1EFID

Heat-labile enterotoxin b-pentamer complexed with para-aminophenyl-alpha-d-galactopyranoside
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HEAT-LABILE ENTEROTOXIN B CHAIN)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1efiD00
4DXGA 1EEFD 1JWMD 2XN9C 4L6TB 1UNSA 1RCVD 1LO5D 4DXFA 2IJ0A 1B1ZA 1LT3D 1RD9D 3URYA 2AQ2B 1LT6D 4RGTA 2NTTA 2Z8LA 3BVZA 1BCPB 1XXGA 4O1NA 5FK9C 2G9HD 1EFID 1M4VA 1I4RA 3OWEB 1JQYD 1EU3A 1EU4A 1F77A 1TS4A 4TSSA 1FNVA 1GOZA 3MC0B 1FNUA 1LTTD 1S5DD 2ICIA 1FGBD 1I4QA 2WV6D 1BCPF 3DWQA 3DWPA 2NTSA 5I4DA 1BCPC 2RDGA 4L63B 1SBBB 1JWSD 1LTBD 1SE4A 4RFBA 1S5FD 4RGNA 4RHSA 1I4PA 1SEBD 1B44D 1SJHD 1PTOB 2SEBD 1DYQA 1ESFA 3KLSX 4RGMA 1BCPD 1PZKD 3BYTB 4RH6A 5ELDA 1S5CD 1TY2A 2XRQD 3DWAA 4RGOS 1HQRD 5D3IB 1G8ZD 1TS3A 3BVMA 3O13A 1V1PB 1MD2D 1LTAD 2J4XA 1PTOH 2QEJC 1JR0D 1LTRD 1D5XC 4UDUC 1KTKA 1V1OA 1L0YB 5ELCA 4RCOA 1D5MC 1EWCA 3BZDB 4Z9CB 3EA6A 1PYWD 1V1PA 1HTLD 1JWUD 1HXYD 4OHJA 3TSSA 3V05A 1PRTB 5FKAC 3MFGA 1KLGD 3BYYB 3BVGA 1I4HA 2XRSD 3R2TA 3GP7A 1RF2D 2AQ1B 3R8BA 1LLRD 1UUPA 4RHRA 1I4GA 2XNAC 3EFXD 1DJRD 1FNWA 3R2IA 1I4XA 4C56C 1TS5A 1ET9A 1LT4D 3W2DA 1LTID 2IPKD 2TSSA 1S5BD 1TS2A 2QILA 3CHBD 1STEA 1PRTF 1CT1D 1AN8A 1ENFA 1BXTA 1KLUD 1LTSD 1PRTC 1S5ED 3SEBA 1PZJD 1LT5D 5ELEA 1L0XB 1CHPD 1PTOF 1RDPD 2AQ3B 1TY0A 1CK1A 1QILA 2CHBD 1LTGD 1PTOC 1SXTA 1JCKB 1FD7D 1CHQD 1CQVA 5D3DA 2O2LD 1PZID 1EEID 1SE3A 1HA5A 2RDHA 1PRTD 5TSSA 4ZYSA 1D6EC 5ELFA 1ET6A 2R61A 1SE2A 1D5ZC 1SJED 1PTOD 1T5XD 1XTCD 4BWGB 5ELBA 1AW7A 4K6LA
chains in the Genus database with same CATH superfamily
3OIQA 1EEFD 5EQ0A 1Q12A 3HOYG 4R8NA 1UWVA 2JXMB 2A8VA 4DUYQ 4A75A 5I2YA 1GD7A 3BS1A 3P1HA 3HP3A 4OO1H 2G9DA 1SYGA 3SHLA 4AQYL 3K57A 2DNEA 4A3JB 1ZXTA 4J1MA 1CZWA 5C3WA 5C3EH 3TEHB 2NVQB 4IOCA 1O80A 3I7FA 2MO0A 3S1RH 5IOCA 1S5DD 2JN4A 2L11A 5GAHC 3I4MH 3E5SA 2AWOA 3OYYA 2L0CA 1BCPF 3ICEA 1MKHA 2RDGA 5A2QL 4ME3A 3LWUA 5EKKA 5EKIA 4EVOA 3GTJB 3GTLB 1SEBD 4OWWB 1PTOB 4G7ZC 1BUVT 3GQBA 4DF7A 1S5CD 2XRQD 1VDZA 1G8ZD 5JVH3 3O13A 1SE8A 4C3JG 1VQGA 1LTAD 5KGUA 4QUFA 3DHQA 3KLRA 1PV4A 4KN7C 2JA7B 1Y8NB 2B2VC 4JI2Q 1C7YA 3PCOB 1PH5A 2L15A 3S14H 1C8CA 2JEAI 1A8VA 2JA6G 2NVTB 4LFCL 1X65A 3ITPA 5I2XA 4HEDA 3NTKA 1IW7D 2F0JA 1KNEA 3HG9A 3MFGA 5G3LD 3VR3A 3BYYB 3H0GG 4JI8Q 1EZ6A 3BZKA 4GOPA 1ZKOA 1BKBA 3MA2B 2EYOA 4YCWA 3RZOB 2OTJA 5LL6S 1K73C 3CMEA 2OQKA 3HS0C 2PZUA 5CBAE 3PO2H 3ULJA 1PH4A 4KHVA 2EJGC 5ELEA 1NJIC 1CK1A 4YIJA 1PTOC 2FMMA 4C3IG 1L0WA 1PDQA 5M3MB 2O2LD 1D1IA 1PZID 1WJJA 3A0JA 1EIHA 5CORA 2F0HA 4GN5A 1NNXA 4CHTB 1GUGA 1IBML 3ONAB 1VQ7A 4RKBA 3FP9A 4B9XA 4C3JH 1GHKA 5BR8Q 2R93B 1F9SA 4NMZA 4KHZA 2NWGA 1QVFA 1AFPA 1JWMD 3S15B 3PF4A 2V4DA 4G7HC 1OTCA 4BBSH 1MBYA 3HRZC 2JA6H 3C1EA 3NQTA 4HMIA 5CGKA 1A2UA 1SYFA 1KRTA 4ZLTF 3NWTA 1KDBA 2M2LA 3BVZA 3FPUB 3J7A5 1XXGA 4P74A 4ZAIA 5C0XI 2FFKB 2IHEA 2E2HB 3G71A 2UUBL 3Q8DA 3N52A 4R4IA 1X32A 4XQQA 1FNVA 3TREA 2JSOA 1B9MA 1JICA 2JA8B 4GKKL 2NZHA 1N8RC 4R4QA 1UE5A 4JCVE 4GOPB 3M9BA 1FJGL 1BF4A 1P16A 3M3YH 3HOZH 4C3IH 2UXCL 5IGDA 4DV3Q 3GV6A 4JI3L 2CKZB 2EY2A 5KRUA 2ZXRA 3K6OA 4G57A 2EPBA 3S1NB 1I5FA 4OELB 2NZOA 4LW1A 4X65Q 3KBXA 2A68C 4A3FG 1WI5A 1VQAA 1WOCA 3AQQA 1HNWL 1HZAA 1ONLA 4CBVA 5M5YB 1YNJD 2JYOA 2DJFC 3I70A 2Q2HA 1FL0A 1K8GA 1D5MC 2EXDA 5C4HA 4CKCA 3IAYA 3A7LA 3PUXA 1X3EA 2EY6A 1IYJB 4A3GB 1HXYD 1JOQA 1EL0A 3PO3G 1EQRA 3GP7A 4ID6A 2LS01 1UUPA 1Q8IA 3VDYA 1ICWA 2FINB 3IFDA 4C2MB 3S1QB 2D62A 1I4XA 2F0PA 2OXPA 1EOVA 4HJAA 4GOPC 2KHJA 2RDFA 2F0GA 2QILA 2E5LL 3I4OA 2FJ2A 4DV7L 1BOSA 1PZJD 1UE7A 2NB0A 2VS1A 2N55A 1VQNA 2ZTEA 5ELOA 5KEEA 2F0EA 2UU9L 3FVQA 2RDHA 4QB4A 4QGUA 1K8MA 4A3FH 5BN4A 2PPBC 2JA5B 4I7ZC 1G51A 3T56B 4L5TA 4CDFC 5M3FH 1WD0A 2R7ZB 1Q86C 2BE5D 1GXDC 1DOKA 1DZ1A 1D2BA 1BNZA 4A3EH 4K5VA 2J0TD 1TWHH 5C3EB 3M4OB 3D4DA 2VW9A 2NN6I 1G6PA 2K50A 2XVSA 1VMPA 4OIKA 2N78A 1N34L 1HNZL 4EGVA 4BXXG 3KUPA 5IWAQ 5CV8A 1EU3A 1EZ8A 4P2CB 1OXVA 2JE6I 2L4NA 1TT2A 3KOJA 4MHEA 2UXBQ 3J81j 3T1YQ 1E3PA 1TXYA 1FNUA 1S72A 2I5HA 5H1SE 1KD1C 3DWPA 2VY3A 1WFQA 3KLWA 1V43A 2J7ZA 1JWSD 5C4XG 3NTHA 4LF4L 2HQEA 2IT1A 2UUAQ 4CJ1B 1JB7A 2YTYA 2XWBB 1JC7A 2A69D 5ELNA 4RGMA 4A3IH 4HN7A 1GUTA 4LNQA 1X3QA 4YHHQ 1VQBA 5FJ8G 5C6AA 1SNDA 2Z6KA 5EGTA 2JP1A 4IUTA 5G3LF 1PLFA 3LWEA 1HCZA 1L0YB 1ZEQX 1EIGA 4OXPA 2ZJPA 2HCIA 1VCIA 4X66Q 1X3FA 5DAUA 1HTLD 3MXNA 4OX9Q 1U4RA 2GN5A 1HR0Q 3VYTA 4HCSA 4ZKCB 4EQOA 2BDNA 4Q0FA 2VB2X 3IKJA 1RF2D 1TU2B 4N9PA 4LF8L 1Q8KA 3PO2B 2KA7A 4HR7B 1J5EQ 3ND8A 4GNXA 2E8GA 2YYZA 3PUZA 1EQVA 5EPLA 1LT5D 4KMUC 1X55A 3VYSA 1EWHA 1QNUA 1CKNA 2AQ3B 2L1BA 4E6IA 4X64Q 1DONA 1MI2A 1Y8PB 4BBRG 4A3MB 4ZUJA 2B63H 3G7LA 1EEID 3I2ZA 2CCZA 4WJ4A 4QMGA 1FVIA 2R61A 1SJED 4IUPA 5FJ8H 5FLMH 3FKIH 3GO5A 2PO4A 1RIPA 2KCNA 3GDEA 1N33L 4LUVA 3DEOA 4YY3Q 1HZBA 4LF5L 3GTPB 2K03A 1G91A 4OWXB 1EIYB 3JAML 4DR3L 1YIJA 3PV0A 3GTOB 3QJYA 2Y0SE 5E7NA 2CVRA 4PMBA 3CCRA 3A55A 2MJ8A 3P75A 4C3HB 4A3JG 3AMUA 1F9RA 1ASYA 2G5DA 2QDBA 4KTAA 1GOZA 3MC0B 1F2MA 2K4KA 2KHIA 4ZKBB 2YTXA 2F0LA 2NTSA 1BCPC 5CV5A 4JI0Q 4DAYA 1OO9B 2PI2E 4DAMA 1G2TA 5IP9G 4JI7Q 1HNXQ 3K80C 5E4WC 3C2PA 2MFIA 3WOEA 5IGEA 2D0OA 1IZ6A 1K3BC 2MPMA 2RHSB 1TS3A 3LGJA 1XPOA 2HQLA 3ND9A 4O2DA 4ILWA 2N3SA 5BN3A 2K5DA 1KTKA 2F0WA 3A8KE 3F2DA 2Z6KC 3V2TA 4K0KQ 2KEDA 3NHHA 2JA7G 1BVSA 3T13A 2LXKA 1I6HB 1YNND 3V05A 2VZAA 1C48A 2A5HA 4EQNA 1CFMA 3R2TA 4A3DB 3GTMB 4A3LG 3E6ZX 3J81L 1LLRD 4JV5Q 4WJ3M 4DR1Q 1CTMA 3CU7A 3F2BA 4A3BG 2L12A 3SK6A 1UE1A 3NELA 1TS2A 4GNXC 4LF6Q 2UUCQ 1NBWA 3WOFA 1LTGD 1YZ6A 1EY9A 1JCKB 1ESRA 3U4ZA 4B3TQ 3OTOQ 3MZ5A 2OCEA 5M3FB 3GTGB 3MVVA 3T51B 2VUMB 4DV0L 2F0NA 1G6ZA 1A0IA 1P8LA 1XTCD 3KF8A 1L2FA 4QIWE 4DR6Q 2JK8A 4ZRZA 4AYBB 1UNSA 2EVBA 1XMOL 2Q8TA 5C0XG 2VL6A 1JE4A 3AU7A 3RN5A 1RTOA 2R93G 2D5DA 1Q1EA 4HJ7A 4TRDA 3HOVG 5KYLA 2CH4A 3K5NA 2RKSA 4KJOA 1IKLA 1LTLA 4GLVB 2F0TA 1Y1VB 1H9SB 3QOLA 1E22A 1SROA 3I90A 2BA1A 4DR7Q 2DGYA 2OTLA 3RR5A 1JQYD 1M8AA 1B7YB 4TVAB 2NVYH 5C4JH 4HJ8A 1C9OA 3KLSA 4DR2L 4IJLA 3H3VH 4J6HA 1HZ9A 2IHFA 1TWGH 4L63B 2M9VA 4K2LA 3U9OA 1XJVA 2LSSA 3OHXC 1XNQQ 1K83H 2ATWA 4RFBA 3Q23A 4B3ML 5IIFA 2YU9H 1SFOB 2TMPA 2ZTCA 4RH6A 1NMGA 4IPGA 3BVMA 3M4QA 5FLXL 3D3RA 4A3KB 1MD2D 3UI2A 1D5XC 3MFYA 4DV2L 3HOVH 3KF6A 4PG3A 2HT1A 1QCBD 1GVPA 1TWCH 3H15A 4HJ9A 3CCVA 5C4ZA 1IL2A 1H9MA 4G7OC 1PH8A 2K28A 2N88A 4LF9Q 3PIO3 4R4CA 4XDXA 1Q82C 3V96A 4DK0A 1VQIA 3CQZH 1I4GA 1EY6A 3CF5A 1DJRD 1BO0A 1SRUA 1LYLA 2F0IA 1STHA 2Q8IB 1VQCA 4LFCQ 3I4NH 2EOTA 1V9PA 5JPNC 4Y7NH 3TQYA 5ISRA 4APVA 1B9NA 3OW7A 4KHPQ 3L3OC 5LMNQ 2HDLA 1X3PA 2F0MA 5IYBH 3PIP3 3MXPA 1CHQD 1K9MC 3DEPA 4DUZL 4DA2A 3CW2C 1R9TH 5C44B 1YHAA 1HRJA 3BJUA 2PI2A 4NXNL 4BWGB 5LMUL 2B39A 2YV5A 1QUQA 3HGBA 3OIPA 2NN6G 2WB1E 2KCTA 4A93B 1BBWA 2JA5G 2AQ2B 1G291 4DK6C 1IBMQ 3UDIA 2F0QA 3NEMA 1XNRL 4EQPA 5KIXA 2R7ZG 1K8AC 2NTTA 5CV9A 3CC2A 2MQHA 2Q2UA 1QOHA 4O0AA 3KF6B 1NUCA 3DM1A 1CSPA 2LKVA 1ASZA 2LMCB 3G4SA 3HFZB 3LNNA 1E7ZA 3J7AV 4H44C 2F3WA 2K01A 1B3AA 4TSSA 2Z0SA 1W6JA 4LUZA 1I6VC 2F4VL 3S24A 1CA6A 4CJ0B 2HHHL 2FXQA 3C1FA 1O7LA 3W1BA 4DR5L 1F2LA 4HJ5A 4GKKQ 2K05A 4X3SA 5DLQE 3S16H 3J7ZC 1S3OA 1FJGQ 3L9AX 2A6ED 1SLJA 1B3QA 2K04A 3HOUH 3RN2A 2BCOA 2F0VA 4V190 2UXCQ 3AYHB 4JI3Q 2ZT9C 1IW7C 3J7YW 1V1OA 3CPWA 3U58A 1A3VA 5NUCA 4DNIA 1QZGA 1WTXA 2E2IH 1HNWQ 2DY8A 1TWAH 2EYPA 3J81i 2AUJD 4A3CG 3NBHA 3PUVA 4KY5A 1JE5A 1A62A 3Q22A 3CCLA 3S2HB 4LFBL 3GTKH 1FNWA 2B2UA 1QWYA 2IPKD 3NWSA 3HOYH 1ZYRD 3E3XA 5DM63 1STEA 1MHWC 4BY7B 4KKUA 5C0XJ 1E1OA 2EYMA 2VQEQ 1SXTA 2QA4A 3J80i 1N36L 2WAQG 1SSOA 4OL7A 5K36G 1LACA 2R3ZA 1PRTD 4U68A 3F2CA 2E5LQ 3QIAA 2WP8J 4H7BA 2IX0A 3QWNA 3T53B 4DN4M 1T5XD 4A3MG 4IFDG 3D4RA 1W2BA 1IBKL 5FOBB 3HOXB 4JI6L 1YHBA 4B08A 4GKJL 2UU9Q 2WAQE 1KDCA 4AIMA 5HGTA 2B2WA 2JJQA 3T1HL 1QJOA 1EQQA 5C4JB 4V0BA 4P72A 3BDCA 2WIIB 4ZCKA 2H4OA 2RF4A 3A56A 4DV6Q 4KKSA 1EU4A 4BY1B 1TS4A 3CXCA 2SNMA 4DKAC 4LJZC 2NUCA 5A35A 4RMFA 3Q0AA 1WCMB 2VQFL 1STAA 5DEHA 4HSPA 2FHTA 5DNFA 5JAVA 1EY8A 2EYLA 3R3OA 3TP6A 3PGZA 4QL5A 1IKMA 1UEBA 3H3VI 1PFMA 3H0GH 1B44D 1RTNA 1IYUA 1ESFA 3VR6A 1YNJC 2E2JH 1PZKD 1V1QA 4R1JA 4YCVA 1HQRD 2D9UA 5D3IB 2FMCA 2R92G 5J3BA 4MZ9A 4QUCA 1IL8A 1PYBA 1NSNS 3F8TA 5GADC 3FHWA 1KDAA 1SYBA 1O7ZA 3IRBA 4WJWA 3EROA 1PVOA 1R4PB 3CQZB 5J39A 1V1PA 2OQ0A 5LL6X 3HKZB 