2F0MA

Crystal structure of staphylococcal nuclease mutant v23l/i72v
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0mA00
2EXZA 1TQOA 4J1MA 2ENBA 4N9PA 5KEEA 4IZ8A 4QMGA 3P1HA 3PMFA 2EY6A 5I9OA 5K5PA 4NP5A 5DAUA 2EY5A 2F0OA 1EY9A 5HGTA 1A2TA 4DU9A 2EYFA 5J39A 3EVQA 3NQTA 4KHVA 4YIJA 5KIXA 3SHLA 2EYMA 1U9RA 5EGTA 3T13A 4K5XA 5IOCA 4HMIA 1SYDA 1ENAA 1II3A 2F0HA 4K14A 5KYLA 4K2KA 4ZUIA 3V2TA 1SNDA 3D6CA 5I6WA 2QDBA 5ISRA 4OL7A 3SK6A 4K5VA 4WORA 2F0GA 5I9PA 5JAVA 3H6MA 3MHBA 3DHQA 2F0VA 1KAAA 1EY4A 2SOBA 3LX0A 3MEHA 3OSOA 1A3VA 1STYA 1SNMA 2HQEA 2PYKA 1EY5A 2F0KA 2SNSA 4K8JA 5DEHA 5NUCA 4NKLA 1EY8A 3HZXA 3QB3A 4KJOA 4KV6A 4PMCA 4ZUJA 5J1ZA 3TP8A 5IIFA 2WACA 5J22A 2NUCA 3C1FA 1A2UA 2KHSA 2F0DA 3D8GA 2F0EA 3OMGA 3RUZA 2F0JA 5HURA 4ID6A 4TRDA 3VA5A 1SYCA 2EYJA 3ITPA 3OWFA 4EQOA 1STGA 4KTAA 5C6AA 3EJIA 4B9XA 3BDCA 4LAAA 3OMCA 4N9TA 1JOOA 1EZ8A 4KY7A 2F0FA 2PQEA 4HMJA 1NSNS 2LKVA 2F0TA 1JORA 2EYPA 4WRDA 3U9OA 2F3VA 1SNPA 5C3WA 3D4WA 1A3TA 4NMZA 5F2DA 1STNA 3EROA 1NUCA 4IUNA 3QOLA 1F2ZA 2RBMA 2PZWA 4PNYA 3DMUA 4DGZA 5KYIA 3NP8A 2SNMA 1SYBA 4QF4A 1SNCA 2EYOA 2F0MA 2PW7A 3ERQA 4DFAA 4EVOA 3MXPA 5C4ZA 1STBA 1STAA 1SNQA 4IALA 5CR3A 3SK5A 5IGCA 4G57A 3C1EA 4QB4A 3NHHA 3SR1A 3TP5A 4B9WA 1F2YA 4E6IA 5M9OA 5C4HA 5CV4A 1TT2A 3SK4A 1JOQA 1RKNA 1TR5A 5IGBA 1SYFA 2M00A 5IGFA 3BDLA 4EQNA 3NXWA 5C5LA 3D4DA 4DF7A 4F8MA 5E1FA 1KDBA 2F0SA 5EKLA 3TP7A 5I6YA 5JOBA 5CV8A 1EY0A 1JOKA 3NK9A 2O4XA 4S3SA 2F0IA 3TP6A 4KJNA 1ENCA 2EYLA 1STHA 3E5SA 4ODGA 5IGDA 4I65A 2PZUA 3NUCA 4F7XA 3QOJA 3MZ5A 5CV7A 4MIUA 2PW5A 5CGKA 3MVVA 1IHZA 1KDAA 4K8IA 1EQVA 4H7BA 1EYDA 4KD3A 4NDXA 3SK8A 3HEJA 5IGGA 3S9WA 4J6HA 5E3FA 2F0PA 2EY1A 4KY6A 4KD4A 3P75A 2EY2A 2F0QA 5CV6A 4ME5A 2F3WA 1EYAA 4HTHA 1SYEA 1EYCA 1EY6A 5CV9A 5C5MA 2RDFA 4RKLA 4K2LA 2F0UA 4R8NA 2KQ3A 4K6DA 4RKBA 5EKKA 2OF1A 3SXHA 3TMEA 5IGEA 5KGUA 2RKSA 4KY5A 4PMBA 4EQPA 5KRUA 5CC4A 5CV5A 2F0WA 1EZ6A 1F2MA 3T16A 1KABA 1KDCA 4K5WA 4ZQ3A 1SYGA 2OEOA 2F0LA 2EYHA 1SNOA 2OXPA 2PZTA 5C3XA 2F0NA 3R3OA 5IODA 1A3UA 1AEXA 1EY7A
chains in the Genus database with same CATH superfamily
2D0PA 1HNXQ 3A5ZB 1I5FA 3RLFA 3KF8B 3CW2C 1NY4A 3EN2A 1F9RA 4LF9L 3J80L 2BH2A 1B3QA 2EYMA 2CHBD 3U4VA 1EUJA 4LUZA 3MA2B 1QVFA 3D6CA 3CCQA 4K5VA 4UP9A 3M9BA 3Q0AA 1YNXA 1UEBA 1H95A 1L0XB 3IFDA 5IOCA 1LTLA 2RVLA 2Q2IA 3BVGA 1D5XC 1MKHA 3PV0A 1I6HB 1UE7A 2F0DA 1CHPD 1XPOA 4X3TA 4ID6A 4BY1G 2L15A 3SEBA 4KTAA 1SMYD 4DK1A 4B9XA 4EX5A 3KK7A 3B6YA 3HOYG 3QG1A 4A3KB 4DR6Q 2OTLA 4ZYSA 3W3AA 1SRUA 1LT5D 1STNA 2CH4W 1CSPA 3HS0C 4PNYA 3M7GA 4DV6L 3TSSA 2RCFA 4RWSC 1ESRA 1O7LA 2JA9A 3VR2A 3PUVA 2IX0A 2NN6G 3HKZG 4OELB 2NZOA 3SK4A 4Y7NB 5COYA 4POFA 5ELFA 1O7IA 1IKLA 3L3OC 4KI0A 4ZCKA 3K5NA 1CSQA 5C3EB 2Z0SA 4HJ5A 3TP7A 1B50A 3HOWB 2F4VL 4A3KH 2QW7A 4PV1C 4H44C 1CT1D 3VR5A 4I65A 1VCIA 3PSIA 3C3LA 1HHVA 4C3IB 4MIUA 2G9DA 3GV3A 3T4AC 2HDLA 3I91A 1E1OA 3R93A 5M5WH 3LGJA 1PZJD 2JA7H 1YIJA 1C0AA 1JWMD 4KD4A 3P75A 4DK6C 4Y7NH 4A93B 1BCPB 1K0RA 5KGUA 2E2HB 1NMFA 3TMEA 1XNQL 2RF4A 4KN7C 1KABA 4ZRZA 3CCLA 2B2VA 3GTPB 2LXJA 3ULJA 4C3IH 1PH1A 1EYGA 1HZ9A 2XRSD 4B3MQ 3U4ZA 1AEXA 2NVXH 2WKDA 5IWAL 2IX1A 4DN4M 3E6ZX 3P1HA 4GKJL 3V96A 4LFBQ 4PZ8A 4R9WA 3J7AV 4DR2Q 1LTBD 2HQLA 4A75A 2IX3A 4A93H 2LS01 5KIXA 3CC2A 2LFNA 4IN3A 4GLXA 3E9IA 4HJAA 4PMWA 1Y8OB 2K03A 3RMHA 4CDDC 1LABA 1U4RA 4X64L 3GTPH 4WORA 2L9HA 1EY5A 1B70B 1PFNA 1JQYD 1S5BD 2HHHQ 3GO5A 4P73A 4QGUA 2KOLA 2A1AA 1MJCA 2O5JC 3BDCA 3A7AB 5FKAC 4JG2A 1SAPA 1CA6A 1GD7A 5FO9B 1WTHA 2EYPA 4LF5L 4DUYQ 5IP9H 4ZAIA 4HIDA 4BBSG 1LTTD 3CCEA 1F2ZA 2A69C 1HR0L 5GROA 3KF6B 4KN4C 1X9NA 3SK5A 3AB9A 1CKMA 3C1EA 2A68D 2NVQH 1YHAA 4X65L 3BS1A 3HOXG 1TS2A 1VQOA 4DAYB 1WTQA 1L2FA 2GN5A 1HNWL 3CPWA 4DV2L 3H0GB 5CV8A 3D31A 4ODGA 3IFTA 1W6KA 1PA6A 3L0OA 4C2MH 4YY3Q 3M4OB 1I4QA 1WCMH 4FXDA 1QNUA 3S1RB 4C3HB 1NNXA 1N32L 1HA5A 1K8MA 3WDNA 2EY1A 5ELCA 1H9KA 1EOVA 4WFN3 3KLRA 2JA8H 1BBUA 4RKLA 3VYSA 4A3GH 1IYJB 1IW7C 2QCPX 3I2ZA 5I2YA 3H0GH 3KUPA 1ILQA 4FP5D 3EFXD 3TZUA 1N33Q 1TWCB 3GTLH 2OEOA 2OQKA 2F0LA 3AFPA 5JEAH 1DGSA 1AW7A 1JB7A 1BF4A 4IJLA 4A3JG 1HR0W 3WOEA 4C3HH 5JEAJ 4JYAQ 2IY5B 4BBRG 1S3OA 2EY5A 2ZM6Q 2PI2A 1HUNA 1VF7A 3OHXC 4X3SA 4LF7Q 2WAQE 3PGZA 1L0YB 1EIFA 1TWCH 4XIGS 4RG1A 2QDLA 2L0CA 2IPKD 1A3VA 2ATWA 1MI2A 1XXGA 4DR1L 1M4VA 1I4PA 3E3XA 3DWQA 2ID0A 4JV5Q 2R7FA 4EQOA 3T1YQ 3OWFA 1HPCA 1BCPC 2A69D 2IW3A 4N8X1 2XGTA 4A3EB 1HQRD 1RJTA 3FEWX 1CZWA 4YWKA 1TWAH 3KLSA 1F77A 2FFKB 4CHTB 4BY7G 4DXGA 4DV0Q 5KYIA 2HDMA 4QF4A 1JE5A 5FLXc 3PO2G 4JI5Q 3ICEA 1M8AA 1O80A 4GLVB 4LFAQ 1GM5A 2YU9H 1E0BA 3NHHA 4HEDA 3BZCA 1HUMA 1KNAA 4XDXA 2RQXA 1KLUD 3CCMA 3S2HH 2EVBA 1WTPA 4DF7A 4DAPA 1QZGA 3UE0A 2PNHA 4A3EH 3I4NB 2E2JB 1R4QB 5EKLA 5AFWA 4P72A 2F1MA 3TP6A 5M3MG 2JJQA 4IFDI 4V0BA 3AU7A 3Q24A 1O7ZA 3ZJYC 3UI2A 4ULLA 4U673 3NEMA 2WAQG 4LJZC 5CGKA 3JAME 4RCOA 1EQVA 1GKHA 4A3LG 3T51B 1VDZA 1A6XA 2F0PA 3AFQA 2L11A 2KCTA 3J7YW 3VYRA 1X55A 3X3NA 3OTOL 3K7AH 3KF8A 1X65A 3SXHA 1EL0A 5IGEA 2F4VQ 5IT9L 3I4NH 4NPSA 1LYLA 2QF7A 4DV7L 1I4GA 2EJFC 4U68A 1ICWA 4A3IB 4OX9Q 2KHIA 3TEHB 4NXML 1E24A 4IUQA 2VXWA 4L63B 3HKSA 1GHKA 4CBVA 1Q12A 2QA4A 5KEEA 4PQXA 1ICFB 4JI7L 4DNIA 4QIWB 1HNXL 1KL9A 1OXTA 2PPBC 4M8AA 1FGUA 2LSSA 4A3MB 1C4QA 1BCPD 3OSOA 4HIOA 4QQBX 1PYBA 3QJYA 1UAPA 2WIIB 4LF8Q 3OPOA 2HT1A 1PFBA 4GKJQ 3QWNA 1BQQT 3C1FA 3H09A 2F0EA 2F0JA 3F2DA 2E8GA 1A62A 1YBYA 3ITPA 4JC0A 1R9TH 1NJIC 3MAQA 5C6AA 5I4DA 1PDQA 1VQHA 4OONA 4JI6Q 5BN3A 4A3MH 4LNQA 1S40A 3HOZB 1H9JA 2D2CC 4DR6L 1TY2A 4DGZA 3TS0A 2IWHA 3NP8A 2VUMG 4EVOA 1K8GA 1STBA 1JCKB 1NTGA 2JQOA 4L5TA 3DEOA 4AQYQ 3MXUA 4B9WA 5M9OA 3MFGA 4YCVA 1B3AA 5EBDA 1Q81C 4LUOA 2K75A 4JI1Q 3BYYB 1Y1VG 1XPUA 1F9PA 1VQKA 5EBCA 4NB3A 2EYLA 5C44B 3DXJC 5FLMG 1Q8IA 3NUCA 1K9MC 2HUGA 1EFWA 1B53A 3KLWA 4CDCC 4M1UB 2R92B 1C7YA 3WWVA 2O5IC 4K8IA 1WTWA 1KD1C 1B8AA 3GTMH 2JN4A 2EXDA 4DUZQ 2BCOA 3J81c 1QE6A 1UWVA 1BKBA 2X6LA 4H0LC 2D0OA 3S14B 4AIMA 4CKBA 2CWPA 4RKBA 2NVYB 4K6DA 3S17B 4KY5A 2OWOA 5CC4A 2B8FA 1F2MA 1BOSA 3I4MB 5C44H 4RFBA 2ZXOA 2PZTA 1K3BC 1G6PA 2R92H 2ZJQA 2A74C 2LMCB 3M3YB 2CW0C 4YWMA 2DJFC 4Z9CB 2AKWB 4LWCA 1JJCB 4B3ML 3I70A 2WB1G 4BXXH 4XT3B 4N8FA 1BVSA 4C56C 5IYDG 2ES2A 1YNJC 2K33A 4LFBL 2VB2X 4FO2A 4K5XA 2JA6G 1PTOH 4YHHQ 4IFDG 3Q8DA 1VQDA 1SE4A 3HOUG 1SEBD 4AYBG 3IRBA 5ELOA 4DK0A 1AP0A 4QUFA 1ENFA 2FMCA 3OIPA 2AQ1B 4HCEA 1RF2D 4HJ9A 5KNDA 2WP8J 2WFWA 5FK9C 2ZJPA 3D4RA 2WV6D 1GOZA 2ZTEA 4DV1Q 1UE1A 3KF6A 2NUCA 1A2UA 5M3FB 4DR5Q 4TRDA 3VA5A 2HHHL 3BU2A 3A55A 2IJ0A 1N34L 4BY1H 1GUWA 2CQOA 1Y1WG 1JOOA 1T9HA 4DAYA 1VQCA 1WFQA 4IUPA 3HOYH 1H9SB 1JICA 3D4WA 5D14A 1WJJA 3NELA 3G6JB 4DUYL 1VQ4A 2SNMA 1SE8A 1HA6A 3I7FA 2QKIC 4UHVA 5C0XI 5TSSA 5KNBA 2NN6H 5M3FH 5M5XB 3J7AF 5CV4A 2C35B 3H15A 1Q1EA 2NBFA 1UNSA 3URYA 4EQNA 2R93G 1G2TA 4R8IA 2JA5B 3VR6A 5JOBA 2K01A 2N8NA 4HIKA 