1EFID

Heat-labile enterotoxin b-pentamer complexed with para-aminophenyl-alpha-d-galactopyranoside
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (HEAT-LABILE ENTEROTOXIN B CHAIN)
publication title Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives.
pubmed doi rcsb
source organism Escherichia coli
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1efiD00
1ENFA 1SE2A 1SXTA 2SEBD 2QEJC 1FNVA 1EFID 4O1NA 1JWUD 1RCVD 1BXTA 1EWCA 1EU3A 1JR0D 4RGOS 5ELBA 4BWGB 1LTID 1CK1A 3EFXD 2CHBD 5FK9C 1PTOH 1SEBD 4DXGA 1V1PB 1M4VA 1ET6A 1PTOD 2J4XA 1KLGD 5D3IB 1BCPD 1JCKB 2AQ3B 1ET9A 1SJHD 1PZID 2O2LD 2ICIA 1CHQD 3DWPA 1FNUA 1SE4A 3KLSX 2XNAC 2RDGA 3R2TA 1L0XB 1TS2A 2AQ2B 5I4DA 4TSSA 1F77A 3BVMA 4Z9CB 1HA5A 3R2IA 4UDUC 1V1PA 1LTRD 5FKAC 1L0YB 1PTOC 1LTGD 1S5ED 1DJRD 2QILA 1BCPC 1AN8A 1GOZA 3CHBD 3O13A 3DWQA 1LT4D 1HXYD 5D3DA 1TS4A 3URYA 1JQYD 1CT1D 3R8BA 1JWMD 1TS5A 1LT3D 5TSSA 3GP7A 1KLUD 3EA6A 1PRTD 5ELEA 4RCOA 1D6EC 1MD2D 1HTLD 4OHJA 1I4PA 1S5FD 2R61A 1PTOF 1KTKA 4C56C 1D5ZC 1JWSD 1XTCD 1XXGA 2AQ1B 2NTSA 5ELDA 1BCPF 4RHSA 2WV6D 3MC0B 1I4GA 1PRTC 1LO5D 1DYQA 1FNWA 1STEA 1B44D 2Z8LA 2XRQD 1TY0A 1UUPA 1D5XC 4DXFA 1RF2D 1CHPD 1LT6D 1SJED 3BZDB 3W2DA 1RD9D 1TY2A 2IPKD 1SE3A 1SBBB 1CQVA 2XRSD 1S5BD 3OWEB 1EU4A 2IJ0A 1RDPD 4RGTA 1D5MC 4RGMA 1PTOB 4RFBA 4RH6A 1PRTF 3TSSA 4ZYSA 1BCPB 1EEID 2TSSA 1I4QA 1TS3A 1LTTD 5ELCA 3MFGA 1G8ZD 1S5DD 1S5CD 1UNSA 1V1OA 3BVGA 4L63B 1ESFA 4L6TB 1I4HA 1B1ZA 1PZKD 2NTTA 4RHRA 1I4RA 1PZJD 1QILA 1PYWD 5ELFA 1FGBD 4K6LA 1LTBD 1I4XA 1T5XD 2G9HD 3DWAA 1LTAD 3BVZA 3SEBA 1LT5D 1HQRD 1LLRD 1FD7D 2XN9C 3BYYB 4RGNA 1EEFD 2RDHA 3V05A 1PRTB 1AW7A 1LTSD 3BYTB
chains in the Genus database with same CATH superfamily
1F9RA 1E3PA 4ZLTF 1HUNA 1J5EQ 1X56A 1BXTA 3NBIA 5ELBA 3KLWA 2JA7G 5JAVA 1E7ZA 1EUJA 3MZ5A 4V0BA 2EJFC 4A3FH 2B2UC 4A3CH 2QKIC 1AZQA 3D4DA 5I2YA 1ET9A 4LF6Q 2Q2TA 2K5DA 1HA6A 3HGBA 1PHJA 4FXKC 4X66L 1U4PA 1WTQA 1DM0B 3CCJA 5GQOA 3CHBD 2UXCL 3ERSX 2MJ8A 3AB9A 1CKMA 4JI7L 3M9BA 3UDIA 3ER0A 4JI0Q 1PRTD 1VQJA 1KRSA 4RCOA 1EOVA 4JI5L 1C8CA 4KJOA 2BE5D 2RVLA 3N6RA 1YZ6A 1L2FA 4A75A 1YITA 2R92B 1Y1WB 3E9HA 2B2YC 1D5ZC 1XTCD 1EIFA 3PUYA 5ELDA 1NTGA 5IT9c 3Q24A 2VB3X 4JI1Q 4Q5VA 4A3JG 5E1FA 4K8JA 3EQLC 3K5NA 3GTPH 4FXGC 3TZDA 2WAQE 2VXWA 4XQQA 2OTJA 2R7ZG 2RHSB 2OEOA 3A74A 3TP7A 4DV5Q 3BZDB 2K04A 1NR2A 5FOBB 5EPKA 2JA5G 2PW5A 4KHPQ 1CKNA 3SDZA 2NZOA 3M85A 3KJOA 1X3PA 2HT1A 1ZYRD 1NNXA 1TWCH 3H94A 5I2XA 3HP3A 2VUMH 2E76C 4KKUA 2F0GA 2D2CC 3H3VI 3H91A 3NE5B 3BVGA 4FF1A 4IFDJ 1X3GA 3K5LA 4IFDH 1E0BA 2D9UA 2KEDA 4IPDA 3DHQA 4POFA 1RJTA 1WTOA 1FR3A 3S2HH 1GXDC 1I94L 3K7AH 3U50C 1Q12A 1VQ6A 4KTAA 1SLJA 2F0DA 3NBHA 3KBXA 4ZKBB 1MKHA 1V1QA 2MQHA 2JK8A 2F0VA 1N32Q 1PRTB 1SNPA 1N34L 3PGZA 3HRZC 4DPGA 1VF5C 2B2WA 1SXTA 4JV5Q 2R7DA 3ULLA 4X65L 4X3KA 1K0RA 5M5XH 5IIFA 4HN7A 2BCOA 1AEXA 3HOUG 4DV3L 2Z4HA 3VYTA 3Q22A 2PZWA 3J80c 1PLFA 5K36G 2K32A 1RODA 1TXYA 2RA4A 2YTYA 1WTWA 4CKCA 3HS0C 5C3EH 2Z6KA 2KEEA 5KNDA 3P20A 3IRBA 3OSOA 3PUZA 5GAGC 1F77A 1KC8C 2OTLA 4C3JH 1L1OA 3NHHA 3KLRA 4BA1I 3R3OA 3PF5A 1JOQA 3L7ZC 2CQOA 2ES2A 2CFMA 5D3DA 4RKBA 1LTLA 3URYA 4A3GH 2K5QA 4HMJA 4H02A 2QW7A 4GLXA 2B2WC 4ME3A 1LACA 3V2TA 1VMPA 5IWAQ 2G9DA 2K14A 5BR8Q 4CJ1B 4C56C 1IYVA 1VQEA 4ODGA 1VQNA 4OIJA 2F3VA 3F1ZA 3KF8B 5KNBA 5LMUQ 2UXBQ 1HZ9A 2E2JB 4A3EG 3C1EA 3DLLA 4C1NK 1PDQA 2Z6KC 4XYOA 1D2BA 2GN5A 1IL2A 4C3IG 1DZ1A 3CC2A 4WRDA 4MNOA 2BH8A 2A1AA 2NVXH 3NP8A 2K01A 2L12A 1K8AC 4BY7G 4PV1C 3S1QH 2MUYA 1PH1A 4DK6C 4HEDA 1YHBA 4NXNL 2H5XA 4IOCA 2NTTA 4A3BG 2RSOA 1VQIA 4FVMA 1TWHB 1PYWD 5CYUA 2IX3A 4DK3C 2EJGC 1TWGB 1J5EL 2F0WA 1WYDA 1WTVA 1PH3A 2JA7B 4LJZC 5JEAG 3NTIA 5C4XG 1GVPA 3ICEA 1EIHA 1GUGA 1RCVD 3GTGB 3S1NB 2HHHQ 5CGKA 1YIJA 1PTOH 3FKIH 4N9PA 4A3LG 1ET6A 3GTJB 3M4YA 5D3IB 5FO9B 1PVOA 4CDEC 1QVFA 3BS1A 3L9AX 3CD6A 4HSVA 1MIUA 2XNAC 2J0TD 4LFCQ 3MEHA 4H7BA 4ZCKA 2AQ2B 1EFWA 1JMCA 2R6GA 4OWTB 2F0TA 1STYA 2EXZA 1EQRA 1RKNA 1DGSA 3CF5A 4DUYQ 1EQQA 2I0QA 5FO7B 3GTOB 2Z6BA 3RN2A 1MD2D 1K83B 2AKWB 1BKBA 1G2SA 3CU7A 3GTQH 4MHEA 2V4DA 1GUTA 1UAPA 1VMCA 3MAQA 2RCFA 4GZYC 4HIKA 5IGCA 2R7ZB 3H3VC 3RLNA 1CKNB 1Z6HA 2JN4A 2F0UA 1GUOA 3VYUA 2JA5B 1FNWA 1STEA 1XJVA 1XTDA 3W3AA 2B63G 3HOYG 1JOKA 2L11A 3KBGA 4IUPA 4PG3A 4DV0Q 3OWEB 1SYGA 4MN3A 5JPMC 3TS2A 1M90C 3NQTA 4MZ9A 4MIUA 4RFBA 1OXUA 2WIIB 2E75C 3S9WA 1NE3A 4B3ML 1GO3E 4JI2Q 4ZK9B 1JB7A 1VQMA 1G2TA 1G8ZD 1BBUA 4A3DH 1KL9A 3SK6A 1HZAA 1LUZA 3PCOB 4WJ4A 5M9OA 1B70B 1X3FA 3ZYYX 1N32L 2VQFQ 3K0YA 2EY5A 2AUKA 4JBMA 3CRLC 3DWAA 3MXPA 2MNAA 4QUCA 1LLRD 1P8LA 2HIVA 4EVOA 1SYEA 1Q90A 2E2IH 3HOUB 2OQ0A 1AW7A 2Z8LA 5FJ8G 4RCNA 3A5UA 1NSNS 1HPCA 2D5DA 2NWGA 1IBKQ 1MGSA 1D8LA 1BNZA 4KD4A 4DF7A 4AQYQ 1IXRA 2HD3A 1I6HH 2B8FA 4A3IG 1I5FA 1KDAA 2A68C 1VQKA 1SJHD 3TQYA 1FNUA 1TU2B 1SROA 4OWXB 3RZOH 4HIDA 3BVMA 4QGUA 4DAVA 4DN4M 4POGA 5BN5A 1RIPA 3ND8A 4IPGA 2Y0SG 1J6QA 1LT4D 2ZXPA 3MA2B 4BBSG 3PMFA 1VCIA 1PMRA 2AWNA 5IWAL 5BR8L 4LFAQ 3GP7A 4IPCA 4XXEA 1KLUD 3U9SA 2A69C 4FO2A 4BXXG 5LMUL 3OW7A 3AU7A 4OO1H 2UXBL 3CP0A 1L0WA 2XIWA 2RCNA 1MJEA 4A3EB 5FLXc 1B8AA 3K57A 4LF5L 4JBJA 4RHSA 5JOBA 1EQVA 3S1RB 4AIMA 5M3FH 4C3IB 2DJGC 2KENA 4HIOA 3I3CA 5HY6A 4G57A 2L55A 2C35B 4X66Q 5EGTA 4BY7B 4LFBQ 2OWOA 2UXCQ 1B7YB 4F7XA 1PH9A 2ZM6L 2N3SA 1NMFA 1PH5A 1QG7A 2I5HA 2KCMA 3SHLA 1A2UA 3GTKH 4A3BB 4JI5Q 2A74C 1I4QA 1FL0A 2IY5B 2K50A 3S24A 4IO9A 4WJ3M 2K6AA 2D62A 1B1ZA 3AQQA 2F0OA 4PZ7A 2K4KA 5GROA 4KK7A 1I4XA 3J81L 3G4SA 3PIO3 3S14B 2OF1A 2PQAA 3A0JA 1UE5A 5C4XB 4RGNA 2CKZB 5E4WC 4WJWA 5CMDA 1A3VA 1XPOA 1H95A 4GLAC 2F0FA 3K80C 3P1HA 2A68D 5CV8A 1EZ6A 1JWUD 2JYOA 1EU3A 1JR0D 3M3YH 3D8GA 4KD3A 4DAYA 1C4QA 4LFCL 1M4VA 2YTXA 3FVQA 1NCVA 5CV5A 1G51A 5D14A 1Q82C 2EY2A 3IFTA 5I6WA 4JI4L 1EY6A 1G6PA 4HCEA 4DR7Q 4JI6L 2EIFA 2B2VA 1K9MC 1Y1VG 1BBWA 5GAHC 2MO0A 3I7FA 2A69D 2K75A 1S5ED 1EYGA 4C2MB 4A3KH 4WFN3 2NZHA 4K5WA 4L5RC 1XMOL 2E2HB 2KHSA 1YJWA 1N34Q 1OXTA 2SOBA 1U0LA 1TS5A 1GHKA 3PIP3 3HG9A 1SE8A 5ELEA 1JJ2A 4B9XA 4DAMA 2B3GA 3PO2H 1PTOF 4JBKA 1KIXA 1JWSD 1KHIA 2AQ1B 1HNZQ 2B63B 1XPUA 3CPFA 4GN4B 3HOYB 4DR2Q 1K73C 3ND9A 4EQPA 5GADC 3PO3G 5IE8A 4L5QA 1RF2D 2UUCL 2F0IA 3JAML 2B2VC 2EZVA 4DR3Q 2PNHA 3S17B 2QEXA 4GKKQ 1TR5A 2O5JC 5NUCA 5D65A 4X3SA 3NELA 2A73B 5EKIA 4FYDA 1A6XA 1RL2A 2EYMA 5M5YB 1SSOA 1C9OA 3TSSA 1YJNA 1E2WA 4KN4C 2TSSA 1WI5A 3EIVA 4KN7C 5I6YA 5C4JH 4LAAA 1XMQL 5C0XJ 4YWLA 3HOZG 5ELCA 5C0XH 4LWCA 4DV7L 4HJ8A 3TMEA 2DUDA 1I4HA 1GHJA 2F0PA 4J6HA 1EL0A 3G48A 1B9MA 1QUQA 1LTBD 1EY4A 4Y7NH 1BBXC 3J7YW 1STGA 2HUGA 1TWAB 3BVZA 2Q2HA 2F0LA 3OIPA 1LT5D 3DMUA 3PF4A 1EEFD 1IBKL 1W3SA 2WKCA 5FLMH 5AFWA 1XWEA 1GD7A 3CCUA 1GUNA 2QEJC 1HNXL 5IGBA 3N52A 3Q6SA 4IJHA 4A3IB 4RG1A 2L5TA 3STBC 1AH9A 4UP8A 3K5MA 4PMWA 3HOVH 2ASBA 4NXNQ 2E8GA 4DAPA 2O2LD 2ZJPA 3W1GA 2E2DC 2Y0SB 4EQOA 2K5VA 4ID6A 4LUVA 3VR4A 4BBSB 1AE3A 2F0SA 2N8NA 4DUZL 5C4HA 3FEWX 4WORA 3VR3A 1ILQA 1DJRD 2PI2A 4LFAL 3I4MH 3VDYA 2FHTA 4KI0A 4H13C 1YEZA 5DLQE 2WP8J 1E24A 3GD7A 3TN2A 3D0FA 1CT1D 3FDTA 2K5HA 1YJ9A 1NBWA 1PFNA 4FXDA 3CMAA 2XWBB 1HHVA 1HTLD 3OOCA 5H1SE 2Q8TA 1S5FD 2R61A 3H0GH 1KTKA 1VQGA 3K7UC 3KDFA 1CA6A 5IP9G 3DXJC 3T53B 1BCPF 4R1JA 2L4NA 2BA1A 4HR7B 3CCVA 4LFBL 1HTPA 3S16B 4ZKCB 2R93H 2PZTA 2DN8A 2HQLA 4JK1C 1UE7A 2JA8G 1B3QA 1SMYC 1Q1BA 3EN2A 3F2CA 4HAEA 1SBBB 4A3MH 4IUVA 2F4IA 2JSOA 1XNQL 3KF6A 1I3QH 1U4LA 1MJCA 1Y8NB 1SFOB 2LSSA 1RTOA 4ZYSA 2NVQB 3WOEA 2MO1A 3KJPA 1WCMG 1TS3A 2UXDQ 1LTTD 2EYJA 3A8KE 2IX0A 3DEOA 5FLXE 1HFGA 3S15B 1GJXA 5G3LF 3VA7A 2KVMA 2L9HA 5IP7G 5C5LA 4DNRB 4IOAA 1J8IA 4J1MA 3U58A 2RHQB 3H09A 2G9HD 2Z1CA 5M3MH 5E4XA 1SNOA 3VYRA 1IYUA 3A8JE 2KJXA 4DAYB 2ATWA 1PXUA 1VQ9A 1LABA 4OXPA 5J39A 4HJ9A 5JEAJ 4QMGA 1AZPA 1EWCA 2F0KA 2UU9Q 2XVSA 4C3HH 4DR7L 3TREA 3RZDH 2X6LA 3RNUA 4B3MQ 4JI3Q 2ZXRA 1O78A 1Y1VB 4YCWA 5T1IA 3I4NH 1PH2A 1Y14B 1LYLA 2L1BA 1E1OA 2LXJA 1A15A 4EX5A 4BY1G 1Z9FA 3P7JA 3F2DA 4DV1L 2NVTB 3TP8A 4J8QA 1V1PA 1Z7TA 3JAMi 3I8ZA 4DNTB 1PH4A 5IYDH 4NP5A 4A93H 5CBEE 3UE0A 2J7ZA 3BDOA 4GKJQ 2JA6H 1HXYD 4DV4Q 3I72A 1DOMA 2F1MA 4JCVE 2B2TA 4AYBG 3JC66 2XSCA 5M5WB 1HNZL 3L2PA 2LY7A 3T56B 4IURA 1HR0Q 4DR2L 4JVZA 1VQFA 4BA2I 1SMYD 2NTSA 2JEBI 3PO3B 3HKZG 1II3A 4YWMA 4DR3L 2LS01 4BBRG 2YU9B 3VA5A 4GKKL 5DNFA 1TY0A 2EPBA 1UUPA 1D5XC 2PYKA 1IL8A 3I2ZA 