1GUWA 1H95A 3NQIA 3H3VC 5CR3A 3I4NB 4DV4L 2PQAA 5IGBA 3MTSA 1WTPA 1JJGA 1KL9A 2IY5B 3HOWB 4FP5D 4A76A 1VQLA 1ENCA 1KQSA 4YWMA 1II3A 2B2UC 2BH8A 2K5WA 3SXHA 1BXTA 2ENBA 4DAPA 4IALA 3VR5A 5JJIA 3KJPA 4LF8Q 2ZXOA 3VA5A 4R9WA 2NVXH 1PFBA 3CD6A 2XGTA 1E0BA 5BN5A 1CM9A 2BE5C 1JJCB 4JPBW 2ZM6Q 4I7AA 3RZDB 2R92H 2HIXA 2IX1A 1JORA 1MSGA 1PHJA 2R7FA 4HIDA 2WACA 1XWEA 3GTQB 1MIUA 1XPUA 4UHVA 1AH9A 2V1CC 3JC66 5CV4A 3W1GA 5CC4A 3RUZA 5EPKA 1PH9A 1B50A 2B2WC 1GHJA 3EVQA 2AHOB 4B3RQ 1UEAB 4H02A 1Y1VG 3RD4A 5IGFA 3I8ZA 4LF5Q 2A6HD 5FO9B 3TDQA 1JJ2A 2L55A 1VQFA 2WB1B 1VQEA 1GUSA 4FF3A 5C5LA 2C5CA 3F1ZA 4QCLA 4DR3Q 2PNHA 4DV1Q 2BOSA 4P73A 1H9RA 2WINB 4ME5A 3U4VA 3UDGA 3SVMA 2A69C 3CC4A 1IHZA 4K6DA 1DOMA 5KYIA 1WTOA 2EIFA 4NXMQ 1S4ZA 1DYQA 3PO3H 1J9OA 3S1RB 1XX8A 3K8AA 3FEWX 3I4MB 1LV9A 2XWJB 4OO1I 4DAVA 3MWYW 4NKLA 1GM5A 3ERSX 3SDZA 3E0EA 3KDFA 3M4PA 1HFGA 3TMEA 4DR4L 1LTRD 1SMYD 3C3LA 2K75A 2IWHA 1N9WA 1A15A 2VXWA 4H0LC 1L1OA 2SDFA 2GVBA 2B2YA 3ERQA 1B4OA 1NY4A 1X3GA 5C5MA 3EBEA 1VQ8A 4IUVA 5M5XH 3S14B 2KJXA 3LX0A 1ET9A 2H5XA 5IT9L 1M90C 1IYVA 4FXDA 2TSSA 4IFDJ 1F9PA 3VA7A 1PRTF 1ENFA 3MEFA 2CHBD 1EOTA 4GN4B 1QILA 3I55A 1HA6A 3QG1A 1C0AA 2F0DA 1WVLA 4EX5A 1X54A 4N9TA 5C3XA 4BXXH 4ZK9B 4GS3A 1ET6A 1Q3LA 4FNFA 1Y1WG 5ELBA 1EY7A 4BS9A 4MTKA 4DXGA 3M4YA 1U4LA 4M8AA 4X65L 2F3IA 1B1ZA 1LT3D 2ID0A 4GN3B 1YJNA 4IN3A 3M85A 1U9RA 4C1NI 4DV0Q 2XTIA 3BZCA 4DFAA 3A74A 5C4XH 1Y8OB 4C3JB 1BCPB 1S40A 1A6XA 1L1OB 4JI1Q 4UPAA 2ASBA 4KI0A 3D0FA 2Z1CA 4MNOA 4XIGS 4OEMB 4IQZA 4BBSB 3KBGA 2JA6B 3DXJC 4O42A 2L9HA 1TWFH 3CCEA 1IBLL 1ENAA 1WD1A 2WV6D 1R4QB 2QCPX 2E2JB 3MXGA 2K5QA 1STBA 1ICFB 3KFUA 1I4PA 2HDMA 1TY2A 5CYUA 1UE6A 3DWAA 1B8AA 4RGOS 1Y1WH 2K1BA 3RLOA 3MXNB 3SR1A 5KNBA 2QEJC 2B2TA 2F0KA 1YNNC 1F2ZA 4B3MQ 3M3YB 5J22A 3HOZB 4C3IB 3OWFA 2OT2A 1HHVA 2UXDQ 3NENA 5ELCA 2F3VA 1EWCA 4Z9CB 3EA6A 3NP8A 1L1OC 4GNXB 2Q8RE 2B2YC 1K8OA 3TSSA 4WFN3 2MHVA 2D0PA 4J8QA 4BBRH 1I50H 2PYKA 3NSWA 1CA5A 1O78A 1EYAA 4WRDA 3VR2A 3QOJA 4HIKA 5AJ3L 1CKNB 2QGQA 3G6JB 4JBMA 1VQOA 5COYA 2IX3A 1TKWB 1KC8C 2ZJQA 2NVXB 4OGQC 4FYDA 4NB3A 1S5ED 5K5PA 2PW7A 1QB5D 3ULLA 3TBIB 4X3KA 3I4LA 5JEAG 3T1YL 2CW0D 1XTDA 3OMCA 4PMCA 4NPSA 2IW3A 4X6AH 1FD7D 1VF5C 3E9HA 4HIMA 4BY7G 4CDEC 1W6KA 3CCMA 3KK7A 2I5LX 1JT8A 4IURA 2K5HA 5ELFA 5L37A 1BBXC 4A3JH 1HZCA 3CCJA 3BDOA 4DPGA 3HKSA 1AP0A 5CBEE 2I46A 5JPMC 4C1NK 2EYJA 1HFNA 1C4QA 4RGTA 3STBD 5IP9H 5LMUQ 4NXNQ 3HOXG 4A3FB 1E2VA 4B9WA 3T16A 1WTHA 4RA8A 3R93A 1PYSB 3P20A 1I4RA 3K0YA 4LF7Q 4DAYB 3Q24A 2Z4HA 3TS2A 2A1AA 2KECA 2KUMA 2R7DA 3GTLH 5M3MG 1B70B 1PFSA 4A3EB 1HUMA 1TWHB 3P7JA 1TQOA 4L8JA 1YVCA 3UE0A 2QW7A 3K7UC 3FRPB 2F0SA 3BG3A 1JOKA 2O5JC 4BY1G 4QF4A 1SNMA 1QNKA 5I4DA 1J5EL 2KCCA 1TIID 4HCEA 2JA7H 1PA6A 1SE4A 4RHSA 3CAMA 3A5ZB 4ZQ3A 2NVTH 4A3LH 1KIXA 5ELDA 1KHIA 3SGIA 2GA4B 2HHHQ 4FO2A 5KNDA 4A3BH 5E3FA 5CMDA 3I91A 5E1FA 4AQYQ 4DR5Q 2B2TC 2PZWA 2EQSA 4IPDA 2OWOA 3BZDB 4N8FA 4A3IB 1VQJA 5M5XB 2JA8G 5EPJA 1RJTA 4YY3L 3NE5B 3SK4A 1I4HA 4FF1A 4P71A 1YNXA 3R2IA 4X3UA 1EY0A 2KENA 3W2DA 3W3AA 1A2TA 3CPFA 4A4IA 2K5VA 4KD4A 5C0XH 2AMCB 2R93H 1VQDA 5I9OA 2NZ1D 1VQMA 3J81E 4KJNA 3KF8B 4DU9A 4JK1C 2XIWA 3BDLA 1FR3A 4U673 2K52A 1GKHA 5E4XA 2KQ3A 4JYAL 4G4KA 2KBNA 1FYCA 4JI7L 3C46A 4A3GG 2BDOA 1HNXL 1U5KA 1EUJA 4K6LA 1SNCA 2E2HH 2XN9C 3J80E 1HJPA 1WTWA 1RD9D 2B63B 3J7AF 3E0JA 4CJ2C 3I56A 3RNUA 3HZXA 2E76C 4K8JA 5GAEC 1VMCA 4R4OA 2KEEA 2RBMA 1DXMA 1BR9A 1IBKQ 3FKIB 3ZJYC 4GKJQ 4Y52H 4JI5L 2AKWB 4IPHA 4CGYB 1PH1A 5DM73 4GLAC 3S1NH 3T1HQ 2KOLA 2HD3A 2EZVA 1PFNA 4NW2A 2QEXA 1BDOA 2BA0A 3CRKC 4B3SL 2E2DC 4DR1L 2B29A 3L0OA 1SBBB 3RMHA 4CKEA 5M5YH 5M9OA 1LTBD 3JAMi 1D7QA 4RGNA 3NPPA 1EY4A 2A19A 2A6EC 2DJGC 3QB3A 2L5TA 3AEVA 2LXJA 4IJHA 5EKLA 2VQFQ 1YHQA 4A3GH 1KNAA 5C3EG 2XSCA 2RCFA 5FO7B 4B3TL 1YI2A 3S1MH 1JMCA 3G6EA 1Q1BA 4JVZA 4C2MH 3S1QH 1X6OA 2UUBQ 2JQOA 1U4MA 3K5LA 5FLXE 1JWUD 3D4WA 5JEAJ 2Y0SB 1XMQL 4HTHA 4N8X1 2AUKA 4F87A 2CH4W 2ZTDA 3DM3A 1ZYRC 3OMGA 3R8BA 1DD2A 1SYDA 3EFXD 4K2KA 4KY7A 1PH3A 4J15A 3TP7A 5IGGA 1QZHA 3OOCA 4XYOA 2NN6H 4DR7L 2EE1A 2X6LA 3CC7A 2JA5H 4GZYC 1PRTC 4DV4Q 1J8IA 4HMJA 3NBIA 1RDPD 1EYDA 1QUQB 1I94L 1NMFA 2R7ZH 3SK5A 1UAPA 2AWNA 3A54A 1PH6A 2LY7A 2Z4IA 3CCSA 1A3TA 4FF2A 3VR4A 1DOLA 4ODGA 4KV6A 3CMAA 1XNQL 4HIOA 2A74C 1D6EC 5HY6A 3A8JE 1Z7TA 3ER0A 3M4OH 3F2UA 5HGQA 4ABNA 1HH2P 4L6TB 1VQKA 3GV3A 1GUNA 3PO2G 4JOIA 4YWKA 3J81c 2Z8LA 3FPPA 5KNCA 4O1NA 4Q5VA 1IXRA 2RVLA 4R8IA 4IO9A 2F52A 4DV7Q 4LFAL 4LF9L 1YJWA 1K0SA 1N32L 3KJOA 4JI4L 1RODA 5GQOA 3UE1A 3J80c 4DK3C 3D6CA 3H91A 4BBSG 4RWSC 1EYGA 3DWQA 4X62L 3A5UA 4X3TA 3AFQA 2F03A 2MUYA 1B53A 1CSQA 1SN8A 5EAYA 4KHPL 2NVYB 2F4IA 3KLSX 4POFA 1VQ6A 4A3BB 5M5WH 4A3CH 5LMNL 1MJCA 4M1UB 3K5OA 4KN4C 4QIWB 4DV5L 1TWGB 2EY1A 1PMRA 2K33A 1K83B 2PMZE 1QVCA 4PZ6A 4C3HG 3NBHB 2KVMA 1Y14B 2YU9B 1E24A 1N34Q 1HNZQ 4FXGC 3HOZG 2CFMA 3VYRA 4OHJA 4DR4Q 5K36H 1GJXA 3UDFA 4S3SA 3HOVB 1AZPA 4A3MH 1SNPA 2RA4A 5FO8B 1TS5A 1TWCB 4IFDH 1HUNA 5A2QE 2MP1A 3PIOA 4LF4Q 1LM0A 1Z6HA 3TZDA 1JB3A 3PSIA 2O4XA 2OF1A 1GUOA 5FLXc 1KABA 5D3DA 3GTPH 4DUYL 2CWAA 1CQFA 2ZJRA 1V8QA 4Y7NB 4LWCA 3OPOA 2DUDA 3GTOH 1PTOD 1J6QA 4UAIA 3PIPA 1O7IA 3U50C 4A3DG 4UP8A 1LO5D 4DXFA 3FMCA 1KAWA 2IJ0A 4C3HH 4OIJA 4QJFA 1LT6D 2LFNA 1YJ9A 4H13C 1R9TB 2A6HC 4JOIC 4L5QA 1NE3A 3W5OA 2Q2IA 3S9WA 1EFID 1U0LA 3H6MA 2JA9A 5T1GA 2EY5A 4LK1C 3CCQA 4PMWA 1B2TA 1ILQA 2BH2A 4FF4A 5M3FG 4OWTB 2ICIA 1AE3A 5IP7G 2VUMG 1FGBD 1H9KA 5IYCG 2RSOA 4A3EG 1W3SA 1T9HA 3X3MA 4AYBG 3PF5A 4MTNA 4JI2L 3D31A 1Y69U 3S1MB 1SJHD 1SMYC 1IBLQ 1CI3M 2R6GA 4P75A 1N33Q 2VQEL 1I6HH 2K6AA 3PUYA 1V1PB 3DMUA 1KAAA 4A3DH 1RL2A 3GTMH 2B8GA 1OXSC 4I65A 4JI8L 4AYBE 4CKBA 3OW2A 2F0FA 4TQUS 2A68D 2QKIC 2PQAB 3B6YA 4DGZA 3NUCA 1E2WA 5I6YA 5IGCA 1QG7A 1ILPA 4F88A 3S16B 2XRSD 3HOUB 4A3IG 2I5MX 2N8NA 1YITA 2WKDA 2ZXPA 3H09A 4JW0A 5EBDA 4ULLA 4GLXA 1LT4D 3GTGH 3IFTA 5IP7H 4RCNA 2VUMH 1S5BD 4QQBX 2SNSA 4F8MA 5IYCH 1DCZA 4KKTA 2E2IB 4DV6L 3D8GA 1AN8A 1TWAB 2P5ZX 1Q46A 4A3KG 4JBWA 5BR8L 2JEBI 2D2CC 4MN3A 1CHPD 1HR0W 3BVGA 4POGA 5AJ3Q 3E9IA 5JJZA 3T4AC 3CP0A 1RKNA 3GTKB 3K59A 3DUZA 2QDLA 5I6WA 3HOYB 3SE0A 4YWLA 1Y1VH 1SE2A 1AW7A 1Q7YC 4NDXA 1D8LA 2VB3X 4FDBA 2RHQB 4R4TA 3L2PA 1KRSA 4IOAA 3S2DH 5JVG3 1HPCA 2O5IC 1NTGA 1OXXK 2N49A 5JJLA 3H94A 4OONA 2B63G 5FK9C 4K5XA 4NP5A 2Q2TA 1YBYA 3OWEB 1OXTA 1EFWA 1F77A 4DV3L 1SFOH 5FLMG 3FKIG 1YEZA 5J1ZA 1DM0B 1E1TA 1EYCA 1K0RA 2DN8A 5C44G 4A3KH 2F0OA 4RKLA 5M5WB 2I0QA 1VS0A 1M1KC 3KDFB 3TN2A 1S5FD 4A93G 1I3QH 1AZQA 2B8FA 4PNYA 4MIUA 4K5WA 3BYTB 1MSHA 1XMOQ 4PV1C 2A73B 4IUQA 3UDXA 1JOOA 3N6RA 2Z6BA 2NBFA 5GAGC 5D65A 1Z47A 1TVXA 4UDUC 4KY6A 2ZM6L 2WAQB 1X9NA 4CDDC 3AB9A 4XTCS 1E2ZA 3U9SA 3H0GB 1WYDA 3DLLA 2RQXA 2MNAA 3ULPA 2WKCA 4LMQD 3K7AH 1NCVA 3K81C 3NTIA 5LHY1 3TP8A 3S17H 2PCFB 1VQHA 4DR2Q 2X69A 2Y0SG 3PUWA 1LABA 3A8IE 3MHBA 4JG2A 3TRZA 2CW0C 5EBCA 4B3RL 4LAAA 2PMZB 5C44H 2KHSA 1VQPA 1CT1D 1KLUD 4DNTB 1CZGA 4BA2I 3SEBA 3TP5A 2GVAA 4QY7A 1PTOF 3VYUA 3TZUA 4A93H 4IFDI 5GROA 3ZYYX 5I9PA 4DV1L 1CQVA 5IT9E 4ZYSA 2M00A 4PQXA 4DV2Q 3CKIB 3NXWA 5HURA 3STBC 2IL8A 4NXML 3A7AB 2K14A 1RCVD 3GD7A 1TR5A 3URYA 5IWAL 4JYAQ 5CV6A 2X6GA 3X3NA 2UXBL 1ML0D 2R92B 2ALYB 4BA1I 4L5SA 4TKOB 1STNA 4YCUA 1M4VA 1G2SA 1AEXA 2PZTA 4JBJA 1D1KA 4ZUIA 1WTRA 4FVMA 4LUOA 4DNRB 3BU2A 2CWPA 2UUAL 1O7YA 1H9SA 1PXUA 3EJIA 3IL8A 1EY5A 2NVQH 1I4QA 3M7GA 3Q6SA 3K58A 4DUZQ 3CCUA 1Q90A 4PZ8A 4YHHL 1A63A 1SYCA 4JI5Q 3FDTA 1SNOA 3WWVA 3OSOA 2HIVA 4IZ8A 5F2DA 1BCPD 1FGUA 4X66L 2QF7A 1VQ4A 4B3SQ 3GTJH 4OX9L 2J4XA 1GO3E 1PH7A 1HR0L 1XNRQ 1PTOH 1DGSA 3JAME 2HCCA 5IODA 3S2HH 2CQAA 1OXUA 4K14A 4JC0A 4XQNA 2YTVA 5JEAH 3PO3B 1WCMG 3EIVA 3J80L 2PNRC 4BY7H 2EJMA 1VQ5A 4KLKA 3K0XA 4F7XA 2F4VQ 4AH6A 4X64L 3PMFA 3EN2A 5T1IA 2MO1A 5JOBA 4JI1L 4KK7A 2Z9HA 3CHBD 1XMQQ 3SK8A 4FXKC 2EYFA 2EYHA 2DY7A 5D14A 1EWIA 1L0XB 2ICEC 1PH2A 3RZOH 3M7NA 3HOXH 1U4PA 1T5EA 1QVGA 3RLFA 5IYDG 4IUUA 1SE3A 2K7VA 1HA5A 4K8IA 1WTQA 2SOBA 4XQJA 3I73A 1QE6A 2CQOA 3S2DB 1SYEA 3HKZG 2H1EA 4EQ5A 4XYQA 4RG1A 5M3MH 1I94Q 4RAUC 1STYA 1WTVA 3I4NG 2EXZA 4KD3A 3TS0A 1EIFA 1K3RA 2K32A 3MEHA 3MAQA 3I72A 1EQTA 5LMNW 1VF7A 4BY1H 1SMXA 3HOWG 1HQMC 1NR4A 1WCMH 3S15H 1HTPA 5IYBG 3AFPA 3HKZE 4LFBQ 2ES2A 5IT9c 2UXDL 2G9HD 2EDGA 3MXUA 5AFWA 4JI0L 2F1MA 3D6WA 2DNCA 3KYHC 3WDNA 3CRLC 1LTTD 1MJEA 4UY8C 1I3QB 5C4XB 1N36Q 2VNUD 3QO2A 2OEOA 4PZ7A 4UP9A 1XYIA 3RLNA 2PQEA 1XPRA 1VQ9A 2F0UA 1SDFA 5EJWA 2JA8H 1LUZA 4LFAQ 5IYDH 1X56A 3EQLC 1N32Q 4XT3B 4JI4Q 2SEBD 4K0KL 1TWFB 4HSVA 1AE2A 4JI6Q 4X62Q 2B2VA 4XT1B 3PQIA 1Q81C 1JR0D 4HAEA 1F2YA 4JBKA 3K7AB 2K5NA 1CUKA 1K28A 2NYZD 3HOWH 4JV5L 5JJKA 4RCOA 2WB1G 3S17B 4L5RC 2HUGA 1PYWD 4OO1G 1CKOA 2E74C 4DV5Q 1Y1WB 4XXEA 1PRTB 5FKAC 1KLGD 4LF6L 3NK9A 2EJFC 1H9JA 2UUCL 1SNQA 4WORA 2C9OA 2AQ1B 1BBUA 4RHRA 2XNAC 1SR3A 1MGSA 2RCNA 4C56C 1SAPA 3OTOL 3HOUG 3QR8A 1LTID 1A3UA 2I07B 4CDCC 3JAMc 4LF7L 3RZDH 1STGA 1BQQT 1Z9FA 3I4MG 4BBRB 1NAPA 1I50B 1LTSD 5IE8A 4IUNA 4UP7A 2MGSA 5CV7A 1TY0A 4DR6L 4DK1A 3K5MA 3GTQH 5IY0A 2WFWA 2B3GA 2PW5A 3HEJA 3I3CA 1CKMA 4IPCA 2KCMA 3L7ZC 2C35B 2E75C 1NR2A 1RHPA 1KXLA 5TSSA 3G48A 1D5ZC 2RSNA 4ALPA 1F9QA
