2K33A

Solution structure of an n-glycosylated protein using in vitro glycosylation
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
116
structure length
116
Chain Sequence
DVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDQASKDFNRSKALFSQSAISQKEYDSSLATLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, transport protein
molecule keywords AcrA
publication title NMR structure determination of a segmentally labeled glycoprotein using in vitro glycosylation.
pubmed doi rcsb
source organism Campylobacter jejuni
total genus 6
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2008-04-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2k33A00
3A7AB 1V8QA 3EQLC 3P20A 2EDGA 1Y8NB 2JE6I 1GUNA 2K32A 5BN5A 4IFDG 2A6EC 1BDOA 2EVBA 2PPBC 3U9SA 5JEAG 1SMYC 1H9SB 2IT1A 3I72A 3VR6A 3VR4A 2A6HD 1GHJA 1YNNC 2EJMA 1K8OA 1IYUA 4G7OC 3RLFA 2JXMB 2JEAI 3OOCA 3PUWA 3QG1A 1I6VC 2NN6I 4OGQC 3OPOA 1VF7A 3LWUA 1Y8PB 1E2WA 2DN8A 1CTMA 4KKSA 4LJZC 3WDNA 5K36H 1ZKOA 3MFYA 2LMCB 4XTCS 4JK1C 1PMRA 2A68C 2A69C 3VR5A 1OXXK 3FPPA 1DD2A 3A8IE 5C0XH 2R6GA 1YNJC 3A7LA 1TU2B 1H9RA 3AB9A 1TKWB 2ZT9C 3M85A 3IKJA 4KKUA 1GUTA 1Q1EA 2A6ED 4PV1C 3L7ZC 2K7VA 4DK0A 2L5TA 1OXTA 5A35A 2BDOA 2E76C 2BA0A 2O5IC 4OO1H 1H9MA 2E74C 1GUOA 1OXSC 3A8KE 4L8JA 2DNCA 2F1MA 4LK1C 5K36G 2E75C 3VR2A 4XIGS 1HCZA 3PUYA 1IW7C 2CW0C 4I7ZC 2K33A 3T53B 4KI0A 3M7NA 3I73A 4KHZA 1H9SA 1DXMA 3T51B 5C0XG 3IFTA 3W3AA 3A8JE 4BA1I 1VCIA 3H94A 3CRKC 1QJOA 2A68D 3I4LA 2D5DA 2A69D 3D4RA 3QIAA 1H9KA 2EJGC 2DNEA 4DK1A 1CFMA 1Q1BA 3PUVA 4IQZA 2D62A 1FYCA 1E2ZA 3SE0A 4OO1G 4DNTB 5KNBA 1GUSA 2KCCA 2BE5C 2KA7A 3OW7A 1OXUA 2AUKA 1EWHA 5KNCA 3LNNA 1E2VA 1HTPA 3HGBA 3NE5B 3PUZA 2YYZA 1K8MA 1Y8OB 3VA7A 1O7LA 2QF7A 2PCFB 1Y69U 1B9NA 3ND9A 2V4DA 2PNRC 4TQUS 3TZUA 3CRLC 1ONLA 1HPCA 3SDZA 4KN4C 2NN6H 1Q90A 1Z6HA 4DNRB 3T56B 1FR3A 1HQMC 2O5JC 3VR3A 2EJFC 1IYVA 1CI3M 1IW7D 3GQBA 4H44C 3N6RA 1A6XA 2AUJD 1G291 1ZYRC 2A6HC 2B8FA 5BN4A 1GJXA 2JEBI 4IFDH 4RCNA 3PV0A 4H13C 4H0LC 5JEAH 3M4YA 4G7ZC 1O78A 3BDOA 4HR7B 1V43A 3PUXA 2AWOA 1OXVA 4JBWA 3GD7A 4G7HC 1GHKA 5BN3A 1LACA 4KKTA 3FMCA 1B9MA 2Q8IB 2D2CC 2B8GA 1LABA 4TKOB 2BE5D 4KN7C 3D31A 3MXUA 3ND8A 1VF5C 1DCZA 4KMUC 2BA1A 3BG3A 1H9JA 1Q12A 2NN6G 1Z7TA 3DXJC 4BA2I 1GUGA 1VDZA 4GZYC 1T5EA 3QJYA 5KNDA 3KLRA
chains in the Genus database with same CATH superfamily
5C3EH 1PH4A 1XPOA 4JPBW 1R9TB 4GKKQ 4DGZA 1JWMD 3ERQA 1JT8A 1L2FA 3I72A 3CMAA 3BS1A 3S1MB 2JXMB 3OOCA 4B3TL 5HGTA 1B7YB 4DV3Q 1VQFA 5KYLA 5GQOA 3FKIH 1PTOF 4CKEA 2TSSA 2RHSB 1PMRA 3S9WA 1X65A 2UU9Q 1TT2A 1WTXA 4DR6Q 3K6OA 3S1RH 4ZQ3A 1EU3A 2F0VA 2CWAA 4DXGA 1EFWA 4BBSG 2BDOA 1YHQA 1YEZA 3QB3A 2VUMB 2I5MX 1VQPA 1HTLD 4LK1C 4IO9A 4LF4L 1HR0L 1EIYB 3H91A 1PRTD 1F2ZA 4I7ZC 4IPHA 2XWBB 1HZAA 1N36L 3J81E 4XQQA 2JN4A 3RLOA 1VQEA 3IFTA 2F0EA 3PGZA 4OIJA 1X56A 1QJOA 3TP6A 4H02A 4A3GH 4CBVA 4JBMA 4K2KA 5FLMG 4EGVA 2VNUD 1XNRQ 1LTTD 2GVAA 2RDFA 1YVCA 4HMJA 1E1OA 4GLXA 1VQDA 3BZKA 2YYZA 1NJIC 4LFBL 5FJ8H 4HMIA 3VR3A 3SEBA 1UE7A 3FVQA 3LWEA 5LHY1 1I94L 1G291 5E4WC 3IL8A 1V9PA 3CHBD 1UUPA 1A15A 3M4YA 4YCWA 2A1AA 2GN5A 5LMNQ 1IKMA 3S1QH 4IUTA 3U9OA 4H7BA 2IPKD 1TWGH 3DEPA 3DHQA 4F88A 2FFKB 3KF8B 4JVZA 3HOYB 4LFCL 1NE3A 1Q8KA 5C44G 1ET9A 5EPKA 1HNZL 4BY7B 5IYCH 3TQYA 3RN2A 3E3XA 5EAYA 2BH2A 4O2DA 2JE6I 4NDXA 5CV6A 2LXJA 1X3GA 4RFBA 3GTQH 1XMQQ 2EJMA 1K8OA 1PH8A 5M5WH 2JEAI 3UI2A 2UXDQ 1A2UA 1BCPC 5J1ZA 2B63G 1WTWA 2DN8A 2RDGA 2QDBA 4DR7L 4NXML 2EXZA 4GKJQ 3NPPA 3HOXG 3MXPA 5ELBA 2YU9B 3VR5A 1JB3A 2K01A 2ES2A 1U4LA 2N3SA 3BYYB 1LTBD 3A7LA 3G4SA 1KDBA 5CC4A 3I4NH 3L7ZC 4XT1B 2L11A 2PW7A 4P74A 1A2TA 5C4XH 2UXBL 3ERSX 2ZM6L 3WOEA 3J80L 3CCQA 1P8LA 5K36G 1SR3A 4K8JA 4XIGS 3K7AH 1CSQA 1VQ7A 3ULLA 4YY3Q 2HHHQ 1E1TA 4DPGA 4L6TB 2KCTA 1Q86C 5E3FA 1WCMG 4A3CG 2EOTA 4QQBX 1TWHH 4KV6A 4DK3C 1PH5A 1CFMA 1RDPD 4IUUA 2NWGA 3TP7A 1O7ZA 5BR8Q 1AZQA 5KNBA 4AYBB 1KIXA 3NWSA 2HD3A 1A3TA 2AWNA 4JI0L 3HKZE 1FNVA 4JI3Q 2LKVA 1E2VA 1F9QA 4LAAA 1JORA 1FGBD 2BCOA 4HN7A 1VS0A 4DN4M 2IY5B 1KRTA 3CRLC 2B2YC 2NN6H 3NTIA 5IWAL 1X3QA 4DR1Q 4HIKA 1S5FD 1O80A 4P2CB 2NUCA 2AQ3B 1R9TH 1EYDA 3DM1A 1MSHA 2YTYA 1OXVA 2FINB 5FOBB 3D6WA 3K57A 3PSIA 2ICIA 3H3VH 3I91A 3WWVA 4CDFC 3S1MH 4RAUC 5L37A 5F2DA 2KEDA 3QOJA 2FMMA 3NP8A 1STHA 4JG2A 2Q8TA 3P20A 2E2IB 1MI2A 2A6EC 3J7YW 3OTOL 3VDYA 1SEBD 2WKCA 3GDEA 1I3QB 2KJXA 1H9SB 2F0KA 4B3RL 4HJ8A 3T1YQ 2P5ZX 5G3LF 5EBDA 1L1OC 3D4DA 1N9WA 5CBEE 4NP5A 1DOKA 4A3IH 1BR9A 1E2WA 1EWIA 4K5VA 1ZKOA 1Q82C 4DK6C 4DR4Q 1WYDA 2A68C 5FK9C 4ME5A 1E24A 4L5SA 4XXEA 4DUYQ 1SJHD 3QWNA 3FPPA 1G2SA 1VQHA 1KAAA 1UE1A 4K6LA 2EYMA 4UP7A 3M85A 1QVGA 4PV1C 4NXNQ 2MQHA 4CJ1B 4IURA 4DAPA 4DR5Q 5IGGA 1D5ZC 1CQVA 2IX0A 3A8KE 4L8JA 5IGBA 1K73C 5LMNW 1HCZA 4JW0A 1TWFB 2B2VA 1VMCA 1Y1VG 5D65A 2VQFQ 3BYTB 3ULJA 1DXMA 1SYCA 5M5XH 4LF7Q 1KDAA 3URYA 3Q8DA 1HA6A 1G6PA 1PH9A 3FHWA 5IY0A 1RCVD 2K5VA 1D8LA 2EIFA 4OO1G 3J80i 2JA7H 4BWGB 1EWHA 3GV3A 4RMFA 3B6YA 2MHVA 4FXGC 1YITA 2NVTB 1PFNA 1B53A 4RA8A 4PG3A 4HJ7A 4FF3A 2OQKA 4P73A 3FPUB 4DV1Q 4JI2Q 3HOYH 1CKOA 1S40A 2E5LQ 2B2WC 1LTAD 2HDLA 5IP9H 2ID0A 2NZOA 1BCPB 5CV4A 2CH4W 4DV7Q 1JE5A 3H0GG 3HZXA 4XDXA 5JEAH 2B2TA 3ER0A 1QZGA 1L0XB 1MSGA 1LT6D 4QUFA 1GXDC 1VQLA 3H09A 2DJGC 4KKTA 3CCEA 2NB0A 2EYFA 4C2MH 4ZCKA 2NYZD 5C44B 4XYOA 1HZ9A 3DXJC 1Z7TA 1GUGA 4GN4B 4JI4L 2B39A 1LTID 5JJKA 2Q2HA 1F9SA 2MFIA 4OIKA 2UXCL 5GAGC 4ZUJA 1KNAA 3GTJB 1KAWA 1IBMQ 4OX9L 4UHVA 4CKBA 3N52A 3PIPA 4PZ6A 1BNZA 1AFPA 1PYBA 2X69A 2WINB 4HAEA 3HOUG 1ILPA 4DF7A 2NN6I 4X64L 3HOVB 2FJ2A 4KKSA 3TMEA 1EY9A 2IL8A 3HOXB 4PNYA 4C3HB 5IIFA 5H1SE 3NXWA 3CCSA 3I4MB 3HKZG 1YNJC 4GN5A 1UNSA 4K0KL 1YI2A 4DV4L 1PH3A 4OELB 3KF8A 4UY8C 2N78A 3MVVA 3KBXA 3W1GA 4OWXB 4JYAL 1L0WA 1IL2A 4F8MA 1PV4A 1B8AA 1Z47A 1B44D 2UUBQ 3SK6A 5C3EB 4IFDI 1IZ6A 1WCMB 1LT4D 1TVXA 4NMZA 4A3JG 2E2HH 4I7AA 4LUOA 3F2BA 3DWQA 1U9RA 3PQIA 1Q1BA 2Z1CA 2XNAC 2Z6BA 2R92G 3OW7A 4I65A 1KLUD 3OIQA 1Y69U 4XT3B 2B2UA 1L1OB 3EJIA 2IWHA 3V05A 1RD9D 2XSCA 1TR5A 5KGUA 4L5QA 1CI3M 3H3VC 1M4VA 3UDGA 1A6XA 5BN4A 2F52A 2XIWA 1ENAA 2KEEA 5GAHC 1JE4A 2MO1A 4G7ZC 1EQVA 1SYDA 1DOLA 4A3FG 4KHPQ 2M00A 1GHKA 2PZUA 3SXHA 4DK0A 4QGUA 1VF5C 5ISRA 2A5HA 5J22A 1FGUA 2K14A 1MGSA 1RF2D 1ILQA 1KDCA 2N49A 3SGIA 1JCKB 4WRDA 5E7NA 3F2CA 1F9PA 4DV5Q 2NVXH 4J15A 2K6AA 4TRDA 4A4IA 2Y0SE 4EQOA 3S24A 4GOPC 3VR4A 2QW7A 1SE4A 3PIOA 3GTOB 1WFQA 1VQIA 5C3XA 3S14B 2MNAA 1RODA 4BBSH 5JEAJ 2IJ0A 5DEHA 1XTDA 4ZUIA 3I55A 5A2QE 4WORA 1EY4A 1QE6A 4DV0L 2L4NA 2AMCB 3CC7A 1JWUD 4J1MA 4ID6A 4O1NA 1DD2A 2YTXA 1TKWB 1C8CA 1JJ2A 3EVQA 2G9DA 4WJWA 1PRTF 5LMUL 5FLMH 5GADC 1DGSA 1TWGB 2ZTDA 2BA0A 4NPSA 4U673 2HIVA 3HOZG 2PQEA 1PH2A 3VYTA 2PI2E 3KLSX 3KUPA 1H9SA 3J81L 2A8VA 1TIID 5AFWA 4HIOA 1KD1C 2OF1A 4N9TA 1NMGA 4QB4A 4XYQA 3KDFB 2Z4HA 4X66Q 4LF9Q 3S17H 2N8NA 4V190 1SSOA 4DA2A 2NZ1D 4XQJA 3CU7A 5K5PA 1ICFB 2XRQD 1PH7A 1I4XA 1TS2A 1YBYA 2NTSA 4EQNA 1Y8OB 3RD4A 4QCLA 3CMEA 4JI5L 2K50A 3A55A 3NQIA 2F4VQ 5I2XA 4KN4C 1N34L 1IKLA 1Q90A 5C44H 4IPGA 5C4JB 1BOSA 3PCOB 1DOMA 5JVG3 1TS4A 4UAIA 4PMBA 1WTHA 1W3SA 3MA2B 3I4NB 1TS5A 2ZTEA 3DEOA 4JV5L 4H0LC 4WJ3M 5CMDA 3GTJH 1O78A 3BDOA 5C4XB 1LTSD 4JBJA 4JI7Q 5KRUA 2EQSA 2D0PA 5IP7G 1J5EQ 3K7AB 4CKCA 1ESRA 3BZDB 4KN7C 4YHHQ 4DFAA 1EQQA 4BA2I 2B63H 5C0XI 5ELNA 4JI6L 3A54A 4E6IA 1LV9A 4LFAQ 4A3EG 3HOXH 4LF8L 4DV6L 2K32A 1GUNA 1TWHB 1MIUA 1QB5D 3CQZH 3CW2C 4JOIC 1UE5A 2JA5G 4OXPA 4CHTB 1RL2A 1GHJA 4KJOA 1YNNC 1DM0B 2AKWB 1FJGQ 4LF5L 3HOUB 3NBIA 5AJ3L 4OONA 1JOQA 1YZ6A 1QZHA 4UDUC 4B3MQ 1EQRA 3OPOA 3R2IA 1HQRD 1RIPA 1CTMA 2JP1A 1X3EA 2Z4IA 1NR4A 4FF2A 5K36H 2GVBA 3PF5A 2LMCB 1PYWD 3KF6B 1I6HH 2A69C 1LT5D 2H1EA 3DWAA 1EYCA 4RWSC 5J3BA 3HKZB 1TWAB 1TY2A 4A3CH 1WCMH 1IBKQ 2OWOA 2RVLA 3J7AV 4A93G 2F0TA 5M3MG 5EPJA 1Q1EA 2L12A 1SDFA 3D3RA 3JAMc 3RN5A 3ICEA 1WI5A 3PO2G 3STBC 2DNCA 3W2DA 1PZKD 1WTVA 1A8VA 1TWCH 2K33A 1BCPD 4FXKC 4N9PA 1O7IA 4AQYL 3I2ZA 4HJ9A 3EROA 3G6JB 3AFPA 4CGYB 1MJCA 1LTLA 1B3QA 3PUVA 1MBYA 1RTOA 3HOWG 2CQOA 2WP8J 1K0RA 3OWFA 2MO0A 3JC66 4A3IB 4JI3L 1HUMA 3HGBA 4XQNA 2K75A 4GS3A 4GOPB 4ZYSA 3J81i 1EZ8A 3K81C 3HS0C 2Y0SG 1HPCA 5JPNC 1Y1WG 1UWVA 2Z8LA 1S4ZA 2ICEC 2B2YA 2OQ0A 1HQMC 1IYVA 1JB7A 4H44C 1YJ9A 2KQ3A 1I4RA 4RGTA 1IYJB 4ALPA 2M2LA 3NTHA 5CV9A 4RGOS 5D3DA 4A3FB 3F1ZA 5E4XA 2AWOA 4KJNA 4R4TA 1LTRD 5BN3A 1WTPA 4KK7A 3GTOH 4HSVA 3S14H 1IL8A 2RCNA 2VQEL 2MJ8A 1H9JA 1XPRA 3K80C 1NTGA 4DR3L 3W1BA 3I4OA 4RKBA 5M5XB 4POGA 