4JI3Q

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 19
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji3Q00
1YNXA 3L0OA 3S14H 3TS0A 1XPRA 2JEBI 2GN5A 4JBKA 4LFBQ 4L5TA 4JI8Q 4GOPA 4GLXA 3RN2A 4A3BH 3HOUH 1Q12A 3RNUA 3FKIG 1X3EA 4DR4L 1YZ6A 4OXPA 1VQFA 2UUBL 3K81C 3T1YL 1E24A 4P71A 4A3KH 3HOVG 1TXYA 1VQOA 1N36L 4JI6L 4K0KQ 4HJ5A 4GKJQ 4DV0Q 3PUVA 3FKIH 1IL2A 1N8RC 3CC7A 3PGZA 4O2DA 4NXNQ 1WOCA 3HOVH 1GM5A 4A76A 3CPFA 1EQQA 1TWGH 2JA8G 4KI0A 1HNWQ 1AH9A 1G6PA 2WB1G 4X66Q 1XNRQ 3GD7A 4POFA 2A19A 5IP7H 1A63A 2LXKA 4DR5L 1Q8KA 4A3IH 4A3MH 1KHIA 3KOJA 3A0JA 4LFCL 4UPAA 2PI2A 4IOAA 3PF5A 2N3SA 1Y1WG 1YHBA 3U4ZA 1EQRA 1P8LA 2Q2IA 2UXCL 3E9HA 4JI1Q 3AEVA 4X65Q 1FL0A 3I2ZA 4UP7A 4JV5L 4DV7Q 2K75A 3S2DH 2VQEQ 3CCEA 4GN5A 2HHHQ 1SN8A 4A3GG 1W2BA 1N32Q 5LMNW 4OWWB 4X62L 5C0XJ 1PA6A 4P73A 2NZHA 5C0XI 2YTXA 4UP9A 1KD1C 3JAMc 2AHOB 1C9OA 4YY3Q 1WFQA 2YV5A 2A1AA 1B8AA 2HIXA 3F8TA 1I5FA 2LXJA 2MO0A 4DR7L 4A3DH 4B3TQ 3G6EA 2CKZB 4JBWA 2Y0SE 3TREA 1TWCH 2NVXH 2ZJRA 4R1JA 2E2JH 2ZTEA 1E1TA 4LF8Q 4LF9Q 2WAQE 1IBLQ 4YWKA 5C4XG 4A3EH 2UXBL 2QGQA 4IPGA 1LUZA 2GVAA 3J80c 3OW2A 1B7YB 1FJGQ 2F4VQ 4B3SL 3IRBA 3PUZA 3EBEA 3RR5A 4PZ8A 3J80i 1PH3A 4DAMA 4KHPL 1NE3A 3G71A 2PQAA 2A8VA 4P72A 4AYBE 3JC66 4YHHQ 4DV6L 3K8AA 3PUXA 4GKKL 4KLKA 1PH4A 2UUBQ 2VQFQ 5BR8L 5M3FG 2LSSA 2R7ZG 1K9MC 4APVA 4EX5A 4JI6Q 1N36Q 4BXXG 1V9PA 4LFAL 1SROA 2UUCL 1N33Q 1AE3A 5C44G 3ER0A 1HNXL 1XPUA 2KCTA 1XTDA 5GQOA 2IT1A 1Y1VG 2WFWA 1IBML 5IYBG 2Y0SG 1VQ8A 3UDXA 4BXXH 3ULPA 4BBRG 5JEAG 4LWCA 5GAEC 3FHWA 2YYZA 3A74A 5LMNL 1J6QA 5IP9G 2IX0A 3GDEA 4R4TA 4A3FG 2AKWB 2RCNA 1NJIC 4PMWA 5M5WH 3HOWG 1X6OA 4LNQA 1P16A 5IYBH 1YVCA 4IPDA 4DV1L 1YITA 2Z6KA 1R9TH 1K8GA 4YWLA 4R4IA 4LFCQ 1T9HA 4C3HH 1GD7A 1VQBA 5C3EG 3CPWA 4DK6C 3HOYH 4A3FH 5IP9H 5K36G 5C4JH 1PH8A 4QJFA 3NBHB 1VQ9A 3CCJA 3S2HH 1OXUA 2WP8J 5FLXc 1A62A 1A0IA 3DLLA 3L2PA 1VQNA 2UXCQ 3CCQA 2JEAI 3A5UA 3J7A5 4JI5L 3BZKA 4JV5Q 4BA2I 3F2BA 2JE6I 3W1GA 4B3ML 2MQHA 4DUYL 4A4IA 4JI3Q 1K8AC 3S1MH 1X65A 3GTMH 4B3RL 3T1HQ 3PUYA 3ZJYC 4JC0A 1EOVA 3STBD 3PO3G 1M1KC 1EWIA 4X62Q 1N34L 2K5HA 2CWPA 2V1CC 4DR6Q 4JI0Q 1YEZA 3H3VH 2VNUD 4GNXB 2D0OA 2WB1E 3D31A 4A3BG 2KHJA 3HOUG 3HOYG 1HR0W 3S15H 3GTQH 4JG2A 2B29A 3W1BA 2Q2UA 3CD6A 4DR2L 4O0AA 3E9IA 1SE8A 1VQCA 4A3KG 2JA5G 3UE1A 1L2FA 2D0PA 4GNXA 1FGUA 3BU2A 4LF5Q 1J5EL 3STBC 2K50A 3CAMA 4LF4L 4KHZA 2JA9A 3GTOH 3AYHB 1I94L 2JA5H 4YCVA 3KF6A 3I4NG 3S16H 2R7DA 3CXCA 1XMQL 4B3SQ 3G48A 1JJ2A 4IPCA 2ZTCA 3AQQA 3BZCA 1VQ4A 3KFUA 4KHPQ 4GN3B 2I5MX 1TWAH 3KYHC 3GTKH 3M4QA 2AWOA 4RG1A 3RLOA 5IP7G 4A3IG 1M90C 3I4NH 4DNIA 4JOIC 4DAYB 4A3MG 4GKKQ 1VQHA 1XNQL 4NXML 4IFDI 4DV3L 3G4SA 1AE2A 1GO3E 2N8NA 1X56A 2ASBA 1I50H 3U58A 1VQKA 3B6YA 4JI7Q 1E3PA 3BJUA 1GVPA 1QVCA 1MJEA 1PYSB 1YHAA 1JE5A 1OXVA 2RHSB 5FLMH 3W5OA 1G51A 4AQYL 2IHEA 1Q1EA 2HQLA 1IBMQ 4IJHA 4JI2Q 1VQ6A 4MNOA 4DR1L 2R93G 1CKNA 3CMAA 3KF8B 4AIMA 1PH1A 3A5ZB 2E5LQ 3I7FA 5LMNQ 4BY1H 1VQEA 2MO1A 4A3JH 1CSQA 3KJPA 4DUZL 1WJJA 1TWHH 1YBYA 2QEXA 3VDYA 1VQ7A 2VW9A 2R93H 5AJ3L 1HR0L 5H1SE 1UE1A 1X3GA 4DV4Q 3PIOA 1OTCA 1EFWA 1QUQA 4A3DG 1PHJA 3K80C 1NBWA 5IWAQ 1KQSA 2PMZE 4X6AH 1VQ5A 2IHFA 2BA1A 4JCVE 4LF6L 2ALYB 5DLQE 1BBUA 4JI5Q 5C0XG 5JJKA 4QY7A 3RN5A 4A3EG 4Y52H 3JAMi 1KL9A 4DUYQ 1VS0A 4UP8A 3HOZG 5IE8A 4L5SA 1SLJA 2C35B 4DV2L 4JYAQ 3PIPA 4X64L 1PH9A 1DGSA 2VUMH 2DGYA 1SRUA 2PQAB 1PVOA 1LTLA 1U0LA 2R7FA 4HJ8A 4IJLA 1Q7YC 2JJQA 2UU9L 3PF4A 3HOZH 3PO2H 1QZHA 3GTGH 2OTJA 4LUOA 4QQBX 1D8LA 4OX9Q 1PH2A 4L5QA 1Q46A 2MNAA 5LMUL 5HGQA 1YJ9A 4R4OA 4YCWA 4OO1I 2KHIA 5IY0A 1FVIA 1VQAA 3I55A 4IOCA 4WJ3M 1PYBA 4JBJA 3CCMA 1VQMA 2ZJQA 4DR4Q 2R6GA 5GAGC 2CCZA 1PFSA 3T1YQ 4LW1A 4JI8L 4DR3L 1Z47A 1IZ6A 2HIVA 1XMOL 2PI2E 5HY6A 1HNZL 1WCMH 1S72A 1EUJA 1U5KA 2I5LX 4OWXB 3EIVA 5IYDG 3RZDH 4K0KL 2ID0A 4GKJL 4GN4B 1GKHA 1CSPA 4DV3Q 3KLWA 2UXDL 4TQUS 2IX1A 4LUZA 4A93G 1G291 5IYDH 5M3MH 2OWOA 2MFIA 2JA7H 4JBMA 2N49A 1CKMA 4C3JH 1YIJA 1HZCA 1SR3A 4HIMA 4DR5Q 4DV5L 4IPHA 4GS3A 1HNWL 4X66L 3S1QH 3NELA 1BVSA 5GROA 3M9BA 1VQLA 1XNRL 1K83H 2E2IH 2BH2A 4A93H 4YCUA 1IBKL 1B70B 4DR1Q 4C3IH 1PH6A 4HIOA 1XJVA 2NVYH 1C7YA 3E0EA 1ASYA 4R4CA 3SGIA 4DUZQ 1YI2A 3PSIA 1WYDA 1KIXA 2YTYA 1VQDA 1O7IA 3D0FA 1L1OC 4GLAC 3OTOL 4X65L 5AJ3Q 4IFDJ 3WWVA 2JA6G 3CCVA 1NTGA 3HKZG 1JJGA 1HZAA 1L0WA 2VQEL 1VQPA 1EIFA 4XIGS 1QVFA 2PNHA 1OXXK 4PZ6A 2OQKA 2JA6H 4HIDA 4XTCS 3F2CA 4IO9A 1X55A 4DR7Q 3KF6B 4YY3L 2OTLA 3S24A 4DV2Q 3I56A 3CCLA 3NEMA 1X3FA 1I3QH 3EN2A 2NVTH 3U50C 4YWMA 5M5YH 3CCUA 4GOPC 2I0QA 3I4MG 1LM0A 3MXNB 2NN6I 3CMEA 4B3TL 2UXBQ 1PV4A 4RMFA 1MJCA 2VL6A 4LF8L 4GLVB 4LF9L 2OQ0A 1IBLL 1NMGA 3I4MH 2NZOA 2E2HH 2Z0SA 2N78A 3M85A 1N9WA 1FJGL 2F4VL 3F1ZA 4DV6Q 4LF7L 2ATWA 3S17H 3Q8DA 2F52A 1I6HH 2K4KA 4A3CG 1PH5A 2B63H 2ZTDA 4EQ5A 5FLMG 2KCMA 3ULLA 5BR8Q 1D7QA 4YHHL 2I5HA 4DR3Q 4BBSG 3HFZB 1CKNB 1V43A 1XPOA 1S40A 1TWFH 4LFAQ 4OONA 2XGTA 2BA0A 1XMOQ 2UUCQ 4IFDG 1HNZQ 1VCIA 2VQFL 3TS2A 4A3CH 1HNXQ 4BY1G 2QA4A 4A3LG 4BY7G 4A3JG 2OCEA 2KENA 2RHQB 1IYJB 4C2MH 2AMCB 3K0XA 2ES2A 2UUAL 4BBSH 1N33L 2AWNA 2E8GA 2K52A 1Q86C 1JB7A 1MIUA 2UXDQ 2H5XA 3RLFA 3MEFA 3HOXG 1WI5A 1QUQB 4JOIA 3RZOH 4BY7H 1EYGA 2L15A 1E22A 1K3RA 1HZBA 1W3SA 2YTVA 4DV1Q 1JT8A 3GTLH 2B3GA 1VQGA 4DV5Q 3UE0A 3DM3A 3S1RH 2KBNA 1KXLA 3HOXH 2D62A 3UDFA 1IBKQ 4L5RC 5JJIA 3F2DA 3S1NH 2ZM6L 2JA8H 4TVAB 3H15A 1NMFA 2VUMG 1Q81C 1UEBA 4NPSA 3CW2C 4JI4L 4B3MQ 4B3RQ 4H02A 4A75A 3PO2G 3CQZH 3OTOQ 4MTNA 5ELOA 1OXSC 1N34Q 3J7ZC 5ELNA 4JI3L 1OXTA 3T1HL 1Y1WH 3CC2A 2RF4A 1VQIA 3LGJA 4UY8C 2EQSA 4QL5A 2IY5B 1YHQA 4DR6L 4JI0L 3TEHB 4DR2Q 3CC4A 1NY4A 1E1OA 4AH6A 4A3GH 3UDGA 4Y7NH 1RL2A 2K14A 3KJOA 3ERSX 3CF5A 5M5XH 2ZJPA 1E7ZA 3AFPA 1J5EQ 1WCMG 1ASZA 5J3BA 4LF4Q 1BBWA 3M4OH 4LFBL 1X54A 4LUVA 5IT9c 1I94Q 4HIKA 4LF5L 4OO1G 3H0GG 3GTPH 1XMQQ 2F3IA 4BA1I 1Q82C 1C0AA 2YU9H 3CCSA 1EIYB 1CKOA 4P75A 4PZ7A 1V1QA 4ME3A 1JMCA 5EAYA 4FDBA 5GAHC 5M3MG 1Y14B 3HKZE 5JJLA 2JA7G 3PV0A 1UE6A 4LF7Q 1HZ9A 3CCRA 3H0GH 4DV0L 1LYLA 1XNQQ 5C4XH 4NXMQ 3GO5A 1Z9FA 2EXDA 3CP0A 4OWTB 1VQJA 4NXNL 3GTJH 5GADC 1MKHA 3J81c 2B63G 1KC8C 2JQOA 4PG3A 2EIFA 3TRZA 3OYYA 1JJCB 1X9NA 2VY3A 1HJPA 1Q1BA 2Z6KC 3HKSA 3J81i 1H95A 5E7NA 2FXQA 2XTIA 2K5NA 4AQYQ 3TQYA 2CWAA 4MZ9A 5JEAJ 1KRSA 2UUAQ 4JI7L 3KDFB 3FP9A 3PCOB 1BKBA 2R7ZH 5M3FH 4HJ7A 1A8VA 1PH7A 4JI2L 4QGUA 3L7ZC 1KRTA 2WAQG 2CQOA 4JI1L 5C44H 4POGA 2R92G 3KDFA 1UE5A 3ULJA 5FJ8G 1HR0Q 2CFMA 4DK3C 3K7AH 3M3YH 4DV7L 1Y1VH 3PUWA 1KAWA 1UWVA 2DUDA 4P74A 3UDIA 2HHHL 1K0RA 2JK8A 1QVGA 4BBRH 1N32L 2ZM6Q 2NVQH 4LF6Q 2R92H 4A3LH 4DV4L 5FJ8H 4QIWE 1UE7A 3HOWH 4AYBG 1L1OB 3M4PA 1IXRA 4DKAC 3RLNA 1YJWA 4J15A 5IWAL 4HJ9A 4JI4Q 3H3VI 1K73C 4NB3A 4DPGA 3I4OA 4HJAA 2Q2HA 2BH8A 5C3EH 3ICEA 4GNXC 4X64Q 1SMXA 3J81j 1L1OA 1S3OA 5IYCG 1YJNA 4JYAL 2UU9Q 3K7UC 1HH2P 4R4QA 2K5VA 2NN6G 3AFQA 2GVBA 3U4VA 2E5LL 4ALPA 2VZAA 3NENA 5LMUQ 4GOPB 1QZGA 5IYCH 1RIPA 2HT1A 3PO3H 1CUKA 3M7NA 4OX9L 1SFOH 2VS1A 2Q2TA 4WJ4A
chains in the Genus database with same CATH superfamily
2PNRC 5F2DA 4IQZA 3X3MA 4LFBQ 4GOPA 3RN2A 5IOCA 2Z1CA 3HOWB 1Q12A 2QCPX 3FKIG 4OXPA 3S2HB 3N6RA 3K81C 3T1YL 1FGBD 1GUNA 4A3KH 1MSHA 1TXYA 4JI6L 3AMUA 4K0KQ 4DV0Q 3MXGA 2F0TA 4R8IA 2F0LA 3HOVH 1LT3D 3C1FA 4FXDA 2ZXOA 3FEWX 1A2UA 1AH9A 1CZWA 4DXFA 1XNRQ 1SFOB 2A19A 5IP7H 1A63A 3A0JA 1NSNS 2F0JA 3QO2A 1NUCA 2CH4A 3HRZC 1Y1WG 3C46A 5NUCA 2Q2IA 1QB5D 5A2QE 2EE1A 1SJED 3E9HA 5EKLA 1ENAA 4JV5L 1L0YB 1PXUA 2HDMA 4ULLA 1SN8A 3DWPA 1W6JA 1N32Q 5LMNW 1II3A 4P73A 1B9NA 1PA6A 1B53A 3I4NB 1PZKD 4UP9A 4WFN3 2YV5A 1IKLA 1B8AA 4TSSA 4A3IB 4FF4A 3IAYA 4DR7L 1FNVA 4MTKA 2NVXH 3M4YA 3A8IE 4R1JA 2ZTEA 1E1TA 4LF8Q 5CC4A 4XXEA 3MAQA 3BVGA 1JWSD 2UXBL 3DUZA 1LUZA 1B7YB 1FJGQ 2F4VQ 5DM63 4B3SL 3IRBA 1KTKA 2R93B 3J80i 1AZQA 4DNTB 3G71A 4P72A 1STAA 4DV6L 2RA4A 1CQFA 4HAEA 5I6WA 1PH4A 3MXUA 2VQFQ 1K9MC 4BXXG 1V9PA 1SROA 3KLSX 1N33Q 3ER0A 1HNXL 1F9RA 3J7AF 4OEMB 1Z6HA 1MHWC 2WKDA 3GV6A 5JEAG 4C3HG 5GAEC 1XYIA 4A3FG 3HOYG 4R4TA 3GDEA 4N9PA 4PMWA 5M5WH 1LLRD 3NPPA 1TVXA 1YVCA 4IPDA 5IYBH 4LFCQ 5C3EG 1VQBA 3CPWA 1G2SA 3NTIA 5K36G 3RD4A 3H94A 3S2HH 3J7A5 2F0OA 4ILWA 4B3ML 4JI3Q 1X65A 4JW0A 5C3WA 1EFID 3EQLC 4M8AA 1N34L 5EQ0A 5EPLA 1YEZA 2VNUD 1S4ZA 3D31A 2KHJA 4Q0FA 3VA5A 5JVG3 3CD6A 3I4LA 3KBGA 4A3KG 2JA5G 3UE1A 1L2FA 4GNXA 2KJXA 1K83B 1J5EL 3STBC 2K50A 2VB2X 1STYA 3CAMA 1SE3A 5I9PA 5CV8A 3D3RA 2IW3A 2AQ2B 3AYHB 5KYIA 2ZT9C 4YCVA 3S16H 2R7DA 1XMQL 1JJ2A 3S1MB 3GTMB 3MXNA 4KHPQ 2CW0D 2A6EC 2NZ1D 5IP7G 1PFNA 4RHRA 3I4NH 1BDOA 4DNIA 4JOIC 4CJ0B 3TZDA 1ILPA 1JCKB 2QKIC 1PZID 1GO3E 1KAAA 4N9TA 1VQKA 4JI7Q 3A7LA 1E3PA 5D3DA 1ESRA 2RVLA 1MJEA 3I72A 2IHEA 1VQ6A 5M5YB 4IJHA 4IFDH 3A5ZB 3I7FA 1DM0B 1VQEA 4Z9CB 1IYUA 1YBYA 3VDYA 2R93H 3I4MB 2HCIA 1E0BA 2VW9A 1DD2A 1AZPA 3KF8A 3GTKB 1X3GA 4QCLA 3S17B 1PTOH 1ML0D 2IWHA 2B2UC 4HR7B 5DLQE 4JI5Q 2KVMA 1UAPA 3M7GA 1EZ8A 1CTMA 4UP8A 4DUYQ 3HOZG 4L5SA 5C5MA 3P20A 4EQPA 1KLUD 2DGYA 2PQAB 4QIWB 1ENFA 3R3OA 2R7FA 4BY1B 4A3JB 1BQQT 1Q46A 5HGQA 4QB4A 3C3LA 2XRSD 1STBA 3S1RB 4XQNA 4DAVA 5IY0A 1AN8A 1VQAA 3E0JA 2HDLA 2R6GA 1PFSA 3T1YQ 1EOTA 3VR2A 1XX8A 1IZ6A 1XMOL 1F9QA 4F87A 1U5KA 2I5LX 3EIVA 3CQZB 2F0WA 2ID0A 3TN2A 4GN4B 1D1KA 1GKHA 2O5IC 2DN8A 1CSPA 3MZ5A 3KLWA 1PRTD 1HXYD 2V4DA 3A7AB 2L9HA 3BVMA 4IPHA 