2N8NA

Solution structure of translation initiation factor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-1
publication title Structure and dynamics study of translation initiation factor 1 from Staphylococcus aureus suggests its RNA binding mode
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Translation
total genus 16
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n8nA00
4DV0L 4YHHQ 4A3MG 2CWAA 3M3YH 4DR3Q 4A3GG 4LFBL 3S24A 1EFWA 1W2BA 2NVTH 4JV5Q 3S1NH 3U4VA 4HIDA 3H0GH 4J15A 1HNZQ 4OWWB 2UUCQ 3K81C 1VQMA 2UXBL 2JA5H 4LF8L 3TEHB 4X64L 3M4PA 3KJOA 2IHEA 2ASBA 4WJ4A 2YTYA 1WFQA 3CMAA 1XPOA 1TWAH 5LMNW 1PH7A 3GTGH 3TRZA 1AE3A 4TVAB 4TQUS 4DV4L 4GS3A 4GNXB 1N36L 1G51A 5J3BA 3JAMc 1KIXA 2IX1A 2KBNA 5C4XG 5JJKA 1IBKQ 1HH2P 1XNQL 3RLNA 4GN3B 2VW9A 4A76A 5IYDH 1IXRA 4DPGA 1E22A 5C4JH 5JEAJ 4B3MQ 3S17H 3S14H 3CC4A 1Q1EA 1HZ9A 2ZTDA 1VQ9A 3HKZE 4LWCA 2RF4A 3M7NA 1WCMH 1X6OA 3S2HH 4R1JA 1PH9A 4WJ3M 1XNRL 1N34Q 1JT8A 2ALYB 3HOUH 2Z0SA 1U0LA 4IPHA 1MJCA 4JBJA 4AIMA 4OWTB 1XMQQ 1HR0Q 1VQGA 1SLJA 1X55A 3RLFA 3KOJA 1L1OB 2ZJRA 2UUBQ 2CFMA 2WB1G 4C3HH 3BZKA 4HIKA 4HIOA 3GTLH 2NZOA 3L7ZC 4DR5L 5IP9G 3CC2A 1WYDA 4DV0Q 5JJLA 1G6PA 4LF5L 2LXKA 4DV3Q 5ELNA 3A74A 1ASYA 1TWGH 4DR6Q 5IYCH 1OXXK 2KHJA 4A3EH 4A3JG 5IT9c 2PNHA 3AQQA 5C0XI 4LF7L 1VQFA 1N33L 1KQSA 4BBSG 3CD6A 3CP0A 2JA9A 2QA4A 1SE8A 4JBMA 2JA7H 2I5LX 1V9PA 4LW1A 2Y0SG 3I56A 2A8VA 4DV7L 2BA0A 3J81j 3UDGA 1QVGA 4JYAL 1P16A 4GLVB 4IPCA 3GD7A 2K4KA 1VQ7A 1N32L 4R4QA 3B6YA 2N3SA 1MIUA 2ZJPA 1PV4A 2K5HA 3TQYA 5K36G 3K7AH 1Y14B 3S15H 2Q2UA 1XNQQ 4GLAC 2YYZA 4A3MH 4HJ9A 1VQBA 4A3GH 4XIGS 4BXXG 2HHHL 1OXUA 3ULLA 3HKSA 3PO2G 1NTGA 4OXPA 3PIOA 4L5QA 3I4NG 2WP8J 2K5NA 3OTOL 1XJVA 3H0GG 4BA1I 1A8VA 3TS0A 2NVYH 1OXTA 2AWOA 1S3OA 3L0OA 2JA5G 2JJQA 1BBWA 4AQYQ 3CCMA 4MNOA 4YCVA 2DGYA 4YCUA 1Z9FA 1X3FA 4PG3A 5IWAL 2F4VL 1ASZA 4B3RQ 4DR5Q 1N8RC 2BH2A 3I4OA 5EAYA 4DR2Q 3K0XA 2Q2HA 4KLKA 4BA2I 2V1CC 1YJ9A 1E7ZA 2CKZB 3RZDH 4HJ7A 4R4CA 3PV0A 1PVOA 3D31A 4C2MH 1QUQA 2VQFQ 3RN2A 4IFDG 2GVAA 3KDFA 4MZ9A 2K75A 2DUDA 4JBWA 4HJAA 4KHPL 4LFAQ 2F3IA 2JEAI 3W5OA 4B3SQ 1E1OA 3HOUG 3F2DA 1JB7A 2ES2A 3OW2A 3J7A5 2L15A 4JI1L 1X9NA 3CXCA 1EIYB 1JMCA 1XPUA 4NXMQ 1P8LA 2KCMA 5IP9H 4DUZL 3CCLA 1UEBA 4PZ6A 1YJWA 4MTNA 4DR7L 3IRBA 2VQEL 4UP7A 3T1HQ 4JI0L 2HHHQ 4NB3A 2NVQH 4A3JH 3E0EA 1Q12A 2R92G 4GNXC 5C44G 3S1QH 1S40A 4BBSH 2YV5A 4H02A 5IYCG 4A3BG 2C35B 4KHZA 1QVCA 1UE5A 3BJUA 4JOIA 3PF4A 1HNWL 2I5MX 4DAYB 5JEAG 4A4IA 4DV2L 1VQOA 1KAWA 1YNXA 1YVCA 3NENA 1WOCA 5LMUQ 1R9TH 1UE7A 4IFDJ 4YWMA 1E24A 5C3EG 1CKNB 3GO5A 3J80i 4X66Q 3T1YQ 3U50C 4DKAC 2JA6G 4BXXH 4EQ5A 4NXNQ 2NN6G 3I2ZA 4IPGA 4JI8Q 1VQNA 2IT1A 2N78A 2OQ0A 2XGTA 3KF6B 4LNQA 3PO2H 1TWCH 1IL2A 4GLXA 1Q81C 1OXSC 1FGUA 3I4NH 3BU2A 1K3RA 1K83H 3ER0A 4ME3A 2ZTCA 3I7FA 4O0AA 1VQ8A 3TS2A 2UXDL 2E2JH 4GKJL 4GKKL 3CMEA 3CCSA 2CQOA 2WAQG 2MO0A 2EXDA 2K14A 3K80C 1IBML 2YTVA 4LF4Q 4JI4L 2EIFA 3W1GA 1QUQB 4RMFA 3UE1A 5LMNQ 1I94L 1IYJB 4DUZQ 4GN4B 4IPDA 4ALPA 1YHBA 3VDYA 2N8NA 3L2PA 4OWXB 1UE1A 2VS1A 1AH9A 1K8GA 2UUAL 3HOWG 4R4OA 4UY8C 5E7NA 3UE0A 1EQQA 1SROA 1XTDA 4PZ8A 4C3JH 4X62Q 4LFCL 1KXLA 2PI2E 2WB1E 1FJGQ 4YWLA 5M5WH 3CCUA 4LF6L 3MEFA 4P74A 2D62A 2N49A 3KYHC 1NY4A 3M4OH 4A75A 2K50A 1VQJA 1GKHA 1PYBA 4LF9Q 2HQLA 1XPRA 4P72A 2Q2IA 3NEMA 1YI2A 4DV5Q 4L5RC 3ZJYC 4YY3Q 2EQSA 3PUYA 4IFDI 3PIPA 4GN5A 1B70B 1GO3E 1L2FA 2R92H 4LFBQ 5C44H 2UXCL 3PO3G 1QZHA 3KFUA 4AH6A 4A3BH 1XMOL 1PH2A 2R93G 2B29A 1NBWA 2UXBQ 4DV1L 4LUZA 1HZCA 2YU9H 4LF8Q 4X64Q 2OWOA 3S1MH 5GADC 1TWHH 1RIPA 4JI2L 4JI4Q 4DUYL 4JI3L 4DV4Q 4DAMA 5C3EH 2R7DA 1N36Q 2JK8A 1N9WA 2JA6H 2K52A 3JC66 3U4ZA 1OXVA 2E2HH 1VQHA 1BVSA 2E2IH 1GM5A 1U5KA 1VQKA 3U58A 4LFCQ 1JJCB 1YHQA 1M1KC 3A5UA 1Q8KA 2JQOA 1LUZA 1K73C 1VQIA 3GTMH 1XNRQ 1HZAA 2ZM6L 1LM0A 3KJPA 2UU9L 3EN2A 1Q86C 4IJLA 2PMZE 1WI5A 2AMCB 1WJJA 4C3IH 2MQHA 1PH4A 2NN6I 1KD1C 1PH6A 2NVXH 3CCJA 4DR1L 4XTCS 2XTIA 4DV6L 2R6GA 1NJIC 4JI6L 3AFPA 2H5XA 3K8AA 4POGA 2JA8G 1D8LA 3LGJA 3A5ZB 4FDBA 3HOWH 1SFOH 1HNXL 4LF5Q 2VY3A 4B3TL 5AJ3L 1VQ6A 1YJNA 1Q82C 4JI5L 1IBLL 2ZTEA 1BBUA 3KLWA 1YEZA 4QL5A 3RNUA 1N33Q 4LF7Q 2OTJA 1UE6A 2LXJA 3BZCA 4GOPC 1OTCA 4K0KL 4OO1G 4DNIA 1GVPA 4DV7Q 1JJ2A 4JI7L 3NBHB 4JYAQ 4HJ8A 1N32Q 1SRUA 3PF5A 5M3FG 4A3LH 5DLQE 1PH1A 4L5SA 4DR4L 3TREA 2E8GA 2RHSB 3M4QA 4P73A 1V1QA 2PQAA 3S1RH 1JJGA 4OX9L 1YITA 3PO3H 4AYBE 5JJIA 1X3GA 1KC8C 1O7IA 3J81c 3FHWA 4YHHL 1VQLA 2R93H 1VQ5A 1UWVA 3UDFA 4PZ7A 1I50H 1Q46A 4OONA 2ZM6Q 4JV5L 1NE3A 4IJHA 3J80c 3OTOQ 3G6EA 4GNXA 4A3IG 3G71A 1HNZL 2HT1A 5GQOA 4DK3C 2MNAA 1KHIA 5M3MG 1CSQA 2BA1A 4BBRG 4NPSA 1SMXA 4QY7A 3CF5A 3J81i 5IWAQ 2F4VQ 3M9BA 1IZ6A 2RCNA 2MFIA 1G291 3FKIG 3HOXG 3I4MH 1M90C 2WAQE 3PUXA 1IBKL 3PSIA 3HOVH 4EX5A 4B3ML 3ULPA 1L1OC 1KL9A 4A3DG 2VNUD 1TWFH 5IYBG 3NELA 2R7ZH 1PH3A 3H15A 4KHPQ 5HY6A 1MKHA 1N34L 1QVFA 5M5XH 2FXQA 2Z6KC 5FLXc 3E9HA 4POFA 1VQCA 3ICEA 1J6QA 2AWNA 4JI1Q 1K8AC 1XMQL 4UP8A 1HR0L 1YHAA 4X65L 3KDFB 4QJFA 2JA8H 5FLMG 3D0FA 3ERSX 1W3SA 2YTXA 3CCEA 2VUMG 2UUBL 4DR7Q 4JI0Q 2VQEQ 3STBD 2GN5A 4IOAA 4HJ5A 4R4TA 3CQZH 3STBC 2OTLA 3W1BA 1Y1WG 4DV3L 4DK6C 3PGZA 2AHOB 4DR6L 2BH8A 5C0XJ 3GTJH 2Q2TA 2A19A 1YBYA 2HIVA 5GAHC 4IO9A 1C0AA 1LYLA 4JBKA 4YCWA 2PQAB 1X54A 5H1SE 1HNWQ 5M3FH 1PA6A 2PI2A 3J7ZC 3PUWA 4DV2Q 4A3KG 1A63A 1B7YB 1I5FA 4YWKA 4A3LG 2RHQB 3E9IA 1SN8A 1HZBA 3DM3A 5GAGC 5FJ8G 2Y0SE 3DLLA 1GD7A 1NMGA 5IE8A 3HFZB 3CC7A 3CCVA 4OO1I 5GAEC 4JG2A 2B3GA 4QQBX 1YZ6A 1VS0A 2F52A 3PUVA 4APVA 1FL0A 4A3IH 2OCEA 1CKOA 2KHIA 5M5YH 2CWPA 3GTQH 4BY7G 2UXDQ 1CSPA 4GKJQ 3CPWA 1PH5A 2WFWA 5M3MH 4GKKQ 3JAMi 2QEXA 1D7QA 2D0PA 2IX0A 2GVBA 4JCVE 4BBRH 4QGUA 1HR0W 1IBMQ 3HOZG 4A3FG 2B63G 4AQYL 1PHJA 4X65Q 3H3VH 1I94Q 3FKIH 5IP7G 3HOXH 2OQKA 3HKZG 3KF8B 5GROA 1Q7YC 1QZGA 1J5EL 4A3CG 2KCTA 3I55A 4O2DA 3RLOA 4B3RL 2UUAQ 1VQEA 3I4MG 4BY1G 4DR2L 1E3PA 4A3DH 3HOVG 5IYBH 1X3EA 3G4SA 2ATWA 4LUOA 1C9OA 4LF6Q 1FVIA 1EIFA 2VQFL 1VQPA 3H3VI 2R7ZG 1H95A 4A93G 5BR8L 1SR3A 3FP9A 1E1TA 3GTOH 4LFAL 4B3SL 2K5VA 3HOYG 3OYYA 1NMFA 3SGIA 1JE5A 5FLMH 2VUMH 4P71A 4NXML 3ULJA 3UDIA 4Y7NH 1Y1VG 2E5LL 1TXYA 4L5TA 1AE2A 1Y1WH 2UXCQ 3A0JA 4UPAA 3T1HL 2VZAA 3AEVA 2LSSA 1DGSA 1XMOQ 3PUZA 4DV1Q 1EWIA 4P75A 3GTPH 1RL2A 1EQRA 1I3QH 1YIJA 1CKNA 3RZOH 4A3KH 4JI2Q 4GOPA 3GDEA 4DUYQ 3KF6A 3K7UC 1HJPA 4JI3Q 5ELOA 3MXNB 3F8TA 2NZHA 2QGQA 5C4XH 5FJ8H 1L0WA 5LMUL 3PCOB 1J5EQ 1EYGA 3AFQA 4X6AH 2I0QA 3AYHB 2D0OA 2JEBI 1T9HA 4X66L 1KRSA 3T1YL 2AKWB 1Q1BA 4NXNL 2I5HA 5IYDG 4JI8L 3RR5A 1CKMA 2HIXA 4DR3L 4BY7H 3EBEA 2UU9Q 4Y52H 2KENA 2A1AA 4UP9A 5BR8Q 1B8AA 1VQ4A 2IY5B 1WCMG 1A62A 1KRTA 2UUCL 3HOZH 2R7FA 1PFSA 1BKBA 4A3FH 2B63H 3S2DH 4DR1Q 5IP7H 4LF4L 2ID0A 3EIVA 3G48A 4KI0A 4RG1A 5C0XG 4DV6Q 4A3CH 2VL6A 5LMNL 4JI6Q 2E5LQ 1CUKA 1PYSB 3UDXA 1MJEA 1VQDA 1HNXQ 1X56A 3CAMA 4B3TQ 5AJ3Q 4BY1H 3F2BA 4JI5Q 1IBLQ 3WWVA 4JC0A 2JE6I 4JOIC 1EUJA 4X62L 1X65A 4A93H 1EOVA 1FJGL 1L1OA 4A3EG 3CCQA 4K0KQ 3CW2C 1PH8A 1Z47A 4JI7Q 2IHFA 1VQAA 3Q8DA 2JA7G 3M85A 3HOYH 2MO1A 3F1ZA 4R4IA 5HGQA 3CCRA 4LF9L 3RN5A 2ZJQA 1VCIA 3F2CA 4DR4Q 2Z6KA 4AYBG 4HIMA 4LUVA 1V43A 1K0RA 4DV5L 1A0IA 1Y1VH 4QIWE 4YY3L 1K9MC 3S16H 3CPFA 1C7YA 4IOCA 2CCZA 5IY0A 4PMWA 1S72A 4OX9Q 4GOPB 1I6HH 1LTLA 3GTKH
chains in the Genus database with same CATH superfamily
4YHHQ 1EYCA 4FNFA 4DR3Q 2K5WA 4A3GG 2RBMA 1EFWA 3MFYA 1W2BA 3S1NH 5C6AA 5ELFA 2UUCQ 1VQMA 1TWGB 4LF8L 1G2SA 3TEHB 2NBFA 5I2YA 2OXPA 4KMUC 1WFQA 2DNCA 3CMAA 1XPOA 5LMNW 1XXGA 3I72A 4DAPA 4DNTB 4FXDA 1G51A 4ZKCB 1SEBD 3AU7A 2K1BA 3GQBA 3RLNA 3CKIB 4A76A 3K7AB 3NPPA 2PO4A 5JEAJ 3S17H 1ESFA 4HAEA 5G3LD 2ZTDA 3S2HH 4R1JA 1CZWA 1PH9A 4WJ3M 2ALYB 1Y69U 2Z0SA 4IPHA 1MJCA 2G9HD 4UDUC 4OWTB 1XMQQ 5C0XH 1RKNA 5DAUA 1B9NA 4EQNA 2WAQB 1L1OB 3K57A 2CFMA 3TBIB 3L7ZC 5JJLA 1WYDA 3VR6A 1CM9A 4DV3Q 5ELNA 3A74A 1ASYA 1TWGH 4K14A 3X3NA 1OXXK 3FDTA 5IT9c 1N33L 4LF7L 1SE8A 3RZDB 2NZ1D 2BA0A 4C2MB 1Z6HA 3DWAA 4JYAL 1N32L 1MD2D 1ONLA 3GD7A 2K4KA 1D2BA 3B6YA 1MIUA 1PV4A 3K5LA 5EQ0A 5K36G 3K7AH 4IUPA 3O13A 2B2YA 1IL8A 2F0GA 1KDCA 3OWEB 3QOLA 1D5ZC 1OXUA 2RQXA 3PIOA 1SXTA 3I4NG 1TVXA 3H0GG 1A8VA 2JA5G 4YCVA 1DXMA 2QF7A 5IWAL 5EPLA 1ET6A 1R9TB 1EIGA 5EAYA 2Q2HA 1AW7A 3RZDH 1TR5A 4C3JG 4C2MH 2BE5D 4MZ9A 3PO2B 2K75A 4ZUIA 4KHPL 2A6HD 5C5LA 4HMIA 3W5OA 3MZ5A 2ICIA 3F2DA 1JB7A 4XT3B 3J7A5 1GXDC 2XSCA 1SBBB 4NXMQ 1P8LA 4DUZL 1Q90A 1UEBA 5NUCA 1YJWA 4DR7L 2RDGA 3T1HQ 4KKUA 3D4WA 4GNXC 3BJUA 4RKLA 1T5XD 1GUWA 3MXPA 3Q24A 1HNWL 3MXGA 4A4IA 1A2TA 3M7GA 1EY9A 1YVCA 2HD3A 1R9TH 1SYGA 3QR8A 3ITPA 4BWGB 1CZGA 5DEHA 4YWMA 1CKNB 3SK8A 3GO5A 1PLFA 3U50C 4BXXH 2NN6G 4IPGA 3PO2H 2IT1A 2N78A 3KF6B 2XGTA 3HP3A 3IAYA 3ZYYX 5JAVA 3BU2A 1K83H 2ZTCA 3DHQA 2UXDL 3J80L 4GKJL 3VA5A 2CQOA 1JC7A 2Z1CA 3W1GA 1QUQB 4RMFA 5LMNQ 1IYJB 4QUFA 3VDYA 5T1IA 2F0UA 5C3EB 1AH9A 2A68C 2UUAL 3HOWG 4UY8C 5E7NA 1X3QA 4PZ8A 4X62Q 1I4HA 1LACA 5KIXA 2MPMA 4YWLA 5M5WH 1W6KA 3MEFA 1PZID 2N49A 3V2TA 2B2TC 3OOCA 1GKHA 3I8ZA 1F2LA 2Q2IA 3NEMA 3J80E 4L5RC 4IFDI 2N55A 4HTHA 5IODA 1B70B 2NVXB 3EQLC 2R92H 4EQOA 4RA8A 1QZHA 3N6RA 1XWEA 1PH2A 3M4YA 1SFOB 2L55A 2HDLA 3NQTA 1ZEQX 2IWHA 4X64Q 2OWOA 3S1MH 1TKWB 5I9PA 1TWHH 1RIPA 4JI2L 4JI4Q 5CC4A 4MN3A 1EY4A 4JI3L 4ID6A 4DV4Q 4DAMA 5C3EH 2R7DA 5EJWA 3LWUA 2DY8A 3QO2A 4RHSA 4U68A 1GM5A 4J6HA 1JORA 3U58A 1JJCB 