4X3TA 3T1HL 5LL6S 3GTMH 2HDMA 2N78A 1HR0W 1TY2A 5CR3A 3D3RA 2Y0SE 3G6JB 4GS3A 5C44H 1XYIA 3A7LA 3PUXA 4R4IA 1QCBD 1TQOA 4RGTA 3HOZB 1N9WA 4ABNA 4N8FA 1ENCA 3CCRA 1WOCA 3VR2A 4ZRZA 4A3FG 1QNKA 1VS0A 1R9TH 3HOWH 4A3CG 3FP9A 4LF5Q 3K6OA 2IL8A 2KA7A 1CZGA 1CSQA 1T5XD 3FMCA 3GTLB 2KQ3A 3CCLA 3LGJA 2ZTDA 3OWFA 3SEBA 1EIYB 1L1OC 1ICWA 3E6ZX 4L8JA 4YIJA 2M2LA 1LTSD 3WWVA 2SNMA 2ZM6Q 3RLFA 1EQTA 1K8GA 4TQUS 5CV9A 2ZJQA 1VQOA 1E1TA 3HOXH 3UDGA 1T9HA 1NMGA 3IL8A 3S2DH 4L5SA 1C48A 2QDLA 3M4OH 1HUMA 2I07B 2RDFA 1PZID 1TWFH 4KHZA 3S1MB 1KQSA 3Q0AA 4QL5A 4P75A 1I50H 1LTRD 3Q8DA 5C5MA 2ZJRA 4ZUIA 4RMFA 1JT8A 1R4PB 2A6EC 3T1YQ 5IGEA 3KDFB 5IYBH 3R8BA 5TSSA 1YHQA 1MSHA 1JE5A 3BU2A 3NWSA 1HRJA 5DM73 4OHJA 2PQEA 1BOSA 3DM3A 2VUMG 2WB1G 3CQZB 4NXML 2K52A 1QB5D 4JI4Q 3IKJA 1J9OA 1W6JA 4B08A 2JA8B 4IFDG 4JI6Q 3KF6B 1UEBA 4I7ZC 2KCTA 1O7YA 4IZ8A 4F8MA 3I73A 3MHBA 5C6AA 4OIKA 2F52A 2OQKA 4B3SL 1MBYA 2XRSD 5A2QE 1XMOQ 4N8X1 1WCMB 2UXDL 3TS0A 2EYFA 1CUKA 1H9MA 4X6AH 4R4OA 1ZXTA 3I90A 2O5IC 1KAWA 2QCPX 2PO4A 5HGQA 2TMPA 2AUJD 1STAA 1IKMA 1LM0A 3LX0A 1V1OA 2K5WA 1VDZA 2R92H 1Y1WH 3OPOA 3J81E 1A8VA 4QJFA 5C3EG 3OMCA 4YY3Q 2FMCA 3GV6A 4PZ6A 1U9RA 4QUFA 3I55A 4CKBA 2MGSA 1RTNA 4DGZA 2UUCQ 2IW3A 4C3JG 1DONA 1G91A 2F4VL 2RDHA 2UU9L 3F8TA 2XTIA 2JP1A 2A8VA 3PSIA 3OW2A 5CV6A 4JI3L 1FNVA 2YV5A 2Q8IB 3C2PA 5E7NA 4A3GG 4XYQA 4LF8Q 5JVG3 4C1NI 3NBHB 3ONAB 3MWYW 1CK1A 2Q2IA 2K28A 2NN6H 2K03A 4JI8L 4DXGA 1V1PB 3CRKC 1A63A 1XMQQ 2F0EA 1KLGD 4BY1B 1VQPA 4V190 2V1CC 3TRZA 3T16A 4DV7Q 2A6ED 4DK0A 3F2UA 4LUOA 4RWSC 4DR1Q 2X69A 2RDGA 4K8IA 5DEHA 5I4DA 4GKJL 4DV4L 3PQIA 2RF4A 3C1FA 4AYBB 1E2VA 3E0JA 1DOKA 4K5VA 2EVBA 3DWQA 5EBCA 4R9WA 4DV2Q 1F2ZA 1HR0L 5LMNW 3I70A 4IUQA 3UE1A 3AEVA 3NENA 1N33Q 1HNXQ 1L1OB 3TDQA 1O7ZA 3HKZB 5LL6X 3BZKA 1I4PA 4BBRB 1K28A 3E5SA 4X64Q 3OTOL 5KYIA 4P2CB 1D1KA 2PI2E 1DYQA 2NBFA 1BVSA 3JAME 4JYAQ 4LW1A 3DM1A 4TKOB 4DXFA 3QB3A 4DUZQ 5EKLA 4TVAB 1VQHA 1IBLL 3QOLA 1CKOA 1KNAA 1Q86C 4KY6A 3WOFA 1UE1A 4EQNA 1PH7A 3FHWA 4A3FB 4NKLA 1Q1EA 2JE6I 1WJJA 1KXLA 1O7IA 5KIXA 4DR6Q 4ZUJA 3FKIG 1N36L 4CJ0B 4L63B 2CWAA 1LV9A 1OXSC 1VF7A 3E9IA 1H9SA 1ASYA 4QCLA 1Q8IA 5ELFA 1KNEA 2K05A 4OO1I 1WTPA 1IBML 4JG2A 3RLOA 5IYCH 2E2JH 4JC0A 1A2TA 4B9WA 1PH8A 2EOTA 4DKAC 5IY0A 3EROA 4A3MB 3VR5A 4FF3A 1XNQQ 2DJFC 4KKSA 4QY7A 5HGTA 4P74A 2F0MA 1KRTA 1GUWA 3EVQA 1AP0A 1MHWC 3NQIA 4CGYB 4LF7L 3GTPB 1K8MA 3IAYA 2PNRC 1QZHA 3T1YL 4KMUC 1HH2P 2F3IA 1SYDA 3DEPA 3ZJYC 1A3TA 4X62Q 3R2IA 1TWHH 4UDUC 3TP6A 4P71A 1PTOC 2PCFB 1CZWA 1M1KC 1Y8PB 1GOZA 1TWCB 4KY5A 3OYYA 1TWGH 3UDFA 1JORA 4EQ5A 3CCSA 1JWMD 3MEFA 1DOLA 2WINB 2VUMB 2WB1B 3KLSA 2JA7H 3PIOA 4CDFC 2N88A 4MTKA 4LF4L 3BZCA 1EYCA 3SXHA 4MTNA 4CDDC 1UE6A 2SDFA 3S1NH 4DR5L 2KBNA 1XXGA 3S2HB 1VQ8A 1Q8KA 3V96A 3K7AB 3GTJH 2KHIA 4G7ZC 4A3DG 2KOLA 3U9OA 3MXNA 3KOJA 5I9OA 3J81j 4LUZA 3KUPA 1Y8OB 4DV1Q 1K3BC 1UWVA 3ERQA 4JBWA 5IT9L 3L3OC 2UUBL 3LNNA 3FPUB 3W5OA 5M5XB 4JOIA 3SK8A 3AFQA 4NMZA 4AYBE 2P5ZX 1WFQA 3T13A 1F2YA 1B4OA 5KRUA 5LHY1 5JJZA 1CA5A 3EJIA 1CI3M 1G6ZA 5C3EB 1H9KA 3GTOH 4QF4A 4YY3L 5HURA 3MFGA 1K83H 1S5CD 3AYHB 1U4MA 1AE2A 5FO8B 1X6OA 1ESFA 2IHEA 3HKZE 4A3JH 2EY6A 4ULLA 3BDCA 2K7VA 4C3JB 3PIPA 1HJPA 5EQ0A 2R7ZH 2FMMA 3T1HQ 5IGFA 4OX9Q 2BA0A 2JA5H 4YHHL 1FD7D 4A3GB 4LF8L 3U4VA 1WD0A 4YCVA 4B3TL 1SNMA 4RKLA 5LMNL 2EY1A 4ALPA 3SE0A 4R4CA 5EAYA 2HDLA 1Z47A 4DR1L 1U5KA 2M00A 2PW7A 1PTOD 4OO1G 1CM9A 4KHVA 2A6HC 3RMHA 3J80L 1BUVT 3FPPA 1E22A 2DGYA 1L0XB 1OO9B 1TS2A 5CV4A 5M3FG 4DV2L 3AMUA 4O2DA 5C0XI 2BH2A 3NK9A 1X32A 1N33L 2NVXB 1BCPC 1F9QA 2HCIA 2YTVA 1Y69U 3RN5A 2MFIA 5KEEA 2ZXOA 2K33A 4KV6A 4OONA 2XWJB 1ESRA 1ZKOA 2RQXA 1O80A 4KLKA 2L0CA 3HOUH 3S1QB 3GV3A 3KF8A 5K36H 1A3UA 3R93A 1F2LA 3SGIA 4X64L 4DV6L 3P75A 3WDNA 3UI2A 2B2UA 1AFPA 1X54A 1SAPA 4JYAL 1QNUA 2VB2X 4G4KA 2VW9A 4PMBA 1ICFB 3MC0B 4QQBX 3I4OA 1HNWQ 1WTRA 3TP5A 2OCEA 1H9JA 4CJ2C 4X3UA 3ULPA 3W2DA 1RD9D 1TIID 4PNYA 3CMEA 1CQVA 5ISRA 3HEJA 1EY9A 2VL6A 1D5MC 1X9NA 4DR6L 2KUMA 1H9SB 1PTOB 1CFMA 3FKIB 1PRTF 3QO2A 1S4ZA 4FP5D 2WB1E 1A62A 3J81c 2B2YA 2K5NA 4L6TB 4NXMQ 1F9SA 4RHRA 3J81i 1MSGA 4TRDA 1STHA 1QILA 1C7YA 2EJMA 1NY4A 4A3EH 2RBMA 4K6LA 3KK7A 3M7GA 2ENBA 2GA4B 3S1RH 4C3IH 5IODA 4OWWB 2IHFA 1YBYA 5CV7A 2EYHA 4B3SQ 4A3KG 4UY8C 1ENFA 1SNCA 2A6HD 3C3LA 2B39A 4BY7H 2PQAB 5C3XA 5DM63 3GTQB 1S40A 1LTID 1P16A 2VQEQ 1W2BA 1QZGA 3PO2G 4A3BH 4X62L 1BCPD 2AQ3B 3A7AB 2DY7A 3DWPA 3ULJA 1SE4A 1A0IA 4R8NA 3CXCA 3STBD 2QF7A 2BDNA 2M9VA 3H15A 4FNFA 1X3EA 5JJKA 3K59A 3S14H 2QILA 4IQZA 2DNEA 5JEAH 1HZCA 2F4VQ 5C4XH 1TS4A 1PH6A 1JQYD 1BF4A 1EWIA 3H3VH 3BDLA 2D0PA 3W1BA 5CBAE 1O7LA 3L0OA 3VR6A 3MXNB 3K81C 1KABA 4A3LH 4A3DB 4PZ8A 3OMGA 5A35A 3CCEA 4B3RQ 4JI8Q 1DCZA 1DXMA 4KJNA 5C0XG 3BJUA 5G3LD 1FJGQ 1SDFA 3JAMc 3NEMA 2MPMA 4XTCS 4GLVB 2JA9A 2ICEC 1LO5D 1SYBA 3M4QA 1BO0A 4IFDI 3HFZB 4ILWA 2E2IB 3G71A 4ME5A 4IUTA 2IJ0A 1TKWB 4C2MH 3J7A5 2L15A 1IZ6A 5FLMG 3J7AV 1I6HB 2E2HH 4UAIA 2JQOA 2ZTEA 4RGMA 4RH6A 1X55A 1EOTA 4N9TA 1BCPB 4CKEA 1NAPA 1XPRA 3GO5A 1SNQA 4DA2A 2CVRA 3HOVG 3RZOB 3SK4A 4OX9L 3J80i 2PMZB 3D6CA 3OTOQ 4LF9L 3M7NA 2B63H 2RKSA 2ID0A 1IW7C 1QJOA 2A19A 2Z4IA 4NPSA 4DU9A 1IYJB 1JE4A 5KNCA 3HOYH 1LTAD 3ITPA 4G7HC 1NJIC 3CPWA 4IPHA 4E6IA 1IBLQ 4YWKA 1JOOA 3I4MG 2F3WA 1QUQB 4GOPA 2B2TC 3S17H 1NUCA 1TT2A 3Q23A 3IFDA 4S3SA 2LFNA 5M5YH 1QVCA 1F2MA 2BOSA 4XT3B 2ZTCA 2J4XA 4Q0FA 5M3FB 2KHJA 3H0GG 1N36Q 1JCKB 2WACA 1G291 2K1BA 4PMCA 3RD4A 1S3OA 2OXPA 4K2LA 4FF2A 3UDXA 4A4IA 2IX1A 3CKIB 2DY8A 2Q8RE 4L5TA 3RR5A 1IBMQ 2R93G 2DNCA 5FJ8H 3O13A 3TZUA 4QIWB 1TWAH 1YNNC 1QE6A 2R3ZA 1VQBA 4HMIA 2NB0A 5EJWA 4A3MG 2HQEA 2AMCB 4RAUC 3GTKB 4RA8A 3EA6A 5BN4A 4GOPC 2AHOB 4A3IH 4M1UB 4GN5A 2F0NA 1HNWL 1EWHA 3NPPA 2AWOA 5IGGA 2NUCA 3I4LA 4LF7Q 3D4WA 5KGUA 3CC4A 4U68A 1FYCA 1I4GA 1HFNA 5JPNC 2NVYH 2C5CA 1B44D 2FJ2A 5FLXL 1EY7A 2CWPA 1CHPD 2C9OA 1PFBA 1SJED 5M3MG 3CC7A 4BBSH 4OGQC 3C46A 2F0JA 3M3YB 2ZT9C 1BDOA 2CH4W 4YCUA 2CQAA 4BXXH 2JXMB 2MP1A 4PQXA 3D4RA 5CC4A 1IW7D 1JB3A 2KCNA 4C3HG 1B53A 2EQSA 4LF4Q 1XNRQ 2MHVA 3M4PA 3NXWA 4DR5Q 1Q46A 1VQ7A 4LF6L 1KD1C 3I4NG 2HCCA 3SK5A 1I4RA 4FDBA 1GKHA 3A54A 2B8GA 4A3KB 2E5LQ 1Q7YC 3X3MA 1B9NA 1NR4A 1YVCA 3J7AF 1FVIA 1PFMA 1V9PA 2ALYB 1VQDA 2IT1A 2UUBQ 4GNXA 3S16H 1ONLA 3CCQA 2UUAQ 3MFYA 1FGUA 1STNA 3V05A 5IYDG 4A93G 5CORA 3A8IE 1QOHA 2VQEL 2H4OA 5ELNA 5J3BA 4HJ7A 2JA6G 5IOCA 4JI0L 1EFID 5EBDA 4O1NA 3PO2B 3PUWA 1C0AA 1QWYA 1I6VC 3NTKA 1MI2A 1SFOH 2FFKB 2NVQH 2O4XA 4OL7A 4JI1L 4XT1B 4A3JB 1YNND 1D7QA 1B3AA 5JJLA 4OELB 1T5EA 3S15H 4H44C 1B50A 3QJYA 2EYPA 1M8AA 1STBA 4TSSA 1X3QA 4LK1C 3DUZA 2WAQG 4DV5L 2PMZE 2Z0SA 4NB3A 1WTHA 2F03A 4DR4Q 4YHHQ 4KHPL 1HQMC 5C44G 4R4TA 3G7LA 3CW2C 2G5DA 3I91A 4GNXC 3KYHC 4K6DA 4B3TQ 4B3RL 4LNQA 5EPJA 5C4JB 5LMNQ 4F87A 4IUNA 1FJGL 2GVAA 1EYAA 2N49A 2I5MX 1DD2A 4NDXA 1IKLA 1H9RA 1Q3LA 4LMQD 1D1IA 3K58A 4Y7NB 3HOWG 1JJGA 1Y1VH 4HJAA 5IT9E 5IGDA 5E3FA 3J7ZC 2NN6I 4H0LC 5BN3A 1GM5A 4KY7A 4BS9A 5COYA 2NVTH 3LWEA 3QR8A 4I7AA 3MXUA 4IALA 1SE3A 4JW0A 4JV5L 5KYLA 1JJCB 1ILPA 3K0XA 4I65A 1EYDA 4K0KQ 1RHPA 4QIWE 3CAMA 3HOVB 3SVMA 1YHAA 5M5WH 4DV6Q 3HOXG 5C4ZA 4XDXA 5JJIA 1U4RA 1QVGA 1PFSA 1EIGA 4HIMA 2OT2A 2NYZD 4APVA 1K8OA 4GOPB 3PO3H 1FGBD 3I4MB 4UPAA 2YU9H 3KFUA 2PZUA 1HQRD 2JEAI 2QDBA 1V8QA 2XN9C 1VQ5A 5AJ3Q 2SEBD 1IHZA 1OXVA 5IYBG 2R7FA 4R8IA 4IN3A 2N55A 4OEMB 4RGOS 4BWGB 3H0GB 3HOZH 3EFXD 1HZBA 1SEBD 1HCZA 3NUCA 4CHTB 3J80E 2JJQA 3K5OA 3VYSA 4XIGS 4QB4A 5EPLA 4JPBW 3NSWA 2ICIA 4P72A 2R93B 4Z9CB 4U673 1F9PA 1HA5A 1YNXA 5FKAC 1L0YB 1PV4A 5GAEC 3GTLH 2D0OA 2QA4A 1PYSB 4ZAIA 1I3QB 2CCZA 4K2KA 2H1EA 1CSPA 1SYCA 4CBVA 2Q2UA 5K5PA 1OTCA 1D6EC 4A76A 1CQFA 2CW0C 5A2QL 1UEAB 2BDOA 4JI7Q 3K8AA 5F2DA 1K0SA 4P73A 4UP7A 2KECA 2I5LX 2VS1A 4DNIA 4F88A 2F0QA 2LXKA 1BQQT 3I56A 2R92G 1ASZA 5M3MB 1Y1WG 1KAAA 3QWNA 4UP9A 3S1MH 3MTSA 1LT6D 2GVBA 3FRPB 4GN3B 4IJLA 1S5BD 1EU4A 1RDPD 2HIXA 4HSPA 4C3HB 3U4ZA 1XNRL 1EY5A 3GTGH 2X6GA 3RZDB 4HTHA 1SN8A 2YYZA 1R4QB 2HHHL 4R4QA 3MVVA 1V43A 5L37A 3I4NB 1EEID 3PV0A 1SR3A 1VQAA 2EDGA 1CTMA 3GDEA 5IP9H 2NN6G 1S5DD 1XX8A 4GNXB 2LMCB 2E5LL 3T51B 1N8RC 5J22A 1E2ZA 3CQZH 3G6EA 2A5HA 2UUAL 4HJ5A 3OHXC 3A56A 4XQNA 1K3RA 4A93B 1TVXA 2JA8H 1YNJC 1OXXK 1SMXA 2JA6B 3BYYB 4J15A 1ZEQX 1I94Q 3EBEA 4IUUA 1B2TA 2EE1A 3BYTB 3D31A 1SE2A 2PPBC 1JICA 4DUYL 2VNUD 2I46A 4AH6A 3AFPA 1WCMH 2LKVA 3E3XA 4EGVA 2CHBD 5FK9C 2CH4A 4X65Q 2VZAA 2XGTA 1EY8A 1S72A 4DV3Q 2EXDA 2WAQB 5IP7H 1SRUA 1CHQD 3KLSX 4DR4L 1W6KA 3R2TA 3GTMB 5C3WA 4LF9Q 1VQLA 2WKDA 1GUSA 3QG1A 1SYFA 5C44B 1KDCA 1BR9A 1LTGD 3LWUA 4DV0L 2CW0D 2SNSA 5ELOA 4CDCC 1AN8A 1ENAA 4JOIC 2KCCA 3HZXA 3A55A 3HKSA 1PYBA 1LT3D 1PA6A 3SR1A 2IWHA 1SNDA 4FF4A 3PUVA 5EKKA 4KKTA 2NZ1D 3BG3A 1X65A 3H6MA 1R9TB 3HOWB 4JI2L 2WFWA 2E74C 4NW2A 5I9PA 1EZ8A 4HCSA 2WV6D 4O42A 5JVH3 2FXQA 2VY3A 4BY1H 1PRTC 1EY0A 2VQFL 2QGQA 2BE5C 2XRQD 4XQJA 4K14A 1Q81C 3CCMA 1KDBA 3TEHB 3D6WA 2Z9HA 3X3NA 3NTHA 4K0KL 3NWTA 4DFAA 2IPKD 5J1ZA 5IYCG 1WTXA 1YI2A 3QOJA 3GQBA 3T4AC 4ZQ3A 3A5ZB 3HOXB 3MXGA 1WVLA 2F0HA 4M8AA 4AQYL 3B6YA 3S2DB 3F2BA 3M4OB 4DK1A 1YNJD 2FINB 3TBIB 1TWFB 1UNSA 4UHVA 1PZKD 1ZYRC 4BBRH 5DAUA 1ML0D 1I50B 1PZJD 2EYLA 2B29A 2RSNA 3E0EA 4O0AA 5T1GA 4K5XA 3OIQA 1VQ4A 2NVYB 5AJ3L 1JC7A 3RUZA 4G7OC 1VQCA 1WD1A 4Y52H 2EYOA 3QIAA
