4JI3Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3Q00
1EUJA 3CCRA 4LUVA 3GDEA 3CMEA 1L1OB 1UE5A 1HNXQ 3S14H 2UXBL 3S1RH 3G71A 5JEAJ 2UUCQ 2ES2A 4GN3B 1SFOH 1HNXL 3S24A 3ICEA 3I4MH 5IP7H 1YIJA 2UUCL 4YCUA 4LFAQ 1I94Q 2QA4A 2UXDQ 2F3IA 4NXMQ 1FL0A 3Q8DA 1JB7A 4JCVE 3CD6A 4HJAA 3FKIG 1I94L 4LFAL 4A3KG 4IFDJ 2UXDL 4NXML 3U4ZA 4J15A 4DV0Q 3K81C 3KOJA 3ULJA 4POFA 1EQQA 4GLXA 2PMZE 3AFQA 1PH4A 1MJEA 2YU9H 4LWCA 1TWCH 4DV0L 1XMQQ 2PQAA 3GTOH 1AE3A 5LMNQ 3GTPH 2YTVA 3B6YA 3W1BA 2D0OA 5M3FH 2Y0SG 1QUQB 4QY7A 4DPGA 3CCJA 1XMQL 3UDXA 2NZOA 5LMNL 4A3MG 3HOWH 2OWOA 1YJWA 4C3IH 1M90C 1X54A 1H95A 2R93H 2RHQB 3JAMc 4HJ9A 2NVXH 3G48A 3AYHB 4AH6A 1HZAA 3D0FA 2IT1A 4P75A 3PO3H 4X64Q 3STBC 1PFSA 4EX5A 5IYBG 2K4KA 5JJKA 3HKSA 3PO2G 4X64L 4JI8Q 3E9IA 4X6AH 3JC66 2HHHQ 2N8NA 1RL2A 3KF8B 2VZAA 3RN2A 4JI8L 1KL9A 2JK8A 4OXPA 3UDIA 2HHHL 2JA5H 4IO9A 2KENA 4YWMA 2Y0SE 2YTXA 1SRUA 4L5SA 1IYJB 4KI0A 3M4QA 3D31A 3A5UA 3K0XA 2IX0A 1TWHH 3RLOA 2VQEQ 4BBSH 1KXLA 3S1MH 4GOPA 2LXKA 2RCNA 1VQNA 3BZCA 5IE8A 4DK6C 4A3EG 2VQEL 2D62A 4P73A 1PYSB 4LF6Q 2JEAI 2A19A 4OONA 2UXCQ 1IBKQ 4R4TA 1VQ7A 2EQSA 4LF6L 1LYLA 1PH3A 1PH9A 1KQSA 1JJ2A 2E5LQ 2NVQH 2UXCL 2ALYB 3H3VI 1S3OA 1IBKL 4LFCQ 3I2ZA 1J6QA 2IHFA 3KF6A 3KJPA 1BBUA 2E5LL 1L0WA 2E2JH 4LFCL 1VQFA 1PH2A 1HZBA 3J81c 1S40A 1A0IA 1AE2A 2MNAA 2WFWA 4X66Q 2AKWB 3GTJH 1T9HA 4OWWB 4A3LH 4YHHQ 3A74A 4X66L 1K9MC 4IPDA 1LM0A 4LF9Q 4YHHL 4JV5Q 4DAYB 4BA1I 4DK3C 4JV5L 3OTOQ 1VQMA 2K75A 4QQBX 1CSQA 3AEVA 1A62A 3CCEA 2OTLA 4NPSA 3OTOL 2JA5G 5IYDH 4IOCA 4LUZA 5C4XH 4A3FH 1PYBA 2B29A 1W3SA 2WB1G 1HH2P 3L0OA 4UP8A 3W5OA 4KLKA 4P74A 1NJIC 4RG1A 5M3MG 4GNXA 4QJFA 4C3HH 1N32Q 4BXXG 1L1OA 1E7ZA 2AWOA 4B3MQ 1PH7A 1WYDA 5IP9H 3H0GG 4A3BH 4AIMA 1JJCB 4O2DA 1HR0W 3M4PA 4B3ML 1WCMH 5C44H 2BH8A 3K7AH 3E0EA 3MXNB 1WFQA 3HOUG 1X56A 1VQEA 5C3EG 4FDBA 1AH9A 2N78A 1VQCA 4A3JH 2UUBQ 4DR4Q 1E1OA 1EIFA 1E22A 1YJNA 4MNOA 5C0XG 1Q86C 3AFPA 2UUBL 2CQOA 4DR4L 2GN5A 1X3GA 5M5WH 3KDFB 4IPHA 2R6GA 3CXCA 4R4CA 2K5VA 3CC7A 3FHWA 3GTKH 3HOVG 5GAEC 1HZCA 3PF5A 5IWAQ 1QZGA 2JA8H 5ELOA 1Y1VH 2OCEA 4A3LG 3CCSA 2B3GA 1X9NA 2JA6G 1XJVA 5IWAL 1P8LA 4HIOA 4A3CH 1VCIA 1ASYA 3HOYH 4P71A 3I4NH 4OO1G 1I50H 1JT8A 3EBEA 4GS3A 5GAHC 4JI5L 4OWTB 4JI1Q 3PIOA 3S16H 1N9WA 1U5KA 2JJQA 5IYDG 4UP7A 5E7NA 4JI1L 3GTMH 4A3DG 3CMAA 3J80i 4BBRG 1JJGA 1XNRQ 3U50C 3OYYA 2VW9A 4MTNA 3RNUA 4P72A 1I5FA 4BY1G 2QGQA 4Y7NH 4GKKQ 1XNRL 1NTGA 3UE1A 2IX1A 1KRSA 3PV0A 3CCQA 1S72A 2IY5B 4YWLA 3RZDH 4GKKL 4IOAA 4HIDA 3EN2A 2VS1A 3WWVA 1Q1BA 1PHJA 4DNIA 2Z6KA 4JBKA 1KD1C 1VQ8A 1CKNB 1I6HH 4OWXB 1CKMA 2MO0A 4A3JG 2K50A 4XTCS 1A63A 2CFMA 4IPGA 1MIUA 1V9PA 2WP8J 1V43A 2B63G 5JEAG 3SGIA 3HOZH 2BA0A 1YEZA 1OXTA 2LXJA 4YWKA 4JI2Q 4APVA 2R92G 2R7ZH 1NE3A 4A3IG 1VQJA 2DGYA 1VQGA 1Y1VG 2ID0A 4JI2L 4IFDG 3L7ZC 3K8AA 3MEFA 4LF4Q 3CC2A 1KAWA 1HZ9A 5M5XH 2OTJA 3U4VA 4TQUS 1QZHA 1G51A 1GVPA 3NELA 4LF4L 2F4VQ 4HJ5A 4X65Q 1HNWQ 3TREA 5FLMH 1UE7A 3M3YH 1C0AA 4DR2Q 1Y1WH 1K3RA 1OXUA 2F4VL 5IP7G 3I4MG 4X65L 3DM3A 1M1KC 1HNWL 4JYAQ 2C35B 3KLWA 2F52A 3M9BA 4DR2L 4LNQA 1N36Q 3S15H 5HY6A 2ASBA 2WAQG 4JYAL 3KYHC 1N36L 3UDGA 4R4IA 1QVCA 3KFUA 1SLJA 1E1TA 4MZ9A 3HKZG 3OW2A 2ZTEA 3RLFA 4QGUA 1VQPA 3ER0A 4DUZQ 5FJ8H 2AWNA 4L5RC 3F2CA 1DGSA 4JBMA 1OXSC 5M3FG 1E24A 4DUZL 3HOXH 1PH8A 1EWIA 1UE1A 3JAMi 1VQKA 1X6OA 2I5MX 3HOWG 2D0PA 3CF5A 2YYZA 2VL6A 4A75A 1YITA 2JA7H 3S2HH 4LW1A 4A93H 3ULLA 2R93G 1I3QH 3BJUA 1K8GA 4A3GH 1G6PA 4QL5A 1UEBA 4KHPQ 3CW2C 4L5TA 3PO3G 1D7QA 5J3BA 1YVCA 1YI2A 2WAQE 4A4IA 4DV1Q 3VDYA 1GM5A 3RR5A 4KHPL 1RIPA 1PH1A 4YCVA 3HKZE 4DV1L 1FJGQ 4B3SQ 3NENA 1MJCA 1SROA 1Q7YC 1HNZQ 4POGA 1FJGL 2N49A 2KBNA 1L2FA 1N8RC 1BBWA 4R4OA 5LMNW 1KIXA 4B3SL 4LF5Q 2BH2A 1B8AA 1K73C 2ZJQA 1HNZL 4DR6Q 4Y52H 1K0RA 5BR8Q 2A8VA 2ZJPA 4LF5L 3UE0A 4UP9A 2JQOA 3CQZH 4DV6Q 2EXDA 4BBSG 4DR6L 5BR8L 1IBLL 4LF8Q 2KHIA 4H02A 1PA6A 4TVAB 3CPFA 4DV6L 2Z6KC 1X65A 4C2MH 1XPRA 4XIGS 1FVIA 4JOIA 3RLNA 4GOPB 4LF8L 1GD7A 3H3VH 1Z9FA 2XGTA 4GKJQ 1JE5A 4DV2Q 2N3SA 3NBHB 4GLAC 2NN6G 1EFWA 3J81i 2PNHA 4GKJL 4PMWA 3T1YQ 1Q81C 4EQ5A 3PUZA 2HQLA 4DV2L 2ZJRA 1YHQA 1VQLA 3FKIH 1NY4A 3I7FA 4A3KH 1XPOA 3PIPA 3GTGH 3T1YL 2OQ0A 1X3FA 3PGZA 4PZ7A 5GQOA 5M5YH 1EQRA 1OXVA 2WB1E 3G4SA 1NMFA 4DR1Q 2ZTDA 3J80c 4DR3L 3UDFA 4JI4L 2GVAA 1QUQA 1E3PA 2NVTH 1P16A 3F2BA 1CKNA 4DR1L 1Q12A 3J81j 5JJIA 5DLQE 3M4OH 1HJPA 2ZTCA 3IRBA 4R4QA 3RZOH 2QEXA 2Q2TA 4WJ3M 4A3MH 1YHBA 4JI5Q 5GROA 2NZHA 3F8TA 5FLXc 3STBD 3TS0A 2CKZB 2UU9Q 4JI4Q 3I4OA 1EYGA 2JE6I 1K83H 3DLLA 5K36G 4GOPC 2K5HA 3BU2A 4GLVB 2UU9L 5C4XG 4A3FG 1G291 4ALPA 1X55A 1VQ4A 3GTQH 5IYBH 2MQHA 4HJ8A 4HIKA 4DV3Q 2Z0SA 3CAMA 2BA1A 2LSSA 3T1HQ 2RHSB 4DV3L 2EIFA 3PUWA 2HIVA 1KHIA 2V1CC 3T1HL 4PZ8A 5IP9G 3PUVA 1XTDA 1YHAA 5AJ3Q 3CCUA 4A3BG 2I0QA 1WCMG 3W1GA 1B7YB 5IT9c 5C44G 1KC8C 4BY7H 5AJ3L 4LUOA 2FXQA 3PUYA 1PVOA 4A76A 1Q82C 4OX9Q 4GN4B 1JMCA 3LGJA 1HR0Q 1BKBA 1SR3A 4A3EH 1SE8A 4NXNQ 4JC0A 4DV5Q 4OX9L 2XTIA 1HR0L 3H15A 1WOCA 1YZ6A 1CSPA 5EAYA 2Q2IA 4NXNL 4DV5L 1YBYA 3L2PA 4JI0Q 3S2DH 4JG2A 1Q1EA 3PF4A 1CKOA 2JA8G 4B3RQ 1EOVA 1PH6A 1IZ6A 1VQ9A 4JBJA 4K0KQ 1WJJA 4JI0L 1MKHA 2NN6I 4JBWA 1OTCA 4B3RL 1VQDA 1B70B 2YV5A 5C0XI 2JEBI 2ZM6Q 3CC4A 4DR7Q 3CCVA 4A3CG 2CWPA 4DUYQ 3HOYG 4K0KL 3I4NG 1BVSA 4GN5A 3S1NH 4GNXC 1KRTA 2ZM6L 4DR7L 4DAMA 5IYCH 3M85A 4DUYL 2KHJA 3S1QH 1L1OC 3KJOA 2AMCB 3G6EA 2KCMA 3TEHB 3ERSX 4DR5Q 1XMOQ 4KHZA 1TWGH 4JI7Q 1A8VA 3GD7A 1VQ6A 4JOIC 1EIYB 5IY0A 1NBWA 4DR5L 1XMOL 3GTLH 2VNUD 5C4JH 2E2IH 3F1ZA 1CUKA 1Y14B 1SMXA 3I56A 2VQFQ 4DV4Q 4JI7L 4OO1I 1LUZA 1VQHA 2VQFL 4DV4L 4B3TQ 1QVFA 1Q8KA 3ULPA 2Q2UA 4B3TL 1PV4A 4UY8C 4IJLA 4HJ7A 5M3MH 4BY7G 2PQAB 1N33Q 4RMFA 1VQ5A 1C7YA 2VUMH 4L5QA 4BXXH 3U58A 2AHOB 4AYBG 1N33L 4QIWE 3TQYA 3CPWA 4LFBQ 3H0GH 2L15A 2K52A 1VQIA 5GADC 5ELNA 3BZKA 5HGQA 1XNQQ 2I5LX 3HOZG 5GAGC 1D8LA 4LFBL 3PSIA 1R9TH 1IBMQ 3HOUH 5C3EH 4HIMA 1QVGA 2I5HA 2E8GA 4IPCA 3K7UC 2R7ZG 1XNQL 2IHEA 2R7FA 3J7A5 1TWFH 1IBML 1K8AC 1W2BA 3KDFA 3AQQA 4DV7Q 1X3EA 2K14A 2KCTA 4O0AA 2HIXA 2E2HH 4DKAC 4DV7L 2A1AA 3FP9A 1GKHA 4YY3Q 3HOVH 5IYCG 5FLMG 1IBLQ 3M7NA 3A0JA 1Y1WG 4YY3L 1YJ9A 4AYBE 2JA6H 2PI2A 2JA9A 1IXRA 3F2DA 4IFDI 2Q2HA 4PZ6A 2OQKA 1VS0A 2VY3A 3HFZB 3A5ZB 2YTYA 4R1JA 3GO5A 4LF9L 1TXYA 1U0LA 5C0XJ 2ATWA 4BA2I 1ASZA 3RN5A 1N34Q 3CCMA 2HT1A 4UPAA 2MO1A 4IJHA 3NEMA 4X62Q 1XPUA 3TS2A 5H1SE 1NMGA 1N34L 5FJ8G 4YCWA 1TWAH 4A3DH 4X62L 3ZJYC 4BBRH 4DR3Q 2UUAQ 3HOXG 4LF7Q 3PCOB 4C3JH 1VQOA 3KF6B 1OXXK 1J5EQ 4BY1H 2JA7G 5JJLA 3PUXA 2VUMG 2K5NA 4LF7L 2UUAL 3EIVA 2CWAA 1J5EL 4A93G 1PH5A 3TRZA 4A3GG 1N32L 4JI6Q 3CCLA 2R7DA 4NB3A 4JI3Q 1IL2A 3CP0A 4JI6L 4WJ4A 3I55A 1VQBA 4JI3L 2RF4A 3S17H 3K80C 2DUDA 3J7ZC 3E9HA 2B63H 1Z47A 2MFIA 1LTLA 1UWVA 5LMUQ 1YNXA 1O7IA 1WI5A 1C9OA 2R92H 3PO2H 1SN8A 4PG3A 4A3IH 1GO3E 1VQAA 2GVBA 4ME3A 1V1QA 1UE6A 5LMUL 4AQYQ 1Q46A 2NVYH 2CCZA 2PI2E 4AQYL 4GNXB 2H5XA 1FGUA 2UXBQ
chains in the Genus database with same CATH superfamily
3CCRA 4LUVA 4X3SA 3G71A 2UUCQ 2CH4A 1RODA 3SXHA 5I6YA 1JWSD 4LFAQ 5KNCA 1FL0A 3VYRA 1JB7A 4JCVE 3CD6A 3FKIG 4K5WA 2Q8TA 1PRTF 4FXDA 4J15A 4DV0Q 3K81C 3ULJA 3AFQA 4LWCA 1TWAB 4A3DB 2O2LD 2YTVA 4BBRB 2Y0SG 4C3JB 1KDCA 3CCJA 1EY5A 1I4RA 4BY1B 2DNCA 4CKBA 1X54A 3G48A 4RGTA 2IT1A 4P75A 4CHTB 5E4XA 4X64Q 1PMRA 3S17B 2F0GA 3PO2G 3SR1A 3JC66 3SVMA 3BYYB 1D1KA 2EPBA 3KF8B 2VZAA 4OXPA 4M8AA 2MGSA 3KLRA 2HHHL 1RHPA 4LK1C 5FK9C 2HCIA 2Y0SE 2YTXA 4IUUA 4G7HC 3PO2B 1IYJB 4A3IB 1HQRD 1Y1VB 1MGSA 3M4QA 2TMPA 3D31A 2NVYB 3OPOA 2A69C 5IIFA 5IE8A 4U68A 2D62A 2JEAI 1PYSB 1MD2D 1WTQA 1ENAA 4QIWB 3V96A 2XVSA 4LF6L 3I4MB 2EYHA 1LYLA 1KQSA 1STBA 5E1FA 2A68D 2UXCL 2ALYB 3H3VI 1IBKL 1J6QA 1F2MA 3KF6A 2WAQB 2E2JH 2Z6BA 1PH2A 2WFWA 3GTJH 2YU9B 4FF3A 4YHHQ 4NKLA 1XX8A 5BN4A 2KHSA 2F0PA 4BA1I 4S3SA 1G2TA 2DN8A 4JV5L 2K75A 3BVZA 1PFMA 1PYWD 2XNAC 3CCEA 2OTLA 3PO3B 5KYLA 2JA5G 5IYDH 3NQTA 1W3SA 3ND8A 1HH2P 3L0OA 2PW7A 4RH6A 4RG1A 4QJFA 4C3HH 4FP5D 1BXTA 1E7ZA 2F03A 2JA5B 2KCNA 2AWOA 1PH7A 3MEHA 5IP9H 3H0GG 4A3BH 3E0EA 1EYAA 1X56A 2RVLA 2N78A 1TS2A 1E22A 3DWAA 2UUBL 3I70A 1ZYRD 4H13C 5EKLA 2CQAA 2MPMA 3CC7A 3Q0AA 1EY0A 1JWMD 3GTKH 3HOVG 1UNSA 4ZKCB 4A3LG 5IWAQ 4K5VA 2OCEA 3CCSA 2B3GA 4UDUC 2IL8A 4RGOS 3D6WA 4DNTB 1Y69U 4OWTB 4JI1Q 1N9WA 2JJQA 2B39A 2CVRA 2PCFB 1JJGA 4FF4A 3OYYA 2VW9A 4P72A 1I5FA 2LY7A 4DA2A 5ELFA 1KRSA 3S9WA 3FMCA 2IY5B 4YWLA 3RZDH 4GKKL 4HIDA 2A69D 4QMGA 5J1ZA 3R93A 3CRLC 2RDHA 2LS01 3IAYA 3P20A 1CKMA 3QR8A 4XTCS 2CFMA 3EQLC 1MIUA 1KTKA 2B63G 2F0JA 1WCMB 3J81L 1YEZA 2K05A 1LT4D 4APVA 2R92G 1S5DD 1V1PB 1STYA 3BDLA 5CV4A 4IFDG 3L7ZC 3EROA 5EGTA 5M5WB 3MEFA 1WD1A 3CC2A 5M5XH 3AB9A 4WORA 1A15A 2K28A 3L9AX 4TQUS 1SNMA 5D65A 3E5SA 1PDQA 4TSSA 4BWGB 1C0AA 4DAYA 1Y1WH 2F4VL 1K8MA 2EVBA 2F0IA 5HY6A 3I4NB 5C3XA 1N36L 1SLJA 1E1TA 4MZ9A 3S16B 1F2YA 1ENFA 2K33A 5FJ8H 5CV9A 2F0SA 3F2CA 1DGSA 4JBMA 2PQEA 2HUGA 3HOXH 3GP7A 3PQIA 1X6OA 2I5MX 5CV6A 3MA2B 4C1NI 3CF5A 4A75A 3ULLA 4FF1A 3MXNA 1K8GA 1G6PA 4ZK9B 3A8IE 1B3AA 3CW2C 5J3BA 2NZ1D 1GM5A 5EBDA 2QILA 1S5CD 5IGDA 1H9SB 2OXPA 1MJCA 2FHTA 4POGA 1FJGL 2CW0D 2R7ZB 2KBNA 1N8RC 5E4WC 4LF5Q 3A8JE 3IKJA 5EJWA 4DR6Q 2A8VA 2ZJPA 2JQOA 3CQZH 2EXDA 1BR9A 2Z8LA 5BR8L 1FR3A 4H02A 3CPFA 2Z6KC 4JOIA 3RLNA 3M3YB 4RFBA 4OGQC 3VR6A 1JE5A 5CV8A 3HS0C 1SXTA 