2N8NA

Solution structure of translation initiation factor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation
molecule keywords Translation initiation factor IF-1
publication title Structure and dynamics study of translation initiation factor 1 from Staphylococcus aureus suggests its RNA binding mode
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
total genus 16
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n8nA00
2UXBQ 1WCMG 3G48A 2VNUD 3CC7A 4JI5Q 1N32Q 5M5YH 4A75A 3U4VA 5IE8A 1X9NA 4JI3L 1PA6A 1VQKA 2L15A 4R4QA 2OQKA 4PMWA 4C2MH 4DV2Q 1SN8A 3J81j 3M7NA 3S1MH 5HGQA 4HJ8A 4B3TQ 1XMQQ 2EQSA 2RHQB 4DR5L 4HIDA 1S40A 2WFWA 3HKSA 2OCEA 3PF5A 1GM5A 5IP9H 3K8AA 3NENA 4UP7A 1PH6A 1KRTA 1TXYA 1PYBA 1BBUA 1YNXA 1X54A 5C0XJ 1NMGA 4DR5Q 1K73C 3KOJA 4L5SA 4LUZA 5M3FH 1IL2A 3TRZA 4OWTB 3JAMi 4A93G 4KLKA 1KHIA 2CCZA 2KENA 4A3EG 1C0AA 2I5MX 1TWFH 2B63G 1VQ8A 1N34L 4WJ4A 5C44H 2NN6I 2K5HA 3K80C 4B3SQ 3DLLA 4KHZA 3ULLA 4POGA 4OX9L 4AIMA 2HHHQ 1OXUA 3PUYA 1VQDA 5IWAL 3G6EA 4DR2Q 2FXQA 1VQ9A 3PIOA 3GTJH 4MTNA 1L1OB 4C3IH 3F2DA 4A3BG 1N34Q 4BA2I 4H02A 2ZTDA 3I7FA 4UPAA 4JBJA 4X65Q 4A93H 1QZHA 4EX5A 5FJ8H 3EIVA 4OX9Q 4B3ML 3K81C 5IWAQ 1EQQA 2B63H 2V1CC 3ER0A 4MNOA 3CPFA 3RR5A 1G291 3UE1A 2LXJA 1KIXA 3L7ZC 3NEMA 1NTGA 2JA9A 2N49A 1JB7A 4B3MQ 3K7AH 5M5XH 4A3BH 1YITA 1K83H 1M1KC 5LMNL 3M4PA 2A1AA 3ULPA 2K52A 4IPCA 3NBHB 2YV5A 2PI2A 1E1OA 4X62Q 5GADC 1CUKA 4AQYL 3KFUA 3STBC 3T1YL 3CF5A 4IPGA 1YJWA 4GOPB 1Q12A 4LF7L 4BXXG 4P74A 1I5FA 2LSSA 1YHBA 3I56A 1Q1EA 1MJEA 5LMNQ 3CAMA 2E5LL 2IY5B 4DR7L 2R6GA 4Y52H 4AQYQ 4PZ8A 3HOVG 1LM0A 3H15A 4GKJL 4LUOA 1XPOA 3E9HA 3S15H 4LF7Q 1EWIA 4GLVB 1K8AC 2Q2UA 4OONA 2BH2A 2R7ZG 3S2HH 3ULJA 4ME3A 4L5RC 1N8RC 2E5LQ 1GVPA 1XNRQ 4DR7Q 1U0LA 2ID0A 5AJ3L 3M4QA 2K5VA 4IFDG 4GKJQ 3J80c 4BXXH 2Y0SG 4A3IG 1KXLA 2JK8A 2KCTA 4MZ9A 1HZCA 2PQAB 4DKAC 3UDGA 3U58A 4QQBX 1HNWL 1UWVA 1YZ6A 2ASBA 4UP9A 1L1OC 4DV0L 3KF8B 1MJCA 5AJ3Q 3DM3A 3CQZH 3CMEA 3PGZA 4NB3A 3TEHB 2R7ZH 3HOZG 1NJIC 1TWCH 1VQ5A 4K0KL 2R93G 3CCQA 3I55A 3OW2A 4BY1G 1HNWQ 2UXDQ 5J3BA 2IX0A 1VQGA 2B3GA 1EYGA 4BBRG 4DV0Q 2YTYA 4DR4L 5JEAG 4UY8C 4YWMA 5FLMG 4K0KQ 1IBLL 4TVAB 1OXXK 3K7UC 3KF6B 4IOCA 2K50A 3GDEA 3RNUA 2IHEA 1VQBA 2GVAA 3H3VI 1P16A 3GD7A 1VQPA 4LF4L 2JEBI 4OWXB 4LF6Q 3HOZH 1SR3A 3RN5A 1PFSA 2R93H 1G51A 1Q81C 2HT1A 1PVOA 4GN3B 2KCMA 1Y14B 4O2DA 4JI5L 4LUVA 4GOPC 4BY1H 3W5OA 2I5LX 4JOIA 4BBRH 4GLAC 4HJAA 4HIMA 3GTQH 3KYHC 4JI4L 4LF4Q 3SGIA 5FLMH 4YHHL 3TS0A 1S72A 4B3TL 2UUBL 4P71A 1Q86C 1J5EL 2HQLA 3S24A 3D0FA 4IFDI 3PIPA 3ERSX 5M3FG 1WFQA 1UEBA 3KJPA 3S1RH 4JI4Q 1CKMA 4YHHQ 4GLXA 2VQFL 2UUBQ 1J5EQ 5ELNA 3GTOH 2K75A 4X64L 3RZDH 2OTJA 2D62A 3M9BA 3PF4A 2MNAA 3U50C 2JEAI 2D0OA 1VQ4A 4A3CH 5C44G 1SFOH 1K0RA 4GOPA 4LWCA 4DV1L 4APVA 2VQFQ 1HNXQ 1PV4A 4X64Q 5JJKA 3U4ZA 3S2DH 1W3SA 1YJ9A 4DK6C 4Y7NH 5LMUL 3KLWA 3T1HQ 2VY3A 1FVIA 1YHAA 4B3SL 3KDFA 4OO1G 3FKIG 1PYSB 2XTIA 2HIVA 4DR2L 3AQQA 1PHJA 4DV1Q 5FJ8G 2HHHL 2JA8G 2PMZE 1HJPA 1NMFA 3RLOA 4BA1I 5H1SE 1PH3A 2R92G 1N36Q 2A19A 3A74A 1VQ7A 5LMUQ 2I5HA 2MFIA 3OTOL 3GTLH 1C7YA 4X65L 1RL2A 3CMAA 1SMXA 4J15A 4HJ7A 1H95A 1VQJA 1E7ZA 2HIXA 1K3RA 3PO2H 1HZ9A 3M85A 3L2PA 1CKNA 2PQAA 3HOUG 4QJFA 4HJ9A 4AYBG 2VL6A 4R4IA 1N9WA 3GTPH 1VQFA 3PUZA 3OTOQ 1QVCA 1JJCB 3FKIH 2C35B 4A3JG 2Y0SE 1OXSC 2JA8H 2VUMH 2UU9L 3M3YH 3HOYG 2R92H 2AMCB 1MKHA 3CCJA 4HIKA 3PUVA 1OXVA 2CQOA 3GTMH 1MIUA 4IPDA 1EUJA 1GO3E 5ELOA 5IYBG 4X62L 2ZM6L 4GNXB 1XJVA 2YU9H 5C3EG 1SLJA 3HOUH 3M4OH 2UU9Q 1HH2P 4JI7L 4A3FG 4JV5Q 3A5UA 4IO9A 3CCLA 4TQUS 4C3HH 4OWWB 1OXTA 3I2ZA 2WB1G 3J81c 2ZM6Q 4A3JH 1YEZA 2WAQE 2CWPA 3IRBA 2YTXA 2EXDA 3HOYH 1X3FA 4RG1A 3ZJYC 1V9PA 4DAMA 1X6OA 1A63A 1QUQA 4HJ5A 2N78A 4JI7Q 3OYYA 1XNQL 5IYBH 4DV7L 4OO1I 1EOVA 1HZBA 1XNRL 4PZ6A 2ALYB 1UE1A 5C3EH 1G6PA 2JE6I 4YCWA 4A3FH 1NE3A 2NZOA 1I6HH 2E2IH 2JA5G 1QVFA 5C4JH 1VQNA 1XNQQ 4DV7Q 2BA1A 4DNIA 3E0EA 2JA6G 3EBEA 1VQHA 2VS1A 4IJHA 2RCNA 3AFPA 2OTLA 1K8GA 4GN5A 1ASZA 1Q7YC 4JG2A 1FJGL 4DPGA 1JT8A 2UXDL 4YY3L 1X56A 2MO0A 4DR6Q 1IZ6A 2AWOA 3STBD 2UXCL 3CXCA 3CCMA 5IP7H 3A5ZB 1S3OA 1VQLA 4UP8A 1X55A 2JA5H 3J80i 2QGQA 2KHIA 2EIFA 4OXPA 4P72A 4DUZL 5IY0A 1FJGQ 2JA6H 4YY3Q 5GQOA 4R4OA 2DUDA 2OQ0A 4QIWE 3PUXA 1XTDA 5GAHC 4DV4Q 4LF6L 1PH4A 2UXCQ 4GNXC 3L0OA 4JI6L 3B6YA 1Q8KA 1FL0A 3HKZG 4DV5L 5K36G 4LW1A 2RHSB 1Y1VG 2YTVA 2WP8J 1SE8A 4DUZQ 3WWVA 4YWLA 3HOXG 1UE5A 3RZOH 1VQCA 2IX1A 3LGJA 4DR1L 4JI6Q 3AYHB 4A3GG 4DV5Q 1L1OA 4EQ5A 1GKHA 1VQMA 2GVBA 4GN4B 2ZJPA 3CCSA 2NVTH 1AH9A 1W2BA 1IBML 3FP9A 3UDFA 3HOWG 4A3CG 1M90C 2N8NA 3CPWA 2OWOA 4DR1Q 3PO3G 4GKKL 1Y1VH 1O7IA 3UE0A 4LFBL 4BBSG 3G71A 1Q1BA 1I94Q 3I4MG 5JJIA 2LXKA 3HOXH 1IBMQ 2RF4A 1JE5A 1BBWA 1VCIA 3D31A 2UUCQ 1K9MC 2ES2A 4JI2L 4JBMA 4A3GH 1B70B 4L5TA 2VQEL 1HNXL 4GKKQ 4LFBQ 2AWNA 2NVQH 2E2HH 3T1HL 3RLFA 2VZAA 1I3QH 1E24A 4LF8L 3CP0A 1QVGA 3PO3H 4JI2Q 3CC4A 1X3GA 4A3DG 3BZKA 4BBSH 1HZAA 1IXRA 1T9HA 2VQEQ 2CKZB 5GROA 3I4MH 1A0IA 3TQYA 5C4XH 1UE7A 2WB1E 3PO2G 4X6AH 5LMNW 2JJQA 2KBNA 3RN2A 3S14H 2Q2HA 2H5XA 4LF8Q 4XIGS 3S17H 1C9OA 3H0GG 1E1TA 4LFAL 3RLNA 5GAGC 4A3KG 1WOCA 2F4VL 2VUMG 1RIPA 2IT1A 1YJNA 2ZTCA 4YCVA 5EAYA 1A62A 2YYZA 3F8TA 2ZJQA 2PNHA 1V1QA 1N33L 3BZCA 4A3DH 3CCVA 3JAMc 1HNZL 4JI3Q 3PUWA 5M3MH 4P73A 1I50H 5HY6A 4LFAQ 4LF9L 3PV0A 1Q82C 3I4NG 2F4VQ 1WCMH 1AE3A 1CSQA 4PZ7A 4LFCL 1IBKL 4KHPL 4R4TA 4DV3L 2K5NA 1CKOA 1Y1WG 1N33Q 1LYLA 3H0GH 4PG3A 5FLXc 4ALPA 1KD1C 1HNZQ 1XPRA 4A3KH 4YWKA 1D7QA 4R1JA 2GN5A 3HFZB 4LF9Q 4JV5L 2Z6KC 1D8LA 1KAWA 1VQEA 1HR0L 4O0AA 1B8AA 5GAEC 1IBKQ 4LFCQ 2JA7G 4KHPQ 5DLQE 2N3SA 4DV3Q 1LTLA 2IHFA 5M5WH 3I4NH 3PCOB 1KQSA 4A3LG 2DGYA 1IYJB 1PH9A 1JJ2A 3ICEA 3KF6A 1YBYA 2KHJA 3I4OA 2NVXH 1HR0Q 4IFDJ 2NVYH 1Y1WH 3Q8DA 2QEXA 1BVSA 3HKZE 1KRSA 2JQOA 2XGTA 2AHOB 5BR8L 3VDYA 5C0XG 3GTKH 3S1NH 2AKWB 2BH8A 1E3PA 4A3EH 4JI8L 2NZHA 2JA7H 2ATWA 3J7ZC 3TREA 1PH5A 2ZJRA 2Z6KA 4IPHA 4JBWA 2CFMA 1EFWA 3J81i 1KC8C 4A3LH 1X3EA 3W1BA 5BR8Q 4DR3L 1SROA 1AE2A 3GO5A 1XPUA 3TS2A 4DV6L 5IP7G 2F52A 1TWHH 4JI8Q 5JEAJ 4POFA 3MXNB 2MQHA 4IJLA 2Z0SA 4NXML 2ZTEA 4DR6L 3AEVA 1L2FA 2K4KA 4DR3Q 2VW9A 1WI5A 2E2JH 3CC2A 3J7A5 1NY4A 4DV6Q 4JYAL 1TWAH 4NXNL 5IYCG 3AFQA 1EIFA 4X66L 1B7YB 4NXMQ 4DV4L 1P8LA 2UUAL 4A4IA 1VQOA 1Z9FA 4QL5A 3T1YQ 4B3RL 3KDFB 3KJOA 2K14A 4JYAQ 4QY7A 4WJ3M 1R9TH 4NXNQ 1WJJA 3FHWA 2CWAA 3CCEA 4FDBA 1DGSA 3E9IA 3F2BA 4X66Q 1JJGA 2PI2E 4JC0A 2UUAQ 4JI1L 3F2CA 3S16H 3H3VH 2BA0A 4B3RQ 5IYCH 3K0XA 3MEFA 1KL9A 4L5QA 4RMFA 4R4CA 1PH2A 5C0XI 2I0QA 4JI0L 1CKNB 3A0JA 4GS3A 1ASYA 1TWGH 4DAYB 3HOVH 2D0PA 1Q46A 4P75A 3UDXA 4BY7G 4JI1Q 1VS0A 4DK3C 4A3MG 4QGUA 4JOIC 1N36L 3PSIA 1JMCA 3W1GA 4DUYL 1EQRA 1YHQA 1I94L 3CD6A 1VQ6A 3GTGH 3EN2A 1A8VA 4KI0A 1QZGA 2E8GA 4JI0Q 3BJUA 1YIJA 3BU2A 2UUCL 3CCRA 2A8VA 2R7FA 2F3IA 1L0WA 1PH1A 1J6QA 4AYBE 4LNQA 4A3IH 2WAQG 3CCUA 1V43A 4HIOA 3F1ZA 1NBWA 4JCVE 4AH6A 1SRUA 5IYDG 4DUYQ 3JC66 3G4SA 1XMOL 4GNXA 1YI2A 1PH7A 1OTCA 4LF5L 5C4XG 1BKBA 1CSPA 3S1QH 4BY7H 2B29A 2R7DA 1VQIA 2MO1A 1GD7A 3CW2C 4A3MH 4JBKA 4A76A 1FGUA 4DR4Q 1YVCA 1E22A 2Q2TA 2NN6G 3UDIA 5E7NA 5IT9c 2QA4A 2Q2IA 1XMOQ 1IBLQ 2UXBL 1Z47A 4LF5Q 1HR0W 1N32L 1QUQB 4YCUA 1X65A 1U5KA 4XTCS 5IP9G 3NELA 1EIYB 5JJLA 4DV2L 4NPSA 1PH8A 1UE6A 1LUZA 1WYDA 4C3JH 3HOWH 5M3MG 5IYDH 1XMQL 1VQAA 4IOAA
chains in the Genus database with same CATH superfamily
1L0XB 5C5MA 1WCMG 3BZDB 3IAYA 3Q22A 1X9NA 1VQKA 2L15A 4R4QA 3S1MH 2YU9B 3M7NA 4BWGB 2IWHA 1WVLA 1XMQQ 3MXNA 3HKSA 5FO9B 2CVRA 3BDOA 3K8AA 3BVMA 1JQYD 1PZKD 2WKDA 4GZYC 2D5DA 2DJGC 2Q8TA 2M00A 5M3FH 2F03A 1LTID 2K5WA 1MSHA 2IX3A 1DJRD 4EQOA 4E6IA 3A54A 3K5OA 4FYDA 3SVMA 5C44H 2NN6I 1KTKA 5AFWA 2WV6D 5I9OA 2CHBD 4KHZA 1JWUD 2E2JB 1A3UA 1TQOA 3F2DA 4UPAA 4ZLTF 4X65Q 4ZK9B 2KHSA 1SYDA 3VR4A 2B63H 2F0JA 3ER0A 4MNOA 3BYTB 1R9TB 3CPFA 1LACA 1TY2A 1TR5A 1KIXA 1GHKA 3NEMA 2RDFA 2F0EA 2JA9A 3W2DA 2C5CA 4QF4A 1YITA 1M1KC 5LMNL 1E0BA 5EBCA 2PI2A 1ENAA 4AQYL 4RA8A 1E2WA 1YJWA 4GOPB 4LF7L 1I5FA 1MJEA 1Q1EA 3CAMA 2IY5B 4DR7L 3EFXD 2XWJB 4CDDC 4LUOA 3E9HA 1I4RA 1PTOF 3S15H 2R7ZG 1EWIA 2A69D 1K8AC 2Q2UA 1CM9A 4OONA 3ULJA 2MHVA 2E5LQ 1GVPA 3S1QB 4BY7B 1XYIA 1JR0D 1BR9A 2MUYA 4XDXA 4BXXH 4ZRZA 2JK8A 4MZ9A 2PQAB 4DKAC 4KKSA 3U58A 2ASBA 2ICIA 4DV0L 4DU9A 5AJ3Q 3CMEA 3TEHB 4PMBA 3OW2A 1RTNA 1EYGA 2P5ZX 1II3A 3S1MB 3Q6SA 4KMUC 2Z4HA 5DAUA 4C3JG 4CJ2C 5DEHA 5JAVA 5G3LD 1OXXK 3MXGA 4IOCA 2K50A 3I73A 3TP7A 3H3VI 1F9SA 3HOZH 4LF6Q 1LTRD 1SAPA 3RN5A 1G51A 4O2DA 4GOPC 4UDUC 4JOIA 3GP7A 4B9WA 3KYHC 3TS0A 5KIXA 1S72A 2RA4A 2MP1A 2DN8A 3CRLC 1O80A 5IIFA 1XX8A 3PIPA 5M3FG 1EY5A 3KLSX 1CKMA 4YHHQ 2VQFL 3GTOH 5CR3A 2OTJA 3J81L 3U50C 2JEAI 1YNND 5C44G 3M4YA 4GOPA 3TSSA 4LWCA 1HNXQ 1PV4A 4M1UB 2EY6A 4KD3A 4A3EB 1W3SA 1YJ9A 2B63B 5LMUL 1OO9B 3MC0B 4QMGA 3BS1A 4FXDA 2K7VA 1STYA 4CKCA 1PHJA 3ITPA 1R4QB 4FXGC 2JA8G 2NWGA 2PMZE 1HJPA 3EVQA 1VQ7A 5CV5A 2EY1A 4CDEC 1C7YA 4X65L 1RL2A 1EY6A 2HIXA 3RD4A 2BDNA 4J8QA 1PXUA 3M85A 2PQAA 3EQLC 2NB0A 3ND9A 1BF4A 1JJCB 1JOKA 2BCOA 2Y0SE 1OXSC 3AU7A 1SMYC 3S15B 3CCJA 3E5SA 4ZKBB 5I4DA 1B50A 1MIUA 4IPDA 3WDNA 3CU7A 1RODA 1SLJA 3HOUH 4A3FG 4IO9A 1A3TA 5CV7A 2ZM6Q 1YEZA 2CWPA 4EGVA 3HOYH 1A63A 4MTKA 4B9XA 4HJ5A 2JYOA 4PV1C 4OO1I 1HZBA 4X3KA 1G6PA 1NE3A 2F0UA 4A3IB 4WJWA 3VR2A 2E2IH 1VQNA 4DNIA 2JA6G 3EBEA 1FNVA 4A3MB 1CFMA 2RCNA 3QOJA 1KLGD 