2N8NA

Solution structure of translation initiation factor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics study of translation initiation factor 1 from Staphylococcus aureus suggests its RNA binding mode
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Translation
molecule keywords Translation initiation factor IF-1
total genus 16
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n8nA00
1RL2A 2NVQH 4DR6Q 4LFAQ 1VQDA 1Q1EA 4DV4L 1PV4A 4A3EG 4JI2L 3UDFA 3HOYG 2I5LX 2OCEA 4R4CA 4HIKA 3CCQA 1PH4A 4ME3A 2UXBQ 1XMQQ 4LF4Q 4A3FG 2OQ0A 3BU2A 4A3JH 3PF5A 4A3KH 4DR7Q 4OO1G 1Z9FA 2YV5A 5DLQE 1J5EQ 3CMEA 1X56A 2NZOA 5AJ3L 1L1OC 1JE5A 4QIWE 3HOWH 1Z47A 3EN2A 1PYBA 1I6HH 4RG1A 2JA8H 4PG3A 1HNZQ 4YWKA 1OTCA 4C3HH 4BBSG 4A3LH 2VQEQ 5JJKA 1PHJA 2ZJQA 3KF6A 1MIUA 2B63G 4QQBX 4YCWA 4B3SQ 1G291 1CKOA 1Y1VG 3EBEA 3ER0A 4LF4L 2KCMA 3A5ZB 4QGUA 4NXNQ 4JV5Q 1PH2A 4AQYQ 2KENA 5IT9c 1B7YB 4GLAC 1X3GA 2R7FA 5GAGC 4LFAL 5HGQA 3BJUA 2NVTH 2BH8A 1MJCA 5AJ3Q 4HJAA 2K5VA 3NBHB 3GTLH 2IX0A 1PA6A 1IBMQ 4DR5Q 2QA4A 1QVGA 3F2CA 4GLXA 4L5SA 4LF7L 1HNZL 3CC2A 4B3RQ 4GOPC 2CCZA 4JI8Q 1YHBA 1GO3E 1EUJA 4BXXH 4DV7L 1HZBA 2JA7G 1VS0A 1VQ6A 2RHSB 2E5LL 3GTGH 1GVPA 1KQSA 2NN6G 2NVYH 1J5EL 3STBC 4JI6L 4GKKQ 4BY7H 4P73A 2BA1A 3A0JA 3LGJA 3E9HA 2VS1A 1N8RC 3I2ZA 4JCVE 3ICEA 5JJLA 2GN5A 2UXBL 4YCUA 3DLLA 3HOVG 4BBRH 1HNWL 1SR3A 3F1ZA 4DV5L 3W1GA 1PH7A 1TWFH 4C2MH 4R4TA 3GTJH 3M9BA 2R7ZG 4JI5Q 3CW2C 4Y52H 2ALYB 3J81i 3HOXG 3CCJA 2FXQA 3HOZH 4AH6A 3KDFB 1UE7A 2WB1G 4DPGA 4HIDA 4GN3B 1N34Q 1TWGH 4JC0A 1IL2A 4JI3L 4GOPB 4B3TL 4DUZQ 1UE5A 3OW2A 1TXYA 2IY5B 1JMCA 4HJ8A 1KAWA 5C4JH 2K75A 4JI4L 4RMFA 3DM3A 5C44H 3CC7A 5M3FG 4B3SL 1Q82C 4BY7G 3AFQA 3K81C 1C7YA 1IBML 2HHHL 2Z6KA 2AWOA 4IPDA 2HQLA 5IYCG 1YJWA 3J7A5 2UXDL 1HR0L 4POGA 5C0XJ 4IOCA 2F3IA 3U4ZA 4IOAA 4LUVA 3UDIA 5JEAJ 4L5RC 5IWAQ 3HOXH 5BR8L 4HJ7A 1GKHA 4JOIA 1WJJA 1YNXA 3H3VI 1X54A 3M4QA 3AQQA 4A4IA 4X6AH 1N34L 1HNXL 3RLNA 5FJ8G 4OX9Q 2A8VA 2ASBA 3S1NH 1TWAH 5M5WH 1L1OA 4LF6Q 3TREA 1C9OA 2RF4A 4AIMA 1NMFA 1M1KC 3HOUG 4X66L 1WFQA 4GKJQ 3I4NH 2JA5G 3NEMA 1VQNA 2BH2A 1XPOA 4BBSH 5IP9G 2PI2A 4BA2I 4JYAQ 1NTGA 1P16A 1O7IA 1G51A 1YITA 4DAMA 4DV6L 1Y1WG 2JA8G 4TQUS 4JI5L 2CKZB 4QJFA 3CCEA 4A3IG 1HNXQ 1EIYB 4OX9L 1PH1A 2YYZA 4DR3Q 3S16H 1UWVA 3HKZE 2YTYA 2YTVA 5EAYA 1SE8A 3UDGA 3I4OA 4R1JA 2IT1A 4UP7A 1HZCA 5C4XH 4DR5L 4LF7Q 3ULPA 3M7NA 1SN8A 2MO0A 4MTNA 1K83H 1NMGA 1YBYA 4OONA 3A5UA 1Q81C 1KIXA 1K8GA 1HR0Q 2UU9L 3S1MH 2K4KA 5IP7G 3UE0A 5LMNW 1OXSC 3M4PA 1BBWA 1VCIA 3E0EA 4DV7Q 2ES2A 1N32Q 2GVAA 4APVA 1RIPA 1B70B 2UXCL 1WCMG 1VQLA 4O2DA 1N36Q 1JJCB 1GM5A 2H5XA 3TS2A 5C3EH 1WI5A 1VQJA 2RHQB 2ZM6L 5LMNQ 1SMXA 1KL9A 4GNXB 4IO9A 4A3MH 2HIVA 3KYHC 3L7ZC 4LFCL 5IY0A 1MKHA 4DR4Q 4HJ5A 2DGYA 4R4IA 2C35B 1VQ4A 4JYAL 4UPAA 2UUCQ 3S14H 3S1RH 1TWCH 4DNIA 1Y14B 3KFUA 2MFIA 3J80i 3HKSA 3G71A 2JJQA 3GTQH 4JOIC 2VUMH 4OO1I 3T1HQ 1X6OA 3CCLA 4LF6L 1U0LA 2JEBI 3CCMA 4JI1Q 1G6PA 4X64Q 1E22A 5IYBH 4L5QA 2EQSA 3S24A 1CUKA 3PF4A 3D0FA 1Q7YC 1I94Q 2Q2UA 3I4MG 2PI2E 4A3CH 1UE1A 3CAMA 4P74A 5IE8A 3AYHB 1L0WA 2PNHA 5M5YH 2VQEL 1YHQA 1VQOA 2HIXA 1NJIC 2LXKA 2VUMG 1E24A 4IPHA 1VQMA 4WJ3M 1D7QA 4GS3A 1XNRL 4GKJL 3UE1A 3IRBA 2YTXA 4JBMA 1PYSB 3HOVH 5LMUL 3PGZA 2D0PA 2CFMA 3S17H 4LNQA 4X65L 1YZ6A 3CMAA 1BVSA 1C0AA 1Q8KA 3H0GG 2PQAB 2WFWA 5FJ8H 3RN2A 2UUAL 4B3MQ 2N49A 1X3FA 3K8AA 1N33L 2Z0SA 3CPFA 1HZAA 4NXML 4HIOA 2ZM6Q 5LMNL 4A3DG 1N9WA 2K5HA 3F8TA 3PIPA 2NN6I 4X62L 2E2JH 4JI7L 3CP0A 4LFBL 1N32L 1PH3A 3HFZB 4KLKA 1BKBA 2DUDA 4JI1L 1XMOQ 3HOUH 1VQPA 1I3QH 3U50C 3GO5A 3PUZA 4LF5Q 1E1OA 2VW9A 1VQHA 2XGTA 4DUYQ 4LUOA 4UP8A 4JI0Q 4A3IH 5IYBG 1PH8A 1OXTA 3GDEA 1HZ9A 4JBWA 1YI2A 1OXXK 4XIGS 4A3LG 4P71A 1VQBA 5ELOA 3S1QH 2YU9H 4DV3L 2KCTA 1JJ2A 1J6QA 4DV1Q 4X62Q 5IYCH 4JI4Q 4YHHQ 4KI0A 2MNAA 3G6EA 1QUQB 1YIJA 2IHFA 4DR2L 3FKIG 4LW1A 2UUBQ 1VQIA 5IYDH 1WOCA 4DV0L 5FLMG 4FDBA 2LSSA 3OTOL 4IFDJ 2I5HA 1SLJA 1NY4A 2XTIA 5C3EG 2Q2TA 2Y0SE 1V1QA 1AE3A 2AMCB 1A63A 3ULLA 3OYYA 1EQQA 1WCMH 1EOVA 4JI2Q 3WWVA 4IJHA 4DV2L 1H95A 1E7ZA 2PQAA 1CKNA 2AWNA 4L5TA 1U5KA 4YWLA 5IWAL 5C0XG 4AQYL 5M5XH 4YWMA 2R93H 1DGSA 1VQ9A 3KJPA 1FVIA 4PZ6A 4NXMQ 5FLMH 4KHZA 3CCUA 2Q2HA 4DUYL 3CF5A 4OXPA 4X65Q 4GNXA 3I7FA 1W2BA 1JB7A 1XNQL 1JJGA 4LUZA 1PH6A 4KHPQ 1NBWA 4DK6C 2LXJA 3KF6B 1A8VA 3TRZA 3UDXA 4LWCA 1SFOH 5E7NA 2B63H 4BXXG 4DV6Q 4AYBG 2UXDQ 1K0RA 3H3VH 1LTLA 1XNRQ 2Q2IA 4Y7NH 3PUYA 5JJIA 3RZDH 1P8LA 3F2DA 3KJOA 5C0XI 4HIMA 5GROA 4HJ9A 1V43A 3L2PA 3EIVA 1A0IA 4A3BG 3L0OA 1XPRA 3TQYA 4YCVA 1L1OB 4YHHL 2N78A 2JA6H 3PIOA 4JI6Q 4LF9L 2JA7H 2MQHA 3TS0A 1FGUA 4POFA 4A3EH 3BZCA 3HOYH 4A3DH 1FL0A 1K9MC 3PV0A 4BY1G 1I94L 3CQZH 1IBLQ 4KHPL 3S2DH 4GLVB 4P75A 2UUCL 3RLFA 2UU9Q 4BBRG 3TEHB 4X64L 3F2BA 1KXLA 1IBKL 1XTDA 3PO3G 4DK3C 3PO2G 1FJGL 1YEZA 2IX1A 1Y1VH 5ELNA 2F52A 2OWOA 3CXCA 3GTMH 3G4SA 1X55A 2B3GA 4UP9A 4DV1L 3S2HH 3M4OH 3D31A 2QGQA 4DR4L 2F4VL 2N3SA 4PZ8A 1N33Q 4A3CG 3JAMi 1AH9A 1B8AA 1W3SA 3H0GH 3PO2H 1YVCA 4X66Q 5M3MG 1ASYA 4C3JH 4IPCA 4JBJA 3FKIH 4K0KL 1K3RA 1E1TA 2VQFL 1R9TH 2N8NA 3RR5A 1Q86C 2K14A 3Q8DA 4AYBE 4LF8Q 2JE6I 1HR0W 5HY6A 2KHJA 2A19A 5FLXc 2WAQG 3M3YH 1CSPA 3GTOH 5LMUQ 1IYJB 1MJEA 2D62A 4A3GH 3RLOA 1LM0A 1X65A 2AHOB 3K7AH 4OWTB 3G48A 4DR1L 3J81j 3VDYA 1VQ5A 4LF9Q 2R92H 3HOWG 1EFWA 4UY8C 3AFPA 1UE6A 3ZJYC 4B3ML 1PH9A 3PUWA 4IFDI 4NB3A 2D0OA 2KBNA 4YY3L 4LFBQ 1GD7A 3U4VA 4JI3Q 1YJNA 2UUBL 2ATWA 4R4OA 1KC8C 3K7UC 4JV5L 2VNUD 1QZHA 2E2IH 1VQEA 1AE2A 2F4VQ 1XPUA 2K52A 4GOPA 1VQAA 4LFCQ 3GTKH 1A62A 4ALPA 4DR7L 4K0KQ 3CCRA 2VQFQ 5K36G 3E9IA 2Y0SG 1KRTA 2VZAA 2K50A 1SROA 2IHEA 5BR8Q 3KOJA 5H1SE 3JC66 5IYDG 1V9PA 1IBKQ 3S15H 4JG2A 4A3BH 3PUVA 1PVOA 4A3KG 1VQ8A 2BA0A 3I4NG 4WJ4A 4A75A 4TVAB 4DAYB 3HKZG 2JK8A 1VQCA 2OQKA 1K8AC 1T9HA 1EYGA 4A93H 2R93G 2WAQE 4DV0Q 1IBLL 2CWPA 4JI7Q 4C3IH 1LUZA 2A1AA 4GNXC 4MNOA 4NXNL 4IJLA 1I50H 4B3TQ 3GTPH 3T1YQ 1HJPA 3GD7A 1UEBA 4A3MG 3ERSX 3CC4A 3OTOQ 4GKKL 3B6YA 1ASZA 2E5LQ 5GADC 2HHHQ 3JAMc 3KF8B 3ULJA 4DR1Q 2K5NA 2NVXH 1X9NA 1CSQA 4JBKA 1N36L 2NZHA 4A3FH 3H15A 4DR3L 2AKWB 1OXUA 1K73C 4LF8L 1JT8A 2PMZE 2GVBA 4DV4Q 1I5FA 4IPGA 1HNWQ 4YY3Q 2I5MX 1D8LA 5GAEC 3J81c 5M3FH 2OTLA 3K80C 3PCOB 1QVCA 1IXRA 1BBUA 4O0AA 2EXDA 1S72A 3K0XA 2MO1A 4DUZL 3RNUA 2ID0A 3W5OA 1LYLA 4QY7A 2QEXA 1E3PA 4XTCS 2I0QA 1YJ9A 1EIFA 1KHIA 3I56A 2JQOA 1VQ7A 2HT1A 3I55A 2CQOA 2ZTDA 2JA5H 5IP7H 2R7ZH 1EQRA 2EIFA 2KHIA 4A93G 4H02A 1FJGQ 3RZOH 1VQFA 1PFSA 3J7ZC 4DV5Q 5C44G 1QVFA 5J3BA 1SRUA 4A76A 3M85A 2V1CC 1CKMA 3PSIA 1XNQQ 1KRSA 2UUAQ 1IZ6A 2R92G 1HH2P 3SGIA 5GAHC 1Q46A 4A3GG 2ZJRA 5JEAG 2R6GA 2WP8J 5IP9H 4IFDG 2OTJA 3CCVA 1WYDA 2JA9A 1XJVA 3CD6A 4QL5A 4DR6L 1TWHH 1OXVA 4PZ7A 2Z6KC 3CPWA 3AEVA 3FHWA 1X3EA 3NENA 4J15A 2JA6G 1M90C 2ZTEA 1YHAA 4GN4B 3PUXA 4PMWA 4DKAC 3I4MH 1CKNB 3STBD 3T1YL 5M3MH 2L15A 2E8GA 1VQKA 1S3OA 5GQOA 4EX5A 1Q1BA 3J80c 1Q12A 1XMQL 4JI0L 3KLWA 4OWWB 4DR2Q 4BY1H 1EWIA 3MXNB 2R7DA 1KD1C 3CCSA 1QUQA 4NPSA 2VL6A 4BA1I 3HOZG 4B3RL 2B29A 4OWXB 3RN5A 1L2FA 4DV3Q 1QZGA 2E2HH 3T1HL 4MZ9A 2ZJPA 3A74A 2RCNA 1VQGA 4GN5A 2WB1E 4P72A 3BZKA 2ZTCA 1NE3A 4R4QA 3PO3H 2UXCQ 5C4XG 1PH5A 3NELA 3KDFA 4DV2Q 1S40A 3W1BA 2CWAA 4JI8L 3U58A 4A3JG 1XMOL 2JEAI 1Y1WH 2VY3A 4LF5L 3MEFA 4EQ5A 3FP9A
chains in the Genus database with same CATH superfamily
1GUOA 5IGCA 2NVQH 4LFAQ 4DV4L 4JI2L 3UDFA 3SEBA 4HIKA 3CCQA 4ME3A 1PTOC 1PZJD 2OQ0A 5C4HA 2YV5A 1J5EQ 4EQPA 5EGTA 2B2WC 5AJ3L 3MXNA 3EN2A 1PYBA 1K8MA 1HNZQ 4YWKA 4C3HH 1O78A 2VQEQ 1PHJA 5T1GA 2KCMA 2KENA 5CV7A 5I6WA 4GLAC 5HGQA 3K57A 2BH8A 4HJAA 4HSVA 4DR5Q 2QA4A 2F0GA 3F2CA 3TSSA 4GOPC 2CCZA 1YHBA 2NBFA 1GO3E 5JAVA 1ZXTA 1QCBD 2F0SA 4BXXH 5J1ZA 1VS0A 2E5LL 3SK5A 2NVYH 4JI6L 5DM63 3HS0C 4GKKQ 1SJED 2FHTA 3LGJA 2VS1A 3I2ZA 5JPNC 3I70A 3ICEA 1HNWL 5FKAC 2C9OA 3W1GA 1CZGA 3M9BA 2R7ZG 4Y52H 3FEWX 4DNTB 4FF3A 4A3JB 1K83B 2DJGC 2B2YC 3HOZH 5KYLA 1RODA 4DPGA 4HIDA 4GN3B 4DUZQ 1SFOB 2IY5B 1EYCA 4JVZA 1A3UA 1R4PB 1F2LA 2HHHL 2KVMA 3OWEB 2AWOA 1JWMD 1EZ8A 3TBIB 1BCPF 1DYQA 2F3IA 3U4ZA 4LUVA 1GKHA 1WJJA 1X54A 2K28A 2XRSD 3AQQA 4A4IA 4X6AH 3RD4A 2A8VA 2ASBA 1Q3LA 4JK1C 3HOUG 2KEEA 5IGBA 3PMFA 2F0DA 2L5TA 1VQNA 1Z7TA 4BBSH 5IP9G 4BA2I 4IFDH 3A8KE 2Z9HA 1G51A 1YITA 4DAMA 1EWHA 1Y1WG 2CKZB 2NTSA 1EIYB 2GA4B 3QOLA 2YTYA 2YTVA 2X6GA 5EAYA 1SE8A 2IT1A 1HZCA 4LF7Q 1SN8A 3A5UA 1K83H 2Z6BA 5IP7G 1OXSC 1BBWA 1RTNA 2O5IC 2ES2A 3C1FA 4XYQA 1B70B 2UXCL 1F2ZA 1STYA 1SJHD 3AMUA 3LNNA 1WI5A 2RHQB 5C5MA 4A3MH 1KL9A 3KYHC 2F3VA 3ERQA 5NUCA 4LFCL 1MKHA 1JE4A 4HJ5A 4R4IA 1EY9A 4L63B 3KFUA 3K7AB 4ODGA 4RKLA 1EWCA 3Q6SA 4RHSA 1EY0A 1U0LA 3C1EA 3SK6A 4PMBA 2J4XA 1S4ZA 5BN3A 1Q7YC 1Z6HA 1SBBB 2Q2UA 2PI2E 4ABNA 5IE8A 3AYHB 5M5YH 2HIXA 1NJIC 2VUMG 1SYCA 1VQMA 1ONLA 1S5BD 3HOXB 3HOVH 3PGZA 2F0WA 2CFMA 4LNQA 2F0QA 1C0AA 4HMJA 1TY2A 2UUAL 5FJ8H 2PZWA 3NSWA 1J9OA 1N33L 1SDFA 1LV9A 3UI2A 5LMNL 4HIOA 2Q8IB 1PFMA 4G7HC 2NN6I 2E2JH 4JI7L 4FXGC 1N32L 3A7AB 3HFZB 2DUDA 1D2BA 1PTOF 2VW9A 2G9HD 4CJ0B 2XGTA 2QCPX 4UP8A 2R3ZA 1YNJC 2B8FA 5C4XB 4JBWA 1IHZA 4M1UB 4A3KB 2NVTB 1DXMA 3S1QH 3DHQA 1JJ2A 4P2CB 2FMCA 4X62Q 4JI4Q 4YHHQ 3V05A 2XWBB 4IUVA 4QUCA 1A2UA 4OIJA 4B08A 2EY1A 1EOVA 5FOBB 1IKMA 1QG7A 3NBHA 4R9WA 4YWLA 3OPOA 3BVZA 5C3XA 5CBAE 1DGSA 1STEA 1SMYC 1FVIA 4PZ6A 3OSOA 4NXMQ 1HUNA 3CCUA 2Q2HA 3OMGA 4X65Q 