4R4CA

Structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4cA00
2WAQG 1OXUA 3H3VI 1KD1C 1IBMQ 1XPUA 2XGTA 2E2IH 3S16H 1VS0A 3K8AA 1OXTA 2VQEL 3M7NA 1B7YB 3GTPH 1FVIA 5FLXc 1UE7A 3M9BA 3PF4A 3ZJYC 4C3JH 5AJ3L 3PCOB 2VQFQ 1O7IA 1VQFA 1Y1VH 1YNXA 5LMUQ 4IJLA 4JV5L 2NVXH 4IPCA 4YWLA 3J81j 2E2HH 1PYBA 2Z6KC 3CP0A 4YCWA 3AYHB 1YJNA 4A76A 3CCSA 2K75A 5IYCH 2JA6G 3U4VA 4JI2L 3GTJH 4DV0Q 4LUOA 4YWMA 3CAMA 1Q12A 4YWKA 4XIGS 2CKZB 3J81c 4DR5Q 2EXDA 3HKSA 4UP9A 1CKOA 2Q2TA 1KL9A 2GVBA 3CW2C 3A74A 3TS0A 4YCVA 4X64L 4JI5Q 4LWCA 4LFAQ 2JA8H 3RLOA 3ICEA 2WFWA 4DV1Q 3S15H 4LFBQ 1D7QA 4DUZQ 1GVPA 2R6GA 3F2BA 4DV2L 1G6PA 2ZJPA 4AQYQ 3BU2A 1TWCH 1T9HA 4L5QA 4X62Q 1YEZA 1DGSA 5LMNQ 4BBRH 1N33Q 2IX1A 1HR0W 3L0OA 4B3SL 3NELA 4RMFA 1YJWA 3U58A 1L2FA 1HNZQ 2K52A 5J3BA 3S1MH 2NZOA 5M3FH 2B63H 1K9MC 3M85A 4LF6Q 1E1OA 2MO0A 4OXPA 1CUKA 3CF5A 3T1YL 1FJGL 3GTKH 4GKJQ 1PH2A 1SROA 1Q86C 4P72A 4LF5L 4YHHQ 1I5FA 4GS3A 5M3MG 1TWFH 5BR8Q 4BY7G 2VS1A 2YTVA 4DV4Q 1EQQA 3D0FA 2R92H 1PV4A 1KIXA 3FP9A 5M5YH 4PZ7A 3I4MH 1X56A 2HIVA 1A8VA 2JA7G 3EBEA 3EN2A 2LSSA 3KF6A 1HNWQ 2Q2UA 1SMXA 5IP9H 1NMGA 3PIOA 1Y14B 3F2CA 1HZCA 1EQRA 3L2PA 4IFDG 1N32Q 2K5NA 4POFA 4DR2Q 3KOJA 5GAHC 4LF7L 4OO1G 1ASZA 3HOXG 3SGIA 3ERSX 1VQ4A 4MNOA 4LFCQ 3WWVA 3PUZA 2VNUD 4A3EG 1I3QH 4DKAC 4A3DG 4JI6L 1KRTA 3E9IA 4QL5A 5GAEC 3RZDH 4TQUS 1U5KA 1AH9A 1XMQL 2ZJQA 3S14H 5IE8A 2BA0A 1HNXQ 3TREA 4DK3C 3I55A 3S1RH 2ATWA 2UXCL 2CWPA 2C35B 3ER0A 2CFMA 4UP8A 1VQPA 2ES2A 1YHAA 4JI0Q 3W1GA 1JT8A 2NZHA 2R7ZH 4UP7A 4DR4Q 2IT1A 2DGYA 4JI1L 5IYBG 2AKWB 1VQCA 3S2DH 1V43A 1X55A 2UU9Q 4LF4Q 2I5LX 3MXNB 4LW1A 3U50C 3TEHB 2JA6H 4GKKQ 3HOZG 1UE1A 1SE8A 4DV3L 3PV0A 4TVAB 4A3JG 2BA1A 5C4JH 5K36G 1B70B 1Q1EA 2YU9H 1NTGA 1N36L 4EQ5A 2GVAA 2VUMG 1X3EA 3GO5A 1M90C 1VQ9A 1JJGA 4DK6C 5M5XH 1RL2A 1KC8C 1VQ7A 1KAWA 2AMCB 1J6QA 2PMZE 4ME3A 4DR3L 3L7ZC 1K8GA 3E9HA 4A3IG 4BY1G 1QVFA 4GLVB 4A3BG 3HOYG 3KLWA 3S1NH 4DAMA 4PMWA 1IBLQ 5LMNW 3K7AH 1ASYA 3PGZA 1D8LA 2NN6I 3OTOL 1HZ9A 2HQLA 2ZJRA 1Y1WG 3UE0A 1JJ2A 4OX9Q 2F4VQ 3A5ZB 3TRZA 3ULPA 1Z9FA 4DR6Q 3NEMA 1S40A 4NXNQ 1X6OA 4A3GH 2K5VA 3RN5A 4UY8C 4GLAC 3S17H 1WYDA 4IO9A 1W3SA 1PH1A 2UUBL 4DR7L 5JJLA 3T1HL 4X66Q 4IPDA 4A3CG 2YTYA 3CCUA 1I94L 2NVYH 2OWOA 3B6YA 5M3MH 3UDGA 1SLJA 4DV5Q 4HIMA 2HHHQ 1Q8KA 4B3RQ 1LM0A 3PUWA 2YYZA 1IBKL 2JA7H 1TWGH 1OTCA 4JI4Q 4GNXA 5HY6A 3STBC 4HIKA 4A3FG 3CQZH 4X65L 3RN2A 1A62A 2UXDL 3J7A5 1K0RA 1QUQA 4LF8Q 3RZOH 2NVTH 4QY7A 1YHBA 3HOWH 3GTOH 2PQAA 4LUZA 4R4QA 1VQEA 5GROA 3CCRA 2UUCQ 1SFOH 4YY3Q 1X65A 3HOXH 3I4NG 2KBNA 3KFUA 1PH3A 1MJCA 5GQOA 4HJ8A 4A3EH 1BKBA 3MEFA 4A3DH 1PVOA 2UXBQ 5C0XG 4NB3A 4FDBA 5IWAQ 4R1JA 4GNXB 4A3LG 3RLFA 1EIFA 2Y0SE 4UPAA 4R4IA 1VQLA 1XMOQ 1RIPA 2ZM6L 4J15A 4B3ML 4GN5A 4JI7Q 3H0GH 3KDFA 1XJVA 1YVCA 2QA4A 3UDIA 4DUYL 1P16A 1N9WA 3KYHC 3A5UA 3KJOA 2NVQH 1E3PA 2VQEQ 5IYBH 3J7ZC 4IOAA 4A3MG 2RCNA 1KHIA 5IY0A 2VW9A 4DV6L 1JJCB 3CD6A 3D31A 1VQOA 3KF8B 4A93G 3Q8DA 5AJ3Q 1VQAA 1SN8A 2VL6A 2ZTEA 3HOZH 1EUJA 3GDEA 4EX5A 1VQGA 2H5XA 4A3JH 4JV5Q 4JBWA 4LF9L 5JJKA 4GOPA 4JI3L 4GNXC 2CQOA 2EIFA 1J5EL 4JCVE 1VQKA 5E7NA 2IHEA 3E0EA 2MO1A 4HIOA 3DM3A 1JMCA 4IFDI 4APVA 2PNHA 1HZAA 1CKMA 2A1AA 4NPSA 4R4TA 3JAMc 2MNAA 4NXML 4BA2I 4OO1I 3HKZE 4IOCA 2K14A 3AQQA 1GD7A 1BBUA 1NE3A 4A3IH 4IPHA 4BY1H 5GADC 4DV7L 4WJ3M 3CMAA 4A3BH 2ASBA 3HOYH 4K0KL 4DR1L 1E7ZA 5IT9c 2Y0SG 1K3RA 4IJHA 5C0XJ 4MTNA 4Y52H 4X64Q 1KRSA 1S3OA 4AIMA 1NBWA 2K5HA 3AEVA 4OWTB 1Z47A 1Y1WH 4B3TL 4KLKA 3J80i 4ALPA 2F3IA 4O0AA 2QGQA 4JBMA 4DV2Q 2OQ0A 4A3KH 3U4ZA 1N8RC 3S1QH 4JI8L 2N8NA 1WCMG 2UUAL 3KF6B 1HR0L 1I6HH 4RG1A 2Q2HA 3CCLA 5ELNA 3GTMH 2I5MX 3RR5A 4B3SQ 4A3CH 1KQSA 1E24A 4DR6L 3I4OA 3PUYA 2E5LL 1QZHA 1XNRL 2KCMA 1PH6A 4JYAL 4IPGA 1K83H 1L1OA 2JJQA 1FJGQ 3T1YQ 3J81i 1L0WA 5M5WH 2OCEA 4GN4B 4LF5Q 1JB7A 1UWVA 3K81C 2N78A 3FKIG 1PH5A 4P75A 3F1ZA 1PH8A 1N34L 3A0JA 3CXCA 1VQ5A 1TWHH 3I4NH 3IRBA 1YIJA 2KHIA 2ID0A 4AH6A 4XTCS 2IHFA 2KHJA 1MIUA 4KHPL 1XNQL 2HIXA 1HH2P 1WOCA 4LNQA 4YCUA 1YHQA 1K73C 3H3VH 5DLQE 1IBML 4LF7Q 4BBSG 4A4IA 4A3LH 1LTLA 1LYLA 1Q7YC 3CCVA 1XTDA 1R9TH 4JC0A 3PO3G 3TQYA 3RNUA 4JI6Q 4OWWB 2A8VA 3CC4A 3GTLH 2VQFL 2LXKA 1UE6A 5M3FG 3H15A 1XMQQ 4POGA 4C3HH 2D62A 1QVCA 2OTLA 3M3YH 2RHQB 5LMUL 2UXCQ 4A3MH 1CKNA 1C9OA 3F2DA 1VQ8A 3G48A 3I2ZA 4PG3A 3G4SA 1LUZA 3EIVA 1OXSC 3HOUG 2MQHA 5ELOA 1QVGA 1P8LA 3K7UC 4QIWE 2R92G 1L1OC 4DV0L 4A3KG 3M4PA 4JI1Q 3I4MG 2R93G 5JEAG 5FJ8G 4DR5L 1SR3A 3CCQA 4A75A 5C4XG 1VQDA 4BY7H 2OQKA 4JG2A 1SRUA 3BZCA 1YZ6A 4P71A 5IP9G 4DV3Q 2E2JH 2R93H 1IL2A 4JI5L 4LFAL 2F52A 1VQMA 1N36Q 2VZAA 1YI2A 4DV1L 4LFBL 2N49A 4DUZL 3FHWA 1A63A 1YBYA 2JK8A 1V9PA 3GD7A 2ZTDA 4AQYL 2ALYB 4DR3Q 1XPRA 3K0XA 4LUVA 4X62L 3ULLA 3J80c 3PUVA 2NN6G 1MJEA 2BH8A 1XPOA 1GKHA 5LMNL 3PSIA 5FLMG 1N33L 3M4QA 2YTXA 3PF5A 3I56A 4BXXG 5C44G 1HNZL 4JBJA 1Q46A 3OTOQ 1WCMH 2R7ZG 2YV5A 1VQNA 4P74A 4R4CA 2IY5B 3M4OH 4LF6L 1H95A 1QUQB 3HOVG 1VQBA 1CSQA 3G71A 2E8GA 2D0OA 3CC2A 2MFIA 4GKJL 1OXVA 1BBWA 2PQAB 2KCTA 1FL0A 1I50H 1IZ6A 4YHHL 5BR8L 2EQSA 2JE6I 4DV4L 4L5RC 1AE2A 2AWNA 5JEAJ 4HJAA 4HJ9A 2UUBQ 1FGUA 4QJFA 3PIPA 4HJ7A 3T1HQ 4DR7Q 1C0AA 4L5SA 4A3GG 3ULJA 2I0QA 1I94Q 2R7FA 3FKIH 2PI2A 3PO2G 2RHSB 1HNWL 1TWAH 4P73A 3PUXA 1EFWA 1IBKQ 3KDFB 2VY3A 5IYDG 4DR2L 1N32L 2R7DA 2VUMH 1C7YA 1IXRA 1NMFA 3UDFA 4WJ4A 4X65Q 2UXDQ 4LFCL 4HJ5A 4QQBX 1QZGA 4JI2Q 2WB1E 1PHJA 5IP7G 3CCJA 1GO3E 4BBSH 1PYSB 5C3EG 4HIDA 1B8AA 3W5OA 3JC66 1EWIA 4AYBE 1WI5A 1HNXL 2JA5G 3PO3H 2KENA 4GOPB 3LGJA 5JJIA 2IX0A 1OXXK 2ZTCA 1YITA 4JI0L 3GTGH 2JQOA 4DR4L 2A19A 1PA6A 2CWAA 1WFQA 1X3GA 3NBHB 2ZM6Q 4B3MQ 4PZ6A 3RLNA 1HJPA 2UU9L 4LF4L 4DUYQ 1PFSA 2B3GA 2FXQA 4DAYB 5HGQA 3HOUH 5GAGC 1Y1VG 3DLLA 4GLXA 4GKKL 1JE5A 2L15A 3NENA 2JA9A 2JEAI 5EAYA 5FJ8H 4DV6Q 1VQIA 1EIYB 3K80C 2BH2A 4MZ9A 1IYJB 1PH4A 2AHOB 4JOIA 1UE5A 2WP8J 5C4XH 3CCMA 1YJ9A 1EYGA 1KXLA 4KI0A 5IYCG 1X54A 4BA1I 1M1KC 3VDYA 4LF9Q 3HOWG 1U0LA 4PZ8A 4GOPC 4JI3Q 2N3SA 1VQJA 1E1TA 2AWOA 2WB1G 3S24A 3AFPA 1MKHA 1J5EQ 3HKZG 4A3FH 2LXJA 4X6AH 3G6EA 4AYBG 4DNIA 1BVSA 3CMEA 1IBLL 4NXMQ 2JA8G 2I5HA 1X3FA 2K4KA 3S2HH 4H02A 1S72A 1X9NA 1K8AC 1Q81C 4BXXH 4R4OA 3W1BA 2OTJA 4DV7Q 3CC7A 1GM5A 4C2MH 4K0KQ 1PH7A 4DR1Q 4OX9L 2F4VL 2JEBI 5FLMH 3TS2A 1L1OB 4OONA 3H0GG 3KJPA 1E22A 4L5TA 5C44H 3BZKA 3HFZB 2RF4A 4NXNL 1Q82C 4JBKA 3CPWA 2GN5A 4B3TQ 3HOVH 1VQ6A 2WAQE 4BBRG 1VCIA 4X66L 3OW2A 4JI8Q 2CCZA 2K50A 2UUAQ 1A0IA 2B63G 4DV5L 3GTQH 1HR0Q 2HHHL 3BJUA 3PO2H 3CPFA 3CCEA 4B3RL 2Z0SA 4QGUA 4O2DA 1EOVA 3OYYA 3F8TA 1PH9A 2Z6KA 4JI4L 1V1QA 2PI2E 4GN3B 4JOIC 2DUDA 2E5LQ 4A93H 1XNRQ 2XTIA 4IFDJ 4KHZA 4JYAQ 3I7FA 4LF8L 4Y7NH 2D0PA 3JAMi 1CSPA 5IYDH 1Q1BA 1UEBA 3UDXA 2UUCL 1AE3A 2QEXA 3UE1A 4YY3L 1WJJA 1VQHA 2Q2IA 4C3IH 2V1CC 2B29A 1NY4A 1HZBA 4DPGA 1NJIC 1CKNB 5IP7H 4OWXB 1N34Q 2UXBL 1W2BA 3AFQA 5IWAL 2HT1A 1TXYA 3STBD 5C3EH 5H1SE 1G291 1XMOL 2JA5H 4KHPQ 1XNQQ 1G51A 4JI7L 5C0XI
chains in the Genus database with same CATH superfamily
2MP1A 2LY7A 1IBMQ 1B4OA 3DM1A 5ELDA 4L8JA 3K8AA 2B63B 2PW7A 3K0YA 3M9BA 2E74C 3ZJYC 5AJ3L 1O7IA 3MVVA 1EL0A 4IPCA 3NXWA 4ZK9B 1B3QA 2Z6KC 1B9NA 1SYDA 2NTSA 4DGZA 4BY1B 4DFAA 2K75A 4YWMA 4YWKA 3J81c 2K28A 2EXDA 3MFYA 5ELFA 4F87A 2Q2TA 4K5XA 4IALA 4UDUC 1EY8A 3J80E 3NHHA 4DV1Q 4LFBQ 4ID6A 4KY7A 4MTKA 4ZRZA 2B2UC 1I6HB 3OPOA 4DV2L 4N9TA 5I9PA 2N88A 4X62Q 1YEZA 2F1MA 4KMUC 4KTAA 2I46A 1LT4D 3NELA 1WD0A 4L6TB 2FFKB 2NZOA 1V1PA 1CUKA 3T1YL 1L0YB 4XQQA 3ND8A 3I4NB 1TWFH 4F88A 2R93G 3I4MH 1QNUA 4RHRA 4XT3B 1HNWQ 2Q2UA 1FYCA 1KTKA 2A69C 2F4IA 4RGMA 1QCBD 2F0LA 1NMGA 5CV8A 5G3LF 1HZCA 1EQRA 4K6LA 2K5NA 4B9XA 4POFA 5GAHC 4LF7L 2VNUD 4A3EG 1H9SB 3RZDH 5JAVA 3PIP3 2EYHA 1AN8A 3I55A 4DK3C 5ELCA 5JPNC 1CQVA 2CFMA 1YNJC 4JI0Q 1KLGD 1JT8A 2NZHA 2PQEA 4UP7A 4DR4Q 1O7ZA 4JVZA 4HEDA 1V43A 4LF4Q 1XYIA 3I72A 1LTTD 3QG1A 3K6OA 1CFMA 1UE1A 4DV3L 2BA1A 4PMCA 3O13A 1NTGA 1N36L 5I2XA 2GVAA 2LKVA 1VQ9A 3QR8A 5ISRA 2XWBB 1UEAB 4DNRB 1KAWA 2PMZE 4ME3A 1CI3M 3BZDB 4O1NA 3E9HA 3OHXC 3P1HA 4A3IG 1SNDA 1QOHA 4A3BG 3K58A 2K5WA 3S1NH 2PCFB 4PMWA 2RSNA 3K7AH 1MI2A 1O7LA 2B2VC 1D8LA 2K5QA 1HZ9A 4QB4A 2ZJRA 1STYA 1H9RA 1STHA 1JJ2A 4ODGA 1B9MA 4OX9Q 3TRZA 3ULPA 3NEMA 1K8MA 1AEXA 4K6DA 5IGEA 3I70A 4UY8C 1H9KA 4B08A 1WYDA 2B2WA 1PH1A 5A2QE 1TWAB 1CA6A 2UUBL 4XT1B 5JJLA 4X66Q 2D2CC 3J81L 1SLJA 4DV5Q 1Q8KA 4L63B 3DMUA 4JI4Q 4GNXA 3STBC 4X65L 2UXDL 1LTGD 3Q6SA 2NVTH 3PO3B 1JC7A 3C46A 1MSHA 4R4QA 1VQEA 3KFUA 2RDGA 3E0JA 1MHWC 2ICEC 1PH3A 2FJ2A 1ONLA 5C3WA 4A3EH 1GHJA 1IYVA 4R1JA 1EIFA 3HOUB 1EU4A 2Y0SE 1KLUD 1T5EA 1T5XD 2F03A 4J15A 2CQAA 1YVCA 1ENCA 1BBXC 3UDIA 1M8AA 5I4DA 3KYHC 1FR3A 4DUYL 3A8JE 4ILWA 4DF7A 3BG3A 3CU7A 3K59A 2VW9A 1JJCB 3D6WA 3D31A 4QCLA 5FOBB 1U9RA 2ICIA 5E4WC 2ZTEA 4GZYC 1VQGA 4LF9L 4RGTA 1G2SA 1WTRA 2F3VA 2EIFA 1J5EL 1JMCA 1LLRD 1E2WA 3DM3A 2J0TD 2PNHA 3NBHA 4NPSA 4OO1I 1BR9A 3KBXA 4R4TA 1EY7A 1PXUA 3JAMc 1GD7A 1TT2A 4A3IH 1Y69U 5GADC 4A3BH 1U4PA 1V1PB 5J22A 4G7OC 4MTNA 4QIWB 4X64Q 1KRSA 4IUPA 2R3ZA 5KIXA 2K5HA 4B3TL 2AQ3B 1SDFA 4O0AA 3GTQB 2QGQA 1F9SA 3S1QH 4ZQ3A 2QDLA 1WCMG 1HR0L 1S4ZA 5ELNA 3RR5A 3TZDA 2F0HA 1TS4A 5FO7B 5LL6S 4DR6L 1VMPA 1QZHA 3VA7A 1XNRL 1DXMA 4IPGA 4C3IB 2XSCA 4FXGC 4IUUA 1FJGQ 1GUWA 4S3SA 4BS9A 5IGCA 3J81i 5M5WH 4GN4B 2O5JC 3FKIG 1PH5A 3MFGA 2Y0SB 