1L1OA 3NK9A 1ENCA 1JJGA 4IPCA 3RD4A 2K04A 1TS4A 3ZYYX 1B2TA 1L0WA 3HGBA 1YJWA 1BDOA 3OYYA 3K6OA 1ILPA 1EQTA 1RDPD 4YY3L 3A8JE 2KCCA 5E3FA 5JJIA 2B63G 1RTOA 2AHOB 3OWEB 4POGA 1K3RA 3CC7A 4R8NA 5ELBA 4A3BG 2CW0D 3ND8A 2JA5H 2B2VC 4FF2A 4OO1G 3CPFA 2PCFB 2NZ1D 2MO0A 2UXCQ 4B3SQ 4JBMA 1N33L 1YNJD 2NB0A 1DJRD 5C3XA 1E2WA 3S24A 3J80E 1GJXA 5T1GA 2KEEA 2EY6A 1IBLQ 1HNZQ 3HG9A 4JYAL 1CUKA 4HSVA 3NBIA 3OW2A 1VQJA 2EPBA 2ZM6L 5GAEC 2K14A 5DLQE 1AH9A 4LF7L 3A8IE 2XNAC 5I6WA 1VQ6A 1U0LA 2OT2A 3G48A 2IHFA 3DHQA 3HKZE 2FXQA 3MEHA 1QUQB 2F0KA 4XXEA 5M5YH 4NXNL 1XMOQ 2AWNA 4ZUJA 4KV6A 5IIFA 1D6EC 1YEZA 2RSOA 3S1NB 4V190 4JBJA 4RGMA 5HGQA 4OWXB 4JV5L 3PO3G 1G291 4ILWA 1NAPA 3T1YL 1EZ8A 5FJ8G 1PTOC 1XJVA 2MO1A 4JCVE 2LKVA 3A0JA 1CQVA 4OWTB 1LTGD 1ET9A 5C3WA 4J15A 1FD7D 4CKCA 2YTVA 3VYTA 4BBSH 4R1JA 5I2XA 1VQLA 4DV0L 3CAMA 2KBNA 3FHWA 1U5KA 4JI5L 3I4OA 2UUCL 3W1GA 3S1NH 1PTOF 4LFAL 1RKNA 4XQQA 3ONAB 5IGBA 3BDLA 5IP7G 1EU3A 3PIP3 3HOXH 3CMEA 2C9OA 2E75C 3AMUA 5I6YA 1IL8A 1K83H 1KC8C 1VQAA 2O4XA 2DNCA 4S3SA 5BN5A 1FVIA 3K57A 2AMCB 4DAMA 1X54A 2IT1A 4QL5A 1KDAA 1PH3A 1E2ZA 1EWHA 4KD3A 2XTIA 3SK8A 4GS3A 2B2UC 3SVMA 5M5WB 3E0JA 5E4XA 3T1HQ 2JA7B 2EZVA 5EPLA 3EBEA 3FKIG 1D1IA 2I46A 3K5OA 4BBRB 4YCWA 4O1NA 1F2LA 1PMRA 4PZ6A 4PG3A 5ELEA 1HTLD 4LF6L 4ZQ3A 1YI2A 1O7YA 1SYGA 2X6GA 4I7AA 3H3VI 1YHQA 2OXPA 1A0IA 4OX9L 5JVG3 3J81i 1PRTB 2K6AA 2RDGA 4KJNA 5C0XG 2NVXB 5K36G 2X69A 5K5PA 2KJXA 4XT1B 2DUDA 4ABNA 3S1MB 4BBRH 3EVQA 4DR3Q 1C9OA 3CD6A 5JPNC 4BS9A 4X6AH 4DA2A 4JI3Q 1GUGA 4JI8Q 1EFID 4L5SA 1GUSA 3KOJA 3RN2A 1VQMA 4B3RQ 3SK6A 4O2DA 1S5DD 1B9MA 1KHIA 4BY7B 3CC4A 1S5ED 5CBEE 4GKKQ 3PIO3 5J1ZA 3BZKA 4HJ7A 3BG3A 5J22A 4LF8L 2QILA 1U4MA 5IYCG 3M4QA 3NPPA 3S1MH 4KLKA 2Y0SG 2KENA 4HN7A 4N9TA 3CHBD 1SMXA 2PQEA 1MBYA 3Q23A 1DCZA 1JORA 2F0TA 4JI6L 2A6EC 3L7ZC 2LXKA 2GA4B 1RHPA 4OEMB 3STBC 2Q8RE 4BY7H 2EOTA 2WAQB 1DZ1A 1SNCA 4DFAA 3S15H 2FINB 5D3DA 1DONA 1YVCA 1G6ZA 4C1NI 3PO2H 1X3QA 4E6IA 3BYTB 4A3CG 1YJNA 2Z9HA 2NVQB 5C4HA 1N34Q 4AQYL 1TR5A 1SLJA 1H9RA 3X3MA 2H5XA 1GUTA 3U50C 2F0SA 1PV4A 1EY0A 1Y8NB 3AQQA 1P8LA 4JI1L 1CQFA 3CCUA 1PH8A 1JJ2A 2B2WA 4RHRA 4RHSA 2BE5C 1SE3A 2E74C 4F7XA 2NYZD 2N78A 2BDOA 5CV7A 1IHZA 1S4ZA 3MXGA 1K28A 4HR7B 4C2MB 1WCMB 4H7BA 1D5MC 5JVH3 3HEJA 3A7LA 5JJLA 1ZEQX 4L6TB 3J7A5 1JT8A 1PH9A 4HTHA 4DUZL 1WD1A 4JK1C 1TY0A 2JA8B 1C48A 2F0UA 5LMUQ 1HTPA 4A3GB 3HOVG 3FPUB 2EDGA 4FDBA 2RDHA 4B08A 4X66Q 2QEXA 1STEA 3GTLB 2CQAA 1EIYB 1SNOA 1SXTA 1NCVA 3Q6SA 2K5WA 1YNNC 2K28A 3CP0A 2E2DC 1V1PB 2E5LL 3D6WA 1S5CD 1DOLA 5I9OA 2R6GA 2B2UA 5GAHC 1I50B 1BUVT 2A6HC 2MQHA 5EGTA 1X6OA 1L1OB 1I6VC 1KIXA 3PIOA 1EU4A 4YHHL 1NE3A 1H9SA 3RNUA 4FYDA 4X3KA 3I55A 5DEHA 4HCSA 5KRUA 1PLFA 1ZXTA 2VUMB 2A6ED 1KRTA 1VQ7A 5HURA 4DV1L 3ULLA 2R3ZA 2I0QA 2J4XA 1I50H 1B9NA 4LAAA 4DR5L 1XYIA 4A3KG 3JAMc 2Z6KA 1S5FD 4QY7A 2Q2TA 1I4RA 4GLAC 1TWAB 1RODA 4NXNQ 1NUCA 3QOLA 1KNEA 1PRTC 2EIFA 1TWGB 3S1QB 2JSOA 2KHJA 4AH6A 2VUMH 2YU9B 3VR4A 3SR1A 4RAUC 4XYOA 3J81j 2BE5D 1VMCA 2KVMA 5C3EG 3S2HB 3IKJA 4XYQA 1G91A 1FJGQ 3HOWG 4JI0Q 2DNEA 4OGQC 5GADC 1RD9D 3T56B 1AFPA 3PUZA 2SDFA 5CYUA 1Y1VH 4G7OC 1PRTF 3E5SA 1STHA 4C3IG 1TWFB 5E7NA 1OTCA 3SDZA 4MNOA 1EIGA 2OCEA 1EYDA 1TWGH 3S1QH 2L1BA 2XN9C 2UUCQ 1B7YB 1LT4D 5IT9E 4CDEC 2AUKA 4OHJA 1PH7A 1EY6A 1W3SA 2RDFA 4C1NK 1EQQA 3K7AB 4R4TA 1YNND 3PUYA 2NZHA 4PMBA 1VQ5A 2JA6B 5FO8B 5FOBB 2Z4HA 1TWFH 1HJPA 2A6HD 2RA4A 1LUZA 3R3OA 1NR2A 2UXCL 3I90A 4B3SL 3ND9A 1K8OA 1QUQA 2OTJA 3SE0A 1IW7D 2UUAQ 5HGTA 2EJMA 1A2TA 5JJZA 2V4DA 3FRPB 1IBMQ 4YIJA 3MXNA 1IBLL 1HNZL 5IYDH 4LF6Q 3T13A 1Y1WB 4TQUS 5KYLA 2JA6H 4IFDH 2PMZE 3HOUH 5JAVA 2Q2UA 1V43A 1KAAA 4IUTA 1STYA 1SNMA 1CI3M 1FNVA 1X3FA 2SNSA 4IFDJ 4LW1A 1EY8A 4K0KQ 1CKOA 4DKAC 2ZXRA 1XMOL 2I07B 4CJ2C 2NTTA 4FNFA 1OXVA 3RN5A 1R9TB 4JBWA 1XMQQ 4IPDA 2UXBQ 1WYDA 1Y1WH 2J0TD 2HIVA 4H13C 4UY8C 1H9MA 2L4NA 1X3PA 4A3FB 3C46A 1XNRQ 2LY7A 1XTDA 1PH5A 2F0MA 1SSOA 3F8TA 1UUPA 3KBXA 3EQLC 2E2IB 1CZGA 1RCVD 1TT2A 1P16A 5AJ3Q 1JOQA 3K7UC 1SYFA 3L2PA 3G7LA 4F8MA 5EJWA 1BR9A 4HIMA 3FMCA 3GP7A 3PF4A 1L1OC 3RZOH 5IY0A 1ML0D 1A63A 4ZKCB 1YHBA 4G4KA 1Z9FA 2KEDA 1FYCA 1LT3D 3QOJA 4A3FH 4OO1I 2WB1E 5G3LF 4C3JG 3OOCA 2CWAA 2B2YA 4NDXA 1BBXC 2JYOA 3GTMB 2YTXA 2E2IH 3NTKA 4IPGA 4O42A 1QNKA 5JPMC 1GVPA 3T1HL 1EYAA 3K0XA 4AYBE 2B63H 1EYCA 2XIWA 5CV9A 3MC0B 1SBBB 4H02A 1F9QA 2MUYA 4LFCQ 1G2SA 4A3BH 1N8RC 5FLXL 4IJHA 1Q90A 1BO0A 1ET6A 1UE5A 3HFZB 1PH6A 4IPHA 2R61A 1EQRA 1PH2A 4DAVA 1WTVA 2YV5A 2VS1A 1D8LA 4F87A 5C4JH 3ULPA 2O2LD 4DR3L 1PTOB 4K2KA 5A2QL 4FXGC 2QDBA 3S2DB 4JI3L 4JI8L 3VA7A 4IUVA 1CTMA 3GV6A 3RZDB 4B3RL 1O78A 2E5LQ 4K8JA 3VDYA 1A8VA 4PMCA 3TP8A 1VQBA 4GKKL 2N88A 2R7DA 1E7ZA 4A3EG 1J5EQ 4RH6A 2L12A 4UAIA 4BY1B 3PO3H 3D3RA 5EQ0A 4IURA 3HOYB 3S2DH 2IL8A 3DEPA 2RBMA 3RZDH 1TVXA 3A8KE 3N6RA 4MTNA 2D9UA 4GOPB 2VB3X 4IALA 1I3QB 1IYVA 1DYQA 2N55A 1LM0A 4LMQD 3KYHC 3HKZB 3MTSA 5IGFA 2M00A 2K5QA 3I4NG 4IQZA 1J9OA 2KA7A 2K4KA 5IP7H 1CHQD 4WJWA 3Q22A 3J80c 3MWYW 4GZYC 1XX8A 1IBKQ 2MJ8A 2DY7A 4DK3C 1B4OA 2PW5A 3TDQA 1MSGA 2FHTA 5H1SE 5IGGA 2I5LX 4L5QA 1I3QH 1Q7YC 2HCIA 2PO4A 1V1PA 1VQPA 3NTHA 5CV6A 2EY2A 3FKIH 1SYEA 3VR3A 2RKSA 1QG7A 4OWWB 1PFSA 1QILA 5LMUL 4A3IG 3P20A 2N3SA 1Z7TA 2EYHA 4X66L 1JR0D 1YJ9A 1N36Q 3P7JA 4J1MA 4KKUA 5C0XH 2CCZA 1BNZA 4JI4Q 5K36H 1JWUD 4LF4Q 3RR5A 2F52A 5J3BA 2RCNA 1CFMA 3GD7A 5C0XJ 1U9RA 3F2BA 4A3MG 3I72A 4HMIA 4F88A 1ENAA 2F0HA 2ICIA 3KBGA 2N49A 3NBHB 1B1ZA 2JK8A 4HSPA 1D2BA 2R7ZG 1SMYC 1VMPA 2F0VA 2Z4IA 2SOBA 4XQJA 3J81L 2K05A 5LHY1 5M5YB 3HZXA 3R8BA 4DR4Q 1HFNA 3D8GA 3E0EA 4L5RC 4WJ3M 2AQ3B 3PUWA 1SYCA 5IYCH 3EJIA 3GTJH 5GQOA 2H4OA 1CK1A 4FVMA 3HOZG 3M4YA 2K5HA 2NVTH 1LT6D 2XRQD 1V9PA 2ALYB 1UEAB 3EROA 2PZWA 4BBSB 3TZDA 2UUBQ 3FDTA 1RTNA 4X62Q 1STAA 3CCJA 4NW2A 3V05A 1LTRD 1A15A 4A3CH 5C4XG 3MXNB 1I94Q 5GAGC 3HOXB 1ZYRC 4FXKC 5CBAE 3NWTA 5C44G 1JOKA 1K83B 2B2WC 4MHEA 1FJGL 3HOVB 3M85A 4JI0L 1LTAD 5IGDA 2VL6A 2R92G 4A4IA 3UDFA 1EEID 1WVLA 2UXDQ 2AWOA 3K80C 2VQFL 3L9AX 2ZTDA 4BXXG 1G51A 4YCUA 4J6HA 1E3PA 1VQNA 3WOFA 4LUVA 3N52A 4DV4Q 2CKZB 1WTXA 1DOMA 5E4WC 1AZQA 4ME5A 5EKIA 4J8QA 1VQ9A 1XWEA 2JE6I 3U58A 1FGBD 4P74A 2A73B 3HP3A 3I4MG 5CV5A 1Y8PB 2F0WA 2HD3A 3HOVH 2I5HA 2PI2E 4DNTB 3GTKB 2G5DA 2K52A 4JW0A 1JMCA 1W6JA 4GOPC 2BA1A 5IODA 1OXSC 4PZ7A 1T5EA 2Y0SE 3W5OA 4FF1A 1CKNB 4IZ8A 4QMGA 4XTCS 1IZ6A 4A3JB 1T5XD 2UUAL 3CXCA 1D5ZC 1CA5A 1QVGA 3DLLA 2EE1A 1IBML 1SYDA 1VQ8A 4CGYB 5LMNQ 3K5LA 4HAEA 1M1KC 5ISRA 5I9PA 3GTKH 2DN8A 2JXMB 1TU2B 4DXFA 4KMUC 2B2TA 2HQEA 3KFUA 2A5HA 3K0YA 4TVAB 5NUCA 4KJOA 3EA6A 5M3FG 1I6HH 1I4XA 4K0KL 3RUZA 4A3JH 2L5TA 2EYJA 4OIJA 1STGA 3OW7A 2Z6KC 2H1EA 2F0FA 4R4QA 4QCLA 4HMJA 1RIPA 2A68C 1XMQL 2UXBL 3K58A 5DM73 4NMZA 3BZDB 3H3VH 2D62A 1KLGD 1PFMA 4I7ZC 4R4OA 2PNRC 3DMUA 1VS0A 1I4HA 1ZYRD 5C4ZA 3S15B 1XNRL 1PTOD 4CJ1B 5IGCA 3PO2B 