4R4CA

Structure of rpa70n in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)methyl)phenyl)-1-(3,4-dichlorophenyl)-1h-pyrazole-3-carboxylic acid
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
123
structure length
123
Chain Sequence
b'GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFMLATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVPYNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Replication protein A 70 kDa DNA-binding subunit
molecule tags Protein binding
source organism Homo sapiens
publication title Diphenylpyrazoles as replication protein a inhibitors.
pubmed doi rcsb
total genus 30
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2014-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04057 Rep-A_N Replication factor-A protein 1, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4r4cA00
3RN5A 4HJ8A 5GROA 3EIVA 5C44G 1I5FA 4GLXA 1N34Q 1G291 2LSSA 1XNQQ 3FKIH 2E8GA 2IHFA 3F8TA 1H95A 5LMNW 1BVSA 4GLVB 2NVYH 4X6AH 5IP9G 2A19A 5M5XH 4C3JH 4A3LH 1TWCH 4MNOA 3TS0A 1YIJA 1I94L 4B3ML 1PH4A 1UEBA 4DV6Q 2UUCL 1VQ7A 1YJNA 1P16A 3DLLA 1SN8A 2D0PA 1VQCA 3PGZA 2AHOB 2E2IH 4DR1L 4GNXC 1W2BA 4GOPC 4LFBL 3HOXG 4JG2A 2H5XA 3ULLA 3CC4A 3E9HA 4A4IA 4BBRH 4YY3L 3I56A 3S16H 5M3FH 4L5RC 4GKJQ 4DR6L 2N8NA 1CKOA 2ZTDA 1X9NA 4DV1Q 4XIGS 2I0QA 4YHHL 1TWAH 4BA1I 4NXNL 1JMCA 4LF4Q 1E22A 3I4NG 4A75A 1Q1BA 1TWGH 1XMOQ 5JJLA 4GKKL 2JA7G 5FJ8H 3E9IA 1WJJA 4A3EG 2RF4A 2Y0SG 2A1AA 4JOIC 3GTKH 2CFMA 4DR2L 5BR8Q 3CCSA 1YNXA 2UXCQ 4UPAA 2JJQA 1VQHA 3S24A 4LF6L 4JI8L 4X62Q 4LFAQ 5IE8A 1PH9A 3ULJA 1M90C 1HNXQ 3PUYA 4OXPA 5K36G 4IFDI 1GVPA 1PHJA 4AIMA 2E2JH 2Q2TA 2E2HH 3PUXA 3HOYG 3KLWA 3CXCA 2RHSB 1XPRA 1E24A 1VQJA 3CC2A 2JA7H 1VQ4A 2UXBL 2MFIA 2UUAL 2BH2A 3I7FA 4JI5L 1KRTA 3CCVA 5JJKA 2D62A 4DR7Q 1IBKQ 4BBSH 4LWCA 5LMUL 1OXUA 3CF5A 1LTLA 4DUYQ 1EYGA 3GDEA 2BH8A 2Y0SE 1HR0L 1A62A 2KENA 3M9BA 5IWAL 2VUMH 3ERSX 2PQAA 3HOWH 1S72A 4IJLA 4YWKA 1Q81C 3AQQA 4L5SA 1AH9A 3HOYH 4LF5L 3AEVA 1HZBA 1X3GA 3NBHB 1YBYA 4DV0Q 2ZJRA 4LF6Q 2JA5G 2UXDQ 3PO3H 3EN2A 2KHIA 1N33Q 3K0XA 1HZ9A 3H3VI 1WOCA 1Y1WH 1Y1WG 3I4MG 3I4MH 4DV2Q 4A3DH 3GTGH 3W5OA 1Q86C 2UUBL 2V1CC 1B8AA 2F3IA 4LF4L 4NXNQ 4JYAL 1YHQA 4YHHQ 4DV4Q 4JI1L 1DGSA 4BY7G 1VQ5A 3KDFB 3TRZA 1KC8C 1BKBA 1VQKA 2B63H 4GKJL 3CCRA 2NZHA 4POFA 3PO2H 2OTLA 3CAMA 1C0AA 2VNUD 3BJUA 4C3HH 4X64Q 4APVA 4DV7L 1UE1A 4JOIA 2EXDA 5ELOA 4B3TL 4P74A 3VDYA 2JEBI 1PH8A 5GAHC 2K5VA 4YCUA 5ELNA 3J7A5 3M85A 1KL9A 1Q46A 5C0XG 1HR0Q 2IX0A 2B63G 2LXKA 2CQOA 4JI2Q 2GN5A 3CCQA 2NVTH 1PH5A 5LMUQ 3UDIA 4A3CG 2JA9A 5IP9H 1SR3A 4OX9Q 3CQZH 2HIVA 2VQEL 3BZKA 2E5LQ 5FLMH 1YJ9A 4R4CA 4DV4L 1E7ZA 4HIMA 4LF9L 2HT1A 2R92G 2NVXH 1G51A 2OQ0A 2PNHA 1C9OA 3J81i 4PZ6A 5FJ8G 1KIXA 4A3EH 3WWVA 4YWMA 4OWWB 2HHHQ 3KF6A 4DKAC 3AYHB 2QGQA 1EIFA 1RL2A 4C3IH 3KJPA 2VQFL 4DV2L 2Z6KC 1HR0W 5GAEC 3G4SA 1V9PA 5C3EG 1WCMH 5IP7G 1L0WA 1RIPA 2UXDL 2VZAA 3AFQA 3CW2C 3ER0A 3J80i 5LMNQ 1C7YA 2D0OA 1QUQA 3RN2A 5IYBG 1FJGQ 3OTOQ 4LF9Q 1VQ6A 2JEAI 3GTOH 1XTDA 2BA0A 2L15A 3I2ZA 4GN4B 1XJVA 4B3SQ 1XNRL 1VQMA 3U4ZA 1K0RA 3S1MH 5C3EH 4RG1A 4DUYL 4A76A 3HOZG 2JE6I 1VQ9A 3NELA 2R6GA 3PIPA 1CKNB 2N78A 1AE2A 3W1BA 4A3LG 3HKSA 2UXBQ 1LYLA 4JI4L 3CCMA 3S2DH 3T1YQ 3LGJA 4DV5L 1N36Q 1MJEA 2ATWA 4YCVA 1VS0A 2N3SA 1D8LA 3HOVG 3M4QA 4R4OA 2OCEA 3S15H 4LF8Q 4X62L 4PZ8A 2XGTA 2VL6A 4B3RL 4O2DA 4JI3L 4POGA 1PH1A 3KF8B 4DR2Q 1SROA 3HOWG 1IBML 4A3KG 1EQRA 1VQ8A 5EAYA 2KBNA 4DPGA 4DNIA 5FLXc 4JYAQ 4X65L 2YTXA 4P73A 1N8RC 1HNWQ 5GQOA 1E1TA 3PUVA 2UUBQ 2R92H 2RHQB 4KHPQ 4JI6Q 4IPCA 4DR3Q 1NMGA 4LW1A 2ASBA 4DR6Q 3TREA 1JJCB 1Y1VH 3H0GG 2YTVA 4A3GG 3TQYA 1HJPA 3AFPA 3PO2G 2QEXA 3W1GA 4P75A 1NBWA 2B29A 2R7DA 2WB1G 2N49A 2RCNA 1VQEA 4R1JA 4QJFA 1BBUA 1OXTA 2IT1A 4QY7A 1N32Q 4GNXA 2Z6KA 2PI2A 4L5QA 1OXXK 4R4QA 4B3MQ 3BZCA 1K3RA 5IYBH 4OONA 1NY4A 2ZJPA 4JI4Q 1FGUA 4DR5L 3ULPA 3A0JA 1QZHA 1J5EL 4JI7Q 1A8VA 1JT8A 1X55A 4UY8C 2IX1A 3S2HH 5IY0A 3D0FA 1L1OC 1B7YB 2EQSA 3JAMc 1GM5A 4DAMA 3RLOA 4A3JG 1N34L 4GOPB 3S1QH 4B3SL 2UUAQ 1X56A 1GKHA 1YHAA 4X66Q 3K8AA 3S1RH 1EOVA 3K7UC 3M7NA 5IYCG 2CWAA 4JI8Q 1TWHH 1HH2P 1YVCA 3ZJYC 5BR8L 2MQHA 2JA8G 3HOUH 2JA5H 3HOZH 4PZ7A 3HKZG 5HY6A 1YITA 3FP9A 4PG3A 3TEHB 2WFWA 4JI6L 2VY3A 4OO1G 2AMCB 4GKKQ 1LM0A 4HIDA 2B3GA 4EX5A 4XTCS 1L1OA 1XMOL 2ZTCA 3OW2A 1MIUA 4X65Q 4GNXB 5DLQE 1Q7YC 2BA1A 5C44H 1SFOH 1JJGA 4NXML 1HNZL 2YTYA 1I6HH 2DUDA 1ASYA 4GS3A 2A8VA 5J3BA 4UP9A 2NVQH 3RNUA 1VCIA 4P71A 1NE3A 1CUKA 1YHBA 3CCLA 1N9WA 1IL2A 3MEFA 1VQLA 2CKZB 3PV0A 1EIYB 2R93G 3JAMi 1I94Q 3HOVH 4JBJA 4B3TQ 3M3YH 4QIWE 1U0LA 3CP0A 3CMEA 4BY7H 1NMFA 4X64L 3F1ZA 3K7AH 1NJIC 3CMAA 3UE0A 2WB1E 3E0EA 5HGQA 3PSIA 3G71A 4A3BG 1QVGA 4NXMQ 1BBWA 4DR4L 4JI1Q 2XTIA 3CPWA 2ID0A 2R93H 3J7ZC 2LXJA 4KHPL 1HZAA 2F4VQ 1YZ6A 3I4NH 1NTGA 4C2MH 5GAGC 1QUQB 3K81C 1Y1VG 1L1OB 3RZDH 3TS2A 2WAQG 4BXXG 1VQBA 1GO3E 2R7ZG 1YJWA 1N33L 4IOCA 3KF6B 3RLNA 2MNAA 4JI3Q 3M4OH 4KLKA 4QGUA 5AJ3Q 3T1HQ 2VQFQ 2I5LX 2KHJA 4BY1G 2VUMG 3DM3A 1KRSA 2OWOA 1AE3A 4LF5Q 3PUZA 4IPGA 4DV5Q 2Z0SA 2Q2HA 3CC7A 1N36L 1PYSB 4LF7Q 4YCWA 2VQEQ 1W3SA 4LUZA 1XPOA 4BA2I 1PH2A 4IFDJ 1PH7A 1IXRA 1O7IA 3GTMH 2EIFA 5E7NA 1WYDA 3GTPH 5JJIA 2PQAB 2JA6H 2UU9L 4L5TA 2K14A 2ES2A 1FJGL 3S1NH 4IPHA 1R9TH 4HJ5A 1OXVA 4HJ7A 3PF5A 4PMWA 4HIKA 1HNXL 4Y52H 5AJ3L 2HQLA 1IBLL 2FXQA 4MTNA 1SMXA 3KDFA 1FL0A 2DGYA 3H15A 3GD7A 1CKNA 4A3BH 3IRBA 4KI0A 3F2DA 2MO0A 4ME3A 1WI5A 5M3FG 4DR3L 1E1OA 3UDFA 4A3KH 5M3MH 3F2CA 2PMZE 3KJOA 4LUVA 2KCTA 1TXYA 2NN6I 1IYJB 2AWNA 2ZJQA 1TWFH 4DV1L 2C35B 3L0OA 2YU9H 4DR4Q 1FVIA 2GVBA 4NPSA 5JEAJ 1XMQQ 2I5MX 3STBD 4YY3Q 2ALYB 1OXSC 4LFBQ 3F2BA 1EWIA 4B3RQ 1Q82C 3SGIA 4A3CH 4LNQA 3OYYA 3K80C 3M4PA 3A5UA 1VQPA 1K9MC 1K8GA 4A3DG 2HIXA 2UUCQ 2F52A 3T1YL 1PFSA 4P72A 4TVAB 4GN5A 1JJ2A 4GN3B 2Q2IA 1L2FA 5IWAQ 4RMFA 5GADC 3GO5A 2VS1A 3B6YA 1PV4A 4MZ9A 2PI2E 4R4TA 3KFUA 5C4XG 1EUJA 1T9HA 3U4VA 4A93G 3UE1A 4ALPA 2JA8H 4AQYQ 1KXLA 4O0AA 4JI5Q 5IYDH 3EBEA 1Z47A 3HFZB 3MXNB 1U5KA 4AH6A 5M5WH 4JCVE 1X54A 1KHIA 3GTQH 2GVAA 4A3IH 5IT9c 2QA4A 3H3VH 2WP8J 5C0XJ 4WJ3M 4OWTB 1P8LA 5LMNL 3J80c 4LFAL 3JC66 4AYBE 5C4XH 4BXXH 2UXCL 1Q12A 4DV3L 1VQNA 4A3FG 3HOUG 2K50A 5IP7H 2WAQE 1IBLQ 4JV5L 3GTJH 1V1QA 3GTLH 2K5NA 3L7ZC 4DV0L 1PA6A 1PH3A 3HKZE 4OWXB 4K0KQ 1K8AC 1VQOA 2JQOA 3D31A 3L2PA 2R7FA 1S40A 2UU9Q 4A3MG 3KYHC 4A3MH 2YV5A 3I55A 1KQSA 2AKWB 3CCEA 2E5LL 1M1KC 4OX9L 1K73C 4AQYL 4DK3C 3BU2A 3NENA 3UDXA 4JI0L 4A3FH 3PO3G 3STBC 2ZTEA 1OTCA 1PYBA 1UWVA 4JI2L 4QQBX 1PVOA 2NZOA 4UP7A 1ASZA 4DR7L 4DR5Q 4LF7L 1SE8A 3CPFA 4R4IA 2K4KA 4EQ5A 1PH6A 2MO1A 1YI2A 4OO1I 3U50C 1G6PA 1V43A 2CWPA 2YYZA 4DAYB 3PF4A 4DUZQ 2Q2UA 4DV7Q 1CKMA 1QVCA 3G6EA 3CCJA 1IZ6A 1VQFA 1I3QH 1N32L 1UE7A 4LUOA 3S14H 4QL5A 3J81c 1X3EA 3H0GH 4A3GH 1HNZQ 1XMQL 3I4OA 5C4JH 4Y7NH 1MJCA 1B70B 1A0IA 1X65A 4WJ4A 2JA6G 3KOJA 4TQUS 5FLMG 3U58A 1UE5A 4GLAC 3G48A 1YEZA 2NN6G 1CSQA 3S17H 1CSPA 2JK8A 4IPDA 1IBMQ 1K83H 1EFWA 4JBMA 4HJAA 1X6OA 1WFQA 2K52A 4BBRG 2IY5B 1VQAA 4DR1Q 1MKHA 2IHEA 4A3JH 4LF8L 4BY1H 1UE6A 2OTJA 2VW9A 1X3FA 1EQQA 4IFDG 2K75A 4DUZL 1Q8KA 4DV6L 1J6QA 2OQKA 4X66L 4NB3A 4GOPA 3PCOB 4LFCQ 3ICEA 2KCMA 5JEAG 1SRUA 1VQIA 1QZGA 1Z9FA 4BBSG 4KHZA 3PUWA 4JBKA 2R7ZH 3HOXH 3Q8DA 4A93H 1VQDA 1D7QA 2AWOA 4JI0Q 1Y14B 1XPUA 1IBKL 1XNQL 4J15A 1HZCA 3NEMA 4JI7L 1J5EQ 1XNRQ 3PIOA 3UDGA 3RZOH 4JBWA 5C0XI 1E3PA 4LFCL 1VQGA 4IJHA 4AYBG 1KAWA 3OTOL 3CCUA 1KD1C 3RLFA 3A5ZB 1GD7A 5M3MG 4JC0A 2ZM6L 4A3IG 2CCZA 1QVFA 4K0KL 4HIOA 3CD6A 5IYCH 2I5HA 4FDBA 4IO9A 3T1HL 5H1SE 4IOAA 1S3OA 4JV5Q 5M5YH 1LUZA 2K5HA 3FHWA 1WCMG 3A74A 3FKIG 4DV3Q 5IYDG 4H02A 1JB7A 1A63A 2HHHL 1JE5A 4UP8A 4YWLA 3RR5A 4DK6C 1SLJA 4HJ9A 1Q1EA 1HNWL 2ZM6Q 3J81j 1I50H 2F4VL
chains in the Genus database with same CATH superfamily
3Q23A 3RN5A 4HJ8A 1HRJA 4RAUC 3FRPB 5C44G 5M3FB 4FF2A 4GLVB 1SFOB 3VR5A 1WCMB 2EJGC 2A19A 5DAUA 1YNJD 1D5ZC 1UNSA 4MNOA 1CTMA 1I94L 1YIJA 5CORA 4DV6Q 4DAPA 1TS4A 2L4NA 1P16A 4F7XA 3K59A 2DN8A 1KDCA 3MA2B 1W2BA 4LFBL 3HOXG 4HAEA 4KJOA 4BBRH 3I56A 1BO0A 4DR6L 2CHBD 5G3LD 4CBVA 1E22A 3I4NG 1Q1BA 1TWGH 1EWHA 1A2TA 4GKKL 4HCEA 1TKWB 4DR2L 5BR8Q 3CCSA 2E2IB 3S24A 3MXPA 1BCPC 5IE8A 1PH9A 1AZPA 3GTOB 2EDGA 1D1KA 3PUYA 3GTKB 1EZ6A 1EL0A 2E2JH 2B2YC 3KLWA 1VQ4A 4RCNA 2UXBL 3I7FA 3CCVA 2L55A 3CF5A 3NBIA 4Q5VA 1ENCA 3HOWH 3NP8A 4L5SA 5C3WA 3AEVA 2F0TA 3NBHB 1FYCA 4BS9A 4DV0Q 5KIXA 4K2LA 2QCPX 2JA5G 1EYAA 1GUSA 1KLUD 3K0XA 3TBIB 4ABNA 4ZLTF 2L9HA 1IW7D 1NR4A 1IHZA 2V1CC 3CU7A 4KKSA 4YHHQ 4BY7G 1JICA 3OWEB 1IL8A 1JOOA 4QMGA 2SNMA 1C0AA 3PO2H 2SNSA 3BJUA 5C3EB 4RGOS 2WKCA 2X6GA 4X64Q 1UE1A 4JOIA 1ICFB 2JEBI 1LT3D 4YCUA 1R4PB 4RGTA 5I9PA 5FLXE 3J7A5 1WTOA 3HG9A 1Q46A 3EJIA 5E3FA 5C0XG 4U673 4HSVA 1IKMA 2GN5A 3CCQA 4HMJA 4EQOA 1ZYRC 1EZ8A 2E5LQ 5FLMH 4R4CA 4DV4L 4HIMA 1JCKB 4LF9L 2HT1A 1VF5C 2EY6A 2OQ0A 4CDDC 3J81i 2HCIA 4PZ6A 5FJ8G 4YWMA 3ND8A 1EIFA 2PZTA 2VUMB 1STGA 2NVYB 1V9PA 1WCMH 1SE4A 3J7AV 5I4DA 2VZAA 4PMCA 1C7YA 1DONA 3OHXC 3M4YA 5KRUA 1VQ6A 3QJYA 1B3AA 2JEAI 2BA0A 1MD2D 1XJVA 1XNRL 2CH4A 3U4ZA 1LABA 3QB3A 5C3EH 5CYUA 4DUYL 1F2LA 5D14A 5ELDA 3OW7A 2R6GA 5DEHA 2N78A 1AE2A 2J7ZA 3RD4A 3HKSA 1LYLA 4JI4L 3CCMA 1KNAA 4JK1C 1B3QA 1MJEA 3GTMB 3DWPA 2JSOA 4YCVA 2JXMB 1VS0A 3M4QA 4X62L 2XGTA 4O2DA 1PH1A 3S1MB 4CGYB 2DNCA 3W3AA 1SJHD 3NXWA 4FXDA 2Z9HA 3D3RA 1BF4A 4DNIA 4JYAQ 3MTSA 5ELFA 1PMRA 1HNWQ 