1PRTC 2B2UA 5DM63 2B2VC 4DK1A 3PO3B 1XNRQ 2R93B 4IJLA 2EJMA 2PZTA 4LJZC 3SR1A 4K2LA 2NVXH 1T5EA 1DYQA 1BF4A 1K8MA 4XTCS 1SNPA 1ENFA 2RA4A 1KTKA 2B2WC 3K8AA 5TSSA 4POGA 1EWHA 1SFOH 1HNXL 2VY3A 5AJ3L 3I70A 4RGMA 1Q82C 2KVMA 4JI5L 1YEZA 4QL5A 1SMYC 1STYA 1MI2A 5HGTA 2OTJA 2LXJA 1NNXA 3BZCA 1OTCA 5A35A 4DV7Q 2EYFA 3BVMA 3PF5A 4L5SA 2HUGA 3TREA 4O42A 2K7VA 2KA7A 4Z9CB 5E3FA 3PO3H 4ILWA 3NXWA 4AYBE 3D4DA 2FINB 3QOJA 5I9OA 3J81c 2R93H 2RCFA 3SXHA 2EYMA 2ZM6Q 1M4VA 1NE3A 4IJHA 2F3WA 1LTAD 5LL6S 1FNWA 1KHIA 1SNDA 1SMXA 3DWQA 1K3BC 4QY7A 3OIPA 5M3FB 1G291 1F2ZA 3MC0B 3PUXA 2E75C 3PSIA 4ULLA 4C56C 4A3DG 1PH3A 3KF8A 4IUNA 1N34L 3MXUA 1QVFA 1GUNA 4A3IB 3ICEA 2EYPA 1J6QA 3DEOA 1JWUD 4C3IG 4HMJA 1RHPA 1CA6A 4UP8A 2PZWA 1YHAA 3DEPA 3ERSX 3CCEA 1W3SA 3A54A 3CRLC 2GN5A 4HJ5A 2RKSA 2CQAA 4HCSA 5EGTA 2OTLA 3BYYB 1S5CD 4DR6L 2EJFC 1LYLA 5IGEA 4YCWA 1EY8A 5M3FH 2F0VA 2PI2A 5C4HA 3J7ZC 4DV2Q 3PMFA 4M8AA 1EZ6A 3RUZA 1V1PB 3GTOB 4K5WA 1CA5A 3FMCA 2HCIA 2CW0C 1SN8A 1HZBA 3DM3A 3HFZB 4JVZA 2EXZA 2PYKA 5J39A 4QQBX 1H9JA 1Y1WB 3MXNA 4A3IH 2O2LD 2K05A 3HS0C 1CSPA 5M3MH 1D7QA 3TP8A 3HOZG 4HEDA 1IKLA 4X65Q 3RZOB 4A3KB 5IP7G 2OQKA 1Q7YC 3DWPA 1J5EL 3D3RA 3EFXD 2F0SA 3OMGA 4O2DA 3I55A 3RLOA 4RCOA 5C4XB 4FF4A 1VQEA 3I4MG 1LT3D 4OELB 4DR2L 2H1EA 5LHY1 3G4SA 2ATWA 4CJ0B 4RGNA 5IOCA 1PTOC 4LF6Q 2VQFL 3H3VI 4KK7A 4A93G 1E1TA 3GTOH 4BY7B 3OYYA 5FLMH 2B2YC 4P71A 1BXTA 4A3FB 3UDIA 4L5TA 1AE2A 1SE3A 1Y1WH 3UI2A 4FF1A 2UXCQ 3A0JA 4DAYA 2JYOA 1SMYD 2OEOA 1RDPD 4BY1B 5IT9L 1RL2A 3KLSX 1S4ZA 2VB3X 5AFWA 3RZOH 1KLGD 1VF5C 4A3KH 4ME5A 4GOPA 1A15A 2TSSA 1D6EC 1HJPA 5E4XA 1B3QA 2NZHA 5C4XH 1L0WA 5LMUL 5IGCA 1EYGA 3H09A 2FJ2A 1T9HA 4X66L 1KRSA 4R8NA 1MSGA 4NXNL 1Y8PB 4BY7H 2E74C 4Y52H 4UP9A 5BR8Q 3H3VC 1B8AA 3FRPB 2IY5B 1A62A 2NVTB 2F3VA 1JE4A 4A3FH 2JSOA 1HA5A 5IT9E 4XQNA 2R3ZA 4PNYA 5C0XG 1PRTB 5KRUA 4JI6Q 2E5LQ 3ND8A 1EYAA 1TWAB 2SNMA 1VQDA 1STNA 4BY1H 1NCVA 1LT4D 1GHKA 2Z8LA 5DM73 1X65A 3P1HA 1FYCA 3CCQA 1U9RA 3KBXA 3C46A 3SK5A 1VQAA 1FD7D 3M85A 3F1ZA 1WCMB 3TP6A 4PMCA 2Z6KA 3HOUB 1K0RA 4DV5L 1QILA 1K9MC 3CPFA 2CCZA 1MHWC 5IY0A 1S72A 4OX9Q 1H9KA 2XIWA 1LTLA 4DV0L 2FFKB 2CWAA 4LFBL 1BDOA 2AUKA 2NVTH 4J15A 1PDQA 4XQQA 3K81C 4A3EB 4WJ4A 2YTYA 1TWAH 2KCCA 3BVZA 4TVAB 4AYBB 1N36L 3JAMc 1KIXA 1JICA 4LMQD 1WTQA 1KDBA 3C1FA 1HH2P 1XNQL 1B53A 2ZXPA 4GN3B 2VW9A 5IYDH 1KAAA 4QF4A 1MBYA 4O1NA 4A3MB 1WCMH 1AN8A 3PIP3 3HOUH 1CI3M 2KQ3A 2NYZD 4JBJA 2L0CA 3OWFA 1SLJA 1X55A 2NVYB 4IALA 3Q23A 2UUBQ 2K03A 2WB1G 1G6PA 4LF5L 1F2MA 4QMGA 1PTOD 5D3IB 4A3EH 1JCKB 3AQQA 1VQFA 1G8ZD 4JBMA 2JA9A 3CD6A 2TMPA 1DZ1A 3I56A 2A8VA 3BDOA 3UDGA 2L12A 4IPCA 3CU7A 2N3SA 2K5HA 3OIQA 4OIKA 2Z6BA 4I7ZC 2Q2UA 1DONA 5D14A 4DU9A 2YYZA 1EY6A 2B2UC 4A3MH 4BXXG 3PO2G 3HKSA 1ML0D 2L1BA 3GV3A 2K5NA 3OTOL 1TY2A 3S1QB 2NVYH 4BBSB 1OXTA 1S3OA 3CCMA 3SHLA 1BCPF 1Z9FA 3KLRA 1HPCA 1X3FA 4PG3A 2XRQD 2F4VL 1ASZA 4X3SA 1WVLA 1HA6A 1N8RC 3I4OA 3I3CA 2EOTA 3QG1A 4X3TA 2P5ZX 4RHRA 1E7ZA 4HJ7A 1BR9A 1SSOA 3PV0A 1PVOA 1D1KA 1KDAA 4LFAQ 2F3IA 4RAUC 1E1OA 2I46A 2NTTA 4HSVA 2L15A 4JI1L 1XPUA 2LFNA 2KCMA 5IP9H 3OPOA 4JI0L 2VQEL 1PFNA 2R92G 3S1QH 4BBSH 5IYCG 1MSHA 1KNEA 1LTID 5EBCA 4JOIA 1UE5A 2A69D 1STBA 2VXWA 3TZUA 3EROA 2I07B 3M4OB 3SK6A 5C3EG 3J80i 4FYDA 3D8GA 4RGOS 1Z7TA 1TWCH 2XNAC 1FGUA 5IGBA 3ER0A 4ME3A 3NUCA 3I91A 4GKKL 3CCSA 1RTOA 2MO0A 2K14A 4LF4Q 1IBML 2YTVA 2EIFA 2BDOA 3MA2B 4DUZQ 4ALPA 5CV7A 1HRJA 2FMCA 3L2PA 4OWXB 2F0EA 3H91A 2DJFC 1SROA 2KECA 3K5NA 4LFCL 2PI2E 2DJGC 1FJGQ 4JK1C 4P74A 2D62A 4DA2A 3M4OH 2EY2A 3J81E 4LF9Q 2HQLA 1JOKA 2X69A 3ZJYC 2EQSA 4XT1B 1L2FA 5FO9B 1B44D 4R9WA 2ZT9C 2F0QA 2F0NA 3G7LA 3PO3G 3KFUA 4AH6A 2R93G 2B29A 2F0MA 2UXBQ 5JEAH 1RTNA 4DUYL 2IL8A 3NE5B 1QCBD 3JC66 2CVRA 2D9UA 1YHQA 2XWBB 3A5UA 3DXJC 2JQOA 3IFTA 3LWEA 4L6TB 3KJPA 3EN2A 2PMZE 1WJJA 1I50B 1LTGD 3G6JB 2NN6I 3KK7A 4KY5A 3CCJA 3LNNA 2XTIA 2B63B 2H5XA 1FNUA 1SYBA 2IPKD 3NWSA 4B3TL 1VQ6A 1J8IA 2ZTEA 2E76C 1Y8OB 2F0OA 2L5TA 3HOVB 4GOPC 1ESRA 2EYOA 3TSSA 1TWFB 3TZDA 4HJ8A 1FGBD 1I6VC 5M3FG 4G7ZC 5DLQE 4DXFA 3NQIA 4DR4L 2Z4HA 3FPPA 1GUGA 2RHSB 3M4QA 2IW3A 4B9WA 1DOKA 3T13A 4DXGA 1YITA 2JA8B 4KV6A 4ZRZA 3FHWA 4YHHL 4DFAA 1F77A 1UWVA 3UDFA 2J4XA 1I50H 3CQZB 1S5FD 4A3IG 1PMRA 3G71A 5GQOA 2MNAA 2SEBD 1EWCA 5M3MG 2M9VA 3C2PA 1NR4A 3AB9A 2MP1A 1C8CA 3J7YW 1XYIA 1D5MC 3MWYW 1STHA 5BN4A 2MFIA 4ZKBB 3GTGB 2EY1A 3HOVH 1LLRD 3ULPA 2VNUD 1TWFH 1ZYRC 5FKAC 3BVGA 3L3OC 1X3PA 2Z6KC 3GTQB 5M5YB 2AWNA 1XMQL 3QB3A 3RMHA 4U673 4CKCA 3KDFB 4QJFA 2JA8H 5FLMG 1B50A 1IYVA 1LV9A 3NTHA 3STBD 3CQZH 3HOXB 3W1BA 1Y1WG 4DV3L 3PGZA 1DM0B 2AHOB 5GAHC 4OO1H 5EKKA 1WTVA 2BDNA 5H1SE 2LY7A 3PUWA 2Z4IA 3NTIA 4A3KG 1A63A 1GUSA 4PV1C 1WTOA 3AMUA 4A3LG 5GAGC 4Q0FA 2Y0SE 5GAEC 4TSSA 4EVOA 2B3GA 4ZUJA 4N8X1 4Y7NB 3PUVA 4APVA 1FL0A 3GTQH 3BZDB 5M5YH 2CWPA 4BY7G 4QGUA 1HR0W 5KNBA 4A3FG 1I3QB 2EVBA 2KCNA 3T56B 3Q6SA 1I94Q 3HOXH 3HKZG 3KF8B 2EPBA 1QZGA 4K8JA 4WFN3 3VYUA 4BY1G 3A8JE 1E3PA 3NWTA 4GZYC 1C9OA 2PZUA 1IHZA 1F9RA 2R7ZG 4ZAIA 1X32A 2K5VA 3K59A 1JE5A 3ERQA 1HUNA 1ENCA 4NXML 1LT5D 3ULJA 4Y7NH 2H4OA 1TY0A 1H9RA 1GJXA 4UPAA 3T1HL 1G91A 2LSSA 1XMOQ 1EU4A 1O80A 2F0PA 3JAME 4DV1Q 5JPNC 4KN7C 4KJOA 2E2DC 2A73B 1I3QH 1EEFD 1KNAA 4OL7A 5E4WC 1CKNA 1G2TA 2G9DA 4CJ1B 1S5ED 2MHVA 3E0JA 3H94A 1D1IA 3KF6A 4XYQA 3FEWX 5ELOA 1CFMA 3MXNB 3F8TA 5FJ8H 3HOYB 1J5EQ 3AFQA 4KY7A 2I0QA 3AYHB 2JEBI 5CMDA 1Y1VB 2AKWB 5IYDG 3RR5A 1WD0A 1PZKD 1I6HB 3EBEA 2UU9Q 2DN8A 2A1AA 2KENA 1WCMG 1KRTA 4P2CB 2R7FA 1PFSA 4I7AA 2MUYA 3H0GB 1U4LA 5CGKA 4DR1Q 4KI0A 2JA5B 4RG1A 4DV6Q 4A3CH 2VL6A 5LMNL 1WTXA 1PYSB 2KEDA 1I4RA 3VR5A 3CAMA 5JJZA 1IBLQ 3URYA 3WWVA 4JC0A 2JE6I 1ZYRD 2PMZB 4JOIC 4X62L 4A3EG 4K0KQ 3S14B 5C4ZA 1VMPA 4JI7Q 3HOYH 1LTBD 3P20A 5HGQA 4KKSA 3MAQA 3RN5A 2ZJQA 3HEJA 4AYBG 5A2QL 4HIMA 1TS2A 4LUVA 1Y1VH 5J1ZA 5LL6X 2EE1A 2D2CC 4KJNA 4GOPB 1I6HH 1Q3LA 4H13C 5JPMC 4A3MG 3R3OA 3MVVA 3GP7A 4OHJA 4C3HB 1U4MA 4ODGA 4JV5Q 2ZXOA 3U4VA 2EYJA 3H0GH 1HNZQ 4OWWB 1II3A 2JA5H 4N8FA 4X64L 3M4PA 2IHEA 1F9PA 1QOHA 4UAIA 1TQOA 5HURA 1A2UA 2NWGA 3TRZA 4TQUS 1PFMA 4GS3A 5CR3A 4DV4L 4GNXB 4HR7B 5J3BA 1DOLA 2KBNA 5JJKA 1IBKQ 1EY7A 4NDXA 5A2QE 4B3MQ 4DPGA 2LKVA 3S14H 1Q1EA 1HZ9A 2RF4A 3SVMA 1EFID 1F9SA 1XNRL 1JT8A 1ICWA 1U0LA 2WKCA 4KY6A 4XXEA 3NK9A 2O4XA 1HR0Q 1YNJD 2CH4W 3D6CA 3CHBD 4LAAA 3KOJA 4C3HH 3HGBA 1MGSA 4C1NI 4HIKA 1J9OA 5CV8A 4DR5L 5IP9G 3CC2A 4DV0Q 2LXKA 3N52A 5C0XI 4KHVA 1KQSA 4BBSG 2ENBA 3CP0A 5F2DA 2I5LX 2KJXA 4DV7L 3J81j 1NUCA 5CBEE 4GLVB 2ZJPA 4ZCKA 1JQYD 2O5JC 3TQYA 3R8BA 3Q22A 3U9SA 1XNQQ 1W6JA 1UUPA 5T1GA 4XIGS 2HHHL 4L8JA 1RCVD 1NTGA 4OXPA 4H7BA 1HCZA 3S1RB 4L5QA 3BS1A 3VYRA 2WP8J 4A3JB 4BA1I 3TS0A 5K5PA 1EQTA 3L0OA 1QNKA 1I4XA 1BBWA 2Y0SB 4AQYQ 1IYUA 2RDHA 4YCUA 1K0SA 5KNDA 4KD4A 5JVG3 4B3RQ 1E0BA 1V1OA 2DNEA 3F2UA 1SJHD 5DNFA 5ELEA 4KLKA 5J22A 2QDBA 2CKZB 4R4CA 3D31A 1PRTF 3RN2A 2GVAA 4HJAA 1EY5A 2DUDA 4I65A 1BUVT 2JEAI 1QE6A 4B3SQ 3HG9A 3WDNA 1JR0D 1SNOA 3OW2A 3FVQA 2E2JB 1X9NA 3CXCA 1QB5D 1EIYB 1JMCA 1CT1D 3CCLA 4MTNA 1I4QA 3IRBA 1JB3A 4A3JH 1Q12A 1S40A 4H02A 1V8QA 2RSOA 2IJ0A 2AQ2B 3WOEA 1U4RA 3K5MA 2A69C 3PF4A 2I5MX 5JEAG 4DV2L 1YNXA 5CORA 1WOCA 4IFDJ 2EDGA 1E24A 1ZKOA 3T1YQ 2B8GA 4EQ5A 4JI8Q 1VQNA 2PQEA 3MFGA 2Q8RE 3I7FA 4F8MA 4CHTB 2KEEA 5C44B 1I4PA 2E2JH 2RVLA 4A3BB 1IW7D 1GOZA 3CMEA 2JN4A 3BDCA 2WAQG 3W2DA 2YU9B 3KUPA 4CJ2C 2JXMB 1YNNC 3UE1A 3L9AX 4GN4B 4IPDA 1YHBA 4K2KA 1UE1A 2VS1A 4CKBA 1K8GA 4R4OA 3UE0A 3A55A 3VR2A 2JA6B 1XTDA 4IFDH 1KLUD 2F0HA 2WB1E 2E2IB 1NAPA 4LF6L 1STAA 3SK4A 4JW0A 5JOBA 3KYHC 1HQMC 1G6ZA 2K50A 1VQJA 2IX3A 2QILA 1XPRA 1YI2A 1B9MA 4C3IB 1SYEA 1NR2A 4YY3Q 1ICFB 4WRDA 4N9TA 5IGDA 2AUJD 3QWNA 3KBGA 3PIPA 4GN5A 4QB4A 1GO3E 1SYDA 1SNMA 3NBHA 1ET9A 1CTMA 5C44H 5D65A 4CDFC 2UXCL 5EBDA 1BOSA 4A3BH 2JP1A 4CDDC 4OIJA 4K6LA 1Q8IA 1A6XA 4LUZA 2YU9H 4LF8Q 4KKTA 2F0KA 4F87A 1BCPD 3P7JA 1HXYD 2JK8A 1N9WA 1WTHA 2JA6H 1PZJD 4UHVA 4YIJA 2K52A 4K5XA 1OXVA 4IUTA 3U4ZA 4WJWA 1VQHA 1C48A 2E2IH 1U5KA 3PQIA 4LFCQ 1M1KC 1Q8KA 1B1ZA 1H9SA 4TRDA 1HZAA 1QJOA 1LM0A 2FHTA 4V190 4C3IH 2R61A 1KD1C 5CV9A 1Y8NB 2PCFB 4C1NK 5KYLA 2XVSA 2R6GA 1NJIC 4JI6L 1DD2A 2F0LA 2JA8G 1D8LA 3A5ZB 1VF7A 5CV4A 1BBUA 2Q8IB 1N33Q 3I4MB 4LF7Q 3D6WA 1PTOF 4OO1G 1GVPA 1JJ2A 1AZPA 4JYAQ 1N32Q 3D4RA 1PH1A 1GUOA 5M5XB 1CHPD 1PTOB 2ZXRA 2PQAA 1JJGA 2HDMA 4OX9L 5JJIA 1EQVA 1JOOA 1X3GA 1O7IA 4PZ7A 3TMEA 1Q46A 3HZXA 3QIAA 2F1MA 4DN4M 4BS9A 3GTJB 1TU2B 4NPSA 2C9OA 4MTKA 1CQFA 3CF5A 1O78A 5IWAQ 5CV6A 2PNRC 3X3MA 3TP7A 3HOXG 2QW7A 5KEEA 3I4MH 2C5CA 3A8IE 2L9HA 4N9PA 3J81L 3NELA 3GV6A 5EPKA 1F9QA 4NMZA 4KHPQ 1CQVA 1EEID 5HY6A 5M5XH 3VR3A 2NB0A 1BNZA 5FLXc 3E9HA 4ABNA 1VQCA 4POFA 2WINB 1NSNS 1PTOH 1K8AC 1YNND 2B39A 4M1UB 4XYOA 4BBRB 3C1EA 2MJ8A 3D0FA 2F0WA 2YTXA 1TS5A 2UUBL 4DR7Q 2J0TD 2EY5A 3T53B 3STBC 1SJED 3FKIB 1ILQA 4R8IA 2F0TA 2PW7A 2A74C 2BH8A 2QKIC 5C0XJ 3GTJH 1BBXC 4IO9A 4EQPA 2RDFA 4JBKA 2K5QA 5KYIA 1HNWQ 4ZLTF 1PA6A 1GUTA 3HRZC 1B7YB 1I5FA 1JWSD 2RHQB 3K6OA 3E9IA 5FJ8G 4CDEC 3CC7A 1GD7A 1NMGA 4FP5D 3V05A 3CCVA 2VUMB 2OF1A 2XN9C 1VS0A 2EYHA 2M2LA 1CKOA 2KHIA 2UXDQ 4GKJQ 1PH5A 4RWSC 2WFWA 1HFGA 4J1MA 3JAMi 3K0YA 2QEXA 2D0PA 4JCVE 4BBRH 4FO2A 3GTPB 1IKMA 5I6WA 1PHJA 3H3VH 5M9OA 3FKIH 5GROA 4A3CG 1STGA 3VR4A 2KCTA 1PFBA 2UUAQ 1KABA 4NP5A 2K33A 5CYUA 4FF3A 5COYA 2CHBD 5IYBH 