2K33A

Solution structure of an n-glycosylated protein using in vitro glycosylation
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
116
structure length
116
Chain Sequence
DVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDQASKDFNRSKALFSQSAISQKEYDSSLATLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure determination of a segmentally labeled glycoprotein using in vitro glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni
molecule tags Membrane protein, transport protein
molecule keywords AcrA
total genus 6
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k33A00
1LABA 2PCFB 3M4YA 4DNRB 2A6HD 1GUNA 1OXUA 2E75C 3N6RA 2E74C 2JEBI 1PMRA 3D4RA 5BN5A 4KI0A 1IYUA 1CFMA 1Z7TA 1SMYC 3VR3A 2D62A 4G7HC 1Q1BA 4KN4C 3MXUA 3T56B 2D5DA 1HCZA 3BG3A 3T53B 3A8KE 2EJGC 2D2CC 5K36H 2EDGA 1H9SB 1Y8PB 3PUZA 4KKTA 3VR6A 1E2VA 1EWHA 1LACA 1E2WA 2DNEA 2EJFC 3PV0A 1VF5C 3RLFA 2K33A 1A6XA 3IKJA 2A68D 1ZKOA 2B8GA 1GJXA 1IW7D 3MFYA 3HGBA 1IW7C 1O78A 2F1MA 1Q90A 3NE5B 3DXJC 2K7VA 1K8OA 1Q1EA 2E76C 4JK1C 1I6VC 1DD2A 1G291 5C0XH 3A7AB 4IQZA 2IT1A 2KCCA 1GHJA 4H44C 4G7OC 3A8IE 2NN6I 1ONLA 4OGQC 4DK1A 1Z6HA 4OO1H 2ZT9C 3PUYA 1T5EA 2A6HC 3PUWA 4HR7B 2A6ED 5BN4A 5JEAG 5JEAH 2O5JC 1GUGA 1K8MA 2EVBA 3OOCA 4XIGS 1OXVA 2PNRC 2O5IC 1IYVA 1GHKA 1V8QA 1TU2B 5K36G 2EJMA 5KNCA 1B9NA 1FR3A 4H13C 3ND8A 5C0XG 1VDZA 2DN8A 3SDZA 4KHZA 1GUOA 1QJOA 1VF7A 3GD7A 3H94A 2QF7A 3SE0A 5KNDA 2JEAI 3VR2A 2AWOA 2B8FA 2KA7A 1H9MA 3IFTA 1Y8NB 2CW0C 4TQUS 1V43A 1HQMC 4L8JA 1DCZA 3CRKC 5BN3A 3WDNA 1TKWB 3VR5A 2BE5D 2K32A 1Y69U 1H9KA 2BA0A 2NN6H 1YNNC 3W3AA 3A7LA 2NN6G 1Q12A 4KN7C 3GQBA 3TZUA 4KKSA 1HPCA 3I73A 2PPBC 4PV1C 3L7ZC 3OPOA 4KMUC 3QJYA 2BE5C 3ND9A 4BA2I 3BDOA 1HTPA 3I72A 4IFDG 5KNBA 4G7ZC 2YYZA 3P20A 4JBWA 2A69C 1CI3M 3QIAA 3U9SA 2L5TA 3I4LA 3D31A 3FMCA 1VCIA 4I7ZC 1H9SA 2DNCA 1B9MA 3AB9A 1GUSA 3VR4A 4IFDH 2A68C 1GUTA 2AUKA 1O7LA 1E2ZA 3OW7A 3QG1A 4LK1C 3KLRA 3M85A 2V4DA 2JE6I 3A8JE 5A35A 4XTCS 2BDOA 1BDOA 4RCNA 2LMCB 1DXMA 4H0LC 1OXTA 2A6EC 1FYCA 2AUJD 2BA1A 3LNNA 3PUVA 2Q8IB 2R6GA 4BA1I 4DK0A 3VA7A 2JXMB 4OO1G 3PUXA 4GZYC 1H9RA 3FPPA 1CTMA 1YNJC 3T51B 1H9JA 1OXSC 4DNTB 3M7NA 3EQLC 4KKUA 1ZYRC 3LWUA 1OXXK 1Y8OB 4LJZC 3CRLC 2A69D 4TKOB
chains in the Genus database with same CATH superfamily
1EQTA 5EBCA 2EYPA 1PFNA 2ZJPA 3VYRA 3H0GH 4J15A 1C7YA 1NBWA 1JMCA 2HCCA 2CH4W 2K03A 4OO1I 4RGMA 4BBRH 4LFAL 4GN4B 3FVQA 3VYSA 1IL8A 4CDEC 2JQOA 3D3RA 3SK5A 4OXPA 1TWGH 1CM9A 2WAQE 1EU4A 4R8NA 3H0GB 3GTPB 1LT3D 4A3EB 1BBXC 3CW2C 1S5CD 2F0VA 1IBKL 4HSVA 1GHJA 4DR5L 1IL2A 2JA7H 4NB3A 3A8IE 2K04A 4B3SL 2B2YC 1CKOA 3UDFA 4A4IA 3KYHC 4ODGA 5C3XA 3E5SA 1SYCA 1LTTD 3OOCA 2B63G 4UAIA 3KJOA 1B9NA 1FR3A 4OL7A 4ZUJA 4EVOA 4OONA 1MBYA 1HFGA 2Z6KC 2LXKA 2K75A 3S16B 2AHOB 1JC7A 4IJHA 3E3XA 1KNAA 4IJLA 1DCZA 4CKEA 1KL9A 1SXTA 1KIXA 1HR0L 5C4XG 3AMUA 3C46A 3TRZA 3GTQB 4DAYA 1EZ8A 3Q22A 3RN2A 4A3JH 1WTVA 2UUAL 3VA5A 1S5ED 4LNQA 2X6GA 3G6EA 4IPDA 4A3JG 3K5NA 2L4NA 1QCBD 1J8IA 1IBMQ 4XQJA 1CKMA 4EQ5A 1O7IA 3TN2A 3HOYH 4X62Q 1V1PA 4X64Q 2LKVA 1QWYA 1EY9A 1PYBA 1XMQL 1LUZA 2KBNA 2GA4B 2FMCA 4GNXA 3K59A 4MZ9A 1K83B 5IYBH 2EPBA 2VQEQ 4UP9A 5DLQE 1YHAA 3S1RH 3L9AX 1OXTA 2KEDA 3CKIB 4QMGA 2OCEA 2RA4A 1FNWA 5CBAE 1BCPB 1D6EC 1U5KA 2KCMA 4K2LA 4K6LA 4BA1I 2RF4A 2JA7G 4JI1L 3VYUA 1KQSA 3SHLA 2VZAA 4OWWB 2JA5B 2CQAA 1D5ZC 2VS1A 3D4RA 4KI0A 3NTHA 3KOJA 2UUAQ 2AWNA 3S1NB 4WORA 2QCPX 2NVYH 1G51A 1TR5A 1XTCD 4IUQA 1K9MC 3OIQA 3JAMi 2ZTCA 4KKTA 5L37A 4QIWB 4CDCC 4JI2Q 2EJFC 1E0BA 1F77A 1ICFB 2K33A 5C4JB 5BR8L 3EROA 3UE1A 1QUQA 3BYTB 3UDXA 1LV9A 2HQEA 1E7ZA 3F2CA 5M3FB 4C3JH 5KYIA 1S72A 1O80A 2F0HA 1K3RA 5LL6S 5CORA 2R7ZG 3H3VH 1ENCA 2ID0A 1ILPA 5BN4A 3ERQA 3KLSA 3D6CA 2G9DA 4R8IA 1L0YB 3FRPB 4KY5A 1NR2A 1SYFA 3NXWA 1UE5A 3NBIA 4XYOA 4R9WA 5I2XA 3HOWH 4HAEA 5CC4A 2QF7A 2K6AA 5M3FH 4FYDA 1SMYD 1EY4A 2QILA 3MXPA 1EYGA 2CW0C 5JJZA 3HKZE 3CRKC 5BN3A 4UDUC 1G2SA 4BBSB 1M1KC 1BNZA 1MJEA 4JCVE 3BVMA 3W3AA 1SNQA 5G3LD 2NN6G 2RDFA 2AMCB 4P2CB 4ALPA 5EKIA 4UHVA 3FKIH 4KD3A 2YYZA 1KRSA 2F52A 1I4GA 2NZ1D 2MO0A 3X3NA 4R4CA 4DAVA 3FMCA 1Q8KA 1DOLA 4IFDI 3T1HL 1X3QA 5C4XB 3BDLA 2D0OA 4LMQD 4JI5Q 2D0PA 2V4DA 5HY6A 2K5HA 1FYCA 3KFUA 1PHJA 2WB1G 5D3DA 2JXMB 1VQPA 1XYIA 1H9RA 4A3JB 4K0KQ 1YNJC 4F88A 4A3GH 3SVMA 4MN3A 2OF1A 2RQXA 1YHQA 1L0XB 1A3VA 2A69D 3I70A 3OSOA 5JAVA 1LTID 1K0SA 1SMYC 4MHEA 3VR3A 2F03A 5M3MB 1ENFA 1HCZA 3BG3A 1YJ9A 3F1ZA 4FDBA 1CZWA 1CSPA 4TRDA 2HCIA 3Q8DA 3MZ5A 4LF9Q 1S3OA 3NTIA 3NWTA 3TS0A 2SNMA 1WCMH 3I91A 3G4SA 3M4OH 1HNXQ 2VNUD 2RHSB 2B63B 2MO1A 1EYAA 4BY1B 3RLFA 4A3LH 2UUCL 5IWAL 2MJ8A 2EY2A 3HRZC 4A3DH 2NVYB 3L2PA 2QDBA 2FMMA 1JJ2A 4JI0Q 4A3IG 5FLMH 4A3CG 4WFN3 3FP9A 4M8AA 4ME3A 1V1OA 2NN6I 3KBXA 2Y0SB 2ZT9C 3W1BA 1JB3A 5FK9C 3NUCA 2UXCQ 2E2DC 4KLKA 1KDBA 2KCNA 2H5XA 4HJ7A 1RL2A 4H02A 2MUYA 3TEHB 1HFNA 3H0GG 5I9PA 1MSHA 3LWEA 2EOTA 2KECA 4LF9L 3G48A 3GTJB 1QNKA 3TP7A 5M5WH 4KJOA 1HR0W 2VUMB 4KHVA 4QUFA 2NBFA 1S5DD 2F0TA 4BBRB 5FO8B 1EQQA 1A15A 4HCSA 4PV1C 3EVQA 1XNRL 3QJYA 3F2DA 3BDOA 3HOUB 2IX1A 2JA5G 4K0KL 4LUZA 1PRTB 1Q8IA 5ELBA 3JAMc 1YHBA 4XDXA 4DV5Q 2QW7A 2A69C 4JBWA 1WTRA 2PW5A 4C3JG 4R4QA 4J6HA 4JV5L 1FNUA 5DAUA 3RD4A 1YJNA 1XPUA 4HJAA 3RLOA 2AQ3B 4WJWA 1FJGQ 5M3MG 4YCVA 1VQDA 4RAUC 4Y7NB 4IUNA 4DKAC 4HMIA 4X62L 4JI3L 2XWJB 2EE1A 1KLUD 1I50B 4PNYA 2R92G 3OTOL 3QR8A 1JJCB 4UPAA 3DLLA 1JWUD 3K57A 2MNAA 1ESRA 2N78A 2HDMA 5E1FA 3MXUA 3PIPA 2OQ0A 3J81E 1QE6A 2F0SA 3PF5A 5CBEE 3H15A 5C44B 3UDIA 1F9QA 4FXKC 5DM63 3K5MA 5C4ZA 1A6XA 1B53A 3DM1A 1ESFA 2EZVA 2NYZD 3M4QA 3AQQA 4N9TA 4IQZA 1KRTA 2KCCA 4HMJA 1D8LA 3HFZB 4G57A 1SDFA 3CC2A 5JEAG 3A0JA 1EWIA 1SN8A 5JPMC 2F0KA 3PO2G 5ELCA 2BCOA 4RA8A 4KHZA 1XNQQ 2A5HA 2KHSA 1W2BA 3KF6A 5IIFA 3VR2A 2B8FA 1E22A 2O4XA 3CCMA 4X6AH 3G71A 2MHVA 4TQUS 1V43A 2TMPA 5IOCA 3M7GA 4IPCA 2DJFC 1RKNA 1M90C 1QVCA 1I4HA 5IYCG 1GVPA 5EGTA 4DXGA 2DGYA 4A3MB 1EIHA 3WOFA 4HJ5A 4IOCA 3OPOA 1LT5D 2EXZA 1NCVA 3TDQA 1K3BC 2M2LA 3J80E 3D31A 3MEHA 1B9MA 4AYBE 4HIMA 3HOVG 4LF5Q 2AUKA 3U4VA 3HKZB 4HJ9A 4QGUA 2I5HA 4JOIA 3S1QH 2JA6G 3S24A 4XQQA 4H0LC 1VQIA 2VUMG 4OO1G 4EX5A 2L11A 3EIVA 2DJGC 3CRLC 2A74C 3LX0A 4K8IA 1SROA 4KY6A 1X54A 3FKIB 4ZK9B 2K28A 1I94L 3A56A 1JWSD 3A8KE 4QF4A 2E8GA 2EJGC 5BR8Q 1HNZL 3CU7A 5IGBA 4JI2L 1B7YB 4PZ7A 5AJ3L 3NQTA 3GP7A 3PUZA 1XPOA 4IURA 4LAAA 3OHXC 2M9VA 4LF7Q 3FEWX 5IGEA 3JAME 3RZOH 3I4NB 5DNFA 4YCUA 3SR1A 1I94Q 2NVTH 4IPHA 2KENA 5LMNL 2H4OA 2F0GA 4LF8Q 1EIGA 5J1ZA 3UI2A 2E76C 1JE5A 3HOWB 1IZ6A 4DF7A 3CF5A 1SJED 4DXFA 1NNXA 4EQOA 2PQEA 1CZGA 2B2TC 4C2MH 4IPGA 4JVZA 3C1FA 3MA2B 2A6HC 5EJWA 4OEMB 3HOZB 4FXGC 3MEFA 3D6WA 1CA5A 2O5IC 1HNWQ 4LF5L 1IYJB 3BU2A 3T13A 1XMQQ 3V05A 1YITA 3P1HA 4DR4Q 1M4VA 1HQMC 3NWSA 1KDAA 1IBML 2UUBL 3V2TA 4IFDJ 5CGKA 2IPKD 2B2TA 1SFOB 1XXGA 4C3IB 5CV7A 4Z9CB 3SK6A 3K7AH 3A7LA 3PO3B 4C3IH 1YBYA 5I6WA 1HR0Q 1I4XA 4AIMA 2ALYB 1PH2A 4LFBL 2G5DA 3J7AV 3QIAA 4AQYL 2L5TA 1VCIA 3AB9A 1BCPD 3OWEB 2YTVA 1ZEQX 1EY0A 1B70B 2IHEA 1K0RA 1WYDA 4XXEA 2F0NA 2OTLA 1YZ6A 5IE8A 4DK0A 2B29A 3ERSX 3NHHA 4NPSA 4DR7Q 4DR5Q 4BY7G 4LWCA 1SE2A 4DV0Q 3E6ZX 3EQLC 4KKUA 3R8BA 3CCRA 4DV3L 2EQSA 1BO0A 2F3WA 1SE3A 2VB2X 1Q1BA 5IODA 1SE4A 1AZQA 3HOVB 1I6HB 2NVTB 2PQAA 4PG3A 3STBC 3KDFB 2JYOA 4QCLA 1Q86C 4JOIC 3NBHB 2RCFA 3IL8A 4FP5D 3CPWA 2WAQB 3DWAA 4CHTB 1X65A 1N32Q 3HOZG 4DV4L 1QILA 2WP8J 3HGBA 2AKWB 1CUKA 3ZYYX 3S16H 1Q90A 3S15B 1D2BA 1SAPA 1VQEA 3D8GA 3MFGA 1M8AA 1G291 1ILQA 5I9OA 5M5YB 4H44C 4IUTA 2MP1A 4JI3Q 4C3IG 3HOXH 1FVIA 5GROA 1Z6HA 2L0CA 4POGA 5CV5A 1PRTF 4X3TA 3CMEA 2XRSD 4JI7Q 2UXBL 4DR3Q 1JR0D 1K8MA 1FJGL 1JOKA 3ND8A 5KRUA 2XIWA 4YIJA 2XTIA 3IAYA 4R4TA 4NMZA 1O7ZA 4JI8Q 2X6LA 1FD7D 1SR3A 1PH1A 1PH3A 4GKJQ 1A0IA 4L63B 1PTOB 2IW3A 2F0WA 1SNMA 4A3MH 4X65L 3EA6A 3GTGH 1HPCA 3GDEA 2R93B 4P71A 3G7LA 4RWSC 4ZAIA 4NXNL 4YY3Q 4OX9Q 2OWOA 2DY8A 1TWFH 1EUJA 3WWVA 1Q46A 2E2HH 3PSIA 2EYFA 4QUCA 1TWCB 4NDXA 4B3RQ 2EYMA 1GUTA 2ENBA 5CV4A 4DK3C 5M9OA 1J5EL 4U673 4RCNA 3T1YL 5C5LA 2JA8H 5C3EG 1PRTC 2RDHA 1CSQA 3EBEA 2DY7A 3PUVA 2PZWA 3FPPA 4BXXH 3U58A 2WKDA 4ILWA 3TP5A 3MTSA 2WAQG 4E6IA 2JA7B 1UEBA 1Y8OB 1EQRA 1TVXA 5A2QE 2E75C 3L0OA 2CKZB 4JI4L 2VQFQ 1CFMA 4AYBG 5IWAQ 1TWFB 2D5DA 1AH9A 4HCEA 4L5SA 3FPUB 2Y0SE 5HGTA 1E1TA 1S40A 4JI6Q 4DV6Q 1QUQB 1Y8PB 2MGSA 4RH6A 2KOLA 2VUMH 1WTPA 3K80C 2WB1E 2GVBA 3NSWA 4BY7B 1ZKOA 3MXNB 4CGYB 1B8AA 4GN3B 1EIYB 5FLMG 1EEID 4LFCQ 2B2VC 4CDFC 1SYBA 3K0XA 