1EUJA

A novel anti-tumor cytokine contains a rna-binding motif present in aminoacyl-trna synthetases
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
PIDVSRLDLRIGCIITARKHPDADSLYVEEVDVGEIAPRTVVSGLVNHVPLEQMQNRMVILLCNLKPAKMRGVLSQAMVMCASSPEKIEILAPPNGSVPGDRITFDAFPGEPDKELNPKKKIWEQIQPDLHTNDECVATYKGVPFEVKGKGVCRAQTMSNSGIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel anti-tumor cytokine contains an RNA binding motif present in aminoacyl-tRNA synthetases.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords ENDOTHELIAL MONOCYTE ACTIVATING POLYPEPTIDE 2
total genus 37
structure length 164
sequence length 164
chains with identical sequence B
ec nomenclature
pdb deposition date 2000-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eujA00
3ULJA 2NVYH 2RHSB 4BY1G 3STBC 1DGSA 1VQBA 1CUKA 3AYHB 1PYBA 1U5KA 3I2ZA 3T1HQ 3HOWH 4RMFA 1L1OC 2ZJRA 1IL2A 3SGIA 3M3YH 3A0JA 4PZ8A 4R4IA 3RLOA 1K73C 4LWCA 3EIVA 4OWTB 1IBMQ 1CKMA 5AJ3Q 1X56A 2HIVA 1Q86C 4JI5Q 1GM5A 3L0OA 5EAYA 3HOZG 1W3SA 4UP7A 3J7A5 4DR6Q 3G6EA 3TS2A 1PYSB 1OTCA 1A0IA 4P72A 5IP7H 4GOPC 2E5LQ 2F4VQ 4A3DG 4DR6L 1NMFA 1CKNA 1SMXA 4A3DH 4JYAQ 4L5SA 1CSQA 3J7ZC 3AFQA 1N9WA 2YTYA 1NBWA 1RL2A 2OQ0A 4JI5L 3W5OA 2KBNA 5FJ8H 5FJ8G 5AJ3L 1VQHA 4YWMA 1A62A 1JJCB 1SRUA 4POGA 1NY4A 3UE1A 3CMEA 1G51A 4KI0A 1N8RC 2AHOB 2Q2IA 1HNWL 3J80i 1B70B 2ZTEA 1VQLA 1K3RA 1SR3A 2N3SA 3HOYG 3W1GA 3HOVG 4MNOA 2R7DA 3HOYH 1VQAA 2JA6G 2JA6H 1BBUA 5GADC 4HIOA 2UUAL 4R4CA 3PUYA 4JI7L 2CWAA 3CCEA 2JA8H 3CD6A 2XTIA 4DK3C 4PZ6A 4X66L 2NVQH 3RNUA 1I3QH 3CC4A 3ZJYC 1UE5A 1LM0A 1MKHA 4QL5A 3KJOA 4HJAA 3JAMc 1IBLQ 1JMCA 4DR4L 4DR2Q 1OXSC 3AQQA 1CSPA 1PH9A 1VQNA 4A75A 4LFBQ 5LMUL 1Q46A 1PH6A 2OCEA 1VCIA 1TWCH 1B8AA 2AKWB 3M4PA 3PO2G 3M85A 2R7FA 1YBYA 2D0OA 3A5UA 2RCNA 3ICEA 1JJGA 4JCVE 1PHJA 1JB7A 1VQOA 4DV4L 4DUYQ 3UDGA 2K14A 4A3KG 4K0KQ 2CCZA 1UWVA 1KXLA 3J81i 4H02A 5C0XJ 3PUVA 1SFOH 3FKIG 1N34L 1TWHH 2OQKA 4NXNQ 1X54A 2BA0A 5IP9G 5LMUQ 3I4MH 1VQCA 4LFBL 3JAMi 5H1SE 4A3IG 4A76A 5M3MG 1PA6A 2RHQB 1KRSA 1HJPA 1TWFH 2LSSA 4JBWA 2HHHL 2N78A 5GROA 1I94Q 2ZM6L 1IBLL 3CCQA 3HOWG 4APVA 1M1KC 4JI0Q 1HNXL 2F3IA 4L5TA 3CW2C 1WCMH 1WYDA 5IYDG 3U4ZA 4LUZA 1WCMG 1PH3A 2Q2HA 3HOXG 2VQFL 2UUBL 2UUAQ 4FDBA 4JG2A 1MIUA 4UP8A 3G48A 3M9BA 3MEFA 3T1HL 4YHHQ 4GNXB 2HQLA 2NVXH 3J81j 1PV4A 1G6PA 4ALPA 3HOZH 2I5LX 4AIMA 2N8NA 2WFWA 2NN6I 4O0AA 4WJ4A 1QZGA 4LNQA 2VUMG 1FGUA 2YV5A 2WP8J 1HNWQ 1XMQQ 3S15H 3AEVA 1N32L 2Z6KA 5DLQE 3S1QH 3OYYA 2CQOA 1I5FA 1TWGH 4GLAC 2K4KA 2AMCB 3KF6A 1VQMA 1XJVA 1C0AA 2PI2A 2A8VA 4LF7L 1EQRA 2R92H 5C4XG 5C0XG 2XGTA 1XPUA 3GD7A 4J15A 1Q1BA 4QGUA 2EQSA 2F4VL 4JYAL 2PQAB 4DAMA 3ULLA 1QVGA 4X6AH 1XTDA 1X3FA 3GO5A 3J80c 3KF6B 4DAYB 1GKHA 1WFQA 4GLVB 1UE6A 5BR8Q 1Y1WG 1L0WA 2IHFA 2K75A 3CQZH 4R4OA 2BH8A 2VQEQ 2VY3A 2AWNA 1S72A 1HNZL 1IBML 2D0PA 3TRZA 2EXDA 1NE3A 3F2CA 1LTLA 4DUZQ 1FJGL 2JA9A 2GN5A 1OXXK 4C2MH 3U58A 4C3HH 4TVAB 4A3FG 4NPSA 4GNXA 1VQEA 4P74A 1OXTA 4POFA 4LF4Q 3JC66 1A8VA 5IYBH 2K52A 3PUWA 5IYBG 1M90C 3FHWA 2VS1A 2UXDL 2E2IH 3S1NH 1K0RA 1HZAA 5C0XI 4DR5L 1VQDA 1YJNA 5LMNQ 1KAWA 4BBSG 4LF8Q 4A3LG 2UXBL 1OXUA 4IPGA 5M5YH 1XNQL 2VNUD 1YVCA 4NXML 2WAQG 1HR0L 3OTOQ 3PUZA 2HIXA 3CAMA 1RIPA 2E8GA 2EIFA 4EX5A 4KHPL 1XMOL 4A3GH 3KDFB 4JOIC 5FLMH 4HJ8A 4A3JH 3H15A 2JJQA 2NN6G 4P71A 2UUCL 4LUOA 3KFUA 1D7QA 3S1RH 2CFMA 1N36Q 1XNRQ 3GTMH 1Q12A 2GVBA 4YY3Q 1SLJA 4XIGS 3PIPA 4GOPB 3NELA 1W2BA 3BZCA 3M4OH 4B3SL 2UXCL 1Y1VH 5ELNA 1K8AC 3RZOH 3RLFA 3S1MH 1UEBA 4OWXB 4B3TL 1YHQA 1KRTA 4JI6L 4JI4L 3BZKA 4JBMA 1QVCA 1GVPA 2DUDA 1E7ZA 4GN3B 2E2HH 4JI3Q 2BH2A 4P73A 2Q2TA 4AQYQ 1ASZA 4LFCQ 1WI5A 3PV0A 2NVTH 1EFWA 1X3EA 4LF6L 1VQIA 3PSIA 3RN5A 4IFDI 1YITA 1PH8A 4IFDJ 1E22A 4X64L 2CWPA 2D62A 4DV0Q 2JEBI 4DV2Q 4IO9A 3T1YQ 1C9OA 5GQOA 1S3OA 2YTXA 1YZ6A 4DV1Q 4DR3Q 1VQGA 1EIYB 4GKJL 3VDYA 4ME3A 1YIJA 4A3BG 2ALYB 1X55A 4R1JA 4BBRG 4LF9Q 3U50C 1I6HH 4GN4B 2R93G 4HJ9A 4JI2Q 3BJUA 3B6YA 3STBD 1NTGA 3S2DH 4IOAA 4HJ7A 2KHJA 4JI1L 4DV5L 3S17H 4DK6C 1E1TA 4X62Q 4MTNA 1Y1WH 1N33Q 1JE5A 1A63A 3NBHB 3PGZA 2K5NA 4DV6Q 4GS3A 3RZDH 5GAHC 3DLLA 3S16H 2I0QA 5IT9c 2I5HA 4DR7Q 1OXVA 2VZAA 1HR0W 1E1OA 3I4NH 3I4NG 5IP9H 3G71A 2ASBA 3EBEA 3WWVA 1O7IA 3F2BA 4BY1H 5IWAL 4GKKQ 4JBJA 3HKSA 4JBKA 4IJLA 3CCMA 3D0FA 4OX9L 3A74A 3RR5A 4WJ3M 5JJKA 4A3FH 1E24A 4OXPA 1IZ6A 1B7YB 4DV7L 2IT1A 5IYDH 2H5XA 1GO3E 2LXKA 2WAQE 3KYHC 1J5EQ 1SE8A 2MNAA 4BA2I 4A3EH 1Z9FA 3GDEA 2JK8A 2ZTDA 3CF5A 3ER0A 4GLXA 2LXJA 5HY6A 2ATWA 1FL0A 1NMGA 3A5ZB 5IE8A 4DR1Q 1PH4A 4QY7A 2MO0A 2IY5B 3CCVA 4B3RQ 1P16A 3CPFA 4DV3L 4DV3Q 2QEXA 4OONA 1AE2A 3M4QA 2V1CC 5M3FG 1Q7YC 5IP7G 2UU9Q 5JJIA 1LYLA 1V9PA 1VQKA 3S14H 4TQUS 1V43A 4JI8L 4DV0L 4QIWE 3L2PA 1J5EL 4XTCS 1EIFA 1IBKL 4JV5L 3I55A 4PMWA 1VQ9A 4OO1I 2ID0A 1EOVA 3H0GH 3LGJA 4HIMA 3H0GG 3S2HH 4OX9Q 4C3JH 4JI3L 4B3ML 3PO3H 4DPGA 2A1AA 2PQAA 1G291 1LUZA 4EQ5A 1YJ9A 1PH2A 3PO3G 4A3MG 4BXXH 4O2DA 2JA8G 4X65L 1VQ4A 1Y14B 2MQHA 2A19A 1R9TH 3Q8DA 4AYBG 5HGQA 3CC7A 1X3GA 2OTLA 2ZJPA 2DGYA 2JQOA 3KOJA 4DV6L 1GD7A 3E9HA 1PFSA 1VQPA 4X62L 4UY8C 4QJFA 4DNIA 3KJPA 3RN2A 2UUCQ 4DKAC 4UPAA 2YU9H 2PMZE 3CMAA 3F2DA 2MO1A 4JC0A 4LF5L 1L1OA 1V1QA 5J3BA 1D8LA 2KCMA 4KLKA 4LFAL 2KHIA 4HIDA 2UXBQ 4JV5Q 3RLNA 1PH1A 3G4SA 4IPDA 2WB1G 4A3CH 2NZOA 2IHEA 4DR5Q 4A3KH 4JI8Q 3CCJA 1VS0A 4GOPA 4X64Q 1EWIA 5K36G 2FXQA 2JA5G 4A3GG 1MJCA 4LFAQ 1X9NA 1L2FA 5FLMG 2JA5H 4LF6Q 2IX1A 4A3JG 2RF4A 2JEAI 3J81c 3CCRA 4LF5Q 1XPOA 1Z47A 3KLWA 4MZ9A 3TREA 3UDFA 5C44H 3PIOA 3UDXA 5C44G 4AQYL 4L5RC 4A93H 1MJEA 4B3RL 2N49A 1J6QA 4DR1L 5M3MH 4JI4Q 2AWOA 4IOCA 2PI2E 1KD1C 1KQSA 1T9HA 3GTOH 3IRBA 4RG1A 3ULPA 1EYGA 1X65A 1HNZQ 2QA4A 3OW2A 3HOXH 2VQEL 3HKZG 4X65Q 1PVOA 5M5WH 4AH6A 3H3VI 1BVSA 1YHBA 1HH2P 1UE7A 3K8AA 4YY3L 5BR8L 1VQJA 1TWAH 4A3EG 1N36L 2OTJA 5JJLA 4YWKA 4B3MQ 2ZJQA 3ERSX 3DM3A 1SROA 1AH9A 4IFDG 5IWAQ 1K8GA 4IJHA 2Z0SA 1HZBA 1SN8A 1Q82C 1AE3A 4KHPQ 1C7YA 1YNXA 2VUMH 5M3FH 1U0LA 5IYCG 2Q2UA 3K80C 1PH7A 5C3EG 2QGQA 4LF7Q 4NXMQ 3M7NA 3K81C 1IBKQ 4LF8L 4JOIA 2F52A 3GTKH 2OWOA 1JT8A 4A3BH 1QUQA 4JI1Q 3F1ZA 4BBRH 4DV5Q 1YI2A 2R92G 5C4JH 2R93H 5C4XH 3GTQH 1X6OA 1VQ8A 1JJ2A 1CKNB 2UU9L 2ZTCA 1QZHA 4QQBX 1YEZA 2I5MX 1YHAA 4IPHA 3PCOB 2Y0SG 5GAEC 3HOVH 3TQYA 3U4VA 2UUBQ 4GKJQ 3GTGH 4UP9A 5ELOA 3T1YL 3PF4A 3I7FA 4A3MH 2L15A 1HNXQ 1KL9A 2B63G 3CP0A 3GTPH 1WOCA 2R6GA 2B63H 1I94L 1EQQA 4DV7Q 3KDFA 3E0EA 1HZ9A 3I4OA 3PUXA 3CPWA 4LFCL 2E2JH 2C35B 4R4TA 1QUQB 1KHIA 1PH5A 5M5XH 2YTVA 4YCWA 4C3IH 1N34Q 1IXRA 4GKKL 1P8LA 4R4QA 1FVIA 2JA7H 1Q1EA 2MFIA 4LUVA 1CKOA 2JA7G 2R7ZG 4Y52H 2WB1E 4YCUA 2R7ZH 1BBWA 1EUJA 4K0KL 4DUYL 4DR7L 1UE1A 3L7ZC 4BBSH 2UXCQ 3K7AH 4A3LH 2HT1A 1N33L 4A3CG 1XPRA 2PNHA 1N32Q 1XNRL 1XMQL 4HIKA 4BA1I 1H95A 4YWLA 2B29A 2Y0SE 5LMNW 2K5HA 4JI2L 2NZHA 3D31A 4PG3A 1XMOQ 3FKIH 1YJWA 1HZCA 3S24A 4YHHL 4LF9L 5IY0A 3NENA 3OTOL 4DR2L 3I4MG 4A4IA 2YYZA 4LW1A 4A3IH 1XNQQ 4AYBE 1E3PA 2VQFQ 4DV1L 4DR3L 1S40A 5LMNL 1Y1VG 3PF5A 4DV2L 2ES2A 4JI0L 1I50H 1TXYA 4YCVA 5GAGC 3AFPA 4GNXC 2ZM6Q 3FP9A 1VQ5A 2HHHQ 3GTLH 1WJJA 1KC8C 2VL6A 3KF8B 5FLXc 3E9IA 1VQFA 4PZ7A 3K0XA 2JE6I 3HOUH 4BXXG 4NXNL 2CKZB 3HOUG 3CXCA 3BU2A 3UE0A 3CCUA 4JI6Q 1KIXA 3I56A 4B3TQ 1Q81C 3EN2A 3W1BA 4DUZL 1ASYA 5E7NA 1FJGQ 1L1OB 4DV4Q 1NJIC 1IYJB 5IYCH 5C3EH 4B3SQ 4OWWB 3TS0A 2KCTA 5JEAJ 4OO1G 1K83H 2K5VA 1QVFA 5JEAG 3UDIA 3H3VH 1K9MC 2E5LL 4HJ5A 3NEMA 3CCSA 4P75A 3CC2A 2IX0A 4KHZA 3F8TA 3CCLA 3PO2H 2KENA 3HFZB 4Y7NH 2GVAA 1VQ6A 4IPCA 1Q8KA 3K7UC 1HR0Q 4DR4Q 1VQ7A 2Z6KC 3HKZE 4GN5A 4BY7H 4X66Q 4L5QA 4BY7G 3MXNB 4JI7Q 4NB3A 2K50A 3TEHB 2VW9A 2B3GA 2UXDQ 3GTJH 4A93G 2BA1A 4LF4L 1BKBA
chains in the Genus database with same CATH superfamily
4G7ZC 2NVYH 1MI2A 1ENCA 2L5TA 1PYBA 3T1HQ 1L1OC 3S2DB 2L4NA 3A0JA 5CV8A 4PZ8A 4R4IA 3OIQA 3SHLA 4LWCA 1SNMA 1YNNC 4CDFC 3EIVA 1SNPA 4IUUA 4OWTB 2XWBB 1IBMQ 4Z9CB 2B2WC 4JI5Q 1GM5A 3HOZG 3E0JA 4UP7A 1EQTA 1PTOF 2RVLA 2JA8B 4DNTB 5IP7H 4JYAQ 2B63B 1SMXA 4L5SA 3PQIA 1NBWA 3W5OA 1A62A 1PRTB 1SRUA 3D8GA 1NY4A 1CM9A 3CMEA 1PTOD 1JWUD 1STNA 2F0SA 1R4QB 1EY7A 4K5XA 4C3JG 3HEJA 1VQLA 2EYOA 4A3MB 1PRTF 2N3SA 3W1GA 4MNOA 1HA6A 2PW7A 1S5FD 2JA6H 1BBUA 4JI7L 1BUVT 4O42A 3RNUA 1I3QH 5KEEA 2NVTB 2Z4HA 2B2UA 3KJOA 1MKHA 1JMCA 3JAMc 4ZCKA 1PRTC 1RF2D 4DR2Q 5A2QL 1EY4A 1OXSC 5C44B 3A8JE 2XRQD 1BCPD 5LMUL 1I50B 4LJZC 1B8AA 3M4PA 1YBYA 3VR4A 1WTPA 1H9JA 3K58A 1NR4A 2NVXB 4DUYQ 2K14A 4H44C 4QUCA 4K0KQ 1TS3A 1V1OA 2CCZA 2OQKA 2BA0A 4PNYA 5AFWA 2B8FA 5H1SE 3JAMi 4A3IG 3H3VC 3HOYB 1KRSA 4HAEA 5M5WB 3HOWG 1JR0D 3T56B 3IFTA 4JI0Q 3EA6A 3U4ZA 1WTOA 1JE4A 2VQFL 2UUBL 2UUAQ 1NR2A 3NK9A 4DN4M 4IZ8A 1G6PA 3HOXB 4ALPA 2I5LX 2N8NA 2NN6I 4WJ4A 3DEPA 1XMQQ 3S15H 5JJZA 2F0KA 1EQVA 3OYYA 1VMCA 5C4XB 1H9RA 1TWGH 2FJ2A 1ESFA 2L9HA 2A8VA 1XPUA 1SNQA 4J15A 4QGUA 1EY8A 2DJGC 4DAMA 1WD0A 1R4PB 4ZUJA 1STHA 5CBAE 3PIO3 3GQBA 2K75A 4R4OA 2BH8A 2EY1A 4RA8A 3VR6A 4DUZQ 4EQNA 2JA9A 2JA5B 3J7YW 2EVBA 3C1FA 1TR5A 1EWHA 4C3HH 1QCBD 4NPSA 2KEEA 3DMUA 4GNXA 4TSSA 1EZ6A 2K52A 3PUWA 2NB0A 1JOQA 1HZAA 1TVXA 4BBSG 5FLXE 2WKDA 2DNCA 4IPGA 5M5YH 2WAQG 3J80L 2QDLA 4JOIC 4A3JH 3KFUA 2UUCL 2CFMA 1FD7D 5C5MA 1XNRQ 3GTMH 3BVGA 1ILPA 4XIGS 2IWHA 1DD2A 1JOOA 1F2ZA 2G9HD 2PYKA 1Y1VH 4BWGB 1K8AC 3S1MH 1UEBA 4B3TL 1A6XA 1CZGA 3BVMA 2R93B 3RD4A 3F2UA 2SNSA 2FMCA 3V2TA 4IFDH 1C4QA 3EROA 3RN5A 2NTSA 2E2DC 1SNDA 1PXUA 1C9OA 1A3TA 