4F7XA 4LUOA 5D3DA 1FVIA 1EIFA 5G3LF 2Z9HA 4WORA 3FP9A 1I4GA 4B9XA 4LFAL 2PW5A 3HOYG 3U9OA 2VUMH 5FO7B 3PIO3 3S2DB 1Y1VG 3OSOA 2WB1B 1EYDA 4ZQ3A 3AEVA 2VZAA 2WV6D 4IN3A 1DGSA 3PUZA 4J8QA 1EWIA 4P75A 3GTPH 1HHVA 1EQRA 1YIJA 4V0BA 4JI2Q 3T4AC 4DF7A 3K7UC 4JI3Q 2KOLA 2QGQA 3E5SA 3T51B 1XTCD 4FXKC 3ONAB 1O7LA 1Q1BA 2I5HA 1CKMA 4DR3L 1O7YA 1FR3A 1WD1A 4RCNA 1DCZA 3M3YB 4IUVA 4HCEA 2UUCL 1C4QA 4PQXA 1BKBA 1K83B 3FPUB 2B63H 2K01A 3S2DH 4CGYB 4LF4L 2ID0A 3EIVA 3G48A 5FOBB 1H9MA 3A7AB 3UDXA 1E2ZA 4MIUA 1MJEA 1HNXQ 1A3VA 1EZ8A 4C3HG 5AJ3Q 2B8FA 3F2BA 4JI5Q 3EVQA 1EUJA 4KTAA 1EOVA 5C4JB 1L1OA 2LMCB 1FJGL 3CW2C 1PH8A 1UAPA 5M5WB 3CCRA 4LF9L 3VYSA 1VCIA 3F2CA 1QWYA 4TKOB 1A0IA 4QIWE 3ND9A 4PMWA 3SDZA 3M3YH 3S24A 3GTLB 2XWJB 4HIDA 2R92B 2WKDA 2UXBL 3BDLA 2ASBA 3KJOA 2L11A 3P75A 1PH7A 3GTGH 3S1MB 2JA7B 1AE3A 1TWHB 3NP8A 3TDQA 5C4XG 1HTLD 2IX1A 3DMUA 1AP0A 1IXRA 1E22A 5C4JH 3S15B 3BG3A 3CC4A 2A5HA 1VQ9A 3HKZE 4LWCA 3M7NA 1X6OA 1HFNA 4A3GB 1N34Q 1CK1A 4AIMA 3A7LA 1VQGA 1YNJC 2ZJRA 1OO9B 3RLFA 4HIOA 3BZKA 3JAML 3GTLH 2NZOA 2EY6A 3R93A 4DK0A 4DR6Q 5IYCH 5KGUA 2KHJA 4A3JG 2PNHA 4H0LC 2QA4A 2JA7H 2QEJC 1V9PA 4LW1A 2Y0SG 2AQ3B 4DNRB 1QVGA 1P16A 1VQ7A 1ENAA 3K5OA 4R4QA 4K5VA 4X3UA 1Y14B 4FF2A 3S15H 1RD9D 1WTPA 4GLAC 4HJ9A 1VQBA 4A3GH 1EIHA 3J7AV 3ULLA 1SNCA 2NVQB 1AEXA 4IURA 1LABA 5BN5A 1XJVA 3Q0AA 5C3WA 4H44C 1HQRD 2AWOA 2JJQA 4MNOA 1EU3A 2DGYA 1TIID 4DR5Q 2GA4B 2BH2A 4DR2Q 3K0XA 4BA2I 2V1CC 1YJ9A 4G7OC 3TP5A 3IFDA 4NW2A 1B4OA 1QUQA 2VQFQ 4IFDG 3KDFA 1UNSA 4JBWA 2SOBA 4L63B 3HOUG 3I4NB 2ES2A 3W3AA 5ISRA 3CRKC 1HUMA 2LS01 1RODA 4PZ6A 1B2TA 1VDZA 4KD3A 4UP7A 5I2XA 2HHHQ 1SYFA 4NB3A 2NVQH 4IZ8A 3E0EA 4FVMA 5C44G 1BO0A 4Q5VA 4A3BG 2YV5A 2C35B 3EJIA 4KHZA 1QVCA 4B08A 4C3JB 4DAYB 5CBAE 5K36H 1VQOA 1KAWA 3NENA 5LMUQ 1UE7A 4PMBA 1HTPA 4X66Q 5I4DA 2JA6G 4DKAC 4NXNQ 3SEBA 3I2ZA 4OEMB 2OQ0A 4K8IA 4LNQA 2F4IA 1IL2A 4GLXA 1Q81C 1LTSD 1OXSC 3I4NH 1K3RA 4O0AA 1VQ8A 3TS2A 1B3AA 2NUCA 5IIFA 1TT2A 2NTSA 2G5DA 2X6GA 2K5DA 1IW7C 5EPJA 2EXDA 3K80C 1SDFA 4S3SA 3T16A 3DUZA 5M3MB 1S5BD 4JI4L 5C5MA 3OHXC 1I94L 2KHSA 2F03A 2N8NA 2QCPX 5ELCA 2A68D 5ELBA 4KN4C 4RKBA 1EQQA 4C3JH 1KXLA 3E6ZX 2E2HB 4FXGC 3CCUA 1ILPA 1LTTD 3VYTA 4ZYSA 1QG7A 1NY4A 2CH4A 4A75A 1PYBA 3GTMB 5FLXL 4P72A 4DV5Q 1DOMA 3VA7A 5C3XA 3OW7A 3PUYA 2SNSA 2K32A 3DM1A 4LFBQ 3BYTB 1XMOL 3HOWB 2A6EC 1S5DD 1NBWA 2ICEC 4DV1L 1EL0A 1HZCA 4XDXA 5GADC 1R4PB 4QIWB 4HSPA 1BCPC 4G57A 1JWMD 1VMCA 3LX0A 1N36Q 2V4DA 4E6IA 2D5DA 5FLXE 1PYWD 2NN6H 2E2HH 1BVSA 2EJGC 1PRTD 1VQKA 1K8OA 4CDCC 1AZQA 1LUZA 1K73C 1VQIA 3H6MA 4DAVA 3GTMH 2ZM6L 1LTRD 3A56A 2UU9L 5L37A 1Q86C 1WI5A 2AMCB 4G7HC 5JVH3 2MQHA 1PH4A 4NKLA 1PH6A 4DR1L 2BCOA 1M8AA 4DV6L 1L0YB 1K28A 3AFPA 3LGJA 4FDBA 3HOWH 3HKZB 2VB2X 4LF5Q 2FMMA 1YJNA 1IBLL 1LT6D 3KLWA 1E2VA 3RNUA 2F0FA 1UE6A 4XQJA 4K0KL 5FO8B 4DNIA 3V96A 4JI7L 4LK1C 2R7ZB 3NBHB 3I90A 1SRUA 3KLSA 2K28A 1E2WA 4IUUA 4A3LH 2M00A 2HQEA 4X3KA 2E8GA 4DGZA 1SYCA 2K04A 4P73A 2O5IC 1QNUA 1V1QA 3S1RH 3MHBA 3S9WA 1KC8C 1O7ZA 1VQLA 1VQ5A 1TS4A 1V1PA 3K58A 4OONA 4JV5L 3J80c 3QJYA 3OTOQ 2DY7A 3G6EA 4GNXA 2HT1A 1HNZL 2F0IA 4DK3C 1TS3A 1CSQA 2BA1A 4BBRG 1H9SB 3J81i 3A8KE 2F4VQ 2X6LA 3M9BA 1IZ6A 2RCNA 5BN3A 3FKIG 1M90C 2WAQE 1IBKL 3C3LA 1EOTA 3R2IA 4EX5A 3EA6A 4B3ML 1R4QB 2J7ZA 3RD4A 1L1OC 1RJTA 5EKIA 1KL9A 1U4PA 2R7ZH 5IYBG 3H15A 4RH6A 1MKHA 2KUMA 2FXQA 1SAPA 4JI1Q 1HR0L 4X65L 2VUMG 1LO5D 3I73A 4JI0Q 2VQEQ 1SNQA 4IOAA 2XRSD 1FNVA 4R4TA 1WTRA 4DK6C 2L4NA 3NTKA 2Q2TA 2A19A 1YBYA 2HIVA 1C0AA 2SDFA 4A3DB 2PQAB 1BQQT 1X54A 3MEHA 3SE0A 2B2TA 2EZVA 5KNCA 4YWKA 4QCLA 2CW0D 3MTSA 3TN2A 3DLLA 1XX8A 1UEAB 5IE8A 3E3XA 4OO1I 2RSNA 4G4KA 4JG2A 5E1FA 1YZ6A 2F52A 2A6ED 2OCEA 2BOSA 3I4LA 3CPWA 4GKKQ 2OT2A 2IX0A 2GVBA 2F0DA 3IL8A 1IBMQ 2B63G 4AQYL 4EGVA 5ELDA 3NHHA 5FK9C 2QDLA 4B3RL 1F2YA 4ZK9B 4IQZA 4A3DH 3HOVG 1X3EA 2HCCA 3WOFA 2PPBC 1CHQD 2B2VA 1VQPA 1H95A 4CKEA 5BR8L 1SR3A 2F0JA 4IUQA 4B3SL 1NMFA 3SGIA 3HOZB 4K6DA 1A3UA 2Q8TA 2E5LL 1TXYA 2EYLA 2B2WA 1AFPA 1RF2D 1GHJA 1PXUA 4RGTA 1SE2A 3IKJA 3NSWA 1JOQA 4A93B 3GDEA 4DUYQ 3J7AF 4OGQC 3PCOB 4X6AH 5IGFA 4F88A 2D0OA 1SE4A 3T1YL 2WIIB 1WTWA 4MHEA 4JI8L 3S16B 4JPBW 2HIXA 1BCPB 4RFBA 3GTKB 2WACA 2BE5C 2MGSA 1VQ4A 1TWCB 3HOZH 2A6HC 3S1NB 1A3TA 4CBVA 4HN7A 5I6YA 5IP7H 3OMCA 3NBIA 1STEA 1CUKA 1D5XC 1X56A 4B3TQ 5IGGA 2AQ1B 3R2TA 4A93H 1ZXTA 3S17B 1Z47A 2IHFA 3Q8DA 2JA7G 1L0XB 2MO1A 4R4IA 3S2HB 5EKLA 4DR4Q 2N88A 5CV5A 1V43A 4QUCA 1DJRD 4YY3L 3S16H 1C7YA 4IOCA 1EY0A 3GTKH 2K6AA
chains in the Genus database with same CATH topology
4DV0L 4YHHQ 4A3MG 2CWAA 3M3YH 4DR3Q 4A3GG 4LFBL 3S24A 1EFWA 1W2BA 2NVTH 4JV5Q 3S1NH 3U4VA 4HIDA 3H0GH 4J15A 1HNZQ 4OWWB 2UUCQ 3K81C 1VQMA 2UXBL 2JA5H 4LF8L 3TEHB 4X64L 3M4PA 3KJOA 2IHEA 2ASBA 4WJ4A 2YTYA 1WFQA 3CMAA 1XPOA 1TWAH 5LMNW 1PH7A 3GTGH 3TRZA 1AE3A 4TVAB 4TQUS 4DV4L 4GS3A 4GNXB 1N36L 1G51A 5J3BA 3JAMc 1KIXA 2IX1A 2KBNA 5C4XG 5JJKA 1IBKQ 1HH2P 1XNQL 3RLNA 4GN3B 2VW9A 4A76A 5IYDH 1IXRA 4DPGA 1E22A 5C4JH 5JEAJ 4B3MQ 3S17H 3S14H 3CC4A 1Q1EA 1HZ9A 2ZTDA 1VQ9A 3HKZE 4LWCA 2RF4A 3M7NA 1WCMH 1X6OA 3S2HH 4R1JA 1PH9A 4WJ3M 1XNRL 1N34Q 1JT8A 2ALYB 3HOUH 2Z0SA 1U0LA 4IPHA 1MJCA 4JBJA 4AIMA 4OWTB 1XMQQ 1HR0Q 1VQGA 1SLJA 1X55A 3RLFA 3KOJA 1L1OB 2ZJRA 2UUBQ 2CFMA 2WB1G 4C3HH 3BZKA 4HIKA 4HIOA 3GTLH 2NZOA 3L7ZC 4DR5L 5IP9G 3CC2A 1WYDA 4DV0Q 5JJLA 1G6PA 4LF5L 2LXKA 4DV3Q 5ELNA 3A74A 1ASYA 1TWGH 4DR6Q 5IYCH 1OXXK 2KHJA 4A3EH 4A3JG 5IT9c 2PNHA 3AQQA 5C0XI 4LF7L 1VQFA 1N33L 1KQSA 4BBSG 3CD6A 3CP0A 2JA9A 2QA4A 1SE8A 4JBMA 2JA7H 2I5LX 1V9PA 4LW1A 2Y0SG 3I56A 2A8VA 4DV7L 2BA0A 3J81j 3UDGA 1QVGA 4JYAL 1P16A 4GLVB 4IPCA 3GD7A 2K4KA 1VQ7A 1N32L 4R4QA 3B6YA 2N3SA 1MIUA 2ZJPA 1PV4A 2K5HA 3TQYA 5K36G 3K7AH 1Y14B 3S15H 2Q2UA 1XNQQ 4GLAC 2YYZA 4A3MH 4HJ9A 1VQBA 4A3GH 4XIGS 4BXXG 2HHHL 1OXUA 3ULLA 3HKSA 3PO2G 1NTGA 4OXPA 3PIOA 4L5QA 3I4NG 2WP8J 2K5NA 3OTOL 1XJVA 3H0GG 4BA1I 1A8VA 3TS0A 2NVYH 1OXTA 2AWOA 1S3OA 3L0OA 2JA5G 2JJQA 1BBWA 4AQYQ 3CCMA 4MNOA 4YCVA 2DGYA 4YCUA 1Z9FA 1X3FA 4PG3A 5IWAL 2F4VL 1ASZA 4B3RQ 4DR5Q 1N8RC 2BH2A 3I4OA 5EAYA 4DR2Q 3K0XA 2Q2HA 4KLKA 4BA2I 2V1CC 1YJ9A 1E7ZA 2CKZB 3RZDH 4HJ7A 4R4CA 3PV0A 1PVOA 3D31A 4C2MH 1QUQA 2VQFQ 3RN2A 4IFDG 2GVAA 3KDFA 4MZ9A 2K75A 2DUDA 4JBWA 4HJAA 4KHPL 4LFAQ 2F3IA 2JEAI 3W5OA 4B3SQ 1E1OA 3HOUG 3F2DA 1JB7A 2ES2A 3OW2A 3J7A5 2L15A 4JI1L 1X9NA 3CXCA 1EIYB 1JMCA 1XPUA 4NXMQ 1P8LA 2KCMA 5IP9H 4DUZL 3CCLA 1UEBA 4PZ6A 1YJWA 4MTNA 4DR7L 3IRBA 2VQEL 4UP7A 3T1HQ 4JI0L 2HHHQ 4NB3A 2NVQH 4A3JH 3E0EA 1Q12A 2R92G 4GNXC 5C44G 3S1QH 1S40A 4BBSH 2YV5A 4H02A 5IYCG 4A3BG 2C35B 4KHZA 1QVCA 1UE5A 3BJUA 4JOIA 3PF4A 1HNWL 2I5MX 4DAYB 5JEAG 4A4IA 4DV2L 1VQOA 1KAWA 1YNXA 1YVCA 3NENA 1WOCA 5LMUQ 1R9TH 1UE7A 4IFDJ 4YWMA 1E24A 5C3EG 1CKNB 3GO5A 3J80i 4X66Q 3T1YQ 3U50C 4DKAC 2JA6G 4BXXH 4EQ5A 4NXNQ 2NN6G 3I2ZA 4IPGA 4JI8Q 1VQNA 2IT1A 2N78A 2OQ0A 2XGTA 3KF6B 4LNQA 3PO2H 1TWCH 1IL2A 4GLXA 1Q81C 1OXSC 1FGUA 3I4NH 3BU2A 1K3RA 1K83H 3ER0A 4ME3A 2ZTCA 3I7FA 4O0AA 1VQ8A 3TS2A 2UXDL 2E2JH 4GKJL 4GKKL 3CMEA 3CCSA 2CQOA 2WAQG 2MO0A 2EXDA 2K14A 3K80C 1IBML 2YTVA 4LF4Q 4JI4L 2EIFA 3W1GA 1QUQB 4RMFA 3UE1A 5LMNQ 1I94L 1IYJB 4DUZQ 4GN4B 4IPDA 4ALPA 1YHBA 3VDYA 2N8NA 3L2PA 4OWXB 1UE1A 2VS1A 1AH9A 1K8GA 2UUAL 3HOWG 4R4OA 4UY8C 5E7NA 3UE0A 1EQQA 1SROA 1XTDA 4PZ8A 4C3JH 4X62Q 4LFCL 1KXLA 2PI2E 2WB1E 1FJGQ 4YWLA 5M5WH 3CCUA 4LF6L 3MEFA 4P74A 2D62A 2N49A 3KYHC 1NY4A 3M4OH 4A75A 2K50A 1VQJA 1GKHA 1PYBA 4LF9Q 2HQLA 1XPRA 4P72A 2Q2IA 3NEMA 1YI2A 4DV5Q 4L5RC 3ZJYC 4YY3Q 2EQSA 3PUYA 4IFDI 3PIPA 4GN5A 1B70B 1GO3E 1L2FA 2R92H 4LFBQ 5C44H 2UXCL 3PO3G 1QZHA 3KFUA 4AH6A 4A3BH 1XMOL 1PH2A 2R93G 2B29A 1NBWA 2UXBQ 4DV1L 4LUZA 1HZCA 2YU9H 4LF8Q 4X64Q 2OWOA 3S1MH 5GADC 1TWHH 1RIPA 4JI2L 4JI4Q 4DUYL 4JI3L 4DV4Q 4DAMA 5C3EH 2R7DA 1N36Q 2JK8A 1N9WA 2JA6H 2K52A 3JC66 3U4ZA 1OXVA 2E2HH 1VQHA 1BVSA 2E2IH 1GM5A 1U5KA 1VQKA 3U58A 4LFCQ 1JJCB 1YHQA 1M1KC 3A5UA 1Q8KA 2JQOA 1LUZA 1K73C 1VQIA 3GTMH 1XNRQ 1HZAA 2ZM6L 1LM0A 3KJPA 2UU9L 3EN2A 1Q86C 4IJLA 2PMZE 1WI5A 2AMCB 1WJJA 4C3IH 2MQHA 1PH4A 2NN6I 1KD1C 1PH6A 2NVXH 3CCJA 4DR1L 4XTCS 2XTIA 4DV6L 2R6GA 1NJIC 4JI6L 3AFPA 2H5XA 3K8AA 4POGA 2JA8G 1D8LA 3LGJA 3A5ZB 4FDBA 3HOWH 1SFOH 1HNXL 4LF5Q 2VY3A 4B3TL 5AJ3L 1VQ6A 1YJNA 1Q82C 4JI5L 1IBLL 2ZTEA 1BBUA 3KLWA 1YEZA 4QL5A 3RNUA 1N33Q 4LF7Q 2OTJA 1UE6A 2LXJA 3BZCA 4GOPC 1OTCA 4K0KL 4OO1G 4DNIA 1GVPA 4DV7Q 1JJ2A 4JI7L 3NBHB 4JYAQ 4HJ8A 1N32Q 1SRUA 3PF5A 5M3FG 4A3LH 5DLQE 1PH1A 4L5SA 4DR4L 3TREA 2E8GA 2RHSB 3M4QA 4P73A 1V1QA 2PQAA 3S1RH 1JJGA 4OX9L 1YITA 3PO3H 4AYBE 5JJIA 1X3GA 1KC8C 1O7IA 3J81c 3FHWA 4YHHL 1VQLA 2R93H 1VQ5A 1UWVA 3UDFA 4PZ7A 1I50H 1Q46A 4OONA 2ZM6Q 4JV5L 1NE3A 4IJHA 3J80c 3OTOQ 3G6EA 4GNXA 4A3IG 3G71A 1HNZL 2HT1A 5GQOA 4DK3C 2MNAA 1KHIA 5M3MG 1CSQA 2BA1A 4BBRG 4NPSA 1SMXA 4QY7A 3CF5A 3J81i 5IWAQ 2F4VQ 3M9BA 1IZ6A 2RCNA 2MFIA 1G291 3FKIG 3HOXG 3I4MH 1M90C 2WAQE 3PUXA 1IBKL 3PSIA 3HOVH 4EX5A 4B3ML 3ULPA 1L1OC 1KL9A 4A3DG 2VNUD 1TWFH 5IYBG 3NELA 2R7ZH 1PH3A 3H15A 4KHPQ 5HY6A 1MKHA 1N34L 1QVFA 5M5XH 2FXQA 2Z6KC 5FLXc 3E9HA 4POFA 1VQCA 3ICEA 1J6QA 2AWNA 4JI1Q 1K8AC 1XMQL 4UP8A 1HR0L 1YHAA 4X65L 3KDFB 4QJFA 2JA8H 5FLMG 3D0FA 3ERSX 1W3SA 2YTXA 3CCEA 2VUMG 2UUBL 4DR7Q 4JI0Q 2VQEQ 3STBD 2GN5A 4IOAA 4HJ5A 4R4TA 3CQZH 3STBC 2OTLA 3W1BA 1Y1WG 4DV3L 4DK6C 