3KLSA 1K83H 5M5XB 1GUOA 2WACA 3HGBA 2L11A 1ZYRC 1IBKL 1B70B 4DR1Q 4CKCA 1HTLD 2NVYH 1CHPD 1C7YA 1EQVA 1ASYA 1EYAA 4DUZQ 1WCMB 3D0FA 4X65L 5AJ3Q 2G9DA 4ZQ3A 1L0WA 1EYDA 1VQPA 1EIFA 5KGUA 3GTJB 3ERQA 3SK6A 1BUVT 2JA7B 1NAPA 1D5XC 2EXZA 2D2CC 4DR7Q 3H91A 1X55A 2PO4A 3S24A 4DV2Q 1BCPF 1X3FA 3EN2A 4YWMA 5M5YH 3CCUA 1WTWA 1ENCA 1EY7A 1C8CA 4B3TL 2UXBQ 1BF4A 2R7ZB 4RMFA 3I70A 4GLVB 4IUVA 2A73B 3I4MH 2NZOA 2Z0SA 4ZUIA 4KKUA 3Q24A 4DV6Q 3S17H 1I6HH 4G7ZC 2K4KA 4A3CG 2NN6H 2ZTDA 5EKIA 3LX0A 1SDFA 2NVQB 4H7BA 2I5HA 2A68D 2JN4A 2KQ3A 1CKNB 2PPBC 2D9UA 4IFDG 4O1NA 3FMCA 4XYQA 1HNZQ 4PNYA 3TS2A 2JSOA 2VB3X 4CBVA 1HNXQ 3HZXA 2QEJC 3FPPA 2F03A 2I46A 3H3VC 3NQIA 2E8GA 2K52A 2ZXRA 4JOIA 1QUQB 2L15A 1K3RA 1IW7D 1NR4A 2B3GA 2E74C 4DNRB 5JJZA 3S1RH 3PO3B 4PV1C 2KBNA 1AFPA 1KXLA 2KECA 2OEOA 1NNXA 1EEFD 1J8IA 1Q81C 4NPSA 2EYLA 4JI4L 4B3MQ 4ZKCB 3MFYA 3CQZH 2RKSA 5ELOA 5FKAC 1N34Q 5ELNA 1U4MA 3FKIB 5ISRA 1LO5D 1SYFA 2RF4A 4DR6L 1QNUA 2B2UA 3TEHB 1QG7A 4AH6A 4A3GH 2K14A 3ERSX 5M5XH 1CA5A 1J5EQ 4LFBL 1IHZA 2EPBA 1RF2D 5IGGA 1QWYA 1XMQQ 4KK7A 1Q82C 1C0AA 4P75A 4PZ7A 1V1QA 4R9WA 5EAYA 5GAHC 2ICEC 1AP0A 2FMMA 3J80L 1UE6A 4DV0L 1FYCA 3GO5A 1VQJA 3GTJH 4NP5A 3J7YW 1QNKA 3OYYA 3TRZA 1JJCB 1EY4A 1Q1BA 3J81i 1JC7A 5KNDA 2NYZD 2XTIA 2K5NA 4RHSA 4DF7A 4MZ9A 5JEAJ 1EY8A 5J39A 3KDFB 1DZ1A 2F0QA 4DN4M 3PCOB 2R7ZH 5M3FH 1PH7A 1TWCB 4HEDA 5C44H 5E1FA 4RKBA 3URYA 3K7AH 3PUWA 3SK4A 2MGSA 1UWVA 4BBRH 1N32L 1PRTB 2NVQH 4A3LH 1YNJD 1B9MA 4AYBG 4I7AA 2F1MA 5IWAL 2JP1A 4K2LA 4NB3A 2G9HD 1S5ED 5J22A 5IT9E 1IYVA 5FLXL 4OGQC 4FF3A 2K03A 1B3QA 1B50A 1WVLA 3K7UC 3WDNA 2K5VA 4R8NA 2NN6G 2GVBA 1KABA 2VZAA 3NENA 4K5VA 4ALPA 4GOPB 2NB0A 5IYCH 2ICIA 3K5OA 3PO3H 1CUKA 3M3YB 2VS1A 5C5LA 1UUPA 1SNDA 2GN5A 4C3HB 4JBKA 4HCEA 3HOYB 4A3FB 1G91A 4DR4L 3BZDB 1E24A 4P71A 1H9KA 2AUKA 1TU2B 5C3EB 1VQOA 4HJ5A 3PUVA 3FKIH 1G8ZD 1DJRD 1TIID 2EDGA 4NXNQ 1GM5A 1EU4A 4CDEC 2E75C 3CPFA 1EQQA 2MPMA 1EIHA 4K6LA 3GD7A 1V1PB 1KHIA 4LFCL 4X3TA 4FF1A 1D6EC 4KD4A 3PF5A 3NWSA 3U4ZA 1EQRA 1P8LA 3E6ZX 4JI1Q 2JA5B 4X65Q 3I2ZA 4P2CB 4RKLA 2K75A 2HHHQ 4A3GG 3V05A 1TWAB 4OWWB 4IALA 2EJFC 2NZHA 2RSOA 1PTOD 1KD1C 3JAMc 1ICFB 1C9OA 5FO7B 2HIXA 1X3QA 1D5ZC 2LXJA 2MO0A 2F0IA 3SK5A 4B3TQ 3G6EA 3TREA 2Y0SE 1TWCH 3SDZA 1A3TA 1ICWA 4MIUA 4A3EH 2O4XA 3E5SA 3J80c 1TR5A 1BR9A 1IKMA 1BO0A 1TWHB 4PZ8A 4KHPL 4HSVA 4AYBE 3JC66 3R2TA 1BXTA 2Z4HA 2EYHA 2UUBQ 2R7ZG 5M3FG 2LSSA 4G57A 4B9WA 4APVA 4EX5A 1N36Q 5EKKA 5C44G 1XPUA 2A69C 1XTDA 4NMZA 2F0HA 1VQ8A 1STGA 1HPCA 2VUMB 4BXXH 4BBRG 4CKBA 2QILA 4LWCA 3FHWA 4A3LG 3A74A 3HOZB 5IP9G 1NJIC 2DNCA 2RCNA 1SYCA 1X6OA 4LNQA 4DV1L 3EVQA 4YWLA 5JEAH 4C3HH 3K59A 2F0GA 4A3FH 3HOYH 2KEEA 4QJFA 4J1MA 3CCJA 3G7LA 2WP8J 5FK9C 5FLXc 3L2PA 2JEAI 4KV6A 4JI5L 3BZKA 3C2PA 4BA2I 4L63B 3F2BA 5K36H 4DUYL 2IX3A 3PUYA 3ZJYC 3PO3G 3STBD 3AB9A 2IL8A 4X62Q 2V1CC 3NXWA 3A56A 4DR6Q 4GNXB 2D0OA 3W1BA 2QDLA 1RCVD 2Z9HA 4WJWA 1SE8A 2A6ED 2FJ2A 2D0PA 3S1QB 2K05A 1S5BD 1RTOA 2JYOA 1I94L 2JA5H 3KF6A 2CQAA 5KEEA 2ZTCA 3BZCA 1TWAH 1WD1A 3M4QA 2AQ1B 4IFDJ 4RG1A 1M90C 1U4LA 3CRKC 1WTRA 4GKKQ 1WTXA 4IFDI 3G4SA 2K32A 1AE2A 2K5DA 3U58A 2F0UA 3T4AC 3B6YA 3NUCA 4DAYA 2RHSB 5DEHA 3W5OA 1I3QB 1G51A 4AQYL 1IBMQ 1EY6A 4Q5VA 3FPUB 4RGTA 4DR1L 2BDNA 4HMIA 3CMAA 3KF8B 4AIMA 2E5LQ 2R3ZA 5LMNQ 1RD9D 3S16B 1CSQA 4DUZL 1TWHH 4IZ8A 5AJ3L 1HR0L 5H1SE 1UE1A 2XWJB 3SXHA 1OTCA 1PHJA 3K80C 5IWAQ 3RUZA 4X6AH 1VQ5A 4LF6L 2EY5A 2NWGA 5JJKA 4QY7A 4A3EG 3JAMi 1VS0A 3QR8A 3NSWA 2SOBA 2Z4IA 4DV2L 4ZLTF 1PH9A 3P1HA 1DGSA 3G6JB 2VUMH 3Q0AA 2UU9L 3HOZH 3EROA 4IJLA 4RGOS 3PF4A 2OTJA 1KNEA 4QQBX 1D8LA 1ESFA 2MNAA 5LMUL 4YCWA 1Y8NB 3OOCA 1PTOB 4IOCA 4WJ3M 2B2WC 1PYBA 3A8KE 1VQMA 4DR4Q 1DOKA 4LW1A 1CQVA 5ELBA 5IT9L 1F2MA 4KD3A 3K5MA 1PFBA 1HNZL 4X3SA 2MHVA 4U68A 4OWXB 5IYDG 4J8QA 3OPOA 1ZYRD 4GKJL 1OO9B 3QG1A 1EY5A 4DV3Q 5CR3A 4TQUS 2SNMA 2IX1A 4A93G 2OWOA 4JBMA 1YIJA 1CKMA 1B44D 4HIMA 3J81L 2F0DA 4H13C 1D1IA 3JAME 1HNWL 3S1QH 3NELA 5GROA 4Y7NB 5G3LD 1VQLA 3R93A 3K58A 4FXKC 5T1GA 3M4OB 1XJVA 4ZK9B 3H09A 3GTPB 1YI2A 3OMGA 4C1NI 5C4ZA 1L1OC 3SHLA 3J80E 4IURA 1NTGA 3HKZG 1HZAA 2VQEL 1KLGD 4L8JA 4MHEA 1QVFA 2PNHA 5CV6A 1HQRD 4XTCS 3F2CA 4IO9A 5CBAE 2OTLA 3I56A 1DONA 1I3QH 2NVTH 1GUTA 5COYA 1TKWB 4DK0A 2NN6I 1PV4A 2NVYB 2SDFA 1MSGA 4LF9L 2OQ0A 2M00A 2E2HH 1PZJD 2N78A 1TS2A 2L4NA 2EYMA 4KKTA 1O78A 3F1ZA 2ATWA 1LTTD 3C1EA 3Q8DA 2Y0SB 1I4HA 1PH5A 4EQ5A 1PDQA 2KCMA 3KBXA 1D7QA 4XDXA 4YHHL 2EY1A 4DR3Q 3HFZB 1ET9A 2BA0A 4A3CH 1JOOA 4K6DA 5FLXE 4BY7G 2X69A 2KENA 2RHQB 3MA2B 2ES2A 3FDTA 3LNNA 2AWNA 4AYBB 4RCNA 1MIUA 4EGVA 2UXDQ 3HOXG 1W3SA 2F0KA 4DV1Q 4G7OC 1K8OA 4DV5Q 3UE0A 3DM3A 3NK9A 1RODA 2D62A 1I6HB 4L5RC 3F2DA 3S14B 3S1NH 2JA8H 4CDDC 2VUMG 1SE2A 1UEBA 2EYOA 2PYKA 2BE5C 4DFAA 4WORA 4QUFA 1OXSC 3MTSA 5HURA 2B2TC 1BOSA 1X32A 3CC2A 3VR3A 1KDCA 1GUWA 1QOHA 4KJNA 1LTBD 1VQIA 2N88A 3ND8A 4QL5A 2IY5B 1YHQA 2IJ0A 4CHTB 1E1OA 1A15A 4Y7NH 3AFPA 1ASZA 5J3BA 4RA8A 4A3MB 2F3VA 2OXPA 4DK1A 1BBWA 1STNA 3M4OH 4LUVA 5IT9c 4OO1G 1I94Q 5DNFA 3H0GG 5ELDA 4FNFA 3GTPH 2F3IA 2FFKB 4BA1I 2AUJD 3CCSA 1CKOA 3P7JA 2ENBA 2Z8LA 4ME3A 4FDBA 4I65A 1JMCA 3HKZE 5JJLA 1G6ZA 3PV0A 3GV3A 4LF7Q 1HZ9A 1RJTA 5C4XH 1PRTF 1Z9FA 4NXNL 5GADC 1MKHA 2B2WA 5ELFA 3J81c 4PG3A 5I2XA 4A3GB 1H95A 4AQYQ 3DEOA 3X3NA 4K5XA 2G5DA 1JOKA 5JOBA 2RDHA 5L37A 4JI2L 2KA7A 5AFWA 4MN3A 4HCSA 4QGUA 4JI1L 4POGA 1HR0Q 4N8X1 4PMCA 2K01A 3R8BA 1QE6A 4P74A 2HHHL 1K0RA 2JK8A 1QVGA 3QIAA 2ZM6Q 4LF6Q 4DV4L 1UE7A 1YNNC 5EBDA 4H44C 5C3XA 4XQJA 1IXRA 3H3VI 4HJ9A 1K73C 3Q23A 1MGSA 1CHQD 1L1OA 1K0SA 2EVBA 1YJNA 5M3FB 4I7ZC 2UU9Q 2DY8A 3DMUA 1E2VA 3AFQA 1B3AA 1Q8IA 5LMUQ 2B2VC 5C44B 3BG3A 3EJIA 1RIPA 2HT1A 3K7AB 3M7NA 4OX9L 1F2ZA 2Q2TA 3W2DA 2I07B 3I90A 3S14H 5IGDA 4BBRB 2JEBI 2NUCA 4L5TA 4A3BH 2FHTA 1HUNA 3RNUA 1SXTA 1YZ6A 3BVZA 4XQQA 2UUBL 4K5WA 3NP8A 5EPJA 2WV6D 1N36L 1SYDA 4GKJQ 5CGKA 4KY6A 2PW5A 1N8RC 3PGZA 3W3AA 1EWCA 4A76A 1GOZA 2JA8G 2F4IA 1HNWQ 5JPMC 2WB1G 3GTQB 4POFA 4DR5L 1Q8KA 4A3MH 1O80A 3KOJA 5TSSA 4EVOA 5KYLA 4PQXA 3KK7A 2PI2A 2LY7A 2N3SA 1HFGA 3HEJA 1FL0A 1K28A 4DV7Q 1EY0A 1Y8PB 1EIGA 2VQEQ 1WTHA 3QB3A 2PQEA 4YIJA 1U9RA 3CCEA 5IGEA 4X62L 1AW7A 1O7YA 3SE0A 2AHOB 3VR6A 3JAML 1WFQA 1I50B 3F8TA 4A3DH 4JBWA 1JR0D 2ZJRA 1XTCD 5D3IB 2E2JH 2B2TA 4LF9Q 5C4XG 4YWKA 5HGTA 3OW2A 3SEBA 3ND9A 1PYWD 4F7XA 3RR5A 2A69D 1NE3A 2B8FA 2O2LD 2PQAA 4UHVA 4YHHQ 2H4OA 1LV9A 2MUYA 3PUXA 4GKKL 2XRQD 4KLKA 5BR8L 4LK1C 4IUUA 3T13A 4G7HC 2KCTA 1S5DD 1GUGA 3NE5B 1CI3M 1IBML 2Y0SG 3UDXA 1UNSA 1LTAD 3ULPA 4A3EB 1HUMA 2E5LL 5LMNL 1SNMA 1SMYC 4JVZA 1YITA 1CFMA 1UEAB 1T9HA 1GD7A 4DK6C 5IP9H 5M9OA 1PH8A 1F2YA 4KJOA 1VQ9A 1OXUA 4KMUC 1A0IA 2UXCQ 3A5UA 1LTGD 2EJGC 1NCVA 1TS3A 3BDLA 3MFGA 2F0PA 4K2KA 3BS1A 4B3RL 1GHJA 1QCBD 3NBHA 1W6KA 2KOLA 1EOVA 4JC0A 1EWIA 3OSOA 1LABA 3ZYYX 2CWPA 1WTVA 4DAPA 3H3VH 2WB1E 4A3BG 1H9MA 1E2ZA 1SE4A 5M3MB 3GTQH 3J81E 2Q2UA 2KCNA 4FF2A 3NTKA 4DR2L 3E9IA 3TBIB 2B39A 2XWBB 3BU2A 2A5HA 2Q8TA 2E2IB 4A93B 3K5LA 2RQXA 4LF4L 5IIFA 2L55A 4KHZA 2JA9A 4O42A 1TY0A 3H6MA 1CA6A 1EEID 3G48A 2B2VA 3AQQA 3KFUA 1K8MA 3N52A 4QUCA 3KYHC 1JWMD 3RLOA 2NTSA 1XWEA 1EU3A 4DAYB 4A3MG 4ID6A 1VQHA 4CKEA 4NXML 1XNQL 4DV3L 1BCPC 2N8NA 2ASBA 3TP5A 1I50H 4RWSC 3HKZB 1GVPA 4IUNA 1PYSB 2HCCA 1OXVA 3TP6A 3WOEA 2HQLA 4JI2Q 4MNOA 1CKNA 2XIWA 2P5ZX 2SEBD 2MO1A 2FINB 4E6IA 3KJPA 5EBCA 2QEXA 1VQ7A 4DV4Q 1PTOF 2PZTA 3I3CA 1EFWA 1QUQA 4A3DG 1NBWA 3VR4A 3UI2A 2PMZE 1KQSA 2ALYB 2LKVA 1BBUA 1ONLA 5C0XG 3QJYA 3RN5A 4Y52H 1XXGA 1SLJA 2C35B 3D6CA 4X64L 4C2MB 1D2BA 1QJOA 4RGNA 2WIIB 1SRUA 1LTLA 3I73A 1I4GA 1Q7YC 2D5DA 4NW2A 4BY7B 3GTGH 4LUOA 4OX9Q 1ET6A 4UAIA 5IGBA 4L5QA 1M8AA 3MEHA 3VYSA 4C56C 4R4OA 1CZGA 4OO1I 2KHIA 5E4WC 4FP5D 1FVIA 3HOXB 1HFNA 4OIKA 4RFBA 3CCMA 5GAGC 4KKSA 4JI8L 4DR3L 2N55A 2PI2E 5HY6A 1S72A 2L12A 2GA4B 1TS4A 2Z6BA 3ITPA 3DWQA 2UXDL 3DXJC 1BBXC 5IYDH 5M3MH 2MFIA 1H9RA 2N49A 4C3JH 1SR3A 4DR5Q 4DV5L 5BN5A 4UDUC 4X66L 1S5FD 3M9BA 2E2IH 2BH2A 4A93H 4K8JA 2LFNA 2LMCB 5KIXA 4HIOA 4HTHA 1PH6A 3E0EA 4B9XA 1B4OA 2TSSA 3TZUA 4BS9A 2YU9B 1CM9A 1KIXA 1O7IA 3TMEA 1FR3A 4RH6A 4FO2A 2JA6G 3SVMA 3CCVA 3H0GB 4U673 3VYTA 4PZ6A 3D4DA 1Y8OB 3OHXC 2OQKA 4B08A 4HIDA 1H9SA 4YY3L 3CCLA 4C1NK 3Q22A 3K0YA 3U50C 2I0QA 3I91A 3MXNB 1SAPA 4IUTA 3F2UA 1ILQA 3GQBA 1Q90A 4HN7A 4PMBA 4K14A 1MJCA 4KHVA 2VL6A 1IBLL 3T16A 1E2WA 2MP1A 1N9WA 5FO8B 3HS0C 4LF7L 1Y1VB 2B63H 1QILA 2EJMA 4KTAA 3ULLA 5BR8Q 1EYCA 3P75A 4BBSG 1VF7A 3Q6SA 4KN7C 2XGTA 4OONA 3PIO3 3EFXD 1VCIA 2K33A 5CBEE 1A3UA 1X3PA 3TDQA 2NVTB 4C2MH 2AMCB 3K0XA 1HRJA 5CV5A 5DAUA 1Q86C 1JB7A 4BY7H 1WI5A 2BE5D 3PIP3 1EYGA 2YTVA 1HZBA 2QDBA 2E2HB 1JT8A 2DJFC 1VQGA 4IUQA 2X6GA 5JVH3 5CORA 1B1ZA 3HOXH 3CKIB 1L0XB 1I6VC 5JJIA 4XT3B 1JICA 5LL6X 1KDAA 2ZM6L 1HHVA 3H15A 1U4RA 4HSPA 4TKOB 1NMFA 2RDGA 3HOUB 3CW2C 3A55A 3T53B 1V1PA 4B3RQ 3OTOQ 4MTNA 1SYGA 4NKLA 3CRLC 3T1HL 1SNCA 2A6HC 4BWGB 3MWYW 3CU7A 3IL8A 4UY8C 4JI0L 2O5JC 4DR2Q 1TWGB 4KN4C 4ODGA 3WOFA 3CF5A 1RL2A 3NQTA 1VMCA 3EA6A 1TT2A 4LF4Q 2TMPA 3S1NB 3OWFA 2JA8B 4LF5L 1B2TA 2WB1B 2OT2A 2YU9H 1ZKOA 1EIYB 1PTOC 5A35A 5I6YA 5M3MG 4OO1H 4ABNA 4C3JG 3CCRA 1NR2A 3H0GH 3S2DB 2F0SA 1LYLA 1XNQQ 4NXMQ 4OWTB 1KC8C 2JQOA 2EIFA 5KRUA 3I8ZA 5G3LF 2AQ3B 1HJPA 2BDOA 2Z6KC 3IKJA 3QOLA 3BDOA 4EQOA 3TQYA 2CWAA 1Z7TA 