4GNXA 1B9NA 1PRTD 1JB7A 1JJGA 3NHHA 1A8VA 2AUKA 3TRZA 2MUYA 5CYUA 5EBCA 4DV6Q 4AYBG 2UXDQ 1NR4A 4Y7NH 2PCFB 1P8LA 4PMCA 4Q5VA 3LWUA 2KOLA 5M5WB 3S1NB 1TS5A 4ZYSA 2JA7H 1D5MC 3V2TA 1FR3A 4A3EH 1FL0A 4IQZA 1K9MC 1C48A 1I94L 3RLFA 2WKDA 4BBRG 5FO7B 4LK1C 4PNYA 3K5LA 1D5ZC 1D5XC 1FJGL 1E2ZA 2IX1A 2F52A 2RBMA 3GTMH 3GTQB 3HG9A 4UP9A 2EPBA 5CGKA 1ZYRC 4G7ZC 3S2HH 4A3BB 1F9SA 2K01A 4DR4L 4PZ8A 2EOTA 2R61A 4RGMA 1XTCD 2VB3X 1B8AA 3PO2H 3WDNA 1ASYA 3TDQA 3A55A 3FPUB 3QR8A 3FKIH 4KY5A 1E1TA 2EY5A 4K2KA 3GTKB 1R9TH 1Q86C 2SDFA 2K14A 2XN9C 5HY6A 5FLXc 2A19A 3RMHA 2WAQG 1LTBD 2K03A 1PTOB 4ILWA 1SNQA 4OELB 1TWCB 2VB2X 2AHOB 2QF7A 1VQ5A 3G48A 4LF9Q 3J81j 2RSOA 4UY8C 1TS3A 4X3TA 3AFPA 3D3RA 3PUWA 4XQQA 4MN3A 2JA7B 1CK1A 4JV5L 3K7UC 2DNEA 5C5LA 5C3EB 2PW5A 1II3A 1XPUA 2VXWA 4ZLTF 1A62A 2K1BA 5LL6S 3OHXC 1QE6A 1WTWA 1SROA 3S15H 3GTMB 1VQ8A 4TVAB 4DAYB 3QWNA 3HKZG 2JK8A 1VQCA 1T9HA 2R93G 5FO8B 3JAML 4OEMB 5CV8A 1LUZA 4C3IH 2HD3A 1I50H 1VDZA 2F0JA 2PO4A 3T1YQ 4ZKBB 4B3TQ 2F0FA 1UEBA 3OTOQ 1ENAA 3NTHA 4RAUC 3KK7A 2NVXH 2ZXPA 4JBKA 4A3FH 4CHTB 4DR3L 2FJ2A 2AKWB 2JP1A 2FINB 4IPGA 3J81c 2ZXRA 3BVMA 1TY0A 2E2HB 1VF7A 2DY7A 2B39A 4KTAA 4DUZL 1BCPC 1LYLA 2I0QA 2JN4A 4HTHA 1EIFA 1KHIA 2HT1A 2JQOA 1TVXA 4KMUC 5EQ0A 2R7ZH 4A93G 2F4IA 3H09A 4H02A 4A3IB 4UDUC 5C44G 1QVFA 5I2XA 4A76A 2R93B 2V1CC 2F0TA 1KRSA 3M4YA 1G8ZD 3ONAB 2A5HA 4A3GG 2ZJRA 5A35A 4NW2A 4C3IG 2F0MA 1XJVA 4QL5A 4X3KA 4DR6L 3AEVA 3FHWA 4PV1C 1HFGA 4DKAC 3I4MH 4HMIA 1CKNB 3T1YL 4PQXA 1CHQD 3J80c 1Q12A 1IYVA 4QF4A 5EKLA 3KF8A 4BY1H 1O7YA 2R7DA 3I90A 2JA6B 2B2TC 1L2FA 5DM73 1Y69U 5CV4A 2L4NA 4MHEA 2TMPA 3D6WA 2WB1E 4P72A 3BZKA 2NZ1D 3CRLC 3EA6A 1LT3D 4C3HB 4C1NK 1DJRD 1EY6A 1XMOL 2JEAI 2JA5B 3HOUB 1Y1WH 2B2WA 5C0XH 1K8AC 1RL2A 3HOVB 4DR6Q 1JC7A 1Q1EA 3IFDA 3HOYG 3MC0B 2CHBD 4R4CA 4LF4Q 4A3FG 4A3JH 4DR7Q 1KAAA 3MAQA 2SOBA 4CBVA 2RVLA 1X56A 2NZOA 4OGQC 5I9OA 1L1OC 4QIWE 2KHSA 1I6HH 5K36H 4RG1A 2JA8H 1LTRD 3NXWA 1OTCA 4A3LH 2B63G 4YCWA 4B3SQ 1CKOA 1G291 3ER0A 2SNMA 4Z9CB 2IJ0A 4KK7A 1PH2A 5IT9c 1B44D 1X3GA 1K8OA 3BJUA 2NVTH 5AJ3Q 2OF1A 3TP6A 1SYDA 3GTLH 4LF7L 2K5QA 1HNZL 1TWHB 5JEAH 5JPMC 1HZBA 1D6EC 4XQJA 2BCOA 3I4NB 3BS1A 1DD2A 1EY8A 1J5EL 3STBC 3HP3A 4X3UA 1B4OA 4XYOA 4A3MB 4V190 4DN4M 2BA1A 3QIAA 3E9HA 4UHVA 1LTAD 2GN5A 3HOVG 3D4DA 1SR3A 4DV5L 1YNNC 3MHBA 3T16A 3MEHA 2FXQA 3R2IA 4OHJA 1UE7A 3OMCA 1TWGH 3QG1A 5J39A 2EYOA 4RKBA 4JI3L 4NDXA 5F2DA 1TXYA 1BO0A 1KAWA 4HJ8A 5C4JH 2K75A 4BY7G 5M3FG 1Q82C 4BBSB 1F77A 1HA5A 5JJZA 5IYCG 3Q22A 1O7ZA 3J7A5 2UXDL 2A68D 1HR0L 4IOCA 2RA4A 3FDTA 1GUNA 5JEAJ 3HOXH 4DAYA 4JOIA 1HFNA 3S1NH 3KLRA 4CKBA 2F0VA 3F2UA 2RF4A 2Y0SB 1M1KC 2F0NA 1WFQA 4K5WA 4F87A 3GTPB 4K5VA 5A2QL 3J81L 4EQNA 5CORA 3DEPA 2JA8G 1HRJA 1JOQA 4NP5A 1PH1A 5EKKA 2K5DA 1S5ED 5COYA 4GKJQ 3UDGA 5C4XH 4DR5L 1H95A 2E2DC 2MO0A 1NMGA 1YBYA 3W2DA 1HR0Q 3S1MH 2UU9L 3M4OB 1O80A 3P1HA 3UE0A 4IUUA 3E0EA 1VCIA 4RCOA 2GVAA 3H91A 4R8IA 5CMDA 1RIPA 3VYUA 1VQLA 1N36Q 1JJCB 1F9RA 2IWHA 2HIVA 4B9XA 3L7ZC 1ICWA 2RKSA 2RCFA 5M3MB 1EY5A 5TSSA 5CBEE 3S1RH 1TWCH 2QEJC 2MFIA 1WVLA 3HKSA 4JOIC 2VUMH 1HXYD 2ENBA 1TQOA 1SNCA 2JEBI 3R3OA 3CCMA 1G6PA 4X64Q 1E22A 3HKZB 4L5QA 3D0FA 3C46A 3Q24A 1UE1A 3CAMA 1L0WA 2PNHA 1EYAA 2L0CA 1E24A 1B3AA 4IPHA 4GKJL 3UE1A 2M2LA 4JBMA 5HURA 2D0PA 3S17H 3QB3A 4X65L 1YZ6A 1QNUA 3S1QB 3RN2A 4B3MQ 2N49A 1X3FA 4HN7A 3NBIA 4DAVA 4FNFA 4NXML 2WINB 1EQTA 5I4DA 1N9WA 2QILA 1IW7D 2K5HA 4R8NA 3I4LA 1U9RA 1VQPA 1I3QH 3U50C 3GO5A 1KABA 4DUYQ 2NVXB 4LUOA 3DWPA 3MVVA 3S16B 5IYBG 1PH8A 3KBGA 1S5DD 1ET9A 1HZ9A 4KN7C 2VUMB 4XIGS 2PMZB 4P71A 3O13A 1VQBA 4DK1A 2YU9H 1J6QA 1WTVA 1BR9A 3T51B 2PYKA 2IPKD 4DR2L 2UUBQ 5IYDH 1PMRA 5IGEA 5FLMG 4FDBA 3OTOL 4IFDJ 1SLJA 1SE4A 2HCIA 2IX3A 2Q2TA 1PXUA 1AE3A 2AMCB 3ULLA 3OYYA 1EQQA 1U4MA 3VR3A 3NP8A 4AQYL 2AWNA 4CGYB 1U5KA 1MSHA 3NE5B 2R93H 5IGDA 5EPKA 3KJPA 2B8GA 1WTHA 3CRKC 4N9TA 1EZ6A 1XNQL 1W2BA 4KHPQ 1PH6A 1I4QA 2LXJA 3KF6B 3A8IE 5JVH3 5E7NA 4BXXG 1K0RA 3BDOA 1CHPD 3F2DA 3KJOA 4RHRA 3L2PA 1SMYD 4AYBB 1L0YB 3L0OA 1XPRA 3TQYA 1RF2D 4XDXA 1LT4D 2LS01 4U68A 2BE5C 4LF9L 5D65A 2MQHA 4POFA 3PO2B 4A3DH 3KUPA 3S2DH 2UU9Q 4O1NA 1QJOA 1I4HA 4FO2A 4DK3C 3T4AC 1V8QA 1YEZA 2OWOA 1AZQA 4KKUA 5HGTA 3D31A 2QGQA 5DEHA 2F4VL 2N3SA 4ZKCB 3PIP3 3H0GH 1LO5D 3EQLC 4H7BA 1E2WA 5KNBA 3HOWB 4C3JH 1TS4A 3MZ5A 1PZID 2EYMA 2VQFL 2G5DA 3Q8DA 4IURA 3A56A 3GV6A 2KHJA 3A7LA 1JWSD 4A3GH 3LX0A 1ZKOA 2ICEC 1HA6A 4FP5D 3P20A 3HOWG 2NWGA 5M3FB 3GTLB 1UE6A 1OO9B 4YY3L 4LFBQ 4ZCKA 2JXMB 1GD7A 2AUJD 4JI3Q 1YJNA 3ND9A 2E2IH 1YNJD 2F0KA 2K52A 4OL7A 4BY7B 3RZDB 1CTMA 4QIWB 2VQFQ 5KGUA 1IL8A 1KRTA 4A3FB 1UNSA 2IHEA 5BR8Q 5IYDG 3JC66 1F2MA 4IZ8A 5L37A 2WB1B 5EBDA 2V4DA 1EYGA 1JB3A 1ZEQX 4C3HG 2A1AA 5CV9A 4NXNL 5C4JB 4FYDA 1BF4A 2ZT9C 3H6MA 3GD7A 4GKKL 3ERSX 3CC4A 1RKNA 3B6YA 1I4RA 2E5LQ 1MBYA 1X9NA 3GQBA 2PMZE 1I5FA 3DXJC 4V0BA 1WTPA 1GXDC 1D8LA 2EVBA 5M3FH 1QB5D 3MXUA 1IXRA 3IFTA 2L1BA 3CHBD 2A6HD 4X3SA 2EXDA 5CV6A 3K0XA 4DA2A 1PTOD 3TMEA 4ZK9B 1FNVA 4QY7A 1AEXA 1LTID 2AQ2B 2I46A 4XTCS 4KJOA 2L12A 2B63B 2FMMA 3NWTA 4DNRB 5JVG3 2ZTDA 2JA5H 1Y1WB 1FJGQ 3GTOB 3J7ZC 4XT3B 4G4KA 2K04A 2L55A 1XNQQ 2UUAQ 4EQOA 5C6AA 2WP8J 4N9PA 1MHWC 3CD6A 1TWHH 2A69C 3E0JA 1X3EA 3NENA 3C2PA 2ZTEA 1YHAA 4GN4B 1NNXA 3I72A 2RQXA 4CDDC 3STBD 1VQKA 4EX5A 1Q1BA 1XMQL 4JI0L 4DFAA 4FF4A 4DR2Q 4RGNA 2K6AA 3MXNB 1KD1C 1SE3A 3HOZG 1STAA 2B29A 3J80L 3RN5A 1RCVD 3OIPA 3E5SA 1EEID 4MZ9A 4ZRZA 4ULLA 1VQGA 3VA7A 5D14A 3GV3A 5E1FA 2JA8B 2UXCQ 1SEBD 3NELA 3KDFA 2CWAA 2MGSA 4MIUA 2DJFC 2F0OA 4EQ5A 1GUSA 2F3WA 1VQDA 1PV4A 4A3EG 3S17B 2I5LX 1PH4A 2UXBQ 3VYTA 1XMQQ 3BU2A 4JW0A 2CQAA 2EYFA 4A3KH 2K5WA 1Z9FA 4WJWA 5DLQE 4CJ2C 1QNKA 3ZYYX 1JE5A 1Z47A 3EJIA 1H9SA 4FXDA 2HUGA 1B53A 4PG3A 3HRZC 2EY2A 4BBSG 5JJKA 1I3QB 2E74C 3KF6A 1MIUA 2O2LD 1PRTB 4Q0FA 1Y1VG 3EBEA 4LF4L 3OIQA 4QGUA 2NUCA 4RH6A 4NXNQ 1CZWA 1B7YB 1SYEA 1T5EA 5GAGC 2FFKB 1FD7D 2WAQB 1O7LA 1MJCA 5KIXA 4TRDA 4HAEA 4KN4C 1LTGD 1QVGA 4L5SA 3CC2A 1EUJA 5CR3A 1F9PA 4DV7L 3I3CA 1VQ6A 2RHSB 2L9HA 2CH4A 1GVPA 1KQSA 5E4WC 1EEFD 4P73A 3A0JA 1YNND 2N88A 3AU7A 3G7LA 1N8RC 1ILPA 4BBRH 4G57A 2F03A 3J81i 3CCJA 1LTSD 3K5MA 3KDFB 1SNMA 1XWEA 2PNRC 1EU3A 4GOPB 2WKCA 4RGTA 1JMCA 1PZKD 4JI4L 5C44H 4BWGB 3AFQA 3K81C 1C7YA 3K5OA 2Z6KA 2B2YA 3DM1A 3U9SA 4IPDA 1PYWD 1DOLA 4NMZA 1C8CA 2K33A 3UDIA 5BR8L 3M4QA 3GTJB 1H9JA 1N34L 5FJ8G 3S2HB 4RFBA 1AN8A 5G3LD 4LF6Q 4CDCC 1X3QA 2JA5G 1TKWB 2LFNA 2EE1A 1NR2A 3SVMA 1XPOA 2BH2A 4JYAQ 1P16A 5G3LF 4IUPA 3I73A 4JI5L 4QJFA 3BDCA 2YYZA 4DR3Q 3S16H 3HKZE 2F0PA 1LACA 3A8JE 4C56C 1RHPA 3I4OA 3M7NA 3ULPA 3QJYA 4WFN3 4MTNA 1Q81C 1KIXA 5IT9E 1TWAB 2K4KA 5ELBA 3H0GB 4IUQA 1H9RA 4N8X1 3RUZA 1N32Q 4M8AA 2TSSA 1WCMG 4O2DA 3TS2A 5C3EH 5LMNQ 4WRDA 4IO9A 4TSSA 1XXGA 3D4RA 1BCPB 3IKJA 2DGYA 2C35B 2UUCQ 2B2TA 1SAPA 2NVQB 4A3GB 4DNIA 4ZUIA 1FNUA 3J80i 3G71A 2JJQA 3GTQH 4OO1I 3T1HQ 1ICFB 4DF7A 1G6ZA 2F0LA 4JI1Q 4I7AA 2O4XA 4OIKA 2B2UC 2EQSA 3S24A 1CUKA 3VYSA 2X69A 1I50B 1YHQA 1CQVA 1VQOA 1G91A 2EXZA 4GS3A 1S5FD 2EYPA 2YTXA 1PYSB 3X3MA 4ID6A 4CKEA 1CQFA 1Q8KA 2NN6H 2PQAB 2PZTA 1I4PA 3K8AA 4WORA 4A3DB 1PFBA 3F8TA 4K5XA 2KA7A 4X62L 3PIPA 3CP0A 4EGVA 1PH3A 3S2DB 4KLKA 4JI1L 1XMOQ 1KDAA 2NVYB 2AQ3B 2R7ZB 4A3IH 1YI2A 2I07B 1TT2A 1U4LA 2KCNA 4A3LG 5ELOA 1SYFA 3R8BA 4DV1Q 1L0XB 2Z4IA 5IYCH 4KI0A 2MNAA 3G6EA 4LAAA 1YIJA 1XX8A 2KEDA 1AZPA 2CW0C 1AFPA 3WOEA 2LSSA 2I5HA 5C3EG 2Y0SE 3N6RA 5KNCA 2IL8A 1WCMH 3ND8A 3R2TA 4BS9A 1WTXA 4J6HA 4JI2Q 4DV2L 1E7ZA 2PQAA 1UAPA 1LLRD 5C0XG 2AQ1B 4YWMA 4XXEA 4CKCA 1VQ9A 3WOFA 4BY1B 5KEEA 3P75A 4DUYL 2F0UA 3CF5A 2A74C 4OXPA 1KNAA 4DK6C 3BVGA 3UDXA 2A68C 5LHY1 1Q8IA 1WD1A 5BN5A 2M9VA 1V1PA 1XNRQ 2E75C 1K3BC 2MPMA 3PUYA 3RZDH 4HJ9A 1SNOA 1V43A 1HQMC 1A0IA 3EIVA 4A3BG 1B2TA 3NWSA 4EVOA 5M5XB 1JICA 3D8GA 4YHHL 5IGGA 3PIOA 4JI6Q 1X32A 4FF2A 3BZCA 1A3TA 1IKLA 1JQYD 3FPPA 1Y8NB 5BN4A 1IBLQ 1I6HB 4RWSC 3MTSA 3BDLA 2DY8A 4CDEC 3OOCA 1UEAB 3BZDB 4X64L 4LJZC 3F2BA 3FMCA 4C3JG 1IBKL 1XTDA 2JSOA 3IL8A 3PO3G 4XQNA 1Y8OB 1SSOA 1KLUD 5ELNA 3NTKA 3HZXA 4H44C 3BYYB 3SHLA 3CXCA 1TU2B 1X55A 1SE2A 2B3GA 1B1ZA 4DV1L 4A93B 3M4OH 1N33Q 3JAMi 2SNSA 1BXTA 3HOYB 1YVCA 2F1MA 5M3MG 4HR7B 4K14A 4YIJA 2E2IB 5EPJA 1ZYRD 1GUTA 1K3RA 2EJFC 4OO1H 2N8NA 3RR5A 3IAYA 3P7JA 1SNDA 2JE6I 3S1RB 1HR0W 3M3YH 1CSPA 3GTOH 2D62A 3RLOA 1LM0A 4OWTB 5E4XA 4DR1L 1QWYA 3SK8A 3ZJYC 4NKLA 4F7XA 2D0OA 2KBNA 2NTTA 3D4WA 4RCNA 1GUWA 1IYUA 2ATWA 1EL0A 2UUBL 4RA8A 1KC8C 4IUNA 5C4ZA 1VQEA 1AE2A 2EZVA 2QW7A 4K6LA 4GOPA 1AW7A 1VQAA 1LTTD 1BNZA 4ALPA 4LFCQ 3K58A 4DXFA 3T56B 2Y0SG 1GOZA 2RDFA 2K50A 1E2VA 1IBKQ 2QKIC 4A3KG 4A75A 2R92B 1I6VC 3LWEA 4A93H 4DAPA 1VMCA 1QILA 4DV0Q 1IBLL 4ZAIA 2EYHA 4MNOA 1C4QA 4IJLA 3GTPH 2RDHA 1EOTA 1ASZA 3JAMc 2CW0D 1Q90A 2K5NA 3JAME 1CSQA 1CT1D 1ESRA 2NB0A 3H15A 2M00A 1JT8A 5J22A 1K73C 4LF8L 3FRPB 4DV4Q 4F88A 4ZQ3A 1PLFA 3J81E 2E76C 2K05A 4RGOS 2K32A 4O0AA 1S72A 2MO1A 1BOSA 2PZUA 2ID0A 3W5OA 1DOMA 3D6CA 1E3PA 2Z1CA 2A6ED 2MJ8A 4O42A 3I55A 3VR4A 4DK0A 1GJXA 1BQQT 2EIFA 3BG3A 1BCPD 4QB4A 3RZOH 3DUZA 3HGBA 1SNPA 5J3BA 3AB9A 5DAUA 3M85A 3Q0AA 1EY7A 5A2QE 1CKMA 3PSIA 2R92G 1EIGA 1HH2P 4ME5A 5GAHC 1Q46A 2EYLA 4IUTA 4U673 1GUGA 5FO9B 3CCVA 2K7VA 1I4GA 1ENCA 1OXVA 2Z6KC 1EY4A 1M90C 1DM0B 3PUXA 4PMWA 5KYIA 1G2SA 3N52A 2E8GA 2C5CA 3TN2A 3J7YW 5ELCA 2L11A 4QUFA 2WIIB 3QO2A 1EWIA 4NPSA 2VL6A 4OWXB 5I6YA 2QDBA 1ET6A 2SEBD 1QZGA 5IIFA 3L9AX 2RCNA 2ZTCA 4R4QA 1NCVA 2H4OA 1PH5A 4DV2Q 1S40A 3GTGB 5I2YA 1LT5D 3A54A 1D1IA 3H94A 1MGSA 4DGZA 3ITPA 2ICIA 3MEFA 4C1NI 3FP9A 1L1OA 2H1EA 2HQEA 3SK4A 5ISRA 2BDNA 2OCEA 1KLGD 2F0IA 4F8MA 3PF5A 1RTOA 2Z8LA 4OO1G 3Q23A 3CMEA 3HEJA 1NUCA 2EJGC 3HOWH 2WACA 5EPLA 4QCLA 3PO3B 3VR2A 1PRTC 2CVRA 1EQVA 4KD4A 1TIID 2ZJQA 5K5PA 1DCZA 4QQBX 4E6IA 3A5ZB 4JV5Q 3NQTA 4AQYQ 2R7FA 4LFAL 3TP5A 2K5VA 1UUPA 3NBHB 2XIWA 2IX0A 1PA6A 1IBMQ 3QOJA 4GLXA 5DNFA 4B3RQ 4JI8Q 4I7ZC 3M7GA 2JA7G 4B9WA 1E0BA 3GTGH 1EFID 2NN6G 2KUMA 1VF5C 1FNWA 4BY7H 3MXGA 2WV6D 4JCVE 5JJLA 2UXBL 4YCUA 3DLLA 1DONA 5EJWA 4K2LA 3F1ZA 1PH7A 1ML0D 4HCSA 1TWFH 4C2MH 4R4TA 3GTJH 3T53B 2F0EA 4JI5Q 1T5XD 3CW2C 2ALYB 2XNAC 3HOXG 3I91A 4AH6A 2WB1G 3DEOA 1N34Q 2IW3A 4JC0A 1IL2A 3KLSA 4B3TL 1UE5A 3OW2A 4RMFA 3DM3A 4B3SL 3CC7A 4KD3A 3VR5A 1IBML 1KTKA 3TZDA 2HQLA 1YJWA 4POGA 5C0XJ 3R93A 4IOAA 1U4PA 1HCZA 4L5RC 5IWAQ 4HJ7A 1H9MA 1YNXA 3H3VI 1HNXL 3RLNA 2EJMA 4OX9Q 3MXPA 5D3DA 1TWAH 5M5WH 1GHJA 1MD2D 3TREA 1C9OA 4AIMA 3K59A 1NMFA 4C3IB 4FF1A 4X66L 4KV6A 3VR6A 3NEMA 2B2VC 2JYOA 2PI2A 1NTGA 1O7IA 4DV6L 4HEDA 1DZ1A 1STHA 4TQUS 3CCEA 4A3IG 1HNXQ 4OX9L 1UWVA 2KJXA 3SR1A 4R1JA 4UP7A 3HOZB 4OONA 1K8GA 2KECA 2LMCB 5LMNW 3M4PA 4DV7Q 1AP0A 4APVA 5KRUA 1CM9A 4IALA 2XWJB 2EYJA 4HCEA 5ELDA 1GM5A 2H5XA 2ZM6L 1VQJA 4GNXB 1SMXA 4KHVA 4DXGA 5IY0A 4DR4Q 1VQ4A 4JYAL 4UPAA 3S14H 4JPBW 3MFGA 2J0TD 1Y14B 3CKIB 1PTOH 3I8ZA 1K0SA 2DN8A 1X6OA 2KCCA 1J8IA 1FGBD 5M9OA 5FLXL 3CCLA 4LF6L 3NPPA 1HQRD 3URYA 2PW7A 3VYRA 5IYBH 4C3JB 3PF4A 5KNDA 4K8JA 2XRQD 1I94Q 3I4MG 4A3CH 1EIHA 4P74A 3W3AA 2CH4W 3KLSX 2VQEL 1K28A 1D7QA 1MSGA 2LXKA 1HTLD 4WJ3M 3X3NA 1XNRL 1WCMB 1RJTA 3IRBA 2N55A 5LMUL 3BYTB 1WTRA 4K6DA 1IW7C 3CMAA 1BVSA 3S15B 3H0GG 2WFWA 5CV5A 2Z0SA 3CPFA 1HZAA 3KBXA 2D5DA 4H0LC 2ZM6Q 4A3DG 1BUVT 4LFBL 3I4NH 1BKBA 3HOUH 1PFNA 1TR5A 3PUZA 1E1OA 4LF5Q 1VQHA 5M5YB 1SXTA 1VMPA 4JI0Q 1U4RA 1OXTA 3GDEA 1CI3M 3MA2B 2O5JC 5IODA 2HDMA 3EFXD 1OXXK 2XSCA 3EROA 4DV3L 2KCTA 3E3XA 2QDLA 3SXHA 1NSNS 1QUQB 2IHFA 3FKIG 4LW1A 4ZUJA 1VQIA 1WOCA 4DV0L 1WTQA 3NUCA 3J7AV 4S3SA 1SYBA 5FLXE 2DNCA 1NY4A 2XTIA 1V1QA 1A63A 2LY7A 4J8QA 3WWVA 4IJHA 1PDQA 1CKNA 4L5TA 1B50A 5IWAL 2Q8TA 5M5XH 2OXPA 1FYCA 2A73B 4N8FA 5FLMH 4KHZA 1F9QA 3S9WA 1JOKA 3I7FA 3MWYW 4LUZA 1NBWA 4LWCA 5ELEA 1SFOH 5C44B 2B63H 1B9MA 3E6ZX 2BOSA 5CC4A 1LTLA 3H3VH 1M4VA 2Q2IA 2D9UA 1B3QA 5IT9L 3J80E 1CFMA 3I4MB 1RD9D 2G9DA 5JJIA 1ESFA 1RDPD 1SYGA 3DWQA 5C0XI 4HIMA 5GROA 5D3IB 1HHVA 5E3FA 4CDFC 3VA5A 4YCVA 1L1OB 2N78A 2A69D 2JA6H 3OWFA 3NQIA 1WTOA 3S1MB 2LKVA 3TS0A 1FGUA 3HOYH 1ILQA 3PV0A 1Y8PB 4BY1G 2E2JB 3CQZH 4KHPL 4KKSA 4GLVB 4P75A 2UUCL 3K5NA 4J1MA 3TEHB 4Y7NB 1KXLA 1STGA 1HTPA 1S5CD 3M3YB 3PO2G 3H3VC 1EU4A 1Y1VH 1W6JA 3G4SA 2BDOA 5LL6X 4A3CG 2OT2A 5IOCA 3TZUA 1WD0A 1AH9A 4IN3A 5FK9C 2EDGA 2Z4HA 1W3SA 4A3EB 3MFYA 4X66Q 4KJNA 1KNEA 1H9KA 4FVMA 4IPCA 4JBJA 4K0KL 1X3PA 4GZYC 3C3LA 1A6XA 1HPCA 2HCCA 4AYBE 4LF8Q 3J7AF 2B2UA 1IYJB 2MP1A 5LMUQ 1MJEA 1X65A 3K7AH 3VDYA 4KY7A 2R92H 1EFWA 1H9SB 4B3ML 1PH9A 4IFDI 4NB3A 5AFWA 2EY6A 3EVQA 4I65A 3U4VA 2VNUD 4R4OA 1QZHA 1V1OA 3CQZB 1F2YA 3K0YA 2F4VQ 1ENFA 3FKIB 1JR0D 3GTKH 4DR7L 4K0KQ 1XYIA 2MHVA 1MI2A 3CCRA 5K36G 1STBA 1LT6D 3E9IA 2VZAA 2BE5D 5T1IA 5H1SE 1Y1VB 3KOJA 1V9PA 4JG2A 4A3BH 3PUVA 5I9PA 1PVOA 4WJ4A 2BA0A 3I4NG 2OQKA 2KQ3A 1KDBA 2WAQE 2YU9B 2CWPA 1TWGB 2NYZD 4JI7Q 2F0HA 2Q8RE 4GNXC 1G2TA 1BDOA 2OEOA 4MTKA 1QOHA 1A2TA 1JWUD 1HJPA 1R9TB 4A3MG 1TS2A 4FXKC 5GADC 4DR1Q 3KF8B 3ULJA 4BBRB 1CA5A 2HHHQ 1BBXC 3RZOB 4G7OC 1I4XA 1N36L 2NZHA 1JORA 2PQEA 1OXUA 2HDLA 2GVBA 1STNA 1HNWQ 3DMUA 4YY3Q 2I5MX 5GAEC 2OTLA 3U9OA 3PCOB 3K80C 3FVQA 1W6KA 1QVCA 1BBUA 2J7ZA 2RSNA 4L8JA 1D1KA 4CJ1B 3RNUA 1KDCA 2XVSA 3PIO3 2QEXA 3NTIA 5JOBA 1YJ9A 3I56A 1VQ7A 2A6HC 2CQOA 3NK9A 4KY6A 5IP7H 1EQRA 4QMGA 2KHIA 3T13A 3SE0A 3G6JB 1VQFA 1PFSA 3PQIA 4TKOB 4DV5Q 5C3WA 1EYDA 1SRUA 2D2CC 3OW7A 3L3OC 1IZ6A 2ZXOA 3CU7A 4UAIA 3SGIA 3GP7A 4KKTA 5JEAG 2R6GA 1R4QB 5IP9H 3V96A 3SDZA 4IFDG 1A15A 1WYDA 2JA9A 2A6EC 2OTJA 2RDGA 4H13C 5IGFA 1DOKA 3DWAA 1HUMA 4PZ7A 3CPWA 4XT1B 4J15A 2JA6G 1A3VA 1CA6A 4L6TB 3TP7A 1NAPA 1JCKB 1PRTF 3S14B 5M3MH 2L15A 3K6OA 1S3OA 5GQOA 3TP8A 3KLWA 1TWFB 4C2MB 4OWWB 3CCSA 1QUQA 2PPBC 4B3RL 4BA1I 1JOOA 2E2HH 4DV3Q 3T1HL 2ZJPA 1LABA 3A74A 4DU9A 4GN5A 4LMQD 1NE3A 3PO3H 1V1PB 2B2VA 5C4XG 5EKIA 3W1BA 4JI8L 1M8AA 2P5ZX 3U58A 4A3JG 5ELFA 4K8IA 2VY3A 4LF5L 1GHKA 2X6LA 4HSPA
chains in the Genus database with same CATH topology
1RL2A 2NVQH 4DR6Q 4LFAQ 1VQDA 1Q1EA 4DV4L 1PV4A 4A3EG 4JI2L 3UDFA 3HOYG 2I5LX 2OCEA 4R4CA 4HIKA 3CCQA 1PH4A 4ME3A 2UXBQ 1XMQQ 4LF4Q 4A3FG 2OQ0A 3BU2A 4A3JH 3PF5A 4A3KH 4DR7Q 4OO1G 1Z9FA 2YV5A 5DLQE 1J5EQ 3CMEA 1X56A 2NZOA 5AJ3L 1L1OC 1JE5A 4QIWE 3HOWH 1Z47A 3EN2A 1PYBA 1I6HH 4RG1A 2JA8H 4PG3A 1HNZQ 4YWKA 1OTCA 4C3HH 4BBSG 4A3LH 2VQEQ 5JJKA 1PHJA 2ZJQA 3KF6A 1MIUA 2B63G 4QQBX 4YCWA 4B3SQ 1G291 1CKOA 1Y1VG 3EBEA 3ER0A 4LF4L 2KCMA 3A5ZB 4QGUA 4NXNQ 4JV5Q 1PH2A 4AQYQ 2KENA 5IT9c 1B7YB 4GLAC 1X3GA 2R7FA 5GAGC 4LFAL 5HGQA 3BJUA 2NVTH 2BH8A 1MJCA 5AJ3Q 4HJAA 2K5VA 3NBHB 3GTLH 2IX0A 1PA6A 1IBMQ 4DR5Q 2QA4A 1QVGA 3F2CA 4GLXA 4L5SA 4LF7L 1HNZL 3CC2A 4B3RQ 4GOPC 2CCZA 4JI8Q 1YHBA 1GO3E 1EUJA 4BXXH 4DV7L 1HZBA 2JA7G 1VS0A 1VQ6A 2RHSB 2E5LL 3GTGH 1GVPA 1KQSA 2NN6G 2NVYH 1J5EL 3STBC 4JI6L 4GKKQ 4BY7H 4P73A 2BA1A 3A0JA 3LGJA 3E9HA 2VS1A 1N8RC 3I2ZA 4JCVE 3ICEA 5JJLA 2GN5A 2UXBL 4YCUA 3DLLA 3HOVG 4BBRH 1HNWL 1SR3A 3F1ZA 4DV5L 3W1GA 1PH7A 1TWFH 4C2MH 4R4TA 3GTJH 3M9BA 2R7ZG 4JI5Q 3CW2C 4Y52H 2ALYB 3J81i 3HOXG 3CCJA 2FXQA 3HOZH 4AH6A 3KDFB 1UE7A 2WB1G 4DPGA 4HIDA 4GN3B 1N34Q 1TWGH 4JC0A 1IL2A 4JI3L 4GOPB 4B3TL 4DUZQ 1UE5A 3OW2A 1TXYA 2IY5B 1JMCA 4HJ8A 1KAWA 5C4JH 2K75A 4JI4L 4RMFA 3DM3A 5C44H 3CC7A 5M3FG 4B3SL 1Q82C 4BY7G 3AFQA 3K81C 1C7YA 1IBML 2HHHL 2Z6KA 2AWOA 4IPDA 2HQLA 5IYCG 1YJWA 3J7A5 2UXDL 1HR0L 4POGA 5C0XJ 4IOCA 2F3IA 3U4ZA 4IOAA 4LUVA 3UDIA 5JEAJ 4L5RC 5IWAQ 3HOXH 5BR8L 4HJ7A 1GKHA 4JOIA 1WJJA 1YNXA 3H3VI 1X54A 3M4QA 3AQQA 4A4IA 4X6AH 1N34L 1HNXL 3RLNA 5FJ8G 4OX9Q 2A8VA 2ASBA 3S1NH 1TWAH 5M5WH 1L1OA 4LF6Q 3TREA 1C9OA 2RF4A 4AIMA 1NMFA 1M1KC 3HOUG 4X66L 1WFQA 4GKJQ 3I4NH 2JA5G 3NEMA 1VQNA 2BH2A 1XPOA 4BBSH 5IP9G 2PI2A 4BA2I 4JYAQ 1NTGA 1P16A 1O7IA 1G51A 1YITA 4DAMA 4DV6L 1Y1WG 2JA8G 4TQUS 4JI5L 2CKZB 4QJFA 3CCEA 4A3IG 1HNXQ 1EIYB 4OX9L 1PH1A 2YYZA 4DR3Q 3S16H 1UWVA 3HKZE 2YTYA 2YTVA 5EAYA 1SE8A 3UDGA 3I4OA 4R1JA 2IT1A 4UP7A 1HZCA 5C4XH 4DR5L 4LF7Q 3ULPA 3M7NA 1SN8A 2MO0A 4MTNA 1K83H 1NMGA 1YBYA 4OONA 3A5UA 1Q81C 1KIXA 1K8GA 1HR0Q 2UU9L 3S1MH 2K4KA 5IP7G 3UE0A 5LMNW 1OXSC 3M4PA 1BBWA 1VCIA 3E0EA 4DV7Q 2ES2A 1N32Q 2GVAA 4APVA 1RIPA 1B70B 2UXCL 1WCMG 1VQLA 4O2DA 1N36Q 1JJCB 1GM5A 2H5XA 3TS2A 5C3EH 1WI5A 1VQJA 2RHQB 2ZM6L 5LMNQ 1SMXA 1KL9A 4GNXB 4IO9A 4A3MH 2HIVA 3KYHC 3L7ZC 4LFCL 5IY0A 1MKHA 4DR4Q 4HJ5A 2DGYA 4R4IA 2C35B 1VQ4A 4JYAL 4UPAA 2UUCQ 3S14H 3S1RH 1TWCH 4DNIA 1Y14B 3KFUA 2MFIA 3J80i 3HKSA 3G71A 2JJQA 3GTQH 4JOIC 2VUMH 4OO1I 3T1HQ 1X6OA 3CCLA 4LF6L 1U0LA 2JEBI 3CCMA 4JI1Q 1G6PA 4X64Q 1E22A 5IYBH 4L5QA 2EQSA 3S24A 1CUKA 3PF4A 3D0FA 1Q7YC 1I94Q 2Q2UA 3I4MG 2PI2E 4A3CH 1UE1A 3CAMA 4P74A 5IE8A 3AYHB 1L0WA 2PNHA 5M5YH 2VQEL 1YHQA 1VQOA 2HIXA 1NJIC 2LXKA 2VUMG 1E24A 4IPHA 1VQMA 4WJ3M 1D7QA 4GS3A 1XNRL 4GKJL 3UE1A 3IRBA 2YTXA 4JBMA 1PYSB 3HOVH 5LMUL 3PGZA 2D0PA 2CFMA 3S17H 4LNQA 4X65L 1YZ6A 3CMAA 1BVSA 1C0AA 1Q8KA 3H0GG 2PQAB 2WFWA 5FJ8H 3RN2A 2UUAL 4B3MQ 2N49A 1X3FA 3K8AA 1N33L 2Z0SA 3CPFA 1HZAA 4NXML 4HIOA 2ZM6Q 5LMNL 4A3DG 1N9WA 2K5HA 3F8TA 3PIPA 2NN6I 4X62L 2E2JH 4JI7L 3CP0A 4LFBL 1N32L 1PH3A 3HFZB 4KLKA 1BKBA 2DUDA 4JI1L 1XMOQ 3HOUH 1VQPA 1I3QH 3U50C 3GO5A 3PUZA 4LF5Q 1E1OA 2VW9A 1VQHA 2XGTA 4DUYQ 4LUOA 4UP8A 4JI0Q 4A3IH 5IYBG 1PH8A 1OXTA 3GDEA 1HZ9A 4JBWA 1YI2A 1OXXK 4XIGS 4A3LG 4P71A 1VQBA 5ELOA 3S1QH 2YU9H 4DV3L 2KCTA 1JJ2A 1J6QA 4DV1Q 4X62Q 5IYCH 4JI4Q 4YHHQ 4KI0A 2MNAA 3G6EA 1QUQB 1YIJA 2IHFA 4DR2L 3FKIG 4LW1A 2UUBQ 1VQIA 5IYDH 1WOCA 4DV0L 5FLMG 4FDBA 2LSSA 3OTOL 4IFDJ 2I5HA 1SLJA 1NY4A 2XTIA 5C3EG 2Q2TA 2Y0SE 1V1QA 1AE3A 2AMCB 1A63A 3ULLA 3OYYA 1EQQA 1WCMH 1EOVA 4JI2Q 3WWVA 4IJHA 4DV2L 1H95A 1E7ZA 2PQAA 1CKNA 2AWNA 4L5TA 1U5KA 4YWLA 5IWAL 5C0XG 4AQYL 5M5XH 4YWMA 2R93H 1DGSA 1VQ9A 3KJPA 1FVIA 4PZ6A 4NXMQ 5FLMH 4KHZA 3CCUA 2Q2HA 4DUYL 3CF5A 4OXPA 4X65Q 4GNXA 3I7FA 1W2BA 1JB7A 1XNQL 1JJGA 4LUZA 1PH6A 4KHPQ 1NBWA 4DK6C 2LXJA 3KF6B 1A8VA 3TRZA 3UDXA 4LWCA 1SFOH 5E7NA 2B63H 4BXXG 4DV6Q 4AYBG 2UXDQ 1K0RA 3H3VH 1LTLA 1XNRQ 2Q2IA 4Y7NH 3PUYA 5JJIA 3RZDH 1P8LA 3F2DA 3KJOA 5C0XI 4HIMA 5GROA 4HJ9A 1V43A 3L2PA 3EIVA 1A0IA 4A3BG 3L0OA 1XPRA 3TQYA 4YCVA 1L1OB 4YHHL 2N78A 2JA6H 3PIOA 4JI6Q 4LF9L 2JA7H 2MQHA 3TS0A 1FGUA 4POFA 4A3EH 3BZCA 3HOYH 4A3DH 1FL0A 1K9MC 3PV0A 4BY1G 1I94L 3CQZH 1IBLQ 4KHPL 3S2DH 4GLVB 4P75A 2UUCL 3RLFA 2UU9Q 4BBRG 3TEHB 4X64L 3F2BA 1KXLA 1IBKL 1XTDA 3PO3G 4DK3C 3PO2G 1FJGL 1YEZA 2IX1A 1Y1VH 5ELNA 2F52A 2OWOA 3CXCA 3GTMH 3G4SA 1X55A 2B3GA 4UP9A 4DV1L 3S2HH 3M4OH 3D31A 2QGQA 4DR4L 2F4VL 2N3SA 4PZ8A 1N33Q 4A3CG 3JAMi 1AH9A 1B8AA 1W3SA 3H0GH 3PO2H 1YVCA 4X66Q 5M3MG 1ASYA 4C3JH 4IPCA 4JBJA 3FKIH 4K0KL 1K3RA 1E1TA 2VQFL 1R9TH 2N8NA 3RR5A 1Q86C 2K14A 3Q8DA 4AYBE 4LF8Q 2JE6I 1HR0W 5HY6A 2KHJA 