chains in the Genus database with same CATH topology
1F9RA 4ZLTF 1HUNA 1BXTA 3NBIA 5ELBA 5JAVA 3MZ5A 4V0BA 2EJFC 2B2UC 2QKIC 1AZQA 3D4DA 5I2YA 1ET9A 2K5DA 1HA6A 3HGBA 4FXKC 1WTQA 1U4PA 1DM0B 3CHBD 2MJ8A 3AB9A 1PRTD 4RCOA 1C8CA 4KJOA 2BE5D 2RVLA 3N6RA 2R92B 1Y1WB 2B2YC 1D5ZC 1XTCD 3PUYA 5ELDA 3Q24A 2VB3X 4Q5VA 5E1FA 4K8JA 3EQLC 3K5NA 4FXGC 3TZDA 4XQQA 2VXWA 2OEOA 3TP7A 3BZDB 2K04A 1NR2A 5FOBB 5EPKA 2PW5A 3SDZA 3M85A 1X3PA 1ZYRD 3H94A 5I2XA 3HP3A 2E76C 4KKUA 2F0GA 2D2CC 3H91A 3NE5B 3BVGA 4FF1A 4IFDJ 3K5LA 4IFDH 1E0BA 2D9UA 2KEDA 3DHQA 1RJTA 1WTOA 1FR3A 1GXDC 1Q12A 4KTAA 2F0DA 3KBXA 3NBHA 4ZKBB 2F0VA 1PRTB 1SNPA 3HRZC 1VF5C 2B2WA 1SXTA 4X3KA 5IIFA 4HN7A 2BCOA 1AEXA 2Z4HA 3VYTA 3Q22A 2PZWA 5K36G 1PLFA 2K32A 1RODA 2RA4A 1WTWA 4CKCA 3HS0C 2KEEA 5KNDA 3P20A 3OSOA 3PUZA 1F77A 3NHHA 3KLRA 4BA1I 3R3OA 1JOQA 3L7ZC 5D3DA 4RKBA 3URYA 2K5QA 4HMJA 2B2WC 1LACA 3V2TA 1VMPA 2G9DA 4CJ1B 4C56C 1IYVA 4ODGA 4OIJA 2F3VA 5KNBA 2E2JB 3C1EA 4C1NK 1PDQA 1D2BA 4XYOA 4C3IG 1DZ1A 4WRDA 3NP8A 2K01A 2L12A 4PV1C 2MUYA 4HEDA 2NTTA 2RSOA 4FVMA 1TWHB 1PYWD 5CYUA 2IX3A 2EJGC 1TWGB 2F0WA 1WTVA 2JA7B 4LJZC 5JEAG 3NTIA 1EIHA 1GUGA 1RCVD 3GTGB 3S1NB 5CGKA 1PTOH 4N9PA 1ET6A 3GTJB 3M4YA 5D3IB 5FO9B 3BS1A 3L9AX 4HSVA 2XNAC 2J0TD 3MEHA 4H7BA 2AQ2B 2R6GA 2F0TA 1STYA 2EXZA 1RKNA 5FO7B 3GTOB 1MD2D 1K83B 1G2SA 3CU7A 4MHEA 2V4DA 1GUTA 1UAPA 1VMCA 3MAQA 4GZYC 5IGCA 2R7ZB 3H3VC 1Z6HA 2F0UA 1GUOA 3VYUA 2JA5B 1FNWA 1STEA 3W3AA 1JOKA 2L11A 3KBGA 4IUPA 3OWEB 1SYGA 4MN3A 5JPMC 3NQTA 4MIUA 4RFBA 1OXUA 2WIIB 2E75C 3S9WA 4ZK9B 1G2TA 1G8ZD 3SK6A 5M9OA 3ZYYX 3K0YA 2EY5A 2AUKA 3CRLC 3DWAA 3MXPA 4QUCA 1LLRD 4EVOA 1SYEA 1Q90A 3HOUB 1AW7A 2Z8LA 4RCNA 1NSNS 1HPCA 2D5DA 2NWGA 1MGSA 1BNZA 4KD4A 4DF7A 2B8FA 1KDAA 2A68C 1SJHD 1FNUA 1TU2B 3BVMA 4DAVA 4DN4M 5BN5A 3ND8A 1LT4D 2ZXPA 3MA2B 3PMFA 1VCIA 1PMRA 2AWNA 3GP7A 4XXEA 3U9SA 1KLUD 2A69C 4FO2A 3OW7A 3AU7A 4OO1H 2XIWA 4A3EB 3K57A 4RHSA 5JOBA 1EQVA 3S1RB 4C3IB 3I3CA 4G57A 2L55A 5EGTA 4BY7B 4F7XA 1QG7A 3SHLA 1A2UA 4A3BB 2A74C 1I4QA 2K6AA 2D62A 1B1ZA 2F0OA 4KK7A 1I4XA 3J81L 3PIO3 3S14B 2OF1A 5C4XB 4RGNA 5E4WC 4WJWA 5CMDA 1A3VA 2F0FA 3P1HA 2A68D 5CV8A 1EZ6A 1JWUD 2JYOA 1EU3A 1JR0D 3D8GA 4KD3A 4DAYA 1C4QA 1M4VA 3FVQA 1NCVA 5CV5A 5D14A 2EY2A 3IFTA 5I6WA 1EY6A 4HCEA 2B2VA 2A69D 1S5ED 4C2MB 4WFN3 4K5WA 2E2HB 2KHSA 1OXTA 2SOBA 1TS5A 1GHKA 3PIP3 3HG9A 5ELEA 4B9XA 1PTOF 1JWSD 2AQ1B 2B63B 3HOYB 3ND9A 4EQPA 1RF2D 2F0IA 3JAML 2B2VC 2EZVA 3S17B 1TR5A 2O5JC 5NUCA 5D65A 4X3SA 2A73B 5EKIA 4FYDA 1A6XA 2EYMA 5M5YB 1SSOA 3TSSA 1E2WA 4KN4C 2TSSA 4KN7C 5I6YA 4LAAA 5C0XJ 5ELCA 5C0XH 3TMEA 1I4HA 1GHJA 2F0PA 4J6HA 1EL0A 1B9MA 1LTBD 1EY4A 1BBXC 3J7YW 1STGA 2HUGA 1TWAB 3BVZA 2F0LA 1LT5D 3OIPA 3DMUA 1EEFD 2WKCA 5AFWA 1XWEA 1GUNA 2QEJC 5IGBA 3N52A 3Q6SA 4A3IB 2L5TA 3K5MA 4PMWA 4DAPA 2O2LD 2E2DC 2Y0SB 4EQOA 4ID6A 3VR4A 4BBSB 2F0SA 5C4HA 3FEWX 4WORA 3VR3A 1ILQA 1DJRD 2FHTA 4KI0A 4H13C 2WP8J 3GD7A 3TN2A 1CT1D 3FDTA 1PFNA 4FXDA 2XWBB 1HHVA 1HTLD 3OOCA 2Q8TA 1S5FD 2R61A 1KTKA 1CA6A 3DXJC 3T53B 1BCPF 2L4NA 2BA1A 4HR7B 1HTPA 3S16B 4ZKCB 2PZTA 2DN8A 4JK1C 1SMYC 1Q1BA 4HAEA 1SBBB 4IUVA 2F4IA 2JSOA 1U4LA 1Y8NB 1SFOB 1RTOA 4ZYSA 2NVQB 3WOEA 1TS3A 1LTTD 2EYJA 3A8KE 2IX0A 3DEOA 5FLXE 1HFGA 3S15B 1GJXA 5G3LF 3VA7A 2KVMA 2L9HA 5C5LA 4DNRB 1J8IA 4J1MA 3H09A 2G9HD 2Z1CA 5E4XA 1SNOA 3VYRA 1IYUA 3A8JE 2KJXA 1PXUA 1LABA 5J39A 5JEAJ 4QMGA 1AZPA 1EWCA 2F0KA 2XVSA 2X6LA 2ZXRA 1O78A 1Y1VB 5T1IA 2L1BA 1A15A 3P7JA 2NVTB 3TP8A 4J8QA 1V1PA 1Z7TA 3I8ZA 4DNTB 4NP5A 5CBEE 2J7ZA 3BDOA 1HXYD 3I72A 1DOMA 2F1MA 2B2TA 2XSCA 5M5WB 2LY7A 3T56B 4IURA 4BA2I 1SMYD 2NTSA 2JEBI 3PO3B 1II3A 2LS01 2YU9B 3VA5A 5DNFA 1TY0A 2EPBA 1UUPA 1D5XC 2PYKA 1IL8A 4X3TA 5LL6S 2HDMA 1TY2A 5CR3A 3D3RA 1XYIA 3G6JB 3A7LA 3PUXA 1QCBD 1TQOA 4RGTA 3HOZB 4ABNA 1ENCA 3VR2A 4ZRZA 1QNKA 3K6OA 2IL8A 2KA7A 1CZGA 3FMCA 1T5XD 3GTLB 2KQ3A 3OWFA 3SEBA 1ICWA 3E6ZX 4L8JA 4YIJA 2M2LA 1LTSD 2SNMA 3RLFA 1EQTA 4TQUS 5CV9A 3IL8A 1C48A 1HUMA 2I07B 2RDFA 1PZID 4KHZA 3S1MB 3Q0AA 1LTRD 5C5MA 4ZUIA 1R4PB 2A6EC 5IGEA 3R8BA 5TSSA 1MSHA 3NWSA 1HRJA 5DM73 4OHJA 2PQEA 1BOSA 3CQZB 1QB5D 3IKJA 1J9OA 1W6JA 4B08A 2JA8B 4IFDG 4I7ZC 1O7YA 4IZ8A 4F8MA 3I73A 3MHBA 5C6AA 4OIKA 1MBYA 2XRSD 5A2QE 1WCMB 2EYFA 1H9MA 1ZXTA 3I90A 2O5IC 2QCPX 2PO4A 2TMPA 2AUJD 1STAA 1IKMA 3LX0A 1V1OA 2K5WA 1VDZA 3OPOA 3J81E 3OMCA 2FMCA 3GV6A 1U9RA 4QUFA 4CKBA 2MGSA 1RTNA 4DGZA 2IW3A 4C3JG 1DONA 1G91A 2RDHA 2JP1A 5CV6A 1FNVA 2Q8IB 3C2PA 4XYQA 5JVG3 4C1NI 3ONAB 3MWYW 1CK1A 2K28A 2NN6H 2K03A 4DXGA 1V1PB 3CRKC 2F0EA 1KLGD 4BY1B 4V190 3T16A 2A6ED 4DK0A 3F2UA 4RWSC 2X69A 2RDGA 4K8IA 5DEHA 5I4DA 3C1FA 4AYBB 1E2VA 3E0JA 1DOKA 4K5VA 2EVBA 3DWQA 5EBCA 4R9WA 1F2ZA 3I70A 4IUQA 3TDQA 1O7ZA 3HKZB 5LL6X 1I4PA 4BBRB 3E5SA 5KYIA 4P2CB 1D1KA 1DYQA 2NBFA 3JAME 3DM1A 4TKOB 4DXFA 3QB3A 5EKLA 3QOLA 1KNAA 4KY6A 3WOFA 4EQNA 4A3FB 4NKLA 1Q1EA 2JE6I 5KIXA 4ZUJA 4CJ0B 4L63B 1LV9A 1OXSC 1VF7A 1H9SA 4QCLA 1Q8IA 5ELFA 1KNEA 2K05A 4OO1I 1WTPA 1A2TA 4B9WA 2EOTA 3EROA 4A3MB 3VR5A 4FF3A 4KKSA 5HGTA 2F0MA 1GUWA 3EVQA 1AP0A 3NQIA 4CGYB 3GTPB 1K8MA 3IAYA 2PNRC 4KMUC 1SYDA 3DEPA 1A3TA 3R2IA 4UDUC 3TP6A 1PTOC 2PCFB 1CZWA 1Y8PB 1GOZA 1TWCB 4KY5A 1JORA 1JWMD 1DOLA 2WINB 2VUMB 2WB1B 3KLSA 2N88A 1EYCA 3SXHA 2SDFA 1XXGA 3S2HB 3V96A 3K7AB 4G7ZC 2KOLA 3U9OA 3MXNA 5I9OA 3KUPA 1Y8OB 4JBWA 3ERQA 5IT9L 3L3OC 3LNNA 3FPUB 5M5XB 3SK8A 4NMZA 3T13A 1F2YA 1B4OA 5KRUA 5LHY1 5JJZA 1CA5A 3EJIA 1CI3M 1G6ZA 5C3EB 1H9KA 4QF4A 5HURA 3MFGA 1S5CD 1U4MA 5FO8B 1ESFA 2EY6A 4ULLA 3BDCA 2K7VA 4C3JB 5EQ0A 2FMMA 5IGFA 2BA0A 1FD7D 4A3GB 1WD0A 1SNMA 4RKLA 2EY1A 3SE0A 2HDLA 1Z47A 2M00A 2PW7A 1PTOD 4OO1G 1CM9A 4KHVA 2A6HC 3RMHA 3J80L 1BUVT 3FPPA 1L0XB 1OO9B 1TS2A 5CV4A 3AMUA 5C0XI 3NK9A 1X32A 2NVXB 1BCPC 1F9QA 2HCIA 1Y69U 5KEEA 2ZXOA 2K33A 4KV6A 2XWJB 1ESRA 1ZKOA 2RQXA 1O80A 2L0CA 3S1QB 3GV3A 3KF8A 5K36H 1A3UA 3R93A 1F2LA 3P75A 3WDNA 3UI2A 2B2UA 1AFPA 1SAPA 1QNUA 2VB2X 4G4KA 4PMBA 3MC0B 1WTRA 3TP5A 1H9JA 4CJ2C 4X3UA 3W2DA 1RD9D 1TIID 4PNYA 1CQVA 5ISRA 3HEJA 1EY9A 1D5MC 2KUMA 1H9SB 1PTOB 1CFMA 3FKIB 1PRTF 3QO2A 1S4ZA 4FP5D 2B2YA 4L6TB 1F9SA 4RHRA 1MSGA 4TRDA 1STHA 1QILA 2EJMA 2RBMA 4K6LA 3KK7A 3M7GA 2ENBA 2GA4B 5IODA 5CV7A 2EYHA 1ENFA 1SNCA 2A6HD 3C3LA 2B39A 5C3XA 5DM63 3GTQB 1LTID 1BCPD 2AQ3B 3A7AB 2DY7A 3DWPA 1SE4A 4R8NA 2QF7A 2BDNA 2M9VA 4FNFA 3K59A 2QILA 4IQZA 2DNEA 5JEAH 1TS4A 1JQYD 1BF4A 3BDLA 5CBAE 1O7LA 3VR6A 1KABA 4A3DB 3OMGA 5A35A 1DCZA 1DXMA 4KJNA 5C0XG 5G3LD 1SDFA 2MPMA 4XTCS 2ICEC 1LO5D 1SYBA 1BO0A 4IFDI 4ILWA 2E2IB 4ME5A 4IUTA 2IJ0A 1TKWB 3J7AV 1I6HB 4UAIA 4RGMA 4RH6A 1EOTA 4N9TA 1BCPB 4CKEA 1NAPA 3GO5A 1SNQA 4DA2A 2CVRA 3RZOB 3SK4A 2PMZB 3D6CA 3M7NA 2RKSA 2ID0A 1IW7C 1QJOA 2Z4IA 4DU9A 5KNCA 1JE4A 1LTAD 3ITPA 4G7HC 4E6IA 1JOOA 2F3WA 2B2TC 1NUCA 1TT2A 3Q23A 3IFDA 4S3SA 2LFNA 2BOSA 1F2MA 4XT3B 2J4XA 4Q0FA 5M3FB 1JCKB 2WACA 1G291 2K1BA 4PMCA 3RD4A 2OXPA 4K2LA 4FF2A 2IX1A 3CKIB 2DY8A 2Q8RE 2DNCA 3O13A 3TZUA 4QIWB 1YNNC 1QE6A 2R3ZA 4HMIA 2NB0A 5EJWA 2HQEA 4RAUC 3GTKB 4RA8A 3EA6A 5BN4A 4M1UB 2F0NA 1EWHA 3NPPA 2AWOA 5IGGA 2NUCA 3I4LA 3D4WA 5KGUA 4U68A 1FYCA 1I4GA 1HFNA 5JPNC 2C5CA 1B44D 2FJ2A 5FLXL 1EY7A 1CHPD 2C9OA 1PFBA 1SJED 4OGQC 3C46A 2F0JA 3M3YB 2ZT9C 1BDOA 2CQAA 2JXMB 2MP1A 4PQXA 3D4RA 5CC4A 1IW7D 1JB3A 2KCNA 4C3HG 1B53A 2MHVA 3NXWA 2HCCA 3SK5A 1I4RA 