4JI3Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3Q00
2JK8A 3W1GA 3WWVA 3S17H 2VQEQ 4DV7L 1E24A 2KENA 4IPCA 1KD1C 2R7ZH 2R7FA 1XMQQ 2HQLA 1EIFA 4GS3A 3U4ZA 1YJWA 5LMUQ 4DR7Q 3RZOH 1HH2P 3GTJH 3AYHB 5J3BA 4DR5Q 5C4JH 4JBMA 1PHJA 4LFBQ 4KI0A 1KQSA 4X64Q 2GVBA 1W3SA 2VNUD 1VQNA 5C44H 3OTOL 3CXCA 1B7YB 1XPRA 2ASBA 4NXNL 3KOJA 1X3FA 4A3BG 3D0FA 2KBNA 4PZ8A 3PO3G 1UE1A 1I50H 1CKMA 1LUZA 3K7UC 3J80c 2ZM6L 1X6OA 1UE7A 2ES2A 4KHZA 4P75A 3ULLA 3FKIG 4QGUA 2PQAB 5IP7G 1VCIA 4UP8A 4C3HH 1G6PA 1X65A 3J7ZC 4GNXC 3CD6A 4P74A 1N33L 1YHQA 3U58A 1PH1A 2RCNA 4JI2L 3GTQH 5IE8A 2I5HA 3HKZG 4LFCL 5HGQA 2VQFL 5DLQE 4A76A 3TEHB 4OX9L 2ZJRA 2JA8H 4P72A 3W1BA 1J5EL 1X3EA 2AMCB 3STBC 5C4XH 3ERSX 4GNXB 1TWGH 4HJ9A 2NVYH 4LWCA 4OXPA 3UE0A 1AE3A 3T1HQ 2F4VQ 1EQRA 3PUZA 1I3QH 3NBHB 3STBD 4A3IH 1J6QA 2KCTA 1KL9A 3UE1A 3DLLA 1PV4A 1IBKL 4K0KL 1BBUA 1YI2A 3GTKH 1X3GA 4GN4B 4O2DA 1KAWA 2AWOA 1IBLQ 1KXLA 3PIPA 4DK6C 2D0OA 4JI8Q 1JJCB 5LMNW 1B8AA 4BA2I 3HOXH 3B6YA 2Z0SA 4JV5L 1Q8KA 4IFDI 1D8LA 1XMQL 4YCUA 1Z47A 5LMUL 4DR7L 3RR5A 5IYCH 1X9NA 3GD7A 4DR5L 4LFBL 5E7NA 1N32Q 1CKOA 1GD7A 3S1QH 4X64L 3MXNB 1VQAA 3HOUG 1LYLA 2GVAA 3CCUA 5FLXc 2OWOA 2ID0A 3U4VA 3KF8B 1CSPA 3PSIA 3EN2A 2Q2TA 4BY7G 4L5RC 1FVIA 1Q12A 4NPSA 1PH4A 1VQ8A 2YYZA 4JYAL 1OXTA 4HIKA 1K0RA 5JEAJ 4BY1H 3A0JA 3NENA 1EYGA 3FP9A 3TS0A 1FL0A 2MFIA 5M5WH 4QIWE 5GROA 2ZJPA 2MNAA 4GN3B 1Z9FA 4B3SQ 4B3MQ 4LF6Q 3TRZA 5C0XI 4Y7NH 3HKZE 3CCSA 4IO9A 3NELA 1PH5A 4A3LG 1C0AA 3L7ZC 2L15A 5IT9c 4AQYQ 1MJEA 2E5LQ 4XTCS 4LUOA 1HR0W 3CCLA 4DV5Q 3PCOB 3AQQA 2FXQA 2WAQG 2ZTEA 4YCVA 2VZAA 4DR2Q 1CKNA 3KDFB 4TVAB 2DGYA 2F4VL 3T1HL 1EUJA 4DK3C 3E9IA 2K52A 4AH6A 4EQ5A 1M1KC 2JA7G 5C3EH 4ME3A 1Y1VG 4DAMA 4X62Q 2ZM6Q 2VUMH 1IL2A 1IBLL 3OYYA 4HIOA 4JI8L 4JI7Q 3S24A 3ICEA 2D62A 5FJ8G 2NN6I 4MZ9A 4TQUS 4IPHA 4JOIC 1NTGA 3S14H 1RIPA 4LUZA 1N32L 2CKZB 1I94Q 4AYBG 5IYDH 2K5HA 3CC7A 1YJ9A 1XPOA 3HOWG 3I4MH 3S16H 5IP9H 2E8GA 1I5FA 4JI6Q 1V43A 1K73C 5M5YH 1Q46A 3I56A 3GTLH 3UDFA 3TREA 4ALPA 1B70B 3LGJA 4DUYQ 3OW2A 4A3GH 3PUXA 4A3DH 4JYAQ 3HOZH 1HZ9A 2CFMA 1QUQA 3D31A 1AH9A 2N8NA 4JCVE 4DR4Q 1Q81C 1Q86C 4QQBX 2R93G 3AFPA 4P71A 1IBKQ 4IFDJ 4B3SL 3J81j 4B3ML 4PZ6A 4LF6L 1HZBA 2VS1A 1VQPA 3PO2H 3CP0A 2YU9H 3PF5A 1BBWA 2AWNA 4AQYL 2E5LL 2RHQB 3H3VH 5JJIA 2Q2HA 3I4NH 4O0AA 2WAQE 1UE5A 2JQOA 3H3VI 4OO1I 5JJLA 1PFSA 4DV5L 1CSQA 1VQBA 2ZTCA 3HOZG 4DR2L 4GKKQ 4BBSG 1C7YA 2R6GA 1C9OA 3F2BA 3A5ZB 3F2CA 1XTDA 1XNRL 4LUVA 1P8LA 5GQOA 1X55A 3SGIA 3HOVH 3PO2G 4X62L 1SRUA 3M9BA 2A19A 4LF5Q 2R7ZG 1PYBA 2UU9Q 5C0XJ 4JC0A 4R4TA 1VQDA 3I4NG 1DGSA 4JI7L 2UXCQ 1A62A 2KCMA 2WP8J 2OQKA 3KLWA 1YHBA 2I0QA 2ALYB 5IWAQ 1I94L 3RLOA 2JEAI 5C44G 4GKJQ 1V1QA 1K9MC 1UE6A 1VQFA 4PG3A 4DR3Q 4LNQA 3IRBA 3GTMH 2NZOA 1HNWQ 4JI6L 3G71A 1VQ6A 4R4IA 1EIYB 4KHPQ 2ZJQA 1X56A 4DUYL 2Q2UA 5FLMH 1HNZQ 1SFOH 2BA1A 4YHHL 2CWPA 4DUZQ 3CCQA 1FGUA 4DR4L 4PZ7A 3RLFA 2BH2A 2N3SA 3PUVA 5IYBH 2HHHQ 3PUYA 4UP9A 4Y52H 2AHOB 5JJKA 1JB7A 2OTLA 3M4QA 3TQYA 3JAMc 2OQ0A 4HIMA 2JA8G 2B63H 1CUKA 3HFZB 4A3FH 3K81C 3K8AA 4DR6Q 1OXXK 5C4XG 3BJUA 2F3IA 4DV1Q 4BBRH 2ATWA 4A3MH 4GKKL 4QY7A 3ZJYC 1JMCA 2NVXH 5M3FH 1ASYA 1MIUA 2LXJA 3UDIA 1GKHA 1UWVA 2YTVA 4A3IG 3HOYH 2XGTA 1SMXA 4YWKA 1PA6A 3M4OH 2PI2A 3CAMA 4LF5L 3W5OA 4WJ3M 5BR8L 5M3MH 2Z6KA 3HOXG 2UU9L 4EX5A 4WJ4A 4AIMA 1U5KA 2Y0SG 1L2FA 2K5VA 2JJQA 1UEBA 2CWAA 1O7IA 1G291 1VQHA 5IYCG 4L5SA 2HT1A 2Q2IA 4MTNA 2UXCL 2VL6A 2HIXA 2R7DA 4LF4Q 1AE2A 1PH7A 4IJLA 5IWAL 4A3JH 3ULPA 4NXMQ 3KF6A 4GKJL 4DNIA 4GOPA 2H5XA 3A74A 5AJ3Q 4DR3L 1KHIA 2N78A 1YEZA 1MKHA 1HNWL 1YHAA 2YTXA 3PIOA 4A3EH 4LF9Q 2R92H 1OXVA 1JJ2A 5M3MG 4RG1A 4BY1G 2DUDA 4L5QA 3T1YQ 4LFAL 4KHPL 4POFA 1VQ9A 1A63A 1QVFA 4DV4Q 1HNZL 1K83H 3J80i 5C0XG 3GDEA 3CMAA 1TWHH 4DUZL 1XNRQ 2IT1A 4HJ5A 1XNQQ 4BA1I 1ASZA 3G6EA 2NVQH 2I5LX 2HHHL 1LTLA 1L1OA 4JG2A 1JJGA 2HIVA 2IX1A 4MNOA 3K80C 1BVSA 2NZHA 2YTYA 1KRTA 2UUBQ 3GTOH 4C3IH 3MEFA 2V1CC 2VW9A 4DR6L 2JA6H 1OXSC 4JBJA 1NE3A 3NEMA 4DV1L 1N36Q 4HJ8A 4DR1Q 2WFWA 4LF8L 3S1NH 3CW2C 4GLXA 4A3CH 1PH3A 3GTGH 3EIVA 1E1TA 5HY6A 5GAEC 5C3EG 1OXUA 4H02A 1VQIA 2ZTDA 1QZHA 2VUMG 1QUQB 2UXBQ 1E1OA 4BXXH 2Y0SE 3M4PA 4YWMA 1KC8C 2MQHA 2UXDQ 3DM3A 2B3GA 3KDFA 2UUCQ 2E2HH 4IOCA 4YHHQ 1QVGA 1HZCA 1P16A 2CQOA 3M85A 1EWIA 3JAMi 4DAYB 2RF4A 1V9PA 5IYDG 2XTIA 1A8VA 4RMFA 4DKAC 1VQMA 4LF4L 1HNXQ 3I4MG 3KFUA 2EIFA 4NXML 2BH8A 4R4QA 2K5NA 4DPGA 5IP9G 5AJ3L 4IPDA 4NB3A 4X65Q 3TS2A 3FHWA 4R1JA 3I55A 3ER0A 2D0PA 4JI4L 4LF9L 2E2IH 1VQGA 4A3GG 4UY8C 4A3DG 1VQ4A 3T1YL 1TWCH 4GLVB 2IX0A 5ELOA 4DV4L 1VQLA 5JEAG 1S40A 4JOIA 1FJGQ 4X66Q 4B3RL 3CPFA 1EOVA 1XNQL 4A3BH 3PF4A 5BR8Q 1SN8A 3PO3H 2IHEA 1N34Q 4OO1G 4HIDA 1PH8A 2C35B 1HZAA 1S3OA 2UUBL 1SROA 3FKIH 4GLAC 4AYBE 4R4CA 1KRSA 2WB1G 5IY0A 2AKWB 5IP7H 1IZ6A 4UP7A 1IBMQ 5K36G 1X54A 1PVOA 1JT8A 4HJAA 1XMOQ 4A75A 3CCEA 3J81c 1Q7YC 1KIXA 1NBWA 1QVCA 3ULJA 1N36L 4DR1L 4JBKA 1OTCA 3AFQA 2K14A 4DV2Q 1EFWA 1JE5A 2BA0A 2IY5B 2QA4A 2R93H 3CMEA 1PH9A 3HOVG 1Y14B 1PH6A 2UXBL 2NVTH 4LFAQ 1E22A 3CC2A 2UXDL 4X6AH 2UUCL 1VQOA 4IJHA 2A1AA 4DV6Q 1BKBA 3RNUA 4JI0Q 2KHIA 2QGQA 3H0GH 1TWFH 4OWWB 2EQSA 4APVA 3CPWA 3J7A5 1T9HA 1E7ZA 1MJCA 4A4IA 1WOCA 2PQAA 4JI5Q 2KHJA 1VQCA 1HNXL 3F1ZA 4J15A 3UDGA 2Z6KC 2LXKA 4B3TQ 2UUAQ 3Q8DA 4X65L 3RN5A 3CCRA 2GN5A 5LMNQ 2K4KA 1Q1BA 3KYHC 5FLMG 3CCJA 3KJPA 4JI3Q 4LF8Q 2OCEA 1R9TH 5GADC 4PMWA 3H0GG 5M5XH 4XIGS 4GOPC 3HOUH 4JBWA 5IYBG 4X66L 4FDBA 1FJGL 1YVCA 4R4OA 5ELNA 3EBEA 4GNXA 1YNXA 1H95A 3K0XA 1WYDA 4IFDG 2N49A 1I6HH 4BY7H 1N9WA 1VQJA 2WB1E 3CQZH 1M90C 1N34L 2B63G 2A8VA 3BZKA 2VQEL 4LW1A 4A3FG 2VY3A 3S2DH 2F52A 3KF6B 3S2HH 4GOPB 1GO3E 4GN5A 4DV0Q 3F8TA 4BBRG 1IBML 4A3MG 2MO1A 1N8RC 1XMOL 1D7QA 3E0EA 5M3FG 3I7FA 1L1OC 1Q82C 4JI1Q 2B29A 4A3LH 4DV2L 3BU2A 3E9HA 3RN2A 1VQ5A 3GO5A 3HOYG 2IHFA 2MO0A 4YY3Q 1CKNB 1YBYA 4JI4Q 1TWAH 4YCWA 3S1MH 1LM0A 4OWTB 4UPAA 1HJPA 4C2MH 1GVPA 5GAHC 1HR0Q 3JC66 1WCMH 4A93H 4LF7Q 3PGZA 3S15H 1U0LA 4P73A 4DV6L 1L1OB 1YJNA 4JI0L 1TXYA 4B3RQ 2K50A 1VQEA 2JEBI 3CCVA 3UDXA 2QEXA 1E3PA 4DV3Q 4A3JG 4KLKA 2JA7H 1IXRA 1GM5A 4JI5L 1Y1VH 1W2BA 4DV7Q 1XJVA 5GAGC 2CCZA 3J81i 4B3TL 2UUAL 1NMFA 2YV5A 4A3EG 5EAYA 2R92G 2PNHA 4QJFA 1K3RA 5FJ8H 5LMNL 1PH2A 1S72A 1SE8A 1A0IA 1WCMG 4JI3L 4OONA 1VQKA 3VDYA 2JA5H 3M3YH 4A3KH 4A93G 2OTJA 3OTOQ 1SLJA 2JE6I 3G4SA 4NXNQ 3HOWH 2PMZE 3GTPH 3CF5A 1PYSB 1WJJA 2I5MX 3F2DA 2RHSB 1YITA 2LSSA 4HJ7A 2PI2E 2NN6G 3PUWA 3A5UA 1YZ6A 3S1RH 3L2PA 4IPGA 1K8GA 1VQ7A 1G51A 3I2ZA 3RLNA 1VS0A 4POGA 3I4OA 3L0OA 1Q1EA 2JA6G 4L5TA 3KJOA 1Y1WH 1SR3A 1NY4A 4DV0L 2JA5G 1RL2A 1YIJA 4QL5A 3BZCA 4A3KG 1EQQA 4A3CG 2EXDA 3PV0A 1N33Q 1QZGA 4JI2Q 4JV5Q 4JI1L 4LFCQ 2VQFQ 4OX9Q 3HKSA 1L0WA 2K75A 2JA9A 4BXXG 1WFQA 4YY3L 4IOAA 4YWLA 1J5EQ 1WI5A 3U50C 3CC4A 1NMGA 3M7NA 1IYJB 1HR0L 3AEVA 4LF7L 4BBSH 1XPUA 4C3JH 3G48A 3H15A 3CCMA 1Y1WG 3K7AH 1K8AC 5H1SE 1NJIC 2E2JH 4K0KQ 4OWXB 4DV3L 3RZDH
chains in the Genus database with same CATH superfamily
2D2CC 1TIID 2EYFA 2R7ZH 1KD1C 2HQLA 4GS3A 4DR7Q 3GTJH 5J3BA 4DR5Q 3PO3B 4LFBQ 1PHJA 4KI0A 2HUGA 3MEHA 1O7YA 1JR0D 3FKIB 1TS5A 2X69A 1Y8PB 1QCBD 4KHVA 2EPBA 4G57A 1NR4A 1H9KA 2ES2A 1UE7A 5KYLA 3J80E 1CQVA 3HKZB 4QGUA 1VCIA 4C3HH 5I2YA 1G6PA 5JOBA 1X65A 4P74A 1YHQA 2CQAA 4A76A 5HGQA 4OX9L 1A3UA 1QG7A 4MN3A 2L11A 1CK1A 1LT5D 5C4XH 3ERSX 1TWGH 2NVYH 1MGSA 1AE3A 3STBD 5I4DA 1B9MA 1PV4A 3GTKH 3M4YA 1X3GA 2AWOA 3MXGA 3PIPA 1JJCB 1GUSA 2F0MA 3VYRA 4ZCKA 4BA2I 2RCFA 1D8LA 1VF5C 5E1FA 4EQOA 4YCUA 5LMUL 1I6HB 1E2ZA 1PTOD 3GD7A 5E7NA 1GD7A 1JWMD 4TSSA 1VQAA 1LYLA 3S2HB 3CCUA 5FLXc 3J80L 1ESFA 1Y8OB 2XRSD 2ID0A 2B8FA 5G3LD 3EN2A 5F2DA 1Y8NB 4NPSA 5IGGA 1PH4A 2FFKB 4HIKA 5JEAJ 4LK1C 1EY4A 3FP9A 4Q5VA 3OWFA 3TS0A 1FL0A 1EYGA 1D2BA 2MFIA 5M5WH 1A3VA 4C2MB 4UDUC 2MNAA 4GN3B 4LF6Q 3TRZA 3NELA 1PH5A 3DHQA 1C0AA 3L7ZC 2O5JC 1Z6HA 1WD1A 3CCLA 2JA7B 4DV5Q 5IGDA 4WJWA 2FXQA 4YCVA 2X6LA 4NDXA 3KLRA 2L12A 3LWEA 3KDFB 4TVAB 2DGYA 3KLSX 3KUPA 3T1HL 2F4VL 3VR4A 1F9QA 4C1NI 2ZM6Q 4AYBB 2VUMH 3BS1A 4ILWA 2KCNA 3K5MA 3GTPB 4FNFA 1GHKA 4PMBA 5C5LA 2D62A 4MZ9A 3A7LA 3HGBA 3I91A 1RIPA 2KA7A 1I94Q 2EDGA 1I5FA 1ZYRC 2F0GA 2RKSA 1K73C 3I56A 4HAEA 1ET9A 3A8IE 4Q0FA 5EKLA 4A3GH 3AB9A 2XVSA 3D31A 1GUGA 4JCVE 1IBKQ 1F2YA 4B3SL 1QJOA 1HZBA 1VQPA 3HOZB 1HQMC 2YU9H 4BBSB 2AWNA 3QIAA 3K7AB 4AQYL 3C1EA 1I4HA 2WAQE 1UE5A 4J6HA 1QWYA 1CSQA 1VQBA 2R7ZB 5EPLA 4DR2L 3ERQA 4GKKQ 1C7YA 2F03A 2Z8LA 4C3JG 3GTJB 1A3TA 4R8IA 2IPKD 4JW0A 1AN8A 4LUVA 5FO7B 3PO2G 3HOVH 1EU3A 4X62L 3KK7A 3M9BA 3BZDB 2X6GA 4R4TA 1J9OA 1U4PA 4LAAA 3K6OA 1KLGD 1STBA 5C4ZA 2UXCQ 2QEJC 2AQ2B 2ALYB 4GKJQ 1S5ED 4XT3B 2JSOA 4C3HB 4PG3A 3J81E 4DR3Q 2J4XA 2NZOA 3Q0AA 1HNWQ 3MAQA 2E76C 4JI6L 3G71A 2XN9C 1VQ6A 2OXPA 1FNUA 4KHPQ 2V4DA 1SFOH 4QUFA 3OOCA 1O7ZA 2NBFA 2CH4A 2Q8IB 3J7AV 1V1OA 1X3QA 4DXGA 1TWGB 2NVYB 1JB7A 5DM63 4IFDH 2M9VA 2OQ0A 3JAME 3J7YW 4A3FH 3GTKB 1ICFB 1B4OA 2F3IA 4H44C 3NK9A 4QY7A 1JMCA 3KBGA 4A3IG 1UWVA 1JQYD 3HOYH 1H9JA 2IW3A 5BR8L 4WJ4A 4EX5A 5EQ0A 4RGMA 3NBHA 1L2FA 1G291 3FPPA 3SDZA 1I4XA 5IYCG 2B2UC 2HT1A 3EVQA 3DWPA 2AUJD 2R7DA 4DK1A 2K7VA 4IJLA 5IWAL 4A3JH 4DNIA 2H5XA 3QOJA 4L63B 1YNND 2HD3A 1KDCA 4A3EH 4RG1A 3T1YQ 5J1ZA 4L5QA 4LFAL 1A63A 1QVFA 4WORA 1K83H 3CMAA 1I4QA 3JAML 1XNQQ 5D65A 1ASZA 1LTLA 1L1OA 1NAPA 3TDQA 4B9WA 