2N8NA

Solution structure of translation initiation factor
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
72
structure length
72
Chain Sequence
MAKQDVIELEGTVLDTLPNAMFKVELENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and dynamics study of translation initiation factor 1 from Staphylococcus aureus suggests its RNA binding mode
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus mu50
molecule tags Translation
molecule keywords Translation initiation factor IF-1
total genus 16
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2n8nA00
1VQLA 3J80c 2KBNA 3B6YA 4HJ7A 4JI7L 4A76A 3F8TA 5J3BA 1C7YA 2VUMG 2VNUD 4HJAA 1WI5A 4HJ9A 3CMAA 1GVPA 1C0AA 2ASBA 4YY3L 1N36L 1IBKL 1KL9A 5IWAQ 1E1TA 1TWAH 1QVFA 1A62A 3S1QH 3I7FA 4JC0A 5BR8L 1M90C 3CMEA 1I3QH 4GKKL 1Q82C 1N32Q 2LXJA 4GS3A 5ELOA 4BA2I 4UP7A 3L2PA 3D0FA 5IY0A 1PA6A 3M4PA 3W1GA 4DPGA 1Q86C 3KLWA 5AJ3L 2N8NA 3CPWA 1QZGA 2NVTH 4JI8Q 3J80i 4BXXG 4DR4Q 1SRUA 2QA4A 2KCMA 4DR4L 2XTIA 3GTLH 2D62A 2VW9A 3PUVA 2EIFA 4X65Q 1G291 2MQHA 4B3SQ 2AKWB 3I4MH 1X65A 5K36G 4H02A 4JI3L 1N9WA 4R4QA 4JCVE 3I56A 5LMNL 4GN4B 2R92H 1JJGA 2IHEA 3D31A 3UDIA 4DV1Q 2UXDQ 4DV5L 1S40A 1Z47A 2UXDL 5C0XG 4DUYL 2NN6G 3I2ZA 4GN5A 3BJUA 3HOXG 2KENA 2BH8A 1B7YB 2BA1A 3AQQA 1DGSA 3S2HH 2WP8J 3M3YH 3HOUH 1FGUA 3HOYG 2Q2UA 2CKZB 2F4VL 4O2DA 3PIOA 3F1ZA 1YBYA 3RLOA 1Q1BA 3ULLA 2F4VQ 2OTJA 3T1YL 2UXBL 1VQ6A 1J5EL 2PQAA 3GTOH 2C35B 3VDYA 3I4NH 2UUBL 1NMGA 3L0OA 1W2BA 4LF6Q 3CCVA 2AMCB 2JK8A 3NENA 3CXCA 2ZJRA 1KRTA 4GLVB 1U0LA 4DUZQ 1BKBA 3J7ZC 3E9HA 1X54A 1YITA 4B3TQ 5IYBH 3PV0A 1VQ4A 3EN2A 2KCTA 3I4OA 3KYHC 3RLFA 4LF4Q 4WJ4A 3HOVG 3F2CA 5IT9c 4UP9A 5IYDH 4IPHA 3DLLA 1XNRL 4TQUS 4OXPA 2E2JH 4DV1L 4R4IA 2ZTCA 1HZCA 3RN2A 1HNZL 3S14H 2NVXH 3S16H 2N78A 2OCEA 4KI0A 1IXRA 4BBSH 2YYZA 4JOIC 3U50C 4DV6Q 1A63A 1XPOA 3H0GG 4LFCQ 2B29A 4QQBX 1EOVA 3HOVH 1VQBA 3ZJYC 4JI4L 1WJJA 1TWGH 1PFSA 4OONA 3CW2C 4IPCA 1YVCA 4HJ8A 1UE7A 4A3BH 4WJ3M 2UXCL 1FJGQ 1E7ZA 2YTVA 4LWCA 4DR3L 1GM5A 1VQ7A 4DV0L 3CC4A 1XNQL 4APVA 2I5LX 2I0QA 1L1OC 3BU2A 4DK6C 4XTCS 4LF9Q 3A74A 1J5EQ 3E9IA 3FP9A 4JI3Q 2CCZA 4X65L 1VQ8A 3OYYA 2CFMA 1VS0A 3ER0A 2CWAA 1VQGA 3A0JA 1OXSC 3PUYA 4YWKA 1HH2P 2VL6A 4UP8A 1HZ9A 2R7FA 1NY4A 3I55A 1MJCA 1SMXA 1VQNA 1A8VA 4P72A 1KC8C 1Q81C 2UUAL 2AHOB 4DV2L 2K50A 2MFIA 1Q8KA 2PI2E 2Z0SA 4JI0L 1IBLL 1HNWL 4JG2A 2VUMH 3U4ZA 3KDFA 3S1MH 3NEMA 1JE5A 3BZCA 1PH2A 1EQQA 1V1QA 3K81C 1HR0Q 1PH8A 4B3RL 1MIUA 1YJWA 3PF4A 1KXLA 2CWPA 3LGJA 1T9HA 3CF5A 4B3ML 4LF9L 1A0IA 4GOPC 3EIVA 4DKAC 2K5VA 3GDEA 3A5UA 3ICEA 4LF5L 1YHBA 3CCEA 4A3DG 2BA0A 2OTLA 2NVYH 1Y14B 3CP0A 3TQYA 2R6GA 4L5QA 2VQEL 1I6HH 4DR6L 4X62L 1BVSA 2VQEQ 1Q12A 2PI2A 4C3HH 1RIPA 1SR3A 2PMZE 2Q2HA 1OTCA 3KF6A 1EFWA 4IFDI 3ERSX 5LMNW 4BXXH 1HZBA 3CCSA 3FHWA 1VQFA 1W3SA 3L7ZC 5M3FG 4JI4Q 1XJVA 1H95A 2NZHA 4LF7L 4A3JH 3G48A 3T1HQ 4A3DH 1EWIA 4LFCL 4IPDA 4R4TA 3RLNA 3KJOA 3F2BA 1PHJA 5M3MH 1XTDA 1E3PA 4NXNL 3WWVA 5JJLA 3F2DA 4A75A 1CKMA 3HKZE 3PUWA 4LF6L 2MO0A 4PMWA 4OWXB 4L5SA 2R7ZH 4JI1L 3HOXH 5C0XJ 2E2HH 4R1JA 4A93G 4LFAL 3HOWG 1L1OB 4JI2Q 1YJ9A 4A3JG 1HR0W 2E5LL 4GKJL 1NJIC 3CCMA 4LF7Q 1N33L 2HIVA 4KLKA 1K9MC 4JI2L 1P16A 5C4JH 1PYSB 1N33Q 3PO3G 4JI6Q 4DR7Q 1Q7YC 4QIWE 4GNXA 2FXQA 2ZJPA 4RMFA 3I4NG 1LYLA 1K0RA 2RF4A 4LUZA 4AH6A 2MNAA 2R7ZG 4PZ8A 1E24A 4GLXA 1EQRA 2QGQA 1NE3A 2JQOA 2OQKA 2XGTA 4A93H 2ZM6Q 2VQFQ 3HOWH 3K0XA 4A3CH 2N49A 3UE1A 1K83H 3NBHB 3GO5A 1VQAA 5IYDG 2K52A 4BBRH 1WFQA 1PH3A 4JI8L 5IP9G 4HIOA 2Y0SG 4OX9Q 1FVIA 1R9TH 2IT1A 3J81i 1YZ6A 3NELA 1PV4A 4JBJA 4KHPQ 1K73C 4J15A 4BA1I 1VQ9A 1PH6A 3H0GH 4JI7Q 5LMNQ 1IBMQ 2B63H 2RCNA 2WAQE 1OXXK 2ZTEA 1PH5A 4FDBA 1KAWA 1YNXA 4OO1I 4UPAA 5C3EH 2VY3A 4GKJQ 1N34L 5HY6A 1VQOA 2B3GA 3K7AH 4OWWB 4Y52H 5JJIA 4QGUA 1OXVA 4POFA 4RG1A 1CKOA 1O7IA 5IP9H 5IWAL 1EYGA 4GNXB 1Q46A 1RL2A 4QL5A 1MKHA 3M85A 3K7UC 5LMUQ 3PUXA 4YWLA 3H3VH 1N36Q 1IBKQ 3MXNB 2UU9L 2IHFA 5JEAG 5M5WH 3RZOH 1UWVA 3CCUA 4BY1H 3J81j 4DR5Q 3H3VI 1V9PA 3T1YQ 2B63G 2OQ0A 4DR5L 5FLXc 1HNXQ 5C3EG 5IYCG 4YHHL 4GLAC 3S17H 3TS2A 4HIDA 4X6AH 2I5MX 4LF8Q 1NTGA 3ULJA 4DNIA 2NVQH 2V1CC 1BBWA 3M9BA 1QUQB 2OWOA 1VQ5A 5AJ3Q 1EIYB 4LF4L 4P71A 5FJ8G 1QZHA 5C4XG 1VQMA 3A5ZB 3CCJA 4IFDJ 1QVGA 4O0AA 2K4KA 4IO9A 3UDGA 2N3SA 4A3IH 4L5RC 3U58A 4DV2Q 1JB7A 1D8LA 5GROA 4DK3C 1IBLQ 1HNWQ 1AH9A 5IYCH 3GD7A 1X9NA 1HNZQ 4EX5A 4B3SL 4KHPL 1L0WA 4P73A 1QUQA 1N8RC 2PQAB 3PUZA 3GTMH 1LM0A 5DLQE 2DGYA 2ID0A 2IX0A 2K14A 3STBD 1HR0L 2JA5H 1PYBA 5C4XH 2JA7G 3G71A 3MEFA 1I50H 2Q2IA 4JBWA 5JJKA 1XPRA 3GTPH 5M5YH 4A3IG 3M7NA 1XMOL 2HIXA 4GKKQ 3EBEA 1Y1WH 4OO1G 3UE0A 1E22A 1P8LA 3J7A5 1OXUA 4TVAB 3TREA 3CCQA 4DR3Q 2I5HA 1FJGL 1VQJA 3W1BA 4DV0Q 1KQSA 2R93H 1JT8A 3RNUA 5M3FH 4XIGS 1K8GA 1X3GA 3GTJH 2JEBI 4PZ7A 1UE1A 4DR1Q 4A3MG 5H1SE 2JA7H 3S15H 4R4CA 2K5HA 4JI6L 5M3MG 2K5NA 3CPFA 4JI1Q 2GVAA 2E5LQ 1TWHH 4X64Q 3K80C 3PCOB 4X66Q 4R4OA 4DV3Q 1KHIA 1SLJA 4DV3L 1PH7A 1XNRQ 2R93G 2NZOA 4LFBL 1MJEA 4MZ9A 1IYJB 4LUVA 3RR5A 3AFPA 1TWCH 1WOCA 5EAYA 3PO3H 1N32L 3CQZH 2GVBA 3PIPA 1X6OA 3IRBA 2YU9H 2HT1A 3BZKA 4EQ5A 2ATWA 1CSPA 1GD7A 5IP7G 1IL2A 4JOIA 2EXDA 1JJCB 3FKIH 2UUBQ 4B3MQ 1VQEA 4Y7NH 4DAMA 4C3IH 2AWOA 4YCVA 1TWFH 4C2MH 1SN8A 2AWNA 2VS1A 3W5OA 2WB1G 4X62Q 1XMQL 2R7DA 2Q2TA 1PH9A 4PG3A 4A3CG 3JAMc 2JA8G 2F3IA 4IOAA 4DR6Q 4BY7G 4A3LH 2MO1A 3PGZA 1XPUA 1K3RA 1WCMH 2DUDA 2HHHL 1L1OA 2JA6G 4IFDG 2WB1E 1EUJA 4BBRG 4DAYB 1VQKA 5IP7H 3M4OH 4JV5Q 1K8AC 4DR1L 1AE3A 2JE6I 2JEAI 1N34Q 2KHJA 4DUYQ 1VCIA 5C0XI 4YCWA 3DM3A 2UUCQ 1SROA 3AFQA 4MNOA 1NBWA 4DR2Q 4A3FH 1SE8A 4K0KQ 1YHAA 4IPGA 2JA8H 1BBUA 4LUOA 1YI2A 3HOZG 2D0PA 2HQLA 4POGA 2E8GA 2ZTDA 2RHSB 4GOPB 4UY8C 4DV7Q 4LF8L 4NPSA 4LFAQ 3TEHB 4DV7L 3CC7A 4NB3A 1PVOA 5HGQA 2GN5A 2K75A 4YY3Q 2A8VA 4HIKA 2ES2A 1IZ6A 3S2DH 4BY1G 4YWMA 2A1AA 4A3FG 3PO2G 1GO3E 1VQPA 2F52A 2JA9A 1YJNA 4A3KH 4A4IA 3GTGH 3HOZH 4JYAL 4IJLA 2UUAQ 1KIXA 1VQIA 4JI0Q 2JJQA 3RZDH 3KDFB 3Q8DA 2HHHQ 3K8AA 1I5FA 5GAGC 5GADC 2ZJQA 4IOCA 1LUZA 1HNXL 5FJ8H 4PZ6A 1C9OA 1S3OA 5GAEC 3S24A 1ASYA 3OW2A 1U5KA 1VQCA 4LW1A 4AQYQ 3KFUA 2CQOA 4DV6L 2LXKA 3PO2H 1I94L 3I4MG 2NN6I 4P75A 4C3JH 1SFOH 4A3KG 4DR2L 1XMQQ 2R92G 1CKNA 1UE5A 1VQHA 2BH2A 2L15A 4OX9L 2UUCL 2IY5B 3KF8B 4AIMA 3E0EA 4LF5Q 3S1NH 2WFWA 4NXML 3G6EA 1AE2A 2WAQG 3OTOQ 2LSSA 1L2FA 3TRZA 1ASZA 2QEXA 4DV4Q 2JA5G 2UXBQ 2Z6KC 4JV5L 4MTNA 1VQDA 3CCRA 1IBML 2H5XA 4OWTB 3HOYH 3PSIA 3HOUG 5IE8A 1YHQA 3HKSA 5GQOA 3J81c 2KHIA 1G51A 1UEBA 2YV5A 4DUZL 1Y1WG 4JBKA 3GTKH 1QVCA 3JAMi 4A3GG 2Z6KA 5LMUL 2YTXA 4DV5Q 1TXYA 3KJPA 5C44G 4X66L 2IX1A 4GNXC 3UDFA 1KRSA 1X3EA 4L5TA 4A3MH 3GTQH 4NXNQ 2A19A 4ME3A 4JBMA 3HKZG 4X64L 4JI5L 5IYBG 1Y1VH 4KHZA 1EIFA 4JI5Q 1KD1C 4HJ5A 1JJ2A 3CD6A 2ZM6L 2VQFL 1WYDA 3HFZB 5JEAJ 4B3TL 1GKHA 4LFBQ 3U4VA 1G6PA 5FLMH 4A3GH 4B3RQ 3CAMA 1LTLA 1X55A 3AYHB 4A3EH 1PH1A 4P74A 1CKNB 4YCUA 1OXTA 5C44H 3G4SA 4JYAQ 3STBC 1E1OA 1NMFA 1FL0A 5GAHC 2EQSA 2PNHA 1HJPA 3JC66 1YEZA 3RN5A 4BBSG 2RHQB 4HIMA 3CC2A 2VZAA 2YTYA 1Y1VG 5M5XH 4ALPA 4DR7L 1B8AA 3H15A 4LNQA 3AEVA 1M1KC 1D7QA 3OTOL 5ELNA 5BR8Q 4DV4L 3FKIG 1J6QA 5FLMG 1CSQA 4AYBE 1YIJA 4A3BG 3TS0A 1Q1EA 4QY7A 4A3EG 1V43A 1XMOQ 4K0KL 3UDXA 2E2IH 1HZAA 1B70B 3S1RH 1I94Q 1JMCA 4BY7H 4GOPA 2Y0SE 3PF5A 4AYBG 3ULPA 4A3LG 3KOJA 1XNQQ 4AQYL 1WCMG 1S72A 2UU9Q 2JA6H 3SGIA 3T1HL 2UXCQ 3M4QA 4GN3B 2D0OA 5E7NA 1X3FA 1X56A 1UE6A 4QJFA 1CUKA 3KF6B 1PH4A 4YHHQ 1Z9FA 2ALYB 4NXMQ 4IJHA 3CCLA
chains in the Genus database with same CATH superfamily
1K3BC 2KBNA 5LL6X 2SOBA 3DEPA 1WI5A 1IW7D 4FF3A 1GVPA 2L0CA 5CV9A 1HA5A 2ASBA 3RZDB 1EU4A 4NW2A 1EIHA 4YY3L 1WTVA 2F4IA 1IBKL 1KL9A 1O7LA 2EYOA 3DM1A 2E2DC 3BVZA 4R8NA 4ZUIA 4IURA 2OF1A 3KLWA 5AJ3L 2NVTH 4JI8Q 1Y8NB 4K8JA 1CTMA 2ZXOA 4HMJA 3V05A 2RBMA 2XTIA 4DR4L 2D62A 2NYZD 3E5SA 3PUVA 3TSSA 5KYLA 3J7YW 4FF2A 1G291 4B3SQ 3I4MH 1X65A 3PIP3 5LMNL 2A6ED 3X3NA 4G4KA 4CDDC 2UXDL 2NN6G 5CC4A 3HOXG 2KENA 3MXGA 3S2HH 2WP8J 2EY6A 3HOYG 3A7LA 2CKZB 4HCSA 3PIOA 3TBIB 3OMGA 2F4VQ 2UXBL 3T1YL 2AQ3B 4KJNA 3VDYA 1NMGA 3L0OA 3SXHA 3CCVA 3GQBA 2ZJRA 1KDAA 2LKVA 5IYBH 3PV0A 3EN2A 5EKLA 3GV3A 3I4OA 3RLFA 4WJ4A 3HOVG 4KD4A 2MP1A 5EKKA 1UEAB 1XNRL 1PXUA 1EFID 1SNMA 4QB4A 4WFN3 4DV1L 3RN2A 2F3WA 2ZTCA 2F03A 2EYHA 2PZWA 2NVXH 5KNBA 4KI0A 4JOIC 3R93A 1XPOA 3H0GG 4LFCQ 2B29A 2K5WA 1EOVA 1TWGH 1PFSA 1WTQA 1UE7A 4DFAA 5E4XA 2UXCL 1EQVA 4K2LA 5DM73 1FJGQ 2PQEA 1GM5A 1QCBD 1J5EQ 4X65L 1PZID 3OYYA 3C3LA 3ER0A 3PUYA 3VA5A 1OXSC 1EU3A 2VL6A 4UP8A 1HZ9A 1JQYD 1NY4A 2FMCA 3S2HB 1SMXA 1K8MA 4JW0A 1G91A 4DV2L 4C56C 2MFIA 2K28A 2CHBD 5I9OA 3K5MA 2BOSA 4DAYA 3VA7A 1EWCA 5JVH3 3H6MA 3K81C 4TSSA 1MIUA 3PF4A 1F77A 1KXLA 2CWPA 3LGJA 4RKBA 4B3ML 4UDUC 1A0IA 1TIID 4DKAC 3ICEA 4LF5L 2AQ1B 2BA0A 5I4DA 2NVYH 2RSOA 1Y14B 3TQYA 4L5QA 2F3VA 3MZ5A 1JCKB 1J9OA 4C3HH 1B9NA 1OTCA 1I4HA 3ERSX 3S16B 5FO9B 3BVMA 2HDMA 2L9HA 2NZHA 4A3JH 1B50A 3T1HQ 3NWTA 1EWIA 4LFCL 1NNXA 3HOUB 3RLNA 2Z4IA 5A35A 5M3MH 1JC7A 3F2DA 3HKZE 1U4LA 2D5DA 1PTOD 3BS1A 2R7ZH 4JI1L 4R1JA 4LFAL 1HR0W 4A3JG 4GKJL 2E5LL 1N33L 1RF2D 1G8ZD 4DAVA 1K9MC 3HOZB 1P16A 2Z8LA 1PYSB 3ONAB 1K0SA 4QIWE 2FXQA 2WKDA 1D2BA 4DF7A 2R7ZG 4PZ8A 1FGBD 1E24A 4ODGA 1EQRA 2C9OA 2XGTA 2ZM6Q 3HOWH 3VR5A 1STNA 5KRUA 3N52A 2MPMA 4GZYC 3GTPB 4DGZA 5G3LD 5IYDG 4BBRH 3KK7A 1FVIA 1B9MA 3NELA 1PV4A 5JEAH 2L4NA 2KHSA 2RCNA 1OXXK 2ZTEA 2EYMA 1KAWA 