3A54A 2B8GA 4A3KB 3X3MA 1B9NA 1NR4A 3J7AF 1PFMA 2IT1A 1ONLA 3MFYA 1STNA 3V05A 5CORA 3A8IE 1QOHA 2H4OA 5IOCA 1EFID 5EBDA 4O1NA 3PO2B 3PUWA 1QWYA 1I6VC 3NTKA 1MI2A 2FFKB 2O4XA 4OL7A 4XT1B 4A3JB 1YNND 1B3AA 1T5EA 1B50A 4H44C 3QJYA 2EYPA 1M8AA 1STBA 4TSSA 1X3QA 4LK1C 3DUZA 2F03A 1HQMC 3G7LA 3I91A 4K6DA 5EPJA 5C4JB 4F87A 4IUNA 1EYAA 1DD2A 4NDXA 1IKLA 1H9RA 1Q3LA 4LMQD 1D1IA 3K58A 4Y7NB 5IT9E 5IGDA 5E3FA 2NN6I 4H0LC 5BN3A 4KY7A 4BS9A 5COYA 3LWEA 3MXUA 4IALA 1SE3A 5KYLA 1ILPA 4I65A 1EYDA 1RHPA 3HOVB 3SVMA 5C4ZA 4XDXA 1U4RA 1EIGA 2OT2A 2NYZD 1K8OA 1FGBD 3I4MB 2PZUA 1HQRD 2JEAI 2QDBA 1V8QA 2XN9C 2SEBD 1IHZA 1OXVA 4R8IA 4IN3A 2N55A 4RGOS 4BWGB 3H0GB 3EFXD 1SEBD 4CHTB 1HCZA 3NUCA 3J80E 3K5OA 3VYSA 4XIGS 4QB4A 5EPLA 3NSWA 2ICIA 2R93B 4Z9CB 4U673 1F9PA 1HA5A 5FKAC 1L0YB 4ZAIA 1I3QB 4K2KA 2H1EA 1SYCA 4CBVA 5K5PA 1D6EC 1CQFA 2CW0C 5A2QL 1UEAB 2BDOA 5F2DA 2KECA 4F88A 2F0QA 1BQQT 5M3MB 1KAAA 3QWNA 3MTSA 1LT6D 3FRPB 1S5BD 1EU4A 1RDPD 4HSPA 4C3HB 1EY5A 2X6GA 3RZDB 4HTHA 2YYZA 1R4QB 3MVVA 1V43A 3I4NB 1EEID 3PV0A 2EDGA 1CTMA 2NN6G 1S5DD 1XX8A 2LMCB 3T51B 5J22A 1E2ZA 2A5HA 3OHXC 3A56A 4XQNA 4A93B 1TVXA 1YNJC 1OXXK 2JA6B 3BYYB 1ZEQX 4IUUA 1B2TA 2EE1A 3BYTB 3D31A 1SE2A 2PPBC 1JICA 2VNUD 2I46A 2LKVA 4EGVA 2CHBD 5FK9C 1EY8A 2WAQB 1CHQD 3KLSX 1W6KA 3R2TA 3GTMB 5C3WA 2WKDA 1GUSA 3QG1A 1SYFA 5C44B 1KDCA 1BR9A 1LTGD 3LWUA 2CW0D 2SNSA 1AN8A 1ENAA 2KCCA 3HZXA 3A55A 1LT3D 3SR1A 2IWHA 1SNDA 4FF4A 3PUVA 5EKKA 4KKTA 2NZ1D 3BG3A 3H6MA 1R9TB 3HOWB 2E74C 4NW2A 5I9PA 1EZ8A 4HCSA 2WV6D 4O42A 5JVH3 1PRTC 1EY0A 2BE5C 2XRQD 4XQJA 4K14A 1KDBA 3D6WA 3X3NA 3NTHA 3NWTA 4DFAA 2IPKD 5J1ZA 1WTXA 3QOJA 3GQBA 3T4AC 4ZQ3A 3HOXB 3MXGA 1WVLA 2F0HA 4M8AA 3S2DB 3M4OB 4DK1A 1YNJD 2FINB 3TBIB 1TWFB 1UNSA 1PZKD 1ZYRC 5DAUA 1ML0D 1I50B 1PZJD 2EYLA 2RSNA 5T1GA 4K5XA 3OIQA 2NVYB 1JC7A 3RUZA 4G7OC 1WD1A 2EYOA 3QIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ENF A;  1SE2 A;  1SXT A;  2SEB D;  2QEJ C;  1FNV A;  1EFI D;  4O1N A;  1JWU D;  1RCV D;  1BXT A;  1EWC A;  1EU3 A;  1JR0 D;  4RGO S;  5ELB A;  4BWG B;  1LTI D;  1CK1 A;  3EFX D;  2CHB D;  5FK9 C;  1PTO H;  1SEB D;  4DXG A;  1V1P B;  1M4V A;  1ET6 A;  1PTO D;  2J4X A;  1KLG D;  5D3I B;  1BCP D;  1JCK B;  2AQ3 B;  1ET9 A;  1SJH D;  1PZI D;  2O2L D;  2ICI A;  1CHQ D;  3DWP A;  1FNU A;  1SE4 A;  3KLS X;  2XNA C;  2RDG A;  3R2T A;  1L0X B;  1TS2 A;  2AQ2 B;  5I4D A;  4TSS A;  1F77 A;  3BVM A;  4Z9C B;  1HA5 A;  3R2I A;  4UDU C;  1V1P A;  1LTR D;  5FKA C;  1L0Y B;  1PTO C;  1LTG D;  1S5E D;  1DJR D;  2QIL A;  1BCP C;  1AN8 A;  1GOZ A;  3CHB D;  3O13 A;  3DWQ A;  1LT4 D;  1HXY D;  5D3D A;  1TS4 A;  3URY A;  1JQY D;  1CT1 D;  3R8B A;  1JWM D;  1TS5 A;  1LT3 D;  5TSS A;  3GP7 A;  1KLU D;  3EA6 A;  1PRT D;  5ELE A;  4RCO A;  1D6E C;  1MD2 D;  1HTL D;  4OHJ A;  1I4P A;  1S5F D;  2R61 A;  1PTO F;  1KTK A;  4C56 C;  1D5Z C;  1JWS D;  1XTC D;  1XXG A;  2AQ1 B;  2NTS A;  5ELD A;  1BCP F;  4RHS A;  2WV6 D;  3MC0 B;  1I4G A;  1PRT C;  1LO5 D;  1DYQ A;  1FNW A;  1STE A;  1B44 D;  2Z8L A;  2XRQ D;  1TY0 A;  1UUP A;  1D5X C;  4DXF A;  1RF2 D;  1CHP D;  1LT6 D;  1SJE D;  3BZD B;  3W2D A;  1RD9 D;  1TY2 A;  2IPK D;  1SE3 A;  1SBB B;  1CQV A;  2XRS D;  1S5B D;  3OWE B;  1EU4 A;  2IJ0 A;  1RDP D;  4RGT A;  1D5M C;  4RGM A;  1PTO B;  4RFB A;  4RH6 A;  1PRT F;  3TSS A;  4ZYS A;  1BCP B;  1EEI D;  2TSS A;  1I4Q A;  1TS3 A;  1LTT D;  5ELC A;  3MFG A;  1G8Z D;  1S5D D;  1S5C D;  1UNS A;  1V1O A;  3BVG A;  4L63 B;  1ESF A;  4L6T B;  1I4H A;  1B1Z A;  1PZK D;  2NTT A;  4RHR A;  1I4R A;  1PZJ D;  1QIL A;  1PYW D;  5ELF A;  1FGB D;  4K6L A;  1LTB D;  1I4X A;  1T5X D;  2G9H D;  3DWA A;  1LTA D;  3BVZ A;  3SEB A;  1LT5 D;  1HQR D;  1LLR D;  1FD7 D;  2XN9 C;  3BYY B;  4RGN A;  1EEF D;  2RDH A;  3V05 A;  1PRT B;  1AW7 A;  1LTS D;  3BYT B; 
#chains in the Genus database with same CATH topology
 1F9R A;  1E3P A;  4ZLT F;  1HUN A;  1J5E Q;  1X56 A;  1BXT A;  3NBI A;  5ELB A;  3KLW A;  2JA7 G;  5JAV A;  1E7Z A;  1EUJ A;  3MZ5 A;  4V0B A;  2EJF C;  4A3F H;  2B2U C;  4A3C H;  2QKI C;  1AZQ A;  3D4D A;  5I2Y A;  1ET9 A;  4LF6 Q;  2Q2T A;  2K5D A;  1HA6 A;  3HGB A;  1PHJ A;  4FXK C;  4X66 L;  1U4P A;  1WTQ A;  1DM0 B;  3CCJ A;  5GQO A;  3CHB D;  2UXC L;  3ERS X;  2MJ8 A;  3AB9 A;  1CKM A;  4JI7 L;  3M9B A;  3UDI A;  3ER0 A;  4JI0 Q;  1PRT D;  1VQJ A;  1KRS A;  4RCO A;  1EOV A;  4JI5 L;  1C8C A;  4KJO A;  2BE5 D;  2RVL A;  3N6R A;  1YZ6 A;  1L2F A;  4A75 A;  1YIT A;  2R92 B;  1Y1W B;  3E9H A;  2B2Y C;  1D5Z C;  1XTC D;  1EIF A;  3PUY A;  5ELD A;  1NTG A;  5IT9 c;  3Q24 A;  2VB3 X;  4JI1 Q;  4Q5V A;  4A3J G;  5E1F A;  4K8J A;  3EQL C;  3K5N A;  3GTP H;  4FXG C;  3TZD A;  2WAQ E;  2VXW A;  4XQQ A;  2OTJ A;  2R7Z G;  2RHS B;  2OEO A;  3A74 A;  3TP7 A;  4DV5 Q;  3BZD B;  2K04 A;  1NR2 A;  5FOB B;  5EPK A;  2JA5 G;  2PW5 A;  4KHP Q;  1CKN A;  3SDZ A;  2NZO A;  3M85 A;  3KJO A;  1X3P A;  2HT1 A;  1ZYR D;  1NNX A;  1TWC H;  3H94 A;  5I2X A;  3HP3 A;  2VUM H;  2E76 C;  4KKU A;  2F0G A;  2D2C C;  3H3V I;  3H91 A;  3NE5 B;  3BVG A;  4FF1 A;  4IFD J;  1X3G A;  3K5L A;  4IFD H;  1E0B A;  2D9U A;  2KED A;  4IPD A;  3DHQ A;  4POF A;  1RJT A;  1WTO A;  1FR3 A;  3S2H H;  1GXD C;  1I94 L;  3K7A H;  3U50 C;  1Q12 A;  1VQ6 A;  4KTA A;  1SLJ A;  2F0D A;  3NBH A;  3KBX A;  4ZKB B;  1MKH A;  1V1Q A;  2MQH A;  2JK8 A;  2F0V A;  1N32 Q;  1PRT B;  1SNP A;  1N34 L;  3PGZ A;  3HRZ C;  4DPG A;  1VF5 C;  2B2W A;  1SXT A;  4JV5 Q;  2R7D A;  3ULL A;  4X65 L;  4X3K A;  1K0R A;  5M5X H;  5IIF A;  4HN7 A;  2BCO A;  1AEX A;  3HOU G;  4DV3 L;  2Z4H A;  3VYT A;  3Q22 A;  2PZW A;  3J80 c;  1PLF A;  5K36 G;  2K32 A;  1ROD A;  1TXY A;  2RA4 A;  2YTY A;  1WTW A;  4CKC A;  3HS0 C;  5C3E H;  2Z6K A;  2KEE A;  5KND A;  3P20 A;  3IRB A;  3OSO A;  3PUZ A;  5GAG C;  1F77 A;  1KC8 C;  2OTL A;  4C3J H;  1L1O A;  3NHH A;  3KLR A;  4BA1 I;  3R3O A;  3PF5 A;  1JOQ A;  3L7Z C;  2CQO A;  2ES2 A;  2CFM A;  5D3D A;  4RKB A;  1LTL A;  3URY A;  4A3G H;  2K5Q A;  4HMJ A;  4H02 A;  2QW7 A;  4GLX A;  2B2W C;  4ME3 A;  1LAC A;  3V2T A;  1VMP A;  5IWA Q;  2G9D A;  2K14 A;  5BR8 Q;  4CJ1 B;  4C56 C;  1IYV A;  1VQE A;  4ODG A;  1VQN A;  4OIJ A;  2F3V A;  3F1Z A;  3KF8 B;  5KNB A;  5LMU Q;  2UXB Q;  1HZ9 A;  2E2J B;  4A3E G;  3C1E A;  3DLL A;  4C1N K;  1PDQ A;  2Z6K C;  4XYO A;  1D2B A;  2GN5 A;  1IL2 A;  4C3I G;  1DZ1 A;  3CC2 A;  4WRD A;  4MNO A;  2BH8 A;  2A1A A;  2NVX H;  3NP8 A;  2K01 A;  2L12 A;  1K8A C;  4BY7 G;  4PV1 C;  3S1Q H;  2MUY A;  1PH1 A;  4DK6 C;  4HED A;  1YHB A;  4NXN L;  2H5X A;  4IOC A;  2NTT A;  4A3B G;  2RSO A;  1VQI A;  4FVM A;  1TWH B;  1PYW D;  5CYU A;  2IX3 A;  4DK3 C;  2EJG C;  1TWG B;  1J5E L;  2F0W A;  1WYD A;  1WTV A;  1PH3 A;  2JA7 B;  4LJZ C;  5JEA G;  3NTI A;  5C4X G;  1GVP A;  3ICE A;  1EIH A;  1GUG A;  1RCV D;  3GTG B;  3S1N B;  2HHH Q;  5CGK A;  1YIJ A;  1PTO H;  3FKI H;  4N9P A;  4A3L G;  1ET6 A;  3GTJ B;  3M4Y A;  5D3I B;  5FO9 B;  1PVO A;  4CDE C;  1QVF A;  3BS1 A;  3L9A X;  3CD6 A;  4HSV A;  1MIU A;  2XNA C;  2J0T D;  4LFC Q;  3MEH A;  4H7B A;  4ZCK A;  2AQ2 B;  1EFW A;  1JMC A;  2R6G A;  4OWT B;  2F0T A;  1STY A;  2EXZ A;  1EQR A;  1RKN A;  1DGS A;  3CF5 A;  4DUY Q;  1EQQ A;  2I0Q A;  5FO7 B;  3GTO B;  2Z6B A;  3RN2 A;  1MD2 D;  1K83 B;  2AKW B;  1BKB A;  1G2S A;  3CU7 A;  3GTQ H;  4MHE A;  2V4D A;  1GUT A;  1UAP A;  1VMC A;  3MAQ A;  2RCF A;  4GZY C;  4HIK A;  5IGC A;  2R7Z B;  3H3V C;  3RLN A;  1CKN B;  1Z6H A;  2JN4 A;  2F0U A;  1GUO A;  3VYU A;  2JA5 B;  1FNW A;  1STE A;  1XJV A;  1XTD A;  3W3A A;  2B63 G;  3HOY G;  1JOK A;  2L11 A;  3KBG A;  4IUP A;  4PG3 A;  4DV0 Q;  3OWE B;  1SYG A;  4MN3 A;  5JPM C;  3TS2 A;  1M90 C;  3NQT A;  4MZ9 A;  4MIU A;  4RFB A;  1OXU A;  2WII B;  2E75 C;  3S9W A;  1NE3 A;  4B3M L;  1GO3 E;  4JI2 Q;  4ZK9 B;  1JB7 A;  1VQM A;  1G2T A;  1G8Z D;  1BBU A;  4A3D H;  1KL9 A;  3SK6 A;  1HZA A;  1LUZ A;  3PCO B;  4WJ4 A;  5M9O A;  1B70 B;  1X3F A;  3ZYY X;  1N32 L;  2VQF Q;  3K0Y A;  2EY5 A;  2AUK A;  4JBM A;  3CRL C;  3DWA A;  3MXP A;  2MNA A;  4QUC A;  1LLR D;  1P8L A;  2HIV A;  4EVO A;  1SYE A;  1Q90 A;  2E2I H;  3HOU B;  2OQ0 A;  1AW7 A;  2Z8L A;  5FJ8 G;  4RCN A;  