  1A8V A;  2VNU D;  3WWV A;  1UEB A;  2EQS A;  3JAM c;  4JI6 L;  2VY3 A;  2CWA A;  1EWI A;  2F3I A;  5HY6 A;  2DUD A;  3F2D A;  3G71 A;  2K75 A;  2OTL A;  4X64 Q;  4DV7 Q;  4JC0 A;  1X54 A;  3J81 j;  1N32 L;  1EIF A;  1VCI A;  3KLW A;  2MNA A;  4LFA Q;  4JOI C;  2NZH A;  3MXN B;  3S2D H;  2UUB L;  3GTJ H;  2ZTC A;  3RNU A;  1Q86 C;  4BA2 I;  3CC7 A;  1VQ9 A;  4UP8 A;  3S15 H;  4DR1 L;  4JI5 L;  1LTL A;  3FKI G;  4DUZ Q;  1MKH A; 
#chains in the Genus database with same CATH topology
 1CA5 A;  3STB D;  2Q2U A;  2WIN B;  3HOW H;  1LTA D;  2OWO A;  3SHL A;  3TZU A;  1Z7T A;  3IL8 A;  4LF8 Q;  4IFD H;  1PRT D;  4JBM A;  4UY8 C;  4GOP A;  1A3U A;  1EFW A;  3C3L A;  5GQO A;  5EKI A;  1PTO D;  5AJ3 Q;  4NMZ A;  2MHV A;  2OTJ A;  1DOM A;  5M5W H;  3ZJY C;  2PYK A;  4FDB A;  4LF7 Q;  4OXP A;  4RA8 A;  2R7Z H;  1EU3 A;  2PNH A;  1B3A A;  3T1Y L;  5IP9 G;  5IGE A;  4H02 A;  5JVH 3;  3UDG A;  1JWM D;  1I4X A;  1I50 B;  4K2L A;  3AMU A;  3SE0 A;  3CCU A;  1E0B A;  3D3R A;  3NQI A;  3S1N H;  1QB5 D;  3HOY G;  2E5L Q;  4UP7 A;  5HGQ A;  2XTI A;  1M90 C;  2B2Y A;  4KY5 A;  1VQF A;  4X62 Q;  4DF7 A;  3A5Z B;  1EYD A;  5BR8 L;  1ILP A;  1XMO L;  3SK5 A;  5E4X A;  1EZ6 A;  5I2Y A;  2H4O A;  1S5E D;  4L6T B;  2HQE A;  5IYC H;  3SK6 A;  4B3S Q;  2XNA C;  2E2I B;  3RZO H;  2IT1 A;  1PH9 A;  3T1H L;  4A3D H;  3TS0 A;  4ZAI A;  5C44 G;  1TT2 A;  1Y8N B;  4XIG S;  3KJO A;  2ZXO A;  4DXF A;  4HJ8 A;  1O7L A;  2JJQ A;  3D31 A;  1UE6 A;  1X6O A;  3CRL C;  4EQP A;  1X3F A;  1CQV A;  2R93 B;  1VQA A;  3BVM A;  5C0X I;  1IHZ A;  4AQY L;  2VQF L;  1Q46 A;  4YIJ A;  3H15 A;  4KTA A;  4NXM Q;  3PUZ A;  5JPN C;  2F0V A;  3CW2 C;  2JA7 G;  1D5X C;  1G6P A;  3Q22 A;  1TS3 A;  1FNV A;  1XPR A;  5CV9 A;  4BY7 B;  4K8J A;  3LWU A;  2JE6 I;  1JT8 A;  1V1P A;  3K7A H;  4ZQ3 A;  1Y1W H;  4JI4 L;  1LTT D;  1QJO A;  4AH6 A;  4HSP A;  2FXQ A;  2FMC A;  4DV1 Q;  2Z0S A;  3KLS A;  3R3O A;  2Q8R E;  3IAY A;  1K83 H;  4ZK9 B;  1Q7Y C;  4JI0 L;  3QO2 A;  1WYD A;  3EFX D;  2AQ2 B;  3TBI B;  1TII D;  1V1Q A;  4GOP C;  2L12 A;  3H0G G;  2Z4H A;  2UXD Q;  2EYP A;  3CMA A;  3I4M B;  3J7Z C;  1I50 H;  2PI2 A;  3J81 i;  5EPJ A;  1L1O B;  4MIU A;  1FJG Q;  3IRB A;  3NBH B;  4IUT A;  2JA8 H;  4DKA C;  4RH6 A;  3RN2 A;  2A69 D;  2B63 H;  4H7B A;  1STN A;  1HFG A;  3CCM A;  3OTO Q;  5FLM H;  3W1B A;  2ZJR A;  2R92 G;  3KDF A;  2B2V A;  2N78 A;  1EQR A;  1A3T A;  1BF4 A;  1XNQ L;  3HFZ B;  4XDX A;  4GNX B;  1U4R A;  5JJL A;  2AWO A;  3A56 A;  1QVG A;  1FGU A;  2B2Y C;  1TXY A;  2MPM A;  1IL8 A;  2PQE A;  4BBS H;  1SYB A;  1HTL D;  1HR0 Q;  4JI1 L;  1TWF H;  2B2U C;  1G29 1;  2FJ2 A;  3ULL A;  1EY9 A;  2A6H D;  2LXK A;  2AKW B;  2F0Q A;  2B2T A;  2I5H A;  3C2P A;  2RDF A;  1IW7 D;  1I6H H;  2BE5 D;  3VYR A;  1HRJ A;  4RKL A;  4DV6 Q;  4C56 C;  4HIM A;  5A2Q E;  2Y0S G;  3KF8 A;  4NW2 A;  5CV5 A;  1Q81 C;  1SSO A;  1B70 B;  1KNA A;  4OO1 G;  4QQB X;  4A3B H;  2MJ8 A;  3A7A B;  3BZC A;  3MHB A;  3L7Z C;  3W1G A;  2HIV A;  2UUB Q;  1T5E A;  1KQS A;  2ZTE A;  2Z4I A;  1DYQ A;  2AWN A;  3K7U C;  3D4R A;  4KJO A;  3D6W A;  1YJW A;  4IQZ A;  3RN5 A;  5C4J H;  2I5L X;  4HCS A;  4I7A A;  1ENC A;  1BBX C;  3NTI A;  1PFS A;  3M4P A;  2F4V Q;  4LFB L;  2F0L A;  1GM5 A;  4C3J G;  3CC2 A;  4A3L G;  5C3E H;  5JEA J;  3S2H B;  3K0X A;  3U9O A;  3AYH B;  2B3G A;  3DEO A;  4RFB A;  1XNR L;  3J7A V;  1VQB A;  4C3I H;  5IIF A;  5C44 B;  2I46 A;  2NN6 G;  4PMC A;  4DR2 Q;  1JWS D;  3MA2 B;  3H91 A;  2E2H H;  3L2P A;  2LSS A;  4ZCK A;  4K8I A;  2VQE Q;  4N8F A;  1IBL L;  3I4N B;  2KCC A;  4R8N A;  4V19 0;  1L0Y B;  4DK6 C;  2SOB A;  4GN4 B;  1PYS B;  5M3F G;  1VQI A;  2L1B A;  2PO4 A;  3TN2 A;  3M4Q A;  1N8R C;  4A3E G;  1HZB A;  4L5T A;  5IWA L;  2GVA A;  3L0O A;  4ILW A;  2C5C A;  1CKN B;  4QJF A;  2B2V C;  3I72 A;  1XPU A;  3F2U A;  1WVL A;  2L15 A;  4WFN 3;  2KHS A;  4A3I G;  3P1H A;  2F03 A;  1SYG A;  3SGI A;  4GN5 A;  1HFN A;  4L5Q A;  1SR3 A;  2R7F A;  1S5C D;  1SE3 A;  2DJF C;  1QZG A;  1ESR A;  2HHH L;  1E3P A;  1S72 A;  4PQX A;  4JI8 Q;  1IBK Q;  2EXD A;  3E0J A;  5BN5 A;  5DNF A;  1ML0 D;  3TQY A;  5IP9 H;  1YNX A;  1BCP C;  4GKK L;  3CCR A;  1AE3 A;  4G7Z C;  3T53 B;  2BH8 A;  1F77 A;  2DGY A;  3E0E