2UUAQ 4KY5A 3FP9A 1YNND 4HJ7A 2K5QA 4V190 3OIPA 4KY7A 2J7ZA 3L7ZC 1KRTA 2WAQG 2R92G 3OMCA 3HG9A 2E2DC 5FJ8G 4G4KA 2ZXPA 1HCZA 2CFMA 1GXDC 2E76C 4DV7L 1Y1VH 3OW7A 2EZVA 1JORA 5C4XB 1DXMA 2K7VA 5D14A 5I2YA 3HOWH 1L1OB 3M4PA 1YJWA 4ZRZA 4J15A 5LHY1 2SNSA 3T56B 2LS01 4DPGA 4HJAA 3ICEA 2BH8A 4X64Q 3GP7A 3PQIA 1S3OA 2BCOA 4J6HA 2CH4W 4JYAL 2PZWA 1HH2P 2PMZB 4QF4A 2B63G 3U4VA 2DJGC 1QZGA 1TY2A 4CJ1B 1SFOH 2K1BA 2C5CA 4WJ4A 1YNXA 3L0OA 1DYQA 1R9TB 3TS0A 2EOTA 1XPRA 4JI8Q 4GLXA 3HOUH 1JWUD 5C4JB 1K3BC 1F9PA 1X3EA 2PCFB 4ZUJA 1VQFA 4OELB 2CHBD 3HOVG 2M9VA 1JE4A 1STHA 2WKCA 2PW7A 2XVSA 5DM73 1IL2A 5FOBB 3QOJA 3CC7A 4O2DA 1WOCA 4LMQD 4CDFC 1WD0A 1Q3LA 1TWGH 4KI0A 1G6PA 2BOSA 4X66Q 3S15B 4RAUC 5T1IA 2LXKA 4A3IH 5I4DA 2C9OA 4UPAA 4A3BB 4S3SA 4IOAA 4K8IA 2K04A 5C4HA 3IFTA 4ZAIA 1YHBA 1F2LA 2UXCL 1HA5A 3GTOB 3AEVA 1KDBA 4UP7A 4OL7A 4IN3A 3S2DH 4GN5A 1W2BA 1DOMA 1FNUA 4M1UB 2DY7A 5C0XJ 4WRDA 5C0XI 2YTXA 3K57A 4YY3Q 1SYEA 2A1AA 1I5FA 1V8QA 3NHHA 2B2YC 2M2LA 2EYPA 2CKZB 3A54A 1EWHA 1BNZA 4JK1C 1I4XA 3FVQA 2K6AA 2WAQE 4F88A 1IBLQ 1S5CD 2QGQA 4IPGA 2GVAA 1VMPA 3PUZA 3EBEA 1PH3A 4DAMA 2A8VA 1HA6A 3U9OA 3BDCA 3K8AA 1SEBD 1PLFA 1WTQA 1SSOA 1SMYD 1ZEQX 4JI6Q 5EPKA 1WTOA 4LFAL 2UUCL 4DU9A 1AE3A 1EQTA 4H0LC 4A3DB 5K5PA 5GQOA 2IT1A 1Y1VG 2WFWA 4XYOA 5IYBG 2E2JB 2IPKD 2YYZA 1J6QA 2IX0A 3HOWG 2AKWB 3PO2B 1P16A 1R9TH 2QW7A 2Z6KA 1K8GA 4R4IA 1LT4D 1MI2A 5D65A 2JXMB 2L0CA 1MBYA 5C4JH 2RSNA 3NBHB 1GUSA 3BYTB 3DLLA 1A62A 1VQNA 4QMGA 3CCQA 4ZCKA 4JV5Q 1F9SA 4LJZC 2JE6I 3W1GA 2MQHA 4A4IA 2WINB 1K8AC 3S1MH 3GTMH 3T1HQ 3RZDB 1M1KC 3VR5A 2K5HA 4JI0Q 4DA2A 4XT1B 4X3KA 3HOUG 1HR0W 3S15H 1DCZA 4JG2A 2B29A 3QWNA 5KNBA 2J0TD 4O0AA 3HP3A 1VQCA 4IUPA 1FGUA 4LF5Q 1BCPD 4C3IB 3DEPA 3D6WA 3GTOH 5CV4A 4CGYB 5A2QL 3I4NG 3CXCA 4B3SQ 2MJ8A 4IPCA 3SR1A 1VQ4A 2NTTA 4LAAA 4GN3B 2I5MX 3GTKH 3PMFA 2F0NA 2AWOA 4FXGC 4A3IG 2CVRA 5J1ZA 5IGCA 2HQEA 1X56A 2EYFA 2OF1A 2JA6B 3BJUA 3MVVA 1QVCA 1YHAA 1JE5A 5FLMH 1DOLA 4CJ2C 1Q1EA 2R93G 2CW0C 5JAVA 1VDZA 1PH1A 3DWAA 4BY1H 3FRPB 4A3JH 4GZYC 1WJJA 1LT6D 2HD3A 1HQMC 1PFMA 2F0FA 4NDXA 3VA7A 2RCFA 2K5WA 1RHPA 5BN3A 3PIOA 5FO9B 1O7ZA 1RKNA 1TS5A 2IHFA 2BA1A 4JCVE 1SNOA 2A74C 1C48A 1HTPA 1TWFB 1KL9A 5EGTA 3J7AV 2F0EA 5IE8A 1PMRA 4JYAQ 3PIPA 3D4WA 4BBSB 5BN4A 2XNAC 1EZ6A 5EJWA 1AEXA 5C0XH 1PVOA 3K6OA 1U0LA 4HJ8A 1H9JA 3L3OC 2JJQA 4RGMA 3RZOB 3PO2H 1QZHA 1PH2A 3GTLB 1YJ9A 2DNEA 2J4XA 1Y69U 2B2YA 3I55A 4F8MA 4JBJA 2ZJQA 4L6TB 2CCZA 4ZYSA 1Z47A 2HIVA 1WCMH 1EUJA 3AU7A 1FD7D 3V96A 3RZDH 2KHSA 4K0KL 5KNCA 1D5MC 1Y1WB 4LUZA 1G291 3GTGB 2JA7H 4ME5A 5CV7A 1HZCA 2B8GA 4GS3A 1BVSA 1XNRL 1LTRD 4YCUA 5IODA 4C3IH 3NBIA 1MD2D 4R4CA 3SGIA 4JPBW 1PRTC 3T51B 3PSIA 1WYDA 2YTYA 1VQDA 4GLAC 3OTOL 3WWVA 3CHBD 1H9SB 1JJGA 1KNAA 3VYRA 4EQNA 4XIGS 1OXXK 4RCOA 1C4QA 2JA6H 1T5EA 4C3JB 5E3FA 3D8GA 3DM1A 1ZXTA 1WTPA 3KF6B 3NEMA 4GOPC 2KCCA 3TSSA 3I4MG 1LM0A 3CMEA 1SJHD 3OIQA 3LWEA 3E3XA 4LF8L 1LTID 1NMGA 1EY9A 1GHKA 1JB3A 1IL8A 4V0BA 3KLRA 1J9OA 1O7LA 1RTNA 2R61A 3M85A 1FJGL 2F4VL 5IGFA 2F52A 3LWUA 3K5NA 2QF7A 5FLMG 2WAQB 2R92B 3TP7A 1I4RA 2EYJA 1CK1A 1V43A 1XPOA 1S40A 1TWFH 4LFAQ 1XMOQ 2UUCQ 2NBFA 2VQFL 1RDPD 4BY1G 2QA4A 4A3JG 1U4PA 2OCEA 1BCPB 1IYJB 1F77A 3IFDA 3ONAB 4N8FA 2UUAL 4BBSH 1N33L 3KUPA 1SNPA 5I9OA 3S9WA 3NTHA 2H5XA 3RLFA 3MEFA 1CT1D 1I4PA 3RZOH 3TP8A 1FNWA 1LT5D 2A68C 1E22A 4CDCC 4TRDA 4HMJA 3GTLH 5ELEA 2F3WA 2F0VA 2RBMA 2A6HD 3UDFA 1IBKQ 2B63B 1V1OA 4TVAB 3O13A 4H02A 4A75A 4A3KB 3PO2G 1IW7C 1M4VA 2X6LA 3J7ZC 2RDFA 4JI3L 3R2IA 1OXTA 1I4QA 1LTSD 1STEA 1Y1WH 2XN9C 2XSCA 3LGJA 3HOVB 2EQSA 1A3VA 3CC4A 1NY4A 3UDGA 1JOQA 2HUGA 1JQYD 5E4XA 3KJOA 2ZJPA 1E7ZA 1WCMG 2L1BA 3VYUA 1X54A 4HIKA 1LACA 3SK8A 4DXGA 1G2TA 4ZKBB 1Y14B 3MC0B 2JA7G 3NWTA 3CP0A 2EXDA 2L5TA 4DGZA 1SBBB 5CMDA 3L9AX 5CYUA 4C3IG 2PZUA 2EY6A 2FMCA 3V2TA 3D4RA 2VY3A 1X9NA 5LL6S 2K28A 3HKSA 3MXPA 5CV9A 4FYDA 5E7NA 2FXQA 4JI7L 1R4PB 2EY2A 1KRSA 3A8JE 1A6XA 1BKBA 2VXWA 2NVXB 1A8VA 2H1EA 3OWEB 1R4QB 4FVMA 2KEDA 1A2TA 2CQOA 3KDFA 1UE5A 3ULJA 4DK3C 3RMHA 3M3YH 1KAWA 2DUDA 3UDIA 3DHQA 2F0MA 2R92H 5C6AA 1SYBA 5FJ8H 5JPNC 4QIWE 1SNQA 1GJXA 4DKAC 3RLNA 4JI4Q 3MHBA 4OIJA 4X3UA 2Q8IB 1T5XD 4OHJA 3I4OA 2Q2HA 5C3EH 4GNXC 3U9SA 3BYYB 5ELCA 1SMXA 3J81j 5IYCG 2KUMA 4R4QA 1YNJC 2Q8RE 1EL0A 1TQOA 1VF5C 5M5WB
chains in the Genus database with same CATH topology
1YNXA 3L0OA 3S14H 3TS0A 1XPRA 2JEBI 2GN5A 4JBKA 4LFBQ 4L5TA 4JI8Q 4GOPA 4GLXA 3RN2A 4A3BH 3HOUH 1Q12A 3RNUA 3FKIG 1X3EA 4DR4L 1YZ6A 4OXPA 1VQFA 2UUBL 3K81C 3T1YL 1E24A 4P71A 4A3KH 3HOVG 1TXYA 1VQOA 1N36L 4JI6L 4K0KQ 4HJ5A 4GKJQ 4DV0Q 3PUVA 3FKIH 1IL2A 1N8RC 3CC7A 3PGZA 4O2DA 4NXNQ 1WOCA 3HOVH 1GM5A 4A76A 3CPFA 1EQQA 1TWGH 2JA8G 4KI0A 1HNWQ 1AH9A 1G6PA 2WB1G 4X66Q 1XNRQ 3GD7A 4POFA 2A19A 5IP7H 1A63A 2LXKA 4DR5L 1Q8KA 4A3IH 4A3MH 1KHIA 3KOJA 3A0JA 4LFCL 4UPAA 2PI2A 4IOAA 3PF5A 2N3SA 1Y1WG 1YHBA 3U4ZA 1EQRA 1P8LA 2Q2IA 2UXCL 3E9HA 4JI1Q 3AEVA 4X65Q 1FL0A 3I2ZA 4UP7A 4JV5L 4DV7Q 2K75A 3S2DH 2VQEQ 3CCEA 4GN5A 2HHHQ 1SN8A 4A3GG 1W2BA 1N32Q 5LMNW 4OWWB 4X62L 5C0XJ 1PA6A 4P73A 2NZHA 5C0XI 2YTXA 4UP9A 1KD1C 3JAMc 2AHOB 1C9OA 4YY3Q 1WFQA 2YV5A 2A1AA 1B8AA 2HIXA 3F8TA 1I5FA 2LXJA 2MO0A 4DR7L 4A3DH 4B3TQ 3G6EA 2CKZB 4JBWA 2Y0SE 3TREA 1TWCH 2NVXH 2ZJRA 4R1JA 2E2JH 2ZTEA 1E1TA 4LF8Q 4LF9Q 2WAQE 1IBLQ 4YWKA 5C4XG 4A3EH 2UXBL 2QGQA 4IPGA 1LUZA 2GVAA 3J80c 3OW2A 1B7YB 1FJGQ 2F4VQ 4B3SL 3IRBA 3PUZA 3EBEA 3RR5A 4PZ8A 3J80i 1PH3A 4DAMA 4KHPL 1NE3A 3G71A 2PQAA 2A8VA 4P72A 4AYBE 3JC66 4YHHQ 4DV6L 3K8AA 3PUXA 4GKKL 4KLKA 1PH4A 2UUBQ 2VQFQ 5BR8L 5M3FG 2LSSA 2R7ZG 1K9MC 4APVA 4EX5A 4JI6Q 1N36Q 4BXXG 1V9PA 4LFAL 1SROA 2UUCL 1N33Q 1AE3A 5C44G 3ER0A 1HNXL 1XPUA 2KCTA 1XTDA 5GQOA 2IT1A 1Y1VG 2WFWA 1IBML 5IYBG 2Y0SG 1VQ8A 3UDXA 4BXXH 3ULPA 4BBRG 5JEAG 4LWCA 5GAEC 3FHWA 2YYZA 3A74A 5LMNL 1J6QA 5IP9G 2IX0A 3GDEA 4R4TA 4A3FG 2AKWB 2RCNA 1NJIC 4PMWA 5M5WH 3HOWG 1X6OA 4LNQA 1P16A 5IYBH 1YVCA 4IPDA 4DV1L 1YITA 2Z6KA 1R9TH 1K8GA 4YWLA 4R4IA 4LFCQ 1T9HA 4C3HH 1GD7A 1VQBA 5C3EG 3CPWA 4DK6C 3HOYH 4A3FH 5IP9H 5K36G 5C4JH 1PH8A 4QJFA 3NBHB 1VQ9A 3CCJA 3S2HH 1OXUA 2WP8J 5FLXc 1A62A 1A0IA 3DLLA 3L2PA 1VQNA 2UXCQ 3CCQA 2JEAI 3A5UA 3J7A5 4JI5L 3BZKA 4JV5Q 4BA2I 3F2BA 2JE6I 3W1GA 4B3ML 2MQHA 4DUYL 4A4IA 4JI3Q 1K8AC 3S1MH 1X65A 3GTMH 4B3RL 3T1HQ 3PUYA 3ZJYC 4JC0A 1EOVA 3STBD 3PO3G 1M1KC 1EWIA 4X62Q 1N34L 2K5HA 2CWPA 2V1CC 4DR6Q 4JI0Q 1YEZA 3H3VH 2VNUD 4GNXB 2D0OA 2WB1E 3D31A 4A3BG 2KHJA 3HOUG 3HOYG 1HR0W 3S15H 3GTQH 4JG2A 2B29A 3W1BA 2Q2UA 3CD6A 4DR2L 4O0AA 3E9IA 1SE8A 1VQCA 4A3KG 2JA5G 3UE1A 1L2FA 2D0PA 4GNXA 1FGUA 3BU2A 4LF5Q 1J5EL 3STBC 2K50A 3CAMA 4LF4L 4KHZA 2JA9A 3GTOH 3AYHB 1I94L 2JA5H 4YCVA 3KF6A 3I4NG 3S16H 2R7DA 3CXCA 1XMQL 4B3SQ 3G48A 1JJ2A 4IPCA 2ZTCA 3AQQA 3BZCA 1VQ4A 3KFUA 4KHPQ 4GN3B 2I5MX 1TWAH 3KYHC 3GTKH 3M4QA 2AWOA 4RG1A 3RLOA 5IP7G 4A3IG 1M90C 3I4NH 4DNIA 4JOIC 4DAYB 4A3MG 4GKKQ 1VQHA 1XNQL 4NXML 4IFDI 4DV3L 3G4SA 1AE2A 1GO3E 2N8NA 1X56A 2ASBA 1I50H 3U58A 1VQKA 3B6YA 4JI7Q 1E3PA 3BJUA 1GVPA 1QVCA 1MJEA 1PYSB 1YHAA 1JE5A 1OXVA 2RHSB 5FLMH 3W5OA 1G51A 4AQYL 2IHEA 1Q1EA 2HQLA 1IBMQ 4IJHA 4JI2Q 1VQ6A 4MNOA 4DR1L 2R93G 1CKNA 3CMAA 3KF8B 4AIMA 1PH1A 3A5ZB 2E5LQ 3I7FA 5LMNQ 4BY1H 1VQEA 2MO1A 4A3JH 1CSQA 3KJPA 4DUZL 1WJJA 1TWHH 1YBYA 2QEXA 3VDYA 1VQ7A 2VW9A 2R93H 5AJ3L 1HR0L 5H1SE 1UE1A 1X3GA 4DV4Q 3PIOA 1OTCA 1EFWA 1QUQA 4A3DG 1PHJA 3K80C 1NBWA 5IWAQ 1KQSA 2PMZE 4X6AH 1VQ5A 2IHFA 2BA1A 4JCVE 4LF6L 2ALYB 5DLQE 1BBUA 4JI5Q 5C0XG 5JJKA 4QY7A 3RN5A 4A3EG 4Y52H 3JAMi 1KL9A 4DUYQ 1VS0A 4UP8A 3HOZG 5IE8A 4L5SA 1SLJA 2C35B 4DV2L 4JYAQ 3PIPA 4X64L 1PH9A 1DGSA 2VUMH 2DGYA 1SRUA 2PQAB 1PVOA 1LTLA 1U0LA 2R7FA 4HJ8A 4IJLA 1Q7YC 2JJQA 2UU9L 3PF4A 3HOZH 3PO2H 1QZHA 3GTGH 2OTJA 4LUOA 4QQBX 1D8LA 4OX9Q 1PH2A 4L5QA 1Q46A 2MNAA 5LMUL 5HGQA 1YJ9A 4R4OA 4YCWA 4OO1I 2KHIA 5IY0A 1FVIA 1VQAA 3I55A 4IOCA 4WJ3M 1PYBA 4JBJA 3CCMA 1VQMA 2ZJQA 4DR4Q 2R6GA 5GAGC 2CCZA 1PFSA 3T1YQ 4LW1A 4JI8L 4DR3L 1Z47A 1IZ6A 2HIVA 1XMOL 2PI2E 5HY6A 1HNZL 1WCMH 1S72A 1EUJA 1U5KA 2I5LX 4OWXB 3EIVA 5IYDG 3RZDH 4K0KL 2ID0A 4GKJL 4GN4B 1GKHA 1CSPA 4DV3Q 3KLWA 2UXDL 4TQUS 2IX1A 4LUZA 4A93G 1G291 5IYDH 5M3MH 2OWOA 2MFIA 2JA7H 4JBMA 2N49A 1CKMA 4C3JH 1YIJA 1HZCA 1SR3A 4HIMA 4DR5Q 4DV5L 4IPHA 4GS3A 1HNWL 4X66L 3S1QH 3NELA 1BVSA 5GROA 3M9BA 1VQLA 1XNRL 1K83H 2E2IH 2BH2A 4A93H 4YCUA 1IBKL 1B70B 4DR1Q 4C3IH 1PH6A 4HIOA 1XJVA 2NVYH 1C7YA 3E0EA 1ASYA 4R4CA 3SGIA 4DUZQ 1YI2A 3PSIA 1WYDA 1KIXA 2YTYA 1VQDA 1O7IA 3D0FA 1L1OC 4GLAC 3OTOL 4X65L 5AJ3Q 4IFDJ 3WWVA 2JA6G 3CCVA 1NTGA 3HKZG 1JJGA 1HZAA 1L0WA 2VQEL 1VQPA 1EIFA 4XIGS 1QVFA 2PNHA 1OXXK 4PZ6A 2OQKA 2JA6H 4HIDA 4XTCS 3F2CA 4IO9A 1X55A 4DR7Q 3KF6B 4YY3L 2OTLA 3S24A 4DV2Q 3I56A 3CCLA 3NEMA 1X3FA 1I3QH 3EN2A 2NVTH 3U50C 4YWMA 5M5YH 3CCUA 4GOPC 2I0QA 3I4MG 1LM0A 3MXNB 2NN6I 3CMEA 4B3TL 2UXBQ 1PV4A 4RMFA 1MJCA 2VL6A 4LF8L 4GLVB 4LF9L 2OQ0A 1IBLL 1NMGA 3I4MH 2NZOA 2E2HH 2Z0SA 2N78A 3M85A 1N9WA 1FJGL 2F4VL 3F1ZA 4DV6Q 4LF7L 2ATWA 3S17H 3Q8DA 2F52A 1I6HH 2K4KA 4A3CG 1PH5A 2B63H 2ZTDA 4EQ5A 5FLMG 2KCMA 3ULLA 5BR8Q 1D7QA 4YHHL 2I5HA 4DR3Q 4BBSG 3HFZB 1CKNB 1V43A 1XPOA 1S40A 1TWFH 4LFAQ 4OONA 2XGTA 2BA0A 1XMOQ 2UUCQ 4IFDG 1HNZQ 1VCIA 2VQFL 3TS2A 4A3CH 1HNXQ 4BY1G 2QA4A 4A3LG 4BY7G 4A3JG 2OCEA 2KENA 2RHQB 1IYJB 4C2MH 2AMCB 