4MNOA 2OF1A 1U4MA 4C3IH 1LTID 2F0QA 2VUMB 4DR6L 2JA6H 1EIHA 5ELFA 1NE3A 1J8IA 1N36Q 1JE4A 1LTGD 1PXUA 4CHTB 3GQBA 1AZPA 2F0UA 1E1OA 2Y0SE 3SE0A 4CDDC 2K05A 3H6MA 3BYYB 1HZCA 3FMCA 3T4AC 4HMIA 5IT9L 1EWIA 3JAMi 4NP5A 2F0SA 4DAYB 4A3GB 5IYDG 1STEA 1A8VA 4DKAC 3KFUA 1VQMA 1SE2A 1HFGA 3FRPB 4DPGA 1TS3A 1M4VA 4K2LA 4IPDA 5IGFA 4X65Q 1KLUD 2L0CA 3ER0A 1DZ1A 5ELOA 1F2LA 5G3LF 2E2IB 5C4HA 2A6EC 2KOLA 3EA6A 2EYJA 2C35B 2UUBL 4R4CA 2WB1G 3HOVB 2AKWB 1IZ6A 3V96A 2SDFA 1SYCA 1Q7YC 4JBKA 1OTCA 3AFQA 1PLFA 2F0PA 2IY5B 1EYCA 5JPNC 1SJHD 2AUKA 1PH6A 4ZRZA 3C2PA 1E22A 4KMUC 2MHVA 4X6AH 3NE5B 2UUCL 4QIWB 1EY0A 4IJHA 3URYA 1BKBA 4JI0Q 1KNAA 1B1ZA 2QGQA 3CRKC 1D6EC 4HMJA 3CPWA 1E7ZA 4KY6A 1I4GA 4OELB 4A4IA 1SFOB 2PQAA 4JI5Q 4MTKA 1BBXC 4JK1C 4N9TA 4B3TQ 4FVMA 3ND9A 1CZWA 5C5MA 3I70A 4KD3A 3PMFA 1CHQD 1T5EA 3MHBA 1R9TH 3U9OA 1VMPA 4A3FB 1H9SA 2B2VC 4GOPC 3VR5A 3VR3A 5IYBG 1FJGL 1YVCA 3KLSA 5ELNA 5KIXA 1YNXA 3I8ZA 2N49A 3IFTA 1N9WA 3VYSA 1H9MA 2B63G 2A8VA 3BZKA 2VQEL 3HOYB 4H13C 3KF6B 4GOPB 1GO3E 4GN5A 1IBML 4KD4A 4BBRG 4IN3A 1B3AA 5M3FG 3E9HA 3RN2A 1VQ5A 3GO5A 2IHFA 4P2CB 5CV4A 2WINB 3MXNA 4QCLA 2RSNA 1TWAH 3S1MH 4A3JB 3I72A 3KF8A 1WCMH 3PGZA 2G9DA 4FO2A 1TXYA 4A3EB 2BE5C 2EYLA 2JEBI 2ZXPA 1TT2A 4F8MA 3K5NA 4A93B 3NTKA 1K83B 1EIGA 2F0HA 1XJVA 1MD2D 2JN4A 5D3IB 2B2TA 2IL8A 4B9XA 2R92G 2Q8TA 2BDNA 4C1NK 4DAVA 1Y1VB 1PZKD 2DNEA 4JI3L 4EQNA 3E6ZX 4C3IB 2L4NA 1KDAA 1RJTA 4GZYC 1DD2A 1PRTB 2B2WC 1PYSB 2JA6B 1TQOA 5JVG3 2LSSA 1YITA 2PI2E 3S1RH 3A5UA 1YZ6A 3L2PA 2QILA 5EJWA 1X3PA 1G2SA 2KEEA 4I65A 4EQPA 3RLNA 1VS0A 4CBVA 4L5TA 3K5LA 1GOZA 1NY4A 3NXWA 1YIJA 4A3KG 1QZGA 3ITPA 4OX9Q 3HKSA 1Y1WB 4BXXG 1BUVT 2F1MA 5CYUA 4V190 3H94A 1HR0L 1ZYRD 3AEVA 1WD0A 5IGBA 4C3JH 1Z7TA 1VDZA 1HTPA 4OWXB 4K5XA 3DXJC 2JK8A 1WTOA 3WWVA 2NTTA 3S17H 1EU4A 4WFN3 2E2JB 2SNSA 3U4ZA 2TMPA 5LMUQ 3RZOH 1HH2P 4JBMA 4OIKA 1M8AA 4QUCA 1VQNA 3OTOL 4ABNA 2G5DA 4NXNL 4A3BG 1B53A 1G6ZA 4KHZA 2MUYA 4P75A 3ULLA 1MI2A 5J22A 4K8JA 1WTVA 2K5DA 2D9UA 3U58A 4JI2L 2RCNA 4JV5L 2R93G 2VQFL 2XNAC 5DLQE 5IGEA 3TEHB 4KY7A 4P72A 3NWSA 1J5EL 1X3EA 5KNDA 4OXPA 3UE0A 3T1HQ 2F4VQ 3PUZA 1I3QH 4A3IH 3DLLA 2ICIA 4K0KL 3UE1A 1R9TB 1YI2A 4DK6C 2PZTA 1B8AA 2Z0SA 1EEID 1ZXTA 1L0XB 4ME5A 3RR5A 5IYCH 4KJOA 3HP3A 3I4LA 3CHBD 3HOUG 2Z4HA 4NMZA 1BCPC 1S4ZA 3U4VA 2Q2TA 4BY7G 5BN5A 2YYZA 4HSPA 1VQ8A 4JYAL 1FGBD 4RKBA 3S1MB 1BCPB 5GROA 2MPMA 4B3SQ 1Z9FA 3CCSA 3HKZE 4KY5A 1LTSD 1BR9A 5IT9c 4AQYQ 3BG3A 1HR0W 1HTLD 1EOTA 2DJGC 1SNPA 1BO0A 4DR2Q 2ZTEA 2VZAA 3NQIA 1EUJA 4DK3C 2K52A 4EQ5A 2I07B 1Y1VG 4X62Q 2DNCA 5E3FA 1IL2A 1IBLL 3OYYA 4JI8L 5FJ8G 2NN6I 4TQUS 2N88A 3S14H 3S1RB 1DONA 3C46A 4LUZA 1N32L 2CKZB 1JICA 2DJFC 5IYDH 2HCCA 1XPOA 5C6AA 3TP6A 3S16H 1AP0A 2E8GA 4DXFA 4JI6Q 1V43A 5M5YH 3GTLH 5EBDA 2EJFC 3U9SA 1B70B 3LGJA 3LX0A 4HN7A 3OW2A 4HR7B 3HOZH 1HZ9A 2A6HD 1QUQA 1AH9A 2K28A 1A6XA 4IFDJ 5FOBB 4PZ6A 3D4RA 3CP0A 4O42A 1Q8IA 4MIUA 4C3JB 3TZDA 4NW2A 2E5LL 1IW7D 4O0AA 5D14A 2JQOA 3NP8A 3PO2B 3S17B 2B2YA 2ZTCA 3EQLC 2L1BA 1C9OA 3F2BA 3A5ZB 3F2CA 3RZOB 1LT3D 1XNRL 1P8LA 2HQEA 1X55A 3SGIA 1SRUA 3MZ5A 5C0XJ 1VQDA 3I4NG 2RQXA 1DGSA 3W2DA 1SBBB 5E4XA 2Z9HA 2A6ED 1A62A 2J7ZA 2KCMA 2OQKA 1F9PA 2F3WA 5IWAQ 3RLOA 5C44G 2IX3A 1V1QA 4LNQA 1UE6A 3A8JE 1W6JA 4I7AA 4R4IA 2ZJQA 4DUYL 3GTMB 4DR4L 2N3SA 3PUVA 5IYBH 1O78A 2OTLA 1TVXA 1I3QB 2K6AA 4FYDA 1YNJC 4A3IB 2B63H 1CUKA 3K81C 3K8AA 4DR6Q 3QG1A 1EQVA 3BJUA 1TY2A 4BBRH 4ZLTF 5M3FH 1ASYA 1MIUA 2YTVA 1MHWC 4HSVA 1KABA 2KJXA 2XGTA 1FNVA 5AFWA 4N9PA 3CAMA 3W5OA 1B44D 3HOXG 3QB3A 4IUTA 4L5SA 2CWAA 1EY7A 3N6RA 2Q2IA 3MXPA 4MTNA 2H1EA 4ZKBB 2K03A 1AE2A 3OSOA 4ZAIA 1ML0D 3A74A 1MKHA 5CV9A 2QCPX 2YTXA 3ONAB 2SOBA 2R92H 1OXVA 4K6LA 5M3MG 4FXDA 2KVMA 4XYQA 1AFPA 1C4QA 4RFBA 1Q3LA 1UEAB 3J80i 4YIJA 3GDEA 4X3TA 1TWHH 3X3NA 4BA1I 3G6EA 2NVQH 2HHHL 1IYVA 3A56A 3X3MA 2HIVA 1RF2D 2BE5D 1KRTA 1MBYA 2UUBQ 2Z4IA 1CA5A 3QOLA 3MEFA 2V1CC 3VR6A 1OXSC 1XTCD 1PRTD 4DV1L 4LF8L 3S1NH 3CW2C 3MC0B 2EYMA 3S14B 1E1TA 5HY6A 5LL6S 4R9WA 5GAEC 3P75A 1QZHA 1VQIA 4BXXH 1KC8C 4IURA 4KTAA 3NQTA 4YWMA 3KDFA 2B3GA 2UUCQ 3S16B 3FDTA 3Q23A 4YHHQ 3BDOA 1QVGA 1P16A 3M85A 3GTLB 3L3OC 5M5YB 3BVMA 4IALA 3IKJA 2RF4A 4LF4L 4RMFA 1B3QA 3TS2A 1QOHA 1K8MA 2D0PA 1ILQA 2E2IH 1VQGA 5K36H 1VQ4A 2LFNA 4FF3A 1VQLA 3S9WA 3I3CA 1FJGQ 2WB1B 3CPFA 4ZK9B 1EOVA 3DMUA 4A3BH 3Q22A 3PF4A 1SJED 4OO1G 1GXDC 4CDCC 1JOOA 1SROA 2EY6A 1SEBD 4UP7A 1IBMQ 1X54A 5HURA 4HJAA 4A75A 4K5WA 3CCEA 1QVCA 3HEJA 4DR1L 2K14A 4U68A 4UAIA 5KRUA 2QA4A 2R93H 1BQQT 4G7HC 3G6JB 3IAYA 1Y14B 2UXBL 3D6CA 1DM0B 2NVTH 2M00A 2UXDL 1VQOA 3OMGA 1MSHA 3NSWA 2IJ0A 4OWWB 3J7A5 1T9HA 1A2UA 1RD9D 2FMMA 4J15A 2E2DC 3R8BA 3Q8DA 3RN5A 1SMYC 2OT2A 5EKKA 2K4KA 2PMZB 4KK7A 4F88A 1LTAD 3CCJA 3KJPA 1C8CA 4JI3Q 1BOSA 1D5MC 3IL8A 2B63B 4PMWA 4I7ZC 3H0GG 5M5XH 4XIGS 1STNA 3HOUH 4JBWA 4X66L 4XQQA 4GNXA 4BBRB 4RGNA 3O13A 4BY7H 4IZ8A 5M3FB 2KEDA 1N34L 1S5FD 2EXZA 4LW1A 5I2XA 3A54A 3J81L 3S2DH 4M8AA 5CV7A 1XMOL 2ZT9C 1L1OC 2B29A 1BDOA 3D6WA 1CKNB 2TSSA 4JI4Q 3OW7A 4YCWA 3UI2A 1NCVA 1RTNA 2RDFA 1HR0Q 1BCPD 4RGOS 1II3A 2NWGA 4XQNA 4A93H 1U0LA 4P73A 4DV6L 1L1OB 1SNQA 1Y69U 1LT4D 4XYOA 4B3RQ 5IGCA 2R92B 1K8OA 3C3LA 3CCVA 2EJGC 3VYUA 1IXRA 4BWGB 1JB3A 1KDBA 1Y1VH 1W2BA 3S15B 1TWHB 3PQIA 1RHPA 2CCZA 3J81i 2NVQB 1NMFA 5FJ8H 5LMNL 1PH2A 1A0IA 4OONA 1VQKA 3OTOQ 3LWUA 1SLJA 4NXNQ 3BVZA 3MVVA 2RHSB 3S1NB 4A3KB 2NN6G 3PUWA 3M7GA 2WACA 3R2IA 1VQ7A 4FF1A 1WTWA 3I2ZA 1Q1EA 5KNBA 1SYBA 3Q6SA 3KJOA 1Y1WH 2JA5G 1RL2A 4QL5A 1EQQA 4A3CG 2ICEC 1IKMA 4JI2Q 1R4QB 5IIFA 4JV5Q 4UHVA 4JI1L 2VQFQ 2K75A 2JA9A 1PTOF 2MGSA 1J5EQ 3CC4A 3M7NA 2EJMA 3G7LA 4U673 1XPUA 3H15A 3MFGA 2E2JH 4K0KQ 1LO5D 5ELEA 4DV7L 1E24A 2KENA 2R7FA 4A3BB 5C4JH 4J8QA 1KQSA 1W3SA 2VNUD 5C44H 3CXCA 2ASBA 2JP1A 2NYZD 1CQFA 3D0FA 2KBNA 3J80c 1CKMA 3BDLA 3K0YA 3K7UC 4OL7A 2ZM6L 4JYAQ 1ESRA 1HA6A 1CZGA 2R93B 2PQAB 5IP7G 1WVLA 2NVTB 3SXHA 3PIO3 3OIQA 3J7ZC 3CD6A 3E0JA 1PH1A 3GTQH 3QO2A 4PMCA 2NB0A 4LFCL 2PZWA 1O7LA 1H9SB 1NNXA 1PRTF 2AMCB 3STBC 4HJ9A 4LWCA 1EQRA 4RCNA 1J6QA 1IBKL 1G2TA 1BBUA 1JCKB 4GN4B 1ENAA 1IBLQ 5M5XB 1KXLA 1WTQA 4JI8Q 3HOUB 5LMNW 3HOXH 1XMQL 1GHJA 4KV6A 1ENCA 1Z47A 4BY7B 2O5IC 2F0OA 1N32Q 1CKOA 2VXWA 4X64L 3MXNB 1YNJD 3S2DB 1AEXA 4HTHA 4KKTA 5LL6X 2F0KA 3KF8B 5FLXE 3NPPA 3PSIA 3TP8A 2B2TC 4L5RC 4E6IA 1CT1D 1B9NA 3SVMA 3A0JA 1IKLA 5A2QE 4RH6A 5I9OA 1E2WA 1TS2A 2K32A 4Y7NH 4IO9A 4A3LG 2E5LQ 1MJEA 4X3SA 4LUOA 1H9RA 2F0DA 5CBEE 2E74C 3PCOB 1K3BC 2WAQG 1JC7A 1PZID 3E9IA 5CC4A 1M1KC 1STHA 4ODGA 1STYA 4DAMA 1STGA 4HIOA 2XWBB 1HA5A 4IPHA 1TR5A 4JOIC 1NTGA 2FMCA 5FLXL 2K33A 3CC7A 3HOWG 4K14A 2KQ3A 5A2QL 1GUWA 1STAA 1Q46A 3TREA 2RA4A 4DUYQ 3HRZC 2CFMA 2EY1A 5IOCA 2N8NA 4EGVA 4DR4Q 1Q81C 3AFPA 4P71A 3J81j 4B3ML 2K5QA 3PO2H 3NTHA 5COYA 1BBWA 3K59A 2RHQB 3H3VH 4OO1H 2Q2HA 3H3VI 4OO1I 3OHXC 1UAPA 2RSOA 1RODA 3PIP3 1G8ZD 3I4NB 4DF7A 1HUMA 5C4JB 2PZUA 5GQOA 2CW0C 5EPJA 2A19A 5C44B 1OO9B 1PYBA 2Z1CA 4JI7L 2WP8J 3KLWA 1YHBA 2I0QA 2JEAI 4IUNA 2FJ2A 2OEOA 1VQFA 4G7OC 3GTMH 3IRBA 3N52A 2IWHA 3OIPA 2KUMA 4ZKCB 4G7ZC 3MA2B 2O2LD 1EIYB 2EYOA 1SNMA 3IFDA 5I6YA 3GTQB 4IUQA 3P20A 5DM73 2CWPA 2F0IA 3RLFA 1V1PA 2HHHQ 4UP9A 4Y52H 2AHOB 5L37A 3M4QA 3TQYA 4NKLA 3JAMc 2JA8G 4OGQC 3T53B 1D1IA 3R2TA 1OXXK 5FO9B 2XRQD 1SSOA 1EWCA 4DV1Q 2ATWA 3HOXB 1A15A 1SMYD 2O4XA 2QF7A 4F7XA 1GKHA 3P1HA 5EKIA 1CM9A 4YWKA 1PA6A 3M4OH 2PI2A 5CORA 4LF5L 1VF7A 2NVXB 2Z6KA 2UU9L 4AIMA 1U5KA 2Y0SG 2JJQA 1RTOA 1UEBA 1O7IA 4BS9A 2HIXA 3VA7A 4LF4Q 5M3MB 2Q8RE 1CTMA 4X3UA 3ULPA 4CJ0B 2JYOA 2RVLA 1KHIA 1YEZA 3AU7A 1EWHA 2SEBD 4WRDA 4Y7NB 1YHAA 3PIOA 1JJ2A 3QJYA 4BY1G 2DUDA 1Q90A 1VQ9A 1HNZL 2KECA 5C0XG 1UNSA 4DUZL 5T1GA 2GA4B 2I5LX 4S3SA 1ICWA 3RMHA 1JJGA 2F3VA 1SNCA 4RKLA 2IX1A 3K80C 2NN6H 2YTYA 3GTOH 2CVRA 2EVBA 3A8KE 4JBJA 3NBIA 4TRDA 3TN2A 4HJ8A 3GP7A 4DR1Q 4GLXA 4A3CH 1C48A 1PH3A 2A69C 5C3EG 1LTBD 1SXTA 4H02A 2ZTDA 1BF4A 1QUQB 2UXBQ 5EGTA 2MQHA 2UXDQ 3DM3A 2F0VA 4IOCA 2B2YC 2PO4A 5DNFA 1TS4A 3DEPA 4XDXA 2CQOA 3P7JA 1I4PA 2LMCB 1F2MA 2M2LA 2E2HB 3H3VC 2XTIA 3I4MG 3SK4A 2EIFA 4NXML 5IP9G 2K5NA 5NUCA 5K5PA 4CDFC 5AJ3L 4NB3A 1LTTD 2ENBA 3TMEA 3VYTA 3ZYYX 4LF9L 4UY8C 3OPOA 4A3DG 1TWCH 4GLVB 2NTSA 4DV4L 5JEAG 2A74C 1WTHA 2RDHA 4X66Q 3RD4A 5CGKA 4ZYSA 1NR2A 4J1MA 5BR8Q 2IHEA 1NUCA 1UUPA 1N34Q 1ILPA 4HIDA 1PH8A 1A2TA 4GLAC 4AYBE 1KRSA 1SNOA 5IY0A 5IP7H 1PVOA 1XMOQ 3SK8A 1KIXA 1NBWA 1HHVA 3ULJA 4N8X1 1GUNA 1I4RA 3TZUA 1EFWA 1JE5A 3CMEA 2QW7A 1PH9A 2EY2A 4LFAQ 5CMDA 1S5DD 3H91A 1E0BA 4DV6Q 2Z6BA 3RNUA 2KHIA 2PNRC 1TWFH 2EQSA 4APVA 1MJCA 3ND8A 3WOFA 2A73B 2A5HA 2KCCA 1HFNA 1HNXL 3H0GB 3BYTB 3CCRA 2L5TA 5LMNQ 1QNUA 3KYHC 5FLMG 4DU9A 2OCEA 3D4DA 4C56C 1XWEA 2RBMA 4K6DA 4KN7C 4DNTB 1H95A 3EBEA 1VMCA 1EY5A 1WYDA 4HCEA 1XYIA 3A55A 1VQJA 2WB1E 3CQZH 1ET6A 1M90C 1PZJD 3NTIA 1GJXA 4DN4M 2XSCA 4QMGA 2F52A 4RWSC 3M4OB 1GUTA 4A3MG 1D7QA 3W3AA 3E0EA 3I7FA 1D5ZC 2QKIC 4JI1Q 4A3LH 4DV2L 3BU2A 2MO0A 3NUCA 1DXMA 1YBYA 3WOEA 5FO8B 1LM0A 4OWTB 4UPAA 1HJPA 1GVPA 5D3DA 3JC66 3T51B 3S15H 4KN4C 1YJNA 2EYPA 1EZ6A 4CKEA 1VQEA 2B39A 4L6TB 2G9HD 4KLKA 1G91A 1JWSD 1JORA 2JXMB 4DV7Q 2PCFB 3D8GA 1I6VC 5GAGC 1FR3A 1FNWA 2UUAL 5BN4A 2YV5A 3FEWX 5EAYA 2PNHA 1QILA 1K3RA 4QJFA 3WDNA 4OHJA 4LMQD 1WCMG 3GTOB 3E5SA 3M3YH 4A3KH 1QE6A 2JE6I 