1WCMB 4OO1I 4UPAA 4GKJQ 2Z9HA 2B3GA 3K7AH 1NR4A 4OWWB 3NQIA 5JJIA 1D6EC 1HTLD 1SSOA 4POFA 5IP9H 1Q46A 3M85A 5LMUQ 3VYUA 3SEBA 1LLRD 2FINB 2FJ2A 3RZOH 4DR5Q 2OQ0A 4ZUJA 3BDCA 1R4QB 1HNXQ 4OELB 4HIDA 4BY1B 1O7YA 4DNIA 1D5MC 4LF4L 4Y7NB 1MSHA 3A5ZB 3NSWA 4KN7C 3TP5A 4IFDJ 2SNSA 2K4KA 4O0AA 3JAML 1PMRA 4DV2Q 1JB7A 1IBLQ 1HNWQ 3GD7A 4EX5A 1SBBB 1GUTA 1LM0A 2Q8IB 4K5VA 1LTTD 1UNSA 2JA5H 4A3DB 4ILWA 2O4XA 3SK6A 2VB2X 5M5YH 1H9RA 5CR3A 1JWSD 2F0JA 4DU9A 2K03A 2LFNA 2F1MA 4GKKQ 3DXJC 2JA8B 1SJED 1E22A 3W1BA 1KQSA 3E0JA 1UE1A 2JA7H 3S15H 2F0QA 4R4CA 1I4XA 2K5NA 4FXKC 3DEOA 1QWYA 2GVAA 1TWHH 3QB3A 2G9DA 5EGTA 3PCOB 1ET9A 4X66Q 4R4OA 3KLSX 4DV3Q 4G7ZC 1KHIA 1J8IA 2WAQB 2R93G 3SHLA 5JPMC 1MJEA 3HOWB 1IYJB 1JOOA 4CKBA 3RR5A 3AFPA 3I8ZA 3CQZH 4FNFA 5CV4A 4BWGB 3PIPA 4IFDH 4G57A 4PMCA 2C5CA 5FKAC 1CA6A 2EXDA 3FRPB 4ZKCB 4Y7NH 4DAMA 3R3OA 2AWOA 2AWNA 1SYGA 1NCVA 1F2ZA 2VS1A 3S1NB 2WB1G 4X62Q 5E1FA 1XMQL 2Q2TA 1PH9A 4K5XA 3JAMc 1MGSA 1QNUA 4A3LH 4IFDG 1L1OA 3A7AB 1VQKA 1EUJA 4DAYB 4JV5Q 3M4OH 5CV8A 3T13A 4DR1L 2QKIC 3SK8A 4PV1C 1MD2D 4HN7A 1U4PA 2UUCQ 4RGMA 3I90A 1NBWA 4A3FH 1ZEQX 1YHAA 4IPGA 1AW7A 2JA8H 1BBUA 1YI2A 2D0PA 3NWSA 2K7VA 4UY8C 5J22A 4NPSA 2EJMA 4FO2A 3NBIA 4DV7L 4IZ8A 2K75A 2A8VA 2QILA 1PFNA 4A3GB 2ES2A 2EVBA 4YWMA 1A3TA 4A3FG 5BN3A 2F52A 2JA9A 1EEFD 2EYFA 4JYAL 3GTGH 2UUAQ 1KIXA 1WTHA 1SYFA 1FNWA 3EA6A 1I5FA 4DA2A 4DNRB 1ILPA 1HHVA 1ZKOA 1C9OA 1DM0B 1S3OA 1H9JA 1BR9A 1FYCA 5JVG3 3KFUA 1GUWA 1I4QA 2LXKA 3P20A 2CW0C 4KMUC 5ELEA 1SFOH 4A3KG 4UAIA 2R92G 2F0MA 4OX9L 1GUNA 4AIMA 4LF5Q 3S1NH 2EYJA 3OSOA 2QW7A 1AE2A 1NUCA 1TWFB 2WAQG 4C2MB 2LSSA 1L2FA 2DNEA 3TRZA 2R93B 4MTNA 2K1BA 1YHQA 3SK4A 5GQOA 1G51A 4JBKA 2F0VA 4OO1H 1QVCA 4RKLA 1CA5A 4DV5Q 1CZWA 4GNXC 1KRSA 4O1NA 1X3EA 3A56A 4A3MH 1S4ZA 4NXNQ 4ME3A 1Y1VH 2X69A 4JI5Q 1KD1C 1TT2A 4X3TA 3CD6A 4KY7A 3I3CA 1WYDA 4C3IB 4B3TL 2PPBC 2EZVA 2A69D 1GKHA 2R61A 3FKIB 1PH1A 1X55A 1SE2A 1CKNB 4NP5A 5GAHC 2PNHA 1HJPA 1TS3A 1I6HB 3RN5A 4HIMA 1TY2A 1Y1VG 3H15A 1AZPA 5BR8Q 4DV4L 2ZT9C 2E2IB 1ESFA 1J6QA 1HFNA 4A3BG 3K7AB 1Q1EA 2MUYA 1STBA 1XMOQ 4BBSB 2DJFC 2RSNA 1I94Q 2B8GA 3PF5A 3KOJA 3OHXC 4AQYL 1XNQQ 2JA6H 1DCZA 3WOFA 1RJTA 3M4QA 4GN3B 3I4NB 1X3FA 2EDGA 3QR8A 1Q90A 3KF6B 4A3BB 1A6XA 4IUQA 3Q24A 1VF7A 1GUSA 3B6YA 2VNUD 3F8TA 5J3BA 4DNTB 4MN3A 5DEHA 4EQPA 3J7AV 1C0AA 1V8QA 5C6AA 3TP6A 3DMUA 3SVMA 5IWAQ 1E1TA 1QVFA 1PZKD 2E74C 2B2YA 5BR8L 3MAQA 3CMEA 1Q82C 4GS3A 4OL7A 2A68C 3L3OC 4BA2I 3Q0AA 4UP7A 5CMDA 3ITPA 3D0FA 1R9TB 1I3QB 3QO2A 3M4PA 3W1GA 1Q86C 4EVOA 2JN4A 2XSCA 3CPWA 1JWMD 1QZGA 4DR4Q 2F0TA 1SRUA 4AYBB 5IGCA 2VW9A 1HRJA 1JE4A 3DWAA 2BDOA 2MQHA 1SNQA 2AKWB 4JI3L 3WOEA 1N9WA 3I56A 4JCVE 1JJGA 4TKOB 4DV5L 2O5IC 1Z47A 2IPKD 5C0XG 4DUYL 3PMFA 2CH4W 4DK1A 2BA1A 3R2TA 1LTBD 1FGUA 2Q2UA 3E6ZX 3F1ZA 3ULLA 2F0UA 3GTOH 5ELBA 1STYA 2NN6H 2JK8A 2ENBA 1KRTA 4GLVB 3NXWA 1BKBA 3J7ZC 1YITA 2NVYB 2KCTA 3A54A 4LF4Q 3RD4A 2LS01 3I72A 5I9PA 2IX3A 3KUPA 4IPHA 1IYUA 3DLLA 3MFYA 4OGQC 4TQUS 3HEJA 4K6DA 1VMCA 3S16H 2RQXA 1IXRA 5CBAE 3U50C 1GJXA 1ML0D 1A63A 2B8FA 5DM63 2B2WC 3HOVH 1VQBA 2CH4A 2XRQD 5T1GA 3ZJYC 4KKUA 1YVCA 4RWSC 1D1IA 2R7ZB 1E7ZA 4GKKL 4LWCA 3CC4A 4DV0L 2I5LX 2I0QA 1L1OC 3BG3A 1IYVA 3E9IA 3FP9A 2CCZA 1AP0A 2F0NA 3A0JA 4LF7Q 2NB0A 3G6JB 4FP5D 1H9SA 1F2YA 4P72A 5C3WA 1KC8C 2PZUA 2AHOB 1LTID 2Z0SA 1G2TA 4JG2A 4RH6A 2VUMH 1ONLA 3U4ZA 3NEMA 4XQJA 3NTIA 1JR0D 4HCEA 2F0FA 4FYDA 2HD3A 3BZCA 5I2XA 1CK1A 1EQQA 1HR0Q 1PH8A 3T16A 2F0LA 1T9HA 1PRTB 2N88A 1SNCA 2K5VA 5ELCA 3A5UA 4U673 2VQEL 3I4MB 3URYA 4X62L 1BVSA 2PI2A 1G2SA 1SR3A 1ICWA 1AN8A 2Q2HA 5D65A 1RTOA 4IFDI 1QILA 2L11A 2B2UC 1LTRD 1F9PA 2E2JB 3FHWA 3GTMB 2RA4A 4XQQA 1H95A 1XJVA 3G48A 3RMHA 4IPDA 1SE3A 1SEBD 1PHJA 1O78A 1A3UA 1E3PA 1I50B 1Y1VB 4IUNA 4A75A 1C8CA 2SNMA 1BNZA 2Q8TA 1DYQA 4L5SA 3HOXH 5C0XJ 5F2DA 5ELFA 1V1PB 1L1OB 4JI2Q 5JPNC 3CCMA 3GTGB 4JI2L 2RKSA 4JI6Q 2A69C 4GNXA 1E2VA 3I4NG 1KNAA 5C5MA 4N9TA 2B2VA 2RF4A 3H09A 3NUCA 2XIWA 2VQFQ 1FR3A 3K0XA 2N49A 1B1ZA 3ERQA 3SE0A 3GO5A 2K52A 1PH3A 5A2QL 2PW7A 2Y0SG 1I4PA 1PTOF 3J81i 1YZ6A 2J0TD 4JBJA 4RFBA 1K73C 1LTAD 1PFBA 4BA1I 1VQ9A 1HQMC 1C48A 3H0GH 4JI7Q 5FOBB 1PTOB 1PH5A 1YNXA 5C3EH 2VY3A 3W2DA 2DY7A 5HY6A 1N34L 4KD3A 1EYGA 1CKOA 2A6HC 3TDQA 5IWAL 4ZK9B 4KV6A 4QL5A 3K7UC 5IGDA 4YWLA 1HA6A 4C1NI 1N36Q 2UU9L 3MXNB 3L9AX 2IHFA 5JEAG 3J81j 3H3VI 3CQZB 4DR5L 3TN2A 1DJRD 2PYKA 2M2LA 1S5FD 2LY7A 1KDCA 1NTGA 2NVQH 1EL0A 1T5EA 2OWOA 2K01A 5FJ8G 1QZHA 4FF1A 3CCJA 5C4JB 1Y8OB 2N3SA 1QE6A 3U58A 2K04A 1K28A 2XWJB 1YNJC 1B44D 1X9NA 1U9RA 4H13C 1V1PA 3C1FA 2A5HA 5DLQE 3BDOA 4I7ZC 3STBD 5FLXL 4Z9CB 1PYBA 2EE1A 4A3FB 4PQXA 4ZLTF 4PNYA 4JBWA 1S5BD 4FF4A 1HFGA 3M7NA 5EPJA 3LWUA 3D4RA 3UE0A 2K6AA 4TVAB 3CCQA 2I5HA 1VQJA 5M3FH 4IUVA 1K8GA 2JEBI 3J7AF 4PZ7A 1II3A 4DR1Q 1GUOA 5JJZA 3EROA 5C3EB 2K5HA 1LT4D 1PTOC 3GTJB 2E5LQ 4J6HA 5LL6S 2PO4A 3F2UA 2A74C 1JOKA 2DNCA 2F0KA 2RDGA 4DN4M 4OIKA 4MZ9A 4L63B 1K83B 3IAYA 1GHJA 5C5LA 4C1NK 1X6OA 4EQ5A 2ATWA 1GD7A 5IP7G 1FNVA 3NE5B 4BBRB 5KNCA 1D5XC 3OWFA 4OIJA 5CV7A 1KABA 3W5OA 2WIIB 1PZJD 4PG3A 1RHPA 5KEEA 1XPUA 1SE4A 1WCMH 3H3VC 3K5NA 1EZ8A 2KUMA 5FO8B 1LTSD 4DUYQ 1VCIA 5C0XI 2B2WA 4YCWA 3QOLA 1SROA 1TY0A 3AFQA 4K0KQ 3RZOB 4DK0A 4RCOA 2TMPA 2RDFA 1ENFA 3QG1A 4POGA 2ZTDA 2RHSB 3S2DB 4LFAQ 3TEHB 1MI2A 2GN5A 3V96A 4HIKA 1IZ6A 4LJZC 1VQPA 1S5ED 4A4IA 2PNRC 4IJLA 1NR2A 1VQIA 2F0OA 4JI0Q 1TKWB 3RZDH 3KDFB 2NVXB 2ZJQA 5GADC 4IOCA 4PZ6A 5GAEC 3S24A 1ASYA 3OW2A 1U5KA 2IJ0A 3CHBD 2CQOA 1EZ6A 5EBCA 4KY6A 4U68A 2IY5B 1Z6HA 1UE5A 4CKCA 2UUCL 2CQAA 1DXMA 1XTCD 4RGNA 5D3DA 1EY0A 3M7GA 3QWNA 4C3JB 2JA5G 2UXBQ 1JORA 2Z6KC 4JV5L 3CCRA 1Q8IA 1IBML 3HOUG 3PSIA 1W6KA 3GTKH 1STHA 1Y1WG 4A3MB 3JAMi 3R8BA 5NUCA 3MTSA 5LMUL 1BCPF 2YTXA 3I70A 4HAEA 4RAUC 2IX1A 4X66L 3AB9A 1PLFA 2XNAC 3M3YB 2I46A 2P5ZX 5JOBA 4KHZA 1EIFA 4IUPA 4HJ5A 4H7BA 3DUZA 1SMYD 5FLMH 3CAMA 1LTLA 3O13A 3JAME 2JYOA 3GV6A 3G4SA 2K33A 2Z1CA 5J1ZA 2EOTA 1PRTF 2O2LD 1BO0A 5M5XH 4ALPA 2QEJC 1D7QA 5ELNA 3FKIG 3TP8A 5FLMG 1CSQA 1L0XB 4LAAA 4QY7A 1SNPA 4WJWA 3IL8A 3H94A 3KLRA 4L8JA 3S1RH 3LNNA 5KYIA 3MHBA 4BY7H 2EY1A 2Y0SE 4AYBG 4A3LG 1JB3A 2K5QA 1DZ1A 3SGIA 4CJ2C 1SNDA 2HCCA 2IL8A 1R4PB 1F2MA 1X56A 5BN4A 1UE6A 4QJFA 5KIXA 4IJHA 4QMGA 5COYA 1VQLA 1LT3D 4ZYSA 3G7LA 1C7YA 4K2KA 1ET6A 2JXMB 4HJAA 4HJ9A 3I73A 3A8KE 1N36L 2K5DA 1TWAH 1M8AA 3I7FA 3NK9A 4JC0A 1H9KA 1M90C 1I3QH 1N32Q 2LXJA 5ELOA 3QOJA 3D4DA 4DAPA 3S17B 4J1MA 4MTKA 5IY0A 4DPGA 4P2CB 2N8NA 4IALA 3J80i 4BXXG 3OMCA 1LO5D 3FPPA 2KCMA 4NKLA 1EYCA 2EIFA 2EXZA 3K5OA 4K14A 1LTGD 1TS2A 5C4HA 4X3KA 4CGYB 5K36G 5LHY1 4GN4B 2R92H 3NPPA 4DV1Q 4QIWB 4C3HB 2QCPX 3I2ZA 2SEBD 3BJUA 1STGA 2Z4HA 2BH8A 4B9XA 3AQQA 1DGSA 3M3YH 2F4VL 2B2UA 4O2DA 3RLOA 1Q1BA 2EYPA 4EQOA 2OTJA 4FVMA 1AFPA 2PQAA 5ELDA 2C35B 4F88A 3HG9A 4IN3A 2UUBL 2KCNA 1W2BA 2B39A 2AMCB 1MSGA 3NENA 4I7AA 4DUZQ 1U0LA 3E9HA 3SK5A 3HGBA 1VQ4A 4NDXA 1A2UA 3KYHC 2IWHA 5HURA 5IT9E 3DWQA 3CRLC 5IT9c 4UP9A 1HUMA 1HTPA 1RD9D 1BBXC 3TP7A 4OXPA 2E2JH 3H91A 1HNZL 1HZCA 3KBGA 3HOVB 1O7ZA 2OCEA 4BBSH 4XDXA 2QDLA 4DV6Q 2J7ZA 3K5LA 4JI4L 2EJGC 4OONA 4IPCA 4HJ8A 4A3BH 4CBVA 1I6VC 4WRDA 4DR3L 4APVA 3K6OA 4XTCS 3A74A 3M4YA 3IFDA 1D5ZC 2M00A 1VS0A 5D14A 4YWKA 3PIO3 2AQ2B 4N8FA 1HH2P 2R7FA 1EYAA 2RDHA 1B53A 1SYDA 3I55A 1VQNA 2PZTA 1EY6A 1Q81C 2UUAL 2N55A 1IKLA 5I6WA 1IBLL 1HNWL 2O5JC 3KDFA 3S1MH 1JE5A 2RVLA 1JOQA 3GP7A 1IW7C 3CF5A 1SYEA 4OEMB 3GDEA 1YHBA 3T53B 3M4OB 2GA4B 5IODA 4RA8A 2R6GA 3KLSA 2L55A 4DR6L 1Y8PB 2PMZE 3KF6A 5M9OA 3S14B 2Z6BA 3CCSA 3NHHA 1VQFA 1CI3M 1W3SA 3L7ZC 2Y0SB 4LF7L 3KJOA 4R4TA 2OXPA 1E0BA 1XTDA 1ESRA 4NXNL 4FXGC 3WWVA 5JJLA 2NTSA 3PUWA 4UHVA 2MO0A 3MA2B 2NVQB 1QG7A 2E2HH 1TQOA 1ENCA 1GXDC 1W6JA 3NTKA 3OIPA 4K5WA 4XT1B 4A93G 3K57A 2FMMA 5L37A 5IGBA 2HIVA 5C4JH 1I4GA 3PO3G 1PRTD 4DR7Q 1Q7YC 1YNNC 4AH6A 1Z7TA 2F0SA 2QGQA 2OQKA 3FPUB 1ZXTA 3HP3A 1EQTA 3OIQA 3P75A 4JPBW 3Q23A 2TSSA 4A3CH 3UE1A 1YNND 3NBHB 3HRZC 4QUFA 2AUKA 2Q8RE 1WTRA 1WFQA 1K8OA 4JI8L 5KNDA 4HIOA 3SR1A 3D8GA 2G9HD 1PH6A 3S15B 4F87A 1IBMQ 2B63H 4FDBA 4ZQ3A 5HGTA 2KVMA 1QJOA 3RUZA 4Y52H 4QGUA 4RCNA 4R8IA 4R9WA 1O7IA 4K8IA 4GNXB 3H3VH 1MKHA 3PUXA 2HUGA 1SXTA 4A3JB 1RKNA 1UWVA 4BY1H 2B63G 5C44B 5FLXc 4XYOA 3S17H 5C3EG 5IYCG 3TS2A 1HQRD 4GLAC 2E2HB 4ABNA 3VR3A 5IIFA 4X6AH 2I5MX 4LF8Q 3ULJA 2V1CC 1EY9A 3M9BA 1VQMA 2ICIA 2NUCA 4IO9A 3UDGA 4A3IH 4L5RC 3TMEA 1D8LA 1AH9A 5IYCH 4KHPL 3GTMH 1QUQA 2PQAB 4A93B 2IX0A 2LMCB 2X6LA 3TZUA 1X3QA 1I50H 4F7XA 5JJKA 1SMYC 4CDEC 5CYUA 1XPRA 3GTPH 4A3IG 4M8AA 1B2TA 2HIXA 3EBEA 1O80A 4OO1G 4JVZA 5C4XB 2ZXRA 1JT8A 1FJGL 1SDFA 4DV0Q 3CU7A 4RGOS 1X3GA 3FVQA 3GTJH 1WD0A 2HQEA 4A3MG 2MJ8A 5KGUA 4ZRZA 5H1SE 5M3MG 4JI1Q 1RCVD 3K80C 4Q5VA 4C3IG 1SLJA 1PH7A 2MHVA 1XNRQ 3VR2A 2NZOA 2I07B 4J8QA 5EPLA 1N32L 1IKMA 2GVBA 2YU9H 3IRBA 2HT1A 3BZKA 1EWHA 2F0DA 1IL2A 5DNFA 4JOIA 4B3MQ 1VQEA 4C3IH 1XX8A 4A3EB 5CV6A 1TWFH 4C2MH 1SN8A 4N9PA 1HUNA 1CQVA 2PMZB 2R7DA 2F3IA 4IOAA 3MXUA 4DR6Q 4M1UB 3PGZA 4MHEA 1K3RA 2DY8A 2DUDA 4HEDA 2HHHL 2WB1E 4BBRG 5IP7H 1K8AC 1AE3A 2JE6I 2JEAI 2KQ3A 1N34Q 1GUGA 4HR7B 1XWEA 4E6IA 4LUOA 3HOZG 1LV9A 2HQLA 3HKZB 2A6EC 4GOPB 4DV7Q 4LF8L 1PRTC 1A3VA 2L1BA 1DOLA 2EYLA 3CC7A 4NB3A 1PVOA 5HGQA 1B3QA 2KEDA 4XXEA 2M9VA 2JA7B 3J81L 3PO2G 1GO3E 5FK9C 3Q8DA 2HHHQ 5GAGC 1HNXL 5FJ8H 2DN8A 3K0YA 1RODA 2HCIA 4B08A 