1EUJA

A novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
b'PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE 2
publication title A novel anti-tumor cytokine contains an RNA binding motif present in aminoacyl-tRNA synthetases.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 37
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eujA00
1BVSA 1VQIA 1PH8A 4LUOA 2VNUD 4WJ4A 2B3GA 1LYLA 3MEFA 1HNZL 1HNXL 1V43A 3U4ZA 3GTOH 2JA8G 3L7ZC 2A1AA 4B3SQ 1U5KA 1XMQQ 4HIMA 2OTJA 2IY5B 2XGTA 1KD1C 1X3GA 2HQLA 4GN4B 4A3EH 4NXMQ 2NN6I 4AIMA 1VQ9A 1CKOA 3KFUA 3J80i 2QGQA 4KHZA 4KHPQ 5JJLA 5EAYA 5C3EG 3CPFA 4DV0Q 1N33Q 2B63G 3ER0A 3S15H 3S17H 2WAQE 1CKMA 4MNOA 1NMFA 4A3GG 4LUVA 4A3LG 3W1GA 2JA5H 4R4QA 1IL2A 3RZDH 5LMNL 4R4TA 2DUDA 5FJ8H 1PYSB 1X54A 1Y1VH 3RLOA 1Q82C 3CXCA 1XNQQ 3I56A 2Y0SG 2R92G 2JA9A 2F52A 2PNHA 4LFCQ 2JA6H 3NELA 1OXSC 1BBWA 5GAEC 4DV6L 3PUWA 3PIOA 1HZ9A 4B3TQ 2HT1A 3I4NG 2BA1A 2HHHQ 2PMZE 3GTMH 3HOVG 4LF5Q 4IPDA 1YZ6A 4YHHL 2Z6KC 4OX9L 2ZTDA 2GVBA 3EBEA 1HR0L 2VUMG 3KF6A 4APVA 2H5XA 1C9OA 3GD7A 5C44H 1V1QA 1VQ6A 3M4QA 1K9MC 4NXNQ 4GKJQ 2R7ZH 3D0FA 1XJVA 1HZBA 1JJCB 4HIDA 3J81j 4IO9A 1N36Q 3GTGH 1M90C 2OQKA 4X6AH 1VQDA 2VY3A 3HOXH 3U4VA 4A3KG 2PI2E 4JBJA 1A62A 2F4VQ 3LGJA 3M9BA 2VL6A 3I4MG 4JI2L 2E8GA 1LTLA 2ES2A 2BH2A 3CC4A 1NE3A 1WFQA 2I0QA 3CCUA 1KHIA 1VQEA 2E2HH 1TXYA 1EYGA 3H3VH 3GTQH 1GVPA 4PZ7A 5C4JH 3M4OH 4JI6Q 1PA6A 2CQOA 4LFBL 4X66Q 2CWPA 1YJNA 2UU9Q 4OO1G 2KCMA 4QIWE 1HZCA 3OYYA 4MZ9A 4R4OA 3HOZH 4BBSG 2N8NA 4AYBE 1QUQB 1O7IA 2WAQG 2WFWA 1K8GA 3S1RH 3ICEA 4JI5Q 1J6QA 1FJGL 2QA4A 1CSPA 1CKNA 1XNRQ 3AEVA 4TVAB 3CCMA 3BJUA 3E9IA 4JI1L 1B70B 1VQJA 2NVTH 4P72A 4JBKA 4AH6A 2UXDL 2JEBI 4ME3A 5J3BA 4DR3Q 4YY3Q 1UE6A 4HJ9A 3S1QH 4A3FG 2AHOB 1Y14B 5C4XH 3E0EA 5GQOA 5IYCG 3A5ZB 3L2PA 1YVCA 4JBWA 4RG1A 4A93G 3STBC 2AWOA 1NJIC 2BH8A 5C3EH 4DR1Q 4Y7NH 4JOIC 4P73A 1X6OA 3KDFA 1G291 1I50H 2FXQA 2Q2HA 4EQ5A 2VQEL 4DV3L 1N34L 3PO3H 3PUXA 2E5LL 3RR5A 3HOWG 4DUYL 3S1MH 3PUYA 1EWIA 1K0RA 5HGQA 3BZCA 1VQ4A 1X9NA 1D8LA 2RHQB 3FKIG 1Q7YC 5JJIA 1HZAA 5GROA 3KJPA 1IBML 1JE5A 3I4NH 1VQCA 3NEMA 4UP8A 1L1OC 3HOVH 4GOPC 4A3MG 4LF8Q 3CC7A 4GNXB 1PH2A 3HOUH 4HJ5A 1NBWA 4DV7L 4B3ML 4JV5L 4LWCA 1WYDA 2JA7G 5ELOA 1Q46A 2KHIA 4DKAC 2UXCL 3J7A5 3PV0A 1C7YA 1YIJA 3HKZE 1IBLL 1QZHA 5FLMG 1ASZA 5IE8A 4YWKA 1HNWQ 1VS0A 4KI0A 1G51A 1VQ7A 3I4MH 5M5WH 1XMOL 4JI0Q 2AKWB 4A3IH 1PH3A 3AYHB 1OXTA 3HKSA 3H15A 4IOCA 1YI2A 3AFPA 4DR6L 4JI7L 3A5UA 2Z0SA 1XPUA 2ZTCA 1KAWA 3K0XA 4R4CA 3PF5A 2XTIA 1PH4A 2Q2TA 4LF4L 4UP9A 4DAYB 2ZM6Q 1VQPA 4J15A 1EQQA 4GKKL 3BZKA 2NVYH 4A4IA 3M7NA 5IWAL 4DR7L 4NB3A 3UE1A 5C0XI 5K36G 3L0OA 1N32L 4BBSH 5BR8L 1VQBA 2NZHA 1SR3A 5ELNA 4DV2L 4YCWA 1W2BA 4XTCS 1OTCA 4JI4Q 4OO1I 5IYDG 3PUZA 2N3SA 4BXXH 2VQFL 1SROA 1K73C 1VQ5A 3F1ZA 1PH9A 1PVOA 4WJ3M 5IYCH 1I5FA 1VQHA 4RMFA 2CFMA 4YCVA 4XIGS 3S16H 1MJCA 4L5TA 1Q1BA 1YJWA 1QZGA 5JJKA 1EFWA 1UE5A 2A19A 5GADC 5LMNQ 2LSSA 3FHWA 4GNXC 1Z9FA 4DV5L 3S14H 1Y1WG 4A3BG 3F2CA 1E1TA 2OQ0A 4C3JH 5IP9G 2N49A 1PH6A 3HOYG 3TS2A 1YBYA 4NPSA 4OWXB 1N9WA 2K5VA 3F8TA 5IYBG 3VDYA 3HOWH 1UE7A 4JI8L 3HKZG 2UUCQ 3K7UC 3MXNB 4AQYQ 3F2BA 2GN5A 2UXBQ 3CC2A 1HR0Q 2OTLA 2CWAA 1KIXA 4BY1G 3GTLH 1CUKA 4X62L 3G48A 3UDGA 3SGIA 1XMQL 4JBMA 1CSQA 3CQZH 2R6GA 3H0GG 4GLXA 1TWAH 1KRSA 4JI3Q 4A3JH 4BBRH 1FVIA 4LFAL 4IFDG 1RIPA 2V1CC 4JI2Q 5GAGC 5M3FG 1VQGA 4DR5Q 4UP7A 4OWTB 4GLAC 1ASYA 5FLMH 1I94L 3M3YH 1BKBA 4YCUA 3NENA 3TRZA 5AJ3L 1L1OB 1AE3A 1QUQA 2K14A 2ZTEA 3IRBA 4C3HH 1MKHA 4GOPB 1XPOA 4L5SA 1XNQL 4LW1A 4BY7H 4QJFA 4LFBQ 4GLVB 5C0XG 4LFCL 2MNAA 2VS1A 2B29A 1KL9A 4IPCA 1WOCA 2QEXA 2R93H 1HJPA 4LF5L 2D0PA 5E7NA 1HH2P 4POFA 2EXDA 1WCMH 5IP7H 1VQFA 3UDIA 3CP0A 4B3RL 4K0KQ 4A3CG 4JI1Q 3A0JA 4IFDJ 1JJ2A 1M1KC 1W3SA 1IBKL 3S2DH 1K83H 5GAHC 2AWNA 3GTJH 5IYDH 3I4OA 2JA8H 4OONA 5DLQE 1VQ8A 2RF4A 4DK6C 4IPHA 1Q86C 1TWHH 2PI2A 1Q8KA 2I5MX 1N34Q 4IJLA 4DR4Q 2K5HA 5C0XJ 2OCEA 2VQEQ 3T1YQ 3CW2C 3CMEA 4GNXA 3CCLA 1WI5A 4LF6Q 2B63H 4A3GH 4DUYQ 2K75A 4X66L 3ZJYC 2UUBQ 1A8VA 1QVFA 3H3VI 1PV4A 4A3LH 3HOYH 2JK8A 5HY6A 4P71A 1IBMQ 5IYBH 2WP8J 1X56A 1VQNA 2NVXH 2R92H 4JI5L 4DUZL 4LF9L 1XNRL 2N78A 3Q8DA 1OXUA 4DNIA 1QVGA 4B3MQ 3RZOH 1XPRA 4JV5Q 2LXKA 2Z6KA 4A3EG 1S40A 4DR3L 1X65A 2PQAB 2L15A 4LF7L 1QVCA 3BU2A 2VUMH 2UXCQ 3H0GH 4DV4Q 2ZJQA 2YV5A 2JA5G 1E3PA 1P16A 1YNXA 3JAMi 4DR2Q 1Y1VG 3W5OA 3CCEA 4OWWB 1D7QA 1MJEA 1XMOQ 2YTXA 2C35B 1PYBA 4A3KH 2DGYA 2UUAL 1E7ZA 3PO2G 1KXLA 4QL5A 4A75A 1VQLA 3KYHC 2YTYA 4AYBG 1TWCH 4C2MH 2MQHA 2JA6G 4DR6Q 4KLKA 4JI7Q 4IOAA 3RLNA 4IFDI 3I55A 1OXVA 2YYZA 4Y52H 1Q81C 4YWLA 1J5EL 2IHFA 1YITA 2YU9H 3RLFA 1L2FA 4JYAL 3KF8B 4DV1L 5C44G 4PZ6A 4X65Q 3TQYA 5LMUL 5IWAQ 2EQSA 2IX0A 4L5RC 4LF8L 4DR7Q 1E22A 1N32Q 1IZ6A 1IYJB 4DV2Q 4HJ7A 1YHBA 1YEZA 2IHEA 1UE1A 1HNZQ 1HNXQ 1EUJA 1E24A 3GO5A 3KLWA 1YHAA 2ZJPA 1MIUA 2VQFQ 1EIFA 4HIKA 1SN8A 3HFZB 4POGA 3ULPA 3OTOL 3GTKH 1NMGA 3DLLA 1HNWL 1B7YB 4X64L 1V9PA 3J81c 1X55A 3T1HL 4A3FH 3CCRA 3CCVA 4DV5Q 4R1JA 3PGZA 4A93H 1GKHA 1FL0A 1NY4A 4JOIA 4ALPA 3HOZG 1GM5A 4H02A 1AH9A 4HJ8A 1VQMA 2ALYB 4JI8Q 3ULJA 3TS0A 4QY7A 3I7FA 4DV6Q 2RHSB 2VW9A 4A76A 3AFQA 3G71A 3RN5A 4X62Q 4OX9Q 4A3DH 4YHHQ 4JI4L 4BA2I 2R7DA 4QGUA 1X3FA 3FKIH 5C4XG 3U58A 2AMCB 3GTPH 1L1OA 4GOPA 2Q2UA 4B3SL 1KC8C 4A3MH 2KCTA 3F2DA 4LFAQ 1RL2A 1AE2A 1UEBA 3J7ZC 1Q12A 3JC66 4GS3A 4NXML 4A3DG 2JA7H 3PO3G 1IXRA 4JCVE 3K81C 2ZJRA 4KHPL 1SFOH 1I94Q 4DV0L 1N33L 4PZ8A 1A63A 1LUZA 3U50C 5AJ3Q 3PO2H 1U0LA 3CF5A 2D62A 2F3IA 1PH7A 1S3OA 4TQUS 3UDXA 4QQBX 3J81i 4DK3C 1C0AA 2UUCL 3HOUG 1YHQA 4AQYL 3RN2A 4O0AA 4GN3B 2UXBL 2VZAA 4B3TL 2IX1A 1NTGA 3S2HH 2HHHL 4B3RQ 1EIYB 2GVAA 1X3EA 2JE6I 3CAMA 2IT1A 3DM3A 3I2ZA 3GDEA 3M4PA 1FJGQ 1VCIA 2NVQH 2JQOA 2Q2IA 4JI3L 1UWVA 5M5XH 1IBKQ 4NXNL 4GKJL 1JT8A 3JAMc 2OWOA 2JEAI 1N36L 5M3MG 2UXDQ 1WJJA 4MTNA 4P74A 1XTDA 2MO0A 4LNQA 3S24A 2KHJA 1SLJA 4DR5L 1PFSA 4A3IG 1PHJA 1GO3E 3PIPA 1R9TH 2F4VL 2R7FA 1OXXK 1SMXA 4DAMA 3KF6B 1T9HA 4PG3A 4IPGA 4JC0A 1S72A 2A8VA 4DV3Q 3PUVA 1TWFH 4HJAA 2KBNA 2ID0A 2E5LQ 2PQAA 1EOVA 4JI6L 3D31A 2WB1E 2HIVA 1Y1WH 4A3BH 2UU9L 5M5YH 2CCZA 5IP9H 1VQKA 1I6HH 4DUZQ 4LF9Q 2NN6G 3EN2A 4K0KL 4L5QA 3CMAA 1Q1EA 4O2DA 3K7AH 4BXXG 2NZOA 4GN5A 1TWGH 2E2JH 3RNUA 3G4SA 2ASBA 1VQAA 4LF7Q 3ULLA 4DV7Q 4BY1H 2LXJA 1I3QH 1JB7A 4YY3L 3UE0A 1K8AC 4LUZA 3WWVA 1SE8A 3PCOB 5IT9c 2E2IH 3CD6A 4IJHA 3TEHB 4JG2A 2YTVA 4YWMA 4HIOA 1LM0A 2BA0A 3AQQA 1FGUA 1IBLQ 2UUAQ 4PMWA 1P8LA 4DR4L 1CKNB 4FDBA 3UDFA 5H1SE 5FJ8G 3T1YL 3CCQA 5FLXc 4DR1L 2K52A 5M3FH 4LF6L 1JJGA 3S1NH 2UUBL 2MFIA 1BBUA 4UY8C 1N8RC 2CKZB 1J5EQ 3CCJA 3OW2A 4EX5A 2K5NA 1L0WA 4JYAQ 4DPGA 4DV1Q 3K8AA 3E9HA 3KOJA 5LMUQ 4LF4Q 3STBD 2I5HA 3W1BA 1SRUA 4GKKQ 3KJOA 1EQRA 3KDFB 2HIXA 5JEAG 4A3JG 3J80c 4BBRG 2R7ZG 4P75A 1B8AA 3PSIA 5LMNW 2ATWA 5BR8Q 3HOXG 2Y0SE 4UPAA 4DV4L 1K3RA 4C3IH 4A3CH 1VQOA 3OTOQ 2I5LX 3EIVA 5IY0A 3CCSA 5M3MH 2WB1G 4DR2L 4X64Q 3K80C 3T1HQ 1G6PA 1Z47A 2K50A 2MO1A 3FP9A 4OXPA 1HR0W 4BY7G 1KQSA 1E1OA 1GD7A 3PF4A 4JI0L 3CPWA 1YJ9A 2R93G 1PH5A 1H95A 1DGSA 1WCMG 3A74A 5IP7G 2JJQA 3G6EA 1A0IA 3B6YA 2KENA 3TREA 2K4KA 4X65L 3M85A 4R4IA 2EIFA 2RCNA 5JEAJ 4BA1I 2ZM6L 1JMCA 3ERSX 2D0OA 1KRTA 1PH1A 3NBHB
chains in the Genus database with same CATH superfamily
1VQIA 1PH8A 2OT2A 2VNUD 1ICWA 1V43A 3NE5B 4IQZA 3GTJB 1EU4A 2JA8B 3S1QB 2XGTA 2CVRA 3HGBA 4AIMA 4KHPQ 4KHZA 1GUGA 2KUMA 3CPFA 1ENCA 3S15H 3ER0A 3S17H 4A3GG 4MNOA 1NMFA 4Y7NB 3W1GA 4U673 2JA5H 1IL2A 1PTOD 2RDFA 5IGCA 2K6AA 2DUDA 3QJYA 4R4TA 5FJ8H 2D2CC 1Q82C 5ELEA 3CXCA 4H0LC 1QNKA 4HN7A 2R92G 2PNHA 4LFCQ 2JA6H 1BOSA 3NELA 4DV6L 4B3TQ 2CQAA 3I4NG 1YZ6A 3RZOB 2Z6KC 2ZTDA 3EBEA 3GD7A 1C9OA 1V1QA 3LX0A 4NXNQ 5A35A 1ESFA 1N36Q 5I4DA 4RH6A 3Q6SA 1VQDA 3HOXH 3U4VA 1YNJD 2F4VQ 2B2UA 2VL6A 3I4MG 2E8GA 4C1NI 1LTLA 4DN4M 5BN5A 3GP7A 3ND9A 1WFQA 1XX8A 4K14A 3P20A 2A68C 1KHIA 3MEHA 1LT6D 3H3VH 1RCVD 1LLRD 4PZ7A 3M4OH 2XSCA 2CQOA 1VDZA 3OYYA 4MZ9A 3TSSA 3HOZH 2DY7A 4BBSG 1QUQB 3ICEA 4JI5Q 1CSPA 5ELCA 3CCMA 3E9IA 4JI1L 1B70B 3E6ZX 1VQJA 1TIID 2JEBI 5J3BA 1EYCA 4DR3Q 3NHHA 2RA4A 1Y14B 5GQOA 4DGZA 1YVCA 4JBWA 4RG1A 3G6JB 3STBC 4DR1Q 3E3XA 5C3EH 3KF8A 4P73A 4EQ5A 5I9OA 1S4ZA 2FXQA 2VQEL 1WD0A 3VA7A 2F0WA 1EWIA 3I72A 3HOWB 1D8LA 1EZ8A 1VMCA 1JOOA 1Q7YC 1AZPA 4ZQ3A 2K32A 3HG9A 3FKIB 4N8FA 4UP8A 4R9WA 4A3MB 3GQBA 1HA5A 5ELOA 2JA7G 2A73B 4WFN3 2UXCL 4I65A 2TMPA 3MZ5A 5FLMG 1QZHA 4MHEA 1ASZA 4YWKA 2WV6D 1VS0A 4KI0A 3D6WA 1HRJA 1TS3A 4JI0Q 4C3HB 4A3IH 4PQXA 1YI2A 2H1EA 4DR6L 3VA5A 3A5UA 2EYPA 1XPUA 2ZTCA 1KAWA 4BWGB 5IGGA 3BZKA 2NVYH 1U4LA 2IPKD 4OELB 1RTOA 3UE1A 2LS01 4DV2L 2IJ0A 3DMUA 1JOQA 1PTOC 4MIUA 3V05A 4CBVA 5IYDG 3PUZA 3A8IE 3W3AA 2ICEC 4WJ3M 3CU7A 1VQHA 2CFMA 4QF4A 4XIGS 1DZ1A 5GADC 2XIWA 2H4OA 4X3TA 2N49A 2QF7A 3H94A 3F8TA 3NTKA 3VDYA 1YNJC 4FF4A 4JI8L 2UUCQ 5IIFA 3MXNB 1STYA 2NVXB 2DJFC 3W2DA 3CC2A 2E2JB 1CUKA 2FMMA 5E4XA 4KY5A 4XQNA 3K57A 4JBMA 3CKIB 4GLXA 1TWAH 2EXZA 2EZVA 4K8JA 4A3JH 3A7AB 1RIPA 3P75A 4QMGA 4GLAC 5FO8B 5AJ3L 1L1OB 1QUQA 3IRBA 3BVZA 1SYFA 1K3BC 4GLVB 1SXTA 2QEXA 3IAYA 2D0PA 5E7NA 2EXDA 2K5WA 1VQFA 3UDIA 2E75C 2QEJC 1BUVT 1TQOA 4JI1Q 1WTVA 2CHBD 5JOBA 3S2DH 2EOTA 2QDBA 1QB5D 4OEMB 3I3CA 4N9PA 2EJGC 4KKUA 1VQ8A 2F0OA 2DN8A 2VQEQ 5DEHA 3CW2C 4EGVA 1WI5A 1YNND 4LF6Q 2B63H 1BCPF 2UUBQ 4X66L 1PV4A 2JK8A 