3PMFA 1GHKA 3PUVA 1DXMA 2UUBQ 2NN6H 2RQXA 2RHQB 2XIWA 2X69A 1NMGA 4LW1A 4H44C 1JJCB 1Y1VH 4BY1B 4A3GG 2MGSA 3PO2G 1Y69U 1TS5A 2QEXA 4P75A 2B29A 2WB1G 3FKIB 4GNXA 2WAQB 2Z6KA 4L5QA 1OXXK 4B3MQ 2JP1A 1FGUA 1J5EL 3HOZB 1D5MC 3OPOA 2BDNA 5JOBA 1ZYRD 4OGQC 4KV6A 1L1OC 2EQSA 3JAMc 1BBXC 3VA7A 2C9OA 4X3SA 4A3JG 1ESFA 3H09A 1PTOC 4B3SL 2UUAQ 5IT9E 1YHAA 1YNNC 3K8AA 3GV3A 4ULLA 1EOVA 4C3IG 2CWAA 4X3UA 4JI8Q 1TWHH 1WTHA 3ZJYC 2JA8G 3VYTA 2K04A 3J7YW 5CV5A 5HY6A 1YITA 3KLSX 1H9RA 2WFWA 3BYTB 4OO1G 4OO1H 2AMCB 2XSCA 1XMOL 3OW2A 1MIUA 1BCPB 4GNXB 2K32A 1SFOH 3T16A 4NXML 3ITPA 4UAIA 3LWEA 1ASYA 4GS3A 1LLRD 2A8VA 2RKSA 1A3VA 1EY4A 1YHBA 3MEFA 3PV0A 1EIYB 1PTOD 1H9SB 3M3YH 3S9WA 1U0LA 3CMEA 1JORA 2F0SA 1NMFA 1ILPA 3E0EA 4A3JB 3G71A 2DY7A 1BBWA 1LTBD 1RD9D 1I6HB 4DR4L 2XTIA 3CPWA 2LXJA 1QWYA 3S2DB 4A3KB 4C2MH 1TS2A 5GAGC 1JB3A 3SK6A 1YJWA 1N33L 3KF6B 2KUMA 3M4OH 2B63B 1CA5A 4QGUA 5AJ3Q 2PW5A 2Z8LA 2VQFQ 3MXGA 2VUMG 3C46A 4LF5Q 1KDAA 1UEAB 1PYSB 4FYDA 4YCWA 3GTJB 1W3SA 1TT2A 1U4RA 2K03A 3SK5A 1EU3A 1O7IA 2EIFA 5E7NA 1WYDA 1I6VC 2PQAB 1QJOA 1FR3A 1QNKA 1PRTF 4JW0A 4K6LA 1HUMA 1T5EA 1OXVA 1PZKD 1STEA 2PZUA 2NVTB 3C1FA 4MTNA 2K28A 4FNFA 3KDFA 1GOZA 5M5YB 1DM0B 1TY2A 4KI0A 2MO0A 4ME3A 4DR3L 5FO8B 3KK7A 1E1OA 3I73A 3UDFA 1PRTC 3E6ZX 2ZJQA 1JOKA 4DV1L 4G7OC 2OEOA 3L0OA 2ICIA 2GVBA 4YY3Q 2ALYB 2D5DA 1OXSC 3FVQA 4B3RQ 3H6MA 3NQIA 4LNQA 1K8GA 1D6EC 1PFNA 2K33A 4P72A 4C3JB 1EOTA 1M8AA 2Q2IA 4RMFA 4RH6A 3GO5A 2VS1A 1PV4A 2Q8TA 4MZ9A 2PI2E 4R4TA 3KFUA 2SOBA 5CMDA 4A93G 3PO3B 1KXLA 2A69D 2J4XA 1Z47A 1I4XA 1KHIA 2P5ZX 1O7YA 2QA4A 5T1GA 4WJ3M 4KK7A 3JAML 5LMNL 3JC66 4DV3L 2RDFA 5A2QL 5FO7B 2TSSA 4JV5L 5A2QE 1ET9A 4IUTA 1F9QA 2K5NA 4DV0L 3HKZE 3O13A 1K8AC 4E6IA 2R7FA 4A3MG 3KYHC 4A3MH 2YV5A 1M1KC 4AQYL 4Y7NB 1HTPA 3BU2A 4KN4C 2KCCA 1OTCA 3A8JE 1V8QA 5EBDA 1I3QB 4IZ8A 2A69C 1AP0A 1V43A 1IW7C 3G6EA 1DYQA 1N32L 2O4XA 4EVOA 5DM63 3J81c 1K28A 4A3GH 1MJCA 1FGBD 4HTHA 1SAPA 3H91A 3URYA 2H1EA 4KMUC 3U58A 3EA6A 3K5MA 3S17H 2JK8A 1PZID 1SYCA 1F77A 2XNAC 1VQAA 1MKHA 2IHEA 4HN7A 1GJXA 1UE6A 1EQTA 2K75A 3ICEA 2OQKA 4NB3A 4GOPA 4LFCQ 1AN8A 2Q8IB 1CA6A 1DZ1A 3VR3A 2RSOA 4K8IA 1SRUA 4BBSG 1J9OA 1D7QA 3PUWA 2R7ZH 3Q8DA 1F9RA 4JI0Q 1XPUA 1XNRQ 3UDGA 4JBWA 5C0XI 4LFCL 4JBKA 1YNJC 2CCZA 3RLFA 3A5ZB 2ZM6L 3CD6A 1A3UA 3RUZA 1STAA 1S3OA 2N55A 1LUZA 4I7AA 3NE5B 5IYDG 4OIJA 2EYJA 2O5IC 4N9TA 1L0XB 4HJ9A 5IT9L 1I50H 1IYUA 1AZQA 1G91A 2EXZA 4J1MA 1I5FA 4GLXA 1N34Q 4L8JA 1G291 1XNQQ 3FKIH 3KLSA 2QDBA 4I65A 3TP8A 3SK8A 5LHY1 2ZT9C 3HZXA 5IP9G 4C3JG 4C3JH 4A3LH 2NVXB 1F2MA 4HEDA 1VQ7A 2F0KA 5I2YA 1SN8A 4UDUC 1VQCA 2E2IH 4DR1L 4ZK9B 4QUCA 1PTOB 3FEWX 4JG2A 3E9HA 4A4IA 4YY3L 3I90A 5M3FH 4QUFA 2N8NA 1X9NA 4DV1Q 2CQAA 4YHHL 1ONLA 3T53B 1TWAH 1JMCA 4NXNL 4LF4Q 3VA5A 4A75A 1XMOQ 3VR4A 5CV8A 2JA7G 2F0MA 1WJJA 1W6JA 3KF8A 2RF4A 3GTKH 2A1AA 2F0UA 5NUCA 1YNXA 4A3GB 2JJQA 1VQHA 2XWBB 4LF6L 3T4AC 2EYFA 4X62Q 1HNXQ 4OXPA 5IIFA 1PHJA 2G5DA 5G3LF 3DUZA 2F0DA 4IUNA 3CC2A 1E24A 2HQEA 4JI5L 1KRTA 5JJKA 1S4ZA 1T5XD 1QOHA 2D2CC 1IBKQ 4BBSH 1UUPA 1OXUA 2BH8A 2Y0SE 1B4OA 4C3HB 1PRTB 2KENA 3K5NA 5IWAL 2VUMH 3ERSX 4Q0FA 2PQAA 1X3QA 3RMHA 3D4RA 1HQRD 4B9XA 1G6ZA 3C3LA 1QCBD 3ZYYX 3HOYH 2QW7A 2F03A 1XWEA 3GTPB 1LTAD 2B2VA 3A54A 3JAME 3EN2A 1N33Q 3H3VI 5IOCA 1WOCA 1SE3A 3GTGH 2UUBL 1PFMA 2G9DA 1F2YA 1SNQA 2MUYA 4B9WA 2F3IA 3OIPA 4JYAL 3MFYA 1DGSA 2A5HA 3S16B 3TRZA 1TIID 3I72A 1BKBA 1VQKA 3CCRA 2NZHA 4POFA 3CAMA 4C3HH 2Q8RE 2EYPA 5FLXL 1SNOA 4CJ2C 1PYWD 4B3TL 3VDYA 4DK1A 3E0JA 1DOLA 3FMCA 3M85A 5M5XB 2F0NA 1G8ZD 3TZUA 2IX0A 2LXKA 2F0OA 3VYUA 1PH5A 1K83B 5LMUQ 3UDIA 3VYRA 2JA9A 3CQZH 2HIVA 3BZKA 2NVXH 5BN4A 1K8OA 2NZ1D 4A3EH 2VQFL 2QGQA 3KJPA 3D4DA 1HR0W 5GAEC 5C3EG 5IP7G 3KUPA 5KNDA 1RIPA 1PZJD 4H0LC 1A6XA 5LMNQ 3D6WA 2D0OA 1TWAB 1QUQA 5IYBG 3NTKA 4FF3A 3GTOH 1RCVD 1JE4A 5EQ0A 5T1IA 3AU7A 4RHRA 1EIGA 5JPNC 1VQ9A 1EU4A 5E1FA 2LMCB 2UXBQ 1DJRD 3T1YQ 3LGJA 3S1RB 2KA7A 3L3OC 2C5CA 2OT2A 3ND9A 1U4MA 4DXFA 3HOVG 2OCEA 1PDQA 4LF8Q 4PZ8A 3GP7A 3J81E 1GUTA 1Q90A 2PW7A 4CKEA 4DR2Q 2A6HD 1SNCA 3HOWG 1EQRA 1VQ8A 5EAYA 4AYBB 5FLXc 3EFXD 1FNWA 1N8RC 3A7LA 4IPCA 2OF1A 4DR3Q 4RHSA 4DR6Q 2B2WA 2B2TA 3E3XA 1NBWA 2R7DA 1BBUA 2R61A 2PI2A 4C3IB 1CT1D 2PCFB 4MIUA 3BZCA 1K3RA 5IYBH 1LTID 4OONA 4JI4Q 4DR5L 1QZHA 4IURA 3ULPA 2XWJB 3IFDA 1JT8A 3S2HH 2PMZB 3RLOA 3DHQA 3OMCA 3MZ5A 2IWHA 3I4LA 5IGFA 1LTRD 1DOMA 4V190 2N88A 5D3DA 3M7NA 5IYCG 1F9PA 1YVCA 5BR8L 2MQHA 4PZ7A 3HKZG 4J8QA 3FP9A 3TEHB 2DJFC 2VY3A 4JI6L 1TWHB 4J6HA 1LM0A 4HIDA 4MN3A 4WJWA 1VMCA 4R8NA 1Q7YC 2BA1A 1JJGA 2MPMA 1HXYD 4MTKA 3ERQA 2O5JC 1I6HH 4C1NI 1BQQT 5J3BA 2NVQH 3RNUA 1VCIA 3S15B 1S5FD 3QIAA 5CR3A 2AUKA 3MXUA 3MVVA 4OELB 3GTQB 2R93G 4EGVA 4BY7H 4X64L 5EBCA 2A6HC 1WD1A 5HGQA 5HGTA 4NXMQ 4RGMA 4K5WA 4CKCA 4KHPL 1YZ6A 3I4NH 1C4QA 2HDMA 3H3VC 5FKAC 1CK1A 3TS2A 2WAQG 3K7AB 4IOCA 2ENBA 3D8GA 4KLKA 3PO2B 4BY1G 1GUOA 3C2PA 1AE3A 2F0QA 2K5DA 2KVMA 3SK4A 4QIWB 3PUZA 4IPGA 4F8MA 5IGEA 2VQEQ 1D5XC 2ZXOA 1FD7D 1MBYA 3GQBA 4IUQA 1PH7A 1C48A 2A68D 5JJIA 2CW0D 4XQJA 2K14A 1FJGL 2Z4IA 4HJ5A 4PMWA 4HIKA 5C4HA 1FL0A 2LY7A 3H15A 1HA6A 1CKNA 1KDBA 3IRBA 4ID6A 1RJTA 1WI5A 5LL6S 3LX0A 2E76C 5M3MH 2PMZE 1TXYA 2AWNA 1TWFH 1CQFA 4NPSA 3SHLA 3TP7A 2EYMA 4DFAA 4LFBQ 1G2SA 2JA5B 3SGIA 3WDNA 3K80C 1WTPA 3RZDB 2HIXA 2F52A 3BG3A 1JJ2A 5C0XH 5KNCA 5EKLA 1BOSA 3U4VA 3QWNA 3S17B 3A8KE 2JA8H 1EFID 1BR9A 3HFZB 3FDTA 4DK0A 5M5WH 4KY5A 3GTQH 4K2KA 4MHEA 2GVAA 4IUUA 5IT9c 3OOCA 4IALA 2WP8J 3OSOA 4AYBE 5EGTA 2UXCL 3S14B 2AQ2B 3HOUG 1EY5A 3NPPA 4ZQ3A 4K0KQ 4H13C 2E2HB 1KQSA 3CCEA 4DK3C 1ML0D 1SBBB 3PO3G 1UWVA 3V96A 1R9TB 5L37A 4PV1C 5CBAE 4DR5Q 2XVSA 2BE5D 2FINB 2K4KA 2KEDA 4EQ5A 1PH6A 1QE6A 4OO1I 3U50C 2CWPA 2L5TA 3SXHA 4DAYB 2IW3A 4DV7Q 1CKMA 3A55A 3BS1A 5CV9A 3CCJA 1VQFA 1I3QH 1H9SA 4LUOA 3EQLC 3A7AB 2OXPA 5I9OA 5C4JH 4Y7NH 1A0IA 1X65A 4WJ4A 5DNFA 3KOJA 2F3VA 5FLMG 1MSHA 4GLAC 3G48A 1YEZA 4CDCC 1AFPA 2A73B 1EFWA 4HJAA 5KYIA 1WTQA 2BDOA 2F0FA 2GA4B 2K52A 4DR1Q 3R3OA 4LF8L 5J1ZA 1ZKOA 2OTJA 2QDLA 2IPKD 2VW9A 4IFDG 4DUZL 4DF7A 4A3EB 3BVMA 2WV6D 4UHVA 1VQIA 3CQZB 1Z9FA 1KNEA 2PYKA 4KHZA 4X3TA 2F0VA 4OL7A 3LNNA 4FF1A 2MHVA 1I4QA 3PIOA 1EEID 1VQGA 2Z4HA 4IJHA 3OTOL 3CCUA 1GD7A 1QVFA 3NWSA 4K0KL 3S1QB 1SYFA 3K6OA 1RF2D 4IOAA 4LK1C 3I3CA 1SEBD 3NHHA 3T13A 1WCMG 2B2YA 1SYGA 5C4JB 4KY6A 1B53A 2HHHL 4FVMA 1JE5A 4UP8A 3RR5A 1SLJA 4K5VA 2L0CA 3J81j 4KKUA 5GROA 3EIVA 3FPPA 4HSPA 2E2DC 2ZXPA 1S5BD 3DEPA 5DM73 1ZEQX 2E8GA 2NVYH 3DXJC 2RSNA 4X6AH 1TQOA 4ZRZA 1XYIA 4JVZA 1ET6A 3Q22A 5M5XH 2K5QA 5IODA 3J81L 1EYCA 3TS0A 2B2TC 3DLLA 2D0PA 4C1NK 2AHOB 1J8IA 1BUVT 3MEHA 3TDQA 1CQVA 3CC4A 3ULLA 2HD3A 3S16H 1SYDA 3KLRA 1WD0A 4L5RC 1SNDA 1K0SA 1CKOA 2ZTDA 2I0QA 1B9MA 1CZGA 1LT6D 5FJ8H 3E9IA 3HS0C 4JOIC 2CFMA 2X6LA 3G6JB 1SMYD 3D6CA 3L9AX 2UXCQ 4M1UB 4UPAA 5K36G 1EY7A 4IFDI 1GVPA 4XQQA 4AIMA 1TR5A 2Q2TA 2E2HH 2BE5C 3HOYG 1H9KA 2RHSB 3CXCA 2JA7H 2MFIA 3RZOB 4DR7Q 4LWCA 4TSSA 3Q6SA 1HR0L 1W6KA 3M9BA 4KKTA 4K5XA 3IFTA 4IJLA 1Q81C 3AQQA 1PFBA 1AH9A 1II3A 1RODA 1A15A 2FJ2A 2KHSA 1JC7A 1MSGA 4LF6Q 2UXDQ 2KHIA 1LACA 1Y1WH 1Y1WG 3I4MG 2M00A 3I4MH 3V2TA 4A3DH 5BN5A 3MWYW 3W5OA 3OIQA 4XYQA 2WIIB 4LF4L 4NXNQ 4G7ZC 1YHQA 5IGCA 1H9MA 4JI1L 4HR7B 1VQ5A 3KDFB 1KC8C 4GKJL 2K6AA 2F1MA 3CKIB 2VNUD 2RA4A 2KQ3A 3ONAB 4APVA 4DV7L 3HP3A 5CC4A 4ZKCB 1STYA 1KL9A 3P75A 1I4RA 2HDLA 4I7ZC 1HR0Q 2B63G 1U9RA 2CQOA 2LKVA 4JI2Q 2NVTH 5CV7A 4G57A 5IP9H 4H7BA 4OX9Q 2VQEL 1YJ9A 1E7ZA 2WINB 1TU2B 1G51A 1AEXA 1C9OA 3K0YA 3WWVA 4DKAC 1RL2A 4C3IH 4DV2L 1CM9A 2Z6KC 3G4SA 1BCPD 3N6RA 1HHVA 1L0WA 5FO9B 3J80i 4NKLA 2EY1A 1CI3M 4L6TB 3I91A 2R93B 1XTDA 2L15A 3I2ZA 2WKDA 1VQMA 1VDZA 1O7ZA 4XT3B 3S1MH 3HOZG 2JE6I 2A74C 3WOEA 1EY8A 3NELA 1CKNB 1E2VA 1HPCA 2QEJC 3W1BA 1STHA 5CBEE 3U9SA 3S2DH 4DV5L 4WFN3 5ELEA 1N36Q 2IL8A 2N3SA 3S15H 2WB1B 4EQPA 3AMUA 4POGA 3J80L 4ILWA 1SROA 3K5LA 2J0TD 4BY7B 2KBNA 4X65L 4P73A 5GQOA 1E1TA 1EQVA 1NR2A 4JI6Q 3GTGB 1HFNA 3NTHA 3H0GG 2YTVA 3AFPA 2ICEC 2L12A 4WRDA 3W1GA 1N32Q 2IT1A 1Q3LA 4XDXA 1NCVA 1E2ZA 4FO2A 4RFBA 2NTSA 2ZJPA 1TWCB 3A0JA 1S5DD 3CHBD 3MAQA 4UY8C 3NBHA 1SYBA 4O1NA 4C3HG 3D0FA 4FF4A 1GM5A 3MXNA 2QKIC 3IKJA 5K5PA 1Y8OB 1N34L 4DN4M 4GOPB 3S1QH 2K05A 4NMZA 1GKHA 4TRDA 3K7UC 2NVQB 5EPLA 4S3SA 4R9WA 4DAVA 4KTAA 4PG3A 1TWFB 2Z1CA 4EX5A 1L1OA 2ZTCA 2WACA 4F87A 5D3IB 5I6YA 1O78A 5DLQE 2CVRA 1I4PA 4DAYA 5C44H 5KGUA 1WTWA 2YTYA 1CZWA 2EZVA 4DA2A 4M8AA 5COYA 4CKBA 1NE3A 4CJ0B 1N9WA 1RKNA 2B2WC 2XRSD 4PMBA 3JAMi 4JBJA 1ENFA 4B3TQ 5ELCA 1YNND 3BZDB 3CP0A 1E0BA 2FMCA 4G4KA 4KHVA 1NJIC 2PZWA 3CMAA 5EKKA 1Z6HA 1LT5D 1G2TA 2R93H 3J7ZC 2A6EC 1GXDC 4CDFC 1NTGA 2A68C 3K81C 5IGGA 1Y1VG 1L1OB 3RZDH 3M7GA 4ZCKA 4BXXG 1VQBA 2K7VA 4DNTB 1I4HA 1MI2A 1JQYD 3T1HQ 1FNUA 2KHJA 1EY9A 2B8FA 3DM3A 1KRSA 2OWOA 4QF4A 3BDLA 4ODGA 4DV5Q 1N36L 2Q2HA 3VR6A 4LF7Q 1B50A 2BOSA 3HRZC 4LUZA 3K57A 2AUJD 4IUPA 1BXTA 1IXRA 5K36H 5C4XB 3GTMH 3BDCA 2JA6H 4L5TA 4IPHA 2FFKB 1R9TH 3PF5A 4Y52H 1HNXL 1VMPA 4JPBW 5AJ3L 4A3DB 1SMXA 3GD7A 3A8IE 1AW7A 1EY6A 2EPBA 3F2DA 5M3FG 1V1PB 1PLFA 4HCSA 4A3KH 1QNUA 3F2CA 3KJOA 2BCOA 2VB2X 4LUVA 2KCTA 4K8JA 2NN6I 1IYJB 2C35B 4DR4Q 1FVIA 2K01A 5JEAJ 4A93B 2I5MX 5I2XA 1EWIA 4Z9CB 2EE1A 4A3FB 1Q82C 5KYLA 2B39A 1BNZA 4A3DG 3A5UA 1DOKA 1K9MC 3R93A 2UUCQ 3BDOA 2EYLA 2F4IA 3T1YL 4TVAB 4GN5A 1RTNA 4GN3B 1L2FA 5IWAQ 3HEJA 1F9SA 4DXGA 3B6YA 5C4XG 1Q8IA 