4R4CA

Structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4cA00
5IT9c 1VQGA 2PI2A 3ULPA 1N33Q 2WAQG 2Z0SA 1X3FA 3S17H 2ZM6L 4DK6C 3RZOH 2JA9A 2R93G 1YITA 3HKZG 4NPSA 5IYDH 3KDFB 1LYLA 3PF4A 3UE1A 4GNXC 1VQ9A 3ERSX 2VY3A 2A19A 4C2MH 2R6GA 2K5NA 4DUZL 4GOPC 4JI0Q 2KENA 4LFCL 3K8AA 1C7YA 4BY7H 4AIMA 1V43A 4IPCA 2K4KA 2WAQE 4BBRH 5IP9G 1MJEA 1W2BA 2B63G 4XTCS 1BKBA 2WB1G 2HT1A 3CCSA 5IWAL 2JA7G 3HKZE 4A3GH 1X6OA 2UUAQ 4ALPA 1Y1VH 1OTCA 2YV5A 2MNAA 5M5YH 1LTLA 1C0AA 2VS1A 3CCVA 3S14H 3CC7A 3VDYA 1KD1C 2HIVA 1EIYB 1NY4A 2IT1A 1XNRQ 1HZBA 4UY8C 1FJGQ 4LWCA 2UXDL 5M3MH 2ES2A 2EIFA 4P73A 2OQKA 2WB1E 4LF9Q 1KRTA 2HQLA 1NE3A 3S1MH 4GS3A 2DUDA 3OTOL 4IO9A 4LW1A 1N33L 1M1KC 5C0XI 1Q8KA 4DV4Q 2Z6KA 1VQFA 3STBD 3ICEA 3H0GG 3HOUH 1YNXA 2JE6I 4HJ9A 3W5OA 2JJQA 3MEFA 4A3EG 4YHHQ 1Q46A 1PH4A 4X64Q 1PH5A 3TS2A 2AWNA 5C3EH 2MO0A 3J80i 4GNXB 4B3RL 1LM0A 4DR1L 3I2ZA 2UUBL 4IFDJ 1CSQA 4R4TA 1X65A 2ZTDA 4GOPB 4PZ7A 3RZDH 4BXXG 1A63A 3UDIA 1PA6A 4JI7Q 2PQAA 4GN3B 1ASYA 4JI3Q 1PVOA 4POFA 3A0JA 5IYBG 2AKWB 3J80c 2EXDA 3A5ZB 2Q2TA 1FL0A 4C3HH 2JQOA 4IPHA 3UDGA 1XPOA 3GTKH 2ZJRA 4HJ5A 2NVQH 1Q1EA 1TWHH 3CMEA 4DR3Q 3E0EA 4LF7L 3HOYH 3T1HL 1TWAH 4JOIC 1B70B 3NEMA 2Q2HA 4GLAC 5JEAG 5M3FH 4JI6Q 4NXNQ 2ASBA 3HOVH 2GVAA 2KCTA 3HOWG 2OTJA 3M4OH 5BR8Q 1Q81C 1IBMQ 3FP9A 3CAMA 1EQRA 2EQSA 4IFDG 1S40A 1BVSA 1XMOL 4DV4L 1YI2A 2A1AA 3L0OA 1HNWQ 2CQOA 3CPFA 4DV3Q 1RL2A 4QIWE 4L5QA 4X66Q 3RN5A 4P74A 3K0XA 4YHHL 1PH3A 2RHSB 2VQEQ 3RR5A 1VQMA 1YHAA 2B29A 2E8GA 4X65L 1Y1VG 1WI5A 2E5LL 3KDFA 4LF8Q 2UXBQ 2IX1A 2F52A 4UP9A 3KYHC 1Q7YC 1MJCA 5IP9H 5GADC 4R4OA 1U0LA 2JEAI 1MIUA 5M3MG 3PIOA 4LFAQ 2JA7H 4DR7L 2IHEA 4YY3Q 3ULJA 1IBKQ 4LFBL 2R92G 3K7AH 4JYAQ 4JI5Q 4YCUA 1X9NA 1Q86C 4A3BH 1I94Q 2PNHA 5LMUL 4YWKA 3KF6B 4GLXA 1E24A 2Y0SG 2VQFL 2WP8J 4YWMA 5BR8L 4DV1L 4DR2L 4AQYL 1N36Q 3MXNB 2R7FA 1JJCB 5JJLA 2NVXH 1WJJA 4DK3C 1UE5A 3PUVA 5C3EG 3BJUA 1KAWA 4DV0L 1YJWA 2BA0A 3CMAA 4DUZQ 1PV4A 1M90C 4LFCQ 1NMFA 2NZHA 3A74A 4IFDI 3I55A 1QVGA 1KQSA 2AMCB 3J7ZC 3K7UC 4UP8A 5EAYA 5IY0A 5J3BA 5IWAQ 4DV7L 4A3EH 1KC8C 1L1OA 2UU9L 3RNUA 2Q2IA 5IP7G 2UXBL 1X3EA 1TWCH 2VL6A 4OO1I 1V9PA 2I5LX 1I6HH 4HJ8A 1NTGA 2L15A 1JT8A 1CKOA 2ZTCA 3HOYG 2VNUD 3G6EA 4BXXH 1CKNA 5H1SE 4Y7NH 5M3FG 3TRZA 2UXDQ 2VZAA 2K5HA 3CQZH 1HZ9A 2KBNA 5IYBH 1MKHA 3PV0A 2OCEA 1VQBA 3ZJYC 1YJ9A 2CFMA 4GKKL 3I4MH 3OTOQ 1FGUA 1YZ6A 4GN4B 3PF5A 1HJPA 3J81i 2MFIA 4QGUA 2PMZE 1I94L 1JJGA 4L5TA 1I5FA 1P8LA 3HKSA 2LSSA 3E9HA 1YJNA 3HOWH 1N36L 4B3MQ 4O2DA 4AH6A 3GTJH 4OWWB 3J81c 5JJKA 4AYBG 1PHJA 4B3RQ 3PSIA 2JEBI 1X3GA 1NBWA 2K5VA 4DR1Q 5K36G 2UUBQ 4R1JA 3U4ZA 2Q2UA 5M5WH 1S3OA 2KHJA 1XJVA 1JB7A 4JV5L 3ULLA 4A3JG 5GROA 4YWLA 1YBYA 1Z47A 3CPWA 3JC66 1GKHA 4YCVA 4JCVE 3FKIH 4AYBE 4POGA 4EX5A 1VQAA 4DV5L 3ER0A 4A3BG 1X56A 4P71A 3PO3G 1WCMG 1IYJB 2N49A 3BU2A 3M4PA 2I0QA 4IOCA 4LF7Q 3T1HQ 1HR0W 1Q82C 2K52A 2RF4A 4JI4L 2R92H 1UWVA 4FDBA 1E22A 3AYHB 1WOCA 3CXCA 1QVFA 4GLVB 3OYYA 3PUZA 2D0PA 4QL5A 1XMOQ 2E2HH 2QGQA 4LNQA 5LMNW 4C3JH 5FLXc 3S15H 4IJLA 4DV2L 4HIKA 3M4QA 2XGTA 3KF6A 4B3ML 4A3DG 1TXYA 5JEAJ 3U50C 4A3IG 2VUMH 4X65Q 2E5LQ 3PCOB 4JOIA 1S72A 1A0IA 4ME3A 4A3MH 1KL9A 2HHHL 3AFQA 1N9WA 2LXJA 2RCNA 4IJHA 4DR5L 1QUQB 5C44G 4QY7A 3I4NG 3KJPA 2MQHA 4HIDA 4JBKA 1PH7A 4DR7Q 5IP7H 1B7YB 5GAHC 1JMCA 1NJIC 4LFBQ 3RLOA 1I50H 3PGZA 4R4QA 3I4MG 4A93H 1L0WA 4JC0A 4JI8L 2I5MX 4OWXB 2A8VA 5LMUQ 3GTMH 2C35B 3TREA 4LUVA 4LF6L 2VQFQ 1BBWA 1EYGA 3TQYA 3U4VA 4DV1Q 4DR2Q 4AQYQ 4A3FG 2NN6G 4B3SL 2BH8A 5E7NA 1VQ5A 3CW2C 2VW9A 1AE2A 2HIXA 3BZKA 4JG2A 4DV0Q 4HIMA 1EFWA 3KFUA 4R4IA 1GM5A 4LUZA 1SLJA 4KI0A 4DV7Q 2UU9Q 2B3GA 4A3CG 1A8VA 1XPUA 3S1RH 3FKIG 3JAMi 2JA5H 2N3SA 4OX9L 2K75A 1FVIA 3F2BA 1UE1A 3S16H 4DR6L 1TWFH 2ZJQA 1VQJA 4A3JH 4L5RC 3GD7A 2K14A 1VQKA 1YHBA 2JA6G 3G71A 3JAMc 4DAMA 1VQEA 1CSPA 1TWGH 2YTYA 4GKKQ 4DPGA 4GKJL 3BZCA 3GTQH 3PO3H 1WCMH 3UDFA 4NB3A 1W3SA 1D8LA 1HH2P 2YTVA 3AFPA 3D0FA 4O0AA 2K50A 1PH2A 3GTLH 1BBUA 3S1QH 1HNZL 2VUMG 3OW2A 4J15A 3WWVA 3CCEA 4A3MG 2WFWA 1P16A 3RLFA 2E2JH 1EWIA 4A3DH 2IHFA 1EIFA 4P72A 1I3QH 3CCLA 4JV5Q 1X54A 4BY1H 4A3IH 5GQOA 4TVAB 1XMQL 1VS0A 3D31A 1O7IA 2KHIA 5HY6A 3CCJA 4DV6L 2FXQA 3DM3A 2RHQB 4DUYL 4JBMA 1YIJA 4A93G 4DV5Q 2IX0A 4GNXA 3SGIA 3S2HH 3T1YL 2UXCL 4R4CA 5C44H 4PG3A 3I4NH 1DGSA 3PUXA 5IYCG 2LXKA 4GOPA 1OXSC 3L2PA 2CKZB 3W1BA 3FHWA 4DR4L 4JBWA 5C0XJ 1PYBA 1QZHA 1E7ZA 1QZGA 1K8GA 4B3TL 3AEVA 1SROA 1AH9A 4JI4Q 1LUZA 4A3LH 2JA8H 1YEZA 2H5XA 2PQAB 1G51A 2N8NA 4PMWA 2ZJPA 3GTPH 3S1NH 1Y1WG 2F4VL 5FJ8G 2QA4A 5ELOA 3TEHB 4LUOA 1PH8A 4DV2Q 1U5KA 3UDXA 1SN8A 1XTDA 4LF4Q 4A3FH 1N32Q 1K9MC 1K3RA 4HJAA 1IZ6A 1UE7A 2JA5G 1N8RC 1T9HA 3CCQA 3M3YH 2HHHQ 3HOZH 3CC4A 2YU9H 4IOAA 4OWTB 5C0XG 3KOJA 4DR5Q 2NZOA 1K0RA 4OONA 2BA1A 1G6PA 3G48A 2R7DA 1VQ4A 4A3CH 3J81j 2UUCL 2ATWA 4BA2I 5C4XG 1L1OC 1OXXK 3GO5A 3UE0A 3H3VH 3AQQA 1VQDA 4JI8Q 1PH9A 1XNQL 2R7ZH 1KIXA 1VQ8A 4OXPA 1EUJA 4K0KL 2BH2A 4LF6Q 4MTNA 1SMXA 1VQ7A 2JA6H 3GTOH 4B3SQ 1VQPA 3M7NA 1PYSB 1VQHA 1YHQA 3TS0A 2CCZA 2F3IA 1HR0L 1G291 2GVBA 3H15A 4JI2L 4Y52H 1PH1A 4UP7A 5AJ3L 3EIVA 1IBLQ 1J5EL 4JI1L 4A4IA 4LF4L 1OXTA 1OXVA 4HJ7A 1N32L 2IY5B 4BY1G 2ID0A 4IPDA 2ALYB 3F1ZA 4BBSH 4KHPL 1IL2A 3EBEA 2OWOA 1CKMA 2GN5A 5LMNL 1Z9FA 4OX9Q 4NXML 4GN5A 2JK8A 4TQUS 3RN2A 4LF5L 4DR6Q 3IRBA 3E9IA 1VQLA 3HOXG 4JBJA 2NVTH 4HIOA 3GTGH 3PO2H 1IXRA 1SR3A 4QJFA 3GDEA 1AE3A 4A3LG 2JA8G 1K8AC 5DLQE 4GKJQ 1EQQA 1L1OB 1SE8A 4A3KG 5IYCH 1Q12A 3I7FA 4YCWA 1ASZA 4XIGS 4JI0L 3M9BA 1HNZQ 1WYDA 1K73C 5M5XH 1CKNB 1PFSA 1C9OA 2N78A 4MNOA 3CP0A 1N34Q 3HOZG 1HZCA 2D0OA 1Y1WH 5FJ8H 2YTXA 1IBLL 1Q1BA 2UUAL 3K80C 2Z6KC 1VQIA 3F2DA 4APVA 4A76A 4RG1A 5FLMH 1Y14B 3EN2A 3PUYA 2D62A 3CC2A 1X55A 1XMQQ 2OTLA 1E1OA 3I56A 4DKAC 1OXUA 1XNRL 1FJGL 4DV6Q 4DUYQ 3W1GA 4LF9L 4DAYB 1VQCA 2R7ZG 1D7QA 5IYDG 3T1YQ 1VQNA 2UXCQ 2AHOB 3KLWA 1UE6A 1KXLA 5ELNA 2CWPA 4DR4Q 4B3TQ 4DNIA 5C4XH 4BY7G 4PZ8A 4X6AH 4BBRG 3DLLA 3CF5A 1HNXQ 2R93H 4OO1G 3B6YA 4BA1I 2F4VQ 4A3GG 2V1CC 4X64L 1JJ2A 3PUWA 3A5UA 4BBSG 4RMFA 2OQ0A 4P75A 3I4OA 1PH6A 5JJIA 3Q8DA 1N34L 1L2FA 4X62Q 2B63H 3CD6A 4JI7L 2NN6I 4JI3L 4UPAA 5IE8A 4KHZA 3KJOA 1KHIA 1GO3E 3HFZB 4EQ5A 3S2DH 4KLKA 1YVCA 1HZAA 2PI2E 4PZ6A 1GD7A 3PO2G 4WJ3M 1KRSA 1NMGA 3CCRA 4DR3L 2UUCQ 1A62A 2NVYH 3S24A 2AWOA 4JI6L 3K81C 2ZM6Q 4NXNL 1EOVA 2ZTEA 4C3IH 1R9TH 5C4JH 3HOUG 4IPGA 3CCMA 2KCMA 1XNQQ 1IBML 2I5HA 3HOXH 3PIPA 3F8TA 3CCUA 3H3VI 4K0KQ 1QUQA 3NBHB 3M85A 4QQBX 2CWAA 3G4SA 1XPRA 2MO1A 5GAEC 5GAGC 3NELA 1VCIA 1J6QA 3STBC 1HNWL 1HNXL 2XTIA 3L7ZC 1GVPA 4DV3L 4WJ4A 4A3KH 3H0GH 4X66L 4A75A 1VQOA 1HR0Q 1CUKA 1B8AA 2Y0SE 4JI2Q 1E1TA 1K83H 2VQEL 3KF8B 3RLNA 5AJ3Q 2E2IH 2YYZA 3U58A 4JI1Q 1J5EQ 4L5SA 4LF8L 4H02A 1WFQA 5FLMG 3F2CA 1V1QA 2DGYA 1SFOH 1VQ6A 1RIPA 4KHPQ 1UEBA 4MZ9A 4X62L 3LGJA 1JE5A 1QVCA 5LMNQ 4LFAL 4NXMQ 3NENA 5HGQA 3HOVG 2QEXA 4YY3L 3J7A5 4LF5Q 1IBKL 1E3PA 1H95A 4JYAL 1SRUA 4JI5L
chains in the Genus database with same CATH superfamily
5IT9c 2PI2A 3ULPA 4G7OC 5KIXA 3K5NA 2EY1A 2JA9A 1IW7D 4PMCA 5L37A 4FF1A 5IYDH 3PF4A 4GNXC 1MD2D 1LO5D 3BYYB 4U68A 2A19A 1D2BA 4RKBA 2KENA 3TMEA 2EVBA 4IPCA 5BN3A 1W2BA 1BKBA 1PTOC 2WB1G 4A3EB 1BCPB 3FPPA 3VR2A 2DNEA 3S14H 4PQXA 2IT1A 3I4NB 4FXDA 4RGMA 4HMIA 4UY8C 1JORA 2ES2A 4P73A 2WB1E 4N8X1 4GS3A 3OTOL 3Q6SA 4IO9A 5ELDA 1M1KC 5C0XI 1Q8KA 4QIWB 1DZ1A 2Z6KA 4OGQC 3STBD 3OIQA 3NPPA 1JWUD 5DM63 2L12A 1ENFA 4FXKC 1U4LA 2OT2A 4FF2A 3TS2A 2MO0A 4Z9CB 1GHJA 2UUBL 4GOPB 4R4TA 2ZTDA 4JI7Q 2PQAA 4JI3Q 4CDFC 3I73A 3MTSA 2KA7A 2WKCA 3A5ZB 4HCSA 3O13A 3DEOA 2ZJRA 4BS9A 1HA6A 4HJ5A 4DR3Q 3CMEA 5ELFA 3T1HL 1TWAH 1B70B 4GLAC 3GTOB 2GVAA 3HOWG 2OTJA 1D1IA 3FP9A 4B08A 2EQSA 1S40A 2K7VA 1BVSA 1SNMA 3F2UA 4DV4L 1FR3A 2G5DA 2K32A 1YI2A 2IX3A 2CQOA 4L5QA 4YHHL 2VUMB 3RR5A 1VQMA 1YHAA 2E8GA 3KDFA 4LF8Q 1F9PA 1BCPF 1MSGA 1Q7YC 5GADC 4R4OA 1U0LA 2PO4A 5FLXE 3BZDB 2QDBA 3ULJA 2B2VA 5CORA 2R92G 5G3LD 5LMUL 5T1GA 4MTKA 1DONA 4G57A 2VQFL 1I4PA 4OHJA 4YWMA 5J22A 1H9RA 2R7FA 3ZYYX 5JJLA 3P7JA 4OELB 4DK3C 3J7YW 1UE5A 1KNEA 3CHBD 3D6CA 3BJUA 3MAQA 4DV0L 2BA0A 1M90C 1SNPA 1NMFA 2NZHA 3FVQA 4IFDI 1KQSA 1RCVD 2AMCB 1BR9A 2WINB 3J7ZC 4UP8A 1KC8C 3GTGH 2UU9L 5IP7G 2UXBL 2JA5B 2A69D 3CU7A 3MXGA 1CKOA 2A6HD 4RCNA 1LT4D 2EY5A 5H1SE 4Y7NH 1RKNA 1YJ9A 1VQBA 5C4ZA 1EYAA 1TR5A 1YZ6A 1TU2B 1I94L 3J81i 2MFIA 3HP3A 5EQ0A 5IGEA 5G3LF 1FGBD 1U4PA 1N36L 2FINB 4FXGC 4DAYA 4O2DA 3MFGA 3MHBA 4B3RQ 1X3GA 4CGYB 3NQTA 2E2JB 4R1JA 4K8JA 5M5WH 3OIPA 3IFTA 2Z9HA 4JV5L 4A3JG 2CH4A 5GROA 1YBYA 3MA2B 1AN8A 4YCVA 1A6XA 1SNQA 1VQAA 4DV5L 5C4JB 1WCMG 1IYJB 2N49A 3M4PA 3QIAA 1G91A 2V4DA 4MN3A 3DHQA 2EPBA 4KJNA 2RF4A 4JI4L 3SEBA 1UWVA 1LTTD 1OO9B 3OYYA 4A3KB 2D0PA 4QL5A 2QGQA 1HFGA 5LMNW 2RQXA 4C3JH 5FLXc 4DV2L 4A3DG 3KF6A 2EDGA 2F0DA 4A3IG 2E5LQ 1E2WA 1S72A 1ILPA 4ME3A 1KL9A 3NBHA 2RCNA 4QY7A 2DNCA 2SNSA 2MQHA 2Q8RE 1BDOA 1PH7A 4ZRZA 1B7YB 5GAHC 3RZOB 3RLOA 1I50H 4A93H 1L0WA 2I5MX 2R7ZB 2A8VA 3E0JA 4EQNA 4LF6L 1CM9A 1BBWA 4AQYQ 2NN6G 4C1NI 1CA6A 1AE2A 1EFWA 4KV6A 4HIMA 1D5MC 1SLJA 4JW0A 4DV7Q 4A3CG 3E5SA 3S1RH 1A15A 4PV1C 2M2LA 1FVIA 3F2BA 5K36H 4IUVA 2ZJQA 2L5TA 1VQJA 3WDNA 4L5RC 2NTTA 1VQKA 3EROA 3L3OC 2DJFC 3SK4A 4GKKQ 4GKJL 1IW7C 2F0NA 2AUKA 1PMRA 3C46A 3SK8A 3D0FA 4O0AA 1EEID 1DD2A 2NB0A 3OW2A 4J15A 3WWVA 