1CQVA 5HY6A 4P71A 2SNSA 5IYBH 3NBIA 3GTOB 1XNRL 1EY8A 3Q8DA 3J7YW 4DNIA 1QVGA 3EFXD 2LXKA 2L15A 1EU3A 3K5LA 4A3EB 1QVCA 2UXCQ 3OOCA 2RSOA 2JA5G 1F2YA 3FDTA 2UUAL 2F0HA 4ZKCB 4A3KH 1NUCA 4A75A 3KYHC 1EL0A 2YTYA 3KLRA 1TWCH 3VYUA 2MQHA 4C2MH 2JA6G 4DR6Q 2PYKA 4AYBB 3I55A 3N52A 1S5DD 4FVMA 2IW3A 4JYAL 2PW7A 3TQYA 5LMUL 5C44B 4LF8L 4ZYSA 4ZUIA 4DV2Q 2IL8A 2RDGA 5FLXE 1YHBA 2IHEA 1HNZQ 3C2PA 1SN8A 4DNTB 1ET9A 3DLLA 1STHA 1V9PA 1X55A 4A3FH 3MXNA 4IUVA 3CCVA 5C4JB 4R1JA 3J80E 1GKHA 4F8MA 1FL0A 2EJMA 5KIXA 4JOIA 3HOZG 4KK7A 1B50A 4H02A 2R3ZA 1AFPA 2ALYB 4JI8Q 5M5YB 4QY7A 4A76A 3VYSA 5IGDA 3RN5A 1LT4D 3AU7A 2NVTB 3K7AB 3EJIA 4BA2I 5I6WA 4QGUA 1X3FA 2A69D 3U58A 4J6HA 1L1OA 3A54A 1BXTA 2A6ED 4HMIA 4CDDC 1AE2A 1WTPA 2EE1A 4M1UB 3JC66 2E2IB 4GS3A 1RTNA 1TT2A 1IXRA 1EIHA 1T5EA 2K04A 1SFOH 4L8JA 4ZKBB 1QG7A 3NWTA 1A63A 2WIIB 4RWSC 5AJ3Q 4K5VA 3PO2H 3S1MB 4XYOA 5EQ0A 1S3OA 2E74C 1SNDA 5DM73 2EYOA 1YHQA 4AQYL 3KLSA 4O0AA 3X3NA 1NTGA 2P5ZX 4WJWA 3K59A 4KV6A 3MFGA 1U4PA 1FJGQ 2NVQH 2Q2IA 4DNRB 4HR7B 5C3WA 2JEAI 1SMYD 2KVMA 1YNNC 1SYCA 2K05A 3Q24A 4P74A 2CH4A 2MO0A 3WOEA 5M3MB 2OEOA 4A3IG 1HTPA 3KF6B 4PG3A 3R2TA 4KKSA 4DV3Q 1O80A 1PRTF 2PO4A 2EDGA 2ID0A 3D8GA 4JI6L 3R8BA 1Y1WH 2CCZA 5IP9H 4K0KL 2MJ8A 3X3MA 1TWGH 3G4SA 3Q0AA 4KHVA 4BY1H 2F0VA 1JB7A 1ENFA 4Z9CB 4YY3L 1S5CD 4LUZA 3S16B 4IJHA 3TEHB 4JG2A 2YTVA 4HIOA 1LM0A 2B2TA 2BA0A 1FGUA 1IBLQ 2UUAQ 1PFMA 4PMWA 3FEWX 4DR4L 1CKNB 2PZTA 2C9OA 3DWPA 3T1YL 1E2ZA 5M3FH 1JJGA 2XWBB 4KJOA 4CKEA 2ZXPA 2F4IA 2CKZB 3T13A 3OW2A 1F9PA 2K01A 2K5NA 1L0WA 1STNA 4DPGA 3H09A 4JYAQ 3KOJA 5LMUQ 3K6OA 2I5HA 4ODGA 5C0XH 3TZUA 3TP7A 3KDFB 2HIXA 4A3JG 2F0JA 3PSIA 5CV9A 5LMNW 1FNVA 2R7ZB 1CA5A 4DV4L 3GTGB 4C3IH 4FF2A 1VQOA 1I6VC 4KKTA 2DNCA 2WB1G 2Z6BA 5IGEA 4V190 2K50A 1LO5D 2EPBA 2F0PA 4KY6A 3PF4A 4IALA 3CPWA 1AEXA 1SDFA 1WVLA 2A69C 4K6DA 3G6EA 3B6YA 2KENA 3MXGA 3UI2A 2ZM6L 4BA1I 3ERSX 1KRTA 1NAPA 1BVSA 5KGUA 2AQ2B 4LUOA 1LYLA 1HNXL 3U4ZA 4RKLA 1K8MA 3L7ZC 4RGNA 3SE0A 1D5XC 2XRQD 1CKOA 1RKNA 3KFUA 4ZCKA 2B63G 1CKMA 4LUVA 5CBAE 4A3GB 1PYSB 3RLOA 1XNQQ 3HZXA 3TBIB 1AZQA 4H13C 1SMYC 2O5IC 2R92B 1Y8OB 1OXSC 3GTMH 3HOVG 3I4NB 4LF5Q 4OX9L 1CZGA 1R4PB 3KF6A 3CHBD 5E1FA 1K9MC 3D0FA 2Z9HA 3MHBA 2OQKA 5BN3A 2L12A 4A3KG 1A62A 1EY5A 2KEEA 3M9BA 3MVVA 4JI2L 2ES2A 2B39A 2BH2A 2FJ2A 3I4MB 3CC4A 1B1ZA 3FRPB 1NE3A 2J7ZA 1D2BA 1KLGD 2YU9B 2D9UA 4JI6Q 4LFBL 1HFGA 3U9OA 3WOFA 2CWPA 1O7ZA 2JP1A 2B8FA 5DNFA 4R4OA 1JQYD 2WAQG 1RF2D 1J6QA 4BBSB 3VYTA 2QA4A 1CKNA 4TKOB 5KYLA 4YY3Q 3S1QH 1HXYD 4A3FG 3HEJA 3E0EA 5C4XH 2B2WA 3CRLC 4MTKA 2EYFA 4Y7NH 1GHJA 1X6OA 1G291 1I50H 3KDFA 1JC7A 3PO3H 2F3VA 4KN7C 1WTOA 3PUXA 2E5LL 5CV7A 3D6CA 3WDNA 3EA6A 1PFNA 1K0RA 4RCNA 5HGQA 5D3DA 1UNSA 5JJIA 1HZAA 5GROA 1JE5A 2BOSA 3GV3A 3H91A 3GTPB 3CC7A 4DK0A 1F9RA 2EY2A 4DV7L 4B3ML 3KUPA 1WYDA 4FYDA 2KHIA 2JA7B 4B9XA 2A74C 1C7YA 2L9HA 5IE8A 3M7GA 1HNWQ 2DNEA 4DFAA 1B9NA 1G51A 4DA2A 1VQ7A 1XMOL 4C56C 3AYHB 2CH4W 1EY7A 1T5XD 3PMFA 2Z0SA 4R4CA 1PLFA 2XTIA 4LF4L 2ZM6Q 3BYTB 2B2YC 3T4AC 2PW5A 4A4IA 3M7NA 4DR7L 2L1BA 1TS5A 3L0OA 3SK5A 1N32L 5ELNA 2NZHA 1SR3A 4JI4Q 1OTCA 4YCWA 4XTCS 4ZUJA 5D65A 4OO1I 1SROA 1VQ5A 3BS1A 1PH9A 1PVOA 3PIO3 1IW7D 2WINB 3FVQA 5IYCH 1I5FA 4RMFA 3BVGA 4M8AA 1D1KA 1E2VA 1TWHB 5KRUA 1Q1BA 1EFWA 1TWFB 3FHWA 4GNXC 1KNEA 1Y1WG 1SE2A 3F2CA 1PH6A 5IP9G 3HOYG 1D1IA 4NPSA 1I4HA 3IL8A 1IHZA 1WTXA 1TKWB 3HOWH 1CQFA 1V8QA 3K7UC 2UXBQ 3J81E 2CWAA 4GZYC 4BY1G 1NNXA 2G9HD 1KDCA 1BO0A 2RBMA 1XMQL 2Q8IB 1STAA 2R6GA 3H0GG 3BDCA 1GUTA 3SK8A 5FKAC 3OMGA 2NBFA 4LFAL 1G8ZD 3ITPA 2V1CC 4JI2Q 2QKIC 5GAGC 5M3FG 2IWHA 4DR5Q 4UP7A 4OWTB 2F0KA 5CYUA 3S1NB 4YCUA 3NENA 4C3HH 1AE3A 4GOPB 1MKHA 4L5SA 4CDFC 1J9OA 1EY4A 4BY7H 1PXUA 4LFBQ 4HAEA 5C0XG 2MNAA 1DOLA 5FO7B 4IPCA 1WOCA 1SSOA 1Q90A 1HJPA 2R93H 1HH2P 4POFA 1WCMH 5IP7H 3CP0A 5DAUA 4C3IG 3A0JA 3QIAA 1JJ2A 5KEEA 2Z4HA 1KAAA 2MHVA 1B44D 3I4OA 4OONA 3NK9A 5DLQE 2RF4A 4IPHA 2K5HA 5C0XJ 4RGMA 4EQNA 1A3UA 2FINB 3OHXC 4HSPA 4ILWA 4A3LH 3JAME 1QVFA 4DK1A 2K5DA 1Z6HA 2C5CA 4DU9A 5F2DA 1E2WA 3EQLC 1UAPA 2PQEA 1ZXTA 1VQNA 2NVXH 4LF9L 1EEFD 1BCPC 4B3MQ 1XPRA 4KY7A 2EY1A 1ILQA 4LF7L 1I4PA 2VUMH 2VXWA 2V4DA 4S3SA 1NR4A 2YV5A 3S15B 1II3A 4ZK9B 2JA5B 3CCEA 4OWWB 1PRTD 2HDLA 1XMOQ 2C35B 1MJEA 1E7ZA 3NTIA 4QL5A 2F0LA 3Q23A 2M9VA 3R3OA 2JA6B 2YYZA 4Y52H 1Q81C 2J0TD 3D4WA 1J5EL 2IHFA 5IODA 1ESRA 4NKLA 3QWNA 3SXHA 5IT9E 4PZ6A 4X65Q 1IW7C 4OL7A 4DR7Q 1N32Q 4QUFA 4OO1H 1PYWD 1SNMA 1AN8A 1YEZA 1UE1A 5A2QE 2J4XA 1E24A 3KLWA 2RVLA 1MGSA 2B2UC 1MIUA 1IKLA 4TSSA 3OTOL 3GTKH 3QOLA 2O2LD 1IKMA 1R9TB 4X64L 1H9KA 3T1HL 4CKCA 1I4GA 1SE4A 1HA6A 1U4RA 2LMCB 4A93H 1NY4A 1GM5A 1AH9A 4B08A 5NUCA 1VQMA 3HOZB 4G4KA 3ULJA 2X69A 2VW9A 4DV6Q 4FXDA 1TU2B 2NZ1D 3OSOA 2R7DA 5LL6X 4F88A 5C4XG 2VB2X 4NDXA 3TP8A 1RD9D 1V1OA 4GOPA 2F0SA 4B3SL 1Z7TA 3I73A 2F0MA 4LFAQ 1RL2A 1STEA 3S9WA 3PO3G 1FGBD 3K81C 1XTCD 4FO2A 4PZ8A 1GUNA 5CV4A 3U50C 1CHPD 3OPOA 1V1PB 1D5ZC 2LKVA 2R61A 1U0LA 3K5MA 1I4XA 2F0UA 2D62A 2D5DA 4TQUS 4QQBX 1SYEA 3M4YA 2EY5A 2F0NA 1Q3LA 5C5MA 1IL8A 3S2HH 3DEOA 3MFYA 1EIYB 2GVAA 3CAMA 2F0FA 2JSOA 1IYUA 1VCIA 5M5XH 4JI3L 4FF1A 2GA4B 1PZID 2OWOA 2JXMB 2KA7A 2KEDA 2ENBA 4LNQA 1PFSA 1LABA 4JK1C 2NTTA 3FPUB 4ZRZA 1SMXA 4A3IB 1SYGA 1T9HA 2MUYA 1QJOA 3MC0B 2A8VA 1HQRD 2KBNA 4RA8A 3Q22A 1EOVA 2NVYB 2WB1E 2HIVA 4A3BH 2UU9L 5M5YH 1STGA 1G6ZA 4LF9Q 3BVMA 1EQTA 3CMAA 1PRTC 3K7AH 2NZOA 3I4LA 2PZUA 2ASBA 1VQAA 4LF7Q 1EYDA 1Y8PB 5I6YA 2LXJA 3KK7A 1K8AC 1SE8A 2WKDA 2E2IH 4HSVA 4R8IA 4LJZC 3A55A 3UDFA 4DF7A 5FJ8G 4FF3A 3RZDB 4O42A 1H9JA 2K52A 1U4MA 1BBUA 4UY8C 1N8RC 4WRDA 4FP5D 1J5EQ 2NYZD 2PCFB 1PMRA 1LTAD 3W1BA 1SRUA 2ZXOA 3KJOA 4P75A 5CR3A 1TWAB 1MHWC 3I70A 4A3JB 2ATWA 4KN4C 3HOXG 1K3RA 3OTOQ 2I5LX 5M3MH 1EFID 4DR2L 4C3HG 4X64Q 1O7LA 3K80C 3T1HQ 2WB1B 3FP9A 1HR0W 4BY7G 2EYJA 1EIGA 2M2LA 2E2HB 2R93G 3GTQB 1F2MA 1WCMG 5IP7G 2MPMA 3M85A 1GJXA 3TREA 5G3LF 1JMCA 3K8AA 4F7XA 1E0BA 3S1RB 2G9DA 4WJ4A 5JJZA 3MEFA 4L63B 4CJ1B 2M00A 1V1PA 2A1AA 4B3SQ 1U5KA 4HIMA 1KD1C 4N9TA 1QWYA 2HQLA 1VQ9A 2K7VA 5JJLA 5C3EG 3OIPA 4J8QA 2WAQE 3LNNA 4A3LG 2B63B 4R4QA 2IX3A 5J22A 5LMNL 2ICIA 1X54A 1Y1VH 3I56A 2Y0SG 4FXKC 4IUQA 5D3IB 5IOCA 2VB3X 2JA9A 1HUNA 1CK1A 1BBWA 3QO2A 3K58A 3PIOA 1QCBD 1HZ9A 3M3YH 1DONA 2PMZE 4YHHL 1L0XB 2GVBA 3GV6A 3HOVB 2VUMG 1ZEQX 3QB3A 2Q8RE 4PV1C 2R7ZH 1XJVA 1HZBA 1JJCB 4HIDA 3J81j 4IO9A 3GTGH 2NTSA 4X6AH 2VY3A 3BZDB 4JBJA 1PZKD 4RHRA 1TY2A 4A3KB 5ELDA 1EEID 1TWCB 4C2MB 2BDOA 1VF5C 2I0QA 3QG1A 3CCUA 4K5WA 5T1IA 1PA6A 4X66Q 2HDMA 3KBXA 2UU9Q 4OO1G 2KCMA 4QIWE 1HZCA 2RCFA 3VR3A 2N8NA 2WFWA 1K8GA 2KCCA 1XNRQ 2WAQB 4I7ZC 3BJUA 1CFMA 5COYA 4P72A 2UXDL 4HJ9A 1U9RA 1UE6A 4IN3A 3L2PA 3A5ZB 4A3FB 4A93G 4KD3A 1H9RA 1NJIC 2KJXA 3NQTA 4JOIC 4A3DH 1JWSD 1N34L 3S14B 2KECA 4CDCC 4DUYL 1F77A 2HD3A 3BZCA 4RHSA 1VQ4A 1WTHA 3P7JA 1X3QA 3I4NH 3NEMA 1L1OC 3P1HA 2XWJB 4LF8Q 3HOUH 4GNXB 4XT3B 3KLSX 4HJ5A 1NBWA 1PFBA 4LWCA 2FFKB 2KQ3A 4XQJA 1SFOB 3TZDA 4X3KA 4QIWB 3DWAA 3TP6A 3I4MH 5M5WH 4UHVA 4X3UA 2AKWB 3HKSA 1OXTA 3H15A 4ZLTF 5CMDA 1JICA 4JI7L 2B2VC 3K0XA 2BE5C 2Q2TA 4UP9A 4DAYB 1UEAB 4GKKL 4J15A 1XYIA 1QILA 5FK9C 4MN3A 5A2QL 4BBSH 5BR8L 1VQBA 2ZXRA 5D14A 1K83B 3I90A 3N6RA 1SYDA 4CHTB 2N3SA 1D6EC 2NB0A 3A8JE 4IUUA 5BN4A 3FPPA 4OGQC 1MI2A 4KD4A 1MJCA 4L5TA 4DAVA 1YJWA 1QZGA 5LMNQ 2LSSA 1ET6A 1Z9FA 2KHSA 4A3BG 1KDAA 2L55A 4C3JH 1Y1WB 1YBYA 4IUPA 3RMHA 4DAPA 4ID6A 3HOYB 5IYBG 1MSHA 1TVXA 1UE7A 4V0BA 3HKZG 4AQYQ 3F2BA 2GN5A 3GTLH 3NPPA 3G48A 1HPCA 4BY1B 4N8X1 1F9QA 2Z4IA 3CQZH 3SR1A 1G2SA 5CV6A 1KRSA 5JEAH 1I4RA 3H0GB 4BBRH 1FVIA 4HCEA 4K5XA 1VQGA 4UAIA 2K5QA 5M3FB 1ASYA 5FLMH 1BKBA 1KNAA 5I2XA 3TRZA 5J39A 2ZTEA 2K14A 4UDUC 4LW1A 4QJFA 4K6LA 4LFCL 2B29A 1KL9A 1EOTA 1A15A 3CRKC 3QOJA 4K0KQ 1EY0A 4C3IB 1X32A 1IBKL 1A2UA 3QR8A 5GAHC 1I4QA 3SEBA 3GTJH 5IYDH 2JA8H 2X6GA 1CZWA 4K8IA 1TWHH 2F0EA 5ELFA 1Q8KA 1ICFB 1N34Q 4DR4Q 2OCEA 3T1YQ 2HQEA 3SK6A 3CMEA 4GNXA 1R4QB 4DUYQ 1PTOB 1A8VA 1JWUD 3H3VI 1SJED 1VMPA 1KABA 4C1NK 4JI5L 4ABNA 1W6JA 3VR4A 3RZOH 2F0IA 1S40A 2Z6KA 4FNFA 4DR3L 1DJRD 2ZT9C 1BQQT 4DV4Q 3NUCA 2ZJQA 3C3LA 1SAPA 2F03A 1P16A 3DXJC 1RODA 3JAMi 1D7QA 1Y1VG 3W5OA 2XNAC 3PO2G 1LTBD 1PYBA 2DGYA 1KXLA 1VQLA 1BCPD 5EPLA 5C6AA 2SEBD 4IOAA 2OXPA 4JI7Q 3RLNA 4IFDI 1OXVA 4R8NA 1LTGD 3GTMB 3RLFA 3KF8B 1GUOA 2EYLA 5KNBA 1H9SB 4HJ7A 5FLXL 4HMJA 3MTSA 1HNXQ 2EVBA 3GO5A 4G7ZC 1S5FD 1EIFA 4HIKA 2TSSA 4POGA 3ULPA 3OW7A 1NMGA 1B7YB 1DOMA 2PNRC 5E4WC 1SNQA 3PGZA 3J80L 1F2LA 3V96A 1GOZA 1EQVA 3HP3A 5CORA 3TS0A 1I6HB 2AUJD 2XN9C 4OX9Q 1SJHD 1G91A 3SK4A 3FKIH 3DM1A 4I7AA 3D4RA 3TMEA 5C4XB 3HS0C 5EBCA 2Q2UA 1I3QB 4A3MH 3F2DA 2B2WC 1RJTA 1ZYRC 1DCZA 3J7ZC 4G7HC 1FNWA 4NXML 4A3DG 1I50B 4DV0L 1N33L 3PO3B 1PRTB 1LUZA 1AW7A 3DUZA 5G3LD 5C4HA 2F3IA 1PH7A 5EPJA 5CC4A 1HUMA 1HCZA 3UDXA 5JPNC 1LTID 4DK3C 2UUCL 3HOUG 3RN2A 1ILPA 4CJ2C 2HHHL 3T56B 4G57A 1Q8IA 3DM3A 2IT1A 3I2ZA 3A56A 5J1ZA 3GDEA 3M4PA 1IBKQ 4GKJL 5K36H 1KLUD 1WJJA 4MTNA 1XTDA 3S24A 3NWSA 1GO3E 1IYVA 2HUGA 1R9TH 3FMCA 5HGTA 4XXEA 4DAMA 1LTTD 3K5NA 2L11A 2SDFA 1HHVA 4JC0A 3OWEB 1S72A 2F0TA 3EVQA 4YIJA 2E5LQ 2LFNA 3VYRA 2DJGC 3TDQA 4CKBA 4L6TB 4J1MA 1VQKA 4GN5A 2E2JH 3ZYYX 1DD2A 4DV7Q 3OWFA 5KNDA 1ZKOA 2L5TA 3PCOB 5EKIA 3CD6A 4YWMA 3S17B 4XDXA 4C3JG 4IFDH 1KTKA 4EQOA 5H1SE 3CCQA 4LAAA 5FLXc 