2N3SA 4GLAC 1B44D 3S15B 2F3VA 2K04A 2VB3X 4PMWA 3VR5A 3T1YQ 4EQ5A 1U4PA 2HQLA 1KAAA 5CORA 2OQ0A 5LMNW 2WB1E 4LAAA 1GUOA 1V8QA 3UDFA 2EOTA 5EKIA 3LWEA 1CKNA 1Q12A 5TSSA 4B9WA 4KY6A 4XT3B 3IRBA 3RZOH 2QEXA 2Q2TA 4A3MH 5IGEA 4XQJA 4A93B 5LL6S 3F8TA 2CKZB 3K0YA 1O80A 1PLFA 1ET6A 2UU9L 3K59A 1G291 4ALPA 4G7ZC 1X55A 2RSNA 2NTTA 1VQ4A 3GTQH 2MQHA 2WACA 4HIKA 4DV3Q 2Z0SA 3CAMA 5DAUA 2RHSB 4C3HG 3PUWA 2HIVA 5ISRA 4UHVA 2V1CC 5IP9G 3PUVA 1TU2B 4A3BG 3NTIA 1CK1A 1G2SA 1HCZA 5AJ3L 2FXQA 4OX9Q 3LGJA 1WTHA 3FPPA 3K6OA 1BKBA 1DOKA 1SR3A 4A3EH 1SE8A 4NXNQ 4JC0A 3H15A 1M8AA 5JAVA 1AEXA 1EYDA 2EY5A 2Q2IA 4DV5L 3BVMA 2A5HA 1PTOC 1STHA 3VYSA 1PH6A 2HCCA 1WJJA 1WD0A 3OW7A 1MKHA 1F2ZA 1OTCA 3GTGB 4B3RL 4N9TA 2CWPA 1M4VA 1V1OA 4GNXC 2ZM6L 4DR7L 4DAMA 4DUYL 2KHJA 3SK6A 1QILA 1NUCA 3M4OB 1MBYA 2M00A 1LTBD 1X3PA 3ERSX 1XMOQ 3OMGA 2NWGA 1EIYB 5IY0A 4DR5L 4H44C 4DXFA 1CUKA 3T16A 4DV4Q 1U4MA 1BO0A 2B2WA 4PNYA 4CDDC 3ULPA 2Q2UA 4KN7C 4Q5VA 2IW3A 1K3BC 2VUMH 4BXXH 3EJIA 4RHRA 3G7LA 3TQYA 3CPWA 1VQIA 4MN3A 1R4QB 5ELNA 1I4XA 2EZVA 1D8LA 2OEOA 1R9TH 3J80L 4IPCA 5EPLA 4K2KA 2DY8A 1QCBD 5HGTA 1W2BA 1MSHA 1HPCA 2KCTA 2HIXA 1K28A 4ZYSA 2A1AA 3FP9A 3BVGA 4OELB 1Q90A 2QCPX 2L9HA 3A0JA 1Y1WG 2HDMA 1YJ9A 3NWTA 1BUVT 2Q2HA 2VY3A 4RAUC 4KJOA 4ZRZA 1TXYA 1U0LA 2X6LA 2AUKA 1GHJA 3CCMA 3D6CA 3NEMA 1XPUA 3TS2A 1JOQA 1NMGA 1N34L 5FJ8G 4YCWA 2Z4HA 1TWAH 4A3DH 4X62L 1B1ZA 3GTLB 2K5QA 4BBRH 4DK0A 4DR3Q 3HOXG 4C3JH 1SJHD 1VQOA 3KF6B 1J5EQ 1ZXTA 4BY1H 3KLSX 2K5DA 2CWAA 1WVLA 5G3LF 3CCLA 3SK8A 1RKNA 3ITPA 1SYFA 3CP0A 4NB3A 5M3MB 4JI3Q 2B2UC 1TWHB 4C56C 2RF4A 3S17H 3IL8A 3RMHA 2DUDA 2F0DA 3E9HA 5JEAH 1PTOD 1Z47A 4R8NA 1V1PA 1DOLA 4HCEA 3HOUB 5C3EB 2KOLA 2BE5C 2C5CA 3MTSA 3R2TA 3PO2H 1TWFB 3GV3A 2BCOA 4A3IH 1GO3E 1VQAA 4ME3A 5LMUL 1V1QA 1K8OA 5DNFA 2NVYH 2E2HB 2Z1CA 1I4QA 3GDEA 3CMEA 1UAPA 1LT5D 1GUWA 4K5XA 1HHVA 3MXPA 2ES2A 4GN3B 1HNXL 2JA6B 3I4MH 2UXDQ 4NXMQ 1I94L 2M2LA 4WRDA 4XYQA 2B2TC 4GLXA 2PMZE 1JE4A 2B2VC 2YU9H 1XMQQ 5LMNQ 3W1BA 2D0OA 5FOBB 1QUQB 5ELEA 4DGZA 4H0LC 4A3MG 2OWOA 1O7ZA 4DK1A 3V05A 3AU7A 1PXUA 1DD2A 3JAMc 4HJ9A 1HZAA 3PO3H 3STBC 1PFSA 4EX5A 1IL8A 5JJKA 3E9IA 4X6AH 4JI8L 1KL9A 4O42A 2JA5H 2A74C 4IO9A 4N8X1 4L5SA 3K0XA 2H4OA 2IX0A 3RLOA 2VQEQ 2LXKA 1W6JA 1YNJC 4A3EG 2VB2X 4P73A 1EY9A 4RKLA 4XT1B 1VQ7A 2EQSA 5CV5A 1PH3A 1PH9A 2E5LQ 3I2ZA 2IHFA 1BBUA 3DEOA 4OHJA 2DJFC 4LFCL 1S40A 2MNAA 3HKZB 2AQ1B 2NBFA 4L6TB 3TP8A 4I7ZC 1TWCB 4A3LH 3FEWX 3GTPB 4X66L 4IPDA 4DXGA 1CZWA 3HOWB 4DAYB 4C3IB 2QDBA 2F0WA 4DK3C 4KY5A 1EU3A 3OTOQ 4QQBX 1DM0B 1CSQA 2HQEA 3BYTB 3TP5A 2QKIC 3K58A 5K36H 4JVZA 2WINB 3NQIA 4UP8A 4K6LA 4KLKA 4P74A 1ENCA 3QIAA 1KLUD 4BXXG 1L1OA 4B3MQ 2K1BA 1O7YA 1CQFA 4O2DA 2HD3A 1HR0W 3M4PA 1WCMH 3K7AH 3MXNB 1WFQA 4BBSB 3S1MB 2EDGA 3SDZA 4DR4Q 1E1OA 1EIFA 3T53B 4MNOA 5C0XG 3FDTA 5ELCA 3JAME 5D3DA 5M5WH 1EWCA 3QOLA 2R6GA 2E74C 5GAEC 3PF5A 1QZGA 1JICA 3AMUA 1P8LA 1ICFB 4A3CH 2L11A 2F0UA 1DZ1A 3I4NH 3T56B 3RD4A 1RCVD 1JT8A 2QEJC 3TP7A 3S16H 3MHBA 1U5KA 3VA5A 4XDXA 4UP7A 5E7NA 1EIHA 4A3DG 5DM63 1BCPD 3J80i 1HQMC 4BBRG 1XNRQ 3U50C 4C3JG 4BY1G 1SNQA 1AW7A 2F0FA 2X6GA 4IUTA 1HXYD 3CCQA 1S72A 4G4KA 4IOAA 5IGBA 4HSVA 1PHJA 2Q8RE 3K57A 4LMQD 1CKNB 1Q8IA 2A73B 4F7XA 1B3QA 4A3JG 5C6AA 4K6DA 1V9PA 5JEAG 1NR2A 3NP8A 4N8FA 3K5OA 4A3JB 2EJGC 3P1HA 1LTID 4R9WA 2R7ZH 3A8KE 4A3IG 2DGYA 3LWUA 1Y1VG 4JI2L 1XWEA 1PZID 1XXGA 3DMUA 2L0CA 1EY7A 4LF4Q 2RSOA 1HZ9A 5C4HA 1O7LA 1B9NA 1GVPA 2J7ZA 2JA8B 3M3YH 2PNRC 4DR2Q 4XXEA 3I4MG 5T1IA 1HNWL 3SHLA 4X65L 2C35B 3HGBA 3M9BA 3S15H 2SEBD 4CJ1B 2WAQG 1I50B 4JYAL 4MIUA 3UDGA 1QVCA 3KFUA 2I07B 1F2LA 4DUZQ 4L5RC 1UUPA 2RKSA 4X3TA 1E24A 4TKOB 1PH8A 4ZCKA 1SNCA 3JAMi 1VQKA 4Y7NB 2D0PA 2YYZA 3ERQA 4A93H 4QL5A 3CRKC 1UEBA 1AP0A 3PO3G 4BY7B 1D7QA 1YVCA 1YI2A 2WAQE 4F8MA 4DV1Q 4KHPL 3RR5A 1ZEQX 1WTRA 1RIPA 1PH1A 2ZXPA 3I4LA 3SE0A 2ENBA 2EJFC 4X3KA 4IUQA 3PIP3 1SROA 1LLRD 4ABNA 1KNEA 1Q3LA 4B3SL 1L2FA 1BBWA 1KIXA 2ZJQA 1HNZL 4Y52H 1EIGA 3UE0A 4DV6Q 4LF8Q 2KHIA 4QUCA 5FO8B 4TVAB 1X65A 1XPRA 2HDLA 4XIGS 4J6HA 1SNPA 1U4LA 1F9SA 1Z9FA 2XGTA 4RA8A 1X3QA 1EFWA 2PNHA 1TWGB 2AUJD 4GKJL 1Q81C 1TVXA 4DV2L 2ZJRA 3QOJA 3TN2A 3I7FA 1XPOA 3PIPA 3GTGH 1BQQT 4PZ7A 3G4SA 1NMFA 4DR3L 4JI4L 1QUQA 3NTKA 4OIKA 4DR1L 5DLQE 3M4OH 1HJPA 1ILPA 1AZPA 2JA7B 1HFNA 4WJ3M 2BOSA 3X3NA 1YHBA 3S2HB 4JI5Q 4JW0A 4GZYC 4NDXA 5K36G 4MHEA 2JE6I 1EYGA 1RD9D 4GOPC 1SMYC 5IOCA 4GLVB 1PTOB 5IYBH 4HJ8A 1MHWC 2OF1A 2LSSA 5CGKA 3T1HQ 1PZKD 4KHVA 5DEHA 1VMPA 4K14A 2P5ZX 3BDCA 1O78A 3H94A 2I0QA 1WCMG 4ZUJA 1B7YB 3W1GA 4V0BA 1RJTA 4KD3A 5F2DA 4R8IA 4A76A 1Q82C 1JMCA 1HR0Q 1B9MA 2KEEA 3OIPA 4C2MB 1WOCA 3P75A 5EAYA 3W2DA 3S2DH 5EBCA 1EOVA 1VQ9A 2G9HD 4JBJA 4K0KQ 4JI0L 4A3KB 3CKIB 1VQDA 2YV5A 3Q6SA 4A3CG 2EYJA 1NNXA 2AQ2B 2LMCB 4KK7A 3I4NG 2F0LA 2NVTB 4X3UA 3OOCA 3M85A 2EE1A 1TS3A 4EQNA 1F9RA 4XYOA 1UEAB 2N55A 1EFID 2KCMA 4KHZA 1TKWB 4KKSA 4JI7Q 3LNNA 4JOIC 1GJXA 1NBWA 3GTLH 1S4ZA 1S5ED 1SMXA 1K83B 2F3WA 1EYCA 4N9PA 4OO1I 3IFDA 2G5DA 2VQFL 1A3VA 3U9OA 1QVFA 1IW7C 2L12A 2NTSA 2O5IC 3I73A 4B3TL 2ZT9C 5DM73 5M3MH 2FMMA 1N33Q 4FF2A 4RKBA 2AHOB 1EQTA 4RGMA 4IURA 4LFBQ 2RDGA 3NBHA 2XWBB 3BZKA 2I5LX 5KIXA 3HOUH 1KDBA 5C3EH 4HIMA 2R7ZG 1XNQL 1TWFH 2PZUA 1IBML 2K14A 5IGGA 2E2HH 4DV7L 4ZAIA 4KKUA 1IBLQ 1HA5A 4CKCA 4YY3L 2JA6H 2JA9A 1BF4A 3F2DA 2PYKA 2OQKA 4CJ2C 2ATWA 1SMYD 5M9OA 3S1QB 5JPMC 1DCZA 3RN5A 2DNEA 2HT1A 4UPAA 3T4AC 2MO1A 2X69A 5A2QE 3H91A 4WFN3 1KABA 5C4JB 4LF7Q 2E2IB 2H1EA 1OXXK 5D3IB 2UUAL 4A93G 3TRZA 2WKCA 2WB1B 4JI6Q 1EWHA 2F0VA 3MFYA 1RF2D 4WJ4A 3I55A 1LT3D 4NW2A 3D4WA 1FNVA 3J7ZC 2F0MA 1D5XC 2XN9C 2B2YC 2MJ8A 1WI5A 1C9OA 3C1FA 5BN3A 4AQYQ 2OT2A 3N52A 2M9VA 1A3TA 2PI2E 2XRQD 1U4RA 2H5XA 5NUCA 1FGUA 4MTKA 1EUJA 3K5MA 1L1OB 2ZXOA 3S14H 3OMCA 2UXBL 2AQ3B 5EPKA 1BOSA 1YIJA 2UUCL 4YCUA 2QA4A 3Q8DA 4CJ0B 4LFAL 1BCPB 4IFDJ 1IW7D 3U4ZA 4IALA 2KCCA 3J7YW 1AN8A 1PH4A 3QB3A 1TWCH 4DV0L 2GA4B 1AE3A 3GTPH 1E0BA 3UDXA 2NZOA 2EYOA 3HOWH 3KUPA 1YJWA 4C3IH 1M90C 2NVXH 2BDNA 3C46A 1F9PA 1EL0A 1KNAA 3D3RA 2JN4A 3D4DA 1JB3A 5ELBA 1CQVA 5IYBG 2K5WA 4RCOA 4X64L 2HHHQ 3I8ZA 1WTOA 2EY2A 1PRTC 4KD4A 3RN2A 3WDNA 1HFGA 2JK8A 4E6IA 3EA6A 3GTKB 3MZ5A 5JJZA 4KI0A 3A5UA 4ZUIA 4BBSH 1KXLA 3S1MH 1XTCD 1VQNA 2RCNA 3BZCA 2XWJB 4DK6C 4LF6Q 3S1RB 2UXCQ 4OIJA 1SFOB 1IBKQ 1H9MA 1JJ2A 2MP1A 2NN6H 3FRPB 1S3OA 1LACA 5C0XH 1Y8OB 3KJPA 1B53A 1L0WA 1VQFA 5K5PA 1HZBA 1AE2A 1C8CA 1RDPD 3WOEA 3GTOB 3NHHA 1ESRA 3HP3A 1JC7A 5M3FB 1ICWA 1QNUA 1LM0A 1K9MC 1LTSD 1SAPA 4LF9Q 1DXMA 4YHHL 4JV5Q 1LTTD 1LTAD 4J8QA 5ELDA 3NUCA 4RGNA 2R93B 1IYVA 1VQMA 4IN3A 3VYTA 4JK1C 1RTNA 1KDAA 4LUZA 1PYBA 1IKMA 2B29A 1C4QA 4NMZA 3W5OA 1STEA 5M3MG 4GNXA 3I90A 5C5LA 2B8FA 3MVVA 1EY8A 1H9JA 1WYDA 1SSOA 5CC4A 1JJCB 2BH8A 3HOUG 1VQEA 1DJRD 5C3EG 4FDBA 3QWNA 4A3JH 2UUBQ 5KRUA 5CBEE 1YJNA 1CT1D 4HAEA 5HURA 1Q86C 2NB0A 3D8GA 1X3GA 1YNNC 2K03A 2WV6D 1G8ZD 2NVQB 1NR4A 5FKAC 3MFGA 4HMIA 4RCNA 3FHWA 3JAML 1HZCA 1LTGD 2JA8H 5ELOA 1Y1VH 4KY7A 2WKDA 1X9NA 2JA6G 5IWAL 4HIOA 1ASYA 1I50H 4GS3A 5GAHC 4JI5L 4HR7B 4CGYB 1XYIA 4FO2A 4CDEC 2E75C 4JI1L 1PRTD 2A6EC 1CFMA 4MTNA 3RNUA 1SE4A 4Y7NH 4GKKQ 1VF5C 5C4XB 3RUZA 5KGUA 4A3FB 1HTLD 4J1MA 2F4IA 3EN2A 2D9UA 3FVQA 3WWVA 4DNIA 1STGA 4JBKA 3GQBA 1A2TA 1VQ8A 1I4HA 4OWXB 4IPGA 5I4DA 3SGIA 5C44B 3HRZC 1OXTA 1TQOA 2CHBD 5IGFA 4V190 1VQJA 1VQGA 2KQ3A 3K8AA 4FVMA 1QJOA 5J22A 5JVH3 1QZHA 1G51A 3NELA 2F4VQ 4HSPA 5FLMH 4FXKC 2EYPA 1OXUA 3DM3A 3KLWA 3HOYB 1N36Q 2L4NA 1L0YB 2RCFA 4UAIA 4ODGA 3VYUA 4R4IA 5I6WA 1DOMA 3HKZG 2ZTEA 4QGUA 1VQPA 1VF7A 1J9OA 3ER0A 1FYCA 4ZQ3A 3T51B 4U673 3GTMB 1OXSC 4FYDA 1UE1A 1D5ZC 3HOWG 2JA7H 2QDLA 1YITA 4C3IG 3S2HH 4LW1A 4RWSC 3BJUA 1SYGA 1EEFD 2JSOA 2R3ZA 1EOTA 4L5TA 4O1NA 1I6HB 1FGBD 1PZJD 1GUNA 3H09A 3A7AB 2B2TA 2L1BA 3N6RA 4AYBB 4G7OC 4YCVA 2B2VA 3HKZE 5KEEA 1FJGQ 2BE5D 3HOZB 1Q7YC 2B8GA 1X32A 1K73C 1K0RA 3OWEB 5BR8Q 2EYMA 2XIWA 4LF5L 2KECA 4UP9A 4BBSG 1FNUA 4DR6L 1STAA 2N88A 1IBLL 4ME5A 4C2MH 4GOPB 1HUNA 3H3VH 3A7LA 3NBHB 2NN6G 1SYDA 2SOBA 2ICIA 3PUZA 4DAPA 1VQLA 5JOBA 5JVG3 4A3KH 2A68C 3T1YL 5GQOA 1X3FA 3SK5A 1EQRA 2JYOA 3P7JA 2ZTDA 3TMEA 4HEDA 2NVTH 1P16A 4DFAA 1TS4A 5JJIA 2ZTCA 4R4QA 3R2IA 2VUMB 3WOFA 1I3QB 5FLXc 3FPUB 3STBD 2UU9Q 4A3GB 3I4OA 1K83H 4P2CB 3DLLA 2K5HA 3A54A 1F77A 3BU2A 3C1EA 1PTOF 3MXGA 4DV3L 2EIFA 4HMJA 2G9DA 2XRSD 4PZ8A 4FXGC 1TR5A 4ZKBB 1YHAA 5AJ3Q 3CCUA 1CHQD 5IT9c 1YNJD 4LUOA 3PUYA 1CM9A 4EVOA 4OX9L 1FD7D 4DV5Q 2XTIA 1CSPA 2IWHA 2K01A 2DY7A 4NXNL 1YBYA 3MC0B 4JG2A 1CKOA 2JA8G 4B3RQ 2RQXA 1ZYRC 1IZ6A 1Z6HA 1R4PB 3FKIB 3H6MA 2A6HC 1HRJA 1B70B 2JEBI 2ZM6Q 3CC4A 4DR7Q 5M5YB 1HA6A 4DUYQ 4GN5A 4F87A 5T1GA 3S1QH 3KJOA 1ET9A 3VR3A 2Y0SB 1MSGA 2AMCB 2NUCA 3TEHB 4DR5Q 1A8VA 5CR3A 1XMOL 4Z9CB 5C4JH 2E2IH 3F1ZA 5FO7B 3E3XA 1LUZA 1TY2A 1QWYA 4DV4L 3HZXA 5COYA 1DYQA 1GHKA 4IJLA 4HJ7A 3Q24A 4BY7G 4RMFA 1C7YA 3BS1A 4L5QA 4QIWE 3M7GA 2L15A 4EGVA 5HGQA 3SEBA 5GAGC 2F0OA 3PSIA 1QVGA 2I5HA 4H7BA 3K7UC 1WTXA 2IHEA 2R7FA 5CMDA 1IHZA 1K8AC 2PZTA 5FLXE 3AQQA 1ESFA 1TS5A 4O0AA 4KTAA 4K8IA 2SNSA 5IYCG 5FLMG 3KLSA 1HTPA 2D2CC 3M7NA 1JR0D 1BNZA 3E6ZX 4IFDI 1T5XD 3HFZB 4R1JA 3DM1A 4QF4A 4LF9L 4F88A 3S1NB 4OO1H 5C0XJ 5I9PA 4BA2I 5IT9E 3HEJA 1N34Q 2EYLA 4DU9A 4IJHA 5L37A 4X62Q 5IGCA 3T13A 1PFBA 3ZJYC 1D1IA 2FINB 1QG7A 