A;  1KD1 C;  4XQQ A;  1WTP A;  1NUC A;  1IBM L;  1Y1V G;  3S9W A;  4A4I A;  2ICE C;  3A74 A;  1HNX Q;  4IO9 A;  1A3V A;  3A8I E;  1EWH A;  2CQA A;  4DAY A;  3RD4 A;  2I0Q A;  3HOY H;  1WTH A;  4DV2 L;  1V43 A;  2K5W A;  1BDO A;  2R92 B;  2YYZ A;  1BR9 A;  2F3W A;  2IHE A;  1R9T H;  3CU7 A;  2N8N A;  4LFC L;  1PDQ A;  3ND8 A;  2IX1 A;  4K5V A;  3AFP A;  5K5P A;  1GUT A;  5J3B A;  3M9B A;  1F2M A;  4YY3 L;  4WJ4 A;  1CHP D;  2SDF A;  1GOZ A;  3S2H H;  4CJ2 C;  3R2T A;  4Y7N H;  3E6Z X;  1RJT A;  5GRO A;  3J7Y W;  5C44 H;  1E24 A;  2O5J C;  4QF4 A;  1TKW B;  1MJC A;  3D4W A;  1TS2 A;  3BJU A;  5C0X G;  1H9M A;  1ET9 A;  2EYJ A;  3PO2 G;  1OXS C;  4KD3 A;  1EUJ A;  3MWY W;  2TMP A;  2HUG A;  1CK1 A;  4CBV A;  5CV7 A;  2ZTD A;  3UDX A;  3DEP A;  1KIX A;  2KCM A;  2GVB A;  1J5E L;  3MVV A;  3LWE A;  4DK1 A;  4OWX B;  3CXC A;  2JA7 H;  1K0R A;  4IPD A;  1KRS A;  1YJ9 A;  2E2J H;  3M3Y B;  4U68 A;  4DR7 Q;  4A3M B;  4X6A H;  3CCV A;  2MFI A;  2E76 C;  4JBJ A;  2L4N A;  1W6K A;  1CTM A;  1G91 A;  1I3Q H;  4G57 A;  1SMY D;  4E6I A;  2ATW A;  4A3J G;  3J80 E;  1EIY B;  2UXB Q;  1PFM A;  2EYH A;  2EYO A;  3WOF A;  2JYO A;  1ZXT A;  4Z9C B;  3CQZ B;  4WJW A;  4B3M Q;  4LF5 L;  4IFD J;  1VQN A;  3ICE A;  1HUN A;  3H0G H;  2K5N A;  1OO9 B;  1X3E A;  5C4X B;  1GUG A;  4DFA A;  3NWT A;  1VQK A;  5I9O A;  2NVY B;  3RLO A;  5LMN W;  4A3K B;  3I4L A;  1U4M A;  1D5M C;  2L55 A;  1BKB A;  1EYC A;  3TRE A;  3PO3 G;  1PRT B;  3DWP A;  5KNC A;  2R92 H;  2JSO A;  4TRD A;  2QKI C;  5ELO A;  1D1I A;  1PTO B;  3I2Z A;  1IYV A;  4MZ9 A;  2UUA L;  3T16 A;  3SK4 A;  1STY A;  1TY0 A;  1YNN D;  2FFK B;  3J7A F;  1JC7 A;  4GZY C;  2ENB A;  3OYY A;  5JVG 3;  1IKL A;  5COY A;  4A3I B;  4CDF C;  3PIO 3;  1PFB A;  1A8V A;  1PLF A;  3WWV A;  4DAP A;  1EY8 A;  1HQR D;  1UEB A;  4KKS A;  1D1K A;  2MGS A;  1EWI A;  3URY A;  1CT1 D;  2DUD A;  3R93 A;  3F2D A;  1WD0 A;  3S1R B;  4X64 Q;  4DV7 Q;  3J81 j;  1LT4 D;  3C46 A;  3OHX C;  3MXN B;  2C9O A;  3M4Y A;  3S2D H;  1X3Q A;  4RGN A;  3GTJ H;  1ET6 A;  1KDA A;  1TR5 A;  1I4P A;  1JOO A;  4UP8 A;  3K6O A;  5I9P A;  2G9H D;  1LTL A;  1KNE A;  2IWH A;  1MKH A;  4OO1 H;  3SK8 A;  2NZO A;  3CCJ A;  3RLF A;  4X65 L;  1DGS A;  4DR5 L;  1Y1V B;  3U58 A;  3K80 C;  1LM0 A;  4GKJ Q;  3S15 B;  5C3X A;  2MO0 A;  1E22 A;  4XXE A;  1A2U A;  1ZEQ X;  5EPL A;  1SFO H;  3CCQ A;  1SJE D;  3NK9 A;  3HOX H;  2PPB C;  4IPC A;  3FHW A;  4J8Q A;  4C3J H;  4ABN A;  1L0X B;  5DLQ E;  5L37 A;  4A3L H;  4KKU A;  1CZG A;  2A73 B;  2KQ3 A;  4R1J A;  1F2L A;  4UP9 A;  4JG2 A;  3H09 A;  1STH A;  1JB7 A;  3G48 A;  1FNU A;  4IZ8 A;  1TS5 A;  2NN6 H;  4YHH L;  2F4I A;  4K14 A;  5DM7 3;  3CCE A;  1IZ6 A;  2A1A A;  1F9S A;  1ICF B;  4R8I A;  5CYU A;  1SYD A;  1QZH A;  5D14 A;  4R4T A;  5IT9 L;  2Z6B A;  5FLX L;  2L9H A;  4KD4 A;  3PO2 B;  5EAY A;  1VQM A;  3K0Y A;  4A3G B;  2JA6 B;  2R93 G;  2PW5 A;  3ERO A;  4KHP Q;  5M3F H;  4GLA C;  4A3E H;  4B3T L;  3GTK H;  4OIJ A;  3K5O A;  4LMQ D;  4BA1 I;  1EOV A;  2KVM A;  3A8K E;  1E7Z A;  2WFW A;  3BZK A;  1HPC A;  3DWA A;  3KF6 B;  1F2Z A;  3CCS A;  2ID0 A;  1OTC A;  1LT6 D;  3TSS A;  3UE1 A;  3S17 H;  1WTQ A;  4QCL A;  2UXC L;  1N36 L;  1VQJ A;  2QW7 A;  4CJ1 B;  4BY7 G;  1TWA H;  3MFG A;  1BBU A;  2R61 A;  2A19 A;  1HTP A;  3NEN A;  1PH4 A;  3S1R H;  4YWK A;  2IL8 A;  2F0T A;  2B8G A;  4N9P A;  2SNS A;  2PCF B;  1C9O A;  3TP5 A;  3M7G A;  4LFA L;  4AYB B;  4WRD A;  5M5X B;  3EBE A;  1I4Q A;  4C2M H;  1IXR A;  2B39 A;  5C4Z A;  4JI2 Q;  1NJI C;  3U4Z A;  3I4M G;  1J6Q A;  2NTS A;  4Y52 H;  1Y1V H;  5CBE E;  4LF8 L;  2KEC A;  1PRT F;  2DNC A;  2DY8 A;  2Z6K A;  4HIO A;  3Q6S A;  3H94 A;  1I4G A;  2YU9 B;  1PTO F;  2F0U A;  1DZ1 A;  4FF2 A;  1DOL A;  2NWG A;  2A6E C;  3GQB A;  3OWE B;  4DUY Q;  4RCO A;  1X3P A;  4ALP A;  1LUZ A;  2PQA B;  4R4O A;  1O7Y A;  2B29 A;  5EKK A;  2AUJ D;  2E75 C;  1TVX A;  2EVB A;  2JP1 A;  1SE8 A;  1UNS A;  1XPO A;  1ONL A;  1SAP A;  4G7O C;  1SNO A;  5FO9 B;  4PG3 A;  4X66 Q;  5M3M B;  3ONA B;  2VZA A;  1GHJ A;  1SMX A;  3S1Q H;  1JJ2 A;  4DV0 L;  3PQI A;  2XGT A;  1FR3 A;  2ZM6 Q;  1CA6 A;  2PMZ E;  3ULP A;  4IUQ A;  3ERQ A;  5J1Z A;  5C0X H;  1SND A;  3PO2 H;  4FXK C;  3VR2 A;  