4R4CA

Structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Replication protein A 70 kDa DNA-binding subunit
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4cA00
4GNXB 1SFOH 4LF5L 1VQEA 4AYBE 4JOIC 5C0XG 1PV4A 3H15A 2E2IH 2E2HH 3KF6A 1GKHA 1X3GA 3CPWA 1M90C 1U5KA 3HOZG 2K5VA 3TREA 4DV6Q 4GLXA 4O0AA 3PCOB 1CSQA 4BY1G 1I5FA 4EX5A 3IRBA 4GLVB 1SLJA 3G4SA 3GTGH 2R93H 1CSPA 4JI0L 5IYBH 2JA8G 1B70B 2QGQA 4POGA 1VQBA 1YNXA 3CC2A 4A93H 1YEZA 2A1AA 3PIOA 4DV4Q 1VQLA 4IFDJ 3TS2A 3DM3A 4DAYB 5IYBG 3ERSX 1X9NA 4C3JH 2R93G 3BZCA 2C35B 3PSIA 3RLNA 1PYSB 1N34L 3U4VA 3U4ZA 1JJ2A 3UDGA 2MNAA 5LMUQ 2UUAQ 4BY1H 5C44G 3CCUA 3OTOQ 4B3SL 4X65Q 3GTKH 4A3CH 4OO1I 2YYZA 1JJGA 1EYGA 3CCRA 1FJGQ 1T9HA 4EQ5A 1XMQQ 1OXUA 1X6OA 3H0GG 4DV7L 2YTYA 2CWPA 4DR5Q 3K80C 4Y7NH 3PUVA 1HNWL 5EAYA 2A8VA 4A3JH 4YCUA 3W1GA 4QGUA 2VQEQ 4GOPB 3UDXA 4C3HH 1Z9FA 3I55A 1RIPA 1EFWA 4LFBL 4QY7A 1TWGH 1MJCA 1XNQQ 1PH5A 2D62A 3E9HA 1PH8A 4AYBG 1KD1C 3F8TA 1VQ9A 5C0XI 4LNQA 2NVTH 5IYCH 3HKZE 1WCMH 4JI8Q 5GADC 3CXCA 4LF5Q 3J7A5 1HZAA 4A3KH 3HOWG 1XPRA 2N8NA 2UXDQ 2Q2TA 1P8LA 4DR4Q 5H1SE 4A3MH 1LTLA 4JI1L 1NJIC 4GN5A 1VQJA 3ULJA 4IOCA 1X54A 2B3GA 2N3SA 2PNHA 3NBHB 5DLQE 2IHFA 1BVSA 4JI6L 2B63G 4QIWE 4HJ5A 4LW1A 4LUOA 4LUVA 2WB1G 1WCMG 4A3EG 5IP9H 1XPOA 4DK3C 1S40A 4X6AH 3G6EA 4LUZA 1L1OB 4DR3L 2MFIA 4A4IA 1WYDA 1I94L 3S1NH 4PZ6A 1EIYB 2ZJPA 1EQQA 4JBJA 1K9MC 2ZJRA 4AQYQ 3M4QA 3I4OA 4IOAA 4NXML 1CUKA 2D0OA 4RMFA 2JA9A 2K75A 4DK6C 4YWMA 3DLLA 2VQFQ 1HR0Q 2HT1A 3MEFA 1NMFA 3RN5A 4JI4L 2R6GA 3PF4A 3S1MH 4LF9L 1HR0W 3CMAA 1N34Q 5ELOA 4GNXA 1I3QH 3W1BA 1V1QA 2CQOA 2OCEA 3M85A 1JMCA 4DV2Q 3MXNB 1Y1VH 1YZ6A 3CCQA 4DR2L 1YIJA 1PH3A 3K7AH 2KCMA 2R92H 3S16H 4JG2A 2VUMH 1UE6A 3HOVH 4DUZQ 3K7UC 5JEAJ 3LGJA 1OTCA 4JI7Q 4L5SA 3CMEA 2JA8H 1Q1BA 2Y0SG 4DUZL 1G291 2N78A 3KDFB 3HKSA 4GOPA 1H95A 4R4CA 4RG1A 1YJWA 1X56A 2N49A 4JI3L 3EN2A 4MTNA 3E0EA 1XNQL 2BA0A 2JA5H 1Q46A 2B63H 1VQPA 1I94Q 3U58A 1B8AA 3CCEA 1K73C 4NXNQ 5C3EG 1P16A 1PYBA 3TEHB 3WWVA 4B3MQ 4BBSH 5C4JH 3RR5A 3PIPA 4PZ7A 1L1OA 3F1ZA 3F2BA 1QVCA 3RZOH 3PV0A 4DR7L 2JEBI 5JJKA 4UP9A 1HH2P 1TWAH 3CP0A 1XMQL 4IO9A 4DV0L 5IYCG 3T1YL 1Q82C 4BA2I 3T1HL 3KFUA 1TWCH 1NMGA 1CKNA 4H02A 3G48A 1HNZL 4GLAC 5C4XG 1KRSA 1WI5A 3RLOA 5IYDH 3GTPH 4P72A 2LXJA 3CCVA 1HR0L 4DKAC 3CPFA 1EUJA 3KOJA 1C0AA 1Q1EA 2B29A 1X55A 2R7ZH 4QQBX 1L0WA 3CCJA 2JA6G 1IBKL 1IBMQ 4C3IH 3NEMA 4JCVE 1L2FA 2HHHL 5HGQA 2WFWA 4X62L 3KF6B 1Q86C 2H5XA 2IY5B 3GO5A 1HNWQ 3GTQH 2ZTCA 1M1KC 1IBML 1QZGA 5JEAG 5JJIA 2UU9Q 1N8RC 3GTOH 5LMNL 4JBKA 4HJ9A 4LF6L 3NELA 1ASYA 2Q2UA 2WB1E 1KRTA 3STBC 3PO2H 2GVAA 1NTGA 3G71A 1IBKQ 4GKJQ 4KHZA 2MO0A 2R7DA 2AHOB 2PQAA 4X62Q 2Z0SA 1NE3A 4OWWB 2VUMG 5GROA 3M4PA 2CCZA 3HOVG 3CC7A 3CC4A 3S15H 1FL0A 1K8GA 4A3IH 4P71A 2DUDA 4JBWA 4JI5L 1TWFH 3SGIA 3S1QH 1GD7A 3NENA 4A76A 2OQKA 2UXDL 3HKZG 4DV5Q 1KIXA 4QJFA 4A3IG 1D8LA 4DV0Q 2OTJA 2UUAL 3EBEA 4LF4L 1VS0A 1K8AC 3FHWA 2IX1A 3S2DH 4HJ8A 1VQGA 1N33Q 1JE5A 3UE0A 1SMXA 1VCIA 4PG3A 3PO2G 2HIVA 5M3MG 4DR6Q 4JI5Q 1J6QA 1HJPA 4MZ9A 1EWIA 2F52A 2KBNA 5FLXc 4JBMA 2Y0SE 3PO3H 1L1OC 3J7ZC 4LFAL 3I7FA 1VQNA 3HOUG 1YBYA 4JC0A 4DV4L 2I5MX 1VQDA 3PGZA 4POFA 3S1RH 1VQFA 2ZJQA 5IT9c 3J80c 4NPSA 2JA7H 3S14H 2UUCQ 4DUYL 4JI4Q 2IT1A 1VQ4A 2JA6H 5C0XJ 5M3FG 2JJQA 3BZKA 2A19A 4IPDA 4UY8C 2OWOA 2ALYB 4A3KG 3HOWH 4YY3Q 4YCWA 1X3FA 1VQIA 5M3MH 3A74A 2K52A 3I4MH 1X3EA 1XNRL 3I2ZA 1AE2A 4KLKA 4OWTB 4APVA 2F4VQ 2LSSA 1TXYA 1CKNB 1IBLL 1R9TH 4HIOA 2YV5A 4R4OA 4UP7A 3I56A 1E24A 4A3JG 2AKWB 1EOVA 4R1JA 2I0QA 3CD6A 2K5NA 3L0OA 4IFDG 1O7IA 4DR1Q 1WOCA 1A8VA 2JK8A 1V43A 2EIFA 1IXRA 2RHQB 2KHIA 1XTDA 1XPUA 1VQCA 4LF8Q 4BBRH 5IP7H 1OXTA 1ASZA 4C2MH 2ES2A 3L7ZC 4OX9Q 3A5ZB 2NZOA 1WJJA 3HFZB 4NB3A 3GTMH 2ID0A 1AH9A 3J80i 3M3YH 1BBWA 4IPHA 1VQ8A 4K0KQ 1E1OA 1YHAA 2KENA 1W2BA 3K8AA 4AQYL 1SR3A 1XMOL 4LWCA 3ZJYC 4DV1Q 1OXVA 2XGTA 4YCVA 1QUQB 3A5UA 3CW2C 4B3SQ 1FGUA 4LF6Q 4KI0A 3GDEA 4A3DH 2RF4A 1FVIA 3ER0A 1VQOA 3CCSA 5FJ8H 1BBUA 4DV3L 1GVPA 3AFPA 3UDFA 2RHSB 4XTCS 1Q8KA 1UE1A 2AWOA 1YHQA 3KYHC 4JV5Q 3GTLH 2PI2E 4O2DA 2EQSA 4PMWA 1HNZQ 4GN4B 1XMOQ 4HJ7A 1N36L 1TWHH 4NXNL 2E5LQ 3Q8DA 1IYJB 2KCTA 2PMZE 1Q7YC 1J5EQ 4BXXG 4BY7H 4B3RQ 3B6YA 4NXMQ 1KL9A 2BH8A 4DV6L 4ALPA 5C4XH 4P75A 3KJOA 2UU9L 4DAMA 3L2PA 5K36G 5E7NA 2DGYA 3CAMA 1IL2A 5AJ3Q 1DGSA 1XJVA 1HZBA 1QVGA 1V9PA 4XIGS 3I4NH 3K0XA 4DR4L 3T1HQ 4JV5L 1K0RA 3RN2A 2NVQH 1KXLA 2HQLA 4R4IA 2L15A 3KDFA 5M3FH 4J15A 4JI6Q 3S17H 1EQRA 5BR8L 5JJLA 3RLFA 4B3RL 1CKOA 4ME3A 3KLWA 1BKBA 2F3IA 4IFDI 2JA5G 1QVFA 5BR8Q 5AJ3L 3H3VI 4DPGA 1SE8A 3J81j 3HOUH 1HZCA 1PH2A 4KHPQ 4OONA 2VNUD 4JI8L 3TQYA 4DV7Q 3D31A 4DV2L 1A0IA 2KHJA 2R7FA 5IYDG 1Z47A 2K5HA 4QL5A 4DR1L 4DR6L 4P73A 2WAQG 5HY6A 4JI2Q 3STBD 1N32L 2GVBA 3A0JA 2YTVA 1OXXK 2I5HA 2MO1A 3GD7A 4JI1Q 3F2CA 3K81C 5LMUL 4B3ML 3HOYH 4FDBA 2VQEL 2VZAA 4DV5L 4WJ3M 2NVYH 2QEXA 1XNRQ 2RCNA 2IHEA 1MKHA 2FXQA 5M5XH 4YHHL 1VQ7A 4DR7Q 3RNUA 4P74A 4LF7Q 1SN8A 5FLMH 4TVAB 1N36Q 2E5LL 4BBSG 5IWAL 3OW2A 4X64L 4JI0Q 2Q2HA 5C3EH 4HIDA 1PH6A 4TQUS 5FJ8G 1YJ9A 2K4KA 4LFBQ 5J3BA 5GAGC 2ZM6Q 1UWVA 4GS3A 3HOYG 4X64Q 2XTIA 1PH9A 4GN3B 4IPGA 3HOXG 1UE7A 3EIVA 4DR2Q 1G6PA 3PUWA 4LF4Q 2K50A 4YHHQ 2Z6KA 2YTXA 4B3TQ 2E2JH 2UXCL 1UE5A 4HIKA 4A3FG 1E1TA 3M4OH 4HJAA 3ULPA 2Z6KC 4A3EH 2R92G 2F4VL 2BA1A 2CWAA 1Y14B 2UUBL 3BJUA 2AWNA 2CFMA 1PHJA 4L5RC 4BBRG 4IJHA 1C7YA 4WJ4A 2ATWA 1Y1WG 1VQAA 3E9IA 2GN5A 4AH6A 1K83H 3AFQA 4LF8L 4A3LH 3JAMi 2R7ZG 4A3BG 1LYLA 1CKMA 3UDIA 4DV1L 1HNXQ 1VQMA 2E8GA 3KF8B 3PF5A 4GOPC 2OTLA 1AE3A 4K0KL 5IY0A 2UUBQ 1A63A 4BXXH 3J81c 3BU2A 2HHHQ 2JQOA 2ZTDA 1VQ5A 5IP9G 4OX9L 5IWAQ 4A3BH 1QZHA 3CCLA 4R4TA 3H0GH 2UXCQ 1NBWA 4LFCQ 1Y1WH 4JYAL 2JA7G 4L5QA 1MJEA 2QA4A 1JB7A 1N33L 3S2HH 1VQ6A 4A3CG 3UE1A 1J5EL 2NZHA 3W5OA 4YWKA 4X65L 3ICEA 3AYHB 2UXBQ 4IJLA 3AEVA 2ASBA 2NVXH 5GQOA 3PO3G 2VY3A 4A3DG 5GAHC 2PI2A 3RZDH 4MNOA 1PH4A 2JE6I 4AIMA 2AMCB 1PH1A 1VQKA 1W3SA 4LFAQ 4GNXC 4A3FH 3OYYA 1B7YB 2Q2IA 3I4NG 4PZ8A 1EIFA 4R4QA 1PH7A 1OXSC 3PUXA 3M7NA 1YJNA 4OXPA 1E22A 3PUZA 3HOXH 5IE8A 1HNXL 2NN6I 4GKKQ 1GO3E 4DR3Q 4DUYQ 1RL2A 1PVOA 3AQQA 4OWXB 1Y1VG 3H3VH 1YVCA 1N32Q 3M9BA 3JC66 3ULLA 4JI3Q 3HOZH 4YY3L 3CF5A 1KC8C 5LMNQ 5GAEC 1UEBA 3CQZH 5FLMG 2EXDA 4OO1G 2I5LX 4DV3Q 1JT8A 5C44H 2OQ0A 1KHIA 1E7ZA 4L5TA 4DNIA 3OTOL 5LMNW 4GKJL 1I50H 1KAWA 4LF9Q 4A3GG 4JI2L 1Q12A 2LXKA 4A75A 4GKKL 3KJPA 3CCMA 1Q81C 1KQSA 4Y52H 2NN6G 4DR5L 4A93G 3S24A 1PA6A 1D7QA 4KHPL 2ZTEA 5M5WH 1N9WA 4YWLA 3U50C 1S72A 4X66L 2VW9A 1YITA 1IZ6A 4UP8A 1E3PA 2JEAI 2MQHA 4JI7L 3FP9A 2D0PA 2PQAB 4B3TL 1QUQA 4X66Q 1I6HH 2UXBL 1LM0A 3JAMc 1JJCB 3T1YQ 2HIXA 5IP7G 1SROA 1U0LA 2K14A 4A3MG 1GM5A 1YHBA 5M5YH 2VS1A 1YI2A 1FJGL 2WP8J 3D0FA 4UPAA 1WFQA 2UUCL 3TRZA 1A62A 3TS0A 1LUZA 2VL6A 3FKIG 1HZ9A 1VQHA 3J81i 2V1CC 2VQFL 1SRUA 1NY4A 2BH2A 1MIUA 4IPCA 3VDYA 3GTJH 1S3OA 1PFSA 4LFCL 3I4MG 1X65A 3FKIH 4LF7L 4JYAQ 2IX0A 4A3GH 2CKZB 4BY7G 1G51A 2WAQE 4A3LG 3PUYA 4JOIA 1IBLQ 2YU9H 1K3RA 5ELNA 3F2DA 2ZM6L 4HIMA 1C9OA 4BA1I
chains in the Genus database with same CATH superfamily
4LF5L 1PV4A 5C0XG 3H15A 3CPWA 1X3GA 4X3SA 2B2TA 4BY1G 1CSQA 3IRBA 2F0WA 3EVQA 2EPBA 4GLVB 1F9QA 5ELEA 1SLJA 3G4SA 4KHVA 4A93H 2O4XA 4DV4Q 1VQLA 3TS2A 1LLRD 1D1KA 3W2DA 3PSIA 4JK1C 1PYSB 3U4VA 3U4ZA 4DR6L 4JW0A 1RF2D 1SE4A 3OTOQ 4B3SL 4X65Q 4BY1H 4A3CH 4WJ3M 1JJGA 3NHHA 1XMQQ 4EQ5A 1OXUA 1EWCA 2CWPA 1SNOA 2KUMA 4Y7NH 2B63B 1TY0A 2QW7A 4LFBL 1DONA 1LTBD 4C3HH 4OGQC 2P5ZX 1XNQQ 1PH5A 2D62A 2JA6B 3GTKB 4CDDC 2F3WA 3HKZE 3OHXC 3CXCA 2PZUA 4A3KH 1XPRA 3EFXD 1GUGA 5EPKA 4H13C 5H1SE 4JI1L 1JCKB 4HN7A 4IOCA 3D4WA 1LACA 3NBHB 2PNHA 1HHVA 3HOUB 2EXZA 3IFTA 4I7ZC 4G7HC 2F0LA 3HS0C 4KY6A 4X6AH 3SK4A 2F03A 4DR3L 4IQZA 4KY7A 1WYDA 3C2PA 2B2UC 3M4QA 2EYLA 1YNNC 5CR3A 1HR0Q 3KK7A 1I4RA 2B2VC 3CKIB 1Y1WB 4GNXA 3M85A 1AZQA 3MXNB 4FXKC 5DM73 4DR2L 1G8ZD 3K7AH 1SYCA 2VUMH 1K28A 2PZTA 3J81E 4F8MA 1Q90A 3LGJA 1VMPA 2JA8H 2KOLA 2Y0SG 4A3FB 2K1BA 3S1MB 5KIXA 4DUZL 2N78A 3KDFB 4GOPA 1H95A 4R4CA 4UHVA 1CFMA 2N49A 3IFDA 3EN2A 3VA5A 1I94Q 2JSOA 2F0GA 4TKOB 2AQ1B 3WWVA 1PYBA 2B2WA 2RVLA 5D3IB 4QIWB 4HEDA 3T53B 3F2BA 3Q24A 4DR7L 2JEBI 4UP9A 1GHJA 1HH2P 4DV0L 1S5FD 5IIFA 3KFUA 4H02A 2PW5A 1F2MA 3P20A 3G48A 1JE4A 1WI5A 3GTPH 4Z9CB 1SNPA 1NAPA 3CPFA 1A3UA 1R9TB 1KNAA 2XNAC 1X55A 4QQBX 3OMCA 1E2ZA 1EU3A 3RMHA 1MHWC 2PW7A 2NB0A 2WFWA 5HGQA 4X62L 2HHHL 4QCLA 3KF6B 5C3WA 2H5XA 2L55A 3GO5A 3GTQH 3NWTA 4DK1A 3RZDB 4F87A 1OO9B 4EQPA 1F9RA 1QNUA 4LF6L 2R7ZB 1R4PB 3STBC 4KHZA 1U4MA 2Z0SA 4BY1B 4XQQA 3EJIA 4OWWB 5GROA 3M4PA 2CH4W 1C9OA 1EOTA 2AQ3B 1X3PA 3VYUA 4P71A 4WRDA 1TWFH 3AB9A 1MGSA 3SGIA 4FYDA 2SOBA 3NENA 4A76A 2ICIA 2IL8A 2CVRA 5IT9L 2OTJA 1H9KA 4A3DB 4LF4L 1VS0A 2IX1A 1B9MA 1VQGA 3J7YW 3UE0A 1ENCA 4PG3A 3PO2G 3N52A 1PDQA 1DM0B 3Q6SA 1K8OA 1J6QA 4MZ9A 4YIJA 5FLXc 2C5CA 1L1OC 1EZ6A 2EYJA 3I7FA 5JEAH 3J7ZC 4LFAL 1VQNA 4CJ0B 2ZJQA 2DN8A 2J4XA 4NPSA 5I6YA 1CZWA 3TDQA 2UUCQ 3BDCA 3G6JB 3KF8A 3BZDB 4N9TA 4U68A 1O78A 3LWEA 2JJQA 3BZKA 4IPDA 5M3FG 5KYLA 2ALYB 2Z4IA 4YY3Q 5M5YB 1X3FA 3I70A 2K52A 4RGTA 3I4MH 2A6HC 4KLKA 4APVA 3WOEA 3S1RB 2F4VQ 1A3VA 1CKNB 4PMCA 4HIOA 2A6ED 1CHQD 1E24A 4R1JA 2K5NA 4DR1Q 1D2BA 1IKLA 3MA2B 3N6RA 2EIFA 5C6AA 5E1FA 3E3XA 3VYTA 1D7QA 4XT1B 3ITPA 4BBRH 1OXTA 2EDGA 3MFGA 1BDOA 