3PIP3 3K5NA 2EDGA 3CCJA 3A5ZB 1W2BA 1BDOA 1NMFA 4K6DA 4KLKA 1I50H 3NK9A 2UUCQ 1EIHA 2LY7A 2JA7B 2NBFA 5GAEC 1QCBD 5EGTA 2J4XA 1L1OA 4G7OC 1HH2P 5I6WA 4DR2Q 1PTOH 2R61A 2F3WA 2JA9A 3JAME 3M3YH 3BVMA 5M3FG 1Y1VH 4IOAA 3A8IE 1HNWQ 2F0MA 2WB1E 2F0HA 1N33Q 4X3UA 2A6ED 3SK8A 4LF6Q 1SNCA 3C3LA 2HDMA 1HFGA 5ELFA 4APVA 5A35A 1CKNB 2HCIA 4DUZL 4C2MB 4DR5L 4OO1H 2IX3A 1GUOA 3AU7A 2I07B 2QEXA 4EQ5A 1FL0A 1IBLQ 3SR1A 1KQSA 3C46A 5JJIA 2EY5A 4X62L 3K0YA 3SHLA 1H95A 3G6EA 4FNFA 3MHBA 2A68D 1EIFA 2UUAQ 1STNA 5C4JH 1I5FA 2DNEA 3H15A 3PO3G 2CCZA 1U5KA 4QIWE 5JPMC 2X6GA 3H0GH 3SVMA 3U4VA 1RJTA 2K5WA 1GUSA 2R93G 1NSNS 3TRZA 2ASBA 2AUKA 4U68A 1N32L 2NVYH 1AP0A 4DXFA 1F9RA 1AW7A 2PW5A 1S5CD 2VZAA 3L3OC 2R7DA 2OEOA 4CDCC 2BOSA 1JMCA 1KHIA 3K7UC 2B2WA 2A6HC 2IHEA 3U50C 1GJXA 1XMOL 4RCNA 5IGDA 3IAYA 1ZYRD 2EPBA 1B50A 3R8BA 3AYHB 3HP3A 1K0SA 3PUXA 4B3TQ 1LUZA 1V1OA 3FMCA 4POFA 3LGJA 2SEBD 3HOUH 4TKOB 3M7GA 3A0JA 2K28A 2WIIB 1T5EA 2SOBA 4IOCA 1KTKA 1PXUA 3GO5A 3HFZB 3PIO3 3KDFA 1VQMA 2E2HB 3NWTA 1LT3D 4L5RC 3BDCA 3BVGA 2PPBC 2JA5B 1TWAH 1DZ1A 4MN3A 1PH6A 1J6QA 4X65L 1XWEA 1IYUA 3X3NA 4R8IA 3RLFA 3GTKH 3RNUA 4IZ8A 2Z6KC 4LF4Q 1C4QA 1E0BA 1CZGA 5IYBG 1HR0Q 1AN8A 3OSOA 1WD0A 2CHBD 4A3MG 1N36Q 4ZRZA 1CHQD 4IJHA 2K5QA 3Q0AA 4BY1G 3RZDB 1CZWA 1EYAA 2R6GA 5C3WA 1H9RA 2Q2TA 2ZT9C 4A3JH 4A93B 5M3MB 1K9MC 2F0NA 1II3A 3S2DB 2HCCA 1PZJD 1VQ6A 1XJVA 2FHTA 1F2MA 1HXYD 2XWJB 1B70B 1EQTA 1I4QA 2E76C 1UEBA 4TSSA 4J6HA 1D7QA 2R92H 2EXDA 3DWPA 3HKSA 1NR2A 4LFBQ 2JA6G 3M9BA 4FO2A 4J8QA 2F0JA 1I94Q 4JI1L 2NVXB 3TREA 2RCFA 1CT1D 2KHSA 2EJGC 3BZCA 4RHRA 3S1NB 2VB2X 1YNJD 4PMCA 4BBSB 2QDLA 3ITPA 4A3FH 3KF6A 1SN8A 1XNQL 1GVPA 1JWSD 3D4WA 4FYDA 4LFCQ 4C1NK 2YTVA 2Y0SB 1HNZQ 1Z9FA 1ONLA 3CC4A 1LTGD 1QG7A 1STYA 1FR3A 5I9OA 1ZYRC 4HJAA 4MTNA 4MIUA 4Q0FA 4OO1I 4R8NA 2ENBA 1J9OA 4GLVB 1WOCA 4DU9A 1Q7YC 1K3BC 1EY0A 1LACA 3P7JA 3NTKA 3NHHA 2WB1G 4DR7Q 1EEFD 3A74A 3R2TA 3UDIA 4NXMQ 3RR5A 2A19A 4LUZA 4AH6A 2KHJA 3EQLC 2J7ZA 4OHJA 1MD2D 1PTOC 2L55A 3TP5A 1G2TA 1TY0A 1SMYC 5ELCA 3S17B 4KD4A 4GOPA 5C6AA 4JI8L 4OL7A 3VA5A 5C5MA 2ZM6Q 2UXBQ 2R7ZG 4MTKA 1VQKA 4HSPA 1VF7A 2LSSA 3EN2A 2Z0SA 3WDNA 3HOZH 5A2QL 4HEDA 4PMWA 1K83H 3KLWA 1YNXA 4FP5D 1F2LA 1FNWA 3AQQA 2B3GA 1A3VA 1VQ5A 1X55A 4JI0Q 4N8X1 1OXTA 1A3UA 4WFN3 3KFUA 3GTMH 4IN3A 3DMUA 3E5SA 2B63B 2KCNA 2WAQG 3PUYA 3R93A 1QVFA 4S3SA 5IWAQ 2L15A 1DONA 5I4DA 3KJPA 3CQZB 5EKKA 3D4RA 4DAYB 3PO3B 2MP1A 1H9KA 4LW1A 3TS2A 3SE0A 4TVAB 2R93B 3H3VI 3QR8A 4RKLA 5LL6X 1OTCA 4A3BG 1M8AA 2KBNA 4DV2L 2OXPA 3DLLA 3CCUA 3NE5B 1YJWA 5EKIA 5IP7H 2ZXRA 2KUMA 3QO2A 1I6HB 3TZUA 2O2LD 2F4VL 4ULLA 1DYQA 5FO9B 3BJUA 1HR0W 3OTOQ 3N6RA 4UPAA 1PYSB 4B3SL 4YWKA 3WOFA 4A3EH 4B3RQ 1T5XD 4MZ9A 1G51A 3I90A 3KLSA 2JA5H 4JI7L 1V43A 2A74C 3VYRA 4G7HC 4CJ0B 5JJZA 4NB3A 2IHFA 3CD6A 2J0TD 2V1CC 1W6JA 3D31A 1TWCB 1D2BA 2BA1A 4LWCA 5G3LD 5CR3A 1JJCB 1VDZA 3J7ZC 1GD7A 3P75A 1D5XC 4CDEC 1SFOH 4N8FA 4IFDG 2PO4A 1SRUA 3RZDH 1D1KA 2F0IA 3HRZC 4JOIA 5IE8A 1MHWC 4A93H 5M3MH 1EFID 1U0LA 1B2TA 3S2DH 3T1HL 2VUMG 3C1FA 1V1QA 2IX1A 3PO2H 1HJPA 4A75A 4LJZC 1HNXL 1FD7D 2N55A 2L9HA 1VQ4A 2JA8G 1P16A 4EVOA 1RKNA 2DY8A 2K03A 4DKAC 2OCEA 1B4OA 2B29A 3TZDA 4P71A 1JICA 2BH8A 3AB9A 4GKKL 3C1EA 5ELEA 2PZTA 3X3MA 2IW3A 1BCPF 3HOWH 3S1NH 4X3KA 3BU2A 5JVH3 4IUVA 5IOCA 3I7FA 1YNND 3AFQA 1JOKA 4DV3L 3U4ZA 2BDNA 2JA6B 2K04A 5EPLA 2EY1A 1IW7C 1W6KA 5C4HA 1HFNA 2E2JB 1Y1WH 3W3AA 2UU9L 2YV5A 1K28A 4DR6L 1AE3A 1I50B 3QIAA 2A69D 1WVLA 4RHSA 3L2PA 1AEXA 2XRSD 1FYCA 2K5NA 4KHVA 1PA6A 2KVMA 1HRJA 4C3IG 3MEFA 2BE5C 1OXUA 5HURA 1PTOB 3PUZA 4PZ8A 3M3YB 4JI4Q 2H4OA 3STBD 4BY7G 1Y1VB 3Q24A 3UDFA 4DNRB 1EOVA 1PH1A 3T56B 2F0LA 5IYDG 2UXCQ 3GQBA 1SYBA 1A62A 1IHZA 1Q46A 4Y7NB 3GTPB 5FO8B 3RZOB 4B9XA 4OX9Q 2AQ2B 3L9AX 4CDDC 1XNRL 5IT9c 1YHAA 4HR7B 1VQOA 3MAQA 1C48A 3CC2A 2WV6D 1M90C 1ZEQX 2JJQA 3NSWA 2NVQB 4X64Q 3SK5A 2VXWA 2B8GA 4G4KA 2WB1B 3MWYW 1JQYD 4DNIA 4IALA 5C5LA 3A7AB 1X3PA 5M3FH 4K0KQ 1ZXTA 4DV4Q 2JQOA 4FF1A 3H0GB 2IT1A 4A3DG 3G71A 1CQFA 2A73B 5LMNL 2NVYB 2R7ZB 4JYAQ 2JSOA 3E9HA 3TBIB 4QIWB 2DJFC 3JAML 1KABA 1XX8A 4R9WA 3PMFA 3GTGB 3BVZA 3PO3H 4X3SA 2QEJC 1YHBA 1SNPA 1XMQL 4F7XA 3OW2A 3K59A 4R4OA 1ASYA 1WD1A 2R93H 1QILA 4OWTB 4MHEA 2UXDL 3M4OH 1EY5A 1R4PB 1GM5A 2CW0C 3T4AC 3T53B 3BDLA 4KI0A 3M7NA 3I73A 1C0AA 3KK7A 4KHZA 2QKIC 2FXQA 4GKJL 3T51B 5C0XG 2ZJRA 4BXXG 4BA1I 3OYYA 3A8JE 1NUCA 2PI2A 1PFMA 1VMPA 2D62A 2OTLA 4HTHA 1RTNA 4B9WA 4A3BB 3GTKB 1JJGA 1X6OA 5FLXc 3D0FA 1FNUA 2EY6A 3K5MA 1HTPA 1STBA 2QF7A 2KOLA 5IT9E 3SDZA 4YY3L 3W5OA 2SNSA 1BBXC 2HHHL 2HQLA 4A3JB 1X32A 4F87A 4R4IA 3MXNB 3CAMA 1I4GA 5BR8L 3KOJA 2R92B 3GD7A 4IPCA 1CK1A 3M4QA 1BBWA 3MXUA 4KMUC 3HEJA 1EY7A 1DCZA 5D3IB 4A3KG 2F0PA 5GROA 4DAYA 2R3ZA 4K5XA 5IYBH 5KNDA 4DV0Q 3TEHB 2VW9A 4A3MH 1CSPA 3RUZA 5CV5A 1Y8NB 5T1GA 4DR1L 5BN5A 4BY1H 2F0QA 1LM0A 2C9OA 4BBRG 1E22A 5LMUQ 3K5OA 1HA5A 2A6HD 3S2HB 3AEVA 1XPUA 3S15H 4K2LA 3QG1A 1S72A 4OGQC 5EKLA 3LWUA 2JA8B 2KECA 1D5MC 4GLAC 2Z6KA 4FVMA 5CV8A 1G6ZA 5COYA 2JA6H 3I56A 3P1HA 3NQTA 3NEMA 3TN2A 2E2JH 3RMHA 2G5DA 4C3JG 4AIMA 1GUTA 3EFXD 3T1YL 2K7VA 2L5TA 1BVSA 2ZTCA 2AHOB 1BF4A 4HIDA 1NBWA 1BUVT 2F0UA 3JAMi 4JI5Q 1N34Q 2F4IA 3IFDA 1EIGA 5FLXE 2QA4A 4DR4L 3KBGA 4K14A 1BQQT 5IGEA 4DUYL 1VCIA 3CRKC 4KTAA 4Q5VA 2WACA 4UP8A 2CQAA 4JV5Q 4ME3A 3IRBA 4ZKBB 1STGA 1CUKA 4C3IB 4Y7NH 3GTPH 1EOTA 3RZOH 4NXNL 1SE3A 1Q3LA 3M4PA 3K5LA 3D6CA 1PFBA 3HOZB 2I0QA 2NVQH 1J8IA 4TQUS 4JI6Q 1CHPD 3TSSA 3CCLA 1K83B 5KIXA 2PNHA 3VYSA 2VQFL 4IPDA 1RHPA 5DAUA 2RKSA 4ZK9B 4ZKCB 4DV6Q 4LF8Q 2O5JC 4LF7L 4A3LG 1JC7A 4JBKA 2K05A 2B8FA 4RCOA 3UE0A 1TXYA 2JEBI 1S5BD 1PHJA 2I46A 3GTMB 4LF5Q 4GNXC 4ZAIA 4JBWA 1I4HA 5AJ3Q 1G8ZD 5CORA 4KD3A 1SXTA 4IUNA 3HOVG 2R7ZH 1KC8C 2EYLA 3Q6SA 1SMXA 1VQAA 1B3AA 4C3HG 4DV1L 3U58A 1V8QA 2F0GA 1C7YA 4JI2L 3I4MG 1U4PA 2E5LL 1XYIA 1D6EC 2Q2IA 2N88A 3O13A 1A63A 3S16B 2EYHA 2WAQE 3A56A 4DV7L 2CFMA 4A3DB 3VR6A 4HCSA 1VQGA 5CGKA 3GTGH 4FXDA 1PFSA 3OMCA 1PRTC 3H6MA 1KRSA 4G57A 1QUQB 1EY8A 1Y8PB 2F0OA 2LS01 1X3FA 4P72A 3MFYA 2CVRA 5C3EG 4B08A 5KYIA 4AQYQ 1OXXK 3GTLB 4A3EB 2K5HA 2AQ1B 3CF5A 4BS9A 4LUVA 2PQAB 2PMZB 2EZVA 1OO9B 1PTOD 1IBML 1K3RA 1SMYD 2QCPX 1EEID 2L0CA 1H9MA 2E74C 1F77A 4A3BH 1SE8A 3FKIG 2F1MA 2LXKA 5E1FA 2E75C 3VR2A 4ZLTF 5M5YB 3K58A 1SFOB 2C5CA 1V1PB 2DUDA 3E6ZX 1Q8IA 5KEEA 1WTOA 1NAPA 1S3OA 2CH4A 1GKHA 2D5DA 4C56C 2L1BA 4RH6A 4DK1A 3J80c 2EYJA 1NNXA 1E2ZA 3ONAB 5IGFA 2KHIA 1SNMA 2I5HA 2SNMA 4DNTB 2GA4B 4MNOA 2JK8A 3PO2B 2EYOA 2VQEQ 5I9PA 2XGTA 1O7LA 2K1BA 1BBUA 5JJLA 3NUCA 2PYKA 4DR3Q 2DGYA 2UUBL 5CBAE 1KXLA 4R1JA 4EQPA 2VY3A 4A3GG 5J39A 5JOBA 5CYUA 4IFDH 3OWEB 2LFNA 1STEA 4YWMA 2OT2A 3E0JA 3HOWB 3MTSA 4PZ7A 3CPWA 5DM63 4A76A 4O42A 2F3VA 3FDTA 3S2HH 1G91A 2VUMH 3TS0A 3FP9A 4A3KB 4QJFA 5FJ8G 1S5ED 1Y1WB 2D0OA 3KYHC 3F8TA 4L5TA 2JA8H 1EUJA 5DM73 3NBHB 1QNKA 4L63B 1DJRD 3U9SA 1MJEA 4BBRB 1CA6A 4DAVA 1HZCA 3L0OA 4WJ4A 2TMPA 2H5XA 3I8ZA 1O7YA 4DUZQ 1SBBB 5D14A 5JAVA 4KHPL 3PUWA 3GP7A 3OHXC 4X3TA 1VQCA 1SYGA 4PQXA 5IYCG 4FDBA 1X54A 4X62Q 2FMCA 1XTCD 4XTCS 3MXNA 4JK1C 1QWYA 1WTQA 1L0YB 5HGQA 1ENFA 1TS3A 3MEHA 3QOLA 3Q22A 1QVCA 2M9VA 1STAA 3E0EA 3SK4A 4C3JB 2Q2UA 5EQ0A 4DV5L 3MC0B 1F2YA 5T1IA 3RLNA 1SNDA 5IGCA 1N32Q 2K4KA 4UP9A 5FO7B 1SYFA 4C3IH 1AZPA 2CWPA 3J80E 3F2UA 1ML0D 2KENA 1EYGA 1Y14B 3UDXA 3ULPA 3OIPA 4GNXB 2ZJQA 5M3FB 4BY7H 2XVSA 1X9NA 5IYDH 1XMOQ 2F0SA 1SLJA 1U4MA 3I4NG 2RSOA 4ODGA 4IQZA 4EX5A 3CXCA 1QOHA 3VYUA 5C4XG 2QILA 2KCCA 1SYEA 3ZYYX 2VB3X 4IUQA 3T16A 3F2DA 1BXTA 1JOOA 3EIVA 2RBMA 3GV6A 2Z9HA 4QMGA 2PCFB 3CCRA 2V4DA 2PNRC 1TQOA 1Z6HA 4R4QA 2MPMA 1PRTB 2EJFC 1IW7D 1YJNA 5CV7A 2YU9H 2AUJD 5DLQE 5LL6S 3CCMA 4HJ5A 5IODA 2KCMA 3PV0A 4H13C 1ICWA 3OMGA 4X66L 3S16H 4X65Q 4LF9L 1N8RC 4A3DH 1UAPA 2F0WA 3M4OB 2BE5D 1LYLA 1XXGA 1PZID 4YWLA 1VQNA 2NN6G 2PMZE 1UE6A 1ASZA 1EZ6A 4C1NI 1CM9A 4Z9CB 4CJ2C 3QJYA 4AYBE 1R4QB 4NKLA 2EVBA 2MGSA 3GTLH 3I70A 1CKNA 1YIJA 2HQEA 2R7FA 3NELA 5NUCA 2X6LA 4KY6A 4IFDJ 1J5EL 4M8AA 1M1KC 5ELDA 1KNEA 4YHHL 3G48A 3MXGA 3DM3A 3UE1A 1K8AC 5DNFA 5ELOA 4JI1Q 3NENA 4DAMA 5M5YH 3J81j 4R4CA 4LFAL 5C0XH 4BXXH 4OWWB 4JC0A 1QNUA 3IKJA 1SE2A 4KY7A 2XTIA 1VQ9A 3T13A 1SNQA 2F03A 3J7AF 4A3IG 4IUPA 2O5IC 1FJGL 1XNQQ 3FKIB 1OXSC 2HIXA 1LLRD 4HIMA 1U4RA 2B2VC 4B3ML 3V96A 1SNOA 3ZJYC 4GN3B 4A3MB 2E8GA 1BO0A 1KL9A 1NY4A 3S1RB 1PVOA 2E2DC 1KLGD 3K8AA 4QY7A 5C4ZA 4BY1B 4YIJA 2E2IH 3D8GA 2I5LX 1ENCA 1IBKL 1GO3E 3S15B 2RF4A 1I3QH 1QUQA 