3GTP B;  4JI7 Q;  2CCZ A;  2KBN A;  4JYA Q;  1B1Z A;  1GUW A;  2QEJ C;  3I73 A;  3JAM E;  2QGQ A;  2QEX A;  4GS3 A;  3PUW A;  4B3S L;  1W3S A;  3FPP A;  3ITP A;  1L0W A;  3GTO H;  1SBB B;  4CKC A;  4LF6 Q;  2K04 A;  4F88 A;  5FK9 C;  3S14 H;  2CKZ B;  2VW9 A;  1CSP A;  2J7Z A;  4YCW A;  5LMU Q;  1PZI D;  1AEX A;  2CHB D;  1CUK A;  4EQN A;  4FP5 D;  1Q82 C;  4A3J H;  3CCL A;  4TSS A;  4KY7 A;  3K8A A;  2LKV A;  1LT3 D;  4JI3 Q;  1HZA A;  3MTS A;  1CSQ A;  5M5X H;  1Z9F A;  3KOJ A;  1KL9 A;  3H3V I;  3AB9 A;  1LT5 D;  2B2U A;  5NUC A;  4FF4 A;  1TU2 B;  2QIL A;  3J80 c;  4JVZ A;  1CKM A;  1MBY A;  2PZU A;  3DM1 A;  4DR1 Q;  4JI5 Q;  4AIM A;  3P75 A;  1S5F D;  4P71 A;  1YHA A;  1YIT A;  3T56 B;  4DXG A;  3BS1 A;  3PO3 H;  5M5Y B;  2Q2H A;  2HQL A;  1N9W A;  3TRZ A;  3I4N G;  2HDL A;  2PI2 E;  3NHH A;  2Z6K C;  1CFM A;  5EGT A;  1RTO A;  2UXD L;  2P5Z X;  3P7J A;  5KRU A;  4NB3 A;  1KDC A;  5E4W C;  4K6D A;  4TVA B;  3SDZ A;  1FJG L;  1HZC A;  1XTC D;  4UHV A;  4CDC C;  1X3G A;  3E5S A;  4JCV E;  1Y8P B;  4C3H B;  1BQQ T;  4EVO A;  1H9R A;  2G5D A;  2LS0 1;  5BN4 A;  4UPA A;  2YV5 A;  4GOP B;  5D3I B;  2WP8 J;  4ZUI A;  5BR8 Q;  1AE2 A;  1EQQ A;  1XMO Q;  4FF1 A;  3A54 A;  5DAU A;  5I6Y A;  1I4R A;  1IKM A;  4QUC A;  4K6L A;  4MHE A;  5D3D A;  1G2T A;  3IFD A;  3S1M B;  3T1H Q;  1PH1 A;  4DR6 Q;  3NWS A;  3SXH A;  1JB3 A;  3HOZ B;  1NTG A;  2LXJ A;  1I94 L;  2NVQ B;  4B3R L;  4XT3 B;  3Q0A A;  3KFU A;  4K0K L;  1JOK A;  2RHQ B;  2K5V A;  3MEF A;  5A2Q L;  4PZ8 A;  1FL0 A;  2KHJ A;  4AQY Q;  2YTV A;  2K50 A;  4ZKB B;  1WTR A;  2PMZ B;  4HJ7 A;  2VQF Q;  4JV5 L;  1Q1E A;  4HCE A;  3UDI A;  4P73 A;  5JJI A;  2K05 A;  1JWU D;  4Q0F A;  2E2I H;  2CH4 A;  5I6W A;  3K57 A;  1DM0 B;  2F0I A;  3CPW A;  1IYJ B;  3QOJ A;  2OQK A;  4ZKC B;  4DK0 A;  4DV4 L;  3P20 A;  4DV5 L;  1AP0 A;  1GHK A;  1HNW L;  4JI4 Q;  2A6E D;  1EQT A;  3G7L A;  1AZQ A;  4BS9 A;  2F4V L;  2R93 H;  1HUM A;  3M4O B;  1A0I A;  3L3O C;  2Z8L A;  4DK3 C;  3Q23 A;  1YIJ A;  1MSH A;  4JI0 Q;  5IGC A;  2KEE A;  2A74 C;  2VB2 X;  1LTR D;  4YWM A;  2K5H A;  1SYF A;  2BCO A;  4IOC A;  2QDL A;  1I6V C;  4KN7 C;  4HIK A;  5IY0 A;  1N32 Q;  2K4K A;  2YTX A;  1V1P B;  4BY7 H;  4OHJ A;  4A3M G;  4DR4 L;  3GV3 A;  2EZV A;  4O1N A;  1N34 L;  4X3U A;  1E2V A;  1UEA B;  4X3T A;  4DNR B;  1G2S A;  2LMC B;  2KED A;  4RKB A;  1XNQ Q;  4PMW A;  4BBR B;  1B4O A;  3OIP A;  2A68 C;  4PNY A;  1LTG D;  4HJ5 A;  3E3X A;  2L11 A;  3I4M H;  4A3C G;  5IYD G;  5C4X G;  1JE4 A;  2RSO A;  1WJJ A;  3MXU A;  2LFN A;  4OEM B;  1XMQ Q;  4JI1 Q;  4BY1 B;  4FXG C;  4A3K G;  2J0T D;  3PV0 A;  2CWP A;  1J8I A;  1SNC A;  4ID6 A;  2NVX B;  1KAW A;  4R4C A;  3HZX A;  1VQL A;  3NBI A;  4C1N I;  3S16 B;  2XRS D;  2BDO A;  4DGZ A;  1GUN A;  2OQ0 A;  4JI8 L;  1Q1B A;  3HOU B;  3KDF B;  4LUO A;  1GKH A;  4BXX G;  3BDO A;  4IOA A;  1VQ7 A;  1YBY A;  1MI2 A;  3R8B A;  4CHT B;  3L9A X;  1J9O A;  3TP6 A;  1LAC A;  1N33 L;  4A93 B;  3DXJ C;  5CGK A;  4H0L C;  1II3 A;  2F0F A;  2ES2 A;  4QY7 A;  1BUV T;  2HD3 A;  1CQF A;  1RDP D;  1K28 A;  1VQ4 A;  1Y8O B;  3BYT B;  4GN3 B;  1RIP A;  2WKD A;  4LF9 Q;  3Q24 A;  1EQV A;  1SNQ A;  4RG1 A;  1BCP B;  2XSC A;  2G9D A;  4POF A;  4LFB Q;  3BDL A;  3KF8 B;  1SEB D;  3NP8 A;  2KHI A;  2E74 C;  5EKL A;  1UE5 A;  2WB1 E;  3GTG B;  5CMD A;  2AHO B;  1RTN A;  4OGQ C;  3X3N A;  3JAM c;  2VY3 A;  5HY6 A;  2F3I A;  1PYW D;  1EZ8 A;  3BG3 A;  4DU9 A;  2K75 A;  2OTL A;  4JC0 A;  1X54 A;  3KLW A;  2FIN B;  3EVQ A;  4JOI C;  1ENF A;  3BVG A;  4BA2 I;  3VA5 A;  2RQX A;  4DR3 Q;  1IL2 A;  3U4V A;  3CP0 A;  2K01 A;  2D2C C;  5J22 A;  5IWA Q;  1DJR D;  4IPH A;  1PZJ D;  5CV6 A;  2K14 A;  1F9Q A;  4R4I A;  3QJY A;  5C4H A;  2NVT B;  4OIK A;  4DR7 L;  2SEB D;  5CBA E;  5LHY 1;  3ER0 A;  3F1Z A;  4J6H A;  2AQ3 B;  4IUP A;  3K5L A;  5IGG A;  1VF7 A;  5IGF A;  1LYL A;  1KC8 C;  4H13 C;  1SDF A;  3FKI B;  3J80 L;  4K5X A;  4LF4 L;  2J4X A;  3NQT A;  3SEB A;  5C6A A;  2UU9 L;  4IUU A;  2V4D A;  2HHH Q;  1GD7 A;  3I4N H;  3D6C A;  3HP3 A;  4L5S A;  4A3G G;  2EY2 A;  1PH7 A;  1O78 A;  3OWF A;  4HMI A;  1Y14 B;  3C1F A;  4LUV A;  2ICI A;  3VR3 A;  4B3M L;  2JA6 G;  2EIF A;  1BVS A;  4A3F B;  2RF4 A;  1ICW