chains in the Genus database with same CATH topology
3OIQA 1EEFD 5EQ0A 1Q12A 4R8NA 2JXMB 5I2YA 3BS1A 4OO1H 3P1HA 3HP3A 2G9DA 1SYGA 3SHLA 3K57A 2DNEA 4A3JB 1ZXTA 4J1MA 1CZWA 5C3WA 2NVQB 1O80A 5IOCA 1S5DD 2L11A 3E5SA 2AWOA 2L0CA 1BCPF 2RDGA 5A2QL 3LWUA 5EKKA 5EKIA 4EVOA 3GTJB 3GTLB 1SEBD 1PTOB 4G7ZC 1BUVT 3GQBA 4DF7A 1S5CD 2XRQD 1VDZA 1G8ZD 5JVH3 3O13A 4C3JG 1LTAD 5KGUA 4QUFA 3DHQA 3KLRA 4KN7C 2JA7B 1Y8NB 2B2VC 1C8CA 2JEAI 2NVTB 3ITPA 5I2XA 4HEDA 1IW7D 2F0JA 3NTKA 1KNEA 3HG9A 3MFGA 5G3LD 3VR3A 3BYYB 1EZ6A 1ZKOA 3MA2B 2EYOA 3RZOB 5LL6S 3HS0C 2PZUA 5CBAE 4KHVA 2EJGC 5ELEA 1CK1A 4YIJA 1PTOC 2FMMA 4C3IG 1PDQA 5M3MB 2O2LD 1D1IA 1PZID 1EIHA 5CORA 2F0HA 4CHTB 1GUGA 3ONAB 4RKBA 4B9XA 1GHKA 2R93B 1F9SA 4NMZA 4KHZA 2NWGA 1AFPA 1JWMD 3S15B 2V4DA 4G7HC 1MBYA 3HRZC 3C1EA 3NQTA 4HMIA 5CGKA 1A2UA 1SYFA 4ZLTF 3NWTA 1KDBA 2M2LA 3BVZA 3FPUB 1XXGA 4ZAIA 5C0XI 2FFKB 2E2HB 3N52A 1X32A 4XQQA 1FNVA 2JSOA 1B9MA 1JICA 2JA8B 1BF4A 5IGDA 3GV6A 5KRUA 2EY2A 2ZXRA 3K6OA 4G57A 2EPBA 3S1NB 3KBXA 2A68C 1ONLA 4CBVA 5M5YB 1YNJD 2JYOA 3I70A 1D5MC 5C4HA 4CKCA 3IAYA 3A7LA 3PUXA 2EY6A 4A3GB 1HXYD 1JOQA 1EL0A 3GP7A 4ID6A 2LS01 1UUPA 1Q8IA 1ICWA 2FINB 3IFDA 4C2MB 3S1QB 2D62A 1I4XA 2F0PA 2OXPA 2RDFA 2F0GA 2QILA 2FJ2A 1BOSA 1PZJD 2NB0A 2N55A 5KEEA 2F0EA 3FVQA 2RDHA 4QB4A 1K8MA 5BN4A 2PPBC 2JA5B 4I7ZC 3T56B 1WD0A 2R7ZB 2BE5D 1GXDC 1DOKA 1DZ1A 1D2BA 1BNZA 4K5VA 2J0TD 5C3EB 3M4OB 3D4DA 2NN6I 2XVSA 1VMPA 4OIKA 4EGVA 3KUPA 5CV8A 1EU3A 1EZ8A 4P2CB 1OXVA 2JE6I 2L4NA 1TT2A 4MHEA 1FNUA 3DWPA 1V43A 2J7ZA 1JWSD 3NTHA 2HQEA 2IT1A 4CJ1B 2XWBB 1JC7A 2A69D 4RGMA 4HN7A 1GUTA 1X3QA 5C6AA 1SNDA 5EGTA 2JP1A 4IUTA 5G3LF 1PLFA 3LWEA 1HCZA 1L0YB 1ZEQX 1EIGA 2HCIA 1VCIA 5DAUA 1HTLD 3MXNA 1U4RA 3VYTA 4HCSA 4ZKCB 4EQOA 2BDNA 4Q0FA 2VB2X 3IKJA 1RF2D 1TU2B 4N9PA 3PO2B 2KA7A 4HR7B 3ND8A 2YYZA 3PUZA 1EQVA 5EPLA 1LT5D 3VYSA 4KMUC 1EWHA 1QNUA 2AQ3B 2L1BA 1DONA 4E6IA 1MI2A 1Y8PB 4A3MB 4ZUJA 3G7LA 1EEID 4QMGA 2R61A 1SJED 4IUPA 3GO5A 2PO4A 2KCNA 3DEOA 3GTPB 2K03A 1G91A 3JAML 3PV0A 3GTOB 3QJYA 2CVRA 4PMBA 3A55A 2MJ8A 3P75A 4C3HB 3AMUA 1F9RA 4KTAA 2QDBA 1GOZA 3MC0B 1F2MA 4ZKBB 2F0LA 2NTSA 1BCPC 5CV5A 4DAYA 1OO9B 1G2TA 5E4WC 3C2PA 5IGEA 3WOEA 2MPMA 1TS3A 3ND9A 4ILWA 5BN3A 2K5DA 1KTKA 2F0WA 3A8KE 3V2TA 2KEDA 3NHHA 3T13A 1I6HB 1YNND 3V05A 1C48A 2A5HA 4EQNA 1CFMA 3R2TA 4A3DB 3GTMB 3E6ZX 3J81L 1LLRD 1CTMA 3CU7A 2L12A 3SK6A 1TS2A 3WOFA 1LTGD 1EY9A 1JCKB 1ESRA 3MZ5A 5M3FB 3GTGB 3MVVA 3T51B 2VUMB 2F0NA 1G6ZA 1XTCD 3KF8A 4ZRZA 4AYBB 1UNSA 2EVBA 2Q8TA 5C0XG 1JE4A 3AU7A 1RTOA 2D5DA 1Q1EA 4TRDA 5KYLA 3K5NA 2RKSA 4KJOA 1IKLA 2F0TA 1Y1VB 1H9SB 3QOLA 3I90A 2BA1A 1JQYD 1M8AA 3KLSA 4J6HA 4L63B 2M9VA 4K2LA 3U9OA 3OHXC 4RFBA 3Q23A 5IIFA 1SFOB 2TMPA 4RH6A 3BVMA 5FLXL 3D3RA 4A3KB 1MD2D 3UI2A 1D5XC 3MFYA 1QCBD 5C4ZA 1H9MA 4G7OC 2K28A 2N88A 3PIO3 4XDXA 3V96A 4DK0A 1I4GA 1EY6A 1DJRD 1BO0A 2Q8IB 2F0IA 1STHA 2EOTA 5JPNC 5ISRA 1B9NA 3OW7A 3L3OC 2HDLA 1X3PA 2F0MA 3PIP3 3MXPA 1CHQD 3DEPA 4DA2A 5C44B 1HRJA 4BWGB 2B39A 3HGBA 3OIPA 2NN6G 4A93B 2AQ2B 1G291 2F0QA 4EQPA 5KIXA 2NTTA 5CV9A 1QOHA 1NUCA 3DM1A 2LKVA 2LMCB 3LNNA 3J7AV 4H44C 2F3WA 2K01A 1B3AA 4TSSA 1W6JA 1I6VC 1CA6A 4CJ0B 3C1FA 1O7LA 1F2LA 2K05A 4X3SA 3L9AX 2A6ED 2K04A 2BCOA 2F0VA 4V190 2ZT9C 1IW7C 3J7YW 1V1OA 1A3VA 5NUCA 1WTXA 2DY8A 2EYPA 2AUJD 3NBHA 3PUVA 4KY5A 3Q22A 3S2HB 1FNWA 2B2UA 1QWYA 2IPKD 3NWSA 1ZYRD 5DM63 1STEA 4BY7B 4KKUA 5C0XJ 2EYMA 1SXTA 1SSOA 4OL7A 5K36G 1LACA 2R3ZA 1PRTD 4U68A 3QIAA 2WP8J 4H7BA 2IX0A 3QWNA 3T53B 4DN4M 1T5XD 4IFDG 3D4RA 5FOBB 3HOXB 4B08A 1KDCA 5HGTA 2B2WA 1QJOA 5C4JB 4V0BA 3BDCA 2WIIB 2H4OA 3A56A 4KKSA 1EU4A 4BY1B 1TS4A 2SNMA 4LJZC 2NUCA 5A35A 3Q0AA 1WCMB 1STAA 5DEHA 4HSPA 2FHTA 5DNFA 5JAVA 1EY8A 2EYLA 3R3OA 3TP6A 1IKMA 1PFMA 1B44D 1RTNA 1IYUA 1ESFA 3VR6A 1YNJC 1PZKD 1HQRD 2D9UA 5D3IB 2FMCA 4QUCA 1IL8A 1NSNS 1KDAA 1SYBA 1O7ZA 4WJWA 3EROA 1R4PB 3CQZB 5J39A 1V1PA 5LL6X 3HKZB 1GUWA 3NQIA 3H3VC 5CR3A 3I4NB 5IGBA 3MTSA 1WTPA 3HOWB 4FP5D 1ENCA 1II3A 2B2UC 2K5WA 3SXHA 1BXTA 2ENBA 4DAPA 4IALA 3VR5A 2ZXOA 3VA5A 4R9WA 1PFBA 1E0BA 5BN5A 1CM9A 2BE5C 3RZDB 2IX1A 1JORA 1MSGA 2WACA 1XWEA 3GTQB 5CV4A 5CC4A 3RUZA 5EPKA 1B50A 2B2WC 1GHJA 3EVQA 1UEAB 3RD4A 5IGFA 3I8ZA 2A6HD 5FO9B 3TDQA 2L55A 2WB1B 1GUSA 4FF3A 5C5LA 2C5CA 4QCLA 2BOSA 1H9RA 2WINB 4ME5A 3SVMA 2A69C 1IHZA 4K6DA 1DOMA 5KYIA 1WTOA 1S4ZA 1DYQA 1J9OA 3S1RB 1XX8A 3FEWX 3I4MB 1LV9A 2XWJB 4OO1I 4DAVA 3MWYW 4NKLA 3SDZA 1HFGA 3TMEA 1LTRD 1SMYD 3C3LA 2IWHA 1A15A 2VXWA 4H0LC 2SDFA 2B2YA 3ERQA 1B4OA 5C5MA 4IUVA 3S14B 2KJXA 3LX0A 1ET9A 5IT9L 1IYVA 4FXDA 2TSSA 4IFDJ 1F9PA 3VA7A 1PRTF 1ENFA 2CHBD 1EOTA 1QILA 1HA6A 3QG1A 2F0DA 1WVLA 4N9TA 5C3XA 4ZK9B 1ET6A 1Q3LA 4FNFA 5ELBA 1EY7A 4BS9A 4DXGA 3M4YA 1U4LA 4M8AA 1B1ZA 1LT3D 2ID0A 4IN3A 3M85A 1U9RA 4C1NI 4DFAA 1Y8OB 4C3JB 1BCPB 1A6XA 4KI0A 2Z1CA 4XIGS 4IQZA 4BBSB 3KBGA 2JA6B 3DXJC 4O42A 2L9HA 1ENAA 1WD1A 2WV6D 1R4QB 2QCPX 2E2JB 3MXGA 2K5QA 1STBA 1I4PA 2HDMA 1TY2A 5CYUA 3DWAA 4RGOS 2K1BA 3SR1A 5KNBA 2QEJC 2B2TA 2F0KA 1YNNC 1F2ZA 3M3YB 5J22A 3HOZB 4C3IB 3OWFA 2OT2A 1HHVA 5ELCA 2F3VA 1EWCA 4Z9CB 3EA6A 3NP8A 1K8OA 2Q8RE 2B2YC 3TSSA 4WFN3 2MHVA 4J8QA 2PYKA 3NSWA 1CA5A 1O78A 1EYAA 4WRDA 3VR2A 3QOJA 3G6JB 5COYA 2IX3A 1TKWB 2NVXB 4OGQC 4FYDA 1S5ED 5K5PA 2PW7A 1QB5D 3TBIB 4X3KA 3I4LA 5JEAG 2CW0D 3OMCA 4PMCA 2IW3A 1FD7D 1VF5C 1W6KA 3KK7A 4IURA 5ELFA 1BBXC 3BDOA 1AP0A 5CBEE 2I46A 5JPMC 4C1NK 2EYJA 1HFNA 1C4QA 4RGTA 4A3FB 1E2VA 4B9WA 3T16A 4RA8A 3R93A 3P20A 1I4RA 3K0YA 3Q24A 2Z4HA 2KECA 2KUMA 4A3EB 1HUMA 1TWHB 3P7JA 1TQOA 4L8JA 3FRPB 2F0SA 3BG3A 1JOKA 2O5JC 4QF4A 1SNMA 1QNKA 5I4DA 2KCCA 1TIID 4HCEA 1SE4A 4RHSA 4ZQ3A 5ELDA 2GA4B 4FO2A 5KNDA 5E3FA 5CMDA 3I91A 5E1FA 2B2TC 2PZWA 3BZDB 4A3IB 5M5XB 5EPJA 1RJTA 3NE5B 3SK4A 1I4HA 4FF1A 3R2IA 4X3UA 1EY0A 3W2DA 3W3AA 1A2TA 4KD4A 5C0XH 5I9OA 2NZ1D 3J81E 4KJNA 4DU9A 4JK1C 2XIWA 3BDLA 1FR3A 4U673 5E4XA 2KQ3A 4G4KA 1FYCA 3C46A 2BDOA 4K6LA 1SNCA 2XN9C 3J80E 1WTWA 1RD9D 2B63B 3J7AF 3E0JA 4CJ2C 3HZXA 2E76C 4K8JA 1VMCA 2KEEA 2RBMA 1DXMA 1BR9A 3FKIB 4CGYB 5DM73 2KOLA 2EZVA 1PFNA 4NW2A 1BDOA 2BA0A 3CRKC 2E2DC 1SBBB 3RMHA 4CKEA 5M9OA 1LTBD 4RGNA 3NPPA 1EY4A 2A6EC 3QB3A 2L5TA 5EKLA 1KNAA 2XSCA 5FO7B 1Q1BA 1U4MA 3K5LA 5FLXE 1JWUD 3D4WA 5JEAJ 2Y0SB 4HTHA 2AUKA 4F87A 1ZYRC 3OMGA 3R8BA 1DD2A 1SYDA 3EFXD 4K2KA 4KY7A 3TP7A 5IGGA 3OOCA 4XYOA 2NN6H 2EE1A 2X6LA 4GZYC 1PRTC 1J8IA 4HMJA 3NBIA 1RDPD 1EYDA 3SK5A 1UAPA 2AWNA 3A54A 2LY7A 2Z4IA 1A3TA 4FF2A 3VR4A 1DOLA 4ODGA 4KV6A 2A74C 1D6EC 3A8JE 1Z7TA 3F2UA 4ABNA 4L6TB 3GV3A 1GUNA 2Z8LA 3FPPA 5KNCA 4O1NA 4Q5VA 2RVLA 4R8IA 1RODA 3D6CA 3H91A 4RWSC 3DWQA 4X3TA 2F03A 2MUYA 1B53A 2NVYB 2F4IA 3KLSX 4A3BB 4M1UB 3K5OA 4KN4C 4QIWB 1TWGB 2EY1A 1PMRA 2K33A 1K83B 4C3HG 2KVMA 2YU9B 4FXGC 3VYRA 4OHJA 5K36H 1GJXA 4S3SA 3HOVB 1AZPA 1SNPA 2RA4A 5FO8B 1TS5A 1TWCB 4IFDH 1HUNA 5A2QE 2MP1A 1Z6HA 3TZDA 1JB3A 2O4XA 2OF1A 1GUOA 1KABA 5D3DA 1CQFA 1V8QA 4Y7NB 3OPOA 1PTOD 4UAIA 1LO5D 4DXFA 3FMCA 2IJ0A 4OIJA 1LT6D 2LFNA 4H13C 1R9TB 2A6HC 3S9WA 1EFID 3H6MA 5T1GA 2EY5A 4LK1C 4PMWA 1B2TA 1ILQA 4FF4A 2ICIA 1FGBD 1H9KA 2RSOA 3X3MA 3D31A 1Y69U 3S1MB 1SJHD 1SMYC 1CI3M 2R6GA 2K6AA 3PUYA 1V1PB 3DMUA 1KAAA 2B8GA 1OXSC 4I65A 4CKBA 2F0FA 4TQUS 2A68D 2QKIC 4DGZA 3NUCA 1E2WA 5I6YA 5IGCA 1QG7A 1ILPA 4F88A 3S16B 2XRSD 3HOUB 2WKDA 2ZXPA 3H09A 5EBDA 4ULLA 1LT4D 3IFTA 4RCNA 1S5BD 2SNSA 4F8MA 1DCZA 4KKTA 2E2IB 3D8GA 1AN8A 1TWAB 4JBWA 2JEBI 