5KEEA 1RTNA 3QOLA 4AH6A 3VR4A 1L0XB 1D5ZC 1PTOH 4YCUA 4KK7A 3H3VH 5DLQE 1GUGA 1QG7A 4DA2A 1LTLA 2VB3X 1GUTA 3TP8A 3CCVA 4ULLA 1XTDA 1KDCA 3I90A 3TQYA 4OWWB 5HURA 1G6ZA 4DXGA 5M3FG 1S5DD 2G9HD 5LMUL 2UXCQ 1CKNA 3AB9A 2LFNA 3I2ZA 1O7YA 1WTQA 3K7UC 3LWUA 4KY5A 2H4OA 5EPJA 4DR5L 5ELEA 1SR3A 4BY7H 2OQKA 4JG2A 2M2LA 1SRUA 4JI5L 2F52A 1VQMA 4K5VA 4CDFC 4BBSB 4DUZL 2ZTDA 3R8BA 1FD7D 3ULLA 3K5MA 3Q0AA 1WTHA 2BH8A 1MJEA 1TKWB 5FLMG 3I4LA 1S5ED 4C1NK 1HNZL 1Q46A 2Z6BA 1VF7A 1WCMH 2R7ZG 3M4OH 1TWFB 4CKCA 1VQBA 1M4VA 3I4MB 1IZ6A 2JE6I 4DV4L 4DR7Q 1FGUA 3EJIA 4QJFA 1C0AA 4HTHA 3JAML 5BN5A 1WTWA 3A7AB 3FKIH 4ZUJA 2PZUA 1PZKD 1IBKQ 3X3NA 2VY3A 4DR2L 3RZDB 1C7YA 3S2HB 1NMFA 3UDFA 3KUPA 3HZXA 2BCOA 1PDQA 1EY6A 1RCVD 3I8ZA 1MGSA 3K5NA 4G7ZC 1BCPB 2FMCA 1PYSB 5C44B 4KD3A 3CKIB 3MXPA 4HIDA 1B8AA 4AYBE 3WDNA 2KENA 5JJIA 1YITA 3NE5B 4ABNA 3MAQA 4Q5VA 1ENFA 2A19A 2BDOA 1PA6A 1X3GA 2EYFA 1D6EC 3NBHB 1C8CA 4K8IA 3E3XA 1PFSA 3DWAA 4A3GB 3DLLA 1Q3LA 1Y1VG 3QB3A 1JE5A 2X69A 1K0SA 3TDQA 2JEAI 4DV6Q 2BH2A 4FF3A 2FINB 1YNJD 4MZ9A 1UE5A 1GUNA 4G57A 5IYCG 5KNCA 3HOWG 3S1NB 1U0LA 4GOPC 1ICFB 1GXDC 1VQJA 3K7AB 3SR1A 2WB1G 5TSSA 2K5DA 4H44C 3HKZG 2SOBA 2JP1A 1XTCD 3S9WA 2JA5B 1QNKA 4NXMQ 1X9NA 1S72A 2MHVA 1Q81C 3MXNA 3W1BA 4C2MH 4K0KQ 1PH7A 2E2IB 2JEBI 5FLMH 1AFPA 5T1GA 2RVLA 3CPWA 2EYOA 4X3SA 2WAQE 1PZJD 2CCZA 1BF4A 4OIKA 4B3RL 3CCEA 2NVTB 4NKLA 3IAYA 4A93H 4GN3B 1W6KA 2DUDA 2MPMA 3HEJA 1SNQA 4XQJA 4A3EB 1DJRD 4QF4A 4AYBB 3JAMi 2HD3A 5EQ0A 1JOQA 2B29A 2BOSA 1NY4A 4DU9A 3ONAB 4DPGA 1CKNB 5JPMC 2K6AA 3AFQA 1TXYA 3STBD 3R2IA 5H1SE 1XNQQ 1G51A 4A3KG 3H3VI 1NUCA 1G91A 1O78A 4FYDA 3NP8A 1VS0A 1F2LA 1RDPD 3L9AX 1SMYC 5FLXc 2VQFQ 1Y1VH 1YNXA 4IJLA 2MGSA 3OOCA 2NVXH 4YWLA 1SNPA 3J81j 5EKKA 2E2HH 1PYBA 2O2LD 3CP0A 4A3IB 1AP0A 3EQLC 5IYCH 4A3BB 1B44D 1Y8PB 1MSGA 2CKZB 5KYLA 4ZKCB 1CKOA 2EXZA 3TS0A 4YCVA 2A5HA 1EIGA 4LWCA 4O42A 4LFAQ 3S1QB 2WAQB 2PPBC 5DM73 3OIPA 1GVPA 1STAA 2DJFC 1TWCH 3NTIA 4KKSA 1ILQA 2KCCA 1YJWA 3U58A 1L2FA 4FVMA 5M5WB 1MD2D 1V8QA 4RAUC 1CHPD 5L37A 2MO0A 1EY9A 3J81E 3GTKH 1Q86C 4LF5L 3TMEA 1U4RA 5M3MG 1CQFA 2YTVA 2R92H 1FNVA 1PTOB 3EBEA 3EN2A 2LSSA 2QCPX 5EBDA 5IP9H 3PIOA 4CKEA 3F2CA 2B8FA 4HSPA 1N32Q 4OO1G 3KOJA 1EEFD 1ASZA 1VQ4A 3PUZA 1SEBD 4I7AA 4A3DG 3C3LA 3E9IA 1EYCA 1A3UA 4TQUS 1U5KA 1AH9A 1XMQL 1PRTB 3S1RH 3ER0A 1SXTA 4UP8A 1VQPA 3NWTA 1YHAA 2KVMA 1UNSA 4BY7B 4NW2A 2IT1A 5CGKA 5FK9C 1VQCA 4FXKC 2I5LX 5AFWA 3MXNB 3U50C 3D4WA 4GKKQ 3HOZG 4KKTA 1SE8A 4TVAB 4KN7C 1B70B 2VUMG 1X3EA 1JJGA 5M5XH 3HOXB 1RL2A 2F0TA 2M9VA 1JORA 1J6QA 1DOLA 4IN3A 3L7ZC 3M4YA 1WCMB 2SNMA 3LWEA 5COYA 4GLVB 1QVFA 4HSVA 3M4OB 3SK8A 4DAMA 3OMGA 5LMNW 1ASYA 3OTOL 3UE0A 3VR2A 2KA7A 3E6ZX 4HAEA 1TY0A 3RN5A 2F0FA 2VXWA 4GLAC 3S17H 3FKIB 3MZ5A 1J8IA 2L1BA 2CW0C 4NP5A 5IGDA 4A3JB 3DWQA 3HS0C 4IPDA 2P5ZX 1I94L 3B6YA 5M3MH 3UDGA 1STNA 4HIMA 3GV3A 1LM0A 2YYZA 1NR2A 1TWGH 1IL8A 3DEOA 5HY6A 4A3FG 2A6HC 4QY7A 5JVG3 1YHBA 3R93A 1H9MA 4OO1H 2UUCQ 5D3DA 2KBNA 1MJCA 3PMFA 4HJ8A 2DNEA 3MEFA 4A3DH 1PVOA 5IWAQ 3FMCA 3RLFA 1WTOA 3URYA 1GJXA 3C1FA 2ZM6L 3MTSA 2NVQH 4OELB 4C3HG 2B2WC 2DY7A 2VQEQ 4H7BA 1FNUA 1C4QA 3CD6A 1LT3D 3G7LA 1VQAA 2VL6A 3A55A 3HOZH 1EUJA 3BDCA 1ML0D 4JV5Q 4JBWA 2RDFA 1AZPA 4GNXC 1EYDA 1VQKA 2MO1A 4LMQD 2A1AA 2MNAA 5E1FA 3HKZE 1KNEA 1BBUA 3CMAA 5J1ZA 1ESFA 2ASBA 3U9OA 1NR4A 4H0LC 1Z47A 4KLKA 2X6LA 3P7JA 3M3YB 4CHTB 4JI8L 3V05A 3FDTA 4RGOS 4A93B 4X3KA 2Z4HA 2UUAL 3E5SA 3CCLA 3GTMH 2I5MX 4B3SQ 1A2TA 3PUYA 1K83H 3JAME 4CBVA 1L1OA 2ZXPA 3EA6A 4NDXA 2OT2A 1UWVA 4CDEC 3F1ZA 1N34L 4G7HC 1VQ5A 2EE1A 1I4RA 1TWHH 1YIJA 2KHIA 2CH4A 2IHFA 3EFXD 1HRJA 1WOCA 3SK5A 1XX8A 1YHQA 2K32A 4JK1C 3VYTA 3H09A 1IBML 3A8IE 1Y1VB 2HDLA 4CDCC 1EIHA 3IFTA 4JI6Q 1Z6HA 3GTLH 2E2HB 1TU2B 3G6JB 4CGYB 1I50B 4C3HH 5CBEE 4MIUA 5DAUA 3G48A 4PG3A 5T1IA 3G4SA 4FXDA 2WB1B 2C9OA 4C56C 3EIVA 1OXSC 3MEHA 3HKZB 4QIWE 3OWEB 4G4KA 4JI1Q 4ME5A 1SMYD 1F9QA 5C4XG 4OIJA 1YZ6A 2E2JH 2R93H 1SE3A 2A68C 1SYEA 1TWCB 4DV1L 4CJ2C 4LFBL 2JK8A 1SYBA 4KY6A 4DR3Q 2F0MA 4X62L 3J80c 3NTHA 3WOEA 1BQQT 2ZT9C 3D4RA 3H94A 3M4QA 5IGGA 1RJTA 3I56A 3GTKB 3C2PA 2WV6D 3H91A 1TQOA 2Z1CA 2R92B 2E8GA 1HTLD 2D0OA 2F0KA 2AQ1B 3A54A 3QIAA 4WJWA 2KCTA 2PZTA 2RDHA 3A56A 4L5RC 3PO2G 4HJAA 4HJ9A 3T1HQ 4EQNA 4L5SA 3DHQA 1HNWL 2RHSB 4XYQA 1SAPA 1AZQA 3TP7A 1NSNS 3PUXA 1I4XA 1GHKA 1HHVA 2R7DA 1IXRA 4WJ4A 2F0VA 2RCFA 4XQNA 3GP7A 4HJ5A 3S1RB 1QZGA 4CKBA 3SK6A 3CCJA 4J1MA 1HPCA 1EWIA 1VF5C 3LGJA 3BVZA 1OXXK 2ZTCA 4JI0L 2JQOA 4KD4A 4Z9CB 4DR4L 2CWAA 4B3MQ 3NK9A 3RLNA 4LF4L 5HGQA 1B2TA 3NUCA 1EY0A 2EYLA 5M5XB 4LK1C 3NENA 1EQTA 3VYRA 2JA9A 2KECA 1W6JA 4M1UB 3FPUB 4FF2A 3CCMA 5C4XH 2WP8J 3P20A 4KI0A 1X54A 1M1KC 1D5MC 4PZ8A 1II3A 4JI3Q 1ENAA 1MKHA 4IUVA 2QILA 5C3EB 5IT9E 3G6EA 1EZ6A 4DNIA 1R4QB 1BVSA 1JICA 2JA8G 4H02A 4DV7Q 5IGBA 1GM5A 3S17B 4DR1Q 4OX9L 1L1OB 1F9RA 4OONA 3H0GG 3KJPA 4L5TA 1B50A 4JBKA 2GN5A 5KGUA 1LTID 5M3MB 3MHBA 4BBRG 4X66L 3OW2A 1IKLA 2VB2X 1TWGB 5IGFA 1A0IA 2B63G 4DV5L 3PO2H 2Z0SA 3NTKA 4JI4L 2TSSA 1V1QA 1BO0A 5EKIA 2E5LQ 1PRTC 4IFDJ 4KHZA 4JYAQ 3I7FA 4Y7NH 2CW0D 2L5TA 2D0PA 3OW7A 1TS5A 1D1KA 1Q1BA 1UEBA 4A3DB 1AE3A 3UE1A 4QUCA 3J80L 3J7AV 1FGBD 1DM0B 1W2BA 1ET9A 4WFN3 2HT1A 2NVQB 3MWYW 4EQOA 1G291 2AUJD 2A6HD 4KHPQ 2RBMA 1E2ZA 1D2BA 1OXUA 2K03A 4HCEA 4CDDC 1TVXA 3HOZB 1D1IA 1B7YB 3M7NA 3GTPH 1FVIA 3PF4A 4ZYSA 3PCOB 2JSOA 4TRDA 1SE4A 3CRLC 2EJFC 3CCSA 1JWSD 2JA6G 3U4VA 1ZEQX 4WORA 3GTJH 4DV0Q 1GUOA 1JR0D 4QMGA 4XYOA 1EU3A 4UP9A 1KL9A 2GVBA 1SBBB 3W3AA 1IHZA 4X64L 2JA8H 3KF8A 3HGBA 1D5XC 3S15H 4P2CB 1D7QA 2R6GA 3N52A 1G6PA 3VR5A 4AQYQ 3GTMB 5CV9A 1ZYRC 1QWYA 5EJWA 2QEJC 5KNBA 2IX3A 5LMNQ 1K83B 3FRPB 3L3OC 4BBRH 1N33Q 4DXFA 1HR0W 4KJNA 1J9OA 2NBFA 5J3BA 2B63H 5M3FH 1IKMA 2EDGA 4LF6Q 1E1OA 1S5FD 4OXPA 3CF5A 4GKJQ 1FJGL 1PH2A 1SROA 1TWHB 1NNXA 4YHHQ 4MHEA 4GS3A 5BR8Q 2VS1A 3D0FA 1KIXA 5M5YH 4PZ7A 1BCPD 1RD9D 1A8VA 2WINB 5C5MA 1YNND 1F2MA 1SMXA 1Y14B 5M9OA 3L2PA 5CORA 3GTLB 1CT1D 3ERSX 2B2YC 4LFCQ 4C3HB 5EBCA 3VR3A 1I3QH 4RKLA 4DKAC 4DNTB 4QL5A 3R2TA 3DXJC 2BE5C 1HXYD 2ZJQA 4BWGB 1HNXQ 3TREA 2UXCL 2F0SA 2ATWA 2C35B 3K5LA 2ES2A 5A2QL 3W1GA 2R7ZH 3NBIA 1DONA 2EY1A 3MC0B 5IYBG 2R93B 1X55A 5FO9B 2UU9Q 1BDOA 1A3TA 4LW1A 2JA6H 3M7GA 1STBA 5C4JH 1DD2A 4HN7A 2YU9H 3BDOA 1C48A 1M90C 4DK6C 2H1EA 1VQ7A 2AMCB 3T16A 3OMCA 1U4MA 3CRKC 1KNAA 3HOYG 2Z9HA 1IBLQ 4DN4M 2A68D 3RMHA 3PGZA 2N55A 1V1OA 2HQLA 3OSOA 1Y1WG 1DZ1A 2F4VQ 3A5ZB 1SNOA 1TIID 4RHSA 4EGVA 1S40A 4NXNQ 2PNRC 4PQXA 2K05A 1LT5D 1XXGA 2A73B 1W3SA 4WRDA 4IO9A 3CHBD 4DR7L 2XWJB 2YTYA 1ZKOA 1ICWA 1SSOA 3T13A 3CCUA 4HMIA 2OWOA 2NVYH 2DY8A 2HHHQ 3PUWA 1LTAD 4K5WA 1IBKL 2V4DA 3DUZA 2EJMA 1A62A 1K0RA 4LF8Q 1SYGA 2KEEA 3HOWH 4KJOA 2F0IA 4BXXG 1SFOH 2L12A 5C3XA 4YY3Q 1CA5A 1BKBA 1EWCA 2UXBQ 3DWPA 2WACA 4NB3A 4A3LG 2FMMA 1IYUA 4UPAA 1VQLA 1EQVA 1XMOQ 1BNZA 4GN5A 1PRTF 4JI7Q 2ENBA 3H6MA 2O5IC 2F0JA 1P16A 1N9WA 1X32A 3A5UA 3KJOA 5C4XB 1E3PA 1RTOA 2HQEA 5IYBH 4A3MG 1I4PA 2RCNA 4DV6L 1VQOA 3KF8B 4PMBA 1KDBA 3Q8DA 1G8ZD 5AJ3Q 1ILPA 1SN8A 2QDBA 3GDEA 4EX5A 5JJKA 1EZ8A 2H5XA 4GOPA 1B1ZA 4R8NA 2CQOA 3X3MA 4JCVE 5E7NA 4C3IG 4HIOA 4IFDI 4APVA 1HZAA 4Q0FA 4NMZA 4NXML 4IOCA 1NE3A 2KQ3A 5D65A 4IPHA 4WJ3M 1A3VA 1PFNA 3HOYH 4K0KL 1ET6A 1E7ZA 2Y0SG 1RKNA 1K3RA 4Y52H 2JN4A 1S3OA 1NBWA 1GOZA 1Y1WH 4KN4C 2HCCA 4ALPA 5HGTA 3VYUA 4JBMA 4DV2Q 4A3KH 3U4ZA 1N8RC 2L9HA 3T53B 5CYUA 4RWSC 1CTMA 2F0QA 4Y7NB 1KQSA 2EYMA 3I4OA 1GUSA 1Z7TA 5CV5A 1PH6A 5BN3A 3T1YQ 1B53A 1HFGA 2OCEA 1LO5D 4FNFA 1PH8A 3NQTA 5EGTA 5F2DA 2CH4W 4K14A 1PRTD 1R4PB 2D9UA 3I91A 1DYQA 4IURA 1MIUA 1XNQL 1X3QA 2HIXA 1HH2P 3GTPB 4LNQA 1K73C 4LF7Q 5CBAE 4BBSG 4A3LH 1LYLA 4OGQC 5DNFA 1CZGA 2A6EC 1PFMA 4XXEA 1R9TH 2ZXRA 4JC0A 5JOBA 4J8QA 2MJ8A 1G2TA 3RNUA 2K01A 2VQFL 1UE6A 5FLXL 3H15A 2E75C 2K1BA 2OTLA 1SE2A 1QVCA 2D62A 2RHQB 4A3MH 2IL8A 3GTJB 1B3AA 2IPKD 4K8JA 4JPBW 3PIO3 3AU7A 2JXMB 2RSOA 1L1OC 1WTPA 3I4MG 1SJHD 4CJ1B 5FJ8G 2JA8B 2X6GA 2MUYA 3WOFA 4A75A 3S15B 4KV6A 4IUNA 4P71A 4DV3Q 1IL2A 4LFAL 1IW7C 1N36Q 2IW3A 5EPLA 4RCOA 1I4GA 3EVQA 3IL8A 3FHWA 2B2TA 1V9PA 4BBRB 2ALYB 1XPRA 3K0XA 3PUVA 2NN6G 2ZXOA 1XPOA 2TMPA 5M3FB 1LV9A 3PF5A 2FHTA 5C44G 1WTXA 4JBJA 1F2ZA 2WKCA 2YV5A 1VQNA 4P74A 4R4CA 5I6WA 2IY5B 5I9OA 3HOVG 1CSQA 3CC2A 2MFIA 5M5YB 2EPBA 1ZYRD 1EOTA 2RA4A 1FL0A 2EY5A 4U68A 2RQXA 4DAPA 2EQSA 2NZ1D 2AWNA 4TSSA 2UUBQ 3PIPA 4R9WA 3ULJA 2I0QA 4A3GG 3MXUA 2R7FA 4RKBA 1LABA 4P73A 4ZCKA 3V96A 1N32L 1I3QB 5IYDG 2VUMH 4X65Q 2UXDQ 5D3IB 1A15A 2XN9C 3NPPA 4C2MB 4JI2Q 2WB1E 2F0DA 5IP7G 1PHJA 1GO3E 1S5CD 4BBSH 2NUCA 3NWSA 3T51B 2R7ZB 3JC66 1WI5A 3TP6A 2JA5G 4N9PA 4GOPB 3GTGH 5CMDA 4DK1A 3V2TA 2JA6B 2XRQD 1TY2A 4RFBA 5C4JB 3VR6A 4PZ6A 3IKJA 1HJPA 4RCNA 2YU9B 4DUYQ 4C3JG 1F2YA 2B3GA 2BE5D 1RHPA 2FXQA 5GAGC 4GLXA 4GKKL 1X3PA 2L15A 5EAYA 5FJ8H 3TBIB 1BCPC 1LTBD 1EIYB 2OXPA 1IYJB 5NUCA 2AHOB 2SNSA 4JOIA 3TP5A 1YJ9A 1PH4A 1EYGA 1KXLA 1YNNC 4H13C 4BA1I 1CM9A 5LL6X 4LF9Q 3FVQA 2N3SA 4C1NI 2AWOA 3S24A 3QO2A 3HP3A 1J5EQ 4A3FH 2LXJA 4X6AH 3QWNA 2F0EA 1HA5A 3SVMA 4M8AA 2A74C 4AYBG 5BN4A 3CMEA 2E76C 2I5HA 4LAAA 2K4KA 3S2HH 2OTJA 2NN6H 1AW7A 2F0NA 1XWEA 2G5DA 3D6CA 1JOOA 1EWHA 5C44H 3HFZB 3T56B 1Q82C 1JCKB 4B3TQ 2NVYB 3P75A 3HG9A 3HOVH 1VQ6A 1WD1A 1TS2A 1VCIA 2NVXB 4KHVA 2LMCB 3GV6A 1HR0Q 5D14A 