1EUJA

A novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE 2
publication title A novel anti-tumor cytokine contains an RNA binding motif present in aminoacyl-tRNA synthetases.
pubmed rcsb
source organism Homo sapiens
total genus 37
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eujA00
3AFPA 3EBEA 4RG1A 1RL2A 2Q2IA 1XMOL 1S72A 4A3DG 1G51A 2Z6KC 3HFZB 3KYHC 3TREA 1QUQA 4KHPQ 1D7QA 2IX1A 3PF4A 1X55A 1NMFA 1Q46A 4PMWA 1HZAA 1IBKQ 1OTCA 4HJ5A 4OONA 4P73A 4DUYL 4A3JG 1KD1C 4JI6L 4L5QA 5IT9c 5JJLA 1A8VA 5EAYA 1VQLA 5DLQE 1XNRQ 2ZJQA 2AHOB 1EQRA 4HJ9A 3K80C 4A3KH 3HOWH 3S15H 4A3BH 2UUBL 4A3FH 1EIFA 4OO1I 1K83H 2K5VA 1O7IA 1NBWA 2E2IH 1PH5A 4J15A 4DK6C 2N49A 1YZ6A 4HJ8A 4POGA 4KHPL 3CC7A 3H0GG 1X56A 1IBKL 3TQYA 2ZJPA 3GTJH 1EOVA 4GKKL 1DGSA 3HOYH 1KL9A 3KF6A 3F2BA 2RCNA 3RLNA 4BBRH 1X9NA 1P8LA 2Q2UA 3J81c 3HOXH 3A5UA 1RIPA 5IP9G 3CC2A 3J81i 1UE7A 2ASBA 3GTQH 3NENA 4QGUA 1VQ5A 1K3RA 1XPUA 4R4OA 2JA5H 4IFDI 1NY4A 1YHBA 4DKAC 1N9WA 2MFIA 1PHJA 1K73C 3HOZG 2JA8H 1SROA 5M3FH 3BJUA 1B7YB 4LF7Q 1TWGH 1VQFA 4GNXA 4DV2Q 4B3TQ 1OXUA 4HIDA 2R7ZG 4BA1I 1JT8A 5GAGC 2K4KA 2YV5A 4A4IA 1OXSC 2AWOA 4GOPA 4JBKA 2A1AA 1YBYA 5J3BA 1IZ6A 4IPCA 3CCQA 1SFOH 3CQZH 3DM3A 5IYCG 3IRBA 4LF7L 1MJCA 1EWIA 3UDFA 5M3MH 4A3LH 1QVCA 1A63A 5JEAJ 2VY3A 1N32Q 1QZGA 1C9OA 2I0QA 4B3TL 3S1NH 3GTMH 2PQAA 2EIFA 4B3SQ 3I4NG 5M5WH 4DK3C 1LTLA 1Q82C 1PH3A 1L0WA 4AH6A 4IPGA 1BBUA 1X54A 1HH2P 2KENA 2JA6G 3CP0A 3CCJA 4IOAA 3L7ZC 1CKOA 2JK8A 4A3EH 3HKZG 1HJPA 1AE3A 3BU2A 4IPHA 4C3HH 5C0XG 2CCZA 3CC4A 3MEFA 2VUMG 4A3CG 4QQBX 1PH4A 3RR5A 3NELA 2BH2A 2PI2A 1VQ6A 1TWFH 3H15A 4JCVE 4DR6Q 1YI2A 3JAMc 3I4MH 4C3JH 2DGYA 3HOUH 1I6HH 4A3IH 3PUYA 2I5MX 2A8VA 5M5XH 3L0OA 2UUAQ 2RHSB 1K8GA 1HNWQ 2LXJA 1E1TA 2GVBA 5C44G 1K0RA 2ZTCA 5BR8Q 3RLOA 2WP8J 1B8AA 1HZCA 1BBWA 4QY7A 3M7NA 1YHQA 3UDGA 4LFBQ 1GKHA 3KDFB 3CCUA 2JEAI 3K7AH 1U5KA 4DR6L 3M4OH 3HOVH 2YTXA 4ALPA 1E1OA 2IX0A 1VCIA 1NE3A 4MNOA 4TVAB 1Y1WG 1XMQL 1Q86C 3J7A5 1BVSA 1QZHA 1A0IA 1VQ4A 3S1MH 2ES2A 1XPRA 1EYGA 4B3RQ 2UUAL 2B63G 1IL2A 1HNWL 2NZHA 4DR4Q 3CCVA 1W2BA 3K7UC 3J80i 1XMOQ 4NXML 1L1OA 3AFQA 1FVIA 2BA1A 3KF8B 4ME3A 1CSQA 4LFBL 4BY7H 3RZOH 4IFDJ 1VQDA 1A62A 2YTYA 3SGIA 3J7ZC 4APVA 1U0LA 3BZCA 1XJVA 1VQJA 2VQEQ 4PG3A 5JJKA 1J6QA 3S2DH 3M4PA 2NVQH 2NN6G 3UDIA 4R4QA 2V1CC 1VQ8A 4DV5Q 2N78A 1B70B 4QIWE 1OXTA 1PYBA 2PI2E 3S1RH 1EIYB 1MIUA 4GN3B 1CSPA 3I56A 4UY8C 5LMUQ 2Z6KA 4TQUS 4X65Q 4JI1Q 3F2DA 1OXVA 4EQ5A 1G291 3CMAA 3S16H 4JV5Q 1Q1BA 2KBNA 3GTLH 1VQPA 1Q8KA 2JE6I 2VQEL 4A3DH 4R4IA 1M90C 2PMZE 3ICEA 4GKKQ 4KLKA 2UXBQ 2ZTDA 4A3MG 1N8RC 4IJHA 5C3EH 4K0KQ 4DV5L 2VZAA 3RN5A 1V43A 2R93G 3CCEA 4YCWA 2HT1A 4X64Q 5IWAL 1UEBA 2ZM6Q 1WJJA 1LYLA 2OCEA 5LMUL 4X65L 3A5ZB 4JI1L 4LWCA 1PH7A 5M5YH 3CMEA 4JV5L 5IP7G 5GQOA 1E22A 4NPSA 2UXBL 2VQFQ 1TWCH 3H0GH 1T9HA 2UXCQ 4K0KL 3BZKA 5IYDG 3L2PA 1WFQA 2R7FA 3STBC 4AYBE 3D0FA 5JEAG 3S17H 4X64L 2JQOA 1ASYA 4LUZA 2ZM6L 4KI0A 5IP9H 5IYBG 1PVOA 1I50H 1MJEA 2VS1A 4YCUA 1VQOA 1YEZA 2K5NA 3RLFA 1Q12A 4YCVA 2QGQA 3KJPA 2CWPA 2RHQB 1VQHA 5HGQA 4X6AH 2IY5B 2Y0SE 3HOZH 1IBMQ 1GD7A 2VQFL 1WCMG 3K81C 1PV4A 2UXCL 4DR5Q 1D8LA 1NMGA 4L5TA 2YU9H 1H95A 2FXQA 4O2DA 1VQNA 3H3VH 1UE5A 4YWLA 4JG2A 5LMNW 1HZ9A 4GLAC 1S3OA 4Y7NH 1PH1A 2OQ0A 1SRUA 3S14H 1PH8A 1K9MC 1YHAA 1Q1EA 4AYBG 1L2FA 1Z9FA 1CKNB 1Q81C 3DLLA 2N8NA 1PH6A 4MTNA 1HNXQ 2D0OA 1IBML 4DPGA 3FKIH 1E3PA 5ELNA 4BA2I 2WFWA 3UDXA 3CCRA 4DR5L 4OO1G 1HZBA 1X3GA 2ALYB 1VQBA 4H02A 2Y0SG 3PUWA 1X6OA 2QEXA 1KRTA 1Y1VG 1YJWA 1XTDA 4DNIA 5M3MG 4YHHQ 4A3LG 3CCLA 3W1GA 1I3QH 3CF5A 3OW2A 4PZ6A 1XPOA 2EQSA 1HR0W 3I2ZA 2JA6H 3CXCA 5FJ8G 3CPWA 4C2MH 2R92G 4JOIA 1CUKA 2KCTA 4A93G 5IY0A 1HNXL 3K8AA 4FDBA 1TWHH 4GS3A 5HY6A 3W5OA 1XMQQ 3T1HQ 3U4VA 4JI3Q 2VUMH 3KLWA 4A3CH 1YIJA 3GTGH 3Q8DA 4A75A 4LF9Q 3PO3G 1VQAA 1TXYA 2WB1E 3AQQA 4UPAA 2NN6I 4XIGS 4IO9A 4LUOA 3S2HH 2PNHA 3UE0A 4OX9Q 1X3EA 4YHHL 3GDEA 4IPDA 2ZTEA 1JMCA 4NXMQ 4LF5Q 1E7ZA 2GVAA 5FLMG 3KFUA 3STBD 4JBJA 4NB3A 1UE6A 3G71A 2LXKA 4DV4Q 4NXNQ 3HOUG 1GVPA 1I94L 3PUXA 1N33Q 1KIXA 1C0AA 4JI3L 3T1HL 3G4SA 2N3SA 3LGJA 3K0XA 4R4CA 4BBSG 2K50A 2JA7G 5FLXc 2LSSA 4LF9L 2IHFA 4C3IH 1PA6A 4GN4B 3TS0A 2XGTA 3GD7A 1Y1WH 1MKHA 1SMXA 4BY1G 2OTJA 2R7DA 4P71A 3AEVA 2R6GA 3J80c 4OX9L 4BXXG 4JI0Q 2E2JH 1YNXA 2B3GA 2IHEA 4JI4Q 4LF4Q 4LF5L 2B63H 3HOVG 2HIXA 3G6EA 4NXNL 4DV4L 1UWVA 1KC8C 4GLXA 2K5HA 4UP9A 1N33L 3MXNB 1YITA 4P72A 1JJGA 3ULJA 1QUQB 1VS0A 4A3GG 2KCMA 3PO2G 4JI5Q 3S24A 3NEMA 4UP8A 3KJOA 4Y52H 4HIOA 4YWMA 5IWAQ 2F3IA 4YWKA 4IJLA 3PUVA 3PUZA 1KHIA 3AYHB 1JE5A 1Y14B 3KDFA 4B3ML 4JI0L 3ER0A 4JI4L 4LF4L 1W3SA 4PZ8A 4LF8L 1L1OC 5C4XG 3E9IA 2JEBI 3GTPH 4RMFA 2OTLA 2K52A 1QVFA 2UU9Q 1VQKA 1Z47A 2H5XA 2IT1A 2I5HA 2E5LQ 2A19A 3F1ZA 3U58A 2HIVA 4POFA 2I5LX 4A3JH 4JI5L 3H3VI 4WJ3M 2UXDL 1PFSA 1YJ9A 3KF6B 2K14A 4R4TA 4A3MH 1G6PA 4OXPA 1NTGA 4UP7A 4DUZQ 2F4VL 4DR2Q 1N34Q 2NVTH 1JJ2A 3M4QA 3F8TA 3GTOH 2R93H 2MO0A 4EX5A 2CKZB 3EN2A 1TWAH 1HNZQ 2VNUD 2KHJA 5C3EG 1OXXK 2UU9L 4A3KG 1YJNA 3HOWG 2VW9A 2E2HH 4A3BG 4A3FG 2E5LL 4GNXB 4L5RC 2K75A 5IE8A 4DV1Q 4LFAQ 5IP7H 2NVYH 3TEHB 4DV0Q 3RNUA 4HIMA 2CQOA 3KOJA 4XTCS 4LF6Q 5IYDH 4GOPB 4LFCL 4DUZL 4YY3Q 4DV3Q 2NVXH 3WWVA 4DR2L 1N34L 3CD6A 1KXLA 1VQEA 4AQYQ 3HOYG 3CCMA 1VQGA 2AWNA 3ULPA 5JJIA 2ID0A 5C0XI 2AKWB 2D0PA 4BBRG 3OTOQ 1PH9A 3CW2C 3CPFA 2NZOA 5IYBH 3HOXG 3PF5A 1NJIC 3JC66 4R1JA 1IYJB 1AH9A 4LW1A 1N36Q 1VQMA 3VDYA 4DV1L 1Q7YC 2JA5G 4LFAL 3T1YQ 4DV0L 2PQAB 4JYAQ 1X65A 1XNRL 1KQSA 2HHHQ 2R7ZH 1BKBA 3I4OA 4O0AA 2JA8G 4JI8Q 5M3FG 1WCMH 2EXDA 3PV0A 3PIOA 4LF6L 3G48A 1IXRA 4KHZA 4YY3L 4DV3L 4DV6Q 4QL5A 2CWAA 4AQYL 3TS2A 4DAMA 1E24A 1P16A 1GO3E 2RF4A 5H1SE 2Z0SA 3OTOL 3I7FA 4GNXC 4A76A 2AMCB 2KHIA 5IYCH 1SLJA 4PZ7A 1PH2A 1N36L 4LUVA 4JI2Q 3T1YL 2XTIA 4JYAL 3HKZE 4GOPC 3I4NH 1GM5A 2HHHL 3F2CA 1FJGQ 4JI7Q 4JI8L 2OQKA 3J81j 3TRZA 1X3FA 4DV6L 4HJ7A 1ASZA 2CFMA 4IOCA 4L5SA 1Y1VH 3FKIG 5GAEC 4HIKA 1I94Q 2MNAA 2BA0A 3PGZA 4DV2L 4JBWA 3ERSX 2VL6A 1V1QA 4LNQA 2UUCQ 2F52A 5FJ8H 1WI5A 4JI2L 2C35B 4A3EG 2R92H 3A0JA 4A93H 2QA4A 4IFDG 4OWWB 1FJGL 2HQLA 3FHWA 4JI7L 3RN2A 2DUDA 3W1BA 1CKNA 1C7YA 2ZJRA 3PO3H 2JA9A 4GN5A 4P75A 4X62Q 3S1QH 1SN8A 2GN5A 4GKJQ 1FGUA 3E0EA 1VQIA 5C44H 1WYDA 3U4ZA 4OWXB 1EFWA 3I4MG 2Q2TA 3CAMA 5GADC 2Q2HA 4A3IG 3M3YH 1L1OB 2B29A 1UE1A 4MZ9A 3ZJYC 1N32L 4JOIC 5E7NA 5FLMH 3M85A 4DR7Q 5LMNQ 4B3SL 3JAMi 1VQ9A 2UUCL 2YTVA 3ULLA 1SR3A 4GLVB 1J5EQ 1XNQQ 2L15A 4HJAA 1PYSB 2MO1A 5AJ3Q 1WOCA 3NBHB 2OWOA 1VQCA 3HKSA 4DR1Q 1R9TH 1EQQA 1IBLQ 4BBSH 1EUJA 2JA7H 3E9HA 4B3MQ 1HNZL 4LF8Q 4X62L 2WB1G 1K8AC 4GKJL 3OYYA 2MQHA 3U50C 4DV7Q 1JJCB 3A74A 4BY1H 4BXXH 1KRSA 1JB7A 3GTKH 4X66Q 4P74A 3I55A 5ELOA 2WAQE 1VQ7A 4AIMA 4DR7L 5LMNL 1S40A 5C0XJ 3EIVA 1J5EL 1YVCA 1XNQL 4JC0A 3PIPA 5AJ3L 1KAWA 2UXDQ 2E8GA 1HR0Q 1M1KC 4OWTB 2BH8A 4DR1L 1AE2A 4DR3Q 1IBLL 3GO5A 4A3GH 4WJ4A 3UE1A 5BR8L 3D31A 3PO2H 2F4VQ 5GROA 2D62A 1LUZA 5K36G 4DAYB 5GAHC 4DV7L 2YYZA 4JBMA 3RZDH 2ATWA 1CKMA 4X66L 1LM0A 3M9BA 1SE8A 4DUYQ 4JI6Q 5C4XH 1FL0A 3PCOB 4B3RL 2WAQG 1I5FA 3PSIA 1HR0L 3FP9A 2JJQA 5C4JH 4DR3L 4BY7G 1V9PA 2UUBQ 3B6YA 1QVGA 4DR4L 4QJFA 4LFCQ 3CCSA
chains in the Genus database with same CATH superfamily
4OHJA 1RL2A 4Q0FA 3HFZB 3KYHC 1D7QA 4H13C 1Q46A 2HDMA 2PO4A 4OONA 2OT2A 4JI6L 2KUMA 4L5QA 5IT9c 5FO9B 3P1HA 2ZJQA 2AHOB 3K80C 4RHRA 4A3BH 3SR1A 4A3FH 2PPBC 1PH5A 4J15A 1BXTA 1I4XA 1YZ6A 4BY7B 3KLSA 4POGA 1JQYD 3P20A 4RKLA 5C4XB 2GA4B 3GTJH 2NVQB 2H1EA 4JK1C 1KL9A 1PZKD 3KF6A 2N55A 3FEWX 2RCNA 3RLNA 2Q2UA 1C4QA 4R8NA 3GTQH 4QGUA 1K3RA 4R4OA 4XYQA 4DKAC 1N9WA 3EFXD 2MFIA 1K73C 2JA8H 1SROA 5M3FH 3BJUA 5A2QE 3L9AX 1PTOF 5L37A 4EQNA 4HIDA 3FPPA 3DUZA 2K4KA 2YV5A 4A4IA 1OXSC 2AWOA 3LWEA 2E2IB 3J7YW 3CCQA 4N9TA 3IRBA 5M3MH 1S5ED 1EY8A 2AUJD 2VY3A 3HOYB 1B53A 2IPKD 1SE3A 4DK3C 1KLUD 1CZGA 2KENA 4ZKBB 2JA6G 3K58A 3CCJA 4OELB 1CKOA 3D6WA 3HKZG 4C3HH 3NWSA 4IPHA 2WACA 1FYCA 3NELA 2PI2A 1YI2A 3L3OC 3I4MH 5I4DA 2DGYA 1FR3A 1SSOA 1K8GA 1HNWQ 1E1TA 1IW7C 3S14B 1B8AA 4LFBQ 1U5KA 1HTLD 3FKIB 3QOLA 1I4HA 2X6LA 1LTTD 2F0FA 1GUWA 4IALA 1XPRA 2B63G 1HNWL 4KTAA 4A3EB 4DR4Q 3CCVA 1XMOQ 2JA6B 1U4MA 4ZAIA 3KF8B 4LFBL 1CSQA 4N8FA 3RZOH 1JWMD 3HKZB 3SGIA 3J7ZC 4APVA 2K03A 1A6XA 3DEPA 1VQJA 3NBHA 3TZUA 1J6QA 3M4PA 3FPUB 5KYIA 2KEEA 4RH6A 1VQ8A 5IGBA 2N78A 1RJTA 5I2YA 3CRLC 2B2WC 4HCEA 3Q6SA 2LKVA 1L0XB 2FMCA 5CBEE 3NXWA 4X65Q 4EQ5A 1G291 4HMIA 1VQPA 2JE6I 4A3DH 4GKKQ 1SNQA 4OGQC 2UXBQ 1N8RC 4O1NA 3IKJA 4IJHA 5C3EH 5CR3A 4K0KQ 1LACA 1V43A 3MZ5A 1B9MA 1G91A 4KKUA 2B63B 1UEBA 1SNCA 1LYLA 5HGTA 1PZID 4X65L 1X32A 4LWCA 4CHTB 3K57A 3U9SA 1FNWA 3K5MA 2UXBL 3H0GH 5EKIA 2B2UC 2QW7A 2QEJC 3BZKA 4K0KL 1KAAA 1WFQA 1V1PA 3NBIA 5ELDA 3S1RB 3WOEA 4U673 2XNAC 2MP1A 1ILPA 1CA6A 2EY2A 1MJEA 4YCUA 3MFYA 2K5NA 3RLFA 3K0YA 1Q12A 5FK9C 5HGQA 2Y0SE 1T5XD 3HOZH 1IBMQ 1GD7A 4A3JB 3VA7A 1D8LA 3SHLA 2YU9H 1MI2A 3H3VH 1PRTC 3PQIA 4JG2A 2B2TC 3BDOA 1SRUA 4H7BA 4AYBG 1STAA 1CKNB 1Z9FA 2N8NA 2G5DA 4DXFA 1HNXQ 2AQ1B 1IBML 1WTHA 3CHBD 1YNNC 4OO1G 3QB3A 4H02A 1LT3D 2E2DC 1KTKA 1X6OA 3OWEB 1XTDA 3NPPA 1YJWA 4DNIA 1TY0A 3I70A 3OW2A 4PZ6A 1XPOA 1TT2A 2EQSA 5KNBA 3CPWA 4A93G 1HNXL 5C0XH 4GS3A 3K8AA 3M7GA 3W5OA 1XMQQ 3GTGH 2A69D 1EZ6A 1JICA 3Q8DA 3PO3G 3VYUA 3OPOA 1VQAA 1CHPD 3I90A 5FO8B 4LUOA 4IUQA 1JE4A 2B8FA 5C5LA 