2A19A 5FLXc 2WAQG 3M3YH 1CSPA 3GTOH 5LMUQ 1IYJB 1MJEA 2D62A 4A3GH 3RLOA 1LM0A 1X65A 2AHOB 3K7AH 4OWTB 3G48A 4DR1L 3J81j 3VDYA 1VQ5A 4LF9Q 2R92H 3HOWG 1EFWA 4UY8C 3AFPA 1UE6A 3ZJYC 4B3ML 1PH9A 3PUWA 4IFDI 4NB3A 2D0OA 2KBNA 4YY3L 4LFBQ 1GD7A 3U4VA 4JI3Q 1YJNA 2UUBL 2ATWA 4R4OA 1KC8C 3K7UC 4JV5L 2VNUD 1QZHA 2E2IH 1VQEA 1AE2A 2F4VQ 1XPUA 2K52A 4GOPA 1VQAA 4LFCQ 3GTKH 1A62A 4ALPA 4DR7L 4K0KQ 3CCRA 2VQFQ 5K36G 3E9IA 2Y0SG 1KRTA 2VZAA 2K50A 1SROA 2IHEA 5BR8Q 3KOJA 5H1SE 3JC66 5IYDG 1V9PA 1IBKQ 3S15H 4JG2A 4A3BH 3PUVA 1PVOA 4A3KG 1VQ8A 2BA0A 3I4NG 4WJ4A 4A75A 4TVAB 4DAYB 3HKZG 2JK8A 1VQCA 2OQKA 1K8AC 1T9HA 1EYGA 4A93H 2R93G 2WAQE 4DV0Q 1IBLL 2CWPA 4JI7Q 4C3IH 1LUZA 2A1AA 4GNXC 4MNOA 4NXNL 4IJLA 1I50H 4B3TQ 3GTPH 3T1YQ 1HJPA 3GD7A 1UEBA 4A3MG 3ERSX 3CC4A 3OTOQ 4GKKL 3B6YA 1ASZA 2E5LQ 5GADC 2HHHQ 3JAMc 3KF8B 3ULJA 4DR1Q 2K5NA 2NVXH 1X9NA 1CSQA 4JBKA 1N36L 2NZHA 4A3FH 3H15A 4DR3L 2AKWB 1OXUA 1K73C 4LF8L 1JT8A 2PMZE 2GVBA 4DV4Q 1I5FA 4IPGA 1HNWQ 4YY3Q 2I5MX 1D8LA 5GAEC 3J81c 5M3FH 2OTLA 3K80C 3PCOB 1QVCA 1IXRA 1BBUA 4O0AA 2EXDA 1S72A 3K0XA 2MO1A 4DUZL 3RNUA 2ID0A 3W5OA 1LYLA 4QY7A 2QEXA 1E3PA 4XTCS 2I0QA 1YJ9A 1EIFA 1KHIA 3I56A 2JQOA 1VQ7A 2HT1A 3I55A 2CQOA 2ZTDA 2JA5H 5IP7H 2R7ZH 1EQRA 2EIFA 2KHIA 4A93G 4H02A 1FJGQ 3RZOH 1VQFA 1PFSA 3J7ZC 4DV5Q 5C44G 1QVFA 5J3BA 1SRUA 4A76A 3M85A 2V1CC 1CKMA 3PSIA 1XNQQ 1KRSA 2UUAQ 1IZ6A 2R92G 1HH2P 3SGIA 5GAHC 1Q46A 4A3GG 2ZJRA 5JEAG 2R6GA 2WP8J 5IP9H 4IFDG 2OTJA 3CCVA 1WYDA 2JA9A 1XJVA 3CD6A 4QL5A 4DR6L 1TWHH 1OXVA 4PZ7A 2Z6KC 3CPWA 3AEVA 3FHWA 1X3EA 3NENA 4J15A 2JA6G 1M90C 2ZTEA 1YHAA 4GN4B 3PUXA 4PMWA 4DKAC 3I4MH 1CKNB 3STBD 3T1YL 5M3MH 2L15A 2E8GA 1VQKA 1S3OA 5GQOA 4EX5A 1Q1BA 3J80c 1Q12A 1XMQL 4JI0L 3KLWA 4OWWB 4DR2Q 4BY1H 1EWIA 3MXNB 2R7DA 1KD1C 3CCSA 1QUQA 4NPSA 2VL6A 4BA1I 3HOZG 4B3RL 2B29A 4OWXB 3RN5A 1L2FA 4DV3Q 1QZGA 2E2HH 3T1HL 4MZ9A 2ZJPA 3A74A 2RCNA 1VQGA 4GN5A 2WB1E 4P72A 3BZKA 2ZTCA 1NE3A 4R4QA 3PO3H 2UXCQ 5C4XG 1PH5A 3NELA 3KDFA 4DV2Q 1S40A 3W1BA 2CWAA 4JI8L 3U58A 4A3JG 1XMOL 2JEAI 1Y1WH 2VY3A 4LF5L 3MEFA 4EQ5A 3FP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RL2 A;  2NVQ H;  4DR6 Q;  4LFA Q;  1VQD A;  1Q1E A;  4DV4 L;  1PV4 A;  4A3E G;  4JI2 L;  3UDF A;  3HOY G;  2I5L X;  2OCE A;  4R4C A;  4HIK A;  3CCQ A;  1PH4 A;  4ME3 A;  2UXB Q;  1XMQ Q;  4LF4 Q;  4A3F G;  2OQ0 A;  3BU2 A;  4A3J H;  3PF5 A;  4A3K H;  4DR7 Q;  4OO1 G;  1Z9F A;  2YV5 A;  5DLQ E;  1J5E Q;  3CME A;  1X56 A;  2NZO A;  5AJ3 L;  1L1O C;  1JE5 A;  4QIW E;  3HOW H;  1Z47 A;  3EN2 A;  1PYB A;  1I6H H;  4RG1 A;  2JA8 H;  4PG3 A;  1HNZ Q;  4YWK A;  1OTC A;  4C3H H;  4BBS G;  4A3L H;  2VQE Q;  5JJK A;  1PHJ A;  2ZJQ A;  3KF6 A;  1MIU A;  2B63 G;  4QQB X;  4YCW A;  4B3S Q;  1G29 1;  1CKO A;  1Y1V G;  3EBE A;  3ER0 A;  4LF4 L;  2KCM A;  3A5Z B;  4QGU A;  4NXN Q;  4JV5 Q;  1PH2 A;  4AQY Q;  2KEN A;  5IT9 c;  1B7Y B;  4GLA C;  1X3G A;  2R7F A;  5GAG C;  4LFA L;  5HGQ A;  3BJU A;  2NVT H;  2BH8 A;  1MJC A;  5AJ3 Q;  4HJA A;  2K5V A;  3NBH B;  3GTL H;  2IX0 A;  1PA6 A;  1IBM Q;  4DR5 Q;  2QA4 A;  1QVG A;  3F2C A;  4GLX A;  4L5S A;  4LF7 L;  1HNZ L;  3CC2 A;  4B3R Q;  4GOP C;  2CCZ A;  4JI8 Q;  1YHB A;  1GO3 E;  1EUJ A;  4BXX H;  4DV7 L;  1HZB A;  2JA7 G;  1VS0 A;  1VQ6 A;  2RHS B;  2E5L L;  3GTG H;  1GVP A;  1KQS A;  2NN6 G;  2NVY H;  1J5E L;  3STB C;  4JI6 L;  4GKK Q;  4BY7 H;  4P73 A;  2BA1 A;  3A0J A;  3LGJ A;  3E9H A;  2VS1 A;  1N8R C;  3I2Z A;  4JCV E;  3ICE A;  5JJL A;  2GN5 A;  2UXB L;  4YCU A;  3DLL A;  3HOV G;  4BBR H;  1HNW L;  1SR3 A;  3F1Z A;  4DV5 L;  3W1G A;  1PH7 A;  1TWF H;  4C2M H;  4R4T A;  3GTJ H;  3M9B A;  2R7Z G;  4JI5 Q;  3CW2 C;  4Y52 H;  2ALY B;  3J81 i;  3HOX G;  3CCJ A;  2FXQ A;  3HOZ H;  4AH6 A;  3KDF B;  1UE7 A;  2WB1 G;  4DPG A;  4HID A;  4GN3 B;  1N34 Q;  1TWG H;  4JC0 A;  1IL2 A;  4JI3 L;  4GOP B;  4B3T L;  4DUZ Q;  1UE5 A;  3OW2 A;  1TXY A;  2IY5 B;  1JMC A;  4HJ8 A;  1KAW A;  5C4J H;  2K75 A;  4JI4 L;  4RMF A;  3DM3 A;  5C44 H;  3CC7 A;  5M3F G;  4B3S L;  1Q82 C;  4BY7 G;  3AFQ A;  3K81 C;  1C7Y A;  1IBM L;  2HHH L;  2Z6K A;  2AWO A;  4IPD A;  2HQL A;  5IYC G;  1YJW A;  3J7A 5;  2UXD L;  1HR0 L;  4POG A;  5C0X J;  4IOC A;  2F3I A;  3U4Z A;  4IOA A;  4LUV A;  3UDI A;  5JEA J;  4L5R C;  5IWA Q;  3HOX H;  5BR8 L;  4HJ7 A;  1GKH A;  4JOI A;  1WJJ A;  1YNX A;  3H3V I;  1X54 A;  3M4Q A;  3AQQ A;  4A4I A;  4X6A H;  1N34 L;  1HNX L;  3RLN A;  5FJ8 G;  4OX9 Q;  2A8V A;  2ASB A;  3S1N H;  1TWA H;  5M5W H;  1L1O A;  4LF6 Q;  3TRE A;  1C9O A;  2RF4 A;  4AIM A;  1NMF A;  1M1K C;  3HOU G;  4X66 L;  1WFQ A;  4GKJ Q;  3I4N H;  2JA5 G;  3NEM A;  1VQN A;  2BH2 A;  1XPO A;  4BBS H;  5IP9 G;  2PI2 A;  4BA2 I;  4JYA Q;  1NTG A;  1P16 A;  1O7I A;  1G51 A;  1YIT A;  4DAM A;  4DV6 L;  1Y1W G;  2JA8 G;  4TQU S;  4JI5 L;  2CKZ B;  4QJF A;  3CCE A;  4A3I G;  1HNX Q;  1EIY B;  4OX9 L;  1PH1 A;  2YYZ A;  4DR3 Q;  3S16 H;  1UWV A;  3HKZ E;  2YTY A;  2YTV A;  5EAY A;  1SE8 A;  3UDG A;  3I4O A;  4R1J A;  2IT1 A;  4UP7 A;  1HZC A;  5C4X H;  4DR5 L;  4LF7 Q;  3ULP A;  3M7N A;  1SN8 A;  2MO0 A;  4MTN A;  1K83 H;  1NMG A;  1YBY A;  4OON A;  3A5U A;  1Q81 C;  1KIX A;  1K8G A;  1HR0 Q;  2UU9 L;  3S1M H;  2K4K A;  5IP7 G;  3UE0 A;  5LMN W;  1OXS C;  3M4P A;  1BBW A;  1VCI A;  3E0E A;  4DV7 Q;  2ES2 A;  1N32 Q;  2GVA A;  4APV A;  1RIP A;  1B70 B;  2UXC L;  1WCM G;  1VQL A;  4O2D A;  1N36 Q;  1JJC B;  1GM5 A;  2H5X A;  3TS2 A;  5C3E H;  1WI5 A;  1VQJ A;  2RHQ B;  2ZM6 L;  5LMN Q;  1SMX A;  1KL9 A;  4GNX B;  4IO9 A;  4A3M H;  2HIV A;  3KYH C;  3L7Z C;  4LFC L;  5IY0 A;  1MKH A;  4DR4 Q;  4HJ5 A;  2DGY A;  4R4I A;  2C35 B;  1VQ4 A;  4JYA L;  4UPA A;  2UUC Q;  3S14 H;  3S1R H;  1TWC H;  4DNI A;  1Y14 B;  3KFU A;  2MFI A;  3J80 i;  3HKS A;  3G71 A;  2JJQ A;  3GTQ H;  4JOI C;  2VUM H;  4OO1 I;  3T1H Q;  1X6O A;  3CCL A;  4LF6 L;  1U0L A;  2JEB I;  3CCM A;  4JI1 Q;  1G6P A;  4X64 Q;  1E22 A;  5IYB H;  4L5Q A;  2EQS A;  3S24 A;  1CUK A;  3PF4 A;  3D0F A;  1Q7Y C;  1I94 Q;  2Q2U A;  3I4M G;  2PI2 E;  4A3C H;  1UE1 A;  3CAM A;  4P74 A;  5IE8 A;  3AYH B;  1L0W A;  2PNH A;  5M5Y H;  2VQE L;  1YHQ A;  1VQO A;  2HIX A;  1NJI C;  2LXK A;  2VUM G;  1E24 A;  4IPH A;  1VQM A;  4WJ3 M;  1D7Q A;  4GS3 A;  1XNR L;  4GKJ L;  3UE1 A;  3IRB A;  2YTX A;  4JBM A;  1PYS B;  3HOV H;  5LMU L;  3PGZ A;  2D0P A;  2CFM A;  3S17 H;  4LNQ A;  4X65 L;  1YZ6 A;  3CMA A;  1BVS A;  1C0A A;  1Q8K A;  3H0G G;  2PQA B;  2WFW A;  5FJ8 H;  3RN2 A;  2UUA L;  4B3M Q;  2N49 A;  1X3F A;  3K8A A;  1N33 L;  2Z0S A;  3CPF A;  1HZA A;  4NXM L;  4HIO A;  2ZM6 Q;  5LMN L;  4A3D G;  1N9W A;  2K5H A;  3F8T A;  3PIP A;  2NN6 I;  4X62 L;  2E2J H;  4JI7 L;  3CP0 A;  4LFB L;  1N32 L;  1PH3 A;  3HFZ B;  4KLK A;  1BKB A;  2DUD A;  4JI1 L;  1XMO Q;  3HOU H;  1VQP A;  1I3Q H;  3U50 C;  3GO5 A;  3PUZ A;  4LF5 Q;  1E1O A;  2VW9 A;  1VQH A;  2XGT A;  4DUY Q;  4LUO A;  4UP8 A;  4JI0 Q;  4A3I H;  5IYB G;  1PH8 A;  1OXT A;  3GDE A;  1HZ9 A;  4JBW A;  1YI2 A;  1OXX K;  4XIG S;  4A3L G;  4P71 A;  1VQB A;  5ELO A;  3S1Q H;  2YU9 H;  4DV3 L;  2KCT A;  1JJ2 A;  1J6Q A;  4DV1 Q;  4X62 Q;  5IYC H;  4JI4 Q;  4YHH Q;  4KI0 A;  2MNA A;  3G6E A;  1QUQ B;  1YIJ A;  2IHF A;  4DR2 L;  3FKI G;  4LW1 A;  2UUB Q;  1VQI A;  5IYD H;  1WOC A;  4DV0 L;  5FLM G;  4FDB A;  2LSS A;  3OTO L;  4IFD J;  2I5H A;  1SLJ A;  1NY4 A;  2XTI A;  5C3E G;  2Q2T A;  2Y0S E;  1V1Q A;  1AE3 A;  2AMC B;  1A63 A;  3ULL A;  3OYY A;  1EQQ A;  1WCM H;  1EOV A;  4JI2 Q;  3WWV A;  4IJH A;  4DV2 L;  1H95 A;  1E7Z A;  2PQA A;  1CKN A;  2AWN A;  4L5T A;  1U5K A;  4YWL A;  5IWA L;  5C0X G;  4AQY L;  5M5X H;  4YWM A;  2R93 H;  1DGS A;  1VQ9 A;  3KJP A;  1FVI A;  4PZ6 A;  4NXM Q;  5FLM H;  4KHZ A;  3CCU A;  2Q2H A;  4DUY L;  3CF5 A;  4OXP A;  4X65 Q;  4GNX A;  3I7F A;  1W2B A;  1JB7 A;  1XNQ L;  1JJG A;  4LUZ A;  1PH6 A;  4KHP Q;  1NBW A;  4DK6 C;  2LXJ A;  3KF6 B;  1A8V A;  3TRZ A;  3UDX A;  4LWC A;  1SFO H;  5E7N A;  2B63 H;  4BXX G;  4DV6 Q;  4AYB G;  2UXD Q;  1K0R A;  3H3V H;  1LTL A;  1XNR Q;  2Q2I A;  4Y7N H;  3PUY A;  5JJI A;  3RZD H;  1P8L A;  3F2D A;  3KJO A;  5C0X I;  4HIM A;  5GRO A;  4HJ9 A;  1V43 A;  3L2P A;  3EIV A;  1A0I A;  4A3B G;  3L0O A;  1XPR A;  3TQY A;  4YCV A;  1L1O B;  4YHH L;  2N78 A;  2JA6 H;  3PIO A;  4JI6 Q;  4LF9 L;  2JA7 H;  2MQH A;  3TS0 A;  1FGU A;  4POF A;  4A3E H;  3BZC A;  3HOY H;  4A3D H;  1FL0 A;  1K9M C;  3PV0 A;  4BY1 G;  1I94 L;  3CQZ H;  1IBL Q;  4KHP L;  3S2D H;  4GLV B;  4P75 A;  2UUC L;  3RLF A;  2UU9 Q;  4BBR G;  3TEH B;  4X64 L;  3F2B A;  1KXL A;  1IBK L;  1XTD A;  3PO3 G;  4DK3 C;  3PO2 G;  1FJG L;  1YEZ A;  2IX1 A;  1Y1V H;  5ELN A;  2F52 A;  2OWO A;  3CXC A;  3GTM H;  3G4S A;  1X55 A;  2B3G A;  4UP9 A;  4DV1 L;  3S2H H;  3M4O H;  3D31 A;  2QGQ A;  4DR4 L;  2F4V L;  2N3S A;  4PZ8 A;  1N33 Q;  4A3C G;  3JAM i;  1AH9 A;  1B8A A;  1W3S A;  3H0G H;  3PO2 H;  1YVC A;  4X66 Q;  5M3M G;  1ASY A;  4C3J H;  4IPC A;  4JBJ A;  3FKI H;  4K0K L;  1K3R A;  1E1T A;  2VQF L;  1R9T H;  2N8N A;  3RR5 A;  1Q86 C;  2K14 A;  3Q8D A;  4AYB E;  4LF8 Q;  2JE6 I;  1HR0 W;  5HY6 A;  2KHJ A;  2A19 A;  5FLX c;  2WAQ G;  3M3Y H;  1CSP A;  3GTO H;  5LMU Q;  1IYJ B;  1MJE A;  2D62 A;  4A3G H;  3RLO A;  1LM0 A;  1X65 A;  2AHO B;  3K7A H;  4OWT B;  3G48 A;  4DR1 L;  3J81 j;  3VDY A;  1VQ5 A;  4LF9 Q;  2R92 H;  3HOW G;  1EFW A;  4UY8 C;  3AFP A;  1UE6 A;  3ZJY C;  4B3M L;  1PH9 A;  3PUW A;  4IFD I;  4NB3 A;  2D0O A;  2KBN A;  4YY3 L;  4LFB Q;  1GD7 A;  3U4V A;  4JI3 Q;  1YJN A;  2UUB L;  2ATW A;  4R4O A;  1KC8 C;  3K7U C;  4JV5 L;  2VNU D;  1QZH A;  2E2I H;  1VQE A;  1AE2 A;  2F4V Q;  1XPU A;  2K52 A;  4GOP A;  1VQA A;  4LFC Q;  3GTK H;  1A62 A;  4ALP A;  4DR7 L;  4K0K Q;  3CCR A;  2VQF Q;  5K36 G;  3E9I A;  2Y0S G;  1KRT A;  2VZA A;  2K50 A;  1SRO A;  2IHE A;  5BR8 Q;  3KOJ A;  5H1S E;  3JC6 6;  5IYD G;  1V9P A;  1IBK Q;  3S15 H;  4JG2 A;  4A3B H;  3PUV A;  1PVO A;  4A3K G;  1VQ8 A;  2BA0 A;  3I4N G;  4WJ4 A;  4A75 A;  4TVA B;  4DAY B;  3HKZ G;  2JK8 A;  1VQC A;  2OQK A;  1K8A C;  1T9H A;  1EYG A;  4A93 H;  2R93 G;  2WAQ E;  4DV0 Q;  1IBL L;  2CWP A;  4JI7 Q;  4C3I H;  1LUZ A;  2A1A A;  4GNX C;  4MNO A;  4NXN L;  4IJL A;  1I50 H;  4B3T Q;  3GTP H;  3T1Y Q;  1HJP A;  3GD7 A;  1UEB A;  4A3M G;  3ERS X;  3CC4 A;  3OTO Q;  4GKK L;  3B6Y A;  1ASZ A;  2E5L Q;  5GAD C;  2HHH Q;  3JAM c;  3KF8 B;  3ULJ A;  4DR1 Q;  2K5N A;  2NVX H;  1X9N A;  1CSQ A;  4JBK A;  1N36 L;  2NZH A;  4A3F H;  3H15 A;  4DR3 L;  2AKW B;  1OXU A;  1K73 C;  4LF8 L;  1JT8 A;  2PMZ E;  2GVB A;  4DV4 Q;  1I5F A;  4IPG A;  1HNW Q;  4YY3 Q;  2I5M X;  1D8L A;  5GAE C;  3J81 c;  5M3F H;  2OTL A;  3K80 C;  3PCO B;  1QVC A;  1IXR A;  1BBU A;  4O0A A;  2EXD A;  1S72 A;  3K0X A;  2MO1 A;  4DUZ L;  3RNU A;  2ID0 A;  3W5O A;  1LYL A;  4QY7 A;  2QEX A;  1E3P A;  4XTC S;  2I0Q A;  1YJ9 A;  1EIF A;  1KHI A;  3I56 A;  2JQO A;  1VQ7 A;  2HT1 A;  3I55 A;  2CQO A;  2ZTD A;  2JA5 H;  5IP7 H;  2R7Z H;  1EQR A;  2EIF A;  2KHI A;  4A93 G;  4H02 A;  1FJG Q;  3RZO H;  1VQF A;  1PFS A;  3J7Z C;  4DV5 Q;  5C44 G;  1QVF A;  5J3B A;  1SRU A;  4A76 A;  3M85 A;  2V1C C;  1CKM A;  3PSI A;  1XNQ Q;  1KRS A;  2UUA Q;  1IZ6 A;  2R92 G;  1HH2 P;  3SGI A;  5GAH C;  1Q46 A;  4A3G G;  2ZJR A;  5JEA G;  2R6G A;  2WP8 J;  5IP9 H;  4IFD G;  2OTJ A;  3CCV A;  1WYD A;  2JA9 A;  1XJV A;  3CD6 A;  4QL5 A;  4DR6 L;  1TWH H;  1OXV A;  4PZ7 A;  2Z6K C;  3CPW A;  3AEV A;  3FHW A;  1X3E A;  3NEN A;  4J15 A;  2JA6 G;  1M90 C;  2ZTE A;  1YHA A;  4GN4 B;  3PUX A;  4PMW A;  4DKA C;  3I4M H;  1CKN B;  3STB D;  3T1Y L;  5M3M H;  2L15 A;  2E8G A;  1VQK A;  1S3O A;  5GQO A;  4EX5 A;  1Q1B A;  3J80 c;  1Q12 A;  1XMQ L;  4JI0 L;  3KLW A;  4OWW B;  4DR2 Q;  4BY1 H;  1EWI A;  3MXN B;  2R7D A;  1KD1 C;  3CCS A;  1QUQ A;  4NPS A;  2VL6 A;  4BA1 I;  3HOZ G;  4B3R L;  2B29 A;  4OWX B;  3RN5 A;  1L2F A;  4DV3 Q;  1QZG A;  2E2H H;  3T1H L;  4MZ9 A;  2ZJP A;  3A74 A;  2RCN A;  1VQG A;  4GN5 A;  2WB1 E;  4P72 A;  3BZK A;  2ZTC A;  1NE3 A;  4R4Q A;  3PO3 H;  2UXC Q;  5C4X G;  1PH5 A;  3NEL A;  3KDF A;  4DV2 Q;  1S40 A;  3W1B A;  2CWA A;  4JI8 L;  3U58 A;  4A3J G;  1XMO L;  2JEA I;  1Y1W H;  2VY3 A;  4LF5 L;  3MEF A;  4EQ5 A;  3FP9 A; 
#chains in the Genus database with same CATH topology
 1GUO A;  5IGC A;  2NVQ H;  4LFA Q;  4DV4 L;  4JI2 L;  3UDF A;  3SEB A;  4HIK A;  3CCQ A;  4ME3 A;  1PTO C;  1PZJ D;  2OQ0 A;  5C4H A;  2YV5 A;  1J5E Q;  4EQP A;  5EGT A;  2B2W C;  5AJ3 L;  3MXN A;  3EN2 A;  1PYB A;  1K8M A;  1HNZ Q;  4YWK A;  4C3H H;  1O78 A;  2VQE Q;  1PHJ A;  5T1G A;  2KCM A;  2KEN A;  5CV7 A;  5I6W A;  4GLA C;  5HGQ A;  3K57 A;  2BH8 A;  4HJA A;  4HSV A;  4DR5 Q;  2QA4 A;  2F0G A;  3F2C A;  3TSS A;  4GOP C;  2CCZ A;  1YHB A;  2NBF A;  1GO3 E;  5JAV A;  1ZXT A;  1QCB D;  2F0S A;  4BXX H;  5J1Z A;  1VS0 A;  2E5L L;  3SK5 A;  2NVY H;  4JI6 L;  5DM6 3;  3HS0 C;  4GKK Q;  1SJE D;  2FHT A;  3LGJ A;  2VS1 A;  3I2Z A;  5JPN C;  3I70 A;  3ICE A;  1HNW L;  5FKA C;  2C9O A;  3W1G A;  1CZG A;  3M9B A;  2R7Z G;  4Y52 H;  3FEW X;  4DNT B;  4FF3 A;  4A3J B;  1K83 B;  2DJG C;  2B2Y C;  3HOZ H;  5KYL A;  1ROD A;  4DPG A;  4HID A;  4GN3 B;  4DUZ Q;  1SFO B;  2IY5 B;  1EYC A;  4JVZ A;  1A3U A;  1R4P B;  1F2L A;  2HHH L;  2KVM A;  3OWE B;  2AWO A;  1JWM D;  1EZ8 A;  3TBI B;  1BCP F;  1DYQ A;  2F3I A;  3U4Z A;  4LUV A;  1GKH A;  1WJJ A;  1X54 A;  2K28 A;  2XRS D;  3AQQ A;  4A4I A;  4X6A H;  3RD4 A;  2A8V A;  2ASB A;  1Q3L A;  4JK1 C;  3HOU G;  2KEE A;  5IGB A;  3PMF A;  2F0D A;  2L5T A;  1VQN A;  1Z7T A;  4BBS H;  5IP9 G;  4BA2 I;  4IFD H;  3A8K E;  2Z9H A;  1G51 A;  1YIT A;  4DAM A;  1EWH A;  1Y1W G;  2CKZ B;  2NTS A;  1EIY B;  2GA4 B;  3QOL A;  2YTY A;  2YTV A;  2X6G A;  5EAY A;  1SE8 A;  2IT1 A;  1HZC A;  4LF7 Q;  1SN8 A;  3A5U A;  1K83 H;  2Z6B A;  5IP7 G;  1OXS C;  1BBW A;  1RTN A;  2O5I C;  2ES2 A;  3C1F A;  4XYQ A;  1B70 B;  2UXC L;  1F2Z A;  1STY A;  1SJH D;  3AMU A;  3LNN A;  1WI5 A;  2RHQ B;  5C5M A;  4A3M H;  1KL9 A;  3KYH C;  2F3V A;  3ERQ A;  5NUC A;  4LFC L;  1MKH A;  1JE4 A;  4HJ5 A;  4R4I A;  1EY9 A;  4L63 B;  3KFU A;  3K7A B;  4ODG A;  4RKL A;  1EWC A;  3Q6S A;  4RHS A;  1EY0 A;  1U0L A;  3C1E A;  3SK6 A;  4PMB A;  2J4X A;  1S4Z A;  5BN3 A;  1Q7Y C;  1Z6H A;  1SBB B;  2Q2U A;  2PI2 E;  4ABN A;  5IE8 A;  3AYH B;  5M5Y H;  2HIX A;  1NJI C;  2VUM G;  1SYC A;  1VQM A;  1ONL A;  1S5B D;  3HOX B;  3HOV H;  3PGZ A;  2F0W A;  2CFM A;  4LNQ A;  2F0Q A;  1C0A A;  4HMJ A;  1TY2 A;  2UUA L;  5FJ8 H;  2PZW A;  3NSW A;  1J9O A;  1N33 L;  1SDF A;  1LV9 A;  3UI2 A;  5LMN L;  4HIO A;  2Q8I B;  1PFM A;  4G7H C;  2NN6 I;  2E2J H;  4JI7 L;  4FXG C;  1N32 L;  3A7A B;  3HFZ B;  2DUD A;  1D2B A;  1PTO F;  2VW9 A;  2G9H D;  4CJ0 B;  2XGT A;  2QCP X;  4UP8 A;  2R3Z A;  1YNJ C;  2B8F A;  5C4X B;  4JBW A;  1IHZ A;  4M1U B;  4A3K B;  2NVT B;  1DXM A;  3S1Q H;  3DHQ A;  1JJ2 A;  4P2C B;  2FMC A;  4X62 Q;  4JI4 Q;  4YHH Q;  3V05 A;  2XWB B;  4IUV A;  4QUC A;  1A2U A;  4OIJ A;  4B08 A;  2EY1 A;  1EOV A;  5FOB B;  1IKM A;  1QG7 A;  3NBH A;  4R9W A;  4YWL A;  3OPO A;  3BVZ A;  5C3X A;  5CBA E;  1DGS A;  1STE A;  1SMY C;  1FVI A;  4PZ6 A;  3OSO A;  4NXM Q;  1HUN A;  3CCU A;  2Q2H A;  3OMG A;  4X65 Q;  4GNX A;  1B9N A;  1PRT D;  1JB7 A;  1JJG A;  3NHH A;  1A8V A;  2AUK A;  3TRZ A;  2MUY A;  5CYU A;  5EBC A;  4DV6 Q;  4AYB G;  2UXD Q;  1NR4 A;  4Y7N H;  2PCF B;  1P8L A;  4PMC A;  4Q5V A;  3LWU A;  2KOL A;  5M5W B;  3S1N B;  1TS5 A;  4ZYS A;  2JA7 H;  1D5M C;  3V2T A;  1FR3 A;  4A3E H;  1FL0 A;  4IQZ A;  1K9M C;  1C48 A;  1I94 L;  3RLF A;  2WKD A;  4BBR G;  5FO7 B;  4LK1 C;  4PNY A;  3K5L A;  1D5Z C;  1D5X C;  1FJG L;  1E2Z A;  2IX1 A;  2F52 A;  2RBM A;  3GTM H;  3GTQ B;  3HG9 A;  4UP9 A;  2EPB A;  5CGK A;  1ZYR C;  4G7Z C;  3S2H H;  4A3B B;  1F9S A;  2K01 A;  4DR4 L;  4PZ8 A;  2EOT A;  2R61 A;  4RGM A;  1XTC D;  2VB3 X;  1B8A A;  3PO2 H;  3WDN A;  1ASY A;  3TDQ A;  3A55 A;  3FPU B;  3QR8 A;  3FKI H;  4KY5 A;  1E1T A;  2EY5 A;  4K2K A;  3GTK B;  1R9T H;  1Q86 C;  2SDF A;  2K14 A;  2XN9 C;  5HY6 A;  5FLX c;  2A19 A;  3RMH A;  2WAQ G;  1LTB D;  2K03 A;  1PTO B;  4ILW A;  1SNQ A;  4OEL B;  1TWC B;  2VB2 X;  2AHO B;  2QF7 A;  1VQ5 A;  3G48 A;  4LF9 Q;  3J81 j;  2RSO A;  4UY8 C;  1TS3 A;  4X3T A;  3AFP A;  3D3R A;  3PUW A;  4XQQ A;  4MN3 A;  2JA7 B;  1CK1 A;  4JV5 L;  3K7U C;  2DNE A;  5C5L A;  5C3E B;  2PW5 A;  1II3 A;  1XPU A;  2VXW A;  4ZLT F;  1A62 A;  2K1B A;  5LL6 S;  3OHX C;  1QE6 A;  1WTW A;  1SRO A;  3S15 H;  3GTM B;  1VQ8 A;  4TVA B;  4DAY B;  3QWN A;  3HKZ G;  2JK8 A;  1VQC A;  1T9H A;  2R93 G;  5FO8 B;  3JAM L;  4OEM B;  5CV8 A;  1LUZ A;  4C3I H;  2HD3 A;  1I50 H;  1VDZ A;  2F0J A;  2PO4 A;  3T1Y Q;  4ZKB B;  4B3T Q;  2F0F A;  1UEB A;  3OTO Q;  1ENA A;  3NTH A;  4RAU C;  3KK7 A;  2NVX H;  2ZXP A;  4JBK A;  4A3F H;  4CHT B;  4DR3 L;  2FJ2 A;  2AKW B;  2JP1 A;  2FIN B;  4IPG A;  3J81 c;  2ZXR A;  3BVM A;  1TY0 A;  2E2H B;  1VF7 A;  2DY7 A;  2B39 A;  4KTA A;  4DUZ L;  1BCP C;  1LYL A;  2I0Q A;  2JN4 A;  4HTH A;  1EIF A;  1KHI A;  2HT1 A;  2JQO A;  1TVX A;  4KMU C;  5EQ0 A;  2R7Z H;  4A93 G;  2F4I A;  3H09 A;  4H02 A;  4A3I B;  4UDU C;  5C44 G;  1QVF A;  5I2X A;  4A76 A;  2R93 B;  2V1C C;  2F0T A;  1KRS A;  3M4Y A;  1G8Z D;  3ONA B;  2A5H A;  4A3G G;  2ZJR A;  5A35 A;  4NW2 A;  4C3I G;  2F0M A;  1XJV A;  4QL5 A;  4X3K A;  4DR6 L;  3AEV A;  3FHW A;  4PV1 C;  1HFG A;  4DKA C;  3I4M H;  4HMI A;  1CKN B;  3T1Y L;  4PQX A;  1CHQ D;  3J80 c;  1Q12 A;  1IYV A;  4QF4 A;  5EKL A;  3KF8 A;  4BY1 H;  1O7Y A;  2R7D A;  3I90 A;  2JA6 B;  2B2T C;  1L2F A;  5DM7 3;  1Y69 U;  5CV4 A;  2L4N A;  4MHE A;  2TMP A;  3D6W A;  2WB1 E;  4P72 A;  3BZK A;  2NZ1 D;  3CRL C;  3EA6 A;  1LT3 D;  4C3H B;  4C1N K;  1DJR D;  1EY6 A;  1XMO L;  2JEA I;  2JA5 B;  3HOU B;  1Y1W H;  2B2W A;  5C0X H;  1K8A C;  1RL2 A;  3HOV B;  4DR6 Q;  1JC7 A;  1Q1E A;  3IFD A;  3HOY G;  3MC0 B;  2CHB D;  4R4C A;  4LF4 Q;  4A3F G;  4A3J H;  4DR7 Q;  1KAA A;  3MAQ A;  2SOB A;  4CBV A;  2RVL A;  1X56 A;  2NZO A;  4OGQ C;  5I9O A;  1L1O C;  4QIW E;  2KHS A;  1I6H H;  5K36 H;  4RG1 A;  2JA8 H;  1LTR D;  3NXW A;  1OTC A;  4A3L H;  2B63 G;  4YCW A;  4B3S Q;  1CKO A;  1G29 1;  3ER0 A;  2SNM A;  4Z9C B;  2IJ0 A;  4KK7 A;  1PH2 A;  5IT9 c;  1B44 D;  1X3G A;  1K8O A;  3BJU A;  2NVT H;  5AJ3 Q;  2OF1 A;  3TP6 A;  1SYD A;  