1TVXA 3PO2H 1I94L 3I4MG 1Q3LA 4C3JH 4KN4C 3OW7A 2BH2A 3K59A 2F0GA 3KF8B 2NVTB 2WFWA 5C0XH 1IL8A 3A8IE 4NXML 3C46A 1ASZA 2QEXA 2MGSA 1VQDA 3FDTA 2H5XA 3HOYH 5CORA 1EOTA 2D9UA 1BUVT 3J81c 2PW5A 2Z6KA 3AMUA 1TXYA 1HCZA 1PDQA 1GOZA 3UDFA 3S1MB 4L5TA 3GTQH 3VR6A 2J4XA 3HKZG 1U4MA 4JI5L 5IYBG 2KA7A 2D2CC 2VQFL 5JEAJ 3A8JE 1IHZA 3QJYA 2DJGC 1G6PA 1JWUD 3EFXD 3AYHB 4A3EH 4P74A 5M5XB 1OXTA 3STBC 1NMFA 2EQSA 3VYRA 4ULLA 2EY2A 3JC66 1YEZA 1QNKA 3CC2A 3GTLB 2YTYA 3WDNA 1B8AA 1YNJD 3AEVA 1M1KC 2B63B 3OTOL 5E4WC 1WTPA 2BDNA 3Q22A 2E75C 1U4RA 3TS0A 1C4QA 2A68D 4KKTA 4RHSA 3ULPA 1XXGA 1WCMG 1S72A 2UU9Q 3T1HL 2UXCQ 2D0OA 2KCCA 1DOMA 3T56B 5FLXE 1Y1WB 1CFMA 1CUKA 3I91A 5M5YB 4YHHQ 1Z9FA 2ALYB 3C2PA 1HXYD 3J80c 4HJ7A 4JI7L 2A6HD 4A76A 2VUMG 4CDCC 2ZXPA 5M3FB 3CMAA 3J81E 1TWHB 1A62A 3S1QH 1PYWD 1DOKA 5C3XA 1SYBA 3L2PA 1I4RA 3IFTA 2NTTA 1PA6A 2OEOA 3BDLA 3S9WA 4LK1C 2A73B 1TS5A 1TS4A 3LX0A 2QA4A 2WACA 1T5XD 4MIUA 3GTLH 1SNOA 5IT9L 4H0LC 4X65Q 1EY5A 3HOYB 1D1KA 4H02A 4R4QA 2IHEA 3D31A 3UDIA 2UXDQ 1S40A 4LMQD 2X6GA 2JA5B 1PFMA 4GN5A 1B7YB 4FXDA 3HOUH 1TU2B 1YBYA 5AFWA 1ZYRD 5D3IB 1VQ6A 1J5EL 1EEID 1H9SB 3MFGA 3I4NH 4LF6Q 3CXCA 3BYTB 2BE5D 1V1OA 3I4LA 1OO9B 1X54A 4HMIA 4B3TQ 2XVSA 2RCFA 2G5DA 3FEWX 3F2CA 1BCPC 5IYDH 2B2TA 1ZYRC 1F2LA 4R4IA 3S14H 2N78A 1F9SA 2YYZA 3OPOA 3ND9A 1AEXA 1SAPA 2NZ1D 4QQBX 1F9RA 2B2TC 5A2QE 1WJJA 3CW2C 1BXTA 4XT3B 1A2TA 1EIGA 4WJ3M 4KTAA 2YTVA 3ZYYX 1VQ7A 1XNQL 1L0YB 3BU2A 4DK6C 4LF9Q 3MVVA 1BCPB 5CGKA 4JI3Q 5IOCA 1VQ8A 1BDOA 2CFMA 2CWAA 3J80L 1VQGA 4QF4A 5I6YA 3MEHA 1DD2A 1MJCA 1WVLA 1EYDA 1A8VA 1ILQA 1DONA 3LWEA 5EJWA 2K50A 2PI2E 1Q8KA 2AUJD 4JI0L 5JAVA 1FD7D 5M5WB 4KJOA 3VYTA 4YIJA 1LABA 3VYSA 4C3HG 1PH2A 1QOHA 1V1QA 4B3RL 3BVGA 4B9WA 2VUMB 1YJWA 4G7OC 4ME5A 2WINB 2WV6D 3CKIB 5CBEE 5J39A 3D4WA 4GOPC 3EIVA 1WTOA 1MHWC 3CCEA 4A3DG 2OTLA 4H44C 4A3KB 3CP0A 3T51B 1I6HH 2VXWA 5EKIA 2VQEQ 1Q12A 2JP1A 1RIPA 1EFWA 2H4OA 5BN5A 5LMNW 4BXXH 1HZBA 3G6EA 2NWGA 3SDZA 5M3FG 4HTHA 5EPKA 4JI4Q 1X32A 3NP8A 3NQTA 1AZQA 4A3DH 5I2YA 3IKJA 3GTOB 3F2BA 5FO7B 4N8X1 3DWPA 4XQNA 1CKMA 3AU7A 2KEEA 4XYQA 1STEA 2F0PA 2CW0D 4LF6L 3EVQA 4PMWA 4JK1C 4OWXB 4S3SA 1X3PA 4DXFA 2QDBA 3D6CA 3HOWG 1BOSA 1SYCA 1YJ9A 1BF4A 1NJIC 4KLKA 4PMBA 2FFKB 1N33Q 3QIAA 1F9QA 1GHKA 2ZJPA 4RMFA 4KK7A 1KDBA 2F0IA 1LYLA 4CKEA 3Q6SA 1K0RA 4KKSA 4LUZA 2MNAA 4O42A 4GLXA 1KAAA 1E2WA 1NE3A 2JQOA 1WD1A 4A93H 1WTWA 4V0BA 2F0WA 2XWBB 3EJIA 1FNUA 1KLUD 3KF8A 3S1RB 1K83H 1VQAA 1HPCA 3DHQA 4ZCKA 5IP9G 4OX9Q 1LT6D 1R9TH 2IT1A 4WORA 4KHPQ 4J15A 4IUTA 5EQ0A 5LMNQ 2WAQE 2VB3X 4HSVA 1STAA 1VQOA 1KTKA 4IUUA 3FMCA 1OXVA 4RG1A 2EJFC 3J80E 1RL2A 3T4AC 5ISRA 4X3UA 2V4DA 3HZXA 1TWAB 2HDLA 1IBKQ 3S1QB 1BQQT 5M5WH 3CCUA 3PQIA 1V9PA 3T1YQ 2B2YC 2WB1B 5M3MB 5T1IA 5K5PA 1ENAA 4YHHL 4DXGA 1ICFB 1RTNA 3TZDA 3NBHA 1BBWA 1QUQB 1UUPA 5AJ3Q 1VQ5A 1EIYB 4P71A 4KHVA 3MXPA 5C4XG 4L6TB 1QVGA 1RDPD 4ID6A 3BZDB 1LT5D 2E76C 2F0HA 5GROA 4DK3C 5IGEA 1B4OA 4B3SL 1HNZQ 3P7JA 1L0WA 4P73A 1N8RC 2R92B 3PUZA 2EPBA 4CDFC 2DGYA 2ID0A 2K14A 3UI2A 1HR0L 1B3AA 3HS0C 5C4XH 2JA7G 2FHTA 3MEFA 3G71A 2Q2IA 3BYYB 1M4VA 4BS9A 1XMOL 2ICEC 1G6ZA 5IGGA 1Y1WH 1P8LA 3J7A5 1OXUA 3TREA 4DR3Q 2XN9C 1TWGB 2R93H 2KOLA 3RNUA 4XIGS 5IGFA 2F0EA 3OOCA 4JI6L 3CPFA 4X64Q 4EQNA 4DV3L 4CJ0B 2YU9B 2KJXA 4ZAIA 3C1EA 4LFBL 3X3MA 3K58A 4LUVA 1CQFA 1TWCH 1WOCA 5EAYA 1A15A 3PO3H 3D6WA 1VMPA 1CHQD 1CSPA 5E3FA 3PO2B 2K05A 2UUBQ 1JJCB 3FKIH 5EBDA 4YCVA 2XRSD 3H0GB 1EY7A 1PTOH 1QB5D 4A3CG 4EGVA 2BE5C 2JA8G 3MWYW 4BY7G 2MO1A 2JA6G 3ND8A 1SJHD 4ZKBB 3V2TA 2KHJA 4QUCA 2K32A 3DM3A 4KY5A 4MNOA 1VDZA 3U9OA 4DR2Q 1EY4A 1SE8A 4V190 2IW3A 2B2VC 4BY7B 2E8GA 2SDFA 4CHTB 1CT1D 1UAPA 5C4ZA 4YY3Q 3P1HA 4X3SA 3S2DH 4BY1G 1S5DD 2A1AA 2H1EA 1MBYA 1NAPA 3HOXB 1TR5A 1CZGA 1YJNA 4A3KH 3HOZH 1JICA 1CHPD 4NMZA 4RHRA 2JJQA 3K8AA 1KLGD 5DAUA 1LUZA 1TWCB 3PO3B 1VQCA 3E3XA 4LW1A 2BCOA 4AQYQ 3N6RA 4DV6L 3VR4A 4OHJA 5K36H 1S5CD 2NN6I 4P75A 2OT2A 4DR2L 1XMQQ 1CKNA 1VQHA 2L15A 3E0EA 3OTOQ 1SFOB 3CRKC 4DV4Q 4OWTB 2JSOA 2KECA 1WTXA 5IE8A 4IQZA 1BCPD 3HKSA 4LF9L 4HSPA 2KHIA 4C3JG 1UEBA 1VF5C 2YV5A 3R2IA 4DUZL 4QCLA 3GTQB 3MXNA 4A3GG 3KJPA 5C44G 1Y69U 2PCFB 1LACA 3GTKB 5CV5A 2A19A 4JBMA 4X64L 2R3ZA 2L12A 3NTHA 1JJ2A 4Q0FA 4G7HC 3W3AA 2ZM6L 3HFZB 2WKCA 3OWEB 1E2ZA 4LFBQ 3U4VA 4A3GH 4B3RQ 5TSSA 4YCUA 4TRDA 5C44H 4JYAQ 2EY5A 1E1OA 1FL0A 3KBXA 4RGTA 1H9MA 4BBSG 2RHQB 2VZAA 3A55A 4DR7L 4LNQA 1KNEA 1NSNS 4CJ1B 3MC0B 4I65A 2CVRA 3EQLC 4AYBE 1CM9A 1YIJA 4A3IB 4A3EG 2NBFA 1V43A 1XYIA 4K0KL 3UDXA 2E2IH 1HZAA 1B70B 1JMCA 4GOPA 2QF7A 3D3RA 5G3LF 2L5TA 4K6LA 1EY8A 5E7NA 4F8MA 1PH4A 2JA6B 4NXMQ 3U9SA 3CCLA
chains in the Genus database with same CATH topology
1VQLA 3J80c 2KBNA 3B6YA 4HJ7A 4JI7L 4A76A 3F8TA 5J3BA 1C7YA 2VUMG 2VNUD 4HJAA 1WI5A 4HJ9A 3CMAA 1GVPA 1C0AA 2ASBA 4YY3L 1N36L 1IBKL 1KL9A 5IWAQ 1E1TA 1TWAH 1QVFA 1A62A 3S1QH 3I7FA 4JC0A 5BR8L 1M90C 3CMEA 1I3QH 4GKKL 1Q82C 1N32Q 2LXJA 4GS3A 5ELOA 4BA2I 4UP7A 3L2PA 3D0FA 5IY0A 1PA6A 3M4PA 3W1GA 4DPGA 1Q86C 3KLWA 5AJ3L 2N8NA 3CPWA 1QZGA 2NVTH 4JI8Q 3J80i 4BXXG 4DR4Q 1SRUA 2QA4A 2KCMA 4DR4L 2XTIA 3GTLH 2D62A 2VW9A 3PUVA 2EIFA 4X65Q 1G291 2MQHA 4B3SQ 2AKWB 3I4MH 1X65A 5K36G 4H02A 4JI3L 1N9WA 4R4QA 4JCVE 3I56A 5LMNL 4GN4B 2R92H 1JJGA 2IHEA 3D31A 3UDIA 4DV1Q 2UXDQ 4DV5L 1S40A 1Z47A 2UXDL 5C0XG 4DUYL 2NN6G 3I2ZA 4GN5A 3BJUA 3HOXG 2KENA 2BH8A 1B7YB 2BA1A 3AQQA 1DGSA 3S2HH 2WP8J 3M3YH 3HOUH 1FGUA 3HOYG 2Q2UA 2CKZB 2F4VL 4O2DA 3PIOA 3F1ZA 1YBYA 3RLOA 1Q1BA 3ULLA 2F4VQ 2OTJA 3T1YL 2UXBL 1VQ6A 1J5EL 2PQAA 3GTOH 2C35B 3VDYA 3I4NH 2UUBL 1NMGA 3L0OA 1W2BA 4LF6Q 3CCVA 2AMCB 2JK8A 3NENA 3CXCA 2ZJRA 1KRTA 4GLVB 1U0LA 4DUZQ 1BKBA 3J7ZC 3E9HA 1X54A 1YITA 4B3TQ 5IYBH 3PV0A 1VQ4A 3EN2A 2KCTA 3I4OA 3KYHC 3RLFA 4LF4Q 4WJ4A 3HOVG 3F2CA 5IT9c 4UP9A 5IYDH 4IPHA 3DLLA 1XNRL 4TQUS 4OXPA 2E2JH 4DV1L 4R4IA 2ZTCA 1HZCA 3RN2A 1HNZL 3S14H 2NVXH 3S16H 2N78A 2OCEA 4KI0A 1IXRA 4BBSH 2YYZA 4JOIC 3U50C 4DV6Q 1A63A 1XPOA 3H0GG 4LFCQ 2B29A 4QQBX 1EOVA 3HOVH 1VQBA 3ZJYC 4JI4L 1WJJA 1TWGH 1PFSA 4OONA 3CW2C 4IPCA 1YVCA 4HJ8A 1UE7A 4A3BH 4WJ3M 2UXCL 1FJGQ 1E7ZA 2YTVA 4LWCA 4DR3L 1GM5A 1VQ7A 4DV0L 3CC4A 1XNQL 4APVA 2I5LX 2I0QA 1L1OC 3BU2A 4DK6C 4XTCS 4LF9Q 3A74A 1J5EQ 3E9IA 3FP9A 4JI3Q 2CCZA 4X65L 1VQ8A 3OYYA 2CFMA 1VS0A 3ER0A 2CWAA 1VQGA 3A0JA 1OXSC 3PUYA 4YWKA 1HH2P 2VL6A 4UP8A 1HZ9A 2R7FA 1NY4A 3I55A 1MJCA 1SMXA 1VQNA 1A8VA 4P72A 1KC8C 1Q81C 2UUAL 2AHOB 4DV2L 2K50A 2MFIA 1Q8KA 2PI2E 2Z0SA 4JI0L 1IBLL 1HNWL 4JG2A 2VUMH 3U4ZA 3KDFA 3S1MH 3NEMA 1JE5A 3BZCA 1PH2A 1EQQA 1V1QA 3K81C 1HR0Q 1PH8A 4B3RL 1MIUA 1YJWA 3PF4A 1KXLA 2CWPA 3LGJA 1T9HA 3CF5A 4B3ML 4LF9L 1A0IA 4GOPC 3EIVA 4DKAC 2K5VA 3GDEA 3A5UA 3ICEA 4LF5L 1YHBA 3CCEA 4A3DG 2BA0A 2OTLA 2NVYH 1Y14B 3CP0A 3TQYA 2R6GA 4L5QA 2VQEL 1I6HH 4DR6L 4X62L 1BVSA 2VQEQ 1Q12A 2PI2A 4C3HH 1RIPA 1SR3A 2PMZE 2Q2HA 1OTCA 3KF6A 1EFWA 4IFDI 3ERSX 5LMNW 4BXXH 1HZBA 3CCSA 3FHWA 1VQFA 1W3SA 3L7ZC 5M3FG 4JI4Q 1XJVA 1H95A 2NZHA 4LF7L 4A3JH 3G48A 3T1HQ 4A3DH 1EWIA 4LFCL 4IPDA 4R4TA 3RLNA 3KJOA 3F2BA 1PHJA 5M3MH 1XTDA 1E3PA 4NXNL 3WWVA 5JJLA 3F2DA 4A75A 1CKMA 3HKZE 3PUWA 4LF6L 2MO0A 4PMWA 4OWXB 4L5SA 2R7ZH 4JI1L 3HOXH 5C0XJ 2E2HH 4R1JA 4A93G 4LFAL 3HOWG 1L1OB 4JI2Q 1YJ9A 4A3JG 1HR0W 2E5LL 4GKJL 1NJIC 3CCMA 4LF7Q 1N33L 2HIVA 4KLKA 1K9MC 4JI2L 1P16A 5C4JH 1PYSB 1N33Q 3PO3G 4JI6Q 4DR7Q 1Q7YC 4QIWE 4GNXA 2FXQA 2ZJPA 4RMFA 3I4NG 1LYLA 1K0RA 2RF4A 4LUZA 4AH6A 2MNAA 2R7ZG 4PZ8A 1E24A 4GLXA 1EQRA 2QGQA 1NE3A 2JQOA 2OQKA 2XGTA 4A93H 2ZM6Q 2VQFQ 3HOWH 3K0XA 4A3CH 2N49A 3UE1A 1K83H 3NBHB 3GO5A 1VQAA 5IYDG 2K52A 4BBRH 1WFQA 1PH3A 4JI8L 5IP9G 4HIOA 2Y0SG 4OX9Q 1FVIA 1R9TH 2IT1A 3J81i 1YZ6A 3NELA 1PV4A 4JBJA 4KHPQ 1K73C 4J15A 4BA1I 1VQ9A 1PH6A 3H0GH 4JI7Q 5LMNQ 1IBMQ 2B63H 2RCNA 2WAQE 1OXXK 2ZTEA 1PH5A 4FDBA 1KAWA 1YNXA 4OO1I 4UPAA 5C3EH 2VY3A 4GKJQ 1N34L 5HY6A 1VQOA 2B3GA 3K7AH 4OWWB 4Y52H 5JJIA 4QGUA 1OXVA 4POFA 4RG1A 1CKOA 1O7IA 5IP9H 5IWAL 1EYGA 4GNXB 1Q46A 1RL2A 4QL5A 1MKHA 3M85A 3K7UC 5LMUQ 3PUXA 4YWLA 3H3VH 1N36Q 1IBKQ 3MXNB 2UU9L 2IHFA 5JEAG 5M5WH 3RZOH 1UWVA 3CCUA 4BY1H 3J81j 4DR5Q 3H3VI 1V9PA 3T1YQ 2B63G 2OQ0A 4DR5L 5FLXc 1HNXQ 5C3EG 5IYCG 4YHHL 4GLAC 3S17H 3TS2A 4HIDA 4X6AH 2I5MX 4LF8Q 1NTGA 3ULJA 4DNIA 2NVQH 2V1CC 1BBWA 3M9BA 1QUQB 2OWOA 1VQ5A 5AJ3Q 1EIYB 4LF4L 4P71A 5FJ8G 1QZHA 5C4XG 1VQMA 3A5ZB 3CCJA 4IFDJ 1QVGA 4O0AA 2K4KA 4IO9A 3UDGA 2N3SA 4A3IH 4L5RC 3U58A 4DV2Q 1JB7A 1D8LA 5GROA 4DK3C 1IBLQ 1HNWQ 1AH9A 5IYCH 3GD7A 1X9NA 1HNZQ 4EX5A 4B3SL 4KHPL 1L0WA 4P73A 1QUQA 1N8RC 2PQAB 3PUZA 3GTMH 1LM0A 5DLQE 2DGYA 2ID0A 2IX0A 2K14A 3STBD 1HR0L 2JA5H 1PYBA 5C4XH 2JA7G 3G71A 3MEFA 1I50H 2Q2IA 4JBWA 5JJKA 1XPRA 3GTPH 5M5YH 4A3IG 3M7NA 1XMOL 2HIXA 4GKKQ 3EBEA 1Y1WH 4OO1G 3UE0A 1E22A 1P8LA 3J7A5 1OXUA 4TVAB 3TREA 3CCQA 4DR3Q 2I5HA 1FJGL 1VQJA 3W1BA 4DV0Q 1KQSA 2R93H 1JT8A 3RNUA 5M3FH 4XIGS 1K8GA 1X3GA 3GTJH 2JEBI 4PZ7A 1UE1A 4DR1Q 4A3MG 5H1SE 2JA7H 3S15H 4R4CA 2K5HA 4JI6L 5M3MG 2K5NA 3CPFA 4JI1Q 2GVAA 2E5LQ 1TWHH 4X64Q 3K80C 3PCOB 4X66Q 4R4OA 4DV3Q 1KHIA 1SLJA 4DV3L 1PH7A 1XNRQ 2R93G 2NZOA 4LFBL 1MJEA 4MZ9A 1IYJB 4LUVA 3RR5A 3AFPA 1TWCH 1WOCA 5EAYA 3PO3H 1N32L 3CQZH 2GVBA 3PIPA 1X6OA 3IRBA 2YU9H 2HT1A 3BZKA 4EQ5A 2ATWA 1CSPA 1GD7A 5IP7G 1IL2A 4JOIA 2EXDA 1JJCB 3FKIH 2UUBQ 4B3MQ 1VQEA 4Y7NH 4DAMA 4C3IH 2AWOA 4YCVA 1TWFH 4C2MH 1SN8A 