2D2CC 4MN3A 1CHPD 3BVGA 5JJZA 3T4AC 3GTKB 1RKNA 3K59A 3DUZA 5I6WA 3HOYB 3SE0A 1SE2A 1AW7A 4NDXA 2VB3X 5JVG3 1HPCA 2O5IC 1OXXK 3H94A 5FK9C 4K5XA 4NP5A 3OWEB 1OXTA 1F77A 5J1ZA 1DM0B 1EYCA 2DN8A 2F0OA 4RKLA 5M5WB 3TN2A 1S5FD 1AZQA 2B8FA 4PNYA 4MIUA 4K5WA 3BYTB 1MSHA 4PV1C 2A73B 4IUQA 1JOOA 3N6RA 2NBFA 5D65A 1Z47A 1TVXA 4UDUC 4KY6A 2WAQB 3AB9A 4XTCS 1E2ZA 3U9SA 3H0GB 2RQXA 2WKCA 4LMQD 1NCVA 3NTIA 5LHY1 3TP8A 2PCFB 2X69A 3PUWA 1LABA 3A8IE 3MHBA 2CW0C 5EBCA 4LAAA 2PMZB 2KHSA 1CT1D 1KLUD 4DNTB 1CZGA 4BA2I 3SEBA 3TP5A 1PTOF 3VYUA 3TZUA 4IFDI 5I9PA 3ZYYX 1CQVA 5IT9E 4ZYSA 2M00A 4PQXA 3CKIB 3NXWA 5HURA 2IL8A 3A7AB 1RCVD 3GD7A 1TR5A 3URYA 5CV6A 2X6GA 3X3NA 1ML0D 2R92B 4BA1I 4TKOB 1STNA 1M4VA 1G2SA 1AEXA 2PZTA 1D1KA 4ZUIA 1WTRA 4FVMA 4DNRB 1O7YA 1H9SA 1PXUA 3EJIA 3IL8A 1EY5A 1I4QA 3M7GA 3Q6SA 3K58A 1Q90A 1SYCA 3FDTA 1SNOA 3OSOA 4IZ8A 5F2DA 1BCPD 2QF7A 2J4XA 1PTOH 3JAME 2HCCA 5IODA 2CQAA 1OXUA 4K14A 4XQNA 5JEAH 3PO3B 3J80L 2PNRC 2EJMA 4F7XA 3PMFA 5T1IA 5JOBA 4KK7A 3CHBD 3SK8A 4FXKC 2EYFA 2EYHA 2DY7A 5D14A 1L0XB 2ICEC 3M7NA 1U4PA 1T5EA 3RLFA 4IUUA 1SE3A 2K7VA 1HA5A 4K8IA 1WTQA 2SOBA 4XQJA 3I73A 1QE6A 3S2DB 1SYEA 2H1EA 4XYQA 4RAUC 1STYA 1WTVA 2EXZA 4KD3A 2K32A 3MEHA 3MAQA 3I72A 1EQTA 1VF7A 1HQMC 1NR4A 1HTPA 2G9HD 2EDGA 3MXUA 5AFWA 2F1MA 3D6WA 2DNCA 3WDNA 3CRLC 1LTTD 1I3QB 5C4XB 2VNUD 3QO2A 2OEOA 1XYIA 2PQEA 2F0UA 1SDFA 5EJWA 3EQLC 4XT3B 2SEBD 1TWFB 4HSVA 2B2VA 4XT1B 1JR0D 4HAEA 1F2YA 3K7AB 2NYZD 4RCOA 3S17B 2HUGA 1PYWD 4OO1G 2E74C 1Y1WB 4XXEA 1PRTB 5FKAC 1KLGD 3NK9A 2EJFC 1H9JA 1SNQA 4WORA 2C9OA 2AQ1B 4RHRA 2XNAC 1MGSA 4C56C 1SAPA 1LTID 1A3UA 2I07B 1STGA 1BQQT 4BBRB 1NAPA 1I50B 1LTSD 4IUNA 2MGSA 5CV7A 1TY0A 4DK1A 3K5MA 3HEJA 2PW5A 3I3CA 3L7ZC 2E75C 1NR2A 1RHPA 5TSSA 1D5ZC 2RSNA 1F9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DXG A;  1EEF D;  1JWM D;  2XN9 C;  4L6T B;  1UNS A;  1RCV D;  1LO5 D;  4DXF A;  2IJ0 A;  1B1Z A;  1LT3 D;  1RD9 D;  3URY A;  2AQ2 B;  1LT6 D;  4RGT A;  2NTT A;  2Z8L A;  3BVZ A;  1BCP B;  1XXG A;  4O1N A;  5FK9 C;  2G9H D;  1EFI D;  1M4V A;  1I4R A;  3OWE B;  1JQY D;  1EU3 A;  1EU4 A;  1F77 A;  1TS4 A;  4TSS A;  1FNV A;  1GOZ A;  3MC0 B;  1FNU A;  1LTT D;  1S5D D;  2ICI A;  1FGB D;  1I4Q A;  2WV6 D;  1BCP F;  3DWQ A;  3DWP A;  2NTS A;  5I4D A;  1BCP C;  2RDG A;  4L63 B;  1SBB B;  1JWS D;  1LTB D;  1SE4 A;  4RFB A;  1S5F D;  4RGN A;  4RHS A;  1I4P A;  1SEB D;  1B44 D;  1SJH D;  1PTO B;  2SEB D;  1DYQ A;  1ESF A;  3KLS X;  4RGM A;  1BCP D;  1PZK D;  3BYT B;  4RH6 A;  5ELD A;  1S5C D;  1TY2 A;  2XRQ D;  3DWA A;  4RGO S;  1HQR D;  5D3I B;  1G8Z D;  1TS3 A;  3BVM A;  3O13 A;  1V1P B;  1MD2 D;  1LTA D;  2J4X A;  1PTO H;  2QEJ C;  1JR0 D;  1LTR D;  1D5X C;  4UDU C;  1KTK A;  1V1O A;  1L0Y B;  5ELC A;  4RCO A;  1D5M C;  1EWC A;  3BZD B;  4Z9C B;  3EA6 A;  1PYW D;  1V1P A;  1HTL D;  1JWU D;  1HXY D;  4OHJ A;  3TSS A;  3V05 A;  1PRT B;  5FKA C;  3MFG A;  1KLG D;  3BYY B;  3BVG A;  1I4H A;  2XRS D;  3R2T A;  3GP7 A;  1RF2 D;  2AQ1 B;  3R8B A;  1LLR D;  1UUP A;  4RHR A;  1I4G A;  2XNA C;  3EFX D;  1DJR D;  1FNW A;  3R2I A;  1I4X A;  4C56 C;  1TS5 A;  1ET9 A;  1LT4 D;  3W2D A;  1LTI D;  2IPK D;  2TSS A;  1S5B D;  1TS2 A;  2QIL A;  3CHB D;  1STE A;  1PRT F;  1CT1 D;  1AN8 A;  1ENF A;  1BXT A;  1KLU D;  1LTS D;  1PRT C;  1S5E D;  3SEB A;  1PZJ D;  1LT5 D;  5ELE A;  1L0X B;  1CHP D;  1PTO F;  1RDP D;  2AQ3 B;  1TY0 A;  1CK1 A;  1QIL A;  2CHB D;  1LTG D;  1PTO C;  1SXT A;  1JCK B;  1FD7 D;  1CHQ D;  1CQV A;  5D3D A;  2O2L D;  1PZI D;  1EEI D;  1SE3 A;  1HA5 A;  2RDH A;  1PRT D;  5TSS A;  4ZYS A;  1D6E C;  5ELF A;  1ET6 A;  2R61 A;  1SE2 A;  1D5Z C;  1SJE D;  1PTO D;  1T5X D;  1XTC D;  4BWG B;  5ELB A;  1AW7 A;  4K6L A; 
#chains in the Genus database with same CATH topology
 3OIQ A;  1EEF D;  5EQ0 A;  1Q12 A;  3HOY G;  4R8N A;  1UWV A;  2JXM B;  2A8V A;  4DUY Q;  4A75 A;  5I2Y A;  1GD7 A;  3BS1 A;  3P1H A;  3HP3 A;  4OO1 H;  2G9D A;  1SYG A;  3SHL A;  4AQY L;  3K57 A;  2DNE A;  4A3J B;  1ZXT A;  4J1M A;  1CZW A;  5C3W A;  5C3E H;  3TEH B;  2NVQ B;  4IOC A;  1O80 A;  3I7F A;  2MO0 A;  3S1R H;  5IOC A;  1S5D D;  2JN4 A;  2L11 A;  5GAH C;  3I4M H;  3E5S A;  2AWO A;  3OYY A;  2L0C A;  1BCP F;  3ICE A;  1MKH A;  2RDG A;  5A2Q L;  4ME3 A;  3LWU A;  5EKK A;  5EKI A;  4EVO A;  3GTJ B;  3GTL B;  1SEB D;  4OWW B;  1PTO B;  4G7Z C;  1BUV T;  3GQB A;  4DF7 A;  1S5C D;  2XRQ D;  1VDZ A;  1G8Z D;  5JVH 3;  3O13 A;  1SE8 A;  4C3J G;  1VQG A;  1LTA D;  5KGU A;  4QUF A;  3DHQ A;  3KLR A;  1PV4 A;  4KN7 C;  2JA7 B;  1Y8N B;  2B2V C;  4JI2 Q;  1C7Y A;  3PCO B;  1PH5 A;  2L15 A;  3S14 H;  1C8C A;  2JEA I;  1A8V A;  2JA6 G;  2NVT B;  4LFC L;  1X65 A;  3ITP A;  5I2X A;  4HED A;  3NTK A;  1IW7 D;  2F0J A;  1KNE A;  3HG9 A;  3MFG A;  5G3L D;  3VR3 A;  3BYY B;  3H0G G;  4JI8 Q;  1EZ6 A;  3BZK A;  4GOP A;  1ZKO A;  1BKB A;  3MA2 B;  2EYO A;  4YCW A;  3RZO B;  2OTJ A;  5LL6 S;  1K73 C;  3CME A;  2OQK A;  3HS0 C;  2PZU A;  5CBA E;  3PO2 H;  3ULJ A;  1PH4 A;  4KHV A;  2EJG C;  5ELE A;  1NJI C;  1CK1 A;  4YIJ A;  1PTO C;  2FMM A;  4C3I G;  1L0W A;  1PDQ A;  5M3M B;  2O2L D;  1D1I A;  1PZI D;  1WJJ A;  3A0J A;  1EIH A;  5COR A;  2F0H A;  4GN5 A;  1NNX A;  4CHT B;  1GUG A;  1IBM L;  3ONA B;  1VQ7 A;  4RKB A;  3FP9 A;  4B9X A;  4C3J H;  1GHK A;  5BR8 Q;  2R93 B;  1F9S A;  4NMZ A;  4KHZ A;  2NWG A;  1QVF A;  1AFP A;  1JWM D;  3S15 B;  3PF4 A;  2V4D A;  4G7H C;  1OTC A;  4BBS H;  1MBY A;  3HRZ C;  2JA6 H;  3C1E A;  3NQT A;  4HMI A;  5CGK A;  1A2U A;  1SYF A;  1KRT A;  4ZLT F;  3NWT A;  1KDB A;  2M2L A;  3BVZ A;  3FPU B;  3J7A 5;  1XXG A;  4P74 A;  4ZAI A;  5C0X I;  2FFK B;  2IHE A;  2E2H B;  3G71 A;  2UUB L;  3Q8D A;  3N52 A;  4R4I A;  1X32 A;  4XQQ A;  1FNV A;  3TRE A;  2JSO A;  1B9M A;  1JIC A;  2JA8 B;  4GKK L;  2NZH A;  1N8R C;  4R4Q A;  1UE5 A;  4JCV E;  4GOP B;  3M9B A;  1FJG L;  1BF4 A;  1P16 A;  3M3Y H;  3HOZ H;  4C3I H;  2UXC L;  5IGD A;  4DV3 Q;  3GV6 A;  4JI3 L;  2CKZ B;  2EY2 A;  5KRU A;  2ZXR A;  3K6O A;  4G57 A;  2EPB A;  3S1N B;  1I5F A;  4OEL B;  2NZO A;  4LW1 A;  4X65 Q;  3KBX A;  2A68 C;  4A3F G;  1WI5 A;  1VQA A;  1WOC A;  3AQQ A;  1HNW L;  1HZA A;  1ONL A;  4CBV A;  5M5Y B;  1YNJ D;  2JYO A;  2DJF C;  3I70 A;  2Q2H A;  1FL0 A;  1K8G A;  1D5M C;  2EXD A;  5C4H A;  4CKC A;  3IAY A;  3A7L A;  3PUX A;  1X3E A;  2EY6 A;  1IYJ B;  4A3G B;  1HXY D;  1JOQ A;  1EL0 A;  3PO3 G;  1EQR A;  3GP7 A;  4ID6 A;  2LS0 1;  1UUP A;  1Q8I A;  3VDY A;  1ICW A;  2FIN B;  3IFD A;  4C2M B;  3S1Q B;  2D62 A;  1I4X A;  2F0P A;  2OXP A;  1EOV A;  4HJA A;  4GOP C;  2KHJ A;  2RDF A;  2F0G A;  2QIL A;  2E5L L;  3I4O A;  2FJ2 A;  4DV7 L;  1BOS A;  1PZJ D;  1UE7 A;  2NB0 A;  2VS1 A;  2N55 A;  1VQN A;  2ZTE A;  5ELO A;  5KEE A;  2F0E A;  2UU9 L;  3FVQ A;  2RDH A;  4QB4 A;  4QGU A;  1K8M A;  4A3F H;  5BN4 A;  2PPB C;  2JA5 B;  4I7Z C;  1G51 A;  3T56 B;  4L5T A;  4CDF C;  5M3F H;  1WD0 A;  2R7Z B;  1Q86 C;  2BE5 D;  1GXD C;  1DOK A;  1DZ1 A;  1D2B A;  1BNZ A;  4A3E H;  4K5V A;  2J0T D;  1TWH H;  5C3E B;  3M4O B;  3D4D A;  2VW9 A;  2NN6 I;  1G6P A;  2K50 A;  2XVS A;  1VMP A;  4OIK A;  2N78 A;  1N34 L;  1HNZ L;  4EGV A;  4BXX G;  3KUP A;  5IWA Q;  5CV8 A;  1EU3 A;  1EZ8 A;  4P2C B;  1OXV A;  2JE6 I;  2L4N A;  1TT2 A;  3KOJ A;  4MHE A;  2UXB Q;  3J81 j;  3T1Y Q;  1E3P A;  1TXY A;  1FNU A;  1S72 A;  2I5H A;  5H1S E;  1KD1 C;  3DWP A;  2VY3 A;  1WFQ A;  3KLW A;  1V43 A;  2J7Z A;  1JWS D;  5C4X G;  3NTH A;  4LF4 L;  2HQE A;  2IT1 A;  2UUA Q;  4CJ1 B;  1JB7 A;  2YTY A;  2XWB B;  1JC7 A;  2A69 D;  5ELN A;  4RGM A;  4A3I H;  4HN7 A;  1GUT A;  4LNQ A;  1X3Q A;  4YHH Q;  1VQB A;  5FJ8 G;  5C6A A;  1SND A;  2Z6K A;  5EGT A;  2JP1 A;  4IUT A;  5G3L F;  1PLF A;  3LWE A;  1HCZ A;  1L0Y B;  1ZEQ X;  1EIG A;  4OXP A;  2ZJP A;  2HCI A;  1VCI A;  4X66 Q;  1X3F A;  5DAU A;  1HTL D;  3MXN A;  4OX9 Q;  1U4R A;  2GN5 A;  1HR0 Q;  3VYT A;  4HCS A;  4ZKC B;  4EQO A;  2BDN A;  4Q0F A;  2VB2 X;  3IKJ A;  1RF2 D;  1TU2 B;  4N9P A;  4LF8 L;  1Q8K A;  3PO2 B;  2KA7 A;  4HR7 B;  1J5E Q;  3ND8 A;  4GNX A;  2E8G A;  2YYZ A;  3PUZ A;  1EQV A;  5EPL A;  1LT5 D;  4KMU C;  1X55 A;  3VYS A;  