2AQ3B 1S3OA 2YTXA 1YZ6A 3VDYA 1S5DD 4R1JA 4BBRG 3MWYW 4RHSA 4CKCA 3TMEA 3BJUA 1NTGA 1PFNA 3BDCA 1IYVA 5CV7A 4DV5L 1YNJD 1L0XB 4N9TA 3FPUB 3NBHB 3RZDH 2K5NA 1J8IA 2I0QA 4DR7Q 3BYYB 1SYEA 3U9SA 2X6GA 4GKKQ 3HKSA 3D0FA 4OX9L 3A74A 1PFBA 1T5EA 4LK1C 1IZ6A 2L55A 3EFXD 2JP1A 2LXKA 2WAQE 4BA2I 1ILQA 1CTMA 1Z9FA 1LABA 2JK8A 3CF5A 3ER0A 2LXJA 2ATWA 3LWEA 4HCEA 5D3IB 2F1MA 2IY5B 2QEXA 2K28A 3I4NB 2ZT9C 1Z7TA 5IP7G 1S4ZA 3AB9A 2EYJA 2OXPA 3TP6A 5L37A 3TSSA 1V43A 1U4RA 5FO7B 3NWTA 3I55A 1VQ9A 1I4XA 3H0GH 5IT9E 3S2HH 2ZXPA 3HZXA 1GUGA 4RGNA 2K5DA 1U4MA 4XXEA 4B3ML 4DPGA 2A1AA 1LUZA 4ILWA 4A3MG 5CC4A 4V0BA 1RODA 1Y14B 2E76C 5HGQA 1G2TA 3G7LA 3Q24A 2ZJPA 1LO5D 5IGFA 1JORA 4CKBA 5ELDA 3E5SA 4A3IB 3R2TA 1NNXA 4OO1H 1KDCA 2UUCQ 4N9PA 4DKAC 5J22A 1J9OA 3L9AX 3SE0A 2MO1A 5J3BA 1V1QA 2KCMA 2R3ZA 4KLKA 1LTRD 1G91A 1PH1A 1F2MA 1STAA 4DR5Q 4JI8Q 1LTTD 4X64Q 1EWIA 4DXGA 4LFAQ 5FLMG 2IX1A 4A3JG 4QCLA 1E2VA 1XPOA 3ONAB 4AQYL 3UDXA 4EGVA 1J6QA 1LLRD 1AZQA 1T9HA 4RG1A 4FVMA 1AEXA 3ULPA 4DGZA 3HOWB 4ODGA 1PVOA 1QWYA 2HCCA 1BVSA 1YHBA 1HH2P 4YY3L 5BR8L 1TWAH 3D6WA 3S15B 1AH9A 4E6IA 1K8GA 3L3OC 2Z0SA 4O1NA 1AE3A 2JA7B 2DNEA 1U4PA 1SE2A 1U0LA 2QGQA 1IBKQ 2F52A 2OWOA 3DWQA 1JT8A 1TS2A 1QUQA 4JI1Q 5C4JH 5I9PA 3SVMA 1BNZA 1A2TA 4ZUIA 2UU9L 1GXDC 3DWAA 4K14A 3HOVH 3DM1A 3GTGH 2K7VA 3I7FA 3QOLA 2L15A 4R9WA 5ELCA 3CP0A 2PQEA 1I94L 1EQQA 4LAAA 2AUJD 4DV7Q 1NCVA 3I90A 4ZQ3A 2VB3X 4FXGC 4DK0A 3D4WA 1PH5A 4OIJA 1FVIA 2R7ZG 1QG7A 1EUJA 1LT4D 5EBCA 3K7AH 5CBEE 2RDFA 1K83B 1RDPD 1XPRA 3HOVB 4EVOA 2OEOA 1XMQL 4OELB 4BA1I 4XQNA 4YWLA 4CJ2C 4V190 1LTBD 2K5HA 1SE4A 3FKIH 3I4MG 1QILA 1Y1VB 4LW1A 1CK1A 4K5VA 4AYBE 1E3PA 4DV1L 2RBMA 5HURA 4XYOA 4JI0L 1VQ5A 5GAGC 3TBIB 1RHPA 2VL6A 5FLXc 2Q8IB 2JE6I 3CXCA 4XT1B 1KIXA 3I56A 3MEHA 2EYMA 4WRDA 3ITPA 1B4OA 1ICWA 1YNJC 1L1OB 4RGMA 3NPPA 1LACA 5C3EH 4OWWB 3OW7A 3TS0A 1S5CD 5JEAJ 4OO1G 2PZUA 2PO4A 3H3VH 2B2WA 3CCSA 2K5WA 4P75A 1XYIA 1KLGD 2EJMA 1FGBD 2IX0A 3PO2H 3PO3B 2CW0C 2GVAA 4IPCA 3H91A 2WACA 4I7ZC 4GN5A 4L5QA 4CBVA 3MXNB 4X3SA 5CYUA 1WTXA 4FXDA 4TKOB 2IW3A 5C3XA 3TEHB 2B3GA 3GTOB 4LF4L 3ULJA 2RHSB 3G6JB 4BY1G 3STBC 1DGSA 3K5NA 1VQBA 3AYHB 1ZXTA 1U5KA 1CA6A 4WJWA 1DONA 2ZJRA 2M2LA 1IL2A 3SGIA 3M3YH 4LMQD 1WTQA 5C4ZA 2L11A 1PTOB 3SEBA 5G3LF 4UAIA 1X56A 2Z1CA 3J7A5 1O7ZA 1EEID 1B53A 1ML0D 2F4VQ 1NMFA 1CKNA 4A3DH 4HN7A 5CR3A 2H4OA 4OGQC 3AFQA 1N9WA 3GP7A 1S5BD 2Z6BA 3UE1A 4RFBA 1K28A 2Q2IA 1HNWL 1TWCB 1M8AA 2ZTEA 3HOYG 4XQQA 3HOVG 1VQAA 2D9UA 3K5OA 5GADC 4HIOA 4R4CA 3PUYA 3SK6A 3CCEA 2JA8H 1QE6A 3K0YA 4DK3C 4A3JB 2NVQH 1LM0A 4QL5A 1ENAA 4QF4A 1ET9A 1PH9A 1VQNA 4A75A 1U9RA 4LFBQ 4C3JB 1LT5D 1TWCH 5LL6X 2AKWB 3OWFA 1HUMA 3M85A 1D1KA 3A5UA 2RCNA 1JJGA 1WTRA 2XN9C 1JB7A 3QG1A 4A3KG 2F0FA 1PTOC 3T13A 3FKIG 5LMUQ 4C3IB 4LFBL 1FYCA 4A76A 5M3MG 1PA6A 4HSPA 1TWFH 2LSSA 4K5WA 2N78A 3OMGA 5GROA 1I94Q 3CCQA 5E3FA 3S14B 4APVA 2QCPX 1M1KC 5EBDA 1WCMH 2WAQB 5EPLA 1PH3A 4FDBA 4JG2A 3X3NA 4EQOA 3MEFA 4C3HB 3QWNA 5FLXL 1CA5A 4YHHQ 4GNXB 1PV4A 4NDXA 4K2KA 1QZGA 4LNQA 1FGUA 2KCNA 2WP8J 2YV5A 5KYIA 1N32L 1PLFA 5DLQE 4DF7A 3NQIA 3S1QH 2B2TC 2JSOA 5I9OA 1DJRD 1XX8A 3OOCA 2XGTA 1LT3D 3CU7A 4JYAL 4B9WA 4G7OC 3ULLA 1QVGA 1XTDA 2YU9B 3I8ZA 1GKHA 3SK4A 1B1ZA 1CZWA 2J0TD 3CQZH 3MVVA 2F0EA 3T51B 5C3EB 1IBML 2D0PA 5C5LA 3TRZA 2Z9HA 5G3LD 1NE3A 4JVZA 4BBRB 2GN5A 5LL6S 4C2MH 3U58A 4TVAB 1PTOH 3A55A 1VQEA 4P74A 1OXTA 2PMZB 4LF4Q 3JC66 1A8VA 2IL8A 5IYBH 3RZOB 1GUOA 4TRDA 1M90C 5ISRA 1UAPA 1KTKA 2ZXOA 1K0RA 5EKKA 4BY7B 1O7LA 1YJNA 1KAWA 4WFN3 4A3LG 2MUYA 1YVCA 4NXML 1BDOA 1D5MC 3PUZA 2HIXA 1RIPA 2E8GA 2EIFA 5J39A 1XWEA 2CQAA 2NN6H 4J8QA 3MHBA 1C48A 4OHJA 3TP8A 1N36Q 4YY3Q 4GOPB 3PIPA 3BZCA 2XWJB 2UXCL 3RZOH 1ZEQX 3QOJA 3IFDA 1YHQA 3TN2A 1KRTA 4KKUA 1QVCA 4GN3B 2BH2A 5JPMC 4JI3Q 2Q2TA 4AQYQ 2NVTH 1EFWA 4PQXA 1X3EA 4A3GB 1VQIA 3PSIA 4IFDJ 2ZXRA 2CWPA 2JEBI 1LTGD 3LNNA 3M7GA 5GQOA 1AN8A 4RCNA 5A2QE 4DR3Q 3E3XA 4CJ0B 1YIJA 2EJFC 2ALYB 4GN4B 2R93G 3AMUA 4JI2Q 3STBD 4A3BB 4IALA 4X3TA 2I46A 3S9WA 1WTVA 4DK6C 1E1TA 4X62Q 2QILA 2EY5A 3PGZA 4DV6Q 3S16H 1A63A 4CHTB 2O2LD 2JYOA 2NVYB 1KDBA 1OXVA 1HR0W 1E1OA 2E74C 3G71A 3MFGA 3NTHA 3F2BA 4BY1H 1TKWB 1X3QA 2QEJC 3CCMA 2EYFA 3RR5A 4WJ3M 5JJKA 3NWSA 1E24A 1IKMA 1I4HA 4CJ1B 2IT1A 2EPBA 4HTHA 1J5EQ 4A3EH 3GDEA 1HRJA 1B44D 3BZDB 4GLXA 2A6HC 3VYTA 3A5ZB 1NMGA 4DR1Q 1HFNA 2MO0A 4CDEC 3D3RA 4DV3L 4DXFA 4DV3Q 4OONA 3DEOA 5E1FA 2V1CC 5M3FG 1Q7YC 2UU9Q 3K5LA 4RAUC 3BDLA 3S14H 3Q23A 2K1BA 1TS4A 2G9DA 3ND8A 4MHEA 1J5EL 1IBKL 4JV5L 3H94A 2K01A 3R93A 4PMWA 1RKNA 3KLSA 3QR8A 4OO1I 2ID0A 1EOVA 1EIHA 1BOSA 1WD1A 5I6WA 3PO3H 1IW7D 1DOKA 2F0NA 3PO3G 4A3DB 4IUQA 4O2DA 3HRZC 2A19A 3Q8DA 1X3GA 2OTLA 3KOJA 4HCSA 3W3AA 1GD7A 3E9HA 1PFSA 1IL8A 2QDBA 1CT1D 4RKLA 5C4HA 1OO9B 3IAYA 4LF5L 4RGTA 4HIDA 3VYSA 1STGA 2UXBQ 3RLNA 1BXTA 4IPDA 3I72A 1F9QA 2F4IA 4A3KH 1B50A 5FOBB 4HSVA 3T4AC 5K36G 4KKSA 4A3GG 4LF6Q 5D3DA 3J81c 3CRKC 5C44H 3UDFA 4ZLTF 5IOCA 1CI3M 2Q8TA 1MJEA 4A93H 3K59A 4N8X1 5M3MH 2AWOA 2A68D 4IOCA 2PI2E 1KQSA 2E2IB 3FMCA 1KNEA 3GTPB 1X65A 4HMJA 1UUPA 3OW2A 4X65Q 1EEFD 5M5WH 1BCPB 4AH6A 1FR3A 3H3VI 1ICFB 3K8AA 4A3EG 2O5IC 5JJLA 4YWKA 2ZJQA 3DM3A 1SROA 1EY6A 2F0MA 4IFDG 5IWAQ 2HDMA 4IJHA 3I4MB 1Q82C 5JOBA 5JAVA 3I91A 5IYCG 1TWFB 4NXMQ 2EZVA 3PMFA 2RSNA 3GTKH 4F88A 4ZYSA 1V1PA 5C3WA 4DV5Q 2F0WA 1YI2A 1CQFA 5C4XH 2K5QA 2RDGA 1JJ2A 1CKNB 1PMRA 2ZTCA 2K33A 4GZYC 1YEZA 3PCOB 5GAEC 3TQYA 2UUBQ 2F0UA 4PMBA 3T1YL 1SYGA 1HNXQ 2WV6D 3GTPH 1LT6D 1VF5C 2R6GA 2B63H 5D14A 2JA6B 3CPWA 1HHVA 2J4XA 3RUZA 4KHVA 3CRLC 2KA7A 5M5XH 1P8LA 4Y52H 2JA7H 4JK1C 2R7ZH 3M4OB 1UE1A 2A68C 4BBSH 4A3LH 2HT1A 2FMMA 2PNHA 1GHJA 1BF4A 2CH4W 2NZHA 1XMOQ 2PNRC 4A3FB 3NENA 3OTOL 1IYUA 1VF7A 2Y0SB 1KDAA 1G2SA 3S1QB 1S40A 2EY6A 3PF5A 4DAPA 3AFPA 2ZM6Q 3FP9A 4K8JA 2G5DA 3GTLH 1STEA 1MHWC 1KC8C 4K6LA 3E9IA 1VQFA 3K0XA 1DZ1A 4BXXG 4NXNL 3BU2A 2B2TA 3UE0A 3CCUA 4JI6Q 1SYFA 3O13A 4B08A 4B3TQ 1Q81C 3W1BA 1FJGQ 2HQEA 1NJIC 4FXKC 3E6ZX 5JEAH 1K9MC 1LTSD 4ABNA 4C1NK 3CC2A 4KHZA 3P7JA 3EJIA 3HFZB 4Y7NH 4I7AA 1Q8KA 3NTIA 3Q22A 3NXWA 4U68A 4BY7G 1I4QA 2ICIA 3WDNA 2VW9A 2VUMB 4A93G 2BA1A 2NWGA 2N55A 3GV3A 1CUKA 3I2ZA 3HOWH 3S1RB 4ZKCB 3GTMB 4KY6A 1K73C 1ENFA 2RSOA 2NVQB 4A3KB 2L12A 5AJ3Q 2HIVA 1IHZA 3L0OA 4FYDA 1U4LA 1OTCA 5KYLA 2K04A 4GOPC 4OEMB 2E5LQ 1LV9A 2CW0D 4DR6L 3ERQA 5KGUA 1CSQA 2WIIB 3J7ZC 5IIFA 5FJ8G 2KBNA 5FJ8H 2B2VA 2EOTA 1BO0A 1EZ8A 1VQHA 5M5XB 2FFKB 5C0XH 3S2HB 2MJ8A 1QJOA 1W6KA 3CKIB 3VYRA 3WOFA 1GUTA 5TSSA 5CV9A 3H6MA 1K3RA 1SR3A 2R7DA 3HOYH 1DXMA 2LFNA 4M1UB 2JA6G 3J7AV 1WTWA 1NUCA 2XTIA 4PZ6A 5IGBA 2OT2A 3CC4A 3U9OA 3ZJYC 1UE5A 1PDQA 5CV4A 1YNND 2XSCA 4H13C 4B9XA 4C3HG 1PZID 4DR4L 5M9OA 1LTAD 1CSPA 2NTTA 5F2DA 2H1EA 2F0OA 3K7AB 1Q46A 1D5ZC 2WKCA 1G8ZD 2FHTA 2L1BA 1STBA 2R7FA 1SE3A 4JCVE 5J1ZA 4DV4L 3UDGA 3QJYA 2BDNA 1UWVA 3J80E 5C0XJ 3N6RA 3PUVA 1SFOH 1TWHH 4NXNQ 1K0SA 2RDHA 2RHQB 4XT3B 2HHHL 3T53B 1IBLL 1DCZA 3BYTB 1Q3LA 2F3IA 4L5TA 5IYDG 2Q2HA 3HS0C 3HOXG 1MIUA 1EY0A 3G48A 1SAPA 3HG9A 4UP8A 3T1HL 1E0BA 2KEDA 2OF1A 2HQLA 2NVXH 3HOZH 4AIMA 4KD4A 2WFWA 1K8OA 1TT2A 2VUMG 1BCPF 1V1PB 5D65A 3AEVA 2Z6KA 1ESRA 4KTAA 2KJXA 4GLAC 3WOEA 3V96A 2AMCB 3KF6A 4DAYA 1XJVA 2PI2A 1EQRA 2R92H 5C4XG 3A54A 1Q1BA 3MXNA 2F4VL 2PQAB 3KK7A 5CV5A 3TZDA 3J80c 4DFAA 3HOUB 1PZKD 4GLVB 3X3MA 1EYDA 2NZ1D 2IHFA 1ONLA 2X69A 2VQEQ 2EYLA 1S72A 1HNZL 5ELFA 2EXDA 4KN7C 2AQ2B 1FJGL 5T1IA 4R8IA 1TWGB 4ZRZA 5CV6A 3EQLC 3CHBD 1SDFA 3Q0AA 1QOHA 1HUNA 4FF1A 2UXDL 2VS1A 5KIXA 2E2IH 3VR5A 4UHVA 5LMNQ 1EU3A 4LF8Q 1OXUA 1XNQL 4EX5A 1QNKA 2EYHA 1XMOL 5FLMH 4DA2A 3H15A 2NN6G 4P71A 3V05A 1D7QA 1MD2D 1SLJA 1JQYD 1XTCD 1W2BA 2R61A 3M4OH 2AUKA 4B3SL 1C8CA 3R3OA 1SBBB 5ELNA 3J81E 2B2YC 4M8AA 3OSOA 4JI4L 1GVPA 2DUDA 4K6DA 2E2HH 3FRPB 4P73A 3BVZA 2XRSD 1ASZA 3GTLB 4FNFA 2CH4A 4LF6L 3D4RA 4IFDI 1YITA 2F0DA 1E22A 4X64L 2D62A 2PCFB 4DV0Q 4DV2Q 3T1YQ 4KJNA 1EIYB 4DV1Q 1D2BA 4GKJL 3GTJB 4Y7NB 1EY5A 2E2JB 4LF9Q 2F0PA 4HJ9A 2EXZA 3B6YA 4KY7A 4IOAA 4HJ7A 1SEBD 2KHJA 1GUNA 3S17H 2F0GA 2EYPA 2O5JC 1Y1WH 1N33Q 1JE5A 2HCIA 5GAHC 4ULLA 4RCOA 5EKLA 1EOTA 3I4NH 3I4NG 3TP7A 5IP9H 2ASBA 3WWVA 1O7IA 1SJED 5IWAL 2KVMA 4JBJA 4JBKA 1SMYC 2MHVA 3PO2B 5KNBA 1B7YB 3J81L 5I2XA 1F77A 1B3QA 2Q8RE 1TY2A 5HY6A 1FL0A 1O80A 3VA7A 3M4QA 5JJIA 1V8QA 1LYLA 4CKEA 1VQKA 4JI8L 5ELBA 4DV0L 4QIWE 5JVG3 4XTCS 2DY8A 4H0LC 3A8KE 3PIP3 3P75A 3RMHA 3KBXA 2XNAC 4K2LA 4HIMA 3H0GG 5FO8B 1TIID 4X65L 1VQ4A 1R9TH 3D4DA 2DGYA 2JQOA 4X62L 4UY8C 4DNIA 2BE5C 1EL0A 4C3IG 2RKSA 2PMZE 3CMAA 3F2DA 4JC0A 1Q90A 3KUPA 1D8LA 4LFAL 2KHIA 4KV6A 4JV5Q 2WB1G 4A3CH 3NBIA 4RH6A 3CCJA 4GOPA 1JC7A 3MZ5A 3GTQB 1X9NA 2JA5H 1HCZA 1R9TB 2RF4A 2AQ1B 3CCRA 4LF5Q 1Z47A 3KLWA 4MZ9A 3TREA 3PIOA 3SK8A 5C44G 2XIWA 1MSHA 4N8FA 2N49A 1MSGA 3OPOA 4DR1L 3DUZA 2KHSA 1X32A 1HXYD 1KD1C 3P20A 3IRBA 1TS5A 1FNVA 4AYBB 4OIKA 4DU9A 2R92B 3HOXH 4L8JA 2KUMA 4R8NA 1UEAB 4WORA 1N36L 4H7BA 5DEHA 4B3MQ 3ERSX 3K6OA 2F0QA 2JXMB 1C7YA 2XVSA 1YNXA 2VUMH 5M3FH 1PH7A 5C3EG 4LF7Q 1I6HB 1O78A 4JPBW 3K81C 4LF8L 4JOIA 1GOZA 4RGOS 4BBSB 5I2YA 4A3BH 3KLSX 1EY9A 4FF4A 5EJWA 1B3AA 3C3LA 3GTQH 4QUFA 5CORA 3CQZB 1EWCA 2BE5D 2HUGA 3MAQA 2I5MX 4IPHA 4QB4A 2Y0SG 1TWAB 2A73B 5ELEA 3URYA 4GKJQ 4QIWB 4UP9A 5ELOA 3PF4A 1Q8IA 2BOSA 1SNOA 2M00A 2B63G 1WOCA 2I07B 3KDFA 3E0EA 1HZ9A 4LFCL 2E2JH 4R4TA 4RWSC 1QUQB 1FNUA 1KHIA 2Z4IA 2YTVA 5BN4A 