1IXRA 5IYBG 2YTYA 2ICEC 4QJFA 4GNXA 2JA5G 5C5LA 4EQ5A 4A3DG 5C3EH 5AJ3L 1KDBA 3TN2A 1IYUA 3HOWH 3NE5B 2F0IA 4KHPQ 4FF3A 3GTOB 1X56A 3M4PA 2JEAI 2D5DA 5M3MB 2VW9A 3MVVA 5CORA 3S16B 1X3EA 1EOTA 2F3IA 4R4IA 3IL8A 3S9WA 3DWAA 5LL6X 1MGSA 1JC7A 4K6LA 3PIPA 2XVSA 2F3WA 3OIQA 2OQ0A 2E2HH 5HY6A 1HRJA 3J80i 3DM1A 4RMFA 4BA1I 5A35A 4LFCL 3GTOH 1Q82C 5M3MH 1GUNA 3AYHB 2CH4A 1C8CA 3S16H 1PHJA 2F0NA 1TS3A 4QUCA 1D7QA 2ENBA 3TQYA 3PMFA 1OXXK 4A3LH 3KLSX 4NP5A 4UP8A 2F0OA 1AZPA 1PVOA 3K81C 4ALPA 4Y52H 2UU9Q 2C5CA 1IL2A 3W2DA 5D3IB 3G4SA 1MHWC 1OO9B 1LTSD 3W1BA 2K32A 4DV5L 4K14A 4DNRB 3K59A 2DJGC 3CCRA 2K1BA 3I56A 2F0GA 3H6MA 2V1CC 3CRLC 1G8ZD 1PYSB 2RHQB 3QB3A 1TKWB 1Z47A 1EWIA 4ZLTF 4GOPA 1D1KA 1S72A 1DM0B 1SN8A 1VQFA 3H91A 4DR7Q 3DUZA 1J5EL 1QVCA 5EPKA 2XWJB 1NSNS 1SNPA 4FF4A 5IT9c 1ONLA 1CM9A 2VQEQ 2K5DA 1XTCD 3R2TA 4MTKA 4C3JB 3QO2A 3F2CA 5DNFA 1PZID 4O0AA 2NWGA 1F9SA 2PMZB 3GTQB 3TS2A 1DD2A 1QWYA 3STBD 4XQNA 3U9SA 3NXWA 1X3GA 3MEFA 4ME3A 1GO3E 3F1ZA 1AE2A 4DV3Q 4G7HC 1Y1VB 4WJ4A 4JVZA 3KDFA 4G7ZC 3H3VC 3DM3A 3MZ5A 2B2YC 3M4OH 3A74A 3I73A 1IBKL 2JA7G 2AUJD 4C3JH 1DOKA 4KK7A 3S1RH 1R4PB 4DPGA 3QIAA 2K7VA 1FNUA 3NENA 3GTQH 3F2UA 1NMGA 2BDNA 5C5MA 2IHEA 4JI2L 2KQ3A 2E76C 3SGIA 1ESFA 1HCZA 5JJKA 2BH8A 2ZJRA 1RL2A 1EZ6A 2B39A 5FO7B 1HZCA 5BR8Q 2VQFQ 3NBHA 5FLMH 1M90C 3BJUA 1WI5A 1AN8A 3I4LA 1EY7A 2K5NA 3UDGA 1N36L 3O13A 1TQOA 1LTID 2Z1CA 4EGVA 1MJEA 4LF9Q 5T1IA 5DAUA 4A93G 3CMAA 4DU9A 2EYFA 2WB1B 4JI4L 4P75A 3TREA 4LF4L 1WTOA 1II3A 4ZUIA 1Y69U 3CCVA 2M2LA 3HOUB 3CRKC 4AYBB 2YYZA 3MHBA 4APVA 2JEBI 1DXMA 4OIKA 2QEJC 2EJGC 1BCPF 4BA2I 2WACA 1MIUA 1VF5C 4RA8A 4RGOS 2PQAA 1JWSD 1KXLA 2KHSA 4DR4L 3OMGA 1SDFA 2FJ2A 4L8JA 3PQIA 1KQSA 1Z6HA 4KY7A 1WOCA 1YITA 3HRZC 5IP9G 3FPPA 1TS5A 3TBIB 3U9OA 1A3TA 5F2DA 3RLNA 1QCBD 4DV6Q 5D65A 1GXDC 2MNAA 4RGNA 3FVQA 3UDIA 2Q2HA 3MXPA 4R4CA 5KNCA 2UUBL 3CKIB 2HIXA 4G57A 4X62L 3TP5A 4KKTA 1QZHA 1FNWA 1GUOA 3M7NA 3PUXA 4JPBW 2HCCA 4IO9A 4KKSA 2E2JH 1I94L 1J8IA 2R93B 1PRTD 3RZOB 2NTSA 3GQBA 3H94A 2MGSA 2DY8A 3CQZB 4IOAA 3QR8A 3LWEA 1WCMG 3NWSA 1BXTA 1YZ6A 3E9HA 2UXDL 1K73C 1V8QA 3I8ZA 2CFMA 4B3TL 3K5MA 1WTRA 3JAML 2F4IA 4KY6A 2JA8G 2GVBA 2BOSA 1CKNA 5FLXE 2B63B 4A3GG 4DV4L 1XNQQ 1K8AC 3H0GG 2FMMA 1KAWA 1VQGA 2VNUD 2R93H 1KRSA 2RHSB 4A3BB 1SJED 4MZ9A 3NTIA 3T16A 2KCNA 4A3IH 5JEAG 3CQZH 1Q1BA 2CVRA 1QOHA 4P71A 5L37A 2R7ZB 1MD2D 3R2IA 5IWAQ 4MN3A 1LLRD 4C3HG 3KJOA 3FP9A 3PCOB 2P5ZX 4YWLA 2RSNA 1TWHB 4GN3B 1EY9A 2KCMA 2TSSA 4JOIC 4GNXB 1WD0A 3C2PA 3A56A 4ZK9B 5J39A 5A2QE 2EQSA 3LWUA 5DM63 3SHLA 3A5UA 4JBKA 1ZKOA 4X64Q 5C4JB 1W2BA 2B3GA 4Q0FA 2MFIA 1FL0A 5LMNL 4K2LA 1LACA 3LX0A 1E1TA 1EY4A 2WINB 2R7ZH 4OO1H 1TIID 2PYKA 1PYWD 4NKLA 1SFOB 2I5MX 3D0FA 1ASYA 3K8AA 4UDUC 2KUMA 2GVAA 1NBWA 1TWHH 4TSSA 4P2CB 5C4XB 2VY3A 4OXPA 4DV5Q 4LF5Q 2QGQA 1Q46A 3CF5A 3PO3B 2DGYA 1U4PA 3HOZH 2VZAA 1HR0Q 1SJHD 4RGTA 1LV9A 3GTGB 1N9WA 3J7ZC 2MHVA 2EYOA 3ERQA 1SFOH 4Q5VA 4X65Q 4QB4A 1NR4A 1F2YA 3CU7A 1HNWQ 2XWBB 3MFYA 4DV2Q 3IAYA 5C4XH 3EIVA 1PH4A 4X3UA 3BDOA 5FJ8H 4GN5A 4RCNA 1JE4A 3RLOA 2PZUA 5G3LD 1ASZA 4HJ8A 4QIWE 3GTGH 4KHPL 1N32Q 5EAYA 5LMNW 3PF5A 3G6EA 5LL6S 3UE1A 3S14H 3FKIB 3JAMi 5BN4A 2Q8TA 2NVYH 3S17H 4DR2L 4UPAA 1B44D 4EQPA 1HH2P 1HQMC 1FR3A 1X32A 1EEFD 1PZKD 3LNNA 3I4MH 2F03A 3KJPA 1VQEA 1E2VA 1E22A 2MPMA 4A76A 2M9VA 1Q86C 3T53B 5CMDA 3M3YH 2ASBA 5IE8A 1A3UA 2F3VA 5ELDA 1UE6A 2EXZA 1U4LA 1MSHA 4N9PA 3VYUA 4ZKBB 3G71A 2NN6I 4JI2Q 3NQTA 1Q3LA 4KHVA 1SR3A 2ZT9C 3J81E 2UU9L 1EIHA 4UP7A 4CKEA 3KDFB 1PXUA 1SNDA 3ER0A 1TXYA 4OL7A 2B2TC 2B8GA 2K50A 4K5WA 3AEVA 4CJ0B 3ERSX 4DR1Q 4GN4B 3UDXA 1QB5D 1JB3A 2A19A 1IKMA 1HZBA 5ELNA 4CDFC 4IOCA 1EWCA 3TRZA 2ZXPA 3NSWA 2MP1A 4JOIA 3OMCA 3GTJB 4A3DB 1OXUA 2Y0SB 4DR7L 1BBWA 1Q8KA 4WRDA 4BWGB 4A3FG 2Z6BA 3NQIA 2NVTB 1K0SA 1QJOA 1V1OA 4IUNA 3CCSA 2J7ZA 5EPJA 2WKCA 1SYBA 2G9HD 2PW7A 2KECA 5CR3A 1SNQA 4KHZA 2VQEL 1Y14B 3DWPA 2AQ2B 2Q8IB 1SROA 5M5XH 3JC66 4IUUA 2L55A 4GNXC 1J6QA 5IYBH 2B29A 3D4DA 5E1FA 1AE3A 3A54A 4A3DH 2A8VA 3I3CA 4TKOB 1GHJA 2BA0A 4DV3L 4LK1C 1VQIA 2PQAB 3BVMA 1V1QA 3OTOQ 2F0QA 1LO5D 1HXYD 2XSCA 2ZTCA 3V2TA 5EKKA 4DV7Q 2OF1A 1SE2A 2Z8LA 4NXMQ 3BVZA 2SEBD 1KDCA 4B3TQ 1HFGA 2TMPA 2JP1A 2K5VA 5BR8L 1XPRA 1KTKA 3GDEA 1HZAA 4JI7Q
chains in the Genus database with same CATH topology
3RLFA 1F9RA 3J80L 2EYMA 2CHBD 3MA2B 3D6CA 4K5VA 3Q0AA 1L0XB 3IFDA 5IOCA 2RVLA 3BVGA 1D5XC 1I6HB 3PV0A 2F0DA 1CHPD 4X3TA 4ID6A 4DK1A 3SEBA 4KTAA 1SMYD 4B9XA 3KK7A 3QG1A 4A3KB 4ZYSA 3W3AA 1LT5D 1STNA 3HS0C 4PNYA 3M7GA 3TSSA 4RWSC 1ESRA 1O7LA 3VR2A 3PUVA 2IX0A 2NN6G 3SK4A 4Y7NB 5COYA 5ELFA 1IKLA 3L3OC 4KI0A 3K5NA 5C3EB 3TP7A 1B50A 3HOWB 4PV1C 4H44C 1CT1D 3VR5A 4I65A 1VCIA 3C3LA 1HHVA 4C3IB 4MIUA 2G9DA 3GV3A 3T4AC 2HDLA 3I91A 3R93A 1PZJD 1JWMD 4KD4A 3P75A 4A93B 1BCPB 5KGUA 2E2HB 3TMEA 4KN7C 1KABA 4ZRZA 2B2VA 3GTPB 2XRSD 1AEXA 2IX1A 2WKDA 4DN4M 3E6ZX 3P1HA 3V96A 4R9WA 3J7AV 1LTBD 2IX3A 2LS01 5KIXA 2LFNA 4IN3A 4PMWA 1Y8OB 2K03A 3RMHA 1LABA 1U4RA 4WORA 2L9HA 1EY5A 1PFNA 1JQYD 1S5BD 3GO5A 2KOLA 2O5JC 3BDCA 3A7AB 5FKAC 1SAPA 1CA6A 5FO9B 2EYPA 4ZAIA 1LTTD 1F2ZA 2A69C 4KN4C 3SK5A 3AB9A 3C1EA 2A68D 3BS1A 1TS2A 1WTQA 3H0GB 5CV8A 3D31A 4ODGA 3IFTA 1W6KA 3M4OB 1I4QA 4FXDA 1QNUA 3S1RB 4C3HB 1HA5A 1K8MA 3WDNA 2EY1A 5ELCA 1H9KA 4WFN3 3KLRA 3VYSA 4RKLA 1IW7C 2QCPX 5I2YA 3KUPA 1ILQA 4FP5D 3EFXD 3TZUA 1TWCB 2OEOA 2F0LA 5JEAH 1AW7A 1BF4A 3WOEA 5JEAJ 2EY5A 1HUNA 1VF7A 3OHXC 4X3SA 1L0YB 4XIGS 2L0CA 2IPKD 1A3VA 1MI2A 1XXGA 1M4VA 1I4PA 3DWQA 2ID0A 4EQOA 3OWFA 1HPCA 1BCPC 2A69D 2IW3A 4A3EB 1HQRD 1RJTA 3FEWX 1CZWA 3KLSA 1F77A 2FFKB 4CHTB 4DXGA 5KYIA 2HDMA 4QF4A 1M8AA 1O80A 1E0BA 3NHHA 4HEDA 1HUMA 1KNAA 4XDXA 2RQXA 1KLUD 2EVBA 1WTPA 4DF7A 4DAPA 3I4NB 2E2JB 1R4QB 5EKLA 5AFWA 2F1MA 3TP6A 4IFDI 4V0BA 3AU7A 3Q24A 1O7ZA 3UI2A 4ULLA 4U673 3JAME 5CGKA 4LJZC 4RCOA 1EQVA 3T51B 1VDZA 1A6XA 2F0PA 2L11A 3J7YW 3VYRA 3X3NA 3KF8A 3SXHA 1EL0A 5IGEA 5IT9L 2QF7A 1I4GA 2EJFC 4U68A 1ICWA 4A3IB 4IUQA 2VXWA 4L63B 1GHKA 4CBVA 1Q12A 5KEEA 4PQXA 4QIWB 1OXTA 2PPBC 4M8AA 4A3MB 1C4QA 1BCPD 3OSOA 3QJYA 1UAPA 2WIIB 3OPOA 1PFBA 3QWNA 1BQQT 3C1FA 3H09A 2F0EA 2F0JA 3ITPA 3MAQA 5C6AA 5I4DA 1PDQA 5BN3A 3HOZB 1H9JA 2D2CC 1TY2A 4DGZA 2IWHA 3NP8A 4EVOA 1STBA 1JCKB 3DEOA 3MXUA 4B9WA 5M9OA 3MFGA 1B3AA 5EBDA 3BYYB 1F9PA 5EBCA 2EYLA 5C44B 3DXJC 1Q8IA 3NUCA 2HUGA 1B53A 2R92B 4M1UB 2O5IC 4K8IA 1WTWA 2BCOA 1QE6A 2X6LA 4H0LC 3S14B 4CKBA 4RKBA 2NVYB 4K6DA 3S17B 4KY5A 5CC4A 2B8FA 1F2MA 1BOSA 3I4MB 4RFBA 2ZXOA 2PZTA 2A74C 2LMCB 3M3YB 2CW0C 4Z9CB 3I70A 4XT3B 4C56C 1YNJC 2K33A 2VB2X 4FO2A 4K5XA 1PTOH 4IFDG 1SE4A 1SEBD 4DK0A 1AP0A 4QUFA 1ENFA 2FMCA 3OIPA 2AQ1B 4HCEA 1RF2D 5KNDA 2WP8J 5FK9C 3D4RA 2WV6D 1GOZA 2NUCA 1A2UA 5M3FB 4TRDA 3VA5A 3A55A 2IJ0A 1GUWA 1JOOA 4DAYA 4IUPA 1H9SB 1JICA 3D4WA 5D14A 3G6JB 2SNMA 1HA6A 2QKIC 5C0XI 5TSSA 5KNBA 