2DY7A 1VQBA 2KA7A 3EBEA 1I4PA 5KNCA 1K8MA 4RGMA 5IT9L 1JR0D 4A3KH 4V0BA 2PQAA 2XN9C 4A3GB 4P75A 4YCVA 1MKHA 4LNQA 2CW0D 3I3CA 2B2TC 3TP8A 3MFGA 3DUZA 4JI8Q 2RSNA 2JA7G 2WFWA 4M1UB 2EY2A 4BBRH 3CCVA 1WTRA 4K5WA 2D9UA 2D2CC 2NTTA 1A0IA 4K8IA 1GOZA 1V1PA 2F0DA 2HT1A 3ND8A 3BG3A 2O4XA 2F0FA 3HOYG 3KLRA 1LO5D 1EU4A 1WJJA 1TWFH 1SAPA 5IP9G 3EA6A 1AE2A 2ZXOA 3G7LA 2F3IA 3PF4A 5JEAG 4QF4A 3S1QB 3A5UA 3MZ5A 4C3JH 4Y52H 1PDQA 1I6VC 2NZHA 4JCVE 1HHVA 4OEMB 2RQXA 2NVTH 4FF4A 3CPFA 4NW2A 1IXRA 3FRPB 4X6AH 1NCVA 1CKMA 4YCUA 4KY5A 3GTQB 1E3PA 1TU2B 1SROA 2MUYA 5EBCA 1S5DD 4KKUA 2OTJA 5M5WB 1D1IA 5I6YA 2UUCL 2HUGA 1AH9A 4DV2Q 2K5DA 4IJLA 3C2PA 4DR2L 5HY6A 3NBHA 4ILWA 2C35B 1Q81C 5FLXL 3J7A5 5TSSA 1SJED 5M9OA 4B3SQ 3H94A 3I4LA 2JYOA 1HNWL 4RGNA 3V2TA 4A3LH 4HCEA 1N33L 3FEWX 3CKIB 2ZJPA 2PZWA 3LX0A 2QGQA 5C0XJ 3K0XA 4LF6L 2RHQB 1FVIA 3J81c 1CA5A 2RA4A 4AYBG 3LNNA 5FKAC 2ALYB 1E7ZA 2B2UC 3VA7A 1B9NA 2WAQB 3ND9A 3R3OA 4QL5A 3HOVH 1IBLL 1VQJA 1HZBA 3TDQA 4C3HH 2EE1A 1EWCA 1PLFA 3E9IA 3I4MH 1HUNA 2UUAL 2RDHA 2VL6A 2ATWA 1GUWA 2VS1A 4RG1A 4ABNA 2WKDA 1C9OA 5EJWA 1EY6A 3Q23A 2K52A 3T1HQ 2G9HD 1B1ZA 1ET6A 1UEAB 2SDFA 2Q8IB 1B9MA 4GNXA 2Q8RE 1ESFA 4O0AA 1LABA 1HNXQ 5I2YA 3AMUA 2CKZB 4QUCA 3KJOA 4LMQD 1Q12A 1K8GA 2ZXPA 4GZYC 1VQ8A 1BKBA 1EL0A 3HG9A 3CP0A 2EYPA 1T9HA
chains in the Genus database with same CATH topology
1R9TB 4DGZA 1JWMD 3ERQA 3I72A 3BS1A 3S1MB 2JXMB 3OOCA 5HGTA 5KYLA 1PTOF 4CKEA 2TSSA 1PMRA 3S9WA 1TT2A 1WTXA 3K6OA 4ZQ3A 1EU3A 2F0VA 4DXGA 2BDOA 3QB3A 2VUMB 1HTLD 4LK1C 3H91A 1PRTD 1F2ZA 4I7ZC 2XWBB 3J81E 4XQQA 3IFTA 2F0EA 4OIJA 1QJOA 3TP6A 4CBVA 4K2KA 4EGVA 2VNUD 1LTTD 2RDFA 4HMJA 2YYZA 4HMIA 3VR3A 3SEBA 3FVQA 3LWEA 5LHY1 1G291 5E4WC 3IL8A 3CHBD 1UUPA 1A15A 3M4YA 1IKMA 4IUTA 3U9OA 4H7BA 2IPKD 3DEPA 3DHQA 4F88A 2FFKB 3HOYB 1ET9A 5EPKA 4BY7B 2JE6I 4NDXA 5CV6A 4RFBA 2EJMA 1K8OA 2JEAI 3UI2A 1A2UA 1BCPC 5J1ZA 1WTWA 2DN8A 2RDGA 2QDBA 2EXZA 3NPPA 3MXPA 5ELBA 2YU9B 3VR5A 1JB3A 2K01A 1U4LA 3BYYB 1LTBD 3A7LA 1KDBA 5CC4A 3L7ZC 4XT1B 2L11A 2PW7A 1A2TA 3WOEA 3J80L 5K36G 4K8JA 4XIGS 4L6TB 5E3FA 2EOTA 4KV6A 1CFMA 1RDPD 4IUUA 2NWGA 3TP7A 1O7ZA 1AZQA 5KNBA 4AYBB 3NWSA 1A3TA 2AWNA 1FNVA 2LKVA 1E2VA 1F9QA 4LAAA 1JORA 1FGBD 2BCOA 4HN7A 4DN4M 3CRLC 2B2YC 2NN6H 3NTIA 1X3QA 1S5FD 1O80A 4P2CB 2NUCA 2AQ3B 1EYDA 3DM1A 1MSHA 1OXVA 2FINB 5FOBB 3D6WA 3K57A 2ICIA 3I91A 4RAUC 5F2DA 2KEDA 3QOJA 2FMMA 3NP8A 1STHA 2Q8TA 3P20A 2E2IB 1MI2A 2A6EC 3J7YW 1SEBD 2WKCA 1I3QB 2KJXA 1H9SB 2F0KA 5G3LF 5EBDA 3D4DA 5CBEE 4NP5A 1DOKA 1BR9A 1E2WA 4K5VA 1ZKOA 2A68C 5FK9C 4ME5A 4XXEA 1SJHD 3QWNA 3FPPA 1G2SA 1KAAA 4K6LA 2EYMA 3M85A 4PV1C 4CJ1B 4IURA 4DAPA 5IGGA 1D5ZC 1CQVA 2IX0A 3A8KE 4L8JA 5IGBA 1HCZA 1TWFB 2B2VA 1VMCA 5D65A 3BYTB 1DXMA 1SYCA 1KDAA 3URYA 1HA6A 1RCVD 4OO1G 4BWGB 1EWHA 3GV3A 2MHVA 4FXGC 2NVTB 1PFNA 1B53A 4RA8A 4FF3A 3FPUB 2B2WC 1LTAD 2HDLA 2ID0A 1BCPB 5CV4A 3HZXA 4XDXA 5JEAH 2B2TA 1L0XB 1MSGA 1LT6D 4QUFA 1GXDC 3H09A 4KKTA 2NB0A 2EYFA 2NYZD 5C44B 4XYOA 3DXJC 1Z7TA 1GUGA 2B39A 1LTID 1F9SA 4OIKA 4ZUJA 1KNAA 3GTJB 4CKBA 3N52A 1BNZA 1AFPA 2X69A 2WINB 4HAEA 1ILPA 4DF7A 2NN6I 3HOVB 2FJ2A 4KKSA 3TMEA 1EY9A 2IL8A 3HOXB 4PNYA 4C3HB 5IIFA 3NXWA 3I4MB 1YNJC 1UNSA 3KF8A 3MVVA 3KBXA 4F8MA 1Z47A 1B44D 3SK6A 5C3EB 4IFDI 1WCMB 1LT4D 1TVXA 4NMZA 3DWQA 1U9RA 1Q1BA 2Z1CA 2XNAC 3OW7A 4I65A 1KLUD 3OIQA 1Y69U 4XT3B 2B2UA 3EJIA 2IWHA 3V05A 1RD9D 2XSCA 1TR5A 5KGUA 1CI3M 3H3VC 1M4VA 1A6XA 5BN4A 2XIWA 1ENAA 2KEEA 1JE4A 4G7ZC 1EQVA 1SYDA 1DOLA 2M00A 1GHKA 2PZUA 3SXHA 4DK0A 1VF5C 5ISRA 2A5HA 5J22A 1MGSA 1RF2D 1ILQA 1KDCA 1JCKB 4WRDA 1F9PA 4TRDA 2K6AA 4EQOA 3VR4A 1SE4A 3GTOB 3S14B 5C3XA 1RODA 5JEAJ 2IJ0A 5DEHA 4ZUIA 5A2QE 4WORA 1EY4A 1QE6A 2L4NA 1JWUD 4J1MA 4ID6A 4O1NA 1DD2A 1TKWB 1C8CA 3EVQA 2G9DA 4WJWA 1PRTF 1TWGB 2BA0A 4U673 2PQEA 3VYTA 3KLSX 3KUPA 1H9SA 3J81L 1TIID 5AFWA 2OF1A 4N9TA 4QB4A 4XYQA 2Z4HA 4V190 1SSOA 4DA2A 2NZ1D 4XQJA 3CU7A 5K5PA 2XRQD 1I4XA 1TS2A 2NTSA 4EQNA 4QCLA 1Y8OB 3RD4A 3A55A 3NQIA 5I2XA 4KN4C 1IKLA 1Q90A 5C4JB 1BOSA 1DOMA 5JVG3 1TS4A 4UAIA 4PMBA 3MA2B 3I4NB 1TS5A 3DEOA 4H0LC 5CMDA 5C4XB 1O78A 3BDOA 1LTSD 5KRUA 3K7AB 4CKCA 1ESRA 3BZDB 4KN7C 4DFAA 4BA2I 5C0XI 3A54A 4E6IA 1LV9A 2K32A 1GUNA 1TWHB 1QB5D 4CHTB 1GHJA 4KJOA 1YNNC 1DM0B 3HOUB 3NBIA 1JOQA 4UDUC 3OPOA 3R2IA 1HQRD 1CTMA 2JP1A 2Z4IA 1NR4A 4FF2A 5K36H 2LMCB 1PYWD 2A69C 1LT5D 2H1EA 3DWAA 1EYCA 4RWSC 3HKZB 1TWAB 1TY2A 2RVLA 3J7AV 2F0TA 5EPJA 1Q1EA 2L12A 1SDFA 3D3RA 2DNCA 3W2DA 1PZKD 1WTVA 2K33A 1BCPD 4FXKC 4N9PA 3EROA 3G6JB 4CGYB 3PUVA 1MBYA 1RTOA 2WP8J 3OWFA 4A3IB 1HUMA 3HGBA 4XQNA 4ZYSA 1EZ8A 3HS0C 1HPCA 5JPNC 2Z8LA 1S4ZA 2ICEC 2B2YA 1HQMC 1IYVA 4H44C 2KQ3A 1I4RA 4RGTA 2M2LA 3NTHA 5CV9A 4RGOS 5D3DA 4A3FB 5E4XA 2AWOA 4KJNA 1LTRD 5BN3A 1WTPA 4KK7A 4HSVA 1IL8A 2MJ8A 1H9JA 5M5XB 4RKBA 3PIP3 3K5NA 2EDGA 1BDOA 4K6DA 3NK9A 1EIHA 2LY7A 2JA7B 2NBFA 1QCBD 5EGTA 2J4XA 4G7OC 5I6WA 1PTOH 2R61A 2F3WA 3JAME 3BVMA 3A8IE 2F0MA 2F0HA 4X3UA 2A6ED 3SK8A 1SNCA 3C3LA 2HDMA 1HFGA 5ELFA 5A35A 2HCIA 4C2MB 4OO1H 2IX3A 1GUOA 3AU7A 2I07B 3SR1A 3C46A 2EY5A 3K0YA 3SHLA 4FNFA 3MHBA 2A68D 1STNA 2DNEA 5JPMC 2X6GA 3SVMA 1RJTA 2K5WA 1GUSA 1NSNS 2AUKA 4U68A 1AP0A 4DXFA 1F9RA 1AW7A 2PW5A 1S5CD 3L3OC 2OEOA 2BOSA 2B2WA 2A6HC 1GJXA 4RCNA 5IGDA 3IAYA 1ZYRD 2EPBA 1B50A 3R8BA 3HP3A 3PUXA 1V1OA 3FMCA 2SEBD 4TKOB 3M7GA 2K28A 2WIIB 1T5EA 2SOBA 1KTKA 1PXUA 3GO5A 3PIO3 2E2HB 3NWTA 1LT3D 3BDCA 3BVGA 2PPBC 2JA5B 1DZ1A 4MN3A 4R8IA 1XWEA 1IYUA 3X3NA 3RLFA 4IZ8A 1C4QA 1E0BA 1CZGA 1AN8A 3OSOA 1WD0A 2CHBD 4ZRZA 1CHQD 2K5QA 3Q0AA 3RZDB 1CZWA 1EYAA 2R6GA 5C3WA 1H9RA 2ZT9C 4A93B 5M3MB 2F0NA 1II3A 3S2DB 2HCCA 1PZJD 2FHTA 1F2MA 1HXYD 2XWJB 1EQTA 2E76C 1I4QA 4TSSA 4J6HA 3DWPA 1NR2A 4FO2A 4J8QA 2F0JA 2NVXB 1CT1D 2KHSA 2EJGC 4RHRA 3S1NB 2VB2X 1YNJD 4PMCA 4BBSB 3ITPA 1JWSD 3D4WA 4FYDA 4C1NK 2Y0SB 1ONLA 1LTGD 1QG7A 1STYA 1FR3A 5I9OA 1ZYRC 4MIUA 4Q0FA 4OO1I 4R8NA 2ENBA 1J9OA 4DU9A 1EY0A 1LACA 3P7JA 3NTKA 3NHHA 1EEFD 3R2TA 3EQLC 2J7ZA 4OHJA 1MD2D 1PTOC 2L55A 3TP5A 1G2TA 1TY0A 1SMYC 5ELCA 3S17B 4KD4A 5C6AA 4OL7A 3VA5A 5C5MA 4HSPA 1VF7A 3WDNA 5A2QL 4HEDA 4PMWA 4FP5D 1F2LA 1FNWA 1A3VA 1OXTA 1A3UA 4WFN3 4IN3A 3DMUA 3E5SA 2B63B 2KCNA 3PUYA 3R93A 4S3SA 1DONA 5I4DA 3CQZB 5EKKA 3D4RA 3PO3B 2MP1A 1H9KA 3SE0A 2R93B 4RKLA 5LL6X 1M8AA 2OXPA 3NE5B 5EKIA 2ZXRA 2KUMA 3QO2A 1I6HB 3TZUA 2O2LD 4ULLA 1DYQA 5FO9B 3N6RA 3WOFA 1T5XD 3I90A 3KLSA 1V43A 2A74C 3VYRA 4G7HC 4CJ0B 5JJZA 2J0TD 3D31A 1W6JA 1D2BA 1TWCB 2BA1A 5G3LD 5CR3A 1VDZA 3P75A 1D5XC 4IFDG 2PO4A 1D1KA 2F0IA 3HRZC 1B2TA 1EFID 3C1FA 2IX1A 4LJZC 1FD7D 2N55A 2L9HA 4EVOA 1RKNA 2DY8A 2K03A 1B4OA 3TZDA 1JICA 3AB9A 3C1EA 5ELEA 2PZTA 3X3MA 2IW3A 1BCPF 4X3KA 5JVH3 4IUVA 5IOCA 1YNND 1JOKA 2BDNA 2JA6B 2K04A 5EPLA 2EY1A 1IW7C 1W6KA 5C4HA 1HFNA 2E2JB 3W3AA 1I50B 3QIAA 2A69D 1WVLA 4RHSA 1AEXA 2XRSD 1FYCA 4KHVA 2KVMA 1HRJA 4C3IG 2BE5C 1OXUA 5HURA 1PTOB 3PUZA 3M3YB 2H4OA 1Y1VB 3Q24A 4DNRB 3T56B 2F0LA 3GQBA 1SYBA 1IHZA 4Y7NB 3GTPB 5FO8B 3RZOB 4B9XA 2AQ2B 3L9AX 4HR7B 3MAQA 1C48A 2WV6D 1ZEQX 3NSWA 2NVQB 3SK5A 2VXWA 2B8GA 4G4KA 2WB1B 3MWYW 1JQYD 4IALA 5C5LA 3A7AB 1X3PA 1ZXTA 4FF1A 3H0GB 2IT1A 1CQFA 2A73B 2NVYB 2R7ZB 2JSOA 3TBIB 4QIWB 3JAML 1KABA 1XX8A 4R9WA 3PMFA 3GTGB 3BVZA 4X3SA 2QEJC 1SNPA 4F7XA 3K59A 1WD1A 1QILA 4MHEA 1EY5A 1R4PB 2CW0C 3T53B 3T4AC 3BDLA 4KI0A 3M7NA 3I73A 3KK7A 4KHZA 2QKIC 3T51B 5C0XG 4BA1I 3A8JE 1NUCA 1PFMA 1VMPA 2D62A 4HTHA 1RTNA 4B9WA 4A3BB 3GTKB 1FNUA 2EY6A 3K5MA 1HTPA 1STBA 2QF7A 2KOLA 5IT9E 3SDZA 1BBXC 2SNSA 4A3JB 1X32A 4F87A 1I4GA 2R92B 3GD7A 1CK1A 3MXUA 4KMUC 5D3IB 1EY7A 1DCZA 3HEJA 2F0PA 4DAYA 2R3ZA 4K5XA 5KNDA 3RUZA 5CV5A 1Y8NB 5T1GA 5BN5A 2F0QA 2C9OA 3K5OA 1HA5A 2A6HD 3S2HB 4K2LA 3QG1A 4OGQC 5EKLA 3LWUA 2JA8B 2KECA 1D5MC 4FVMA 5CV8A 1G6ZA 5COYA 3P1HA 3NQTA 3TN2A 3RMHA 4C3JG 1GUTA 3EFXD 2K7VA 2L5TA 1BF4A 1BUVT 2F0UA 2F4IA 3IFDA 1EIGA 5FLXE 3KBGA 4K14A 1BQQT 5IGEA 1VCIA 3CRKC 4KTAA 4Q5VA 2WACA 2CQAA 4ZKBB 1STGA 4C3IB 1EOTA 1SE3A 1Q3LA 3K5LA 3D6CA 1PFBA 3HOZB 1J8IA 4TQUS 1CHPD 3TSSA 1K83B 5KIXA 3VYSA 1RHPA 5DAUA 2RKSA 4ZK9B 4ZKCB 2O5JC 1JC7A 2K05A 2B8FA 4RCOA 2JEBI 1S5BD 2I46A 3GTMB 4ZAIA 4JBWA 1I4HA 1G8ZD 5CORA 4KD3A 1SXTA 4IUNA 2EYLA 3Q6SA 1B3AA 4C3HG 1V8QA 2F0GA 1U4PA 1XYIA 1D6EC 2N88A 3O13A 3S16B 2EYHA 3A56A 4A3DB 3VR6A 4HCSA 5CGKA 4FXDA 3OMCA 1PRTC 3H6MA 4G57A 1EY8A 1Y8PB 2F0OA 2LS01 3MFYA 2CVRA 4B08A 5KYIA 1OXXK 3GTLB 4A3EB 2AQ1B 4BS9A 2EZVA 2PMZB 1OO9B 1PTOD 1SMYD 2QCPX 