3GTL H;  4LF7 L;  2K5Q A;  1HNZ L;  1TWH B;  5JEA H;  5JPM C;  1HZB A;  1D6E C;  4XQJ A;  2BCO A;  3I4N B;  3BS1 A;  1DD2 A;  1EY8 A;  1J5E L;  3STB C;  3HP3 A;  4X3U A;  1B4O A;  4XYO A;  4A3M B;  4V19 0;  4DN4 M;  2BA1 A;  3QIA A;  3E9H A;  4UHV A;  1LTA D;  2GN5 A;  3HOV G;  3D4D A;  1SR3 A;  4DV5 L;  1YNN C;  3MHB A;  3T16 A;  3MEH A;  2FXQ A;  3R2I A;  4OHJ A;  1UE7 A;  3OMC A;  1TWG H;  3QG1 A;  5J39 A;  2EYO A;  4RKB A;  4JI3 L;  4NDX A;  5F2D A;  1TXY A;  1BO0 A;  1KAW A;  4HJ8 A;  5C4J H;  2K75 A;  4BY7 G;  5M3F G;  1Q82 C;  4BBS B;  1F77 A;  1HA5 A;  5JJZ A;  5IYC G;  3Q22 A;  1O7Z A;  3J7A 5;  2UXD L;  2A68 D;  1HR0 L;  4IOC A;  2RA4 A;  3FDT A;  1GUN A;  5JEA J;  3HOX H;  4DAY A;  4JOI A;  1HFN A;  3S1N H;  3KLR A;  4CKB A;  2F0V A;  3F2U A;  2RF4 A;  2Y0S B;  1M1K C;  2F0N A;  1WFQ A;  4K5W A;  4F87 A;  3GTP B;  4K5V A;  5A2Q L;  3J81 L;  4EQN A;  5COR A;  3DEP A;  2JA8 G;  1HRJ A;  1JOQ A;  4NP5 A;  1PH1 A;  5EKK A;  2K5D A;  1S5E D;  5COY A;  4GKJ Q;  3UDG A;  5C4X H;  4DR5 L;  1H95 A;  2E2D C;  2MO0 A;  1NMG A;  1YBY A;  3W2D A;  1HR0 Q;  3S1M H;  2UU9 L;  3M4O B;  1O80 A;  3P1H A;  3UE0 A;  4IUU A;  3E0E A;  1VCI A;  4RCO A;  2GVA A;  3H91 A;  4R8I A;  5CMD A;  1RIP A;  3VYU A;  1VQL A;  1N36 Q;  1JJC B;  1F9R A;  2IWH A;  2HIV A;  4B9X A;  3L7Z C;  1ICW A;  2RKS A;  2RCF A;  5M3M B;  1EY5 A;  5TSS A;  5CBE E;  3S1R H;  1TWC H;  2QEJ C;  2MFI A;  1WVL A;  3HKS A;  4JOI C;  2VUM H;  1HXY D;  2ENB A;  1TQO A;  1SNC A;  2JEB I;  3R3O A;  3CCM A;  1G6P A;  4X64 Q;  1E22 A;  3HKZ B;  4L5Q A;  3D0F A;  3C46 A;  3Q24 A;  1UE1 A;  3CAM A;  1L0W A;  2PNH A;  1EYA A;  2L0C A;  1E24 A;  1B3A A;  4IPH A;  4GKJ L;  3UE1 A;  2M2L A;  4JBM A;  5HUR A;  2D0P A;  3S17 H;  3QB3 A;  4X65 L;  1YZ6 A;  1QNU A;  3S1Q B;  3RN2 A;  4B3M Q;  2N49 A;  1X3F A;  4HN7 A;  3NBI A;  4DAV A;  4FNF A;  4NXM L;  2WIN B;  1EQT A;  5I4D A;  1N9W A;  2QIL A;  1IW7 D;  2K5H A;  4R8N A;  3I4L A;  1U9R A;  1VQP A;  1I3Q H;  3U50 C;  3GO5 A;  1KAB A;  4DUY Q;  2NVX B;  4LUO A;  3DWP A;  3MVV A;  3S16 B;  5IYB G;  1PH8 A;  3KBG A;  1S5D D;  1ET9 A;  1HZ9 A;  4KN7 C;  2VUM B;  4XIG S;  2PMZ B;  4P71 A;  3O13 A;  1VQB A;  4DK1 A;  2YU9 H;  1J6Q A;  1WTV A;  1BR9 A;  3T51 B;  2PYK A;  2IPK D;  4DR2 L;  2UUB Q;  5IYD H;  1PMR A;  5IGE A;  5FLM G;  4FDB A;  3OTO L;  4IFD J;  1SLJ A;  1SE4 A;  2HCI A;  2IX3 A;  2Q2T A;  1PXU A;  1AE3 A;  2AMC B;  3ULL A;  3OYY A;  1EQQ A;  1U4M A;  3VR3 A;  3NP8 A;  4AQY L;  2AWN A;  4CGY B;  1U5K A;  1MSH A;  3NE5 B;  2R93 H;  5IGD A;  5EPK A;  3KJP A;  2B8G A;  1WTH A;  3CRK C;  4N9T A;  1EZ6 A;  1XNQ L;  1W2B A;  4KHP Q;  1PH6 A;  1I4Q A;  2LXJ A;  3KF6 B;  3A8I E;  5JVH 3;  5E7N A;  4BXX G;  1K0R A;  3BDO A;  1CHP D;  3F2D A;  3KJO A;  4RHR A;  3L2P A;  1SMY D;  4AYB B;  1L0Y B;  3L0O A;  1XPR A;  3TQY A;  1RF2 D;  4XDX A;  1LT4 D;  2LS0 1;  4U68 A;  2BE5 C;  4LF9 L;  5D65 A;  2MQH A;  4POF A;  3PO2 B;  4A3D H;  3KUP A;  3S2D H;  2UU9 Q;  4O1N A;  1QJO A;  1I4H A;  4FO2 A;  4DK3 C;  3T4A C;  1V8Q A;  1YEZ A;  2OWO A;  1AZQ A;  4KKU A;  5HGT A;  3D31 A;  2QGQ A;  5DEH A;  2F4V L;  2N3S A;  4ZKC B;  3PIP 3;  3H0G H;  1LO5 D;  3EQL C;  4H7B A;  1E2W A;  5KNB A;  3HOW B;  4C3J H;  1TS4 A;  3MZ5 A;  1PZI D;  2EYM A;  2VQF L;  2G5D A;  3Q8D A;  4IUR A;  3A56 A;  3GV6 A;  2KHJ A;  3A7L A;  1JWS D;  4A3G H;  3LX0 A;  1ZKO A;  2ICE C;  1HA6 A;  4FP5 D;  3P20 A;  3HOW G;  2NWG A;  5M3F B;  3GTL B;  1UE6 A;  1OO9 B;  4YY3 L;  4LFB Q;  4ZCK A;  2JXM B;  1GD7 A;  2AUJ D;  4JI3 Q;  1YJN A;  3ND9 A;  2E2I H;  1YNJ D;  2F0K A;  2K52 A;  4OL7 A;  4BY7 B;  3RZD B;  1CTM A;  4QIW B;  2VQF Q;  5KGU A;  1IL8 A;  1KRT A;  4A3F B;  1UNS A;  2IHE A;  5BR8 Q;  5IYD G;  3JC6 6;  1F2M A;  4IZ8 A;  5L37 A;  2WB1 B;  5EBD A;  2V4D A;  1EYG A;  1JB3 A;  1ZEQ X;  4C3H G;  2A1A A;  5CV9 A;  4NXN L;  5C4J B;  4FYD A;  1BF4 A;  2ZT9 C;  3H6M A;  3GD7 A;  4GKK L;  3ERS X;  3CC4 A;  1RKN A;  3B6Y A;  1I4R A;  2E5L Q;  1MBY A;  1X9N A;  3GQB A;  2PMZ E;  1I5F A;  3DXJ C;  4V0B A;  1WTP A;  1GXD C;  1D8L A;  2EVB A;  5M3F H;  1QB5 D;  3MXU A;  1IXR A;  3IFT A;  2L1B A;  3CHB D;  2A6H D;  4X3S A;  2EXD A;  5CV6 A;  3K0X A;  4DA2 A;  1PTO D;  3TME A;  4ZK9 B;  1FNV A;  4QY7 A;  1AEX A;  1LTI D;  2AQ2 B;  2I46 A;  4XTC S;  4KJO A;  2L12 A;  2B63 B;  2FMM A;  3NWT A;  4DNR B;  5JVG 3;  2ZTD A;  2JA5 H;  1Y1W B;  1FJG Q;  3GTO B;  3J7Z C;  4XT3 B;  4G4K A;  2K04 A;  2L55 A;  1XNQ Q;  2UUA Q;  4EQO A;  5C6A A;  2WP8 J;  4N9P A;  1MHW C;  3CD6 A;  1TWH H;  2A69 C;  3E0J A;  1X3E A;  3NEN A;  3C2P A;  2ZTE A;  1YHA A;  4GN4 B;  1NNX A;  3I72 A;  2RQX A;  4CDD C;  3STB D;  1VQK A;  4EX5 A;  1Q1B A;  1XMQ L;  4JI0 L;  4DFA A;  4FF4 A;  4DR2 Q;  4RGN A;  2K6A A;  3MXN B;  1KD1 C;  1SE3 A;  3HOZ G;  1STA A;  2B29 A;  3J80 L;  3RN5 A;  1RCV D;  3OIP A;  3E5S A;  1EEI D;  4MZ9 A;  4ZRZ A;  4ULL A;  1VQG A;  3VA7 A;  5D14 A;  3GV3 A;  5E1F A;  2JA8 B;  2UXC Q;  1SEB D;  3NEL A;  3KDF A;  2CWA A;  2MGS A;  4MIU A;  2DJF C;  2F0O A;  4EQ5 A;  1GUS A;  2F3W A;  1VQD A;  1PV4 A;  4A3E G;  3S17 B;  2I5L X;  1PH4 A;  2UXB Q;  3VYT A;  1XMQ Q;  3BU2 A;  4JW0 A;  2CQA A;  2EYF A;  4A3K H;  2K5W A;  1Z9F A;  4WJW A;  5DLQ E;  4CJ2 C;  1QNK A;  3ZYY X;  1JE5 A;  1Z47 A;  3EJI A;  1H9S A;  4FXD A;  2HUG A;  1B53 A;  4PG3 A;  3HRZ C;  2EY2 A;  4BBS G;  5JJK A;  1I3Q B;  2E74 C;  3KF6 A;  1MIU A;  2O2L D;  1PRT B;  4Q0F A;  1Y1V G;  3EBE A;  4LF4 L;  3OIQ A;  4QGU A;  2NUC A;  4RH6 A;  4NXN Q;  1CZW A;  1B7Y B;  1SYE A;  1T5E A;  5GAG C;  2FFK B;  1FD7 D;  2WAQ B;  1O7L A;  1MJC A;  5KIX A;  4TRD A;  4HAE A;  4KN4 C;  1LTG D;  1QVG A;  4L5S A;  3CC2 A;  1EUJ A;  5CR3 A;  1F9P A;  4DV7 L;  3I3C A;  1VQ6 A;  2RHS B;  2L9H A;  2CH4 A;  1GVP A;  1KQS A;  5E4W C;  1EEF D;  4P73 A;  3A0J A;  1YNN D;  2N88 A;  3AU7 A;  3G7L A;  1N8R C;  1ILP A;  4BBR H;  4G57 A;  2F03 A;  3J81 i;  3CCJ A;  1LTS D;  3K5M A;  3KDF B;  1SNM A;  1XWE A;  2PNR C;  1EU3 A;  4GOP B;  2WKC A;  4RGT A;  1JMC A;  1PZK D;  4JI4 L;  5C44 H;  4BWG B;  3AFQ A;  3K81 C;  1C7Y A;  3K5O A;  2Z6K A;  2B2Y A;  3DM1 A;  3U9S A;  4IPD A;  1PYW D;  1DOL A;  4NMZ A;  1C8C A;  2K33 A;  3UDI A;  5BR8 L;  3M4Q A;  3GTJ B;  1H9J A;  1N34 L;  5FJ8 G;  3S2H B;  4RFB A;  1AN8 A;  5G3L D;  4LF6 Q;  4CDC C;  1X3Q A;  2JA5 G;  1TKW B;  2LFN A;  2EE1 A;  1NR2 A;  3SVM A;  1XPO A;  2BH2 A;  4JYA Q;  1P16 A;  5G3L F;  4IUP A;  3I73 A;  4JI5 L;  4QJF A;  3BDC A;  2YYZ A;  4DR3 Q;  3S16 H;  3HKZ E;  2F0P A;  1LAC A;  3A8J E;  4C56 C;  1RHP A;  3I4O A;  3M7N A;  3ULP A;  3QJY A;  4WFN 3;  4MTN A;  1Q81 C;  1KIX A;  5IT9 E;  1TWA B;  2K4K A;  5ELB A;  3H0G B;  4IUQ A;  1H9R A;  4N8X 1;  3RUZ A;  1N32 Q;  4M8A A;  2TSS A;  1WCM G;  4O2D A;  3TS2 A;  5C3E H;  5LMN Q;  4WRD A;  4IO9 A;  4TSS A;  1XXG A;  3D4R A;  1BCP B;  3IKJ A;  2DGY A;  2C35 B;  2UUC Q;  2B2T A;  1SAP A;  2NVQ B;  4A3G B;  4DNI A;  4ZUI A;  1FNU A;  3J80 i;  3G71 A;  2JJQ A;  3GTQ H;  4OO1 I;  3T1H Q;  1ICF B;  4DF7 A;  1G6Z A;  2F0L A;  4JI1 Q;  4I7A A;  2O4X A;  4OIK A;  2B2U C;  2EQS A;  3S24 A;  1CUK A;  3VYS A;  2X69 A;  1I50 B;  1YHQ A;  1CQV A;  1VQO A;  1G91 A;  2EXZ A;  4GS3 A;  1S5F D;  2EYP A;  2YTX A;  1PYS B;  3X3M A;  4ID6 A;  4CKE A;  1CQF A;  1Q8K A;  2NN6 H;  2PQA B;  2PZT A;  1I4P A;  3K8A A;  4WOR A;  4A3D B;  1PFB A;  3F8T A;  4K5X A;  2KA7 A;  4X62 L;  3PIP A;  3CP0 A;  4EGV A;  1PH3 A;  3S2D B;  4KLK A;  4JI1 L;  1XMO Q;  1KDA A;  2NVY B;  2AQ3 B;  2R7Z B;  4A3I H;  1YI2 A;  2I07 B;  1TT2 A;  1U4L A;  2KCN A;  4A3L G;  5ELO A;  1SYF A;  3R8B A;  4DV1 Q;  1L0X B;  2Z4I A;  5IYC H;  4KI0 A;  2MNA A;  3G6E A;  4LAA A;  1YIJ A;  1XX8 A;  2KED A;  1AZP A;  2CW0 C;  1AFP A;  3WOE A;  2LSS A;  2I5H A;  5C3E G;  2Y0S E;  3N6R A;  5KNC A;  2IL8 A;  1WCM H;  3ND8 A;  3R2T A;  4BS9 A;  1WTX A;  4J6H A;  4JI2 Q;  4DV2 L;  1E7Z A;  2PQA A;  1UAP A;  1LLR D;  5C0X G;  2AQ1 B;  4YWM A;  4XXE A;  4CKC A;  1VQ9 A;  3WOF A;  4BY1 B;  5KEE A;  3P75 A;  4DUY L;  2F0U A;  3CF5 A;  2A74 C;  4OXP A;  1KNA A;  4DK6 C;  3BVG A;  3UDX A;  2A68 C;  5LHY 1;  1Q8I A;  1WD1 A;  5BN5 A;  2M9V A;  1V1P A;  1XNR Q;  2E75 C;  1K3B C;  2MPM A;  3PUY A;  3RZD H;  4HJ9 A;  1SNO A;  1V43 A;  1HQM C;  1A0I A;  3EIV A;  4A3B G;  1B2T A;  3NWS A;  4EVO A;  5M5X B;  1JIC A;  3D8G A;  4YHH L;  5IGG A;  3PIO A;  4JI6 Q;  1X32 A;  4FF2 A;  3BZC A;  1A3T A;  1IKL A;  1JQY D;  3FPP A;  1Y8N B;  5BN4 A;  1IBL Q;  1I6H B;  4RWS C;  3MTS A;  3BDL A;  2DY8 A;  4CDE C;  3OOC A;  1UEA B;  3BZD B;  4X64 L;  4LJZ C;  3F2B A;  3FMC A;  4C3J G;  1IBK L;  1XTD A;  2JSO A;  3IL8 A;  3PO3 G;  4XQN A;  1Y8O B;  1SSO A;  1KLU D;  5ELN A;  3NTK A;  3HZX A;  4H44 C;  3BYY B;  3SHL A;  3CXC A;  1TU2 B;  1X55 A;  1SE2 A;  2B3G A;  1B1Z A;  4DV1 L;  4A93 B;  3M4O H;  1N33 Q;  3JAM i;  2SNS A;  1BXT A;  3HOY B;  1YVC A;  2F1M A;  5M3M G;  4HR7 B;  4K14 A;  4YIJ A;  2E2I B;  5EPJ A;  1ZYR D;  1GUT A;  1K3R A;  2EJF C;  4OO1 H;  2N8N A;  3RR5 A;  3IAY A;  3P7J A;  1SND A;  2JE6 I;  3S1R B;  1HR0 W;  3M3Y H;  1CSP A;  3GTO H;  2D62 A;  3RLO A;  1LM0 A;  