4IPDA

Structure of the n-terminal domain of rpa70, e100r mutant
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2013-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ipdA00
1C7YA 3F2BA 4BBSH 3K7UC 2OTJA 4K0KL 1FL0A 1UEBA 5HY6A 4Y52H 2D0PA 2N8NA 1SLJA 3F2DA 4WJ4A 2D62A 5FLMG 4JV5Q 2BA0A 4YCVA 3PF4A 5C0XJ 4YY3Q 3CPWA 1K8AC 4AQYQ 2ID0A 1NTGA 4JBMA 3CCJA 2WB1G 1YVCA 3GTMH 1JJ2A 3VDYA 3MXNB 1VQPA 1K8GA 1VQ8A 4OX9L 4BBSG 4BA1I 2R6GA 4L5RC 4YHHQ 1QUQB 1JJGA 3S14H 3UDGA 1RIPA 2YTXA 4DR1Q 3IRBA 1G291 1GO3E 1S72A 3K81C 3HKZG 3CPFA 3E9IA 5J3BA 3S2DH 3CC2A 5IP7H 4LF7Q 1RL2A 3FP9A 2OWOA 1HNXL 1HR0L 1X3GA 1KRTA 3KF6B 1IBKL 3NELA 3HFZB 1EUJA 1X54A 4R4TA 2OCEA 3I4MH 4NXMQ 1KD1C 4LF4Q 1JJCB 1AH9A 3BJUA 2MO1A 4MTNA 3TREA 3H3VH 1EWIA 3E9HA 2NZOA 5C44H 1EOVA 2K52A 2IHEA 5M3FH 2HIXA 5LMNL 3T1HL 3M7NA 2K75A 1V9PA 5C0XI 2C35B 4BBRH 1XNQL 1P8LA 1PH5A 4P75A 1JE5A 1ASZA 1FJGL 1IZ6A 1VQDA 3S24A 1UE5A 5C44G 5JJIA 5M3FG 2BA1A 4QL5A 1D7QA 3AQQA 5ELNA 1MKHA 4LFAL 4B3RQ 4OWTB 4X6AH 5M3MH 4A4IA 4PMWA 4LF5Q 2N49A 1UE7A 4DV2L 2CQOA 4B3TL 4QIWE 4DV1Q 4JI0Q 1HNWL 2ATWA 1PH1A 3ERSX 4QGUA 1XNQQ 4BXXG 4JI2Q 1GVPA 2E8GA 2PI2E 1IXRA 2ZJPA 3KFUA 1I5FA 1DGSA 4DPGA 5C3EH 4R4CA 3UE0A 5M3MG 2VQEQ 2Q2HA 3A5ZB 4X66L 2AWNA 4A3MG 2WAQG 2QGQA 4LUVA 5JEAG 1KIXA 3HOWH 2NZHA 4JI3Q 2Q2IA 3KYHC 2Z6KA 2JA6H 2B29A 3BZCA 4X62Q 4DV4L 2R7FA 1Q8KA 2R7DA 4EX5A 4B3SL 2GVAA 4R4OA 3CCLA 4OO1G 3GDEA 1A8VA 4NXNQ 1VQMA 1YNXA 4P72A 1CSQA 3GTPH 2NVYH 3HOWG 3GTOH 1NE3A 3U4ZA 2JA6G 4A3CH 2K4KA 4OWXB 3RN5A 2JA8H 1L2FA 1XMOL 2B63H 4JOIC 2ZTEA 1BBUA 4A3BH 3OTOQ 5E7NA 4DV5L 2YV5A 1WOCA 1UWVA 3J80c 4JI8L 2UUBQ 3PUYA 4YWKA 1E22A 1Z9FA 3EN2A 4POGA 1GKHA 4P74A 4IOAA 1Y1VH 3F2CA 4R4IA 2R7ZH 2Q2UA 1VQEA 4B3MQ 4DR6Q 1PFSA 4A3LG 2B63G 1V43A 5K36G 5GADC 4GNXB 4UP8A 4DR3Q 3TRZA 3G6EA 1U0LA 3I4NH 2RHSB 1YZ6A 3KLWA 4UP9A 4JI8Q 4EQ5A 1J5EL 4BY1H 1PH4A 4KHPL 1Y1WH 3PV0A 1VQJA 1HNZQ 4GLAC 4H02A 4IO9A 3UDXA 3GTJH 1Y14B 1SFOH 2PQAA 1MIUA 4OWWB 1GD7A 3KJPA 4LFBQ 1E1TA 1I50H 2IT1A 1XTDA 5M5YH 4LF6Q 3BZKA 4JI7L 3M4OH 4IFDJ 4PG3A 1Q86C 1IBML 4JI5Q 2KENA 3L7ZC 2NVTH 3E0EA 4JI1Q 4A3IH 1KHIA 1WFQA 3M3YH 1N8RC 4GKJL 1N36Q 5BR8L 1X3FA 2I5HA 3J7ZC 3DLLA 2IX0A 1G51A 3D0FA 3CCMA 4DV3L 1QUQA 2BH8A 2KCMA 3PUXA 3NEMA 5C4XH 3S17H 3S2HH 3JC66 1YHBA 1XMQL 5GROA 4A3DH 1I3QH 4A3IG 2KBNA 1TWGH 1C9OA 3K8AA 1Q12A 1UE6A 4JOIA 1YHAA 4AIMA 2MQHA 1QVGA 4A3FH 1K83H 2DGYA 3A74A 2PNHA 2MNAA 4HJ9A 2XGTA 4GKJQ 1N32Q 1NBWA 1U5KA 2HIVA 2F52A 3KF6A 3CCVA 1E24A 2H5XA 1JT8A 5AJ3L 5C4XG 4X64Q 2A8VA 1B7YB 4A3DG 1PVOA 4IPHA 1K3RA 2CWAA 3I56A 1OXXK 2HHHQ 1N33L 4QQBX 1SMXA 1HZAA 1Z47A 3UDFA 4A3KH 5FJ8H 1VQ4A 1N34Q 3U50C 3PF5A 1JMCA 4IFDI 3GTQH 1VQKA 4HJ5A 2HT1A 1YJ9A 2N78A 4GLVB 4FDBA 1LUZA 4HJAA 1K0RA 2NN6G 4YCUA 3RLOA 4RG1A 1S40A 2E5LL 4K0KQ 3W1BA 4DK3C 5H1SE 4X65L 2D0OA 1M90C 2ASBA 3HOUH 2E2JH 3MEFA 3K0XA 4A3KG 3OW2A 4LF9L 1EYGA 4C3JH 4PZ8A 4GNXC 4HIMA 3T1YL 2CCZA 1YI2A 4DV7L 1K9MC 1PH2A 3AEVA 4LUOA 1TWFH 2JA5H 4OX9Q 2L15A 4GLXA 2E5LQ 1HZBA 4J15A 1PV4A 1X56A 4AH6A 2VZAA 4XIGS 4DR2L 1XJVA 2N3SA 1X6OA 1IBLL 2JE6I 5IP7G 1AE2A 2QEXA 1EIFA 2RF4A 4LF9Q 1VQFA 3TS2A 3HOVH 4DR7L 1CSPA 2VQFL 2OTLA 2R92H 4DV0L 1JB7A 1KAWA 1HNXQ 1HR0Q 1IBKQ 3I4MG 3ULPA 4P71A 1B8AA 3STBC 5JJLA 1W2BA 3I4OA 4JCVE 3H0GH 4L5QA 3FKIH 3H15A 2UXBL 3HOVG 1FVIA 4O2DA 1QZHA 2R92G 4A3JH 1YHQA 3PO3H 4DR7Q 5LMUL 5LMNQ 3T1HQ 4BBRG 3S1NH 5C4JH 1WI5A 2VL6A 3PIPA 4DV0Q 1NJIC 1SRUA 2BH2A 1K73C 1AE3A 2YTYA 3JAMi 1YIJA 3H0GG 1FJGQ 1CUKA 1VQBA 2WP8J 3HKSA 3A5UA 1PYBA 1H95A 3ULLA 3GTLH 4GOPC 4A3JG 1VQ5A 3PO3G 4LFAQ 4KI0A 3G48A 3HOXH 1HH2P 1L1OB 2VUMH 4KLKA 2JQOA 2UUCL 3L2PA 4DV2Q 1HZ9A 4UP7A 5GAEC 4B3TQ 1HNWQ 5HGQA 2GN5A 5C3EG 4GNXA 4L5TA 4IOCA 3PO2H 1VQCA 4BY7H 5C0XG 4DV6L 1XPOA 2KHJA 1OXSC 1VS0A 3HOXG 1VQAA 4QY7A 3CC7A 1X3EA 4X66Q 1WYDA 3PUWA 2NVQH 2ALYB 4DUYL 1B70B 1FGUA 1J6QA 3CMEA 1XPRA 4HJ7A 3F8TA 4DAYB 1IL2A 3PO2G 2K5NA 4JYAL 3PGZA 1A63A 1D8LA 1OXVA 2QA4A 3KDFA 4DV4Q 3AFPA 3PUZA 4B3SQ 1W3SA 2IHFA 1NMGA 2JEBI 4POFA 5IT9c 4DR4L 2JA8G 4A3CG 2UUAL 2AWOA 2R93H 4UPAA 4R1JA 3U4VA 4A3BG 3U58A 3RLFA 3UE1A 3A0JA 4OXPA 1XMOQ 1OXTA 4DV5Q 3BU2A 1WCMH 1Y1VG 1VQ7A 5JJKA 2UXCQ 2R7ZG 4C3HH 3TEHB 1OXUA 3CCQA 2UU9L 3D31A 1YJWA 5IYBH 4DR4Q 3FHWA 1PH8A 3GD7A 2PI2A 1VQGA 4DUZL 3KF8B 3W5OA 4GN3B 4C2MH 4JI4L 3I4NG 1XPUA 1WCMG 2WFWA 4BY1G 1E1OA 5IP9H 1Y1WG 1J5EQ 3DM3A 1KXLA 2A1AA 1SROA 4LFCL 2LXKA 3WWVA 2ZM6L 1OTCA 2F4VL 3CD6A 4KHPQ 4GS3A 4DNIA 1UE1A 3GO5A 4LF8L 3ZJYC 1YITA 4JBJA 1VQNA 3S15H 4DUZQ 3EBEA 4JI4Q 1EQQA 1L1OC 4JI6L 1Q46A 3AFQA 5IP9G 1PH3A 1MJCA 1Q82C 1WJJA 4JI7Q 1IBMQ 2JA7H 2VS1A 4QJFA 2ZM6Q 4HJ8A 3NENA 1BKBA 5BR8Q 4GOPB 4LF8Q 2DUDA 3PCOB 1PH9A 1Q1EA 4DV3Q 1PHJA 4OONA 4UY8C 1VCIA 1XMQQ 3B6YA 5ELOA 2JA7G 1LM0A 3CXCA 2Z0SA 3KOJA 4JC0A 4RMFA 4A3FG 1EIYB 2YTVA 3GTKH 3M4PA 4GN4B 3RZDH 3ULJA 3S1RH 1E3PA 2HQLA 4KHZA 4JV5L 3TS0A 4AYBE 4YY3L 3CCUA 4DK6C 2JA9A 5AJ3Q 1CKNB 5FLMH 1SN8A 4TVAB 2AHOB 3I2ZA 1L0WA 3STBD 1PH6A 1M1KC 1ASYA 2I0QA 4YWLA 4L5SA 1E7ZA 1V1QA 1N33Q 5FJ8G 5DLQE 5JEAJ 4DKAC 4YHHL 3NBHB 2A19A 2ZJRA 2WAQE 2YYZA 4R4QA 2UXCL 4LW1A 2EXDA 4DR1L 2AMCB 2ZTDA 2EQSA 2IY5B 5EAYA 3J80i 1N9WA 1P16A 5GAGC 3HOUG 1QVCA 4LUZA 3H3VI 1YEZA 3EIVA 4LF7L 4X65Q 5IWAL 3KJOA 1A0IA 3G71A 3W1GA 2I5MX 3T1YQ 3CCEA 2JA5G 2I5LX 4LF4L 4TQUS 4NXML 1L1OA 3CAMA 4O0AA 4DV7Q 4GKKL 1CKMA 2Z6KC 2K50A 3S1MH 3PIOA 4IFDG 4DR2Q 1TWAH 1T9HA 2CFMA 2JJQA 4Y7NH 1X9NA 1IBLQ 2VNUD 5IWAQ 4HIKA 2B3GA 1HZCA 3RN2A 1PA6A 1YBYA 2MO0A 3M85A 3PSIA 2VQFQ 2KCTA 4GKKQ 1EQRA 4HIDA 2ES2A 4B3RL 3FKIG 4LF5L 1I6HH 3HOZH 3CCRA 2UXDL 4JI0L 3J81c 4DV1L 4IJHA 1LTLA 5M5WH 4HIOA 4IPDA 1QVFA 3OYYA 4OO1I 2UXBQ 4JI2L 2OQ0A 3G4SA 5LMUQ 1VQ9A 2ZJQA 4BXXH 4YWMA 4IJLA 5M5XH 4LNQA 2K5VA 2VQEL 1G6PA 4MNOA 3HOZG 1IYJB 3UDIA 2EIFA 3CCSA 2CWPA 3CW2C 3CMAA 1VQOA 1Q7YC 1Q81C 2K14A 4JBKA 4C3IH 1BVSA 3L0OA 3GTGH 2LSSA 4JI3L 2VUMG 2UXDQ 4XTCS 5IYDH 4A3MH 2Y0SE 3LGJA 4LWCA 5IYCH 3ER0A 1O7IA 4AYBG 3I7FA 1HJPA 4PZ7A 4X62L 2UUCQ 3CC4A 3CF5A 2YU9H 4BA2I 3S16H 3M4QA 1TWCH 3F1ZA 4BY7G 3ICEA 4NXNL 4YCWA 2VY3A 5IYDG 3CQZH 4DV6Q 3CP0A 5IYCG 2E2IH 1KQSA 1MJEA 3HOYH 3RR5A 1VQLA 5IY0A 3OTOL 2FXQA 4A3EH 2AKWB 3TQYA 4DUYQ 2UUBL 1KL9A 1A62A 1PYSB 1BBWA 1KC8C 1C0AA 4WJ3M 1NMFA 2LXJA 2MFIA 3K7AH 4B3ML 4DR6L 4JYAQ 4MZ9A 2V1CC 1KRSA 2WB1E 1VQ6A 2NVXH 1X55A 2OQKA 3HOYG 3S1QH 2R93G 1CKOA 2JK8A 4A3LH 4A3EG 4DR3L 4IPGA 1GM5A 1S3OA 2UUAQ 4GOPA 4A76A 1QZGA 5GAHC 5FLXc 1EFWA 4APVA 1XNRL 3HKZE 1HNZL 4IPCA 1TWHH 4JBWA 2CKZB 4LFBL 5IYBG 3RLNA 4GN5A 2UU9Q 4ALPA 4LF6L 3M9BA 2RCNA 3SGIA 2IX1A 4ME3A 4DAMA 4DR5L 1R9TH 5IE8A 4NB3A 4JI5L 1Q1BA 2JEAI 4JI1L 1CKNA 1PH7A 1I94L 2F3IA 1XNRQ 1N36L 4P73A 2PMZE 3RZOH 2E2HH 2GVBA 4LFCQ 3J7A5 3K80C 1NY4A 2F4VQ 2Q2TA 1SR3A 3KDFB 1TXYA 2NN6I 4DR5Q 3PUVA 3Q8DA 3JAMc 3J81i 2ZTCA 1HR0W 4A3GH 1I94Q 3J81j 1N32L 4JI6Q 2Y0SG 3I55A 2RHQB 3RNUA 4A93H 4PZ6A 1VQHA 2K5HA 4X64L 5GQOA 4A75A 2HHHL 4A3GG 1VQIA 5LMNW 2VW9A 4JG2A 4AQYL 1X65A 1N34L 2KHIA 3AYHB 2XTIA 1SE8A 1YJNA 4A93G 4NPSA 2PQAB 1LYLA
chains in the Genus database with same CATH superfamily
1F2LA 4BBSH 4Y52H 1SLJA 2N55A 2E75C 2D62A 1PTOD 5FLMG 2BA0A 3PF4A 4JV5Q 4A3GB 5C0XJ 4YY3Q 2AQ2B 4KMUC 1NTGA 3MC0B 2Q8TA 2WB1G 4DK1A 2K05A 4MN3A 3MXNB 1NNXA 2R6GA 4YHHQ 4DAVA 3UDGA 3S14H 1RIPA 1D5ZC 1FGBD 1S72A 3EQLC 1SE4A 1LTGD 3HRZC 3MVVA 1Y8PB 3NWTA 5IP7H 1JCKB 5ISRA 4X3UA 3FP9A 3K5OA 1HNXL 1BOSA 1KRTA 4CKCA 3TZUA 1IBKL 1KD1C 2WKCA 2MO1A 1BCPD 1CHPD 3E9HA 4HMJA 1ESRA 2K04A 2HIXA 3T1HL 2XNAC 1O7LA 2C35B 1QE6A 1XNQL 1FJGL 1IZ6A 2EY2A 3F2UA 3NWSA 1UE5A 5C44G 3S1MB 5JJIA 4KTAA 1KDCA 1D7QA 3T16A 2PMZB 1S5CD 5DNFA 3IAYA 2CQOA 2ATWA 1X3QA 3I90A 2PI2E 4JI2Q 4CKEA 1IXRA 4G4KA 3BVMA 1CQFA 5M3FB 1JR0D 2Q2HA 4X66L 5ELEA 2QGQA 1CZWA 2JA6H 2O5IC 2B29A 1G8ZD 5HGTA 1LV9A 1NAPA 3A8IE 5M3MB 3CCLA 4OO1G 2Z1CA 4C3IB 4NXNQ 1YNXA 1NE3A 4A3CH 3RN5A 1PYWD 4RGMA 2RKSA 1BBUA 1D5XC 2SEBD 3G6JB 4CDEC 4DV5L 2NYZD 3QJYA 2F0IA 3U9OA 3J80c 2UUBQ 4DXGA 4POGA 5IT9E 1ET9A 1V43A 1LACA 5K36G 3G6EA 3C1FA 1QJOA 2RHSB 4XT1B 1J5EL 3KLWA 2G9HD 2NVYB 1PH4A 1B2TA 3PV0A 4GLAC 5C4ZA 4L8JA 3SHLA 3NXWA 1XTDA 4KY6A 4LF6Q 4IFDJ 1EYCA 4LMQD 2AUKA 5A35A 4JI1Q 3WOFA 3FRPB 3T53B 1N8RC 1TWHB 1X3FA 2I5HA 4K6DA 3J7ZC 1G91A 4DV3L 2KCMA 5C4XH 3NEMA 4ME5A 3JC66 4I7AA 1VDZA 4A3IG 3K8AA 1Q12A 1Y8NB 3I70A 1YHAA 5CORA 4AIMA 1QVGA 2DGYA 3A74A 2PNHA 2MNAA 1HXYD 3J80L 1MD2D 2F52A 2H4OA 5AJ3L 3M4OB 3R93A 4IPHA 2NVTB 3M3YB 1RJTA 2KQ3A 2QF7A 1R4QB 3GTQH 4KK7A 2DY8A 3K5MA 4GLVB 3RLOA 2E5LL 4OIKA 1Y8OB 1HUMA 4A3DB 4X65L 1I3QB 1I4HA 3MEFA 3A7LA 3OW2A 4LF9L 1JOOA 2F0VA 4A3FB 1K0SA 4PZ8A 2CCZA 1YI2A 5E1FA 2JA5H 1X56A 1PDQA 1PFBA 2K32A 1XJVA 2JE6I 1AE2A 2QEXA 4PNYA 4A3KB 1TKWB 4DR7L 3OIPA 2M00A 1JB7A 1CA6A 1KAWA 3I4MG 1SYDA 1BUVT 2E2JB 3I4OA 4XQJA 5JAVA 3HOVG 2R92G 4A3JH 3I72A 4KJNA 1NJIC 3VR3A 1YIJA 2ZXRA 2VB3X 2WP8J 3A5UA 1H95A 2AQ3B 3A8KE 2EYMA 3DUZA 1CQVA 2VUMH 4KLKA 2JQOA 2IL8A 4ODGA 1HZ9A 1VMPA 1HNWQ 5HGQA 3MAQA 2WKDA 3K58A 3ND9A 4L5TA 4IOCA 4BY7H 2F0NA 1OXSC 4MHEA 1RTNA 3HOXG 1WYDA 1UNSA 1FGUA 4N9TA 5EKKA 3F8TA 4DAYB 3M4YA 1BXTA 1D8LA 1OXVA 3TSSA 3KDFA 1IL8A 1W3SA 3DHQA 5JVG3 2EJGC 2IHFA 5C5LA 1NMGA 2JEBI 2SOBA 4POFA 2JA8G 4A3BG 3Q23A 3RLFA 2RA4A 3UE1A 1TT2A 3PO2B 1WCMH 3PQIA 5JJKA 2BE5D 1ZYRD 2UXCQ 4ZRZA 1GUWA 3CCQA 