1EWH A;  1QNU A;  1CKN A;  2AQ3 B;  2L1B A;  4E6I A;  4X64 Q;  1DON A;  1MI2 A;  1Y8P B;  4BBR G;  4A3M B;  4ZUJ A;  2B63 H;  3G7L A;  1EEI D;  3I2Z A;  2CCZ A;  4WJ4 A;  4QMG A;  1FVI A;  2R61 A;  1SJE D;  4IUP A;  5FJ8 H;  5FLM H;  3FKI H;  3GO5 A;  2PO4 A;  1RIP A;  2KCN A;  3GDE A;  1N33 L;  4LUV A;  3DEO A;  4YY3 Q;  1HZB A;  4LF5 L;  3GTP B;  2K03 A;  1G91 A;  4OWX B;  1EIY B;  3JAM L;  4DR3 L;  1YIJ A;  3PV0 A;  3GTO B;  3QJY A;  2Y0S E;  5E7N A;  2CVR A;  4PMB A;  3CCR A;  3A55 A;  2MJ8 A;  3P75 A;  4C3H B;  4A3J G;  3AMU A;  1F9R A;  1ASY A;  2G5D A;  2QDB A;  4KTA A;  1GOZ A;  3MC0 B;  1F2M A;  2K4K A;  2KHI A;  4ZKB B;  2YTX A;  2F0L A;  2NTS A;  1BCP C;  5CV5 A;  4JI0 Q;  4DAY A;  1OO9 B;  2PI2 E;  4DAM A;  1G2T A;  5IP9 G;  4JI7 Q;  1HNX Q;  3K80 C;  5E4W C;  3C2P A;  2MFI A;  3WOE A;  5IGE A;  2D0O A;  1IZ6 A;  1K3B C;  2MPM A;  2RHS B;  1TS3 A;  3LGJ A;  1XPO A;  2HQL A;  3ND9 A;  4O2D A;  4ILW A;  2N3S A;  5BN3 A;  2K5D A;  1KTK A;  2F0W A;  3A8K E;  3F2D A;  2Z6K C;  3V2T A;  4K0K Q;  2KED A;  3NHH A;  2JA7 G;  1BVS A;  3T13 A;  2LXK A;  1I6H B;  1YNN D;  3V05 A;  2VZA A;  1C48 A;  2A5H A;  4EQN A;  1CFM A;  3R2T A;  4A3D B;  3GTM B;  4A3L G;  3E6Z X;  3J81 L;  1LLR D;  4JV5 Q;  4WJ3 M;  4DR1 Q;  1CTM A;  3CU7 A;  3F2B A;  4A3B G;  2L12 A;  3SK6 A;  1UE1 A;  3NEL A;  1TS2 A;  4GNX C;  4LF6 Q;  2UUC Q;  1NBW A;  3WOF A;  1LTG D;  1YZ6 A;  1EY9 A;  1JCK B;  1ESR A;  3U4Z A;  4B3T Q;  3OTO Q;  3MZ5 A;  2OCE A;  5M3F B;  3GTG B;  3MVV A;  3T51 B;  2VUM B;  4DV0 L;  2F0N A;  1G6Z A;  1A0I A;  1P8L A;  1XTC D;  3KF8 A;  1L2F A;  4QIW E;  4DR6 Q;  2JK8 A;  4ZRZ A;  4AYB B;  1UNS A;  2EVB A;  1XMO L;  2Q8T A;  5C0X G;  2VL6 A;  1JE4 A;  3AU7 A;  3RN5 A;  1RTO A;  2R93 G;  2D5D A;  1Q1E A;  4HJ7 A;  4TRD A;  3HOV G;  5KYL A;  2CH4 A;  3K5N A;  2RKS A;  4KJO A;  1IKL A;  1LTL A;  4GLV B;  2F0T A;  1Y1V B;  1H9S B;  3QOL A;  1E22 A;  1SRO A;  3I90 A;  2BA1 A;  4DR7 Q;  2DGY A;  2OTL A;  3RR5 A;  1JQY D;  1M8A A;  1B7Y B;  4TVA B;  2NVY H;  5C4J H;  4HJ8 A;  1C9O A;  3KLS A;  4DR2 L;  4IJL A;  3H3V H;  4J6H A;  1HZ9 A;  2IHF A;  1TWG H;  4L63 B;  2M9V A;  4K2L A;  3U9O A;  1XJV A;  2LSS A;  3OHX C;  1XNQ Q;  1K83 H;  2ATW A;  4RFB A;  3Q23 A;  4B3M L;  5IIF A;  2YU9 H;  1SFO B;  2TMP A;  2ZTC A;  4RH6 A;  1NMG A;  4IPG A;  3BVM A;  3M4Q A;  5FLX L;  3D3R A;  4A3K B;  1MD2 D;  3UI2 A;  1D5X C;  3MFY A;  4DV2 L;  3HOV H;  3KF6 A;  4PG3 A;  2HT1 A;  1QCB D;  1GVP A;  1TWC H;  3H15 A;  4HJ9 A;  3CCV A;  5C4Z A;  1IL2 A;  1H9M A;  4G7O C;  1PH8 A;  2K28 A;  2N88 A;  4LF9 Q;  3PIO 3;  4R4C A;  4XDX A;  1Q82 C;  3V96 A;  4DK0 A;  1VQI A;  3CQZ H;  1I4G A;  1EY6 A;  3CF5 A;  1DJR D;  1BO0 A;  1SRU A;  1LYL A;  2F0I A;  1STH A;  2Q8I B;  1VQC A;  4LFC Q;  3I4N H;  2EOT A;  1V9P A;  5JPN C;  4Y7N H;  3TQY A;  5ISR A;  4APV A;  1B9N A;  3OW7 A;  4KHP Q;  3L3O C;  5LMN Q;  2HDL A;  1X3P A;  2F0M A;  5IYB H;  3PIP 3;  3MXP A;  1CHQ D;  1K9M C;  3DEP A;  4DUZ L;  4DA2 A;  3CW2 C;  1R9T H;  5C44 B;  1YHA A;  1HRJ A;  3BJU A;  2PI2 A;  4NXN L;  4BWG B;  5LMU L;  2B39 A;  2YV5 A;  1QUQ A;  3HGB A;  3OIP A;  2NN6 G;  2WB1 E;  2KCT A;  4A93 B;  1BBW A;  2JA5 G;  2AQ2 B;  1G29 1;  4DK6 C;  1IBM Q;  3UDI A;  2F0Q A;  3NEM A;  1XNR L;  4EQP A;  5KIX A;  2R7Z G;  1K8A C;  2NTT A;  5CV9 A;  3CC2 A;  2MQH A;  2Q2U A;  1QOH A;  4O0A A;  3KF6 B;  1NUC A;  3DM1 A;  1CSP A;  2LKV A;  1ASZ A;  2LMC B;  3G4S A;  3HFZ B;  3LNN A;  1E7Z A;  3J7A V;  4H44 C;  2F3W A;  2K01 A;  1B3A A;  4TSS A;  2Z0S A;  1W6J A;  4LUZ A;  1I6V C;  2F4V L;  3S24 A;  1CA6 A;  4CJ0 B;  2HHH L;  2FXQ A;  3C1F A;  1O7L A;  3W1B A;  4DR5 L;  1F2L A;  4HJ5 A;  4GKK Q;  2K05 A;  4X3S A;  5DLQ E;  3S16 H;  3J7Z C;  1S3O A;  1FJG Q;  3L9A X;  2A6E D;  1SLJ A;  1B3Q A;  2K04 A;  3HOU H;  3RN2 A;  2BCO A;  2F0V A;  4V19 0;  2UXC Q;  3AYH B;  4JI3 Q;  2ZT9 C;  1IW7 C;  3J7Y W;  1V1O A;  3CPW A;  3U58 A;  1A3V A;  5NUC A;  4DNI A;  1QZG A;  1WTX A;  2E2I H;  1HNW Q;  2DY8 A;  1TWA H;  2EYP A;  3J81 i;  2AUJ D;  4A3C G;  3NBH A;  3PUV A;  4KY5 A;  1JE5 A;  1A62 A;  3Q22 A;  3CCL A;  3S2H B;  4LFB L;  3GTK H;  1FNW A;  2B2U A;  1QWY A;  2IPK D;  3NWS A;  3HOY H;  1ZYR D;  3E3X A;  5DM6 3;  1STE A;  1MHW C;  4BY7 B;  4KKU A;  5C0X J;  1E1O A;  2EYM A;  2VQE Q;  1SXT A;  2QA4 A;  3J80 i;  1N36 L;  2WAQ G;  1SSO A;  4OL7 A;  5K36 G;  1LAC A;  2R3Z A;  1PRT D;  4U68 A;  3F2C A;  2E5L Q;  3QIA A;  2WP8 J;  4H7B A;  2IX0 A;  3QWN A;  3T53 B;  4DN4 M;  1T5X D;  4A3M G;  4IFD G;  3D4R A;  1W2B A;  1IBK L;  5FOB B;  3HOX B;  4JI6 L;  1YHB A;  4B08 A;  4GKJ L;  2UU9 Q;  2WAQ E;  1KDC A;  4AIM A;  5HGT A;  2B2W A;  2JJQ A;  3T1H L;  1QJO A;  1EQQ A;  5C4J B;  4V0B A;  4P72 A;  3BDC A;  2WII B;  4ZCK A;  2H4O A;  2RF4 A;  3A56 A;  4DV6 Q;  4KKS A;  1EU4 A;  4BY1 B;  1TS4 A;  3CXC A;  2SNM A;  4DKA C;  4LJZ C;  2NUC A;  5A35 A;  4RMF A;  3Q0A A;  1WCM B;  2VQF L;  1STA A;  5DEH A;  4HSP A;  2FHT A;  5DNF A;  5JAV A;  1EY8 A;  2EYL A;  3R3O A;  3TP6 A;  3PGZ A;  4QL5 A;  1IKM A;  1UEB A;  3H3V I;  1PFM A;  3H0G H;  1B44 D;  1RTN A;  1IYU A;  1ESF A;  3VR6 A;  1YNJ C;  2E2J H;  1PZK D;  1V1Q A;  4R1J A;  4YCV A;  1HQR D;  2D9U A;  5D3I B;  2FMC A;  2R92 G;  5J3B A;  4MZ9 A;  4QUC A;  1IL8 A;  1PYB A;  1NSN S;  3F8T A;  5GAD C;  3FHW A;  1KDA A;  1SYB A;  1O7Z A;  3IRB A;  4WJW A;  3ERO A;  1PVO A;  1R4P B;  3CQZ B;  5J39 A;  1V1P A;  2OQ0 A;  5LL6 X;  3HKZ B;  1GUW A;  1H95 A;  3NQI A;  3H3V C;  5CR3 A;  3I4N B;  4DV4 L;  2PQA A;  5IGB A;  3MTS A;  1WTP A;  1JJG A;  1KL9 A;  2IY5 B;  3HOW B;  4FP5 D;  4A76 A;  1VQL A;  1ENC A;  1KQS A;  4YWM A;  1II3 A;  2B2U C;  2BH8 A;  2K5W A;  3SXH A;  1BXT A;  2ENB A;  4DAP A;  4IAL A;  3VR5 A;  5JJI A;  3KJP A;  4LF8 Q;  2ZXO A;  3VA5 A;  4R9W A;  2NVX H;  1PFB A;  3CD6 A;  2XGT A;  1E0B A;  5BN5 A;  1CM9 A;  2BE5 C;  1JJC B;  4JPB W;  2ZM6 Q;  4I7A A;  3RZD B;  2R92 H;  2HIX A;  2IX1 A;  1JOR A;  1MSG A;  1PHJ A;  2R7F A;  4HID A;  2WAC A;  1XWE A;  3GTQ B;  1MIU A;  1XPU A;  4UHV A;  1AH9 A;  2V1C C;  3JC6 6;  5CV4 A;  3W1G A;  5CC4 A;  3RUZ A;  5EPK A;  1PH9 A;  1B50 A;  2B2W C;  1GHJ A;  3EVQ A;  2AHO B;  4B3R Q;  1UEA B;  4H02 A;  1Y1V G;  3RD4 A;  5IGF A;  3I8Z A;  4LF5 Q;  2A6H D;  5FO9 B;  3TDQ A;  1JJ2 A;  2L55 A;  1VQF A;  2WB1 B;  1VQE A;  1GUS A;  4FF3 A;  5C5L A;  2C5C A;  3F1Z A;  4QCL A;  4DR3 Q;  2PNH A;  4DV1 Q;  2BOS A;  4P73 A;  1H9R A;  2WIN B;  4ME5 A;  3U4V A;  3UDG A;  3SVM A;  2A69 C;  3CC4 A;  1IHZ A;  4K6D A;  1DOM A;  5KYI A;  1WTO A;  2EIF A;  4NXM Q;  1S4Z A;  1DYQ A;  3PO3 H;  1J9O A;  3S1R B;  1XX8 A;  3K8A A;  3FEW X;  3I4M B;  1LV9 A;  2XWJ B;  4OO1 I;  4DAV A;  3MWY W;  4NKL A;  1GM5 A;  3ERS X;  3SDZ A;  3E0E A;  3KDF A;  3M4P A;  1HFG A;  3TME A;  4DR4 L;  1LTR D;  1SMY D;  3C3L A;  2K75 A;  2IWH A;  1N9W A;  1A15 A;  2VXW A;  4H0L C;  1L1O A;  2SDF A;  2GVB A;  2B2Y A;  3ERQ A;  1B4O A;  1NY4 A;  1X3G A;  5C5M A;  3EBE A;  1VQ8 A;  4IUV A;  5M5X H;  3S14 B;  2KJX A;  3LX0 A;  1ET9 A;  2H5X A;  5IT9 L;  1M90 C;  1IYV A;  4FXD A;  2TSS A;  4IFD J;  1F9P A;  3VA7 A;  1PRT F;  1ENF A;  3MEF A;  2CHB D;  1EOT A;  4GN4 B;  1QIL A;  3I55 A;  1HA6 A;  3QG1 A;  1C0A A;  2F0D A;  1WVL A;  4EX5 A;  1X54 A;  4N9T A;  5C3X A;  4BXX H;  4ZK9 B;  4GS3 A;  1ET6 A;  1Q3L A;  4FNF A;  1Y1W G;  5ELB A;  1EY7 A;  4BS9 A;  4MTK A;  4DXG A;  3M4Y A;  1U4L A;  4M8A A;  4X65 L;  2F3I A;  1B1Z A;  1LT3 D;  2ID0 A;  4GN3 B;  1YJN A;  4IN3 A;  3M85 A;  1U9R A;  4C1N I;  4DV0 Q;  2XTI A;  3BZC A;  4DFA A;  3A74 A;  5C4X H;  1Y8O B;  4C3J B;  1BCP B;  1S40 A;  1A6X A;  1L1O B;  4JI1 Q;  4UPA A;  2ASB A;  4KI0 A;  3D0F A;  2Z1C A;  4MNO A;  4XIG S;  4OEM B;  4IQZ A;  4BBS B;  3KBG A;  2JA6 B;  3DXJ C;  4O42 A;  2L9H A;  1TWF H;  3CCE A;  1IBL L;  1ENA A;  1WD1 A;  2WV6 D;  1R4Q B;  2QCP X;  2E2J B;  3MXG A;  2K5Q A;  1STB A;  1ICF B;  3KFU A;  1I4P A;  2HDM A;  1TY2 A;  5CYU A;  1UE6 A;  3DWA A;  1B8A A;  4RGO S;  1Y1W H;  2K1B A;  3RLO A;  3MXN B;  3SR1 A;  5KNB A;  2QEJ C;  2B2T A;  2F0K A;  1YNN C;  1F2Z A;  4B3M Q;  3M3Y B;  5J22 A;  