5JJKA 1CHQD 2WKCA 4LUVA 4DAPA 4ZCKA 5IYDG 4PMCA 4OGQC 3JAML 5C44G 2OTJA 1WCMG 1YEZA 4K5XA 2HHHQ 2O5JC 1TY2A 1EY7A 5C44H 5IYCH 2ICIA 4XIGS 4A3KB 1IHZA 1WJJA 1V8QA 1TWHH 2MQHA 4H13C 1A62A 3LGJA 4K2KA 5C0XG 1E1OA 3FDTA 2I5MX 1PH8A 4KY7A 1D5MC 1HZCA 3M9BA 2ATWA 3URYA 3PO2H 2KEEA 3S1MB 5GAEC 4CDDC 4IUPA 1IKMA 1XX8A 3J7YW 4Y7NH 2HQLA 4KKSA 1VQJA 2E5LL 2CH4A 1VQGA 3I90A 3V96A 3NELA 3S14B 3KDFA 2BE5C 4DU9A 3CCVA 2CQOA 4ABNA 2L9HA 1JICA 4GLAC 5KNBA 2JSOA 1TWCH 5M5WB 1N34Q 1SJHD 2RHQB 1Y1VH 4QB4A 2K4KA 3K0YA 4A3GB 3PCOB 3HOUH 3OW7A 3ULLA 4BXXG 2FJ2A 2SEBD 1VMPA 4JYAQ 2N49A 2YU9B 2JJQA 3A54A 4IUUA 2F0EA 5ELEA 4NKLA 2R93G 4LF6L 3QO2A 4ZUIA 3SXHA 1EWCA 5NUCA 3HKSA 4JG2A 4DNRB 5EQ0A 3AEVA 1O7YA 1LM0A 1A8VA 2R61A 1RJTA 2NVXB 1PZKD 5I2YA 3I2ZA 1PTOC 2EYLA 5IGDA 5LMNW 5EKLA 3RZDB 1H9SB 3D4WA 2QDLA 4DUZL 1SFOH 3TREA 2LFNA 3QB3A 2OXPA 3J7A5 1G91A 1VF5C 2RCNA 4GLXA 3IKJA 3ICEA 1EOVA 1A63A 4DAMA 4N8FA 4RHSA 2F0PA 2QKIC 2K7VA 3DXJC 5COYA 4N8X1 2OEOA 1HZ9A 1R9TB 5JOBA 1B3AA 4YY3L 3T16A 1X9NA 4ID6A 4OO1H 4OELB 4AH6A 1ENAA 1SMXA 1GHKA 2E2IH 1B4OA 1I6HH 2PMZB 3HOVH 4PMBA 4R4OA 3JC66 1VF7A 3OMCA 4JI8L 4L5QA 5EPJA 2K5DA 3M3YB 3S9WA 5ELOA 4ZQ3A 1MGSA 1H9KA 5C3EB 1G6ZA 4C2MB 1L2FA 1AFPA 1JE4A 1R9TH 2F0OA 2NVQH 3GTMH 2I5LX 3U4ZA 1AE3A 1S5BD 3GTLH 4FO2A 3CCJA 3GTOH 1EY8A 1F2YA 1LTRD 4GOPB 1CI3M 2DNCA 4A3DG 3HOYG 4K8JA 3QWNA 4L5TA 4J1MA 3GTLB 3HZXA 2JE6I 2PZUA 3GTMB 3BZDB 1JOOA 4B3SQ 2I07B 4YCWA 4A93G 5EAYA 1H9JA 4DV1Q 1SYDA 1YNXA 1C4QA 1OXSC 1IBKQ 4UY8C 1L0WA 3QOLA 1B1ZA 1NUCA 1OXUA 3TP8A 5LMUQ 5G3LF 1PH9A 1PFMA 5T1GA 3CCSA 2EYHA 4A3GG 2D2CC 1RIPA 1BBWA 1SLJA 1EL0A 5I4DA 1QZHA 5C4JH 2K5QA 1UE6A 5EKKA 4OWXB 2UU9L 4GNXC 4A3KG 1LACA 1K8AC 1LO5D 4RCOA 2IX0A 1SYGA 2HUGA 1YJWA 2B8GA 1GJXA 2Q2TA 3KK7A 2MFIA 2PO4A 5CV8A 3S1NH 3PIP3 2N88A 2Z4IA 1NR4A 1EFWA 2F0DA 4QL5A 2XN9C 4DUYL 3S14H 3S2HH 3PIO3 1ICWA 1STNA 4C3HG 4G7OC 1BXTA 1MD2D 5J3BA 4U68A 3P7JA 2F3IA 4DGZA 3OWFA 1YNND 3PUWA 1N33L 2O2LD 3TS2A 1V9PA 1BUVT 1YNJD 3EJIA 2QEXA 3K6OA 1LYLA 2NTTA 3J81L 2DN8A 1RDPD 3MVVA 4ZKCB 3RN5A 1I3QH 2J7ZA 5E3FA 1WTOA 3J80L 1R4QB 4DR4L 1DOKA 3GTPH 1VQKA 1PH6A 1Y8NB 2LSSA 4L8JA 1TWGB 2JA5H 1NMGA 1IBLL 2J4XA 1GKHA 4H7BA 2BE5D 3GTOB 1II3A 2L12A 1Z47A 2K05A 1SNPA 4ZLTF 3J81c 1KAWA 3E0JA 5LMUL 4KN7C 2K52A 1EEFD 1E24A 3DUZA 4LUOA 4JW0A 4CJ2C 4A93B 2Q8RE 2R7ZH 1EU3A 2L55A 3I72A 4IFDG 1BF4A 5K5PA 4DAYB 2GVAA 2ZTDA 4HN7A 2PNHA 4KV6A 2AQ1B 3I4LA 3U9SA 4A3FG 1QNUA 1VQ8A 2BDNA 4RKLA 1X3PA 4RKBA 4A3IB 1STAA 5J39A 1LT4D 1Q7YC 2NUCA 1MIUA 4KHPQ 1U4RA 3T4AC 2BA1A 4C56C 4DV2Q 4C3HH 5FLXc 3GTQH 1HNZQ 1ASZA 4DNTB 3S1MH 4LF4L 2BH8A 5GQOA 1ASYA 2A6HD 3N6RA 4MTNA 1VQ6A 3G6JB 1IXRA 1Z7TA 3KLWA 4TSSA 1VQ9A 5C5MA 1PYWD 1K28A 5K36H 4IALA 2EDGA 4A3KH 5IP9H 1C0AA 2C5CA 4UP7A 4ULLA 4RGOS 5LL6X 5IYBG 4A3BH 2A68D 3W1GA 3GTJH 4DR6L 1D7QA 1EOTA 1MI2A 2N8NA 2LXJA 1O78A 3NE5B 1HXYD 2R3ZA 1X56A 5FLXE 3AYHB 1EY6A 2FINB 4AYBB 1STBA 2R7ZB 4G4KA 4K6DA 5ELFA 3Q24A 1GM5A 3U50C 3I4OA 4DK1A 1SRUA 3GTKB 2ASBA 1STHA 3OW2A 1TWAB 1TIID 4O0AA 3I4MG 4KK7A 1F9SA 1FNVA 4YHHQ 3PGZA 2F4VL 1PVOA 4DR1L 4X3KA 2CHBD 1C9OA 1EIFA 4A3DB 3H91A 5ISRA 1Y1VB 1BVSA 3SK8A 5E7NA 2K32A 2B63H 2WACA 4HJ8A 1AE2A 3GO5A 2NN6H 4B3ML 2JA9A 3GQBA 3RMHA 1VQFA 3I73A 2PPBC 5EPLA 3I4MB 5D14A 2F0UA 3ND9A 2LS01 4B9WA 1KLGD 1KAAA 4G7ZC 5IY0A 1DM0B 2QGQA 3HG9A 3SEBA 2J0TD 5C0XI 2F0MA 2IHFA 2E2HB 2PI2A 1HZAA 3VR4A 2A68C 3QG1A 4GKKL 4DNIA 4DR2L 1L1OA 2KVMA 2YV5A 1I4QA 5IGFA 1TS4A 2AUJD 1TWAH 2Q8IB 1KD1C 2VW9A 3UDGA 5JEAJ 1Y1WH 1JQYD 3I55A 5M3MH 1PYSB 1JOQA 1G8ZD 2Z1CA 3M7NA 5IT9E 2PCFB 3M4YA 3F2UA 4A3FH 2JEBI 1PMRA 1WTHA 3ITPA 2F0JA 1TS2A 3TSSA 1A2TA 1GUWA 1XTDA 4X66Q 2RDGA 1UAPA 4K5WA 1WI5A 1WD0A 4FVMA 1B3QA 2Z8LA 1VQMA 1LTAD 1BQQT 4MNOA 4OWTB 1N36L 2QEJC 3MHBA 1F9PA 1RD9D 4ZKBB 5M5YH 1VQ5A 2F4VQ 3PQIA 1IW7C 5I6YA 3DEPA 4ZYSA 4MIUA 4I65A 1Q1EA 4DV5L 1XJVA 4FF1A 2L15A 1X3EA 1CHPD 2Y0SG 1XMOL 3NK9A 3CC7A 4NXNQ 2F0QA 3RR5A 3HS0C 2XNAC 3NP8A 1RF2D 1X32A 1R4PB 2F0LA 4DV7L 1F2LA 1TU2B 1WFQA 1UEAB 5ELNA 1P8LA 3J81i 1GUOA 1QJOA 1N36Q 4A3IH 4A3CH 5JVG3 3TQYA 3K81C 1U4PA 5KGUA 1AP0A 1H9MA 5JPNC 4DA2A 4V190 2RBMA 2PZTA 3CQZH 3R2IA 5HURA 4A3LG 2CVRA 3VR5A 4O42A 3J7AF 1WD1A 2SNSA 1TS3A 4A93H 2NTSA 1YNNC 5DM73 2UXBQ 3Q0AA 2VQFL 4JI4Q 3RUZA 2L1BA 1KDCA 1PZID 4LF4Q 1D5XC 3CCUA 4XYQA 1PTOH 5C4XH 1NE3A 4RHRA 2VL6A 3Q23A 5GAGC 1GO3E 1ML0D 4C3JB 1WTXA 2C9OA 1LTBD 1H9SA 3ULJA 2ZTEA 4RFBA 1G6PA 2R7DA 1SBBB 2ZM6Q 1N32L 1SSOA 2IY5B 4DV7Q 2Z9HA 3K58A 1BDOA 2NVQB 1N34L 2XGTA 1FGBD 2KQ3A 1FL0A 1DONA 2PI2E 5IP7H 3BVGA 5IP9G 1K83H 1DGSA 3KJPA 5IYDH 1XMOQ 1KTKA 3T51B 3I8ZA 3CMAA 1YIJA 1AN8A 4OX9L 1ZYRC 3LWUA 5C3WA 1B50A 1HH2P 2ZJRA 1NSNS 4Y52H 4YWMA 2E74C 5FO7B 4B3MQ 3H3VI 4R1JA 3KUPA 4WJ4A 3FKIG 4RG1A 4G7HC 4KN4C 4CKBA 5EPKA 2AQ2B 1NY4A 4DV3Q 1Y1WB 4EQPA 2E2IB 4IOAA 4EQNA 4X3SA 1CKNA 1XWEA 4GNXB 2Q8TA 3S1QB 1OTCA 2XRQD 4DR1Q 1N9WA 1UUPA 1NJIC 3T1HQ 4TVAB 1CT1D 1YVCA 4B3TL 3ZJYC 1IW7D 4PZ8A 2B2UC 2HHHL 5FLXL 5M3FG 1N33Q 4P75A 4BWGB 5E4XA 3HOWG 2F4IA 2NZHA 4QJFA 1RCVD 1PH4A 3PUYA 3I3CA 3AFQA 4HR7B 3CC4A 2JA8G 3W5OA 1GUGA 4GKKQ 3PO2B 1HA5A 1T5XD 2B2UA 2UUBQ 2JK8A 4A3EH 3GD7A 3VDYA 5D65A 4NXML 5LHY1 4DV6L 1JJGA 3R2TA 1PFBA 1HUNA 4K14A 4HEDA 4HSPA 1I4PA 5C6AA 2OT2A 1HZBA 1QG7A 3RZDH 3FHWA 2CWPA 1EYCA 3KBGA 3OIPA 4DV0L 3J80c 3HOUG 1V1QA 1HTPA 2CWAA 3CQZB 1CA6A 4HIOA 2FFKB 2ZJQA 4C1NK 1BCPC 3T1YQ 4LF8L 1KXLA 4NW2A 3U9OA 1IKLA 5LMNQ 2KUMA 1BCPF 4A3BB 4JBMA 1ET6A 2GN5A 3EFXD 4LK1C 2K5WA 1E2ZA 3C2PA 1KHIA 2Z6BA 3CHBD 4B3RL 4HIKA 2BDOA 3P75A 3TBIB 3A74A 4F7XA 3LNNA 2PYKA 4OIKA 4OIJA 1C48A 1TXYA 4LFBQ 4KD4A 1PTOD 2H1EA 1Q3LA 2TSSA 3PMFA 1OXXK 5DEHA 1CQFA 1GUNA 1GOZA 1VQBA 1L1OB 3K5LA 1I50H 4IUVA 2D62A 1RTNA 3KLSX 5CV6A 1I5FA 3BJUA 1IBLQ 1TWHB 4BBSG 4RMFA 2JA8B 4Q0FA 3OMGA 1PA6A 1AW7A 2HIXA 1A3TA 2FXQA 5JVH3 3PV0A 4BS9A 1STYA 1VQ7A 3MFYA 2ZXPA 4JI7L 5C4HA 4X64L 3KF8B 4JK1C 4FXDA 5C0XH 4A3FB 3A7AB 4R4IA 1GXDC 3GTGB 4BY7H 4DV2L 1A3UA 3J80i 3UE0A 4KHPL 1PRTD 2M00A 2E2JB 1RODA 4ME5A 1OXVA 1VQCA 2PNRC 3RNUA 5A2QL 2NZOA 4XT3B 2B2WC 2QA4A 1QB5D 1VDZA 3SDZA 5KIXA 1SE8A 3E9IA 3ONAB 1X55A 4JPBW 5KNDA 4DUZQ 3OYYA 1HJPA 2KA7A 5FJ8H 5AJ3Q 1VS0A 4LW1A 4B9XA 3NQIA 2A73B 3K8AA 3STBD 2F0IA 3N52A 3KF8A 4S3SA 4BBRG 3PO3G 4KMUC 1SEBD 4PZ6A 2EIFA 1NAPA 1PH7A 3DM3A 4NXMQ 4APVA 1D1IA 4I7ZC 1GUSA 2EXDA 1JT8A 1HRJA 2OQKA 2VY3A 3S17H 4GOPA 2K5VA 3J81j 1TQOA 1Q82C 2BH2A 2WB1B 4GOPC 1DXMA 1TT2A 3DWQA 5IGCA 4A75A 3KF6B 2SDFA 4NP5A 2E2JH 4LFAQ 3PUXA 3TP6A 2Q2UA 2DUDA 1QOHA 3EN2A 3S2DH 1WTQA 1EYDA 1A2UA 4UP8A 4IO9A 1PH5A 2E5LQ 5BN5A 4C1NI 2NWGA 1F9RA 3B6YA 3R3OA 4A3EG 1G2TA 2ICEC 4B3TQ 3T53B 3OTOQ 4FF4A 2R93H 1X3GA 4XQNA 2UU9Q 4A3MG 1B2TA 2K14A 4BY1G 3DWPA 3SGIA 1E2VA 1EWHA 2CCZA 1H95A 4ZRZA 2C35B 2RSOA 2ES2A 3HOXB 1LTGD 4QIWE 1U9RA 2V1CC 2N3SA 1DJRD 2F1MA 4PQXA 2A8VA 1Y1VG 1JCKB 3ULPA 1S4ZA 1VQNA 1I3QB 1UE7A 2K01A 1F2ZA 1U4MA 3HKZG 3NBHA 4I7AA 4J8QA 1DD2A 2VXWA 2HD3A 3PF4A 4DPGA 4DV1L 1XNRQ 3PO3H 1ONLA 1CK1A 3E0EA 3E9HA 5T1IA 5CMDA 5CV9A 4O2DA 2JA6H 3GV6A 3HOXG 1P16A 3A55A 1BKBA 4XT1B 2ZM6L 5M5XH 5KNCA 2R92B 2I46A 2HDLA 1LLRD 1L1OC 4M1UB 3CPFA 3GV3A 2LY7A 3D4DA 4GN5A 3M4PA 2JEAI 4IN3A 3CCLA 3K7UC 5KYLA 4WJ3M 3IFDA 3HEJA 1VQLA 4Q5VA 4FF3A 1U0LA 4HIDA 3HOZH 1TKWB 3X3MA 3TZDA 1QVFA 5C0XJ 2UXCL 2BA0A 5KEEA 4P74A 2JN4A 5CR3A 2RVLA 3L3OC 2K50A 3L7ZC 2XWBB 5CYUA 1B44D 3H3VC 4BA2I 4DN4M 1FGUA 2X69A 2Q2IA 1AZPA 3IRBA 2EYOA 1SNCA 3BZKA 1LT6D 4JC0A 1GD7A 2RKSA 3M85A 2UXDL 3KLRA 1BOSA 2IJ0A 2YTXA 4JV5Q 1BBUA 3CP0A 2R6GA 2WFWA 1CTMA 4BBSH 2RSNA 1UNSA 2NVXH 5ELDA 1PXUA 5JJLA 3MXGA 4TKOB 5FKAC 1LABA 1W6KA 3S2HB 1BR9A 1IYUA 5IT9c 1D1KA 2YTYA 1TS5A 2XSCA 3S15H 1QVGA 4GKJL 1JWMD 1HQRD 4N9PA 1W6JA 5AFWA 2FHTA 1ZXTA 2K1BA 2YU9H 1X3FA 2ZXOA 4F87A 3PIOA 3K7AB 1VMCA 1KNEA 1PV4A 4BY1H 5C3EH 3C3LA 4PMWA 5J22A 1XNQL 5IT9L 1E2WA 2DNEA 3J7ZC 4JI5L 3BVZA 3WOEA 4X66L 2Z4HA 3CXCA 3HP3A 5JJIA 3I4NG 1CKNB 3M3YH 2Z6KA 2WV6D 3RLNA 4L6TB 1K8OA 4P73A 2CW0D 3BS1A 2R92H 1C8CA 4LF6Q 2B39A 1PTOF 2N55A 2MPMA 2JA6B 5HGQA 4JI0L 4JYAL 2BOSA 2EY1A 4FNFA 4V0BA 3MAQA 3CCEA 1JB7A 4DR2Q 1OO9B 3H09A 2Z0SA 2EJMA 4DV4Q 2CFMA 1DZ1A 4YWKA 3I7FA 1SNOA 3DEOA 3SE0A 2AWOA 1TY0A 1RHPA 5IGGA 4JI6L 5M5XB 5FO9B 4JBJA 3I4NH 2WIIB 5TSSA 3D0FA 2PW7A 4POFA 3RZOB 1WVLA 1XPRA 1Y69U 2IL8A 2Q2HA 3R93A 1Y1WG 1J6QA 3Q6SA 5GAHC 2B2WA 3TZUA 5F2DA 2KHJA 1EY5A 1SYEA 1T9HA 1NMFA 3TMEA 2P5ZX 1I4RA 3F2BA 3A5UA 3CD6A 1K8GA 5FJ8G 2F0FA 