4E6IA 1YJWA 4DNRB 1VQGA 3NQTA 3J81L 4DUZL 4RGNA 2EY5A 4C2MH 1STBA 4JI4L 5J39A 1GUOA 2CQAA 1TS4A 4BY1G 1E1OA 1BR9A 3W2DA 2CH4A 2LXKA 1OTCA 2ZM6L 4KHPQ 3VA5A 3GO5A 1ZXTA 4LF8L 3MXNA 2PW7A 1VQNA 3QR8A 1W6KA 5T1GA 1AP0A 1L1OC 1Q46A 4O1NA 1MJCA 2IPKD 5DM73 2F0PA 1BF4A 5EKIA 1EY7A 2VS1A 3NSWA 4QJFA 4HJ8A 1H9SA 2PQEA 4KN7C 4G7HC 1JQYD 1IKMA 3R3OA 3B6YA 3OIQA 4HR7B 2Z4IA 2JA7G 3KOJA 3OMGA 1O7YA 4KY7A 4FXDA 4YIJA 3RZDH 3ULJA 4JV5L 4YY3L 4DK6C 1PFNA 1PH6A 1ASYA 1E7ZA 5FJ8G 5DLQE 4YHHL 2ZJRA 2JSOA 2WAQE 2YYZA 2KCCA 2QEJC 2EQSA 2EXZA 1TS2A 1STNA 1BQQT 5FO7B 3H3VI 3VR5A 5IWAL 3KJOA 3G71A 1EQVA 2M9VA 3NPPA 4XYQA 2K50A 2WACA 2DNEA 4Y7NH 1K3BC 1SYFA 2JA5B 2E76C 2C9OA 1FR3A 4DN4M 3IKJA 2ES2A 5IODA 1E2VA 1I6HH 3CCRA 4IJHA 5M5WH 4JI2L 5I6WA 5LMUQ 2I07B 1VQ9A 4IJLA 1G6PA 1TWAB 3FDTA 4RFBA 2CWPA 4XT3B 3CMAA 1ET6A 1Q81C 3NTKA 4R8NA 4JBKA 1BVSA 3I3CA 2XRSD 4NKLA 4XTCS 5D65A 4A3MH 3NK9A 3I7FA 2UUCQ 1SJHD 5TSSA 3VYRA 1I4QA 3HOZB 3F1ZA 3KF8A 4NXNL 5E4XA 5I4DA 3UI2A 3CQZH 2JP1A 5IYCG 2VUMB 2E2IH 1MJEA 1EZ8A 2F0SA 4Q5VA 2RVLA 5M5XB 4DFAA 4A3EH 2WINB 2F0MA 4DUYQ 1F2YA 2UUBL 1A62A 2QKIC 5EPKA 1WTOA 2LXJA 4BY7B 2KECA 3ND8A 1ENFA 1MSHA 3K7AH 3OW7A 3KBXA 1GJXA 3VYTA 2NVXH 1X55A 3Q24A 3QOJA 4DK0A 2R93G 4A3LH 2F0UA 2YU9B 1QOHA 1S3OA 4RKBA 2CW0D 4NP5A 2Z4HA 5FLXc 3DEPA 4APVA 1XNRL 3HKZE 4KKUA 2KA7A 1NR2A 2BOSA 4TSSA 2TMPA 2CKZB 5IYBG 2UU9Q 1U4LA 4LF6L 3SGIA 2TSSA 4DAMA 4NB3A 5DEHA 1Q1BA 4JI1L 1PH7A 1STGA 1S5DD 2E2HH 5J1ZA 3ITPA 3IFTA 1SR3A 2AQ1B 3TP6A 1TXYA 1KNAA 3JAMc 1PZKD 3Q8DA 2F0JA 2ZTCA 4A3GH 2XIWA 1I94Q 1LO5D 5KNDA 3BDCA 3SVMA 2F0LA 2K6AA 4AQYL 1X65A 1B44D 1CI3M 1YJNA 3Q6SA 1LYLA 3F2BA 1FL0A 2PYKA 2N8NA 3CPWA 2ID0A 4JBMA 3VDYA 1VQPA 1K8GA 3CRKC 4BBSG 2B2YC 4A93B 4M8AA 5EJWA 4L5RC 2XSCA 2FINB 4EGVA 3IRBA 4I7ZC 3K81C 3HKZG 3FMCA 5J3BA 4LAAA 3CC2A 2J7ZA 3K59A 2OWOA 2A73B 1YNNC 2B2VA 2SNMA 5KIXA 1CA5A 3NELA 4R4TA 4K6LA 1JICA 2VXWA 1AH9A 2K7VA 4X3SA 3GTMB 1J9OA 4PMCA 1EOVA 2IHEA 5M3FH 3M7NA 2K75A 5C0XI 1HTPA 3WOEA 1VMCA 3SEBA 1JE5A 1ASZA 3S2DB 3H09A 4IN3A 4QL5A 2Z8LA 4IUNA 4B3RQ 4Y7NB 4OWTB 5M3MH 3MXPA 4LF5Q 3J7AF 2N49A 2RDGA 3HG9A 1U4MA 1HNWL 4QIWE 4DV1Q 1PH1A 5JEAH 1PMRA 3QB3A 4QGUA 1WTRA 2E8GA 4H7BA 4J8QA 4JVZA 3KFUA 1IW7C 1I5FA 1DGSA 4DPGA 4R4CA 3A5ZB 1SEBD 4WFN3 5E3FA 1CFMA 4LUVA 5CV4A 4JI3Q 3K57A 3BS1A 2Z6KA 2CH4W 1FNWA 1Q8KA 1B3QA 1KDAA 1I6VC 1XWEA 3A54A 2NVYH 4A3MB 1CZGA 4ZQ3A 1RHPA 2JA6G 4OWXB 4N9PA 4JOIC 2ZTEA 1FYCA 5E7NA 1A3TA 2LY7A 1WOCA 1EL0A 2D9UA 2UXCL 4JI8L 3EN2A 1Z9FA 1B53A 1GKHA 4P74A 4IUQA 1Y1VH 4FVMA 3F2CA 2EYFA 2R7ZH 3L3OC 1VQEA 5AFWA 3HOWB 4DR6Q 1PFSA 1TS3A 5KGUA 4NMZA 2QW7A 1E0BA 1U0LA 3I4NH 3KLSX 4ZUIA 4EQ5A 3GTPB 1PTOH 4FXGC 3GTOB 4KHPL 2NVXB 1VQJA 1PRTD 3BVZA 2B63B 2BDOA 2B2WA 1GD7A 3KJPA 2IT1A 2X6LA 5FKAC 4FXKC 3M4OH 4ZYSA 1Q86C 5CV8A 4JI5Q 2NVTH 3E0EA 1WFQA 5BN5A 3M3YH 1N36Q 3DLLA 3D0FA 2JXMB 1SAPA 1AN8A 3S17H 5T1IA 4BY1B 4A3DH 1I3QH 1TU2B 3GTJB 4A3FH 1SFOB 4GKJQ 3VR2A 1NBWA 1U5KA 2HIVA 3KF6A 3CCVA 1E24A 3H6MA 5C4XG 5KNCA 1HRJA 1B7YB 1PVOA 3I56A 2CWAA 3P7JA 1OXXK 1RDPD 4XQNA 4QQBX 1SMXA 2MP1A 4RHSA 1HZAA 1SYEA 1Z47A 4A3KH 4IFDI 1VQ4A 1KNEA 3U50C 3PF5A 1N34Q 1JMCA 2V4DA 3C46A 2GA4B 1LUZA 1HA6A 4L6TB 2NN6G 3X3MA 4K0KQ 5H1SE 2D0OA 1M90C 2ASBA 3HOUH 1TWGB 2E2JH 3K0XA 1EY5A 3A7AB 4C3JH 1H9SB 2E74C 3AEVA 4LUOA 3TN2A 3A55A 3V2TA 4PQXA 4XIGS 3SE0A 1EIFA 3RMHA 2ZXPA 2J4XA 2OTLA 4DV0L 4IUPA 1MBYA 3DEOA 1AZQA 3ULPA 1V8QA 4P71A 1STAA 3D6CA 3H15A 2RQXA 5LMUL 1DONA 4PV1C 4BBRG 1QCBD 2DY7A 4EQPA 1PTOC 2PO4A 1EYDA 1K73C 1AE3A 2YTYA 3MFGA 1U4RA 1VQBA 4A3JG 4B9WA 1HFGA 1WD0A 4HAEA 4LFAQ 4KI0A 3G48A 1ILQA 3T51B 2UUCL 3KLRA 4N8X1 3C3LA 1M8AA 1EY0A 3EJIA 1D2BA 2E2HB 3H0GB 5C3EG 4GNXA 4K14A 3PO2H 2KJXA 2OEOA 3EFXD 3K0YA 4KY5A 3PO3B 3LX0A 1G2TA 1VS0A 1VQAA 3S1NB 4QY7A 2PZWA 1X3EA 1K8OA 3PUWA 4DUYL 1B70B 3CMEA 5IGEA 1PTOF 4HJ7A 3BYYB 2F0DA 2MPMA 2K5NA 2HCCA 3WDNA 4ZKCB 3PGZA 3HS0C 3P1HA 4DV4Q 3PUZA 4B3SQ 2ENBA 1EIGA 4FF3A 4DR4L 1O78A 2AWOA 2Z9HA 4UPAA 3GP7A 1Q8IA 1U4PA 3J7YW 4OXPA 2CVRA 4ZUJA 1HFNA 4OL7A 1VQ7A 2E2DC 3TEHB 2UU9L 1NR4A 1TS5A 1F2MA 2PI2A 2B2TC 2IX3A 3KF8B 3W5OA 4GN3B 1WCMG 2IW3A 1Y1VB 1TVXA 2R7ZB 1Y1WG 1I4GA 3WWVA 4DA2A 5IIFA 3ZJYC 2EJMA 3DM1A 4JBJA 4IUVA 3I4NB 2EYJA 2A68C 5ELFA 4JI7Q 1S5FD 1PTOB 1WJJA 4C3HB 3TZDA 3R8BA 2WV6D 1IBMQ 3NENA 5BR8Q 5I2YA 3E3XA 4JPBW 3JAME 1PH9A 2A6HD 1RF2D 4Q0FA 1KLGD 5LHY1 4HCSA 1XMQQ 3CXCA 4RMFA 2PZUA 2K5QA 2YTVA 1E3PA 4AYBE 2K01A 3DMUA 3CCUA 2JA9A 3S17B 3OSOA 5FLMH 1SN8A 4TVAB 2AHOB 1L0WA 1Q3LA 3SDZA 1BCPB 4YWLA 2FHTA 3DWAA 5I6YA 4DKAC 3D4RA 2A19A 1SNQA 1KDBA 1II3A 2EXDA 1C48A 3GV6A 4ZK9B 5EAYA 1P16A 1QVCA 2PNRC 2F0HA 3GTKB 2XWJB 3KLSA 3S1RB 3W1GA 3ONAB 3T1YQ 2I5LX 4GKKL 3CAMA 4DV7Q 2P5ZX 5C6AA 4F87A 3AB9A 5JJZA 2Z6KC 1LTSD 3HOUB 4DR2Q 1TWAH 1IBLQ 4C3JB 4CBVA 1YBYA 2MO0A 3M85A 2KCTA 3EROA 2FMMA 1O7ZA 4B3RL 4GZYC 3FKIG 4LF5L 1G6ZA 3HOZH 2DJGC 2B2UA 4EQNA 2UXDL 3J81c 4DV1L 4HIOA 4IPDA 1X3PA 3OYYA 4OO1I 1AEXA 5L37A 1TR5A 2ZJQA 3NBIA 5M5XH 2A5HA 4G7ZC 4K8JA 3UDIA 3CW2C 3VYUA 3O13A 1Q7YC 2OF1A 2ICIA 4JI3L 2Y0SE 2XWBB 3LGJA 4LWCA 4AYBG 3CC4A 4PZ7A 4I65A 2YU9H 2B2WC 1DCZA 1LT4D 1WVLA 3ICEA 1MHWC 4YCWA 4OO1H 2VY3A 4R9WA 4DV6Q 3CP0A 3BDLA 1LT5D 3SXHA 5IOCA 4RGOS 1DOKA 2EY1A 2B8FA 2AKWB 3TQYA 4WJ3M 1KC8C 1D5MC 1ENCA 1KTKA 3GTGB 4DR6L 2L9HA 3S1QH 2JK8A 4A3EG 5K36H 3S16B 4IPGA 1TWCB 2F0TA 2RBMA 5GAHC 4FF2A 1GUGA 1QNUA 4IPCA 1SNCA 3HOYB 4JBWA 1H9KA 4UHVA 3M9BA 2RCNA 1SE3A 1LT6D 4ME3A 4XQQA 4IQZA 4DR5L 5G3LD 4JI5L 2JEAI 1DOMA 1N36L 2LFNA 2PMZE 4DNTB 3CHBD 4LFCQ 1NY4A 3SK6A 2F4VQ 1H9MA 1BDOA 2HD3A 2ICEC 4JI6Q 2Y0SG 4QB4A 3I55A 4A93H 4PZ6A 1SYGA 5A2QE 5GQOA 5CMDA 1R9TB 3GV3A 1ENAA 4A3GG 4QIWB 1N34L 1SNPA 1C7YA 1CK1A 5C3WA 4RA8A 4K0KL 1UEBA 3A8JE 5EGTA 2D0PA 3F2DA 5EKLA 2LKVA 1LT3D 4MIUA 3GTMH 1OO9B 2G9DA 4CJ2C 5ELCA 1RTOA 1ESFA 1JJ2A 5C3XA 1VQ8A 1TY2A 4K5WA 3IFDA 3Q0AA 1ZEQX 3SR1A 2K28A 2YTXA 1DM0B 4ULLA 3RUZA 1D1IA 3E9IA 3S2DH 1A2UA 2WB1B 3E0JA 1RL2A 3KF6B 4C56C 3HFZB 1VF5C 2OCEA 3I4MH 1VF7A 2F03A 1JJCB 3BJUA 1LTTD 3TREA 3H3VH 1V9PA 1WTXA 1VQDA 2ZXOA 3OOCA 1D6EC 5M3FG 1JWUD 4LFAL 3ZYYX 4RAUC 4A4IA 4PMWA 2PW5A 1UE7A 4B08A 4KKSA 3NE5B 3ERSX 1XNQQ 4BXXG 1GVPA 2ZJPA 5C44B 3UE0A 5M3MG 5CV5A 2L11A 4C3IG 3URYA 2AWNA 1W6JA 2WAQG 5JEAG 3HOWH 2NZHA 4XXEA 4K2LA 2PPBC 5D14A 1STHA 4DV4L 2R7DA 5IGDA 4B3SL 1J8IA 2F0KA 3GDEA 1A8VA 3GTPH 4P72A 5ELBA 3GTOH 4P2CB 2K4KA 4CHTB 2JA8H 2B63H 2A6ED 4A3BH 4K2KA 3OTOQ 1RODA 2YV5A 3J80E 1ILPA 4J6HA 4HCEA 1UWVA 2HUGA 3PUYA 2Q8IB 1E22A 2ZT9C 4IOAA 4TKOB 1A2TA 1QG7A 2IJ0A 2KOLA 1T5XD 4GNXB 4UP8A 4MTKA 3EA6A 4DR3Q 3TRZA 3CU7A 3NQIA 1EY8A 3RD4A 1BNZA 1B3AA 4DAPA 5K5PA 4DXFA 4ILWA 4BY1H 3S1QB 1RCVD 1F2ZA 4H02A 3UDXA 3GTJH 1Y14B 1SFOH 4LFBQ 1E1TA 3D6WA 1TIID 5M5YH 2K5DA 1WTQA 3BZKA 4JI7L 5COYA 4PG3A 1IYVA 4K5VA 1IBML 2KENA 3H3VC 5BR8L 4LK1C 1EU3A 1A3UA 2IX0A 1G51A 1FNVA 1QUQA 2H1EA 3PUXA 4DGZA 2I46A 1XMQL 1EY6A 1RD9D 4KV6A 2KBNA 1TWGH 1UE6A 2MQHA 3D3RA 1N32Q 1YNND 2XGTA 3QO2A 4U68A 2R61A 1NSNS 1ZKOA 4IUUA 4A3DG 2F0EA 5IT9L 4BS9A 1K3RA 1H9JA 1SYCA 2HHHQ 4OHJA 4A3IB 3OPOA 3UDFA 4RCOA 5FJ8H 1VQKA 4HJ5A 3C1EA 2HT1A 2N78A 4FDBA 1SYBA 3S2HB 2FFKB 2O5JC 3LWUA 4DK3C 2RCFA 2HCIA 4A3KG 2EVBA 2F3WA 1K83B 4HIMA 4CGYB 3T1YL 4V190 3I8ZA 4DV7L 3E5SA 1PH2A 3FPPA 4OX9Q 2L15A 4GLXA 1DYQA 1QNKA 2E5LQ 1HZBA 4J15A 3HP3A 2VZAA 4UAIA 1IW7D 4DR2L 2N3SA 1IBLL 1B50A 5BN4A 5IP7G 4LF9Q 4NDXA 3TS2A 3U9SA 1HR0Q 4FYDA 2RDHA 2QDBA 4K5XA 3STBC 1W2BA 4JCVE 3H0GH 4L5QA 2X6GA 1JWSD 1SMYD 1YHQA 1I4RA 3PO3H 2NB0A 4DR7Q 5LMNQ 1TWFB 3S1NH 4EVOA 4H44C 1A3VA 2VL6A 1XX8A 4WRDA 3I4MB 3ERQA 2QDLA 5JVH3 1CHQD 1H9RA 1CUKA 3HKSA 1PXUA 5BN3A 3J81E 3ULLA 3HOVB 5EBCA 3N6RA 5C0XH 2R92B 1V1OA 4RGTA 4DV2Q 1A15A 4B3TQ 4FF4A 1F9PA 3P20A 2RSNA 1M4VA 1VQCA 4DV6L 1GUTA 2KEEA 3CC7A 1R4PB 3P75A 1EWHA 1XPRA 1LTID 2A69C 3TMEA 2DNCA 3PO2G 1BO0A 3GTLB 1A63A 1ICWA 1E2WA 1SNOA 3AFPA 3HOXB 4C1NI 4A3CG 2R93H 4M1UB 2D2CC 4R1JA 4C1NK 1CM9A 2FMCA 5DAUA 1XMOQ 3A0JA 5J22A 3BDOA 3BU2A 1SSOA 5IGGA 1Q90A 4C3HH 2NVQB 1OXUA 1QB5D 2JA8B 5IYBH 4A3BB 3GD7A 5CV9A 2RSOA 3H94A 5IP9H 3DM3A 4LFCL 1SROA 2F4VL 2LS01 4GS3A 2RDFA 4HMIA 2F0FA 4DUZQ 4JI4Q 5M9OA 1EQQA 2M2LA 5LL6S 3AFQA 3FEWX 4JI6L 1B4OA 1JWMD 3MFYA 2ZM6Q 4IZ8A 1L0XB 4LF8Q 5M5YB 3D4WA 1PHJA 1VCIA 2C5CA 1WD1A 1G2SA 3SK5A 3GTKH 3M4PA 4QUCA 3S1RH 2HQLA 4KHZA 3S15B 3D8GA 1S4ZA 1WTVA 2Z6BA 3I2ZA 4G57A 1M1KC 4G7OC 1PRTC 1HQRD 1V1QA 1N33Q 2JA7B 1LTBD 5JEAJ 3MWYW 4HSPA 5KYLA 3NTHA 4LW1A 1Z6HA 2AMCB 2ZTDA 1YNJC 2CHBD 4F88A 3J80i 1N9WA 1JORA 1JOKA 4LUZA 3EIVA 1XYIA 4IFDH 2F1MA 3CCEA 2JA5G 2BH2A 4TQUS 1L1OA 4O0AA 2HQEA 1CKMA 5I9PA 3PIOA 1T9HA 2CFMA 2JJQA 1BBXC 1PRTF 3MXGA 5IWAQ 4HIKA 1HZCA 1E2ZA 1PA6A 3PSIA 2VQFQ 1LABA 4HIDA 1DD2A 2QILA 4ABNA 1CTMA 5A2QL 1QVFA 3X3NA 1LTLA 2UXBQ 2L1BA 4RWSC 4YWMA 4LNQA 2DN8A 1MI2A 4MNOA 3HOZG 1IYJB 2BCOA 1GUNA 2G5DA 3QOLA 3K6OA 2K14A 4OELB 3L0OA 3GTGH 1HTLD 2LSSA 2VUMG 4QCLA 5I2XA 5IYDH 1AFPA 1B9MA 1O7IA 3CF5A 1BCPC 3CRLC 3S16H 3M4QA 1TWCH 4V0BA 4BY7G 2EJFC 3QG1A 4BWGB 5EPJA 4ZAIA 1SNMA 4XYOA 3HOYH 5JOBA 3W3AA 5IY0A 3OTOL 1PRTB 2FXQA 3R2TA 3QWNA 1KL9A 1I4XA 1BBWA 4PMBA 4FF1A 1NMFA 4KD4A 3T56B 4JYAQ 2A68D 4MZ9A 2V1CC 1KRSA 2WAQB 4XDXA 1CKOA 4X3TA 5IGFA 4DR3L 2UUAQ 1C4QA 1BCPF 4GOPA 3PIP3 5FLXE 4UDUC 2K33A 1LLRD 1EEFD 