4GN5A 4XQNA 1H9SA 3HOZB 1QILA 3FPPA 1D5MC 2LMCB 2MO0A 3J7YW 4Z9CB 1LLRD 4O1NA 1YNJD 3NE5B 3PMFA 2JA5H 4UP8A 1K8MA 1LT4D 2KHIA 4OXPA 1S5DD 4P72A 4WFN3 5IY0A 1FJGQ 4YY3Q 5GAHC 4DV4Q 4ODGA 4LF6L 3RMHA 4DV5L 1MHWC 1CQFA 2Z1CA 3WWVA 4XXEA 1K3BC 1ZYRC 1EYAA 4DR1L 1PZJD 2NVTH 2B2TC 5IODA 5FLXL 2CQAA 3HS0C 3K6OA 3NQTA 2FMMA 1Y1VH 2K01A 4ME5A 1LTAD 1Q1BA 2A6HD 3OWFA 2NZ1D 1BBWA 4JBMA 1B70B 3NTHA 2VQEL 1HNXL 2Z6BA 3MFYA 2E2HH 3KBXA 3GTJB 3RLFA 3E6ZX 1IW7C 1CI3M 1I3QH 2RDGA 1E24A 1EY9A 1QVGA 3PO3H 4JI2Q 3BZKA 1HZAA 3TP6A 1T9HA 5GROA 3TDQA 3I4MH 3CRKC 5JPNC 4X6AH 4KJNA 1BCPB 3T4AC 4LF8Q 3SXHA 5GAGC 5KYIA 2F4VL 1GXDC 3HOUB 1RIPA 4YCVA 1PFBA 2YYZA 4JW0A 1V1QA 4K8IA 4F8MA 4A3DH 5M3MH 1B4OA 5HY6A 1DZ1A 4DF7A 3I4NG 1A3VA 1Q82C 3HOYB 4UAIA 2F0MA 1X3QA 1EYCA 2LY7A 2K5NA 2K6AA 1LYLA 3H0GH 4PG3A 5BN5A 4RGOS 1PYWD 1KNEA 4A3KH 1JCKB 4LF9Q 2Z6KC 4IQZA 1QWYA 4KJOA 1LTSD 2E2IB 2WB1B 4IUPA 4RKLA 1NCVA 1CA5A 1IYJB 3I4OA 2NVXH 2B2UC 1H9KA 1RCVD 2NVYH 3NUCA 3Q8DA 1Y1WH 3MTSA 2QEXA 3HRZC 2AHOB 1QG7A 2HDLA 2JA5B 2A73B 4FF3A 3TREA 2Z6KA 4IPHA 1WTRA 1BCPC 1EFWA 4A3LH 4IUVA 4HSPA 2XVSA 4PNYA 4DV6L 3OWEB 2F52A 2QDBA 4PQXA 1HQRD 2ZXRA 2Z0SA 4NXML 3AEVA 2QF7A 3IFDA 1STHA 4DR3Q 5IT9L 1NY4A 2NVTB 1D6EC 4DV4L 1D1KA 4DFAA 2BE5D 4B3RL 4NXNQ 3N6RA 2RVLA 4FDBA 1C4QA 4ZQ3A 4X66Q 4RGTA 1V8QA 2UUAQ 3VR5A 4JI1L 4DNTB 3F2CA 3S16H 3H3VH 2Q8RE 2BA0A 5IYCH 2EYFA 4KTAA 4JI0L 2E2HB 3A0JA 4GS3A 3HOVH 1JOOA 3X3MA 4DK3C 1I3QB 3FRPB 5IOCA 3PO3B 5CYUA 1JMCA 1YHQA 1EQRA 2F0WA 3I4MB 3GTGH 1QZGA 3S2DB 2E8GA 1D5ZC 5KEEA 4Y7NB 2A8VA 1L0WA 1PH1A 4HMIA 1V43A 2OXPA 3F1ZA 4HIOA 4JCVE 1N36Q 4GNXA 1YI2A 1OTCA 3FPUB 3TZUA 3DEOA 4A3DB 1FGUA 1PRTB 1YVCA 1E22A 5L37A 2Q2TA 4FVMA 2NN6G 3PO2B 1IBLQ 2UXBL 4I7AA 4YCUA 1X65A 2EYLA 2AQ1B 3H0GB 1SDFA 3H6MA 4DA2A 3HOWH 5M3MG 4RCNA 4A3KB 1VQAA 1PTOH 1BUVT 2R92B 4JI5Q 5M5YH 3G7LA 3U4VA 5IE8A 1LV9A 3FDTA 3BG3A 3V05A 4PMWA 4HJ8A 4B3TQ 3M4OB 4DR5L 1S40A 2DNCA 2WFWA 2OCEA 2NVXB 1K0SA 3K59A 2NVYB 1Y1WB 1KRTA 1TXYA 1BBUA 5K5PA 2TMPA 1NMGA 3KOJA 2FJ2A 5E3FA 4LUZA 4C3IG 2PO4A 4H44C 2B2VC 4A93G 2CCZA 1B3QA 2KENA 1AN8A 2GA4B 5J22A 1WD1A 1C0AA 1TWFH 5ISRA 1N34L 3I90A 1BDOA 3DLLA 2PW7A 4OX9L 5IWAL 4DR2Q 1VQDA 1PRTC 1O7YA 2AQ2B 2MJ8A 4A3BG 4BA2I 3NHHA 2EY5A 4JBJA 4EX5A 3VYUA 3C46A 1GUWA 5C6AA 5T1GA 3RR5A 2XRSD 1I4XA 1G291 1PFMA 2G5DA 4NP5A 2LXJA 3U9OA 3URYA 3L7ZC 3K5MA 3S16B 5IGDA 3K7AH 5HURA 3M4PA 2A1AA 2PMZB 3ULPA 2XSCA 2A6EC 1CA6A 4X62Q 2RSNA 3STBC 3ZYYX 3CF5A 1FNWA 4K2LA 5A35A 1YHBA 2RQXA 5LMNQ 3GTGB 1AZPA 5A2QE 4AQYQ 4PZ8A 5EKKA 3HOVG 1LM0A 3O13A 1XPOA 1UAPA 2Q8IB 2H4OA 4LF7Q 1ONLA 3DM1A 4ME3A 2KQ3A 4DR7Q 1V1OA 1U0LA 3QJYA 2Y0SG 2OT2A 3A56A 3AB9A 2RDHA 4LJZC 1HTPA 2I46A 1HNWL 3MEHA 5ELDA 3DM3A 4NB3A 5CV6A 2D2CC 2R7ZH 1TWCH 1WTHA 3DWQA 1VQ5A 3HOWB 5C4XB 1PTOB 4FNFA 1W6JA 2F3VA 4BY1G 2QEJC 1H9MA 2EY2A 5M5YB 4CGYB 3WOEA 4BBRG 4DV0Q 5DNFA 1F2ZA 3VR6A 5JEAG 1KABA 3VYTA 5ELEA 1ZKOA 3MWYW 1IBLL 3SK5A 3KF6B 3H3VC 4HCSA 2GVAA 1P16A 3GD7A 4H7BA 1VF5C 2IL8A 1PFSA 1Q81C 2BDOA 2KCMA 1CT1D 1WCMB 4JI5L 2B2WC 1IKLA 3SK8A 3BYYB 2I5LX 5C3XA 2B8FA 4JI4L 4B3TL 3TP8A 2UUBL 4P71A 5CBAE 4XYQA 3OOCA 3A8JE 4IFDI 1TWFB 3ERSX 4KY6A 1O7LA 2QKIC 4JK1C 5ELNA 1AP0A 4R9WA 2K75A 4X64L 4RWSC 3M9BA 2K5QA 5EPKA 1K0RA 4LMQD 3DEPA 4DV1L 2JP1A 4APVA 2VQFQ 4KKTA 1EIGA 4OEMB 4DK6C 3T1HQ 2F0TA 1PTOC 1FVIA 1YHAA 4OO1G 3FKIG 1JE4A 4DR2L 4BA1I 4X3SA 2XRQD 2X6LA 1NR2A 3OMCA 2A19A 5LMUQ 5ELBA 2MFIA 4RGNA 1B9MA 1HZ9A 3BDLA 1XTCD 1TWAB 2VL6A 1CQVA 2CW0C 1QVCA 2C35B 4A3JG 2JA8H 2VUMH 2UU9L 2A68D 1MKHA 3PUVA 2CQOA 1GO3E 4X62L 1PZID 2F0DA 1MBYA 3L3OC 3MAQA 5C3EG 2AUKA 3MHBA 4JI7L 5CC4A 3A5UA 4C3HH 4OWWB 1OXTA 4K6LA 1AFPA 3ZJYC 3VA7A 2R7ZB 2N78A 1TWCB 3GQBA 3OYYA 4DV7L 1DOKA 4PZ6A 2SNSA 1CZGA 4A3FH 1VMPA 1ENCA 1EEID 2F3WA 2KCNA 3TN2A 2VS1A 2XIWA 5KNDA 3NTKA 1K8GA 1ASZA 2N88A 1Q7YC 4JG2A 1X56A 1SE4A 3D6CA 1Y69U 2UXCL 2WAQB 3CXCA 2HCIA 4C3JB 3CCMA 1VQLA 2V4DA 1EU3A 2JA6H 1C48A 1CZWA 2J0TD 2K28A 4I7ZC 4JI6L 1Q8KA 4K5VA 3GV6A 2YTVA 4YIJA 1EY7A 3DWPA 2WACA 3NXWA 3Q24A 4A3GG 4DV5Q 2QDLA 4EQ5A 1VQMA 4GN4B 2F0SA 2ZJPA 4IOAA 3FP9A 3QO2A 5M3FB 3HGBA 3UDFA 3PIP3 2G9HD 3S9WA 2N8NA 2PW5A 4C1NK 3CPWA 4DR1Q 4GKKL 4LFBL 1O7IA 1SYBA 4G7OC 1I94Q 2RF4A 1JE5A 1VCIA 5C44B 1I4HA 1K9MC 1D1IA 2ES2A 2F0PA 3FMCA 1EQVA 1HUNA 1VDZA 1RF2D 2QILA 3T1HL 3KBGA 5CORA 5I2XA 5ELFA 2KEEA 3CC4A 1X3GA 4IURA 1IXRA 3SDZA 3TBIB 4F88A 2VQEQ 2JA8B 3TQYA 2F0FA 4PMCA 2PQEA 2KBNA 3RN2A 3S14H 1ZEQX 2H5XA 2Q2HA 3LX0A 4N9TA 5G3LF 4EQPA 1E1TA 3S17H 4LFAL 3RLNA 2VUMG 1SYCA 2IT1A 1YJNA 2ZTCA 2ZJQA 4IUUA 1N33L 1BNZA 4JI3Q 3JAMc 1EWHA 3PUWA 1HA6A 2K04A 1F9PA 3PV0A 3JAME 2F4VQ 1AE3A 3NP8A 1IBKL 4R4TA 4C3HG 4DV3L 5CV8A 2A74C 2ZT9C 4F7XA 5KYLA 4YWKA 2GN5A 4A3FB 1HR0L 1G8ZD 1MI2A 5GAEC 2F0GA 2JA7G 1SYFA 5DLQE 3VR3A 3NSWA 3I4NH 4P2CB 2DGYA 1NSNS 1STEA 1EL0A 4DAPA 3HKZE 3GTKH 5BR8L 2AKWB 2LFNA 1KDAA 2K5DA 1BXTA 2NZHA 5NUCA 1X32A 3C3LA 3OIPA 1PH5A 4K2KA 2ZJRA 2JA6B 1X3EA 1SROA 1AE2A 2XWBB 1XPUA 1SMYD 1WTOA 5JEAJ 4BS9A 2WKCA 2MQHA 4IJLA 2ZTEA 4CBVA 4FXKC 1L2FA 4F87A 2K4KA 3J7A5 2RKSA 4H0LC 4DV6Q 3AFQA 1IL8A 5I2YA 1HCZA 1F77A 1B7YB 1DXMA 4NXMQ 1L0YB 1UUPA 1VQOA 2BOSA 3A55A 3NWSA 3KDFB 3P1HA 2WIIB 4WJ3M 4WORA 1WJJA 1DGSA 1JJGA 2B8GA 2O4XA 2PI2E 3U9SA 5IGEA 2F0HA 4DXGA 4B3RQ 3K0XA 1KL9A 1SNCA 3GTOB 4L5QA 4R4CA 1PH2A 3A7AB 1JICA 5C0XI 1B3AA 1CKNB 1ASYA 4DAYB 3BVZA 4JI1Q 1VS0A 2X69A 1KDBA 4A3MG 3PSIA 4DUYL 5I9PA 1I94L 5DM63 3EN2A 4JI0Q 1U4LA 2HUGA 3CCRA 1PMRA 4KN7C 5E4WC 3S17B 1NBWA 1RKNA 1SRUA 5IYDG 2XNAC 4LF5L 5KGUA 1BKBA 1CSPA 3LNNA 2R7DA 3QR8A 1GD7A 1DM0B 3CW2C 4HTHA 4JBKA 3C1EA 1TS5A 3UDIA 5E7NA 2Q2IA 1N32L 1QUQB 1STGA 4XTCS 5IP9G 2EYOA 4DV2L 5JJLA 2B2TA 1TS3A 1PH8A 1I4GA 4CKEA 3OPOA 1LT3D 3EJIA 2UXBQ 3G48A 4M8AA 3X3NA 2L12A 4A75A 4JI3L 5C4ZA 2OQKA 5LL6X 1DYQA 1SN8A 3J81j 2NN6H 1MGSA 3I4NB 4CJ0B 2EQSA 4AYBB 3IFTA 3CKIB 3NENA 4UP7A 3GTKB 1PYBA 5A2QL 1YNXA 4L6TB 5C0XJ 4DR5Q 1K73C 1K28A 2O5JC 1IW7D 1IL2A 3H91A 4OWTB 3JAMi 4KLKA 3V96A 2EJGC 3D3RA 1VQ8A 2EDGA 5COYA 1ENFA 2K5HA 2TSSA 2E74C 3K80C 4OL7A 4B3SQ 3ULLA 4AIMA 1OXUA 2EJFC 1D2BA 2FXQA 1L1OB 4C3IH 1N34Q 3I4LA 2ZTDA 4A93H 4NKLA 2N55A 1S5FD 5FJ8H 3EIVA 1CHQD 4OX9Q 4B3ML 3J7AF 5IWAQ 3UE1A 2ZXOA 1CK1A 1EFID 1NTGA 3VA5A 1SYEA 1JB7A 4A3BH 4OELB 2JXMB 2K52A 3NBHB 4IPCA 4KY7A 1E1OA 5GADC 3OW7A 2B2UA 5LL6S 4IPGA 4ABNA 1GHJA 2LSSA 3I56A 1S5CD 4Y52H 4GKJL 4R8NA 1Y1VB 4QB4A 3S2HH 2BH2A 4FF2A 1GUNA 1XNRQ 1BCPD 2ID0A 4FO2A 4IFDG 1V1PB 3J80c 5BN3A 2FMCA 2KCTA 2RBMA 1HZCA 3J80E 4QQBX 4IUQA 3R2TA 4CJ1B 1O78A 1L1OC 3R93A 3DHQA 1S4ZA 1MSGA 4K0KL 1NJIC 4HEDA 2FINB 2R93G 4N8FA 3CCQA 3I55A 2LS01 1HNWQ 5J3BA 4G57A 1SNQA 4I65A 3TZDA 4UY8C 4YWMA 5FLMG 3DUZA 1QNKA 4NDXA 4TVAB 1KLUD 3K7UC 3T56B 3MA2B 1VQPA 4LF4L 2JEBI 1WD0A 5M3MB 1B2TA 4GN3B 1Y14B 4BY1H 4RH6A 1FNUA 4BBRH 4GLAC 2EYHA 2HD3A 5JEAH 1EY0A 4HIMA 3GTQH 1EIHA 1J5EL 2PZWA 2HQLA 2KCCA 1IHZA 2SOBA 3S24A 1D5XC 5EKIA 3K57A 3UI2A 1X3PA 4L63B 3SR1A 3S1RH 3TP5A 4JI4Q 1SYGA 2UUBQ 2KA7A 3RZDH 1H9RA 3PF4A 2MNAA 3L9AX 2D0OA 4A3CH 1EOTA 1SFOH 3G6JB 3P7JA 4A93B 1G2TA 1QNUA 1JORA 2VB2X 4X64Q 5JJKA 1HHVA 3KLWA 1I4QA 3EA6A 2VY3A 2F0VA 1U4PA 4B3SL 1PYSB 2HIVA 3AQQA 4DV1Q 5FJ8G 1NMFA 3RLOA 4O42A 5H1SE 2R92G 1IYUA 3A74A 4A3BB 1E2ZA 3LWUA 1Q8IA 1CTMA 3OTOL 3GTLH 2EYPA 3IL8A 3CMAA 4J15A 1PLFA 1VQJA 1E7ZA 1WTWA 4HJ9A 1DCZA 1HPCA 3QOLA 4R4IA 2KOLA 1N9WA 2CH4A 4G7ZC 1VQFA 3QG1A 4OO1H 1SEBD 3FKIH 1B1ZA 1JWSD 1Y8PB 2G9DA 2AMCB 2B2VA 2VXWA 4HIKA 3S2HB 3MXUA 1EUJA 5ELOA 5IYBG 4HMJA 2YU9H 4ULLA 3I91A 5CV4A 3HG9A 3R8BA 2UU9Q 3DWAA 4JV5Q 3I70A 2JSOA 1WTXA 1EZ6A 3CCLA 4A3JH 3IRBA 3F2UA 3HOVB 2YTXA 5EGTA 1H9JA 1PRTD 4JI7Q 5JVG3 1RDPD 1SBBB 2EZVA 1XNQL 3SK4A 1EOVA 4IZ8A 1XNRL 5IGBA 1EEFD 2ALYB 3T13A 1UE1A 5C3EH 2Y0SB 2NZOA 1R4PB 4DV7Q 2LKVA 1QB5D 1GJXA 1VQHA 5C0XH 3AFPA 1HXYD 2OTLA 4QCLA 4C56C 5LHY1 2KECA 2JN4A 1JT8A 1BOSA 4BY1B 2A6ED 1IZ6A 4BBRB 3STBD 1Q3LA 3A5ZB 1ICFB 1FR3A 5T1IA 2AQ3B 3J80i 4J6HA 2EIFA 4DUZL 5GQOA 2DUDA 2E2DC 3D4WA 4QIWE 1XTDA 1BBXC 1PH4A 2UXCQ 3S1RB 3B6YA 3HKZG 1FL0A 4LW1A 2RHSB 3WOFA 3JAML 4XQJA 3HOXG 5FKAC 1VQCA 1SFOB 2IX1A 3LGJA 4JI6Q 3AYHB 4WRDA 1GKHA 1W2BA 1IBML 2F0KA 2ICEC 2DJFC 4A3CG 4DK0A 3UE0A 1W6KA 4BBSG 1SJED 1AZQA 3G71A 5EPJA 5J1ZA 2UUCQ 1NR4A 3GTLB 5CGKA 4A3GH 2FFKB 4GKKQ 2K03A 4KKUA 4LFBQ 2AWNA 1ESFA 4X3UA 2VZAA 3CP0A 1TT2A 2B2WA 3FKIB 4K8JA 2CKZB 2L5TA 2EJMA 2WB1E 2AUJD 4ID6A 5D3DA 1WOCA 1EY8A 1J8IA 3K7AB 1A62A 3F8TA 4HCEA 5EBDA 3BZCA 4IUNA 3CCVA 4A3JB 1HNZL 3K5NA 4P73A 4LFAQ 3KUPA 2A68C 4LFCL 4KHPL 1BO0A 1N33Q 1CKOA 2F0IA 1QOHA 3HZXA 2E75C 5C3EB 1XPRA 1HQMC 3HFZB 4JV5L 1D8LA 1NUCA 1F2MA 1IBKQ 3V2TA 2FHTA 1PTOD 2N3SA 4DV3Q 1GUSA 1LTLA 5M5WH 4EQNA 1F9QA 3KF6A 4C1NI 1HFNA 4IFDJ 1HR0Q 5DM73 1LO5D 1NNXA 1SNDA 2M9VA 1BVSA 3FEWX 1KRSA 2JQOA 3VDYA 5C0XG 3S1NH 2DNEA 1KDCA 2BH8A 4TSSA 4A3EH 3LWEA 4JI8L 2JA7H 2A69C 1VF7A 2ATWA 4RFBA 1QCBD 2CW0D 2D9UA 3ONAB 4RKBA 4JBWA 1HUMA 1KC8C 4DN4M 5BR8Q 4HSVA 4DNRB 1A2TA 1TWHH 4POFA 5KNBA 1TVXA 2KJXA 3OSOA 3CC2A 2VW9A 1WI5A 3HEJA 4JYAL 1SNPA 1EIFA 1LTTD 1EZ8A 3MVVA 2PNRC 4A4IA 1WTVA 5IGFA 2HQEA 3D8GA 1Z9FA 4QL5A 3T1YQ 3IKJA 2K14A 2OEOA 3CCEA 2CWAA 1BQQT 1GUOA 3F2BA 2IJ0A 2L0CA 2L55A 4A3GB 2EXZA 1RD9D 3Q0AA 3T51B 1EYDA 1U9RA 3OMGA 1FYCA 1STBA 1TWGH 4ZAIA 2D0PA 1Q46A 3A7LA 4G4KA 4NMZA 4BY7G 5I6WA 4JOIC 