3GDEA 2ZTEA 4NXMQ 2GVAA 3D4DA 2XSCA 1UE6A 4NXNQ 2LXKA 3KK7A 3PUXA 1KIXA 3J7AF 1DM0B 2N3SA 3LGJA 4R4CA 2F0JA 2LSSA 2IHFA 5ELBA 1EY6A 1MKHA 1SMXA 1TS4A 4BY1G 2OTJA 3AEVA 3VYTA 2PW5A 4DXGA 3J80c 1L0YB 2E2JH 2DY7A 1JOKA 4JI4Q 4LF4Q 3G6EA 4NXNL 4GLXA 3NSWA 1UUPA 2K5HA 5BN3A 4UDUC 3ZYYX 1JJGA 1QUQB 3KLSX 2O2LD 4K6LA 4A93B 3GV6A 3PO2G 1RDPD 3S2HB 3LWUA 3GQBA 4LAAA 3IFTA 3PO3B 1IKLA 2NN6H 2NZ1D 1EYAA 1I4QA 3PUVA 3PUZA 3KDFA 4GZYC 1Y14B 1YNND 4B3ML 4JI4L 5C44B 4LF4L 1W3SA 1BCPB 2P5ZX 3K59A 3GTPH 1O78A 2OTLA 4ABNA 1G2TA 1B3AA 4C3IB 2A19A 3VR4A 3U58A 2HIVA 4WJ3M 1STEA 2K14A 4R4TA 3P7JA 1TR5A 2EY5A 1RODA 4DUZQ 1SDFA 4DR2Q 2BOSA 1N34Q 2R93H 3F8TA 3VYRA 1GUGA 2CKZB 1LO5D 2J0TD 3EQLC 2VNUD 5EBDA 1LTSD 1YJNA 2E2HH 4A3BG 1LT4D 3MWYW 4A3FG 2QKIC 2K75A 4LFAQ 5IP7H 4DV0Q 3N6RA 2CQOA 3PO2B 2C9OA 5IGDA 5IYDH 3KUPA 4LFCL 4DUZL 4YY3Q 2NVXH 4DR2L 1N34L 1EZ8A 1ICWA 1DCZA 4XDXA 5JEAH 1AEXA 2AKWB 1PH9A 3CPFA 1OO9B 4XQNA 4FP5D 4QB4A 3MXPA 1IYJB 1AH9A 3VDYA 4LFAL 1A2UA 4DV0L 4A3MB 2RDHA 1BKBA 3I4OA 2JA8G 4JI8Q 5M3FG 3PV0A 2F0TA 1CTMA 3CKIB 1DD2A 4KHZA 4YY3L 1B44D 1SJHD 2L12A 4PQXA 1P16A 1GO3E 3E6ZX 2H4OA 1JR0D 2KHIA 1A3VA 2Z9HA 4PZ7A 4J8QA 4F8MA 4JI2Q 2I46A 3HKZE 4A3FB 3UI2A 1FJGQ 2M2LA 4JI8L 1YNJC 3J81j 2PMZB 1I4PA 5KNCA 2CFMA 3R93A 2DJFC 1I94Q 2BA0A 5KNDA 4DV2L 3BZDB 3ERSX 5J39A 4QF4A 5FJ8H 1MGSA 4DF7A 4JI2L 5G3LD 4C3HG 2QA4A 1IYUA 1FJGL 2DUDA 2ZJRA 4GN5A 3S1QH 2CQAA 1KDAA 3E0EA 4PMCA 3I4MG 4QMGA 3SK8A 1QWYA 3ZJYC 1N32L 5E7NA 2O5JC 1EQVA 4YIJA 1JOOA 5LMNQ 3QWNA 1ESRA 1R4PB 1JOQA 1R9TH 3HP3A 1EUJA 2JA7H 2WIIB 3E9HA 5COYA 1F9PA 4CKCA 1Y1VB 2WB1G 1QILA 1K8AC 4UHVA 4CJ2C 5M3MB 2MQHA 4BXXH 5IODA 3C1FA 4KY7A 4P74A 5CV4A 1F9SA 3BDLA 5C3XA 1KNAA 5LMNL 1S40A 3J7AV 4JC0A 4IUTA 4FF4A 1KAWA 2UXDQ 2EYLA 2BH8A 4OWTB 1AE2A 4MIUA 2L0CA 3UE1A 3D31A 1A3UA 1I4GA 1QB5D 2D62A 2RVLA 5IIFA 1DYQA 1QNUA 3RZDH 4CDCC 2ATWA 1YNJD 5DEHA 1QOHA 1RHPA 4RGOS 3I4MB 1NNXA 1FL0A 4BBSB 3FP9A 5C4JH 1S5DD 3BG3A 4LJZC 4P2CB 4QJFA 5EBCA 4A3DG 2KHSA 1G51A 1S5CD 2DNCA 4KHPQ 4WJWA 2WB1B 3PF4A 1EFID 1AFPA 1OTCA 3OSOA 1GHKA 4KY6A 1J9OA 3KBGA 5EAYA 1VQLA 3MXUA 3NWTA 3QOJA 5E4WC 1BDOA 4HJ9A 3MAQA 4A3KH 1WVLA 2JSOA 4DK6C 1RTNA 2N49A 3RZOB 4HJ8A 4KHPL 3H0GG 3C3LA 2D2CC 1DGSA 1QNKA 3FDTA 2F0LA 3BVZA 5FLXL 3J81c 3CC2A 1RIPA 3J81i 3I4LA 3NENA 1V8QA 5FKAC 4DFAA 2JA5H 1YHBA 3QJYA 3HOZG 1RTOA 2OF1A 1XWEA 4RWSC 3OIPA 2TMPA 4N8X1 3G6JB 1OXUA 4X3KA 2R7ZG 5C3EB 5JPNC 1JT8A 2XIWA 2ICEC 1K83B 2EPBA 5J3BA 3J81E 4KKTA 1IZ6A 3HG9A 3TDQA 2PYKA 4G57A 2IJ0A 2FFKB 3IFDA 5IYCG 1Q8IA 1A63A 1SJED 1C9OA 1CK1A 2PQAA 2EIFA 4B3SQ 2F0SA 1PH3A 1IL8A 1D1IA 3RUZA 1SYDA 3CP0A 3O13A 5DNFA 2JK8A 1HFGA 1HJPA 1AE3A 3BU2A 1QJOA 1WTOA 5C0XG 4IFDH 1TWGB 2BH2A 1VQ6A 2K5QA 1TWFH 4JCVE 3JAMc 4ZLTF 2E76C 1ET6A 3OWFA 3X3NA 1I6HH 3PUYA 2I5MX 2A8VA 5M5XH 3H94A 1CA5A 4NP5A 2F0NA 5KYLA 2GVBA 1K0RA 2ZTCA 4M1UB 5BR8Q 3RLOA 3OW7A 3K6OA 3D4WA 1HZCA 4KN4C 4QY7A 4R8IA 5JPMC 1H9KA 3GTMB 1HA5A 3M4OH 3HEJA 1E1OA 2IX0A 4MNOA 1Q86C 3NHHA 2FJ2A 1QZHA 1VDZA 2LY7A 1VQ4A 2NZHA 1HXYD 2WINB 1L1OA 1FVIA 1NR4A 4IFDJ 2EYJA 1VQDA 1A62A 2EJFC 2YTYA 4C3JB 1FNUA 5JJKA 4PMBA 3K5NA 1C48A 3S2DH 2NN6G 5FO7B 3QG1A 1MSGA 1B70B 4MHEA 1BCPF 3C46A 1OXTA 1EIYB 4B9XA 4GN3B 4UY8C 3K7AB 4TQUS 4JPBW 4JI1Q 2QDLA 3F2DA 4C1NI 1JC7A 3CMAA 2EE1A 2KBNA 3GTLH 1K3BC 1M90C 2PMZE 4KLKA 4OL7A 4HN7A 3ND9A 2VZAA 1QCBD 4DK1A 2R93G 3CCEA 4YCWA 1DJRD 4X64Q 4F88A 1H9SB 3I91A 1XXGA 5CV6A 4JI1L 2O4XA 3C2PA 5M5YH 3W3AA 5IP7G 2KVMA 5GQOA 3N52A 1J8IA 5CBAE 2UXCQ 5IYDG 3L2PA 1EY9A 1F9QA 1ICFB 2R61A 2R7FA 3D0FA 3NUCA 5JEAG 4G7OC 3S17H 4X64L 2WAQB 4CDDC 3Q23A 5JVH3 1PVOA 3GTPB 1BUVT 2KEDA 2EYMA 4X6AH 3K81C 1PV4A 2UXCL 1NMGA 1D5ZC 4L5TA 1H95A 2ICIA 2EXZA 2F4IA 2F0MA 1S3OA 2R93B 4K14A 1L2FA 1H9RA 3DLLA 1C8CA 1PH6A 4MTNA 1TWCB 3TP8A 1AW7A 2EDGA 4DPGA 3DWPA 5D65A 4NMZA 3UDXA 1F9RA 1R4QB 1HZBA 3PUWA 4DNTB 4FF2A 4C56C 2NVXB 1I50B 1WD0A 4A3LG 3CF5A 1Q3LA 1K28A 1D5XC 3CXCA 2XVSA 1EEFD 5FJ8G 2NBFA 4V190 4JOIA 1I4RA 4FDBA 1TWHH 4EQPA 1PTOC 4FVMA 2VUMH 4A3CH 3U4VA 5E1FA 5IT9L 4A75A 2JN4A 4LF9Q 4IQZA 1TXYA 2WB1E 3AQQA 4KK7A 2NN6I 4UPAA 3UE0A 1SE4A 1E7ZA 4XYOA 4JBJA 4DV4Q 4KY5A 2PQEA 4NW2A 2F03A 1N33Q 3OMGA 4K2KA 2JA7G 1CQFA 2QF7A 2PNRC 4LF9L 2PZUA 3AU7A 2QCPX 4MN3A 2HD3A 2K1BA 2R7DA 4BXXG 2JP1A 1YNXA 2B3GA 3HOVG 2HIXA 4C2MB 1KC8C 4DV4L 1HHVA 1MBYA 1N33L 1EOTA 3GV3A 3EA6A 1UNSA 1ENCA 3S24A 3R2TA 4Y52H 3TP7A 1XTCD 1SMYC 3SK6A 4YWKA 4IJLA 4L6TB 1F2LA 3AYHB 4LF8L 2JEBI 2PZTA 5CGKA 4KD3A 2K52A 1SNMA 1TKWB 1Z47A 2IT1A 1E0BA 2LMCB 1IKMA 1ZYRC 2SOBA 1F2MA 3PIO3 1R9TB 2HUGA 2E74C 3KF6B 2JA7B 1PTOD 1G6PA 3TP6A 1PLFA 4OXPA 4UP7A 2NVTH 3GTOH 1G8ZD 1E2ZA 2TSSA 1IW7D 1LTID 1TWAH 3X3MA 4KV6A 3ERQA 1OXXK 3S9WA 4A3KG 2VW9A 1ZXTA 1EL0A 5IE8A 4DV1Q 5I6WA 3HGBA 4HCSA 3KOJA 4LF6Q 4KD4A 5A35A 4DV3Q 3WWVA 2D5DA 1VQGA 2AWNA 5JJIA 2L9HA 2ID0A 2D0PA 1PFBA 3PF5A 3JC66 4LW1A 1VQMA 2JA5G 4DV1L 2C5CA 1Q7YC 5C4JB 1XNRL 2R7ZH 3J7A5 4L8JA 4LF6L 1M4VA 1WCMH 2EXDA 4DV3L 1IYVA 3DHQA 4DV6Q 3ND8A 1DONA 4DAMA 5JJZA 2RF4A 4GNXC 3MVVA 4QIWB 2AMCB 1U4RA 5IYCH 3MHBA 2K05A 3SE0A 2NVYB 4RCOA 4LUVA 2K32A 4GOPC 2AUKA 2A6EC 2OQKA 1F77A 1X3FA 1ZYRD 4DV6L 1ASZA 1K0SA 1K8OA 4ZKCB 3PGZA 3NE5B 4FF3A 5I9OA 1V1QA 4LNQA 1PXUA 3D3RA 1WI5A 2A68C 1A15A 4IFDG 4I7AA 2OXPA 2HQLA 2JA5B 3RN2A 4P75A 4X62Q 3Q0AA 1EFWA 1WYDA 3U4ZA 2Q8RE 1SNOA 4XT3B 3CAMA 4AYBB 1SAPA 1B3QA 2B29A 4NKLA 5FLMH 3M85A 1SR3A 4GLVB 1XNQQ 2L15A 1PYSB 2A6HC 2B8GA 3NBHB 2OWOA 1VQCA 4CBVA 2MPMA 3WDNA 4QCLA 2K04A 4B3MQ 4X62L 1ZEQX 2OEOA 1EQTA 3OYYA 1PRTD 3DXJC 4DV7Q 1KRSA 4X66Q 2WAQE 1WTQA 4AIMA 2RA4A 1CQVA 4H44C 3EIVA 5C0XJ 1EIGA 1MSHA 4K8JA 1XNQL 1HR0Q 1D2BA 2ZXOA 4B9WA 2LS01 2B2WA 5JVG3 1EY4A 1PFNA 5GROA 1LUZA 3BDCA 3M3YB 4DV7L 2YYZA 4PV1C 1QG7A 1ZKOA 2HDLA 4ULLA 4X66L 3M9BA 4IUUA 5C4XH 4B3RL 3NP8A 1I5FA 3PSIA 1HR0L 2JJQA 2F0GA 2I07B 3B6YA 2UUBQ 2XWJB 1ML0D 4LFCQ 4BY1B 3AFPA 1V1PB 3EBEA 1S72A 2Q2IA 3GTKB 1JCKB 2Z6KC 3T51B 3I72A 2KOLA 1NMFA 2N88A 4DNRB 4HJ5A 1U9RA 3T13A 3EROA 2B2UA 4F87A 2RSOA 5DLQE 5EPLA 1STNA 4L63B 3HOWH 4OO1I 2UUBL 1EIFA 5HURA 2IX3A 2K5VA 2E2IH 3A55A 4ZUIA 2A6HD 2BE5C 4IUVA 3CC7A 2KA7A 2EZVA 1X56A 3MA2B 1HUNA 3V05A 2K01A 3HOYH 4ID6A 4BBRH 1X9NA 1P8LA 2F0OA 3TZDA 3HOXH 3BYYB 2ASBA 1O80A 2B2TA 1Y69U 1XPUA 3J80L 4IFDI 5DAUA 1G6ZA 5KRUA 1PHJA 4LF7Q 1CM9A 3GTLB 4GNXA 4XXEA 4DV2Q 4B3TQ 2CH4A 4BA1I 2ZXPA 1SYEA 5GAGC 4IZ8A 4A3BB 4V0BA 4GOPA 1ESFA 2A1AA 1I6VC 2KCCA 3D4RA 5I9PA 1Z7TA 2SNMA 5BN5A 4S3SA 3E3XA 2B39A 2K7VA 3CQZH 2DN8A 2PZWA 5E3FA 5M5YB 4LF7L 1MJCA 3UDFA 2ENBA 1SXTA 3GTJB 4A3LH 1QVCA 5JEAJ 1N32Q 1QZGA 5ELEA 4KJOA 2I0QA 3BVMA 4B3TL 3S1NH 2E75C 1EYCA 1TS3A 3I4NG 2CHBD 3SK4A 5M5WH 3AB9A 1L0WA 3GTQB 4KMUC 1BNZA 2NTTA 5DM63 4EGVA 4IOAA 4G4KA 2JXMB 1FD7D 4A3EH 2JA8B 1ENAA 5M3FB 3MEFA 4RKBA 2VUMG 4A3CG 4X3TA 1PH4A 3RR5A 3MEHA 2XRSD 1H9MA 1STBA 3V96A 4A3IH 3L0OA 2UUAQ 1X3PA 3WOFA 3HZXA 5CYUA 3E0JA 2RDFA 1BBWA 5IGEA 3UDGA 2CVRA 3KDFB 2L4NA 2JEAI 4PNYA 3HOVH 2YTXA 4ALPA 3CU7A 2A73B 1A0IA 3I8ZA 3M4YA 3S1MH 1WTPA 2UUAL 4NDXA 3LX0A 5EPKA 4C3HB 1Y8OB 2RDGA 2EVBA 3K7UC 3E5SA 3SXHA 1GUSA 4ME3A 1XYIA 1WTRA 4CKEA 2VUMB 1U0LA 4FYDA 3BZCA 1XJVA 2VQEQ 2B2VC 2EYFA 3UDIA 2Z4IA 3HS0C 4R4QA 2HQEA 1AP0A 1LT6D 2DNEA 3TMEA 5LL6S 5FLXE 4QIWE 2PI2E 3S1RH 2DY8A 1CI3M 1CSPA 3MXNA 3I56A 1LLRD 2Z6KA 2L11A 1OXVA 3T4AC 3S16H 4DU9A 1Q8KA 2VQEL 3VR2A 4R4IA 3OIQA 4DAYA 5IWAL 1D6EC 2ZM6Q 1SEBD 2OCEA 1NCVA 4C1NK 5KGUA 1UEAB 1PZJD 5EGTA 4AYBE 1F2YA 5CMDA 1G2SA 2JQOA 2ZM6L 2PW7A 2BDNA 1RF2D 5IP9H 2VS1A 1A3TA 4A3DB 3KJPA 2SDFA 1VQHA 2SEBD 5C4HA 2EYHA 1WCMG 4RGTA 4DR5Q 1VF7A 4FXDA 2FXQA 3VA5A 4O2DA 1VQNA 1UE5A 3Q24A 2Q8TA 1SYBA 4YWLA 5LMNW 4ME5A 4X3UA 1HZ9A 4GLAC 4Y7NH 1PH1A 2OQ0A 4WFN3 1SE2A 2AQ3B 1YHAA 1K9MC 1TWAB 1SBBB 1Q81C 2L1BA 1PYWD 2NUCA 1PFMA 5DM73 1TS5A 3H0GB 4U68A 1QE6A 5LL6X 1E3PA 5ELNA 4BA2I 5F2DA 2WFWA 4DR5L 2ALYB 2Y0SG 2QEXA 1WTXA 4YHHQ 4RCNA 3W1GA 1I3QH 5EKKA 2Z6BA 3HOZB 1CUKA 2X6GA 2IL8A 1EU4A 1X3QA 4JI3Q 2KCNA 2YU9B 1DOKA 1AZPA 2R7ZB 5CV8A 1W6JA 3D6CA 1HA6A 2J7ZA 3I73A 3S2HH 1EY5A 2PNHA 4YHHL 4IPDA 1JMCA 2K5WA 2K5DA 5FLMG 4DA2A 3KFUA 2EYOA 5JOBA 4NB3A 3G71A 1NSNS 3HOUG 1GVPA 1KNEA 3D8GA 1PDQA 1C0AA 4JI3L 3R3OA 1CZWA 1SYGA 2EYPA 4C3IH 4GN4B 1GOZA 2XGTA 3TS0A 1Y1WH 4P71A 2JYOA 2RSNA 2IHEA 2DJGC 4K5WA 3LNNA 5LHY1 1UWVA 5D14A 3VR3A 4UP9A 3MXNB 1YITA 3GTGB 4CJ0B 3ULJA 1VS0A 4FXKC 3KJOA 3T56B 5C4ZA 4HIOA 4YWMA 5IOCA 4BY7G 3SEBA 4PZ8A 1STYA 5J22A 2NTSA 2VXWA 5C4XG 1QVFA 1VQKA 2H5XA 3EJIA 1ENFA 1E2VA 4K5VA 2E5LQ 3F1ZA 4IUNA 2IW3A 4POFA 3H3VI 4RHSA 1YJ9A 3K5OA 1PTOH 4FF1A 2E2JB 4XQJA 3KF8A 4A3MH 4RAUC 5AFWA 1V1OA 4KHVA 2F4VL 1JJ2A 2EY1A 4DK0A 3NQIA 3EN2A 1HNZQ 5J1ZA 1ET9A 5ELCA 1Q90A 3JAML 4LMQD 3HOWG 3HRZC 2E5LL 4L5RC 5T1IA 4TKOB 1SNPA 3RNUA 1U4PA 2D9UA 1BCPC 2O5IC 4KN7C 2MHVA 2ZXRA 3DM1A 1VQEA 3HOYG 3CCMA 3ULPA 5C0XI 1HNZL 4BBRG 1T5EA 2NZOA 5IYBH 3HOXG 2B2YC 3ITPA 2G9DA 1MHWC 4JYAQ 2PQAB 4UAIA 1SYFA 5IT9E 2HHHQ 5CC4A 1EIHA 3PIOA 2X69A 3G48A 1IXRA 4QL5A 2CWAA 1E24A 1EWHA 2Z0SA 2E2HB 2F0PA 4DAPA 1SLJA 4HTHA 1PH2A 3QO2A 1WD1A 3HOWB 1B1ZA 4JYAL 3I4NH 2EOTA 2HHHL 3F2CA 4JI7Q 5KEEA 1LT5D 4HJ7A 4IOCA 1UAPA 1Y1VH 3FKIG 4HIKA 4L5SA 2MNAA 1RCVD 3PIP3 4BBRB 2F52A 3HOXB 1SNDA 4A3EG 2R92H 3AMUA 3A0JA 5D3DA 2A74C 4JI7L 3FHWA 1W6KA 4K8IA 1CKNA 1C7YA 2EY6A 