5E3FA 1LV9A 2LFNA 2JA7G 3E0JA 2K5NA 3DUZA 5A2QL 1A3UA 3EIVA 1J5EL 1PH5A 2R7DA 4M1UB 1EQVA 4JI3L 4ILWA 3K80C 5C3WA 1SJED 3H0GB 2WIIB 4CKEA 4DAVA 2MFIA 5LMUQ 1O7IA 2A6HD 1SN8A 4PG3A 1SDFA 1UE6A 1Q46A 2CW0C 1E2ZA 4GNXB 1ILQA 1UE5A 1HNXQ 3HOVB 3BZDB 3S1RH 5JEAJ 1SEBD 3TBIB 3A56A 1SFOH 3S24A 3ICEA 5IP7H 3VR4A 4ID6A 1CI3M 1I94Q 2JP1A 2F3IA 4DF7A 1PRTB 4DNRB 4HJAA 3OHXC 4A3KG 4QCLA 4NXML 3UI2A 2UXDL 3QO2A 1BCPF 2C9OA 4POFA 3KOJA 1EQQA 1EZ8A 2F0TA 1MJEA 1SYCA 1SE3A 4IUPA 2RBMA 1JCKB 1J8IA 2PQAA 3GTOH 1Z7TA 3B6YA 2NYZD 1QNKA 5M3FH 4QY7A 4DPGA 4QB4A 1XMQL 5LMNL 4L8JA 3KBGA 2FJ2A 1H95A 2R93H 2RHQB 2F0EA 3U9SA 3AYHB 4AH6A 3D0FA 2V4DA 3K7AB 1BDOA 1WTPA 3HG9A 2K4KA 3HKSA 4PV1C 4JI8Q 2Q8IB 3Q23A 2N8NA 4WJWA 2B63B 1RL2A 2VXWA 3UDIA 4ULLA 2KA7A 5I2YA 3URYA 1HUMA 2KENA 4YWMA 2R92B 1A6XA 1SRUA 2PO4A 2R61A 3DWPA 3X3MA 1EZ6A 3KK7A 1D2BA 1TWHH 2F0HA 1A2UA 4GOPA 1STNA 3DHQA 1SBBB 1TIID 2VQEL 2EYFA 4I65A 5CBAE 2A19A 4OONA 1QB5D 1LABA 4R4TA 2NVQH 5I9OA 4LFCQ 3J7AF 3MWYW 4CBVA 3MAQA 2E5LL 5BN5A 4I7AA 3J81c 1A0IA 1KLGD 4X66Q 2AKWB 1T9HA 4OWWB 3A74A 2L55A 3ZYYX 1JORA 3TZUA 3EVQA 2F0QA 4KV6A 5C4ZA 1C48A 2TSSA 3AEVA 2E2DC 1A62A 2LKVA 4NPSA 3OTOL 2J0TD 4IOCA 2IPKD 5C4XH 4A3FH 3OWFA 2SDFA 2WB1G 4KMUC 1EY6A 1NJIC 1NAPA 1N32Q 2O5JC 4RHSA 5G3LD 1I4GA 3KBXA 1G6ZA 3R3OA 3ONAB 4AIMA 3QJYA 4B3ML 1TY0A 5C44H 3W3AA 1E2VA 1AH9A 5CYUA 1VQCA 3PIO3 2KVMA 1SNDA 4OL7A 3AFPA 3Q22A 2CQOA 4DR4L 1CTMA 1EU4A 2GN5A 4B9XA 2F0KA 3KDFB 4IPHA 3CXCA 1L0XB 3EFXD 4R4CA 2K5VA 1EEID 2E2JB 2B2WC 1XJVA 4K2LA 3ND9A 1WTWA 1VCIA 2FMCA 3HOYH 3G6JB 3GTJB 1EY4A 4P71A 4OO1G 5KYIA 1II3A 3EBEA 1WTVA 1K0SA 3PIOA 5IYDG 2PZWA 3GTMH 3CMAA 3KF8A 4XQNA 3NBIA 1S5BD 1Y8NB 3J7AV 4HN7A 2QGQA 1XNRL 1NTGA 3UE1A 2IX1A 2PW5A 3PV0A 5LL6X 2E76C 2QW7A 2VS1A 1Q1BA 2CH4W 1SYBA 2Z6KA 1KD1C 4IUNA 4C3HB 3J81E 1I6HH 2MO0A 5AFWA 2K50A 2RDFA 2EY6A 1A63A 4IUVA 2WP8J 2I46A 2K32A 4A3BB 1V43A 1IKLA 3HOZH 1GUGA 2BA0A 2LXJA 4YWKA 4G57A 4JI2Q 1NE3A 3VR2A 4EQOA 2ID0A 5EKKA 2KUMA 1DONA 1KAWA 2OTJA 3U4VA 4HCSA 1AZQA 1LT6D 4LF4L 4HJ5A 4X65Q 1HNWQ 3TREA 1NSNS 1UE7A 3OSOA 4OEMB 1K3RA 5IP7G 1M1KC 4JYAQ 2F52A 4DR2L 4LNQA 2B2YA 2ASBA 1TT2A 3TDQA 3KYHC 4LJZC 3MXUA 3OW2A 4JPBW 3RLFA 3H3VC 2EJMA 3NPPA 2AWNA 3DEPA 3OIQA 5M3FG 2ZXRA 2QF7A 4DUZL 1EWIA 1VDZA 2VL6A 3NSWA 1CZGA 2R93G 3RZDB 1JQYD 1I3QH 4A3GH 1B2TA 4KHPQ 4A4IA 2IJ0A 3VDYA 5IODA 3K5NA 2K7VA 4DV1L 2SNMA 4B3SQ 4IZ8A 1H9KA 3NENA 1I6VC 1HNZQ 1G91A 3TP6A 2N49A 2BH2A 3S2DB 4R4OA 3NK9A 1B8AA 5A35A 4KJNA 5M5XB 3TSSA 1PA6A 3M4YA 4DV6L 1E2WA 4PMBA 2J4XA 4LF8L 1FVIA 3BG3A 1GD7A 1MI2A 1Y1WB 4GKJQ 4DV2Q 3J81i 5I2XA 1GUTA 3I91A 2ICEC 1YHQA 3FKIH 1NY4A 3GV6A 2RA4A 3PGZA 4JI4Q 5M5YH 1OXVA 2EXZA 1GXDC 4Q0FA 4DR1Q 1H9RA 3J80c 1ZKOA 2GVAA 1E3PA 3F2BA 3F2UA 1LO5D 3J81j 3HOXB 3BDOA 5EPJA 5GROA 2IX3A 2NZHA 3NWSA 3TS0A 1CHPD 5C4XG 4A3FG 1JOKA 5JPNC 4PQXA 1Y8PB 2BA1A 1SYEA 3L3OC 1KHIA 3T1HL 2D5DA 1XTDA 2PMZB 3NE5B 4NP5A 5C44G 4HTHA 1KC8C 4BY7H 1PVOA 3CQZB 1FNWA 4GN4B 1NCVA 1S5FD 3D4RA 1HR0L 1YZ6A 2FFKB 1T5EA 3L2PA 1I4PA 1JWUD 4QUFA 4JI0Q 1Q1EA 3PF4A 2NN6I 4JBWA 5C0XI 1W6KA 4XQQA 4K0KL 1OO9B 1IL2A 3V2TA 3CCVA 2B2UA 3HOYG 1BVSA 2KEDA 3CU7A 3S1NH 5CV7A 1KRTA 1VMCA 5IYCH 3SK4A 1L1OC 2JXMB 3RZOB 4C1NK 3G6EA 4A3MB 1TWGH 1VQ6A 3GD7A 3QG1A 2PPBC 1H9SA 2VNUD 4JI7L 2VQFQ 1Y14B 3O13A 3I56A 1RTOA 1VQHA 1BCPC 4KN4C 2F1MA 2O4XA 4B3TQ 1Q8KA 2BDOA 3GTQB 1ML0D 1GUSA 1PV4A 4UY8C 2PQAB 3NTHA 1VQ5A 3PMFA 3U58A 4AYBG 3J80E 1N33L 3C2PA 3H0GH 5D14A 1GOZA 2EY1A 2K52A 3S14B 5GADC 4ZLTF 3HOZG 3DWQA 4L63B 4K8JA 1PTOH 4B08A 1XNQQ 4LFBL 1IBMQ 3DXJC 2E8GA 1BBXC 1YNND 3J7A5 5EQ0A 5KNBA 4A3EB 3KDFA 4TRDA 4DV7Q 1X3EA 1CA5A 3C3LA 3NXWA 4DKAC 2Z9HA 3I72A 4KKTA 3A55A 1GKHA 2MUYA 4BS9A 4YY3Q 5FLXL 3HOVH 3CHBD 1B50A 4AYBE 2PI2A 1IXRA 4PZ6A 2L5TA 1VS0A 4CDFC 1PFNA 2YTYA 3A5ZB 3GO5A 4CDCC 2NVXB 1ASZA 3TZDA 5J39A 1D6EC 1LTRD 5H1SE 2A6ED 3I3CA 1JOOA 5IT9L 4YIJA 2UUAQ 3PCOB 2F0NA 2KJXA 1ONLA 3IFTA 5JJLA 3PUXA 2VUMG 1D5MC 4LF7L 3VA7A 4A3GG 1N32L 2K6AA 1SE2A 4FNFA 3R8BA 4JI6L 5FO9B 1VQBA 1CA6A 4DN4M 1IYUA 5LHY1 1AFPA 2MHVA 1SNOA 1QE6A 2XSCA 2Z4IA 1B4OA 2B63H 1LTLA 1R9TB 1U9RA 3LX0A 1UWVA 4EQPA 1YNXA 3K5LA 2R92H 4PMCA 5C5MA 2GVBA 4IFDH 4IQZA 2CCZA 4AQYL 1QOHA 5KNDA 1F9QA 2UXBQ 2DJGC
chains in the Genus database with same CATH topology
1EUJA 3CCRA 4LUVA 3GDEA 3CMEA 1L1OB 1UE5A 1HNXQ 3S14H 2UXBL 3S1RH 3G71A 5JEAJ 2UUCQ 2ES2A 4GN3B 1SFOH 1HNXL 3S24A 3ICEA 3I4MH 5IP7H 1YIJA 2UUCL 4YCUA 4LFAQ 1I94Q 2QA4A 2UXDQ 2F3IA 4NXMQ 1FL0A 3Q8DA 1JB7A 4JCVE 3CD6A 4HJAA 3FKIG 1I94L 4LFAL 4A3KG 4IFDJ 2UXDL 4NXML 3U4ZA 4J15A 4DV0Q 3K81C 3KOJA 3ULJA 4POFA 1EQQA 4GLXA 2PMZE 3AFQA 1PH4A 1MJEA 2YU9H 4LWCA 1TWCH 4DV0L 1XMQQ 2PQAA 3GTOH 1AE3A 5LMNQ 3GTPH 2YTVA 3B6YA 3W1BA 2D0OA 5M3FH 2Y0SG 1QUQB 4QY7A 4DPGA 3CCJA 1XMQL 3UDXA 2NZOA 5LMNL 4A3MG 3HOWH 2OWOA 1YJWA 4C3IH 1M90C 1X54A 1H95A 2R93H 2RHQB 3JAMc 4HJ9A 2NVXH 3G48A 3AYHB 4AH6A 1HZAA 3D0FA 2IT1A 4P75A 3PO3H 4X64Q 3STBC 1PFSA 4EX5A 5IYBG 2K4KA 5JJKA 3HKSA 3PO2G 4X64L 4JI8Q 3E9IA 4X6AH 3JC66 2HHHQ 2N8NA 1RL2A 3KF8B 2VZAA 3RN2A 4JI8L 1KL9A 2JK8A 4OXPA 3UDIA 2HHHL 2JA5H 4IO9A 2KENA 4YWMA 2Y0SE 2YTXA 1SRUA 4L5SA 1IYJB 4KI0A 3M4QA 3D31A 3A5UA 3K0XA 2IX0A 1TWHH 3RLOA 2VQEQ 4BBSH 1KXLA 3S1MH 4GOPA 2LXKA 2RCNA 1VQNA 3BZCA 5IE8A 4DK6C 4A3EG 2VQEL 2D62A 4P73A 1PYSB 4LF6Q 2JEAI 2A19A 4OONA 2UXCQ 1IBKQ 4R4TA 1VQ7A 2EQSA 4LF6L 1LYLA 1PH3A 1PH9A 1KQSA 1JJ2A 2E5LQ 2NVQH 2UXCL 2ALYB 3H3VI 1S3OA 1IBKL 4LFCQ 3I2ZA 1J6QA 2IHFA 3KF6A 3KJPA 1BBUA 2E5LL 1L0WA 2E2JH 4LFCL 1VQFA 1PH2A 1HZBA 3J81c 1S40A 1A0IA 1AE2A 2MNAA 2WFWA 4X66Q 2AKWB 3GTJH 1T9HA 4OWWB 4A3LH 4YHHQ 3A74A 4X66L 1K9MC 4IPDA 1LM0A 4LF9Q 4YHHL 4JV5Q 4DAYB 4BA1I 4DK3C 4JV5L 3OTOQ 1VQMA 2K75A 4QQBX 1CSQA 3AEVA 1A62A 3CCEA 2OTLA 4NPSA 3OTOL 2JA5G 5IYDH 4IOCA 4LUZA 5C4XH 4A3FH 1PYBA 2B29A 1W3SA 2WB1G 1HH2P 3L0OA 4UP8A 3W5OA 4KLKA 4P74A 1NJIC 4RG1A 5M3MG 4GNXA 4QJFA 4C3HH 1N32Q 4BXXG 1L1OA 1E7ZA 2AWOA 4B3MQ 1PH7A 1WYDA 5IP9H 3H0GG 4A3BH 4AIMA 1JJCB 4O2DA 1HR0W 3M4PA 4B3ML 1WCMH 5C44H 2BH8A 3K7AH 3E0EA 3MXNB 1WFQA 3HOUG 1X56A 1VQEA 5C3EG 4FDBA 1AH9A 2N78A 1VQCA 4A3JH 2UUBQ 4DR4Q 1E1OA 1EIFA 1E22A 1YJNA 4MNOA 5C0XG 1Q86C 3AFPA 2UUBL 2CQOA 4DR4L 2GN5A 1X3GA 5M5WH 3KDFB 4IPHA 2R6GA 3CXCA 4R4CA 2K5VA 3CC7A 3FHWA 3GTKH 3HOVG 5GAEC 1HZCA 3PF5A 5IWAQ 1QZGA 2JA8H 5ELOA 1Y1VH 2OCEA 4A3LG 3CCSA 2B3GA 1X9NA 2JA6G 1XJVA 5IWAL 1P8LA 4HIOA 4A3CH 1VCIA 1ASYA 3HOYH 4P71A 3I4NH 4OO1G 1I50H 1JT8A 3EBEA 4GS3A 5GAHC 4JI5L 4OWTB 4JI1Q 3PIOA 3S16H 1N9WA 1U5KA 2JJQA 5IYDG 4UP7A 5E7NA 4JI1L 3GTMH 4A3DG 3CMAA 3J80i 4BBRG 1JJGA 1XNRQ 3U50C 3OYYA 2VW9A 4MTNA 3RNUA 4P72A 1I5FA 4BY1G 2QGQA 4Y7NH 4GKKQ 1XNRL 1NTGA 3UE1A 2IX1A 1KRSA 3PV0A 3CCQA 1S72A 2IY5B 4YWLA 3RZDH 4GKKL 4IOAA 4HIDA 3EN2A 2VS1A 3WWVA 1Q1BA 1PHJA 4DNIA 2Z6KA 4JBKA 1KD1C 1VQ8A 1CKNB 1I6HH 4OWXB 1CKMA 2MO0A 4A3JG 2K50A 4XTCS 1A63A 2CFMA 4IPGA 1MIUA 1V9PA 2WP8J 1V43A 2B63G 5JEAG 3SGIA 3HOZH 2BA0A 1YEZA 1OXTA 2LXJA 4YWKA 4JI2Q 4APVA 2R92G 2R7ZH 1NE3A 4A3IG 1VQJA 2DGYA 1VQGA 1Y1VG 2ID0A 4JI2L 4IFDG 3L7ZC 3K8AA 3MEFA 4LF4Q 3CC2A 1KAWA 1HZ9A 5M5XH 2OTJA 3U4VA 4TQUS 1QZHA 1G51A 1GVPA 3NELA 4LF4L 2F4VQ 4HJ5A 4X65Q 1HNWQ 3TREA 5FLMH 1UE7A 3M3YH 1C0AA 4DR2Q 1Y1WH 1K3RA 1OXUA 2F4VL 5IP7G 3I4MG 4X65L 3DM3A 1M1KC 1HNWL 4JYAQ 2C35B 3KLWA 2F52A 3M9BA 4DR2L 4LNQA 1N36Q 3S15H 5HY6A 2ASBA 2WAQG 4JYAL 3KYHC 1N36L 3UDGA 4R4IA 1QVCA 3KFUA 1SLJA 1E1TA 4MZ9A 3HKZG 3OW2A 2ZTEA 3RLFA 4QGUA 1VQPA 3ER0A 4DUZQ 5FJ8H 2AWNA 4L5RC 3F2CA 1DGSA 4JBMA 1OXSC 5M3FG 1E24A 4DUZL 3HOXH 1PH8A 1EWIA 1UE1A 3JAMi 1VQKA 1X6OA 2I5MX 3HOWG 2D0PA 3CF5A 2YYZA 2VL6A 4A75A 1YITA 2JA7H 3S2HH 4LW1A 4A93H 3ULLA 2R93G 1I3QH 3BJUA 1K8GA 4A3GH 1G6PA 4QL5A 1UEBA 4KHPQ 3CW2C 4L5TA 3PO3G 1D7QA 5J3BA 1YVCA 1YI2A 2WAQE 4A4IA 4DV1Q 3VDYA 1GM5A 3RR5A 4KHPL 1RIPA 1PH1A 4YCVA 3HKZE 4DV1L 1FJGQ 4B3SQ 3NENA 1MJCA 1SROA 1Q7YC 1HNZQ 4POGA 1FJGL 2N49A 2KBNA 1L2FA 1N8RC 1BBWA 4R4OA 5LMNW 1KIXA 4B3SL 4LF5Q 2BH2A 1B8AA 1K73C 2ZJQA 1HNZL 4DR6Q 4Y52H 1K0RA 5BR8Q 2A8VA 2ZJPA 4LF5L 3UE0A 4UP9A 2JQOA 3CQZH 4DV6Q 2EXDA 4BBSG 4DR6L 5BR8L 1IBLL 4LF8Q 2KHIA 4H02A 1PA6A 4TVAB 3CPFA 4DV6L 2Z6KC 1X65A 4C2MH 1XPRA 4XIGS 1FVIA 4JOIA 3RLNA 4GOPB 4LF8L 1GD7A 3H3VH 1Z9FA 2XGTA 4GKJQ 1JE5A 4DV2Q 2N3SA 3NBHB 4GLAC 2NN6G 1EFWA 3J81i 2PNHA 4GKJL 4PMWA 3T1YQ 1Q81C 4EQ5A 3PUZA 2HQLA 4DV2L 2ZJRA 1YHQA 1VQLA 3FKIH 1NY4A 3I7FA 4A3KH 1XPOA 3PIPA 3GTGH 3T1YL 2OQ0A 1X3FA 3PGZA 4PZ7A 5GQOA 5M5YH 1EQRA 1OXVA 2WB1E 3G4SA 1NMFA 4DR1Q 2ZTDA 3J80c 4DR3L 3UDFA 4JI4L 2GVAA 1QUQA 1E3PA 2NVTH 1P16A 3F2BA 1CKNA 4DR1L 1Q12A 3J81j 5JJIA 5DLQE 3M4OH 1HJPA 2ZTCA 3IRBA 4R4QA 3RZOH 2QEXA 2Q2TA 4WJ3M 4A3MH 1YHBA 4JI5Q 5GROA 2NZHA 3F8TA 5FLXc 3STBD 3TS0A 2CKZB 2UU9Q 4JI4Q 3I4OA 1EYGA 2JE6I 1K83H 3DLLA 5K36G 4GOPC 2K5HA 3BU2A 4GLVB 2UU9L 5C4XG 4A3FG 1G291 4ALPA 1X55A 1VQ4A 3GTQH 5IYBH 2MQHA 4HJ8A 4HIKA 4DV3Q 2Z0SA 3CAMA 2BA1A 2LSSA 3T1HQ 2RHSB 4DV3L 2EIFA 3PUWA 2HIVA 1KHIA 2V1CC 3T1HL 4PZ8A 5IP9G 3PUVA 1XTDA 1YHAA 5AJ3Q 3CCUA 4A3BG 2I0QA 1WCMG 3W1GA 1B7YB 5IT9c 5C44G 1KC8C 4BY7H 5AJ3L 4LUOA 2FXQA 3PUYA 1PVOA 4A76A 1Q82C 4OX9Q 4GN4B 1JMCA 3LGJA 1HR0Q 1BKBA 1SR3A 4A3EH 1SE8A 4NXNQ 4JC0A 4DV5Q 4OX9L 2XTIA 1HR0L 3H15A 1WOCA 1YZ6A 1CSPA 5EAYA 2Q2IA 4NXNL 4DV5L 