1EEID 2L0CA 1H9MA 2E74C 1F77A 2F1MA 5E1FA 2E75C 3VR2A 4ZLTF 5M5YB 3K58A 1SFOB 2C5CA 1V1PB 3E6ZX 1Q8IA 5KEEA 1WTOA 1NAPA 2D5DA 4C56C 2L1BA 4RH6A 4DK1A 2EYJA 3ONAB 1E2ZA 5IGFA 1SNMA 2SNMA 4DNTB 2GA4B 3PO2B 2EYOA 5I9PA 1O7LA 2K1BA 3NUCA 2PYKA 5CBAE 4EQPA 5J39A 5JOBA 5CYUA 4IFDH 3OWEB 2LFNA 1STEA 2OT2A 3E0JA 3HOWB 3MTSA 5DM63 4O42A 2F3VA 3FDTA 1G91A 4A3KB 1S5ED 1Y1WB 5DM73 1QNKA 4L63B 1DJRD 3U9SA 4BBRB 1CA6A 4DAVA 2TMPA 3I8ZA 1O7YA 1SBBB 5D14A 5JAVA 3PUWA 3GP7A 3OHXC 4X3TA 1SYGA 4PQXA 2FMCA 1XTCD 4XTCS 3MXNA 4JK1C 1QWYA 1WTQA 1L0YB 3Q22A 1ENFA 1TS3A 3MEHA 3QOLA 2M9VA 1STAA 3SK4A 4C3JB 5EQ0A 3MC0B 1F2YA 5T1IA 1SNDA 5IGCA 5FO7B 1SYFA 1AZPA 3J80E 3F2UA 1ML0D 3OIPA 5M3FB 2XVSA 2F0SA 1U4MA 2RSOA 4ODGA 4IQZA 1QOHA 3VYUA 2QILA 2KCCA 1SYEA 3ZYYX 2VB3X 4IUQA 3T16A 1BXTA 1JOOA 2RBMA 3GV6A 4QMGA 2PCFB 2V4DA 2PNRC 1TQOA 1Z6HA 2MPMA 1PRTB 2EJFC 1IW7D 5CV7A 2AUJD 5LL6S 5IODA 3PV0A 4H13C 1ICWA 3OMGA 1UAPA 2F0WA 3M4OB 2BE5D 1XXGA 1PZID 2NN6G 1EZ6A 4C1NI 1CM9A 4Z9CB 4CJ2C 3QJYA 1R4QB 4NKLA 2EVBA 2MGSA 3I70A 2HQEA 5NUCA 2X6LA 4KY6A 4IFDJ 4M8AA 5ELDA 1KNEA 3MXGA 5DNFA 5C0XH 1QNUA 3IKJA 1SE2A 4KY7A 3T13A 1SNQA 2F03A 3J7AF 4IUPA 2O5IC 3FKIB 1OXSC 1LLRD 1U4RA 2B2VC 3V96A 1SNOA 4A3MB 1BO0A 3S1RB 2E2DC 1KLGD 5C4ZA 4BY1B 4YIJA 3D8GA 1ENCA 3S15B 2DY7A 2KA7A 1I4PA 5KNCA 1K8MA 4RGMA 5IT9L 1JR0D 4V0BA 2XN9C 4A3GB 2CW0D 3I3CA 2B2TC 3TP8A 3MFGA 3DUZA 2RSNA 4M1UB 2EY2A 1WTRA 4K5WA 2D9UA 2D2CC 2NTTA 4K8IA 1GOZA 1V1PA 2F0DA 3ND8A 3BG3A 2O4XA 2F0FA 3KLRA 1LO5D 1EU4A 1SAPA 3EA6A 2ZXOA 3G7LA 5JEAG 4QF4A 3S1QB 3MZ5A 1PDQA 1I6VC 1HHVA 2RQXA 4FF4A 4NW2A 3FRPB 1NCVA 4KY5A 3GTQB 1TU2B 2MUYA 5EBCA 1S5DD 4KKUA 5M5WB 1D1IA 5I6YA 2HUGA 2K5DA 3C2PA 3NBHA 4ILWA 5FLXL 5TSSA 1SJED 5M9OA 3H94A 3I4LA 2JYOA 4RGNA 3V2TA 4HCEA 3FEWX 3CKIB 2PZWA 3LX0A 5C0XJ 1CA5A 2RA4A 3LNNA 5FKAC 2B2UC 3VA7A 1B9NA 2WAQB 3ND9A 3R3OA 3TDQA 2EE1A 1EWCA 1PLFA 1HUNA 2RDHA 1GUWA 4ABNA 2WKDA 5EJWA 1EY6A 3Q23A 2G9HD 1B1ZA 1ET6A 1UEAB 2SDFA 2Q8IB 1B9MA 2Q8RE 1ESFA 1LABA 5I2YA 3AMUA 4QUCA 4LMQD 1Q12A 2ZXPA 4GZYC 1EL0A 3HG9A 2EYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7A B;  1V8Q A;  3EQL C;  3P20 A;  2EDG A;  1Y8N B;  2JE6 I;  1GUN A;  2K32 A;  5BN5 A;  4IFD G;  2A6E C;  1BDO A;  2EVB A;  2PPB C;  3U9S A;  5JEA G;  1SMY C;  1H9S B;  2IT1 A;  3I72 A;  3VR6 A;  3VR4 A;  2A6H D;  1GHJ A;  1YNN C;  2EJM A;  1K8O A;  1IYU A;  4G7O C;  3RLF A;  2JXM B;  2JEA I;  3OOC A;  3PUW A;  3QG1 A;  1I6V C;  2NN6 I;  4OGQ C;  3OPO A;  1VF7 A;  3LWU A;  1Y8P B;  1E2W A;  2DN8 A;  1CTM A;  4KKS A;  4LJZ C;  3WDN A;  5K36 H;  1ZKO A;  3MFY A;  2LMC B;  4XTC S;  4JK1 C;  1PMR A;  2A68 C;  2A69 C;  3VR5 A;  1OXX K;  3FPP A;  1DD2 A;  3A8I E;  5C0X H;  2R6G A;  1YNJ C;  3A7L A;  1TU2 B;  1H9R A;  3AB9 A;  1TKW B;  2ZT9 C;  3M85 A;  3IKJ A;  4KKU A;  1GUT A;  1Q1E A;  2A6E D;  4PV1 C;  3L7Z C;  2K7V A;  4DK0 A;  2L5T A;  1OXT A;  5A35 A;  2BDO A;  2E76 C;  2BA0 A;  2O5I C;  4OO1 H;  1H9M A;  2E74 C;  1GUO A;  1OXS C;  3A8K E;  4L8J A;  2DNC A;  2F1M A;  4LK1 C;  5K36 G;  2E75 C;  3VR2 A;  4XIG S;  1HCZ A;  3PUY A;  1IW7 C;  2CW0 C;  4I7Z C;  2K33 A;  3T53 B;  4KI0 A;  3M7N A;  3I73 A;  4KHZ A;  1H9S A;  1DXM A;  3T51 B;  5C0X G;  3IFT A;  3W3A A;  3A8J E;  4BA1 I;  1VCI A;  3H94 A;  3CRK C;  1QJO A;  2A68 D;  3I4L A;  2D5D A;  2A69 D;  3D4R A;  3QIA A;  1H9K A;  2EJG C;  2DNE A;  4DK1 A;  1CFM A;  1Q1B A;  3PUV A;  4IQZ A;  2D62 A;  1FYC A;  1E2Z A;  3SE0 A;  4OO1 G;  4DNT B;  5KNB A;  1GUS A;  2KCC A;  2BE5 C;  2KA7 A;  3OW7 A;  1OXU A;  2AUK A;  1EWH A;  5KNC A;  3LNN A;  1E2V A;  1HTP A;  3HGB A;  3NE5 B;  3PUZ A;  2YYZ A;  1K8M A;  1Y8O B;  3VA7 A;  1O7L A;  2QF7 A;  2PCF B;  1Y69 U;  1B9N A;  3ND9 A;  2V4D A;  2PNR C;  4TQU S;  3TZU A;  3CRL C;  1ONL A;  1HPC A;  3SDZ A;  4KN4 C;  2NN6 H;  1Q90 A;  1Z6H A;  4DNR B;  3T56 B;  1FR3 A;  1HQM C;  2O5J C;  3VR3 A;  2EJF C;  1IYV A;  1CI3 M;  1IW7 D;  3GQB A;  4H44 C;  3N6R A;  1A6X A;  2AUJ D;  1G29 1;  1ZYR C;  2A6H C;  2B8F A;  5BN4 A;  1GJX A;  2JEB I;  4IFD H;  4RCN A;  3PV0 A;  4H13 C;  4H0L C;  5JEA H;  3M4Y A;  4G7Z C;  1O78 A;  3BDO A;  4HR7 B;  1V43 A;  3PUX A;  2AWO A;  1OXV A;  4JBW A;  3GD7 A;  4G7H C;  1GHK A;  5BN3 A;  1LAC A;  4KKT A;  3FMC A;  1B9M A;  2Q8I B;  2D2C C;  2B8G A;  1LAB A;  4TKO B;  2BE5 D;  4KN7 C;  3D31 A;  3MXU A;  3ND8 A;  1VF5 C;  1DCZ A;  4KMU C;  2BA1 A;  3BG3 A;  1H9J A;  1Q12 A;  2NN6 G;  1Z7T A;  3DXJ C;  4BA2 I;  1GUG A;  1VDZ A;  4GZY C;  1T5E A;  3QJY A;  5KND A;  3KLR A; 
#chains in the Genus database with same CATH topology
 5C3E H;  1PH4 A;  1XPO A;  4JPB W;  1R9T B;  4GKK Q;  4DGZ A;  1JWM D;  3ERQ A;  1JT8 A;  1L2F A;  3I72 A;  3CMA A;  3BS1 A;  3S1M B;  2JXM B;  3OOC A;  4B3T L;  5HGT A;  1B7Y B;  4DV3 Q;  1VQF A;  5KYL A;  5GQO A;  3FKI H;  1PTO F;  4CKE A;  2TSS A;  2RHS B;  1PMR A;  3S9W A;  1X65 A;  2UU9 Q;  1TT2 A;  1WTX A;  4DR6 Q;  3K6O A;  3S1R H;  4ZQ3 A;  1EU3 A;  2F0V A;  2CWA A;  4DXG A;  1EFW A;  4BBS G;  2BDO A;  1YHQ A;  1YEZ A;  3QB3 A;  2VUM B;  2I5M X;  1VQP A;  1HTL D;  4LK1 C;  4IO9 A;  4LF4 L;  1HR0 L;  1EIY B;  3H91 A;  1PRT D;  1F2Z A;  4I7Z C;  4IPH A;  2XWB B;  1HZA A;  1N36 L;  3J81 E;  4XQQ A;  2JN4 A;  3RLO A;  1VQE A;  3IFT A;  2F0E A;  3PGZ A;  4OIJ A;  1X56 A;  1QJO A;  3TP6 A;  4H02 A;  4A3G H;  4CBV A;  4JBM A;  4K2K A;  5FLM G;  4EGV A;  2VNU D;  1XNR Q;  1LTT D;  2GVA A;  2RDF A;  1YVC A;  4HMJ A;  1E1O A;  4GLX A;  1VQD A;  3BZK A;  2YYZ A;  1NJI C;  4LFB L;  5FJ8 H;  4HMI A;  3VR3 A;  3SEB A;  1UE7 A;  3FVQ A;  3LWE A;  5LHY 1;  1I94 L;  1G29 1;  5E4W C;  3IL8 A;  1V9P A;  3CHB D;  1UUP A;  1A15 A;  3M4Y A;  4YCW A;  2A1A A;  2GN5 A;  5LMN Q;  1IKM A;  3S1Q H;  4IUT A;  3U9O A;  4H7B A;  2IPK D;  1TWG H;  3DEP A;  3DHQ A;  4F88 A;  2FFK B;  3KF8 B;  4JVZ A;  3HOY B;  4LFC L;  1NE3 A;  1Q8K A;  5C44 G;  1ET9 A;  5EPK A;  1HNZ L;  4BY7 B;  5IYC H;  3TQY A;  3RN2 A;  3E3X A;  5EAY A;  2BH2 A;  4O2D A;  2JE6 I;  4NDX A;  5CV6 A;  2LXJ A;  1X3G A;  4RFB A;  3GTQ H;  1XMQ Q;  2EJM A;  1K8O A;  1PH8 A;  5M5W H;  2JEA I;  3UI2 A;  2UXD Q;  1A2U A;  1BCP C;  5J1Z A;  2B63 G;  1WTW A;  2DN8 A;  2RDG A;  2QDB A;  4DR7 L;  4NXM L;  2EXZ A;  4GKJ Q;  3NPP A;  3HOX G;  3MXP A;  5ELB A;  2YU9 B;  3VR5 A;  1JB3 A;  2K01 A;  2ES2 A;  1U4L A;  2N3S A;  3BYY B;  1LTB D;  3A7L A;  3G4S A;  1KDB A;  5CC4 A;  3I4N H;  3L7Z C;  4XT1 B;  2L11 A;  2PW7 A;  4P74 A;  1A2T A;  5C4X H;  2UXB L;  3ERS X;  2ZM6 L;  3WOE A;  3J80 L;  3CCQ A;  1P8L A;  5K36 G;  1SR3 A;  4K8J A;  4XIG S;  3K7A H;  1CSQ A;  1VQ7 A;  3ULL A;  4YY3 Q;  2HHH Q;  1E1T A;  4DPG A;  4L6T B;  2KCT A;  1Q86 C;  5E3F A;  1WCM G;  4A3C G;  2EOT A;  4QQB X;  1TWH H;  4KV6 A;  4DK3 C;  1PH5 A;  1CFM A;  1RDP D;  4IUU A;  2NWG A;  3TP7 A;  1O7Z A;  5BR8 Q;  1AZQ A;  5KNB A;  4AYB B;  1KIX A;  3NWS A;  2HD3 A;  1A3T A;  2AWN A;  4JI0 L;  3HKZ E;  1FNV A;  4JI3 Q;  2LKV A;  1E2V A;  1F9Q A;  4LAA A;  1JOR A;  1FGB D;  2BCO A;  4HN7 A;  1VS0 A;  4DN4 M;  2IY5 B;  1KRT A;  3CRL C;  2B2Y C;  2NN6 H;  3NTI A;  5IWA L;  1X3Q A;  4DR1 Q;  4HIK A;  1S5F D;  1O80 A;  4P2C B;  2NUC A;  2AQ3 B;  1R9T H;  1EYD A;  3DM1 A;  1MSH A;  2YTY A;  1OXV A;  2FIN B;  5FOB B;  3D6W A;  3K57 A;  3PSI A;  2ICI A;  3H3V H;  3I91 A;  3WWV A;  4CDF C;  3S1M H;  4RAU C;  5L37 A;  5F2D A;  2KED A;  3QOJ A;  2FMM A;  3NP8 A;  1STH A;  4JG2 A;  2Q8T A;  3P20 A;  2E2I B;  1MI2 A;  2A6E C;  3J7Y W;  3OTO L;  3VDY A;  1SEB D;  2WKC A;  3GDE A;  1I3Q B;  2KJX A;  1H9S B;  2F0K A;  4B3R L;  4HJ8 A;  3T1Y Q;  2P5Z X;  5G3L F;  5EBD A;  1L1O C;  3D4D A;  1N9W A;  5CBE E;  4NP5 A;  1DOK A;  4A3I H;  1BR9 A;  1E2W A;  1EWI A;  4K5V A;  1ZKO A;  1Q82 C;  4DK6 C;  4DR4 Q;  1WYD A;  2A68 C;  5FK9 C;  4ME5 A;  1E24 A;  4L5S A;  4XXE A;  4DUY Q;  1SJH D;  3QWN A;  3FPP A;  1G2S A;  1VQH A;  1KAA A;  1UE1 A;  4K6L A;  2EYM A;  4UP7 A;  3M85 A;  1QVG A;  4PV1 C;  4NXN Q;  2MQH A;  4CJ1 B;  4IUR A;  4DAP A;  4DR5 Q;  5IGG A;  1D5Z C;  1CQV A;  2IX0 A;  3A8K E;  4L8J A;  5IGB A;  1K73 C;  5LMN W;  1HCZ A;  4JW0 A;  1TWF B;  2B2V A;  1VMC A;  1Y1V G;  5D65 A;  2VQF Q;  3BYT B;  3ULJ A;  1DXM A;  1SYC A;  5M5X H;  4LF7 Q;  1KDA A;  3URY A;  3Q8D A;  1HA6 A;  1G6P A;  1PH9 A;  3FHW A;  5IY0 A;  1RCV D;  2K5V A;  1D8L A;  2EIF A;  