2PPBC 3G4SA 1ENFA 2PMZE 3HOWH 3CF5A 1WJJA 2I5MX 2MJ8A 2EY5A 4DA2A 2JA5B 4RGTA 2PQEA 4HJ7A 3K5OA 1EY6A 1SYEA 4IPGA 1NSNS 2HDMA 3I4OA 3VR2A 4DV0L 3BZCA 2EXDA 1L0YB 3EFXD 4IUPA 4CKBA 4LFCQ 2PYKA 1CFMA 4IOAA 1WFQA 4YY3L 5T1IA 1WTRA 4YWLA 3R93A 1WI5A 1JWUD 1NMGA 1IYJB 3LNNA 4LF7L 2AQ1B 3G48A 1K8AC 5H1SE 1NJIC 1TWCB 4DV3L 3RZDH 3W1GA 4L8JA 2VQEQ 4IPCA 1XMQQ 1EIFA 1YJWA 4HCSA 4EVOA 5BN3A 1ZEQX 3AYHB 4CJ2C 4X64Q 2GVBA 1KAAA 5E4WC 1EQTA 1XPRA 1B7YB 4RHRA 3KOJA 1X3FA 3V2TA 4PZ8A 3PO3G 1IYUA 1UE1A 1I50H 1LUZA 1X6OA 3FKIG 5EBCA 4UP8A 4HEDA 2CHBD 2CW0D 1AZQA 2BDOA 2KHSA 4GNXC 4FF2A 5EPKA 1N33L 1TWFB 3H09A 5IE8A 2I5HA 3HKZG 5FKAC 3NHHA 1BNZA 2ZJRA 2JA8H 4DFAA 1LT6D 3W1BA 1TU2B 1SYGA 5M9OA 4GNXB 4TKOB 4X3KA 4N8FA 1ZKOA 1GUOA 1TY0A 3DEOA 3NBHB 1K0SA 2KCTA 1KL9A 1HPCA 5C4XB 3A7AB 1KAWA 2A68C 2QDBA 4O2DA 4KKSA 2D0OA 5JPMC 3B6YA 1Q8KA 2F4IA 4IFDI 1PTOH 4DR7L 5JVH3 1X9NA 4DR5L 3EJIA 4LFBL 3CQZB 1MSGA 1PFNA 3S1QH 2SNMA 1QNKA 3FPUB 2OWOA 2GVAA 1CSPA 5C3XA 1FVIA 1Q12A 1EY9A 1D1KA 4KJNA 4RCOA 1W6KA 1B50A 1OXTA 1K0RA 4BY1H 4IQZA 3NENA 1CA6A 2I46A 5ELBA 5C0XH 4QIWE 1F77A 1QB5D 2ZJPA 3RUZA 4B3MQ 5C0XI 1LLRD 2EYHA 2WAQB 2CH4W 2L15A 5M5WB 5IT9E 4XTCS 5I6WA 1EZ8A 3TSSA 4QB4A 3AQQA 2WKCA 5KGUA 1CKNA 4CJ1B 2B2UA 3HZXA 2DY8A 4AH6A 2JA7G 5C3EH 4ME3A 1PFBA 3T13A 3M3YB 4DK0A 4M1UB 1EEFD 1KNEA 2WV6D 2HDLA 2EOTA 3HOWB 5HGTA 4JI7Q 3S24A 1LABA 3ICEA 1HRJA 3DUZA 4B08A 1T5XD 4AYBG 4ZQ3A 2K5HA 1YJ9A 3I4MH 3NWTA 4FXKC 1S5BD 5IP9H 2XWJB 1XX8A 1X32A 2A6HC 4OIJA 4JVZA 3UDFA 4ALPA 3T16A 2A69D 3PUXA 4A3DH 2NZ1D 4DGZA 3F2UA 5JEAH 1Q86C 4QQBX 1DYQA 3TP7A 1IW7C 2P5ZX 4LF6L 2VS1A 3CKIB 3PF5A 2R3ZA 2ZXRA 3R3OA 4DAYA 5JJIA 3I4NH 2DN8A 3RZDB 1WTXA 5JJZA 5JJLA 1PFSA 1RDPD 4DV5L 2YU9B 3HOZG 1RCVD 1EYDA 3C1FA 5IODA 4DAPA 4BBSG 2R6GA 1SAPA 3Q24A 1XTDA 3GV3A 2F0FA 1HXYD 4LF5Q 1SE4A 3KBXA 2R7ZG 2UU9Q 4JC0A 4K2KA 1LV9A 3L9AX 1R4PB 3D4WA 1I50B 1V8QA 3HG9A 1I94L 1O80A 4ULLA 2F0EA 4RAUC 3GV6A 1K9MC 4G4KA 5ELDA 2B8GA 3QWNA 3DM1A 1X56A 5JAVA 4IUVA 2Q2UA 5FLMH 3HS0C 1HNZQ 4C3HG 2JA8B 2BA1A 4YHHL 4FF4A 2XIWA 3SHLA 4DUZQ 3CCQA 1FGUA 2HCIA 2F0WA 2K5WA 1PYWD 4PZ7A 2BH2A 3PUYA 4XXEA 5JJKA 1PTOC 4FP5D 4HIMA 2R61A 2C5CA 3T56B 3HFZB 3TP5A 2LS01 5C4XG 1CI3M 4A3MH 5DEHA 4GKKL 3ZJYC 2Y0SB 1PTOB 2NVXH 2LXJA 3UDIA 1DOKA 3S1QB 1U4LA 1SMXA 3CRLC 3BDCA 4WJ3M 3OWEB 5M3MH 1TKWB 4CGYB 2K5VA 2E75C 4CKCA 5ISRA 2NUCA 1SNDA 1VQHA 4ZUJA 5KNCA 2UXCL 2VL6A 1EYAA 1CHPD 1U9RA 4BY1B 5C3WA 4RHSA 1PH7A 4GKJL 4NXMQ 3KF6A 2B2VA 4ZUIA 4GOPA 5AJ3Q 5CBAE 2N78A 4DR3L 2LY7A 3SK6A 1HNWL 4LF9Q 4KHPL 4POFA 4DV4Q 3DWQA 3MWYW 1XNRQ 2IT1A 4HJ5A 1DCZA 2F0JA 2K01A 4JG2A 4QF4A 5DAUA 2L9HA 1BVSA 2NZHA 3K58A 1PRTC 5C3EB 1DJRD 2PW7A 5CV5A 2VW9A 2F0LA 1F2ZA 4Z9CB 3BVGA 3NEMA 2WFWA 3MFYA 3FVQA 3GTGH 3EIVA 4OEMB 4IUUA 1WTPA 1OXUA 5KEEA 2VUMG 1K28A 4XQJA 3MXUA 3M4PA 3I4MB 1PFMA 4F87A 2E2HH 3TBIB 2PW5A 2RDGA 4DNRB 3CU7A 4CDEC 1HQRD 1V9PA 4A3DB 4K5VA 1HNXQ 1PMRA 2BH8A 4O1NA 2B2WA 4R4QA 3FHWA 3D3RA 4R1JA 3I55A 4JI4L 2ZXOA 2DY7A 4A3GG 3T1YL 1D5XC 4FXGC 2IX0A 1IL8A 1S40A 4JOIA 2J0TD 5I9PA 4B3RL 1XNQL 5FK9C 1BCPF 1SN8A 3PO3H 1HCZA 1F9SA 2LKVA 1HZAA 1S3OA 2QDLA 3FKIH 1LACA 3I90A 3I73A 1E2VA 1JT8A 5K36G 1FYCA 3J81c 1N36L 1BXTA 4ID6A 4DV2Q 2BA0A 3HOVG 1EY8A 3CC2A 1F9RA 2EZVA 1V1PB 2C9OA 2A1AA 2BCOA 3H0GH 1JOKA 3K57A 4JPBW 1WOCA 2KHJA 1VQCA 3F1ZA 2L55A 3UDGA 3J7AF 2Z6KC 2LXKA 2UUAQ 4X65L 4H7BA 2GN5A 1ONLA 1Q1BA 1PDQA 1SDFA 4LF8Q 4PV1C 2WIIB 5GADC 5CV6A 1EFID 4FDBA 4R4OA 5TSSA 4KKUA 2FHTA 3K0XA 4A3MB 4IFDG 1B2TA 1I6HH 2F0NA 3VA5A 3SR1A 1DOMA 3DWAA 4A3FG 2VY3A 2VB3X 3S2HH 3QR8A 2A68D 1YNNC 4DV0Q 3F8TA 4XT1B 3OMCA 2MO1A 1N8RC 3MTSA 2N55A 1Q82C 2H4OA 1XXGA 3AMUA 5LHY1 3HOYG 4LJZC 4YY3Q 2EE1A 1KTKA 4C2MH 2MP1A 1IHZA 2D5DA 5GAHC 4LF7Q 4JI0L 2K50A 1TWAB 3UDXA 2QEXA 1E3PA 4DV3Q 4A3JG 5A35A 2JA7H 1WCMB 1GM5A 4JI5L 2FINB 5CV8A 4B3TL 2F0TA 4A3EG 4H0LC 5ELCA 4MHEA 3E3XA 1FD7D 2K04A 1S72A 1SE8A 4V0BA 4A93G 2JA5H 2VB2X 2OTJA 3VDYA 3GTPH 1RKNA 1SYFA 3EROA 2WKDA 3F2DA 2BOSA 1U4RA 4PQXA 3GTGB 1K8GA 1SE3A 1G51A 4C3IG 4POGA 1SYDA 3L0OA 2JA6G 3SEBA 1SR3A 2K1BA 5CR3A 1EL0A 3V05A 3PV0A 1N33Q 1AW7A 1S5CD 5KYIA 1L0WA 4RA8A 1LTRD 1HUNA 3U50C 4R8NA 1DOLA 4PNYA 4BBSH 4K8IA 3CCMA 1Y1WG 3K7AH 2AQ3B 1JOQA 3SK5A 5J39A
chains in the Genus database with same CATH topology
2JK8A 3W1GA 3WWVA 3S17H 2VQEQ 4DV7L 1E24A 2KENA 4IPCA 1KD1C 2R7ZH 2R7FA 1XMQQ 2HQLA 1EIFA 4GS3A 3U4ZA 1YJWA 5LMUQ 4DR7Q 3RZOH 1HH2P 3GTJH 3AYHB 5J3BA 4DR5Q 5C4JH 4JBMA 1PHJA 4LFBQ 4KI0A 1KQSA 4X64Q 2GVBA 1W3SA 2VNUD 1VQNA 5C44H 3OTOL 3CXCA 1B7YB 1XPRA 2ASBA 4NXNL 3KOJA 1X3FA 4A3BG 3D0FA 2KBNA 4PZ8A 3PO3G 1UE1A 1I50H 1CKMA 1LUZA 3K7UC 3J80c 2ZM6L 1X6OA 1UE7A 2ES2A 4KHZA 4P75A 3ULLA 3FKIG 4QGUA 2PQAB 5IP7G 1VCIA 4UP8A 4C3HH 1G6PA 1X65A 3J7ZC 4GNXC 3CD6A 4P74A 1N33L 1YHQA 3U58A 1PH1A 2RCNA 4JI2L 3GTQH 5IE8A 2I5HA 3HKZG 4LFCL 5HGQA 2VQFL 5DLQE 4A76A 3TEHB 4OX9L 2ZJRA 2JA8H 4P72A 3W1BA 1J5EL 1X3EA 2AMCB 3STBC 5C4XH 3ERSX 4GNXB 1TWGH 4HJ9A 2NVYH 4LWCA 4OXPA 3UE0A 1AE3A 3T1HQ 2F4VQ 1EQRA 3PUZA 1I3QH 3NBHB 3STBD 4A3IH 1J6QA 2KCTA 1KL9A 3UE1A 3DLLA 1PV4A 1IBKL 4K0KL 1BBUA 1YI2A 3GTKH 1X3GA 4GN4B 4O2DA 1KAWA 2AWOA 1IBLQ 1KXLA 3PIPA 4DK6C 2D0OA 4JI8Q 1JJCB 5LMNW 1B8AA 4BA2I 3HOXH 3B6YA 2Z0SA 4JV5L 1Q8KA 4IFDI 1D8LA 1XMQL 4YCUA 1Z47A 5LMUL 4DR7L 3RR5A 5IYCH 1X9NA 3GD7A 4DR5L 4LFBL 5E7NA 1N32Q 1CKOA 1GD7A 3S1QH 4X64L 3MXNB 1VQAA 3HOUG 1LYLA 2GVAA 3CCUA 5FLXc 2OWOA 2ID0A 3U4VA 3KF8B 1CSPA 3PSIA 3EN2A 2Q2TA 4BY7G 4L5RC 1FVIA 1Q12A 4NPSA 1PH4A 1VQ8A 2YYZA 4JYAL 1OXTA 4HIKA 1K0RA 5JEAJ 4BY1H 3A0JA 3NENA 1EYGA 3FP9A 3TS0A 1FL0A 2MFIA 5M5WH 4QIWE 5GROA 2ZJPA 2MNAA 4GN3B 1Z9FA 4B3SQ 4B3MQ 4LF6Q 3TRZA 5C0XI 4Y7NH 3HKZE 3CCSA 4IO9A 3NELA 1PH5A 4A3LG 1C0AA 3L7ZC 2L15A 5IT9c 4AQYQ 1MJEA 2E5LQ 4XTCS 4LUOA 1HR0W 3CCLA 4DV5Q 3PCOB 3AQQA 2FXQA 2WAQG 2ZTEA 4YCVA 2VZAA 4DR2Q 1CKNA 3KDFB 4TVAB 2DGYA 2F4VL 3T1HL 1EUJA 4DK3C 3E9IA 2K52A 4AH6A 4EQ5A 1M1KC 2JA7G 5C3EH 4ME3A 1Y1VG 4DAMA 4X62Q 2ZM6Q 2VUMH 1IL2A 1IBLL 3OYYA 4HIOA 4JI8L 4JI7Q 3S24A 3ICEA 2D62A 5FJ8G 2NN6I 4MZ9A 4TQUS 4IPHA 4JOIC 1NTGA 3S14H 1RIPA 4LUZA 1N32L 2CKZB 1I94Q 4AYBG 5IYDH 2K5HA 3CC7A 1YJ9A 1XPOA 3HOWG 3I4MH 3S16H 5IP9H 2E8GA 1I5FA 4JI6Q 1V43A 1K73C 5M5YH 1Q46A 3I56A 3GTLH 3UDFA 3TREA 4ALPA 1B70B 3LGJA 4DUYQ 3OW2A 4A3GH 3PUXA 4A3DH 4JYAQ 3HOZH 1HZ9A 2CFMA 1QUQA 3D31A 1AH9A 2N8NA 4JCVE 4DR4Q 1Q81C 1Q86C 4QQBX 2R93G 3AFPA 4P71A 1IBKQ 4IFDJ 4B3SL 3J81j 4B3ML 4PZ6A 4LF6L 1HZBA 2VS1A 1VQPA 3PO2H 3CP0A 2YU9H 3PF5A 1BBWA 2AWNA 4AQYL 2E5LL 2RHQB 3H3VH 5JJIA 2Q2HA 3I4NH 4O0AA 2WAQE 1UE5A 2JQOA 3H3VI 4OO1I 5JJLA 1PFSA 4DV5L 1CSQA 1VQBA 2ZTCA 3HOZG 4DR2L 4GKKQ 4BBSG 1C7YA 2R6GA 1C9OA 3F2BA 3A5ZB 3F2CA 1XTDA 1XNRL 4LUVA 1P8LA 5GQOA 1X55A 3SGIA 3HOVH 3PO2G 4X62L 1SRUA 3M9BA 2A19A 4LF5Q 2R7ZG 1PYBA 2UU9Q 5C0XJ 4JC0A 4R4TA 1VQDA 3I4NG 1DGSA 4JI7L 2UXCQ 1A62A 2KCMA 2WP8J 2OQKA 3KLWA 1YHBA 2I0QA 2ALYB 5IWAQ 1I94L 3RLOA 2JEAI 5C44G 4GKJQ 1V1QA 1K9MC 1UE6A 1VQFA 4PG3A 4DR3Q 4LNQA 3IRBA 3GTMH 2NZOA 1HNWQ 4JI6L 3G71A 1VQ6A 4R4IA 1EIYB 4KHPQ 2ZJQA 1X56A 4DUYL 2Q2UA 5FLMH 1HNZQ 1SFOH 2BA1A 4YHHL 2CWPA 4DUZQ 3CCQA 1FGUA 4DR4L 4PZ7A 3RLFA 2BH2A 2N3SA 3PUVA 5IYBH 2HHHQ 3PUYA 4UP9A 4Y52H 2AHOB 5JJKA 1JB7A 2OTLA 3M4QA 3TQYA 3JAMc 2OQ0A 4HIMA 2JA8G 2B63H 1CUKA 3HFZB 4A3FH 3K81C 3K8AA 4DR6Q 1OXXK 5C4XG 3BJUA 2F3IA 4DV1Q 4BBRH 2ATWA 4A3MH 4GKKL 4QY7A 3ZJYC 1JMCA 2NVXH 5M3FH 1ASYA 1MIUA 2LXJA 3UDIA 1GKHA 1UWVA 2YTVA 4A3IG 3HOYH 2XGTA 1SMXA 4YWKA 1PA6A 3M4OH 2PI2A 3CAMA 4LF5L 3W5OA 4WJ3M 5BR8L 5M3MH 2Z6KA 3HOXG 2UU9L 4EX5A 4WJ4A 4AIMA 1U5KA 2Y0SG 1L2FA 2K5VA 2JJQA 1UEBA 2CWAA 1O7IA 1G291 1VQHA 5IYCG 4L5SA 2HT1A 2Q2IA 4MTNA 2UXCL 2VL6A 2HIXA 2R7DA 4LF4Q 1AE2A 1PH7A 4IJLA 5IWAL 4A3JH 3ULPA 4NXMQ 3KF6A 4GKJL 4DNIA 4GOPA 2H5XA 3A74A 5AJ3Q 4DR3L 1KHIA 2N78A 1YEZA 1MKHA 1HNWL 1YHAA 2YTXA 3PIOA 4A3EH 4LF9Q 2R92H 1OXVA 1JJ2A 5M3MG 4RG1A 4BY1G 2DUDA 4L5QA 3T1YQ 4LFAL 4KHPL 4POFA 1VQ9A 1A63A 1QVFA 4DV4Q 1HNZL 1K83H 3J80i 5C0XG 3GDEA 3CMAA 1TWHH 4DUZL 1XNRQ 2IT1A 4HJ5A 1XNQQ 4BA1I 1ASZA 3G6EA 2NVQH 2I5LX 2HHHL 1LTLA 1L1OA 4JG2A 1JJGA 2HIVA 2IX1A 4MNOA 3K80C 1BVSA 2NZHA 2YTYA 1KRTA 2UUBQ 3GTOH 4C3IH 3MEFA 2V1CC 2VW9A 4DR6L 2JA6H 1OXSC 4JBJA 1NE3A 3NEMA 4DV1L 1N36Q 4HJ8A 4DR1Q 2WFWA 4LF8L 3S1NH 3CW2C 4GLXA 4A3CH 1PH3A 3GTGH 3EIVA 1E1TA 5HY6A 5GAEC 5C3EG 1OXUA 4H02A 1VQIA 2ZTDA 1QZHA 2VUMG 1QUQB 2UXBQ 1E1OA 4BXXH 2Y0SE 3M4PA 4YWMA 1KC8C 2MQHA 2UXDQ 3DM3A 2B3GA 3KDFA 2UUCQ 2E2HH 4IOCA 4YHHQ 1QVGA 1HZCA 1P16A 2CQOA 3M85A 1EWIA 3JAMi 4DAYB 2RF4A 1V9PA 5IYDG 2XTIA 1A8VA 4RMFA 4DKAC 1VQMA 4LF4L 1HNXQ 3I4MG 3KFUA 2EIFA 4NXML 2BH8A 4R4QA 2K5NA 4DPGA 5IP9G 5AJ3L 4IPDA 4NB3A 4X65Q 3TS2A 3FHWA 4R1JA 3I55A 3ER0A 2D0PA 4JI4L 4LF9L 2E2IH 1VQGA 4A3GG 4UY8C 4A3DG 1VQ4A 3T1YL 1TWCH 4GLVB 2IX0A 5ELOA 4DV4L 1VQLA 5JEAG 1S40A 4JOIA 1FJGQ 4X66Q 4B3RL 3CPFA 1EOVA 1XNQL 4A3BH 3PF4A 5BR8Q 1SN8A 3PO3H 2IHEA 1N34Q 4OO1G 4HIDA 1PH8A 2C35B 1HZAA 1S3OA 2UUBL 1SROA 3FKIH 4GLAC 4AYBE 4R4CA 1KRSA 2WB1G 5IY0A 2AKWB 5IP7H 1IZ6A 4UP7A 1IBMQ 5K36G 1X54A 1PVOA 1JT8A 4HJAA 1XMOQ 4A75A 3CCEA 3J81c 1Q7YC 1KIXA 1NBWA 1QVCA 3ULJA 1N36L 4DR1L 4JBKA 1OTCA 3AFQA 2K14A 4DV2Q 1EFWA 1JE5A 2BA0A 2IY5B 2QA4A 2R93H 3CMEA 1PH9A 3HOVG 1Y14B 1PH6A 2UXBL 2NVTH 4LFAQ 