4RHRA 1J9OA 1EWCA 1SNMA 4MHEA 1VQ6A 1S5BD 2R61A 3DMUA 4KI0A 4JVZA 3T16A 4ILWA 3K58A 3BJUA 1YIJA 2UUCL 2Z8LA 1GUTA 4FF4A 2K05A 3MXPA 2WAQG 4HR7B 4G7HC 4B08A 4A3IH 4AH6A 5K36G 4DUYQ 1XMOL 3JC66 1ESRA 1PFNA 1PDQA 4RAUC 1YNNC 2MO1A 4A3MH 4ZUJA 4DR4Q 4QUCA 1STAA 1TKWB 1Z47A 4LF5Q 5JPMC 1U5KA 5JJZA 3NELA 1EIYB 1TU2B 5FO7B 1WYDA 1LUZA 5IYDH 5CMDA 2DY8A 1XMQL 2VUMB 2VNUD 3CC7A 1N32Q 1NAPA 2K1BA 2KEDA 1PA6A 4C2MH 5EQ0A 4DV2Q 2F0QA 5HGQA 5M5WB 3BDCA 2RHQB 3I72A 1H9SB 4HIDA 1GM5A 3PF5A 4NW2A 4C3HB 5IP9H 3KK7A 1PH6A 3S1NB 4ZYSA 1X54A 1A2UA 1LABA 4Q0FA 4L5SA 2JA7B 5JVH3 2F4IA 3TRZA 2E76C 1LT6D 1LTBD 1KHIA 1O7ZA 2IPKD 5KNCA 4A3EG 2I5MX 3NBIA 1TWHB 2NTTA 2B63G 4WJ4A 3PIO3 1DONA 3DXJC 3J80L 3C1FA 1DOMA 4POGA 2HHHQ 3PUYA 3G6EA 1VQ9A 2QW7A 3PIOA 3GTJH 4MTNA 5JOBA 1SE2A 2WINB 3C2PA 4H02A 3I7FA 5J39A 1QZHA 1WTPA 1QE6A 2I07B 3K81C 4DGZA 1EQQA 1JWMD 1Q90A 2V1CC 4MIUA 5C4HA 5E1FA 2O2LD 1TIID 1ZXTA 2N49A 1G91A 3BVGA 2IW3A 4B3MQ 2L11A 5M5XH 4OGQC 1K83H 1M4VA 1AEXA 3R3OA 2YV5A 3KFUA 1CUKA 1TWGB 5F2DA 3T1YL 3Q23A 1YNJC 1Q12A 2EE1A 4BXXG 4P74A 2A5HA 2E5LL 2R6GA 3H15A 2M2LA 4CKBA 4GLVB 4N8X1 1FGBD 4L5RC 1N8RC 5IGGA 5AJ3L 3M4QA 2K5VA 4KHVA 4GKJQ 1LT5D 4H13C 1KXLA 2HDMA 4A3IG 1S5ED 3UDGA 4U673 1F2YA 1UWVA 1YZ6A 3PQIA 5C3WA 4UP9A 4RCOA 3KF8B 5EKLA 1MJCA 1HRJA 3CQZH 3PGZA 3HOZG 2CH4W 4UHVA 4LAAA 2A6HC 2SEBD 1UNSA 4LK1C 2UXDQ 1STNA 2IX0A 1VQGA 2B3GA 2RSOA 3P20A 4IFDH 3S14B 2YTYA 4DR4L 4C2MB 4K0KQ 3NPPA 4OIKA 1ILPA 1ML0D 3GDEA 3W3AA 3RNUA 2IHEA 1VQBA 2EYJA 1CHPD 4OWXB 1SR3A 2L1BA 2R93H 3AMUA 2HT1A 2SDFA 4KD4A 1PVOA 4N9PA 4TKOB 4LUVA 1IKMA 3KLRA 3W5OA 2J4XA 2O5IC 1ZYRD 4J1MA 4HJAA 2DY7A 4LF4Q 4TRDA 3SGIA 5FLMH 4YHHL 2F0OA 1Q86C 4JPBW 3D0FA 5BN4A 4Q5VA 1HTLD 1SE3A 1WFQA 1UEBA 1Z7TA 3KJPA 4CDCC 2X6GA 4GLXA 4QIWB 4X3TA 2EYMA 4R8IA 1J5EQ 2D62A 1F2LA 1M8AA 1KNAA 4KK7A 5CV9A 3MZ5A 5CBEE 1VQ4A 2F0LA 1SNOA 3NTIA 2PCFB 1B9NA 1SJHD 3E0JA 3U4ZA 3S2DH 4IALA 4Y7NH 1Z6HA 5KRUA 4FF1A 3KDFA 1IYVA 2XTIA 2HHHL 3KLSA 3ERQA 1I6VC 1PH3A 4K5XA 5M5XB 4L8JA 1K83B 2I5HA 1SMXA 4HJ7A 1H95A 1K3RA 3PO2H 3MFGA 1TY0A 1EU4A 2HCCA 3L2PA 1CKNA 3HOUG 4QJFA 4IN3A 4AYBG 5D65A 3HP3A 4DAYA 3QB3A 2RCFA 3GTPH 3PUZA 3KF8A 3OTOQ 2PZUA 3M3YH 3HOYG 2R92H 1TS2A 3GTMH 1OXVA 2ZM6L 1DD2A 4GNXB 1XJVA 3H94A 1VMCA 3M4OH 1HH2P 2KUMA 4RGMA 4TQUS 3N52A 3I2ZA 2WB1G 3J81c 3M7GA 2WAQE 3D4DA 2EXDA 2BE5C 1X3FA 4RG1A 3J81E 1V9PA 4DAMA 1X6OA 1K8OA 3CQZB 1GUGA 1QUQA 4K5WA 2B2YC 1KAAA 1F9RA 3SHLA 5IYBH 2Z9HA 1G2SA 1ET9A 2JE6I 4YCWA 2EPBA 3A8KE 1ILQA 1I6HH 1QVFA 2JA5G 3QWNA 5C4JH 1XNQQ 2BA1A 4KY5A 3E0EA 5D3IB 5FK9C 2F0NA 2R3ZA 4IJHA 2R93B 1FJGL 4DPGA 4OHJA 5E4XA 2UXDL 3SK6A 4YY3L 3H09A 4DR6Q 2AWOA 2B2YA 1WTQA 4DK1A 5IP7H 3SE0A 1S3OA 1X55A 1SXTA 2QGQA 4OIJA 1JB3A 3RUZA 4DXFA 4CHTB 3CHBD 2NBFA 2OF1A 1LTGD 2OQ0A 4R4OA 4XYOA 3PUXA 3VYRA 4XT3B 1HFGA 4GNXC 3L0OA 3K0YA 2K32A 1Y1VG 2WP8J 1SE8A 4DUZQ 4YWLA 1UE5A 4KV6A 3OHXC 5HGTA 3RZOH 4HAEA 2NUCA 1L1OA 1B53A 2GVBA 3CCSA 1AH9A 1U4RA 1M90C 2K33A 3NWTA 2OWOA 3PO3G 1BCPF 2NYZD 3I4MG 5JJIA 2LXKA 3HOXH 1IBMQ 4KN4C 3D31A 2Z4IA 4JI2L 1UEAB 4L5TA 1SSOA 4QUFA 1GOZA 2NVQH 3NBHA 3ND8A 4C3IB 1C8CA 3SEBA 4LF8L 4K6DA 3GTPB 4A3DG 4BBSH 3K5LA 2ZXPA 3PO2G 1A0IA 2EOTA 4HN7A 1UE7A 5C4XH 3M3YB 5FOBB 4ZKCB 5LMNW 2JJQA 3GTMB 4XIGS 1C9OA 1AW7A 3H0GG 2C9OA 4A3KG 2KVMA 3FVQA 5EAYA 1A15A 5C5LA 2PNHA 1V1PA 2L9HA 1Y8OB 4ZCKA 1I50H 4LF9L 1JOQA 3GV3A 1WCMH 1CSQA 4K14A 4PZ7A 3EROA 1RJTA 1Y1WG 5FLXc 4ALPA 2XN9C 1KD1C 1HNZQ 1HA5A 1D7QA 5FLXE 4R1JA 5D14A 4V0BA 1KAWA 1VQEA 4O0AA 1I6HB 1B8AA 4LFCQ 4KHPQ 1B44D 4XQQA 5C4JB 2IHFA 2VB3X 3PCOB 1KQSA 4A3LG 1T5EA 1PH9A 1JJ2A 3ICEA 5EPLA 5I6YA 1YBYA 2KHJA 2NTSA 1A6XA 1FD7D 4CDFC 4EVOA 2XGTA 1E3PA 4FP5D 1E2VA 1G6ZA 3D6WA 1T5XD 3J7ZC 1Y8NB 2F1MA 2CFMA 3J81i 3W1BA 4DR3L 2ENBA 3GO5A 3TS2A 5IGCA 5IP7G 4JI8Q 5M9OA 3MXNB 4DR6L 3NQIA 3E3XA 4RHSA 2J7ZA 3P75A 2E2JH 1DOLA 3RZOB 1EQTA 3T53B 1TWAH 4NXNL 5IYCG 4X66L 1XXGA 3NK9A 2PPBC 2UUAL 1P8LA 2EVBA 5FO8B 2H1EA 3GTQB 3VYSA 2MGSA 3HKZB 2PZTA 3KJOA 3I8ZA 4QY7A 4JYAQ 1R9TH 1RTOA 1U4MA 3R2IA 3FHWA 1QJOA 3E9IA 3TMEA 3A8IE 4JC0A 3HOXB 1RHPA 3MEFA 4RMFA 3RZDB 2NVQB 2I0QA 5TSSA 1JC7A 1PRTF 2SNMA 4P75A 3UDXA 5ELCA 4DAVA 2L4NA 4QGUA 4U68A 1N36L 3CD6A 1ICWA 2B39A 5EJWA 3W1GA 4BBSB 3D4RA 1A8VA 2MPMA 3OIQA 4MN3A 3BU2A 2R7FA 2F3IA 1J6QA 1EY4A 4S3SA 4AYBE 4LNQA 3CCUA 4IUTA 1ET6A 3HOWG 3G4SA 1PH7A 5C4XG 1TS4A 1I4PA 3S1QH 3I3CA 2B29A 4BY7H 1VQIA 4A76A 1I50B 5IT9c 2QA4A 1XMOQ 4ZUIA 4V190 1HR0W 5IT9E 1MD2D 1XWEA 4NPSA 1UE6A 2QCPX 2PYKA 4C3JH 5K36H 4XT1B 3J7AV 3QIAA
chains in the Genus database with same CATH topology
2UXBQ 1WCMG 3G48A 2VNUD 3CC7A 4JI5Q 1N32Q 5M5YH 4A75A 3U4VA 5IE8A 1X9NA 4JI3L 1PA6A 1VQKA 2L15A 4R4QA 2OQKA 4PMWA 4C2MH 4DV2Q 1SN8A 3J81j 3M7NA 3S1MH 5HGQA 4HJ8A 4B3TQ 1XMQQ 2EQSA 2RHQB 4DR5L 4HIDA 1S40A 2WFWA 3HKSA 2OCEA 3PF5A 1GM5A 5IP9H 3K8AA 3NENA 4UP7A 1PH6A 1KRTA 1TXYA 1PYBA 1BBUA 1YNXA 1X54A 5C0XJ 1NMGA 4DR5Q 1K73C 3KOJA 4L5SA 4LUZA 5M3FH 1IL2A 3TRZA 4OWTB 3JAMi 4A93G 4KLKA 1KHIA 2CCZA 2KENA 4A3EG 1C0AA 2I5MX 1TWFH 2B63G 1VQ8A 1N34L 4WJ4A 5C44H 2NN6I 2K5HA 3K80C 4B3SQ 3DLLA 4KHZA 3ULLA 4POGA 4OX9L 4AIMA 2HHHQ 1OXUA 3PUYA 1VQDA 5IWAL 3G6EA 4DR2Q 2FXQA 1VQ9A 3PIOA 3GTJH 4MTNA 1L1OB 4C3IH 3F2DA 4A3BG 1N34Q 4BA2I 4H02A 2ZTDA 3I7FA 4UPAA 4JBJA 4X65Q 4A93H 1QZHA 4EX5A 5FJ8H 3EIVA 4OX9Q 4B3ML 3K81C 5IWAQ 1EQQA 2B63H 2V1CC 3ER0A 4MNOA 3CPFA 3RR5A 1G291 3UE1A 2LXJA 1KIXA 3L7ZC 3NEMA 1NTGA 2JA9A 2N49A 1JB7A 4B3MQ 3K7AH 5M5XH 4A3BH 1YITA 1K83H 1M1KC 5LMNL 3M4PA 2A1AA 3ULPA 2K52A 4IPCA 3NBHB 2YV5A 2PI2A 1E1OA 4X62Q 5GADC 1CUKA 4AQYL 3KFUA 3STBC 3T1YL 3CF5A 4IPGA 1YJWA 4GOPB 1Q12A 4LF7L 4BXXG 4P74A 1I5FA 2LSSA 1YHBA 3I56A 1Q1EA 1MJEA 5LMNQ 3CAMA 2E5LL 2IY5B 4DR7L 2R6GA 4Y52H 4AQYQ 4PZ8A 3HOVG 1LM0A 3H15A 4GKJL 4LUOA 1XPOA 3E9HA 3S15H 4LF7Q 1EWIA 4GLVB 1K8AC 2Q2UA 4OONA 2BH2A 2R7ZG 3S2HH 3ULJA 4ME3A 4L5RC 1N8RC 2E5LQ 1GVPA 1XNRQ 4DR7Q 1U0LA 2ID0A 5AJ3L 3M4QA 2K5VA 4IFDG 4GKJQ 3J80c 4BXXH 2Y0SG 4A3IG 1KXLA 2JK8A 2KCTA 4MZ9A 1HZCA 2PQAB 4DKAC 3UDGA 3U58A 4QQBX 1HNWL 1UWVA 1YZ6A 2ASBA 4UP9A 1L1OC 4DV0L 3KF8B 1MJCA 5AJ3Q 3DM3A 3CQZH 3CMEA 3PGZA 4NB3A 3TEHB 2R7ZH 3HOZG 1NJIC 1TWCH 1VQ5A 4K0KL 2R93G 3CCQA 3I55A 3OW2A 4BY1G 1HNWQ 2UXDQ 5J3BA 2IX0A 1VQGA 2B3GA 1EYGA 4BBRG 4DV0Q 2YTYA 4DR4L 5JEAG 4UY8C 4YWMA 5FLMG 4K0KQ 1IBLL 4TVAB 1OXXK 3K7UC 3KF6B 4IOCA 2K50A 3GDEA 3RNUA 2IHEA 1VQBA 2GVAA 3H3VI 1P16A 3GD7A 1VQPA 4LF4L 2JEBI 4OWXB 4LF6Q 3HOZH 1SR3A 3RN5A 1PFSA 2R93H 1G51A 1Q81C 2HT1A 1PVOA 4GN3B 2KCMA 1Y14B 4O2DA 4JI5L 4LUVA 4GOPC 4BY1H 3W5OA 2I5LX 4JOIA 4BBRH 4GLAC 4HJAA 4HIMA 3GTQH 3KYHC 4JI4L 4LF4Q 3SGIA 5FLMH 4YHHL 3TS0A 1S72A 4B3TL 2UUBL 4P71A 1Q86C 1J5EL 2HQLA 3S24A 3D0FA 4IFDI 3PIPA 3ERSX 5M3FG 1WFQA 1UEBA 3KJPA 3S1RH 4JI4Q 1CKMA 4YHHQ 4GLXA 2VQFL 2UUBQ 1J5EQ 5ELNA 3GTOH 2K75A 4X64L 3RZDH 2OTJA 2D62A 3M9BA 3PF4A 2MNAA 3U50C 2JEAI 2D0OA 1VQ4A 4A3CH 5C44G 1SFOH 1K0RA 4GOPA 4LWCA 4DV1L 4APVA 2VQFQ 1HNXQ 1PV4A 4X64Q 5JJKA 3U4ZA 3S2DH 1W3SA 1YJ9A 4DK6C 4Y7NH 5LMUL 3KLWA 3T1HQ 2VY3A 1FVIA 1YHAA 4B3SL 3KDFA 4OO1G 3FKIG 1PYSB 2XTIA 2HIVA 4DR2L 3AQQA 1PHJA 4DV1Q 5FJ8G 2HHHL 2JA8G 2PMZE 1HJPA 1NMFA 3RLOA 4BA1I 5H1SE 1PH3A 2R92G 1N36Q 2A19A 3A74A 1VQ7A 5LMUQ 2I5HA 2MFIA 3OTOL 3GTLH 1C7YA 4X65L 1RL2A 3CMAA 1SMXA 4J15A 4HJ7A 1H95A 1VQJA 1E7ZA 2HIXA 1K3RA 3PO2H 1HZ9A 3M85A 3L2PA 1CKNA 2PQAA 3HOUG 4QJFA 4HJ9A 4AYBG 2VL6A 4R4IA 1N9WA 3GTPH 1VQFA 3PUZA 3OTOQ 1QVCA 1JJCB 3FKIH 2C35B 4A3JG 2Y0SE 1OXSC 2JA8H 2VUMH 2UU9L 3M3YH 3HOYG 2R92H 2AMCB 1MKHA 3CCJA 4HIKA 3PUVA 1OXVA 2CQOA 3GTMH 1MIUA 4IPDA 1EUJA 1GO3E 5ELOA 5IYBG 4X62L 2ZM6L 4GNXB 1XJVA 2YU9H 5C3EG 1SLJA 3HOUH 3M4OH 2UU9Q 1HH2P 4JI7L 4A3FG 4JV5Q 3A5UA 4IO9A 3CCLA 4TQUS 4C3HH 4OWWB 1OXTA 3I2ZA 2WB1G 3J81c 2ZM6Q 4A3JH 1YEZA 2WAQE 2CWPA 3IRBA 2YTXA 2EXDA 3HOYH 1X3FA 4RG1A 3ZJYC 1V9PA 4DAMA 1X6OA 1A63A 1QUQA 4HJ5A 2N78A 4JI7Q 3OYYA 1XNQL 5IYBH 4DV7L 4OO1I 1EOVA 1HZBA 1XNRL 4PZ6A 2ALYB 1UE1A 5C3EH 1G6PA 2JE6I 4YCWA 4A3FH 1NE3A 2NZOA 1I6HH 2E2IH 2JA5G 1QVFA 5C4JH 1VQNA 1XNQQ 4DV7Q 2BA1A 4DNIA 3E0EA 2JA6G 3EBEA 1VQHA 2VS1A 4IJHA 2RCNA 3AFPA 2OTLA 1K8GA 4GN5A 1ASZA 1Q7YC 4JG2A 1FJGL 4DPGA 1JT8A 2UXDL 4YY3L 1X56A 2MO0A 4DR6Q 1IZ6A 2AWOA 3STBD 2UXCL 3CXCA 3CCMA 5IP7H 3A5ZB 1S3OA 1VQLA 4UP8A 1X55A 2JA5H 3J80i 2QGQA 2KHIA 2EIFA 4OXPA 4P72A 4DUZL 5IY0A 1FJGQ 2JA6H 4YY3Q 5GQOA 4R4OA 2DUDA 2OQ0A 4QIWE 3PUXA 1XTDA 5GAHC 4DV4Q 4LF6L 1PH4A 2UXCQ 4GNXC 3L0OA 4JI6L 3B6YA 1Q8KA 1FL0A 3HKZG 4DV5L 5K36G 4LW1A 2RHSB 1Y1VG 2YTVA 2WP8J 1SE8A 4DUZQ 3WWVA 4YWLA 3HOXG 1UE5A 3RZOH 1VQCA 2IX1A 3LGJA 4DR1L 4JI6Q 3AYHB 4A3GG 4DV5Q 1L1OA 4EQ5A 1GKHA 1VQMA 2GVBA 4GN4B 2ZJPA 3CCSA 2NVTH 1AH9A 1W2BA 1IBML 3FP9A 3UDFA 3HOWG 4A3CG 1M90C 2N8NA 3CPWA 2OWOA 4DR1Q 3PO3G 4GKKL 1Y1VH 1O7IA 3UE0A 4LFBL 4BBSG 3G71A 1Q1BA 1I94Q 3I4MG 5JJIA 2LXKA 3HOXH 1IBMQ 2RF4A 1JE5A 1BBWA 1VCIA 3D31A 2UUCQ 1K9MC 2ES2A 4JI2L 4JBMA 4A3GH 1B70B 4L5TA 2VQEL 1HNXL 4GKKQ 4LFBQ 2AWNA 2NVQH 2E2HH 3T1HL 3RLFA 2VZAA 1I3QH 1E24A 4LF8L 3CP0A 1QVGA 3PO3H 4JI2Q 3CC4A 1X3GA 4A3DG 3BZKA 4BBSH 1HZAA 1IXRA 1T9HA 2VQEQ 2CKZB 5GROA 3I4MH 1A0IA 3TQYA 5C4XH 1UE7A 2WB1E 3PO2G 4X6AH 5LMNW 2JJQA 2KBNA 3RN2A 3S14H 2Q2HA 2H5XA 4LF8Q 4XIGS 3S17H 1C9OA 3H0GG 1E1TA 4LFAL 3RLNA 5GAGC 4A3KG 1WOCA 2F4VL 2VUMG 1RIPA 2IT1A 1YJNA 2ZTCA 4YCVA 