1EUJA

A novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE 2
publication title A novel anti-tumor cytokine contains an RNA binding motif present in aminoacyl-tRNA synthetases.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 37
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eujA00
3PIPA 2CFMA 1N34Q 4DR2L 3HOYG 3UDFA 2RHSB 1V43A 1QVCA 3HOXH 4PMWA 4DV6Q 3S15H 4TQUS 4JI5L 4X6AH 1X3EA 4JI4L 1VQ7A 2JA7G 1FJGL 4LUOA 1D7QA 4PZ6A 4A3JG 3M3YH 2VQFQ 4LF5L 1I6HH 3CF5A 4LFCL 2E5LQ 5IP9G 1W2BA 4IFDJ 3UE1A 4EQ5A 2D62A 4DV0L 2MO1A 1ASYA 4HJ7A 3J81i 3GDEA 3PO3H 4LUVA 4IFDI 5LMNL 2K52A 1YJNA 1JB7A 2K75A 1KRSA 2JA6G 4JI8Q 1Q82C 3K8AA 1SLJA 1RL2A 4BBSH 2CQOA 4R4OA 3CC7A 2JJQA 3W1GA 4A4IA 1E1TA 1NJIC 4L5RC 1IBKQ 1X65A 2HHHQ 3HOZG 1VQAA 2ZTDA 3PO2H 4YHHL 4R1JA 1IYJB 4OX9L 2Y0SE 3RLNA 4X66L 3DLLA 1YNXA 4HJ9A 1PHJA 1AE2A 4YWKA 2ZJRA 4LF8Q 3J7ZC 5FLXc 2D0OA 5E7NA 1K3RA 1J6QA 2VQEQ 4DUYQ 2K5NA 3I4NH 3A5UA 1A62A 1YJ9A 1CKOA 2WP8J 4LUZA 4DR1L 3T1HQ 3CQZH 2OWOA 2R92H 4GNXC 3E9HA 1EWIA 3I4MH 1KRTA 4BY1G 1X56A 1XPRA 5ELOA 3TQYA 1PH8A 2UXCQ 4B3RQ 3PIOA 3F2DA 3A74A 3CXCA 3PSIA 1JJCB 2AMCB 2JE6I 4HIDA 3RZOH 1AE3A 1S40A 4LWCA 3PUXA 4XTCS 3UE0A 2ZM6L 1VQEA 1VQ9A 2JEAI 3M4OH 4UP7A 4DV7Q 4A3GG 4A3DG 1N34L 1CKMA 1JJGA 3CC2A 2MQHA 4DV6L 4HIKA 1KD1C 2A8VA 2I5HA 2I5LX 2CCZA 5J3BA 4JI3Q 2QEXA 2HQLA 1B7YB 1NTGA 5M5WH 1U5KA 3U58A 1GM5A 4NXNQ 4JOIA 2R93H 3D0FA 2YV5A 4A3KH 4XIGS 3GTQH 5C0XG 3OW2A 2N8NA 1Q81C 1XNQL 3TS0A 2R7FA 2VQFL 1YZ6A 5AJ3Q 1VQOA 2JA7H 4LF4Q 4DV2L 1MJEA 1LUZA 2JA8G 4JI7Q 4OWWB 3WWVA 4AIMA 1JE5A 1J5EQ 1YIJA 2IHFA 3TEHB 3S1MH 1EQRA 5IP9H 4JV5Q 2VS1A 3D31A 3RR5A 4DR2Q 4C3JH 1Y1VH 1VS0A 2WAQG 1VQDA 4JI8L 2NN6G 1BBWA 4R4TA 3ULPA 1VQNA 3H3VI 1UE5A 5H1SE 3CAMA 3L7ZC 1KL9A 1LYLA 1N32L 3J81c 4IOCA 2R7ZG 4DV1Q 3E9IA 1LM0A 5IYDH 2KHIA 4A76A 4BXXG 5M5YH 4JCVE 2UUBQ 3KYHC 1XTDA 5IYCG 3U4ZA 3MEFA 1PYSB 4AQYL 4A3FH 1O7IA 4KI0A 2I0QA 2VUMH 1E24A 2N49A 1Q46A 2YTXA 4GN5A 1PH4A 2K5HA 4OXPA 2VQEL 4DUYL 1SROA 3BZKA 5C44G 4DR7Q 1OXXK 3T1HL 4KLKA 3KF6B 1I94L 4QIWE 2EXDA 4GOPB 1VQKA 2VNUD 2I5MX 4NXMQ 1TWCH 2ATWA 2UXCL 3S17H 4B3RL 1TWFH 5IYBH 4IJHA 1UEBA 3CCLA 3B6YA 4AH6A 2PNHA 2BH8A 4GLVB 4GN4B 4JG2A 2LSSA 2PMZE 2QGQA 3F2BA 1VQLA 4OO1G 1BKBA 3EN2A 4DV7L 1VQJA 3G4SA 1N8RC 2OTLA 4HJ8A 2BH2A 4OX9Q 4A3GH 2KENA 3BU2A 2VL6A 1B8AA 2MFIA 2E2JH 4BY7G 4A3DH 3KLWA 4JI3L 2XTIA 3LGJA 4DV3Q 2YTVA 3ULJA 2UUAQ 4NXNL 4GLAC 4IPCA 3RLOA 1N33Q 1TWHH 1OXUA 4LFAQ 1YITA 2IT1A 2V1CC 4ME3A 5AJ3L 1WCMH 2XGTA 3A5ZB 4C3HH 3PF4A 3AFQA 1K9MC 4JI7L 4BA1I 5LMNW 3NBHB 4JV5L 2K5VA 2JA8H 2N78A 4JI0Q 3CD6A 1WOCA 3E0EA 2Q2UA 1SRUA 4B3TL 4A93G 1G291 1YVCA 1YHAA 1VQIA 1JT8A 4DAMA 3CW2C 2WAQE 2JEBI 1CUKA 5IWAQ 4L5SA 1S3OA 3RN5A 3KF6A 2L15A 4JI1Q 4GOPA 4B3SQ 3S1QH 2E2IH 2HIVA 1BBUA 4DV1L 1XNQQ 5M3FG 1HZCA 2ID0A 4UP8A 3SGIA 5C3EH 4DV2Q 2UUBL 4JBKA 3ZJYC 4OWTB 1L0WA 1PH9A 2K4KA 1QZHA 4NB3A 4WJ3M 5IYCH 1PH6A 3K0XA 3W5OA 3Q8DA 4RG1A 4DR7L 1R9TH 4IFDG 3UDXA 3CC4A 2K14A 3U4VA 4L5TA 4A3MG 1XPOA 4X65Q 1SE8A 2BA1A 1VQPA 5C44H 4NXML 1Z9FA 4IPHA 1N32Q 3CCRA 1GO3E 4KHPQ 1CSPA 2YU9H 4A3CG 4JBWA 4A3LH 2GN5A 1PFSA 4TVAB 3BJUA 3KJPA 3S2DH 1QUQB 4AQYQ 2WB1G 1K0RA 2Q2TA 4IPGA 3CPWA 3ERSX 2Z6KA 2ASBA 3K80C 4YWLA 1S72A 1PH1A 5C4XG 4DV3L 2UUAL 2R6GA 3CCVA 3J7A5 2OTJA 1I94Q 1N33L 3NEMA 4JI6Q 4BY7H 3ULLA 3OYYA 1A8VA 5GADC 4LFAL 3GTMH 4GOPC 2NVQH 3H0GG 5IE8A 3FHWA 4Y7NH 2OQKA 3ICEA 3S16H 2JA9A 2KCTA 3TREA 3M7NA 3S1NH 3FKIH 3MXNB 5HY6A 3HOVH 1E1OA 1E22A 2HIXA 2H5XA 4ALPA 3GO5A 4POGA 1C0AA 3K7UC 2HT1A 4BBRG 4JI0L 5FJ8H 2ZTEA 3U50C 3PV0A 3STBD 3EBEA 1UWVA 3HOYH 2OQ0A 3I4OA 5HGQA 1N36Q 2NVTH 2PQAB 3CP0A 5IWAL 4A93H 4JI1L 4B3SL 2E8GA 2GVAA 1Z47A 1C9OA 1V9PA 3JAMi 3RLFA 1XMQL 1OTCA 2CWPA 4YY3Q 4QY7A 1MIUA 4A3JH 4A3EG 2B63G 1WI5A 1WYDA 3CMEA 1VQHA 5M3FH 1YBYA 3NELA 2VW9A 2UXBQ 1QUQA 2N3SA 2DUDA 3I55A 1GKHA 1IBLQ 1IXRA 4B3TQ 5JJLA 4DPGA 1UE1A 5IP7G 5C0XJ 2Z6KC 3G71A 5JJKA 1HNWL 4DK6C 3HOUG 1EYGA 4YCVA 3AYHB 4X65L 5C0XI 5JEAG 3OTOL 2JA6H 1XNRQ 1XPUA 3J80i 2CKZB 1IL2A 4KHPL 4UY8C 2JA5G 4A3MH 4Y52H 1NBWA 1HH2P 2E2HH 4QL5A 4R4QA 4LNQA 3PF5A 3HOZH 1X6OA 2B29A 1X3FA 2QA4A 3HOWG 2A19A 1AH9A 4DV4L 4OONA 1X3GA 1U0LA 2EIFA 4R4IA 1X9NA 2WB1E 3HOXG 1OXVA 2ZJQA 4UPAA 1M90C 2R7DA 2BA0A 4JI6L 2PQAA 5C4XH 3PUZA 2A1AA 4JOIC 3BZCA 3CCUA 4GKJQ 1FL0A 4BY1H 4JBJA 3KFUA 2F3IA 1HNXQ 2WFWA 3H0GH 4DNIA 3JC66 2IX1A 1VCIA 2DGYA 1DGSA 3EIVA 4DV5Q 2Z0SA 4A3CH 1MJCA 5GAEC 1YHBA 1K73C 4BBRH 1G51A 1N36L 4YCWA 4X64L 1Q1BA 1Q8KA 4C3IH 5C4JH 3F1ZA 3PO2G 1NE3A 4JI2L 3PUVA 3CCEA 1Q1EA 4H02A 4YY3L 4OO1I 1VQ5A 3CCQA 4X62Q 1NMGA 1YJWA 2UXBL 3PUWA 2AWNA 4EX5A 4POFA 1IBLL 2B63H 1HZ9A 2NZHA 3K7AH 3I4NG 5IT9c 3JAMc 5GAGC 4P73A 3CCMA 3IRBA 4GKKL 4IJLA 2F52A 2JQOA 1SN8A 5IP7H 1C7YA 1XNRL 5FLMG 1RIPA 1G6PA 1BVSA 3HOUH 3PCOB 3CCJA 3CCSA 4HJ5A 4LF7Q 4O0AA 3GTJH 1XMQQ 1I50H 2IHEA 2IX0A 2ES2A 4LFBQ 1D8LA 1HNZQ 2JA5H 2R7ZH 4IO9A 1P16A 1I5FA 4BXXH 1L1OB 5GAHC 1HZBA 1TXYA 4AYBG 3FP9A 4RMFA 3J80c 1PA6A 1KQSA 3HOWH 4BA2I 1VQ4A 4JYAQ 4UP9A 4P74A 3GTPH 1HNWQ 2R93G 3S14H 2AKWB 3OTOQ 4A3KG 2MNAA 1SFOH 4GNXA 2F4VQ 4O2DA 4C2MH 1XMOQ 4A3BG 3M4QA 2AHOB 4GKJL 1PVOA 1WFQA 2C35B 2FXQA 1HNXL 1EFWA 1TWAH 4NPSA 1HJPA 5BR8Q 3T1YQ 1PH2A 4IOAA 4DV5L 4DV4Q 5JJIA 1Q7YC 5IY0A 1Y1VG 3S24A 3AQQA 2YTYA 2KBNA 2YYZA 4PZ7A 2D0PA 2NZOA 1YI2A 4MTNA 4P75A 2ZTCA 2KHJA 3PUYA 1YEZA 1NY4A 2B3GA 5DLQE 4DR3L 1FGUA 3S1RH 4YWMA 3RN2A 4WJ4A 1E3PA 1VQCA 1I3QH 5IYDG 1IBMQ 5ELNA 4K0KQ 1XJVA 1PH5A 2EQSA 4IPDA 4X62L 1NMFA 1SMXA 2NVYH 3I2ZA 4A3FG 4B3ML 2VUMG 3F8TA 1KXLA 2MO0A 1L1OA 4A3IG 3UDGA 4DR6L 1CKNB 4QGUA 3KDFA 3KJOA 2ALYB 1PYBA 3PGZA 1MKHA 2RCNA 3KF8B 3J81j 1EIFA 5EAYA 3VDYA 4X64Q 1EQQA 1HZAA 4LW1A 5IYBG 4JI2Q 4LF7L 3F2CA 2UXDQ 4LFBL 3AFPA 3HFZB 4APVA 5FLMH 2RF4A 5M3MG 3A0JA 3L2PA 1HNZL 4LF6Q 4PG3A 4DR4Q 1A0IA 4OWXB 1IZ6A 4DUZL 4LF9L 3HKZG 1EOVA 4QQBX 4JYAL 2K50A 4HIMA 5LMUQ 4L5QA 1YHQA 1Q12A 4KHZA 4AYBE 5M5XH 1JMCA 1A63A 1QVGA 2UU9Q 4GKKQ 4DR5Q 1Y1WG 1T9HA 4HIOA 1PV4A 1L2FA 2F4VL 2PI2A 1XMOL 1CSQA 1WCMG 2ZJPA 1UE7A 2RHQB 3DM3A 1Q86C 1KC8C 2OCEA 4A3BH 1HR0Q 5BR8L 3T1YL 4DK3C 1E7ZA 2LXKA 4J15A 1PH3A 2E5LL 2UUCQ 4GLXA 1UE6A 1M1KC 3GD7A 5JEAJ 3W1BA 1V1QA 1KIXA 3H15A 2NN6I 1VQBA 4DKAC 1X55A 3S2HH 1L1OC 1FVIA 1CKNA 1KAWA 3ER0A 2Q2IA 1KHIA 3I56A 4JI5Q 3RZDH 4JI4Q 1EUJA 1P8LA 3G48A 1FJGQ 2Q2HA 5C3EG 1IBKL 1IBML 3STBC 1VQ8A 2HHHL 4K0KL 5GQOA 1Y14B 4QJFA 1OXSC 4GN3B 4MNOA 4LF5Q 3GTLH 4LFCQ 3PO3G 3NENA 3TRZA 4DV0Q 2LXJA 1K8AC 2KCMA 1VQFA 1OXTA 1GD7A 4LF8L 5LMNQ 5K36G 1JJ2A 4BBSG 4A75A 3KOJA 4A3IH 1SR3A 1H95A 4GNXB 4DR3Q 1VQ6A 1K83H 4JBMA 2VZAA 1VQGA 3GTGH 2UXDL 2Y0SG 4A3LG 3M85A 3HKSA 3CPFA 3M4PA 4P71A 4YHHQ 1HR0W 3G6EA 4DAYB 1EIYB 4LF6L 4FDBA 1WJJA 4R4CA 4P72A 4X66Q 4DR4L 4B3MQ 3I7FA 1B70B 4GS3A 5M3MH 3CMAA 1QZGA 3GTOH 5GROA 4A3EH 3TS2A 1QVFA 2PI2E 4DR6Q 5LMUL 3HKZE 2AWOA 3RNUA 2JK8A 2R92G 2UU9L 2CWAA 1W3SA 4DR5L 3I4MG 1GVPA 4MZ9A 2VY3A 2GVBA 1N9WA 1LTLA 4PZ8A 4DR1Q 1K8GA 1ASZA 4HJAA 1VQMA 1Y1WH 1X54A 1TWGH 3M9BA 3FKIG 3K81C 3L0OA 3UDIA 3HOVG 3GTKH 1HR0L 4LF4L 3H3VH 2UUCL 2IY5B 4DUZQ 4LF9Q 4JC0A 5FJ8G 4YCUA 3AEVA 2ZM6Q 1PH7A 1J5EL 3KDFB 2NVXH
chains in the Genus database with same CATH superfamily
3HOYG 4DV6Q 5CYUA 4X6AH 1JOKA 4RFBA 4ZYSA 4Q5VA 1D7QA 1GUSA 3M3YH 1LT5D 5FKAC 2E5LQ 1GHKA 1TWCB 4XT1B 4XYOA 5IP9G 4IFDJ 3NUCA 3PO3H 5LMNL 2K75A 1I6VC 1KRSA 2JA6G 2A74C 3K8AA 1SLJA 4CHTB 4A3GB 5JJZA 1E1TA 2HHHQ 1VQAA 3BYYB 4YHHL 1IYJB 2Y0SE 2H1EA 4J6HA 4DNRB 1PHJA 5AFWA 2F3WA 4LF8Q 5E7NA 1ZYRD 1J6QA 2VQEQ 3A5UA 5CV9A 1CKOA 4DR1L 4LUZA 2FMMA 3DEOA 4GNXC 1EWIA 1KRTA 1PH8A 3F2DA 3CXCA 2JE6I 1TVXA 4XXEA 1S40A 4LWCA 3PUXA 4F8MA 2ZM6L 4A3CG 1VQEA 4A3GG 2WACA 2MQHA 4HIKA 1KD1C 4WRDA 5CMDA 3OWEB 2HQLA 2QEXA 2WIIB 1QWYA 1S5CD 4QMGA 4JOIA 2BDOA 4A3KH 3BVMA 5CGKA 4XQNA 4X3UA 3BVZA 4HR7B 2MHVA 1MJEA 3SK5A 4OHJA 2IHFA 5KNBA 2PPBC 5DM73 3RR5A 1ESFA 4DR2Q 2A68C 5LL6X 3KLSX 1C48A 1SYFA 2Z4HA 3L7ZC 1ILPA 3J81c 2EY6A 1LM0A 1JWMD 4R8NA 3KYHC 5JPNC 4FP5D 5ELEA 1O7IA 4Y7NB 5BN3A 5I6WA 2YTXA 4GN5A 4LJZC 1XTCD 4NP5A 5BN5A 1VMCA 1I94L 4H13C 2EXDA 4EGVA 1EY9A 4B3RL 5C3WA 3VR6A 2AUJD 2PCFB 3B6YA 4GLVB 2RDGA 1BKBA 3BDOA 4R8IA 1A2UA 1N8RC 3MZ5A 2P5ZX 3FEWX 4K5XA 2XTIA 3ULJA 4NXNL 3O13A 1F2MA 4IPCA 1TWHH 4LFAQ 2XWJB 5M5XB 5AJ3L 2L5TA 1B4OA 1WCMH 4C3HH 3PF4A 1UNSA 3E0JA 3NBHB 4JV5L 1V1PB 4GZYC 1YVCA 1VQIA 5C6AA 3CW2C 3S2HB 1E2ZA 4L5SA 4GOPA 2PZTA 3DWPA 3S1QH 1PFBA 2E2IH 2K5WA 1HZCA 3SGIA 3NK9A 4DV2Q 1TS3A 5C4XB 3ZJYC 1EIGA 4KK7A 4WJ3M 1U4LA 4HMIA 3H0GB 4RKBA 1CZGA 3Q8DA 4DR7L 3UDXA 1KDCA 3U4VA 1XPOA 3MXUA 4X65Q 1SE8A 3D6CA 3TN2A 5C44H 1AW7A 1PXUA 1GO3E 3P20A 3SEBA 3VA7A 5C4JB 1AEXA 1PTOD 4O1NA 1QUQB 4AQYQ 3CRKC 2KHSA 2EDGA 3CPWA 4OO1H 1DOMA 1ZKOA 1EZ8A 3K80C 1S72A 5C4XG 2RDFA 3GTOB 3K7AB 1KNAA 1DYQA 5EBCA 4BY7H 3GTMH 2NVQH 3H0GG 1G6ZA 4FO2A 2CHBD 2B2YA 3S1NH 5HY6A 4TKOB 5J1ZA 1QCBD 4ALPA 5CV4A 2A68D 2H5XA 2HIXA 3OIPA 1LV9A 2XIWA 4E6IA 4HN7A 1C0AA 2HDMA 2HT1A 1IYUA 4JI0L 1ENCA 3STBD 1STEA 3HOYH 4A93H 3HOWB 2F0LA 4B3SL 3GTPB 2XN9C 1OTCA 3S15B 3RLFA 4QY7A 4YIJA 2B2UC 4DXFA 1WI5A 2D2CC 3MVVA 2N3SA 3I55A 1GKHA 1KLUD 1IBLQ 5JJLA 2LKVA 1F9RA 5IP7G 2JXMB 5C0XI 2JA6H 1XPUA 4KKUA 3BDCA 2KJXA 4LK1C 3K5LA 4KHPL 4A3MH 4R4QA 1EIHA 1X6OA 3HOWG 3MXNA 2X69A 1EY7A 4ZK9B 1SSOA 2X6LA 5IGEA 2XWBB 3QJYA 