2B2WC 4CKCA 3J80i 1UNSA 4IPHA 4CHTB 1SR3A 1CHPD 1XMOL 3ZJYC 2L9HA 1OXVA 5EBDA 2F0DA 4DV1Q 3QG1A 1DOMA 3A5UA 2L0CA 1TT2A 4LF6Q 4KI0A 3GDEA 2RF4A 1FVIA 3ER0A 3LWUA 1VQOA 1BNZA 3CCSA 3GP7A 3AFPA 2MP1A 3I4NB 1EY6A 3GTLH 4P2CB 3TZUA 1HNZQ 4BY7B 1EY7A 1XMOQ 3E6ZX 3Q8DA 1IYJB 2QKIC 4IZ8A 4K2KA 2RDFA 4QF4A 2E2DC 1Q7YC 1J5EQ 4B3RQ 5BN4A 1C4QA 4DV6L 3KJOA 3L2PA 5K36G 5E7NA 1IL2A 1DGSA 1IW7C 1ICFB 3NPPA 3RN2A 3X3MA 2HQLA 4R4IA 1NNXA 4JI6Q 2EY1A 1EQRA 1EZ8A 5BR8L 3ONAB 1BKBA 2F3IA 5IGDA 4IFDI 2DNEA 5M5XB 1TVXA 5AJ3L 1SE8A 2TMPA 4J1MA 2HD3A 4KHPQ 1U9RA 4DV7Q 3D31A 2N55A 1A0IA 4DR1L 1STHA 2K5HA 2YTVA 4JI1Q 3CC4A 4KKUA 3H3VC 3K81C 1LTRD 2VZAA 4G57A 4DV5L 1NR4A 2L11A 2RCNA 4BBSB 5D3DA 5BN5A 1SXTA 3RNUA 4P74A 4LF7Q 4HR7B 2F0EA 3U9OA 5C3EH 4HIDA 4TQUS 4ID6A 1HTPA 2K4KA 1YJ9A 4LFBQ 4B08A 4RKLA 3GTQB 2XTIA 4FXGC 4IPGA 1G6PA 3PUWA 4LF4Q 2Z6KA 2YTXA 4A3FG 2M9VA 4XDXA 2DJGC 3HG9A 1AEXA 3A8JE 3J81L 2R92G 2MHVA 3WOFA 2CWAA 1GUTA 4L5RC 1I50B 2AWNA 2CFMA 3D4DA 3MEHA 4BBRG 1PHJA 1C7YA 1II3A 4M8AA 1O7LA 2ATWA 2EYMA 5I9PA 2GN5A 4AH6A 4LMQD 2JA5B 3JAMi 1CKMA 1IKMA 3BS1A 3BVZA 3CHBD 1IL8A 2X69A 4HMJA 2OTLA 2KQ3A 1BR9A 4LK1C 2UUBQ 1A63A 2JQOA 2ZTDA 1C8CA 3BVGA 5IWAQ 2PO4A 4C56C 2UXCQ 4JYAL 4K6DA 3PO2B 5C4HA 1MJEA 2QA4A 1JB7A 1N33L 1VQ6A 4A3CG 1VF5C 1J5EL 5ELCA 3A56A 2UXBQ 4G7ZC 2QEJC 3Q23A 1CQFA 3D8GA 4A3DG 2RDHA 3DHQA 1D5ZC 4MTKA 1VQKA 1PH1A 4O42A 1LT6D 3OYYA 1B7YB 1JC7A 4PZ8A 1EYDA 2XVSA 1YJNA 4OXPA 1E22A 4F88A 2NN6I 4CKEA 1WVLA 1EYAA 1RL2A 3AQQA 5FO7B 4OWXB 1Y1VG 4XQJA 3C1FA 1YVCA 5I4DA 3M9BA 5C0XH 3CQZH 1BCPF 1ENFA 1JT8A 4L5TA 2C9OA 3A8KE 2RKSA 1V1PA 3OW7A 1WTXA 1K8MA 2CQAA 4JI2L 3KBGA 1SNQA 3EQLC 5DAUA 3KJPA 1Q81C 1KQSA 3KBXA 5ISRA 2NN6G 3NE5B 1HTLD 4HTHA 2SNSA 2D5DA 1S5CD 3U50C 3HZXA 1YITA 1STYA 2HQEA 2MQHA 4KKTA 5CYUA 2K7VA 4ZYSA 1LM0A 1JICA 2QILA 4RWSC 1M4VA 5IP7G 1U0LA 5M5YH 2JA7B 2WV6D 3D0FA 2UUCL 2RA4A 1WCMB 1B44D 2ICEC 1TWHB 3J81i 3K5LA 2VQFL 1SRUA 1NY4A 3VDYA 4I65A 1I6HB 4JYAQ 3I90A 4A3GH 1HA5A 2I46A 1RTOA 2WAQE 3HEJA 3PUYA 2LKVA 2F0UA 5ELNA 1MSHA 2ZM6L 3JAML 2VNUD 1SYEA 4K6LA 5G3LF 1SFOH 5ELFA 1VQEA 3K5MA 1MI2A 3KF6A 1U5KA 3DMUA 4LJZC 4ZKCB 2G9DA 1EY9A 3QJYA 3PCOB 1I5FA 1WTPA 1FYCA 1TS2A 5A2QL 3GTGH 1BBXC 1ET9A 5IYBH 3R2TA 2JA8G 4PQXA 1QILA 4O1NA 3PIOA 1TWFB 3DM3A 4DAYB 3ERSX 4C3JH 2R93G 1GJXA 2A6EC 1PYWD 2FINB 3UDGA 1JOQA 5LMUQ 4OO1I 5C44G 2NVTB 1EYGA 1T9HA 1HUNA 1WTWA 4OEMB 3H0GG 1DOKA 4A3JB 5IGBA 1QOHA 3K80C 5EAYA 1KAAA 4YCUA 1BOSA 4GOPB 4KJOA 1RIPA 1TWGH 1WTQA 3E9HA 4LNQA 5C0XI 5GADC 4LF5Q 2N8NA 1ZYRC 5D14A 1ML0D 4A3MH 1B3QA 1NJIC 3PO3B 1EQTA 2N3SA 5DLQE 5IOCA 2IHFA 1BVSA 4JI6L 2B63G 2FJ2A 4QIWE 4DAVA 3GTGB 4A3EG 1S40A 4OO1G 4LUVA 3HGBA 1S5DD 4RHRA 5L37A 3MWYW 2E2HB 1I94L 5CV4A 1EIYB 1EQQA 3FPPA 4JBJA 3I4OA 2K32A 2D0OA 4A3IB 3EA6A 3DLLA 1QCBD 2F0VA 4BS9A 3I4LA 3S1MH 2M00A 2F0KA 1JMCA 1F77A 2SDFA 3CCQA 1SNDA 1YIJA 2QDBA 2KCMA 3HOVH 1UE6A 4DUZQ 5FK9C 2WACA 2K01A 1Q1BA 1RCVD 1GUOA 3T4AC 1H9RA 4V190 4MTNA 5KNCA 4Y7NB 2B63H 4ZUIA 1B8AA 1QJOA 2VB2X 3CCEA 4B3MQ 4BBSH 4RFBA 2WAQB 5C4JH 3RR5A 5CGKA 4TRDA 2K5DA 1QVCA 3IKJA 3T1YL 4GLAC 1KRSA 3RLOA 5IYDH 1F2LA 1HR0L 4DKAC 1NUCA 3LNNA 1C0AA 4DK0A 1AFPA 1ILQA 2B29A 3CCJA 5ELBA 1Q86C 2ZTCA 1IBML 1KDBA 1KTKA 1QZGA 1NCVA 4DF7A 1SYBA 1D5MC 5LMNL 4IUUA 1D5XC 2DY7A 4C3JB 3EROA 1NTGA 4GKJQ 2MO0A 2AHOB 2N88A 4DNTB 3HOVG 1S4ZA 2B8GA 5FLXL 4ME5A 4A3IH 2ZT9C 4JBWA 4JI5L 2K5WA 2B2YA 1TS3A 2OQKA 1RODA 3HKZG 1Y8NB 4DV5Q 4QJFA 4A3IG 4L6TB 3NQTA 4OIKA 2H4OA 2UUAL 1BCPD 1K8AC 3NWSA 4HJ8A 3D4RA 2HUGA 1O7YA 2L1BA 4IALA 2F3VA 1RD9D 5D65A 4DR6Q 3BDOA 2O5IC 2NVQB 1EWIA 1MSGA 1NSNS 4JBMA 5C3XA 2Y0SE 3PO3H 4RCNA 5KNDA 4JC0A 4DV4L 2IJ0A 1VQDA 4F7XA 1BXTA 2JA7H 1TU2B 2IT1A 2OXPA 5C0XJ 1STAA 1HPCA 4LAAA 5EKLA 4UY8C 2OWOA 1CI3M 1EQVA 2E75C 1PTOB 4RHSA 3A74A 1KNEA 4ZRZA 1X3EA 2DJFC 2KVMA 3I2ZA 2LSSA 1TXYA 2Q8TA 4NKLA 1EOVA 3CD6A 3L0OA 1WOCA 1A8VA 3J80L 1V43A 1PTOC 1IXRA 1CA6A 1SDFA 2KHIA 4L63B 5EKKA 5C44B 4LF8Q 2ES2A 3HFZB 4NB3A 3X3NA 5CV8A 1FD7D 3M3YH 1PRTD 2EY6A 1CM9A 1E1OA 1W2BA 3R8BA 3DUZA 3I72A 3S1QB 3ZYYX 2XGTA 4RA8A 4J6HA 2BDOA 4MHEA 4FF3A 4A3DH 1GUNA 4DV3L 2ZXRA 1GOZA 2RHSB 1Q8KA 3S14B 2DNCA 5IGGA 3ERQA 1YHQA 2RBMA 3URYA 2Q8RE 4OIJA 3K59A 2EQSA 1A3TA 4PMWA 3Q22A 2K28A 2B39A 2B2UA 2E5LQ 1V1PB 4KN7C 2PMZE 5CV9A 3GQBA 1JOKA 3V2TA 3BYYB 2CH4A 1X32A 1BF4A 5FLXE 4P75A 3NUCA 1EY0A 3U9SA 4U673 3I4NH 3QO2A 1V9PA 4XIGS 3K0XA 4JV5L 4TSSA 4K14A 5KGUA 4WORA 3S17H 2F0TA 5AFWA 5CV5A 4CGYB 5JJLA 3RLFA 3S17B 3S2DB 1TWCB 1QVFA 1PMRA 3J81j 3HOUH 1HZCA 4B9XA 4OONA 4JI8L 5IT9E 4DV2L 2R7FA 4C2MB 5IYDG 3STBD 5HY6A 1N32L 3S2DH 2A68C 5LMUL 4H7BA 1LTAD 3MVVA 4FDBA 3SEBA 1ONLA 5BN3A 3QR8A 1XNRQ 2IHEA 1MKHA 5IODA 2K05A 5M5XH 1F2ZA 3GTLB 1VMCA 1HFGA 2A74C 5KNBA 5CBAE 1N36Q 4TVAB 1WD0A 4BBSG 3OW2A 2Y0SB 5M3MB 1SYDA 2F0FA 5FJ8G 1LO5D 1HQRD 5J3BA 5GAGC 2ZM6Q 3S16B 1G91A 1V8QA 1JORA 4BWGB 3ND9A 4GN3B 2LY7A 3J7AF 4G7OC 2RQXA 4C1NI 2K50A 3C1EA 4YHHQ 3K57A 2E2JH 3VR3A 4HIKA 1E1TA 1EIHA 3ULPA 2Z6KC 2KJXA 3GV6A 1Y14B 2NTTA 2HCIA 4IJHA 4JPBW 3H94A 4WJ4A 4QB4A 4CDFC 4LF8L 2R7ZG 1VDZA 3UDIA 1BCPB 3KF8B 3PF5A 4GOPC 3GTPB 1DD2A 2A6HD 5IY0A 3I8ZA 2RSNA 3BU2A 2F0NA 3FKIB 2HHHQ 1JOOA 5CV6A 1I3QB 2F0SA 5I2YA 1NBWA 4ZAIA 2XWBB 4L5QA 3HRZC 5FOBB 3SK6A 2NZHA 5C4XB 3ICEA 2KA7A 1JWSD 2B8FA 3NP8A 2ASBA 5GQOA 4RGNA 4UDUC 2PI2A 1EY5A 5A35A 4AIMA 2AMCB 1W3SA 1AW7A 4A3FH 1ZEQX 1LTTD 1RDPD 1EIGA 1EIFA 3PUXA 2PMZB 3DXJC 5IE8A 4K5XA 3HOVB 3NBIA 2KHSA 5ELDA 1N32Q 1QE6A 3VA7A 4JI3Q 1FGBD 4YY3L 2F0QA 5LMNQ 1UEBA 3MXPA 5C4ZA 5IGCA 2PCFB 3QB3A 5C44H 2OQ0A 1KHIA 4DNIA 4GKJL 1I50H 1KAWA 1Q12A 1XYIA 4GKKL 3CCMA 4IN3A 2L4NA 4Y52H 3NQIA 3A7AB 4MN3A 4A3KB 1TIID 2ZTEA 4YWLA 1S72A 4ZUJA 4X66L 2EYOA 4RCOA 1PTOH 3FP9A 1UAPA 1Y8PB 3C46A 3JAMc 1JJCB 3V96A 1SROA 4RH6A 3FMCA 1GM5A 1YI2A 3VR5A 4IUTA 3NTIA 4IFDH 5M9OA 3TRZA 3PQIA 4CKBA 4QMGA 3DEPA 2V1CC 3SK5A 3AU7A 4IPCA 4MIUA 3GTJH 5I6WA 4QUFA 4LF7L 2IX0A 1S5ED 2CKZB 1PTOF 3VYRA 1G51A 4JOIA 1K3RA 3F2DA 1F9SA 4HIMA 4GNXB 1I4QA 3RD4A 4AYBE 1GKHA 1SYGA 2TSSA 2K5VA 1GXDC 3TREA 4DV6Q 4CDEC 2A5HA 3SDZA 5E4XA 4A3GB 4V0BA 1PLFA 4JI0L 3A7LA 4HCEA 2NZ1D 4EQOA 1B70B 4POGA 1VQBA 3VYSA 5CBEE 1YEZA 2A1AA 2EYFA 3KUPA 3RLNA 1N34L 4KN4C 1Z7TA 4XYOA 5EBCA 5EPJA 4DV7L 4FNFA 3T51B 4K2LA 1Z6HA 3K0YA 2PPBC 1PFMA 4QGUA 2VQEQ 1Z9FA 4QY7A 1FNVA 1YNJD 2ZXPA 2NVTH 1PH8A 4AYBG 3F8TA 1WCMH 2IPKD 2Q2TA 4NDXA 3S2HB 2UXDQ 2V4DA 1S5BD 4GN5A 1VQJA 3ULJA 1FNWA 4LW1A 2WB1G 2R3ZA 1RKNA 3G6EA 2I07B 5EQ0A 1L1OB 5J22A 4A4IA 2Z1CA 3M3YB 1K9MC 3GV3A 2ZJRA 2EYPA 3I73A 1CUKA 4RMFA 2JA9A 2B2TC 2K75A 4R9WA 4QUCA 3D3RA 2HT1A 3RN5A 2E2JB 3PF4A 4LF9L 1HR0W 3CMAA 1N34Q 1B2TA 5ELOA 1I3QH 1V1QA 2CQOA 4DV2Q 3TP7A 1YZ6A 4ZQ3A 2R92H 4JG2A 3K7UC 1T5EA 5JEAJ 1OTCA 4JI7Q 1CTMA 3CMEA 1IW7D 3CRKC 5CMDA 4RG1A 1YJWA 4N8X1 3K6OA 2IW3A 2BA0A 5I2XA 2JA5H 1Q46A 1XNQL 3T56B 4XXEA 1LTSD 3U58A 1TQOA 1K73C 4NXNQ 5C3EG 1P16A 3TP6A 3PIPA 4PZ7A 1L1OA 3F1ZA 4DA2A 3PV0A 3K5OA 4A3MB 3H09A 4AYBB 1XMQL 2OF1A 4BA2I 4DXFA 3T1HL 1TWCH 1CKNA 2IWHA 4DU9A 5C4XG 4C3HG 4P72A 1EUJA 2ENBA 1V1OA 1ZXTA 2R7ZH 4KKSA 1IBMQ 5C3EB 3NEMA 4JCVE 1L2FA 1AZPA 2JN4A 3O13A 2A69D 4OELB 1M1KC 1LTID 4EGVA 5JEAG 5JJIA 4Q5VA 4JBKA 3NELA 1ASYA 1MBYA 1SJHD 3PO2H 5K36H 5FO8B 4ZKBB 2R7DA 3SK8A 2B2VA 1H9JA 2PQAA 2PQEA 4Q0FA 4X62Q 3RUZA 1XXGA 2VUMG 2RDGA 1HUMA 2CCZA 1FL0A 1O80A 4K5VA 3BVMA 2DUDA 3CQZB 3S1QH 1GD7A 2UXDL 2FHTA 1KIXA 1ENAA 3PIP3 2B2YC 1I4PA 4DNRB 3FHWA 5C5LA 1QB5D 1JE5A 1AP0A 2KEEA 1VCIA 1BO0A 3IL8A 3ND8A 5M5WB 5J1ZA 5HURA 1WTVA 5M3MG 3TSSA 1HJPA 1PFBA 1GUSA 3HOUG 1HXYD 1SMYD 2I5MX 3PGZA 4POFA 1STEA 1VQFA 4KD4A 1W6KA 3J80c 3GTJB 5E4WC 3S14H 4DUYL 3OIPA 1VQ4A 1A15A 4IUVA 4A3KG 1L0XB 1VQIA 5M3MH 1BQQT 1L0YB 2FMCA 4OWTB 2Z4HA 1IBLL 1F9PA 1R9TH 1EEID 2YV5A 4R4OA 4FF4A 2BCOA 2GA4B 2I0QA 4IFDG 1O7IA 2X6LA 4RKBA 2WKDA 2F0HA 4R8IA 1ASZA 4OX9Q 1SAPA 2NZOA 1B9NA 1BBWA 1VQ8A 3NTHA 4XYQA 2XIWA 5I9OA 2EZVA 1YHAA 2KENA 1SNCA 4AQYL 3OPOA 2F0MA 1LABA 1LTGD 1XWEA 3A55A 3CW2C 1EEFD 1FGUA 1RJTA 4CJ2C 4JVZA 2FMMA 1FNUA 1I4GA 1M8AA 1O7ZA 1EY8A 3KYHC 1K0SA 1EFID 2PI2E 5JVH3 3E0JA 4K8IA 4O2DA 4HJ7A 1N36L 1TWHH 4NXNL 2KCTA 4BY7H 1TWGB 4ODGA 4NXMQ 1KL9A 1Y8OB 1A6XA 4OL7A 5C4XH 4DAMA 4H44C 1ZKOA 5AJ3Q 1QVGA 1HZBA 1SJED 5IGFA 4DR4L 3T1HQ 4ILWA 1K0RA 5C5MA 4CJ1B 3Q0AA 1UEAB 2L15A 3KDFA 4PMBA 4B3RL 2BE5C 1CKOA 4ME3A 2EY5A 1PXUA 2JA5G 2D2CC 5CV7A 4KD3A 1SBBB 2L12A 3TQYA 1HQMC 4BBRB 1ESFA 2KHJA 3WDNA 4QL5A 2WAQG 3FEWX 4JI2Q 2GVBA 4N8FA 4OHJA 3GD7A 2MO1A 5LL6X 3F2CA 4B3ML 2VQEL 3HP3A 3MFYA 5KYIA 3OOCA 4DFAA 3J7AV 1CZGA 3MZ5A 1SN8A 3QOJA 2E5LL 3HOXB 3F2UA 4X64L 3L3OC 4WJWA 1UWVA 4GS3A 1BCPC 1W6JA 3HOYG 1PH9A 3HOXG 2NVYB 2EJMA 3EIVA 4FO2A 4DR2Q 3SE0A 1UE5A 1B53A 5LHY1 3M4OH 1PZKD 5G3LD 4XQNA 2F4VL 3SVMA 2MGSA 2CW0D 2UUBL 5C4JB 4GZYC 1Y1WG 1GHKA 1K83H 1EYCA 5E3FA 5M3FB 1LYLA 4DV1L 1HNXQ 3SHLA 2E8GA 2QCPX 4X3KA 4E6IA 1AE3A 3I4MB 4HSVA 1KLUD 3FPUB 1DXMA 4BXXH 2F0IA 1LT5D 1HA6A 3OSOA 3V05A 4A3BH 3CCLA 3RZOB 4R4TA 2L5TA 4LFCQ 3OWFA 4YWKA 3AYHB 3DM1A 2HDMA 3AEVA 2EOTA 4CDCC 5LL6S 3NXWA 5GAHC 5EJWA 4MNOA 1PH4A 3VR4A 1B4OA 3I4NG 2EYHA 2Q2IA 4R4QA 1PH7A 1OXSC 3M7NA 1UUPA 2LFNA 2VUMB 1GO3E 4DR3Q 1PVOA 3MAQA 3C3LA 3JC66 2ZXOA 3HOZH 1K83B 3CF5A 1KC8C 5GAEC 2JXMB 5FLMG 2EXDA 2EJGC 2KCNA 2A69C 2I5LX 