1E22A 3CC2A 2UXDL 4X6AH 2UUCL 1VQOA 4IJHA 2A1AA 4DV6Q 1BKBA 3RNUA 4JI0Q 2KHIA 2QGQA 3H0GH 1TWFH 4OWWB 2EQSA 4APVA 3CPWA 3J7A5 1T9HA 1E7ZA 1MJCA 4A4IA 1WOCA 2PQAA 4JI5Q 2KHJA 1VQCA 1HNXL 3F1ZA 4J15A 3UDGA 2Z6KC 2LXKA 4B3TQ 2UUAQ 3Q8DA 4X65L 3RN5A 3CCRA 2GN5A 5LMNQ 2K4KA 1Q1BA 3KYHC 5FLMG 3CCJA 3KJPA 4JI3Q 4LF8Q 2OCEA 1R9TH 5GADC 4PMWA 3H0GG 5M5XH 4XIGS 4GOPC 3HOUH 4JBWA 5IYBG 4X66L 4FDBA 1FJGL 1YVCA 4R4OA 5ELNA 3EBEA 4GNXA 1YNXA 1H95A 3K0XA 1WYDA 4IFDG 2N49A 1I6HH 4BY7H 1N9WA 1VQJA 2WB1E 3CQZH 1M90C 1N34L 2B63G 2A8VA 3BZKA 2VQEL 4LW1A 4A3FG 2VY3A 3S2DH 2F52A 3KF6B 3S2HH 4GOPB 1GO3E 4GN5A 4DV0Q 3F8TA 4BBRG 1IBML 4A3MG 2MO1A 1N8RC 1XMOL 1D7QA 3E0EA 5M3FG 3I7FA 1L1OC 1Q82C 4JI1Q 2B29A 4A3LH 4DV2L 3BU2A 3E9HA 3RN2A 1VQ5A 3GO5A 3HOYG 2IHFA 2MO0A 4YY3Q 1CKNB 1YBYA 4JI4Q 1TWAH 4YCWA 3S1MH 1LM0A 4OWTB 4UPAA 1HJPA 4C2MH 1GVPA 5GAHC 1HR0Q 3JC66 1WCMH 4A93H 4LF7Q 3PGZA 3S15H 1U0LA 4P73A 4DV6L 1L1OB 1YJNA 4JI0L 1TXYA 4B3RQ 2K50A 1VQEA 2JEBI 3CCVA 3UDXA 2QEXA 1E3PA 4DV3Q 4A3JG 4KLKA 2JA7H 1IXRA 1GM5A 4JI5L 1Y1VH 1W2BA 4DV7Q 1XJVA 5GAGC 2CCZA 3J81i 4B3TL 2UUAL 1NMFA 2YV5A 4A3EG 5EAYA 2R92G 2PNHA 4QJFA 1K3RA 5FJ8H 5LMNL 1PH2A 1S72A 1SE8A 1A0IA 1WCMG 4JI3L 4OONA 1VQKA 3VDYA 2JA5H 3M3YH 4A3KH 4A93G 2OTJA 3OTOQ 1SLJA 2JE6I 3G4SA 4NXNQ 3HOWH 2PMZE 3GTPH 3CF5A 1PYSB 1WJJA 2I5MX 3F2DA 2RHSB 1YITA 2LSSA 4HJ7A 2PI2E 2NN6G 3PUWA 3A5UA 1YZ6A 3S1RH 3L2PA 4IPGA 1K8GA 1VQ7A 1G51A 3I2ZA 3RLNA 1VS0A 4POGA 3I4OA 3L0OA 1Q1EA 2JA6G 4L5TA 3KJOA 1Y1WH 1SR3A 1NY4A 4DV0L 2JA5G 1RL2A 1YIJA 4QL5A 3BZCA 4A3KG 1EQQA 4A3CG 2EXDA 3PV0A 1N33Q 1QZGA 4JI2Q 4JV5Q 4JI1L 4LFCQ 2VQFQ 4OX9Q 3HKSA 1L0WA 2K75A 2JA9A 4BXXG 1WFQA 4YY3L 4IOAA 4YWLA 1J5EQ 1WI5A 3U50C 3CC4A 1NMGA 3M7NA 1IYJB 1HR0L 3AEVA 4LF7L 4BBSH 1XPUA 4C3JH 3G48A 3H15A 3CCMA 1Y1WG 3K7AH 1K8AC 5H1SE 1NJIC 2E2JH 4K0KQ 4OWXB 4DV3L 3RZDH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JK8 A;  3W1G A;  3WWV A;  3S17 H;  2VQE Q;  4DV7 L;  1E24 A;  2KEN A;  4IPC A;  1KD1 C;  2R7Z H;  2R7F A;  1XMQ Q;  2HQL A;  1EIF A;  4GS3 A;  3U4Z A;  1YJW A;  5LMU Q;  4DR7 Q;  3RZO H;  1HH2 P;  3GTJ H;  3AYH B;  5J3B A;  4DR5 Q;  5C4J H;  4JBM A;  1PHJ A;  4LFB Q;  4KI0 A;  1KQS A;  4X64 Q;  2GVB A;  1W3S A;  2VNU D;  1VQN A;  5C44 H;  3OTO L;  3CXC A;  1B7Y B;  1XPR A;  2ASB A;  4NXN L;  3KOJ A;  1X3F A;  4A3B G;  3D0F A;  2KBN A;  4PZ8 A;  3PO3 G;  1UE1 A;  1I50 H;  1CKM A;  1LUZ A;  3K7U C;  3J80 c;  2ZM6 L;  1X6O A;  1UE7 A;  2ES2 A;  4KHZ A;  4P75 A;  3ULL A;  3FKI G;  4QGU A;  2PQA B;  5IP7 G;  1VCI A;  4UP8 A;  4C3H H;  1G6P A;  1X65 A;  3J7Z C;  4GNX C;  3CD6 A;  4P74 A;  1N33 L;  1YHQ A;  3U58 A;  1PH1 A;  2RCN A;  4JI2 L;  3GTQ H;  5IE8 A;  2I5H A;  3HKZ G;  4LFC L;  5HGQ A;  2VQF L;  5DLQ E;  4A76 A;  3TEH B;  4OX9 L;  2ZJR A;  2JA8 H;  4P72 A;  3W1B A;  1J5E L;  1X3E A;  2AMC B;  3STB C;  5C4X H;  3ERS X;  4GNX B;  1TWG H;  4HJ9 A;  2NVY H;  4LWC A;  4OXP A;  3UE0 A;  1AE3 A;  3T1H Q;  2F4V Q;  1EQR A;  3PUZ A;  1I3Q H;  3NBH B;  3STB D;  4A3I H;  1J6Q A;  2KCT A;  1KL9 A;  3UE1 A;  3DLL A;  1PV4 A;  1IBK L;  4K0K L;  1BBU A;  1YI2 A;  3GTK H;  1X3G A;  4GN4 B;  4O2D A;  1KAW A;  2AWO A;  1IBL Q;  1KXL A;  3PIP A;  4DK6 C;  2D0O A;  4JI8 Q;  1JJC B;  5LMN W;  1B8A A;  4BA2 I;  3HOX H;  3B6Y A;  2Z0S A;  4JV5 L;  1Q8K A;  4IFD I;  1D8L A;  1XMQ L;  4YCU A;  1Z47 A;  5LMU L;  4DR7 L;  3RR5 A;  5IYC H;  1X9N A;  3GD7 A;  4DR5 L;  4LFB L;  5E7N A;  1N32 Q;  1CKO A;  1GD7 A;  3S1Q H;  4X64 L;  3MXN B;  1VQA A;  3HOU G;  1LYL A;  2GVA A;  3CCU A;  5FLX c;  2OWO A;  2ID0 A;  3U4V A;  3KF8 B;  1CSP A;  3PSI A;  3EN2 A;  2Q2T A;  4BY7 G;  4L5R C;  1FVI A;  1Q12 A;  4NPS A;  1PH4 A;  1VQ8 A;  2YYZ A;  4JYA L;  1OXT A;  4HIK A;  1K0R A;  5JEA J;  4BY1 H;  3A0J A;  3NEN A;  1EYG A;  3FP9 A;  3TS0 A;  1FL0 A;  2MFI A;  5M5W H;  4QIW E;  5GRO A;  2ZJP A;  2MNA A;  4GN3 B;  1Z9F A;  4B3S Q;  4B3M Q;  4LF6 Q;  3TRZ A;  5C0X I;  4Y7N H;  3HKZ E;  3CCS A;  4IO9 A;  3NEL A;  1PH5 A;  4A3L G;  1C0A A;  3L7Z C;  2L15 A;  5IT9 c;  4AQY Q;  1MJE A;  2E5L Q;  4XTC S;  4LUO A;  1HR0 W;  3CCL A;  4DV5 Q;  3PCO B;  3AQQ A;  2FXQ A;  2WAQ G;  2ZTE A;  4YCV A;  2VZA A;  4DR2 Q;  1CKN A;  3KDF B;  4TVA B;  2DGY A;  2F4V L;  3T1H L;  1EUJ A;  4DK3 C;  3E9I A;  2K52 A;  4AH6 A;  4EQ5 A;  1M1K C;  2JA7 G;  5C3E H;  4ME3 A;  1Y1V G;  4DAM A;  4X62 Q;  2ZM6 Q;  2VUM H;  1IL2 A;  1IBL L;  3OYY A;  4HIO A;  4JI8 L;  4JI7 Q;  3S24 A;  3ICE A;  2D62 A;  5FJ8 G;  2NN6 I;  4MZ9 A;  4TQU S;  4IPH A;  4JOI C;  1NTG A;  3S14 H;  1RIP A;  4LUZ A;  1N32 L;  2CKZ B;  1I94 Q;  4AYB G;  5IYD H;  2K5H A;  3CC7 A;  1YJ9 A;  1XPO A;  3HOW G;  3I4M H;  3S16 H;  5IP9 H;  2E8G A;  1I5F A;  4JI6 Q;  1V43 A;  1K73 C;  5M5Y H;  1Q46 A;  3I56 A;  3GTL H;  3UDF A;  3TRE A;  4ALP A;  1B70 B;  3LGJ A;  4DUY Q;  3OW2 A;  4A3G H;  3PUX A;  4A3D H;  4JYA Q;  3HOZ H;  1HZ9 A;  2CFM A;  1QUQ A;  3D31 A;  1AH9 A;  2N8N A;  4JCV E;  4DR4 Q;  1Q81 C;  1Q86 C;  4QQB X;  2R93 G;  3AFP A;  4P71 A;  1IBK Q;  4IFD J;  4B3S L;  3J81 j;  4B3M L;  4PZ6 A;  4LF6 L;  1HZB A;  2VS1 A;  1VQP A;  3PO2 H;  3CP0 A;  2YU9 H;  3PF5 A;  1BBW A;  2AWN A;  4AQY L;  2E5L L;  2RHQ B;  3H3V H;  5JJI A;  2Q2H A;  3I4N H;  4O0A A;  2WAQ E;  1UE5 A;  2JQO A;  3H3V I;  4OO1 I;  5JJL A;  1PFS A;  4DV5 L;  1CSQ A;  1VQB A;  2ZTC A;  3HOZ G;  4DR2 L;  4GKK Q;  4BBS G;  1C7Y A;  2R6G A;  1C9O A;  3F2B A;  3A5Z B;  3F2C A;  1XTD A;  1XNR L;  4LUV A;  1P8L A;  5GQO A;  1X55 A;  3SGI A;  3HOV H;  3PO2 G;  4X62 L;  1SRU A;  3M9B A;  2A19 A;  4LF5 Q;  2R7Z G;  1PYB A;  2UU9 Q;  5C0X J;  4JC0 A;  4R4T A;  1VQD A;  3I4N G;  1DGS A;  4JI7 L;  2UXC Q;  1A62 A;  2KCM A;  2WP8 J;  2OQK A;  3KLW A;  1YHB A;  2I0Q A;  2ALY B;  5IWA Q;  1I94 L;  3RLO A;  2JEA I;  5C44 G;  4GKJ Q;  1V1Q A;  1K9M C;  1UE6 A;  1VQF A;  4PG3 A;  4DR3 Q;  4LNQ A;  3IRB A;  3GTM H;  2NZO A;  1HNW Q;  4JI6 L;  3G71 A;  1VQ6 A;  4R4I A;  1EIY B;  4KHP Q;  2ZJQ A;  1X56 A;  4DUY L;  2Q2U A;  5FLM H;  1HNZ Q;  1SFO H;  2BA1 A;  4YHH L;  2CWP A;  4DUZ Q;  3CCQ A;  1FGU A;  4DR4 L;  4PZ7 A;  3RLF A;  2BH2 A;  2N3S A;  3PUV A;  5IYB H;  2HHH Q;  3PUY A;  4UP9 A;  4Y52 H;  2AHO B;  5JJK A;  1JB7 A;  2OTL A;  3M4Q A;  3TQY A;  3JAM c;  2OQ0 A;  4HIM A;  2JA8 G;  2B63 H;  1CUK A;  3HFZ B;  4A3F H;  3K81 C;  3K8A A;  4DR6 Q;  1OXX K;  5C4X G;  3BJU A;  2F3I A;  4DV1 Q;  4BBR H;  2ATW A;  4A3M H;  4GKK L;  4QY7 A;  3ZJY C;  1JMC A;  2NVX H;  5M3F H;  1ASY A;  1MIU A;  2LXJ A;  3UDI A;  1GKH A;  1UWV A;  2YTV A;  4A3I G;  3HOY H;  2XGT A;  1SMX A;  4YWK A;  1PA6 A;  3M4O H;  2PI2 A;  3CAM A;  4LF5 L;  3W5O A;  4WJ3 M;  5BR8 L;  5M3M H;  2Z6K A;  3HOX G;  2UU9 L;  4EX5 A;  4WJ4 A;  4AIM A;  1U5K A;  2Y0S G;  1L2F A;  2K5V A;  2JJQ A;  1UEB A;  2CWA A;  1O7I A;  1G29 1;  1VQH A;  5IYC G;  4L5S A;  2HT1 A;  2Q2I A;  4MTN A;  2UXC L;  2VL6 A;  2HIX A;  2R7D A;  4LF4 Q;  1AE2 A;  1PH7 A;  4IJL A;  5IWA L;  4A3J H;  3ULP A;  4NXM Q;  3KF6 A;  4GKJ L;  4DNI A;  4GOP A;  2H5X A;  3A74 A;  5AJ3 Q;  4DR3 L;  1KHI A;  2N78 A;  1YEZ A;  1MKH A;  1HNW L;  1YHA A;  2YTX A;  3PIO A;  4A3E H;  4LF9 Q;  2R92 H;  1OXV A;  1JJ2 A;  5M3M G;  4RG1 A;  4BY1 G;  2DUD A;  4L5Q A;  3T1Y Q;  4LFA L;  4KHP L;  4POF A;  1VQ9 A;  1A63 A;  1QVF A;  4DV4 Q;  1HNZ L;  1K83 H;  3J80 i;  5C0X G;  3GDE A;  3CMA A;  1TWH H;  4DUZ L;  1XNR Q;  2IT1 A;  4HJ5 A;  1XNQ Q;  4BA1 I;  1ASZ A;  3G6E A;  2NVQ H;  2I5L X;  2HHH L;  1LTL A;  1L1O A;  4JG2 A;  1JJG A;  2HIV A;  2IX1 A;  4MNO A;  3K80 C;  1BVS A;  2NZH A;  2YTY A;  1KRT A;  2UUB Q;  3GTO H;  4C3I H;  3MEF A;  2V1C C;  2VW9 A;  4DR6 L;  2JA6 H;  1OXS C;  4JBJ A;  1NE3 A;  3NEM A;  4DV1 L;  1N36 Q;  4HJ8 A;  4DR1 Q;  2WFW A;  4LF8 L;  3S1N H;  3CW2 C;  4GLX A;  4A3C H;  1PH3 A;  3GTG H;  3EIV A;  1E1T A;  5HY6 A;  5GAE C;  5C3E G;  1OXU A;  4H02 A;  1VQI A;  2ZTD A;  1QZH A;  2VUM G;  1QUQ B;  2UXB Q;  1E1O A;  4BXX H;  2Y0S E;  3M4P A;  4YWM A;  1KC8 C;  2MQH A;  2UXD Q;  3DM3 A;  2B3G A;  3KDF A;  2UUC Q;  2E2H H;  4IOC A;  4YHH Q;  1QVG A;  1HZC A;  1P16 A;  2CQO A;  3M85 A;  1EWI A;  3JAM i;  4DAY B;  2RF4 A;  1V9P A;  5IYD G;  2XTI A;  1A8V A;  4RMF A;  4DKA C;  1VQM A;  4LF4 L;  1HNX Q;  3I4M G;  3KFU A;  2EIF A;  4NXM L;  2BH8 A;  4R4Q A;  2K5N A;  4DPG A;  5IP9 G;  5AJ3 L;  4IPD A;  4NB3 A;  4X65 Q;  3TS2 A;  3FHW A;  4R1J A;  3I55 A;  3ER0 A;  2D0P A;  4JI4 L;  4LF9 L;  2E2I H;  1VQG A;  4A3G G;  4UY8 C;  4A3D G;  1VQ4 A;  3T1Y L;  1TWC H;  4GLV B;  2IX0 A;  5ELO A;  4DV4 L;  1VQL A;  5JEA G;  1S40 A;  4JOI A;  1FJG Q;  4X66 Q;  4B3R L;  3CPF A;  1EOV A;  1XNQ L;  4A3B H;  3PF4 A;  5BR8 Q;  1SN8 A;  3PO3 H;  2IHE A;  1N34 Q;  4OO1 G;  4HID A;  1PH8 A;  2C35 B;  1HZA A;  1S3O A;  2UUB L;  1SRO A;  3FKI H;  4GLA C;  4AYB E;  4R4C A;  1KRS A;  2WB1 G;  5IY0 A;  2AKW B;  5IP7 H;  1IZ6 A;  4UP7 A;  1IBM Q;  5K36 G;  1X54 A;  1PVO A;  1JT8 A;  4HJA A;  1XMO Q;  4A75 A;  3CCE A;  3J81 c;  1Q7Y C;  1KIX A;  1NBW A;  1QVC A;  3ULJ A;  1N36 L;  4DR1 L;  4JBK A;  1OTC A;  3AFQ A;  2K14 A;  4DV2 Q;  1EFW A;  1JE5 A;  2BA0 A;  2IY5 B;  2QA4 A;  