2MGSA 3JAME 3Q6SA 1N34Q 4GKKL 1GUWA 4LUVA 1CKOA 2WB1E 4YCUA 1BBWA 1Y8NB 4DR7L 3ND9A 5IGDA 3GTKB 2UXCQ 1E2ZA 1AP0A 1N33L 2F0LA 4A3CG 3TP5A 4HIKA 2NBFA 4XDXA 1H95A 2B29A 5LMNW 2F0HA 4JI2L 4IURA 4KK7A 2F0JA 3S24A 4YHHL 1YJWA 5IY0A 4LF9L 4A4IA 1RTOA 2YYZA 1I4GA 4A3IH 3H0GB 5LMNL 1Y1VG 2X6LA 2ES2A 1I50H 1SYBA 1TXYA 4YCVA 4GNXC 2PW5A 3KLRA 5LHY1 1WJJA 2WB1B 3SDZA 3DXJC 4G57A 3HOUG 3GV6A 2F3WA 1Y69U 1ASYA 5E7NA 2F0VA 3OHXC 1KLUD 4B3SQ 1I4RA 2LMCB 1K83H 2K5VA 4ZKBB 2LS01 3R8BA 5JEAG 3UDIA 5FO9B 2E5LL 3MTSA 2SOBA 5CGKA 3NEMA 3OIPA 2KENA 5DNFA 1NSNS 1EIGA 3MC0B 2FINB 1T5XD 2IJ0A 3K7UC 4DR4Q 1VQ7A 3TZUA 2F0IA 2Z6KC 3HKZE 1DOMA 4BY7H 4X66Q 5IGCA 5FK9C 4JI7Q 2DY7A 1A2UA 3C1EA 4G7HC 2UXDQ 2RCFA 3GTJH 1JCKB 1EYGA 4J1MA 1BKBA 2J7ZA 4IUVA 4RMFA 5DAUA 4RHRA 1ZYRC 4UDUC 1Z6HA 1VDZA 1DM0B 2F3VA 1SXTA 3RLOA 2L0CA 3I3CA 1CKMA 3RZDB 1RCVD 1PRTD 4BS9A 5K5PA 1Q86C 4X3UA 3I4LA 5EAYA 1G6ZA 1W3SA 4DR6Q 3G6EA 3TS2A 1PYSB 1Y8OB 1A0IA 4P72A 4A93B 1XXGA 4A3DG 1II3A 4KMUC 1HPCA 3NTKA 2YTYA 1RL2A 2OQ0A 4L6TB 4JI5L 5AJ3L 3BG3A 3MFYA 1L0YB 4DK1A 4YWMA 1JJCB 4POGA 3SXHA 5I6YA 1G51A 4KI0A 1N8RC 2BDOA 2AHOB 2KECA 1TWHB 3J80i 1B70B 2TSSA 4ID6A 2MP1A 4Q0FA 1SYDA 2UUAL 2KCCA 1WCMB 2CWAA 3NE5B 5IGEA 1SFOB 3CD6A 3S16B 4X66L 3NQTA 2A69C 3NP8A 4HJAA 1IBLQ 3BS1A 4HMIA 3AQQA 1EFID 3T16A 1HA5A 3I73A 5E4XA 1PH6A 2OCEA 1VCIA 3VA5A 3PO2G 2QKIC 5BN3A 1F9SA 2D0OA 3ICEA 3VR3A 4IQZA 1PHJA 1VQOA 1IKLA 4A3EB 3EVQA 1KXLA 3J81i 4H02A 1A3UA 1CFMA 3A7AB 1N34L 1ZKOA 3I4MH 1X54A 5IP9G 1VQCA 4S3SA 1HJPA 3NBHA 4JBWA 2O4XA 1AZPA 1BBXC 2ZM6L 4MIUA 1HNXL 3CW2C 1WYDA 4LUZA 1WCMG 1GUSA 4NMZA 3M9BA 1D1IA 2IPKD 1BQQT 4C2MB 3J81j 3M4YA 4O0AA 1SJHD 2NUCA 1HNWQ 4IUPA 4FF2A 2IX3A 2CQOA 2EY2A 1I5FA 2PPBC 2K4KA 1VQMA 1C0AA 4LF7L 4F87A 4FF3A 5C0XG 3C2PA 1AW7A 3GD7A 2SEBD 5EGTA 2EQSA 3UI2A 2ENBA 4X6AH 1X3FA 3GO5A 5CMDA 3KF6B 4DAYB 1H9MA 5KNDA 1WFQA 3R2IA 1UE6A 5BR8Q 1Y1WG 4ME5A 1L0WA 2VY3A 1B9MA 2AWNA 3SK5A 1UNSA 1Y8PB 2ICEC 1ZYRD 3F2CA 1LTLA 4IN3A 4JW0A 3M3YB 2CHBD 2PZWA 4FP5D 1OXXK 4A3FG 1E2WA 4POFA 2C9OA 5IYBG 3FHWA 1RTNA 2A6ED 3S1NH 5C0XI 1WTHA 4DR5L 1VQDA 4ZK9B 2UXBL 5EPKA 2VNUD 3LX0A 2HDLA 2E75C 1HR0L 3OTOQ 1TU2B 3CAMA 2PZTA 2K32A 1STYA 3KBGA 1VMPA 4A3GH 4KHPL 3KDFB 4KY5A 4HJ8A 3BDOA 2JJQA 2F0TA 5EPJA 5DM63 4LUOA 3S1RH 1K3BC 3OWEB 1Q12A 2GVBA 2RA4A 4IUTA 3QB3A 2B8GA 3FDTA 3NELA 1Y1WB 3FKIB 1A15A 3RLFA 2QF7A 1HTLD 2GA4B 3FEWX 4MN3A 4OWXB 1NAPA 1EYAA 4C1NI 5C4JB 1F2LA 4JI6L 1HQRD 3BZKA 4JBMA 1E7ZA 3J7AF 1F9PA 2A69D 4LFCQ 1WI5A 3PV0A 5EKIA 4Q5VA 2LY7A 1H9SB 1CQVA 3GTGB 1TY0A 1PH8A 4IO9A 2A5HA 1VQGA 1KNAA 2M9VA 1AFPA 2DJFC 4KD3A 4ME3A 3AU7A 4A3BG 1X55A 1I6HH 1CHPD 3U50C 1I6VC 4XQJA 5NUCA 3S2DH 5EQ0A 4KN4C 3NSWA 2K6AA 3A8IE 4JI1L 4MTNA 4HR7B 3MXPA 4GS3A 2TMPA 4CDCC 2SNMA 5IT9c 2I5HA 2VZAA 5E4WC 5M3FB 2A6HD 1F2YA 3EBEA 3KF8A 1ET6A 4IJLA 4PMCA 3HGBA 2E2HB 3K5MA 1K8MA 1I4PA 4C56C 5JVH3 4A3FH 3OMCA 4OXPA 4DV7L 5IYDH 2H5XA 2N88A 3H09A 1GO3E 3KYHC 3HOZB 1SE8A 2MNAA 2ZTDA 2F03A 5IE8A 1PH4A 1JB3A 2P5ZX 4QY7A 1HTPA 3CCVA 4B3RQ 1P16A 3CPFA 2B2VC 4XYQA 3D6CA 1AE2A 2EE1A 1V9PA 1IW7C 1GHKA 4TQUS 1JOKA 2D2CC 2NYZD 2JN4A 3DHQA 3L2PA 1EIFA 3A56A 3MXGA 3LGJA 1DYQA 5KNCA 4OX9Q 4C3JH 1MGSA 5IODA 4JI3L 1PZJD 2KQ3A 2PQAA 1G291 1H9SA 3N52A 5FKAC 4EQ5A 5I4DA 1YJ9A 1PH2A 4BXXH 2JA8G 5COYA 3HKZB 2MQHA 2CVRA 4AYBG 2C5CA 3CC7A 1M4VA 4U673 4DV6L 1VQPA 4QJFA 4RKBA 1H9KA 1O7YA 3KJPA 3RN2A 4UPAA 2YU9H 4L63B 3S1MB 1HFGA 1L1OA 3LWUA 2B39A 4DNRB 4NW2A 3NUCA 3G4SA 2NZOA 2IHEA 1VS0A 2FXQA 1I3QB 2JA5G 1MJCA 2DN8A 1L2FA 2SDFA 4KJOA 3TDQA 2JEAI 2VXWA 4B3RL 2A6EC 4L5RC 2MPMA 2V4DA 4OL7A 4IUNA 2BCOA 4JI4Q 1EYCA 4MTKA 3GTOH 1FNWA 1HNZQ 2QA4A 5IT9L 1EU4A 4X3KA 3HKZG 2VQEL 1WVLA 5M5YB 4I65A 1F9RA 1JICA 1KAAA 1UE7A 2OTJA 2KOLA 4PV1C 1VQJA 3IKJA 2HD3A 1SNCA 4DAVA 1HZBA 1SN8A 3DWPA 4KHPQ 2A74C 3HP3A 3QO2A 2Q2UA 5JPNC 3K80C 3M7NA 3JAML 1KABA 2B2YA 4BBRH 3F1ZA 2R92G 2R93H 4J6HA 1X6OA 3FVQA 1VQ8A 1QZHA 4QQBX 4CGYB 1BR9A 3MXUA 1YHAA 4YIJA 4HEDA 1X3PA 1QNUA 1HQMC 3I70A 4F7XA 3U4VA 5M3MB 1A3VA 1TQOA 4A3MH 1BCPC 1KL9A 1SSOA 1D6EC 4K8IA 1B9NA 3I4OA 3PUXA 2K05A 2C35B 4YCWA 4C3IH 1IXRA 5HGTA 1MBYA 1LTID 4R4QA 1S5ED 1Q1EA 2MFIA 2JA7G 1QB5D 2EDGA 4NP5A 4K0KL 4DUYL 3L7ZC 5DM73 2LKVA 2VB2X 1SYCA 1N32Q 1XNRL 4NKLA 4G4KA 4ZAIA 2Y0SE 5IGGA 1B2TA 4QMGA 4F8MA 3D31A 4PG3A 1HZCA 3NHHA 1RJTA 4DR2L 1XNQQ 2VQFQ 4DR3L 5KRUA 5T1GA 4DV2L 1GJXA 2HHHQ 3VR2A 1SMYD 3IL8A 3VYUA 3KF8B 2RQXA 4PZ7A 3HOUH 1PYWD 2CKZB 3W2DA 3S17B 3MA2B 2R7ZB 3EN2A 4DUZL 4DV4Q 1IYJB 5IYCH 1JWMD 3C46A 2KCTA 4FO2A 1W6JA 3ZYYX 1CHQD 5BN5A 1QVFA 2B2UC 4BY1B 3SR1A 4HJ5A 2QW7A 2WINB 3A7LA 4EQPA 2D5DA 5C6AA 3CCLA 3F8TA 2K03A 3FPPA 4KKTA 1JWSD 1VQ6A 2Z8LA 1HR0Q 3QIAA 1D5XC 3S1NB 4P2CB 5K36H 3P1HA 1PFMA 4CDDC 5A35A 4NB3A 1DOLA 2K50A 1RD9D 2EJGC 3DLLA 3K57A
chains in the Genus database with same CATH topology
3ULJA 2NVYH 2RHSB 4BY1G 3STBC 1DGSA 1VQBA 1CUKA 3AYHB 1PYBA 1U5KA 3I2ZA 3T1HQ 3HOWH 4RMFA 1L1OC 2ZJRA 1IL2A 3SGIA 3M3YH 3A0JA 4PZ8A 4R4IA 3RLOA 1K73C 4LWCA 3EIVA 4OWTB 1IBMQ 1CKMA 5AJ3Q 1X56A 2HIVA 1Q86C 4JI5Q 1GM5A 3L0OA 5EAYA 3HOZG 1W3SA 4UP7A 3J7A5 4DR6Q 3G6EA 3TS2A 1PYSB 1OTCA 1A0IA 4P72A 5IP7H 4GOPC 2E5LQ 2F4VQ 4A3DG 4DR6L 1NMFA 1CKNA 1SMXA 4A3DH 4JYAQ 4L5SA 1CSQA 3J7ZC 3AFQA 1N9WA 2YTYA 1NBWA 1RL2A 2OQ0A 4JI5L 3W5OA 2KBNA 5FJ8H 5FJ8G 5AJ3L 1VQHA 4YWMA 1A62A 1JJCB 1SRUA 4POGA 1NY4A 3UE1A 3CMEA 1G51A 4KI0A 1N8RC 2AHOB 2Q2IA 1HNWL 3J80i 1B70B 2ZTEA 1VQLA 1K3RA 1SR3A 2N3SA 3HOYG 3W1GA 3HOVG 4MNOA 2R7DA 3HOYH 1VQAA 2JA6G 2JA6H 1BBUA 5GADC 4HIOA 2UUAL 4R4CA 3PUYA 4JI7L 2CWAA 3CCEA 2JA8H 3CD6A 2XTIA 4DK3C 4PZ6A 4X66L 2NVQH 3RNUA 1I3QH 3CC4A 3ZJYC 1UE5A 1LM0A 1MKHA 4QL5A 3KJOA 4HJAA 3JAMc 1IBLQ 1JMCA 4DR4L 4DR2Q 1OXSC 3AQQA 1CSPA 1PH9A 1VQNA 4A75A 4LFBQ 5LMUL 1Q46A 1PH6A 2OCEA 1VCIA 1TWCH 1B8AA 2AKWB 3M4PA 3PO2G 3M85A 2R7FA 1YBYA 2D0OA 3A5UA 2RCNA 3ICEA 1JJGA 4JCVE 1PHJA 1JB7A 1VQOA 4DV4L 4DUYQ 3UDGA 2K14A 4A3KG 4K0KQ 2CCZA 1UWVA 1KXLA 3J81i 4H02A 5C0XJ 3PUVA 1SFOH 3FKIG 1N34L 1TWHH 2OQKA 4NXNQ 1X54A 2BA0A 5IP9G 5LMUQ 3I4MH 1VQCA 4LFBL 3JAMi 5H1SE 4A3IG 4A76A 5M3MG 1PA6A 2RHQB 1KRSA 1HJPA 1TWFH 2LSSA 4JBWA 2HHHL 2N78A 5GROA 1I94Q 2ZM6L 1IBLL 3CCQA 3HOWG 4APVA 1M1KC 4JI0Q 1HNXL 2F3IA 4L5TA 3CW2C 1WCMH 1WYDA 5IYDG 3U4ZA 4LUZA 1WCMG 1PH3A 2Q2HA 3HOXG 2VQFL 2UUBL 2UUAQ 4FDBA 4JG2A 1MIUA 4UP8A 3G48A 3M9BA 3MEFA 3T1HL 4YHHQ 4GNXB 2HQLA 2NVXH 3J81j 1PV4A 1G6PA 4ALPA 3HOZH 2I5LX 4AIMA 2N8NA 2WFWA 2NN6I 4O0AA 4WJ4A 1QZGA 4LNQA 2VUMG 1FGUA 2YV5A 2WP8J 1HNWQ 1XMQQ 3S15H 3AEVA 1N32L 2Z6KA 5DLQE 3S1QH 3OYYA 2CQOA 1I5FA 1TWGH 4GLAC 2K4KA 2AMCB 3KF6A 1VQMA 1XJVA 1C0AA 2PI2A 2A8VA 4LF7L 1EQRA 2R92H 5C4XG 5C0XG 2XGTA 1XPUA 3GD7A 4J15A 1Q1BA 4QGUA 2EQSA 2F4VL 4JYAL 2PQAB 4DAMA 3ULLA 1QVGA 4X6AH 1XTDA 1X3FA 3GO5A 3J80c 3KF6B 4DAYB 1GKHA 1WFQA 4GLVB 1UE6A 5BR8Q 1Y1WG 1L0WA 2IHFA 2K75A 3CQZH 4R4OA 2BH8A 2VQEQ 2VY3A 2AWNA 1S72A 1HNZL 1IBML 2D0PA 3TRZA 2EXDA 1NE3A 3F2CA 1LTLA 4DUZQ 1FJGL 2JA9A 2GN5A 1OXXK 4C2MH 3U58A 4C3HH 4TVAB 4A3FG 4NPSA 4GNXA 1VQEA 4P74A 1OXTA 4POFA 4LF4Q 3JC66 1A8VA 5IYBH 2K52A 3PUWA 5IYBG 1M90C 3FHWA 2VS1A 2UXDL 2E2IH 3S1NH 1K0RA 1HZAA 5C0XI 4DR5L 1VQDA 1YJNA 5LMNQ 1KAWA 4BBSG 4LF8Q 4A3LG 2UXBL 1OXUA 4IPGA 5M5YH 1XNQL 2VNUD 1YVCA 4NXML 2WAQG 1HR0L 3OTOQ 3PUZA 2HIXA 3CAMA 1RIPA 2E8GA 2EIFA 4EX5A 4KHPL 1XMOL 4A3GH 3KDFB 4JOIC 5FLMH 4HJ8A 4A3JH 3H15A 2JJQA 2NN6G 4P71A 2UUCL 4LUOA 3KFUA 1D7QA 3S1RH 2CFMA 1N36Q 1XNRQ 3GTMH 1Q12A 2GVBA 4YY3Q 1SLJA 4XIGS 3PIPA 4GOPB 3NELA 1W2BA 3BZCA 3M4OH 4B3SL 2UXCL 1Y1VH 5ELNA 1K8AC 3RZOH 3RLFA 3S1MH 1UEBA 4OWXB 4B3TL 1YHQA 1KRTA 4JI6L 4JI4L 3BZKA 4JBMA 1QVCA 1GVPA 2DUDA 1E7ZA 4GN3B 2E2HH 4JI3Q 2BH2A 4P73A 2Q2TA 4AQYQ 1ASZA 4LFCQ 1WI5A 3PV0A 2NVTH 1EFWA 1X3EA 4LF6L 1VQIA 3PSIA 3RN5A 4IFDI 1YITA 1PH8A 4IFDJ 1E22A 4X64L 2CWPA 2D62A 4DV0Q 2JEBI 4DV2Q 4IO9A 3T1YQ 1C9OA 5GQOA 1S3OA 2YTXA 1YZ6A 4DV1Q 4DR3Q 1VQGA 1EIYB 4GKJL 3VDYA 4ME3A 1YIJA 4A3BG 2ALYB 1X55A 4R1JA 4BBRG 4LF9Q 3U50C 1I6HH 4GN4B 2R93G 4HJ9A 4JI2Q 3BJUA 3B6YA 3STBD 1NTGA 3S2DH 4IOAA 4HJ7A 2KHJA 4JI1L 4DV5L 3S17H 4DK6C 1E1TA 4X62Q 4MTNA 1Y1WH 1N33Q 1JE5A 1A63A 3NBHB 3PGZA 2K5NA 4DV6Q 4GS3A 3RZDH 5GAHC 3DLLA 3S16H 2I0QA 5IT9c 2I5HA 4DR7Q 1OXVA 2VZAA 1HR0W 1E1OA 3I4NH 3I4NG 5IP9H 3G71A 2ASBA 3EBEA 3WWVA 1O7IA 3F2BA 4BY1H 5IWAL 4GKKQ 4JBJA 3HKSA 4JBKA 4IJLA 3CCMA 3D0FA 4OX9L 3A74A 3RR5A 4WJ3M 5JJKA 4A3FH 1E24A 4OXPA 1IZ6A 1B7YB 4DV7L 2IT1A 5IYDH 2H5XA 1GO3E 2LXKA 2WAQE 3KYHC 1J5EQ 1SE8A 2MNAA 4BA2I 4A3EH 1Z9FA 3GDEA 2JK8A 2ZTDA 3CF5A 3ER0A 4GLXA 2LXJA 5HY6A 2ATWA 1FL0A 1NMGA 3A5ZB 5IE8A 4DR1Q 1PH4A 4QY7A 2MO0A 2IY5B 3CCVA 4B3RQ 1P16A 3CPFA 4DV3L 4DV3Q 2QEXA 4OONA 1AE2A 3M4QA 2V1CC 5M3FG 1Q7YC 5IP7G 2UU9Q 5JJIA 1LYLA 1V9PA 1VQKA 3S14H 4TQUS 1V43A 4JI8L 4DV0L 4QIWE 3L2PA 1J5EL 4XTCS 1EIFA 1IBKL 4JV5L 3I55A 4PMWA 1VQ9A 4OO1I 2ID0A 1EOVA 3H0GH 3LGJA 4HIMA 3H0GG 3S2HH 4OX9Q 4C3JH 4JI3L 4B3ML 3PO3H 4DPGA 2A1AA 2PQAA 1G291 1LUZA 4EQ5A 1YJ9A 1PH2A 3PO3G 4A3MG 4BXXH 4O2DA 2JA8G 4X65L 1VQ4A 1Y14B 2MQHA 2A19A 1R9TH 3Q8DA 4AYBG 5HGQA 3CC7A 1X3GA 2OTLA 2ZJPA 2DGYA 2JQOA 3KOJA 4DV6L 1GD7A 3E9HA 1PFSA 1VQPA 4X62L 4UY8C 4QJFA 4DNIA 3KJPA 3RN2A 2UUCQ 4DKAC 4UPAA 2YU9H 2PMZE 3CMAA 3F2DA 2MO1A 4JC0A 4LF5L 1L1OA 1V1QA 5J3BA 1D8LA 2KCMA 4KLKA 4LFAL 2KHIA 4HIDA 2UXBQ 4JV5Q 3RLNA 1PH1A 3G4SA 4IPDA 2WB1G 4A3CH 2NZOA 2IHEA 