1U4MA 1LT3D 3SXHA 4KD4A 3PUZA 2EVBA 4TRDA 1B50A 3CCUA 1K28A 1PTOF 4UDUC 4P2CB 1FL0A 4U673 4O42A 1HNXQ 2IX1A 1VCIA 2DGYA 1DGSA 1PLFA 2E75C 1Q3LA 3EFXD 4A3CH 1DZ1A 3M7GA 1YHBA 1K73C 4H7BA 3G7LA 5KNCA 2Q8RE 2F0GA 3F1ZA 3M4YA 3PUVA 2VB2X 4H02A 1VQ5A 1GUOA 2CW0C 2LMCB 1DM0B 2UXBL 2K1BA 1EYAA 3FDTA 4DNTB 3R2IA 2M00A 2B63H 5GAGC 3IRBA 2RSNA 2PO4A 1C7YA 3S1MB 1G6PA 3PCOB 4HJ5A 3CCSA 1Y1VB 2B2TA 2ES2A 2IX0A 3TDQA 4FXGC 2A5HA 1ICWA 4IO9A 1TXYA 1CA6A 3FP9A 1S4ZA 1O7LA 3S14H 1CA5A 3OTOQ 1CI3M 3NXWA 1XYIA 2F4VQ 1TS2A 4OIJA 4C2MH 1XMOQ 3M4QA 4GKJL 3ERQA 1K83B 5HGTA 2FJ2A 2MUYA 4NPSA 1HJPA 4KY5A 5BR8Q 4HSVA 5EPLA 2AQ3B 3IFTA 1TWFB 1Y1VG 2YTYA 4PZ7A 3IAYA 1W6JA 1YI2A 2L0CA 3FRPB 4MTNA 2KHJA 1YEZA 3HKZB 1FGUA 4LMQD 4YWMA 4WJ4A 1VQCA 2HUGA 1I3QH 2ICIA 3TP7A 5IYDG 1IBMQ 4G7OC 4DF7A 1B44D 1NMFA 2A69D 1NAPA 3J7YW 4PNYA 3R8BA 2A6HC 3UDGA 1GUTA 3ITPA 1Y8PB 2EPBA 4QGUA 1PYBA 1MKHA 3FPPA 3KF8B 3Q0AA 3VDYA 4X64Q 1HZAA 3BDLA 3LX0A 4LFBL 3HFZB 1TT2A 4APVA 2RF4A 3A0JA 4OWXB 2R3ZA 1PZKD 2B2WA 3HKZG 3M3YB 1RKNA 4HIMA 3C1FA 4L5QA 2F0EA 5M5XH 2F1MA 3HG9A 2UU9Q 4GKKQ 2BE5D 4IN3A 4DR5Q 3PO3B 5M9OA 1L2FA 3TSSA 3NSWA 5E4XA 2ZJPA 2NTSA 1KC8C 2OCEA 4A3BH 3T1YL 2SOBA 1E7ZA 2LXKA 1B3AA 1G91A 1UE6A 1M1KC 1KIXA 5JEAJ 2Q2UA 3S2HH 3H15A 5IODA 2EYOA 1CKNA 1KHIA 1Z7TA 2F0FA 3I56A 3QO2A 1EUJA 1LTBD 5A35A 3AMUA 2XVSA 1PRTF 2Q2HA 2HD3A 1IBKL 1RHPA 4K0KL 1S5ED 1STBA 4GN3B 3MC0B 3HRZC 3PO3G 1TU2B 3TRZA 2LXJA 4KN4C 1H9KA 3C46A 2PZWA 5LMNQ 1KDAA 1JJ2A 1SR3A 2K04A 4N9PA 1LTTD 1UUPA 1BOSA 4FF2A 3GTGH 4EVOA 4FYDA 4A3LG 4P71A 1HR0W 4YHHQ 3G6EA 4DAYB 4DR4L 1SJHD 4FDBA 4A3KB 1GOZA 3GTOH 3TS2A 1HA6A 5LMUL 3HKZE 1D2BA 1BCPD 4ME5A 5ELCA 3TZUA 1W3SA 1GVPA 1WTRA 4DR1Q 2GVBA 1N9WA 1LTLA 1VQMA 2QCPX 1TWGH 4OGQC 1UEAB 1HR0L 3H3VH 4DUZQ 4K8JA 4JC0A 4ABNA 5FJ8G 3AEVA 2ZM6Q 2Q8IB 2KA7A 1STAA 2NVXH 3SK8A 1V43A 2HQEA 3S15H 4PMWA 1IKMA 4RWSC 1ICFB 3C1EA 4LUOA 2L12A 2H4OA 1DOLA 4PZ6A 4LF5L 1EY6A 1GXDC 3CF5A 3DEPA 3RUZA 3K6OA 1W2BA 1HHVA 4EQ5A 2D62A 2MO1A 3J81i 2NBFA 3AU7A 4BY1B 2PMZB 4K2LA 4TSSA 2XRQD 4G7HC 1NSNS 5DAUA 3OPOA 2ICEC 4L5RC 1BQQT 1RODA 4OEMB 4R1JA 3MA2B 4BWGB 1WTQA 3KK7A 4C3IB 1JWSD 1TWHB 4L8JA 1AE2A 4YWKA 2ZJRA 3J7ZC 2K28A 5ELDA 3QB3A 4C3HB 1DCZA 2D0OA 1SE3A 3TP6A 5FLXc 1CFMA 1QNUA 1LT6D 2BCOA 2F0HA 3EROA 2OWOA 2R92H 4F87A 4BY1G 1QNKA 4ZKCB 5TSSA 4B3RQ 4JPBW 1WD1A 4HIDA 3RZOH 3OHXC 3S1QB 1SE4A 3I91A 4XTCS 2E2IB 1WD0A 1JJGA 5JVG3 2R7ZB 4ZUJA 2I5HA 2I5LX 4RA8A 4C3IG 2PZUA 1STNA 5M5WH 4NXNQ 1FGBD 2L4NA 3D0FA 3GTQH 4C3HG 2N8NA 2CQAA 1Q81C 2D5DA 3TS0A 2VQFL 3IKJA 4WFN3 5AJ3Q 1VQOA 4ZAIA 4LF4Q 1JICA 5KYIA 5C44B 3GV6A 4OWWB 3LWEA 1J5EQ 5JAVA 3TEHB 3S1MH 1EQRA 4JV5Q 2VS1A 2SNSA 5ELBA 1RTOA 1Y1VH 1ZEQX 3TMEA 2WAQG 1VQDA 2ZXRA 4JI8L 4F7XA 1BBWA 4R4TA 1VQNA 1EEFD 1U9RA 1LYLA 2C5CA 4Z9CB 2R7ZG 3NQIA 3E9IA 1BXTA 2KHIA 4A76A 4BXXG 5M5YH 4JCVE 1HA5A 5IYDH 4BY7B 3GTMB 2NVQB 1PYSB 1R4QB 3OMGA 2I0QA 1W6KA 1Q46A 2FMCA 2AQ1B 3S1NB 5DNFA 2TSSA 1SROA 4N8FA 5C44G 4DR7Q 2TMPA 3T1HL 2EOTA 4JK1C 5F2DA 1IL8A 1TR5A 4GOPB 2K5QA 2VNUD 4K5WA 3HOYB 1TWFH 4A93B 3CCLA 4KKTA 2BH8A 4CDEC 2LSSA 2PMZE 3F2BA 4G7ZC 1VQLA 4OO1G 1DONA 4DV7L 3G4SA 2BH2A 3BU2A 1B8AA 2B2VC 1NCVA 4BY7G 4A3DH 4JI3L 4DGZA 5I2YA 2V1CC 1WTHA 4ME3A 2JA6B 1HUNA 2XGTA 1ESRA 4KN7C 1K9MC 4JI7L 4A3MB 1IW7C 5LMNW 2K5VA 5C4ZA 2JA8H 4JI0Q 4B3TL 3E0EA 4A93G 1SRUA 1G291 1D5ZC 3QOJA 5I9PA 3I90A 2HCIA 4CGYB 2WAQE 2JEBI 3RN5A 4B3SQ 3NTIA 1XNQQ 1RTNA 3DUZA 4ZQ3A 1EEID 4OWTB 1HXYD 1L0WA 1SMYD 4KJNA 1QZHA 1EFID 3L3OC 3K0XA 2DY8A 1R9TH 4A3MG 1EU3A 1K3BC 2BA1A 4H44C 1Z9FA 4IPHA 1WTXA 1N32Q 4KHPQ 2O5JC 5KEEA 4A3LH 1YNJD 1F9PA 5LHY1 1V1OA 2WB1G 1FYCA 1SDFA 3MFGA 2Z6KA 3TP5A 1O78A 1GJXA 3OIQA 4YWLA 1PH1A 3A56A 2L55A 4NMZA 2UUAL 2R6GA 2B63B 2OTJA 2D9UA 4J1MA 1N33L 3NEMA 5G3LD 3OYYA 5GADC 4X3TA 4GOPC 2F0SA 2OQKA 3ICEA 2KCTA 2F0QA 3M7NA 3MXNB 1E1OA 3VR5A 2NZ1D 3ONAB 2NB0A 1J9OA 2ZTEA 3IL8A 5FJ8H 3U50C 3EBEA 1XXGA 5HGQA 4JI1L 4KHVA 2E8GA 3HOXB 3S14B 3HEJA 1MIUA 2B63G 4C2MB 4V190 1VQHA 1YBYA 2UXBQ 5IOCA 3NTHA 1A2TA 4DPGA 1KAAA 3A8IE 5JEAG 3DM1A 2CKZB 3EVQA 2F03A 1NBWA 1ET9A 3K57A 5I4DA 4QL5A 2FINB 4ZUIA 2QA4A 2EJMA 1I3QB 3TP8A 2O4XA 4RAUC 3CU7A 2G9HD 2EIFA 4R4IA 2F4IA 2WB1E 3HOXG 2ZJQA 4UPAA 2EYHA 2KUMA 3NWTA 2QDLA 3I73A 4JI6L 2PQAA 2A1AA 1SNDA 3BZCA 4GKJQ 4BY1H 4JBJA 2F0OA 2WFWA 3CQZB 5FO9B 4CJ2C 1K8OA 1B9NA 2A73B 4G57A 3P1HA 1LTID 1AZPA 4BBRH 5IGBA 1N36L 1EQTA 1Q1BA 1Q8KA 4QUCA 4C3IH 5KYLA 3PO2G 1NE3A 4AYBB 4JI2L 4UAIA 1Q1EA 5EJWA 4YY3L 3K5MA 2K05A 1VF7A 4KMUC 1YJWA 1EYDA 2AWNA 1LABA 3Q24A 5FLXL 3BG3A 4A3BB 1PRTB 4P73A 3H94A 2KOLA 4RGMA 4HTHA 2F52A 1SN8A 3SHLA 4DXGA 1BVSA 2WKDA 4O0AA 4LFBQ 1YNNC 1I50H 2IHEA 3QR8A 1XMQQ 2JA5H 2F0IA 2R7ZH 1P16A 4BXXH 1HZBA 4AYBG 4RMFA 1VQ4A 2DNCA 4P74A 2J7ZA 1HNWQ 1AP0A 2DN8A 3MTSA 2VUMB 3W3AA 4GNXA 1SNOA 4O2DA 2WV6D 1BBXC 4A3BG 4N9TA 1QB5D 1TWAH 4RH6A 3T1YQ 2HCCA 1PH2A 3GTGB 2EYMA 4DV4Q 1H9MA 5IY0A 3WOFA 5CV8A 1HQRD 4PQXA 1IKLA 5KIXA 1X32A 4P75A 1AFPA 3L9AX 3PUYA 4DR3L 1NY4A 3RN2A 1EY4A 1TKWB 4RCOA 2IJ0A 4K0KQ 5D3IB 3AB9A 4IPDA 4X62L 4A3FG 3HS0C 2VUMG 1KXLA 2MP1A 1ML0D 1TWGB 4HSPA 2FFKB 1CKNB 3KDFA 5EQ0A 5EAYA 5E4WC 2NVXB 4IURA 2EZVA 5IYBG 4LF7L 3E6ZX 3L2PA 2RDHA 1HNZL 4DR4Q 4LF9L 4HCSA 2EY5A 1GHJA 4QQBX 5NUCA 4JYAL 5COYA 5LMUQ 1YHQA 4KHZA 4AYBE 1PRTC 1QVGA 1T9HA 1VDZA 4HIOA 2PI2A 1FNUA 3I72A 4RHRA 1S5DD 1UE7A 3D4RA 1M8AA 1HTPA 1HR0Q 1PTOH 2E5LL 4J15A 1NR4A 3BZDB 4GLXA 3GD7A 3W1BA 2F3VA 2NN6I 1VQBA 4DKAC 2KECA 1KAWA 3ER0A 2Q2IA 5FLXE 3S2DB 4NW2A 2ENBA 1A6XA 3KLSA 2K7VA 1P8LA 3DHQA 3K5NA 4K6LA 5C3EG 2HHHL 4IALA 3G6JB 2LS01 1Y14B 3J7AF 1WTOA 2R92B 4LF5Q 2OF1A 5ISRA 3NPPA 5L37A 1K8AC 4LF8L 1OXTA 1GD7A 3RZOB 3NHHA 3FKIB 4A3IH 1HUMA 1RD9D 1H95A 3SE0A 1VQ6A 1TS5A 1VQGA 2UXDL 5CBAE 4ODGA 3M85A 3HKSA 3CPFA 4ULLA 2NVTB 1LACA 5M5WB 4B3MQ 3GTQB 5M3MH 1B70B 3CMAA 4RGOS 5GROA 1QVFA 4DR6Q 2AWOA 4PMCA 4A3JB 2R92G 3H3VC 2N88A 2OT2A 3A55A 4MZ9A 5J22A 2EJGC 1ASZA 4HJAA 5JEAH 1X54A 2ZT9C 3FKIG 1KDBA 3L0OA 3HOVG 3GTKH 4I7ZC 2UUCL 3OW7A 3VA5A 1QILA 1PH7A 2DJGC 4KD3A 3HOZB 5M5YB 2B8FA 4DR2L 3UDFA 1QVCA 3HOXH 4TQUS 4JI5L 1STHA 4JI4L 1VQ7A 1QE6A 4L6TB 1E0BA 2QW7A 4A3JG 3K5OA 2VQFQ 4LFCL 3FPUB 1HQMC 3UE1A 1ASYA 4QB4A 4DA2A 4HJ7A 2KCCA 2JN4A 3GDEA 4IFDI 1H9SB 4CJ1B 4JI8Q 1EWCA 1I4RA 5T1IA 3VYUA 1RL2A 4BBSH 4R4OA 2JP1A 2KCNA 1R4PB 2JJQA 3W1GA 3SVMA 3HOZG 2XRSD 4A3DB 3PO2H 4OX9L 1EQVA 4X66L 1PFNA 1YNXA 2O2LD 3DLLA 4HJ9A 1G2SA 1WVLA 4K5VA 2K5NA 1V1PA 3VYSA 1C8CA 1A62A 1YJ9A 2JA8B 2WP8J 3T1HQ 3CQZH 5EPJA 2QEJC 5CV7A 1XPRA 3A74A 1ENFA 2MJ8A 3PSIA 4H0LC 2AMCB 2C9OA 2EYLA 1VQ9A 3GTJB 1F9SA 4DV7Q 2PNRC 4A3DG 1N34L 1CKMA 2Z9HA 1SJED 2CCZA 3T56B 5J3BA 4JI3Q 4Q0FA 1NTGA 1O80A 1GM5A 1U5KA 1XWEA 1LO5D 1WTWA 1MGSA 3OW2A 1R9TB 2JA7H 2R7FA 1YZ6A 4DV2L 3QG1A 1LUZA 2JA8G 3VYRA 4JI7Q 3D31A 3H6MA 2O5IC 1D6EC 1JB3A 3ULPA 2CW0D 3OMCA 4ZLTF 3TZDA 1UE5A 5H1SE 4UHVA 5EKLA 2DJFC 3J7AV 1Z6HA 2Z6BA 1U4RA 3MEFA 3U9SA 4AQYL 1S5FD 4A3FH 4KI0A 2VUMH 2N49A 2K5HA 3OSOA 3FMCA 3RMHA 4DUYL 2NUCA 3BZKA 1A15A 5EKIA 1OXXK 4KLKA 1CZWA 2PYKA 2LY7A 2K01A 3TBIB 2UXCL 3S17H 5IYBH 1UEBA 4AH6A 4JG2A 2IWHA 1FNWA 3T51B 4HJ8A 2KENA 1G8ZD 5EKKA 3LGJA 2UUAQ 2A6EC 3RLOA 1N33Q 1OXUA 2EYJA 2R61A 1D1KA 1EL0A 5HURA 1PZID 5C0XH 4FXKC 1I4XA 1HPCA 4BA1I 3D4DA 2KQ3A 2F0KA 1WOCA 1FR3A 1YHAA 1MBYA 3DWAA 4XDXA 5C5LA 3KF6A 2L15A 4JI1Q 1SNMA 3D3RA 2HIVA 1BBUA 4DV1L 2A6HD 2ID0A 5C3EH 2UUBL 4JBKA 3GV3A 2EYFA 3Q23A 4FNFA 4NB3A 5IYCH 4CBVA 2PQEA 4RG1A 1O7ZA 2LFNA 1SNPA 3A7AB 3CC4A 4L5TA 4NXML 5CR3A 4BBRB 1A3VA 3CCRA 2YU9H 3F2UA 3KBXA 4JBWA 4N8X1 1PFSA 1SYDA 3BJUA 3KJPA 3S2DH 1JR0D 2Q2TA 2CH4A 1JE4A 3ERSX 2ASBA 1ZXTA 1MI2A 5CBEE 1EY8A 4DV3L 3CCVA 4K14A 4K8IA 1I94Q 2EXZA 4JI6Q 3ULLA 5IE8A 4IZ8A 3C2PA 4KY6A 2WAQB 3S16H 2JA9A 3TREA 3FKIH 3HOVH 4POGA 1BCPF 3GO5A 1I50B 4BBRG 2JA5B 4L63B 1C4QA 1MSGA 2OQ0A 3I4OA 1N36Q 4LAAA 2PQAB 3SK4A 5IWAL 2NVTH 1V9PA 2QF7A 1DD2A 2CWPA 4YY3Q 4ZCKA 4A3JH 1WYDA 5M3FH 4K2KA 4JW0A 2VW9A 2F0JA 2DUDA 1TWAB 4IUUA 1UE1A 5C0XJ 2Z6KC 5JJKA 4YCVA 3OTOL 4UY8C 2JA5G 4Y52H 1ZYRC 1HH2P 4ILWA 3HOZH 1X3FA 4EQNA 1B3QA 1AH9A 3DWQA 5JOBA 2Z1CA 1U0LA 1X9NA 3VR4A 1NR2A 1BDOA 1LTAD 1GUGA 3BVGA 3I70A 3KF8A 1M90C 4X3SA 2L9HA 3K0YA 1RF2D 4JOIC 4EQOA 3KUPA 3I4NB 2F3IA 4DNIA 5J39A 2I07B 3EIVA 3CKIB 1MJCA 5GAEC 4C1NI 2QKIC 1G51A 1BUVT 2OEOA 1CHQD 4X64L 5D65A 2X6GA 4DU9A 2RBMA 4RGNA 4OO1I 3CCQA 5JPMC 4CDCC 2R93B 4X62Q 2QILA 1NMGA 3PUWA 4EX5A 4POFA 2NZHA 1PTOB 3I4NG 5IT9c 3VR3A 2EE1A 3JAMc 1BR9A 4GKKL 4IJLA 1XNRL 2WB1B 1L0XB 3HOUH 3X3NA 2RVLA 3CCJA 4LF7Q 4C3JB 3GTJH 2E2DC 4DN4M 1HNZQ 2NTTA 3PMFA 4HEDA 1II3A 5GAHC 2IPKD 3A8KE 3J80c 1KQSA 1MHWC 4BA2I 4JYAQ 4UP9A 1EWHA 3Q6SA 2R93G 2AKWB 1VF5C 2MNAA 3E3XA 5DEHA 4A3IB 1SNCA 4WORA 2FXQA 1EFWA 4J8QA 4IOAA 1PYWD 4DAYA 1T5EA 4DV5L 2K5DA 1Q7YC 4C3JG 3S24A 1EZ6A 1SYEA 5JVH3 4U68A 3N52A 4PV1C 3OWFA 5M3MB 1X3QA 1H9RA 2ZTCA 4B9XA 3N6RA 5DLQE 2Z4IA 3S1RH 1E3PA 4DK0A 2E2JB 5ELNA 4RCNA 5IGGA 1XJVA 1CK1A 2EQSA 2VXWA 2NVYH 4MHEA 3F8TA 4BS9A 3GTKB 1L1OA 4A3IG 3KJOA 2ALYB 3PGZA 5KGUA 2RCNA 1KNEA 2Z8LA 3H91A 1OO9B 5BN4A 1A3TA 3F2CA 2UXDQ 2F0DA 3P75A 3AFPA 1S5BD 5FLMH 3I8ZA 5M3MG 1D5MC 3I4LA 1JCKB 4DUZL 4I65A 1PZJD 1EOVA 3QOLA 3MWYW 1QG7A 2K50A 3NQTA 4B08A 1EYCA 1Q12A 1F77A 1JMCA 1E2WA 1A63A 1PTOC 3MEHA 5CC4A 3X3MA 2IW3A 2RHQB 