1CT1D 1E2VA 3FDTA 1E7ZA 5LMNW 2A73B 4LF9Q 1A2UA 3MXNA 1LT3D 2LXKA 5F2DA 4I7AA 1Q3LA 4DR5L 4A93G 3S24A 1PA6A 4KHPL 2G9HD 1N9WA 4UP8A 2JEAI 1E3PA 4JI7L 2PQAB 3VR6A 4X66Q 3AMUA 3CRLC 3P1HA 2KECA 4FF2A 3T1YQ 4NMZA 4RGOS 1SYFA 2K14A 4A3MG 1I6VC 2VS1A 5FO9B 4IUNA 1WFQA 1A62A 3FKIG 1VQHA 1WTHA 3K5NA 1VF7A 2VXWA 4LFCL 5DEHA 2XRQD 4A3LG 4ZLTF 2JYOA 1IBLQ 2YU9H 3W5OA 4K8JA 1B1ZA 3L9AX 4JOIC 2E2IH 2E2HH 1M90C 4GLXA 4O0AA 2PNRC 4EX5A 1STNA 2F0JA 4C3JG 1CSPA 2R93H 1RHPA 3H91A 2QGQA 1WTRA 1YNXA 3CC2A 2M2LA 4ZCKA 4IFDJ 2WKCA 4K5WA 5IYBG 5COYA 1X9NA 4IURA 5NUCA 3BZCA 3K7AB 2C35B 3H6MA 1Y1VB 1JJ2A 2BOSA 2MNAA 2UUAQ 3HOZB 2NBFA 5FKAC 3CCUA 3GTKH 1PRTB 2YYZA 3CCRA 1FJGQ 4UAIA 3JAME 1X6OA 4DGZA 4C3IG 3MXUA 2XRSD 2YTYA 5HGTA 2WB1B 2JA8B 1EL0A 4DR5Q 4H0LC 3PUVA 1HNWL 2NWGA 2A8VA 4A3JH 3W1GA 3UDXA 3I55A 3K58A 1EFWA 3S9WA 1MJCA 3I3CA 1KD1C 1VQ9A 5IYCH 3D6CA 4JI8Q 3J7A5 1HZAA 2JP1A 3HOWG 3NK9A 1P8LA 3A54A 4DR4Q 1KABA 1LTLA 1SNMA 1I4HA 2CW0C 3QWNA 3GTMB 1X54A 2B3GA 5JPMC 3DEOA 1STBA 4KK7A 1XTCD 1DYQA 1ET6A 1C48A 1PRTC 1KDAA 4LUOA 4HJ5A 1XPOA 1WCMG 5IP9H 1Y69U 4DK3C 2AUKA 4NW2A 1JR0D 3T13A 1U4RA 4LUZA 2MFIA 3S1NH 2H1EA 4PZ6A 2ZJPA 5JVG3 1TS5A 4AQYQ 4KMUC 2WINB 2YU9B 4NXML 4IOAA 2BDNA 2NVXB 4DK6C 4YWMA 5EKIA 5IGEA 2VQFQ 3MEFA 1NMFA 4JI4L 2R6GA 2EY2A 2AQ2B 1B50A 3W1BA 2OCEA 5JOBA 1STGA 4HAEA 1Y1VH 1PH3A 2DY8A 3S16H 4CBVA 4L5SA 4R8NA 1PFNA 1YNJC 1G291 3HKSA 1X56A 4JI3L 3E0EA 1F2YA 3PMFA 1VQPA 3R2IA 4HSPA 4FXDA 4B9WA 1D1IA 3NSWA 1LV9A 2XSCA 3TEHB 3TP8A 3BDLA 2R61A 1K3BC 3RZOH 1SE2A 2PZWA 5JJKA 2QDLA 1TWAH 3CP0A 4IO9A 1Q82C 3M7GA 5IYCG 2F1MA 1TWAB 1NMGA 1HNZL 2FFKB 1CA5A 1X3QA 2A68D 2LXJA 3CCVA 3KOJA 2XN9C 1SFOB 1Q1EA 4HMIA 5JAVA 1L0WA 2Q8IB 2JA6G 1IBKL 4C3IH 3DWAA 3NTKA 2BE5D 1GUWA 1H9MA 2IY5B 1HNWQ 5K5PA 3S15B 2QF7A 2UU9Q 1N8RC 2WIIB 3GTOH 4RGMA 1G6ZA 4HJ9A 1HCZA 4ZK9B 2Q2UA 1DCZA 2WB1E 1KRTA 3GTOB 2GVAA 3QOLA 3G71A 1IBKQ 1EU4A 2IX3A 1NE3A 3S15H 3CC7A 1K8GA 3M4YA 1JQYD 3MTSA 1HFNA 3TN2A 1D8LA 5EGTA 3TZDA 5DM63 4DV0Q 3EBEA 1B3AA 1PRTF 3KLSA 2EE1A 1N33Q 3HOYB 5T1IA 3LX0A 1SMXA 4XT3B 2HIVA 2F0OA 4JI5Q 4PV1C 2F52A 2KBNA 3KLSX 1DJRD 1DZ1A 3A8IE 1DOLA 5JJZA 3BYTB 1YBYA 4KV6A 1E0BA 3S1RH 3MXGA 5IT9c 1G2TA 4JI4Q 2JA6H 4A3BB 2A19A 4C1NK 1HRJA 5EPLA 3R3OA 3HOWH 2SEBD 4YCWA 1MD2D 5TSSA 2Z6BA 1PZJD 1AN8A 3T16A 2G5DA 1XNRL 1AE2A 3TP5A 1D6EC 3J80E 3S1NB 4UP7A 3I56A 3I91A 4A3JG 2AKWB 4L8JA 3H0GB 1NR2A 1TKWB 3MHBA 1A2TA 1TY2A 2JK8A 2RHQB 1XPUA 1XTDA 3HOZG 1VQCA 1ILPA 5IP7H 4C2MH 3L7ZC 3A5ZB 1WJJA 4IUQA 2AUJD 3GTMH 2ID0A 1AH9A 3DWQA 4K0KQ 1TS4A 1SE3A 5J39A 2O5JC 3K8AA 2E76C 4LWCA 1J9OA 3W3AA 2NN6H 3SXHA 4YCVA 1QUQB 1SSOA 4B3SQ 4G4KA 2E74C 2XWJB 5FJ8H 1BBUA 3E5SA 1GVPA 3UDFA 4PNYA 1UE1A 4XTCS 4WFN3 2AWOA 1FR3A 4FP5D 4JV5Q 3SR1A 4GN4B 2OT2A 4BXXG 3B6YA 1EY4A 2BH8A 4DAPA 4ALPA 2UU9L 1BUVT 2K5QA 2DGYA 3CAMA 4M1UB 1XJVA 1YNND 1IHZA 2SNMA 2NVQH 1KXLA 2OEOA 4EQNA 3P75A 1J8IA 2HDLA 5M3FH 1XX8A 2RSOA 4J15A 2MPMA 3CU7A 1WTOA 2VB3X 3KLWA 1JWMD 2D9UA 4IUPA 3H3VI 5BR8Q 3P7JA 4DPGA 4RAUC 2K04A 4A93B 1PH2A 5KEEA 1JB3A 1QG7A 1Z47A 2X6GA 4DXGA 4P73A 3OWEB 3A0JA 1OXXK 4EVOA 2I5HA 1QNKA 3PIO3 3IAYA 5CC4A 3HOYH 2NVYH 2QEXA 4YHHL 2FXQA 1VQ7A 1IYUA 4DR7Q 2F0PA 1QWYA 5FLMH 5IWAL 1KLGD 2K03A 2Q2HA 4C3IB 1PH6A 4JI0Q 5CORA 1H9SA 5A2QE 2J7ZA 4X64Q 2KEDA 3FRPB 1RTNA 3TMEA 1WD1A 1UE7A 2EJFC 4B3TQ 2UXCL 1CK1A 1E2WA 1ICWA 3KLRA 4HJAA 4ULLA 2MUYA 4A3EH 4OO1H 2BA1A 1EWHA 1SMYC 3BJUA 4NP5A 3VR2A 3FVQA 1VQAA 3E9IA 3DWPA 1TR5A 3AFQA 4KTAA 4A3LH 4A3BG 3D6WA 5DNFA 1H9SB 2E2IB 1VQMA 3MC0B 3BG3A 4FVMA 2NUCA 4K0KL 3J81c 1ZYRD 4KY5A 5IP9G 1VQ5A 4OX9L 4FF1A 2KCCA 1QZHA 2NTSA 3H0GH 4A3EB 1Y1WH 4X3TA 2JA7G 2O2LD 3S2HH 2PYKA 3UE1A 4C3HB 4HCSA 1LT4D 4KJNA 2K6AA 2R92B 4X65L 1U4PA 4IJLA 2J0TD 2NVXH 3PO3G 2VY3A 5KRUA 1KDCA 1T5XD 3RZDH 3HKZB 3R93A 2JE6I 3HOWB 4N9PA 2LS01 2F4IA 4LFAQ 1CQVA 4GNXC 3TBIB 4J8QA 4X3UA 5T1GA 4ABNA 3PUZA 3HOXH 1HNXL 4GKKQ 3OIQA 4DUYQ 4DAYA 3H3VH 3ULLA 1ESRA 1R4QB 3QIAA 1PTOD 4S3SA 4DV3Q 3OTOL 4DN4M 2EVBA 4A3GG 4A75A 1I4XA 2R93B 2Z8LA 3G7LA 3NBHA 2K33A 5M5WH 1SEBD 2NYZD 2VW9A 1IZ6A 2LMCB 2D0PA 4B3TL 1QUQA 1I6HH 2UXBL 1IYVA 2CHBD 2HCCA 2HIXA 1PZID 2MJ8A 1YHBA 1FJGL 3M4OB 2WP8J 3OMGA 4UPAA 3TS0A 2RCFA 1LUZA 2VL6A 1HZ9A 2BH2A 1MIUA 2Z9HA 1S3OA 1PFSA 3I4MG 1X65A 3FKIH 1G2SA 4BY7G 1U4LA 3UI2A 5JPNC 1Q8IA 1JWUD 4BA1I
chains in the Genus database with same CATH topology
4GNXB 1SFOH 4LF5L 1VQEA 4AYBE 4JOIC 5C0XG 1PV4A 3H15A 2E2IH 2E2HH 3KF6A 1GKHA 1X3GA 3CPWA 1M90C 1U5KA 3HOZG 2K5VA 3TREA 4DV6Q 4GLXA 4O0AA 3PCOB 1CSQA 4BY1G 1I5FA 4EX5A 3IRBA 4GLVB 1SLJA 3G4SA 3GTGH 2R93H 1CSPA 4JI0L 5IYBH 2JA8G 1B70B 2QGQA 4POGA 1VQBA 1YNXA 3CC2A 4A93H 1YEZA 2A1AA 3PIOA 4DV4Q 1VQLA 4IFDJ 3TS2A 3DM3A 4DAYB 5IYBG 3ERSX 1X9NA 4C3JH 2R93G 3BZCA 2C35B 3PSIA 3RLNA 1PYSB 1N34L 3U4VA 3U4ZA 1JJ2A 3UDGA 2MNAA 5LMUQ 2UUAQ 4BY1H 5C44G 3CCUA 3OTOQ 4B3SL 4X65Q 3GTKH 4A3CH 4OO1I 2YYZA 1JJGA 1EYGA 3CCRA 1FJGQ 1T9HA 4EQ5A 1XMQQ 1OXUA 1X6OA 3H0GG 4DV7L 2YTYA 2CWPA 4DR5Q 3K80C 4Y7NH 3PUVA 1HNWL 5EAYA 2A8VA 4A3JH 4YCUA 3W1GA 4QGUA 2VQEQ 4GOPB 3UDXA 4C3HH 1Z9FA 3I55A 1RIPA 1EFWA 4LFBL 4QY7A 1TWGH 1MJCA 1XNQQ 1PH5A 2D62A 3E9HA 1PH8A 4AYBG 1KD1C 3F8TA 1VQ9A 5C0XI 4LNQA 2NVTH 5IYCH 3HKZE 1WCMH 4JI8Q 5GADC 3CXCA 4LF5Q 3J7A5 1HZAA 4A3KH 3HOWG 1XPRA 2N8NA 2UXDQ 2Q2TA 1P8LA 4DR4Q 5H1SE 4A3MH 1LTLA 4JI1L 1NJIC 4GN5A 1VQJA 3ULJA 4IOCA 1X54A 2B3GA 2N3SA 2PNHA 3NBHB 5DLQE 2IHFA 1BVSA 4JI6L 2B63G 4QIWE 4HJ5A 4LW1A 4LUOA 4LUVA 2WB1G 1WCMG 4A3EG 5IP9H 1XPOA 4DK3C 1S40A 4X6AH 3G6EA 4LUZA 1L1OB 4DR3L 2MFIA 4A4IA 1WYDA 1I94L 3S1NH 4PZ6A 1EIYB 2ZJPA 1EQQA 4JBJA 1K9MC 2ZJRA 4AQYQ 3M4QA 3I4OA 4IOAA 4NXML 1CUKA 2D0OA 4RMFA 2JA9A 2K75A 4DK6C 4YWMA 3DLLA 2VQFQ 1HR0Q 2HT1A 3MEFA 1NMFA 3RN5A 4JI4L 2R6GA 3PF4A 3S1MH 4LF9L 1HR0W 3CMAA 1N34Q 5ELOA 4GNXA 1I3QH 3W1BA 1V1QA 2CQOA 2OCEA 3M85A 1JMCA 4DV2Q 3MXNB 1Y1VH 1YZ6A 3CCQA 4DR2L 1YIJA 1PH3A 3K7AH 2KCMA 2R92H 3S16H 4JG2A 2VUMH 1UE6A 3HOVH 4DUZQ 3K7UC 5JEAJ 3LGJA 1OTCA 4JI7Q 4L5SA 3CMEA 2JA8H 1Q1BA 2Y0SG 4DUZL 1G291 2N78A 3KDFB 3HKSA 4GOPA 1H95A 4R4CA 4RG1A 1YJWA 1X56A 2N49A 4JI3L 3EN2A 4MTNA 3E0EA 1XNQL 2BA0A 2JA5H 1Q46A 2B63H 1VQPA 1I94Q 3U58A 1B8AA 3CCEA 1K73C 4NXNQ 5C3EG 1P16A 1PYBA 3TEHB 3WWVA 4B3MQ 4BBSH 5C4JH 3RR5A 3PIPA 4PZ7A 1L1OA 3F1ZA 3F2BA 1QVCA 3RZOH 3PV0A 4DR7L 2JEBI 5JJKA 4UP9A 1HH2P 1TWAH 3CP0A 1XMQL 4IO9A 4DV0L 5IYCG 3T1YL 1Q82C 4BA2I 3T1HL 3KFUA 1TWCH 1NMGA 1CKNA 4H02A 3G48A 1HNZL 4GLAC 5C4XG 1KRSA 1WI5A 3RLOA 5IYDH 3GTPH 4P72A 2LXJA 3CCVA 1HR0L 4DKAC 3CPFA 1EUJA 3KOJA 1C0AA 1Q1EA 2B29A 1X55A 2R7ZH 4QQBX 1L0WA 3CCJA 2JA6G 1IBKL 1IBMQ 4C3IH 3NEMA 4JCVE 1L2FA 2HHHL 5HGQA 2WFWA 4X62L 3KF6B 1Q86C 2H5XA 2IY5B 3GO5A 1HNWQ 3GTQH 2ZTCA 1M1KC 1IBML 1QZGA 5JEAG 5JJIA 2UU9Q 1N8RC 3GTOH 5LMNL 4JBKA 4HJ9A 4LF6L 3NELA 1ASYA 2Q2UA 2WB1E 1KRTA 3STBC 3PO2H 2GVAA 1NTGA 3G71A 1IBKQ 4GKJQ 4KHZA 2MO0A 2R7DA 2AHOB 2PQAA 4X62Q 2Z0SA 1NE3A 4OWWB 2VUMG 5GROA 3M4PA 2CCZA 3HOVG 3CC7A 3CC4A 3S15H 1FL0A 1K8GA 4A3IH 4P71A 2DUDA 4JBWA 4JI5L 1TWFH 3SGIA 3S1QH 1GD7A 3NENA 4A76A 2OQKA 2UXDL 3HKZG 4DV5Q 1KIXA 4QJFA 4A3IG 1D8LA 4DV0Q 2OTJA 2UUAL 3EBEA 4LF4L 1VS0A 1K8AC 3FHWA 2IX1A 3S2DH 4HJ8A 1VQGA 1N33Q 1JE5A 3UE0A 1SMXA 1VCIA 4PG3A 3PO2G 2HIVA 5M3MG 4DR6Q 4JI5Q 1J6QA 1HJPA 4MZ9A 1EWIA 2F52A 2KBNA 5FLXc 4JBMA 2Y0SE 3PO3H 1L1OC 3J7ZC 4LFAL 3I7FA 1VQNA 3HOUG 1YBYA 4JC0A 4DV4L 2I5MX 1VQDA 3PGZA 4POFA 3S1RH 1VQFA 2ZJQA 5IT9c 3J80c 4NPSA 2JA7H 3S14H 2UUCQ 4DUYL 4JI4Q 2IT1A 1VQ4A 2JA6H 5C0XJ 5M3FG 2JJQA 3BZKA 2A19A 4IPDA 4UY8C 2OWOA 2ALYB 4A3KG 3HOWH 4YY3Q 4YCWA 1X3FA 1VQIA 5M3MH 3A74A 2K52A 3I4MH 1X3EA 1XNRL 3I2ZA 1AE2A 4KLKA 4OWTB 4APVA 2F4VQ 2LSSA 1TXYA 1CKNB 1IBLL 1R9TH 4HIOA 2YV5A 4R4OA 4UP7A 3I56A 1E24A 4A3JG 2AKWB 1EOVA 4R1JA 2I0QA 3CD6A 2K5NA 3L0OA 4IFDG 1O7IA 4DR1Q 1WOCA 1A8VA 2JK8A 1V43A 2EIFA 1IXRA 2RHQB 2KHIA 1XTDA 1XPUA 1VQCA 4LF8Q 4BBRH 5IP7H 1OXTA 1ASZA 4C2MH 2ES2A 3L7ZC 4OX9Q 3A5ZB 2NZOA 1WJJA 3HFZB 4NB3A 3GTMH 2ID0A 1AH9A 3J80i 3M3YH 1BBWA 4IPHA 1VQ8A 4K0KQ 1E1OA 1YHAA 2KENA 1W2BA 3K8AA 4AQYL 1SR3A 1XMOL 4LWCA 3ZJYC 4DV1Q 1OXVA 2XGTA 4YCVA 1QUQB 3A5UA 3CW2C 4B3SQ 1FGUA 4LF6Q 4KI0A 3GDEA 4A3DH 2RF4A 1FVIA 3ER0A 1VQOA 3CCSA 5FJ8H 1BBUA 4DV3L 1GVPA 3AFPA 3UDFA 2RHSB 4XTCS 1Q8KA 1UE1A 2AWOA 1YHQA 3KYHC 4JV5Q 3GTLH 2PI2E 4O2DA 2EQSA 4PMWA 1HNZQ 4GN4B 1XMOQ 4HJ7A 1N36L 1TWHH 4NXNL 2E5LQ 3Q8DA 1IYJB 2KCTA 2PMZE 1Q7YC 1J5EQ 4BXXG 4BY7H 4B3RQ 3B6YA 4NXMQ 1KL9A 2BH8A 4DV6L 4ALPA 5C4XH 4P75A 3KJOA 2UU9L 4DAMA 3L2PA 5K36G 5E7NA 2DGYA 3CAMA 1IL2A 5AJ3Q 1DGSA 1XJVA 1HZBA 1QVGA 1V9PA 4XIGS 3I4NH 3K0XA 4DR4L 3T1HQ 4JV5L 1K0RA 3RN2A 2NVQH 1KXLA 2HQLA 4R4IA 2L15A 3KDFA 5M3FH 4J15A 4JI6Q 3S17H 1EQRA 5BR8L 5JJLA 3RLFA 4B3RL 1CKOA 4ME3A 3KLWA 1BKBA 2F3IA 4IFDI 2JA5G 1QVFA 5BR8Q 5AJ3L 3H3VI 4DPGA 1SE8A 3J81j 3HOUH 1HZCA 1PH2A 4KHPQ 4OONA 2VNUD 4JI8L 3TQYA 4DV7Q 3D31A 4DV2L 1A0IA 2KHJA 2R7FA 5IYDG 1Z47A 2K5HA 4QL5A 4DR1L 4DR6L 4P73A 2WAQG 5HY6A 4JI2Q 3STBD 1N32L 2GVBA 3A0JA 2YTVA 1OXXK 2I5HA 2MO1A 3GD7A 4JI1Q 3F2CA 3K81C 5LMUL 4B3ML 3HOYH 4FDBA 2VQEL 2VZAA 4DV5L 4WJ3M 2NVYH 2QEXA 1XNRQ 2RCNA 2IHEA 1MKHA 2FXQA 5M5XH 4YHHL 1VQ7A 4DR7Q 3RNUA 4P74A 4LF7Q 1SN8A 5FLMH 4TVAB 1N36Q 2E5LL 4BBSG 5IWAL 3OW2A 4X64L 4JI0Q 2Q2HA 5C3EH 4HIDA 1PH6A 4TQUS 5FJ8G 1YJ9A 