2AWNA 2VS1A 3W5OA 2WB1G 4X62Q 1XMQL 2R7DA 2Q2TA 1PH9A 4PG3A 4A3CG 3JAMc 2JA8G 2F3IA 4IOAA 4DR6Q 4BY7G 4A3LH 2MO1A 3PGZA 1XPUA 1K3RA 1WCMH 2DUDA 2HHHL 1L1OA 2JA6G 4IFDG 2WB1E 1EUJA 4BBRG 4DAYB 1VQKA 5IP7H 3M4OH 4JV5Q 1K8AC 4DR1L 1AE3A 2JE6I 2JEAI 1N34Q 2KHJA 4DUYQ 1VCIA 5C0XI 4YCWA 3DM3A 2UUCQ 1SROA 3AFQA 4MNOA 1NBWA 4DR2Q 4A3FH 1SE8A 4K0KQ 1YHAA 4IPGA 2JA8H 1BBUA 4LUOA 1YI2A 3HOZG 2D0PA 2HQLA 4POGA 2E8GA 2ZTDA 2RHSB 4GOPB 4UY8C 4DV7Q 4LF8L 4NPSA 4LFAQ 3TEHB 4DV7L 3CC7A 4NB3A 1PVOA 5HGQA 2GN5A 2K75A 4YY3Q 2A8VA 4HIKA 2ES2A 1IZ6A 3S2DH 4BY1G 4YWMA 2A1AA 4A3FG 3PO2G 1GO3E 1VQPA 2F52A 2JA9A 1YJNA 4A3KH 4A4IA 3GTGH 3HOZH 4JYAL 4IJLA 2UUAQ 1KIXA 1VQIA 4JI0Q 2JJQA 3RZDH 3KDFB 3Q8DA 2HHHQ 3K8AA 1I5FA 5GAGC 5GADC 2ZJQA 4IOCA 1LUZA 1HNXL 5FJ8H 4PZ6A 1C9OA 1S3OA 5GAEC 3S24A 1ASYA 3OW2A 1U5KA 1VQCA 4LW1A 4AQYQ 3KFUA 2CQOA 4DV6L 2LXKA 3PO2H 1I94L 3I4MG 2NN6I 4P75A 4C3JH 1SFOH 4A3KG 4DR2L 1XMQQ 2R92G 1CKNA 1UE5A 1VQHA 2BH2A 2L15A 4OX9L 2UUCL 2IY5B 3KF8B 4AIMA 3E0EA 4LF5Q 3S1NH 2WFWA 4NXML 3G6EA 1AE2A 2WAQG 3OTOQ 2LSSA 1L2FA 3TRZA 1ASZA 2QEXA 4DV4Q 2JA5G 2UXBQ 2Z6KC 4JV5L 4MTNA 1VQDA 3CCRA 1IBML 2H5XA 4OWTB 3HOYH 3PSIA 3HOUG 5IE8A 1YHQA 3HKSA 5GQOA 3J81c 2KHIA 1G51A 1UEBA 2YV5A 4DUZL 1Y1WG 4JBKA 3GTKH 1QVCA 3JAMi 4A3GG 2Z6KA 5LMUL 2YTXA 4DV5Q 1TXYA 3KJPA 5C44G 4X66L 2IX1A 4GNXC 3UDFA 1KRSA 1X3EA 4L5TA 4A3MH 3GTQH 4NXNQ 2A19A 4ME3A 4JBMA 3HKZG 4X64L 4JI5L 5IYBG 1Y1VH 4KHZA 1EIFA 4JI5Q 1KD1C 4HJ5A 1JJ2A 3CD6A 2ZM6L 2VQFL 1WYDA 3HFZB 5JEAJ 4B3TL 1GKHA 4LFBQ 3U4VA 1G6PA 5FLMH 4A3GH 4B3RQ 3CAMA 1LTLA 1X55A 3AYHB 4A3EH 1PH1A 4P74A 1CKNB 4YCUA 1OXTA 5C44H 3G4SA 4JYAQ 3STBC 1E1OA 1NMFA 1FL0A 5GAHC 2EQSA 2PNHA 1HJPA 3JC66 1YEZA 3RN5A 4BBSG 2RHQB 4HIMA 3CC2A 2VZAA 2YTYA 1Y1VG 5M5XH 4ALPA 4DR7L 1B8AA 3H15A 4LNQA 3AEVA 1M1KC 1D7QA 3OTOL 5ELNA 5BR8Q 4DV4L 3FKIG 1J6QA 5FLMG 1CSQA 4AYBE 1YIJA 4A3BG 3TS0A 1Q1EA 4QY7A 4A3EG 1V43A 1XMOQ 4K0KL 3UDXA 2E2IH 1HZAA 1B70B 3S1RH 1I94Q 1JMCA 4BY7H 4GOPA 2Y0SE 3PF5A 4AYBG 3ULPA 4A3LG 3KOJA 1XNQQ 4AQYL 1WCMG 1S72A 2UU9Q 2JA6H 3SGIA 3T1HL 2UXCQ 3M4QA 4GN3B 2D0OA 5E7NA 1X3FA 1X56A 1UE6A 4QJFA 1CUKA 3KF6B 1PH4A 4YHHQ 1Z9FA 2ALYB 4NXMQ 4IJHA 3CCLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL A;  3J80 c;  2KBN A;  3B6Y A;  4HJ7 A;  4JI7 L;  4A76 A;  3F8T A;  5J3B A;  1C7Y A;  2VUM G;  2VNU D;  4HJA A;  1WI5 A;  4HJ9 A;  3CMA A;  1GVP A;  1C0A A;  2ASB A;  4YY3 L;  1N36 L;  1IBK L;  1KL9 A;  5IWA Q;  1E1T A;  1TWA H;  1QVF A;  1A62 A;  3S1Q H;  3I7F A;  4JC0 A;  5BR8 L;  1M90 C;  3CME A;  1I3Q H;  4GKK L;  1Q82 C;  1N32 Q;  2LXJ A;  4GS3 A;  5ELO A;  4BA2 I;  4UP7 A;  3L2P A;  3D0F A;  5IY0 A;  1PA6 A;  3M4P A;  3W1G A;  4DPG A;  1Q86 C;  3KLW A;  5AJ3 L;  2N8N A;  3CPW A;  1QZG A;  2NVT H;  4JI8 Q;  3J80 i;  4BXX G;  4DR4 Q;  1SRU A;  2QA4 A;  2KCM A;  4DR4 L;  2XTI A;  3GTL H;  2D62 A;  2VW9 A;  3PUV A;  2EIF A;  4X65 Q;  1G29 1;  2MQH A;  4B3S Q;  2AKW B;  3I4M H;  1X65 A;  5K36 G;  4H02 A;  4JI3 L;  1N9W A;  4R4Q A;  4JCV E;  3I56 A;  5LMN L;  4GN4 B;  2R92 H;  1JJG A;  2IHE A;  3D31 A;  3UDI A;  4DV1 Q;  2UXD Q;  4DV5 L;  1S40 A;  1Z47 A;  2UXD L;  5C0X G;  4DUY L;  2NN6 G;  3I2Z A;  4GN5 A;  3BJU A;  3HOX G;  2KEN A;  2BH8 A;  1B7Y B;  2BA1 A;  3AQQ A;  1DGS A;  3S2H H;  2WP8 J;  3M3Y H;  3HOU H;  1FGU A;  3HOY G;  2Q2U A;  2CKZ B;  2F4V L;  4O2D A;  3PIO A;  3F1Z A;  1YBY A;  3RLO A;  1Q1B A;  3ULL A;  2F4V Q;  2OTJ A;  3T1Y L;  2UXB L;  1VQ6 A;  1J5E L;  2PQA A;  3GTO H;  2C35 B;  3VDY A;  3I4N H;  2UUB L;  1NMG A;  3L0O A;  1W2B A;  4LF6 Q;  3CCV A;  2AMC B;  2JK8 A;  3NEN A;  3CXC A;  2ZJR A;  1KRT A;  4GLV B;  1U0L A;  4DUZ Q;  1BKB A;  3J7Z C;  3E9H A;  1X54 A;  1YIT A;  4B3T Q;  5IYB H;  3PV0 A;  1VQ4 A;  3EN2 A;  2KCT A;  3I4O A;  3KYH C;  3RLF A;  4LF4 Q;  4WJ4 A;  3HOV G;  3F2C A;  5IT9 c;  4UP9 A;  5IYD H;  4IPH A;  3DLL A;  1XNR L;  4TQU S;  4OXP A;  2E2J H;  4DV1 L;  4R4I A;  2ZTC A;  1HZC A;  3RN2 A;  1HNZ L;  3S14 H;  2NVX H;  3S16 H;  2N78 A;  2OCE A;  4KI0 A;  1IXR A;  4BBS H;  2YYZ A;  4JOI C;  3U50 C;  4DV6 Q;  1A63 A;  1XPO A;  3H0G G;  4LFC Q;  2B29 A;  4QQB X;  1EOV A;  3HOV H;  1VQB A;  3ZJY C;  4JI4 L;  1WJJ A;  1TWG H;  1PFS A;  4OON A;  3CW2 C;  4IPC A;  1YVC A;  4HJ8 A;  1UE7 A;  4A3B H;  4WJ3 M;  2UXC L;  1FJG Q;  1E7Z A;  2YTV A;  4LWC A;  4DR3 L;  1GM5 A;  1VQ7 A;  4DV0 L;  3CC4 A;  1XNQ L;  4APV A;  2I5L X;  2I0Q A;  1L1O C;  3BU2 A;  4DK6 C;  4XTC S;  4LF9 Q;  3A74 A;  1J5E Q;  3E9I A;  3FP9 A;  4JI3 Q;  2CCZ A;  4X65 L;  1VQ8 A;  3OYY A;  2CFM A;  1VS0 A;  3ER0 A;  2CWA A;  1VQG A;  3A0J A;  1OXS C;  3PUY A;  4YWK A;  1HH2 P;  2VL6 A;  4UP8 A;  1HZ9 A;  2R7F A;  1NY4 A;  3I55 A;  1MJC A;  1SMX A;  1VQN A;  1A8V A;  4P72 A;  1KC8 C;  1Q81 C;  2UUA L;  2AHO B;  4DV2 L;  2K50 A;  2MFI A;  1Q8K A;  2PI2 E;  2Z0S A;  4JI0 L;  1IBL L;  1HNW L;  4JG2 A;  2VUM H;  3U4Z A;  3KDF A;  3S1M H;  3NEM A;  1JE5 A;  3BZC A;  1PH2 A;  1EQQ A;  1V1Q A;  3K81 C;  1HR0 Q;  1PH8 A;  4B3R L;  1MIU A;  1YJW A;  3PF4 A;  1KXL A;  2CWP A;  3LGJ A;  1T9H A;  3CF5 A;  4B3M L;  4LF9 L;  1A0I A;  4GOP C;  3EIV A;  4DKA C;  2K5V A;  3GDE A;  3A5U A;  3ICE A;  4LF5 L;  1YHB A;  3CCE A;  4A3D G;  2BA0 A;  2OTL A;  2NVY H;  1Y14 B;  3CP0 A;  3TQY A;  2R6G A;  4L5Q A;  2VQE L;  1I6H H;  4DR6 L;  4X62 L;  1BVS A;  2VQE Q;  1Q12 A;  2PI2 A;  4C3H H;  1RIP A;  1SR3 A;  2PMZ E;  2Q2H A;  1OTC A;  3KF6 A;  1EFW A;  4IFD I;  3ERS X;  5LMN W;  4BXX H;  1HZB A;  3CCS A;  3FHW A;  1VQF A;  1W3S A;  3L7Z C;  5M3F G;  4JI4 Q;  1XJV A;  1H95 A;  2NZH A;  4LF7 L;  4A3J H;  3G48 A;  3T1H Q;  4A3D H;  1EWI A;  4LFC L;  4IPD A;  4R4T A;  3RLN A;  3KJO A;  3F2B A;  1PHJ A;  5M3M H;  1XTD A;  1E3P A;  4NXN L;  3WWV A;  5JJL A;  3F2D A;  4A75 A;  1CKM A;  3HKZ E;  3PUW A;  4LF6 L;  2MO0 A;  4PMW A;  4OWX B;  4L5S A;  2R7Z H;  4JI1 L;  3HOX H;  5C0X J;  2E2H H;  4R1J A;  4A93 G;  4LFA L;  3HOW G;  1L1O B;  4JI2 Q;  1YJ9 A;  4A3J G;  1HR0 W;  2E5L L;  4GKJ L;  1NJI C;  3CCM A;  4LF7 Q;  1N33 L;  2HIV A;  4KLK A;  1K9M C;  4JI2 L;  1P16 A;  5C4J H;  1PYS B;  1N33 Q;  3PO3 G;  4JI6 Q;  4DR7 Q;  1Q7Y C;  4QIW E;  4GNX A;  2FXQ A;  2ZJP A;  4RMF A;  3I4N G;  1LYL A;  1K0R A;  2RF4 A;  4LUZ A;  4AH6 A;  2MNA A;  2R7Z G;  4PZ8 A;  1E24 A;  4GLX A;  1EQR A;  2QGQ A;  1NE3 A;  2JQO A;  2OQK A;  2XGT A;  4A93 H;  2ZM6 Q;  2VQF Q;  3HOW H;  3K0X A;  4A3C H;  2N49 A;  3UE1 A;  1K83 H;  3NBH B;  3GO5 A;  1VQA A;  5IYD G;  2K52 A;  4BBR H;  1WFQ A;  1PH3 A;  4JI8 L;  5IP9 G;  4HIO A;  2Y0S G;  4OX9 Q;  1FVI A;  1R9T H;  2IT1 A;  3J81 i;  1YZ6 A;  3NEL A;  1PV4 A;  4JBJ A;  4KHP Q;  1K73 C;  4J15 A;  4BA1 I;  1VQ9 A;  1PH6 A;  3H0G H;  4JI7 Q;  5LMN Q;  1IBM Q;  2B63 H;  2RCN A;  2WAQ E;  1OXX K;  2ZTE A;  1PH5 A;  4FDB A;  1KAW A;  1YNX A;  4OO1 I;  4UPA A;  5C3E H;  2VY3 A;  4GKJ Q;  1N34 L;  5HY6 A;  1VQO A;  2B3G A;  3K7A H;  4OWW B;  4Y52 H;  5JJI A;  4QGU A;  1OXV A;  4POF A;  4RG1 A;  1CKO A;  1O7I A;  5IP9 H;  5IWA L;  1EYG A;  4GNX B;  1Q46 A;  1RL2 A;  4QL5 A;  1MKH A;  3M85 A;  3K7U C;  5LMU Q;  3PUX A;  4YWL A;  3H3V H;  1N36 Q;  1IBK Q;  3MXN B;  2UU9 L;  2IHF A;  5JEA G;  5M5W H;  3RZO H;  1UWV A;  3CCU A;  4BY1 H;  3J81 j;  4DR5 Q;  3H3V I;  1V9P A;  3T1Y Q;  2B63 G;  2OQ0 A;  4DR5 L;  5FLX c;  1HNX Q;  5C3E G;  5IYC G;  4YHH L;  4GLA C;  3S17 H;  3TS2 A;  4HID A;  4X6A H;  2I5M X;  4LF8 Q;  1NTG A;  3ULJ A;  4DNI A;  2NVQ H;  2V1C C;  1BBW A;  3M9B A;  1QUQ B;  2OWO A;  1VQ5 A;  5AJ3 Q;  1EIY B;  4LF4 L;  4P71 A;  5FJ8 G;  1QZH A;  5C4X G;  1VQM A;  3A5Z B;  3CCJ A;  4IFD J;  1QVG A;  4O0A A;  2K4K A;  4IO9 A;  3UDG A;  2N3S A;  4A3I H;  4L5R C;  3U58 A;  4DV2 Q;  1JB7 A;  1D8L A;  5GRO A;  4DK3 C;  1IBL Q;  1HNW Q;  1AH9 A;  5IYC H;  3GD7 A;  1X9N A;  1HNZ Q;  4EX5 A;  4B3S L;  4KHP L;  1L0W A;  4P73 A;  1QUQ A;  1N8R C;  2PQA B;  3PUZ A;  3GTM H;  1LM0 A;  5DLQ E;  2DGY A;  2ID0 A;  2IX0 A;  2K14 A;  3STB D;  1HR0 L;  2JA5 H;  1PYB A;  5C4X H;  2JA7 G;  3G71 A;  3MEF A;  1I50 H;  2Q2I A;  4JBW A;  5JJK A;  1XPR A;  3GTP H;  5M5Y H;  4A3I G;  3M7N A;  1XMO L;  2HIX A;  4GKK Q;  3EBE A;  1Y1W H;  4OO1 G;  3UE0 A;  1E22 A;  1P8L A;  3J7A 5;  1OXU A;  4TVA B;  3TRE A;  3CCQ A;  4DR3 Q;  2I5H A;  1FJG L;  1VQJ A;  3W1B A;  4DV0 Q;  1KQS A;  2R93 H;  1JT8 A;  3RNU A;  5M3F H;  4XIG S;  1K8G A;  1X3G A;  3GTJ H;  2JEB I;  4PZ7 A;  1UE1 A;  4DR1 Q;  4A3M G;  5H1S E;  2JA7 H;  3S15 H;  4R4C A;  2K5H A;  4JI6 L;  5M3M G;  2K5N A;  3CPF A;  4JI1 Q;  2GVA A;  2E5L Q;  1TWH H;  4X64 Q;  3K80 C;  3PCO B;  4X66 Q;  4R4O A;  4DV3 Q;  1KHI A;  1SLJ A;  4DV3 L;  1PH7 A;  1XNR Q;  2R93 G;  2NZO A;  4LFB L;  1MJE A;  4MZ9 A;  1IYJ B;  4LUV A;  3RR5 A;  3AFP A;  1TWC H;  1WOC A;  5EAY A;  3PO3 H;  1N32 L;  3CQZ H;  2GVB A;  3PIP A;  1X6O A;  3IRB A;  2YU9 H;  2HT1 A;  3BZK A;  4EQ5 A;  2ATW A;  1CSP A;  1GD7 A;  5IP7 G;  1IL2 A;  4JOI A;  2EXD A;  1JJC B;  3FKI H;  2UUB Q;  4B3M Q;  1VQE A;  4Y7N H;  4DAM A;  4C3I H;  2AWO A;  4YCV A;  1TWF H;  4C2M H;  1SN8 A;  2AWN A;  2VS1 A;  3W5O A;  2WB1 G;  4X62 Q;  1XMQ L;  2R7D A;  2Q2T A;  1PH9 A;  4PG3 A;  4A3C G;  3JAM c;  2JA8 G;  2F3I A;  4IOA A;  4DR6 Q;  4BY7 G;  4A3L H;  2MO1 A;  3PGZ A;  1XPU A;  1K3R A;  1WCM H;  2DUD A;  2HHH L;  1L1O A;  2JA6 G;  4IFD G;  2WB1 E;  1EUJ A;  4BBR G;  4DAY B;  1VQK A;  5IP7 H;  3M4O H;  4JV5 Q;  1K8A C;  4DR1 L;  1AE3 A;  2JE6 I;  2JEA I;  1N34 Q;  2KHJ A;  4DUY Q;  1VCI A;  5C0X I;  4YCW A;  3DM3 A;  2UUC Q;  1SRO A;  3AFQ A;  4MNO A;  1NBW A;  4DR2 Q;  4A3F H;  1SE8 A;  4K0K Q;  1YHA A;  4IPG A;  2JA8 H;  1BBU A;  4LUO A;  1YI2 A;  3HOZ G;  2D0P A;  2HQL A;  4POG A;  2E8G A;  2ZTD A;  2RHS B;  4GOP B;  4UY8 C;  4DV7 Q;  4LF8 L;  4NPS A;  4LFA Q;  3TEH B;  4DV7 L;  3CC7 A;  4NB3 A;  1PVO A;  5HGQ A;  2GN5 A;  2K75 A;  4YY3 Q;  2A8V A;  4HIK A;  2ES2 A;  1IZ6 A;  3S2D H;  4BY1 G;  4YWM A;  2A1A A;  4A3F G;  3PO2 G;  1GO3 E;  1VQP A;  2F52 A;  2JA9 A;  1YJN A;  4A3K H;  4A4I A;  3GTG H;  3HOZ H;  4JYA L;  4IJL A;  2UUA Q;  1KIX A;  1VQI A;  4JI0 Q;  2JJQ A;  3RZD H;  3KDF B;  3Q8D A;  2HHH Q;  3K8A A;  1I5F A;  5GAG C;  5GAD C;  2ZJQ A;  4IOC A;  1LUZ A;  1HNX L;  5FJ8 H;  4PZ6 A;  1C9O A;  1S3O A;  5GAE C;  3S24 A;  1ASY A;  3OW2 A;  1U5K A;  1VQC A;  4LW1 A;  4AQY Q;  3KFU A;  2CQO A;  4DV6 L;  2LXK A;  3PO2 H;  1I94 L;  3I4M G;  2NN6 I;  4P75 A;  4C3J H;  1SFO H;  4A3K G;  4DR2 L;  1XMQ Q;  2R92 G;  1CKN A;  1UE5 A;  1VQH A;  2BH2 A;  2L15 A;  4OX9 L;  2UUC L;  2IY5 B;  3KF8 B;  4AIM A;  3E0E A;  4LF5 Q;  3S1N H;  2WFW A;  4NXM L;  3G6E A;  1AE2 A;  2WAQ G;  3OTO Q;  2LSS A;  1L2F A;  3TRZ A;  1ASZ A;  2QEX A;  4DV4 Q;  2JA5 G;  2UXB Q;  2Z6K C;  4JV5 L;  4MTN A;  1VQD A;  3CCR A;  1IBM L;  2H5X A;  4OWT B;  3HOY H;  3PSI A;  3HOU G;  5IE8 A;  1YHQ A;  3HKS A;  5GQO A;  3J81 c;  2KHI A;  1G51 A;  1UEB A;  2YV5 A;  4DUZ L;  1Y1W G;  4JBK A;  3GTK H;  1QVC A;  3JAM i;  4A3G G;  2Z6K A;  5LMU L;  2YTX A;  4DV5 Q;  1TXY A;  3KJP A;  5C44 G;  4X66 L;  2IX1 A;  4GNX C;  3UDF A;  1KRS A;  1X3E A;  4L5T A;  4A3M H;  3GTQ H;  4NXN Q;  2A19 A;  4ME3 A;  4JBM A;  3HKZ G;  4X64 L;  4JI5 L;  5IYB G;  1Y1V H;  4KHZ A;  1EIF A;  4JI5 Q;  1KD1 C;  4HJ5 A;  1JJ2 A;  3CD6 A;  2ZM6 L;  2VQF L;  1WYD A;  3HFZ B;  5JEA J;  4B3T L;  1GKH A;  4LFB Q;  3U4V A;  1G6P A;  5FLM H;  4A3G H;  4B3R Q;  3CAM A;  1LTL A;  1X55 A;  3AYH B;  4A3E H;  1PH1 A;  4P74 A;  1CKN B;  4YCU A;  1OXT A;  5C44 H;  3G4S A;  4JYA Q;  3STB C;  1E1O A;  1NMF A;  1FL0 A;  5GAH C;  2EQS A;  2PNH A;  1HJP A;  3JC6 6;  1YEZ A;  3RN5 A;  4BBS G;  2RHQ B;  4HIM A;  3CC2 A;  2VZA A;  2YTY A;  1Y1V G;  5M5X H;  4ALP A;  4DR7 L;  1B8A A;  3H15 A;  4LNQ A;  3AEV A;  1M1K C;  1D7Q A;  3OTO L;  5ELN A;  5BR8 Q;  4DV4 L;  3FKI G;  1J6Q A;  5FLM G;  1CSQ A;  4AYB E;  1YIJ A;  4A3B G;  3TS0 A;  1Q1E A;  4QY7 A;  4A3E G;  1V43 A;  1XMO Q;  4K0K L;  3UDX A;  2E2I H;  1HZA A;  1B70 B;  3S1R H;  1I94 Q;  1JMC A;  4BY7 H;  4GOP A;  2Y0S E;  3PF5 A;  4AYB G;  3ULP A;  4A3L G;  3KOJ A;  1XNQ Q;  4AQY L;  1WCM G;  1S72 A;  2UU9 Q;  2JA6 H;  3SGI A;  3T1H L;  2UXC Q;  3M4Q A;  4GN3 B;  2D0O A;  5E7N A;  1X3F A;  1X56 A;  1UE6 A;  4QJF A;  1CUK A;  3KF6 B;  1PH4 A;  4YHH Q;  1Z9F A;  2ALY B;  4NXM Q;  4IJH A;  3CCL A; 
#chains in the Genus database with same CATH topology
 1K3B C;  2KBN A;  5LL6 X;  2SOB A;  3DEP A;  1WI5 A;  1IW7 D;  4FF3 A;  1GVP A;  2L0C A;  5CV9 A;  1HA5 A;  2ASB A;  3RZD B;  1EU4 A;  4NW2 A;  1EIH A;  4YY3 L;  1WTV A;  2F4I A;  1IBK L;  1KL9 A;  1O7L A;  2EYO A;  3DM1 A;  2E2D C;  3BVZ A;  4R8N A;  4ZUI A;  4IUR A;  2OF1 A;  3KLW A;  5AJ3 L;  2NVT H;  4JI8 Q;  1Y8N B;  4K8J A;  1CTM A;  2ZXO A;  4HMJ A;  3V05 A;  2RBM A;  2XTI A;  4DR4 L;  2D62 A;  2NYZ D;  3E5S A;  3PUV A;  3TSS A;  5KYL A;  3J7Y W;  4FF2 A;  1G29 1;  4B3S Q;  3I4M H;  1X65 A;  3PIP 3;  5LMN L;  2A6E D;  3X3N A;  4G4K A;  4CDD C;  2UXD L;  2NN6 G;  5CC4 A;  3HOX G;  2KEN A;  3MXG A;  3S2H H;  2WP8 J;  2EY6 A;  3HOY G;  3A7L A;  2CKZ B;  4HCS A;  3PIO A;  3TBI B;  3OMG A;  2F4V Q;  2UXB L;  3T1Y L;  2AQ3 B;  4KJN A;  3VDY A;  1NMG A;  3L0O A;  3SXH A;  3CCV A;  3GQB A;  2ZJR A;  1KDA A;  2LKV A;  5IYB H;  3PV0 A;  3EN2 A;  5EKL A;  3GV3 A;  3I4O A;  3RLF A;  4WJ4 A;  3HOV G;  4KD4 A;  2MP1 A;  5EKK A;  1UEA B;  1XNR L;  1PXU A;  1EFI D;  1SNM A;  4QB4 A;  4WFN 3;  4DV1 L;  3RN2 A;  2F3W A;  2ZTC A;  2F03 A;  2EYH A;  2PZW A;  2NVX H;  5KNB A;  4KI0 A;  4JOI C;  3R93 A;  1XPO A;  3H0G G;  4LFC Q;  2B29 A;  2K5W A;  1EOV A;  1TWG H;  1PFS A;  1WTQ A;  1UE7 A;  4DFA A;  5E4X A;  2UXC L;  1EQV A;  4K2L A;  5DM7 3;  1FJG Q;  2PQE A;  1GM5 A;  1QCB D;  1J5E Q;  4X65 L;  1PZI D;  3OYY A;  3C3L A;  3ER0 A;  3PUY A;  3VA5 A;  1OXS C;  1EU3 A;  2VL6 A;  4UP8 A;  1HZ9 A;  1JQY D;  1NY4 A;  2FMC A;  3S2H B;  1SMX A;  1K8M A;  4JW0 A;  1G91 A;  4DV2 L;  4C56 C;  2MFI A;  2K28 A;  2CHB D;  5I9O A;  3K5M A;  2BOS A;  4DAY A;  3VA7 A;  1EWC A;  5JVH 3;  3H6M A;  3K81 C;  4TSS A;  1MIU A;  3PF4 A;  1F77 A;  1KXL A;  2CWP A;  3LGJ A;  4RKB A;  4B3M L;  4UDU C;  1A0I A;  1TII D;  4DKA C;  3ICE A;  4LF5 L;  2AQ1 B;  2BA0 A;  5I4D A;  2NVY H;  2RSO A;  1Y14 B;  3TQY A;  4L5Q A;  2F3V A;  3MZ5 A;  1JCK B;  1J9O A;  4C3H H;  1B9N A;  1OTC A;  1I4H A;  3ERS X;  3S16 B;  5FO9 B;  3BVM A;  2HDM A;  2L9H A;  2NZH A;  4A3J H;  1B50 A;  3T1H Q;  3NWT A;  1EWI A;  4LFC L;  1NNX A;  3HOU B;  3RLN A;  2Z4I A;  5A35 A;  5M3M H;  1JC7 A;  3F2D A;  3HKZ E;  1U4L A;  2D5D A;  1PTO D;  3BS1 A;  2R7Z H;  4JI1 L;  4R1J A;  4LFA L;  1HR0 W;  4A3J G;  4GKJ L;  2E5L L;  1N33 L;  1RF2 D;  1G8Z D;  4DAV A;  1K9M C;  3HOZ B;  1P16 A;  2Z8L A;  1PYS B;  3ONA B;  1K0S A;  4QIW E;  2FXQ A;  2WKD A;  1D2B A;  4DF7 A;  2R7Z G;  4PZ8 A;  1FGB D;  1E24 A;  4ODG A;  1EQR A;  2C9O A;  2XGT A;  2ZM6 Q;  3HOW H;  3VR5 A;  1STN A;  5KRU A;  3N52 A;  2MPM A;  4GZY C;  3GTP B;  4DGZ A;  5G3L D;  5IYD G;  4BBR H;  3KK7 A;  1FVI A;  1B9M A;  3NEL A;  1PV4 A;  5JEA H;  2L4N A;  2KHS A;  2RCN A;  1OXX K;  2ZTE A;  2EYM A;  1KAW A;  1WCM B;  4OO1 I;  4UPA A;  4GKJ Q;  2Z9H A;  2B3G A;  3K7A H;  1NR4 A;  4OWW B;  3NQI A;  5JJI A;  1D6E C;  1HTL D;  1SSO A;  4POF A;  5IP9 H;  1Q46 A;  3M85 A;  5LMU Q;  3VYU A;  3SEB A;  1LLR D;  2FIN B;  2FJ2 A;  3RZO H;  4DR5 Q;  2OQ0 A;  4ZUJ A;  3BDC A;  1R4Q B;  1HNX Q;  4OEL B;  4HID A;  4BY1 B;  1O7Y A;  4DNI A;  1D5M C;  4LF4 L;  4Y7N B;  1MSH A;  3A5Z B;  3NSW A;  4KN7 C;  3TP5 A;  4IFD J;  2SNS A;  2K4K A;  4O0A A;  3JAM L;  1PMR A;  4DV2 Q;  1JB7 A;  1IBL Q;  1HNW Q;  3GD7 A;  4EX5 A;  1SBB B;  1GUT A;  1LM0 A;  2Q8I B;  4K5V A;  1LTT D;  1UNS A;  2JA5 H;  4A3D B;  4ILW A;  2O4X A;  3SK6 A;  2VB2 X;  5M5Y H;  1H9R A;  5CR3 A;  1JWS D;  2F0J A;  4DU9 A;  2K03 A;  2LFN A;  2F1M A;  4GKK Q;  3DXJ C;  2JA8 B;  1SJE D;  1E22 A;  3W1B A;  1KQS A;  3E0J A;  1UE1 A;  2JA7 H;  3S15 H;  2F0Q A;  4R4C A;  1I4X A;  2K5N A;  4FXK C;  3DEO A;  1QWY A;  2GVA A;  1TWH H;  3QB3 A;  2G9D A;  5EGT A;  3PCO B;  1ET9 A;  4X66 Q;  4R4O A;  3KLS X;  4DV3 Q;  4G7Z C;  1KHI A;  1J8I A;  2WAQ B;  2R93 G;  3SHL A;  5JPM C;  1MJE A;  3HOW B;  1IYJ B;  1JOO A;  4CKB A;  3RR5 A;  3AFP A;  3I8Z A;  3CQZ H;  4FNF A;  5CV4 A;  4BWG B;  3PIP A;  4IFD H;  4G57 A;  4PMC A;  2C5C A;  5FKA C;  1CA6 A;  2EXD A;  3FRP B;  4ZKC B;  4Y7N H;  4DAM A;  3R3O A;  2AWO A;  2AWN A;  1SYG A;  1NCV A;  1F2Z A;  2VS1 A;  3S1N B;  2WB1 G;  4X62 Q;  5E1F A;  1XMQ L;  2Q2T A;  1PH9 A;  4K5X A;  3JAM c;  1MGS A;  1QNU A;  4A3L H;  4IFD G;  1L1O A;  3A7A B;  1VQK A;  1EUJ A;  4DAY B;  4JV5 Q;  3M4O H;  5CV8 A;  3T13 A;  4DR1 L;  2QKI C;  3SK8 A;  4PV1 C;  1MD2 D;  4HN7 A;  1U4P A;  2UUC Q;  4RGM A;  3I90 A;  1NBW A;  4A3F H;  1ZEQ X;  1YHA A;  4IPG A;  1AW7 A;  2JA8 H;  1BBU A;  1YI2 A;  2D0P A;  3NWS A;  2K7V A;  4UY8 C;  5J22 A;  4NPS A;  2EJM A;  4FO2 A;  3NBI A;  4DV7 L;  4IZ8 A;  2K75 A;  2A8V A;  2QIL A;  1PFN A;  4A3G B;  2ES2 A;  2EVB A;  4YWM A;  1A3T A;  4A3F G;  5BN3 A;  2F52 A;  2JA9 A;  1EEF D;  2EYF A;  4JYA L;  3GTG H;  2UUA Q;  1KIX A;  1WTH A;  1SYF A;  1FNW A;  3EA6 A;  1I5F A;  4DA2 A;  4DNR B;  1ILP A;  1HHV A;  1ZKO A;  1C9O A;  1DM0 B;  1S3O A;  1H9J A;  1BR9 A;  1FYC A;  5JVG 3;  3KFU A;  1GUW A;  1I4Q A;  2LXK A;  3P20 A;  2CW0 C;  4KMU C;  5ELE A;  1SFO H;  4A3K G;  4UAI A;  2R92 G;  2F0M A;  4OX9 L;  1GUN A;  4AIM A;  4LF5 Q;  3S1N H;  2EYJ A;  3OSO A;  2QW7 A;  1AE2 A;  1NUC A;  1TWF B;  2WAQ G;  4C2M B;  2LSS A;  1L2F A;  2DNE A;  3TRZ A;  2R93 B;  4MTN A;  2K1B A;  1YHQ A;  3SK4 A;  5GQO A;  1G51 A;  4JBK A;  2F0V A;  4OO1 H;  1QVC A;  4RKL A;  1CA5 A;  4DV5 Q;  1CZW A;  4GNX C;  1KRS A;  4O1N A;  1X3E A;  3A56 A;  4A3M H;  1S4Z A;  4NXN Q;  4ME3 A;  1Y1V H;  2X69 A;  4JI5 Q;  1KD1 C;  1TT2 A;  4X3T A;  3CD6 A;  4KY7 A;  3I3C A;  1WYD A;  4C3I B;  4B3T L;  2PPB C;  2EZV A;  2A69 D;  1GKH A;  2R61 A;  3FKI B;  1PH1 A;  1X55 A;  1SE2 A;  1CKN B;  4NP5 A;  5GAH C;  2PNH A;  1HJP A;  1TS3 A;  1I6H B;  3RN5 A;  4HIM A;  1TY2 A;  1Y1V G;  3H15 A;  1AZP A;  5BR8 Q;  4DV4 L;  2ZT9 C;  2E2I B;  1ESF A;  1J6Q A;  1HFN A;  4A3B G;  3K7A B;  1Q1E A;  2MUY A;  1STB A;  1XMO Q;  4BBS B;  2DJF C;  2RSN A;  1I94 Q;  2B8G A;  3PF5 A;  3KOJ A;  3OHX C;  4AQY L;  1XNQ Q;  2JA6 H;  1DCZ A;  3WOF A;  1RJT A;  3M4Q A;  4GN3 B;  3I4N