3PGZA 2AHOB 4DR6L 2BH8A 5C0XJ 3GTJH 2Q2TA 2A19A 1YBYA 2HIVA 5GAHC 4IO9A 1C0AA 1LYLA 4JBKA 4YCWA 2PQAB 1X54A 5H1SE 1HNWQ 5M3FH 1PA6A 2PI2A 3J7ZC 3PUWA 4DV2Q 4A3KG 1A63A 1B7YB 1I5FA 4YWKA 4A3LG 2RHQB 3E9IA 1SN8A 1HZBA 3DM3A 5GAGC 5FJ8G 2Y0SE 3DLLA 1GD7A 1NMGA 5IE8A 3HFZB 3CC7A 3CCVA 4OO1I 5GAEC 4JG2A 2B3GA 4QQBX 1YZ6A 1VS0A 2F52A 3PUVA 4APVA 1FL0A 4A3IH 2OCEA 1CKOA 2KHIA 5M5YH 2CWPA 3GTQH 4BY7G 2UXDQ 1CSPA 4GKJQ 3CPWA 1PH5A 2WFWA 5M3MH 4GKKQ 3JAMi 2QEXA 1D7QA 2D0PA 2IX0A 2GVBA 4JCVE 4BBRH 4QGUA 1HR0W 1IBMQ 3HOZG 4A3FG 2B63G 4AQYL 1PHJA 4X65Q 3H3VH 1I94Q 3FKIH 5IP7G 3HOXH 2OQKA 3HKZG 3KF8B 5GROA 1Q7YC 1QZGA 1J5EL 4A3CG 2KCTA 3I55A 4O2DA 3RLOA 4B3RL 2UUAQ 1VQEA 3I4MG 4BY1G 4DR2L 1E3PA 4A3DH 3HOVG 5IYBH 1X3EA 3G4SA 2ATWA 4LUOA 1C9OA 4LF6Q 1FVIA 1EIFA 2VQFL 1VQPA 3H3VI 2R7ZG 1H95A 4A93G 5BR8L 1SR3A 3FP9A 1E1TA 3GTOH 4LFAL 4B3SL 2K5VA 3HOYG 3OYYA 1NMFA 3SGIA 1JE5A 5FLMH 2VUMH 4P71A 4NXML 3ULJA 3UDIA 4Y7NH 1Y1VG 2E5LL 1TXYA 4L5TA 1AE2A 1Y1WH 2UXCQ 3A0JA 4UPAA 3T1HL 2VZAA 3AEVA 2LSSA 1DGSA 1XMOQ 3PUZA 4DV1Q 1EWIA 4P75A 3GTPH 1RL2A 1EQRA 1I3QH 1YIJA 1CKNA 3RZOH 4A3KH 4JI2Q 4GOPA 3GDEA 4DUYQ 3KF6A 3K7UC 1HJPA 4JI3Q 5ELOA 3MXNB 3F8TA 2NZHA 2QGQA 5C4XH 5FJ8H 1L0WA 5LMUL 3PCOB 1J5EQ 1EYGA 3AFQA 4X6AH 2I0QA 3AYHB 2D0OA 2JEBI 1T9HA 4X66L 1KRSA 3T1YL 2AKWB 1Q1BA 4NXNL 2I5HA 5IYDG 4JI8L 3RR5A 1CKMA 2HIXA 4DR3L 4BY7H 3EBEA 2UU9Q 4Y52H 2KENA 2A1AA 4UP9A 5BR8Q 1B8AA 1VQ4A 2IY5B 1WCMG 1A62A 1KRTA 2UUCL 3HOZH 2R7FA 1PFSA 1BKBA 4A3FH 2B63H 3S2DH 4DR1Q 5IP7H 4LF4L 2ID0A 3EIVA 3G48A 4KI0A 4RG1A 5C0XG 4DV6Q 4A3CH 2VL6A 5LMNL 4JI6Q 2E5LQ 1CUKA 1PYSB 3UDXA 1MJEA 1VQDA 1HNXQ 1X56A 3CAMA 4B3TQ 5AJ3Q 4BY1H 3F2BA 4JI5Q 1IBLQ 3WWVA 4JC0A 2JE6I 4JOIC 1EUJA 4X62L 1X65A 4A93H 1EOVA 1FJGL 1L1OA 4A3EG 3CCQA 4K0KQ 3CW2C 1PH8A 1Z47A 4JI7Q 2IHFA 1VQAA 3Q8DA 2JA7G 3M85A 3HOYH 2MO1A 3F1ZA 4R4IA 5HGQA 3CCRA 4LF9L 3RN5A 2ZJQA 1VCIA 3F2CA 4DR4Q 2Z6KA 4AYBG 4HIMA 4LUVA 1V43A 1K0RA 4DV5L 1A0IA 1Y1VH 4QIWE 4YY3L 1K9MC 3S16H 3CPFA 1C7YA 4IOCA 2CCZA 5IY0A 4PMWA 1S72A 4OX9Q 4GOPB 1I6HH 1LTLA 3GTKH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV0 L;  4YHH Q;  4A3M G;  2CWA A;  3M3Y H;  4DR3 Q;  4A3G G;  4LFB L;  3S24 A;  1EFW A;  1W2B A;  2NVT H;  4JV5 Q;  3S1N H;  3U4V A;  4HID A;  3H0G H;  4J15 A;  1HNZ Q;  4OWW B;  2UUC Q;  3K81 C;  1VQM A;  2UXB L;  2JA5 H;  4LF8 L;  3TEH B;  4X64 L;  3M4P A;  3KJO A;  2IHE A;  2ASB A;  4WJ4 A;  2YTY A;  1WFQ A;  3CMA A;  1XPO A;  1TWA H;  5LMN W;  1PH7 A;  3GTG H;  3TRZ A;  1AE3 A;  4TVA B;  4TQU S;  4DV4 L;  4GS3 A;  4GNX B;  1N36 L;  1G51 A;  5J3B A;  3JAM c;  1KIX A;  2IX1 A;  2KBN A;  5C4X G;  5JJK A;  1IBK Q;  1HH2 P;  1XNQ L;  3RLN A;  4GN3 B;  2VW9 A;  4A76 A;  5IYD H;  1IXR A;  4DPG A;  1E22 A;  5C4J H;  5JEA J;  4B3M Q;  3S17 H;  3S14 H;  3CC4 A;  1Q1E A;  1HZ9 A;  2ZTD A;  1VQ9 A;  3HKZ E;  4LWC A;  2RF4 A;  3M7N A;  1WCM H;  1X6O A;  3S2H H;  4R1J A;  1PH9 A;  4WJ3 M;  1XNR L;  1N34 Q;  1JT8 A;  2ALY B;  3HOU H;  2Z0S A;  1U0L A;  4IPH A;  1MJC A;  4JBJ A;  4AIM A;  4OWT B;  1XMQ Q;  1HR0 Q;  1VQG A;  1SLJ A;  1X55 A;  3RLF A;  3KOJ A;  1L1O B;  2ZJR A;  2UUB Q;  2CFM A;  2WB1 G;  4C3H H;  3BZK A;  4HIK A;  4HIO A;  3GTL H;  2NZO A;  3L7Z C;  4DR5 L;  5IP9 G;  3CC2 A;  1WYD A;  4DV0 Q;  5JJL A;  1G6P A;  4LF5 L;  2LXK A;  4DV3 Q;  5ELN A;  3A74 A;  1ASY A;  1TWG H;  4DR6 Q;  5IYC H;  1OXX K;  2KHJ A;  4A3E H;  4A3J G;  5IT9 c;  2PNH A;  3AQQ A;  5C0X I;  4LF7 L;  1VQF A;  1N33 L;  1KQS A;  4BBS G;  3CD6 A;  3CP0 A;  2JA9 A;  2QA4 A;  1SE8 A;  4JBM A;  2JA7 H;  2I5L X;  1V9P A;  4LW1 A;  2Y0S G;  3I56 A;  2A8V A;  4DV7 L;  2BA0 A;  3J81 j;  3UDG A;  1QVG A;  4JYA L;  1P16 A;  4GLV B;  4IPC A;  3GD7 A;  2K4K A;  1VQ7 A;  1N32 L;  4R4Q A;  3B6Y A;  2N3S A;  1MIU A;  2ZJP A;  1PV4 A;  2K5H A;  3TQY A;  5K36 G;  3K7A H;  1Y14 B;  3S15 H;  2Q2U A;  1XNQ Q;  4GLA C;  2YYZ A;  4A3M H;  4HJ9 A;  1VQB A;  4A3G H;  4XIG S;  4BXX G;  2HHH L;  1OXU A;  3ULL A;  3HKS A;  3PO2 G;  1NTG A;  4OXP A;  3PIO A;  4L5Q A;  3I4N G;  2WP8 J;  2K5N A;  3OTO L;  1XJV A;  3H0G G;  4BA1 I;  1A8V A;  3TS0 A;  2NVY H;  1OXT A;  2AWO A;  1S3O A;  3L0O A;  2JA5 G;  2JJQ A;  1BBW A;  4AQY Q;  3CCM A;  4MNO A;  4YCV A;  2DGY A;  4YCU A;  1Z9F A;  1X3F A;  4PG3 A;  5IWA L;  2F4V L;  1ASZ A;  4B3R Q;  4DR5 Q;  1N8R C;  2BH2 A;  3I4O A;  5EAY A;  4DR2 Q;  3K0X A;  2Q2H A;  4KLK A;  4BA2 I;  2V1C C;  1YJ9 A;  1E7Z A;  2CKZ B;  3RZD H;  4HJ7 A;  4R4C A;  3PV0 A;  1PVO A;  3D31 A;  4C2M H;  1QUQ A;  2VQF Q;  3RN2 A;  4IFD G;  2GVA A;  3KDF A;  4MZ9 A;  2K75 A;  2DUD A;  4JBW A;  4HJA A;  4KHP L;  4LFA Q;  2F3I A;  2JEA I;  3W5O A;  4B3S Q;  1E1O A;  3HOU G;  3F2D A;  1JB7 A;  2ES2 A;  3OW2 A;  3J7A 5;  2L15 A;  4JI1 L;  1X9N A;  3CXC A;  1EIY B;  1JMC A;  1XPU A;  4NXM Q;  1P8L A;  2KCM A;  5IP9 H;  4DUZ L;  3CCL A;  1UEB A;  4PZ6 A;  1YJW A;  4MTN A;  4DR7 L;  3IRB A;  2VQE L;  4UP7 A;  3T1H Q;  4JI0 L;  2HHH Q;  4NB3 A;  2NVQ H;  4A3J H;  3E0E A;  1Q12 A;  2R92 G;  4GNX C;  5C44 G;  3S1Q H;  1S40 A;  4BBS H;  2YV5 A;  4H02 A;  5IYC G;  4A3B G;  2C35 B;  4KHZ A;  1QVC A;  1UE5 A;  3BJU A;  4JOI A;  3PF4 A;  1HNW L;  2I5M X;  4DAY B;  5JEA G;  4A4I A;  4DV2 L;  1VQO A;  1KAW A;  1YNX A;  1YVC A;  3NEN A;  1WOC A;  5LMU Q;  1R9T H;  1UE7 A;  4IFD J;  4YWM A;  1E24 A;  5C3E G;  1CKN B;  3GO5 A;  3J80 i;  4X66 Q;  3T1Y Q;  3U50 C;  4DKA C;  2JA6 G;  4BXX H;  4EQ5 A;  4NXN Q;  2NN6 G;  3I2Z A;  4IPG A;  4JI8 Q;  1VQN A;  2IT1 A;  2N78 A;  2OQ0 A;  2XGT A;  3KF6 B;  4LNQ A;  3PO2 H;  1TWC H;  1IL2 A;  4GLX A;  1Q81 C;  1OXS C;  1FGU A;  3I4N H;  3BU2 A;  1K3R A;  1K83 H;  3ER0 A;  4ME3 A;  2ZTC A;  3I7F A;  4O0A A;  1VQ8 A;  3TS2 A;  2UXD L;  2E2J H;  4GKJ L;  4GKK L;  3CME A;  3CCS A;  2CQO A;  2WAQ G;  2MO0 A;  2EXD A;  2K14 A;  3K80 C;  1IBM L;  2YTV A;  4LF4 Q;  4JI4 L;  2EIF A;  3W1G A;  1QUQ B;  4RMF A;  3UE1 A;  5LMN Q;  1I94 L;  1IYJ B;  4DUZ Q;  4GN4 B;  4IPD A;  4ALP A;  1YHB A;  3VDY A;  2N8N A;  3L2P A;  4OWX B;  1UE1 A;  2VS1 A;  1AH9 A;  1K8G A;  2UUA L;  3HOW G;  4R4O A;  4UY8 C;  5E7N A;  3UE0 A;  1EQQ A;  1SRO A;  1XTD A;  4PZ8 A;  4C3J H;  4X62 Q;  4LFC L;  1KXL A;  2PI2 E;  2WB1 E;  1FJG Q;  4YWL A;  5M5W H;  3CCU A;  4LF6 L;  3MEF A;  4P74 A;  2D62 A;  2N49 A;  3KYH C;  1NY4 A;  3M4O H;  4A75 A;  2K50 A;  1VQJ A;  1GKH A;  1PYB A;  4LF9 Q;  2HQL A;  1XPR A;  4P72 A;  2Q2I A;  3NEM A;  1YI2 A;  4DV5 Q;  4L5R C;  3ZJY C;  4YY3 Q;  2EQS A;  3PUY A;  4IFD I;  3PIP A;  4GN5 A;  1B70 B;  1GO3 E;  1L2F A;  2R92 H;  4LFB Q;  5C44 H;  2UXC L;  3PO3 G;  1QZH A;  3KFU A;  4AH6 A;  4A3B H;  1XMO L;  1PH2 A;  2R93 G;  2B29 A;  1NBW A;  2UXB Q;  4DV1 L;  4LUZ A;  1HZC A;  2YU9 H;  4LF8 Q;  4X64 Q;  2OWO A;  3S1M H;  5GAD C;  1TWH H;  1RIP A;  4JI2 L;  4JI4 Q;  4DUY L;  4JI3 L;  4DV4 Q;  4DAM A;  5C3E H;  2R7D A;  1N36 Q;  2JK8 A;  1N9W A;  2JA6 H;  2K52 A;  3JC6 6;  3U4Z A;  1OXV A;  2E2H H;  1VQH A;  1BVS A;  2E2I H;  1GM5 A;  1U5K A;  1VQK A;  3U58 A;  4LFC Q;  1JJC B;  1YHQ A;  1M1K C;  3A5U A;  1Q8K A;  2JQO A;  1LUZ A;  1K73 C;  1VQI A;  3GTM H;  1XNR Q;  1HZA A;  2ZM6 L;  1LM0 A;  3KJP A;  2UU9 L;  3EN2 A;  1Q86 C;  4IJL A;  2PMZ E;  1WI5 A;  2AMC B;  1WJJ A;  4C3I H;  2MQH A;  1PH4 A;  2NN6 I;  1KD1 C;  1PH6 A;  2NVX H;  3CCJ A;  4DR1 L;  4XTC S;  2XTI A;  4DV6 L;  2R6G A;  1NJI C;  4JI6 L;  3AFP A;  2H5X A;  3K8A A;  4POG A;  2JA8 G;  1D8L A;  3LGJ A;  3A5Z B;  4FDB A;  3HOW H;  1SFO H;  1HNX L;  4LF5 Q;  2VY3 A;  4B3T L;  5AJ3 L;  1VQ6 A;  1YJN A;  1Q82 C;  4JI5 L;  1IBL L;  2ZTE A;  1BBU A;  3KLW A;  1YEZ A;  4QL5 A;  3RNU A;  1N33 Q;  4LF7 Q;  2OTJ A;  1UE6 A;  2LXJ A;  3BZC A;  4GOP C;  1OTC A;  4K0K L;  4OO1 G;  4DNI A;  1GVP A;  4DV7 Q;  1JJ2 A;  4JI7 L;  3NBH B;  4JYA Q;  4HJ8 A;  1N32 Q;  1SRU A;  3PF5 A;  5M3F G;  4A3L H;  5DLQ E;  1PH1 A;  4L5S A;  4DR4 L;  3TRE A;  2E8G A;  2RHS B;  3M4Q A;  4P73 A;  1V1Q A;  2PQA A;  3S1R H;  1JJG A;  4OX9 L;  1YIT A;  3PO3 H;  4AYB E;  5JJI A;  1X3G A;  1KC8 C;  1O7I A;  3J81 c;  3FHW A;  4YHH L;  1VQL A;  2R93 H;  1VQ5 A;  1UWV A;  3UDF A;  4PZ7 A;  1I50 H;  1Q46 A;  4OON A;  2ZM6 Q;  4JV5 L;  1NE3 A;  4IJH A;  3J80 c;  3OTO Q;  3G6E A;  4GNX A;  4A3I G;  3G71 A;  1HNZ L;  2HT1 A;  5GQO A;  4DK3 C;  2MNA A;  1KHI A;  5M3M G;  1CSQ A;  2BA1 A;  4BBR G;  4NPS A;  1SMX A;  4QY7 A;  3CF5 A;  3J81 i;  5IWA Q;  2F4V Q;  3M9B A;  1IZ6 A;  2RCN A;  2MFI A;  1G29 1;  3FKI G;  3HOX G;  3I4M H;  1M90 C;  2WAQ E;  3PUX A;  1IBK L;  3PSI A;  3HOV H;  4EX5 A;  4B3M L;  3ULP A;  1L1O C;  1KL9 A;  4A3D G;  2VNU D;  1TWF H;  5IYB G;  3NEL A;  2R7Z H;  1PH3 A;  3H15 A;  4KHP Q;  5HY6 A;  1MKH A;  1N34 L;  1QVF A;  5M5X H;  2FXQ A;  2Z6K C;  5FLX c;  3E9H A;  4POF A;  1VQC A;  3ICE A;  1J6Q A;  2AWN A;  4JI1 Q;  1K8A C;  1XMQ L;  4UP8 A;  1HR0 L;  1YHA A;  4X65 L;  3KDF B;  4QJF A;  2JA8 H;  5FLM G;  3D0F A;  3ERS X;  1W3S A;  2YTX A;  3CCE A;  2VUM G;  2UUB L;  4DR7 Q;  4JI0 Q;  2VQE Q;  3STB D;  2GN5 A;  4IOA A;  4HJ5 A;  4R4T A;  3CQZ H;  3STB C;  2OTL A;  3W1B A;  1Y1W G;  4DV3 L;  4DK6 C;  3PGZ A;  2AHO B;  4DR6 L;  2BH8 A;  5C0X J;  3GTJ H;  2Q2T