3P7JA 3EJIA 4BBSB 2K33A 2B2YC 4HMJA 3D6WA 4DK3C 2MGSA 2UUCQ 4OIKA 3PO2B 1F2YA 5ELFA 5A2QL 2B2VA 2J0TD 4JI5Q 5FO7B 4R9WA 3RZDH 4JI4Q 1CTMA 1IW7D 3A7LA 1LTSD 3STBC 5IIFA 1DJRD 2I46A 4FXDA 4MIUA 1OXSC 3BS1A 4LFCQ 3NENA 4M1UB 2EYPA 2KCMA 1VQFA 5K36G 4FF4A 5G3LF 1SNQA 2M2LA 4BBSG 4A75A 3KOJA 1TQOA 1QOHA 1GUNA 4JBMA 2VZAA 4LF6L 4OX9Q 1EIYB 1SBBB 4KKSA 4R4CA 3SDZA 4P72A 4X66Q 2DNEA 4JVZA 2JA7B 1QZGA 1F9QA 3D4WA 4S3SA 2PI2E 4QUFA 2EY2A 2JK8A 3RNUA 3NE5B 2CWAA 5C3XA 2Q8TA 4PZ8A 2VY3A 1Y1WH 2B39A 5I2XA 3HGBA 3K81C 1AN8A 4LF4L 4C1NK 2SNMA 1J5EL 2E2HB 4K6DA 1EY0A 2KEDA 2CFMA 3PIPA 1N34Q 2RHSB 3CHBD 4A3FB 4G4KA 2VB3X 1X3EA 2JA7G 1FJGL 1LLRD 2JYOA 1JC7A 1I6HH 4QIWB 3S9WA 4DV0L 3S17B 1MD2D 4LUVA 4FVMA 2K52A 4IUTA 1YJNA 1JB7A 1Q82C 3K58A 2CQOA 3CC7A 4ZKBB 1NJIC 4V0BA 4A4IA 3R93A 5FOBB 1IBKQ 1X65A 2ZTDA 2B2TC 3CRLC 3GQBA 3V05A 3RLNA 1B1ZA 2K6AA 2G9DA 2CVRA 2MPMA 5CV5A 3Q22A 2AQ2B 1K3RA 4DUYQ 3I4NH 4PMBA 2L11A 1WTPA 5A2QE 1CQVA 4KV6A 3E9HA 3I4MH 1O7YA 1X56A 5ELOA 3TQYA 2UXCQ 3PIOA 2RKSA 1JJCB 4DAVA 3QIAA 2HDLA 1AE3A 3UE0A 2JEAI 3NTKA 3M4OH 4UP7A 1F2LA 5C3EB 5IGCA 3ZYYX 3CC2A 4DV6L 1IYVA 2A8VA 4C56C 3LWUA 1K8MA 1B7YB 3U58A 2R93H 4ID6A 2YV5A 4XIGS 4XQQA 5C0XG 1EU4A 1XNQL 1SFOB 2BDNA 3WWVA 1RCVD 1JE5A 4AIMA 4DAPA 1YIJA 2YU9B 5IP9H 5IT9L 3JAML 2A69C 2F0WA 4C3JH 1VS0A 1K0SA 1J8IA 2NN6G 3SR1A 3H3VI 1BCPB 1DXMA 2KEEA 3FVQA 3CAMA 1N32L 1KL9A 1WTVA 4IOCA 1I4PA 4DV1Q 1UAPA 5IGFA 1T5XD 2UUBQ 2QDBA 5IYCG 1XTDA 5EBDA 3U4ZA 2B2WC 3J80L 3S16B 1E24A 2RSOA 1PH4A 4CKBA 3HOVB 4OXPA 2VQEL 1ENAA 1YNND 2FHTA 2WINB 4HCEA 2CH4W 1V8QA 3KF6B 4QIWE 1VQKA 2I5MX 4NXMQ 1TWCH 2AUKA 2ATWA 1TY2A 2BE5C 4IJHA 4HAEA 2PNHA 1STGA 1H9JA 4GN4B 2QGQA 4OL7A 3EN2A 1Y69U 1VQJA 2OTLA 2XNAC 4A3GH 5M3FB 2VL6A 2MFIA 2E2JH 1EOTA 3KLWA 4DV3Q 2DY7A 2YTVA 4GLAC 5FK9C 4QF4A 1G2TA 1YITA 2IT1A 2OXPA 1I4HA 5C4HA 2JSOA 5I6YA 1LT4D 3A5ZB 3AFQA 2N78A 3CD6A 3KBGA 3PIP3 1JT8A 1RDPD 4DAMA 1NUCA 5IWAQ 1CUKA 2RQXA 1S3OA 3H09A 2F0PA 1CT1D 2E76C 5M3FG 4UP8A 3ND8A 1ILQA 3MXGA 1PH9A 4CKCA 2K4KA 1PH6A 3K59A 3GTLB 3W5OA 3BYTB 5K36H 3KLRA 4IFDG 2K14A 3NWSA 5FO8B 1VQPA 1KLGD 1A3UA 1ONLA 2GA4B 4CKEA 1BCPC 1QJOA 5D3DA 1CSPA 3MAQA 5KRUA 4X3KA 1D1IA 2B2UA 2GN5A 4TVAB 4CDDC 1PRTD 1SEBD 1K0RA 4IPGA 3NBHA 5IT9E 3JAME 4A3EB 3E5SA 4LFAL 1A8VA 3J81L 3MXPA 3FHWA 4Y7NH 3T13A 3NP8A 3PIO3 3HOUB 2SEBD 1F2ZA 1BO0A 1E22A 1STYA 4NDXA 2K03A 2PW7A 3K7UC 2PW5A 3EA6A 1HFGA 1CQFA 3J80E 3PV0A 1PDQA 2ZXOA 1UWVA 1SYBA 3ND9A 1M4VA 3CP0A 4IUPA 1JOOA 2GVAA 2EY1A 1PFMA 1C9OA 1Z47A 5I9OA 2G5DA 3WDNA 3UI2A 3T16A 3JAMi 1XMQL 2ZXPA 4A3EG 3CMEA 3NELA 1QUQA 1IXRA 4B3TQ 1RJTA 1PMRA 3G71A 1HNWL 4DK6C 3HOUG 1EYGA 3AYHB 4X65L 4KJOA 1XNRQ 1CHPD 3J80i 1IL2A 1ET6A 3RD4A 3SK6A 2E2HH 4LNQA 3PF5A 1BNZA 1I4QA 2B29A 3S1RB 2A19A 1Q8IA 4OONA 4DV4L 3NBIA 1X3GA 4OELB 1OXVA 2NVYB 2RA4A 1IHZA 4RHSA 3OOCA 4IUQA 1KTKA 1TIID 3MFYA 2R7DA 2BA0A 5C4XH 1XX8A 2F0TA 3KFUA 3D8GA 1LTRD 1JWUD 3H0GH 3EQLC 3JC66 3PQIA 2V4DA 4DV5Q 2Z0SA 3U9OA 4KTAA 5IGDA 4YCWA 4FF3A 3LNNA 5C4JH 3WOEA 2RCFA 4F88A 3VYTA 3CCEA 1VMPA 2EJFC 3URYA 3I3CA 1B9MA 1IBLL 1HZ9A 3K7AH 4I7AA 3CCMA 4XYQA 5EPKA 2JQOA 5IP7H 5E1FA 1RIPA 2NN6H 5FLMG 2NWGA 4XQJA 1FD7D 3RZDB 1D8LA 4CDFC 3J81E 3HZXA 3V2TA 1I5FA 1L1OB 1HTLD 1PA6A 3HOWH 1BF4A 4IUVA 3W2DA 3GTPH 5LL6S 4A3KG 1SFOH 3A54A 2F0UA 2F0NA 5T1GA 1PVOA 2AHOB 1SYGA 1WFQA 2C35B 1Y8OB 5K5PA 1HNXL 1E2VA 2NYZD 3A8JE 2E74C 5JJIA 3AQQA 2IL8A 2KBNA 2YYZA 2D0PA 2NZOA 1GUWA 2B3GA 1KABA 1FNVA 3T4AC 1HFNA 1PH5A 1SMXA 3I2ZA 4B3ML 1NNXA 1Y1WB 4B9WA 5CORA 2MO0A 4DR6L 1WCMB 2SDFA 1I4GA 2WKCA 1CM9A 3J81j 1EIFA 1EQQA 1SMYC 2XSCA 3R3OA 1Q90A 4LW1A 4JI2Q 1Y8NB 4LF6Q 4PG3A 5KNDA 5C5MA 1A0IA 1IZ6A 4RGTA 1TS4A 1L0YB 1I6HB 3MHBA 1YNJC 1HRJA 1H9SA 2J4XA 1Y1WG 1SE2A 2M9VA 1DOKA 1PV4A 2F4VL 2B8GA 4IFDH 5DM63 1XMOL 1CSQA 1WCMG 5D14A 3DM3A 1Q86C 1SYCA 3C3LA 4M8AA 5BR8L 1PH3A 4DK1A 2L1BA 3DXJC 4ZRZA 4QCLA 4KY7A 2A6ED 1V1QA 3GP7A 2Y0SB 1X55A 1L1OC 2KVMA 1FVIA 2F0VA 1X3PA 3QWNA 3DMUA 5E3FA 3G48A 4EQPA 1FJGQ 1IBML 1D5XC 1VQ8A 5GQOA 4QJFA 4MNOA 3GTLH 3I4MB 1EY5A 4RKLA 4DV0Q 4IQZA 1JORA 3V96A 3VR2A 4FF1A 3IFDA 3M4OB 2F0MA 4GNXB 3R2TA 4DR3Q 1K83H 1JQYD 2K32A 3T53B 1JOQA 4MN3A 4NKLA 2Y0SG 5EGTA 4DFAA 3M4PA 3J7A5 1B53A 1HCZA 4WJWA 1WJJA 1AZQA 3I7FA 4GS3A 1SAPA 1SXTA 1U4PA 4A3EH 1MSHA 2IX3A 2UU9L 1LTGD 4DR5L 3HP3A 3I4MG 4MTKA 1B2TA 4CJ0B 1K8GA 3M9BA 3UDIA 2N55A 5CV6A 2IY5B 4LF9Q 4YCUA 2BOSA 1TY0A 3KDFB 4IUNA 4XT3B
chains in the Genus database with same CATH topology
3PIPA 2CFMA 1N34Q 4DR2L 3HOYG 3UDFA 2RHSB 1V43A 1QVCA 3HOXH 4PMWA 4DV6Q 3S15H 4TQUS 4JI5L 4X6AH 1X3EA 4JI4L 1VQ7A 2JA7G 1FJGL 4LUOA 1D7QA 4PZ6A 4A3JG 3M3YH 2VQFQ 4LF5L 1I6HH 3CF5A 4LFCL 2E5LQ 5IP9G 1W2BA 4IFDJ 3UE1A 4EQ5A 2D62A 4DV0L 2MO1A 1ASYA 4HJ7A 3J81i 3GDEA 3PO3H 4LUVA 4IFDI 5LMNL 2K52A 1YJNA 1JB7A 2K75A 1KRSA 2JA6G 4JI8Q 1Q82C 3K8AA 1SLJA 1RL2A 4BBSH 2CQOA 4R4OA 3CC7A 2JJQA 3W1GA 4A4IA 1E1TA 1NJIC 4L5RC 1IBKQ 1X65A 2HHHQ 3HOZG 1VQAA 2ZTDA 3PO2H 4YHHL 4R1JA 1IYJB 4OX9L 2Y0SE 3RLNA 4X66L 3DLLA 1YNXA 4HJ9A 1PHJA 1AE2A 4YWKA 2ZJRA 4LF8Q 3J7ZC 5FLXc 2D0OA 5E7NA 1K3RA 1J6QA 2VQEQ 4DUYQ 2K5NA 3I4NH 3A5UA 1A62A 1YJ9A 1CKOA 2WP8J 4LUZA 4DR1L 3T1HQ 3CQZH 2OWOA 2R92H 4GNXC 3E9HA 1EWIA 3I4MH 1KRTA 4BY1G 1X56A 1XPRA 5ELOA 3TQYA 1PH8A 2UXCQ 4B3RQ 3PIOA 3F2DA 3A74A 3CXCA 3PSIA 1JJCB 2AMCB 2JE6I 4HIDA 3RZOH 1AE3A 1S40A 4LWCA 3PUXA 4XTCS 3UE0A 2ZM6L 1VQEA 1VQ9A 2JEAI 3M4OH 4UP7A 4DV7Q 4A3GG 4A3DG 1N34L 1CKMA 1JJGA 3CC2A 2MQHA 4DV6L 4HIKA 1KD1C 2A8VA 2I5HA 2I5LX 2CCZA 5J3BA 4JI3Q 2QEXA 2HQLA 1B7YB 1NTGA 5M5WH 1U5KA 3U58A 1GM5A 4NXNQ 4JOIA 2R93H 3D0FA 2YV5A 4A3KH 4XIGS 3GTQH 5C0XG 3OW2A 2N8NA 1Q81C 1XNQL 3TS0A 2R7FA 2VQFL 1YZ6A 5AJ3Q 1VQOA 2JA7H 4LF4Q 4DV2L 1MJEA 1LUZA 2JA8G 4JI7Q 4OWWB 3WWVA 4AIMA 1JE5A 1J5EQ 1YIJA 2IHFA 3TEHB 3S1MH 1EQRA 5IP9H 4JV5Q 2VS1A 3D31A 3RR5A 4DR2Q 4C3JH 1Y1VH 1VS0A 2WAQG 1VQDA 4JI8L 2NN6G 1BBWA 4R4TA 3ULPA 1VQNA 3H3VI 1UE5A 5H1SE 3CAMA 3L7ZC 1KL9A 1LYLA 1N32L 3J81c 4IOCA 2R7ZG 4DV1Q 3E9IA 1LM0A 5IYDH 2KHIA 4A76A 4BXXG 5M5YH 4JCVE 2UUBQ 3KYHC 1XTDA 5IYCG 3U4ZA 3MEFA 1PYSB 4AQYL 4A3FH 1O7IA 4KI0A 2I0QA 2VUMH 1E24A 2N49A 1Q46A 2YTXA 4GN5A 1PH4A 2K5HA 4OXPA 2VQEL 4DUYL 1SROA 3BZKA 5C44G 4DR7Q 1OXXK 3T1HL 4KLKA 3KF6B 1I94L 4QIWE 2EXDA 4GOPB 1VQKA 2VNUD 2I5MX 4NXMQ 1TWCH 2ATWA 2UXCL 3S17H 4B3RL 1TWFH 5IYBH 4IJHA 1UEBA 3CCLA 3B6YA 4AH6A 2PNHA 2BH8A 4GLVB 4GN4B 4JG2A 2LSSA 2PMZE 2QGQA 3F2BA 1VQLA 4OO1G 1BKBA 3EN2A 4DV7L 1VQJA 3G4SA 1N8RC 2OTLA 4HJ8A 2BH2A 4OX9Q 4A3GH 2KENA 3BU2A 2VL6A 1B8AA 2MFIA 2E2JH 4BY7G 4A3DH 3KLWA 4JI3L 2XTIA 3LGJA 4DV3Q 2YTVA 3ULJA 2UUAQ 4NXNL 4GLAC 4IPCA 3RLOA 1N33Q 1TWHH 1OXUA 4LFAQ 1YITA 2IT1A 2V1CC 4ME3A 5AJ3L 1WCMH 2XGTA 3A5ZB 4C3HH 3PF4A 3AFQA 1K9MC 4JI7L 4BA1I 5LMNW 3NBHB 4JV5L 2K5VA 2JA8H 2N78A 4JI0Q 3CD6A 1WOCA 3E0EA 2Q2UA 1SRUA 4B3TL 4A93G 1G291 1YVCA 1YHAA 1VQIA 1JT8A 4DAMA 3CW2C 2WAQE 2JEBI 1CUKA 5IWAQ 4L5SA 1S3OA 3RN5A 3KF6A 2L15A 4JI1Q 4GOPA 4B3SQ 3S1QH 2E2IH 2HIVA 1BBUA 4DV1L 1XNQQ 5M3FG 1HZCA 2ID0A 4UP8A 3SGIA 5C3EH 4DV2Q 2UUBL 4JBKA 3ZJYC 4OWTB 1L0WA 1PH9A 2K4KA 1QZHA 4NB3A 4WJ3M 5IYCH 1PH6A 3K0XA 3W5OA 3Q8DA 4RG1A 4DR7L 1R9TH 4IFDG 3UDXA 3CC4A 2K14A 3U4VA 4L5TA 4A3MG 1XPOA 4X65Q 1SE8A 2BA1A 1VQPA 5C44H 4NXML 1Z9FA 4IPHA 1N32Q 3CCRA 1GO3E 4KHPQ 1CSPA 2YU9H 4A3CG 4JBWA 4A3LH 2GN5A 1PFSA 4TVAB 3BJUA 3KJPA 3S2DH 1QUQB 4AQYQ 2WB1G 1K0RA 2Q2TA 4IPGA 3CPWA 3ERSX 2Z6KA 2ASBA 3K80C 4YWLA 1S72A 1PH1A 5C4XG 4DV3L 2UUAL 2R6GA 3CCVA 3J7A5 2OTJA 1I94Q 1N33L 3NEMA 4JI6Q 4BY7H 3ULLA 3OYYA 1A8VA 5GADC 4LFAL 3GTMH 4GOPC 2NVQH 3H0GG 5IE8A 3FHWA 4Y7NH 2OQKA 3ICEA 3S16H 2JA9A 2KCTA 3TREA 3M7NA 3S1NH 3FKIH 3MXNB 5HY6A 3HOVH 1E1OA 1E22A 2HIXA 2H5XA 4ALPA 3GO5A 4POGA 1C0AA 3K7UC 2HT1A 4BBRG 4JI0L 5FJ8H 2ZTEA 3U50C 3PV0A 3STBD 3EBEA 1UWVA 3HOYH 2OQ0A 3I4OA 5HGQA 1N36Q 2NVTH 2PQAB 3CP0A 5IWAL 4A93H 4JI1L 4B3SL 2E8GA 2GVAA 1Z47A 1C9OA 1V9PA 3JAMi 3RLFA 1XMQL 1OTCA 2CWPA 4YY3Q 4QY7A 1MIUA 4A3JH 4A3EG 2B63G 1WI5A 1WYDA 3CMEA 1VQHA 5M3FH 1YBYA 3NELA 2VW9A 2UXBQ 1QUQA 2N3SA 2DUDA 3I55A 1GKHA 1IBLQ 1IXRA 4B3TQ 5JJLA 4DPGA 1UE1A 5IP7G 5C0XJ 2Z6KC 3G71A 5JJKA 1HNWL 4DK6C 3HOUG 1EYGA 4YCVA 3AYHB 4X65L 5C0XI 5JEAG 3OTOL 2JA6H 1XNRQ 1XPUA 3J80i 2CKZB 1IL2A 4KHPL 4UY8C 2JA5G 4A3MH 4Y52H 1NBWA 1HH2P 2E2HH 4QL5A 4R4QA 4LNQA 3PF5A 3HOZH 1X6OA 2B29A 1X3FA 2QA4A 3HOWG 2A19A 1AH9A 4DV4L 4OONA 1X3GA 1U0LA 2EIFA 4R4IA 1X9NA 2WB1E 3HOXG 1OXVA 2ZJQA 4UPAA 1M90C 2R7DA 2BA0A 4JI6L 2PQAA 5C4XH 3PUZA 2A1AA 4JOIC 3BZCA 3CCUA 4GKJQ 1FL0A 4BY1H 4JBJA 3KFUA 2F3IA 1HNXQ 2WFWA 3H0GH 4DNIA 3JC66 2IX1A 1VCIA 2DGYA 1DGSA 3EIVA 4DV5Q 2Z0SA 4A3CH 1MJCA 5GAEC 1YHBA 1K73C 4BBRH 1G51A 1N36L 4YCWA 4X64L 1Q1BA 1Q8KA 4C3IH 5C4JH 3F1ZA 3PO2G 1NE3A 4JI2L 3PUVA 3CCEA 1Q1EA 4H02A 4YY3L 4OO1I 1VQ5A 3CCQA 4X62Q 1NMGA 1YJWA 2UXBL 3PUWA 2AWNA 4EX5A 4POFA 1IBLL 2B63H 1HZ9A 2NZHA 3K7AH 3I4NG 5IT9c 3JAMc 5GAGC 4P73A 3CCMA 3IRBA 4GKKL 4IJLA 2F52A 2JQOA 1SN8A 5IP7H 1C7YA 1XNRL 5FLMG 1RIPA 1G6PA 1BVSA 3HOUH 3PCOB 3CCJA 3CCSA 4HJ5A 4LF7Q 4O0AA 3GTJH 1XMQQ 1I50H 2IHEA 2IX0A 2ES2A 4LFBQ 1D8LA 1HNZQ 2JA5H 2R7ZH 4IO9A 1P16A 1I5FA 4BXXH 1L1OB 5GAHC 1HZBA 1TXYA 4AYBG 3FP9A 4RMFA 3J80c 1PA6A 1KQSA 3HOWH 4BA2I 1VQ4A 4JYAQ 4UP9A 4P74A 3GTPH 1HNWQ 2R93G 3S14H 2AKWB 3OTOQ 4A3KG 2MNAA 1SFOH 4GNXA 2F4VQ 4O2DA 