4F8MA 5D3DA 4RKLA 2R93B 4LFBL 3RLNA 1U9RA 3NTIA 1STEA 2IX1A 2F4IA 1R9TH 5IE8A 2K03A 1I94L 1CKNA 1XNRQ 2F3IA 2VB2X 1HUNA 4P73A 3RZOH 3H91A 2GVBA 3J7A5 3NBHA 1F77A 2OXPA 2Q2TA 2B2VC 1EZ6A 3MEHA 2NN6I 3PUVA 3J81i 1HR0W 3J81j 1N32L 1NCVA 5D3IB 1IYUA 1VQHA 1UEAB 4A75A 2HHHL 2D5DA 1VQIA 5LMNW 2VW9A 1EOTA 3KK7A 1EU4A 5I9OA 4A93G 4NPSA 2F3VA 3K7UC 1B1ZA 2HDMA 2OTJA 5HY6A 2XRQD 2NN6H 4WJ4A 5NUCA 4YCVA 1K8AC 4AQYQ 5C5MA 3CCJA 1YVCA 1PFMA 4KHVA 1T5EA 3V96A 4OX9L 5DM63 4BA1I 3KUPA 3BYTB 1QUQB 1JJGA 3MZ5A 1XXGA 4IALA 3K5LA 2O4XA 1WTWA 4CKBA 4DR1Q 1DZ1A 2NBFA 1G291 1GO3E 3CPFA 4LF7Q 1HR0L 4BBSB 1X3GA 1GXDC 1EUJA 2F0GA 2A74C 1X54A 2A6HC 4QUFA 1EQTA 4LF4Q 4NXMQ 4MTNA 2WIIB 3HKZB 1EWIA 1SNDA 2NZOA 5C44H 5EPLA 2K52A 5F2DA 1STYA 5LMNL 2L5TA 4O42A 4BBRH 3S14B 1P8LA 1PH5A 4P75A 2HDLA 1SXTA 3S24A 2F0WA 3DWQA 4H13C 1PLFA 2BA1A 3AQQA 5CR3A 5ELNA 1MKHA 4X6AH 5ELDA 1V1PA 4OGQC 3L9AX 1EFID 4DV2L 4B3TL 4JI0Q 4U673 2X69A 4RCNA 2EYOA 2KEDA 4F7XA 5C3EH 3MA2B 2B2YA 2VQEQ 5KNBA 1NUCA 3KBGA 4A3MG 1KIXA 3R2IA 2MGSA 3TP7A 2Q2IA 3KYHC 4RHRA 3BZCA 4X62Q 3QIAA 2R7FA 4EX5A 2GVAA 2EOTA 4R4OA 2K1BA 2XVSA 2EDGA 1VQMA 1TY0A 1CSQA 1I4PA 3HOWG 1K28A 3C2PA 3U4ZA 2MHVA 2F0OA 1L2FA 1XMOL 3NUCA 4YWKA 2QCPX 4IUTA 4R4IA 4S3SA 2Q2UA 4B3MQ 1CT1D 4A3LG 2B63G 2JA6B 5E4WC 5GADC 1GOZA 1JC7A 4WJWA 1YZ6A 4UP9A 4JI8Q 4RH6A 5JPNC 1Y1WH 1GHKA 3T4AC 2EPBA 1HNZQ 4IO9A 4OWWB 2PQAA 1MIUA 2PZTA 1I50H 5KEEA 3IL8A 4QMGA 1Y69U 1RKNA 1SBBB 3I91A 5CBAE 3L7ZC 2J0TD 4A3IH 1KHIA 2L4NA 4GKJL 1F9RA 2L12A 3E6ZX 3CCMA 2JYOA 2BH8A 3S2HH 1YHBA 2BE5C 1ZYRC 5GROA 3N52A 1HPCA 4KN4C 1C9OA 4JOIA 3RZOB 1K83H 4HJ9A 1EY4A 1JT8A 2H5XA 1MGSA 4X64Q 2A8VA 2B39A 3VR4A 1JB3A 5HURA 5FK9C 1N33L 2L55A 3CKIB 2KUMA 1YJ9A 3LWEA 3OMCA 4HJAA 1K0RA 1S40A 4YCUA 5C4XB 4RG1A 3HZXA 3W1BA 2AUJD 1EYGA 4GNXC 1HQMC 1K9MC 1TWFH 2MUYA 3OHXC 1IKLA 1PV4A 4AH6A 5CBEE 1JE4A 1X6OA 2RF4A 1Z7TA 4CJ1B 1VQFA 3GTQB 3GQBA 3HOVH 1CSPA 4L63B 2VQFL 1SE2A 2MJ8A 2R92H 4HTHA 1HNXQ 1IBKQ 5JPMC 5C4HA 2KVMA 5G3LF 1B8AA 3AU7A 5JJLA 1O80A 1XTCD 3NP8A 3FKIH 2UXBL 5KRUA 1FVIA 4O2DA 2O2LD 4FP5D 1QZHA 4EQOA 3T1HQ 5C4JH 1WI5A 4DV0Q 3PIPA 2SNSA 3MTSA 1SRUA 3JAMi 3H0GG 1FJGQ 4ZKBB 1QILA 4KJOA 1PYBA 3GTLH 4GOPC 1VQ5A 3PO3G 4CDCC 1EEID 3HOXH 1HH2P 1L1OB 4BBRB 3L2PA 4FNFA 4ID6A 4UP7A 5GAEC 4JK1C 1JOQA 2GN5A 2XN9C 5C0XG 1WTHA 3EVQA 2KHJA 4A3JB 1XPOA 2PCFB 1UUPA 1HA5A 4X66Q 3PIO3 2NVQH 2ALYB 3MXUA 1J6QA 3DXJC 1IL2A 5C3EB 4JYAL 4H0LC 3G7LA 3S9WA 2QA4A 2EYLA 2EZVA 1ICFB 4OIJA 1AZPA 2EE1A 1QWYA 1F9QA 3BG3A 5IT9c 2UUAL 3U4VA 2BDNA 1K8MA 1KLUD 3FVQA 4QF4A 3U58A 1OXTA 1DJRD 1EY9A 3D4DA 4DV5Q 3PMFA 1PZJD 2KHSA 1Y1VG 2R7ZG 2B8GA 1B9NA 4R8IA 3D31A 2Q8RE 4B9XA 5FOBB 3HEJA 3FHWA 3OWEB 1PH8A 4DR4Q 1X32A 4K8IA 3I4NG 1ML0D 2JN4A 1XPUA 2WFWA 1MSGA 4C3HG 1HCZA 4IURA 1J5EQ 1KXLA 3T13A 2A1AA 3CD6A 4DNIA 1UE1A 1YITA 4CDDC 3S15H 3EBEA 1WCMB 5FO8B 1PH3A 5IP9G 1Q82C 1Y1WB 3VYSA 5FO9B 2JA7H 2A6EC 3AMUA 1BKBA 4GOPB 2NTSA 1I50B 2CW0C 4C2MB 2DUDA 1KAAA 3PCOB 1Q1EA 4DV3Q 4OONA 4LJZC 4UY8C 5IGCA 4CJ0B 5ELOA 4KD3A 1LM0A 2Z0SA 4JC0A 4A3FG 1EIYB 4TRDA 1FD7D 4GN4B 2B2UC 4Z9CB 1SJED 5EQ0A 3TS0A 5AJ3Q 1CKNB 4HN7A 1EWCA 3STBD 2EYHA 2I0QA 4L5SA 2SDFA 2B2TA 3NBHB 4R4QA 5FLXL 4DR1L 2LMCB 2IY5B 3FPUB 1IHZA 1S5ED 5GAGC 3HOUG 1YEZA 4LF7L 4X65Q 4C3JG 1A0IA 3RZDB 1GUSA 2N88A 3M7GA 2I5MX 4NXML 4LF4L 3S1MH 2R3ZA 3TDQA 4IFDG 1X9NA 3NHHA 2VNUD 1KABA 2B3GA 3RN2A 5CV7A 3JAML 1LTRD 2NUCA 2F0QA 2K5WA 1AW7A 1WTPA 4GKKQ 3A56A 4X3KA 4DF7A 1EQRA 5LL6X 2A69D 4DAYA 2KCNA 1SDFA 4JI0L 3OWFA 3LNNA 2OQ0A 2L0CA 3G4SA 1EYAA 4BXXH 4KKTA 2K5VA 2VQEL 3VA7A 3FKIB 2EIFA 3CCSA 4ZLTF 1VQOA 4C3IH 2UXDQ 1TQOA 3BVGA 5C4JB 5IYCH 3ER0A 1HHVA 4X62L 1HJPA 5CYUA 4BA2I 1I6HB 1S5BD 3K5NA 1ONLA 5CV6A 4HSVA 5M5WB 5IYDG 5IGBA 1F9SA 4WORA 1EIHA 1KQSA 1LTAD 3RR5A 4AYBB 1VQLA 4J1MA 5KYIA 1A6XA 1C0AA 1FNUA 1PYSB 3BZDB 1SMYC 1V1PB 2MFIA 3SK8A 3TP5A 1DOLA 3MHBA 4B3ML 3J7AV 2WB1E 1VQ6A 3HOYG 2OQKA 1GM5A 1D1KA 3I4LA 4A76A 1QZGA 1EFWA 3DWPA 3CQZB 1HNZL 2E2IB 3I73A 2NWGA 1DXMA 1TWHH 3Q22A 2OT2A 3SK4A 4GN5A 4A3EB 4ALPA 1GHJA 4JW0A 3TBIB 3K7AB 2NZ1D 2FJ2A 2EY6A 3VR6A 2IWHA 3K80C 1PZID 3V05A 4HEDA 1YNJD 3KDFB 4DR5Q 1L0YB 4OEMB 5CC4A 3TP8A 4N8FA 1UAPA 4FO2A 1C8CA 2RHQB 3RNUA 2NTTA 4X64L 2K5HA 4NW2A 4ZCKA 2DJFC 2EYPA 4JG2A 5EBDA 5CGKA 2KHIA 3AYHB 2XTIA 3HGBA 2Y0SB 1SE8A 4DU9A 4CDFC 2PQAB
chains in the Genus database with same CATH topology
1C7YA 3F2BA 4BBSH 3K7UC 2OTJA 4K0KL 1FL0A 1UEBA 5HY6A 4Y52H 2D0PA 2N8NA 1SLJA 3F2DA 4WJ4A 2D62A 5FLMG 4JV5Q 2BA0A 4YCVA 3PF4A 5C0XJ 4YY3Q 3CPWA 1K8AC 4AQYQ 2ID0A 1NTGA 4JBMA 3CCJA 2WB1G 1YVCA 3GTMH 1JJ2A 3VDYA 3MXNB 1VQPA 1K8GA 1VQ8A 4OX9L 4BBSG 4BA1I 2R6GA 4L5RC 4YHHQ 1QUQB 1JJGA 3S14H 3UDGA 1RIPA 2YTXA 4DR1Q 3IRBA 1G291 1GO3E 1S72A 3K81C 3HKZG 3CPFA 3E9IA 5J3BA 3S2DH 3CC2A 5IP7H 4LF7Q 1RL2A 3FP9A 2OWOA 1HNXL 1HR0L 1X3GA 1KRTA 3KF6B 1IBKL 3NELA 3HFZB 1EUJA 1X54A 4R4TA 2OCEA 3I4MH 4NXMQ 1KD1C 4LF4Q 1JJCB 1AH9A 3BJUA 2MO1A 4MTNA 3TREA 3H3VH 1EWIA 3E9HA 2NZOA 5C44H 1EOVA 2K52A 2IHEA 5M3FH 2HIXA 5LMNL 3T1HL 3M7NA 2K75A 1V9PA 5C0XI 2C35B 4BBRH 1XNQL 1P8LA 1PH5A 4P75A 1JE5A 1ASZA 1FJGL 1IZ6A 1VQDA 3S24A 1UE5A 5C44G 5JJIA 5M3FG 2BA1A 4QL5A 1D7QA 3AQQA 5ELNA 1MKHA 4LFAL 4B3RQ 4OWTB 4X6AH 5M3MH 4A4IA 4PMWA 4LF5Q 2N49A 1UE7A 4DV2L 2CQOA 4B3TL 4QIWE 4DV1Q 4JI0Q 1HNWL 2ATWA 1PH1A 3ERSX 4QGUA 1XNQQ 4BXXG 4JI2Q 1GVPA 2E8GA 2PI2E 1IXRA 2ZJPA 3KFUA 1I5FA 1DGSA 4DPGA 5C3EH 4R4CA 3UE0A 5M3MG 2VQEQ 2Q2HA 3A5ZB 4X66L 2AWNA 4A3MG 2WAQG 2QGQA 4LUVA 5JEAG 1KIXA 3HOWH 2NZHA 4JI3Q 2Q2IA 3KYHC 2Z6KA 2JA6H 2B29A 3BZCA 4X62Q 4DV4L 2R7FA 1Q8KA 2R7DA 4EX5A 4B3SL 2GVAA 4R4OA 3CCLA 4OO1G 3GDEA 1A8VA 4NXNQ 1VQMA 1YNXA 4P72A 1CSQA 3GTPH 2NVYH 3HOWG 3GTOH 1NE3A 3U4ZA 2JA6G 4A3CH 2K4KA 4OWXB 3RN5A 2JA8H 1L2FA 1XMOL 2B63H 4JOIC 2ZTEA 1BBUA 4A3BH 3OTOQ 5E7NA 4DV5L 2YV5A 1WOCA 1UWVA 3J80c 4JI8L 2UUBQ 3PUYA 4YWKA 1E22A 1Z9FA 3EN2A 4POGA 1GKHA 4P74A 4IOAA 1Y1VH 3F2CA 4R4IA 2R7ZH 2Q2UA 1VQEA 4B3MQ 4DR6Q 1PFSA 4A3LG 2B63G 1V43A 5K36G 5GADC 4GNXB 4UP8A 4DR3Q 3TRZA 3G6EA 1U0LA 3I4NH 2RHSB 1YZ6A 3KLWA 4UP9A 4JI8Q 4EQ5A 1J5EL 4BY1H 1PH4A 4KHPL 1Y1WH 3PV0A 1VQJA 1HNZQ 4GLAC 4H02A 4IO9A 3UDXA 3GTJH 1Y14B 1SFOH 2PQAA 1MIUA 4OWWB 1GD7A 3KJPA 4LFBQ 1E1TA 1I50H 2IT1A 1XTDA 5M5YH 4LF6Q 3BZKA 4JI7L 3M4OH 4IFDJ 4PG3A 1Q86C 1IBML 4JI5Q 2KENA 3L7ZC 2NVTH 3E0EA 4JI1Q 4A3IH 1KHIA 1WFQA 3M3YH 1N8RC 4GKJL 1N36Q 5BR8L 1X3FA 2I5HA 3J7ZC 3DLLA 2IX0A 1G51A 3D0FA 3CCMA 4DV3L 1QUQA 2BH8A 2KCMA 3PUXA 3NEMA 5C4XH 3S17H 3S2HH 3JC66 1YHBA 1XMQL 5GROA 4A3DH 1I3QH 4A3IG 2KBNA 1TWGH 1C9OA 3K8AA 1Q12A 1UE6A 4JOIA 1YHAA 4AIMA 2MQHA 1QVGA 4A3FH 1K83H 2DGYA 3A74A 2PNHA 2MNAA 4HJ9A 2XGTA 4GKJQ 1N32Q 1NBWA 1U5KA 2HIVA 2F52A 3KF6A 3CCVA 1E24A 2H5XA 1JT8A 5AJ3L 5C4XG 4X64Q 2A8VA 1B7YB 4A3DG 1PVOA 4IPHA 1K3RA 2CWAA 3I56A 1OXXK 2HHHQ 1N33L 4QQBX 1SMXA 1HZAA 1Z47A 3UDFA 4A3KH 5FJ8H 1VQ4A 1N34Q 3U50C 3PF5A 1JMCA 4IFDI 3GTQH 1VQKA 4HJ5A 2HT1A 1YJ9A 2N78A 4GLVB 4FDBA 1LUZA 4HJAA 1K0RA 2NN6G 4YCUA 3RLOA 4RG1A 1S40A 2E5LL 4K0KQ 3W1BA 4DK3C 5H1SE 4X65L 2D0OA 1M90C 2ASBA 3HOUH 2E2JH 3MEFA 3K0XA 4A3KG 3OW2A 4LF9L 1EYGA 4C3JH 4PZ8A 4GNXC 4HIMA 3T1YL 2CCZA 1YI2A 4DV7L 1K9MC 1PH2A 3AEVA 4LUOA 1TWFH 2JA5H 4OX9Q 2L15A 4GLXA 2E5LQ 1HZBA 4J15A 1PV4A 1X56A 4AH6A 2VZAA 4XIGS 4DR2L 1XJVA 2N3SA 1X6OA 1IBLL 2JE6I 5IP7G 1AE2A 2QEXA 1EIFA 2RF4A 4LF9Q 1VQFA 3TS2A 3HOVH 4DR7L 1CSPA 2VQFL 2OTLA 2R92H 4DV0L 1JB7A 1KAWA 1HNXQ 1HR0Q 1IBKQ 3I4MG 3ULPA 4P71A 1B8AA 3STBC 5JJLA 1W2BA 3I4OA 4JCVE 3H0GH 4L5QA 3FKIH 3H15A 2UXBL 3HOVG 1FVIA 4O2DA 1QZHA 2R92G 4A3JH 1YHQA 3PO3H 4DR7Q 5LMUL 5LMNQ 3T1HQ 4BBRG 3S1NH 5C4JH 1WI5A 2VL6A 3PIPA 4DV0Q 1NJIC 1SRUA 2BH2A 1K73C 1AE3A 2YTYA 3JAMi 1YIJA 3H0GG 1FJGQ 1CUKA 1VQBA 2WP8J 3HKSA 3A5UA 1PYBA 1H95A 3ULLA 3GTLH 4GOPC 4A3JG 1VQ5A 3PO3G 4LFAQ 4KI0A 3G48A 3HOXH 1HH2P 1L1OB 2VUMH 4KLKA 2JQOA 2UUCL 3L2PA 4DV2Q 1HZ9A 4UP7A 5GAEC 4B3TQ 1HNWQ 5HGQA 2GN5A 5C3EG 4GNXA 4L5TA 4IOCA 3PO2H 1VQCA 4BY7H 5C0XG 4DV6L 1XPOA 2KHJA 1OXSC 1VS0A 3HOXG 1VQAA 4QY7A 3CC7A 1X3EA 4X66Q 1WYDA 3PUWA 2NVQH 2ALYB 4DUYL 1B70B 1FGUA 1J6QA 3CMEA 1XPRA 4HJ7A 3F8TA 4DAYB 1IL2A 3PO2G 2K5NA 4JYAL 3PGZA 1A63A 1D8LA 1OXVA 2QA4A 3KDFA 4DV4Q 3AFPA 3PUZA 4B3SQ 1W3SA 2IHFA 1NMGA 2JEBI 4POFA 5IT9c 4DR4L 2JA8G 4A3CG 2UUAL 2AWOA 2R93H 4UPAA 4R1JA 3U4VA 4A3BG 3U58A 3RLFA 3UE1A 3A0JA 4OXPA 1XMOQ 1OXTA 4DV5Q 3BU2A 1WCMH 1Y1VG 1VQ7A 5JJKA 2UXCQ 2R7ZG 4C3HH 3TEHB 1OXUA 3CCQA 2UU9L 3D31A 1YJWA 5IYBH 4DR4Q 3FHWA 1PH8A 3GD7A 2PI2A 1VQGA 4DUZL 3KF8B 3W5OA 4GN3B 4C2MH 4JI4L 3I4NG 1XPUA 1WCMG 2WFWA 4BY1G 1E1OA 5IP9H 1Y1WG 1J5EQ 3DM3A 1KXLA 2A1AA 1SROA 4LFCL 2LXKA 3WWVA 2ZM6L 1OTCA 2F4VL 3CD6A 4KHPQ 4GS3A 4DNIA 1UE1A 3GO5A 4LF8L 3ZJYC 1YITA 4JBJA 1VQNA 3S15H 4DUZQ 3EBEA 4JI4Q 1EQQA 1L1OC 4JI6L 1Q46A 3AFQA 5IP9G 1PH3A 1MJCA 1Q82C 1WJJA 4JI7Q 1IBMQ 2JA7H 2VS1A 4QJFA 2ZM6Q 4HJ8A 3NENA 1BKBA 5BR8Q 4GOPB 4LF8Q 2DUDA 3PCOB 1PH9A 1Q1EA 4DV3Q 1PHJA 4OONA 4UY8C 1VCIA 1XMQQ 3B6YA 5ELOA 2JA7G 1LM0A 3CXCA 2Z0SA 3KOJA 4JC0A 4RMFA 4A3FG 1EIYB 2YTVA 3GTKH 3M4PA 4GN4B 3RZDH 3ULJA 3S1RH 1E3PA 2HQLA 4KHZA 4JV5L 3TS0A 4AYBE 4YY3L 3CCUA 4DK6C 2JA9A 5AJ3Q 1CKNB 5FLMH 1SN8A 4TVAB 2AHOB 3I2ZA 1L0WA 3STBD 1PH6A 1M1KC 1ASYA 2I0QA 4YWLA 4L5SA 1E7ZA 1V1QA 1N33Q 5FJ8G 5DLQE 5JEAJ 4DKAC 4YHHL 3NBHB 