4OO1 G;  3J80 i;  2JA7 H;  4BWG B;  1EWH A;  3GV3 A;  4RMF A;  3B6Y A;  2MHV A;  4FXG C;  1YIT A;  2NVT B;  1PFN A;  1B53 A;  4RA8 A;  4PG3 A;  4HJ7 A;  4FF3 A;  2OQK A;  4P73 A;  3FPU B;  4DV1 Q;  4JI2 Q;  3HOY H;  1CKO A;  1S40 A;  2E5L Q;  2B2W C;  1LTA D;  2HDL A;  5IP9 H;  2ID0 A;  2NZO A;  1BCP B;  5CV4 A;  2CH4 W;  4DV7 Q;  1JE5 A;  3H0G G;  3HZX A;  4XDX A;  5JEA H;  2B2T A;  3ER0 A;  1QZG A;  1L0X B;  1MSG A;  1LT6 D;  4QUF A;  1GXD C;  1VQL A;  3H09 A;  2DJG C;  4KKT A;  3CCE A;  2NB0 A;  2EYF A;  4C2M H;  4ZCK A;  2NYZ D;  5C44 B;  4XYO A;  1HZ9 A;  3DXJ C;  1Z7T A;  1GUG A;  4GN4 B;  4JI4 L;  2B39 A;  1LTI D;  5JJK A;  2Q2H A;  1F9S A;  2MFI A;  4OIK A;  2UXC L;  5GAG C;  4ZUJ A;  1KNA A;  3GTJ B;  1KAW A;  1IBM Q;  4OX9 L;  4UHV A;  4CKB A;  3N52 A;  3PIP A;  4PZ6 A;  1BNZ A;  1AFP A;  1PYB A;  2X69 A;  2WIN B;  4HAE A;  3HOU G;  1ILP A;  4DF7 A;  2NN6 I;  4X64 L;  3HOV B;  2FJ2 A;  4KKS A;  3TME A;  1EY9 A;  2IL8 A;  3HOX B;  4PNY A;  4C3H B;  5IIF A;  5H1S E;  3NXW A;  3CCS A;  3I4M B;  3HKZ G;  1YNJ C;  4GN5 A;  1UNS A;  4K0K L;  1YI2 A;  4DV4 L;  1PH3 A;  4OEL B;  3KF8 A;  4UY8 C;  2N78 A;  3MVV A;  3KBX A;  3W1G A;  4OWX B;  4JYA L;  1L0W A;  1IL2 A;  4F8M A;  1PV4 A;  1B8A A;  1Z47 A;  1B44 D;  2UUB Q;  3SK6 A;  5C3E B;  4IFD I;  1IZ6 A;  1WCM B;  1LT4 D;  1TVX A;  4NMZ A;  4A3J G;  2E2H H;  4I7A A;  4LUO A;  3F2B A;  3DWQ A;  1U9R A;  3PQI A;  1Q1B A;  2Z1C A;  2XNA C;  2Z6B A;  2R92 G;  3OW7 A;  4I65 A;  1KLU D;  3OIQ A;  1Y69 U;  4XT3 B;  2B2U A;  1L1O B;  3EJI A;  2IWH A;  3V05 A;  1RD9 D;  2XSC A;  1TR5 A;  5KGU A;  4L5Q A;  1CI3 M;  3H3V C;  1M4V A;  3UDG A;  1A6X A;  5BN4 A;  2F52 A;  2XIW A;  1ENA A;  2KEE A;  5GAH C;  1JE4 A;  2MO1 A;  4G7Z C;  1EQV A;  1SYD A;  1DOL A;  4A3F G;  4KHP Q;  2M00 A;  1GHK A;  2PZU A;  3SXH A;  4DK0 A;  4QGU A;  1VF5 C;  5ISR A;  2A5H A;  5J22 A;  1FGU A;  2K14 A;  1MGS A;  1RF2 D;  1ILQ A;  1KDC A;  2N49 A;  3SGI A;  1JCK B;  4WRD A;  5E7N A;  3F2C A;  1F9P A;  4DV5 Q;  2NVX H;  4J15 A;  2K6A A;  4TRD A;  4A4I A;  2Y0S E;  4EQO A;  3S24 A;  4GOP C;  3VR4 A;  2QW7 A;  1SE4 A;  3PIO A;  3GTO B;  1WFQ A;  1VQI A;  5C3X A;  3S14 B;  2MNA A;  1ROD A;  4BBS H;  5JEA J;  2IJ0 A;  5DEH A;  1XTD A;  4ZUI A;  3I55 A;  5A2Q E;  4WOR A;  1EY4 A;  1QE6 A;  4DV0 L;  2L4N A;  2AMC B;  3CC7 A;  1JWU D;  4J1M A;  4ID6 A;  4O1N A;  1DD2 A;  2YTX A;  1TKW B;  1C8C A;  1JJ2 A;  3EVQ A;  2G9D A;  4WJW A;  1PRT F;  5LMU L;  5FLM H;  5GAD C;  1DGS A;  1TWG B;  2ZTD A;  2BA0 A;  4NPS A;  4U67 3;  2HIV A;  3HOZ G;  2PQE A;  1PH2 A;  3VYT A;  2PI2 E;  3KLS X;  3KUP A;  1H9S A;  3J81 L;  2A8V A;  1TII D;  5AFW A;  4HIO A;  1KD1 C;  2OF1 A;  4N9T A;  1NMG A;  4QB4 A;  4XYQ A;  3KDF B;  2Z4H A;  4X66 Q;  4LF9 Q;  3S17 H;  2N8N A;  4V19 0;  1SSO A;  4DA2 A;  2NZ1 D;  4XQJ A;  3CU7 A;  5K5P A;  1ICF B;  2XRQ D;  1PH7 A;  1I4X A;  1TS2 A;  1YBY A;  2NTS A;  4EQN A;  1Y8O B;  3RD4 A;  4QCL A;  3CME A;  4JI5 L;  2K50 A;  3A55 A;  3NQI A;  2F4V Q;  5I2X A;  4KN4 C;  1N34 L;  1IKL A;  1Q90 A;  5C44 H;  4IPG A;  5C4J B;  1BOS A;  3PCO B;  1DOM A;  5JVG 3;  1TS4 A;  4UAI A;  4PMB A;  1WTH A;  1W3S A;  3MA2 B;  3I4N B;  1TS5 A;  2ZTE A;  3DEO A;  4JV5 L;  4H0L C;  4WJ3 M;  5CMD A;  3GTJ H;  1O78 A;  3BDO A;  5C4X B;  1LTS D;  4JBJ A;  4JI7 Q;  5KRU A;  2EQS A;  2D0P A;  5IP7 G;  1J5E Q;  3K7A B;  4CKC A;  1ESR A;  3BZD B;  4KN7 C;  4YHH Q;  4DFA A;  1EQQ A;  4BA2 I;  2B63 H;  5C0X I;  5ELN A;  4JI6 L;  3A54 A;  4E6I A;  1LV9 A;  4LFA Q;  4A3E G;  3HOX H;  4LF8 L;  4DV6 L;  2K32 A;  1GUN A;  1TWH B;  1MIU A;  1QB5 D;  3CQZ H;  3CW2 C;  4JOI C;  1UE5 A;  2JA5 G;  4OXP A;  4CHT B;  1RL2 A;  1GHJ A;  4KJO A;  1YNN C;  1DM0 B;  2AKW B;  1FJG Q;  4LF5 L;  3HOU B;  3NBI A;  5AJ3 L;  4OON A;  1JOQ A;  1YZ6 A;  1QZH A;  4UDU C;  4B3M Q;  1EQR A;  3OPO A;  3R2I A;  1HQR D;  1RIP A;  1CTM A;  2JP1 A;  1X3E A;  2Z4I A;  1NR4 A;  4FF2 A;  5K36 H;  2GVB A;  3PF5 A;  2LMC B;  1PYW D;  3KF6 B;  1I6H H;  2A69 C;  1LT5 D;  2H1E A;  3DWA A;  1EYC A;  4RWS C;  5J3B A;  3HKZ B;  1TWA B;  1TY2 A;  4A3C H;  1WCM H;  1IBK Q;  2OWO A;  2RVL A;  3J7A V;  4A93 G;  2F0T A;  5M3M G;  5EPJ A;  1Q1E A;  2L12 A;  1SDF A;  3D3R A;  3JAM c;  3RN5 A;  3ICE A;  1WI5 A;  3PO2 G;  3STB C;  2DNC A;  3W2D A;  1PZK D;  1WTV A;  1A8V A;  1TWC H;  2K33 A;  1BCP D;  4FXK C;  4N9P A;  1O7I A;  4AQY L;  3I2Z A;  4HJ9 A;  3ERO A;  3G6J B;  3AFP A;  4CGY B;  1MJC A;  1LTL A;  1B3Q A;  3PUV A;  1MBY A;  1RTO A;  3HOW G;  2CQO A;  2WP8 J;  1K0R A;  3OWF A;  2MO0 A;  3JC6 6;  4A3I B;  4JI3 L;  1HUM A;  3HGB A;  4XQN A;  2K75 A;  4GS3 A;  4GOP B;  4ZYS A;  3J81 i;  1EZ8 A;  3K81 C;  3HS0 C;  2Y0S G;  1HPC A;  5JPN C;  1Y1W G;  1UWV A;  2Z8L A;  1S4Z A;  2ICE C;  2B2Y A;  2OQ0 A;  1HQM C;  1IYV A;  1JB7 A;  4H44 C;  1YJ9 A;  2KQ3 A;  1I4R A;  4RGT A;  1IYJ B;  4ALP A;  2M2L A;  3NTH A;  5CV9 A;  4RGO S;  5D3D A;  4A3F B;  3F1Z A;  5E4X A;  2AWO A;  4KJN A;  4R4T A;  1LTR D;  5BN3 A;  1WTP A;  4KK7 A;  3GTO H;  4HSV A;  3S14 H;  1IL8 A;  2RCN A;  2VQE L;  2MJ8 A;  1H9J A;  1XPR A;  3K80 C;  1NTG A;  4DR3 L;  3W1B A;  3I4O A;  4RKB A;  5M5X B;  4POG A;  3PIP 3;  3K5N A;  2EDG A;  3CCJ A;  3A5Z B;  1W2B A;  1BDO A;  1NMF A;  4K6D A;  4KLK A;  1I50 H;  3NK9 A;  2UUC Q;  1EIH A;  2LY7 A;  2JA7 B;  2NBF A;  5GAE C;  1QCB D;  5EGT A;  2J4X A;  1L1O A;  4G7O C;  1HH2 P;  5I6W A;  4DR2 Q;  1PTO H;  2R61 A;  2F3W A;  2JA9 A;  3JAM E;  3M3Y H;  3BVM A;  5M3F G;  1Y1V H;  4IOA A;  3A8I E;  1HNW Q;  2F0M A;  2WB1 E;  2F0H A;  1N33 Q;  4X3U A;  2A6E D;  3SK8 A;  4LF6 Q;  1SNC A;  3C3L A;  2HDM A;  1HFG A;  5ELF A;  4APV A;  5A35 A;  1CKN B;  2HCI A;  4DUZ L;  4C2M B;  4DR5 L;  4OO1 H;  2IX3 A;  1GUO A;  3AU7 A;  2I07 B;  2QEX A;  4EQ5 A;  1FL0 A;  1IBL Q;  3SR1 A;  1KQS A;  3C46 A;  5JJI A;  2EY5 A;  4X62 L;  3K0Y A;  3SHL A;  1H95 A;  3G6E A;  4FNF A;  3MHB A;  2A68 D;  1EIF A;  2UUA Q;  1STN A;  5C4J H;  1I5F A;  2DNE A;  3H15 A;  3PO3 G;  2CCZ A;  1U5K A;  4QIW E;  5JPM C;  2X6G A;  3H0G H;  3SVM A;  3U4V A;  1RJT A;  2K5W A;  1GUS A;  2R93 G;  1NSN S;  3TRZ A;  2ASB A;  2AUK A;  4U68 A;  1N32 L;  2NVY H;  1AP0 A;  4DXF A;  1F9R A;  1AW7 A;  2PW5 A;  1S5C D;  2VZA A;  3L3O C;  2R7D A;  2OEO A;  4CDC C;  2BOS A;  1JMC A;  1KHI A;  3K7U C;  2B2W A;  2A6H C;  2IHE A;  3U50 C;  1GJX A;  1XMO L;  4RCN A;  5IGD A;  3IAY A;  1ZYR D;  2EPB A;  1B50 A;  3R8B A;  3AYH B;  3HP3 A;  1K0S A;  3PUX A;  4B3T Q;  1LUZ A;  1V1O A;  3FMC A;  4POF A;  3LGJ A;  2SEB D;  3HOU H;  4TKO B;  3M7G A;  3A0J A;  2K28 A;  2WII B;  1T5E A;  2SOB A;  4IOC A;  1KTK A;  1PXU A;  3GO5 A;  3HFZ B;  3PIO 3;  3KDF A;  1VQM A;  2E2H B;  3NWT A;  1LT3 D;  4L5R C;  3BDC A;  3BVG A;  2PPB C;  2JA5 B;  1TWA H;  1DZ1 A;  4MN3 A;  1PH6 A;  1J6Q A;  4X65 L;  1XWE A;  1IYU A;  3X3N A;  4R8I A;  3RLF A;  3GTK H;  3RNU A;  4IZ8 A;  2Z6K C;  4LF4 Q;  1C4Q A;  1E0B A;  1CZG A;  5IYB G;  1HR0 Q;  1AN8 A;  3OSO A;  1WD0 A;  2CHB D;  4A3M G;  1N36 Q;  4ZRZ A;  1CHQ D;  4IJH A;  2K5Q A;  3Q0A A;  4BY1 G;  3RZD B;  1CZW A;  1EYA A;  2R6G A;  5C3W A;  1H9R A;  2Q2T A;  2ZT9 C;  4A3J H;  4A93 B;  5M3M B;  1K9M C;  2F0N A;  1II3 A;  3S2D B;  2HCC A;  1PZJ D;  1VQ6 A;  1XJV A;  2FHT A;  1F2M A;  1HXY D;  2XWJ B;  1B70 B;  1EQT A;  1I4Q A;  2E76 C;  1UEB A;  4TSS A;  4J6H A;  1D7Q A;  2R92 H;  2EXD A;  3DWP A;  3HKS A;  1NR2 A;  4LFB Q;  2JA6 G;  3M9B A;  4FO2 A;  4J8Q A;  2F0J A;  1I94 Q;  4JI1 L;  2NVX B;  3TRE A;  2RCF A;  1CT1 D;  2KHS A;  2EJG C;  3BZC A;  4RHR A;  3S1N B;  2VB2 X;  1YNJ D;  4PMC A;  4BBS B;  2QDL A;  3ITP A;  4A3F H;  3KF6 A;  1SN8 A;  1XNQ L;  1GVP A;  1JWS D;  3D4W A;  4FYD A;  4LFC Q;  4C1N K;  2YTV A;  2Y0S B;  1HNZ Q;  1Z9F A;  1ONL A;  3CC4 A;  1LTG D;  1QG7 A;  1STY A;  1FR3 A;  5I9O A;  1ZYR C;  4HJA A;  4MTN A;  4MIU A;  4Q0F A;  4OO1 I;  4R8N A;  2ENB A;  1J9O A;  4GLV B;  1WOC A;  4DU9 A;  1Q7Y C;  1K3B C;  1EY0 A;  1LAC A;  3P7J A;  3NTK A;  3NHH A;  2WB1 G;  4DR7 Q;  1EEF D;  3A74 A;  3R2T A;  3UDI A;  4NXM Q;  3RR5 A;  2A19 A;  4LUZ A;  4AH6 A;  2KHJ A;  3EQL C;  2J7Z A;  4OHJ A;  1MD2 D;  1PTO C;  2L55 A;  3TP5 A;  1G2T A;  1TY0 A;  1SMY C;  5ELC A;  3S17 B;  4KD4 A;  4GOP A;  5C6A A;  4JI8 L;  4OL7 A;  3VA5 A;  5C5M