4C2MH 1XMOQ 4A3BG 3M4QA 2AHOB 4GKJL 1PVOA 1WFQA 2C35B 2FXQA 1HNXL 1EFWA 1TWAH 4NPSA 1HJPA 5BR8Q 3T1YQ 1PH2A 4IOAA 4DV5L 4DV4Q 5JJIA 1Q7YC 5IY0A 1Y1VG 3S24A 3AQQA 2YTYA 2KBNA 2YYZA 4PZ7A 2D0PA 2NZOA 1YI2A 4MTNA 4P75A 2ZTCA 2KHJA 3PUYA 1YEZA 1NY4A 2B3GA 5DLQE 4DR3L 1FGUA 3S1RH 4YWMA 3RN2A 4WJ4A 1E3PA 1VQCA 1I3QH 5IYDG 1IBMQ 5ELNA 4K0KQ 1XJVA 1PH5A 2EQSA 4IPDA 4X62L 1NMFA 1SMXA 2NVYH 3I2ZA 4A3FG 4B3ML 2VUMG 3F8TA 1KXLA 2MO0A 1L1OA 4A3IG 3UDGA 4DR6L 1CKNB 4QGUA 3KDFA 3KJOA 2ALYB 1PYBA 3PGZA 1MKHA 2RCNA 3KF8B 3J81j 1EIFA 5EAYA 3VDYA 4X64Q 1EQQA 1HZAA 4LW1A 5IYBG 4JI2Q 4LF7L 3F2CA 2UXDQ 4LFBL 3AFPA 3HFZB 4APVA 5FLMH 2RF4A 5M3MG 3A0JA 3L2PA 1HNZL 4LF6Q 4PG3A 4DR4Q 1A0IA 4OWXB 1IZ6A 4DUZL 4LF9L 3HKZG 1EOVA 4QQBX 4JYAL 2K50A 4HIMA 5LMUQ 4L5QA 1YHQA 1Q12A 4KHZA 4AYBE 5M5XH 1JMCA 1A63A 1QVGA 2UU9Q 4GKKQ 4DR5Q 1Y1WG 1T9HA 4HIOA 1PV4A 1L2FA 2F4VL 2PI2A 1XMOL 1CSQA 1WCMG 2ZJPA 1UE7A 2RHQB 3DM3A 1Q86C 1KC8C 2OCEA 4A3BH 1HR0Q 5BR8L 3T1YL 4DK3C 1E7ZA 2LXKA 4J15A 1PH3A 2E5LL 2UUCQ 4GLXA 1UE6A 1M1KC 3GD7A 5JEAJ 3W1BA 1V1QA 1KIXA 3H15A 2NN6I 1VQBA 4DKAC 1X55A 3S2HH 1L1OC 1FVIA 1CKNA 1KAWA 3ER0A 2Q2IA 1KHIA 3I56A 4JI5Q 3RZDH 4JI4Q 1EUJA 1P8LA 3G48A 1FJGQ 2Q2HA 5C3EG 1IBKL 1IBML 3STBC 1VQ8A 2HHHL 4K0KL 5GQOA 1Y14B 4QJFA 1OXSC 4GN3B 4MNOA 4LF5Q 3GTLH 4LFCQ 3PO3G 3NENA 3TRZA 4DV0Q 2LXJA 1K8AC 2KCMA 1VQFA 1OXTA 1GD7A 4LF8L 5LMNQ 5K36G 1JJ2A 4BBSG 4A75A 3KOJA 4A3IH 1SR3A 1H95A 4GNXB 4DR3Q 1VQ6A 1K83H 4JBMA 2VZAA 1VQGA 3GTGH 2UXDL 2Y0SG 4A3LG 3M85A 3HKSA 3CPFA 3M4PA 4P71A 4YHHQ 1HR0W 3G6EA 4DAYB 1EIYB 4LF6L 4FDBA 1WJJA 4R4CA 4P72A 4X66Q 4DR4L 4B3MQ 3I7FA 1B70B 4GS3A 5M3MH 3CMAA 1QZGA 3GTOH 5GROA 4A3EH 3TS2A 1QVFA 2PI2E 4DR6Q 5LMUL 3HKZE 2AWOA 3RNUA 2JK8A 2R92G 2UU9L 2CWAA 1W3SA 4DR5L 3I4MG 1GVPA 4MZ9A 2VY3A 2GVBA 1N9WA 1LTLA 4PZ8A 4DR1Q 1K8GA 1ASZA 4HJAA 1VQMA 1Y1WH 1X54A 1TWGH 3M9BA 3FKIG 3K81C 3L0OA 3UDIA 3HOVG 3GTKH 1HR0L 4LF4L 3H3VH 2UUCL 2IY5B 4DUZQ 4LF9Q 4JC0A 5FJ8G 4YCUA 3AEVA 2ZM6Q 1PH7A 1J5EL 3KDFB 2NVXH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIP A;  2CFM A;  1N34 Q;  4DR2 L;  3HOY G;  3UDF A;  2RHS B;  1V43 A;  1QVC A;  3HOX H;  4PMW A;  4DV6 Q;  3S15 H;  4TQU S;  4JI5 L;  4X6A H;  1X3E A;  4JI4 L;  1VQ7 A;  2JA7 G;  1FJG L;  4LUO A;  1D7Q A;  4PZ6 A;  4A3J G;  3M3Y H;  2VQF Q;  4LF5 L;  1I6H H;  3CF5 A;  4LFC L;  2E5L Q;  5IP9 G;  1W2B A;  4IFD J;  3UE1 A;  4EQ5 A;  2D62 A;  4DV0 L;  2MO1 A;  1ASY A;  4HJ7 A;  3J81 i;  3GDE A;  3PO3 H;  4LUV A;  4IFD I;  5LMN L;  2K52 A;  1YJN A;  1JB7 A;  2K75 A;  1KRS A;  2JA6 G;  4JI8 Q;  1Q82 C;  3K8A A;  1SLJ A;  1RL2 A;  4BBS H;  2CQO A;  4R4O A;  3CC7 A;  2JJQ A;  3W1G A;  4A4I A;  1E1T A;  1NJI C;  4L5R C;  1IBK Q;  1X65 A;  2HHH Q;  3HOZ G;  1VQA A;  2ZTD A;  3PO2 H;  4YHH L;  4R1J A;  1IYJ B;  4OX9 L;  2Y0S E;  3RLN A;  4X66 L;  3DLL A;  1YNX A;  4HJ9 A;  1PHJ A;  1AE2 A;  4YWK A;  2ZJR A;  4LF8 Q;  3J7Z C;  5FLX c;  2D0O A;  5E7N A;  1K3R A;  1J6Q A;  2VQE Q;  4DUY Q;  2K5N A;  3I4N H;  3A5U A;  1A62 A;  1YJ9 A;  1CKO A;  2WP8 J;  4LUZ A;  4DR1 L;  3T1H Q;  3CQZ H;  2OWO A;  2R92 H;  4GNX C;  3E9H A;  1EWI A;  3I4M H;  1KRT A;  4BY1 G;  1X56 A;  1XPR A;  5ELO A;  3TQY A;  1PH8 A;  2UXC Q;  4B3R Q;  3PIO A;  3F2D A;  3A74 A;  3CXC A;  3PSI A;  1JJC B;  2AMC B;  2JE6 I;  4HID A;  3RZO H;  1AE3 A;  1S40 A;  4LWC A;  3PUX A;  4XTC S;  3UE0 A;  2ZM6 L;  1VQE A;  1VQ9 A;  2JEA I;  3M4O H;  4UP7 A;  4DV7 Q;  4A3G G;  4A3D G;  1N34 L;  1CKM A;  1JJG A;  3CC2 A;  2MQH A;  4DV6 L;  4HIK A;  1KD1 C;  2A8V A;  2I5H A;  2I5L X;  2CCZ A;  5J3B A;  4JI3 Q;  2QEX A;  2HQL A;  1B7Y B;  1NTG A;  5M5W H;  1U5K A;  3U58 A;  1GM5 A;  4NXN Q;  4JOI A;  2R93 H;  3D0F A;  2YV5 A;  4A3K H;  4XIG S;  3GTQ H;  5C0X G;  3OW2 A;  2N8N A;  1Q81 C;  1XNQ L;  3TS0 A;  2R7F A;  2VQF L;  1YZ6 A;  5AJ3 Q;  1VQO A;  2JA7 H;  4LF4 Q;  4DV2 L;  1MJE A;  1LUZ A;  2JA8 G;  4JI7 Q;  4OWW B;  3WWV A;  4AIM A;  1JE5 A;  1J5E Q;  1YIJ A;  2IHF A;  3TEH B;  3S1M H;  1EQR A;  5IP9 H;  4JV5 Q;  2VS1 A;  3D31 A;  3RR5 A;  4DR2 Q;  4C3J H;  1Y1V H;  1VS0 A;  2WAQ G;  1VQD A;  4JI8 L;  2NN6 G;  1BBW A;  4R4T A;  3ULP A;  1VQN A;  3H3V I;  1UE5 A;  5H1S E;  3CAM A;  3L7Z C;  1KL9 A;  1LYL A;  1N32 L;  3J81 c;  4IOC A;  2R7Z G;  4DV1 Q;  3E9I A;  1LM0 A;  5IYD H;  2KHI A;  4A76 A;  4BXX G;  5M5Y H;  4JCV E;  2UUB Q;  3KYH C;  1XTD A;  5IYC G;  3U4Z A;  3MEF A;  1PYS B;  4AQY L;  4A3F H;  1O7I A;  4KI0 A;  2I0Q A;  2VUM H;  1E24 A;  2N49 A;  1Q46 A;  2YTX A;  4GN5 A;  1PH4 A;  2K5H A;  4OXP A;  2VQE L;  4DUY L;  1SRO A;  3BZK A;  5C44 G;  4DR7 Q;  1OXX K;  3T1H L;  4KLK A;  3KF6 B;  1I94 L;  4QIW E;  2EXD A;  4GOP B;  1VQK A;  2VNU D;  2I5M X;  4NXM Q;  1TWC H;  2ATW A;  2UXC L;  3S17 H;  4B3R L;  1TWF H;  5IYB H;  4IJH A;  1UEB A;  3CCL A;  3B6Y A;  4AH6 A;  2PNH A;  2BH8 A;  4GLV B;  4GN4 B;  4JG2 A;  2LSS A;  2PMZ E;  2QGQ A;  3F2B A;  1VQL A;  4OO1 G;  1BKB A;  3EN2 A;  4DV7 L;  1VQJ A;  3G4S A;  1N8R C;  2OTL A;  4HJ8 A;  2BH2 A;  4OX9 Q;  4A3G H;  2KEN A;  3BU2 A;  2VL6 A;  1B8A A;  2MFI A;  2E2J H;  4BY7 G;  4A3D H;  3KLW A;  4JI3 L;  2XTI A;  3LGJ A;  4DV3 Q;  2YTV A;  3ULJ A;  2UUA Q;  4NXN L;  4GLA C;  4IPC A;  3RLO A;  1N33 Q;  1TWH H;  1OXU A;  4LFA Q;  1YIT A;  2IT1 A;  2V1C C;  4ME3 A;  5AJ3 L;  1WCM H;  2XGT A;  3A5Z B;  4C3H H;  3PF4 A;  3AFQ A;  1K9M C;  4JI7 L;  4BA1 I;  5LMN W;  3NBH B;  4JV5 L;  2K5V A;  2JA8 H;  2N78 A;  4JI0 Q;  3CD6 A;  1WOC A;  3E0E A;  2Q2U A;  1SRU A;  4B3T L;  4A93 G;  1G29 1;  1YVC A;  1YHA A;  1VQI A;  1JT8 A;  4DAM A;  3CW2 C;  2WAQ E;  2JEB I;  1CUK A;  5IWA Q;  4L5S A;  1S3O A;  3RN5 A;  3KF6 A;  2L15 A;  4JI1 Q;  4GOP A;  4B3S Q;  3S1Q H;  2E2I H;  2HIV A;  1BBU A;  4DV1 L;  1XNQ Q;  5M3F G;  1HZC A;  2ID0 A;  4UP8 A;  3SGI A;  5C3E H;  4DV2 Q;  2UUB L;  4JBK A;  3ZJY C;  4OWT B;  1L0W A;  1PH9 A;  2K4K A;  1QZH A;  4NB3 A;  4WJ3 M;  5IYC H;  1PH6 A;  3K0X A;  3W5O A;  3Q8D A;  4RG1 A;  4DR7 L;  1R9T H;  4IFD G;  3UDX A;  3CC4 A;  2K14 A;  3U4V A;  4L5T A;  4A3M G;  1XPO A;  4X65 Q;  1SE8 A;  2BA1 A;  1VQP A;  5C44 H;  4NXM L;  1Z9F A;  4IPH A;  1N32 Q;  3CCR A;  1GO3 E;  4KHP Q;  1CSP A;  2YU9 H;  4A3C G;  4JBW A;  4A3L H;  2GN5 A;  1PFS A;  4TVA B;  3BJU A;  3KJP A;  3S2D H;  1QUQ B;  4AQY Q;  2WB1 G;  1K0R A;  2Q2T A;  4IPG A;  3CPW A;  3ERS X;  2Z6K A;  2ASB A;  3K80 C;  4YWL A;  1S72 A;  1PH1 A;  5C4X G;  4DV3 L;  2UUA L;  2R6G A;  3CCV A;  3J7A 5;  2OTJ A;  1I94 Q;  1N33 L;  3NEM A;  4JI6 Q;  4BY7 H;  3ULL A;  3OYY A;  1A8V A;  5GAD C;  4LFA L;  3GTM H;  4GOP C;  2NVQ H;  3H0G G;  5IE8 A;  3FHW A;  4Y7N H;  2OQK A;  3ICE A;  3S16 H;  2JA9 A;  2KCT A;  3TRE A;  3M7N A;  3S1N H;  3FKI H;  3MXN B;  5HY6 A;  3HOV H;  1E1O A;  1E22 A;  2HIX A;  2H5X A;  4ALP A;  3GO5 A;  4POG A;  1C0A A;  3K7U C;  2HT1 A;  4BBR G;  4JI0 L;  5FJ8 H;  2ZTE A;  3U50 C;  3PV0 A;  3STB D;  3EBE A;  1UWV A;  3HOY H;  2OQ0 A;  3I4O A;  5HGQ A;  1N36 Q;  2NVT H;  2PQA B;  3CP0 A;  5IWA L;  4A93 H;  4JI1 L;  4B3S L;  2E8G A;  2GVA A;  1Z47 A;  1C9O A;  1V9P A;  3JAM i;  3RLF A;  1XMQ L;  1OTC A;  2CWP A;  4YY3 Q;  4QY7 A;  1MIU A;  4A3J H;  4A3E G;  2B63 G;  1WI5 A;  1WYD A;  3CME A;  1VQH A;  5M3F H;  1YBY A;  3NEL A;  2VW9 A;  2UXB Q;  1QUQ A;  2N3S A;  2DUD A;  3I55 A;  1GKH A;  1IBL Q;  1IXR A;  4B3T Q;  5JJL A;  4DPG A;  1UE1 A;  5IP7 G;  5C0X J;  2Z6K C;  3G71 A;  5JJK A;  1HNW L;  4DK6 C;  3HOU G;  1EYG A;  4YCV A;  3AYH B;  4X65 L;  5C0X I;  5JEA G;  3OTO L;  2JA6 H;  1XNR Q;  1XPU A;  3J80 i;  2CKZ B;  1IL2 A;  4KHP L;  4UY8 C;  2JA5 G;  4A3M H;  4Y52 H;  1NBW A;  1HH2 P;  2E2H H;  4QL5 A;  4R4Q A;  4LNQ A;  3PF5 A;  3HOZ H;  1X6O A;  2B29 A;  1X3F A;  2QA4 A;  3HOW G;  2A19 A;  1AH9 A;  4DV4 L;  4OON A;  1X3G A;  1U0L A;  2EIF A;  4R4I A;  1X9N A;  2WB1 E;  3HOX G;  1OXV A;  2ZJQ A;  4UPA A;  1M90 C;  2R7D A;  2BA0 A;  4JI6 L;  2PQA A;  5C4X H;  3PUZ A;  2A1A A;  4JOI C;  3BZC A;  3CCU A;  4GKJ Q;  1FL0 A;  4BY1 H;  4JBJ A;  3KFU A;  2F3I A;  1HNX Q;  2WFW A;  3H0G H;  4DNI A;  3JC6 6;  2IX1 A;  1VCI A;  2DGY A;  1DGS A;  3EIV A;  4DV5 Q;  2Z0S A;  4A3C H;  1MJC A;  5GAE C;  1YHB A;  1K73 C;  4BBR H;  1G51 A;  1N36 L;  4YCW A;  4X64 L;  1Q1B A;  1Q8K A;  4C3I H;  5C4J H;  3F1Z A;  3PO2 G;  1NE3 A;  4JI2 L;  3PUV A;  3CCE A;  1Q1E A;  4H02 A;  4YY3 L;  4OO1 I;  1VQ5 A;  3CCQ A;  4X62 Q;  1NMG A;  1YJW A;  2UXB L;  3PUW A;  2AWN A;  4EX5 A;  4POF A;  1IBL L;  2B63 H;  1HZ9 A;  2NZH A;  3K7A H;  3I4N G;  5IT9 c;  3JAM c;  5GAG C;  4P73 A;  3CCM A;  3IRB A;  4GKK L;  4IJL A;  2F52 A;  2JQO A;  1SN8 A;  5IP7 H;  1C7Y A;  1XNR L;  5FLM G;  1RIP A;  1G6P A;  1BVS A;  3HOU H;  3PCO B;  3CCJ A;  3CCS A;  4HJ5 A;  4LF7 Q;  4O0A A;  3GTJ H;  1XMQ Q;  1I50 H;  2IHE A;  2IX0 A;  2ES2 A;  4LFB Q;  1D8L A;  1HNZ Q;  2JA5 H;  2R7Z H;  4IO9 A;  1P16 A;  1I5F A;  4BXX H;  1L1O B;  5GAH C;  1HZB A;  1TXY A;  4AYB G;  3FP9 A;  4RMF A;  3J80 c;  1PA6 A;  1KQS A;  3HOW H;  4BA2 I;  1VQ4 A;  4JYA Q;  4UP9 A;  4P74 A;  3GTP H;  1HNW Q;  2R93 G;  3S14 H;  2AKW B;  3OTO Q;  4A3K G;  2MNA A;  1SFO H;  4GNX A;  2F4V Q;  4O2D A;  4C2M H;  1XMO