2K4KA 4LFBQ 5J3BA 5GAGC 2ZM6Q 1UWVA 4GS3A 3HOYG 4X64Q 2XTIA 1PH9A 4GN3B 4IPGA 3HOXG 1UE7A 3EIVA 4DR2Q 1G6PA 3PUWA 4LF4Q 2K50A 4YHHQ 2Z6KA 2YTXA 4B3TQ 2E2JH 2UXCL 1UE5A 4HIKA 4A3FG 1E1TA 3M4OH 4HJAA 3ULPA 2Z6KC 4A3EH 2R92G 2F4VL 2BA1A 2CWAA 1Y14B 2UUBL 3BJUA 2AWNA 2CFMA 1PHJA 4L5RC 4BBRG 4IJHA 1C7YA 4WJ4A 2ATWA 1Y1WG 1VQAA 3E9IA 2GN5A 4AH6A 1K83H 3AFQA 4LF8L 4A3LH 3JAMi 2R7ZG 4A3BG 1LYLA 1CKMA 3UDIA 4DV1L 1HNXQ 1VQMA 2E8GA 3KF8B 3PF5A 4GOPC 2OTLA 1AE3A 4K0KL 5IY0A 2UUBQ 1A63A 4BXXH 3J81c 3BU2A 2HHHQ 2JQOA 2ZTDA 1VQ5A 5IP9G 4OX9L 5IWAQ 4A3BH 1QZHA 3CCLA 4R4TA 3H0GH 2UXCQ 1NBWA 4LFCQ 1Y1WH 4JYAL 2JA7G 4L5QA 1MJEA 2QA4A 1JB7A 1N33L 3S2HH 1VQ6A 4A3CG 3UE1A 1J5EL 2NZHA 3W5OA 4YWKA 4X65L 3ICEA 3AYHB 2UXBQ 4IJLA 3AEVA 2ASBA 2NVXH 5GQOA 3PO3G 2VY3A 4A3DG 5GAHC 2PI2A 3RZDH 4MNOA 1PH4A 2JE6I 4AIMA 2AMCB 1PH1A 1VQKA 1W3SA 4LFAQ 4GNXC 4A3FH 3OYYA 1B7YB 2Q2IA 3I4NG 4PZ8A 1EIFA 4R4QA 1PH7A 1OXSC 3PUXA 3M7NA 1YJNA 4OXPA 1E22A 3PUZA 3HOXH 5IE8A 1HNXL 2NN6I 4GKKQ 1GO3E 4DR3Q 4DUYQ 1RL2A 1PVOA 3AQQA 4OWXB 1Y1VG 3H3VH 1YVCA 1N32Q 3M9BA 3JC66 3ULLA 4JI3Q 3HOZH 4YY3L 3CF5A 1KC8C 5LMNQ 5GAEC 1UEBA 3CQZH 5FLMG 2EXDA 4OO1G 2I5LX 4DV3Q 1JT8A 5C44H 2OQ0A 1KHIA 1E7ZA 4L5TA 4DNIA 3OTOL 5LMNW 4GKJL 1I50H 1KAWA 4LF9Q 4A3GG 4JI2L 1Q12A 2LXKA 4A75A 4GKKL 3KJPA 3CCMA 1Q81C 1KQSA 4Y52H 2NN6G 4DR5L 4A93G 3S24A 1PA6A 1D7QA 4KHPL 2ZTEA 5M5WH 1N9WA 4YWLA 3U50C 1S72A 4X66L 2VW9A 1YITA 1IZ6A 4UP8A 1E3PA 2JEAI 2MQHA 4JI7L 3FP9A 2D0PA 2PQAB 4B3TL 1QUQA 4X66Q 1I6HH 2UXBL 1LM0A 3JAMc 1JJCB 3T1YQ 2HIXA 5IP7G 1SROA 1U0LA 2K14A 4A3MG 1GM5A 1YHBA 5M5YH 2VS1A 1YI2A 1FJGL 2WP8J 3D0FA 4UPAA 1WFQA 2UUCL 3TRZA 1A62A 3TS0A 1LUZA 2VL6A 3FKIG 1HZ9A 1VQHA 3J81i 2V1CC 2VQFL 1SRUA 1NY4A 2BH2A 1MIUA 4IPCA 3VDYA 3GTJH 1S3OA 1PFSA 4LFCL 3I4MG 1X65A 3FKIH 4LF7L 4JYAQ 2IX0A 4A3GH 2CKZB 4BY7G 1G51A 2WAQE 4A3LG 3PUYA 4JOIA 1IBLQ 2YU9H 1K3RA 5ELNA 3F2DA 2ZM6L 4HIMA 1C9OA 4BA1I
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNX B;  1SFO H;  4LF5 L;  1VQE A;  4AYB E;  4JOI C;  5C0X G;  1PV4 A;  3H15 A;  2E2I H;  2E2H H;  3KF6 A;  1GKH A;  1X3G A;  3CPW A;  1M90 C;  1U5K A;  3HOZ G;  2K5V A;  3TRE A;  4DV6 Q;  4GLX A;  4O0A A;  3PCO B;  1CSQ A;  4BY1 G;  1I5F A;  4EX5 A;  3IRB A;  4GLV B;  1SLJ A;  3G4S A;  3GTG H;  2R93 H;  1CSP A;  4JI0 L;  5IYB H;  2JA8 G;  1B70 B;  2QGQ A;  4POG A;  1VQB A;  1YNX A;  3CC2 A;  4A93 H;  1YEZ A;  2A1A A;  3PIO A;  4DV4 Q;  1VQL A;  4IFD J;  3TS2 A;  3DM3 A;  4DAY B;  5IYB G;  3ERS X;  1X9N A;  4C3J H;  2R93 G;  3BZC A;  2C35 B;  3PSI A;  3RLN A;  1PYS B;  1N34 L;  3U4V A;  3U4Z A;  1JJ2 A;  3UDG A;  2MNA A;  5LMU Q;  2UUA Q;  4BY1 H;  5C44 G;  3CCU A;  3OTO Q;  4B3S L;  4X65 Q;  3GTK H;  4A3C H;  4OO1 I;  2YYZ A;  1JJG A;  1EYG A;  3CCR A;  1FJG Q;  1T9H A;  4EQ5 A;  1XMQ Q;  1OXU A;  1X6O A;  3H0G G;  4DV7 L;  2YTY A;  2CWP A;  4DR5 Q;  3K80 C;  4Y7N H;  3PUV A;  1HNW L;  5EAY A;  2A8V A;  4A3J H;  4YCU A;  3W1G A;  4QGU A;  2VQE Q;  4GOP B;  3UDX A;  4C3H H;  1Z9F A;  3I55 A;  1RIP A;  1EFW A;  4LFB L;  4QY7 A;  1TWG H;  1MJC A;  1XNQ Q;  1PH5 A;  2D62 A;  3E9H A;  1PH8 A;  4AYB G;  1KD1 C;  3F8T A;  1VQ9 A;  5C0X I;  4LNQ A;  2NVT H;  5IYC H;  3HKZ E;  1WCM H;  4JI8 Q;  5GAD C;  3CXC A;  4LF5 Q;  3J7A 5;  1HZA A;  4A3K H;  3HOW G;  1XPR A;  2N8N A;  2UXD Q;  2Q2T A;  1P8L A;  4DR4 Q;  5H1S E;  4A3M H;  1LTL A;  4JI1 L;  1NJI C;  4GN5 A;  1VQJ A;  3ULJ A;  4IOC A;  1X54 A;  2B3G A;  2N3S A;  2PNH A;  3NBH B;  5DLQ E;  2IHF A;  1BVS A;  4JI6 L;  2B63 G;  4QIW E;  4HJ5 A;  4LW1 A;  4LUO A;  4LUV A;  2WB1 G;  1WCM G;  4A3E G;  5IP9 H;  1XPO A;  4DK3 C;  1S40 A;  4X6A H;  3G6E A;  4LUZ A;  1L1O B;  4DR3 L;  2MFI A;  4A4I A;  1WYD A;  1I94 L;  3S1N H;  4PZ6 A;  1EIY B;  2ZJP A;  1EQQ A;  4JBJ A;  1K9M C;  2ZJR A;  4AQY Q;  3M4Q A;  3I4O A;  4IOA A;  4NXM L;  1CUK A;  2D0O A;  4RMF A;  2JA9 A;  2K75 A;  4DK6 C;  4YWM A;  3DLL A;  2VQF Q;  1HR0 Q;  2HT1 A;  3MEF A;  1NMF A;  3RN5 A;  4JI4 L;  2R6G A;  3PF4 A;  3S1M H;  4LF9 L;  1HR0 W;  3CMA A;  1N34 Q;  5ELO A;  4GNX A;  1I3Q H;  3W1B A;  1V1Q A;  2CQO A;  2OCE A;  3M85 A;  1JMC A;  4DV2 Q;  3MXN B;  1Y1V H;  1YZ6 A;  3CCQ A;  4DR2 L;  1YIJ A;  1PH3 A;  3K7A H;  2KCM A;  2R92 H;  3S16 H;  4JG2 A;  2VUM H;  1UE6 A;  3HOV H;  4DUZ Q;  3K7U C;  5JEA J;  3LGJ A;  1OTC A;  4JI7 Q;  4L5S A;  3CME A;  2JA8 H;  1Q1B A;  2Y0S G;  4DUZ L;  1G29 1;  2N78 A;  3KDF B;  3HKS A;  4GOP A;  1H95 A;  4R4C A;  4RG1 A;  1YJW A;  1X56 A;  2N49 A;  4JI3 L;  3EN2 A;  4MTN A;  3E0E A;  1XNQ L;  2BA0 A;  2JA5 H;  1Q46 A;  2B63 H;  1VQP A;  1I94 Q;  3U58 A;  1B8A A;  3CCE A;  1K73 C;  4NXN Q;  5C3E G;  1P16 A;  1PYB A;  3TEH B;  3WWV A;  4B3M Q;  4BBS H;  5C4J H;  3RR5 A;  3PIP A;  4PZ7 A;  1L1O A;  3F1Z A;  3F2B A;  1QVC A;  3RZO H;  3PV0 A;  4DR7 L;  2JEB I;  5JJK A;  4UP9 A;  1HH2 P;  1TWA H;  3CP0 A;  1XMQ L;  4IO9 A;  4DV0 L;  5IYC G;  3T1Y L;  1Q82 C;  4BA2 I;  3T1H L;  3KFU A;  1TWC H;  1NMG A;  1CKN A;  4H02 A;  3G48 A;  1HNZ L;  4GLA C;  5C4X G;  1KRS A;  1WI5 A;  3RLO A;  5IYD H;  3GTP H;  4P72 A;  2LXJ A;  3CCV A;  1HR0 L;  4DKA C;  3CPF A;  1EUJ A;  3KOJ A;  1C0A A;  1Q1E A;  2B29 A;  1X55 A;  2R7Z H;  4QQB X;  1L0W A;  3CCJ A;  2JA6 G;  1IBK L;  1IBM Q;  4C3I H;  3NEM A;  4JCV E;  1L2F A;  2HHH L;  5HGQ A;  2WFW A;  4X62 L;  3KF6 B;  1Q86 C;  2H5X A;  2IY5 B;  3GO5 A;  1HNW Q;  3GTQ H;  2ZTC A;  1M1K C;  1IBM L;  1QZG A;  5JEA G;  5JJI A;  2UU9 Q;  1N8R C;  3GTO H;  5LMN L;  4JBK A;  4HJ9 A;  4LF6 L;  3NEL A;  1ASY A;  2Q2U A;  2WB1 E;  1KRT A;  3STB C;  3PO2 H;  2GVA A;  1NTG A;  3G71 A;  1IBK Q;  4GKJ Q;  4KHZ A;  2MO0 A;  2R7D A;  2AHO B;  2PQA A;  4X62 Q;  2Z0S A;  1NE3 A;  4OWW B;  2VUM G;  5GRO A;  3M4P A;  2CCZ A;  3HOV G;  3CC7 A;  3CC4 A;  3S15 H;  1FL0 A;  1K8G A;  4A3I H;  4P71 A;  2DUD A;  4JBW A;  4JI5 L;  1TWF H;  3SGI A;  3S1Q H;  1GD7 A;  3NEN A;  4A76 A;  2OQK A;  2UXD L;  3HKZ G;  4DV5 Q;  1KIX A;  4QJF A;  4A3I G;  1D8L A;  4DV0 Q;  2OTJ A;  2UUA L;  3EBE A;  4LF4 L;  1VS0 A;  1K8A C;  3FHW A;  2IX1 A;  3S2D H;  4HJ8 A;  1VQG A;  1N33 Q;  1JE5 A;  3UE0 A;  1SMX A;  1VCI A;  4PG3 A;  3PO2 G;  2HIV A;  5M3M G;  4DR6 Q;  4JI5 Q;  1J6Q A;  1HJP A;  4MZ9 A;  1EWI A;  2F52 A;  2KBN A;  5FLX c;  4JBM A;  2Y0S E;  3PO3 H;  1L1O C;  3J7Z C;  4LFA L;  3I7F A;  1VQN A;  3HOU G;  1YBY A;  4JC0 A;  4DV4 L;  2I5M X;  1VQD A;  3PGZ A;  4POF A;  3S1R H;  1VQF A;  2ZJQ A;  5IT9 c;  3J80 c;  4NPS A;  2JA7 H;  3S14 H;  2UUC Q;  4DUY L;  4JI4 Q;  2IT1 A;  1VQ4 A;  2JA6 H;  5C0X J;  5M3F G;  2JJQ A;  3BZK A;  2A19 A;  4IPD A;  4UY8 C;  2OWO A;  2ALY B;  4A3K G;  3HOW H;  4YY3 Q;  4YCW A;  1X3F A;  1VQI A;  5M3M H;  3A74 A;  2K52 A;  3I4M H;  1X3E A;  1XNR L;  3I2Z A;  1AE2 A;  4KLK A;  4OWT B;  4APV A;  2F4V Q;  2LSS A;  1TXY A;  1CKN B;  1IBL L;  1R9T H;  4HIO A;  2YV5 A;  4R4O A;  4UP7 A;  3I56 A;  1E24 A;  4A3J G;  2AKW B;  1EOV A;  4R1J A;  2I0Q A;  3CD6 A;  2K5N A;  3L0O A;  4IFD G;  1O7I A;  4DR1 Q;  1WOC A;  1A8V A;  2JK8 A;  1V43 A;  2EIF A;  1IXR A;  2RHQ B;  2KHI A;  1XTD A;  1XPU A;  1VQC A;  4LF8 Q;  4BBR H;  5IP7 H;  1OXT A;  1ASZ A;  4C2M H;  2ES2 A;  3L7Z C;  4OX9 Q;  3A5Z B;  2NZO A;  1WJJ A;  3HFZ B;  4NB3 A;  3GTM H;  2ID0 A;  1AH9 A;  3J80 i;  3M3Y H;  1BBW A;  4IPH A;  1VQ8 A;  4K0K Q;  1E1O A;  1YHA A;  2KEN A;  1W2B A;  3K8A A;  4AQY L;  1SR3 A;  1XMO L;  4LWC A;  3ZJY C;  4DV1 Q;  1OXV A;  2XGT A;  4YCV A;  1QUQ B;  3A5U A;  3CW2 C;  4B3S Q;  1FGU A;  4LF6 Q;  4KI0 A;  3GDE A;  4A3D H;  2RF4 A;  1FVI A;  3ER0 A;  1VQO A;  3CCS A;  5FJ8 H;  1BBU A;  4DV3 L;  1GVP A;  3AFP A;  3UDF A;  2RHS B;  4XTC S;  1Q8K A;  1UE1 A;  2AWO A;  1YHQ A;  3KYH C;  4JV5 Q;  3GTL H;  2PI2 E;  4O2D A;  2EQS A;  4PMW A;  1HNZ Q;  4GN4 B;  1XMO Q;  4HJ7 A;  1N36 L;  1TWH H;  4NXN L;  2E5L Q;  3Q8D A;  1IYJ B;  2KCT A;  2PMZ E;  1Q7Y C;  1J5E Q;  4BXX G;  4BY7 H;  4B3R Q;  3B6Y A;  4NXM Q;  1KL9 A;  2BH8 A;  4DV6 L;  4ALP A;  5C4X H;  4P75 A;  3KJO A;  2UU9 L;  4DAM A;  3L2P A;  5K36 G;  5E7N A;  2DGY A;  3CAM A;  1IL2 A;  5AJ3 Q;  1DGS A;  1XJV A;  1HZB A;  1QVG A;  1V9P A;  4XIG S;  3I4N H;  3K0X A;  4DR4 L;  3T1H Q;  4JV5 L;  1K0R A;  3RN2 A;  2NVQ H;  1KXL A;  2HQL A;  4R4I A;  2L15 A;  3KDF A;  5M3F H;  4J15 A;  4JI6 Q;  3S17 H;  1EQR A;  5BR8 L;  5JJL A;  3RLF A;  4B3R L;  1CKO A;  4ME3 A;  3KLW A;  1BKB A;  2F3I A;  4IFD I;  2JA5 G;  1QVF A;  5BR8 Q;  5AJ3 L;  3H3V I;  4DPG A;  1SE8 A;  3J81 j;  3HOU H;  1HZC A;  1PH2 A;  4KHP Q;  4OON A;  2VNU D;  4JI8 L;  3TQY A;  4DV7 Q;  3D31 A;  4DV2 L;  1A0I A;  2KHJ A;  2R7F A;  5IYD G;  1Z47 A;  2K5H A;  4QL5 A;  4DR1 L;  4DR6 L;  4P73 A;  2WAQ G;  5HY6 A;  4JI2 Q;  3STB D;  1N32 L;  2GVB A;  3A0J A;  2YTV A;  1OXX K;  2I5H A;  2MO1 A;  3GD7 A;  4JI1 Q;  3F2C A;  3K81 C;  5LMU L;  4B3M L;  3HOY H;  4FDB A;  2VQE L;  2VZA A;  4DV5 L;  4WJ3 M;  2NVY H;  2QEX A;  1XNR Q;  2RCN A;  2IHE A;  1MKH A;  2FXQ A;  5M5X H;  4YHH L;  1VQ7 A;  4DR7 Q;  3RNU A;  4P74 A;  4LF7 Q;  1SN8 A;  5FLM H;  4TVA B;  1N36 Q;  2E5L L;  4BBS G;  5IWA L;  3OW2 A;  4X64 L;  4JI0 Q;  2Q2H A;  5C3E H;  4HID