4QGUA 4O2DA 3HOWB 3OYYA 1RODA 3F8TA 1PH9A 2Z6KA 2XIWA 2Q8RE 2HDMA 4DR6Q 4A3GH 1SFOB 1XNRQ 5C4ZA 3BVMA 3D3RA 5IYDH 3PQIA 2UUCL 2QEXA 3VA5A 1WJJA 1UUPA 2PW5A 2OF1A 5IP7H 2IJ0A 1HTPA 3D4DA 5KYIA 5IWAL 1ESRA 2B2UA 2JA5H 4LJZC 2L11A 5LHY1 1Y8OB 2WAQG 3KLRA 1KD1C 4FF1A 1XPUA 2XGTA 2E2IH 3S16H 1OXTA 2VQEL 4PV1C 5IIFA 1UE7A 4C3JH 5G3LD 3ERQA 1DOKA 1VQFA 5FKAC 5LMUQ 4JV5L 1JOKA 3HRZC 4YCWA 4I65A 3AYHB 2L55A 1F77A 4A76A 1YJNA 1KDAA 3HOYB 4JI2L 4LUOA 3CAMA 1Q12A 4XIGS 1JWMD 4DR5Q 3HKSA 5E3FA 1Y1WB 2CHBD 3CW2C 4EQPA 3A74A 3A8KE 4N8X1 4K2LA 2KHSA 4A3KB 4JI5Q 3RLOA 3ICEA 2WFWA 4CJ0B 4RA8A 2NTTA 4DUZQ 3F2BA 2ZJPA 3BU2A 4B9WA 4KKUA 1T9HA 4L5QA 1DGSA 2EJGC 4RGNA 2IX1A 4B3SL 3L0OA 4X3TA 4RMFA 2PMZB 1HNZQ 2K52A 3S1MH 4ZUIA 4ZKBB 1K9MC 3M85A 2HUGA 3J7YW 3I73A 2EY2A 4P72A 3VYSA 4BY7G 1I5FA 4DV4Q 1EQQA 2SDFA 3T4AC 3FP9A 1PV4A 4ZAIA 1X56A 2HIVA 3SXHA 2JA7G 2C5CA 1EYAA 2RKSA 3EROA 3KF6A 2NYZD 4N8FA 1S5BD 1R9TB 1QE6A 2R61A 1UAPA 4IFDG 5CV4A 5I6YA 4DR2Q 1VDZA 3HOXG 3SGIA 3SE0A 4MNOA 3WWVA 4A3MB 5EKLA 4OL7A 4JI6L 1KRTA 4FO2A 5GAEC 2B2VA 5CR3A 4ZLTF 4RH6A 3S14H 5IE8A 2BA0A 2KOLA 2CWPA 1I4QA 1PTOC 3BS1A 3H3VC 5J39A 4FP5D 1QJOA 5FO8B 1QILA 2F3WA 2A6ED 2DGYA 4JI1L 2AKWB 3S2DH 5I2YA 1KABA 3Q24A 2IWHA 3TEHB 1F9PA 2J4XA 4A3JG 3PV0A 4IQZA 4UHVA 5K36G 1I4HA 1Q1EA 1PMRA 4EQ5A 3KLSX 1JE4A 3GO5A 2Q8IB 1KC8C 2EZVA 4DR3L 1K8GA 4BY1G 2J7ZA 3KLWA 1CZWA 2QKIC 4HMJA 1IW7D 2NN6I 1BCPF 3NQIA 2DN8A 1Z9FA 2L0CA 5C4HA 5CV6A 1X6OA 2K5VA 1EEID 3OWFA 1SYFA 3T1HL 1PZID 4A3CG 2VUMB 2K33A 3J7AF 1BUVT 1LTRD 4UAIA 4B3RQ 2JA7H 1OTCA 4HIKA 3CQZH 3RN2A 2B39A 4E6IA 4V190 3J7A5 1QUQA 3RZOH 4IFDH 3C1EA 3GTOH 2PQAA 2F0OA 4LUZA 3TZUA 3TN2A 5GROA 3CCRA 3I4NG 2D5DA 1X65A 3HOXH 3GTGB 3Q22A 5GQOA 4HR7B 5C0XG 4FDBA 5C5LA 4GNXB 2KJXA 5CV7A 3Q23A 3TSSA 2PYKA 4R4IA 1RIPA 2NB0A 4B3ML 1CK1A 5FLXE 3H0GH 3KDFA 1XJVA 2XRSD 4K2KA 2QA4A 5A35A 3F2UA 3RUZA 3J7ZC 4IOAA 1KHIA 2EVBA 5IY0A 2OEOA 4A93G 5IODA 3A7LA 2Z4IA 4A3FB 4A3JH 5K36H 4JI3L 1CHQD 2IHEA 3E0EA 3IFDA 1CKMA 1HCZA 4BA2I 2K14A 3AQQA 3AMUA 4J6HA 4DAYA 1TS3A 4BY1H 4DV7L 2A69D 3UI2A 5IT9c 4DR1L 4IJHA 5C0XJ 3HOVB 4OEMB 3GQBA 5DM63 4AIMA 1RF2D 3AEVA 4OWTB 2G9DA 1JB3A 2AQ2B 1K28A 3J80i 5ELBA 2F3IA 4IZ8A 2OQ0A 5KNDA 2N8NA 4U673 3ZYYX 3KF6B 1U4LA 1I6HH 4RG1A 2Q2HA 1QB5D 2XNAC 4A3CH 1E24A 2JYOA 4DAVA 2E5LL 2KCMA 2KCNA 4JYAL 3BVGA 2JJQA 2E2JB 1NCVA 1OO9B 1L0WA 4LF5Q 4YIJA 1EFID 4TKOB 1JB7A 3K81C 2N78A 4P75A 1JWUD 3A0JA 3CXCA 1BOSA 2K04A 1A6XA 2EYJA 2CVRA 3I4NH 3IRBA 1LT6D 2ID0A 4XTCS 3S16B 2PZWA 2KHJA 4KHPL 3U9SA 1HQRD 5C0XH 1A2UA 4A4IA 4C3JB 4IUQA 1Q7YC 1PYWD 1SJED 3KLSA 1WTVA 3PO3G 1Y8NB 2DJGC 5K5PA 2K7VA 2A8VA 2HCIA 3CC4A 1HQMC 3NSWA 2LXKA 1XMQQ 4POGA 1EY4A 3M3YH 1JQYD 1HA6A 1C9OA 3SEBA 3F2DA 1WVLA 1VQ8A 2F0GA 1LUZA 1LTSD 3HOUG 2MQHA 1SNMA 5ELOA 1QVGA 1P8LA 3FEWX 2LS01 2R92G 4DV0L 3QOJA 3M4PA 3W2DA 5CC4A 5JEAG 4MN3A 4EVOA 1TR5A 1EY5A 4F7XA 3CCQA 1VQDA 4FF4A 4HCSA 3BZCA 1PFBA 5IP9G 3K5OA 4R8IA 1HUMA 2KEDA 2VZAA 1YI2A 4XDXA 2GA4B 2N49A 2QF7A 1PTOF 1A63A 3BYTB 1YBYA 3GD7A 3BYYB 4AQYL 4LUVA 3RD4A 3S1MB 1DOMA 1GKHA 5LMNL 1ZXTA 3PSIA 1N33L 1NAPA 2YTXA 3DEPA 3OTOQ 4DK0A 1LACA 5JJZA 4LF6L 1QUQB 4GKJL 1H95A 3G71A 1E0BA 2Q8TA 1OXVA 1BBWA 2PQAB 3MXGA 2E2DC 2EY6A 1I50H 3BDLA 4YHHL 5BR8L 1AE2A 3QJYA 5JEAJ 4HJ7A 1SNCA 1I94Q 2PI2A 3D8GA 1TWAH 3I3CA 1EFWA 1H9JA 5IT9L 3KDFB 1I6VC 4I7ZC 2B2YA 3S14B 4LFCL 2B2TC 4QQBX 3SDZA 4X3UA 5C6AA 2F0UA 2B8GA 4QUFA 1HUNA 5C3EG 1HFNA 1HNXL 3W5OA 3PO3H 2EYPA 3ND9A 3S2DB 2IX0A 4OHJA 1PLFA 2L4NA 1WFQA 2ZM6Q 3PO2B 2UU9L 3SHLA 3HOUH 4DAYB 2O4XA 2KUMA 3OIQA 1H9SA 3R3OA 5JEAH 1BXTA 1DCZA 1VQIA 3MA2B 1PTOD 3K80C 1STEA 3LNNA 2Z8LA 2NWGA 3N6RA 2F0PA 3KBGA 3VDYA 2PO4A 2I07B 1E1TA 2QW7A 3AFPA 2SEBD 4V0BA 1K3BC 1IBLL 2EOTA 1X3FA 1K8AC 4BXXH 4R4OA 3CC7A 2WIIB 2F4VL 3TS2A 5JVH3 1E22A 3KK7A 3BZKA 2RF4A 4NXNL 2XVSA 2WKDA 1K8OA 3SK4A 4JI8Q 2JA7B 2K50A 2UUAQ 1FNWA 3CQZB 5E4XA 3GTQH 2HHHL 3BJUA 2M00A 3CPFA 3RZOB 1MBYA 5KRUA 1EOVA 3GTOB 1KAAA 5EPKA 2PI2E 4JOIC 5DEHA 1STGA 2AUKA 2XTIA 1SYCA 3FPPA 4LF8L 4PNYA 1Q8IA 4F8MA 1E2VA 3LX0A 4IUTA 1CSPA 3UDXA 4YY3L 1Q90A 2BDNA 1VMCA 1VQHA 2Q2IA 4C3IH 2V1CC 2DNCA 2F0WA 1HZBA 1N34Q 1NJIC 4OWXB 2UXBL 3H0GB 3K57A 5IOCA 1O80A 5C3EH 4JW0A 3ITPA 1XMOL 4JI7L 5C0XI
chains in the Genus database with same CATH topology
2WAQG 1OXUA 3H3VI 1KD1C 1IBMQ 1XPUA 2XGTA 2E2IH 3S16H 1VS0A 3K8AA 1OXTA 2VQEL 3M7NA 1B7YB 3GTPH 1FVIA 5FLXc 1UE7A 3M9BA 3PF4A 3ZJYC 4C3JH 5AJ3L 3PCOB 2VQFQ 1O7IA 1VQFA 1Y1VH 1YNXA 5LMUQ 4IJLA 4JV5L 2NVXH 4IPCA 4YWLA 3J81j 2E2HH 1PYBA 2Z6KC 3CP0A 4YCWA 3AYHB 1YJNA 4A76A 3CCSA 2K75A 5IYCH 2JA6G 3U4VA 4JI2L 3GTJH 4DV0Q 4LUOA 4YWMA 3CAMA 1Q12A 4YWKA 4XIGS 2CKZB 3J81c 4DR5Q 2EXDA 3HKSA 4UP9A 1CKOA 2Q2TA 1KL9A 2GVBA 3CW2C 3A74A 3TS0A 4YCVA 4X64L 4JI5Q 4LWCA 4LFAQ 2JA8H 3RLOA 3ICEA 2WFWA 4DV1Q 3S15H 4LFBQ 1D7QA 4DUZQ 1GVPA 2R6GA 3F2BA 4DV2L 1G6PA 2ZJPA 4AQYQ 3BU2A 1TWCH 1T9HA 4L5QA 4X62Q 1YEZA 1DGSA 5LMNQ 4BBRH 1N33Q 2IX1A 1HR0W 3L0OA 4B3SL 3NELA 4RMFA 1YJWA 3U58A 1L2FA 1HNZQ 2K52A 5J3BA 3S1MH 2NZOA 5M3FH 2B63H 1K9MC 3M85A 4LF6Q 1E1OA 2MO0A 4OXPA 1CUKA 3CF5A 3T1YL 1FJGL 3GTKH 4GKJQ 1PH2A 1SROA 1Q86C 4P72A 4LF5L 4YHHQ 1I5FA 4GS3A 5M3MG 1TWFH 5BR8Q 4BY7G 2VS1A 2YTVA 4DV4Q 1EQQA 3D0FA 2R92H 1PV4A 1KIXA 3FP9A 5M5YH 4PZ7A 3I4MH 1X56A 2HIVA 1A8VA 2JA7G 3EBEA 3EN2A 2LSSA 3KF6A 1HNWQ 2Q2UA 1SMXA 5IP9H 1NMGA 3PIOA 1Y14B 3F2CA 1HZCA 1EQRA 3L2PA 4IFDG 1N32Q 2K5NA 4POFA 4DR2Q 3KOJA 5GAHC 4LF7L 4OO1G 1ASZA 3HOXG 3SGIA 3ERSX 1VQ4A 4MNOA 4LFCQ 3WWVA 3PUZA 2VNUD 4A3EG 1I3QH 4DKAC 4A3DG 4JI6L 1KRTA 3E9IA 4QL5A 5GAEC 3RZDH 4TQUS 1U5KA 1AH9A 1XMQL 2ZJQA 3S14H 5IE8A 2BA0A 1HNXQ 3TREA 4DK3C 3I55A 3S1RH 2ATWA 2UXCL 2CWPA 2C35B 3ER0A 2CFMA 4UP8A 1VQPA 2ES2A 1YHAA 4JI0Q 3W1GA 1JT8A 2NZHA 2R7ZH 4UP7A 4DR4Q 2IT1A 2DGYA 4JI1L 5IYBG 2AKWB 1VQCA 3S2DH 1V43A 1X55A 2UU9Q 4LF4Q 2I5LX 3MXNB 4LW1A 3U50C 3TEHB 2JA6H 4GKKQ 3HOZG 1UE1A 1SE8A 4DV3L 3PV0A 4TVAB 4A3JG 2BA1A 5C4JH 5K36G 1B70B 1Q1EA 2YU9H 1NTGA 1N36L 4EQ5A 2GVAA 2VUMG 1X3EA 3GO5A 1M90C 1VQ9A 1JJGA 4DK6C 5M5XH 1RL2A 1KC8C 1VQ7A 1KAWA 2AMCB 1J6QA 2PMZE 4ME3A 4DR3L 3L7ZC 1K8GA 3E9HA 4A3IG 4BY1G 1QVFA 4GLVB 4A3BG 3HOYG 3KLWA 3S1NH 4DAMA 4PMWA 1IBLQ 5LMNW 3K7AH 1ASYA 3PGZA 1D8LA 2NN6I 3OTOL 1HZ9A 2HQLA 2ZJRA 1Y1WG 3UE0A 1JJ2A 4OX9Q 2F4VQ 3A5ZB 3TRZA 3ULPA 1Z9FA 4DR6Q 3NEMA 1S40A 4NXNQ 1X6OA 4A3GH 2K5VA 3RN5A 4UY8C 4GLAC 3S17H 1WYDA 4IO9A 1W3SA 1PH1A 2UUBL 4DR7L 5JJLA 3T1HL 4X66Q 4IPDA 4A3CG 2YTYA 3CCUA 1I94L 2NVYH 2OWOA 3B6YA 5M3MH 3UDGA 1SLJA 4DV5Q 4HIMA 2HHHQ 1Q8KA 4B3RQ 1LM0A 3PUWA 2YYZA 1IBKL 2JA7H 1TWGH 1OTCA 4JI4Q 4GNXA 5HY6A 3STBC 4HIKA 4A3FG 3CQZH 4X65L 3RN2A 1A62A 2UXDL 3J7A5 1K0RA 1QUQA 4LF8Q 3RZOH 2NVTH 4QY7A 1YHBA 3HOWH 3GTOH 2PQAA 4LUZA 4R4QA 1VQEA 5GROA 3CCRA 2UUCQ 1SFOH 4YY3Q 1X65A 3HOXH 3I4NG 2KBNA 3KFUA 1PH3A 1MJCA 5GQOA 4HJ8A 4A3EH 1BKBA 3MEFA 4A3DH 1PVOA 2UXBQ 5C0XG 4NB3A 4FDBA 5IWAQ 4R1JA 4GNXB 4A3LG 3RLFA 1EIFA 2Y0SE 4UPAA 4R4IA 1VQLA 1XMOQ 1RIPA 2ZM6L 4J15A 4B3ML 4GN5A 4JI7Q 3H0GH 3KDFA 1XJVA 1YVCA 2QA4A 3UDIA 4DUYL 1P16A 1N9WA 3KYHC 3A5UA 3KJOA 2NVQH 1E3PA 2VQEQ 5IYBH 3J7ZC 4IOAA 4A3MG 2RCNA 1KHIA 5IY0A 2VW9A 4DV6L 1JJCB 3CD6A 3D31A 1VQOA 3KF8B 4A93G 3Q8DA 5AJ3Q 1VQAA 1SN8A 2VL6A 2ZTEA 3HOZH 1EUJA 3GDEA 4EX5A 1VQGA 2H5XA 4A3JH 4JV5Q 4JBWA 4LF9L 5JJKA 4GOPA 4JI3L 4GNXC 2CQOA 2EIFA 1J5EL 4JCVE 1VQKA 5E7NA 2IHEA 3E0EA 2MO1A 4HIOA 3DM3A 1JMCA 4IFDI 4APVA 2PNHA 1HZAA 1CKMA 2A1AA 4NPSA 4R4TA 3JAMc 2MNAA 4NXML 4BA2I 4OO1I 3HKZE 4IOCA 2K14A 3AQQA 1GD7A 1BBUA 1NE3A 4A3IH 4IPHA 4BY1H 5GADC 4DV7L 4WJ3M 3CMAA 4A3BH 2ASBA 3HOYH 4K0KL 4DR1L 1E7ZA 5IT9c 2Y0SG 1K3RA 4IJHA 5C0XJ 4MTNA 4Y52H 4X64Q 1KRSA 1S3OA 4AIMA 1NBWA 2K5HA 3AEVA 4OWTB 1Z47A 1Y1WH 4B3TL 4KLKA 3J80i 4ALPA 2F3IA 4O0AA 2QGQA 4JBMA 4DV2Q 2OQ0A 4A3KH 3U4ZA 1N8RC 3S1QH 4JI8L 2N8NA 1WCMG 2UUAL 3KF6B 1HR0L 1I6HH 4RG1A 2Q2HA 3CCLA 5ELNA 3GTMH 2I5MX 3RR5A 4B3SQ 4A3CH 1KQSA 1E24A 4DR6L 3I4OA 3PUYA 2E5LL 1QZHA 1XNRL 2KCMA 1PH6A 4JYAL 4IPGA 1K83H 1L1OA 2JJQA 1FJGQ 3T1YQ 3J81i 1L0WA 5M5WH 2OCEA 4GN4B 4LF5Q 1JB7A 1UWVA 3K81C 2N78A 3FKIG 1PH5A 4P75A 3F1ZA 1PH8A 1N34L 3A0JA 3CXCA 1VQ5A 1TWHH 3I4NH 3IRBA 1YIJA 2KHIA 2ID0A 4AH6A 4XTCS 2IHFA 2KHJA 1MIUA 4KHPL 1XNQL 2HIXA 1HH2P 1WOCA 4LNQA 4YCUA 1YHQA 1K73C 3H3VH 5DLQE 1IBML 4LF7Q 4BBSG 4A4IA 4A3LH 1LTLA 1LYLA 1Q7YC 3CCVA 1XTDA 1R9TH 4JC0A 3PO3G 3TQYA 3RNUA 4JI6Q 4OWWB 2A8VA 3CC4A 3GTLH 2VQFL 2LXKA 1UE6A 5M3FG 3H15A 1XMQQ 4POGA 4C3HH 2D62A 1QVCA 2OTLA 3M3YH 2RHQB 5LMUL 2UXCQ 4A3MH 1CKNA 1C9OA 3F2DA 1VQ8A 3G48A 3I2ZA 4PG3A 3G4SA 1LUZA 3EIVA 1OXSC 3HOUG 2MQHA 5ELOA 1QVGA 1P8LA 3K7UC 4QIWE 2R92G 1L1OC 4DV0L 4A3KG 3M4PA 4JI1Q 3I4MG 2R93G 5JEAG 5FJ8G 4DR5L 1SR3A 3CCQA 4A75A 5C4XG 1VQDA 4BY7H 2OQKA 4JG2A 1SRUA 3BZCA 1YZ6A 4P71A 5IP9G 4DV3Q 2E2JH 2R93H 1IL2A 4JI5L 4LFAL 2F52A 1VQMA 1N36Q 2VZAA 1YI2A 4DV1L 4LFBL 2N49A 4DUZL 3FHWA 1A63A 1YBYA 2JK8A 1V9PA 3GD7A 2ZTDA 4AQYL 2ALYB 4DR3Q 1XPRA 3K0XA 4LUVA 4X62L 3ULLA 3J80c 3PUVA 2NN6G 1MJEA 2BH8A 1XPOA 1GKHA 5LMNL 3PSIA 5FLMG 1N33L 3M4QA 2YTXA 3PF5A 3I56A 4BXXG 5C44G 1HNZL 4JBJA 1Q46A 3OTOQ 1WCMH 2R7ZG 2YV5A 1VQNA 4P74A 4R4CA 2IY5B 3M4OH 4LF6L 1H95A 1QUQB 3HOVG 1VQBA 1CSQA 3G71A 2E8GA 2D0OA 3CC2A 2MFIA 4GKJL 1OXVA 1BBWA 2PQAB 2KCTA 1FL0A 1I50H 