1YBYA 3L2PA 4JI0Q 3S2DH 4JG2A 1Q1EA 3PF4A 1CKOA 2JA8G 4B3RQ 1EOVA 1PH6A 1IZ6A 1VQ9A 4JBJA 4K0KQ 1WJJA 4JI0L 1MKHA 2NN6I 4JBWA 1OTCA 4B3RL 1VQDA 1B70B 2YV5A 5C0XI 2JEBI 2ZM6Q 3CC4A 4DR7Q 3CCVA 4A3CG 2CWPA 4DUYQ 3HOYG 4K0KL 3I4NG 1BVSA 4GN5A 3S1NH 4GNXC 1KRTA 2ZM6L 4DR7L 4DAMA 5IYCH 3M85A 4DUYL 2KHJA 3S1QH 1L1OC 3KJOA 2AMCB 3G6EA 2KCMA 3TEHB 3ERSX 4DR5Q 1XMOQ 4KHZA 1TWGH 4JI7Q 1A8VA 3GD7A 1VQ6A 4JOIC 1EIYB 5IY0A 1NBWA 4DR5L 1XMOL 3GTLH 2VNUD 5C4JH 2E2IH 3F1ZA 1CUKA 1Y14B 1SMXA 3I56A 2VQFQ 4DV4Q 4JI7L 4OO1I 1LUZA 1VQHA 2VQFL 4DV4L 4B3TQ 1QVFA 1Q8KA 3ULPA 2Q2UA 4B3TL 1PV4A 4UY8C 4IJLA 4HJ7A 5M3MH 4BY7G 2PQAB 1N33Q 4RMFA 1VQ5A 1C7YA 2VUMH 4L5QA 4BXXH 3U58A 2AHOB 4AYBG 1N33L 4QIWE 3TQYA 3CPWA 4LFBQ 3H0GH 2L15A 2K52A 1VQIA 5GADC 5ELNA 3BZKA 5HGQA 1XNQQ 2I5LX 3HOZG 5GAGC 1D8LA 4LFBL 3PSIA 1R9TH 1IBMQ 3HOUH 5C3EH 4HIMA 1QVGA 2I5HA 2E8GA 4IPCA 3K7UC 2R7ZG 1XNQL 2IHEA 2R7FA 3J7A5 1TWFH 1IBML 1K8AC 1W2BA 3KDFA 3AQQA 4DV7Q 1X3EA 2K14A 2KCTA 4O0AA 2HIXA 2E2HH 4DKAC 4DV7L 2A1AA 3FP9A 1GKHA 4YY3Q 3HOVH 5IYCG 5FLMG 1IBLQ 3M7NA 3A0JA 1Y1WG 4YY3L 1YJ9A 4AYBE 2JA6H 2PI2A 2JA9A 1IXRA 3F2DA 4IFDI 2Q2HA 4PZ6A 2OQKA 1VS0A 2VY3A 3HFZB 3A5ZB 2YTYA 4R1JA 3GO5A 4LF9L 1TXYA 1U0LA 5C0XJ 2ATWA 4BA2I 1ASZA 3RN5A 1N34Q 3CCMA 2HT1A 4UPAA 2MO1A 4IJHA 3NEMA 4X62Q 1XPUA 3TS2A 5H1SE 1NMGA 1N34L 5FJ8G 4YCWA 1TWAH 4A3DH 4X62L 3ZJYC 4BBRH 4DR3Q 2UUAQ 3HOXG 4LF7Q 3PCOB 4C3JH 1VQOA 3KF6B 1OXXK 1J5EQ 4BY1H 2JA7G 5JJLA 3PUXA 2VUMG 2K5NA 4LF7L 2UUAL 3EIVA 2CWAA 1J5EL 4A93G 1PH5A 3TRZA 4A3GG 1N32L 4JI6Q 3CCLA 2R7DA 4NB3A 4JI3Q 1IL2A 3CP0A 4JI6L 4WJ4A 3I55A 1VQBA 4JI3L 2RF4A 3S17H 3K80C 2DUDA 3J7ZC 3E9HA 2B63H 1Z47A 2MFIA 1LTLA 1UWVA 5LMUQ 1YNXA 1O7IA 1WI5A 1C9OA 2R92H 3PO2H 1SN8A 4PG3A 4A3IH 1GO3E 1VQAA 2GVBA 4ME3A 1V1QA 1UE6A 5LMUL 4AQYQ 1Q46A 2NVYH 2CCZA 2PI2E 4AQYL 4GNXB 2H5XA 1FGUA 2UXBQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUJ A;  3CCR A;  4LUV A;  3GDE A;  3CME A;  1L1O B;  1UE5 A;  1HNX Q;  3S14 H;  2UXB L;  3S1R H;  3G71 A;  5JEA J;  2UUC Q;  2ES2 A;  4GN3 B;  1SFO H;  1HNX L;  3S24 A;  3ICE A;  3I4M H;  5IP7 H;  1YIJ A;  2UUC L;  4YCU A;  4LFA Q;  1I94 Q;  2QA4 A;  2UXD Q;  2F3I A;  4NXM Q;  1FL0 A;  3Q8D A;  1JB7 A;  4JCV E;  3CD6 A;  4HJA A;  3FKI G;  1I94 L;  4LFA L;  4A3K G;  4IFD J;  2UXD L;  4NXM L;  3U4Z A;  4J15 A;  4DV0 Q;  3K81 C;  3KOJ A;  3ULJ A;  4POF A;  1EQQ A;  4GLX A;  2PMZ E;  3AFQ A;  1PH4 A;  1MJE A;  2YU9 H;  4LWC A;  1TWC H;  4DV0 L;  1XMQ Q;  2PQA A;  3GTO H;  1AE3 A;  5LMN Q;  3GTP H;  2YTV A;  3B6Y A;  3W1B A;  2D0O A;  5M3F H;  2Y0S G;  1QUQ B;  4QY7 A;  4DPG A;  3CCJ A;  1XMQ L;  3UDX A;  2NZO A;  5LMN L;  4A3M G;  3HOW H;  2OWO A;  1YJW A;  4C3I H;  1M90 C;  1X54 A;  1H95 A;  2R93 H;  2RHQ B;  3JAM c;  4HJ9 A;  2NVX H;  3G48 A;  3AYH B;  4AH6 A;  1HZA A;  3D0F A;  2IT1 A;  4P75 A;  3PO3 H;  4X64 Q;  3STB C;  1PFS A;  4EX5 A;  5IYB G;  2K4K A;  5JJK A;  3HKS A;  3PO2 G;  4X64 L;  4JI8 Q;  3E9I A;  4X6A H;  3JC6 6;  2HHH Q;  2N8N A;  1RL2 A;  3KF8 B;  2VZA A;  3RN2 A;  4JI8 L;  1KL9 A;  2JK8 A;  4OXP A;  3UDI A;  2HHH L;  2JA5 H;  4IO9 A;  2KEN A;  4YWM A;  2Y0S E;  2YTX A;  1SRU A;  4L5S A;  1IYJ B;  4KI0 A;  3M4Q A;  3D31 A;  3A5U A;  3K0X A;  2IX0 A;  1TWH H;  3RLO A;  2VQE Q;  4BBS H;  1KXL A;  3S1M H;  4GOP A;  2LXK A;  2RCN A;  1VQN A;  3BZC A;  5IE8 A;  4DK6 C;  4A3E G;  2VQE L;  2D62 A;  4P73 A;  1PYS B;  4LF6 Q;  2JEA I;  2A19 A;  4OON A;  2UXC Q;  1IBK Q;  4R4T A;  1VQ7 A;  2EQS A;  4LF6 L;  1LYL A;  1PH3 A;  1PH9 A;  1KQS A;  1JJ2 A;  2E5L Q;  2NVQ H;  2UXC L;  2ALY B;  3H3V I;  1S3O A;  1IBK L;  4LFC Q;  3I2Z A;  1J6Q A;  2IHF A;  3KF6 A;  3KJP A;  1BBU A;  2E5L L;  1L0W A;  2E2J H;  4LFC L;  1VQF A;  1PH2 A;  1HZB A;  3J81 c;  1S40 A;  1A0I A;  1AE2 A;  2MNA A;  2WFW A;  4X66 Q;  2AKW B;  3GTJ H;  1T9H A;  4OWW B;  4A3L H;  4YHH Q;  3A74 A;  4X66 L;  1K9M C;  4IPD A;  1LM0 A;  4LF9 Q;  4YHH L;  4JV5 Q;  4DAY B;  4BA1 I;  4DK3 C;  4JV5 L;  3OTO Q;  1VQM A;  2K75 A;  4QQB X;  1CSQ A;  3AEV A;  1A62 A;  3CCE A;  2OTL A;  4NPS A;  3OTO L;  2JA5 G;  5IYD H;  4IOC A;  4LUZ A;  5C4X H;  4A3F H;  1PYB A;  2B29 A;  1W3S A;  2WB1 G;  1HH2 P;  3L0O A;  4UP8 A;  3W5O A;  4KLK A;  4P74 A;  1NJI C;  4RG1 A;  5M3M G;  4GNX A;  4QJF A;  4C3H H;  1N32 Q;  4BXX G;  1L1O A;  1E7Z A;  2AWO A;  4B3M Q;  1PH7 A;  1WYD A;  5IP9 H;  3H0G G;  4A3B H;  4AIM A;  1JJC B;  4O2D A;  1HR0 W;  3M4P A;  4B3M L;  1WCM H;  5C44 H;  2BH8 A;  3K7A H;  3E0E A;  3MXN B;  1WFQ A;  3HOU G;  1X56 A;  1VQE A;  5C3E G;  4FDB A;  1AH9 A;  2N78 A;  1VQC A;  4A3J H;  2UUB Q;  4DR4 Q;  1E1O A;  1EIF A;  1E22 A;  1YJN A;  4MNO A;  5C0X G;  1Q86 C;  3AFP A;  2UUB L;  2CQO A;  4DR4 L;  2GN5 A;  1X3G A;  5M5W H;  3KDF B;  4IPH A;  2R6G A;  3CXC A;  4R4C A;  2K5V A;  3CC7 A;  3FHW A;  3GTK H;  3HOV G;  5GAE C;  1HZC A;  3PF5 A;  5IWA Q;  1QZG A;  2JA8 H;  5ELO A;  1Y1V H;  2OCE A;  4A3L G;  3CCS A;  2B3G A;  1X9N A;  2JA6 G;  1XJV A;  5IWA L;  1P8L A;  4HIO A;  4A3C H;  1VCI A;  1ASY A;  3HOY H;  4P71 A;  3I4N H;  4OO1 G;  1I50 H;  1JT8 A;  3EBE A;  4GS3 A;  5GAH C;  4JI5 L;  4OWT B;  4JI1 Q;  3PIO A;  3S16 H;  1N9W A;  1U5K A;  2JJQ A;  5IYD G;  4UP7 A;  5E7N A;  4JI1 L;  3GTM H;  4A3D G;  3CMA A;  3J80 i;  4BBR G;  1JJG A;  1XNR Q;  3U50 C;  3OYY A;  2VW9 A;  4MTN A;  3RNU A;  4P72 A;  1I5F A;  4BY1 G;  2QGQ A;  4Y7N H;  4GKK Q;  1XNR L;  1NTG A;  3UE1 A;  2IX1 A;  1KRS A;  3PV0 A;  3CCQ A;  1S72 A;  2IY5 B;  4YWL A;  3RZD H;  4GKK L;  4IOA A;  4HID A;  3EN2 A;  2VS1 A;  3WWV A;  1Q1B A;  1PHJ A;  4DNI A;  2Z6K A;  4JBK A;  1KD1 C;  1VQ8 A;  1CKN B;  1I6H H;  4OWX B;  1CKM A;  2MO0 A;  4A3J G;  2K50 A;  4XTC S;  1A63 A;  2CFM A;  4IPG A;  1MIU A;  1V9P A;  2WP8 J;  1V43 A;  2B63 G;  5JEA G;  3SGI A;  3HOZ H;  2BA0 A;  1YEZ A;  1OXT A;  2LXJ A;  4YWK A;  4JI2 Q;  4APV A;  2R92 G;  2R7Z H;  1NE3 A;  4A3I G;  1VQJ A;  2DGY A;  1VQG A;  1Y1V G;  2ID0 A;  4JI2 L;  4IFD G;  3L7Z C;  3K8A A;  3MEF A;  4LF4 Q;  3CC2 A;  1KAW A;  1HZ9 A;  5M5X H;  2OTJ A;  3U4V A;  4TQU S;  1QZH A;  1G51 A;  1GVP A;  3NEL A;  4LF4 L;  2F4V Q;  4HJ5 A;  4X65 Q;  1HNW Q;  3TRE A;  5FLM H;  1UE7 A;  3M3Y H;  1C0A A;  4DR2 Q;  1Y1W H;  1K3R A;  1OXU A;  2F4V L;  5IP7 G;  3I4M G;  4X65 L;  3DM3 A;  1M1K C;  1HNW L;  4JYA Q;  2C35 B;  3KLW A;  2F52 A;  3M9B A;  4DR2 L;  4LNQ A;  1N36 Q;  3S15 H;  5HY6 A;  2ASB A;  2WAQ G;  4JYA L;  3KYH C;  1N36 L;  3UDG A;  4R4I A;  1QVC A;  3KFU A;  1SLJ A;  1E1T A;  4MZ9 A;  3HKZ G;  3OW2 A;  2ZTE A;  3RLF A;  4QGU A;  1VQP A;  3ER0 A;  4DUZ Q;  5FJ8 H;  2AWN A;  4L5R C;  3F2C A;  1DGS A;  4JBM A;  1OXS C;  5M3F G;  1E24 A;  4DUZ L;  3HOX H;  1PH8 A;  1EWI A;  1UE1 A;  3JAM i;  1VQK A;  1X6O A;  2I5M X;  3HOW G;  2D0P A;  3CF5 A;  2YYZ A;  2VL6 A;  4A75 A;  1YIT A;  2JA7 H;  3S2H H;  4LW1 A;  4A93 H;  3ULL A;  2R93 G;  1I3Q H;  3BJU A;  1K8G A;  4A3G H;  1G6P A;  4QL5 A;  1UEB A;  4KHP Q;  3CW2 C;  4L5T A;  3PO3 G;  1D7Q A;  5J3B A;  1YVC A;  1YI2 A;  2WAQ E;  4A4I A;  4DV1 Q;  3VDY A;  1GM5 A;  3RR5 A;  4KHP L;  1RIP A;  1PH1 A;  4YCV A;  3HKZ E;  4DV1 L;  1FJG Q;  4B3S Q;  3NEN A;  1MJC A;  1SRO A;  1Q7Y C;  1HNZ Q;  4POG A;  1FJG L;  2N49 A;  2KBN A;  1L2F A;  1N8R C;  1BBW A;  4R4O A;  5LMN W;  1KIX A;  4B3S L;  4LF5 Q;  2BH2 A;  1B8A A;  1K73 C;  2ZJQ A;  1HNZ L;  4DR6 Q;  4Y52 H;  1K0R A;  5BR8 Q;  2A8V A;  2ZJP A;  4LF5 L;  3UE0 A;  4UP9 A;  2JQO A;  3CQZ H;  4DV6 Q;  2EXD A;  4BBS G;  4DR6 L;  5BR8 L;  1IBL L;  4LF8 Q;  2KHI A;  4H02 A;  1PA6 A;  4TVA B;  3CPF A;  4DV6 L;  2Z6K C;  1X65 A;  4C2M H;  1XPR A;  4XIG S;  1FVI A;  4JOI A;  3RLN A;  4GOP B;  4LF8 L;  1GD7 A;  3H3V H;  1Z9F A;  2XGT A;  4GKJ Q;  1JE5 A;  4DV2 Q;  2N3S A;  3NBH B;  4GLA C;  2NN6 G;  1EFW A;  3J81 i;  2PNH A;  4GKJ L;  4PMW A;  3T1Y Q;  1Q81 C;  4EQ5 A;  3PUZ A;  2HQL A;  4DV2 L;  2ZJR A;  1YHQ A;  1VQL A;  3FKI H;  1NY4 A;  3I7F A;  4A3K H;  1XPO A;  3PIP A;  3GTG H;  3T1Y L;  2OQ0 A;  1X3F A;  3PGZ A;  4PZ7 A;  5GQO A;  5M5Y H;  1EQR A;  1OXV A;  2WB1 E;  3G4S A;  1NMF A;  4DR1 Q;  2ZTD A;  3J80 c;  4DR3 L;  3UDF A;  4JI4 L;  2GVA A;  1QUQ A;  1E3P A;  2NVT H;  1P16 A;  3F2B A;  1CKN A;  4DR1 L;  1Q12 A;  3J81 j;  5JJI A;  5DLQ E;  3M4O H;  1HJP A;  2ZTC A;  3IRB A;  4R4Q A;  3RZO H;  2QEX A;  2Q2T A;  4WJ3 M;  4A3M H;  1YHB A;  4JI5 Q;  5GRO A;  2NZH A;  3F8T A;  5FLX c;  3STB D;  3TS0 A;  2CKZ B;  2UU9 Q;  4JI4 Q;  3I4O A;  1EYG A;  2JE6 I;  1K83 H;  3DLL A;  5K36 G;  4GOP C;  2K5H A;  3BU2 A;  4GLV B;  2UU9 L;  5C4X G;  4A3F G;  1G29 1;  4ALP A;  1X55 A;  1VQ4 A;  3GTQ H;  5IYB H;  2MQH A;  4HJ8 A;  4HIK A;  4DV3 Q;  2Z0S A;  3CAM A;  2BA1 A;  2LSS A;  3T1H Q;  2RHS B;  4DV3 L;  2EIF A;  3PUW A;  2HIV A;  1KHI A;  2V1C C;  3T1H L;  4PZ8 A;  5IP9 G;  3PUV A;  1XTD A;  1YHA A;  5AJ3 Q;  3CCU A;  4A3B G;  2I0Q A;  1WCM G;  3W1G A;  1B7Y B;  5IT9 c;  5C44 G;  1KC8 C;  4BY7 H;  5AJ3 L;  4LUO A;  2FXQ A;  3PUY A;  1PVO A;  4A76 A;  1Q82 C;  4OX9 Q;  4GN4 B;  1JMC A;  3LGJ A;  1HR0 Q;  1BKB A;  1SR3 A;  4A3E H;  1SE8 A;  4NXN Q;  4JC0 A;  4DV5 Q;  4OX9 L;  2XTI A;  1HR0 L;  3H15 A;  1WOC A;  1YZ6 A;  1CSP A;  5EAY A;  2Q2I A;  4NXN L;  4DV5 L;  1YBY A;  3L2P A;  4JI0 Q;  3S2D H;  4JG2 A;  1Q1E A;  3PF4 A;  1CKO A;  2JA8 G;  4B3R Q;  1EOV A;  1PH6 A;  1IZ6 A;  1VQ9 A;  4JBJ A;  4K0K Q;  1WJJ A;  4JI0 L;  1MKH A;  2NN6 I;  4JBW A;  1OTC A;  4B3R L;  1VQD A;  1B70 B;  2YV5 A;  5C0X I;  2JEB I;  2ZM6 Q;  3CC4 A;  4DR7 Q;  3CCV A;  4A3C G;  2CWP A;  4DUY Q;  3HOY G;  4K0K L;  3I4N G;  1BVS A;  4GN5 A;  3S1N H;  4GNX C;  1KRT A;  2ZM6 L;  4DR7 L;  4DAM A;  5IYC H;  3M85 A;  4DUY L;  2KHJ A;  3S1Q H;  1L1O C;  3KJO A;  2AMC B;  3G6E A;  2KCM A;  3TEH B;  3ERS X;  4DR5 Q;  1XMO Q;  4KHZ A;  1TWG H;  4JI7 Q;  1A8V A;  3GD7 A;  1VQ6 A;  4JOI C;  1EIY B;  5IY0 A;  1NBW A;  4DR5 L;  1XMO L;  3GTL H;  2VNU D;  5C4J H;  2E2I H;  3F1Z A;  1CUK A;  1Y14 B;  1SMX A;  3I56 A;  2VQF Q;  4DV4 Q;  4JI7 L;  4OO1 I;  1LUZ A;  1VQH A;  2VQF L;  4DV4 L;  4B3T Q;  1QVF A;  1Q8K A;  3ULP A;  2Q2U A;  4B3T L;  1PV4 A;  4UY8 C;  4IJL A;  4HJ7 A;  5M3M H;  4BY7 G;  2PQA B;  1N33 Q;  4RMF A;  1VQ5 A;  1C7Y A;  2VUM H;  4L5Q A;  4BXX H;  3U58 A;  2AHO B;  4AYB G;  1N33 L;  4QIW E;  3TQY A;  3CPW A;  4LFB Q;  3H0G H;  2L15 A;  2K52 A;  1VQI A;  5GAD C;  5ELN A;  3BZK A;  5HGQ A;  1XNQ Q;  2I5L X;  3HOZ G;  5GAG C;  1D8L A;  4LFB L;  3PSI A;  1R9T H;  1IBM Q;  3HOU H;  5C3E H;  4HIM A;  1QVG A;  2I5H A;  2E8G A;  4IPC A;  3K7U C;  2R7Z G;  1XNQ L;  2IHE A;  2R7F A;  3J7A 5;  1TWF H;  1IBM L;  1K8A C;  1W2B A;  3KDF A;  3AQQ A;  4DV7 Q;  1X3E A;  2K14 A;  2KCT A;  4O0A A;  2HIX A;  2E2H H;  4DKA C;  4DV7 L;  2A1A A;  3FP9 A;  1GKH A;  4YY3 Q;  3HOV H;  5IYC G;  5FLM G;  1IBL Q;  3M7N A;  3A0J A;  1Y1W G;  4YY3 L;  1YJ9 A;  4AYB E;  2JA6 H;  2PI2 A;  2JA9 A;  1IXR A;  3F2D A;  4IFD I;  2Q2H A;  4PZ6 A;  2OQK A;  1VS0 A;  2VY3 A;  3HFZ B;  3A5Z B;  2YTY A;  4R1J A;  3GO5 A;  4LF9 L;  1TXY A;  1U0L A;  5C0X J;  2ATW A;  4BA2 I;  1ASZ A;  3RN5 A;  1N34 Q;  3CCM A;  2HT1 A;  4UPA A;  2MO1 A;  4IJH A;  3NEM A;  4X62 Q;  1XPU A;  3TS2 A;  5H1S E;  1NMG A;  1N34 L;  5FJ8 G;  4YCW A;  1TWA H;  4A3D H;  4X62 L;  3ZJY C;  4BBR H;  4DR3 Q;  2UUA Q;  3HOX G;  4LF7 Q;  3PCO B;  4C3J H;  1VQO A;  3KF6 B;  1OXX K;  1J5E Q;  4BY1 H;  2JA7 G;  5JJL A;  3PUX A;  2VUM G;  2K5N A;  4LF7 L;  2UUA L;  3EIV A;  2CWA A;  1J5E L;  4A93 G;  1PH5 A;  3TRZ A;  4A3G G;  1N32 L;  4JI6 Q;  3CCL A;  2R7D A;  4NB3 A;  4JI3 Q;  1IL2 A;  3CP0 A;  4JI6 L;  4WJ4 A;  3I55 A;  1VQB A;  4JI3 L;  2RF4 A;  3S17 H;  3K80 C;  2DUD A;  3J7Z C;  3E9H A;  2B63 H;  1Z47 A;  2MFI A;  1LTL A;  1UWV A;  5LMU Q;  1YNX A;  1O7I A;  1WI5 A;  1C9O A;  2R92 H;  3PO2 H;  1SN8 A;  4PG3 A;  4A3I H;  1GO3 E;  1VQA A;  2GVB A;  4ME3 A;  1V1Q A;  1UE6 A;  5LMU L;  4AQY Q;  1Q46 A;  2NVY H;  2CCZ A;  2PI2 E;  4AQY L;  4GNX B;  2H5X A;  1FGU A;  2UXB Q; 
#chains in the Genus database with same CATH topology
 3CCR A;  4LUV A;  4X3S A;  3G71 A;  2UUC Q;  2CH4 A;  1ROD A;  3SXH A;  5I6Y A;  1JWS D;  4LFA Q;  5KNC A;  1FL0 A;  3VYR A;  1JB7 A;  4JCV E;  3CD6 A;  3FKI G;  4K5W A;  2Q8T A;  1PRT F;  4FXD A;  4J15 A;  4DV0 Q;  3K81 C;  3ULJ A;  3AFQ A;  4LWC A;  1TWA B;  4A3D B;  2O2L D;  2YTV A;  4BBR B;  2Y0S G;  4C3J B;  1KDC A;  3CCJ A;  1EY5 A;  1I4R A;  4BY1 B;  2DNC A;  4CKB A;  1X54 A;  3G48 A;  4RGT A;  2IT1 A;  4P75 A;  4CHT B;  5E4X A;  4X64 Q;  1PMR A;  3S17 B;  2F0G A;  3PO2 G;  3SR1 A;  3JC6 6;  3SVM A;  3BYY B;  1D1K A;  2EPB A;  3KF8 B;  2VZA A;  4OXP A;  4M8A A;  2MGS A;  3KLR A;  2HHH L;  1RHP A;  4LK1 C;  5FK9 C;  2HCI A;  2Y0S E;  2YTX A;  4IUU A;  4G7H C;  3PO2 B;  1IYJ B;  4A3I B;  1HQR D;  1Y1V B;  1MGS A;  3M4Q A;  2TMP A;  3D31 A;  2NVY B;  3OPO A;  2A69 C;  5IIF A;  5IE8 A;  4U68 A;  2D62 A;  2JEA I;  1PYS B;  1MD2 D;  1WTQ A;  1ENA A;  4QIW B;  3V96 A;  2XVS A;  4LF6 L;  3I4M B;  2EYH A;  1LYL A;  1KQS A;  1STB A;  5E1F A;  2A68 D;  2UXC L;  2ALY B;  3H3V I;  1IBK L;  1J6Q A;  1F2M A;  3KF6 A;  2WAQ B;  2E2J H;  2Z6B A;  1PH2 A;  2WFW A;  3GTJ H;  2YU9 B;  4FF3 A;  4YHH Q;  4NKL A;  1XX8 A;  5BN4 A;  2KHS A;  2F0P A;  4BA1 I;  4S3S A;  1G2T A;  2DN8 A;  4JV5 L;  2K75 A;  3BVZ A;  1PFM A;  1PYW D;  2XNA C;  3CCE A;  2OTL A;  3PO3 B;  5KYL A;  2JA5 G;  5IYD H;  3NQT A;  1W3S A;  3ND8 A;  1HH2 P;  3L0O A;  2PW7 A;  4RH6 A;  4RG1 A;  4QJF A;  4C3H H;  4FP5 D;  1BXT A;  1E7Z A;  2F03 A;  2JA5 B;  2KCN A;  2AWO A;  1PH7 A;  3MEH A;  5IP9 H;  3H0G G;  4A3B H;  3E0E A;  1EYA A;  1X56 A;  2RVL A;  2N78 A;  1TS2 A;  1E22 A;  3DWA A;  2UUB L;  3I70 A;  1ZYR D;  4H13 C;  5EKL A;  2CQA A;  2MPM A;  3CC7 A;  3Q0A A;  1EY0 A;  1JWM D;  3GTK H;  3HOV G;  1UNS A;  4ZKC B;  4A3L G;  5IWA Q;  4K5V A;  2OCE A;  3CCS A;  2B3G A;  4UDU C;  2IL8 A;  4RGO S;  3D6W A;  4DNT B;  1Y69 U;  4OWT B;  4JI1 Q;  1N9W A;  2JJQ A;  2B39 A;  2CVR A;  2PCF B;  1JJG A;  4FF4 A;  3OYY A;  2VW9 A;  4P72 A;  1I5F A;  2LY7 A;  4DA2 A;  5ELF A;  1KRS A;  3S9W A;  3FMC A;  2IY5 B;  4YWL A;  3RZD H;  4GKK L;  4HID A;  2A69 D;  4QMG A;  5J1Z A;  3R93 A;  3CRL C;  2RDH A;  2LS0 1;  3IAY A;  3P20 A;  1CKM A;  3QR8 A;  4XTC S;  2CFM A;  3EQL C;  1MIU A;  1KTK A;  2B63 G;  2F0J A;  1WCM B;  3J81 L;  1YEZ A;  2K05 A;  1LT4 D;  4APV A;  2R92 G;  1S5D D;  1V1P B;  1STY A;  3BDL A;  5CV4 A;  4IFD G;  3L7Z C;  3ERO A;  5EGT A;  5M5W B;  3MEF A;  1WD1 A;  3CC2 A;  5M5X H;  3AB9 A;  4WOR A;  1A15 A;  2K28 A;  3L9A X;  4TQU S;  1SNM A;  5D65 A;  3E5S A;  1PDQ A;  4TSS A;  4BWG B;  1C0A A;  4DAY A;  1Y1W H;  2F4V L;  1K8M A;  2EVB A;  2F0I A;  5HY6 A;  3I4N B;  5C3X A;  1N36 L;  1SLJ A;  1E1T A;  4MZ9 A;  3S16 B;  1F2Y A;  1ENF A;  2K33 A;  5FJ8 H;  5CV9 A;  2F0S A;  3F2C A;  1DGS A;  4JBM A;  2PQE A;  2HUG A;  3HOX H;  3GP7 A;  3PQI A;  1X6O A;  2I5M X;  5CV6 A;  3MA2 B;  4C1N I;  3CF5 A;  4A75 A;  3ULL A;  4FF1 A;  3MXN A;  1K8G A;  1G6P A;  4ZK9 B;  3A8I E;  1B3A A;  3CW2 C;  5J3B A;  2NZ1 D;  1GM5 A;  5EBD A;  2QIL A;  1S5C D;  5IGD A;  1H9S B;  2OXP A;  1MJC A;  2FHT A;  4POG A;  1FJG L;  2CW0 D;  2R7Z B;  2KBN A;  1N8R C;  5E4W C;  4LF5 Q;  3A8J E;  3IKJ A;  5EJW A;  4DR6 Q;  2A8V A;  2ZJP A;  2JQO A;  3CQZ H;  2EXD A;  1BR9 A;  2Z8L A;  5BR8 L;  1FR3 A;  4H02 A;  3CPF A;  2Z6K C;  4JOI A;  3RLN A;  3M3Y B;  4RFB A;  4OGQ C;  3VR6 A;  1JE5 A;  5CV8 A;  3HS0 C;  1SXT A;  2N3S A;  4GLA C;  1B44 D;  3S15 B;  2F3V A;  2K04 A;  2VB3 X;  4PMW A;  3VR5 A;  3T1Y Q;  4EQ5 A;  1U4P A;  2HQL A;  1KAA A;  5COR A;  2OQ0 A;  5LMN W;  2WB1 E;  4LAA A;  1GUO A;  1V8Q A;  3UDF A;  2EOT A;  5EKI A;  3LWE A;  1CKN A;  1Q12 A;  5TSS A;  4B9W A;  4KY6 A;  4XT3 B;  3IRB A;  3RZO H;  2QEX A;  2Q2T A;  4A3M H;  5IGE A;  4XQJ A;  4A93 B;  5LL6 S;  3F8T A;  2CKZ B;  3K0Y A;  1O80 A;  1PLF A;  1ET6 A;  2UU9 L;  3K59 A;  1G29 1;  4ALP A;  4G7Z C;  1X55 A;  2RSN A;  2NTT A;  1VQ4 A;  3GTQ H;  2MQH A;  2WAC A;  4HIK A;  4DV3 Q;  2Z0S A;  3CAM A;  5DAU A;  2RHS B;  4C3H G;  3PUW A;  2HIV A;  5ISR A;  4UHV A;  2V1C C;  5IP9 G;  3PUV A;  1TU2 B;  4A3B G;  3NTI A;  1CK1 A;  1G2S A;  1HCZ A;  5AJ3 L;  2FXQ A;  4OX9 Q;  3LGJ A;  1WTH A;  3FPP A;  3K6O A;  1BKB A;  1DOK A;  1SR3 A;  4A3E H;  1SE8 A;  4NXN Q;  4JC0 A;  3H15 A;  1M8A A;  5JAV A;  1AEX A;  1EYD A;  2EY5 A;  2Q2I A;  4DV5 L;  3BVM A;  2A5H A;  1PTO C;  1STH A;  3VYS A;  1PH6 A;  2HCC A;  1WJJ A;  1WD0 A;  3OW7 A;  1MKH A;  1F2Z A;  1OTC A;  3GTG B;  4B3R L;  4N9T A;  2CWP A;  1M4V A;  1V1O A;  4GNX C;  2ZM6 L;  4DR7 L;  4DAM A;  4DUY L;  2KHJ A;  3SK6 A;  1QIL A;  1NUC A;  3M4O B;  1MBY A;  2M00 A;  1LTB D;  1X3P A;  3ERS X;  1XMO Q;  3OMG A;  2NWG A;  1EIY B;  5IY0 A;  4DR5 L;  4H44 C;  4DXF A;  1CUK A;  3T16 A;  4DV4 Q;  1U4M A;  1BO0 A;  2B2W A;  4PNY A;  4CDD C;  3ULP A;  2Q2U A;  4KN7 C;  4Q5V A;  2IW3 A;  1K3B C;  2VUM H;  4BXX H;  3EJI A;  4RHR A;  3G7L A;  3TQY A;  3CPW A;  1VQI A;  4MN3 A;  1R4Q B;  5ELN A;  1I4X A;  2EZV A;  1D8L A;  2OEO A;  1R9T H;  3J80 L;  4IPC A;  5EPL A;  4K2K A;  2DY8 A;  1QCB D;  5HGT A;  1W2B A;  1MSH A;  1HPC A;  2KCT A;  2HIX A;  1K28 A;  4ZYS A;  2A1A A;  3FP9 A;  3BVG A;  4OEL B;  1Q90 A;  2QCP X;  2L9H A;  3A0J A;  1Y1W G;  2HDM A;  1YJ9 A;  3NWT A;  1BUV T;  2Q2H A;  2VY3 A;  4RAU C;  4KJO A;  4ZRZ A;  1TXY A;  1U0L A;  2X6L A;  2AUK A;  1GHJ A;  3CCM A;  3D6C A;  3NEM A;  1XPU A;  3TS2 A;  1JOQ A;  1NMG A;  1N34 L;  5FJ8 G;  4YCW A;  2Z4H A;  1TWA H;  4A3D H;  4X62 L;  1B1Z A;  3GTL B;  2K5Q A;  4BBR H;  4DK0 A;  4DR3 Q;  3HOX G;  4C3J H;  1SJH D;  1VQO A;  3KF6 B;  1J5E Q;  1ZXT A;  4BY1 H;  3KLS X;  2K5D A;  2CWA A;  1WVL A;  5G3L F;  3CCL A;  3SK8 A;  1RKN A;  3ITP A;  1SYF A;  3CP0 A;  4NB3 A;  5M3M B;  4JI3 Q;  2B2U C;  1TWH B;  4C56 C;  2RF4 A;  3S17 H;  3IL8 A;  3RMH A;  2DUD A;  2F0D A;  3E9H A;  5JEA H;  1PTO D;  1Z47 A;  4R8N A;  1V1P A;  1DOL A;  4HCE A;  3HOU B;  5C3E B;  2KOL A;  2BE5 C;  2C5C A;  3MTS A;  3R2T A;  3PO2 H;  1TWF B;  3GV3 A;  2BCO A;  4A3I H;  1GO3 E;  1VQA A;  4ME3 A;  5LMU L;  1V1Q A;  1K8O A;  5DNF A;  2NVY H;  2E2H B;  2Z1C A;  1I4Q A;  3GDE A;  3CME A;  1UAP A;  1LT5 D;  1GUW A;  4K5X A;  1HHV A;  