A;  2ZM6 Q;  2UXB Q;  2R7Z G;  4MTK A;  1VQK A;  4HSP A;  1VF7 A;  2LSS A;  3EN2 A;  2Z0S A;  3WDN A;  3HOZ H;  5A2Q L;  4HED A;  4PMW A;  1K83 H;  3KLW A;  1YNX A;  4FP5 D;  1F2L A;  1FNW A;  3AQQ A;  2B3G A;  1A3V A;  1VQ5 A;  1X55 A;  4JI0 Q;  4N8X 1;  1OXT A;  1A3U A;  4WFN 3;  3KFU A;  3GTM H;  4IN3 A;  3DMU A;  3E5S A;  2B63 B;  2KCN A;  2WAQ G;  3PUY A;  3R93 A;  1QVF A;  4S3S A;  5IWA Q;  2L15 A;  1DON A;  5I4D A;  3KJP A;  3CQZ B;  5EKK A;  3D4R A;  4DAY B;  3PO3 B;  2MP1 A;  1H9K A;  4LW1 A;  3TS2 A;  3SE0 A;  4TVA B;  2R93 B;  3H3V I;  3QR8 A;  4RKL A;  5LL6 X;  1OTC A;  4A3B G;  1M8A A;  2KBN A;  4DV2 L;  2OXP A;  3DLL A;  3CCU A;  3NE5 B;  1YJW A;  5EKI A;  5IP7 H;  2ZXR A;  2KUM A;  3QO2 A;  1I6H B;  3TZU A;  2O2L D;  2F4V L;  4ULL A;  1DYQ A;  5FO9 B;  3BJU A;  1HR0 W;  3OTO Q;  3N6R A;  4UPA A;  1PYS B;  4B3S L;  4YWK A;  3WOF A;  4A3E H;  4B3R Q;  1T5X D;  4MZ9 A;  1G51 A;  3I90 A;  3KLS A;  2JA5 H;  4JI7 L;  1V43 A;  2A74 C;  3VYR A;  4G7H C;  4CJ0 B;  5JJZ A;  4NB3 A;  2IHF A;  3CD6 A;  2J0T D;  2V1C C;  1W6J A;  3D31 A;  1TWC B;  1D2B A;  2BA1 A;  4LWC A;  5G3L D;  5CR3 A;  1JJC B;  1VDZ A;  3J7Z C;  1GD7 A;  3P75 A;  1D5X C;  4CDE C;  1SFO H;  4N8F A;  4IFD G;  2PO4 A;  1SRU A;  3RZD H;  1D1K A;  2F0I A;  3HRZ C;  4JOI A;  5IE8 A;  1MHW C;  4A93 H;  5M3M H;  1EFI D;  1U0L A;  1B2T A;  3S2D H;  3T1H L;  2VUM G;  3C1F A;  1V1Q A;  2IX1 A;  3PO2 H;  1HJP A;  4A75 A;  4LJZ C;  1HNX L;  1FD7 D;  2N55 A;  2L9H A;  1VQ4 A;  2JA8 G;  1P16 A;  4EVO A;  1RKN A;  2DY8 A;  2K03 A;  4DKA C;  2OCE A;  1B4O A;  2B29 A;  3TZD A;  4P71 A;  1JIC A;  2BH8 A;  3AB9 A;  4GKK L;  3C1E A;  5ELE A;  2PZT A;  3X3M A;  2IW3 A;  1BCP F;  3HOW H;  3S1N H;  4X3K A;  3BU2 A;  5JVH 3;  4IUV A;  5IOC A;  3I7F A;  1YNN D;  3AFQ A;  1JOK A;  4DV3 L;  3U4Z A;  2BDN A;  2JA6 B;  2K04 A;  5EPL A;  2EY1 A;  1IW7 C;  1W6K A;  5C4H A;  1HFN A;  2E2J B;  1Y1W H;  3W3A A;  2UU9 L;  2YV5 A;  1K28 A;  4DR6 L;  1AE3 A;  1I50 B;  3QIA A;  2A69 D;  1WVL A;  4RHS A;  3L2P A;  1AEX A;  2XRS D;  1FYC A;  2K5N A;  4KHV A;  1PA6 A;  2KVM A;  1HRJ A;  4C3I G;  3MEF A;  2BE5 C;  1OXU A;  5HUR A;  1PTO B;  3PUZ A;  4PZ8 A;  3M3Y B;  4JI4 Q;  2H4O A;  3STB D;  4BY7 G;  1Y1V B;  3Q24 A;  3UDF A;  4DNR B;  1EOV A;  1PH1 A;  3T56 B;  2F0L A;  5IYD G;  2UXC Q;  3GQB A;  1SYB A;  1A62 A;  1IHZ A;  1Q46 A;  4Y7N B;  3GTP B;  5FO8 B;  3RZO B;  4B9X A;  4OX9 Q;  2AQ2 B;  3L9A X;  4CDD C;  1XNR L;  5IT9 c;  1YHA A;  4HR7 B;  1VQO A;  3MAQ A;  1C48 A;  3CC2 A;  2WV6 D;  1M90 C;  1ZEQ X;  2JJQ A;  3NSW A;  2NVQ B;  4X64 Q;  3SK5 A;  2VXW A;  2B8G A;  4G4K A;  2WB1 B;  3MWY W;  1JQY D;  4DNI A;  4IAL A;  5C5L A;  3A7A B;  1X3P A;  5M3F H;  4K0K Q;  1ZXT A;  4DV4 Q;  2JQO A;  4FF1 A;  3H0G B;  2IT1 A;  4A3D G;  3G71 A;  1CQF A;  2A73 B;  5LMN L;  2NVY B;  2R7Z B;  4JYA Q;  2JSO A;  3E9H A;  3TBI B;  4QIW B;  2DJF C;  3JAM L;  1KAB A;  1XX8 A;  4R9W A;  3PMF A;  3GTG B;  3BVZ A;  3PO3 H;  4X3S A;  2QEJ C;  1YHB A;  1SNP A;  1XMQ L;  4F7X A;  3OW2 A;  3K59 A;  4R4O A;  1ASY A;  1WD1 A;  2R93 H;  1QIL A;  4OWT B;  4MHE A;  2UXD L;  3M4O H;  1EY5 A;  1R4P B;  1GM5 A;  2CW0 C;  3T4A C;  3T53 B;  3BDL A;  4KI0 A;  3M7N A;  3I73 A;  1C0A A;  3KK7 A;  4KHZ A;  2QKI C;  2FXQ A;  4GKJ L;  3T51 B;  5C0X G;  2ZJR A;  4BXX G;  4BA1 I;  3OYY A;  3A8J E;  1NUC A;  2PI2 A;  1PFM A;  1VMP A;  2D62 A;  2OTL A;  4HTH A;  1RTN A;  4B9W A;  4A3B B;  3GTK B;  1JJG A;  1X6O A;  5FLX c;  3D0F A;  1FNU A;  2EY6 A;  3K5M A;  1HTP A;  1STB A;  2QF7 A;  2KOL A;  5IT9 E;  3SDZ A;  4YY3 L;  3W5O A;  2SNS A;  1BBX C;  2HHH L;  2HQL A;  4A3J B;  1X32 A;  4F87 A;  4R4I A;  3MXN B;  3CAM A;  1I4G A;  5BR8 L;  3KOJ A;  2R92 B;  3GD7 A;  4IPC A;  1CK1 A;  3M4Q A;  1BBW A;  3MXU A;  4KMU C;  3HEJ A;  1EY7 A;  1DCZ A;  5D3I B;  4A3K G;  2F0P A;  5GRO A;  4DAY A;  2R3Z A;  4K5X A;  5IYB H;  5KND A;  4DV0 Q;  3TEH B;  2VW9 A;  4A3M H;  1CSP A;  3RUZ A;  5CV5 A;  1Y8N B;  5T1G A;  4DR1 L;  5BN5 A;  4BY1 H;  2F0Q A;  1LM0 A;  2C9O A;  4BBR G;  1E22 A;  5LMU Q;  3K5O A;  1HA5 A;  2A6H D;  3S2H B;  3AEV A;  1XPU A;  3S15 H;  4K2L A;  3QG1 A;  1S72 A;  4OGQ C;  5EKL A;  3LWU A;  2JA8 B;  2KEC A;  1D5M C;  4GLA C;  2Z6K A;  4FVM A;  5CV8 A;  1G6Z A;  5COY A;  2JA6 H;  3I56 A;  3P1H A;  3NQT A;  3NEM A;  3TN2 A;  2E2J H;  3RMH A;  2G5D A;  4C3J G;  4AIM A;  1GUT A;  3EFX D;  3T1Y L;  2K7V A;  2L5T A;  1BVS A;  2ZTC A;  2AHO B;  1BF4 A;  4HID A;  1NBW A;  1BUV T;  2F0U A;  3JAM i;  4JI5 Q;  1N34 Q;  2F4I A;  3IFD A;  1EIG A;  5FLX E;  2QA4 A;  4DR4 L;  3KBG A;  4K14 A;  1BQQ T;  5IGE A;  4DUY L;  1VCI A;  3CRK C;  4KTA A;  4Q5V A;  2WAC A;  4UP8 A;  2CQA A;  4JV5 Q;  4ME3 A;  3IRB A;  4ZKB B;  1STG A;  1CUK A;  4C3I B;  4Y7N H;  3GTP H;  1EOT A;  3RZO H;  4NXN L;  1SE3 A;  1Q3L A;  3M4P A;  3K5L A;  3D6C A;  1PFB A;  3HOZ B;  2I0Q A;  2NVQ H;  1J8I A;  4TQU S;  4JI6 Q;  1CHP D;  3TSS A;  3CCL A;  1K83 B;  5KIX A;  2PNH A;  3VYS A;  2VQF L;  4IPD A;  1RHP A;  5DAU A;  2RKS A;  4ZK9 B;  4ZKC B;  4DV6 Q;  4LF8 Q;  2O5J C;  4LF7 L;  4A3L G;  1JC7 A;  4JBK A;  2K05 A;  2B8F A;  4RCO A;  3UE0 A;  1TXY A;  2JEB I;  1S5B D;  1PHJ A;  2I46 A;  3GTM B;  4LF5 Q;  4GNX C;  4ZAI A;  4JBW A;  1I4H A;  5AJ3 Q;  1G8Z D;  5COR A;  4KD3 A;  1SXT A;  4IUN A;  3HOV G;  2R7Z H;  1KC8 C;  2EYL A;  3Q6S A;  1SMX A;  1VQA A;  1B3A A;  4C3H G;  4DV1 L;  3U58 A;  1V8Q A;  2F0G A;  1C7Y A;  4JI2 L;  3I4M G;  1U4P A;  2E5L L;  1XYI A;  1D6E C;  2Q2I A;  2N88 A;  3O13 A;  1A63 A;  3S16 B;  2EYH A;  2WAQ E;  3A56 A;  4DV7 L;  2CFM A;  4A3D B;  3VR6 A;  4HCS A;  1VQG A;  5CGK A;  3GTG H;  4FXD A;  1PFS A;  3OMC A;  1PRT C;  3H6M A;  1KRS A;  4G57 A;  1QUQ B;  1EY8 A;  1Y8P B;  2F0O A;  2LS0 1;  1X3F A;  4P72 A;  3MFY A;  2CVR A;  5C3E G;  4B08 A;  5KYI A;  4AQY Q;  1OXX K;  3GTL B;  4A3E B;  2K5H A;  2AQ1 B;  3CF5 A;  4BS9 A;  4LUV A;  2PQA B;  2PMZ B;  2EZV A;  1OO9 B;  1PTO D;  1IBM L;  1K3R A;  1SMY D;  2QCP X;  1EEI D;  2L0C A;  1H9M A;  2E74 C;  1F77 A;  4A3B H;  1SE8 A;  3FKI G;  2F1M A;  2LXK A;  5E1F A;  2E75 C;  3VR2 A;  4ZLT F;  5M5Y B;  3K58 A;  1SFO B;  2C5C A;  1V1P B;  2DUD A;  3E6Z X;  1Q8I A;  5KEE A;  1WTO A;  1NAP A;  1S3O A;  2CH4 A;  1GKH A;  2D5D A;  4C56 C;  2L1B A;  4RH6 A;  4DK1 A;  3J80 c;  2EYJ A;  1NNX A;  1E2Z A;  3ONA B;  5IGF A;  2KHI A;  1SNM A;  2I5H A;  2SNM A;  4DNT B;  2GA4 B;  4MNO A;  2JK8 A;  3PO2 B;  2EYO A;  2VQE Q;  5I9P A;  2XGT A;  1O7L A;  2K1B A;  1BBU A;  5JJL A;  3NUC A;  2PYK A;  4DR3 Q;  2DGY A;  2UUB L;  5CBA E;  1KXL A;  4R1J A;  4EQP A;  2VY3 A;  4A3G G;  5J39 A;  5JOB A;  5CYU A;  4IFD H;  3OWE B;  2LFN A;  1STE A;  4YWM A;  2OT2 A;  3E0J A;  3HOW B;  3MTS A;  4PZ7 A;  3CPW A;  5DM6 3;  4A76 A;  4O42 A;  2F3V A;  3FDT A;  3S2H H;  1G91 A;  2VUM H;  3TS0 A;  3FP9 A;  4A3K B;  4QJF A;  5FJ8 G;  1S5E D;  1Y1W B;  2D0O A;  3KYH C;  3F8T A;  4L5T A;  2JA8 H;  1EUJ A;  5DM7 3;  3NBH B;  1QNK A;  4L63 B;  1DJR D;  3U9S A;  1MJE A;  4BBR B;  1CA6 A;  4DAV A;  1HZC A;  3L0O A;  4WJ4 A;  2TMP A;  2H5X A;  3I8Z A;  1O7Y A;  4DUZ Q;  1SBB B;  5D14 A;  5JAV A;  4KHP L;  3PUW A;  3GP7 A;  3OHX C;  4X3T A;  1VQC A;  1SYG A;  4PQX A;  5IYC G;  4FDB A;  1X54 A;  4X62 Q;  2FMC A;  1XTC D;  4XTC S;  3MXN A;  4JK1 C;  1QWY A;  1WTQ A;  1L0Y B;  5HGQ A;  1ENF A;  1TS3 A;  3MEH A;  3QOL A;  3Q22 A;  1QVC A;  2M9V A;  1STA A;  3E0E A;  3SK4 A;  4C3J B;  2Q2U A;  5EQ0 A;  4DV5 L;  3MC0 B;  1F2Y A;  5T1I A;  3RLN A;  1SND A;  5IGC A;  1N32 Q;  2K4K A;  4UP9 A;  5FO7 B;  1SYF A;  4C3I H;  1AZP A;  2CWP A;  3J80 E;  3F2U A;  1ML0 D;  2KEN A;  1EYG A;  1Y14 B;  3UDX A;  3ULP A;  3OIP A;  4GNX B;  2ZJQ A;  5M3F B;  4BY7 H;  2XVS A;  1X9N A;  5IYD H;  1XMO Q;  2F0S A;  1SLJ A;  1U4M A;  3I4N G;  2RSO A;  4ODG A;  4IQZ A;  4EX5 A;  3CXC A;  1QOH A;  3VYU A;  5C4X G;  2QIL A;  2KCC A;  1SYE A;  3ZYY X;  2VB3 X;  4IUQ A;  3T16 A;  3F2D A;  1BXT A;  1JOO A;  3EIV A;  2RBM A;  3GV6 A;  2Z9H A;  4QMG A;  2PCF B;  3CCR A;  2V4D A;  2PNR C;  1TQO A;  1Z6H A;  4R4Q A;  2MPM A;  1PRT B;  2EJF C;  1IW7 D;  1YJN A;  5CV7 A;  2YU9 H;  2AUJ D;  5DLQ E;  5LL6 S;  3CCM A;  4HJ5 A;  5IOD A;  2KCM A;  3PV0 A;  4H13 C;  1ICW A;  3OMG A;  4X66 L;  3S16 H;  4X65 Q;  4LF9 L;  1N8R