A;  1PH6 A;  4TQU S;  5FJ8 G;  1YJ9 A;  2K4K A;  4LFB Q;  5J3B A;  5GAG C;  2ZM6 Q;  1UWV A;  4GS3 A;  3HOY G;  4X64 Q;  2XTI A;  1PH9 A;  4GN3 B;  4IPG A;  3HOX G;  1UE7 A;  3EIV A;  4DR2 Q;  1G6P A;  3PUW A;  4LF4 Q;  2K50 A;  4YHH Q;  2Z6K A;  2YTX A;  4B3T Q;  2E2J H;  2UXC L;  1UE5 A;  4HIK A;  4A3F G;  1E1T A;  3M4O H;  4HJA A;  3ULP A;  2Z6K C;  4A3E H;  2R92 G;  2F4V L;  2BA1 A;  2CWA A;  1Y14 B;  2UUB L;  3BJU A;  2AWN A;  2CFM A;  1PHJ A;  4L5R C;  4BBR G;  4IJH A;  1C7Y A;  4WJ4 A;  2ATW A;  1Y1W G;  1VQA A;  3E9I A;  2GN5 A;  4AH6 A;  1K83 H;  3AFQ A;  4LF8 L;  4A3L H;  3JAM i;  2R7Z G;  4A3B G;  1LYL A;  1CKM A;  3UDI A;  4DV1 L;  1HNX Q;  1VQM A;  2E8G A;  3KF8 B;  3PF5 A;  4GOP C;  2OTL A;  1AE3 A;  4K0K L;  5IY0 A;  2UUB Q;  1A63 A;  4BXX H;  3J81 c;  3BU2 A;  2HHH Q;  2JQO A;  2ZTD A;  1VQ5 A;  5IP9 G;  4OX9 L;  5IWA Q;  4A3B H;  1QZH A;  3CCL A;  4R4T A;  3H0G H;  2UXC Q;  1NBW A;  4LFC Q;  1Y1W H;  4JYA L;  2JA7 G;  4L5Q A;  1MJE A;  2QA4 A;  1JB7 A;  1N33 L;  3S2H H;  1VQ6 A;  4A3C G;  3UE1 A;  1J5E L;  2NZH A;  3W5O A;  4YWK A;  4X65 L;  3ICE A;  3AYH B;  2UXB Q;  4IJL A;  3AEV A;  2ASB A;  2NVX H;  5GQO A;  3PO3 G;  2VY3 A;  4A3D G;  5GAH C;  2PI2 A;  3RZD H;  4MNO A;  1PH4 A;  2JE6 I;  4AIM A;  2AMC B;  1PH1 A;  1VQK A;  1W3S A;  4LFA Q;  4GNX C;  4A3F H;  3OYY A;  1B7Y B;  2Q2I A;  3I4N G;  4PZ8 A;  1EIF A;  4R4Q A;  1PH7 A;  1OXS C;  3PUX A;  3M7N A;  1YJN A;  4OXP A;  1E22 A;  3PUZ A;  3HOX H;  5IE8 A;  1HNX L;  2NN6 I;  4GKK Q;  1GO3 E;  4DR3 Q;  4DUY Q;  1RL2 A;  1PVO A;  3AQQ A;  4OWX B;  1Y1V G;  3H3V H;  1YVC A;  1N32 Q;  3M9B A;  3JC6 6;  3ULL A;  4JI3 Q;  3HOZ H;  4YY3 L;  3CF5 A;  1KC8 C;  5LMN Q;  5GAE C;  1UEB A;  3CQZ H;  5FLM G;  2EXD A;  4OO1 G;  2I5L X;  4DV3 Q;  1JT8 A;  5C44 H;  2OQ0 A;  1KHI A;  1E7Z A;  4L5T A;  4DNI A;  3OTO L;  5LMN W;  4GKJ L;  1I50 H;  1KAW A;  4LF9 Q;  4A3G G;  4JI2 L;  1Q12 A;  2LXK A;  4A75 A;  4GKK L;  3KJP A;  3CCM A;  1Q81 C;  1KQS A;  4Y52 H;  2NN6 G;  4DR5 L;  4A93 G;  3S24 A;  1PA6 A;  1D7Q A;  4KHP L;  2ZTE A;  5M5W H;  1N9W A;  4YWL A;  3U50 C;  1S72 A;  4X66 L;  2VW9 A;  1YIT A;  1IZ6 A;  4UP8 A;  1E3P A;  2JEA I;  2MQH A;  4JI7 L;  3FP9 A;  2D0P A;  2PQA B;  4B3T L;  1QUQ A;  4X66 Q;  1I6H H;  2UXB L;  1LM0 A;  3JAM c;  1JJC B;  3T1Y Q;  2HIX A;  5IP7 G;  1SRO A;  1U0L A;  2K14 A;  4A3M G;  1GM5 A;  1YHB A;  5M5Y H;  2VS1 A;  1YI2 A;  1FJG L;  2WP8 J;  3D0F A;  4UPA A;  1WFQ A;  2UUC L;  3TRZ A;  1A62 A;  3TS0 A;  1LUZ A;  2VL6 A;  3FKI G;  1HZ9 A;  1VQH A;  3J81 i;  2V1C C;  2VQF L;  1SRU A;  1NY4 A;  2BH2 A;  1MIU A;  4IPC A;  3VDY A;  3GTJ H;  1S3O A;  1PFS A;  4LFC L;  3I4M G;  1X65 A;  3FKI H;  4LF7 L;  4JYA Q;  2IX0 A;  4A3G H;  2CKZ B;  4BY7 G;  1G51 A;  2WAQ E;  4A3L G;  3PUY A;  4JOI A;  1IBL Q;  2YU9 H;  1K3R A;  5ELN A;  3F2D A;  2ZM6 L;  4HIM A;  1C9O A;  4BA1 I; 
#chains in the Genus database with same CATH topology
 4LF5 L;  1PV4 A;  5C0X G;  3H15 A;  3CPW A;  1X3G A;  4X3S A;  2B2T A;  4BY1 G;  1CSQ A;  3IRB A;  2F0W A;  3EVQ A;  2EPB A;  4GLV B;  1F9Q A;  5ELE A;  1SLJ A;  3G4S A;  4KHV A;  4A93 H;  2O4X A;  4DV4 Q;  1VQL A;  3TS2 A;  1LLR D;  1D1K A;  3W2D A;  3PSI A;  4JK1 C;  1PYS B;  3U4V A;  3U4Z A;  4DR6 L;  4JW0 A;  1RF2 D;  1SE4 A;  3OTO Q;  4B3S L;  4X65 Q;  4BY1 H;  4A3C H;  4WJ3 M;  1JJG A;  3NHH A;  1XMQ Q;  4EQ5 A;  1OXU A;  1EWC A;  2CWP A;  1SNO A;  2KUM A;  4Y7N H;  2B63 B;  1TY0 A;  2QW7 A;  4LFB L;  1DON A;  1LTB D;  4C3H H;  4OGQ C;  2P5Z X;  1XNQ Q;  1PH5 A;  2D62 A;  2JA6 B;  3GTK B;  4CDD C;  2F3W A;  3HKZ E;  3OHX C;  3CXC A;  2PZU A;  4A3K H;  1XPR A;  3EFX D;  1GUG A;  5EPK A;  4H13 C;  5H1S E;  4JI1 L;  1JCK B;  4HN7 A;  4IOC A;  3D4W A;  1LAC A;  3NBH B;  2PNH A;  1HHV A;  3HOU B;  2EXZ A;  3IFT A;  4I7Z C;  4G7H C;  2F0L A;  3HS0 C;  4KY6 A;  4X6A H;  3SK4 A;  2F03 A;  4DR3 L;  4IQZ A;  4KY7 A;  1WYD A;  3C2P A;  2B2U C;  3M4Q A;  2EYL A;  1YNN C;  5CR3 A;  1HR0 Q;  3KK7 A;  1I4R A;  2B2V C;  3CKI B;  1Y1W B;  4GNX A;  3M85 A;  1AZQ A;  3MXN B;  4FXK C;  5DM7 3;  4DR2 L;  1G8Z D;  3K7A H;  1SYC A;  2VUM H;  1K28 A;  2PZT A;  3J81 E;  4F8M A;  1Q90 A;  3LGJ A;  1VMP A;  2JA8 H;  2KOL A;  2Y0S G;  4A3F B;  2K1B A;  3S1M B;  5KIX A;  4DUZ L;  2N78 A;  3KDF B;  4GOP A;  1H95 A;  4R4C A;  4UHV A;  1CFM A;  2N49 A;  3IFD A;  3EN2 A;  3VA5 A;  1I94 Q;  2JSO A;  2F0G A;  4TKO B;  2AQ1 B;  3WWV A;  1PYB A;  2B2W A;  2RVL A;  5D3I B;  4QIW B;  4HED A;  3T53 B;  3F2B A;  3Q24 A;  4DR7 L;  2JEB I;  4UP9 A;  1GHJ A;  1HH2 P;  4DV0 L;  1S5F D;  5IIF A;  3KFU A;  4H02 A;  2PW5 A;  1F2M A;  3P20 A;  3G48 A;  1JE4 A;  1WI5 A;  3GTP H;  4Z9C B;  1SNP A;  1NAP A;  3CPF A;  1A3U A;  1R9T B;  1KNA A;  2XNA C;  1X55 A;  4QQB X;  3OMC A;  1E2Z A;  1EU3 A;  3RMH A;  1MHW C;  2PW7 A;  2NB0 A;  2WFW A;  5HGQ A;  4X62 L;  2HHH L;  4QCL A;  3KF6 B;  5C3W A;  2H5X A;  2L55 A;  3GO5 A;  3GTQ H;  3NWT A;  4DK1 A;  3RZD B;  4F87 A;  1OO9 B;  4EQP A;  1F9R A;  1QNU A;  4LF6 L;  2R7Z B;  1R4P B;  3STB C;  4KHZ A;  1U4M A;  2Z0S A;  4BY1 B;  4XQQ A;  3EJI A;  4OWW B;  5GRO A;  3M4P A;  2CH4 W;  1C9O A;  1EOT A;  2AQ3 B;  1X3P A;  3VYU A;  4P71 A;  4WRD A;  1TWF H;  3AB9 A;  1MGS A;  3SGI A;  4FYD A;  2SOB A;  3NEN A;  4A76 A;  2ICI A;  2IL8 A;  2CVR A;  5IT9 L;  2OTJ A;  1H9K A;  4A3D B;  4LF4 L;  1VS0 A;  2IX1 A;  1B9M A;  1VQG A;  3J7Y W;  3UE0 A;  1ENC A;  4PG3 A;  3PO2 G;  3N52 A;  1PDQ A;  1DM0 B;  3Q6S A;  1K8O A;  1J6Q A;  4MZ9 A;  4YIJ A;  5FLX c;  2C5C A;  1L1O C;  1EZ6 A;  2EYJ A;  3I7F A;  5JEA H;  3J7Z C;  4LFA L;  1VQN A;  4CJ0 B;  2ZJQ A;  2DN8 A;  2J4X A;  4NPS A;  5I6Y A;  1CZW A;  3TDQ A;  2UUC Q;  3BDC A;  3G6J B;  3KF8 A;  3BZD B;  4N9T A;  4U68 A;  1O78 A;  3LWE A;  2JJQ A;  3BZK A;  4IPD A;  5M3F G;  5KYL A;  2ALY B;  2Z4I A;  4YY3 Q;  5M5Y B;  1X3F A;  3I70 A;  2K52 A;  4RGT A;  3I4M H;  2A6H C;  4KLK A;  4APV A;  3WOE A;  3S1R B;  2F4V Q;  1A3V A;  1CKN B;  4PMC A;  4HIO A;  2A6E D;  1CHQ D;  1E24 A;  4R1J A;  2K5N A;  4DR1 Q;  1D2B A;  1IKL A;  3MA2 B;  3N6R A;  2EIF A;  5C6A A;  5E1F A;  3E3X A;  3VYT A;  1D7Q A;  4XT1 B;  3ITP A;  4BBR H;  1OXT A;  2EDG A;  3MFG A;  1BDO A;  2B2W C;  4CKC A;  3J80 i;  1UNS A;  4IPH A;  4CHT B;  1SR3 A;  1CHP D;  1XMO L;  3ZJY C;  2L9H A;  1OXV A;  5EBD A;  2F0D A;  4DV1 Q;  3QG1 A;  1DOM A;  3A5U A;  2L0C A;  1TT2 A;  4LF6 Q;  4KI0 A;  3GDE A;  2RF4 A;  1FVI A;  3ER0 A;  3LWU A;  1VQO A;  1BNZ A;  3CCS A;  3GP7 A;  3AFP A;  2MP1 A;  3I4N B;  1EY6 A;  3GTL H;  4P2C B;  3TZU A;  1HNZ Q;  4BY7 B;  1EY7 A;  1XMO Q;  3E6Z X;  3Q8D A;  1IYJ B;  2QKI C;  4IZ8 A;  4K2K A;  2RDF A;  4QF4 A;  2E2D C;  1Q7Y C;  1J5E Q;  4B3R Q;  5BN4 A;  1C4Q A;  4DV6 L;  3KJO A;  3L2P A;  5K36 G;  5E7N A;  1IL2 A;  1DGS A;  1IW7 C;  1ICF B;  3NPP A;  3RN2 A;  3X3M A;  2HQL A;  4R4I A;  1NNX A;  4JI6 Q;  2EY1 A;  1EQR A;  1EZ8 A;  5BR8 L;  3ONA B;  1BKB A;  2F3I A;  5IGD A;  4IFD I;  2DNE A;  5M5X B;  1TVX A;  5AJ3 L;  1SE8 A;  2TMP A;  4J1M A;  2HD3 A;  4KHP Q;  1U9R A;  4DV7 Q;  3D31 A;  2N55 A;  1A0I A;  4DR1 L;  1STH A;  2K5H A;  2YTV A;  4JI1 Q;  3CC4 A;  4KKU A;  3H3V C;  3K81 C;  1LTR D;  2VZA A;  4G57 A;  4DV5 L;  1NR4 A;  2L11 A;  2RCN A;  4BBS B;  5D3D A;  5BN5 A;  1SXT A;  3RNU A;  4P74 A;  4LF7 Q;  4HR7 B;  2F0E A;  3U9O A;  5C3E H;  4HID A;  4TQU S;  4ID6 A;  1HTP A;  2K4K A;  1YJ9 A;  4LFB Q;  4B08 A;  4RKL A;  3GTQ B;  2XTI A;  4FXG C;  4IPG A;  1G6P A;  3PUW A;  4LF4 Q;  2Z6K A;  2YTX A;  4A3F G;  2M9V A;  4XDX A;  2DJG C;  3HG9 A;  1AEX A;  3A8J E;  3J81 L;  2R92 G;  2MHV A;  3WOF A;  2CWA A;  1GUT A;  4L5R C;  1I50 B;  2AWN A;  2CFM A;  3D4D A;  3MEH A;  4BBR G;  1PHJ A;  1C7Y A;  1II3 A;  4M8A A;  1O7L A;  2ATW A;  2EYM A;  5I9P A;  2GN5 A;  4AH6 A;  4LMQ D;  2JA5 B;  3JAM i;  1CKM A;  1IKM A;  3BS1 A;  3BVZ A;  3CHB D;  1IL8 A;  2X69 A;  4HMJ A;  2OTL A;  2KQ3 A;  1BR9 A;  4LK1 C;  2UUB Q;  1A63 A;  2JQO A;  2ZTD A;  1C8C A;  3BVG A;  5IWA Q;  2PO4 A;  4C56 C;  2UXC Q;  4JYA L;  4K6D A;  3PO2 B;  5C4H A;  1MJE A;  2QA4 A;  1JB7 A;  1N33 L;  1VQ6 A;  4A3C G;  1VF5 C;  1J5E L;  5ELC A;  3A56 A;  2UXB Q;  4G7Z C;  2QEJ C;  3Q23 A;  1CQF A;  3D8G A;  4A3D G;  2RDH A;  3DHQ A;  1D5Z C;  4MTK A;  1VQK A;  1PH1 A;  4O42 A;  1LT6 D;  3OYY A;  1B7Y B;  1JC7 A;  4PZ8 A;  1EYD A;  2XVS A;  1YJN A;  4OXP A;  1E22 A;  4F88 A;  2NN6 I;  4CKE A;  1WVL A;  1EYA A;  1RL2 A;  3AQQ A;  5FO7 B;  4OWX B;  1Y1V G;  4XQJ A;  3C1F A;  1YVC A;  5I4D A;  3M9B A;  5C0X H;  3CQZ H;  1BCP F;  1ENF A;  1JT8 A;  4L5T A;  2C9O A;  3A8K E;  2RKS A;  1V1P A;  3OW7 A;  1WTX A;  1K8M A;  2CQA A;  4JI2 L;  3KBG A;  1SNQ A;  3EQL C;  5DAU A;  3KJP A;  1Q81 C;  1KQS A;  3KBX A;  5ISR A;  2NN6 G;  3NE5 B;  1HTL D;  4HTH A;  2SNS A;  2D5D A;  1S5C D;  3U50 C;  3HZX A;  1YIT A;  1STY A;  2HQE A;  2MQH A;  4KKT A;  5CYU A;  2K7V A;  4ZYS A;  1LM0 A;  1JIC A;  2QIL A;  4RWS C;  1M4V A;  5IP7 G;  1U0L A;  5M5Y H;  2JA7 B;  2WV6 D;  3D0F A;  2UUC L;  2RA4 A;  1WCM B;  1B44 D;  2ICE C;  1TWH B;  3J81 i;  3K5L A;  2VQF L;  1SRU A;  1NY4 