2R93 H;  3CME A;  1PH9 A;  3HOV G;  1Y14 B;  1PH6 A;  2UXB L;  2NVT H;  4LFA Q;  1E22 A;  3CC2 A;  2UXD L;  4X6A H;  2UUC L;  1VQO A;  4IJH A;  2A1A A;  4DV6 Q;  1BKB A;  3RNU A;  4JI0 Q;  2KHI A;  2QGQ A;  3H0G H;  1TWF H;  4OWW B;  2EQS A;  4APV A;  3CPW A;  3J7A 5;  1T9H A;  1E7Z A;  1MJC A;  4A4I A;  1WOC A;  2PQA A;  4JI5 Q;  2KHJ A;  1VQC A;  1HNX L;  3F1Z A;  4J15 A;  3UDG A;  2Z6K C;  2LXK A;  4B3T Q;  2UUA Q;  3Q8D A;  4X65 L;  3RN5 A;  3CCR A;  2GN5 A;  5LMN Q;  2K4K A;  1Q1B A;  3KYH C;  5FLM G;  3CCJ A;  3KJP A;  4JI3 Q;  4LF8 Q;  2OCE A;  1R9T H;  5GAD C;  4PMW A;  3H0G G;  5M5X H;  4XIG S;  4GOP C;  3HOU H;  4JBW A;  5IYB G;  4X66 L;  4FDB A;  1FJG L;  1YVC A;  4R4O A;  5ELN A;  3EBE A;  4GNX A;  1YNX A;  1H95 A;  3K0X A;  1WYD A;  4IFD G;  2N49 A;  1I6H H;  4BY7 H;  1N9W A;  1VQJ A;  2WB1 E;  3CQZ H;  1M90 C;  1N34 L;  2B63 G;  2A8V A;  3BZK A;  2VQE L;  4LW1 A;  4A3F G;  2VY3 A;  3S2D H;  2F52 A;  3KF6 B;  3S2H H;  4GOP B;  1GO3 E;  4GN5 A;  4DV0 Q;  3F8T A;  4BBR G;  1IBM L;  4A3M G;  2MO1 A;  1N8R C;  1XMO L;  1D7Q A;  3E0E A;  5M3F G;  3I7F A;  1L1O C;  1Q82 C;  4JI1 Q;  2B29 A;  4A3L H;  4DV2 L;  3BU2 A;  3E9H A;  3RN2 A;  1VQ5 A;  3GO5 A;  3HOY G;  2IHF A;  2MO0 A;  4YY3 Q;  1CKN B;  1YBY A;  4JI4 Q;  1TWA H;  4YCW A;  3S1M H;  1LM0 A;  4OWT B;  4UPA A;  1HJP A;  4C2M H;  1GVP A;  5GAH C;  1HR0 Q;  3JC6 6;  1WCM H;  4A93 H;  4LF7 Q;  3PGZ A;  3S15 H;  1U0L A;  4P73 A;  4DV6 L;  1L1O B;  1YJN A;  4JI0 L;  1TXY A;  4B3R Q;  2K50 A;  1VQE A;  2JEB I;  3CCV A;  3UDX A;  2QEX A;  1E3P A;  4DV3 Q;  4A3J G;  4KLK A;  2JA7 H;  1IXR A;  1GM5 A;  4JI5 L;  1Y1V H;  1W2B A;  4DV7 Q;  1XJV A;  5GAG C;  2CCZ A;  3J81 i;  4B3T L;  2UUA L;  1NMF A;  2YV5 A;  4A3E G;  5EAY A;  2R92 G;  2PNH A;  4QJF A;  1K3R A;  5FJ8 H;  5LMN L;  1PH2 A;  1S72 A;  1SE8 A;  1A0I A;  1WCM G;  4JI3 L;  4OON A;  1VQK A;  3VDY A;  2JA5 H;  3M3Y H;  4A3K H;  4A93 G;  2OTJ A;  3OTO Q;  1SLJ A;  2JE6 I;  3G4S A;  4NXN Q;  3HOW H;  2PMZ E;  3GTP H;  3CF5 A;  1PYS B;  1WJJ A;  2I5M X;  3F2D A;  2RHS B;  1YIT A;  2LSS A;  4HJ7 A;  2PI2 E;  2NN6 G;  3PUW A;  3A5U A;  1YZ6 A;  3S1R H;  3L2P A;  4IPG A;  1K8G A;  1VQ7 A;  1G51 A;  3I2Z A;  3RLN A;  1VS0 A;  4POG A;  3I4O A;  3L0O A;  1Q1E A;  2JA6 G;  4L5T A;  3KJO A;  1Y1W H;  1SR3 A;  1NY4 A;  4DV0 L;  2JA5 G;  1RL2 A;  1YIJ A;  4QL5 A;  3BZC A;  4A3K G;  1EQQ A;  4A3C G;  2EXD A;  3PV0 A;  1N33 Q;  1QZG A;  4JI2 Q;  4JV5 Q;  4JI1 L;  4LFC Q;  2VQF Q;  4OX9 Q;  3HKS A;  1L0W A;  2K75 A;  2JA9 A;  4BXX G;  1WFQ A;  4YY3 L;  4IOA A;  4YWL A;  1J5E Q;  1WI5 A;  3U50 C;  3CC4 A;  1NMG A;  3M7N A;  1IYJ B;  1HR0 L;  3AEV A;  4LF7 L;  4BBS H;  1XPU A;  4C3J H;  3G48 A;  3H15 A;  3CCM A;  1Y1W G;  3K7A H;  1K8A C;  5H1S E;  1NJI C;  2E2J H;  4K0K Q;  4OWX B;  4DV3 L;  3RZD H; 
#chains in the Genus database with same CATH topology
 2D2C C;  1TII D;  2EYF A;  2R7Z H;  1KD1 C;  2HQL A;  4GS3 A;  4DR7 Q;  3GTJ H;  5J3B A;  4DR5 Q;  3PO3 B;  4LFB Q;  1PHJ A;  4KI0 A;  2HUG A;  3MEH A;  1O7Y A;  1JR0 D;  3FKI B;  1TS5 A;  2X69 A;  1Y8P B;  1QCB D;  4KHV A;  2EPB A;  4G57 A;  1NR4 A;  1H9K A;  2ES2 A;  1UE7 A;  5KYL A;  3J80 E;  1CQV A;  3HKZ B;  4QGU A;  1VCI A;  4C3H H;  5I2Y A;  1G6P A;  5JOB A;  1X65 A;  4P74 A;  1YHQ A;  2CQA A;  4A76 A;  5HGQ A;  4OX9 L;  1A3U A;  1QG7 A;  4MN3 A;  2L11 A;  1CK1 A;  1LT5 D;  5C4X H;  3ERS X;  1TWG H;  2NVY H;  1MGS A;  1AE3 A;  3STB D;  5I4D A;  1B9M A;  1PV4 A;  3GTK H;  3M4Y A;  1X3G A;  2AWO A;  3MXG A;  3PIP A;  1JJC B;  1GUS A;  2F0M A;  3VYR A;  4ZCK A;  4BA2 I;  2RCF A;  1D8L A;  1VF5 C;  5E1F A;  4EQO A;  4YCU A;  5LMU L;  1I6H B;  1E2Z A;  1PTO D;  3GD7 A;  5E7N A;  1GD7 A;  1JWM D;  4TSS A;  1VQA A;  1LYL A;  3S2H B;  3CCU A;  5FLX c;  3J80 L;  1ESF A;  1Y8O B;  2XRS D;  2ID0 A;  2B8F A;  5G3L D;  3EN2 A;  5F2D A;  1Y8N B;  4NPS A;  5IGG A;  1PH4 A;  2FFK B;  4HIK A;  5JEA J;  4LK1 C;  1EY4 A;  3FP9 A;  4Q5V A;  3OWF A;  3TS0 A;  1FL0 A;  1EYG A;  1D2B A;  2MFI A;  5M5W H;  1A3V A;  4C2M B;  4UDU C;  2MNA A;  4GN3 B;  4LF6 Q;  3TRZ A;  3NEL A;  1PH5 A;  3DHQ A;  1C0A A;  3L7Z C;  2O5J C;  1Z6H A;  1WD1 A;  3CCL A;  2JA7 B;  4DV5 Q;  5IGD A;  4WJW A;  2FXQ A;  4YCV A;  2X6L A;  4NDX A;  3KLR A;  2L12 A;  3LWE A;  3KDF B;  4TVA B;  2DGY A;  3KLS X;  3KUP A;  3T1H L;  2F4V L;  3VR4 A;  1F9Q A;  4C1N I;  2ZM6 Q;  4AYB B;  2VUM H;  3BS1 A;  4ILW A;  2KCN A;  3K5M A;  3GTP B;  4FNF A;  1GHK A;  4PMB A;  5C5L A;  2D62 A;  4MZ9 A;  3A7L A;  3HGB A;  3I91 A;  1RIP A;  2KA7 A;  1I94 Q;  2EDG A;  1I5F A;  1ZYR C;  2F0G A;  2RKS A;  1K73 C;  3I56 A;  4HAE A;  1ET9 A;  3A8I E;  4Q0F A;  5EKL A;  4A3G H;  3AB9 A;  2XVS A;  3D31 A;  1GUG A;  4JCV E;  1IBK Q;  1F2Y A;  4B3S L;  1QJO A;  1HZB A;  1VQP A;  3HOZ B;  1HQM C;  2YU9 H;  4BBS B;  2AWN A;  3QIA A;  3K7A B;  4AQY L;  3C1E A;  1I4H A;  2WAQ E;  1UE5 A;  4J6H A;  1QWY A;  1CSQ A;  1VQB A;  2R7Z B;  5EPL A;  4DR2 L;  3ERQ A;  4GKK Q;  1C7Y A;  2F03 A;  2Z8L A;  4C3J G;  3GTJ B;  1A3T A;  4R8I A;  2IPK D;  4JW0 A;  1AN8 A;  4LUV A;  5FO7 B;  3PO2 G;  3HOV H;  1EU3 A;  4X62 L;  3KK7 A;  3M9B A;  3BZD B;  2X6G A;  4R4T A;  1J9O A;  1U4P A;  4LAA A;  3K6O A;  1KLG D;  1STB A;  5C4Z A;  2UXC Q;  2QEJ C;  2AQ2 B;  2ALY B;  4GKJ Q;  1S5E D;  4XT3 B;  2JSO A;  4C3H B;  4PG3 A;  3J81 E;  4DR3 Q;  2J4X A;  2NZO A;  3Q0A A;  1HNW Q;  3MAQ A;  2E76 C;  4JI6 L;  3G71 A;  2XN9 C;  1VQ6 A;  2OXP A;  1FNU A;  4KHP Q;  2V4D A;  1SFO H;  4QUF A;  3OOC A;  1O7Z A;  2NBF A;  2CH4 A;  2Q8I B;  3J7A V;  1V1O A;  1X3Q A;  4DXG A;  1TWG B;  2NVY B;  1JB7 A;  5DM6 3;  4IFD H;  2M9V A;  2OQ0 A;  3JAM E;  3J7Y W;  4A3F H;  3GTK B;  1ICF B;  1B4O A;  2F3I A;  4H44 C;  3NK9 A;  4QY7 A;  1JMC A;  3KBG A;  4A3I G;  1UWV A;  1JQY D;  3HOY H;  1H9J A;  2IW3 A;  5BR8 L;  4WJ4 A;  4EX5 A;  5EQ0 A;  4RGM A;  3NBH A;  1L2F A;  1G29 1;  3FPP A;  3SDZ A;  1I4X A;  5IYC G;  2B2U C;  2HT1 A;  3EVQ A;  3DWP A;  2AUJ D;  2R7D A;  4DK1 A;  2K7V A;  4IJL A;  5IWA L;  4A3J H;  4DNI A;  2H5X A;  3QOJ A;  4L63 B;  1YNN D;  2HD3 A;  1KDC A;  4A3E H;  4RG1 A;  3T1Y Q;  5J1Z A;  4L5Q A;  4LFA L;  1A63 A;  1QVF A;  4WOR A;  1K83 H;  3CMA A;  1I4Q A;  3JAM L;  1XNQ Q;  5D65 A;  1ASZ A;  1LTL A;  1L1O A;  1NAP A;  3TDQ A;  4B9W A;  4MNO A;  2OF1 A;  1U4M A;  4C3I H;  1LTI D;  2F0Q A;  2VUM B;  4DR6 L;  2JA6 H;  1EIH A;  5ELF A;  1NE3 A;  1J8I A;  1N36 Q;  1JE4 A;  1LTG D;  1PXU A;  4CHT B;  3GQB A;  1AZP A;  2F0U A;  1E1O A;  2Y0S E;  3SE0 A;  4CDD C;  2K05 A;  3H6M A;  3BYY B;  1HZC A;  3FMC A;  3T4A C;  4HMI A;  5IT9 L;  1EWI A;  3JAM i;  4NP5 A;  2F0S A;  4DAY B;  4A3G B;  5IYD G;  1STE A;  1A8V A;  4DKA C;  3KFU A;  1VQM A;  1SE2 A;  1HFG A;  3FRP B;  4DPG A;  1TS3 A;  1M4V A;  4K2L A;  4IPD A;  5IGF A;  4X65 Q;  1KLU D;  2L0C A;  3ER0 A;  1DZ1 A;  5ELO A;  1F2L A;  5G3L F;  2E2I B;  5C4H A;  2A6E C;  2KOL A;  3EA6 A;  2EYJ A;  2C35 B;  2UUB L;  4R4C A;  2WB1 G;  3HOV B;  2AKW B;  1IZ6 A;  3V96 A;  2SDF A;  1SYC A;  1Q7Y C;  4JBK A;  1OTC A;  3AFQ A;  1PLF A;  2F0P A;  2IY5 B;  1EYC A;  5JPN C;  1SJH D;  2AUK A;  1PH6 A;  4ZRZ A;  3C2P A;  1E22 A;  4KMU C;  2MHV A;  4X6A H;  3NE5 B;  2UUC L;  4QIW B;  1EY0 A;  4IJH A;  3URY A;  1BKB A;  4JI0 Q;  1KNA A;  1B1Z A;  2QGQ A;  3CRK C;  1D6E C;  4HMJ A;  3CPW A;  1E7Z A;  4KY6 A;  1I4G A;  4OEL B;  4A4I A;  1SFO B;  2PQA A;  4JI5 Q;  4MTK A;  1BBX C;  4JK1 C;  4N9T A;  4B3T Q;  4FVM A;  3ND9 A;  1CZW A;  5C5M A;  3I70 A;  4KD3 A;  3PMF A;  1CHQ D;  1T5E A;  3MHB A;  1R9T H;  3U9O A;  1VMP A;  4A3F B;  1H9S A;  2B2V C;  4GOP C;  3VR5 A;  3VR3 A;  5IYB G;  1FJG L;  1YVC A;  3KLS A;  5ELN A;  5KIX A;  1YNX A;  3I8Z A;  2N49 A;  3IFT A;  1N9W A;  3VYS A;  1H9M A;  2B63 G;  2A8V A;  3BZK A;  2VQE L;  3HOY B;  4H13 C;  3KF6 B;  4GOP B;  1GO3 E;  4GN5 A;  1IBM L;  4KD4 A;  4BBR G;  4IN3 A;  1B3A A;  5M3F G;  3E9H A;  3RN2 A;  1VQ5 A;  3GO5 A;  2IHF A;  4P2C B;  5CV4 A;  2WIN B;  3MXN A;  4QCL A;  2RSN A;  1TWA H;  3S1M H;  4A3J B;  3I72 A;  3KF8 A;  1WCM H;  3PGZ A;  2G9D A;  4FO2 A;  1TXY A;  4A3E B;  2BE5 C;  2EYL A;  2JEB I;  2ZXP A;  1TT2 A;  4F8M A;  3K5N A;  4A93 B;  3NTK A;  1K83 B;  1EIG A;  2F0H A;  1XJV A;  1MD2 D;  2JN4 A;  5D3I B;  2B2T A;  2IL8 A;  4B9X A;  2R92 G;  2Q8T A;  2BDN A;  4C1N K;  4DAV A;  1Y1V B;  1PZK D;  2DNE A;  4JI3 L;  4EQN A;  3E6Z X;  4C3I B;  2L4N A;  1KDA A;  1RJT A;  4GZY C;  1DD2 A;  1PRT B;  2B2W C;  1PYS B;  2JA6 B;  1TQO A;  5JVG 3;  2LSS A;  1YIT A;  2PI2 E;  3S1R H;  3A5U A;  1YZ6 A;  3L2P A;  2QIL A;  5EJW A;  1X3P A;  1G2S A;  2KEE A;  4I65 A;  4EQP A;  3RLN A;  1VS0 A;  4CBV A;  4L5T A;  3K5L A;  1GOZ A;  1NY4 A;  3NXW A;  1YIJ A;  4A3K G;  1QZG A;  3ITP A;  4OX9 Q;  3HKS A;  1Y1W B;  4BXX G;  1BUV T;  2F1M A;  5CYU A;  4V19 0;  3H94 A;  1HR0 L;  1ZYR D;  3AEV A;  1WD0 A;  5IGB A;  4C3J H;  1Z7T A;  1VDZ A;  1HTP A;  4OWX B;  4K5X A;  3DXJ C;  2JK8 A;  1WTO A;  3WWV A;  2NTT A;  3S17 H;  1EU4 A;  4WFN 3;  2E2J B;  2SNS A;  3U4Z A;  2TMP A;  5LMU Q;  3RZO H;  1HH2 P;  4JBM A;  4OIK