4DR5Q 4A3KH 4JI8Q 3CCJA 1VS0A 4GOPA 4X64Q 1EWIA 5K36G 2FXQA 2JA5G 4A3GG 1MJCA 4LFAQ 1X9NA 1L2FA 5FLMG 2JA5H 4LF6Q 2IX1A 4A3JG 2RF4A 2JEAI 3J81c 3CCRA 4LF5Q 1XPOA 1Z47A 3KLWA 4MZ9A 3TREA 3UDFA 5C44H 3PIOA 3UDXA 5C44G 4AQYL 4L5RC 4A93H 1MJEA 4B3RL 2N49A 1J6QA 4DR1L 5M3MH 4JI4Q 2AWOA 4IOCA 2PI2E 1KD1C 1KQSA 1T9HA 3GTOH 3IRBA 4RG1A 3ULPA 1EYGA 1X65A 1HNZQ 2QA4A 3OW2A 3HOXH 2VQEL 3HKZG 4X65Q 1PVOA 5M5WH 4AH6A 3H3VI 1BVSA 1YHBA 1HH2P 1UE7A 3K8AA 4YY3L 5BR8L 1VQJA 1TWAH 4A3EG 1N36L 2OTJA 5JJLA 4YWKA 4B3MQ 2ZJQA 3ERSX 3DM3A 1SROA 1AH9A 4IFDG 5IWAQ 1K8GA 4IJHA 2Z0SA 1HZBA 1SN8A 1Q82C 1AE3A 4KHPQ 1C7YA 1YNXA 2VUMH 5M3FH 1U0LA 5IYCG 2Q2UA 3K80C 1PH7A 5C3EG 2QGQA 4LF7Q 4NXMQ 3M7NA 3K81C 1IBKQ 4LF8L 4JOIA 2F52A 3GTKH 2OWOA 1JT8A 4A3BH 1QUQA 4JI1Q 3F1ZA 4BBRH 4DV5Q 1YI2A 2R92G 5C4JH 2R93H 5C4XH 3GTQH 1X6OA 1VQ8A 1JJ2A 1CKNB 2UU9L 2ZTCA 1QZHA 4QQBX 1YEZA 2I5MX 1YHAA 4IPHA 3PCOB 2Y0SG 5GAEC 3HOVH 3TQYA 3U4VA 2UUBQ 4GKJQ 3GTGH 4UP9A 5ELOA 3T1YL 3PF4A 3I7FA 4A3MH 2L15A 1HNXQ 1KL9A 2B63G 3CP0A 3GTPH 1WOCA 2R6GA 2B63H 1I94L 1EQQA 4DV7Q 3KDFA 3E0EA 1HZ9A 3I4OA 3PUXA 3CPWA 4LFCL 2E2JH 2C35B 4R4TA 1QUQB 1KHIA 1PH5A 5M5XH 2YTVA 4YCWA 4C3IH 1N34Q 1IXRA 4GKKL 1P8LA 4R4QA 1FVIA 2JA7H 1Q1EA 2MFIA 4LUVA 1CKOA 2JA7G 2R7ZG 4Y52H 2WB1E 4YCUA 2R7ZH 1BBWA 1EUJA 4K0KL 4DUYL 4DR7L 1UE1A 3L7ZC 4BBSH 2UXCQ 3K7AH 4A3LH 2HT1A 1N33L 4A3CG 1XPRA 2PNHA 1N32Q 1XNRL 1XMQL 4HIKA 4BA1I 1H95A 4YWLA 2B29A 2Y0SE 5LMNW 2K5HA 4JI2L 2NZHA 3D31A 4PG3A 1XMOQ 3FKIH 1YJWA 1HZCA 3S24A 4YHHL 4LF9L 5IY0A 3NENA 3OTOL 4DR2L 3I4MG 4A4IA 2YYZA 4LW1A 4A3IH 1XNQQ 4AYBE 1E3PA 2VQFQ 4DV1L 4DR3L 1S40A 5LMNL 1Y1VG 3PF5A 4DV2L 2ES2A 4JI0L 1I50H 1TXYA 4YCVA 5GAGC 3AFPA 4GNXC 2ZM6Q 3FP9A 1VQ5A 2HHHQ 3GTLH 1WJJA 1KC8C 2VL6A 3KF8B 5FLXc 3E9IA 1VQFA 4PZ7A 3K0XA 2JE6I 3HOUH 4BXXG 4NXNL 2CKZB 3HOUG 3CXCA 3BU2A 3UE0A 3CCUA 4JI6Q 1KIXA 3I56A 4B3TQ 1Q81C 3EN2A 3W1BA 4DUZL 1ASYA 5E7NA 1FJGQ 1L1OB 4DV4Q 1NJIC 1IYJB 5IYCH 5C3EH 4B3SQ 4OWWB 3TS0A 2KCTA 5JEAJ 4OO1G 1K83H 2K5VA 1QVFA 5JEAG 3UDIA 3H3VH 1K9MC 2E5LL 4HJ5A 3NEMA 3CCSA 4P75A 3CC2A 2IX0A 4KHZA 3F8TA 3CCLA 3PO2H 2KENA 3HFZB 4Y7NH 2GVAA 1VQ6A 4IPCA 1Q8KA 3K7UC 1HR0Q 4DR4Q 1VQ7A 2Z6KC 3HKZE 4GN5A 4BY7H 4X66Q 4L5QA 4BY7G 3MXNB 4JI7Q 4NB3A 2K50A 3TEHB 2VW9A 2B3GA 2UXDQ 3GTJH 4A93G 2BA1A 4LF4L 1BKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ULJ A;  2NVY H;  2RHS B;  4BY1 G;  3STB C;  1DGS A;  1VQB A;  1CUK A;  3AYH B;  1PYB A;  1U5K A;  3I2Z A;  3T1H Q;  3HOW H;  4RMF A;  1L1O C;  2ZJR A;  1IL2 A;  3SGI A;  3M3Y H;  3A0J A;  4PZ8 A;  4R4I A;  3RLO A;  1K73 C;  4LWC A;  3EIV A;  4OWT B;  1IBM Q;  1CKM A;  5AJ3 Q;  1X56 A;  2HIV A;  1Q86 C;  4JI5 Q;  1GM5 A;  3L0O A;  5EAY A;  3HOZ G;  1W3S A;  4UP7 A;  3J7A 5;  4DR6 Q;  3G6E A;  3TS2 A;  1PYS B;  1OTC A;  1A0I A;  4P72 A;  5IP7 H;  4GOP C;  2E5L Q;  2F4V Q;  4A3D G;  4DR6 L;  1NMF A;  1CKN A;  1SMX A;  4A3D H;  4JYA Q;  4L5S A;  1CSQ A;  3J7Z C;  3AFQ A;  1N9W A;  2YTY A;  1NBW A;  1RL2 A;  2OQ0 A;  4JI5 L;  3W5O A;  2KBN A;  5FJ8 H;  5FJ8 G;  5AJ3 L;  1VQH A;  4YWM A;  1A62 A;  1JJC B;  1SRU A;  4POG A;  1NY4 A;  3UE1 A;  3CME A;  1G51 A;  4KI0 A;  1N8R C;  2AHO B;  2Q2I A;  1HNW L;  3J80 i;  1B70 B;  2ZTE A;  1VQL A;  1K3R A;  1SR3 A;  2N3S A;  3HOY G;  3W1G A;  3HOV G;  4MNO A;  2R7D A;  3HOY H;  1VQA A;  2JA6 G;  2JA6 H;  1BBU A;  5GAD C;  4HIO A;  2UUA L;  4R4C A;  3PUY A;  4JI7 L;  2CWA A;  3CCE A;  2JA8 H;  3CD6 A;  2XTI A;  4DK3 C;  4PZ6 A;  4X66 L;  2NVQ H;  3RNU A;  1I3Q H;  3CC4 A;  3ZJY C;  1UE5 A;  1LM0 A;  1MKH A;  4QL5 A;  3KJO A;  4HJA A;  3JAM c;  1IBL Q;  1JMC A;  4DR4 L;  4DR2 Q;  1OXS C;  3AQQ A;  1CSP A;  1PH9 A;  1VQN A;  4A75 A;  4LFB Q;  5LMU L;  1Q46 A;  1PH6 A;  2OCE A;  1VCI A;  1TWC H;  1B8A A;  2AKW B;  3M4P A;  3PO2 G;  3M85 A;  2R7F A;  1YBY A;  2D0O A;  3A5U A;  2RCN A;  3ICE A;  1JJG A;  4JCV E;  1PHJ A;  1JB7 A;  1VQO A;  4DV4 L;  4DUY Q;  3UDG A;  2K14 A;  4A3K G;  4K0K Q;  2CCZ A;  1UWV A;  1KXL A;  3J81 i;  4H02 A;  5C0X J;  3PUV A;  1SFO H;  3FKI G;  1N34 L;  1TWH H;  2OQK A;  4NXN Q;  1X54 A;  2BA0 A;  5IP9 G;  5LMU Q;  3I4M H;  1VQC A;  4LFB L;  3JAM i;  5H1S E;  4A3I G;  4A76 A;  5M3M G;  1PA6 A;  2RHQ B;  1KRS A;  1HJP A;  1TWF H;  2LSS A;  4JBW A;  2HHH L;  2N78 A;  5GRO A;  1I94 Q;  2ZM6 L;  1IBL L;  3CCQ A;  3HOW G;  4APV A;  1M1K C;  4JI0 Q;  1HNX L;  2F3I A;  4L5T A;  3CW2 C;  1WCM H;  1WYD A;  5IYD G;  3U4Z A;  4LUZ A;  1WCM G;  1PH3 A;  2Q2H A;  3HOX G;  2VQF L;  2UUB L;  2UUA Q;  4FDB A;  4JG2 A;  1MIU A;  4UP8 A;  3G48 A;  3M9B A;  3MEF A;  3T1H L;  4YHH Q;  4GNX B;  2HQL A;  2NVX H;  3J81 j;  1PV4 A;  1G6P A;  4ALP A;  3HOZ H;  2I5L X;  4AIM A;  2N8N A;  2WFW A;  2NN6 I;  4O0A A;  4WJ4 A;  1QZG A;  4LNQ A;  2VUM G;  1FGU A;  2YV5 A;  2WP8 J;  1HNW Q;  1XMQ Q;  3S15 H;  3AEV A;  1N32 L;  2Z6K A;  5DLQ E;  3S1Q H;  3OYY A;  2CQO A;  1I5F A;  1TWG H;  4GLA C;  2K4K A;  2AMC B;  3KF6 A;  1VQM A;  1XJV A;  1C0A A;  2PI2 A;  2A8V A;  4LF7 L;  1EQR A;  2R92 H;  5C4X G;  5C0X G;  2XGT A;  1XPU A;  3GD7 A;  4J15 A;  1Q1B A;  4QGU A;  2EQS A;  2F4V L;  4JYA L;  2PQA B;  4DAM A;  3ULL A;  1QVG A;  4X6A H;  1XTD A;  1X3F A;  3GO5 A;  3J80 c;  3KF6 B;  4DAY B;  1GKH A;  1WFQ A;  4GLV B;  1UE6 A;  5BR8 Q;  1Y1W G;  1L0W A;  2IHF A;  2K75 A;  3CQZ H;  4R4O A;  2BH8 A;  2VQE Q;  2VY3 A;  2AWN A;  1S72 A;  1HNZ L;  1IBM L;  2D0P A;  3TRZ A;  2EXD A;  1NE3 A;  3F2C A;  1LTL A;  4DUZ Q;  1FJG L;  2JA9 A;  2GN5 A;  1OXX K;  4C2M H;  3U58 A;  4C3H H;  4TVA B;  4A3F G;  4NPS A;  4GNX A;  1VQE A;  4P74 A;  1OXT A;  4POF A;  4LF4 Q;  3JC6 6;  1A8V A;  5IYB H;  2K52 A;  3PUW A;  5IYB G;  1M90 C;  3FHW A;  2VS1 A;  2UXD L;  2E2I H;  3S1N H;  1K0R A;  1HZA A;  5C0X I;  4DR5 L;  1VQD A;  1YJN A;  5LMN Q;  1KAW A;  4BBS G;  4LF8 Q;  4A3L G;  2UXB L;  1OXU A;  4IPG A;  5M5Y H;  1XNQ L;  2VNU D;  1YVC A;  4NXM L;  2WAQ G;  1HR0 L;  3OTO Q;  3PUZ A;  2HIX A;  3CAM A;  1RIP A;  2E8G A;  2EIF A;  4EX5 A;  4KHP L;  1XMO L;  4A3G H;  3KDF B;  4JOI C;  5FLM H;  4HJ8 A;  4A3J H;  3H15 A;  2JJQ A;  2NN6 G;  4P71 A;  2UUC L;  4LUO A;  3KFU A;  1D7Q A;  3S1R H;  2CFM A;  1N36 Q;  1XNR Q;  3GTM H;  1Q12 A;  2GVB A;  4YY3 Q;  1SLJ A;  4XIG S;  3PIP A;  4GOP B;  3NEL A;  1W2B A;  3BZC A;  3M4O H;  4B3S L;  2UXC L;  1Y1V H;  5ELN A;  1K8A C;  3RZO H;  3RLF A;  3S1M H;  1UEB A;  4OWX B;  4B3T L;  1YHQ A;  1KRT A;  4JI6 L;  4JI4 L;  3BZK A;  4JBM A;  1QVC A;  1GVP A;  2DUD A;  1E7Z A;  4GN3 B;  2E2H H;  4JI3 Q;  2BH2 A;  4P73 A;  2Q2T A;  4AQY Q;  1ASZ A;  4LFC Q;  1WI5 A;  3PV0 A;  2NVT H;  1EFW A;  1X3E A;  4LF6 L;  1VQI A;  3PSI A;  3RN5 A;  4IFD I;  1YIT A;  1PH8 A;  4IFD J;  1E22 A;  4X64 L;  2CWP A;  2D62 A;  4DV0 Q;  2JEB I;  4DV2 Q;  4IO9 A;  3T1Y Q;  1C9O A;  5GQO A;  1S3O A;  2YTX A;  1YZ6 A;  4DV1 Q;  4DR3 Q;  1VQG A;  1EIY B;  4GKJ L;  3VDY A;  4ME3 A;  1YIJ A;  4A3B G;  2ALY B;  1X55 A;  4R1J A;  4BBR G;  4LF9 Q;  3U50 C;  1I6H H;  4GN4 B;  2R93 G;  4HJ9 A;  4JI2 Q;  3BJU A;  3B6Y A;  3STB D;  1NTG A;  3S2D H;  4IOA A;  4HJ7 A;  2KHJ A;  4JI1 L;  4DV5 L;  3S17 H;  4DK6 C;  1E1T A;  4X62 Q;  4MTN A;  1Y1W H;  1N33 Q;  1JE5 A;  1A63 A;  3NBH B;  3PGZ A;  2K5N A;  4DV6 Q;  4GS3 A;  3RZD H;  5GAH C;  3DLL A;  3S16 H;  2I0Q A;  5IT9 c;  2I5H A;  4DR7 Q;  1OXV A;  2VZA A;  1HR0 W;  1E1O A;  3I4N H;  3I4N G;  5IP9 H;  3G71 A;  2ASB A;  3EBE A;  3WWV A;  1O7I A;  3F2B A;  4BY1 H;  5IWA L;  4GKK Q;  4JBJ A;  3HKS A;  4JBK A;  4IJL A;  3CCM A;  3D0F A;  4OX9 L;  3A74 A;  3RR5 A;  4WJ3 M;  5JJK A;  4A3F H;  1E24 A;  4OXP A;  1IZ6 A;  1B7Y B;  4DV7 L;  2IT1 A;  5IYD H;  2H5X A;  1GO3 E;  2LXK A;  2WAQ E;  3KYH C;  1J5E Q;  1SE8 A;  2MNA A;  4BA2 I;  4A3E H;  1Z9F A;  3GDE A;  2JK8 A;  2ZTD A;  3CF5 A;  3ER0 A;  4GLX A;  2LXJ A;  5HY6 A;  2ATW A;  1FL0 A;  1NMG A;  3A5Z B;  5IE8 A;  4DR1 Q;  1PH4 A;  4QY7 A;  2MO0 A;  2IY5 B;  3CCV A;  4B3R Q;  1P16 A;  3CPF A;  4DV3 L;  4DV3 Q;  2QEX A;  4OON A;  1AE2 A;  3M4Q A;  2V1C C;  5M3F G;  1Q7Y C;  5IP7 G;  2UU9 Q;  5JJI A;  1LYL A;  1V9P A;  1VQK A;  3S14 H;  4TQU S;  1V43 A;  4JI8 L;  4DV0 L;  4QIW E;  3L2P A;  1J5E L;  4XTC S;  1EIF A;  1IBK L;  4JV5 L;  3I55 A;  4PMW A;  1VQ9 A;  4OO1 I;  2ID0 A;  1EOV A;  3H0G H;  3LGJ A;  4HIM A;  3H0G G;  3S2H H;  4OX9 Q;  4C3J H;  4JI3 L;  4B3M L;  3PO3 H;  4DPG A;  2A1A A;  2PQA A;  1G29 1;  1LUZ A;  4EQ5 A;  1YJ9 A;  1PH2 A;  3PO3 G;  4A3M G;  4BXX H;  4O2D A;  2JA8 G;  4X65 L;  1VQ4 A;  1Y14 B;  2MQH A;  2A19 A;  1R9T H;  3Q8D A;  4AYB G;  5HGQ A;  3CC7 A;  1X3G A;  2OTL A;  2ZJP A;  2DGY A;  2JQO A;  3KOJ A;  4DV6 L;  1GD7 A;  3E9H A;  1PFS A;  1VQP A;  4X62 L;  4UY8 C;  4QJF A;  4DNI A;  3KJP A;  3RN2 A;  2UUC Q;  4DKA C;  4UPA A;  2YU9 H;  2PMZ E;  3CMA A;  3F2D A;  2MO1 A;  4JC0 A;  4LF5 L;  1L1O A;  1V1Q A;  5J3B A;  1D8L A;  2KCM A;  4KLK A;  4LFA L;  2KHI A;  4HID A;  2UXB Q;  4JV5 Q;  3RLN A;  1PH1 A;  3G4S A;  4IPD A;  2WB1 G;  4A3C H;  2NZO A;  2IHE A;  4DR5 Q;  4A3K H;  4JI8 Q;  3CCJ A;  1VS0 A;  4GOP A;  4X64 Q;  1EWI A;  5K36 G;  2FXQ A;  2JA5 G;  4A3G G;  1MJC A;  4LFA Q;  1X9N A;  1L2F A;  5FLM G;  2JA5 H;  4LF6 Q;  2IX1 A;  4A3J G;  2RF4 A;  2JEA I;  3J81 c;  