2NN6H 5M5XB 3J7AF 5CV4A 1Q1EA 2NBFA 1UNSA 3URYA 4EQNA 1G2TA 4R8IA 2JA5B 3VR6A 5JOBA 2K01A 3NK9A 1ENCA 3RD4A 2K04A 1TS4A 3ZYYX 1B2TA 3HGBA 1BDOA 3K6OA 1ILPA 1EQTA 1RDPD 3A8JE 2KCCA 5E3FA 1RTOA 3OWEB 4R8NA 5ELBA 2CW0D 3ND8A 2B2VC 4FF2A 4OO1G 2PCFB 2NZ1D 1YNJD 2NB0A 1DJRD 5C3XA 1E2WA 3J80E 1GJXA 5T1GA 2KEEA 2EY6A 3HG9A 4HSVA 3NBIA 2EPBA 3A8IE 2XNAC 5I6WA 2OT2A 3DHQA 3MEHA 2F0KA 4XXEA 2AWNA 4ZUJA 4KV6A 5IIFA 1D6EC 2RSOA 3S1NB 4V190 4RGMA 1G291 4ILWA 1NAPA 1EZ8A 1PTOC 2LKVA 1CQVA 1LTGD 1ET9A 5C3WA 1FD7D 4CKCA 3VYTA 5I2XA 1PTOF 1RKNA 4XQQA 3ONAB 5IGBA 3BDLA 1EU3A 3PIP3 2C9OA 2E75C 3AMUA 5I6YA 1IL8A 2O4XA 2DNCA 4S3SA 5BN5A 3K57A 2IT1A 1KDAA 1E2ZA 1EWHA 4KD3A 3SK8A 2B2UC 3SVMA 5M5WB 3E0JA 5E4XA 2JA7B 2EZVA 5EPLA 1D1IA 2I46A 3K5OA 4BBRB 4O1NA 1F2LA 1PMRA 5ELEA 1HTLD 4ZQ3A 1O7YA 1SYGA 2X6GA 2OXPA 5JVG3 1PRTB 2K6AA 2RDGA 4KJNA 5C0XG 2NVXB 5K36G 2X69A 5K5PA 2KJXA 4XT1B 4ABNA 3S1MB 3EVQA 5JPNC 4BS9A 4DA2A 1GUGA 1EFID 1GUSA 3SK6A 1S5DD 1B9MA 4BY7B 1S5ED 5CBEE 3PIO3 5J1ZA 3BG3A 5J22A 2QILA 1U4MA 3NPPA 4HN7A 4N9TA 3CHBD 2PQEA 1MBYA 3Q23A 1DCZA 1JORA 2F0TA 2A6EC 3L7ZC 2GA4B 1RHPA 2Q8RE 2EOTA 2WAQB 1DZ1A 1SNCA 4DFAA 2FINB 5D3DA 1DONA 1G6ZA 4C1NI 1X3QA 4E6IA 3BYTB 2NVQB 5C4HA 1TR5A 1H9RA 3X3MA 1GUTA 2F0SA 1EY0A 1Y8NB 1CQFA 2B2WA 4RHRA 4RHSA 2BE5C 1SE3A 2E74C 4F7XA 2NYZD 2BDOA 5CV7A 1IHZA 1S4ZA 3MXGA 4C2MB 4HR7B 1WCMB 4H7BA 1D5MC 5JVH3 3HEJA 3A7LA 1ZEQX 4L6TB 4HTHA 1WD1A 4JK1C 1TY0A 2JA8B 1C48A 2F0UA 1HTPA 4A3GB 3FPUB 2EDGA 2RDHA 4B08A 1STEA 3GTLB 2CQAA 1SNOA 1SXTA 1NCVA 3Q6SA 2K5WA 1YNNC 2K28A 2E2DC 1V1PB 3D6WA 1S5CD 1DOLA 5I9OA 2R6GA 2B2UA 1I50B 1BUVT 2A6HC 5EGTA 1I6VC 1EU4A 1H9SA 4FYDA 4X3KA 5DEHA 4HCSA 5KRUA 1PLFA 1ZXTA 2VUMB 2A6ED 5HURA 2R3ZA 2J4XA 1B9NA 4LAAA 1XYIA 1S5FD 1I4RA 1TWAB 1RODA 1NUCA 3QOLA 1KNEA 1PRTC 1TWGB 3S1QB 2JSOA 2YU9B 3VR4A 3SR1A 4RAUC 4XYOA 2BE5D 1VMCA 2KVMA 3S2HB 3IKJA 4XYQA 1G91A 2DNEA 4OGQC 1RD9D 3T56B 1AFPA 3PUZA 2SDFA 5CYUA 4G7OC 1PRTF 3E5SA 1STHA 4C3IG 1TWFB 3SDZA 1EIGA 1EYDA 2L1BA 2XN9C 1LT4D 5IT9E 2AUKA 4OHJA 1EY6A 2RDFA 4C1NK 3K7AB 1YNND 3PUYA 4PMBA 2JA6B 5FO8B 5FOBB 2Z4HA 2A6HD 2RA4A 3R3OA 1NR2A 1K8OA 3I90A 3ND9A 3SE0A 1IW7D 5HGTA 2EJMA 1A2TA 5JJZA 2V4DA 3FRPB 4YIJA 3MXNA 3T13A 1Y1WB 4TQUS 5KYLA 4IFDH 5JAVA 1V43A 1KAAA 4IUTA 1STYA 1SNMA 1CI3M 1FNVA 2SNSA 4IFDJ 1EY8A 2ZXRA 2I07B 4CJ2C 2NTTA 4FNFA 1OXVA 1R9TB 4JBWA 2J0TD 4H13C 1H9MA 2L4NA 1X3PA 4A3FB 3C46A 2LY7A 2F0MA 1SSOA 1UUPA 3KBXA 3EQLC 2E2IB 1CZGA 1RCVD 1TT2A 1JOQA 1SYFA 3G7LA 4F8MA 5EJWA 1BR9A 3FMCA 3GP7A 1ML0D 4ZKCB 4G4KA 2KEDA 1FYCA 1LT3D 3QOJA 4OO1I 5G3LF 4C3JG 3OOCA 2B2YA 4NDXA 1BBXC 2JYOA 3GTMB 3NTKA 4O42A 1QNKA 5JPMC 1EYAA 1EYCA 2XIWA 5CV9A 3MC0B 1SBBB 1F9QA 2MUYA 1G2SA 5FLXL 1Q90A 1BO0A 1ET6A 2R61A 4DAVA 1WTVA 4F87A 2O2LD 1PTOB 4K2KA 5A2QL 4FXGC 2QDBA 3S2DB 3VA7A 4IUVA 1CTMA 3GV6A 3RZDB 1O78A 4K8JA 4PMCA 3TP8A 2N88A 4RH6A 2L12A 4UAIA 4BY1B 3D3RA 5EQ0A 4IURA 3HOYB 2IL8A 3DEPA 2RBMA 1TVXA 3A8KE 3N6RA 2D9UA 2VB3X 4IALA 1I3QB 1IYVA 1DYQA 2N55A 4LMQD 3HKZB 3MTSA 5IGFA 2M00A 2K5QA 4IQZA 1J9OA 2KA7A 1CHQD 4WJWA 3Q22A 3MWYW 4GZYC 1XX8A 2MJ8A 2DY7A 1B4OA 2PW5A 3TDQA 1MSGA 2FHTA 5IGGA 2HCIA 2PO4A 1V1PA 3NTHA 5CV6A 2EY2A 1SYEA 3VR3A 2RKSA 1QG7A 1QILA 3P20A 1Z7TA 2EYHA 1JR0D 3P7JA 4J1MA 4KKUA 5C0XH 1BNZA 5K36H 1JWUD 1CFMA 3GD7A 5C0XJ 1U9RA 3I72A 4HMIA 4F88A 1ENAA 2F0HA 2ICIA 3KBGA 1B1ZA 4HSPA 1D2BA 1SMYC 1VMPA 2F0VA 2Z4IA 2SOBA 4XQJA 3J81L 2K05A 5LHY1 5M5YB 3HZXA 3R8BA 1HFNA 3D8GA 2AQ3B 3PUWA 1SYCA 3EJIA 2H4OA 1CK1A 4FVMA 3M4YA 1LT6D 2XRQD 3EROA 1UEAB 2PZWA 4BBSB 3TZDA 3FDTA 1RTNA 1STAA 4NW2A 3V05A 1LTRD 1A15A 3HOXB 1ZYRC 4FXKC 5CBAE 3NWTA 1JOKA 1K83B 2B2WC 4MHEA 3HOVB 3M85A 1LTAD 5IGDA 1EEID 1WVLA 2AWOA 3L9AX 4J6HA 3WOFA 3N52A 1WTXA 1DOMA 5E4WC 1AZQA 4ME5A 5EKIA 4J8QA 1XWEA 2JE6I 1FGBD 2A73B 3HP3A 5CV5A 1Y8PB 2F0WA 4DNTB 3GTKB 1W6JA 2BA1A 5IODA 1OXSC 1T5EA 4FF1A 4IZ8A 4QMGA 4XTCS 4A3JB 1T5XD 1D5ZC 1CA5A 2EE1A 1SYDA 4CGYB 3K5LA 4HAEA 5ISRA 5I9PA 2DN8A 2JXMB 1TU2B 4DXFA 4KMUC 2B2TA 2HQEA 2A5HA 3K0YA 5NUCA 4KJOA 3EA6A 1I4XA 3RUZA 2L5TA 2EYJA 4OIJA 1STGA 3OW7A 2H1EA 2F0FA 4QCLA 4HMJA 2A68C 3K58A 5DM73 4NMZA 3BZDB 2D62A 4I7ZC 1KLGD 1PFMA 2PNRC 3DMUA 1I4HA 1ZYRD 5C4ZA 3S15B 1PTOD 4CJ1B 5IGCA 3PO2B 2ICEC 5C5LA 1KDBA 3TN2A 1IYUA 3NE5B 2F0IA 4FF3A 3GTOB 2JEAI 2D5DA 5M3MB 3MVVA 5CORA 3S16B 1EOTA 3IL8A 3S9WA 3DWAA 5LL6X 1MGSA 1JC7A 4K6LA 2XVSA 2F3WA 3OIQA 1HRJA 3DM1A 4BA1I 5A35A 1GUNA 1C8CA 2F0NA 1TS3A 4QUCA 2ENBA 3PMFA 1OXXK 3KLSX 4NP5A 2F0OA 1AZPA 2C5CA 3W2DA 5D3IB 1OO9B 1LTSD 2K32A 4K14A 4DNRB 3K59A 2K1BA 2F0GA 3H6MA 3CRLC 1G8ZD 3QB3A 1TKWB 1Z47A 4ZLTF 1D1KA 1DM0B 3H91A 3DUZA 5EPKA 2XWJB 1NSNS 1SNPA 4FF4A 1ONLA 1CM9A 2K5DA 1XTCD 3R2TA 4C3JB 3QO2A 5DNFA 1PZID 2NWGA 1F9SA 2PMZB 3GTQB 1DD2A 1QWYA 4XQNA 3U9SA 3NXWA 4G7HC 1Y1VB 4G7ZC 3H3VC 3MZ5A 2B2YC 3I73A 2AUJD 1DOKA 4KK7A 1R4PB 3QIAA 2K7VA 1FNUA 3F2UA 2BDNA 5C5MA 2KQ3A 2E76C 1ESFA 1HCZA 2B39A 1EZ6A 5FO7B 3NBHA 1AN8A 3I4LA 1EY7A 3O13A 1TQOA 1LTID 2Z1CA 4EGVA 5T1IA 5DAUA 4DU9A 2EYFA 2WB1B 1WTOA 1II3A 4ZUIA 1Y69U 2M2LA 3HOUB 3CRKC 4AYBB 2YYZA 3MHBA 2JEBI 1DXMA 4OIKA 2QEJC 2EJGC 1BCPF 4BA2I 2WACA 1VF5C 4RA8A 4RGOS 1JWSD 2KHSA 3OMGA 1SDFA 2FJ2A 4L8JA 1Z6HA 4KY7A 3HRZC 3FPPA 1TS5A 3TBIB 3U9OA 1A3TA 5F2DA 1QCBD 5D65A 1GXDC 4RGNA 3FVQA 3MXPA 5KNCA 3CKIB 4G57A 3TP5A 4KKTA 1FNWA 1GUOA 3M7NA 3PUXA 2HCCA 4KKSA 1J8IA 2R93B 1PRTD 3RZOB 2NTSA 3GQBA 3H94A 2MGSA 2DY8A 3CQZB 3LWEA 3NWSA 1BXTA 1V8QA 3I8ZA 3K5MA 1WTRA 3JAML 2F4IA 4KY6A 2BOSA 5FLXE 2B63B 2FMMA 2VNUD 4A3BB 1SJED 3NTIA 3T16A 2KCNA 5JEAG 1Q1BA 2CVRA 1QOHA 2R7ZB 1MD2D 3R2IA 4MN3A 1LLRD 4C3HG 2RSNA 1TWHB 1EY9A 3C2PA 2TSSA 1WD0A 3A56A 4ZK9B 5J39A 5A2QE 3LWUA 5DM63 3SHLA 1ZKOA 5C4JB 4Q0FA 4K2LA 1LACA 3LX0A 1EY4A 4OO1H 2WINB 1TIID 2PYKA 1PYWD 4NKLA 1SFOB 4UDUC 2KUMA 4TSSA 4P2CB 5C4XB 3PO3B 1U4PA 1SJHD 4RGTA 1LV9A 3GTGB 2MHVA 2EYOA 3ERQA 4Q5VA 4QB4A 1NR4A 1F2YA 3CU7A 2XWBB 3MFYA 3IAYA 4X3UA 3BDOA 4RCNA 1JE4A 2PZUA 5G3LD 5LL6S 3FKIB 5BN4A 2Q8TA 1B44D 4EQPA 1HQMC 1FR3A 1X32A 1EEFD 1PZKD 3LNNA 2F03A 1E2VA 2MPMA 2M9VA 3T53B 5CMDA 1A3UA 2F3VA 5ELDA 2EXZA 1U4LA 1MSHA 4N9PA 3VYUA 4ZKBB 2NN6I 3NQTA 1Q3LA 4KHVA 2ZT9C 3J81E 1EIHA 4CKEA 1PXUA 1SNDA 4OL7A 2B2TC 2B8GA 4K5WA 4CJ0B 1QB5D 1JB3A 1IKMA 1EWCA 2ZXPA 3NSWA 2MP1A 3OMCA 3GTJB 4A3DB 1OXUA 2Y0SB 4WRDA 4BWGB 3NQIA 2NVTB 1QJOA 1V1OA 4IUNA 2J7ZA 5EPJA 2WKCA 1SYBA 2G9HD 2PW7A 2KECA 5CR3A 1SNQA 4KHZA 3DWPA 2AQ2B 2Q8IB 4IUUA 2L55A 3D4DA 5E1FA 3A54A 3I3CA 4TKOB 1GHJA 2BA0A 4LK1C 3BVMA 2F0QA 1LO5D 1HXYD 2XSCA 3V2TA 5EKKA 2OF1A 1SE2A 2Z8LA 3BVZA 2SEBD 1KDCA 1HFGA 2TMPA 2JP1A 1KTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXZ A;  1TQO A;  4J1M A;  2ENB A;  4N9P A;  5KEE A;  4IZ8 A;  4QMG A;  3P1H A;  3PMF A;  2EY6 A;  5I9O A;  5K5P A;  4NP5 A;  5DAU A;  2EY5 A;  2F0O A;  1EY9 A;  5HGT A;  