A;  2A19 A;  1YBY A;  2HIV A;  5GAH C;  4IO9 A;  1C0A A;  1LYL A;  4JBK A;  4YCW A;  2PQA B;  1X54 A;  5H1S E;  1HNW Q;  5M3F H;  1PA6 A;  2PI2 A;  3J7Z C;  3PUW A;  4DV2 Q;  4A3K G;  1A63 A;  1B7Y B;  1I5F A;  4YWK A;  4A3L G;  2RHQ B;  3E9I A;  1SN8 A;  1HZB A;  3DM3 A;  5GAG C;  5FJ8 G;  2Y0S E;  3DLL A;  1GD7 A;  1NMG A;  5IE8 A;  3HFZ B;  3CC7 A;  3CCV A;  4OO1 I;  5GAE C;  4JG2 A;  2B3G A;  4QQB X;  1YZ6 A;  1VS0 A;  2F52 A;  3PUV A;  4APV A;  1FL0 A;  4A3I H;  2OCE A;  1CKO A;  2KHI A;  5M5Y H;  2CWP A;  3GTQ H;  4BY7 G;  2UXD Q;  1CSP A;  4GKJ Q;  3CPW A;  1PH5 A;  2WFW A;  5M3M H;  4GKK Q;  3JAM i;  2QEX A;  1D7Q A;  2D0P A;  2IX0 A;  2GVB A;  4JCV E;  4BBR H;  4QGU A;  1HR0 W;  1IBM Q;  3HOZ G;  4A3F G;  2B63 G;  4AQY L;  1PHJ A;  4X65 Q;  3H3V H;  1I94 Q;  3FKI H;  5IP7 G;  3HOX H;  2OQK A;  3HKZ G;  3KF8 B;  5GRO A;  1Q7Y C;  1QZG A;  1J5E L;  4A3C G;  2KCT A;  3I55 A;  4O2D A;  3RLO A;  4B3R L;  2UUA Q;  1VQE A;  3I4M G;  4BY1 G;  4DR2 L;  1E3P A;  4A3D H;  3HOV G;  5IYB H;  1X3E A;  3G4S A;  2ATW A;  4LUO A;  1C9O A;  4LF6 Q;  1FVI A;  1EIF A;  2VQF L;  1VQP A;  3H3V I;  2R7Z G;  1H95 A;  4A93 G;  5BR8 L;  1SR3 A;  3FP9 A;  1E1T A;  3GTO H;  4LFA L;  4B3S L;  2K5V A;  3HOY G;  3OYY A;  1NMF A;  3SGI A;  1JE5 A;  5FLM H;  2VUM H;  4P71 A;  4NXM L;  3ULJ A;  3UDI A;  4Y7N H;  1Y1V G;  2E5L L;  1TXY A;  4L5T A;  1AE2 A;  1Y1W H;  2UXC Q;  3A0J A;  4UPA A;  3T1H L;  2VZA A;  3AEV A;  2LSS A;  1DGS A;  1XMO Q;  3PUZ A;  4DV1 Q;  1EWI A;  4P75 A;  3GTP H;  1RL2 A;  1EQR A;  1I3Q H;  1YIJ A;  1CKN A;  3RZO H;  4A3K H;  4JI2 Q;  4GOP A;  3GDE A;  4DUY Q;  3KF6 A;  3K7U C;  1HJP A;  4JI3 Q;  5ELO A;  3MXN B;  3F8T A;  2NZH A;  2QGQ A;  5C4X H;  5FJ8 H;  1L0W A;  5LMU L;  3PCO B;  1J5E Q;  1EYG A;  3AFQ A;  4X6A H;  2I0Q A;  3AYH B;  2D0O A;  2JEB I;  1T9H A;  4X66 L;  1KRS A;  3T1Y L;  2AKW B;  1Q1B A;  4NXN L;  2I5H A;  5IYD G;  4JI8 L;  3RR5 A;  1CKM A;  2HIX A;  4DR3 L;  4BY7 H;  3EBE A;  2UU9 Q;  4Y52 H;  2KEN A;  2A1A A;  4UP9 A;  5BR8 Q;  1B8A A;  1VQ4 A;  2IY5 B;  1WCM G;  1A62 A;  1KRT A;  2UUC L;  3HOZ H;  2R7F A;  1PFS A;  1BKB A;  4A3F H;  2B63 H;  3S2D H;  4DR1 Q;  5IP7 H;  4LF4 L;  2ID0 A;  3EIV A;  3G48 A;  4KI0 A;  4RG1 A;  5C0X G;  4DV6 Q;  4A3C H;  2VL6 A;  5LMN L;  4JI6 Q;  2E5L Q;  1CUK A;  1PYS B;  3UDX A;  1MJE A;  1VQD A;  1HNX Q;  1X56 A;  3CAM A;  4B3T Q;  5AJ3 Q;  4BY1 H;  3F2B A;  4JI5 Q;  1IBL Q;  3WWV A;  4JC0 A;  2JE6 I;  4JOI C;  1EUJ A;  4X62 L;  1X65 A;  4A93 H;  1EOV A;  1FJG L;  1L1O A;  4A3E G;  3CCQ A;  4K0K Q;  3CW2 C;  1PH8 A;  1Z47 A;  4JI7 Q;  2IHF A;  1VQA A;  3Q8D A;  2JA7 G;  3M85 A;  3HOY H;  2MO1 A;  3F1Z A;  4R4I A;  5HGQ A;  3CCR A;  4LF9 L;  3RN5 A;  2ZJQ A;  1VCI A;  3F2C A;  4DR4 Q;  2Z6K A;  4AYB G;  4HIM A;  4LUV A;  1V43 A;  1K0R A;  4DV5 L;  1A0I A;  1Y1V H;  4QIW E;  4YY3 L;  1K9M C;  3S16 H;  3CPF A;  1C7Y A;  4IOC A;  2CCZ A;  5IY0 A;  4PMW A;  1S72 A;  4OX9 Q;  4GOP B;  1I6H H;  1LTL A;  3GTK H; 
#chains in the Genus database with same CATH topology
 4YHH Q;  1EYC A;  4FNF A;  4DR3 Q;  2K5W A;  4A3G G;  2RBM A;  1EFW A;  3MFY A;  1W2B A;  3S1N H;  5C6A A;  5ELF A;  2UUC Q;  1VQM A;  1TWG B;  4LF8 L;  1G2S A;  3TEH B;  2NBF A;  5I2Y A;  2OXP A;  4KMU C;  1WFQ A;  2DNC A;  3CMA A;  1XPO A;  5LMN W;  1XXG A;  3I72 A;  4DAP A;  4DNT B;  4FXD A;  1G51 A;  4ZKC B;  1SEB D;  3AU7 A;  2K1B A;  3GQB A;  3RLN A;  3CKI B;  4A76 A;  3K7A B;  3NPP A;  2PO4 A;  5JEA J;  3S17 H;  1ESF A;  4HAE A;  5G3L D;  2ZTD A;  3S2H H;  4R1J A;  1CZW A;  1PH9 A;  4WJ3 M;  2ALY B;  1Y69 U;  2Z0S A;  4IPH A;  1MJC A;  2G9H D;  4UDU C;  4OWT B;  1XMQ Q;  5C0X H;  1RKN A;  5DAU A;  1B9N A;  4EQN A;  2WAQ B;  1L1O B;  3K57 A;  2CFM A;  3TBI B;  3L7Z C;  5JJL A;  1WYD A;  3VR6 A;  1CM9 A;  4DV3 Q;  5ELN A;  3A74 A;  1ASY A;  1TWG H;  4K14 A;  3X3N A;  1OXX K;  3FDT A;  5IT9 c;  1N33 L;  4LF7 L;  1SE8 A;  3RZD B;  2NZ1 D;  2BA0 A;  4C2M B;  1Z6H A;  3DWA A;  4JYA L;  1N32 L;  1MD2 D;  1ONL A;  3GD7 A;  2K4K A;  1D2B A;  3B6Y A;  1MIU A;  1PV4 A;  3K5L A;  5EQ0 A;  5K36 G;  3K7A H;  4IUP A;  3O13 A;  2B2Y A;  1IL8 A;  2F0G A;  1KDC A;  3OWE B;  3QOL A;  1D5Z C;  1OXU A;  2RQX A;  3PIO A;  1SXT A;  3I4N G;  1TVX A;  3H0G G;  1A8V A;  2JA5 G;  4YCV A;  1DXM A;  2QF7 A;  5IWA L;  5EPL A;  1ET6 A;  1R9T B;  1EIG A;  5EAY A;  2Q2H A;  1AW7 A;  3RZD H;  1TR5 A;  4C3J G;  4C2M H;  2BE5 D;  4MZ9 A;  3PO2 B;  2K75 A;  4ZUI A;  4KHP L;  2A6H D;  5C5L A;  4HMI A;  3W5O A;  3MZ5 A;  2ICI A;  3F2D A;  1JB7 A;  4XT3 B;  3J7A 5;  1GXD C;  2XSC A;  1SBB B;  4NXM Q;  1P8L A;  4DUZ L;  1Q90 A;  1UEB A;  5NUC A;  1YJW A;  4DR7 L;  2RDG A;  3T1H Q;  4KKU A;  3D4W A;  4GNX C;  3BJU A;  4RKL A;  1T5X D;  1GUW A;  3MXP A;  3Q24 A;  1HNW L;  3MXG A;  4A4I A;  1A2T A;  3M7G A;  1EY9 A;  1YVC A;  2HD3 A;  1R9T H;  1SYG A;  3QR8 A;  3ITP A;  4BWG B;  1CZG A;  5DEH A;  4YWM A;  1CKN B;  3SK8 A;  3GO5 A;  1PLF A;  3U50 C;  4BXX H;  2NN6 G;  4IPG A;  3PO2 H;  2IT1 A;  2N78 A;  3KF6 B;  2XGT A;  3HP3 A;  3IAY A;  3ZYY X;  5JAV A;  3BU2 A;  1K83 H;  2ZTC A;  3DHQ A;  2UXD L;  3J80 L;  4GKJ L;  3VA5 A;  2CQO A;  1JC7 A;  2Z1C A;  3W1G A;  1QUQ B;  4RMF A;  5LMN Q;  1IYJ B;  4QUF A;  3VDY A;  5T1I A;  2F0U A;  5C3E B;  1AH9 A;  2A68 C;  2UUA L;  3HOW G;  4UY8 C;  5E7N A;  1X3Q A;  4PZ8 A;  4X62 Q;  1I4H A;  1LAC A;  5KIX A;  2MPM A;  4YWL A;  5M5W H;  1W6K A;  3MEF A;  1PZI D;  2N49 A;  3V2T A;  2B2T C;  3OOC A;  1GKH A;  3I8Z A;  1F2L A;  2Q2I A;  3NEM A;  3J80 E;  4L5R C;  4IFD I;  2N55 A;  4HTH A;  5IOD A;  1B70 B;  2NVX B;  3EQL C;  2R92 H;  4EQO A;  4RA8 A;  1QZH A;  3N6R A;  1XWE A;  1PH2 A;  3M4Y A;  1SFO B;  2L55 A;  2HDL A;  3NQT A;  1ZEQ X;  2IWH A;  4X64 Q;  2OWO A;  3S1M H;  1TKW B;  5I9P A;  1TWH H;  1RIP A;  4JI2 L;  4JI4 Q;  5CC4 A;  4MN3 A;  1EY4 A;  4JI3 L;  4ID6 A;  4DV4 Q;  4DAM A;  5C3E H;  2R7D A;  5EJW A;  3LWU A;  2DY8 A;  3QO2 A;  4RHS A;  4U68 A;  1GM5 A;  4J6H A;  1JOR A;  3U58 A;  1JJC B;  1PRT C;  2B2U A;  5DM6 3;  2B2V C;  4DK1 A;  3PO3 B;  1XNR Q;  2R93 B;  4IJL A;  2EJM A;  2PZT A;  4LJZ C;  3SR1 A;  4K2L A;  2NVX H;  1T5E A;  1DYQ A;  1BF4 A;  1K8M A;  4XTC S;  1SNP A;  1ENF A;  2RA4 A;  1KTK A;  2B2W C;  3K8A A;  5TSS A;  4POG A;  1EWH A;  1SFO H;  1HNX L;  2VY3 A;  5AJ3 L;  3I70 A;  4RGM A;  1Q82 C;  2KVM A;  4JI5 L;  1YEZ A;  4QL5 A;  1SMY C;  1STY A;  1MI2 A;  5HGT A;  2OTJ A;  2LXJ A;  1NNX A;  3BZC A;  1OTC A;  5A35 A;  4DV7 Q;  2EYF A;  3BVM A;  3PF5 A;  4L5S A;  2HUG A;  3TRE A;  4O42 A;  2K7V A;  2KA7 A;  4Z9C B;  5E3F A;  3PO3 H;  4ILW A;  3NXW A;  4AYB E;  3D4D A;  2FIN B;  3QOJ A;  5I9O A;  3J81 c;  2R93 H;  2RCF A;  3SXH A;  2EYM A;  2ZM6 Q;  1M4V A;  1NE3 A;  4IJH A;  2F3W A;  1LTA D;  5LL6 S;  1FNW A;  1KHI A;  1SND A;  1SMX A;  3DWQ A;  1K3B C;  4QY7 A;  3OIP A;  5M3F B;  1G29 1;  1F2Z A;  3MC0 B;  3PUX A;  2E75 C;  3PSI A;  4ULL A;  4C56 C;  4A3D G;  1PH3 A;  3KF8 A;  4IUN A;  1N34 L;  3MXU A;  1QVF A;  1GUN A;  4A3I B;  3ICE A;  2EYP A;  1J6Q A;  3DEO A;  1JWU D;  4C3I G;  4HMJ A;  1RHP A;  1CA6 A;  4UP8 A;  2PZW A;  1YHA A;  3DEP A;  3ERS X;  3CCE A;  1W3S A;  3A54 A;  3CRL C;  2GN5 A;  4HJ5 A;  2RKS A;  2CQA A;  4HCS A;  5EGT A;  2OTL A;  3BYY B;  1S5C D;  4DR6 L;  2EJF C;  1LYL A;  5IGE A;  4YCW A;  1EY8 A;  5M3F H;  2F0V A;  2PI2 A;  5C4H A;  3J7Z C;  4DV2 Q;  3PMF A;  4M8A A;  1EZ6 A;  3RUZ A;  1V1P B;  3GTO B;  4K5W A;  1CA5 A;  3FMC A;  2HCI A;  2CW0 C;  1SN8 A;  1HZB A;  3DM3 A;  3HFZ B;  4JVZ A;  2EXZ A;  2PYK A;  5J39 A;  4QQB X;  1H9J A;  1Y1W B;  3MXN A;  4A3I H;  2O2L D;  2K05 A;  3HS0 C;  1CSP A;  5M3M H;  1D7Q A;  3TP8 A;  3HOZ G;  4HED A;  1IKL A;  4X65 Q;  3RZO B;  4A3K B;  5IP7 G;  2OQK A;  1Q7Y C;  3DWP A;  1J5E L;  3D3R A;  3EFX D;  2F0S A;  3OMG A;  4O2D A;  3I55 A;  3RLO A;  4RCO A;  5C4X B;  4FF4 A;  1VQE A;  3I4M G;  1LT3 D;  4OEL B;  4DR2 L;  2H1E A;  5LHY 1;  3G4S A;  2ATW A;  4CJ0 B;  4RGN A;  5IOC A;  1PTO C;  4LF6 Q;  2VQF L;  3H3V I;  4KK7 A;  4A93 G;  1E1T A;  3GTO H;  4BY7 B;  3OYY A;  5FLM H;  2B2Y C;  4P71 A;  1BXT A;  4A3F B;  3UDI A;  4L5T A;  1AE2 A;  1SE3 A;  1Y1W H;  3UI2 A;  4FF1 A;  2UXC Q;  3A0J A;  4DAY A;  2JYO A;  1SMY D;  2OEO A;  1RDP D;  4BY1 B;  5IT9 L;  1RL2 A;  3KLS X;  1S4Z A;  2VB3 X;  5AFW A;  3RZO H;  1KLG D;  1VF5 C;  4A3K H;  4ME5 A;  4GOP A;  1A15 A;  2TSS A;  1D6E C;  1HJP A;  5E4X A;  1B3Q A;  2NZH A;  5C4X H;  1L0W A;  5LMU L;  5IGC A;  1EYG A;  3H09 A;  2FJ2 A;  1T9H A;  4X66 L;  1KRS A;  4R8N A;  1MSG A;  4NXN L;  1Y8P B;  4BY7 H;  2E74 C;  4Y52 H;  4UP9 A;  5BR8 Q;  3H3V C;  1B8A A;  3FRP B;  2IY5 B;  1A62 A;  2NVT B;  2F3V A;  1JE4 A;  4A3F H;  2JSO A;  1HA5 A;  5IT9 E;  4XQN A;  2R3Z A;  4PNY A;  5C0X G;  1PRT B;  5KRU A;  4JI6 Q;  2E5L Q;  3ND8 A;  1EYA A;  1TWA B;  2SNM A;  1VQD A;  1STN A;  4BY1 H;  1NCV A;  1LT4 D;  1GHK A;  2Z8L A;  5DM7 3;  1X65 A;  3P1H A;  1FYC A;  3CCQ A;  1U9R A;  3KBX A;  3C46 A;  3SK5 A;  1VQA A;  1FD7 D;  3M85 A;  3F1Z A;  1WCM B;  3TP6 A;  4PMC A;  2Z6K A;  3HOU B;  1K0R A;  4DV5 L;  1QIL A;  1K9M C;  3CPF A;  2CCZ A;  1MHW C;  5IY0 A;  1S72 A;  4OX9 Q;  1H9K A;  2XIW A;  1LTL A;  4DV0 L;  2FFK B;  2CWA A;  4LFB L;  1BDO A;  2AUK A;  2NVT H;  4J15 A;  1PDQ A;  4XQQ A;  3K81 C;  4A3E B;  4WJ4 A;  2YTY A;  1TWA H;  2KCC A;  3BVZ A;  4TVA B;  4AYB B;  1N36 L;  3JAM c;  1KIX A;  1JIC A;  4LMQ D;  1WTQ A;  1KDB A;  3C1F A;  1HH2 P;  1XNQ L;  1B53 A;  2ZXP A;  4GN3 B;  2VW9 A;  5IYD H;  1KAA A;  4QF4 A;  1MBY A;  4O1N A;  4A3M B;  1WCM H;  1AN8 A;  3PIP 3;  3HOU H;  1CI3 M;  2KQ3 A;  2NYZ D;  4JBJ A;  2L0C A;  3OWF A;  1SLJ A;  1X55 A;  2NVY B;  4IAL A;  3Q23 A;  2UUB Q;  2K03 A;  2WB1 G;  1G6P A;  4LF5 L;  1F2M A;  4QMG A;  1PTO D;  5D3I B;  4A3E H;  1JCK B;  3AQQ A;  1VQF A;  1G8Z D;  4JBM A;  2JA9 A;  3CD6 A;  2TMP A;  1DZ1 A;  3I56 A;  2A8V A;  3BDO A;  3UDG A;  2L12 A;  4IPC A;  3CU7 A;  2N3S A;  2K5H A;  3OIQ A;  4OIK A;  2Z6B A;  4I7Z C;  2Q2U A;  1DON A;  5D14 A;  4DU9 A;  2YYZ A;  1EY6 A;  2B2U C;  4A3M H;  4BXX G;  3PO2 G;  3HKS A;  1ML0 D;  2L1B A;  3GV3 A;  2K5N A;  3OTO L;  1TY2 A;  3S1Q B;  2NVY H;  4BBS B;  1OXT A;  1S3O A;  3CCM A;  3SHL A;  1BCP F;  1Z9F A;  3KLR A;  1HPC A;  1X3F A;  4PG3 A;  2XRQ D;  2F4V L;  1ASZ A;  4X3S A;  1WVL A;  1HA6 A;  1N8R C;  3I4O A;  3I3C A;  2EOT A;  3QG1 A;  4X3T A;  2P5Z X;  4RHR A;  1E7Z A;  4HJ7 A;  1BR9 A;  1SSO A;  3PV0 A;  1PVO A;  1D1K A;  1KDA A;  4LFA Q;  2F3I A;  4RAU C;  1E1O A;  2I46 A;  2NTT A;  4HSV A;  2L15 A;  4JI1 L;  1XPU A;  2LFN A;  2KCM A;  5IP9 H;  3OPO A;  4JI0 L;  2VQE L;  1PFN A;  2R92 G;  3S1Q H;  4BBS H;  5IYC G;  1MSH A;  1KNE A;  1LTI D;  5EBC A;  4JOI A;  1UE5 A;  2A69 D;  1STB A;  2VXW A;  3TZU A;  3ERO A;  2I07 B;  3M4O B;  3SK6 A;  5C3E G;  3J80 i;  4FYD A;  3D8G A;  4RGO S;  1Z7T A;  1TWC H;  2XNA C;  1FGU A;  5IGB A;  3ER0 A;  4ME3 A;  3NUC A;  3I91 A;  4GKK L;  3CCS A;  1RTO A;  2MO0 A;  2K14 A;  4LF4 Q;  1IBM L;  2YTV A;  2EIF A;  2BDO A;  3MA2 B;  4DUZ Q;  4ALP A;  5CV7 A;  1HRJ A;  2FMC A;  3L2P A;  4OWX B;  2F0E A;  3H91 A;  2DJF C;  1SRO A;  2KEC A;  3K5N A;  4LFC L;  2PI2 E;  2DJG C;  1FJG Q;  4JK1 C;  4P74 A;  2D62 A;  4DA2 A;  3M4O H;  2EY2 A;  3J81 E;  4LF9 Q;  2HQL A;  1JOK A;  2X69 A;  3ZJY C;  2EQS A;  4XT1 B;  1L2F A;  5FO9 B;  1B44 D;  4R9W A;  2ZT9 C;  2F0Q A;  2F0N A;  3G7L A;  3PO3 G;  3KFU A;  4AH6 A;  2R93 G;  2B29 A;  2F0M A;  2UXB Q;  5JEA H;  1RTN A;  4DUY L;  2IL8 A;  3NE5 B;  1QCB D;  3JC6 6;  2CVR A;  2D9U A;  1YHQ A;  2XWB B;  3A5U A;  3DXJ C;  2JQO A;  3IFT A;  3LWE A;  4L6T B;  3KJP A;  3EN2 A;  2PMZ E;  1WJJ A;  1I50 B;  1LTG D;  3G6J B;  2NN6 I;  3KK7 A;  4KY5 A;  3CCJ A;  3LNN A;  2XTI A;  2B63 B;  2H5X A;  1FNU A;  1SYB A;  2IPK D;  3NWS A;  4B3T L;  1VQ6 A;  1J8I A;  2ZTE A;  2E76 C;  1Y8O B;  2F0O A;  2L5T A;  3HOV B;  4GOP C;  1ESR A;  2EYO A;  3TSS A;  1TWF B;  3TZD A;  4HJ8 A;  1FGB D;  1I6V C;  5M3F G;  4G7Z C;  5DLQ E;  4DXF A;  3NQI A;  4DR4 L;  2Z4H A;  3FPP A;  1GUG A;  2RHS B;  3M4Q A;  2IW3 A;  4B9W A;  1DOK A;  3T13 A;  4DXG A;  1YIT A;  2JA8 B;  4KV6 A;  4ZRZ A;  3FHW A;  4YHH L;  4DFA A;  1F77 A;  1UWV A;  3UDF A;  2J4X A;  1I50 H;  3CQZ B;  1S5F D;  4A3I G;  1PMR A;  3G71 A;  5GQO A;  2MNA A;  2SEB D;  1EWC A;  5M3M G;  2M9V A;  3C2P A;  1NR4 A;  3AB9 A;  2MP1 A;  1C8C A;  3J7Y W;  1XYI A;  1D5M C;  3MWY W;  1STH A;  5BN4 A;  2MFI A;  4ZKB B;  3GTG B;  2EY1 A;  3HOV H;  1LLR D;  3ULP A;  2VNU D;  1TWF H;  1ZYR C;  5FKA C;  3BVG A;  3L3O C;  1X3P A;  2Z6K C;  3GTQ B;  5M5Y B;  2AWN A;  1XMQ L;  3QB3 A;  3RMH A;  4U67 3;  4CKC A;  3KDF B;  4QJF A;  2JA8 H;  5FLM G;  1B50 A;  1IYV A;  1LV9 A;  3NTH A;  3STB D;  3CQZ H;  3HOX B;  3W1B A;  1Y1W G;  4DV3 L;  3PGZ A;  1DM0 B;  2AHO B;  5GAH C;  4OO1 H;  5EKK A;  1WTV A;  2BDN A;  5H1S E;  2LY7 A;  3PUW A;  2Z4I A;  3NTI A;  4A3K G;  1A63 A;  1GUS A;  4PV1 C;  1WTO A;  3AMU A;  4A3L G;  5GAG C;  4Q0F A;  2Y0S E;  5GAE C;  4TSS A;  4EVO A;  2B3G A;  4ZUJ A;  4N8X 1;  4Y7N B;  3PUV A;  4APV A;  1FL0 A;  3GTQ H;  3BZD B;  5M5Y H;  2CWP A;  4BY7 G;  4QGU A;  1HR0 W;  5KNB A;  4A3F G;  1I3Q B;  2EVB A;  2KCN A;  3T56 B;  3Q6S A;  1I94 Q;  3HOX H;  3HKZ G;  3KF8 B;  2EPB A;  1QZG A;  4K8J A;  4WFN 3;  3VYU A;  4BY1 G;  3A8J E;  1E3P A;  3NWT A;  4GZY C;  1C9O A;  2PZU A;  1IHZ A;  1F9R A;  2R7Z G;  4ZAI A;  1X32 A;  2K5V A;  3K59 A;  1JE5 A;  3ERQ A;  1HUN A;  1ENC A;  4NXM L;  1LT5 D;  3ULJ A;  4Y7N H;  2H4O A;  1TY0 A;  1H9R A;  1GJX A;  4UPA A;  3T1H L;  1G91 A;  2LSS A;  1XMO Q;  1EU4 A;  1O80 A;  2F0P A;  3JAM E;  4DV1 Q;  5JPN C;  4KN7 C;  4KJO A;  2E2D C;  2A73 B;  1I3Q H;  1EEF D;  1KNA A;  4OL7 A;  5E4W C;  1CKN A;  1G2T A;  2G9D A;  4CJ1 B;  1S5E D;  2MHV A;  3E0J A;  3H94 A;  1D1I A;  3KF6 A;  4XYQ A;  3FEW X;  5ELO A;  1CFM A;  3MXN B;  3F8T A;  5FJ8 H;  3HOY B;  1J5E Q;  3AFQ A;  4KY7 A;  2I0Q A;  3AYH B;  2JEB I;  5CMD A;  1Y1V B;  2AKW B;  5IYD G;  3RR5 A;  1WD0 A;  1PZK D;  1I6H B;  3EBE A;  2UU9 Q;  2DN8 A;  2A1A A;  2KEN A;  1WCM G;  1KRT A;  4P2C B;  2R7F A;  1PFS A;  4I7A A;  2MUY A;  3H0G B;  1U4L A;  5CGK A;  4DR1 Q;  4KI0 A;  2JA5 B;  4RG1 A;  4DV6 Q;  4A3C H;  2VL6 A;  5LMN L;  1WTX A;  1PYS B;  2KED A;  1I4R A;  3VR5 A;  3CAM A;  5JJZ A;  1IBL Q;  3URY A;  3WWV A;  4JC0 A;  2JE6 I;  1ZYR D;  2PMZ B;  4JOI C;  4X62 L;  4A3E G;  4K0K Q;  3S14 B;  5C4Z A;  1VMP A;  4JI7 Q;  3HOY H;  1LTB D;  3P20 A;  5HGQ A;  4KKS A;  3MAQ A;  3RN5 A;  2ZJQ A;  3HEJ A;  4AYB G;  5A2Q L;  4HIM A;  1TS2 A;  4LUV A;  1Y1V H;  5J1Z A;  5LL6 X;  2EE1 A;  2D2C C;  4KJN A;  4GOP B;  1I6H H;  1Q3L A;  4H13 C;  5JPM C;  4A3M G;  3R3O A;  3MVV A;  3GP7 A;  4OHJ A;  4C3H B;  1U4M A;  4ODG A;  4JV5 Q;  2ZXO A;  3U4V A;  2EYJ A;  3H0G H;  1HNZ Q;  4OWW B;  1II3 A;  2JA5 H;  4N8F A;  4X64 L;  3M4P A;  2IHE A;  1F9P A;  1QOH A;  4UAI A;  1TQO A;  5HUR A;  1A2U A;  2NWG A;  3TRZ A;  4TQU S;  1PFM A;  4GS3 A;  5CR3 A;  4DV4 L;  4GNX B;  4HR7 B;  5J3B A;  1DOL A;  2KBN A;  5JJK A;  1IBK Q;  1EY7 A;  4NDX A;  5A2Q E;  4B3M Q;  4DPG A;  2LKV A;  3S14 H;  1Q1E A;  1HZ9 A;  2RF4 A;  3SVM A;  1EFI D;  1F9S A;  1XNR L;  1JT8 A;  1ICW A;  1U0L A;  2WKC A;  4KY6 A;  4XXE A;  3NK9 A;  2O4X A;  1HR0 Q;  1YNJ D;  2CH4 W;  3D6C A;  3CHB D;  4LAA A;  3KOJ A;  4C3H H;  3HGB A;  1MGS A;  4C1N I;  4HIK A;  1J9O A;  5CV8 A;  4DR5 L;  5IP9 G;  3CC2 A;  4DV0 Q;  2LXK A;  3N52 A;  5C0X I;  4KHV A;  1KQS A;  4BBS G;  2ENB A;  3CP0 A;  5F2D A;  2I5L X;  2KJX A;  4DV7 L;  3J81 j;  1NUC A;  5CBE E;  4GLV B;  2ZJP A;  4ZCK A;  1JQY D;  2O5J C;  3TQY A;  3R8B A;  3Q22 A;  3U9S A;  1XNQ Q;  1W6J A;  1UUP A;  5T1G A;  4XIG S;  2HHH L;  4L8J A;  1RCV D;  1NTG A;  4OXP A;  4H7B A;  1HCZ A;  3S1R B;  4L5Q A;  3BS1 A;  3VYR A;  2WP8 J;  4A3J B;  4BA1 I;  3TS0 A;  5K5P A;  1EQT A;  3L0O A;  1QNK A;  1I4X A;  1BBW A;  2Y0S B;  4AQY Q;  1IYU A;  2RDH A;  4YCU A;  1K0S A;  5KND A;  4KD4 A;  5JVG 3;  4B3R Q;  1E0B A;  1V1O A;  2DNE A;  3F2U A;  1SJH D;  5DNF A;  5ELE A;  4KLK A;  5J22 A;  2QDB A;  2CKZ B;  4R4C A;  3D31 A;  1PRT F;  3RN2 A;  2GVA A;  4HJA A;  1EY5 A;  2DUD A;  4I65 A;  1BUV T;  2JEA I;  1QE6 A;  4B3S Q;  3HG9 A;  3WDN A;  1JR0 D;  1SNO A;  3OW2 A;  3FVQ A;  2E2J B;  1X9N A;  3CXC A;  1QB5 D;  1EIY B;  1JMC A;  1CT1 D;  3CCL A;  4MTN A;  1I4Q A;  3IRB A;  1JB3 A;  4A3J H;  1Q12 A;  1S40 A;  4H02 A;  1V8Q A;  2RSO A;  2IJ0 A;  2AQ2 B;  3WOE A;  1U4R A;  3K5M A;  2A69 C;  3PF4 A;  2I5M X;  5JEA G;  4DV2 L;  1YNX A;  5COR A;  1WOC A;  4IFD J;  2EDG A;  1E24 A;  1ZKO A;  3T1Y Q;  2B8G A;  4EQ5 A;  4JI8 Q;  1VQN A;  2PQE A;  3MFG A;  2Q8R E;  3I7F A;  4F8M A;  4CHT B;  2KEE A;  5C44 B;  1I4P A;  2E2J H;  2RVL A;  4A3B B;  1IW7 D;  1GOZ A;  3CME A;  2JN4 A;  3BDC A;  2WAQ G;  3W2D A;  2YU9 B;  3KUP A;  4CJ2 C;  2JXM B;  1YNN C;  3UE1 A;  3L9A X;  4GN4 B;  4IPD A;  1YHB A;  4K2K A;  1UE1 A;  2VS1 A;  4CKB A;  1K8G A;  4R4O A;  3UE0 A;  3A55 A;  3VR2 A;  2JA6 B;  1XTD A;  4IFD H;  1KLU D;  2F0H A;  2WB1 E;  2E2I B;  1NAP A;  4LF6 L;  1STA A;  3SK4 A;  4JW0 A;  5JOB A;  3KYH C;  1HQM C;  1G6Z A;  2K50 A;  1VQJ A;  2IX3 A;  2QIL A;  1XPR A;  1YI2 A;  1B9M A;  4C3I B;  1SYE A;  1NR2 A;  4YY3 Q;  1ICF B;  4WRD A;  4N9T A;  5IGD A;  2AUJ D;  3QWN A;  3KBG A;  3PIP A;  4GN5 A;  4QB4 A;  1GO3 E;  1SYD A;  1SNM A;  3NBH A;  1ET9 A;  1CTM A;  5C44 H;  5D65 A;  4CDF C;  2UXC L;  5EBD A;  1BOS A;  4A3B H;  2JP1 A;  4CDD C;  4OIJ A;  4K6L A;  1Q8I A;  1A6X A;  4LUZ A;  2YU9 H;  4LF8 Q;  4KKT A;  2F0K A;  4F87 A;  1BCP D;  3P7J A;  1HXY D;  2JK8 A;  1N9W A;  1WTH A;  2JA6 H;  1PZJ D;  4UHV A;  4YIJ A;  2K52 A;  4K5X A;  1OXV A;  4IUT A;  3U4Z A;  4WJW A;  1VQH A;  1C48 A;  2E2I H;  1U5K A;  3PQI A;  4LFC Q;  1M1K C;  1Q8K A;  1B1Z A;  1H9S A;  4TRD A;  1HZA A;  1QJO A;  1LM0 A;  2FHT A;  4V19 0;  4C3I H;  2R61 A;  1KD1 C;  5CV9 A;  1Y8N B;  2PCF B;  4C1N K;  5KYL A;  2XVS A;  2R6G A;  1NJI C;  4JI6 L;  1DD2 A;  2F0L A;  2JA8 G;  1D8L A;  3A5Z B;  1VF7 A;  5CV4 A;  1BBU A;  2Q8I B;  1N33 Q;  3I4M B;  4LF7 Q;  3D6W A;  1PTO F;  4OO1 G;  1GVP A;  1JJ2 A;  1AZP A;  4JYA Q;  1N32 Q;  3D4R A;  1PH1 A;  1GUO A;  5M5X B;  1CHP D;  1PTO B;  2ZXR A;  2PQA A;  1JJG