3CCR A;  4LF5 Q;  1XPO A;  1Z47 A;  3KLW A;  4MZ9 A;  3TRE A;  3UDF A;  5C44 H;  3PIO A;  3UDX A;  5C44 G;  4AQY L;  4L5R C;  4A93 H;  1MJE A;  4B3R L;  2N49 A;  1J6Q A;  4DR1 L;  5M3M H;  4JI4 Q;  2AWO A;  4IOC A;  2PI2 E;  1KD1 C;  1KQS A;  1T9H A;  3GTO H;  3IRB A;  4RG1 A;  3ULP A;  1EYG A;  1X65 A;  1HNZ Q;  2QA4 A;  3OW2 A;  3HOX H;  2VQE L;  3HKZ G;  4X65 Q;  1PVO A;  5M5W H;  4AH6 A;  3H3V I;  1BVS A;  1YHB A;  1HH2 P;  1UE7 A;  3K8A A;  4YY3 L;  5BR8 L;  1VQJ A;  1TWA H;  4A3E G;  1N36 L;  2OTJ A;  5JJL A;  4YWK A;  4B3M Q;  2ZJQ A;  3ERS X;  3DM3 A;  1SRO A;  1AH9 A;  4IFD G;  5IWA Q;  1K8G A;  4IJH A;  2Z0S A;  1HZB A;  1SN8 A;  1Q82 C;  1AE3 A;  4KHP Q;  1C7Y A;  1YNX A;  2VUM H;  5M3F H;  1U0L A;  5IYC G;  2Q2U A;  3K80 C;  1PH7 A;  5C3E G;  2QGQ A;  4LF7 Q;  4NXM Q;  3M7N A;  3K81 C;  1IBK Q;  4LF8 L;  4JOI A;  2F52 A;  3GTK H;  2OWO A;  1JT8 A;  4A3B H;  1QUQ A;  4JI1 Q;  3F1Z A;  4BBR H;  4DV5 Q;  1YI2 A;  2R92 G;  5C4J H;  2R93 H;  5C4X H;  3GTQ H;  1X6O A;  1VQ8 A;  1JJ2 A;  1CKN B;  2UU9 L;  2ZTC A;  1QZH A;  4QQB X;  1YEZ A;  2I5M X;  1YHA A;  4IPH A;  3PCO B;  2Y0S G;  5GAE C;  3HOV H;  3TQY A;  3U4V A;  2UUB Q;  4GKJ Q;  3GTG H;  4UP9 A;  5ELO A;  3T1Y L;  3PF4 A;  3I7F A;  4A3M H;  2L15 A;  1HNX Q;  1KL9 A;  2B63 G;  3CP0 A;  3GTP H;  1WOC A;  2R6G A;  2B63 H;  1I94 L;  1EQQ A;  4DV7 Q;  3KDF A;  3E0E A;  1HZ9 A;  3I4O A;  3PUX A;  3CPW A;  4LFC L;  2E2J H;  2C35 B;  4R4T A;  1QUQ B;  1KHI A;  1PH5 A;  5M5X H;  2YTV A;  4YCW A;  4C3I H;  1N34 Q;  1IXR A;  4GKK L;  1P8L A;  4R4Q A;  1FVI A;  2JA7 H;  1Q1E A;  2MFI A;  4LUV A;  1CKO A;  2JA7 G;  2R7Z G;  4Y52 H;  2WB1 E;  4YCU A;  2R7Z H;  1BBW A;  1EUJ A;  4K0K L;  4DUY L;  4DR7 L;  1UE1 A;  3L7Z C;  4BBS H;  2UXC Q;  3K7A H;  4A3L H;  2HT1 A;  1N33 L;  4A3C G;  1XPR A;  2PNH A;  1N32 Q;  1XNR L;  1XMQ L;  4HIK A;  4BA1 I;  1H95 A;  4YWL A;  2B29 A;  2Y0S E;  5LMN W;  2K5H A;  4JI2 L;  2NZH A;  3D31 A;  4PG3 A;  1XMO Q;  3FKI H;  1YJW A;  1HZC A;  3S24 A;  4YHH L;  4LF9 L;  5IY0 A;  3NEN A;  3OTO L;  4DR2 L;  3I4M G;  4A4I A;  2YYZ A;  4LW1 A;  4A3I H;  1XNQ Q;  4AYB E;  1E3P A;  2VQF Q;  4DV1 L;  4DR3 L;  1S40 A;  5LMN L;  1Y1V G;  3PF5 A;  4DV2 L;  2ES2 A;  4JI0 L;  1I50 H;  1TXY A;  4YCV A;  5GAG C;  3AFP A;  4GNX C;  2ZM6 Q;  3FP9 A;  1VQ5 A;  2HHH Q;  3GTL H;  1WJJ A;  1KC8 C;  2VL6 A;  3KF8 B;  5FLX c;  3E9I A;  1VQF A;  4PZ7 A;  3K0X A;  2JE6 I;  3HOU H;  4BXX G;  4NXN L;  2CKZ B;  3HOU G;  3CXC A;  3BU2 A;  3UE0 A;  3CCU A;  4JI6 Q;  1KIX A;  3I56 A;  4B3T Q;  1Q81 C;  3EN2 A;  3W1B A;  4DUZ L;  1ASY A;  5E7N A;  1FJG Q;  1L1O B;  4DV4 Q;  1NJI C;  1IYJ B;  5IYC H;  5C3E H;  4B3S Q;  4OWW B;  3TS0 A;  2KCT A;  5JEA J;  4OO1 G;  1K83 H;  2K5V A;  1QVF A;  5JEA G;  3UDI A;  3H3V H;  1K9M C;  2E5L L;  4HJ5 A;  3NEM A;  3CCS A;  4P75 A;  3CC2 A;  2IX0 A;  4KHZ A;  3F8T A;  3CCL A;  3PO2 H;  2KEN A;  3HFZ B;  4Y7N H;  2GVA A;  1VQ6 A;  4IPC A;  1Q8K A;  3K7U C;  1HR0 Q;  4DR4 Q;  1VQ7 A;  2Z6K C;  3HKZ E;  4GN5 A;  4BY7 H;  4X66 Q;  4L5Q A;  4BY7 G;  3MXN B;  4JI7 Q;  4NB3 A;  2K50 A;  3TEH B;  2VW9 A;  2B3G A;  2UXD Q;  3GTJ H;  4A93 G;  2BA1 A;  4LF4 L;  1BKB A; 
#chains in the Genus database with same CATH topology
 4G7Z C;  2NVY H;  1MI2 A;  1ENC A;  2L5T A;  1PYB A;  3T1H Q;  1L1O C;  3S2D B;  2L4N A;  3A0J A;  5CV8 A;  4PZ8 A;  4R4I A;  3OIQ A;  3SHL A;  4LWC A;  1SNM A;  1YNN C;  4CDF C;  3EIV A;  1SNP A;  4IUU A;  4OWT B;  2XWB B;  1IBM Q;  4Z9C B;  2B2W C;  4JI5 Q;  1GM5 A;  3HOZ G;  3E0J A;  4UP7 A;  1EQT A;  1PTO F;  2RVL A;  2JA8 B;  4DNT B;  5IP7 H;  4JYA Q;  2B63 B;  1SMX A;  4L5S A;  3PQI A;  1NBW A;  3W5O A;  1A62 A;  1PRT B;  1SRU A;  3D8G A;  1NY4 A;  1CM9 A;  3CME A;  1PTO D;  1JWU D;  1STN A;  2F0S A;  1R4Q B;  1EY7 A;  4K5X A;  4C3J G;  3HEJ A;  1VQL A;  2EYO A;  4A3M B;  1PRT F;  2N3S A;  3W1G A;  4MNO A;  1HA6 A;  2PW7 A;  1S5F D;  2JA6 H;  1BBU A;  4JI7 L;  1BUV T;  4O42 A;  3RNU A;  1I3Q H;  5KEE A;  2NVT B;  2Z4H A;  2B2U A;  3KJO A;  1MKH A;  1JMC A;  3JAM c;  4ZCK A;  1PRT C;  1RF2 D;  4DR2 Q;  5A2Q L;  1EY4 A;  1OXS C;  5C44 B;  3A8J E;  2XRQ D;  1BCP D;  5LMU L;  1I50 B;  4LJZ C;  1B8A A;  3M4P A;  1YBY A;  3VR4 A;  1WTP A;  1H9J A;  3K58 A;  1NR4 A;  2NVX B;  4DUY Q;  2K14 A;  4H44 C;  4QUC A;  4K0K Q;  1TS3 A;  1V1O A;  2CCZ A;  2OQK A;  2BA0 A;  4PNY A;  5AFW A;  2B8F A;  5H1S E;  3JAM i;  4A3I G;  3H3V C;  3HOY B;  1KRS A;  4HAE A;  5M5W B;  3HOW G;  1JR0 D;  3T56 B;  3IFT A;  4JI0 Q;  3EA6 A;  3U4Z A;  1WTO A;  1JE4 A;  2VQF L;  2UUB L;  2UUA Q;  1NR2 A;  3NK9 A;  4DN4 M;  4IZ8 A;  1G6P A;  3HOX B;  4ALP A;  2I5L X;  2N8N A;  2NN6 I;  4WJ4 A;  3DEP A;  1XMQ Q;  3S15 H;  5JJZ A;  2F0K A;  1EQV A;  3OYY A;  1VMC A;  5C4X B;  1H9R A;  1TWG H;  2FJ2 A;  1ESF A;  2L9H A;  2A8V A;  1XPU A;  1SNQ A;  4J15 A;  4QGU A;  1EY8 A;  2DJG C;  4DAM A;  1WD0 A;  1R4P B;  4ZUJ A;  1STH A;  5CBA E;  3PIO 3;  3GQB A;  2K75 A;  4R4O A;  2BH8 A;  2EY1 A;  4RA8 A;  3VR6 A;  4DUZ Q;  4EQN A;  2JA9 A;  2JA5 B;  3J7Y W;  2EVB A;  3C1F A;  1TR5 A;  1EWH A;  4C3H H;  1QCB D;  4NPS A;  2KEE A;  3DMU A;  4GNX A;  4TSS A;  1EZ6 A;  2K52 A;  3PUW A;  2NB0 A;  1JOQ A;  1HZA A;  1TVX A;  4BBS G;  5FLX E;  2WKD A;  2DNC A;  4IPG A;  5M5Y H;  2WAQ G;  3J80 L;  2QDL A;  4JOI C;  4A3J H;  3KFU A;  2UUC L;  2CFM A;  1FD7 D;  5C5M A;  1XNR Q;  3GTM H;  3BVG A;  1ILP A;  4XIG S;  2IWH A;  1DD2 A;  1JOO A;  1F2Z A;  2G9H D;  2PYK A;  1Y1V H;  4BWG B;  1K8A C;  3S1M H;  1UEB A;  4B3T L;  1A6X A;  1CZG A;  3BVM A;  2R93 B;  3RD4 A;  3F2U A;  2SNS A;  2FMC A;  3V2T A;  4IFD H;  1C4Q A;  3ERO A;  3RN5 A;  2NTS A;  2E2D C;  1SND A;  1PXU A;  1C9O A;  1A3T A;  2AQ3 B;  1S3O A;  2YTX A;  1YZ6 A;  3VDY A;  1S5D D;  4R1J A;  4BBR G;  3MWY W;  4RHS A;  4CKC A;  3TME A;  3BJU A;  1NTG A;  1PFN A;  3BDC A;  1IYV A;  5CV7 A;  4DV5 L;  1YNJ D;  1L0X B;  4N9T A;  3FPU B;  3NBH B;  3RZD H;  2K5N A;  1J8I A;  2I0Q A;  4DR7 Q;  3BYY B;  1SYE A;  3U9S A;  2X6G A;  4GKK Q;  3HKS A;  3D0F A;  4OX9 L;  3A74 A;  1PFB A;  1T5E A;  4LK1 C;  1IZ6 A;  2L55 A;  3EFX D;  2JP1 A;  2LXK A;  2WAQ E;  4BA2 I;  1ILQ A;  1CTM A;  1Z9F A;  1LAB A;  2JK8 A;  3CF5 A;  3ER0 A;  2LXJ A;  2ATW A;  3LWE A;  4HCE A;  5D3I B;  2F1M A;  2IY5 B;  2QEX A;  2K28 A;  3I4N B;  2ZT9 C;  1Z7T A;  5IP7 G;  1S4Z A;  3AB9 A;  2EYJ A;  2OXP A;  3TP6 A;  5L37 A;  3TSS A;  1V43 A;  1U4R A;  5FO7 B;  3NWT A;  3I55 A;  1VQ9 A;  1I4X A;  3H0G H;  5IT9 E;  3S2H H;  2ZXP A;  3HZX A;  1GUG A;  4RGN A;  2K5D A;  1U4M A;  4XXE A;  4B3M L;  4DPG A;  2A1A A;  1LUZ A;  4ILW A;  4A3M G;  5CC4 A;  4V0B A;  1ROD A;  1Y14 B;  2E76 C;  5HGQ A;  1G2T A;  3G7L A;  3Q24 A;  2ZJP A;  1LO5 D;  5IGF A;  1JOR A;  4CKB A;  5ELD A;  3E5S A;  4A3I B;  3R2T A;  1NNX A;  4OO1 H;  1KDC A;  2UUC Q;  4N9P A;  4DKA C;  5J22 A;  1J9O A;  3L9A X;  3SE0 A;  2MO1 A;  5J3B A;  1V1Q A;  2KCM A;  2R3Z A;  4KLK A;  1LTR D;  1G91 A;  1PH1 A;  1F2M A;  1STA A;  4DR5 Q;  4JI8 Q;  1LTT D;  4X64 Q;  1EWI A;  4DXG A;  4LFA Q;  5FLM G;  2IX1 A;  4A3J G;  4QCL A;  1E2V A;  1XPO A;  3ONA B;  4AQY L;  3UDX A;  4EGV A;  1J6Q A;  1LLR D;  1AZQ A;  1T9H A;  4RG1 A;  4FVM A;  1AEX A;  3ULP A;  4DGZ A;  3HOW B;  4ODG A;  1PVO A;  1QWY A;  2HCC A;  1BVS A;  1YHB A;  1HH2 P;  4YY3 L;  5BR8 L;  1TWA H;  3D6W A;  3S15 B;  1AH9 A;  4E6I A;  1K8G A;  3L3O C;  2Z0S A;  4O1N A;  1AE3 A;  2JA7 B;  2DNE A;  1U4P A;  1SE2 A;  1U0L A;  2QGQ A;  1IBK Q;  2F52 A;  2OWO A;  3DWQ A;  1JT8 A;  1TS2 A;  1QUQ A;  4JI1 Q;  5C4J H;  5I9P A;  3SVM A;  1BNZ A;  1A2T A;  4ZUI A;  2UU9 L;  1GXD C;  3DWA A;  4K14 A;  3HOV H;  3DM1 A;  3GTG H;  2K7V A;  3I7F A;  3QOL A;  2L15 A;  4R9W A;  5ELC A;  3CP0 A;  2PQE A;  1I94 L;  1EQQ A;  4LAA A;  2AUJ D;  4DV7 Q;  1NCV A;  3I90 A;  4ZQ3 A;  2VB3 X;  4FXG C;  4DK0 A;  3D4W A;  1PH5 A;  4OIJ A;  1FVI A;  2R7Z G;  1QG7 A;  1EUJ A;  1LT4 D;  5EBC A;  3K7A H;  5CBE E;  2RDF A;  1K83 B;  1RDP D;  1XPR A;  3HOV B;  4EVO A;  2OEO A;  1XMQ L;  4OEL B;  4BA1 I;  4XQN A;  4YWL A;  4CJ2 C;  4V19 0;  1LTB D;  2K5H A;  1SE4 A;  3FKI H;  3I4M G;  1QIL A;  1Y1V B;  4LW1 A;  1CK1 A;  4K5V A;  4AYB E;  1E3P A;  4DV1 L;  2RBM A;  5HUR A;  4XYO A;  4JI0 L;  1VQ5 A;  5GAG C;  3TBI B;  1RHP A;  2VL6 A;  5FLX c;  2Q8I B;  2JE6 I;  3CXC A;  4XT1 B;  1KIX A;  3I56 A;  3MEH A;  2EYM A;  4WRD A;  3ITP A;  1B4O A;  1ICW A;  1YNJ C;  1L1O B;  4RGM A;  3NPP A;  1LAC A;  5C3E H;  4OWW B;  3OW7 A;  3TS0 A;  1S5C D;  5JEA J;  4OO1 G;  2PZU A;  2PO4 A;  3H3V H;  2B2W A;  3CCS A;  2K5W A;  4P75 A;  1XYI A;  1KLG D;  2EJM A;  1FGB D;  2IX0 A;  3PO2 H;  3PO3 B;  2CW0 C;  2GVA A;  4IPC A;  3H91 A;  2WAC A;  4I7Z C;  4GN5 A;  4L5Q A;  4CBV A;  3MXN B;  4X3S A;  5CYU A;  1WTX A;  4FXD A;  4TKO B;  2IW3 A;  5C3X A;  3TEH B;  2B3G A;  3GTO B;  4LF4 L;  3ULJ A;  2RHS B;  3G6J B;  4BY1 G;  3STB C;  1DGS A;  3K5N A;  1VQB A;  3AYH B;  1ZXT A;  1U5K A;  1CA6 A;  4WJW A;  1DON A;  2ZJR A;  2M2L A;  1IL2 A;  3SGI A;  3M3Y H;  4LMQ D;  1WTQ A;  5C4Z A;  2L11 A;  1PTO B;  3SEB A;  5G3L F;  4UAI A;  1X56 A;  2Z1C A;  3J7A 5;  1O7Z A;  1EEI D;  1B53 A;  1ML0 D;  2F4V Q;  