3A5U A;  1NSN S;  1HPC A;  2D5D A;  2NWG A;  1IBK Q;  1MGS A;  1D8L A;  1BNZ A;  4KD4 A;  4DF7 A;  4AQY Q;  1IXR A;  2HD3 A;  1I6H H;  2B8F A;  4A3I G;  1I5F A;  1KDA A;  2A68 C;  1VQK A;  1SJH D;  3TQY A;  1FNU A;  1TU2 B;  1SRO A;  4OWX B;  3RZO H;  4HID A;  3BVM A;  4QGU A;  4DAV A;  4DN4 M;  4POG A;  5BN5 A;  1RIP A;  3ND8 A;  4IPG A;  2Y0S G;  1J6Q A;  1LT4 D;  2ZXP A;  3MA2 B;  4BBS G;  3PMF A;  1VCI A;  1PMR A;  2AWN A;  5IWA L;  5BR8 L;  4LFA Q;  3GP7 A;  4IPC A;  4XXE A;  1KLU D;  3U9S A;  2A69 C;  4FO2 A;  4BXX G;  5LMU L;  3OW7 A;  3AU7 A;  4OO1 H;  2UXB L;  3CP0 A;  1L0W A;  2XIW A;  2RCN A;  1MJE A;  4A3E B;  5FLX c;  1B8A A;  3K57 A;  4LF5 L;  4JBJ A;  4RHS A;  5JOB A;  1EQV A;  3S1R B;  4AIM A;  5M3F H;  4C3I B;  2DJG C;  2KEN A;  4HIO A;  3I3C A;  5HY6 A;  4G57 A;  2L55 A;  2C35 B;  4X66 Q;  5EGT A;  4BY7 B;  4LFB Q;  2OWO A;  2UXC Q;  1B7Y B;  4F7X A;  1PH9 A;  2ZM6 L;  2N3S A;  1NMF A;  1PH5 A;  1QG7 A;  2I5H A;  2KCM A;  3SHL A;  1A2U A;  3GTK H;  4A3B B;  4JI5 Q;  2A74 C;  1I4Q A;  1FL0 A;  2IY5 B;  2K50 A;  3S24 A;  4IO9 A;  4WJ3 M;  2K6A A;  2D62 A;  1B1Z A;  3AQQ A;  2F0O A;  4PZ7 A;  2K4K A;  5GRO A;  4KK7 A;  1I4X A;  3J81 L;  3G4S A;  3PIO 3;  3S14 B;  2OF1 A;  2PQA A;  3A0J A;  1UE5 A;  5C4X B;  4RGN A;  2CKZ B;  5E4W C;  4WJW A;  5CMD A;  1A3V A;  1XPO A;  1H95 A;  4GLA C;  2F0F A;  3K80 C;  3P1H A;  2A68 D;  5CV8 A;  1EZ6 A;  1JWU D;  2JYO A;  1EU3 A;  1JR0 D;  3M3Y H;  3D8G A;  4KD3 A;  4DAY A;  1C4Q A;  4LFC L;  1M4V A;  2YTX A;  3FVQ A;  1NCV A;  5CV5 A;  1G51 A;  5D14 A;  1Q82 C;  2EY2 A;  3IFT A;  5I6W A;  4JI4 L;  1EY6 A;  1G6P A;  4HCE A;  4DR7 Q;  4JI6 L;  2EIF A;  2B2V A;  1K9M C;  1Y1V G;  1BBW A;  5GAH C;  2MO0 A;  3I7F A;  2A69 D;  2K75 A;  1S5E D;  1EYG A;  4C2M B;  4A3K H;  4WFN 3;  2NZH A;  4K5W A;  4L5R C;  1XMO L;  2E2H B;  2KHS A;  1YJW A;  1N34 Q;  1OXT A;  2SOB A;  1U0L A;  1TS5 A;  1GHK A;  3PIP 3;  3HG9 A;  1SE8 A;  5ELE A;  1JJ2 A;  4B9X A;  4DAM A;  2B3G A;  3PO2 H;  1PTO F;  4JBK A;  1KIX A;  1JWS D;  1KHI A;  2AQ1 B;  1HNZ Q;  2B63 B;  1XPU A;  3CPF A;  4GN4 B;  3HOY B;  4DR2 Q;  1K73 C;  3ND9 A;  4EQP A;  5GAD C;  3PO3 G;  5IE8 A;  4L5Q A;  1RF2 D;  2UUC L;  2F0I A;  3JAM L;  2B2V C;  2EZV A;  4DR3 Q;  2PNH A;  3S17 B;  2QEX A;  4GKK Q;  1TR5 A;  2O5J C;  5NUC A;  5D65 A;  4X3S A;  3NEL A;  2A73 B;  5EKI A;  4FYD A;  1A6X A;  1RL2 A;  2EYM A;  5M5Y B;  1SSO A;  1C9O A;  3TSS A;  1YJN A;  1E2W A;  4KN4 C;  2TSS A;  1WI5 A;  3EIV A;  4KN7 C;  5I6Y A;  5C4J H;  4LAA A;  1XMQ L;  5C0X J;  4YWL A;  3HOZ G;  5ELC A;  5C0X H;  4LWC A;  4DV7 L;  4HJ8 A;  3TME A;  2DUD A;  1I4H A;  1GHJ A;  2F0P A;  4J6H A;  1EL0 A;  3G48 A;  1B9M A;  1QUQ A;  1LTB D;  1EY4 A;  4Y7N H;  1BBX C;  3J7Y W;  1STG A;  2HUG A;  1TWA B;  3BVZ A;  2Q2H A;  2F0L A;  3OIP A;  1LT5 D;  3DMU A;  3PF4 A;  1EEF D;  1IBK L;  1W3S A;  2WKC A;  5FLM H;  5AFW A;  1XWE A;  1GD7 A;  3CCU A;  1GUN A;  2QEJ C;  1HNX L;  5IGB A;  3N52 A;  3Q6S A;  4IJH A;  4A3I B;  4RG1 A;  2L5T A;  3STB C;  1AH9 A;  4UP8 A;  3K5M A;  4PMW A;  3HOV H;  2ASB A;  4NXN Q;  2E8G A;  4DAP A;  2O2L D;  2ZJP A;  3W1G A;  2E2D C;  2Y0S B;  4EQO A;  2K5V A;  4ID6 A;  4LUV A;  3VR4 A;  4BBS B;  1AE3 A;  2F0S A;  2N8N A;  4DUZ L;  5C4H A;  3FEW X;  4WOR A;  3VR3 A;  1ILQ A;  1DJR D;  2PI2 A;  4LFA L;  3I4M H;  3VDY A;  2FHT A;  4KI0 A;  4H13 C;  1YEZ A;  5DLQ E;  2WP8 J;  1E24 A;  3GD7 A;  3TN2 A;  3D0F A;  1CT1 D;  3FDT A;  2K5H A;  1YJ9 A;  1NBW A;  1PFN A;  4FXD A;  3CMA A;  2XWB B;  1HHV A;  1HTL D;  3OOC A;  5H1S E;  2Q8T A;  1S5F D;  2R61 A;  3H0G H;  1KTK A;  1VQG A;  3K7U C;  3KDF A;  1CA6 A;  5IP9 G;  3DXJ C;  3T53 B;  1BCP F;  4R1J A;  2L4N A;  2BA1 A;  4HR7 B;  3CCV A;  4LFB L;  1HTP A;  3S16 B;  4ZKC B;  2R93 H;  2PZT A;  2DN8 A;  2HQL A;  4JK1 C;  1UE7 A;  2JA8 G;  1B3Q A;  1SMY C;  1Q1B A;  3EN2 A;  3F2C A;  4HAE A;  1SBB B;  4A3M H;  4IUV A;  2F4I A;  2JSO A;  1XNQ L;  3KF6 A;  1I3Q H;  1U4L A;  1MJC A;  1Y8N B;  1SFO B;  2LSS A;  1RTO A;  4ZYS A;  2NVQ B;  3WOE A;  2MO1 A;  3KJP A;  1WCM G;  1TS3 A;  2UXD Q;  1LTT D;  2EYJ A;  3A8K E;  2IX0 A;  3DEO A;  5FLX E;  1HFG A;  3S15 B;  1GJX A;  5G3L F;  3VA7 A;  2KVM A;  2L9H A;  5IP7 G;  5C5L A;  4DNR B;  4IOA A;  1J8I A;  4J1M A;  3U58 A;  2RHQ B;  3H09 A;  2G9H D;  2Z1C A;  5M3M H;  5E4X A;  1SNO A;  3VYR A;  1IYU A;  3A8J E;  2KJX A;  4DAY B;  2ATW A;  1PXU A;  1VQ9 A;  1LAB A;  4OXP A;  5J39 A;  4HJ9 A;  5JEA J;  4QMG A;  1AZP A;  1EWC A;  2F0K A;  2UU9 Q;  2XVS A;  4C3H H;  4DR7 L;  3TRE A;  3RZD H;  2X6L A;  3RNU A;  4B3M Q;  4JI3 Q;  2ZXR A;  1O78 A;  1Y1V B;  4YCW A;  5T1I A;  3I4N H;  1PH2 A;  1Y14 B;  1LYL A;  2L1B A;  1E1O A;  2LXJ A;  1A15 A;  4EX5 A;  4BY1 G;  1Z9F A;  3P7J A;  3F2D A;  4DV1 L;  2NVT B;  3TP8 A;  4J8Q A;  1V1P A;  1Z7T A;  3JAM i;  3I8Z A;  4DNT B;  1PH4 A;  5IYD H;  4NP5 A;  4A93 H;  5CBE E;  3UE0 A;  2J7Z A;  3BDO A;  4GKJ Q;  2JA6 H;  1HXY D;  4DV4 Q;  3I72 A;  1DOM A;  2F1M A;  4JCV E;  2B2T A;  4AYB G;  3JC6 6;  2XSC A;  5M5W B;  1HNZ L;  3L2P A;  2LY7 A;  3T56 B;  4IUR A;  1HR0 Q;  4DR2 L;  4JVZ A;  1VQF A;  4BA2 I;  1SMY D;  2NTS A;  2JEB I;  3PO3 B;  3HKZ G;  1II3 A;  4YWM A;  4DR3 L;  2LS0 1;  4BBR G;  2YU9 B;  3VA5 A;  4GKK L;  5DNF A;  1TY0 A;  2EPB A;  1UUP A;  1D5X C;  2PYK A;  1IL8 A;  3I2Z A;  4X3T A;  3T1H L;  5LL6 S;  3GTM H;  2HDM A;  2N78 A;  1HR0 W;  1TY2 A;  5CR3 A;  3D3R A;  2Y0S E;  3G6J B;  4GS3 A;  5C44 H;  1XYI A;  3A7L A;  3PUX A;  4R4I A;  1QCB D;  1TQO A;  4RGT A;  3HOZ B;  1N9W A;  4ABN A;  4N8F A;  1ENC A;  3CCR A;  1WOC A;  3VR2 A;  4ZRZ A;  4A3F G;  1QNK A;  1VS0 A;  1R9T H;  3HOW H;  4A3C G;  3FP9 A;  4LF5 Q;  3K6O A;  2IL8 A;  2KA7 A;  1CZG A;  1CSQ A;  1T5X D;  3FMC A;  3GTL B;  2KQ3 A;  3CCL A;  3LGJ A;  2ZTD A;  3OWF A;  3SEB A;  1EIY B;  1L1O C;  1ICW A;  3E6Z X;  4L8J A;  4YIJ A;  2M2L A;  1LTS D;  3WWV A;  2SNM A;  2ZM6 Q;  3RLF A;  1EQT A;  1K8G A;  4TQU S;  5CV9 A;  2ZJQ A;  1VQO A;  1E1T A;  3HOX H;  3UDG A;  1T9H A;  1NMG A;  3IL8 A;  3S2D H;  4L5S A;  1C48 A;  2QDL A;  3M4O H;  1HUM A;  2I07 B;  2RDF A;  1PZI D;  1TWF H;  4KHZ A;  3S1M B;  1KQS A;  3Q0A A;  4QL5 A;  4P75 A;  1I50 H;  1LTR D;  3Q8D A;  5C5M A;  2ZJR A;  4ZUI A;  4RMF A;  1JT8 A;  1R4P B;  2A6E C;  3T1Y Q;  5IGE A;  3KDF B;  5IYB H;  3R8B A;  5TSS A;  1YHQ A;  1MSH A;  1JE5 A;  3BU2 A;  3NWS A;  1HRJ A;  5DM7 3;  4OHJ A;  2PQE A;  1BOS A;  3DM3 A;  2VUM G;  2WB1 G;  3CQZ B;  4NXM L;  2K52 A;  1QB5 D;  4JI4 Q;  3IKJ A;  1J9O A;  1W6J A;  4B08 A;  2JA8 B;  4IFD G;  4JI6 Q;  3KF6 B;  1UEB A;  4I7Z C;  2KCT A;  1O7Y A;  4IZ8 A;  4F8M A;  3I73 A;  3MHB A;  5C6A A;  4OIK A;  2F52 A;  2OQK A;  4B3S L;  1MBY A;  2XRS D;  5A2Q E;  1XMO Q;  4N8X 1;  1WCM B;  2UXD L;  3TS0 A;  2EYF A;  1CUK A;  1H9M A;  4X6A H;  4R4O A;  1ZXT A;  3I90 A;  2O5I C;  1KAW A;  2QCP X;  2PO4 A;  5HGQ A;  2TMP A;  2AUJ D;  1STA A;  1IKM A;  1LM0 A;  3LX0 A;  1V1O A;  2K5W A;  1VDZ A;  2R92 H;  1Y1W H;  3OPO A;  3J81 E;  1A8V A;  4QJF A;  5C3E G;  3OMC A;  4YY3 Q;  2FMC A;  3GV6 A;  4PZ6 A;  1U9R A;  4QUF A;  3I55 A;  4CKB A;  2MGS A;  1RTN A;  4DGZ A;  2UUC Q;  2IW3 A;  4C3J G;  1DON A;  1G91 A;  2F4V L;  2RDH A;  2UU9 L;  3F8T A;  2XTI A;  2JP1 A;  2A8V A;  3PSI A;  3OW2 A;  5CV6 A;  4JI3 L;  1FNV A;  2YV5 A;  2Q8I B;  3C2P A;  5E7N A;  4A3G G;  4XYQ A;  4LF8 Q;  5JVG 3;  4C1N I;  3NBH B;  3ONA B;  3MWY W;  1CK1 A;  2Q2I A;  2K28 A;  2NN6 H;  2K03 A;  4JI8 L;  4DXG A;  1V1P B;  3CRK C;  1A63 A;  1XMQ Q;  2F0E A;  1KLG D;  4BY1 B;  1VQP A;  4V19 0;  2V1C C;  3TRZ A;  3T16 A;  4DV7 Q;  2A6E D;  4DK0 A;  3F2U A;  4LUO A;  4RWS C;  4DR1 Q;  2X69 A;  2RDG A;  4K8I A;  5DEH A;  5I4D A;  4GKJ L;  4DV4 L;  3PQI A;  2RF4 A;  3C1F A;  4AYB B;  1E2V A;  3E0J A;  1DOK A;  4K5V A;  2EVB A;  3DWQ A;  5EBC A;  4R9W A;  4DV2 Q;  1F2Z A;  1HR0 L;  5LMN W;  3I70 A;  4IUQ A;  3UE1 A;  3AEV A;  3NEN A;  1N33 Q;  1HNX Q;  1L1O B;  3TDQ A;  1O7Z A;  3HKZ B;  5LL6 X;  3BZK A;  1I4P A;  4BBR B;  1K28 A;  3E5S A;  4X64 Q;  3OTO L;  5KYI A;  4P2C B;  1D1K A;  2PI2 E;  1DYQ A;  2NBF A;  1BVS A;  3JAM