1EUJA 1T9HA 4ZUIA 3UE1A 4ALPA 4AQYQ 4JI5Q 2JA7B 4ZYSA 3R2TA 2CW0C 2FMMA 2F0IA 4LFAL 2AQ1B 4BXXH 1Q12A 3X3MA 1STNA 5IGBA 5IP7H 1PTOH 2B8GA 2Y0SB 1V1QA 1H9JA 1PA6A 4OWXB 4N9PA 1VQOA 2JQOA 5JEAH 1K8MA 3L2PA 3X3NA 1S40A 3PIP3 1Y8PB 3I55A 4IUVA 2AKWB 2NYZD 4O42A 3G7LA 3HOWB 3UDXA 2KOLA 4JI0L 4A3FH 3STBC 1ESRA 1PYBA 3VR2A 4QQBX 3S2HB 2NZOA 1ASZA 2CH4W 4DR7L 3AB9A 2RDGA 4LF7L 3QOLA 2EY5A 3CPFA 2KECA 4R4IA 4IN3A 2MO1A 1YI2A 3PF4A 3DMUA 1S5ED 2Q2UA 1QVCA 1Y1WB 4BBRB 1B1ZA 1UE7A 1X3EA 3T51B 2MJ8A 3H0GH 1HNZQ 2D9UA 1F2ZA 1TVXA 1UE5A 4RA8A 4ZKBB 4A3MB 2NN6G 4IPDA 1PXUA 1O7LA 4BWGB 4BBRG 2NBFA 1X3FA 1EQQA 2JYOA 2L11A 4DV6L 1XXGA 4X66L 4R8IA 4RGNA 5FOBB 2KCMA 5JEAG 4PNYA 1KABA 1Z7TA 1GUGA 1LT4D 4A93H 2F0PA 2AWOA 1B2TA 1Y14B 1IBKL 1HZCA 3NEMA 4JI7L 3T56B 2KCNA 1VF7A 3RZOH 1SE2A 5TSSA 4AYBG 1KAWA 5M3MG 4JC0A 4NDXA 2I07B 3T1HL 3I4MB 4JV5Q 5M5YH 2K5HA 3FHWA 1HCZA 1HA5A 4DV3Q 1IYVA 1O80A 1MHWC 1JB7A 1CHPD 1E2WA 2B2VC 2NWGA 4EQNA 3TN2A 4FP5D 1KTKA 4RCOA 3I8ZA 2LSSA 2SDFA 1SSOA 4BBSB 2XRQD 2IHFA 3F8TA 1H95A 5LMNW 1BVSA 3CRKC 4CDEC 1TWCH 4B3ML 1EYDA 1PH4A 1UEBA 2UUCL 2DNEA 1YJNA 2XN9C 1M4VA 3PGZA 1QILA 2HCCA 2A6ED 5J39A 4GNXC 1A2UA 4GOPC 3FPUB 1NNXA 2H5XA 3SE0A 4GKJQ 1LTTD 4XIGS 3QO2A 5JVG3 1BCPF 3BVGA 4BA1I 5JJLA 3EVQA 4A3EG 2Y0SG 3C1EA 3H0GB 2PQEA 1B9NA 4JI8L 4LFAQ 2RVLA 3ULJA 1M90C 3IAYA 5E4XA 3PUXA 4RKBA 1XPRA 1A3TA 1VQJA 3TZDA 2UUAL 2BH2A 3GTLB 5HURA 3SEBA 2D62A 3LWUA 4ME5A 3SVMA 4QB4A 5LMUL 1LTLA 4DUYQ 4XT1B 3Q24A 1EYGA 3GDEA 1SYEA 1A62A 1HFGA 1GHJA 1S72A 1TS3A 1DCZA 4YWKA 5CGKA 2M9VA 4U68A 4LF5L 3P20A 3H94A 1HZBA 1X3GA 3WOFA 5C3XA 5M5WB 1YBYA 2EY2A 2ZJRA 1SMYC 3NWTA 2FHTA 3QG1A 3PO3H 5BN3A 1HZ9A 5M9OA 2HUGA 4DV2Q 3OMGA 1JWMD 5C44B 3NQTA 2NTTA 1Q86C 3P7JA 1B8AA 2E75C 4DV4Q 4QCLA 1U4PA 4IQZA 2B63H 2EJFC 2OTLA 4FXGC 4NP5A 2YU9B 2QF7A 2RDHA 2EXDA 5ELOA 4P74A 1JWUD 3U9OA 3PIO3 1PH8A 5J22A 5GAHC 2K5VA 5ELNA 1TY0A 1WTRA 4A3CG 5EPKA 1SR3A 1L0YB 1RDPD 3OWFA 2R92G 2PNHA 3PQIA 1WTVA 1KIXA 5LL6X 4OWWB 1SXTA 2HHHQ 3KF6A 1HTLD 3AYHB 1GUWA 4B08A 2L1BA 2RBMA 1D1IA 3TSSA 2UXDL 1EIHA 3VYSA 3AFQA 3ER0A 3CW2C 3KBXA 4XXEA 2F0GA 1WVLA 5JAVA 3RN2A 1FJGQ 4CJ1B 3OTOQ 2AQ3B 4LF9Q 2R92B 4GN4B 4B3SQ 4PQXA 2R3ZA 1K0RA 4RG1A 4A76A 3BYYB 3PIPA 3J80E 3M3YB 5EJWA 4A3LG 2ATWA 1V1PA 4K14A 3V05A 1D8LA 2EJMA 4R4OA 1RTOA 2VL6A 3R8BA 3P1HA 4B3RL 4JI3L 3KF8B 2KJXA 1EEFD 3R2IA 2VXWA 1IBML 4A3KG 4DPGA 2YTXA 2SEBD 5JPMC 3HOYB 2K1BA 4ZAIA 2R92H 4KHPQ 4LAAA 3M4OB 2F0EA 4OHJA 2ASBA 3TREA 2K5WA 3TQYA 1HJPA 1X32A 3Q0AA 5C5MA 1VQEA 2N49A 2RCNA 4R1JA 4QJFA 1OXTA 4C2MB 4QY7A 1EY0A 1I50B 3GV6A 1SNPA 2ZXRA 4R4QA 1PTOF 1LTSD 1NY4A 4HMIA 1X3PA 4JI7Q 2F0HA 2PNRC 1A8VA 1QB5D 1X55A 2IX1A 5IY0A 1B7YB 4DAMA 4FXKC 1FNVA 2VB3X 1X56A 4X66Q 4NW2A 3S1RH 2I46A 3HGBA 3BVZA 2G9HD 2EOTA 4GZYC 1HH2P 4P2CB 5EKIA 3HOUH 2JA5H 3HOZH 3SDZA 4F88A 3UI2A 1ENAA 4YIJA 4GKKQ 5E4WC 2B3GA 1R4QB 4XTCS 1BDOA 1IKLA 4X65Q 3MFGA 3J7AF 3NUCA 1HNZL 3KBGA 1HUNA 2DUDA 2LFNA 1XX8A 4UP9A 4LMQD 4P71A 3TMEA 1CUKA 1EWCA 5EPJA 3F2UA 3CCLA 1LV9A 1IL2A 1VQLA 2CKZB 4IFDH 1I94Q 2EYOA 3HOVH 4XYOA 1U4LA 4QIWE 5A35A 1STBA 3F1ZA 3K7AH 4OEMB 3UE0A 4KJNA 2WB1E 3PSIA 4XQNA 5KEEA 2DY8A 4A3BG 1QVGA 5KNBA 1QG7A 4JI1Q 1D2BA 2ID0A 1HZAA 2F4VQ 4KN7C 1SDFA 1QUQB 2O2LD 1CFMA 2F3WA 1GO3E 2R7ZG 5F2DA 3RLNA 2MNAA 4JI3Q 4N8X1 1ICWA 2I5LX 2B2UC 5ELBA 4ZUJA 2Z0SA 3CC7A 4RWSC 1PRTD 3NTIA 3I4NB 1CHQD 1XPOA 4BA2I 2F0LA 4A3BB 1PH2A 4IFDJ 3HOXB 2LS01 1WTXA 1JWSD 3GTPH 3K58A 2UU9L 3HOVB 4KY7A 2ES2A 1NAPA 5JJZA 4TKOB 3S1NH 4K6DA 2B2UA 1KAAA 4HJ7A 2HQLA 2F0JA 2JN4A 2FXQA 4V0BA 1SJED 1IBLL 2M2LA 2DGYA 4DU9A 3W2DA 4A3BH 3MC0B 2QILA 5CV6A 1NUCA 1OO9B 2JA6B 2YU9H 3E5SA 3NK9A 1XMQQ 3STBD 2JA8B 3F2BA 1KLGD 1I4GA 3HOUB 3TP5A 1GUNA 4A3CH 2EYHA 2Z6BA 3M4PA 3OYYA 1VQPA 1PFSA 1LTGD 4RKLA 5M3MB 1NSNS 2E74C 3I70A 5GADC 1B44D 4KD4A 5IGDA 4WORA 5C6AA 4DNRB 4O0AA 5IYDH 3EBEA 4G7HC 3MXNB 4AH6A 1U5KA 4OIKA 4JCVE 3IL8A 1X54A 2MP1A 4A3IH 1Y8NB 5ISRA 3H3VH 5C0XJ 4OWTB 1JR0D 2RCFA 1P8LA 1JOQA 4CHTB 3J80c 5C4XH 5CV4A 1VQNA 4A3FG 4KD3A 2K50A 1ZXTA 2WAQE 1IBLQ 3GTJH 4LJZC 3GTLH 1UAPA 3L7ZC 1PH3A 2TMPA 3D31A 5JVH3 2UU9Q 3QR8A 2EVBA 2E5LL 1MGSA 1V1OA 1K73C 4OX9L 3TP6A 5D65A 3NENA 2ZTEA 4JI2L 1PVOA 4UP7A 5C4ZA 3A56A 2DJGC 3NSWA 3MHBA 1SE8A 2PO4A 1G6PA 1TWGB 2YYZA 4DUZQ 4X3KA 3DEOA 1IZ6A 3S14H 5AFWA 4QL5A 1DD2A 1XMQL 3I4OA 1B70B 2JA6G 2NB0A 2E2JB 4TQUS 2KEEA 4A3IB 2H4OA 1CSQA 5C5LA 1ILQA 1CSPA 1IBMQ 1K83H 1XTCD 4JBMA 3DWAA 1X6OA 2IJ0A 1WFQA 3DWQA 1SNMA 3DM1A 3HKZB 5FK9C 5I6WA 2IY5B 4A3JH 1Y1VB 4BY1H 1Q8KA 3S1NB 1J6QA 2IX3A 2V4DA 3PCOB 3D4WA 4C56C 1QZGA 3HOXH 1VQDA 3N52A 4N8FA 1XNQL 2NUCA 1LO5D 4J15A 1K3BC 3EROA 1J5EQ 1C8CA 1E3PA 4L63B 1KD1C 4DGZA 4A3IG 1S5CD 4HIOA 2F0WA 5IYCH 2I5HA 4FDBA 4IO9A 5H1SE 1HQMC 3A74A 3FKIG 2PPBC 2R7ZB 3K5OA 4H02A 1A63A 3QOJA 3CRLC 4YWLA 3SR1A 4DK6C 1RHPA 1Q1EA 1HNWL 2ZM6Q 2F4VL
chains in the Genus database with same CATH topology
3RN5A 4HJ8A 5GROA 3EIVA 5C44G 1I5FA 4GLXA 1N34Q 1G291 2LSSA 1XNQQ 3FKIH 2E8GA 2IHFA 3F8TA 1H95A 5LMNW 1BVSA 4GLVB 2NVYH 4X6AH 5IP9G 2A19A 5M5XH 4C3JH 4A3LH 1TWCH 4MNOA 3TS0A 1YIJA 1I94L 4B3ML 1PH4A 1UEBA 4DV6Q 2UUCL 1VQ7A 1YJNA 1P16A 3DLLA 1SN8A 2D0PA 1VQCA 3PGZA 2AHOB 2E2IH 4DR1L 4GNXC 1W2BA 4GOPC 4LFBL 3HOXG 4JG2A 2H5XA 3ULLA 3CC4A 3E9HA 4A4IA 4BBRH 4YY3L 3I56A 3S16H 5M3FH 4L5RC 4GKJQ 4DR6L 2N8NA 1CKOA 2ZTDA 1X9NA 4DV1Q 4XIGS 2I0QA 4YHHL 1TWAH 4BA1I 4NXNL 1JMCA 4LF4Q 1E22A 3I4NG 4A75A 1Q1BA 1TWGH 1XMOQ 5JJLA 4GKKL 2JA7G 5FJ8H 3E9IA 1WJJA 4A3EG 2RF4A 2Y0SG 2A1AA 4JOIC 3GTKH 2CFMA 4DR2L 5BR8Q 3CCSA 1YNXA 2UXCQ 4UPAA 2JJQA 1VQHA 3S24A 4LF6L 4JI8L 4X62Q 4LFAQ 5IE8A 1PH9A 3ULJA 1M90C 1HNXQ 3PUYA 4OXPA 5K36G 4IFDI 1GVPA 1PHJA 4AIMA 2E2JH 2Q2TA 2E2HH 3PUXA 3HOYG 3KLWA 3CXCA 2RHSB 1XPRA 1E24A 1VQJA 3CC2A 2JA7H 1VQ4A 2UXBL 2MFIA 2UUAL 2BH2A 3I7FA 4JI5L 1KRTA 3CCVA 5JJKA 2D62A 4DR7Q 1IBKQ 4BBSH 4LWCA 5LMUL 1OXUA 3CF5A 1LTLA 4DUYQ 1EYGA 3GDEA 2BH8A 2Y0SE 1HR0L 1A62A 2KENA 3M9BA 5IWAL 2VUMH 3ERSX 2PQAA 3HOWH 1S72A 4IJLA 4YWKA 1Q81C 3AQQA 4L5SA 1AH9A 3HOYH 4LF5L 3AEVA 1HZBA 1X3GA 3NBHB 1YBYA 4DV0Q 2ZJRA 4LF6Q 2JA5G 2UXDQ 3PO3H 3EN2A 2KHIA 1N33Q 3K0XA 1HZ9A 3H3VI 1WOCA 1Y1WH 1Y1WG 3I4MG 3I4MH 4DV2Q 4A3DH 3GTGH 3W5OA 1Q86C 2UUBL 2V1CC 1B8AA 2F3IA 4LF4L 4NXNQ 4JYAL 1YHQA 4YHHQ 4DV4Q 4JI1L 1DGSA 4BY7G 1VQ5A 3KDFB 3TRZA 1KC8C 1BKBA 1VQKA 2B63H 4GKJL 3CCRA 2NZHA 4POFA 3PO2H 2OTLA 3CAMA 1C0AA 2VNUD 3BJUA 4C3HH 4X64Q 4APVA 4DV7L 1UE1A 4JOIA 2EXDA 5ELOA 4B3TL 4P74A 3VDYA 2JEBI 1PH8A 5GAHC 2K5VA 4YCUA 5ELNA 3J7A5 3M85A 1KL9A 1Q46A 5C0XG 1HR0Q 2IX0A 2B63G 2LXKA 2CQOA 4JI2Q 2GN5A 3CCQA 2NVTH 1PH5A 5LMUQ 3UDIA 4A3CG 2JA9A 5IP9H 1SR3A 4OX9Q 3CQZH 2HIVA 2VQEL 3BZKA 2E5LQ 5FLMH 1YJ9A 4R4CA 4DV4L 1E7ZA 4HIMA 4LF9L 2HT1A 2R92G 2NVXH 1G51A 2OQ0A 2PNHA 1C9OA 3J81i 4PZ6A 5FJ8G 1KIXA 4A3EH 3WWVA 4YWMA 4OWWB 2HHHQ 3KF6A 4DKAC 3AYHB 2QGQA 1EIFA 1RL2A 4C3IH 3KJPA 2VQFL 4DV2L 2Z6KC 1HR0W 5GAEC 3G4SA 1V9PA 5C3EG 1WCMH 5IP7G 1L0WA 1RIPA 2UXDL 2VZAA 3AFQA 3CW2C 3ER0A 3J80i 5LMNQ 1C7YA 2D0OA 1QUQA 3RN2A 5IYBG 1FJGQ 3OTOQ 4LF9Q 1VQ6A 2JEAI 3GTOH 1XTDA 2BA0A 2L15A 3I2ZA 4GN4B 1XJVA 4B3SQ 1XNRL 1VQMA 3U4ZA 1K0RA 3S1MH 5C3EH 4RG1A 4DUYL 4A76A 3HOZG 2JE6I 1VQ9A 3NELA 2R6GA 3PIPA 1CKNB 2N78A 1AE2A 3W1BA 4A3LG 3HKSA 2UXBQ 1LYLA 4JI4L 3CCMA 3S2DH 3T1YQ 3LGJA 4DV5L 1N36Q 1MJEA 2ATWA 4YCVA 1VS0A 2N3SA 1D8LA 3HOVG 3M4QA 4R4OA 2OCEA 3S15H 4LF8Q 4X62L 4PZ8A 2XGTA 2VL6A 4B3RL 4O2DA 4JI3L 4POGA 1PH1A 3KF8B 4DR2Q 1SROA 3HOWG 1IBML 4A3KG 1EQRA 1VQ8A 5EAYA 2KBNA 4DPGA 4DNIA 5FLXc 4JYAQ 4X65L 2YTXA 4P73A 1N8RC 1HNWQ 5GQOA 1E1TA 3PUVA 2UUBQ 2R92H 2RHQB 4KHPQ 4JI6Q 4IPCA 4DR3Q 1NMGA 4LW1A 2ASBA 4DR6Q 3TREA 1JJCB 1Y1VH 3H0GG 2YTVA 4A3GG 3TQYA 1HJPA 3AFPA 3PO2G 2QEXA 3W1GA 4P75A 1NBWA 2B29A 2R7DA 2WB1G 2N49A 2RCNA 1VQEA 4R1JA 4QJFA 1BBUA 1OXTA 2IT1A 4QY7A 1N32Q 4GNXA 2Z6KA 2PI2A 4L5QA 1OXXK 4R4QA 4B3MQ 3BZCA 1K3RA 5IYBH 4OONA 1NY4A 2ZJPA 4JI4Q 1FGUA 4DR5L 3ULPA 3A0JA 1QZHA 1J5EL 4JI7Q 1A8VA 1JT8A 1X55A 4UY8C 2IX1A 3S2HH 5IY0A 3D0FA 1L1OC 1B7YB 2EQSA 3JAMc 1GM5A 4DAMA 3RLOA 4A3JG 1N34L 4GOPB 3S1QH 4B3SL 2UUAQ 1X56A 1GKHA 1YHAA 4X66Q 3K8AA 3S1RH 1EOVA 3K7UC 3M7NA 5IYCG 2CWAA 4JI8Q 1TWHH 1HH2P 1YVCA 3ZJYC 5BR8L 2MQHA 2JA8G 3HOUH 2JA5H 3HOZH 4PZ7A 3HKZG 5HY6A 1YITA 3FP9A 4PG3A 3TEHB 2WFWA 4JI6L 2VY3A 4OO1G 2AMCB 4GKKQ 1LM0A 4HIDA 2B3GA 4EX5A 4XTCS 1L1OA 1XMOL 2ZTCA 3OW2A 1MIUA 4X65Q 4GNXB 5DLQE 1Q7YC 2BA1A 5C44H 1SFOH 1JJGA 4NXML 1HNZL 2YTYA 1I6HH 2DUDA 1ASYA 4GS3A 2A8VA 5J3BA 4UP9A 2NVQH 3RNUA 1VCIA 4P71A 1NE3A 1CUKA 1YHBA 3CCLA 1N9WA 1IL2A 3MEFA 1VQLA 2CKZB 3PV0A 1EIYB 2R93G 3JAMi 1I94Q 3HOVH 4JBJA 4B3TQ 3M3YH 4QIWE 1U0LA 3CP0A 3CMEA 4BY7H 1NMFA 4X64L 3F1ZA 3K7AH 1NJIC 3CMAA 3UE0A 2WB1E 3E0EA 5HGQA 3PSIA 3G71A 4A3BG 1QVGA 4NXMQ 1BBWA 4DR4L 4JI1Q 2XTIA 3CPWA 2ID0A 2R93H 3J7ZC 2LXJA 4KHPL 1HZAA 2F4VQ 1YZ6A 3I4NH 1NTGA 4C2MH 5GAGC 1QUQB 3K81C 1Y1VG 1L1OB 3RZDH 3TS2A 2WAQG 4BXXG 1VQBA 1GO3E 2R7ZG 1YJWA 1N33L 4IOCA 3KF6B 3RLNA 2MNAA 4JI3Q 3M4OH 4KLKA 4QGUA 5AJ3Q 3T1HQ 2VQFQ 2I5LX 2KHJA 4BY1G 2VUMG 3DM3A 1KRSA 2OWOA 1AE3A 4LF5Q 3PUZA 4IPGA 4DV5Q 2Z0SA 2Q2HA 3CC7A 1N36L 1PYSB 4LF7Q 4YCWA 2VQEQ 1W3SA 4LUZA 1XPOA 4BA2I 1PH2A 4IFDJ 1PH7A 1IXRA 1O7IA 3GTMH 2EIFA 5E7NA 1WYDA 3GTPH 5JJIA 2PQAB 2JA6H 2UU9L 4L5TA 2K14A 2ES2A 1FJGL 3S1NH 4IPHA 1R9TH 4HJ5A 1OXVA 4HJ7A 3PF5A 4PMWA 4HIKA 1HNXL 4Y52H 5AJ3L 2HQLA 