3K0XA 2ES2A 2UUAL 4BBSH 1N33L 2AWNA 2E8GA 2K52A 1Q86C 1JB7A 1MIUA 2UXDQ 2H5XA 3RLFA 3MEFA 3HOXG 1WI5A 1QUQB 4JOIA 3RZOH 4BY7H 1EYGA 2L15A 1E22A 1K3RA 1HZBA 1W3SA 2YTVA 4DV1Q 1JT8A 3GTLH 2B3GA 1VQGA 4DV5Q 3UE0A 3DM3A 3S1RH 2KBNA 1KXLA 3HOXH 2D62A 3UDFA 1IBKQ 4L5RC 5JJIA 3F2DA 3S1NH 2ZM6L 2JA8H 4TVAB 3H15A 1NMFA 2VUMG 1Q81C 1UEBA 4NPSA 3CW2C 4JI4L 4B3MQ 4B3RQ 4H02A 4A75A 3PO2G 3CQZH 3OTOQ 4MTNA 5ELOA 1OXSC 1N34Q 3J7ZC 5ELNA 4JI3L 1OXTA 3T1HL 1Y1WH 3CC2A 2RF4A 1VQIA 3LGJA 4UY8C 2EQSA 4QL5A 2IY5B 1YHQA 4DR6L 4JI0L 3TEHB 4DR2Q 3CC4A 1NY4A 1E1OA 4AH6A 4A3GH 3UDGA 4Y7NH 1RL2A 2K14A 3KJOA 3ERSX 3CF5A 5M5XH 2ZJPA 1E7ZA 3AFPA 1J5EQ 1WCMG 1ASZA 5J3BA 4LF4Q 1BBWA 3M4OH 4LFBL 1X54A 4LUVA 5IT9c 1I94Q 4HIKA 4LF5L 4OO1G 3H0GG 3GTPH 1XMQQ 2F3IA 4BA1I 1Q82C 1C0AA 2YU9H 3CCSA 1EIYB 1CKOA 4P75A 4PZ7A 1V1QA 4ME3A 1JMCA 5EAYA 4FDBA 5GAHC 5M3MG 1Y14B 3HKZE 5JJLA 2JA7G 3PV0A 1UE6A 4LF7Q 1HZ9A 3CCRA 3H0GH 4DV0L 1LYLA 1XNQQ 5C4XH 4NXMQ 3GO5A 1Z9FA 2EXDA 3CP0A 4OWTB 1VQJA 4NXNL 3GTJH 5GADC 1MKHA 3J81c 2B63G 1KC8C 2JQOA 4PG3A 2EIFA 3TRZA 3OYYA 1JJCB 1X9NA 2VY3A 1HJPA 1Q1BA 2Z6KC 3HKSA 3J81i 1H95A 5E7NA 2FXQA 2XTIA 2K5NA 4AQYQ 3TQYA 2CWAA 4MZ9A 5JEAJ 1KRSA 2UUAQ 4JI7L 3KDFB 3FP9A 3PCOB 1BKBA 2R7ZH 5M3FH 4HJ7A 1A8VA 1PH7A 4JI2L 4QGUA 3L7ZC 1KRTA 2WAQG 2CQOA 4JI1L 5C44H 4POGA 2R92G 3KDFA 1UE5A 3ULJA 5FJ8G 1HR0Q 2CFMA 4DK3C 3K7AH 3M3YH 4DV7L 1Y1VH 3PUWA 1KAWA 1UWVA 2DUDA 4P74A 3UDIA 2HHHL 1K0RA 2JK8A 1QVGA 4BBRH 1N32L 2ZM6Q 2NVQH 4LF6Q 2R92H 4A3LH 4DV4L 5FJ8H 4QIWE 1UE7A 3HOWH 4AYBG 1L1OB 3M4PA 1IXRA 4DKAC 3RLNA 1YJWA 4J15A 5IWAL 4HJ9A 4JI4Q 3H3VI 1K73C 4NB3A 4DPGA 3I4OA 4HJAA 2Q2HA 2BH8A 5C3EH 3ICEA 4GNXC 4X64Q 1SMXA 3J81j 1L1OA 1S3OA 5IYCG 1YJNA 4JYAL 2UU9Q 3K7UC 1HH2P 4R4QA 2K5VA 2NN6G 3AFQA 2GVBA 3U4VA 2E5LL 4ALPA 2VZAA 3NENA 5LMUQ 4GOPB 1QZGA 5IYCH 1RIPA 2HT1A 3PO3H 1CUKA 3M7NA 4OX9L 1SFOH 2VS1A 2Q2TA 4WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNX A;  3L0O A;  3S14 H;  3TS0 A;  1XPR A;  2JEB I;  2GN5 A;  4JBK A;  4LFB Q;  4L5T A;  4JI8 Q;  4GOP A;  4GLX A;  3RN2 A;  4A3B H;  3HOU H;  1Q12 A;  3RNU A;  3FKI G;  1X3E A;  4DR4 L;  1YZ6 A;  4OXP A;  1VQF A;  2UUB L;  3K81 C;  3T1Y L;  1E24 A;  4P71 A;  4A3K H;  3HOV G;  1TXY A;  1VQO A;  1N36 L;  4JI6 L;  4K0K Q;  4HJ5 A;  4GKJ Q;  4DV0 Q;  3PUV A;  3FKI H;  1IL2 A;  1N8R C;  3CC7 A;  3PGZ A;  4O2D A;  4NXN Q;  1WOC A;  3HOV H;  1GM5 A;  4A76 A;  3CPF A;  1EQQ A;  1TWG H;  2JA8 G;  4KI0 A;  1HNW Q;  1AH9 A;  1G6P A;  2WB1 G;  4X66 Q;  1XNR Q;  3GD7 A;  4POF A;  2A19 A;  5IP7 H;  1A63 A;  2LXK A;  4DR5 L;  1Q8K A;  4A3I H;  4A3M H;  1KHI A;  3KOJ A;  3A0J A;  4LFC L;  4UPA A;  2PI2 A;  4IOA A;  3PF5 A;  2N3S A;  1Y1W G;  1YHB A;  3U4Z A;  1EQR A;  1P8L A;  2Q2I A;  2UXC L;  3E9H A;  4JI1 Q;  3AEV A;  4X65 Q;  1FL0 A;  3I2Z A;  4UP7 A;  4JV5 L;  4DV7 Q;  2K75 A;  3S2D H;  2VQE Q;  3CCE A;  4GN5 A;  2HHH Q;  1SN8 A;  4A3G G;  1W2B A;  1N32 Q;  5LMN W;  4OWW B;  4X62 L;  5C0X J;  1PA6 A;  4P73 A;  2NZH A;  5C0X I;  2YTX A;  4UP9 A;  1KD1 C;  3JAM c;  2AHO B;  1C9O A;  4YY3 Q;  1WFQ A;  2YV5 A;  2A1A A;  1B8A A;  2HIX A;  3F8T A;  1I5F A;  2LXJ A;  2MO0 A;  4DR7 L;  4A3D H;  4B3T Q;  3G6E A;  2CKZ B;  4JBW A;  2Y0S E;  3TRE A;  1TWC H;  2NVX H;  2ZJR A;  4R1J A;  2E2J H;  2ZTE A;  1E1T A;  4LF8 Q;  4LF9 Q;  2WAQ E;  1IBL Q;  4YWK A;  5C4X G;  4A3E H;  2UXB L;  2QGQ A;  4IPG A;  1LUZ A;  2GVA A;  3J80 c;  3OW2 A;  1B7Y B;  1FJG Q;  2F4V Q;  4B3S L;  3IRB A;  3PUZ A;  3EBE A;  3RR5 A;  4PZ8 A;  3J80 i;  1PH3 A;  4DAM A;  4KHP L;  1NE3 A;  3G71 A;  2PQA A;  2A8V A;  4P72 A;  4AYB E;  3JC6 6;  4YHH Q;  4DV6 L;  3K8A A;  3PUX A;  4GKK L;  4KLK A;  1PH4 A;  2UUB Q;  2VQF Q;  5BR8 L;  5M3F G;  2LSS A;  2R7Z G;  1K9M C;  4APV A;  4EX5 A;  4JI6 Q;  1N36 Q;  4BXX G;  1V9P A;  4LFA L;  1SRO A;  2UUC L;  1N33 Q;  1AE3 A;  5C44 G;  3ER0 A;  1HNX L;  1XPU A;  2KCT A;  1XTD A;  5GQO A;  2IT1 A;  1Y1V G;  2WFW A;  1IBM L;  5IYB G;  2Y0S G;  1VQ8 A;  3UDX A;  4BXX H;  3ULP A;  4BBR G;  5JEA G;  4LWC A;  5GAE C;  3FHW A;  2YYZ A;  3A74 A;  5LMN L;  1J6Q A;  5IP9 G;  2IX0 A;  3GDE A;  4R4T A;  4A3F G;  2AKW B;  2RCN A;  1NJI C;  4PMW A;  5M5W H;  3HOW G;  1X6O A;  4LNQ A;  1P16 A;  5IYB H;  1YVC A;  4IPD A;  4DV1 L;  1YIT A;  2Z6K A;  1R9T H;  1K8G A;  4YWL A;  4R4I A;  4LFC Q;  1T9H A;  4C3H H;  1GD7 A;  1VQB A;  5C3E G;  3CPW A;  4DK6 C;  3HOY H;  4A3F H;  5IP9 H;  5K36 G;  5C4J H;  1PH8 A;  4QJF A;  3NBH B;  1VQ9 A;  3CCJ A;  3S2H H;  1OXU A;  2WP8 J;  5FLX c;  1A62 A;  1A0I A;  3DLL A;  3L2P A;  1VQN A;  2UXC Q;  3CCQ A;  2JEA I;  3A5U A;  3J7A 5;  4JI5 L;  3BZK A;  4JV5 Q;  4BA2 I;  3F2B A;  2JE6 I;  3W1G A;  4B3M L;  2MQH A;  4DUY L;  4A4I A;  4JI3 Q;  1K8A C;  3S1M H;  1X65 A;  3GTM H;  4B3R L;  3T1H Q;  3PUY A;  3ZJY C;  4JC0 A;  1EOV A;  3STB D;  3PO3 G;  1M1K C;  1EWI A;  4X62 Q;  1N34 L;  2K5H A;  2CWP A;  2V1C C;  4DR6 Q;  4JI0 Q;  1YEZ A;  3H3V H;  2VNU D;  4GNX B;  2D0O A;  2WB1 E;  3D31 A;  4A3B G;  2KHJ A;  3HOU G;  3HOY G;  1HR0 W;  3S15 H;  3GTQ H;  4JG2 A;  2B29 A;  3W1B A;  2Q2U A;  3CD6 A;  4DR2 L;  4O0A A;  3E9I A;  1SE8 A;  1VQC A;  4A3K G;  2JA5 G;  3UE1 A;  1L2F A;  2D0P A;  4GNX A;  1FGU A;  3BU2 A;  4LF5 Q;  1J5E L;  3STB C;  2K50 A;  3CAM A;  4LF4 L;  4KHZ A;  2JA9 A;  3GTO H;  3AYH B;  1I94 L;  2JA5 H;  4YCV A;  3KF6 A;  3I4N G;  3S16 H;  2R7D A;  3CXC A;  1XMQ L;  4B3S Q;  3G48 A;  1JJ2 A;  4IPC A;  2ZTC A;  3AQQ A;  3BZC A;  1VQ4 A;  3KFU A;  4KHP Q;  4GN3 B;  2I5M X;  1TWA H;  3KYH C;  3GTK H;  3M4Q A;  2AWO A;  4RG1 A;  3RLO A;  5IP7 G;  4A3I G;  1M90 C;  3I4N H;  4DNI A;  4JOI C;  4DAY B;  4A3M G;  4GKK Q;  1VQH A;  1XNQ L;  4NXM L;  4IFD I;  4DV3 L;  3G4S A;  1AE2 A;  1GO3 E;  2N8N A;  1X56 A;  2ASB A;  1I50 H;  3U58 A;  1VQK A;  3B6Y A;  4JI7 Q;  1E3P A;  3BJU A;  1GVP A;  1QVC A;  1MJE A;  1PYS B;  1YHA A;  1JE5 A;  1OXV A;  2RHS B;  5FLM H;  3W5O A;  1G51 A;  4AQY L;  2IHE A;  1Q1E A;  2HQL A;  1IBM Q;  4IJH A;  4JI2 Q;  1VQ6 A;  4MNO A;  4DR1 L;  2R93 G;  1CKN A;  3CMA A;  3KF8 B;  4AIM A;  1PH1 A;  3A5Z B;  2E5L Q;  3I7F A;  5LMN Q;  4BY1 H;  1VQE A;  2MO1 A;  4A3J H;  1CSQ A;  3KJP A;  4DUZ L;  1WJJ A;  1TWH H;  1YBY A;  2QEX A;  3VDY A;  1VQ7 A;  2VW9 A;  2R93 H;  5AJ3 L;  1HR0 L;  5H1S E;  1UE1 A;  1X3G A;  4DV4 Q;  3PIO A;  1OTC A;  1EFW A;  1QUQ A;  4A3D G;  1PHJ A;  3K80 C;  1NBW A;  5IWA Q;  1KQS A;  2PMZ E;  4X6A H;  1VQ5 A;  2IHF A;  2BA1 A;  4JCV E;  4LF6 L;  2ALY B;  5DLQ E;  1BBU A;  4JI5 Q;  5C0X G;  5JJK A;  4QY7 A;  3RN5 A;  4A3E G;  4Y52 H;  3JAM i;  1KL9 A;  4DUY Q;  1VS0 A;  4UP8 A;  3HOZ G;  5IE8 A;  4L5S A;  1SLJ A;  2C35 B;  4DV2 L;  4JYA Q;  3PIP A;  4X64 L;  1PH9 A;  1DGS A;  2VUM H;  2DGY A;  1SRU A;  2PQA B;  1PVO A;  1LTL A;  1U0L A;  2R7F A;  4HJ8 A;  4IJL A;  1Q7Y C;  2JJQ A;  2UU9 L;  3PF4 A;  3HOZ H;  3PO2 H;  1QZH A;  3GTG H;  2OTJ A;  4LUO A;  4QQB X;  1D8L A;  4OX9 Q;  1PH2 A;  4L5Q A;  1Q46 A;  2MNA A;  5LMU L;  5HGQ A;  1YJ9 A;  4R4O A;  4YCW A;  4OO1 I;  2KHI A;  5IY0 A;  1FVI A;  1VQA A;  3I55 A;  4IOC A;  4WJ3 M;  1PYB A;  4JBJ A;  3CCM A;  1VQM A;  2ZJQ A;  4DR4 Q;  2R6G A;  5GAG C;  2CCZ A;  1PFS A;  3T1Y Q;  4LW1 A;  4JI8 L;  4DR3 L;  1Z47 A;  1IZ6 A;  2HIV A;  1XMO L;  2PI2 E;  5HY6 A;  1HNZ L;  1WCM H;  1S72 A;  1EUJ A;  1U5K A;  2I5L X;  4OWX B;  3EIV A;  5IYD G;  3RZD H;  4K0K L;  2ID0 A;  4GKJ L;  4GN4 B;  1GKH A;  1CSP A;  4DV3 Q;  3KLW A;  2UXD L;  4TQU S;  2IX1 A;  4LUZ A;  4A93 G;  1G29 1;  5IYD H;  5M3M H;  2OWO A;  2MFI A;  2JA7 H;  4JBM A;  2N49 A;  1CKM A;  4C3J H;  1YIJ A;  1HZC A;  1SR3 A;  4HIM A;  4DR5 Q;  4DV5 L;  4IPH A;  4GS3 A;  1HNW L;  4X66 L;  3S1Q H;  3NEL A;  1BVS A;  5GRO A;  3M9B A;  1VQL A;  1XNR L;  1K83 H;  2E2I H;  2BH2 A;  4A93 H;  4YCU A;  1IBK L;  1B70 B;  4DR1 Q;  4C3I H;  1PH6 A;  4HIO A;  1XJV A;  2NVY H;  1C7Y A;  3E0E A;  1ASY A;  4R4C A;  3SGI A;  4DUZ Q;  1YI2 A;  3PSI A;  1WYD A;  1KIX A;  2YTY A;  1VQD A;  1O7I A;  3D0F A;  1L1O C;  4GLA C;  3OTO L;  4X65 L;  5AJ3 Q;  4IFD J;  3WWV A;  2JA6 G;  3CCV A;  1NTG A;  3HKZ G;  1JJG A;  1HZA A;  1L0W A;  2VQE L;  1VQP A;  1EIF A;  4XIG S;  1QVF A;  2PNH A;  1OXX K;  4PZ6 A;  2OQK A;  2JA6 H;  4HID A;  4XTC S;  3F2C A;  4IO9 A;  1X55 A;  4DR7 Q;  3KF6 B;  4YY3 L;  2OTL A;  3S24 A;  4DV2 Q;  3I56 A;  3CCL A;  3NEM A;  1X3F A;  1I3Q H;  3EN2 A;  2NVT H;  3U50 C;  4YWM A;  5M5Y H;  3CCU A;  4GOP C;  2I0Q A;  3I4M G;  1LM0 A;  3MXN B;  2NN6 I;  3CME A;  4B3T L;  2UXB Q;  1PV4 A;  4RMF A;  1MJC A;  2VL6 A;  4LF8 L;  4GLV B;  4LF9 L;  2OQ0 A;  1IBL L;  1NMG A;  3I4M H;  2NZO A;  2E2H H;  2Z0S A;  2N78 A;  3M85 A;  1N9W A;  1FJG L;  2F4V L;  3F1Z A;  4DV6 Q;  4LF7 L;  2ATW A;  3S17 H;  3Q8D A;  2F52 A;  1I6H H;  2K4K A;  4A3C G;  1PH5 A;  2B63 H;  2ZTD A;  4EQ5 A;  5FLM G;  2KCM A;  3ULL A;  5BR8 Q;  1D7Q A;  4YHH L;  2I5H A;  4DR3 Q;  4BBS G;  3HFZ B;  1CKN B;  1V43 A;  1XPO A;  1S40 A;  1TWF H;  4LFA Q;  4OON A;  2XGT A;  2BA0 A;  1XMO Q;  2UUC Q;  4IFD G;  1HNZ Q;  1VCI A;  2VQF L;  3TS2 A;  4A3C H;  1HNX Q;  4BY1 G;  2QA4 A;  4A3L G;  4BY7 G;  4A3J