A;  1M8A A;  4QUC A;  1VQN A;  3OTO L;  4ABN A;  2G5D A;  4NXN L;  4A3B G;  1B53 A;  1G6Z A;  4KHZ A;  2MUY A;  4P75 A;  3ULL A;  1MI2 A;  5J22 A;  4K8J A;  1WTV A;  2K5D A;  2D9U A;  3U58 A;  4JI2 L;  2RCN A;  4JV5 L;  2R93 G;  2VQF L;  2XNA C;  5DLQ E;  5IGE A;  3TEH B;  4KY7 A;  4P72 A;  3NWS A;  1J5E L;  1X3E A;  5KND A;  4OXP A;  3UE0 A;  3T1H Q;  2F4V Q;  3PUZ A;  1I3Q H;  4A3I H;  3DLL A;  2ICI A;  4K0K L;  3UE1 A;  1R9T B;  1YI2 A;  4DK6 C;  2PZT A;  1B8A A;  2Z0S A;  1EEI D;  1ZXT A;  1L0X B;  4ME5 A;  3RR5 A;  5IYC H;  4KJO A;  3HP3 A;  3I4L A;  3CHB D;  3HOU G;  2Z4H A;  4NMZ A;  1BCP C;  1S4Z A;  3U4V A;  2Q2T A;  4BY7 G;  5BN5 A;  2YYZ A;  4HSP A;  1VQ8 A;  4JYA L;  1FGB D;  4RKB A;  3S1M B;  1BCP B;  5GRO A;  2MPM A;  4B3S Q;  1Z9F A;  3CCS A;  3HKZ E;  4KY5 A;  1LTS D;  1BR9 A;  5IT9 c;  4AQY Q;  3BG3 A;  1HR0 W;  1HTL D;  1EOT A;  2DJG C;  1SNP A;  1BO0 A;  4DR2 Q;  2ZTE A;  2VZA A;  3NQI A;  1EUJ A;  4DK3 C;  2K52 A;  4EQ5 A;  2I07 B;  1Y1V G;  4X62 Q;  2DNC A;  5E3F A;  1IL2 A;  1IBL L;  3OYY A;  4JI8 L;  5FJ8 G;  2NN6 I;  4TQU S;  2N88 A;  3S14 H;  3S1R B;  1DON A;  3C46 A;  4LUZ A;  1N32 L;  2CKZ B;  1JIC A;  2DJF C;  5IYD H;  2HCC A;  1XPO A;  5C6A A;  3TP6 A;  3S16 H;  1AP0 A;  2E8G A;  4DXF A;  4JI6 Q;  1V43 A;  5M5Y H;  3GTL H;  5EBD A;  2EJF C;  3U9S A;  1B70 B;  3LGJ A;  3LX0 A;  4HN7 A;  3OW2 A;  4HR7 B;  3HOZ H;  1HZ9 A;  2A6H D;  1QUQ A;  1AH9 A;  2K28 A;  1A6X A;  4IFD J;  5FOB B;  4PZ6 A;  3D4R A;  3CP0 A;  4O42 A;  1Q8I A;  4MIU A;  4C3J B;  3TZD A;  4NW2 A;  2E5L L;  1IW7 D;  4O0A A;  5D14 A;  2JQO A;  3NP8 A;  3PO2 B;  3S17 B;  2B2Y A;  2ZTC A;  3EQL C;  2L1B A;  1C9O A;  3F2B A;  3A5Z B;  3F2C A;  3RZO B;  1LT3 D;  1XNR L;  1P8L A;  2HQE A;  1X55 A;  3SGI A;  1SRU A;  3MZ5 A;  5C0X J;  1VQD A;  3I4N G;  2RQX A;  1DGS A;  3W2D A;  1SBB B;  5E4X A;  2Z9H A;  2A6E D;  1A62 A;  2J7Z A;  2KCM A;  2OQK A;  1F9P A;  2F3W A;  5IWA Q;  3RLO A;  5C44 G;  2IX3 A;  1V1Q A;  4LNQ A;  1UE6 A;  3A8J E;  1W6J A;  4I7A A;  4R4I A;  2ZJQ A;  4DUY L;  3GTM B;  4DR4 L;  2N3S A;  3PUV A;  5IYB H;  1O78 A;  2OTL A;  1TVX A;  1I3Q B;  2K6A A;  4FYD A;  1YNJ C;  4A3I B;  2B63 H;  1CUK A;  3K81 C;  3K8A A;  4DR6 Q;  3QG1 A;  1EQV A;  3BJU A;  1TY2 A;  4BBR H;  4ZLT F;  5M3F H;  1ASY A;  1MIU A;  2YTV A;  1MHW C;  4HSV A;  1KAB A;  2KJX A;  2XGT A;  1FNV A;  5AFW A;  4N9P A;  3CAM A;  3W5O A;  1B44 D;  3HOX G;  3QB3 A;  4IUT A;  4L5S A;  2CWA A;  1EY7 A;  3N6R A;  2Q2I A;  3MXP A;  4MTN A;  2H1E A;  4ZKB B;  2K03 A;  1AE2 A;  3OSO A;  4ZAI A;  1ML0 D;  3A74 A;  1MKH A;  5CV9 A;  2QCP X;  2YTX A;  3ONA B;  2SOB A;  2R92 H;  1OXV A;  4K6L A;  5M3M G;  4FXD A;  2KVM A;  4XYQ A;  1AFP A;  1C4Q A;  4RFB A;  1Q3L A;  1UEA B;  3J80 i;  4YIJ A;  3GDE A;  4X3T A;  1TWH H;  3X3N A;  4BA1 I;  3G6E A;  2NVQ H;  2HHH L;  1IYV A;  3A56 A;  3X3M A;  2HIV A;  1RF2 D;  2BE5 D;  1KRT A;  1MBY A;  2UUB Q;  2Z4I A;  1CA5 A;  3QOL A;  3MEF A;  2V1C C;  3VR6 A;  1OXS C;  1XTC D;  1PRT D;  4DV1 L;  4LF8 L;  3S1N H;  3CW2 C;  3MC0 B;  2EYM A;  3S14 B;  1E1T A;  5HY6 A;  5LL6 S;  4R9W A;  5GAE C;  3P75 A;  1QZH A;  1VQI A;  4BXX H;  1KC8 C;  4IUR A;  4KTA A;  3NQT A;  4YWM A;  3KDF A;  2B3G A;  2UUC Q;  3S16 B;  3FDT A;  3Q23 A;  4YHH Q;  3BDO A;  1QVG A;  1P16 A;  3M85 A;  3GTL B;  3L3O C;  5M5Y B;  3BVM A;  4IAL A;  3IKJ A;  2RF4 A;  4LF4 L;  4RMF A;  1B3Q A;  3TS2 A;  1QOH A;  1K8M A;  2D0P A;  1ILQ A;  2E2I H;  1VQG A;  5K36 H;  1VQ4 A;  2LFN A;  4FF3 A;  1VQL A;  3S9W A;  3I3C A;  1FJG Q;  2WB1 B;  3CPF A;  4ZK9 B;  1EOV A;  3DMU A;  4A3B H;  3Q22 A;  3PF4 A;  1SJE D;  4OO1 G;  1GXD C;  4CDC C;  1JOO A;  1SRO A;  2EY6 A;  1SEB D;  4UP7 A;  1IBM Q;  1X54 A;  5HUR A;  4HJA A;  4A75 A;  4K5W A;  3CCE A;  1QVC A;  3HEJ A;  4DR1 L;  2K14 A;  4U68 A;  4UAI A;  5KRU A;  2QA4 A;  2R93 H;  1BQQ T;  4G7H C;  3G6J B;  3IAY A;  1Y14 B;  2UXB L;  3D6C A;  1DM0 B;  2NVT H;  2M00 A;  2UXD L;  1VQO A;  3OMG A;  1MSH A;  3NSW A;  2IJ0 A;  4OWW B;  3J7A 5;  1T9H A;  1A2U A;  1RD9 D;  2FMM A;  4J15 A;  2E2D C;  3R8B A;  3Q8D A;  3RN5 A;  1SMY C;  2OT2 A;  5EKK A;  2K4K A;  2PMZ B;  4KK7 A;  4F88 A;  1LTA D;  3CCJ A;  3KJP A;  1C8C A;  4JI3 Q;  1BOS A;  1D5M C;  3IL8 A;  2B63 B;  4PMW A;  4I7Z C;  3H0G G;  5M5X H;  4XIG S;  1STN A;  3HOU H;  4JBW A;  4X66 L;  4XQQ A;  4GNX A;  4BBR B;  4RGN A;  3O13 A;  4BY7 H;  4IZ8 A;  5M3F B;  2KED A;  1N34 L;  1S5F D;  2EXZ A;  4LW1 A;  5I2X A;  3A54 A;  3J81 L;  3S2D H;  4M8A A;  5CV7 A;  1XMO L;  2ZT9 C;  1L1O C;  2B29 A;  1BDO A;  3D6W A;  1CKN B;  2TSS A;  4JI4 Q;  3OW7 A;  4YCW A;  3UI2 A;  1NCV A;  1RTN A;  2RDF A;  1HR0 Q;  1BCP D;  4RGO S;  1II3 A;  2NWG A;  4XQN A;  4A93 H;  1U0L A;  4P73 A;  4DV6 L;  1L1O B;  1SNQ A;  1Y69 U;  1LT4 D;  4XYO A;  4B3R Q;  5IGC A;  2R92 B;  1K8O A;  3C3L A;  3CCV A;  2EJG C;  3VYU A;  1IXR A;  4BWG B;  1JB3 A;  1KDB A;  1Y1V H;  1W2B A;  3S15 B;  1TWH B;  3PQI A;  1RHP A;  2CCZ A;  3J81 i;  2NVQ B;  1NMF A;  5FJ8 H;  5LMN L;  1PH2 A;  1A0I A;  4OON A;  1VQK A;  3OTO Q;  3LWU A;  1SLJ A;  4NXN Q;  3BVZ A;  3MVV A;  2RHS B;  3S1N B;  4A3K B;  2NN6 G;  3PUW A;  3M7G A;  2WAC A;  3R2I A;  1VQ7 A;  4FF1 A;  1WTW A;  3I2Z A;  1Q1E A;  5KNB A;  1SYB A;  3Q6S A;  3KJO A;  1Y1W H;  2JA5 G;  1RL2 A;  4QL5 A;  1EQQ A;  4A3C G;  2ICE C;  1IKM A;  4JI2 Q;  1R4Q B;  5IIF A;  4JV5 Q;  4UHV A;  4JI1 L;  2VQF Q;  2K75 A;  2JA9 A;  1PTO F;  2MGS A;  1J5E Q;  3CC4 A;  3M7N A;  2EJM A;  3G7L A;  4U67 3;  1XPU A;  3H15 A;  3MFG A;  2E2J H;  4K0K Q;  1LO5 D;  5ELE A;  4DV7 L;  1E24 A;  2KEN A;  2R7F A;  4A3B B;  5C4J H;  4J8Q A;  1KQS A;  1W3S A;  2VNU D;  5C44 H;  3CXC A;  2ASB A;  2JP1 A;  2NYZ D;  1CQF A;  3D0F A;  2KBN A;  3J80 c;  1CKM A;  3BDL A;  3K0Y A;  3K7U C;  4OL7 A;  2ZM6 L;  4JYA Q;  1ESR A;  1HA6 A;  1CZG A;  2R93 B;  2PQA B;  5IP7 G;  1WVL A;  2NVT B;  3SXH A;  3PIO 3;  3OIQ A;  3J7Z C;  3CD6 A;  3E0J A;  1PH1 A;  3GTQ H;  3QO2 A;  4PMC A;  2NB0 A;  4LFC L;  2PZW A;  1O7L A;  1H9S B;  1NNX A;  1PRT F;  2AMC B;  3STB C;  4HJ9 A;  4LWC A;  1EQR A;  4RCN A;  1J6Q A;  1IBK L;  1G2T A;  1BBU A;  1JCK B;  4GN4 B;  1ENA A;  1IBL Q;  5M5X B;  1KXL A;  1WTQ A;  4JI8 Q;  3HOU B;  5LMN W;  3HOX H;  1XMQ L;  1GHJ A;  4KV6 A;  1ENC A;  1Z47 A;  4BY7 B;  2O5I C;  2F0O A;  1N32 Q;  1CKO A;  2VXW A;  4X64 L;  3MXN B;  1YNJ D;  3S2D B;  1AEX A;  4HTH A;  4KKT A;  5LL6 X;  2F0K A;  3KF8 B;  5FLX E;  3NPP A;  3PSI A;  3TP8 A;  2B2T C;  4L5R C;  4E6I A;  1CT1 D;  1B9N A;  3SVM A;  3A0J A;  1IKL A;  5A2Q E;  4RH6 A;  5I9O A;  1E2W A;  1TS2 A;  2K32 A;  4Y7N H;  4IO9 A;  4A3L G;  2E5L Q;  1MJE A;  4X3S A;  4LUO A;  1H9R A;  2F0D A;  5CBE E;  2E74 C;  3PCO B;  1K3B C;  2WAQ G;  1JC7 A;  1PZI D;  3E9I A;  5CC4 A;  1M1K C;  1STH A;  4ODG A;  1STY A;  4DAM A;  1STG A;  4HIO A;  2XWB B;  1HA5 A;  4IPH A;  1TR5 A;  4JOI C;  1NTG A;  2FMC A;  5FLX L;  2K33 A;  3CC7 A;  3HOW G;  4K14 A;  2KQ3 A;  5A2Q L;  1GUW A;  1STA A;  1Q46 A;  3TRE A;  2RA4 A;  4DUY Q;  3HRZ C;  2CFM A;  2EY1 A;  5IOC A;  2N8N A;  4EGV A;  4DR4 Q;  1Q81 C;  3AFP A;  4P71 A;  3J81 j;  4B3M L;  2K5Q A;  3PO2 H;  3NTH A;  5COY A;  1BBW A;  3K59 A;  2RHQ B;  3H3V H;  4OO1 H;  2Q2H A;  3H3V I;  4OO1 I;  3OHX C;  1UAP A;  2RSO A;  1ROD A;  3PIP 3;  1G8Z D;  3I4N B;  4DF7 A;  1HUM A;  5C4J B;  2PZU A;  5GQO A;  2CW0 C;  5EPJ A;  2A19 A;  5C44 B;  1OO9 B;  1PYB A;  2Z1C A;  4JI7 L;  2WP8 J;  3KLW A;  1YHB A;  2I0Q A;  2JEA I;  4IUN A;  2FJ2 A;  2OEO A;  1VQF A;  4G7O C;  3GTM H;  3IRB A;  3N52 A;  2IWH A;  3OIP A;  2KUM A;  4ZKC B;  4G7Z C;  3MA2 B;  2O2L D;  1EIY B;  2EYO A;  1SNM A;  3IFD A;  5I6Y A;  3GTQ B;  4IUQ A;  3P20 A;  5DM7 3;  2CWP A;  2F0I A;  3RLF A;  1V1P A;  2HHH Q;  4UP9 A;  4Y52 H;  2AHO B;  5L37 A;  3M4Q A;  3TQY A;  4NKL A;  3JAM c;  2JA8 G;  4OGQ C;  3T53 B;  1D1I A;  3R2T A;  1OXX K;  5FO9 B;  2XRQ D;  1SSO A;  1EWC A;  4DV1 Q;  2ATW A;  3HOX B;  1A15 A;  1SMY D;  2O4X A;  2QF7 A;  4F7X A;  1GKH A;  3P1H A;  5EKI A;  1CM9 A;  4YWK A;  1PA6 A;  3M4O H;  2PI2 A;  5COR A;  4LF5 L;  1VF7 A;  2NVX B;  2Z6K A;  2UU9 L;  4AIM A;  1U5K A;  2Y0S G;  2JJQ A;  1RTO A;  1UEB A;  1O7I A;  4BS9 A;  2HIX A;  3VA7 A;  4LF4 Q;  5M3M B;  2Q8R E;  1CTM A;  4X3U A;  3ULP A;  4CJ0 B;  2JYO A;  2RVL A;  1KHI A;  1YEZ A;  3AU7 A;  1EWH A;  2SEB D;  4WRD A;  4Y7N B;  1YHA A;  3PIO A;  1JJ2 A;  3QJY A;  4BY1 G;  2DUD A;  1Q90 A;  1VQ9 A;  1HNZ L;  2KEC A;  5C0X G;  1UNS A;  4DUZ L;  5T1G A;  2GA4 B;  2I5L X;  4S3S A;  1ICW A;  3RMH A;  1JJG A;  2F3V A;  1SNC A;  4RKL A;  2IX1 A;  3K80 C;  2NN6 H;  2YTY A;  3GTO H;  2CVR A;  2EVB A;  3A8K E;  4JBJ A;  3NBI A;  4TRD A;  3TN2 A;  4HJ8 A;  3GP7 A;  4DR1 Q;  4GLX A;  4A3C H;  1C48 A;  1PH3 A;  2A69 C;  5C3E G;  1LTB D;  1SXT A;  4H02 A;  2ZTD A;  1BF4 A;  1QUQ B;  2UXB Q;  5EGT A;  2MQH A;  2UXD Q;  3DM3 A;  2F0V A;  4IOC A;  2B2Y C;  2PO4 A;  5DNF A;  1TS4 A;  3DEP A;  4XDX A;  2CQO A;  3P7J A;  1I4P A;  2LMC B;  1F2M A;  2M2L A;  2E2H B;  3H3V C;  2XTI A;  3I4M G;  3SK4 A;  2EIF A;  4NXM L;  