3RZDB 2WFWA 5CV9A 1B3QA 1FYCA 3ITPA 3RLFA 1EWIA 3NK9A 2CHBD 1EIFA 4P72A 3H6MA 5D3DA 1X54A 2LKVA 4H0LC 5GQOA 4TVAB 4FVMA 2NVQB 1TWHB 1O7IA 2KHIA 4A93G 1O7LA 2RHQB 2F03A 2EJGC 5ELCA 4JBMA 3HOVB 2IX0A 2WIIB 2XN9C 3EFXD 3S2HH 4R4CA 4I7AA 3I4NH 3A54A 2PZUA 1OXSC 4DR4L 1JB3A 1CQFA 1SROA 1LUZA 1YEZA 2H5XA 2PQAB 3BG3A 3M4YA 4PMWA 2ZJPA 3S1NH 1Y1WG 5ELBA 5FJ8G 3UDXA 3J81L 1XTDA 4LF4Q 2O5JC 1K9MC 3L9AX 1UE7A 2WB1B 3VR5A 2EOTA 1F2MA 3CC4A 4DR5Q 5JJZA 2NZOA 4OONA 1G6PA 3A56A 4KY7A 2UUCL 2ATWA 5CYUA 3E3XA 4M8AA 4IUQA 1S4ZA 3J7AF 3QJYA 1EY9A 1Q3LA 2KQ3A 5TSSA 3GTOH 3BDOA 1GUSA 2TSSA 1PYSB 1VQHA 3C3LA 3K57A 1G291 2GVBA 3H15A 4Y52H 5LHY1 3WOEA 4JI1L 1OXTA 2IY5B 2ID0A 2SDFA 4ZAIA 4BBSH 1LLRD 1IL2A 1F9SA 4OX9Q 1Z9FA 3CQZB 1AZQA 3K58A 3FEWX 3RUZA 1AE3A 4DN4M 2A5HA 1KNAA 3HOWB 1GUOA 4WJWA 1VDZA 1LT6D 1Q12A 1ASZA 4XIGS 1JC7A 1WYDA 1PZJD 1K73C 4HSVA 3C2PA 3DUZA 4CJ2C 2EJFC 1W6JA 1Q1BA 2HUGA 4APVA 5FLMH 3S14B 3EN2A 1SXTA 2D62A 3CC2A 2OTLA 3HG9A 4DKAC 5A35A 5DEHA 1I4GA 4RCOA 4DUYQ 4DAYB 2B2WC 2HQEA 1NUCA 1VQCA 5C0XH 1VQNA 2R92B 1A2UA 1EY6A 5C3WA 4MIUA 1UE6A 5IGCA 4CHTB 1X3PA 4TSSA 5FKAC 3NHHA 1IL8A 2RA4A 4BBRG 2CQAA 2R93H 4RGOS 3ND8A 2F4VQ 3VR3A 5FK9C 3PUWA 4BBSG 1TS3A 2OQ0A 4J8QA 4P75A 4RGTA 4X3KA 3I4OA 5JJIA 4DXFA 1L2FA 4JI7L 2NN6I 4JI3L 4L8JA 2PYKA 4KHZA 1B3AA 3HFZB 4NW2A 5A2QE 1HZAA 3OWFA 3CKIB 4PZ6A 4WJ3M 4DR3L 5E4WC 3CRLC 5AFWA 3MXUA 2FHTA 3K81C 4DA2A 4C3IH 2EYLA 2I07B 1EL0A 5C4JH 3HOUG 4IPGA 2KCMA 2I5HA 3J80E 1QUQA 3NBHB 4F8MA 1BNZA 4QQBX 3GQBA 2MO1A 5GAEC 3NELA 1PDQA 3K5OA 4G4KA 1HNXL 3L7ZC 1GVPA 1C8CA 4A3KH 3H0GH 1HR0Q 4JI2Q 1L0XB 1B2TA 3RLNA 5AJ3Q 1CTMA 4LF8L 1J5EQ 1SJHD 1WFQA 5FLMG 2ICIA 4C3HG 2DGYA 3NTHA 1TWFB 5LL6S 2F0UA 1QVCA 4A3JB 1K3BC 1V1PA 3C1FA 4XXEA 2F0FA 1A3UA 2BDNA 1TWGB 2JYOA 1STNA 3GTQB 1WCMB 1LTAD 1SNCA 2Z1CA 2Z0SA 3SVMA 1N33Q 3RZOH 2ZXPA 2R93G 3IKJA 4NPSA 3S1QB 5JVG3 4ULLA 3RMHA 1CHQD 4IFDH 2R6GA 2K5NA 3K8AA 1YNND 1MJEA 5IGGA 1SDFA 5C4HA 2HT1A 3KK7A 2M00A 4A3IB 1PZKD 3OWEB 4X3TA 2UUAQ 1Y1VH 2R61A 2VS1A 3CCVA 1KD1C 4ID6A 3TP8A 1FJGQ 4IQZA 4LWCA 2OQKA 3U9SA 3AB9A 4ZLTF 1STYA 2CW0D 5E4XA 3BVMA 1S5DD 1JWMD 4K8IA 4XQNA 4NP5A 3RD4A 1B9MA 2K03A 3H0GG 1YNXA 3AU7A 3OSOA 5EPKA 1EIGA 1PH4A 4K14A 4B3RL 4FF4A 4ZYSA 2B2WA 3I91A 1LM0A 4R9WA 1HHVA 3I2ZA 4KMUC 4IFDJ 5M5WB 3RZDH 4BXXG 1SYBA 1O7ZA 1SYDA 4POFA 3A0JA 1VMPA 5IYBG 2AKWB 3J80c 3UI2A 2EXDA 4IN3A 1HUMA 2Q2TA 2BDOA 2IJ0A 2JQOA 4IPHA 4KKUA 3GTKH 3OW7A 2NVQH 3HOYH 1TWHH 2L4NA 1PFMA 5M3FH 3HOVH 4IFDG 3T13A 5CV8A 4DV3Q 1RL2A 3RN5A 3K0XA 2B29A 2E5LL 1Y1VG 3A55A 2IX1A 4C1NK 3X3MA 1B53A 2BE5D 1F9QA 1NSNS 4QMGA 2JEAI 1MIUA 3PIOA 2NVTB 1PRTB 2IHEA 4YY3Q 1PZID 1I50B 1STAA 1IBKQ 4A93B 3K7AH 4JI5Q 4QB4A 4YCUA 4A3BH 2PNHA 2F0MA 1CZGA 4YWKA 4GLXA 1E24A 1WTPA 2Y0SG 1QCBD 3Q23A 1LACA 4XYQA 5BR8L 4AQYL 1HXYD 2NVXH 3W2DA 5J39A 3TP6A 1KAWA 1YJWA 1Y1WB 4LFCQ 4J6HA 3BYTB 2A68D 1HTPA 5EAYA 5J3BA 5IWAQ 1JQYD 3C1EA 4DV7L 1L1OA 3RNUA 2Q2IA 3TSSA 3R3OA 1X3EA 5JVH3 1O80A 4CDCC 4HJ8A 1QOHA 2L15A 3KLSA 2ZTCA 3HOYG 1ML0D 1IYVA 1EFID 3A7AB 5M3FG 4M1UB 2HD3A 4FO2A 3CQZH 3PV0A 1VMCA 2OCEA 5IT9L 1STGA 1CK1A 4GKKL 3I4MH 1EWHA 4U673 2VXWA 4L5TA 2XVSA 1AW7A 3HOWH 1SNDA 4B3MQ 3BVZA 3JAME 5JJKA 5FO9B 2SOBA 4WRDA 4DR1Q 4YIJA 1K8MA 1NR2A 1IYUA 4KTAA 3G6JB 3ULLA 1S5CD 3K5MA 1DOLA 3H3VC 2KHSA 1A3VA 1PRTF 1STEA 2NVYB 3JC66 4POGA 3T53B 3S2HB 4A3BG 4P71A 2I0QA 1DJRD 2KEDA 4IOCA 4LF7Q 3VR4A 3HGBA 1Q82C 2R92H 3PQIA 3AYHB 3MC0B 2RBMA 3S1NB 3I3CA 3PUZA 1XMOQ 2N55A 1WD1A 5D65A 4IJLA 4HIKA 1BCPD 3M4QA 1BQQT 1SSOA 4X65Q 1LABA 3X3NA 1A0IA 2RKSA 3VR6A 4A3MH 1Z6HA 4DR5L 4IJHA 1QUQB 5I9PA 5C44G 3KJPA 4B9XA 5IP7H 2D5DA 2EY6A 3PGZA 3I4MG 4JC0A 2PCFB 2G9DA 1LTSD 2CVRA 1IKMA 4N8FA 4LUVA 2BOSA 4C2MB 3U4VA 3BVGA 4A3FG 1ESRA 4BBRB 2HDMA 1GOZA 2VW9A 3BZKA 2HIXA 4JG2A 2FMMA 5HURA 5KYIA 3SE0A 3MVVA 4O42A 4BBSB 1GM5A 3P20A 3FMCA 1ICWA 2B3GA 1A8VA 3BS1A 4OX9L 2N3SA 3S16H 1TWFH 4A3JH 3GD7A 1YHBA 1V1OA 3JAMc 4DAMA 1B44D 1MBYA 1TWGH 1LTRD 2YTYA 3A8JE 4DPGA 3BZCA 2QW7A 3GTQH 2F3WA 1IKLA 1Q90A 1WCMH 2KECA 4HMJA 3UDFA 4OIJA 3V2TA 1D8LA 1HH2P 3AFPA 2K50A 5EGTA 1BBUA 3S1QH 1QNKA 4A3MG 4FYDA 4ABNA 1B1ZA 4A3DH 4C3HB 2F0VA 4BY1H 4A3IH 3I70A 1VS0A 5COYA 3CCJA 1HQMC 1EU4A 3Q22A 4DUYL 2L0CA 5EBCA 4GNXA 4E6IA 1H9MA 1CT1D 1ILQA 1TS5A 3L2PA 4JBWA 1QZHA 1E7ZA 1AH9A 4CKEA 5CGKA 2JA8H 2R93B 2F0KA 2F0QA 3GTPH 5EPLA 2JSOA 2F4VL 3DWAA 4XQQA 1WTQA 2Q8TA 1W6KA 3AMUA 2NN6H 2HDLA 1K3RA 1ET6A 1NR4A 1T5XD 2IPKD 1D1KA 3DWQA 3KLSX 2HHHQ 3IFDA 4OWTB 2O5IC 2J0TD 4NKLA 1MSHA 2R7DA 4EQPA 4A3CH 3R2IA 5C4XG 4L6TB 1LT3D 1OXXK 2KCCA 3GO5A 4C3IB 3KBGA 2KOLA 3FPUB 2A73B 4I65A 4OXPA 1VF5C 5F2DA 1A3TA 2X69A 3M7NA 1YHQA 1L0YB 3H0GB 5M9OA 1HR0L 4JI2L 5FLXL 1PH1A 4UP7A 5AJ3L 3EIVA 2C9OA 1IBLQ 1J5EL 4A4IA 1QE6A 4HN7A 1N32L 5IGDA 4ZUIA 4BY1G 3F1ZA 1SE2A 2GN5A 4KD3A 4UDUC 3P1HA 4GN5A 4TQUS 3RN2A 2MUYA 2F0IA 2RDFA 1BUVT 3IRBA 3E9IA 4DR6Q 4IALA 4JBJA 2NVTH 4QUCA 1R4QB 1BXTA 1IXRA 2XRQD 2O4XA 2JA8G 2H1EA 1K8AC 4RA8A 1EQQA 2XRSD 1L1OB 1SE8A 3DM1A 3GTJB 1BO0A 1J8IA 2IWHA 1HNZQ 4N9PA 4XT1B 1PFSA 1C9OA 2N78A 4ZKCB 1N34Q 1Y1WH 5FJ8H 1Y1VB 2UUAL 1VQIA 4RG1A 2RSOA 1XMQQ 1FJGL 4DNRB 1YNJC 3DEPA 3FDTA 1XX8A 3QO2A 1EY4A 5ELNA 1TQOA 4B3TQ 1S5BD 1DM0B 4BY7G 2Y0SB 5D3IB 3S15B 4OO1G 2B2TC 4DAPA 4A3GG 5DAUA 4P2CB 2RCFA 2LFNA 5KRUA 1EZ8A 4CJ0B 1PFBA 3D4WA 1PH6A 1F2YA 3Q8DA 2B63H 4X62Q 2L11A 4JPBW 3KJOA 1LT5D 4KLKA 2LS01 3GTKB 1EEFD 4KY6A 3HOYB 5IGFA 3CCRA 2NVYH 2PZTA 5M3FB 3SHLA 4X3SA 3A8IE 1O78A 3F8TA 3H3VI 4K0KQ 3M85A 2PNRC 2L9HA 2CWAA 3I72A 1XPRA 2L55A 4KN4C 3STBC 1VCIA 1EWCA 3K5LA 4DV3L 3VYSA 4A75A 2Q2UA 1H9JA 3MZ5A 3F2CA 2TMPA 1VQ6A 4MZ9A 5LMNQ 2QEXA 4YY3L 4KHVA 3J7A5 4LF5Q 1FD7D 3K7AB 1E3PA 1IBKL 3TP7A 1H95A 1QILA 4JI5L 1VQGA 4A3BB 4Q5VA 2EZVA 1SAPA 1X3FA 3BDLA 1KTKA 2ZM6L 1K28A 1ESFA 3A7LA 3KDFB 1LYLA 2NVXB 3UE1A 2KJXA 1KLGD 1VQ9A 2VY3A 4CDEC 4C2MH 4GOPC 4LFCL 1WVLA 1C7YA 1V43A 4BBRH 5IP9G 2B63G 1ZYRD 5IWAL 2JA7G 1X6OA 2F0SA 1OTCA 1C0AA 5CMDA 3VDYA 1EIYB 1NY4A 1XNRQ 3OPOA 1QG7A 4LF9Q 4DGZA 2HQLA 1KDBA 1RTNA 1NE3A 1H9KA 3MXPA 2FFKB 2DUDA 1HTLD 2F4IA 2MPMA 3I4MB 1U4RA 1DOKA 4LW1A 3U9OA 1B9NA 4O1NA 1PXUA 1RHPA 4DV4Q 1VQFA 4F7XA 3ICEA 4QCLA 3HOUH 2JE6I 2X6GA 4A3FB 2JJQA 4UHVA 4A3EG 3VA5A 4YHHQ 1Q46A 4X64Q 1PH5A 4GNXB 3J80i 3D8GA 2YU9B 4DR1L 1KDCA 1TY0A 3UDIA 1XYIA 1QWYA 3OOCA 1SEBD 1PTOB 3DXJC 1EQVA 1KLUD 2A69C 4KK7A 4C3HH 2B2TA 2GA4B 3H91A 3PMFA 2K5WA 5K5PA 3UDGA 2A6HC 1Q1EA 1VF7A 4LF7L 3TP5A 4DK1A 5JEAG 3NEMA 2Q2HA 5KGUA 4JI6Q 1K0SA 4DU9A 2DY7A 4R8NA 4XDXA 3TZUA 1X3QA 1EQRA 3NP8A 1XMOL 1HFNA 3L0OA 3CPFA 4QIWE 3MEHA 4X66Q 1PH3A 2RHSB 4X65L 4KY5A 2UXBQ 4A3MB 2LY7A 4NDXA 2B8GA 4UP9A 2FJ2A 3KYHC 5ISRA 2NTSA 4LFAQ 1KABA 5CR3A 4V190 1GUNA 1RF2D 4JYAQ 1CFMA 1I94Q 2NZ1D 1H9SA 2AQ3B 3KF6B 4K6LA 2WP8J 5I6WA 1N36Q 4OEMB 3VYUA 1JJCB 5M5XB 1WJJA 2K1BA 5C3XA 1FNUA 1I6VC 4DUZQ 1PV4A 1NCVA 3N52A 3A74A 2XNAC 3D4RA 3I55A 1SE4A 1QVGA 3I90A 5C6AA 4HCEA 5IY0A 5KNBA 5IODA 5BN4A 4H13C 1TWCH 2VL6A 3Q0AA 1JICA 4OO1I 1PTOF 3LWUA 1R4PB 5I4DA 1NTGA 1JT8A 3S16B 2VNUD 3D3RA 1UUPA 4BXXH 1CKNA 2KUMA 3TRZA 2UXDQ 2K5HA 2KBNA 5IYBH 5CV6A 3ZJYC 2Z4IA 5C4XB 2I46A 3PF5A 1FGUA 4GN4B 5E1FA 3NBIA 1Z7TA 1I5FA 3HKSA 1RDPD 1Q8IA 1C48A 1YJNA 2J4XA 4AH6A 3GTJH 2B2UC 5IIFA 4AYBG 2M9VA 3PSIA 1ENCA 2HCIA 1JOOA 1NBWA 1S5ED 4A3DB 3QOLA 3S2DB 1JB7A 4BY1B 3EQLC 3LX0A 4CJ1B 2A74C 1Z47A 3CPWA 1GKHA 1SMYD 4JCVE 3FKIH 4AYBE 1GUWA 1R9TB 1JOQA 1TKWB 3ER0A 1X56A 3PO3G 1I4QA 2D9UA 1MHWC 3QG1A 2JA8B 1EYCA 2EYJA 4FDBA 4CBVA 1E22A 3CXCA 4DNTB 1JE4A 4GLVB 3GTPB 3SK6A 4R8IA 1K83B 1LTGD 1E2VA 3OMGA 3S15H 2QCPX 3PIP3 5A2QL 4G7ZC 2XGTA 2E76C 4KKSA 1TXYA 2Z8LA 1STBA 2QILA 2F0OA 1JR0D 2HHHL 3AFQA 1N9WA 2LXJA 2NYZD 4KN7C 5DNFA 3J80L 1PFNA 4DR7Q 4ODGA 3S17B 1CZWA 4LFBQ 4R4QA 4FP5D 2F0LA 3GTMH 4XQJA 3GP7A 4IUTA 3TREA 3G7LA 1EYGA 3EVQA 4DV1Q 4DR2Q 4BY7B 1SE3A 3P75A 5E7NA 5HGTA 3CW2C 3KFUA 1A2TA 4A3GB 3LWEA 2F0PA 1D6EC 1WD0A 2KCNA 2AQ1B 4LUZA 4KI0A 1NAPA 4DK0A 1XPUA 3FKIG 3JAMi 1HPCA 1UE1A 4DR6L 1O7YA 5CV7A 1U9RA 2FMCA 4ILWA 3KBXA 2JA6G 5I9OA 3G71A 3QB3A 1VQEA 1SNOA 4XT3B 2YTVA 5DM73 1PH2A 3GTLH 1HNZL 1BOSA 2F3VA 2X6LA 3MFYA 4EVOA 3CCEA 1PLFA 5CBEE 1PRTD 3HRZC 2IHFA 2PW5A 1TVXA 1XMQL 3D31A 5HY6A 1AZPA 3TN2A 2FXQA 3DM3A 5JOBA 3SGIA 4F87A 2B2UA 5C44H 4PG3A 5E3FA 5IYCG 2LXKA 2ZXOA 1SJED 5I2XA 4OIKA 4B3TL 1PYBA 1QZGA 4ME5A 5LL6X 3AEVA 2BCOA 2E2DC 4A3LH 2OEOA 1HCZA 1G51A 2N8NA 2EYOA 4KD4A 3CRKC 3H94A 2JP1A 1GUGA 5ELOA 4LUOA 1PH8A 1SYFA 1U5KA 1SN8A 4A3FH 5EJWA 1DYQA 3KLRA 2F0GA 4HJAA 2B63B 1EQTA 1N8RC 3CCQA 3M3YH 3HOZH 4HEDA 2YU9H 3A8KE 4Q0FA 1K0RA 3E6ZX 2B2YC 2F0TA 1PTOH 3ND9A 1CHPD 4BA2I 3UE0A 4XYOA 3OMCA 3H3VH 4S3SA 4JI8Q 1VQDA 5FOBB 1KIXA 2N88A 3I4LA 1EUJA 4K0KL 4LK1C 3MWYW 4V0BA 4B3SQ 2EXZA 2VB3X 5D14A 2XWBB 3HZXA 4HJ7A 1OXVA 4LF4L 1I6HB 1MI2A 1NNXA 1H9SB 2ALYB 3SDZA 3NQIA 3MXNA 1CKMA 5LMNL 4LF5L 1WTXA 5J1ZA 5NUCA 3HOXG 5JPNC 4HIOA 1ONLA 3PO2H 1SR3A 4QJFA 3GDEA 1ENAA 4A3LG 1AEXA 1CA5A 2Q8IB 1HUNA 3D4DA 4HR7B 3EJIA 2C5CA 3D6WA 3I7FA 4YCWA 1MGSA 3M9BA 5M5XH 1CKNB 1V1PB 2Z6BA 3HOZG 3K80C 4A76A 4ZCKA 3PUYA 1X55A 1XNRL 4DV6Q 3W1GA 4LF9L 2AUJD 5IYDG 2O2LD 3NWTA 3T1YQ 2UXCQ 2K01A 2SNMA 2AHOB 3JAML 1KXLA 1ICFB 4DNIA 2K33A 2E2HB 5C4XH 3LNNA 4PZ8A 3HOUB 3CF5A 3QR8A 1HNXQ 3OHXC 2RVLA 3B6YA 3Q24A 4F88A 4UAIA 2V1CC 4X64L 1JOKA 1RD9D 1YNNC 2XWJB 3T16A 4WORA 3CD6A 2JN4A 3SK5A 3QWNA 1GO3E 3S2DH 1SMYC 4EQ5A 2K5QA 4RAUC 3PO2G 1GD7A 2J7ZA 1EY8A 4RKLA 1KRSA 1Y69U 1NMGA 1A62A 3S24A 2AWOA 4JI6L 1R9TH 2K28A 1AFPA 3CCMA 2CW0C 1XNQQ 2OF1A 1DXMA 4N9TA 1J6QA 2XTIA 2B2YA 4ZUJA 3T4AC 4WJ4A 4X66L 5KYLA 1CUKA 1B8AA 1E1TA 1K83H 3S9WA 1RODA 4AYBB 2E2IH 3U58A 1V1QA 1SFOH 4KHPQ 1G6ZA 2SEBD 3LGJA 5CC4A 4LFAL 4NXMQ 5HGQA 3T56B 1G2SA 4HSPA 4IZ8A 5FO7B 3IAYA 2EYFA 4JYAL 3J7AV 4C56C 3PO3B 3WOFA 2WAQG 3S17H 4DK6C 1YITA 3HKZG 4QF4A 3NUCA 3ERSX 1BF4A 4DUZL 4JI0Q 4BY7H 4AIMA 2K4KA 2WAQE 4HTHA 3NXWA 4XTCS 4OO1H 2EYMA 1I3QB 3CCSA 1STHA 1J9OA 1LTID 3HKZE 4A3GH 1V8QA 1TWCB 4ALPA 2YV5A 2MNAA 5M5YH 1LTLA 4CKBA 2BE5C 3CC7A 2HIVA 5T1IA 1HZBA 2UXDL 5M3MH 2EIFA 1KRTA 3S1MH 1GXDC 4GZYC 1N33L 4PNYA 1TIID 4HJ9A 3W5OA 3MEFA 2EY2A 1KDAA 2AWNA 5C3EH 1HRJA 1DCZA 2A68C 4HAEA 1WTWA 1CSQA 1PRTC 1X65A 4DF7A 2G9HD 4PZ7A 1A63A 1PA6A 2ICEC 4JK1C 4GN3B 2DJGC 1ASYA 2PZWA 1PVOA 5EKLA 3FKIB 3J81E 1FL0A 1XPOA 4FF3A 2DY8A 4J1MA 3E0EA 4JOIC 2ASBA 4NXNQ 2JA6B 2KCTA 5CBAE 3M4OH 4LJZC 5BR8Q 1Q81C 1IBMQ 3CAMA 2A1AA 2KEEA 1HNWQ 2PPBC 3ONAB 2QKIC 3SXHA 4P74A 1U4MA 2VQEQ 1WI5A 3R93A 2F52A 1D5ZC 1MJCA 5IP9H 1B4OA 4RGNA 5M3MG 3FRPB 3NTKA 2JA7H 4DR7L 2VB2X 1GJXA 4TKOB 2MJ8A 4LFBL 2K05A 5EBDA 1X9NA 1Q86C 3GTMB 1BBXC 2KVMA 2F0JA 4C3JG 3R2TA 4DV1L 4DR2L 3MXNB 5JAVA 1CI3M 3PUVA 5C3EG 3CMAA 4KKTA 3HS0C 3N6RA 1BCPC 3K7UC 4A3EH 1WTOA 1V9PA 2I5LX 2PQEA 1I6HH 1Y8PB 3NSWA 1C4QA 3G6EA 1G8ZD 2VZAA 1HZ9A 1MKHA 1ZKOA 2RDHA 2CFMA 1ET9A 3OTOQ 1HJPA 1JJGA 4QGUA 2PMZE 4L63B 1EZ6A 1QNUA 4K5VA 1P8LA 4DAVA 2LSSA 3E9HA 5JEAH 3GTLB 4LAAA 1SYEA 4PMBA 2OXPA 1TS2A 4OWWB 1ZXTA 1EU3A 3J81c 3EA6A 1PHJA 2JEBI 3BDCA 2K5VA 1T5EA 5K36G 5CV4A 3SR1A 2UUBQ 3U4ZA 1LV9A 1S3OA 1FNVA 1SBBB 2KHJA 1XJVA 2EE1A 4YWLA 2EYHA 3KUPA 4EX5A 5C44B 3BU2A 3HOXB 3QOJA 3T1HQ 1HR0W 1GUTA 2LMCB 3T51B 2K52A 5KNDA 1WOCA 1Y8OB 3VYRA 1QVFA 4MHEA 2E2HH 4LNQA 1AP0A 2ZT9C 2XSCA 3I8ZA 4B3ML 5JEAJ 2K6AA 4ZQ3A 3U50C 1I4RA 2VUMH 3PCOB 4JOIA 2A6ED 3M3YB 3HOZB 3V05A 3I4NG 4HIDA 4JBKA 1FNWA 2CH4W 1JMCA 5IOCA 1NJIC 1S5FD 3W3AA 3KF8A 1JWSD 1GHKA 4JI8L 1M8AA 4OWXB 1II3A 3R8BA 5LMUQ 2C35B 1M4VA 1WTHA 1XXGA 1D5XC 2VQFQ 3TQYA 5KNCA 4B3SL 2BH8A 1F2ZA 2NBFA 2MP1A 3TZDA 5I6YA 3M7GA 1VQ5A 1RJTA 5IGBA 4DV0Q 4WFN3 1DOMA 2K5DA 1PTOD 4R4IA 2UU9Q 5KEEA 5ELEA 4H44C 2JA5H 2K75A 4IUUA 2DN8A 3PO2B 2RDGA 2K14A 3VYTA 1CSPA 3PO3H 4NB3A 1W3SA 4BWGB 3DWPA 2VUMG 2AQ2B 4H7BA 4K5WA 1P16A 2F0EA 4X3UA 2E2JH 4IURA 1I3QH 3CCLA 4JV5Q 4TRDA 1SYCA 4FNFA 2L1BA 3TBIB 4DXGA 1TWAB 2XIWA 4DV6L 4K2KA 1YIJA 4DV5Q 5I2YA 3T1YL 2UXCL 1ZEQX 4NMZA 1DGSA 3PUXA 2NWGA 4GOPA 1F77A 1SYGA 2CKZB 3W1BA 3FHWA 5C0XJ 1K8GA 2WAQB 4JI4Q 2P5ZX 1I4XA 2B39A 3HKZB 1QJOA 2MHVA 1RTOA 2QA4A 3TEHB 2EYPA 4DV2Q 1N32Q 2E75C 4RHRA 5EPJA 1IZ6A 2JA5G 1T9HA 4IOAA 5C0XG 3KOJA 4ZK9B 1TT2A 2BA1A 3G48A 1VQ4A 3J81j 1L1OC 2MGSA 2QEJC 3K6OA 3AQQA 2PW7A 3PIO3 1PH9A 1E2ZA 1XNQL 2R7ZH 1VQ8A 2BH2A 1XTCD 4LF6Q 4MTNA 1SMXA 1VQ7A 2JA6H 4ZKBB 1VQPA 1F9RA 3TS0A 2CCZA 2WV6D 2F3IA 3GTGB 1HA5A 2E2IB 1JCKB 4KJOA 4IPDA 1SFOB 1G2TA 1E0BA 2B8FA 4KHPL 4RWSC 4IUPA 3EBEA 2OWOA 4Y7NB 3TDQA 5CV5A 4NXML 1EOTA 4C3IG 2JK8A 2R3ZA 1HQRD 1KAAA 5EKKA 3NWSA 1VQLA 2JXMB 1X32A 4EQOA 3K0YA 2QDLA 5DLQE 4GKJQ 4A3KG 2RSNA 3IL8A 1F2LA 4QUFA 5IYCH 3URYA 3GV3A 2K04A 5IT9E 4JI0L 4RH6A 5C5MA 4DFAA 4MNOA 1Y8NB 3CP0A 1HZCA 2D0OA 2YTXA 3VA7A 1IBLL 3HEJA 2H4OA 2Z6KC 5M5YB 3F2DA 1UAPA 1EIHA 1Y14B 1TS4A 1E1OA 3I56A 1OXUA 5M3MB 1EYDA 4K2LA 4RHSA 2R7ZG 3S1MB 1UNSA 4K5XA 1D7QA 5C5LA 1PYWD 1WTRA 2WACA 3H09A 3KLWA 4EGVA 5FO8B 1K8OA 2CWPA 2E74C 4DR4Q 3DMUA 4X6AH 2ZXRA 3DLLA 4C3JB 4G7HC 1LTBD 2F0HA 4BA1I 1I4HA 2IL8A 3ERQA 5C3EB 1JJ2A 1CQVA 4I7ZC 3A5UA 1IHZA 4RMFA 2Z4HA 4CDDC 1EY0A 1ZYRC 1WTVA 1N34L 2IW3A 3NTIA 4LMQD 4UPAA 5IE8A 1KHIA 4K6DA 2PMZB 1YVCA 2PI2E 4JVZA 2UUCQ 2F1MA 1TY2A 2ZM6Q 4NXNL 1EOVA 2ZTEA 2HCCA 3GV6A 4IUNA 3M4OB 2NUCA 1IBML 1XWEA 3HOXH 3PIPA 3CCUA 5BN5A 1EY5A 3G4SA 3V96A 2EJMA 5GAGC 1HNWL 2B2VC 2D2CC 2F0WA 1VQOA 5EKIA 2Y0SE 4B9WA 4RFBA 2VQEL 1UEAB 3KF8B 1QB5D 1B50A 2YYZA 2A6EC 4JI1Q 3S1RB 4L5SA 4H02A 3K59A 2QF7A 1RIPA 1UEBA 4OL7A 4X62L 1JE5A 4CKCA 2ENBA 3NE5B 2JA7B 3NENA 1YNJD 2WKDA 3HOVG 5JPMC 1EY7A 1SRUA
chains in the Genus database with same CATH topology
5IT9c 1VQGA 2PI2A 3ULPA 1N33Q 2WAQG 2Z0SA 1X3FA 3S17H 2ZM6L 4DK6C 3RZOH 2JA9A 2R93G 1YITA 3HKZG 4NPSA 5IYDH 3KDFB 1LYLA 3PF4A 3UE1A 4GNXC 1VQ9A 3ERSX 2VY3A 2A19A 4C2MH 2R6GA 2K5NA 4DUZL 4GOPC 4JI0Q 2KENA 4LFCL 3K8AA 1C7YA 4BY7H 4AIMA 1V43A 4IPCA 2K4KA 2WAQE 4BBRH 5IP9G 1MJEA 1W2BA 2B63G 4XTCS 1BKBA 2WB1G 2HT1A 3CCSA 5IWAL 2JA7G 3HKZE 4A3GH 1X6OA 2UUAQ 4ALPA 1Y1VH 1OTCA 2YV5A 2MNAA 5M5YH 1LTLA 1C0AA 2VS1A 3CCVA 3S14H 3CC7A 3VDYA 1KD1C 2HIVA 1EIYB 1NY4A 2IT1A 1XNRQ 1HZBA 4UY8C 1FJGQ 4LWCA 2UXDL 5M3MH 2ES2A 2EIFA 4P73A 2OQKA 2WB1E 4LF9Q 1KRTA 2HQLA 1NE3A 3S1MH 4GS3A 2DUDA 3OTOL 4IO9A 4LW1A 1N33L 1M1KC 5C0XI 1Q8KA 4DV4Q 2Z6KA 1VQFA 3STBD 3ICEA 3H0GG 3HOUH 1YNXA 2JE6I 4HJ9A 3W5OA 2JJQA 3MEFA 4A3EG 4YHHQ 1Q46A 1PH4A 4X64Q 1PH5A 3TS2A 2AWNA 5C3EH 2MO0A 3J80i 4GNXB 4B3RL 1LM0A 4DR1L 3I2ZA 2UUBL 4IFDJ 1CSQA 4R4TA 1X65A 2ZTDA 4GOPB 4PZ7A 3RZDH 4BXXG 1A63A 3UDIA 1PA6A 4JI7Q 2PQAA 4GN3B 1ASYA 4JI3Q 1PVOA 4POFA 3A0JA 5IYBG 2AKWB 3J80c 2EXDA 3A5ZB 2Q2TA 1FL0A 4C3HH 2JQOA 4IPHA 3UDGA 1XPOA 3GTKH 2ZJRA 4HJ5A 2NVQH 1Q1EA 1TWHH 3CMEA 4DR3Q 3E0EA 4LF7L 3HOYH 3T1HL 1TWAH 4JOIC 1B70B 3NEMA 2Q2HA 4GLAC 5JEAG 5M3FH 4JI6Q 4NXNQ 2ASBA 3HOVH 2GVAA 2KCTA 3HOWG 2OTJA 3M4OH 5BR8Q 1Q81C 1IBMQ 3FP9A 3CAMA 1EQRA 2EQSA 4IFDG 1S40A 1BVSA 1XMOL 4DV4L 1YI2A 2A1AA 3L0OA 1HNWQ 2CQOA 3CPFA 4DV3Q 1RL2A 4QIWE 4L5QA 4X66Q 3RN5A 4P74A 3K0XA 4YHHL 1PH3A 2RHSB 2VQEQ 3RR5A 1VQMA 1YHAA 2B29A 2E8GA 4X65L 1Y1VG 1WI5A 2E5LL 3KDFA 4LF8Q 2UXBQ 2IX1A 2F52A 4UP9A 3KYHC 1Q7YC 1MJCA 5IP9H 5GADC 4R4OA 1U0LA 2JEAI 1MIUA 5M3MG 3PIOA 4LFAQ 2JA7H 4DR7L 2IHEA 4YY3Q 3ULJA 1IBKQ 4LFBL 2R92G 3K7AH 4JYAQ 4JI5Q 4YCUA 1X9NA 1Q86C 4A3BH 1I94Q 2PNHA 5LMUL 4YWKA 3KF6B 4GLXA 1E24A 2Y0SG 2VQFL 2WP8J 4YWMA 5BR8L 4DV1L 4DR2L 4AQYL 1N36Q 3MXNB 2R7FA 1JJCB 5JJLA 2NVXH 1WJJA 4DK3C 1UE5A 3PUVA 5C3EG 3BJUA 1KAWA 4DV0L 1YJWA 2BA0A 3CMAA 4DUZQ 1PV4A 1M90C 4LFCQ 1NMFA 2NZHA 3A74A 4IFDI 3I55A 1QVGA 1KQSA 2AMCB 3J7ZC 3K7UC 4UP8A 5EAYA 5IY0A 5J3BA 5IWAQ 4DV7L 4A3EH 1KC8C 1L1OA 2UU9L 3RNUA 2Q2IA 5IP7G 2UXBL 1X3EA 1TWCH 2VL6A 4OO1I 1V9PA 2I5LX 1I6HH 4HJ8A 1NTGA 2L15A 1JT8A 1CKOA 2ZTCA 3HOYG 2VNUD 3G6EA 4BXXH 1CKNA 5H1SE 4Y7NH 5M3FG 3TRZA 2UXDQ 2VZAA 2K5HA 3CQZH 1HZ9A 2KBNA 5IYBH 1MKHA 3PV0A 2OCEA 1VQBA 3ZJYC 1YJ9A 2CFMA 4GKKL 3I4MH 3OTOQ 1FGUA 1YZ6A 4GN4B 3PF5A 1HJPA 3J81i 2MFIA 4QGUA 2PMZE 1I94L 1JJGA 4L5TA 1I5FA 1P8LA 3HKSA 2LSSA 3E9HA 1YJNA 3HOWH 1N36L 4B3MQ 4O2DA 4AH6A 3GTJH 4OWWB 3J81c 5JJKA 4AYBG 1PHJA 4B3RQ 3PSIA 2JEBI 1X3GA 1NBWA 2K5VA 4DR1Q 5K36G 2UUBQ 4R1JA 3U4ZA 2Q2UA 5M5WH 1S3OA 2KHJA 1XJVA 1JB7A 4JV5L 3ULLA 4A3JG 5GROA 4YWLA 1YBYA 1Z47A 3CPWA 3JC66 1GKHA 4YCVA 4JCVE 3FKIH 4AYBE 4POGA 4EX5A 1VQAA 4DV5L 3ER0A 4A3BG 1X56A 4P71A 3PO3G 1WCMG 1IYJB 2N49A 3BU2A 3M4PA 2I0QA 4IOCA 4LF7Q 3T1HQ 1HR0W 1Q82C 2K52A 2RF4A 4JI4L 2R92H 1UWVA 4FDBA 1E22A 3AYHB 1WOCA 3CXCA 1QVFA 4GLVB 3OYYA 3PUZA 2D0PA 4QL5A 1XMOQ 2E2HH 2QGQA 4LNQA 5LMNW 4C3JH 5FLXc 3S15H 4IJLA 4DV2L 4HIKA 3M4QA 2XGTA 3KF6A 4B3ML 4A3DG 1TXYA 5JEAJ 3U50C 4A3IG 2VUMH 4X65Q 2E5LQ 3PCOB 4JOIA 1S72A 1A0IA 4ME3A 4A3MH 1KL9A 2HHHL 3AFQA 1N9WA 2LXJA 2RCNA 4IJHA 4DR5L 1QUQB 5C44G 4QY7A 3I4NG 3KJPA 2MQHA 4HIDA 4JBKA 1PH7A 4DR7Q 5IP7H 1B7YB 5GAHC 1JMCA 1NJIC 4LFBQ 3RLOA 1I50H 3PGZA 4R4QA 3I4MG 4A93H 1L0WA 4JC0A 4JI8L 2I5MX 4OWXB 2A8VA 5LMUQ 3GTMH 2C35B 3TREA 4LUVA 4LF6L 2VQFQ 1BBWA 1EYGA 3TQYA 3U4VA 4DV1Q 4DR2Q 4AQYQ 4A3FG 2NN6G 4B3SL 2BH8A 5E7NA 1VQ5A 3CW2C 2VW9A 1AE2A 2HIXA 3BZKA 4JG2A 4DV0Q 4HIMA 1EFWA 3KFUA 4R4IA 1GM5A 4LUZA 1SLJA 4KI0A 4DV7Q 2UU9Q 2B3GA 4A3CG 1A8VA 1XPUA 3S1RH 3FKIG 3JAMi 2JA5H 2N3SA 4OX9L 2K75A 1FVIA 3F2BA 1UE1A 3S16H 4DR6L 1TWFH 2ZJQA 1VQJA 4A3JH 4L5RC 3GD7A 2K14A 1VQKA 1YHBA 2JA6G 3G71A 3JAMc 4DAMA 1VQEA 1CSPA 1TWGH 2YTYA 4GKKQ 4DPGA 4GKJL 3BZCA 3GTQH 3PO3H 1WCMH 3UDFA 4NB3A 1W3SA 1D8LA 1HH2P 2YTVA 3AFPA 3D0FA 4O0AA 2K50A 1PH2A 3GTLH 1BBUA 3S1QH 1HNZL 2VUMG 3OW2A 4J15A 3WWVA 3CCEA 4A3MG 2WFWA 1P16A 3RLFA 2E2JH 1EWIA 4A3DH 2IHFA 1EIFA 4P72A 1I3QH 3CCLA 4JV5Q 1X54A 4BY1H 4A3IH 5GQOA 4TVAB 1XMQL 1VS0A 3D31A 1O7IA 2KHIA 5HY6A 3CCJA 4DV6L 2FXQA 3DM3A 2RHQB 4DUYL 4JBMA 1YIJA 4A93G 4DV5Q 2IX0A 4GNXA 3SGIA 3S2HH 3T1YL 2UXCL 4R4CA 5C44H 4PG3A 3I4NH 1DGSA 3PUXA 5IYCG 2LXKA 4GOPA 1OXSC 3L2PA 2CKZB 3W1BA 3FHWA 4DR4L 4JBWA 5C0XJ 1PYBA 1QZHA 1E7ZA 1QZGA 1K8GA 4B3TL 3AEVA 1SROA 1AH9A 4JI4Q 1LUZA 4A3LH 2JA8H 1YEZA 2H5XA 2PQAB 1G51A 2N8NA 4PMWA 2ZJPA 3GTPH 3S1NH 1Y1WG 2F4VL 5FJ8G 2QA4A 5ELOA 3TEHB 4LUOA 1PH8A 4DV2Q 1U5KA 3UDXA 1SN8A 1XTDA 4LF4Q 4A3FH 1N32Q 1K9MC 1K3RA 4HJAA 1IZ6A 1UE7A 2JA5G 1N8RC 1T9HA 3CCQA 3M3YH 2HHHQ 3HOZH 3CC4A 2YU9H 4IOAA 4OWTB 5C0XG 3KOJA 4DR5Q 2NZOA 1K0RA 4OONA 2BA1A 1G6PA 3G48A 2R7DA 1VQ4A 4A3CH 3J81j 2UUCL 2ATWA 4BA2I 5C4XG 1L1OC 1OXXK 3GO5A 3UE0A 3H3VH 3AQQA 1VQDA 4JI8Q 1PH9A 1XNQL 2R7ZH 1KIXA 1VQ8A 4OXPA 1EUJA 4K0KL 2BH2A 4LF6Q 4MTNA 1SMXA 1VQ7A 2JA6H 3GTOH 4B3SQ 1VQPA 3M7NA 1PYSB 1VQHA 1YHQA 3TS0A 