G;  2OCE A;  2KEN A;  2RHQ B;  1IYJ B;  4C2M H;  2AMC B;  3K0X A;  2ES2 A;  2UUA L;  4BBS H;  1N33 L;  2AWN A;  2E8G A;  2K52 A;  1Q86 C;  1JB7 A;  1MIU A;  2UXD Q;  2H5X A;  3RLF A;  3MEF A;  3HOX G;  1WI5 A;  1QUQ B;  4JOI A;  3RZO H;  4BY7 H;  1EYG A;  2L15 A;  1E22 A;  1K3R A;  1HZB A;  1W3S A;  2YTV A;  4DV1 Q;  1JT8 A;  3GTL H;  2B3G A;  1VQG A;  4DV5 Q;  3UE0 A;  3DM3 A;  3S1R H;  2KBN A;  1KXL A;  3HOX H;  2D62 A;  3UDF A;  1IBK Q;  4L5R C;  5JJI A;  3F2D A;  3S1N H;  2ZM6 L;  2JA8 H;  4TVA B;  3H15 A;  1NMF A;  2VUM G;  1Q81 C;  1UEB A;  4NPS A;  3CW2 C;  4JI4 L;  4B3M Q;  4B3R Q;  4H02 A;  4A75 A;  3PO2 G;  3CQZ H;  3OTO Q;  4MTN A;  5ELO A;  1OXS C;  1N34 Q;  3J7Z C;  5ELN A;  4JI3 L;  1OXT A;  3T1H L;  1Y1W H;  3CC2 A;  2RF4 A;  1VQI A;  3LGJ A;  4UY8 C;  2EQS A;  4QL5 A;  2IY5 B;  1YHQ A;  4DR6 L;  4JI0 L;  3TEH B;  4DR2 Q;  3CC4 A;  1NY4 A;  1E1O A;  4AH6 A;  4A3G H;  3UDG A;  4Y7N H;  1RL2 A;  2K14 A;  3KJO A;  3ERS X;  3CF5 A;  5M5X H;  2ZJP A;  1E7Z A;  3AFP A;  1J5E Q;  1WCM G;  1ASZ A;  5J3B A;  4LF4 Q;  1BBW A;  3M4O H;  4LFB L;  1X54 A;  4LUV A;  5IT9 c;  1I94 Q;  4HIK A;  4LF5 L;  4OO1 G;  3H0G G;  3GTP H;  1XMQ Q;  2F3I A;  4BA1 I;  1Q82 C;  1C0A A;  2YU9 H;  3CCS A;  1EIY B;  1CKO A;  4P75 A;  4PZ7 A;  1V1Q A;  4ME3 A;  1JMC A;  5EAY A;  4FDB A;  5GAH C;  5M3M G;  1Y14 B;  3HKZ E;  5JJL A;  2JA7 G;  3PV0 A;  1UE6 A;  4LF7 Q;  1HZ9 A;  3CCR A;  3H0G H;  4DV0 L;  1LYL A;  1XNQ Q;  5C4X H;  4NXM Q;  3GO5 A;  1Z9F A;  2EXD A;  3CP0 A;  4OWT B;  1VQJ A;  4NXN L;  3GTJ H;  5GAD C;  1MKH A;  3J81 c;  2B63 G;  1KC8 C;  2JQO A;  4PG3 A;  2EIF A;  3TRZ A;  3OYY A;  1JJC B;  1X9N A;  2VY3 A;  1HJP A;  1Q1B A;  2Z6K C;  3HKS A;  3J81 i;  1H95 A;  5E7N A;  2FXQ A;  2XTI A;  2K5N A;  4AQY Q;  3TQY A;  2CWA A;  4MZ9 A;  5JEA J;  1KRS A;  2UUA Q;  4JI7 L;  3KDF B;  3FP9 A;  3PCO B;  1BKB A;  2R7Z H;  5M3F H;  4HJ7 A;  1A8V A;  1PH7 A;  4JI2 L;  4QGU A;  3L7Z C;  1KRT A;  2WAQ G;  2CQO A;  4JI1 L;  5C44 H;  4POG A;  2R92 G;  3KDF A;  1UE5 A;  3ULJ A;  5FJ8 G;  1HR0 Q;  2CFM A;  4DK3 C;  3K7A H;  3M3Y H;  4DV7 L;  1Y1V H;  3PUW A;  1KAW A;  1UWV A;  2DUD A;  4P74 A;  3UDI A;  2HHH L;  1K0R A;  2JK8 A;  1QVG A;  4BBR H;  1N32 L;  2ZM6 Q;  2NVQ H;  4LF6 Q;  2R92 H;  4A3L H;  4DV4 L;  5FJ8 H;  4QIW E;  1UE7 A;  3HOW H;  4AYB G;  1L1O B;  3M4P A;  1IXR A;  4DKA C;  3RLN A;  1YJW A;  4J15 A;  5IWA L;  4HJ9 A;  4JI4 Q;  3H3V I;  1K73 C;  4NB3 A;  4DPG A;  3I4O A;  4HJA A;  2Q2H A;  2BH8 A;  5C3E H;  3ICE A;  4GNX C;  4X64 Q;  1SMX A;  3J81 j;  1L1O A;  1S3O A;  5IYC G;  1YJN A;  4JYA L;  2UU9 Q;  3K7U C;  1HH2 P;  4R4Q A;  2K5V A;  2NN6 G;  3AFQ A;  2GVB A;  3U4V A;  2E5L L;  4ALP A;  2VZA A;  3NEN A;  5LMU Q;  4GOP B;  1QZG A;  5IYC H;  1RIP A;  2HT1 A;  3PO3 H;  1CUK A;  3M7N A;  4OX9 L;  1SFO H;  2VS1 A;  2Q2T A;  4WJ4 A; 
#chains in the Genus database with same CATH topology
 2PNR C;  5F2D A;  4IQZ A;  3X3M A;  4LFB Q;  4GOP A;  3RN2 A;  5IOC A;  2Z1C A;  3HOW B;  1Q12 A;  2QCP X;  3FKI G;  4OXP A;  3S2H B;  3N6R A;  3K81 C;  3T1Y L;  1FGB D;  1GUN A;  4A3K H;  1MSH A;  1TXY A;  4JI6 L;  3AMU A;  4K0K Q;  4DV0 Q;  3MXG A;  2F0T A;  4R8I A;  2F0L A;  3HOV H;  1LT3 D;  3C1F A;  4FXD A;  2ZXO A;  3FEW X;  1A2U A;  1AH9 A;  1CZW A;  4DXF A;  1XNR Q;  1SFO B;  2A19 A;  5IP7 H;  1A63 A;  3A0J A;  1NSN S;  2F0J A;  3QO2 A;  1NUC A;  2CH4 A;  3HRZ C;  1Y1W G;  3C46 A;  5NUC A;  2Q2I A;  1QB5 D;  5A2Q E;  2EE1 A;  1SJE D;  3E9H A;  5EKL A;  1ENA A;  4JV5 L;  1L0Y B;  1PXU A;  2HDM A;  4ULL A;  1SN8 A;  3DWP A;  1W6J A;  1N32 Q;  5LMN W;  1II3 A;  4P73 A;  1B9N A;  1PA6 A;  1B53 A;  3I4N B;  1PZK D;  4UP9 A;  4WFN 3;  2YV5 A;  1IKL A;  1B8A A;  4TSS A;  4A3I B;  4FF4 A;  3IAY A;  4DR7 L;  1FNV A;  4MTK A;  2NVX H;  3M4Y A;  3A8I E;  4R1J A;  2ZTE A;  1E1T A;  4LF8 Q;  5CC4 A;  4XXE A;  3MAQ A;  3BVG A;  1JWS D;  2UXB L;  3DUZ A;  1LUZ A;  1B7Y B;  1FJG Q;  2F4V Q;  5DM6 3;  4B3S L;  3IRB A;  1KTK A;  2R93 B;  3J80 i;  1AZQ A;  4DNT B;  3G71 A;  4P72 A;  1STA A;  4DV6 L;  2RA4 A;  1CQF A;  4HAE A;  5I6W A;  1PH4 A;  3MXU A;  2VQF Q;  1K9M C;  4BXX G;  1V9P A;  1SRO A;  3KLS X;  1N33 Q;  3ER0 A;  1HNX L;  1F9R A;  3J7A F;  4OEM B;  1Z6H A;  1MHW C;  2WKD A;  3GV6 A;  5JEA G;  4C3H G;  5GAE C;  1XYI A;  4A3F G;  3HOY G;  4R4T A;  3GDE A;  4N9P A;  4PMW A;  5M5W H;  1LLR D;  3NPP A;  1TVX A;  1YVC A;  4IPD A;  5IYB H;  4LFC Q;  5C3E G;  1VQB A;  3CPW A;  1G2S A;  3NTI A;  5K36 G;  3RD4 A;  3H94 A;  3S2H H;  3J7A 5;  2F0O A;  4ILW A;  4B3M L;  4JI3 Q;  1X65 A;  4JW0 A;  5C3W A;  1EFI D;  3EQL C;  4M8A A;  1N34 L;  5EQ0 A;  5EPL A;  1YEZ A;  2VNU D;  1S4Z A;  3D31 A;  2KHJ A;  4Q0F A;  3VA5 A;  5JVG 3;  3CD6 A;  3I4L A;  3KBG A;  4A3K G;  2JA5 G;  3UE1 A;  1L2F A;  4GNX A;  2KJX A;  1K83 B;  1J5E L;  3STB C;  2K50 A;  2VB2 X;  1STY A;  3CAM A;  1SE3 A;  5I9P A;  5CV8 A;  3D3R A;  2IW3 A;  2AQ2 B;  3AYH B;  5KYI A;  2ZT9 C;  4YCV A;  3S16 H;  2R7D A;  1XMQ L;  1JJ2 A;  3S1M B;  3GTM B;  3MXN A;  4KHP Q;  2CW0 D;  2A6E C;  2NZ1 D;  5IP7 G;  1PFN A;  4RHR A;  3I4N H;  1BDO A;  4DNI A;  4JOI C;  4CJ0 B;  3TZD A;  1ILP A;  1JCK B;  2QKI C;  1PZI D;  1GO3 E;  1KAA A;  4N9T A;  1VQK A;  4JI7 Q;  3A7L A;  1E3P A;  5D3D A;  1ESR A;  2RVL A;  1MJE A;  3I72 A;  2IHE A;  1VQ6 A;  5M5Y B;  4IJH A;  4IFD H;  3A5Z B;  3I7F A;  1DM0 B;  1VQE A;  4Z9C B;  1IYU A;  1YBY A;  3VDY A;  2R93 H;  3I4M B;  2HCI A;  1E0B A;  2VW9 A;  1DD2 A;  1AZP A;  3KF8 A;  3GTK B;  1X3G A;  4QCL A;  3S17 B;  1PTO H;  1ML0 D;  2IWH A;  2B2U C;  4HR7 B;  5DLQ E;  4JI5 Q;  2KVM A;  1UAP A;  3M7G A;  1EZ8 A;  1CTM A;  4UP8 A;  4DUY Q;  3HOZ G;  4L5S A;  5C5M A;  3P20 A;  4EQP A;  1KLU D;  2DGY A;  2PQA B;  4QIW B;  1ENF A;  3R3O A;  2R7F A;  4BY1 B;  4A3J B;  1BQQ T;  1Q46 A;  5HGQ A;  4QB4 A;  3C3L A;  2XRS D;  1STB A;  3S1R B;  4XQN A;  4DAV A;  5IY0 A;  1AN8 A;  1VQA A;  3E0J A;  2HDL A;  2R6G A;  1PFS A;  3T1Y Q;  1EOT A;  3VR2 A;  1XX8 A;  1IZ6 A;  1XMO L;  1F9Q A;  4F87 A;  1U5K A;  2I5L X;  3EIV A;  3CQZ B;  2F0W A;  2ID0 A;  3TN2 A;  4GN4 B;  1D1K A;  1GKH A;  2O5I C;  2DN8 A;  1CSP A;  3MZ5 A;  3KLW A;  1PRT D;  1HXY D;  2V4D A;  3A7A B;  2L9H A;  3BVM A;  4IPH A;  3KLS A;  1K83 H;  5M5X B;  1GUO A;  2WAC A;  3HGB A;  2L11 A;  1ZYR C;  1IBK L;  1B70 B;  4DR1 Q;  4CKC A;  1HTL D;  2NVY H;  1CHP D;  1C7Y A;  1EQV A;  1ASY A;  1EYA A;  4DUZ Q;  1WCM B;  3D0F A;  4X65 L;  5AJ3 Q;  2G9D A;  4ZQ3 A;  1L0W A;  1EYD A;  1VQP A;  1EIF A;  5KGU A;  3GTJ B;  3ERQ A;  3SK6 A;  1BUV T;  2JA7 B;  1NAP A;  1D5X C;  2EXZ A;  2D2C C;  4DR7 Q;  3H91 A;  1X55 A;  2PO4 A;  3S24 A;  4DV2 Q;  1BCP F;  1X3F A;  3EN2 A;  4YWM A;  5M5Y H;  3CCU A;  1WTW A;  1ENC A;  1EY7 A;  1C8C A;  4B3T L;  2UXB Q;  1BF4 A;  2R7Z B;  4RMF A;  3I70 A;  4GLV B;  4IUV A;  2A73 B;  3I4M H;  2NZO A;  2Z0S A;  4ZUI A;  4KKU A;  3Q24 A;  4DV6 Q;  3S17 H;  1I6H H;  4G7Z C;  2K4K A;  4A3C G;  2NN6 H;  2ZTD A;  5EKI A;  3LX0 A;  1SDF A;  2NVQ B;  4H7B A;  2I5H A;  2A68 D;  2JN4 A;  2KQ3 A;  1CKN B;  2PPB C;  2D9U A;  4IFD G;  4O1N A;  3FMC A;  4XYQ A;  1HNZ Q;  4PNY A;  3TS2 A;  2JSO A;  2VB3 X;  4CBV A;  1HNX Q;  3HZX A;  2QEJ C;  3FPP A;  2F03 A;  2I46 A;  3H3V C;  3NQI A;  2E8G A;  2K52 A;  2ZXR A;  4JOI A;  1QUQ B;  2L15 A;  1K3R A;  1IW7 D;  1NR4 A;  2B3G A;  2E74 C;  4DNR B;  5JJZ A;  3S1R H;  3PO3 B;  4PV1 C;  2KBN A;  1AFP A;  1KXL A;  2KEC A;  2OEO A;  1NNX A;  1EEF D;  1J8I A;  1Q81 C;  4NPS A;  2EYL A;  4JI4 L;  4B3M Q;  4ZKC B;  3MFY A;  3CQZ H;  2RKS A;  5ELO A;  5FKA C;  1N34 Q;  5ELN A;  1U4M A;  3FKI B;  5ISR A;  1LO5 D;  1SYF A;  2RF4 A;  4DR6 L;  1QNU A;  2B2U A;  3TEH B;  1QG7 A;  4AH6 A;  4A3G H;  2K14 A;  3ERS X;  5M5X H;  1CA5 A;  1J5E Q;  4LFB L;  1IHZ A;  2EPB A;  1RF2 D;  5IGG A;  1QWY A;  1XMQ Q;  4KK7 A;  1Q82 C;  1C0A A;  4P75 A;  4PZ7 A;  1V1Q A;  4R9W A;  5EAY A;  5GAH C;  2ICE C;  1AP0 A;  2FMM A;  3J80 L;  1UE6 A;  4DV0 L;  1FYC A;  3GO5 A;  1VQJ A;  3GTJ H;  4NP5 A;  3J7Y W;  1QNK A;  3OYY A;  3TRZ A;  1JJC B;  1EY4 A;  1Q1B A;  3J81 i;  1JC7 A;  5KND A;  2NYZ D;  2XTI A;  2K5N A;  4RHS A;  4DF7 A;  4MZ9 A;  5JEA J;  1EY8 A;  5J39 A;  3KDF B;  1DZ1 A;  2F0Q A;  4DN4 M;  3PCO B;  2R7Z H;  5M3F H;  1PH7 A;  1TWC B;  4HED A;  5C44 H;  5E1F A;  4RKB A;  3URY A;  3K7A H;  3PUW A;  3SK4 A;  2MGS A;  1UWV A;  4BBR H;  1N32 L;  1PRT B;  2NVQ H;  4A3L H;  1YNJ D;  1B9M A;  4AYB G;  4I7A A;  2F1M A;  5IWA L;  2JP1 A;  4K2L A;  4NB3 A;  2G9H D;  1S5E D;  5J22 A;  5IT9 E;  1IYV A;  5FLX L;  4OGQ C;  4FF3 A;  2K03 A;  1B3Q A;  1B50 A;  1WVL A;  3K7U C;  3WDN A;  2K5V A;  4R8N A;  2NN6 G;  2GVB A;  1KAB A;  2VZA A;  3NEN A;  4K5V A;  4ALP A;  4GOP B;  2NB0 A;  5IYC H;  2ICI A;  3K5O A;  3PO3 H;  1CUK A;  3M3Y B;  2VS1 A;  5C5L A;  1UUP A;  1SND A;  2GN5 A;  4C3H B;  4JBK A;  4HCE A;  3HOY B;  4A3F B;  1G91 A;  4DR4 L;  3BZD B;  1E24 A;  4P71 A;  1H9K A;  2AUK A;  1TU2 B;  5C3E B;  1VQO A;  4HJ5 A;  3PUV A;  3FKI H;  1G8Z D;  1DJR D;  1TII D;  2EDG A;  4NXN Q;  1GM5 A;  1EU4 A;  4CDE C;  2E75 