5IP9 G;  2K5N A;  5NUC A;  5K5P A;  4CDF C;  5AJ3 L;  4NB3 A;  1LTT D;  2ENB A;  3TME A;  3VYT A;  3ZYY X;  4LF9 L;  4UY8 C;  3OPO A;  4A3D G;  1TWC H;  4GLV B;  2NTS A;  4DV4 L;  5JEA G;  2A74 C;  1WTH A;  2RDH A;  4X66 Q;  3RD4 A;  5CGK A;  4ZYS A;  1NR2 A;  4J1M A;  5BR8 Q;  2IHE A;  1NUC A;  1UUP A;  1N34 Q;  1ILP A;  4HID A;  1PH8 A;  1A2T A;  4GLA C;  4AYB E;  1KRS A;  1SNO A;  5IY0 A;  5IP7 H;  1PVO A;  1XMO Q;  3SK8 A;  1KIX A;  1NBW A;  1HHV A;  3ULJ A;  4N8X 1;  1GUN A;  1I4R A;  3TZU A;  1EFW A;  1JE5 A;  3CME A;  2QW7 A;  1PH9 A;  2EY2 A;  4LFA Q;  5CMD A;  1S5D D;  3H91 A;  1E0B A;  4DV6 Q;  2Z6B A;  3RNU A;  2KHI A;  2PNR C;  1TWF H;  2EQS A;  4APV A;  1MJC A;  3ND8 A;  3WOF A;  2A73 B;  2A5H A;  2KCC A;  1HFN A;  1HNX L;  3H0G B;  3BYT B;  3CCR A;  2L5T A;  5LMN Q;  1QNU A;  3KYH C;  5FLM G;  4DU9 A;  2OCE A;  3D4D A;  4C56 C;  1XWE A;  2RBM A;  4K6D A;  4KN7 C;  4DNT B;  1H95 A;  3EBE A;  1VMC A;  1EY5 A;  1WYD A;  4HCE A;  1XYI A;  3A55 A;  1VQJ A;  2WB1 E;  3CQZ H;  1ET6 A;  1M90 C;  1PZJ D;  3NTI A;  1GJX A;  4DN4 M;  2XSC A;  4QMG A;  2F52 A;  4RWS C;  3M4O B;  1GUT A;  4A3M G;  1D7Q A;  3W3A A;  3E0E A;  3I7F A;  1D5Z C;  2QKI C;  4JI1 Q;  4A3L H;  4DV2 L;  3BU2 A;  2MO0 A;  3NUC A;  1DXM A;  1YBY A;  3WOE A;  5FO8 B;  1LM0 A;  4OWT B;  4UPA A;  1HJP A;  1GVP A;  5D3D A;  3JC6 6;  3T51 B;  3S15 H;  4KN4 C;  1YJN A;  2EYP A;  1EZ6 A;  4CKE A;  1VQE A;  2B39 A;  4L6T B;  2G9H D;  4KLK A;  1G91 A;  1JWS D;  1JOR A;  2JXM B;  4DV7 Q;  2PCF B;  3D8G A;  1I6V C;  5GAG C;  1FR3 A;  1FNW A;  2UUA L;  5BN4 A;  2YV5 A;  3FEW X;  5EAY A;  2PNH A;  1QIL A;  1K3R A;  4QJF A;  3WDN A;  4OHJ A;  4LMQ D;  1WCM G;  3GTO B;  3E5S A;  3M3Y H;  4A3K H;  1QE6 A;  2JE6 I;  2PPB C;  3G4S A;  1ENF A;  2PMZ E;  3HOW H;  3CF5 A;  1WJJ A;  2I5M X;  2MJ8 A;  2EY5 A;  4DA2 A;  2JA5 B;  4RGT A;  2PQE A;  4HJ7 A;  3K5O A;  1EY6 A;  1SYE A;  4IPG A;  1NSN S;  2HDM A;  3I4O A;  3VR2 A;  4DV0 L;  3BZC A;  2EXD A;  1L0Y B;  3EFX D;  4IUP A;  4CKB A;  4LFC Q;  2PYK A;  1CFM A;  4IOA A;  1WFQ A;  4YY3 L;  5T1I A;  1WTR A;  4YWL A;  3R93 A;  1WI5 A;  1JWU D;  1NMG A;  1IYJ B;  3LNN A;  4LF7 L;  2AQ1 B;  3G48 A;  1K8A C;  5H1S E;  1NJI C;  1TWC B;  4DV3 L;  3RZD H;  3W1G A;  4L8J A;  2VQE Q;  4IPC A;  1XMQ Q;  1EIF A;  1YJW A;  4HCS A;  4EVO A;  5BN3 A;  1ZEQ X;  3AYH B;  4CJ2 C;  4X64 Q;  2GVB A;  1KAA A;  5E4W C;  1EQT A;  1XPR A;  1B7Y B;  4RHR A;  3KOJ A;  1X3F A;  3V2T A;  4PZ8 A;  3PO3 G;  1IYU A;  1UE1 A;  1I50 H;  1LUZ A;  1X6O A;  3FKI G;  5EBC A;  4UP8 A;  4HED A;  2CHB D;  2CW0 D;  1AZQ A;  2BDO A;  2KHS A;  4GNX C;  4FF2 A;  5EPK A;  1N33 L;  1TWF B;  3H09 A;  5IE8 A;  2I5H A;  3HKZ G;  5FKA C;  3NHH A;  1BNZ A;  2ZJR A;  2JA8 H;  4DFA A;  1LT6 D;  3W1B A;  1TU2 B;  1SYG A;  5M9O A;  4GNX B;  4TKO B;  4X3K A;  4N8F A;  1ZKO A;  1GUO A;  1TY0 A;  3DEO A;  3NBH B;  1K0S A;  2KCT A;  1KL9 A;  1HPC A;  5C4X B;  3A7A B;  1KAW A;  2A68 C;  2QDB A;  4O2D A;  4KKS A;  2D0O A;  5JPM C;  3B6Y A;  1Q8K A;  2F4I A;  4IFD I;  1PTO H;  4DR7 L;  5JVH 3;  1X9N A;  4DR5 L;  3EJI A;  4LFB L;  3CQZ B;  1MSG A;  1PFN A;  3S1Q H;  2SNM A;  1QNK A;  3FPU B;  2OWO A;  2GVA A;  1CSP A;  5C3X A;  1FVI A;  1Q12 A;  1EY9 A;  1D1K A;  4KJN A;  4RCO A;  1W6K A;  1B50 A;  1OXT A;  1K0R A;  4BY1 H;  4IQZ A;  3NEN A;  1CA6 A;  2I46 A;  5ELB A;  5C0X H;  4QIW E;  1F77 A;  1QB5 D;  2ZJP A;  3RUZ A;  4B3M Q;  5C0X I;  1LLR D;  2EYH A;  2WAQ B;  2CH4 W;  2L15 A;  5M5W B;  5IT9 E;  4XTC S;  5I6W A;  1EZ8 A;  3TSS A;  4QB4 A;  3AQQ A;  2WKC A;  5KGU A;  1CKN A;  4CJ1 B;  2B2U A;  3HZX A;  2DY8 A;  4AH6 A;  2JA7 G;  5C3E H;  4ME3 A;  1PFB A;  3T13 A;  3M3Y B;  4DK0 A;  4M1U B;  1EEF D;  1KNE A;  2WV6 D;  2HDL A;  2EOT A;  3HOW B;  5HGT A;  4JI7 Q;  3S24 A;  1LAB A;  3ICE A;  1HRJ A;  3DUZ A;  4B08 A;  1T5X D;  4AYB G;  4ZQ3 A;  2K5H A;  1YJ9 A;  3I4M H;  3NWT A;  4FXK C;  1S5B D;  5IP9 H;  2XWJ B;  1XX8 A;  1X32 A;  2A6H C;  4OIJ A;  4JVZ A;  3UDF A;  4ALP A;  3T16 A;  2A69 D;  3PUX A;  4A3D H;  2NZ1 D;  4DGZ A;  3F2U A;  5JEA H;  1Q86 C;  4QQB X;  1DYQ A;  3TP7 A;  1IW7 C;  2P5Z X;  4LF6 L;  2VS1 A;  3CKI B;  3PF5 A;  2R3Z A;  2ZXR A;  3R3O A;  4DAY A;  5JJI A;  3I4N H;  2DN8 A;  3RZD B;  1WTX A;  5JJZ A;  5JJL A;  1PFS A;  1RDP D;  4DV5 L;  2YU9 B;  3HOZ G;  1RCV D;  1EYD A;  3C1F A;  5IOD A;  4DAP A;  4BBS G;  2R6G A;  1SAP A;  3Q24 A;  1XTD A;  3GV3 A;  2F0F A;  1HXY D;  4LF5 Q;  1SE4 A;  3KBX A;  2R7Z G;  2UU9 Q;  4JC0 A;  4K2K A;  1LV9 A;  3L9A X;  1R4P B;  3D4W A;  1I50 B;  1V8Q A;  3HG9 A;  1I94 L;  1O80 A;  4ULL A;  2F0E A;  4RAU C;  3GV6 A;  1K9M C;  4G4K A;  5ELD A;  2B8G A;  3QWN A;  3DM1 A;  1X56 A;  5JAV A;  4IUV A;  2Q2U A;  5FLM H;  3HS0 C;  1HNZ Q;  4C3H G;  2JA8 B;  2BA1 A;  4YHH L;  4FF4 A;  2XIW A;  3SHL A;  4DUZ Q;  3CCQ A;  1FGU A;  2HCI A;  2F0W A;  2K5W A;  1PYW D;  4PZ7 A;  2BH2 A;  3PUY A;  4XXE A;  5JJK A;  1PTO C;  4FP5 D;  4HIM A;  2R61 A;  2C5C A;  3T56 B;  3HFZ B;  3TP5 A;  2LS0 1;  5C4X G;  1CI3 M;  4A3M H;  5DEH A;  4GKK L;  3ZJY C;  2Y0S B;  1PTO B;  2NVX H;  2LXJ A;  3UDI A;  1DOK A;  3S1Q B;  1U4L A;  1SMX A;  3CRL C;  3BDC A;  4WJ3 M;  3OWE B;  5M3M H;  1TKW B;  4CGY B;  2K5V A;  2E75 C;  4CKC A;  5ISR A;  2NUC A;  1SND A;  1VQH A;  4ZUJ A;  5KNC A;  2UXC L;  2VL6 A;  1EYA A;  1CHP D;  1U9R A;  4BY1 B;  5C3W A;  4RHS A;  1PH7 A;  4GKJ L;  4NXM Q;  3KF6 A;  2B2V A;  4ZUI A;  4GOP A;  5AJ3 Q;  5CBA E;  2N78 A;  4DR3 L;  2LY7 A;  3SK6 A;  1HNW L;  4LF9 Q;  4KHP L;  4POF A;  4DV4 Q;  3DWQ A;  3MWY W;  1XNR Q;  2IT1 A;  4HJ5 A;  1DCZ A;  2F0J A;  2K01 A;  4JG2 A;  4QF4 A;  5DAU A;  2L9H A;  1BVS A;  2NZH A;  3K58 A;  1PRT C;  5C3E B;  1DJR D;  2PW7 A;  5CV5 A;  2VW9 A;  2F0L A;  1F2Z A;  4Z9C B;  3BVG A;  3NEM A;  2WFW A;  3MFY A;  3FVQ A;  3GTG H;  3EIV A;  4OEM B;  4IUU A;  1WTP A;  1OXU A;  5KEE A;  2VUM G;  1K28 A;  4XQJ A;  3MXU A;  3M4P A;  3I4M B;  1PFM A;  4F87 A;  2E2H H;  3TBI B;  2PW5 A;  2RDG A;  4DNR B;  3CU7 A;  4CDE C;  1HQR D;  1V9P A;  4A3D B;  4K5V A;  1HNX Q;  1PMR A;  2BH8 A;  4O1N A;  2B2W A;  4R4Q A;  3FHW A;  3D3R A;  4R1J A;  3I55 A;  4JI4 L;  2ZXO A;  2DY7 A;  4A3G G;  3T1Y L;  1D5X C;  4FXG C;  2IX0 A;  1IL8 A;  1S40 A;  4JOI A;  2J0T D;  5I9P A;  4B3R L;  1XNQ L;  5FK9 C;  1BCP F;  1SN8 A;  3PO3 H;  1HCZ A;  1F9S A;  2LKV A;  1HZA A;  1S3O A;  2QDL A;  3FKI H;  1LAC A;  3I90 A;  3I73 A;  1E2V A;  1JT8 A;  5K36 G;  1FYC A;  3J81 c;  1N36 L;  1BXT A;  4ID6 A;  4DV2 Q;  2BA0 A;  3HOV G;  1EY8 A;  3CC2 A;  1F9R A;  2EZV A;  1V1P B;  2C9O A;  2A1A A;  2BCO A;  3H0G H;  1JOK A;  3K57 A;  4JPB W;  1WOC A;  2KHJ A;  1VQC A;  3F1Z A;  2L55 A;  3UDG A;  3J7A F;  2Z6K C;  2LXK A;  2UUA Q;  4X65 L;  4H7B A;  2GN5 A;  1ONL A;  1Q1B A;  1PDQ A;  1SDF A;  4LF8 Q;  4PV1 C;  2WII B;  5GAD C;  5CV6 A;  1EFI D;  4FDB A;  4R4O A;  5TSS A;  4KKU A;  2FHT A;  3K0X A;  4A3M B;  4IFD G;  1B2T A;  1I6H H;  2F0N A;  3VA5 A;  3SR1 A;  1DOM A;  3DWA A;  4A3F G;  2VY3 A;  2VB3 X;  3S2H H;  3QR8 A;  2A68 D;  1YNN C;  4DV0 Q;  3F8T A;  4XT1 B;  3OMC A;  2MO1 A;  1N8R C;  3MTS A;  2N55 A;  1Q82 C;  2H4O A;  1XXG A;  3AMU A;  5LHY 1;  3HOY G;  4LJZ C;  4YY3 Q;  2EE1 A;  1KTK A;  4C2M H;  2MP1 A;  1IHZ A;  2D5D A;  5GAH C;  4LF7 Q;  4JI0 L;  2K50 A;  1TWA B;  3UDX A;  2QEX A;  1E3P A;  4DV3 Q;  4A3J G;  5A35 A;  2JA7 H;  1WCM B;  1GM5 A;  4JI5 L;  2FIN B;  5CV8 A;  4B3T L;  2F0T A;  4A3E G;  4H0L C;  5ELC A;  4MHE A;  3E3X A;  1FD7 D;  2K04 A;  1S72 A;  1SE8 A;  4V0B A;  4A93 G;  2JA5 H;  2VB2 X;  2OTJ A;  3VDY A;  3GTP H;  1RKN A;  1SYF A;  3ERO A;  2WKD A;  3F2D A;  2BOS A;  1U4R A;  4PQX A;  3GTG B;  1K8G A;  1SE3 A;  1G51 A;  4C3I G;  4POG A;  1SYD A;  3L0O A;  2JA6 G;  3SEB A;  1SR3 A;  2K1B A;  5CR3 A;  1EL0 A;  3V05 A;  3PV0 A;  1N33 Q;  1AW7 A;  1S5C D;  5KYI A;  1L0W A;  4RA8 A;  1LTR D;  1HUN A;  3U50 C;  4R8N A;  1DOL A;  4PNY A;  4BBS H;  4K8I A;  3CCM A;  1Y1W G;  3K7A H;  2AQ3 B;  1JOQ A;  3SK5 A;  5J39 A; 
#chains in the Genus database with same CATH homology