2CCZA 2F3IA 1HR0L 1G291 2GVBA 3H15A 4JI2L 4Y52H 1PH1A 4UP7A 5AJ3L 3EIVA 1IBLQ 1J5EL 4JI1L 4A4IA 4LF4L 1OXTA 1OXVA 4HJ7A 1N32L 2IY5B 4BY1G 2ID0A 4IPDA 2ALYB 3F1ZA 4BBSH 4KHPL 1IL2A 3EBEA 2OWOA 1CKMA 2GN5A 5LMNL 1Z9FA 4OX9Q 4NXML 4GN5A 2JK8A 4TQUS 3RN2A 4LF5L 4DR6Q 3IRBA 3E9IA 1VQLA 3HOXG 4JBJA 2NVTH 4HIOA 3GTGH 3PO2H 1IXRA 1SR3A 4QJFA 3GDEA 1AE3A 4A3LG 2JA8G 1K8AC 5DLQE 4GKJQ 1EQQA 1L1OB 1SE8A 4A3KG 5IYCH 1Q12A 3I7FA 4YCWA 1ASZA 4XIGS 4JI0L 3M9BA 1HNZQ 1WYDA 1K73C 5M5XH 1CKNB 1PFSA 1C9OA 2N78A 4MNOA 3CP0A 1N34Q 3HOZG 1HZCA 2D0OA 1Y1WH 5FJ8H 2YTXA 1IBLL 1Q1BA 2UUAL 3K80C 2Z6KC 1VQIA 3F2DA 4APVA 4A76A 4RG1A 5FLMH 1Y14B 3EN2A 3PUYA 2D62A 3CC2A 1X55A 1XMQQ 2OTLA 1E1OA 3I56A 4DKAC 1OXUA 1XNRL 1FJGL 4DV6Q 4DUYQ 3W1GA 4LF9L 4DAYB 1VQCA 2R7ZG 1D7QA 5IYDG 3T1YQ 1VQNA 2UXCQ 2AHOB 3KLWA 1UE6A 1KXLA 5ELNA 2CWPA 4DR4Q 4B3TQ 4DNIA 5C4XH 4BY7G 4PZ8A 4X6AH 4BBRG 3DLLA 3CF5A 1HNXQ 2R93H 4OO1G 3B6YA 4BA1I 2F4VQ 4A3GG 2V1CC 4X64L 1JJ2A 3PUWA 3A5UA 4BBSG 4RMFA 2OQ0A 4P75A 3I4OA 1PH6A 5JJIA 3Q8DA 1N34L 1L2FA 4X62Q 2B63H 3CD6A 4JI7L 2NN6I 4JI3L 4UPAA 5IE8A 4KHZA 3KJOA 1KHIA 1GO3E 3HFZB 4EQ5A 3S2DH 4KLKA 1YVCA 1HZAA 2PI2E 4PZ6A 1GD7A 3PO2G 4WJ3M 1KRSA 1NMGA 3CCRA 4DR3L 2UUCQ 1A62A 2NVYH 3S24A 2AWOA 4JI6L 3K81C 2ZM6Q 4NXNL 1EOVA 2ZTEA 4C3IH 1R9TH 5C4JH 3HOUG 4IPGA 3CCMA 2KCMA 1XNQQ 1IBML 2I5HA 3HOXH 3PIPA 3F8TA 3CCUA 3H3VI 4K0KQ 1QUQA 3NBHB 3M85A 4QQBX 2CWAA 3G4SA 1XPRA 2MO1A 5GAEC 5GAGC 3NELA 1VCIA 1J6QA 3STBC 1HNWL 1HNXL 2XTIA 3L7ZC 1GVPA 4DV3L 4WJ4A 4A3KH 3H0GH 4X66L 4A75A 1VQOA 1HR0Q 1CUKA 1B8AA 2Y0SE 4JI2Q 1E1TA 1K83H 2VQEL 3KF8B 3RLNA 5AJ3Q 2E2IH 2YYZA 3U58A 4JI1Q 1J5EQ 4L5SA 4LF8L 4H02A 1WFQA 5FLMG 3F2CA 1V1QA 2DGYA 1SFOH 1VQ6A 1RIPA 4KHPQ 1UEBA 4MZ9A 4X62L 3LGJA 1JE5A 1QVCA 5LMNQ 4LFAL 4NXMQ 3NENA 5HGQA 3HOVG 2QEXA 4YY3L 3J7A5 4LF5Q 1IBKL 1E3PA 1H95A 4JYAL 1SRUA 4JI5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 c;  1VQG A;  2PI2 A;  3ULP A;  1N33 Q;  2WAQ G;  2Z0S A;  1X3F A;  3S17 H;  2ZM6 L;  4DK6 C;  3RZO H;  2JA9 A;  2R93 G;  1YIT A;  3HKZ G;  4NPS A;  5IYD H;  3KDF B;  1LYL A;  3PF4 A;  3UE1 A;  4GNX C;  1VQ9 A;  3ERS X;  2VY3 A;  2A19 A;  4C2M H;  2R6G A;  2K5N A;  4DUZ L;  4GOP C;  4JI0 Q;  2KEN A;  4LFC L;  3K8A A;  1C7Y A;  4BY7 H;  4AIM A;  1V43 A;  4IPC A;  2K4K A;  2WAQ E;  4BBR H;  5IP9 G;  1MJE A;  1W2B A;  2B63 G;  4XTC S;  1BKB A;  2WB1 G;  2HT1 A;  3CCS A;  5IWA L;  2JA7 G;  3HKZ E;  4A3G H;  1X6O A;  2UUA Q;  4ALP A;  1Y1V H;  1OTC A;  2YV5 A;  2MNA A;  5M5Y H;  1LTL A;  1C0A A;  2VS1 A;  3CCV A;  3S14 H;  3CC7 A;  3VDY A;  1KD1 C;  2HIV A;  1EIY B;  1NY4 A;  2IT1 A;  1XNR Q;  1HZB A;  4UY8 C;  1FJG Q;  4LWC A;  2UXD L;  5M3M H;  2ES2 A;  2EIF A;  4P73 A;  2OQK A;  2WB1 E;  4LF9 Q;  1KRT A;  2HQL A;  1NE3 A;  3S1M H;  4GS3 A;  2DUD A;  3OTO L;  4IO9 A;  4LW1 A;  1N33 L;  1M1K C;  5C0X I;  1Q8K A;  4DV4 Q;  2Z6K A;  1VQF A;  3STB D;  3ICE A;  3H0G G;  3HOU H;  1YNX A;  2JE6 I;  4HJ9 A;  3W5O A;  2JJQ A;  3MEF A;  4A3E G;  4YHH Q;  1Q46 A;  1PH4 A;  4X64 Q;  1PH5 A;  3TS2 A;  2AWN A;  5C3E H;  2MO0 A;  3J80 i;  4GNX B;  4B3R L;  1LM0 A;  4DR1 L;  3I2Z A;  2UUB L;  4IFD J;  1CSQ A;  4R4T A;  1X65 A;  2ZTD A;  4GOP B;  4PZ7 A;  3RZD H;  4BXX G;  1A63 A;  3UDI A;  1PA6 A;  4JI7 Q;  2PQA A;  4GN3 B;  1ASY A;  4JI3 Q;  1PVO A;  4POF A;  3A0J A;  5IYB G;  2AKW B;  3J80 c;  2EXD A;  3A5Z B;  2Q2T A;  1FL0 A;  4C3H H;  2JQO A;  4IPH A;  3UDG A;  1XPO A;  3GTK H;  2ZJR A;  4HJ5 A;  2NVQ H;  1Q1E A;  1TWH H;  3CME A;  4DR3 Q;  3E0E A;  4LF7 L;  3HOY H;  3T1H L;  1TWA H;  4JOI C;  1B70 B;  3NEM A;  2Q2H A;  4GLA C;  5JEA G;  5M3F H;  4JI6 Q;  4NXN Q;  2ASB A;  3HOV H;  2GVA A;  2KCT A;  3HOW G;  2OTJ A;  3M4O H;  5BR8 Q;  1Q81 C;  1IBM Q;  3FP9 A;  3CAM A;  1EQR A;  2EQS A;  4IFD G;  1S40 A;  1BVS A;  1XMO L;  4DV4 L;  1YI2 A;  2A1A A;  3L0O A;  1HNW Q;  2CQO A;  3CPF A;  4DV3 Q;  1RL2 A;  4QIW E;  4L5Q A;  4X66 Q;  3RN5 A;  4P74 A;  3K0X A;  4YHH L;  1PH3 A;  2RHS B;  2VQE Q;  3RR5 A;  1VQM A;  1YHA A;  2B29 A;  2E8G A;  4X65 L;  1Y1V G;  1WI5 A;  2E5L L;  3KDF A;  4LF8 Q;  2UXB Q;  2IX1 A;  2F52 A;  4UP9 A;  3KYH C;  1Q7Y C;  1MJC A;  5IP9 H;  5GAD C;  4R4O A;  1U0L A;  2JEA I;  1MIU A;  5M3M G;  3PIO A;  4LFA Q;  2JA7 H;  4DR7 L;  2IHE A;  4YY3 Q;  3ULJ A;  1IBK Q;  4LFB L;  2R92 G;  3K7A H;  4JYA Q;  4JI5 Q;  4YCU A;  1X9N A;  1Q86 C;  4A3B H;  1I94 Q;  2PNH A;  5LMU L;  4YWK A;  3KF6 B;  4GLX A;  1E24 A;  2Y0S G;  2VQF L;  2WP8 J;  4YWM A;  5BR8 L;  4DV1 L;  4DR2 L;  4AQY L;  1N36 Q;  3MXN B;  2R7F A;  1JJC B;  5JJL A;  2NVX H;  1WJJ A;  4DK3 C;  1UE5 A;  3PUV A;  5C3E G;  3BJU A;  1KAW A;  4DV0 L;  1YJW A;  2BA0 A;  3CMA A;  4DUZ Q;  1PV4 A;  1M90 C;  4LFC Q;  1NMF A;  2NZH A;  3A74 A;  4IFD I;  3I55 A;  1QVG A;  1KQS A;  2AMC B;  3J7Z C;  3K7U C;  4UP8 A;  5EAY A;  5IY0 A;  5J3B A;  5IWA Q;  4DV7 L;  4A3E H;  1KC8 C;  1L1O A;  2UU9 L;  3RNU A;  2Q2I A;  5IP7 G;  2UXB L;  1X3E A;  1TWC H;  2VL6 A;  4OO1 I;  1V9P A;  2I5L X;  1I6H H;  4HJ8 A;  1NTG A;  2L15 A;  1JT8 A;  1CKO A;  2ZTC A;  3HOY G;  2VNU D;  3G6E A;  4BXX H;  1CKN A;  5H1S E;  4Y7N H;  5M3F G;  3TRZ A;  2UXD Q;  2VZA A;  2K5H A;  3CQZ H;  1HZ9 A;  2KBN A;  5IYB H;  1MKH A;  3PV0 A;  2OCE A;  1VQB A;  3ZJY C;  1YJ9 A;  2CFM A;  4GKK L;  3I4M H;  3OTO Q;  1FGU A;  1YZ6 A;  4GN4 B;  3PF5 A;  1HJP A;  3J81 i;  2MFI A;  4QGU A;  2PMZ E;  1I94 L;  1JJG A;  4L5T A;  1I5F A;  1P8L A;  3HKS A;  2LSS A;  3E9H A;  1YJN A;  3HOW H;  1N36 L;  4B3M Q;  4O2D A;  4AH6 A;  3GTJ H;  4OWW B;  3J81 c;  5JJK A;  4AYB G;  1PHJ A;  4B3R Q;  3PSI A;  2JEB I;  1X3G A;  1NBW A;  2K5V A;  4DR1 Q;  5K36 G;  2UUB Q;  4R1J A;  3U4Z A;  2Q2U A;  5M5W H;  1S3O A;  2KHJ A;  1XJV A;  1JB7 A;  4JV5 L;  3ULL A;  4A3J G;  5GRO A;  4YWL A;  1YBY A;  1Z47 A;  3CPW A;  3JC6 6;  1GKH A;  4YCV A;  4JCV E;  3FKI H;  4AYB E;  4POG A;  4EX5 A;  1VQA A;  4DV5 L;  3ER0 A;  4A3B G;  1X56 A;  4P71 A;  3PO3 G;  1WCM G;  1IYJ B;  2N49 A;  3BU2 A;  3M4P A;  2I0Q A;  4IOC A;  4LF7 Q;  3T1H Q;  1HR0 W;  1Q82 C;  2K52 A;  2RF4 A;  4JI4 L;  2R92 H;  1UWV A;  4FDB A;  1E22 A;  3AYH B;  1WOC A;  3CXC A;  1QVF A;  4GLV B;  3OYY A;  3PUZ A;  2D0P A;  4QL5 A;  1XMO Q;  2E2H H;  2QGQ A;  4LNQ A;  5LMN W;  4C3J H;  5FLX c;  3S15 H;  4IJL A;  4DV2 L;  4HIK A;  3M4Q A;  2XGT A;  3KF6 A;  4B3M L;  4A3D G;  1TXY A;  5JEA J;  3U50 C;  4A3I G;  2VUM H;  4X65 Q;  2E5L Q;  3PCO B;  4JOI A;  1S72 A;  1A0I A;  4ME3 A;  4A3M H;  1KL9 A;  2HHH L;  3AFQ A;  1N9W A;  2LXJ A;  2RCN A;  4IJH A;  4DR5 L;  1QUQ B;  5C44 G;  4QY7 A;  3I4N G;  3KJP A;  2MQH A;  4HID A;  4JBK A;  1PH7 A;  4DR7 Q;  5IP7 H;  1B7Y B;  5GAH C;  1JMC A;  1NJI C;  4LFB Q;  3RLO A;  1I50 H;  3PGZ A;  4R4Q A;  3I4M G;  4A93 H;  1L0W A;  4JC0 A;  4JI8 L;  2I5M X;  4OWX B;  2A8V A;  5LMU Q;  3GTM H;  2C35 B;  3TRE A;  4LUV A;  4LF6 L;  2VQF Q;  1BBW A;  1EYG A;  3TQY A;  3U4V A;  4DV1 Q;  4DR2 Q;  4AQY Q;  4A3F G;  2NN6 G;  4B3S L;  2BH8 A;  5E7N A;  1VQ5 A;  3CW2 C;  2VW9 A;  1AE2 A;  2HIX A;  3BZK A;  4JG2 A;  4DV0 Q;  4HIM A;  1EFW A;  3KFU A;  4R4I A;  1GM5 A;  4LUZ A;  1SLJ A;  4KI0 A;  4DV7 Q;  2UU9 Q;  2B3G A;  4A3C G;  1A8V A;  1XPU A;  3S1R H;  3FKI G;  3JAM i;  2JA5 H;  2N3S A;  4OX9 L;  2K75 A;  1FVI A;  3F2B A;  1UE1 A;  3S16 H;  4DR6 L;  1TWF H;  2ZJQ A;  1VQJ A;  4A3J H;  4L5R C;  3GD7 A;  2K14 A;  1VQK A;  1YHB A;  2JA6 G;  3G71 A;  3JAM c;  4DAM A;  1VQE A;  1CSP A;  1TWG H;  2YTY A;  4GKK Q;  4DPG A;  4GKJ L;  3BZC A;  3GTQ H;  3PO3 H;  1WCM H;  3UDF A;  4NB3 A;  1W3S A;  1D8L A;  1HH2 P;  2YTV A;  3AFP A;  3D0F A;  4O0A A;  2K50 A;  1PH2 A;  3GTL H;  1BBU A;  3S1Q H;  1HNZ L;  2VUM G;  3OW2 A;  4J15 A;  3WWV A;  3CCE A;  4A3M G;  2WFW A;  1P16 A;  3RLF A;  2E2J H;  1EWI A;  4A3D H;  2IHF A;  1EIF A;  4P72 A;  1I3Q H;  3CCL A;  4JV5 Q;  1X54 A;  4BY1 H;  4A3I H;  5GQO A;  4TVA B;  1XMQ L;  1VS0 A;  3D31 A;  1O7I A;  2KHI A;  5HY6 A;  3CCJ A;  4DV6 L;  2FXQ A;  3DM3 A;  2RHQ B;  4DUY L;  4JBM A;  1YIJ A;  4A93 G;  4DV5 Q;  2IX0 A;  4GNX A;  3SGI A;  3S2H H;  3T1Y L;  2UXC L;  4R4C A;  5C44 H;  4PG3 A;  3I4N H;  1DGS A;  3PUX A;  5IYC G;  2LXK A;  4GOP A;  1OXS C;  3L2P A;  2CKZ B;  3W1B A;  3FHW A;  4DR4 L;  4JBW A;  5C0X J;  1PYB A;  1QZH A;  1E7Z A;  1QZG A;  1K8G A;  4B3T L;  3AEV A;  1SRO A;  1AH9 A;  4JI4 Q;  1LUZ A;  4A3L H;  2JA8 H;  1YEZ A;  2H5X A;  2PQA B;  1G51 A;  2N8N A;  4PMW A;  2ZJP A;  3GTP H;  3S1N H;  1Y1W G;  2F4V L;  5FJ8 G;  2QA4 A;  5ELO A;  3TEH B;  4LUO A;  1PH8 A;  4DV2 Q;  1U5K A;  3UDX A;  1SN8 A;  1XTD A;  4LF4 Q;  4A3F H;  1N32 Q;  1K9M C;  1K3R A;  4HJA A;  1IZ6 A;  1UE7 A;  2JA5 G;  1N8R C;  1T9H A;  3CCQ A;  3M3Y H;  2HHH Q;  3HOZ H;  3CC4 A;  2YU9 H;  4IOA A;  4OWT B;  5C0X G;  3KOJ A;  4DR5 Q;  2NZO A;  1K0R A;  4OON A;  2BA1 A;  1G6P A;  3G48 A;  2R7D A;  1VQ4 A;  4A3C H;  3J81 j;  2UUC L;  2ATW A;  4BA2 I;  5C4X G;  1L1O C;  1OXX K;  3GO5 A;  3UE0 A;  3H3V H;  3AQQ A;  1VQD A;  4JI8 Q;  1PH9 A;  1XNQ L;  2R7Z H;  1KIX A;  1VQ8 A;  4OXP A;  1EUJ A;  4K0K L;  2BH2 A;  4LF6 Q;  4MTN A;  1SMX A;  1VQ7 A;  2JA6 