A;  3VDY A;  4I65 A;  1I6H B;  4JYA Q;  3I90 A;  4A3G H;  1HA5 A;  2I46 A;  1RTO A;  2WAQ E;  3HEJ A;  3PUY A;  2LKV A;  2F0U A;  5ELN A;  1MSH A;  2ZM6 L;  3JAM L;  2VNU D;  1SYE A;  4K6L A;  5G3L F;  1SFO H;  5ELF A;  1VQE A;  3K5M A;  1MI2 A;  3KF6 A;  1U5K A;  3DMU A;  4LJZ C;  4ZKC B;  2G9D A;  1EY9 A;  3QJY A;  3PCO B;  1I5F A;  1WTP A;  1FYC A;  1TS2 A;  5A2Q L;  3GTG H;  1BBX C;  1ET9 A;  5IYB H;  3R2T A;  2JA8 G;  4PQX A;  1QIL A;  4O1N A;  3PIO A;  1TWF B;  3DM3 A;  4DAY B;  3ERS X;  4C3J H;  2R93 G;  1GJX A;  2A6E C;  1PYW D;  2FIN B;  3UDG A;  1JOQ A;  5LMU Q;  4OO1 I;  5C44 G;  2NVT B;  1EYG A;  1T9H A;  1HUN A;  1WTW A;  4OEM B;  3H0G G;  1DOK A;  4A3J B;  5IGB A;  1QOH A;  3K80 C;  5EAY A;  1KAA A;  4YCU A;  1BOS A;  4GOP B;  4KJO A;  1RIP A;  1TWG H;  1WTQ A;  3E9H A;  4LNQ A;  5C0X I;  5GAD C;  4LF5 Q;  2N8N A;  1ZYR C;  5D14 A;  1ML0 D;  4A3M H;  1B3Q A;  1NJI C;  3PO3 B;  1EQT A;  2N3S A;  5DLQ E;  5IOC A;  2IHF A;  1BVS A;  4JI6 L;  2B63 G;  2FJ2 A;  4QIW E;  4DAV A;  3GTG B;  4A3E G;  1S40 A;  4OO1 G;  4LUV A;  3HGB A;  1S5D D;  4RHR A;  5L37 A;  3MWY W;  2E2H B;  1I94 L;  5CV4 A;  1EIY B;  1EQQ A;  3FPP A;  4JBJ A;  3I4O A;  2K32 A;  2D0O A;  4A3I B;  3EA6 A;  3DLL A;  1QCB D;  2F0V A;  4BS9 A;  3I4L A;  3S1M H;  2M00 A;  2F0K A;  1JMC A;  1F77 A;  2SDF A;  3CCQ A;  1SND A;  1YIJ A;  2QDB A;  2KCM A;  3HOV H;  1UE6 A;  4DUZ Q;  5FK9 C;  2WAC A;  2K01 A;  1Q1B A;  1RCV D;  1GUO A;  3T4A C;  1H9R A;  4V19 0;  4MTN A;  5KNC A;  4Y7N B;  2B63 H;  4ZUI A;  1B8A A;  1QJO A;  2VB2 X;  3CCE A;  4B3M Q;  4BBS H;  4RFB A;  2WAQ B;  5C4J H;  3RR5 A;  5CGK A;  4TRD A;  2K5D A;  1QVC A;  3IKJ A;  3T1Y L;  4GLA C;  1KRS A;  3RLO A;  5IYD H;  1F2L A;  1HR0 L;  4DKA C;  1NUC A;  3LNN A;  1C0A A;  4DK0 A;  1AFP A;  1ILQ A;  2B29 A;  3CCJ A;  5ELB A;  1Q86 C;  2ZTC A;  1IBM L;  1KDB A;  1KTK A;  1QZG A;  1NCV A;  4DF7 A;  1SYB A;  1D5M C;  5LMN L;  4IUU A;  1D5X C;  2DY7 A;  4C3J B;  3ERO A;  1NTG A;  4GKJ Q;  2MO0 A;  2AHO B;  2N88 A;  4DNT B;  3HOV G;  1S4Z A;  2B8G A;  5FLX L;  4ME5 A;  4A3I H;  2ZT9 C;  4JBW A;  4JI5 L;  2K5W A;  2B2Y A;  1TS3 A;  2OQK A;  1ROD A;  3HKZ G;  1Y8N B;  4DV5 Q;  4QJF A;  4A3I G;  4L6T B;  3NQT A;  4OIK A;  2H4O A;  2UUA L;  1BCP D;  1K8A C;  3NWS A;  4HJ8 A;  3D4R A;  2HUG A;  1O7Y A;  2L1B A;  4IAL A;  2F3V A;  1RD9 D;  5D65 A;  4DR6 Q;  3BDO A;  2O5I C;  2NVQ B;  1EWI A;  1MSG A;  1NSN S;  4JBM A;  5C3X A;  2Y0S E;  3PO3 H;  4RCN A;  5KND A;  4JC0 A;  4DV4 L;  2IJ0 A;  1VQD A;  4F7X A;  1BXT A;  2JA7 H;  1TU2 B;  2IT1 A;  2OXP A;  5C0X J;  1STA A;  1HPC A;  4LAA A;  5EKL A;  4UY8 C;  2OWO A;  1CI3 M;  1EQV A;  2E75 C;  1PTO B;  4RHS A;  3A74 A;  1KNE A;  4ZRZ A;  1X3E A;  2DJF C;  2KVM A;  3I2Z A;  2LSS A;  1TXY A;  2Q8T A;  4NKL A;  1EOV A;  3CD6 A;  3L0O A;  1WOC A;  1A8V A;  3J80 L;  1V43 A;  1PTO C;  1IXR A;  1CA6 A;  1SDF A;  2KHI A;  4L63 B;  5EKK A;  5C44 B;  4LF8 Q;  2ES2 A;  3HFZ B;  4NB3 A;  3X3N A;  5CV8 A;  1FD7 D;  3M3Y H;  1PRT D;  2EY6 A;  1CM9 A;  1E1O A;  1W2B A;  3R8B A;  3DUZ A;  3I72 A;  3S1Q B;  3ZYY X;  2XGT A;  4RA8 A;  4J6H A;  2BDO A;  4MHE A;  4FF3 A;  4A3D H;  1GUN A;  4DV3 L;  2ZXR A;  1GOZ A;  2RHS B;  1Q8K A;  3S14 B;  2DNC A;  5IGG A;  3ERQ A;  1YHQ A;  2RBM A;  3URY A;  2Q8R E;  4OIJ A;  3K59 A;  2EQS A;  1A3T A;  4PMW A;  3Q22 A;  2K28 A;  2B39 A;  2B2U A;  2E5L Q;  1V1P B;  4KN7 C;  2PMZ E;  5CV9 A;  3GQB A;  1JOK A;  3V2T A;  3BYY B;  2CH4 A;  1X32 A;  1BF4 A;  5FLX E;  4P75 A;  3NUC A;  1EY0 A;  3U9S A;  4U67 3;  3I4N H;  3QO2 A;  1V9P A;  4XIG S;  3K0X A;  4JV5 L;  4TSS A;  4K14 A;  5KGU A;  4WOR A;  3S17 H;  2F0T A;  5AFW A;  5CV5 A;  4CGY B;  5JJL A;  3RLF A;  3S17 B;  3S2D B;  1TWC B;  1QVF A;  1PMR A;  3J81 j;  3HOU H;  1HZC A;  4B9X A;  4OON A;  4JI8 L;  5IT9 E;  4DV2 L;  2R7F A;  4C2M B;  5IYD G;  3STB D;  5HY6 A;  1N32 L;  3S2D H;  2A68 C;  5LMU L;  4H7B A;  1LTA D;  3MVV A;  4FDB A;  3SEB A;  1ONL A;  5BN3 A;  3QR8 A;  1XNR Q;  2IHE A;  1MKH A;  5IOD A;  2K05 A;  5M5X H;  1F2Z A;  3GTL B;  1VMC A;  1HFG A;  2A74 C;  5KNB A;  5CBA E;  1N36 Q;  4TVA B;  1WD0 A;  4BBS G;  3OW2 A;  2Y0S B;  5M3M B;  1SYD A;  2F0F A;  5FJ8 G;  1LO5 D;  1HQR D;  5J3B A;  5GAG C;  2ZM6 Q;  3S16 B;  1G91 A;  1V8Q A;  1JOR A;  4BWG B;  3ND9 A;  4GN3 B;  2LY7 A;  3J7A F;  4G7O C;  2RQX A;  4C1N I;  2K50 A;  3C1E A;  4YHH Q;  3K57 A;  2E2J H;  3VR3 A;  4HIK A;  1E1T A;  1EIH A;  3ULP A;  2Z6K C;  2KJX A;  3GV6 A;  1Y14 B;  2NTT A;  2HCI A;  4IJH A;  4JPB W;  3H94 A;  4WJ4 A;  4QB4 A;  4CDF C;  4LF8 L;  2R7Z G;  1VDZ A;  3UDI A;  1BCP B;  3KF8 B;  3PF5 A;  4GOP C;  3GTP B;  1DD2 A;  2A6H D;  5IY0 A;  3I8Z A;  2RSN A;  3BU2 A;  2F0N A;  3FKI B;  2HHH Q;  1JOO A;  5CV6 A;  1I3Q B;  2F0S A;  5I2Y A;  1NBW A;  4ZAI A;  2XWB B;  4L5Q A;  3HRZ C;  5FOB B;  3SK6 A;  2NZH A;  5C4X B;  3ICE A;  2KA7 A;  1JWS D;  2B8F A;  3NP8 A;  2ASB A;  5GQO A;  4RGN A;  4UDU C;  2PI2 A;  1EY5 A;  5A35 A;  4AIM A;  2AMC B;  1W3S A;  1AW7 A;  4A3F H;  1ZEQ X;  1LTT D;  1RDP D;  1EIG A;  1EIF A;  3PUX A;  2PMZ B;  3DXJ C;  5IE8 A;  4K5X A;  3HOV B;  3NBI A;  2KHS A;  5ELD A;  1N32 Q;  1QE6 A;  3VA7 A;  4JI3 Q;  1FGB D;  4YY3 L;  2F0Q A;  5LMN Q;  1UEB A;  3MXP A;  5C4Z A;  5IGC A;  2PCF B;  3QB3 A;  5C44 H;  2OQ0 A;  1KHI A;  4DNI A;  4GKJ L;  1I50 H;  1KAW A;  1Q12 A;  1XYI A;  4GKK L;  3CCM A;  4IN3 A;  2L4N A;  4Y52 H;  3NQI A;  3A7A B;  4MN3 A;  4A3K B;  1TII D;  2ZTE A;  4YWL A;  1S72 A;  4ZUJ A;  4X66 L;  2EYO A;  4RCO A;  1PTO H;  3FP9 A;  1UAP A;  1Y8P B;  3C46 A;  3JAM c;  1JJC B;  3V96 A;  1SRO A;  4RH6 A;  3FMC A;  1GM5 A;  1YI2 A;  3VR5 A;  4IUT A;  3NTI A;  4IFD H;  5M9O A;  3TRZ A;  3PQI A;  4CKB A;  4QMG A;  3DEP A;  2V1C C;  3SK5 A;  3AU7 A;  4IPC A;  4MIU A;  3GTJ H;  5I6W A;  4QUF A;  4LF7 L;  2IX0 A;  1S5E D;  2CKZ B;  1PTO F;  3VYR A;  1G51 A;  4JOI A;  1K3R A;  3F2D A;  1F9S A;  4HIM A;  4GNX B;  1I4Q A;  3RD4 A;  4AYB E;  1GKH A;  1SYG A;  2TSS A;  2K5V A;  1GXD C;  3TRE A;  4DV6 Q;  4CDE C;  2A5H A;  3SDZ A;  5E4X A;  4A3G B;  4V0B A;  1PLF A;  4JI0 L;  3A7L A;  4HCE A;  2NZ1 D;  4EQO A;  1B70 B;  4POG A;  1VQB A;  3VYS A;  5CBE E;  1YEZ A;  2A1A A;  2EYF A;  3KUP A;  3RLN A;  1N34 L;  4KN4 C;  1Z7T A;  4XYO A;  5EBC A;  5EPJ A;  4DV7 L;  4FNF A;  3T51 B;  4K2L A;  1Z6H A;  3K0Y A;  2PPB C;  1PFM A;  4QGU A;  2VQE Q;  1Z9F A;  4QY7 A;  1FNV A;  1YNJ D;  2ZXP A;  2NVT H;  1PH8 A;  4AYB G;  3F8T A;  1WCM H;  2IPK D;  2Q2T A;  4NDX A;  3S2H B;  2UXD Q;  2V4D A;  1S5B D;  4GN5 A;  1VQJ A;  3ULJ A;  1FNW A;  4LW1 A;  2WB1 G;  2R3Z A;  1RKN A;  3G6E A;  2I07 B;  5EQ0 A;  1L1O B;  5J22 A;  4A4I A;  2Z1C A;  3M3Y B;  1K9M C;  3GV3 A;  2ZJR A;  2EYP A;  3I73 A;  1CUK A;  4RMF A;  2JA9 A;  2B2T C;  2K75 A;  4R9W A;  4QUC A;  3D3R A;  2HT1 A;  3RN5 A;  2E2J B;  3PF4 A;  4LF9 L;  1HR0 W;  3CMA A;  1N34 Q;  1B2T A;  5ELO A;  1I3Q H;  1V1Q A;  2CQO A;  4DV2 Q;  3TP7 A;  1YZ6 A;  4ZQ3 A;  2R92 H;  4JG2 A;  3K7U C;  1T5E A;  5JEA J;  1OTC A;  4JI7 Q;  1CTM A;  3CME A;  1IW7 D;  3CRK C;  5CMD A;  4RG1 A;  1YJW A;  4N8X 1;  3K6O A;  2IW3 A;  2BA0 A;  5I2X A;  2JA5 H;  1Q46 A;  1XNQ L;  3T56 B;  4XXE A;  1LTS D;  3U58 A;  1TQO A;  1K73 C;  4NXN Q;  5C3E G;  1P16 A;  3TP6 A;  3PIP A;  4PZ7 A;  1L1O A;  3F1Z A;  4DA2 A;  3PV0 A;  3K5O A;  4A3M B;  3H09 A;  4AYB B;  1XMQ L;  2OF1 A;  4BA2 I;  4DXF A;  3T1H L;  1TWC H;  1CKN A;  2IWH A;  4DU9 A;  5C4X G;  4C3H G;  4P72 A;  1EUJ A;  2ENB A;  1V1O A;  1ZXT A;  2R7Z H;  4KKS A;  1IBM Q;  5C3E B;  3NEM A;  4JCV E;  1L2F A;  1AZP A;  2JN4 A;  3O13 A;  2A69 D;  4OEL B;  1M1K C;  1LTI D;  4EGV A;  5JEA G;  5JJI A;  4Q5V A;  4JBK A;  3NEL A;  1ASY A;  1MBY A;  1SJH D;  3PO2 H;  5K36 H;  5FO8 B;  4ZKB B;  2R7D A;  3SK8 A;  2B2V A;  1H9J A;  2PQA A;  2PQE A;  4Q0F A;  4X62 Q;  3RUZ A;  1XXG A;  2VUM G;  2RDG A;  1HUM A;  2CCZ A;  1FL0 A;  1O80 A;  4K5V A;  3BVM A;  2DUD A;  3CQZ B;  3S1Q H;  1GD7 A;  2UXD L;  2FHT A;  1KIX A;  1ENA A;  3PIP 3;  2B2Y C;  1I4P A;  4DNR B;  3FHW A;  5C5L A;  1QB5 D;  1JE5 A;  1AP0 A;  2KEE A;  1VCI A;  1BO0 A;  3IL8 A;  3ND8 A;  5M5W B;  5J1Z A;  5HUR A;  1WTV A;  5M3M G;  3TSS A;  1HJP A;  1PFB A;  1GUS A;  3HOU G;  1HXY D;  1SMY D;  2I5M X;  3PGZ A;  4POF A;  1STE A;  1VQF A;  4KD4 A;  1W6K A;  3J80 c;  3GTJ B;  5E4W C;  3S14 H;  4DUY L;  3OIP A;  1VQ4 A;  1A15 A;  4IUV A;  4A3K G;  1L0X B;  1VQI A;  5M3M H;  1BQQ T;  1L0Y B;  2FMC A;  4OWT B;  2Z4H A;  1IBL L;  1F9P A;  1R9T H;  1EEI D;  2YV5 A;  4R4O A;  4FF4 A;  2BCO A;  2GA4 B;  2I0Q A;  4IFD G;  1O7I A;  2X6L A;  4RKB A;  2WKD A;  2F0H A;  4R8I A;  1ASZ A;  4OX9 Q;  1SAP A;  2NZO A;  1B9N A;  1BBW A;  1VQ8 A;  3NTH A;  4XYQ A;  2XIW A;  5I9O A;  2EZV A;  1YHA A;  2KEN A;  1SNC A;  4AQY L;  3OPO A;  2F0M A;  1LAB A;  1LTG D;  1XWE A;  3A55 A;  3CW2 C;  1EEF D;  1FGU A;  1RJT A;  4CJ2 C;  4JVZ A;  2FMM A;  1FNU A;  1I4G A;  1M8A A;  1O7Z A;  1EY8 A;  3KYH C;  1K0S A;  1EFI D;  2PI2 E;  5JVH 3;  3E0J A;  4K8I A;  4O2D A;  4HJ7 A;  1N36 L;  1TWH H;  4NXN L;  2KCT A;  4BY7 