2E2DC 1Y69U 4LF6L 1XXGA 3NP8A 1H9SA 1QOHA 5EPKA 2UUBL 4HTHA 1AP0A 3ERQA 4EX5A 4RKBA 5I2YA 1WTWA 3BDOA 3E9HA 1SNCA 4LF4Q 4CDEC 1EQRA 4K2LA 5JEAG 3J80c 4BBRG 3A8KE 2Y0SE 4JW0A 3T51B 3C1EA 4LMQD 1HTLD 4UPAA 3HOXB 4A3CH 2L4NA 3CCSA 5IY0A 4RCOA 3F2UA 1CT1D 4F87A 4NW2A 1G6PA 1Z47A 1BR9A 4OXPA 1A6XA 2KCNA 1E1OA 1M4VA 1GD7A 2OF1A 2EY6A 4BY7B 5C5LA 2EYMA 1A3TA 1SEBD 5IGBA 1A3VA 1H95A 2R93B 3M4OB 1DGSA 1GHKA 2Z8LA 2N88A 1A0IA 2K4KA 1WCMB 4R4IA 2EIFA 5JEAJ 2FHTA 2D0OA 3NBHB 3T16A 2B3GA 4U68A 2AUKA 5JAVA 1HNZL 2K33A 3GTOH 2N55A 2EJFC 2JA8G 2K1BA 1HQMC 5CBEE 1XMQQ 2OTJA 2IY5B 1X3GA 1O78A 4HEDA 4GN4B 3MA2B 4A3EH 2NN6I 3SHLA 1LT3D 1SNPA 4NXMQ 3J80i 2QGQA 5EAYA 4DV0Q 1N33Q 4OHJA 5C3EB 1WD1A 1W6KA 3RZDH 1CI3M 4RAUC 1RHPA 3NTHA 2O5JC 4WORA 3I8ZA 4TRDA 2Y0SB 3OMCA 3D4DA 2F52A 4LK1C 4PMBA 3PIP3 3I91A 5GAEC 3PUWA 2HT1A 2BA1A 5IGFA 2HHHQ 2JYOA 4IPDA 5CGKA 2JN4A 3VR6A 1HR0L 1EZ6A 4APVA 2H5XA 2X6LA 5C44H 1LTSD 1VQ6A 3M4QA 2VUMB 4GKJQ 3V2TA 3L3OC 5LHY1 3HRZC 1M90C 4IUTA 3IFDA 2PI2E 2XRSD 3LGJA 4PNYA 2K03A 3C1FA 5ISRA 4H44C 1VQEA 2E2HH 1J8IA 1TXYA 1EYGA 3GTQH 1GVPA 5C4JH 4QUCA 5T1GA 1PZJD 3U9SA 1TS4A 1YJNA 1CTMA 3K5OA 5EKKA 4AYBE 1O7IA 2BCOA 3S1RH 1FJGL 3AEVA 4E6IA 4TVAB 3MWYW 2NVTH 1QNUA 2HCIA 4JBKA 4AH6A 4ME3A 3SDZA 3GTKB 2F0DA 5FO9B 3IKJA 4CGYB 5K5PA 2AHOB 1SYBA 5IYCG 1JE4A 2A6HD 2AQ1B 2G5DA 2HCCA 2AWOA 4ME5A 2BH8A 4A93B 4DV3L 2Q2HA 1DM0B 1S5ED 1FD7D 2NWGA 3RR5A 3HOWG 3S1MH 3PUYA 5E3FA 1X9NA 2PZWA 3O13A 2WACA 3BDLA 2RHQB 3FKIG 1IBML 3KJPA 3H6MA 1VQCA 4EVOA 3HOVH 4GOPC 2A5HA 4A3MG 1PH2A 4JV5L 3SVMA 1OO9B 4ZAIA 1Q46A 4DKAC 4RGTA 3J7A5 5AFWA 3PV0A 1YIJA 3HKZE 1IBLL 2SOBA 5HURA 4KTAA 3K0YA 3NBHA 2QDLA 4K2KA 3DEPA 1PH3A 4IOCA 1TR5A 2RSNA 3AFPA 1LV9A 5L37A 3PF5A 1PH4A 2Q8TA 1CHQD 1PTOF 3S2HB 1ONLA 1JWMD 1VQPA 1EQQA 1JOKA 4IUNA 4DXGA 5IWAL 4NB3A 5C0XI 3NQIA 5M5XB 5K36G 3MXPA 4OIKA 1W2BA 1EWCA 2NN6H 4QCLA 3S2DB 1F2ZA 2KOLA 4BXXH 2VQFL 2RKSA 4EQPA 1K73C 1LACA 2BE5D 3F1ZA 4JVZA 5JVG3 3LWEA 4YCVA 3S16H 5JJKA 1FR3A 1GXDC 1UE5A 2A19A 1H9MA 3G7LA 4DV5L 3S14H 1D5MC 1E1TA 2OQ0A 3TS2A 3T53B 1UUPA 4OWXB 1C8CA 4A3BB 1N9WA 2K5VA 3IFTA 5FOBB 1BF4A 2AQ3B 1B3QA 1HR0Q 3HKZB 2BDNA 2OTLA 3J81L 1KIXA 1MBYA 4X62L 3UDGA 1SE3A 2EYHA 3SGIA 1CSQA 2PPBC 3AB9A 1LT5D 4JI3Q 1JB3A 4IFDG 2CW0D 3BYYB 4FXGC 5C4ZA 1CA6A 1I94L 4Q0FA 3A7LA 4HCSA 1XPOA 2L0CA 1XNQL 4NMZA 1HFNA 2B2VA 2VS1A 4XQQA 2K28A 1CM9A 3VR2A 4LF5L 2A6HC 3H3VC 4B3RL 3BG3A 4X3SA 2MGSA 4A3CG 3J7AV 1X3PA 4IFDJ 1NCVA 1C48A 1MD2D 4QB4A 1W3SA 1M1KC 1K83H 2F0GA 3AMUA 2FMCA 3URYA 2AWNA 1BNZA 5C3XA 5CV5A 2I46A 2B8GA 1DOKA 4DK6C 1Q86C 2PI2A 1C4QA 1B53A 2I5MX 4IJLA 1FNUA 1JORA 1FYCA 1ML0D 2PMZB 3CCLA 4DXFA 4G7OC 4A3GH 2NUCA 1B2TA 2K75A 3ZJYC 3JAML 1GUSA 1K28A 3HOYH 5M9OA 1QE6A 2WKCA 1IBMQ 1K0SA 2WP8J 2RDHA 1X56A 2R92H 4DUZL 2N78A 5LL6S 1DYQA 1OXUA 4JV5Q 4A3EG 1F9SA 1X65A 2PQAB 3BU2A 3H0GH 1S5BD 2QW7A 1Y8NB 1E3PA 1SBBB 1YNXA 4DR2Q 1BDOA 5EKLA 2YTXA 4H7BA 1Y1VB 3PO2B 4AYBG 4NP5A 4KLKA 4YWLA 3M3YB 1YITA 2YU9H 1L2FA 1TS2A 4DV1L 5C44G 3DHQA 5IT9L 3TP5A 2Z1CA 5IWAQ 2EQSA 2IX0A 4L5RC 1EY9A 1E22A 1IZ6A 1IYJB 3D3RA 3ONAB 1BBXC 2NVQB 5KYIA 1EUJA 4XT1B 1YHAA 2ZJPA 2VQFQ 3E0JA 2F1MA 3HFZB 1HNWL 3NSWA 3J81c 1TY0A 1ENAA 1G2TA 3CCRA 4DV5Q 3DWQA 3MXUA 2A6EC 3R93A 5DM63 1NSNS 4ALPA 1PTOH 4HJ8A 4P2CB 2CW0C 3I7FA 2RHSB 2RQXA 3AFQA 3G71A 4IZ8A 4X62Q 1O7YA 4YHHQ 4JI4L 1TWGB 1EWHA 5JVH3 2AMCB 3GTPH 1KC8C 2KCTA 1UEBA 3R2IA 1STBA 1Q12A 2B2TC 2JA7H 1K8OA 4JCVE 2ZJRA 4KHPL 4A3DB 2MP1A 4JPBW 1I94Q 1BCPB 1WTQA 3CF5A 4RGOS 5JPMC 3J81i 1B3AA 1C0AA 1B9MA 1ZYRD 3VR5A 1LTRD 2UXBL 4GN3B 2VZAA 4B3TL 2IX1A 1EY6A 3HOUB 4B3RQ 2B2YA 3NXWA 1X3EA 2JE6I 5TSSA 1WTRA 2JQOA 1JT8A 1UWVA 1VF7A 4NXNL 4XYQA 3JAMc 5I9PA 2QCPX 1N36L 4PMCA 5M3MG 2UXDQ 2KHJA 1SLJA 4DR5L 1PHJA 5M5WB 3PIPA 2F4VL 1M8AA 1OXXK 2R7FA 4BS9A 2LY7A 4IPGA 1JR0D 2F3WA 3PUVA 1TWFH 5ELBA 3KBGA 4HJAA 2PQAA 4CJ0B 3D31A 3RD4A 2O4XA 1I6HH 4DUZQ 2NN6G 3EN2A 4L5QA 2I07B 2A68D 1Q1EA 4KJNA 4O2DA 4BXXG 1JCKB 3L9AX 3RNUA 3J7AF 4KMUC 4ULLA 3ULLA 4O1NA 1I3QH 1PDQA 3UE0A 3WWVA 5IT9c 1XWEA 2DY8A 3AQQA 3C46A 1DXMA 1P8LA 4FDBA 4DAYA 4DR1L 4C3JB 1NR2A 4OIJA 3S1NH 2SNMA 2MFIA 3MAQA 3CCJA 1SNOA 5KNCA 4DV1Q 1MSGA 3GTLB 3STBD 4IURA 4Q5VA 4GKKQ 2E76C 1B4OA 3CQZB 2R7ZG 1B8AA 2QILA 3ND8A 2XVSA 4BBRB 5BR8Q 1RDPD 5EBDA 2F0QA 3OIQA 3EIVA 5CV8A 1L0YB 3RUZA 1A2TA 1EYAA 2MO1A 3E5SA 1KDBA 5EGTA 1KQSA 4JI0L 1YJ9A 3LWUA 1PH5A 3TN2A 1GUWA 5EJWA 3A74A 2JJQA 3PQIA 4X65L 2RCNA 4RFBA 4B9WA 3EROA 1PH1A
chains in the Genus database with same CATH topology
1BVSA 1VQIA 1PH8A 4LUOA 2VNUD 4WJ4A 2B3GA 1LYLA 3MEFA 1HNZL 1HNXL 1V43A 3U4ZA 3GTOH 2JA8G 3L7ZC 2A1AA 4B3SQ 1U5KA 1XMQQ 4HIMA 2OTJA 2IY5B 2XGTA 1KD1C 1X3GA 2HQLA 4GN4B 4A3EH 4NXMQ 2NN6I 4AIMA 1VQ9A 1CKOA 3KFUA 3J80i 2QGQA 4KHZA 4KHPQ 5JJLA 5EAYA 5C3EG 3CPFA 4DV0Q 1N33Q 2B63G 3ER0A 3S15H 3S17H 2WAQE 1CKMA 4MNOA 1NMFA 4A3GG 4LUVA 4A3LG 3W1GA 2JA5H 4R4QA 1IL2A 3RZDH 5LMNL 4R4TA 2DUDA 5FJ8H 1PYSB 1X54A 1Y1VH 3RLOA 1Q82C 3CXCA 1XNQQ 3I56A 2Y0SG 2R92G 2JA9A 2F52A 2PNHA 4LFCQ 2JA6H 3NELA 1OXSC 1BBWA 5GAEC 4DV6L 3PUWA 3PIOA 1HZ9A 4B3TQ 2HT1A 3I4NG 2BA1A 2HHHQ 2PMZE 3GTMH 3HOVG 4LF5Q 4IPDA 1YZ6A 4YHHL 2Z6KC 4OX9L 2ZTDA 2GVBA 3EBEA 1HR0L 2VUMG 3KF6A 4APVA 2H5XA 1C9OA 3GD7A 5C44H 1V1QA 1VQ6A 3M4QA 1K9MC 4NXNQ 4GKJQ 2R7ZH 3D0FA 1XJVA 1HZBA 1JJCB 4HIDA 3J81j 4IO9A 1N36Q 3GTGH 1M90C 2OQKA 4X6AH 1VQDA 2VY3A 3HOXH 3U4VA 4A3KG 2PI2E 4JBJA 1A62A 2F4VQ 3LGJA 3M9BA 2VL6A 3I4MG 4JI2L 2E8GA 1LTLA 2ES2A 2BH2A 3CC4A 1NE3A 1WFQA 2I0QA 3CCUA 1KHIA 1VQEA 2E2HH 1TXYA 1EYGA 3H3VH 3GTQH 1GVPA 4PZ7A 5C4JH 3M4OH 4JI6Q 1PA6A 2CQOA 4LFBL 4X66Q 2CWPA 1YJNA 2UU9Q 4OO1G 2KCMA 4QIWE 1HZCA 3OYYA 4MZ9A 4R4OA 3HOZH 4BBSG 2N8NA 4AYBE 1QUQB 1O7IA 2WAQG 2WFWA 1K8GA 3S1RH 3ICEA 4JI5Q 1J6QA 1FJGL 2QA4A 1CSPA 1CKNA 1XNRQ 3AEVA 4TVAB 3CCMA 3BJUA 3E9IA 4JI1L 1B70B 1VQJA 2NVTH 4P72A 4JBKA 4AH6A 2UXDL 2JEBI 4ME3A 5J3BA 4DR3Q 4YY3Q 1UE6A 4HJ9A 3S1QH 4A3FG 2AHOB 1Y14B 5C4XH 3E0EA 5GQOA 5IYCG 3A5ZB 3L2PA 1YVCA 4JBWA 4RG1A 4A93G 3STBC 2AWOA 1NJIC 2BH8A 5C3EH 4DR1Q 4Y7NH 4JOIC 4P73A 1X6OA 3KDFA 1G291 1I50H 2FXQA 2Q2HA 4EQ5A 2VQEL 4DV3L 1N34L 3PO3H 3PUXA 2E5LL 3RR5A 3HOWG 4DUYL 3S1MH 3PUYA 1EWIA 1K0RA 5HGQA 3BZCA 1VQ4A 1X9NA 1D8LA 2RHQB 3FKIG 1Q7YC 5JJIA 1HZAA 5GROA 3KJPA 1IBML 1JE5A 3I4NH 1VQCA 3NEMA 4UP8A 1L1OC 3HOVH 4GOPC 4A3MG 4LF8Q 3CC7A 4GNXB 1PH2A 3HOUH 4HJ5A 1NBWA 4DV7L 4B3ML 4JV5L 4LWCA 1WYDA 2JA7G 5ELOA 1Q46A 2KHIA 4DKAC 2UXCL 3J7A5 3PV0A 1C7YA 1YIJA 3HKZE 1IBLL 1QZHA 5FLMG 1ASZA 5IE8A 4YWKA 1HNWQ 1VS0A 4KI0A 1G51A 1VQ7A 3I4MH 5M5WH 1XMOL 4JI0Q 2AKWB 4A3IH 1PH3A 3AYHB 1OXTA 3HKSA 3H15A 4IOCA 1YI2A 3AFPA 4DR6L 4JI7L 3A5UA 2Z0SA 1XPUA 2ZTCA 1KAWA 3K0XA 4R4CA 3PF5A 2XTIA 1PH4A 2Q2TA 4LF4L 4UP9A 4DAYB 2ZM6Q 1VQPA 4J15A 1EQQA 4GKKL 3BZKA 2NVYH 4A4IA 3M7NA 5IWAL 4DR7L 4NB3A 3UE1A 5C0XI 5K36G 3L0OA 1N32L 4BBSH 5BR8L 1VQBA 2NZHA 1SR3A 5ELNA 4DV2L 4YCWA 1W2BA 4XTCS 1OTCA 4JI4Q 4OO1I 5IYDG 3PUZA 2N3SA 4BXXH 2VQFL 1SROA 1K73C 1VQ5A 3F1ZA 1PH9A 1PVOA 4WJ3M 5IYCH 1I5FA 1VQHA 4RMFA 2CFMA 4YCVA 4XIGS 3S16H 1MJCA 4L5TA 1Q1BA 1YJWA 1QZGA 5JJKA 1EFWA 1UE5A 2A19A 5GADC 5LMNQ 2LSSA 3FHWA 4GNXC 1Z9FA 4DV5L 3S14H 1Y1WG 4A3BG 3F2CA 1E1TA 2OQ0A 4C3JH 5IP9G 2N49A 1PH6A 3HOYG 3TS2A 1YBYA 4NPSA 4OWXB 1N9WA 2K5VA 3F8TA 5IYBG 3VDYA 3HOWH 1UE7A 4JI8L 3HKZG 2UUCQ 3K7UC 3MXNB 4AQYQ 3F2BA 2GN5A 2UXBQ 3CC2A 1HR0Q 2OTLA 2CWAA 1KIXA 4BY1G 3GTLH 1CUKA 4X62L 3G48A 3UDGA 3SGIA 1XMQL 4JBMA 1CSQA 3CQZH 2R6GA 3H0GG 4GLXA 1TWAH 1KRSA 4JI3Q 4A3JH 4BBRH 1FVIA 4LFAL 4IFDG 1RIPA 2V1CC 4JI2Q 5GAGC 5M3FG 1VQGA 4DR5Q 4UP7A 4OWTB 4GLAC 1ASYA 5FLMH 1I94L 3M3YH 1BKBA 4YCUA 3NENA 3TRZA 5AJ3L 1L1OB 1AE3A 1QUQA 2K14A 2ZTEA 3IRBA 4C3HH 1MKHA 4GOPB 1XPOA 4L5SA 1XNQL 4LW1A 4BY7H 4QJFA 4LFBQ 4GLVB 5C0XG 4LFCL 2MNAA 2VS1A 2B29A 1KL9A 4IPCA 1WOCA 2QEXA 2R93H 1HJPA 4LF5L 2D0PA 5E7NA 1HH2P 4POFA 2EXDA 1WCMH 5IP7H 1VQFA 3UDIA 3CP0A 4B3RL 4K0KQ 4A3CG 4JI1Q 3A0JA 4IFDJ 1JJ2A 1M1KC 1W3SA 1IBKL 3S2DH 1K83H 5GAHC 2AWNA 3GTJH 5IYDH 3I4OA 2JA8H 4OONA 5DLQE 1VQ8A 2RF4A 4DK6C 4IPHA 1Q86C 1TWHH 2PI2A 1Q8KA 2I5MX 1N34Q 4IJLA 4DR4Q 2K5HA 5C0XJ 2OCEA 2VQEQ 3T1YQ 3CW2C 3CMEA 4GNXA 3CCLA 1WI5A 4LF6Q 2B63H 4A3GH 4DUYQ 2K75A 4X66L 3ZJYC 2UUBQ 1A8VA 1QVFA 3H3VI 1PV4A 4A3LH 3HOYH 2JK8A 5HY6A 4P71A 1IBMQ 5IYBH 2WP8J 1X56A 1VQNA 2NVXH 2R92H 4JI5L 4DUZL 4LF9L 1XNRL 2N78A 3Q8DA 1OXUA 4DNIA 1QVGA 4B3MQ 3RZOH 1XPRA 4JV5Q 2LXKA 2Z6KA 4A3EG 1S40A 4DR3L 1X65A 2PQAB 2L15A 4LF7L 1QVCA 3BU2A 2VUMH 2UXCQ 3H0GH 4DV4Q 2ZJQA 2YV5A 2JA5G 1E3PA 1P16A 1YNXA 3JAMi 4DR2Q 1Y1VG 3W5OA 3CCEA 4OWWB 1D7QA 1MJEA 1XMOQ 2YTXA 2C35B 1PYBA 4A3KH 2DGYA 2UUAL 1E7ZA 3PO2G 1KXLA 4QL5A 4A75A 1VQLA 3KYHC 2YTYA 4AYBG 1TWCH 4C2MH 2MQHA 2JA6G 4DR6Q 4KLKA 4JI7Q 4IOAA 3RLNA 4IFDI 3I55A 1OXVA 2YYZA 4Y52H 1Q81C 4YWLA 1J5EL 2IHFA 1YITA 2YU9H 3RLFA 1L2FA 4JYAL 3KF8B 4DV1L 5C44G 4PZ6A 4X65Q 3TQYA 5LMUL 5IWAQ 2EQSA 2IX0A 4L5RC 4LF8L 4DR7Q 1E22A 1N32Q 1IZ6A 1IYJB 4DV2Q 4HJ7A 1YHBA 1YEZA 2IHEA 1UE1A 1HNZQ 1HNXQ 1EUJA 1E24A 3GO5A 3KLWA 1YHAA 2ZJPA 1MIUA 2VQFQ 1EIFA 4HIKA 1SN8A 3HFZB 4POGA 3ULPA 3OTOL 3GTKH 1NMGA 3DLLA 1HNWL 1B7YB 4X64L 1V9PA 3J81c 1X55A 3T1HL 4A3FH 3CCRA 3CCVA 4DV5Q 4R1JA 3PGZA 4A93H 1GKHA 1FL0A 1NY4A 4JOIA 4ALPA 3HOZG 1GM5A 4H02A 1AH9A 4HJ8A 1VQMA 2ALYB 4JI8Q 3ULJA 3TS0A 4QY7A 3I7FA 4DV6Q 