5EAYA 1A62A 2YYZA 3F8TA 2ZJQA 2PNHA 1V1QA 1N33L 3BZCA 4A3DH 3CCVA 3JAMc 1HNZL 4JI3Q 3PUWA 5M3MH 4P73A 1I50H 5HY6A 4LFAQ 4LF9L 3PV0A 1Q82C 3I4NG 2F4VQ 1WCMH 1AE3A 1CSQA 4PZ7A 4LFCL 1IBKL 4KHPL 4R4TA 4DV3L 2K5NA 1CKOA 1Y1WG 1N33Q 1LYLA 3H0GH 4PG3A 5FLXc 4ALPA 1KD1C 1HNZQ 1XPRA 4A3KH 4YWKA 1D7QA 4R1JA 2GN5A 3HFZB 4LF9Q 4JV5L 2Z6KC 1D8LA 1KAWA 1VQEA 1HR0L 4O0AA 1B8AA 5GAEC 1IBKQ 4LFCQ 2JA7G 4KHPQ 5DLQE 2N3SA 4DV3Q 1LTLA 2IHFA 5M5WH 3I4NH 3PCOB 1KQSA 4A3LG 2DGYA 1IYJB 1PH9A 1JJ2A 3ICEA 3KF6A 1YBYA 2KHJA 3I4OA 2NVXH 1HR0Q 4IFDJ 2NVYH 1Y1WH 3Q8DA 2QEXA 1BVSA 3HKZE 1KRSA 2JQOA 2XGTA 2AHOB 5BR8L 3VDYA 5C0XG 3GTKH 3S1NH 2AKWB 2BH8A 1E3PA 4A3EH 4JI8L 2NZHA 2JA7H 2ATWA 3J7ZC 3TREA 1PH5A 2ZJRA 2Z6KA 4IPHA 4JBWA 2CFMA 1EFWA 3J81i 1KC8C 4A3LH 1X3EA 3W1BA 5BR8Q 4DR3L 1SROA 1AE2A 3GO5A 1XPUA 3TS2A 4DV6L 5IP7G 2F52A 1TWHH 4JI8Q 5JEAJ 4POFA 3MXNB 2MQHA 4IJLA 2Z0SA 4NXML 2ZTEA 4DR6L 3AEVA 1L2FA 2K4KA 4DR3Q 2VW9A 1WI5A 2E2JH 3CC2A 3J7A5 1NY4A 4DV6Q 4JYAL 1TWAH 4NXNL 5IYCG 3AFQA 1EIFA 4X66L 1B7YB 4NXMQ 4DV4L 1P8LA 2UUAL 4A4IA 1VQOA 1Z9FA 4QL5A 3T1YQ 4B3RL 3KDFB 3KJOA 2K14A 4JYAQ 4QY7A 4WJ3M 1R9TH 4NXNQ 1WJJA 3FHWA 2CWAA 3CCEA 4FDBA 1DGSA 3E9IA 3F2BA 4X66Q 1JJGA 2PI2E 4JC0A 2UUAQ 4JI1L 3F2CA 3S16H 3H3VH 2BA0A 4B3RQ 5IYCH 3K0XA 3MEFA 1KL9A 4L5QA 4RMFA 4R4CA 1PH2A 5C0XI 2I0QA 4JI0L 1CKNB 3A0JA 4GS3A 1ASYA 1TWGH 4DAYB 3HOVH 2D0PA 1Q46A 4P75A 3UDXA 4BY7G 4JI1Q 1VS0A 4DK3C 4A3MG 4QGUA 4JOIC 1N36L 3PSIA 1JMCA 3W1GA 4DUYL 1EQRA 1YHQA 1I94L 3CD6A 1VQ6A 3GTGH 3EN2A 1A8VA 4KI0A 1QZGA 2E8GA 4JI0Q 3BJUA 1YIJA 3BU2A 2UUCL 3CCRA 2A8VA 2R7FA 2F3IA 1L0WA 1PH1A 1J6QA 4AYBE 4LNQA 4A3IH 2WAQG 3CCUA 1V43A 4HIOA 3F1ZA 1NBWA 4JCVE 4AH6A 1SRUA 5IYDG 4DUYQ 3JC66 3G4SA 1XMOL 4GNXA 1YI2A 1PH7A 1OTCA 4LF5L 5C4XG 1BKBA 1CSPA 3S1QH 4BY7H 2B29A 2R7DA 1VQIA 2MO1A 1GD7A 3CW2C 4A3MH 4JBKA 4A76A 1FGUA 4DR4Q 1YVCA 1E22A 2Q2TA 2NN6G 3UDIA 5E7NA 5IT9c 2QA4A 2Q2IA 1XMOQ 1IBLQ 2UXBL 1Z47A 4LF5Q 1HR0W 1N32L 1QUQB 4YCUA 1X65A 1U5KA 4XTCS 5IP9G 3NELA 1EIYB 5JJLA 4DV2L 4NPSA 1PH8A 1UE6A 1LUZA 1WYDA 4C3JH 3HOWH 5M3MG 5IYDH 1XMQL 1VQAA 4IOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB Q;  1WCM G;  3G48 A;  2VNU D;  3CC7 A;  4JI5 Q;  1N32 Q;  5M5Y H;  4A75 A;  3U4V A;  5IE8 A;  1X9N A;  4JI3 L;  1PA6 A;  1VQK A;  2L15 A;  4R4Q A;  2OQK A;  4PMW A;  4C2M H;  4DV2 Q;  1SN8 A;  3J81 j;  3M7N A;  3S1M H;  5HGQ A;  4HJ8 A;  4B3T Q;  1XMQ Q;  2EQS A;  2RHQ B;  4DR5 L;  4HID A;  1S40 A;  2WFW A;  3HKS A;  2OCE A;  3PF5 A;  1GM5 A;  5IP9 H;  3K8A A;  3NEN A;  4UP7 A;  1PH6 A;  1KRT A;  1TXY A;  1PYB A;  1BBU A;  1YNX A;  1X54 A;  5C0X J;  1NMG A;  4DR5 Q;  1K73 C;  3KOJ A;  4L5S A;  4LUZ A;  5M3F H;  1IL2 A;  3TRZ A;  4OWT B;  3JAM i;  4A93 G;  4KLK A;  1KHI A;  2CCZ A;  2KEN A;  4A3E G;  1C0A A;  2I5M X;  1TWF H;  2B63 G;  1VQ8 A;  1N34 L;  4WJ4 A;  5C44 H;  2NN6 I;  2K5H A;  3K80 C;  4B3S Q;  3DLL A;  4KHZ A;  3ULL A;  4POG A;  4OX9 L;  4AIM A;  2HHH Q;  1OXU A;  3PUY A;  1VQD A;  5IWA L;  3G6E A;  4DR2 Q;  2FXQ A;  1VQ9 A;  3PIO A;  3GTJ H;  4MTN A;  1L1O B;  4C3I H;  3F2D A;  4A3B G;  1N34 Q;  4BA2 I;  4H02 A;  2ZTD A;  3I7F A;  4UPA A;  4JBJ A;  4X65 Q;  4A93 H;  1QZH A;  4EX5 A;  5FJ8 H;  3EIV A;  4OX9 Q;  4B3M L;  3K81 C;  5IWA Q;  1EQQ A;  2B63 H;  2V1C C;  3ER0 A;  4MNO A;  3CPF A;  3RR5 A;  1G29 1;  3UE1 A;  2LXJ A;  1KIX A;  3L7Z C;  3NEM A;  1NTG A;  2JA9 A;  2N49 A;  1JB7 A;  4B3M Q;  3K7A H;  5M5X H;  4A3B H;  1YIT A;  1K83 H;  1M1K C;  5LMN L;  3M4P A;  2A1A A;  3ULP A;  2K52 A;  4IPC A;  3NBH B;  2YV5 A;  2PI2 A;  1E1O A;  4X62 Q;  5GAD C;  1CUK A;  4AQY L;  3KFU A;  3STB C;  3T1Y L;  3CF5 A;  4IPG A;  1YJW A;  4GOP B;  1Q12 A;  4LF7 L;  4BXX G;  4P74 A;  1I5F A;  2LSS A;  1YHB A;  3I56 A;  1Q1E A;  1MJE A;  5LMN Q;  3CAM A;  2E5L L;  2IY5 B;  4DR7 L;  2R6G A;  4Y52 H;  4AQY Q;  4PZ8 A;  3HOV G;  1LM0 A;  3H15 A;  4GKJ L;  4LUO A;  1XPO A;  3E9H A;  3S15 H;  4LF7 Q;  1EWI A;  4GLV B;  1K8A C;  2Q2U A;  4OON A;  2BH2 A;  2R7Z G;  3S2H H;  3ULJ A;  4ME3 A;  4L5R C;  1N8R C;  2E5L Q;  1GVP A;  1XNR Q;  4DR7 Q;  1U0L A;  2ID0 A;  5AJ3 L;  3M4Q A;  2K5V A;  4IFD G;  4GKJ Q;  3J80 c;  4BXX H;  2Y0S G;  4A3I G;  1KXL A;  2JK8 A;  2KCT A;  4MZ9 A;  1HZC A;  2PQA B;  4DKA C;  3UDG A;  3U58 A;  4QQB X;  1HNW L;  1UWV A;  1YZ6 A;  2ASB A;  4UP9 A;  1L1O C;  4DV0 L;  3KF8 B;  1MJC A;  5AJ3 Q;  3DM3 A;  3CQZ H;  3CME A;  3PGZ A;  4NB3 A;  3TEH B;  2R7Z H;  3HOZ G;  1NJI C;  1TWC H;  1VQ5 A;  4K0K L;  2R93 G;  3CCQ A;  3I55 A;  3OW2 A;  4BY1 G;  1HNW Q;  2UXD Q;  5J3B A;  2IX0 A;  1VQG A;  2B3G A;  1EYG A;  4BBR G;  4DV0 Q;  2YTY A;  4DR4 L;  5JEA G;  4UY8 C;  4YWM A;  5FLM G;  4K0K Q;  1IBL L;  4TVA B;  1OXX K;  3K7U C;  3KF6 B;  4IOC A;  2K50 A;  3GDE A;  3RNU A;  2IHE A;  1VQB A;  2GVA A;  3H3V I;  1P16 A;  3GD7 A;  1VQP A;  4LF4 L;  2JEB I;  4OWX B;  4LF6 Q;  3HOZ H;  1SR3 A;  3RN5 A;  1PFS A;  2R93 H;  1G51 A;  1Q81 C;  2HT1 A;  1PVO A;  4GN3 B;  2KCM A;  1Y14 B;  4O2D A;  4JI5 L;  4LUV A;  4GOP C;  4BY1 H;  3W5O A;  2I5L X;  4JOI A;  4BBR H;  4GLA C;  4HJA A;  4HIM A;  3GTQ H;  3KYH C;  4JI4 L;  4LF4 Q;  3SGI A;  5FLM H;  4YHH L;  3TS0 A;  1S72 A;  4B3T L;  2UUB L;  4P71 A;  1Q86 C;  1J5E L;  2HQL A;  3S24 A;  3D0F A;  4IFD I;  3PIP A;  3ERS X;  5M3F G;  1WFQ A;  1UEB A;  3KJP A;  3S1R H;  4JI4 Q;  1CKM A;  4YHH Q;  4GLX A;  2VQF L;  2UUB Q;  1J5E Q;  5ELN A;  3GTO H;  2K75 A;  4X64 L;  3RZD H;  2OTJ A;  2D62 A;  3M9B A;  3PF4 A;  2MNA A;  3U50 C;  2JEA I;  2D0O A;  1VQ4 A;  4A3C H;  5C44 G;  1SFO H;  1K0R A;  4GOP A;  4LWC A;  4DV1 L;  4APV A;  2VQF Q;  1HNX Q;  1PV4 A;  4X64 Q;  5JJK A;  3U4Z A;  3S2D H;  1W3S A;  1YJ9 A;  4DK6 C;  4Y7N H;  5LMU L;  3KLW A;  3T1H Q;  2VY3 A;  1FVI A;  1YHA A;  4B3S L;  3KDF A;  4OO1 G;  3FKI G;  1PYS B;  2XTI A;  2HIV A;  4DR2 L;  3AQQ A;  1PHJ A;  4DV1 Q;  5FJ8 G;  2HHH L;  2JA8 G;  2PMZ E;  1HJP A;  1NMF A;  3RLO A;  4BA1 I;  5H1S E;  1PH3 A;  2R92 G;  1N36 Q;  2A19 A;  3A74 A;  1VQ7 A;  5LMU Q;  2I5H A;  2MFI A;  3OTO L;  3GTL H;  1C7Y A;  4X65 L;  1RL2 A;  3CMA A;  1SMX A;  4J15 A;  4HJ7 A;  1H95 A;  1VQJ A;  1E7Z A;  2HIX A;  1K3R A;  3PO2 H;  1HZ9 A;  3M85 A;  3L2P A;  1CKN A;  2PQA A;  3HOU G;  4QJF A;  4HJ9 A;  4AYB G;  2VL6 A;  4R4I A;  1N9W A;  3GTP H;  1VQF A;  3PUZ A;  3OTO Q;  1QVC A;  1JJC B;  3FKI H;  2C35 B;  4A3J G;  2Y0S E;  1OXS C;  2JA8 H;  2VUM H;  2UU9 L;  3M3Y H;  3HOY G;  2R92 H;  2AMC B;  1MKH A;  3CCJ A;  4HIK A;  3PUV A;  1OXV A;  2CQO A;  3GTM H;  1MIU A;  4IPD A;  1EUJ A;  1GO3 E;  5ELO A;  5IYB G;  4X62 L;  2ZM6 L;  4GNX B;  1XJV A;  2YU9 H;  5C3E G;  1SLJ A;  3HOU H;  3M4O H;  2UU9 Q;  1HH2 P;  4JI7 L;  4A3F G;  4JV5 Q;  3A5U A;  4IO9 A;  3CCL A;  4TQU S;  4C3H H;  4OWW B;  1OXT A;  3I2Z A;  2WB1 G;  3J81 c;  2ZM6 Q;  4A3J H;  1YEZ A;  2WAQ E;  2CWP A;  3IRB A;  2YTX A;  2EXD A;  3HOY H;  1X3F A;  4RG1 A;  3ZJY C;  1V9P A;  4DAM A;  1X6O A;  1A63 A;  1QUQ A;  4HJ5 A;  2N78 A;  4JI7 Q;  3OYY A;  1XNQ L;  5IYB H;  4DV7 L;  4OO1 I;  1EOV A;  1HZB A;  1XNR L;  4PZ6 A;  2ALY B;  1UE1 A;  5C3E H;  1G6P A;  2JE6 I;  4YCW A;  4A3F H;  1NE3 A;  2NZO A;  1I6H H;  2E2I H;  2JA5 G;  1QVF A;  5C4J H;  1VQN A;  1XNQ Q;  4DV7 Q;  2BA1 A;  4DNI A;  3E0E A;  2JA6 G;  3EBE A;  1VQH A;  2VS1 A;  4IJH A;  2RCN A;  3AFP A;  2OTL A;  1K8G A;  4GN5 A;  1ASZ A;  1Q7Y C;  4JG2 A;  1FJG L;  4DPG A;  1JT8 A;  2UXD L;  4YY3 L;  1X56 A;  2MO0 A;  4DR6 Q;  1IZ6 A;  2AWO A;  3STB D;  2UXC L;  3CXC A;  3CCM A;  5IP7 H;  3A5Z B;  1S3O A;  1VQL A;  4UP8 A;  1X55 A;  2JA5 H;  3J80 i;  2QGQ A;  2KHI A;  2EIF A;  4OXP A;  4P72 A;  4DUZ L;  5IY0 A;  1FJG Q;  2JA6 H;  4YY3 Q;  5GQO A;  4R4O A;  2DUD A;  2OQ0 A;  4QIW E;  3PUX A;  1XTD A;  5GAH C;  4DV4 Q;  4LF6 L;  1PH4 A;  2UXC Q;  4GNX C;  3L0O A;  4JI6 L;  3B6Y A;  1Q8K A;  1FL0 A;  3HKZ G;  4DV5 L;  5K36 G;  4LW1 A;  2RHS B;  1Y1V G;  2YTV A;  2WP8 J;  1SE8 A;  4DUZ Q;  3WWV A;  4YWL A;  3HOX G;  1UE5 A;  3RZO H;  1VQC A;  2IX1 A;  3LGJ A;  4DR1 L;  4JI6 Q;  3AYH B;  4A3G G;  4DV5 Q;  1L1O A;  4EQ5 A;  1GKH A;  1VQM A;  2GVB A;  4GN4 B;  2ZJP A;  3CCS A;  2NVT H;  1AH9 A;  1W2B A;  1IBM L;  3FP9 A;  3UDF A;  3HOW G;  4A3C G;  1M90 C;  2N8N A;  3CPW A;  2OWO A;  4DR1 Q;  3PO3 G;  4GKK L;  1Y1V H;  1O7I A;  3UE0 A;  4LFB L;  4BBS G;  3G71 A;  1Q1B A;  1I94 Q;  3I4M G;  5JJI A;  2LXK A;  3HOX H;  1IBM Q;  2RF4 A;  1JE5 A;  1BBW A;  1VCI A;  3D31 A;  2UUC Q;  1K9M C;  2ES2 A;  4JI2 L;  4JBM A;  4A3G H;  1B70 B;  4L5T A;  2VQE L;  1HNX L;  4GKK Q;  4LFB Q;  2AWN A;  2NVQ H;  2E2H H;  3T1H L;  3RLF A;  2VZA A;  1I3Q H;  1E24 A;  4LF8 L;  3CP0 A;  1QVG A;  3PO3 H;  4JI2 Q;  3CC4 A;  1X3G A;  4A3D G;  3BZK A;  4BBS H;  1HZA A;  1IXR A;  1T9H A;  2VQE Q;  2CKZ B;  5GRO A;  3I4M H;  1A0I A;  3TQY A;  5C4X H;  1UE7 A;  2WB1 E;  3PO2 G;  4X6A H;  5LMN W;  2JJQ A;  2KBN A;  3RN2 A;  3S14 H;  2Q2H A;  2H5X A;  4LF8 Q;  4XIG S;  3S17 H;  1C9O A;  3H0G G;  1E1T A;  4LFA L;  3RLN A;  5GAG C;  4A3K G;  1WOC A;  2F4V L;  2VUM G;  1RIP A;  2IT1 A;  1YJN A;  2ZTC A;  4YCV A;  5EAY A;  1A62 A;  2YYZ A;  3F8T A;  2ZJQ A;  2PNH A;  1V1Q A;  1N33 L;  3BZC A;  