Q;  4A3B G;  3M4Q A;  2AHO B;  4GKJ L;  1PVO A;  1WFQ A;  2C35 B;  2FXQ A;  1HNX L;  1EFW A;  1TWA H;  4NPS A;  1HJP A;  5BR8 Q;  3T1Y Q;  1PH2 A;  4IOA A;  4DV5 L;  4DV4 Q;  5JJI A;  1Q7Y C;  5IY0 A;  1Y1V G;  3S24 A;  3AQQ A;  2YTY A;  2KBN A;  2YYZ A;  4PZ7 A;  2D0P A;  2NZO A;  1YI2 A;  4MTN A;  4P75 A;  2ZTC A;  2KHJ A;  3PUY A;  1YEZ A;  1NY4 A;  2B3G A;  5DLQ E;  4DR3 L;  1FGU A;  3S1R H;  4YWM A;  3RN2 A;  4WJ4 A;  1E3P A;  1VQC A;  1I3Q H;  5IYD G;  1IBM Q;  5ELN A;  4K0K Q;  1XJV A;  1PH5 A;  2EQS A;  4IPD A;  4X62 L;  1NMF A;  1SMX A;  2NVY H;  3I2Z A;  4A3F G;  4B3M L;  2VUM G;  3F8T A;  1KXL A;  2MO0 A;  1L1O A;  4A3I G;  3UDG A;  4DR6 L;  1CKN B;  4QGU A;  3KDF A;  3KJO A;  2ALY B;  1PYB A;  3PGZ A;  1MKH A;  2RCN A;  3KF8 B;  3J81 j;  1EIF A;  5EAY A;  3VDY A;  4X64 Q;  1EQQ A;  1HZA A;  4LW1 A;  5IYB G;  4JI2 Q;  4LF7 L;  3F2C A;  2UXD Q;  4LFB L;  3AFP A;  3HFZ B;  4APV A;  5FLM H;  2RF4 A;  5M3M G;  3A0J A;  3L2P A;  1HNZ L;  4LF6 Q;  4PG3 A;  4DR4 Q;  1A0I A;  4OWX B;  1IZ6 A;  4DUZ L;  4LF9 L;  3HKZ G;  1EOV A;  4QQB X;  4JYA L;  2K50 A;  4HIM A;  5LMU Q;  4L5Q A;  1YHQ A;  1Q12 A;  4KHZ A;  4AYB E;  5M5X H;  1JMC A;  1A63 A;  1QVG A;  2UU9 Q;  4GKK Q;  4DR5 Q;  1Y1W G;  1T9H A;  4HIO A;  1PV4 A;  1L2F A;  2F4V L;  2PI2 A;  1XMO L;  1CSQ A;  1WCM G;  2ZJP A;  1UE7 A;  2RHQ B;  3DM3 A;  1Q86 C;  1KC8 C;  2OCE A;  4A3B H;  1HR0 Q;  5BR8 L;  3T1Y L;  4DK3 C;  1E7Z A;  2LXK A;  4J15 A;  1PH3 A;  2E5L L;  2UUC Q;  4GLX A;  1UE6 A;  1M1K C;  3GD7 A;  5JEA J;  3W1B A;  1V1Q A;  1KIX A;  3H15 A;  2NN6 I;  1VQB A;  4DKA C;  1X55 A;  3S2H H;  1L1O C;  1FVI A;  1CKN A;  1KAW A;  3ER0 A;  2Q2I A;  1KHI A;  3I56 A;  4JI5 Q;  3RZD H;  4JI4 Q;  1EUJ A;  1P8L A;  3G48 A;  1FJG Q;  2Q2H A;  5C3E G;  1IBK L;  1IBM L;  3STB C;  1VQ8 A;  2HHH L;  4K0K L;  5GQO A;  1Y14 B;  4QJF A;  1OXS C;  4GN3 B;  4MNO A;  4LF5 Q;  3GTL H;  4LFC Q;  3PO3 G;  3NEN A;  3TRZ A;  4DV0 Q;  2LXJ A;  1K8A C;  2KCM A;  1VQF A;  1OXT A;  1GD7 A;  4LF8 L;  5LMN Q;  5K36 G;  1JJ2 A;  4BBS G;  4A75 A;  3KOJ A;  4A3I H;  1SR3 A;  1H95 A;  4GNX B;  4DR3 Q;  1VQ6 A;  1K83 H;  4JBM A;  2VZA A;  1VQG A;  3GTG H;  2UXD L;  2Y0S G;  4A3L G;  3M85 A;  3HKS A;  3CPF A;  3M4P A;  4P71 A;  4YHH Q;  1HR0 W;  3G6E A;  4DAY B;  1EIY B;  4LF6 L;  4FDB A;  1WJJ A;  4R4C A;  4P72 A;  4X66 Q;  4DR4 L;  4B3M Q;  3I7F A;  1B70 B;  4GS3 A;  5M3M H;  3CMA A;  1QZG A;  3GTO H;  5GRO A;  4A3E H;  3TS2 A;  1QVF A;  2PI2 E;  4DR6 Q;  5LMU L;  3HKZ E;  2AWO A;  3RNU A;  2JK8 A;  2R92 G;  2UU9 L;  2CWA A;  1W3S A;  4DR5 L;  3I4M G;  1GVP A;  4MZ9 A;  2VY3 A;  2GVB A;  1N9W A;  1LTL A;  4PZ8 A;  4DR1 Q;  1K8G A;  1ASZ A;  4HJA A;  1VQM A;  1Y1W H;  1X54 A;  1TWG H;  3M9B A;  3FKI G;  3K81 C;  3L0O A;  3UDI A;  3HOV G;  3GTK H;  1HR0 L;  4LF4 L;  3H3V H;  2UUC L;  2IY5 B;  4DUZ Q;  4LF9 Q;  4JC0 A;  5FJ8 G;  4YCU A;  3AEV A;  2ZM6 Q;  1PH7 A;  1J5E L;  3KDF B;  2NVX H; 
#chains in the Genus database with same CATH topology
 3HOY G;  4DV6 Q;  5CYU A;  4X6A H;  1JOK A;  4RFB A;  4ZYS A;  4Q5V A;  1D7Q A;  1GUS A;  3M3Y H;  1LT5 D;  5FKA C;  2E5L Q;  1GHK A;  1TWC B;  4XT1 B;  4XYO A;  5IP9 G;  4IFD J;  3NUC A;  3PO3 H;  5LMN L;  2K75 A;  1I6V C;  1KRS A;  2JA6 G;  2A74 C;  3K8A A;  1SLJ A;  4CHT B;  4A3G B;  5JJZ A;  1E1T A;  2HHH Q;  1VQA A;  3BYY B;  4YHH L;  1IYJ B;  2Y0S E;  2H1E A;  4J6H A;  4DNR B;  1PHJ A;  5AFW A;  2F3W A;  4LF8 Q;  5E7N A;  1ZYR D;  1J6Q A;  2VQE Q;  3A5U A;  5CV9 A;  1CKO A;  4DR1 L;  4LUZ A;  2FMM A;  3DEO A;  4GNX C;  1EWI A;  1KRT A;  1PH8 A;  3F2D A;  3CXC A;  2JE6 I;  1TVX A;  4XXE A;  1S40 A;  4LWC A;  3PUX A;  4F8M A;  2ZM6 L;  4A3C G;  1VQE A;  4A3G G;  2WAC A;  2MQH A;  4HIK A;  1KD1 C;  4WRD A;  5CMD A;  3OWE B;  2HQL A;  2QEX A;  2WII B;  1QWY A;  1S5C D;  4QMG A;  4JOI A;  2BDO A;  4A3K H;  3BVM A;  5CGK A;  4XQN A;  4X3U A;  3BVZ A;  4HR7 B;  2MHV A;  1MJE A;  3SK5 A;  4OHJ A;  2IHF A;  5KNB A;  2PPB C;  5DM7 3;  3RR5 A;  1ESF A;  4DR2 Q;  2A68 C;  5LL6 X;  3KLS X;  1C48 A;  1SYF A;  2Z4H A;  3L7Z C;  1ILP A;  3J81 c;  2EY6 A;  1LM0 A;  1JWM D;  4R8N A;  3KYH C;  5JPN C;  4FP5 D;  5ELE A;  1O7I A;  4Y7N B;  5BN3 A;  5I6W A;  2YTX A;  4GN5 A;  4LJZ C;  1XTC D;  4NP5 A;  5BN5 A;  1VMC A;  1I94 L;  4H13 C;  2EXD A;  4EGV A;  1EY9 A;  4B3R L;  5C3W A;  3VR6 A;  2AUJ D;  2PCF B;  3B6Y A;  4GLV B;  2RDG A;  1BKB A;  3BDO A;  4R8I A;  1A2U A;  1N8R C;  3MZ5 A;  2P5Z X;  3FEW X;  4K5X A;  2XTI A;  3ULJ A;  4NXN L;  3O13 A;  1F2M A;  4IPC A;  1TWH H;  4LFA Q;  2XWJ B;  5M5X B;  5AJ3 L;  2L5T A;  1B4O A;  1WCM H;  4C3H H;  3PF4 A;  1UNS A;  3E0J A;  3NBH B;  4JV5 L;  1V1P B;  4GZY C;  1YVC A;  1VQI A;  5C6A A;  3CW2 C;  3S2H B;  1E2Z A;  4L5S A;  4GOP A;  2PZT A;  3DWP A;  3S1Q H;  1PFB A;  2E2I H;  2K5W A;  1HZC A;  3SGI A;  3NK9 A;  4DV2 Q;  1TS3 A;  5C4X B;  3ZJY C;  1EIG A;  4KK7 A;  4WJ3 M;  1U4L A;  4HMI A;  3H0G B;  4RKB A;  1CZG A;  3Q8D A;  4DR7 L;  3UDX A;  1KDC A;  3U4V A;  1XPO A;  3MXU A;  4X65 Q;  1SE8 A;  3D6C A;  3TN2 A;  5C44 H;  1AW7 A;  1PXU A;  1GO3 E;  3P20 A;  3SEB A;  3VA7 A;  5C4J B;  1AEX A;  1PTO D;  4O1N A;  1QUQ B;  4AQY Q;  3CRK C;  2KHS A;  2EDG A;  3CPW A;  4OO1 H;  1DOM A;  1ZKO A;  1EZ8 A;  3K80 C;  1S72 A;  5C4X G;  2RDF A;  3GTO B;  3K7A B;  1KNA A;  1DYQ A;  5EBC A;  4BY7 H;  3GTM H;  2NVQ H;  3H0G G;  1G6Z A;  4FO2 A;  2CHB D;  2B2Y A;  3S1N H;  5HY6 A;  4TKO B;  5J1Z A;  1QCB D;  4ALP A;  5CV4 A;  2A68 D;  2H5X A;  2HIX A;  3OIP A;  1LV9 A;  2XIW A;  4E6I A;  4HN7 A;  1C0A A;  2HDM A;  2HT1 A;  1IYU A;  4JI0 L;  1ENC A;  3STB D;  1STE A;  3HOY H;  4A93 H;  3HOW B;  2F0L A;  4B3S L;  3GTP B;  2XN9 C;  1OTC A;  3S15 B;  3RLF A;  4QY7 A;  4YIJ A;  2B2U C;  4DXF A;  1WI5 A;  2D2C C;  3MVV A;  2N3S A;  3I55 A;  1GKH A;  1KLU D;  1IBL Q;  5JJL A;  2LKV A;  1F9R A;  5IP7 G;  2JXM B;  5C0X I;  2JA6 H;  1XPU A;  4KKU A;  3BDC A;  2KJX A;  4LK1 C;  3K5L A;  4KHP L;  4A3M H;  4R4Q A;  1EIH A;  1X6O A;  3HOW G;  3MXN A;  2X69 A;  1EY7 A;  4ZK9 B;  1SSO A;  2X6L A;  5IGE A;  2XWB B;  3QJY A;  1U4M A;  1LT3 D;  3SXH A;  4KD4 A;  3PUZ A;  2EVB A;  4TRD A;  1B50 A;  3CCU A;  1K28 A;  1PTO F;  4UDU C;  4P2C B;  1FL0 A;  4U67 3;  4O42 A;  1HNX Q;  2IX1 A;  1VCI A;  2DGY A;  1DGS A;  1PLF A;  2E75 C;  1Q3L A;  3EFX D;  4A3C H;  1DZ1 A;  3M7G A;  1YHB A;  1K73 C;  4H7B A;  3G7L A;  5KNC A;  2Q8R E;  2F0G A;  3F1Z A;  3M4Y A;  3PUV A;  2VB2 X;  4H02 A;  1VQ5 A;  1GUO A;  2CW0 C;  2LMC B;  1DM0 B;  2UXB L;  2K1B A;  1EYA A;  3FDT A;  4DNT B;  3R2I A;  2M00 A;  2B63 H;  5GAG C;  3IRB A;  2RSN A;  2PO4 A;  1C7Y A;  3S1M B;  1G6P A;  3PCO B;  4HJ5 A;  3CCS A;  1Y1V B;  2B2T A;  2ES2 A;  2IX0 A;  3TDQ A;  4FXG C;  2A5H A;  1ICW A;  4IO9 A;  1TXY A;  1CA6 A;  3FP9 A;  1S4Z A;  1O7L A;  3S14 H;  1CA5 A;  3OTO Q;  1CI3 M;  3NXW A;  1XYI A;  2F4V Q;  1TS2 A;  4OIJ A;  4C2M H;  1XMO Q;  3M4Q A;  4GKJ L;  3ERQ A;  1K83 B;  5HGT A;  2FJ2 A;  2MUY A;  4NPS A;  1HJP A;  4KY5 A;  5BR8 Q;  4HSV A;  5EPL A;  2AQ3 B;  3IFT A;  1TWF B;  1Y1V G;  2YTY A;  4PZ7 A;  3IAY A;  1W6J A;  1YI2 A;  2L0C A;  3FRP B;  4MTN A;  2KHJ A;  1YEZ A;  3HKZ B;  1FGU A;  4LMQ D;  4YWM A;  4WJ4 A;  1VQC A;  2HUG A;  1I3Q H;  2ICI A;  3TP7 A;  5IYD G;  1IBM Q;  4G7O C;  4DF7 A;  1B44 D;  1NMF A;  2A69 D;  1NAP A;  3J7Y W;  4PNY A;  3R8B A;  2A6H C;  3UDG A;  1GUT A;  3ITP A;  1Y8P B;  2EPB A;  4QGU A;  1PYB A;  1MKH A;  3FPP A;  3KF8 B;  3Q0A A;  3VDY A;  4X64 Q;  1HZA A;  3BDL A;  3LX0 A;  4LFB L;  3HFZ B;  1TT2 A;  4APV A;  2RF4 A;  3A0J A;  4OWX B;  2R3Z A;  1PZK D;  2B2W A;  3HKZ G;  3M3Y B;  1RKN A;  4HIM A;  3C1F A;  4L5Q A;  2F0E A;  5M5X H;  2F1M A;  3HG9 A;  2UU9 Q;  4GKK Q;  2BE5 D;  4IN3 A;  4DR5 Q;  3PO3 B;  5M9O A;  1L2F A;  3TSS A;  3NSW A;  5E4X A;  2ZJP A;  2NTS A;  1KC8 C;  2OCE A;  4A3B H;  3T1Y L;  2SOB A;  1E7Z A;  2LXK A;  1B3A A;  1G91 A;  1UE6 A;  1M1K C;  1KIX A;  5JEA J;  2Q2U A;  3S2H H;  3H15 A;  5IOD A;  2EYO A;  1CKN A;  1KHI A;  1Z7T A;  2F0F A;  3I56 A;  3QO2 A;  1EUJ A;  1LTB D;  5A35 A;  3AMU A;  2XVS A;  1PRT F;  2Q2H A;  2HD3 A;  1IBK L;  1RHP A;  4K0K L;  1S5E D;  1STB A;  4GN3 B;  3MC0 B;  3HRZ C;  3PO3 G;  1TU2 B;  3TRZ A;  2LXJ A;  4KN4 C;  1H9K A;  3C46 A;  2PZW A;  5LMN Q;  1KDA A;  1JJ2 A;  1SR3 A;  2K04 A;  4N9P A;  1LTT D;  1UUP A;  1BOS A;  4FF2 A;  3GTG H;  4EVO A;  4FYD A;  4A3L G;  4P71 A;  1HR0 W;  4YHH Q;  3G6E A;  4DAY B;  4DR4 L;  1SJH D;  4FDB A;  4A3K B;  1GOZ A;  3GTO H;  3TS2 A;  1HA6 A;  5LMU L;  3HKZ E;  1D2B A;  1BCP D;  4ME5 A;  5ELC A;  3TZU A;  1W3S A;  1GVP A;  1WTR A;  4DR1 Q;  2GVB A;  1N9W A;  1LTL A;  1VQM A;  2QCP X;  1TWG H;  4OGQ C;  1UEA B;  1HR0 L;  3H3V H;  4DUZ Q;  4K8J A;  4JC0 A;  4ABN A;  5FJ8 G;  3AEV A;  2ZM6 Q;  2Q8I B;  2KA7 A;  1STA A;  2NVX H;  3SK8 A;  1V43 A;  2HQE A;  3S15 H;  4PMW A;  1IKM A;  4RWS C;  1ICF B;  3C1E A;  4LUO A;  2L12 A;  2H4O A;  1DOL A;  4PZ6 A;  4LF5 L;  1EY6 A;  1GXD C;  3CF5 A;  3DEP A;  3RUZ A;  3K6O A;  1W2B A;  1HHV A;  4EQ5 A;  2D62 A;  2MO1 A;  3J81 i;  2NBF A;  3AU7 A;  4BY1 B;  2PMZ B;  4K2L A;  4TSS A;  2XRQ D;  4G7H C;  1NSN S;  5DAU A;  3OPO A;  2ICE C;  4L5R C;  1BQQ T;  1ROD A;  4OEM B;  4R1J A;  3MA2 B;  4BWG B;  1WTQ A;  3KK7 A;  4C3I B;  1JWS D;  1TWH B;  4L8J A;  1AE2 A;  4YWK A;  2ZJR A;  3J7Z C;  2K28 A;  5ELD A;  3QB3 A;  4C3H B;  1DCZ A;  2D0O A;  1SE3 A;  3TP6 A;  5FLX c;  1CFM A;  1QNU A;  1LT6 D;  2BCO A;  2F0H A;  3ERO A;  2OWO A;  2R92 H;  4F87 A;  4BY1 G;  1QNK A;  4ZKC B;  5TSS A;  4B3R Q;  4JPB W;  1WD1 A;  4HID A;  3RZO H;  3OHX C;  3S1Q B;  1SE4 A;  3I91 A;  4XTC S;  2E2I B;  1WD0 A;  1JJG A;  5JVG 3;  2R7Z B;  4ZUJ A;  2I5H A;  2I5L X;  4RA8 A;  4C3I G;  2PZU A;  1STN A;  5M5W H;  4NXN Q;  1FGB D;  2L4N A;  3D0F A;  3GTQ H;  4C3H G;  2N8N A;  2CQA A;  1Q81 C;  2D5D A;  3TS0 A;  2VQF L;  3IKJ A;  4WFN 3;  5AJ3 Q;  1VQO A;  4ZAI A;  4LF4 Q;  1JIC A;  5KYI A;  5C44 B;  3GV6 A;  4OWW B;  3LWE A;  1J5E Q;  5JAV A;  3TEH B;  3S1M H;  1EQR A;  4JV5 Q;  2VS1 A;  2SNS A;  5ELB A;  1RTO A;  1Y1V H;  1ZEQ X;  3TME A;  2WAQ G;  1VQD A;  2ZXR A;  4JI8 L;  4F7X A;  1BBW A;  4R4T A;  1VQN A;  1EEF D;  1U9R A;  1LYL A;  2C5C A;  4Z9C B;  2R7Z G;  3NQI A;  3E9I A;  1BXT A;  2KHI A;  4A76 A;  4BXX G;  5M5Y H;  4JCV E;  1HA5 A;  5IYD H;  4BY7 B;  3GTM B;  2NVQ B;  1PYS B;  1R4Q B;  3OMG A;  2I0Q A;  1W6K A;  1Q46 A;  2FMC A;  2AQ1 B;  3S1N B;  5DNF A;  2TSS A;  1SRO A;  4N8F A;  5C44 G;  4DR7 Q;  2TMP A;  3T1H L;  2EOT A;  4JK1 C;  5F2D A;  1IL8 A;  1TR5 A;  4GOP B;  2K5Q A;  2VNU D;  4K5W A;  3HOY B;  1TWF H;  4A93 B;  3CCL A;  4KKT A;  2BH8 A;  4CDE C;  2LSS A;  2PMZ E;  3F2B A;  4G7Z C;  1VQL A;  4OO1 G;  1DON A;  4DV7 L;  3G4S A;  2BH2 A;  3BU2 A;  1B8A A;  2B2V C;  1NCV A;  4BY7 G;  4A3D H;  4JI3 L;  4DGZ A;  5I2Y A;  2V1C C;  1WTH A;  4ME3 A;  2JA6 B;  1HUN A;  2XGT A;  1ESR A;  4KN7 C;  1K9M C;  4JI7 L;  4A3M B;  1IW7 C;  5LMN W;  2K5V A;  5C4Z A;  2JA8 H;  4JI0 Q;  4B3T L;  3E0E A;  4A93 G;  1SRU A;  1G29 1;  1D5Z C;  3QOJ A;  5I9P A;  3I90 A;  2HCI A;  4CGY B;  2WAQ E;  2JEB I;  3RN5 A;  4B3S Q;  3NTI A;  1XNQ Q;  1RTN A;  3DUZ A;  4ZQ3 A;  1EEI D;  4OWT B;  1HXY D;  1L0W A;  1SMY D;  4KJN A;  1QZH A;  1EFI D;  3L3O C;  3K0X A;  2DY8 A;  1R9T H;  4A3M G;  1EU3 A;  1K3B C;  2BA1 A;  4H44 C;  1Z9F A;  4IPH A;  1WTX A;  1N32 Q;  4KHP Q;  2O5J C;  5KEE A;  4A3L H;  1YNJ D;  1F9P A;  5LHY 1;  1V1O A;  2WB1 G;  1FYC A;  1SDF A;  3MFG A;  2Z6K A;  3TP5 A;  1O78 A;  1GJX A;  3OIQ A;  4YWL A;  1PH1 A;  3A56 A;  2L55 A;  4NMZ A;  2UUA L;  2R6G A;  2B63 B;  2OTJ A;  2D9U A;  4J1M A;  1N33 L;  3NEM A;  5G3L D;  3OYY A;  5GAD C;  4X3T A;  4GOP C;  2F0S A;  2OQK A;  3ICE A;  2KCT A;  2F0Q A;  3M7N A;  3MXN B;  1E1O A;  3VR5 A;  2NZ1 D;  3ONA B;  2NB0 A;  1J9O A;  2ZTE A;  3IL8 A;  5FJ8 H;  3U50 C;  3EBE A;  1XXG A;  5HGQ A;  4JI1 L;  4KHV A;  2E8G A;  3HOX B;  3S14 B;  3HEJ A;  1MIU A;  2B63 G;  4C2M B;  4V19 0;  1VQH A;  1YBY A;  2UXB Q;  5IOC A;  3NTH A;  1A2T A;  4DPG A;  1KAA A;  3A8I E;  5JEA G;  3DM1 A;  2CKZ B;  3EVQ A;  2F03 A;  1NBW A;  1ET9 A;  3K57 A;  5I4D A;  4QL5 A;  2FIN B;  4ZUI A;  2QA4 A;  2EJM A;  1I3Q B;  3TP8 A;  2O4X A;  4RAU C;  3CU7 A;  2G9H D;  2EIF A;  4R4I A;  2F4I A;  2WB1 E;  3HOX G;  2ZJQ A;  4UPA A;  2EYH A;  2KUM A;  3NWT A;  2QDL A;  3I73 A;  4JI6 L;  2PQA A;  2A1A A;  1SND A;  3BZC A;  4GKJ Q;  4BY1 H;  4JBJ A;  2F0O A;  2WFW A;  3CQZ B;  5FO9 B;  4CJ2 C;  1K8O A;  1B9N A;  2A73 B;  4G57 A;  3P1H A;  1LTI D;  1AZP A;  4BBR H;  5IGB A;  1N36 L;  1EQT A;  1Q1B A;  1Q8K A;  4QUC A;  4C3I H;  5KYL A;  3PO2 G;  1NE3 A;  4AYB B;  4JI2 L;  4UAI A;  1Q1E A;  5EJW A;  4YY3 L;  3K5M A;  2K05 A;  1VF7 A;  4KMU C;  1YJW A;  1EYD A;  2AWN A;  1LAB A;  3Q24 A;  5FLX L;  3BG3 A;  4A3B B;  1PRT B;  4P73 A;  3H94 A;  2KOL A;  4RGM A;  4HTH A;  2F52 A;  1SN8 A;  3SHL A;  4DXG A;  1BVS A;  2WKD A;  4O0A A;  4LFB Q;  1YNN C;  1I50 H;  2IHE A;  3QR8 A;  1XMQ Q;  2JA5 H;  2F0I A;  2R7Z H;  1P16 A;  4BXX H;  1HZB A;  4AYB G;  4RMF A;  1VQ4 A;  2DNC A;  4P74 A;  2J7Z A;  1HNW Q;  1AP0 A;  2DN8 A;  3MTS A;  2VUM B;  3W3A A;  4GNX A;  1SNO A;  4O2D A;  2WV6 D;  1BBX C;  4A3B G;  4N9T A;  1QB5 D;  1TWA H;  4RH6 A;  3T1Y Q;  2HCC A;  1PH2 A;  3GTG B;  2EYM A;  4DV4 Q;  1H9M A;  5IY0 A;  3WOF A;  5CV8 A;  1HQR D;  4PQX A;  1IKL A;  5KIX A;  1X32 A;  4P75 A;  1AFP A;  3L9A X;  3PUY A;  4DR3 L;  1NY4 A;  3RN2 A;  1EY4 A;  1TKW B;  4RCO A;  2IJ0 A;  4K0K Q;  5D3I B;  3AB9 A;  4IPD A;  4X62 L;  4A3F G;  3HS0 C;  2VUM G;  1KXL A;  2MP1 A;  1ML0 D;  1TWG B;  4HSP A;  2FFK B;  1CKN B;  3KDF A;  5EQ0 A;  5EAY A;  5E4W C;  2NVX B;  4IUR A;  2EZV A;  5IYB G;  4LF7 L;  3E6Z X;  3L2P A;  2RDH A;  1HNZ L;  4DR4 Q;  4LF9 L;  4HCS A;  2EY5 A;  1GHJ A;  4QQB X;  5NUC A;  4JYA L;  5COY A;  5LMU Q;  1YHQ A;  4KHZ A;  4AYB E;  1PRT C;  1QVG A;  1T9H A;  1VDZ A;  4HIO A;  2PI2 A;  1FNU A;  3I72 A;  4RHR A;  1S5D D;  1UE7 A;  3D4R A;  1M8A A;  1HTP A;  1HR0 Q;  1PTO H;  2E5L L;  4J15 A;  1NR4 A;  3BZD B;  4GLX A;  3GD7 A;  3W1B A;  2F3V A;  2NN6 I;  1VQB A;  4DKA C;  2KEC A;  1KAW A;  3ER0 A;  2Q2I A;  5FLX E;  3S2D B;  4NW2 A;  2ENB A;  1A6X A;  3KLS A;  2K7V A;  1P8L A;  3DHQ A;  3K5N A;  4K6L A;  5C3E G;  2HHH L;  4IAL A;  3G6J B;  2LS0 1;  1Y14 B;  3J7A F;  1WTO A;  2R92 B;  4LF5 Q;  2OF1 A;  5ISR A;  3NPP A;  5L37 A;  1K8A C;  4LF8 L;  1OXT A;  1GD7 A;  3RZO B;  3NHH A;  3FKI B;  4A3I H;  1HUM A;  1RD9 D;  1H95 A;  3SE0 A;  1VQ6 A;  1TS5 A;  1VQG A;  2UXD L;  5CBA E;  4ODG A;  3M85 A;  3HKS A;  3CPF A;  4ULL A;  2NVT B;  1LAC A;  5M5W B;  4B3M Q;  3GTQ B;  5M3M H;  1B70 B;  3CMA A;  4RGO S;  5GRO A;  1QVF A;  4DR6 Q;  2AWO A;  4PMC A;  4A3J B;  2R92 G;  3H3V C;  2N88 A;  2OT2 A;  3A55 A;  4MZ9 A;  5J22 A;  2EJG C;  1ASZ A;  4HJA A;  5JEA H;  1X54 A;  2ZT9 C;  3FKI G;  1KDB A;  3L0O A;  3HOV G;  3GTK H;  4I7Z C;  2UUC L;  3OW7 A;  3VA5 A;  1QIL A;  1PH7 A;  2DJG C;  4KD3 A;  3HOZ B;  5M5Y B;  2B8F A;  4DR2 L;  3UDF A;  1QVC A;  3HOX H;  4TQU S;  4JI5 L;  1STH A;  4JI4 L;  1VQ7 A;  1QE6 A;  4L6T B;  1E0B A;  2QW7 A;  4A3J G;  3K5O A;  2VQF Q;  4LFC L;  3FPU B;  1HQM C;  3UE1 A;  1ASY A;  4QB4 A;  4DA2 A;  4HJ7 A;  2KCC A;  2JN4 A;  3GDE A;  4IFD I;  1H9S B;  4CJ1 B;  4JI8 Q;  1EWC A;  1I4R A;  5T1I A;  3VYU A;  1RL2 A;  4BBS H;  4R4O A;  2JP1 A;  2KCN A;  1R4P B;  2JJQ A;  3W1G A;  3SVM A;  3HOZ G;  2XRS D;  4A3D B;  3PO2 H;  4OX9 L;  1EQV A;  4X66 L;  1PFN A;  1YNX A;  2O2L D;  3DLL A;  4HJ9 A;  1G2S A;  1WVL A;  4K5V A;  2K5N A;  1V1P A;  3VYS A;  1C8C A;  1A62 A;  1YJ9 A;  2JA8 B;  2WP8 J;  3T1H Q;  3CQZ H;  5EPJ A;  2QEJ C;  5CV7 A;  1XPR A;  3A74 A;  1ENF A;  2MJ8 A;  3PSI A;  4H0L C;  2AMC B;  2C9O A;  2EYL A;  1VQ9 A;  3GTJ B;  1F9S A;  4DV7 Q;  2PNR C;  4A3D G;  1N34 L;  1CKM A;  2Z9H A;  1SJE D;  2CCZ A;  3T56 B;  5J3B A;  4JI3 Q;  4Q0F A;  1NTG A;  1O80 A;  1GM5 A;  1U5K A;  1XWE A;  1LO5 D;  1WTW A;  1MGS A;  3OW2 A;  1R9T B;  2JA7 H;  2R7F A;  1YZ6 A;  4DV2 L;  3QG1 A;  1LUZ A;  2JA8 G;  3VYR A;  4JI7 Q;  3D31 A;  3H6M A;  2O5I C;  1D6E C;  1JB3 A;  3ULP A;  2CW0 D;  3OMC A;  4ZLT F;  3TZD A;  1UE5 A;  5H1S E;  4UHV A;  5EKL A;  2DJF C;  3J7A V;  1Z6H A;  2Z6B A;  1U4R A;  3MEF A;  3U9S A;  4AQY L;  1S5F D;  4A3F H;  4KI0 A;  2VUM H;  2N49 A;  2K5H A;  3OSO A;  3FMC A;  3RMH A;  4DUY L;  2NUC A;  3BZK A;  1A15 A;  5EKI A;  1OXX K;  4KLK A;  1CZW A;  2PYK A;  2LY7 A;  2K01 A;  3TBI B;  2UXC L;  3S17 H;  5IYB H;  1UEB A;  4AH6 A;  4JG2 A;  2IWH A;  1FNW A;  3T51 B;  4HJ8 A;  2KEN A;  1G8Z D;  5EKK A;  3LGJ A;  2UUA Q;  2A6E C;  3RLO A;  1N33 Q;  1OXU A;  2EYJ A;  2R61 A;  1D1K A;  1EL0 A;  5HUR A;  1PZI D;  5C0X H;  4FXK C;  1I4X A;  1HPC A;  4BA1 I;  3D4D A;  2KQ3 A;  2F0K A;  1WOC A;  1FR3 A;  1YHA A;  1MBY A;  3DWA A;  4XDX A;  5C5L A;  3KF6 A;  2L15 A;  4JI1 Q;  1SNM A;  3D3R A;  2HIV A;  1BBU A;  4DV1 L;  2A6H D;  2ID0 A;  5C3E H;  2UUB L;  4JBK A;  3GV3 A;  2EYF A;  3Q23 A;  4FNF A;  4NB3 A;  5IYC H;  4CBV A;  2PQE A;  4RG1 A;  1O7Z A;  2LFN A;  1SNP A;  3A7A B;  3CC4 A;  4L5T A;  4NXM L;  5CR3 A;  4BBR B;  1A3V A;  3CCR A;  2YU9 H;  3F2U A;  3KBX A;  4JBW A;  4N8X 1;  1PFS A;  1SYD A;  3BJU A;  3KJP A;  3S2D H;  1JR0 D;  2Q2T A;  2CH4 A;  1JE4 A;  3ERS X;  2ASB A;  1ZXT A;  1MI2 A;  5CBE E;  1EY8 A;  4DV3 L;  3CCV A;  4K14 A;  4K8I A;  1I94 Q;  2EXZ A;  4JI6 Q;  3ULL A;  5IE8 A;  4IZ8 A;  3C2P A;  4KY6 A;  2WAQ B;  3S16 H;  2JA9 A;  3TRE A;  3FKI H;  3HOV H;  4POG A;  1BCP F;  3GO5 A;  1I50 B;  4BBR G;  2JA5 B;  4L63 B;  1C4Q A;  1MSG A;  2OQ0 A;  3I4O A;  1N36 Q;  4LAA A;  2PQA B;  3SK4 A;  5IWA L;  2NVT H;  1V9P A;  2QF7 A;  1DD2 A;  2CWP A;  4YY3 Q;  4ZCK A;  4A3J H;  1WYD A;  5M3F H;  4K2K A;  4JW0 A;  2VW9 A;  2F0J A;  2DUD A;  1TWA B;  4IUU A;  1UE1 A;  5C0X J;  2Z6K C;  5JJK A;  4YCV A;  3OTO L;  4UY8 C;  2JA5 G;  4Y52 H;  1ZYR C;  1HH2 P;  4ILW A;  3HOZ H;  1X3F A;  4EQN A;  1B3Q A;  1AH9 A;  3DWQ A;  5JOB A;  2Z1C A;  1U0L A;  1X9N A;  3VR4 A;  1NR2 A;  1BDO A;  1LTA D;  1GUG A;  3BVG A;  3I70 A;  3KF8 A;  1M90 C;  4X3S A;  2L9H A;  3K0Y A;  1RF2 D;  4JOI C;  4EQO A;  3KUP A;  3I4N B;  2F3I A;  4DNI A;  5J39 