2A5HA 2JA9A 1E2WA 5A2QL 4GKJQ 1VQIA 4OWXB 3RD4A 1BCPD 4A3IG 2Q2HA 1L1OB 2MJ8A 4MZ9A 3F2UA 1VMCA 1FNVA 1VQ9A 1EY7A 2XWBB 2YTVA 4LK1C 1J5EQ 4HJAA 5KIXA 5AJ3Q 1WOCA 3PMFA 4DR1Q 1B4OA 1O7ZA 1IBLQ 4BBSH 1FGBD 3CQZB 4LF8Q 3DEOA 4GKJL 1TIID 1JJCB 3A74A 1JB7A 3S1NB 1B50A 5M5WB 1S5FD 1VQ7A 3H09A 1J5EL 1YVCA 2BDOA 5AJ3L 2F0UA 3KBXA 2E8GA 1M1KC 1RKNA 4DR1L 4DR3Q 1IBLL 3S1QB 4A3GH 4WJ4A 5FOBB 3A8IE 1VF5C 4QUCA 1BOSA 4BS9A 1JWUD 1LV9A 4XT1B 5GAHC 1CKMA 1LM0A 2F0KA 3K5LA 4DUYQ 1HQRD 4A3IB 4B08A 1DZ1A 3IAYA 1STHA 2Z1CA 2VB2X 4DR3L 1V9PA 4DR4L 3A8JE 3CCSA 3A7AB 1CHQD 2HCIA 3RMHA 4RG1A 1NR2A 1XMOL 3TREA 4CKBA 1QUQA 3HOVB 2IX1A 1X55A 4O42A 2R3ZA 4PMWA 4E6IA 1HZAA 1IBKQ 4P73A 4A3JG 4DUYL 1BBXC 1KD1C 4WRDA 3ONAB 3S1MB 5JJLA 1A8VA 1HPCA 1XNRQ 1EQRA 1PRTF 3S15H 1K83H 1O7IA 1NBWA 5TSSA 3RZDB 2M9VA 2A69C 1IBKL 3TQYA 2ZJPA 2B2YA 4HMJA 1EOVA 3V2TA 4GKKL 4K6DA 3F2BA 4X3SA 2NWGA 3A5UA 1A2TA 5IP9G 1HFNA 1UE7A 3MTSA 3GP7A 3OOCA 4JW0A 1VQ5A 1TY2A 1NY4A 2AQ2B 5CV7A 1LTAD 4TRDA 1SMYD 1EWCA 1BF4A 3S16B 1B7YB 1TWGH 1VQFA 4FNFA 3T53B 4A3KB 3QR8A 2KQ3A 4JBKA 2F0HA 1YBYA 3C1EA 4CGYB 4IPCA 3QIAA 4ZK9B 1SFOH 1KABA 3DM3A 3NTKA 1EWIA 3DMUA 2Q8IB 3A54A 3GTMH 1EEID 1LTLA 1Q82C 4AH6A 2CW0C 4IPGA 3MXGA 1BBUA 2F1MA 4G7ZC 1X54A 1LTGD 1HH2P 4ZUJA 3OMCA 3L7ZC 2CCZA 3CC4A 1II3A 4QQBX 4FXGC 1DOLA 1VMPA 3H15A 4DR6Q 2WKCA 1EY0A 2CH4W 4C3JH 4K2LA 3HOUH 1K8MA 2F0EA 1JORA 2RHSB 4EVOA 2LXJA 4ZYSA 4Y7NB 5C44G 1O7LA 3G7LA 4J1MA 2WP8J 4Q5VA 1B2TA 1O7YA 3M7NA 1YHQA 4KKSA 1GKHA 3CCUA 4ODGA 3K7AH 4DR6L 3I3CA 4H0LC 4C3IG 1VCIA 2F3VA 1NE3A 4TVAB 3VR6A 1Y1WG 1XMQL 1BVSA 2ES2A 1EYGA 4B3RQ 1IL2A 4FO2A 1BO0A 3TBIB 1W2BA 1I3QB 3J80i 4NXML 3AFQA 5EPJA 1GJXA 2A6ED 1TWFB 2BA1A 4BY7H 1Z6HA 5G3LF 5D3IB 5K5PA 5NUCA 5K36H 1I6HB 3H3VC 4OIKA 4PG3A 5M5XB 2NVQH 4EQOA 4ZRZA 2V1CC 5BN4A 4DV5Q 1PYBA 2A68D 1MD2D 1MIUA 2CW0D 3J80E 5LMUQ 3M4OB 2KJXA 1HTPA 3R2IA 4JV5Q 3DWQA 1Q1BA 1TVXA 2EJGC 3ICEA 4HSPA 1WTVA 2ZTDA 4A3MG 4DV5L 1Y1WB 1JWSD 3RN5A 2HT1A 2BCOA 4HEDA 5JAVA 3IL8A 1WJJA 2VB3X 4TSSA 1PMRA 5LMUL 1NAPA 3A5ZB 1PH7A 2K28A 3VR5A 3CMEA 4JV5L 3S2DB 3SDZA 1E22A 4NPSA 2VQFQ 1TWCH 1T9HA 2XRQD 5CV9A 3STBC 3KLRA 1ASYA 4LUZA 4KI0A 5IYBG 5I2XA 2WV6D 1I50H 1VQOA 1YEZA 4YCVA 2QGQA 2CWPA 2RHQB 2RBMA 2IY5B 2VQFL 3H6MA 4IURA 5I6YA 1SYCA 2ZT9C 1PTOB 4CJ1B 1IHZA 2F0QA 4J6HA 1GUTA 3FRPB 3S14H 1PH8A 1Q1EA 2LFNA 5CV5A 1M8AA 1TQOA 2D0OA 1TS2A 3FKIH 5EKLA 1GUNA 4XQQA 3CCRA 1STGA 3NK9A 3S17B 1X3GA 1VQBA 4Z9CB 1KRTA 1Y1VG 2WKDA 5M3MG 3CCLA 3BS1A 1HR0W 3I2ZA 4DGZA 2M00A 2JA6H 3SK5A 5E4XA 3TN2A 5ELFA 2RQXA 4C2MH 2R92G 2KCTA 5IY0A 5HY6A 2BE5D 3T1HQ 1Y8PB 3KLWA 4ZCKA 1YIJA 5T1GA 5C5MA 2K6AA 1KDCA 4XIGS 4IO9A 4OX9Q 1X3EA 2Z8LA 5CORA 4LF5Q 3STBD 4DN4M 2K33A 1I94L 1HRJA 3T1HL 3G4SA 5IGGA 3K0XA 4BBSG 2K50A 5FLXc 1KDBA 3I4NB 1PA6A 3GD7A 2R6GA 4OX9L 4JI0Q 2B63H 4LF5L 1BR9A 1RD9D 1TWHB 1S4ZA 4P72A 2F0WA 2R92B 4A3GG 3URYA 2KCMA 1H9JA 3U9OA 2L55A 2RKSA 4JI5Q 3NEMA 4UP8A 5IWAQ 2F3IA 4JI0L 1KHIA 2G9HD 1JE5A 3ER0A 1L1OC 3E9IA 1CFMA 2MGSA 4RMFA 2UU9Q 2I5HA 3OHXC 4MTKA 1HQMC 2I5LX 2QILA 4JI5L 4A3JH 2V4DA 3DWAA 1PFSA 2UXDL 2FMMA 4I65A 1NTGA 1PRTB 3NTIA 4IN3A 3M4QA 3MC0B 2MO0A 4EX5A 4HR7B 2L5TA 1LABA 2NYZD 4CDFC 2KHJA 5C3EG 4JVZA 2UU9L 1WTWA 4GNXB 1KLGD 2XN9C 5C6AA 2NVYH 3TEHB 2QDBA 1ONLA 4A3GB 4HIMA 3Q22A 4XTCS 2F3WA 4GOPB 1KXLA 3SVMA 3CD6A 4AQYQ 4BWGB 2FINB 3OTOQ 4F7XA 3CW2C 1NJIC 1GXDC 4R1JA 4OEMB 1N36Q 4M8AA 3T1YQ 4RGMA 1X65A 4KJNA 1H9SA 1KQSA 3FVQA 4O0AA 4QUFA 2NVTB 3A56A 3GTOB 2PCFB 1F2ZA 2F0VA 4AQYL 3TS2A 3NQTA 3MFGA 5H1SE 3OTOL 3I7FA 4A76A 3FMCA 1LTRD 4ILWA 1N36L 4K5XA 4WORA 5C3WA 1Y8NB 2XTIA 3T1YL 3S15B 1GM5A 2F0IA 5EJWA 4OO1H 1D1KA 1B9NA 3TSSA 3TRZA 1JB3A 2IWHA 5GAEC 2J4XA 3VYSA 4R9WA 4JBWA 3T16A 2HCCA 5IGFA 1NUCA 2VL6A 4HSVA 2UUCQ 2KECA 1GHJA 2C35B 4ZQ3A 4A93H 1WCMB 3BYTB 4G7HC 4OWWB 4HAEA 4RA8A 2F0DA 1HCZA 3W1BA 1CT1D 1DXMA 3PO3H 4CDEC 5EQ0A 1SN8A 2GN5A 1FGUA 5C44H 1ILQA 4C3JG 2Q2TA 5GADC 1XX8A 3M3YH 1UE1A 4JOIC 3BVGA 4DR7Q 4B3SL 3JAMi 4N9PA 2UUCL 3ULLA 2EJMA 2MO1A 3J81L 1U4LA 3HKSA 1S5BD 1EQQA 1SFOB 1AN8A 3A8KE 2Y0SB 2FHTA 3P75A 1EYDA 3CRKC 2SNSA 3U50C 4BY1H 3R8BA 3H91A 3GTKH 3I55A 5ELOA 2B2VA 3EVQA 4RFBA 4DR7L 1LTBD 4RGNA 3TP5A 5IGCA 1D5MC 2Z4HA 3JAME 3PIPA 1EU3A 3GO5A 5BR8L 3A7LA 3PO2H 2F4VQ 1TU2B 5ISRA 5K36G 4DAYB 4I7ZC 1GUOA 4JBMA 4IUPA 5M9OA 1AZQA 1SE8A 2NB0A 3HOUB 4OIJA 4JI6Q 3NTHA 3W2DA 3PCOB 1HUMA 1DOMA 2WAQG 4DAVA 1BQQT 2RCFA 1QVGA 2MUYA
chains in the Genus database with same CATH topology
3AFPA 3EBEA 4RG1A 1RL2A 2Q2IA 1XMOL 1S72A 4A3DG 1G51A 2Z6KC 3HFZB 3KYHC 3TREA 1QUQA 4KHPQ 1D7QA 2IX1A 3PF4A 1X55A 1NMFA 1Q46A 4PMWA 1HZAA 1IBKQ 1OTCA 4HJ5A 4OONA 4P73A 4DUYL 4A3JG 1KD1C 4JI6L 4L5QA 5IT9c 5JJLA 1A8VA 5EAYA 1VQLA 5DLQE 1XNRQ 2ZJQA 2AHOB 1EQRA 4HJ9A 3K80C 4A3KH 3HOWH 3S15H 4A3BH 2UUBL 4A3FH 1EIFA 4OO1I 1K83H 2K5VA 1O7IA 1NBWA 2E2IH 1PH5A 4J15A 4DK6C 2N49A 1YZ6A 4HJ8A 4POGA 4KHPL 3CC7A 3H0GG 1X56A 1IBKL 3TQYA 2ZJPA 3GTJH 1EOVA 4GKKL 1DGSA 3HOYH 1KL9A 3KF6A 3F2BA 2RCNA 3RLNA 4BBRH 1X9NA 1P8LA 2Q2UA 3J81c 3HOXH 3A5UA 1RIPA 5IP9G 3CC2A 3J81i 1UE7A 2ASBA 3GTQH 3NENA 4QGUA 1VQ5A 1K3RA 1XPUA 4R4OA 2JA5H 4IFDI 1NY4A 1YHBA 4DKAC 1N9WA 2MFIA 1PHJA 1K73C 3HOZG 2JA8H 1SROA 5M3FH 3BJUA 1B7YB 4LF7Q 1TWGH 1VQFA 4GNXA 4DV2Q 4B3TQ 1OXUA 4HIDA 2R7ZG 4BA1I 1JT8A 5GAGC 2K4KA 2YV5A 4A4IA 1OXSC 2AWOA 4GOPA 4JBKA 2A1AA 1YBYA 5J3BA 1IZ6A 4IPCA 3CCQA 1SFOH 3CQZH 3DM3A 5IYCG 3IRBA 4LF7L 1MJCA 1EWIA 3UDFA 5M3MH 4A3LH 1QVCA 1A63A 5JEAJ 2VY3A 1N32Q 1QZGA 1C9OA 2I0QA 4B3TL 3S1NH 3GTMH 2PQAA 2EIFA 4B3SQ 3I4NG 5M5WH 4DK3C 1LTLA 1Q82C 1PH3A 1L0WA 4AH6A 4IPGA 1BBUA 1X54A 1HH2P 2KENA 2JA6G 3CP0A 3CCJA 4IOAA 3L7ZC 1CKOA 2JK8A 4A3EH 3HKZG 1HJPA 1AE3A 3BU2A 4IPHA 4C3HH 5C0XG 2CCZA 3CC4A 3MEFA 2VUMG 4A3CG 4QQBX 1PH4A 3RR5A 3NELA 2BH2A 2PI2A 1VQ6A 1TWFH 3H15A 4JCVE 4DR6Q 1YI2A 3JAMc 3I4MH 4C3JH 2DGYA 3HOUH 1I6HH 4A3IH 3PUYA 2I5MX 2A8VA 5M5XH 3L0OA 2UUAQ 2RHSB 1K8GA 1HNWQ 2LXJA 1E1TA 2GVBA 5C44G 1K0RA 2ZTCA 5BR8Q 3RLOA 2WP8J 1B8AA 1HZCA 1BBWA 4QY7A 3M7NA 1YHQA 3UDGA 4LFBQ 1GKHA 3KDFB 3CCUA 2JEAI 3K7AH 1U5KA 4DR6L 3M4OH 3HOVH 2YTXA 4ALPA 1E1OA 2IX0A 1VCIA 1NE3A 4MNOA 4TVAB 1Y1WG 1XMQL 1Q86C 3J7A5 1BVSA 1QZHA 1A0IA 1VQ4A 3S1MH 2ES2A 1XPRA 1EYGA 4B3RQ 2UUAL 2B63G 1IL2A 1HNWL 2NZHA 4DR4Q 3CCVA 1W2BA 3K7UC 3J80i 1XMOQ 4NXML 1L1OA 3AFQA 1FVIA 2BA1A 3KF8B 4ME3A 1CSQA 4LFBL 4BY7H 3RZOH 4IFDJ 1VQDA 1A62A 2YTYA 3SGIA 3J7ZC 4APVA 1U0LA 3BZCA 1XJVA 1VQJA 2VQEQ 4PG3A 5JJKA 1J6QA 3S2DH 3M4PA 2NVQH 2NN6G 3UDIA 4R4QA 2V1CC 1VQ8A 4DV5Q 2N78A 1B70B 4QIWE 1OXTA 1PYBA 2PI2E 3S1RH 1EIYB 1MIUA 4GN3B 1CSPA 3I56A 4UY8C 5LMUQ 2Z6KA 4TQUS 4X65Q 4JI1Q 3F2DA 1OXVA 4EQ5A 1G291 3CMAA 3S16H 4JV5Q 1Q1BA 2KBNA 3GTLH 1VQPA 1Q8KA 2JE6I 2VQEL 4A3DH 4R4IA 1M90C 2PMZE 3ICEA 4GKKQ 4KLKA 2UXBQ 2ZTDA 4A3MG 1N8RC 4IJHA 5C3EH 4K0KQ 4DV5L 2VZAA 3RN5A 1V43A 2R93G 3CCEA 4YCWA 2HT1A 4X64Q 5IWAL 1UEBA 2ZM6Q 1WJJA 1LYLA 2OCEA 5LMUL 4X65L 3A5ZB 4JI1L 4LWCA 1PH7A 5M5YH 3CMEA 4JV5L 5IP7G 5GQOA 1E22A 4NPSA 2UXBL 2VQFQ 1TWCH 3H0GH 1T9HA 2UXCQ 4K0KL 3BZKA 5IYDG 3L2PA 1WFQA 2R7FA 3STBC 4AYBE 3D0FA 5JEAG 3S17H 4X64L 2JQOA 1ASYA 4LUZA 2ZM6L 4KI0A 5IP9H 5IYBG 1PVOA 1I50H 1MJEA 2VS1A 4YCUA 1VQOA 1YEZA 2K5NA 3RLFA 1Q12A 4YCVA 2QGQA 3KJPA 2CWPA 2RHQB 1VQHA 5HGQA 4X6AH 2IY5B 2Y0SE 3HOZH 1IBMQ 1GD7A 2VQFL 1WCMG 3K81C 1PV4A 2UXCL 4DR5Q 1D8LA 1NMGA 4L5TA 2YU9H 1H95A 2FXQA 4O2DA 1VQNA 3H3VH 1UE5A 4YWLA 4JG2A 5LMNW 1HZ9A 4GLAC 1S3OA 4Y7NH 1PH1A 2OQ0A 1SRUA 3S14H 1PH8A 1K9MC 1YHAA 1Q1EA 4AYBG 1L2FA 1Z9FA 1CKNB 1Q81C 3DLLA 2N8NA 1PH6A 4MTNA 1HNXQ 2D0OA 1IBML 4DPGA 3FKIH 1E3PA 5ELNA 4BA2I 2WFWA 3UDXA 3CCRA 4DR5L 4OO1G 1HZBA 1X3GA 2ALYB 1VQBA 4H02A 2Y0SG 3PUWA 1X6OA 2QEXA 1KRTA 1Y1VG 1YJWA 1XTDA 4DNIA 5M3MG 4YHHQ 4A3LG 3CCLA 3W1GA 1I3QH 3CF5A 3OW2A 4PZ6A 1XPOA 2EQSA 1HR0W 3I2ZA 2JA6H 3CXCA 5FJ8G 3CPWA 4C2MH 2R92G 4JOIA 1CUKA 2KCTA 4A93G 5IY0A 1HNXL 3K8AA 4FDBA 1TWHH 4GS3A 5HY6A 3W5OA 1XMQQ 3T1HQ 3U4VA 4JI3Q 2VUMH 3KLWA 4A3CH 1YIJA 3GTGH 3Q8DA 4A75A 4LF9Q 3PO3G 1VQAA 1TXYA 2WB1E 3AQQA 4UPAA 2NN6I 4XIGS 4IO9A 4LUOA 3S2HH 2PNHA 3UE0A 4OX9Q 1X3EA 4YHHL 3GDEA 4IPDA 2ZTEA 1JMCA 4NXMQ 4LF5Q 1E7ZA 2GVAA 5FLMG 3KFUA 3STBD 4JBJA 4NB3A 1UE6A 3G71A 2LXKA 4DV4Q 4NXNQ 3HOUG 1GVPA 1I94L 3PUXA 1N33Q 1KIXA 1C0AA 4JI3L 3T1HL 3G4SA 2N3SA 3LGJA 3K0XA 4R4CA 4BBSG 2K50A 2JA7G 5FLXc 2LSSA 4LF9L 2IHFA 4C3IH 1PA6A 4GN4B 3TS0A 2XGTA 3GD7A 1Y1WH 1MKHA 1SMXA 4BY1G 2OTJA 2R7DA 4P71A 3AEVA 2R6GA 3J80c 4OX9L 4BXXG 4JI0Q 2E2JH 1YNXA 2B3GA 2IHEA 4JI4Q 4LF4Q 4LF5L 2B63H 3HOVG 2HIXA 3G6EA 4NXNL 4DV4L 1UWVA 1KC8C 4GLXA 2K5HA 4UP9A 1N33L 3MXNB 1YITA 4P72A 1JJGA 3ULJA 1QUQB 1VS0A 4A3GG 2KCMA 3PO2G 4JI5Q 3S24A 3NEMA 4UP8A 3KJOA 4Y52H 4HIOA 4YWMA 5IWAQ 2F3IA 4YWKA 4IJLA 3PUVA 3PUZA 1KHIA 3AYHB 1JE5A 1Y14B 3KDFA 4B3ML 4JI0L 3ER0A 4JI4L 4LF4L 1W3SA 4PZ8A 4LF8L 1L1OC 5C4XG 3E9IA 2JEBI 3GTPH 4RMFA 2OTLA 2K52A 1QVFA 2UU9Q 1VQKA 1Z47A 2H5XA 2IT1A 2I5HA 2E5LQ 2A19A 3F1ZA 3U58A 2HIVA 4POFA 2I5LX 4A3JH 4JI5L 3H3VI 4WJ3M 2UXDL 1PFSA 1YJ9A 3KF6B 2K14A 4R4TA 4A3MH 1G6PA 4OXPA 1NTGA 4UP7A 4DUZQ 2F4VL 4DR2Q 1N34Q 2NVTH 1JJ2A 3M4QA 3F8TA 3GTOH 2R93H 2MO0A 4EX5A 2CKZB 3EN2A 1TWAH 1HNZQ 2VNUD 2KHJA 5C3EG 1OXXK 2UU9L 4A3KG 1YJNA 3HOWG 2VW9A 2E2HH 4A3BG 4A3FG 2E5LL 4GNXB 4L5RC 2K75A 5IE8A 4DV1Q 4LFAQ 5IP7H 2NVYH 