3HOZ B;  4C3I B;  3OWF A;  2OT2 A;  1HHV A;  2UXD Q;  3NEN A;  5ELC A;  2F3V A;  1EWC A;  4Z9C B;  3EA6 A;  3NP8 A;  1L1O C;  4GNX B;  2Q8R E;  2B2Y C;  1K8O A;  3TSS A;  4WFN 3;  2MHV A;  2D0P A;  4J8Q A;  4BBR H;  1I50 H;  2PYK A;  3NSW A;  1CA5 A;  1O78 A;  1EYA A;  4WRD A;  3VR2 A;  3QOJ A;  4HIK A;  5AJ3 L;  1CKN B;  2QGQ A;  3G6J B;  4JBM A;  1VQO A;  5COY A;  2IX3 A;  1TKW B;  1KC8 C;  2ZJQ A;  2NVX B;  4OGQ C;  4FYD A;  4NB3 A;  1S5E D;  5K5P A;  2PW7 A;  1QB5 D;  3ULL A;  3TBI B;  4X3K A;  3I4L A;  5JEA G;  3T1Y L;  2CW0 D;  1XTD A;  3OMC A;  4PMC A;  4NPS A;  2IW3 A;  4X6A H;  1FD7 D;  1VF5 C;  3E9H A;  4HIM A;  4BY7 G;  4CDE C;  1W6K A;  3CCM A;  3KK7 A;  2I5L X;  1JT8 A;  4IUR A;  2K5H A;  5ELF A;  5L37 A;  1BBX C;  4A3J H;  1HZC A;  3CCJ A;  3BDO A;  4DPG A;  3HKS A;  1AP0 A;  5CBE E;  2I46 A;  5JPM C;  4C1N K;  2EYJ A;  1HFN A;  1C4Q A;  4RGT A;  3STB D;  5IP9 H;  5LMU Q;  4NXN Q;  3HOX G;  4A3F B;  1E2V A;  4B9W A;  3T16 A;  1WTH A;  4RA8 A;  3R93 A;  1PYS B;  3P20 A;  1I4R A;  3K0Y A;  4LF7 Q;  4DAY B;  3Q24 A;  2Z4H A;  3TS2 A;  2A1A A;  2KEC A;  2KUM A;  2R7D A;  3GTL H;  5M3M G;  1B70 B;  1PFS A;  4A3E B;  1HUM A;  1TWH B;  3P7J A;  1TQO A;  4L8J A;  1YVC A;  3UE0 A;  2QW7 A;  3K7U C;  3FRP B;  2F0S A;  3BG3 A;  1JOK A;  2O5J C;  4BY1 G;  4QF4 A;  1SNM A;  1QNK A;  5I4D A;  1J5E L;  2KCC A;  1TII D;  4HCE A;  2JA7 H;  1PA6 A;  1SE4 A;  4RHS A;  3CAM A;  3A5Z B;  4ZQ3 A;  2NVT H;  4A3L H;  1KIX A;  5ELD A;  1KHI A;  3SGI A;  2GA4 B;  2HHH Q;  4FO2 A;  5KND A;  4A3B H;  5E3F A;  5CMD A;  3I91 A;  5E1F A;  4AQY Q;  4DR5 Q;  2B2T C;  2PZW A;  2EQS A;  4IPD A;  2OWO A;  3BZD B;  4N8F A;  4A3I B;  1VQJ A;  5M5X B;  2JA8 G;  5EPJ A;  1RJT A;  4YY3 L;  3NE5 B;  3SK4 A;  1I4H A;  4FF1 A;  4P71 A;  1YNX A;  3R2I A;  4X3U A;  1EY0 A;  2KEN A;  3W2D A;  3W3A A;  1A2T A;  3CPF A;  4A4I A;  2K5V A;  4KD4 A;  5C0X H;  2AMC B;  2R93 H;  1VQD A;  5I9O A;  2NZ1 D;  1VQM A;  3J81 E;  4KJN A;  3KF8 B;  4DU9 A;  4JK1 C;  2XIW A;  3BDL A;  1FR3 A;  4U67 3;  2K52 A;  1GKH A;  5E4X A;  2KQ3 A;  4JYA L;  4G4K A;  2KBN A;  1FYC A;  4JI7 L;  3C46 A;  4A3G G;  2BDO A;  1HNX L;  1U5K A;  1EUJ A;  4K6L A;  1SNC A;  2E2H H;  2XN9 C;  3J80 E;  1HJP A;  1WTW A;  1RD9 D;  2B63 B;  3J7A F;  3E0J A;  4CJ2 C;  3I56 A;  3RNU A;  3HZX A;  2E76 C;  4K8J A;  5GAE C;  1VMC A;  4R4O A;  2KEE A;  2RBM A;  1DXM A;  1BR9 A;  1IBK Q;  3FKI B;  3ZJY C;  4GKJ Q;  4Y52 H;  4JI5 L;  2AKW B;  4IPH A;  4CGY B;  1PH1 A;  5DM7 3;  4GLA C;  3S1N H;  3T1H Q;  2KOL A;  2HD3 A;  2EZV A;  1PFN A;  4NW2 A;  2QEX A;  1BDO A;  2BA0 A;  3CRK C;  4B3S L;  2E2D C;  4DR1 L;  2B29 A;  3L0O A;  1SBB B;  3RMH A;  4CKE A;  5M5Y H;  5M9O A;  1LTB D;  3JAM i;  1D7Q A;  4RGN A;  3NPP A;  1EY4 A;  2A19 A;  2A6E C;  2DJG C;  3QB3 A;  2L5T A;  3AEV A;  2LXJ A;  4IJH A;  5EKL A;  2VQF Q;  1YHQ A;  4A3G H;  1KNA A;  5C3E G;  2XSC A;  2RCF A;  5FO7 B;  4B3T L;  1YI2 A;  3S1M H;  1JMC A;  3G6E A;  1Q1B A;  4JVZ A;  4C2M H;  3S1Q H;  1X6O A;  2UUB Q;  2JQO A;  1U4M A;  3K5L A;  5FLX E;  1JWU D;  3D4W A;  5JEA J;  2Y0S B;  1XMQ L;  4HTH A;  4N8X 1;  2AUK A;  4F87 A;  2CH4 W;  2ZTD A;  3DM3 A;  1ZYR C;  3OMG A;  3R8B A;  1DD2 A;  1SYD A;  3EFX D;  4K2K A;  4KY7 A;  1PH3 A;  4J15 A;  3TP7 A;  5IGG A;  1QZH A;  3OOC A;  4XYO A;  2NN6 H;  4DR7 L;  2EE1 A;  2X6L A;  3CC7 A;  2JA5 H;  4GZY C;  1PRT C;  4DV4 Q;  1J8I A;  4HMJ A;  3NBI A;  1RDP D;  1EYD A;  1QUQ B;  1I94 L;  1NMF A;  2R7Z H;  3SK5 A;  1UAP A;  2AWN A;  3A54 A;  1PH6 A;  2LY7 A;  2Z4I A;  3CCS A;  1A3T A;  4FF2 A;  3VR4 A;  1DOL A;  4ODG A;  4KV6 A;  3CMA A;  1XNQ L;  4HIO A;  2A74 C;  1D6E C;  5HY6 A;  3A8J E;  1Z7T A;  3ER0 A;  3M4O H;  3F2U A;  5HGQ A;  4ABN A;  1HH2 P;  4L6T B;  1VQK A;  3GV3 A;  1GUN A;  3PO2 G;  4JOI A;  4YWK A;  3J81 c;  2Z8L A;  3FPP A;  5KNC A;  4O1N A;  4Q5V A;  1IXR A;  2RVL A;  4R8I A;  4IO9 A;  2F52 A;  4DV7 Q;  4LFA L;  4LF9 L;  1YJW A;  1K0S A;  1N32 L;  3KJO A;  4JI4 L;  1ROD A;  5GQO A;  3UE1 A;  3J80 c;  4DK3 C;  3D6C A;  3H91 A;  4BBS G;  4RWS C;  1EYG A;  3DWQ A;  4X62 L;  3A5U A;  4X3T A;  3AFQ A;  2F03 A;  2MUY A;  1B53 A;  1CSQ A;  1SN8 A;  5EAY A;  4KHP L;  2NVY B;  2F4I A;  3KLS X;  4POF A;  1VQ6 A;  4A3B B;  5M5W H;  4A3C H;  5LMN L;  1MJC A;  4M1U B;  3K5O A;  4KN4 C;  4QIW B;  4DV5 L;  1TWG B;  2EY1 A;  1PMR A;  2K33 A;  1K83 B;  2PMZ E;  1QVC A;  4PZ6 A;  4C3H G;  3NBH B;  2KVM A;  1Y14 B;  2YU9 B;  1E24 A;  1N34 Q;  1HNZ Q;  4FXG C;  3HOZ G;  2CFM A;  3VYR A;  4OHJ A;  4DR4 Q;  5K36 H;  1GJX A;  3UDF A;  4S3S A;  3HOV B;  1AZP A;  4A3M H;  1SNP A;  2RA4 A;  5FO8 B;  1TS5 A;  1TWC B;  4IFD H;  1HUN A;  5A2Q E;  2MP1 A;  3PIO A;  4LF4 Q;  1LM0 A;  1Z6H A;  3TZD A;  1JB3 A;  3PSI A;  2O4X A;  2OF1 A;  1GUO A;  5FLX c;  1KAB A;  5D3D A;  3GTP H;  4DUY L;  2CWA A;  1CQF A;  2ZJR A;  1V8Q A;  4Y7N B;  4LWC A;  3OPO A;  2DUD A;  3GTO H;  1PTO D;  1J6Q A;  4UAI A;  3PIP A;  1O7I A;  3U50 C;  4A3D G;  4UP8 A;  1LO5 D;  4DXF A;  3FMC A;  1KAW A;  2IJ0 A;  4C3H H;  4OIJ A;  4QJF A;  1LT6 D;  2LFN A;  1YJ9 A;  4H13 C;  1R9T B;  2A6H C;  4JOI C;  4L5Q A;  1NE3 A;  3W5O A;  2Q2I A;  3S9W A;  1EFI D;  1U0L A;  3H6M A;  2JA9 A;  5T1G A;  2EY5 A;  4LK1 C;  3CCQ A;  4PMW A;  1B2T A;  1ILQ A;  2BH2 A;  4FF4 A;  5M3F G;  4OWT B;  2ICI A;  1AE3 A;  5IP7 G;  2VUM G;  1FGB D;  1H9K A;  5IYC G;  2RSO A;  4A3E G;  1W3S A;  1T9H A;  3X3M A;  4AYB G;  3PF5 A;  4MTN A;  4JI2 L;  3D31 A;  1Y69 U;  3S1M B;  1SJH D;  1SMY C;  1IBL Q;  1CI3 M;  2R6G A;  4P75 A;  1N33 Q;  2VQE L;  1I6H H;  2K6A A;  3PUY A;  1V1P B;  3DMU A;  1KAA A;  4A3D H;  1RL2 A;  3GTM H;  2B8G A;  1OXS C;  4I65 A;  4JI8 L;  4AYB E;  4CKB A;  3OW2 A;  2F0F A;  4TQU S;  2A68 D;  2QKI C;  2PQA B;  3B6Y A;  4DGZ A;  3NUC A;  1E2W A;  5I6Y A;  5IGC A;  1QG7 A;  1ILP A;  4F88 A;  3S16 B;  2XRS D;  3HOU B;  4A3I G;  2I5M X;  2N8N A;  1YIT A;  2WKD A;  2ZXP A;  3H09 A;  4JW0 A;  5EBD A;  4ULL A;  4GLX A;  1LT4 D;  3GTG H;  3IFT A;  5IP7 H;  4RCN A;  2VUM H;  1S5B D;  4QQB X;  2SNS A;  4F8M A;  5IYC H;  1DCZ A;  4KKT A;  2E2I B;  4DV6 L;  3D8G A;  1AN8 A;  1TWA B;  2P5Z X;  1Q46 A;  4A3K G;  4JBW A;  5BR8 L;  2JEB I;  2D2C C;  4MN3 A;  1CHP D;  1HR0 W;  3BVG A;  4POG A;  5AJ3 Q;  3E9I A;  5JJZ A;  3T4A C;  3CP0 A;  1RKN A;  3GTK B;  3K59 A;  3DUZ A;  2QDL A;  5I6W A;  3HOY B;  3SE0 A;  4YWL A;  1Y1V H;  1SE2 A;  1AW7 A;  1Q7Y C;  4NDX A;  1D8L A;  2VB3 X;  4FDB A;  2RHQ B;  4R4T A;  3L2P A;  1KRS A;  4IOA A;  3S2D H;  5JVG 3;  1HPC A;  2O5I C;  1NTG A;  1OXX K;  2N49 A;  5JJL A;  3H94 A;  4OON A;  2B63 G;  5FK9 C;  4K5X A;  4NP5 A;  2Q2T A;  1YBY A;  3OWE B;  1OXT A;  1EFW A;  1F77 A;  4DV3 L;  1SFO H;  5FLM G;  3FKI G;  1YEZ A;  5J1Z A;  1DM0 B;  1E1T A;  1EYC A;  1K0R A;  2DN8 A;  5C44 G;  4A3K H;  2F0O A;  4RKL A;  5M5W B;  2I0Q A;  1VS0 A;  1M1K C;  3KDF B;  3TN2 A;  1S5F D;  4A93 G;  1I3Q H;  1AZQ A;  2B8F A;  4PNY A;  4MIU A;  4K5W A;  3BYT B;  1MSH A;  1XMO Q;  4PV1 C;  2A73 B;  4IUQ A;  3UDX A;  1JOO A;  3N6R A;  2Z6B A;  2NBF A;  5GAG C;  5D65 A;  1Z47 A;  1TVX A;  4UDU C;  4KY6 A;  2ZM6 L;  2WAQ B;  1X9N A;  4CDD C;  3AB9 A;  4XTC S;  1E2Z A;  3U9S A;  3H0G B;  1WYD A;  3DLL A;  2RQX A;  2MNA A;  3ULP A;  2WKC A;  4LMQ D;  3K7A H;  1NCV A;  3K81 C;  3NTI A;  5LHY 1;  3TP8 A;  3S17 H;  2PCF B;  1VQH A;  4DR2 Q;  2X69 A;  2Y0S G;  3PUW A;  1LAB A;  3A8I E;  3MHB A;  4JG2 A;  3TRZ A;  2CW0 C;  5EBC A;  4B3R L;  4LAA A;  2PMZ B;  5C44 H;  2KHS A;  1VQP A;  1CT1 D;  1KLU D;  4DNT B;  1CZG A;  4BA2 I;  3SEB A;  3TP5 A;  2GVA A;  4QY7 A;  1PTO F;  3VYU A;  3TZU A;  4A93 H;  4IFD I;  5GRO A;  3ZYY X;  5I9P A;  4DV1 L;  1CQV A;  5IT9 E;  4ZYS A;  2M00 A;  4PQX A;  4DV2 Q;  3CKI B;  3NXW A;  5HUR A;  3STB C;  2IL8 A;  4NXM L;  3A7A B;  2K14 A;  1RCV D;  3GD7 A;  1TR5 A;  3URY A;  5IWA L;  4JYA Q;  5CV6 A;  2X6G A;  3X3N A;  2UXB L;  1ML0 D;  2R92 B;  2ALY B;  4BA1 I;  4L5S A;  4TKO B;  1STN A;  4YCU A;  1M4V A;  1G2S A;  1AEX A;  2PZT A;  4JBJ A;  1D1K A;  4ZUI A;  1WTR A;  4FVM A;  4LUO A;  4DNR B;  3BU2 A;  2CWP A;  2UUA L;  1O7Y