A;  3A5U A;  1ASZ A;  4IJL A;  2AUK A;  1E2W A;  1Z47 A;  4HTH A;  4GKK Q;  1B53 A;  4C1N K;  3OIQ A;  3N6R A;  4B9X A;  2EJM A;  2JN4 A;  3I4O A;  2K28 A;  4XYO A;  3TDQ A;  1UE1 A;  2MUY A;  3BVZ A;  2RCN A;  4P72 A;  4FYD A;  1DD2 A;  1S4Z A;  1HQM C;  2KUM A;  1T9H A;  3NEM A;  1FNW A;  2F0P A;  3QIA A;  1BNZ A;  4XYQ A;  1VQC A;  1VQ6 A;  1GUO A;  2VS1 A;  4GLX A;  5JJK A;  3GTQ B;  3CF5 A;  2MO1 A;  3RMH A;  5C0X J;  1GJX A;  2DNE A;  3T51 B;  1VQP A;  4KN4 C;  5JOB A;  4YY3 Q;  4AYB G;  3PIO A;  1NBW A;  3ERS X;  4F7X A;  4JBW A;  1X55 A;  2HT1 A;  1ZYR C;  4EQO A;  3GO5 A;  2C35 B;  5DM6 3;  4DAY B;  3NEL A;  3EQL C;  1Q90 A;  2QDB A;  3HOV G;  1F9R A;  4X3S A;  4ZRZ A;  2YTY A;  4X64 L;  4F8M A;  1QNK A;  2B8F A;  4AYB E;  2A68 D;  2NZ1 D;  4S3S A;  1JR0 D;  1JE5 A;  1VQ5 A;  3DM3 A;  4IPG A;  4YCU A;  2F0W A;  1WCM B;  1LTB D;  4POG A;  3HS0 C;  1P16 A;  1QIL A;  1D2B A;  2F1M A;  2NUC A;  2QA4 A;  3RZD B;  1B2T A;  4L63 B;  4A75 A;  4FNF A;  1TWH B;  1M8A A;  5M3M G;  4RHR A;  1OXT A;  1OXV A;  4UDU C;  1A15 A;  2PW7 A;  1SE4 A;  2XRQ D;  1R4P B;  2MP1 A;  2WB1 B;  4HMJ A;  4P74 A;  1X9N A;  3CPF A;  3PCO B;  3RLN A;  3VR6 A;  2I5M X;  3V05 A;  3PF5 A;  1NCV A;  2VXW A;  4WJ3 M;  1UWV A;  4N8X 1;  1WI5 A;  1TWC B;  1EEI D;  2OXP A;  2AQ1 B;  4OON A;  1K3B C;  3A7L A;  1Q8K A;  5ELC A;  1O7Z A;  3W2D A;  3HGB A;  2WAQ B;  3J81 E;  1P8L A;  3JC6 6;  4O2D A;  1SNM A;  4HJA A;  4KK7 A;  5KND A;  1S5B D;  3M3Y H;  1HCZ A;  2QCP X;  3QG1 A;  1JMC A;  1U4P A;  4A3M H;  2WII B;  3G4S A;  3GTM B;  3QOL A;  3FP9 A;  1ILQ A;  3UE0 A;  1MD2 D;  4OX9 L;  3I56 A;  4IUN A;  4QB4 A;  1K8A C;  5HGT A;  2K33 A;  1V8Q A;  1BCP D;  1GVP A;  2UUA Q;  4RHS A;  3SVM A;  3CQZ H;  1G6Z A;  4DV3 L;  2Z9H A;  3AU7 A;  3BYY B;  3ND9 A;  3U50 C;  2IY5 B;  3HKZ G;  4YWL A;  1JCK B;  4A3C H;  5C4X H;  5IYD H;  5LMN L;  2NVY H;  2RDG A;  1FD7 D;  4A3K H;  1QUQ A;  2F0D A;  3RR5 A;  4KMU C;  3AQQ A;  1LV9 A;  3MXP A;  1VQH A;  3KK7 A;  5FLM G;  3PIP 3;  3VYS A;  3WOE A;  3HKZ E;  2OF1 A;  1XWE A;  4LW1 A;  2EXZ A;  1PTO H;  4M1U B;  4BXX H;  1H9J A;  3I3C A;  1PH5 A;  1BXT A;  5ELB A;  5A35 A;  1V9P A;  3A8J E;  1KTK A;  1VQD A;  4MNO A;  5AFW A;  1STG A;  1Z6H A;  2GN5 A;  2UUC L;  2XVS A;  5IP7 G;  3O13 A;  3LGJ A;  4DNI A;  2K52 A;  3V96 A;  4A3I H;  3HOW B;  5DEH A;  1B8A A;  2FHT A;  2D0P A;  4NXN L;  4C3H G;  3F2B A;  1HNZ L;  2OCE A;  3G6J B;  5LL6 X;  3AFQ A;  4DN4 M;  3IFT A;  1K9M C;  3CC4 A;  1RF2 D;  2X6L A;  1ESF A;  5H1S E;  1K8G A;  2JXM B;  2JEA I;  5JAV A;  3VYU A;  3GDE A;  4O42 A;  5M5W B;  3T13 A;  2HDM A;  2HCC A;  2IHF A;  4IN3 A;  1HA6 A;  1SLJ A;  2R7Z B;  4LAA A;  5E3F A;  1YJN A;  5KYI A;  2IJ0 A;  1E1T A;  3EJI A;  4HJ9 A;  2D5D A;  1V1O A;  3KBX A;  3NTH A;  5G3L D;  3TZD A;  1BO0 A;  2JK8 A;  2F52 A;  4DUZ L;  1BBW A;  3S1N B;  5ELD A;  5GAD C;  3HOZ G;  1EYG A;  2E2D C;  3S15 H;  3EN2 A;  5GAG C;  4MTK A;  3HOV B;  4KI0 A;  1YI2 A;  5IT9 E;  2PZT A;  2GA4 B;  5FLX E;  1PA6 A;  2MQH A;  3H3V H;  5AJ3 L;  2EJG C;  1TY2 A;  1X65 A;  4J1M A;  1D8L A;  1KRT A;  4B3T Q;  4LF7 L;  1ZYR D;  1LO5 D;  3RZO B;  1NR2 A;  1LTI D;  4LF6 L;  4A3D B;  3MXG A;  5ELF A;  3GP7 A;  2ASB A;  2K03 A;  2VUM G;  2BA1 A;  1YNJ C;  1HHV A;  2IX0 A;  2QF7 A;  3BU2 A;  4IJH A;  5KNB A;  1HH2 P;  4PV1 C;  3OMC A;  3I70 A;  5IGD A;  2E5L L;  2B2W A;  4X62 L;  3KBG A;  4JI3 L;  4A3G H;  3E9H A;  2JA6 H;  3ULJ A;  4M8A A;  4R9W A;  4PMB A;  3FVQ A;  1IW7 C;  1F9P A;  1KLG D;  4MTN A;  3DMU A;  1WOC A;  1HR0 W;  2ZJP A;  3OPO A;  3PGZ A;  1SXT A;  3NUC A;  3K7A B;  3TP7 A;  1HA5 A;  4OL7 A;  1Y1W B;  1FVI A;  2E8G A;  2JQO A;  1ASY A;  5I2X A;  2F0M A;  1C0A A;  4EQ5 A;  1VQE A;  4OEL B;  4QGU A;  4OWW B;  2HIX A;  1NAP A;  3I55 A;  1K83 B;  1UE7 A;  1EIH A;  2EDG A;  3FRP B;  1EEF D;  1AN8 A;  4JI6 Q;  5FJ8 G;  1NE3 A;  1Q8I A;  4RAU C;  3TME A;  4BBR G;  2SNM A;  4NXM L;  3KYH C;  5CV4 A;  2IPK D;  3HKZ B;  1IYU A;  2BDN A;  1ROD A;  4EGV A;  5FO8 B;  1L1O A;  5ELN A;  4CJ0 B;  2AMC B;  5IYB G;  2RDH A;  1BOS A;  3CHB D;  1OXU A;  2JA8 B;  1WFQ A;  3NBH A;  2B63 B;  4BY1 G;  2EYL A;  4DV0 Q;  3HOV H;  5CR3 A;  2ALY B;  1NSN S;  1MJE A;  5TSS A;  