A;  2HDM A;  4OX9 L;  5JJI A;  1EQV A;  1JOO A;  1X3G A;  1O7I A;  4PZ7 A;  3TME A;  1Q46 A;  3HZX A;  3QIA A;  2F1M A;  4DN4 M;  4BS9 A;  3GTJ B;  1TU2 B;  4NPS A;  2C9O A;  4MTK A;  1CQF A;  3CF5 A;  1O78 A;  5IWA Q;  5CV6 A;  2PNR C;  3X3M A;  3TP7 A;  3HOX G;  2QW7 A;  5KEE A;  3I4M H;  2C5C A;  3A8I E;  2L9H A;  4N9P A;  3J81 L;  3NEL A;  3GV6 A;  5EPK A;  1F9Q A;  4NMZ A;  4KHP Q;  1CQV A;  1EEI D;  5HY6 A;  5M5X H;  3VR3 A;  2NB0 A;  1BNZ A;  5FLX c;  3E9H A;  4ABN A;  1VQC A;  4POF A;  2WIN B;  1NSN S;  1PTO H;  1K8A C;  1YNN D;  2B39 A;  4M1U B;  4XYO A;  4BBR B;  3C1E A;  2MJ8 A;  3D0F A;  2F0W A;  2YTX A;  1TS5 A;  2UUB L;  4DR7 Q;  2J0T D;  2EY5 A;  3T53 B;  3STB C;  1SJE D;  3FKI B;  1ILQ A;  4R8I A;  2F0T A;  2PW7 A;  2A74 C;  2BH8 A;  2QKI C;  5C0X J;  3GTJ H;  1BBX C;  4IO9 A;  4EQP A;  2RDF A;  4JBK A;  2K5Q A;  5KYI A;  1HNW Q;  4ZLT F;  1PA6 A;  1GUT A;  3HRZ C;  1B7Y B;  1I5F A;  1JWS D;  2RHQ B;  3K6O A;  3E9I A;  5FJ8 G;  4CDE C;  3CC7 A;  1GD7 A;  1NMG A;  4FP5 D;  3V05 A;  3CCV A;  2VUM B;  2OF1 A;  2XN9 C;  1VS0 A;  2EYH A;  2M2L A;  1CKO A;  2KHI A;  2UXD Q;  4GKJ Q;  1PH5 A;  4RWS C;  2WFW A;  1HFG A;  4J1M A;  3JAM i;  3K0Y A;  2QEX A;  2D0P A;  4JCV E;  4BBR H;  4FO2 A;  3GTP B;  1IKM A;  5I6W A;  1PHJ A;  3H3V H;  5M9O A;  3FKI H;  5GRO A;  4A3C G;  1STG A;  3VR4 A;  2KCT A;  1PFB A;  2UUA Q;  1KAB A;  4NP5 A;  2K33 A;  5CYU A;  4FF3 A;  5COY A;  2CHB D;  5IYB H;  4F7X A;  4LUO A;  5D3D A;  1FVI A;  1EIF A;  5G3L F;  2Z9H A;  4WOR A;  3FP9 A;  1I4G A;  4B9X A;  4LFA L;  2PW5 A;  3HOY G;  3U9O A;  2VUM H;  5FO7 B;  3PIO 3;  3S2D B;  1Y1V G;  3OSO A;  2WB1 B;  1EYD A;  4ZQ3 A;  3AEV A;  2VZA A;  2WV6 D;  4IN3 A;  1DGS A;  3PUZ A;  4J8Q A;  1EWI A;  4P75 A;  3GTP H;  1HHV A;  1EQR A;  1YIJ A;  4V0B A;  4JI2 Q;  3T4A C;  4DF7 A;  3K7U C;  4JI3 Q;  2KOL A;  2QGQ A;  3E5S A;  3T51 B;  1XTC D;  4FXK C;  3ONA B;  1O7L A;  1Q1B A;  2I5H A;  1CKM A;  4DR3 L;  1O7Y A;  1FR3 A;  1WD1 A;  4RCN A;  1DCZ A;  3M3Y B;  4IUV A;  4HCE A;  2UUC L;  1C4Q A;  4PQX A;  1BKB A;  1K83 B;  3FPU B;  2B63 H;  2K01 A;  3S2D H;  4CGY B;  4LF4 L;  2ID0 A;  3EIV A;  3G48 A;  5FOB B;  1H9M A;  3A7A B;  3UDX A;  1E2Z A;  4MIU A;  1MJE A;  1HNX Q;  1A3V A;  1EZ8 A;  4C3H G;  5AJ3 Q;  2B8F A;  3F2B A;  4JI5 Q;  3EVQ A;  1EUJ A;  4KTA A;  1EOV A;  5C4J B;  1L1O A;  2LMC B;  1FJG L;  3CW2 C;  1PH8 A;  1UAP A;  5M5W B;  3CCR A;  4LF9 L;  3VYS A;  1VCI A;  3F2C A;  1QWY A;  4TKO B;  1A0I A;  4QIW E;  3ND9 A;  4PMW A;  3SDZ A;  3M3Y H;  3S24 A;  3GTL B;  2XWJ B;  4HID A;  2R92 B;  2WKD A;  2UXB L;  3BDL A;  2ASB A;  3KJO A;  2L11 A;  3P75 A;  1PH7 A;  3GTG H;  3S1M B;  2JA7 B;  1AE3 A;  1TWH B;  3NP8 A;  3TDQ A;  5C4X G;  1HTL D;  2IX1 A;  3DMU A;  1AP0 A;  1IXR A;  1E22 A;  5C4J H;  3S15 B;  3BG3 A;  3CC4 A;  2A5H A;  1VQ9 A;  3HKZ E;  4LWC A;  3M7N A;  1X6O A;  1HFN A;  4A3G B;  1N34 Q;  1CK1 A;  4AIM A;  3A7L A;  1VQG A;  1YNJ C;  2ZJR A;  1OO9 B;  3RLF A;  4HIO A;  3BZK A;  3JAM L;  3GTL H;  2NZO A;  2EY6 A;  3R93 A;  4DK0 A;  4DR6 Q;  5IYC H;  5KGU A;  2KHJ A;  4A3J G;  2PNH A;  4H0L C;  2QA4 A;  2JA7 H;  2QEJ C;  1V9P A;  4LW1 A;  2Y0S G;  2AQ3 B;  4DNR B;  1QVG A;  1P16 A;  1VQ7 A;  1ENA A;  3K5O A;  4R4Q A;  4K5V A;  4X3U A;  1Y14 B;  4FF2 A;  3S15 H;  1RD9 D;  1WTP A;  4GLA C;  4HJ9 A;  1VQB A;  4A3G H;  1EIH A;  3J7A V;  3ULL A;  1SNC A;  2NVQ B;  1AEX A;  4IUR A;  1LAB A;  5BN5 A;  1XJV A;  3Q0A A;  5C3W A;  4H44 C;  1HQR D;  2AWO A;  2JJQ A;  4MNO A;  1EU3 A;  2DGY A;  1TII D;  4DR5 Q;  2GA4 B;  2BH2 A;  4DR2 Q;  3K0X A;  4BA2 I;  2V1C C;  1YJ9 A;  4G7O C;  3TP5 A;  3IFD A;  4NW2 A;  1B4O A;  1QUQ A;  2VQF Q;  4IFD G;  3KDF A;  1UNS A;  4JBW A;  2SOB A;  4L63 B;  3HOU G;  3I4N B;  2ES2 A;  3W3A A;  5ISR A;  3CRK C;  1HUM A;  2LS0 1;  1ROD A;  4PZ6 A;  1B2T A;  1VDZ A;  4KD3 A;  4UP7 A;  5I2X A;  2HHH Q;  1SYF A;  4NB3 A;  2NVQ H;  4IZ8 A;  3E0E A;  4FVM A;  5C44 G;  1BO0 A;  4Q5V A;  4A3B G;  2YV5 A;  2C35 B;  3EJI A;  4KHZ A;  1QVC A;  4B08 A;  4C3J B;  4DAY B;  5CBA E;  5K36 H;  1VQO A;  1KAW A;  3NEN A;  5LMU Q;  1UE7 A;  4PMB A;  1HTP A;  4X66 Q;  5I4D A;  2JA6 G;  4DKA C;  4NXN Q;  3SEB A;  3I2Z A;  4OEM B;  2OQ0 A;  4K8I A;  4LNQ A;  2F4I A;  1IL2 A;  4GLX A;  1Q81 C;  1LTS D;  1OXS C;  3I4N H;  1K3R A;  4O0A A;  1VQ8 A;  3TS2 A;  1B3A A;  2NUC A;  5IIF A;  1TT2 A;  2NTS A;  2G5D A;  2X6G A;  2K5D A;  1IW7 C;  5EPJ A;  2EXD A;  3K80 C;  1SDF A;  4S3S A;  3T16 A;  3DUZ A;  5M3M B;  1S5B D;  4JI4 L;  5C5M A;  3OHX C;  1I94 L;  2KHS A;  2F03 A;  2N8N A;  2QCP X;  5ELC A;  2A68 D;  5ELB A;  4KN4 C;  4RKB A;  1EQQ A;  4C3J H;  1KXL A;  3E6Z X;  2E2H B;  4FXG C;  3CCU A;  1ILP A;  1LTT D;  3VYT A;  4ZYS A;  1QG7 A;  1NY4 A;  2CH4 A;  4A75 A;  1PYB A;  3GTM B;  5FLX L;  4P72 A;  4DV5 Q;  1DOM A;  3VA7 A;  5C3X A;  3OW7 A;  3PUY A;  2SNS A;  2K32 A;  3DM1 A;  4LFB Q;  3BYT B;  1XMO L;  3HOW B;  2A6E C;  1S5D D;  1NBW A;  2ICE C;  4DV1 L;  1EL0 A;  1HZC A;  4XDX A;  5GAD C;  1R4P B;  4QIW B;  4HSP A;  1BCP C;  4G57 A;  1JWM D;  1VMC A;  3LX0 A;  1N36 Q;  2V4D A;  4E6I A;  2D5D A;  5FLX E;  1PYW D;  2NN6 H;  2E2H H;  1BVS A;  2EJG C;  1PRT D;  1VQK A;  1K8O A;  4CDC C;  1AZQ A;  1LUZ A;  1K73 C;  1VQI A;  3H6M A;  4DAV A;  3GTM H;  2ZM6 L;  1LTR D;  3A56 A;  2UU9 L;  5L37 A;  1Q86 C;  1WI5 A;  2AMC B;  4G7H C;  5JVH 3;  2MQH A;  1PH4 A;  4NKL A;  1PH6 A;  4DR1 L;  2BCO A;  1M8A A;  4DV6 L;  1L0Y B;  1K28 A;  3AFP A;  3LGJ A;  4FDB A;  3HOW H;  3HKZ B;  2VB2 X;  4LF5 Q;  2FMM A;  1YJN A;  1IBL L;  1LT6 D;  3KLW A;  1E2V A;  3RNU A;  2F0F A;  1UE6 A;  4XQJ A;  4K0K L;  5FO8 B;  4DNI A;  3V96 A;  4JI7 L;  4LK1 C;  2R7Z B;  3NBH B;  3I90 A;  1SRU A;  3KLS A;  2K28 A;  1E2W A;  4IUU A;  4A3L H;  2M00 A;  2HQE A;  4X3K A;  2E8G A;  4DGZ A;  1SYC A;  2K04 A;  4P73 A;  2O5I C;  1QNU A;  1V1Q A;  3S1R H;  3MHB A;  3S9W A;  1KC8 C;  1O7Z A;  1VQL A;  1VQ5 A;  1TS4 A;  1V1P A;  3K58 A;  4OON A;  4JV5 L;  3J80 c;  3QJY A;  3OTO Q;  2DY7 A;  3G6E A;  4GNX A;  2HT1 A;  1HNZ L;  2F0I A;  4DK3 C;  1TS3 A;  1CSQ A;  2BA1 A;  4BBR G;  1H9S B;  3J81 i;  3A8K E;  2F4V Q;  2X6L A;  3M9B A;  1IZ6 A;  2RCN A;  5BN3 A;  3FKI G;  1M90 C;  2WAQ E;  1IBK L;  3C3L A;  1EOT A;  3R2I A;  4EX5 A;  3EA6 A;  4B3M L;  1R4Q B;  2J7Z A;  3RD4 A;  1L1O C;  1RJT A;  5EKI A;  1KL9 A;  1U4P A;  2R7Z H;  5IYB G;  3H15 A;  4RH6 A;  1MKH A;  2KUM A;  2FXQ A;  1SAP A;  4JI1 Q;  1HR0 L;  4X65 L;  2VUM G;  1LO5 D;  3I73 A;  4JI0 Q;  2VQE Q;  1SNQ A;  4IOA A;  2XRS D;  1FNV A;  4R4T A;  1WTR A;  4DK6 C;  2L4N A;  3NTK A;  2Q2T A;  2A19 A;  1YBY A;  2HIV A;  1C0A A;  2SDF A;  4A3D B;  2PQA B;  1BQQ T;  1X54 A;  3MEH A;  3SE0 A;  2B2T A;  2EZV A;  5KNC A;  4YWK A;  4QCL A;  2CW0 D;  3MTS A;  3TN2 A;  3DLL A;  1XX8 A;  1UEA B;  5IE8 A;  3E3X A;  4OO1 I;  2RSN A;  4G4K A;  4JG2 A;  5E1F A;  1YZ6 A;  2F52 A;  2A6E D;  2OCE A;  2BOS A;  3I4L A;  3CPW A;  4GKK Q;  2OT2 A;  2IX0 A;  2GVB A;  2F0D A;  3IL8 A;  1IBM Q;  2B63 G;  4AQY L;  4EGV A;  5ELD A;  3NHH A;  5FK9 C;  2QDL A;  4B3R L;  1F2Y A;  4ZK9 B;  4IQZ A;  4A3D H;  3HOV G;  1X3E A;  2HCC A;  3WOF A;  2PPB C;  1CHQ D;  2B2V A;  1VQP A;  1H95 A;  4CKE A;  5BR8 L;  1SR3 A;  2F0J A;  4IUQ A;  4B3S L;  1NMF A;  3SGI A;  3HOZ B;  4K6D A;  1A3U A;  2Q8T A;  2E5L L;  1TXY A;  2EYL A;  2B2W A;  1AFP A;  1RF2 D;  1GHJ A;  1PXU A;  4RGT A;  1SE2 A;  3IKJ A;  3NSW A;  1JOQ A;  4A93 B;  3GDE A;  4DUY Q;  3J7A F;  4OGQ C;  3PCO B;  4X6A H;  5IGF A;  4F88 A;  2D0O A;  1SE4 A;  3T1Y L;  2WII B;  1WTW A;  4MHE A;  4JI8 L;  3S16 B;  4JPB W;  2HIX A;  1BCP B;  4RFB A;  3GTK B;  2WAC A;  2BE5 C;  2MGS A;  1VQ4 A;  1TWC B;  3HOZ H;  2A6H C;  3S1N B;  1A3T A;  4CBV A;  4HN7 A;  5I6Y A;  5IP7 H;  3OMC A;  3NBI A;  1STE A;  1CUK A;  1D5X C;  1X56 A;  4B3T Q;  5IGG A;  2AQ1 B;  3R2T A;  4A93 H;  1ZXT A;  3S17 B;  1Z47 A;  2IHF A;  3Q8D A;  2JA7 G;  1L0X B;  2MO1 A;  4R4I A;  3S2H B;  5EKL A;  4DR4 Q;  2N88 A;  5CV5 A;  1V43 A;  4QUC A;  1DJR D;  4YY3 L;  3S16 H;  1C7Y A;  4IOC A;  1EY0 A;  3GTK H;  2K6A A; 
#chains in the Genus database with same CATH homology