A;  1H9S A;  1PXU A;  3EJI A;  3IL8 A;  1EY5 A;  2NVQ H;  1I4Q A;  3M7G A;  3Q6S A;  3K58 A;  4DUZ Q;  3CCU A;  1Q90 A;  4PZ8 A;  4YHH L;  1A63 A;  1SYC A;  4JI5 Q;  3FDT A;  1SNO A;  3WWV A;  3OSO A;  2HIV A;  4IZ8 A;  5F2D A;  1BCP D;  1FGU A;  4X66 L;  2QF7 A;  1VQ4 A;  4B3S Q;  3GTJ H;  4OX9 L;  2J4X A;  1GO3 E;  1PH7 A;  1HR0 L;  1XNR Q;  1PTO H;  1DGS A;  3JAM E;  2HCC A;  5IOD A;  3S2H H;  2CQA A;  1OXU A;  4K14 A;  4JC0 A;  4XQN A;  2YTV A;  5JEA H;  3PO3 B;  1WCM G;  3EIV A;  3J80 L;  2PNR C;  4BY7 H;  2EJM A;  1VQ5 A;  4KLK A;  3K0X A;  4F7X A;  2F4V Q;  4AH6 A;  4X64 L;  3PMF A;  3EN2 A;  5T1I A;  2MO1 A;  5JOB A;  4JI1 L;  4KK7 A;  2Z9H A;  3CHB D;  1XMQ Q;  3SK8 A;  4FXK C;  2EYF A;  2EYH A;  2DY7 A;  5D14 A;  1EWI A;  1L0X B;  2ICE C;  1PH2 A;  3RZO H;  3M7N A;  3HOX H;  1U4P A;  1T5E A;  1QVG A;  3RLF A;  5IYD G;  4IUU A;  1SE3 A;  2K7V A;  1HA5 A;  4K8I A;  1WTQ A;  2SOB A;  4XQJ A;  3I73 A;  1QE6 A;  2CQO A;  3S2D B;  1SYE A;  3HKZ G;  2H1E A;  4EQ5 A;  4XYQ A;  4RG1 A;  5M3M H;  1I94 Q;  4RAU C;  1STY A;  1WTV A;  3I4N G;  2EXZ A;  4KD3 A;  3TS0 A;  1EIF A;  1K3R A;  2K32 A;  3MEH A;  3MAQ A;  3I72 A;  1EQT A;  5LMN W;  1VF7 A;  4BY1 H;  1SMX A;  3HOW G;  1HQM C;  1NR4 A;  1WCM H;  3S15 H;  1HTP A;  5IYB G;  3AFP A;  3HKZ E;  4LFB Q;  2ES2 A;  5IT9 c;  2UXD L;  2G9H D;  2EDG A;  3MXU A;  5AFW A;  4JI0 L;  2F1M A;  3D6W A;  2DNC A;  3KYH C;  3WDN A;  3CRL C;  1LTT D;  1MJE A;  4UY8 C;  1I3Q B;  5C4X B;  1N36 Q;  2VNU D;  3QO2 A;  2OEO A;  4PZ7 A;  4UP9 A;  1XYI A;  3RLN A;  2PQE A;  1XPR A;  1VQ9 A;  2F0U A;  1SDF A;  5EJW A;  2JA8 H;  1LUZ A;  4LFA Q;  5IYD H;  1X56 A;  3EQL C;  1N32 Q;  4XT3 B;  4JI4 Q;  2SEB D;  4K0K L;  1TWF B;  4HSV A;  1AE2 A;  4JI6 Q;  4X62 Q;  2B2V A;  4XT1 B;  3PQI A;  1Q81 C;  1JR0 D;  4HAE A;  1F2Y A;  4JBK A;  3K7A B;  2K5N A;  1CUK A;  1K28 A;  2NYZ D;  3HOW H;  4JV5 L;  5JJK A;  4RCO A;  2WB1 G;  3S17 B;  4L5R C;  2HUG A;  1PYW D;  4OO1 G;  1CKO A;  2E74 C;  4DV5 Q;  1Y1W B;  4XXE A;  1PRT B;  5FKA C;  1KLG D;  4LF6 L;  3NK9 A;  2EJF C;  1H9J A;  2UUC L;  1SNQ A;  4WOR A;  2C9O A;  2AQ1 B;  1BBU A;  4RHR A;  2XNA C;  1SR3 A;  1MGS A;  2RCN A;  4C56 C;  1SAP A;  3OTO L;  3HOU G;  3QR8 A;  1LTI D;  1A3U A;  2I07 B;  4CDC C;  3JAM c;  4LF7 L;  3RZD H;  1STG A;  1BQQ T;  1Z9F A;  3I4M G;  4BBR B;  1NAP A;  1I50 B;  1LTS D;  5IE8 A;  4IUN A;  4UP7 A;  2MGS A;  5CV7 A;  1TY0 A;  4DR6 L;  4DK1 A;  3K5M A;  3GTQ H;  5IY0 A;  2WFW A;  2B3G A;  2PW5 A;  3HEJ A;  3I3C A;  1CKM A;  4IPC A;  2KCM A;  3L7Z C;  2C35 B;  2E75 C;  1NR2 A;  1RHP A;  1KXL A;  5TSS A;  3G48 A;  1D5Z C;  2RSN A;  4ALP A;  1F9Q A; 
#chains in the Genus database with same CATH homology
 3OIQ A;  1EEF D;  5EQ0 A;  1Q12 A;  4R8N A;  2JXM B;  5I2Y A;  3BS1 A;  4OO1 H;  3P1H A;  3HP3 A;  2G9D A;  1SYG A;  3SHL A;  3K57 A;  2DNE A;  4A3J B;  1ZXT A;  4J1M A;  1CZW A;  5C3W A;  2NVQ B;  1O80 A;  5IOC A;  1S5D D;  2L11 A;  3E5S A;  2AWO A;  2L0C A;  1BCP F;  2RDG A;  5A2Q L;  3LWU A;  5EKK A;  5EKI A;  4EVO A;  3GTJ B;  3GTL B;  1SEB D;  1PTO B;  4G7Z C;  1BUV T;  3GQB A;  4DF7 A;  1S5C D;  2XRQ D;  1VDZ A;  1G8Z D;  5JVH 3;  3O13 A;  4C3J G;  1LTA D;  5KGU A;  4QUF A;  3DHQ A;  3KLR A;  4KN7 C;  2JA7 B;  1Y8N B;  2B2V C;  1C8C A;  2JEA I;  2NVT B;  3ITP A;  5I2X A;  4HED A;  1IW7 D;  2F0J A;  3NTK A;  1KNE A;  3HG9 A;  3MFG A;  5G3L D;  3VR3 A;  3BYY B;  1EZ6 A;  1ZKO A;  3MA2 B;  2EYO A;  3RZO B;  5LL6 S;  3HS0 C;  2PZU A;  5CBA E;  4KHV A;  2EJG C;  5ELE A;  1CK1 A;  4YIJ A;  1PTO C;  2FMM A;  4C3I G;  1PDQ A;  5M3M B;  2O2L D;  1D1I A;  1PZI D;  1EIH A;  5COR A;  2F0H A;  4CHT B;  1GUG A;  3ONA B;  4RKB A;  4B9X A;  1GHK A;  2R93 B;  1F9S A;  4NMZ A;  4KHZ A;  2NWG A;  1AFP A;  1JWM D;  3S15 B;  2V4D A;  4G7H C;  1MBY A;  3HRZ C;  3C1E A;  3NQT A;  4HMI A;  5CGK A;  1A2U A;  1SYF A;  4ZLT F;  3NWT A;  1KDB A;  2M2L A;  3BVZ A;  3FPU B;  1XXG A;  4ZAI A;  5C0X I;  2FFK B;  2E2H B;  3N52 A;  1X32 A;  4XQQ A;  1FNV A;  2JSO A;  1B9M A;  1JIC A;  2JA8 B;  1BF4 A;  5IGD A;  3GV6 A;  5KRU A;  2EY2 A;  2ZXR A;  3K6O A;  4G57 A;  2EPB A;  3S1N B;  3KBX A;  2A68 C;  1ONL A;  4CBV A;  5M5Y B;  1YNJ D;  2JYO A;  3I70 A;  1D5M C;  5C4H A;  4CKC A;  3IAY A;  3A7L A;  3PUX A;  2EY6 A;  4A3G B;  1HXY D;  1JOQ A;  1EL0 A;  3GP7 A;  4ID6 A;  2LS0 1;  1UUP A;  1Q8I A;  1ICW A;  2FIN B;  3IFD A;  4C2M B;  3S1Q B;  2D62 A;  1I4X A;  2F0P A;  2OXP A;  2RDF A;  2F0G A;  2QIL A;  2FJ2 A;  1BOS A;  1PZJ D;  2NB0 A;  2N55 A;  5KEE A;  2F0E A;  3FVQ A;  2RDH A;  4QB4 A;  1K8M A;  5BN4 A;  2PPB C;  2JA5 B;  4I7Z C;  3T56 B;  1WD0 A;  2R7Z B;  2BE5 D;  1GXD C;  1DOK A;  1DZ1 A;  1D2B A;  1BNZ A;  4K5V A;  2J0T D;  5C3E B;  3M4O B;  3D4D A;  2NN6 I;  2XVS A;  1VMP A;  4OIK A;  4EGV A;  3KUP A;  5CV8 A;  1EU3 A;  1EZ8 A;  4P2C B;  1OXV A;  2JE6 I;  2L4N A;  1TT2 A;  4MHE A;  1FNU A;  3DWP A;  1V43 A;  2J7Z A;  1JWS D;  3NTH A;  2HQE A;  2IT1 A;  4CJ1 B;  2XWB B;  1JC7 A;  2A69 D;  4RGM A;  4HN7 A;  1GUT A;  1X3Q A;  5C6A A;  1SND A;  5EGT A;  2JP1 A;  4IUT A;  5G3L F;  1PLF A;  3LWE A;  1HCZ A;  1L0Y B;  1ZEQ X;  1EIG A;  2HCI A;  1VCI A;  5DAU A;  1HTL D;  3MXN A;  1U4R A;  3VYT A;  4HCS A;  4ZKC B;  4EQO A;  2BDN A;  4Q0F A;  2VB2 X;  3IKJ A;  1RF2 D;  1TU2 B;  4N9P A;  3PO2 B;  2KA7 A;  4HR7 B;  3ND8 A;  2YYZ A;  3PUZ A;  1EQV A;  5EPL A;  1LT5 D;  3VYS A;  4KMU C;  1EWH A;  1QNU A;  2AQ3 B;  2L1B A;  1DON A;  4E6I A;  1MI2 A;  1Y8P B;  4A3M B;  4ZUJ A;  3G7L A;  1EEI D;  4QMG A;  2R61 A;  1SJE D;  4IUP A;  3GO5 A;  2PO4 A;  2KCN A;  3DEO A;  3GTP B;  2K03 A;  1G91 A;  3JAM L;  3PV0 A;  3GTO B;  3QJY A;  2CVR A;  4PMB A;  3A55 A;  2MJ8 A;  3P75 A;  4C3H B;  3AMU A;  1F9R A;  4KTA A;  2QDB A;  1GOZ A;  3MC0 B;  1F2M A;  4ZKB B;  2F0L A;  2NTS A;  1BCP C;  5CV5 A;  4DAY A;  1OO9 B;  1G2T A;  5E4W C;  3C2P A;  5IGE A;  3WOE A;  2MPM A;  1TS3 A;  3ND9 A;  4ILW A;  5BN3 A;  2K5D A;  1KTK A;  2F0W A;  3A8K E;  3V2T A;  2KED A;  3NHH A;  3T13 A;  1I6H B;  1YNN D;  3V05 A;  1C48 A;  2A5H A;  4EQN A;  1CFM A;  3R2T A;  4A3D B;  3GTM B;  3E6Z X;  3J81 L;  1LLR D;  1CTM A;  3CU7 A;  2L12 A;  3SK6 A;  1TS2 A;  3WOF A;  1LTG D;  1EY9 A;  1JCK B;  1ESR A;  3MZ5 A;  5M3F B;  3GTG B;  3MVV A;  3T51 B;  2VUM B;  2F0N A;  1G6Z A;  1XTC D;  3KF8 A;  4ZRZ A;  4AYB B;  1UNS A;  2EVB A;  2Q8T A;  5C0X G;  1JE4 A;  3AU7 A;  1RTO A;  2D5D A;  1Q1E A;  4TRD A;  5KYL A;  3K5N A;  2RKS A;  4KJO A;  1IKL A;  2F0T A;  1Y1V B;  1H9S B;  3QOL A;  3I90 A;  2BA1 A;  1JQY D;  1M8A A;  3KLS A;  4J6H A;  4L63 B;  2M9V A;  4K2L A;  3U9O A;  3OHX C;  4RFB A;  3Q23 A;  5IIF A;  1SFO B;  2TMP A;  4RH6 A;  3BVM A;  5FLX L;  3D3R A;  4A3K B;  1MD2 D;  3UI2 A;  1D5X C;  3MFY A;  1QCB D;  5C4Z A;  1H9M A;  4G7O C;  2K28 A;  2N88 A;  3PIO 3;  4XDX A;  3V96 A;  4DK0 A;  1I4G A;  1EY6 A;  1DJR D;  1BO0 A;  2Q8I B;  2F0I A;  1STH A;  2EOT A;  5JPN C;  5ISR A;  1B9N A;  3OW7 A;  3L3O C;  2HDL A;  1X3P A;  2F0M A;  3PIP 3;  3MXP A;  1CHQ D;  3DEP A;  4DA2 A;  5C44 B;  1HRJ A;  4BWG B;  2B39 A;  3HGB A;  3OIP A;  2NN6 G;  4A93 B;  2AQ2 B;  1G29 1;  2F0Q A;  4EQP A;  5KIX A;  2NTT A;  5CV9 A;  1QOH A;  1NUC A;  3DM1 A;  2LKV A;  2LMC B;  3LNN A;  3J7A V;  4H44 C;  2F3W A;  2K01 A;  1B3A A;  4TSS A;  1W6J A;  1I6V C;  1CA6 A;  4CJ0 B;  3C1F A;  1O7L A;  1F2L A;  2K05 A;  4X3S A;  3L9A X;  2A6E D;  2K04 A;  2BCO A;  2F0V A;  4V19 0;  2ZT9 C;  1IW7 C;  3J7Y W;  1V1O A;  1A3V A;  5NUC A;  1WTX A;  2DY8 A;  2EYP A;  2AUJ D;  3NBH A;  3PUV A;  4KY5 A;  3Q22 A;  3S2H B;  1FNW A;  2B2U A;  1QWY A;  2IPK D;  3NWS A;  1ZYR D;  5DM6 3;  1STE A;  4BY7 B;  4KKU A;  5C0X J;  2EYM A;  1SXT A;  1SSO A;  4OL7 A;  5K36 G;  1LAC A;  2R3Z A;  1PRT D;  4U68 A;  3QIA A;  2WP8 J;  4H7B A;  2IX0 A;  3QWN A;  3T53 B;  4DN4 M;  1T5X D;  4IFD G;  3D4R A;  5FOB B;  3HOX B;  4B08 A;  1KDC A;  5HGT A;  2B2W A;  1QJO A;  5C4J B;  4V0B A;  3BDC A;  2WII B;  2H4O A;  3A56 A;  4KKS A;  1EU4 A;  4BY1 B;  1TS4 A;  2SNM A;  4LJZ C;  2NUC A;  5A35 A;  3Q0A A;  1WCM B;  1STA A;  5DEH A;  4HSP A;  2FHT A;  5DNF A;  