B;  1X3F A;  2EDG A;  3QR8 A;  1Q90 A;  3KF6 B;  4A3B B;  1A6X A;  4IUQ A;  3Q24 A;  1VF7 A;  1GUS A;  3B6Y A;  2VNU D;  3F8T A;  5J3B A;  4DNT B;  4MN3 A;  5DEH A;  4EQP A;  3J7A V;  1C0A A;  1V8Q A;  5C6A A;  3TP6 A;  3DMU A;  3SVM A;  5IWA Q;  1E1T A;  1QVF A;  1PZK D;  2E74 C;  2B2Y A;  5BR8 L;  3MAQ A;  3CME A;  1Q82 C;  4GS3 A;  4OL7 A;  2A68 C;  3L3O C;  4BA2 I;  3Q0A A;  4UP7 A;  5CMD A;  3ITP A;  3D0F A;  1R9T B;  1I3Q B;  3QO2 A;  3M4P A;  3W1G A;  1Q86 C;  4EVO A;  2JN4 A;  2XSC A;  3CPW A;  1JWM D;  1QZG A;  4DR4 Q;  2F0T A;  1SRU A;  4AYB B;  5IGC A;  2VW9 A;  1HRJ A;  1JE4 A;  3DWA A;  2BDO A;  2MQH A;  1SNQ A;  2AKW B;  4JI3 L;  3WOE A;  1N9W A;  3I56 A;  4JCV E;  1JJG A;  4TKO B;  4DV5 L;  2O5I C;  1Z47 A;  2IPK D;  5C0X G;  4DUY L;  3PMF A;  2CH4 W;  4DK1 A;  2BA1 A;  3R2T A;  1LTB D;  1FGU A;  2Q2U A;  3E6Z X;  3F1Z A;  3ULL A;  2F0U A;  3GTO H;  5ELB A;  1STY A;  2NN6 H;  2JK8 A;  2ENB A;  1KRT A;  4GLV B;  3NXW A;  1BKB A;  3J7Z C;  1YIT A;  2NVY B;  2KCT A;  3A54 A;  4LF4 Q;  3RD4 A;  2LS0 1;  3I72 A;  5I9P A;  2IX3 A;  3KUP A;  4IPH A;  1IYU A;  3DLL A;  3MFY A;  4OGQ C;  4TQU S;  3HEJ A;  4K6D A;  1VMC A;  3S16 H;  2RQX A;  1IXR A;  5CBA E;  3U50 C;  1GJX A;  1ML0 D;  1A63 A;  2B8F A;  5DM6 3;  2B2W C;  3HOV H;  1VQB A;  2CH4 A;  2XRQ D;  5T1G A;  3ZJY C;  4KKU A;  1YVC A;  4RWS C;  1D1I A;  2R7Z B;  1E7Z A;  4GKK L;  4LWC A;  3CC4 A;  4DV0 L;  2I5L X;  2I0Q A;  1L1O C;  3BG3 A;  1IYV A;  3E9I A;  3FP9 A;  2CCZ A;  1AP0 A;  2F0N A;  3A0J A;  4LF7 Q;  2NB0 A;  3G6J B;  4FP5 D;  1H9S A;  1F2Y A;  4P72 A;  5C3W A;  1KC8 C;  2PZU A;  2AHO B;  1LTI D;  2Z0S A;  1G2T A;  4JG2 A;  4RH6 A;  2VUM H;  1ONL A;  3U4Z A;  3NEM A;  4XQJ A;  3NTI A;  1JR0 D;  4HCE A;  2F0F A;  4FYD A;  2HD3 A;  3BZC A;  5I2X A;  1CK1 A;  1EQQ A;  1HR0 Q;  1PH8 A;  3T16 A;  2F0L A;  1T9H A;  1PRT B;  2N88 A;  1SNC A;  2K5V A;  5ELC A;  3A5U A;  4U67 3;  2VQE L;  3I4M B;  3URY A;  4X62 L;  1BVS A;  2PI2 A;  1G2S A;  1SR3 A;  1ICW A;  1AN8 A;  2Q2H A;  5D65 A;  1RTO A;  4IFD I;  1QIL A;  2L11 A;  2B2U C;  1LTR D;  1F9P A;  2E2J B;  3FHW A;  3GTM B;  2RA4 A;  4XQQ A;  1H95 A;  1XJV A;  3G48 A;  3RMH A;  4IPD A;  1SE3 A;  1SEB D;  1PHJ A;  1O78 A;  1A3U A;  1E3P A;  1I50 B;  1Y1V B;  4IUN A;  4A75 A;  1C8C A;  2SNM A;  1BNZ A;  2Q8T A;  1DYQ A;  4L5S A;  3HOX H;  5C0X J;  5F2D A;  5ELF A;  1V1P B;  1L1O B;  4JI2 Q;  5JPN C;  3CCM A;  3GTG B;  4JI2 L;  2RKS A;  4JI6 Q;  2A69 C;  4GNX A;  1E2V A;  3I4N G;  1KNA A;  5C5M A;  4N9T A;  2B2V A;  2RF4 A;  3H09 A;  3NUC A;  2XIW A;  2VQF Q;  1FR3 A;  3K0X A;  2N49 A;  1B1Z A;  3ERQ A;  3SE0 A;  3GO5 A;  2K52 A;  1PH3 A;  5A2Q L;  2PW7 A;  2Y0S G;  1I4P A;  1PTO F;  3J81 i;  1YZ6 A;  2J0T D;  4JBJ A;  4RFB A;  1K73 C;  1LTA D;  1PFB A;  4BA1 I;  1VQ9 A;  1HQM C;  1C48 A;  3H0G H;  4JI7 Q;  5FOB B;  1PTO B;  1PH5 A;  1YNX A;  5C3E H;  2VY3 A;  3W2D A;  2DY7 A;  5HY6 A;  1N34 L;  4KD3 A;  1EYG A;  1CKO A;  2A6H C;  3TDQ A;  5IWA L;  4ZK9 B;  4KV6 A;  4QL5 A;  3K7U C;  5IGD A;  4YWL A;  1HA6 A;  4C1N I;  1N36 Q;  2UU9 L;  3MXN B;  3L9A X;  2IHF A;  5JEA G;  3J81 j;  3H3V I;  3CQZ B;  4DR5 L;  3TN2 A;  1DJR D;  2PYK A;  2M2L A;  1S5F D;  2LY7 A;  1KDC A;  1NTG A;  2NVQ H;  1EL0 A;  1T5E A;  2OWO A;  2K01 A;  5FJ8 G;  1QZH A;  4FF1 A;  3CCJ A;  5C4J B;  1Y8O B;  2N3S A;  1QE6 A;  3U58 A;  2K04 A;  1K28 A;  2XWJ B;  1YNJ C;  1B44 D;  1X9N A;  1U9R A;  4H13 C;  1V1P A;  3C1F A;  2A5H A;  5DLQ E;  3BDO A;  4I7Z C;  3STB D;  5FLX L;  4Z9C B;  1PYB A;  2EE1 A;  4A3F B;  4PQX A;  4ZLT F;  4PNY A;  4JBW A;  1S5B D;  4FF4 A;  1HFG A;  3M7N A;  5EPJ A;  3LWU A;  3D4R A;  3UE0 A;  2K6A A;  4TVA B;  3CCQ A;  2I5H A;  1VQJ A;  5M3F H;  4IUV A;  1K8G A;  2JEB I;  3J7A F;  4PZ7 A;  1II3 A;  4DR1 Q;  1GUO A;  5JJZ A;  3ERO A;  5C3E B;  2K5H A;  1LT4 D;  1PTO C;  3GTJ B;  2E5L Q;  4J6H A;  5LL6 S;  2PO4 A;  3F2U A;  2A74 C;  1JOK A;  2DNC A;  2F0K A;  2RDG A;  4DN4 M;  4OIK A;  4MZ9 A;  4L63 B;  1K83 B;  3IAY A;  1GHJ A;  5C5L A;  4C1N K;  1X6O A;  4EQ5 A;  2ATW A;  1GD7 A;  5IP7 G;  1FNV A;  3NE5 B;  4BBR B;  5KNC A;  1D5X C;  3OWF A;  4OIJ A;  5CV7 A;  1KAB A;  3W5O A;  2WII B;  1PZJ D;  4PG3 A;  1RHP A;  5KEE A;  1XPU A;  1SE4 A;  1WCM H;  3H3V C;  3K5N A;  1EZ8 A;  2KUM A;  5FO8 B;  1LTS D;  4DUY Q;  1VCI A;  5C0X I;  2B2W A;  4YCW A;  3QOL A;  1SRO A;  1TY0 A;  3AFQ A;  4K0K Q;  3RZO B;  4DK0 A;  4RCO A;  2TMP A;  2RDF A;  1ENF A;  3QG1 A;  4POG A;  2ZTD A;  2RHS B;  3S2D B;  4LFA Q;  3TEH B;  1MI2 A;  2GN5 A;  3V96 A;  4HIK A;  1IZ6 A;  4LJZ C;  1VQP A;  1S5E D;  4A4I A;  2PNR C;  4IJL A;  1NR2 A;  1VQI A;  2F0O A;  4JI0 Q;  1TKW B;  3RZD H;  3KDF B;  2NVX B;  2ZJQ A;  5GAD C;  4IOC A;  4PZ6 A;  5GAE C;  3S24 A;  1ASY A;  3OW2 A;  1U5K A;  2IJ0 A;  3CHB D;  2CQO A;  1EZ6 A;  5EBC A;  4KY6 A;  4U68 A;  2IY5 B;  1Z6H A;  1UE5 A;  4CKC A;  2UUC L;  2CQA A;  1DXM A;  1XTC D;  4RGN A;  5D3D A;  1EY0 A;  3M7G A;  3QWN A;  4C3J B;  2JA5 G;  2UXB Q;  1JOR A;  2Z6K C;  4JV5 L;  3CCR A;  1Q8I A;  1IBM L;  3HOU G;  3PSI A;  1W6K A;  3GTK H;  1STH A;  1Y1W G;  4A3M B;  3JAM i;  3R8B A;  5NUC A;  3MTS A;  5LMU L;  1BCP F;  2YTX A;  3I70 A;  4HAE A;  4RAU C;  2IX1 A;  4X66 L;  3AB9 A;  1PLF A;  2XNA C;  3M3Y B;  2I46 A;  2P5Z X;  5JOB A;  4KHZ A;  1EIF A;  4IUP A;  4HJ5 A;  4H7B A;  3DUZ A;  1SMY D;  5FLM H;  3CAM A;  1LTL A;  3O13 A;  3JAM E;  2JYO A;  3GV6 A;  3G4S A;  2K33 A;  2Z1C A;  5J1Z A;  2EOT A;  1PRT F;  2O2L D;  1BO0 A;  5M5X H;  4ALP A;  2QEJ C;  1D7Q A;  5ELN A;  3FKI G;  3TP8 A;  5FLM G;  1CSQ A;  1L0X B;  4LAA A;  4QY7 A;  1SNP A;  4WJW A;  3IL8 A;  3H94 A;  3KLR A;  4L8J A;  3S1R H;  3LNN A;  5KYI A;  3MHB A;  4BY7 H;  2EY1 A;  2Y0S E;  4AYB G;  4A3L G;  1JB3 A;  2K5Q A;  1DZ1 A;  3SGI A;  4CJ2 C;  1SND A;  2HCC A;  2IL8 A;  1R4P B;  1F2M A;  1X56 A;  5BN4 A;  1UE6 A;  4QJF A;  5KIX A;  4IJH A;  4QMG A;  5COY A;  1VQL A;  1LT3 D;  4ZYS A;  3G7L A;  1C7Y A;  4K2K A;  1ET6 A;  2JXM B;  4HJA A;  4HJ9 A;  3I73 A;  3A8K E;  1N36 L;  2K5D A;  1TWA H;  1M8A A;  3I7F A;  3NK9 A;  4JC0 A;  1H9K A;  1M90 C;  1I3Q H;  1N32 Q;  2LXJ A;  5ELO A;  3QOJ A;  3D4D A;  4DAP A;  3S17 B;  4J1M A;  4MTK A;  5IY0 A;  4DPG A;  4P2C B;  2N8N A;  4IAL A;  3J80 i;  4BXX G;  3OMC A;  1LO5 D;  3FPP A;  2KCM A;  4NKL A;  1EYC A;  2EIF A;  2EXZ A;  3K5O A;  4K14 A;  1LTG D;  1TS2 A;  5C4H A;  4X3K A;  4CGY B;  5K36 G;  5LHY 1;  4GN4 B;  2R92 H;  3NPP A;  4DV1 Q;  4QIW B;  4C3H B;  2QCP X;  3I2Z A;  2SEB D;  3BJU A;  1STG A;  2Z4H A;  2BH8 A;  4B9X A;  3AQQ A;  1DGS A;  3M3Y H;  2F4V L;  2B2U A;  4O2D A;  3RLO A;  1Q1B A;  2EYP A;  4EQO A;  2OTJ A;  4FVM A;  1AFP A;  2PQA A;  5ELD A;  2C35 B;  4F88 A;  3HG9 A;  4IN3 A;  2UUB L;  2KCN A;  1W2B A;  2B39 A;  2AMC B;  1MSG A;  3NEN A;  4I7A A;  4DUZ Q;  1U0L A;  3E9H A;  3SK5 A;  3HGB A;  1VQ4 A;  4NDX A;  1A2U A;  3KYH C;  2IWH A;  5HUR A;  5IT9 E;  3DWQ A;  3CRL C;  5IT9 c;  4UP9 A;  1HUM A;  1HTP A;  1RD9 D;  1BBX C;  3TP7 A;  4OXP A;  2E2J H;  3H91 A;  1HNZ L;  1HZC A;  3KBG A;  3HOV B;  1O7Z A;  2OCE A;  4BBS H;  4XDX A;  2QDL A;  4DV6 Q;  2J7Z A;  3K5L A;  4JI4 L;  2EJG C;  4OON A;  4IPC A;  4HJ8 A;  4A3B H;  4CBV A;  1I6V C;  4WRD A;  4DR3 L;  4APV A;  3K6O A;  4XTC S;  3A74 A;  3M4Y A;  3IFD A;  1D5Z C;  2M00 A;  1VS0 A;  5D14 A;  4YWK A;  3PIO 3;  2AQ2 B;  4N8F A;  1HH2 P;  2R7F A;  1EYA A;  2RDH A;  1B53 A;  1SYD A;  3I55 A;  1VQN A;  2PZT A;  1EY6 A;  1Q81 C;  2UUA L;  2N55 A;  1IKL A;  5I6W A;  1IBL L;  1HNW L;  2O5J C;  3KDF A;  3S1M H;  1JE5 A;  2RVL A;  1JOQ A;  3GP7 A;  1IW7 C;  3CF5 A;  1SYE A;  4OEM B;  3GDE A;  1YHB A;  3T53 B;  3M4O B;  2GA4 B;  5IOD A;  4RA8 A;  2R6G A;  3KLS A;  2L55 A;  4DR6 L;  1Y8P B;  2PMZ E;  3KF6 A;  5M9O A;  3S14 B;  2Z6B A;  3CCS A;  3NHH A;  1VQF A;  1CI3 M;  1W3S A;  3L7Z C;  2Y0S B;  4LF7 L;  3KJO A;  4R4T A;  2OXP A;  1E0B A;  1XTD A;  1ESR A;  4NXN L;  4FXG C;  3WWV A;  5JJL A;  2NTS A;  3PUW A;  4UHV A;  2MO0 A;  3MA2 B;  2NVQ B;  1QG7 A;  2E2H H;  1TQO A;  1ENC A;  1GXD C;  1W6J A;  3NTK A;  3OIP A;  4K5W A;  4XT1 B;  4A93 G;  3K57 A;  2FMM A;  5L37 A;  5IGB A;  2HIV A;  5C4J H;  1I4G A;  3PO3 G;  1PRT D;  4DR7 Q;  1Q7Y C;  1YNN C;  4AH6 A;  1Z7T A;  2F0S A;  2QGQ A;  2OQK A;  3FPU B;  1ZXT A;  3HP3 A;  1EQT A;  3OIQ A;  3P75 A;  4JPB W;  3Q23 A;  2TSS A;  4A3C H;  3UE1 A;  1YNN D;  3NBH B;  3HRZ C;  4QUF A;  2AUK A;  2Q8R E;  1WTR A;  1WFQ A;  1K8O A;  4JI8 L;  5KND A;  4HIO A;  3SR1 A;  3D8G A;  2G9H D;  1PH6 A;  3S15 B;  4F87 A;  1IBM Q;  2B63 H;  4FDB A;  4ZQ3 A;  5HGT A;  2KVM A;  1QJO A;  3RUZ A;  4Y52 H;  4QGU A;  4RCN A;  4R8I A;  4R9W A;  1O7I A;  4K8I A;  4GNX B;  3H3V H;  1MKH A;  3PUX A;  2HUG A;  1SXT A;  4A3J B;  1RKN A;  1UWV A;  4BY1 H;  2B63 G;  5C44 B;  5FLX c;  4XYO A;  3S17 H;  5C3E G;  5IYC G;  3TS2 A;  1HQR D;  4GLA C;  2E2H B;  4ABN A;  3VR3 A;  5IIF A;  4X6A H;  2I5M X;  4LF8 Q;  3ULJ A;  2V1C C;  1EY9 A;  3M9B A;  1VQM A;  2ICI A;  2NUC A;  4IO9 A;  3UDG A;  4A3I H;  4L5R C;  3TME A;  1D8L A;  1AH9 A;  5IYC H;  4KHP L;  3GTM H;  1QUQ A;  2PQA B;  4A93 B;  2IX0 A;  