1IZ6A 4YHHL 5BR8L 2EQSA 2JE6I 4DV4L 4L5RC 1AE2A 2AWNA 5JEAJ 4HJAA 4HJ9A 2UUBQ 1FGUA 4QJFA 3PIPA 4HJ7A 3T1HQ 4DR7Q 1C0AA 4L5SA 4A3GG 3ULJA 2I0QA 1I94Q 2R7FA 3FKIH 2PI2A 3PO2G 2RHSB 1HNWL 1TWAH 4P73A 3PUXA 1EFWA 1IBKQ 3KDFB 2VY3A 5IYDG 4DR2L 1N32L 2R7DA 2VUMH 1C7YA 1IXRA 1NMFA 3UDFA 4WJ4A 4X65Q 2UXDQ 4LFCL 4HJ5A 4QQBX 1QZGA 4JI2Q 2WB1E 1PHJA 5IP7G 3CCJA 1GO3E 4BBSH 1PYSB 5C3EG 4HIDA 1B8AA 3W5OA 3JC66 1EWIA 4AYBE 1WI5A 1HNXL 2JA5G 3PO3H 2KENA 4GOPB 3LGJA 5JJIA 2IX0A 1OXXK 2ZTCA 1YITA 4JI0L 3GTGH 2JQOA 4DR4L 2A19A 1PA6A 2CWAA 1WFQA 1X3GA 3NBHB 2ZM6Q 4B3MQ 4PZ6A 3RLNA 1HJPA 2UU9L 4LF4L 4DUYQ 1PFSA 2B3GA 2FXQA 4DAYB 5HGQA 3HOUH 5GAGC 1Y1VG 3DLLA 4GLXA 4GKKL 1JE5A 2L15A 3NENA 2JA9A 2JEAI 5EAYA 5FJ8H 4DV6Q 1VQIA 1EIYB 3K80C 2BH2A 4MZ9A 1IYJB 1PH4A 2AHOB 4JOIA 1UE5A 2WP8J 5C4XH 3CCMA 1YJ9A 1EYGA 1KXLA 4KI0A 5IYCG 1X54A 4BA1I 1M1KC 3VDYA 4LF9Q 3HOWG 1U0LA 4PZ8A 4GOPC 4JI3Q 2N3SA 1VQJA 1E1TA 2AWOA 2WB1G 3S24A 3AFPA 1MKHA 1J5EQ 3HKZG 4A3FH 2LXJA 4X6AH 3G6EA 4AYBG 4DNIA 1BVSA 3CMEA 1IBLL 4NXMQ 2JA8G 2I5HA 1X3FA 2K4KA 3S2HH 4H02A 1S72A 1X9NA 1K8AC 1Q81C 4BXXH 4R4OA 3W1BA 2OTJA 4DV7Q 3CC7A 1GM5A 4C2MH 4K0KQ 1PH7A 4DR1Q 4OX9L 2F4VL 2JEBI 5FLMH 3TS2A 1L1OB 4OONA 3H0GG 3KJPA 1E22A 4L5TA 5C44H 3BZKA 3HFZB 2RF4A 4NXNL 1Q82C 4JBKA 3CPWA 2GN5A 4B3TQ 3HOVH 1VQ6A 2WAQE 4BBRG 1VCIA 4X66L 3OW2A 4JI8Q 2CCZA 2K50A 2UUAQ 1A0IA 2B63G 4DV5L 3GTQH 1HR0Q 2HHHL 3BJUA 3PO2H 3CPFA 3CCEA 4B3RL 2Z0SA 4QGUA 4O2DA 1EOVA 3OYYA 3F8TA 1PH9A 2Z6KA 4JI4L 1V1QA 2PI2E 4GN3B 4JOIC 2DUDA 2E5LQ 4A93H 1XNRQ 2XTIA 4IFDJ 4KHZA 4JYAQ 3I7FA 4LF8L 4Y7NH 2D0PA 3JAMi 1CSPA 5IYDH 1Q1BA 1UEBA 3UDXA 2UUCL 1AE3A 2QEXA 3UE1A 4YY3L 1WJJA 1VQHA 2Q2IA 4C3IH 2V1CC 2B29A 1NY4A 1HZBA 4DPGA 1NJIC 1CKNB 5IP7H 4OWXB 1N34Q 2UXBL 1W2BA 3AFQA 5IWAL 2HT1A 1TXYA 3STBD 5C3EH 5H1SE 1G291 1XMOL 2JA5H 4KHPQ 1XNQQ 1G51A 4JI7L 5C0XI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAQ G;  1OXU A;  3H3V I;  1KD1 C;  1IBM Q;  1XPU A;  2XGT A;  2E2I H;  3S16 H;  1VS0 A;  3K8A A;  1OXT A;  2VQE L;  3M7N A;  1B7Y B;  3GTP H;  1FVI A;  5FLX c;  1UE7 A;  3M9B A;  3PF4 A;  3ZJY C;  4C3J H;  5AJ3 L;  3PCO B;  2VQF Q;  1O7I A;  1VQF A;  1Y1V H;  1YNX A;  5LMU Q;  4IJL A;  4JV5 L;  2NVX H;  4IPC A;  4YWL A;  3J81 j;  2E2H H;  1PYB A;  2Z6K C;  3CP0 A;  4YCW A;  3AYH B;  1YJN A;  4A76 A;  3CCS A;  2K75 A;  5IYC H;  2JA6 G;  3U4V A;  4JI2 L;  3GTJ H;  4DV0 Q;  4LUO A;  4YWM A;  3CAM A;  1Q12 A;  4YWK A;  4XIG S;  2CKZ B;  3J81 c;  4DR5 Q;  2EXD A;  3HKS A;  4UP9 A;  1CKO A;  2Q2T A;  1KL9 A;  2GVB A;  3CW2 C;  3A74 A;  3TS0 A;  4YCV A;  4X64 L;  4JI5 Q;  4LWC A;  4LFA Q;  2JA8 H;  3RLO A;  3ICE A;  2WFW A;  4DV1 Q;  3S15 H;  4LFB Q;  1D7Q A;  4DUZ Q;  1GVP A;  2R6G A;  3F2B A;  4DV2 L;  1G6P A;  2ZJP A;  4AQY Q;  3BU2 A;  1TWC H;  1T9H A;  4L5Q A;  4X62 Q;  1YEZ A;  1DGS A;  5LMN Q;  4BBR H;  1N33 Q;  2IX1 A;  1HR0 W;  3L0O A;  4B3S L;  3NEL A;  4RMF A;  1YJW A;  3U58 A;  1L2F A;  1HNZ Q;  2K52 A;  5J3B A;  3S1M H;  2NZO A;  5M3F H;  2B63 H;  1K9M C;  3M85 A;  4LF6 Q;  1E1O A;  2MO0 A;  4OXP A;  1CUK A;  3CF5 A;  3T1Y L;  1FJG L;  3GTK H;  4GKJ Q;  1PH2 A;  1SRO A;  1Q86 C;  4P72 A;  4LF5 L;  4YHH Q;  1I5F A;  4GS3 A;  5M3M G;  1TWF H;  5BR8 Q;  4BY7 G;  2VS1 A;  2YTV A;  4DV4 Q;  1EQQ A;  3D0F A;  2R92 H;  1PV4 A;  1KIX A;  3FP9 A;  5M5Y H;  4PZ7 A;  3I4M H;  1X56 A;  2HIV A;  1A8V A;  2JA7 G;  3EBE A;  3EN2 A;  2LSS A;  3KF6 A;  1HNW Q;  2Q2U A;  1SMX A;  5IP9 H;  1NMG A;  3PIO A;  1Y14 B;  3F2C A;  1HZC A;  1EQR A;  3L2P A;  4IFD G;  1N32 Q;  2K5N A;  4POF A;  4DR2 Q;  3KOJ A;  5GAH C;  4LF7 L;  4OO1 G;  1ASZ A;  3HOX G;  3SGI A;  3ERS X;  1VQ4 A;  4MNO A;  4LFC Q;  3WWV A;  3PUZ A;  2VNU D;  4A3E G;  1I3Q H;  4DKA C;  4A3D G;  4JI6 L;  1KRT A;  3E9I A;  4QL5 A;  5GAE C;  3RZD H;  4TQU S;  1U5K A;  1AH9 A;  1XMQ L;  2ZJQ A;  3S14 H;  5IE8 A;  2BA0 A;  1HNX Q;  3TRE A;  4DK3 C;  3I55 A;  3S1R H;  2ATW A;  2UXC L;  2CWP A;  2C35 B;  3ER0 A;  2CFM A;  4UP8 A;  1VQP A;  2ES2 A;  1YHA A;  4JI0 Q;  3W1G A;  1JT8 A;  2NZH A;  2R7Z H;  4UP7 A;  4DR4 Q;  2IT1 A;  2DGY A;  4JI1 L;  5IYB G;  2AKW B;  1VQC A;  3S2D H;  1V43 A;  1X55 A;  2UU9 Q;  4LF4 Q;  2I5L X;  3MXN B;  4LW1 A;  3U50 C;  3TEH B;  2JA6 H;  4GKK Q;  3HOZ G;  1UE1 A;  1SE8 A;  4DV3 L;  3PV0 A;  4TVA B;  4A3J G;  2BA1 A;  5C4J H;  5K36 G;  1B70 B;  1Q1E A;  2YU9 H;  1NTG A;  1N36 L;  4EQ5 A;  2GVA A;  2VUM G;  1X3E A;  3GO5 A;  1M90 C;  1VQ9 A;  1JJG A;  4DK6 C;  5M5X H;  1RL2 A;  1KC8 C;  1VQ7 A;  1KAW A;  2AMC B;  1J6Q A;  2PMZ E;  4ME3 A;  4DR3 L;  3L7Z C;  1K8G A;  3E9H A;  4A3I G;  4BY1 G;  1QVF A;  4GLV B;  4A3B G;  3HOY G;  3KLW A;  3S1N H;  4DAM A;  4PMW A;  1IBL Q;  5LMN W;  3K7A H;  1ASY A;  3PGZ A;  1D8L A;  2NN6 I;  3OTO L;  1HZ9 A;  2HQL A;  2ZJR A;  1Y1W G;  3UE0 A;  1JJ2 A;  4OX9 Q;  2F4V Q;  3A5Z B;  3TRZ A;  3ULP A;  1Z9F A;  4DR6 Q;  3NEM A;  1S40 A;  4NXN Q;  1X6O A;  4A3G H;  2K5V A;  3RN5 A;  4UY8 C;  4GLA C;  3S17 H;  1WYD A;  4IO9 A;  1W3S A;  1PH1 A;  2UUB L;  4DR7 L;  5JJL A;  3T1H L;  4X66 Q;  4IPD A;  4A3C G;  2YTY A;  3CCU A;  1I94 L;  2NVY H;  2OWO A;  3B6Y A;  5M3M H;  3UDG A;  1SLJ A;  4DV5 Q;  4HIM A;  2HHH Q;  1Q8K A;  4B3R Q;  1LM0 A;  3PUW A;  2YYZ A;  1IBK L;  2JA7 H;  1TWG H;  1OTC A;  4JI4 Q;  4GNX A;  5HY6 A;  3STB C;  4HIK A;  4A3F G;  3CQZ H;  4X65 L;  3RN2 A;  1A62 A;  2UXD L;  3J7A 5;  1K0R A;  1QUQ A;  4LF8 Q;  3RZO H;  2NVT H;  4QY7 A;  1YHB A;  3HOW H;  3GTO H;  2PQA A;  4LUZ A;  4R4Q A;  1VQE A;  5GRO A;  3CCR A;  2UUC Q;  1SFO H;  4YY3 Q;  1X65 A;  3HOX H;  3I4N G;  2KBN A;  3KFU A;  1PH3 A;  1MJC A;  5GQO A;  4HJ8 A;  4A3E H;  1BKB A;  3MEF A;  4A3D H;  1PVO A;  2UXB Q;  5C0X G;  4NB3 A;  4FDB A;  5IWA Q;  4R1J A;  4GNX B;  4A3L G;  3RLF A;  1EIF A;  2Y0S E;  4UPA A;  4R4I A;  1VQL A;  1XMO Q;  1RIP A;  2ZM6 L;  4J15 A;  4B3M L;  4GN5 A;  4JI7 Q;  3H0G H;  3KDF A;  1XJV A;  1YVC A;  2QA4 A;  3UDI A;  4DUY L;  1P16 A;  1N9W A;  3KYH C;  3A5U A;  3KJO A;  2NVQ H;  1E3P A;  2VQE Q;  5IYB H;  3J7Z C;  4IOA A;  4A3M G;  2RCN A;  1KHI A;  5IY0 A;  2VW9 A;  4DV6 L;  1JJC B;  3CD6 A;  3D31 A;  1VQO A;  3KF8 B;  4A93 G;  3Q8D A;  5AJ3 Q;  1VQA A;  1SN8 A;  2VL6 A;  2ZTE A;  3HOZ H;  1EUJ A;  3GDE A;  4EX5 A;  1VQG A;  2H5X A;  4A3J H;  4JV5 Q;  4JBW A;  4LF9 L;  5JJK A;  4GOP A;  4JI3 L;  4GNX C;  2CQO A;  2EIF A;  1J5E L;  4JCV E;  1VQK A;  5E7N A;  2IHE A;  3E0E A;  2MO1 A;  4HIO A;  3DM3 A;  1JMC A;  4IFD I;  4APV A;  2PNH A;  1HZA A;  1CKM A;  2A1A A;  4NPS A;  4R4T A;  3JAM c;  2MNA A;  4NXM L;  4BA2 I;  4OO1 I;  3HKZ E;  4IOC A;  2K14 A;  3AQQ A;  1GD7 A;  1BBU A;  1NE3 A;  4A3I H;  4IPH A;  4BY1 H;  5GAD C;  4DV7 L;  4WJ3 M;  3CMA A;  4A3B H;  2ASB A;  3HOY H;  4K0K L;  4DR1 L;  1E7Z A;  5IT9 c;  2Y0S G;  1K3R A;  4IJH A;  5C0X J;  4MTN A;  4Y52 H;  4X64 Q;  1KRS A;  1S3O A;  4AIM A;  1NBW A;  2K5H A;  3AEV A;  4OWT B;  1Z47 A;  1Y1W H;  4B3T L;  4KLK A;  3J80 i;  4ALP A;  2F3I A;  4O0A A;  2QGQ A;  4JBM A;  4DV2 Q;  2OQ0 A;  4A3K H;  3U4Z A;  1N8R C;  3S1Q H;  4JI8 L;  2N8N A;  1WCM G;  2UUA L;  3KF6 B;  1HR0 L;  1I6H H;  4RG1 A;  2Q2H A;  3CCL A;  5ELN A;  3GTM H;  2I5M X;  3RR5 A;  4B3S Q;  4A3C H;  1KQS A;  1E24 A;  4DR6 L;  3I4O A;  3PUY A;  2E5L L;  1QZH A;  1XNR L;  2KCM A;  1PH6 A;  4JYA L;  4IPG A;  1K83 H;  1L1O A;  2JJQ A;  1FJG Q;  3T1Y Q;  3J81 i;  1L0W A;  5M5W H;  2OCE A;  4GN4 B;  4LF5 Q;  1JB7 A;  1UWV A;  3K81 C;  2N78 A;  3FKI G;  1PH5 A;  4P75 A;  3F1Z A;  1PH8 A;  1N34 L;  3A0J A;  3CXC A;  1VQ5 A;  1TWH H;  3I4N H;  3IRB A;  1YIJ A;  2KHI A;  2ID0 A;  4AH6 A;  4XTC S;  2IHF A;  2KHJ A;  1MIU A;  4KHP L;  1XNQ L;  2HIX A;  1HH2 P;  1WOC A;  4LNQ A;  4YCU A;  1YHQ A;  1K73 C;  3H3V H;  5DLQ E;  1IBM L;  4LF7 Q;  4BBS G;  4A4I A;  4A3L H;  1LTL A;  1LYL A;  1Q7Y C;  3CCV A;  1XTD A;  1R9T H;  4JC0 A;  3PO3 G;  3TQY A;  3RNU A;  4JI6 Q;  4OWW B;  2A8V A;  3CC4 A;  3GTL H;  2VQF L;  2LXK A;  1UE6 A;  5M3F G;  3H15 A;  1XMQ Q;  4POG A;  4C3H H;  2D62 A;  1QVC A;  2OTL A;  3M3Y H;  2RHQ B;  5LMU L;  2UXC Q;  4A3M H;  1CKN A;  1C9O A;  3F2D A;  1VQ8 A;  3G48 A;  3I2Z A;  4PG3 A;  3G4S A;  1LUZ A;  3EIV A;  1OXS C;  3HOU G;  2MQH A;  5ELO A;  1QVG A;  1P8L A;  3K7U C;  4QIW E;  2R92 G;  1L1O C;  4DV0 L;  4A3K G;  3M4P A;  4JI1 Q;  3I4M G;  2R93 G;  5JEA G;  5FJ8 G;  4DR5 L;  1SR3 A;  3CCQ A;  4A75 A;  5C4X G;  1VQD A;  4BY7 H;  2OQK A;  4JG2 A;  1SRU A;  3BZC A;  1YZ6 A;  4P71 A;  5IP9 G;  4DV3 Q;  2E2J H;  2R93 H;  1IL2 A;  4JI5 L;  4LFA L;  2F52 A;  1VQM A;  1N36 Q;  2VZA A;  1YI2 A;  4DV1 L;  4LFB L;  2N49 A;  4DUZ L;  3FHW A;  1A63 A;  1YBY A;  2JK8 A;  1V9P A;  3GD7 A;  2ZTD A;  4AQY L;  2ALY B;  4DR3 Q;  1XPR A;  3K0X A;  4LUV A;  4X62 L;  3ULL A;  3J80 c;  3PUV A;  2NN6 G;  1MJE A;  2BH8 A;  1XPO A;  1GKH A;  5LMN L;  3PSI A;  5FLM G;  1N33 L;  3M4Q A;  2YTX A;  3PF5 A;  3I56 A;  4BXX G;  5C44 G;  1HNZ L;  4JBJ A;  1Q46 A;  3OTO Q;  1WCM H;  2R7Z G;  2YV5 A;  1VQN A;  4P74 A;  4R4C A;  2IY5 B;  3M4O H;  4LF6 L;  1H95 A;  1QUQ B;  3HOV G;  1VQB A;  1CSQ A;  3G71 A;  2E8G A;  2D0O A;  3CC2 