4DV1 L;  2YU9 H;  3HOU G;  1Q12 A;  5IOD A;  5KGU A;  3J80 i;  3OW2 A;  2NTT A;  3QR8 A;  4GNX A;  1QVC A;  2X6G A;  4QIW B;  3QWN A;  4J15 A;  5IE8 A;  3CRK C;  3Q8D A;  4DR6 L;  4BBS B;  2EE1 A;  1TS4 A;  5ISR A;  2F0G A;  3T1Y Q;  4HAE A;  1KAB A;  1LLR D;  5M3M H;  4A93 G;  1TWF B;  5C5L A;  2WKC A;  1C48 A;  4QL5 A;  3OSO A;  4APV A;  1T5X D;  1JJG A;  1MSG A;  1VF5 C;  3K5N A;  3OTO L;  1C8C A;  1MIU A;  1I6H B;  5M9O A;  3GTP H;  5E1F A;  2N88 A;  3AEV A;  4IFD I;  1G51 A;  2NB0 A;  2B2W C;  1K0S A;  1DON A;  1NMF A;  1XYI A;  3OMG A;  1GXD C;  4A3B B;  1VS0 A;  2K5D A;  3FPU B;  3PMF A;  2M2L A;  1HR0 L;  1AW7 A;  3CKI B;  5FOB B;  4CDD C;  1VDZ A;  4IUV A;  1A63 A;  1HJP A;  4HR7 B;  3J81 c;  3KJP A;  5C4J B;  1K8O A;  3I90 A;  3GD7 A;  3WDN A;  3KLR A;  2XWJ B;  4KY6 A;  3K59 A;  1X32 A;  5GAE C;  4DV6 L;  3PSI A;  2EY1 A;  4UAI A;  4B9W A;  2VNU D;  2K32 A;  5C3E B;  2EQS A;  2M9V A;  4C3I B;  3ZYY X;  1VMP A;  2VUM B;  1N32 L;  1VCI A;  2NZH A;  1PZK D;  1H9S A;  2UUB L;  3GV6 A;  1Q86 C;  3RNU A;  2E2H B;  2XWB B;  3CC7 A;  1AZP A;  3FKI G;  1DCZ A;  5M5Y H;  1PH3 A;  1G8Z D;  4DAV A;  1WTO A;  1L1O C;  3S24 A;  1LTS D;  4P75 A;  2Q2T A;  1A2T A;  1B9M A;  1YNJ D;  4L5R C;  2NYZ D;  2F0E A;  3U9S A;  4QUF A;  4A3F G;  4PZ6 A;  1U0L A;  1TWG B;  1CKN A;  4IUR A;  5IP7 H;  3MC0 B;  1XMQ L;  5FO7 B;  4JOI A;  4GNX C;  4RGO S;  1PFN A;  4DR2 L;  3VA7 A;  4NDX A;  1B44 D;  3EA6 A;  4C3H H;  4NPS A;  1YZ6 A;  3HEJ A;  4KKT A;  1NMG A;  1I94 Q;  3OW7 A;  1KHI A;  3DUZ A;  4B3R Q;  4JK1 C;  2VQE L;  4ZYS A;  4K0K Q;  1JOQ A;  4WOR A;  4CDE C;  1QG7 A;  5JEA G;  1JJC B;  5BN3 A;  3K81 C;  5K36 G;  1SMY C;  3KUP A;  3EIV A;  3K58 A;  5FKA C;  4EX5 A;  5CC4 A;  4JV5 Q;  1PVO A;  3SR1 A;  1XX8 A;  3D8G A;  4KV6 A;  5I4D A;  1X56 A;  3S1M H;  2LY7 A;  4GLV B;  1SYE A;  4DV4 Q;  4DV5 Q;  3HOZ H;  2JEB I;  2Y0S E;  3HOY B;  4LF9 L;  1HNW Q;  2NVQ H;  2EOT A;  3DHQ A;  2F0J A;  1A62 A;  1C4Q A;  3HOX G;  3R2I A;  4ME5 A;  1R9T B;  3NTK A;  1PH6 A;  3HKS A;  1IBK L;  3MFY A;  1E2Z A;  2PNR C;  3GTL B;  4A76 A;  2F0O A;  1WCM G;  1QVF A;  1SN8 A;  4Y7N B;  5IT9 c;  5FLX c;  3H6M A;  1LAB A;  1MGS A;  2VUM H;  5KEE A;  2EY5 A;  1H9S B;  1JQY D;  1H95 A;  1YNN C;  4MN3 A;  1HNX L;  1F2Y A;  1B50 A;  3W5O A;  1JIC A;  4DR4 Q;  1K73 C;  2WB1 G;  2IX3 A;  5EQ0 A;  3VDY A;  1B9N A;  4XTC S;  1N34 Q;  1CZW A;  5IOC A;  4I65 A;  1RCV D;  4ZLT F;  4IAL A;  4DR3 L;  2KOL A;  3A55 A;  4RCN A;  3M4O H;  1KLU D;  1Y69 U;  1ZKO A;  3FMC A;  3VR4 A;  1O80 A;  3V2T A;  1TWG H;  2JA7 B;  1AH9 A;  2O5I C;  2WAQ G;  2E2J B;  1XNR Q;  1WTV A;  1EFI D;  4ULL A;  5HUR A;  2N55 A;  1W6J A;  2RHS B;  1I3Q B;  3UI2 A;  4K2K A;  1E1O A;  3MAQ A;  1KXL A;  3CME A;  1IBL Q;  1B3Q A;  1KDB A;  2WAQ E;  4DA2 A;  3M7N A;  2EPB A;  2JA5 G;  1STA A;  2L5T A;  2B2T C;  1STB A;  5FJ8 H;  4N9T A;  3NSW A;  1PXU A;  3H0G B;  4X3K A;  2VL6 A;  4KLK A;  4NKL A;  1NR4 A;  2RKS A;  5C5M A;  3VYT A;  4BBR H;  3JAM i;  2BOS A;  2EJF C;  2O2L D;  4KJN A;  1N33 Q;  2EY6 A;  4LJZ C;  1QWY A;  3E9I A;  3LX0 A;  1A6X A;  1TQO A;  2A8V A;  5IYB H;  1R4Q B;  2CQO A;  4DPG A;  4ZUJ A;  2K5Q A;  1S3O A;  4BY1 H;  3HRZ C;  1EU4 A;  1QNU A;  3I8Z A;  2NVX H;  5COR A;  3M85 A;  1Q3L A;  4U67 3;  3S16 H;  2UXB L;  4OWT B;  3HOU H;  1QCB D;  3FEW X;  4RWS C;  3GTL H;  4KHV A;  3LNN A;  5E7N A;  4LWC A;  1PH2 A;  1PV4 A;  5LL6 S;  1EIG A;  1KAA A;  4A93 H;  1RD9 D;  1YHQ A;  4R4Q A;  1D6E C;  2CFM A;  1S5D D;  1ENA A;  2RCF A;  3KLS X;  1IBM Q;  2XIW A;  3X3M A;  3HOW G;  3B6Y A;  2X69 A;  1NY4 A;  4Q5V A;  2ZXR A;  1AFP A;  2JA9 A;  4IFD G;  4DV2 Q;  3S2D B;  3A0J A;  3GTJ B;  3MXN A;  3D0F A;  2Y0S B;  4P2C B;  1XTD A;  5J39 A;  4LFC Q;  1EY0 A;  4RMF A;  5F2D A;  2RA4 A;  2R7Z G;  4FXD A;  4HN7 A;  3GTG H;  4HED A;  4FF3 A;  2WV6 D;  5KIX A;  3I91 A;  4XQJ A;  4YCV A;  3K5M A;  1D5Z C;  3TEH B;  1RL2 A;  1OXX K;  4L8J A;  1RKN A;  1I5F A;  2WAC A;  2L0C A;  1RHP A;  2F0H A;  2V1C C;  1EY4 A;  4LF4 Q;  2XN9 C;  1VQ8 A;  1SFO B;  3N52 A;  2UU9 Q;  3HOX B;  4DV7 L;  3UDF A;  4C3J B;  1PMR A;  2CW0 C;  1XJV A;  1PH8 A;  3J81 L;  1CI3 M;  3J7A 5;  3F2C A;  1B7Y B;  3IKJ A;  1SRO A;  5IYC G;  