1IBLL 2FXQA 4MTNA 1SMXA 3KDFA 1FL0A 2DGYA 3H15A 3GD7A 1CKNA 4A3BH 3IRBA 4KI0A 3F2DA 2MO0A 4ME3A 1WI5A 5M3FG 4DR3L 1E1OA 3UDFA 4A3KH 5M3MH 3F2CA 2PMZE 3KJOA 4LUVA 2KCTA 1TXYA 2NN6I 1IYJB 2AWNA 2ZJQA 1TWFH 4DV1L 2C35B 3L0OA 2YU9H 4DR4Q 1FVIA 2GVBA 4NPSA 5JEAJ 1XMQQ 2I5MX 3STBD 4YY3Q 2ALYB 1OXSC 4LFBQ 3F2BA 1EWIA 4B3RQ 1Q82C 3SGIA 4A3CH 4LNQA 3OYYA 3K80C 3M4PA 3A5UA 1VQPA 1K9MC 1K8GA 4A3DG 2HIXA 2UUCQ 2F52A 3T1YL 1PFSA 4P72A 4TVAB 4GN5A 1JJ2A 4GN3B 2Q2IA 1L2FA 5IWAQ 4RMFA 5GADC 3GO5A 2VS1A 3B6YA 1PV4A 4MZ9A 2PI2E 4R4TA 3KFUA 5C4XG 1EUJA 1T9HA 3U4VA 4A93G 3UE1A 4ALPA 2JA8H 4AQYQ 1KXLA 4O0AA 4JI5Q 5IYDH 3EBEA 1Z47A 3HFZB 3MXNB 1U5KA 4AH6A 5M5WH 4JCVE 1X54A 1KHIA 3GTQH 2GVAA 4A3IH 5IT9c 2QA4A 3H3VH 2WP8J 5C0XJ 4WJ3M 4OWTB 1P8LA 5LMNL 3J80c 4LFAL 3JC66 4AYBE 5C4XH 4BXXH 2UXCL 1Q12A 4DV3L 1VQNA 4A3FG 3HOUG 2K50A 5IP7H 2WAQE 1IBLQ 4JV5L 3GTJH 1V1QA 3GTLH 2K5NA 3L7ZC 4DV0L 1PA6A 1PH3A 3HKZE 4OWXB 4K0KQ 1K8AC 1VQOA 2JQOA 3D31A 3L2PA 2R7FA 1S40A 2UU9Q 4A3MG 3KYHC 4A3MH 2YV5A 3I55A 1KQSA 2AKWB 3CCEA 2E5LL 1M1KC 4OX9L 1K73C 4AQYL 4DK3C 3BU2A 3NENA 3UDXA 4JI0L 4A3FH 3PO3G 3STBC 2ZTEA 1OTCA 1PYBA 1UWVA 4JI2L 4QQBX 1PVOA 2NZOA 4UP7A 1ASZA 4DR7L 4DR5Q 4LF7L 1SE8A 3CPFA 4R4IA 2K4KA 4EQ5A 1PH6A 2MO1A 1YI2A 4OO1I 3U50C 1G6PA 1V43A 2CWPA 2YYZA 4DAYB 3PF4A 4DUZQ 2Q2UA 4DV7Q 1CKMA 1QVCA 3G6EA 3CCJA 1IZ6A 1VQFA 1I3QH 1N32L 1UE7A 4LUOA 3S14H 4QL5A 3J81c 1X3EA 3H0GH 4A3GH 1HNZQ 1XMQL 3I4OA 5C4JH 4Y7NH 1MJCA 1B70B 1A0IA 1X65A 4WJ4A 2JA6G 3KOJA 4TQUS 5FLMG 3U58A 1UE5A 4GLAC 3G48A 1YEZA 2NN6G 1CSQA 3S17H 1CSPA 2JK8A 4IPDA 1IBMQ 1K83H 1EFWA 4JBMA 4HJAA 1X6OA 1WFQA 2K52A 4BBRG 2IY5B 1VQAA 4DR1Q 1MKHA 2IHEA 4A3JH 4LF8L 4BY1H 1UE6A 2OTJA 2VW9A 1X3FA 1EQQA 4IFDG 2K75A 4DUZL 1Q8KA 4DV6L 1J6QA 2OQKA 4X66L 4NB3A 4GOPA 3PCOB 4LFCQ 3ICEA 2KCMA 5JEAG 1SRUA 1VQIA 1QZGA 1Z9FA 4BBSG 4KHZA 3PUWA 4JBKA 2R7ZH 3HOXH 3Q8DA 4A93H 1VQDA 1D7QA 2AWOA 4JI0Q 1Y14B 1XPUA 1IBKL 1XNQL 4J15A 1HZCA 3NEMA 4JI7L 1J5EQ 1XNRQ 3PIOA 3UDGA 3RZOH 4JBWA 5C0XI 1E3PA 4LFCL 1VQGA 4IJHA 4AYBG 1KAWA 3OTOL 3CCUA 1KD1C 3RLFA 3A5ZB 1GD7A 5M3MG 4JC0A 2ZM6L 4A3IG 2CCZA 1QVFA 4K0KL 4HIOA 3CD6A 5IYCH 2I5HA 4FDBA 4IO9A 3T1HL 5H1SE 4IOAA 1S3OA 4JV5Q 5M5YH 1LUZA 2K5HA 3FHWA 1WCMG 3A74A 3FKIG 4DV3Q 5IYDG 4H02A 1JB7A 1A63A 2HHHL 1JE5A 4UP8A 4YWLA 3RR5A 4DK6C 1SLJA 4HJ9A 1Q1EA 1HNWL 2ZM6Q 3J81j 1I50H 2F4VL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN5 A;  4HJ8 A;  5GRO A;  3EIV A;  5C44 G;  1I5F A;  4GLX A;  1N34 Q;  1G29 1;  2LSS A;  1XNQ Q;  3FKI H;  2E8G A;  2IHF A;  3F8T A;  1H95 A;  5LMN W;  1BVS A;  4GLV B;  2NVY H;  4X6A H;  5IP9 G;  2A19 A;  5M5X H;  4C3J H;  4A3L H;  1TWC H;  4MNO A;  3TS0 A;  1YIJ A;  1I94 L;  4B3M L;  1PH4 A;  1UEB A;  4DV6 Q;  2UUC L;  1VQ7 A;  1YJN A;  1P16 A;  3DLL A;  1SN8 A;  2D0P A;  1VQC A;  3PGZ A;  2AHO B;  2E2I H;  4DR1 L;  4GNX C;  1W2B A;  4GOP C;  4LFB L;  3HOX G;  4JG2 A;  2H5X A;  3ULL A;  3CC4 A;  3E9H A;  4A4I A;  4BBR H;  4YY3 L;  3I56 A;  3S16 H;  5M3F H;  4L5R C;  4GKJ Q;  4DR6 L;  2N8N A;  1CKO A;  2ZTD A;  1X9N A;  4DV1 Q;  4XIG S;  2I0Q A;  4YHH L;  1TWA H;  4BA1 I;  4NXN L;  1JMC A;  4LF4 Q;  1E22 A;  3I4N G;  4A75 A;  1Q1B A;  1TWG H;  1XMO Q;  5JJL A;  4GKK L;  2JA7 G;  5FJ8 H;  3E9I A;  1WJJ A;  4A3E G;  2RF4 A;  2Y0S G;  2A1A A;  4JOI C;  3GTK H;  2CFM A;  4DR2 L;  5BR8 Q;  3CCS A;  1YNX A;  2UXC Q;  4UPA A;  2JJQ A;  1VQH A;  3S24 A;  4LF6 L;  4JI8 L;  4X62 Q;  4LFA Q;  5IE8 A;  1PH9 A;  3ULJ A;  1M90 C;  1HNX Q;  3PUY A;  4OXP A;  5K36 G;  4IFD I;  1GVP A;  1PHJ A;  4AIM A;  2E2J H;  2Q2T A;  2E2H H;  3PUX A;  3HOY G;  3KLW A;  3CXC A;  2RHS B;  1XPR A;  1E24 A;  1VQJ A;  3CC2 A;  2JA7 H;  1VQ4 A;  2UXB L;  2MFI A;  2UUA L;  2BH2 A;  3I7F A;  4JI5 L;  1KRT A;  3CCV A;  5JJK A;  2D62 A;  4DR7 Q;  1IBK Q;  4BBS H;  4LWC A;  5LMU L;  1OXU A;  3CF5 A;  1LTL A;  4DUY Q;  1EYG A;  3GDE A;  2BH8 A;  2Y0S E;  1HR0 L;  1A62 A;  2KEN A;  3M9B A;  5IWA L;  2VUM H;  3ERS X;  2PQA A;  3HOW H;  1S72 A;  4IJL A;  4YWK A;  1Q81 C;  3AQQ A;  4L5S A;  1AH9 A;  3HOY H;  4LF5 L;  3AEV A;  1HZB A;  1X3G A;  3NBH B;  1YBY A;  4DV0 Q;  2ZJR A;  4LF6 Q;  2JA5 G;  2UXD Q;  3PO3 H;  3EN2 A;  2KHI A;  1N33 Q;  3K0X A;  1HZ9 A;  3H3V I;  1WOC A;  1Y1W H;  1Y1W G;  3I4M G;  3I4M H;  4DV2 Q;  4A3D H;  3GTG H;  3W5O A;  1Q86 C;  2UUB L;  2V1C C;  1B8A A;  2F3I A;  4LF4 L;  4NXN Q;  4JYA L;  1YHQ A;  4YHH Q;  4DV4 Q;  4JI1 L;  1DGS A;  4BY7 G;  1VQ5 A;  3KDF B;  3TRZ A;  1KC8 C;  1BKB A;  1VQK A;  2B63 H;  4GKJ L;  3CCR A;  2NZH A;  4POF A;  3PO2 H;  2OTL A;  3CAM A;  1C0A A;  2VNU D;  3BJU A;  4C3H H;  4X64 Q;  4APV A;  4DV7 L;  1UE1 A;  4JOI A;  2EXD A;  5ELO A;  4B3T L;  4P74 A;  3VDY A;  2JEB I;  1PH8 A;  5GAH C;  2K5V A;  4YCU A;  5ELN A;  3J7A 5;  3M85 A;  1KL9 A;  1Q46 A;  5C0X G;  1HR0 Q;  2IX0 A;  2B63 G;  2LXK A;  2CQO A;  4JI2 Q;  2GN5 A;  3CCQ A;  2NVT H;  1PH5 A;  5LMU Q;  3UDI A;  4A3C G;  2JA9 A;  5IP9 H;  1SR3 A;  4OX9 Q;  3CQZ H;  2HIV A;  2VQE L;  3BZK A;  2E5L Q;  5FLM H;  1YJ9 A;  4R4C A;  4DV4 L;  1E7Z A;  4HIM A;  4LF9 L;  2HT1 A;  2R92 G;  2NVX H;  1G51 A;  2OQ0 A;  2PNH A;  1C9O A;  3J81 i;  4PZ6 A;  5FJ8 G;  1KIX A;  4A3E H;  3WWV A;  4YWM A;  4OWW B;  2HHH Q;  3KF6 A;  4DKA C;  3AYH B;  2QGQ A;  1EIF A;  1RL2 A;  4C3I H;  3KJP A;  2VQF L;  4DV2 L;  2Z6K C;  1HR0 W;  5GAE C;  3G4S A;  1V9P A;  5C3E G;  1WCM H;  5IP7 G;  1L0W A;  1RIP A;  2UXD L;  2VZA A;  3AFQ A;  3CW2 C;  3ER0 A;  3J80 i;  5LMN Q;  1C7Y A;  2D0O A;  1QUQ A;  3RN2 A;  5IYB G;  1FJG Q;  3OTO Q;  4LF9 Q;  1VQ6 A;  2JEA I;  3GTO H;  1XTD A;  2BA0 A;  2L15 A;  3I2Z A;  4GN4 B;  1XJV A;  4B3S Q;  1XNR L;  1VQM A;  3U4Z A;  1K0R A;  3S1M H;  5C3E H;  4RG1 A;  4DUY L;  4A76 A;  3HOZ G;  2JE6 I;  1VQ9 A;  3NEL A;  2R6G A;  3PIP A;  1CKN B;  2N78 A;  1AE2 A;  3W1B A;  4A3L G;  3HKS A;  2UXB Q;  1LYL A;  4JI4 L;  3CCM A;  3S2D H;  3T1Y Q;  3LGJ A;  4DV5 L;  1N36 Q;  1MJE A;  2ATW A;  4YCV A;  1VS0 A;  2N3S A;  1D8L A;  3HOV G;  3M4Q A;  4R4O A;  2OCE A;  3S15 H;  4LF8 Q;  4X62 L;  4PZ8 A;  2XGT A;  2VL6 A;  4B3R L;  4O2D A;  4JI3 L;  4POG A;  1PH1 A;  3KF8 B;  4DR2 Q;  1SRO A;  3HOW G;  1IBM L;  4A3K G;  1EQR A;  1VQ8 A;  5EAY A;  2KBN A;  4DPG A;  4DNI A;  5FLX c;  4JYA Q;  4X65 L;  2YTX A;  4P73 A;  1N8R C;  1HNW Q;  5GQO A;  1E1T A;  3PUV A;  2UUB Q;  2R92 H;  2RHQ B;  4KHP Q;  4JI6 Q;  4IPC A;  4DR3 Q;  1NMG A;  4LW1 A;  2ASB A;  4DR6 Q;  3TRE A;  1JJC B;  1Y1V H;  3H0G G;  2YTV A;  4A3G G;  3TQY A;  1HJP A;  3AFP A;  3PO2 G;  2QEX A;  3W1G A;  4P75 A;  1NBW A;  2B29 A;  2R7D A;  2WB1 G;  2N49 A;  2RCN A;  1VQE A;  4R1J A;  4QJF A;  1BBU A;  1OXT A;  2IT1 A;  4QY7 A;  1N32 Q;  4GNX A;  2Z6K A;  2PI2 A;  4L5Q A;  1OXX K;  4R4Q A;  4B3M Q;  3BZC A;  1K3R A;  5IYB H;  4OON A;  1NY4 A;  2ZJP A;  4JI4 Q;  1FGU A;  4DR5 L;  3ULP A;  3A0J A;  1QZH A;  1J5E L;  4JI7 Q;  1A8V A;  1JT8 A;  1X55 A;  4UY8 C;  2IX1 A;  3S2H H;  5IY0 A;  3D0F A;  1L1O C;  1B7Y B;  2EQS A;  3JAM c;  1GM5 A;  4DAM A;  3RLO A;  4A3J G;  1N34 L;  4GOP B;  3S1Q H;  4B3S L;  2UUA Q;  1X56 A;  1GKH A;  1YHA A;  4X66 Q;  3K8A A;  3S1R H;  1EOV A;  3K7U C;  3M7N A;  5IYC G;  2CWA A;  4JI8 Q;  1TWH H;  1HH2 P;  1YVC A;  3ZJY C;  5BR8 L;  2MQH A;  2JA8 G;  3HOU H;  2JA5 H;  3HOZ H;  4PZ7 A;  3HKZ G;  5HY6 A;  1YIT A;  3FP9 A;  4PG3 A;  3TEH B;  2WFW A;  4JI6 L;  2VY3 A;  4OO1 G;  2AMC B;  4GKK Q;  1LM0 A;  4HID A;  2B3G A;  4EX5 A;  4XTC S;  1L1O A;  1XMO L;  2ZTC A;  3OW2 A;  1MIU A;  4X65 Q;  4GNX B;  5DLQ E;  1Q7Y C;  2BA1 A;  5C44 H;  1SFO H;  1JJG A;  4NXM L;  1HNZ L;  2YTY A;  1I6H H;  2DUD A;  1ASY A;  4GS3 A;  2A8V A;  5J3B A;  4UP9 A;  2NVQ H;  3RNU A;  1VCI A;  4P71 A;  1NE3 A;  1CUK A;  1YHB A;  3CCL A;  1N9W A;  1IL2 A;  3MEF A;  1VQL A;  2CKZ B;  3PV0 A;  1EIY B;  2R93 G;  3JAM i;  1I94 Q;  3HOV H;  4JBJ A;  4B3T Q;  3M3Y H;  4QIW E;  1U0L A;  3CP0 A;  3CME A;  4BY7 H;  1NMF A;  4X64 L;  3F1Z A;  3K7A H;  1NJI C;  3CMA A;  3UE0 A;  2WB1 E;  3E0E A;  5HGQ A;  3PSI A;  3G71 A;  4A3B G;  1QVG A;  4NXM Q;  1BBW A;  4DR4 L;  4JI1 Q;  2XTI A;  3CPW A;  2ID0 A;  2R93 H;  3J7Z C;  2LXJ A;  4KHP L;  1HZA A;  2F4V Q;  1YZ6 A;  3I4N H;  1NTG A;  4C2M H;  5GAG C;  1QUQ B;  3K81 C;  1Y1V G;  1L1O B;  3RZD H;  3TS2 A;  2WAQ G;  4BXX G;  1VQB A;  1GO3 E;  2R7Z G;  1YJW A;  1N33 L;  4IOC A;  3KF6 B;  3RLN A;  2MNA A;  4JI3 Q;  3M4O H;  4KLK A;  4QGU A;  5AJ3 Q;  3T1H Q;  2VQF Q;  2I5L X;  2KHJ A;  4BY1 G;  2VUM G;  3DM3 A;  1KRS A;  2OWO A;  1AE3 A;  4LF5 Q;  3PUZ A;  4IPG A;  4DV5 Q;  2Z0S A;  2Q2H A;  3CC7 A;  1N36 L;  1PYS B;  4LF7 Q;  4YCW A;  2VQE Q;  1W3S A;  4LUZ A;  1XPO A;  4BA2 I;  1PH2 A;  4IFD J;  1PH7 A;  1IXR A;  1O7I A;  3GTM H;  2EIF A;  5E7N A;  1WYD A;  3GTP H;  5JJI A;  2PQA B;  2JA6 H;  2UU9 L;  4L5T A;  2K14 A;  2ES2 A;  1FJG L;  3S1N H;  4IPH A;  1R9T H;  4HJ5 A;  1OXV A;  4HJ7 A;  3PF5 A;  4PMW A;  4HIK A;  1HNX L;  4Y52 H;  5AJ3 L;  2HQL A;  1IBL L;  2FXQ A;  4MTN A;  1SMX A;  3KDF A;  1FL0 A;  2DGY A;  3H15 A;  3GD7 A;  1CKN A;  4A3B H;  3IRB A;  4KI0 A;  3F2D A;  2MO0 A;  4ME3 A;  1WI5 A;  5M3F G;  4DR3 L;  1E1O A;  3UDF A;  4A3K H;  5M3M H;  3F2C A;  2PMZ E;  3KJO A;  4LUV A;  2KCT A;  1TXY