5JAV A;  1EY8 A;  2EYL A;  3R3O A;  3TP6 A;  1IKM A;  1PFM A;  1B44 D;  1RTN A;  1IYU A;  1ESF A;  3VR6 A;  1YNJ C;  1PZK D;  1HQR D;  2D9U A;  5D3I B;  2FMC A;  4QUC A;  1IL8 A;  1NSN S;  1KDA A;  1SYB A;  1O7Z A;  4WJW A;  3ERO A;  1R4P B;  3CQZ B;  5J39 A;  1V1P A;  5LL6 X;  3HKZ B;  1GUW A;  3NQI A;  3H3V C;  5CR3 A;  3I4N B;  5IGB A;  3MTS A;  1WTP A;  3HOW B;  4FP5 D;  1ENC A;  1II3 A;  2B2U C;  2K5W A;  3SXH A;  1BXT A;  2ENB A;  4DAP A;  4IAL A;  3VR5 A;  2ZXO A;  3VA5 A;  4R9W A;  1PFB A;  1E0B A;  5BN5 A;  1CM9 A;  2BE5 C;  3RZD B;  2IX1 A;  1JOR A;  1MSG A;  2WAC A;  1XWE A;  3GTQ B;  5CV4 A;  5CC4 A;  3RUZ A;  5EPK A;  1B50 A;  2B2W C;  1GHJ A;  3EVQ A;  1UEA B;  3RD4 A;  5IGF A;  3I8Z A;  2A6H D;  5FO9 B;  3TDQ A;  2L55 A;  2WB1 B;  1GUS A;  4FF3 A;  5C5L A;  2C5C A;  4QCL A;  2BOS A;  1H9R A;  2WIN B;  4ME5 A;  3SVM A;  2A69 C;  1IHZ A;  4K6D A;  1DOM A;  5KYI A;  1WTO A;  1S4Z A;  1DYQ A;  1J9O A;  3S1R B;  1XX8 A;  3FEW X;  3I4M B;  1LV9 A;  2XWJ B;  4OO1 I;  4DAV A;  3MWY W;  4NKL A;  3SDZ A;  1HFG A;  3TME A;  1LTR D;  1SMY D;  3C3L A;  2IWH A;  1A15 A;  2VXW A;  4H0L C;  2SDF A;  2B2Y A;  3ERQ A;  1B4O A;  5C5M A;  4IUV A;  3S14 B;  2KJX A;  3LX0 A;  1ET9 A;  5IT9 L;  1IYV A;  4FXD A;  2TSS A;  4IFD J;  1F9P A;  3VA7 A;  1PRT F;  1ENF A;  2CHB D;  1EOT A;  1QIL A;  1HA6 A;  3QG1 A;  2F0D A;  1WVL A;  4N9T A;  5C3X A;  4ZK9 B;  1ET6 A;  1Q3L A;  4FNF A;  5ELB A;  1EY7 A;  4BS9 A;  4DXG A;  3M4Y A;  1U4L A;  4M8A A;  1B1Z A;  1LT3 D;  2ID0 A;  4IN3 A;  3M85 A;  1U9R A;  4C1N I;  4DFA A;  1Y8O B;  4C3J B;  1BCP B;  1A6X A;  4KI0 A;  2Z1C A;  4XIG S;  4IQZ A;  4BBS B;  3KBG A;  2JA6 B;  3DXJ C;  4O42 A;  2L9H A;  1ENA A;  1WD1 A;  2WV6 D;  1R4Q B;  2QCP X;  2E2J B;  3MXG A;  2K5Q A;  1STB A;  1I4P A;  2HDM A;  1TY2 A;  5CYU A;  3DWA A;  4RGO S;  2K1B A;  3SR1 A;  5KNB A;  2QEJ C;  2B2T A;  2F0K A;  1YNN C;  1F2Z A;  3M3Y B;  5J22 A;  3HOZ B;  4C3I B;  3OWF A;  2OT2 A;  1HHV A;  5ELC A;  2F3V A;  1EWC A;  4Z9C B;  3EA6 A;  3NP8 A;  1K8O A;  2Q8R E;  2B2Y C;  3TSS A;  4WFN 3;  2MHV A;  4J8Q A;  2PYK A;  3NSW A;  1CA5 A;  1O78 A;  1EYA A;  4WRD A;  3VR2 A;  3QOJ A;  3G6J B;  5COY A;  2IX3 A;  1TKW B;  2NVX B;  4OGQ C;  4FYD A;  1S5E D;  5K5P A;  2PW7 A;  1QB5 D;  3TBI B;  4X3K A;  3I4L A;  5JEA G;  2CW0 D;  3OMC A;  4PMC A;  2IW3 A;  1FD7 D;  1VF5 C;  1W6K A;  3KK7 A;  4IUR A;  5ELF A;  1BBX C;  3BDO A;  1AP0 A;  5CBE E;  2I46 A;  5JPM C;  4C1N K;  2EYJ A;  1HFN A;  1C4Q A;  4RGT A;  4A3F B;  1E2V A;  4B9W A;  3T16 A;  4RA8 A;  3R93 A;  3P20 A;  1I4R A;  3K0Y A;  3Q24 A;  2Z4H A;  2KEC A;  2KUM A;  4A3E B;  1HUM A;  1TWH B;  3P7J A;  1TQO A;  4L8J A;  3FRP B;  2F0S A;  3BG3 A;  1JOK A;  2O5J C;  4QF4 A;  1SNM A;  1QNK A;  5I4D A;  2KCC A;  1TII D;  4HCE A;  1SE4 A;  4RHS A;  4ZQ3 A;  5ELD A;  2GA4 B;  4FO2 A;  5KND A;  5E3F A;  5CMD A;  3I91 A;  5E1F A;  2B2T C;  2PZW A;  3BZD B;  4A3I B;  5M5X B;  5EPJ A;  1RJT A;  3NE5 B;  3SK4 A;  1I4H A;  4FF1 A;  3R2I A;  4X3U A;  1EY0 A;  3W2D A;  3W3A A;  1A2T A;  4KD4 A;  5C0X H;  5I9O A;  2NZ1 D;  3J81 E;  4KJN A;  4DU9 A;  4JK1 C;  2XIW A;  3BDL A;  1FR3 A;  4U67 3;  5E4X A;  2KQ3 A;  4G4K A;  1FYC A;  3C46 A;  2BDO A;  4K6L A;  1SNC A;  2XN9 C;  3J80 E;  1WTW A;  1RD9 D;  2B63 B;  3J7A F;  3E0J A;  4CJ2 C;  3HZX A;  2E76 C;  4K8J A;  1VMC A;  2KEE A;  2RBM A;  1DXM A;  1BR9 A;  3FKI B;  4CGY B;  5DM7 3;  2KOL A;  2EZV A;  1PFN A;  4NW2 A;  1BDO A;  2BA0 A;  3CRK C;  2E2D C;  1SBB B;  3RMH A;  4CKE A;  5M9O A;  1LTB D;  4RGN A;  3NPP A;  1EY4 A;  2A6E C;  3QB3 A;  2L5T A;  5EKL A;  1KNA A;  2XSC A;  5FO7 B;  1Q1B A;  1U4M A;  3K5L A;  5FLX E;  1JWU D;  3D4W A;  5JEA J;  2Y0S B;  4HTH A;  2AUK A;  4F87 A;  1ZYR C;  3OMG A;  3R8B A;  1DD2 A;  1SYD A;  3EFX D;  4K2K A;  4KY7 A;  3TP7 A;  5IGG A;  3OOC A;  4XYO A;  2NN6 H;  2EE1 A;  2X6L A;  4GZY C;  1PRT C;  1J8I A;  4HMJ A;  3NBI A;  1RDP D;  1EYD A;  3SK5 A;  1UAP A;  2AWN A;  3A54 A;  2LY7 A;  2Z4I A;  1A3T A;  4FF2 A;  3VR4 A;  1DOL A;  4ODG A;  4KV6 A;  2A74 C;  1D6E C;  3A8J E;  1Z7T A;  3F2U A;  4ABN A;  4L6T B;  3GV3 A;  1GUN A;  2Z8L A;  3FPP A;  5KNC A;  4O1N A;  4Q5V A;  2RVL A;  4R8I A;  1ROD A;  3D6C A;  3H91 A;  4RWS C;  3DWQ A;  4X3T A;  2F03 A;  2MUY A;  1B53 A;  2NVY B;  2F4I A;  3KLS X;  4A3B B;  4M1U B;  3K5O A;  4KN4 C;  4QIW B;  1TWG B;  2EY1 A;  1PMR A;  2K33 A;  1K83 B;  4C3H G;  2KVM A;  2YU9 B;  4FXG C;  3VYR A;  4OHJ A;  5K36 H;  1GJX A;  4S3S A;  3HOV B;  1AZP A;  1SNP A;  2RA4 A;  5FO8 B;  1TS5 A;  1TWC B;  4IFD H;  1HUN A;  5A2Q E;  2MP1 A;  1Z6H A;  3TZD A;  1JB3 A;  2O4X A;  2OF1 A;  1GUO A;  1KAB A;  5D3D A;  1CQF A;  1V8Q A;  4Y7N B;  3OPO A;  1PTO D;  4UAI A;  1LO5 D;  4DXF A;  3FMC A;  2IJ0 A;  4OIJ A;  1LT6 D;  2LFN A;  4H13 C;  1R9T B;  2A6H C;  3S9W A;  1EFI D;  3H6M A;  5T1G A;  2EY5 A;  4LK1 C;  4PMW A;  1B2T A;  1ILQ A;  4FF4 A;  2ICI A;  1FGB D;  1H9K A;  2RSO A;  3X3M A;  3D31 A;  1Y69 U;  3S1M B;  1SJH D;  1SMY C;  1CI3 M;  2R6G A;  2K6A A;  3PUY A;  1V1P B;  3DMU A;  1KAA A;  2B8G A;  1OXS C;  4I65 A;  4CKB A;  2F0F A;  4TQU S;  2A68 D;  2QKI C;  4DGZ A;  3NUC A;  1E2W A;  5I6Y A;  5IGC A;  1QG7 A;  1ILP A;  4F88 A;  3S16 B;  2XRS D;  3HOU B;  2WKD A;  2ZXP A;  3H09 A;  5EBD A;  4ULL A;  1LT4 D;  3IFT A;  4RCN A;  1S5B D;  2SNS A;  4F8M A;  1DCZ A;  4KKT A;  2E2I B;  3D8G A;  1AN8 A;  1TWA B;  4JBW A;  2JEB I;  2D2C C;  4MN3 A;  1CHP D;  3BVG A;  5JJZ A;  3T4A C;  3GTK B;  1RKN A;  3K59 A;  3DUZ A;  5I6W A;  3HOY B;  3SE0 A;  1SE2 A;  1AW7 A;  4NDX A;  2VB3 X;  5JVG 3;  1HPC A;  2O5I C;  1OXX K;  3H94 A;  5FK9 C;  4K5X A;  4NP5 A;  3OWE B;  1OXT A;  1F77 A;  5J1Z A;  1DM0 B;  1EYC A;  2DN8 A;  2F0O A;  4RKL A;  5M5W B;  3TN2 A;  1S5F D;  1AZQ A;  2B8F A;  4PNY A;  4MIU A;  4K5W A;  3BYT B;  1MSH A;  4PV1 C;  2A73 B;  4IUQ A;  1JOO A;  3N6R A;  2NBF A;  5D65 A;  1Z47 A;  1TVX A;  4UDU C;  4KY6 A;  2WAQ B;  3AB9 A;  4XTC S;  1E2Z A;  3U9S A;  3H0G B;  2RQX A;  2WKC A;  4LMQ D;  1NCV A;  3NTI A;  5LHY 1;  3TP8 A;  2PCF B;  2X69 A;  3PUW A;  1LAB A;  3A8I E;  3MHB A;  2CW0 C;  5EBC A;  4LAA A;  2PMZ B;  2KHS A;  1CT1 D;  1KLU D;  4DNT B;  1CZG A;  4BA2 I;  3SEB A;  3TP5 A;  1PTO F;  3VYU A;  3TZU A;  4IFD I;  5I9P A;  3ZYY X;  1CQV A;  5IT9 E;  4ZYS A;  2M00 A;  4PQX A;  3CKI B;  3NXW A;  5HUR A;  2IL8 A;  3A7A B;  1RCV D;  3GD7 A;  1TR5 A;  3URY A;  5CV6 A;  2X6G A;  3X3N A;  1ML0 D;  2R92 B;  4BA1 I;  4TKO B;  1STN A;  1M4V A;  1G2S A;  1AEX A;  2PZT A;  1D1K A;  4ZUI A;  1WTR A;  4FVM A;  4DNR B;  1O7Y A;  1H9S A;  1PXU A;  3EJI A;  3IL8 A;  1EY5 A;  1I4Q A;  3M7G A;  3Q6S A;  3K58 A;  1Q90 A;  1SYC A;  3FDT A;  1SNO A;  3OSO A;  4IZ8 A;  5F2D A;  1BCP D;  2QF7 A;  2J4X A;  1PTO H;  3JAM E;  2HCC A;  5IOD A;  2CQA A;  1OXU A;  4K14 A;  4XQN A;  5JEA H;  3PO3 B;  3J80 L;  2PNR C;  2EJM A;  4F7X A;  3PMF A;  5T1I A;  5JOB A;  4KK7 A;  3CHB D;  3SK8 A;  4FXK C;  2EYF A;  2EYH A;  2DY7 A;  5D14 A;  1L0X B;  2ICE C;  3M7N A;  1U4P A;  1T5E A;  3RLF A;  4IUU A;  1SE3 A;  2K7V A;  1HA5 A;  4K8I A;  1WTQ A;  2SOB A;  4XQJ A;  3I73 A;  1QE6 A;  3S2D B;  1SYE A;  2H1E A;  4XYQ A;  4RAU C;  1STY A;  1WTV A;  2EXZ A;  4KD3 A;  2K32 A;  3MEH A;  3MAQ A;  3I72 A;  1EQT A;  1VF7 A;  1HQM C;  1NR4 A;  1HTP A;  2G9H D;  2EDG A;  3MXU A;  5AFW A;  2F1M A;  3D6W A;  2DNC A;  3WDN A;  3CRL C;  1LTT D;  1I3Q B;  5C4X B;  2VNU D;  3QO2 A;  2OEO A;  1XYI A;  2PQE A;  2F0U A;  1SDF A;  5EJW A;  3EQL C;  4XT3 B;  2SEB D;  1TWF B;  4HSV A;  2B2V A;  4XT1 B;  1JR0 D;  4HAE A;  1F2Y A;  3K7A B;  2NYZ D;  4RCO A;  3S17 B;  2HUG A;  1PYW D;  4OO1 G;  2E74 C;  1Y1W B;  4XXE A;  1PRT B;  5FKA C;  1KLG D;  3NK9 A;  2EJF C;  1H9J A;  1SNQ A;  4WOR A;  2C9O A;  2AQ1 B;  4RHR A;  2XNA C;  1MGS A;  4C56 C;  1SAP A;  1LTI D;  1A3U A;  2I07 B;  1STG A;  1BQQ T;  4BBR B;  1NAP A;  1I50 B;  1LTS D;  4IUN A;  2MGS A;  5CV7 A;  1TY0 A;  4DK1 A;  3K5M A;  3HEJ A;  2PW5 A;  3I3C A;  3L7Z C;  2E75 C;  1NR2 A;  1RHP A;  5TSS A;  1D5Z C;  2RSN A;  1F9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...