H;  3GTO H;  4B3S Q;  1VQP A;  3M7N A;  1PYS B;  1VQH A;  1YHQ A;  3TS0 A;  2CCZ A;  2F3I A;  1HR0 L;  1G29 1;  2GVB A;  3H15 A;  4JI2 L;  4Y52 H;  1PH1 A;  4UP7 A;  5AJ3 L;  3EIV A;  1IBL Q;  1J5E L;  4JI1 L;  4A4I A;  4LF4 L;  1OXT A;  1OXV A;  4HJ7 A;  1N32 L;  2IY5 B;  4BY1 G;  2ID0 A;  4IPD A;  2ALY B;  3F1Z A;  4BBS H;  4KHP L;  1IL2 A;  3EBE A;  2OWO A;  1CKM A;  2GN5 A;  5LMN L;  1Z9F A;  4OX9 Q;  4NXM L;  4GN5 A;  2JK8 A;  4TQU S;  3RN2 A;  4LF5 L;  4DR6 Q;  3IRB A;  3E9I A;  1VQL A;  3HOX G;  4JBJ A;  2NVT H;  4HIO A;  3GTG H;  3PO2 H;  1IXR A;  1SR3 A;  4QJF A;  3GDE A;  1AE3 A;  4A3L G;  2JA8 G;  1K8A C;  5DLQ E;  4GKJ Q;  1EQQ A;  1L1O B;  1SE8 A;  4A3K G;  5IYC H;  1Q12 A;  3I7F A;  4YCW A;  1ASZ A;  4XIG S;  4JI0 L;  3M9B A;  1HNZ Q;  1WYD A;  1K73 C;  5M5X H;  1CKN B;  1PFS A;  1C9O A;  2N78 A;  4MNO A;  3CP0 A;  1N34 Q;  3HOZ G;  1HZC A;  2D0O A;  1Y1W H;  5FJ8 H;  2YTX A;  1IBL L;  1Q1B A;  2UUA L;  3K80 C;  2Z6K C;  1VQI A;  3F2D A;  4APV A;  4A76 A;  4RG1 A;  5FLM H;  1Y14 B;  3EN2 A;  3PUY A;  2D62 A;  3CC2 A;  1X55 A;  1XMQ Q;  2OTL A;  1E1O A;  3I56 A;  4DKA C;  1OXU A;  1XNR L;  1FJG L;  4DV6 Q;  4DUY Q;  3W1G A;  4LF9 L;  4DAY B;  1VQC A;  2R7Z G;  1D7Q A;  5IYD G;  3T1Y Q;  1VQN A;  2UXC Q;  2AHO B;  3KLW A;  1UE6 A;  1KXL A;  5ELN A;  2CWP A;  4DR4 Q;  4B3T Q;  4DNI A;  5C4X H;  4BY7 G;  4PZ8 A;  4X6A H;  4BBR G;  3DLL A;  3CF5 A;  1HNX Q;  2R93 H;  4OO1 G;  3B6Y A;  4BA1 I;  2F4V Q;  4A3G G;  2V1C C;  4X64 L;  1JJ2 A;  3PUW A;  3A5U A;  4BBS G;  4RMF A;  2OQ0 A;  4P75 A;  3I4O A;  1PH6 A;  5JJI A;  3Q8D A;  1N34 L;  1L2F A;  4X62 Q;  2B63 H;  3CD6 A;  4JI7 L;  2NN6 I;  4JI3 L;  4UPA A;  5IE8 A;  4KHZ A;  3KJO A;  1KHI A;  1GO3 E;  3HFZ B;  4EQ5 A;  3S2D H;  4KLK A;  1YVC A;  1HZA A;  2PI2 E;  4PZ6 A;  1GD7 A;  3PO2 G;  4WJ3 M;  1KRS A;  1NMG A;  3CCR A;  4DR3 L;  2UUC Q;  1A62 A;  2NVY H;  3S24 A;  2AWO A;  4JI6 L;  3K81 C;  2ZM6 Q;  4NXN L;  1EOV A;  2ZTE A;  4C3I H;  1R9T H;  5C4J H;  3HOU G;  4IPG A;  3CCM A;  2KCM A;  1XNQ Q;  1IBM L;  2I5H A;  3HOX H;  3PIP A;  3F8T A;  3CCU A;  3H3V I;  4K0K Q;  1QUQ A;  3NBH B;  3M85 A;  4QQB X;  2CWA A;  3G4S A;  1XPR A;  2MO1 A;  5GAE C;  5GAG C;  3NEL A;  1VCI A;  1J6Q A;  3STB C;  1HNW L;  1HNX L;  2XTI A;  3L7Z C;  1GVP A;  4DV3 L;  4WJ4 A;  4A3K H;  3H0G H;  4X66 L;  4A75 A;  1VQO A;  1HR0 Q;  1CUK A;  1B8A A;  2Y0S E;  4JI2 Q;  1E1T A;  1K83 H;  2VQE L;  3KF8 B;  3RLN A;  5AJ3 Q;  2E2I H;  2YYZ A;  3U58 A;  4JI1 Q;  1J5E Q;  4L5S A;  4LF8 L;  4H02 A;  1WFQ A;  5FLM G;  3F2C A;  1V1Q A;  2DGY A;  1SFO H;  1VQ6 A;  1RIP A;  4KHP Q;  1UEB A;  4MZ9 A;  4X62 L;  3LGJ A;  1JE5 A;  1QVC A;  5LMN Q;  4LFA L;  4NXM Q;  3NEN A;  5HGQ A;  3HOV G;  2QEX A;  4YY3 L;  3J7A 5;  4LF5 Q;  1IBK L;  1E3P A;  1H95 A;  4JYA L;  1SRU A;  4JI5 L; 
#chains in the Genus database with same CATH topology
 5IT9 c;  2PI2 A;  3ULP A;  4G7O C;  5KIX A;  3K5N A;  2EY1 A;  2JA9 A;  1IW7 D;  4PMC A;  5L37 A;  4FF1 A;  5IYD H;  3PF4 A;  4GNX C;  1MD2 D;  1LO5 D;  3BYY B;  4U68 A;  2A19 A;  1D2B A;  4RKB A;  2KEN A;  3TME A;  2EVB A;  4IPC A;  5BN3 A;  1W2B A;  1BKB A;  1PTO C;  2WB1 G;  4A3E B;  1BCP B;  3FPP A;  3VR2 A;  2DNE A;  3S14 H;  4PQX A;  2IT1 A;  3I4N B;  4FXD A;  4RGM A;  4HMI A;  4UY8 C;  1JOR A;  2ES2 A;  4P73 A;  2WB1 E;  4N8X 1;  4GS3 A;  3OTO L;  3Q6S A;  4IO9 A;  5ELD A;  1M1K C;  5C0X I;  1Q8K A;  4QIW B;  1DZ1 A;  2Z6K A;  4OGQ C;  3STB D;  3OIQ A;  3NPP A;  1JWU D;  5DM6 3;  2L12 A;  1ENF A;  4FXK C;  1U4L A;  2OT2 A;  4FF2 A;  3TS2 A;  2MO0 A;  4Z9C B;  1GHJ A;  2UUB L;  4GOP B;  4R4T A;  2ZTD A;  4JI7 Q;  2PQA A;  4JI3 Q;  4CDF C;  3I73 A;  3MTS A;  2KA7 A;  2WKC A;  3A5Z B;  4HCS A;  3O13 A;  3DEO A;  2ZJR A;  4BS9 A;  1HA6 A;  4HJ5 A;  4DR3 Q;  3CME A;  5ELF A;  3T1H L;  1TWA H;  1B70 B;  4GLA C;  3GTO B;  2GVA A;  3HOW G;  2OTJ A;  1D1I A;  3FP9 A;  4B08 A;  2EQS A;  1S40 A;  2K7V A;  1BVS A;  1SNM A;  3F2U A;  4DV4 L;  1FR3 A;  2G5D A;  2K32 A;  1YI2 A;  2IX3 A;  2CQO A;  4L5Q A;  4YHH L;  2VUM B;  3RR5 A;  1VQM A;  1YHA A;  2E8G A;  3KDF A;  4LF8 Q;  1F9P A;  1BCP F;  1MSG A;  1Q7Y C;  5GAD C;  4R4O A;  1U0L A;  2PO4 A;  5FLX E;  3BZD B;  2QDB A;  3ULJ A;  2B2V A;  5COR A;  2R92 G;  5G3L D;  5LMU L;  5T1G A;  4MTK A;  1DON A;  4G57 A;  2VQF L;  1I4P A;  4OHJ A;  4YWM A;  5J22 A;  1H9R A;  2R7F A;  3ZYY X;  5JJL A;  3P7J A;  4OEL B;  4DK3 C;  3J7Y W;  1UE5 A;  1KNE A;  3CHB D;  3D6C A;  3BJU A;  3MAQ A;  4DV0 L;  2BA0 A;  1M90 C;  1SNP A;  1NMF A;  2NZH A;  3FVQ A;  4IFD I;  1KQS A;  1RCV D;  2AMC B;  1BR9 A;  2WIN B;  3J7Z C;  4UP8 A;  1KC8 C;  3GTG H;  2UU9 L;  5IP7 G;  2UXB L;  2JA5 B;  2A69 D;  3CU7 A;  3MXG A;  1CKO A;  2A6H D;  4RCN A;  1LT4 D;  2EY5 A;  5H1S E;  4Y7N H;  1RKN A;  1YJ9 A;  1VQB A;  5C4Z A;  1EYA A;  1TR5 A;  1YZ6 A;  1TU2 B;  1I94 L;  3J81 i;  2MFI A;  3HP3 A;  5EQ0 A;  5IGE A;  5G3L F;  1FGB D;  1U4P A;  1N36 L;  2FIN B;  4FXG C;  4DAY A;  4O2D A;  3MFG A;  3MHB A;  4B3R Q;  1X3G A;  4CGY B;  3NQT A;  2E2J B;  4R1J A;  4K8J A;  5M5W H;  3OIP A;  3IFT A;  2Z9H A;  4JV5 L;  4A3J G;  2CH4 A;  5GRO A;  1YBY A;  3MA2 B;  1AN8 A;  4YCV A;  1A6X A;  1SNQ A;  1VQA A;  4DV5 L;  5C4J B;  1WCM G;  1IYJ B;  2N49 A;  3M4P A;  3QIA A;  1G91 A;  2V4D A;  4MN3 A;  3DHQ A;  2EPB A;  4KJN A;  2RF4 A;  4JI4 L;  3SEB A;  1UWV A;  1LTT D;  1OO9 B;  3OYY A;  4A3K B;  2D0P A;  4QL5 A;  2QGQ A;  1HFG A;  5LMN W;  2RQX A;  4C3J H;  5FLX c;  4DV2 L;  4A3D G;  3KF6 A;  2EDG A;  2F0D A;  4A3I G;  2E5L Q;  1E2W A;  1S72 A;  1ILP A;  4ME3 A;  1KL9 A;  3NBH A;  2RCN A;  4QY7 A;  2DNC A;  2SNS A;  2MQH A;  2Q8R E;  1BDO A;  1PH7 A;  4ZRZ A;  1B7Y B;  5GAH C;  3RZO B;  3RLO A;  1I50 H;  4A93 H;  1L0W A;  2I5M X;  2R7Z B;  2A8V A;  3E0J A;  4EQN A;  4LF6 L;  1CM9 A;  1BBW A;  4AQY Q;  2NN6 G;  4C1N I;  1CA6 A;  1AE2 A;  1EFW A;  4KV6 A;  4HIM A;  1D5M C;  1SLJ A;  4JW0 A;  4DV7 Q;  4A3C G;  3E5S A;  3S1R H;  1A15 A;  4PV1 C;  2M2L A;  1FVI A;  3F2B A;  5K36 H;  4IUV A;  2ZJQ A;  2L5T A;  1VQJ A;  3WDN A;  4L5R C;  2NTT A;  1VQK A;  3ERO A;  3L3O C;  2DJF C;  3SK4 A;  4GKK Q;  4GKJ L;  1IW7 C;  2F0N A;  2AUK A;  1PMR A;  3C46 A;  3SK8 A;  3D0F A;  4O0A A;  1EEI D;  1DD2 A;  2NB0 A;  3OW2 A;  4J15 A;  3WWV A;  3RZD B;  2WFW A;  5CV9 A;  1B3Q A;  1FYC A;  3ITP A;  3RLF A;  1EWI A;  3NK9 A;  2CHB D;  1EIF A;  4P72 A;  3H6M A;  5D3D A;  1X54 A;  2LKV A;  4H0L C;  5GQO A;  4TVA B;  4FVM A;  2NVQ B;  1TWH B;  1O7I A;  2KHI A;  4A93 G;  1O7L A;  2RHQ B;  2F03 A;  2EJG C;  5ELC A;  4JBM A;  3HOV B;  2IX0 A;  2WII B;  2XN9 C;  3EFX D;  3S2H H;  4R4C A;  4I7A A;  3I4N H;  3A54 A;  2PZU A;  1OXS C;  4DR4 L;  1JB3 A;  1CQF A;  1SRO A;  1LUZ A;  1YEZ A;  2H5X A;  2PQA B;  3BG3 A;  3M4Y A;  4PMW A;  2ZJP A;  3S1N H;  1Y1W G;  5ELB A;  5FJ8 G;  3UDX A;  3J81 L;  1XTD A;  4LF4 Q;  2O5J C;  1K9M C;  3L9A X;  1UE7 A;  2WB1 B;  3VR5 A;  2EOT A;  1F2M A;  3CC4 A;  4DR5 Q;  5JJZ A;  2NZO A;  4OON A;  1G6P A;  3A56 A;  4KY7 A;  2UUC L;  2ATW A;  5CYU A;  3E3X A;  4M8A A;  4IUQ A;  1S4Z A;  3J7A F;  3QJY A;  1EY9 A;  1Q3L A;  2KQ3 A;  5TSS A;  3GTO H;  3BDO A;  1GUS A;  2TSS A;  1PYS B;  1VQH A;  3C3L A;  3K57 A;  1G29 1;  2GVB A;  3H15 A;  4Y52 H;  5LHY 1;  3WOE A;  4JI1 L;  1OXT A;  2IY5 B;  2ID0 A;  2SDF A;  4ZAI A;  4BBS H;  1LLR D;  1IL2 A;  1F9S A;  4OX9 Q;  1Z9F A;  3CQZ B;  1AZQ A;  3K58 A;  3FEW X;  3RUZ A;  1AE3 A;  4DN4 M;  2A5H A;  1KNA A;  3HOW B;  1GUO A;  4WJW A;  1VDZ A;  1LT6 D;  1Q12 A;  1ASZ A;  4XIG S;  1JC7 A;  1WYD A;  1PZJ D;  1K73 C;  4HSV A;  3C2P A;  3DUZ A;  4CJ2 C;  2EJF C;  1W6J A;  1Q1B A;  2HUG A;  4APV A;  5FLM H;  3S14 B;  3EN2 A;  1SXT A;  2D62 A;  3CC2 A;  2OTL A;  3HG9 A;  4DKA C;  5A35 A;  5DEH A;  1I4G A;  4RCO A;  4DUY Q;  4DAY B;  2B2W C;  2HQE A;  1NUC A;  1VQC A;  5C0X H;  1VQN A;  2R92 B;  1A2U A;  1EY6 A;  5C3W A;  4MIU A;  1UE6 A;  5IGC A;  4CHT B;  1X3P A;  4TSS A;  5FKA C;  3NHH A;  1IL8 A;  2RA4 A;  4BBR G;  2CQA A;  2R93 H;  4RGO S;  3ND8 A;  2F4V Q;  3VR3 A;  5FK9 C;  3PUW A;  4BBS G;  1TS3 A;  2OQ0 A;  4J8Q A;  4P75 A;  4RGT A;  4X3K A;  3I4O A;  5JJI A;  4DXF A;  1L2F A;  4JI7 L;  2NN6 I;  4JI3 L;  4L8J A;  2PYK A;  4KHZ A;  1B3A A;  3HFZ B;  4NW2 A;  5A2Q E;  1HZA A;  3OWF A;  3CKI B;  4PZ6 A;  4WJ3 M;  4DR3 L;  5E4W C;  3CRL C;  5AFW A;  3MXU A;  2FHT A;  3K81 C;  4DA2 A;  4C3I H;  2EYL A;  2I07 B;  1EL0 A;  5C4J H;  3HOU G;  4IPG A;  2KCM A;  2I5H A;  3J80 E;  1QUQ A;  3NBH B;  4F8M A;  1BNZ A;  4QQB X;  3GQB A;  2MO1 A;  5GAE C;  3NEL A;  1PDQ A;  3K5O A;  4G4K A;  1HNX L;  3L7Z C;  1GVP A;  1C8C A;  4A3K H;  3H0G H;  1HR0 Q;  4JI2 Q;  1L0X B;  1B2T A;  3RLN A;  5AJ3 Q;  1CTM A;  4LF8 L;  1J5E Q;  1SJH D;  1WFQ A;  5FLM G;  2ICI A;  4C3H G;  2DGY A;  3NTH A;  1TWF B;  5LL6 S;  2F0U A;  1QVC A;  4A3J B;  1K3B C;  1V1P A;  3C1F A;  4XXE A;  2F0F A;  1A3U A;  2BDN A;  1TWG B;  2JYO A;  1STN A;  3GTQ B;  1WCM B;  1LTA D;  1SNC A;  2Z1C A;  2Z0S A;  3SVM A;  1N33 Q;  3RZO H;  2ZXP A;  2R93 G;  3IKJ A;  4NPS A;  3S1Q B;  5JVG 3;  