C;  4A3D H;  1UAP A;  2F0W A;  3M4O B;  2BE5 D;  1LYL A;  1XXG A;  1PZI D;  4YWL A;  1VQN A;  2NN6 G;  2PMZ E;  1UE6 A;  1ASZ A;  1EZ6 A;  4C1N I;  1CM9 A;  4Z9C B;  4CJ2 C;  3QJY A;  4AYB E;  1R4Q B;  4NKL A;  2EVB A;  2MGS A;  3GTL H;  3I70 A;  1CKN A;  1YIJ A;  2HQE A;  2R7F A;  3NEL A;  5NUC A;  2X6L A;  4KY6 A;  4IFD J;  1J5E L;  4M8A A;  1M1K C;  5ELD A;  1KNE A;  4YHH L;  3G48 A;  3MXG A;  3DM3 A;  3UE1 A;  1K8A C;  5DNF A;  5ELO A;  4JI1 Q;  3NEN A;  4DAM A;  5M5Y H;  3J81 j;  4R4C A;  4LFA L;  5C0X H;  4BXX H;  4OWW B;  4JC0 A;  1QNU A;  3IKJ A;  1SE2 A;  4KY7 A;  2XTI A;  1VQ9 A;  3T13 A;  1SNQ A;  2F03 A;  3J7A F;  4A3I G;  4IUP A;  2O5I C;  1FJG L;  1XNQ Q;  3FKI B;  1OXS C;  2HIX A;  1LLR D;  4HIM A;  1U4R A;  2B2V C;  4B3M L;  3V96 A;  1SNO A;  3ZJY C;  4GN3 B;  4A3M B;  2E8G A;  1BO0 A;  1KL9 A;  1NY4 A;  3S1R B;  1PVO A;  2E2D C;  1KLG D;  3K8A A;  4QY7 A;  5C4Z A;  4BY1 B;  4YIJ A;  2E2I H;  3D8G A;  2I5L X;  1ENC A;  1IBK L;  1GO3 E;  3S15 B;  2RF4 A;  1I3Q H;  1QUQ A;  2DY7 A;  1VQB A;  2KA7 A;  3EBE A;  1I4P A;  5KNC A;  1K8M A;  4RGM A;  5IT9 L;  1JR0 D;  4A3K H;  4V0B A;  2PQA A;  2XN9 C;  4A3G B;  4P75 A;  4YCV A;  1MKH A;  4LNQ A;  2CW0 D;  3I3C A;  2B2T C;  3TP8 A;  3MFG A;  3DUZ A;  4JI8 Q;  2RSN A;  2JA7 G;  2WFW A;  4M1U B;  2EY2 A;  4BBR H;  3CCV A;  1WTR A;  4K5W A;  2D9U A;  2D2C C;  2NTT A;  1A0I A;  4K8I A;  1GOZ A;  1V1P A;  2F0D A;  2HT1 A;  3ND8 A;  3BG3 A;  2O4X A;  2F0F A;  3HOY G;  3KLR A;  1LO5 D;  1EU4 A;  1WJJ A;  1TWF H;  1SAP A;  5IP9 G;  3EA6 A;  1AE2 A;  2ZXO A;  3G7L A;  2F3I A;  3PF4 A;  5JEA G;  4QF4 A;  3S1Q B;  3A5U A;  3MZ5 A;  4C3J H;  4Y52 H;  1PDQ A;  1I6V C;  2NZH A;  4JCV E;  1HHV A;  4OEM B;  2RQX A;  2NVT H;  4FF4 A;  3CPF A;  4NW2 A;  1IXR A;  3FRP B;  4X6A H;  1NCV A;  1CKM A;  4YCU A;  4KY5 A;  3GTQ B;  1E3P A;  1TU2 B;  1SRO A;  2MUY A;  5EBC A;  1S5D D;  4KKU A;  2OTJ A;  5M5W B;  1D1I A;  5I6Y A;  2UUC L;  2HUG A;  1AH9 A;  4DV2 Q;  2K5D A;  4IJL A;  3C2P A;  4DR2 L;  5HY6 A;  3NBH A;  4ILW A;  2C35 B;  1Q81 C;  5FLX L;  3J7A 5;  5TSS A;  1SJE D;  5M9O A;  4B3S Q;  3H94 A;  3I4L A;  2JYO A;  1HNW L;  4RGN A;  3V2T A;  4A3L H;  4HCE A;  1N33 L;  3FEW X;  3CKI B;  2ZJP A;  2PZW A;  3LX0 A;  2QGQ A;  5C0X J;  3K0X A;  4LF6 L;  2RHQ B;  1FVI A;  3J81 c;  1CA5 A;  2RA4 A;  4AYB G;  3LNN A;  5FKA C;  2ALY B;  1E7Z A;  2B2U C;  3VA7 A;  1B9N A;  2WAQ B;  3ND9 A;  3R3O A;  4QL5 A;  3HOV H;  1IBL L;  1VQJ A;  1HZB A;  3TDQ A;  4C3H H;  2EE1 A;  1EWC A;  1PLF A;  3E9I A;  3I4M H;  1HUN A;  2UUA L;  2RDH A;  2VL6 A;  2ATW A;  1GUW A;  2VS1 A;  4RG1 A;  4ABN A;  2WKD A;  1C9O A;  5EJW A;  1EY6 A;  3Q23 A;  2K52 A;  3T1H Q;  2G9H D;  1B1Z A;  1ET6 A;  1UEA B;  2SDF A;  2Q8I B;  1B9M A;  4GNX A;  2Q8R E;  1ESF A;  4O0A A;  1LAB A;  1HNX Q;  5I2Y A;  3AMU A;  2CKZ B;  4QUC A;  3KJO A;  4LMQ D;  1Q12 A;  1K8G A;  2ZXP A;  4GZY C;  1VQ8 A;  1BKB A;  1EL0 A;  3HG9 A;  3CP0 A;  2EYP A;  1T9H A; 
#chains in the Genus database with same CATH homology
 1R9T B;  4DGZ A;  1JWM D;  3ERQ A;  3I72 A;  3BS1 A;  3S1M B;  2JXM B;  3OOC A;  5HGT A;  5KYL A;  1PTO F;  4CKE A;  2TSS A;  1PMR A;  3S9W A;  1TT2 A;  1WTX A;  3K6O A;  4ZQ3 A;  1EU3 A;  2F0V A;  4DXG A;  2BDO A;  3QB3 A;  2VUM B;  1HTL D;  4LK1 C;  3H91 A;  1PRT D;  1F2Z A;  4I7Z C;  2XWB B;  3J81 E;  4XQQ A;  3IFT A;  2F0E A;  4OIJ A;  1QJO A;  3TP6 A;  4CBV A;  4K2K A;  4EGV A;  2VNU D;  1LTT D;  2RDF A;  4HMJ A;  2YYZ A;  4HMI A;  3VR3 A;  3SEB A;  3FVQ A;  3LWE A;  5LHY 1;  1G29 1;  5E4W C;  3IL8 A;  3CHB D;  1UUP A;  1A15 A;  3M4Y A;  1IKM A;  4IUT A;  3U9O A;  4H7B A;  2IPK D;  3DEP A;  3DHQ A;  4F88 A;  2FFK B;  3HOY B;  1ET9 A;  5EPK A;  4BY7 B;  2JE6 I;  4NDX A;  5CV6 A;  4RFB A;  2EJM A;  1K8O A;  2JEA I;  3UI2 A;  1A2U A;  1BCP C;  5J1Z A;  1WTW A;  2DN8 A;  2RDG A;  2QDB A;  2EXZ A;  3NPP A;  3MXP A;  5ELB A;  2YU9 B;  3VR5 A;  1JB3 A;  2K01 A;  1U4L A;  3BYY B;  1LTB D;  3A7L A;  1KDB A;  5CC4 A;  3L7Z C;  4XT1 B;  2L11 A;  2PW7 A;  1A2T A;  3WOE A;  3J80 L;  5K36 G;  4K8J A;  4XIG S;  4L6T B;  5E3F A;  2EOT A;  4KV6 A;  1CFM A;  1RDP D;  4IUU A;  2NWG A;  3TP7 A;  1O7Z A;  1AZQ A;  5KNB A;  4AYB B;  3NWS A;  1A3T A;  2AWN A;  1FNV A;  2LKV A;  1E2V A;  1F9Q A;  4LAA A;  1JOR A;  1FGB D;  2BCO A;  4HN7 A;  4DN4 M;  3CRL C;  2B2Y C;  2NN6 H;  3NTI A;  1X3Q A;  1S5F D;  1O80 A;  4P2C B;  2NUC A;  2AQ3 B;  1EYD A;  3DM1 A;  1MSH A;  1OXV A;  2FIN B;  5FOB B;  3D6W A;  3K57 A;  2ICI A;  3I91 A;  4RAU C;  5F2D A;  2KED A;  3QOJ A;  2FMM A;  3NP8 A;  1STH A;  2Q8T A;  3P20 A;  2E2I B;  1MI2 A;  2A6E C;  3J7Y W;  1SEB D;  2WKC A;  1I3Q B;  2KJX A;  1H9S B;  2F0K A;  5G3L F;  5EBD A;  3D4D A;  5CBE E;  4NP5 A;  1DOK A;  1BR9 A;  1E2W A;  4K5V A;  1ZKO A;  2A68 C;  5FK9 C;  4ME5 A;  4XXE A;  1SJH D;  3QWN A;  3FPP A;  1G2S A;  1KAA A;  4K6L A;  2EYM A;  3M85 A;  4PV1 C;  4CJ1 B;  4IUR A;  4DAP A;  5IGG A;  1D5Z C;  1CQV A;  2IX0 A;  3A8K E;  4L8J A;  5IGB A;  1HCZ A;  1TWF B;  2B2V A;  1VMC A;  5D65 A;  3BYT B;  1DXM A;  1SYC A;  1KDA A;  3URY A;  1HA6 A;  1RCV D;  4OO1 G;  4BWG B;  1EWH A;  3GV3 A;  2MHV A;  4FXG C;  2NVT B;  1PFN A;  1B53 A;  4RA8 A;  4FF3 A;  3FPU B;  2B2W C;  1LTA D;  2HDL A;  2ID0 A;  1BCP B;  5CV4 A;  3HZX A;  4XDX A;  5JEA H;  2B2T A;  1L0X B;  1MSG A;  1LT6 D;  4QUF A;  1GXD C;  3H09 A;  4KKT A;  2NB0 A;  2EYF A;  2NYZ D;  5C44 B;  4XYO A;  3DXJ C;  1Z7T A;  1GUG A;  2B39 A;  1LTI D;  1F9S A;  4OIK A;  4ZUJ A;  1KNA A;  3GTJ B;  4CKB A;  3N52 A;  1BNZ A;  1AFP A;  2X69 A;  2WIN B;  4HAE A;  1ILP A;  4DF7 A;  2NN6 I;  3HOV B;  2FJ2 A;  4KKS A;  3TME A;  1EY9 A;  2IL8 A;  3HOX B;  4PNY A;  4C3H B;  5IIF A;  3NXW A;  3I4M B;  1YNJ C;  1UNS A;  3KF8 A;  3MVV A;  3KBX A;  4F8M A;  1Z47 A;  1B44 D;  3SK6 A;  5C3E B;  4IFD I;  1WCM B;  1LT4 D;  1TVX A;  4NMZ A;  3DWQ A;  1U9R A;  1Q1B A;  2Z1C A;  2XNA C;  3OW7 A;  4I65 A;  1KLU D;  3OIQ A;  1Y69 U;  4XT3 B;  2B2U A;  3EJI A;  2IWH A;  3V05 A;  1RD9 D;  2XSC A;  1TR5 A;  5KGU A;  1CI3 M;  3H3V C;  1M4V A;  1A6X A;  5BN4 A;  2XIW A;  1ENA A;  2KEE A;  1JE4 A;  4G7Z C;  1EQV A;  1SYD A;  1DOL A;  2M00 A;  1GHK A;  2PZU A;  3SXH A;  4DK0 A;  1VF5 C;  5ISR A;  2A5H A;  5J22 A;  1MGS A;  1RF2 D;  1ILQ A;  1KDC A;  1JCK B;  4WRD A;  1F9P A;  4TRD A;  2K6A A;  4EQO A;  3VR4 A;  1SE4 A;  3GTO B;  3S14 B;  5C3X A;  1ROD A;  5JEA J;  2IJ0 A;  5DEH A;  4ZUI A;  5A2Q E;  4WOR A;  1EY4 A;  1QE6 A;  2L4N A;  1JWU D;  4J1M A;  4ID6 A;  4O1N A;  1DD2 A;  1TKW B;  1C8C A;  3EVQ A;  2G9D A;  4WJW A;  1PRT F;  1TWG B;  2BA0 A;  4U67 3;  2PQE A;  3VYT A;  3KLS X;  3KUP A;  1H9S A;  3J81 L;  1TII D;  5AFW A;  2OF1 A;  4N9T A;  4QB4 A;  4XYQ A;  2Z4H A;  4V19 0;  1SSO A;  4DA2 A;  2NZ1 D;  4XQJ A;  3CU7 A;  5K5P A;  2XRQ D;  1I4X A;  1TS2 A;  2NTS A;  4EQN A;  4QCL A;  1Y8O B;  3RD4 A;  3A55 A;  3NQI A;  5I2X A;  4KN4 C;  1IKL A;  1Q90 A;  5C4J B;  1BOS A;  1DOM A;  5JVG 3;  1TS4 A;  4UAI A;  4PMB A;  3MA2 B;  3I4N B;  1TS5 A;  3DEO A;  4H0L C;  5CMD A;  5C4X B;  1O78 A;  3BDO A;  1LTS D;  5KRU A;  3K7A B;  4CKC A;  1ESR A;  3BZD B;  4KN7 C;  4DFA A;  4BA2 I;  5C0X I;  3A54 A;  4E6I A;  1LV9 A;  2K32 A;  1GUN A;  1TWH B;  1QB5 D;  4CHT B;  1GHJ A;  4KJO A;  1YNN C;  1DM0 B;  3HOU B;  3NBI A;  1JOQ A;  4UDU C;  3OPO A;  3R2I A;  1HQR D;  1CTM A;  2JP1 A;  2Z4I A;  1NR4 A;  4FF2 A;  5K36 H;  2LMC B;  1PYW D;  2A69 C;  1LT5 D;  2H1E A;  3DWA A;  1EYC A;  4RWS C;  3HKZ B;  1TWA B;  1TY2 A;  2RVL A;  3J7A V;  2F0T A;  5EPJ A;  1Q1E A;  2L12 A;  1SDF A;  3D3R A;  2DNC A;  3W2D A;  1PZK D;  1WTV A;  2K33 A;  1BCP D;  4FXK C;  4N9P A;  3ERO A;  3G6J B;  4CGY B;  3PUV A;  1MBY A;  1RTO A;  2WP8 J;  3OWF A;  4A3I B;  1HUM A;  3HGB A;  4XQN A;  4ZYS A;  1EZ8 A;  3HS0 C;  1HPC A;  5JPN C;  2Z8L A;  1S4Z A;  2ICE C;  2B2Y A;  1HQM C;  1IYV A;  4H44 C;  2KQ3 A;  1I4R A;  4RGT A;  2M2L A;  3NTH A;  5CV9 A;  4RGO S;  5D3D A;  4A3F B;  5E4X A;  2AWO A;  4KJN A;  1LTR D;  5BN3 A;  1WTP A;  4KK7 A;  4HSV A;  1IL8 A;  2MJ8 A;  1H9J A;  5M5X B;  4RKB A;  3PIP 3;  3K5N A;  2EDG A;  1BDO A;  4K6D A;  3NK9 A;  1EIH A;  2LY7 A;  2JA7 B;  2NBF A;  1QCB D;  5EGT A;  2J4X A;  4G7O C;  5I6W A;  1PTO H;  2R61 A;  2F3W A;  3JAM E;  3BVM A;  