1MSGA 1J5EQ 1HTLD 1E3PA 3HOYB 2A1AA 4YHHL 2B2YA 2NB0A 1O7LA 1HA6A 4KTAA 3ER0A 3NENA 2R7FA 4DK6C 3A8JE 5A35A 1EQVA 4XTCS 2WINB 1LTLA 1VQ4A 3C1EA 2EYJA 3S17B 1DOMA 3VYTA 2KHIA 3CCQA 1DYQA 2ZXRA 4QQBX 1PDQA 4O1NA 3I56A 3O13A 4HTHA 4KJNA 1HUMA 3AFPA 4LFCL 1PZJD 1W3SA 4DR6Q 3BDCA 1VQAA 3T56B 4FF2A 1MJCA 2SOBA 2B3GA 3H6MA 4K5VA 1Q81C 3I4MH 2B2VA 4JI1Q 1HHVA 3MXNA 5IP7G 4CJ0B 1MHWC 4RGTA 3W2DA 1J9OA 3VR6A 1S5FD 1UWVA 1EFID 4F8MA 5EBDA 3BZCA 2EY5A 1STEA 3NTKA 4YWLA 2UXDQ 1HNWL 2KJXA 2PQAB 5H1SE 3K5OA 1X6OA 2VB3X 4IZ8A 5GADC 4X3UA 1I6VC 2D9UA 1YI2A 2IT1A 4A3BG 4A76A 1K73C 1ET9A 3DMUA 1T5EA 2IWHA 5JEAH 2A6ED 1PLFA 1UE1A 1MKHA 1KABA 2EVBA 4GLVB 3S1RB 2G9HD 4RGNA 2UUCQ 1IYVA 1AEXA 2I0QA 5K36G 3SK4A 1JORA 2HIVA 4OHJA 1HNXL 2PMZE 3H94A 4LF7L 4CKCA 2EY6A 3IFTA 3F8TA 4MTKA 4L5RC 3AU7A 2KCTA 1LTSD 3WDNA 1F2MA 4DFAA 3S2DB 1Z9FA 3CAMA 2HT1A 2IX3A 1U4LA 2JP1A 4X65Q 1EZ6A 1WTWA 2K5NA 3MWYW 1Q12A 4QY7A 1RTOA 1V1PB 1WOCA 3BYYB 3NEMA 2F3VA 4B08A 4DR7L 5D3IB 3P20A 2A19A 3DHQA 4WRDA 2XVSA 3NPPA 1VQHA 1STGA 2VQEL 4IFDH 3MC0B 4JBKA 3A5ZB 4C3HB 1Y14B 1WCMB 3M4OB 4P72A 4GS3A 4DR3L 1SNDA 2LMCB 4AQYQ 2A6EC 5E4WC 3VA7A 3GTKH 4EGVA 4GZYC 4CBVA 5FOBB 1VQOA 1QZGA 1CQVA 1NTGA 1N8RC 1KC8C 1ZYRD 3QOJA 1PFSA 4LJZC 4DUYQ 4CJ1B
chains in the Genus database with same CATH topology
1EQTA 5EBCA 2EYPA 1PFNA 3VYRA 2HCCA 2K03A 4OO1I 4RGMA 3VYSA 3FVQA 1IL8A 3D3RA 3SK5A 1CM9A 1EU4A 4R8NA 3H0GB 3GTPB 1LT3D 4A3EB 1BBXC 1S5CD 2F0VA 4HSVA 1GHJA 3A8IE 2K04A 2B2YC 4ODGA 5C3XA 3E5SA 1SYCA 1LTTD 3OOCA 4UAIA 1B9NA 1FR3A 4OL7A 4ZUJA 4EVOA 1MBYA 1HFGA 3S16B 1JC7A 1KNAA 1DCZA 4CKEA 1SXTA 3AMUA 3C46A 3GTQB 4DAYA 1EZ8A 3Q22A 1WTVA 3VA5A 1S5ED 2X6GA 3K5NA 2L4NA 1QCBD 1J8IA 4XQJA 3TN2A 1V1PA 2LKVA 1QWYA 1EY9A 2GA4B 2FMCA 3K59A 1K83B 2EPBA 3L9AX 1OXTA 2KEDA 3CKIB 4QMGA 2RA4A 5CBAE 1FNWA 1BCPB 1D6EC 4K6LA 4K2LA 4BA1I 3VYUA 3SHLA 2JA5B 2CQAA 1D5ZC 3D4RA 4KI0A 3NTHA 2AWNA 3S1NB 4WORA 2QCPX 1TR5A 1XTCD 4IUQA 3OIQA 4KKTA 4QIWB 2EJFC 1E0BA 1F77A 2K33A 5C4JB 3EROA 3BYTB 1LV9A 2HQEA 5M3FB 5KYIA 1O80A 2F0HA 5LL6S 5CORA 1ENCA 2ID0A 1ILPA 5BN4A 3ERQA 3KLSA 3D6CA 2G9DA 4R8IA 1L0YB 3FRPB 4KY5A 1NR2A 1SYFA 3NXWA 3NBIA 4XYOA 4R9WA 5I2XA 4HAEA 5CC4A 2QF7A 2K6AA 4FYDA 1SMYD 1EY4A 2QILA 3MXPA 2CW0C 5JJZA 3CRKC 5BN3A 4UDUC 1G2SA 4BBSB 1BNZA 3BVMA 3W3AA 1SNQA 5G3LD 2NN6G 2RDFA 4P2CB 5EKIA 4KD3A 2YYZA 2NZ1D 3X3NA 1I4GA 4DAVA 3FMCA 1DOLA 4IFDI 1X3QA 5C4XB 3BDLA 4LMQD 2V4DA 1FYCA 5D3DA 2JXMB 1XYIA 1H9RA 4A3JB 1YNJC 4F88A 3SVMA 4MN3A 2OF1A 2RQXA 1L0XB 1A3VA 2A69D 3I70A 3OSOA 5JAVA 1LTID 1SMYC 4MHEA 3VR3A 2F03A 5M3MB 1ENFA 1HCZA 3BG3A 1CZWA 4TRDA 2HCIA 3MZ5A 3NTIA 3NWTA 2SNMA 3I91A 2VNUD 2B63B 4BY1B 1EYAA 3RLFA 2MJ8A 2EY2A 3HRZC 2NVYB 2QDBA 2FMMA 4WFN3 4M8AA 1V1OA 2NN6I 3KBXA 2Y0SB 2ZT9C 1JB3A 5FK9C 3NUCA 2E2DC 1KDBA 2KCNA 1HFNA 2MUYA 5I9PA 1MSHA 3LWEA 2EOTA 2KECA 3GTJB 1QNKA 3TP7A 4KJOA 2VUMB 4KHVA 4QUFA 2NBFA 1S5DD 2F0TA 4BBRB 5FO8B 1A15A 4HCSA 4PV1C 3EVQA 3QJYA 3BDOA 3HOUB 2IX1A 1PRTB 1Q8IA 5ELBA 4XDXA 4JBWA 2A69C 1WTRA 2PW5A 4C3JG 4J6HA 1FNUA 5DAUA 3RD4A 2AQ3B 4WJWA 4RAUC 4Y7NB 4IUNA 4HMIA 2XWJB 2EE1A 1KLUD 1I50B 4PNYA 1JWUD 3K57A 1ESRA 2HDMA 5E1FA 3MXUA 3J81E 1QE6A 2F0SA 5CBEE 5C44B 1F9QA 4FXKC 5DM63 3K5MA 5C4ZA 1A6XA 1B53A 3DM1A 1ESFA 2EZVA 2NYZD 4N9TA 4IQZA 2KCCA 4HMJA 4G57A 1SDFA 5JEAG 5JPMC 2F0KA 5ELCA 2BCOA 4RA8A 4KHZA 2A5HA 2KHSA 5IIFA 3VR2A 2B8FA 2O4XA 2MHVA 4TQUS 1V43A 2TMPA 5IOCA 3M7GA 1RKNA 1I4HA 5EGTA 4DXGA 4A3MB 1EIHA 3WOFA 3OPOA 3TDQA 1LT5D 1NCVA 2EXZA 2M2LA 3J80E 3D31A 3MEHA 1B9MA 2AUKA 3HKZB 4XQQA 4H0LC 4OO1G 2L11A 3CRLC 2A74C 3LX0A 4K8IA 4KY6A 3FKIB 4ZK9B 2K28A 3A56A 1JWSD 3A8KE 4QF4A 2EJGC 3CU7A 5IGBA 3NQTA 3GP7A 3PUZA 4IURA 4LAAA 3OHXC 2M9VA 3FEWX 5IGEA 3JAME 3I4NB 5DNFA 3SR1A 2H4OA 2F0GA 1EIGA 5J1ZA 3UI2A 2E76C 3HOWB 4DF7A 1SJED 4DXFA 4EQOA 2PQEA 1CZGA 2B2TC 3C1FA 3MA2B 2A6HC 5EJWA 3HOZB 4FXGC 1CA5A 3D6WA 2O5IC 3T13A 3V05A 3P1HA 1M4VA 1HQMC 3NWSA 1KDAA 3V2TA 4IFDJ 5CGKA 2IPKD 2B2TA 1SFOB 1XXGA 4C3IB 5CV7A 4Z9CB 3SK6A 3PO3B 3A7LA 5I6WA 1I4XA 3J7AV 3QIAA 2L5TA 1VCIA 3AB9A 1BCPD 3OWEB 1ZEQX 1EY0A 4XXEA 2F0NA 4DK0A 3NHHA 1SE2A 3E6ZX 3EQLC 4KKUA 3R8BA 1BO0A 2F3WA 1SE3A 2VB2X 1Q1BA 5IODA 1SE4A 1AZQA 3HOVB 1I6HB 2NVTB 2JYOA 4QCLA 3IL8A 4FP5D 2WAQB 3DWAA 4CHTB 1QILA 2WP8J 3HGBA 3ZYYX 1Q90A 3S15B 1D2BA 1SAPA 3D8GA 3MFGA 1M8AA 1G291 1ILQA 5I9OA 5M5YB 4H44C 4IUTA 2MP1A 4C3IG 1Z6HA 2L0CA 5CV5A 1PRTF 4X3TA 2XRSD 1JR0D 1K8MA 1JOKA 3ND8A 5KRUA 2XIWA 4YIJA 3IAYA 4NMZA 1O7ZA 2X6LA 1FD7D 4L63B 1PTOB 2IW3A 2F0WA 1SNMA 3EA6A 1HPCA 2R93B 3G7LA 4RWSC 4ZAIA 2DY8A 2EYFA 4QUCA 1TWCB 4NDXA 2EYMA 1GUTA 2ENBA 5CV4A 5M9OA 4U673 4RCNA 5C5LA 1PRTC 2RDHA 2DY7A 3PUVA 2PZWA 3FPPA 2WKDA 4ILWA 3TP5A 3MTSA 4E6IA 2JA7B 1Y8OB 1TVXA 5A2QE 2E75C 1CFMA 1TWFB 2D5DA 4HCEA 3FPUB 5HGTA 1Y8PB 2MGSA 4RH6A 2KOLA 1WTPA 3NSWA 4BY7B 1ZKOA 4CGYB 1EEID 2B2VC 1SYBA 1CHQD 2WKCA 4DAPA 4PMCA 4OGQC 3JAML 4K5XA 2O5JC 1TY2A 1EY7A 2ICIA 4XIGS 4A3KB 1IHZA 1V8QA 4H13C 5C0XG 4K2KA 3FDTA 4KY7A 1D5MC 3URYA 2KEEA 3S1MB 4IUPA 1IKMA 1XX8A 3J7YW 4KKSA 3I90A 3V96A 3S14B 2BE5C 4DU9A 4ABNA 2L9HA 1JICA 5KNBA 2JSOA 5M5WB 1SJHD 4QB4A 3K0YA 4A3GB 3OW7A 2FJ2A 2SEBD 1VMPA 2YU9B 3A54A 4IUUA 2F0EA 5ELEA 4NKLA 3QO2A 4ZUIA 3SXHA 1EWCA 5NUCA 4DNRB 5EQ0A 1O7YA 2R61A 1RJTA 2NVXB 1PZKD 5I2YA 1PTOC 2EYLA 5IGDA 5EKLA 3RZDB 1H9SB 3D4WA 2LFNA 3QB3A 2OXPA 1G91A 1VF5C 3IKJA 4RHSA 2F0PA 2QKIC 2K7VA 3DXJC 5COYA 2OEOA 1R9TB 5JOBA 1B3AA 3T16A 4ID6A 4OO1H 1ENAA 1GHKA 1B4OA 2PMZB 4PMBA 1VF7A 3OMCA 5EPJA 2K5DA 3M3YB 3S9WA 4ZQ3A 1MGSA 1H9KA 5C3EB 1G6ZA 4C2MB 1AFPA 1JE4A 2F0OA 1S5BD 4FO2A 1EY8A 1F2YA 1LTRD 1CI3M 2DNCA 4K8JA 3QWNA 4J1MA 3GTLB 3HZXA 2JE6I 2PZUA 3GTMB 3BZDB 1JOOA 2I07B 1H9JA 1SYDA 1C4QA 1OXSC 3QOLA 1B1ZA 1NUCA 1OXUA 3TP8A 5G3LF 1PFMA 5T1GA 2EYHA 2D2CC 1EL0A 5I4DA 2K5QA 5EKKA 1LACA 1LO5D 4RCOA 2IX0A 1SYGA 2HUGA 2B8GA 1GJXA 3KK7A 2PO4A 5CV8A 3PIP3 2N88A 2Z4IA 1NR4A 2F0DA 2XN9C 3PIO3 1ICWA 1STNA 4C3HG 4G7OC 1BXTA 1MD2D 4U68A 3P7JA 4DGZA 3OWFA 1YNND 3PUWA 2O2LD 1BUVT 1YNJD 3EJIA 3K6OA 2NTTA 3J81L 2DN8A 1RDPD 3MVVA 4ZKCB 2J7ZA 5E3FA 1WTOA 3J80L 1R4QB 1DOKA 1Y8NB 4L8JA 1TWGB 2J4XA 4H7BA 2BE5D 3GTOB 1II3A 2L12A 1Z47A 2K05A 1SNPA 4ZLTF 3E0JA 4KN7C 1EEFD 3DUZA 4CJ2C 4A93B 2Q8RE 1EU3A 2L55A 3I72A 4IFDG 1BF4A 5K5PA 4HN7A 4KV6A 3U9SA 2AQ1B 3I4LA 1QNUA 2BDNA 4RKLA 1X3PA 4RKBA 4A3IB 1STAA 5J39A 1LT4D 2NUCA 1U4RA 3T4AC 2BA1A 4C56C 4DNTB 2A6HD 3N6RA 3G6JB 1Z7TA 4TSSA 5C5MA 1PYWD 5K36H 4IALA 2EDGA 2C5CA 4ULLA 4RGOS 5LL6X 2A68D 1EOTA 1MI2A 1O78A 3NE5B 1HXYD 2R3ZA 5FLXE 1EY6A 2FINB 4AYBB 1STBA 2R7ZB 4G4KA 4K6DA 5ELFA 3Q24A 4DK1A 3GTKB 1STHA 1TWAB 1TIID 4KK7A 1F9SA 1FNVA 4X3KA 2CHBD 4A3DB 3H91A 5ISRA 1Y1VB 3SK8A 2K32A 2WACA 3GO5A 2NN6H 3GQBA 3RMHA 3I73A 2PPBC 5EPLA 3I4MB 5D14A 2F0UA 3ND9A 2LS01 4B9WA 1KLGD 1KAAA 4G7ZC 1DM0B 3HG9A 3SEBA 2J0TD 5C0XI 2F0MA 2E2HB 3VR4A 2A68C 3QG1A 2KVMA 1I4QA 5IGFA 1TS4A 2AUJD 2Q8IB 5JEAJ 1JQYD 1JOQA 1G8ZD 2Z1CA 3M7NA 5IT9E 2PCFB 3M4YA 3F2UA 2JEBI 1PMRA 3ITPA 2F0JA 1TS2A 3TSSA 1A2TA 1GUWA 2RDGA 1UAPA 4K5WA 1WD0A 2Z8LA 4FVMA 1LTAD 1BQQT 2QEJC 3MHBA 1F9PA 1RD9D 4ZKBB 1IW7C 5I6YA 3DEPA 4ZYSA 4MIUA 4I65A 1Q1EA 4FF1A 1CHPD 3NK9A 2F0QA 3HS0C 2XNAC 3NP8A 1RF2D 1X32A 1R4PB 2F0LA 1F2LA 1TU2B 1UEAB 1GUOA 1QJOA 5JVG3 1U4PA 5KGUA 1AP0A 1H9MA 5JPNC 4DA2A 4V190 5HURA 2RBMA 2PZTA 3R2IA 2CVRA 3VR5A 4O42A 3J7AF 1WD1A 2SNSA 1TS3A 2NTSA 1YNNC 5DM73 3Q0AA 3RUZA 2L1BA 1KDCA 1PZID 1D5XC 4XYQA 1PTOH 4RHRA 3Q23A 1ML0D 4C3JB 1WTXA 2C9OA 1LTBD 1H9SA 4RFBA 1SBBB 1SSOA 3K58A 1BDOA 2NVQB 1FGBD 2KQ3A 1DONA 3BVGA 1KTKA 3T51B 3I8ZA 1AN8A 1ZYRC 3LWUA 5C3WA 1B50A 1NSNS 2E74C 5FO7B 3KUPA 4G7HC 4KN4C 4CKBA 5EPKA 2AQ2B 1Y1WB 4EQPA 2E2IB 4EQNA 4X3SA 1XWEA 3S1QB 2Q8TA 2XRQD 1UUPA 1CT1D 1IW7D 2B2UC 5FLXL 4BWGB 5E4XA 2F4IA 1RCVD 3PUYA 3I3CA 4HR7B 1GUGA 3PO2B 1HA5A 1T5XD 2B2UA 3GD7A 5D65A 5LHY1 3R2TA 1PFBA 1HUNA 4K14A 4HEDA 4HSPA 1I4PA 5C6AA 2OT2A 1QG7A 3KBGA 1EYCA 3OIPA 1HTPA 3CQZB 1CA6A 2FFKB 4C1NK 1BCPC 4NW2A 3U9OA 1IKLA 4A3BB 2KUMA 1BCPF 1ET6A 3EFXD 4LK1C 2K5WA 1E2ZA 3C2PA 3CHBD 2BDOA 3P75A 3TBIB 4F7XA 3LNNA 2PYKA 4OIKA 4OIJA 1C48A 4KD4A 1PTOD 2H1EA 1Q3LA 2TSSA 5DEHA 3PMFA 1OXXK 1CQFA 1GUNA 1GOZA 3K5LA 4IUVA 2D62A 1RTNA 3KLSX 5CV6A 1TWHB 2JA8B 4Q0FA 3OMGA 1AW7A 1A3TA 5JVH3 3PV0A 4BS9A 1STYA 3MFYA 2ZXPA 5C4HA 4JK1C 4FXDA 5C0XH 4A3FB 3A7AB 1GXDC 3GTGB 1A3UA 1PRTD 2M00A 2E2JB 1RODA 4ME5A 1OXVA 2PNRC 5A2QL 4XT3B 2B2WC 1QB5D 1VDZA 