2A19A 2ZJRA 2WAQE 2YYZA 4R4QA 2UXCL 4LW1A 2EXDA 4DR1L 2AMCB 2ZTDA 2EQSA 2IY5B 5EAYA 3J80i 1N9WA 1P16A 5GAGC 3HOUG 1QVCA 4LUZA 3H3VI 1YEZA 3EIVA 4LF7L 4X65Q 5IWAL 3KJOA 1A0IA 3G71A 3W1GA 2I5MX 3T1YQ 3CCEA 2JA5G 2I5LX 4LF4L 4TQUS 4NXML 1L1OA 3CAMA 4O0AA 4DV7Q 4GKKL 1CKMA 2Z6KC 2K50A 3S1MH 3PIOA 4IFDG 4DR2Q 1TWAH 1T9HA 2CFMA 2JJQA 4Y7NH 1X9NA 1IBLQ 2VNUD 5IWAQ 4HIKA 2B3GA 1HZCA 3RN2A 1PA6A 1YBYA 2MO0A 3M85A 3PSIA 2VQFQ 2KCTA 4GKKQ 1EQRA 4HIDA 2ES2A 4B3RL 3FKIG 4LF5L 1I6HH 3HOZH 3CCRA 2UXDL 4JI0L 3J81c 4DV1L 4IJHA 1LTLA 5M5WH 4HIOA 4IPDA 1QVFA 3OYYA 4OO1I 2UXBQ 4JI2L 2OQ0A 3G4SA 5LMUQ 1VQ9A 2ZJQA 4BXXH 4YWMA 4IJLA 5M5XH 4LNQA 2K5VA 2VQEL 1G6PA 4MNOA 3HOZG 1IYJB 3UDIA 2EIFA 3CCSA 2CWPA 3CW2C 3CMAA 1VQOA 1Q7YC 1Q81C 2K14A 4JBKA 4C3IH 1BVSA 3L0OA 3GTGH 2LSSA 4JI3L 2VUMG 2UXDQ 4XTCS 5IYDH 4A3MH 2Y0SE 3LGJA 4LWCA 5IYCH 3ER0A 1O7IA 4AYBG 3I7FA 1HJPA 4PZ7A 4X62L 2UUCQ 3CC4A 3CF5A 2YU9H 4BA2I 3S16H 3M4QA 1TWCH 3F1ZA 4BY7G 3ICEA 4NXNL 4YCWA 2VY3A 5IYDG 3CQZH 4DV6Q 3CP0A 5IYCG 2E2IH 1KQSA 1MJEA 3HOYH 3RR5A 1VQLA 5IY0A 3OTOL 2FXQA 4A3EH 2AKWB 3TQYA 4DUYQ 2UUBL 1KL9A 1A62A 1PYSB 1BBWA 1KC8C 1C0AA 4WJ3M 1NMFA 2LXJA 2MFIA 3K7AH 4B3ML 4DR6L 4JYAQ 4MZ9A 2V1CC 1KRSA 2WB1E 1VQ6A 2NVXH 1X55A 2OQKA 3HOYG 3S1QH 2R93G 1CKOA 2JK8A 4A3LH 4A3EG 4DR3L 4IPGA 1GM5A 1S3OA 2UUAQ 4GOPA 4A76A 1QZGA 5GAHC 5FLXc 1EFWA 4APVA 1XNRL 3HKZE 1HNZL 4IPCA 1TWHH 4JBWA 2CKZB 4LFBL 5IYBG 3RLNA 4GN5A 2UU9Q 4ALPA 4LF6L 3M9BA 2RCNA 3SGIA 2IX1A 4ME3A 4DAMA 4DR5L 1R9TH 5IE8A 4NB3A 4JI5L 1Q1BA 2JEAI 4JI1L 1CKNA 1PH7A 1I94L 2F3IA 1XNRQ 1N36L 4P73A 2PMZE 3RZOH 2E2HH 2GVBA 4LFCQ 3J7A5 3K80C 1NY4A 2F4VQ 2Q2TA 1SR3A 3KDFB 1TXYA 2NN6I 4DR5Q 3PUVA 3Q8DA 3JAMc 3J81i 2ZTCA 1HR0W 4A3GH 1I94Q 3J81j 1N32L 4JI6Q 2Y0SG 3I55A 2RHQB 3RNUA 4A93H 4PZ6A 1VQHA 2K5HA 4X64L 5GQOA 4A75A 2HHHL 4A3GG 1VQIA 5LMNW 2VW9A 4JG2A 4AQYL 1X65A 1N34L 2KHIA 3AYHB 2XTIA 1SE8A 1YJNA 4A93G 4NPSA 2PQAB 1LYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C7Y A;  3F2B A;  4BBS H;  3K7U C;  2OTJ A;  4K0K L;  1FL0 A;  1UEB A;  5HY6 A;  4Y52 H;  2D0P A;  2N8N A;  1SLJ A;  3F2D A;  4WJ4 A;  2D62 A;  5FLM G;  4JV5 Q;  2BA0 A;  4YCV A;  3PF4 A;  5C0X J;  4YY3 Q;  3CPW A;  1K8A C;  4AQY Q;  2ID0 A;  1NTG A;  4JBM A;  3CCJ A;  2WB1 G;  1YVC A;  3GTM H;  1JJ2 A;  3VDY A;  3MXN B;  1VQP A;  1K8G A;  1VQ8 A;  4OX9 L;  4BBS G;  4BA1 I;  2R6G A;  4L5R C;  4YHH Q;  1QUQ B;  1JJG A;  3S14 H;  3UDG A;  1RIP A;  2YTX A;  4DR1 Q;  3IRB A;  1G29 1;  1GO3 E;  1S72 A;  3K81 C;  3HKZ G;  3CPF A;  3E9I A;  5J3B A;  3S2D H;  3CC2 A;  5IP7 H;  4LF7 Q;  1RL2 A;  3FP9 A;  2OWO A;  1HNX L;  1HR0 L;  1X3G A;  1KRT A;  3KF6 B;  1IBK L;  3NEL A;  3HFZ B;  1EUJ A;  1X54 A;  4R4T A;  2OCE A;  3I4M H;  4NXM Q;  1KD1 C;  4LF4 Q;  1JJC B;  1AH9 A;  3BJU A;  2MO1 A;  4MTN A;  3TRE A;  3H3V H;  1EWI A;  3E9H A;  2NZO A;  5C44 H;  1EOV A;  2K52 A;  2IHE A;  5M3F H;  2HIX A;  5LMN L;  3T1H L;  3M7N A;  2K75 A;  1V9P A;  5C0X I;  2C35 B;  4BBR H;  1XNQ L;  1P8L A;  1PH5 A;  4P75 A;  1JE5 A;  1ASZ A;  1FJG L;  1IZ6 A;  1VQD A;  3S24 A;  1UE5 A;  5C44 G;  5JJI A;  5M3F G;  2BA1 A;  4QL5 A;  1D7Q A;  3AQQ A;  5ELN A;  1MKH A;  4LFA L;  4B3R Q;  4OWT B;  4X6A H;  5M3M H;  4A4I A;  4PMW A;  4LF5 Q;  2N49 A;  1UE7 A;  4DV2 L;  2CQO A;  4B3T L;  4QIW E;  4DV1 Q;  4JI0 Q;  1HNW L;  2ATW A;  1PH1 A;  3ERS X;  4QGU A;  1XNQ Q;  4BXX G;  4JI2 Q;  1GVP A;  2E8G A;  2PI2 E;  1IXR A;  2ZJP A;  3KFU A;  1I5F A;  1DGS A;  4DPG A;  5C3E H;  4R4C A;  3UE0 A;  5M3M G;  2VQE Q;  2Q2H A;  3A5Z B;  4X66 L;  2AWN A;  4A3M G;  2WAQ G;  2QGQ A;  4LUV A;  5JEA G;  1KIX A;  3HOW H;  2NZH A;  4JI3 Q;  2Q2I A;  3KYH C;  2Z6K A;  2JA6 H;  2B29 A;  3BZC A;  4X62 Q;  4DV4 L;  2R7F A;  1Q8K A;  2R7D A;  4EX5 A;  4B3S L;  2GVA A;  4R4O A;  3CCL A;  4OO1 G;  3GDE A;  1A8V A;  4NXN Q;  1VQM A;  1YNX A;  4P72 A;  1CSQ A;  3GTP H;  2NVY H;  3HOW G;  3GTO H;  1NE3 A;  3U4Z A;  2JA6 G;  4A3C H;  2K4K A;  4OWX B;  3RN5 A;  2JA8 H;  1L2F A;  1XMO L;  2B63 H;  4JOI C;  2ZTE A;  1BBU A;  4A3B H;  3OTO Q;  5E7N A;  4DV5 L;  2YV5 A;  1WOC A;  1UWV A;  3J80 c;  4JI8 L;  2UUB Q;  3PUY A;  4YWK A;  1E22 A;  1Z9F A;  3EN2 A;  4POG A;  1GKH A;  4P74 A;  4IOA A;  1Y1V H;  3F2C A;  4R4I A;  2R7Z H;  2Q2U A;  1VQE A;  4B3M Q;  4DR6 Q;  1PFS A;  4A3L G;  2B63 G;  1V43 A;  5K36 G;  5GAD C;  4GNX B;  4UP8 A;  4DR3 Q;  3TRZ A;  3G6E A;  1U0L A;  3I4N H;  2RHS B;  1YZ6 A;  3KLW A;  4UP9 A;  4JI8 Q;  4EQ5 A;  1J5E L;  4BY1 H;  1PH4 A;  4KHP L;  1Y1W H;  3PV0 A;  1VQJ A;  1HNZ Q;  4GLA C;  4H02 A;  4IO9 A;  3UDX A;  3GTJ H;  1Y14 B;  1SFO H;  2PQA A;  1MIU A;  4OWW B;  1GD7 A;  3KJP A;  4LFB Q;  1E1T A;  1I50 H;  2IT1 A;  1XTD A;  5M5Y H;  4LF6 Q;  3BZK A;  4JI7 L;  3M4O H;  4IFD J;  4PG3 A;  1Q86 C;  1IBM L;  4JI5 Q;  2KEN A;  3L7Z C;  2NVT H;  3E0E A;  4JI1 Q;  4A3I H;  1KHI A;  1WFQ A;  3M3Y H;  1N8R C;  4GKJ L;  1N36 Q;  5BR8 L;  1X3F A;  2I5H A;  3J7Z C;  3DLL A;  2IX0 A;  1G51 A;  3D0F A;  3CCM A;  4DV3 L;  1QUQ A;  2BH8 A;  2KCM A;  3PUX A;  3NEM A;  5C4X H;  3S17 H;  3S2H H;  3JC6 6;  1YHB A;  1XMQ L;  5GRO A;  4A3D H;  1I3Q H;  4A3I G;  2KBN A;  1TWG H;  1C9O A;  3K8A A;  1Q12 A;  1UE6 A;  4JOI A;  1YHA A;  4AIM A;  2MQH A;  1QVG A;  4A3F H;  1K83 H;  2DGY A;  3A74 A;  2PNH A;  2MNA A;  4HJ9 A;  2XGT A;  4GKJ Q;  1N32 Q;  1NBW A;  1U5K A;  2HIV A;  2F52 A;  3KF6 A;  3CCV A;  1E24 A;  2H5X A;  1JT8 A;  5AJ3 L;  5C4X G;  4X64 Q;  2A8V A;  1B7Y B;  4A3D G;  1PVO A;  4IPH A;  1K3R A;  2CWA A;  3I56 A;  1OXX K;  2HHH Q;  1N33 L;  4QQB X;  1SMX A;  1HZA A;  1Z47 A;  3UDF A;  4A3K H;  5FJ8 H;  1VQ4 A;  1N34 Q;  3U50 C;  3PF5 A;  1JMC A;  4IFD I;  3GTQ H;  1VQK A;  4HJ5 A;  2HT1 A;  1YJ9 A;  2N78 A;  4GLV B;  4FDB A;  1LUZ A;  4HJA A;  1K0R A;  2NN6 G;  4YCU A;  3RLO A;  4RG1 A;  1S40 A;  2E5L L;  4K0K Q;  3W1B A;  4DK3 C;  5H1S E;  4X65 L;  2D0O A;  1M90 C;  2ASB A;  3HOU H;  2E2J H;  3MEF A;  3K0X A;  4A3K G;  3OW2 A;  4LF9 L;  1EYG A;  4C3J H;  4PZ8 A;  4GNX C;  4HIM A;  3T1Y L;  2CCZ A;  1YI2 A;  4DV7 L;  1K9M C;  1PH2 A;  3AEV A;  4LUO A;  1TWF H;  2JA5 H;  4OX9 Q;  2L15 A;  4GLX A;  2E5L Q;  1HZB A;  4J15 A;  1PV4 A;  1X56 A;  4AH6 A;  2VZA A;  4XIG S;  4DR2 L;  1XJV A;  2N3S A;  1X6O A;  1IBL L;  2JE6 I;  5IP7 G;  1AE2 A;  2QEX A;  1EIF A;  2RF4 A;  4LF9 Q;  1VQF A;  3TS2 A;  3HOV H;  4DR7 L;  1CSP A;  2VQF L;  2OTL A;  2R92 H;  4DV0 L;  1JB7 A;  1KAW A;  1HNX Q;  1HR0 Q;  1IBK Q;  3I4M G;  3ULP A;  4P71 A;  1B8A A;  3STB C;  5JJL A;  1W2B A;  3I4O A;  4JCV E;  3H0G H;  4L5Q A;  3FKI H;  3H15 A;  2UXB L;  3HOV G;  1FVI A;  4O2D A;  1QZH A;  2R92 G;  4A3J H;  1YHQ A;  3PO3 H;  4DR7 Q;  5LMU L;  5LMN Q;  3T1H Q;  4BBR G;  3S1N H;  5C4J H;  1WI5 A;  2VL6 A;  3PIP A;  4DV0 Q;  1NJI C;  1SRU A;  2BH2 A;  1K73 C;  1AE3 A;  2YTY A;  3JAM i;  1YIJ A;  3H0G G;  1FJG Q;  1CUK A;  1VQB A;  2WP8 J;  3HKS A;  3A5U A;  1PYB A;  1H95 A;  3ULL A;  3GTL H;  4GOP C;  4A3J G;  1VQ5 A;  3PO3 G;  4LFA Q;  4KI0 A;  3G48 A;  3HOX H;  1HH2 P;  1L1O B;  2VUM H;  4KLK A;  2JQO A;  2UUC L;  3L2P A;  4DV2 Q;  1HZ9 A;  4UP7 A;  5GAE C;  4B3T Q;  1HNW Q;  5HGQ A;  2GN5 A;  5C3E G;  4GNX A;  4L5T A;  4IOC A;  3PO2 H;  1VQC A;  4BY7 H;  5C0X G;  4DV6 L;  1XPO A;  2KHJ A;  1OXS C;  1VS0 A;  3HOX G;  1VQA A;  4QY7 A;  3CC7 A;  1X3E A;  4X66 Q;  1WYD A;  3PUW A;  2NVQ H;  2ALY B;  4DUY L;  1B70 B;  1FGU A;  1J6Q A;  3CME A;  1XPR A;  4HJ7 A;  3F8T A;  4DAY B;  1IL2 A;  3PO2 G;  2K5N A;  4JYA L;  3PGZ A;  1A63 A;  1D8L A;  1OXV A;  2QA4 A;  3KDF A;  4DV4 Q;  3AFP A;  3PUZ A;  4B3S Q;  1W3S A;  2IHF A;  1NMG A;  2JEB I;  4POF A;  5IT9 c;  4DR4 L;  2JA8 G;  4A3C G;  2UUA L;  2AWO A;  2R93 H;  4UPA A;  4R1J A;  3U4V A;  4A3B G;  3U58 A;  3RLF A;  3UE1 A;  3A0J A;  4OXP A;  1XMO Q;  1OXT A;  4DV5 Q;  3BU2 A;  1WCM H;  1Y1V G;  1VQ7 A;  5JJK A;  2UXC Q;  2R7Z G;  4C3H H;  3TEH B;  1OXU A;  3CCQ A;  2UU9 L;  3D31 A;  1YJW A;  5IYB H;  4DR4 Q;  3FHW A;  1PH8 A;  3GD7 A;  2PI2 A;  1VQG A;  4DUZ L;  3KF8 B;  3W5O A;  4GN3 B;  4C2M H;  4JI4 L;  3I4N G;  1XPU A;  1WCM G;  2WFW A;  4BY1 G;  1E1O A;  5IP9 H;  1Y1W G;  1J5E Q;  3DM3 A;  1KXL A;  2A1A A;  1SRO A;  4LFC L;  2LXK A;  3WWV A;  2ZM6 L;  1OTC A;  2F4V L;  3CD6 A;  4KHP Q;  4GS3 A;  4DNI A;  1UE1 A;  3GO5 A;  4LF8 L;  3ZJY C;  1YIT A;  4JBJ A;  1VQN A;  3S15 H;  4DUZ Q;  3EBE A;  4JI4 Q;  1EQQ A;  1L1O C;  4JI6 L;  1Q46 A;  3AFQ A;  5IP9 G;  1PH3 A;  1MJC A;  1Q82 C;  1WJJ A;  4JI7 Q;  1IBM Q;  2JA7 H;  2VS1 A;  4QJF A;  2ZM6 Q;  4HJ8 A;  3NEN A;  1BKB A;  5BR8 Q;  4GOP B;  4LF8 Q;  2DUD A;  3PCO B;  1PH9 A;  1Q1E A;  4DV3 Q;  1PHJ A;  4OON A;  4UY8 C;  1VCI A;  1XMQ Q;  3B6Y A;  5ELO A;  2JA7 G;  1LM0 A;  3CXC A;  2Z0S A;  3KOJ A;  4JC0 A;  4RMF A;  4A3F G;  1EIY B;  2YTV A;  3GTK H;  3M4P A;  4GN4 B;  3RZD H;  3ULJ A;  3S1R H;  1E3P A;  2HQL A;  4KHZ A;  4JV5 L;  3TS0 A;  4AYB E;  4YY3 L;  3CCU A;  4DK6 C;  2JA9 A;  5AJ3 Q;  1CKN B;  5FLM H;  1SN8 A;  4TVA B;  2AHO B;  3I2Z A;  1L0W A;  3STB D;  1PH6 A;  1M1K C;  1ASY A;  2I0Q A;  4YWL A;  4L5S A;  1E7Z A;  1V1Q A;  1N33 Q;  5FJ8 G;  5DLQ E;  