4ULL A;  3RMH A;  1CHQ D;  4IFD H;  2R6G A;  2K5N A;  3K8A A;  1YNN D;  1MJE A;  5IGG A;  1SDF A;  5C4H A;  2HT1 A;  3KK7 A;  2M00 A;  4A3I B;  1PZK D;  3OWE B;  4X3T A;  2UUA Q;  1Y1V H;  2R61 A;  2VS1 A;  3CCV A;  1KD1 C;  4ID6 A;  3TP8 A;  1FJG Q;  4IQZ A;  4LWC A;  2OQK A;  3U9S A;  3AB9 A;  4ZLT F;  1STY A;  2CW0 D;  5E4X A;  3BVM A;  1S5D D;  1JWM D;  4K8I A;  4XQN A;  4NP5 A;  3RD4 A;  1B9M A;  2K03 A;  3H0G G;  1YNX A;  3AU7 A;  3OSO A;  5EPK A;  1EIG A;  1PH4 A;  4K14 A;  4B3R L;  4FF4 A;  4ZYS A;  2B2W A;  3I91 A;  1LM0 A;  4R9W A;  1HHV A;  3I2Z A;  4KMU C;  4IFD J;  5M5W B;  3RZD H;  4BXX G;  1SYB A;  1O7Z A;  1SYD A;  4POF A;  3A0J A;  1VMP A;  5IYB G;  2AKW B;  3J80 c;  3UI2 A;  2EXD A;  4IN3 A;  1HUM A;  2Q2T A;  2BDO A;  2IJ0 A;  2JQO A;  4IPH A;  4KKU A;  3GTK H;  3OW7 A;  2NVQ H;  3HOY H;  1TWH H;  2L4N A;  1PFM A;  5M3F H;  3HOV H;  4IFD G;  3T13 A;  5CV8 A;  4DV3 Q;  1RL2 A;  3RN5 A;  3K0X A;  2B29 A;  2E5L L;  1Y1V G;  3A55 A;  2IX1 A;  4C1N K;  3X3M A;  1B53 A;  2BE5 D;  1F9Q A;  1NSN S;  4QMG A;  2JEA I;  1MIU A;  3PIO A;  2NVT B;  1PRT B;  2IHE A;  4YY3 Q;  1PZI D;  1I50 B;  1STA A;  1IBK Q;  4A93 B;  3K7A H;  4JI5 Q;  4QB4 A;  4YCU A;  4A3B H;  2PNH A;  2F0M A;  1CZG A;  4YWK A;  4GLX A;  1E24 A;  1WTP A;  2Y0S G;  1QCB D;  3Q23 A;  1LAC A;  4XYQ A;  5BR8 L;  4AQY L;  1HXY D;  2NVX H;  3W2D A;  5J39 A;  3TP6 A;  1KAW A;  1YJW A;  1Y1W B;  4LFC Q;  4J6H A;  3BYT B;  2A68 D;  1HTP A;  5EAY A;  5J3B A;  5IWA Q;  1JQY D;  3C1E A;  4DV7 L;  1L1O A;  3RNU A;  2Q2I A;  3TSS A;  3R3O A;  1X3E A;  5JVH 3;  1O80 A;  4CDC C;  4HJ8 A;  1QOH A;  2L15 A;  3KLS A;  2ZTC A;  3HOY G;  1ML0 D;  1IYV A;  1EFI D;  3A7A B;  5M3F G;  4M1U B;  2HD3 A;  4FO2 A;  3CQZ H;  3PV0 A;  1VMC A;  2OCE A;  5IT9 L;  1STG A;  1CK1 A;  4GKK L;  3I4M H;  1EWH A;  4U67 3;  2VXW A;  4L5T A;  2XVS A;  1AW7 A;  3HOW H;  1SND A;  4B3M Q;  3BVZ A;  3JAM E;  5JJK A;  5FO9 B;  2SOB A;  4WRD A;  4DR1 Q;  4YIJ A;  1K8M A;  1NR2 A;  1IYU A;  4KTA A;  3G6J B;  3ULL A;  1S5C D;  3K5M A;  1DOL A;  3H3V C;  2KHS A;  1A3V A;  1PRT F;  1STE A;  2NVY B;  3JC6 6;  4POG A;  3T53 B;  3S2H B;  4A3B G;  4P71 A;  2I0Q A;  1DJR D;  2KED A;  4IOC A;  4LF7 Q;  3VR4 A;  3HGB A;  1Q82 C;  2R92 H;  3PQI A;  3AYH B;  3MC0 B;  2RBM A;  3S1N B;  3I3C A;  3PUZ A;  1XMO Q;  2N55 A;  1WD1 A;  5D65 A;  4IJL A;  4HIK A;  1BCP D;  3M4Q A;  1BQQ T;  1SSO A;  4X65 Q;  1LAB A;  3X3N A;  1A0I A;  2RKS A;  3VR6 A;  4A3M H;  1Z6H A;  4DR5 L;  4IJH A;  1QUQ B;  5I9P A;  5C44 G;  3KJP A;  4B9X A;  5IP7 H;  2D5D A;  2EY6 A;  3PGZ A;  3I4M G;  4JC0 A;  2PCF B;  2G9D A;  1LTS D;  2CVR A;  1IKM A;  4N8F A;  4LUV A;  2BOS A;  4C2M B;  3U4V A;  3BVG A;  4A3F G;  1ESR A;  4BBR B;  2HDM A;  1GOZ A;  2VW9 A;  3BZK A;  2HIX A;  4JG2 A;  2FMM A;  5HUR A;  5KYI A;  3SE0 A;  3MVV A;  4O42 A;  4BBS B;  1GM5 A;  3P20 A;  3FMC A;  1ICW A;  2B3G A;  1A8V A;  3BS1 A;  4OX9 L;  2N3S A;  3S16 H;  1TWF H;  4A3J H;  3GD7 A;  1YHB A;  1V1O A;  3JAM c;  4DAM A;  1B44 D;  1MBY A;  1TWG H;  1LTR D;  2YTY A;  3A8J E;  4DPG A;  3BZC A;  2QW7 A;  3GTQ H;  2F3W A;  1IKL A;  1Q90 A;  1WCM H;  2KEC A;  4HMJ A;  3UDF A;  4OIJ A;  3V2T A;  1D8L A;  1HH2 P;  3AFP A;  2K50 A;  5EGT A;  1BBU A;  3S1Q H;  1QNK A;  4A3M G;  4FYD A;  4ABN A;  1B1Z A;  4A3D H;  4C3H B;  2F0V A;  4BY1 H;  4A3I H;  3I70 A;  1VS0 A;  5COY A;  3CCJ A;  1HQM C;  1EU4 A;  3Q22 A;  4DUY L;  2L0C A;  5EBC A;  4GNX A;  4E6I A;  1H9M A;  1CT1 D;  1ILQ A;  1TS5 A;  3L2P A;  4JBW A;  1QZH A;  1E7Z A;  1AH9 A;  4CKE A;  5CGK A;  2JA8 H;  2R93 B;  2F0K A;  2F0Q A;  3GTP H;  5EPL A;  2JSO A;  2F4V L;  3DWA A;  4XQQ A;  1WTQ A;  2Q8T A;  1W6K A;  3AMU A;  2NN6 H;  2HDL A;  1K3R A;  1ET6 A;  1NR4 A;  1T5X D;  2IPK D;  1D1K A;  3DWQ A;  3KLS X;  2HHH Q;  3IFD A;  4OWT B;  2O5I C;  2J0T D;  4NKL A;  1MSH A;  2R7D A;  4EQP A;  4A3C H;  3R2I A;  5C4X G;  4L6T B;  1LT3 D;  1OXX K;  2KCC A;  3GO5 A;  4C3I B;  3KBG A;  2KOL A;  3FPU B;  2A73 B;  4I65 A;  4OXP A;  1VF5 C;  5F2D A;  1A3T A;  2X69 A;  3M7N A;  1YHQ A;  1L0Y B;  3H0G B;  5M9O A;  1HR0 L;  4JI2 L;  5FLX L;  1PH1 A;  4UP7 A;  5AJ3 L;  3EIV A;  2C9O A;  1IBL Q;  1J5E L;  4A4I A;  1QE6 A;  4HN7 A;  1N32 L;  5IGD A;  4ZUI A;  4BY1 G;  3F1Z A;  1SE2 A;  2GN5 A;  4KD3 A;  4UDU C;  3P1H A;  4GN5 A;  4TQU S;  3RN2 A;  2MUY A;  2F0I A;  2RDF A;  1BUV T;  3IRB A;  3E9I A;  4DR6 Q;  4IAL A;  4JBJ A;  2NVT H;  4QUC A;  1R4Q B;  1BXT A;  1IXR A;  2XRQ D;  2O4X A;  2JA8 G;  2H1E A;  1K8A C;  4RA8 A;  1EQQ A;  2XRS D;  1L1O B;  1SE8 A;  3DM1 A;  3GTJ B;  1BO0 A;  1J8I A;  2IWH A;  1HNZ Q;  4N9P A;  4XT1 B;  1PFS A;  1C9O A;  2N78 A;  4ZKC B;  1N34 Q;  1Y1W H;  5FJ8 H;  1Y1V B;  2UUA L;  1VQI A;  4RG1 A;  2RSO A;  1XMQ Q;  1FJG L;  4DNR B;  1YNJ C;  3DEP A;  3FDT A;  1XX8 A;  3QO2 A;  1EY4 A;  5ELN A;  1TQO A;  4B3T Q;  1S5B D;  1DM0 B;  4BY7 G;  2Y0S B;  5D3I B;  3S15 B;  4OO1 G;  2B2T C;  4DAP A;  4A3G G;  5DAU A;  4P2C B;  2RCF A;  2LFN A;  5KRU A;  1EZ8 A;  4CJ0 B;  1PFB A;  3D4W A;  1PH6 A;  1F2Y A;  3Q8D A;  2B63 H;  4X62 Q;  2L11 A;  4JPB W;  3KJO A;  1LT5 D;  4KLK A;  2LS0 1;  3GTK B;  1EEF D;  4KY6 A;  3HOY B;  5IGF A;  3CCR A;  2NVY H;  2PZT A;  5M3F B;  3SHL A;  4X3S A;  3A8I E;  1O78 A;  3F8T A;  3H3V I;  4K0K Q;  3M85 A;  2PNR C;  2L9H A;  2CWA A;  3I72 A;  1XPR A;  2L55 A;  4KN4 C;  3STB C;  1VCI A;  1EWC A;  3K5L A;  4DV3 L;  3VYS A;  4A75 A;  2Q2U A;  1H9J A;  3MZ5 A;  3F2C A;  2TMP A;  1VQ6 A;  4MZ9 A;  5LMN Q;  2QEX A;  4YY3 L;  4KHV A;  3J7A 5;  4LF5 Q;  1FD7 D;  3K7A B;  1E3P A;  1IBK L;  3TP7 A;  1H95 A;  1QIL A;  4JI5 L;  1VQG A;  4A3B B;  4Q5V A;  2EZV A;  1SAP A;  1X3F A;  3BDL A;  1KTK A;  2ZM6 L;  1K28 A;  1ESF A;  3A7L A;  3KDF B;  1LYL A;  2NVX B;  3UE1 A;  2KJX A;  1KLG D;  1VQ9 A;  2VY3 A;  4CDE C;  4C2M H;  4GOP C;  4LFC L;  1WVL A;  1C7Y A;  1V43 A;  4BBR H;  5IP9 G;  2B63 G;  1ZYR D;  5IWA L;  2JA7 G;  1X6O A;  2F0S A;  1OTC A;  1C0A A;  5CMD A;  3VDY A;  1EIY B;  1NY4 A;  1XNR Q;  3OPO A;  1QG7 A;  4LF9 Q;  4DGZ A;  2HQL A;  1KDB A;  1RTN A;  1NE3 A;  1H9K A;  3MXP A;  2FFK B;  2DUD A;  1HTL D;  2F4I A;  2MPM A;  3I4M B;  1U4R A;  1DOK A;  4LW1 A;  3U9O A;  1B9N A;  4O1N A;  1PXU A;  1RHP A;  4DV4 Q;  1VQF A;  4F7X A;  3ICE A;  4QCL A;  3HOU H;  2JE6 I;  2X6G A;  4A3F B;  2JJQ A;  4UHV A;  4A3E G;  3VA5 A;  4YHH Q;  1Q46 A;  4X64 Q;  1PH5 A;  4GNX B;  3J80 i;  3D8G A;  2YU9 B;  4DR1 L;  1KDC A;  1TY0 A;  3UDI A;  1XYI A;  1QWY A;  3OOC A;  1SEB D;  1PTO B;  3DXJ C;  1EQV A;  1KLU D;  2A69 C;  4KK7 A;  4C3H H;  2B2T A;  2GA4 B;  3H91 A;  3PMF A;  2K5W A;  5K5P A;  3UDG A;  2A6H C;  1Q1E A;  1VF7 A;  4LF7 L;  3TP5 A;  4DK1 A;  5JEA G;  3NEM A;  2Q2H A;  5KGU A;  4JI6 Q;  1K0S A;  4DU9 A;  2DY7 A;  4R8N A;  4XDX A;  3TZU A;  1X3Q A;  1EQR A;  3NP8 A;  1XMO L;  1HFN A;  3L0O A;  3CPF A;  4QIW E;  3MEH A;  4X66 Q;  1PH3 A;  2RHS B;  4X65 L;  4KY5 A;  2UXB Q;  4A3M B;  2LY7 A;  4NDX A;  2B8G A;  4UP9 A;  2FJ2 A;  3KYH C;  5ISR A;  2NTS A;  4LFA Q;  1KAB A;  5CR3 A;  4V19 0;  1GUN A;  1RF2 D;  4JYA Q;  1CFM A;  1I94 Q;  2NZ1 D;  1H9S A;  2AQ3 B;  3KF6 B;  4K6L A;  2WP8 J;  5I6W A;  1N36 Q;  4OEM B;  3VYU A;  1JJC B;  5M5X B;  1WJJ A;  2K1B A;  5C3X A;  1FNU A;  1I6V C;  4DUZ Q;  1PV4 A;  1NCV A;  3N52 A;  3A74 A;  2XNA C;  3D4R A;  3I55 A;  1SE4 A;  1QVG A;  3I90 A;  5C6A A;  4HCE A;  5IY0 A;  5KNB A;  5IOD A;  5BN4 A;  4H13 C;  1TWC H;  2VL6 A;  3Q0A A;  1JIC A;  4OO1 I;  1PTO F;  3LWU A;  1R4P B;  5I4D A;  1NTG A;  1JT8 A;  3S16 B;  2VNU D;  3D3R A;  1UUP A;  4BXX H;  1CKN A;  2KUM A;  3TRZ A;  2UXD Q;  2K5H A;  2KBN A;  5IYB H;  5CV6 A;  3ZJY C;  2Z4I A;  5C4X B;  2I46 A;  3PF5 A;  1FGU A;  4GN4 B;  5E1F A;  3NBI A;  1Z7T A;  1I5F A;  3HKS A;  1RDP D;  1Q8I A;  1C48 A;  1YJN A;  2J4X A;  4AH6 A;  3GTJ H;  2B2U C;  5IIF A;  4AYB G;  2M9V A;  3PSI A;  1ENC A;  2HCI A;  1JOO A;  1NBW A;  1S5E D;  4A3D B;  3QOL A;  3S2D B;  1JB7 A;  4BY1 B;  3EQL C;  3LX0 A;  4CJ1 B;  2A74 C;  1Z47 A;  3CPW A;  1GKH A;  1SMY D;  4JCV E;  3FKI H;  4AYB E;  1GUW A;  1R9T B;  1JOQ A;  1TKW B;  3ER0 A;  1X56 A;  3PO3 G;  1I4Q A;  2D9U A;  1MHW C;  3QG1 A;  2JA8 B;  1EYC A;  2EYJ A;  4FDB A;  4CBV A;  1E22 A;  3CXC A;  4DNT B;  1JE4 A;  4GLV B;  3GTP B;  3SK6 A;  4R8I A;  1K83 B;  1LTG D;  1E2V A;  3OMG A;  3S15 H;  2QCP X;  3PIP 3;  5A2Q L;  4G7Z C;  2XGT A;  2E76 C;  4KKS A;  1TXY A;  2Z8L A;  1STB A;  2QIL A;  2F0O A;  1JR0 D;  2HHH L;  3AFQ A;  1N9W A;  2LXJ A;  2NYZ D;  4KN7 C;  5DNF A;  3J80 L;  1PFN A;  4DR7 Q;  4ODG A;  3S17 B;  1CZW A;  4LFB Q;  4R4Q A;  4FP5 D;  2F0L A;  3GTM H;  4XQJ A;  3GP7 A;  4IUT A;  3TRE A;  3G7L A;  1EYG A;  3EVQ A;  4DV1 Q;  4DR2 Q;  4BY7 B;  1SE3 A;  3P75 A;  5E7N A;  5HGT A;  3CW2 C;  3KFU A;  1A2T A;  4A3G B;  3LWE A;  2F0P A;  1D6E C;  1WD0 A;  2KCN A;  2AQ1 B;  4LUZ A;  4KI0 A;  1NAP A;  4DK0 A;  1XPU A;  3FKI G;  3JAM i;  1HPC A;  1UE1 A;  4DR6 L;  1O7Y A;  5CV7 A;  1U9R A;  2FMC A;  4ILW A;  3KBX A;  2JA6 G;  5I9O A;  3G71 A;  3QB3 A;  1VQE A;  1SNO A;  4XT3 