3TEHB 4DV0Q 3RNUA 4HIMA 2CQOA 3KOJA 4XTCS 4LF6Q 5IYDH 4GOPB 4LFCL 4DUZL 4YY3Q 4DV3Q 2NVXH 3WWVA 4DR2L 1N34L 3CD6A 1KXLA 1VQEA 4AQYQ 3HOYG 3CCMA 1VQGA 2AWNA 3ULPA 5JJIA 2ID0A 5C0XI 2AKWB 2D0PA 4BBRG 3OTOQ 1PH9A 3CW2C 3CPFA 2NZOA 5IYBH 3HOXG 3PF5A 1NJIC 3JC66 4R1JA 1IYJB 1AH9A 4LW1A 1N36Q 1VQMA 3VDYA 4DV1L 1Q7YC 2JA5G 4LFAL 3T1YQ 4DV0L 2PQAB 4JYAQ 1X65A 1XNRL 1KQSA 2HHHQ 2R7ZH 1BKBA 3I4OA 4O0AA 2JA8G 4JI8Q 5M3FG 1WCMH 2EXDA 3PV0A 3PIOA 4LF6L 3G48A 1IXRA 4KHZA 4YY3L 4DV3L 4DV6Q 4QL5A 2CWAA 4AQYL 3TS2A 4DAMA 1E24A 1P16A 1GO3E 2RF4A 5H1SE 2Z0SA 3OTOL 3I7FA 4GNXC 4A76A 2AMCB 2KHIA 5IYCH 1SLJA 4PZ7A 1PH2A 1N36L 4LUVA 4JI2Q 3T1YL 2XTIA 4JYAL 3HKZE 4GOPC 3I4NH 1GM5A 2HHHL 3F2CA 1FJGQ 4JI7Q 4JI8L 2OQKA 3J81j 3TRZA 1X3FA 4DV6L 4HJ7A 1ASZA 2CFMA 4IOCA 4L5SA 1Y1VH 3FKIG 5GAEC 4HIKA 1I94Q 2MNAA 2BA0A 3PGZA 4DV2L 4JBWA 3ERSX 2VL6A 1V1QA 4LNQA 2UUCQ 2F52A 5FJ8H 1WI5A 4JI2L 2C35B 4A3EG 2R92H 3A0JA 4A93H 2QA4A 4IFDG 4OWWB 1FJGL 2HQLA 3FHWA 4JI7L 3RN2A 2DUDA 3W1BA 1CKNA 1C7YA 2ZJRA 3PO3H 2JA9A 4GN5A 4P75A 4X62Q 3S1QH 1SN8A 2GN5A 4GKJQ 1FGUA 3E0EA 1VQIA 5C44H 1WYDA 3U4ZA 4OWXB 1EFWA 3I4MG 2Q2TA 3CAMA 5GADC 2Q2HA 4A3IG 3M3YH 1L1OB 2B29A 1UE1A 4MZ9A 3ZJYC 1N32L 4JOIC 5E7NA 5FLMH 3M85A 4DR7Q 5LMNQ 4B3SL 3JAMi 1VQ9A 2UUCL 2YTVA 3ULLA 1SR3A 4GLVB 1J5EQ 1XNQQ 2L15A 4HJAA 1PYSB 2MO1A 5AJ3Q 1WOCA 3NBHB 2OWOA 1VQCA 3HKSA 4DR1Q 1R9TH 1EQQA 1IBLQ 4BBSH 1EUJA 2JA7H 3E9HA 4B3MQ 1HNZL 4LF8Q 4X62L 2WB1G 1K8AC 4GKJL 3OYYA 2MQHA 3U50C 4DV7Q 1JJCB 3A74A 4BY1H 4BXXH 1KRSA 1JB7A 3GTKH 4X66Q 4P74A 3I55A 5ELOA 2WAQE 1VQ7A 4AIMA 4DR7L 5LMNL 1S40A 5C0XJ 3EIVA 1J5EL 1YVCA 1XNQL 4JC0A 3PIPA 5AJ3L 1KAWA 2UXDQ 2E8GA 1HR0Q 1M1KC 4OWTB 2BH8A 4DR1L 1AE2A 4DR3Q 1IBLL 3GO5A 4A3GH 4WJ4A 3UE1A 5BR8L 3D31A 3PO2H 2F4VQ 5GROA 2D62A 1LUZA 5K36G 4DAYB 5GAHC 4DV7L 2YYZA 4JBMA 3RZDH 2ATWA 1CKMA 4X66L 1LM0A 3M9BA 1SE8A 4DUYQ 4JI6Q 5C4XH 1FL0A 3PCOB 4B3RL 2WAQG 1I5FA 3PSIA 1HR0L 3FP9A 2JJQA 5C4JH 4DR3L 4BY7G 1V9PA 2UUBQ 3B6YA 1QVGA 4DR4L 4QJFA 4LFCQ 3CCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AFP A;  3EBE A;  4RG1 A;  1RL2 A;  2Q2I A;  1XMO L;  1S72 A;  4A3D G;  1G51 A;  2Z6K C;  3HFZ B;  3KYH C;  3TRE A;  1QUQ A;  4KHP Q;  1D7Q A;  2IX1 A;  3PF4 A;  1X55 A;  1NMF A;  1Q46 A;  4PMW A;  1HZA A;  1IBK Q;  1OTC A;  4HJ5 A;  4OON A;  4P73 A;  4DUY L;  4A3J G;  1KD1 C;  4JI6 L;  4L5Q A;  5IT9 c;  5JJL A;  1A8V A;  5EAY A;  1VQL A;  5DLQ E;  1XNR Q;  2ZJQ A;  2AHO B;  1EQR A;  4HJ9 A;  3K80 C;  4A3K H;  3HOW H;  3S15 H;  4A3B H;  2UUB L;  4A3F H;  1EIF A;  4OO1 I;  1K83 H;  2K5V A;  1O7I A;  1NBW A;  2E2I H;  1PH5 A;  4J15 A;  4DK6 C;  2N49 A;  1YZ6 A;  4HJ8 A;  4POG A;  4KHP L;  3CC7 A;  3H0G G;  1X56 A;  1IBK L;  3TQY A;  2ZJP A;  3GTJ H;  1EOV A;  4GKK L;  1DGS A;  3HOY H;  1KL9 A;  3KF6 A;  3F2B A;  2RCN A;  3RLN A;  4BBR H;  1X9N A;  1P8L A;  2Q2U A;  3J81 c;  3HOX H;  3A5U A;  1RIP A;  5IP9 G;  3CC2 A;  3J81 i;  1UE7 A;  2ASB A;  3GTQ H;  3NEN A;  4QGU A;  1VQ5 A;  1K3R A;  1XPU A;  4R4O A;  2JA5 H;  4IFD I;  1NY4 A;  1YHB A;  4DKA C;  1N9W A;  2MFI A;  1PHJ A;  1K73 C;  3HOZ G;  2JA8 H;  1SRO A;  5M3F H;  3BJU A;  1B7Y B;  4LF7 Q;  1TWG H;  1VQF A;  4GNX A;  4DV2 Q;  4B3T Q;  1OXU A;  4HID A;  2R7Z G;  4BA1 I;  1JT8 A;  5GAG C;  2K4K A;  2YV5 A;  4A4I A;  1OXS C;  2AWO A;  4GOP A;  4JBK A;  2A1A A;  1YBY A;  5J3B A;  1IZ6 A;  4IPC A;  3CCQ A;  1SFO H;  3CQZ H;  3DM3 A;  5IYC G;  3IRB A;  4LF7 L;  1MJC A;  1EWI A;  3UDF A;  5M3M H;  4A3L H;  1QVC A;  1A63 A;  5JEA J;  2VY3 A;  1N32 Q;  1QZG A;  1C9O A;  2I0Q A;  4B3T L;  3S1N H;  3GTM H;  2PQA A;  2EIF A;  4B3S Q;  3I4N G;  5M5W H;  4DK3 C;  1LTL A;  1Q82 C;  1PH3 A;  1L0W A;  4AH6 A;  4IPG A;  1BBU A;  1X54 A;  1HH2 P;  2KEN A;  2JA6 G;  3CP0 A;  3CCJ A;  4IOA A;  3L7Z C;  1CKO A;  2JK8 A;  4A3E H;  3HKZ G;  1HJP A;  1AE3 A;  3BU2 A;  4IPH A;  4C3H H;  5C0X G;  2CCZ A;  3CC4 A;  3MEF A;  2VUM G;  4A3C G;  4QQB X;  1PH4 A;  3RR5 A;  3NEL A;  2BH2 A;  2PI2 A;  1VQ6 A;  1TWF H;  3H15 A;  4JCV E;  4DR6 Q;  1YI2 A;  3JAM c;  3I4M H;  4C3J H;  2DGY A;  3HOU H;  1I6H H;  4A3I H;  3PUY A;  2I5M X;  2A8V A;  5M5X H;  3L0O A;  2UUA Q;  2RHS B;  1K8G A;  1HNW Q;  2LXJ A;  1E1T A;  2GVB A;  5C44 G;  1K0R A;  2ZTC A;  5BR8 Q;  3RLO A;  2WP8 J;  1B8A A;  1HZC A;  1BBW A;  4QY7 A;  3M7N A;  1YHQ A;  3UDG A;  4LFB Q;  1GKH A;  3KDF B;  3CCU A;  2JEA I;  3K7A H;  1U5K A;  4DR6 L;  3M4O H;  3HOV H;  2YTX A;  4ALP A;  1E1O A;  2IX0 A;  1VCI A;  1NE3 A;  4MNO A;  4TVA B;  1Y1W G;  1XMQ L;  1Q86 C;  3J7A 5;  1BVS A;  1QZH A;  1A0I A;  1VQ4 A;  3S1M H;  2ES2 A;  1XPR A;  1EYG A;  4B3R Q;  2UUA L;  2B63 G;  1IL2 A;  1HNW L;  2NZH A;  4DR4 Q;  3CCV A;  1W2B A;  3K7U C;  3J80 i;  1XMO Q;  4NXM L;  1L1O A;  3AFQ A;  1FVI A;  2BA1 A;  3KF8 B;  4ME3 A;  1CSQ A;  4LFB L;  4BY7 H;  3RZO H;  4IFD J;  1VQD A;  1A62 A;  2YTY A;  3SGI A;  3J7Z C;  4APV A;  1U0L A;  3BZC A;  1XJV A;  1VQJ A;  2VQE Q;  4PG3 A;  5JJK A;  1J6Q A;  3S2D H;  3M4P A;  2NVQ H;  2NN6 G;  3UDI A;  4R4Q A;  2V1C C;  1VQ8 A;  4DV5 Q;  2N78 A;  1B70 B;  4QIW E;  1OXT A;  1PYB A;  2PI2 E;  3S1R H;  1EIY B;  1MIU A;  4GN3 B;  1CSP A;  3I56 A;  4UY8 C;  5LMU Q;  2Z6K A;  4TQU S;  4X65 Q;  4JI1 Q;  3F2D A;  1OXV A;  4EQ5 A;  1G29 1;  3CMA A;  3S16 H;  4JV5 Q;  1Q1B A;  2KBN A;  3GTL H;  1VQP A;  1Q8K A;  2JE6 I;  2VQE L;  4A3D H;  4R4I A;  1M90 C;  2PMZ E;  3ICE A;  4GKK Q;  4KLK A;  2UXB Q;  2ZTD A;  4A3M G;  1N8R C;  4IJH A;  5C3E H;  4K0K Q;  4DV5 L;  2VZA A;  3RN5 A;  1V43 A;  2R93 G;  3CCE A;  4YCW A;  2HT1 A;  4X64 Q;  5IWA L;  1UEB A;  2ZM6 Q;  1WJJ A;  1LYL A;  2OCE A;  5LMU L;  4X65 L;  3A5Z B;  4JI1 L;  4LWC A;  1PH7 A;  5M5Y H;  3CME A;  4JV5 L;  5IP7 G;  5GQO A;  1E22 A;  4NPS A;  2UXB L;  2VQF Q;  1TWC H;  3H0G H;  1T9H A;  2UXC Q;  4K0K L;  3BZK A;  5IYD G;  3L2P A;  1WFQ A;  2R7F A;  3STB C;  4AYB E;  3D0F A;  5JEA G;  3S17 H;  4X64 L;  2JQO A;  1ASY A;  4LUZ A;  2ZM6 L;  4KI0 A;  5IP9 H;  5IYB G;  1PVO A;  1I50 H;  1MJE A;  2VS1 A;  4YCU A;  1VQO A;  1YEZ A;  2K5N A;  3RLF A;  1Q12 A;  4YCV A;  2QGQ A;  3KJP A;  2CWP A;  2RHQ B;  1VQH A;  5HGQ A;  4X6A H;  2IY5 B;  2Y0S E;  3HOZ H;  1IBM Q;  1GD7 A;  2VQF L;  1WCM G;  3K81 C;  1PV4 A;  2UXC L;  4DR5 Q;  1D8L A;  1NMG A;  4L5T A;  2YU9 H;  1H95 A;  2FXQ A;  4O2D A;  1VQN A;  3H3V H;  1UE5 A;  4YWL A;  4JG2 A;  5LMN W;  1HZ9 A;  4GLA C;  1S3O A;  4Y7N H;  1PH1 A;  2OQ0 A;  1SRU A;  3S14 H;  1PH8 A;  1K9M C;  1YHA A;  1Q1E A;  4AYB G;  1L2F A;  1Z9F A;  1CKN B;  1Q81 C;  3DLL A;  2N8N A;  1PH6 A;  4MTN A;  1HNX Q;  2D0O A;  1IBM L;  4DPG A;  3FKI H;  1E3P A;  5ELN A;  4BA2 I;  2WFW A;  3UDX A;  3CCR A;  4DR5 L;  4OO1 G;  1HZB A;  1X3G A;  2ALY B;  1VQB A;  4H02 A;  2Y0S G;  3PUW A;  1X6O A;  2QEX A;  1KRT A;  1Y1V G;  1YJW A;  1XTD A;  4DNI A;  5M3M G;  4YHH Q;  4A3L G;  3CCL A;  3W1G A;  1I3Q H;  3CF5 A;  3OW2 A;  4PZ6 A;  1XPO A;  2EQS A;  1HR0 W;  3I2Z A;  2JA6 H;  3CXC A;  5FJ8 G;  3CPW A;  4C2M H;  2R92 G;  4JOI A;  1CUK A;  2KCT A;  4A93 G;  5IY0 A;  1HNX L;  3K8A A;  4FDB A;  1TWH H;  4GS3 A;  5HY6 A;  3W5O A;  1XMQ Q;  3T1H Q;  3U4V A;  4JI3 Q;  2VUM H;  3KLW A;  4A3C H;  1YIJ A;  3GTG H;  3Q8D A;  4A75 A;  4LF9 Q;  3PO3 G;  1VQA A;  1TXY A;  2WB1 E;  3AQQ A;  4UPA A;  2NN6 I;  4XIG S;  4IO9 A;  4LUO A;  3S2H H;  2PNH A;  3UE0 A;  4OX9 Q;  1X3E A;  4YHH L;  3GDE A;  4IPD A;  2ZTE A;  1JMC A;  4NXM Q;  4LF5 Q;  1E7Z A;  2GVA A;  5FLM G;  3KFU A;  3STB D;  4JBJ A;  4NB3 A;  1UE6 A;  3G71 A;  2LXK A;  4DV4 Q;  4NXN Q;  3HOU G;  1GVP A;  1I94 L;  3PUX A;  1N33 Q;  1KIX A;  1C0A A;  4JI3 L;  3T1H L;  3G4S A;  2N3S A;  3LGJ A;  3K0X A;  4R4C A;  4BBS G;  2K50 A;  2JA7 G;  5FLX c;  2LSS A;  4LF9 L;  2IHF A;  4C3I H;  1PA6 A;  4GN4 B;  3TS0 A;  2XGT A;  3GD7 A;  1Y1W H;  1MKH A;  1SMX A;  4BY1 G;  2OTJ A;  2R7D A;  4P71 A;  3AEV A;  2R6G A;  3J80 c;  4OX9 L;  4BXX G;  4JI0 Q;  2E2J H;  1YNX A;  2B3G A;  2IHE A;  4JI4 Q;  4LF4 Q;  4LF5 L;  2B63 H;  3HOV G;  2HIX A;  3G6E A;  4NXN L;  4DV4 L;  1UWV A;  1KC8 C;  4GLX A;  2K5H A;  4UP9 A;  1N33 L;  3MXN B;  1YIT A;  4P72 A;  1JJG A;  3ULJ A;  1QUQ B;  1VS0 A;  4A3G G;  2KCM A;  3PO2 G;  4JI5 Q;  3S24 A;  3NEM A;  4UP8 A;  3KJO A;  4Y52 H;  4HIO A;  4YWM A;  5IWA Q;  2F3I A;  4YWK A;  4IJL A;  3PUV A;  3PUZ A;  1KHI A;  3AYH B;  1JE5 A;  1Y14 B;  3KDF A;  4B3M L;  4JI0 L;  3ER0 A;  4JI4 L;  4LF4 L;  1W3S A;  4PZ8 A;  4LF8 L;  1L1O C;  5C4X G;  3E9I A;  2JEB I;  3GTP H;  4RMF A;  2OTL A;  2K52 A;  1QVF A;  2UU9 Q;  1VQK A;  1Z47 A;  2H5X A;  2IT1 A;  2I5H A;  2E5L Q;  2A19 A;  3F1Z A;  3U58 A;  2HIV A;  4POF A;  2I5L X;  4A3J H;  4JI5 L;  3H3V I;  4WJ3 M;  2UXD L;  1PFS A;  1YJ9 A;  3KF6 B;  2K14 A;  4R4T A;  4A3M H;  1G6P A;  4OXP A;  1NTG A;  4UP7 A;  4DUZ Q;  2F4V L;  4DR2 Q;  1N34 Q;  2NVT H;  1JJ2 A;  3M4Q A;  3F8T A;  3GTO H;  2R93 H;  2MO0 A;  4EX5 A;  2CKZ B;  3EN2 A;  1TWA H;  1HNZ Q;  2VNU D;  2KHJ A;  5C3E G;  1OXX K;  2UU9 L;  4A3K G;  1YJN A;  3HOW G;  2VW9 A;  2E2H H;  4A3B G;  4A3F G;  2E5L L;  4GNX B;  4L5R C;  2K75 A;  5IE8 A;  4DV1 Q;  4LFA Q;  5IP7 H;  2NVY H;  3TEH B;  4DV0 Q;  3RNU