3MXP A;  2ES2 A;  4GN3 B;  1HNX L;  2JA6 B;  3I4M H;  2UXD Q;  4NXM Q;  1I94 L;  2M2L A;  4WRD A;  4XYQ A;  2B2T C;  4GLX A;  2PMZ E;  1JE4 A;  2B2V C;  2YU9 H;  1XMQ Q;  5LMN Q;  3W1B A;  2D0O A;  5FOB B;  1QUQ B;  5ELE A;  4DGZ A;  4H0L C;  4A3M G;  2OWO A;  1O7Z A;  4DK1 A;  3V05 A;  3AU7 A;  1PXU A;  1DD2 A;  3JAM c;  4HJ9 A;  1HZA A;  3PO3 H;  3STB C;  1PFS A;  4EX5 A;  1IL8 A;  5JJK A;  3E9I A;  4X6A H;  4JI8 L;  1KL9 A;  4O42 A;  2JA5 H;  2A74 C;  4IO9 A;  4N8X 1;  4L5S A;  3K0X A;  2H4O A;  2IX0 A;  3RLO A;  2VQE Q;  2LXK A;  1W6J A;  1YNJ C;  4A3E G;  2VB2 X;  4P73 A;  1EY9 A;  4RKL A;  4XT1 B;  1VQ7 A;  2EQS A;  5CV5 A;  1PH3 A;  1PH9 A;  2E5L Q;  3I2Z A;  2IHF A;  1BBU A;  3DEO A;  4OHJ A;  2DJF C;  4LFC L;  1S40 A;  2MNA A;  3HKZ B;  2AQ1 B;  2NBF A;  4L6T B;  3TP8 A;  4I7Z C;  1TWC B;  4A3L H;  3FEW X;  3GTP B;  4X66 L;  4IPD A;  4DXG A;  1CZW A;  3HOW B;  4DAY B;  4C3I B;  2QDB A;  2F0W A;  4DK3 C;  4KY5 A;  1EU3 A;  3OTO Q;  4QQB X;  1DM0 B;  1CSQ A;  2HQE A;  3BYT B;  3TP5 A;  2QKI C;  3K58 A;  5K36 H;  4JVZ A;  2WIN B;  3NQI A;  4UP8 A;  4K6L A;  4KLK A;  4P74 A;  1ENC A;  3QIA A;  1KLU D;  4BXX G;  1L1O A;  4B3M Q;  2K1B A;  1O7Y A;  1CQF A;  4O2D A;  2HD3 A;  1HR0 W;  3M4P A;  1WCM H;  3K7A H;  3MXN B;  1WFQ A;  4BBS B;  3S1M B;  2EDG A;  3SDZ A;  4DR4 Q;  1E1O A;  1EIF A;  3T53 B;  4MNO A;  5C0X G;  3FDT A;  5ELC A;  3JAM E;  5D3D A;  5M5W H;  1EWC A;  3QOL A;  2R6G A;  2E74 C;  5GAE C;  3PF5 A;  1QZG A;  1JIC A;  3AMU A;  1P8L A;  1ICF B;  4A3C H;  2L11 A;  2F0U A;  1DZ1 A;  3I4N H;  3T56 B;  3RD4 A;  1RCV D;  1JT8 A;  2QEJ C;  3TP7 A;  3S16 H;  3MHB A;  1U5K A;  3VA5 A;  4XDX A;  4UP7 A;  5E7N A;  1EIH A;  4A3D G;  5DM6 3;  1BCP D;  3J80 i;  1HQM C;  4BBR G;  1XNR Q;  3U50 C;  4C3J G;  4BY1 G;  1SNQ A;  1AW7 A;  2F0F A;  2X6G A;  4IUT A;  1HXY D;  3CCQ A;  1S72 A;  4G4K A;  4IOA A;  5IGB A;  4HSV A;  1PHJ A;  2Q8R E;  3K57 A;  4LMQ D;  1CKN B;  1Q8I A;  2A73 B;  4F7X A;  1B3Q A;  4A3J G;  5C6A A;  4K6D A;  1V9P A;  5JEA G;  1NR2 A;  3NP8 A;  4N8F A;  3K5O A;  4A3J B;  2EJG C;  3P1H A;  1LTI D;  4R9W A;  2R7Z H;  3A8K E;  4A3I G;  2DGY A;  3LWU A;  1Y1V G;  4JI2 L;  1XWE A;  1PZI D;  1XXG A;  3DMU A;  2L0C A;  1EY7 A;  4LF4 Q;  2RSO A;  1HZ9 A;  5C4H A;  1O7L A;  1B9N A;  1GVP A;  2J7Z A;  2JA8 B;  3M3Y H;  2PNR C;  4DR2 Q;  4XXE A;  3I4M G;  5T1I A;  1HNW L;  3SHL A;  4X65 L;  2C35 B;  3HGB A;  3M9B A;  3S15 H;  2SEB D;  4CJ1 B;  2WAQ G;  1I50 B;  4JYA L;  4MIU A;  3UDG A;  1QVC A;  3KFU A;  2I07 B;  1F2L A;  4DUZ Q;  4L5R C;  1UUP A;  2RKS A;  4X3T A;  1E24 A;  4TKO B;  1PH8 A;  4ZCK A;  1SNC A;  3JAM i;  1VQK A;  4Y7N B;  2D0P A;  2YYZ A;  3ERQ A;  4A93 H;  4QL5 A;  3CRK C;  1UEB A;  1AP0 A;  3PO3 G;  4BY7 B;  1D7Q A;  1YVC A;  1YI2 A;  2WAQ E;  4F8M A;  4DV1 Q;  4KHP L;  3RR5 A;  1ZEQ X;  1WTR A;  1RIP A;  1PH1 A;  2ZXP A;  3I4L A;  3SE0 A;  2ENB A;  2EJF C;  4X3K A;  4IUQ A;  3PIP 3;  1SRO A;  1LLR D;  4ABN A;  1KNE A;  1Q3L A;  4B3S L;  1L2F A;  1BBW A;  1KIX A;  2ZJQ A;  1HNZ L;  4Y52 H;  1EIG A;  3UE0 A;  4DV6 Q;  4LF8 Q;  2KHI A;  4QUC A;  5FO8 B;  4TVA B;  1X65 A;  1XPR A;  2HDL A;  4XIG S;  4J6H A;  1SNP A;  1U4L A;  1F9S A;  1Z9F A;  2XGT A;  4RA8 A;  1X3Q A;  1EFW A;  2PNH A;  1TWG B;  2AUJ D;  4GKJ L;  1Q81 C;  1TVX A;  4DV2 L;  2ZJR A;  3QOJ A;  3TN2 A;  3I7F A;  1XPO A;  3PIP A;  3GTG H;  1BQQ T;  4PZ7 A;  3G4S A;  1NMF A;  4DR3 L;  4JI4 L;  1QUQ A;  3NTK A;  4OIK A;  4DR1 L;  5DLQ E;  3M4O H;  1HJP A;  1ILP A;  1AZP A;  2JA7 B;  1HFN A;  4WJ3 M;  2BOS A;  3X3N A;  1YHB A;  3S2H B;  4JI5 Q;  4JW0 A;  4GZY C;  4NDX A;  5K36 G;  4MHE A;  2JE6 I;  1EYG A;  1RD9 D;  4GOP C;  1SMY C;  5IOC A;  4GLV B;  1PTO B;  5IYB H;  4HJ8 A;  1MHW C;  2OF1 A;  2LSS A;  5CGK A;  3T1H Q;  1PZK D;  4KHV A;  5DEH A;  1VMP A;  4K14 A;  2P5Z X;  3BDC A;  1O78 A;  3H94 A;  2I0Q A;  1WCM G;  4ZUJ A;  1B7Y B;  3W1G A;  4V0B A;  1RJT A;  4KD3 A;  5F2D A;  4R8I A;  4A76 A;  1Q82 C;  1JMC A;  1HR0 Q;  1B9M A;  2KEE A;  3OIP A;  4C2M B;  1WOC A;  3P75 A;  5EAY A;  3W2D A;  3S2D H;  5EBC A;  1EOV A;  1VQ9 A;  2G9H D;  4JBJ A;  4K0K Q;  4JI0 L;  4A3K B;  3CKI B;  1VQD A;  2YV5 A;  3Q6S A;  4A3C G;  2EYJ A;  1NNX A;  2AQ2 B;  2LMC B;  4KK7 A;  3I4N G;  2F0L A;  2NVT B;  4X3U A;  3OOC A;  3M85 A;  2EE1 A;  1TS3 A;  4EQN A;  1F9R A;  4XYO A;  1UEA B;  2N55 A;  1EFI D;  2KCM A;  4KHZ A;  1TKW B;  4KKS A;  4JI7 Q;  3LNN A;  4JOI C;  1GJX A;  1NBW A;  3GTL H;  1S4Z A;  1S5E D;  1SMX A;  1K83 B;  2F3W A;  1EYC A;  4N9P A;  4OO1 I;  3IFD A;  2G5D A;  2VQF L;  1A3V A;  3U9O A;  1QVF A;  1IW7 C;  2L12 A;  2NTS A;  2O5I C;  3I73 A;  4B3T L;  2ZT9 C;  5DM7 3;  5M3M H;  2FMM A;  1N33 Q;  4FF2 A;  4RKB A;  2AHO B;  1EQT A;  4RGM A;  4IUR A;  4LFB Q;  2RDG A;  3NBH A;  2XWB B;  3BZK A;  2I5L X;  5KIX A;  3HOU H;  1KDB A;  5C3E H;  4HIM A;  2R7Z G;  1XNQ L;  1TWF H;  2PZU A;  1IBM L;  2K14 A;  5IGG A;  2E2H H;  4DV7 L;  4ZAI A;  4KKU A;  1IBL Q;  1HA5 A;  4CKC A;  4YY3 L;  2JA6 H;  2JA9 A;  1BF4 A;  3F2D A;  2PYK A;  2OQK A;  4CJ2 C;  2ATW A;  1SMY D;  5M9O A;  3S1Q B;  5JPM C;  1DCZ A;  3RN5 A;  2DNE A;  2HT1 A;  4UPA A;  3T4A C;  2MO1 A;  2X69 A;  5A2Q E;  3H91 A;  4WFN 3;  1KAB A;  5C4J B;  4LF7 Q;  2E2I B;  2H1E A;  1OXX K;  5D3I B;  2UUA L;  4A93 G;  3TRZ A;  2WKC A;  2WB1 B;  4JI6 Q;  1EWH A;  2F0V A;  3MFY A;  1RF2 D;  4WJ4 A;  3I55 A;  1LT3 D;  4NW2 A;  3D4W A;  1FNV A;  3J7Z C;  2F0M A;  1D5X C;  2XN9 C;  2B2Y C;  2MJ8 A;  1WI5 A;  1C9O A;  3C1F A;  5BN3 A;  4AQY Q;  2OT2 A;  3N52 A;  2M9V A;  1A3T A;  2PI2 E;  2XRQ D;  1U4R A;  2H5X A;  5NUC A;  1FGU A;  4MTK A;  1EUJ A;  3K5M A;  1L1O B;  2ZXO A;  3S14 H;  3OMC A;  2UXB L;  2AQ3 B;  5EPK A;  1BOS A;  1YIJ A;  2UUC L;  4YCU A;  2QA4 A;  3Q8D A;  4CJ0 B;  4LFA L;  1BCP B;  4IFD J;  1IW7 D;  3U4Z A;  4IAL A;  2KCC A;  3J7Y W;  1AN8 A;  1PH4 A;  3QB3 A;  1TWC H;  4DV0 L;  2GA4 B;  1AE3 A;  3GTP H;  1E0B A;  3UDX A;  2NZO A;  2EYO A;  3HOW H;  3KUP A;  1YJW A;  4C3I H;  1M90 C;  2NVX H;  2BDN A;  3C46 A;  1F9P A;  1EL0 A;  1KNA A;  3D3R A;  2JN4 A;  3D4D A;  1JB3 A;  5ELB A;  1CQV A;  5IYB G;  2K5W A;  4RCO A;  4X64 L;  2HHH Q;  3I8Z A;  1WTO A;  2EY2 A;  1PRT C;  4KD4 A;  3RN2 A;  3WDN A;  1HFG A;  2JK8 A;  4E6I A;  3EA6 A;  3GTK B;  3MZ5 A;  5JJZ A;  4KI0 A;  3A5U A;  4ZUI A;  4BBS H;  1KXL A;  3S1M H;  1XTC D;  1VQN A;  2RCN A;  3BZC A;  2XWJ B;  4DK6 C;  4LF6 Q;  3S1R B;  2UXC Q;  4OIJ A;  1SFO B;  1IBK Q;  1H9M A;  1JJ2 A;  2MP1 A;  2NN6 H;  3FRP B;  1S3O A;  1LAC A;  5C0X H;  1Y8O B;  3KJP A;  1B53 A;  1L0W A;  1VQF A;  5K5P A;  1HZB A;  1AE2 A;  1C8C A;  1RDP D;  3WOE A;  3GTO B;  3NHH A;  1ESR A;  3HP3 A;  1JC7 A;  5M3F B;  1ICW A;  1QNU A;  1LM0 A;  1K9M C;  1LTS D;  1SAP A;  4LF9 Q;  1DXM A;  4YHH L;  4JV5 Q;  1LTT D;  1LTA D;  4J8Q A;  5ELD A;  3NUC A;  4RGN A;  2R93 B;  1IYV A;  1VQM A;  4IN3 A;  3VYT A;  4JK1 C;  1RTN A;  1KDA A;  4LUZ A;  1PYB A;  1IKM A;  2B29 A;  1C4Q A;  4NMZ A;  3W5O A;  1STE A;  5M3M G;  4GNX A;  3I90 A;  5C5L A;  2B8F A;  3MVV A;  1EY8 A;  1H9J A;  1WYD A;  1SSO A;  5CC4 A;  1JJC B;  2BH8 A;  3HOU G;  1VQE A;  1DJR D;  5C3E G;  4FDB A;  3QWN A;  4A3J H;  2UUB Q;  5KRU A;  5CBE E;  1YJN A;  1CT1 D;  4HAE A;  5HUR A;  1Q86 C;  2NB0 A;  3D8G A;  1X3G A;  1YNN C;  2K03 A;  2WV6 D;  1G8Z D;  2NVQ B;  1NR4 A;  5FKA C;  3MFG A;  4HMI A;  4RCN A;  3FHW A;  3JAM L;  1HZC A;  1LTG D;  2JA8 H;  5ELO A;  1Y1V H;  4KY7 A;  2WKD A;  1X9N A;  2JA6 G;  5IWA L;  4HIO A;  1ASY A;  1I50 H;  4GS3 A;  5GAH C;  4JI5 L;  4HR7 B;  4CGY B;  1XYI A;  4FO2 A;  4CDE C;  2E75 C;  4JI1 L;  1PRT D;  2A6E C;  1CFM A;  4MTN A;  3RNU A;  1SE4 A;  4Y7N H;  4GKK Q;  1VF5 C;  5C4X B;  3RUZ A;  5KGU A;  4A3F B;  1HTL D;  4J1M A;  2F4I A;  3EN2 A;  2D9U A;  3FVQ A;  3WWV A;  4DNI A;  1STG A;  4JBK A;  3GQB A;  1A2T A;  1VQ8 A;  1I4H A;  4OWX B;  4IPG A;  5I4D A;  3SGI A;  5C44 B;  3HRZ C;  1OXT A;  1TQO A;  2CHB D;  5IGF A;  4V19 0;  1VQJ A;  1VQG A;  2KQ3 A;  3K8A A;  4FVM A;  1QJO A;  5J22 A;  5JVH 3;  1QZH A;  1G51 A;  3NEL A;  2F4V Q;  4HSP A;  5FLM H;  4FXK C;  2EYP A;  1OXU A;  3DM3 A;  3KLW A;  3HOY B;  1N36 Q;  2L4N A;  1L0Y B;  2RCF A;  4UAI A;  4ODG A;  3VYU A;  4R4I A;  5I6W A;  1DOM A;  3HKZ G;  2ZTE A;  4QGU A;  1VQP A;  1VF7 A;  1J9O A;  3ER0 A;  1FYC A;  4ZQ3 A;  3T51 B;  4U67 3;  3GTM B;  1OXS C;  4FYD A;  1UE1 A;  1D5Z C;  3HOW G;  2JA7 H;  2QDL A;  1YIT A;  4C3I G;  3S2H H;  4LW1 A;  4RWS C;  3BJU A;  1SYG A;  1EEF D;  2JSO A;  2R3Z A;  1EOT A;  4L5T A;  4O1N A;  1I6H B;  1FGB D;  1PZJ D;  1GUN A;  3H09 A;  3A7A B;  2B2T A;  2L1B A;  3N6R A;  4AYB B;  4G7O C;  4YCV A;  2B2V A;  3HKZ E;  5KEE A;  1FJG Q;  2BE5 D;  3HOZ B;  1Q7Y C;  2B8G A;  1X32 A;  1K73 C;  1K0R A;  3OWE B;  5BR8 Q;  2EYM A;  2XIW A;  4LF5 L;  2KEC A;  4UP9 A;  4BBS G;  1FNU A;  4DR6 L;  1STA A;  2N88 A;  1IBL L;  4ME5 A;  4C2M H;  4GOP B;  1HUN A;  3H3V H;  3A7L A;  3NBH B;  2NN6 G;  1SYD A;  2SOB A;  2ICI A;  3PUZ A;  4DAP A;  1VQL A;  5JOB A;  5JVG 3;  4A3K H;  2A68 C;  3T1Y L;  5GQO