H;  1TWG B;  4ODG A;  4NXM Q;  1KL9 A;  1Y8O B;  1A6X A;  4OL7 A;  5C4X H;  4DAM A;  4H44 C;  1ZKO A;  5AJ3 Q;  1QVG A;  1HZB A;  1SJE D;  5IGF A;  4DR4 L;  3T1H Q;  4ILW A;  1K0R A;  5C5M A;  4CJ1 B;  3Q0A A;  1UEA B;  2L15 A;  3KDF A;  4PMB A;  4B3R L;  2BE5 C;  1CKO A;  4ME3 A;  2EY5 A;  1PXU A;  2JA5 G;  2D2C C;  5CV7 A;  4KD3 A;  1SBB B;  2L12 A;  3TQY A;  1HQM C;  4BBR B;  1ESF A;  2KHJ A;  3WDN A;  4QL5 A;  2WAQ G;  3FEW X;  4JI2 Q;  2GVB A;  4N8F A;  4OHJ A;  3GD7 A;  2MO1 A;  5LL6 X;  3F2C A;  4B3M L;  2VQE L;  3HP3 A;  3MFY A;  5KYI A;  3OOC A;  4DFA A;  3J7A V;  1CZG A;  3MZ5 A;  1SN8 A;  3QOJ A;  2E5L L;  3HOX B;  3F2U A;  4X64 L;  3L3O C;  4WJW A;  1UWV A;  4GS3 A;  1BCP C;  1W6J A;  3HOY G;  1PH9 A;  3HOX G;  2NVY B;  2EJM A;  3EIV A;  4FO2 A;  4DR2 Q;  3SE0 A;  1UE5 A;  1B53 A;  5LHY 1;  3M4O H;  1PZK D;  5G3L D;  4XQN A;  2F4V L;  3SVM A;  2MGS A;  2CW0 D;  2UUB L;  5C4J B;  4GZY C;  1Y1W G;  1GHK A;  1K83 H;  1EYC A;  5E3F A;  5M3F B;  1LYL A;  4DV1 L;  1HNX Q;  3SHL A;  2E8G A;  2QCP X;  4X3K A;  4E6I A;  1AE3 A;  3I4M B;  4HSV A;  1KLU D;  3FPU B;  1DXM A;  4BXX H;  2F0I A;  1LT5 D;  1HA6 A;  3OSO A;  3V05 A;  4A3B H;  3CCL A;  3RZO B;  4R4T A;  2L5T A;  4LFC Q;  3OWF A;  4YWK A;  3AYH B;  3DM1 A;  2HDM A;  3AEV A;  2EOT A;  4CDC C;  5LL6 S;  3NXW A;  5GAH C;  5EJW A;  4MNO A;  1PH4 A;  3VR4 A;  1B4O A;  3I4N G;  2EYH A;  2Q2I A;  4R4Q A;  1PH7 A;  1OXS C;  3M7N A;  1UUP A;  2LFN A;  2VUM B;  1GO3 E;  4DR3 Q;  1PVO A;  3MAQ A;  3C3L A;  3JC6 6;  2ZXO A;  3HOZ H;  1K83 B;  3CF5 A;  1KC8 C;  5GAE C;  2JXM B;  5FLM G;  2EXD A;  2EJG C;  2KCN A;  2A69 C;  2I5L X;  1CT1 D;  1E2V A;  3FDT A;  1E7Z A;  5LMN W;  2A73 B;  4LF9 Q;  1A2U A;  3MXN A;  1LT3 D;  2LXK A;  5F2D A;  4I7A A;  1Q3L A;  4DR5 L;  4A93 G;  3S24 A;  1PA6 A;  4KHP L;  2G9H D;  1N9W A;  4UP8 A;  2JEA I;  1E3P A;  4JI7 L;  2PQA B;  3VR6 A;  4X66 Q;  3AMU A;  3CRL C;  3P1H A;  2KEC A;  4FF2 A;  3T1Y Q;  4NMZ A;  4RGO S;  1SYF A;  2K14 A;  4A3M G;  1I6V C;  2VS1 A;  5FO9 B;  4IUN A;  1WFQ A;  1A62 A;  3FKI G;  1VQH A;  1WTH A;  3K5N A;  1VF7 A;  2VXW A;  4LFC L;  5DEH A;  2XRQ D;  4A3L G;  4ZLT F;  2JYO A;  1IBL Q;  2YU9 H;  3W5O A;  4K8J A;  1B1Z A;  3L9A X;  4JOI C;  2E2I H;  2E2H H;  1M90 C;  4GLX A;  4O0A A;  2PNR C;  4EX5 A;  1STN A;  2F0J A;  4C3J G;  1CSP A;  2R93 H;  1RHP A;  3H91 A;  2QGQ A;  1WTR A;  1YNX A;  3CC2 A;  2M2L A;  4ZCK A;  4IFD J;  2WKC A;  4K5W A;  5IYB G;  5COY A;  1X9N A;  4IUR A;  5NUC A;  3BZC A;  3K7A B;  2C35 B;  3H6M A;  1Y1V B;  1JJ2 A;  2BOS A;  2MNA A;  2UUA Q;  3HOZ B;  2NBF A;  5FKA C;  3CCU A;  3GTK H;  1PRT B;  2YYZ A;  3CCR A;  1FJG Q;  4UAI A;  3JAM E;  1X6O A;  4DGZ A;  4C3I G;  3MXU A;  2XRS D;  2YTY A;  5HGT A;  2WB1 B;  2JA8 B;  1EL0 A;  4DR5 Q;  4H0L C;  3PUV A;  1HNW L;  2NWG A;  2A8V A;  4A3J H;  3W1G A;  3UDX A;  3I55 A;  3K58 A;  1EFW A;  3S9W A;  1MJC A;  3I3C A;  1KD1 C;  1VQ9 A;  5IYC H;  3D6C A;  4JI8 Q;  3J7A 5;  1HZA A;  2JP1 A;  3HOW G;  3NK9 A;  1P8L A;  3A54 A;  4DR4 Q;  1KAB A;  1LTL A;  1SNM A;  1I4H A;  2CW0 C;  3QWN A;  3GTM B;  1X54 A;  2B3G A;  5JPM C;  3DEO A;  1STB A;  4KK7 A;  1XTC D;  1DYQ A;  1ET6 A;  1C48 A;  1PRT C;  1KDA A;  4LUO A;  4HJ5 A;  1XPO A;  1WCM G;  5IP9 H;  1Y69 U;  4DK3 C;  2AUK A;  4NW2 A;  1JR0 D;  3T13 A;  1U4R A;  4LUZ A;  2MFI A;  3S1N H;  2H1E A;  4PZ6 A;  2ZJP A;  5JVG 3;  1TS5 A;  4AQY Q;  4KMU C;  2WIN B;  2YU9 B;  4NXM L;  4IOA A;  2BDN A;  2NVX B;  4DK6 C;  4YWM A;  5EKI A;  5IGE A;  2VQF Q;  3MEF A;  1NMF A;  4JI4 L;  2R6G A;  2EY2 A;  2AQ2 B;  1B50 A;  3W1B A;  2OCE A;  5JOB A;  1STG A;  4HAE A;  1Y1V H;  1PH3 A;  2DY8 A;  3S16 H;  4CBV A;  4L5S A;  4R8N A;  1PFN A;  1YNJ C;  1G29 1;  3HKS A;  1X56 A;  4JI3 L;  3E0E A;  1F2Y A;  3PMF A;  1VQP A;  3R2I A;  4HSP A;  4FXD A;  4B9W A;  1D1I A;  3NSW A;  1LV9 A;  2XSC A;  3TEH B;  3TP8 A;  3BDL A;  2R61 A;  1K3B C;  3RZO H;  1SE2 A;  2PZW A;  5JJK A;  2QDL A;  1TWA H;  3CP0 A;  4IO9 A;  1Q82 C;  3M7G A;  5IYC G;  2F1M A;  1TWA B;  1NMG A;  1HNZ L;  2FFK B;  1CA5 A;  1X3Q A;  2A68 D;  2LXJ A;  3CCV A;  3KOJ A;  2XN9 C;  1SFO B;  1Q1E A;  4HMI A;  5JAV A;  1L0W A;  2Q8I B;  2JA6 G;  1IBK L;  4C3I H;  3DWA A;  3NTK A;  2BE5 D;  1GUW A;  1H9M A;  2IY5 B;  1HNW Q;  5K5P A;  3S15 B;  2QF7 A;  2UU9 Q;  1N8R C;  2WII B;  3GTO H;  4RGM A;  1G6Z A;  4HJ9 A;  1HCZ A;  4ZK9 B;  2Q2U A;  1DCZ A;  2WB1 E;  1KRT A;  3GTO B;  2GVA A;  3QOL A;  3G71 A;  1IBK Q;  1EU4 A;  2IX3 A;  1NE3 A;  3S15 H;  3CC7 A;  1K8G A;  3M4Y A;  1JQY D;  3MTS A;  1HFN A;  3TN2 A;  1D8L A;  5EGT A;  3TZD A;  5DM6 3;  4DV0 Q;  3EBE A;  1B3A A;  1PRT F;  3KLS A;  2EE1 A;  1N33 Q;  3HOY B;  5T1I A;  3LX0 A;  1SMX A;  4XT3 B;  2HIV A;  2F0O A;  4JI5 Q;  4PV1 C;  2F52 A;  2KBN A;  3KLS X;  1DJR D;  1DZ1 A;  3A8I E;  1DOL A;  5JJZ A;  3BYT B;  1YBY A;  4KV6 A;  1E0B A;  3S1R H;  3MXG A;  5IT9 c;  1G2T A;  4JI4 Q;  2JA6 H;  4A3B B;  2A19 A;  4C1N K;  1HRJ A;  5EPL A;  3R3O A;  3HOW H;  2SEB D;  4YCW A;  1MD2 D;  5TSS A;  2Z6B A;  1PZJ D;  1AN8 A;  3T16 A;  2G5D A;  1XNR L;  1AE2 A;  3TP5 A;  1D6E C;  3J80 E;  3S1N B;  4UP7 A;  3I56 A;  3I91 A;  4A3J G;  2AKW B;  4L8J A;  3H0G B;  1NR2 A;  1TKW B;  3MHB A;  1A2T A;  1TY2 A;  2JK8 A;  2RHQ B;  1XPU A;  1XTD A;  3HOZ G;  1VQC A;  1ILP A;  5IP7 H;  4C2M H;  3L7Z C;  3A5Z B;  1WJJ A;  4IUQ A;  2AUJ D;  3GTM H;  2ID0 A;  1AH9 A;  3DWQ A;  4K0K Q;  1TS4 A;  1SE3 A;  5J39 A;  2O5J C;  3K8A A;  2E76 C;  4LWC A;  1J9O A;  3W3A A;  2NN6 H;  3SXH A;  4YCV A;  1QUQ B;  1SSO A;  4B3S Q;  4G4K A;  2E74 C;  2XWJ B;  5FJ8 H;  1BBU A;  3E5S A;  1GVP A;  3UDF A;  4PNY A;  1UE1 A;  4XTC S;  4WFN 3;  2AWO A;  1FR3 A;  4FP5 D;  4JV5 Q;  3SR1 A;  4GN4 B;  2OT2 A;  4BXX G;  3B6Y A;  1EY4 A;  2BH8 A;  4DAP A;  4ALP A;  2UU9 L;  1BUV T;  2K5Q A;  2DGY A;  3CAM A;  4M1U B;  1XJV A;  1YNN D;  1IHZ A;  2SNM A;  2NVQ H;  1KXL A;  2OEO A;  4EQN A;  3P75 A;  1J8I A;  2HDL A;  5M3F H;  1XX8 A;  2RSO A;  4J15 A;  2MPM A;  3CU7 A;  1WTO A;  2VB3 X;  3KLW A;  1JWM D;  2D9U A;  4IUP A;  3H3V I;  5BR8 Q;  3P7J A;  4DPG A;  4RAU C;  2K04 A;  4A93 B;  1PH2 A;  5KEE A;  1JB3 A;  1QG7 A;  1Z47 A;  2X6G A;  4DXG A;  4P73 A;  3OWE B;  3A0J A;  1OXX K;  4EVO A;  2I5H A;  1QNK A;  3PIO 3;  3IAY A;  5CC4 A;  3HOY H;  2NVY H;  2QEX A;  4YHH L;  2FXQ A;  1VQ7 A;  1IYU A;  4DR7 Q;  2F0P A;  1QWY A;  5FLM H;  5IWA L;  1KLG D;  2K03 A;  2Q2H A;  4C3I B;  1PH6 A;  4JI0 Q;  5COR A;  1H9S A;  5A2Q E;  2J7Z A;  4X64 Q;  2KED A;  3FRP B;  1RTN A;  3TME A;  1WD1 A;  1UE7 A;  2EJF C;  4B3T Q;  2UXC L;  1CK1 A;  1E2W A;  1ICW A;  3KLR A;  4HJA A;  4ULL A;  2MUY A;  4A3E H;  4OO1 H;  2BA1 A;  1EWH A;  1SMY C;  3BJU A;  4NP5 A;  3VR2 A;  3FVQ A;  1VQA A;  3E9I A;  3DWP A;  1TR5 A;  3AFQ A;  4KTA A;  4A3L H;  4A3B G;  3D6W A;  5DNF A;  1H9S B;  2E2I B;  1VQM A;  3MC0 B;  3BG3 A;  4FVM A;  2NUC A;  4K0K L;  3J81 c;  1ZYR D;  4KY5 A;  5IP9 G;  1VQ5 A;  4OX9 L;  4FF1 A;  2KCC A;  1QZH A;  2NTS A;  3H0G H;  4A3E B;  1Y1W H;  4X3T A;  2JA7 G;  2O2L D;  3S2H H;  2PYK A;  3UE1 A;  4C3H B;  4HCS A;  1LT4 D;  4KJN A;  2K6A A;  2R92 B;  4X65 L;  1U4P A;  4IJL A;  2J0T D;  2NVX H;  3PO3 G;  2VY3 A;  5KRU A;  1KDC A;  1T5X D;  3RZD H;  3HKZ B;  3R93 A;  2JE6 I;  3HOW B;  4N9P A;  2LS0 1;  2F4I A;  4LFA Q;  1CQV A;  4GNX C;  3TBI B;  4J8Q A;  4X3U A;  5T1G A;  4ABN A;  3PUZ A;  3HOX H;  1HNX L;  4GKK Q;  3OIQ A;  4DUY Q;  4DAY A;  3H3V H;  3ULL A;  1ESR A;  1R4Q B;  3QIA A;  1PTO D;  4S3S A;  4DV3 Q;  3OTO L;  4DN4 M;  2EVB A;  4A3G G;  4A75 A;  1I4X A;  2R93 B;  2Z8L A;  3G7L A;  3NBH A;  2K33 A;  5M5W H;  1SEB D;  2NYZ D;  2VW9 A;  1IZ6 A;  2LMC B;  2D0P A;  4B3T L;  1QUQ A;  1I6H H;  2UXB L;  1IYV A;  2CHB D;  2HCC A;  2HIX A;  1PZI D;  2MJ8 A;  1YHB A;  1FJG L;  3M4O B;  2WP8 J;  3OMG A;  4UPA A;  3TS0 A;  2RCF A;  1LUZ A;  2VL6 A;  1HZ9 A;  2BH2 A;  1MIU A;  2Z9H A;  1S3O A;  1PFS A;  3I4M G;  1X65 A;  3FKI H;  1G2S A;  4BY7 G;  1U4L A;  3UI2 A;  5JPN C;  1Q8I A;  1JWU D;  4BA1 I; 
#chains in the Genus database with same CATH homology