 2JK8 A;  3W1G A;  3WWV A;  3S17 H;  2VQE Q;  4DV7 L;  1E24 A;  2KEN A;  4IPC A;  1KD1 C;  2R7Z H;  2R7F A;  1XMQ Q;  2HQL A;  1EIF A;  4GS3 A;  3U4Z A;  1YJW A;  5LMU Q;  4DR7 Q;  3RZO H;  1HH2 P;  3GTJ H;  3AYH B;  5J3B A;  4DR5 Q;  5C4J H;  4JBM A;  1PHJ A;  4LFB Q;  4KI0 A;  1KQS A;  4X64 Q;  2GVB A;  1W3S A;  2VNU D;  1VQN A;  5C44 H;  3OTO L;  3CXC A;  1B7Y B;  1XPR A;  2ASB A;  4NXN L;  3KOJ A;  1X3F A;  4A3B G;  3D0F A;  2KBN A;  4PZ8 A;  3PO3 G;  1UE1 A;  1I50 H;  1CKM A;  1LUZ A;  3K7U C;  3J80 c;  2ZM6 L;  1X6O A;  1UE7 A;  2ES2 A;  4KHZ A;  4P75 A;  3ULL A;  3FKI G;  4QGU A;  2PQA B;  5IP7 G;  1VCI A;  4UP8 A;  4C3H H;  1G6P A;  1X65 A;  3J7Z C;  4GNX C;  3CD6 A;  4P74 A;  1N33 L;  1YHQ A;  3U58 A;  1PH1 A;  2RCN A;  4JI2 L;  3GTQ H;  5IE8 A;  2I5H A;  3HKZ G;  4LFC L;  5HGQ A;  2VQF L;  5DLQ E;  4A76 A;  3TEH B;  4OX9 L;  2ZJR A;  2JA8 H;  4P72 A;  3W1B A;  1J5E L;  1X3E A;  2AMC B;  3STB C;  5C4X H;  3ERS X;  4GNX B;  1TWG H;  4HJ9 A;  2NVY H;  4LWC A;  4OXP A;  3UE0 A;  1AE3 A;  3T1H Q;  2F4V Q;  1EQR A;  3PUZ A;  1I3Q H;  3NBH B;  3STB D;  4A3I H;  1J6Q A;  2KCT A;  1KL9 A;  3UE1 A;  3DLL A;  1PV4 A;  1IBK L;  4K0K L;  1BBU A;  1YI2 A;  3GTK H;  1X3G A;  4GN4 B;  4O2D A;  1KAW A;  2AWO A;  1IBL Q;  1KXL A;  3PIP A;  4DK6 C;  2D0O A;  4JI8 Q;  1JJC B;  5LMN W;  1B8A A;  4BA2 I;  3HOX H;  3B6Y A;  2Z0S A;  4JV5 L;  1Q8K A;  4IFD I;  1D8L A;  1XMQ L;  4YCU A;  1Z47 A;  5LMU L;  4DR7 L;  3RR5 A;  5IYC H;  1X9N A;  3GD7 A;  4DR5 L;  4LFB L;  5E7N A;  1N32 Q;  1CKO A;  1GD7 A;  3S1Q H;  4X64 L;  3MXN B;  1VQA A;  3HOU G;  1LYL A;  2GVA A;  3CCU A;  5FLX c;  2OWO A;  2ID0 A;  3U4V A;  3KF8 B;  1CSP A;  3PSI A;  3EN2 A;  2Q2T A;  4BY7 G;  4L5R C;  1FVI A;  1Q12 A;  4NPS A;  1PH4 A;  1VQ8 A;  2YYZ A;  4JYA L;  1OXT A;  4HIK A;  1K0R A;  5JEA J;  4BY1 H;  3A0J A;  3NEN A;  1EYG A;  3FP9 A;  3TS0 A;  1FL0 A;  2MFI A;  5M5W H;  4QIW E;  5GRO A;  2ZJP A;  2MNA A;  4GN3 B;  1Z9F A;  4B3S Q;  4B3M Q;  4LF6 Q;  3TRZ A;  5C0X I;  4Y7N H;  3HKZ E;  3CCS A;  4IO9 A;  3NEL A;  1PH5 A;  4A3L G;  1C0A A;  3L7Z C;  2L15 A;  5IT9 c;  4AQY Q;  1MJE A;  2E5L Q;  4XTC S;  4LUO A;  1HR0 W;  3CCL A;  4DV5 Q;  3PCO B;  3AQQ A;  2FXQ A;  2WAQ G;  2ZTE A;  4YCV A;  2VZA A;  4DR2 Q;  1CKN A;  3KDF B;  4TVA B;  2DGY A;  2F4V L;  3T1H L;  1EUJ A;  4DK3 C;  3E9I A;  2K52 A;  4AH6 A;  4EQ5 A;  1M1K C;  2JA7 G;  5C3E H;  4ME3 A;  1Y1V G;  4DAM A;  4X62 Q;  2ZM6 Q;  2VUM H;  1IL2 A;  1IBL L;  3OYY A;  4HIO A;  4JI8 L;  4JI7 Q;  3S24 A;  3ICE A;  2D62 A;  5FJ8 G;  2NN6 I;  4MZ9 A;  4TQU S;  4IPH A;  4JOI C;  1NTG A;  3S14 H;  1RIP A;  4LUZ A;  1N32 L;  2CKZ B;  1I94 Q;  4AYB G;  5IYD H;  2K5H A;  3CC7 A;  1YJ9 A;  1XPO A;  3HOW G;  3I4M H;  3S16 H;  5IP9 H;  2E8G A;  1I5F A;  4JI6 Q;  1V43 A;  1K73 C;  5M5Y H;  1Q46 A;  3I56 A;  3GTL H;  3UDF A;  3TRE A;  4ALP A;  1B70 B;  3LGJ A;  4DUY Q;  3OW2 A;  4A3G H;  3PUX A;  4A3D H;  4JYA Q;  3HOZ H;  1HZ9 A;  2CFM A;  1QUQ A;  3D31 A;  1AH9 A;  2N8N A;  4JCV E;  4DR4 Q;  1Q81 C;  1Q86 C;  4QQB X;  2R93 G;  3AFP A;  4P71 A;  1IBK Q;  4IFD J;  4B3S L;  3J81 j;  4B3M L;  4PZ6 A;  4LF6 L;  1HZB A;  2VS1 A;  1VQP A;  3PO2 H;  3CP0 A;  2YU9 H;  3PF5 A;  1BBW A;  2AWN A;  4AQY L;  2E5L L;  2RHQ B;  3H3V H;  5JJI A;  2Q2H A;  3I4N H;  4O0A A;  2WAQ E;  1UE5 A;  2JQO A;  3H3V I;  4OO1 I;  5JJL A;  1PFS A;  4DV5 L;  1CSQ A;  1VQB A;  2ZTC A;  3HOZ G;  4DR2 L;  4GKK Q;  4BBS G;  1C7Y A;  2R6G A;  1C9O A;  3F2B A;  3A5Z B;  3F2C A;  1XTD A;  1XNR L;  4LUV A;  1P8L A;  5GQO A;  1X55 A;  3SGI A;  3HOV H;  3PO2 G;  4X62 L;  1SRU A;  3M9B A;  2A19 A;  4LF5 Q;  2R7Z G;  1PYB A;  2UU9 Q;  5C0X J;  4JC0 A;  4R4T A;  1VQD A;  3I4N G;  1DGS A;  4JI7 L;  2UXC Q;  1A62 A;  2KCM A;  2WP8 J;  2OQK A;  3KLW A;  1YHB A;  2I0Q A;  2ALY B;  5IWA Q;  1I94 L;  3RLO A;  2JEA I;  5C44 G;  4GKJ Q;  1V1Q A;  1K9M C;  1UE6 A;  1VQF A;  4PG3 A;  4DR3 Q;  4LNQ A;  3IRB A;  3GTM H;  2NZO A;  1HNW Q;  4JI6 L;  3G71 A;  1VQ6 A;  4R4I A;  1EIY B;  4KHP Q;  2ZJQ A;  1X56 A;  4DUY L;  2Q2U A;  5FLM H;  1HNZ Q;  1SFO H;  2BA1 A;  4YHH L;  2CWP A;  4DUZ Q;  3CCQ A;  1FGU A;  4DR4 L;  4PZ7 A;  3RLF A;  2BH2 A;  2N3S A;  3PUV A;  5IYB H;  2HHH Q;  3PUY A;  4UP9 A;  4Y52 H;  2AHO B;  5JJK A;  1JB7 A;  2OTL A;  3M4Q A;  3TQY A;  3JAM c;  2OQ0 A;  4HIM A;  2JA8 G;  2B63 H;  1CUK A;  3HFZ B;  4A3F H;  3K81 C;  3K8A A;  4DR6 Q;  1OXX K;  5C4X G;  3BJU A;  2F3I A;  4DV1 Q;  4BBR H;  2ATW A;  4A3M H;  4GKK L;  4QY7 A;  3ZJY C;  1JMC A;  2NVX H;  5M3F H;  1ASY A;  1MIU A;  2LXJ A;  3UDI A;  1GKH A;  1UWV A;  2YTV A;  4A3I G;  3HOY H;  2XGT A;  1SMX A;  4YWK A;  1PA6 A;  3M4O H;  2PI2 A;  3CAM A;  4LF5 L;  3W5O A;  4WJ3 M;  5BR8 L;  5M3M H;  2Z6K A;  3HOX G;  2UU9 L;  4EX5 A;  4WJ4 A;  4AIM A;  1U5K A;  2Y0S G;  1L2F A;  2K5V A;  2JJQ A;  1UEB A;  2CWA A;  1O7I A;  1G29 1;  1VQH A;  5IYC G;  4L5S A;  2HT1 A;  2Q2I A;  4MTN A;  2UXC L;  2VL6 A;  2HIX A;  2R7D A;  4LF4 Q;  1AE2 A;  1PH7 A;  4IJL A;  5IWA L;  4A3J H;  3ULP A;  4NXM Q;  3KF6 A;  4GKJ L;  4DNI A;  4GOP A;  2H5X A;  3A74 A;  5AJ3 Q;  4DR3 L;  1KHI A;  2N78 A;  1YEZ A;  1MKH A;  1HNW L;  1YHA A;  2YTX A;  3PIO A;  4A3E H;  4LF9 Q;  2R92 H;  1OXV A;  1JJ2 A;  5M3M G;  4RG1 A;  4BY1 G;  2DUD A;  4L5Q A;  3T1Y Q;  4LFA L;  4KHP L;  4POF A;  1VQ9 A;  1A63 A;  1QVF A;  4DV4 Q;  1HNZ L;  1K83 H;  3J80 i;  5C0X G;  3GDE A;  3CMA A;  1TWH H;  4DUZ L;  1XNR Q;  2IT1 A;  4HJ5 A;  1XNQ Q;  4BA1 I;  1ASZ A;  3G6E A;  2NVQ H;  2I5L X;  2HHH L;  1LTL A;  1L1O A;  4JG2 A;  1JJG A;  2HIV A;  2IX1 A;  4MNO A;  3K80 C;  1BVS A;  2NZH A;  2YTY A;  1KRT A;  2UUB Q;  3GTO H;  4C3I H;  3MEF A;  2V1C C;  2VW9 A;  4DR6 L;  2JA6 H;  1OXS C;  4JBJ A;  1NE3 A;  3NEM A;  4DV1 L;  1N36 Q;  4HJ8 A;  4DR1 Q;  2WFW A;  4LF8 L;  3S1N H;  3CW2 C;  4GLX A;  4A3C H;  1PH3 A;  3GTG H;  3EIV A;  1E1T A;  5HY6 A;  5GAE C;  5C3E G;  1OXU A;  4H02 A;  1VQI A;  2ZTD A;  1QZH A;  2VUM G;  1QUQ B;  2UXB Q;  1E1O A;  4BXX H;  2Y0S E;  3M4P A;  4YWM A;  1KC8 C;  2MQH A;  2UXD Q;  3DM3 A;  2B3G A;  3KDF A;  2UUC Q;  2E2H H;  4IOC A;  4YHH Q;  1QVG A;  1HZC A;  1P16 A;  2CQO A;  3M85 A;  1EWI A;  3JAM i;  4DAY B;  2RF4 A;  1V9P A;  5IYD G;  2XTI A;  1A8V A;  4RMF A;  4DKA C;  1VQM A;  4LF4 L;  1HNX Q;  3I4M G;  3KFU A;  2EIF A;  4NXM L;  2BH8 A;  4R4Q A;  2K5N A;  4DPG A;  5IP9 G;  5AJ3 L;  4IPD A;  4NB3 A;  4X65 Q;  3TS2 A;  3FHW A;  4R1J A;  3I55 A;  3ER0 A;  2D0P A;  4JI4 L;  4LF9 L;  2E2I H;  1VQG A;  4A3G G;  4UY8 C;  4A3D G;  1VQ4 A;  3T1Y L;  1TWC H;  4GLV B;  2IX0 A;  5ELO A;  4DV4 L;  1VQL A;  5JEA G;  1S40 A;  4JOI A;  1FJG Q;  4X66 Q;  4B3R L;  3CPF A;  1EOV A;  1XNQ L;  4A3B H;  3PF4 A;  5BR8 Q;  1SN8 A;  3PO3 H;  2IHE A;  1N34 Q;  4OO1 G;  4HID A;  1PH8 A;  2C35 B;  1HZA A;  1S3O A;  2UUB L;  1SRO A;  3FKI H;  4GLA C;  4AYB E;  4R4C A;  1KRS A;  2WB1 G;  5IY0 A;  2AKW B;  5IP7 H;  1IZ6 A;  4UP7 A;  1IBM Q;  5K36 G;  1X54 A;  1PVO A;  1JT8 A;  4HJA A;  1XMO Q;  4A75 A;  3CCE A;  3J81 c;  1Q7Y C;  1KIX A;  1NBW A;  1QVC A;  3ULJ A;  1N36 L;  4DR1 L;  4JBK A;  1OTC A;  3AFQ A;  2K14 A;  4DV2 Q;  1EFW A;  1JE5 A;  2BA0 A;  2IY5 B;  2QA4 A;  2R93 H;  3CME A;  1PH9 A;  3HOV G;  1Y14 B;  1PH6 A;  2UXB L;  2NVT H;  4LFA Q;  1E22 A;  3CC2 A;  2UXD L;  4X6A H;  2UUC L;  1VQO A;  4IJH A;  2A1A A;  4DV6 Q;  1BKB A;  3RNU A;  4JI0 Q;  2KHI A;  2QGQ A;  3H0G H;  1TWF H;  4OWW B;  2EQS A;  4APV A;  3CPW A;  3J7A 5;  1T9H A;  1E7Z A;  1MJC A;  4A4I A;  1WOC A;  2PQA A;  4JI5 Q;  2KHJ A;  1VQC A;  1HNX L;  3F1Z A;  4J15 A;  3UDG A;  2Z6K C;  2LXK A;  4B3T Q;  2UUA Q;  3Q8D A;  4X65 L;  3RN5 A;  3CCR A;  2GN5 A;  5LMN Q;  2K4K A;  1Q1B A;  3KYH C;  5FLM G;  3CCJ A;  3KJP A;  4JI3 Q;  4LF8 Q;  2OCE A;  1R9T H;  5GAD C;  4PMW A;  3H0G G;  5M5X H;  4XIG S;  4GOP C;  3HOU H;  4JBW A;  5IYB G;  4X66 L;  4FDB A;  1FJG L;  1YVC A;  4R4O A;  5ELN A;  3EBE A;  4GNX A;  1YNX A;  1H95 A;  3K0X A;  1WYD A;  4IFD G;  2N49 A;  1I6H H;  4BY7 H;  1N9W A;  1VQJ A;  2WB1 E;  3CQZ H;  1M90 C;  1N34 L;  2B63 G;  2A8V A;  3BZK A;  2VQE L;  4LW1 A;  4A3F G;  2VY3 A;  3S2D H;  2F52 A;  3KF6 B;  3S2H H;  4GOP B;  1GO3 E;  4GN5 A;  4DV0 Q;  3F8T A;  4BBR G;  1IBM L;  4A3M G;  2MO1 A;  1N8R C;  1XMO L;  1D7Q A;  3E0E A;  5M3F G;  3I7F A;  1L1O C;  1Q82 C;  4JI1 Q;  2B29 A;  4A3L H;  4DV2 L;  3BU2 A;  3E9H A;  3RN2 A;  1VQ5 A;  3GO5 A;  3HOY G;  2IHF A;  2MO0 A;  4YY3 Q;  1CKN B;  1YBY A;  4JI4 Q;  1TWA H;  4YCW A;  3S1M H;  1LM0 A;  4OWT B;  4UPA A;  1HJP A;  4C2M H;  1GVP A;  5GAH C;  1HR0 Q;  3JC6 6;  1WCM H;  4A93 H;  4LF7 Q;  3PGZ A;  3S15 H;  1U0L A;  4P73 A;  4DV6 L;  1L1O B;  1YJN A;  4JI0 L;  1TXY A;  4B3R Q;  2K50 A;  1VQE A;  2JEB I;  3CCV A;  3UDX A;  2QEX A;  1E3P A;  4DV3 Q;  4A3J G;  4KLK A;  2JA7 H;  1IXR A;  1GM5 A;  4JI5 L;  1Y1V H;  1W2B A;  4DV7 Q;  1XJV A;  5GAG C;  2CCZ A;  3J81 i;  4B3T L;  2UUA L;  1NMF A;  2YV5 A;  4A3E G;  5EAY A;  2R92 G;  2PNH A;  4QJF A;  1K3R A;  5FJ8 H;  5LMN L;  1PH2 A;  1S72 A;  1SE8 A;  1A0I A;  1WCM G;  4JI3 L;  4OON A;  1VQK A;  3VDY A;  2JA5 H;  3M3Y H;  4A3K H;  4A93 G;  2OTJ A;  3OTO Q;  1SLJ A;  2JE6 I;  3G4S A;  4NXN Q;  3HOW H;  2PMZ E;  3GTP H;  3CF5 A;  1PYS B;  1WJJ A;  2I5M X;  3F2D A;  2RHS B;  1YIT A;  2LSS A;  4HJ7 A;  2PI2 E;  2NN6 G;  3PUW A;  3A5U A;  1YZ6 A;  3S1R H;  3L2P A;  4IPG A;  1K8G A;  1VQ7 A;  1G51 A;  3I2Z A;  3RLN A;  1VS0 A;  4POG A;  3I4O A;  3L0O A;  1Q1E A;  2JA6 G;  4L5T A;  3KJO A;  1Y1W H;  1SR3 A;  1NY4 A;  4DV0 L;  2JA5 G;  1RL2 A;  1YIJ A;  4QL5 A;  3BZC A;  4A3K G;  1EQQ A;  4A3C G;  2EXD A;  3PV0 A;  1N33 Q;  1QZG A;  4JI2 Q;  4JV5 Q;  4JI1 L;  4LFC Q;  2VQF Q;  4OX9 Q;  3HKS A;  1L0W A;  2K75 A;  2JA9 A;  4BXX G;  1WFQ A;  4YY3 L;  4IOA A;  4YWL A;  1J5E Q;  1WI5 A;  3U50 C;  3CC4 A;  1NMG A;  3M7N A;  1IYJ B;  1HR0 L;  3AEV A;  4LF7 L;  4BBS H;  1XPU A;  4C3J H;  3G48 A;  3H15 A;  3CCM A;  1Y1W G;  3K7A H;  1K8A C;  5H1S E;  1NJI C;  2E2J H;  4K0K Q;  4OWX B;  4DV3 L;  3RZD H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...