4A3D H;  3CCV A;  3JAM c;  1HNZ L;  4JI3 Q;  3PUW A;  5M3M H;  4P73 A;  1I50 H;  5HY6 A;  4LFA Q;  4LF9 L;  3PV0 A;  1Q82 C;  3I4N G;  2F4V Q;  1WCM H;  1AE3 A;  1CSQ A;  4PZ7 A;  4LFC L;  1IBK L;  4KHP L;  4R4T A;  4DV3 L;  2K5N A;  1CKO A;  1Y1W G;  1N33 Q;  1LYL A;  3H0G H;  4PG3 A;  5FLX c;  4ALP A;  1KD1 C;  1HNZ Q;  1XPR A;  4A3K H;  4YWK A;  1D7Q A;  4R1J A;  2GN5 A;  3HFZ B;  4LF9 Q;  4JV5 L;  2Z6K C;  1D8L A;  1KAW A;  1VQE A;  1HR0 L;  4O0A A;  1B8A A;  5GAE C;  1IBK Q;  4LFC Q;  2JA7 G;  4KHP Q;  5DLQ E;  2N3S A;  4DV3 Q;  1LTL A;  2IHF A;  5M5W H;  3I4N H;  3PCO B;  1KQS A;  4A3L G;  2DGY A;  1IYJ B;  1PH9 A;  1JJ2 A;  3ICE A;  3KF6 A;  1YBY A;  2KHJ A;  3I4O A;  2NVX H;  1HR0 Q;  4IFD J;  2NVY H;  1Y1W H;  3Q8D A;  2QEX A;  1BVS A;  3HKZ E;  1KRS A;  2JQO A;  2XGT A;  2AHO B;  5BR8 L;  3VDY A;  5C0X G;  3GTK H;  3S1N H;  2AKW B;  2BH8 A;  1E3P A;  4A3E H;  4JI8 L;  2NZH A;  2JA7 H;  2ATW A;  3J7Z C;  3TRE A;  1PH5 A;  2ZJR A;  2Z6K A;  4IPH A;  4JBW A;  2CFM A;  1EFW A;  3J81 i;  1KC8 C;  4A3L H;  1X3E A;  3W1B A;  5BR8 Q;  4DR3 L;  1SRO A;  1AE2 A;  3GO5 A;  1XPU A;  3TS2 A;  4DV6 L;  5IP7 G;  2F52 A;  1TWH H;  4JI8 Q;  5JEA J;  4POF A;  3MXN B;  2MQH A;  4IJL A;  2Z0S A;  4NXM L;  2ZTE A;  4DR6 L;  3AEV A;  1L2F A;  2K4K A;  4DR3 Q;  2VW9 A;  1WI5 A;  2E2J H;  3CC2 A;  3J7A 5;  1NY4 A;  4DV6 Q;  4JYA L;  1TWA H;  4NXN L;  5IYC G;  3AFQ A;  1EIF A;  4X66 L;  1B7Y B;  4NXM Q;  4DV4 L;  1P8L A;  2UUA L;  4A4I A;  1VQO A;  1Z9F A;  4QL5 A;  3T1Y Q;  4B3R L;  3KDF B;  3KJO A;  2K14 A;  4JYA Q;  4QY7 A;  4WJ3 M;  1R9T H;  4NXN Q;  1WJJ A;  3FHW A;  2CWA A;  3CCE A;  4FDB A;  1DGS A;  3E9I A;  3F2B A;  4X66 Q;  1JJG A;  2PI2 E;  4JC0 A;  2UUA Q;  4JI1 L;  3F2C A;  3S16 H;  3H3V H;  2BA0 A;  4B3R Q;  5IYC H;  3K0X A;  3MEF A;  1KL9 A;  4L5Q A;  4RMF A;  4R4C A;  1PH2 A;  5C0X I;  2I0Q A;  4JI0 L;  1CKN B;  3A0J A;  4GS3 A;  1ASY A;  1TWG H;  4DAY B;  3HOV H;  2D0P A;  1Q46 A;  4P75 A;  3UDX A;  4BY7 G;  4JI1 Q;  1VS0 A;  4DK3 C;  4A3M G;  4QGU A;  4JOI C;  1N36 L;  3PSI A;  1JMC A;  3W1G A;  4DUY L;  1EQR A;  1YHQ A;  1I94 L;  3CD6 A;  1VQ6 A;  3GTG H;  3EN2 A;  1A8V A;  4KI0 A;  1QZG A;  2E8G A;  4JI0 Q;  3BJU A;  1YIJ A;  3BU2 A;  2UUC L;  3CCR A;  2A8V A;  2R7F A;  2F3I A;  1L0W A;  1PH1 A;  1J6Q A;  4AYB E;  4LNQ A;  4A3I H;  2WAQ G;  3CCU A;  1V43 A;  4HIO A;  3F1Z A;  1NBW A;  4JCV E;  4AH6 A;  1SRU A;  5IYD G;  4DUY Q;  3JC6 6;  3G4S A;  1XMO L;  4GNX A;  1YI2 A;  1PH7 A;  1OTC A;  4LF5 L;  5C4X G;  1BKB A;  1CSP A;  3S1Q H;  4BY7 H;  2B29 A;  2R7D A;  1VQI A;  2MO1 A;  1GD7 A;  3CW2 C;  4A3M H;  4JBK A;  4A76 A;  1FGU A;  4DR4 Q;  1YVC A;  1E22 A;  2Q2T A;  2NN6 G;  3UDI A;  5E7N A;  5IT9 c;  2QA4 A;  2Q2I A;  1XMO Q;  1IBL Q;  2UXB L;  1Z47 A;  4LF5 Q;  1HR0 W;  1N32 L;  1QUQ B;  4YCU A;  1X65 A;  1U5K A;  4XTC S;  5IP9 G;  3NEL A;  1EIY B;  5JJL A;  4DV2 L;  4NPS A;  1PH8 A;  1UE6 A;  1LUZ A;  1WYD A;  4C3J H;  3HOW H;  5M3M G;  5IYD H;  1XMQ L;  1VQA A;  4IOA A; 
#chains in the Genus database with same CATH topology
 1L0X B;  5C5M A;  1WCM G;  3BZD B;  3IAY A;  3Q22 A;  1X9N A;  1VQK A;  2L15 A;  4R4Q A;  3S1M H;  2YU9 B;  3M7N A;  4BWG B;  2IWH A;  1WVL A;  1XMQ Q;  3MXN A;  3HKS A;  5FO9 B;  2CVR A;  3BDO A;  3K8A A;  3BVM A;  1JQY D;  1PZK D;  2WKD A;  4GZY C;  2D5D A;  2DJG C;  2Q8T A;  2M00 A;  5M3F H;  2F03 A;  1LTI D;  2K5W A;  1MSH A;  2IX3 A;  1DJR D;  4EQO A;  4E6I A;  3A54 A;  3K5O A;  4FYD A;  3SVM A;  5C44 H;  2NN6 I;  1KTK A;  5AFW A;  2WV6 D;  5I9O A;  2CHB D;  4KHZ A;  1JWU D;  2E2J B;  1A3U A;  1TQO A;  3F2D A;  4UPA A;  4ZLT F;  4X65 Q;  4ZK9 B;  2KHS A;  1SYD A;  3VR4 A;  2B63 H;  2F0J A;  3ER0 A;  4MNO A;  3BYT B;  1R9T B;  3CPF A;  1LAC A;  1TY2 A;  1TR5 A;  1KIX A;  1GHK A;  3NEM A;  2RDF A;  2F0E A;  2JA9 A;  3W2D A;  2C5C A;  4QF4 A;  1YIT A;  1M1K C;  5LMN L;  1E0B A;  5EBC A;  2PI2 A;  1ENA A;  4AQY L;  4RA8 A;  1E2W A;  1YJW A;  4GOP B;  4LF7 L;  1I5F A;  1MJE A;  1Q1E A;  3CAM A;  2IY5 B;  4DR7 L;  3EFX D;  2XWJ B;  4CDD C;  4LUO A;  3E9H A;  1I4R A;  1PTO F;  3S15 H;  2R7Z G;  1EWI A;  2A69 D;  1K8A C;  2Q2U A;  1CM9 A;  4OON A;  3ULJ A;  2MHV A;  2E5L Q;  1GVP A;  3S1Q B;  4BY7 B;  1XYI A;  1JR0 D;  1BR9 A;  2MUY A;  4XDX A;  4BXX H;  4ZRZ A;  2JK8 A;  4MZ9 A;  2PQA B;  4DKA C;  4KKS A;  3U58 A;  2ASB A;  2ICI A;  4DV0 L;  4DU9 A;  5AJ3 Q;  3CME A;  3TEH B;  4PMB A;  3OW2 A;  1RTN A;  1EYG A;  2P5Z X;  1II3 A;  3S1M B;  3Q6S A;  4KMU C;  2Z4H A;  5DAU A;  4C3J G;  4CJ2 C;  5DEH A;  5JAV A;  5G3L D;  1OXX K;  3MXG A;  4IOC A;  2K50 A;  3I73 A;  3TP7 A;  3H3V I;  1F9S A;  3HOZ H;  4LF6 Q;  1LTR D;  1SAP A;  3RN5 A;  1G51 A;  4O2D A;  4GOP C;  4UDU C;  4JOI A;  3GP7 A;  4B9W A;  3KYH C;  3TS0 A;  5KIX A;  1S72 A;  2RA4 A;  2MP1 A;  2DN8 A;  3CRL C;  1O80 A;  5IIF A;  1XX8 A;  3PIP A;  5M3F G;  1EY5 A;  3KLS X;  1CKM A;  4YHH Q;  2VQF L;  3GTO H;  5CR3 A;  2OTJ A;  3J81 L;  3U50 C;  2JEA I;  1YNN D;  5C44 G;  3M4Y A;  4GOP A;  3TSS A;  4LWC A;  1HNX Q;  1PV4 A;  4M1U B;  2EY6 A;  4KD3 A;  4A3E B;  1W3S A;  1YJ9 A;  2B63 B;  5LMU L;  1OO9 B;  3MC0 B;  4QMG A;  3BS1 A;  4FXD A;  2K7V A;  1STY A;  4CKC A;  1PHJ A;  3ITP A;  1R4Q B;  4FXG C;  2JA8 G;  2NWG A;  2PMZ E;  1HJP A;  3EVQ A;  1VQ7 A;  5CV5 A;  2EY1 A;  4CDE C;  1C7Y A;  4X65 L;  1RL2 A;  1EY6 A;  2HIX A;  3RD4 A;  2BDN A;  4J8Q A;  1PXU A;  3M85 A;  2PQA A;  3EQL C;  2NB0 A;  3ND9 A;  1BF4 A;  1JJC B;  1JOK A;  2BCO A;  2Y0S E;  1OXS C;  3AU7 A;  1SMY C;  3S15 B;  3CCJ A;  3E5S A;  4ZKB B;  5I4D A;  1B50 A;  1MIU A;  4IPD A;  3WDN A;  3CU7 A;  1ROD A;  1SLJ A;  3HOU H;  4A3F G;  4IO9 A;  1A3T A;  5CV7 A;  2ZM6 Q;  1YEZ A;  2CWP A;  4EGV A;  3HOY H;  1A63 A;  4MTK A;  4B9X A;  4HJ5 A;  2JYO A;  4PV1 C;  4OO1 I;  1HZB A;  4X3K A;  1G6P A;  1NE3 A;  2F0U A;  4A3I B;  4WJW A;  3VR2 A;  2E2I H;  1VQN A;  4DNI A;  2JA6 G;  3EBE A;  1FNV A;  4A3M B;  1CFM A;  2RCN A;  3QOJ A;  1KLG D;  4GN5 A;  4XQN A;  1H9S A;  3HOZ B;  1QIL A;  3FPP A;  1D5M C;  2LMC B;  2MO0 A;  3J7Y W;  4Z9C B;  1LLR D;  4O1N A;  1YNJ D;  3NE5 B;  3PMF A;  2JA5 H;  4UP8 A;  1K8M A;  1LT4 D;  2KHI A;  4OXP A;  1S5D D;  4P72 A;  4WFN 3;  5IY0 A;  1FJG Q;  4YY3 Q;  5GAH C;  4DV4 Q;  4ODG A;  4LF6 L;  3RMH A;  4DV5 L;  1MHW C;  1CQF A;  2Z1C A;  3WWV A;  4XXE A;  1K3B C;  1ZYR C;  1EYA A;  4DR1 L;  1PZJ D;  2NVT H;  2B2T C;  5IOD A;  5FLX L;  2CQA A;  3HS0 C;  3K6O A;  3NQT A;  2FMM A;  1Y1V H;  2K01 A;  4ME5 A;  1LTA D;  1Q1B A;  2A6H D;  3OWF A;  2NZ1 D;  1BBW A;  4JBM A;  1B70 B;  3NTH A;  2VQE L;  1HNX L;  2Z6B A;  3MFY A;  2E2H H;  3KBX A;  3GTJ B;  3RLF A;  3E6Z X;  1IW7 C;  1CI3 M;  1I3Q H;  2RDG A;  1E24 A;  1EY9 A;  1QVG A;  3PO3 H;  4JI2 Q;  3BZK A;  1HZA A;  3TP6 A;  1T9H A;  5GRO A;  3TDQ A;  3I4M H;  3CRK C;  5JPN C;  4X6A H;  4KJN A;  1BCP B;  3T4A C;  4LF8 Q;  3SXH A;  5GAG C;  5KYI A;  2F4V L;  1GXD C;  3HOU B;  1RIP A;  4YCV A;  1PFB A;  2YYZ A;  4JW0 A;  1V1Q A;  4K8I A;  4F8M A;  4A3D H;  5M3M H;  1B4O A;  5HY6 A;  1DZ1 A;  4DF7 A;  3I4N G;  1A3V A;  1Q82 C;  3HOY B;  4UAI A;  2F0M A;  1X3Q A;  1EYC A;  2LY7 A;  2K5N A;  2K6A A;  1LYL A;  3H0G H;  4PG3 A;  5BN5 A;  4RGO S;  1PYW D;  1KNE A;  4A3K H;  1JCK B;  4LF9 Q;  2Z6K C;  4IQZ A;  1QWY A;  4KJO A;  1LTS D;  2E2I B;  2WB1 B;  4IUP A;  4RKL A;  1NCV A;  1CA5 A;  1IYJ B;  3I4O A;  2NVX H;  2B2U C;  1H9K A;  1RCV D;  2NVY H;  3NUC A;  3Q8D A;  1Y1W H;  3MTS A;  2QEX A;  3HRZ C;  2AHO B;  1QG7 A;  2HDL A;  2JA5 B;  2A73 B;  4FF3 A;  3TRE A;  2Z6K A;  4IPH A;  1WTR A;  1BCP C;  1EFW A;  4A3L H;  4IUV A;  4HSP A;  2XVS A;  4PNY A;  4DV6 L;  3OWE B;  2F52 A;  2QDB A;  4PQX A;  1HQR D;  2ZXR A;  2Z0S A;  4NXM L;  3AEV A;  2QF7 A;  3IFD A;  1STH A;  4DR3 Q;  5IT9 L;  1NY4 A;  2NVT B;  1D6E C;  4DV4 L;  1D1K A;  4DFA A;  2BE5 D;  4B3R L;  4NXN Q;  3N6R A;  2RVL A;  4FDB A;  1C4Q A;  4ZQ3 A;  4X66 Q;  4RGT A;  1V8Q A;  2UUA Q;  3VR5 A;  4JI1 L;  4DNT B;  3F2C A;  3S16 H;  3H3V H;  2Q8R E;  2BA0 A;  5IYC H;  2EYF A;  4KTA A;  4JI0 L;  2E2H B;  3A0J A;  4GS3 A;  3HOV H;  1JOO A;  3X3M A;  4DK3 C;  1I3Q B;  3FRP B;  5IOC A;  3PO3 B;  5CYU A;  1JMC A;  1YHQ A;  1EQR A;  2F0W A;  3I4M B;  3GTG H;  1QZG A;  3S2D B;  2E8G A;  1D5Z C;  5KEE A;  4Y7N B;  2A8V A;  1L0W A;  1PH1 A;  4HMI A;  1V43 A;  2OXP A;  3F1Z A;  4HIO A;  4JCV E;  1N36 Q;  4GNX A;  1YI2 A;  1OTC A;  3FPU B;  3TZU A;  3DEO A;  4A3D B;  1FGU A;  1PRT B;  1YVC A;  1E22 A;  5L37 A;  2Q2T A;  4FVM A;  2NN6 G;  3PO2 B;  1IBL Q;  2UXB L;  4I7A A;  4YCU A;  1X65 A;  2EYL A;  2AQ1 B;  3H0G B;  1SDF A;  3H6M A;  4DA2 A;  3HOW H;  5M3M G;  4RCN A;  4A3K B;  1VQA A;  1PTO H;  1BUV T;  2R92 B;  4JI5 Q;  5M5Y H;  3G7L A;  3U4V A;  5IE8 A;  1LV9 A;  3FDT A;  3BG3 A;  3V05 A;  4PMW A;  4HJ8 A;  4B3T Q;  3M4O B;  4DR5 L;  1S40 A;  2DNC A;  2WFW A;  2OCE A;  2NVX B;  1K0S A;  3K59 A;  2NVY B;  1Y1W B;  1KRT A;  1TXY A;  1BBU A;  5K5P A;  2TMP A;  1NMG A;  3KOJ A;  2FJ2 A;  5E3F A;  4LUZ A;  4C3I G;  2PO4 A;  4H44 C;  2B2V C;  4A93 G;  2CCZ A;  1B3Q A;  2KEN A;  1AN8 A;  2GA4 B;  5J22 A;  1WD1 