1SE2 A;  2F0N A;  5D65 A;  4A3D G;  2NVT H;  1J5E Q;  1PHJ A;  1WTW A;  4JBK A;  1O7I A;  4GKJ L;  3VR5 A;  2KCT A;  5EPK A;  4V0B A;  1D7Q A;  3FKI H;  5EJW A;  4PZ7 A;  3C1E A;  4FO2 A;  2PZW A;  1YEZ A;  3STB C;  1BCP F;  4TQU S;  5M3F B;  1QE6 A;  1NNX A;  4XT1 B;  4A3E B;  3GTK B;  1GUS A;  5GAH C;  2D9U A;  2ZXP A;  2H5X A;  1PRT C;  4A3F H;  4BWG B;  1W2B A;  4LF5 Q;  2D62 A;  1PTO C;  3PUY A;  2R3Z A;  1EY5 A;  3NE5 B;  2RSN A;  3KF6 A;  1EYA A;  3S17 B;  4JW0 A;  3PIP A;  1WTX A;  5CV8 A;  1TWA B;  1QOH A;  1UAP A;  1Y1W G;  3PUV A;  1EL0 A;  2Q2I A;  5T1G A;  4CKE A;  3F8T A;  2A5H A;  5JEA H;  3CD6 A;  5JJZ A;  4KHP L;  4TKO B;  5K36 H;  1K8M A;  2JA5 B;  3PF4 A;  5EBC A;  2O4X A;  4C2M B;  3GTQ H;  4DNT B;  3TP8 A;  2KCN A;  3I7F A;  1VQG A;  1SJH D;  4XQN A;  4K5W A;  1VQO A;  2NBF A;  1K3R A;  1SYC A;  2N49 A;  2R7D A;  2JA8 G;  4QMG A;  2K1B A;  2B63 G;  3NPP A;  1CM9 A;  2DY7 A;  1SRU A;  2CVR A;  2KEN A;  4ODG A;  1C7Y A;  2HCI A;  5C3W A;  1EY6 A;  2H1E A;  4RGM A;  2EYM A;  1WCM H;  2PQA A;  2D0O A;  3H3V C;  4CKB A;  2K7V A;  1YHB A;  4LNQ A;  5G3L F;  1JOR A;  3T4A C;  4JI2 L;  4BBS G;  4O0A A;  3RZD H;  3OOC A;  2F3V A;  3S1Q B;  4HSV A;  1CKO A;  1TWH H;  1GO3 E;  4X65 Q;  4DR5 Q;  2F0K A;  4DAM A;  1HZ9 A;  3PUX A;  2TSS A;  4G4K A;  1H9K A;  2BH2 A;  2DN8 A;  3CAM A;  4OX9 Q;  1L2F A;  4QIW E;  5ELE A;  4DUY L;  4CGY B;  1WD1 A;  1XXG A;  3DLL A;  1TWC H;  2KJX A;  3BDC A;  4B08 A;  4JPB W;  2BA0 A;  2F0S A;  4KHZ A;  4DV3 Q;  3GTO B;  1U9R A;  2I07 B;  1PYB A;  4X66 L;  1I4H A;  2DJG C;  4A3B G;  3S14 B;  2Q8T A;  1HXY D;  2Z1C A;  3G6E A;  5LMN Q;  3MEH A;  3QB3 A;  4OO1 I;  4YHH Q;  2M00 A;  1CHQ D;  2ZM6 L;  2IW3 A;  4A3J B;  1DOK A;  3GTM H;  4H44 C;  1FGB D;  1M1K C;  2CH4 W;  2KA7 A;  4JI7 L;  2OEO A;  4I7Z C;  4JYA L;  1DXM A;  3JAM L;  2JA5 H;  3TS2 A;  1YVC A;  1S40 A;  2A69 C;  2ZJQ A;  2N3S A;  4HID A;  4ME3 A;  4F87 A;  4G7H C;  5C3E G;  3FDT A;  1U5K A;  2UUC Q;  5T1I A;  2VB3 X;  4C3I G;  2ZT9 C;  1EOT A;  3RUZ A;  1EWC A;  1QUQ B;  5LMU L;  4LK1 C;  2RVL A;  3NXW A;  4NXN Q;  2UXC Q;  4NP5 A;  1N36 Q;  1HNZ Q;  2R6G A;  3PO3 B;  2CW0 D;  1EY7 A;  2NN6 I;  5JPM C;  1M4V A;  3MZ5 A;  4LUZ A;  1SNP A;  1MHW C;  4RGT A;  2FMM A;  5EBD A;  3D4D A;  3BZD B;  4JI6 L;  2A6H C;  3W3A A;  2OT2 A;  2CWA A;  1VMC A;  3G71 A;  4FVM A;  1U4L A;  1EIF A;  2MNA A;  4LFA Q;  2K6A A;  1STE A;  3DWQ A;  2BE5 C;  5IGB A;  2ZTC A;  5KYL A;  3HG9 A;  2RBM A;  1FYC A;  2Q8I B;  1VQ9 A;  2EYF A;  4DR1 L;  4JI5 L;  1UUP A;  4DUZ Q; 
#chains in the Genus database with same CATH homology
 5M5Y H;  1PH3 A;  2NZO A;  3STB D;  4DR3 Q;  2Q2U A;  1IL2 A;  3U4V A;  3HOW H;  1L1O C;  3S24 A;  3CP0 A;  4P75 A;  3CCJ A;  3RLF A;  2Q2T A;  2OWO A;  5IWA Q;  4X65 L;  1DGS A;  4IPH A;  4DR5 L;  4LF8 Q;  2K14 A;  3U58 A;  3K80 C;  4R4I A;  1LM0 A;  4GKJ Q;  4L5R C;  4JBM A;  4UY8 C;  4GOP A;  4DR7 L;  1EFW A;  2MO0 A;  4A3F G;  5GQO A;  3ER0 A;  1E22 A;  3F1Z A;  5AJ3 Q;  4PZ6 A;  2OTJ A;  1U0L A;  1CKN A;  5IP7 H;  5M5W H;  3ZJY C;  1LYL A;  1KC8 C;  4FDB A;  3CCQ A;  1XMQ L;  1SFO H;  4OXP A;  3HOX H;  4LF7 Q;  2R7Z H;  2PNH A;  4JOI A;  3T1Y L;  4IPC A;  4GNX C;  3FHW A;  4LF4 L;  5IP9 G;  4DR2 L;  4C3J H;  4H02 A;  3UDG A;  5DLQ E;  2UU9 L;  4A3L H;  4C3H H;  2HHH Q;  1GD7 A;  4NPS A;  3I4N H;  1YZ6 A;  1I94 Q;  4L5S A;  1NMG A;  4A3G G;  1KHI A;  3CCU A;  1PH7 A;  4B3R Q;  4R1J A;  1Y14 B;  4LUV A;  2VQE L;  2JA6 G;  4B3M L;  4K0K Q;  2EIF A;  4UP9 A;  4JG2 A;  1BVS A;  3S1N H;  2RF4 A;  5JEA G;  1JJC B;  3A5U A;  1JB7 A;  1ASZ A;  3G48 A;  4IJL A;  3K81 C;  5K36 G;  4YHH L;  3HOY G;  1Z47 A;  2E5L Q;  4UP7 A;  5HGQ A;  2XTI A;  3CCE A;  4GKK Q;  1M90 C;  1IZ6 A;  2A1A A;  1VQF A;  3EIV A;  4X62 Q;  4EX5 A;  3A5Z B;  5BR8 L;  1QZH A;  4JV5 Q;  1XMO L;  4R4T A;  1PVO A;  3I4O A;  5EAY A;  1VQM A;  1UE1 A;  1X56 A;  3S1M H;  2R93 G;  4GLV B;  2RCN A;  4P72 A;  5IYC H;  4KHP Q;  5M3F H;  4GLA C;  4B3S Q;  3RZO H;  4DV4 Q;  4DV5 Q;  2IT1 A;  4A3E H;  4B3T L;  1PH9 A;  2JEB I;  3T1H L;  3GTK H;  1T9H A;  3TS0 A;  3NEM A;  3HOZ H;  4A3D H;  4BA1 I;  1EOV A;  2Y0S E;  1VQC A;  5C44 G;  4LF9 L;  1HNW Q;  1VQ6 A;  4XIG S;  1E7Z