5JEA J;  4DKA C;  4YHH L;  3NBH B;  2A19 A;  2ZJR A;  2WAQ E;  2YYZ A;  4R4Q A;  2UXC L;  4LW1 A;  2EXD A;  4DR1 L;  2AMC B;  2ZTD A;  2EQS A;  2IY5 B;  5EAY A;  3J80 i;  1N9W A;  1P16 A;  5GAG C;  3HOU G;  1QVC A;  4LUZ A;  3H3V I;  1YEZ A;  3EIV A;  4LF7 L;  4X65 Q;  5IWA L;  3KJO A;  1A0I A;  3G71 A;  3W1G A;  2I5M X;  3T1Y Q;  3CCE A;  2JA5 G;  2I5L X;  4LF4 L;  4TQU S;  4NXM L;  1L1O A;  3CAM A;  4O0A A;  4DV7 Q;  4GKK L;  1CKM A;  2Z6K C;  2K50 A;  3S1M H;  3PIO A;  4IFD G;  4DR2 Q;  1TWA H;  1T9H A;  2CFM A;  2JJQ A;  4Y7N H;  1X9N A;  1IBL Q;  2VNU D;  5IWA Q;  4HIK A;  2B3G A;  1HZC A;  3RN2 A;  1PA6 A;  1YBY A;  2MO0 A;  3M85 A;  3PSI A;  2VQF Q;  2KCT A;  4GKK Q;  1EQR A;  4HID A;  2ES2 A;  4B3R L;  3FKI G;  4LF5 L;  1I6H H;  3HOZ H;  3CCR A;  2UXD L;  4JI0 L;  3J81 c;  4DV1 L;  4IJH A;  1LTL A;  5M5W H;  4HIO A;  4IPD A;  1QVF A;  3OYY A;  4OO1 I;  2UXB Q;  4JI2 L;  2OQ0 A;  3G4S A;  5LMU Q;  1VQ9 A;  2ZJQ A;  4BXX H;  4YWM A;  4IJL A;  5M5X H;  4LNQ A;  2K5V A;  2VQE L;  1G6P A;  4MNO A;  3HOZ G;  1IYJ B;  3UDI A;  2EIF A;  3CCS A;  2CWP A;  3CW2 C;  3CMA A;  1VQO A;  1Q7Y C;  1Q81 C;  2K14 A;  4JBK A;  4C3I H;  1BVS A;  3L0O A;  3GTG H;  2LSS A;  4JI3 L;  2VUM G;  2UXD Q;  4XTC S;  5IYD H;  4A3M H;  2Y0S E;  3LGJ A;  4LWC A;  5IYC H;  3ER0 A;  1O7I A;  4AYB G;  3I7F A;  1HJP A;  4PZ7 A;  4X62 L;  2UUC Q;  3CC4 A;  3CF5 A;  2YU9 H;  4BA2 I;  3S16 H;  3M4Q A;  1TWC H;  3F1Z A;  4BY7 G;  3ICE A;  4NXN L;  4YCW A;  2VY3 A;  5IYD G;  3CQZ H;  4DV6 Q;  3CP0 A;  5IYC G;  2E2I H;  1KQS A;  1MJE A;  3HOY H;  3RR5 A;  1VQL A;  5IY0 A;  3OTO L;  2FXQ A;  4A3E H;  2AKW B;  3TQY A;  4DUY Q;  2UUB L;  1KL9 A;  1A62 A;  1PYS B;  1BBW A;  1KC8 C;  1C0A A;  4WJ3 M;  1NMF A;  2LXJ A;  2MFI A;  3K7A H;  4B3M L;  4DR6 L;  4JYA Q;  4MZ9 A;  2V1C C;  1KRS A;  2WB1 E;  1VQ6 A;  2NVX H;  1X55 A;  2OQK A;  3HOY G;  3S1Q H;  2R93 G;  1CKO A;  2JK8 A;  4A3L H;  4A3E G;  4DR3 L;  4IPG A;  1GM5 A;  1S3O A;  2UUA Q;  4GOP A;  4A76 A;  1QZG A;  5GAH C;  5FLX c;  1EFW A;  4APV A;  1XNR L;  3HKZ E;  1HNZ L;  4IPC A;  1TWH H;  4JBW A;  2CKZ B;  4LFB L;  5IYB G;  3RLN A;  4GN5 A;  2UU9 Q;  4ALP A;  4LF6 L;  3M9B A;  2RCN A;  3SGI A;  2IX1 A;  4ME3 A;  4DAM A;  4DR5 L;  1R9T H;  5IE8 A;  4NB3 A;  4JI5 L;  1Q1B A;  2JEA I;  4JI1 L;  1CKN A;  1PH7 A;  1I94 L;  2F3I A;  1XNR Q;  1N36 L;  4P73 A;  2PMZ E;  3RZO H;  2E2H H;  2GVB A;  4LFC Q;  3J7A 5;  3K80 C;  1NY4 A;  2F4V Q;  2Q2T A;  1SR3 A;  3KDF B;  1TXY A;  2NN6 I;  4DR5 Q;  3PUV A;  3Q8D A;  3JAM c;  3J81 i;  2ZTC A;  1HR0 W;  4A3G H;  1I94 Q;  3J81 j;  1N32 L;  4JI6 Q;  2Y0S G;  3I55 A;  2RHQ B;  3RNU A;  4A93 H;  4PZ6 A;  1VQH A;  2K5H A;  4X64 L;  5GQO A;  4A75 A;  2HHH L;  4A3G G;  1VQI A;  5LMN W;  2VW9 A;  4JG2 A;  4AQY L;  1X65 A;  1N34 L;  2KHI A;  3AYH B;  2XTI A;  1SE8 A;  1YJN A;  4A93 G;  4NPS A;  2PQA B;  1LYL A; 
#chains in the Genus database with same CATH topology
 1F2L A;  4BBS H;  4Y52 H;  1SLJ A;  2N55 A;  2E75 C;  2D62 A;  1PTO D;  5FLM G;  2BA0 A;  3PF4 A;  4JV5 Q;  4A3G B;  5C0X J;  4YY3 Q;  2AQ2 B;  4KMU C;  1NTG A;  3MC0 B;  2Q8T A;  2WB1 G;  4DK1 A;  2K05 A;  4MN3 A;  3MXN B;  1NNX A;  2R6G A;  4YHH Q;  4DAV A;  3UDG A;  3S14 H;  1RIP A;  1D5Z C;  1FGB D;  1S72 A;  3EQL C;  1SE4 A;  1LTG D;  3HRZ C;  3MVV A;  1Y8P B;  3NWT A;  5IP7 H;  1JCK B;  5ISR A;  4X3U A;  3FP9 A;  3K5O A;  1HNX L;  1BOS A;  1KRT A;  4CKC A;  3TZU A;  1IBK L;  1KD1 C;  2WKC A;  2MO1 A;  1BCP D;  1CHP D;  3E9H A;  4HMJ A;  1ESR A;  2K04 A;  2HIX A;  3T1H L;  2XNA C;  1O7L A;  2C35 B;  1QE6 A;  1XNQ L;  1FJG L;  1IZ6 A;  2EY2 A;  3F2U A;  3NWS A;  1UE5 A;  5C44 G;  3S1M B;  5JJI A;  4KTA A;  1KDC A;  1D7Q A;  3T16 A;  2PMZ B;  1S5C D;  5DNF A;  3IAY A;  2CQO A;  2ATW A;  1X3Q A;  3I90 A;  2PI2 E;  4JI2 Q;  4CKE A;  1IXR A;  4G4K A;  3BVM A;  1CQF A;  5M3F B;  1JR0 D;  2Q2H A;  4X66 L;  5ELE A;  2QGQ A;  1CZW A;  2JA6 H;  2O5I C;  2B29 A;  1G8Z D;  5HGT A;  1LV9 A;  1NAP A;  3A8I E;  5M3M B;  3CCL A;  4OO1 G;  2Z1C A;  4C3I B;  4NXN Q;  1YNX A;  1NE3 A;  4A3C H;  3RN5 A;  1PYW D;  4RGM A;  2RKS A;  1BBU A;  1D5X C;  2SEB D;  3G6J B;  4CDE C;  4DV5 L;  2NYZ D;  3QJY A;  2F0I A;  3U9O A;  3J80 c;  2UUB Q;  4DXG A;  4POG A;  5IT9 E;  1ET9 A;  1V43 A;  1LAC A;  5K36 G;  3G6E A;  3C1F A;  1QJO A;  2RHS B;  4XT1 B;  1J5E L;  3KLW A;  2G9H D;  2NVY B;  1PH4 A;  1B2T A;  3PV0 A;  4GLA C;  5C4Z A;  4L8J A;  3SHL A;  3NXW A;  1XTD A;  4KY6 A;  4LF6 Q;  4IFD J;  1EYC A;  4LMQ D;  2AUK A;  5A35 A;  4JI1 Q;  3WOF A;  3FRP B;  3T53 B;  1N8R C;  1TWH B;  1X3F A;  2I5H A;  4K6D A;  3J7Z C;  1G91 A;  4DV3 L;  2KCM A;  5C4X H;  3NEM A;  4ME5 A;  3JC6 6;  4I7A A;  1VDZ A;  4A3I G;  3K8A A;  1Q12 A;  1Y8N B;  3I70 A;  1YHA A;  5COR A;  4AIM A;  1QVG A;  2DGY A;  3A74 A;  2PNH A;  2MNA A;  1HXY D;  3J80 L;  1MD2 D;  2F52 A;  2H4O A;  5AJ3 L;  3M4O B;  3R93 A;  4IPH A;  2NVT B;  3M3Y B;  1RJT A;  2KQ3 A;  2QF7 A;  1R4Q B;  3GTQ H;  4KK7 A;  2DY8 A;  3K5M A;  4GLV B;  3RLO A;  2E5L L;  4OIK A;  1Y8O B;  1HUM A;  4A3D B;  4X65 L;  1I3Q B;  1I4H A;  3MEF A;  3A7L A;  3OW2 A;  4LF9 L;  1JOO A;  2F0V A;  4A3F B;  1K0S A;  4PZ8 A;  2CCZ A;  1YI2 A;  5E1F A;  2JA5 H;  1X56 A;  1PDQ A;  1PFB A;  2K32 A;  1XJV A;  2JE6 I;  1AE2 A;  2QEX A;  4PNY A;  4A3K B;  1TKW B;  4DR7 L;  3OIP A;  2M00 A;  1JB7 A;  1CA6 A;  1KAW A;  3I4M G;  1SYD A;  1BUV T;  2E2J B;  3I4O A;  4XQJ A;  5JAV A;  3HOV G;  2R92 G;  4A3J H;  3I72 A;  4KJN A;  1NJI C;  3VR3 A;  1YIJ A;  2ZXR A;  2VB3 X;  2WP8 J;  3A5U A;  1H95 A;  2AQ3 B;  3A8K E;  2EYM A;  3DUZ A;  1CQV A;  2VUM H;  4KLK A;  2JQO A;  2IL8 A;  4ODG A;  1HZ9 A;  1VMP A;  1HNW Q;  5HGQ A;  3MAQ A;  2WKD A;  3K58 A;  3ND9 A;  4L5T A;  4IOC A;  4BY7 H;  2F0N A;  1OXS C;  4MHE A;  1RTN A;  3HOX G;  1WYD A;  1UNS A;  1FGU A;  4N9T A;  5EKK A;  3F8T A;  4DAY B;  3M4Y A;  1BXT A;  1D8L A;  1OXV A;  3TSS A;  3KDF A;  1IL8 A;  1W3S A;  3DHQ A;  5JVG 3;  2EJG C;  2IHF A;  5C5L A;  1NMG A;  2JEB I;  2SOB A;  4POF A;  2JA8 G;  4A3B G;  3Q23 A;  3RLF A;  2RA4 A;  3UE1 A;  1TT2 A;  3PO2 B;  1WCM H;  3PQI A;  5JJK A;  2BE5 D;  1ZYR D;  2UXC Q;  4ZRZ A;  1GUW A;  3CCQ A;  4E6I A;  1YJW A;  4DNR B;  1VQG A;  3NQT A;  3J81 L;  4DUZ L;  4RGN A;  2EY5 A;  4C2M H;  1STB A;  4JI4 L;  5J39 A;  1GUO A;  2CQA A;  1TS4 A;  4BY1 G;  1E1O A;  1BR9 A;  3W2D A;  2CH4 A;  2LXK A;  1OTC A;  2ZM6 L;  4KHP Q;  3VA5 A;  3GO5 A;  1ZXT A;  4LF8 L;  3MXN A;  2PW7 A;  1VQN A;  3QR8 A;  1W6K A;  5T1G A;  1AP0 A;  1L1O C;  1Q46 A;  4O1N A;  1MJC A;  2IPK D;  5DM7 3;  2F0P A;  1BF4 A;  5EKI A;  1EY7 A;  2VS1 A;  3NSW A;  4QJF A;  4HJ8 A;  1H9S A;  2PQE A;  4KN7 C;  4G7H C;  1JQY D;  1IKM A;  3R3O A;  3B6Y A;  3OIQ A;  4HR7 B;  2Z4I A;  2JA7 G;  3KOJ A;  3OMG A;  1O7Y A;  4KY7 A;  4FXD A;  4YIJ A;  3RZD H;  3ULJ A;  4JV5 L;  4YY3 L;  4DK6 C;  1PFN A;  1PH6 A;  1ASY A;  1E7Z A;  5FJ8 G;  5DLQ E;  4YHH L;  2ZJR A;  2JSO A;  2WAQ E;  2YYZ A;  2KCC A;  2QEJ C;  2EQS A;  2EXZ A;  1TS2 A;  1STN A;  1BQQ T;  5FO7 B;  3H3V I;  3VR5 A;  5IWA L;  3KJO A;  3G71 A;  1EQV A;  2M9V A;  3NPP A;  4XYQ A;  2K50 A;  2WAC A;  2DNE A;  4Y7N H;  1K3B C;  1SYF A;  2JA5 B;  2E76 C;  2C9O A;  1FR3 A;  4DN4 M;  3IKJ A;  2ES2 A;  5IOD A;  1E2V A;  1I6H H;  3CCR A;  4IJH A;  5M5W H;  4JI2 L;  5I6W A;  5LMU Q;  2I07 B;  1VQ9 A;  4IJL A;  1G6P A;  1TWA B;  3FDT A;  4RFB A;  2CWP A;  4XT3 B;  3CMA A;  1ET6 A;  1Q81 C;  3NTK A;  4R8N A;  4JBK A;  1BVS A;  3I3C A;  2XRS D;  4NKL A;  4XTC S;  5D65 A;  4A3M H;  3NK9 A;  3I7F A;  2UUC Q;  1SJH D;  5TSS A;  3VYR A;  1I4Q A;  3HOZ B;  3F1Z A;  3KF8 A;  4NXN L;  5E4X A;  5I4D A;  3UI2 A;  3CQZ H;  2JP1 A;  5IYC G;  2VUM B;  2E2I H;  1MJE A;  1EZ8 A;  2F0S A;  4Q5V A;  2RVL A;  5M5X B;  4DFA A;  4A3E H;  2WIN B;  2F0M A;  4DUY Q;  1F2Y A;  2UUB L;  1A62 A;  2QKI C;  5EPK A;  1WTO A;  2LXJ A;  4BY7 B;  2KEC A;  3ND8 A;  1ENF A;  1MSH A;  3K7A H;  3OW7 A;  3KBX A;  1GJX A;  3VYT A;  2NVX H;  1X55 A;  3Q24 A;  3QOJ A;  4DK0 A;  2R93 G;  4A3L H;  2F0U A;  2YU9 B;  1QOH A;  1S3O A;  4RKB A;  2CW0 D;  4NP5 A;  2Z4H A;  5FLX c;  3DEP A;  4APV A;  1XNR L;  3HKZ E;  4KKU A;  2KA7 A;  1NR2 A;  2BOS A;  4TSS A;  2TMP A;  2CKZ B;  5IYB G;  2UU9 Q;  1U4L A;  4LF6 L;  3SGI A;  2TSS A;  4DAM A;  4NB3 A;  5DEH A;  1Q1B A;  4JI1 L;  1PH7 A;  1STG A;  1S5D D;  2E2H H;  5J1Z A;  3ITP A;  3IFT A;  1SR3 A;  2AQ1 B;  3TP6 A;  1TXY A;  1KNA A;  3JAM c;  1PZK D;  3Q8D A;  2F0J A;  2ZTC A;  4A3G H;  2XIW A;  1I94 Q;  1LO5 D;  5KND A;  3BDC A;  3SVM A;  2F0L A;  2K6A A;  4AQY L;  1X65 A;  1B44 D;  1CI3 M;  1YJN A;  3Q6S A;  1LYL A;  3F2B A;  1FL0 A;  2PYK A;  2N8N A;  3CPW A;  2ID0 A;  4JBM A;  3VDY A;  1VQP A;  1K8G A;  3CRK C;  4BBS G;  2B2Y C;  4A93 B;  4M8A A;  5EJW A;  4L5R C;  2XSC A;  2FIN B;  4EGV A;  3IRB A;  4I7Z C;  3K81 C;  3HKZ G;  3FMC A;  5J3B A;  4LAA A;  3CC2 A;  2J7Z A;  3K59 A;  2OWO A;  2A73 B;  1YNN C;  2B2V A;  2SNM A;  5KIX A;  1CA5 A;  3NEL A;  4R4T A;  4K6L A;  1JIC A;  2VXW A;  1AH9 A;  2K7V A;  4X3S A;  3GTM B;  1J9O A;  4PMC A;  