A;  4HIM A;  2CQO A;  3KOJ A;  4XTC S;  4LF6 Q;  5IYD H;  4GOP B;  4LFC L;  4DUZ L;  4YY3 Q;  4DV3 Q;  2NVX H;  3WWV A;  4DR2 L;  1N34 L;  3CD6 A;  1KXL A;  1VQE A;  4AQY Q;  3HOY G;  3CCM A;  1VQG A;  2AWN A;  3ULP A;  5JJI A;  2ID0 A;  5C0X I;  2AKW B;  2D0P A;  4BBR G;  3OTO Q;  1PH9 A;  3CW2 C;  3CPF A;  2NZO A;  5IYB H;  3HOX G;  3PF5 A;  1NJI C;  3JC6 6;  4R1J A;  1IYJ B;  1AH9 A;  4LW1 A;  1N36 Q;  1VQM A;  3VDY A;  4DV1 L;  1Q7Y C;  2JA5 G;  4LFA L;  3T1Y Q;  4DV0 L;  2PQA B;  4JYA Q;  1X65 A;  1XNR L;  1KQS A;  2HHH Q;  2R7Z H;  1BKB A;  3I4O A;  4O0A A;  2JA8 G;  4JI8 Q;  5M3F G;  1WCM H;  2EXD A;  3PV0 A;  3PIO A;  4LF6 L;  3G48 A;  1IXR A;  4KHZ A;  4YY3 L;  4DV3 L;  4DV6 Q;  4QL5 A;  2CWA A;  4AQY L;  3TS2 A;  4DAM A;  1E24 A;  1P16 A;  1GO3 E;  2RF4 A;  5H1S E;  2Z0S A;  3OTO L;  3I7F A;  4GNX C;  4A76 A;  2AMC B;  2KHI A;  5IYC H;  1SLJ A;  4PZ7 A;  1PH2 A;  1N36 L;  4LUV A;  4JI2 Q;  3T1Y L;  2XTI A;  4JYA L;  3HKZ E;  4GOP C;  3I4N H;  1GM5 A;  2HHH L;  3F2C A;  1FJG Q;  4JI7 Q;  4JI8 L;  2OQK A;  3J81 j;  3TRZ A;  1X3F A;  4DV6 L;  4HJ7 A;  1ASZ A;  2CFM A;  4IOC A;  4L5S A;  1Y1V H;  3FKI G;  5GAE C;  4HIK A;  1I94 Q;  2MNA A;  2BA0 A;  3PGZ A;  4DV2 L;  4JBW A;  3ERS X;  2VL6 A;  1V1Q A;  4LNQ A;  2UUC Q;  2F52 A;  5FJ8 H;  1WI5 A;  4JI2 L;  2C35 B;  4A3E G;  2R92 H;  3A0J A;  4A93 H;  2QA4 A;  4IFD G;  4OWW B;  1FJG L;  2HQL A;  3FHW A;  4JI7 L;  3RN2 A;  2DUD A;  3W1B A;  1CKN A;  1C7Y A;  2ZJR A;  3PO3 H;  2JA9 A;  4GN5 A;  4P75 A;  4X62 Q;  3S1Q H;  1SN8 A;  2GN5 A;  4GKJ Q;  1FGU A;  3E0E A;  1VQI A;  5C44 H;  1WYD A;  3U4Z A;  4OWX B;  1EFW A;  3I4M G;  2Q2T A;  3CAM A;  5GAD C;  2Q2H A;  4A3I G;  3M3Y H;  1L1O B;  2B29 A;  1UE1 A;  4MZ9 A;  3ZJY C;  1N32 L;  4JOI C;  5E7N A;  5FLM H;  3M85 A;  4DR7 Q;  5LMN Q;  4B3S L;  3JAM i;  1VQ9 A;  2UUC L;  2YTV A;  3ULL A;  1SR3 A;  4GLV B;  1J5E Q;  1XNQ Q;  2L15 A;  4HJA A;  1PYS B;  2MO1 A;  5AJ3 Q;  1WOC A;  3NBH B;  2OWO A;  1VQC A;  3HKS A;  4DR1 Q;  1R9T H;  1EQQ A;  1IBL Q;  4BBS H;  1EUJ A;  2JA7 H;  3E9H A;  4B3M Q;  1HNZ L;  4LF8 Q;  4X62 L;  2WB1 G;  1K8A C;  4GKJ L;  3OYY A;  2MQH A;  3U50 C;  4DV7 Q;  1JJC B;  3A74 A;  4BY1 H;  4BXX H;  1KRS A;  1JB7 A;  3GTK H;  4X66 Q;  4P74 A;  3I55 A;  5ELO A;  2WAQ E;  1VQ7 A;  4AIM A;  4DR7 L;  5LMN L;  1S40 A;  5C0X J;  3EIV A;  1J5E L;  1YVC A;  1XNQ L;  4JC0 A;  3PIP A;  5AJ3 L;  1KAW A;  2UXD Q;  2E8G A;  1HR0 Q;  1M1K C;  4OWT B;  2BH8 A;  4DR1 L;  1AE2 A;  4DR3 Q;  1IBL L;  3GO5 A;  4A3G H;  4WJ4 A;  3UE1 A;  5BR8 L;  3D31 A;  3PO2 H;  2F4V Q;  5GRO A;  2D62 A;  1LUZ A;  5K36 G;  4DAY B;  5GAH C;  4DV7 L;  2YYZ A;  4JBM A;  3RZD H;  2ATW A;  1CKM A;  4X66 L;  1LM0 A;  3M9B A;  1SE8 A;  4DUY Q;  4JI6 Q;  5C4X H;  1FL0 A;  3PCO B;  4B3R L;  2WAQ G;  1I5F A;  3PSI A;  1HR0 L;  3FP9 A;  2JJQ A;  5C4J H;  4DR3 L;  4BY7 G;  1V9P A;  2UUB Q;  3B6Y A;  1QVG A;  4DR4 L;  4QJF A;  4LFC Q;  3CCS A; 
#chains in the Genus database with same CATH topology
 4OHJ A;  1RL2 A;  4Q0F A;  3HFZ B;  3KYH C;  1D7Q A;  4H13 C;  1Q46 A;  2HDM A;  2PO4 A;  4OON A;  2OT2 A;  4JI6 L;  2KUM A;  4L5Q A;  5IT9 c;  5FO9 B;  3P1H A;  2ZJQ A;  2AHO B;  3K80 C;  4RHR A;  4A3B H;  3SR1 A;  4A3F H;  2PPB C;  1PH5 A;  4J15 A;  1BXT A;  1I4X A;  1YZ6 A;  4BY7 B;  3KLS A;  4POG A;  1JQY D;  3P20 A;  4RKL A;  5C4X B;  2GA4 B;  3GTJ H;  2NVQ B;  2H1E A;  4JK1 C;  1KL9 A;  1PZK D;  3KF6 A;  2N55 A;  3FEW X;  2RCN A;  3RLN A;  2Q2U A;  1C4Q A;  4R8N A;  3GTQ H;  4QGU A;  1K3R A;  4R4O A;  4XYQ A;  4DKA C;  1N9W A;  3EFX D;  2MFI A;  1K73 C;  2JA8 H;  1SRO A;  5M3F H;  3BJU A;  5A2Q E;  3L9A X;  1PTO F;  5L37 A;  4EQN A;  4HID A;  3FPP A;  3DUZ A;  2K4K A;  2YV5 A;  4A4I A;  1OXS C;  2AWO A;  3LWE A;  2E2I B;  3J7Y W;  3CCQ A;  4N9T A;  3IRB A;  5M3M H;  1S5E D;  1EY8 A;  2AUJ D;  2VY3 A;  3HOY B;  1B53 A;  2IPK D;  1SE3 A;  4DK3 C;  1KLU D;  1CZG A;  2KEN A;  4ZKB B;  2JA6 G;  3K58 A;  3CCJ A;  4OEL B;  1CKO A;  3D6W A;  3HKZ G;  4C3H H;  3NWS A;  4IPH A;  2WAC A;  1FYC A;  3NEL A;  2PI2 A;  1YI2 A;  3L3O C;  3I4M H;  5I4D A;  2DGY A;  1FR3 A;  1SSO A;  1K8G A;  1HNW Q;  1E1T A;  1IW7 C;  3S14 B;  1B8A A;  4LFB Q;  1U5K A;  1HTL D;  3FKI B;  3QOL A;  1I4H A;  2X6L A;  1LTT D;  2F0F A;  1GUW A;  4IAL A;  1XPR A;  2B63 G;  1HNW L;  4KTA A;  4A3E B;  4DR4 Q;  3CCV A;  1XMO Q;  2JA6 B;  1U4M A;  4ZAI A;  3KF8 B;  4LFB L;  1CSQ A;  4N8F A;  3RZO H;  1JWM D;  3HKZ B;  3SGI A;  3J7Z C;  4APV A;  2K03 A;  1A6X A;  3DEP A;  1VQJ A;  3NBH A;  3TZU A;  1J6Q A;  3M4P A;  3FPU B;  5KYI A;  2KEE A;  4RH6 A;  1VQ8 A;  5IGB A;  2N78 A;  1RJT A;  5I2Y A;  3CRL C;  2B2W C;  4HCE A;  3Q6S A;  2LKV A;  1L0X B;  2FMC A;  5CBE E;  3NXW A;  4X65 Q;  4EQ5 A;  1G29 1;  4HMI A;  1VQP A;  2JE6 I;  4A3D H;  4GKK Q;  1SNQ A;  4OGQ C;  2UXB Q;  1N8R C;  4O1N A;  3IKJ A;  4IJH A;  5C3E H;  5CR3 A;  4K0K Q;  1LAC A;  1V43 A;  3MZ5 A;  1B9M A;  1G91 A;  4KKU A;  2B63 B;  1UEB A;  1SNC A;  1LYL A;  5HGT A;  1PZI D;  4X65 L;  1X32 A;  4LWC A;  4CHT B;  3K57 A;  3U9S A;  1FNW A;  3K5M A;  2UXB L;  3H0G H;  5EKI A;  2B2U C;  2QW7 A;  2QEJ C;  3BZK A;  4K0K L;  1KAA A;  1WFQ A;  1V1P A;  3NBI A;  5ELD A;  3S1R B;  3WOE A;  4U67 3;  2XNA C;  2MP1 A;  1ILP A;  1CA6 A;  2EY2 A;  1MJE A;  4YCU A;  3MFY A;  2K5N A;  3RLF A;  3K0Y A;  1Q12 A;  5FK9 C;  5HGQ A;  2Y0S E;  1T5X D;  3HOZ H;  1IBM Q;  1GD7 A;  4A3J B;  3VA7 A;  1D8L A;  3SHL A;  2YU9 H;  1MI2 A;  3H3V H;  1PRT C;  3PQI A;  4JG2 A;  2B2T C;  3BDO A;  1SRU A;  4H7B A;  4AYB G;  1STA A;  1CKN B;  1Z9F A;  2N8N A;  2G5D A;  4DXF A;  1HNX Q;  2AQ1 B;  1IBM L;  1WTH A;  3CHB D;  1YNN C;  4OO1 G;  3QB3 A;  4H02 A;  1LT3 D;  2E2D C;  1KTK A;  1X6O A;  3OWE B;  1XTD A;  3NPP A;  1YJW A;  4DNI A;  1TY0 A;  3I70 A;  3OW2 A;  4PZ6 A;  1XPO A;  1TT2 A;  2EQS A;  5KNB A;  3CPW A;  4A93 G;  1HNX L;  5C0X H;  4GS3 A;  3K8A A;  3M7G A;  3W5O A;  1XMQ Q;  3GTG H;  2A69 D;  1EZ6 A;  1JIC A;  3Q8D A;  3PO3 G;  3VYU A;  3OPO A;  1VQA A;  1CHP D;  3I90 A;  5FO8 B;  4LUO A;  4IUQ A;  1JE4 A;  2B8F A;  5C5L A;  3GDE A;  2ZTE A;  4NXM Q;  2GVA A;  3D4D A;  2XSC A;  1UE6 A;  4NXN Q;  2LXK A;  3KK7 A;  3PUX A;  1KIX A;  3J7A F;  1DM0 B;  2N3S A;  3LGJ A;  4R4C A;  2F0J A;  2LSS A;  2IHF A;  5ELB A;  1EY6 A;  1MKH A;  1SMX A;  1TS4 A;  4BY1 G;  2OTJ A;  3AEV A;  3VYT A;  2PW5 A;  4DXG A;  3J80 c;  1L0Y B;  2E2J H;  2DY7 A;  1JOK A;  4JI4 Q;  4LF4 Q;  3G6E A;  4NXN L;  4GLX A;  3NSW A;  1UUP A;  2K5H A;  5BN3 A;  4UDU C;  3ZYY X;  1JJG A;  1QUQ B;  3KLS X;  2O2L D;  4K6L A;  4A93 B;  3GV6 A;  3PO2 G;  1RDP D;  3S2H B;  3LWU A;  3GQB A;  4LAA A;  3IFT A;  3PO3 B;  1IKL A;  2NN6 H;  2NZ1 D;  1EYA A;  1I4Q A;  3PUV A;  3PUZ A;  3KDF A;  4GZY C;  1Y14 B;  1YNN D;  4B3M L;  4JI4 L;  5C44 B;  4LF4 L;  1W3S A;  1BCP B;  2P5Z X;  3K59 A;  3GTP H;  1O78 A;  2OTL A;  4ABN A;  1G2T A;  1B3A A;  4C3I B;  2A19 A;  3VR4 A;  3U58 A;  2HIV A;  4WJ3 M;  1STE A;  2K14 A;  4R4T A;  3P7J A;  1TR5 A;  2EY5 A;  1ROD A;  4DUZ Q;  1SDF A;  4DR2 Q;  2BOS A;  1N34 Q;  2R93 H;  3F8T A;  3VYR A;  1GUG A;  2CKZ B;  1LO5 D;  2J0T D;  3EQL C;  2VNU D;  5EBD A;  1LTS D;  1YJN A;  2E2H H;  4A3B G;  1LT4 D;  3MWY W;  4A3F G;  2QKI C;  2K75 A;  4LFA Q;  5IP7 H;  4DV0 Q;  3N6R A;  2CQO A;  3PO2 B;  2C9O A;  5IGD A;  5IYD H;  3KUP A;  4LFC L;  4DUZ L;  4YY3 Q;  2NVX H;  4DR2 L;  1N34 L;  1EZ8 A;  1ICW A;  1DCZ A;  4XDX A;  5JEA H;  1AEX A;  2AKW B;  1PH9 A;  3CPF A;  1OO9 B;  4XQN A;  4FP5 D;  4QB4 A;  3MXP A;  1IYJ B;  1AH9 A;  3VDY A;  4LFA L;  1A2U A;  4DV0 L;  4A3M B;  2RDH A;  1BKB A;  3I4O A;  2JA8 G;  4JI8 Q;  5M3F G;  3PV0 A;  2F0T A;  1CTM A;  3CKI B;  1DD2 A;  4KHZ A;  4YY3 L;  1B44 D;  1SJH D;  2L12 A;  4PQX A;  1P16 A;  1GO3 E;  3E6Z X;  2H4O A;  1JR0 D;  2KHI A;  1A3V A;  2Z9H A;  4PZ7 A;  4J8Q A;  4F8M A;  4JI2 Q;  2I46 A;  3HKZ E;  4A3F B;  3UI2 A;  1FJG Q;  2M2L A;  4JI8 L;  1YNJ C;  3J81 j;  2PMZ B;  1I4P A;  5KNC A;  2CFM A;  3R93 A;  2DJF C;  1I94 Q;  2BA0 A;  5KND A;  4DV2 L;  3BZD B;  3ERS X;  5J39 A;  4QF4 A;  5FJ8 H;  1MGS A;  4DF7 A;  4JI2 L;  5G3L D;  4C3H G;  2QA4 A;  1IYU A;  1FJG L;  2DUD A;  2ZJR A;  4GN5 A;  3S1Q H;  2CQA A;  1KDA A;  3E0E A;  4PMC A;  3I4M G;  4QMG A;  3SK8 A;  1QWY A;  3ZJY C;  1N32 L;  5E7N A;  2O5J C;  1EQV A;  4YIJ A;  1JOO A;  5LMN Q;  3QWN A;  1ESR A;  1R4P B;  1JOQ A;  1R9T H;  3HP3 A;  1EUJ A;  2JA7 H;  2WII B;  3E9H A;  5COY A;  1F9P A;  4CKC A;  1Y1V B;  2WB1 G;  1QIL A;  1K8A C;  4UHV A;  4CJ2 C;  5M3M B;  2MQH A;  4BXX H;  5IOD A;  3C1F A;  4KY7 A;  4P74 A;  5CV4 A;  1F9S A;  3BDL A;  5C3X A;  1KNA A;  5LMN L;  1S40 A;  3J7A V;  4JC0 A;  4IUT A;  4FF4 A;  1KAW A;  2UXD Q;  2EYL A;  2BH8 A;  4OWT B;  1AE2 A;  4MIU A;  2L0C A;  3UE1 A;  3D31 A;  1A3U A;  1I4G A;  1QB5 D;  2D62 A;  2RVL A;  5IIF A;  1DYQ A;  1QNU A;  3RZD H;  4CDC C;  2ATW A;  1YNJ D;  5DEH A;  1QOH A;  1RHP A;  4RGO S;  3I4M B;  1NNX A;  1FL0 A;  4BBS B;  3FP9 A;  5C4J H;  1S5D D;  3BG3 A;  4LJZ C;  4P2C B;  4QJF A;  5EBC A;  4A3D G;  2KHS A;  1G51 A;  1S5C D;  2DNC A;  4KHP Q;  4WJW