4OWT B;  5E4X A;  4DR1 L;  1QWY A;  3SK8 A;  3ZJY C;  4NKL A;  4F7X A;  2D0O A;  2KBN A;  2NTT A;  3D4W A;  4RCN A;  1GUW A;  1IYU A;  2ATW A;  1EL0 A;  2UUB L;  4RA8 A;  1KC8 C;  4IUN A;  5C4Z A;  1VQE A;  1AE2 A;  2EZV A;  2QW7 A;  4K6L A;  4GOP A;  1AW7 A;  1VQA A;  1LTT D;  1BNZ A;  4ALP A;  4LFC Q;  3K58 A;  4DXF A;  3T56 B;  2Y0S G;  1GOZ A;  2RDF A;  2K50 A;  1E2V A;  1IBK Q;  2QKI C;  4A3K G;  4A75 A;  2R92 B;  1I6V C;  3LWE A;  4A93 H;  4DAP A;  1VMC A;  1QIL A;  4DV0 Q;  1IBL L;  4ZAI A;  2EYH A;  4MNO A;  1C4Q A;  4IJL A;  3GTP H;  2RDH A;  1EOT A;  1ASZ A;  3JAM c;  2CW0 D;  1Q90 A;  2K5N A;  3JAM E;  1CSQ A;  1CT1 D;  1ESR A;  2NB0 A;  3H15 A;  2M00 A;  1JT8 A;  5J22 A;  1K73 C;  4LF8 L;  3FRP B;  4DV4 Q;  4F88 A;  4ZQ3 A;  1PLF A;  3J81 E;  2E76 C;  2K05 A;  4RGO S;  2K32 A;  4O0A A;  1S72 A;  2MO1 A;  1BOS A;  2PZU A;  2ID0 A;  3W5O A;  1DOM A;  3D6C A;  1E3P A;  2Z1C A;  2A6E D;  2MJ8 A;  4O42 A;  3I55 A;  3VR4 A;  4DK0 A;  1GJX A;  1BQQ T;  2EIF A;  3BG3 A;  1BCP D;  4QB4 A;  3RZO H;  3DUZ A;  3HGB A;  1SNP A;  5J3B A;  3AB9 A;  5DAU A;  3M85 A;  3Q0A A;  1EY7 A;  5A2Q E;  1CKM A;  3PSI A;  2R92 G;  1EIG A;  1HH2 P;  4ME5 A;  5GAH C;  1Q46 A;  2EYL A;  4IUT A;  4U67 3;  1GUG A;  5FO9 B;  3CCV A;  2K7V A;  1I4G A;  1ENC A;  1OXV A;  2Z6K C;  1EY4 A;  1M90 C;  1DM0 B;  3PUX A;  4PMW A;  5KYI A;  1G2S A;  3N52 A;  2E8G A;  2C5C A;  3TN2 A;  3J7Y W;  5ELC A;  2L11 A;  4QUF A;  2WII B;  3QO2 A;  1EWI A;  4NPS A;  2VL6 A;  4OWX B;  5I6Y A;  2QDB A;  1ET6 A;  2SEB D;  1QZG A;  5IIF A;  3L9A X;  2RCN A;  2ZTC A;  4R4Q A;  1NCV A;  2H4O A;  1PH5 A;  4DV2 Q;  1S40 A;  3GTG B;  5I2Y A;  1LT5 D;  3A54 A;  1D1I A;  3H94 A;  1MGS A;  4DGZ A;  3ITP A;  2ICI A;  3MEF A;  4C1N I;  3FP9 A;  1L1O A;  2H1E A;  2HQE A;  3SK4 A;  5ISR A;  2BDN A;  2OCE A;  1KLG D;  2F0I A;  4F8M A;  3PF5 A;  1RTO A;  2Z8L A;  4OO1 G;  3Q23 A;  3CME A;  3HEJ A;  1NUC A;  2EJG C;  3HOW H;  2WAC A;  5EPL A;  4QCL A;  3PO3 B;  3VR2 A;  1PRT C;  2CVR A;  1EQV A;  4KD4 A;  1TII D;  2ZJQ A;  5K5P A;  1DCZ A;  4QQB X;  4E6I A;  3A5Z B;  4JV5 Q;  3NQT A;  4AQY Q;  2R7F A;  4LFA L;  3TP5 A;  2K5V A;  1UUP A;  3NBH B;  2XIW A;  2IX0 A;  1PA6 A;  1IBM Q;  3QOJ A;  4GLX A;  5DNF A;  4B3R Q;  4JI8 Q;  4I7Z C;  3M7G A;  2JA7 G;  4B9W A;  1E0B A;  3GTG H;  1EFI D;  2NN6 G;  2KUM A;  1VF5 C;  1FNW A;  4BY7 H;  3MXG A;  2WV6 D;  4JCV E;  5JJL A;  2UXB L;  4YCU A;  3DLL A;  1DON A;  5EJW A;  4K2L A;  3F1Z A;  1PH7 A;  1ML0 D;  4HCS A;  1TWF H;  4C2M H;  4R4T A;  3GTJ H;  3T53 B;  2F0E A;  4JI5 Q;  1T5X D;  3CW2 C;  2ALY B;  2XNA C;  3HOX G;  3I91 A;  4AH6 A;  2WB1 G;  3DEO A;  1N34 Q;  2IW3 A;  4JC0 A;  1IL2 A;  3KLS A;  4B3T L;  1UE5 A;  3OW2 A;  4RMF A;  3DM3 A;  4B3S L;  3CC7 A;  4KD3 A;  3VR5 A;  1IBM L;  1KTK A;  3TZD A;  2HQL A;  1YJW A;  4POG A;  5C0X J;  3R93 A;  4IOA A;  1U4P A;  1HCZ A;  4L5R C;  5IWA Q;  4HJ7 A;  1H9M A;  1YNX A;  3H3V I;  1HNX L;  3RLN A;  2EJM A;  4OX9 Q;  3MXP A;  5D3D A;  1TWA H;  5M5W H;  1GHJ A;  1MD2 D;  3TRE A;  1C9O A;  4AIM A;  3K59 A;  1NMF A;  4C3I B;  4FF1 A;  4X66 L;  4KV6 A;  3VR6 A;  3NEM A;  2B2V C;  2JYO A;  2PI2 A;  1NTG A;  1O7I A;  4DV6 L;  4HED A;  1DZ1 A;  1STH A;  4TQU S;  3CCE A;  4A3I G;  1HNX Q;  4OX9 L;  1UWV A;  2KJX A;  3SR1 A;  4R1J A;  4UP7 A;  3HOZ B;  4OON A;  1K8G A;  2KEC A;  2LMC B;  5LMN W;  3M4P A;  4DV7 Q;  1AP0 A;  4APV A;  5KRU A;  1CM9 A;  4IAL A;  2XWJ B;  2EYJ A;  4HCE A;  5ELD A;  1GM5 A;  2H5X A;  2ZM6 L;  1VQJ A;  4GNX B;  1SMX A;  4KHV A;  4DXG A;  5IY0 A;  4DR4 Q;  1VQ4 A;  4JYA L;  4UPA A;  3S14 H;  4JPB W;  3MFG A;  2J0T D;  1Y14 B;  3CKI B;  1PTO H;  3I8Z A;  1K0S A;  2DN8 A;  1X6O A;  2KCC A;  1J8I A;  1FGB D;  5M9O A;  5FLX L;  3CCL A;  4LF6 L;  3NPP A;  1HQR D;  3URY A;  2PW7 A;  3VYR A;  5IYB H;  4C3J B;  3PF4 A;  5KND A;  4K8J A;  2XRQ D;  1I94 Q;  3I4M G;  4A3C H;  1EIH A;  4P74 A;  3W3A A;  2CH4 W;  3KLS X;  2VQE L;  1K28 A;  1D7Q A;  1MSG A;  2LXK A;  1HTL D;  4WJ3 M;  3X3N A;  1XNR L;  1WCM B;  1RJT A;  3IRB A;  2N55 A;  5LMU L;  3BYT B;  1WTR A;  4K6D A;  1IW7 C;  3CMA A;  1BVS A;  3S15 B;  3H0G G;  2WFW A;  5CV5 A;  2Z0S A;  3CPF A;  1HZA A;  3KBX A;  2D5D A;  4H0L C;  2ZM6 Q;  4A3D G;  1BUV T;  4LFB L;  3I4N H;  1BKB A;  3HOU H;  1PFN A;  1TR5 A;  3PUZ A;  1E1O A;  4LF5 Q;  1VQH A;  5M5Y B;  1SXT A;  1VMP A;  4JI0 Q;  1U4R A;  1OXT A;  3GDE A;  1CI3 M;  3MA2 B;  2O5J C;  5IOD A;  2HDM A;  3EFX D;  1OXX K;  2XSC A;  3ERO A;  4DV3 L;  2KCT A;  3E3X A;  2QDL A;  3SXH A;  1NSN S;  1QUQ B;  2IHF A;  3FKI G;  4LW1 A;  4ZUJ A;  1VQI A;  1WOC A;  4DV0 L;  1WTQ A;  3NUC A;  3J7A V;  4S3S A;  1SYB A;  5FLX E;  2DNC A;  1NY4 A;  2XTI A;  1V1Q A;  1A63 A;  2LY7 A;  4J8Q A;  3WWV A;  4IJH A;  1PDQ A;  1CKN A;  4L5T A;  1B50 A;  5IWA L;  2Q8T A;  5M5X H;  2OXP A;  1FYC A;  2A73 B;  4N8F A;  5FLM H;  4KHZ A;  1F9Q A;  3S9W A;  1JOK A;  3I7F A;  3MWY W;  4LUZ A;  1NBW A;  4LWC A;  5ELE A;  1SFO H;  5C44 B;  2B63 H;  1B9M A;  3E6Z X;  2BOS A;  5CC4 A;  1LTL A;  3H3V H;  1M4V A;  2Q2I A;  2D9U A;  1B3Q A;  5IT9 L;  3J80 E;  1CFM A;  3I4M B;  1RD9 D;  2G9D A;  5JJI A;  1ESF A;  1RDP D;  1SYG A;  3DWQ A;  5C0X I;  4HIM A;  5GRO A;  5D3I B;  1HHV A;  5E3F A;  4CDF C;  3VA5 A;  4YCV A;  1L1O B;  2N78 A;  2A69 D;  2JA6 H;  3OWF A;  3NQI A;  1WTO A;  3S1M B;  2LKV A;  3TS0 A;  1FGU A;  3HOY H;  1ILQ A;  3PV0 A;  1Y8P B;  4BY1 G;  2E2J B;  3CQZ H;  4KHP L;  4KKS A;  4GLV B;  4P75 A;  2UUC L;  3K5N A;  4J1M A;  3TEH B;  4Y7N B;  1KXL A;  1STG A;  1HTP A;  1S5C D;  3M3Y B;  3PO2 G;  3H3V C;  1EU4 A;  1Y1V H;  1W6J A;  3G4S A;  2BDO A;  5LL6 X;  4A3C G;  2OT2 A;  5IOC A;  3TZU A;  1WD0 A;  1AH9 A;  4IN3 A;  5FK9 C;  2EDG A;  2Z4H A;  1W3S A;  4A3E B;  3MFY A;  4X66 Q;  4KJN A;  1KNE A;  1H9K A;  4FVM A;  4IPC A;  4JBJ A;  4K0K L;  1X3P A;  4GZY C;  3C3L A;  1A6X A;  1HPC A;  2HCC A;  4AYB E;  4LF8 Q;  3J7A F;  2B2U A;  1IYJ B;  2MP1 A;  5LMU Q;  1MJE A;  1X65 A;  3K7A H;  3VDY A;  4KY7 A;  2R92 H;  1EFW A;  1H9S B;  4B3M L;  1PH9 A;  4IFD I;  4NB3 A;  5AFW A;  2EY6 A;  3EVQ A;  4I65 A;  3U4V A;  2VNU D;  4R4O A;  1QZH A;  1V1O A;  3CQZ B;  1F2Y A;  3K0Y A;  2F4V Q;  1ENF A;  3FKI B;  1JR0 D;  3GTK H;  4DR7 L;  4K0K Q;  1XYI A;  2MHV A;  1MI2 A;  3CCR A;  5K36 G;  1STB A;  1LT6 D;  3E9I A;  2VZA A;  2BE5 D;  5T1I A;  5H1S E;  1Y1V B;  3KOJ A;  1V9P A;  4JG2 A;  4A3B H;  3PUV A;  5I9P A;  1PVO A;  4WJ4 A;  2BA0 A;  3I4N G;  2OQK A;  2KQ3 A;  1KDB A;  2WAQ E;  2YU9 B;  2CWP A;  1TWG B;  2NYZ D;  4JI7 Q;  2F0H A;  2Q8R E;  4GNX C;  1G2T A;  1BDO A;  2OEO A;  4MTK A;  1QOH A;  1A2T A;  1JWU D;  1HJP A;  1R9T B;  4A3M G;  1TS2 A;  4FXK C;  5GAD C;  4DR1 Q;  3KF8 B;  3ULJ A;  4BBR B;  1CA5 A;  2HHH Q;  1BBX C;  3RZO B;  4G7O C;  1I4X A;  1N36 L;  2NZH A;  1JOR A;  2PQE A;  1OXU A;  2HDL A;  2GVB A;  1STN A;  1HNW Q;  3DMU A;  4YY3 Q;  2I5M X;  5GAE C;  2OTL A;  3U9O A;  3PCO B;  3K80 C;  3FVQ A;  1W6K A;  1QVC A;  1BBU A;  2J7Z A;  2RSN A;  4L8J A;  1D1K A;  4CJ1 B;  3RNU A;  1KDC A;  2XVS A;  3PIO 3;  2QEX A;  3NTI A;  5JOB A;  1YJ9 A;  3I56 A;  1VQ7 A;  2A6H C;  2CQO A;  3NK9 A;  4KY6 A;  5IP7 H;  1EQR A;  4QMG A;  2KHI A;  3T13 A;  3SE0 A;  3G6J B;  1VQF A;  1PFS A;  3PQI A;  4TKO B;  4DV5 Q;  5C3W A;  1EYD A;  1SRU A;  2D2C C;  3OW7 A;  3L3O C;  1IZ6 A;  2ZXO A;  3CU7 A;  4UAI A;  3SGI A;  3GP7 A;  4KKT A;  5JEA G;  2R6G A;  1R4Q B;  5IP9 H;  3V96 A;  3SDZ A;  4IFD G;  1A15 A;  1WYD A;  2JA9 A;  2A6E C;  2OTJ A;  2RDG A;  4H13 C;  5IGF A;  1DOK A;  3DWA A;  1HUM A;  4PZ7 A;  3CPW A;  4XT1 B;  4J15 A;  2JA6 G;  1A3V A;  1CA6 A;  4L6T B;  3TP7 A;  1NAP A;  1JCK B;  1PRT F;  3S14 B;  5M3M H;  2L15 A;  3K6O A;  1S3O A;  5GQO A;  3TP8 A;  3KLW A;  1TWF B;  4C2M B;  4OWW B;  3CCS A;  1QUQ A;  2PPB C;  4B3R L;  4BA1 I;  1JOO A;  2E2H H;  4DV3 Q;  3T1H L;  2ZJP A;  1LAB A;  3A74 A;  4DU9 A;  4GN5 A;  4LMQ D;  1NE3 A;  3PO3 H;  1V1P B;  2B2V A;  5C4X G;  5EKI A;  3W1B A;  4JI8 L;  1M8A A;  2P5Z X;  3U58 A;  4A3J G;  5ELF A;  4K8I A;  2VY3 A;  4LF5 L;  1GHK A;  2X6L A;  4HSP A; 
#chains in the Genus database with same CATH homology