B;  2YTV A;  5DM7 3;  1PH2 A;  3GTL H;  1HNZ L;  1BOS A;  2F3V A;  2X6L A;  3MFY A;  4EVO A;  3CCE A;  1PLF A;  5CBE E;  1PRT D;  3HRZ C;  2IHF A;  2PW5 A;  1TVX A;  1XMQ L;  3D31 A;  5HY6 A;  1AZP A;  3TN2 A;  2FXQ A;  3DM3 A;  5JOB A;  3SGI A;  4F87 A;  2B2U A;  5C44 H;  4PG3 A;  5E3F A;  5IYC G;  2LXK A;  2ZXO A;  1SJE D;  5I2X A;  4OIK A;  4B3T L;  1PYB A;  1QZG A;  4ME5 A;  5LL6 X;  3AEV A;  2BCO A;  2E2D C;  4A3L H;  2OEO A;  1HCZ A;  1G51 A;  2N8N A;  2EYO A;  4KD4 A;  3CRK C;  3H94 A;  2JP1 A;  1GUG A;  5ELO A;  4LUO A;  1PH8 A;  1SYF A;  1U5K A;  1SN8 A;  4A3F H;  5EJW A;  1DYQ A;  3KLR A;  2F0G A;  4HJA A;  2B63 B;  1EQT A;  1N8R C;  3CCQ A;  3M3Y H;  3HOZ H;  4HED A;  2YU9 H;  3A8K E;  4Q0F A;  1K0R A;  3E6Z X;  2B2Y C;  2F0T A;  1PTO H;  3ND9 A;  1CHP D;  4BA2 I;  3UE0 A;  4XYO A;  3OMC A;  3H3V H;  4S3S A;  4JI8 Q;  1VQD A;  5FOB B;  1KIX A;  2N88 A;  3I4L A;  1EUJ A;  4K0K L;  4LK1 C;  3MWY W;  4V0B A;  4B3S Q;  2EXZ A;  2VB3 X;  5D14 A;  2XWB B;  3HZX A;  4HJ7 A;  1OXV A;  4LF4 L;  1I6H B;  1MI2 A;  1NNX A;  1H9S B;  2ALY B;  3SDZ A;  3NQI A;  3MXN A;  1CKM A;  5LMN L;  4LF5 L;  1WTX A;  5J1Z A;  5NUC A;  3HOX G;  5JPN C;  4HIO A;  1ONL A;  3PO2 H;  1SR3 A;  4QJF A;  3GDE A;  1ENA A;  4A3L G;  1AEX A;  1CA5 A;  2Q8I B;  1HUN A;  3D4D A;  4HR7 B;  3EJI A;  2C5C A;  3D6W A;  3I7F A;  4YCW A;  1MGS A;  3M9B A;  5M5X H;  1CKN B;  1V1P B;  2Z6B A;  3HOZ G;  3K80 C;  4A76 A;  4ZCK A;  3PUY A;  1X55 A;  1XNR L;  4DV6 Q;  3W1G A;  4LF9 L;  2AUJ D;  5IYD G;  2O2L D;  3NWT A;  3T1Y Q;  2UXC Q;  2K01 A;  2SNM A;  2AHO B;  3JAM L;  1KXL A;  1ICF B;  4DNI A;  2K33 A;  2E2H B;  5C4X H;  3LNN A;  4PZ8 A;  3HOU B;  3CF5 A;  3QR8 A;  1HNX Q;  3OHX C;  2RVL A;  3B6Y A;  3Q24 A;  4F88 A;  4UAI A;  2V1C C;  4X64 L;  1JOK A;  1RD9 D;  1YNN C;  2XWJ B;  3T16 A;  4WOR A;  3CD6 A;  2JN4 A;  3SK5 A;  3QWN A;  1GO3 E;  3S2D H;  1SMY C;  4EQ5 A;  2K5Q A;  4RAU C;  3PO2 G;  1GD7 A;  2J7Z A;  1EY8 A;  4RKL A;  1KRS A;  1Y69 U;  1NMG A;  1A62 A;  3S24 A;  2AWO A;  4JI6 L;  1R9T H;  2K28 A;  1AFP A;  3CCM A;  2CW0 C;  1XNQ Q;  2OF1 A;  1DXM A;  4N9T A;  1J6Q A;  2XTI A;  2B2Y A;  4ZUJ A;  3T4A C;  4WJ4 A;  4X66 L;  5KYL A;  1CUK A;  1B8A A;  1E1T A;  1K83 H;  3S9W A;  1ROD A;  4AYB B;  2E2I H;  3U58 A;  1V1Q A;  1SFO H;  4KHP Q;  1G6Z A;  2SEB D;  3LGJ A;  5CC4 A;  4LFA L;  4NXM Q;  5HGQ A;  3T56 B;  1G2S A;  4HSP A;  4IZ8 A;  5FO7 B;  3IAY A;  2EYF A;  4JYA L;  3J7A V;  4C56 C;  3PO3 B;  3WOF A;  2WAQ G;  3S17 H;  4DK6 C;  1YIT A;  3HKZ G;  4QF4 A;  3NUC A;  3ERS X;  1BF4 A;  4DUZ L;  4JI0 Q;  4BY7 H;  4AIM A;  2K4K A;  2WAQ E;  4HTH A;  3NXW A;  4XTC S;  4OO1 H;  2EYM A;  1I3Q B;  3CCS A;  1STH A;  1J9O A;  1LTI D;  3HKZ E;  4A3G H;  1V8Q A;  1TWC B;  4ALP A;  2YV5 A;  2MNA A;  5M5Y H;  1LTL A;  4CKB A;  2BE5 C;  3CC7 A;  2HIV A;  5T1I A;  1HZB A;  2UXD L;  5M3M H;  2EIF A;  1KRT A;  3S1M H;  1GXD C;  4GZY C;  1N33 L;  4PNY A;  1TII D;  4HJ9 A;  3W5O A;  3MEF A;  2EY2 A;  1KDA A;  2AWN A;  5C3E H;  1HRJ A;  1DCZ A;  2A68 C;  4HAE A;  1WTW A;  1CSQ A;  1PRT C;  1X65 A;  4DF7 A;  2G9H D;  4PZ7 A;  1A63 A;  1PA6 A;  2ICE C;  4JK1 C;  4GN3 B;  2DJG C;  1ASY A;  2PZW A;  1PVO A;  5EKL A;  3FKI B;  3J81 E;  1FL0 A;  1XPO A;  4FF3 A;  2DY8 A;  4J1M A;  3E0E A;  4JOI C;  2ASB A;  4NXN Q;  2JA6 B;  2KCT A;  5CBA E;  3M4O H;  4LJZ C;  5BR8 Q;  1Q81 C;  1IBM Q;  3CAM A;  2A1A A;  2KEE A;  1HNW Q;  2PPB C;  3ONA B;  2QKI C;  3SXH A;  4P74 A;  1U4M A;  2VQE Q;  1WI5 A;  3R93 A;  2F52 A;  1D5Z C;  1MJC A;  5IP9 H;  1B4O A;  4RGN A;  5M3M G;  3FRP B;  3NTK A;  2JA7 H;  4DR7 L;  2VB2 X;  1GJX A;  4TKO B;  2MJ8 A;  4LFB L;  2K05 A;  5EBD A;  1X9N A;  1Q86 C;  3GTM B;  1BBX C;  2KVM A;  2F0J A;  4C3J G;  3R2T A;  4DV1 L;  4DR2 L;  3MXN B;  5JAV A;  1CI3 M;  3PUV A;  5C3E G;  3CMA A;  4KKT A;  3HS0 C;  3N6R A;  1BCP C;  3K7U C;  4A3E H;  1WTO A;  1V9P A;  2I5L X;  2PQE A;  1I6H H;  1Y8P B;  3NSW A;  1C4Q A;  3G6E A;  1G8Z D;  2VZA A;  1HZ9 A;  1MKH A;  1ZKO A;  2RDH A;  2CFM A;  1ET9 A;  3OTO Q;  1HJP A;  1JJG A;  4QGU A;  2PMZ E;  4L63 B;  1EZ6 A;  1QNU A;  4K5V A;  1P8L A;  4DAV A;  2LSS A;  3E9H A;  5JEA H;  3GTL B;  4LAA A;  1SYE A;  4PMB A;  2OXP A;  1TS2 A;  4OWW B;  1ZXT A;  1EU3 A;  3J81 c;  3EA6 A;  1PHJ A;  2JEB I;  3BDC A;  2K5V A;  1T5E A;  5K36 G;  5CV4 A;  3SR1 A;  2UUB Q;  3U4Z A;  1LV9 A;  1S3O A;  1FNV A;  1SBB B;  2KHJ A;  1XJV A;  2EE1 A;  4YWL A;  2EYH A;  3KUP A;  4EX5 A;  5C44 B;  3BU2 A;  3HOX B;  3QOJ A;  3T1H Q;  1HR0 W;  1GUT A;  2LMC B;  3T51 B;  2K52 A;  5KND A;  1WOC A;  1Y8O B;  3VYR A;  1QVF A;  4MHE A;  2E2H H;  4LNQ A;  1AP0 A;  2ZT9 C;  2XSC A;  3I8Z A;  4B3M L;  5JEA J;  2K6A A;  4ZQ3 A;  3U50 C;  1I4R A;  2VUM H;  3PCO B;  4JOI A;  2A6E D;  3M3Y B;  3HOZ B;  3V05 A;  3I4N G;  4HID A;  4JBK A;  1FNW A;  2CH4 W;  1JMC A;  5IOC A;  1NJI C;  1S5F D;  3W3A A;  3KF8 A;  1JWS D;  1GHK A;  4JI8 L;  1M8A A;  4OWX B;  1II3 A;  3R8B A;  5LMU Q;  2C35 B;  1M4V A;  1WTH A;  1XXG A;  1D5X C;  2VQF Q;  3TQY A;  5KNC A;  4B3S L;  2BH8 A;  1F2Z A;  2NBF A;  2MP1 A;  3TZD A;  5I6Y A;  3M7G A;  1VQ5 A;  1RJT A;  5IGB A;  4DV0 Q;  4WFN 3;  1DOM A;  2K5D A;  1PTO D;  4R4I A;  2UU9 Q;  5KEE A;  5ELE A;  4H44 C;  2JA5 H;  2K75 A;  4IUU A;  2DN8 A;  3PO2 B;  2RDG A;  2K14 A;  3VYT A;  1CSP A;  3PO3 H;  4NB3 A;  1W3S A;  4BWG B;  3DWP A;  2VUM G;  2AQ2 B;  4H7B A;  4K5W A;  1P16 A;  2F0E A;  4X3U A;  2E2J H;  4IUR A;  1I3Q H;  3CCL A;  4JV5 Q;  4TRD A;  1SYC A;  4FNF A;  2L1B A;  3TBI B;  4DXG A;  1TWA B;  2XIW A;  4DV6 L;  4K2K A;  1YIJ A;  4DV5 Q;  5I2Y A;  3T1Y L;  2UXC L;  1ZEQ X;  4NMZ A;  1DGS A;  3PUX A;  2NWG A;  4GOP A;  1F77 A;  1SYG A;  2CKZ B;  3W1B A;  3FHW A;  5C0X J;  1K8G A;  2WAQ B;  4JI4 Q;  2P5Z X;  1I4X A;  2B39 A;  3HKZ B;  1QJO A;  2MHV A;  1RTO A;  2QA4 A;  3TEH B;  2EYP A;  4DV2 Q;  1N32 Q;  2E75 C;  4RHR A;  5EPJ A;  1IZ6 A;  2JA5 G;  1T9H A;  4IOA A;  5C0X G;  3KOJ A;  4ZK9 B;  1TT2 A;  2BA1 A;  3G48 A;  1VQ4 A;  3J81 j;  1L1O C;  2MGS A;  2QEJ C;  3K6O A;  3AQQ A;  2PW7 A;  3PIO 3;  1PH9 A;  1E2Z A;  1XNQ L;  2R7Z H;  1VQ8 A;  2BH2 A;  1XTC D;  4LF6 Q;  4MTN A;  1SMX A;  1VQ7 A;  2JA6 H;  4ZKB B;  1VQP A;  1F9R A;  3TS0 A;  2CCZ A;  2WV6 D;  2F3I A;  3GTG B;  1HA5 A;  2E2I B;  1JCK B;  4KJO A;  4IPD A;  1SFO B;  1G2T A;  1E0B A;  2B8F A;  4KHP L;  4RWS C;  4IUP A;  3EBE A;  2OWO A;  4Y7N B;  3TDQ A;  5CV5 A;  4NXM L;  1EOT A;  4C3I G;  2JK8 A;  2R3Z A;  1HQR D;  1KAA A;  5EKK A;  3NWS A;  1VQL A;  2JXM B;  1X32 A;  4EQO A;  3K0Y A;  2QDL A;  5DLQ E;  4GKJ Q;  4A3K G;  2RSN A;  3IL8 A;  1F2L A;  4QUF A;  5IYC H;  3URY A;  3GV3 A;  2K04 A;  5IT9 E;  4JI0 L;  4RH6 A;  5C5M A;  4DFA A;  4MNO A;  1Y8N B;  3CP0 A;  1HZC A;  2D0O A;  2YTX A;  3VA7 A;  1IBL L;  3HEJ A;  2H4O A;  2Z6K C;  5M5Y B;  3F2D A;  1UAP A;  1EIH A;  1Y14 B;  1TS4 A;  1E1O A;  3I56 A;  1OXU A;  5M3M B;  1EYD A;  4K2L A;  4RHS A;  2R7Z G;  3S1M B;  1UNS A;  4K5X A;  1D7Q A;  5C5L A;  1PYW D;  1WTR A;  2WAC A;  3H09 A;  3KLW A;  4EGV A;  5FO8 B;  1K8O A;  2CWP A;  2E74 C;  4DR4 Q;  3DMU A;  4X6A H;  2ZXR A;  3DLL A;  4C3J B;  4G7H C;  1LTB D;  2F0H A;  4BA1 I;  1I4H A;  2IL8 A;  3ERQ A;  5C3E B;  1JJ2 A;  1CQV A;  4I7Z C;  3A5U A;  1IHZ A;  4RMF A;  2Z4H A;  4CDD C;  1EY0 A;  1ZYR C;  1WTV A;  1N34 L;  2IW3 A;  3NTI A;  4LMQ D;  4UPA A;  5IE8 A;  1KHI A;  4K6D A;  2PMZ B;  1YVC A;  2PI2 E;  4JVZ A;  2UUC Q;  2F1M A;  1TY2 A;  2ZM6 Q;  4NXN L;  1EOV A;  2ZTE A;  2HCC A;  3GV6 A;  4IUN A;  3M4O B;  2NUC A;  1IBM L;  1XWE A;  3HOX H;  3PIP A;  3CCU A;  5BN5 A;  1EY5 A;  3G4S A;  3V96 A;  2EJM A;  5GAG C;  1HNW L;  2B2V C;  2D2C C;  2F0W A;  1VQO A;  5EKI A;  2Y0S E;  4B9W A;  4RFB A;  2VQE L;  1UEA B;  3KF8 B;  1QB5 D;  1B50 A;  2YYZ A;  2A6E C;  4JI1 Q;  3S1R B;  4L5S A;  4H02 A;  3K59 A;  2QF7 A;  1RIP A;  1UEB A;  4OL7 A;  4X62 L;  1JE5 A;  4CKC A;  2ENB A;  3NE5 B;  2JA7 B;  3NEN A;  1YNJ D;  2WKD A;  3HOV G;  5JPM C;  1EY7 A;  1SRU A; 
#chains in the Genus database with same CATH homology