A;  2MFI A;  4GKJ L;  1OXV A;  1BBW A;  2PQA B;  2KCT A;  1FL0 A;  1I50 H;  1IZ6 A;  4YHH L;  5BR8 L;  2EQS A;  2JE6 I;  4DV4 L;  4L5R C;  1AE2 A;  2AWN A;  5JEA J;  4HJA A;  4HJ9 A;  2UUB Q;  1FGU A;  4QJF A;  3PIP A;  4HJ7 A;  3T1H Q;  4DR7 Q;  1C0A A;  4L5S A;  4A3G G;  3ULJ A;  2I0Q A;  1I94 Q;  2R7F A;  3FKI H;  2PI2 A;  3PO2 G;  2RHS B;  1HNW L;  1TWA H;  4P73 A;  3PUX A;  1EFW A;  1IBK Q;  3KDF B;  2VY3 A;  5IYD G;  4DR2 L;  1N32 L;  2R7D A;  2VUM H;  1C7Y A;  1IXR A;  1NMF A;  3UDF A;  4WJ4 A;  4X65 Q;  2UXD Q;  4LFC L;  4HJ5 A;  4QQB X;  1QZG A;  4JI2 Q;  2WB1 E;  1PHJ A;  5IP7 G;  3CCJ A;  1GO3 E;  4BBS H;  1PYS B;  5C3E G;  4HID A;  1B8A A;  3W5O A;  3JC6 6;  1EWI A;  4AYB E;  1WI5 A;  1HNX L;  2JA5 G;  3PO3 H;  2KEN A;  4GOP B;  3LGJ A;  5JJI A;  2IX0 A;  1OXX K;  2ZTC A;  1YIT A;  4JI0 L;  3GTG H;  2JQO A;  4DR4 L;  2A19 A;  1PA6 A;  2CWA A;  1WFQ A;  1X3G A;  3NBH B;  2ZM6 Q;  4B3M Q;  4PZ6 A;  3RLN A;  1HJP A;  2UU9 L;  4LF4 L;  4DUY Q;  1PFS A;  2B3G A;  2FXQ A;  4DAY B;  5HGQ A;  3HOU H;  5GAG C;  1Y1V G;  3DLL A;  4GLX A;  4GKK L;  1JE5 A;  2L15 A;  3NEN A;  2JA9 A;  2JEA I;  5EAY A;  5FJ8 H;  4DV6 Q;  1VQI A;  1EIY B;  3K80 C;  2BH2 A;  4MZ9 A;  1IYJ B;  1PH4 A;  2AHO B;  4JOI A;  1UE5 A;  2WP8 J;  5C4X H;  3CCM A;  1YJ9 A;  1EYG A;  1KXL A;  4KI0 A;  5IYC G;  1X54 A;  4BA1 I;  1M1K C;  3VDY A;  4LF9 Q;  3HOW G;  1U0L A;  4PZ8 A;  4GOP C;  4JI3 Q;  2N3S A;  1VQJ A;  1E1T A;  2AWO A;  2WB1 G;  3S24 A;  3AFP A;  1MKH A;  1J5E Q;  3HKZ G;  4A3F H;  2LXJ A;  4X6A H;  3G6E A;  4AYB G;  4DNI A;  1BVS A;  3CME A;  1IBL L;  4NXM Q;  2JA8 G;  2I5H A;  1X3F A;  2K4K A;  3S2H H;  4H02 A;  1S72 A;  1X9N A;  1K8A C;  1Q81 C;  4BXX H;  4R4O A;  3W1B A;  2OTJ A;  4DV7 Q;  3CC7 A;  1GM5 A;  4C2M H;  4K0K Q;  1PH7 A;  4DR1 Q;  4OX9 L;  2F4V L;  2JEB I;  5FLM H;  3TS2 A;  1L1O B;  4OON A;  3H0G G;  3KJP A;  1E22 A;  4L5T A;  5C44 H;  3BZK A;  3HFZ B;  2RF4 A;  4NXN L;  1Q82 C;  4JBK A;  3CPW A;  2GN5 A;  4B3T Q;  3HOV H;  1VQ6 A;  2WAQ E;  4BBR G;  1VCI A;  4X66 L;  3OW2 A;  4JI8 Q;  2CCZ A;  2K50 A;  2UUA Q;  1A0I A;  2B63 G;  4DV5 L;  3GTQ H;  1HR0 Q;  2HHH L;  3BJU A;  3PO2 H;  3CPF A;  3CCE A;  4B3R L;  2Z0S A;  4QGU A;  4O2D A;  1EOV A;  3OYY A;  3F8T A;  1PH9 A;  2Z6K A;  4JI4 L;  1V1Q A;  2PI2 E;  4GN3 B;  4JOI C;  2DUD A;  2E5L Q;  4A93 H;  1XNR Q;  2XTI A;  4IFD J;  4KHZ A;  4JYA Q;  3I7F A;  4LF8 L;  4Y7N H;  2D0P A;  3JAM i;  1CSP A;  5IYD H;  1Q1B A;  1UEB A;  3UDX A;  2UUC L;  1AE3 A;  2QEX A;  3UE1 A;  4YY3 L;  1WJJ A;  1VQH A;  2Q2I A;  4C3I H;  2V1C C;  2B29 A;  1NY4 A;  1HZB A;  4DPG A;  1NJI C;  1CKN B;  5IP7 H;  4OWX B;  1N34 Q;  2UXB L;  1W2B A;  3AFQ A;  5IWA L;  2HT1 A;  1TXY A;  3STB D;  5C3E H;  5H1S E;  1G29 1;  1XMO L;  2JA5 H;  4KHP Q;  1XNQ Q;  1G51 A;  4JI7 L;  5C0X I; 
#chains in the Genus database with same CATH topology
 2MP1 A;  2LY7 A;  1IBM Q;  1B4O A;  3DM1 A;  5ELD A;  4L8J A;  3K8A A;  2B63 B;  2PW7 A;  3K0Y A;  3M9B A;  2E74 C;  3ZJY C;  5AJ3 L;  1O7I A;  3MVV A;  1EL0 A;  4IPC A;  3NXW A;  4ZK9 B;  1B3Q A;  2Z6K C;  1B9N A;  1SYD A;  2NTS A;  4DGZ A;  4BY1 B;  4DFA A;  2K75 A;  4YWM A;  4YWK A;  3J81 c;  2K28 A;  2EXD A;  3MFY A;  5ELF A;  4F87 A;  2Q2T A;  4K5X A;  4IAL A;  4UDU C;  1EY8 A;  3J80 E;  3NHH A;  4DV1 Q;  4LFB Q;  4ID6 A;  4KY7 A;  4MTK A;  4ZRZ A;  2B2U C;  1I6H B;  3OPO A;  4DV2 L;  4N9T A;  5I9P A;  2N88 A;  4X62 Q;  1YEZ A;  2F1M A;  4KMU C;  4KTA A;  2I46 A;  1LT4 D;  3NEL A;  1WD0 A;  4L6T B;  2FFK B;  2NZO A;  1V1P A;  1CUK A;  3T1Y L;  1L0Y B;  4XQQ A;  3ND8 A;  3I4N B;  1TWF H;  4F88 A;  2R93 G;  3I4M H;  1QNU A;  4RHR A;  4XT3 B;  1HNW Q;  2Q2U A;  1FYC A;  1KTK A;  2A69 C;  2F4I A;  4RGM A;  1QCB D;  2F0L A;  1NMG A;  5CV8 A;  5G3L F;  1HZC A;  1EQR A;  4K6L A;  2K5N A;  4B9X A;  4POF A;  5GAH C;  4LF7 L;  2VNU D;  4A3E G;  1H9S B;  3RZD H;  5JAV A;  3PIP 3;  2EYH A;  1AN8 A;  3I55 A;  4DK3 C;  5ELC A;  5JPN C;  1CQV A;  2CFM A;  1YNJ C;  4JI0 Q;  1KLG D;  1JT8 A;  2NZH A;  2PQE A;  4UP7 A;  4DR4 Q;  1O7Z A;  4JVZ A;  4HED A;  1V43 A;  4LF4 Q;  1XYI A;  3I72 A;  1LTT D;  3QG1 A;  3K6O A;  1CFM A;  1UE1 A;  4DV3 L;  2BA1 A;  4PMC A;  3O13 A;  1NTG A;  1N36 L;  5I2X A;  2GVA A;  2LKV A;  1VQ9 A;  3QR8 A;  5ISR A;  2XWB B;  1UEA B;  4DNR B;  1KAW A;  2PMZ E;  4ME3 A;  1CI3 M;  3BZD B;  4O1N A;  3E9H A;  3OHX C;  3P1H A;  4A3I G;  1SND A;  1QOH A;  4A3B G;  3K58 A;  2K5W A;  3S1N H;  2PCF B;  4PMW A;  2RSN A;  3K7A H;  1MI2 A;  1O7L A;  2B2V C;  1D8L A;  2K5Q A;  1HZ9 A;  4QB4 A;  2ZJR A;  1STY A;  1H9R A;  1STH A;  1JJ2 A;  4ODG A;  1B9M A;  4OX9 Q;  3TRZ A;  3ULP A;  3NEM A;  1K8M A;  1AEX A;  4K6D A;  5IGE A;  3I70 A;  4UY8 C;  1H9K A;  4B08 A;  1WYD A;  2B2W A;  1PH1 A;  5A2Q E;  1TWA B;  1CA6 A;  2UUB L;  4XT1 B;  5JJL A;  4X66 Q;  2D2C C;  3J81 L;  1SLJ A;  4DV5 Q;  1Q8K A;  4L63 B;  3DMU A;  4JI4 Q;  4GNX A;  3STB C;  4X65 L;  2UXD L;  1LTG D;  3Q6S A;  2NVT H;  3PO3 B;  1JC7 A;  3C46 A;  1MSH A;  4R4Q A;  1VQE A;  3KFU A;  2RDG A;  3E0J A;  1MHW C;  2ICE C;  1PH3 A;  2FJ2 A;  1ONL A;  5C3W A;  4A3E H;  1GHJ A;  1IYV A;  4R1J A;  1EIF A;  3HOU B;  1EU4 A;  2Y0S E;  1KLU D;  1T5E A;  1T5X D;  2F03 A;  4J15 A;  2CQA A;  1YVC A;  1ENC A;  1BBX C;  3UDI A;  1M8A A;  5I4D A;  3KYH C;  1FR3 A;  4DUY L;  3A8J E;  4ILW A;  4DF7 A;  3BG3 A;  3CU7 A;  3K59 A;  2VW9 A;  1JJC B;  3D6W A;  3D31 A;  4QCL A;  5FOB B;  1U9R A;  2ICI A;  5E4W C;  2ZTE A;  4GZY C;  1VQG A;  4LF9 L;  4RGT A;  1G2S A;  1WTR A;  2F3V A;  2EIF A;  1J5E L;  1JMC A;  1LLR D;  1E2W A;  3DM3 A;  2J0T D;  2PNH A;  3NBH A;  4NPS A;  4OO1 I;  1BR9 A;  3KBX A;  4R4T A;  1EY7 A;  1PXU A;  3JAM c;  1GD7 A;  1TT2 A;  4A3I H;  1Y69 U;  5GAD C;  4A3B H;  1U4P A;  1V1P B;  5J22 A;  4G7O C;  4MTN A;  4QIW B;  4X64 Q;  1KRS A;  4IUP A;  2R3Z A;  5KIX A;  2K5H A;  4B3T L;  2AQ3 B;  1SDF A;  4O0A A;  3GTQ B;  2QGQ A;  1F9S A;  3S1Q H;  4ZQ3 A;  2QDL A;  1WCM G;  1HR0 L;  1S4Z A;  5ELN A;  3RR5 A;  3TZD A;  2F0H A;  1TS4 A;  5FO7 B;  5LL6 S;  4DR6 L;  1VMP A;  1QZH A;  3VA7 A;  1XNR L;  1DXM A;  4IPG A;  4C3I B;  2XSC A;  4FXG C;  4IUU A;  1FJG Q;  1GUW A;  4S3S A;  4BS9 A;  5IGC A;  3J81 i;  5M5W H;  4GN4 B;  2O5J C;  3FKI G;  1PH5 A;  3MFG A;  2Y0S B;  5KEE A;  1RTN A;  3QOL A;  4AH6 A;  3VR4 A;  1L0X B;  1D5Z C;  1PTO H;  4YCU A;  4KK7 A;  3H3V H;  5DLQ E;  1GUG A;  1QG7 A;  4DA2 A;  1LTL A;  2VB3 X;  1GUT A;  3TP8 A;  3CCV A;  4ULL A;  1XTD A;  1KDC A;  3I90 A;  3TQY A;  4OWW B;  5HUR A;  1G6Z A;  4DXG A;  5M3F G;  1S5D D;  2G9H D;  5LMU L;  2UXC Q;  1CKN A;  3AB9 A;  2LFN A;  3I2Z A;  1O7Y A;  1WTQ A;  3K7U C;  3LWU A;  4KY5 A;  2H4O A;  5EPJ A;  4DR5 L;  5ELE A;  1SR3 A;  4BY7 H;  2OQK A;  4JG2 A;  2M2L A;  1SRU A;  4JI5 L;  2F52 A;  1VQM A;  4K5V A;  4CDF C;  4BBS B;  4DUZ L;  2ZTD A;  3R8B A;  1FD7 D;  3ULL A;  3K5M A;  3Q0A A;  1WTH A;  2BH8 A;  1MJE A;  1TKW B;  5FLM G;  3I4L A;  1S5E D;  4C1N K;  1HNZ L;  1Q46 A;  2Z6B A;  1VF7 A;  1WCM H;  2R7Z G;  3M4O H;  1TWF B;  4CKC A;  1VQB A;  1M4V A;  3I4M B;  1IZ6 A;  2JE6 I;  4DV4 L;  4DR7 Q;  1FGU A;  3EJI A;  4QJF A;  1C0A A;  4HTH A;  3JAM L;  5BN5 A;  1WTW A;  3A7A B;  3FKI H;  4ZUJ A;  2PZU A;  1PZK D;  1IBK Q;  3X3N A;  2VY3 A;  4DR2 L;  3RZD B;  1C7Y A;  3S2H B;  1NMF A;  3UDF A;  3KUP A;  3HZX A;  2BCO A;  1PDQ A;  1EY6 A;  1RCV D;  3I8Z A;  1MGS A;  3K5N A;  4G7Z C;  1BCP B;  2FMC A;  1PYS B;  5C44 B;  4KD3 A;  3CKI B;  3MXP A;  4HID A;  1B8A A;  4AYB E;  3WDN A;  2KEN A;  5JJI A;  1YIT A;  3NE5 B;  4ABN A;  3MAQ A;  4Q5V A;  1ENF A;  2A19 A;  2BDO A;  1PA6 A;  1X3G A;  2EYF A;  1D6E C;  3NBH B;  1C8C A;  4K8I A;  3E3X A;  1PFS A;  3DWA A;  4A3G B;  3DLL A;  1Q3L A;  1Y1V G;  3QB3 A;  1JE5 A;  2X69 A;  1K0S A;  3TDQ A;  2JEA I;  4DV6 Q;  2BH2 A;  4FF3 A;  2FIN B;  1YNJ D;  4MZ9 A;  1UE5 A;  1GUN A;  4G57 A;  5IYC G;  5KNC A;  3HOW G;  3S1N B;  1U0L A;  4GOP C;  1ICF B;  1GXD C;  1VQJ A;  3K7A B;  3SR1 A;  2WB1 G;  5TSS A;  2K5D A;  4H44 C;  3HKZ G;  2SOB A;  2JP1 A;  1XTC D;  3S9W A;  2JA5 B;  1QNK A;  4NXM Q;  1X9N A;  1S72 A;  2MHV A;  1Q81 C;  3MXN A;  3W1B A;  4C2M H;  4K0K Q;  1PH7 A;  2E2I B;  2JEB I;  5FLM H;  1AFP A;  5T1G A;  2RVL A;  3CPW A;  2EYO A;  4X3S A;  2WAQ E;  1PZJ D;  2CCZ A;  1BF4 A;  4OIK A;  4B3R L;  3CCE A;  2NVT B;  4NKL A;  3IAY A;  4A93 H;  4GN3 B;  1W6K A;  2DUD A;  2MPM A;  3HEJ A;  1SNQ A;  4XQJ A;  4A3E B;  1DJR D;  4QF4 A;  4AYB B;  3JAM i;  2HD3 A;  5EQ0 A;  1JOQ A;  2B29 A;  2BOS A;  1NY4 A;  4DU9 A;  3ONA B;  4DPG A;  1CKN B;  5JPM C;  2K6A A;  3AFQ A;  1TXY A;  3STB D;  3R2I A;  5H1S E;  1XNQ Q;  1G51 A;  4A3K G;  3H3V I;  1NUC A;  1G91 A;  1O78 A;  4FYD A;  3NP8 A;  1VS0 A;  1F2L A;  1RDP D;  3L9A X;  1SMY C;  5FLX c;  2VQF Q;  1Y1V H;  1YNX A;  4IJL A;  2MGS A;  3OOC A;  2NVX H;  4YWL A;  1SNP A;  3J81 j;  5EKK A;  2E2H H;  1PYB A;  2O2L D;  3CP0 A;  4A3I B;  1AP0 A;  3EQL C;  5IYC H;  4A3B B;  1B44 D;  1Y8P B;  1MSG A;  2CKZ B;  5KYL A;  4ZKC B;  1CKO A;  2EXZ A;  3TS0 A;  4YCV A;  2A5H A;  1EIG A;  