3SDZA 5KIXA 3ONAB 5KNDA 2KA7A 4B9XA 3NQIA 2A73B 2F0IA 3N52A 3KF8A 4S3SA 4KMUC 1SEBD 1NAPA 1D1IA 4I7ZC 1GUSA 1HRJA 1TQOA 2WB1B 1DXMA 1TT2A 3DWQA 5IGCA 2SDFA 4NP5A 3PUXA 3TP6A 1QOHA 1WTQA 1EYDA 1A2UA 5BN5A 4C1NI 2NWGA 1F9RA 3R3OA 1G2TA 2ICEC 3T53B 4FF4A 4XQNA 1B2TA 3DWPA 1E2VA 1EWHA 4ZRZA 2RSOA 3HOXB 1LTGD 1U9RA 1DJRD 2F1MA 4PQXA 1JCKB 1S4ZA 1I3QB 2K01A 1F2ZA 1U4MA 3NBHA 1DD2A 4J8QA 2VXWA 1ONLA 1CK1A 5T1IA 5CMDA 5CV9A 3GV6A 3A55A 4XT1B 5KNCA 2R92B 2I46A 2HDLA 1LLRD 4M1UB 3GV3A 2LY7A 3D4DA 2JEAI 4IN3A 5KYLA 3IFDA 3HEJA 4FF3A 4Q5VA 1TKWB 3X3MA 3TZDA 5C0XJ 2BA0A 5KEEA 5CR3A 2RVLA 3L3OC 3L7ZC 2XWBB 5CYUA 1B44D 3H3VC 4BA2I 4DN4M 2X69A 1AZPA 2EYOA 1SNCA 1LT6D 2RKSA 3M85A 3KLRA 1BOSA 2IJ0A 2R6GA 1CTMA 2RSNA 1UNSA 5ELDA 1PXUA 3MXGA 4TKOB 5FKAC 1LABA 1W6KA 3S2HB 1BR9A 1IYUA 1D1KA 1TS5A 2XSCA 1JWMD 1HQRD 4N9PA 1W6JA 5AFWA 2FHTA 1ZXTA 2K1BA 2ZXOA 4F87A 3K7AB 1VMCA 1KNEA 3C3LA 4PMWA 5J22A 5IT9L 1E2WA 2DNEA 3WOEA 3BVZA 2Z4HA 3HP3A 2WV6D 4L6TB 1K8OA 2CW0D 3BS1A 1C8CA 2B39A 1PTOF 2N55A 2MPMA 2JA6B 2BOSA 2EY1A 4FNFA 4V0BA 3MAQA 1OO9B 3H09A 2EJMA 1DZ1A 1SNOA 3DEOA 3SE0A 2AWOA 1TY0A 1RHPA 5IGGA 5M5XB 5FO9B 2WIIB 5TSSA 3RZOB 2PW7A 1WVLA 1Y69U 2IL8A 3R93A 3Q6SA 2B2WA 3TZUA 5F2DA 1EY5A 1SYEA 3TMEA 1I4RA 2F0FA 1MSGA 1HTLD 3HOYB 2B2YA 2NB0A 1O7LA 1HA6A 4KTAA 3A8JE 5A35A 1EQVA 4XTCS 2WINB 3C1EA 2EYJA 3S17B 1DOMA 3VYTA 1DYQA 2ZXRA 1PDQA 4O1NA 3O13A 4HTHA 4KJNA 1HUMA 1PZJD 3BDCA 3T56B 4FF2A 2SOBA 3H6MA 4K5VA 2B2VA 1HHVA 3MXNA 4CJ0B 4RGTA 3W2DA 1J9OA 3VR6A 1S5FD 4F8MA 1EFID 5EBDA 2EY5A 1STEA 3NTKA 2KJXA 3K5OA 2VB3X 4IZ8A 4X3UA 1I6VC 2D9UA 2IT1A 1ET9A 3DMUA 1T5EA 2IWHA 5JEAH 2A6ED 1PLFA 1KABA 2EVBA 3S1RB 2G9HD 4RGNA 1IYVA 1AEXA 5K36G 3SK4A 1JORA 4OHJA 3H94A 4CKCA 2EY6A 3IFTA 3AU7A 1LTSD 3WDNA 1F2MA 4DFAA 3S2DB 2IX3A 1U4LA 2JP1A 1EZ6A 1WTWA 3MWYW 1Q12A 1RTOA 1V1PB 3BYYB 2F3VA 4B08A 5D3IB 3P20A 3DHQA 4WRDA 2XVSA 3NPPA 1STGA 4IFDH 3MC0B 4C3HB 1WCMB 3M4OB 1SNDA 2LMCB 2A6EC 5E4WC 3VA7A 4EGVA 4GZYC 4CBVA 5FOBB 1CQVA 1ZYRD 3QOJA 4LJZC 4CJ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAB A;  2PCF B;  3M4Y A;  4DNR B;  2A6H D;  1GUN A;  1OXU A;  2E75 C;  3N6R A;  2E74 C;  2JEB I;  1PMR A;  3D4R A;  5BN5 A;  4KI0 A;  1IYU A;  1CFM A;  1Z7T A;  1SMY C;  3VR3 A;  2D62 A;  4G7H C;  1Q1B A;  4KN4 C;  3MXU A;  3T56 B;  2D5D A;  1HCZ A;  3BG3 A;  3T53 B;  3A8K E;  2EJG C;  2D2C C;  5K36 H;  2EDG A;  1H9S B;  1Y8P B;  3PUZ A;  4KKT A;  3VR6 A;  1E2V A;  1EWH A;  1LAC A;  1E2W A;  2DNE A;  2EJF C;  3PV0 A;  1VF5 C;  3RLF A;  2K33 A;  1A6X A;  3IKJ A;  2A68 D;  1ZKO A;  2B8G A;  1GJX A;  1IW7 D;  3MFY A;  3HGB A;  1IW7 C;  1O78 A;  2F1M A;  1Q90 A;  3NE5 B;  3DXJ C;  2K7V A;  1K8O A;  1Q1E A;  2E76 C;  4JK1 C;  1I6V C;  1DD2 A;  1G29 1;  5C0X H;  3A7A B;  4IQZ A;  2IT1 A;  2KCC A;  1GHJ A;  4H44 C;  4G7O C;  3A8I E;  2NN6 I;  1ONL A;  4OGQ C;  4DK1 A;  1Z6H A;  4OO1 H;  2ZT9 C;  3PUY A;  1T5E A;  2A6H C;  3PUW A;  4HR7 B;  2A6E D;  5BN4 A;  5JEA G;  5JEA H;  2O5J C;  1GUG A;  1K8M A;  2EVB A;  3OOC A;  4XIG S;  1OXV A;  2PNR C;  2O5I C;  1IYV A;  1GHK A;  1V8Q A;  1TU2 B;  5K36 G;  2EJM A;  5KNC A;  1B9N A;  1FR3 A;  4H13 C;  3ND8 A;  5C0X G;  1VDZ A;  2DN8 A;  3SDZ A;  4KHZ A;  1GUO A;  1QJO A;  1VF7 A;  3GD7 A;  3H94 A;  2QF7 A;  3SE0 A;  5KND A;  2JEA I;  3VR2 A;  2AWO A;  2B8F A;  2KA7 A;  1H9M A;  3IFT A;  1Y8N B;  2CW0 C;  4TQU S;  1V43 A;  1HQM C;  4L8J A;  1DCZ A;  3CRK C;  5BN3 A;  3WDN A;  1TKW B;  3VR5 A;  2BE5 D;  2K32 A;  1Y69 U;  1H9K A;  2BA0 A;  2NN6 H;  1YNN C;  3W3A A;  3A7L A;  2NN6 G;  1Q12 A;  4KN7 C;  3GQB A;  3TZU A;  4KKS A;  1HPC A;  3I73 A;  2PPB C;  4PV1 C;  3L7Z C;  3OPO A;  4KMU C;  3QJY A;  2BE5 C;  3ND9 A;  4BA2 I;  3BDO A;  1HTP A;  3I72 A;  4IFD G;  5KNB A;  4G7Z C;  2YYZ A;  3P20 A;  4JBW A;  2A69 C;  1CI3 M;  3QIA A;  3U9S A;  2L5T A;  3I4L A;  3D31 A;  3FMC A;  1VCI A;  4I7Z C;  1H9S A;  2DNC A;  1B9M A;  3AB9 A;  1GUS A;  3VR4 A;  4IFD H;  2A68 C;  1GUT A;  2AUK A;  1O7L A;  1E2Z A;  3OW7 A;  3QG1 A;  4LK1 C;  3KLR A;  3M85 A;  2V4D A;  2JE6 I;  3A8J E;  5A35 A;  4XTC S;  2BDO A;  1BDO A;  4RCN A;  2LMC B;  1DXM A;  4H0L C;  1OXT A;  2A6E C;  1FYC A;  2AUJ D;  2BA1 A;  3LNN A;  3PUV A;  2Q8I B;  2R6G A;  4BA1 I;  4DK0 A;  3VA7 A;  2JXM B;  4OO1 G;  3PUX A;  4GZY C;  1H9R A;  3FPP A;  1CTM A;  1YNJ C;  3T51 B;  1H9J A;  1OXS C;  4DNT B;  3M7N A;  3EQL C;  4KKU A;  1ZYR C;  3LWU A;  1OXX K;  1Y8O B;  4LJZ C;  3CRL C;  2A69 D;  4TKO B; 
#chains in the Genus database with same CATH topology
 1EQT A;  5EBC A;  2EYP A;  1PFN A;  2ZJP A;  3VYR A;  3H0G H;  4J15 A;  1C7Y A;  1NBW A;  1JMC A;  2HCC A;  2CH4 W;  2K03 A;  4OO1 I;  4RGM A;  4BBR H;  4LFA L;  4GN4 B;  3FVQ A;  3VYS A;  1IL8 A;  4CDE C;  2JQO A;  3D3R A;  3SK5 A;  4OXP A;  1TWG H;  1CM9 A;  2WAQ E;  1EU4 A;  4R8N A;  3H0G B;  3GTP B;  1LT3 D;  4A3E B;  1BBX C;  3CW2 C;  1S5C D;  2F0V A;  1IBK L;  4HSV A;  1GHJ A;  4DR5 L;  1IL2 A;  2JA7 H;  4NB3 A;  3A8I E;  2K04 A;  4B3S L;  2B2Y C;  1CKO A;  3UDF A;  4A4I A;  3KYH C;  4ODG A;  5C3X A;  3E5S A;  1SYC A;  1LTT D;  3OOC A;  2B63 G;  4UAI A;  3KJO A;  1B9N A;  1FR3 A;  4OL7 A;  4ZUJ A;  4EVO A;  4OON A;  1MBY A;  1HFG A;  2Z6K C;  2LXK A;  2K75 A;  3S16 B;  2AHO B;  1JC7 A;  4IJH A;  3E3X A;  1KNA A;  4IJL A;  1DCZ A;  4CKE A;  1KL9 A;  1SXT A;  1KIX A;  1HR0 L;  5C4X G;  3AMU A;  3C46 A;  3TRZ A;  3GTQ B;  4DAY A;  1EZ8 A;  3Q22 A;  3RN2 A;  4A3J H;  1WTV A;  2UUA L;  3VA5 A;  1S5E D;  4LNQ A;  2X6G A;  3G6E A;  4IPD A;  4A3J G;  3K5N A;  2L4N A;  1QCB D;  1J8I A;  1IBM Q;  4XQJ A;  1CKM A;  4EQ5 A;  1O7I A;  3TN2 A;  3HOY H;  4X62 Q;  1V1P A;  4X64 Q;  2LKV A;  1QWY A;  1EY9 A;  1PYB A;  1XMQ L;  1LUZ A;  2KBN A;  2GA4 B;  2FMC A;  4GNX A;  3K59 A;  4MZ9 A;  1K83 B;  5IYB H;  2EPB A;  2VQE Q;  4UP9 A;  5DLQ E;  1YHA A;  3S1R H;  3L9A X;  1OXT A;  2KED A;  3CKI B;  4QMG A;  2OCE A;  2RA4 A;  1FNW A;  5CBA E;  1BCP B;  1D6E C;  1U5K A;  2KCM A;  4K2L A;  4K6L A;  4BA1 I;  2RF4 A;  2JA7 G;  4JI1 L;  3VYU A;  1KQS A;  3SHL A;  2VZA A;  4OWW B;  2JA5 B;  2CQA A;  1D5Z C;  2VS1 A;  3D4R A;  4KI0 A;  3NTH A;  3KOJ A;  2UUA Q;  2AWN A;  3S1N B;  4WOR A;  2QCP X;  2NVY H;  1G51 A;  1TR5 A;  1XTC D;  4IUQ A;  1K9M C;  3OIQ A;  3JAM i;  2ZTC A;  4KKT A;  5L37 A;  4QIW B;  4CDC C;  4JI2 Q;  2EJF C;  1E0B A;  1F77 A;  1ICF B;  2K33 A;  5C4J B;  5BR8 L;  3ERO A;  3UE1 A;  1QUQ A;  3BYT B;  3UDX A;  1LV9 A;  2HQE A;  1E7Z A;  3F2C A;  5M3F B;  4C3J H;  5KYI A;  1S72 A;  1O80 A;  2F0H A;  1K3R A;  5LL6 S;  5COR A;  2R7Z G;  3H3V H;  1ENC A;  2ID0 A;  1ILP A;  5BN4 A;  3ERQ A;  3KLS A;  3D6C A;  2G9D A;  4R8I A;  1L0Y B;  3FRP B;  4KY5 A;  1NR2 A;  1SYF A;  3NXW A;  1UE5 A;  3NBI A;  4XYO A;  4R9W A;  5I2X A;  3HOW H;  4HAE A;  5CC4 A;  2QF7 A;  2K6A A;  5M3F H;  4FYD A;  1SMY D;  1EY4 A;  2QIL A;  3MXP A;  1EYG A;  2CW0 C;  5JJZ A;  3HKZ E;  3CRK C;  5BN3 A;  4UDU C;  1G2S A;  4BBS B;  1M1K C;  1BNZ A;  1MJE A;  4JCV E;  3BVM A;  3W3A A;  1SNQ A;  5G3L D;  2NN6 G;  2RDF A;  2AMC B;  4P2C B;  4ALP A;  5EKI A;  4UHV A;  3FKI H;  4KD3 A;  2YYZ A;  1KRS A;  2F52 A;  1I4G A;  2NZ1 D;  2MO0 A;  3X3N A;  4R4C A;  4DAV A;  3FMC A;  1Q8K A;  1DOL A;  4IFD I;  3T1H L;  1X3Q A;  5C4X B;  3BDL A;  2D0O A;  4LMQ D;  4JI5 Q;  2D0P A;  2V4D A;  5HY6 A;  2K5H A;  1FYC A;  3KFU A;  1PHJ A;  2WB1 G;  5D3D A;  2JXM B;  1VQP A;  1XYI A;  1H9R A;  4A3J B;  4K0K Q;  1YNJ C;  4F88 A;  4A3G H;  3SVM A;  4MN3 A;  2OF1 A;  2RQX A;  1YHQ A;  1L0X B;  1A3V A;  2A69 D;  3I70 A;  3OSO A;  5JAV A;  1LTI D;  1K0S A;  1SMY C;  4MHE A;  3VR3 A;  2F03 A;  5M3M B;  1ENF A;  1HCZ A;  3BG3 A;  1YJ9 A;  3F1Z A;  4FDB A;  1CZW A;  1CSP A;  4TRD A;  2HCI A;  3Q8D A;  3MZ5 A;  4LF9 Q;  1S3O A;  3NTI A;  3NWT A;  3TS0 A;  2SNM A;  1WCM H;  3I91 A;  3G4S A;  3M4O H;  1HNX Q;  2VNU D;  2RHS B;  2B63 B;  2MO1 A;  1EYA A;  4BY1 B;  3RLF A;  4A3L H;  2UUC L;  5IWA L;  2MJ8 A;  2EY2 A;  3HRZ C;  4A3D H;  2NVY B;  3L2P A;  2QDB A;  2FMM A;  1JJ2 A;  4JI0 Q;  4A3I G;  5FLM H;  4A3C G;  4WFN 3;  3FP9 A;  4M8A A;  4ME3 A;  1V1O A;  2NN6 I;  3KBX A;  2Y0S B;  2ZT9 C;  3W1B A;  1JB3 A;  5FK9 C;  3NUC A;  2UXC Q;  2E2D C;  4KLK A;  1KDB A;  2KCN A;  2H5X A;  4HJ7 A;  1RL2 A;  4H02 A;  2MUY A;  3TEH B;  1HFN A;  3H0G G;  