1EOV A;  2IHE A;  5M3F H;  3M7N A;  2K75 A;  5C0X I;  1HTP A;  3WOE A;  1VMC A;  3SEB A;  1JE5 A;  1ASZ A;  3S2D B;  3H09 A;  4IN3 A;  4QL5 A;  2Z8L A;  4IUN A;  4B3R Q;  4Y7N B;  4OWT B;  5M3M H;  3MXP A;  4LF5 Q;  3J7A F;  2N49 A;  2RDG A;  3HG9 A;  1U4M A;  1HNW L;  4QIW E;  4DV1 Q;  1PH1 A;  5JEA H;  1PMR A;  3QB3 A;  4QGU A;  1WTR A;  2E8G A;  4H7B A;  4J8Q A;  4JVZ A;  3KFU A;  1IW7 C;  1I5F A;  1DGS A;  4DPG A;  4R4C A;  3A5Z B;  1SEB D;  4WFN 3;  5E3F A;  1CFM A;  4LUV A;  5CV4 A;  4JI3 Q;  3K57 A;  3BS1 A;  2Z6K A;  2CH4 W;  1FNW A;  1Q8K A;  1B3Q A;  1KDA A;  1I6V C;  1XWE A;  3A54 A;  2NVY H;  4A3M B;  1CZG A;  4ZQ3 A;  1RHP A;  2JA6 G;  4OWX B;  4N9P A;  4JOI C;  2ZTE A;  1FYC A;  5E7N A;  1A3T A;  2LY7 A;  1WOC A;  1EL0 A;  2D9U A;  2UXC L;  4JI8 L;  3EN2 A;  1Z9F A;  1B53 A;  1GKH A;  4P74 A;  4IUQ A;  1Y1V H;  4FVM A;  3F2C A;  2EYF A;  2R7Z H;  3L3O C;  1VQE A;  5AFW A;  3HOW B;  4DR6 Q;  1PFS A;  1TS3 A;  5KGU A;  4NMZ A;  2QW7 A;  1E0B A;  1U0L A;  3I4N H;  3KLS X;  4ZUI A;  4EQ5 A;  3GTP B;  1PTO H;  4FXG C;  3GTO B;  4KHP L;  2NVX B;  1VQJ A;  1PRT D;  3BVZ A;  2B63 B;  2BDO A;  2B2W A;  1GD7 A;  3KJP A;  2IT1 A;  2X6L A;  5FKA C;  4FXK C;  3M4O H;  4ZYS A;  1Q86 C;  5CV8 A;  4JI5 Q;  2NVT H;  3E0E A;  1WFQ A;  5BN5 A;  3M3Y H;  1N36 Q;  3DLL A;  3D0F A;  2JXM B;  1SAP A;  1AN8 A;  3S17 H;  5T1I A;  4BY1 B;  4A3D H;  1I3Q H;  1TU2 B;  3GTJ B;  4A3F H;  1SFO B;  4GKJ Q;  3VR2 A;  1NBW A;  1U5K A;  2HIV A;  3KF6 A;  3CCV A;  1E24 A;  3H6M A;  5C4X G;  5KNC A;  1HRJ A;  1B7Y B;  1PVO A;  3I56 A;  2CWA A;  3P7J A;  1OXX K;  1RDP D;  4XQN A;  4QQB X;  1SMX A;  2MP1 A;  4RHS A;  1HZA A;  1SYE A;  1Z47 A;  4A3K H;  4IFD I;  1VQ4 A;  1KNE A;  3U50 C;  3PF5 A;  1N34 Q;  1JMC A;  2V4D A;  3C46 A;  2GA4 B;  1LUZ A;  1HA6 A;  4L6T B;  2NN6 G;  3X3M A;  4K0K Q;  5H1S E;  2D0O A;  1M90 C;  2ASB A;  3HOU H;  1TWG B;  2E2J H;  3K0X A;  1EY5 A;  3A7A B;  4C3J H;  1H9S B;  2E74 C;  3AEV A;  4LUO A;  3TN2 A;  3A55 A;  3V2T A;  4PQX A;  4XIG S;  3SE0 A;  1EIF A;  3RMH A;  2ZXP A;  2J4X A;  2OTL A;  4DV0 L;  4IUP A;  1MBY A;  3DEO A;  1AZQ A;  3ULP A;  1V8Q A;  4P71 A;  1STA A;  3D6C A;  3H15 A;  2RQX A;  5LMU L;  1DON A;  4PV1 C;  4BBR G;  1QCB D;  2DY7 A;  4EQP A;  1PTO C;  2PO4 A;  1EYD A;  1K73 C;  1AE3 A;  2YTY A;  3MFG A;  1U4R A;  1VQB A;  4A3J G;  4B9W A;  1HFG A;  1WD0 A;  4HAE A;  4LFA Q;  4KI0 A;  3G48 A;  1ILQ A;  3T51 B;  2UUC L;  3KLR A;  4N8X 1;  3C3L A;  1M8A A;  1EY0 A;  3EJI A;  1D2B A;  2E2H B;  3H0G B;  5C3E G;  4GNX A;  4K14 A;  3PO2 H;  2KJX A;  2OEO A;  3EFX D;  3K0Y A;  4KY5 A;  3PO3 B;  3LX0 A;  1G2T A;  1VS0 A;  1VQA A;  3S1N B;  4QY7 A;  2PZW A;  1X3E A;  1K8O A;  3PUW A;  4DUY L;  1B70 B;  3CME A;  5IGE A;  1PTO F;  4HJ7 A;  3BYY B;  2F0D A;  2MPM A;  2K5N A;  2HCC A;  3WDN A;  4ZKC B;  3PGZ A;  3HS0 C;  3P1H A;  4DV4 Q;  3PUZ A;  4B3S Q;  2ENB A;  1EIG A;  4FF3 A;  4DR4 L;  1O78 A;  2AWO A;  2Z9H A;  4UPA A;  3GP7 A;  1Q8I A;  1U4P A;  3J7Y W;  4OXP A;  2CVR A;  4ZUJ A;  1HFN A;  4OL7 A;  1VQ7 A;  2E2D C;  3TEH B;  2UU9 L;  1NR4 A;  1TS5 A;  1F2M A;  2PI2 A;  2B2T C;  2IX3 A;  3KF8 B;  3W5O A;  4GN3 B;  1WCM G;  2IW3 A;  1Y1V B;  1TVX A;  2R7Z B;  1Y1W G;  1I4G A;  3WWV A;  4DA2 A;  5IIF A;  3ZJY C;  2EJM A;  3DM1 A;  4JBJ A;  4IUV A;  3I4N B;  2EYJ A;  2A68 C;  5ELF A;  4JI7 Q;  1S5F D;  1PTO B;  1WJJ A;  4C3H B;  3TZD A;  3R8B A;  2WV6 D;  1IBM Q;  3NEN A;  5BR8 Q;  5I2Y A;  3E3X A;  4JPB W;  3JAM E;  1PH9 A;  2A6H D;  1RF2 D;  4Q0F A;  1KLG D;  5LHY 1;  4HCS A;  1XMQ Q;  3CXC A;  4RMF A;  2PZU A;  2K5Q A;  2YTV A;  1E3P A;  4AYB E;  2K01 A;  3DMU A;  3CCU A;  2JA9 A;  3S17 B;  3OSO A;  5FLM H;  1SN8 A;  4TVA B;  2AHO B;  1L0W A;  1Q3L A;  3SDZ A;  1BCP B;  4YWL A;  2FHT A;  3DWA A;  5I6Y A;  4DKA C;  3D4R A;  2A19 A;  1SNQ A;  1KDB A;  1II3 A;  2EXD A;  1C48 A;  3GV6 A;  4ZK9 B;  5EAY A;  1P16 A;  1QVC A;  2PNR C;  2F0H A;  3GTK B;  2XWJ B;  3KLS A;  3S1R B;  3W1G A;  3ONA B;  3T1Y Q;  2I5L X;  4GKK L;  3CAM A;  4DV7 Q;  2P5Z X;  5C6A A;  4F87 A;  3AB9 A;  5JJZ A;  2Z6K C;  1LTS D;  3HOU B;  4DR2 Q;  1TWA H;  1IBL Q;  4C3J B;  4CBV A;  1YBY A;  2MO0 A;  3M85 A;  2KCT A;  3ERO A;  2FMM A;  1O7Z A;  4B3R L;  4GZY C;  3FKI G;  4LF5 L;  1G6Z A;  3HOZ H;  2DJG C;  2B2U A;  4EQN A;  2UXD L;  3J81 c;  4DV1 L;  4HIO A;  4IPD A;  1X3P A;  3OYY A;  4OO1 I;  1AEX A;  5L37 A;  1TR5 A;  2ZJQ A;  3NBI A;  5M5X H;  2A5H A;  4G7Z C;  4K8J A;  3UDI A;  3CW2 C;  3VYU A;  3O13 A;  1Q7Y C;  2OF1 A;  2ICI A;  4JI3 L;  2Y0S E;  2XWB B;  3LGJ A;  4LWC A;  4AYB G;  3CC4 A;  4PZ7 A;  4I65 A;  2YU9 H;  2B2W C;  1DCZ A;  1LT4 D;  1WVL A;  3ICE A;  1MHW C;  4YCW A;  4OO1 H;  2VY3 A;  4R9W A;  4DV6 Q;  3CP0 A;  3BDL A;  1LT5 D;  3SXH A;  5IOC A;  4RGO S;  1DOK A;  2EY1 A;  2B8F A;  2AKW B;  3TQY A;  4WJ3 M;  1KC8 C;  1D5M C;  1ENC A;  1KTK A;  3GTG B;  4DR6 L;  2L9H A;  3S1Q H;  2JK8 A;  4A3E G;  5K36 H;  3S16 B;  4IPG A;  1TWC B;  2F0T A;  2RBM A;  5GAH C;  4FF2 A;  1GUG A;  1QNU A;  4IPC A;  1SNC A;  3HOY B;  4JBW A;  1H9K A;  4UHV A;  3M9B A;  2RCN A;  1SE3 A;  1LT6 D;  4ME3 A;  4XQQ A;  4IQZ A;  4DR5 L;  5G3L D;  4JI5 L;  2JEA I;  1DOM A;  1N36 L;  2LFN A;  2PMZ E;  4DNT B;  3CHB D;  4LFC Q;  1NY4 A;  3SK6 A;  2F4V Q;  1H9M A;  1BDO A;  2HD3 A;  2ICE C;  4JI6 Q;  2Y0S G;  4QB4 A;  3I55 A;  4A93 H;  4PZ6 A;  1SYG A;  5A2Q E;  5GQO A;  5CMD A;  1R9T B;  3GV3 A;  1ENA A;  4A3G G;  4QIW B;  1N34 L;  1SNP A;  1C7Y A;  1CK1 A;  5C3W A;  4RA8 A;  4K0K L;  1UEB A;  3A8J E;  5EGT A;  2D0P A;  3F2D A;  5EKL A;  2LKV A;  1LT3 D;  4MIU A;  3GTM H;  1OO9 B;  2G9D A;  4CJ2 C;  5ELC A;  1RTO A;  1ESF A;  1JJ2 A;  5C3X A;  1VQ8 A;  1TY2 A;  4K5W A;  3IFD A;  3Q0A A;  1ZEQ X;  3SR1 A;  2K28 A;  2YTX A;  1DM0 B;  4ULL A;  3RUZ A;  1D1I A;  3E9I A;  3S2D H;  1A2U A;  2WB1 B;  3E0J A;  1RL2 A;  3KF6 B;  4C56 C;  3HFZ B;  1VF5 C;  2OCE A;  3I4M H;  1VF7 A;  2F03 A;  1JJC B;  3BJU A;  1LTT D;  3TRE A;  3H3V H;  1V9P A;  1WTX A;  1VQD A;  2ZXO A;  3OOC A;  1D6E C;  5M3F G;  1JWU D;  4LFA L;  3ZYY X;  4RAU C;  4A4I A;  4PMW A;  2PW5 A;  1UE7 A;  4B08 A;  4KKS A;  3NE5 B;  3ERS X;  1XNQ Q;  4BXX G;  1GVP A;  2ZJP A;  5C44 B;  3UE0 A;  5M3M G;  5CV5 A;  2L11 A;  4C3I G;  3URY A;  2AWN A;  1W6J A;  2WAQ G;  5JEA G;  3HOW H;  2NZH A;  4XXE A;  4K2L A;  2PPB C;  5D14 A;  1STH A;  4DV4 L;  2R7D A;  5IGD A;  4B3S L;  1J8I A;  2F0K A;  3GDE A;  1A8V A;  3GTP H;  4P72 A;  5ELB A;  3GTO H;  4P2C B;  2K4K A;  4CHT B;  2JA8 H;  2B63 H;  2A6E D;  4A3B H;  4K2K A;  3OTO Q;  1ROD A;  2YV5 A;  3J80 E;  1ILP A;  4J6H A;  4HCE A;  1UWV A;  2HUG A;  3PUY A;  2Q8I B;  1E22 A;  2ZT9 C;  4IOA A;  4TKO B;  1A2T A;  1QG7 A;  2IJ0 A;  2KOL A;  1T5X D;  4GNX B;  4UP8 A;  4MTK A;  3EA6 A;  4DR3 Q;  3TRZ A;  3CU7 A;  3NQI A;  1EY8 A;  3RD4 A;  1BNZ A;  1B3A A;  4DAP A;  5K5P A;  4DXF A;  4ILW A;  4BY1 H;  3S1Q B;  1RCV D;  1F2Z A;  4H02 A;  3UDX A;  3GTJ H;  1Y14 B;  1SFO H;  4LFB Q;  1E1T A;  3D6W A;  1TII D;  5M5Y H;  2K5D A;  1WTQ A;  3BZK A;  4JI7 L;  5COY A;  4PG3 A;  1IYV A;  4K5V A;  1IBM L;  2KEN A;  3H3V C;  5BR8 L;  4LK1 C;  1EU3 A;  1A3U A;  2IX0 A;  1G51 A;  1FNV A;  1QUQ A;  2H1E A;  3PUX A;  4DGZ A;  2I46 A;  1XMQ L;  1EY6 A;  1RD9 D;  4KV6 A;  2KBN A;  1TWG H;  1UE6 A;  2MQH A;  3D3R A;  1N32 Q;  1YNN D;  2XGT A;  3QO2 A;  4U68 A;  2R61 A;  1NSN S;  1ZKO A;  4IUU A;  4A3D G;  2F0E A;  5IT9 L;  4BS9 A;  1K3R A;  1H9J A;  1SYC A;  2HHH Q;  4OHJ A;  4A3I B;  3OPO A;  3UDF A;  4RCO A;  5FJ8 H;  1VQK A;  4HJ5 A;  3C1E A;  2HT1 A;  2N78 A;  4FDB A;  1SYB A;  3S2H B;  2FFK B;  2O5J C;  3LWU A;  4DK3 C;  2RCF A;  2HCI A;  4A3K G;  2EVB A;  2F3W A;  1K83 B;  4HIM A;  4CGY B;  3T1Y L;  4V19 0;  3I8Z A;  4DV7 L;  3E5S A;  1PH2 A;  3FPP A;  4OX9 Q;  2L15 A;  4GLX A;  1DYQ A;  1QNK A;  2E5L Q;  1HZB A;  4J15 A;  3HP3 A;  2VZA A;  4UAI A;  1IW7 D;  4DR2 L;  2N3S A;  1IBL L;  1B50 A;  5BN4 A;  5IP7 G;  4LF9 Q;  4NDX A;  3TS2 A;  3U9S A;  1HR0 Q;  4FYD A;  2RDH A;  2QDB A;  4K5X A;  3STB C;  1W2B A;  4JCV E;  3H0G H;  4L5Q A;  2X6G A;  1JWS D;  1SMY D;  1YHQ A;  1I4R A;  3PO3 H;  2NB0 A;  4DR7 Q;  5LMN Q;  1TWF B;  3S1N H;  4EVO A;  4H44 C;  1A3V A;  2VL6 A;  1XX8 A;  4WRD A;  3I4M B;  3ERQ A;  2QDL A;  5JVH 3;  1CHQ D;  1H9R A;  1CUK A;  3HKS A;  1PXU A;  5BN3 A;  3J81 E;  3ULL A;  3HOV B;  5EBC A;  3N6R A;  5C0X H;  2R92 B;  1V1O A;  4RGT A;  4DV2 Q;  1A15 A;  4B3T Q;  4FF4 A;  1F9P A;  3P20 A;  2RSN A;  1M4V A;  1VQC A;  4DV6 L;  1GUT A;  2KEE A;  3CC7 A;  1R4P B;  3P75 A;  1EWH A;  1XPR A;  1LTI D;  2A69 C;  3TME A;  2DNC A;  3PO2 G;  1BO0 A;  3GTL B;  1A63 A;  1ICW A;  1E2W A;  1SNO A;  3AFP A;  3HOX B;  4C1N I;  4A3C G;  2R93 H;  4M1U B;  2D2C C;  4R1J A;  4C1N K;  1CM9 A;  2FMC A;  5DAU A;  1XMO Q;  3A0J A;  5J22 A;  3BDO A;  3BU2 A;  1SSO A;  5IGG A;  1Q90 A;  4C3H H;  2NVQ B;  1OXU A;  1QB5 D;  2JA8 B;  5IYB H;  4A3B B;  3GD7 A;  5CV9 A;  2RSO A;  3H94 A;  5IP9 H;  3DM3 A;  4LFC L;  1SRO A;  2F4V L;  2LS0 1;  4GS3 A;  2RDF A;  4HMI A;  2F0F A;  4DUZ Q;  4JI4 Q;  5M9O