A;  2WFW A;  2VS1 A;  3KJO A;  4GLX A;  2NVQ H;  5JJK A;  4HJ8 A;  1A62 A;  3CF5 A;  3BZK A;  2MO1 A;  3HOX G;  2JJQ A;  5C0X J;  3D31 A;  3KF6 B;  1VQP A;  4YY3 Q;  3CCS A;  1UE6 A;  1X6O A;  2ID0 A;  3HKS A;  4AYB G;  1PH6 A;  1IBK L;  1OTC A;  3UE1 A;  3S17 H;  3PIO A;  2UXC L;  1N36 L;  1VQJ A;  1X3F A;  4BY7 G;  1VQA A;  1NBW A;  3ERS X;  4A76 A;  1TWA H;  1WCM G;  1QVF A;  1SN8 A;  4JBW A;  1X55 A;  1BBU A;  2HT1 A;  2A19 A;  5IT9 c;  3NEN A;  5C0X I;  4AQY L;  3GO5 A;  1PH4 A;  5FLX c;  3S1R H;  4YWK A;  2C35 B;  2VUM H;  4DAY B;  3NEL A;  2VQF L;  1Q46 A;  3HOV G;  3H15 A;  4X64 L;  2YTY A;  3PUZ A;  3CW2 C;  1C9O A;  4NXM Q;  1HNX L;  1H95 A;  4AYB E;  4LFA L;  3W5O A;  2JA7 G;  3EBE A;  4C2M H;  1G6P A;  4DR4 Q;  1IXR A;  1JE5 A;  1XPR A;  1K73 C;  3DM3 A;  1VQ5 A;  4IPG A;  2WB1 G;  3VDY A;  4YCU A;  4XTC S;  2JE6 I;  1JT8 A;  1N34 Q;  4JI2 Q;  1NJI C;  3K7A H;  3U4Z A;  4POG A;  3I4M G;  1J6Q A;  1Y1W H;  1P16 A;  4JI4 L;  4DR3 L;  4Y52 H;  4AH6 A;  1Y1V H;  3M4O H;  2QA4 A;  2FXQ A;  4DV1 Q;  2Z0S A;  4A75 A;  4LF8 L;  2Z6K A;  5M3M G;  4HIO A;  1K83 H;  1Q7Y C;  1OXT A;  1TWG H;  4JI0 L;  1OXV A;  1AH9 A;  1WYD A;  2WAQ G;  1V1Q A;  4P74 A;  1XNR Q;  4GOP C;  3H0G G;  1X9N A;  4DUY Q;  4ALP A;  2UXD Q;  3CPF A;  3CMA A;  3PCO B;  3J7Z C;  1LUZ A;  3RLN A;  1I50 H;  2PI2 A;  2PQA B;  2B29 A;  4R4O A;  2RHS B;  2I5M X;  3J81 i;  3PF5 A;  1L1O B;  4WJ3 M;  1UWV A;  1SE8 A;  1FJG Q;  1XPO A;  1WI5 A;  3IRB A;  3NBH B;  4OON A;  1E1O A;  4PG3 A;  4X66 Q;  3CME A;  4DKA C;  3RN2 A;  2JA8 H;  1IBL Q;  1Q8K A;  1KXL A;  2B63 H;  2VZA A;  2WAQ E;  3M7N A;  2JA5 G;  1SMX A;  3CCM A;  3S1Q H;  1P8L A;  3OTO Q;  3JC6 6;  5FLM H;  4O2D A;  4HJA A;  3W1B A;  5FJ8 H;  2ZJR A;  2R92 G;  1JJ2 A;  3KDF A;  4DV0 L;  2XGT A;  2VL6 A;  4KLK A;  4BBR H;  3JAM i;  2PMZ E;  2N78 A;  2ZM6 Q;  3ULP A;  1EQR A;  3M3Y H;  1XNQ L;  3PO2 H;  1JMC A;  1N33 Q;  3HFZ B;  4GNX B;  4A3M H;  3E9I A;  5JJL A;  2AWO A;  1QVG A;  4JI7 Q;  2CCZ A;  1FGU A;  2KBN A;  3G4S A;  4JYA Q;  2A8V A;  5IYB H;  3FP9 A;  1TXY A;  2CQO A;  2QGQ A;  3UE0 A;  4BBS H;  4DPG A;  2QEX A;  4OX9 L;  4GS3 A;  3I56 A;  1S3O A;  3PUW A;  1HR0 Q;  4B3S L;  4BY1 H;  1K8A C;  1W3S A;  2NVX H;  4JI1 L;  1TWF H;  1G29 1;  1GVP A;  1L0W A;  3M85 A;  3GTO H;  3ULL A;  2UUA Q;  3S16 H;  4LF6 Q;  2UXB L;  4OWT B;  2LXK A;  3HOU H;  3CQZ H;  3S14 H;  2AKW B;  4DV3 L;  2CKZ B;  3U50 C;  2VW9 A;  2IY5 B;  3HKZ G;  2I5H A;  1CSP A;  4YWL A;  3GTL H;  4YCW A;  5LMU Q;  4A3C H;  5C4X H;  5IYD H;  1CUK A;  1I6H H;  5E7N A;  5LMN L;  2NVY H;  4LWC A;  1PH2 A;  4DV6 Q;  1PV4 A;  4A3K H;  1Q82 C;  4A3J H;  1QUQ A;  3CCL A;  4HIM A;  3RR5 A;  2Y0S G;  4A93 H;  3AQQ A;  1Q81 C;  3K8A A;  1YHQ A;  1B70 B;  1VQH A;  2CFM A;  4R4Q A;  1HZA A;  5FLM G;  4JI3 Q;  4OO1 G;  1CSQ A;  4QQB X;  5M5X H;  1Z9F A;  1IBM Q;  4A3B H;  3HOW G;  3KOJ A;  1KL9 A;  3B6Y A;  3BZC A;  3HKZ E;  1NY4 A;  3H3V I;  3L7Z C;  4LW1 A;  3W1G A;  4BXX H;  2HIV A;  2JA9 A;  3J80 c;  1PH5 A;  2UUB Q;  4IFD G;  1CKM A;  1KQS A;  4DV2 Q;  1V9P A;  2ZTE A;  4DR1 Q;  4JI5 Q;  1VQD A;  2AWN A;  3A0J A;  4MNO A;  4P71 A;  3K7U C;  4AIM A;  2GN5 A;  3D0F A;  2UUC L;  1XTD A;  5IP7 G;  1YJW A;  3RN5 A;  5C4J H;  4LFC Q;  2I5L X;  1YHA A;  1YIT A;  4RMF A;  2R7Z G;  3LGJ A;  1PFS A;  3M4P A;  2F4V Q;  3PO3 H;  4DNI A;  2Q2H A;  2K52 A;  4LFB L;  4A3I H;  2HQL A;  1GM5 A;  1B8A A;  2D0P A;  3GTG H;  1N9W A;  3CC2 A;  4NXN L;  3TRZ A;  3F2B A;  1HNZ L;  4A3L G;  3I4N G;  2OCE A;  4YCV A;  3AFQ A;  5JEA J;  3TEH B;  5C3E H;  2PI2 E;  1RL2 A;  1K9M C;  3K0X A;  3CC4 A;  1OXX K;  3AYH B;  2B3G A;  2Z6K C;  1I5F A;  1XNR L;  1VQB A;  4C3I H;  5H1S E;  1K8G A;  2JEA I;  2V1C C;  2UXD L;  4LF4 Q;  2NN6 G;  1VQ8 A;  3GDE A;  4DR2 Q;  4NB3 A;  2IHF A;  2UU9 Q;  1SLJ A;  4TVA B;  4DV7 L;  2E2H H;  3L2P A;  1FJG L;  2LSS A;  1HZC A;  1YJN A;  3UDF A;  1E1T A;  2VQE Q;  1X3G A;  4JCV E;  1IBL L;  4HJ9 A;  1XJV A;  1PH8 A;  3J7A 5;  3F2C A;  1B7Y B;  4DK6 C;  1SRO A;  2JK8 A;  5IYC G;  2F52 A;  4GN4 B;  1PYS B;  1BBW A;  1VQI A;  5M3F G;  4DUZ L;  3M4Q A;  5GAD C;  4UPA A;  4A3E G;  2YV5 A;  4GOP B;  1HZB A;  4L5T A;  1N8R C;  3HOZ G;  1EYG A;  