2RHSB 2VW9A 4A76A 3AFQA 3G71A 3RN5A 4X62Q 4OX9Q 4A3DH 4YHHQ 4JI4L 4BA2I 2R7DA 4QGUA 1X3FA 3FKIH 5C4XG 3U58A 2AMCB 3GTPH 1L1OA 4GOPA 2Q2UA 4B3SL 1KC8C 4A3MH 2KCTA 3F2DA 4LFAQ 1RL2A 1AE2A 1UEBA 3J7ZC 1Q12A 3JC66 4GS3A 4NXML 4A3DG 2JA7H 3PO3G 1IXRA 4JCVE 3K81C 2ZJRA 4KHPL 1SFOH 1I94Q 4DV0L 1N33L 4PZ8A 1A63A 1LUZA 3U50C 5AJ3Q 3PO2H 1U0LA 3CF5A 2D62A 2F3IA 1PH7A 1S3OA 4TQUS 3UDXA 4QQBX 3J81i 4DK3C 1C0AA 2UUCL 3HOUG 1YHQA 4AQYL 3RN2A 4O0AA 4GN3B 2UXBL 2VZAA 4B3TL 2IX1A 1NTGA 3S2HH 2HHHL 4B3RQ 1EIYB 2GVAA 1X3EA 2JE6I 3CAMA 2IT1A 3DM3A 3I2ZA 3GDEA 3M4PA 1FJGQ 1VCIA 2NVQH 2JQOA 2Q2IA 4JI3L 1UWVA 5M5XH 1IBKQ 4NXNL 4GKJL 1JT8A 3JAMc 2OWOA 2JEAI 1N36L 5M3MG 2UXDQ 1WJJA 4MTNA 4P74A 1XTDA 2MO0A 4LNQA 3S24A 2KHJA 1SLJA 4DR5L 1PFSA 4A3IG 1PHJA 1GO3E 3PIPA 1R9TH 2F4VL 2R7FA 1OXXK 1SMXA 4DAMA 3KF6B 1T9HA 4PG3A 4IPGA 4JC0A 1S72A 2A8VA 4DV3Q 3PUVA 1TWFH 4HJAA 2KBNA 2ID0A 2E5LQ 2PQAA 1EOVA 4JI6L 3D31A 2WB1E 2HIVA 1Y1WH 4A3BH 2UU9L 5M5YH 2CCZA 5IP9H 1VQKA 1I6HH 4DUZQ 4LF9Q 2NN6G 3EN2A 4K0KL 4L5QA 3CMAA 1Q1EA 4O2DA 3K7AH 4BXXG 2NZOA 4GN5A 1TWGH 2E2JH 3RNUA 3G4SA 2ASBA 1VQAA 4LF7Q 3ULLA 4DV7Q 4BY1H 2LXJA 1I3QH 1JB7A 4YY3L 3UE0A 1K8AC 4LUZA 3WWVA 1SE8A 3PCOB 5IT9c 2E2IH 3CD6A 4IJHA 3TEHB 4JG2A 2YTVA 4YWMA 4HIOA 1LM0A 2BA0A 3AQQA 1FGUA 1IBLQ 2UUAQ 4PMWA 1P8LA 4DR4L 1CKNB 4FDBA 3UDFA 5H1SE 5FJ8G 3T1YL 3CCQA 5FLXc 4DR1L 2K52A 5M3FH 4LF6L 1JJGA 3S1NH 2UUBL 2MFIA 1BBUA 4UY8C 1N8RC 2CKZB 1J5EQ 3CCJA 3OW2A 4EX5A 2K5NA 1L0WA 4JYAQ 4DPGA 4DV1Q 3K8AA 3E9HA 3KOJA 5LMUQ 4LF4Q 3STBD 2I5HA 3W1BA 1SRUA 4GKKQ 3KJOA 1EQRA 3KDFB 2HIXA 5JEAG 4A3JG 3J80c 4BBRG 2R7ZG 4P75A 1B8AA 3PSIA 5LMNW 2ATWA 5BR8Q 3HOXG 2Y0SE 4UPAA 4DV4L 1K3RA 4C3IH 4A3CH 1VQOA 3OTOQ 2I5LX 3EIVA 5IY0A 3CCSA 5M3MH 2WB1G 4DR2L 4X64Q 3K80C 3T1HQ 1G6PA 1Z47A 2K50A 2MO1A 3FP9A 4OXPA 1HR0W 4BY7G 1KQSA 1E1OA 1GD7A 3PF4A 4JI0L 3CPWA 1YJ9A 2R93G 1PH5A 1H95A 1DGSA 1WCMG 3A74A 5IP7G 2JJQA 3G6EA 1A0IA 3B6YA 2KENA 3TREA 2K4KA 4X65L 3M85A 4R4IA 2EIFA 2RCNA 5JEAJ 4BA1I 2ZM6L 1JMCA 3ERSX 2D0OA 1KRTA 1PH1A 3NBHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BVS A;  1VQI A;  1PH8 A;  4LUO A;  2VNU D;  4WJ4 A;  2B3G A;  1LYL A;  3MEF A;  1HNZ L;  1HNX L;  1V43 A;  3U4Z A;  3GTO H;  2JA8 G;  3L7Z C;  2A1A A;  4B3S Q;  1U5K A;  1XMQ Q;  4HIM A;  2OTJ A;  2IY5 B;  2XGT A;  1KD1 C;  1X3G A;  2HQL A;  4GN4 B;  4A3E H;  4NXM Q;  2NN6 I;  4AIM A;  1VQ9 A;  1CKO A;  3KFU A;  3J80 i;  2QGQ A;  4KHZ A;  4KHP Q;  5JJL A;  5EAY A;  5C3E G;  3CPF A;  4DV0 Q;  1N33 Q;  2B63 G;  3ER0 A;  3S15 H;  3S17 H;  2WAQ E;  1CKM A;  4MNO A;  1NMF A;  4A3G G;  4LUV A;  4A3L G;  3W1G A;  2JA5 H;  4R4Q A;  1IL2 A;  3RZD H;  5LMN L;  4R4T A;  2DUD A;  5FJ8 H;  1PYS B;  1X54 A;  1Y1V H;  3RLO A;  1Q82 C;  3CXC A;  1XNQ Q;  3I56 A;  2Y0S G;  2R92 G;  2JA9 A;  2F52 A;  2PNH A;  4LFC Q;  2JA6 H;  3NEL A;  1OXS C;  1BBW A;  5GAE C;  4DV6 L;  3PUW A;  3PIO A;  1HZ9 A;  4B3T Q;  2HT1 A;  3I4N G;  2BA1 A;  2HHH Q;  2PMZ E;  3GTM H;  3HOV G;  4LF5 Q;  4IPD A;  1YZ6 A;  4YHH L;  2Z6K C;  4OX9 L;  2ZTD A;  2GVB A;  3EBE A;  1HR0 L;  2VUM G;  3KF6 A;  4APV A;  2H5X A;  1C9O A;  3GD7 A;  5C44 H;  1V1Q A;  1VQ6 A;  3M4Q A;  1K9M C;  4NXN Q;  4GKJ Q;  2R7Z H;  3D0F A;  1XJV A;  1HZB A;  1JJC B;  4HID A;  3J81 j;  4IO9 A;  1N36 Q;  3GTG H;  1M90 C;  2OQK A;  4X6A H;  1VQD A;  2VY3 A;  3HOX H;  3U4V A;  4A3K G;  2PI2 E;  4JBJ A;  1A62 A;  2F4V Q;  3LGJ A;  3M9B A;  2VL6 A;  3I4M G;  4JI2 L;  2E8G A;  1LTL A;  2ES2 A;  2BH2 A;  3CC4 A;  1NE3 A;  1WFQ A;  2I0Q A;  3CCU A;  1KHI A;  1VQE A;  2E2H H;  1TXY A;  1EYG A;  3H3V H;  3GTQ H;  1GVP A;  4PZ7 A;  5C4J H;  3M4O H;  4JI6 Q;  1PA6 A;  2CQO A;  4LFB L;  4X66 Q;  2CWP A;  1YJN A;  2UU9 Q;  4OO1 G;  2KCM A;  4QIW E;  1HZC A;  3OYY A;  4MZ9 A;  4R4O A;  3HOZ H;  4BBS G;  2N8N A;  4AYB E;  1QUQ B;  1O7I A;  2WAQ G;  2WFW A;  1K8G A;  3S1R H;  3ICE A;  4JI5 Q;  1J6Q A;  1FJG L;  2QA4 A;  1CSP A;  1CKN A;  1XNR Q;  3AEV A;  4TVA B;  3CCM A;  3BJU A;  3E9I A;  4JI1 L;  1B70 B;  1VQJ A;  2NVT H;  4P72 A;  4JBK A;  4AH6 A;  2UXD L;  2JEB I;  4ME3 A;  5J3B A;  4DR3 Q;  4YY3 Q;  1UE6 A;  4HJ9 A;  3S1Q H;  4A3F G;  2AHO B;  1Y14 B;  5C4X H;  3E0E A;  5GQO A;  5IYC G;  3A5Z B;  3L2P A;  1YVC A;  4JBW A;  4RG1 A;  4A93 G;  3STB C;  2AWO A;  1NJI C;  2BH8 A;  5C3E H;  4DR1 Q;  4Y7N H;  4JOI C;  4P73 A;  1X6O A;  3KDF A;  1G29 1;  1I50 H;  2FXQ A;  2Q2H A;  4EQ5 A;  2VQE L;  4DV3 L;  1N34 L;  3PO3 H;  3PUX A;  2E5L L;  3RR5 A;  3HOW G;  4DUY L;  3S1M H;  3PUY A;  1EWI A;  1K0R A;  5HGQ A;  3BZC A;  1VQ4 A;  1X9N A;  1D8L A;  2RHQ B;  3FKI G;  1Q7Y C;  5JJI A;  1HZA A;  5GRO A;  3KJP A;  1IBM L;  1JE5 A;  3I4N H;  1VQC A;  3NEM A;  4UP8 A;  1L1O C;  3HOV H;  4GOP C;  4A3M G;  4LF8 Q;  3CC7 A;  4GNX B;  1PH2 A;  3HOU H;  4HJ5 A;  1NBW A;  4DV7 L;  4B3M L;  4JV5 L;  4LWC A;  1WYD A;  2JA7 G;  5ELO A;  1Q46 A;  2KHI A;  4DKA C;  2UXC L;  3J7A 5;  3PV0 A;  1C7Y A;  1YIJ A;  3HKZ E;  1IBL L;  1QZH A;  5FLM G;  1ASZ A;  5IE8 A;  4YWK A;  1HNW Q;  1VS0 A;  4KI0 A;  1G51 A;  1VQ7 A;  3I4M H;  5M5W H;  1XMO L;  4JI0 Q;  2AKW B;  4A3I H;  1PH3 A;  3AYH B;  1OXT A;  3HKS A;  3H15 A;  4IOC A;  1YI2 A;  3AFP A;  4DR6 L;  4JI7 L;  3A5U A;  2Z0S A;  1XPU A;  2ZTC A;  1KAW A;  3K0X A;  4R4C A;  3PF5 A;  2XTI A;  1PH4 A;  2Q2T A;  4LF4 L;  4UP9 A;  4DAY B;  2ZM6 Q;  1VQP A;  4J15 A;  1EQQ A;  4GKK L;  3BZK A;  2NVY H;  4A4I A;  3M7N A;  5IWA L;  4DR7 L;  4NB3 A;  3UE1 A;  5C0X I;  5K36 G;  3L0O A;  1N32 L;  4BBS H;  5BR8 L;  1VQB A;  2NZH A;  1SR3 A;  5ELN A;  4DV2 L;  4YCW A;  1W2B A;  4XTC S;  1OTC A;  4JI4 Q;  4OO1 I;  5IYD G;  3PUZ A;  2N3S A;  4BXX H;  2VQF L;  1SRO A;  1K73 C;  1VQ5 A;  3F1Z A;  1PH9 A;  1PVO A;  4WJ3 M;  5IYC H;  1I5F A;  1VQH A;  4RMF A;  2CFM A;  4YCV A;  4XIG S;  3S16 H;  1MJC A;  4L5T A;  1Q1B A;  1YJW A;  1QZG A;  5JJK A;  1EFW A;  1UE5 A;  2A19 A;  5GAD C;  5LMN Q;  2LSS A;  3FHW A;  4GNX C;  1Z9F A;  4DV5 L;  3S14 H;  1Y1W G;  4A3B G;  3F2C A;  1E1T A;  2OQ0 A;  4C3J H;  5IP9 G;  2N49 A;  1PH6 A;  3HOY G;  3TS2 A;  1YBY A;  4NPS A;  4OWX B;  1N9W A;  2K5V A;  3F8T A;  5IYB G;  3VDY A;  3HOW H;  1UE7 A;  4JI8 L;  3HKZ G;  2UUC Q;  3K7U C;  3MXN B;  4AQY Q;  3F2B A;  2GN5 A;  2UXB Q;  3CC2 A;  1HR0 Q;  2OTL A;  2CWA A;  1KIX A;  4BY1 G;  3GTL H;  1CUK A;  4X62 L;  3G48 A;  3UDG A;  3SGI A;  1XMQ L;  4JBM A;  1CSQ A;  3CQZ H;  2R6G A;  3H0G G;  4GLX A;  1TWA H;  1KRS A;  4JI3 Q;  4A3J H;  4BBR H;  1FVI A;  4LFA L;  4IFD G;  1RIP A;  2V1C C;  4JI2 Q;  5GAG C;  5M3F G;  1VQG A;  4DR5 Q;  4UP7 A;  4OWT B;  4GLA C;  1ASY A;  5FLM H;  1I94 L;  3M3Y H;  1BKB A;  4YCU A;  3NEN A;  3TRZ A;  5AJ3 L;  1L1O B;  1AE3 A;  1QUQ A;  2K14 A;  2ZTE A;  3IRB A;  4C3H H;  1MKH A;  4GOP B;  1XPO A;  4L5S A;  1XNQ L;  4LW1 A;  4BY7 H;  4QJF A;  4LFB Q;  4GLV B;  5C0X G;  4LFC L;  2MNA A;  2VS1 A;  2B29 A;  1KL9 A;  4IPC A;  1WOC A;  2QEX A;  2R93 H;  1HJP A;  4LF5 L;  2D0P A;  5E7N A;  1HH2 P;  4POF A;  2EXD A;  1WCM H;  5IP7 H;  1VQF A;  3UDI A;  3CP0 A;  4B3R L;  4K0K Q;  4A3C G;  4JI1 Q;  3A0J A;  4IFD J;  1JJ2 A;  1M1K C;  1W3S A;  1IBK L;  3S2D H;  1K83 H;  5GAH C;  2AWN A;  3GTJ H;  5IYD H;  3I4O A;  2JA8 H;  4OON A;  5DLQ E;  1VQ8 A;  2RF4 A;  4DK6 C;  4IPH A;  1Q86 C;  1TWH H;  2PI2 A;  1Q8K A;  2I5M X;  1N34 Q;  4IJL A;  4DR4 Q;  2K5H A;  5C0X J;  2OCE A;  2VQE Q;  3T1Y Q;  3CW2 C;  3CME A;  4GNX A;  3CCL A;  1WI5 A;  4LF6 Q;  2B63 H;  4A3G H;  4DUY Q;  2K75 A;  4X66 L;  3ZJY C;  2UUB Q;  1A8V A;  1QVF A;  3H3V I;  1PV4 A;  4A3L H;  3HOY H;  2JK8 A;  5HY6 A;  4P71 A;  1IBM Q;  5IYB H;  2WP8 J;  1X56 A;  1VQN A;  2NVX H;  2R92 H;  4JI5 L;  4DUZ L;  4LF9 L;  1XNR L;  2N78 A;  3Q8D A;  1OXU A;  4DNI A;  1QVG A;  4B3M Q;  3RZO H;  1XPR A;  4JV5 Q;  2LXK A;  2Z6K A;  4A3E G;  1S40 A;  4DR3 L;  1X65 A;  2PQA B;  2L15 A;  4LF7 L;  1QVC A;  3BU2 A;  2VUM H;  2UXC Q;  3H0G H;  4DV4 Q;  2ZJQ A;  2YV5 A;  2JA5 G;  1E3P A;  1P16 A;  1YNX A;  3JAM i;  4DR2 Q;  1Y1V G;  3W5O A;  3CCE A;  4OWW B;  1D7Q A;  1MJE A;  1XMO Q;  2YTX A;  2C35 B;  1PYB A;  4A3K H;  2DGY A;  2UUA L;  1E7Z A;  3PO2 G;  1KXL A;  4QL5 A;  4A75 A;  1VQL A;  3KYH C;  2YTY A;  4AYB G;  1TWC H;  4C2M H;  2MQH A;  2JA6 G;  4DR6 Q;  4KLK A;  4JI7 Q;  4IOA A;  3RLN A;  4IFD I;  3I55 A;  1OXV A;  2YYZ A;  4Y52 H;  1Q81 C;  4YWL A;  1J5E L;  2IHF A;  1YIT A;  2YU9 H;  3RLF A;  1L2F A;  4JYA L;  3KF8 B;  4DV1 L;  5C44 G;  4PZ6 A;  4X65 Q;  3TQY A;  5LMU L;  5IWA Q;  2EQS A;  2IX0 A;  4L5R C;  4LF8 L;  4DR7 Q;  1E22 A;  1N32 Q;  1IZ6 A;  1IYJ B;  4DV2 Q;  4HJ7 A;  1YHB A;  1YEZ A;  2IHE A;  1UE1 A;  1HNZ Q;  1HNX Q;  1EUJ A;  1E24 A;  3GO5 A;  3KLW A;  1YHA A;  2ZJP A;  1MIU A;  2VQF Q;  1EIF A;  4HIK A;  1SN8 A;  3HFZ B;  4POG A;  3ULP A;  3OTO L;  3GTK H;  1NMG A;  3DLL A;  1HNW L;  1B7Y B;  4X64 L;  1V9P A;  3J81 c;  1X55 A;  3T1H L;  4A3F H;  3CCR A;  3CCV A;  4DV5 Q;  4R1J A;  3PGZ A;  4A93 H;  1GKH A;  1FL0 A;  1NY4 A;  4JOI A;  4ALP A;  3HOZ G;  1GM5 A;  4H02 A;  1AH9 A;  4HJ8 A;  1VQM A;  2ALY B;  4JI8 Q;  3ULJ A;  3TS0 A;  4QY7 A;  3I7F A;  4DV6 Q;  2RHS B;  2VW9 A;  4A76 A;  3AFQ A;  3G71 