A;  1C0A A;  1TWF H;  5ISR A;  1N34 L;  3I90 A;  1BDO A;  3DLL A;  2PW7 A;  4OX9 L;  5IWA L;  4DR2 Q;  1VQD A;  1PRT C;  1O7Y A;  2AQ2 B;  2MJ8 A;  4A3B G;  4BA2 I;  3NHH A;  2EY5 A;  4JBJ A;  4EX5 A;  3VYU A;  3C46 A;  1GUW A;  5C6A A;  5T1G A;  3RR5 A;  2XRS D;  1I4X A;  1G29 1;  1PFM A;  2G5D A;  4NP5 A;  2LXJ A;  3U9O A;  3URY A;  3L7Z C;  3K5M A;  3S16 B;  5IGD A;  3K7A H;  5HUR A;  3M4P A;  2A1A A;  2PMZ B;  3ULP A;  2XSC A;  2A6E C;  1CA6 A;  4X62 Q;  2RSN A;  3STB C;  3ZYY X;  3CF5 A;  1FNW A;  4K2L A;  5A35 A;  1YHB A;  2RQX A;  5LMN Q;  3GTG B;  1AZP A;  5A2Q E;  4AQY Q;  4PZ8 A;  5EKK A;  3HOV G;  1LM0 A;  3O13 A;  1XPO A;  1UAP A;  2Q8I B;  2H4O A;  4LF7 Q;  1ONL A;  3DM1 A;  4ME3 A;  2KQ3 A;  4DR7 Q;  1V1O A;  1U0L A;  3QJY A;  2Y0S G;  2OT2 A;  3A56 A;  3AB9 A;  2RDH A;  4LJZ C;  1HTP A;  2I46 A;  1HNW L;  3MEH A;  5ELD A;  3DM3 A;  4NB3 A;  5CV6 A;  2D2C C;  2R7Z H;  1TWC H;  1WTH A;  3DWQ A;  1VQ5 A;  3HOW B;  5C4X B;  1PTO B;  4FNF A;  1W6J A;  2F3V A;  4BY1 G;  2QEJ C;  1H9M A;  2EY2 A;  5M5Y B;  4CGY B;  3WOE A;  4BBR G;  4DV0 Q;  5DNF A;  1F2Z A;  3VR6 A;  5JEA G;  1KAB A;  3VYT A;  5ELE A;  1ZKO A;  3MWY W;  1IBL L;  3SK5 A;  3KF6 B;  3H3V C;  4HCS A;  2GVA A;  1P16 A;  3GD7 A;  4H7B A;  1VF5 C;  2IL8 A;  1PFS A;  1Q81 C;  2BDO A;  2KCM A;  1CT1 D;  1WCM B;  4JI5 L;  2B2W C;  1IKL A;  3SK8 A;  3BYY B;  2I5L X;  5C3X A;  2B8F A;  4JI4 L;  4B3T L;  3TP8 A;  2UUB L;  4P71 A;  5CBA E;  4XYQ A;  3OOC A;  3A8J E;  4IFD I;  1TWF B;  3ERS X;  4KY6 A;  1O7L A;  2QKI C;  4JK1 C;  5ELN A;  1AP0 A;  4R9W A;  2K75 A;  4X64 L;  4RWS C;  3M9B A;  2K5Q A;  5EPK A;  1K0R A;  4LMQ D;  3DEP A;  4DV1 L;  2JP1 A;  4APV A;  2VQF Q;  4KKT A;  1EIG A;  4OEM B;  4DK6 C;  3T1H Q;  2F0T A;  1PTO C;  1FVI A;  1YHA A;  4OO1 G;  3FKI G;  1JE4 A;  4DR2 L;  4BA1 I;  4X3S A;  2XRQ D;  2X6L A;  1NR2 A;  3OMC A;  2A19 A;  5LMU Q;  5ELB A;  2MFI A;  4RGN A;  1B9M A;  1HZ9 A;  3BDL A;  1XTC D;  1TWA B;  2VL6 A;  1CQV A;  2CW0 C;  1QVC A;  2C35 B;  4A3J G;  2JA8 H;  2VUM H;  2UU9 L;  2A68 D;  1MKH A;  3PUV A;  2CQO A;  1GO3 E;  4X62 L;  1PZI D;  2F0D A;  1MBY A;  3L3O C;  3MAQ A;  5C3E G;  2AUK A;  3MHB A;  4JI7 L;  5CC4 A;  3A5U A;  4C3H H;  4OWW B;  1OXT A;  4K6L A;  1AFP A;  3ZJY C;  3VA7 A;  2R7Z B;  2N78 A;  1TWC B;  3GQB A;  3OYY A;  4DV7 L;  1DOK A;  4PZ6 A;  2SNS A;  1CZG A;  4A3F H;  1VMP A;  1ENC A;  1EEI D;  2F3W A;  2KCN A;  3TN2 A;  2VS1 A;  2XIW A;  5KND A;  3NTK A;  1K8G A;  1ASZ A;  2N88 A;  1Q7Y C;  4JG2 A;  1X56 A;  1SE4 A;  3D6C A;  1Y69 U;  2UXC L;  2WAQ B;  3CXC A;  2HCI A;  4C3J B;  3CCM A;  1VQL A;  2V4D A;  1EU3 A;  2JA6 H;  1C48 A;  1CZW A;  2J0T D;  2K28 A;  4I7Z C;  4JI6 L;  1Q8K A;  4K5V A;  3GV6 A;  2YTV A;  4YIJ A;  1EY7 A;  3DWP A;  2WAC A;  3NXW A;  3Q24 A;  4A3G G;  4DV5 Q;  2QDL A;  4EQ5 A;  1VQM A;  4GN4 B;  2F0S A;  2ZJP A;  4IOA A;  3FP9 A;  3QO2 A;  5M3F B;  3HGB A;  3UDF A;  3PIP 3;  2G9H D;  3S9W A;  2N8N A;  2PW5 A;  4C1N K;  3CPW A;  4DR1 Q;  4GKK L;  4LFB L;  1O7I A;  1SYB A;  4G7O C;  1I94 Q;  2RF4 A;  1JE5 A;  1VCI A;  5C44 B;  1I4H A;  1K9M C;  1D1I A;  2ES2 A;  2F0P A;  3FMC A;  1EQV A;  1HUN A;  1VDZ A;  1RF2 D;  2QIL A;  3T1H L;  3KBG A;  5COR A;  5I2X A;  5ELF A;  2KEE A;  3CC4 A;  1X3G A;  4IUR A;  1IXR A;  3SDZ A;  3TBI B;  4F88 A;  2VQE Q;  2JA8 B;  3TQY A;  2F0F A;  4PMC A;  2PQE A;  2KBN A;  3RN2 A;  3S14 H;  1ZEQ X;  2H5X A;  2Q2H A;  3LX0 A;  4N9T A;  5G3L F;  4EQP A;  1E1T A;  3S17 H;  4LFA L;  3RLN A;  2VUM G;  1SYC A;  2IT1 A;  1YJN A;  2ZTC A;  2ZJQ A;  4IUU A;  1N33 L;  1BNZ A;  4JI3 Q;  3JAM c;  1EWH A;  3PUW A;  1HA6 A;  2K04 A;  1F9P A;  3PV0 A;  3JAM E;  2F4V Q;  1AE3 A;  3NP8 A;  1IBK L;  4R4T A;  4C3H G;  4DV3 L;  5CV8 A;  2A74 C;  2ZT9 C;  4F7X A;  5KYL A;  4YWK A;  2GN5 A;  4A3F B;  1HR0 L;  1G8Z D;  1MI2 A;  5GAE C;  2F0G A;  2JA7 G;  1SYF A;  5DLQ E;  3VR3 A;  3NSW A;  3I4N H;  4P2C B;  2DGY A;  1NSN S;  1STE A;  1EL0 A;  4DAP A;  3HKZ E;  3GTK H;  5BR8 L;  2AKW B;  2LFN A;  1KDA A;  2K5D A;  1BXT A;  2NZH A;  5NUC A;  1X32 A;  3C3L A;  3OIP A;  1PH5 A;  4K2K A;  2ZJR A;  2JA6 B;  1X3E A;  1SRO A;  1AE2 A;  2XWB B;  1XPU A;  1SMY D;  1WTO A;  5JEA J;  4BS9 A;  2WKC A;  2MQH A;  4IJL A;  2ZTE A;  4CBV A;  4FXK C;  1L2F A;  4F87 A;  2K4K A;  3J7A 5;  2RKS A;  4H0L C;  4DV6 Q;  3AFQ A;  1IL8 A;  5I2Y A;  1HCZ A;  1F77 A;  1B7Y B;  1DXM A;  4NXM Q;  1L0Y B;  1UUP A;  1VQO A;  2BOS A;  3A55 A;  3NWS A;  3KDF B;  3P1H A;  2WII B;  4WJ3 M;  4WOR A;  1WJJ A;  1DGS A;  1JJG A;  2B8G A;  2O4X A;  2PI2 E;  3U9S A;  5IGE A;  2F0H A;  4DXG A;  4B3R Q;  3K0X A;  1KL9 A;  1SNC A;  3GTO B;  4L5Q A;  4R4C A;  1PH2 A;  3A7A B;  1JIC A;  5C0X I;  1B3A A;  1CKN B;  1ASY A;  4DAY B;  3BVZ A;  4JI1 Q;  1VS0 A;  2X69 A;  1KDB A;  4A3M G;  3PSI A;  4DUY L;  5I9P A;  1I94 L;  5DM6 3;  3EN2 A;  4JI0 Q;  1U4L A;  2HUG A;  3CCR A;  1PMR A;  4KN7 C;  5E4W C;  3S17 B;  1NBW A;  1RKN A;  1SRU A;  5IYD G;  2XNA C;  4LF5 L;  5KGU A;  1BKB A;  1CSP A;  3LNN A;  2R7D A;  3QR8 A;  1GD7 A;  1DM0 B;  3CW2 C;  4HTH A;  4JBK A;  3C1E A;  1TS5 A;  3UDI A;  5E7N A;  2Q2I A;  1N32 L;  1QUQ B;  1STG A;  4XTC S;  5IP9 G;  2EYO A;  4DV2 L;  5JJL A;  2B2T A;  1TS3 A;  1PH8 A;  1I4G A;  4CKE A;  3OPO A;  1LT3 D;  3EJI A;  2UXB Q;  3G48 A;  4M8A A;  3X3N A;  2L12 A;  4A75 A;  4JI3 L;  5C4Z A;  2OQK A;  5LL6 X;  1DYQ A;  1SN8 A;  3J81 j;  2NN6 H;  1MGS A;  3I4N B;  4CJ0 B;  2EQS A;  4AYB B;  3IFT A;  3CKI B;  3NEN A;  4UP7 A;  3GTK B;  1PYB A;  5A2Q L;  1YNX A;  4L6T B;  5C0X J;  4DR5 Q;  1K73 C;  1K28 A;  2O5J C;  1IW7 D;  1IL2 A;  3H91 A;  4OWT B;  3JAM i;  4KLK A;  3V96 A;  2EJG C;  3D3R A;  1VQ8 A;  2EDG A;  5COY A;  1ENF A;  2K5H A;  2TSS A;  2E74 C;  3K80 C;  4OL7 A;  4B3S Q;  3ULL A;  4AIM A;  1OXU A;  2EJF C;  1D2B A;  2FXQ A;  1L1O B;  4C3I H;  1N34 Q;  3I4L A;  2ZTD A;  4A93 H;  4NKL A;  2N55 A;  1S5F D;  5FJ8 H;  3EIV A;  1CHQ D;  4OX9 Q;  4B3M L;  3J7A F;  5IWA Q;  3UE1 A;  2ZXO A;  1CK1 A;  1EFI D;  1NTG A;  3VA5 A;  1SYE A;  1JB7 A;  4A3B H;  4OEL B;  2JXM B;  2K52 A;  3NBH B;  4IPC A;  4KY7 A;  1E1O A;  5GAD C;  3OW7 A;  2B2U A;  5LL6 S;  4IPG A;  4ABN A;  1GHJ A;  2LSS A;  3I56 A;  1S5C D;  4Y52 H;  4GKJ L;  4R8N A;  1Y1V B;  4QB4 A;  3S2H H;  2BH2 A;  4FF2 A;  1GUN A;  1XNR Q;  1BCP D;  2ID0 A;  4FO2 A;  4IFD G;  1V1P B;  3J80 c;  5BN3 A;  2FMC A;  2KCT A;  2RBM A;  1HZC A;  3J80 E;  4QQB X;  4IUQ A;  3R2T A;  4CJ1 B;  1O78 A;  1L1O C;  3R93 A;  3DHQ A;  1S4Z A;  1MSG A;  4K0K L;  1NJI C;  4HED A;  2FIN B;  2R93 G;  4N8F A;  3CCQ A;  3I55 A;  2LS0 1;  1HNW Q;  5J3B A;  4G57 A;  1SNQ A;  4I65 A;  3TZD A;  4UY8 C;  4YWM A;  5FLM G;  3DUZ A;  1QNK A;  4NDX A;  4TVA B;  1KLU D;  3K7U C;  3T56 B;  3MA2 B;  1VQP A;  4LF4 L;  2JEB I;  1WD0 A;  5M3M B;  1B2T A;  4GN3 B;  1Y14 B;  4BY1 H;  4RH6 A;  1FNU A;  4BBR H;  4GLA C;  2EYH A;  2HD3 A;  5JEA H;  1EY0 A;  4HIM A;  3GTQ H;  1EIH A;  1J5E L;  2PZW A;  2HQL A;  2KCC A;  1IHZ A;  2SOB A;  3S24 A;  1D5X C;  5EKI A;  3K57 A;  3UI2 A;  1X3P A;  4L63 B;  3SR1 A;  3S1R H;  3TP5 A;  4JI4 Q;  1SYG A;  2UUB Q;  2KA7 A;  3RZD H;  1H9R A;  3PF4 A;  2MNA A;  3L9A X;  2D0O A;  4A3C H;  1EOT A;  1SFO H;  3G6J B;  3P7J A;  4A93 B;  1G2T A;  1QNU A;  1JOR A;  2VB2 X;  4X64 Q;  5JJK A;  1HHV A;  3KLW A;  1I4Q A;  3EA6 A;  2VY3 A;  2F0V A;  1U4P A;  4B3S L;  1PYS B;  2HIV A;  3AQQ A;  4DV1 Q;  5FJ8 G;  1NMF A;  3RLO A;  4O42 A;  5H1S E;  2R92 G;  1IYU A;  3A74 A;  4A3B B;  1E2Z A;  3LWU A;  1Q8I A;  1CTM A;  3OTO L;  3GTL H;  2EYP A;  3IL8 A;  3CMA A;  4J15 A;  1PLF A;  1VQJ A;  1E7Z A;  1WTW A;  4HJ9 A;  1DCZ A;  1HPC A;  3QOL A;  4R4I A;  2KOL A;  1N9W A;  2CH4 A;  4G7Z C;  1VQF A;  3QG1 A;  4OO1 H;  1SEB D;  3FKI H;  1B1Z A;  1JWS D;  1Y8P B;  2G9D A;  2AMC B;  2B2V A;  2VXW A;  4HIK A;  3S2H B;  3MXU A;  1EUJ A;  5ELO A;  5IYB G;  4HMJ A;  2YU9 H;  4ULL A;  3I91 A;  5CV4 A;  3HG9 A;  3R8B A;  2UU9 Q;  3DWA A;  4JV5 Q;  3I70 A;  2JSO A;  1WTX A;  1EZ6 A;  3CCL A;  4A3J H;  3IRB A;  3F2U A;  3HOV B;  2YTX A;  5EGT A;  1H9J A;  1PRT D;  4JI7 Q;  5JVG 3;  1RDP D;  1SBB B;  2EZV A;  1XNQ L;  3SK4 A;  1EOV A;  4IZ8 A;  1XNR L;  5IGB A;  1EEF D;  2ALY B;  3T13 A;  1UE1 A;  5C3E H;  2Y0S B;  2NZO A;  1R4P B;  4DV7 Q;  2LKV A;  1QB5 D;  1GJX A;  1VQH A;  5C0X H;  3AFP A;  1HXY D;  2OTL A;  4QCL A;  4C56 C;  5LHY 1;  2KEC A;  2JN4 A;  1JT8 A;  1BOS A;  4BY1 B;  2A6E D;  1IZ6 A;  4BBR B;  3STB D;  1Q3L A;  3A5Z B;  1ICF B;  1FR3 A;  5T1I A;  2AQ3 B;  3J80 i;  4J6H A;  2EIF A;  4DUZ L;  5GQO A;  2DUD A;  2E2D C;  3D4W A;  4QIW E;  1XTD A;  1BBX C;  1PH4 A;  2UXC Q;  3S1R B;  3B6Y A;  3HKZ G;  1FL0 A;  4LW1 A;  2RHS B;  3WOF A;  3JAM L;  4XQJ A;  3HOX G;  5FKA C;  1VQC A;  1SFO B;  2IX1 A;  3LGJ A;  4JI6 Q;  3AYH B;  4WRD A;  1GKH A;  1W2B A;  1IBM L;  2F0K A;  2ICE C;  2DJF C;  4A3C G;  4DK0 A;  3UE0 A;  1W6K A;  4BBS G;  1SJE D;  1AZQ A;  3G71 A;  5EPJ A;  5J1Z A;  2UUC Q;  1NR4 A;  3GTL B;  5CGK A;  4A3G H;  2FFK B;  4GKK Q;  2K03 A;  4KKU A;  4LFB Q;  2AWN A;  1ESF A;  4X3U A;  2VZA A;  3CP0 A;  1TT2 A;  2B2W A;  3FKI