E;  4JYA Q;  4LW1 A;  3DM1 A;  4TKO B;  4DXF A;  3QB3 A;  4DUZ Q;  5EKL A;  4TVA B;  1VQH A;  1IBL L;  3QOL A;  1CKO A;  1KNA A;  1Q86 C;  4KY6 A;  3WOF A;  1UE1 A;  4EQN A;  1PH7 A;  3FHW A;  4A3F B;  4NKL A;  1Q1E A;  2JE6 I;  1WJJ A;  1KXL A;  1O7I A;  5KIX A;  4DR6 Q;  4ZUJ A;  3FKI G;  1N36 L;  4CJ0 B;  4L63 B;  2CWA A;  1LV9 A;  1OXS C;  1VF7 A;  3E9I A;  1H9S A;  1ASY A;  4QCL A;  1Q8I A;  5ELF A;  1KNE A;  2K05 A;  4OO1 I;  1WTP A;  1IBM L;  4JG2 A;  3RLO A;  5IYC H;  2E2J H;  4JC0 A;  1A2T A;  4B9W A;  1PH8 A;  2EOT A;  4DKA C;  5IY0 A;  3ERO A;  4A3M B;  3VR5 A;  4FF3 A;  1XNQ Q;  2DJF C;  4KKS A;  4QY7 A;  5HGT A;  4P74 A;  2F0M A;  1KRT A;  1GUW A;  3EVQ A;  1AP0 A;  1MHW C;  3NQI A;  4CGY B;  4LF7 L;  3GTP B;  1K8M A;  3IAY A;  2PNR C;  1QZH A;  3T1Y L;  4KMU C;  1HH2 P;  2F3I A;  1SYD A;  3DEP A;  3ZJY C;  1A3T A;  4X62 Q;  3R2I A;  1TWH H;  4UDU C;  3TP6 A;  4P71 A;  1PTO C;  2PCF B;  1CZW A;  1M1K C;  1Y8P B;  1GOZ A;  1TWC B;  4KY5 A;  3OYY A;  1TWG H;  3UDF A;  1JOR A;  4EQ5 A;  3CCS A;  1JWM D;  3MEF A;  1DOL A;  2WIN B;  2VUM B;  2WB1 B;  3KLS A;  2JA7 H;  3PIO A;  4CDF C;  2N88 A;  4MTK A;  4LF4 L;  3BZC A;  1EYC A;  3SXH A;  4MTN A;  4CDD C;  1UE6 A;  2SDF A;  3S1N H;  4DR5 L;  2KBN A;  1XXG A;  3S2H B;  1VQ8 A;  1Q8K A;  3V96 A;  3K7A B;  3GTJ H;  2KHI A;  4G7Z C;  4A3D G;  2KOL A;  3U9O A;  3MXN A;  3KOJ A;  5I9O A;  3J81 j;  4LUZ A;  3KUP A;  1Y8O B;  4DV1 Q;  1K3B C;  1UWV A;  3ERQ A;  4JBW A;  5IT9 L;  3L3O C;  2UUB L;  3LNN A;  3FPU B;  3W5O A;  5M5X B;  4JOI A;  3SK8 A;  3AFQ A;  4NMZ A;  4AYB E;  2P5Z X;  1WFQ A;  3T13 A;  1F2Y A;  1B4O A;  5KRU A;  5LHY 1;  5JJZ A;  1CA5 A;  3EJI A;  1CI3 M;  1G6Z A;  5C3E B;  1H9K A;  3GTO H;  4QF4 A;  4YY3 L;  5HUR A;  3MFG A;  1K83 H;  1S5C D;  3AYH B;  1U4M A;  1AE2 A;  5FO8 B;  1X6O A;  1ESF A;  2IHE A;  3HKZ E;  4A3J H;  2EY6 A;  4ULL A;  3BDC A;  2K7V A;  4C3J B;  3PIP A;  1HJP A;  5EQ0 A;  2R7Z H;  2FMM A;  3T1H Q;  5IGF A;  4OX9 Q;  2BA0 A;  2JA5 H;  4YHH L;  1FD7 D;  4A3G B;  4LF8 L;  3U4V A;  1WD0 A;  4YCV A;  4B3T L;  1SNM A;  4RKL A;  5LMN L;  2EY1 A;  4ALP A;  3SE0 A;  4R4C A;  5EAY A;  2HDL A;  1Z47 A;  4DR1 L;  1U5K A;  2M00 A;  2PW7 A;  1PTO D;  4OO1 G;  1CM9 A;  4KHV A;  2A6H C;  3RMH A;  3J80 L;  1BUV T;  3FPP A;  1E22 A;  2DGY A;  1L0X B;  1OO9 B;  1TS2 A;  5CV4 A;  5M3F G;  4DV2 L;  3AMU A;  4O2D A;  5C0X I;  2BH2 A;  3NK9 A;  1X32 A;  1N33 L;  2NVX B;  1BCP C;  1F9Q A;  2HCI A;  2YTV A;  1Y69 U;  3RN5 A;  2MFI A;  5KEE A;  2ZXO A;  2K33 A;  4KV6 A;  4OON A;  2XWJ B;  1ESR A;  1ZKO A;  2RQX A;  1O80 A;  4KLK A;  2L0C A;  3HOU H;  3S1Q B;  3GV3 A;  3KF8 A;  5K36 H;  1A3U A;  3R93 A;  1F2L A;  3SGI A;  4X64 L;  4DV6 L;  3P75 A;  3WDN A;  3UI2 A;  2B2U A;  1AFP A;  1X54 A;  1SAP A;  4JYA L;  1QNU A;  2VB2 X;  4G4K A;  2VW9 A;  4PMB A;  1ICF B;  3MC0 B;  4QQB X;  3I4O A;  1HNW Q;  1WTR A;  3TP5 A;  2OCE A;  1H9J A;  4CJ2 C;  4X3U A;  3ULP A;  3W2D A;  1RD9 D;  1TII D;  4PNY A;  3CME A;  1CQV A;  5ISR A;  3HEJ A;  1EY9 A;  2VL6 A;  1D5M C;  1X9N A;  4DR6 L;  2KUM A;  1H9S B;  1PTO B;  1CFM A;  3FKI B;  1PRT F;  3QO2 A;  1S4Z A;  4FP5 D;  2WB1 E;  1A62 A;  3J81 c;  2B2Y A;  2K5N A;  4L6T B;  4NXM Q;  1F9S A;  4RHR A;  3J81 i;  1MSG A;  4TRD A;  1STH A;  1QIL A;  1C7Y A;  2EJM A;  1NY4 A;  4A3E H;  2RBM A;  4K6L A;  3KK7 A;  3M7G A;  2ENB A;  2GA4 B;  3S1R H;  4C3I H;  5IOD A;  4OWW B;  2IHF A;  1YBY A;  5CV7 A;  2EYH A;  4B3S Q;  4A3K G;  4UY8 C;  1ENF A;  1SNC A;  2A6H D;  3C3L A;  2B39 A;  4BY7 H;  2PQA B;  5C3X A;  5DM6 3;  3GTQ B;  1S40 A;  1LTI D;  1P16 A;  2VQE Q;  1W2B A;  1QZG A;  3PO2 G;  4A3B H;  4X62 L;  1BCP D;  2AQ3 B;  3A7A B;  2DY7 A;  3DWP A;  3ULJ A;  1SE4 A;  1A0I A;  4R8N A;  3CXC A;  3STB D;  2QF7 A;  2BDN A;  2M9V A;  3H15 A;  4FNF A;  1X3E A;  5JJK A;  3K59 A;  3S14 H;  2QIL A;  4IQZ A;  2DNE A;  5JEA H;  1HZC A;  2F4V Q;  5C4X H;  1TS4 A;  1PH6 A;  1JQY D;  1BF4 A;  1EWI A;  3H3V H;  3BDL A;  2D0P A;  3W1B A;  5CBA E;  1O7L A;  3L0O A;  3VR6 A;  3MXN B;  3K81 C;  1KAB A;  4A3L H;  4A3D B;  4PZ8 A;  3OMG A;  5A35 A;  3CCE A;  4B3R Q;  4JI8 Q;  1DCZ A;  1DXM A;  4KJN A;  5C0X G;  3BJU A;  5G3L D;  1FJG Q;  1SDF A;  3JAM c;  3NEM A;  2MPM A;  4XTC S;  4GLV B;  2JA9 A;  2ICE C;  1LO5 D;  1SYB A;  3M4Q A;  1BO0 A;  4IFD I;  3HFZ B;  4ILW A;  2E2I B;  3G71 A;  4ME5 A;  4IUT A;  2IJ0 A;  1TKW B;  4C2M H;  3J7A 5;  2L15 A;  1IZ6 A;  5FLM G;  3J7A V;  1I6H B;  2E2H H;  4UAI A;  2JQO A;  2ZTE A;  4RGM A;  4RH6 A;  1X55 A;  1EOT A;  4N9T A;  1BCP B;  4CKE A;  1NAP A;  1XPR A;  3GO5 A;  1SNQ A;  4DA2 A;  2CVR A;  3HOV G;  3RZO B;  3SK4 A;  4OX9 L;  3J80 i;  2PMZ B;  3D6C A;  3OTO Q;  4LF9 L;  3M7N A;  2B63 H;  2RKS A;  2ID0 A;  1IW7 C;  1QJO A;  2A19 A;  2Z4I A;  4NPS A;  4DU9 A;  1IYJ B;  1JE4 A;  5KNC A;  3HOY H;  1LTA D;  3ITP A;  4G7H C;  1NJI C;  3CPW A;  4IPH A;  4E6I A;  1IBL Q;  4YWK A;  1JOO A;  3I4M G;  2F3W A;  1QUQ B;  4GOP A;  2B2T C;  3S17 H;  1NUC A;  1TT2 A;  3Q23 A;  3IFD A;  4S3S A;  2LFN A;  5M5Y H;  1QVC A;  1F2M A;  2BOS A;  4XT3 B;  2ZTC A;  2J4X A;  4Q0F A;  5M3F B;  2KHJ A;  3H0G G;  1N36 Q;  1JCK B;  2WAC A;  1G29 1;  2K1B A;  4PMC A;  3RD4 A;  1S3O A;  2OXP A;  4K2L A;  4FF2 A;  3UDX A;  4A4I A;  2IX1 A;  3CKI B;  2DY8 A;  2Q8R E;  4L5T A;  3RR5 A;  1IBM Q;  2R93 G;  2DNC A;  5FJ8 H;  3O13 A;  3TZU A;  4QIW B;  1TWA H;  1YNN C;  1QE6 A;  2R3Z A;  1VQB A;  4HMI A;  2NB0 A;  5EJW A;  4A3M G;  2HQE A;  2AMC B;  4RAU C;  3GTK B;  4RA8 A;  3EA6 A;  5BN4 A;  4GOP C;  2AHO B;  4A3I H;  4M1U B;  4GN5 A;  2F0N A;  1HNW L;  1EWH A;  3NPP A;  2AWO A;  5IGG A;  2NUC A;  3I4L A;  4LF7 Q;  3D4W A;  5KGU A;  3CC4 A;  4U68 A;  1FYC A;  1I4G A;  1HFN A;  5JPN C;  2NVY H;  2C5C A;  1B44 D;  2FJ2 A;  5FLX L;  1EY7 A;  2CWP A;  1CHP D;  2C9O A;  1PFB A;  1SJE D;  5M3M G;  3CC7 A;  4BBS H;  4OGQ C;  3C46 A;  2F0J A;  3M3Y B;  2ZT9 C;  1BDO A;  2CH4 W;  4YCU A;  2CQA A;  4BXX H;  2JXM B;  2MP1 A;  4PQX A;  3D4R A;  5CC4 A;  1IW7 D;  1JB3 A;  2KCN A;  4C3H G;  1B53 A;  2EQS A;  4LF4 Q;  1XNR Q;  2MHV A;  3M4P A;  3NXW A;  4DR5 Q;  1Q46 A;  1VQ7 A;  4LF6 L;  1KD1 C;  3I4N G;  2HCC A;  3SK5 A;  1I4R A;  4FDB A;  1GKH A;  3A54 A;  2B8G A;  4A3K B;  2E5L Q;  1Q7Y C;  3X3M A;  1B9N A;  1NR4 A;  1YVC A;  3J7A F;  1FVI A;  1PFM A;  1V9P A;  2ALY B;  1VQD A;  2IT1 A;  2UUB Q;  4GNX A;  3S16 H;  1ONL A;  3CCQ A;  2UUA Q;  3MFY A;  1FGU A;  1STN A;  3V05 A;  5IYD G;  4A93 G;  5COR A;  3A8I E;  1QOH A;  2VQE L;  2H4O A;  5ELN A;  5J3B A;  4HJ7 A;  2JA6 G;  5IOC A;  4JI0 L;  1EFI D;  5EBD A;  4O1N A;  3PO2 B;  3PUW A;  1C0A A;  1QWY A;  1I6V C;  3NTK A;  1MI2 A;  1SFO H;  2FFK B;  2NVQ H;  2O4X A;  4OL7 A;  4JI1 L;  4XT1 B;  4A3J B;  1YNN D;  1D7Q A;  1B3A A;  5JJL A;  4OEL B;  1T5E A;  3S15 H;  4H44 C;  1B50 A;  3QJY A;  2EYP A;  1M8A A;  1STB A;  4TSS A;  1X3Q A;  4LK1 C;  3DUZ A;  2WAQ G;  4DV5 L;  2PMZ E;  2Z0S A;  4NB3 A;  1WTH A;  2F03 A;  4DR4 Q;  4YHH Q;  4KHP L;  1HQM C;  5C44 G;  4R4T A;  3G7L A;  3CW2 C;  2G5D A;  3I91 A;  4GNX C;  3KYH C;  4K6D A;  4B3T Q;  4B3R L;  4LNQ A;  5EPJ A;  5C4J B;  5LMN Q;  4F87 A;  4IUN A;  1FJG L;  2GVA A;  1EYA A;  2N49 A;  2I5M X;  1DD2 A;  4NDX A;  1IKL A;  1H9R A;  1Q3L A;  4LMQ D;  1D1I A;  3K58 A;  4Y7N B;  3HOW G;  1JJG A;  1Y1V H;  4HJA A;  5IT9 E;  5IGD A;  5E3F A;  3J7Z C;  2NN6 I;  4H0L C;  5BN3 A;  1GM5 A;  4KY7 A;  4BS9 A;  5COY A;  2NVT H;  3LWE A;  3QR8 A;  4I7A A;  3MXU A;  4IAL A;  1SE3 A;  4JW0 A;  4JV5 L;  5KYL A;  1JJC B;  1ILP A;  3K0X A;  4I65 A;  1EYD A;  4K0K Q;  1RHP A;  4QIW E;  3CAM A;  3HOV B;  3SVM A;  1YHA A;  5M5W H;  4DV6 Q;  3HOX G;  5C4Z A;  4XDX A;  5JJI A;  1U4R A;  1QVG A;  1PFS A;  1EIG A;  4HIM A;  2OT2 A;  2NYZ D;  4APV A;  1K8O A;  4GOP B;  3PO3 H;  1FGB D;  3I4M B;  4UPA A;  2YU9 H;  3KFU A;  2PZU A;  1HQR D;  2JEA I;  2QDB A;  1V8Q A;  2XN9 C;  1VQ5 A;  5AJ3 Q;  2SEB D;  1IHZ A;  1OXV A;  5IYB G;  2R7F A;  4R8I A;  4IN3 A;  2N55 A;  4OEM B;  4RGO S;  4BWG B;  3H0G B;  3HOZ H;  3EFX D;  1HZB A;  1SEB D;  1HCZ A;  3NUC A;  4CHT B;  3J80 E;  2JJQ A;  3K5O A;  