1A2T A;  4DU9 A;  2EYF A;  5J39 A;  3EVQ A;  3NQT A;  4KHV A;  4YIJ A;  5KIX A;  3SHL A;  2EYM A;  1U9R A;  5EGT A;  3T13 A;  4K5X A;  5IOC A;  4HMI A;  1SYD A;  1ENA A;  1II3 A;  2F0H A;  4K14 A;  5KYL A;  4K2K A;  4ZUI A;  3V2T A;  1SND A;  3D6C A;  5I6W A;  2QDB A;  5ISR A;  4OL7 A;  3SK6 A;  4K5V A;  4WOR A;  2F0G A;  5I9P A;  5JAV A;  3H6M A;  3MHB A;  3DHQ A;  2F0V A;  1KAA A;  1EY4 A;  2SOB A;  3LX0 A;  3MEH A;  3OSO A;  1A3V A;  1STY A;  1SNM A;  2HQE A;  2PYK A;  1EY5 A;  2F0K A;  2SNS A;  4K8J A;  5DEH A;  5NUC A;  4NKL A;  1EY8 A;  3HZX A;  3QB3 A;  4KJO A;  4KV6 A;  4PMC A;  4ZUJ A;  5J1Z A;  3TP8 A;  5IIF A;  2WAC A;  5J22 A;  2NUC A;  3C1F A;  1A2U A;  2KHS A;  2F0D A;  3D8G A;  2F0E A;  3OMG A;  3RUZ A;  2F0J A;  5HUR A;  4ID6 A;  4TRD A;  3VA5 A;  1SYC A;  2EYJ A;  3ITP A;  3OWF A;  4EQO A;  1STG A;  4KTA A;  5C6A A;  3EJI A;  4B9X A;  3BDC A;  4LAA A;  3OMC A;  4N9T A;  1JOO A;  1EZ8 A;  4KY7 A;  2F0F A;  2PQE A;  4HMJ A;  1NSN S;  2LKV A;  2F0T A;  1JOR A;  2EYP A;  4WRD A;  3U9O A;  2F3V A;  1SNP A;  5C3W A;  3D4W A;  1A3T A;  4NMZ A;  5F2D A;  1STN A;  3ERO A;  1NUC A;  4IUN A;  3QOL A;  1F2Z A;  2RBM A;  2PZW A;  4PNY A;  3DMU A;  4DGZ A;  5KYI A;  3NP8 A;  2SNM A;  1SYB A;  4QF4 A;  1SNC A;  2EYO A;  2F0M A;  2PW7 A;  3ERQ A;  4DFA A;  4EVO A;  3MXP A;  5C4Z A;  1STB A;  1STA A;  1SNQ A;  4IAL A;  5CR3 A;  3SK5 A;  5IGC A;  4G57 A;  3C1E A;  4QB4 A;  3NHH A;  3SR1 A;  3TP5 A;  4B9W A;  1F2Y A;  4E6I A;  5M9O A;  5C4H A;  5CV4 A;  1TT2 A;  3SK4 A;  1JOQ A;  1RKN A;  1TR5 A;  5IGB A;  1SYF A;  2M00 A;  5IGF A;  3BDL A;  4EQN A;  3NXW A;  5C5L A;  3D4D A;  4DF7 A;  4F8M A;  5E1F A;  1KDB A;  2F0S A;  5EKL A;  3TP7 A;  5I6Y A;  5JOB A;  5CV8 A;  1EY0 A;  1JOK A;  3NK9 A;  2O4X A;  4S3S A;  2F0I A;  3TP6 A;  4KJN A;  1ENC A;  2EYL A;  1STH A;  3E5S A;  4ODG A;  5IGD A;  4I65 A;  2PZU A;  3NUC A;  4F7X A;  3QOJ A;  3MZ5 A;  5CV7 A;  4MIU A;  2PW5 A;  5CGK A;  3MVV A;  1IHZ A;  1KDA A;  4K8I A;  1EQV A;  4H7B A;  1EYD A;  4KD3 A;  4NDX A;  3SK8 A;  3HEJ A;  5IGG A;  3S9W A;  4J6H A;  5E3F A;  2F0P A;  2EY1 A;  4KY6 A;  4KD4 A;  3P75 A;  2EY2 A;  2F0Q A;  5CV6 A;  4ME5 A;  2F3W A;  1EYA A;  4HTH A;  1SYE A;  1EYC A;  1EY6 A;  5CV9 A;  5C5M A;  2RDF A;  4RKL A;  4K2L A;  2F0U A;  4R8N A;  2KQ3 A;  4K6D A;  4RKB A;  5EKK A;  2OF1 A;  3SXH A;  3TME A;  5IGE A;  5KGU A;  2RKS A;  4KY5 A;  4PMB A;  4EQP A;  5KRU A;  5CC4 A;  5CV5 A;  2F0W A;  1EZ6 A;  1F2M A;  3T16 A;  1KAB A;  1KDC A;  4K5W A;  4ZQ3 A;  1SYG A;  2OEO A;  2F0L A;  2EYH A;  1SNO A;  2OXP A;  2PZT A;  5C3X A;  2F0N A;  3R3O A;  5IOD A;  1A3U A;  1AEX A;  1EY7 A; 
#chains in the Genus database with same CATH topology
 2D0P A;  1HNX Q;  3A5Z B;  1I5F A;  3RLF A;  3KF8 B;  3CW2 C;  1NY4 A;  3EN2 A;  1F9R A;  4LF9 L;  3J80 L;  2BH2 A;  1B3Q A;  2EYM A;  2CHB D;  3U4V A;  1EUJ A;  4LUZ A;  3MA2 B;  1QVF A;  3D6C A;  3CCQ A;  4K5V A;  4UP9 A;  3M9B A;  3Q0A A;  1YNX A;  1UEB A;  1H95 A;  1L0X B;  3IFD A;  5IOC A;  1LTL A;  2RVL A;  2Q2I A;  3BVG A;  1D5X C;  1MKH A;  3PV0 A;  1I6H B;  1UE7 A;  2F0D A;  1CHP D;  1XPO A;  4X3T A;  4ID6 A;  4BY1 G;  2L15 A;  3SEB A;  4KTA A;  1SMY D;  4DK1 A;  4B9X A;  4EX5 A;  3KK7 A;  3B6Y A;  3HOY G;  3QG1 A;  4A3K B;  4DR6 Q;  2OTL A;  4ZYS A;  3W3A A;  1SRU A;  1LT5 D;  1STN A;  2CH4 W;  1CSP A;  3HS0 C;  4PNY A;  3M7G A;  4DV6 L;  3TSS A;  2RCF A;  4RWS C;  1ESR A;  1O7L A;  2JA9 A;  3VR2 A;  3PUV A;  2IX0 A;  2NN6 G;  3HKZ G;  4OEL B;  2NZO A;  3SK4 A;  4Y7N B;  5COY A;  4POF A;  5ELF A;  1O7I A;  1IKL A;  3L3O C;  4KI0 A;  4ZCK A;  3K5N A;  1CSQ A;  5C3E B;  2Z0S A;  4HJ5 A;  3TP7 A;  1B50 A;  3HOW B;  2F4V L;  4A3K H;  2QW7 A;  4PV1 C;  4H44 C;  1CT1 D;  3VR5 A;  4I65 A;  1VCI A;  3PSI A;  3C3L A;  1HHV A;  4C3I B;  4MIU A;  2G9D A;  3GV3 A;  3T4A C;  2HDL A;  3I91 A;  1E1O A;  3R93 A;  5M5W H;  3LGJ A;  1PZJ D;  2JA7 H;  1YIJ A;  1C0A A;  1JWM D;  4KD4 A;  3P75 A;  4DK6 C;  4Y7N H;  4A93 B;  1BCP B;  1K0R A;  5KGU A;  2E2H B;  1NMF A;  3TME A;  1XNQ L;  2RF4 A;  4KN7 C;  1KAB A;  4ZRZ A;  3CCL A;  2B2V A;  3GTP B;  2LXJ A;  3ULJ A;  4C3I H;  1PH1 A;  1EYG A;  1HZ9 A;  2XRS D;  4B3M Q;  3U4Z A;  1AEX A;  2NVX H;  2WKD A;  5IWA L;  2IX1 A;  4DN4 M;  3E6Z X;  3P1H A;  4GKJ L;  3V96 A;  4LFB Q;  4PZ8 A;  4R9W A;  3J7A V;  4DR2 Q;  1LTB D;  2HQL A;  4A75 A;  2IX3 A;  4A93 H;  2LS0 1;  5KIX A;  3CC2 A;  2LFN A;  4IN3 A;  4GLX A;  3E9I A;  4HJA A;  4PMW A;  1Y8O B;  2K03 A;  3RMH A;  4CDD C;  1LAB A;  1U4R A;  4X64 L;  3GTP H;  4WOR A;  2L9H A;  1EY5 A;  1B70 B;  1PFN A;  1JQY D;  1S5B D;  2HHH Q;  3GO5 A;  4P73 A;  4QGU A;  2KOL A;  2A1A A;  1MJC A;  2O5J C;  3BDC A;  3A7A B;  5FKA C;  4JG2 A;  1SAP A;  1CA6 A;  1GD7 A;  5FO9 B;  1WTH A;  2EYP A;  4LF5 L;  4DUY Q;  5IP9 H;  4ZAI A;  4HID A;  4BBS G;  1LTT D;  3CCE A;  1F2Z A;  2A69 C;  1HR0 L;  5GRO A;  3KF6 B;  4KN4 C;  1X9N A;  3SK5 A;  3AB9 A;  1CKM A;  3C1E A;  2A68 D;  2NVQ H;  1YHA A;  4X65 L;  3BS1 A;  3HOX G;  1TS2 A;  1VQO A;  4DAY B;  1WTQ A;  1L2F A;  2GN5 A;  1HNW L;  3CPW A;  4DV2 L;  3H0G B;  5CV8 A;  3D31 A;  4ODG A;  3IFT A;  1W6K A;  1PA6 A;  3L0O A;  4C2M H;  4YY3 Q;  3M4O B;  1I4Q A;  1WCM H;  4FXD A;  1QNU A;  3S1R B;  4C3H B;  1NNX A;  1N32 L;  1HA5 A;  1K8M A;  3WDN A;  2EY1 A;  5ELC A;  1H9K A;  1EOV A;  4WFN 3;  3KLR A;  2JA8 H;  1BBU A;  4RKL A;  3VYS A;  4A3G H;  1IYJ B;  1IW7 C;  2QCP X;  3I2Z A;  5I2Y A;  3H0G H;  3KUP A;  1ILQ A;  4FP5 D;  3EFX D;  3TZU A;  1N33 Q;  1TWC B;  3GTL H;  2OEO A;  2OQK A;  2F0L A;  3AFP A;  5JEA H;  1DGS A;  1AW7 A;  1JB7 A;  1BF4 A;  4IJL A;  4A3J G;  1HR0 W;  3WOE A;  4C3H H;  5JEA J;  4JYA Q;  2IY5 B;  4BBR G;  1S3O A;  2EY5 A;  2ZM6 Q;  2PI2 A;  1HUN A;  1VF7 A;  3OHX C;  4X3S A;  4LF7 Q;  2WAQ E;  3PGZ A;  1L0Y B;  1EIF A;  1TWC H;  4XIG S;  4RG1 A;  2QDL A;  2L0C A;  2IPK D;  1A3V A;  2ATW A;  1MI2 A;  1XXG A;  4DR1 L;  1M4V A;  1I4P A;  3E3X A;  3DWQ A;  2ID0 A;  4JV5 Q;  2R7F A;  4EQO A;  3T1Y Q;  3OWF A;  1HPC A;  1BCP C;  2A69 D;  2IW3 A;  4N8X 1;  2XGT A;  4A3E B;  1HQR D;  1RJT A;  3FEW X;  1CZW A;  4YWK A;  1TWA H;  3KLS A;  1F77 A;  2FFK B;  4CHT B;  4BY7 G;  4DXG A;  4DV0 Q;  5KYI A;  2HDM A;  4QF4 A;  1JE5 A;  5FLX c;  3PO2 G;  4JI5 Q;  3ICE A;  1M8A A;  1O80 A;  4GLV B;  4LFA Q;  1GM5 A;  2YU9 H;  1E0B A;  3NHH A;  4HED A;  3BZC A;  1HUM A;  1KNA A;  4XDX A;  2RQX A;  1KLU D;  3CCM A;  3S2H H;  2EVB A;  1WTP A;  4DF7 A;  4DAP A;  1QZG A;  3UE0 A;  2PNH A;  4A3E H;  3I4N B;  2E2J B;  1R4Q B;  5EKL A;  5AFW A;  4P72 A;  2F1M A;  3TP6 A;  5M3M G;  2JJQ A;  4IFD I;  4V0B A;  3AU7 A;  3Q24 A;  1O7Z A;  3ZJY C;  3UI2 A;  4ULL A;  4U67 3;  3NEM A;  2WAQ G;  4LJZ C;  5CGK A;  3JAM E;  4RCO A;  1EQV A;  1GKH A;  4A3L G;  3T51 B;  1VDZ A;  1A6X A;  2F0P A;  3AFQ A;  2L11 A;  2KCT A;  3J7Y W;  3VYR A;  1X55 A;  3X3N A;  3OTO L;  3K7A H;  3KF8 A;  1X65 A;  3SXH A;  1EL0 A;  5IGE A;  2F4V Q;  5IT9 L;  3I4N H;  4NPS A;  1LYL A;  2QF7 A;  4DV7 L;  1I4G A;  2EJF C;  4U68 A;  1ICW A;  4A3I B;  4OX9 Q;  2KHI A;  3TEH B;  4NXM L;  1E24 A;  4IUQ A;  2VXW A;  4L63 B;  3HKS A;  1GHK A;  4CBV A;  1Q12 A;  2QA4 A;  5KEE A;  4PQX A;  1ICF B;  4JI7 L;  4DNI A;  4QIW B;  1HNX L;  1KL9 A;  1OXT A;  2PPB C;  4M8A A;  1FGU A;  2LSS A;  4A3M B;  1C4Q A;  1BCP D;  3OSO A;  4HIO A;  4QQB X;  1PYB A;  3QJY A;  1UAP A;  2WII B;  4LF8 Q;  3OPO A;  2HT1 A;  1PFB A;  4GKJ Q;  3QWN A;  1BQQ T;  3C1F A;  3H09 A;  2F0E A;  2F0J A;  3F2D A;  2E8G A;  1A62 A;  1YBY A;  3ITP A;  4JC0 A;  1R9T H;  1NJI C;  3MAQ A;  5C6A A;  5I4D A;  1PDQ A;  1VQH A;  4OON A;  4JI6 Q;  5BN3 A;  4A3M H;  4LNQ A;  1S40 A;  3HOZ B;  1H9J A;  2D2C C;  4DR6 L;  1TY2 A;  4DGZ A;  3TS0 A;  2IWH A;  3NP8 A;  2VUM G;  4EVO A;  1K8G A;  1STB A;  1JCK B;  1NTG A;  2JQO A;  4L5T A;  3DEO A;  4AQY Q;  3MXU A;  4B9W A;  5M9O A;  3MFG A;  4YCV A;  1B3A A;  5EBD A;  1Q81 C;  4LUO A;  2K75 A;  4JI1 Q;  3BYY B;  1Y1V G;  1XPU A;  1F9P A;  1VQK A;  5EBC A;  4NB3 A;  2EYL A;  5C44 B;  3DXJ C;  5FLM G;  1Q8I A;  3NUC A;  1K9M C;  2HUG A;  1EFW A;  1B53 A;  3KLW A;  4CDC C;  4M1U B;  2R92 B;  1C7Y A;  3WWV A;  2O5I C;  4K8I A;  1WTW A;  1KD1 C;  1B8A A;  3GTM H;  2JN4 A;  2EXD A;  4DUZ Q;  2BCO A;  3J81 c;  1QE6 A;  1UWV A;  1BKB A;  2X6L A;  4H0L C;  2D0O A;  3S14 B;  4AIM A;  4CKB A;  2CWP A;  4RKB A;  2NVY B;  4K6D A;  3S17 B;  4KY5 A;  2OWO A;  5CC4 A;  2B8F A;  1F2M A;  1BOS A;  3I4M B;  5C44 H;  4RFB A;  2ZXO A;  2PZT A;  1K3B C;  1G6P A;  2R92 H;  2ZJQ A;  2A74 C;  2LMC B;  3M3Y B;  2CW0 C;  4YWM A;  2DJF C;  4Z9C B;  2AKW B;  4LWC A;  1JJC B;  4B3M L;  3I70 A;  2WB1 G;  4BXX H;  4XT3 B;  4N8F A;  1BVS A;  4C56 C;  5IYD G;  2ES2 A;  1YNJ C;  2K33 A;  4LFB L;  2VB2 X;  4FO2 A;  4K5X A;  2JA6 G;  1PTO H;  4YHH Q;  4IFD G;  3Q8D A;  1VQD A;  1SE4 A;  3HOU G;  1SEB D;  4AYB G;  3IRB A;  5ELO A;  4DK0 A;  1AP0 A;  4QUF A;  1ENF A;  2FMC A;  3OIP A;  2AQ1 B;  4HCE A;  1RF2 D;  4HJ9 A;  5KND A;  2WP8 J;  2WFW A;  5FK9 C;  2ZJP A;  3D4R A;  2WV6 D;  1GOZ A;  2ZTE A;  4DV1 Q;  1UE1 A;  3KF6 A;  2NUC A;  1A2U A;  5M3F B;  4DR5 Q;  4TRD A;  3VA5 A;  2HHH L;  3BU2 A;  3A55 A;  2IJ0 A;  1N34 L;  4BY1 H;  1GUW A;  2CQO A;  1Y1W G;  1JOO A;  1T9H A;  4DAY A;  1VQC A;  1WFQ A;  4IUP A;  3HOY H;  1H9S B;  1JIC A;  3D4W A;  5D14 A;  1WJJ A;  3NEL A;  3G6J B;  4DUY L;  1VQ4 A;  2SNM A;  1SE8 A;  1HA6 A;  3I7F A;  2QKI C;  4UHV A;  5C0X I;  5TSS A;  5KNB A;  2NN6 H;  5M3F H;  5M5X B;  3J7A F;  5CV4 A;  2C35 B;  3H15 A;  1Q1E A;  2NBF A;  1UNS A;  3URY A;  4EQN A;  2R93 G;  1G2T A;  4R8I A;  2JA5 B;  3VR6 A;  5JOB A;  2K01 A;  2N8N A;  4HIK A;  1L1O A;  3NK9 A;  1ENC A;  1JJG A;  4IPC A;  3RD4 A;  2K04 A;  1TS4 A;  3ZYY X;  1B2T A;  1L0W A;  3HGB A;  1YJW A;  1BDO A;  3OYY A;  3K6O A;  1ILP A;  1EQT A;  1RDP D;  4YY3 L;  3A8J E;  2KCC A;  5E3F A;  5JJI A;  2B63 G;  1RTO A;  2AHO B;  3OWE B;  4POG A;  1K3R A;  3CC7 A;  4R8N A;  5ELB A;  4A3B G;  2CW0 D;  3ND8 A;  2JA5 H;  2B2V C;  4FF2 A;  4OO1 G;  3CPF A;  2PCF B;  2NZ1 D;  2MO0 A;  2UXC Q;  4B3S Q;  4JBM A;  1N33 L;  1YNJ D;  2NB0 A;  1DJR D;  5C3X A;  1E2W A;  3S24 A;  3J80 E;  1GJX A;  5T1G A;  2KEE A;  2EY6 A;  1IBL Q;  1HNZ Q;  3HG9 A;  4JYA L;  1CUK A;  4HSV A;  3NBI A;  3OW2 A;  1VQJ A;  2EPB A;  2ZM6 L;  5GAE C;  2K14 A;  5DLQ E;  1AH9 A;  4LF7 L;  3A8I E;  2XNA C;  5I6W A;  1VQ6 A;  1U0L A;  2OT2 A;  3G48 A;  2IHF A;  3DHQ A;  3HKZ E;  2FXQ A;  3MEH A;  1QUQ B;  2F0K A;  4XXE A;  5M5Y H;  4NXN L;  1XMO Q;  2AWN A;  4ZUJ A;  4KV6 A;  5IIF A;  1D6E C;  1YEZ A;  2RSO A;  3S1N B;  4V19 0;  4JBJ A;  4RGM A;  5HGQ A;  4OWX B;  4JV5 L;  3PO3 G;  1G29 1;  4ILW A;  1NAP A;  3T1Y L;  1EZ8 A;  5FJ8 G;  1PTO C;  1XJV A;  2MO1 A;  4JCV E;  2LKV A;  3A0J A;  1CQV A;  4OWT B;  1LTG D;  1ET9 A;  5C3W A;  4J15 A;  1FD7 D;  4CKC A;  2YTV A;  3VYT A;  4BBS H;  4R1J A;  5I2X A;  1VQL A;  4DV0 L;  3CAM A;  2KBN A;  3FHW A;  1U5K A;  4JI5 L;  3I4O A;  2UUC L;  3W1G A;  3S1N H;  1PTO F;  4LFA L;  1RKN A;  4XQQ A;  3ONA B;  5IGB A;  3BDL A;  5IP7 G;  1EU3 A;  3PIP 3;  3HOX H;  3CME A;  2C9O A;  2E75 C;  3AMU A;  5I6Y A;  1IL8 A;  1K83 H;  1KC8 C;  1VQA A;  2O4X A;  2DNC A;  4S3S A;  5BN5 A;  1FVI A;  3K57 A;  2AMC B;  4DAM A;  1X54 A;  2IT1 A;  4QL5 A;  1KDA A;  1PH3 A;  1E2Z A;  1EWH A;  4KD3 A;  2XTI A;  3SK8 A;  4GS3 A;  2B2U C;  3SVM A;  5M5W B;  3E0J A;  5E4X A;  3T1H Q;  2JA7 B;  2EZV A;  5EPL A;  3EBE A;  3FKI G;  1D1I A;  2I46 A;  3K5O A;  4BBR B;  4YCW A;  4O1N A;  1F2L A;  1PMR A;  4PZ6 A;  4PG3 A;  5ELE A;  1HTL D;  4LF6 L;  4ZQ3 A;  1YI2 A;  1O7Y A;  1SYG A;  2X6G A;  4I7A A;  3H3V I;  1YHQ A;  2OXP A;  1A0I A;  4OX9 L;  5JVG 3;  3J81 i;  1PRT B;  2K6A A;  2RDG A;  4KJN A;  5C0X G;  2NVX B;  5K36 G;  2X69 A;  5K5P A;  2KJX A;  4XT1 B;  2DUD A;  4ABN A;  3S1M B;  4BBR H;  3EVQ A;  4DR3 Q;  1C9O A;  3CD6 A;  5JPN C;  4BS9 A;  4X6A H;  4DA2 A;  4JI3 Q;  1GUG A;  4JI8 Q;  1EFI D;  4L5S A;  1GUS A;  3KOJ A;  3RN2 A;  1VQM A;  4B3R Q;  3SK6 A;  4O2D A;  1S5D D;  1B9M A;  1KHI A;  4BY7 B;  3CC4 A;  1S5E D;  5CBE E;  4GKK Q;  3PIO 3;  5J1Z A;  3BZK A;  4HJ7 A;  3BG3 A;  5J22 A;  4LF8 L;  2QIL A;  1U4M A;  5IYC G;  3M4Q A;  3NPP A;  3S1M H;  4KLK A;  2Y0S G;  2KEN A;  4HN7 A;  4N9T A;  3CHB D;  1SMX A;  2PQE A;  1MBY A;  3Q23 A;  1DCZ A;  1JOR A;  2F0T A;  4JI6 L;  2A6E C;  3L7Z C;  2LXK A;  2GA4 B;  1RHP A;  4OEM B;  3STB C;  2Q8R E;  4BY7 H;  2EOT A;  2WAQ B;  1DZ1 A;  1SNC A;  4DFA A;  3S15 H;  2FIN B;  5D3D A;  1DON A;  1YVC A;  1G6Z A;  4C1N I;  3PO2 H;  1X3Q A;  4E6I A;  3BYT B;  4A3C G;  1YJN A;  2Z9H A;  2NVQ B;  5C4H A;  1N34 Q;  4AQY L;  1TR5 A;  1SLJ A;  1H9R A;  3X3M A;  2H5X A;  1GUT A;  3U50 C;  2F0S A;  1PV4 A;  1EY0 A;  1Y8N B;  3AQQ A;  1P8L A;  4JI1 L;  1CQF A;  3CCU A;  1PH8 A;  1JJ2 A;  2B2W A;  4RHR A;  4RHS A;  2BE5 C;  1SE3 A;  2E74 C;  4F7X A;  2NYZ D;  2N78 A;  2BDO A;  5CV7 A;  1IHZ A;  1S4Z A;  3MXG A;  1K28 A;  4HR7 B;  4C2M B;  1WCM B;  4H7B A;  1D5M C;  5JVH 3;  3HEJ A;  3A7L A;  5JJL A;  1ZEQ X;  4L6T B;  3J7A 5;  1JT8 A;  1PH9 A;  4HTH A;  4DUZ L;  1WD1 A;  4JK1 C;  1TY0 A;  2JA8 B;  1C48 A;  2F0U A;  5LMU Q;  1HTP A;  4A3G B;  3HOV G;  3FPU B;  2EDG A;  4FDB A;  2RDH A;  4B08 A;  4X66 Q;  2QEX A;  1STE A;  3GTL B;  2CQA A;  1EIY B;  1SNO A;  1SXT A;  1NCV A;  3Q6S A;  2K5W A;  1YNN C;  2K28 A;  3CP0 A;  2E2D C;  1V1P B;  2E5L L;  3D6W A;  