 4DV0 L;  4YHH Q;  4A3M G;  2CWA A;  3M3Y H;  4DR3 Q;  4A3G G;  4LFB L;  3S24 A;  1EFW A;  1W2B A;  2NVT H;  4JV5 Q;  3S1N H;  3U4V A;  4HID A;  3H0G H;  4J15 A;  1HNZ Q;  4OWW B;  2UUC Q;  3K81 C;  1VQM A;  2UXB L;  2JA5 H;  4LF8 L;  3TEH B;  4X64 L;  3M4P A;  3KJO A;  2IHE A;  2ASB A;  4WJ4 A;  2YTY A;  1WFQ A;  3CMA A;  1XPO A;  1TWA H;  5LMN W;  1PH7 A;  3GTG H;  3TRZ A;  1AE3 A;  4TVA B;  4TQU S;  4DV4 L;  4GS3 A;  4GNX B;  1N36 L;  1G51 A;  5J3B A;  3JAM c;  1KIX A;  2IX1 A;  2KBN A;  5C4X G;  5JJK A;  1IBK Q;  1HH2 P;  1XNQ L;  3RLN A;  4GN3 B;  2VW9 A;  4A76 A;  5IYD H;  1IXR A;  4DPG A;  1E22 A;  5C4J H;  5JEA J;  4B3M Q;  3S17 H;  3S14 H;  3CC4 A;  1Q1E A;  1HZ9 A;  2ZTD A;  1VQ9 A;  3HKZ E;  4LWC A;  2RF4 A;  3M7N A;  1WCM H;  1X6O A;  3S2H H;  4R1J A;  1PH9 A;  4WJ3 M;  1XNR L;  1N34 Q;  1JT8 A;  2ALY B;  3HOU H;  2Z0S A;  1U0L A;  4IPH A;  1MJC A;  4JBJ A;  4AIM A;  4OWT B;  1XMQ Q;  1HR0 Q;  1VQG A;  1SLJ A;  1X55 A;  3RLF A;  3KOJ A;  1L1O B;  2ZJR A;  2UUB Q;  2CFM A;  2WB1 G;  4C3H H;  3BZK A;  4HIK A;  4HIO A;  3GTL H;  2NZO A;  3L7Z C;  4DR5 L;  5IP9 G;  3CC2 A;  1WYD A;  4DV0 Q;  5JJL A;  1G6P A;  4LF5 L;  2LXK A;  4DV3 Q;  5ELN A;  3A74 A;  1ASY A;  1TWG H;  4DR6 Q;  5IYC H;  1OXX K;  2KHJ A;  4A3E H;  4A3J G;  5IT9 c;  2PNH A;  3AQQ A;  5C0X I;  4LF7 L;  1VQF A;  1N33 L;  1KQS A;  4BBS G;  3CD6 A;  3CP0 A;  2JA9 A;  2QA4 A;  1SE8 A;  4JBM A;  2JA7 H;  2I5L X;  1V9P A;  4LW1 A;  2Y0S G;  3I56 A;  2A8V A;  4DV7 L;  2BA0 A;  3J81 j;  3UDG A;  1QVG A;  4JYA L;  1P16 A;  4GLV B;  4IPC A;  3GD7 A;  2K4K A;  1VQ7 A;  1N32 L;  4R4Q A;  3B6Y A;  2N3S A;  1MIU A;  2ZJP A;  1PV4 A;  2K5H A;  3TQY A;  5K36 G;  3K7A H;  1Y14 B;  3S15 H;  2Q2U A;  1XNQ Q;  4GLA C;  2YYZ A;  4A3M H;  4HJ9 A;  1VQB A;  4A3G H;  4XIG S;  4BXX G;  2HHH L;  1OXU A;  3ULL A;  3HKS A;  3PO2 G;  1NTG A;  4OXP A;  3PIO A;  4L5Q A;  3I4N G;  2WP8 J;  2K5N A;  3OTO L;  1XJV A;  3H0G G;  4BA1 I;  1A8V A;  3TS0 A;  2NVY H;  1OXT A;  2AWO A;  1S3O A;  3L0O A;  2JA5 G;  2JJQ A;  1BBW A;  4AQY Q;  3CCM A;  4MNO A;  4YCV A;  2DGY A;  4YCU A;  1Z9F A;  1X3F A;  4PG3 A;  5IWA L;  2F4V L;  1ASZ A;  4B3R Q;  4DR5 Q;  1N8R C;  2BH2 A;  3I4O A;  5EAY A;  4DR2 Q;  3K0X A;  2Q2H A;  4KLK A;  4BA2 I;  2V1C C;  1YJ9 A;  1E7Z A;  2CKZ B;  3RZD H;  4HJ7 A;  4R4C A;  3PV0 A;  1PVO A;  3D31 A;  4C2M H;  1QUQ A;  2VQF Q;  3RN2 A;  4IFD G;  2GVA A;  3KDF A;  4MZ9 A;  2K75 A;  2DUD A;  4JBW A;  4HJA A;  4KHP L;  4LFA Q;  2F3I A;  2JEA I;  3W5O A;  4B3S Q;  1E1O A;  3HOU G;  3F2D A;  1JB7 A;  2ES2 A;  3OW2 A;  3J7A 5;  2L15 A;  4JI1 L;  1X9N A;  3CXC A;  1EIY B;  1JMC A;  1XPU A;  4NXM Q;  1P8L A;  2KCM A;  5IP9 H;  4DUZ L;  3CCL A;  1UEB A;  4PZ6 A;  1YJW A;  4MTN A;  4DR7 L;  3IRB A;  2VQE L;  4UP7 A;  3T1H Q;  4JI0 L;  2HHH Q;  4NB3 A;  2NVQ H;  4A3J H;  3E0E A;  1Q12 A;  2R92 G;  4GNX C;  5C44 G;  3S1Q H;  1S40 A;  4BBS H;  2YV5 A;  4H02 A;  5IYC G;  4A3B G;  2C35 B;  4KHZ A;  1QVC A;  1UE5 A;  3BJU A;  4JOI A;  3PF4 A;  1HNW L;  2I5M X;  4DAY B;  5JEA G;  4A4I A;  4DV2 L;  1VQO A;  1KAW A;  1YNX A;  1YVC A;  3NEN A;  1WOC A;  5LMU Q;  1R9T H;  1UE7 A;  4IFD J;  4YWM A;  1E24 A;  5C3E G;  1CKN B;  3GO5 A;  3J80 i;  4X66 Q;  3T1Y Q;  3U50 C;  4DKA C;  2JA6 G;  4BXX H;  4EQ5 A;  4NXN Q;  2NN6 G;  3I2Z A;  4IPG A;  4JI8 Q;  1VQN A;  2IT1 A;  2N78 A;  2OQ0 A;  2XGT A;  3KF6 B;  4LNQ A;  3PO2 H;  1TWC H;  1IL2 A;  4GLX A;  1Q81 C;  1OXS C;  1FGU A;  3I4N H;  3BU2 A;  1K3R A;  1K83 H;  3ER0 A;  4ME3 A;  2ZTC A;  3I7F A;  4O0A A;  1VQ8 A;  3TS2 A;  2UXD L;  2E2J H;  4GKJ L;  4GKK L;  3CME A;  3CCS A;  2CQO A;  2WAQ G;  2MO0 A;  2EXD A;  2K14 A;  3K80 C;  1IBM L;  2YTV A;  4LF4 Q;  4JI4 L;  2EIF A;  3W1G A;  1QUQ B;  4RMF A;  3UE1 A;  5LMN Q;  1I94 L;  1IYJ B;  4DUZ Q;  4GN4 B;  4IPD A;  4ALP A;  1YHB A;  3VDY A;  2N8N A;  3L2P A;  4OWX B;  1UE1 A;  2VS1 A;  1AH9 A;  1K8G A;  2UUA L;  3HOW G;  4R4O A;  4UY8 C;  5E7N A;  3UE0 A;  1EQQ A;  1SRO A;  1XTD A;  4PZ8 A;  4C3J H;  4X62 Q;  4LFC L;  1KXL A;  2PI2 E;  2WB1 E;  1FJG Q;  4YWL A;  5M5W H;  3CCU A;  4LF6 L;  3MEF A;  4P74 A;  2D62 A;  2N49 A;  3KYH C;  1NY4 A;  3M4O H;  4A75 A;  2K50 A;  1VQJ A;  1GKH A;  1PYB A;  4LF9 Q;  2HQL A;  1XPR A;  4P72 A;  2Q2I A;  3NEM A;  1YI2 A;  4DV5 Q;  4L5R C;  3ZJY C;  4YY3 Q;  2EQS A;  3PUY A;  4IFD I;  3PIP A;  4GN5 A;  1B70 B;  1GO3 E;  1L2F A;  2R92 H;  4LFB Q;  5C44 H;  2UXC L;  3PO3 G;  1QZH A;  3KFU A;  4AH6 A;  4A3B H;  1XMO L;  1PH2 A;  2R93 G;  2B29 A;  1NBW A;  2UXB Q;  4DV1 L;  4LUZ A;  1HZC A;  2YU9 H;  4LF8 Q;  4X64 Q;  2OWO A;  3S1M H;  5GAD C;  1TWH H;  1RIP A;  4JI2 L;  4JI4 Q;  4DUY L;  4JI3 L;  4DV4 Q;  4DAM A;  5C3E H;  2R7D A;  1N36 Q;  2JK8 A;  1N9W A;  2JA6 H;  2K52 A;  3JC6 6;  3U4Z A;  1OXV A;  2E2H H;  1VQH A;  1BVS A;  2E2I H;  1GM5 A;  1U5K A;  1VQK A;  3U58 A;  4LFC Q;  1JJC B;  1YHQ A;  1M1K C;  3A5U A;  1Q8K A;  2JQO A;  1LUZ A;  1K73 C;  1VQI A;  3GTM H;  1XNR Q;  1HZA A;  2ZM6 L;  1LM0 A;  3KJP A;  2UU9 L;  3EN2 A;  1Q86 C;  4IJL A;  2PMZ E;  1WI5 A;  2AMC B;  1WJJ A;  4C3I H;  2MQH A;  1PH4 A;  2NN6 I;  1KD1 C;  1PH6 A;  2NVX H;  3CCJ A;  4DR1 L;  4XTC S;  2XTI A;  4DV6 L;  2R6G A;  1NJI C;  4JI6 L;  3AFP A;  2H5X A;  3K8A A;  4POG A;  2JA8 G;  1D8L A;  3LGJ A;  3A5Z B;  4FDB A;  3HOW H;  1SFO H;  1HNX L;  4LF5 Q;  2VY3 A;  4B3T L;  5AJ3 L;  1VQ6 A;  1YJN A;  1Q82 C;  4JI5 L;  1IBL L;  2ZTE A;  1BBU A;  3KLW A;  1YEZ A;  4QL5 A;  3RNU A;  1N33 Q;  4LF7 Q;  2OTJ A;  1UE6 A;  2LXJ A;  3BZC A;  4GOP C;  1OTC A;  4K0K L;  4OO1 G;  4DNI A;  1GVP A;  4DV7 Q;  1JJ2 A;  4JI7 L;  3NBH B;  4JYA Q;  4HJ8 A;  1N32 Q;  1SRU A;  3PF5 A;  5M3F G;  4A3L H;  5DLQ E;  1PH1 A;  4L5S A;  4DR4 L;  3TRE A;  2E8G A;  2RHS B;  3M4Q A;  4P73 A;  1V1Q A;  2PQA A;  3S1R H;  1JJG A;  4OX9 L;  1YIT A;  3PO3 H;  4AYB E;  5JJI A;  1X3G A;  1KC8 C;  1O7I A;  3J81 c;  3FHW A;  4YHH L;  1VQL A;  2R93 H;  1VQ5 A;  1UWV A;  3UDF A;  4PZ7 A;  1I50 H;  1Q46 A;  4OON A;  2ZM6 Q;  4JV5 L;  1NE3 A;  4IJH A;  3J80 c;  3OTO Q;  3G6E A;  4GNX A;  4A3I G;  3G71 A;  1HNZ L;  2HT1 A;  5GQO A;  4DK3 C;  2MNA A;  1KHI A;  5M3M G;  1CSQ A;  2BA1 A;  4BBR G;  4NPS A;  1SMX A;  4QY7 A;  3CF5 A;  3J81 i;  5IWA Q;  2F4V Q;  3M9B A;  1IZ6 A;  2RCN A;  2MFI A;  1G29 1;  3FKI G;  3HOX G;  3I4M H;  1M90 C;  2WAQ E;  3PUX A;  1IBK L;  3PSI A;  3HOV H;  4EX5 A;  4B3M L;  3ULP A;  1L1O C;  1KL9 A;  4A3D G;  2VNU D;  1TWF H;  5IYB G;  3NEL A;  2R7Z H;  1PH3 A;  3H15 A;  4KHP Q;  5HY6 A;  1MKH A;  1N34 L;  1QVF A;  5M5X H;  2FXQ A;  2Z6K C;  5FLX c;  3E9H A;  4POF A;  1VQC A;  3ICE A;  1J6Q A;  2AWN A;  4JI1 Q;  1K8A C;  1XMQ L;  4UP8 A;  1HR0 L;  1YHA A;  4X65 L;  3KDF B;  4QJF A;  2JA8 H;  5FLM G;  3D0F A;  3ERS X;  1W3S A;  2YTX A;  3CCE A;  2VUM G;  2UUB L;  4DR7 Q;  4JI0 Q;  2VQE Q;  3STB D;  2GN5 A;  4IOA A;  4HJ5 A;  4R4T A;  3CQZ H;  3STB C;  2OTL A;  3W1B A;  1Y1W G;  4DV3 L;  4DK6 C;  3PGZ A;  2AHO B;  4DR6 L;  2BH8 A;  5C0X J;  3GTJ H;  2Q2T A;  2A19 A;  1YBY A;  2HIV A;  5GAH C;  4IO9 A;  1C0A A;  1LYL A;  4JBK A;  4YCW A;  2PQA B;  1X54 A;  5H1S E;  1HNW Q;  5M3F H;  1PA6 A;  2PI2 A;  3J7Z C;  3PUW A;  4DV2 Q;  4A3K G;  1A63 A;  1B7Y B;  1I5F A;  4YWK A;  4A3L G;  2RHQ B;  3E9I A;  1SN8 A;  1HZB A;  3DM3 A;  5GAG C;  5FJ8 G;  2Y0S E;  3DLL A;  1GD7 A;  1NMG A;  5IE8 A;  3HFZ B;  3CC7 A;  3CCV A;  4OO1 I;  5GAE C;  4JG2 A;  2B3G A;  4QQB X;  1YZ6 A;  1VS0 A;  2F52 A;  3PUV A;  4APV A;  1FL0 A;  4A3I H;  2OCE A;  1CKO A;  2KHI A;  5M5Y H;  2CWP A;  3GTQ H;  4BY7 G;  2UXD Q;  1CSP A;  4GKJ Q;  3CPW A;  1PH5 A;  2WFW A;  5M3M H;  4GKK Q;  3JAM i;  2QEX A;  1D7Q A;  2D0P A;  2IX0 A;  2GVB A;  4JCV E;  4BBR H;  4QGU A;  1HR0 W;  1IBM Q;  3HOZ G;  4A3F G;  2B63 G;  4AQY L;  1PHJ A;  4X65 Q;  3H3V H;  1I94 Q;  3FKI H;  5IP7 G;  3HOX H;  2OQK A;  3HKZ G;  3KF8 B;  5GRO A;  1Q7Y C;  1QZG A;  1J5E L;  4A3C G;  2KCT A;  3I55 A;  4O2D A;  3RLO A;  4B3R L;  2UUA Q;  1VQE A;  3I4M G;  4BY1 G;  4DR2 L;  1E3P A;  4A3D H;  3HOV G;  5IYB H;  1X3E A;  3G4S A;  2ATW A;  4LUO A;  1C9O A;  4LF6 Q;  1FVI A;  1EIF A;  2VQF L;  1VQP A;  3H3V I;  2R7Z G;  1H95 A;  4A93 G;  5BR8 L;  1SR3 A;  3FP9 A;  1E1T A;  3GTO H;  4LFA L;  4B3S L;  2K5V A;  3HOY G;  3OYY A;  1NMF A;  3SGI A;  1JE5 A;  5FLM H;  2VUM H;  4P71 A;  4NXM L;  3ULJ A;  3UDI A;  4Y7N H;  1Y1V G;  2E5L L;  1TXY A;  4L5T A;  1AE2 A;  1Y1W H;  2UXC Q;  3A0J A;  4UPA A;  3T1H L;  2VZA A;  3AEV A;  2LSS A;  1DGS A;  1XMO Q;  3PUZ A;  4DV1 Q;  1EWI A;  4P75 A;  3GTP H;  1RL2 A;  1EQR A;  1I3Q H;  1YIJ A;  1CKN A;  3RZO H;  4A3K H;  4JI2 Q;  4GOP A;  3GDE A;  4DUY Q;  3KF6 A;  3K7U C;  1HJP A;  4JI3 Q;  5ELO A;  3MXN B;  3F8T A;  2NZH A;  2QGQ A;  5C4X H;  5FJ8 H;  1L0W A;  5LMU L;  3PCO B;  1J5E Q;  1EYG A;  3AFQ A;  4X6A H;  2I0Q A;  3AYH B;  2D0O A;  2JEB I;  1T9H A;  4X66 L;  1KRS A;  3T1Y L;  2AKW B;  1Q1B A;  4NXN L;  2I5H A;  5IYD G;  4JI8 L;  3RR5 A;  1CKM A;  2HIX A;  4DR3 L;  4BY7 H;  3EBE A;  2UU9 Q;  4Y52 H;  2KEN A;  2A1A A;  4UP9 A;  5BR8 Q;  1B8A A;  1VQ4 A;  2IY5 B;  1WCM G;  1A62 A;  1KRT A;  2UUC L;  3HOZ H;  2R7F A;  1PFS A;  1BKB A;  4A3F H;  2B63 H;  3S2D H;  4DR1 Q;  5IP7 H;  4LF4 L;  2ID0 A;  3EIV A;  3G48 A;  4KI0 A;  4RG1 A;  5C0X G;  4DV6 Q;  4A3C H;  2VL6 A;  5LMN L;  4JI6 Q;  2E5L Q;  1CUK A;  1PYS B;  3UDX A;  1MJE A;  1VQD A;  1HNX Q;  1X56 A;  3CAM A;  4B3T Q;  5AJ3 Q;  4BY1 H;  3F2B A;  4JI5 Q;  1IBL Q;  3WWV A;  4JC0 A;  2JE6 I;  4JOI C;  1EUJ A;  4X62 L;  1X65 A;  4A93 H;  1EOV A;  1FJG L;  1L1O A;  4A3E G;  3CCQ A;  4K0K Q;  3CW2 C;  1PH8 A;  1Z47 A;  4JI7 Q;  2IHF A;  1VQA A;  3Q8D A;  2JA7 G;  3M85 A;  3HOY H;  2MO1 A;  3F1Z A;  4R4I A;  5HGQ A;  3CCR A;  4LF9 L;  3RN5 A;  2ZJQ A;  1VCI A;  3F2C A;  4DR4 Q;  2Z6K A;  4AYB G;  4HIM A;  4LUV A;  1V43 A;  1K0R A;  4DV5 L;  1A0I A;  1Y1V H;  4QIW E;  4YY3 L;  1K9M C;  3S16 H;  3CPF A;  1C7Y A;  4IOC A;  2CCZ A;  5IY0 A;  4PMW A;  1S72 A;  4OX9 Q;  4GOP B;  1I6H H;  1LTL A;  3GTK H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...