3VYS A;  4XIG S;  4QB4 A;  5EPL A;  4JPB W;  3NSW A;  2ICI A;  4P72 A;  2R93 B;  4Z9C B;  4U67 3;  1F9P A;  1HA5 A;  1YNX A;  5FKA C;  1L0Y B;  1PV4 A;  5GAE C;  3GTL H;  2D0O A;  2QA4 A;  1PYS B;  4ZAI A;  1I3Q B;  2CCZ A;  4K2K A;  2H1E A;  1CSP A;  1SYC A;  4CBV A;  2Q2U A;  5K5P A;  1OTC A;  1D6E C;  4A76 A;  1CQF A;  2CW0 C;  5A2Q L;  1UEA B;  2BDO A;  4JI7 Q;  3K8A A;  5F2D A;  1K0S A;  4P73 A;  4UP7 A;  2KEC A;  2I5L X;  2VS1 A;  4DNI A;  4F88 A;  2F0Q A;  2LXK A;  1BQQ T;  3I56 A;  2R92 G;  1ASZ A;  5M3M B;  1Y1W G;  1KAA A;  3QWN A;  4UP9 A;  3S1M H;  3MTS A;  1LT6 D;  2GVB A;  3FRP B;  4GN3 B;  4IJL A;  1S5B D;  1EU4 A;  1RDP D;  2HIX A;  4HSP A;  4C3H B;  3U4Z A;  1XNR L;  1EY5 A;  3GTG H;  2X6G A;  3RZD B;  4HTH A;  1SN8 A;  2YYZ A;  1R4Q B;  2HHH L;  4R4Q A;  3MVV A;  1V43 A;  5L37 A;  3I4N B;  1EEI D;  3PV0 A;  1SR3 A;  1VQA A;  2EDG A;  1CTM A;  3GDE A;  5IP9 H;  2NN6 G;  1S5D D;  1XX8 A;  4GNX B;  2LMC B;  2E5L L;  3T51 B;  1N8R C;  5J22 A;  1E2Z A;  3CQZ H;  3G6E A;  2A5H A;  2UUA L;  4HJ5 A;  3OHX C;  3A56 A;  4XQN A;  1K3R A;  4A93 B;  1TVX A;  2JA8 H;  1YNJ C;  1OXX K;  1SMX A;  2JA6 B;  3BYY B;  4J15 A;  1ZEQ X;  1I94 Q;  3EBE A;  4IUU A;  1B2T A;  2EE1 A;  3BYT B;  3D31 A;  1SE2 A;  2PPB C;  1JIC A;  4DUY L;  2VNU D;  2I46 A;  4AH6 A;  3AFP A;  1WCM H;  2LKV A;  3E3X A;  4EGV A;  2CHB D;  5FK9 C;  2CH4 A;  4X65 Q;  2VZA A;  2XGT A;  1EY8 A;  1S72 A;  4DV3 Q;  2EXD A;  2WAQ B;  5IP7 H;  1SRU A;  1CHQ D;  3KLS X;  4DR4 L;  1W6K A;  3R2T A;  3GTM B;  5C3W A;  4LF9 Q;  1VQL A;  2WKD A;  1GUS A;  3QG1 A;  1SYF A;  5C44 B;  1KDC A;  1BR9 A;  1LTG D;  3LWU A;  4DV0 L;  2CW0 D;  2SNS A;  5ELO A;  4CDC C;  1AN8 A;  1ENA A;  4JOI C;  2KCC A;  3HZX A;  3A55 A;  3HKS A;  1PYB A;  1LT3 D;  1PA6 A;  3SR1 A;  2IWH A;  1SND A;  4FF4 A;  3PUV A;  5EKK A;  4KKT A;  2NZ1 D;  3BG3 A;  1X65 A;  3H6M A;  1R9T B;  3HOW B;  4JI2 L;  2WFW A;  2E74 C;  4NW2 A;  5I9P A;  1EZ8 A;  4HCS A;  2WV6 D;  4O42 A;  5JVH 3;  2FXQ A;  2VY3 A;  4BY1 H;  1PRT C;  1EY0 A;  2VQF L;  2QGQ A;  2BE5 C;  2XRQ D;  4XQJ A;  4K14 A;  1Q81 C;  3CCM A;  1KDB A;  3TEH B;  3D6W A;  2Z9H A;  3X3N A;  3NTH A;  4K0K L;  3NWT A;  4DFA A;  2IPK D;  5J1Z A;  5IYC G;  1WTX A;  1YI2 A;  3QOJ A;  3GQB A;  3T4A C;  4ZQ3 A;  3A5Z B;  3HOX B;  3MXG A;  1WVL A;  2F0H A;  4M8A A;  4AQY L;  3B6Y A;  3S2D B;  3F2B A;  3M4O B;  4DK1 A;  1YNJ D;  2FIN B;  3TBI B;  1TWF B;  1UNS A;  4UHV A;  1PZK D;  1ZYR C;  4BBR H;  5DAU A;  1ML0 D;  1I50 B;  1PZJ D;  2EYL A;  2B29 A;  2RSN A;  3E0E A;  4O0A A;  5T1G A;  4K5X A;  3OIQ A;  1VQ4 A;  2NVY B;  5AJ3 L;  1JC7 A;  3RUZ A;  4G7O C;  1VQC A;  1WD1 A;  4Y52 H;  2EYO A;  3QIA A; 
#chains in the Genus database with same CATH homology
 1F9R A;  4ZLT F;  1HUN A;  1BXT A;  3NBI A;  5ELB A;  5JAV A;  3MZ5 A;  4V0B A;  2EJF C;  2B2U C;  2QKI C;  1AZQ A;  3D4D A;  5I2Y A;  1ET9 A;  2K5D A;  1HA6 A;  3HGB A;  4FXK C;  1WTQ A;  1U4P A;  1DM0 B;  3CHB D;  2MJ8 A;  3AB9 A;  1PRT D;  4RCO A;  1C8C A;  4KJO A;  2BE5 D;  2RVL A;  3N6R A;  2R92 B;  1Y1W B;  2B2Y C;  1D5Z C;  1XTC D;  3PUY A;  5ELD A;  3Q24 A;  2VB3 X;  4Q5V A;  5E1F A;  4K8J A;  3EQL C;  3K5N A;  4FXG C;  3TZD A;  4XQQ A;  2VXW A;  2OEO A;  3TP7 A;  3BZD B;  2K04 A;  1NR2 A;  5FOB B;  5EPK A;  2PW5 A;  3SDZ A;  3M85 A;  1X3P A;  1ZYR D;  3H94 A;  5I2X A;  3HP3 A;  2E76 C;  4KKU A;  2F0G A;  2D2C C;  3H91 A;  3NE5 B;  3BVG A;  4FF1 A;  4IFD J;  3K5L A;  4IFD H;  1E0B A;  2D9U A;  2KED A;  3DHQ A;  1RJT A;  1WTO A;  1FR3 A;  1GXD C;  1Q12 A;  4KTA A;  2F0D A;  3KBX A;  3NBH A;  4ZKB B;  2F0V A;  1PRT B;  1SNP A;  3HRZ C;  1VF5 C;  2B2W A;  1SXT A;  4X3K A;  5IIF A;  4HN7 A;  2BCO A;  1AEX A;  2Z4H A;  3VYT A;  3Q22 A;  2PZW A;  5K36 G;  1PLF A;  2K32 A;  1ROD A;  2RA4 A;  1WTW A;  4CKC A;  3HS0 C;  2KEE A;  5KND A;  3P20 A;  3OSO A;  3PUZ A;  1F77 A;  3NHH A;  3KLR A;  4BA1 I;  3R3O A;  1JOQ A;  3L7Z C;  5D3D A;  4RKB A;  3URY A;  2K5Q A;  4HMJ A;  2B2W C;  1LAC A;  3V2T A;  1VMP A;  2G9D A;  4CJ1 B;  4C56 C;  1IYV A;  4ODG A;  4OIJ A;  2F3V A;  5KNB A;  2E2J B;  3C1E A;  4C1N K;  1PDQ A;  1D2B A;  4XYO A;  4C3I G;  1DZ1 A;  4WRD A;  3NP8 A;  2K01 A;  2L12 A;  4PV1 C;  2MUY A;  4HED A;  2NTT A;  2RSO A;  4FVM A;  1TWH B;  1PYW D;  5CYU A;  2IX3 A;  2EJG C;  1TWG B;  2F0W A;  1WTV A;  2JA7 B;  4LJZ C;  5JEA G;  3NTI A;  1EIH A;  1GUG A;  1RCV D;  3GTG B;  3S1N B;  5CGK A;  1PTO H;  4N9P A;  1ET6 A;  3GTJ B;  3M4Y A;  5D3I B;  5FO9 B;  3BS1 A;  3L9A X;  4HSV A;  2XNA C;  2J0T D;  3MEH A;  4H7B A;  2AQ2 B;  2R6G A;  2F0T A;  1STY A;  2EXZ A;  1RKN A;  5FO7 B;  3GTO B;  1MD2 D;  1K83 B;  1G2S A;  3CU7 A;  4MHE A;  2V4D A;  1GUT A;  1UAP A;  1VMC A;  3MAQ A;  4GZY C;  5IGC A;  2R7Z B;  3H3V C;  1Z6H A;  2F0U A;  1GUO A;  3VYU A;  2JA5 B;  1FNW A;  1STE A;  3W3A A;  1JOK A;  2L11 A;  3KBG A;  4IUP A;  3OWE B;  1SYG A;  4MN3 A;  5JPM C;  3NQT A;  4MIU A;  4RFB A;  1OXU A;  2WII B;  2E75 C;  3S9W A;  4ZK9 B;  1G2T A;  1G8Z D;  3SK6 A;  5M9O A;  3ZYY X;  3K0Y A;  2EY5 A;  2AUK A;  3CRL C;  3DWA A;  3MXP A;  4QUC A;  1LLR D;  4EVO A;  1SYE A;  1Q90 A;  3HOU B;  1AW7 A;  2Z8L A;  4RCN A;  1NSN S;  1HPC A;  2D5D A;  2NWG A;  1MGS A;  1BNZ A;  4KD4 A;  4DF7 A;  2B8F A;  1KDA A;  2A68 C;  1SJH D;  1FNU A;  1TU2 B;  3BVM A;  4DAV A;  4DN4 M;  5BN5 A;  3ND8 A;  1LT4 D;  2ZXP A;  3MA2 B;  3PMF A;  1VCI A;  1PMR A;  2AWN A;  3GP7 A;  4XXE A;  3U9S A;  1KLU D;  2A69 C;  4FO2 A;  3OW7 A;  3AU7 A;  4OO1 H;  2XIW A;  4A3E B;  3K57 A;  4RHS A;  5JOB A;  1EQV A;  3S1R B;  4C3I B;  3I3C A;  4G57 A;  2L55 A;  5EGT A;  4BY7 B;  4F7X A;  1QG7 A;  3SHL A;  1A2U A;  4A3B B;  2A74 C;  1I4Q A;  2K6A A;  2D62 A;  1B1Z A;  2F0O A;  4KK7 A;  1I4X A;  3J81 L;  3PIO 3;  3S14 B;  2OF1 A;  5C4X B;  4RGN A;  5E4W C;  4WJW A;  5CMD A;  1A3V A;  2F0F A;  3P1H A;  2A68 D;  5CV8 A;  1EZ6 A;  1JWU D;  2JYO A;  1EU3 A;  1JR0 D;  3D8G A;  4KD3 A;  4DAY A;  1C4Q A;  1M4V A;  3FVQ A;  1NCV A;  5CV5 A;  5D14 A;  2EY2 A;  3IFT A;  5I6W A;  1EY6 A;  4HCE A;  2B2V A;  2A69 D;  1S5E D;  4C2M B;  4WFN 3;  4K5W A;  2E2H B;  2KHS A;  1OXT A;  2SOB A;  1TS5 A;  1GHK A;  3PIP 3;  3HG9 A;  5ELE A;  4B9X A;  1PTO F;  1JWS D;  2AQ1 B;  2B63 B;  3HOY B;  3ND9 A;  4EQP A;  1RF2 D;  2F0I A;  3JAM L;  2B2V C;  2EZV A;  3S17 B;  1TR5 A;  2O5J C;  5NUC A;  5D65 A;  4X3S A;  2A73 B;  5EKI A;  4FYD A;  1A6X A;  2EYM A;  5M5Y B;  1SSO A;  3TSS A;  1E2W A;  4KN4 C;  2TSS A;  4KN7 C;  5I6Y A;  4LAA A;  5C0X J;  5ELC A;  5C0X H;  3TME A;  1I4H A;  1GHJ A;  2F0P A;  4J6H A;  1EL0 A;  1B9M A;  1LTB D;  1EY4 A;  1BBX C;  3J7Y W;  1STG A;  2HUG A;  1TWA B;  3BVZ A;  2F0L A;  1LT5 D;  3OIP A;  3DMU A;  1EEF D;  2WKC A;  5AFW A;  1XWE A;  1GUN A;  2QEJ C;  5IGB A;  3N52 A;  3Q6S A;  4A3I B;  2L5T A;  3K5M A;  4PMW A;  4DAP A;  2O2L D;  2E2D C;  2Y0S B;  4EQO A;  4ID6 A;  3VR4 A;  4BBS B;  2F0S A;  5C4H A;  3FEW X;  4WOR A;  3VR3 A;  1ILQ A;  1DJR D;  2FHT A;  4KI0 A;  4H13 C;  2WP8 J;  3GD7 A;  3TN2 A;  1CT1 D;  3FDT A;  1PFN A;  4FXD A;  2XWB B;  1HHV A;  1HTL D;  3OOC A;  2Q8T A;  1S5F D;  2R61 A;  1KTK A;  1CA6 A;  3DXJ C;  3T53 B;  1BCP F;  2L4N A;  2BA1 A;  4HR7 B;  1HTP A;  3S16 B;  4ZKC B;  2PZT A;  2DN8 A;  4JK1 C;  1SMY C;  1Q1B A;  4HAE A;  1SBB B;  4IUV A;  2F4I A;  2JSO A;  1U4L A;  1Y8N B;  1SFO B;  1RTO A;  4ZYS A;  2NVQ B;  3WOE A;  1TS3 A;  1LTT D;  2EYJ A;  3A8K E;  2IX0 A;  3DEO A;  5FLX E;  1HFG A;  3S15 B;  1GJX A;  5G3L F;  3VA7 A;  2KVM A;  2L9H A;  5C5L A;  4DNR B;  1J8I A;  4J1M A;  3H09 A;  2G9H D;  2Z1C A;  5E4X A;  1SNO A;  3VYR A;  1IYU A;  3A8J E;  2KJX A;  1PXU A;  1LAB A;  5J39 A;  5JEA J;  4QMG A;  1AZP A;  1EWC A;  2F0K A;  2XVS A;  2X6L A;  2ZXR A;  1O78 A;  1Y1V B;  5T1I A;  2L1B A;  1A15 A;  3P7J A;  2NVT B;  3TP8 A;  4J8Q A;  1V1P A;  1Z7T A;  3I8Z A;  4DNT B;  4NP5 A;  5CBE E;  2J7Z A;  3BDO A;  1HXY D;  3I72 A;  1DOM A;  2F1M A;  2B2T A;  2XSC A;  5M5W B;  2LY7 A;  3T56 B;  4IUR A;  4BA2 I;  1SMY D;  2NTS A;  2JEB I;  3PO3 B;  1II3 A;  2LS0 1;  2YU9 B;  3VA5 A;  5DNF A;  1TY0 A;  2EPB A;  1UUP A;  1D5X C;  2PYK A;  