B;  4K8J A;  2CKZ B;  2L5T A;  2EJM A;  2WB1 E;  2AUJ D;  4ID6 A;  5D3D A;  1WOC A;  1EY8 A;  1J8I A;  3K7A B;  1A62 A;  3F8T A;  4HCE A;  5EBD A;  3BZC A;  4IUN A;  3CCV A;  4A3J B;  1HNZ L;  3K5N A;  4P73 A;  4LFA Q;  3KUP A;  2A68 C;  4LFC L;  4KHP L;  1BO0 A;  1N33 Q;  1CKO A;  2F0I A;  1QOH A;  3HZX A;  2E75 C;  5C3E B;  1XPR A;  1HQM C;  3HFZ B;  4JV5 L;  1D8L A;  1NUC A;  1F2M A;  1IBK Q;  3V2T A;  2FHT A;  1PTO D;  2N3S A;  4DV3 Q;  1GUS A;  1LTL A;  5M5W H;  4EQN A;  1F9Q A;  3KF6 A;  4C1N I;  1HFN A;  4IFD J;  1HR0 Q;  5DM7 3;  1LO5 D;  1NNX A;  1SND A;  2M9V A;  1BVS A;  3FEW X;  1KRS A;  2JQO A;  3VDY A;  5C0X G;  3S1N H;  2DNE A;  1KDC A;  2BH8 A;  4TSS A;  4A3E H;  3LWE A;  4JI8 L;  2JA7 H;  2A69 C;  1VF7 A;  2ATW A;  4RFB A;  1QCB D;  2CW0 D;  2D9U A;  3ONA B;  4RKB A;  4JBW A;  1HUM A;  1KC8 C;  4DN4 M;  5BR8 Q;  4HSV A;  4DNR B;  1A2T A;  1TWH H;  4POF A;  5KNB A;  1TVX A;  2KJX A;  3OSO A;  3CC2 A;  2VW9 A;  1WI5 A;  3HEJ A;  4JYA L;  1SNP A;  1EIF A;  1LTT D;  1EZ8 A;  3MVV A;  2PNR C;  4A4I A;  1WTV A;  5IGF A;  2HQE A;  3D8G A;  1Z9F A;  4QL5 A;  3T1Y Q;  3IKJ A;  2K14 A;  2OEO A;  3CCE A;  2CWA A;  1BQQ T;  1GUO A;  3F2B A;  2IJ0 A;  2L0C A;  2L55 A;  4A3G B;  2EXZ A;  1RD9 D;  3Q0A A;  3T51 B;  1EYD A;  1U9R A;  3OMG A;  1FYC A;  1STB A;  1TWG H;  4ZAI A;  2D0P A;  1Q46 A;  3A7L A;  4G4K A;  4NMZ A;  4BY7 G;  5I6W A;  4JOI C;  4RHR A;  1J9O A;  1EWC A;  1SNM A;  4MHE A;  1VQ6 A;  1S5B D;  2R61 A;  3DMU A;  4KI0 A;  4JVZ A;  3T16 A;  4ILW A;  3K58 A;  3BJU A;  1YIJ A;  2UUC L;  2Z8L A;  1GUT A;  4FF4 A;  2K05 A;  3MXP A;  2WAQ G;  4HR7 B;  4G7H C;  4B08 A;  4A3I H;  4AH6 A;  5K36 G;  4DUY Q;  1XMO L;  3JC6 6;  1ESR A;  1PFN A;  1PDQ A;  4RAU C;  1YNN C;  2MO1 A;  4A3M H;  4ZUJ A;  4DR4 Q;  4QUC A;  1STA A;  1TKW B;  1Z47 A;  4LF5 Q;  5JPM C;  1U5K A;  5JJZ A;  3NEL A;  1EIY B;  1TU2 B;  5FO7 B;  1WYD A;  1LUZ A;  5IYD H;  5CMD A;  2DY8 A;  1XMQ L;  2VUM B;  2VNU D;  3CC7 A;  1N32 Q;  1NAP A;  2K1B A;  2KED A;  1PA6 A;  4C2M H;  5EQ0 A;  4DV2 Q;  2F0Q A;  5HGQ A;  5M5W B;  3BDC A;  2RHQ B;  3I72 A;  1H9S B;  4HID A;  1GM5 A;  3PF5 A;  4NW2 A;  4C3H B;  5IP9 H;  3KK7 A;  1PH6 A;  3S1N B;  4ZYS A;  1X54 A;  1A2U A;  1LAB A;  4Q0F A;  4L5S A;  2JA7 B;  5JVH 3;  2F4I A;  3TRZ A;  2E76 C;  1LT6 D;  1LTB D;  1KHI A;  1O7Z A;  2IPK D;  5KNC A;  4A3E G;  2I5M X;  3NBI A;  1TWH B;  2NTT A;  2B63 G;  4WJ4 A;  3PIO 3;  1DON A;  3DXJ C;  3J80 L;  3C1F A;  1DOM A;  4POG A;  2HHH Q;  3PUY A;  3G6E A;  1VQ9 A;  2QW7 A;  3PIO A;  3GTJ H;  4MTN A;  5JOB A;  1SE2 A;  2WIN B;  3C2P A;  4H02 A;  3I7F A;  5J39 A;  1QZH A;  1WTP A;  1QE6 A;  2I07 B;  3K81 C;  4DGZ A;  1EQQ A;  1JWM D;  1Q90 A;  2V1C C;  4MIU A;  5C4H A;  5E1F A;  2O2L D;  1TII D;  1ZXT A;  2N49 A;  1G91 A;  3BVG A;  2IW3 A;  4B3M Q;  2L11 A;  5M5X H;  4OGQ C;  1K83 H;  1M4V A;  1AEX A;  3R3O A;  2YV5 A;  3KFU A;  1CUK A;  1TWG B;  5F2D A;  3T1Y L;  3Q23 A;  1YNJ C;  1Q12 A;  2EE1 A;  4BXX G;  4P74 A;  2A5H A;  2E5L L;  2R6G A;  3H15 A;  2M2L A;  4CKB A;  4GLV B;  4N8X 1;  1FGB D;  4L5R C;  1N8R C;  5IGG A;  5AJ3 L;  3M4Q A;  2K5V A;  4KHV A;  4GKJ Q;  1LT5 D;  4H13 C;  1KXL A;  2HDM A;  4A3I G;  1S5E D;  3UDG A;  4U67 3;  1F2Y A;  1UWV A;  1YZ6 A;  3PQI A;  5C3W A;  4UP9 A;  4RCO A;  3KF8 B;  5EKL A;  1MJC A;  1HRJ A;  3CQZ H;  3PGZ A;  3HOZ G;  2CH4 W;  4UHV A;  4LAA A;  2A6H C;  2SEB D;  1UNS A;  4LK1 C;  2UXD Q;  1STN A;  2IX0 A;  1VQG A;  2B3G A;  2RSO A;  3P20 A;  4IFD H;  3S14 B;  2YTY A;  4DR4 L;  4C2M B;  4K0K Q;  3NPP A;  4OIK A;  1ILP A;  1ML0 D;  3GDE A;  3W3A A;  3RNU A;  2IHE A;  1VQB A;  2EYJ A;  1CHP D;  4OWX B;  1SR3 A;  2L1B A;  2R93 H;  3AMU A;  2HT1 A;  2SDF A;  4KD4 A;  1PVO A;  4N9P A;  4TKO B;  4LUV A;  1IKM A;  3KLR A;  3W5O A;  2J4X A;  2O5I C;  1ZYR D;  4J1M A;  4HJA A;  2DY7 A;  4LF4 Q;  4TRD A;  3SGI A;  5FLM H;  4YHH L;  2F0O A;  1Q86 C;  4JPB W;  3D0F A;  5BN4 A;  4Q5V A;  1HTL D;  1SE3 A;  1WFQ A;  1UEB A;  1Z7T A;  3KJP A;  4CDC C;  2X6G A;  4GLX A;  4QIW B;  4X3T A;  2EYM A;  4R8I A;  1J5E Q;  2D62 A;  1F2L A;  1M8A A;  1KNA A;  4KK7 A;  5CV9 A;  3MZ5 A;  5CBE E;  1VQ4 A;  2F0L A;  1SNO A;  3NTI A;  2PCF B;  1B9N A;  1SJH D;  3E0J A;  3U4Z A;  3S2D H;  4IAL A;  4Y7N H;  1Z6H A;  5KRU A;  4FF1 A;  3KDF A;  1IYV A;  2XTI A;  2HHH L;  3KLS A;  3ERQ A;  1I6V C;  1PH3 A;  4K5X A;  5M5X B;  4L8J A;  1K83 B;  2I5H A;  1SMX A;  4HJ7 A;  1H95 A;  1K3R A;  3PO2 H;  3MFG A;  1TY0 A;  1EU4 A;  2HCC A;  3L2P A;  1CKN A;  3HOU G;  4QJF A;  4IN3 A;  4AYB G;  5D65 A;  3HP3 A;  4DAY A;  3QB3 A;  2RCF A;  3GTP H;  3PUZ A;  3KF8 A;  3OTO Q;  2PZU A;  3M3Y H;  3HOY G;  2R92 H;  1TS2 A;  3GTM H;  1OXV A;  2ZM6 L;  1DD2 A;  4GNX B;  1XJV A;  3H94 A;  1VMC A;  3M4O H;  1HH2 P;  2KUM A;  4RGM A;  4TQU S;  3N52 A;  3I2Z A;  2WB1 G;  3J81 c;  3M7G A;  2WAQ E;  3D4D A;  2EXD A;  2BE5 C;  1X3F A;  4RG1 A;  3J81 E;  1V9P A;  4DAM A;  1X6O A;  1K8O A;  3CQZ B;  1GUG A;  1QUQ A;  4K5W A;  2B2Y C;  1KAA A;  1F9R A;  3SHL A;  5IYB H;  2Z9H A;  1G2S A;  1ET9 A;  2JE6 I;  4YCW A;  2EPB A;  3A8K E;  1ILQ A;  1I6H H;  1QVF A;  2JA5 G;  3QWN A;  5C4J H;  1XNQ Q;  2BA1 A;  4KY5 A;  3E0E A;  5D3I B;  5FK9 C;  2F0N A;  2R3Z A;  4IJH A;  2R93 B;  1FJG L;  4DPG A;  4OHJ A;  5E4X A;  2UXD L;  3SK6 A;  4YY3 L;  3H09 A;  4DR6 Q;  2AWO A;  2B2Y A;  1WTQ A;  4DK1 A;  5IP7 H;  3SE0 A;  1S3O A;  1X55 A;  1SXT A;  2QGQ A;  4OIJ A;  1JB3 A;  3RUZ A;  4DXF A;  4CHT B;  3CHB D;  2NBF A;  2OF1 A;  1LTG D;  2OQ0 A;  4R4O A;  4XYO A;  3PUX A;  3VYR A;  4XT3 B;  1HFG A;  4GNX C;  3L0O A;  3K0Y A;  2K32 A;  1Y1V G;  2WP8 J;  1SE8 A;  4DUZ Q;  4YWL A;  1UE5 A;  4KV6 A;  3OHX C;  5HGT A;  3RZO H;  4HAE A;  2NUC A;  1L1O A;  1B53 A;  2GVB A;  3CCS A;  1AH9 A;  1U4R A;  1M90 C;  2K33 A;  3NWT A;  2OWO A;  3PO3 G;  1BCP F;  2NYZ D;  3I4M G;  5JJI A;  2LXK A;  3HOX H;  1IBM Q;  4KN4 C;  3D31 A;  2Z4I A;  4JI2 L;  1UEA B;  4L5T A;  1SSO A;  4QUF A;  1GOZ A;  2NVQ H;  3NBH A;  3ND8 A;  4C3I B;  1C8C A;  3SEB A;  4LF8 L;  4K6D A;  3GTP B;  4A3D G;  4BBS H;  3K5L A;  2ZXP A;  3PO2 G;  1A0I A;  2EOT A;  4HN7 A;  1UE7 A;  5C4X H;  3M3Y B;  5FOB B;  4ZKC B;  5LMN W;  2JJQ A;  3GTM B;  4XIG S;  1C9O A;  1AW7 A;  3H0G G;  2C9O A;  4A3K G;  2KVM A;  3FVQ A;  5EAY A;  1A15 A;  5C5L A;  2PNH A;  1V1P A;  2L9H A;  1Y8O B;  4ZCK A;  1I50 H;  4LF9 L;  1JOQ A;  3GV3 A;  1WCM H;  1CSQ A;  4K14 A;  4PZ7 A;  3ERO A;  1RJT A;  1Y1W G;  5FLX c;  4ALP A;  2XN9 C;  1KD1 C;  1HNZ Q;  1HA5 A;  1D7Q A;  5FLX E;  4R1J A;  5D14 A;  4V0B A;  1KAW A;  1VQE A;  4O0A A;  1I6H B;  1B8A A;  4LFC Q;  4KHP Q;  1B44 D;  4XQQ A;  5C4J B;  2IHF A;  2VB3 X;  3PCO B;  1KQS A;  4A3L G;  1T5E A;  1PH9 A;  1JJ2 A;  3ICE A;  5EPL A;  5I6Y A;  1YBY A;  2KHJ A;  2NTS A;  1A6X A;  1FD7 D;  4CDF C;  4EVO A;  2XGT A;  1E3P A;  4FP5 D;  1E2V A;  1G6Z A;  3D6W A;  1T5X D;  3J7Z C;  1Y8N B;  2F1M A;  2CFM A;  3J81 i;  3W1B A;  4DR3 L;  2ENB A;  3GO5 A;  3TS2 A;  5IGC A;  5IP7 G;  4JI8 Q;  5M9O A;  3MXN B;  4DR6 L;  3NQI A;  3E3X A;  4RHS A;  2J7Z A;  3P75 A;  2E2J H;  1DOL A;  3RZO B;  1EQT A;  3T53 B;  1TWA H;  4NXN L;  5IYC G;  4X66 L;  1XXG A;  3NK9 A;  2PPB C;  2UUA L;  1P8L A;  2EVB A;  5FO8 B;  2H1E A;  3GTQ B;  3VYS A;  2MGS A;  3HKZ B;  2PZT A;  3KJO A;  3I8Z A;  4QY7 A;  4JYA Q;  1R9T H;  1RTO A;  1U4M A;  3R2I A;  3FHW A;  1QJO A;  3E9I A;  3TME A;  3A8I E;  4JC0 A;  3HOX B;  1RHP A;  3MEF A;  4RMF A;  3RZD B;  2NVQ B;  2I0Q A;  5TSS A;  1JC7 A;  1PRT F;  2SNM A;  4P75 A;  3UDX A;  5ELC A;  4DAV A;  2L4N A;  4QGU A;  4U68 A;  1N36 L;  3CD6 A;  1ICW A;  2B39 A;  5EJW A;  3W1G A;  4BBS B;  3D4R A;  1A8V A;  2MPM A;  3OIQ A;  4MN3 A;  3BU2 A;  2R7F A;  2F3I A;  1J6Q A;  1EY4 A;  4S3S A;  4AYB E;  4LNQ A;  3CCU A;  4IUT A;  1ET6 A;  3HOW G;  3G4S A;  1PH7 A;  5C4X G;  1TS4 A;  1I4P A;  3S1Q H;  3I3C A;  2B29 A;  4BY7 H;  1VQI A;  4A76 A;  1I50 B;  5IT9 c;  2QA4 A;  1XMO Q;  4ZUI A;  4V19 0;  1HR0 W;  5IT9 E;  1MD2 D;  1XWE A;  4NPS A;  1UE6 A;  2QCP X;  2PYK A;  4C3J H;  5K36 H;  4XT1 B;  3J7A V;  3QIA A; 
#chains in the Genus database with same CATH homology