 1RL2 A;  2NVQ H;  4DR6 Q;  4LFA Q;  1VQD A;  1Q1E A;  4DV4 L;  1PV4 A;  4A3E G;  4JI2 L;  3UDF A;  3HOY G;  2I5L X;  2OCE A;  4R4C A;  4HIK A;  3CCQ A;  1PH4 A;  4ME3 A;  2UXB Q;  1XMQ Q;  4LF4 Q;  4A3F G;  2OQ0 A;  3BU2 A;  4A3J H;  3PF5 A;  4A3K H;  4DR7 Q;  4OO1 G;  1Z9F A;  2YV5 A;  5DLQ E;  1J5E Q;  3CME A;  1X56 A;  2NZO A;  5AJ3 L;  1L1O C;  1JE5 A;  4QIW E;  3HOW H;  1Z47 A;  3EN2 A;  1PYB A;  1I6H H;  4RG1 A;  2JA8 H;  4PG3 A;  1HNZ Q;  4YWK A;  1OTC A;  4C3H H;  4BBS G;  4A3L H;  2VQE Q;  5JJK A;  1PHJ A;  2ZJQ A;  3KF6 A;  1MIU A;  2B63 G;  4QQB X;  4YCW A;  4B3S Q;  1G29 1;  1CKO A;  1Y1V G;  3EBE A;  3ER0 A;  4LF4 L;  2KCM A;  3A5Z B;  4QGU A;  4NXN Q;  4JV5 Q;  1PH2 A;  4AQY Q;  2KEN A;  5IT9 c;  1B7Y B;  4GLA C;  1X3G A;  2R7F A;  5GAG C;  4LFA L;  5HGQ A;  3BJU A;  2NVT H;  2BH8 A;  1MJC A;  5AJ3 Q;  4HJA A;  2K5V A;  3NBH B;  3GTL H;  2IX0 A;  1PA6 A;  1IBM Q;  4DR5 Q;  2QA4 A;  1QVG A;  3F2C A;  4GLX A;  4L5S A;  4LF7 L;  1HNZ L;  3CC2 A;  4B3R Q;  4GOP C;  2CCZ A;  4JI8 Q;  1YHB A;  1GO3 E;  1EUJ A;  4BXX H;  4DV7 L;  1HZB A;  2JA7 G;  1VS0 A;  1VQ6 A;  2RHS B;  2E5L L;  3GTG H;  1GVP A;  1KQS A;  2NN6 G;  2NVY H;  1J5E L;  3STB C;  4JI6 L;  4GKK Q;  4BY7 H;  4P73 A;  2BA1 A;  3A0J A;  3LGJ A;  3E9H A;  2VS1 A;  1N8R C;  3I2Z A;  4JCV E;  3ICE A;  5JJL A;  2GN5 A;  2UXB L;  4YCU A;  3DLL A;  3HOV G;  4BBR H;  1HNW L;  1SR3 A;  3F1Z A;  4DV5 L;  3W1G A;  1PH7 A;  1TWF H;  4C2M H;  4R4T A;  3GTJ H;  3M9B A;  2R7Z G;  4JI5 Q;  3CW2 C;  4Y52 H;  2ALY B;  3J81 i;  3HOX G;  3CCJ A;  2FXQ A;  3HOZ H;  4AH6 A;  3KDF B;  1UE7 A;  2WB1 G;  4DPG A;  4HID A;  4GN3 B;  1N34 Q;  1TWG H;  4JC0 A;  1IL2 A;  4JI3 L;  4GOP B;  4B3T L;  4DUZ Q;  1UE5 A;  3OW2 A;  1TXY A;  2IY5 B;  1JMC A;  4HJ8 A;  1KAW A;  5C4J H;  2K75 A;  4JI4 L;  4RMF A;  3DM3 A;  5C44 H;  3CC7 A;  5M3F G;  4B3S L;  1Q82 C;  4BY7 G;  3AFQ A;  3K81 C;  1C7Y A;  1IBM L;  2HHH L;  2Z6K A;  2AWO A;  4IPD A;  2HQL A;  5IYC G;  1YJW A;  3J7A 5;  2UXD L;  1HR0 L;  4POG A;  5C0X J;  4IOC A;  2F3I A;  3U4Z A;  4IOA A;  4LUV A;  3UDI A;  5JEA J;  4L5R C;  5IWA Q;  3HOX H;  5BR8 L;  4HJ7 A;  1GKH A;  4JOI A;  1WJJ A;  1YNX A;  3H3V I;  1X54 A;  3M4Q A;  3AQQ A;  4A4I A;  4X6A H;  1N34 L;  1HNX L;  3RLN A;  5FJ8 G;  4OX9 Q;  2A8V A;  2ASB A;  3S1N H;  1TWA H;  5M5W H;  1L1O A;  4LF6 Q;  3TRE A;  1C9O A;  2RF4 A;  4AIM A;  1NMF A;  1M1K C;  3HOU G;  4X66 L;  1WFQ A;  4GKJ Q;  3I4N H;  2JA5 G;  3NEM A;  1VQN A;  2BH2 A;  1XPO A;  4BBS H;  5IP9 G;  2PI2 A;  4BA2 I;  4JYA Q;  1NTG A;  1P16 A;  1O7I A;  1G51 A;  1YIT A;  4DAM A;  4DV6 L;  1Y1W G;  2JA8 G;  4TQU S;  4JI5 L;  2CKZ B;  4QJF A;  3CCE A;  4A3I G;  1HNX Q;  1EIY B;  4OX9 L;  1PH1 A;  2YYZ A;  4DR3 Q;  3S16 H;  1UWV A;  3HKZ E;  2YTY A;  2YTV A;  5EAY A;  1SE8 A;  3UDG A;  3I4O A;  4R1J A;  2IT1 A;  4UP7 A;  1HZC A;  5C4X H;  4DR5 L;  4LF7 Q;  3ULP A;  3M7N A;  1SN8 A;  2MO0 A;  4MTN A;  1K83 H;  1NMG A;  1YBY A;  4OON A;  3A5U A;  1Q81 C;  1KIX A;  1K8G A;  1HR0 Q;  2UU9 L;  3S1M H;  2K4K A;  5IP7 G;  3UE0 A;  5LMN W;  1OXS C;  3M4P A;  1BBW A;  1VCI A;  3E0E A;  4DV7 Q;  2ES2 A;  1N32 Q;  2GVA A;  4APV A;  1RIP A;  1B70 B;  2UXC L;  1WCM G;  1VQL A;  4O2D A;  1N36 Q;  1JJC B;  1GM5 A;  2H5X A;  3TS2 A;  5C3E H;  1WI5 A;  1VQJ A;  2RHQ B;  2ZM6 L;  5LMN Q;  1SMX A;  1KL9 A;  4GNX B;  4IO9 A;  4A3M H;  2HIV A;  3KYH C;  3L7Z C;  4LFC L;  5IY0 A;  1MKH A;  4DR4 Q;  4HJ5 A;  2DGY A;  4R4I A;  2C35 B;  1VQ4 A;  4JYA L;  4UPA A;  2UUC Q;  3S14 H;  3S1R H;  1TWC H;  4DNI A;  1Y14 B;  3KFU A;  2MFI A;  3J80 i;  3HKS A;  3G71 A;  2JJQ A;  3GTQ H;  4JOI C;  2VUM H;  4OO1 I;  3T1H Q;  1X6O A;  3CCL A;  4LF6 L;  1U0L A;  2JEB I;  3CCM A;  4JI1 Q;  1G6P A;  4X64 Q;  1E22 A;  5IYB H;  4L5Q A;  2EQS A;  3S24 A;  1CUK A;  3PF4 A;  3D0F A;  1Q7Y C;  1I94 Q;  2Q2U A;  3I4M G;  2PI2 E;  4A3C H;  1UE1 A;  3CAM A;  4P74 A;  5IE8 A;  3AYH B;  1L0W A;  2PNH A;  5M5Y H;  2VQE L;  1YHQ A;  1VQO A;  2HIX A;  1NJI C;  2LXK A;  2VUM G;  1E24 A;  4IPH A;  1VQM A;  4WJ3 M;  1D7Q A;  4GS3 A;  1XNR L;  4GKJ L;  3UE1 A;  3IRB A;  2YTX A;  4JBM A;  1PYS B;  3HOV H;  5LMU L;  3PGZ A;  2D0P A;  2CFM A;  3S17 H;  4LNQ A;  4X65 L;  1YZ6 A;  3CMA A;  1BVS A;  1C0A A;  1Q8K A;  3H0G G;  2PQA B;  2WFW A;  5FJ8 H;  3RN2 A;  2UUA L;  4B3M Q;  2N49 A;  1X3F A;  3K8A A;  1N33 L;  2Z0S A;  3CPF A;  1HZA A;  4NXM L;  4HIO A;  2ZM6 Q;  5LMN L;  4A3D G;  1N9W A;  2K5H A;  3F8T A;  3PIP A;  2NN6 I;  4X62 L;  2E2J H;  4JI7 L;  3CP0 A;  4LFB L;  1N32 L;  1PH3 A;  3HFZ B;  4KLK A;  1BKB A;  2DUD A;  4JI1 L;  1XMO Q;  3HOU H;  1VQP A;  1I3Q H;  3U50 C;  3GO5 A;  3PUZ A;  4LF5 Q;  1E1O A;  2VW9 A;  1VQH A;  2XGT A;  4DUY Q;  4LUO A;  4UP8 A;  4JI0 Q;  4A3I H;  5IYB G;  1PH8 A;  1OXT A;  3GDE A;  1HZ9 A;  4JBW A;  1YI2 A;  1OXX K;  4XIG S;  4A3L G;  4P71 A;  1VQB A;  5ELO A;  3S1Q H;  2YU9 H;  4DV3 L;  2KCT A;  1JJ2 A;  1J6Q A;  4DV1 Q;  4X62 Q;  5IYC H;  4JI4 Q;  4YHH Q;  4KI0 A;  2MNA A;  3G6E A;  1QUQ B;  1YIJ A;  2IHF A;  4DR2 L;  3FKI G;  4LW1 A;  2UUB Q;  1VQI A;  5IYD H;  1WOC A;  4DV0 L;  5FLM G;  4FDB A;  2LSS A;  3OTO L;  4IFD J;  2I5H A;  1SLJ A;  1NY4 A;  2XTI A;  5C3E G;  2Q2T A;  2Y0S E;  1V1Q A;  1AE3 A;  2AMC B;  1A63 A;  3ULL A;  3OYY A;  1EQQ A;  1WCM H;  1EOV A;  4JI2 Q;  3WWV A;  4IJH A;  4DV2 L;  1H95 A;  1E7Z A;  2PQA A;  1CKN A;  2AWN A;  4L5T A;  1U5K A;  4YWL A;  5IWA L;  5C0X G;  4AQY L;  5M5X H;  4YWM A;  2R93 H;  1DGS A;  1VQ9 A;  3KJP A;  1FVI A;  4PZ6 A;  4NXM Q;  5FLM H;  4KHZ A;  3CCU A;  2Q2H A;  4DUY L;  3CF5 A;  4OXP A;  4X65 Q;  4GNX A;  3I7F A;  1W2B A;  1JB7 A;  1XNQ L;  1JJG A;  4LUZ A;  1PH6 A;  4KHP Q;  1NBW A;  4DK6 C;  2LXJ A;  3KF6 B;  1A8V A;  3TRZ A;  3UDX A;  4LWC A;  1SFO H;  5E7N A;  2B63 H;  4BXX G;  4DV6 Q;  4AYB G;  2UXD Q;  1K0R A;  3H3V H;  1LTL A;  1XNR Q;  2Q2I A;  4Y7N H;  3PUY A;  5JJI A;  3RZD H;  1P8L A;  3F2D A;  3KJO A;  5C0X I;  4HIM A;  5GRO A;  4HJ9 A;  1V43 A;  3L2P A;  3EIV A;  1A0I A;  4A3B G;  3L0O A;  1XPR A;  3TQY A;  4YCV A;  1L1O B;  4YHH L;  2N78 A;  2JA6 H;  3PIO A;  4JI6 Q;  4LF9 L;  2JA7 H;  2MQH A;  3TS0 A;  1FGU A;  4POF A;  4A3E H;  3BZC A;  3HOY H;  4A3D H;  1FL0 A;  1K9M C;  3PV0 A;  4BY1 G;  1I94 L;  3CQZ H;  1IBL Q;  4KHP L;  3S2D H;  4GLV B;  4P75 A;  2UUC L;  3RLF A;  2UU9 Q;  4BBR G;  3TEH B;  4X64 L;  3F2B A;  1KXL A;  1IBK L;  1XTD A;  3PO3 G;  4DK3 C;  3PO2 G;  1FJG L;  1YEZ A;  2IX1 A;  1Y1V H;  5ELN A;  2F52 A;  2OWO A;  3CXC A;  3GTM H;  3G4S A;  1X55 A;  2B3G A;  4UP9 A;  4DV1 L;  3S2H H;  3M4O H;  3D31 A;  2QGQ A;  4DR4 L;  2F4V L;  2N3S A;  4PZ8 A;  1N33 Q;  4A3C G;  3JAM i;  1AH9 A;  1B8A A;  1W3S A;  3H0G H;  3PO2 H;  1YVC A;  4X66 Q;  5M3M G;  1ASY A;  4C3J H;  4IPC A;  4JBJ A;  3FKI H;  4K0K L;  1K3R A;  1E1T A;  2VQF L;  1R9T H;  2N8N A;  3RR5 A;  1Q86 C;  2K14 A;  3Q8D A;  4AYB E;  4LF8 Q;  2JE6 I;  1HR0 W;  5HY6 A;  2KHJ A;  2A19 A;  5FLX c;  2WAQ G;  3M3Y H;  1CSP A;  3GTO H;  5LMU Q;  1IYJ B;  1MJE A;  2D62 A;  4A3G H;  3RLO A;  1LM0 A;  1X65 A;  2AHO B;  3K7A H;  4OWT B;  3G48 A;  4DR1 L;  3J81 j;  3VDY A;  1VQ5 A;  4LF9 Q;  2R92 H;  3HOW G;  1EFW A;  4UY8 C;  3AFP A;  1UE6 A;  3ZJY C;  4B3M L;  1PH9 A;  3PUW A;  4IFD I;  4NB3 A;  2D0O A;  2KBN A;  4YY3 L;  4LFB Q;  1GD7 A;  3U4V A;  4JI3 Q;  1YJN A;  2UUB L;  2ATW A;  4R4O A;  1KC8 C;  3K7U C;  4JV5 L;  2VNU D;  1QZH A;  2E2I H;  1VQE A;  1AE2 A;  2F4V Q;  1XPU A;  2K52 A;  4GOP A;  1VQA A;  4LFC Q;  3GTK H;  1A62 A;  4ALP A;  4DR7 L;  4K0K Q;  3CCR A;  2VQF Q;  5K36 G;  3E9I A;  2Y0S G;  1KRT A;  2VZA A;  2K50 A;  1SRO A;  2IHE A;  5BR8 Q;  3KOJ A;  5H1S E;  3JC6 6;  5IYD G;  1V9P A;  1IBK Q;  3S15 H;  4JG2 A;  4A3B H;  3PUV A;  1PVO A;  4A3K G;  1VQ8 A;  2BA0 A;  3I4N G;  4WJ4 A;  4A75 A;  4TVA B;  4DAY B;  3HKZ G;  2JK8 A;  1VQC A;  2OQK A;  1K8A C;  1T9H A;  1EYG A;  4A93 H;  2R93 G;  2WAQ E;  4DV0 Q;  1IBL L;  2CWP A;  4JI7 Q;  4C3I H;  1LUZ A;  2A1A A;  4GNX C;  4MNO A;  4NXN L;  4IJL A;  1I50 H;  4B3T Q;  3GTP H;  3T1Y Q;  1HJP A;  3GD7 A;  1UEB A;  4A3M G;  3ERS X;  3CC4 A;  3OTO Q;  4GKK L;  3B6Y A;  1ASZ A;  2E5L Q;  5GAD C;  2HHH Q;  3JAM c;  3KF8 B;  3ULJ A;  4DR1 Q;  2K5N A;  2NVX H;  1X9N A;  1CSQ A;  4JBK A;  1N36 L;  2NZH A;  4A3F H;  3H15 A;  4DR3 L;  2AKW B;  1OXU A;  1K73 C;  4LF8 L;  1JT8 A;  2PMZ E;  2GVB A;  4DV4 Q;  1I5F A;  4IPG A;  1HNW Q;  4YY3 Q;  2I5M X;  1D8L A;  5GAE C;  3J81 c;  5M3F H;  2OTL A;  3K80 C;  3PCO B;  1QVC A;  1IXR A;  1BBU A;  4O0A A;  2EXD A;  1S72 A;  3K0X A;  2MO1 A;  4DUZ L;  3RNU A;  2ID0 A;  3W5O A;  1LYL A;  4QY7 A;  2QEX A;  1E3P A;  4XTC S;  2I0Q A;  1YJ9 A;  1EIF A;  1KHI A;  3I56 A;  2JQO A;  1VQ7 A;  2HT1 A;  3I55 A;  2CQO A;  2ZTD A;  2JA5 H;  5IP7 H;  2R7Z H;  1EQR A;  2EIF A;  2KHI A;  4A93 G;  4H02 A;  1FJG Q;  3RZO H;  1VQF A;  1PFS A;  3J7Z C;  4DV5 Q;  5C44 G;  1QVF A;  5J3B A;  1SRU A;  4A76 A;  3M85 A;  2V1C C;  1CKM A;  3PSI A;  1XNQ Q;  1KRS A;  2UUA Q;  1IZ6 A;  2R92 G;  1HH2 P;  3SGI A;  5GAH C;  1Q46 A;  4A3G G;  2ZJR A;  5JEA G;  2R6G A;  2WP8 J;  5IP9 H;  4IFD G;  2OTJ A;  3CCV A;  1WYD A;  2JA9 A;  1XJV A;  3CD6 A;  4QL5 A;  4DR6 L;  1TWH H;  1OXV A;  4PZ7 A;  2Z6K C;  3CPW A;  3AEV A;  3FHW A;  1X3E A;  3NEN A;  4J15 A;  2JA6 G;  1M90 C;  2ZTE A;  1YHA A;  4GN4 B;  3PUX A;  4PMW A;  4DKA C;  3I4M H;  1CKN B;  3STB D;  3T1Y L;  5M3M H;  2L15 A;  2E8G A;  1VQK A;  1S3O A;  5GQO A;  4EX5 A;  1Q1B A;  3J80 c;  1Q12 A;  1XMQ L;  4JI0 L;  3KLW A;  4OWW B;  4DR2 Q;  4BY1 H;  1EWI A;  3MXN B;  2R7D A;  1KD1 C;  3CCS A;  1QUQ A;  4NPS A;  2VL6 A;  4BA1 I;  3HOZ G;  4B3R L;  2B29 A;  4OWX B;  3RN5 A;  1L2F A;  4DV3 Q;  1QZG A;  2E2H H;  3T1H L;  4MZ9 A;  2ZJP A;  3A74 A;  2RCN A;  1VQG A;  4GN5 A;  2WB1 E;  4P72 A;  3BZK A;  2ZTC A;  1NE3 A;  4R4Q A;  3PO3 H;  2UXC Q;  5C4X G;  1PH5 A;  3NEL A;  3KDF A;  4DV2 Q;  1S40 A;  3W1B A;  2CWA A;  4JI8 L;  3U58 A;  4A3J G;  1XMO L;  2JEA I;  1Y1W H;  2VY3 A;  4LF5 L;  3MEF A;  4EQ5 A;  3FP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...