A;  2WB1 B;  3PF4 A;  1EFI D;  1AFP A;  1OTC A;  3OSO A;  1GHK A;  4KY6 A;  1J9O A;  3KBG A;  5EAY A;  1VQL A;  3MXU A;  3NWT A;  3QOJ A;  5E4W C;  1BDO A;  4HJ9 A;  3MAQ A;  4A3K H;  1WVL A;  2JSO A;  4DK6 C;  1RTN A;  2N49 A;  3RZO B;  4HJ8 A;  4KHP L;  3H0G G;  3C3L A;  2D2C C;  1DGS A;  1QNK A;  3FDT A;  2F0L A;  3BVZ A;  5FLX L;  3J81 c;  3CC2 A;  1RIP A;  3J81 i;  3I4L A;  3NEN A;  1V8Q A;  5FKA C;  4DFA A;  2JA5 H;  1YHB A;  3QJY A;  3HOZ G;  1RTO A;  2OF1 A;  1XWE A;  4RWS C;  3OIP A;  2TMP A;  4N8X 1;  3G6J B;  1OXU A;  4X3K A;  2R7Z G;  5C3E B;  5JPN C;  1JT8 A;  2XIW A;  2ICE C;  1K83 B;  2EPB A;  5J3B A;  3J81 E;  4KKT A;  1IZ6 A;  3HG9 A;  3TDQ A;  2PYK A;  4G57 A;  2IJ0 A;  2FFK B;  3IFD A;  5IYC G;  1Q8I A;  1A63 A;  1SJE D;  1C9O A;  1CK1 A;  2PQA A;  2EIF A;  4B3S Q;  2F0S A;  1PH3 A;  1IL8 A;  1D1I A;  3RUZ A;  1SYD A;  3CP0 A;  3O13 A;  5DNF A;  2JK8 A;  1HFG A;  1HJP A;  1AE3 A;  3BU2 A;  1QJO A;  1WTO A;  5C0X G;  4IFD H;  1TWG B;  2BH2 A;  1VQ6 A;  2K5Q A;  1TWF H;  4JCV E;  3JAM c;  4ZLT F;  2E76 C;  1ET6 A;  3OWF A;  3X3N A;  1I6H H;  3PUY A;  2I5M X;  2A8V A;  5M5X H;  3H94 A;  1CA5 A;  4NP5 A;  2F0N A;  5KYL A;  2GVB A;  1K0R A;  2ZTC A;  4M1U B;  5BR8 Q;  3RLO A;  3OW7 A;  3K6O A;  3D4W A;  1HZC A;  4KN4 C;  4QY7 A;  4R8I A;  5JPM C;  1H9K A;  3GTM B;  1HA5 A;  3M4O H;  3HEJ A;  1E1O A;  2IX0 A;  4MNO A;  1Q86 C;  3NHH A;  2FJ2 A;  1QZH A;  1VDZ A;  2LY7 A;  1VQ4 A;  2NZH A;  1HXY D;  2WIN B;  1L1O A;  1FVI A;  1NR4 A;  4IFD J;  2EYJ A;  1VQD A;  1A62 A;  2EJF C;  2YTY A;  4C3J B;  1FNU A;  5JJK A;  4PMB A;  3K5N A;  1C48 A;  3S2D H;  2NN6 G;  5FO7 B;  3QG1 A;  1MSG A;  1B70 B;  4MHE A;  1BCP F;  3C46 A;  1OXT A;  1EIY B;  4B9X A;  4GN3 B;  4UY8 C;  3K7A B;  4TQU S;  4JPB W;  4JI1 Q;  2QDL A;  3F2D A;  4C1N I;  1JC7 A;  3CMA A;  2EE1 A;  2KBN A;  3GTL H;  1K3B C;  1M90 C;  2PMZ E;  4KLK A;  4OL7 A;  4HN7 A;  3ND9 A;  2VZA A;  1QCB D;  4DK1 A;  2R93 G;  3CCE A;  4YCW A;  1DJR D;  4X64 Q;  4F88 A;  1H9S B;  3I91 A;  1XXG A;  5CV6 A;  4JI1 L;  2O4X A;  3C2P A;  5M5Y H;  3W3A A;  5IP7 G;  2KVM A;  5GQO A;  3N52 A;  1J8I A;  5CBA E;  2UXC Q;  5IYD G;  3L2P A;  1EY9 A;  1F9Q A;  1ICF B;  2R61 A;  2R7F A;  3D0F A;  3NUC A;  5JEA G;  4G7O C;  3S17 H;  4X64 L;  2WAQ B;  4CDD C;  3Q23 A;  5JVH 3;  1PVO A;  3GTP B;  1BUV T;  2KED A;  2EYM A;  4X6A H;  3K81 C;  1PV4 A;  2UXC L;  1NMG A;  1D5Z C;  4L5T A;  1H95 A;  2ICI A;  2EXZ A;  2F4I A;  2F0M A;  1S3O A;  2R93 B;  4K14 A;  1L2F A;  1H9R A;  3DLL A;  1C8C A;  1PH6 A;  4MTN A;  1TWC B;  3TP8 A;  1AW7 A;  2EDG A;  4DPG A;  3DWP A;  5D65 A;  4NMZ A;  3UDX A;  1F9R A;  1R4Q B;  1HZB A;  3PUW A;  4DNT B;  4FF2 A;  4C56 C;  2NVX B;  1I50 B;  1WD0 A;  4A3L G;  3CF5 A;  1Q3L A;  1K28 A;  1D5X C;  3CXC A;  2XVS A;  1EEF D;  5FJ8 G;  2NBF A;  4V19 0;  4JOI A;  1I4R A;  4FDB A;  1TWH H;  4EQP A;  1PTO C;  4FVM A;  2VUM H;  4A3C H;  3U4V A;  5E1F A;  5IT9 L;  4A75 A;  2JN4 A;  4LF9 Q;  4IQZ A;  1TXY A;  2WB1 E;  3AQQ A;  4KK7 A;  2NN6 I;  4UPA A;  3UE0 A;  1SE4 A;  1E7Z A;  4XYO A;  4JBJ A;  4DV4 Q;  4KY5 A;  2PQE A;  4NW2 A;  2F03 A;  1N33 Q;  3OMG A;  4K2K A;  2JA7 G;  1CQF A;  2QF7 A;  2PNR C;  4LF9 L;  2PZU A;  3AU7 A;  2QCP X;  4MN3 A;  2HD3 A;  2K1B A;  2R7D A;  4BXX G;  2JP1 A;  1YNX A;  2B3G A;  3HOV G;  2HIX A;  4C2M B;  1KC8 C;  4DV4 L;  1HHV A;  1MBY A;  1N33 L;  1EOT A;  3GV3 A;  3EA6 A;  1UNS A;  1ENC A;  3S24 A;  3R2T A;  4Y52 H;  3TP7 A;  1XTC D;  1SMY C;  3SK6 A;  4YWK A;  4IJL A;  4L6T B;  1F2L A;  3AYH B;  4LF8 L;  2JEB I;  2PZT A;  5CGK A;  4KD3 A;  2K52 A;  1SNM A;  1TKW B;  1Z47 A;  2IT1 A;  1E0B A;  2LMC B;  1IKM A;  1ZYR C;  2SOB A;  1F2M A;  3PIO 3;  1R9T B;  2HUG A;  2E74 C;  3KF6 B;  2JA7 B;  1PTO D;  1G6P A;  3TP6 A;  1PLF A;  4OXP A;  4UP7 A;  2NVT H;  3GTO H;  1G8Z D;  1E2Z A;  2TSS A;  1IW7 D;  1LTI D;  1TWA H;  3X3M A;  4KV6 A;  3ERQ A;  1OXX K;  3S9W A;  4A3K G;  2VW9 A;  1ZXT A;  1EL0 A;  5IE8 A;  4DV1 Q;  5I6W A;  3HGB A;  4HCS A;  3KOJ A;  4LF6 Q;  4KD4 A;  5A35 A;  4DV3 Q;  3WWV A;  2D5D A;  1VQG A;  2AWN A;  5JJI A;  2L9H A;  2ID0 A;  2D0P A;  1PFB A;  3PF5 A;  3JC6 6;  4LW1 A;  1VQM A;  2JA5 G;  4DV1 L;  2C5C A;  1Q7Y C;  5C4J B;  1XNR L;  2R7Z H;  3J7A 5;  4L8J A;  4LF6 L;  1M4V A;  1WCM H;  2EXD A;  4DV3 L;  1IYV A;  3DHQ A;  4DV6 Q;  3ND8 A;  1DON A;  4DAM A;  5JJZ A;  2RF4 A;  4GNX C;  3MVV A;  4QIW B;  2AMC B;  1U4R A;  5IYC H;  3MHB A;  2K05 A;  3SE0 A;  2NVY B;  4RCO A;  4LUV A;  2K32 A;  4GOP C;  2AUK A;  2A6E C;  2OQK A;  1F77 A;  1X3F A;  1ZYR D;  4DV6 L;  1ASZ A;  1K0S A;  1K8O A;  4ZKC B;  3PGZ A;  3NE5 B;  4FF3 A;  5I9O A;  1V1Q A;  4LNQ A;  1PXU A;  3D3R A;  1WI5 A;  2A68 C;  1A15 A;  4IFD G;  4I7A A;  2OXP A;  2HQL A;  2JA5 B;  3RN2 A;  4P75 A;  4X62 Q;  3Q0A A;  1EFW A;  1WYD A;  3U4Z A;  2Q8R E;  1SNO A;  4XT3 B;  3CAM A;  4AYB B;  1SAP A;  1B3Q A;  2B29 A;  4NKL A;  5FLM H;  3M85 A;  1SR3 A;  4GLV B;  1XNQ Q;  2L15 A;  1PYS B;  2A6H C;  2B8G A;  3NBH B;  2OWO A;  1VQC A;  4CBV A;  2MPM A;  3WDN A;  4QCL A;  2K04 A;  4B3M Q;  4X62 L;  1ZEQ X;  2OEO A;  1EQT A;  3OYY A;  1PRT D;  3DXJ C;  4DV7 Q;  1KRS A;  4X66 Q;  2WAQ E;  1WTQ A;  4AIM A;  2RA4 A;  1CQV A;  4H44 C;  3EIV A;  5C0X J;  1EIG A;  1MSH A;  4K8J A;  1XNQ L;  1HR0 Q;  1D2B A;  2ZXO A;  4B9W A;  2LS0 1;  2B2W A;  5JVG 3;  1EY4 A;  1PFN A;  5GRO A;  1LUZ A;  3BDC A;  3M3Y B;  4DV7 L;  2YYZ A;  4PV1 C;  1QG7 A;  1ZKO A;  2HDL A;  4ULL A;  4X66 L;  3M9B A;  4IUU A;  5C4X H;  4B3R L;  3NP8 A;  1I5F A;  3PSI A;  1HR0 L;  2JJQ A;  2F0G A;  2I07 B;  3B6Y A;  2UUB Q;  2XWJ B;  1ML0 D;  4LFC Q;  4BY1 B;  3AFP A;  1V1P B;  3EBE A;  1S72 A;  2Q2I A;  3GTK B;  1JCK B;  2Z6K C;  3T51 B;  3I72 A;  2KOL A;  1NMF A;  2N88 A;  4DNR B;  4HJ5 A;  1U9R A;  3T13 A;  3ERO A;  2B2U A;  4F87 A;  2RSO A;  5DLQ E;  5EPL A;  1STN A;  4L63 B;  3HOW H;  4OO1 I;  2UUB L;  1EIF A;  5HUR A;  2IX3 A;  2K5V A;  2E2I H;  3A55 A;  4ZUI A;  2A6H D;  2BE5 C;  4IUV A;  3CC7 A;  2KA7 A;  2EZV A;  1X56 A;  3MA2 B;  1HUN A;  3V05 A;  2K01 A;  3HOY H;  4ID6 A;  4BBR H;  1X9N A;  1P8L A;  2F0O A;  3TZD A;  3HOX H;  3BYY B;  2ASB A;  1O80 A;  2B2T A;  1Y69 U;  1XPU A;  3J80 L;  4IFD I;  5DAU A;  1G6Z A;  5KRU A;  1PHJ A;  4LF7 Q;  1CM9 A;  3GTL B;  4GNX A;  4XXE A;  4DV2 Q;  4B3T Q;  2CH4 A;  4BA1 I;  2ZXP A;  1SYE A;  5GAG C;  4IZ8 A;  4A3B B;  4V0B A;  4GOP A;  1ESF A;  2A1A A;  1I6V C;  2KCC A;  3D4R A;  5I9P A;  1Z7T A;  2SNM A;  5BN5 A;  4S3S A;  3E3X A;  2B39 A;  2K7V A;  3CQZ H;  2DN8 A;  2PZW A;  5E3F A;  5M5Y B;  4LF7 L;  1MJC A;  3UDF A;  2ENB A;  1SXT A;  3GTJ B;  4A3L H;  1QVC A;  5JEA J;  1N32 Q;  1QZG A;  5ELE A;  4KJO A;  2I0Q A;  3BVM A;  4B3T L;  3S1N H;  2E75 C;  1EYC A;  1TS3 A;  3I4N G;  2CHB D;  3SK4 A;  5M5W H;  3AB9 A;  1L0W A;  3GTQ B;  4KMU C;  1BNZ A;  2NTT A;  5DM6 3;  4EGV A;  4IOA A;  4G4K A;  2JXM B;  1FD7 D;  4A3E H;  2JA8 B;  1ENA A;  5M3F B;  3MEF A;  4RKB A;  2VUM G;  4A3C G;  4X3T A;  1PH4 A;  3RR5 A;  3MEH A;  2XRS D;  1H9M A;  1STB A;  3V96 A;  4A3I H;  3L0O A;  2UUA Q;  1X3P A;  3WOF A;  3HZX A;  5CYU A;  3E0J A;  2RDF A;  1BBW A;  5IGE A;  3UDG A;  2CVR A;  3KDF B;  2L4N A;  2JEA I;  4PNY A;  3HOV H;  2YTX A;  4ALP A;  3CU7 A;  2A73 B;  1A0I A;  3I8Z A;  3M4Y A;  3S1M H;  1WTP A;  2UUA L;  4NDX A;  3LX0 A;  5EPK A;  4C3H B;  1Y8O B;  2RDG A;  2EVB A;  3K7U C;  3E5S A;  3SXH A;  1GUS A;  4ME3 A;  1XYI A;  1WTR A;  4CKE A;  2VUM B;  1U0L A;  4FYD A;  3BZC A;  1XJV A;  2VQE Q;  2B2V C;  2EYF A;  3UDI A;  2Z4I A;  3HS0 C;  4R4Q A;  2HQE A;  1AP0 A;  1LT6 D;  2DNE A;  3TME A;  5LL6 S;  5FLX E;  4QIW E;  2PI2 E;  3S1R H;  2DY8 A;  1CI3 M;  1CSP A;  3MXN A;  3I56 A;  1LLR D;  2Z6K A;  2L11 A;  1OXV A;  3T4A C;  3S16 H;  4DU9 A;  1Q8K A;  2VQE L;  3VR2 A;  4R4I A;  3OIQ A;  4DAY A;  5IWA L;  1D6E C;  2ZM6 Q;  1SEB D;  2OCE A;  1NCV A;  4C1N K;  5KGU A;  1UEA B;  1PZJ D;  5EGT A;  4AYB E;  1F2Y A;  5CMD A;  1G2S A;  2JQO A;  2ZM6 L;  2PW7 A;  2BDN A;  1RF2 D;  5IP9 H;  2VS1 A;  1A3T A;  4A3D B;  3KJP A;  2SDF A;  1VQH A;  2SEB D;  5C4H A;  2EYH A;  1WCM G;  4RGT A;  4DR5 Q;  1VF7 A;  4FXD A;  2FXQ A;  3VA5 A;  4O2D A;  1VQN A;  1UE5 A;  3Q24 A;  2Q8T A;  1SYB A;  4YWL A;  5LMN W;  4ME5 A;  4X3U A;  1HZ9 A;  4GLA C;  4Y7N H;  1PH1 A;  2OQ0 A;  4WFN 3;  1SE2 A;  2AQ3 B;  1YHA A;  1K9M C;  1TWA B;  1SBB B;  1Q81 C;  2L1B A;  1PYW D;  2NUC A;  1PFM A;  5DM7 3;  1TS5 A;  3H0G B;  4U68 A;  1QE6 A;  5LL6 X;  1E3P A;  5ELN A;  4BA2 I;  5F2D A;  2WFW A;  4DR5 L;  2ALY B;  2Y0S G;  2QEX A;  1WTX A;  4YHH Q;  4RCN A;  3W1G A;  1I3Q H;  5EKK A;  2Z6B A;  3HOZ B;  1CUK A;  2X6G A;  2IL8 A;  1EU4 A;  1X3Q A;  4JI3 Q;  2KCN A;  2YU9 B;  1DOK A;  1AZP A;  2R7Z B;  5CV8 A;  1W6J A;  3D6C A;  1HA6 A;  2J7Z A;  3I73 A;  3S2H H;  1EY5 A;  2PNH A;  4YHH L;  4IPD A;  1JMC A;  2K5W A;  2K5D A;  5FLM G;  4DA2 A;  3KFU A;  2EYO A;  5JOB A;  4NB3 A;  3G71 A;  1NSN S;  3HOU G;  1GVP A;  1KNE A;  3D8G A;  1PDQ A;  1C0A A;  4JI3 L;  3R3O A;  1CZW A;  1SYG A;  2EYP A;  4C3I H;  4GN4 B;  1GOZ A;  2XGT A;  3TS0 A;  