 4GNX B;  1SFO H;  4LF5 L;  1VQE A;  4AYB E;  4JOI C;  5C0X G;  1PV4 A;  3H15 A;  2E2I H;  2E2H H;  3KF6 A;  1GKH A;  1X3G A;  3CPW A;  1M90 C;  1U5K A;  3HOZ G;  2K5V A;  3TRE A;  4DV6 Q;  4GLX A;  4O0A A;  3PCO B;  1CSQ A;  4BY1 G;  1I5F A;  4EX5 A;  3IRB A;  4GLV B;  1SLJ A;  3G4S A;  3GTG H;  2R93 H;  1CSP A;  4JI0 L;  5IYB H;  2JA8 G;  1B70 B;  2QGQ A;  4POG A;  1VQB A;  1YNX A;  3CC2 A;  4A93 H;  1YEZ A;  2A1A A;  3PIO A;  4DV4 Q;  1VQL A;  4IFD J;  3TS2 A;  3DM3 A;  4DAY B;  5IYB G;  3ERS X;  1X9N A;  4C3J H;  2R93 G;  3BZC A;  2C35 B;  3PSI A;  3RLN A;  1PYS B;  1N34 L;  3U4V A;  3U4Z A;  1JJ2 A;  3UDG A;  2MNA A;  5LMU Q;  2UUA Q;  4BY1 H;  5C44 G;  3CCU A;  3OTO Q;  4B3S L;  4X65 Q;  3GTK H;  4A3C H;  4OO1 I;  2YYZ A;  1JJG A;  1EYG A;  3CCR A;  1FJG Q;  1T9H A;  4EQ5 A;  1XMQ Q;  1OXU A;  1X6O A;  3H0G G;  4DV7 L;  2YTY A;  2CWP A;  4DR5 Q;  3K80 C;  4Y7N H;  3PUV A;  1HNW L;  5EAY A;  2A8V A;  4A3J H;  4YCU A;  3W1G A;  4QGU A;  2VQE Q;  4GOP B;  3UDX A;  4C3H H;  1Z9F A;  3I55 A;  1RIP A;  1EFW A;  4LFB L;  4QY7 A;  1TWG H;  1MJC A;  1XNQ Q;  1PH5 A;  2D62 A;  3E9H A;  1PH8 A;  4AYB G;  1KD1 C;  3F8T A;  1VQ9 A;  5C0X I;  4LNQ A;  2NVT H;  5IYC H;  3HKZ E;  1WCM H;  4JI8 Q;  5GAD C;  3CXC A;  4LF5 Q;  3J7A 5;  1HZA A;  4A3K H;  3HOW G;  1XPR A;  2N8N A;  2UXD Q;  2Q2T A;  1P8L A;  4DR4 Q;  5H1S E;  4A3M H;  1LTL A;  4JI1 L;  1NJI C;  4GN5 A;  1VQJ A;  3ULJ A;  4IOC A;  1X54 A;  2B3G A;  2N3S A;  2PNH A;  3NBH B;  5DLQ E;  2IHF A;  1BVS A;  4JI6 L;  2B63 G;  4QIW E;  4HJ5 A;  4LW1 A;  4LUO A;  4LUV A;  2WB1 G;  1WCM G;  4A3E G;  5IP9 H;  1XPO A;  4DK3 C;  1S40 A;  4X6A H;  3G6E A;  4LUZ A;  1L1O B;  4DR3 L;  2MFI A;  4A4I A;  1WYD A;  1I94 L;  3S1N H;  4PZ6 A;  1EIY B;  2ZJP A;  1EQQ A;  4JBJ A;  1K9M C;  2ZJR A;  4AQY Q;  3M4Q A;  3I4O A;  4IOA A;  4NXM L;  1CUK A;  2D0O A;  4RMF A;  2JA9 A;  2K75 A;  4DK6 C;  4YWM A;  3DLL A;  2VQF Q;  1HR0 Q;  2HT1 A;  3MEF A;  1NMF A;  3RN5 A;  4JI4 L;  2R6G A;  3PF4 A;  3S1M H;  4LF9 L;  1HR0 W;  3CMA A;  1N34 Q;  5ELO A;  4GNX A;  1I3Q H;  3W1B A;  1V1Q A;  2CQO A;  2OCE A;  3M85 A;  1JMC A;  4DV2 Q;  3MXN B;  1Y1V H;  1YZ6 A;  3CCQ A;  4DR2 L;  1YIJ A;  1PH3 A;  3K7A H;  2KCM A;  2R92 H;  3S16 H;  4JG2 A;  2VUM H;  1UE6 A;  3HOV H;  4DUZ Q;  3K7U C;  5JEA J;  3LGJ A;  1OTC A;  4JI7 Q;  4L5S A;  3CME A;  2JA8 H;  1Q1B A;  2Y0S G;  4DUZ L;  1G29 1;  2N78 A;  3KDF B;  3HKS A;  4GOP A;  1H95 A;  4R4C A;  4RG1 A;  1YJW A;  1X56 A;  2N49 A;  4JI3 L;  3EN2 A;  4MTN A;  3E0E A;  1XNQ L;  2BA0 A;  2JA5 H;  1Q46 A;  2B63 H;  1VQP A;  1I94 Q;  3U58 A;  1B8A A;  3CCE A;  1K73 C;  4NXN Q;  5C3E G;  1P16 A;  1PYB A;  3TEH B;  3WWV A;  4B3M Q;  4BBS H;  5C4J H;  3RR5 A;  3PIP A;  4PZ7 A;  1L1O A;  3F1Z A;  3F2B A;  1QVC A;  3RZO H;  3PV0 A;  4DR7 L;  2JEB I;  5JJK A;  4UP9 A;  1HH2 P;  1TWA H;  3CP0 A;  1XMQ L;  4IO9 A;  4DV0 L;  5IYC G;  3T1Y L;  1Q82 C;  4BA2 I;  3T1H L;  3KFU A;  1TWC H;  1NMG A;  1CKN A;  4H02 A;  3G48 A;  1HNZ L;  4GLA C;  5C4X G;  1KRS A;  1WI5 A;  3RLO A;  5IYD H;  3GTP H;  4P72 A;  2LXJ A;  3CCV A;  1HR0 L;  4DKA C;  3CPF A;  1EUJ A;  3KOJ A;  1C0A A;  1Q1E A;  2B29 A;  1X55 A;  2R7Z H;  4QQB X;  1L0W A;  3CCJ A;  2JA6 G;  1IBK L;  1IBM Q;  4C3I H;  3NEM A;  4JCV E;  1L2F A;  2HHH L;  5HGQ A;  2WFW A;  4X62 L;  3KF6 B;  1Q86 C;  2H5X A;  2IY5 B;  3GO5 A;  1HNW Q;  3GTQ H;  2ZTC A;  1M1K C;  1IBM L;  1QZG A;  5JEA G;  5JJI A;  2UU9 Q;  1N8R C;  3GTO H;  5LMN L;  4JBK A;  4HJ9 A;  4LF6 L;  3NEL A;  1ASY A;  2Q2U A;  2WB1 E;  1KRT A;  3STB C;  3PO2 H;  2GVA A;  1NTG A;  3G71 A;  1IBK Q;  4GKJ Q;  4KHZ A;  2MO0 A;  2R7D A;  2AHO B;  2PQA A;  4X62 Q;  2Z0S A;  1NE3 A;  4OWW B;  2VUM G;  5GRO A;  3M4P A;  2CCZ A;  3HOV G;  3CC7 A;  3CC4 A;  3S15 H;  1FL0 A;  1K8G A;  4A3I H;  4P71 A;  2DUD A;  4JBW A;  4JI5 L;  1TWF H;  3SGI A;  3S1Q H;  1GD7 A;  3NEN A;  4A76 A;  2OQK A;  2UXD L;  3HKZ G;  4DV5 Q;  1KIX A;  4QJF A;  4A3I G;  1D8L A;  4DV0 Q;  2OTJ A;  2UUA L;  3EBE A;  4LF4 L;  1VS0 A;  1K8A C;  3FHW A;  2IX1 A;  3S2D H;  4HJ8 A;  1VQG A;  1N33 Q;  1JE5 A;  3UE0 A;  1SMX A;  1VCI A;  4PG3 A;  3PO2 G;  2HIV A;  5M3M G;  4DR6 Q;  4JI5 Q;  1J6Q A;  1HJP A;  4MZ9 A;  1EWI A;  2F52 A;  2KBN A;  5FLX c;  4JBM A;  2Y0S E;  3PO3 H;  1L1O C;  3J7Z C;  4LFA L;  3I7F A;  1VQN A;  3HOU G;  1YBY A;  4JC0 A;  4DV4 L;  2I5M X;  1VQD A;  3PGZ A;  4POF A;  3S1R H;  1VQF A;  2ZJQ A;  5IT9 c;  3J80 c;  4NPS A;  2JA7 H;  3S14 H;  2UUC Q;  4DUY L;  4JI4 Q;  2IT1 A;  1VQ4 A;  2JA6 H;  5C0X J;  5M3F G;  2JJQ A;  3BZK A;  2A19 A;  4IPD A;  4UY8 C;  2OWO A;  2ALY B;  4A3K G;  3HOW H;  4YY3 Q;  4YCW A;  1X3F A;  1VQI A;  5M3M H;  3A74 A;  2K52 A;  3I4M H;  1X3E A;  1XNR L;  3I2Z A;  1AE2 A;  4KLK A;  4OWT B;  4APV A;  2F4V Q;  2LSS A;  1TXY A;  1CKN B;  1IBL L;  1R9T H;  4HIO A;  2YV5 A;  4R4O A;  4UP7 A;  3I56 A;  1E24 A;  4A3J G;  2AKW B;  1EOV A;  4R1J A;  2I0Q A;  3CD6 A;  2K5N A;  3L0O A;  4IFD G;  1O7I A;  4DR1 Q;  1WOC A;  1A8V A;  2JK8 A;  1V43 A;  2EIF A;  1IXR A;  2RHQ B;  2KHI A;  1XTD A;  1XPU A;  1VQC A;  4LF8 Q;  4BBR H;  5IP7 H;  1OXT A;  1ASZ A;  4C2M H;  2ES2 A;  3L7Z C;  4OX9 Q;  3A5Z B;  2NZO A;  1WJJ A;  3HFZ B;  4NB3 A;  3GTM H;  2ID0 A;  1AH9 A;  3J80 i;  3M3Y H;  1BBW A;  4IPH A;  1VQ8 A;  4K0K Q;  1E1O A;  1YHA A;  2KEN A;  1W2B A;  3K8A A;  4AQY L;  1SR3 A;  1XMO L;  4LWC A;  3ZJY C;  4DV1 Q;  1OXV A;  2XGT A;  4YCV A;  1QUQ B;  3A5U A;  3CW2 C;  4B3S Q;  1FGU A;  4LF6 Q;  4KI0 A;  3GDE A;  4A3D H;  2RF4 A;  1FVI A;  3ER0 A;  1VQO A;  3CCS A;  5FJ8 H;  1BBU A;  4DV3 L;  1GVP A;  3AFP A;  3UDF A;  2RHS B;  4XTC S;  1Q8K A;  1UE1 A;  2AWO A;  1YHQ A;  3KYH C;  4JV5 Q;  3GTL H;  2PI2 E;  4O2D A;  2EQS A;  4PMW A;  1HNZ Q;  4GN4 B;  1XMO Q;  4HJ7 A;  1N36 L;  1TWH H;  4NXN L;  2E5L Q;  3Q8D A;  1IYJ B;  2KCT A;  2PMZ E;  1Q7Y C;  1J5E Q;  4BXX G;  4BY7 H;  4B3R Q;  3B6Y A;  4NXM Q;  1KL9 A;  2BH8 A;  4DV6 L;  4ALP A;  5C4X H;  4P75 A;  3KJO A;  2UU9 L;  4DAM A;  3L2P A;  5K36 G;  5E7N A;  2DGY A;  3CAM A;  1IL2 A;  5AJ3 Q;  1DGS A;  1XJV A;  1HZB A;  1QVG A;  1V9P A;  4XIG S;  3I4N H;  3K0X A;  4DR4 L;  3T1H Q;  4JV5 L;  1K0R A;  3RN2 A;  2NVQ H;  1KXL A;  2HQL A;  4R4I A;  2L15 A;  3KDF A;  5M3F H;  4J15 A;  4JI6 Q;  3S17 H;  1EQR A;  5BR8 L;  5JJL A;  3RLF A;  4B3R L;  1CKO A;  4ME3 A;  3KLW A;  1BKB A;  2F3I A;  4IFD I;  2JA5 G;  1QVF A;  5BR8 Q;  5AJ3 L;  3H3V I;  4DPG A;  1SE8 A;  3J81 j;  3HOU H;  1HZC A;  1PH2 A;  4KHP Q;  4OON A;  2VNU D;  4JI8 L;  3TQY A;  4DV7 Q;  3D31 A;  4DV2 L;  1A0I A;  2KHJ A;  2R7F A;  5IYD G;  1Z47 A;  2K5H A;  4QL5 A;  4DR1 L;  4DR6 L;  4P73 A;  2WAQ G;  5HY6 A;  4JI2 Q;  3STB D;  1N32 L;  2GVB A;  3A0J A;  2YTV A;  1OXX K;  2I5H A;  2MO1 A;  3GD7 A;  4JI1 Q;  3F2C A;  3K81 C;  5LMU L;  4B3M L;  3HOY H;  4FDB A;  2VQE L;  2VZA A;  4DV5 L;  4WJ3 M;  2NVY H;  2QEX A;  1XNR Q;  2RCN A;  2IHE A;  1MKH A;  2FXQ A;  5M5X H;  4YHH L;  1VQ7 A;  4DR7 Q;  3RNU A;  4P74 A;  4LF7 Q;  1SN8 A;  5FLM H;  4TVA B;  1N36 Q;  2E5L L;  4BBS G;  5IWA L;  3OW2 A;  4X64 L;  4JI0 Q;  2Q2H A;  5C3E H;  4HID A;  1PH6 A;  4TQU S;  5FJ8 G;  1YJ9 A;  2K4K A;  4LFB Q;  5J3B A;  5GAG C;  2ZM6 Q;  1UWV A;  4GS3 A;  3HOY G;  4X64 Q;  2XTI A;  1PH9 A;  4GN3 B;  4IPG A;  3HOX G;  1UE7 A;  3EIV A;  4DR2 Q;  1G6P A;  3PUW A;  4LF4 Q;  2K50 A;  4YHH Q;  2Z6K A;  2YTX A;  4B3T Q;  2E2J H;  2UXC L;  1UE5 A;  4HIK A;  4A3F G;  1E1T A;  3M4O H;  4HJA A;  3ULP A;  2Z6K C;  4A3E H;  2R92 G;  2F4V L;  2BA1 A;  2CWA A;  1Y14 B;  2UUB L;  3BJU A;  2AWN A;  2CFM A;  1PHJ A;  4L5R C;  4BBR G;  4IJH A;  1C7Y A;  4WJ4 A;  2ATW A;  1Y1W G;  1VQA A;  3E9I A;  2GN5 A;  4AH6 A;  1K83 H;  3AFQ A;  4LF8 L;  4A3L H;  3JAM i;  2R7Z G;  4A3B G;  1LYL A;  1CKM A;  3UDI A;  4DV1 L;  1HNX Q;  1VQM A;  2E8G A;  3KF8 B;  3PF5 A;  4GOP C;  2OTL A;  1AE3 A;  4K0K L;  5IY0 A;  2UUB Q;  1A63 A;  4BXX H;  3J81 c;  3BU2 A;  2HHH Q;  2JQO A;  2ZTD A;  1VQ5 A;  5IP9 G;  4OX9 L;  5IWA Q;  4A3B H;  1QZH A;  3CCL A;  4R4T A;  3H0G H;  2UXC Q;  1NBW A;  4LFC Q;  1Y1W H;  4JYA L;  2JA7 G;  4L5Q A;  1MJE A;  2QA4 A;  1JB7 A;  1N33 L;  3S2H H;  1VQ6 A;  4A3C G;  3UE1 A;  1J5E L;  2NZH A;  3W5O A;  4YWK A;  4X65 L;  3ICE A;  3AYH B;  2UXB Q;  4IJL A;  3AEV A;  2ASB A;  2NVX H;  5GQO A;  3PO3 G;  2VY3 A;  4A3D G;  5GAH C;  2PI2 A;  3RZD H;  4MNO A;  1PH4 A;  2JE6 I;  4AIM A;  2AMC B;  1PH1 A;  1VQK A;  1W3S A;  4LFA Q;  4GNX C;  4A3F H;  3OYY A;  1B7Y B;  2Q2I A;  3I4N G;  4PZ8 A;  1EIF A;  4R4Q A;  1PH7 A;  1OXS C;  3PUX A;  3M7N A;  1YJN A;  4OXP A;  1E22 A;  3PUZ A;  3HOX H;  5IE8 A;  1HNX L;  2NN6 I;  4GKK Q;  1GO3 E;  4DR3 Q;  4DUY Q;  1RL2 A;  1PVO A;  3AQQ A;  4OWX B;  1Y1V G;  3H3V H;  1YVC A;  1N32 Q;  3M9B A;  3JC6 6;  3ULL A;  4JI3 Q;  3HOZ H;  4YY3 L;  3CF5 A;  1KC8 C;  5LMN Q;  5GAE C;  1UEB A;  3CQZ H;  5FLM G;  2EXD A;  4OO1 G;  2I5L X;  4DV3 Q;  1JT8 A;  5C44 H;  2OQ0 A;  1KHI A;  1E7Z A;  4L5T A;  4DNI A;  3OTO L;  5LMN W;  4GKJ L;  1I50 H;  1KAW A;  4LF9 Q;  4A3G G;  4JI2 L;  1Q12 A;  2LXK A;  4A75 A;  4GKK L;  3KJP A;  3CCM A;  1Q81 C;  1KQS A;  4Y52 H;  2NN6 G;  4DR5 L;  4A93 G;  3S24 A;  1PA6 A;  1D7Q A;  4KHP L;  2ZTE A;  5M5W H;  1N9W A;  4YWL A;  3U50 C;  1S72 A;  4X66 L;  2VW9 A;  1YIT A;  1IZ6 A;  4UP8 A;  1E3P A;  2JEA I;  2MQH A;  4JI7 L;  3FP9 A;  2D0P A;  2PQA B;  4B3T L;  1QUQ A;  4X66 Q;  1I6H H;  2UXB L;  1LM0 A;  3JAM c;  1JJC B;  3T1Y Q;  2HIX A;  5IP7 G;  1SRO A;  1U0L A;  2K14 A;  4A3M G;  1GM5 A;  1YHB A;  5M5Y H;  2VS1 A;  1YI2 A;  1FJG L;  2WP8 J;  3D0F A;  4UPA A;  1WFQ A;  2UUC L;  3TRZ A;  1A62 A;  3TS0 A;  1LUZ A;  2VL6 A;  3FKI G;  1HZ9 A;  1VQH A;  3J81 i;  2V1C C;  2VQF L;  1SRU A;  1NY4 A;  2BH2 A;  1MIU A;  4IPC A;  3VDY A;  3GTJ H;  1S3O A;  1PFS A;  4LFC L;  3I4M G;  1X65 A;  3FKI H;  4LF7 L;  4JYA Q;  2IX0 A;  4A3G H;  2CKZ B;  4BY7 G;  1G51 A;  2WAQ E;  4A3L G;  3PUY A;  4JOI A;  1IBL Q;  2YU9 H;  1K3R A;  5ELN A;  3F2D A;  2ZM6 L;  4HIM A;  1C9O A;  4BA1 I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...