A;  1EQQ A;  2M2L A;  5LL6 S;  3AFQ A;  3FEW X;  4JI6 L;  1B4O A;  1JWM D;  3MFY A;  2ZM6 Q;  4IZ8 A;  1L0X B;  4LF8 Q;  5M5Y B;  3D4W A;  1PHJ A;  1VCI A;  2C5C A;  1WD1 A;  1G2S A;  3SK5 A;  3GTK H;  3M4P A;  4QUC A;  3S1R H;  2HQL A;  4KHZ A;  3S15 B;  3D8G A;  1S4Z A;  1WTV A;  2Z6B A;  3I2Z A;  4G57 A;  1M1K C;  4G7O C;  1PRT C;  1HQR D;  1V1Q A;  1N33 Q;  2JA7 B;  1LTB D;  5JEA J;  3MWY W;  4HSP A;  5KYL A;  3NTH A;  4LW1 A;  1Z6H A;  2AMC B;  2ZTD A;  1YNJ C;  2CHB D;  4F88 A;  3J80 i;  1N9W A;  1JOR A;  1JOK A;  4LUZ A;  3EIV A;  1XYI A;  4IFD H;  2F1M A;  3CCE A;  2JA5 G;  2BH2 A;  4TQU S;  1L1O A;  4O0A A;  2HQE A;  1CKM A;  5I9P A;  3PIO A;  1T9H A;  2CFM A;  2JJQ A;  1BBX C;  1PRT F;  3MXG A;  5IWA Q;  4HIK A;  1HZC A;  1E2Z A;  1PA6 A;  3PSI A;  2VQF Q;  1LAB A;  4HID A;  1DD2 A;  2QIL A;  4ABN A;  1CTM A;  5A2Q L;  1QVF A;  3X3N A;  1LTL A;  2UXB Q;  2L1B A;  4RWS C;  4YWM A;  4LNQ A;  2DN8 A;  1MI2 A;  4MNO A;  3HOZ G;  1IYJ B;  2BCO A;  1GUN A;  2G5D A;  3QOL A;  3K6O A;  2K14 A;  4OEL B;  3L0O A;  3GTG H;  1HTL D;  2LSS A;  2VUM G;  4QCL A;  5I2X A;  5IYD H;  1AFP A;  1B9M A;  1O7I A;  3CF5 A;  1BCP C;  3CRL C;  3S16 H;  3M4Q A;  1TWC H;  4V0B A;  4BY7 G;  2EJF C;  3QG1 A;  4BWG B;  5EPJ A;  4ZAI A;  1SNM A;  4XYO A;  3HOY H;  5JOB A;  3W3A A;  5IY0 A;  3OTO L;  1PRT B;  2FXQ A;  3R2T A;  3QWN A;  1KL9 A;  1I4X A;  1BBW A;  4PMB A;  4FF1 A;  1NMF A;  4KD4 A;  3T56 B;  4JYA Q;  2A68 D;  4MZ9 A;  2V1C C;  1KRS A;  2WAQ B;  4XDX A;  1CKO A;  4X3T A;  5IGF A;  4DR3 L;  2UUA Q;  1C4Q A;  1BCP F;  4GOP A;  3PIP 3;  5FLX E;  4UDU C;  2K33 A;  1LLR D;  1EEF D;  4F8M A;  5D3D A;  4RKL A;  2R93 B;  4LFB L;  3RLN A;  1U9R A;  3NTI A;  1STE A;  2IX1 A;  2F4I A;  1R9T H;  5IE8 A;  2K03 A;  1I94 L;  1CKN A;  1XNR Q;  2F3I A;  2VB2 X;  1HUN A;  4P73 A;  3RZO H;  3H91 A;  2GVB A;  3J7A 5;  3NBH A;  1F77 A;  2OXP A;  2Q2T A;  2B2V C;  1EZ6 A;  3MEH A;  2NN6 I;  3PUV A;  3J81 i;  1HR0 W;  3J81 j;  1N32 L;  1NCV A;  5D3I B;  1IYU A;  1VQH A;  1UEA B;  4A75 A;  2HHH L;  2D5D A;  1VQI A;  5LMN W;  2VW9 A;  1EOT A;  3KK7 A;  1EU4 A;  5I9O A;  4A93 G;  4NPS A;  2F3V A;  3K7U C;  1B1Z A;  2HDM A;  2OTJ A;  5HY6 A;  2XRQ D;  2NN6 H;  4WJ4 A;  5NUC A;  4YCV A;  1K8A C;  4AQY Q;  5C5M A;  3CCJ A;  1YVC A;  1PFM A;  4KHV A;  1T5E A;  3V96 A;  4OX9 L;  5DM6 3;  4BA1 I;  3KUP A;  3BYT B;  1QUQ B;  1JJG A;  3MZ5 A;  1XXG A;  4IAL A;  3K5L A;  2O4X A;  1WTW A;  4CKB A;  4DR1 Q;  1DZ1 A;  2NBF A;  1G29 1;  1GO3 E;  3CPF A;  4LF7 Q;  1HR0 L;  4BBS B;  1X3G A;  1GXD C;  1EUJ A;  2F0G A;  2A74 C;  1X54 A;  2A6H C;  4QUF A;  1EQT A;  4LF4 Q;  4NXM Q;  4MTN A;  2WII B;  3HKZ B;  1EWI A;  1SND A;  2NZO A;  5C44 H;  5EPL A;  2K52 A;  5F2D A;  1STY A;  5LMN L;  2L5T A;  4O42 A;  4BBR H;  3S14 B;  1P8L A;  1PH5 A;  4P75 A;  2HDL A;  1SXT A;  3S24 A;  2F0W A;  3DWQ A;  4H13 C;  1PLF A;  2BA1 A;  3AQQ A;  5CR3 A;  5ELN A;  1MKH A;  4X6A H;  5ELD A;  1V1P A;  4OGQ C;  3L9A X;  1EFI D;  4DV2 L;  4B3T L;  4JI0 Q;  4U67 3;  2X69 A;  4RCN A;  2EYO A;  2KED A;  4F7X A;  5C3E H;  3MA2 B;  2B2Y A;  2VQE Q;  5KNB A;  1NUC A;  3KBG A;  4A3M G;  1KIX A;  3R2I A;  2MGS A;  3TP7 A;  2Q2I A;  3KYH C;  4RHR A;  3BZC A;  4X62 Q;  3QIA A;  2R7F A;  4EX5 A;  2GVA A;  2EOT A;  4R4O A;  2K1B A;  2XVS A;  2EDG A;  1VQM A;  1TY0 A;  1CSQ A;  1I4P A;  3HOW G;  1K28 A;  3C2P A;  3U4Z A;  2MHV A;  2F0O A;  1L2F A;  1XMO L;  3NUC A;  4YWK A;  2QCP X;  4IUT A;  4R4I A;  4S3S A;  2Q2U A;  4B3M Q;  1CT1 D;  4A3L G;  2B63 G;  2JA6 B;  5E4W C;  5GAD C;  1GOZ A;  1JC7 A;  4WJW A;  1YZ6 A;  4UP9 A;  4JI8 Q;  4RH6 A;  5JPN C;  1Y1W H;  1GHK A;  3T4A C;  2EPB A;  1HNZ Q;  4IO9 A;  4OWW B;  2PQA A;  1MIU A;  2PZT A;  1I50 H;  5KEE A;  3IL8 A;  4QMG A;  1Y69 U;  1RKN A;  1SBB B;  3I91 A;  5CBA E;  3L7Z C;  2J0T D;  4A3I H;  1KHI A;  2L4N A;  4GKJ L;  1F9R A;  2L12 A;  3E6Z X;  3CCM A;  2JYO A;  2BH8 A;  3S2H H;  1YHB A;  2BE5 C;  1ZYR C;  5GRO A;  3N52 A;  1HPC A;  4KN4 C;  1C9O A;  4JOI A;  3RZO B;  1K83 H;  4HJ9 A;  1EY4 A;  1JT8 A;  2H5X A;  1MGS A;  4X64 Q;  2A8V A;  2B39 A;  3VR4 A;  1JB3 A;  5HUR A;  5FK9 C;  1N33 L;  2L55 A;  3CKI B;  2KUM A;  1YJ9 A;  3LWE A;  3OMC A;  4HJA A;  1K0R A;  1S40 A;  4YCU A;  5C4X B;  4RG1 A;  3HZX A;  3W1B A;  2AUJ D;  1EYG A;  4GNX C;  1HQM C;  1K9M C;  1TWF H;  2MUY A;  3OHX C;  1IKL A;  1PV4 A;  4AH6 A;  5CBE E;  1JE4 A;  1X6O A;  2RF4 A;  1Z7T A;  4CJ1 B;  1VQF A;  3GTQ B;  3GQB A;  3HOV H;  1CSP A;  4L63 B;  2VQF L;  1SE2 A;  2MJ8 A;  2R92 H;  4HTH A;  1HNX Q;  1IBK Q;  5JPM C;  5C4H A;  2KVM A;  5G3L F;  1B8A A;  3AU7 A;  5JJL A;  1O80 A;  1XTC D;  3NP8 A;  3FKI H;  2UXB L;  5KRU A;  1FVI A;  4O2D A;  2O2L D;  4FP5 D;  1QZH A;  4EQO A;  3T1H Q;  5C4J H;  1WI5 A;  4DV0 Q;  3PIP A;  2SNS A;  3MTS A;  1SRU A;  3JAM i;  3H0G G;  1FJG Q;  4ZKB B;  1QIL A;  4KJO A;  1PYB A;  3GTL H;  4GOP C;  1VQ5 A;  3PO3 G;  4CDC C;  1EEI D;  3HOX H;  1HH2 P;  1L1O B;  4BBR B;  3L2P A;  4FNF A;  4ID6 A;  4UP7 A;  5GAE C;  4JK1 C;  1JOQ A;  2GN5 A;  2XN9 C;  5C0X G;  1WTH A;  3EVQ A;  2KHJ A;  4A3J B;  1XPO A;  2PCF B;  1UUP A;  1HA5 A;  4X66 Q;  3PIO 3;  2NVQ H;  2ALY B;  3MXU A;  1J6Q A;  3DXJ C;  1IL2 A;  5C3E B;  4JYA L;  4H0L C;  3G7L A;  3S9W A;  2QA4 A;  2EYL A;  2EZV A;  1ICF B;  4OIJ A;  1AZP A;  2EE1 A;  1QWY A;  1F9Q A;  3BG3 A;  5IT9 c;  2UUA L;  3U4V A;  2BDN A;  1K8M A;  1KLU D;  3FVQ A;  4QF4 A;  3U58 A;  1OXT A;  1DJR D;  1EY9 A;  3D4D A;  4DV5 Q;  3PMF A;  1PZJ D;  2KHS A;  1Y1V G;  2R7Z G;  2B8G A;  1B9N A;  4R8I A;  3D31 A;  2Q8R E;  4B9X A;  5FOB B;  3HEJ A;  3FHW A;  3OWE B;  1PH8 A;  4DR4 Q;  1X32 A;  4K8I A;  3I4N G;  1ML0 D;  2JN4 A;  1XPU A;  2WFW A;  1MSG A;  4C3H G;  1HCZ A;  4IUR A;  1J5E Q;  1KXL A;  3T13 A;  2A1A A;  3CD6 A;  4DNI A;  1UE1 A;  1YIT A;  4CDD C;  3S15 H;  3EBE A;  1WCM B;  5FO8 B;  1PH3 A;  5IP9 G;  1Q82 C;  1Y1W B;  3VYS A;  5FO9 B;  2JA7 H;  2A6E C;  3AMU A;  1BKB A;  4GOP B;  2NTS A;  1I50 B;  2CW0 C;  4C2M B;  2DUD A;  1KAA A;  3PCO B;  1Q1E A;  4DV3 Q;  4OON A;  4LJZ C;  4UY8 C;  5IGC A;  4CJ0 B;  5ELO A;  4KD3 A;  1LM0 A;  2Z0S A;  4JC0 A;  4A3F G;  1EIY B;  4TRD A;  1FD7 D;  4GN4 B;  2B2U C;  4Z9C B;  1SJE D;  5EQ0 A;  3TS0 A;  5AJ3 Q;  1CKN B;  4HN7 A;  1EWC A;  3STB D;  2EYH A;  2I0Q A;  4L5S A;  2SDF A;  2B2T A;  3NBH B;  4R4Q A;  5FLX L;  4DR1 L;  2LMC B;  2IY5 B;  3FPU B;  1IHZ A;  1S5E D;  5GAG C;  3HOU G;  1YEZ A;  4LF7 L;  4X65 Q;  4C3J G;  1A0I A;  3RZD B;  1GUS A;  2N88 A;  3M7G A;  2I5M X;  4NXM L;  4LF4 L;  3S1M H;  2R3Z A;  3TDQ A;  4IFD G;  1X9N A;  3NHH A;  2VNU D;  1KAB A;  2B3G A;  3RN2 A;  5CV7 A;  3JAM L;  1LTR D;  2NUC A;  2F0Q A;  2K5W A;  1AW7 A;  1WTP A;  4GKK Q;  3A56 A;  4X3K A;  4DF7 A;  1EQR A;  5LL6 X;  2A69 D;  4DAY A;  2KCN A;  1SDF A;  4JI0 L;  3OWF A;  3LNN A;  2OQ0 A;  2L0C A;  3G4S A;  1EYA A;  4BXX H;  4KKT A;  2K5V A;  2VQE L;  3VA7 A;  3FKI B;  2EIF A;  3CCS A;  4ZLT F;  1VQO A;  4C3I H;  2UXD Q;  1TQO A;  3BVG A;  5C4J B;  5IYC H;  3ER0 A;  1HHV A;  4X62 L;  1HJP A;  5CYU A;  4BA2 I;  1I6H B;  1S5B D;  3K5N A;  1ONL A;  5CV6 A;  4HSV A;  5M5W B;  5IYD G;  5IGB A;  1F9S A;  4WOR A;  1EIH A;  1KQS A;  1LTA D;  3RR5 A;  4AYB B;  1VQL A;  4J1M A;  5KYI A;  1A6X A;  1C0A A;  1FNU A;  1PYS B;  3BZD B;  1SMY C;  1V1P B;  2MFI A;  3SK8 A;  3TP5 A;  1DOL A;  3MHB A;  4B3M L;  3J7A V;  2WB1 E;  1VQ6 A;  3HOY G;  2OQK A;  1GM5 A;  1D1K A;  3I4L A;  4A76 A;  1QZG A;  1EFW A;  3DWP A;  3CQZ B;  1HNZ L;  2E2I B;  3I73 A;  2NWG A;  1DXM A;  1TWH H;  3Q22 A;  2OT2 A;  3SK4 A;  4GN5 A;  4A3E B;  4ALP A;  1GHJ A;  4JW0 A;  3TBI B;  3K7A B;  2NZ1 D;  2FJ2 A;  2EY6 A;  3VR6 A;  2IWH A;  3K80 C;  1PZI D;  3V05 A;  4HED A;  1YNJ D;  3KDF B;  4DR5 Q;  1L0Y B;  4OEM B;  5CC4 A;  3TP8 A;  4N8F A;  1UAP A;  4FO2 A;  1C8C A;  2RHQ B;  3RNU A;  2NTT A;  4X64 L;  2K5H A;  4NW2 A;  4ZCK A;  2DJF C;  2EYP A;  4JG2 A;  5EBD A;  5CGK A;  2KHI A;  3AYH B;  2XTI A;  3HGB A;  2Y0S B;  1SE8 A;  4DU9 A;  4CDF C;  2PQA B; 
#chains in the Genus database with same CATH homology