A;  3RN5 A;  4X62 Q;  4OX9 Q;  4A3D H;  4YHH Q;  4JI4 L;  4BA2 I;  2R7D A;  4QGU A;  1X3F A;  3FKI H;  5C4X G;  3U58 A;  2AMC B;  3GTP H;  1L1O A;  4GOP A;  2Q2U A;  4B3S L;  1KC8 C;  4A3M H;  2KCT A;  3F2D A;  4LFA Q;  1RL2 A;  1AE2 A;  1UEB A;  3J7Z C;  1Q12 A;  3JC6 6;  4GS3 A;  4NXM L;  4A3D G;  2JA7 H;  3PO3 G;  1IXR A;  4JCV E;  3K81 C;  2ZJR A;  4KHP L;  1SFO H;  1I94 Q;  4DV0 L;  1N33 L;  4PZ8 A;  1A63 A;  1LUZ A;  3U50 C;  5AJ3 Q;  3PO2 H;  1U0L A;  3CF5 A;  2D62 A;  2F3I A;  1PH7 A;  1S3O A;  4TQU S;  3UDX A;  4QQB X;  3J81 i;  4DK3 C;  1C0A A;  2UUC L;  3HOU G;  1YHQ A;  4AQY L;  3RN2 A;  4O0A A;  4GN3 B;  2UXB L;  2VZA A;  4B3T L;  2IX1 A;  1NTG A;  3S2H H;  2HHH L;  4B3R Q;  1EIY B;  2GVA A;  1X3E A;  2JE6 I;  3CAM A;  2IT1 A;  3DM3 A;  3I2Z A;  3GDE A;  3M4P A;  1FJG Q;  1VCI A;  2NVQ H;  2JQO A;  2Q2I A;  4JI3 L;  1UWV A;  5M5X H;  1IBK Q;  4NXN L;  4GKJ L;  1JT8 A;  3JAM c;  2OWO A;  2JEA I;  1N36 L;  5M3M G;  2UXD Q;  1WJJ A;  4MTN A;  4P74 A;  1XTD A;  2MO0 A;  4LNQ A;  3S24 A;  2KHJ A;  1SLJ A;  4DR5 L;  1PFS A;  4A3I G;  1PHJ A;  1GO3 E;  3PIP A;  1R9T H;  2F4V L;  2R7F A;  1OXX K;  1SMX A;  4DAM A;  3KF6 B;  1T9H A;  4PG3 A;  4IPG A;  4JC0 A;  1S72 A;  2A8V A;  4DV3 Q;  3PUV A;  1TWF H;  4HJA A;  2KBN A;  2ID0 A;  2E5L Q;  2PQA A;  1EOV A;  4JI6 L;  3D31 A;  2WB1 E;  2HIV A;  1Y1W H;  4A3B H;  2UU9 L;  5M5Y H;  2CCZ A;  5IP9 H;  1VQK A;  1I6H H;  4DUZ Q;  4LF9 Q;  2NN6 G;  3EN2 A;  4K0K L;  4L5Q A;  3CMA A;  1Q1E A;  4O2D A;  3K7A H;  4BXX G;  2NZO A;  4GN5 A;  1TWG H;  2E2J H;  3RNU A;  3G4S A;  2ASB A;  1VQA A;  4LF7 Q;  3ULL A;  4DV7 Q;  4BY1 H;  2LXJ A;  1I3Q H;  1JB7 A;  4YY3 L;  3UE0 A;  1K8A C;  4LUZ A;  3WWV A;  1SE8 A;  3PCO B;  5IT9 c;  2E2I H;  3CD6 A;  4IJH A;  3TEH B;  4JG2 A;  2YTV A;  4YWM A;  4HIO A;  1LM0 A;  2BA0 A;  3AQQ A;  1FGU A;  1IBL Q;  2UUA Q;  4PMW A;  1P8L A;  4DR4 L;  1CKN B;  4FDB A;  3UDF A;  5H1S E;  5FJ8 G;  3T1Y L;  3CCQ A;  5FLX c;  4DR1 L;  2K52 A;  5M3F H;  4LF6 L;  1JJG A;  3S1N H;  2UUB L;  2MFI A;  1BBU A;  4UY8 C;  1N8R C;  2CKZ B;  1J5E Q;  3CCJ A;  3OW2 A;  4EX5 A;  2K5N A;  1L0W A;  4JYA Q;  4DPG A;  4DV1 Q;  3K8A A;  3E9H A;  3KOJ A;  5LMU Q;  4LF4 Q;  3STB D;  2I5H A;  3W1B A;  1SRU A;  4GKK Q;  3KJO A;  1EQR A;  3KDF B;  2HIX A;  5JEA G;  4A3J G;  3J80 c;  4BBR G;  2R7Z G;  4P75 A;  1B8A A;  3PSI A;  5LMN W;  2ATW A;  5BR8 Q;  3HOX G;  2Y0S E;  4UPA A;  4DV4 L;  1K3R A;  4C3I H;  4A3C H;  1VQO A;  3OTO Q;  2I5L X;  3EIV A;  5IY0 A;  3CCS A;  5M3M H;  2WB1 G;  4DR2 L;  4X64 Q;  3K80 C;  3T1H Q;  1G6P A;  1Z47 A;  2K50 A;  2MO1 A;  3FP9 A;  4OXP A;  1HR0 W;  4BY7 G;  1KQS A;  1E1O A;  1GD7 A;  3PF4 A;  4JI0 L;  3CPW A;  1YJ9 A;  2R93 G;  1PH5 A;  1H95 A;  1DGS A;  1WCM G;  3A74 A;  5IP7 G;  2JJQ A;  3G6E A;  1A0I A;  3B6Y A;  2KEN A;  3TRE A;  2K4K A;  4X65 L;  3M85 A;  4R4I A;  2EIF A;  2RCN A;  5JEA J;  4BA1 I;  2ZM6 L;  1JMC A;  3ERS X;  2D0O A;  1KRT A;  1PH1 A;  3NBH B; 
#chains in the Genus database with same CATH topology
 1VQI A;  1PH8 A;  2OT2 A;  2VNU D;  1ICW A;  1V43 A;  3NE5 B;  4IQZ A;  3GTJ B;  1EU4 A;  2JA8 B;  3S1Q B;  2XGT A;  2CVR A;  3HGB A;  4AIM A;  4KHP Q;  4KHZ A;  1GUG A;  2KUM A;  3CPF A;  1ENC A;  3S15 H;  3ER0 A;  3S17 H;  4A3G G;  4MNO A;  1NMF A;  4Y7N B;  3W1G A;  4U67 3;  2JA5 H;  1IL2 A;  1PTO D;  2RDF A;  5IGC A;  2K6A A;  2DUD A;  3QJY A;  4R4T A;  5FJ8 H;  2D2C C;  1Q82 C;  5ELE A;  3CXC A;  4H0L C;  1QNK A;  4HN7 A;  2R92 G;  2PNH A;  4LFC Q;  2JA6 H;  1BOS A;  3NEL A;  4DV6 L;  4B3T Q;  2CQA A;  3I4N G;  1YZ6 A;  3RZO B;  2Z6K C;  2ZTD A;  3EBE A;  3GD7 A;  1C9O A;  1V1Q A;  3LX0 A;  4NXN Q;  5A35 A;  1ESF A;  1N36 Q;  5I4D A;  4RH6 A;  3Q6S A;  1VQD A;  3HOX H;  3U4V A;  1YNJ D;  2F4V Q;  2B2U A;  2VL6 A;  3I4M G;  2E8G A;  4C1N I;  1LTL A;  4DN4 M;  5BN5 A;  3GP7 A;  3ND9 A;  1WFQ A;  1XX8 A;  4K14 A;  3P20 A;  2A68 C;  1KHI A;  3MEH A;  1LT6 D;  3H3V H;  1RCV D;  1LLR D;  4PZ7 A;  3M4O H;  2XSC A;  2CQO A;  1VDZ A;  3OYY A;  4MZ9 A;  3TSS A;  3HOZ H;  2DY7 A;  4BBS G;  1QUQ B;  3ICE A;  4JI5 Q;  1CSP A;  5ELC A;  3CCM A;  3E9I A;  4JI1 L;  1B70 B;  3E6Z X;  1VQJ A;  1TII D;  2JEB I;  5J3B A;  1EYC A;  4DR3 Q;  3NHH A;  2RA4 A;  1Y14 B;  5GQO A;  4DGZ A;  1YVC A;  4JBW A;  4RG1 A;  3G6J B;  3STB C;  4DR1 Q;  3E3X A;  5C3E H;  3KF8 A;  4P73 A;  4EQ5 A;  5I9O A;  1S4Z A;  2FXQ A;  2VQE L;  1WD0 A;  3VA7 A;  2F0W A;  1EWI A;  3I72 A;  3HOW B;  1D8L A;  1EZ8 A;  1VMC A;  1JOO A;  1Q7Y C;  1AZP A;  4ZQ3 A;  2K32 A;  3HG9 A;  3FKI B;  4N8F A;  4UP8 A;  4R9W A;  4A3M B;  3GQB A;  1HA5 A;  5ELO A;  2JA7 G;  2A73 B;  4WFN 3;  2UXC L;  4I65 A;  2TMP A;  3MZ5 A;  5FLM G;  1QZH A;  4MHE A;  1ASZ A;  4YWK A;  2WV6 D;  1VS0 A;  4KI0 A;  3D6W A;  1HRJ A;  1TS3 A;  4JI0 Q;  4C3H B;  4A3I H;  4PQX A;  1YI2 A;  2H1E A;  4DR6 L;  3VA5 A;  3A5U A;  2EYP A;  1XPU A;  2ZTC A;  1KAW A;  4BWG B;  5IGG A;  3BZK A;  2NVY H;  1U4L A;  2IPK D;  4OEL B;  1RTO A;  3UE1 A;  2LS0 1;  4DV2 L;  2IJ0 A;  3DMU A;  1JOQ A;  1PTO C;  4MIU A;  3V05 A;  4CBV A;  5IYD G;  3PUZ A;  3A8I E;  3W3A A;  2ICE C;  4WJ3 M;  3CU7 A;  1VQH A;  2CFM A;  4QF4 A;  4XIG S;  1DZ1 A;  5GAD C;  2XIW A;  2H4O A;  4X3T A;  2N49 A;  2QF7 A;  3H94 A;  3F8T A;  3NTK A;  3VDY A;  1YNJ C;  4FF4 A;  4JI8 L;  2UUC Q;  5IIF A;  3MXN B;  1STY A;  2NVX B;  2DJF C;  3W2D A;  3CC2 A;  2E2J B;  1CUK A;  2FMM A;  5E4X A;  4KY5 A;  4XQN A;  3K57 A;  4JBM A;  3CKI B;  4GLX A;  1TWA H;  2EXZ A;  2EZV A;  4K8J A;  4A3J H;  3A7A B;  1RIP A;  3P75 A;  4QMG A;  4GLA C;  5FO8 B;  5AJ3 L;  1L1O B;  1QUQ A;  3IRB A;  3BVZ A;  1SYF A;  1K3B C;  4GLV B;  1SXT A;  2QEX A;  3IAY A;  2D0P A;  5E7N A;  2EXD A;  2K5W A;  1VQF A;  3UDI A;  2E75 C;  2QEJ C;  1BUV T;  1TQO A;  4JI1 Q;  1WTV A;  2CHB D;  5JOB A;  3S2D H;  2EOT A;  2QDB A;  1QB5 D;  4OEM B;  3I3C A;  4N9P A;  2EJG C;  4KKU A;  1VQ8 A;  2F0O A;  2DN8 A;  2VQE Q;  5DEH A;  3CW2 C;  4EGV A;  1WI5 A;  1YNN D;  4LF6 Q;  2B63 H;  1BCP F;  2UUB Q;  4X66 L;  1PV4 A;  2JK8 A;  1CQV A;  5HY6 A;  4P71 A;  2SNS A;  5IYB H;  3NBI A;  3GTO B;  1XNR L;  1EY8 A;  3Q8D A;  3J7Y W;  4DNI A;  1QVG A;  3EFX D;  2LXK A;  2L15 A;  1EU3 A;  3K5L A;  4A3E B;  1QVC A;  2UXC Q;  3OOC A;  2RSO A;  2JA5 G;  1F2Y A;  3FDT A;  2UUA L;  2F0H A;  4ZKC B;  4A3K H;  1NUC A;  4A75 A;  3KYH C;  1EL0 A;  2YTY A;  3KLR A;  1TWC H;  3VYU A;  2MQH A;  4C2M H;  2JA6 G;  4DR6 Q;  2PYK A;  4AYB B;  3I55 A;  3N52 A;  1S5D D;  4FVM A;  2IW3 A;  4JYA L;  2PW7 A;  3TQY A;  5LMU L;  5C44 B;  4LF8 L;  4ZYS A;  4ZUI A;  4DV2 Q;  2IL8 A;  2RDG A;  5FLX E;  1YHB A;  2IHE A;  1HNZ Q;  3C2P A;  1SN8 A;  4DNT B;  1ET9 A;  3DLL A;  1STH A;  1V9P A;  1X55 A;  4A3F H;  3MXN A;  4IUV A;  3CCV A;  5C4J B;  4R1J A;  3J80 E;  1GKH A;  4F8M A;  1FL0 A;  2EJM A;  5KIX A;  4JOI A;  3HOZ G;  4KK7 A;  1B50 A;  4H02 A;  2R3Z A;  1AFP A;  2ALY B;  4JI8 Q;  5M5Y B;  4QY7 A;  4A76 A;  3VYS A;  5IGD A;  3RN5 A;  1LT4 D;  3AU7 A;  2NVT B;  3K7A B;  3EJI A;  4BA2 I;  5I6W A;  4QGU A;  1X3F A;  2A69 D;  3U58 A;  4J6H A;  1L1O A;  3A54 A;  1BXT A;  2A6E D;  4HMI A;  4CDD C;  1AE2 A;  1WTP A;  2EE1 A;  4M1U B;  3JC6 6;  2E2I B;  4GS3 A;  1RTN A;  1TT2 A;  1IXR A;  1EIH A;  1T5E A;  2K04 A;  1SFO H;  4L8J A;  4ZKB B;  1QG7 A;  3NWT A;  1A63 A;  2WII B;  4RWS C;  5AJ3 Q;  4K5V A;  3PO2 H;  3S1M B;  4XYO A;  5EQ0 A;  1S3O A;  2E74 C;  1SND A;  5DM7 3;  2EYO A;  1YHQ A;  4AQY L;  3KLS A;  4O0A A;  3X3N A;  1NTG A;  2P5Z X;  4WJW A;  3K59 A;  4KV6 A;  3MFG A;  1U4P A;  1FJG Q;  2NVQ H;  2Q2I A;  4DNR B;  4HR7 B;  5C3W A;  2JEA I;  1SMY D;  2KVM A;  1YNN C;  1SYC A;  2K05 A;  3Q24 A;  4P74 A;  2CH4 A;  2MO0 A;  3WOE A;  5M3M B;  2OEO A;  4A3I G;  1HTP A;  3KF6 B;  4PG3 A;  3R2T A;  4KKS A;  4DV3 Q;  1O80 A;  1PRT F;  2PO4 A;  2EDG A;  2ID0 A;  3D8G A;  4JI6 L;  3R8B A;  1Y1W H;  2CCZ A;  5IP9 H;  4K0K L;  2MJ8 A;  3X3M A;  1TWG H;  3G4S A;  3Q0A A;  4KHV A;  4BY1 H;  2F0V A;  1JB7 A;  1ENF A;  4Z9C B;  4YY3 L;  1S5C D;  4LUZ A;  3S16 B;  4IJH A;  3TEH B;  4JG2 A;  2YTV A;  4HIO A;  1LM0 A;  2B2T A;  2BA0 A;  1FGU A;  1IBL Q;  2UUA Q;  1PFM A;  4PMW A;  3FEW X;  4DR4 L;  1CKN B;  2PZT A;  2C9O A;  3DWP A;  3T1Y L;  1E2Z A;  5M3F H;  1JJG A;  2XWB B;  4KJO A;  4CKE A;  2ZXP A;  2F4I A;  2CKZ B;  3T13 A;  3OW2 A;  1F9P A;  2K01 A;  2K5N A;  1L0W A;  1STN A;  4DPG A;  3H09 A;  4JYA Q;  3KOJ A;  5LMU Q;  3K6O A;  2I5H A;  4ODG A;  5C0X H;  3TZU A;  3TP7 A;  3KDF B;  2HIX A;  4A3J G;  2F0J A;  3PSI A;  5CV9 A;  5LMN W;  1FNV A;  2R7Z B;  1CA5 A;  4DV4 L;  3GTG B;  4C3I H;  4FF2 A;  1VQO A;  1I6V C;  4KKT A;  2DNC A;  2WB1 G;  2Z6B A;  5IGE A;  4V19 0;  2K50 A;  1LO5 D;  2EPB A;  2F0P A;  4KY6 A;  3PF4 A;  4IAL A;  3CPW A;  1AEX A;  1SDF A;  1WVL A;  2A69 C;  4K6D A;  3G6E A;  3B6Y A;  2KEN A;  3MXG A;  3UI2 A;  2ZM6 L;  4BA1 I;  3ERS X;  1KRT A;  1NAP A;  1BVS A;  5KGU A;  2AQ2 B;  4LUO A;  1LYL A;  1HNX L;  3U4Z A;  4RKL A;  1K8M A;  3L7Z C;  4RGN A;  3SE0 A;  1D5X C;  2XRQ D;  1CKO A;  1RKN A;  3KFU A;  4ZCK A;  2B63 G;  1CKM A;  4LUV A;  5CBA E;  4A3G B;  