A;  1X3F A;  3SK5 A;  1EQR A;  2JYO A;  3P7J A;  2ZTD A;  3TME A;  4HED A;  2NVT H;  1P16 A;  4DFA A;  1TS4 A;  5JJI A;  2ZTC A;  4R4Q A;  3R2I A;  2VUM B;  3WOF A;  1I3Q B;  5FLX c;  3FPU B;  3STB D;  2UU9 Q;  4A3G B;  3I4O A;  1K83 H;  4P2C B;  3DLL A;  2K5H A;  3A54 A;  1F77 A;  3BU2 A;  3C1E A;  1PTO F;  3MXG A;  4DV3 L;  2EIF A;  4HMJ A;  2G9D A;  2XRS D;  4PZ8 A;  4FXG C;  1TR5 A;  4ZKB B;  1YHA A;  5AJ3 Q;  3CCU A;  1CHQ D;  5IT9 c;  1YNJ D;  4LUO A;  3PUY A;  1CM9 A;  4EVO A;  4OX9 L;  1FD7 D;  4DV5 Q;  2XTI A;  1CSP A;  2IWH A;  2K01 A;  2DY7 A;  4NXN L;  1YBY A;  3MC0 B;  4JG2 A;  1CKO A;  2JA8 G;  4B3R Q;  2RQX A;  1ZYR C;  1IZ6 A;  1Z6H A;  1R4P B;  3FKI B;  3H6M A;  2A6H C;  1HRJ A;  1B70 B;  2JEB I;  2ZM6 Q;  3CC4 A;  4DR7 Q;  5M5Y B;  1HA6 A;  4DUY Q;  4GN5 A;  4F87 A;  5T1G A;  3S1Q H;  3KJO A;  1ET9 A;  3VR3 A;  2Y0S B;  1MSG A;  2AMC B;  2NUC A;  3TEH B;  4DR5 Q;  1A8V A;  5CR3 A;  1XMO L;  4Z9C B;  5C4J H;  2E2I H;  3F1Z A;  5FO7 B;  3E3X A;  1LUZ A;  1TY2 A;  1QWY A;  4DV4 L;  3HZX A;  5COY A;  1DYQ A;  1GHK A;  4IJL A;  4HJ7 A;  3Q24 A;  4BY7 G;  4RMF A;  1C7Y A;  3BS1 A;  4L5Q A;  4QIW E;  3M7G A;  2L15 A;  4EGV A;  5HGQ A;  3SEB A;  5GAG C;  2F0O A;  3PSI A;  1QVG A;  2I5H A;  4H7B A;  3K7U C;  1WTX A;  2IHE A;  2R7F A;  5CMD A;  1IHZ A;  1K8A C;  2PZT A;  5FLX E;  3AQQ A;  1ESF A;  1TS5 A;  4O0A A;  4KTA A;  4K8I A;  2SNS A;  5IYC G;  5FLM G;  3KLS A;  1HTP A;  2D2C C;  3M7N A;  1JR0 D;  1BNZ A;  3E6Z X;  4IFD I;  1T5X D;  3HFZ B;  4R1J A;  3DM1 A;  4QF4 A;  4LF9 L;  4F88 A;  3S1N B;  4OO1 H;  5C0X J;  5I9P A;  4BA2 I;  5IT9 E;  3HEJ A;  1N34 Q;  2EYL A;  4DU9 A;  4IJH A;  5L37 A;  4X62 Q;  5IGC A;  3T13 A;  1PFB A;  3ZJY C;  1D1I A;  2FIN B;  1QG7 A;  5E3F A;  1LV9 A;  2LFN A;  2JA7 G;  3E0J A;  2K5N A;  3DUZ A;  5A2Q L;  1A3U A;  3EIV A;  1J5E L;  1PH5 A;  2R7D A;  4M1U B;  1EQV A;  4JI3 L;  4ILW A;  3K80 C;  5C3W A;  1SJE D;  3H0G B;  2WII B;  4CKE A;  4DAV A;  2MFI A;  5LMU Q;  1O7I A;  2A6H D;  1SN8 A;  4PG3 A;  1SDF A;  1UE6 A;  1Q46 A;  2CW0 C;  1E2Z A;  4GNX B;  1ILQ A;  1UE5 A;  1HNX Q;  3HOV B;  3BZD B;  3S1R H;  5JEA J;  1SEB D;  3TBI B;  3A56 A;  1SFO H;  3S24 A;  3ICE A;  5IP7 H;  3VR4 A;  4ID6 A;  1CI3 M;  1I94 Q;  2JP1 A;  2F3I A;  4DF7 A;  1PRT B;  4DNR B;  4HJA A;  3OHX C;  4A3K G;  4QCL A;  4NXM L;  3UI2 A;  2UXD L;  3QO2 A;  1BCP F;  2C9O A;  4POF A;  3KOJ A;  1EQQ A;  1EZ8 A;  2F0T A;  1MJE A;  1SYC A;  1SE3 A;  4IUP A;  2RBM A;  1JCK B;  1J8I A;  2PQA A;  3GTO H;  1Z7T A;  3B6Y A;  2NYZ D;  1QNK A;  5M3F H;  4QY7 A;  4DPG A;  4QB4 A;  1XMQ L;  5LMN L;  4L8J A;  3KBG A;  2FJ2 A;  1H95 A;  2R93 H;  2RHQ B;  2F0E A;  3U9S A;  3AYH B;  4AH6 A;  3D0F A;  2V4D A;  3K7A B;  1BDO A;  1WTP A;  3HG9 A;  2K4K A;  3HKS A;  4PV1 C;  4JI8 Q;  2Q8I B;  3Q23 A;  2N8N A;  4WJW A;  2B63 B;  1RL2 A;  2VXW A;  3UDI A;  4ULL A;  2KA7 A;  5I2Y A;  3URY A;  1HUM A;  2KEN A;  4YWM A;  2R92 B;  1A6X A;  1SRU A;  2PO4 A;  2R61 A;  3DWP A;  3X3M A;  1EZ6 A;  3KK7 A;  1D2B A;  1TWH H;  2F0H A;  1A2U A;  4GOP A;  1STN A;  3DHQ A;  1SBB B;  1TII D;  2VQE L;  2EYF A;  4I65 A;  5CBA E;  2A19 A;  4OON A;  1QB5 D;  1LAB A;  4R4T A;  2NVQ H;  5I9O A;  4LFC Q;  3J7A F;  3MWY W;  4CBV A;  3MAQ A;  2E5L L;  5BN5 A;  4I7A A;  3J81 c;  1A0I A;  1KLG D;  4X66 Q;  2AKW B;  1T9H A;  4OWW B;  3A74 A;  2L55 A;  3ZYY X;  1JOR A;  3TZU A;  3EVQ A;  2F0Q A;  4KV6 A;  5C4Z A;  1C48 A;  2TSS A;  3AEV A;  2E2D C;  1A62 A;  2LKV A;  4NPS A;  3OTO L;  2J0T D;  4IOC A;  2IPK D;  5C4X H;  4A3F H;  3OWF A;  2SDF A;  2WB1 G;  4KMU C;  1EY6 A;  1NJI C;  1NAP A;  1N32 Q;  2O5J C;  4RHS A;  5G3L D;  1I4G A;  3KBX A;  1G6Z A;  3R3O A;  3ONA B;  4AIM A;  3QJY A;  4B3M L;  1TY0 A;  5C44 H;  3W3A A;  1E2V A;  1AH9 A;  5CYU A;  1VQC A;  3PIO 3;  2KVM A;  1SND A;  4OL7 A;  3AFP A;  3Q22 A;  2CQO A;  4DR4 L;  1CTM A;  1EU4 A;  2GN5 A;  4B9X A;  2F0K A;  3KDF B;  4IPH A;  3CXC A;  1L0X B;  3EFX D;  4R4C A;  2K5V A;  1EEI D;  2E2J B;  2B2W C;  1XJV A;  4K2L A;  3ND9 A;  1WTW A;  1VCI A;  2FMC A;  3HOY H;  3G6J B;  3GTJ B;  1EY4 A;  4P71 A;  4OO1 G;  5KYI A;  1II3 A;  3EBE A;  1WTV A;  1K0S A;  3PIO A;  5IYD G;  2PZW A;  3GTM H;  3CMA A;  3KF8 A;  4XQN A;  3NBI A;  1S5B D;  1Y8N B;  3J7A V;  4HN7 A;  2QGQ A;  1XNR L;  1NTG A;  3UE1 A;  2IX1 A;  2PW5 A;  3PV0 A;  5LL6 X;  2E76 C;  2QW7 A;  2VS1 A;  1Q1B A;  2CH4 W;  1SYB A;  2Z6K A;  1KD1 C;  4IUN A;  4C3H B;  3J81 E;  1I6H H;  2MO0 A;  5AFW A;  2K50 A;  2RDF A;  2EY6 A;  1A63 A;  4IUV A;  2WP8 J;  2I46 A;  2K32 A;  4A3B B;  1V43 A;  1IKL A;  3HOZ H;  1GUG A;  2BA0 A;  2LXJ A;  4YWK A;  4G57 A;  4JI2 Q;  1NE3 A;  3VR2 A;  4EQO A;  2ID0 A;  5EKK A;  2KUM A;  1DON A;  1KAW A;  2OTJ A;  3U4V A;  4HCS A;  1AZQ A;  1LT6 D;  4LF4 L;  4HJ5 A;  4X65 Q;  1HNW Q;  3TRE A;  1NSN S;  1UE7 A;  3OSO A;  4OEM B;  1K3R A;  5IP7 G;  1M1K C;  4JYA Q;  2F52 A;  4DR2 L;  4LNQ A;  2B2Y A;  2ASB A;  1TT2 A;  3TDQ A;  3KYH C;  4LJZ C;  3MXU A;  3OW2 A;  4JPB W;  3RLF A;  3H3V C;  2EJM A;  3NPP A;  2AWN A;  3DEP A;  3OIQ A;  5M3F G;  2ZXR A;  2QF7 A;  4DUZ L;  1EWI A;  1VDZ A;  2VL6 A;  3NSW A;  1CZG A;  2R93 G;  3RZD B;  1JQY D;  1I3Q H;  4A3G H;  1B2T A;  4KHP Q;  4A4I A;  2IJ0 A;  3VDY A;  5IOD A;  3K5N A;  2K7V A;  4DV1 L;  2SNM A;  4B3S Q;  4IZ8 A;  1H9K A;  3NEN A;  1I6V C;  1HNZ Q;  1G91 A;  3TP6 A;  2N49 A;  2BH2 A;  3S2D B;  4R4O A;  3NK9 A;  1B8A A;  5A35 A;  4KJN A;  5M5X B;  3TSS A;  1PA6 A;  3M4Y A;  4DV6 L;  1E2W A;  4PMB A;  2J4X A;  4LF8 L;  1FVI A;  3BG3 A;  1GD7 A;  1MI2 A;  1Y1W B;  4GKJ Q;  4DV2 Q;  3J81 i;  5I2X A;  1GUT A;  3I91 A;  2ICE C;  1YHQ A;  3FKI H;  1NY4 A;  3GV6 A;  2RA4 A;  3PGZ A;  4JI4 Q;  5M5Y H;  1OXV A;  2EXZ A;  1GXD C;  4Q0F A;  4DR1 Q;  1H9R A;  3J80 c;  1ZKO A;  2GVA A;  1E3P A;  3F2B A;  3F2U A;  1LO5 D;  3J81 j;  3HOX B;  3BDO A;  5EPJ A;  5GRO A;  2IX3 A;  2NZH A;  3NWS A;  3TS0 A;  1CHP D;  5C4X G;  4A3F G;  1JOK A;  5JPN C;  4PQX A;  1Y8P B;  2BA1 A;  1SYE A;  3L3O C;  1KHI A;  3T1H L;  2D5D A;  1XTD A;  2PMZ B;  3NE5 B;  4NP5 A;  5C44 G;  4HTH A;  1KC8 C;  4BY7 H;  1PVO A;  3CQZ B;  1FNW A;  4GN4 B;  1NCV A;  1S5F D;  3D4R A;  1HR0 L;  1YZ6 A;  2FFK B;  1T5E A;  3L2P A;  1I4P A;  1JWU D;  4QUF A;  4JI0 Q;  1Q1E A;  3PF4 A;  2NN6 I;  4JBW A;  5C0X I;  1W6K A;  4XQQ A;  4K0K L;  1OO9 B;  1IL2 A;  3V2T A;  3CCV A;  2B2U A;  3HOY G;  1BVS A;  2KED A;  3CU7 A;  3S1N H;  5CV7 A;  1KRT A;  1VMC A;  5IYC H;  3SK4 A;  1L1O C;  2JXM B;  3RZO B;  4C1N K;  3G6E A;  4A3M B;  1TWG H;  1VQ6 A;  3GD7 A;  3QG1 A;  2PPB C;  1H9S A;  2VNU D;  4JI7 L;  2VQF Q;  1Y14 B;  3O13 A;  3I56 A;  1RTO A;  1VQH A;  1BCP C;  4KN4 C;  2F1M A;  2O4X A;  4B3T Q;  1Q8K A;  2BDO A;  3GTQ B;  1ML0 D;  1GUS A;  1PV4 A;  4UY8 C;  2PQA B;  3NTH A;  1VQ5 A;  3PMF A;  3U58 A;  4AYB G;  3J80 E;  1N33 L;  3C2P A;  3H0G H;  5D14 A;  1GOZ A;  2EY1 A;  2K52 A;  3S14 B;  5GAD C;  4ZLT F;  3HOZ G;  3DWQ A;  4L63 B;  4K8J A;  1PTO H;  4B08 A;  1XNQ Q;  4LFB L;  1IBM Q;  3DXJ C;  2E8G A;  1BBX C;  1YNN D;  3J7A 5;  5EQ0 A;  5KNB A;  4A3E B;  3KDF A;  4TRD A;  4DV7 Q;  1X3E A;  1CA5 A;  3C3L A;  3NXW A;  4DKA C;  2Z9H A;  3I72 A;  4KKT A;  3A55 A;  1GKH A;  2MUY A;  4BS9 A;  4YY3 Q;  5FLX L;  3HOV H;  3CHB D;  1B50 A;  4AYB E;  2PI2 A;  1IXR A;  4PZ6 A;  2L5T A;  1VS0 A;  4CDF C;  1PFN A;  2YTY A;  3A5Z B;  3GO5 A;  4CDC C;  2NVX B;  1ASZ A;  3TZD A;  5J39 A;  1D6E C;  1LTR D;  5H1S E;  2A6E D;  3I3C A;  1JOO A;  5IT9 L;  4YIJ A;  2UUA Q;  3PCO B;  2F0N A;  2KJX A;  1ONL A;  3IFT A;  5JJL A;  3PUX A;  2VUM G;  1D5M C;  4LF7 L;  3VA7 A;  4A3G G;  1N32 L;  2K6A A;  1SE2 A;  4FNF A;  3R8B A;  4JI6 L;  5FO9 B;  1VQB A;  1CA6 A;  4DN4 M;  1IYU A;  5LHY 1;  1AFP A;  2MHV A;  1SNO A;  1QE6 A;  2XSC A;  2Z4I A;  1B4O A;  2B63 H;  1LTL A;  1R9T B;  1U9R A;  3LX0 A;  1UWV A;  4EQP A;  1YNX A;  3K5L A;  2R92 H;  4PMC A;  5C5M A;  2GVB A;  4IFD H;  4IQZ A;  2CCZ A;  4AQY L;  1QOH A;  5KND A;  1F9Q A;  2UXB Q;  2DJG C; 
#chains in the Genus database with same CATH homology