1S5C D;  1DOL A;  5I9O A;  2R6G A;  2B2U A;  5GAH C;  1I50 B;  1BUV T;  2A6H C;  2MQH A;  5EGT A;  1X6O A;  1L1O B;  1I6V C;  1KIX A;  3PIO A;  1EU4 A;  4YHH L;  1NE3 A;  1H9S A;  3RNU A;  4FYD A;  4X3K A;  3I55 A;  5DEH A;  4HCS A;  5KRU A;  1PLF A;  1ZXT A;  2VUM B;  2A6E D;  1KRT A;  1VQ7 A;  5HUR A;  4DV1 L;  3ULL A;  2R3Z A;  2I0Q A;  2J4X A;  1I50 H;  1B9N A;  4LAA A;  4DR5 L;  1XYI A;  4A3K G;  3JAM c;  2Z6K A;  1S5F D;  4QY7 A;  2Q2T A;  1I4R A;  4GLA C;  1TWA B;  1ROD A;  4NXN Q;  1NUC A;  3QOL A;  1KNE A;  1PRT C;  2EIF A;  1TWG B;  3S1Q B;  2JSO A;  2KHJ A;  4AH6 A;  2VUM H;  2YU9 B;  3VR4 A;  3SR1 A;  4RAU C;  4XYO A;  3J81 j;  2BE5 D;  1VMC A;  2KVM A;  5C3E G;  3S2H B;  3IKJ A;  4XYQ A;  1G91 A;  1FJG Q;  3HOW G;  4JI0 Q;  2DNE A;  4OGQ C;  5GAD C;  1RD9 D;  3T56 B;  1AFP A;  3PUZ A;  2SDF A;  5CYU A;  1Y1V H;  4G7O C;  1PRT F;  3E5S A;  1STH A;  4C3I G;  1TWF B;  5E7N A;  1OTC A;  3SDZ A;  4MNO A;  1EIG A;  2OCE A;  1EYD A;  1TWG H;  3S1Q H;  2L1B A;  2XN9 C;  2UUC Q;  1B7Y B;  1LT4 D;  5IT9 E;  4CDE C;  2AUK A;  4OHJ A;  1PH7 A;  1EY6 A;  1W3S A;  2RDF A;  4C1N K;  1EQQ A;  3K7A B;  4R4T A;  1YNN D;  3PUY A;  2NZH A;  4PMB A;  1VQ5 A;  2JA6 B;  5FO8 B;  5FOB B;  2Z4H A;  1TWF H;  1HJP A;  2A6H D;  2RA4 A;  1LUZ A;  3R3O A;  1NR2 A;  2UXC L;  3I90 A;  4B3S L;  3ND9 A;  1K8O A;  1QUQ A;  2OTJ A;  3SE0 A;  1IW7 D;  2UUA Q;  5HGT A;  2EJM A;  1A2T A;  5JJZ A;  2V4D A;  3FRP B;  1IBM Q;  4YIJ A;  3MXN A;  1IBL L;  1HNZ L;  5IYD H;  4LF6 Q;  3T13 A;  1Y1W B;  4TQU S;  5KYL A;  2JA6 H;  4IFD H;  2PMZ E;  3HOU H;  5JAV A;  2Q2U A;  1V43 A;  1KAA A;  4IUT A;  1STY A;  1SNM A;  1CI3 M;  1FNV A;  1X3F A;  2SNS A;  4IFD J;  4LW1 A;  1EY8 A;  4K0K Q;  1CKO A;  4DKA C;  2ZXR A;  1XMO L;  2I07 B;  4CJ2 C;  2NTT A;  4FNF A;  1OXV A;  3RN5 A;  1R9T B;  4JBW A;  1XMQ Q;  4IPD A;  2UXB Q;  1WYD A;  1Y1W H;  2J0T D;  2HIV A;  4H13 C;  4UY8 C;  1H9M A;  2L4N A;  1X3P A;  4A3F B;  3C46 A;  1XNR Q;  2LY7 A;  1XTD A;  1PH5 A;  2F0M A;  1SSO A;  3F8T A;  1UUP A;  3KBX A;  3EQL C;  2E2I B;  1CZG A;  1RCV D;  1TT2 A;  1P16 A;  5AJ3 Q;  1JOQ A;  3K7U C;  1SYF A;  3L2P A;  3G7L A;  4F8M A;  5EJW A;  1BR9 A;  4HIM A;  3FMC A;  3GP7 A;  3PF4 A;  1L1O C;  3RZO H;  5IY0 A;  1ML0 D;  1A63 A;  4ZKC B;  1YHB A;  4G4K A;  1Z9F A;  2KED A;  1FYC A;  1LT3 D;  3QOJ A;  4A3F H;  4OO1 I;  2WB1 E;  5G3L F;  4C3J G;  3OOC A;  2CWA A;  2B2Y A;  4NDX A;  1BBX C;  2JYO A;  3GTM B;  2YTX A;  2E2I H;  3NTK A;  4IPG A;  4O42 A;  1QNK A;  5JPM C;  1GVP A;  3T1H L;  1EYA A;  3K0X A;  4AYB E;  2B63 H;  1EYC A;  2XIW A;  5CV9 A;  3MC0 B;  1SBB B;  4H02 A;  1F9Q A;  2MUY A;  4LFC Q;  1G2S A;  4A3B H;  1N8R C;  5FLX L;  4IJH A;  1Q90 A;  1BO0 A;  1ET6 A;  1UE5 A;  3HFZ B;  1PH6 A;  4IPH A;  2R61 A;  1EQR A;  1PH2 A;  4DAV A;  1WTV A;  2YV5 A;  2VS1 A;  1D8L A;  4F87 A;  5C4J H;  3ULP A;  2O2L D;  4DR3 L;  1PTO B;  4K2K A;  5A2Q L;  4FXG C;  2QDB A;  3S2D B;  4JI3 L;  4JI8 L;  3VA7 A;  4IUV A;  1CTM A;  3GV6 A;  3RZD B;  4B3R L;  1O78 A;  2E5L Q;  4K8J A;  3VDY A;  1A8V A;  4PMC A;  3TP8 A;  1VQB A;  4GKK L;  2N88 A;  2R7D A;  1E7Z A;  4A3E G;  1J5E Q;  4RH6 A;  2L12 A;  4UAI A;  4BY1 B;  3PO3 H;  3D3R A;  5EQ0 A;  4IUR A;  3HOY B;  3S2D H;  2IL8 A;  3DEP A;  2RBM A;  3RZD H;  1TVX A;  3A8K E;  3N6R A;  4MTN A;  2D9U A;  4GOP B;  2VB3 X;  4IAL A;  1I3Q B;  1IYV A;  1DYQ A;  2N55 A;  1LM0 A;  4LMQ D;  3KYH C;  3HKZ B;  3MTS A;  5IGF A;  2M00 A;  2K5Q A;  3I4N G;  4IQZ A;  1J9O A;  2KA7 A;  2K4K A;  5IP7 H;  1CHQ D;  4WJW A;  3Q22 A;  3J80 c;  3MWY W;  4GZY C;  1XX8 A;  1IBK Q;  2MJ8 A;  2DY7 A;  4DK3 C;  1B4O A;  2PW5 A;  3TDQ A;  1MSG A;  2FHT A;  5H1S E;  5IGG A;  2I5L X;  4L5Q A;  1I3Q H;  1Q7Y C;  2HCI A;  2PO4 A;  1V1P A;  1VQP A;  3NTH A;  5CV6 A;  2EY2 A;  3FKI H;  1SYE A;  3VR3 A;  2RKS A;  1QG7 A;  4OWW B;  1PFS A;  1QIL A;  5LMU L;  4A3I G;  3P20 A;  2N3S A;  1Z7T A;  2EYH A;  4X66 L;  1JR0 D;  1YJ9 A;  1N36 Q;  3P7J A;  4J1M A;  4KKU A;  5C0X H;  2CCZ A;  1BNZ A;  4JI4 Q;  5K36 H;  1JWU D;  4LF4 Q;  3RR5 A;  2F52 A;  5J3B A;  2RCN A;  1CFM A;  3GD7 A;  5C0X J;  1U9R A;  3F2B A;  4A3M G;  3I72 A;  4HMI A;  4F88 A;  1ENA A;  2F0H A;  2ICI A;  3KBG A;  2N49 A;  3NBH B;  1B1Z A;  2JK8 A;  4HSP A;  1D2B A;  2R7Z G;  1SMY C;  1VMP A;  2F0V A;  2Z4I A;  2SOB A;  4XQJ A;  3J81 L;  2K05 A;  5LHY 1;  5M5Y B;  3HZX A;  3R8B A;  4DR4 Q;  1HFN A;  3D8G A;  3E0E A;  4L5R C;  4WJ3 M;  2AQ3 B;  3PUW A;  1SYC A;  5IYC H;  3EJI A;  3GTJ H;  5GQO A;  2H4O A;  1CK1 A;  4FVM A;  3HOZ G;  3M4Y A;  2K5H A;  2NVT H;  1LT6 D;  2XRQ D;  1V9P A;  2ALY B;  1UEA B;  3ERO A;  2PZW A;  4BBS B;  3TZD A;  2UUB Q;  3FDT A;  1RTN A;  4X62 Q;  1STA A;  3CCJ A;  4NW2 A;  3V05 A;  1LTR D;  1A15 A;  4A3C H;  5C4X G;  3MXN B;  1I94 Q;  5GAG C;  3HOX B;  1ZYR C;  4FXK C;  5CBA E;  3NWT A;  5C44 G;  1JOK A;  1K83 B;  2B2W C;  4MHE A;  1FJG L;  3HOV B;  3M85 A;  4JI0 L;  1LTA D;  5IGD A;  2VL6 A;  2R92 G;  4A4I A;  3UDF A;  1EEI D;  1WVL A;  2UXD Q;  2AWO A;  3K80 C;  2VQF L;  3L9A X;  2ZTD A;  4BXX G;  1G51 A;  4YCU A;  4J6H A;  1E3P A;  1VQN A;  3WOF A;  4LUV A;  3N52 A;  4DV4 Q;  2CKZ B;  1WTX A;  1DOM A;  5E4W C;  1AZQ A;  4ME5 A;  5EKI A;  4J8Q A;  1VQ9 A;  1XWE A;  2JE6 I;  3U58 A;  1FGB D;  4P74 A;  2A73 B;  3HP3 A;  3I4M G;  5CV5 A;  1Y8P B;  2F0W A;  2HD3 A;  3HOV H;  2I5H A;  2PI2 E;  4DNT B;  3GTK B;  2G5D A;  2K52 A;  4JW0 A;  1JMC A;  1W6J A;  4GOP C;  2BA1 A;  5IOD A;  1OXS C;  4PZ7 A;  1T5E A;  2Y0S E;  3W5O A;  4FF1 A;  1CKN B;  4IZ8 A;  4QMG A;  4XTC S;  1IZ6 A;  4A3J B;  1T5X D;  2UUA L;  3CXC A;  1D5Z C;  1CA5 A;  1QVG A;  3DLL A;  2EE1 A;  1IBM L;  1SYD A;  1VQ8 A;  4CGY B;  5LMN Q;  3K5L A;  4HAE A;  1M1K C;  5ISR A;  5I9P A;  3GTK H;  2DN8 A;  2JXM B;  1TU2 B;  4DXF A;  4KMU C;  2B2T A;  2HQE A;  3KFU A;  2A5H A;  3K0Y A;  4TVA B;  5NUC A;  4KJO A;  3EA6 A;  5M3F G;  1I6H H;  1I4X A;  4K0K L;  3RUZ A;  4A3J H;  2L5T A;  2EYJ A;  4OIJ A;  1STG A;  3OW7 A;  2Z6K C;  2H1E A;  2F0F A;  4R4Q A;  4QCL A;  4HMJ A;  1RIP A;  2A68 C;  1XMQ L;  2UXB L;  3K58 A;  5DM7 3;  4NMZ A;  3BZD B;  3H3V H;  2D62 A;  1KLG D;  1PFM A;  4I7Z C;  4R4O A;  2PNR C;  3DMU A;  1VS0 A;  1I4H A;  1ZYR D;  5C4Z A;  3S15 B;  1XNR L;  1PTO D;  4CJ1 B;  5IGC A;  3PO2 B;  1IXR A;  5IYB G;  2YTY A;  2ICE C;  4QJF A;  4GNX A;  2JA5 G;  5C5L A;  4EQ5 A;  4A3D G;  5C3E H;  5AJ3 L;  1KDB A;  3TN2 A;  1IYU A;  3HOW H;  3NE5 B;  2F0I A;  4KHP Q;  4FF3 A;  3GTO B;  1X56 A;  3M4P A;  2JEA I;  2D5D A;  5M3M B;  2VW9 A;  3MVV A;  5COR A;  3S16 B;  1X3E A;  1EOT A;  2F3I A;  4R4I A;  3IL8 A;  3S9W A;  3DWA A;  5LL6 X;  1MGS A;  1JC7 A;  4K6L A;  3PIP A;  2XVS A;  2F3W