4LWC A;  4O42 A;  4LFA Q;  3S1Q B;  2WAQ B;  2PPB C;  5DM7 3;  3OIP A;  1GVP A;  1STA A;  2DJF C;  1TWC H;  3NTI A;  4KKS A;  1ILQ A;  2KCC A;  1YJW A;  3U58 A;  1L2F A;  4FVM A;  5M5W B;  1MD2 D;  1V8Q A;  4RAU C;  1CHP D;  5L37 A;  2MO0 A;  1EY9 A;  3J81 E;  3GTK H;  1Q86 C;  4LF5 L;  3TME A;  1U4R A;  5M3M G;  1CQF A;  2YTV A;  2R92 H;  1FNV A;  1PTO B;  3EBE A;  3EN2 A;  2LSS A;  2QCP X;  5EBD A;  5IP9 H;  3PIO A;  4CKE A;  3F2C A;  2B8F A;  4HSP A;  1N32 Q;  4OO1 G;  3KOJ A;  1EEF D;  1ASZ A;  1VQ4 A;  3PUZ A;  1SEB D;  4I7A A;  4A3D G;  3C3L A;  3E9I A;  1EYC A;  1A3U A;  4TQU S;  1U5K A;  1AH9 A;  1XMQ L;  1PRT B;  3S1R H;  3ER0 A;  1SXT A;  4UP8 A;  1VQP A;  3NWT A;  1YHA A;  2KVM A;  1UNS A;  4BY7 B;  4NW2 A;  2IT1 A;  5CGK A;  5FK9 C;  1VQC A;  4FXK C;  2I5L X;  5AFW A;  3MXN B;  3U50 C;  3D4W A;  4GKK Q;  3HOZ G;  4KKT A;  1SE8 A;  4TVA B;  4KN7 C;  1B70 B;  2VUM G;  1X3E A;  1JJG A;  5M5X H;  3HOX B;  1RL2 A;  2F0T A;  2M9V A;  1JOR A;  1J6Q A;  1DOL A;  4IN3 A;  3L7Z C;  3M4Y A;  1WCM B;  2SNM A;  3LWE A;  5COY A;  4GLV B;  1QVF A;  4HSV A;  3M4O B;  3SK8 A;  4DAM A;  3OMG A;  5LMN W;  1ASY A;  3OTO L;  3UE0 A;  3VR2 A;  2KA7 A;  3E6Z X;  4HAE A;  1TY0 A;  3RN5 A;  2F0F A;  2VXW A;  4GLA C;  3S17 H;  3FKI B;  3MZ5 A;  1J8I A;  2L1B A;  2CW0 C;  4NP5 A;  5IGD A;  4A3J B;  3DWQ A;  3HS0 C;  4IPD A;  2P5Z X;  1I94 L;  3B6Y A;  5M3M H;  3UDG A;  1STN A;  4HIM A;  3GV3 A;  1LM0 A;  2YYZ A;  1NR2 A;  1TWG H;  1IL8 A;  3DEO A;  5HY6 A;  4A3F G;  2A6H C;  4QY7 A;  5JVG 3;  1YHB A;  3R93 A;  1H9M A;  4OO1 H;  2UUC Q;  5D3D A;  2KBN A;  1MJC A;  3PMF A;  4HJ8 A;  2DNE A;  3MEF A;  4A3D H;  1PVO A;  5IWA Q;  3FMC A;  3RLF A;  1WTO A;  3URY A;  1GJX A;  3C1F A;  2ZM6 L;  3MTS A;  2NVQ H;  4OEL B;  4C3H G;  2B2W C;  2DY7 A;  2VQE Q;  4H7B A;  1FNU A;  1C4Q A;  3CD6 A;  1LT3 D;  3G7L A;  1VQA A;  2VL6 A;  3A55 A;  3HOZ H;  1EUJ A;  3BDC A;  1ML0 D;  4JV5 Q;  4JBW A;  2RDF A;  1AZP A;  4GNX C;  1EYD A;  1VQK A;  2MO1 A;  4LMQ D;  2A1A A;  2MNA A;  5E1F A;  3HKZ E;  1KNE A;  1BBU A;  3CMA A;  5J1Z A;  1ESF A;  2ASB A;  3U9O A;  1NR4 A;  4H0L C;  1Z47 A;  4KLK A;  2X6L A;  3P7J A;  3M3Y B;  4CHT B;  4JI8 L;  3V05 A;  3FDT A;  4RGO S;  4A93 B;  4X3K A;  2Z4H A;  2UUA L;  3E5S A;  3CCL A;  3GTM H;  2I5M X;  4B3S Q;  1A2T A;  3PUY A;  1K83 H;  3JAM E;  4CBV A;  1L1O A;  2ZXP A;  3EA6 A;  4NDX A;  2OT2 A;  1UWV A;  4CDE C;  3F1Z A;  1N34 L;  4G7H C;  1VQ5 A;  2EE1 A;  1I4R A;  1TWH H;  1YIJ A;  2KHI A;  2CH4 A;  2IHF A;  3EFX D;  1HRJ A;  1WOC A;  3SK5 A;  1XX8 A;  1YHQ A;  2K32 A;  4JK1 C;  3VYT A;  3H09 A;  1IBM L;  3A8I E;  1Y1V B;  2HDL A;  4CDC C;  1EIH A;  3IFT A;  4JI6 Q;  1Z6H A;  3GTL H;  2E2H B;  1TU2 B;  3G6J B;  4CGY B;  1I50 B;  4C3H H;  5CBE E;  4MIU A;  5DAU A;  3G48 A;  4PG3 A;  5T1I A;  3G4S A;  4FXD A;  2WB1 B;  2C9O A;  4C56 C;  3EIV A;  1OXS C;  3MEH A;  3HKZ B;  4QIW E;  3OWE B;  4G4K A;  4JI1 Q;  4ME5 A;  1SMY D;  1F9Q A;  5C4X G;  4OIJ A;  1YZ6 A;  2E2J H;  2R93 H;  1SE3 A;  2A68 C;  1SYE A;  1TWC B;  4DV1 L;  4CJ2 C;  4LFB L;  2JK8 A;  1SYB A;  4KY6 A;  4DR3 Q;  2F0M A;  4X62 L;  3J80 c;  3NTH A;  3WOE A;  1BQQ T;  2ZT9 C;  3D4R A;  3H94 A;  3M4Q A;  5IGG A;  1RJT A;  3I56 A;  3GTK B;  3C2P A;  2WV6 D;  3H91 A;  1TQO A;  2Z1C A;  2R92 B;  2E8G A;  1HTL D;  2D0O A;  2F0K A;  2AQ1 B;  3A54 A;  3QIA A;  4WJW A;  2KCT A;  2PZT A;  2RDH A;  3A56 A;  4L5R C;  3PO2 G;  4HJA A;  4HJ9 A;  3T1H Q;  4EQN A;  4L5S A;  3DHQ A;  1HNW L;  2RHS B;  4XYQ A;  1SAP A;  1AZQ A;  3TP7 A;  1NSN S;  3PUX A;  1I4X A;  1GHK A;  1HHV A;  2R7D A;  1IXR A;  4WJ4 A;  2F0V A;  2RCF A;  4XQN A;  3GP7 A;  4HJ5 A;  3S1R B;  1QZG A;  4CKB A;  3SK6 A;  3CCJ A;  4J1M A;  1HPC A;  1EWI A;  1VF5 C;  3LGJ A;  3BVZ A;  1OXX K;  2ZTC A;  4JI0 L;  2JQO A;  4KD4 A;  4Z9C B;  4DR4 L;  2CWA A;  4B3M Q;  3NK9 A;  3RLN A;  4LF4 L;  5HGQ A;  1B2T A;  3NUC A;  1EY0 A;  2EYL A;  5M5X B;  4LK1 C;  3NEN A;  1EQT A;  3VYR A;  2JA9 A;  2KEC A;  1W6J A;  4M1U B;  3FPU B;  4FF2 A;  3CCM A;  5C4X H;  2WP8 J;  3P20 A;  4KI0 A;  1X54 A;  1M1K C;  1D5M C;  4PZ8 A;  1II3 A;  4JI3 Q;  1ENA A;  1MKH A;  4IUV A;  2QIL A;  5C3E B;  5IT9 E;  3G6E A;  1EZ6 A;  4DNI A;  1R4Q B;  1BVS A;  1JIC A;  2JA8 G;  4H02 A;  4DV7 Q;  5IGB A;  1GM5 A;  3S17 B;  4DR1 Q;  4OX9 L;  1L1O B;  1F9R A;  4OON A;  3H0G G;  3KJP A;  4L5T A;  1B50 A;  4JBK A;  2GN5 A;  5KGU A;  1LTI D;  5M3M B;  3MHB A;  4BBR G;  4X66 L;  3OW2 A;  1IKL A;  2VB2 X;  1TWG B;  5IGF A;  1A0I A;  2B63 G;  4DV5 L;  3PO2 H;  2Z0S A;  3NTK A;  4JI4 L;  2TSS A;  1V1Q A;  1BO0 A;  5EKI A;  2E5L Q;  1PRT C;  4IFD J;  4KHZ A;  4JYA Q;  3I7F A;  4Y7N H;  2CW0 D;  2L5T A;  2D0P A;  3OW7 A;  1TS5 A;  1D1K A;  1Q1B A;  1UEB A;  4A3D B;  1AE3 A;  3UE1 A;  4QUC A;  3J80 L;  3J7A V;  1FGB D;  1DM0 B;  1W2B A;  1ET9 A;  4WFN 3;  2HT1 A;  2NVQ B;  3MWY W;  4EQO A;  1G29 1;  2AUJ D;  2A6H D;  4KHP Q;  2RBM A;  1E2Z A;  1D2B A;  1OXU A;  2K03 A;  4HCE A;  4CDD C;  1TVX A;  3HOZ B;  1D1I A;  1B7Y B;  3M7N A;  3GTP H;  1FVI A;  3PF4 A;  4ZYS A;  3PCO B;  2JSO A;  4TRD A;  1SE4 A;  3CRL C;  2EJF C;  3CCS A;  1JWS D;  2JA6 G;  3U4V A;  1ZEQ X;  4WOR A;  3GTJ H;  4DV0 Q;  1GUO A;  1JR0 D;  4QMG A;  4XYO A;  1EU3 A;  4UP9 A;  1KL9 A;  2GVB A;  1SBB B;  3W3A A;  1IHZ A;  4X64 L;  2JA8 H;  3KF8 A;  3HGB A;  1D5X C;  3S15 H;  4P2C B;  1D7Q A;  2R6G A;  3N52 A;  1G6P A;  3VR5 A;  4AQY Q;  3GTM B;  5CV9 A;  1ZYR C;  1QWY A;  5EJW A;  2QEJ C;  5KNB A;  2IX3 A;  5LMN Q;  1K83 B;  3FRP B;  3L3O C;  4BBR H;  1N33 Q;  4DXF A;  1HR0 W;  4KJN A;  1J9O A;  2NBF A;  5J3B A;  2B63 H;  5M3F H;  1IKM A;  2EDG A;  4LF6 Q;  1E1O A;  1S5F D;  4OXP A;  3CF5 A;  4GKJ Q;  1FJG L;  1PH2 A;  1SRO A;  1TWH B;  1NNX A;  4YHH Q;  4MHE A;  4GS3 A;  5BR8 Q;  2VS1 A;  3D0F A;  1KIX A;  5M5Y H;  4PZ7 A;  1BCP D;  1RD9 D;  1A8V A;  2WIN B;  5C5M A;  1YNN D;  1F2M A;  1SMX A;  1Y14 B;  5M9O A;  3L2P A;  5COR A;  3GTL B;  1CT1 D;  3ERS X;  2B2Y C;  4LFC Q;  4C3H B;  5EBC A;  3VR3 A;  1I3Q H;  4RKL A;  4DKA C;  4DNT B;  4QL5 A;  3R2T A;  3DXJ C;  2BE5 C;  1HXY D;  2ZJQ A;  4BWG B;  1HNX Q;  3TRE A;  2UXC L;  2F0S A;  2ATW A;  2C35 B;  3K5L A;  2ES2 A;  5A2Q L;  3W1G A;  2R7Z H;  3NBI A;  1DON A;  2EY1 A;  3MC0 B;  5IYB G;  2R93 B;  1X55 A;  5FO9 B;  2UU9 Q;  1BDO A;  1A3T A;  4LW1 A;  2JA6 H;  3M7G A;  1STB A;  5C4J H;  1DD2 A;  4HN7 A;  2YU9 H;  3BDO A;  1C48 A;  1M90 C;  4DK6 C;  2H1E A;  1VQ7 A;  2AMC B;  3T16 A;  3OMC A;  1U4M A;  3CRK C;  1KNA A;  3HOY G;  2Z9H A;  1IBL Q;  4DN4 M;  2A68 D;  3RMH A;  3PGZ A;  2N55 A;  1V1O A;  2HQL A;  3OSO A;  1Y1W G;  1DZ1 A;  2F4V Q;  3A5Z B;  1SNO A;  1TII D;  4RHS A;  4EGV A;  1S40 A;  4NXN Q;  2PNR C;  4PQX A;  2K05 A;  1LT5 D;  1XXG A;  2A73 B;  1W3S A;  4WRD A;  4IO9 A;  3CHB D;  4DR7 L;  2XWJ B;  2YTY A;  1ZKO A;  1ICW A;  1SSO A;  3T13 A;  3CCU A;  4HMI A;  2OWO A;  2NVY H;  2DY8 A;  2HHH Q;  3PUW A;  1LTA D;  4K5W A;  1IBK L;  2V4D A;  3DUZ A;  2EJM A;  1A62 A;  1K0R A;  4LF8 Q;  1SYG A;  2KEE A;  3HOW H;  4KJO A;  2F0I A;  4BXX G;  1SFO H;  2L12 A;  5C3X A;  4YY3 Q;  1CA5 A;  1BKB A;  1EWC A;  2UXB Q;  3DWP A;  2WAC A;  4NB3 A;  4A3L G;  2FMM A;  1IYU A;  4UPA A;  1VQL A;  1EQV A;  1XMO Q;  1BNZ A;  4GN5 A;  1PRT F;  4JI7 Q;  2ENB A;  3H6M A;  2O5I C;  2F0J A;  1P16 A;  1N9W A;  1X32 A;  3A5U A;  3KJO A;  5C4X B;  1E3P A;  1RTO A;  2HQE A;  5IYB H;  4A3M G;  1I4P A;  2RCN A;  4DV6 L;  1VQO A;  3KF8 B;  4PMB A;  1KDB A;  3Q8D A;  1G8Z D;  5AJ3 Q;  1ILP A;  1SN8 A;  2QDB A;  3GDE A;  4EX5 A;  5JJK A;  1EZ8 A;  2H5X A;  4GOP A;  1B1Z A;  4R8N A;  2CQO A;  3X3M A;  4JCV E;  5E7N A;  4C3I G;  4HIO A;  4IFD I;  4APV A;  1HZA A;  4Q0F A;  4NMZ A;  4NXM L;  4IOC A;  1NE3 A;  2KQ3 A;  5D65 A;  4IPH A;  4WJ3 M;  1A3V A;  1PFN A;  3HOY H;  4K0K L;  1ET6 A;  1E7Z A;  2Y0S G;  1RKN A;  1K3R A;  4Y52 H;  2JN4 A;  1S3O A;  1NBW A;  1GOZ A;  1Y1W H;  4KN4 C;  2HCC A;  4ALP A;  5HGT A;  3VYU A;  4JBM A;  4DV2 Q;  4A3K H;  3U4Z A;  1N8R C;  2L9H A;  3T53 B;  5CYU A;  4RWS C;  1CTM A;  2F0Q A;  4Y7N B;  1KQS A;  2EYM A;  3I4O A;  1GUS A;  1Z7T A;  5CV5 A;  1PH6 A;  5BN3 A;  3T1Y Q;  1B53 A;  1HFG A;  2OCE A;  1LO5 D;  4FNF A;  1PH8 A;  3NQT A;  5EGT A;  5F2D A;  2CH4 W;  4K14 A;  1PRT D;  1R4P B;  2D9U A;  3I91 A;  1DYQ A;  4IUR A;  1MIU A;  1XNQ L;  1X3Q A;  2HIX A;  1HH2 P;  3GTP B;  4LNQ A;  1K73 C;  4LF7 Q;  5CBA E;  4BBS G;  4A3L H;  1LYL A;  4OGQ C;  5DNF A;  1CZG A;  2A6E C;  1PFM A;  4XXE A;  1R9T H;  2ZXR A;  4JC0 A;  5JOB A;  4J8Q A;  2MJ8 A;  1G2T A;  3RNU A;  2K01 A;  2VQF L;  1UE6 A;  5FLX L;  3H15 A;  2E75 C;  2K1B A;  2OTL A;  1SE2 A;  1QVC A;  2D62 A;  2RHQ B;  4A3M H;  2IL8 A;  3GTJ B;  1B3A A;  2IPK D;  4K8J A;  4JPB W;  3PIO 3;  3AU7 A;  2JXM B;  2RSO A;  1L1O C;  1WTP A;  3I4M G;  1SJH D;  4CJ1 B;  5FJ8 G;  2JA8 B;  2X6G A;  2MUY A;  3WOF A;  4A75 A;  3S15 B;  4KV6 A;  4IUN A;  4P71 A;  4DV3 Q;  1IL2 A;  4LFA L;  1IW7 C;  1N36 Q;  2IW3 A;  5EPL A;  4RCO A;  1I4G A;  3EVQ A;  3IL8 A;  3FHW A;  2B2T A;  1V9P A;  4BBR