5I9P A;  1MSH A;  3LWE A;  2EOT A;  2KEC A;  4LF9 L;  3G48 A;  3GTJ B;  1QNK A;  3TP7 A;  5M5W H;  4KJO A;  1HR0 W;  2VUM B;  4KHV A;  4QUF A;  2NBF A;  1S5D D;  2F0T A;  4BBR B;  5FO8 B;  1EQQ A;  1A15 A;  4HCS A;  4PV1 C;  3EVQ A;  1XNR L;  3QJY A;  3F2D A;  3BDO A;  3HOU B;  2IX1 A;  2JA5 G;  4K0K L;  4LUZ A;  1PRT B;  1Q8I A;  5ELB A;  3JAM c;  1YHB A;  4XDX A;  4DV5 Q;  2QW7 A;  2A69 C;  4JBW A;  1WTR A;  2PW5 A;  4C3J G;  4R4Q A;  4J6H A;  4JV5 L;  1FNU A;  5DAU A;  3RD4 A;  1YJN A;  1XPU A;  4HJA A;  3RLO A;  2AQ3 B;  4WJW A;  1FJG Q;  5M3M G;  4YCV A;  1VQD A;  4RAU C;  4Y7N B;  4IUN A;  4DKA C;  4HMI A;  4X62 L;  4JI3 L;  2XWJ B;  2EE1 A;  1KLU D;  1I50 B;  4PNY A;  2R92 G;  3OTO L;  3QR8 A;  1JJC B;  4UPA A;  3DLL A;  1JWU D;  3K57 A;  2MNA A;  1ESR A;  2N78 A;  2HDM A;  5E1F A;  3MXU A;  3PIP A;  2OQ0 A;  3J81 E;  1QE6 A;  2F0S A;  3PF5 A;  5CBE E;  3H15 A;  5C44 B;  3UDI A;  1F9Q A;  4FXK C;  5DM6 3;  3K5M A;  5C4Z A;  1A6X A;  1B53 A;  3DM1 A;  1ESF A;  2EZV A;  2NYZ D;  3M4Q A;  3AQQ A;  4N9T A;  4IQZ A;  1KRT A;  2KCC A;  4HMJ A;  1D8L A;  3HFZ B;  4G57 A;  1SDF A;  3CC2 A;  5JEA G;  3A0J A;  1EWI A;  1SN8 A;  5JPM C;  2F0K A;  3PO2 G;  5ELC A;  2BCO A;  4RA8 A;  4KHZ A;  1XNQ Q;  2A5H A;  2KHS A;  1W2B A;  3KF6 A;  5IIF A;  3VR2 A;  2B8F A;  1E22 A;  2O4X A;  3CCM A;  4X6A H;  3G71 A;  2MHV A;  4TQU S;  1V43 A;  2TMP A;  5IOC A;  3M7G A;  4IPC A;  2DJF C;  1RKN A;  1M90 C;  1QVC A;  1I4H A;  5IYC G;  1GVP A;  5EGT A;  4DXG A;  2DGY A;  4A3M B;  1EIH A;  3WOF A;  4HJ5 A;  4IOC A;  3OPO A;  1LT5 D;  2EXZ A;  1NCV A;  3TDQ A;  1K3B C;  2M2L A;  3J80 E;  3D31 A;  3MEH A;  1B9M A;  4AYB E;  4HIM A;  3HOV G;  4LF5 Q;  2AUK A;  3U4V A;  3HKZ B;  4HJ9 A;  4QGU A;  2I5H A;  4JOI A;  3S1Q H;  2JA6 G;  3S24 A;  4XQQ A;  4H0L C;  1VQI A;  2VUM G;  4OO1 G;  4EX5 A;  2L11 A;  3EIV A;  2DJG C;  3CRL C;  2A74 C;  3LX0 A;  4K8I A;  1SRO A;  4KY6 A;  1X54 A;  3FKI B;  4ZK9 B;  2K28 A;  1I94 L;  3A56 A;  1JWS D;  3A8K E;  4QF4 A;  2E8G A;  2EJG C;  5BR8 Q;  1HNZ L;  3CU7 A;  5IGB A;  4JI2 L;  1B7Y B;  4PZ7 A;  5AJ3 L;  3NQT A;  3GP7 A;  3PUZ A;  1XPO A;  4IUR A;  4LAA A;  3OHX C;  2M9V A;  4LF7 Q;  3FEW X;  5IGE A;  3JAM E;  3RZO H;  3I4N B;  5DNF A;  4YCU A;  3SR1 A;  1I94 Q;  2NVT H;  4IPH A;  2KEN A;  5LMN L;  2H4O A;  2F0G A;  4LF8 Q;  1EIG A;  5J1Z A;  3UI2 A;  2E76 C;  1JE5 A;  3HOW B;  1IZ6 A;  4DF7 A;  3CF5 A;  1SJE D;  4DXF A;  1NNX A;  4EQO A;  2PQE A;  1CZG A;  2B2T C;  4C2M H;  4IPG A;  4JVZ A;  3C1F A;  3MA2 B;  2A6H C;  5EJW A;  4OEM B;  3HOZ B;  4FXG C;  3MEF A;  3D6W A;  1CA5 A;  2O5I C;  1HNW Q;  4LF5 L;  1IYJ B;  3BU2 A;  3T13 A;  1XMQ Q;  3V05 A;  1YIT A;  3P1H A;  4DR4 Q;  1M4V A;  1HQM C;  3NWS A;  1KDA A;  1IBM L;  2UUB L;  3V2T A;  4IFD J;  5CGK A;  2IPK D;  2B2T A;  1SFO B;  1XXG A;  4C3I B;  5CV7 A;  4Z9C B;  3SK6 A;  3K7A H;  3A7L A;  3PO3 B;  4C3I H;  1YBY A;  5I6W A;  1HR0 Q;  1I4X A;  4AIM A;  2ALY B;  1PH2 A;  4LFB L;  2G5D A;  3J7A V;  3QIA A;  4AQY L;  2L5T A;  1VCI A;  3AB9 A;  1BCP D;  3OWE B;  2YTV A;  1ZEQ X;  1EY0 A;  1B70 B;  2IHE A;  1K0R A;  1WYD A;  4XXE A;  2F0N A;  2OTL A;  1YZ6 A;  5IE8 A;  4DK0 A;  2B29 A;  3ERS X;  3NHH A;  4NPS A;  4DR7 Q;  4DR5 Q;  4BY7 G;  4LWC A;  1SE2 A;  4DV0 Q;  3E6Z X;  3EQL C;  4KKU A;  3R8B A;  3CCR A;  4DV3 L;  2EQS A;  1BO0 A;  2F3W A;  1SE3 A;  2VB2 X;  1Q1B A;  5IOD A;  1SE4 A;  1AZQ A;  3HOV B;  1I6H B;  2NVT B;  2PQA A;  4PG3 A;  3STB C;  3KDF B;  2JYO A;  4QCL A;  1Q86 C;  4JOI C;  3NBH B;  2RCF A;  3IL8 A;  4FP5 D;  3CPW A;  2WAQ B;  3DWA A;  4CHT B;  1X65 A;  1N32 Q;  3HOZ G;  4DV4 L;  1QIL A;  2WP8 J;  3HGB A;  2AKW B;  1CUK A;  3ZYY X;  3S16 H;  1Q90 A;  3S15 B;  1D2B A;  1SAP A;  1VQE A;  3D8G A;  3MFG A;  1M8A A;  1G29 1;  1ILQ A;  5I9O A;  5M5Y B;  4H44 C;  4IUT A;  2MP1 A;  4JI3 Q;  4C3I G;  3HOX H;  1FVI A;  5GRO A;  1Z6H A;  2L0C A;  4POG A;  5CV5 A;  1PRT F;  4X3T A;  3CME A;  2XRS D;  4JI7 Q;  2UXB L;  4DR3 Q;  1JR0 D;  1K8M A;  1FJG L;  1JOK A;  3ND8 A;  5KRU A;  2XIW A;  4YIJ A;  2XTI A;  3IAY A;  4R4T A;  4NMZ A;  1O7Z A;  4JI8 Q;  2X6L A;  1FD7 D;  1SR3 A;  1PH1 A;  1PH3 A;  4GKJ Q;  1A0I A;  4L63 B;  1PTO B;  2IW3 A;  2F0W A;  1SNM A;  4A3M H;  4X65 L;  3EA6 A;  3GTG H;  1HPC A;  3GDE A;  2R93 B;  4P71 A;  3G7L A;  4RWS C;  4ZAI A;  4NXN L;  4YY3 Q;  4OX9 Q;  2OWO A;  2DY8 A;  1TWF H;  1EUJ A;  3WWV A;  1Q46 A;  2E2H H;  3PSI A;  2EYF A;  4QUC A;  1TWC B;  4NDX A;  4B3R Q;  2EYM A;  1GUT A;  2ENB A;  5CV4 A;  4DK3 C;  5M9O A;  1J5E L;  4U67 3;  4RCN A;  3T1Y L;  5C5L A;  2JA8 H;  5C3E G;  1PRT C;  2RDH A;  1CSQ A;  3EBE A;  2DY7 A;  3PUV A;  2PZW A;  3FPP A;  4BXX H;  3U58 A;  2WKD A;  4ILW A;  3TP5 A;  3MTS A;  2WAQ G;  4E6I A;  2JA7 B;  1UEB A;  1Y8O B;  1EQR A;  1TVX A;  5A2Q E;  2E75 C;  3L0O A;  2CKZ B;  4JI4 L;  2VQF Q;  1CFM A;  4AYB G;  5IWA Q;  1TWF B;  2D5D A;  1AH9 A;  4HCE A;  4L5S A;  3FPU B;  2Y0S E;  5HGT A;  1E1T A;  1S40 A;  4JI6 Q;  4DV6 Q;  1QUQ B;  1Y8P B;  2MGS A;  4RH6 A;  2KOL A;  2VUM H;  1WTP A;  3K80 C;  2WB1 E;  2GVB A;  3NSW A;  4BY7 B;  1ZKO A;  3MXN B;  4CGY B;  1B8A A;  4GN3 B;  1EIY B;  5FLM G;  1EEI D;  4LFC Q;  2B2V C;  4CDF C;  1SYB A;  3K0X A;  5JJK A;  1CHQ D;  2WKC A;  4LUV A;  4DAP A;  4ZCK A;  5IYD G;  4PMC A;  4OGQ C;  3JAM L;  5C44 G;  2OTJ A;  1WCM G;  1YEZ A;  4K5X A;  2HHH Q;  2O5J C;  1TY2 A;  1EY7 A;  5C44 H;  5IYC H;  2ICI A;  4XIG S;  4A3K B;  1IHZ A;  1WJJ A;  1V8Q A;  1TWH H;  2MQH A;  4H13 C;  1A62 A;  3LGJ A;  4K2K A;  5C0X G;  1E1O A;  3FDT A;  2I5M X;  1PH8 A;  4KY7 A;  1D5M C;  1HZC A;  3M9B A;  2ATW A;  3URY A;  3PO2 H;  2KEE A;  3S1M B;  5GAE C;  4CDD C;  4IUP A;  1IKM A;  1XX8 A;  3J7Y W;  4Y7N H;  2HQL A;  4KKS A;  1VQJ A;  2E5L L;  2CH4 A;  1VQG A;  3I90 A;  3V96 A;  3NEL A;  3S14 B;  3KDF A;  2BE5 C;  4DU9 A;  3CCV A;  2CQO A;  4ABN A;  2L9H A;  1JIC A;  4GLA C;  5KNB A;  2JSO A;  1TWC H;  5M5W B;  1N34 Q;  1SJH D;  2RHQ B;  1Y1V H;  4QB4 A;  2K4K A;  3K0Y A;  4A3G B;  3PCO B;  3HOU H;  3OW7 A;  3ULL A;  4BXX G;  2FJ2 A;  2SEB D;  1VMP A;  4JYA Q;  2N49 A;  2YU9 B;  2JJQ A;  3A54 A;  4IUU A;  2F0E A;  5ELE A;  4NKL A;  2R93 G;  4LF6 L;  3QO2 A;  4ZUI A;  3SXH A;  1EWC A;  5NUC A;  3HKS A;  4JG2 A;  4DNR B;  5EQ0 A;  3AEV A;  1O7Y A;  1LM0 A;  1A8V A;  2R61 A;  1RJT A;  2NVX B;  1PZK D;  5I2Y A;  3I2Z A;  1PTO C;  2EYL A;  5IGD A;  5LMN W;  5EKL A;  3RZD B;  1H9S B;  3D4W A;  2QDL A;  4DUZ L;  1SFO H;  3TRE A;  2LFN A;  3QB3 A;  2OXP A;  3J7A 5;  1G91 A;  1VF5 C;  2RCN A;  4GLX A;  3IKJ A;  3ICE A;  1EOV A;  1A63 A;  4DAM A;  4N8F A;  4RHS A;  2F0P A;  2QKI C;  2K7V A;  3DXJ C;  5COY A;  4N8X 1;  2OEO A;  1HZ9 A;  1R9T B;  5JOB A;  1B3A A;  4YY3 L;  3T16 A;  1X9N A;  4ID6 A;  4OO1 H;  4OEL B;  4AH6 A;  1ENA A;  1SMX A;  1GHK A;  2E2I H;  1B4O A;  1I6H H;  2PMZ B;  3HOV H;  4PMB A;  4R4O A;  3JC6 6;  1VF7 A;  3OMC A;  4JI8 L;  4L5Q A;  5EPJ A;  2K5D A;  3M3Y B;  3S9W A;  5ELO A;  4ZQ3 A;  1MGS A;  1H9K A;  5C3E B;  1G6Z A;  4C2M B;  1L2F A;  1AFP A;  1JE4 A;  1R9T H;  2F0O A;  2NVQ H;  3GTM H;  2I5L X;  3U4Z A;  1AE3 A;  1S5B D;  3GTL H;  4FO2 A;  3CCJ A;  3GTO H;  1EY8 A;  1F2Y A;  1LTR D;  4GOP B;  1CI3 M;  2DNC A;  4A3D G;  3HOY G;  4K8J A;  3QWN A;  4L5T A;  4J1M A;  3GTL B;  3HZX A;  2JE6 I;  2PZU A;  3GTM B;  3BZD B;  1JOO A;  4B3S Q;  2I07 B;  4YCW A;  4A93 G;  5EAY A;  1H9J A;  4DV1 Q;  1SYD A;  1YNX A;  1C4Q A;  1OXS C;  1IBK Q;  4UY8 C;  1L0W A;  3QOL A;  1B1Z A;  1NUC A;  1OXU A;  3TP8 A;  5LMU Q;  5G3L F;  1PH9 A;  1PFM A;  5T1G A;  3CCS A;  2EYH A;  4A3G G;  2D2C C;  1RIP A;  1BBW A;  1SLJ A;  1EL0 A;  5I4D A;  1QZH A;  5C4J H;  2K5Q A;  1UE6 A;  5EKK A;  4OWX B;  2UU9 L;  4GNX C;  4A3K G;  1LAC A;  1K8A C;  1LO5 D;  4RCO A;  2IX0 A;  1SYG A;  2HUG A;  1YJW A;  2B8G A;  1GJX A;  2Q2T A;  3KK7 A;  2MFI A;  2PO4 A;  5CV8 A;  3S1N H;  3PIP 3;  2N88 A;  2Z4I A;  1NR4 A;  1EFW A;  2F0D A;  4QL5 A;  2XN9 C;  4DUY L;  3S14 H;  3S2H H;  3PIO 3;  1ICW A;  1STN A;  4C3H G;  4G7O C;  1BXT A;  1MD2 D;  5J3B A;  4U68 A;  3P7J A;  2F3I A;  4DGZ A;  3OWF A;  1YNN D;  3PUW A;  1N33 L;  2O2L D;  3TS2 A;  1V9P A;  1BUV T;  1YNJ D;  3EJI A;  2QEX A;  3K6O A;  1LYL A;  2NTT A;  3J81 L;  2DN8 A;  1RDP