2NVT H;  1J5E Q;  2WP8 J;  1PHJ A;  4A3D G;  5BR8 Q;  1AE2 A;  5IWA L;  1EQQ A;  1XMO Q;  2GVA A;  3EN2 A;  3L0O A;  5GAG C;  4JBK A;  4KI0 A;  1O7I A;  1CKN B;  4QJF A;  1YI2 A;  4GKJ L;  2KCT A;  1XPU A;  1PA6 A;  2MQH A;  3H3V H;  2L15 A;  1D7Q A;  4A3I G;  3FKI H;  5AJ3 L;  4PZ7 A;  1X65 A;  1D8L A;  1KRT A;  1YEZ A;  3SGI A;  4B3T Q;  4GN5 A;  3T1H Q;  1PH1 A;  4LF7 L;  3STB C;  4DR6 Q;  4L5Q A;  4TQU S;  1SR3 A;  2R7F A;  4LF6 L;  5GAH C;  1QZG A;  2HHH L;  2ASB A;  1NTG A;  2H5X A;  2BA1 A;  2LXJ A;  1I94 L;  2VUM G;  4A3F H;  1E3P A;  1S72 A;  4JI8 Q;  1W2B A;  1IBK Q;  2EXD A;  4B3R L;  4LF5 Q;  2D62 A;  3KFU A;  4K0K L;  2RHQ B;  2IX0 A;  3PUY A;  3BU2 A;  4IJH A;  2K5V A;  1HH2 P;  3KF6 A;  3MEF A;  4PZ8 A;  3TQY A;  5IP9 H;  2E5L L;  1FL0 A;  1YNX A;  2KHJ A;  3PIP A;  4AQY Q;  2YTV A;  4GKK L;  2K50 A;  3CCR A;  1AE3 A;  4X62 L;  4HJ7 A;  4JI3 L;  2BH8 A;  2VQF Q;  4JV5 L;  2DGY A;  1Q1E A;  3E0E A;  3E9H A;  3PUV A;  1Y1W G;  1KD1 C;  3ULJ A;  2Q2I A;  1IBM L;  3UDI A;  4P73 A;  1Y1V G;  2JA6 H;  3F8T A;  5JJI A;  4A4I A;  3A74 A;  1HNX Q;  4IO9 A;  2E2I H;  3CD6 A;  3CPW A;  4KHP L;  2I0Q A;  1IYJ B;  3HOY H;  2OQK A;  4DV2 L;  1V43 A;  4DV4 L;  4DV5 L;  3PF4 A;  3GTQ H;  4MTN A;  2YYZ A;  1HNW L;  1WOC A;  1HR0 W;  4JI4 Q;  2IHE A;  2ZJP A;  3I7F A;  1R9T H;  3PGZ A;  2N8N A;  4LFC L;  2IX1 A;  1VQG A;  3AFP A;  2F4V L;  5J3B A;  3M9B A;  1FVI A;  2E8G A;  2JQO A;  4YY3 L;  1ASY A;  2R93 H;  4WJ4 A;  3S2H H;  1C0A A;  4EQ5 A;  1A0I A;  4Y7N H;  1VQE A;  4DK3 C;  1VQO A;  1K3R A;  4QGU A;  1YIJ A;  2HIX A;  4JI0 Q;  4OWW B;  2N49 A;  5GRO A;  2R7D A;  3I55 A;  5C44 H;  2JA8 G;  2B63 G;  1E24 A;  1UE7 A;  4YWM A;  2K5H A;  1SRU A;  4JI6 Q;  5FJ8 G;  2KEN A;  1NE3 A;  4IOC A;  1C7Y A;  1MJC A;  3BJU A;  4BBR G;  4NXM L;  3KYH C;  5C0X G;  4HIK A;  5IY0 A;  1N32 Q;  3PO2 G;  2K4K A;  2YTX A;  4BY7 H;  1OXS C;  4A3M G;  1EUJ A;  1WCM H;  4DR4 L;  2PQA A;  2D0O A;  1YHB A;  1L1O A;  5ELN A;  4LNQ A;  2AMC B;  5IYB G;  1OXU A;  1N34 L;  1WFQ A;  4JI2 L;  4BBS G;  2ZTD A;  4O0A A;  3RZD H;  4BY1 G;  3UDX A;  4DV0 Q;  3HOV H;  1KIX A;  2KCM A;  1CKO A;  1TWH H;  1GO3 E;  2GVB A;  2ALY B;  1J5E L;  1MJE A;  1XNQ Q;  4OWX B;  3CXC A;  4X65 Q;  4PMW A;  4DV1 L;  4DR5 Q;  1K0R A;  2JA7 H;  4IPD A;  1KRS A;  1YJ9 A;  2E2J H;  2YU9 H;  3HOU G;  4DAM A;  1HZ9 A;  3PUX A;  4DR7 Q;  1Q12 A;  3OW2 A;  3J80 i;  4HJ5 A;  4X6A H;  3CCV A;  2BH2 A;  2MFI A;  4GNX A;  3CAM A;  4OX9 Q;  1QVC A;  4JBJ A;  3I4M H;  5IYD G;  4A3C G;  5C4X G;  1L2F A;  4QIW E;  1WJJ A;  1I3Q H;  4J15 A;  5IE8 A;  4DUY L;  3Q8D A;  4JI1 Q;  1XMQ Q;  4DR6 L;  3DLL A;  3T1Y Q;  2ATW A;  4A3K G;  4A3J G;  1TWC H;  3PV0 A;  2CWP A;  1EIY B;  2UXB Q;  5M3M H;  4A93 G;  2BA0 A;  4KHZ A;  4DV3 Q;  1KAW A;  4R4C A;  1VQL A;  1PYB A;  2OQ0 A;  4JI8 L;  4X66 L;  1Q1B A;  4QL5 A;  3KDF B;  4LUO A;  1GKH A;  4B3M Q;  4LF5 L;  1VQN A;  4A3B G;  3ICE A;  4IFD J;  4APV A;  3H0G H;  3G6E A;  1JJG A;  2K5N A;  5LMN Q;  4BXX G;  3OTO L;  4OO1 I;  1X3E A;  4IOA A;  1VQ7 A;  1YBY A;  4YHH Q;  1MIU A;  1VQK A;  2ZM6 L;  3GTP H;  3RLO A;  5LMN W;  3AEV A;  3GTM H;  1N33 L;  1G51 A;  1M1K C;  4IFD I;  4JI7 L;  4JYA L;  1BKB A;  2ES2 A;  2JA5 H;  1NMF A;  1YVC A;  3TRE A;  1S40 A;  4QY7 A;  3TS2 A;  3PO3 G;  2ZJQ A;  2N3S A;  4HID A;  1VS0 A;  2R92 H;  1HR0 L;  4ME3 A;  5ELO A;  1VQ4 A;  3I2Z A;  4GN3 B;  5C3E G;  1RIP A;  1U5K A;  4LF9 Q;  4MZ9 A;  2UUC Q;  2UUA L;  4RG1 A;  1A63 A;  1HJP A;  3J81 c;  3KJP A;  4POF A;  4LFB Q;  1QUQ B;  5LMU L;  3GD7 A;  3KF8 B;  4NXN Q;  2UXC Q;  2KHI A;  3OYY A;  1N36 Q;  2R6G A;  1HNZ Q;  1UE5 A;  2NN6 I;  5GAE C;  4DV6 L;  4A3G H;  2WB1 E;  3PSI A;  2AHO B;  4LUZ A;  1A8V A;  2VNU D;  3WWV A;  1UEB A;  2EQS A;  3JAM c;  4JI6 L;  2VY3 A;  2CWA A;  1EWI A;  2F3I A;  5HY6 A;  2DUD A;  3F2D A;  3G71 A;  2K75 A;  2OTL A;  4X64 Q;  4DV7 Q;  4JC0 A;  1X54 A;  3J81 j;  1N32 L;  1EIF A;  1VCI A;  3KLW A;  2MNA A;  4LFA Q;  4JOI C;  2NZH A;  3MXN B;  3S2D H;  2UUB L;  3GTJ H;  2ZTC A;  3RNU A;  1Q86 C;  4BA2 I;  3CC7 A;  1VQ9 A;  4UP8 A;  3S15 H;  4DR1 L;  4JI5 L;  1LTL A;  3FKI G;  4DUZ Q;  1MKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...