A;  2NN6 I;  1IYJ B;  2AWN A;  2ZJQ A;  1TWF H;  4DV1 L;  2C35 B;  3L0O A;  2YU9 H;  4DR4 Q;  1FVI A;  2GVB A;  4NPS A;  5JEA J;  1XMQ Q;  2I5M X;  3STB D;  4YY3 Q;  2ALY B;  1OXS C;  4LFB Q;  3F2B A;  1EWI A;  4B3R Q;  1Q82 C;  3SGI A;  4A3C H;  4LNQ A;  3OYY A;  3K80 C;  3M4P A;  3A5U A;  1VQP A;  1K9M C;  1K8G A;  4A3D G;  2HIX A;  2UUC Q;  2F52 A;  3T1Y L;  1PFS A;  4P72 A;  4TVA B;  4GN5 A;  1JJ2 A;  4GN3 B;  2Q2I A;  1L2F A;  5IWA Q;  4RMF A;  5GAD C;  3GO5 A;  2VS1 A;  3B6Y A;  1PV4 A;  4MZ9 A;  2PI2 E;  4R4T A;  3KFU A;  5C4X G;  1EUJ A;  1T9H A;  3U4V A;  4A93 G;  3UE1 A;  4ALP A;  2JA8 H;  4AQY Q;  1KXL A;  4O0A A;  4JI5 Q;  5IYD H;  3EBE A;  1Z47 A;  3HFZ B;  3MXN B;  1U5K A;  4AH6 A;  5M5W H;  4JCV E;  1X54 A;  1KHI A;  3GTQ H;  2GVA A;  4A3I H;  5IT9 c;  2QA4 A;  3H3V H;  2WP8 J;  5C0X J;  4WJ3 M;  4OWT B;  1P8L A;  5LMN L;  3J80 c;  4LFA L;  3JC6 6;  4AYB E;  5C4X H;  4BXX H;  2UXC L;  1Q12 A;  4DV3 L;  1VQN A;  4A3F G;  3HOU G;  2K50 A;  5IP7 H;  2WAQ E;  1IBL Q;  4JV5 L;  3GTJ H;  1V1Q A;  3GTL H;  2K5N A;  3L7Z C;  4DV0 L;  1PA6 A;  1PH3 A;  3HKZ E;  4OWX B;  4K0K Q;  1K8A C;  1VQO A;  2JQO A;  3D31 A;  3L2P A;  2R7F A;  1S40 A;  2UU9 Q;  4A3M G;  3KYH C;  4A3M H;  2YV5 A;  3I55 A;  1KQS A;  2AKW B;  3CCE A;  2E5L L;  1M1K C;  4OX9 L;  1K73 C;  4AQY L;  4DK3 C;  3BU2 A;  3NEN A;  3UDX A;  4JI0 L;  4A3F H;  3PO3 G;  3STB C;  2ZTE A;  1OTC A;  1PYB A;  1UWV A;  4JI2 L;  4QQB X;  1PVO A;  2NZO A;  4UP7 A;  1ASZ A;  4DR7 L;  4DR5 Q;  4LF7 L;  1SE8 A;  3CPF A;  4R4I A;  2K4K A;  4EQ5 A;  1PH6 A;  2MO1 A;  1YI2 A;  4OO1 I;  3U50 C;  1G6P A;  1V43 A;  2CWP A;  2YYZ A;  4DAY B;  3PF4 A;  4DUZ Q;  2Q2U A;  4DV7 Q;  1CKM A;  1QVC A;  3G6E A;  3CCJ A;  1IZ6 A;  1VQF A;  1I3Q H;  1N32 L;  1UE7 A;  4LUO A;  3S14 H;  4QL5 A;  3J81 c;  1X3E A;  3H0G H;  4A3G H;  1HNZ Q;  1XMQ L;  3I4O A;  5C4J H;  4Y7N H;  1MJC A;  1B70 B;  1A0I A;  1X65 A;  4WJ4 A;  2JA6 G;  3KOJ A;  4TQU S;  5FLM G;  3U58 A;  1UE5 A;  4GLA C;  3G48 A;  1YEZ A;  2NN6 G;  1CSQ A;  3S17 H;  1CSP A;  2JK8 A;  4IPD A;  1IBM Q;  1K83 H;  1EFW A;  4JBM A;  4HJA A;  1X6O A;  1WFQ A;  2K52 A;  4BBR G;  2IY5 B;  1VQA A;  4DR1 Q;  1MKH A;  2IHE A;  4A3J H;  4LF8 L;  4BY1 H;  1UE6 A;  2OTJ A;  2VW9 A;  1X3F A;  1EQQ A;  4IFD G;  2K75 A;  4DUZ L;  1Q8K A;  4DV6 L;  1J6Q A;  2OQK A;  4X66 L;  4NB3 A;  4GOP A;  3PCO B;  4LFC Q;  3ICE A;  2KCM A;  5JEA G;  1SRU A;  1VQI A;  1QZG A;  1Z9F A;  4BBS G;  4KHZ A;  3PUW A;  4JBK A;  2R7Z H;  3HOX H;  3Q8D A;  4A93 H;  1VQD A;  1D7Q A;  2AWO A;  4JI0 Q;  1Y14 B;  1XPU A;  1IBK L;  1XNQ L;  4J15 A;  1HZC A;  3NEM A;  4JI7 L;  1J5E Q;  1XNR Q;  3PIO A;  3UDG A;  3RZO H;  4JBW A;  5C0X I;  1E3P A;  4LFC L;  1VQG A;  4IJH A;  4AYB G;  1KAW A;  3OTO L;  3CCU A;  1KD1 C;  3RLF A;  3A5Z B;  1GD7 A;  5M3M G;  4JC0 A;  2ZM6 L;  4A3I G;  2CCZ A;  1QVF A;  4K0K L;  4HIO A;  3CD6 A;  5IYC H;  2I5H A;  4FDB A;  4IO9 A;  3T1H L;  5H1S E;  4IOA A;  1S3O A;  4JV5 Q;  5M5Y H;  1LUZ A;  2K5H A;  3FHW A;  1WCM G;  3A74 A;  3FKI G;  4DV3 Q;  5IYD G;  4H02 A;  1JB7 A;  1A63 A;  2HHH L;  1JE5 A;  4UP8 A;  4YWL A;  3RR5 A;  4DK6 C;  1SLJ A;  4HJ9 A;  1Q1E A;  1HNW L;  2ZM6 Q;  3J81 j;  1I50 H;  2F4V L; 
#chains in the Genus database with same CATH topology
 3Q23 A;  3RN5 A;  4HJ8 A;  1HRJ A;  4RAU C;  3FRP B;  5C44 G;  5M3F B;  4FF2 A;  4GLV B;  1SFO B;  3VR5 A;  1WCM B;  2EJG C;  2A19 A;  5DAU A;  1YNJ D;  1D5Z C;  1UNS A;  4MNO A;  1CTM A;  1I94 L;  1YIJ A;  5COR A;  4DV6 Q;  4DAP A;  1TS4 A;  2L4N A;  1P16 A;  4F7X A;  3K59 A;  2DN8 A;  1KDC A;  3MA2 B;  1W2B A;  4LFB L;  3HOX G;  4HAE A;  4KJO A;  4BBR H;  3I56 A;  1BO0 A;  4DR6 L;  2CHB D;  5G3L D;  4CBV A;  1E22 A;  3I4N G;  1Q1B A;  1TWG H;  1EWH A;  1A2T A;  4GKK L;  4HCE A;  1TKW B;  4DR2 L;  5BR8 Q;  3CCS A;  2E2I B;  3S24 A;  3MXP A;  1BCP C;  5IE8 A;  1PH9 A;  1AZP A;  3GTO B;  2EDG A;  1D1K A;  3PUY A;  3GTK B;  1EZ6 A;  1EL0 A;  2E2J H;  2B2Y C;  3KLW A;  1VQ4 A;  4RCN A;  2UXB L;  3I7F A;  3CCV A;  2L55 A;  3CF5 A;  3NBI A;  4Q5V A;  1ENC A;  3HOW H;  3NP8 A;  4L5S A;  5C3W A;  3AEV A;  2F0T A;  3NBH B;  1FYC A;  4BS9 A;  4DV0 Q;  5KIX A;  4K2L A;  2QCP X;  2JA5 G;  1EYA A;  1GUS A;  1KLU D;  3K0X A;  3TBI B;  4ABN A;  4ZLT F;  2L9H A;  1IW7 D;  1NR4 A;  1IHZ A;  2V1C C;  3CU7 A;  4KKS A;  4YHH Q;  4BY7 G;  1JIC A;  3OWE B;  1IL8 A;  1JOO A;  4QMG A;  2SNM A;  1C0A A;  3PO2 H;  2SNS A;  3BJU A;  5C3E B;  4RGO S;  2WKC A;  2X6G A;  4X64 Q;  1UE1 A;  4JOI A;  1ICF B;  2JEB I;  1LT3 D;  4YCU A;  1R4P B;  4RGT A;  5I9P A;  5FLX E;  3J7A 5;  1WTO A;  3HG9 A;  1Q46 A;  3EJI A;  5E3F A;  5C0X G;  4U67 3;  4HSV A;  1IKM A;  2GN5 A;  3CCQ A;  4HMJ A;  4EQO A;  1ZYR C;  1EZ8 A;  2E5L Q;  5FLM H;  4R4C A;  4DV4 L;  4HIM A;  1JCK B;  4LF9 L;  2HT1 A;  1VF5 C;  2EY6 A;  2OQ0 A;  4CDD C;  3J81 i;  2HCI A;  4PZ6 A;  5FJ8 G;  4YWM A;  3ND8 A;  1EIF A;  2PZT A;  2VUM B;  1STG A;  2NVY B;  1V9P A;  1WCM H;  1SE4 A;  3J7A V;  5I4D A;  2VZA A;  4PMC A;  1C7Y A;  1DON A;  3OHX C;  3M4Y A;  5KRU A;  1VQ6 A;  3QJY A;  1B3A A;  2JEA I;  2BA0 A;  1MD2 D;  1XJV A;  1XNR L;  2CH4 A;  3U4Z A;  1LAB A;  3QB3 A;  5C3E H;  5CYU A;  4DUY L;  1F2L A;  5D14 A;  5ELD A;  3OW7 A;  2R6G A;  5DEH A;  2N78 A;  1AE2 A;  2J7Z A;  3RD4 A;  3HKS A;  1LYL A;  4JI4 L;  3CCM A;  1KNA A;  4JK1 C;  1B3Q A;  1MJE A;  3GTM B;  3DWP A;  2JSO A;  4YCV A;  2JXM B;  1VS0 A;  3M4Q A;  4X62 L;  2XGT A;  4O2D A;  1PH1 A;  3S1M B;  4CGY B;  2DNC A;  3W3A A;  1SJH D;  3NXW A;  4FXD A;  2Z9H A;  3D3R A;  1BF4 A;  4DNI A;  4JYA Q;  3MTS A;  5ELF A;  1PMR A;  1HNW Q;  3PMF A;  1GHK A;  3PUV A;  1DXM A;  2UUB Q;  2NN6 H;  2RQX A;  2RHQ B;  2XIW A;  2X69 A;  1NMG A;  4LW1 A;  4H44 C;  1JJC B;  1Y1V H;  4BY1 B;  4A3G G;  2MGS A;  3PO2 G;  1Y69 U;  1TS5 A;  2QEX A;  4P75 A;  2B29 A;  2WB1 G;  3FKI B;  4GNX A;  2WAQ B;  2Z6K A;  4L5Q A;  1OXX K;  4B3M Q;  2JP1 A;  1FGU A;  1J5E L;  3HOZ B;  1D5M C;  3OPO A;  2BDN A;  5JOB A;  1ZYR D;  4OGQ C;  4KV6 A;  1L1O C;  2EQS A;  3JAM c;  1BBX C;  3VA7 A;  2C9O A;  4X3S A;  4A3J G;  1ESF A;  3H09 A;  1PTO C;  4B3S L;  2UUA Q;  5IT9 E;  1YHA A;  1YNN C;  3K8A A;  3GV3 A;  4ULL A;  1EOV A;  4C3I G;  2CWA A;  4X3U A;  4JI8 Q;  1TWH H;  1WTH A;  3ZJY C;  2JA8 G;  3VYT A;  2K04 A;  3J7Y W;  5CV5 A;  5HY6 A;  1YIT A;  3KLS X;  1H9R A;  2WFW A;  3BYT B;  4OO1 G;  4OO1 H;  2AMC B;  2XSC A;  1XMO L;  3OW2 A;  1MIU A;  1BCP B;  4GNX B;  2K32 A;  1SFO H;  3T16 A;  4NXM L;  3ITP A;  4UAI A;  3LWE A;  1ASY A;  4GS3 A;  1LLR D;  2A8V A;  2RKS A;  1A3V A;  1EY4 A;  1YHB A;  3MEF A;  3PV0 A;  1EIY B;  1PTO D;  1H9S B;  3M3Y H;  3S9W A;  1U0L A;  3CME A;  1JOR A;  2F0S A;  1NMF A;  1ILP A;  3E0E A;  4A3J B;  3G71 A;  2DY7 A;  1BBW A;  1LTB D;  1RD9 D;  1I6H B;  4DR4 L;  2XTI A;  3CPW A;  2LXJ A;  1QWY A;  3S2D B;  4A3K B;  4C2M H;  1TS2 A;  5GAG C;  1JB3 A;  3SK6 A;  1YJW A;  1N33 L;  3KF6 B;  2KUM A;  3M4O H;  2B63 B;  1CA5 A;  4QGU A;  5AJ3 Q;  2PW5 A;  2Z8L A;  2VQF Q;  3MXG A;  2VUM G;  3C46 A;  4LF5 Q;  1KDA A;  1UEA B;  1PYS B;  4FYD A;  4YCW A;  3GTJ B;  1W3S A;  1TT2 A;  1U4R A;  2K03 A;  3SK5 A;  1EU3 A;  1O7I A;  2EIF A;  5E7N A;  1WYD A;  1I6V C;  2PQA B;  1QJO A;  1FR3 A;  1QNK A;  1PRT F;  4JW0 A;  4K6L A;  1HUM A;  1T5E A;  1OXV A;  1PZK D;  1STE A;  2PZU A;  2NVT B;  3C1F A;  4MTN A;  2K28 A;  4FNF A;  3KDF A;  1GOZ A;  5M5Y B;  1DM0 B;  1TY2 A;  4KI0 A;  2MO0 A;  4ME3 A;  4DR3 L;  5FO8 B;  3KK7 A;  1E1O A;  3I73 A;  3UDF A;  1PRT C;  3E6Z X;  2ZJQ A;  1JOK A;  4DV1 L;  4G7O C;  2OEO A;  3L0O A;  2ICI A;  2GVB A;  4YY3 Q;  2ALY B;  2D5D A;  1OXS C;  3FVQ A;  4B3R Q;  3H6M A;  3NQI A;  4LNQ A;  1K8G A;  1D6E C;  1PFN A;  2K33 A;  4P72 A;  4C3J B;  1EOT A;  1M8A A;  2Q2I A;  4RMF A;  4RH6 A;  3GO5 A;  2VS1 A;  1PV4 A;  2Q8T A;  4MZ9 A;  2PI2 E;  4R4T A;  3KFU A;  2SOB A;  5CMD A;  4A93 G;  3PO3 B;  1KXL A;  2A69 D;  2J4X A;  1Z47 A;  1I4X A;  1KHI A;  2P5Z X;  1O7Y A;  2QA4 A;  5T1G A;  4WJ3 M;  4KK7 A;  3JAM L;  5LMN L;  3JC6 6;  4DV3 L;  2RDF A;  5A2Q L;  5FO7 B;  2TSS A;  4JV5 L;  5A2Q E;  1ET9 A;  4IUT A;  1F9Q A;  2K5N A;  4DV0 L;  3HKZ E;  3O13 A;  1K8A C;  4E6I A;  2R7F A;  4A3M G;  3KYH C;  4A3M H;  2YV5 A;  1M1K C;  4AQY L;  4Y7N B;  1HTP A;  3BU2 A;  4KN4 C;  2KCC A;  1OTC A;  3A8J E;  1V8Q A;  5EBD A;  1I3Q B;  4IZ8 A;  2A69 C;  1AP0 A;  1V43 A;  1IW7 C;  3G6E A;  1DYQ A;  1N32 L;  2O4X A;  4EVO A;  5DM6 3;  3J81 c;  1K28 A;  4A3G H;  1MJC A;  1FGB D;  4HTH A;  1SAP A;  3H91 A;  3URY A;  2H1E A;  4KMU C;  3U58 A;  3EA6 A;  3K5M A;  3S17 H;  2JK8 A;  1PZI D;  1SYC A;  1F77 A;  2XNA C;  1VQA A;  1MKH A;  2IHE A;  4HN7 A;  1GJX A;  1UE6 A;  1EQT A;  2K75 A;  3ICE A;  2OQK A;  4NB3 A;  4GOP A;  4LFC Q;  1AN8 A;  2Q8I B;  1CA6 A;  1DZ1 A;  3VR3 A;  2RSO A;  4K8I A;  1SRU A;  4BBS G;  1J9O A;  1D7Q A;  3PUW A;  2R7Z H;  3Q8D A;  1F9R A;  4JI0 Q;  1XPU A;  1XNR Q;  3UDG A;  4JBW A;  5C0X I;  4LFC L;  4JBK A;  1YNJ C;  2CCZ A;  3RLF A;  3A5Z B;  2ZM6 L;  3CD6 A;  1A3U A;  3RUZ A;  1STA A;  1S3O A;  2N55 A;  1LUZ A;  4I7A A;  3NE5 B;  5IYD G;  4OIJ A;  2EYJ A;  2O5I C;  4N9T A;  1L0X B;  4HJ9 