C;  3CPF A;  1EQQ A;  2MPM A;  1EIH A;  4K6L A;  3GD7 A;  1V1P B;  1KHI A;  4LFC L;  4X3T A;  4FF1 A;  1D6E C;  4KD4 A;  3PF5 A;  3NWS A;  3U4Z A;  1EQR A;  1P8L A;  3E6Z X;  4JI1 Q;  2JA5 B;  4X65 Q;  3I2Z A;  4P2C B;  4RKL A;  2K75 A;  2HHH Q;  4A3G G;  3V05 A;  1TWA B;  4OWW B;  4IAL A;  2EJF C;  2NZH A;  2RSO A;  1PTO D;  1KD1 C;  3JAM c;  1ICF B;  1C9O A;  5FO7 B;  2HIX A;  1X3Q A;  1D5Z C;  2LXJ A;  2MO0 A;  2F0I A;  3SK5 A;  4B3T Q;  3G6E A;  3TRE A;  2Y0S E;  1TWC H;  3SDZ A;  1A3T A;  1ICW A;  4MIU A;  4A3E H;  2O4X A;  3E5S A;  3J80 c;  1TR5 A;  1BR9 A;  1IKM A;  1BO0 A;  1TWH B;  4PZ8 A;  4KHP L;  4HSV A;  4AYB E;  3JC6 6;  3R2T A;  1BXT A;  2Z4H A;  2EYH A;  2UUB Q;  2R7Z G;  5M3F G;  2LSS A;  4G57 A;  4B9W A;  4APV A;  4EX5 A;  1N36 Q;  5EKK A;  5C44 G;  1XPU A;  2A69 C;  1XTD A;  4NMZ A;  2F0H A;  1VQ8 A;  1STG A;  1HPC A;  2VUM B;  4BXX H;  4BBR G;  4CKB A;  2QIL A;  4LWC A;  3FHW A;  4A3L G;  3A74 A;  3HOZ B;  5IP9 G;  1NJI C;  2DNC A;  2RCN A;  1SYC A;  1X6O A;  4LNQ A;  4DV1 L;  3EVQ A;  4YWL A;  5JEA H;  4C3H H;  3K59 A;  2F0G A;  4A3F H;  3HOY H;  2KEE A;  4QJF A;  4J1M A;  3CCJ A;  3G7L A;  2WP8 J;  5FK9 C;  5FLX c;  3L2P A;  2JEA I;  4KV6 A;  4JI5 L;  3BZK A;  3C2P A;  4BA2 I;  4L63 B;  3F2B A;  5K36 H;  4DUY L;  2IX3 A;  3PUY A;  3ZJY C;  3PO3 G;  3STB D;  3AB9 A;  2IL8 A;  4X62 Q;  2V1C C;  3NXW A;  3A56 A;  4DR6 Q;  4GNX B;  2D0O A;  3W1B A;  2QDL A;  1RCV D;  2Z9H A;  4WJW A;  1SE8 A;  2A6E D;  2FJ2 A;  2D0P A;  3S1Q B;  2K05 A;  1S5B D;  1RTO A;  2JYO A;  1I94 L;  2JA5 H;  3KF6 A;  2CQA A;  5KEE A;  2ZTC A;  3BZC A;  1TWA H;  1WD1 A;  3M4Q A;  2AQ1 B;  4IFD J;  4RG1 A;  1M90 C;  1U4L A;  3CRK C;  1WTR A;  4GKK Q;  1WTX A;  4IFD I;  3G4S A;  2K32 A;  1AE2 A;  2K5D A;  3U58 A;  2F0U A;  3T4A C;  3B6Y A;  3NUC A;  4DAY A;  2RHS B;  5DEH A;  3W5O A;  1I3Q B;  1G51 A;  4AQY L;  1IBM Q;  1EY6 A;  4Q5V A;  3FPU B;  4RGT A;  4DR1 L;  2BDN A;  4HMI A;  3CMA A;  3KF8 B;  4AIM A;  2E5L Q;  2R3Z A;  5LMN Q;  1RD9 D;  3S16 B;  1CSQ A;  4DUZ L;  1TWH H;  4IZ8 A;  5AJ3 L;  1HR0 L;  5H1S E;  1UE1 A;  2XWJ B;  3SXH A;  1OTC A;  1PHJ A;  3K80 C;  5IWA Q;  3RUZ A;  4X6A H;  1VQ5 A;  4LF6 L;  2EY5 A;  2NWG A;  5JJK A;  4QY7 A;  4A3E G;  3JAM i;  1VS0 A;  3QR8 A;  3NSW A;  2SOB A;  2Z4I A;  4DV2 L;  4ZLT F;  1PH9 A;  3P1H A;  1DGS A;  3G6J B;  2VUM H;  3Q0A A;  2UU9 L;  3HOZ H;  3ERO A;  4IJL A;  4RGO S;  3PF4 A;  2OTJ A;  1KNE A;  4QQB X;  1D8L A;  1ESF A;  2MNA A;  5LMU L;  4YCW A;  1Y8N B;  3OOC A;  1PTO B;  4IOC A;  4WJ3 M;  2B2W C;  1PYB A;  3A8K E;  1VQM A;  4DR4 Q;  1DOK A;  4LW1 A;  1CQV A;  5ELB A;  5IT9 L;  1F2M A;  4KD3 A;  3K5M A;  1PFB A;  1HNZ L;  4X3S A;  2MHV A;  4U68 A;  4OWX B;  5IYD G;  4J8Q A;  3OPO A;  1ZYR D;  4GKJ L;  1OO9 B;  3QG1 A;  1EY5 A;  4DV3 Q;  5CR3 A;  4TQU S;  2SNM A;  2IX1 A;  4A93 G;  2OWO A;  4JBM A;  1YIJ A;  1CKM A;  1B44 D;  4HIM A;  3J81 L;  2F0D A;  4H13 C;  1D1I A;  3JAM E;  1HNW L;  3S1Q H;  3NEL A;  5GRO A;  4Y7N B;  5G3L D;  1VQL A;  3R93 A;  3K58 A;  4FXK C;  5T1G A;  3M4O B;  1XJV A;  4ZK9 B;  3H09 A;  3GTP B;  1YI2 A;  3OMG A;  4C1N I;  5C4Z A;  1L1O C;  3SHL A;  3J80 E;  4IUR A;  1NTG A;  3HKZ G;  1HZA A;  2VQE L;  1KLG D;  4L8J A;  4MHE A;  1QVF A;  2PNH A;  5CV6 A;  1HQR D;  4XTC S;  3F2C A;  4IO9 A;  5CBA E;  2OTL A;  3I56 A;  1DON A;  1I3Q H;  2NVT H;  1GUT A;  5COY A;  1TKW B;  4DK0 A;  2NN6 I;  1PV4 A;  2NVY B;  2SDF A;  1MSG A;  4LF9 L;  2OQ0 A;  2M00 A;  2E2H H;  1PZJ D;  2N78 A;  1TS2 A;  2L4N A;  2EYM A;  4KKT A;  1O78 A;  3F1Z A;  2ATW A;  1LTT D;  3C1E A;  3Q8D A;  2Y0S B;  1I4H A;  1PH5 A;  4EQ5 A;  1PDQ A;  2KCM A;  3KBX A;  1D7Q A;  4XDX A;  4YHH L;  2EY1 A;  4DR3 Q;  3HFZ B;  1ET9 A;  2BA0 A;  4A3C H;  1JOO A;  4K6D A;  5FLX E;  4BY7 G;  2X69 A;  2KEN A;  2RHQ B;  3MA2 B;  2ES2 A;  3FDT A;  3LNN A;  2AWN A;  4AYB B;  4RCN A;  1MIU A;  4EGV A;  2UXD Q;  3HOX G;  1W3S A;  2F0K A;  4DV1 Q;  4G7O C;  1K8O A;  4DV5 Q;  3UE0 A;  3DM3 A;  3NK9 A;  1ROD A;  2D62 A;  1I6H B;  4L5R C;  3F2D A;  3S14 B;  3S1N H;  2JA8 H;  4CDD C;  2VUM G;  1SE2 A;  1UEB A;  2EYO A;  2PYK A;  2BE5 C;  4DFA A;  4WOR A;  4QUF A;  1OXS C;  3MTS A;  5HUR A;  2B2T C;  1BOS A;  1X32 A;  3CC2 A;  3VR3 A;  1KDC A;  1GUW A;  1QOH A;  4KJN A;  1LTB D;  1VQI A;  2N88 A;  3ND8 A;  4QL5 A;  2IY5 B;  1YHQ A;  2IJ0 A;  4CHT B;  1E1O A;  1A15 A;  4Y7N H;  3AFP A;  1ASZ A;  5J3B A;  4RA8 A;  4A3M B;  2F3V A;  2OXP A;  4DK1 A;  1BBW A;  1STN A;  3M4O H;  4LUV A;  5IT9 c;  4OO1 G;  1I94 Q;  5DNF A;  3H0G G;  5ELD A;  4FNF A;  3GTP H;  2F3I A;  2FFK B;  4BA1 I;  2AUJ D;  3CCS A;  1CKO A;  3P7J A;  2ENB A;  2Z8L A;  4ME3 A;  4FDB A;  4I65 A;  1JMC A;  3HKZ E;  5JJL A;  1G6Z A;  3PV0 A;  3GV3 A;  4LF7 Q;  1HZ9 A;  1RJT A;  5C4X H;  1PRT F;  1Z9F A;  4NXN L;  5GAD C;  1MKH A;  2B2W A;  5ELF A;  3J81 c;  4PG3 A;  5I2X A;  4A3G B;  1H95 A;  4AQY Q;  3DEO A;  3X3N A;  4K5X A;  2G5D A;  1JOK A;  5JOB A;  2RDH A;  5L37 A;  4JI2 L;  2KA7 A;  5AFW A;  4MN3 A;  4HCS A;  4QGU A;  4JI1 L;  4POG A;  1HR0 Q;  4N8X 1;  4PMC A;  2K01 A;  3R8B A;  1QE6 A;  4P74 A;  2HHH L;  1K0R A;  2JK8 A;  1QVG A;  3QIA A;  2ZM6 Q;  4LF6 Q;  4DV4 L;  1UE7 A;  1YNN C;  5EBD A;  4H44 C;  5C3X A;  4XQJ A;  1IXR A;  3H3V I;  4HJ9 A;  1K73 C;  3Q23 A;  1MGS A;  1CHQ D;  1L1O A;  1K0S A;  2EVB A;  1YJN A;  5M3F B;  4I7Z C;  2UU9 Q;  2DY8 A;  3DMU A;  1E2V A;  3AFQ A;  1B3A A;  1Q8I A;  5LMU Q;  2B2V C;  5C44 B;  3BG3 A;  3EJI A;  1RIP A;  2HT1 A;  3K7A B;  3M7N A;  4OX9 L;  1F2Z A;  2Q2T A;  3W2D A;  2I07 B;  3I90 A;  3S14 H;  5IGD A;  4BBR B;  2JEB I;  2NUC A;  4L5T A;  4A3B H;  2FHT A;  1HUN A;  3RNU A;  1SXT A;  1YZ6 A;  3BVZ A;  4XQQ A;  2UUB L;  4K5W A;  3NP8 A;  5EPJ A;  2WV6 D;  1N36 L;  1SYD A;  4GKJ Q;  5CGK A;  4KY6 A;  2PW5 A;  1N8R C;  3PGZ A;  3W3A A;  1EWC A;  4A76 A;  1GOZ A;  2JA8 G;  2F4I A;  1HNW Q;  5JPM C;  2WB1 G;  3GTQ B;  4POF A;  4DR5 L;  1Q8K A;  4A3M H;  1O80 A;  3KOJ A;  5TSS A;  4EVO A;  5KYL A;  4PQX A;  3KK7 A;  2PI2 A;  2LY7 A;  2N3S A;  1HFG A;  3HEJ A;  1FL0 A;  1K28 A;  4DV7 Q;  1EY0 A;  1Y8P B;  1EIG A;  2VQE Q;  1WTH A;  3QB3 A;  2PQE A;  4YIJ A;  1U9R A;  3CCE A;  5IGE A;  4X62 L;  1AW7 A;  1O7Y A;  3SE0 A;  2AHO B;  3VR6 A;  3JAM L;  1WFQ A;  1I50 B;  3F8T A;  4A3D H;  4JBW A;  1JR0 D;  2ZJR A;  1XTC D;  5D3I B;  2E2J H;  2B2T A;  4LF9 Q;  5C4X G;  4YWK A;  5HGT A;  3OW2 A;  3SEB A;  3ND9 A;  1PYW D;  4F7X A;  3RR5 A;  2A69 D;  1NE3 A;  2B8F A;  2O2L D;  2PQA A;  4UHV A;  4YHH Q;  2H4O A;  1LV9 A;  2MUY A;  3PUX A;  4GKK L;  2XRQ D;  4KLK A;  5BR8 L;  4LK1 C;  4IUU A;  3T13 A;  4G7H C;  2KCT A;  1S5D D;  1GUG A;  3NE5 B;  1CI3 M;  1IBM L;  2Y0S G;  3UDX A;  1UNS A;  1LTA D;  3ULP A;  4A3E B;  1HUM A;  2E5L L;  5LMN L;  1SNM A;  1SMY C;  4JVZ A;  1YIT A;  1CFM A;  1UEA B;  1T9H A;  1GD7 A;  4DK6 C;  5IP9 H;  5M9O A;  1PH8 A;  1F2Y A;  4KJO A;  1VQ9 A;  1OXU A;  4KMU C;  1A0I A;  2UXC Q;  3A5U A;  1LTG D;  2EJG C;  1NCV A;  1TS3 A;  3BDL A;  3MFG A;  2F0P A;  4K2K A;  3BS1 A;  4B3R L;  1GHJ A;  1QCB D;  3NBH A;  1W6K A;  2KOL A;  1EOV A;  4JC0 A;  1EWI A;  3OSO A;  1LAB A;  3ZYY X;  2CWP A;  1WTV A;  4DAP A;  3H3V H;  2WB1 E;  4A3B G;  1H9M A;  1E2Z A;  1SE4 A;  5M3M B;  3GTQ H;  3J81 E;  2Q2U A;  2KCN A;  4FF2 A;  3NTK A;  4DR2 L;  3E9I A;  3TBI B;  2B39 A;  2XWB B;  3BU2 A;  2A5H A;  2Q8T A;  2E2I B;  4A93 B;  3K5L A;  2RQX A;  4LF4 L;  5IIF A;  2L55 A;  4KHZ A;  2JA9 A;  4O42 A;  1TY0 A;  3H6M A;  1CA6 A;  1EEI D;  3G48 A;  2B2V A;  3AQQ A;  3KFU A;  1K8M A;  3N52 A;  4QUC A;  3KYH C;  1JWM D;  3RLO A;  2NTS A;  1XWE A;  1EU3 A;  4DAY B;  4A3M G;  4ID6 A;  1VQH A;  4CKE A;  4NXM L;  1XNQ L;  4DV3 L;  1BCP C;  2N8N A;  2ASB A;  3TP5 A;  1I50 H;  4RWS C;  3HKZ B;  1GVP A;  4IUN A;  1PYS B;  2HCC A;  1OXV A;  3TP6 A;  3WOE A;  2HQL A;  4JI2 Q;  4MNO A;  1CKN A;  2XIW A;  2P5Z X;  2SEB D;  2MO1 A;  2FIN B;  4E6I A;  3KJP A;  5EBC A;  2QEX A;  1VQ7 A;  4DV4 Q;  1PTO F;  2PZT A;  3I3C A;  1EFW A;  1QUQ A;  4A3D G;  1NBW A;  3VR4 A;  3UI2 A;  2PMZ E;  1KQS A;  2ALY B;  2LKV A;  1BBU A;  1ONL A;  5C0X G;  3QJY A;  3RN5 A;  4Y52 H;  1XXG A;  1SLJ A;  2C35 B;  3D6C A;  4X64 L;  4C2M B;  1D2B A;  1QJO A;  4RGN A;  2WII B;  1SRU A;  1LTL A;  3I73 A;  1I4G A;  1Q7Y C;  2D5D A;  4NW2 A;  4BY7 B;  3GTG H;  4LUO A;  4OX9 Q;  1ET6 A;  4UAI A;  5IGB A;  4L5Q A;  1M8A A;  3MEH A;  3VYS A;  4C56 C;  4R4O A;  1CZG A;  4OO1 I;  2KHI A;  5E4W C;  4FP5 D;  1FVI A;  3HOX B;  1HFN A;  4OIK A;  4RFB A;  3CCM A;  5GAG C;  4KKS A;  4JI8 L;  4DR3 L;  2N55 A;  2PI2 E;  5HY6 A;  1S72 A;  2L12 A;  2GA4 B;  1TS4 A;  2Z6B A;  3ITP A;  3DWQ A;  2UXD L;  3DXJ C;  1BBX C;  5IYD H;  5M3M H;  2MFI A;  1H9R A;  2N49 A;  4C3J H;  1SR3 A;  4DR5 Q;  4DV5 L;  5BN5 A;  4UDU C;  4X66 L;  1S5F D;  3M9B A;  2E2I H;  2BH2 A;  4A93 H;  4K8J A;  2LFN A;  2LMC B;  5KIX A;  4HIO A;  4HTH A;  1PH6 A;  3E0E A;  4B9X A;  1B4O A;  2TSS A;  3TZU A;  4BS9 A;  2YU9 B;  1CM9 A;  1KIX A;  1O7I A;  3TME A;  1FR3 A;  4RH6 A;  4FO2 A;  2JA6 G;  3SVM A;  3CCV A;  