A;  2I07 B;  3EIV A;  3CKI B;  1MJC A;  5GAE C;  4C1N I;  2QKI C;  1G51 A;  1BUV T;  2OEO A;  1CHQ D;  4X64 L;  5D65 A;  2X6G A;  4DU9 A;  2RBM A;  4RGN A;  4OO1 I;  3CCQ A;  5JPM C;  4CDC C;  2R93 B;  4X62 Q;  2QIL A;  1NMG A;  3PUW A;  4EX5 A;  4POF A;  2NZH A;  1PTO B;  3I4N G;  5IT9 c;  3VR3 A;  2EE1 A;  3JAM c;  1BR9 A;  4GKK L;  4IJL A;  1XNR L;  2WB1 B;  1L0X B;  3HOU H;  3X3N A;  2RVL A;  3CCJ A;  4LF7 Q;  4C3J B;  3GTJ H;  2E2D C;  4DN4 M;  1HNZ Q;  2NTT A;  3PMF A;  4HED A;  1II3 A;  5GAH C;  2IPK D;  3A8K E;  3J80 c;  1KQS A;  1MHW C;  4BA2 I;  4JYA Q;  4UP9 A;  1EWH A;  3Q6S A;  2R93 G;  2AKW B;  1VF5 C;  2MNA A;  3E3X A;  5DEH A;  4A3I B;  1SNC A;  4WOR A;  2FXQ A;  1EFW A;  4J8Q A;  4IOA A;  1PYW D;  4DAY A;  1T5E A;  4DV5 L;  2K5D A;  1Q7Y C;  4C3J G;  3S24 A;  1EZ6 A;  1SYE A;  5JVH 3;  4U68 A;  3N52 A;  4PV1 C;  3OWF A;  5M3M B;  1X3Q A;  1H9R A;  2ZTC A;  4B9X A;  3N6R A;  5DLQ E;  2Z4I A;  3S1R H;  1E3P A;  4DK0 A;  2E2J B;  5ELN A;  4RCN A;  5IGG A;  1XJV A;  1CK1 A;  2EQS A;  2VXW A;  2NVY H;  4MHE A;  3F8T A;  4BS9 A;  3GTK B;  1L1O A;  4A3I G;  3KJO A;  2ALY B;  3PGZ A;  5KGU A;  2RCN A;  1KNE A;  2Z8L A;  3H91 A;  1OO9 B;  5BN4 A;  1A3T A;  3F2C A;  2UXD Q;  2F0D A;  3P75 A;  3AFP A;  1S5B D;  5FLM H;  3I8Z A;  5M3M G;  1D5M C;  3I4L A;  1JCK B;  4DUZ L;  4I65 A;  1PZJ D;  1EOV A;  3QOL A;  3MWY W;  1QG7 A;  2K50 A;  3NQT A;  4B08 A;  1EYC A;  1Q12 A;  1F77 A;  1JMC A;  1E2W A;  1A63 A;  1PTO C;  3MEH A;  5CC4 A;  3X3M A;  2IW3 A;  2RHQ B;  3P7J A;  3EJI A;  4BBS B;  2K33 A;  2B2Y C;  4HMJ A;  3D6W A;  4DK3 C;  2MGS A;  2UUC Q;  4OIK A;  3PO2 B;  1F2Y A;  5ELF A;  5A2Q L;  2B2V A;  2J0T D;  4JI5 Q;  5FO7 B;  4R9W A;  3RZD H;  4JI4 Q;  1CTM A;  1IW7 D;  3A7L A;  1LTS D;  3STB C;  5IIF A;  1DJR D;  2I46 A;  4FXD A;  4MIU A;  1OXS C;  3BS1 A;  4LFC Q;  3NEN A;  4M1U B;  2EYP A;  2KCM A;  1VQF A;  5K36 G;  4FF4 A;  5G3L F;  1SNQ A;  2M2L A;  4BBS G;  4A75 A;  3KOJ A;  1TQO A;  1QOH A;  1GUN A;  4JBM A;  2VZA A;  4LF6 L;  4OX9 Q;  1EIY B;  1SBB B;  4KKS A;  4R4C A;  3SDZ A;  4P72 A;  4X66 Q;  2DNE A;  4JVZ A;  2JA7 B;  1QZG A;  1F9Q A;  3D4W A;  4S3S A;  2PI2 E;  4QUF A;  2EY2 A;  2JK8 A;  3RNU A;  3NE5 B;  2CWA A;  5C3X A;  2Q8T A;  4PZ8 A;  2VY3 A;  1Y1W H;  2B39 A;  5I2X A;  3HGB A;  3K81 C;  1AN8 A;  4LF4 L;  4C1N K;  2SNM A;  1J5E L;  2E2H B;  4K6D A;  1EY0 A;  2KED A;  2CFM A;  3PIP A;  1N34 Q;  2RHS B;  3CHB D;  4A3F B;  4G4K A;  2VB3 X;  1X3E A;  2JA7 G;  1FJG L;  1LLR D;  2JYO A;  1JC7 A;  1I6H H;  4QIW B;  3S9W A;  4DV0 L;  3S17 B;  1MD2 D;  4LUV A;  4FVM A;  2K52 A;  4IUT A;  1YJN A;  1JB7 A;  1Q82 C;  3K58 A;  2CQO A;  3CC7 A;  4ZKB B;  1NJI C;  4V0B A;  4A4I A;  3R93 A;  5FOB B;  1IBK Q;  1X65 A;  2ZTD A;  2B2T C;  3CRL C;  3GQB A;  3V05 A;  3RLN A;  1B1Z A;  2K6A A;  2G9D A;  2CVR A;  2MPM A;  5CV5 A;  3Q22 A;  2AQ2 B;  1K3R A;  4DUY Q;  3I4N H;  4PMB A;  2L11 A;  1WTP A;  5A2Q E;  1CQV A;  4KV6 A;  3E9H A;  3I4M H;  1O7Y A;  1X56 A;  5ELO A;  3TQY A;  2UXC Q;  3PIO A;  2RKS A;  1JJC B;  4DAV A;  3QIA A;  2HDL A;  1AE3 A;  3UE0 A;  2JEA I;  3NTK A;  3M4O H;  4UP7 A;  1F2L A;  5C3E B;  5IGC A;  3ZYY X;  3CC2 A;  4DV6 L;  1IYV A;  2A8V A;  4C56 C;  3LWU A;  1K8M A;  1B7Y B;  3U58 A;  2R93 H;  4ID6 A;  2YV5 A;  4XIG S;  4XQQ A;  5C0X G;  1EU4 A;  1XNQ L;  1SFO B;  2BDN A;  3WWV A;  1RCV D;  1JE5 A;  4AIM A;  4DAP A;  1YIJ A;  2YU9 B;  5IP9 H;  5IT9 L;  3JAM L;  2A69 C;  2F0W A;  4C3J H;  1VS0 A;  1K0S A;  1J8I A;  2NN6 G;  3SR1 A;  3H3V I;  1BCP B;  1DXM A;  2KEE A;  3FVQ A;  3CAM A;  1N32 L;  1KL9 A;  1WTV A;  4IOC A;  1I4P A;  4DV1 Q;  1UAP A;  5IGF A;  1T5X D;  2UUB Q;  2QDB A;  5IYC G;  1XTD A;  5EBD A;  3U4Z A;  2B2W C;  3J80 L;  3S16 B;  1E24 A;  2RSO A;  1PH4 A;  4CKB A;  3HOV B;  4OXP A;  2VQE L;  1ENA A;  1YNN D;  2FHT A;  2WIN B;  4HCE A;  2CH4 W;  1V8Q A;  3KF6 B;  4QIW E;  1VQK A;  2I5M X;  4NXM Q;  1TWC H;  2AUK A;  2ATW A;  1TY2 A;  2BE5 C;  4IJH A;  4HAE A;  2PNH A;  1STG A;  1H9J A;  4GN4 B;  2QGQ A;  4OL7 A;  3EN2 A;  1Y69 U;  1VQJ A;  2OTL A;  2XNA C;  4A3G H;  5M3F B;  2VL6 A;  2MFI A;  2E2J H;  1EOT A;  3KLW A;  4DV3 Q;  2DY7 A;  2YTV A;  4GLA C;  5FK9 C;  4QF4 A;  1G2T A;  1YIT A;  2IT1 A;  2OXP A;  1I4H A;  5C4H A;  2JSO A;  5I6Y A;  1LT4 D;  3A5Z B;  3AFQ A;  2N78 A;  3CD6 A;  3KBG A;  3PIP 3;  1JT8 A;  1RDP D;  4DAM A;  1NUC A;  5IWA Q;  1CUK A;  2RQX A;  1S3O A;  3H09 A;  2F0P A;  1CT1 D;  2E76 C;  5M3F G;  4UP8 A;  3ND8 A;  1ILQ A;  3MXG A;  1PH9 A;  4CKC A;  2K4K A;  1PH6 A;  3K59 A;  3GTL B;  3W5O A;  3BYT B;  5K36 H;  3KLR A;  4IFD G;  2K14 A;  3NWS A;  5FO8 B;  1VQP A;  1KLG D;  1A3U A;  1ONL A;  2GA4 B;  4CKE A;  1BCP C;  1QJO A;  5D3D A;  1CSP A;  3MAQ A;  5KRU A;  4X3K A;  1D1I A;  2B2U A;  2GN5 A;  4TVA B;  4CDD C;  1PRT D;  1SEB D;  1K0R A;  4IPG A;  3NBH A;  5IT9 E;  3JAM E;  4A3E B;  3E5S A;  4LFA L;  1A8V A;  3J81 L;  3MXP A;  3FHW A;  4Y7N H;  3T13 A;  3NP8 A;  3PIO 3;  3HOU B;  2SEB D;  1F2Z A;  1BO0 A;  1E22 A;  1STY A;  4NDX A;  2K03 A;  2PW7 A;  3K7U C;  2PW5 A;  3EA6 A;  1HFG A;  1CQF A;  3J80 E;  3PV0 A;  1PDQ A;  2ZXO A;  1UWV A;  1SYB A;  3ND9 A;  1M4V A;  3CP0 A;  4IUP A;  1JOO A;  2GVA A;  2EY1 A;  1PFM A;  1C9O A;  1Z47 A;  5I9O A;  2G5D A;  3WDN A;  3UI2 A;  3T16 A;  3JAM i;  1XMQ L;  2ZXP A;  4A3E G;  3CME A;  3NEL A;  1QUQ A;  1IXR A;  4B3T Q;  1RJT A;  1PMR A;  3G71 A;  1HNW L;  4DK6 C;  3HOU G;  1EYG A;  3AYH B;  4X65 L;  4KJO A;  1XNR Q;  1CHP D;  3J80 i;  1IL2 A;  1ET6 A;  3RD4 A;  3SK6 A;  2E2H H;  4LNQ A;  3PF5 A;  1BNZ A;  1I4Q A;  2B29 A;  3S1R B;  2A19 A;  1Q8I A;  4OON A;  4DV4 L;  3NBI A;  1X3G A;  4OEL B;  1OXV A;  2NVY B;  2RA4 A;  1IHZ A;  4RHS A;  3OOC A;  4IUQ A;  1KTK A;  1TII D;  3MFY A;  2R7D A;  2BA0 A;  5C4X H;  1XX8 A;  2F0T A;  3KFU A;  3D8G A;  1LTR D;  1JWU D;  3H0G H;  3EQL C;  3JC6 6;  3PQI A;  2V4D A;  4DV5 Q;  2Z0S A;  3U9O A;  4KTA A;  5IGD A;  4YCW A;  4FF3 A;  3LNN A;  5C4J H;  3WOE A;  2RCF A;  4F88 A;  3VYT A;  3CCE A;  1VMP A;  2EJF C;  3URY A;  3I3C A;  1B9M A;  1IBL L;  1HZ9 A;  3K7A H;  4I7A A;  3CCM A;  4XYQ A;  5EPK A;  2JQO A;  5IP7 H;  5E1F A;  1RIP A;  2NN6 H;  5FLM G;  2NWG A;  4XQJ A;  1FD7 D;  3RZD B;  1D8L A;  4CDF C;  3J81 E;  3HZX A;  3V2T A;  1I5F A;  1L1O B;  1HTL D;  1PA6 A;  3HOW H;  1BF4 A;  4IUV A;  3W2D A;  3GTP H;  5LL6 S;  4A3K G;  1SFO H;  3A54 A;  2F0U A;  2F0N A;  5T1G A;  1PVO A;  2AHO B;  1SYG A;  1WFQ A;  2C35 B;  1Y8O B;  5K5P A;  1HNX L;  1E2V A;  2NYZ D;  3A8J E;  2E74 C;  5JJI A;  3AQQ A;  2IL8 A;  2KBN A;  2YYZ A;  2D0P A;  2NZO A;  1GUW A;  2B3G A;  1KAB A;  1FNV A;  3T4A C;  1HFN A;  1PH5 A;  1SMX A;  3I2Z A;  4B3M L;  1NNX A;  1Y1W B;  4B9W A;  5COR A;  2MO0 A;  4DR6 L;  1WCM B;  2SDF A;  1I4G A;  2WKC A;  1CM9 A;  3J81 j;  1EIF A;  1EQQ A;  1SMY C;  2XSC A;  3R3O A;  1Q90 A;  4LW1 A;  4JI2 Q;  1Y8N B;  4LF6 Q;  4PG3 A;  5KND A;  5C5M A;  1A0I A;  1IZ6 A;  4RGT A;  1TS4 A;  1L0Y B;  1I6H B;  3MHB A;  1YNJ C;  1HRJ A;  1H9S A;  2J4X A;  1Y1W G;  1SE2 A;  2M9V A;  1DOK A;  1PV4 A;  2F4V L;  2B8G A;  4IFD H;  5DM6 3;  1XMO L;  1CSQ A;  1WCM G;  5D14 A;  3DM3 A;  1Q86 C;  1SYC A;  3C3L A;  4M8A A;  5BR8 L;  1PH3 A;  4DK1 A;  2L1B A;  3DXJ C;  4ZRZ A;  4QCL A;  4KY7 A;  2A6E D;  1V1Q A;  3GP7 A;  2Y0S B;  1X55 A;  1L1O C;  2KVM A;  1FVI A;  2F0V A;  1X3P A;  3QWN A;  3DMU A;  5E3F A;  3G48 A;  4EQP A;  1FJG Q;  1IBM L;  1D5X C;  1VQ8 A;  5GQO A;  4QJF A;  4MNO A;  3GTL H;  3I4M B;  1EY5 A;  4RKL A;  4DV0 Q;  4IQZ A;  1JOR A;  3V96 A;  3VR2 A;  4FF1 A;  3IFD A;  3M4O B;  2F0M A;  4GNX B;  3R2T A;  4DR3 Q;  1K83 H;  1JQY D;  2K32 A;  3T53 B;  1JOQ A;  4MN3 A;  4NKL A;  2Y0S G;  5EGT A;  4DFA A;  3M4P A;  3J7A 5;  1B53 A;  1HCZ A;  4WJW A;  1WJJ A;  1AZQ A;  3I7F A;  4GS3 A;  1SAP A;  1SXT A;  1U4P A;  4A3E H;  1MSH A;  2IX3 A;  2UU9 L;  1LTG D;  4DR5 L;  3HP3 A;  3I4M G;  4MTK A;  1B2T A;  4CJ0 B;  1K8G A;  3M9B A;  3UDI A;  2N55 A;  5CV6 A;  2IY5 B;  4LF9 Q;  4YCU A;  2BOS A;  1TY0 A;  3KDF B;  4IUN A;  4XT3 B; 
#chains in the Genus database with same CATH homology