2LMC B;  2X6L A;  3TZU A;  1X3Q A;  1I50 H;  4F7X A;  5JJK A;  1SMY C;  4CDE C;  5CYU A;  1XPR A;  3GTP H;  4A3I G;  4M8A A;  1B2T A;  2HIX A;  3EBE A;  1O80 A;  4OO1 G;  4JVZ A;  5C4X B;  2ZXR A;  1JT8 A;  1FJG L;  1SDF A;  4DV0 Q;  3CU7 A;  4RGO S;  1X3G A;  3FVQ A;  3GTJ H;  1WD0 A;  2HQE A;  4A3M G;  2MJ8 A;  5KGU A;  4ZRZ A;  5H1S E;  5M3M G;  4JI1 Q;  1RCV D;  3K80 C;  4Q5V A;  4C3I G;  1SLJ A;  1PH7 A;  2MHV A;  1XNR Q;  3VR2 A;  2NZO A;  2I07 B;  4J8Q A;  5EPL A;  1N32 L;  1IKM A;  2GVB A;  2YU9 H;  3IRB A;  2HT1 A;  3BZK A;  1EWH A;  2F0D A;  1IL2 A;  5DNF A;  4JOI A;  4B3M Q;  1VQE A;  4C3I H;  1XX8 A;  4A3E B;  5CV6 A;  1TWF H;  4C2M H;  1SN8 A;  4N9P A;  1HUN A;  1CQV A;  2PMZ B;  2R7D A;  2F3I A;  4IOA A;  3MXU A;  4DR6 Q;  4M1U B;  3PGZ A;  4MHE A;  1K3R A;  2DY8 A;  2DUD A;  4HED A;  2HHH L;  2WB1 E;  4BBR G;  5IP7 H;  1K8A C;  1AE3 A;  2JE6 I;  2JEA I;  2KQ3 A;  1N34 Q;  1GUG A;  4HR7 B;  1XWE A;  4E6I A;  4LUO A;  3HOZ G;  1LV9 A;  2HQL A;  3HKZ B;  2A6E C;  4GOP B;  4DV7 Q;  4LF8 L;  1PRT C;  1A3V A;  2L1B A;  1DOL A;  2EYL A;  3CC7 A;  4NB3 A;  1PVO A;  5HGQ A;  1B3Q A;  2KED A;  4XXE A;  2M9V A;  2JA7 B;  3J81 L;  3PO2 G;  1GO3 E;  5FK9 C;  3Q8D A;  2HHH Q;  5GAG C;  1HNX L;  5FJ8 H;  2DN8 A;  3K0Y A;  1ROD A;  2HCI A;  4B08 A;  1TVX A;  3PO2 H;  1I94 L;  3I4M G;  1Q3L A;  4C3J H;  4KN4 C;  3OW7 A;  2BH2 A;  3K59 A;  2F0G A;  3KF8 B;  2NVT B;  2WFW A;  5C0X H;  1IL8 A;  3A8I E;  4NXM L;  3C46 A;  1ASZ A;  2QEX A;  2MGS A;  1VQD A;  3FDT A;  2H5X A;  3HOY H;  5COR A;  1EOT A;  2D9U A;  1BUV T;  3J81 c;  2PW5 A;  2Z6K A;  3AMU A;  1TXY A;  1HCZ A;  1PDQ A;  1GOZ A;  3UDF A;  3S1M B;  4L5T A;  3GTQ H;  3VR6 A;  2J4X A;  3HKZ G;  1U4M A;  4JI5 L;  5IYB G;  2KA7 A;  2D2C C;  2VQF L;  5JEA J;  3A8J E;  1IHZ A;  3QJY A;  2DJG C;  1G6P A;  1JWU D;  3EFX D;  3AYH B;  4A3E H;  4P74 A;  5M5X B;  1OXT A;  3STB C;  1NMF A;  2EQS A;  3VYR A;  4ULL A;  2EY2 A;  3JC6 6;  1YEZ A;  1QNK A;  3CC2 A;  3GTL B;  2YTY A;  3WDN A;  1B8A A;  1YNJ D;  3AEV A;  1M1K C;  2B63 B;  3OTO L;  5E4W C;  1WTP A;  2BDN A;  3Q22 A;  2E75 C;  1U4R A;  3TS0 A;  1C4Q A;  2A68 D;  4KKT A;  4RHS A;  3ULP A;  1XXG A;  1WCM G;  1S72 A;  2UU9 Q;  3T1H L;  2UXC Q;  2D0O A;  2KCC A;  1DOM A;  3T56 B;  5FLX E;  1Y1W B;  1CFM A;  1CUK A;  3I91 A;  5M5Y B;  4YHH Q;  1Z9F A;  2ALY B;  3C2P A;  1HXY D;  3J80 c;  4HJ7 A;  4JI7 L;  2A6H D;  4A76 A;  2VUM G;  4CDC C;  2ZXP A;  5M3F B;  3CMA A;  3J81 E;  1TWH B;  1A62 A;  3S1Q H;  1PYW D;  1DOK A;  5C3X A;  1SYB A;  3L2P A;  1I4R A;  3IFT A;  2NTT A;  1PA6 A;  2OEO A;  3BDL A;  3S9W A;  4LK1 C;  2A73 B;  1TS5 A;  1TS4 A;  3LX0 A;  2QA4 A;  2WAC A;  1T5X D;  4MIU A;  3GTL H;  1SNO A;  5IT9 L;  4H0L C;  4X65 Q;  1EY5 A;  3HOY B;  1D1K A;  4H02 A;  4R4Q A;  2IHE A;  3D31 A;  3UDI A;  2UXD Q;  1S40 A;  4LMQ D;  2X6G A;  2JA5 B;  1PFM A;  4GN5 A;  1B7Y B;  4FXD A;  3HOU H;  1TU2 B;  1YBY A;  5AFW A;  1ZYR D;  5D3I B;  1VQ6 A;  1J5E L;  1EEI D;  1H9S B;  3MFG A;  3I4N H;  4LF6 Q;  3CXC A;  3BYT B;  2BE5 D;  1V1O A;  3I4L A;  1OO9 B;  1X54 A;  4HMI A;  4B3T Q;  2XVS A;  2RCF A;  2G5D A;  3FEW X;  3F2C A;  1BCP C;  5IYD H;  2B2T A;  1ZYR C;  1F2L A;  4R4I A;  3S14 H;  2N78 A;  1F9S A;  2YYZ A;  3OPO A;  3ND9 A;  1AEX A;  1SAP A;  2NZ1 D;  4QQB X;  1F9R A;  2B2T C;  5A2Q E;  1WJJ A;  3CW2 C;  1BXT A;  4XT3 B;  1A2T A;  1EIG A;  4WJ3 M;  4KTA A;  2YTV A;  3ZYY X;  1VQ7 A;  1XNQ L;  1L0Y B;  3BU2 A;  4DK6 C;  4LF9 Q;  3MVV A;  1BCP B;  5CGK A;  4JI3 Q;  5IOC A;  1VQ8 A;  1BDO A;  2CFM A;  2CWA A;  3J80 L;  1VQG A;  4QF4 A;  5I6Y A;  3MEH A;  1DD2 A;  1MJC A;  1WVL A;  1EYD A;  1A8V A;  1ILQ A;  1DON A;  3LWE A;  5EJW A;  2K50 A;  2PI2 E;  1Q8K A;  2AUJ D;  4JI0 L;  5JAV A;  1FD7 D;  5M5W B;  4KJO A;  3VYT A;  4YIJ A;  1LAB A;  3VYS A;  4C3H G;  1PH2 A;  1QOH A;  1V1Q A;  4B3R L;  3BVG A;  4B9W A;  2VUM B;  1YJW A;  4G7O C;  4ME5 A;  2WIN B;  2WV6 D;  3CKI B;  5CBE E;  5J39 A;  3D4W A;  4GOP C;  3EIV A;  1WTO A;  1MHW C;  3CCE A;  4A3D G;  2OTL A;  4H44 C;  4A3K B;  3CP0 A;  3T51 B;  1I6H H;  2VXW A;  5EKI A;  2VQE Q;  1Q12 A;  2JP1 A;  1RIP A;  1EFW A;  2H4O A;  5BN5 A;  5LMN W;  4BXX H;  1HZB A;  3G6E A;  2NWG A;  3SDZ A;  5M3F G;  4HTH A;  5EPK A;  4JI4 Q;  1X32 A;  3NP8 A;  3NQT A;  1AZQ A;  4A3D H;  5I2Y A;  3IKJ A;  3GTO B;  3F2B A;  5FO7 B;  4N8X 1;  3DWP A;  4XQN A;  1CKM A;  3AU7 A;  2KEE A;  4XYQ A;  1STE A;  2F0P A;  2CW0 D;  4LF6 L;  3EVQ A;  4PMW A;  4JK1 C;  4OWX B;  4S3S A;  1X3P A;  4DXF A;  2QDB A;  3D6C A;  3HOW G;  1BOS A;  1SYC A;  1YJ9 A;  1BF4 A;  1NJI C;  4KLK A;  4PMB A;  2FFK B;  1N33 Q;  3QIA A;  1F9Q A;  1GHK A;  2ZJP A;  4RMF A;  4KK7 A;  1KDB A;  2F0I A;  1LYL A;  4CKE A;  3Q6S A;  1K0R A;  4KKS A;  4LUZ A;  2MNA A;  4O42 A;  4GLX A;  1KAA A;  1E2W A;  1NE3 A;  2JQO A;  1WD1 A;  4A93 H;  1WTW A;  4V0B A;  2F0W A;  2XWB B;  3EJI A;  1FNU A;  1KLU D;  3KF8 A;  3S1R B;  1K83 H;  1VQA A;  1HPC A;  3DHQ A;  4ZCK A;  5IP9 G;  4OX9 Q;  1LT6 D;  1R9T H;  2IT1 A;  4WOR A;  4KHP Q;  4J15 A;  4IUT A;  5EQ0 A;  5LMN Q;  2WAQ E;  2VB3 X;  4HSV A;  1STA A;  1VQO A;  1KTK A;  4IUU A;  3FMC A;  1OXV A;  4RG1 A;  2EJF C;  3J80 E;  1RL2 A;  3T4A C;  5ISR A;  4X3U A;  2V4D A;  3HZX A;  1TWA B;  2HDL A;  1IBK Q;  3S1Q B;  1BQQ T;  5M5W H;  3CCU A;  3PQI A;  1V9P A;  3T1Y Q;  2B2Y C;  2WB1 B;  5M3M B;  5T1I A;  5K5P A;  1ENA A;  4YHH L;  4DXG A;  1ICF B;  1RTN A;  3TZD A;  3NBH A;  1BBW A;  1QUQ B;  1UUP A;  5AJ3 Q;  1VQ5 A;  1EIY B;  4P71 A;  4KHV A;  3MXP A;  5C4X G;  4L6T B;  1QVG A;  1RDP D;  4ID6 A;  3BZD B;  1LT5 D;  2E76 C;  2F0H A;  5GRO A;  4DK3 C;  5IGE A;  1B4O A;  4B3S L;  1HNZ Q;  3P7J A;  1L0W A;  4P73 A;  1N8R C;  2R92 B;  3PUZ A;  2EPB A;  4CDF C;  2DGY A;  2ID0 A;  2K14 A;  3UI2 A;  1HR0 L;  1B3A A;  3HS0 C;  5C4X H;  2JA7 G;  2FHT A;  3MEF A;  3G71 A;  2Q2I A;  3BYY B;  1M4V A;  4BS9 A;  1XMO L;  2ICE C;  1G6Z A;  5IGG A;  1Y1W H;  1P8L A;  3J7A 5;  1OXU A;  3TRE A;  4DR3 Q;  2XN9 C;  1TWG B;  2R93 H;  2KOL A;  3RNU A;  4XIG S;  5IGF A;  2F0E A;  3OOC A;  4JI6 L;  3CPF A;  4X64 Q;  4EQN A;  4DV3 L;  4CJ0 B;  2YU9 B;  2KJX A;  4ZAI A;  3C1E A;  4LFB L;  3X3M A;  3K58 A;  4LUV A;  1CQF A;  1TWC H;  1WOC A;  5EAY A;  1A15 A;  3PO3 H;  3D6W A;  1VMP A;  1CHQ D;  1CSP A;  5E3F A;  3PO2 B;  2K05 A;  2UUB Q;  1JJC B;  3FKI H;  5EBD A;  4YCV A;  2XRS D;  3H0G B;  1EY7 A;  1PTO H;  1QB5 D;  4A3C G;  4EGV A;  2BE5 C;  2JA8 G;  3MWY W;  4BY7 G;  2MO1 A;  2JA6 G;  3ND8 A;  1SJH D;  4ZKB B;  3V2T A;  2KHJ A;  4QUC A;  2K32 A;  3DM3 A;  4KY5 A;  4MNO A;  1VDZ A;  3U9O A;  4DR2 Q;  1EY4 A;  1SE8 A;  4V19 0;  2IW3 A;  2B2V C;  4BY7 B;  2E8G A;  2SDF A;  4CHT B;  1CT1 D;  1UAP A;  5C4Z A;  4YY3 Q;  3P1H A;  4X3S A;  3S2D H;  4BY1 G;  1S5D D;  2A1A A;  2H1E A;  1MBY A;  1NAP A;  3HOX B;  1TR5 A;  1CZG A;  1YJN A;  4A3K H;  3HOZ H;  1JIC A;  1CHP D;  4NMZ A;  4RHR A;  2JJQ A;  3K8A A;  1KLG D;  5DAU A;  1LUZ A;  1TWC B;  3PO3 B;  1VQC A;  3E3X A;  4LW1 A;  2BCO A;  4AQY Q;  3N6R A;  4DV6 L;  3VR4 A;  4OHJ A;  5K36 H;  1S5C D;  2NN6 I;  4P75 A;  2OT2 A;  4DR2 L;  1XMQ Q;  1CKN A;  1VQH A;  2L15 A;  3E0E A;  3OTO Q;  1SFO B;  3CRK C;  4DV4 Q;  4OWT B;  2JSO A;  2KEC A;  1WTX A;  5IE8 A;  4IQZ A;  1BCP D;  3HKS A;  4LF9 L;  4HSP A;  2KHI A;  4C3J G;  1UEB A;  1VF5 C;  2YV5 A;  3R2I A;  4DUZ L;  4QCL A;  3GTQ B;  3MXN A;  4A3G G;  3KJP A;  5C44 G;  1Y69 U;  2PCF B;  1LAC A;  3GTK B;  5CV5 A;  2A19 A;  4JBM A;  4X64 L;  2R3Z A;  2L12 A;  3NTH A;  1JJ2 A;  4Q0F A;  4G7H C;  3W3A A;  2ZM6 L;  3HFZ B;  2WKC A;  3OWE B;  1E2Z A;  4LFB Q;  3U4V A;  4A3G H;  4B3R Q;  5TSS A;  4YCU A;  4TRD A;  5C44 H;  4JYA Q;  2EY5 A;  1E1O A;  1FL0 A;  3KBX A;  4RGT A;  1H9M A;  4BBS G;  2RHQ B;  2VZA A;  3A55 A;  4DR7 L;  4LNQ A;  1KNE A;  1NSN S;  4CJ1 B;  3MC0 B;  4I65 A;  2CVR A;  3EQL C;  4AYB E;  1CM9 A;  1YIJ A;  4A3I B;  4A3E G;  2NBF A;  1V43 A;  1XYI A;  4K0K L;  3UDX A;  2E2I H;  1HZA A;  1B70 B;  1JMC A;  4GOP A;  2QF7 A;  3D3R A;  5G3L F;  2L5T A;  4K6L A;  1EY8 A;  5E7N A;  4F8M A;  1PH4 A;  2JA6 B;  4NXM Q;  3U9S A;  3CCL A; 
#chains in the Genus database with same CATH homology