3H0G B;  4U67 3;  3VYT A;  4PZ6 A;  3D4D A;  1Y8O B;  3OHX C;  2OQK A;  4B08 A;  4HID A;  1H9S A;  4YY3 L;  3CCL A;  4C1N K;  3Q22 A;  3K0Y A;  3U50 C;  2I0Q A;  3I91 A;  3MXN B;  1SAP A;  4IUT A;  3F2U A;  1ILQ A;  3GQB A;  1Q90 A;  4HN7 A;  4PMB A;  4K14 A;  1MJC A;  4KHV A;  2VL6 A;  1IBL L;  3T16 A;  1E2W A;  2MP1 A;  1N9W A;  5FO8 B;  3HS0 C;  4LF7 L;  1Y1V B;  2B63 H;  1QIL A;  2EJM A;  4KTA A;  3ULL A;  5BR8 Q;  1EYC A;  3P75 A;  4BBS G;  1VF7 A;  3Q6S A;  4KN7 C;  2XGT A;  4OON A;  3PIO 3;  3EFX D;  1VCI A;  2K33 A;  5CBE E;  1A3U A;  1X3P A;  3TDQ A;  2NVT B;  4C2M H;  2AMC B;  3K0X A;  1HRJ A;  5CV5 A;  5DAU A;  1Q86 C;  1JB7 A;  4BY7 H;  1WI5 A;  2BE5 D;  3PIP 3;  1EYG A;  2YTV A;  1HZB A;  2QDB A;  2E2H B;  1JT8 A;  2DJF C;  1VQG A;  4IUQ A;  2X6G A;  5JVH 3;  5COR A;  1B1Z A;  3HOX H;  3CKI B;  1L0X B;  1I6V C;  5JJI A;  4XT3 B;  1JIC A;  5LL6 X;  1KDA A;  2ZM6 L;  1HHV A;  3H15 A;  1U4R A;  4HSP A;  4TKO B;  1NMF A;  2RDG A;  3HOU B;  3CW2 C;  3A55 A;  3T53 B;  1V1P A;  4B3R Q;  3OTO Q;  4MTN A;  1SYG A;  4NKL A;  3CRL C;  3T1H L;  1SNC A;  2A6H C;  4BWG B;  3MWY W;  3CU7 A;  3IL8 A;  4UY8 C;  4JI0 L;  2O5J C;  4DR2 Q;  1TWG B;  4KN4 C;  4ODG A;  3WOF A;  3CF5 A;  1RL2 A;  3NQT A;  1VMC A;  3EA6 A;  1TT2 A;  4LF4 Q;  2TMP A;  3S1N B;  3OWF A;  2JA8 B;  4LF5 L;  1B2T A;  2WB1 B;  2OT2 A;  2YU9 H;  1ZKO A;  1EIY B;  1PTO C;  5A35 A;  5I6Y A;  5M3M G;  4OO1 H;  4ABN A;  4C3J G;  3CCR A;  1NR2 A;  3H0G H;  3S2D B;  2F0S A;  1LYL A;  1XNQ Q;  4NXM Q;  4OWT B;  1KC8 C;  2JQO A;  2EIF A;  5KRU A;  3I8Z A;  5G3L F;  2AQ3 B;  1HJP A;  2BDO A;  2Z6K C;  3IKJ A;  3QOL A;  3BDO A;  4EQO A;  3TQY A;  2CWA A;  1Z7T A;  2UUA Q;  4KY5 A;  3FP9 A;  1YNN D;  4HJ7 A;  2K5Q A;  4V19 0;  3OIP A;  4KY7 A;  2J7Z A;  3L7Z C;  1KRT A;  2WAQ G;  2R92 G;  3OMC A;  3HG9 A;  2E2D C;  5FJ8 G;  4G4K A;  2ZXP A;  1HCZ A;  2CFM A;  1GXD C;  2E76 C;  4DV7 L;  1Y1V H;  3OW7 A;  2EZV A;  1JOR A;  5C4X B;  1DXM A;  2K7V A;  5D14 A;  5I2Y A;  3HOW H;  1L1O B;  3M4P A;  1YJW A;  4ZRZ A;  4J15 A;  5LHY 1;  2SNS A;  3T56 B;  2LS0 1;  4DPG A;  4HJA A;  3ICE A;  2BH8 A;  4X64 Q;  3GP7 A;  3PQI A;  1S3O A;  2BCO A;  4J6H A;  2CH4 W;  4JYA L;  2PZW A;  1HH2 P;  2PMZ B;  4QF4 A;  2B63 G;  3U4V A;  2DJG C;  1QZG A;  1TY2 A;  4CJ1 B;  1SFO H;  2K1B A;  2C5C A;  4WJ4 A;  1YNX A;  3L0O A;  1DYQ A;  1R9T B;  3TS0 A;  2EOT A;  1XPR A;  4JI8 Q;  4GLX A;  3HOU H;  1JWU D;  5C4J B;  1K3B C;  1F9P A;  1X3E A;  2PCF B;  4ZUJ A;  1VQF A;  4OEL B;  2CHB D;  3HOV G;  2M9V A;  1JE4 A;  1STH A;  2WKC A;  2PW7 A;  2XVS A;  5DM7 3;  1IL2 A;  5FOB B;  3QOJ A;  3CC7 A;  4O2D A;  1WOC A;  4LMQ D;  4CDF C;  1WD0 A;  1Q3L A;  1TWG H;  4KI0 A;  1G6P A;  2BOS A;  4X66 Q;  3S15 B;  4RAU C;  5T1I A;  2LXK A;  4A3I H;  5I4D A;  2C9O A;  4UPA A;  4A3B B;  4S3S A;  4IOA A;  4K8I A;  2K04 A;  5C4H A;  3IFT A;  4ZAI A;  1YHB A;  1F2L A;  2UXC L;  1HA5 A;  3GTO B;  3AEV A;  1KDB A;  4UP7 A;  4OL7 A;  4IN3 A;  3S2D H;  4GN5 A;  1W2B A;  1DOM A;  1FNU A;  4M1U B;  2DY7 A;  5C0X J;  4WRD A;  5C0X I;  2YTX A;  3K57 A;  4YY3 Q;  1SYE A;  2A1A A;  1I5F A;  1V8Q A;  3NHH A;  2B2Y C;  2M2L A;  2EYP A;  2CKZ B;  3A54 A;  1EWH A;  1BNZ A;  4JK1 C;  1I4X A;  3FVQ A;  2K6A A;  2WAQ E;  4F88 A;  1IBL Q;  1S5C D;  2QGQ A;  4IPG A;  2GVA A;  1VMP A;  3PUZ A;  3EBE A;  1PH3 A;  4DAM A;  2A8V A;  1HA6 A;  3U9O A;  3BDC A;  3K8A A;  1SEB D;  1PLF A;  1WTQ A;  1SSO A;  1SMY D;  1ZEQ X;  4JI6 Q;  5EPK A;  1WTO A;  4LFA L;  2UUC L;  4DU9 A;  1AE3 A;  1EQT A;  4H0L C;  4A3D B;  5K5P A;  5GQO A;  2IT1 A;  1Y1V G;  2WFW A;  4XYO A;  5IYB G;  2E2J B;  2IPK D;  2YYZ A;  1J6Q A;  2IX0 A;  3HOW G;  2AKW B;  3PO2 B;  1P16 A;  1R9T H;  2QW7 A;  2Z6K A;  1K8G A;  4R4I A;  1LT4 D;  1MI2 A;  5D65 A;  2JXM B;  2L0C A;  1MBY A;  5C4J H;  2RSN A;  3NBH B;  1GUS A;  3BYT B;  3DLL A;  1A62 A;  1VQN A;  4QMG A;  3CCQ A;  4ZCK A;  4JV5 Q;  1F9S A;  4LJZ C;  2JE6 I;  3W1G A;  2MQH A;  4A4I A;  2WIN B;  1K8A C;  3S1M H;  3GTM H;  3T1H Q;  3RZD B;  1M1K C;  3VR5 A;  2K5H A;  4JI0 Q;  4DA2 A;  4XT1 B;  4X3K A;  3HOU G;  1HR0 W;  3S15 H;  1DCZ A;  4JG2 A;  2B29 A;  3QWN A;  5KNB A;  2J0T D;  4O0A A;  3HP3 A;  1VQC A;  4IUP A;  1FGU A;  4LF5 Q;  1BCP D;  4C3I B;  3DEP A;  3D6W A;  3GTO H;  5CV4 A;  4CGY B;  5A2Q L;  3I4N G;  3CXC A;  4B3S Q;  2MJ8 A;  4IPC A;  3SR1 A;  1VQ4 A;  2NTT A;  4LAA A;  4GN3 B;  2I5M X;  3GTK H;  3PMF A;  2F0N A;  2AWO A;  4FXG C;  4A3I G;  2CVR A;  5J1Z A;  5IGC A;  2HQE A;  1X56 A;  2EYF A;  2OF1 A;  2JA6 B;  3BJU A;  3MVV A;  1QVC A;  1YHA A;  1JE5 A;  5FLM H;  1DOL A;  4CJ2 C;  1Q1E A;  2R93 G;  2CW0 C;  5JAV A;  1VDZ A;  1PH1 A;  3DWA A;  4BY1 H;  3FRP B;  4A3J H;  4GZY C;  1WJJ A;  1LT6 D;  2HD3 A;  1HQM C;  1PFM A;  2F0F A;  4NDX A;  3VA7 A;  2RCF A;  2K5W A;  1RHP A;  5BN3 A;  3PIO A;  5FO9 B;  1O7Z A;  1RKN A;  1TS5 A;  2IHF A;  2BA1 A;  4JCV E;  1SNO A;  2A74 C;  1C48 A;  1HTP A;  1TWF B;  1KL9 A;  5EGT A;  3J7A V;  2F0E A;  5IE8 A;  1PMR A;  4JYA Q;  3PIP A;  3D4W A;  4BBS B;  5BN4 A;  2XNA C;  1EZ6 A;  5EJW A;  1AEX A;  5C0X H;  1PVO A;  3K6O A;  1U0L A;  4HJ8 A;  1H9J A;  3L3O C;  2JJQ A;  4RGM A;  3RZO B;  3PO2 H;  1QZH A;  1PH2 A;  3GTL B;  1YJ9 A;  2DNE A;  2J4X A;  1Y69 U;  2B2Y A;  3I55 A;  4F8M A;  4JBJ A;  2ZJQ A;  4L6T B;  2CCZ A;  4ZYS A;  1Z47 A;  2HIV A;  1WCM H;  1EUJ A;  3AU7 A;  1FD7 D;  3V96 A;  3RZD H;  2KHS A;  4K0K L;  5KNC A;  1D5M C;  1Y1W B;  4LUZ A;  1G29 1;  3GTG B;  2JA7 H;  4ME5 A;  5CV7 A;  1HZC A;  2B8G A;  4GS3 A;  1BVS A;  1XNR L;  1LTR D;  4YCU A;  5IOD A;  4C3I H;  3NBI A;  1MD2 D;  4R4C A;  3SGI A;  4JPB W;  1PRT C;  3T51 B;  3PSI A;  1WYD A;  2YTY A;  1VQD A;  4GLA C;  3OTO L;  3WWV A;  3CHB D;  1H9S B;  1JJG A;  1KNA A;  3VYR A;  4EQN A;  4XIG S;  1OXX K;  4RCO A;  1C4Q A;  2JA6 H;  1T5E A;  4C3J B;  5E3F A;  3D8G A;  3DM1 A;  1ZXT A;  1WTP A;  3KF6 B;  3NEM A;  4GOP C;  2KCC A;  3TSS A;  3I4M G;  1LM0 A;  3CME A;  1SJH D;  3OIQ A;  3LWE A;  3E3X A;  4LF8 L;  1LTI D;  1NMG A;  1EY9 A;  1GHK A;  1JB3 A;  1IL8 A;  4V0B A;  3KLR A;  1J9O A;  1O7L A;  1RTN A;  2R61 A;  3M85 A;  1FJG L;  2F4V L;  5IGF A;  2F52 A;  3LWU A;  3K5N A;  2QF7 A;  5FLM G;  2WAQ B;  2R92 B;  3TP7 A;  1I4R A;  2EYJ A;  1CK1 A;  1V43 A;  1XPO A;  1S40 A;  1TWF H;  4LFA Q;  1XMO Q;  2UUC Q;  2NBF A;  2VQF L;  1RDP D;  4BY1 G;  2QA4 A;  4A3J G;  1U4P A;  2OCE A;  1BCP B;  1IYJ B;  1F77 A;  3IFD A;  3ONA B;  4N8F A;  2UUA L;  4BBS H;  1N33 L;  3KUP A;  1SNP A;  5I9O A;  3S9W A;  3NTH A;  2H5X A;  3RLF A;  3MEF A;  1CT1 D;  1I4P A;  3RZO H;  3TP8 A;  1FNW A;  1LT5 D;  2A68 C;  1E22 A;  4CDC C;  4TRD A;  4HMJ A;  3GTL H;  5ELE A;  2F3W A;  2F0V A;  2RBM A;  2A6H D;  3UDF A;  1IBK Q;  2B63 B;  1V1O A;  4TVA B;  3O13 A;  4H02 A;  4A75 A;  4A3K B;  3PO2 G;  1IW7 C;  1M4V A;  2X6L A;  3J7Z C;  2RDF A;  4JI3 L;  3R2I A;  1OXT A;  1I4Q A;  1LTS D;  1STE A;  1Y1W H;  2XN9 C;  2XSC A;  3LGJ A;  3HOV B;  2EQS A;  1A3V A;  3CC4 A;  1NY4 A;  3UDG A;  1JOQ A;  2HUG A;  1JQY D;  5E4X A;  3KJO A;  2ZJP A;  1E7Z A;  1WCM G;  2L1B A;  3VYU A;  1X54 A;  4HIK A;  1LAC A;  3SK8 A;  4DXG A;  1G2T A;  4ZKB B;  1Y14 B;  3MC0 B;  2JA7 G;  3NWT A;  3CP0 A;  2EXD A;  2L5T A;  4DGZ A;  1SBB B;  5CMD A;  3L9A X;  5CYU A;  4C3I G;  2PZU A;  2EY6 A;  2FMC A;  3V2T A;  3D4R A;  2VY3 A;  1X9N A;  5LL6 S;  2K28 A;  3HKS A;  3MXP A;  5CV9 A;  4FYD A;  5E7N A;  2FXQ A;  4JI7 L;  1R4P B;  2EY2 A;  1KRS A;  3A8J E;  1A6X A;  1BKB A;  2VXW A;  2NVX B;  1A8V A;  2H1E A;  3OWE B;  1R4Q B;  4FVM A;  2KED A;  1A2T A;  2CQO A;  3KDF A;  1UE5 A;  3ULJ A;  4DK3 C;  3RMH A;  3M3Y H;  1KAW A;  2DUD A;  3UDI A;  3DHQ A;  2F0M A;  2R92 H;  5C6A A;  1SYB A;  5FJ8 H;  5JPN C;  4QIW E;  1SNQ A;  1GJX A;  4DKA C;  3RLN A;  4JI4 Q;  3MHB A;  4OIJ A;  4X3U A;  2Q8I B;  1T5X D;  4OHJ A;  3I4O A;  2Q2H A;  5C3E H;  4GNX C;  3U9S A;  3BYY B;  5ELC A;  1SMX A;  3J81 j;  5IYC G;  2KUM A;  4R4Q A;  1YNJ C;  2Q8R E;  1EL0 A;  1TQO A;  1VF5 C;  5M5W B; 
#chains in the Genus database with same CATH homology