A;  5IT9 L;  1I50 H;  1IYU A;  1AZQ A;  1G91 A;  2EXZ A;  4J1M A;  1I5F A;  4GLX A;  1N34 Q;  4L8J A;  1G29 1;  1XNQ Q;  3FKI H;  3KLS A;  2QDB A;  4I65 A;  3TP8 A;  3SK8 A;  5LHY 1;  2ZT9 C;  3HZX A;  5IP9 G;  4C3J G;  4C3J H;  4A3L H;  2NVX B;  1F2M A;  4HED A;  1VQ7 A;  2F0K A;  5I2Y A;  1SN8 A;  4UDU C;  1VQC A;  2E2I H;  4DR1 L;  4ZK9 B;  4QUC A;  1PTO B;  3FEW X;  4JG2 A;  3E9H A;  4A4I A;  4YY3 L;  3I90 A;  5M3F H;  4QUF A;  2N8N A;  1X9N A;  4DV1 Q;  2CQA A;  4YHH L;  1ONL A;  3T53 B;  1TWA H;  1JMC A;  4NXN L;  4LF4 Q;  3VA5 A;  4A75 A;  1XMO Q;  3VR4 A;  5CV8 A;  2JA7 G;  2F0M A;  1WJJ A;  1W6J A;  3KF8 A;  2RF4 A;  3GTK H;  2A1A A;  2F0U A;  5NUC A;  1YNX A;  4A3G B;  2JJQ A;  1VQH A;  2XWB B;  4LF6 L;  3T4A C;  2EYF A;  4X62 Q;  1HNX Q;  4OXP A;  5IIF A;  1PHJ A;  2G5D A;  5G3L F;  3DUZ A;  2F0D A;  4IUN A;  3CC2 A;  1E24 A;  2HQE A;  4JI5 L;  1KRT A;  5JJK A;  1S4Z A;  1T5X D;  1QOH A;  2D2C C;  1IBK Q;  4BBS H;  1UUP A;  1OXU A;  2BH8 A;  2Y0S E;  1B4O A;  4C3H B;  1PRT B;  2KEN A;  3K5N A;  5IWA L;  2VUM H;  3ERS X;  4Q0F A;  2PQA A;  1X3Q A;  3RMH A;  3D4R A;  1HQR D;  4B9X A;  1G6Z A;  3C3L A;  1QCB D;  3ZYY X;  3HOY H;  2QW7 A;  2F03 A;  1XWE A;  3GTP B;  1LTA D;  2B2V A;  3A54 A;  3JAM E;  3EN2 A;  1N33 Q;  3H3V I;  5IOC A;  1WOC A;  1SE3 A;  3GTG H;  2UUB L;  1PFM A;  2G9D A;  1F2Y A;  1SNQ A;  2MUY A;  4B9W A;  2F3I A;  3OIP A;  4JYA L;  3MFY A;  1DGS A;  2A5H A;  3S16 B;  3TRZ A;  1TII D;  3I72 A;  1BKB A;  1VQK A;  3CCR A;  2NZH A;  4POF A;  3CAM A;  4C3H H;  2Q8R E;  2EYP A;  5FLX L;  1SNO A;  4CJ2 C;  1PYW D;  4B3T L;  3VDY A;  4DK1 A;  3E0J A;  1DOL A;  3FMC A;  3M85 A;  5M5X B;  2F0N A;  1G8Z D;  3TZU A;  2IX0 A;  2LXK A;  2F0O A;  3VYU A;  1PH5 A;  1K83 B;  5LMU Q;  3UDI A;  3VYR A;  2JA9 A;  3CQZ H;  2HIV A;  3BZK A;  2NVX H;  5BN4 A;  1K8O A;  2NZ1 D;  4A3E H;  2VQF L;  2QGQ A;  3KJP A;  3D4D A;  1HR0 W;  5GAE C;  5C3E G;  5IP7 G;  3KUP A;  5KND A;  1RIP A;  1PZJ D;  4H0L C;  1A6X A;  5LMN Q;  3D6W A;  2D0O A;  1TWA B;  1QUQ A;  5IYB G;  3NTK A;  4FF3 A;  3GTO H;  1RCV D;  1JE4 A;  5EQ0 A;  5T1I A;  3AU7 A;  4RHR A;  1EIG A;  5JPN C;  1VQ9 A;  1EU4 A;  5E1F A;  2LMC B;  2UXB Q;  1DJR D;  3T1Y Q;  3LGJ A;  3S1R B;  2KA7 A;  3L3O C;  2C5C A;  2OT2 A;  3ND9 A;  1U4M A;  4DXF A;  3HOV G;  2OCE A;  1PDQ A;  4LF8 Q;  4PZ8 A;  3GP7 A;  3J81 E;  1GUT A;  1Q90 A;  2PW7 A;  4CKE A;  4DR2 Q;  2A6H D;  1SNC A;  3HOW G;  1EQR A;  1VQ8 A;  5EAY A;  4AYB B;  5FLX c;  3EFX D;  1FNW A;  1N8R C;  3A7L A;  4IPC A;  2OF1 A;  4DR3 Q;  4RHS A;  4DR6 Q;  2B2W A;  2B2T A;  3E3X A;  1NBW A;  2R7D A;  1BBU A;  2R61 A;  2PI2 A;  4C3I B;  1CT1 D;  2PCF B;  4MIU A;  3BZC A;  1K3R A;  5IYB H;  1LTI D;  4OON A;  4JI4 Q;  4DR5 L;  1QZH A;  4IUR A;  3ULP A;  2XWJ B;  3IFD A;  1JT8 A;  3S2H H;  2PMZ B;  3RLO A;  3DHQ A;  3OMC A;  3MZ5 A;  2IWH A;  3I4L A;  5IGF A;  1LTR D;  1DOM A;  4V19 0;  2N88 A;  5D3D A;  3M7N A;  5IYC G;  1F9P A;  1YVC A;  5BR8 L;  2MQH A;  4PZ7 A;  3HKZ G;  4J8Q A;  3FP9 A;  3TEH B;  2DJF C;  2VY3 A;  4JI6 L;  1TWH B;  4J6H A;  1LM0 A;  4HID A;  4MN3 A;  4WJW A;  1VMC A;  4R8N A;  1Q7Y C;  2BA1 A;  1JJG A;  2MPM A;  1HXY D;  4MTK A;  3ERQ A;  2O5J C;  1I6H H;  4C1N I;  1BQQ T;  5J3B A;  2NVQ H;  3RNU A;  1VCI A;  3S15 B;  1S5F D;  3QIA A;  5CR3 A;  2AUK A;  3MXU A;  3MVV A;  4OEL B;  3GTQ B;  2R93 G;  4EGV A;  4BY7 H;  4X64 L;  5EBC A;  2A6H C;  1WD1 A;  5HGQ A;  5HGT A;  4NXM Q;  4RGM A;  4K5W A;  4CKC A;  4KHP L;  1YZ6 A;  3I4N H;  1C4Q A;  2HDM A;  3H3V C;  5FKA C;  1CK1 A;  3TS2 A;  2WAQ G;  3K7A B;  4IOC A;  2ENB A;  3D8G A;  4KLK A;  3PO2 B;  4BY1 G;  1GUO A;  3C2P A;  1AE3 A;  2F0Q A;  2K5D A;  2KVM A;  3SK4 A;  4QIW B;  3PUZ A;  4IPG A;  4F8M A;  5IGE A;  2VQE Q;  1D5X C;  2ZXO A;  1FD7 D;  1MBY A;  3GQB A;  4IUQ A;  1PH7 A;  1C48 A;  2A68 D;  5JJI A;  2CW0 D;  4XQJ A;  2K14 A;  1FJG L;  2Z4I A;  4HJ5 A;  4PMW A;  4HIK A;  5C4H A;  1FL0 A;  2LY7 A;  3H15 A;  1HA6 A;  1CKN A;  1KDB A;  3IRB A;  4ID6 A;  1RJT A;  1WI5 A;  5LL6 S;  3LX0 A;  2E76 C;  5M3M H;  2PMZ E;  1TXY A;  2AWN A;  1TWF H;  1CQF A;  4NPS A;  3SHL A;  3TP7 A;  2EYM A;  4DFA A;  4LFB Q;  1G2S A;  2JA5 B;  3SGI A;  3WDN A;  3K80 C;  1WTP A;  3RZD B;  2HIX A;  2F52 A;  3BG3 A;  1JJ2 A;  5C0X H;  5KNC A;  5EKL A;  1BOS A;  3U4V A;  3QWN A;  3S17 B;  3A8K E;  2JA8 H;  1EFI D;  1BR9 A;  3HFZ B;  3FDT A;  4DK0 A;  5M5W H;  4KY5 A;  3GTQ H;  4K2K A;  4MHE A;  2GVA A;  4IUU A;  5IT9 c;  3OOC A;  4IAL A;  2WP8 J;  3OSO A;  4AYB E;  5EGT A;  2UXC L;  3S14 B;  2AQ2 B;  3HOU G;  1EY5 A;  3NPP A;  4ZQ3 A;  4K0K Q;  4H13 C;  2E2H B;  1KQS A;  3CCE A;  4DK3 C;  1ML0 D;  1SBB B;  3PO3 G;  1UWV A;  3V96 A;  1R9T B;  5L37 A;  4PV1 C;  5CBA E;  4DR5 Q;  2XVS A;  2BE5 D;  2FIN B;  2K4K A;  2KED A;  4EQ5 A;  1PH6 A;  1QE6 A;  4OO1 I;  3U50 C;  2CWP A;  2L5T A;  3SXH A;  4DAY B;  2IW3 A;  4DV7 Q;  1CKM A;  3A55 A;  3BS1 A;  5CV9 A;  3CCJ A;  1VQF A;  1I3Q H;  1H9S A;  4LUO A;  3EQL C;  3A7A B;  2OXP A;  5I9O A;  5C4J H;  4Y7N H;  1A0I A;  1X65 A;  4WJ4 A;  5DNF A;  3KOJ A;  2F3V A;  5FLM G;  1MSH A;  4GLA C;  3G48 A;  1YEZ A;  4CDC C;  1AFP A;  2A73 B;  1EFW A;  4HJA A;  5KYI A;  1WTQ A;  2BDO A;  2F0F A;  2GA4 B;  2K52 A;  4DR1 Q;  3R3O A;  4LF8 L;  5J1Z A;  1ZKO A;  2OTJ A;  2QDL A;  2IPK D;  2VW9 A;  4IFD G;  4DUZ L;  4DF7 A;  4A3E B;  3BVM A;  2WV6 D;  4UHV A;  1VQI A;  3CQZ B;  1Z9F A;  1KNE A;  2PYK A;  4KHZ A;  4X3T A;  2F0V A;  4OL7 A;  3LNN A;  4FF1 A;  2MHV A;  1I4Q A;  3PIO A;  1EEI D;  1VQG A;  2Z4H A;  4IJH A;  3OTO L;  3CCU A;  1GD7 A;  1QVF A;  3NWS A;  4K0K L;  3S1Q B;  1SYF A;  3K6O A;  1RF2 D;  4IOA A;  4LK1 C;  3I3C A;  1SEB D;  3NHH A;  3T13 A;  1WCM G;  2B2Y A;  1SYG A;  5C4J B;  4KY6 A;  1B53 A;  2HHH L;  4FVM A;  1JE5 A;  4UP8 A;  3RR5 A;  1SLJ A;  4K5V A;  2L0C A;  3J81 j;  4KKU A;  5GRO A;  3EIV A;  3FPP A;  4HSP A;  2E2D C;  2ZXP A;  1S5B D;  3DEP A;  5DM7 3;  1ZEQ X;  2E8G A;  2NVY H;  3DXJ C;  2RSN A;  4X6A H;  1TQO A;  4ZRZ A;  1XYI A;  4JVZ A;  1ET6 A;  3Q22 A;  5M5X H;  2K5Q A;  5IOD A;  3J81 L;  1EYC A;  3TS0 A;  2B2T C;  3DLL A;  2D0P A;  4C1N K;  2AHO B;  1J8I A;  1BUV T;  3MEH A;  3TDQ A;  1CQV A;  3CC4 A;  3ULL A;  2HD3 A;  3S16 H;  1SYD A;  3KLR A;  1WD0 A;  4L5R C;  1SND A;  1K0S A;  1CKO A;  2ZTD A;  2I0Q A;  1B9M A;  1CZG A;  1LT6 D;  5FJ8 H;  3E9I A;  3HS0 C;  4JOI C;  2CFM A;  2X6L A;  3G6J B;  1SMY D;  3D6C A;  3L9A X;  2UXC Q;  4M1U B;  4UPA A;  5K36 G;  1EY7 A;  4IFD I;  1GVP A;  4XQQ A;  4AIM A;  1TR5 A;  2Q2T A;  2E2H H;  2BE5 C;  3HOY G;  1H9K A;  2RHS B;  3CXC A;  2JA7 H;  2MFI A;  3RZO B;  4DR7 Q;  4LWC A;  4TSS A;  3Q6S A;  1HR0 L;  1W6K A;  3M9B A;  4KKT A;  4K5X A;  3IFT A;  4IJL A;  1Q81 C;  3AQQ A;  1PFB A;  1AH9 A;  1II3 A;  1ROD A;  1A15 A;  2FJ2 A;  2KHS A;  1JC7 A;  1MSG A;  4LF6 Q;  2UXD Q;  2KHI A;  1LAC A;  1Y1W H;  1Y1W G;  3I4M G;  2M00 A;  3I4M H;  3V2T A;  4A3D H;  5BN5 A;  3MWY W;  3W5O A;  3OIQ A;  4XYQ A;  2WII B;  4LF4 L;  4NXN Q;  4G7Z C;  1YHQ A;  5IGC A;  1H9M A;  4JI1 L;  4HR7 B;  1VQ5 A;  3KDF B;  1KC8 C;  4GKJ L;  2K6A A;  2F1M A;  3CKI B;  2VNU D;  2RA4 A;  2KQ3 A;  3ONA B;  4APV A;  4DV7 L;  3HP3 A;  5CC4 A;  4ZKC B;  1STY A;  1KL9 A;  3P75 A;  1I4R A;  2HDL A;  4I7Z C;  1HR0 Q;  2B63 G;  1U9R A;  2CQO A;  2LKV A;  4JI2 Q;  2NVT H;  5CV7 A;  4G57 A;  5IP9 H;  4H7B A;  4OX9 Q;  2VQE L;  1YJ9 A;  1E7Z A;  2WIN B;  1TU2 B;  1G51 A;  1AEX A;  1C9O A;  3K0Y A;  3WWV A;  4DKA C;  1RL2 A;  4C3I H;  4DV2 L;  1CM9 A;  2Z6K C;  3G4S A;  1BCP D;  3N6R A;  1HHV A;  1L0W A;  5FO9 B;  3J80 i;  4NKL A;  2EY1 A;  1CI3 M;  4L6T B;  3I91 A;  2R93 B;  1XTD A;  2L15 A;  3I2Z A;  2WKD A;  1VQM A;  1VDZ A;  1O7Z A;  4XT3 B;  3S1M H;  3HOZ G;  2JE6 I;  2A74 C;  3WOE A;  1EY8 A;  3NEL A;  1CKN B;  1E2V A;  1HPC A;  2QEJ C;  3W1B A;  1STH A;  5CBE E;  3U9S A;  3S2D H;  4DV5 L;  4WFN 3;  5ELE A;  1N36 Q;  2IL8 A;  2N3S A;  3S15 H;  2WB1 B;  4EQP A;  3AMU A;  4POG A;  3J80 L;  4ILW A;  1SRO A;  3K5L A;  2J0T D;  4BY7 B;  2KBN A;  4X65 L;  4P73 A;  5GQO A;  1E1T A;  1EQV A;  1NR2 A;  4JI6 Q;  3GTG B;  1HFN A;  3NTH A;  3H0G G;  2YTV A;  3AFP A;  2ICE C;  2L12 A;  4WRD A;  3W1G A;  1N32 Q;  2IT1 A;  1Q3L A;  4XDX A;  1NCV A;  1E2Z A;  4FO2 A;  4RFB A;  2NTS A;  2ZJP A;  1TWC B;  3A0J A;  1S5D D;  3CHB D;  3MAQ A;  4UY8 C;  3NBH A;  1SYB A;  4O1N A;  4C3H G;  3D0F A;  4FF4 A;  1GM5 A;  3MXN A;  2QKI C;  3IKJ A;  5K5P A;  1Y8O B;  1N34 L;  4DN4 M;  4GOP B;  3S1Q H;  2K05 A;  4NMZ A;  1GKH A;  4TRD A;  3K7U C;  2NVQ B;  5EPL A;  4S3S A;  4R9W A;  4DAV A;  4KTA A;  4PG3 A;  1TWF B;  2Z1C A;  4EX5 A;  1L1O A;  2ZTC A;  2WAC A;  4F87 A;  5D3I B;  5I6Y A;  1O78 A;  5DLQ E;  2CVR A;  1I4P A;  4DAY A;  5C44 H;  5KGU A;  1WTW A;  2YTY A;  1CZW A;  2EZV A;  4DA2 A;  4M8A A;  5COY A;  4CKB A;  1NE3 A;  4CJ0 B;  1N9W A;  1RKN A;  2B2W C;  2XRS D;  4PMB A;  3JAM i;  4JBJ A;  1ENF A;  4B3T Q;  5ELC A;  1YNN D;  3BZD B;  3CP0 A;  1E0B A;  2FMC A;  4G4K A;  4KHV A;  1NJI C;  2PZW A;  3CMA A;  5EKK A;  1Z6H A;  1LT5 D;  1G2T A;  2R93 H;  3J7Z C;  2A6E C;  1GXD C;  4CDF C;  1NTG A;  2A68 C;  3K81 C;  5IGG A;  