1IL8 A;  4X3T A;  5LL6 S;  2HDM A;  1TY2 A;  5CR3 A;  3D3R A;  1XYI A;  3G6J B;  3A7L A;  3PUX A;  1QCB D;  1TQO A;  4RGT A;  3HOZ B;  4ABN A;  1ENC A;  3VR2 A;  4ZRZ A;  1QNK A;  3K6O A;  2IL8 A;  2KA7 A;  1CZG A;  3FMC A;  1T5X D;  3GTL B;  2KQ3 A;  3OWF A;  3SEB A;  1ICW A;  3E6Z X;  4L8J A;  4YIJ A;  2M2L A;  1LTS D;  2SNM A;  3RLF A;  1EQT A;  4TQU S;  5CV9 A;  3IL8 A;  1C48 A;  1HUM A;  2I07 B;  2RDF A;  1PZI D;  4KHZ A;  3S1M B;  3Q0A A;  1LTR D;  5C5M A;  4ZUI A;  1R4P B;  2A6E C;  5IGE A;  3R8B A;  5TSS A;  1MSH A;  3NWS A;  1HRJ A;  5DM7 3;  4OHJ A;  2PQE A;  1BOS A;  3CQZ B;  1QB5 D;  3IKJ A;  1J9O A;  1W6J A;  4B08 A;  2JA8 B;  4IFD G;  4I7Z C;  1O7Y A;  4IZ8 A;  4F8M A;  3I73 A;  3MHB A;  5C6A A;  4OIK A;  1MBY A;  2XRS D;  5A2Q E;  1WCM B;  2EYF A;  1H9M A;  1ZXT A;  3I90 A;  2O5I C;  2QCP X;  2PO4 A;  2TMP A;  2AUJ D;  1STA A;  1IKM A;  3LX0 A;  1V1O A;  2K5W A;  1VDZ A;  3OPO A;  3J81 E;  3OMC A;  2FMC A;  3GV6 A;  1U9R A;  4QUF A;  4CKB A;  2MGS A;  1RTN A;  4DGZ A;  2IW3 A;  4C3J G;  1DON A;  1G91 A;  2RDH A;  2JP1 A;  5CV6 A;  1FNV A;  2Q8I B;  3C2P A;  4XYQ A;  5JVG 3;  4C1N I;  3ONA B;  3MWY W;  1CK1 A;  2K28 A;  2NN6 H;  2K03 A;  4DXG A;  1V1P B;  3CRK C;  2F0E A;  1KLG D;  4BY1 B;  4V19 0;  3T16 A;  2A6E D;  4DK0 A;  3F2U A;  4RWS C;  2X69 A;  2RDG A;  4K8I A;  5DEH A;  5I4D A;  3C1F A;  4AYB B;  1E2V A;  3E0J A;  1DOK A;  4K5V A;  2EVB A;  3DWQ A;  5EBC A;  4R9W A;  1F2Z A;  3I70 A;  4IUQ A;  3TDQ A;  1O7Z A;  3HKZ B;  5LL6 X;  1I4P A;  4BBR B;  3E5S A;  5KYI A;  4P2C B;  1D1K A;  1DYQ A;  2NBF A;  3JAM E;  3DM1 A;  4TKO B;  4DXF A;  3QB3 A;  5EKL A;  3QOL A;  1KNA A;  4KY6 A;  3WOF A;  4EQN A;  4A3F B;  4NKL A;  1Q1E A;  2JE6 I;  5KIX A;  4ZUJ A;  4CJ0 B;  4L63 B;  1LV9 A;  1OXS C;  1VF7 A;  1H9S A;  4QCL A;  1Q8I A;  5ELF A;  1KNE A;  2K05 A;  4OO1 I;  1WTP A;  1A2T A;  4B9W A;  2EOT A;  3ERO A;  4A3M B;  3VR5 A;  4FF3 A;  4KKS A;  5HGT A;  2F0M A;  1GUW A;  3EVQ A;  1AP0 A;  3NQI A;  4CGY B;  3GTP B;  1K8M A;  3IAY A;  2PNR C;  4KMU C;  1SYD A;  3DEP A;  1A3T A;  3R2I A;  4UDU C;  3TP6 A;  1PTO C;  2PCF B;  1CZW A;  1Y8P B;  1GOZ A;  1TWC B;  4KY5 A;  1JOR A;  1JWM D;  1DOL A;  2WIN B;  2VUM B;  2WB1 B;  3KLS A;  2N88 A;  1EYC A;  3SXH A;  2SDF A;  1XXG A;  3S2H B;  3V96 A;  3K7A B;  4G7Z C;  2KOL A;  3U9O A;  3MXN A;  5I9O A;  3KUP A;  1Y8O B;  4JBW A;  3ERQ A;  5IT9 L;  3L3O C;  3LNN A;  3FPU B;  5M5X B;  3SK8 A;  4NMZ A;  3T13 A;  1F2Y A;  1B4O A;  5KRU A;  5LHY 1;  5JJZ A;  1CA5 A;  3EJI A;  1CI3 M;  1G6Z A;  5C3E B;  1H9K A;  4QF4 A;  5HUR A;  3MFG A;  1S5C D;  1U4M A;  5FO8 B;  1ESF A;  2EY6 A;  4ULL A;  3BDC A;  2K7V A;  4C3J B;  5EQ0 A;  2FMM A;  5IGF A;  2BA0 A;  1FD7 D;  4A3G B;  1WD0 A;  1SNM A;  4RKL A;  2EY1 A;  3SE0 A;  2HDL A;  1Z47 A;  2M00 A;  2PW7 A;  1PTO D;  4OO1 G;  1CM9 A;  4KHV A;  2A6H C;  3RMH A;  3J80 L;  1BUV T;  3FPP A;  1L0X B;  1OO9 B;  1TS2 A;  5CV4 A;  3AMU A;  5C0X I;  3NK9 A;  1X32 A;  2NVX B;  1BCP C;  1F9Q A;  2HCI A;  1Y69 U;  5KEE A;  2ZXO A;  2K33 A;  4KV6 A;  2XWJ B;  1ESR A;  1ZKO A;  2RQX A;  1O80 A;  2L0C A;  3S1Q B;  3GV3 A;  3KF8 A;  5K36 H;  1A3U A;  3R93 A;  1F2L A;  3P75 A;  3WDN A;  3UI2 A;  2B2U A;  1AFP A;  1SAP A;  1QNU A;  2VB2 X;  4G4K A;  4PMB A;  3MC0 B;  1WTR A;  3TP5 A;  1H9J A;  4CJ2 C;  4X3U A;  3W2D A;  1RD9 D;  1TII D;  4PNY A;  1CQV A;  5ISR A;  3HEJ A;  1EY9 A;  1D5M C;  2KUM A;  1H9S B;  1PTO B;  1CFM A;  3FKI B;  1PRT F;  3QO2 A;  1S4Z A;  4FP5 D;  2B2Y A;  4L6T B;  1F9S A;  4RHR A;  1MSG A;  4TRD A;  1STH A;  1QIL A;  2EJM A;  2RBM A;  4K6L A;  3KK7 A;  3M7G A;  2ENB A;  2GA4 B;  5IOD A;  5CV7 A;  2EYH A;  1ENF A;  1SNC A;  2A6H D;  3C3L A;  2B39 A;  5C3X A;  5DM6 3;  3GTQ B;  1LTI D;  1BCP D;  2AQ3 B;  3A7A B;  2DY7 A;  3DWP A;  1SE4 A;  4R8N A;  2QF7 A;  2BDN A;  2M9V A;  4FNF A;  3K59 A;  2QIL A;  4IQZ A;  2DNE A;  5JEA H;  1TS4 A;  1JQY D;  1BF4 A;  3BDL A;  5CBA E;  1O7L A;  3VR6 A;  1KAB A;  4A3D B;  3OMG A;  5A35 A;  1DCZ A;  1DXM A;  4KJN A;  5C0X G;  5G3L D;  1SDF A;  2MPM A;  4XTC S;  2ICE C;  1LO5 D;  1SYB A;  1BO0 A;  4IFD I;  4ILW A;  2E2I B;  4ME5 A;  4IUT A;  2IJ0 A;  1TKW B;  3J7A V;  1I6H B;  4UAI A;  4RGM A;  4RH6 A;  1EOT A;  4N9T A;  1BCP B;  4CKE A;  1NAP A;  3GO5 A;  1SNQ A;  4DA2 A;  2CVR A;  3RZO B;  3SK4 A;  2PMZ B;  3D6C A;  3M7N A;  2RKS A;  2ID0 A;  1IW7 C;  1QJO A;  2Z4I A;  4DU9 A;  5KNC A;  1JE4 A;  1LTA D;  3ITP A;  4G7H C;  4E6I A;  1JOO A;  2F3W A;  2B2T C;  1NUC A;  1TT2 A;  3Q23 A;  3IFD A;  4S3S A;  2LFN A;  2BOS A;  1F2M A;  4XT3 B;  2J4X A;  4Q0F A;  5M3F B;  1JCK B;  2WAC A;  1G29 1;  2K1B A;  4PMC A;  3RD4 A;  2OXP A;  4K2L A;  4FF2 A;  2IX1 A;  3CKI B;  2DY8 A;  2Q8R E;  2DNC A;  3O13 A;  3TZU A;  4QIW B;  1YNN C;  1QE6 A;  2R3Z A;  4HMI A;  2NB0 A;  5EJW A;  2HQE A;  4RAU C;  3GTK B;  4RA8 A;  3EA6 A;  5BN4 A;  4M1U B;  2F0N A;  1EWH A;  3NPP A;  2AWO A;  5IGG A;  2NUC A;  3I4L A;  3D4W A;  5KGU A;  4U68 A;  1FYC A;  1I4G A;  1HFN A;  5JPN C;  2C5C A;  1B44 D;  2FJ2 A;  5FLX L;  1EY7 A;  1CHP D;  2C9O A;  1PFB A;  1SJE D;  4OGQ C;  3C46 A;  2F0J A;  3M3Y B;  2ZT9 C;  1BDO A;  2CQA A;  2JXM B;  2MP1 A;  4PQX A;  3D4R A;  5CC4 A;  1IW7 D;  1JB3 A;  2KCN A;  4C3H G;  1B53 A;  2MHV A;  3NXW A;  2HCC A;  3SK5 A;  1I4R A;  3A54 A;  2B8G A;  4A3K B;  3X3M A;  1B9N A;  1NR4 A;  3J7A F;  1PFM A;  2IT1 A;  1ONL A;  3MFY A;  1STN A;  3V05 A;  5COR A;  3A8I E;  1QOH A;  2H4O A;  5IOC A;  1EFI D;  5EBD A;  4O1N A;  3PO2 B;  3PUW A;  1QWY A;  1I6V C;  3NTK A;  1MI2 A;  2FFK B;  2O4X A;  4OL7 A;  4XT1 B;  4A3J B;  1YNN D;  1B3A A;  1T5E A;  1B50 A;  4H44 C;  3QJY A;  2EYP A;  1M8A A;  1STB A;  4TSS A;  1X3Q A;  4LK1 C;  3DUZ A;  2F03 A;  1HQM C;  3G7L A;  3I91 A;  4K6D A;  5EPJ A;  5C4J B;  4F87 A;  4IUN A;  1EYA A;  1DD2 A;  4NDX A;  1IKL A;  1H9R A;  1Q3L A;  4LMQ D;  1D1I A;  3K58 A;  4Y7N B;  5IT9 E;  5IGD A;  5E3F A;  2NN6 I;  4H0L C;  5BN3 A;  4KY7 A;  4BS9 A;  5COY A;  3LWE A;  3MXU A;  4IAL A;  1SE3 A;  5KYL A;  1ILP A;  4I65 A;  1EYD A;  1RHP A;  3HOV B;  3SVM A;  5C4Z A;  4XDX A;  1U4R A;  1EIG A;  2OT2 A;  2NYZ D;  1K8O A;  1FGB D;  3I4M B;  2PZU A;  1HQR D;  2JEA I;  2QDB A;  1V8Q A;  2XN9 C;  2SEB D;  1IHZ A;  1OXV A;  4R8I A;  4IN3 A;  2N55 A;  4RGO S;  4BWG B;  3H0G B;  3EFX D;  1SEB D;  4CHT B;  1HCZ A;  3NUC A;  3J80 E;  3K5O A;  3VYS A;  4XIG S;  4QB4 A;  5EPL A;  3NSW A;  2ICI A;  2R93 B;  4Z9C B;  4U67 3;  1F9P A;  1HA5 A;  5FKA C;  1L0Y B;  4ZAI A;  1I3Q B;  4K2K A;  2H1E A;  1SYC A;  4CBV A;  5K5P A;  1D6E C;  1CQF A;  2CW0 C;  5A2Q L;  1UEA B;  2BDO A;  5F2D A;  2KEC A;  4F88 A;  2F0Q A;  1BQQ T;  5M3M B;  1KAA A;  3QWN A;  3MTS A;  1LT6 D;  3FRP B;  1S5B D;  1EU4 A;  1RDP D;  4HSP A;  4C3H B;  1EY5 A;  2X6G A;  3RZD B;  4HTH A;  2YYZ A;  1R4Q B;  3MVV A;  1V43 A;  3I4N B;  1EEI D;  3PV0 A;  2EDG A;  1CTM A;  2NN6 G;  1S5D D;  1XX8 A;  2LMC B;  3T51 B;  5J22 A;  1E2Z A;  2A5H A;  3OHX C;  3A56 A;  4XQN A;  4A93 B;  1TVX A;  1YNJ C;  1OXX K;  2JA6 B;  3BYY B;  1ZEQ X;  4IUU A;  1B2T A;  2EE1 A;  3BYT B;  3D31 A;  1SE2 A;  2PPB C;  1JIC A;  2VNU D;  2I46 A;  2LKV A;  4EGV A;  2CHB D;  5FK9 C;  1EY8 A;  2WAQ B;  1CHQ D;  3KLS X;  1W6K A;  3R2T A;  3GTM B;  5C3W A;  2WKD A;  1GUS A;  3QG1 A;  1SYF A;  5C44 B;  1KDC A;  1BR9 A;  1LTG D;  3LWU A;  2CW0 D;  2SNS A;  1AN8 A;  1ENA A;  2KCC A;  3HZX A;  3A55 A;  1LT3 D;  3SR1 A;  2IWH A;  1SND A;  4FF4 A;  3PUV A;  5EKK A;  4KKT A;  2NZ1 D;  3BG3 A;  3H6M A;  1R9T B;  3HOW B;  2E74 C;  4NW2 A;  5I9P A;  1EZ8 A;  4HCS A;  2WV6 D;  4O42 A;  5JVH 3;  1PRT C;  1EY0 A;  2BE5 C;  2XRQ D;  4XQJ A;  4K14 A;  1KDB A;  3D6W A;  3X3N A;  3NTH A;  3NWT A;  4DFA A;  2IPK D;  5J1Z A;  1WTX A;  3QOJ A;  3GQB A;  3T4A C;  4ZQ3 A;  3HOX B;  3MXG A;  1WVL A;  2F0H A;  4M8A A;  3S2D B;  3M4O B;  4DK1 A;  1YNJ D;  2FIN B;  3TBI B;  1TWF B;  1UNS A;  1PZK D;  1ZYR C;  5DAU A;  1ML0 D;  1I50 B;  1PZJ D;  2EYL A;  2RSN A;  5T1G A;  4K5X A;  3OIQ A;  2NVY B;  1JC7 A;  3RUZ A;  4G7O C;  1WD1 A;  2EYO A;  3QIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...