 2UXB Q;  1WCM G;  3G48 A;  2VNU D;  3CC7 A;  4JI5 Q;  1N32 Q;  5M5Y H;  4A75 A;  3U4V A;  5IE8 A;  1X9N A;  4JI3 L;  1PA6 A;  1VQK A;  2L15 A;  4R4Q A;  2OQK A;  4PMW A;  4C2M H;  4DV2 Q;  1SN8 A;  3J81 j;  3M7N A;  3S1M H;  5HGQ A;  4HJ8 A;  4B3T Q;  1XMQ Q;  2EQS A;  2RHQ B;  4DR5 L;  4HID A;  1S40 A;  2WFW A;  3HKS A;  2OCE A;  3PF5 A;  1GM5 A;  5IP9 H;  3K8A A;  3NEN A;  4UP7 A;  1PH6 A;  1KRT A;  1TXY A;  1PYB A;  1BBU A;  1YNX A;  1X54 A;  5C0X J;  1NMG A;  4DR5 Q;  1K73 C;  3KOJ A;  4L5S A;  4LUZ A;  5M3F H;  1IL2 A;  3TRZ A;  4OWT B;  3JAM i;  4A93 G;  4KLK A;  1KHI A;  2CCZ A;  2KEN A;  4A3E G;  1C0A A;  2I5M X;  1TWF H;  2B63 G;  1VQ8 A;  1N34 L;  4WJ4 A;  5C44 H;  2NN6 I;  2K5H A;  3K80 C;  4B3S Q;  3DLL A;  4KHZ A;  3ULL A;  4POG A;  4OX9 L;  4AIM A;  2HHH Q;  1OXU A;  3PUY A;  1VQD A;  5IWA L;  3G6E A;  4DR2 Q;  2FXQ A;  1VQ9 A;  3PIO A;  3GTJ H;  4MTN A;  1L1O B;  4C3I H;  3F2D A;  4A3B G;  1N34 Q;  4BA2 I;  4H02 A;  2ZTD A;  3I7F A;  4UPA A;  4JBJ A;  4X65 Q;  4A93 H;  1QZH A;  4EX5 A;  5FJ8 H;  3EIV A;  4OX9 Q;  4B3M L;  3K81 C;  5IWA Q;  1EQQ A;  2B63 H;  2V1C C;  3ER0 A;  4MNO A;  3CPF A;  3RR5 A;  1G29 1;  3UE1 A;  2LXJ A;  1KIX A;  3L7Z C;  3NEM A;  1NTG A;  2JA9 A;  2N49 A;  1JB7 A;  4B3M Q;  3K7A H;  5M5X H;  4A3B H;  1YIT A;  1K83 H;  1M1K C;  5LMN L;  3M4P A;  2A1A A;  3ULP A;  2K52 A;  4IPC A;  3NBH B;  2YV5 A;  2PI2 A;  1E1O A;  4X62 Q;  5GAD C;  1CUK A;  4AQY L;  3KFU A;  3STB C;  3T1Y L;  3CF5 A;  4IPG A;  1YJW A;  4GOP B;  1Q12 A;  4LF7 L;  4BXX G;  4P74 A;  1I5F A;  2LSS A;  1YHB A;  3I56 A;  1Q1E A;  1MJE A;  5LMN Q;  3CAM A;  2E5L L;  2IY5 B;  4DR7 L;  2R6G A;  4Y52 H;  4AQY Q;  4PZ8 A;  3HOV G;  1LM0 A;  3H15 A;  4GKJ L;  4LUO A;  1XPO A;  3E9H A;  3S15 H;  4LF7 Q;  1EWI A;  4GLV B;  1K8A C;  2Q2U A;  4OON A;  2BH2 A;  2R7Z G;  3S2H H;  3ULJ A;  4ME3 A;  4L5R C;  1N8R C;  2E5L Q;  1GVP A;  1XNR Q;  4DR7 Q;  1U0L A;  2ID0 A;  5AJ3 L;  3M4Q A;  2K5V A;  4IFD G;  4GKJ Q;  3J80 c;  4BXX H;  2Y0S G;  4A3I G;  1KXL A;  2JK8 A;  2KCT A;  4MZ9 A;  1HZC A;  2PQA B;  4DKA C;  3UDG A;  3U58 A;  4QQB X;  1HNW L;  1UWV A;  1YZ6 A;  2ASB A;  4UP9 A;  1L1O C;  4DV0 L;  3KF8 B;  1MJC A;  5AJ3 Q;  3DM3 A;  3CQZ H;  3CME A;  3PGZ A;  4NB3 A;  3TEH B;  2R7Z H;  3HOZ G;  1NJI C;  1TWC H;  1VQ5 A;  4K0K L;  2R93 G;  3CCQ A;  3I55 A;  3OW2 A;  4BY1 G;  1HNW Q;  2UXD Q;  5J3B A;  2IX0 A;  1VQG A;  2B3G A;  1EYG A;  4BBR G;  4DV0 Q;  2YTY A;  4DR4 L;  5JEA G;  4UY8 C;  4YWM A;  5FLM G;  4K0K Q;  1IBL L;  4TVA B;  1OXX K;  3K7U C;  3KF6 B;  4IOC A;  2K50 A;  3GDE A;  3RNU A;  2IHE A;  1VQB A;  2GVA A;  3H3V I;  1P16 A;  3GD7 A;  1VQP A;  4LF4 L;  2JEB I;  4OWX B;  4LF6 Q;  3HOZ H;  1SR3 A;  3RN5 A;  1PFS A;  2R93 H;  1G51 A;  1Q81 C;  2HT1 A;  1PVO A;  4GN3 B;  2KCM A;  1Y14 B;  4O2D A;  4JI5 L;  4LUV A;  4GOP C;  4BY1 H;  3W5O A;  2I5L X;  4JOI A;  4BBR H;  4GLA C;  4HJA A;  4HIM A;  3GTQ H;  3KYH C;  4JI4 L;  4LF4 Q;  3SGI A;  5FLM H;  4YHH L;  3TS0 A;  1S72 A;  4B3T L;  2UUB L;  4P71 A;  1Q86 C;  1J5E L;  2HQL A;  3S24 A;  3D0F A;  4IFD I;  3PIP A;  3ERS X;  5M3F G;  1WFQ A;  1UEB A;  3KJP A;  3S1R H;  4JI4 Q;  1CKM A;  4YHH Q;  4GLX A;  2VQF L;  2UUB Q;  1J5E Q;  5ELN A;  3GTO H;  2K75 A;  4X64 L;  3RZD H;  2OTJ A;  2D62 A;  3M9B A;  3PF4 A;  2MNA A;  3U50 C;  2JEA I;  2D0O A;  1VQ4 A;  4A3C H;  5C44 G;  1SFO H;  1K0R A;  4GOP A;  4LWC A;  4DV1 L;  4APV A;  2VQF Q;  1HNX Q;  1PV4 A;  4X64 Q;  5JJK A;  3U4Z A;  3S2D H;  1W3S A;  1YJ9 A;  4DK6 C;  4Y7N H;  5LMU L;  3KLW A;  3T1H Q;  2VY3 A;  1FVI A;  1YHA A;  4B3S L;  3KDF A;  4OO1 G;  3FKI G;  1PYS B;  2XTI A;  2HIV A;  4DR2 L;  3AQQ A;  1PHJ A;  4DV1 Q;  5FJ8 G;  2HHH L;  2JA8 G;  2PMZ E;  1HJP A;  1NMF A;  3RLO A;  4BA1 I;  5H1S E;  1PH3 A;  2R92 G;  1N36 Q;  2A19 A;  3A74 A;  1VQ7 A;  5LMU Q;  2I5H A;  2MFI A;  3OTO L;  3GTL H;  1C7Y A;  4X65 L;  1RL2 A;  3CMA A;  1SMX A;  4J15 A;  4HJ7 A;  1H95 A;  1VQJ A;  1E7Z A;  2HIX A;  1K3R A;  3PO2 H;  1HZ9 A;  3M85 A;  3L2P A;  1CKN A;  2PQA A;  3HOU G;  4QJF A;  4HJ9 A;  4AYB G;  2VL6 A;  4R4I A;  1N9W A;  3GTP H;  1VQF A;  3PUZ A;  3OTO Q;  1QVC A;  1JJC B;  3FKI H;  2C35 B;  4A3J G;  2Y0S E;  1OXS C;  2JA8 H;  2VUM H;  2UU9 L;  3M3Y H;  3HOY G;  2R92 H;  2AMC B;  1MKH A;  3CCJ A;  4HIK A;  3PUV A;  1OXV A;  2CQO A;  3GTM H;  1MIU A;  4IPD A;  1EUJ A;  1GO3 E;  5ELO A;  5IYB G;  4X62 L;  2ZM6 L;  4GNX B;  1XJV A;  2YU9 H;  5C3E G;  1SLJ A;  3HOU H;  3M4O H;  2UU9 Q;  1HH2 P;  4JI7 L;  4A3F G;  4JV5 Q;  3A5U A;  4IO9 A;  3CCL A;  4TQU S;  4C3H H;  4OWW B;  1OXT A;  3I2Z A;  2WB1 G;  3J81 c;  2ZM6 Q;  4A3J H;  1YEZ A;  2WAQ E;  2CWP A;  3IRB A;  2YTX A;  2EXD A;  3HOY H;  1X3F A;  4RG1 A;  3ZJY C;  1V9P A;  4DAM A;  1X6O A;  1A63 A;  1QUQ A;  4HJ5 A;  2N78 A;  4JI7 Q;  3OYY A;  1XNQ L;  5IYB H;  4DV7 L;  4OO1 I;  1EOV A;  1HZB A;  1XNR L;  4PZ6 A;  2ALY B;  1UE1 A;  5C3E H;  1G6P A;  2JE6 I;  4YCW A;  4A3F H;  1NE3 A;  2NZO A;  1I6H H;  2E2I H;  2JA5 G;  1QVF A;  5C4J H;  1VQN A;  1XNQ Q;  4DV7 Q;  2BA1 A;  4DNI A;  3E0E A;  2JA6 G;  3EBE A;  1VQH A;  2VS1 A;  4IJH A;  2RCN A;  3AFP A;  2OTL A;  1K8G A;  4GN5 A;  1ASZ A;  1Q7Y C;  4JG2 A;  1FJG L;  4DPG A;  1JT8 A;  2UXD L;  4YY3 L;  1X56 A;  2MO0 A;  4DR6 Q;  1IZ6 A;  2AWO A;  3STB D;  2UXC L;  3CXC A;  3CCM A;  5IP7 H;  3A5Z B;  1S3O A;  1VQL A;  4UP8 A;  1X55 A;  2JA5 H;  3J80 i;  2QGQ A;  2KHI A;  2EIF A;  4OXP A;  4P72 A;  4DUZ L;  5IY0 A;  1FJG Q;  2JA6 H;  4YY3 Q;  5GQO A;  4R4O A;  2DUD A;  2OQ0 A;  4QIW E;  3PUX A;  1XTD A;  5GAH C;  4DV4 Q;  4LF6 L;  1PH4 A;  2UXC Q;  4GNX C;  3L0O A;  4JI6 L;  3B6Y A;  1Q8K A;  1FL0 A;  3HKZ G;  4DV5 L;  5K36 G;  4LW1 A;  2RHS B;  1Y1V G;  2YTV A;  2WP8 J;  1SE8 A;  4DUZ Q;  3WWV A;  4YWL A;  3HOX G;  1UE5 A;  3RZO H;  1VQC A;  2IX1 A;  3LGJ A;  4DR1 L;  4JI6 Q;  3AYH B;  4A3G G;  4DV5 Q;  1L1O A;  4EQ5 A;  1GKH A;  1VQM A;  2GVB A;  4GN4 B;  2ZJP A;  3CCS A;  2NVT H;  1AH9 A;  1W2B A;  1IBM L;  3FP9 A;  3UDF A;  3HOW G;  4A3C G;  1M90 C;  2N8N A;  3CPW A;  2OWO A;  4DR1 Q;  3PO3 G;  4GKK L;  1Y1V H;  1O7I A;  3UE0 A;  4LFB L;  4BBS G;  3G71 A;  1Q1B A;  1I94 Q;  3I4M G;  5JJI A;  2LXK A;  3HOX H;  1IBM Q;  2RF4 A;  1JE5 A;  1BBW A;  1VCI A;  3D31 A;  2UUC Q;  1K9M C;  2ES2 A;  4JI2 L;  4JBM A;  4A3G H;  1B70 B;  4L5T A;  2VQE L;  1HNX L;  4GKK Q;  4LFB Q;  2AWN A;  2NVQ H;  2E2H H;  3T1H L;  3RLF A;  2VZA A;  1I3Q H;  1E24 A;  4LF8 L;  3CP0 A;  1QVG A;  3PO3 H;  4JI2 Q;  3CC4 A;  1X3G A;  4A3D G;  3BZK A;  4BBS H;  1HZA A;  1IXR A;  1T9H A;  2VQE Q;  2CKZ B;  5GRO A;  3I4M H;  1A0I A;  3TQY A;  5C4X H;  1UE7 A;  2WB1 E;  3PO2 G;  4X6A H;  5LMN W;  2JJQ A;  2KBN A;  3RN2 A;  3S14 H;  2Q2H A;  2H5X A;  4LF8 Q;  4XIG S;  3S17 H;  1C9O A;  3H0G G;  1E1T A;  4LFA L;  3RLN A;  5GAG C;  4A3K G;  1WOC A;  2F4V L;  2VUM G;  1RIP A;  2IT1 A;  1YJN A;  2ZTC A;  4YCV A;  5EAY A;  1A62 A;  2YYZ A;  3F8T A;  2ZJQ A;  2PNH A;  1V1Q A;  1N33 L;  3BZC A;  4A3D H;  3CCV A;  3JAM c;  1HNZ L;  4JI3 Q;  3PUW A;  5M3M H;  4P73 A;  1I50 H;  5HY6 A;  4LFA Q;  4LF9 L;  3PV0 A;  1Q82 C;  3I4N G;  2F4V Q;  1WCM H;  1AE3 A;  1CSQ A;  4PZ7 A;  4LFC L;  1IBK L;  4KHP L;  4R4T A;  4DV3 L;  2K5N A;  1CKO A;  1Y1W G;  1N33 Q;  1LYL A;  3H0G H;  4PG3 A;  5FLX c;  4ALP A;  1KD1 C;  1HNZ Q;  1XPR A;  4A3K H;  4YWK A;  1D7Q A;  4R1J A;  2GN5 A;  3HFZ B;  4LF9 Q;  4JV5 L;  2Z6K C;  1D8L A;  1KAW A;  1VQE A;  1HR0 L;  4O0A A;  1B8A A;  5GAE C;  1IBK Q;  4LFC Q;  2JA7 G;  4KHP Q;  5DLQ E;  2N3S A;  4DV3 Q;  1LTL A;  2IHF A;  5M5W H;  3I4N H;  3PCO B;  1KQS A;  4A3L G;  2DGY A;  1IYJ B;  1PH9 A;  1JJ2 A;  3ICE A;  3KF6 A;  1YBY A;  2KHJ A;  3I4O A;  2NVX H;  1HR0 Q;  4IFD J;  2NVY H;  1Y1W H;  3Q8D A;  2QEX A;  1BVS A;  3HKZ E;  1KRS A;  2JQO A;  2XGT A;  2AHO B;  5BR8 L;  3VDY A;  5C0X G;  3GTK H;  3S1N H;  2AKW B;  2BH8 A;  1E3P A;  4A3E H;  4JI8 L;  2NZH A;  2JA7 H;  2ATW A;  3J7Z C;  3TRE A;  1PH5 A;  2ZJR A;  2Z6K A;  4IPH A;  4JBW A;  2CFM A;  1EFW A;  3J81 i;  1KC8 C;  4A3L H;  1X3E A;  3W1B A;  5BR8 Q;  4DR3 L;  1SRO A;  1AE2 A;  3GO5 A;  1XPU A;  3TS2 A;  4DV6 L;  5IP7 G;  2F52 A;  1TWH H;  4JI8 Q;  5JEA J;  4POF A;  3MXN B;  2MQH A;  4IJL A;  2Z0S A;  4NXM L;  2ZTE A;  4DR6 L;  3AEV A;  1L2F A;  2K4K A;  4DR3 Q;  2VW9 A;  1WI5 A;  2E2J H;  3CC2 A;  3J7A 5;  1NY4 A;  4DV6 Q;  4JYA L;  1TWA H;  4NXN L;  5IYC G;  3AFQ A;  1EIF A;  4X66 L;  1B7Y B;  4NXM Q;  4DV4 L;  1P8L A;  2UUA L;  4A4I A;  1VQO A;  1Z9F A;  4QL5 A;  3T1Y Q;  4B3R L;  3KDF B;  3KJO A;  2K14 A;  4JYA Q;  4QY7 A;  4WJ3 M;  1R9T H;  4NXN Q;  1WJJ A;  3FHW A;  2CWA A;  3CCE A;  4FDB A;  1DGS A;  3E9I A;  3F2B A;  4X66 Q;  1JJG A;  2PI2 E;  4JC0 A;  2UUA Q;  4JI1 L;  3F2C A;  3S16 H;  3H3V H;  2BA0 A;  4B3R Q;  5IYC H;  3K0X A;  3MEF A;  1KL9 A;  4L5Q A;  4RMF A;  4R4C A;  1PH2 A;  5C0X I;  2I0Q A;  4JI0 L;  1CKN B;  3A0J A;  4GS3 A;  1ASY A;  1TWG H;  4DAY B;  3HOV H;  2D0P A;  1Q46 A;  4P75 A;  3UDX A;  4BY7 G;  4JI1 Q;  1VS0 A;  4DK3 C;  4A3M G;  4QGU A;  4JOI C;  1N36 L;  3PSI A;  1JMC A;  3W1G A;  4DUY L;  1EQR A;  1YHQ A;  1I94 L;  3CD6 A;  1VQ6 A;  3GTG H;  3EN2 A;  1A8V A;  4KI0 A;  1QZG A;  2E8G A;  4JI0 Q;  3BJU A;  1YIJ A;  3BU2 A;  2UUC L;  3CCR A;  2A8V A;  2R7F A;  2F3I A;  1L0W A;  1PH1 A;  1J6Q A;  4AYB E;  4LNQ A;  4A3I H;  2WAQ G;  3CCU A;  1V43 A;  4HIO A;  3F1Z A;  1NBW A;  4JCV E;  4AH6 A;  1SRU A;  5IYD G;  4DUY Q;  3JC6 6;  3G4S A;  1XMO L;  4GNX A;  1YI2 A;  1PH7 A;  1OTC A;  4LF5 L;  5C4X G;  1BKB A;  1CSP A;  3S1Q H;  4BY7 H;  2B29 A;  2R7D A;  1VQI A;  2MO1 A;  1GD7 A;  3CW2 C;  4A3M H;  4JBK A;  4A76 A;  1FGU A;  4DR4 Q;  1YVC A;  1E22 A;  2Q2T A;  2NN6 G;  3UDI A;  5E7N A;  5IT9 c;  2QA4 A;  2Q2I A;  1XMO Q;  1IBL Q;  2UXB L;  1Z47 A;  4LF5 Q;  1HR0 W;  1N32 L;  1QUQ B;  4YCU A;  1X65 A;  1U5K A;  4XTC S;  5IP9 G;  3NEL A;  1EIY B;  5JJL A;  4DV2 L;  4NPS A;  1PH8 A;  1UE6 A;  1LUZ A;  1WYD A;  4C3J H;  3HOW H;  5M3M G;  5IYD H;  1XMQ L;  1VQA A;  4IOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...