1Y1V G;  1L1O B;  3RZD H;  3M7G A;  4ZCK A;  4BXX G;  1VQB A;  2K7V A;  4DNT B;  1I4H A;  1MI2 A;  1JQY D;  3T1H Q;  1FNU A;  2KHJ A;  1EY9 A;  2B8F A;  3DM3 A;  1KRS A;  2OWO A;  4QF4 A;  3BDL A;  4ODG A;  4DV5 Q;  1N36 L;  2Q2H A;  3VR6 A;  4LF7 Q;  1B50 A;  2BOS A;  3HRZ C;  4LUZ A;  3K57 A;  2AUJ D;  4IUP A;  1BXT A;  1IXR A;  5K36 H;  5C4X B;  3GTM H;  3BDC A;  2JA6 H;  4L5T A;  4IPH A;  2FFK B;  1R9T H;  3PF5 A;  4Y52 H;  1HNX L;  1VMP A;  4JPB W;  5AJ3 L;  4A3D B;  1SMX A;  3GD7 A;  3A8I E;  1AW7 A;  1EY6 A;  2EPB A;  3F2D A;  5M3F G;  1V1P B;  1PLF A;  4HCS A;  4A3K H;  1QNU A;  3F2C A;  3KJO A;  2BCO A;  2VB2 X;  4LUV A;  2KCT A;  4K8J A;  2NN6 I;  1IYJ B;  2C35 B;  4DR4 Q;  1FVI A;  2K01 A;  5JEA J;  4A93 B;  2I5M X;  5I2X A;  1EWI A;  4Z9C B;  2EE1 A;  4A3F B;  1Q82 C;  5KYL A;  2B39 A;  1BNZ A;  4A3D G;  3A5U A;  1DOK A;  1K9M C;  3R93 A;  2UUC Q;  3BDO A;  2EYL A;  2F4I A;  3T1Y L;  4TVA B;  4GN5 A;  1RTN A;  4GN3 B;  1L2F A;  5IWA Q;  3HEJ A;  1F9S A;  4DXG A;  3B6Y A;  5C4X G;  1Q8I A;  1EUJ A;  1T9H A;  4ZUI A;  3UE1 A;  4ALP A;  4AQY Q;  4JI5 Q;  2JA7 B;  4ZYS A;  3R2T A;  2CW0 C;  2FMM A;  2F0I A;  4LFA L;  2AQ1 B;  4BXX H;  1Q12 A;  3X3M A;  1STN A;  5IGB A;  5IP7 H;  1PTO H;  2B8G A;  2Y0S B;  1V1Q A;  1H9J A;  1PA6 A;  4OWX B;  4N9P A;  1VQO A;  2JQO A;  5JEA H;  1K8M A;  3L2P A;  3X3N A;  1S40 A;  3PIP 3;  1Y8P B;  3I55 A;  4IUV A;  2AKW B;  2NYZ D;  4O42 A;  3G7L A;  3HOW B;  3UDX A;  2KOL A;  4JI0 L;  4A3F H;  3STB C;  1ESR A;  1PYB A;  3VR2 A;  4QQB X;  3S2H B;  2NZO A;  1ASZ A;  2CH4 W;  4DR7 L;  3AB9 A;  2RDG A;  4LF7 L;  3QOL A;  2EY5 A;  3CPF A;  2KEC A;  4R4I A;  4IN3 A;  2MO1 A;  1YI2 A;  3PF4 A;  3DMU A;  1S5E D;  2Q2U A;  1QVC A;  1Y1W B;  4BBR B;  1B1Z A;  1UE7 A;  1X3E A;  3T51 B;  2MJ8 A;  3H0G H;  1HNZ Q;  2D9U A;  1F2Z A;  1TVX A;  1UE5 A;  4RA8 A;  4ZKB B;  4A3M B;  2NN6 G;  4IPD A;  1PXU A;  1O7L A;  4BWG B;  4BBR G;  2NBF A;  1X3F A;  1EQQ A;  2JYO A;  2L11 A;  4DV6 L;  1XXG A;  4X66 L;  4R8I A;  4RGN A;  5FOB B;  2KCM A;  5JEA G;  4PNY A;  1KAB A;  1Z7T A;  1GUG A;  1LT4 D;  4A93 H;  2F0P A;  2AWO A;  1B2T A;  1Y14 B;  1IBK L;  1HZC A;  3NEM A;  4JI7 L;  3T56 B;  2KCN A;  1VF7 A;  3RZO H;  1SE2 A;  5TSS A;  4AYB G;  1KAW A;  5M3M G;  4JC0 A;  4NDX A;  2I07 B;  3T1H L;  3I4M B;  4JV5 Q;  5M5Y H;  2K5H A;  3FHW A;  1HCZ A;  1HA5 A;  4DV3 Q;  1IYV A;  1O80 A;  1MHW C;  1JB7 A;  1CHP D;  1E2W A;  2B2V C;  2NWG A;  4EQN A;  3TN2 A;  4FP5 D;  1KTK A;  4RCO A;  3I8Z A;  2LSS A;  2SDF A;  1SSO A;  4BBS B;  2XRQ D;  2IHF A;  3F8T A;  1H95 A;  5LMN W;  1BVS A;  3CRK C;  4CDE C;  1TWC H;  4B3M L;  1EYD A;  1PH4 A;  1UEB A;  2UUC L;  2DNE A;  1YJN A;  2XN9 C;  1M4V A;  3PGZ A;  1QIL A;  2HCC A;  2A6E D;  5J39 A;  4GNX C;  1A2U A;  4GOP C;  3FPU B;  1NNX A;  2H5X A;  3SE0 A;  4GKJ Q;  1LTT D;  4XIG S;  3QO2 A;  5JVG 3;  1BCP F;  3BVG A;  4BA1 I;  5JJL A;  3EVQ A;  4A3E G;  2Y0S G;  3C1E A;  3H0G B;  2PQE A;  1B9N A;  4JI8 L;  4LFA Q;  2RVL A;  3ULJ A;  1M90 C;  3IAY A;  5E4X A;  3PUX A;  4RKB A;  1XPR A;  1A3T A;  1VQJ A;  3TZD A;  2UUA L;  2BH2 A;  3GTL B;  5HUR A;  3SEB A;  2D62 A;  3LWU A;  4ME5 A;  3SVM A;  4QB4 A;  5LMU L;  1LTL A;  4DUY Q;  4XT1 B;  3Q24 A;  1EYG A;  3GDE A;  1SYE A;  1A62 A;  1HFG A;  1GHJ A;  1S72 A;  1TS3 A;  1DCZ A;  4YWK A;  5CGK A;  2M9V A;  4U68 A;  4LF5 L;  3P20 A;  3H94 A;  1HZB A;  1X3G A;  3WOF A;  5C3X A;  5M5W B;  1YBY A;  2EY2 A;  2ZJR A;  1SMY C;  3NWT A;  2FHT A;  3QG1 A;  3PO3 H;  5BN3 A;  1HZ9 A;  5M9O A;  2HUG A;  4DV2 Q;  3OMG A;  1JWM D;  5C44 B;  3NQT A;  2NTT A;  1Q86 C;  3P7J A;  1B8A A;  2E75 C;  4DV4 Q;  4QCL A;  1U4P A;  4IQZ A;  2B63 H;  2EJF C;  2OTL A;  4FXG C;  4NP5 A;  2YU9 B;  2QF7 A;  2RDH A;  2EXD A;  5ELO A;  4P74 A;  1JWU D;  3U9O A;  3PIO 3;  1PH8 A;  5J22 A;  5GAH C;  2K5V A;  5ELN A;  1TY0 A;  1WTR A;  4A3C G;  5EPK A;  1SR3 A;  1L0Y B;  1RDP D;  3OWF A;  2R92 G;  2PNH A;  3PQI A;  1WTV A;  1KIX A;  5LL6 X;  4OWW B;  1SXT A;  2HHH Q;  3KF6 A;  1HTL D;  3AYH B;  1GUW A;  4B08 A;  2L1B A;  2RBM A;  1D1I A;  3TSS A;  2UXD L;  1EIH A;  3VYS A;  3AFQ A;  3ER0 A;  3CW2 C;  3KBX A;  4XXE A;  2F0G A;  1WVL A;  5JAV A;  3RN2 A;  1FJG Q;  4CJ1 B;  3OTO Q;  2AQ3 B;  4LF9 Q;  2R92 B;  4GN4 B;  4B3S Q;  4PQX A;  2R3Z A;  1K0R A;  4RG1 A;  4A76 A;  3BYY B;  3PIP A;  3J80 E;  3M3Y B;  5EJW A;  4A3L G;  2ATW A;  1V1P A;  4K14 A;  3V05 A;  1D8L A;  2EJM A;  4R4O A;  1RTO A;  2VL6 A;  3R8B A;  3P1H A;  4B3R L;  4JI3 L;  3KF8 B;  2KJX A;  1EEF D;  3R2I A;  2VXW A;  1IBM L;  4A3K G;  4DPG A;  2YTX A;  2SEB D;  5JPM C;  3HOY B;  2K1B A;  4ZAI A;  2R92 H;  4KHP Q;  4LAA A;  3M4O B;  2F0E A;  4OHJ A;  2ASB A;  3TRE A;  2K5W A;  3TQY A;  1HJP A;  1X32 A;  3Q0A A;  5C5M A;  1VQE A;  2N49 A;  2RCN A;  4R1J A;  4QJF A;  1OXT A;  4C2M B;  4QY7 A;  1EY0 A;  1I50 B;  3GV6 A;  1SNP A;  2ZXR A;  4R4Q A;  1PTO F;  1LTS D;  1NY4 A;  4HMI A;  1X3P A;  4JI7 Q;  2F0H A;  2PNR C;  1A8V A;  1QB5 D;  1X55 A;  2IX1 A;  5IY0 A;  1B7Y B;  4DAM A;  4FXK C;  1FNV A;  2VB3 X;  1X56 A;  4X66 Q;  4NW2 A;  3S1R H;  2I46 A;  3HGB A;  3BVZ A;  2G9H D;  2EOT A;  4GZY C;  1HH2 P;  4P2C B;  5EKI A;  3HOU H;  2JA5 H;  3HOZ H;  3SDZ A;  4F88 A;  3UI2 A;  1ENA A;  4YIJ A;  4GKK Q;  5E4W C;  2B3G A;  1R4Q B;  4XTC S;  1BDO A;  1IKL A;  4X65 Q;  3MFG A;  3J7A F;  3NUC A;  1HNZ L;  3KBG A;  1HUN A;  2DUD A;  2LFN A;  1XX8 A;  4UP9 A;  4LMQ D;  4P71 A;  3TME A;  1CUK A;  1EWC A;  5EPJ A;  3F2U A;  3CCL A;  1LV9 A;  1IL2 A;  1VQL A;  2CKZ B;  4IFD H;  1I94 Q;  2EYO A;  3HOV H;  4XYO A;  1U4L A;  4QIW E;  5A35 A;  1STB A;  3F1Z A;  3K7A H;  4OEM B;  3UE0 A;  4KJN A;  2WB1 E;  3PSI A;  4XQN A;  5KEE A;  2DY8 A;  4A3B G;  1QVG A;  5KNB A;  1QG7 A;  4JI1 Q;  1D2B A;  2ID0 A;  1HZA A;  2F4V Q;  4KN7 C;  1SDF A;  1QUQ B;  2O2L D;  1CFM A;  2F3W A;  1GO3 E;  2R7Z G;  5F2D A;  3RLN A;  2MNA A;  4JI3 Q;  4N8X 1;  1ICW A;  2I5L X;  2B2U C;  5ELB A;  4ZUJ A;  2Z0S A;  3CC7 A;  4RWS C;  1PRT D;  3NTI A;  3I4N B;  1CHQ D;  1XPO A;  4BA2 I;  2F0L A;  4A3B B;  1PH2 A;  4IFD J;  3HOX B;  2LS0 1;  1WTX A;  1JWS D;  3GTP H;  3K58 A;  2UU9 L;  3HOV B;  4KY7 A;  2ES2 A;  1NAP A;  5JJZ A;  4TKO B;  3S1N H;  4K6D A;  2B2U A;  1KAA A;  4HJ7 A;  2HQL A;  2F0J A;  2JN4 A;  2FXQ A;  4V0B A;  1SJE D;  1IBL L;  2M2L A;  2DGY A;  4DU9 A;  3W2D A;  4A3B H;  3MC0 B;  2QIL A;  5CV6 A;  1NUC A;  1OO9 B;  2JA6 B;  2YU9 H;  3E5S A;  3NK9 A;  1XMQ Q;  3STB D;  2JA8 B;  3F2B A;  1KLG D;  1I4G A;  3HOU B;  3TP5 A;  1GUN A;  4A3C H;  2EYH A;  2Z6B A;  3M4P A;  3OYY A;  1VQP A;  1PFS A;  1LTG D;  4RKL A;  5M3M B;  1NSN S;  2E74 C;  3I70 A;  5GAD C;  1B44 D;  4KD4 A;  5IGD A;  4WOR A;  5C6A A;  4DNR B;  4O0A A;  5IYD H;  3EBE A;  4G7H C;  3MXN B;  4AH6 A;  1U5K A;  4OIK A;  4JCV E;  3IL8 A;  1X54 A;  2MP1 A;  4A3I H;  1Y8N B;  5ISR A;  3H3V H;  5C0X J;  4OWT B;  1JR0 D;  2RCF A;  1P8L A;  1JOQ A;  4CHT B;  3J80 c;  5C4X H;  5CV4 A;  1VQN A;  4A3F G;  4KD3 A;  2K50 A;  1ZXT A;  2WAQ E;  1IBL Q;  3GTJ H;  4LJZ C;  3GTL H;  1UAP A;  3L7Z C;  1PH3 A;  2TMP A;  3D31 A;  5JVH 3;  2UU9 Q;  3QR8 A;  2EVB A;  2E5L L;  1MGS A;  1V1O A;  1K73 C;  4OX9 L;  3TP6 A;  5D65 A;  3NEN A;  2ZTE A;  4JI2 L;  1PVO A;  4UP7 A;  5C4Z A;  3A56 A;  2DJG C;  3NSW A;  3MHB A;  1SE8 A;  2PO4 A;  1G6P A;  1TWG B;  2YYZ A;  4DUZ Q;  4X3K A;  3DEO A;  1IZ6 A;  3S14 H;  5AFW A;  4QL5 A;  1DD2 A;  1XMQ L;  3I4O A;  1B70 B;  2JA6 G;  2NB0 A;  2E2J B;  4TQU S;  2KEE A;  4A3I B;  2H4O A;  1CSQ A;  5C5L A;  1ILQ A;  1CSP A;  1IBM Q;  1K83 H;  1XTC D;  4JBM A;  3DWA A;  1X6O A;  2IJ0 A;  1WFQ A;  3DWQ A;  1SNM A;  3DM1 A;  3HKZ B;  5FK9 C;  5I6W A;  2IY5 B;  4A3J H;  1Y1V B;  4BY1 H;  1Q8K A;  3S1N B;  1J6Q A;  2IX3 A;  2V4D A;  3PCO B;  3D4W A;  4C56 C;  1QZG A;  3HOX H;  1VQD A;  3N52 A;  4N8F A;  1XNQ L;  2NUC A;  1LO5 D;  4J15 A;  1K3B C;  3ERO A;  1J5E Q;  1C8C A;  1E3P A;  4L63 B;  1KD1 C;  4DGZ A;  4A3I G;  1S5C D;  4HIO A;  2F0W A;  5IYC H;  2I5H A;  4FDB A;  4IO9 A;  5H1S E;  1HQM C;  3A74 A;  3FKI G;  2PPB C;  2R7Z B;  3K5O A;  4H02 A;  1A63 A;  3QOJ A;  3CRL C;  4YWL A;  3SR1 A;  4DK6 C;  1RHP A;  1Q1E A;  1HNW L;  2ZM6 Q;  2F4V L; 
#chains in the Genus database with same CATH homology