 1VQL A;  3J80 c;  2KBN A;  3B6Y A;  4HJ7 A;  4JI7 L;  4A76 A;  3F8T A;  5J3B A;  1C7Y A;  2VUM G;  2VNU D;  4HJA A;  1WI5 A;  4HJ9 A;  3CMA A;  1GVP A;  1C0A A;  2ASB A;  4YY3 L;  1N36 L;  1IBK L;  1KL9 A;  5IWA Q;  1E1T A;  1TWA H;  1QVF A;  1A62 A;  3S1Q H;  3I7F A;  4JC0 A;  5BR8 L;  1M90 C;  3CME A;  1I3Q H;  4GKK L;  1Q82 C;  1N32 Q;  2LXJ A;  4GS3 A;  5ELO A;  4BA2 I;  4UP7 A;  3L2P A;  3D0F A;  5IY0 A;  1PA6 A;  3M4P A;  3W1G A;  4DPG A;  1Q86 C;  3KLW A;  5AJ3 L;  2N8N A;  3CPW A;  1QZG A;  2NVT H;  4JI8 Q;  3J80 i;  4BXX G;  4DR4 Q;  1SRU A;  2QA4 A;  2KCM A;  4DR4 L;  2XTI A;  3GTL H;  2D62 A;  2VW9 A;  3PUV A;  2EIF A;  4X65 Q;  1G29 1;  2MQH A;  4B3S Q;  2AKW B;  3I4M H;  1X65 A;  5K36 G;  4H02 A;  4JI3 L;  1N9W A;  4R4Q A;  4JCV E;  3I56 A;  5LMN L;  4GN4 B;  2R92 H;  1JJG A;  2IHE A;  3D31 A;  3UDI A;  4DV1 Q;  2UXD Q;  4DV5 L;  1S40 A;  1Z47 A;  2UXD L;  5C0X G;  4DUY L;  2NN6 G;  3I2Z A;  4GN5 A;  3BJU A;  3HOX G;  2KEN A;  2BH8 A;  1B7Y B;  2BA1 A;  3AQQ A;  1DGS A;  3S2H H;  2WP8 J;  3M3Y H;  3HOU H;  1FGU A;  3HOY G;  2Q2U A;  2CKZ B;  2F4V L;  4O2D A;  3PIO A;  3F1Z A;  1YBY A;  3RLO A;  1Q1B A;  3ULL A;  2F4V Q;  2OTJ A;  3T1Y L;  2UXB L;  1VQ6 A;  1J5E L;  2PQA A;  3GTO H;  2C35 B;  3VDY A;  3I4N H;  2UUB L;  1NMG A;  3L0O A;  1W2B A;  4LF6 Q;  3CCV A;  2AMC B;  2JK8 A;  3NEN A;  3CXC A;  2ZJR A;  1KRT A;  4GLV B;  1U0L A;  4DUZ Q;  1BKB A;  3J7Z C;  3E9H A;  1X54 A;  1YIT A;  4B3T Q;  5IYB H;  3PV0 A;  1VQ4 A;  3EN2 A;  2KCT A;  3I4O A;  3KYH C;  3RLF A;  4LF4 Q;  4WJ4 A;  3HOV G;  3F2C A;  5IT9 c;  4UP9 A;  5IYD H;  4IPH A;  3DLL A;  1XNR L;  4TQU S;  4OXP A;  2E2J H;  4DV1 L;  4R4I A;  2ZTC A;  1HZC A;  3RN2 A;  1HNZ L;  3S14 H;  2NVX H;  3S16 H;  2N78 A;  2OCE A;  4KI0 A;  1IXR A;  4BBS H;  2YYZ A;  4JOI C;  3U50 C;  4DV6 Q;  1A63 A;  1XPO A;  3H0G G;  4LFC Q;  2B29 A;  4QQB X;  1EOV A;  3HOV H;  1VQB A;  3ZJY C;  4JI4 L;  1WJJ A;  1TWG H;  1PFS A;  4OON A;  3CW2 C;  4IPC A;  1YVC A;  4HJ8 A;  1UE7 A;  4A3B H;  4WJ3 M;  2UXC L;  1FJG Q;  1E7Z A;  2YTV A;  4LWC A;  4DR3 L;  1GM5 A;  1VQ7 A;  4DV0 L;  3CC4 A;  1XNQ L;  4APV A;  2I5L X;  2I0Q A;  1L1O C;  3BU2 A;  4DK6 C;  4XTC S;  4LF9 Q;  3A74 A;  1J5E Q;  3E9I A;  3FP9 A;  4JI3 Q;  2CCZ A;  4X65 L;  1VQ8 A;  3OYY A;  2CFM A;  1VS0 A;  3ER0 A;  2CWA A;  1VQG A;  3A0J A;  1OXS C;  3PUY A;  4YWK A;  1HH2 P;  2VL6 A;  4UP8 A;  1HZ9 A;  2R7F A;  1NY4 A;  3I55 A;  1MJC A;  1SMX A;  1VQN A;  1A8V A;  4P72 A;  1KC8 C;  1Q81 C;  2UUA L;  2AHO B;  4DV2 L;  2K50 A;  2MFI A;  1Q8K A;  2PI2 E;  2Z0S A;  4JI0 L;  1IBL L;  1HNW L;  4JG2 A;  2VUM H;  3U4Z A;  3KDF A;  3S1M H;  3NEM A;  1JE5 A;  3BZC A;  1PH2 A;  1EQQ A;  1V1Q A;  3K81 C;  1HR0 Q;  1PH8 A;  4B3R L;  1MIU A;  1YJW A;  3PF4 A;  1KXL A;  2CWP A;  3LGJ A;  1T9H A;  3CF5 A;  4B3M L;  4LF9 L;  1A0I A;  4GOP C;  3EIV A;  4DKA C;  2K5V A;  3GDE A;  3A5U A;  3ICE A;  4LF5 L;  1YHB A;  3CCE A;  4A3D G;  2BA0 A;  2OTL A;  2NVY H;  1Y14 B;  3CP0 A;  3TQY A;  2R6G A;  4L5Q A;  2VQE L;  1I6H H;  4DR6 L;  4X62 L;  1BVS A;  2VQE Q;  1Q12 A;  2PI2 A;  4C3H H;  1RIP A;  1SR3 A;  2PMZ E;  2Q2H A;  1OTC A;  3KF6 A;  1EFW A;  4IFD I;  3ERS X;  5LMN W;  4BXX H;  1HZB A;  3CCS A;  3FHW A;  1VQF A;  1W3S A;  3L7Z C;  5M3F G;  4JI4 Q;  1XJV A;  1H95 A;  2NZH A;  4LF7 L;  4A3J H;  3G48 A;  3T1H Q;  4A3D H;  1EWI A;  4LFC L;  4IPD A;  4R4T A;  3RLN A;  3KJO A;  3F2B A;  1PHJ A;  5M3M H;  1XTD A;  1E3P A;  4NXN L;  3WWV A;  5JJL A;  3F2D A;  4A75 A;  1CKM A;  3HKZ E;  3PUW A;  4LF6 L;  2MO0 A;  4PMW A;  4OWX B;  4L5S A;  2R7Z H;  4JI1 L;  3HOX H;  5C0X J;  2E2H H;  4R1J A;  4A93 G;  4LFA L;  3HOW G;  1L1O B;  4JI2 Q;  1YJ9 A;  4A3J G;  1HR0 W;  2E5L L;  4GKJ L;  1NJI C;  3CCM A;  4LF7 Q;  1N33 L;  2HIV A;  4KLK A;  1K9M C;  4JI2 L;  1P16 A;  5C4J H;  1PYS B;  1N33 Q;  3PO3 G;  4JI6 Q;  4DR7 Q;  1Q7Y C;  4QIW E;  4GNX A;  2FXQ A;  2ZJP A;  4RMF A;  3I4N G;  1LYL A;  1K0R A;  2RF4 A;  4LUZ A;  4AH6 A;  2MNA A;  2R7Z G;  4PZ8 A;  1E24 A;  4GLX A;  1EQR A;  2QGQ A;  1NE3 A;  2JQO A;  2OQK A;  2XGT A;  4A93 H;  2ZM6 Q;  2VQF Q;  3HOW H;  3K0X A;  4A3C H;  2N49 A;  3UE1 A;  1K83 H;  3NBH B;  3GO5 A;  1VQA A;  5IYD G;  2K52 A;  4BBR H;  1WFQ A;  1PH3 A;  4JI8 L;  5IP9 G;  4HIO A;  2Y0S G;  4OX9 Q;  1FVI A;  1R9T H;  2IT1 A;  3J81 i;  1YZ6 A;  3NEL A;  1PV4 A;  4JBJ A;  4KHP Q;  1K73 C;  4J15 A;  4BA1 I;  1VQ9 A;  1PH6 A;  3H0G H;  4JI7 Q;  5LMN Q;  1IBM Q;  2B63 H;  2RCN A;  2WAQ E;  1OXX K;  2ZTE A;  1PH5 A;  4FDB A;  1KAW A;  1YNX A;  4OO1 I;  4UPA A;  5C3E H;  2VY3 A;  4GKJ Q;  1N34 L;  5HY6 A;  1VQO A;  2B3G A;  3K7A H;  4OWW B;  4Y52 H;  5JJI A;  4QGU A;  1OXV A;  4POF A;  4RG1 A;  1CKO A;  1O7I A;  5IP9 H;  5IWA L;  1EYG A;  4GNX B;  1Q46 A;  1RL2 A;  4QL5 A;  1MKH A;  3M85 A;  3K7U C;  5LMU Q;  3PUX A;  4YWL A;  3H3V H;  1N36 Q;  1IBK Q;  3MXN B;  2UU9 L;  2IHF A;  5JEA G;  5M5W H;  3RZO H;  1UWV A;  3CCU A;  4BY1 H;  3J81 j;  4DR5 Q;  3H3V I;  1V9P A;  3T1Y Q;  2B63 G;  2OQ0 A;  4DR5 L;  5FLX c;  1HNX Q;  5C3E G;  5IYC G;  4YHH L;  4GLA C;  3S17 H;  3TS2 A;  4HID A;  4X6A H;  2I5M X;  4LF8 Q;  1NTG A;  3ULJ A;  4DNI A;  2NVQ H;  2V1C C;  1BBW A;  3M9B A;  1QUQ B;  2OWO A;  1VQ5 A;  5AJ3 Q;  1EIY B;  4LF4 L;  4P71 A;  5FJ8 G;  1QZH A;  5C4X G;  1VQM A;  3A5Z B;  3CCJ A;  4IFD J;  1QVG A;  4O0A A;  2K4K A;  4IO9 A;  3UDG A;  2N3S A;  4A3I H;  4L5R C;  3U58 A;  4DV2 Q;  1JB7 A;  1D8L A;  5GRO A;  4DK3 C;  1IBL Q;  1HNW Q;  1AH9 A;  5IYC H;  3GD7 A;  1X9N A;  1HNZ Q;  4EX5 A;  4B3S L;  4KHP L;  1L0W A;  4P73 A;  1QUQ A;  1N8R C;  2PQA B;  3PUZ A;  3GTM H;  1LM0 A;  5DLQ E;  2DGY A;  2ID0 A;  2IX0 A;  2K14 A;  3STB D;  1HR0 L;  2JA5 H;  1PYB A;  5C4X H;  2JA7 G;  3G71 A;  3MEF A;  1I50 H;  2Q2I A;  4JBW A;  5JJK A;  1XPR A;  3GTP H;  5M5Y H;  4A3I G;  3M7N A;  1XMO L;  2HIX A;  4GKK Q;  3EBE A;  1Y1W H;  4OO1 G;  3UE0 A;  1E22 A;  1P8L A;  3J7A 5;  1OXU A;  4TVA B;  3TRE A;  3CCQ A;  4DR3 Q;  2I5H A;  1FJG L;  1VQJ A;  3W1B A;  4DV0 Q;  1KQS A;  2R93 H;  1JT8 A;  3RNU A;  5M3F H;  4XIG S;  1K8G A;  1X3G A;  3GTJ H;  2JEB I;  4PZ7 A;  1UE1 A;  4DR1 Q;  4A3M G;  5H1S E;  2JA7 H;  3S15 H;  4R4C A;  2K5H A;  4JI6 L;  5M3M G;  2K5N A;  3CPF A;  4JI1 Q;  2GVA A;  2E5L Q;  1TWH H;  4X64 Q;  3K80 C;  3PCO B;  4X66 Q;  4R4O A;  4DV3 Q;  1KHI A;  1SLJ A;  4DV3 L;  1PH7 A;  1XNR Q;  2R93 G;  2NZO A;  4LFB L;  1MJE A;  4MZ9 A;  1IYJ B;  4LUV A;  3RR5 A;  3AFP A;  1TWC H;  1WOC A;  5EAY A;  3PO3 H;  1N32 L;  3CQZ H;  2GVB A;  3PIP A;  1X6O A;  3IRB A;  2YU9 H;  2HT1 A;  3BZK A;  4EQ5 A;  2ATW A;  1CSP A;  1GD7 A;  5IP7 G;  1IL2 A;  4JOI A;  2EXD A;  1JJC B;  3FKI H;  2UUB Q;  4B3M Q;  1VQE A;  4Y7N H;  4DAM A;  4C3I H;  2AWO A;  4YCV A;  1TWF H;  4C2M H;  1SN8 A;  2AWN A;  2VS1 A;  3W5O A;  2WB1 G;  4X62 Q;  1XMQ L;  2R7D A;  2Q2T A;  1PH9 A;  4PG3 A;  4A3C G;  3JAM c;  2JA8 G;  2F3I A;  4IOA A;  4DR6 Q;  4BY7 G;  4A3L H;  2MO1 A;  3PGZ A;  1XPU A;  1K3R A;  1WCM H;  2DUD A;  2HHH L;  1L1O A;  2JA6 G;  4IFD G;  2WB1 E;  1EUJ A;  4BBR G;  4DAY B;  1VQK A;  5IP7 H;  3M4O H;  4JV5 Q;  1K8A C;  4DR1 L;  1AE3 A;  2JE6 I;  2JEA I;  1N34 Q;  2KHJ A;  4DUY Q;  1VCI A;  5C0X I;  4YCW A;  3DM3 A;  2UUC Q;  1SRO A;  3AFQ A;  4MNO A;  1NBW A;  4DR2 Q;  4A3F H;  1SE8 A;  4K0K Q;  1YHA A;  4IPG A;  2JA8 H;  1BBU A;  4LUO A;  1YI2 A;  3HOZ G;  2D0P A;  2HQL A;  4POG A;  2E8G A;  2ZTD A;  2RHS B;  4GOP B;  4UY8 C;  4DV7 Q;  4LF8 L;  4NPS A;  4LFA Q;  3TEH B;  4DV7 L;  3CC7 A;  4NB3 A;  1PVO A;  5HGQ A;  2GN5 A;  2K75 A;  4YY3 Q;  2A8V A;  4HIK A;  2ES2 A;  1IZ6 A;  3S2D H;  4BY1 G;  4YWM A;  2A1A A;  4A3F G;  3PO2 G;  1GO3 E;  1VQP A;  2F52 A;  2JA9 A;  1YJN A;  4A3K H;  4A4I A;  3GTG H;  3HOZ H;  4JYA L;  4IJL A;  2UUA Q;  1KIX A;  1VQI A;  4JI0 Q;  2JJQ A;  3RZD H;  3KDF B;  3Q8D A;  2HHH Q;  3K8A A;  1I5F A;  5GAG C;  5GAD C;  2ZJQ A;  4IOC A;  1LUZ A;  1HNX L;  5FJ8 H;  4PZ6 A;  1C9O A;  1S3O A;  5GAE C;  3S24 A;  1ASY A;  3OW2 A;  1U5K A;  1VQC A;  4LW1 A;  4AQY Q;  3KFU A;  2CQO A;  4DV6 L;  2LXK A;  3PO2 H;  1I94 L;  3I4M G;  2NN6 I;  4P75 A;  4C3J H;  1SFO H;  4A3K G;  4DR2 L;  1XMQ Q;  2R92 G;  1CKN A;  1UE5 A;  1VQH A;  2BH2 A;  2L15 A;  4OX9 L;  2UUC L;  2IY5 B;  3KF8 B;  4AIM A;  3E0E A;  4LF5 Q;  3S1N H;  2WFW A;  4NXM L;  3G6E A;  1AE2 A;  2WAQ G;  3OTO Q;  2LSS A;  1L2F A;  3TRZ A;  1ASZ A;  2QEX A;  4DV4 Q;  2JA5 G;  2UXB Q;  2Z6K C;  4JV5 L;  4MTN A;  1VQD A;  3CCR A;  1IBM L;  2H5X A;  4OWT B;  3HOY H;  3PSI A;  3HOU G;  5IE8 A;  1YHQ A;  3HKS A;  5GQO A;  3J81 c;  2KHI A;  1G51 A;  1UEB A;  2YV5 A;  4DUZ L;  1Y1W G;  4JBK A;  3GTK H;  1QVC A;  3JAM i;  4A3G G;  2Z6K A;  5LMU L;  2YTX A;  4DV5 Q;  1TXY A;  3KJP A;  5C44 G;  4X66 L;  2IX1 A;  4GNX C;  3UDF A;  1KRS A;  1X3E A;  4L5T A;  4A3M H;  3GTQ H;  4NXN Q;  2A19 A;  4ME3 A;  4JBM A;  3HKZ G;  4X64 L;  4JI5 L;  5IYB G;  1Y1V H;  4KHZ A;  1EIF A;  4JI5 Q;  1KD1 C;  4HJ5 A;  1JJ2 A;  3CD6 A;  2ZM6 L;  2VQF L;  1WYD A;  3HFZ B;  5JEA J;  4B3T L;  1GKH A;  4LFB Q;  3U4V A;  1G6P A;  5FLM H;  4A3G H;  4B3R Q;  3CAM A;  1LTL A;  1X55 A;  3AYH B;  4A3E H;  1PH1 A;  4P74 A;  1CKN B;  4YCU A;  1OXT A;  5C44 H;  3G4S A;  4JYA Q;  3STB C;  1E1O A;  1NMF A;  1FL0 A;  5GAH C;  2EQS A;  2PNH A;  1HJP A;  3JC6 6;  1YEZ A;  3RN5 A;  4BBS G;  2RHQ B;  4HIM A;  3CC2 A;  2VZA A;  2YTY A;  1Y1V G;  5M5X H;  4ALP A;  4DR7 L;  1B8A A;  3H15 A;  4LNQ A;  3AEV A;  1M1K C;  1D7Q A;  3OTO L;  5ELN A;  5BR8 Q;  4DV4 L;  3FKI G;  1J6Q A;  5FLM G;  1CSQ A;  4AYB E;  1YIJ A;  4A3B G;  3TS0 A;  1Q1E A;  4QY7 A;  4A3E G;  1V43 A;  1XMO Q;  4K0K L;  3UDX A;  2E2I H;  1HZA A;  1B70 B;  3S1R H;  1I94 Q;  1JMC A;  4BY7 H;  4GOP A;  2Y0S E;  3PF5 A;  4AYB G;  3ULP A;  4A3L G;  3KOJ A;  1XNQ Q;  4AQY L;  1WCM G;  1S72 A;  2UU9 Q;  2JA6 H;  3SGI A;  3T1H L;  2UXC Q;  3M4Q A;  4GN3 B;  2D0O A;  5E7N A;  1X3F A;  1X56 A;  1UE6 A;  4QJF A;  1CUK A;  3KF6 B;  1PH4 A;  4YHH Q;  1Z9F A;  2ALY B;  4NXM Q;  4IJH A;  3CCL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...