1PYS B;  3RLO A;  1XNQ Q;  3HZX A;  3TBI B;  1AZQ A;  4H13 C;  1SMY C;  2O5I C;  2R92 B;  1Y8O B;  1OXS C;  3GTM H;  3HOV G;  3I4N B;  4LF5 Q;  4OX9 L;  1CZG A;  1R4P B;  3KF6 A;  3CHB D;  5E1F A;  1K9M C;  3D0F A;  2Z9H A;  3MHB A;  2OQK A;  5BN3 A;  2L12 A;  4A3K G;  1A62 A;  1EY5 A;  2KEE A;  3M9B A;  3MVV A;  4JI2 L;  2ES2 A;  2B39 A;  2BH2 A;  2FJ2 A;  3I4M B;  3CC4 A;  1B1Z A;  3FRP B;  1NE3 A;  2J7Z A;  1D2B A;  1KLG D;  2YU9 B;  2D9U A;  4JI6 Q;  4LFB L;  1HFG A;  3U9O A;  3WOF A;  2CWP A;  1O7Z A;  2JP1 A;  2B8F A;  5DNF A;  4R4O A;  1JQY D;  2WAQ G;  1RF2 D;  1J6Q A;  4BBS B;  3VYT A;  2QA4 A;  1CKN A;  4TKO B;  5KYL A;  4YY3 Q;  3S1Q H;  1HXY D;  4A3F G;  3HEJ A;  3E0E A;  5C4X H;  2B2W A;  3CRL C;  4MTK A;  2EYF A;  4Y7N H;  1GHJ A;  1X6O A;  1G29 1;  1I50 H;  3KDF A;  1JC7 A;  3PO3 H;  2F3V A;  4KN7 C;  1WTO A;  3PUX A;  2E5L L;  5CV7 A;  3D6C A;  3WDN A;  3EA6 A;  1PFN A;  1K0R A;  4RCN A;  5HGQ A;  5D3D A;  1UNS A;  5JJI A;  1HZA A;  5GRO A;  1JE5 A;  2BOS A;  3GV3 A;  3H91 A;  3GTP B;  3CC7 A;  4DK0 A;  1F9R A;  2EY2 A;  4DV7 L;  4B3M L;  3KUP A;  1WYD A;  4FYD A;  2KHI A;  2JA7 B;  4B9X A;  2A74 C;  1C7Y A;  2L9H A;  5IE8 A;  3M7G A;  1HNW Q;  2DNE A;  4DFA A;  1B9N A;  1G51 A;  4DA2 A;  1VQ7 A;  1XMO L;  4C56 C;  3AYH B;  2CH4 W;  1EY7 A;  1T5X D;  3PMF A;  2Z0S A;  4R4C A;  1PLF A;  2XTI A;  4LF4 L;  2ZM6 Q;  3BYT B;  2B2Y C;  3T4A C;  2PW5 A;  4A4I A;  3M7N A;  4DR7 L;  2L1B A;  1TS5 A;  3L0O A;  3SK5 A;  1N32 L;  5ELN A;  2NZH A;  1SR3 A;  4JI4 Q;  1OTC A;  4YCW A;  4XTC S;  4ZUJ A;  5D65 A;  4OO1 I;  1SRO A;  1VQ5 A;  3BS1 A;  1PH9 A;  1PVO A;  3PIO 3;  1IW7 D;  2WIN B;  3FVQ A;  5IYC H;  1I5F A;  4RMF A;  3BVG A;  4M8A A;  1D1K A;  1E2V A;  1TWH B;  5KRU A;  1Q1B A;  1EFW A;  1TWF B;  3FHW A;  4GNX C;  1KNE A;  1Y1W G;  1SE2 A;  3F2C A;  1PH6 A;  5IP9 G;  3HOY G;  1D1I A;  4NPS A;  1I4H A;  3IL8 A;  1IHZ A;  1WTX A;  1TKW B;  3HOW H;  1CQF A;  1V8Q A;  3K7U C;  2UXB Q;  3J81 E;  2CWA A;  4GZY C;  4BY1 G;  1NNX A;  2G9H D;  1KDC A;  1BO0 A;  2RBM A;  1XMQ L;  2Q8I B;  1STA A;  2R6G A;  3H0G G;  3BDC A;  1GUT A;  3SK8 A;  5FKA C;  3OMG A;  2NBF A;  4LFA L;  1G8Z D;  3ITP A;  2V1C C;  4JI2 Q;  2QKI C;  5GAG C;  5M3F G;  2IWH A;  4DR5 Q;  4UP7 A;  4OWT B;  2F0K A;  5CYU A;  3S1N B;  4YCU A;  3NEN A;  4C3H H;  1AE3 A;  4GOP B;  1MKH A;  4L5S A;  4CDF C;  1J9O A;  1EY4 A;  4BY7 H;  1PXU A;  4LFB Q;  4HAE A;  5C0X G;  2MNA A;  1DOL A;  5FO7 B;  4IPC A;  1WOC A;  1SSO A;  1Q90 A;  1HJP A;  2R93 H;  1HH2 P;  4POF A;  1WCM H;  5IP7 H;  3CP0 A;  5DAU A;  4C3I G;  3A0J A;  3QIA A;  1JJ2 A;  5KEE A;  2Z4H A;  1KAA A;  2MHV A;  1B44 D;  3I4O A;  4OON A;  3NK9 A;  5DLQ E;  2RF4 A;  4IPH A;  2K5H A;  5C0X J;  4RGM A;  4EQN A;  1A3U A;  2FIN B;  3OHX C;  4HSP A;  4ILW A;  4A3L H;  3JAM E;  1QVF A;  4DK1 A;  2K5D A;  1Z6H A;  2C5C A;  4DU9 A;  5F2D A;  1E2W A;  3EQL C;  1UAP A;  2PQE A;  1ZXT A;  1VQN A;  2NVX H;  4LF9 L;  1EEF D;  1BCP C;  4B3M Q;  1XPR A;  4KY7 A;  2EY1 A;  1ILQ A;  4LF7 L;  1I4P A;  2VUM H;  2VXW A;  2V4D A;  4S3S A;  1NR4 A;  2YV5 A;  3S15 B;  1II3 A;  4ZK9 B;  2JA5 B;  3CCE A;  4OWW B;  1PRT D;  2HDL A;  1XMO Q;  2C35 B;  1MJE A;  1E7Z A;  3NTI A;  4QL5 A;  2F0L A;  3Q23 A;  2M9V A;  3R3O A;  2JA6 B;  2YYZ A;  4Y52 H;  1Q81 C;  2J0T D;  3D4W A;  1J5E L;  2IHF A;  5IOD A;  1ESR A;  4NKL A;  3QWN A;  3SXH A;  5IT9 E;  4PZ6 A;  4X65 Q;  1IW7 C;  4OL7 A;  4DR7 Q;  1N32 Q;  4QUF A;  4OO1 H;  1PYW D;  1SNM A;  1AN8 A;  1YEZ A;  1UE1 A;  5A2Q E;  2J4X A;  1E24 A;  3KLW A;  2RVL A;  1MGS A;  2B2U C;  1MIU A;  1IKL A;  4TSS A;  3OTO L;  3GTK H;  3QOL A;  2O2L D;  1IKM A;  1R9T B;  4X64 L;  1H9K A;  3T1H L;  4CKC A;  1I4G A;  1SE4 A;  1HA6 A;  1U4R A;  2LMC B;  4A93 H;  1NY4 A;  1GM5 A;  1AH9 A;  4B08 A;  5NUC A;  1VQM A;  3HOZ B;  4G4K A;  3ULJ A;  2X69 A;  2VW9 A;  4DV6 Q;  4FXD A;  1TU2 B;  2NZ1 D;  3OSO A;  2R7D A;  5LL6 X;  4F88 A;  5C4X G;  2VB2 X;  4NDX A;  3TP8 A;  1RD9 D;  1V1O A;  4GOP A;  2F0S A;  4B3S L;  1Z7T A;  3I73 A;  2F0M A;  4LFA Q;  1RL2 A;  1STE A;  3S9W A;  3PO3 G;  1FGB D;  3K81 C;  1XTC D;  4FO2 A;  4PZ8 A;  1GUN A;  5CV4 A;  3U50 C;  1CHP D;  3OPO A;  1V1P B;  1D5Z C;  2LKV A;  2R61 A;  1U0L A;  3K5M A;  1I4X A;  2F0U A;  2D62 A;  2D5D A;  4TQU S;  4QQB X;  1SYE A;  3M4Y A;  2EY5 A;  2F0N A;  1Q3L A;  5C5M A;  1IL8 A;  3S2H H;  3DEO A;  3MFY A;  1EIY B;  2GVA A;  3CAM A;  2F0F A;  2JSO A;  1IYU A;  1VCI A;  5M5X H;  4JI3 L;  4FF1 A;  2GA4 B;  1PZI D;  2OWO A;  2JXM B;  2KA7 A;  2KED A;  2ENB A;  4LNQ A;  1PFS A;  1LAB A;  4JK1 C;  2NTT A;  3FPU B;  4ZRZ A;  1SMX A;  4A3I B;  1SYG A;  1T9H A;  2MUY A;  1QJO A;  3MC0 B;  2A8V A;  1HQR D;  2KBN A;  4RA8 A;  3Q22 A;  1EOV A;  2NVY B;  2WB1 E;  2HIV A;  4A3B H;  2UU9 L;  5M5Y H;  1STG A;  1G6Z A;  4LF9 Q;  3BVM A;  1EQT A;  3CMA A;  1PRT C;  3K7A H;  2NZO A;  3I4L A;  2PZU A;  2ASB A;  1VQA A;  4LF7 Q;  1EYD A;  1Y8P B;  5I6Y A;  2LXJ A;  3KK7 A;  1K8A C;  1SE8 A;  2WKD A;  2E2I H;  4HSV A;  4R8I A;  4LJZ C;  3A55 A;  3UDF A;  4DF7 A;  5FJ8 G;  4FF3 A;  3RZD B;  4O42 A;  1H9J A;  2K52 A;  1U4M A;  1BBU A;  4UY8 C;  1N8R C;  4WRD A;  4FP5 D;  1J5E Q;  2NYZ D;  2PCF B;  1PMR A;  1LTA D;  3W1B A;  1SRU A;  2ZXO A;  3KJO A;  4P75 A;  5CR3 A;  1TWA B;  1MHW C;  3I70 A;  4A3J B;  2ATW A;  4KN4 C;  3HOX G;  1K3R A;  3OTO Q;  2I5L X;  5M3M H;  1EFI D;  4DR2 L;  4C3H G;  4X64 Q;  1O7L A;  3K80 C;  3T1H Q;  2WB1 B;  3FP9 A;  1HR0 W;  4BY7 G;  2EYJ A;  1EIG A;  2M2L A;  2E2H B;  2R93 G;  3GTQ B;  1F2M A;  1WCM G;  5IP7 G;  2MPM A;  3M85 A;  1GJX A;  3TRE A;  5G3L F;  1JMC A;  3K8A A;  4F7X A;  1E0B A;  3S1R B;  2G9D A;  4WJ4 A;  5JJZ A;  3MEF A;  4L63 B;  4CJ1 B;  2M00 A;  1V1P A;  2A1A A;  4B3S Q;  1U5K A;  4HIM A;  1KD1 C;  4N9T A;  1QWY A;  2HQL A;  1VQ9 A;  2K7V A;  5JJL A;  5C3E G;  3OIP A;  4J8Q A;  2WAQ E;  3LNN A;  4A3L G;  2B63 B;  4R4Q A;  2IX3 A;  5J22 A;  5LMN L;  2ICI A;  1X54 A;  1Y1V H;  3I56 A;  2Y0S G;  4FXK C;  4IUQ A;  5D3I B;  5IOC A;  2VB3 X;  2JA9 A;  1HUN A;  1CK1 A;  1BBW A;  3QO2 A;  3K58 A;  3PIO A;  1QCB D;  1HZ9 A;  3M3Y H;  1DON A;  2PMZ E;  4YHH L;  1L0X B;  2GVB A;  3GV6 A;  3HOV B;  2VUM G;  1ZEQ X;  3QB3 A;  2Q8R E;  4PV1 C;  2R7Z H;  1XJV A;  1HZB A;  1JJC B;  4HID A;  3J81 j;  4IO9 A;  3GTG H;  2NTS A;  4X6A H;  2VY3 A;  3BZD B;  4JBJ A;  1PZK D;  4RHR A;  1TY2 A;  4A3K B;  5ELD A;  1EEI D;  1TWC B;  4C2M B;  2BDO A;  1VF5 C;  2I0Q A;  3QG1 A;  3CCU A;  4K5W A;  5T1I A;  1PA6 A;  4X66 Q;  2HDM A;  3KBX A;  2UU9 Q;  4OO1 G;  2KCM A;  4QIW E;  1HZC A;  2RCF A;  3VR3 A;  2N8N A;  2WFW A;  1K8G A;  2KCC A;  1XNR Q;  2WAQ B;  4I7Z C;  3BJU A;  1CFM A;  5COY A;  4P72 A;  2UXD L;  4HJ9 A;  1U9R A;  1UE6 A;  4IN3 A;  3L2P A;  3A5Z B;  4A3F B;  4A93 G;  4KD3 A;  1H9R A;  1NJI C;  2KJX A;  3NQT A;  4JOI C;  4A3D H;  1JWS D;  1N34 L;  3S14 B;  2KEC A;  4CDC C;  4DUY L;  1F77 A;  2HD3 A;  3BZC A;  4RHS A;  1VQ4 A;  1WTH A;  3P7J A;  1X3Q A;  3I4N H;  3NEM A;  1L1O C;  3P1H A;  2XWJ B;  4LF8 Q;  3HOU H;  4GNX B;  4XT3 B;  3KLS X;  4HJ5 A;  1NBW A;  1PFB A;  4LWC A;  2FFK B;  2KQ3 A;  4XQJ A;  1SFO B;  3TZD A;  4X3K A;  4QIW B;  3DWA A;  3TP6 A;  3I4M H;  5M5W H;  4UHV A;  4X3U A;  2AKW B;  3HKS A;  1OXT A;  3H15 A;  4ZLT F;  5CMD A;  1JIC A;  4JI7 L;  2B2V C;  3K0X A;  2BE5 C;  2Q2T A;  4UP9 A;  4DAY B;  1UEA B;  4GKK L;  4J15 A;  1XYI A;  1QIL A;  5FK9 C;  4MN3 A;  5A2Q L;  4BBS H;  5BR8 L;  1VQB A;  2ZXR A;  5D14 A;  1K83 B;  3I90 A;  3N6R A;  1SYD A;  4CHT B;  2N3S A;  1D6E C;  2NB0 A;  3A8J E;  4IUU A;  5BN4 A;  3FPP A;  4OGQ C;  1MI2 A;  4KD4 A;  1MJC A;  4L5T A;  4DAV A;  1YJW A;  1QZG A;  5LMN Q;  2LSS A;  1ET6 A;  1Z9F A;  2KHS A;  4A3B G;  1KDA A;  2L55 A;  4C3J H;  1Y1W B;  1YBY A;  4IUP A;  3RMH A;  4DAP A;  4ID6 A;  3HOY B;  5IYB G;  1MSH A;  1TVX A;  1UE7 A;  4V0B A;  3HKZ G;  4AQY Q;  3F2B A;  2GN5 A;  3GTL H;  3NPP A;  3G48 A;  1HPC A;  4BY1 B;  4N8X 1;  1F9Q A;  2Z4I A;  3CQZ H;  3SR1 A;  1G2S A;  5CV6 A;  1KRS A;  5JEA H;  1I4R A;  3H0G B;  4BBR H;  1FVI A;  4HCE A;  4K5X A;  1VQG A;  4UAI A;  2K5Q A;  5M3F B;  1ASY A;  5FLM H;  1BKB A;  1KNA A;  5I2X A;  3TRZ A;  5J39 A;  2ZTE A;  2K14 A;  4UDU C;  4LW1 A;  4QJF A;  4K6L A;  4LFC L;  2B29 A;  1KL9 A;  1EOT A;  1A15 A;  3CRK C;  3QOJ A;  4K0K Q;  1EY0 A;  4C3I B;  1X32 A;  1IBK L;  1A2U A;  3QR8 A;  5GAH C;  1I4Q A;  3SEB A;  3GTJ H;  5IYD H;  2JA8 H;  2X6G A;  1CZW A;  4K8I A;  1TWH H;  2F0E A;  5ELF A;  1Q8K A;  1ICF B;  1N34 Q;  4DR4 Q;  2OCE A;  3T1Y Q;  2HQE A;  3SK6 A;  3CME A;  4GNX A;  1R4Q B;  4DUY Q;  1PTO B;  1A8V A;  1JWU D;  3H3V I;  1SJE D;  1VMP A;  1KAB A;  4C1N K;  4JI5 L;  4ABN A;  1W6J A;  3VR4 A;  3RZO H;  2F0I A;  1S40 A;  2Z6K A;  4FNF A;  4DR3 L;  1DJR D;  2ZT9 C;  1BQQ T;  4DV4 Q;  3NUC A;  2ZJQ A;  3C3L A;  1SAP A;  2F03 A;  1P16 A;  3DXJ C;  1ROD A;  3JAM i;  1D7Q A;  1Y1V G;  3W5O A;  2XNA C;  3PO2 G;  1LTB D;  1PYB A;  2DGY A;  1KXL A;  1VQL A;  1BCP D;  5EPL A;  5C6A A;  2SEB D;  4IOA A;  2OXP A;  4JI7 Q;  3RLN A;  4IFD I;  1OXV A;  4R8N A;  1LTG D;  3GTM