1NMF A;  1CKN A;  4A3D H;  4HN7 A;  5CR3 A;  2H4O A;  4OGQ C;  3AFQ A;  1N9W A;  3GP7 A;  1S5B D;  2Z6B A;  3UE1 A;  4RFB A;  1K28 A;  2Q2I A;  1HNW L;  1TWC B;  1M8A A;  2ZTE A;  3HOY G;  4XQQ A;  3HOV G;  1VQA A;  2D9U A;  3K5O A;  5GAD C;  4HIO A;  4R4C A;  3PUY A;  3SK6 A;  3CCE A;  2JA8 H;  1QE6 A;  3K0Y A;  4DK3 C;  4A3J B;  2NVQ H;  1LM0 A;  4QL5 A;  1ENA A;  4QF4 A;  1ET9 A;  1PH9 A;  1VQN A;  4A75 A;  1U9R A;  4LFB Q;  4C3J B;  1LT5 D;  1TWC H;  5LL6 X;  2AKW B;  3OWF A;  1HUM A;  3M85 A;  1D1K A;  3A5U A;  2RCN A;  1JJG A;  1WTR A;  2XN9 C;  1JB7 A;  3QG1 A;  4A3K G;  2F0F A;  1PTO C;  3T13 A;  3FKI G;  5LMU Q;  4C3I B;  4LFB L;  1FYC A;  4A76 A;  5M3M G;  1PA6 A;  4HSP A;  1TWF H;  2LSS A;  4K5W A;  2N78 A;  3OMG A;  5GRO A;  1I94 Q;  3CCQ A;  5E3F A;  3S14 B;  4APV A;  2QCP X;  1M1K C;  5EBD A;  1WCM H;  2WAQ B;  5EPL A;  1PH3 A;  4FDB A;  4JG2 A;  3X3N A;  4EQO A;  3MEF A;  4C3H B;  3QWN A;  5FLX L;  1CA5 A;  4YHH Q;  4GNX B;  1PV4 A;  4NDX A;  4K2K A;  1QZG A;  4LNQ A;  1FGU A;  2KCN A;  2WP8 J;  2YV5 A;  5KYI A;  1N32 L;  1PLF A;  5DLQ E;  4DF7 A;  3NQI A;  3S1Q H;  2B2T C;  2JSO A;  5I9O A;  1DJR D;  1XX8 A;  3OOC A;  2XGT A;  1LT3 D;  3CU7 A;  4JYA L;  4B9W A;  4G7O C;  3ULL A;  1QVG A;  1XTD A;  2YU9 B;  3I8Z A;  1GKH A;  3SK4 A;  1B1Z A;  1CZW A;  2J0T D;  3CQZ H;  3MVV A;  2F0E A;  3T51 B;  5C3E B;  1IBM L;  2D0P A;  5C5L A;  3TRZ A;  2Z9H A;  5G3L D;  1NE3 A;  4JVZ A;  4BBR B;  2GN5 A;  5LL6 S;  4C2M H;  3U58 A;  4TVA B;  1PTO H;  3A55 A;  1VQE A;  4P74 A;  1OXT A;  2PMZ B;  4LF4 Q;  3JC6 6;  1A8V A;  2IL8 A;  5IYB H;  3RZO B;  1GUO A;  4TRD A;  1M90 C;  5ISR A;  1UAP A;  1KTK A;  2ZXO A;  1K0R A;  5EKK A;  4BY7 B;  1O7L A;  1YJN A;  1KAW A;  4WFN 3;  4A3L G;  2MUY A;  1YVC A;  4NXM L;  1BDO A;  1D5M C;  3PUZ A;  2HIX A;  1RIP A;  2E8G A;  2EIF A;  5J39 A;  1XWE A;  2CQA A;  2NN6 H;  4J8Q A;  3MHB A;  1C48 A;  4OHJ A;  3TP8 A;  1N36 Q;  4YY3 Q;  4GOP B;  3PIP A;  3BZC A;  2XWJ B;  2UXC L;  3RZO H;  1ZEQ X;  3QOJ A;  3IFD A;  1YHQ A;  3TN2 A;  1KRT A;  4KKU A;  1QVC A;  4GN3 B;  2BH2 A;  5JPM C;  4JI3 Q;  2Q2T A;  4AQY Q;  2NVT H;  1EFW A;  4PQX A;  1X3E A;  4A3G B;  1VQI A;  3PSI A;  4IFD J;  2ZXR A;  2CWP A;  2JEB I;  1LTG D;  3LNN A;  3M7G A;  5GQO A;  1AN8 A;  4RCN A;  5A2Q E;  4DR3 Q;  3E3X A;  4CJ0 B;  1YIJ A;  2EJF C;  2ALY B;  4GN4 B;  2R93 G;  3AMU A;  4JI2 Q;  3STB D;  4A3B B;  4IAL A;  4X3T A;  2I46 A;  3S9W A;  1WTV A;  4DK6 C;  1E1T A;  4X62 Q;  2QIL A;  2EY5 A;  3PGZ A;  4DV6 Q;  3S16 H;  1A63 A;  4CHT B;  2O2L D;  2JYO A;  2NVY B;  1KDB A;  1OXV A;  1HR0 W;  1E1O A;  2E74 C;  3G71 A;  3MFG A;  3NTH A;  3F2B A;  4BY1 H;  1TKW B;  1X3Q A;  2QEJ C;  3CCM A;  2EYF A;  3RR5 A;  4WJ3 M;  5JJK A;  3NWS A;  1E24 A;  1IKM A;  1I4H A;  4CJ1 B;  2IT1 A;  2EPB A;  4HTH A;  1J5E Q;  4A3E H;  3GDE A;  1HRJ A;  1B44 D;  3BZD B;  4GLX A;  2A6H C;  3VYT A;  3A5Z B;  1NMG A;  4DR1 Q;  1HFN A;  2MO0 A;  4CDE C;  3D3R A;  4DV3 L;  4DXF A;  4DV3 Q;  4OON A;  3DEO A;  5E1F A;  2V1C C;  5M3F G;  1Q7Y C;  2UU9 Q;  3K5L A;  4RAU C;  3BDL A;  3S14 H;  3Q23 A;  2K1B A;  1TS4 A;  2G9D A;  3ND8 A;  4MHE A;  1J5E L;  1IBK L;  4JV5 L;  3H94 A;  2K01 A;  3R93 A;  4PMW A;  1RKN A;  3KLS A;  3QR8 A;  4OO1 I;  2ID0 A;  1EOV A;  1EIH A;  1BOS A;  1WD1 A;  5I6W A;  3PO3 H;  1IW7 D;  1DOK A;  2F0N A;  3PO3 G;  4A3D B;  4IUQ A;  4O2D A;  3HRZ C;  2A19 A;  3Q8D A;  1X3G A;  2OTL A;  3KOJ A;  4HCS A;  3W3A A;  1GD7 A;  3E9H A;  1PFS A;  1IL8 A;  2QDB A;  1CT1 D;  4RKL A;  5C4H A;  1OO9 B;  3IAY A;  4LF5 L;  4RGT A;  4HID A;  3VYS A;  1STG A;  2UXB Q;  3RLN A;  1BXT A;  4IPD A;  3I72 A;  1F9Q A;  2F4I A;  4A3K H;  1B50 A;  5FOB B;  4HSV A;  3T4A C;  5K36 G;  4KKS A;  4A3G G;  4LF6 Q;  5D3D A;  3J81 c;  3CRK C;  5C44 H;  3UDF A;  4ZLT F;  5IOC A;  1CI3 M;  2Q8T A;  1MJE A;  4A93 H;  3K59 A;  4N8X 1;  5M3M H;  2AWO A;  2A68 D;  4IOC A;  2PI2 E;  1KQS A;  2E2I B;  3FMC A;  1KNE A;  3GTP B;  1X65 A;  4HMJ A;  1UUP A;  3OW2 A;  4X65 Q;  1EEF D;  5M5W H;  1BCP B;  4AH6 A;  1FR3 A;  3H3V I;  1ICF B;  3K8A A;  4A3E G;  2O5I C;  5JJL A;  4YWK A;  2ZJQ A;  3DM3 A;  1SRO A;  1EY6 A;  2F0M A;  4IFD G;  5IWA Q;  2HDM A;  4IJH A;  3I4M B;  1Q82 C;  5JOB A;  5JAV A;  3I91 A;  5IYC G;  1TWF B;  4NXM Q;  2EZV A;  3PMF A;  2RSN A;  3GTK H;  4F88 A;  4ZYS A;  1V1P A;  5C3W A;  4DV5 Q;  2F0W A;  1YI2 A;  1CQF A;  5C4X H;  2K5Q A;  2RDG A;  1JJ2 A;  1CKN B;  1PMR A;  2ZTC A;  2K33 A;  4GZY C;  1YEZ A;  3PCO B;  5GAE C;  3TQY A;  2UUB Q;  2F0U A;  4PMB A;  3T1Y L;  1SYG A;  1HNX Q;  2WV6 D;  3GTP H;  1LT6 D;  1VF5 C;  2R6G A;  2B63 H;  5D14 A;  2JA6 B;  3CPW A;  1HHV A;  2J4X A;  3RUZ A;  4KHV A;  3CRL C;  2KA7 A;  5M5X H;  1P8L A;  4Y52 H;  2JA7 H;  4JK1 C;  2R7Z H;  3M4O B;  1UE1 A;  2A68 C;  4BBS H;  4A3L H;  2HT1 A;  2FMM A;  2PNH A;  1GHJ A;  1BF4 A;  2CH4 W;  2NZH A;  1XMO Q;  2PNR C;  4A3F B;  3NEN A;  3OTO L;  1IYU A;  1VF7 A;  2Y0S B;  1KDA A;  1G2S A;  3S1Q B;  1S40 A;  2EY6 A;  3PF5 A;  4DAP A;  3AFP A;  2ZM6 Q;  3FP9 A;  4K8J A;  2G5D A;  3GTL H;  1STE A;  1MHW C;  1KC8 C;  4K6L A;  3E9I A;  1VQF A;  3K0X A;  1DZ1 A;  4BXX G;  4NXN L;  3BU2 A;  2B2T A;  3UE0 A;  3CCU A;  4JI6 Q;  1SYF A;  3O13 A;  4B08 A;  4B3T Q;  1Q81 C;  3W1B A;  1FJG Q;  2HQE A;  1NJI C;  4FXK C;  3E6Z X;  5JEA H;  1K9M C;  1LTS D;  4ABN A;  4C1N K;  3CC2 A;  4KHZ A;  3P7J A;  3EJI A;  3HFZ B;  4Y7N H;  4I7A A;  1Q8K A;  3NTI A;  3Q22 A;  3NXW A;  4U68 A;  4BY7 G;  1I4Q A;  2ICI A;  3WDN A;  2VW9 A;  2VUM B;  4A93 G;  2BA1 A;  2NWG A;  2N55 A;  3GV3 A;  1CUK A;  3I2Z A;  3HOW H;  3S1R B;  4ZKC B;  3GTM B;  4KY6 A;  1K73 C;  1ENF A;  2RSO A;  2NVQ B;  4A3K B;  2L12 A;  5AJ3 Q;  2HIV A;  1IHZ A;  3L0O A;  4FYD A;  1U4L A;  1OTC A;  5KYL A;  2K04 A;  4GOP C;  4OEM B;  2E5L Q;  1LV9 A;  2CW0 D;  4DR6 L;  3ERQ A;  5KGU A;  1CSQ A;  2WII B;  3J7Z C;  5IIF A;  5FJ8 G;  2KBN A;  5FJ8 H;  2B2V A;  2EOT A;  1BO0 A;  1EZ8 A;  1VQH A;  5M5X B;  2FFK B;  5C0X H;  3S2H B;  2MJ8 A;  1QJO A;  1W6K A;  3CKI B;  3VYR A;  3WOF A;  1GUT A;  5TSS A;  5CV9 A;  3H6M A;  1K3R A;  1SR3 A;  2R7D A;  3HOY H;  1DXM A;  2LFN A;  4M1U B;  2JA6 G;  3J7A V;  1WTW A;  1NUC A;  2XTI A;  4PZ6 A;  5IGB A;  2OT2 A;  3CC4 A;  3U9O A;  3ZJY C;  1UE5 A;  1PDQ A;  5CV4 A;  1YNN D;  2XSC A;  4H13 C;  4B9X A;  4C3H G;  1PZI D;  4DR4 L;  5M9O A;  1LTA D;  1CSP A;  2NTT A;  5F2D A;  2H1E A;  2F0O A;  3K7A B;  1Q46 A;  1D5Z C;  2WKC A;  1G8Z D;  2FHT A;  2L1B A;  1STB A;  2R7F A;  1SE3 A;  4JCV E;  5J1Z A;  4DV4 L;  3UDG A;  3QJY A;  2BDN A;  1UWV A;  3J80 E;  5C0X J;  3N6R A;  3PUV A;  1SFO H;  1TWH H;  4NXN Q;  1K0S A;  2RDH A;  2RHQ B;  4XT3 B;  2HHH L;  3T53 B;  1IBL L;  1DCZ A;  3BYT B;  1Q3L A;  2F3I A;  4L5T A;  5IYD G;  2Q2H A;  3HS0 C;  3HOX G;  1MIU A;  1EY0 A;  3G48 A;  1SAP A;  3HG9 A;  4UP8 A;  3T1H L;  1E0B A;  2KED A;  2OF1 A;  2HQL A;  2NVX H;  3HOZ H;  4AIM A;  4KD4 A;  2WFW A;  1K8O A;  1TT2 A;  2VUM G;  1BCP F;  1V1P B;  5D65 A;  3AEV A;  2Z6K A;  1ESR A;  4KTA A;  2KJX A;  4GLA C;  3WOE A;  3V96 A;  2AMC B;  3KF6 A;  4DAY A;  1XJV A;  2PI2 A;  1EQR A;  2R92 H;  5C4X G;  3A54 A;  1Q1B A;  3MXN A;  2F4V L;  2PQA B;  3KK7 A;  5CV5 A;  3TZD A;  3J80 c;  4DFA A;  3HOU B;  1PZK D;  4GLV B;  3X3M A;  1EYD A;  2NZ1 D;  2IHF A;  1ONL A;  2X69 A;  2VQE Q;  2EYL A;  1S72 A;  1HNZ L;  5ELF A;  2EXD A;  4KN7 C;  2AQ2 B;  1FJG L;  5T1I A;  4R8I A;  1TWG B;  4ZRZ A;  5CV6 A;  3EQL C;  3CHB D;  1SDF A;  3Q0A A;  1QOH A;  1HUN A;  4FF1 A;  2UXD L;  2VS1 A;  5KIX A;  2E2I H;  3VR5 A;  4UHV A;  5LMN Q;  1EU3 A;  4LF8 Q;  1OXU A;  1XNQ L;  4EX5 A;  1QNK A;  2EYH A;  1XMO L;  5FLM H;  4DA2 A;  3H15 A;  2NN6 G;  4P71 A;  3V05 A;  1D7Q A;  1MD2 D;  1SLJ A;  1JQY D;  1XTC D;  1W2B A;  2R61 A;  3M4O H;  2AUK A;  4B3S L;  1C8C A;  3R3O A;  1SBB B;  5ELN A;  3J81 E;  2B2Y C;  4M8A A;  3OSO A;  4JI4 L;  1GVP A;  2DUD A;  4K6D A;  2E2H H;  3FRP B;  4P73 A;  3BVZ A;  2XRS D;  1ASZ A;  3GTL B;  4FNF A;  2CH4 A;  4LF6 L;  3D4R A;  4IFD I;  1YIT A;  2F0D A;  1E22 A;  4X64 L;  2D62 A;  2PCF B;  4DV0 Q;  4DV2 Q;  3T1Y Q;  4KJN A;  1EIY B;  4DV1 Q;  1D2B A;  4GKJ L;  3GTJ B;  4Y7N B;  1EY5 A;  2E2J B;  4LF9 Q;  2F0P A;  4HJ9 A;  2EXZ A;  3B6Y A;  4KY7 A;  4IOA A;  4HJ7 A;  1SEB D;  2KHJ A;  1GUN A;  3S17 H;  2F0G A;  2EYP A;  2O5J C;  1Y1W H;  1N33 Q;  1JE5 A;  2HCI A;  5GAH C;  4ULL A;  4RCO A;  5EKL A;  1EOT A;  3I4N H;  3I4N G;  3TP7 A;  5IP9 H;  2ASB A;  3WWV A;  1O7I A;  1SJE D;  5IWA L;  2KVM A;  4JBJ A;  4JBK A;  1SMY C;  2MHV A;  3PO2 B;  5KNB A;  1B7Y B;  3J81 L;  5I2X A;  1F77 A;  1B3Q A;  2Q8R E;  1TY2 A;  5HY6 A;  1FL0 A;  1O80 A;  3VA7 A;  3M4Q A;  5JJI A;  1V8Q A;  1LYL A;  4CKE A;  1VQK A;  4JI8 L;  5ELB A;  4DV0 L;  4QIW E;  5JVG 3;  4XTC S;  2DY8 A;  4H0L C;  3A8K E;  3PIP 3;  3P75 A;  3RMH A;  3KBX A;  2XNA C;  4K2L A;  4HIM A;  3H0G G;  5FO8 B;  1TII D;  4X65 L;  1VQ4 A;  1R9T H;  3D4D A;  2DGY A;  2JQO A;  4X62 L;  4UY8 C;  4DNI A;  2BE5 C;  1EL0 A;  4C3I G;  2RKS A;  2PMZ E;  3CMA A;  3F2D A;  4JC0 A;  1Q90 A;  3KUP A;  1D8L A;  4LFA L;  2KHI A;  4KV6 A;  4JV5 Q;  2WB1 G;  4A3C H;  3NBI