B;  2ALY B;  1XPR A;  3K0X A;  3PUV A;  2NN6 G;  2ZXO A;  1XPO A;  2TMP A;  5M3F B;  1LV9 A;  3PF5 A;  2FHT A;  5C44 G;  1WTX A;  4JBJ A;  1F2Z A;  2WKC A;  2YV5 A;  1VQN A;  4P74 A;  4R4C A;  5I6W A;  2IY5 B;  5I9O A;  3HOV G;  1CSQ A;  3CC2 A;  2MFI A;  5M5Y B;  2EPB A;  1ZYR D;  1EOT A;  2RA4 A;  1FL0 A;  2EY5 A;  4U68 A;  2RQX A;  4DAP A;  2EQS A;  2NZ1 D;  2AWN A;  4TSS A;  2UUB Q;  3PIP A;  4R9W A;  3ULJ A;  2I0Q A;  4A3G G;  3MXU A;  2R7F A;  4RKB A;  1LAB A;  4P73 A;  4ZCK A;  3V96 A;  1N32 L;  1I3Q B;  5IYD G;  2VUM H;  4X65 Q;  2UXD Q;  5D3I B;  1A15 A;  2XN9 C;  3NPP A;  4C2M B;  4JI2 Q;  2WB1 E;  2F0D A;  5IP7 G;  1PHJ A;  1GO3 E;  1S5C D;  4BBS H;  2NUC A;  3NWS A;  3T51 B;  2R7Z B;  3JC6 6;  1WI5 A;  3TP6 A;  2JA5 G;  4N9P A;  4GOP B;  3GTG H;  5CMD A;  4DK1 A;  3V2T A;  2JA6 B;  2XRQ D;  1TY2 A;  4RFB A;  5C4J B;  3VR6 A;  4PZ6 A;  3IKJ A;  1HJP A;  4RCN A;  2YU9 B;  4DUY Q;  4C3J G;  1F2Y A;  2B3G A;  2BE5 D;  1RHP A;  2FXQ A;  5GAG C;  4GLX A;  4GKK L;  1X3P A;  2L15 A;  5EAY A;  5FJ8 H;  3TBI B;  1BCP C;  1LTB D;  1EIY B;  2OXP A;  1IYJ B;  5NUC A;  2AHO B;  2SNS A;  4JOI A;  3TP5 A;  1YJ9 A;  1PH4 A;  1EYG A;  1KXL A;  1YNN C;  4H13 C;  4BA1 I;  1CM9 A;  5LL6 X;  4LF9 Q;  3FVQ A;  2N3S A;  4C1N I;  2AWO A;  3S24 A;  3QO2 A;  3HP3 A;  1J5E Q;  4A3F H;  2LXJ A;  4X6A H;  3QWN A;  2F0E A;  1HA5 A;  3SVM A;  4M8A A;  2A74 C;  4AYB G;  5BN4 A;  3CME A;  2E76 C;  2I5H A;  4LAA A;  2K4K A;  3S2H H;  2OTJ A;  2NN6 H;  1AW7 A;  2F0N A;  1XWE A;  2G5D A;  3D6C A;  1JOO A;  1EWH A;  5C44 H;  3HFZ B;  3T56 B;  1Q82 C;  1JCK B;  4B3T Q;  2NVY B;  3P75 A;  3HG9 A;  3HOV H;  1VQ6 A;  1WD1 A;  1TS2 A;  1VCI A;  2NVX B;  4KHV A;  2LMC B;  3GV6 A;  1HR0 Q;  5D14 A;  4QGU A;  4O2D A;  3HOW B;  3OYY A;  1ROD A;  3F8T A;  1PH9 A;  2Z6K A;  2XIW A;  2Q8R E;  2HDM A;  4DR6 Q;  4A3G H;  1SFO B;  1XNR Q;  5C4Z A;  3BVM A;  3D3R A;  5IYD H;  3PQI A;  2UUC L;  2QEX A;  3VA5 A;  1WJJ A;  1UUP A;  2PW5 A;  2OF1 A;  5IP7 H;  2IJ0 A;  1HTP A;  3D4D A;  5KYI A;  5IWA L;  1ESR A;  2B2U A;  2JA5 H;  4LJZ C;  2L11 A;  5LHY 1;  1Y8O B;  2WAQ G;  3KLR A;  1KD1 C;  4FF1 A;  1XPU A;  2XGT A;  2E2I H;  3S16 H;  1OXT A;  2VQE L;  4PV1 C;  5IIF A;  1UE7 A;  4C3J H;  5G3L D;  3ERQ A;  1DOK A;  1VQF A;  5FKA C;  5LMU Q;  4JV5 L;  1JOK A;  3HRZ C;  4YCW A;  4I65 A;  3AYH B;  2L55 A;  1F77 A;  4A76 A;  1YJN A;  1KDA A;  3HOY B;  4JI2 L;  4LUO A;  3CAM A;  1Q12 A;  4XIG S;  1JWM D;  4DR5 Q;  3HKS A;  5E3F A;  1Y1W B;  2CHB D;  3CW2 C;  4EQP A;  3A74 A;  3A8K E;  4N8X 1;  4K2L A;  2KHS A;  4A3K B;  4JI5 Q;  3RLO A;  3ICE A;  2WFW A;  4CJ0 B;  4RA8 A;  2NTT A;  4DUZ Q;  3F2B A;  2ZJP A;  3BU2 A;  4B9W A;  4KKU A;  1T9H A;  4L5Q A;  1DGS A;  2EJG C;  4RGN A;  2IX1 A;  4B3S L;  3L0O A;  4X3T A;  4RMF A;  2PMZ B;  1HNZ Q;  2K52 A;  3S1M H;  4ZUI A;  4ZKB B;  1K9M C;  3M85 A;  2HUG A;  3J7Y W;  3I73 A;  2EY2 A;  4P72 A;  3VYS A;  4BY7 G;  1I5F A;  4DV4 Q;  1EQQ A;  2SDF A;  3T4A C;  3FP9 A;  1PV4 A;  4ZAI A;  1X56 A;  2HIV A;  3SXH A;  2JA7 G;  2C5C A;  1EYA A;  2RKS A;  3ERO A;  3KF6 A;  2NYZ D;  4N8F A;  1S5B D;  1R9T B;  1QE6 A;  2R61 A;  1UAP A;  4IFD G;  5CV4 A;  5I6Y A;  4DR2 Q;  1VDZ A;  3HOX G;  3SGI A;  3SE0 A;  4MNO A;  3WWV A;  4A3M B;  5EKL A;  4OL7 A;  4JI6 L;  1KRT A;  4FO2 A;  5GAE C;  2B2V A;  5CR3 A;  4ZLT F;  4RH6 A;  3S14 H;  5IE8 A;  2BA0 A;  2KOL A;  2CWP A;  1I4Q A;  1PTO C;  3BS1 A;  3H3V C;  5J39 A;  4FP5 D;  1QJO A;  5FO8 B;  1QIL A;  2F3W A;  2A6E D;  2DGY A;  4JI1 L;  2AKW B;  3S2D H;  5I2Y A;  1KAB A;  3Q24 A;  2IWH A;  3TEH B;  1F9P A;  2J4X A;  4A3J G;  3PV0 A;  4IQZ A;  4UHV A;  5K36 G;  1I4H A;  1Q1E A;  1PMR A;  4EQ5 A;  3KLS X;  1JE4 A;  3GO5 A;  2Q8I B;  1KC8 C;  2EZV A;  4DR3 L;  1K8G A;  4BY1 G;  2J7Z A;  3KLW A;  1CZW A;  2QKI C;  4HMJ A;  1IW7 D;  2NN6 I;  1BCP F;  3NQI A;  2DN8 A;  1Z9F A;  2L0C A;  5C4H A;  5CV6 A;  1X6O A;  2K5V A;  1EEI D;  3OWF A;  1SYF A;  3T1H L;  1PZI D;  4A3C G;  2VUM B;  2K33 A;  3J7A F;  1BUV T;  1LTR D;  4UAI A;  4B3R Q;  2JA7 H;  1OTC A;  4HIK A;  3CQZ H;  3RN2 A;  2B39 A;  4E6I A;  4V19 0;  3J7A 5;  1QUQ A;  3RZO H;  4IFD H;  3C1E A;  3GTO H;  2PQA A;  2F0O A;  4LUZ A;  3TZU A;  3TN2 A;  5GRO A;  3CCR A;  3I4N G;  2D5D A;  1X65 A;  3HOX H;  3GTG B;  3Q22 A;  5GQO A;  4HR7 B;  5C0X G;  4FDB A;  5C5L A;  4GNX B;  2KJX A;  5CV7 A;  3Q23 A;  3TSS A;  2PYK A;  4R4I A;  1RIP A;  2NB0 A;  4B3M L;  1CK1 A;  5FLX E;  3H0G H;  3KDF A;  1XJV A;  2XRS D;  4K2K A;  2QA4 A;  5A35 A;  3F2U A;  3RUZ A;  3J7Z C;  4IOA A;  1KHI A;  2EVB A;  5IY0 A;  2OEO A;  4A93 G;  5IOD A;  3A7L A;  2Z4I A;  4A3F B;  4A3J H;  5K36 H;  4JI3 L;  1CHQ D;  2IHE A;  3E0E A;  3IFD A;  1CKM A;  1HCZ A;  4BA2 I;  2K14 A;  3AQQ A;  3AMU A;  4J6H A;  4DAY A;  1TS3 A;  4BY1 H;  4DV7 L;  2A69 D;  3UI2 A;  5IT9 c;  4DR1 L;  4IJH A;  5C0X J;  3HOV B;  4OEM B;  3GQB A;  5DM6 3;  4AIM A;  1RF2 D;  3AEV A;  4OWT B;  2G9D A;  1JB3 A;  2AQ2 B;  1K28 A;  3J80 i;  5ELB A;  2F3I A;  4IZ8 A;  2OQ0 A;  5KND A;  2N8N A;  4U67 3;  3ZYY X;  3KF6 B;  1U4L A;  1I6H H;  4RG1 A;  2Q2H A;  1QB5 D;  2XNA C;  4A3C H;  1E24 A;  2JYO A;  4DAV A;  2E5L L;  2KCM A;  2KCN A;  4JYA L;  3BVG A;  2JJQ A;  2E2J B;  1NCV A;  1OO9 B;  1L0W A;  4LF5 Q;  4YIJ A;  1EFI D;  4TKO B;  1JB7 A;  3K81 C;  2N78 A;  4P75 A;  1JWU D;  3A0J A;  3CXC A;  1BOS A;  2K04 A;  1A6X A;  2EYJ A;  2CVR A;  3I4N H;  3IRB A;  1LT6 D;  2ID0 A;  4XTC S;  3S16 B;  2PZW A;  2KHJ A;  4KHP L;  3U9S A;  1HQR D;  5C0X H;  1A2U A;  4A4I A;  4C3J B;  4IUQ A;  1Q7Y C;  1PYW D;  1SJE D;  3KLS A;  1WTV A;  3PO3 G;  1Y8N B;  2DJG C;  5K5P A;  2K7V A;  2A8V A;  2HCI A;  3CC4 A;  1HQM C;  3NSW A;  2LXK A;  1XMQ Q;  4POG A;  1EY4 A;  3M3Y H;  1JQY D;  1HA6 A;  1C9O A;  3SEB A;  3F2D A;  1WVL A;  1VQ8 A;  2F0G A;  1LUZ A;  1LTS D;  3HOU G;  2MQH A;  1SNM A;  5ELO A;  1QVG A;  1P8L A;  3FEW X;  2LS0 1;  2R92 G;  4DV0 L;  3QOJ A;  3M4P A;  3W2D A;  5CC4 A;  5JEA G;  4MN3 A;  4EVO A;  1TR5 A;  1EY5 A;  4F7X A;  3CCQ A;  1VQD A;  4FF4 A;  4HCS A;  3BZC A;  1PFB A;  5IP9 G;  3K5O A;  4R8I A;  1HUM A;  2KED A;  2VZA A;  1YI2 A;  4XDX A;  2GA4 B;  2N49 A;  2QF7 A;  1PTO F;  1A63 A;  3BYT B;  1YBY A;  3GD7 A;  3BYY B;  4AQY L;  4LUV A;  3RD4 A;  3S1M B;  1DOM A;  1GKH A;  5LMN L;  1ZXT A;  3PSI A;  1N33 L;  1NAP A;  2YTX A;  3DEP A;  3OTO Q;  4DK0 A;  1LAC A;  5JJZ A;  4LF6 L;  1QUQ B;  4GKJ L;  1H95 A;  3G71 A;  1E0B A;  2Q8T A;  1OXV A;  1BBW A;  2PQA B;  3MXG A;  2E2D C;  2EY6 A;  1I50 H;  3BDL A;  4YHH L;  5BR8 L;  1AE2 A;  3QJY A;  5JEA J;  4HJ7 A;  1SNC A;  1I94 Q;  2PI2 A;  3D8G A;  1TWA H;  3I3C A;  1EFW A;  1H9J A;  5IT9 L;  3KDF B;  1I6V C;  4I7Z C;  2B2Y A;  3S14 B;  4LFC L;  2B2T C;  4QQB X;  3SDZ A;  4X3U A;  5C6A A;  2F0U A;  2B8G A;  4QUF A;  1HUN A;  5C3E G;  1HFN A;  1HNX L;  3W5O A;  3PO3 H;  2EYP A;  3ND9 A;  3S2D B;  2IX0 A;  4OHJ A;  1PLF A;  2L4N A;  1WFQ A;  2ZM6 Q;  3PO2 B;  2UU9 L;  3SHL A;  3HOU H;  4DAY B;  2O4X A;  2KUM A;  3OIQ A;  1H9S A;  3R3O A;  5JEA H;  1BXT A;  1DCZ A;  1VQI A;  3MA2 B;  1PTO D;  3K80 C;  1STE A;  3LNN A;  2Z8L A;  2NWG A;  3N6R A;  2F0P A;  3KBG A;  3VDY A;  2PO4 A;  2I07 B;  1E1T A;  2QW7 A;  3AFP A;  2SEB D;  4V0B A;  1K3B C;  1IBL L;  2EOT A;  1X3F A;  1K8A C;  4BXX H;  4R4O A;  3CC7 A;  2WII B;  2F4V L;  3TS2 A;  5JVH 3;  1E22 A;  3KK7 A;  3BZK A;  2RF4 A;  4NXN L;  2XVS A;  2WKD A;  1K8O A;  3SK4 A;  4JI8 Q;  2JA7 B;  2K50 A;  2UUA Q;  1FNW A;  3CQZ B;  5E4X A;  3GTQ H;  2HHH L;  3BJU A;  2M00 A;  3CPF A;  3RZO B;  1MBY A;  5KRU A;  1EOV A;  3GTO B;  1KAA A;  5EPK A;  2PI2 E;  4JOI C;  5DEH A;  1STG A;  2AUK A;  2XTI A;  1SYC A;  3FPP A;  4LF8 L;  4PNY A;  1Q8I A;  4F8M A;  1E2V A;  3LX0 A;  4IUT A;  1CSP A;  3UDX A;  4YY3 L;  1Q90 A;  2BDN A;  1VMC A;  1VQH A;  2Q2I A;  4C3I H;  2V1C C;  2DNC A;  2F0W A;  1HZB A;  1N34 Q;  1NJI C;  4OWX B;  2UXB L;  3H0G B;  3K57 A;  5IOC A;  1O80 A;  5C3E H;  4JW0 A;  3ITP A;  1XMO L;  4JI7 L;  5C0X I; 
#chains in the Genus database with same CATH homology