D;  3MVV A;  4ZKC B;  3RN5 A;  1I3Q H;  2J7Z A;  5E3F A;  1WTO A;  3J80 L;  1R4Q B;  4DR4 L;  1DOK A;  3GTP H;  1VQK A;  1PH6 A;  1Y8N B;  2LSS A;  4L8J A;  1TWG B;  2JA5 H;  1NMG A;  1IBL L;  2J4X A;  1GKH A;  4H7B A;  2BE5 D;  3GTO B;  1II3 A;  2L12 A;  1Z47 A;  2K05 A;  1SNP A;  4ZLT F;  3J81 c;  1KAW A;  3E0J A;  5LMU L;  4KN7 C;  2K52 A;  1EEF D;  1E24 A;  3DUZ A;  4LUO A;  4JW0 A;  4CJ2 C;  4A93 B;  2Q8R E;  2R7Z H;  1EU3 A;  2L55 A;  3I72 A;  4IFD G;  1BF4 A;  5K5P A;  4DAY B;  2GVA A;  2ZTD A;  4HN7 A;  2PNH A;  4KV6 A;  2AQ1 B;  3I4L A;  3U9S A;  4A3F G;  1QNU A;  1VQ8 A;  2BDN A;  4RKL A;  1X3P A;  4RKB A;  4A3I B;  1STA A;  5J39 A;  1LT4 D;  1Q7Y C;  2NUC A;  1MIU A;  4KHP Q;  1U4R A;  3T4A C;  2BA1 A;  4C56 C;  4DV2 Q;  4C3H H;  5FLX c;  3GTQ H;  1HNZ Q;  1ASZ A;  4DNT B;  3S1M H;  4LF4 L;  2BH8 A;  5GQO A;  1ASY A;  2A6H D;  3N6R A;  4MTN A;  1VQ6 A;  3G6J B;  1IXR A;  1Z7T A;  3KLW A;  4TSS A;  1VQ9 A;  5C5M A;  1PYW D;  1K28 A;  5K36 H;  4IAL A;  2EDG A;  4A3K H;  5IP9 H;  1C0A A;  2C5C A;  4UP7 A;  4ULL A;  4RGO S;  5LL6 X;  5IYB G;  4A3B H;  2A68 D;  3W1G A;  3GTJ H;  4DR6 L;  1D7Q A;  1EOT A;  1MI2 A;  2N8N A;  2LXJ A;  1O78 A;  3NE5 B;  1HXY D;  2R3Z A;  1X56 A;  5FLX E;  3AYH B;  1EY6 A;  2FIN B;  4AYB B;  1STB A;  2R7Z B;  4G4K A;  4K6D A;  5ELF A;  3Q24 A;  1GM5 A;  3U50 C;  3I4O A;  4DK1 A;  1SRU A;  3GTK B;  2ASB A;  1STH A;  3OW2 A;  1TWA B;  1TII D;  4O0A A;  3I4M G;  4KK7 A;  1F9S A;  1FNV A;  4YHH Q;  3PGZ A;  2F4V L;  1PVO A;  4DR1 L;  4X3K A;  2CHB D;  1C9O A;  1EIF A;  4A3D B;  3H91 A;  5ISR A;  1Y1V B;  1BVS A;  3SK8 A;  5E7N A;  2K32 A;  2B63 H;  2WAC A;  4HJ8 A;  1AE2 A;  3GO5 A;  2NN6 H;  4B3M L;  2JA9 A;  3GQB A;  3RMH A;  1VQF A;  3I73 A;  2PPB C;  5EPL A;  3I4M B;  5D14 A;  2F0U A;  3ND9 A;  2LS0 1;  4B9W A;  1KLG D;  1KAA A;  4G7Z C;  5IY0 A;  1DM0 B;  2QGQ A;  3HG9 A;  3SEB A;  2J0T D;  5C0X I;  2F0M A;  2IHF A;  2E2H B;  2PI2 A;  1HZA A;  3VR4 A;  2A68 C;  3QG1 A;  4GKK L;  4DNI A;  4DR2 L;  1L1O A;  2KVM A;  2YV5 A;  1I4Q A;  5IGF A;  1TS4 A;  2AUJ D;  1TWA H;  2Q8I B;  1KD1 C;  2VW9 A;  3UDG A;  5JEA J;  1Y1W H;  1JQY D;  3I55 A;  5M3M H;  1PYS B;  1JOQ A;  1G8Z D;  2Z1C A;  3M7N A;  5IT9 E;  2PCF B;  3M4Y A;  3F2U A;  4A3F H;  2JEB I;  1PMR A;  1WTH A;  3ITP A;  2F0J A;  1TS2 A;  3TSS A;  1A2T A;  1GUW A;  1XTD A;  4X66 Q;  2RDG A;  1UAP A;  4K5W A;  1WI5 A;  1WD0 A;  4FVM A;  1B3Q A;  2Z8L A;  1VQM A;  1LTA D;  1BQQ T;  4MNO A;  4OWT B;  1N36 L;  2QEJ C;  3MHB A;  1F9P A;  1RD9 D;  4ZKB B;  5M5Y H;  1VQ5 A;  2F4V Q;  3PQI A;  1IW7 C;  5I6Y A;  3DEP A;  4ZYS A;  4MIU A;  4I65 A;  1Q1E A;  4DV5 L;  1XJV A;  4FF1 A;  2L15 A;  1X3E A;  1CHP D;  2Y0S G;  1XMO L;  3NK9 A;  3CC7 A;  4NXN Q;  2F0Q A;  3RR5 A;  3HS0 C;  2XNA C;  3NP8 A;  1RF2 D;  1X32 A;  1R4P B;  2F0L A;  4DV7 L;  1F2L A;  1TU2 B;  1WFQ A;  1UEA B;  5ELN A;  1P8L A;  3J81 i;  1GUO A;  1QJO A;  1N36 Q;  4A3I H;  4A3C H;  5JVG 3;  3TQY A;  3K81 C;  1U4P A;  5KGU A;  1AP0 A;  1H9M A;  5JPN C;  4DA2 A;  4V19 0;  2RBM A;  2PZT A;  3CQZ H;  3R2I A;  5HUR A;  4A3L G;  2CVR A;  3VR5 A;  4O42 A;  3J7A F;  1WD1 A;  2SNS A;  1TS3 A;  4A93 H;  2NTS A;  1YNN C;  5DM7 3;  2UXB Q;  3Q0A A;  2VQF L;  4JI4 Q;  3RUZ A;  2L1B A;  1KDC A;  1PZI D;  4LF4 Q;  1D5X C;  3CCU A;  4XYQ A;  1PTO H;  5C4X H;  1NE3 A;  4RHR A;  2VL6 A;  3Q23 A;  5GAG C;  1GO3 E;  1ML0 D;  4C3J B;  1WTX A;  2C9O A;  1LTB D;  1H9S A;  3ULJ A;  2ZTE A;  4RFB A;  1G6P A;  2R7D A;  1SBB B;  2ZM6 Q;  1N32 L;  1SSO A;  2IY5 B;  4DV7 Q;  2Z9H A;  3K58 A;  1BDO A;  2NVQ B;  1N34 L;  2XGT A;  1FGB D;  2KQ3 A;  1FL0 A;  1DON A;  2PI2 E;  5IP7 H;  3BVG A;  5IP9 G;  1K83 H;  1DGS A;  3KJP A;  5IYD H;  1XMO Q;  1KTK A;  3T51 B;  3I8Z A;  3CMA A;  1YIJ A;  1AN8 A;  4OX9 L;  1ZYR C;  3LWU A;  5C3W A;  1B50 A;  1HH2 P;  2ZJR A;  1NSN S;  4Y52 H;  4YWM A;  2E74 C;  5FO7 B;  4B3M Q;  3H3V I;  4R1J A;  3KUP A;  4WJ4 A;  3FKI G;  4RG1 A;  4G7H C;  4KN4 C;  4CKB A;  5EPK A;  2AQ2 B;  1NY4 A;  4DV3 Q;  1Y1W B;  4EQP A;  2E2I B;  4IOA A;  4EQN A;  4X3S A;  1CKN A;  1XWE A;  4GNX B;  2Q8T A;  3S1Q B;  1OTC A;  2XRQ D;  4DR1 Q;  1N9W A;  1UUP A;  1NJI C;  3T1H Q;  4TVA B;  1CT1 D;  1YVC A;  4B3T L;  3ZJY C;  1IW7 D;  4PZ8 A;  2B2U C;  2HHH L;  5FLX L;  5M3F G;  1N33 Q;  4P75 A;  4BWG B;  5E4X A;  3HOW G;  2F4I A;  2NZH A;  4QJF A;  1RCV D;  1PH4 A;  3PUY A;  3I3C A;  3AFQ A;  4HR7 B;  3CC4 A;  2JA8 G;  3W5O A;  1GUG A;  4GKK Q;  3PO2 B;  1HA5 A;  1T5X D;  2B2U A;  2UUB Q;  2JK8 A;  4A3E H;  3GD7 A;  3VDY A;  5D65 A;  4NXM L;  5LHY 1;  4DV6 L;  1JJG A;  3R2T A;  1PFB A;  1HUN A;  4K14 A;  4HED A;  4HSP A;  1I4P A;  5C6A A;  2OT2 A;  1HZB A;  1QG7 A;  3RZD H;  3FHW A;  2CWP A;  1EYC A;  3KBG A;  3OIP A;  4DV0 L;  3J80 c;  3HOU G;  1V1Q A;  1HTP A;  2CWA A;  3CQZ B;  1CA6 A;  4HIO A;  2FFK B;  2ZJQ A;  4C1N K;  1BCP C;  3T1Y Q;  4LF8 L;  1KXL A;  4NW2 A;  3U9O A;  1IKL A;  5LMN Q;  2KUM A;  1BCP F;  4A3B B;  4JBM A;  1ET6 A;  2GN5 A;  3EFX D;  4LK1 C;  2K5W A;  1E2Z A;  3C2P A;  1KHI A;  2Z6B A;  3CHB D;  4B3R L;  4HIK A;  2BDO A;  3P75 A;  3TBI B;  3A74 A;  4F7X A;  3LNN A;  2PYK A;  4OIK A;  4OIJ A;  1C48 A;  1TXY A;  4LFB Q;  4KD4 A;  1PTO D;  2H1E A;  1Q3L A;  2TSS A;  3PMF A;  1OXX K;  5DEH A;  1CQF A;  1GUN A;  1GOZ A;  1VQB A;  1L1O B;  3K5L A;  1I50 H;  4IUV A;  2D62 A;  1RTN A;  3KLS X;  5CV6 A;  1I5F A;  3BJU A;  1IBL Q;  1TWH B;  4BBS G;  4RMF A;  2JA8 B;  4Q0F A;  3OMG A;  1PA6 A;  1AW7 A;  2HIX A;  1A3T A;  2FXQ A;  5JVH 3;  3PV0 A;  4BS9 A;  1STY A;  1VQ7 A;  3MFY A;  2ZXP A;  4JI7 L;  5C4H A;  4X64 L;  3KF8 B;  4JK1 C;  4FXD A;  5C0X H;  4A3F B;  3A7A B;  4R4I A;  1GXD C;  3GTG B;  4BY7 H;  4DV2 L;  1A3U A;  3J80 i;  3UE0 A;  4KHP L;  1PRT D;  2M00 A;  2E2J B;  1ROD A;  4ME5 A;  1OXV A;  1VQC A;  2PNR C;  3RNU A;  5A2Q L;  2NZO A;  4XT3 B;  2B2W C;  2QA4 A;  1QB5 D;  1VDZ A;  3SDZ A;  5KIX A;  1SE8 A;  3E9I A;  3ONA B;  1X55 A;  4JPB W;  5KND A;  4DUZ Q;  3OYY A;  1HJP A;  2KA7 A;  5FJ8 H;  5AJ3 Q;  1VS0 A;  4LW1 A;  4B9X A;  3NQI A;  2A73 B;  3K8A A;  3STB D;  2F0I A;  3N52 A;  3KF8 A;  4S3S A;  4BBR G;  3PO3 G;  4KMU C;  1SEB D;  4PZ6 A;  2EIF A;  1NAP A;  1PH7 A;  3DM3 A;  4NXM Q;  4APV A;  1D1I A;  4I7Z C;  1GUS A;  2EXD A;  1JT8 A;  1HRJ A;  2OQK A;  2VY3 A;  3S17 H;  4GOP A;  2K5V A;  3J81 j;  1TQO A;  1Q82 C;  2BH2 A;  2WB1 B;  4GOP C;  1DXM A;  1TT2 A;  3DWQ A;  5IGC A;  4A75 A;  3KF6 B;  2SDF A;  4NP5 A;  2E2J H;  4LFA Q;  3PUX A;  3TP6 A;  2Q2U A;  2DUD A;  1QOH A;  3EN2 A;  3S2D H;  1WTQ A;  1EYD A;  1A2U A;  4UP8 A;  4IO9 A;  1PH5 A;  2E5L Q;  5BN5 A;  4C1N I;  2NWG A;  1F9R A;  3B6Y A;  3R3O A;  4A3E G;  1G2T A;  2ICE C;  4B3T Q;  3T53 B;  3OTO Q;  4FF4 A;  2R93 H;  1X3G A;  4XQN A;  2UU9 Q;  4A3M G;  1B2T A;  2K14 A;  4BY1 G;  3DWP A;  3SGI A;  1E2V A;  1EWH A;  2CCZ A;  1H95 A;  4ZRZ A;  2C35 B;  2RSO A;  2ES2 A;  3HOX B;  1LTG D;  4QIW E;  1U9R A;  2V1C C;  2N3S A;  1DJR D;  2F1M A;  4PQX A;  2A8V A;  1Y1V G;  1JCK B;  3ULP A;  1S4Z A;  1VQN A;  1I3Q B;  1UE7 A;  2K01 A;  1F2Z A;  1U4M A;  3HKZ G;  3NBH A;  4I7A A;  4J8Q A;  1DD2 A;  2VXW A;  2HD3 A;  3PF4 A;  4DPG A;  4DV1 L;  1XNR Q;  3PO3 H;  1ONL A;  1CK1 A;  3E0E A;  3E9H A;  5T1I A;  5CMD A;  5CV9 A;  4O2D A;  2JA6 H;  3GV6 A;  3HOX G;  1P16 A;  3A55 A;  1BKB A;  4XT1 B;  2ZM6 L;  5M5X H;  5KNC A;  2R92 B;  2I46 A;  2HDL A;  1LLR D;  1L1O C;  4M1U B;  3CPF A;  3GV3 A;  2LY7 A;  3D4D A;  4GN5 A;  3M4P A;  2JEA I;  4IN3 A;  3CCL A;  3K7U C;  5KYL A;  4WJ3 M;  3IFD A;  3HEJ A;  1VQL A;  4Q5V A;  4FF3 A;  1U0L A;  4HID A;  3HOZ H;  1TKW B;  3X3M A;  3TZD A;  1QVF A;  5C0X J;  2UXC L;  2BA0 A;  5KEE A;  4P74 A;  2JN4 A;  5CR3 A;  2RVL A;  3L3O C;  2K50 A;  3L7Z C;  2XWB B;  5CYU A;  1B44 D;  3H3V C;  4BA2 I;  4DN4 M;  1FGU A;  2X69 A;  2Q2I A;  1AZP A;  3IRB A;  2EYO A;  1SNC A;  3BZK A;  1LT6 D;  4JC0 A;  1GD7 A;  2RKS A;  3M85 A;  2UXD L;  3KLR A;  1BOS A;  2IJ0 A;  2YTX A;  4JV5 Q;  1BBU A;  3CP0 A;  2R6G A;  2WFW A;  1CTM A;  4BBS H;  2RSN A;  1UNS A;  2NVX H;  5ELD A;  1PXU A;  5JJL A;  3MXG A;  4TKO B;  5FKA C;  1LAB A;  1W6K A;  3S2H B;  1BR9 A;  1IYU A;  5IT9 c;  1D1K A;  2YTY A;  1TS5 A;  2XSC A;  3S15 H;  1QVG A;  4GKJ L;  1JWM