A;  4RH6 A;  3CCJ A;  4GOP A;  1JC7 A;  3MZ5 A;  3GTQ B;  1X9N A;  2JA5 H;  1HCZ A;  1R9T B;  2RF4 A;  2AQ1 B;  3CCR A;  4LF5 Q;  1Z47 A;  3KLW A;  4MZ9 A;  3TRE A;  3PIO A;  3SK8 A;  5C44 G;  2XIW A;  1MSH A;  4N8F A;  2N49 A;  1MSG A;  3OPO A;  4DR1 L;  3DUZ A;  2KHS A;  1X32 A;  1HXY D;  1KD1 C;  3P20 A;  3IRB A;  1TS5 A;  1FNV A;  4AYB B;  4OIK A;  4DU9 A;  2R92 B;  3HOX H;  4L8J A;  2KUM A;  4R8N A;  1UEA B;  4WOR A;  1N36 L;  4H7B A;  5DEH A;  4B3M Q;  3ERS X;  3K6O A;  2F0Q A;  2JXM B;  1C7Y A;  2XVS A;  1YNX A;  2VUM H;  5M3F H;  1PH7 A;  5C3E G;  4LF7 Q;  1I6H B;  1O78 A;  4JPB W;  3K81 C;  4LF8 L;  4JOI A;  1GOZ A;  4RGO S;  4BBS B;  5I2Y A;  4A3B H;  3KLS X;  1EY9 A;  4FF4 A;  5EJW A;  1B3A A;  3C3L A;  3GTQ H;  4QUF A;  5COR A;  3CQZ B;  1EWC A;  2BE5 D;  2HUG A;  3MAQ A;  2I5M X;  4IPH A;  4QB4 A;  2Y0S G;  1TWA B;  2A73 B;  5ELE A;  3URY A;  4GKJ Q;  4QIW B;  4UP9 A;  5ELO A;  3PF4 A;  1Q8I A;  2BOS A;  1SNO A;  2M00 A;  2B63 G;  1WOC A;  2I07 B;  3KDF A;  3E0E A;  1HZ9 A;  4LFC L;  2E2J H;  4R4T A;  4RWS C;  1QUQ B;  1FNU A;  1KHI A;  2Z4I A;  2YTV A;  5BN4 A;  2MGS A;  3JAM E;  3Q6S A;  1N34 Q;  4GKK L;  1GUW A;  4LUV A;  1CKO A;  2WB1 E;  4YCU A;  1BBW A;  1Y8N B;  4DR7 L;  3ND9 A;  5IGD A;  3GTK B;  2UXC Q;  1E2Z A;  1AP0 A;  1N33 L;  2F0L A;  4A3C G;  3TP5 A;  4HIK A;  2NBF A;  4XDX A;  1H95 A;  2B29 A;  5LMN W;  2F0H A;  4JI2 L;  4IUR A;  4KK7 A;  2F0J A;  3S24 A;  4YHH L;  1YJW A;  5IY0 A;  4LF9 L;  4A4I A;  1RTO A;  2YYZ A;  1I4G A;  4A3I H;  3H0G B;  5LMN L;  1Y1V G;  2X6L A;  2ES2 A;  1I50 H;  1SYB A;  1TXY A;  4YCV A;  4GNX C;  2PW5 A;  3KLR A;  5LHY 1;  1WJJ A;  2WB1 B;  3SDZ A;  3DXJ C;  4G57 A;  3HOU G;  3GV6 A;  2F3W A;  1Y69 U;  1ASY A;  5E7N A;  2F0V A;  3OHX C;  1KLU D;  4B3S Q;  1I4R A;  2LMC B;  1K83 H;  2K5V A;  4ZKB B;  2LS0 1;  3R8B A;  5JEA G;  3UDI A;  5FO9 B;  2E5L L;  3MTS A;  2SOB A;  5CGK A;  3NEM A;  3OIP A;  2KEN A;  5DNF A;  1NSN S;  1EIG A;  3MC0 B;  2FIN B;  1T5X D;  2IJ0 A;  3K7U C;  4DR4 Q;  1VQ7 A;  3TZU A;  2F0I A;  2Z6K C;  3HKZ E;  1DOM A;  4BY7 H;  4X66 Q;  5IGC A;  5FK9 C;  4JI7 Q;  2DY7 A;  1A2U A;  3C1E A;  4G7H C;  2UXD Q;  2RCF A;  3GTJ H;  1JCK B;  1EYG A;  4J1M A;  1BKB A;  2J7Z A;  4IUV A;  4RMF A;  5DAU A;  4RHR A;  1ZYR C;  4UDU C;  1Z6H A;  1VDZ A;  1DM0 B;  2F3V A;  1SXT A;  3RLO A;  2L0C A;  3I3C A;  1CKM A;  3RZD B;  1RCV D;  1PRT D;  4BS9 A;  5K5P A;  1Q86 C;  4X3U A;  3I4L A;  5EAY A;  1G6Z A;  1W3S A;  4DR6 Q;  3G6E A;  3TS2 A;  1PYS B;  1Y8O B;  1A0I A;  4P72 A;  4A93 B;  1XXG A;  4A3D G;  1II3 A;  4KMU C;  1HPC A;  3NTK A;  2YTY A;  1RL2 A;  2OQ0 A;  4L6T B;  4JI5 L;  5AJ3 L;  3BG3 A;  3MFY A;  1L0Y B;  4DK1 A;  4YWM A;  1JJC B;  4POG A;  3SXH A;  5I6Y A;  1G51 A;  4KI0 A;  1N8R C;  2BDO A;  2AHO B;  2KEC A;  1TWH B;  3J80 i;  1B70 B;  2TSS A;  4ID6 A;  2MP1 A;  4Q0F A;  1SYD A;  2UUA L;  2KCC A;  1WCM B;  2CWA A;  3NE5 B;  5IGE A;  1SFO B;  3CD6 A;  3S16 B;  4X66 L;  3NQT A;  2A69 C;  3NP8 A;  4HJA A;  1IBL Q;  3BS1 A;  4HMI A;  3AQQ A;  1EFI D;  3T16 A;  1HA5 A;  3I73 A;  5E4X A;  1PH6 A;  2OCE A;  1VCI A;  3VA5 A;  3PO2 G;  2QKI C;  5BN3 A;  1F9S A;  2D0O A;  3ICE A;  3VR3 A;  4IQZ A;  1PHJ A;  1VQO A;  1IKL A;  4A3E B;  3EVQ A;  1KXL A;  3J81 i;  4H02 A;  1A3U A;  1CFM A;  3A7A B;  1N34 L;  1ZKO A;  3I4M H;  1X54 A;  5IP9 G;  1VQC A;  4S3S A;  1HJP A;  3NBH A;  4JBW A;  2O4X A;  1AZP A;  1BBX C;  2ZM6 L;  4MIU A;  1HNX L;  3CW2 C;  1WYD A;  4LUZ A;  1WCM G;  1GUS A;  4NMZ A;  3M9B A;  1D1I A;  2IPK D;  1BQQ T;  4C2M B;  3J81 j;  3M4Y A;  4O0A A;  1SJH D;  2NUC A;  1HNW Q;  4IUP A;  4FF2 A;  2IX3 A;  2CQO A;  2EY2 A;  1I5F A;  2PPB C;  2K4K A;  1VQM A;  1C0A A;  4LF7 L;  4F87 A;  4FF3 A;  5C0X G;  3C2P A;  1AW7 A;  3GD7 A;  2SEB D;  5EGT A;  2EQS A;  3UI2 A;  2ENB A;  4X6A H;  1X3F A;  3GO5 A;  5CMD A;  3KF6 B;  4DAY B;  1H9M A;  5KND A;  1WFQ A;  3R2I A;  1UE6 A;  5BR8 Q;  1Y1W G;  4ME5 A;  1L0W A;  2VY3 A;  1B9M A;  2AWN A;  3SK5 A;  1UNS A;  1Y8P B;  2ICE C;  1ZYR D;  3F2C A;  1LTL A;  4IN3 A;  4JW0 A;  3M3Y B;  2CHB D;  2PZW A;  4FP5 D;  1OXX K;  4A3F G;  1E2W A;  4POF A;  2C9O A;  5IYB G;  3FHW A;  1RTN A;  2A6E D;  3S1N H;  5C0X I;  1WTH A;  4DR5 L;  1VQD A;  4ZK9 B;  2UXB L;  5EPK A;  2VNU D;  3LX0 A;  2HDL A;  2E75 C;  1HR0 L;  3OTO Q;  1TU2 B;  3CAM A;  2PZT A;  2K32 A;  1STY A;  3KBG A;  1VMP A;  4A3G H;  4KHP L;  3KDF B;  4KY5 A;  4HJ8 A;  3BDO A;  2JJQ A;  2F0T A;  5EPJ A;  5DM6 3;  4LUO A;  3S1R H;  1K3B C;  3OWE B;  1Q12 A;  2GVB A;  2RA4 A;  4IUT A;  3QB3 A;  2B8G A;  3FDT A;  3NEL A;  1Y1W B;  3FKI B;  1A15 A;  3RLF A;  2QF7 A;  1HTL D;  2GA4 B;  3FEW X;  4MN3 A;  4OWX B;  1NAP A;  1EYA A;  4C1N I;  5C4J B;  1F2L A;  4JI6 L;  1HQR D;  3BZK A;  4JBM A;  1E7Z A;  3J7A F;  1F9P A;  2A69 D;  4LFC Q;  1WI5 A;  3PV0 A;  5EKI A;  4Q5V A;  2LY7 A;  1H9S B;  1CQV A;  3GTG B;  1TY0 A;  1PH8 A;  4IO9 A;  2A5H A;  1VQG A;  1KNA A;  2M9V A;  1AFP A;  2DJF C;  4KD3 A;  4ME3 A;  3AU7 A;  4A3B G;  1X55 A;  1I6H H;  1CHP D;  3U50 C;  1I6V C;  4XQJ A;  5NUC A;  3S2D H;  5EQ0 A;  4KN4 C;  3NSW A;  2K6A A;  3A8I E;  4JI1 L;  4MTN A;  4HR7 B;  3MXP A;  4GS3 A;  2TMP A;  4CDC C;  2SNM A;  5IT9 c;  2I5H A;  2VZA A;  5E4W C;  5M3F B;  2A6H D;  1F2Y A;  3EBE A;  3KF8 A;  1ET6 A;  4IJL A;  4PMC A;  3HGB A;  2E2H B;  3K5M A;  1K8M A;  1I4P A;  4C56 C;  5JVH 3;  4A3F H;  3OMC A;  4OXP A;  4DV7 L;  5IYD H;  2H5X A;  2N88 A;  3H09 A;  1GO3 E;  3KYH C;  3HOZ B;  1SE8 A;  2MNA A;  2ZTD A;  2F03 A;  5IE8 A;  1PH4 A;  1JB3 A;  2P5Z X;  4QY7 A;  1HTP A;  3CCV A;  4B3R Q;  1P16 A;  3CPF A;  2B2V C;  4XYQ A;  3D6C A;  1AE2 A;  2EE1 A;  1V9P A;  1IW7 C;  1GHK A;  4TQU S;  1JOK A;  2D2C C;  2NYZ D;  2JN4 A;  3DHQ A;  3L2P A;  1EIF A;  3A56 A;  3MXG A;  3LGJ A;  1DYQ A;  5KNC A;  4OX9 Q;  4C3J H;  1MGS A;  5IOD A;  4JI3 L;  1PZJ D;  2KQ3 A;  2PQA A;  1G29 1;  1H9S A;  3N52 A;  5FKA C;  4EQ5 A;  5I4D A;  1YJ9 A;  1PH2 A;  4BXX H;  2JA8 G;  5COY A;  3HKZ B;  2MQH A;  2CVR A;  4AYB G;  2C5C A;  3CC7 A;  1M4V A;  4U67 3;  4DV6 L;  1VQP A;  4QJF A;  4RKB A;  1H9K A;  1O7Y A;  3KJP A;  3RN2 A;  4UPA A;  2YU9 H;  4L63 B;  3S1M B;  1HFG A;  1L1O A;  3LWU A;  2B39 A;  4DNR B;  4NW2 A;  3NUC A;  3G4S A;  2NZO A;  2IHE A;  1VS0 A;  2FXQ A;  1I3Q B;  2JA5 G;  1MJC A;  2DN8 A;  1L2F A;  2SDF A;  4KJO A;  3TDQ A;  2JEA I;  2VXW A;  4B3R L;  2A6E C;  4L5R C;  2MPM A;  2V4D A;  4OL7 A;  4IUN A;  2BCO A;  4JI4 Q;  1EYC A;  4MTK A;  3GTO H;  1FNW A;  1HNZ Q;  2QA4 A;  5IT9 L;  1EU4 A;  4X3K A;  3HKZ G;  2VQE L;  1WVL A;  5M5Y B;  4I65 A;  1F9R A;  1JIC A;  1KAA A;  1UE7 A;  2OTJ A;  2KOL A;  4PV1 C;  1VQJ A;  3IKJ A;  2HD3 A;  1SNC A;  4DAV A;  1HZB A;  1SN8 A;  3DWP A;  4KHP Q;  2A74 C;  3HP3 A;  3QO2 A;  2Q2U A;  5JPN C;  3K80 C;  3M7N A;  3JAM L;  1KAB A;  2B2Y A;  4BBR H;  3F1Z A;  2R92 G;  2R93 H;  4J6H A;  1X6O A;  3FVQ A;  1VQ8 A;  1QZH A;  4QQB X;  4CGY B;  1BR9 A;  3MXU A;  1YHA A;  4YIJ A;  4HED A;  1X3P A;  1QNU A;  1HQM C;  3I70 A;  4F7X A;  3U4V A;  5M3M B;  1A3V A;  1TQO A;  4A3M H;  1BCP C;  1KL9 A;  1SSO A;  1D6E C;  4K8I A;  1B9N A;  3I4O A;  3PUX A;  2K05 A;  2C35 B;  4YCW A;  4C3I H;  1IXR A;  5HGT A;  1MBY A;  1LTI D;  4R4Q A;  1S5E D;  1Q1E A;  2MFI A;  2JA7 G;  1QB5 D;  2EDG A;  4NP5 A;  4K0K L;  4DUY L;  3L7Z C;  5DM7 3;  2LKV A;  2VB2 X;  1SYC A;  1N32 Q;  1XNR L;  4NKL A;  4G4K A;  4ZAI A;  2Y0S E;  5IGG A;  1B2T A;  4QMG A;  4F8M A;  3D31 A;  4PG3 A;  1HZC A;  3NHH A;  1RJT A;  4DR2 L;  1XNQ Q;  2VQF Q;  4DR3 L;  5KRU A;  5T1G A;  4DV2 L;  1GJX A;  2HHH Q;  3VR2 A;  1SMY D;  3IL8 A;  3VYU A;  3KF8 B;  2RQX A;  4PZ7 A;  3HOU H;  1PYW D;  2CKZ B;  3W2D A;  3S17 B;  3MA2 B;  2R7Z B;  3EN2 A;  4DUZ L;  4DV4 Q;  1IYJ B;  5IYC H;  1JWM D;  3C46 A;  2KCT A;  4FO2 A;  1W6J A;  3ZYY X;  1CHQ D;  5BN5 A;  1QVF A;  2B2U C;  4BY1 B;  3SR1 A;  4HJ5 A;  2QW7 A;  2WIN B;  3A7L A;  4EQP A;  2D5D A;  5C6A A;  3CCL A;  3F8T A;  2K03 A;  3FPP A;  4KKT A;  1JWS D;  1VQ6 A;  2Z8L A;  1HR0 Q;  3QIA A;  1D5X C;  3S1N B;  4P2C B;  5K36 H;  3P1H A;  1PFM A;  4CDD C;  5A35 A;  4NB3 A;  1DOL A;  2K50 A;  1RD9 D;  2EJG C;  3DLL A;  3K57 A; 
#chains in the Genus database with same CATH homology