1Y1W H;  4P71 A;  2JYO A;  2RSN A;  2IHE A;  2DJG C;  4K5W A;  3LNN A;  5LHY 1;  1UWV A;  5D14 A;  3VR3 A;  4UP9 A;  3MXN B;  1YIT A;  3GTG B;  4CJ0 B;  3ULJ A;  1VS0 A;  4FXK C;  3KJO A;  3T56 B;  5C4Z A;  4HIO A;  4YWM A;  5IOC A;  4BY7 G;  3SEB A;  4PZ8 A;  1STY A;  5J22 A;  2NTS A;  2VXW A;  5C4X G;  1QVF A;  1VQK A;  2H5X A;  3EJI A;  1ENF A;  1E2V A;  4K5V A;  2E5L Q;  3F1Z A;  4IUN A;  2IW3 A;  4POF A;  3H3V I;  4RHS A;  1YJ9 A;  3K5O A;  1PTO H;  4FF1 A;  2E2J B;  4XQJ A;  3KF8 A;  4A3M H;  4RAU C;  5AFW A;  1V1O A;  4KHV A;  2F4V L;  1JJ2 A;  2EY1 A;  4DK0 A;  3NQI A;  3EN2 A;  1HNZ Q;  5J1Z A;  1ET9 A;  5ELC A;  1Q90 A;  3JAM L;  4LMQ D;  3HOW G;  3HRZ C;  2E5L L;  4L5R C;  5T1I A;  4TKO B;  1SNP A;  3RNU A;  1U4P A;  2D9U A;  1BCP C;  2O5I C;  4KN7 C;  2MHV A;  2ZXR A;  3DM1 A;  1VQE A;  3HOY G;  3CCM A;  3ULP A;  5C0X I;  1HNZ L;  4BBR G;  1T5E A;  2NZO A;  5IYB H;  3HOX G;  2B2Y C;  3ITP A;  2G9D A;  1MHW C;  4JYA Q;  2PQA B;  4UAI A;  1SYF A;  5IT9 E;  2HHH Q;  5CC4 A;  1EIH A;  3PIO A;  2X69 A;  3G48 A;  1IXR A;  4QL5 A;  2CWA A;  1E24 A;  1EWH A;  2Z0S A;  2E2H B;  2F0P A;  4DAP A;  1SLJ A;  4HTH A;  1PH2 A;  3QO2 A;  1WD1 A;  3HOW B;  1B1Z A;  4JYA L;  3I4N H;  2EOT A;  2HHH L;  3F2C A;  4JI7 Q;  5KEE A;  1LT5 D;  4HJ7 A;  4IOC A;  1UAP A;  1Y1V H;  3FKI G;  4HIK A;  4L5S A;  2MNA A;  1RCV D;  3PIP 3;  4BBR B;  2F52 A;  3HOX B;  1SND A;  4A3E G;  2R92 H;  3AMU A;  3A0J A;  5D3D A;  2A74 C;  4JI7 L;  3FHW A;  1W6K A;  4K8I A;  1CKN A;  1C7Y A;  2EY6 A;  2A5H A;  2JA9 A;  1E2W A;  5A2Q L;  4GKJ Q;  1VQI A;  4OWX B;  3RD4 A;  1BCP D;  4A3I G;  2Q2H A;  1L1O B;  2MJ8 A;  4MZ9 A;  3F2U A;  1VMC A;  1FNV A;  1VQ9 A;  1EY7 A;  2XWB B;  2YTV A;  4LK1 C;  1J5E Q;  4HJA A;  5KIX A;  5AJ3 Q;  1WOC A;  3PMF A;  4DR1 Q;  1B4O A;  1O7Z A;  1IBL Q;  4BBS H;  1FGB D;  3CQZ B;  4LF8 Q;  3DEO A;  4GKJ L;  1TII D;  1JJC B;  3A74 A;  1JB7 A;  3S1N B;  1B50 A;  5M5W B;  1S5F D;  1VQ7 A;  3H09 A;  1J5E L;  1YVC A;  2BDO A;  5AJ3 L;  2F0U A;  3KBX A;  2E8G A;  1M1K C;  1RKN A;  4DR1 L;  4DR3 Q;  1IBL L;  3S1Q B;  4A3G H;  4WJ4 A;  5FOB B;  3A8I E;  1VF5 C;  4QUC A;  1BOS A;  4BS9 A;  1JWU D;  1LV9 A;  4XT1 B;  5GAH C;  1CKM A;  1LM0 A;  2F0K A;  3K5L A;  4DUY Q;  1HQR D;  4A3I B;  4B08 A;  1DZ1 A;  3IAY A;  1STH A;  2Z1C A;  2VB2 X;  4DR3 L;  1V9P A;  4DR4 L;  3A8J E;  3CCS A;  3A7A B;  1CHQ D;  2HCI A;  3RMH A;  4RG1 A;  1NR2 A;  1XMO L;  3TRE A;  4CKB A;  1QUQ A;  3HOV B;  2IX1 A;  1X55 A;  4O42 A;  2R3Z A;  4PMW A;  4E6I A;  1HZA A;  1IBK Q;  4P73 A;  4A3J G;  4DUY L;  1BBX C;  1KD1 C;  4WRD A;  3ONA B;  3S1M B;  5JJL A;  1A8V A;  1HPC A;  1XNR Q;  1EQR A;  1PRT F;  3S15 H;  1K83 H;  1O7I A;  1NBW A;  5TSS A;  3RZD B;  2M9V A;  2A69 C;  1IBK L;  3TQY A;  2ZJP A;  2B2Y A;  4HMJ A;  1EOV A;  3V2T A;  4GKK L;  4K6D A;  3F2B A;  4X3S A;  2NWG A;  3A5U A;  1A2T A;  5IP9 G;  1HFN A;  1UE7 A;  3MTS A;  3GP7 A;  3OOC A;  4JW0 A;  1VQ5 A;  1TY2 A;  1NY4 A;  2AQ2 B;  5CV7 A;  1LTA D;  4TRD A;  1SMY D;  1EWC A;  1BF4 A;  3S16 B;  1B7Y B;  1TWG H;  1VQF A;  4FNF A;  3T53 B;  4A3K B;  3QR8 A;  2KQ3 A;  4JBK A;  2F0H A;  1YBY A;  3C1E A;  4CGY B;  4IPC A;  3QIA A;  4ZK9 B;  1SFO H;  1KAB A;  3DM3 A;  3NTK A;  1EWI A;  3DMU A;  2Q8I B;  3A54 A;  3GTM H;  1EEI D;  1LTL A;  1Q82 C;  4AH6 A;  2CW0 C;  4IPG A;  3MXG A;  1BBU A;  2F1M A;  4G7Z C;  1X54 A;  1LTG D;  1HH2 P;  4ZUJ A;  3OMC A;  3L7Z C;  2CCZ A;  3CC4 A;  1II3 A;  4QQB X;  4FXG C;  1DOL A;  1VMP A;  3H15 A;  4DR6 Q;  2WKC A;  1EY0 A;  2CH4 W;  4C3J H;  4K2L A;  3HOU H;  1K8M A;  2F0E A;  1JOR A;  2RHS B;  4EVO A;  2LXJ A;  4ZYS A;  4Y7N B;  5C44 G;  1O7L A;  3G7L A;  4J1M A;  2WP8 J;  4Q5V A;  1B2T A;  1O7Y A;  3M7N A;  1YHQ A;  4KKS A;  1GKH A;  3CCU A;  4ODG A;  3K7A H;  4DR6 L;  3I3C A;  4H0L C;  4C3I G;  1VCI A;  2F3V A;  1NE3 A;  4TVA B;  3VR6 A;  1Y1W G;  1XMQ L;  1BVS A;  2ES2 A;  1EYG A;  4B3R Q;  1IL2 A;  4FO2 A;  1BO0 A;  3TBI B;  1W2B A;  1I3Q B;  3J80 i;  4NXM L;  3AFQ A;  5EPJ A;  1GJX A;  2A6E D;  1TWF B;  2BA1 A;  4BY7 H;  1Z6H A;  5G3L F;  5D3I B;  5K5P A;  5NUC A;  5K36 H;  1I6H B;  3H3V C;  4OIK A;  4PG3 A;  5M5X B;  2NVQ H;  4EQO A;  4ZRZ A;  2V1C C;  5BN4 A;  4DV5 Q;  1PYB A;  2A68 D;  1MD2 D;  1MIU A;  2CW0 D;  3J80 E;  5LMU Q;  3M4O B;  2KJX A;  1HTP A;  3R2I A;  4JV5 Q;  3DWQ A;  1Q1B A;  1TVX A;  2EJG C;  3ICE A;  4HSP A;  1WTV A;  2ZTD A;  4A3M G;  4DV5 L;  1Y1W B;  1JWS D;  3RN5 A;  2HT1 A;  2BCO A;  4HED A;  5JAV A;  3IL8 A;  1WJJ A;  2VB3 X;  4TSS A;  1PMR A;  5LMU L;  1NAP A;  3A5Z B;  1PH7 A;  2K28 A;  3VR5 A;  3CME A;  4JV5 L;  3S2D B;  3SDZ A;  1E22 A;  4NPS A;  2VQF Q;  1TWC H;  1T9H A;  2XRQ D;  5CV9 A;  3STB C;  3KLR A;  1ASY A;  4LUZ A;  4KI0 A;  5IYB G;  5I2X A;  2WV6 D;  1I50 H;  1VQO A;  1YEZ A;  4YCV A;  2QGQ A;  2CWP A;  2RHQ B;  2RBM A;  2IY5 B;  2VQF L;  3H6M A;  4IUR A;  5I6Y A;  1SYC A;  2ZT9 C;  1PTO B;  4CJ1 B;  1IHZ A;  2F0Q A;  4J6H A;  1GUT A;  3FRP B;  3S14 H;  1PH8 A;  1Q1E A;  2LFN A;  5CV5 A;  1M8A A;  1TQO A;  2D0O A;  1TS2 A;  3FKI H;  5EKL A;  1GUN A;  4XQQ A;  3CCR A;  1STG A;  3NK9 A;  3S17 B;  1X3G A;  1VQB A;  4Z9C B;  1KRT A;  1Y1V G;  2WKD A;  5M3M G;  3CCL A;  3BS1 A;  1HR0 W;  3I2Z A;  4DGZ A;  2M00 A;  2JA6 H;  3SK5 A;  5E4X A;  3TN2 A;  5ELF A;  2RQX A;  4C2M H;  2R92 G;  2KCT A;  5IY0 A;  5HY6 A;  2BE5 D;  3T1H Q;  1Y8P B;  3KLW A;  4ZCK A;  1YIJ A;  5T1G A;  5C5M A;  2K6A A;  1KDC A;  4XIG S;  4IO9 A;  4OX9 Q;  1X3E A;  2Z8L A;  5COR A;  4LF5 Q;  3STB D;  4DN4 M;  2K33 A;  1I94 L;  1HRJ A;  3T1H L;  3G4S A;  5IGG A;  3K0X A;  4BBS G;  2K50 A;  5FLX c;  1KDB A;  3I4N B;  1PA6 A;  3GD7 A;  2R6G A;  4OX9 L;  4JI0 Q;  2B63 H;  4LF5 L;  1BR9 A;  1RD9 D;  1TWH B;  1S4Z A;  4P72 A;  2F0W A;  2R92 B;  4A3G G;  3URY A;  2KCM A;  1H9J A;  3U9O A;  2L55 A;  2RKS A;  4JI5 Q;  3NEM A;  4UP8 A;  5IWA Q;  2F3I A;  4JI0 L;  1KHI A;  2G9H D;  1JE5 A;  3ER0 A;  1L1O C;  3E9I A;  1CFM A;  2MGS A;  4RMF A;  2UU9 Q;  2I5H A;  3OHX C;  4MTK A;  1HQM C;  2I5L X;  2QIL A;  4JI5 L;  4A3J H;  2V4D A;  3DWA A;  1PFS A;  2UXD L;  2FMM A;  4I65 A;  1NTG A;  1PRT B;  3NTI A;  4IN3 A;  3M4Q A;  3MC0 B;  2MO0 A;  4EX5 A;  4HR7 B;  2L5T A;  1LAB A;  2NYZ D;  4CDF C;  2KHJ A;  5C3E G;  4JVZ A;  2UU9 L;  1WTW A;  4GNX B;  1KLG D;  2XN9 C;  5C6A A;  2NVY H;  3TEH B;  2QDB A;  1ONL A;  4A3G B;  4HIM A;  3Q22 A;  4XTC S;  2F3W A;  4GOP B;  1KXL A;  3SVM A;  3CD6 A;  4AQY Q;  4BWG B;  2FIN B;  3OTO Q;  4F7X A;  3CW2 C;  1NJI C;  1GXD C;  4R1J A;  4OEM B;  1N36 Q;  4M8A A;  3T1Y Q;  4RGM A;  1X65 A;  4KJN A;  1H9S A;  1KQS A;  3FVQ A;  4O0A A;  4QUF A;  2NVT B;  3A56 A;  3GTO B;  2PCF B;  1F2Z A;  2F0V A;  4AQY L;  3TS2 A;  3NQT A;  3MFG A;  5H1S E;  3OTO L;  3I7F A;  4A76 A;  3FMC A;  1LTR D;  4ILW A;  1N36 L;  4K5X A;  4WOR A;  5C3W A;  1Y8N B;  2XTI A;  3T1Y L;  3S15 B;  1GM5 A;  2F0I A;  5EJW A;  4OO1 H;  1D1K A;  1B9N A;  3TSS A;  3TRZ A;  1JB3 A;  2IWH A;  5GAE C;  2J4X A;  3VYS A;  4R9W A;  4JBW A;  3T16 A;  2HCC A;  5IGF A;  1NUC A;  2VL6 A;  4HSV A;  2UUC Q;  2KEC A;  1GHJ A;  2C35 B;  4ZQ3 A;  4A93 H;  1WCM B;  3BYT B;  4G7H C;  4OWW B;  4HAE A;  4RA8 A;  2F0D A;  1HCZ A;  3W1B A;  1CT1 D;  1DXM A;  3PO3 H;  4CDE C;  5EQ0 A;  1SN8 A;  2GN5 A;  1FGU A;  5C44 H;  1ILQ A;  4C3J G;  2Q2T A;  5GAD C;  1XX8 A;  3M3Y H;  1UE1 A;  4JOI C;  3BVG A;  4DR7 Q;  4B3S L;  3JAM i;  4N9P A;  2UUC L;  3ULL A;  2EJM A;  2MO1 A;  3J81 L;  1U4L A;  3HKS A;  1S5B D;  1EQQ A;  1SFO B;  1AN8 A;  3A8K E;  2Y0S B;  2FHT A;  3P75 A;  1EYD A;  3CRK C;  2SNS A;  3U50 C;  4BY1 H;  3R8B A;  3H91 A;  3GTK H;  3I55 A;  5ELO A;  2B2V A;  3EVQ A;  4RFB A;  4DR7 L;  1LTB D;  4RGN A;  3TP5 A;  5IGC A;  1D5M C;  2Z4H A;  3JAM E;  3PIP A;  1EU3 A;  3GO5 A;  5BR8 L;  3A7L A;  3PO2 H;  2F4V Q;  1TU2 B;  5ISR A;  5K36 G;  4DAY B;  4I7Z C;  1GUO A;  4JBM A;  4IUP A;  5M9O A;  1AZQ A;  1SE8 A;  2NB0 A;  3HOU B;  4OIJ A;  4JI6 Q;  3NTH A;  3W2D A;  3PCO B;  1HUM A;  1DOM A;  2WAQ G;  4DAV A;  1BQQ T;  2RCF A;  1QVG A;  2MUY A; 
#chains in the Genus database with same CATH homology