 2WAQ G;  1OXU A;  3H3V I;  1KD1 C;  1IBM Q;  1XPU A;  2XGT A;  2E2I H;  3S16 H;  1VS0 A;  3K8A A;  1OXT A;  2VQE L;  3M7N A;  1B7Y B;  3GTP H;  1FVI A;  5FLX c;  1UE7 A;  3M9B A;  3PF4 A;  3ZJY C;  4C3J H;  5AJ3 L;  3PCO B;  2VQF Q;  1O7I A;  1VQF A;  1Y1V H;  1YNX A;  5LMU Q;  4IJL A;  4JV5 L;  2NVX H;  4IPC A;  4YWL A;  3J81 j;  2E2H H;  1PYB A;  2Z6K C;  3CP0 A;  4YCW A;  3AYH B;  1YJN A;  4A76 A;  3CCS A;  2K75 A;  5IYC H;  2JA6 G;  3U4V A;  4JI2 L;  3GTJ H;  4DV0 Q;  4LUO A;  4YWM A;  3CAM A;  1Q12 A;  4YWK A;  4XIG S;  2CKZ B;  3J81 c;  4DR5 Q;  2EXD A;  3HKS A;  4UP9 A;  1CKO A;  2Q2T A;  1KL9 A;  2GVB A;  3CW2 C;  3A74 A;  3TS0 A;  4YCV A;  4X64 L;  4JI5 Q;  4LWC A;  4LFA Q;  2JA8 H;  3RLO A;  3ICE A;  2WFW A;  4DV1 Q;  3S15 H;  4LFB Q;  1D7Q A;  4DUZ Q;  1GVP A;  2R6G A;  3F2B A;  4DV2 L;  1G6P A;  2ZJP A;  4AQY Q;  3BU2 A;  1TWC H;  1T9H A;  4L5Q A;  4X62 Q;  1YEZ A;  1DGS A;  5LMN Q;  4BBR H;  1N33 Q;  2IX1 A;  1HR0 W;  3L0O A;  4B3S L;  3NEL A;  4RMF A;  1YJW A;  3U58 A;  1L2F A;  1HNZ Q;  2K52 A;  5J3B A;  3S1M H;  2NZO A;  5M3F H;  2B63 H;  1K9M C;  3M85 A;  4LF6 Q;  1E1O A;  2MO0 A;  4OXP A;  1CUK A;  3CF5 A;  3T1Y L;  1FJG L;  3GTK H;  4GKJ Q;  1PH2 A;  1SRO A;  1Q86 C;  4P72 A;  4LF5 L;  4YHH Q;  1I5F A;  4GS3 A;  5M3M G;  1TWF H;  5BR8 Q;  4BY7 G;  2VS1 A;  2YTV A;  4DV4 Q;  1EQQ A;  3D0F A;  2R92 H;  1PV4 A;  1KIX A;  3FP9 A;  5M5Y H;  4PZ7 A;  3I4M H;  1X56 A;  2HIV A;  1A8V A;  2JA7 G;  3EBE A;  3EN2 A;  2LSS A;  3KF6 A;  1HNW Q;  2Q2U A;  1SMX A;  5IP9 H;  1NMG A;  3PIO A;  1Y14 B;  3F2C A;  1HZC A;  1EQR A;  3L2P A;  4IFD G;  1N32 Q;  2K5N A;  4POF A;  4DR2 Q;  3KOJ A;  5GAH C;  4LF7 L;  4OO1 G;  1ASZ A;  3HOX G;  3SGI A;  3ERS X;  1VQ4 A;  4MNO A;  4LFC Q;  3WWV A;  3PUZ A;  2VNU D;  4A3E G;  1I3Q H;  4DKA C;  4A3D G;  4JI6 L;  1KRT A;  3E9I A;  4QL5 A;  5GAE C;  3RZD H;  4TQU S;  1U5K A;  1AH9 A;  1XMQ L;  2ZJQ A;  3S14 H;  5IE8 A;  2BA0 A;  1HNX Q;  3TRE A;  4DK3 C;  3I55 A;  3S1R H;  2ATW A;  2UXC L;  2CWP A;  2C35 B;  3ER0 A;  2CFM A;  4UP8 A;  1VQP A;  2ES2 A;  1YHA A;  4JI0 Q;  3W1G A;  1JT8 A;  2NZH A;  2R7Z H;  4UP7 A;  4DR4 Q;  2IT1 A;  2DGY A;  4JI1 L;  5IYB G;  2AKW B;  1VQC A;  3S2D H;  1V43 A;  1X55 A;  2UU9 Q;  4LF4 Q;  2I5L X;  3MXN B;  4LW1 A;  3U50 C;  3TEH B;  2JA6 H;  4GKK Q;  3HOZ G;  1UE1 A;  1SE8 A;  4DV3 L;  3PV0 A;  4TVA B;  4A3J G;  2BA1 A;  5C4J H;  5K36 G;  1B70 B;  1Q1E A;  2YU9 H;  1NTG A;  1N36 L;  4EQ5 A;  2GVA A;  2VUM G;  1X3E A;  3GO5 A;  1M90 C;  1VQ9 A;  1JJG A;  4DK6 C;  5M5X H;  1RL2 A;  1KC8 C;  1VQ7 A;  1KAW A;  2AMC B;  1J6Q A;  2PMZ E;  4ME3 A;  4DR3 L;  3L7Z C;  1K8G A;  3E9H A;  4A3I G;  4BY1 G;  1QVF A;  4GLV B;  4A3B G;  3HOY G;  3KLW A;  3S1N H;  4DAM A;  4PMW A;  1IBL Q;  5LMN W;  3K7A H;  1ASY A;  3PGZ A;  1D8L A;  2NN6 I;  3OTO L;  1HZ9 A;  2HQL A;  2ZJR A;  1Y1W G;  3UE0 A;  1JJ2 A;  4OX9 Q;  2F4V Q;  3A5Z B;  3TRZ A;  3ULP A;  1Z9F A;  4DR6 Q;  3NEM A;  1S40 A;  4NXN Q;  1X6O A;  4A3G H;  2K5V A;  3RN5 A;  4UY8 C;  4GLA C;  3S17 H;  1WYD A;  4IO9 A;  1W3S A;  1PH1 A;  2UUB L;  4DR7 L;  5JJL A;  3T1H L;  4X66 Q;  4IPD A;  4A3C G;  2YTY A;  3CCU A;  1I94 L;  2NVY H;  2OWO A;  3B6Y A;  5M3M H;  3UDG A;  1SLJ A;  4DV5 Q;  4HIM A;  2HHH Q;  1Q8K A;  4B3R Q;  1LM0 A;  3PUW A;  2YYZ A;  1IBK L;  2JA7 H;  1TWG H;  1OTC A;  4JI4 Q;  4GNX A;  5HY6 A;  3STB C;  4HIK A;  4A3F G;  3CQZ H;  4X65 L;  3RN2 A;  1A62 A;  2UXD L;  3J7A 5;  1K0R A;  1QUQ A;  4LF8 Q;  3RZO H;  2NVT H;  4QY7 A;  1YHB A;  3HOW H;  3GTO H;  2PQA A;  4LUZ A;  4R4Q A;  1VQE A;  5GRO A;  3CCR A;  2UUC Q;  1SFO H;  4YY3 Q;  1X65 A;  3HOX H;  3I4N G;  2KBN A;  3KFU A;  1PH3 A;  1MJC A;  5GQO A;  4HJ8 A;  4A3E H;  1BKB A;  3MEF A;  4A3D H;  1PVO A;  2UXB Q;  5C0X G;  4NB3 A;  4FDB A;  5IWA Q;  4R1J A;  4GNX B;  4A3L G;  3RLF A;  1EIF A;  2Y0S E;  4UPA A;  4R4I A;  1VQL A;  1XMO Q;  1RIP A;  2ZM6 L;  4J15 A;  4B3M L;  4GN5 A;  4JI7 Q;  3H0G H;  3KDF A;  1XJV A;  1YVC A;  2QA4 A;  3UDI A;  4DUY L;  1P16 A;  1N9W A;  3KYH C;  3A5U A;  3KJO A;  2NVQ H;  1E3P A;  2VQE Q;  5IYB H;  3J7Z C;  4IOA A;  4A3M G;  2RCN A;  1KHI A;  5IY0 A;  2VW9 A;  4DV6 L;  1JJC B;  3CD6 A;  3D31 A;  1VQO A;  3KF8 B;  4A93 G;  3Q8D A;  5AJ3 Q;  1VQA A;  1SN8 A;  2VL6 A;  2ZTE A;  3HOZ H;  1EUJ A;  3GDE A;  4EX5 A;  1VQG A;  2H5X A;  4A3J H;  4JV5 Q;  4JBW A;  4LF9 L;  5JJK A;  4GOP A;  4JI3 L;  4GNX C;  2CQO A;  2EIF A;  1J5E L;  4JCV E;  1VQK A;  5E7N A;  2IHE A;  3E0E A;  2MO1 A;  4HIO A;  3DM3 A;  1JMC A;  4IFD I;  4APV A;  2PNH A;  1HZA A;  1CKM A;  2A1A A;  4NPS A;  4R4T A;  3JAM c;  2MNA A;  4NXM L;  4BA2 I;  4OO1 I;  3HKZ E;  4IOC A;  2K14 A;  3AQQ A;  1GD7 A;  1BBU A;  1NE3 A;  4A3I H;  4IPH A;  4BY1 H;  5GAD C;  4DV7 L;  4WJ3 M;  3CMA A;  4A3B H;  2ASB A;  3HOY H;  4K0K L;  4DR1 L;  1E7Z A;  5IT9 c;  2Y0S G;  1K3R A;  4IJH A;  5C0X J;  4MTN A;  4Y52 H;  4X64 Q;  1KRS A;  1S3O A;  4AIM A;  1NBW A;  2K5H A;  3AEV A;  4OWT B;  1Z47 A;  1Y1W H;  4B3T L;  4KLK A;  3J80 i;  4ALP A;  2F3I A;  4O0A A;  2QGQ A;  4JBM A;  4DV2 Q;  2OQ0 A;  4A3K H;  3U4Z A;  1N8R C;  3S1Q H;  4JI8 L;  2N8N A;  1WCM G;  2UUA L;  3KF6 B;  1HR0 L;  1I6H H;  4RG1 A;  2Q2H A;  3CCL A;  5ELN A;  3GTM H;  2I5M X;  3RR5 A;  4B3S Q;  4A3C H;  1KQS A;  1E24 A;  4DR6 L;  3I4O A;  3PUY A;  2E5L L;  1QZH A;  1XNR L;  2KCM A;  1PH6 A;  4JYA L;  4IPG A;  1K83 H;  1L1O A;  2JJQ A;  1FJG Q;  3T1Y Q;  3J81 i;  1L0W A;  5M5W H;  2OCE A;  4GN4 B;  4LF5 Q;  1JB7 A;  1UWV A;  3K81 C;  2N78 A;  3FKI G;  1PH5 A;  4P75 A;  3F1Z A;  1PH8 A;  1N34 L;  3A0J A;  3CXC A;  1VQ5 A;  1TWH H;  3I4N H;  3IRB A;  1YIJ A;  2KHI A;  2ID0 A;  4AH6 A;  4XTC S;  2IHF A;  2KHJ A;  1MIU A;  4KHP L;  1XNQ L;  2HIX A;  1HH2 P;  1WOC A;  4LNQ A;  4YCU A;  1YHQ A;  1K73 C;  3H3V H;  5DLQ E;  1IBM L;  4LF7 Q;  4BBS G;  4A4I A;  4A3L H;  1LTL A;  1LYL A;  1Q7Y C;  3CCV A;  1XTD A;  1R9T H;  4JC0 A;  3PO3 G;  3TQY A;  3RNU A;  4JI6 Q;  4OWW B;  2A8V A;  3CC4 A;  3GTL H;  2VQF L;  2LXK A;  1UE6 A;  5M3F G;  3H15 A;  1XMQ Q;  4POG A;  4C3H H;  2D62 A;  1QVC A;  2OTL A;  3M3Y H;  2RHQ B;  5LMU L;  2UXC Q;  4A3M H;  1CKN A;  1C9O A;  3F2D A;  1VQ8 A;  3G48 A;  3I2Z A;  4PG3 A;  3G4S A;  1LUZ A;  3EIV A;  1OXS C;  3HOU G;  2MQH A;  5ELO A;  1QVG A;  1P8L A;  3K7U C;  4QIW E;  2R92 G;  1L1O C;  4DV0 L;  4A3K G;  3M4P A;  4JI1 Q;  3I4M G;  2R93 G;  5JEA G;  5FJ8 G;  4DR5 L;  1SR3 A;  3CCQ A;  4A75 A;  5C4X G;  1VQD A;  4BY7 H;  2OQK A;  4JG2 A;  1SRU A;  3BZC A;  1YZ6 A;  4P71 A;  5IP9 G;  4DV3 Q;  2E2J H;  2R93 H;  1IL2 A;  4JI5 L;  4LFA L;  2F52 A;  1VQM A;  1N36 Q;  2VZA A;  1YI2 A;  4DV1 L;  4LFB L;  2N49 A;  4DUZ L;  3FHW A;  1A63 A;  1YBY A;  2JK8 A;  1V9P A;  3GD7 A;  2ZTD A;  4AQY L;  2ALY B;  4DR3 Q;  1XPR A;  3K0X A;  4LUV A;  4X62 L;  3ULL A;  3J80 c;  3PUV A;  2NN6 G;  1MJE A;  2BH8 A;  1XPO A;  1GKH A;  5LMN L;  3PSI A;  5FLM G;  1N33 L;  3M4Q A;  2YTX A;  3PF5 A;  3I56 A;  4BXX G;  5C44 G;  1HNZ L;  4JBJ A;  1Q46 A;  3OTO Q;  1WCM H;  2R7Z G;  2YV5 A;  1VQN A;  4P74 A;  4R4C A;  2IY5 B;  3M4O H;  4LF6 L;  1H95 A;  1QUQ B;  3HOV G;  1VQB A;  1CSQ A;  3G71 A;  2E8G A;  2D0O A;  3CC2 A;  2MFI A;  4GKJ L;  1OXV A;  1BBW A;  2PQA B;  2KCT A;  1FL0 A;  1I50 H;  1IZ6 A;  4YHH L;  5BR8 L;  2EQS A;  2JE6 I;  4DV4 L;  4L5R C;  1AE2 A;  2AWN A;  5JEA J;  4HJA A;  4HJ9 A;  2UUB Q;  1FGU A;  4QJF A;  3PIP A;  4HJ7 A;  3T1H Q;  4DR7 Q;  1C0A A;  4L5S A;  4A3G G;  3ULJ A;  2I0Q A;  1I94 Q;  2R7F A;  3FKI H;  2PI2 A;  3PO2 G;  2RHS B;  1HNW L;  1TWA H;  4P73 A;  3PUX A;  1EFW A;  1IBK Q;  3KDF B;  2VY3 A;  5IYD G;  4DR2 L;  1N32 L;  2R7D A;  2VUM H;  1C7Y A;  1IXR A;  1NMF A;  3UDF A;  4WJ4 A;  4X65 Q;  2UXD Q;  4LFC L;  4HJ5 A;  4QQB X;  1QZG A;  4JI2 Q;  2WB1 E;  1PHJ A;  5IP7 G;  3CCJ A;  1GO3 E;  4BBS H;  1PYS B;  5C3E G;  4HID A;  1B8A A;  3W5O A;  3JC6 6;  1EWI A;  4AYB E;  1WI5 A;  1HNX L;  2JA5 G;  3PO3 H;  2KEN A;  4GOP B;  3LGJ A;  5JJI A;  2IX0 A;  1OXX K;  2ZTC A;  1YIT A;  4JI0 L;  3GTG H;  2JQO A;  4DR4 L;  2A19 A;  1PA6 A;  2CWA A;  1WFQ A;  1X3G A;  3NBH B;  2ZM6 Q;  4B3M Q;  4PZ6 A;  3RLN A;  1HJP A;  2UU9 L;  4LF4 L;  4DUY Q;  1PFS A;  2B3G A;  2FXQ A;  4DAY B;  5HGQ A;  3HOU H;  5GAG C;  1Y1V G;  3DLL A;  4GLX A;  4GKK L;  1JE5 A;  2L15 A;  3NEN A;  2JA9 A;  2JEA I;  5EAY A;  5FJ8 H;  4DV6 Q;  1VQI A;  1EIY B;  3K80 C;  2BH2 A;  4MZ9 A;  1IYJ B;  1PH4 A;  2AHO B;  4JOI A;  1UE5 A;  2WP8 J;  5C4X H;  3CCM A;  1YJ9 A;  1EYG A;  1KXL A;  4KI0 A;  5IYC G;  1X54 A;  4BA1 I;  1M1K C;  3VDY A;  4LF9 Q;  3HOW G;  1U0L A;  4PZ8 A;  4GOP C;  4JI3 Q;  2N3S A;  1VQJ A;  1E1T A;  2AWO A;  2WB1 G;  3S24 A;  3AFP A;  1MKH A;  1J5E Q;  3HKZ G;  4A3F H;  2LXJ A;  4X6A H;  3G6E A;  4AYB G;  4DNI A;  1BVS A;  3CME A;  1IBL L;  4NXM Q;  2JA8 G;  2I5H A;  1X3F A;  2K4K A;  3S2H H;  4H02 A;  1S72 A;  1X9N A;  1K8A C;  1Q81 C;  4BXX H;  4R4O A;  3W1B A;  2OTJ A;  4DV7 Q;  3CC7 A;  1GM5 A;  4C2M H;  4K0K Q;  1PH7 A;  4DR1 Q;  4OX9 L;  2F4V L;  2JEB I;  5FLM H;  3TS2 A;  1L1O B;  4OON A;  3H0G G;  3KJP A;  1E22 A;  4L5T A;  5C44 H;  3BZK A;  3HFZ B;  2RF4 A;  4NXN L;  1Q82 C;  4JBK A;  3CPW A;  2GN5 A;  4B3T Q;  3HOV H;  1VQ6 A;  2WAQ E;  4BBR G;  1VCI A;  4X66 L;  3OW2 A;  4JI8 Q;  2CCZ A;  2K50 A;  2UUA Q;  1A0I A;  2B63 G;  4DV5 L;  3GTQ H;  1HR0 Q;  2HHH L;  3BJU A;  3PO2 H;  3CPF A;  3CCE A;  4B3R L;  2Z0S A;  4QGU A;  4O2D A;  1EOV A;  3OYY A;  3F8T A;  1PH9 A;  2Z6K A;  4JI4 L;  1V1Q A;  2PI2 E;  4GN3 B;  4JOI C;  2DUD A;  2E5L Q;  4A93 H;  1XNR Q;  2XTI A;  4IFD J;  4KHZ A;  4JYA Q;  3I7F A;  4LF8 L;  4Y7N H;  2D0P A;  3JAM i;  1CSP A;  5IYD H;  1Q1B A;  1UEB A;  3UDX A;  2UUC L;  1AE3 A;  2QEX A;  3UE1 A;  4YY3 L;  1WJJ A;  1VQH A;  2Q2I A;  4C3I H;  2V1C C;  2B29 A;  1NY4 A;  1HZB A;  4DPG A;  1NJI C;  1CKN B;  5IP7 H;  4OWX B;  1N34 Q;  2UXB L;  1W2B A;  3AFQ A;  5IWA L;  2HT1 A;  1TXY A;  3STB D;  5C3E H;  5H1S E;  1G29 1;  1XMO L;  2JA5 H;  4KHP Q;  1XNQ Q;  1G51 A;  4JI7 L;  5C0X I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...