 3RN5 A;  4HJ8 A;  5GRO A;  3EIV A;  5C44 G;  1I5F A;  4GLX A;  1N34 Q;  1G29 1;  2LSS A;  1XNQ Q;  3FKI H;  2E8G A;  2IHF A;  3F8T A;  1H95 A;  5LMN W;  1BVS A;  4GLV B;  2NVY H;  4X6A H;  5IP9 G;  2A19 A;  5M5X H;  4C3J H;  4A3L H;  1TWC H;  4MNO A;  3TS0 A;  1YIJ A;  1I94 L;  4B3M L;  1PH4 A;  1UEB A;  4DV6 Q;  2UUC L;  1VQ7 A;  1YJN A;  1P16 A;  3DLL A;  1SN8 A;  2D0P A;  1VQC A;  3PGZ A;  2AHO B;  2E2I H;  4DR1 L;  4GNX C;  1W2B A;  4GOP C;  4LFB L;  3HOX G;  4JG2 A;  2H5X A;  3ULL A;  3CC4 A;  3E9H A;  4A4I A;  4BBR H;  4YY3 L;  3I56 A;  3S16 H;  5M3F H;  4L5R C;  4GKJ Q;  4DR6 L;  2N8N A;  1CKO A;  2ZTD A;  1X9N A;  4DV1 Q;  4XIG S;  2I0Q A;  4YHH L;  1TWA H;  4BA1 I;  4NXN L;  1JMC A;  4LF4 Q;  1E22 A;  3I4N G;  4A75 A;  1Q1B A;  1TWG H;  1XMO Q;  5JJL A;  4GKK L;  2JA7 G;  5FJ8 H;  3E9I A;  1WJJ A;  4A3E G;  2RF4 A;  2Y0S G;  2A1A A;  4JOI C;  3GTK H;  2CFM A;  4DR2 L;  5BR8 Q;  3CCS A;  1YNX A;  2UXC Q;  4UPA A;  2JJQ A;  1VQH A;  3S24 A;  4LF6 L;  4JI8 L;  4X62 Q;  4LFA Q;  5IE8 A;  1PH9 A;  3ULJ A;  1M90 C;  1HNX Q;  3PUY A;  4OXP A;  5K36 G;  4IFD I;  1GVP A;  1PHJ A;  4AIM A;  2E2J H;  2Q2T A;  2E2H H;  3PUX A;  3HOY G;  3KLW A;  3CXC A;  2RHS B;  1XPR A;  1E24 A;  1VQJ A;  3CC2 A;  2JA7 H;  1VQ4 A;  2UXB L;  2MFI A;  2UUA L;  2BH2 A;  3I7F A;  4JI5 L;  1KRT A;  3CCV A;  5JJK A;  2D62 A;  4DR7 Q;  1IBK Q;  4BBS H;  4LWC A;  5LMU L;  1OXU A;  3CF5 A;  1LTL A;  4DUY Q;  1EYG A;  3GDE A;  2BH8 A;  2Y0S E;  1HR0 L;  1A62 A;  2KEN A;  3M9B A;  5IWA L;  2VUM H;  3ERS X;  2PQA A;  3HOW H;  1S72 A;  4IJL A;  4YWK A;  1Q81 C;  3AQQ A;  4L5S A;  1AH9 A;  3HOY H;  4LF5 L;  3AEV A;  1HZB A;  1X3G A;  3NBH B;  1YBY A;  4DV0 Q;  2ZJR A;  4LF6 Q;  2JA5 G;  2UXD Q;  3PO3 H;  3EN2 A;  2KHI A;  1N33 Q;  3K0X A;  1HZ9 A;  3H3V I;  1WOC A;  1Y1W H;  1Y1W G;  3I4M G;  3I4M H;  4DV2 Q;  4A3D H;  3GTG H;  3W5O A;  1Q86 C;  2UUB L;  2V1C C;  1B8A A;  2F3I A;  4LF4 L;  4NXN Q;  4JYA L;  1YHQ A;  4YHH Q;  4DV4 Q;  4JI1 L;  1DGS A;  4BY7 G;  1VQ5 A;  3KDF B;  3TRZ A;  1KC8 C;  1BKB A;  1VQK A;  2B63 H;  4GKJ L;  3CCR A;  2NZH A;  4POF A;  3PO2 H;  2OTL A;  3CAM A;  1C0A A;  2VNU D;  3BJU A;  4C3H H;  4X64 Q;  4APV A;  4DV7 L;  1UE1 A;  4JOI A;  2EXD A;  5ELO A;  4B3T L;  4P74 A;  3VDY A;  2JEB I;  1PH8 A;  5GAH C;  2K5V A;  4YCU A;  5ELN A;  3J7A 5;  3M85 A;  1KL9 A;  1Q46 A;  5C0X G;  1HR0 Q;  2IX0 A;  2B63 G;  2LXK A;  2CQO A;  4JI2 Q;  2GN5 A;  3CCQ A;  2NVT H;  1PH5 A;  5LMU Q;  3UDI A;  4A3C G;  2JA9 A;  5IP9 H;  1SR3 A;  4OX9 Q;  3CQZ H;  2HIV A;  2VQE L;  3BZK A;  2E5L Q;  5FLM H;  1YJ9 A;  4R4C A;  4DV4 L;  1E7Z A;  4HIM A;  4LF9 L;  2HT1 A;  2R92 G;  2NVX H;  1G51 A;  2OQ0 A;  2PNH A;  1C9O A;  3J81 i;  4PZ6 A;  5FJ8 G;  1KIX A;  4A3E H;  3WWV A;  4YWM A;  4OWW B;  2HHH Q;  3KF6 A;  4DKA C;  3AYH B;  2QGQ A;  1EIF A;  1RL2 A;  4C3I H;  3KJP A;  2VQF L;  4DV2 L;  2Z6K C;  1HR0 W;  5GAE C;  3G4S A;  1V9P A;  5C3E G;  1WCM H;  5IP7 G;  1L0W A;  1RIP A;  2UXD L;  2VZA A;  3AFQ A;  3CW2 C;  3ER0 A;  3J80 i;  5LMN Q;  1C7Y A;  2D0O A;  1QUQ A;  3RN2 A;  5IYB G;  1FJG Q;  3OTO Q;  4LF9 Q;  1VQ6 A;  2JEA I;  3GTO H;  1XTD A;  2BA0 A;  2L15 A;  3I2Z A;  4GN4 B;  1XJV A;  4B3S Q;  1XNR L;  1VQM A;  3U4Z A;  1K0R A;  3S1M H;  5C3E H;  4RG1 A;  4DUY L;  4A76 A;  3HOZ G;  2JE6 I;  1VQ9 A;  3NEL A;  2R6G A;  3PIP A;  1CKN B;  2N78 A;  1AE2 A;  3W1B A;  4A3L G;  3HKS A;  2UXB Q;  1LYL A;  4JI4 L;  3CCM A;  3S2D H;  3T1Y Q;  3LGJ A;  4DV5 L;  1N36 Q;  1MJE A;  2ATW A;  4YCV A;  1VS0 A;  2N3S A;  1D8L A;  3HOV G;  3M4Q A;  4R4O A;  2OCE A;  3S15 H;  4LF8 Q;  4X62 L;  4PZ8 A;  2XGT A;  2VL6 A;  4B3R L;  4O2D A;  4JI3 L;  4POG A;  1PH1 A;  3KF8 B;  4DR2 Q;  1SRO A;  3HOW G;  1IBM L;  4A3K G;  1EQR A;  1VQ8 A;  5EAY A;  2KBN A;  4DPG A;  4DNI A;  5FLX c;  4JYA Q;  4X65 L;  2YTX A;  4P73 A;  1N8R C;  1HNW Q;  5GQO A;  1E1T A;  3PUV A;  2UUB Q;  2R92 H;  2RHQ B;  4KHP Q;  4JI6 Q;  4IPC A;  4DR3 Q;  1NMG A;  4LW1 A;  2ASB A;  4DR6 Q;  3TRE A;  1JJC B;  1Y1V H;  3H0G G;  2YTV A;  4A3G G;  3TQY A;  1HJP A;  3AFP A;  3PO2 G;  2QEX A;  3W1G A;  4P75 A;  1NBW A;  2B29 A;  2R7D A;  2WB1 G;  2N49 A;  2RCN A;  1VQE A;  4R1J A;  4QJF A;  1BBU A;  1OXT A;  2IT1 A;  4QY7 A;  1N32 Q;  4GNX A;  2Z6K A;  2PI2 A;  4L5Q A;  1OXX K;  4R4Q A;  4B3M Q;  3BZC A;  1K3R A;  5IYB H;  4OON A;  1NY4 A;  2ZJP A;  4JI4 Q;  1FGU A;  4DR5 L;  3ULP A;  3A0J A;  1QZH A;  1J5E L;  4JI7 Q;  1A8V A;  1JT8 A;  1X55 A;  4UY8 C;  2IX1 A;  3S2H H;  5IY0 A;  3D0F A;  1L1O C;  1B7Y B;  2EQS A;  3JAM c;  1GM5 A;  4DAM A;  3RLO A;  4A3J G;  1N34 L;  4GOP B;  3S1Q H;  4B3S L;  2UUA Q;  1X56 A;  1GKH A;  1YHA A;  4X66 Q;  3K8A A;  3S1R H;  1EOV A;  3K7U C;  3M7N A;  5IYC G;  2CWA A;  4JI8 Q;  1TWH H;  1HH2 P;  1YVC A;  3ZJY C;  5BR8 L;  2MQH A;  2JA8 G;  3HOU H;  2JA5 H;  3HOZ H;  4PZ7 A;  3HKZ G;  5HY6 A;  1YIT A;  3FP9 A;  4PG3 A;  3TEH B;  2WFW A;  4JI6 L;  2VY3 A;  4OO1 G;  2AMC B;  4GKK Q;  1LM0 A;  4HID A;  2B3G A;  4EX5 A;  4XTC S;  1L1O A;  1XMO L;  2ZTC A;  3OW2 A;  1MIU A;  4X65 Q;  4GNX B;  5DLQ E;  1Q7Y C;  2BA1 A;  5C44 H;  1SFO H;  1JJG A;  4NXM L;  1HNZ L;  2YTY A;  1I6H H;  2DUD A;  1ASY A;  4GS3 A;  2A8V A;  5J3B A;  4UP9 A;  2NVQ H;  3RNU A;  1VCI A;  4P71 A;  1NE3 A;  1CUK A;  1YHB A;  3CCL A;  1N9W A;  1IL2 A;  3MEF A;  1VQL A;  2CKZ B;  3PV0 A;  1EIY B;  2R93 G;  3JAM i;  1I94 Q;  3HOV H;  4JBJ A;  4B3T Q;  3M3Y H;  4QIW E;  1U0L A;  3CP0 A;  3CME A;  4BY7 H;  1NMF A;  4X64 L;  3F1Z A;  3K7A H;  1NJI C;  3CMA A;  3UE0 A;  2WB1 E;  3E0E A;  5HGQ A;  3PSI A;  3G71 A;  4A3B G;  1QVG A;  4NXM Q;  1BBW A;  4DR4 L;  4JI1 Q;  2XTI A;  3CPW A;  2ID0 A;  2R93 H;  3J7Z C;  2LXJ A;  4KHP L;  1HZA A;  2F4V Q;  1YZ6 A;  3I4N H;  1NTG A;  4C2M H;  5GAG C;  1QUQ B;  3K81 C;  1Y1V G;  1L1O B;  3RZD H;  3TS2 A;  2WAQ G;  4BXX G;  1VQB A;  1GO3 E;  2R7Z G;  1YJW A;  1N33 L;  4IOC A;  3KF6 B;  3RLN A;  2MNA A;  4JI3 Q;  3M4O H;  4KLK A;  4QGU A;  5AJ3 Q;  3T1H Q;  2VQF Q;  2I5L X;  2KHJ A;  4BY1 G;  2VUM G;  3DM3 A;  1KRS A;  2OWO A;  1AE3 A;  4LF5 Q;  3PUZ A;  4IPG A;  4DV5 Q;  2Z0S A;  2Q2H A;  3CC7 A;  1N36 L;  1PYS B;  4LF7 Q;  4YCW A;  2VQE Q;  1W3S A;  4LUZ A;  1XPO A;  4BA2 I;  1PH2 A;  4IFD J;  1PH7 A;  1IXR A;  1O7I A;  3GTM H;  2EIF A;  5E7N A;  1WYD A;  3GTP H;  5JJI A;  2PQA B;  2JA6 H;  2UU9 L;  4L5T A;  2K14 A;  2ES2 A;  1FJG L;  3S1N H;  4IPH A;  1R9T H;  4HJ5 A;  1OXV A;  4HJ7 A;  3PF5 A;  4PMW A;  4HIK A;  1HNX L;  4Y52 H;  5AJ3 L;  2HQL A;  1IBL L;  2FXQ A;  4MTN A;  1SMX A;  3KDF A;  1FL0 A;  2DGY A;  3H15 A;  3GD7 A;  1CKN A;  4A3B H;  3IRB A;  4KI0 A;  3F2D A;  2MO0 A;  4ME3 A;  1WI5 A;  5M3F G;  4DR3 L;  1E1O A;  3UDF A;  4A3K H;  5M3M H;  3F2C A;  2PMZ E;  3KJO A;  4LUV A;  2KCT A;  1TXY A;  2NN6 I;  1IYJ B;  2AWN A;  2ZJQ A;  1TWF H;  4DV1 L;  2C35 B;  3L0O A;  2YU9 H;  4DR4 Q;  1FVI A;  2GVB A;  4NPS A;  5JEA J;  1XMQ Q;  2I5M X;  3STB D;  4YY3 Q;  2ALY B;  1OXS C;  4LFB Q;  3F2B A;  1EWI A;  4B3R Q;  1Q82 C;  3SGI A;  4A3C H;  4LNQ A;  3OYY A;  3K80 C;  3M4P A;  3A5U A;  1VQP A;  1K9M C;  1K8G A;  4A3D G;  2HIX A;  2UUC Q;  2F52 A;  3T1Y L;  1PFS A;  4P72 A;  4TVA B;  4GN5 A;  1JJ2 A;  4GN3 B;  2Q2I A;  1L2F A;  5IWA Q;  4RMF A;  5GAD C;  3GO5 A;  2VS1 A;  3B6Y A;  1PV4 A;  4MZ9 A;  2PI2 E;  4R4T A;  3KFU A;  5C4X G;  1EUJ A;  1T9H A;  3U4V A;  4A93 G;  3UE1 A;  4ALP A;  2JA8 H;  4AQY Q;  1KXL A;  4O0A A;  4JI5 Q;  5IYD H;  3EBE A;  1Z47 A;  3HFZ B;  3MXN B;  1U5K A;  4AH6 A;  5M5W H;  4JCV E;  1X54 A;  1KHI A;  3GTQ H;  2GVA A;  4A3I H;  5IT9 c;  2QA4 A;  3H3V H;  2WP8 J;  5C0X J;  4WJ3 M;  4OWT B;  1P8L A;  5LMN L;  3J80 c;  4LFA L;  3JC6 6;  4AYB E;  5C4X H;  4BXX H;  2UXC L;  1Q12 A;  4DV3 L;  1VQN A;  4A3F G;  3HOU G;  2K50 A;  5IP7 H;  2WAQ E;  1IBL Q;  4JV5 L;  3GTJ H;  1V1Q A;  3GTL H;  2K5N A;  3L7Z C;  4DV0 L;  1PA6 A;  1PH3 A;  3HKZ E;  4OWX B;  4K0K Q;  1K8A C;  1VQO A;  2JQO A;  3D31 A;  3L2P A;  2R7F A;  1S40 A;  2UU9 Q;  4A3M G;  3KYH C;  4A3M H;  2YV5 A;  3I55 A;  1KQS A;  2AKW B;  3CCE A;  2E5L L;  1M1K C;  4OX9 L;  1K73 C;  4AQY L;  4DK3 C;  3BU2 A;  3NEN A;  3UDX A;  4JI0 L;  4A3F H;  3PO3 G;  3STB C;  2ZTE A;  1OTC A;  1PYB A;  1UWV A;  4JI2 L;  4QQB X;  1PVO A;  2NZO A;  4UP7 A;  1ASZ A;  4DR7 L;  4DR5 Q;  4LF7 L;  1SE8 A;  3CPF A;  4R4I A;  2K4K A;  4EQ5 A;  1PH6 A;  2MO1 A;  1YI2 A;  4OO1 I;  3U50 C;  1G6P A;  1V43 A;  2CWP A;  2YYZ A;  4DAY B;  3PF4 A;  4DUZ Q;  2Q2U A;  4DV7 Q;  1CKM A;  1QVC A;  3G6E A;  3CCJ A;  1IZ6 A;  1VQF A;  1I3Q H;  1N32 L;  1UE7 A;  4LUO A;  3S14 H;  4QL5 A;  3J81 c;  1X3E A;  3H0G H;  4A3G H;  1HNZ Q;  1XMQ L;  3I4O A;  5C4J H;  4Y7N H;  1MJC A;  1B70 B;  1A0I A;  1X65 A;  4WJ4 A;  2JA6 G;  3KOJ A;  4TQU S;  5FLM G;  3U58 A;  1UE5 A;  4GLA C;  3G48 A;  1YEZ A;  2NN6 G;  1CSQ A;  3S17 H;  1CSP A;  2JK8 A;  4IPD A;  1IBM Q;  1K83 H;  1EFW A;  4JBM A;  4HJA A;  1X6O A;  1WFQ A;  2K52 A;  4BBR G;  2IY5 B;  1VQA A;  4DR1 Q;  1MKH A;  2IHE A;  4A3J H;  4LF8 L;  4BY1 H;  1UE6 A;  2OTJ A;  2VW9 A;  1X3F A;  1EQQ A;  4IFD G;  2K75 A;  4DUZ L;  1Q8K A;  4DV6 L;  1J6Q A;  2OQK A;  4X66 L;  4NB3 A;  4GOP A;  3PCO B;  4LFC Q;  3ICE A;  2KCM A;  5JEA G;  1SRU A;  1VQI A;  1QZG A;  1Z9F A;  4BBS G;  4KHZ A;  3PUW A;  4JBK A;  2R7Z H;  3HOX H;  3Q8D A;  4A93 H;  1VQD A;  1D7Q A;  2AWO A;  4JI0 Q;  1Y14 B;  1XPU A;  1IBK L;  1XNQ L;  4J15 A;  1HZC A;  3NEM A;  4JI7 L;  1J5E Q;  1XNR Q;  3PIO A;  3UDG A;  3RZO H;  4JBW A;  5C0X I;  1E3P A;  4LFC L;  1VQG A;  4IJH A;  4AYB G;  1KAW A;  3OTO L;  3CCU A;  1KD1 C;  3RLF A;  3A5Z B;  1GD7 A;  5M3M G;  4JC0 A;  2ZM6 L;  4A3I G;  2CCZ A;  1QVF A;  4K0K L;  4HIO A;  3CD6 A;  5IYC H;  2I5H A;  4FDB A;  4IO9 A;  3T1H L;  5H1S E;  4IOA A;  1S3O A;  4JV5 Q;  5M5Y H;  1LUZ A;  2K5H A;  3FHW A;  1WCM G;  3A74 A;  3FKI G;  4DV3 Q;  5IYD G;  4H02 A;  1JB7 A;  1A63 A;  2HHH L;  1JE5 A;  4UP8 A;  4YWL A;  3RR5 A;  4DK6 C;  1SLJ A;  4HJ9 A;  1Q1E A;  1HNW L;  2ZM6 Q;  3J81 j;  1I50 H;  2F4V L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...