 1YNX A;  3L0O A;  3S14 H;  3TS0 A;  1XPR A;  2JEB I;  2GN5 A;  4JBK A;  4LFB Q;  4L5T A;  4JI8 Q;  4GOP A;  4GLX A;  3RN2 A;  4A3B H;  3HOU H;  1Q12 A;  3RNU A;  3FKI G;  1X3E A;  4DR4 L;  1YZ6 A;  4OXP A;  1VQF A;  2UUB L;  3K81 C;  3T1Y L;  1E24 A;  4P71 A;  4A3K H;  3HOV G;  1TXY A;  1VQO A;  1N36 L;  4JI6 L;  4K0K Q;  4HJ5 A;  4GKJ Q;  4DV0 Q;  3PUV A;  3FKI H;  1IL2 A;  1N8R C;  3CC7 A;  3PGZ A;  4O2D A;  4NXN Q;  1WOC A;  3HOV H;  1GM5 A;  4A76 A;  3CPF A;  1EQQ A;  1TWG H;  2JA8 G;  4KI0 A;  1HNW Q;  1AH9 A;  1G6P A;  2WB1 G;  4X66 Q;  1XNR Q;  3GD7 A;  4POF A;  2A19 A;  5IP7 H;  1A63 A;  2LXK A;  4DR5 L;  1Q8K A;  4A3I H;  4A3M H;  1KHI A;  3KOJ A;  3A0J A;  4LFC L;  4UPA A;  2PI2 A;  4IOA A;  3PF5 A;  2N3S A;  1Y1W G;  1YHB A;  3U4Z A;  1EQR A;  1P8L A;  2Q2I A;  2UXC L;  3E9H A;  4JI1 Q;  3AEV A;  4X65 Q;  1FL0 A;  3I2Z A;  4UP7 A;  4JV5 L;  4DV7 Q;  2K75 A;  3S2D H;  2VQE Q;  3CCE A;  4GN5 A;  2HHH Q;  1SN8 A;  4A3G G;  1W2B A;  1N32 Q;  5LMN W;  4OWW B;  4X62 L;  5C0X J;  1PA6 A;  4P73 A;  2NZH A;  5C0X I;  2YTX A;  4UP9 A;  1KD1 C;  3JAM c;  2AHO B;  1C9O A;  4YY3 Q;  1WFQ A;  2YV5 A;  2A1A A;  1B8A A;  2HIX A;  3F8T A;  1I5F A;  2LXJ A;  2MO0 A;  4DR7 L;  4A3D H;  4B3T Q;  3G6E A;  2CKZ B;  4JBW A;  2Y0S E;  3TRE A;  1TWC H;  2NVX H;  2ZJR A;  4R1J A;  2E2J H;  2ZTE A;  1E1T A;  4LF8 Q;  4LF9 Q;  2WAQ E;  1IBL Q;  4YWK A;  5C4X G;  4A3E H;  2UXB L;  2QGQ A;  4IPG A;  1LUZ A;  2GVA A;  3J80 c;  3OW2 A;  1B7Y B;  1FJG Q;  2F4V Q;  4B3S L;  3IRB A;  3PUZ A;  3EBE A;  3RR5 A;  4PZ8 A;  3J80 i;  1PH3 A;  4DAM A;  4KHP L;  1NE3 A;  3G71 A;  2PQA A;  2A8V A;  4P72 A;  4AYB E;  3JC6 6;  4YHH Q;  4DV6 L;  3K8A A;  3PUX A;  4GKK L;  4KLK A;  1PH4 A;  2UUB Q;  2VQF Q;  5BR8 L;  5M3F G;  2LSS A;  2R7Z G;  1K9M C;  4APV A;  4EX5 A;  4JI6 Q;  1N36 Q;  4BXX G;  1V9P A;  4LFA L;  1SRO A;  2UUC L;  1N33 Q;  1AE3 A;  5C44 G;  3ER0 A;  1HNX L;  1XPU A;  2KCT A;  1XTD A;  5GQO A;  2IT1 A;  1Y1V G;  2WFW A;  1IBM L;  5IYB G;  2Y0S G;  1VQ8 A;  3UDX A;  4BXX H;  3ULP A;  4BBR G;  5JEA G;  4LWC A;  5GAE C;  3FHW A;  2YYZ A;  3A74 A;  5LMN L;  1J6Q A;  5IP9 G;  2IX0 A;  3GDE A;  4R4T A;  4A3F G;  2AKW B;  2RCN A;  1NJI C;  4PMW A;  5M5W H;  3HOW G;  1X6O A;  4LNQ A;  1P16 A;  5IYB H;  1YVC A;  4IPD A;  4DV1 L;  1YIT A;  2Z6K A;  1R9T H;  1K8G A;  4YWL A;  4R4I A;  4LFC Q;  1T9H A;  4C3H H;  1GD7 A;  1VQB A;  5C3E G;  3CPW A;  4DK6 C;  3HOY H;  4A3F H;  5IP9 H;  5K36 G;  5C4J H;  1PH8 A;  4QJF A;  3NBH B;  1VQ9 A;  3CCJ A;  3S2H H;  1OXU A;  2WP8 J;  5FLX c;  1A62 A;  1A0I A;  3DLL A;  3L2P A;  1VQN A;  2UXC Q;  3CCQ A;  2JEA I;  3A5U A;  3J7A 5;  4JI5 L;  3BZK A;  4JV5 Q;  4BA2 I;  3F2B A;  2JE6 I;  3W1G A;  4B3M L;  2MQH A;  4DUY L;  4A4I A;  4JI3 Q;  1K8A C;  3S1M H;  1X65 A;  3GTM H;  4B3R L;  3T1H Q;  3PUY A;  3ZJY C;  4JC0 A;  1EOV A;  3STB D;  3PO3 G;  1M1K C;  1EWI A;  4X62 Q;  1N34 L;  2K5H A;  2CWP A;  2V1C C;  4DR6 Q;  4JI0 Q;  1YEZ A;  3H3V H;  2VNU D;  4GNX B;  2D0O A;  2WB1 E;  3D31 A;  4A3B G;  2KHJ A;  3HOU G;  3HOY G;  1HR0 W;  3S15 H;  3GTQ H;  4JG2 A;  2B29 A;  3W1B A;  2Q2U A;  3CD6 A;  4DR2 L;  4O0A A;  3E9I A;  1SE8 A;  1VQC A;  4A3K G;  2JA5 G;  3UE1 A;  1L2F A;  2D0P A;  4GNX A;  1FGU A;  3BU2 A;  4LF5 Q;  1J5E L;  3STB C;  2K50 A;  3CAM A;  4LF4 L;  4KHZ A;  2JA9 A;  3GTO H;  3AYH B;  1I94 L;  2JA5 H;  4YCV A;  3KF6 A;  3I4N G;  3S16 H;  2R7D A;  3CXC A;  1XMQ L;  4B3S Q;  3G48 A;  1JJ2 A;  4IPC A;  2ZTC A;  3AQQ A;  3BZC A;  1VQ4 A;  3KFU A;  4KHP Q;  4GN3 B;  2I5M X;  1TWA H;  3KYH C;  3GTK H;  3M4Q A;  2AWO A;  4RG1 A;  3RLO A;  5IP7 G;  4A3I G;  1M90 C;  3I4N H;  4DNI A;  4JOI C;  4DAY B;  4A3M G;  4GKK Q;  1VQH A;  1XNQ L;  4NXM L;  4IFD I;  4DV3 L;  3G4S A;  1AE2 A;  1GO3 E;  2N8N A;  1X56 A;  2ASB A;  1I50 H;  3U58 A;  1VQK A;  3B6Y A;  4JI7 Q;  1E3P A;  3BJU A;  1GVP A;  1QVC A;  1MJE A;  1PYS B;  1YHA A;  1JE5 A;  1OXV A;  2RHS B;  5FLM H;  3W5O A;  1G51 A;  4AQY L;  2IHE A;  1Q1E A;  2HQL A;  1IBM Q;  4IJH A;  4JI2 Q;  1VQ6 A;  4MNO A;  4DR1 L;  2R93 G;  1CKN A;  3CMA A;  3KF8 B;  4AIM A;  1PH1 A;  3A5Z B;  2E5L Q;  3I7F A;  5LMN Q;  4BY1 H;  1VQE A;  2MO1 A;  4A3J H;  1CSQ A;  3KJP A;  4DUZ L;  1WJJ A;  1TWH H;  1YBY A;  2QEX A;  3VDY A;  1VQ7 A;  2VW9 A;  2R93 H;  5AJ3 L;  1HR0 L;  5H1S E;  1UE1 A;  1X3G A;  4DV4 Q;  3PIO A;  1OTC A;  1EFW A;  1QUQ A;  4A3D G;  1PHJ A;  3K80 C;  1NBW A;  5IWA Q;  1KQS A;  2PMZ E;  4X6A H;  1VQ5 A;  2IHF A;  2BA1 A;  4JCV E;  4LF6 L;  2ALY B;  5DLQ E;  1BBU A;  4JI5 Q;  5C0X G;  5JJK A;  4QY7 A;  3RN5 A;  4A3E G;  4Y52 H;  3JAM i;  1KL9 A;  4DUY Q;  1VS0 A;  4UP8 A;  3HOZ G;  5IE8 A;  4L5S A;  1SLJ A;  2C35 B;  4DV2 L;  4JYA Q;  3PIP A;  4X64 L;  1PH9 A;  1DGS A;  2VUM H;  2DGY A;  1SRU A;  2PQA B;  1PVO A;  1LTL A;  1U0L A;  2R7F A;  4HJ8 A;  4IJL A;  1Q7Y C;  2JJQ A;  2UU9 L;  3PF4 A;  3HOZ H;  3PO2 H;  1QZH A;  3GTG H;  2OTJ A;  4LUO A;  4QQB X;  1D8L A;  4OX9 Q;  1PH2 A;  4L5Q A;  1Q46 A;  2MNA A;  5LMU L;  5HGQ A;  1YJ9 A;  4R4O A;  4YCW A;  4OO1 I;  2KHI A;  5IY0 A;  1FVI A;  1VQA A;  3I55 A;  4IOC A;  4WJ3 M;  1PYB A;  4JBJ A;  3CCM A;  1VQM A;  2ZJQ A;  4DR4 Q;  2R6G A;  5GAG C;  2CCZ A;  1PFS A;  3T1Y Q;  4LW1 A;  4JI8 L;  4DR3 L;  1Z47 A;  1IZ6 A;  2HIV A;  1XMO L;  2PI2 E;  5HY6 A;  1HNZ L;  1WCM H;  1S72 A;  1EUJ A;  1U5K A;  2I5L X;  4OWX B;  3EIV A;  5IYD G;  3RZD H;  4K0K L;  2ID0 A;  4GKJ L;  4GN4 B;  1GKH A;  1CSP A;  4DV3 Q;  3KLW A;  2UXD L;  4TQU S;  2IX1 A;  4LUZ A;  4A93 G;  1G29 1;  5IYD H;  5M3M H;  2OWO A;  2MFI A;  2JA7 H;  4JBM A;  2N49 A;  1CKM A;  4C3J H;  1YIJ A;  1HZC A;  1SR3 A;  4HIM A;  4DR5 Q;  4DV5 L;  4IPH A;  4GS3 A;  1HNW L;  4X66 L;  3S1Q H;  3NEL A;  1BVS A;  5GRO A;  3M9B A;  1VQL A;  1XNR L;  1K83 H;  2E2I H;  2BH2 A;  4A93 H;  4YCU A;  1IBK L;  1B70 B;  4DR1 Q;  4C3I H;  1PH6 A;  4HIO A;  1XJV A;  2NVY H;  1C7Y A;  3E0E A;  1ASY A;  4R4C A;  3SGI A;  4DUZ Q;  1YI2 A;  3PSI A;  1WYD A;  1KIX A;  2YTY A;  1VQD A;  1O7I A;  3D0F A;  1L1O C;  4GLA C;  3OTO L;  4X65 L;  5AJ3 Q;  4IFD J;  3WWV A;  2JA6 G;  3CCV A;  1NTG A;  3HKZ G;  1JJG A;  1HZA A;  1L0W A;  2VQE L;  1VQP A;  1EIF A;  4XIG S;  1QVF A;  2PNH A;  1OXX K;  4PZ6 A;  2OQK A;  2JA6 H;  4HID A;  4XTC S;  3F2C A;  4IO9 A;  1X55 A;  4DR7 Q;  3KF6 B;  4YY3 L;  2OTL A;  3S24 A;  4DV2 Q;  3I56 A;  3CCL A;  3NEM A;  1X3F A;  1I3Q H;  3EN2 A;  2NVT H;  3U50 C;  4YWM A;  5M5Y H;  3CCU A;  4GOP C;  2I0Q A;  3I4M G;  1LM0 A;  3MXN B;  2NN6 I;  3CME A;  4B3T L;  2UXB Q;  1PV4 A;  4RMF A;  1MJC A;  2VL6 A;  4LF8 L;  4GLV B;  4LF9 L;  2OQ0 A;  1IBL L;  1NMG A;  3I4M H;  2NZO A;  2E2H H;  2Z0S A;  2N78 A;  3M85 A;  1N9W A;  1FJG L;  2F4V L;  3F1Z A;  4DV6 Q;  4LF7 L;  2ATW A;  3S17 H;  3Q8D A;  2F52 A;  1I6H H;  2K4K A;  4A3C G;  1PH5 A;  2B63 H;  2ZTD A;  4EQ5 A;  5FLM G;  2KCM A;  3ULL A;  5BR8 Q;  1D7Q A;  4YHH L;  2I5H A;  4DR3 Q;  4BBS G;  3HFZ B;  1CKN B;  1V43 A;  1XPO A;  1S40 A;  1TWF H;  4LFA Q;  4OON A;  2XGT A;  2BA0 A;  1XMO Q;  2UUC Q;  4IFD G;  1HNZ Q;  1VCI A;  2VQF L;  3TS2 A;  4A3C H;  1HNX Q;  4BY1 G;  2QA4 A;  4A3L G;  4BY7 G;  4A3J G;  2OCE A;  2KEN A;  2RHQ B;  1IYJ B;  4C2M H;  2AMC B;  3K0X A;  2ES2 A;  2UUA L;  4BBS H;  1N33 L;  2AWN A;  2E8G A;  2K52 A;  1Q86 C;  1JB7 A;  1MIU A;  2UXD Q;  2H5X A;  3RLF A;  3MEF A;  3HOX G;  1WI5 A;  1QUQ B;  4JOI A;  3RZO H;  4BY7 H;  1EYG A;  2L15 A;  1E22 A;  1K3R A;  1HZB A;  1W3S A;  2YTV A;  4DV1 Q;  1JT8 A;  3GTL H;  2B3G A;  1VQG A;  4DV5 Q;  3UE0 A;  3DM3 A;  3S1R H;  2KBN A;  1KXL A;  3HOX H;  2D62 A;  3UDF A;  1IBK Q;  4L5R C;  5JJI A;  3F2D A;  3S1N H;  2ZM6 L;  2JA8 H;  4TVA B;  3H15 A;  1NMF A;  2VUM G;  1Q81 C;  1UEB A;  4NPS A;  3CW2 C;  4JI4 L;  4B3M Q;  4B3R Q;  4H02 A;  4A75 A;  3PO2 G;  3CQZ H;  3OTO Q;  4MTN A;  5ELO A;  1OXS C;  1N34 Q;  3J7Z C;  5ELN A;  4JI3 L;  1OXT A;  3T1H L;  1Y1W H;  3CC2 A;  2RF4 A;  1VQI A;  3LGJ A;  4UY8 C;  2EQS A;  4QL5 A;  2IY5 B;  1YHQ A;  4DR6 L;  4JI0 L;  3TEH B;  4DR2 Q;  3CC4 A;  1NY4 A;  1E1O A;  4AH6 A;  4A3G H;  3UDG A;  4Y7N H;  1RL2 A;  2K14 A;  3KJO A;  3ERS X;  3CF5 A;  5M5X H;  2ZJP A;  1E7Z A;  3AFP A;  1J5E Q;  1WCM G;  1ASZ A;  5J3B A;  4LF4 Q;  1BBW A;  3M4O H;  4LFB L;  1X54 A;  4LUV A;  5IT9 c;  1I94 Q;  4HIK A;  4LF5 L;  4OO1 G;  3H0G G;  3GTP H;  1XMQ Q;  2F3I A;  4BA1 I;  1Q82 C;  1C0A A;  2YU9 H;  3CCS A;  1EIY B;  1CKO A;  4P75 A;  4PZ7 A;  1V1Q A;  4ME3 A;  1JMC A;  5EAY A;  4FDB A;  5GAH C;  5M3M G;  1Y14 B;  3HKZ E;  5JJL A;  2JA7 G;  3PV0 A;  1UE6 A;  4LF7 Q;  1HZ9 A;  3CCR A;  3H0G H;  4DV0 L;  1LYL A;  1XNQ Q;  5C4X H;  4NXM Q;  3GO5 A;  1Z9F A;  2EXD A;  3CP0 A;  4OWT B;  1VQJ A;  4NXN L;  3GTJ H;  5GAD C;  1MKH A;  3J81 c;  2B63 G;  1KC8 C;  2JQO A;  4PG3 A;  2EIF A;  3TRZ A;  3OYY A;  1JJC B;  1X9N A;  2VY3 A;  1HJP A;  1Q1B A;  2Z6K C;  3HKS A;  3J81 i;  1H95 A;  5E7N A;  2FXQ A;  2XTI A;  2K5N A;  4AQY Q;  3TQY A;  2CWA A;  4MZ9 A;  5JEA J;  1KRS A;  2UUA Q;  4JI7 L;  3KDF B;  3FP9 A;  3PCO B;  1BKB A;  2R7Z H;  5M3F H;  4HJ7 A;  1A8V A;  1PH7 A;  4JI2 L;  4QGU A;  3L7Z C;  1KRT A;  2WAQ G;  2CQO A;  4JI1 L;  5C44 H;  4POG A;  2R92 G;  3KDF A;  1UE5 A;  3ULJ A;  5FJ8 G;  1HR0 Q;  2CFM A;  4DK3 C;  3K7A H;  3M3Y H;  4DV7 L;  1Y1V H;  3PUW A;  1KAW A;  1UWV A;  2DUD A;  4P74 A;  3UDI A;  2HHH L;  1K0R A;  2JK8 A;  1QVG A;  4BBR H;  1N32 L;  2ZM6 Q;  2NVQ H;  4LF6 Q;  2R92 H;  4A3L H;  4DV4 L;  5FJ8 H;  4QIW E;  1UE7 A;  3HOW H;  4AYB G;  1L1O B;  3M4P A;  1IXR A;  4DKA C;  3RLN A;  1YJW A;  4J15 A;  5IWA L;  4HJ9 A;  4JI4 Q;  3H3V I;  1K73 C;  4NB3 A;  4DPG A;  3I4O A;  4HJA A;  2Q2H A;  2BH8 A;  5C3E H;  3ICE A;  4GNX C;  4X64 Q;  1SMX A;  3J81 j;  1L1O A;  1S3O A;  5IYC G;  1YJN A;  4JYA L;  2UU9 Q;  3K7U C;  1HH2 P;  4R4Q A;  2K5V A;  2NN6 G;  3AFQ A;  2GVB A;  3U4V A;  2E5L L;  4ALP A;  2VZA A;  3NEN A;  5LMU Q;  4GOP B;  1QZG A;  5IYC H;  1RIP A;  2HT1 A;  3PO3 H;  1CUK A;  3M7N A;  4OX9 L;  1SFO H;  2VS1 A;  2Q2T A;  4WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...