D;  1HQR D;  4N9P A;  1W6J A;  5AFW A;  2FHT A;  1ZXT A;  2K1B A;  2YU9 H;  1X3F A;  2ZXO A;  4F87 A;  3PIO A;  3K7A B;  1VMC A;  1KNE A;  1PV4 A;  4BY1 H;  5C3E H;  3C3L A;  4PMW A;  5J22 A;  1XNQ L;  5IT9 L;  1E2W A;  2DNE A;  3J7Z C;  4JI5 L;  3BVZ A;  3WOE A;  4X66 L;  2Z4H A;  3CXC A;  3HP3 A;  5JJI A;  3I4N G;  1CKN B;  3M3Y H;  2Z6K A;  2WV6 D;  3RLN A;  4L6T B;  1K8O A;  4P73 A;  2CW0 D;  3BS1 A;  2R92 H;  1C8C A;  4LF6 Q;  2B39 A;  1PTO F;  2N55 A;  2MPM A;  2JA6 B;  5HGQ A;  4JI0 L;  4JYA L;  2BOS A;  2EY1 A;  4FNF A;  4V0B A;  3MAQ A;  3CCE A;  1JB7 A;  4DR2 Q;  1OO9 B;  3H09 A;  2Z0S A;  2EJM A;  4DV4 Q;  2CFM A;  1DZ1 A;  4YWK A;  3I7F A;  1SNO A;  3DEO A;  3SE0 A;  2AWO A;  1TY0 A;  1RHP A;  5IGG A;  4JI6 L;  5M5X B;  5FO9 B;  4JBJ A;  3I4N H;  2WII B;  5TSS A;  3D0F A;  2PW7 A;  4POF A;  3RZO B;  1WVL A;  1XPR A;  1Y69 U;  2IL8 A;  2Q2H A;  3R93 A;  1Y1W G;  1J6Q A;  3Q6S A;  5GAH C;  2B2W A;  3TZU A;  5F2D A;  2KHJ A;  1EY5 A;  1SYE A;  1T9H A;  1NMF A;  3TME A;  2P5Z X;  1I4R A;  3F2B A;  3A5U A;  3CD6 A;  1K8G A;  5FJ8 G;  2F0F A;  1MSG A;  1J5E Q;  1HTL D;  1E3P A;  3HOY B;  2A1A A;  4YHH L;  2B2Y A;  2NB0 A;  1O7L A;  1HA6 A;  4KTA A;  3ER0 A;  3NEN A;  2R7F A;  4DK6 C;  3A8J E;  5A35 A;  1EQV A;  4XTC S;  2WIN B;  1LTL A;  1VQ4 A;  3C1E A;  2EYJ A;  3S17 B;  1DOM A;  3VYT A;  2KHI A;  3CCQ A;  1DYQ A;  2ZXR A;  4QQB X;  1PDQ A;  4O1N A;  3I56 A;  3O13 A;  4HTH A;  4KJN A;  1HUM A;  3AFP A;  4LFC L;  1PZJ D;  1W3S A;  4DR6 Q;  3BDC A;  1VQA A;  3T56 B;  4FF2 A;  1MJC A;  2SOB A;  2B3G A;  3H6M A;  4K5V A;  1Q81 C;  3I4M H;  2B2V A;  4JI1 Q;  1HHV A;  3MXN A;  5IP7 G;  4CJ0 B;  1MHW C;  4RGT A;  3W2D A;  1J9O A;  3VR6 A;  1S5F D;  1UWV A;  1EFI D;  4F8M A;  5EBD A;  3BZC A;  2EY5 A;  1STE A;  3NTK A;  4YWL A;  2UXD Q;  1HNW L;  2KJX A;  2PQA B;  5H1S E;  3K5O A;  1X6O A;  2VB3 X;  4IZ8 A;  5GAD C;  4X3U A;  1I6V C;  2D9U A;  1YI2 A;  2IT1 A;  4A3B G;  4A76 A;  1K73 C;  1ET9 A;  3DMU A;  1T5E A;  2IWH A;  5JEA H;  2A6E D;  1PLF A;  1UE1 A;  1MKH A;  1KAB A;  2EVB A;  4GLV B;  3S1R B;  2G9H D;  4RGN A;  2UUC Q;  1IYV A;  1AEX A;  2I0Q A;  5K36 G;  3SK4 A;  1JOR A;  2HIV A;  4OHJ A;  1HNX L;  2PMZ E;  3H94 A;  4LF7 L;  4CKC A;  2EY6 A;  3IFT A;  3F8T A;  4MTK A;  4L5R C;  3AU7 A;  2KCT A;  1LTS D;  3WDN A;  1F2M A;  4DFA A;  3S2D B;  1Z9F A;  3CAM A;  2HT1 A;  2IX3 A;  1U4L A;  2JP1 A;  4X65 Q;  1EZ6 A;  1WTW A;  2K5N A;  3MWY W;  1Q12 A;  4QY7 A;  1RTO A;  1V1P B;  1WOC A;  3BYY B;  3NEM A;  2F3V A;  4B08 A;  4DR7 L;  5D3I B;  3P20 A;  2A19 A;  3DHQ A;  4WRD A;  2XVS A;  3NPP A;  1VQH A;  1STG A;  2VQE L;  4IFD H;  3MC0 B;  4JBK A;  3A5Z B;  4C3H B;  1Y14 B;  1WCM B;  3M4O B;  4P72 A;  4GS3 A;  4DR3 L;  1SND A;  2LMC B;  4AQY Q;  2A6E C;  5E4W C;  3VA7 A;  3GTK H;  4EGV A;  4GZY C;  4CBV A;  5FOB B;  1VQO A;  1QZG A;  1CQV A;  1NTG A;  1N8R C;  1KC8 C;  1ZYR D;  3QOJ A;  1PFS A;  4LJZ C;  4DUY Q;  4CJ1 B; 
#chains in the Genus database with same CATH homology
 1EQT A;  5EBC A;  2EYP A;  1PFN A;  3VYR A;  2HCC A;  2K03 A;  4OO1 I;  4RGM A;  3VYS A;  3FVQ A;  1IL8 A;  3D3R A;  3SK5 A;  1CM9 A;  1EU4 A;  4R8N A;  3H0G B;  3GTP B;  1LT3 D;  4A3E B;  1BBX C;  1S5C D;  2F0V A;  4HSV A;  1GHJ A;  3A8I E;  2K04 A;  2B2Y C;  4ODG A;  5C3X A;  3E5S A;  1SYC A;  1LTT D;  3OOC A;  4UAI A;  1B9N A;  1FR3 A;  4OL7 A;  4ZUJ A;  4EVO A;  1MBY A;  1HFG A;  3S16 B;  1JC7 A;  1KNA A;  1DCZ A;  4CKE A;  1SXT A;  3AMU A;  3C46 A;  3GTQ B;  4DAY A;  1EZ8 A;  3Q22 A;  1WTV A;  3VA5 A;  1S5E D;  2X6G A;  3K5N A;  2L4N A;  1QCB D;  1J8I A;  4XQJ A;  3TN2 A;  1V1P A;  2LKV A;  1QWY A;  1EY9 A;  2GA4 B;  2FMC A;  3K59 A;  1K83 B;  2EPB A;  3L9A X;  1OXT A;  2KED A;  3CKI B;  4QMG A;  2RA4 A;  5CBA E;  1FNW A;  1BCP B;  1D6E C;  4K6L A;  4K2L A;  4BA1 I;  3VYU A;  3SHL A;  2JA5 B;  2CQA A;  1D5Z C;  3D4R A;  4KI0 A;  3NTH A;  2AWN A;  3S1N B;  4WOR A;  2QCP X;  1TR5 A;  1XTC D;  4IUQ A;  3OIQ A;  4KKT A;  4QIW B;  2EJF C;  1E0B A;  1F77 A;  2K33 A;  5C4J B;  3ERO A;  3BYT B;  1LV9 A;  2HQE A;  5M3F B;  5KYI A;  1O80 A;  2F0H A;  5LL6 S;  5COR A;  1ENC A;  2ID0 A;  1ILP A;  5BN4 A;  3ERQ A;  3KLS A;  3D6C A;  2G9D A;  4R8I A;  1L0Y B;  3FRP B;  4KY5 A;  1NR2 A;  1SYF A;  3NXW A;  3NBI A;  4XYO A;  4R9W A;  5I2X A;  4HAE A;  5CC4 A;  2QF7 A;  2K6A A;  4FYD A;  1SMY D;  1EY4 A;  2QIL A;  3MXP A;  2CW0 C;  5JJZ A;  3CRK C;  5BN3 A;  4UDU C;  1G2S A;  4BBS B;  1BNZ A;  3BVM A;  3W3A A;  1SNQ A;  5G3L D;  2NN6 G;  2RDF A;  4P2C B;  5EKI A;  4KD3 A;  2YYZ A;  2NZ1 D;  3X3N A;  1I4G A;  4DAV A;  3FMC A;  1DOL A;  4IFD I;  1X3Q A;  5C4X B;  3BDL A;  4LMQ D;  2V4D A;  1FYC A;  5D3D A;  2JXM B;  1XYI A;  1H9R A;  4A3J B;  1YNJ C;  4F88 A;  3SVM A;  4MN3 A;  2OF1 A;  2RQX A;  1L0X B;  1A3V A;  2A69 D;  3I70 A;  3OSO A;  5JAV A;  1LTI D;  1SMY C;  4MHE A;  3VR3 A;  2F03 A;  5M3M B;  1ENF A;  1HCZ A;  3BG3 A;  1CZW A;  4TRD A;  2HCI A;  3MZ5 A;  3NTI A;  3NWT A;  2SNM A;  3I91 A;  2VNU D;  2B63 B;  4BY1 B;  1EYA A;  3RLF A;  2MJ8 A;  2EY2 A;  3HRZ C;  2NVY B;  2QDB A;  2FMM A;  4WFN 3;  4M8A A;  1V1O A;  2NN6 I;  3KBX A;  2Y0S B;  2ZT9 C;  1JB3 A;  5FK9 C;  3NUC A;  2E2D C;  1KDB A;  2KCN A;  1HFN A;  2MUY A;  5I9P A;  1MSH A;  3LWE A;  2EOT A;  2KEC A;  3GTJ B;  1QNK A;  3TP7 A;  4KJO A;  2VUM B;  4KHV A;  4QUF A;  2NBF A;  1S5D D;  2F0T A;  4BBR B;  5FO8 B;  1A15 A;  4HCS A;  4PV1 C;  3EVQ A;  3QJY A;  3BDO A;  3HOU B;  2IX1 A;  1PRT B;  1Q8I A;  5ELB A;  4XDX A;  4JBW A;  2A69 C;  1WTR A;  2PW5 A;  4C3J G;  4J6H A;  1FNU A;  5DAU A;  3RD4 A;  2AQ3 B;  4WJW A;  4RAU C;  4Y7N B;  4IUN A;  4HMI A;  2XWJ B;  2EE1 A;  1KLU D;  1I50 B;  4PNY A;  1JWU D;  3K57 A;  1ESR A;  2HDM A;  5E1F A;  3MXU A;  3J81 E;  1QE6 A;  2F0S A;  5CBE E;  5C44 B;  1F9Q A;  4FXK C;  5DM6 3;  3K5M A;  5C4Z A;  1A6X A;  1B53 A;  3DM1 A;  1ESF A;  2EZV A;  2NYZ D;  4N9T A;  4IQZ A;  2KCC A;  4HMJ A;  4G57 A;  1SDF A;  5JEA G;  5JPM C;  2F0K A;  5ELC A;  2BCO A;  4RA8 A;  4KHZ A;  2A5H A;  2KHS A;  5IIF A;  3VR2 A;  2B8F A;  2O4X A;  2MHV A;  4TQU S;  1V43 A;  2TMP A;  5IOC A;  3M7G A;  1RKN A;  1I4H A;  5EGT A;  4DXG A;  4A3M B;  1EIH A;  3WOF A;  3OPO A;  3TDQ A;  1LT5 D;  1NCV A;  2EXZ A;  2M2L A;  3J80 E;  3D31 A;  3MEH A;  1B9M A;  2AUK A;  3HKZ B;  4XQQ A;  4H0L C;  4OO1 G;  2L11 A;  3CRL C;  2A74 C;  3LX0 A;  4K8I A;  4KY6 A;  3FKI B;  4ZK9 B;  2K28 A;  3A56 A;  1JWS D;  3A8K E;  4QF4 A;  2EJG C;  3CU7 A;  5IGB A;  3NQT A;  3GP7 A;  3PUZ A;  4IUR A;  4LAA A;  3OHX C;  2M9V A;  3FEW X;  5IGE A;  3JAM E;  3I4N B;  5DNF A;  3SR1 A;  2H4O A;  2F0G A;  1EIG A;  5J1Z A;  3UI2 A;  2E76 C;  3HOW B;  4DF7 A;  1SJE D;  4DXF A;  4EQO A;  2PQE A;  1CZG A;  2B2T C;  3C1F A;  3MA2 B;  2A6H C;  5EJW A;  3HOZ B;  4FXG C;  1CA5 A;  3D6W A;  2O5I C;  3T13 A;  3V05 A;  3P1H A;  1M4V A;  1HQM C;  3NWS A;  1KDA A;  3V2T A;  4IFD J;  5CGK A;  2IPK D;  2B2T A;  1SFO B;  1XXG A;  4C3I B;  5CV7 A;  4Z9C B;  3SK6 A;  3PO3 B;  3A7L A;  5I6W A;  1I4X A;  3J7A V;  3QIA A;  2L5T A;  1VCI A;  3AB9 A;  1BCP D;  3OWE B;  1ZEQ X;  1EY0 A;  4XXE A;  2F0N A;  4DK0 A;  3NHH A;  1SE2 A;  3E6Z X;  3EQL C;  4KKU A;  3R8B A;  1BO0 A;  2F3W A;  1SE3 A;  2VB2 X;  1Q1B A;  5IOD A;  1SE4 A;  1AZQ A;  3HOV B;  1I6H B;  2NVT B;  2JYO A;  4QCL A;  3IL8 A;  4FP5 D;  2WAQ B;  3DWA A;  4CHT B;  1QIL A;  2WP8 J;  3HGB A;  3ZYY X;  1Q90 A;  3S15 B;  1D2B A;  1SAP A;  3D8G A;  3MFG A;  1M8A A;  1G29 1;  1ILQ A;  5I9O A;  5M5Y B;  4H44 C;  4IUT A;  2MP1 A;  4C3I G;  1Z6H A;  2L0C A;  5CV5 A;  1PRT F;  4X3T A;  2XRS D;  1JR0 D;  1K8M A;  1JOK A;  3ND8 A;  5KRU A;  2XIW A;  4YIJ A;  3IAY A;  4NMZ A;  1O7Z A;  2X6L A;  1FD7 D;  4L63 B;  1PTO B;  2IW3 A;  2F0W A;  1SNM A;  3EA6 A;  1HPC A;  2R93 B;  3G7L A;  4RWS C;  4ZAI A;  2DY8 A;  2EYF A;  4QUC A;  1TWC B;  4NDX A;  2EYM A;  1GUT A;  2ENB A;  5CV4 A;  5M9O A;  4U67 3;  4RCN A;  5C5L A;  1PRT C;  2RDH A;  2DY7 A;  3PUV A;  2PZW A;  3FPP A;  2WKD A;  4ILW A;  3TP5 A;  3MTS A;  4E6I A;  2JA7 B;  1Y8O B;  1TVX A;  5A2Q E;  2E75 C;  1CFM A;  1TWF B;  2D5D A;  4HCE A;  3FPU B;  5HGT A;  1Y8P B;  2MGS A;  4RH6 A;  2KOL A;  1WTP A;  3NSW A;  4BY7 B;  1ZKO A;  4CGY B;  1EEI D;  2B2V C;  1SYB A;  1CHQ D;  