B;  3RLF A;  3KF8 B;  1GUO A;  2EYL A;  5KNB A;  1H9S B;  4HJ7 A;  5FLX L;  4HMJ A;  3MTS A;  1HNX Q;  2EVB A;  3GO5 A;  4G7Z C;  1S5F D;  1EIF A;  4HIK A;  2TSS A;  4POG A;  3ULP A;  3OW7 A;  1NMG A;  1B7Y B;  1DOM A;  2PNR C;  5E4W C;  1SNQ A;  3PGZ A;  3J80 L;  1F2L A;  3V96 A;  1GOZ A;  1EQV A;  3HP3 A;  5COR A;  3TS0 A;  1I6H B;  2AUJ D;  2XN9 C;  4OX9 Q;  1SJH D;  1G91 A;  3SK4 A;  3FKI H;  3DM1 A;  4I7A A;  3D4R A;  3TME A;  5C4X B;  3HS0 C;  5EBC A;  2Q2U A;  1I3Q B;  4A3M H;  3F2D A;  2B2W C;  1RJT A;  1ZYR C;  1DCZ A;  3J7Z C;  4G7H C;  1FNW A;  4NXM L;  4A3D G;  1I50 B;  4DV0 L;  1N33 L;  3PO3 B;  1PRT B;  1LUZ A;  1AW7 A;  3DUZ A;  5G3L D;  5C4H A;  2F3I A;  1PH7 A;  5EPJ A;  5CC4 A;  1HUM A;  1HCZ A;  3UDX A;  5JPN C;  1LTI D;  4DK3 C;  2UUC L;  3HOU G;  3RN2 A;  1ILP A;  4CJ2 C;  2HHH L;  3T56 B;  4G57 A;  1Q8I A;  3DM3 A;  2IT1 A;  3I2Z A;  3A56 A;  5J1Z A;  3GDE A;  3M4P A;  1IBK Q;  4GKJ L;  5K36 H;  1KLU D;  1WJJ A;  4MTN A;  1XTD A;  3S24 A;  3NWS A;  1GO3 E;  1IYV A;  2HUG A;  1R9T H;  3FMC A;  5HGT A;  4XXE A;  4DAM A;  1LTT D;  3K5N A;  2L11 A;  2SDF A;  1HHV A;  4JC0 A;  3OWE B;  1S72 A;  2F0T A;  3EVQ A;  4YIJ A;  2E5L Q;  2LFN A;  3VYR A;  2DJG C;  3TDQ A;  4CKB A;  4L6T B;  4J1M A;  1VQK A;  4GN5 A;  2E2J H;  3ZYY X;  1DD2 A;  4DV7 Q;  3OWF A;  5KND A;  1ZKO A;  2L5T A;  3PCO B;  5EKI A;  3CD6 A;  4YWM A;  3S17 B;  4XDX A;  4C3J G;  4IFD H;  1KTK A;  4EQO A;  5H1S E;  3CCQ A;  4LAA A;  5FLX c;  2E2D C;  1Y69 U;  4LF6 L;  1XXG A;  3NP8 A;  1H9S A;  1QOH A;  5EPK A;  2UUB L;  4HTH A;  1AP0 A;  3ERQ A;  4EX5 A;  4RKB A;  5I2Y A;  1WTW A;  3BDO A;  3E9H A;  1SNC A;  4LF4 Q;  4CDE C;  1EQR A;  4K2L A;  5JEA G;  3J80 c;  4BBR G;  3A8K E;  2Y0S E;  4JW0 A;  3T51 B;  3C1E A;  4LMQ D;  1HTL D;  4UPA A;  3HOX B;  4A3C H;  2L4N A;  3CCS A;  5IY0 A;  4RCO A;  3F2U A;  1CT1 D;  4F87 A;  4NW2 A;  1G6P A;  1Z47 A;  1BR9 A;  4OXP A;  1A6X A;  2KCN A;  1E1O A;  1M4V A;  1GD7 A;  2OF1 A;  2EY6 A;  4BY7 B;  5C5L A;  2EYM A;  1A3T A;  1SEB D;  5IGB A;  1A3V A;  1H95 A;  2R93 B;  3M4O B;  1DGS A;  1GHK A;  2Z8L A;  2N88 A;  1A0I A;  2K4K A;  1WCM B;  4R4I A;  2EIF A;  5JEA J;  2FHT A;  2D0O A;  3NBH B;  3T16 A;  2B3G A;  4U68 A;  2AUK A;  5JAV A;  1HNZ L;  2K33 A;  3GTO H;  2N55 A;  2EJF C;  2JA8 G;  2K1B A;  1HQM C;  5CBE E;  1XMQ Q;  2OTJ A;  2IY5 B;  1X3G A;  1O78 A;  4HED A;  4GN4 B;  3MA2 B;  4A3E H;  2NN6 I;  3SHL A;  1LT3 D;  1SNP A;  4NXM Q;  3J80 i;  2QGQ A;  5EAY A;  4DV0 Q;  1N33 Q;  4OHJ A;  5C3E B;  1WD1 A;  1W6K A;  3RZD H;  1CI3 M;  4RAU C;  1RHP A;  3NTH A;  2O5J C;  4WOR A;  3I8Z A;  4TRD A;  2Y0S B;  3OMC A;  3D4D A;  2F52 A;  4LK1 C;  4PMB A;  3PIP 3;  3I91 A;  5GAE C;  3PUW A;  2HT1 A;  2BA1 A;  5IGF A;  2HHH Q;  2JYO A;  4IPD A;  5CGK A;  2JN4 A;  3VR6 A;  1HR0 L;  1EZ6 A;  4APV A;  2H5X A;  2X6L A;  5C44 H;  1LTS D;  1VQ6 A;  3M4Q A;  2VUM B;  4GKJ Q;  3V2T A;  3L3O C;  5LHY 1;  3HRZ C;  1M90 C;  4IUT A;  3IFD A;  2PI2 E;  2XRS D;  3LGJ A;  4PNY A;  2K03 A;  3C1F A;  5ISR A;  4H44 C;  1VQE A;  2E2H H;  1J8I A;  1TXY A;  1EYG A;  3GTQ H;  1GVP A;  5C4J H;  4QUC A;  5T1G A;  1PZJ D;  3U9S A;  1TS4 A;  1YJN A;  1CTM A;  3K5O A;  5EKK A;  4AYB E;  1O7I A;  2BCO A;  3S1R H;  1FJG L;  3AEV A;  4E6I A;  4TVA B;  3MWY W;  2NVT H;  1QNU A;  2HCI A;  4JBK A;  4AH6 A;  4ME3 A;  3SDZ A;  3GTK B;  2F0D A;  5FO9 B;  3IKJ A;  4CGY B;  5K5P A;  2AHO B;  1SYB A;  5IYC G;  1JE4 A;  2A6H D;  2AQ1 B;  2G5D A;  2HCC A;  2AWO A;  4ME5 A;  2BH8 A;  4A93 B;  4DV3 L;  2Q2H A;  1DM0 B;  1S5E D;  1FD7 D;  2NWG A;  3RR5 A;  3HOW G;  3S1M H;  3PUY A;  5E3F A;  1X9N A;  2PZW A;  3O13 A;  2WAC A;  3BDL A;  2RHQ B;  3FKI G;  1IBM L;  3KJP A;  3H6M A;  1VQC A;  4EVO A;  3HOV H;  4GOP C;  2A5H A;  4A3M G;  1PH2 A;  4JV5 L;  3SVM A;  1OO9 B;  4ZAI A;  1Q46 A;  4DKA C;  4RGT A;  3J7A 5;  5AFW A;  3PV0 A;  1YIJ A;  3HKZ E;  1IBL L;  2SOB A;  5HUR A;  4KTA A;  3K0Y A;  3NBH A;  2QDL A;  4K2K A;  3DEP A;  1PH3 A;  4IOC A;  1TR5 A;  2RSN A;  3AFP A;  1LV9 A;  5L37 A;  3PF5 A;  1PH4 A;  2Q8T A;  1CHQ D;  1PTO F;  3S2H B;  1ONL A;  1JWM D;  1VQP A;  1EQQ A;  1JOK A;  4IUN A;  4DXG A;  5IWA L;  4NB3 A;  5C0X I;  3NQI A;  5M5X B;  5K36 G;  3MXP A;  4OIK A;  1W2B A;  1EWC A;  2NN6 H;  4QCL A;  3S2D B;  1F2Z A;  2KOL A;  4BXX H;  2VQF L;  2RKS A;  4EQP A;  1K73 C;  1LAC A;  2BE5 D;  3F1Z A;  4JVZ A;  5JVG 3;  3LWE A;  4YCV A;  3S16 H;  5JJK A;  1FR3 A;  1GXD C;  1UE5 A;  2A19 A;  1H9M A;  3G7L A;  4DV5 L;  3S14 H;  1D5M C;  1E1T A;  2OQ0 A;  3TS2 A;  3T53 B;  1UUP A;  4OWX B;  1C8C A;  4A3B B;  1N9W A;  2K5V A;  3IFT A;  5FOB B;  1BF4 A;  2AQ3 B;  1B3Q A;  1HR0 Q;  3HKZ B;  2BDN A;  2OTL A;  3J81 L;  1KIX A;  1MBY A;  4X62 L;  3UDG A;  1SE3 A;  2EYH A;  3SGI A;  1CSQ A;  2PPB C;  3AB9 A;  1LT5 D;  4JI3 Q;  1JB3 A;  4IFD G;  2CW0 D;  3BYY B;  4FXG C;  5C4Z A;  1CA6 A;  1I94 L;  4Q0F A;  3A7L A;  4HCS A;  1XPO A;  2L0C A;  1XNQ L;  4NMZ A;  1HFN A;  2B2V A;  2VS1 A;  4XQQ A;  2K28 A;  1CM9 A;  3VR2 A;  4LF5 L;  2A6H C;  3H3V C;  4B3R L;  3BG3 A;  4X3S A;  2MGS A;  4A3C G;  3J7A V;  1X3P A;  4IFD J;  1NCV A;  1C48 A;  1MD2 D;  4QB4 A;  1W3S A;  1M1K C;  1K83 H;  2F0G A;  3AMU A;  2FMC A;  3URY A;  2AWN A;  1BNZ A;  5C3X A;  5CV5 A;  2I46 A;  2B8G A;  1DOK A;  4DK6 C;  1Q86 C;  2PI2 A;  1C4Q A;  1B53 A;  2I5M X;  4IJL A;  1FNU A;  1JOR A;  1FYC A;  1ML0 D;  2PMZ B;  3CCL A;  4DXF A;  4G7O C;  4A3G H;  2NUC A;  1B2T A;  2K75 A;  3ZJY C;  3JAM L;  1GUS A;  1K28 A;  3HOY H;  5M9O A;  1QE6 A;  2WKC A;  1IBM Q;  1K0S A;  2WP8 J;  2RDH A;  1X56 A;  2R92 H;  4DUZ L;  2N78 A;  5LL6 S;  1DYQ A;  1OXU A;  4JV5 Q;  4A3E G;  1F9S A;  1X65 A;  2PQA B;  3BU2 A;  3H0G H;  1S5B D;  2QW7 A;  1Y8N B;  1E3P A;  1SBB B;  1YNX A;  4DR2 Q;  1BDO A;  5EKL A;  2YTX A;  4H7B A;  1Y1V B;  3PO2 B;  4AYB G;  4NP5 A;  4KLK A;  4YWL A;  3M3Y B;  1YIT A;  2YU9 H;  1L2F A;  1TS2 A;  4DV1 L;  5C44 G;  3DHQ A;  5IT9 L;  3TP5 A;  2Z1C A;  5IWA Q;  2EQS A;  2IX0 A;  4L5R C;  1EY9 A;  1E22 A;  1IZ6 A;  1IYJ B;  3D3R A;  3ONA B;  1BBX C;  2NVQ B;  5KYI A;  1EUJ A;  4XT1 B;  1YHA A;  2ZJP A;  2VQF Q;  3E0J A;  2F1M A;  3HFZ B;  1HNW L;  3NSW A;  3J81 c;  1TY0 A;  1ENA A;  1G2T A;  3CCR A;  4DV5 Q;  3DWQ A;  3MXU A;  2A6E C;  3R93 A;  5DM6 3;  1NSN S;  4ALP A;  1PTO H;  4HJ8 A;  4P2C B;  2CW0 C;  3I7F A;  2RHS B;  2RQX A;  3AFQ A;  3G71 A;  4IZ8 A;  4X62 Q;  1O7Y A;  4YHH Q;  4JI4 L;  1TWG B;  1EWH A;  5JVH 3;  2AMC B;  3GTP H;  1KC8 C;  2KCT A;  1UEB A;  3R2I A;  1STB A;  1Q12 A;  2B2T C;  2JA7 H;  1K8O A;  4JCV E;  2ZJR A;  4KHP L;  4A3D B;  2MP1 A;  4JPB W;  1I94 Q;  1BCP B;  1WTQ A;  3CF5 A;  4RGO S;  5JPM C;  3J81 i;  1B3A A;  1C0A A;  1B9M A;  1ZYR D;  3VR5 A;  1LTR D;  2UXB L;  4GN3 B;  2VZA A;  4B3T L;  2IX1 A;  1EY6 A;  3HOU B;  4B3R Q;  2B2Y A;  3NXW A;  1X3E A;  2JE6 I;  5TSS A;  1WTR A;  2JQO A;  1JT8 A;  1UWV A;  1VF7 A;  4NXN L;  4XYQ A;  3JAM c;  5I9P A;  2QCP X;  1N36 L;  4PMC A;  5M3M G;  2UXD Q;  2KHJ A;  1SLJ A;  4DR5 L;  1PHJ A;  5M5W B;  3PIP A;  2F4V L;  1M8A A;  1OXX K;  2R7F A;  4BS9 A;  2LY7 A;  4IPG A;  1JR0 D;  2F3W A;  3PUV A;  1TWF H;  5ELB A;  3KBG A;  4HJA A;  2PQA A;  4CJ0 B;  3D31 A;  3RD4 A;  2O4X A;  1I6H H;  4DUZ Q;  2NN6 G;  3EN2 A;  4L5Q A;  2I07 B;  2A68 D;  1Q1E A;  4KJN A;  4O2D A;  4BXX G;  1JCK B;  3L9A X;  3RNU A;  3J7A F;  4KMU C;  4ULL A;  3ULL A;  4O1N A;  1I3Q H;  1PDQ A;  3UE0 A;  3WWV A;  5IT9 c;  1XWE A;  2DY8 A;  3AQQ A;  3C46 A;  1DXM A;  1P8L A;  4FDB A;  4DAY A;  4DR1 L;  4C3J B;  1NR2 A;  4OIJ A;  3S1N H;  2SNM A;  2MFI A;  3MAQ A;  3CCJ A;  1SNO A;  5KNC A;  4DV1 Q;  1MSG A;  3GTL B;  3STB D;  4IUR A;  4Q5V A;  4GKK Q;  2E76 C;  1B4O A;  3CQZ B;  2R7Z G;  1B8A A;  2QIL A;  3ND8 A;  2XVS A;  4BBR B;  5BR8 Q;  1RDP D;  5EBD A;  2F0Q A;  3OIQ A;  3EIV A;  5CV8 A;  1L0Y B;  3RUZ A;  1A2T A;  1EYA A;  2MO1 A;  3E5S A;  1KDB A;  5EGT A;  1KQS A;  4JI0 L;  1YJ9 A;  3LWU A;  1PH5 A;  3TN2 A;  1GUW A;  5EJW A;  3A74 A;  2JJQ A;  3PQI A;  4X65 L;  2RCN A;  4RFB A;  4B9W A;  3ERO A;  1PH1 A; 
#chains in the Genus database with same CATH homology