3A8I E;  2F0M A;  2F0H A;  4X3U A;  2A6E D;  3SK8 A;  1SNC A;  3C3L A;  2HDM A;  1HFG A;  5ELF A;  5A35 A;  2HCI A;  4C2M B;  4OO1 H;  2IX3 A;  1GUO A;  3AU7 A;  2I07 B;  3SR1 A;  3C46 A;  2EY5 A;  3K0Y A;  3SHL A;  4FNF A;  3MHB A;  2A68 D;  1STN A;  2DNE A;  5JPM C;  2X6G A;  3SVM A;  1RJT A;  2K5W A;  1GUS A;  1NSN S;  2AUK A;  4U68 A;  1AP0 A;  4DXF A;  1F9R A;  1AW7 A;  2PW5 A;  1S5C D;  3L3O C;  2OEO A;  2BOS A;  2B2W A;  2A6H C;  1GJX A;  4RCN A;  5IGD A;  3IAY A;  1ZYR D;  2EPB A;  1B50 A;  3R8B A;  3HP3 A;  3PUX A;  1V1O A;  3FMC A;  2SEB D;  4TKO B;  3M7G A;  2K28 A;  2WII B;  1T5E A;  2SOB A;  1KTK A;  1PXU A;  3GO5 A;  3PIO 3;  2E2H B;  3NWT A;  1LT3 D;  3BDC A;  3BVG A;  2PPB C;  2JA5 B;  1DZ1 A;  4MN3 A;  4R8I A;  1XWE A;  1IYU A;  3X3N A;  3RLF A;  4IZ8 A;  1C4Q A;  1E0B A;  1CZG A;  1AN8 A;  3OSO A;  1WD0 A;  2CHB D;  4ZRZ A;  1CHQ D;  2K5Q A;  3Q0A A;  3RZD B;  1CZW A;  1EYA A;  2R6G A;  5C3W A;  1H9R A;  2ZT9 C;  4A93 B;  5M3M B;  2F0N A;  1II3 A;  3S2D B;  2HCC A;  1PZJ D;  2FHT A;  1F2M A;  1HXY D;  2XWJ B;  1EQT A;  2E76 C;  1I4Q A;  4TSS A;  4J6H A;  3DWP A;  1NR2 A;  4FO2 A;  4J8Q A;  2F0J A;  2NVX B;  1CT1 D;  2KHS A;  2EJG C;  4RHR A;  3S1N B;  2VB2 X;  1YNJ D;  4PMC A;  4BBS B;  3ITP A;  1JWS D;  3D4W A;  4FYD A;  4C1N K;  2Y0S B;  1ONL A;  1LTG D;  1QG7 A;  1STY A;  1FR3 A;  5I9O A;  1ZYR C;  4MIU A;  4Q0F A;  4OO1 I;  4R8N A;  2ENB A;  1J9O A;  4DU9 A;  1EY0 A;  1LAC A;  3P7J A;  3NTK A;  3NHH A;  1EEF D;  3R2T A;  3EQL C;  2J7Z A;  4OHJ A;  1MD2 D;  1PTO C;  2L55 A;  3TP5 A;  1G2T A;  1TY0 A;  1SMY C;  5ELC A;  3S17 B;  4KD4 A;  5C6A A;  4OL7 A;  3VA5 A;  5C5M A;  4HSP A;  1VF7 A;  3WDN A;  5A2Q L;  4HED A;  4PMW A;  4FP5 D;  1F2L A;  1FNW A;  1A3V A;  1OXT A;  1A3U A;  4WFN 3;  4IN3 A;  3DMU A;  3E5S A;  2B63 B;  2KCN A;  3PUY A;  3R93 A;  4S3S A;  1DON A;  5I4D A;  3CQZ B;  5EKK A;  3D4R A;  3PO3 B;  2MP1 A;  1H9K A;  3SE0 A;  2R93 B;  4RKL A;  5LL6 X;  1M8A A;  2OXP A;  3NE5 B;  5EKI A;  2ZXR A;  2KUM A;  3QO2 A;  1I6H B;  3TZU A;  2O2L D;  4ULL A;  1DYQ A;  5FO9 B;  3N6R A;  3WOF A;  1T5X D;  3I90 A;  3KLS A;  1V43 A;  2A74 C;  3VYR A;  4G7H C;  4CJ0 B;  5JJZ A;  2J0T D;  3D31 A;  1W6J A;  1D2B A;  1TWC B;  2BA1 A;  5G3L D;  5CR3 A;  1VDZ A;  3P75 A;  1D5X C;  4IFD G;  2PO4 A;  1D1K A;  2F0I A;  3HRZ C;  1B2T A;  1EFI D;  3C1F A;  2IX1 A;  4LJZ C;  1FD7 D;  2N55 A;  2L9H A;  4EVO A;  1RKN A;  2DY8 A;  2K03 A;  1B4O A;  3TZD A;  1JIC A;  3AB9 A;  3C1E A;  5ELE A;  2PZT A;  3X3M A;  2IW3 A;  1BCP F;  4X3K A;  5JVH 3;  4IUV A;  5IOC A;  1YNN D;  1JOK A;  2BDN A;  2JA6 B;  2K04 A;  5EPL A;  2EY1 A;  1IW7 C;  1W6K A;  5C4H A;  1HFN A;  2E2J B;  3W3A A;  1I50 B;  3QIA A;  2A69 D;  1WVL A;  4RHS A;  1AEX A;  2XRS D;  1FYC A;  4KHV A;  2KVM A;  1HRJ A;  4C3I G;  2BE5 C;  1OXU A;  5HUR A;  1PTO B;  3PUZ A;  3M3Y B;  2H4O A;  1Y1V B;  3Q24 A;  4DNR B;  3T56 B;  2F0L A;  3GQB A;  1SYB A;  1IHZ A;  4Y7N B;  3GTP B;  5FO8 B;  3RZO B;  4B9X A;  2AQ2 B;  3L9A X;  4HR7 B;  3MAQ A;  1C48 A;  2WV6 D;  1ZEQ X;  3NSW A;  2NVQ B;  3SK5 A;  2VXW A;  2B8G A;  4G4K A;  2WB1 B;  3MWY W;  1JQY D;  4IAL A;  5C5L A;  3A7A B;  1X3P A;  1ZXT A;  4FF1 A;  3H0G B;  2IT1 A;  1CQF A;  2A73 B;  2NVY B;  2R7Z B;  2JSO A;  3TBI B;  4QIW B;  3JAM L;  1KAB A;  1XX8 A;  4R9W A;  3PMF A;  3GTG B;  3BVZ A;  4X3S A;  2QEJ C;  1SNP A;  4F7X A;  3K59 A;  1WD1 A;  1QIL A;  4MHE A;  1EY5 A;  1R4P B;  2CW0 C;  3T53 B;  3T4A C;  3BDL A;  4KI0 A;  3M7N A;  3I73 A;  3KK7 A;  4KHZ A;  2QKI C;  3T51 B;  5C0X G;  4BA1 I;  3A8J E;  1NUC A;  1PFM A;  1VMP A;  2D62 A;  4HTH A;  1RTN A;  4B9W A;  4A3B B;  3GTK B;  1FNU A;  2EY6 A;  3K5M A;  1HTP A;  1STB A;  2QF7 A;  2KOL A;  5IT9 E;  3SDZ A;  1BBX C;  2SNS A;  4A3J B;  1X32 A;  4F87 A;  1I4G A;  2R92 B;  3GD7 A;  1CK1 A;  3MXU A;  4KMU C;  5D3I B;  1EY7 A;  1DCZ A;  3HEJ A;  2F0P A;  4DAY A;  2R3Z A;  4K5X A;  5KND A;  3RUZ A;  5CV5 A;  1Y8N B;  5T1G A;  5BN5 A;  2F0Q A;  2C9O A;  3K5O A;  1HA5 A;  2A6H D;  3S2H B;  4K2L A;  3QG1 A;  4OGQ C;  5EKL A;  3LWU A;  2JA8 B;  2KEC A;  1D5M C;  4FVM A;  5CV8 A;  1G6Z A;  5COY A;  3P1H A;  3NQT A;  3TN2 A;  3RMH A;  4C3J G;  1GUT A;  3EFX D;  2K7V A;  2L5T A;  1BF4 A;  1BUV T;  2F0U A;  2F4I A;  3IFD A;  1EIG A;  5FLX E;  3KBG A;  4K14 A;  1BQQ T;  5IGE A;  1VCI A;  3CRK C;  4KTA A;  4Q5V A;  2WAC A;  2CQA A;  4ZKB B;  1STG A;  4C3I B;  1EOT A;  1SE3 A;  1Q3L A;  3K5L A;  3D6C A;  1PFB A;  3HOZ B;  1J8I A;  4TQU S;  1CHP D;  3TSS A;  1K83 B;  5KIX A;  3VYS A;  1RHP A;  5DAU A;  2RKS A;  4ZK9 B;  4ZKC B;  2O5J C;  1JC7 A;  2K05 A;  2B8F A;  4RCO A;  2JEB I;  1S5B D;  2I46 A;  3GTM B;  4ZAI A;  4JBW A;  1I4H A;  1G8Z D;  5COR A;  4KD3 A;  1SXT A;  4IUN A;  2EYL A;  3Q6S A;  1B3A A;  4C3H G;  1V8Q A;  2F0G A;  1U4P A;  1XYI A;  1D6E C;  2N88 A;  3O13 A;  3S16 B;  2EYH A;  3A56 A;  4A3D B;  3VR6 A;  4HCS A;  5CGK A;  4FXD A;  3OMC A;  1PRT C;  3H6M A;  4G57 A;  1EY8 A;  1Y8P B;  2F0O A;  2LS0 1;  3MFY A;  2CVR A;  4B08 A;  5KYI A;  1OXX K;  3GTL B;  4A3E B;  2AQ1 B;  4BS9 A;  2EZV A;  2PMZ B;  1OO9 B;  1PTO D;  1SMY D;  2QCP X;  1EEI D;  2L0C A;  1H9M A;  2E74 C;  1F77 A;  2F1M A;  5E1F A;  2E75 C;  3VR2 A;  4ZLT F;  5M5Y B;  3K58 A;  1SFO B;  2C5C A;  1V1P B;  3E6Z X;  1Q8I A;  5KEE A;  1WTO A;  1NAP A;  2D5D A;  4C56 C;  2L1B A;  4RH6 A;  4DK1 A;  2EYJ A;  3ONA B;  1E2Z A;  5IGF A;  1SNM A;  2SNM A;  4DNT B;  2GA4 B;  3PO2 B;  2EYO A;  5I9P A;  1O7L A;  2K1B A;  3NUC A;  2PYK A;  5CBA E;  4EQP A;  5J39 A;  5JOB A;  5CYU A;  4IFD H;  3OWE B;  2LFN A;  1STE A;  2OT2 A;  3E0J A;  3HOW B;  3MTS A;  5DM6 3;  4O42 A;  2F3V A;  3FDT A;  1G91 A;  4A3K B;  1S5E D;  1Y1W B;  5DM7 3;  1QNK A;  4L63 B;  1DJR D;  3U9S A;  4BBR B;  1CA6 A;  4DAV A;  2TMP A;  3I8Z A;  1O7Y A;  1SBB B;  5D14 A;  5JAV A;  3PUW A;  3GP7 A;  3OHX C;  4X3T A;  1SYG A;  4PQX A;  2FMC A;  1XTC D;  4XTC S;  3MXN A;  4JK1 C;  1QWY A;  1WTQ A;  1L0Y B;  3Q22 A;  1ENF A;  1TS3 A;  3MEH A;  3QOL A;  2M9V A;  1STA A;  3SK4 A;  4C3J B;  5EQ0 A;  3MC0 B;  1F2Y A;  5T1I A;  1SND A;  5IGC A;  5FO7 B;  1SYF A;  1AZP A;  3J80 E;  3F2U A;  1ML0 D;  3OIP A;  5M3F B;  2XVS A;  2F0S A;  1U4M A;  2RSO A;  4ODG A;  4IQZ A;  1QOH A;  3VYU A;  2QIL A;  2KCC A;  1SYE A;  3ZYY X;  2VB3 X;  4IUQ A;  3T16 A;  1BXT A;  1JOO A;  2RBM A;  3GV6 A;  4QMG A;  2PCF B;  2V4D A;  2PNR C;  1TQO A;  1Z6H A;  2MPM A;  1PRT B;  2EJF C;  1IW7 D;  5CV7 A;  2AUJ D;  5LL6 S;  5IOD A;  3PV0 A;  4H13 C;  1ICW A;  3OMG A;  1UAP A;  2F0W A;  3M4O B;  2BE5 D;  1XXG A;  1PZI D;  2NN6 G;  1EZ6 A;  4C1N I;  1CM9 A;  4Z9C B;  4CJ2 C;  3QJY A;  1R4Q B;  4NKL A;  2EVB A;  2MGS A;  3I70 A;  2HQE A;  5NUC A;  2X6L A;  4KY6 A;  4IFD J;  4M8A A;  5ELD A;  1KNE A;  3MXG A;  5DNF A;  5C0X H;  1QNU A;  3IKJ A;  1SE2 A;  4KY7 A;  3T13 A;  1SNQ A;  2F03 A;  3J7A F;  4IUP A;  2O5I C;  3FKI B;  1OXS C;  1LLR D;  1U4R A;  2B2V C;  3V96 A;  1SNO A;  4A3M B;  1BO0 A;  3S1R B;  2E2D C;  1KLG D;  5C4Z A;  4BY1 B;  4YIJ A;  3D8G A;  1ENC A;  3S15 B;  2DY7 A;  2KA7 A;  1I4P A;  5KNC A;  1K8M A;  4RGM A;  5IT9 L;  1JR0 D;  4V0B A;  2XN9 C;  4A3G B;  2CW0 D;  3I3C A;  2B2T C;  3TP8 A;  3MFG A;  3DUZ A;  2RSN A;  4M1U B;  2EY2 A;  1WTR A;  4K5W A;  2D9U A;  2D2C C;  2NTT A;  4K8I A;  1GOZ A;  1V1P A;  2F0D A;  3ND8 A;  3BG3 A;  2O4X A;  2F0F A;  3KLR A;  1LO5 D;  1EU4 A;  1SAP A;  3EA6 A;  2ZXO A;  3G7L A;  5JEA G;  4QF4 A;  3S1Q B;  3MZ5 A;  1PDQ A;  1I6V C;  1HHV A;  2RQX A;  4FF4 A;  4NW2 A;  3FRP B;  1NCV A;  4KY5 A;  3GTQ B;  1TU2 B;  2MUY A;  5EBC A;  1S5D D;  4KKU A;  5M5W B;  1D1I A;  5I6Y A;  2HUG A;  2K5D A;  3C2P A;  3NBH A;  4ILW A;  5FLX L;  5TSS A;  1SJE D;  5M9O A;  3H94 A;  3I4L A;  2JYO A;  4RGN A;  3V2T A;  4HCE A;  3FEW X;  3CKI B;  2PZW A;  3LX0 A;  5C0X J;  1CA5 A;  2RA4 A;  3LNN A;  5FKA C;  2B2U C;  3VA7 A;  1B9N A;  2WAQ B;  3ND9 A;  3R3O A;  3TDQ A;  2EE1 A;  1EWC A;  1PLF A;  1HUN A;  2RDH A;  1GUW A;  4ABN A;  2WKD A;  5EJW A;  1EY6 A;  3Q23 A;  2G9H D;  1B1Z A;  1ET6 A;  1UEA B;  2SDF A;  2Q8I B;  1B9M A;  2Q8R E;  1ESF A;  1LAB A;  5I2Y A;  3AMU A;  4QUC A;  4LMQ D;  1Q12 A;  2ZXP A;  4GZY C;  1EL0 A;  3HG9 A;  2EYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...