 1EUJ A;  3CCR A;  4LUV A;  3GDE A;  3CME A;  1L1O B;  1UE5 A;  1HNX Q;  3S14 H;  2UXB L;  3S1R H;  3G71 A;  5JEA J;  2UUC Q;  2ES2 A;  4GN3 B;  1SFO H;  1HNX L;  3S24 A;  3ICE A;  3I4M H;  5IP7 H;  1YIJ A;  2UUC L;  4YCU A;  4LFA Q;  1I94 Q;  2QA4 A;  2UXD Q;  2F3I A;  4NXM Q;  1FL0 A;  3Q8D A;  1JB7 A;  4JCV E;  3CD6 A;  4HJA A;  3FKI G;  1I94 L;  4LFA L;  4A3K G;  4IFD J;  2UXD L;  4NXM L;  3U4Z A;  4J15 A;  4DV0 Q;  3K81 C;  3KOJ A;  3ULJ A;  4POF A;  1EQQ A;  4GLX A;  2PMZ E;  3AFQ A;  1PH4 A;  1MJE A;  2YU9 H;  4LWC A;  1TWC H;  4DV0 L;  1XMQ Q;  2PQA A;  3GTO H;  1AE3 A;  5LMN Q;  3GTP H;  2YTV A;  3B6Y A;  3W1B A;  2D0O A;  5M3F H;  2Y0S G;  1QUQ B;  4QY7 A;  4DPG A;  3CCJ A;  1XMQ L;  3UDX A;  2NZO A;  5LMN L;  4A3M G;  3HOW H;  2OWO A;  1YJW A;  4C3I H;  1M90 C;  1X54 A;  1H95 A;  2R93 H;  2RHQ B;  3JAM c;  4HJ9 A;  2NVX H;  3G48 A;  3AYH B;  4AH6 A;  1HZA A;  3D0F A;  2IT1 A;  4P75 A;  3PO3 H;  4X64 Q;  3STB C;  1PFS A;  4EX5 A;  5IYB G;  2K4K A;  5JJK A;  3HKS A;  3PO2 G;  4X64 L;  4JI8 Q;  3E9I A;  4X6A H;  3JC6 6;  2HHH Q;  2N8N A;  1RL2 A;  3KF8 B;  2VZA A;  3RN2 A;  4JI8 L;  1KL9 A;  2JK8 A;  4OXP A;  3UDI A;  2HHH L;  2JA5 H;  4IO9 A;  2KEN A;  4YWM A;  2Y0S E;  2YTX A;  1SRU A;  4L5S A;  1IYJ B;  4KI0 A;  3M4Q A;  3D31 A;  3A5U A;  3K0X A;  2IX0 A;  1TWH H;  3RLO A;  2VQE Q;  4BBS H;  1KXL A;  3S1M H;  4GOP A;  2LXK A;  2RCN A;  1VQN A;  3BZC A;  5IE8 A;  4DK6 C;  4A3E G;  2VQE L;  2D62 A;  4P73 A;  1PYS B;  4LF6 Q;  2JEA I;  2A19 A;  4OON A;  2UXC Q;  1IBK Q;  4R4T A;  1VQ7 A;  2EQS A;  4LF6 L;  1LYL A;  1PH3 A;  1PH9 A;  1KQS A;  1JJ2 A;  2E5L Q;  2NVQ H;  2UXC L;  2ALY B;  3H3V I;  1S3O A;  1IBK L;  4LFC Q;  3I2Z A;  1J6Q A;  2IHF A;  3KF6 A;  3KJP A;  1BBU A;  2E5L L;  1L0W A;  2E2J H;  4LFC L;  1VQF A;  1PH2 A;  1HZB A;  3J81 c;  1S40 A;  1A0I A;  1AE2 A;  2MNA A;  2WFW A;  4X66 Q;  2AKW B;  3GTJ H;  1T9H A;  4OWW B;  4A3L H;  4YHH Q;  3A74 A;  4X66 L;  1K9M C;  4IPD A;  1LM0 A;  4LF9 Q;  4YHH L;  4JV5 Q;  4DAY B;  4BA1 I;  4DK3 C;  4JV5 L;  3OTO Q;  1VQM A;  2K75 A;  4QQB X;  1CSQ A;  3AEV A;  1A62 A;  3CCE A;  2OTL A;  4NPS A;  3OTO L;  2JA5 G;  5IYD H;  4IOC A;  4LUZ A;  5C4X H;  4A3F H;  1PYB A;  2B29 A;  1W3S A;  2WB1 G;  1HH2 P;  3L0O A;  4UP8 A;  3W5O A;  4KLK A;  4P74 A;  1NJI C;  4RG1 A;  5M3M G;  4GNX A;  4QJF A;  4C3H H;  1N32 Q;  4BXX G;  1L1O A;  1E7Z A;  2AWO A;  4B3M Q;  1PH7 A;  1WYD A;  5IP9 H;  3H0G G;  4A3B H;  4AIM A;  1JJC B;  4O2D A;  1HR0 W;  3M4P A;  4B3M L;  1WCM H;  5C44 H;  2BH8 A;  3K7A H;  3E0E A;  3MXN B;  1WFQ A;  3HOU G;  1X56 A;  1VQE A;  5C3E G;  4FDB A;  1AH9 A;  2N78 A;  1VQC A;  4A3J H;  2UUB Q;  4DR4 Q;  1E1O A;  1EIF A;  1E22 A;  1YJN A;  4MNO A;  5C0X G;  1Q86 C;  3AFP A;  2UUB L;  2CQO A;  4DR4 L;  2GN5 A;  1X3G A;  5M5W H;  3KDF B;  4IPH A;  2R6G A;  3CXC A;  4R4C A;  2K5V A;  3CC7 A;  3FHW A;  3GTK H;  3HOV G;  5GAE C;  1HZC A;  3PF5 A;  5IWA Q;  1QZG A;  2JA8 H;  5ELO A;  1Y1V H;  2OCE A;  4A3L G;  3CCS A;  2B3G A;  1X9N A;  2JA6 G;  1XJV A;  5IWA L;  1P8L A;  4HIO A;  4A3C H;  1VCI A;  1ASY A;  3HOY H;  4P71 A;  3I4N H;  4OO1 G;  1I50 H;  1JT8 A;  3EBE A;  4GS3 A;  5GAH C;  4JI5 L;  4OWT B;  4JI1 Q;  3PIO A;  3S16 H;  1N9W A;  1U5K A;  2JJQ A;  5IYD G;  4UP7 A;  5E7N A;  4JI1 L;  3GTM H;  4A3D G;  3CMA A;  3J80 i;  4BBR G;  1JJG A;  1XNR Q;  3U50 C;  3OYY A;  2VW9 A;  4MTN A;  3RNU A;  4P72 A;  1I5F A;  4BY1 G;  2QGQ A;  4Y7N H;  4GKK Q;  1XNR L;  1NTG A;  3UE1 A;  2IX1 A;  1KRS A;  3PV0 A;  3CCQ A;  1S72 A;  2IY5 B;  4YWL A;  3RZD H;  4GKK L;  4IOA A;  4HID A;  3EN2 A;  2VS1 A;  3WWV A;  1Q1B A;  1PHJ A;  4DNI A;  2Z6K A;  4JBK A;  1KD1 C;  1VQ8 A;  1CKN B;  1I6H H;  4OWX B;  1CKM A;  2MO0 A;  4A3J G;  2K50 A;  4XTC S;  1A63 A;  2CFM A;  4IPG A;  1MIU A;  1V9P A;  2WP8 J;  1V43 A;  2B63 G;  5JEA G;  3SGI A;  3HOZ H;  2BA0 A;  1YEZ A;  1OXT A;  2LXJ A;  4YWK A;  4JI2 Q;  4APV A;  2R92 G;  2R7Z H;  1NE3 A;  4A3I G;  1VQJ A;  2DGY A;  1VQG A;  1Y1V G;  2ID0 A;  4JI2 L;  4IFD G;  3L7Z C;  3K8A A;  3MEF A;  4LF4 Q;  3CC2 A;  1KAW A;  1HZ9 A;  5M5X H;  2OTJ A;  3U4V A;  4TQU S;  1QZH A;  1G51 A;  1GVP A;  3NEL A;  4LF4 L;  2F4V Q;  4HJ5 A;  4X65 Q;  1HNW Q;  3TRE A;  5FLM H;  1UE7 A;  3M3Y H;  1C0A A;  4DR2 Q;  1Y1W H;  1K3R A;  1OXU A;  2F4V L;  5IP7 G;  3I4M G;  4X65 L;  3DM3 A;  1M1K C;  1HNW L;  4JYA Q;  2C35 B;  3KLW A;  2F52 A;  3M9B A;  4DR2 L;  4LNQ A;  1N36 Q;  3S15 H;  5HY6 A;  2ASB A;  2WAQ G;  4JYA L;  3KYH C;  1N36 L;  3UDG A;  4R4I A;  1QVC A;  3KFU A;  1SLJ A;  1E1T A;  4MZ9 A;  3HKZ G;  3OW2 A;  2ZTE A;  3RLF A;  4QGU A;  1VQP A;  3ER0 A;  4DUZ Q;  5FJ8 H;  2AWN A;  4L5R C;  3F2C A;  1DGS A;  4JBM A;  1OXS C;  5M3F G;  1E24 A;  4DUZ L;  3HOX H;  1PH8 A;  1EWI A;  1UE1 A;  3JAM i;  1VQK A;  1X6O A;  2I5M X;  3HOW G;  2D0P A;  3CF5 A;  2YYZ A;  2VL6 A;  4A75 A;  1YIT A;  2JA7 H;  3S2H H;  4LW1 A;  4A93 H;  3ULL A;  2R93 G;  1I3Q H;  3BJU A;  1K8G A;  4A3G H;  1G6P A;  4QL5 A;  1UEB A;  4KHP Q;  3CW2 C;  4L5T A;  3PO3 G;  1D7Q A;  5J3B A;  1YVC A;  1YI2 A;  2WAQ E;  4A4I A;  4DV1 Q;  3VDY A;  1GM5 A;  3RR5 A;  4KHP L;  1RIP A;  1PH1 A;  4YCV A;  3HKZ E;  4DV1 L;  1FJG Q;  4B3S Q;  3NEN A;  1MJC A;  1SRO A;  1Q7Y C;  1HNZ Q;  4POG A;  1FJG L;  2N49 A;  2KBN A;  1L2F A;  1N8R C;  1BBW A;  4R4O A;  5LMN W;  1KIX A;  4B3S L;  4LF5 Q;  2BH2 A;  1B8A A;  1K73 C;  2ZJQ A;  1HNZ L;  4DR6 Q;  4Y52 H;  1K0R A;  5BR8 Q;  2A8V A;  2ZJP A;  4LF5 L;  3UE0 A;  4UP9 A;  2JQO A;  3CQZ H;  4DV6 Q;  2EXD A;  4BBS G;  4DR6 L;  5BR8 L;  1IBL L;  4LF8 Q;  2KHI A;  4H02 A;  1PA6 A;  4TVA B;  3CPF A;  4DV6 L;  2Z6K C;  1X65 A;  4C2M H;  1XPR A;  4XIG S;  1FVI A;  4JOI A;  3RLN A;  4GOP B;  4LF8 L;  1GD7 A;  3H3V H;  1Z9F A;  2XGT A;  4GKJ Q;  1JE5 A;  4DV2 Q;  2N3S A;  3NBH B;  4GLA C;  2NN6 G;  1EFW A;  3J81 i;  2PNH A;  4GKJ L;  4PMW A;  3T1Y Q;  1Q81 C;  4EQ5 A;  3PUZ A;  2HQL A;  4DV2 L;  2ZJR A;  1YHQ A;  1VQL A;  3FKI H;  1NY4 A;  3I7F A;  4A3K H;  1XPO A;  3PIP A;  3GTG H;  3T1Y L;  2OQ0 A;  1X3F A;  3PGZ A;  4PZ7 A;  5GQO A;  5M5Y H;  1EQR A;  1OXV A;  2WB1 E;  3G4S A;  1NMF A;  4DR1 Q;  2ZTD A;  3J80 c;  4DR3 L;  3UDF A;  4JI4 L;  2GVA A;  1QUQ A;  1E3P A;  2NVT H;  1P16 A;  3F2B A;  1CKN A;  4DR1 L;  1Q12 A;  3J81 j;  5JJI A;  5DLQ E;  3M4O H;  1HJP A;  2ZTC A;  3IRB A;  4R4Q A;  3RZO H;  2QEX A;  2Q2T A;  4WJ3 M;  4A3M H;  1YHB A;  4JI5 Q;  5GRO A;  2NZH A;  3F8T A;  5FLX c;  3STB D;  3TS0 A;  2CKZ B;  2UU9 Q;  4JI4 Q;  3I4O A;  1EYG A;  2JE6 I;  1K83 H;  3DLL A;  5K36 G;  4GOP C;  2K5H A;  3BU2 A;  4GLV B;  2UU9 L;  5C4X G;  4A3F G;  1G29 1;  4ALP A;  1X55 A;  1VQ4 A;  3GTQ H;  5IYB H;  2MQH A;  4HJ8 A;  4HIK A;  4DV3 Q;  2Z0S A;  3CAM A;  2BA1 A;  2LSS A;  3T1H Q;  2RHS B;  4DV3 L;  2EIF A;  3PUW A;  2HIV A;  1KHI A;  2V1C C;  3T1H L;  4PZ8 A;  5IP9 G;  3PUV A;  1XTD A;  1YHA A;  5AJ3 Q;  3CCU A;  4A3B G;  2I0Q A;  1WCM G;  3W1G A;  1B7Y B;  5IT9 c;  5C44 G;  1KC8 C;  4BY7 H;  5AJ3 L;  4LUO A;  2FXQ A;  3PUY A;  1PVO A;  4A76 A;  1Q82 C;  4OX9 Q;  4GN4 B;  1JMC A;  3LGJ A;  1HR0 Q;  1BKB A;  1SR3 A;  4A3E H;  1SE8 A;  4NXN Q;  4JC0 A;  4DV5 Q;  4OX9 L;  2XTI A;  1HR0 L;  3H15 A;  1WOC A;  1YZ6 A;  1CSP A;  5EAY A;  2Q2I A;  4NXN L;  4DV5 L;  1YBY A;  3L2P A;  4JI0 Q;  3S2D H;  4JG2 A;  1Q1E A;  3PF4 A;  1CKO A;  2JA8 G;  4B3R Q;  1EOV A;  1PH6 A;  1IZ6 A;  1VQ9 A;  4JBJ A;  4K0K Q;  1WJJ A;  4JI0 L;  1MKH A;  2NN6 I;  4JBW A;  1OTC A;  4B3R L;  1VQD A;  1B70 B;  2YV5 A;  5C0X I;  2JEB I;  2ZM6 Q;  3CC4 A;  4DR7 Q;  3CCV A;  4A3C G;  2CWP A;  4DUY Q;  3HOY G;  4K0K L;  3I4N G;  1BVS A;  4GN5 A;  3S1N H;  4GNX C;  1KRT A;  2ZM6 L;  4DR7 L;  4DAM A;  5IYC H;  3M85 A;  4DUY L;  2KHJ A;  3S1Q H;  1L1O C;  3KJO A;  2AMC B;  3G6E A;  2KCM A;  3TEH B;  3ERS X;  4DR5 Q;  1XMO Q;  4KHZ A;  1TWG H;  4JI7 Q;  1A8V A;  3GD7 A;  1VQ6 A;  4JOI C;  1EIY B;  5IY0 A;  1NBW A;  4DR5 L;  1XMO L;  3GTL H;  2VNU D;  5C4J H;  2E2I H;  3F1Z A;  1CUK A;  1Y14 B;  1SMX A;  3I56 A;  2VQF Q;  4DV4 Q;  4JI7 L;  4OO1 I;  1LUZ A;  1VQH A;  2VQF L;  4DV4 L;  4B3T Q;  1QVF A;  1Q8K A;  3ULP A;  2Q2U A;  4B3T L;  1PV4 A;  4UY8 C;  4IJL A;  4HJ7 A;  5M3M H;  4BY7 G;  2PQA B;  1N33 Q;  4RMF A;  1VQ5 A;  1C7Y A;  2VUM H;  4L5Q A;  4BXX H;  3U58 A;  2AHO B;  4AYB G;  1N33 L;  4QIW E;  3TQY A;  3CPW A;  4LFB Q;  3H0G H;  2L15 A;  2K52 A;  1VQI A;  5GAD C;  5ELN A;  3BZK A;  5HGQ A;  1XNQ Q;  2I5L X;  3HOZ G;  5GAG C;  1D8L A;  4LFB L;  3PSI A;  1R9T H;  1IBM Q;  3HOU H;  5C3E H;  4HIM A;  1QVG A;  2I5H A;  2E8G A;  4IPC A;  3K7U C;  2R7Z G;  1XNQ L;  2IHE A;  2R7F A;  3J7A 5;  1TWF H;  1IBM L;  1K8A C;  1W2B A;  3KDF A;  3AQQ A;  4DV7 Q;  1X3E A;  2K14 A;  2KCT A;  4O0A A;  2HIX A;  2E2H H;  4DKA C;  4DV7 L;  2A1A A;  3FP9 A;  1GKH A;  4YY3 Q;  3HOV H;  5IYC G;  5FLM G;  1IBL Q;  3M7N A;  3A0J A;  1Y1W G;  4YY3 L;  1YJ9 A;  4AYB E;  2JA6 H;  2PI2 A;  2JA9 A;  1IXR A;  3F2D A;  4IFD I;  2Q2H A;  4PZ6 A;  2OQK A;  1VS0 A;  2VY3 A;  3HFZ B;  3A5Z B;  2YTY A;  4R1J A;  3GO5 A;  4LF9 L;  1TXY A;  1U0L A;  5C0X J;  2ATW A;  4BA2 I;  1ASZ A;  3RN5 A;  1N34 Q;  3CCM A;  2HT1 A;  4UPA A;  2MO1 A;  4IJH A;  3NEM A;  4X62 Q;  1XPU A;  3TS2 A;  5H1S E;  1NMG A;  1N34 L;  5FJ8 G;  4YCW A;  1TWA H;  4A3D H;  4X62 L;  3ZJY C;  4BBR H;  4DR3 Q;  2UUA Q;  3HOX G;  4LF7 Q;  3PCO B;  4C3J H;  1VQO A;  3KF6 B;  1OXX K;  1J5E Q;  4BY1 H;  2JA7 G;  5JJL A;  3PUX A;  2VUM G;  2K5N A;  4LF7 L;  2UUA L;  3EIV A;  2CWA A;  1J5E L;  4A93 G;  1PH5 A;  3TRZ A;  4A3G G;  1N32 L;  4JI6 Q;  3CCL A;  2R7D A;  4NB3 A;  4JI3 Q;  1IL2 A;  3CP0 A;  4JI6 L;  4WJ4 A;  3I55 A;  1VQB A;  4JI3 L;  2RF4 A;  3S17 H;  3K80 C;  2DUD A;  3J7Z C;  3E9H A;  2B63 H;  1Z47 A;  2MFI A;  1LTL A;  1UWV A;  5LMU Q;  1YNX A;  1O7I A;  1WI5 A;  1C9O A;  2R92 H;  3PO2 H;  1SN8 A;  4PG3 A;  4A3I H;  1GO3 E;  1VQA A;  2GVB A;  4ME3 A;  1V1Q A;  1UE6 A;  5LMU L;  4AQY Q;  1Q46 A;  2NVY H;  2CCZ A;  2PI2 E;  4AQY L;  4GNX B;  2H5X A;  1FGU A;  2UXB Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...