 5IT9 c;  1VQG A;  2PI2 A;  3ULP A;  1N33 Q;  2WAQ G;  2Z0S A;  1X3F A;  3S17 H;  2ZM6 L;  4DK6 C;  3RZO H;  2JA9 A;  2R93 G;  1YIT A;  3HKZ G;  4NPS A;  5IYD H;  3KDF B;  1LYL A;  3PF4 A;  3UE1 A;  4GNX C;  1VQ9 A;  3ERS X;  2VY3 A;  2A19 A;  4C2M H;  2R6G A;  2K5N A;  4DUZ L;  4GOP C;  4JI0 Q;  2KEN A;  4LFC L;  3K8A A;  1C7Y A;  4BY7 H;  4AIM A;  1V43 A;  4IPC A;  2K4K A;  2WAQ E;  4BBR H;  5IP9 G;  1MJE A;  1W2B A;  2B63 G;  4XTC S;  1BKB A;  2WB1 G;  2HT1 A;  3CCS A;  5IWA L;  2JA7 G;  3HKZ E;  4A3G H;  1X6O A;  2UUA Q;  4ALP A;  1Y1V H;  1OTC A;  2YV5 A;  2MNA A;  5M5Y H;  1LTL A;  1C0A A;  2VS1 A;  3CCV A;  3S14 H;  3CC7 A;  3VDY A;  1KD1 C;  2HIV A;  1EIY B;  1NY4 A;  2IT1 A;  1XNR Q;  1HZB A;  4UY8 C;  1FJG Q;  4LWC A;  2UXD L;  5M3M H;  2ES2 A;  2EIF A;  4P73 A;  2OQK A;  2WB1 E;  4LF9 Q;  1KRT A;  2HQL A;  1NE3 A;  3S1M H;  4GS3 A;  2DUD A;  3OTO L;  4IO9 A;  4LW1 A;  1N33 L;  1M1K C;  5C0X I;  1Q8K A;  4DV4 Q;  2Z6K A;  1VQF A;  3STB D;  3ICE A;  3H0G G;  3HOU H;  1YNX A;  2JE6 I;  4HJ9 A;  3W5O A;  2JJQ A;  3MEF A;  4A3E G;  4YHH Q;  1Q46 A;  1PH4 A;  4X64 Q;  1PH5 A;  3TS2 A;  2AWN A;  5C3E H;  2MO0 A;  3J80 i;  4GNX B;  4B3R L;  1LM0 A;  4DR1 L;  3I2Z A;  2UUB L;  4IFD J;  1CSQ A;  4R4T A;  1X65 A;  2ZTD A;  4GOP B;  4PZ7 A;  3RZD H;  4BXX G;  1A63 A;  3UDI A;  1PA6 A;  4JI7 Q;  2PQA A;  4GN3 B;  1ASY A;  4JI3 Q;  1PVO A;  4POF A;  3A0J A;  5IYB G;  2AKW B;  3J80 c;  2EXD A;  3A5Z B;  2Q2T A;  1FL0 A;  4C3H H;  2JQO A;  4IPH A;  3UDG A;  1XPO A;  3GTK H;  2ZJR A;  4HJ5 A;  2NVQ H;  1Q1E A;  1TWH H;  3CME A;  4DR3 Q;  3E0E A;  4LF7 L;  3HOY H;  3T1H L;  1TWA H;  4JOI C;  1B70 B;  3NEM A;  2Q2H A;  4GLA C;  5JEA G;  5M3F H;  4JI6 Q;  4NXN Q;  2ASB A;  3HOV H;  2GVA A;  2KCT A;  3HOW G;  2OTJ A;  3M4O H;  5BR8 Q;  1Q81 C;  1IBM Q;  3FP9 A;  3CAM A;  1EQR A;  2EQS A;  4IFD G;  1S40 A;  1BVS A;  1XMO L;  4DV4 L;  1YI2 A;  2A1A A;  3L0O A;  1HNW Q;  2CQO A;  3CPF A;  4DV3 Q;  1RL2 A;  4QIW E;  4L5Q A;  4X66 Q;  3RN5 A;  4P74 A;  3K0X A;  4YHH L;  1PH3 A;  2RHS B;  2VQE Q;  3RR5 A;  1VQM A;  1YHA A;  2B29 A;  2E8G A;  4X65 L;  1Y1V G;  1WI5 A;  2E5L L;  3KDF A;  4LF8 Q;  2UXB Q;  2IX1 A;  2F52 A;  4UP9 A;  3KYH C;  1Q7Y C;  1MJC A;  5IP9 H;  5GAD C;  4R4O A;  1U0L A;  2JEA I;  1MIU A;  5M3M G;  3PIO A;  4LFA Q;  2JA7 H;  4DR7 L;  2IHE A;  4YY3 Q;  3ULJ A;  1IBK Q;  4LFB L;  2R92 G;  3K7A H;  4JYA Q;  4JI5 Q;  4YCU A;  1X9N A;  1Q86 C;  4A3B H;  1I94 Q;  2PNH A;  5LMU L;  4YWK A;  3KF6 B;  4GLX A;  1E24 A;  2Y0S G;  2VQF L;  2WP8 J;  4YWM A;  5BR8 L;  4DV1 L;  4DR2 L;  4AQY L;  1N36 Q;  3MXN B;  2R7F A;  1JJC B;  5JJL A;  2NVX H;  1WJJ A;  4DK3 C;  1UE5 A;  3PUV A;  5C3E G;  3BJU A;  1KAW A;  4DV0 L;  1YJW A;  2BA0 A;  3CMA A;  4DUZ Q;  1PV4 A;  1M90 C;  4LFC Q;  1NMF A;  2NZH A;  3A74 A;  4IFD I;  3I55 A;  1QVG A;  1KQS A;  2AMC B;  3J7Z C;  3K7U C;  4UP8 A;  5EAY A;  5IY0 A;  5J3B A;  5IWA Q;  4DV7 L;  4A3E H;  1KC8 C;  1L1O A;  2UU9 L;  3RNU A;  2Q2I A;  5IP7 G;  2UXB L;  1X3E A;  1TWC H;  2VL6 A;  4OO1 I;  1V9P A;  2I5L X;  1I6H H;  4HJ8 A;  1NTG A;  2L15 A;  1JT8 A;  1CKO A;  2ZTC A;  3HOY G;  2VNU D;  3G6E A;  4BXX H;  1CKN A;  5H1S E;  4Y7N H;  5M3F G;  3TRZ A;  2UXD Q;  2VZA A;  2K5H A;  3CQZ H;  1HZ9 A;  2KBN A;  5IYB H;  1MKH A;  3PV0 A;  2OCE A;  1VQB A;  3ZJY C;  1YJ9 A;  2CFM A;  4GKK L;  3I4M H;  3OTO Q;  1FGU A;  1YZ6 A;  4GN4 B;  3PF5 A;  1HJP A;  3J81 i;  2MFI A;  4QGU A;  2PMZ E;  1I94 L;  1JJG A;  4L5T A;  1I5F A;  1P8L A;  3HKS A;  2LSS A;  3E9H A;  1YJN A;  3HOW H;  1N36 L;  4B3M Q;  4O2D A;  4AH6 A;  3GTJ H;  4OWW B;  3J81 c;  5JJK A;  4AYB G;  1PHJ A;  4B3R Q;  3PSI A;  2JEB I;  1X3G A;  1NBW A;  2K5V A;  4DR1 Q;  5K36 G;  2UUB Q;  4R1J A;  3U4Z A;  2Q2U A;  5M5W H;  1S3O A;  2KHJ A;  1XJV A;  1JB7 A;  4JV5 L;  3ULL A;  4A3J G;  5GRO A;  4YWL A;  1YBY A;  1Z47 A;  3CPW A;  3JC6 6;  1GKH A;  4YCV A;  4JCV E;  3FKI H;  4AYB E;  4POG A;  4EX5 A;  1VQA A;  4DV5 L;  3ER0 A;  4A3B G;  1X56 A;  4P71 A;  3PO3 G;  1WCM G;  1IYJ B;  2N49 A;  3BU2 A;  3M4P A;  2I0Q A;  4IOC A;  4LF7 Q;  3T1H Q;  1HR0 W;  1Q82 C;  2K52 A;  2RF4 A;  4JI4 L;  2R92 H;  1UWV A;  4FDB A;  1E22 A;  3AYH B;  1WOC A;  3CXC A;  1QVF A;  4GLV B;  3OYY A;  3PUZ A;  2D0P A;  4QL5 A;  1XMO Q;  2E2H H;  2QGQ A;  4LNQ A;  5LMN W;  4C3J H;  5FLX c;  3S15 H;  4IJL A;  4DV2 L;  4HIK A;  3M4Q A;  2XGT A;  3KF6 A;  4B3M L;  4A3D G;  1TXY A;  5JEA J;  3U50 C;  4A3I G;  2VUM H;  4X65 Q;  2E5L Q;  3PCO B;  4JOI A;  1S72 A;  1A0I A;  4ME3 A;  4A3M H;  1KL9 A;  2HHH L;  3AFQ A;  1N9W A;  2LXJ A;  2RCN A;  4IJH A;  4DR5 L;  1QUQ B;  5C44 G;  4QY7 A;  3I4N G;  3KJP A;  2MQH A;  4HID A;  4JBK A;  1PH7 A;  4DR7 Q;  5IP7 H;  1B7Y B;  5GAH C;  1JMC A;  1NJI C;  4LFB Q;  3RLO A;  1I50 H;  3PGZ A;  4R4Q A;  3I4M G;  4A93 H;  1L0W A;  4JC0 A;  4JI8 L;  2I5M X;  4OWX B;  2A8V A;  5LMU Q;  3GTM H;  2C35 B;  3TRE A;  4LUV A;  4LF6 L;  2VQF Q;  1BBW A;  1EYG A;  3TQY A;  3U4V A;  4DV1 Q;  4DR2 Q;  4AQY Q;  4A3F G;  2NN6 G;  4B3S L;  2BH8 A;  5E7N A;  1VQ5 A;  3CW2 C;  2VW9 A;  1AE2 A;  2HIX A;  3BZK A;  4JG2 A;  4DV0 Q;  4HIM A;  1EFW A;  3KFU A;  4R4I A;  1GM5 A;  4LUZ A;  1SLJ A;  4KI0 A;  4DV7 Q;  2UU9 Q;  2B3G A;  4A3C G;  1A8V A;  1XPU A;  3S1R H;  3FKI G;  3JAM i;  2JA5 H;  2N3S A;  4OX9 L;  2K75 A;  1FVI A;  3F2B A;  1UE1 A;  3S16 H;  4DR6 L;  1TWF H;  2ZJQ A;  1VQJ A;  4A3J H;  4L5R C;  3GD7 A;  2K14 A;  1VQK A;  1YHB A;  2JA6 G;  3G71 A;  3JAM c;  4DAM A;  1VQE A;  1CSP A;  1TWG H;  2YTY A;  4GKK Q;  4DPG A;  4GKJ L;  3BZC A;  3GTQ H;  3PO3 H;  1WCM H;  3UDF A;  4NB3 A;  1W3S A;  1D8L A;  1HH2 P;  2YTV A;  3AFP A;  3D0F A;  4O0A A;  2K50 A;  1PH2 A;  3GTL H;  1BBU A;  3S1Q H;  1HNZ L;  2VUM G;  3OW2 A;  4J15 A;  3WWV A;  3CCE A;  4A3M G;  2WFW A;  1P16 A;  3RLF A;  2E2J H;  1EWI A;  4A3D H;  2IHF A;  1EIF A;  4P72 A;  1I3Q H;  3CCL A;  4JV5 Q;  1X54 A;  4BY1 H;  4A3I H;  5GQO A;  4TVA B;  1XMQ L;  1VS0 A;  3D31 A;  1O7I A;  2KHI A;  5HY6 A;  3CCJ A;  4DV6 L;  2FXQ A;  3DM3 A;  2RHQ B;  4DUY L;  4JBM A;  1YIJ A;  4A93 G;  4DV5 Q;  2IX0 A;  4GNX A;  3SGI A;  3S2H H;  3T1Y L;  2UXC L;  4R4C A;  5C44 H;  4PG3 A;  3I4N H;  1DGS A;  3PUX A;  5IYC G;  2LXK A;  4GOP A;  1OXS C;  3L2P A;  2CKZ B;  3W1B A;  3FHW A;  4DR4 L;  4JBW A;  5C0X J;  1PYB A;  1QZH A;  1E7Z A;  1QZG A;  1K8G A;  4B3T L;  3AEV A;  1SRO A;  1AH9 A;  4JI4 Q;  1LUZ A;  4A3L H;  2JA8 H;  1YEZ A;  2H5X A;  2PQA B;  1G51 A;  2N8N A;  4PMW A;  2ZJP A;  3GTP H;  3S1N H;  1Y1W G;  2F4V L;  5FJ8 G;  2QA4 A;  5ELO A;  3TEH B;  4LUO A;  1PH8 A;  4DV2 Q;  1U5K A;  3UDX A;  1SN8 A;  1XTD A;  4LF4 Q;  4A3F H;  1N32 Q;  1K9M C;  1K3R A;  4HJA A;  1IZ6 A;  1UE7 A;  2JA5 G;  1N8R C;  1T9H A;  3CCQ A;  3M3Y H;  2HHH Q;  3HOZ H;  3CC4 A;  2YU9 H;  4IOA A;  4OWT B;  5C0X G;  3KOJ A;  4DR5 Q;  2NZO A;  1K0R A;  4OON A;  2BA1 A;  1G6P A;  3G48 A;  2R7D A;  1VQ4 A;  4A3C H;  3J81 j;  2UUC L;  2ATW A;  4BA2 I;  5C4X G;  1L1O C;  1OXX K;  3GO5 A;  3UE0 A;  3H3V H;  3AQQ A;  1VQD A;  4JI8 Q;  1PH9 A;  1XNQ L;  2R7Z H;  1KIX A;  1VQ8 A;  4OXP A;  1EUJ A;  4K0K L;  2BH2 A;  4LF6 Q;  4MTN A;  1SMX A;  1VQ7 A;  2JA6 H;  3GTO H;  4B3S Q;  1VQP A;  3M7N A;  1PYS B;  1VQH A;  1YHQ A;  3TS0 A;  2CCZ A;  2F3I A;  1HR0 L;  1G29 1;  2GVB A;  3H15 A;  4JI2 L;  4Y52 H;  1PH1 A;  4UP7 A;  5AJ3 L;  3EIV A;  1IBL Q;  1J5E L;  4JI1 L;  4A4I A;  4LF4 L;  1OXT A;  1OXV A;  4HJ7 A;  1N32 L;  2IY5 B;  4BY1 G;  2ID0 A;  4IPD A;  2ALY B;  3F1Z A;  4BBS H;  4KHP L;  1IL2 A;  3EBE A;  2OWO A;  1CKM A;  2GN5 A;  5LMN L;  1Z9F A;  4OX9 Q;  4NXM L;  4GN5 A;  2JK8 A;  4TQU S;  3RN2 A;  4LF5 L;  4DR6 Q;  3IRB A;  3E9I A;  1VQL A;  3HOX G;  4JBJ A;  2NVT H;  4HIO A;  3GTG H;  3PO2 H;  1IXR A;  1SR3 A;  4QJF A;  3GDE A;  1AE3 A;  4A3L G;  2JA8 G;  1K8A C;  5DLQ E;  4GKJ Q;  1EQQ A;  1L1O B;  1SE8 A;  4A3K G;  5IYC H;  1Q12 A;  3I7F A;  4YCW A;  1ASZ A;  4XIG S;  4JI0 L;  3M9B A;  1HNZ Q;  1WYD A;  1K73 C;  5M5X H;  1CKN B;  1PFS A;  1C9O A;  2N78 A;  4MNO A;  3CP0 A;  1N34 Q;  3HOZ G;  1HZC A;  2D0O A;  1Y1W H;  5FJ8 H;  2YTX A;  1IBL L;  1Q1B A;  2UUA L;  3K80 C;  2Z6K C;  1VQI A;  3F2D A;  4APV A;  4A76 A;  4RG1 A;  5FLM H;  1Y14 B;  3EN2 A;  3PUY A;  2D62 A;  3CC2 A;  1X55 A;  1XMQ Q;  2OTL A;  1E1O A;  3I56 A;  4DKA C;  1OXU A;  1XNR L;  1FJG L;  4DV6 Q;  4DUY Q;  3W1G A;  4LF9 L;  4DAY B;  1VQC A;  2R7Z G;  1D7Q A;  5IYD G;  3T1Y Q;  1VQN A;  2UXC Q;  2AHO B;  3KLW A;  1UE6 A;  1KXL A;  5ELN A;  2CWP A;  4DR4 Q;  4B3T Q;  4DNI A;  5C4X H;  4BY7 G;  4PZ8 A;  4X6A H;  4BBR G;  3DLL A;  3CF5 A;  1HNX Q;  2R93 H;  4OO1 G;  3B6Y A;  4BA1 I;  2F4V Q;  4A3G G;  2V1C C;  4X64 L;  1JJ2 A;  3PUW A;  3A5U A;  4BBS G;  4RMF A;  2OQ0 A;  4P75 A;  3I4O A;  1PH6 A;  5JJI A;  3Q8D A;  1N34 L;  1L2F A;  4X62 Q;  2B63 H;  3CD6 A;  4JI7 L;  2NN6 I;  4JI3 L;  4UPA A;  5IE8 A;  4KHZ A;  3KJO A;  1KHI A;  1GO3 E;  3HFZ B;  4EQ5 A;  3S2D H;  4KLK A;  1YVC A;  1HZA A;  2PI2 E;  4PZ6 A;  1GD7 A;  3PO2 G;  4WJ3 M;  1KRS A;  1NMG A;  3CCR A;  4DR3 L;  2UUC Q;  1A62 A;  2NVY H;  3S24 A;  2AWO A;  4JI6 L;  3K81 C;  2ZM6 Q;  4NXN L;  1EOV A;  2ZTE A;  4C3I H;  1R9T H;  5C4J H;  3HOU G;  4IPG A;  3CCM A;  2KCM A;  1XNQ Q;  1IBM L;  2I5H A;  3HOX H;  3PIP A;  3F8T A;  3CCU A;  3H3V I;  4K0K Q;  1QUQ A;  3NBH B;  3M85 A;  4QQB X;  2CWA A;  3G4S A;  1XPR A;  2MO1 A;  5GAE C;  5GAG C;  3NEL A;  1VCI A;  1J6Q A;  3STB C;  1HNW L;  1HNX L;  2XTI A;  3L7Z C;  1GVP A;  4DV3 L;  4WJ4 A;  4A3K H;  3H0G H;  4X66 L;  4A75 A;  1VQO A;  1HR0 Q;  1CUK A;  1B8A A;  2Y0S E;  4JI2 Q;  1E1T A;  1K83 H;  2VQE L;  3KF8 B;  3RLN A;  5AJ3 Q;  2E2I H;  2YYZ A;  3U58 A;  4JI1 Q;  1J5E Q;  4L5S A;  4LF8 L;  4H02 A;  1WFQ A;  5FLM G;  3F2C A;  1V1Q A;  2DGY A;  1SFO H;  1VQ6 A;  1RIP A;  4KHP Q;  1UEB A;  4MZ9 A;  4X62 L;  3LGJ A;  1JE5 A;  1QVC A;  5LMN Q;  4LFA L;  4NXM Q;  3NEN A;  5HGQ A;  3HOV G;  2QEX A;  4YY3 L;  3J7A 5;  4LF5 Q;  1IBK L;  1E3P A;  1H95 A;  4JYA L;  1SRU A;  4JI5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...