 3ULJ A;  2NVY H;  2RHS B;  4BY1 G;  3STB C;  1DGS A;  1VQB A;  1CUK A;  3AYH B;  1PYB A;  1U5K A;  3I2Z A;  3T1H Q;  3HOW H;  4RMF A;  1L1O C;  2ZJR A;  1IL2 A;  3SGI A;  3M3Y H;  3A0J A;  4PZ8 A;  4R4I A;  3RLO A;  1K73 C;  4LWC A;  3EIV A;  4OWT B;  1IBM Q;  1CKM A;  5AJ3 Q;  1X56 A;  2HIV A;  1Q86 C;  4JI5 Q;  1GM5 A;  3L0O A;  5EAY A;  3HOZ G;  1W3S A;  4UP7 A;  3J7A 5;  4DR6 Q;  3G6E A;  3TS2 A;  1PYS B;  1OTC A;  1A0I A;  4P72 A;  5IP7 H;  4GOP C;  2E5L Q;  2F4V Q;  4A3D G;  4DR6 L;  1NMF A;  1CKN A;  1SMX A;  4A3D H;  4JYA Q;  4L5S A;  1CSQ A;  3J7Z C;  3AFQ A;  1N9W A;  2YTY A;  1NBW A;  1RL2 A;  2OQ0 A;  4JI5 L;  3W5O A;  2KBN A;  5FJ8 H;  5FJ8 G;  5AJ3 L;  1VQH A;  4YWM A;  1A62 A;  1JJC B;  1SRU A;  4POG A;  1NY4 A;  3UE1 A;  3CME A;  1G51 A;  4KI0 A;  1N8R C;  2AHO B;  2Q2I A;  1HNW L;  3J80 i;  1B70 B;  2ZTE A;  1VQL A;  1K3R A;  1SR3 A;  2N3S A;  3HOY G;  3W1G A;  3HOV G;  4MNO A;  2R7D A;  3HOY H;  1VQA A;  2JA6 G;  2JA6 H;  1BBU A;  5GAD C;  4HIO A;  2UUA L;  4R4C A;  3PUY A;  4JI7 L;  2CWA A;  3CCE A;  2JA8 H;  3CD6 A;  2XTI A;  4DK3 C;  4PZ6 A;  4X66 L;  2NVQ H;  3RNU A;  1I3Q H;  3CC4 A;  3ZJY C;  1UE5 A;  1LM0 A;  1MKH A;  4QL5 A;  3KJO A;  4HJA A;  3JAM c;  1IBL Q;  1JMC A;  4DR4 L;  4DR2 Q;  1OXS C;  3AQQ A;  1CSP A;  1PH9 A;  1VQN A;  4A75 A;  4LFB Q;  5LMU L;  1Q46 A;  1PH6 A;  2OCE A;  1VCI A;  1TWC H;  1B8A A;  2AKW B;  3M4P A;  3PO2 G;  3M85 A;  2R7F A;  1YBY A;  2D0O A;  3A5U A;  2RCN A;  3ICE A;  1JJG A;  4JCV E;  1PHJ A;  1JB7 A;  1VQO A;  4DV4 L;  4DUY Q;  3UDG A;  2K14 A;  4A3K G;  4K0K Q;  2CCZ A;  1UWV A;  1KXL A;  3J81 i;  4H02 A;  5C0X J;  3PUV A;  1SFO H;  3FKI G;  1N34 L;  1TWH H;  2OQK A;  4NXN Q;  1X54 A;  2BA0 A;  5IP9 G;  5LMU Q;  3I4M H;  1VQC A;  4LFB L;  3JAM i;  5H1S E;  4A3I G;  4A76 A;  5M3M G;  1PA6 A;  2RHQ B;  1KRS A;  1HJP A;  1TWF H;  2LSS A;  4JBW A;  2HHH L;  2N78 A;  5GRO A;  1I94 Q;  2ZM6 L;  1IBL L;  3CCQ A;  3HOW G;  4APV A;  1M1K C;  4JI0 Q;  1HNX L;  2F3I A;  4L5T A;  3CW2 C;  1WCM H;  1WYD A;  5IYD G;  3U4Z A;  4LUZ A;  1WCM G;  1PH3 A;  2Q2H A;  3HOX G;  2VQF L;  2UUB L;  2UUA Q;  4FDB A;  4JG2 A;  1MIU A;  4UP8 A;  3G48 A;  3M9B A;  3MEF A;  3T1H L;  4YHH Q;  4GNX B;  2HQL A;  2NVX H;  3J81 j;  1PV4 A;  1G6P A;  4ALP A;  3HOZ H;  2I5L X;  4AIM A;  2N8N A;  2WFW A;  2NN6 I;  4O0A A;  4WJ4 A;  1QZG A;  4LNQ A;  2VUM G;  1FGU A;  2YV5 A;  2WP8 J;  1HNW Q;  1XMQ Q;  3S15 H;  3AEV A;  1N32 L;  2Z6K A;  5DLQ E;  3S1Q H;  3OYY A;  2CQO A;  1I5F A;  1TWG H;  4GLA C;  2K4K A;  2AMC B;  3KF6 A;  1VQM A;  1XJV A;  1C0A A;  2PI2 A;  2A8V A;  4LF7 L;  1EQR A;  2R92 H;  5C4X G;  5C0X G;  2XGT A;  1XPU A;  3GD7 A;  4J15 A;  1Q1B A;  4QGU A;  2EQS A;  2F4V L;  4JYA L;  2PQA B;  4DAM A;  3ULL A;  1QVG A;  4X6A H;  1XTD A;  1X3F A;  3GO5 A;  3J80 c;  3KF6 B;  4DAY B;  1GKH A;  1WFQ A;  4GLV B;  1UE6 A;  5BR8 Q;  1Y1W G;  1L0W A;  2IHF A;  2K75 A;  3CQZ H;  4R4O A;  2BH8 A;  2VQE Q;  2VY3 A;  2AWN A;  1S72 A;  1HNZ L;  1IBM L;  2D0P A;  3TRZ A;  2EXD A;  1NE3 A;  3F2C A;  1LTL A;  4DUZ Q;  1FJG L;  2JA9 A;  2GN5 A;  1OXX K;  4C2M H;  3U58 A;  4C3H H;  4TVA B;  4A3F G;  4NPS A;  4GNX A;  1VQE A;  4P74 A;  1OXT A;  4POF A;  4LF4 Q;  3JC6 6;  1A8V A;  5IYB H;  2K52 A;  3PUW A;  5IYB G;  1M90 C;  3FHW A;  2VS1 A;  2UXD L;  2E2I H;  3S1N H;  1K0R A;  1HZA A;  5C0X I;  4DR5 L;  1VQD A;  1YJN A;  5LMN Q;  1KAW A;  4BBS G;  4LF8 Q;  4A3L G;  2UXB L;  1OXU A;  4IPG A;  5M5Y H;  1XNQ L;  2VNU D;  1YVC A;  4NXM L;  2WAQ G;  1HR0 L;  3OTO Q;  3PUZ A;  2HIX A;  3CAM A;  1RIP A;  2E8G A;  2EIF A;  4EX5 A;  4KHP L;  1XMO L;  4A3G H;  3KDF B;  4JOI C;  5FLM H;  4HJ8 A;  4A3J H;  3H15 A;  2JJQ A;  2NN6 G;  4P71 A;  2UUC L;  4LUO A;  3KFU A;  1D7Q A;  3S1R H;  2CFM A;  1N36 Q;  1XNR Q;  3GTM H;  1Q12 A;  2GVB A;  4YY3 Q;  1SLJ A;  4XIG S;  3PIP A;  4GOP B;  3NEL A;  1W2B A;  3BZC A;  3M4O H;  4B3S L;  2UXC L;  1Y1V H;  5ELN A;  1K8A C;  3RZO H;  3RLF A;  3S1M H;  1UEB A;  4OWX B;  4B3T L;  1YHQ A;  1KRT A;  4JI6 L;  4JI4 L;  3BZK A;  4JBM A;  1QVC A;  1GVP A;  2DUD A;  1E7Z A;  4GN3 B;  2E2H H;  4JI3 Q;  2BH2 A;  4P73 A;  2Q2T A;  4AQY Q;  1ASZ A;  4LFC Q;  1WI5 A;  3PV0 A;  2NVT H;  1EFW A;  1X3E A;  4LF6 L;  1VQI A;  3PSI A;  3RN5 A;  4IFD I;  1YIT A;  1PH8 A;  4IFD J;  1E22 A;  4X64 L;  2CWP A;  2D62 A;  4DV0 Q;  2JEB I;  4DV2 Q;  4IO9 A;  3T1Y Q;  1C9O A;  5GQO A;  1S3O A;  2YTX A;  1YZ6 A;  4DV1 Q;  4DR3 Q;  1VQG A;  1EIY B;  4GKJ L;  3VDY A;  4ME3 A;  1YIJ A;  4A3B G;  2ALY B;  1X55 A;  4R1J A;  4BBR G;  4LF9 Q;  3U50 C;  1I6H H;  4GN4 B;  2R93 G;  4HJ9 A;  4JI2 Q;  3BJU A;  3B6Y A;  3STB D;  1NTG A;  3S2D H;  4IOA A;  4HJ7 A;  2KHJ A;  4JI1 L;  4DV5 L;  3S17 H;  4DK6 C;  1E1T A;  4X62 Q;  4MTN A;  1Y1W H;  1N33 Q;  1JE5 A;  1A63 A;  3NBH B;  3PGZ A;  2K5N A;  4DV6 Q;  4GS3 A;  3RZD H;  5GAH C;  3DLL A;  3S16 H;  2I0Q A;  5IT9 c;  2I5H A;  4DR7 Q;  1OXV A;  2VZA A;  1HR0 W;  1E1O A;  3I4N H;  3I4N G;  5IP9 H;  3G71 A;  2ASB A;  3EBE A;  3WWV A;  1O7I A;  3F2B A;  4BY1 H;  5IWA L;  4GKK Q;  4JBJ A;  3HKS A;  4JBK A;  4IJL A;  3CCM A;  3D0F A;  4OX9 L;  3A74 A;  3RR5 A;  4WJ3 M;  5JJK A;  4A3F H;  1E24 A;  4OXP A;  1IZ6 A;  1B7Y B;  4DV7 L;  2IT1 A;  5IYD H;  2H5X A;  1GO3 E;  2LXK A;  2WAQ E;  3KYH C;  1J5E Q;  1SE8 A;  2MNA A;  4BA2 I;  4A3E H;  1Z9F A;  3GDE A;  2JK8 A;  2ZTD A;  3CF5 A;  3ER0 A;  4GLX A;  2LXJ A;  5HY6 A;  2ATW A;  1FL0 A;  1NMG A;  3A5Z B;  5IE8 A;  4DR1 Q;  1PH4 A;  4QY7 A;  2MO0 A;  2IY5 B;  3CCV A;  4B3R Q;  1P16 A;  3CPF A;  4DV3 L;  4DV3 Q;  2QEX A;  4OON A;  1AE2 A;  3M4Q A;  2V1C C;  5M3F G;  1Q7Y C;  5IP7 G;  2UU9 Q;  5JJI A;  1LYL A;  1V9P A;  1VQK A;  3S14 H;  4TQU S;  1V43 A;  4JI8 L;  4DV0 L;  4QIW E;  3L2P A;  1J5E L;  4XTC S;  1EIF A;  1IBK L;  4JV5 L;  3I55 A;  4PMW A;  1VQ9 A;  4OO1 I;  2ID0 A;  1EOV A;  3H0G H;  3LGJ A;  4HIM A;  3H0G G;  3S2H H;  4OX9 Q;  4C3J H;  4JI3 L;  4B3M L;  3PO3 H;  4DPG A;  2A1A A;  2PQA A;  1G29 1;  1LUZ A;  4EQ5 A;  1YJ9 A;  1PH2 A;  3PO3 G;  4A3M G;  4BXX H;  4O2D A;  2JA8 G;  4X65 L;  1VQ4 A;  1Y14 B;  2MQH A;  2A19 A;  1R9T H;  3Q8D A;  4AYB G;  5HGQ A;  3CC7 A;  1X3G A;  2OTL A;  2ZJP A;  2DGY A;  2JQO A;  3KOJ A;  4DV6 L;  1GD7 A;  3E9H A;  1PFS A;  1VQP A;  4X62 L;  4UY8 C;  4QJF A;  4DNI A;  3KJP A;  3RN2 A;  2UUC Q;  4DKA C;  4UPA A;  2YU9 H;  2PMZ E;  3CMA A;  3F2D A;  2MO1 A;  4JC0 A;  4LF5 L;  1L1O A;  1V1Q A;  5J3B A;  1D8L A;  2KCM A;  4KLK A;  4LFA L;  2KHI A;  4HID A;  2UXB Q;  4JV5 Q;  3RLN A;  1PH1 A;  3G4S A;  4IPD A;  2WB1 G;  4A3C H;  2NZO A;  2IHE A;  4DR5 Q;  4A3K H;  4JI8 Q;  3CCJ A;  1VS0 A;  4GOP A;  4X64 Q;  1EWI A;  5K36 G;  2FXQ A;  2JA5 G;  4A3G G;  1MJC A;  4LFA Q;  1X9N A;  1L2F A;  5FLM G;  2JA5 H;  4LF6 Q;  2IX1 A;  4A3J G;  2RF4 A;  2JEA I;  3J81 c;  3CCR A;  4LF5 Q;  1XPO A;  1Z47 A;  3KLW A;  4MZ9 A;  3TRE A;  3UDF A;  5C44 H;  3PIO A;  3UDX A;  5C44 G;  4AQY L;  4L5R C;  4A93 H;  1MJE A;  4B3R L;  2N49 A;  1J6Q A;  4DR1 L;  5M3M H;  4JI4 Q;  2AWO A;  4IOC A;  2PI2 E;  1KD1 C;  1KQS A;  1T9H A;  3GTO H;  3IRB A;  4RG1 A;  3ULP A;  1EYG A;  1X65 A;  1HNZ Q;  2QA4 A;  3OW2 A;  3HOX H;  2VQE L;  3HKZ G;  4X65 Q;  1PVO A;  5M5W H;  4AH6 A;  3H3V I;  1BVS A;  1YHB A;  1HH2 P;  1UE7 A;  3K8A A;  4YY3 L;  5BR8 L;  1VQJ A;  1TWA H;  4A3E G;  1N36 L;  2OTJ A;  5JJL A;  4YWK A;  4B3M Q;  2ZJQ A;  3ERS X;  3DM3 A;  1SRO A;  1AH9 A;  4IFD G;  5IWA Q;  1K8G A;  4IJH A;  2Z0S A;  1HZB A;  1SN8 A;  1Q82 C;  1AE3 A;  4KHP Q;  1C7Y A;  1YNX A;  2VUM H;  5M3F H;  1U0L A;  5IYC G;  2Q2U A;  3K80 C;  1PH7 A;  5C3E G;  2QGQ A;  4LF7 Q;  4NXM Q;  3M7N A;  3K81 C;  1IBK Q;  4LF8 L;  4JOI A;  2F52 A;  3GTK H;  2OWO A;  1JT8 A;  4A3B H;  1QUQ A;  4JI1 Q;  3F1Z A;  4BBR H;  4DV5 Q;  1YI2 A;  2R92 G;  5C4J H;  2R93 H;  5C4X H;  3GTQ H;  1X6O A;  1VQ8 A;  1JJ2 A;  1CKN B;  2UU9 L;  2ZTC A;  1QZH A;  4QQB X;  1YEZ A;  2I5M X;  1YHA A;  4IPH A;  3PCO B;  2Y0S G;  5GAE C;  3HOV H;  3TQY A;  3U4V A;  2UUB Q;  4GKJ Q;  3GTG H;  4UP9 A;  5ELO A;  3T1Y L;  3PF4 A;  3I7F A;  4A3M H;  2L15 A;  1HNX Q;  1KL9 A;  2B63 G;  3CP0 A;  3GTP H;  1WOC A;  2R6G A;  2B63 H;  1I94 L;  1EQQ A;  4DV7 Q;  3KDF A;  3E0E A;  1HZ9 A;  3I4O A;  3PUX A;  3CPW A;  4LFC L;  2E2J H;  2C35 B;  4R4T A;  1QUQ B;  1KHI A;  1PH5 A;  5M5X H;  2YTV A;  4YCW A;  4C3I H;  1N34 Q;  1IXR A;  4GKK L;  1P8L A;  4R4Q A;  1FVI A;  2JA7 H;  1Q1E A;  2MFI A;  4LUV A;  1CKO A;  2JA7 G;  2R7Z G;  4Y52 H;  2WB1 E;  4YCU A;  2R7Z H;  1BBW A;  1EUJ A;  4K0K L;  4DUY L;  4DR7 L;  1UE1 A;  3L7Z C;  4BBS H;  2UXC Q;  3K7A H;  4A3L H;  2HT1 A;  1N33 L;  4A3C G;  1XPR A;  2PNH A;  1N32 Q;  1XNR L;  1XMQ L;  4HIK A;  4BA1 I;  1H95 A;  4YWL A;  2B29 A;  2Y0S E;  5LMN W;  2K5H A;  4JI2 L;  2NZH A;  3D31 A;  4PG3 A;  1XMO Q;  3FKI H;  1YJW A;  1HZC A;  3S24 A;  4YHH L;  4LF9 L;  5IY0 A;  3NEN A;  3OTO L;  4DR2 L;  3I4M G;  4A4I A;  2YYZ A;  4LW1 A;  4A3I H;  1XNQ Q;  4AYB E;  1E3P A;  2VQF Q;  4DV1 L;  4DR3 L;  1S40 A;  5LMN L;  1Y1V G;  3PF5 A;  4DV2 L;  2ES2 A;  4JI0 L;  1I50 H;  1TXY A;  4YCV A;  5GAG C;  3AFP A;  4GNX C;  2ZM6 Q;  3FP9 A;  1VQ5 A;  2HHH Q;  3GTL H;  1WJJ A;  1KC8 C;  2VL6 A;  3KF8 B;  5FLX c;  3E9I A;  1VQF A;  4PZ7 A;  3K0X A;  2JE6 I;  3HOU H;  4BXX G;  4NXN L;  2CKZ B;  3HOU G;  3CXC A;  3BU2 A;  3UE0 A;  3CCU A;  4JI6 Q;  1KIX A;  3I56 A;  4B3T Q;  1Q81 C;  3EN2 A;  3W1B A;  4DUZ L;  1ASY A;  5E7N A;  1FJG Q;  1L1O B;  4DV4 Q;  1NJI C;  1IYJ B;  5IYC H;  5C3E H;  4B3S Q;  4OWW B;  3TS0 A;  2KCT A;  5JEA J;  4OO1 G;  1K83 H;  2K5V A;  1QVF A;  5JEA G;  3UDI A;  3H3V H;  1K9M C;  2E5L L;  4HJ5 A;  3NEM A;  3CCS A;  4P75 A;  3CC2 A;  2IX0 A;  4KHZ A;  3F8T A;  3CCL A;  3PO2 H;  2KEN A;  3HFZ B;  4Y7N H;  2GVA A;  1VQ6 A;  4IPC A;  1Q8K A;  3K7U C;  1HR0 Q;  4DR4 Q;  1VQ7 A;  2Z6K C;  3HKZ E;  4GN5 A;  4BY7 H;  4X66 Q;  4L5Q A;  4BY7 G;  3MXN B;  4JI7 Q;  4NB3 A;  2K50 A;  3TEH B;  2VW9 A;  2B3G A;  2UXD Q;  3GTJ H;  4A93 G;  2BA1 A;  4LF4 L;  1BKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...