 1BVS A;  1VQI A;  1PH8 A;  4LUO A;  2VNU D;  4WJ4 A;  2B3G A;  1LYL A;  3MEF A;  1HNZ L;  1HNX L;  1V43 A;  3U4Z A;  3GTO H;  2JA8 G;  3L7Z C;  2A1A A;  4B3S Q;  1U5K A;  1XMQ Q;  4HIM A;  2OTJ A;  2IY5 B;  2XGT A;  1KD1 C;  1X3G A;  2HQL A;  4GN4 B;  4A3E H;  4NXM Q;  2NN6 I;  4AIM A;  1VQ9 A;  1CKO A;  3KFU A;  3J80 i;  2QGQ A;  4KHZ A;  4KHP Q;  5JJL A;  5EAY A;  5C3E G;  3CPF A;  4DV0 Q;  1N33 Q;  2B63 G;  3ER0 A;  3S15 H;  3S17 H;  2WAQ E;  1CKM A;  4MNO A;  1NMF A;  4A3G G;  4LUV A;  4A3L G;  3W1G A;  2JA5 H;  4R4Q A;  1IL2 A;  3RZD H;  5LMN L;  4R4T A;  2DUD A;  5FJ8 H;  1PYS B;  1X54 A;  1Y1V H;  3RLO A;  1Q82 C;  3CXC A;  1XNQ Q;  3I56 A;  2Y0S G;  2R92 G;  2JA9 A;  2F52 A;  2PNH A;  4LFC Q;  2JA6 H;  3NEL A;  1OXS C;  1BBW A;  5GAE C;  4DV6 L;  3PUW A;  3PIO A;  1HZ9 A;  4B3T Q;  2HT1 A;  3I4N G;  2BA1 A;  2HHH Q;  2PMZ E;  3GTM H;  3HOV G;  4LF5 Q;  4IPD A;  1YZ6 A;  4YHH L;  2Z6K C;  4OX9 L;  2ZTD A;  2GVB A;  3EBE A;  1HR0 L;  2VUM G;  3KF6 A;  4APV A;  2H5X A;  1C9O A;  3GD7 A;  5C44 H;  1V1Q A;  1VQ6 A;  3M4Q A;  1K9M C;  4NXN Q;  4GKJ Q;  2R7Z H;  3D0F A;  1XJV A;  1HZB A;  1JJC B;  4HID A;  3J81 j;  4IO9 A;  1N36 Q;  3GTG H;  1M90 C;  2OQK A;  4X6A H;  1VQD A;  2VY3 A;  3HOX H;  3U4V A;  4A3K G;  2PI2 E;  4JBJ A;  1A62 A;  2F4V Q;  3LGJ A;  3M9B A;  2VL6 A;  3I4M G;  4JI2 L;  2E8G A;  1LTL A;  2ES2 A;  2BH2 A;  3CC4 A;  1NE3 A;  1WFQ A;  2I0Q A;  3CCU A;  1KHI A;  1VQE A;  2E2H H;  1TXY A;  1EYG A;  3H3V H;  3GTQ H;  1GVP A;  4PZ7 A;  5C4J H;  3M4O H;  4JI6 Q;  1PA6 A;  2CQO A;  4LFB L;  4X66 Q;  2CWP A;  1YJN A;  2UU9 Q;  4OO1 G;  2KCM A;  4QIW E;  1HZC A;  3OYY A;  4MZ9 A;  4R4O A;  3HOZ H;  4BBS G;  2N8N A;  4AYB E;  1QUQ B;  1O7I A;  2WAQ G;  2WFW A;  1K8G A;  3S1R H;  3ICE A;  4JI5 Q;  1J6Q A;  1FJG L;  2QA4 A;  1CSP A;  1CKN A;  1XNR Q;  3AEV A;  4TVA B;  3CCM A;  3BJU A;  3E9I A;  4JI1 L;  1B70 B;  1VQJ A;  2NVT H;  4P72 A;  4JBK A;  4AH6 A;  2UXD L;  2JEB I;  4ME3 A;  5J3B A;  4DR3 Q;  4YY3 Q;  1UE6 A;  4HJ9 A;  3S1Q H;  4A3F G;  2AHO B;  1Y14 B;  5C4X H;  3E0E A;  5GQO A;  5IYC G;  3A5Z B;  3L2P A;  1YVC A;  4JBW A;  4RG1 A;  4A93 G;  3STB C;  2AWO A;  1NJI C;  2BH8 A;  5C3E H;  4DR1 Q;  4Y7N H;  4JOI C;  4P73 A;  1X6O A;  3KDF A;  1G29 1;  1I50 H;  2FXQ A;  2Q2H A;  4EQ5 A;  2VQE L;  4DV3 L;  1N34 L;  3PO3 H;  3PUX A;  2E5L L;  3RR5 A;  3HOW G;  4DUY L;  3S1M H;  3PUY A;  1EWI A;  1K0R A;  5HGQ A;  3BZC A;  1VQ4 A;  1X9N A;  1D8L A;  2RHQ B;  3FKI G;  1Q7Y C;  5JJI A;  1HZA A;  5GRO A;  3KJP A;  1IBM L;  1JE5 A;  3I4N H;  1VQC A;  3NEM A;  4UP8 A;  1L1O C;  3HOV H;  4GOP C;  4A3M G;  4LF8 Q;  3CC7 A;  4GNX B;  1PH2 A;  3HOU H;  4HJ5 A;  1NBW A;  4DV7 L;  4B3M L;  4JV5 L;  4LWC A;  1WYD A;  2JA7 G;  5ELO A;  1Q46 A;  2KHI A;  4DKA C;  2UXC L;  3J7A 5;  3PV0 A;  1C7Y A;  1YIJ A;  3HKZ E;  1IBL L;  1QZH A;  5FLM G;  1ASZ A;  5IE8 A;  4YWK A;  1HNW Q;  1VS0 A;  4KI0 A;  1G51 A;  1VQ7 A;  3I4M H;  5M5W H;  1XMO L;  4JI0 Q;  2AKW B;  4A3I H;  1PH3 A;  3AYH B;  1OXT A;  3HKS A;  3H15 A;  4IOC A;  1YI2 A;  3AFP A;  4DR6 L;  4JI7 L;  3A5U A;  2Z0S A;  1XPU A;  2ZTC A;  1KAW A;  3K0X A;  4R4C A;  3PF5 A;  2XTI A;  1PH4 A;  2Q2T A;  4LF4 L;  4UP9 A;  4DAY B;  2ZM6 Q;  1VQP A;  4J15 A;  1EQQ A;  4GKK L;  3BZK A;  2NVY H;  4A4I A;  3M7N A;  5IWA L;  4DR7 L;  4NB3 A;  3UE1 A;  5C0X I;  5K36 G;  3L0O A;  1N32 L;  4BBS H;  5BR8 L;  1VQB A;  2NZH A;  1SR3 A;  5ELN A;  4DV2 L;  4YCW A;  1W2B A;  4XTC S;  1OTC A;  4JI4 Q;  4OO1 I;  5IYD G;  3PUZ A;  2N3S A;  4BXX H;  2VQF L;  1SRO A;  1K73 C;  1VQ5 A;  3F1Z A;  1PH9 A;  1PVO A;  4WJ3 M;  5IYC H;  1I5F A;  1VQH A;  4RMF A;  2CFM A;  4YCV A;  4XIG S;  3S16 H;  1MJC A;  4L5T A;  1Q1B A;  1YJW A;  1QZG A;  5JJK A;  1EFW A;  1UE5 A;  2A19 A;  5GAD C;  5LMN Q;  2LSS A;  3FHW A;  4GNX C;  1Z9F A;  4DV5 L;  3S14 H;  1Y1W G;  4A3B G;  3F2C A;  1E1T A;  2OQ0 A;  4C3J H;  5IP9 G;  2N49 A;  1PH6 A;  3HOY G;  3TS2 A;  1YBY A;  4NPS A;  4OWX B;  1N9W A;  2K5V A;  3F8T A;  5IYB G;  3VDY A;  3HOW H;  1UE7 A;  4JI8 L;  3HKZ G;  2UUC Q;  3K7U C;  3MXN B;  4AQY Q;  3F2B A;  2GN5 A;  2UXB Q;  3CC2 A;  1HR0 Q;  2OTL A;  2CWA A;  1KIX A;  4BY1 G;  3GTL H;  1CUK A;  4X62 L;  3G48 A;  3UDG A;  3SGI A;  1XMQ L;  4JBM A;  1CSQ A;  3CQZ H;  2R6G A;  3H0G G;  4GLX A;  1TWA H;  1KRS A;  4JI3 Q;  4A3J H;  4BBR H;  1FVI A;  4LFA L;  4IFD G;  1RIP A;  2V1C C;  4JI2 Q;  5GAG C;  5M3F G;  1VQG A;  4DR5 Q;  4UP7 A;  4OWT B;  4GLA C;  1ASY A;  5FLM H;  1I94 L;  3M3Y H;  1BKB A;  4YCU A;  3NEN A;  3TRZ A;  5AJ3 L;  1L1O B;  1AE3 A;  1QUQ A;  2K14 A;  2ZTE A;  3IRB A;  4C3H H;  1MKH A;  4GOP B;  1XPO A;  4L5S A;  1XNQ L;  4LW1 A;  4BY7 H;  4QJF A;  4LFB Q;  4GLV B;  5C0X G;  4LFC L;  2MNA A;  2VS1 A;  2B29 A;  1KL9 A;  4IPC A;  1WOC A;  2QEX A;  2R93 H;  1HJP A;  4LF5 L;  2D0P A;  5E7N A;  1HH2 P;  4POF A;  2EXD A;  1WCM H;  5IP7 H;  1VQF A;  3UDI A;  3CP0 A;  4B3R L;  4K0K Q;  4A3C G;  4JI1 Q;  3A0J A;  4IFD J;  1JJ2 A;  1M1K C;  1W3S A;  1IBK L;  3S2D H;  1K83 H;  5GAH C;  2AWN A;  3GTJ H;  5IYD H;  3I4O A;  2JA8 H;  4OON A;  5DLQ E;  1VQ8 A;  2RF4 A;  4DK6 C;  4IPH A;  1Q86 C;  1TWH H;  2PI2 A;  1Q8K A;  2I5M X;  1N34 Q;  4IJL A;  4DR4 Q;  2K5H A;  5C0X J;  2OCE A;  2VQE Q;  3T1Y Q;  3CW2 C;  3CME A;  4GNX A;  3CCL A;  1WI5 A;  4LF6 Q;  2B63 H;  4A3G H;  4DUY Q;  2K75 A;  4X66 L;  3ZJY C;  2UUB Q;  1A8V A;  1QVF A;  3H3V I;  1PV4 A;  4A3L H;  3HOY H;  2JK8 A;  5HY6 A;  4P71 A;  1IBM Q;  5IYB H;  2WP8 J;  1X56 A;  1VQN A;  2NVX H;  2R92 H;  4JI5 L;  4DUZ L;  4LF9 L;  1XNR L;  2N78 A;  3Q8D A;  1OXU A;  4DNI A;  1QVG A;  4B3M Q;  3RZO H;  1XPR A;  4JV5 Q;  2LXK A;  2Z6K A;  4A3E G;  1S40 A;  4DR3 L;  1X65 A;  2PQA B;  2L15 A;  4LF7 L;  1QVC A;  3BU2 A;  2VUM H;  2UXC Q;  3H0G H;  4DV4 Q;  2ZJQ A;  2YV5 A;  2JA5 G;  1E3P A;  1P16 A;  1YNX A;  3JAM i;  4DR2 Q;  1Y1V G;  3W5O A;  3CCE A;  4OWW B;  1D7Q A;  1MJE A;  1XMO Q;  2YTX A;  2C35 B;  1PYB A;  4A3K H;  2DGY A;  2UUA L;  1E7Z A;  3PO2 G;  1KXL A;  4QL5 A;  4A75 A;  1VQL A;  3KYH C;  2YTY A;  4AYB G;  1TWC H;  4C2M H;  2MQH A;  2JA6 G;  4DR6 Q;  4KLK A;  4JI7 Q;  4IOA A;  3RLN A;  4IFD I;  3I55 A;  1OXV A;  2YYZ A;  4Y52 H;  1Q81 C;  4YWL A;  1J5E L;  2IHF A;  1YIT A;  2YU9 H;  3RLF A;  1L2F A;  4JYA L;  3KF8 B;  4DV1 L;  5C44 G;  4PZ6 A;  4X65 Q;  3TQY A;  5LMU L;  5IWA Q;  2EQS A;  2IX0 A;  4L5R C;  4LF8 L;  4DR7 Q;  1E22 A;  1N32 Q;  1IZ6 A;  1IYJ B;  4DV2 Q;  4HJ7 A;  1YHB A;  1YEZ A;  2IHE A;  1UE1 A;  1HNZ Q;  1HNX Q;  1EUJ A;  1E24 A;  3GO5 A;  3KLW A;  1YHA A;  2ZJP A;  1MIU A;  2VQF Q;  1EIF A;  4HIK A;  1SN8 A;  3HFZ B;  4POG A;  3ULP A;  3OTO L;  3GTK H;  1NMG A;  3DLL A;  1HNW L;  1B7Y B;  4X64 L;  1V9P A;  3J81 c;  1X55 A;  3T1H L;  4A3F H;  3CCR A;  3CCV A;  4DV5 Q;  4R1J A;  3PGZ A;  4A93 H;  1GKH A;  1FL0 A;  1NY4 A;  4JOI A;  4ALP A;  3HOZ G;  1GM5 A;  4H02 A;  1AH9 A;  4HJ8 A;  1VQM A;  2ALY B;  4JI8 Q;  3ULJ A;  3TS0 A;  4QY7 A;  3I7F A;  4DV6 Q;  2RHS B;  2VW9 A;  4A76 A;  3AFQ A;  3G71 A;  3RN5 A;  4X62 Q;  4OX9 Q;  4A3D H;  4YHH Q;  4JI4 L;  4BA2 I;  2R7D A;  4QGU A;  1X3F A;  3FKI H;  5C4X G;  3U58 A;  2AMC B;  3GTP H;  1L1O A;  4GOP A;  2Q2U A;  4B3S L;  1KC8 C;  4A3M H;  2KCT A;  3F2D A;  4LFA Q;  1RL2 A;  1AE2 A;  1UEB A;  3J7Z C;  1Q12 A;  3JC6 6;  4GS3 A;  4NXM L;  4A3D G;  2JA7 H;  3PO3 G;  1IXR A;  4JCV E;  3K81 C;  2ZJR A;  4KHP L;  1SFO H;  1I94 Q;  4DV0 L;  1N33 L;  4PZ8 A;  1A63 A;  1LUZ A;  3U50 C;  5AJ3 Q;  3PO2 H;  1U0L A;  3CF5 A;  2D62 A;  2F3I A;  1PH7 A;  1S3O A;  4TQU S;  3UDX A;  4QQB X;  3J81 i;  4DK3 C;  1C0A A;  2UUC L;  3HOU G;  1YHQ A;  4AQY L;  3RN2 A;  4O0A A;  4GN3 B;  2UXB L;  2VZA A;  4B3T L;  2IX1 A;  1NTG A;  3S2H H;  2HHH L;  4B3R Q;  1EIY B;  2GVA A;  1X3E A;  2JE6 I;  3CAM A;  2IT1 A;  3DM3 A;  3I2Z A;  3GDE A;  3M4P A;  1FJG Q;  1VCI A;  2NVQ H;  2JQO A;  2Q2I A;  4JI3 L;  1UWV A;  5M5X H;  1IBK Q;  4NXN L;  4GKJ L;  1JT8 A;  3JAM c;  2OWO A;  2JEA I;  1N36 L;  5M3M G;  2UXD Q;  1WJJ A;  4MTN A;  4P74 A;  1XTD A;  2MO0 A;  4LNQ A;  3S24 A;  2KHJ A;  1SLJ A;  4DR5 L;  1PFS A;  4A3I G;  1PHJ A;  1GO3 E;  3PIP A;  1R9T H;  2F4V L;  2R7F A;  1OXX K;  1SMX A;  4DAM A;  3KF6 B;  1T9H A;  4PG3 A;  4IPG A;  4JC0 A;  1S72 A;  2A8V A;  4DV3 Q;  3PUV A;  1TWF H;  4HJA A;  2KBN A;  2ID0 A;  2E5L Q;  2PQA A;  1EOV A;  4JI6 L;  3D31 A;  2WB1 E;  2HIV A;  1Y1W H;  4A3B H;  2UU9 L;  5M5Y H;  2CCZ A;  5IP9 H;  1VQK A;  1I6H H;  4DUZ Q;  4LF9 Q;  2NN6 G;  3EN2 A;  4K0K L;  4L5Q A;  3CMA A;  1Q1E A;  4O2D A;  3K7A H;  4BXX G;  2NZO A;  4GN5 A;  1TWG H;  2E2J H;  3RNU A;  3G4S A;  2ASB A;  1VQA A;  4LF7 Q;  3ULL A;  4DV7 Q;  4BY1 H;  2LXJ A;  1I3Q H;  1JB7 A;  4YY3 L;  3UE0 A;  1K8A C;  4LUZ A;  3WWV A;  1SE8 A;  3PCO B;  5IT9 c;  2E2I H;  3CD6 A;  4IJH A;  3TEH B;  4JG2 A;  2YTV A;  4YWM A;  4HIO A;  1LM0 A;  2BA0 A;  3AQQ A;  1FGU A;  1IBL Q;  2UUA Q;  4PMW A;  1P8L A;  4DR4 L;  1CKN B;  4FDB A;  3UDF A;  5H1S E;  5FJ8 G;  3T1Y L;  3CCQ A;  5FLX c;  4DR1 L;  2K52 A;  5M3F H;  4LF6 L;  1JJG A;  3S1N H;  2UUB L;  2MFI A;  1BBU A;  4UY8 C;  1N8R C;  2CKZ B;  1J5E Q;  3CCJ A;  3OW2 A;  4EX5 A;  2K5N A;  1L0W A;  4JYA Q;  4DPG A;  4DV1 Q;  3K8A A;  3E9H A;  3KOJ A;  5LMU Q;  4LF4 Q;  3STB D;  2I5H A;  3W1B A;  1SRU A;  4GKK Q;  3KJO A;  1EQR A;  3KDF B;  2HIX A;  5JEA G;  4A3J G;  3J80 c;  4BBR G;  2R7Z G;  4P75 A;  1B8A A;  3PSI A;  5LMN W;  2ATW A;  5BR8 Q;  3HOX G;  2Y0S E;  4UPA A;  4DV4 L;  1K3R A;  4C3I H;  4A3C H;  1VQO A;  3OTO Q;  2I5L X;  3EIV A;  5IY0 A;  3CCS A;  5M3M H;  2WB1 G;  4DR2 L;  4X64 Q;  3K80 C;  3T1H Q;  1G6P A;  1Z47 A;  2K50 A;  2MO1 A;  3FP9 A;  4OXP A;  1HR0 W;  4BY7 G;  1KQS A;  1E1O A;  1GD7 A;  3PF4 A;  4JI0 L;  3CPW A;  1YJ9 A;  2R93 G;  1PH5 A;  1H95 A;  1DGS A;  1WCM G;  3A74 A;  5IP7 G;  2JJQ A;  3G6E A;  1A0I A;  3B6Y A;  2KEN A;  3TRE A;  2K4K A;  4X65 L;  3M85 A;  4R4I A;  2EIF A;  2RCN A;  5JEA J;  4BA1 I;  2ZM6 L;  1JMC A;  3ERS X;  2D0O A;  1KRT A;  1PH1 A;  3NBH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...