 3PIP A;  2CFM A;  1N34 Q;  4DR2 L;  3HOY G;  3UDF A;  2RHS B;  1V43 A;  1QVC A;  3HOX H;  4PMW A;  4DV6 Q;  3S15 H;  4TQU S;  4JI5 L;  4X6A H;  1X3E A;  4JI4 L;  1VQ7 A;  2JA7 G;  1FJG L;  4LUO A;  1D7Q A;  4PZ6 A;  4A3J G;  3M3Y H;  2VQF Q;  4LF5 L;  1I6H H;  3CF5 A;  4LFC L;  2E5L Q;  5IP9 G;  1W2B A;  4IFD J;  3UE1 A;  4EQ5 A;  2D62 A;  4DV0 L;  2MO1 A;  1ASY A;  4HJ7 A;  3J81 i;  3GDE A;  3PO3 H;  4LUV A;  4IFD I;  5LMN L;  2K52 A;  1YJN A;  1JB7 A;  2K75 A;  1KRS A;  2JA6 G;  4JI8 Q;  1Q82 C;  3K8A A;  1SLJ A;  1RL2 A;  4BBS H;  2CQO A;  4R4O A;  3CC7 A;  2JJQ A;  3W1G A;  4A4I A;  1E1T A;  1NJI C;  4L5R C;  1IBK Q;  1X65 A;  2HHH Q;  3HOZ G;  1VQA A;  2ZTD A;  3PO2 H;  4YHH L;  4R1J A;  1IYJ B;  4OX9 L;  2Y0S E;  3RLN A;  4X66 L;  3DLL A;  1YNX A;  4HJ9 A;  1PHJ A;  1AE2 A;  4YWK A;  2ZJR A;  4LF8 Q;  3J7Z C;  5FLX c;  2D0O A;  5E7N A;  1K3R A;  1J6Q A;  2VQE Q;  4DUY Q;  2K5N A;  3I4N H;  3A5U A;  1A62 A;  1YJ9 A;  1CKO A;  2WP8 J;  4LUZ A;  4DR1 L;  3T1H Q;  3CQZ H;  2OWO A;  2R92 H;  4GNX C;  3E9H A;  1EWI A;  3I4M H;  1KRT A;  4BY1 G;  1X56 A;  1XPR A;  5ELO A;  3TQY A;  1PH8 A;  2UXC Q;  4B3R Q;  3PIO A;  3F2D A;  3A74 A;  3CXC A;  3PSI A;  1JJC B;  2AMC B;  2JE6 I;  4HID A;  3RZO H;  1AE3 A;  1S40 A;  4LWC A;  3PUX A;  4XTC S;  3UE0 A;  2ZM6 L;  1VQE A;  1VQ9 A;  2JEA I;  3M4O H;  4UP7 A;  4DV7 Q;  4A3G G;  4A3D G;  1N34 L;  1CKM A;  1JJG A;  3CC2 A;  2MQH A;  4DV6 L;  4HIK A;  1KD1 C;  2A8V A;  2I5H A;  2I5L X;  2CCZ A;  5J3B A;  4JI3 Q;  2QEX A;  2HQL A;  1B7Y B;  1NTG A;  5M5W H;  1U5K A;  3U58 A;  1GM5 A;  4NXN Q;  4JOI A;  2R93 H;  3D0F A;  2YV5 A;  4A3K H;  4XIG S;  3GTQ H;  5C0X G;  3OW2 A;  2N8N A;  1Q81 C;  1XNQ L;  3TS0 A;  2R7F A;  2VQF L;  1YZ6 A;  5AJ3 Q;  1VQO A;  2JA7 H;  4LF4 Q;  4DV2 L;  1MJE A;  1LUZ A;  2JA8 G;  4JI7 Q;  4OWW B;  3WWV A;  4AIM A;  1JE5 A;  1J5E Q;  1YIJ A;  2IHF A;  3TEH B;  3S1M H;  1EQR A;  5IP9 H;  4JV5 Q;  2VS1 A;  3D31 A;  3RR5 A;  4DR2 Q;  4C3J H;  1Y1V H;  1VS0 A;  2WAQ G;  1VQD A;  4JI8 L;  2NN6 G;  1BBW A;  4R4T A;  3ULP A;  1VQN A;  3H3V I;  1UE5 A;  5H1S E;  3CAM A;  3L7Z C;  1KL9 A;  1LYL A;  1N32 L;  3J81 c;  4IOC A;  2R7Z G;  4DV1 Q;  3E9I A;  1LM0 A;  5IYD H;  2KHI A;  4A76 A;  4BXX G;  5M5Y H;  4JCV E;  2UUB Q;  3KYH C;  1XTD A;  5IYC G;  3U4Z A;  3MEF A;  1PYS B;  4AQY L;  4A3F H;  1O7I A;  4KI0 A;  2I0Q A;  2VUM H;  1E24 A;  2N49 A;  1Q46 A;  2YTX A;  4GN5 A;  1PH4 A;  2K5H A;  4OXP A;  2VQE L;  4DUY L;  1SRO A;  3BZK A;  5C44 G;  4DR7 Q;  1OXX K;  3T1H L;  4KLK A;  3KF6 B;  1I94 L;  4QIW E;  2EXD A;  4GOP B;  1VQK A;  2VNU D;  2I5M X;  4NXM Q;  1TWC H;  2ATW A;  2UXC L;  3S17 H;  4B3R L;  1TWF H;  5IYB H;  4IJH A;  1UEB A;  3CCL A;  3B6Y A;  4AH6 A;  2PNH A;  2BH8 A;  4GLV B;  4GN4 B;  4JG2 A;  2LSS A;  2PMZ E;  2QGQ A;  3F2B A;  1VQL A;  4OO1 G;  1BKB A;  3EN2 A;  4DV7 L;  1VQJ A;  3G4S A;  1N8R C;  2OTL A;  4HJ8 A;  2BH2 A;  4OX9 Q;  4A3G H;  2KEN A;  3BU2 A;  2VL6 A;  1B8A A;  2MFI A;  2E2J H;  4BY7 G;  4A3D H;  3KLW A;  4JI3 L;  2XTI A;  3LGJ A;  4DV3 Q;  2YTV A;  3ULJ A;  2UUA Q;  4NXN L;  4GLA C;  4IPC A;  3RLO A;  1N33 Q;  1TWH H;  1OXU A;  4LFA Q;  1YIT A;  2IT1 A;  2V1C C;  4ME3 A;  5AJ3 L;  1WCM H;  2XGT A;  3A5Z B;  4C3H H;  3PF4 A;  3AFQ A;  1K9M C;  4JI7 L;  4BA1 I;  5LMN W;  3NBH B;  4JV5 L;  2K5V A;  2JA8 H;  2N78 A;  4JI0 Q;  3CD6 A;  1WOC A;  3E0E A;  2Q2U A;  1SRU A;  4B3T L;  4A93 G;  1G29 1;  1YVC A;  1YHA A;  1VQI A;  1JT8 A;  4DAM A;  3CW2 C;  2WAQ E;  2JEB I;  1CUK A;  5IWA Q;  4L5S A;  1S3O A;  3RN5 A;  3KF6 A;  2L15 A;  4JI1 Q;  4GOP A;  4B3S Q;  3S1Q H;  2E2I H;  2HIV A;  1BBU A;  4DV1 L;  1XNQ Q;  5M3F G;  1HZC A;  2ID0 A;  4UP8 A;  3SGI A;  5C3E H;  4DV2 Q;  2UUB L;  4JBK A;  3ZJY C;  4OWT B;  1L0W A;  1PH9 A;  2K4K A;  1QZH A;  4NB3 A;  4WJ3 M;  5IYC H;  1PH6 A;  3K0X A;  3W5O A;  3Q8D A;  4RG1 A;  4DR7 L;  1R9T H;  4IFD G;  3UDX A;  3CC4 A;  2K14 A;  3U4V A;  4L5T A;  4A3M G;  1XPO A;  4X65 Q;  1SE8 A;  2BA1 A;  1VQP A;  5C44 H;  4NXM L;  1Z9F A;  4IPH A;  1N32 Q;  3CCR A;  1GO3 E;  4KHP Q;  1CSP A;  2YU9 H;  4A3C G;  4JBW A;  4A3L H;  2GN5 A;  1PFS A;  4TVA B;  3BJU A;  3KJP A;  3S2D H;  1QUQ B;  4AQY Q;  2WB1 G;  1K0R A;  2Q2T A;  4IPG A;  3CPW A;  3ERS X;  2Z6K A;  2ASB A;  3K80 C;  4YWL A;  1S72 A;  1PH1 A;  5C4X G;  4DV3 L;  2UUA L;  2R6G A;  3CCV A;  3J7A 5;  2OTJ A;  1I94 Q;  1N33 L;  3NEM A;  4JI6 Q;  4BY7 H;  3ULL A;  3OYY A;  1A8V A;  5GAD C;  4LFA L;  3GTM H;  4GOP C;  2NVQ H;  3H0G G;  5IE8 A;  3FHW A;  4Y7N H;  2OQK A;  3ICE A;  3S16 H;  2JA9 A;  2KCT A;  3TRE A;  3M7N A;  3S1N H;  3FKI H;  3MXN B;  5HY6 A;  3HOV H;  1E1O A;  1E22 A;  2HIX A;  2H5X A;  4ALP A;  3GO5 A;  4POG A;  1C0A A;  3K7U C;  2HT1 A;  4BBR G;  4JI0 L;  5FJ8 H;  2ZTE A;  3U50 C;  3PV0 A;  3STB D;  3EBE A;  1UWV A;  3HOY H;  2OQ0 A;  3I4O A;  5HGQ A;  1N36 Q;  2NVT H;  2PQA B;  3CP0 A;  5IWA L;  4A93 H;  4JI1 L;  4B3S L;  2E8G A;  2GVA A;  1Z47 A;  1C9O A;  1V9P A;  3JAM i;  3RLF A;  1XMQ L;  1OTC A;  2CWP A;  4YY3 Q;  4QY7 A;  1MIU A;  4A3J H;  4A3E G;  2B63 G;  1WI5 A;  1WYD A;  3CME A;  1VQH A;  5M3F H;  1YBY A;  3NEL A;  2VW9 A;  2UXB Q;  1QUQ A;  2N3S A;  2DUD A;  3I55 A;  1GKH A;  1IBL Q;  1IXR A;  4B3T Q;  5JJL A;  4DPG A;  1UE1 A;  5IP7 G;  5C0X J;  2Z6K C;  3G71 A;  5JJK A;  1HNW L;  4DK6 C;  3HOU G;  1EYG A;  4YCV A;  3AYH B;  4X65 L;  5C0X I;  5JEA G;  3OTO L;  2JA6 H;  1XNR Q;  1XPU A;  3J80 i;  2CKZ B;  1IL2 A;  4KHP L;  4UY8 C;  2JA5 G;  4A3M H;  4Y52 H;  1NBW A;  1HH2 P;  2E2H H;  4QL5 A;  4R4Q A;  4LNQ A;  3PF5 A;  3HOZ H;  1X6O A;  2B29 A;  1X3F A;  2QA4 A;  3HOW G;  2A19 A;  1AH9 A;  4DV4 L;  4OON A;  1X3G A;  1U0L A;  2EIF A;  4R4I A;  1X9N A;  2WB1 E;  3HOX G;  1OXV A;  2ZJQ A;  4UPA A;  1M90 C;  2R7D A;  2BA0 A;  4JI6 L;  2PQA A;  5C4X H;  3PUZ A;  2A1A A;  4JOI C;  3BZC A;  3CCU A;  4GKJ Q;  1FL0 A;  4BY1 H;  4JBJ A;  3KFU A;  2F3I A;  1HNX Q;  2WFW A;  3H0G H;  4DNI A;  3JC6 6;  2IX1 A;  1VCI A;  2DGY A;  1DGS A;  3EIV A;  4DV5 Q;  2Z0S A;  4A3C H;  1MJC A;  5GAE C;  1YHB A;  1K73 C;  4BBR H;  1G51 A;  1N36 L;  4YCW A;  4X64 L;  1Q1B A;  1Q8K A;  4C3I H;  5C4J H;  3F1Z A;  3PO2 G;  1NE3 A;  4JI2 L;  3PUV A;  3CCE A;  1Q1E A;  4H02 A;  4YY3 L;  4OO1 I;  1VQ5 A;  3CCQ A;  4X62 Q;  1NMG A;  1YJW A;  2UXB L;  3PUW A;  2AWN A;  4EX5 A;  4POF A;  1IBL L;  2B63 H;  1HZ9 A;  2NZH A;  3K7A H;  3I4N G;  5IT9 c;  3JAM c;  5GAG C;  4P73 A;  3CCM A;  3IRB A;  4GKK L;  4IJL A;  2F52 A;  2JQO A;  1SN8 A;  5IP7 H;  1C7Y A;  1XNR L;  5FLM G;  1RIP A;  1G6P A;  1BVS A;  3HOU H;  3PCO B;  3CCJ A;  3CCS A;  4HJ5 A;  4LF7 Q;  4O0A A;  3GTJ H;  1XMQ Q;  1I50 H;  2IHE A;  2IX0 A;  2ES2 A;  4LFB Q;  1D8L A;  1HNZ Q;  2JA5 H;  2R7Z H;  4IO9 A;  1P16 A;  1I5F A;  4BXX H;  1L1O B;  5GAH C;  1HZB A;  1TXY A;  4AYB G;  3FP9 A;  4RMF A;  3J80 c;  1PA6 A;  1KQS A;  3HOW H;  4BA2 I;  1VQ4 A;  4JYA Q;  4UP9 A;  4P74 A;  3GTP H;  1HNW Q;  2R93 G;  3S14 H;  2AKW B;  3OTO Q;  4A3K G;  2MNA A;  1SFO H;  4GNX A;  2F4V Q;  4O2D A;  4C2M H;  1XMO Q;  4A3B G;  3M4Q A;  2AHO B;  4GKJ L;  1PVO A;  1WFQ A;  2C35 B;  2FXQ A;  1HNX L;  1EFW A;  1TWA H;  4NPS A;  1HJP A;  5BR8 Q;  3T1Y Q;  1PH2 A;  4IOA A;  4DV5 L;  4DV4 Q;  5JJI A;  1Q7Y C;  5IY0 A;  1Y1V G;  3S24 A;  3AQQ A;  2YTY A;  2KBN A;  2YYZ A;  4PZ7 A;  2D0P A;  2NZO A;  1YI2 A;  4MTN A;  4P75 A;  2ZTC A;  2KHJ A;  3PUY A;  1YEZ A;  1NY4 A;  2B3G A;  5DLQ E;  4DR3 L;  1FGU A;  3S1R H;  4YWM A;  3RN2 A;  4WJ4 A;  1E3P A;  1VQC A;  1I3Q H;  5IYD G;  1IBM Q;  5ELN A;  4K0K Q;  1XJV A;  1PH5 A;  2EQS A;  4IPD A;  4X62 L;  1NMF A;  1SMX A;  2NVY H;  3I2Z A;  4A3F G;  4B3M L;  2VUM G;  3F8T A;  1KXL A;  2MO0 A;  1L1O A;  4A3I G;  3UDG A;  4DR6 L;  1CKN B;  4QGU A;  3KDF A;  3KJO A;  2ALY B;  1PYB A;  3PGZ A;  1MKH A;  2RCN A;  3KF8 B;  3J81 j;  1EIF A;  5EAY A;  3VDY A;  4X64 Q;  1EQQ A;  1HZA A;  4LW1 A;  5IYB G;  4JI2 Q;  4LF7 L;  3F2C A;  2UXD Q;  4LFB L;  3AFP A;  3HFZ B;  4APV A;  5FLM H;  2RF4 A;  5M3M G;  3A0J A;  3L2P A;  1HNZ L;  4LF6 Q;  4PG3 A;  4DR4 Q;  1A0I A;  4OWX B;  1IZ6 A;  4DUZ L;  4LF9 L;  3HKZ G;  1EOV A;  4QQB X;  4JYA L;  2K50 A;  4HIM A;  5LMU Q;  4L5Q A;  1YHQ A;  1Q12 A;  4KHZ A;  4AYB E;  5M5X H;  1JMC A;  1A63 A;  1QVG A;  2UU9 Q;  4GKK Q;  4DR5 Q;  1Y1W G;  1T9H A;  4HIO A;  1PV4 A;  1L2F A;  2F4V L;  2PI2 A;  1XMO L;  1CSQ A;  1WCM G;  2ZJP A;  1UE7 A;  2RHQ B;  3DM3 A;  1Q86 C;  1KC8 C;  2OCE A;  4A3B H;  1HR0 Q;  5BR8 L;  3T1Y L;  4DK3 C;  1E7Z A;  2LXK A;  4J15 A;  1PH3 A;  2E5L L;  2UUC Q;  4GLX A;  1UE6 A;  1M1K C;  3GD7 A;  5JEA J;  3W1B A;  1V1Q A;  1KIX A;  3H15 A;  2NN6 I;  1VQB A;  4DKA C;  1X55 A;  3S2H H;  1L1O C;  1FVI A;  1CKN A;  1KAW A;  3ER0 A;  2Q2I A;  1KHI A;  3I56 A;  4JI5 Q;  3RZD H;  4JI4 Q;  1EUJ A;  1P8L A;  3G48 A;  1FJG Q;  2Q2H A;  5C3E G;  1IBK L;  1IBM L;  3STB C;  1VQ8 A;  2HHH L;  4K0K L;  5GQO A;  1Y14 B;  4QJF A;  1OXS C;  4GN3 B;  4MNO A;  4LF5 Q;  3GTL H;  4LFC Q;  3PO3 G;  3NEN A;  3TRZ A;  4DV0 Q;  2LXJ A;  1K8A C;  2KCM A;  1VQF A;  1OXT A;  1GD7 A;  4LF8 L;  5LMN Q;  5K36 G;  1JJ2 A;  4BBS G;  4A75 A;  3KOJ A;  4A3I H;  1SR3 A;  1H95 A;  4GNX B;  4DR3 Q;  1VQ6 A;  1K83 H;  4JBM A;  2VZA A;  1VQG A;  3GTG H;  2UXD L;  2Y0S G;  4A3L G;  3M85 A;  3HKS A;  3CPF A;  3M4P A;  4P71 A;  4YHH Q;  1HR0 W;  3G6E A;  4DAY B;  1EIY B;  4LF6 L;  4FDB A;  1WJJ A;  4R4C A;  4P72 A;  4X66 Q;  4DR4 L;  4B3M Q;  3I7F A;  1B70 B;  4GS3 A;  5M3M H;  3CMA A;  1QZG A;  3GTO H;  5GRO A;  4A3E H;  3TS2 A;  1QVF A;  2PI2 E;  4DR6 Q;  5LMU L;  3HKZ E;  2AWO A;  3RNU A;  2JK8 A;  2R92 G;  2UU9 L;  2CWA A;  1W3S A;  4DR5 L;  3I4M G;  1GVP A;  4MZ9 A;  2VY3 A;  2GVB A;  1N9W A;  1LTL A;  4PZ8 A;  4DR1 Q;  1K8G A;  1ASZ A;  4HJA A;  1VQM A;  1Y1W H;  1X54 A;  1TWG H;  3M9B A;  3FKI G;  3K81 C;  3L0O A;  3UDI A;  3HOV G;  3GTK H;  1HR0 L;  4LF4 L;  3H3V H;  2UUC L;  2IY5 B;  4DUZ Q;  4LF9 Q;  4JC0 A;  5FJ8 G;  4YCU A;  3AEV A;  2ZM6 Q;  1PH7 A;  1J5E L;  3KDF B;  2NVX H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...