2WKC A;  4DAP A;  4PMC A;  4OGQ C;  3JAM L;  4K5X A;  2O5J C;  1TY2 A;  1EY7 A;  2ICI A;  4XIG S;  4A3K B;  1IHZ A;  1V8Q A;  4H13 C;  5C0X G;  4K2K A;  3FDT A;  4KY7 A;  1D5M C;  3URY A;  2KEE A;  3S1M B;  4IUP A;  1IKM A;  1XX8 A;  3J7Y W;  4KKS A;  3I90 A;  3V96 A;  3S14 B;  2BE5 C;  4DU9 A;  4ABN A;  2L9H A;  1JIC A;  5KNB A;  2JSO A;  5M5W B;  1SJH D;  4QB4 A;  3K0Y A;  4A3G B;  3OW7 A;  2FJ2 A;  2SEB D;  1VMP A;  2YU9 B;  3A54 A;  4IUU A;  2F0E A;  5ELE A;  4NKL A;  3QO2 A;  4ZUI A;  3SXH A;  1EWC A;  5NUC A;  4DNR B;  5EQ0 A;  1O7Y A;  2R61 A;  1RJT A;  2NVX B;  1PZK D;  5I2Y A;  1PTO C;  2EYL A;  5IGD A;  5EKL A;  3RZD B;  1H9S B;  3D4W A;  2LFN A;  3QB3 A;  2OXP A;  1G91 A;  1VF5 C;  3IKJ A;  4RHS A;  2F0P A;  2QKI C;  2K7V A;  3DXJ C;  5COY A;  2OEO A;  1R9T B;  5JOB A;  1B3A A;  3T16 A;  4ID6 A;  4OO1 H;  1ENA A;  1GHK A;  1B4O A;  2PMZ B;  4PMB A;  1VF7 A;  3OMC A;  5EPJ A;  2K5D A;  3M3Y B;  3S9W A;  4ZQ3 A;  1MGS A;  1H9K A;  5C3E B;  1G6Z A;  4C2M B;  1AFP A;  1JE4 A;  2F0O A;  1S5B D;  4FO2 A;  1EY8 A;  1F2Y A;  1LTR D;  1CI3 M;  2DNC A;  4K8J A;  3QWN A;  4J1M A;  3GTL B;  3HZX A;  2JE6 I;  2PZU A;  3GTM B;  3BZD B;  1JOO A;  2I07 B;  1H9J A;  1SYD A;  1C4Q A;  1OXS C;  3QOL A;  1B1Z A;  1NUC A;  1OXU A;  3TP8 A;  5G3L F;  1PFM A;  5T1G A;  2EYH A;  2D2C C;  1EL0 A;  5I4D A;  2K5Q A;  5EKK A;  1LAC A;  1LO5 D;  4RCO A;  2IX0 A;  1SYG A;  2HUG A;  2B8G A;  1GJX A;  3KK7 A;  2PO4 A;  5CV8 A;  3PIP 3;  2N88 A;  2Z4I A;  1NR4 A;  2F0D A;  2XN9 C;  3PIO 3;  1ICW A;  1STN A;  4C3H G;  4G7O C;  1BXT A;  1MD2 D;  4U68 A;  3P7J A;  4DGZ A;  3OWF A;  1YNN D;  3PUW A;  2O2L D;  1BUV T;  1YNJ D;  3EJI A;  3K6O A;  2NTT A;  3J81 L;  2DN8 A;  1RDP D;  3MVV A;  4ZKC B;  2J7Z A;  5E3F A;  1WTO A;  3J80 L;  1R4Q B;  1DOK A;  1Y8N B;  4L8J A;  1TWG B;  2J4X A;  4H7B A;  2BE5 D;  3GTO B;  1II3 A;  2L12 A;  1Z47 A;  2K05 A;  1SNP A;  4ZLT F;  3E0J A;  4KN7 C;  1EEF D;  3DUZ A;  4CJ2 C;  4A93 B;  2Q8R E;  1EU3 A;  2L55 A;  3I72 A;  4IFD G;  1BF4 A;  5K5P A;  4HN7 A;  4KV6 A;  3U9S A;  2AQ1 B;  3I4L A;  1QNU A;  2BDN A;  4RKL A;  1X3P A;  4RKB A;  4A3I B;  1STA A;  5J39 A;  1LT4 D;  2NUC A;  1U4R A;  3T4A C;  2BA1 A;  4C56 C;  4DNT B;  2A6H D;  3N6R A;  3G6J B;  1Z7T A;  4TSS A;  5C5M A;  1PYW D;  5K36 H;  4IAL A;  2EDG A;  2C5C A;  4ULL A;  4RGO S;  5LL6 X;  2A68 D;  1EOT A;  1MI2 A;  1O78 A;  3NE5 B;  1HXY D;  2R3Z A;  5FLX E;  1EY6 A;  2FIN B;  4AYB B;  1STB A;  2R7Z B;  4G4K A;  4K6D A;  5ELF A;  3Q24 A;  4DK1 A;  3GTK B;  1STH A;  1TWA B;  1TII D;  4KK7 A;  1F9S A;  1FNV A;  4X3K A;  2CHB D;  4A3D B;  3H91 A;  5ISR A;  1Y1V B;  3SK8 A;  2K32 A;  2WAC A;  3GO5 A;  2NN6 H;  3GQB A;  3RMH A;  3I73 A;  2PPB C;  5EPL A;  3I4M B;  5D14 A;  2F0U A;  3ND9 A;  2LS0 1;  4B9W A;  1KLG D;  1KAA A;  4G7Z C;  1DM0 B;  3HG9 A;  3SEB A;  2J0T D;  5C0X I;  2F0M A;  2E2H B;  3VR4 A;  2A68 C;  3QG1 A;  2KVM A;  1I4Q A;  5IGF A;  1TS4 A;  2AUJ D;  2Q8I B;  5JEA J;  1JQY D;  1JOQ A;  1G8Z D;  2Z1C A;  3M7N A;  5IT9 E;  2PCF B;  3M4Y A;  3F2U A;  2JEB I;  1PMR A;  3ITP A;  2F0J A;  1TS2 A;  3TSS A;  1A2T A;  1GUW A;  2RDG A;  1UAP A;  4K5W A;  1WD0 A;  2Z8L A;  4FVM A;  1LTA D;  1BQQ T;  2QEJ C;  3MHB A;  1F9P A;  1RD9 D;  4ZKB B;  1IW7 C;  5I6Y A;  3DEP A;  4ZYS A;  4MIU A;  4I65 A;  1Q1E A;  4FF1 A;  1CHP D;  3NK9 A;  2F0Q A;  3HS0 C;  2XNA C;  3NP8 A;  1RF2 D;  1X32 A;  1R4P B;  2F0L A;  1F2L A;  1TU2 B;  1UEA B;  1GUO A;  1QJO A;  5JVG 3;  1U4P A;  5KGU A;  1AP0 A;  1H9M A;  5JPN C;  4DA2 A;  4V19 0;  5HUR A;  2RBM A;  2PZT A;  3R2I A;  2CVR A;  3VR5 A;  4O42 A;  3J7A F;  1WD1 A;  2SNS A;  1TS3 A;  2NTS A;  1YNN C;  5DM7 3;  3Q0A A;  3RUZ A;  2L1B A;  1KDC A;  1PZI D;  1D5X C;  4XYQ A;  1PTO H;  4RHR A;  3Q23 A;  1ML0 D;  4C3J B;  1WTX A;  2C9O A;  1LTB D;  1H9S A;  4RFB A;  1SBB B;  1SSO A;  3K58 A;  1BDO A;  2NVQ B;  1FGB D;  2KQ3 A;  1DON A;  3BVG A;  1KTK A;  3T51 B;  3I8Z A;  1AN8 A;  1ZYR C;  3LWU A;  5C3W A;  1B50 A;  1NSN S;  2E74 C;  5FO7 B;  3KUP A;  4G7H C;  4KN4 C;  4CKB A;  5EPK A;  2AQ2 B;  1Y1W B;  4EQP A;  2E2I B;  4EQN A;  4X3S A;  1XWE A;  3S1Q B;  2Q8T A;  2XRQ D;  1UUP A;  1CT1 D;  1IW7 D;  2B2U C;  5FLX L;  4BWG B;  5E4X A;  2F4I A;  1RCV D;  3PUY A;  3I3C A;  4HR7 B;  1GUG A;  3PO2 B;  1HA5 A;  1T5X D;  2B2U A;  3GD7 A;  5D65 A;  5LHY 1;  3R2T A;  1PFB A;  1HUN A;  4K14 A;  4HED A;  4HSP A;  1I4P A;  5C6A A;  2OT2 A;  1QG7 A;  3KBG A;  1EYC A;  3OIP A;  1HTP A;  3CQZ B;  1CA6 A;  2FFK B;  4C1N K;  1BCP C;  4NW2 A;  3U9O A;  1IKL A;  4A3B B;  2KUM A;  1BCP F;  1ET6 A;  3EFX D;  4LK1 C;  2K5W A;  1E2Z A;  3C2P A;  3CHB D;  2BDO A;  3P75 A;  3TBI B;  4F7X A;  3LNN A;  2PYK A;  4OIK A;  4OIJ A;  1C48 A;  4KD4 A;  1PTO D;  2H1E A;  1Q3L A;  2TSS A;  5DEH A;  3PMF A;  1OXX K;  1CQF A;  1GUN A;  1GOZ A;  3K5L A;  4IUV A;  2D62 A;  1RTN A;  3KLS X;  5CV6 A;  1TWH B;  2JA8 B;  4Q0F A;  3OMG A;  1AW7 A;  1A3T A;  5JVH 3;  3PV0 A;  4BS9 A;  1STY A;  3MFY A;  2ZXP A;  5C4H A;  4JK1 C;  4FXD A;  5C0X H;  4A3F B;  3A7A B;  1GXD C;  3GTG B;  1A3U A;  1PRT D;  2M00 A;  2E2J B;  1ROD A;  4ME5 A;  1OXV A;  2PNR C;  5A2Q L;  4XT3 B;  2B2W C;  1QB5 D;  1VDZ A;  3SDZ A;  5KIX A;  3ONA B;  5KND A;  2KA7 A;  4B9X A;  3NQI A;  2A73 B;  2F0I A;  3N52 A;  3KF8 A;  4S3S A;  4KMU C;  1SEB D;  1NAP A;  1D1I A;  4I7Z C;  1GUS A;  1HRJ A;  1TQO A;  2WB1 B;  1DXM A;  1TT2 A;  3DWQ A;  5IGC A;  2SDF A;  4NP5 A;  3PUX A;  3TP6 A;  1QOH A;  1WTQ A;  1EYD A;  1A2U A;  5BN5 A;  4C1N I;  2NWG A;  1F9R A;  3R3O A;  1G2T A;  2ICE C;  3T53 B;  4FF4 A;  4XQN A;  1B2T A;  3DWP A;  1E2V A;  1EWH A;  4ZRZ A;  2RSO A;  3HOX B;  1LTG D;  1U9R A;  1DJR D;  2F1M A;  4PQX A;  1JCK B;  1S4Z A;  1I3Q B;  2K01 A;  1F2Z A;  1U4M A;  3NBH A;  1DD2 A;  4J8Q A;  2VXW A;  1ONL A;  1CK1 A;  5T1I A;  5CMD A;  5CV9 A;  3GV6 A;  3A55 A;  4XT1 B;  5KNC A;  2R92 B;  2I46 A;  2HDL A;  1LLR D;  4M1U B;  3GV3 A;  2LY7 A;  3D4D A;  2JEA I;  4IN3 A;  5KYL A;  3IFD A;  3HEJ A;  4FF3 A;  4Q5V A;  1TKW B;  3X3M A;  3TZD A;  5C0X J;  2BA0 A;  5KEE A;  5CR3 A;  2RVL A;  3L3O C;  3L7Z C;  2XWB B;  5CYU A;  1B44 D;  3H3V C;  4BA2 I;  4DN4 M;  2X69 A;  1AZP A;  2EYO A;  1SNC A;  1LT6 D;  2RKS A;  3M85 A;  3KLR A;  1BOS A;  2IJ0 A;  2R6G A;  1CTM A;  2RSN A;  1UNS A;  5ELD A;  1PXU A;  3MXG A;  4TKO B;  5FKA C;  1LAB A;  1W6K A;  3S2H B;  1BR9 A;  1IYU A;  1D1K A;  1TS5 A;  2XSC A;  1JWM D;  1HQR D;  4N9P A;  1W6J A;  5AFW A;  2FHT A;  1ZXT A;  2K1B A;  2ZXO A;  4F87 A;  3K7A B;  1VMC A;  1KNE A;  3C3L A;  4PMW A;  5J22 A;  5IT9 L;  1E2W A;  2DNE A;  3WOE A;  3BVZ A;  2Z4H A;  3HP3 A;  2WV6 D;  4L6T B;  1K8O A;  2CW0 D;  3BS1 A;  1C8C A;  2B39 A;  1PTO F;  2N55 A;  2MPM A;  2JA6 B;  2BOS A;  2EY1 A;  4FNF A;  4V0B A;  3MAQ A;  1OO9 B;  3H09 A;  2EJM A;  1DZ1 A;  1SNO A;  3DEO A;  3SE0 A;  2AWO A;  1TY0 A;  1RHP A;  5IGG A;  5M5X B;  5FO9 B;  2WII B;  5TSS A;  3RZO B;  2PW7 A;  1WVL A;  1Y69 U;  2IL8 A;  3R93 A;  3Q6S A;  2B2W A;  3TZU A;  5F2D A;  1EY5 A;  1SYE A;  3TME A;  1I4R A;  2F0F A;  1MSG A;  1HTL D;  3HOY B;  2B2Y A;  2NB0 A;  1O7L A;  1HA6 A;  4KTA A;  3A8J E;  5A35 A;  1EQV A;  4XTC S;  2WIN B;  3C1E A;  2EYJ A;  3S17 B;  1DOM A;  3VYT A;  1DYQ A;  2ZXR A;  1PDQ A;  4O1N A;  3O13 A;  4HTH A;  4KJN A;  1HUM A;  1PZJ D;  3BDC A;  3T56 B;  4FF2 A;  2SOB A;  3H6M A;  4K5V A;  2B2V A;  1HHV A;  3MXN A;  4CJ0 B;  4RGT A;  3W2D A;  1J9O A;  3VR6 A;  1S5F D;  4F8M A;  1EFI D;  5EBD A;  2EY5 A;  1STE A;  3NTK A;  2KJX A;  3K5O A;  2VB3 X;  4IZ8 A;  4X3U A;  1I6V C;  2D9U A;  2IT1 A;  1ET9 A;  3DMU A;  1T5E A;  2IWH A;  5JEA H;  2A6E D;  1PLF A;  1KAB A;  2EVB A;  3S1R B;  2G9H D;  4RGN A;  1IYV A;  1AEX A;  5K36 G;  3SK4 A;  1JOR A;  4OHJ A;  3H94 A;  4CKC A;  2EY6 A;  3IFT A;  3AU7 A;  1LTS D;  3WDN A;  1F2M A;  4DFA A;  3S2D B;  2IX3 A;  1U4L A;  2JP1 A;  1EZ6 A;  1WTW A;  3MWY W;  1Q12 A;  1RTO A;  1V1P B;  3BYY B;  2F3V A;  4B08 A;  5D3I B;  3P20 A;  3DHQ A;  4WRD A;  2XVS A;  3NPP A;  1STG A;  4IFD H;  3MC0 B;  4C3H B;  1WCM B;  3M4O B;  1SND A;  2LMC B;  2A6E C;  5E4W C;  3VA7 A;  4EGV A;  4GZY C;  4CBV A;  5FOB B;  1CQV A;  1ZYR D;  3QOJ A;  4LJZ C;  4CJ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...