 1C7Y A;  3F2B A;  4BBS H;  3K7U C;  2OTJ A;  4K0K L;  1FL0 A;  1UEB A;  5HY6 A;  4Y52 H;  2D0P A;  2N8N A;  1SLJ A;  3F2D A;  4WJ4 A;  2D62 A;  5FLM G;  4JV5 Q;  2BA0 A;  4YCV A;  3PF4 A;  5C0X J;  4YY3 Q;  3CPW A;  1K8A C;  4AQY Q;  2ID0 A;  1NTG A;  4JBM A;  3CCJ A;  2WB1 G;  1YVC A;  3GTM H;  1JJ2 A;  3VDY A;  3MXN B;  1VQP A;  1K8G A;  1VQ8 A;  4OX9 L;  4BBS G;  4BA1 I;  2R6G A;  4L5R C;  4YHH Q;  1QUQ B;  1JJG A;  3S14 H;  3UDG A;  1RIP A;  2YTX A;  4DR1 Q;  3IRB A;  1G29 1;  1GO3 E;  1S72 A;  3K81 C;  3HKZ G;  3CPF A;  3E9I A;  5J3B A;  3S2D H;  3CC2 A;  5IP7 H;  4LF7 Q;  1RL2 A;  3FP9 A;  2OWO A;  1HNX L;  1HR0 L;  1X3G A;  1KRT A;  3KF6 B;  1IBK L;  3NEL A;  3HFZ B;  1EUJ A;  1X54 A;  4R4T A;  2OCE A;  3I4M H;  4NXM Q;  1KD1 C;  4LF4 Q;  1JJC B;  1AH9 A;  3BJU A;  2MO1 A;  4MTN A;  3TRE A;  3H3V H;  1EWI A;  3E9H A;  2NZO A;  5C44 H;  1EOV A;  2K52 A;  2IHE A;  5M3F H;  2HIX A;  5LMN L;  3T1H L;  3M7N A;  2K75 A;  1V9P A;  5C0X I;  2C35 B;  4BBR H;  1XNQ L;  1P8L A;  1PH5 A;  4P75 A;  1JE5 A;  1ASZ A;  1FJG L;  1IZ6 A;  1VQD A;  3S24 A;  1UE5 A;  5C44 G;  5JJI A;  5M3F G;  2BA1 A;  4QL5 A;  1D7Q A;  3AQQ A;  5ELN A;  1MKH A;  4LFA L;  4B3R Q;  4OWT B;  4X6A H;  5M3M H;  4A4I A;  4PMW A;  4LF5 Q;  2N49 A;  1UE7 A;  4DV2 L;  2CQO A;  4B3T L;  4QIW E;  4DV1 Q;  4JI0 Q;  1HNW L;  2ATW A;  1PH1 A;  3ERS X;  4QGU A;  1XNQ Q;  4BXX G;  4JI2 Q;  1GVP A;  2E8G A;  2PI2 E;  1IXR A;  2ZJP A;  3KFU A;  1I5F A;  1DGS A;  4DPG A;  5C3E H;  4R4C A;  3UE0 A;  5M3M G;  2VQE Q;  2Q2H A;  3A5Z B;  4X66 L;  2AWN A;  4A3M G;  2WAQ G;  2QGQ A;  4LUV A;  5JEA G;  1KIX A;  3HOW H;  2NZH A;  4JI3 Q;  2Q2I A;  3KYH C;  2Z6K A;  2JA6 H;  2B29 A;  3BZC A;  4X62 Q;  4DV4 L;  2R7F A;  1Q8K A;  2R7D A;  4EX5 A;  4B3S L;  2GVA A;  4R4O A;  3CCL A;  4OO1 G;  3GDE A;  1A8V A;  4NXN Q;  1VQM A;  1YNX A;  4P72 A;  1CSQ A;  3GTP H;  2NVY H;  3HOW G;  3GTO H;  1NE3 A;  3U4Z A;  2JA6 G;  4A3C H;  2K4K A;  4OWX B;  3RN5 A;  2JA8 H;  1L2F A;  1XMO L;  2B63 H;  4JOI C;  2ZTE A;  1BBU A;  4A3B H;  3OTO Q;  5E7N A;  4DV5 L;  2YV5 A;  1WOC A;  1UWV A;  3J80 c;  4JI8 L;  2UUB Q;  3PUY A;  4YWK A;  1E22 A;  1Z9F A;  3EN2 A;  4POG A;  1GKH A;  4P74 A;  4IOA A;  1Y1V H;  3F2C A;  4R4I A;  2R7Z H;  2Q2U A;  1VQE A;  4B3M Q;  4DR6 Q;  1PFS A;  4A3L G;  2B63 G;  1V43 A;  5K36 G;  5GAD C;  4GNX B;  4UP8 A;  4DR3 Q;  3TRZ A;  3G6E A;  1U0L A;  3I4N H;  2RHS B;  1YZ6 A;  3KLW A;  4UP9 A;  4JI8 Q;  4EQ5 A;  1J5E L;  4BY1 H;  1PH4 A;  4KHP L;  1Y1W H;  3PV0 A;  1VQJ A;  1HNZ Q;  4GLA C;  4H02 A;  4IO9 A;  3UDX A;  3GTJ H;  1Y14 B;  1SFO H;  2PQA A;  1MIU A;  4OWW B;  1GD7 A;  3KJP A;  4LFB Q;  1E1T A;  1I50 H;  2IT1 A;  1XTD A;  5M5Y H;  4LF6 Q;  3BZK A;  4JI7 L;  3M4O H;  4IFD J;  4PG3 A;  1Q86 C;  1IBM L;  4JI5 Q;  2KEN A;  3L7Z C;  2NVT H;  3E0E A;  4JI1 Q;  4A3I H;  1KHI A;  1WFQ A;  3M3Y H;  1N8R C;  4GKJ L;  1N36 Q;  5BR8 L;  1X3F A;  2I5H A;  3J7Z C;  3DLL A;  2IX0 A;  1G51 A;  3D0F A;  3CCM A;  4DV3 L;  1QUQ A;  2BH8 A;  2KCM A;  3PUX A;  3NEM A;  5C4X H;  3S17 H;  3S2H H;  3JC6 6;  1YHB A;  1XMQ L;  5GRO A;  4A3D H;  1I3Q H;  4A3I G;  2KBN A;  1TWG H;  1C9O A;  3K8A A;  1Q12 A;  1UE6 A;  4JOI A;  1YHA A;  4AIM A;  2MQH A;  1QVG A;  4A3F H;  1K83 H;  2DGY A;  3A74 A;  2PNH A;  2MNA A;  4HJ9 A;  2XGT A;  4GKJ Q;  1N32 Q;  1NBW A;  1U5K A;  2HIV A;  2F52 A;  3KF6 A;  3CCV A;  1E24 A;  2H5X A;  1JT8 A;  5AJ3 L;  5C4X G;  4X64 Q;  2A8V A;  1B7Y B;  4A3D G;  1PVO A;  4IPH A;  1K3R A;  2CWA A;  3I56 A;  1OXX K;  2HHH Q;  1N33 L;  4QQB X;  1SMX A;  1HZA A;  1Z47 A;  3UDF A;  4A3K H;  5FJ8 H;  1VQ4 A;  1N34 Q;  3U50 C;  3PF5 A;  1JMC A;  4IFD I;  3GTQ H;  1VQK A;  4HJ5 A;  2HT1 A;  1YJ9 A;  2N78 A;  4GLV B;  4FDB A;  1LUZ A;  4HJA A;  1K0R A;  2NN6 G;  4YCU A;  3RLO A;  4RG1 A;  1S40 A;  2E5L L;  4K0K Q;  3W1B A;  4DK3 C;  5H1S E;  4X65 L;  2D0O A;  1M90 C;  2ASB A;  3HOU H;  2E2J H;  3MEF A;  3K0X A;  4A3K G;  3OW2 A;  4LF9 L;  1EYG A;  4C3J H;  4PZ8 A;  4GNX C;  4HIM A;  3T1Y L;  2CCZ A;  1YI2 A;  4DV7 L;  1K9M C;  1PH2 A;  3AEV A;  4LUO A;  1TWF H;  2JA5 H;  4OX9 Q;  2L15 A;  4GLX A;  2E5L Q;  1HZB A;  4J15 A;  1PV4 A;  1X56 A;  4AH6 A;  2VZA A;  4XIG S;  4DR2 L;  1XJV A;  2N3S A;  1X6O A;  1IBL L;  2JE6 I;  5IP7 G;  1AE2 A;  2QEX A;  1EIF A;  2RF4 A;  4LF9 Q;  1VQF A;  3TS2 A;  3HOV H;  4DR7 L;  1CSP A;  2VQF L;  2OTL A;  2R92 H;  4DV0 L;  1JB7 A;  1KAW A;  1HNX Q;  1HR0 Q;  1IBK Q;  3I4M G;  3ULP A;  4P71 A;  1B8A A;  3STB C;  5JJL A;  1W2B A;  3I4O A;  4JCV E;  3H0G H;  4L5Q A;  3FKI H;  3H15 A;  2UXB L;  3HOV G;  1FVI A;  4O2D A;  1QZH A;  2R92 G;  4A3J H;  1YHQ A;  3PO3 H;  4DR7 Q;  5LMU L;  5LMN Q;  3T1H Q;  4BBR G;  3S1N H;  5C4J H;  1WI5 A;  2VL6 A;  3PIP A;  4DV0 Q;  1NJI C;  1SRU A;  2BH2 A;  1K73 C;  1AE3 A;  2YTY A;  3JAM i;  1YIJ A;  3H0G G;  1FJG Q;  1CUK A;  1VQB A;  2WP8 J;  3HKS A;  3A5U A;  1PYB A;  1H95 A;  3ULL A;  3GTL H;  4GOP C;  4A3J G;  1VQ5 A;  3PO3 G;  4LFA Q;  4KI0 A;  3G48 A;  3HOX H;  1HH2 P;  1L1O B;  2VUM H;  4KLK A;  2JQO A;  2UUC L;  3L2P A;  4DV2 Q;  1HZ9 A;  4UP7 A;  5GAE C;  4B3T Q;  1HNW Q;  5HGQ A;  2GN5 A;  5C3E G;  4GNX A;  4L5T A;  4IOC A;  3PO2 H;  1VQC A;  4BY7 H;  5C0X G;  4DV6 L;  1XPO A;  2KHJ A;  1OXS C;  1VS0 A;  3HOX G;  1VQA A;  4QY7 A;  3CC7 A;  1X3E A;  4X66 Q;  1WYD A;  3PUW A;  2NVQ H;  2ALY B;  4DUY L;  1B70 B;  1FGU A;  1J6Q A;  3CME A;  1XPR A;  4HJ7 A;  3F8T A;  4DAY B;  1IL2 A;  3PO2 G;  2K5N A;  4JYA L;  3PGZ A;  1A63 A;  1D8L A;  1OXV A;  2QA4 A;  3KDF A;  4DV4 Q;  3AFP A;  3PUZ A;  4B3S Q;  1W3S A;  2IHF A;  1NMG A;  2JEB I;  4POF A;  5IT9 c;  4DR4 L;  2JA8 G;  4A3C G;  2UUA L;  2AWO A;  2R93 H;  4UPA A;  4R1J A;  3U4V A;  4A3B G;  3U58 A;  3RLF A;  3UE1 A;  3A0J A;  4OXP A;  1XMO Q;  1OXT A;  4DV5 Q;  3BU2 A;  1WCM H;  1Y1V G;  1VQ7 A;  5JJK A;  2UXC Q;  2R7Z G;  4C3H H;  3TEH B;  1OXU A;  3CCQ A;  2UU9 L;  3D31 A;  1YJW A;  5IYB H;  4DR4 Q;  3FHW A;  1PH8 A;  3GD7 A;  2PI2 A;  1VQG A;  4DUZ L;  3KF8 B;  3W5O A;  4GN3 B;  4C2M H;  4JI4 L;  3I4N G;  1XPU A;  1WCM G;  2WFW A;  4BY1 G;  1E1O A;  5IP9 H;  1Y1W G;  1J5E Q;  3DM3 A;  1KXL A;  2A1A A;  1SRO A;  4LFC L;  2LXK A;  3WWV A;  2ZM6 L;  1OTC A;  2F4V L;  3CD6 A;  4KHP Q;  4GS3 A;  4DNI A;  1UE1 A;  3GO5 A;  4LF8 L;  3ZJY C;  1YIT A;  4JBJ A;  1VQN A;  3S15 H;  4DUZ Q;  3EBE A;  4JI4 Q;  1EQQ A;  1L1O C;  4JI6 L;  1Q46 A;  3AFQ A;  5IP9 G;  1PH3 A;  1MJC A;  1Q82 C;  1WJJ A;  4JI7 Q;  1IBM Q;  2JA7 H;  2VS1 A;  4QJF A;  2ZM6 Q;  4HJ8 A;  3NEN A;  1BKB A;  5BR8 Q;  4GOP B;  4LF8 Q;  2DUD A;  3PCO B;  1PH9 A;  1Q1E A;  4DV3 Q;  1PHJ A;  4OON A;  4UY8 C;  1VCI A;  1XMQ Q;  3B6Y A;  5ELO A;  2JA7 G;  1LM0 A;  3CXC A;  2Z0S A;  3KOJ A;  4JC0 A;  4RMF A;  4A3F G;  1EIY B;  2YTV A;  3GTK H;  3M4P A;  4GN4 B;  3RZD H;  3ULJ A;  3S1R H;  1E3P A;  2HQL A;  4KHZ A;  4JV5 L;  3TS0 A;  4AYB E;  4YY3 L;  3CCU A;  4DK6 C;  2JA9 A;  5AJ3 Q;  1CKN B;  5FLM H;  1SN8 A;  4TVA B;  2AHO B;  3I2Z A;  1L0W A;  3STB D;  1PH6 A;  1M1K C;  1ASY A;  2I0Q A;  4YWL A;  4L5S A;  1E7Z A;  1V1Q A;  1N33 Q;  5FJ8 G;  5DLQ E;  5JEA J;  4DKA C;  4YHH L;  3NBH B;  2A19 A;  2ZJR A;  2WAQ E;  2YYZ A;  4R4Q A;  2UXC L;  4LW1 A;  2EXD A;  4DR1 L;  2AMC B;  2ZTD A;  2EQS A;  2IY5 B;  5EAY A;  3J80 i;  1N9W A;  1P16 A;  5GAG C;  3HOU G;  1QVC A;  4LUZ A;  3H3V I;  1YEZ A;  3EIV A;  4LF7 L;  4X65 Q;  5IWA L;  3KJO A;  1A0I A;  3G71 A;  3W1G A;  2I5M X;  3T1Y Q;  3CCE A;  2JA5 G;  2I5L X;  4LF4 L;  4TQU S;  4NXM L;  1L1O A;  3CAM A;  4O0A A;  4DV7 Q;  4GKK L;  1CKM A;  2Z6K C;  2K50 A;  3S1M H;  3PIO A;  4IFD G;  4DR2 Q;  1TWA H;  1T9H A;  2CFM A;  2JJQ A;  4Y7N H;  1X9N A;  1IBL Q;  2VNU D;  5IWA Q;  4HIK A;  2B3G A;  1HZC A;  3RN2 A;  1PA6 A;  1YBY A;  2MO0 A;  3M85 A;  3PSI A;  2VQF Q;  2KCT A;  4GKK Q;  1EQR A;  4HID A;  2ES2 A;  4B3R L;  3FKI G;  4LF5 L;  1I6H H;  3HOZ H;  3CCR A;  2UXD L;  4JI0 L;  3J81 c;  4DV1 L;  4IJH A;  1LTL A;  5M5W H;  4HIO A;  4IPD A;  1QVF A;  3OYY A;  4OO1 I;  2UXB Q;  4JI2 L;  2OQ0 A;  3G4S A;  5LMU Q;  1VQ9 A;  2ZJQ A;  4BXX H;  4YWM A;  4IJL A;  5M5X H;  4LNQ A;  2K5V A;  2VQE L;  1G6P A;  4MNO A;  3HOZ G;  1IYJ B;  3UDI A;  2EIF A;  3CCS A;  2CWP A;  3CW2 C;  3CMA A;  1VQO A;  1Q7Y C;  1Q81 C;  2K14 A;  4JBK A;  4C3I H;  1BVS A;  3L0O A;  3GTG H;  2LSS A;  4JI3 L;  2VUM G;  2UXD Q;  4XTC S;  5IYD H;  4A3M H;  2Y0S E;  3LGJ A;  4LWC A;  5IYC H;  3ER0 A;  1O7I A;  4AYB G;  3I7F A;  1HJP A;  4PZ7 A;  4X62 L;  2UUC Q;  3CC4 A;  3CF5 A;  2YU9 H;  4BA2 I;  3S16 H;  3M4Q A;  1TWC H;  3F1Z A;  4BY7 G;  3ICE A;  4NXN L;  4YCW A;  2VY3 A;  5IYD G;  3CQZ H;  4DV6 Q;  3CP0 A;  5IYC G;  2E2I H;  1KQS A;  1MJE A;  3HOY H;  3RR5 A;  1VQL A;  5IY0 A;  3OTO L;  2FXQ A;  4A3E H;  2AKW B;  3TQY A;  4DUY Q;  2UUB L;  1KL9 A;  1A62 A;  1PYS B;  1BBW A;  1KC8 C;  1C0A A;  4WJ3 M;  1NMF A;  2LXJ A;  2MFI A;  3K7A H;  4B3M L;  4DR6 L;  4JYA Q;  4MZ9 A;  2V1C C;  1KRS A;  2WB1 E;  1VQ6 A;  2NVX H;  1X55 A;  2OQK A;  3HOY G;  3S1Q H;  2R93 G;  1CKO A;  2JK8 A;  4A3L H;  4A3E G;  4DR3 L;  4IPG A;  1GM5 A;  1S3O A;  2UUA Q;  4GOP A;  4A76 A;  1QZG A;  5GAH C;  5FLX c;  1EFW A;  4APV A;  1XNR L;  3HKZ E;  1HNZ L;  4IPC A;  1TWH H;  4JBW A;  2CKZ B;  4LFB L;  5IYB G;  3RLN A;  4GN5 A;  2UU9 Q;  4ALP A;  4LF6 L;  3M9B A;  2RCN A;  3SGI A;  2IX1 A;  4ME3 A;  4DAM A;  4DR5 L;  1R9T H;  5IE8 A;  4NB3 A;  4JI5 L;  1Q1B A;  2JEA I;  4JI1 L;  1CKN A;  1PH7 A;  1I94 L;  2F3I A;  1XNR Q;  1N36 L;  4P73 A;  2PMZ E;  3RZO H;  2E2H H;  2GVB A;  4LFC Q;  3J7A 5;  3K80 C;  1NY4 A;  2F4V Q;  2Q2T A;  1SR3 A;  3KDF B;  1TXY A;  2NN6 I;  4DR5 Q;  3PUV A;  3Q8D A;  3JAM c;  3J81 i;  2ZTC A;  1HR0 W;  4A3G H;  1I94 Q;  3J81 j;  1N32 L;  4JI6 Q;  2Y0S G;  3I55 A;  2RHQ B;  3RNU A;  4A93 H;  4PZ6 A;  1VQH A;  2K5H A;  4X64 L;  5GQO A;  4A75 A;  2HHH L;  4A3G G;  1VQI A;  5LMN W;  2VW9 A;  4JG2 A;  4AQY L;  1X65 A;  1N34 L;  2KHI A;  3AYH B;  2XTI A;  1SE8 A;  1YJN A;  4A93 G;  4NPS A;  2PQA B;  1LYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...