 3AFP A;  3EBE A;  4RG1 A;  1RL2 A;  2Q2I A;  1XMO L;  1S72 A;  4A3D G;  1G51 A;  2Z6K C;  3HFZ B;  3KYH C;  3TRE A;  1QUQ A;  4KHP Q;  1D7Q A;  2IX1 A;  3PF4 A;  1X55 A;  1NMF A;  1Q46 A;  4PMW A;  1HZA A;  1IBK Q;  1OTC A;  4HJ5 A;  4OON A;  4P73 A;  4DUY L;  4A3J G;  1KD1 C;  4JI6 L;  4L5Q A;  5IT9 c;  5JJL A;  1A8V A;  5EAY A;  1VQL A;  5DLQ E;  1XNR Q;  2ZJQ A;  2AHO B;  1EQR A;  4HJ9 A;  3K80 C;  4A3K H;  3HOW H;  3S15 H;  4A3B H;  2UUB L;  4A3F H;  1EIF A;  4OO1 I;  1K83 H;  2K5V A;  1O7I A;  1NBW A;  2E2I H;  1PH5 A;  4J15 A;  4DK6 C;  2N49 A;  1YZ6 A;  4HJ8 A;  4POG A;  4KHP L;  3CC7 A;  3H0G G;  1X56 A;  1IBK L;  3TQY A;  2ZJP A;  3GTJ H;  1EOV A;  4GKK L;  1DGS A;  3HOY H;  1KL9 A;  3KF6 A;  3F2B A;  2RCN A;  3RLN A;  4BBR H;  1X9N A;  1P8L A;  2Q2U A;  3J81 c;  3HOX H;  3A5U A;  1RIP A;  5IP9 G;  3CC2 A;  3J81 i;  1UE7 A;  2ASB A;  3GTQ H;  3NEN A;  4QGU A;  1VQ5 A;  1K3R A;  1XPU A;  4R4O A;  2JA5 H;  4IFD I;  1NY4 A;  1YHB A;  4DKA C;  1N9W A;  2MFI A;  1PHJ A;  1K73 C;  3HOZ G;  2JA8 H;  1SRO A;  5M3F H;  3BJU A;  1B7Y B;  4LF7 Q;  1TWG H;  1VQF A;  4GNX A;  4DV2 Q;  4B3T Q;  1OXU A;  4HID A;  2R7Z G;  4BA1 I;  1JT8 A;  5GAG C;  2K4K A;  2YV5 A;  4A4I A;  1OXS C;  2AWO A;  4GOP A;  4JBK A;  2A1A A;  1YBY A;  5J3B A;  1IZ6 A;  4IPC A;  3CCQ A;  1SFO H;  3CQZ H;  3DM3 A;  5IYC G;  3IRB A;  4LF7 L;  1MJC A;  1EWI A;  3UDF A;  5M3M H;  4A3L H;  1QVC A;  1A63 A;  5JEA J;  2VY3 A;  1N32 Q;  1QZG A;  1C9O A;  2I0Q A;  4B3T L;  3S1N H;  3GTM H;  2PQA A;  2EIF A;  4B3S Q;  3I4N G;  5M5W H;  4DK3 C;  1LTL A;  1Q82 C;  1PH3 A;  1L0W A;  4AH6 A;  4IPG A;  1BBU A;  1X54 A;  1HH2 P;  2KEN A;  2JA6 G;  3CP0 A;  3CCJ A;  4IOA A;  3L7Z C;  1CKO A;  2JK8 A;  4A3E H;  3HKZ G;  1HJP A;  1AE3 A;  3BU2 A;  4IPH A;  4C3H H;  5C0X G;  2CCZ A;  3CC4 A;  3MEF A;  2VUM G;  4A3C G;  4QQB X;  1PH4 A;  3RR5 A;  3NEL A;  2BH2 A;  2PI2 A;  1VQ6 A;  1TWF H;  3H15 A;  4JCV E;  4DR6 Q;  1YI2 A;  3JAM c;  3I4M H;  4C3J H;  2DGY A;  3HOU H;  1I6H H;  4A3I H;  3PUY A;  2I5M X;  2A8V A;  5M5X H;  3L0O A;  2UUA Q;  2RHS B;  1K8G A;  1HNW Q;  2LXJ A;  1E1T A;  2GVB A;  5C44 G;  1K0R A;  2ZTC A;  5BR8 Q;  3RLO A;  2WP8 J;  1B8A A;  1HZC A;  1BBW A;  4QY7 A;  3M7N A;  1YHQ A;  3UDG A;  4LFB Q;  1GKH A;  3KDF B;  3CCU A;  2JEA I;  3K7A H;  1U5K A;  4DR6 L;  3M4O H;  3HOV H;  2YTX A;  4ALP A;  1E1O A;  2IX0 A;  1VCI A;  1NE3 A;  4MNO A;  4TVA B;  1Y1W G;  1XMQ L;  1Q86 C;  3J7A 5;  1BVS A;  1QZH A;  1A0I A;  1VQ4 A;  3S1M H;  2ES2 A;  1XPR A;  1EYG A;  4B3R Q;  2UUA L;  2B63 G;  1IL2 A;  1HNW L;  2NZH A;  4DR4 Q;  3CCV A;  1W2B A;  3K7U C;  3J80 i;  1XMO Q;  4NXM L;  1L1O A;  3AFQ A;  1FVI A;  2BA1 A;  3KF8 B;  4ME3 A;  1CSQ A;  4LFB L;  4BY7 H;  3RZO H;  4IFD J;  1VQD A;  1A62 A;  2YTY A;  3SGI A;  3J7Z C;  4APV A;  1U0L A;  3BZC A;  1XJV A;  1VQJ A;  2VQE Q;  4PG3 A;  5JJK A;  1J6Q A;  3S2D H;  3M4P A;  2NVQ H;  2NN6 G;  3UDI A;  4R4Q A;  2V1C C;  1VQ8 A;  4DV5 Q;  2N78 A;  1B70 B;  4QIW E;  1OXT A;  1PYB A;  2PI2 E;  3S1R H;  1EIY B;  1MIU A;  4GN3 B;  1CSP A;  3I56 A;  4UY8 C;  5LMU Q;  2Z6K A;  4TQU S;  4X65 Q;  4JI1 Q;  3F2D A;  1OXV A;  4EQ5 A;  1G29 1;  3CMA A;  3S16 H;  4JV5 Q;  1Q1B A;  2KBN A;  3GTL H;  1VQP A;  1Q8K A;  2JE6 I;  2VQE L;  4A3D H;  4R4I A;  1M90 C;  2PMZ E;  3ICE A;  4GKK Q;  4KLK A;  2UXB Q;  2ZTD A;  4A3M G;  1N8R C;  4IJH A;  5C3E H;  4K0K Q;  4DV5 L;  2VZA A;  3RN5 A;  1V43 A;  2R93 G;  3CCE A;  4YCW A;  2HT1 A;  4X64 Q;  5IWA L;  1UEB A;  2ZM6 Q;  1WJJ A;  1LYL A;  2OCE A;  5LMU L;  4X65 L;  3A5Z B;  4JI1 L;  4LWC A;  1PH7 A;  5M5Y H;  3CME A;  4JV5 L;  5IP7 G;  5GQO A;  1E22 A;  4NPS A;  2UXB L;  2VQF Q;  1TWC H;  3H0G H;  1T9H A;  2UXC Q;  4K0K L;  3BZK A;  5IYD G;  3L2P A;  1WFQ A;  2R7F A;  3STB C;  4AYB E;  3D0F A;  5JEA G;  3S17 H;  4X64 L;  2JQO A;  1ASY A;  4LUZ A;  2ZM6 L;  4KI0 A;  5IP9 H;  5IYB G;  1PVO A;  1I50 H;  1MJE A;  2VS1 A;  4YCU A;  1VQO A;  1YEZ A;  2K5N A;  3RLF A;  1Q12 A;  4YCV A;  2QGQ A;  3KJP A;  2CWP A;  2RHQ B;  1VQH A;  5HGQ A;  4X6A H;  2IY5 B;  2Y0S E;  3HOZ H;  1IBM Q;  1GD7 A;  2VQF L;  1WCM G;  3K81 C;  1PV4 A;  2UXC L;  4DR5 Q;  1D8L A;  1NMG A;  4L5T A;  2YU9 H;  1H95 A;  2FXQ A;  4O2D A;  1VQN A;  3H3V H;  1UE5 A;  4YWL A;  4JG2 A;  5LMN W;  1HZ9 A;  4GLA C;  1S3O A;  4Y7N H;  1PH1 A;  2OQ0 A;  1SRU A;  3S14 H;  1PH8 A;  1K9M C;  1YHA A;  1Q1E A;  4AYB G;  1L2F A;  1Z9F A;  1CKN B;  1Q81 C;  3DLL A;  2N8N A;  1PH6 A;  4MTN A;  1HNX Q;  2D0O A;  1IBM L;  4DPG A;  3FKI H;  1E3P A;  5ELN A;  4BA2 I;  2WFW A;  3UDX A;  3CCR A;  4DR5 L;  4OO1 G;  1HZB A;  1X3G A;  2ALY B;  1VQB A;  4H02 A;  2Y0S G;  3PUW A;  1X6O A;  2QEX A;  1KRT A;  1Y1V G;  1YJW A;  1XTD A;  4DNI A;  5M3M G;  4YHH Q;  4A3L G;  3CCL A;  3W1G A;  1I3Q H;  3CF5 A;  3OW2 A;  4PZ6 A;  1XPO A;  2EQS A;  1HR0 W;  3I2Z A;  2JA6 H;  3CXC A;  5FJ8 G;  3CPW A;  4C2M H;  2R92 G;  4JOI A;  1CUK A;  2KCT A;  4A93 G;  5IY0 A;  1HNX L;  3K8A A;  4FDB A;  1TWH H;  4GS3 A;  5HY6 A;  3W5O A;  1XMQ Q;  3T1H Q;  3U4V A;  4JI3 Q;  2VUM H;  3KLW A;  4A3C H;  1YIJ A;  3GTG H;  3Q8D A;  4A75 A;  4LF9 Q;  3PO3 G;  1VQA A;  1TXY A;  2WB1 E;  3AQQ A;  4UPA A;  2NN6 I;  4XIG S;  4IO9 A;  4LUO A;  3S2H H;  2PNH A;  3UE0 A;  4OX9 Q;  1X3E A;  4YHH L;  3GDE A;  4IPD A;  2ZTE A;  1JMC A;  4NXM Q;  4LF5 Q;  1E7Z A;  2GVA A;  5FLM G;  3KFU A;  3STB D;  4JBJ A;  4NB3 A;  1UE6 A;  3G71 A;  2LXK A;  4DV4 Q;  4NXN Q;  3HOU G;  1GVP A;  1I94 L;  3PUX A;  1N33 Q;  1KIX A;  1C0A A;  4JI3 L;  3T1H L;  3G4S A;  2N3S A;  3LGJ A;  3K0X A;  4R4C A;  4BBS G;  2K50 A;  2JA7 G;  5FLX c;  2LSS A;  4LF9 L;  2IHF A;  4C3I H;  1PA6 A;  4GN4 B;  3TS0 A;  2XGT A;  3GD7 A;  1Y1W H;  1MKH A;  1SMX A;  4BY1 G;  2OTJ A;  2R7D A;  4P71 A;  3AEV A;  2R6G A;  3J80 c;  4OX9 L;  4BXX G;  4JI0 Q;  2E2J H;  1YNX A;  2B3G A;  2IHE A;  4JI4 Q;  4LF4 Q;  4LF5 L;  2B63 H;  3HOV G;  2HIX A;  3G6E A;  4NXN L;  4DV4 L;  1UWV A;  1KC8 C;  4GLX A;  2K5H A;  4UP9 A;  1N33 L;  3MXN B;  1YIT A;  4P72 A;  1JJG A;  3ULJ A;  1QUQ B;  1VS0 A;  4A3G G;  2KCM A;  3PO2 G;  4JI5 Q;  3S24 A;  3NEM A;  4UP8 A;  3KJO A;  4Y52 H;  4HIO A;  4YWM A;  5IWA Q;  2F3I A;  4YWK A;  4IJL A;  3PUV A;  3PUZ A;  1KHI A;  3AYH B;  1JE5 A;  1Y14 B;  3KDF A;  4B3M L;  4JI0 L;  3ER0 A;  4JI4 L;  4LF4 L;  1W3S A;  4PZ8 A;  4LF8 L;  1L1O C;  5C4X G;  3E9I A;  2JEB I;  3GTP H;  4RMF A;  2OTL A;  2K52 A;  1QVF A;  2UU9 Q;  1VQK A;  1Z47 A;  2H5X A;  2IT1 A;  2I5H A;  2E5L Q;  2A19 A;  3F1Z A;  3U58 A;  2HIV A;  4POF A;  2I5L X;  4A3J H;  4JI5 L;  3H3V I;  4WJ3 M;  2UXD L;  1PFS A;  1YJ9 A;  3KF6 B;  2K14 A;  4R4T A;  4A3M H;  1G6P A;  4OXP A;  1NTG A;  4UP7 A;  4DUZ Q;  2F4V L;  4DR2 Q;  1N34 Q;  2NVT H;  1JJ2 A;  3M4Q A;  3F8T A;  3GTO H;  2R93 H;  2MO0 A;  4EX5 A;  2CKZ B;  3EN2 A;  1TWA H;  1HNZ Q;  2VNU D;  2KHJ A;  5C3E G;  1OXX K;  2UU9 L;  4A3K G;  1YJN A;  3HOW G;  2VW9 A;  2E2H H;  4A3B G;  4A3F G;  2E5L L;  4GNX B;  4L5R C;  2K75 A;  5IE8 A;  4DV1 Q;  4LFA Q;  5IP7 H;  2NVY H;  3TEH B;  4DV0 Q;  3RNU A;  4HIM A;  2CQO A;  3KOJ A;  4XTC S;  4LF6 Q;  5IYD H;  4GOP B;  4LFC L;  4DUZ L;  4YY3 Q;  4DV3 Q;  2NVX H;  3WWV A;  4DR2 L;  1N34 L;  3CD6 A;  1KXL A;  1VQE A;  4AQY Q;  3HOY G;  3CCM A;  1VQG A;  2AWN A;  3ULP A;  5JJI A;  2ID0 A;  5C0X I;  2AKW B;  2D0P A;  4BBR G;  3OTO Q;  1PH9 A;  3CW2 C;  3CPF A;  2NZO A;  5IYB H;  3HOX G;  3PF5 A;  1NJI C;  3JC6 6;  4R1J A;  1IYJ B;  1AH9 A;  4LW1 A;  1N36 Q;  1VQM A;  3VDY A;  4DV1 L;  1Q7Y C;  2JA5 G;  4LFA L;  3T1Y Q;  4DV0 L;  2PQA B;  4JYA Q;  1X65 A;  1XNR L;  1KQS A;  2HHH Q;  2R7Z H;  1BKB A;  3I4O A;  4O0A A;  2JA8 G;  4JI8 Q;  5M3F G;  1WCM H;  2EXD A;  3PV0 A;  3PIO A;  4LF6 L;  3G48 A;  1IXR A;  4KHZ A;  4YY3 L;  4DV3 L;  4DV6 Q;  4QL5 A;  2CWA A;  4AQY L;  3TS2 A;  4DAM A;  1E24 A;  1P16 A;  1GO3 E;  2RF4 A;  5H1S E;  2Z0S A;  3OTO L;  3I7F A;  4GNX C;  4A76 A;  2AMC B;  2KHI A;  5IYC H;  1SLJ A;  4PZ7 A;  1PH2 A;  1N36 L;  4LUV A;  4JI2 Q;  3T1Y L;  2XTI A;  4JYA L;  3HKZ E;  4GOP C;  3I4N H;  1GM5 A;  2HHH L;  3F2C A;  1FJG Q;  4JI7 Q;  4JI8 L;  2OQK A;  3J81 j;  3TRZ A;  1X3F A;  4DV6 L;  4HJ7 A;  1ASZ A;  2CFM A;  4IOC A;  4L5S A;  1Y1V H;  3FKI G;  5GAE C;  4HIK A;  1I94 Q;  2MNA A;  2BA0 A;  3PGZ A;  4DV2 L;  4JBW A;  3ERS X;  2VL6 A;  1V1Q A;  4LNQ A;  2UUC Q;  2F52 A;  5FJ8 H;  1WI5 A;  4JI2 L;  2C35 B;  4A3E G;  2R92 H;  3A0J A;  4A93 H;  2QA4 A;  4IFD G;  4OWW B;  1FJG L;  2HQL A;  3FHW A;  4JI7 L;  3RN2 A;  2DUD A;  3W1B A;  1CKN A;  1C7Y A;  2ZJR A;  3PO3 H;  2JA9 A;  4GN5 A;  4P75 A;  4X62 Q;  3S1Q H;  1SN8 A;  2GN5 A;  4GKJ Q;  1FGU A;  3E0E A;  1VQI A;  5C44 H;  1WYD A;  3U4Z A;  4OWX B;  1EFW A;  3I4M G;  2Q2T A;  3CAM A;  5GAD C;  2Q2H A;  4A3I G;  3M3Y H;  1L1O B;  2B29 A;  1UE1 A;  4MZ9 A;  3ZJY C;  1N32 L;  4JOI C;  5E7N A;  5FLM H;  3M85 A;  4DR7 Q;  5LMN Q;  4B3S L;  3JAM i;  1VQ9 A;  2UUC L;  2YTV A;  3ULL A;  1SR3 A;  4GLV B;  1J5E Q;  1XNQ Q;  2L15 A;  4HJA A;  1PYS B;  2MO1 A;  5AJ3 Q;  1WOC A;  3NBH B;  2OWO A;  1VQC A;  3HKS A;  4DR1 Q;  1R9T H;  1EQQ A;  1IBL Q;  4BBS H;  1EUJ A;  2JA7 H;  3E9H A;  4B3M Q;  1HNZ L;  4LF8 Q;  4X62 L;  2WB1 G;  1K8A C;  4GKJ L;  3OYY A;  2MQH A;  3U50 C;  4DV7 Q;  1JJC B;  3A74 A;  4BY1 H;  4BXX H;  1KRS A;  1JB7 A;  3GTK H;  4X66 Q;  4P74 A;  3I55 A;  5ELO A;  2WAQ E;  1VQ7 A;  4AIM A;  4DR7 L;  5LMN L;  1S40 A;  5C0X J;  3EIV A;  1J5E L;  1YVC A;  1XNQ L;  4JC0 A;  3PIP A;  5AJ3 L;  1KAW A;  2UXD Q;  2E8G A;  1HR0 Q;  1M1K C;  4OWT B;  2BH8 A;  4DR1 L;  1AE2 A;  4DR3 Q;  1IBL L;  3GO5 A;  4A3G H;  4WJ4 A;  3UE1 A;  5BR8 L;  3D31 A;  3PO2 H;  2F4V Q;  5GRO A;  2D62 A;  1LUZ A;  5K36 G;  4DAY B;  5GAH C;  4DV7 L;  2YYZ A;  4JBM A;  3RZD H;  2ATW A;  1CKM A;  4X66 L;  1LM0 A;  3M9B A;  1SE8 A;  4DUY Q;  4JI6 Q;  5C4X H;  1FL0 A;  3PCO B;  4B3R L;  2WAQ G;  1I5F A;  3PSI A;  1HR0 L;  3FP9 A;  2JJQ A;  5C4J H;  4DR3 L;  4BY7 G;  1V9P A;  2UUB Q;  3B6Y A;  1QVG A;  4DR4 L;  4QJF A;  4LFC Q;  3CCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...