A;  3OIQ A;  2OQ0 A;  2E2H H;  5HY6 A;  1HRJ A;  3J80 i;  3DM1 A;  4RMF A;  4BA1 I;  5A35 A;  4LFC L;  3GTO H;  1Q82 C;  5M3M H;  1GUN A;  3AYH B;  2CH4 A;  1C8C A;  3S16 H;  1PHJ A;  2F0N A;  1TS3 A;  4QUC A;  1D7Q A;  2ENB A;  3TQY A;  3PMF A;  1OXX K;  4A3L H;  3KLS X;  4NP5 A;  4UP8 A;  2F0O A;  1AZP A;  1PVO A;  3K81 C;  4ALP A;  4Y52 H;  2UU9 Q;  2C5C A;  1IL2 A;  3W2D A;  5D3I B;  3G4S A;  1MHW C;  1OO9 B;  1LTS D;  3W1B A;  2K32 A;  4DV5 L;  4K14 A;  4DNR B;  3K59 A;  2DJG C;  3CCR A;  2K1B A;  3I56 A;  2F0G A;  3H6M A;  2V1C C;  3CRL C;  1G8Z D;  1PYS B;  2RHQ B;  3QB3 A;  1TKW B;  1Z47 A;  1EWI A;  4ZLT F;  4GOP A;  1D1K A;  1S72 A;  1DM0 B;  1SN8 A;  1VQF A;  3H91 A;  4DR7 Q;  3DUZ A;  1J5E L;  1QVC A;  5EPK A;  2XWJ B;  1NSN S;  1SNP A;  4FF4 A;  5IT9 c;  1ONL A;  1CM9 A;  2VQE Q;  2K5D A;  1XTC D;  3R2T A;  4MTK A;  4C3J B;  3QO2 A;  3F2C A;  5DNF A;  1PZI D;  4O0A A;  2NWG A;  1F9S A;  2PMZ B;  3GTQ B;  3TS2 A;  1DD2 A;  1QWY A;  3STB D;  4XQN A;  3U9S A;  3NXW A;  1X3G A;  3MEF A;  4ME3 A;  1GO3 E;  3F1Z A;  1AE2 A;  4DV3 Q;  4G7H C;  1Y1V B;  4WJ4 A;  4JVZ A;  3KDF A;  4G7Z C;  3H3V C;  3DM3 A;  3MZ5 A;  2B2Y C;  3M4O H;  3A74 A;  3I73 A;  1IBK L;  2JA7 G;  2AUJ D;  4C3J H;  1DOK A;  4KK7 A;  3S1R H;  1R4P B;  4DPG A;  3QIA A;  2K7V A;  1FNU A;  3NEN A;  3GTQ H;  3F2U A;  1NMG A;  2BDN A;  5C5M A;  2IHE A;  4JI2 L;  2KQ3 A;  2E76 C;  3SGI A;  1ESF A;  1HCZ A;  5JJK A;  2BH8 A;  2ZJR A;  1RL2 A;  1EZ6 A;  2B39 A;  5FO7 B;  1HZC A;  5BR8 Q;  2VQF Q;  3NBH A;  5FLM H;  1M90 C;  3BJU A;  1WI5 A;  1AN8 A;  3I4L A;  1EY7 A;  2K5N A;  3UDG A;  1N36 L;  3O13 A;  1TQO A;  1LTI D;  2Z1C A;  4EGV A;  1MJE A;  4LF9 Q;  5T1I A;  5DAU A;  4A93 G;  3CMA A;  4DU9 A;  2EYF A;  2WB1 B;  4JI4 L;  4P75 A;  3TRE A;  4LF4 L;  1WTO A;  1II3 A;  4ZUI A;  1Y69 U;  3CCV A;  2M2L A;  3HOU B;  3CRK C;  4AYB B;  2YYZ A;  3MHB A;  4APV A;  2JEB I;  1DXM A;  4OIK A;  2QEJ C;  2EJG C;  1BCP F;  4BA2 I;  2WAC A;  1MIU A;  1VF5 C;  4RA8 A;  4RGO S;  2PQA A;  1JWS D;  1KXL A;  2KHS A;  4DR4 L;  3OMG A;  1SDF A;  2FJ2 A;  4L8J A;  3PQI A;  1KQS A;  1Z6H A;  4KY7 A;  1WOC A;  1YIT A;  3HRZ C;  5IP9 G;  3FPP A;  1TS5 A;  3TBI B;  3U9O A;  1A3T A;  5F2D A;  3RLN A;  1QCB D;  4DV6 Q;  5D65 A;  1GXD C;  2MNA A;  4RGN A;  3FVQ A;  3UDI A;  2Q2H A;  3MXP A;  4R4C A;  5KNC A;  2UUB L;  3CKI B;  2HIX A;  4G57 A;  4X62 L;  3TP5 A;  4KKT A;  1QZH A;  1FNW A;  1GUO A;  3M7N A;  3PUX A;  4JPB W;  2HCC A;  4IO9 A;  4KKS A;  2E2J H;  1I94 L;  1J8I A;  2R93 B;  1PRT D;  3RZO B;  2NTS A;  3GQB A;  3H94 A;  2MGS A;  2DY8 A;  3CQZ B;  4IOA A;  3QR8 A;  3LWE A;  1WCM G;  3NWS A;  1BXT A;  1YZ6 A;  3E9H A;  2UXD L;  1K73 C;  1V8Q A;  3I8Z A;  2CFM A;  4B3T L;  3K5M A;  1WTR A;  3JAM L;  2F4I A;  4KY6 A;  2JA8 G;  2GVB A;  2BOS A;  1CKN A;  5FLX E;  2B63 B;  4A3G G;  4DV4 L;  1XNQ Q;  1K8A C;  3H0G G;  2FMM A;  1KAW A;  1VQG A;  2VNU D;  2R93 H;  1KRS A;  2RHS B;  4A3B B;  1SJE D;  4MZ9 A;  3NTI A;  3T16 A;  2KCN A;  4A3I H;  5JEA G;  3CQZ H;  1Q1B A;  2CVR A;  1QOH A;  4P71 A;  5L37 A;  2R7Z B;  1MD2 D;  3R2I A;  5IWA Q;  4MN3 A;  1LLR D;  4C3H G;  3KJO A;  3FP9 A;  3PCO B;  2P5Z X;  4YWL A;  2RSN A;  1TWH B;  4GN3 B;  1EY9 A;  2KCM A;  2TSS A;  4JOI C;  4GNX B;  1WD0 A;  3C2P A;  3A56 A;  4ZK9 B;  5J39 A;  5A2Q E;  2EQS A;  3LWU A;  5DM6 3;  3SHL A;  3A5U A;  4JBK A;  1ZKO A;  4X64 Q;  5C4J B;  1W2B A;  2B3G A;  4Q0F A;  2MFI A;  1FL0 A;  5LMN L;  4K2L A;  1LAC A;  3LX0 A;  1E1T A;  1EY4 A;  2WIN B;  2R7Z H;  4OO1 H;  1TII D;  2PYK A;  1PYW D;  4NKL A;  1SFO B;  2I5M X;  3D0F A;  1ASY A;  3K8A A;  4UDU C;  2KUM A;  2GVA A;  1NBW A;  1TWH H;  4TSS A;  4P2C B;  5C4X B;  2VY3 A;  4OXP A;  4DV5 Q;  4LF5 Q;  2QGQ A;  1Q46 A;  3CF5 A;  3PO3 B;  2DGY A;  1U4P A;  3HOZ H;  2VZA A;  1HR0 Q;  1SJH D;  4RGT A;  1LV9 A;  3GTG B;  1N9W A;  3J7Z C;  2MHV A;  2EYO A;  3ERQ A;  1SFO H;  4Q5V A;  4X65 Q;  4QB4 A;  1NR4 A;  1F2Y A;  3CU7 A;  1HNW Q;  2XWB B;  3MFY A;  4DV2 Q;  3IAY A;  5C4X H;  3EIV A;  1PH4 A;  4X3U A;  3BDO A;  5FJ8 H;  4GN5 A;  4RCN A;  1JE4 A;  3RLO A;  2PZU A;  5G3L D;  1ASZ A;  4HJ8 A;  4QIW E;  3GTG H;  4KHP L;  1N32 Q;  5EAY A;  5LMN W;  3PF5 A;  3G6E A;  5LL6 S;  3UE1 A;  3S14 H;  3FKI B;  3JAM i;  5BN4 A;  2Q8T A;  2NVY H;  3S17 H;  4DR2 L;  4UPA A;  1B44 D;  4EQP A;  1HH2 P;  1HQM C;  1FR3 A;  1X32 A;  1EEF D;  1PZK D;  3LNN A;  3I4M H;  2F03 A;  3KJP A;  1VQE A;  1E2V A;  1E22 A;  2MPM A;  4A76 A;  2M9V A;  1Q86 C;  3T53 B;  5CMD A;  3M3Y H;  2ASB A;  5IE8 A;  1A3U A;  2F3V A;  5ELD A;  1UE6 A;  2EXZ A;  1U4L A;  1MSH A;  4N9P A;  3VYU A;  4ZKB B;  3G71 A;  2NN6 I;  4JI2 Q;  3NQT A;  1Q3L A;  4KHV A;  1SR3 A;  2ZT9 C;  3J81 E;  2UU9 L;  1EIH A;  4UP7 A;  4CKE A;  3KDF B;  1PXU A;  1SND A;  3ER0 A;  1TXY A;  4OL7 A;  2B2T C;  2B8G A;  2K50 A;  4K5W A;  3AEV A;  4CJ0 B;  3ERS X;  4DR1 Q;  4GN4 B;  3UDX A;  1QB5 D;  1JB3 A;  2A19 A;  1IKM A;  1HZB A;  5ELN A;  4CDF C;  4IOC A;  1EWC A;  3TRZ A;  2ZXP A;  3NSW A;  2MP1 A;  4JOI A;  3OMC A;  3GTJ B;  4A3D B;  1OXU A;  2Y0S B;  4DR7 L;  1BBW A;  1Q8K A;  4WRD A;  4BWG B;  4A3F G;  2Z6B A;  3NQI A;  2NVT B;  1K0S A;  1QJO A;  1V1O A;  4IUN A;  3CCS A;  2J7Z A;  5EPJ A;  2WKC A;  1SYB A;  2G9H D;  2PW7 A;  2KEC A;  5CR3 A;  1SNQ A;  4KHZ A;  2VQE L;  1Y14 B;  3DWP A;  2AQ2 B;  2Q8I B;  1SRO A;  5M5X H;  3JC6 6;  4IUU A;  2L55 A;  4GNX C;  1J6Q A;  5IYB H;  2B29 A;  3D4D A;  5E1F A;  1AE3 A;  3A54 A;  4A3D H;  2A8V A;  3I3C A;  4TKO B;  1GHJ A;  2BA0 A;  4DV3 L;  4LK1 C;  1VQI A;  2PQA B;  3BVM A;  1V1Q A;  3OTO Q;  2F0Q A;  1LO5 D;  1HXY D;  2XSC A;  2ZTC A;  3V2T A;  5EKK A;  4DV7 Q;  2OF1 A;  1SE2 A;  2Z8L A;  4NXM Q;  3BVZ A;  2SEB D;  1KDC A;  4B3T Q;  1HFG A;  2TMP A;  2JP1 A;  2K5V A;  5BR8 L;  1XPR A;  1KTK A;  3GDE A;  1HZA A;  4JI7 Q; 
#chains in the Genus database with same CATH homology
 3RLF A;  1F9R A;  3J80 L;  2EYM A;  2CHB D;  3MA2 B;  3D6C A;  4K5V A;  3Q0A A;  1L0X B;  3IFD A;  5IOC A;  2RVL A;  3BVG A;  1D5X C;  1I6H B;  3PV0 A;  2F0D A;  1CHP D;  4X3T A;  4ID6 A;  4DK1 A;  3SEB A;  4KTA A;  1SMY D;  4B9X A;  3KK7 A;  3QG1 A;  4A3K B;  4ZYS A;  3W3A A;  1LT5 D;  1STN A;  3HS0 C;  4PNY A;  3M7G A;  3TSS A;  4RWS C;  1ESR A;  1O7L A;  3VR2 A;  3PUV A;  2IX0 A;  2NN6 G;  3SK4 A;  4Y7N B;  5COY A;  5ELF A;  1IKL A;  3L3O C;  4KI0 A;  3K5N A;  5C3E B;  3TP7 A;  1B50 A;  3HOW B;  4PV1 C;  4H44 C;  1CT1 D;  3VR5 A;  4I65 A;  1VCI A;  3C3L A;  1HHV A;  4C3I B;  4MIU A;  2G9D A;  3GV3 A;  3T4A C;  2HDL A;  3I91 A;  3R93 A;  1PZJ D;  1JWM D;  4KD4 A;  3P75 A;  4A93 B;  1BCP B;  5KGU A;  2E2H B;  3TME A;  4KN7 C;  1KAB A;  4ZRZ A;  2B2V A;  3GTP B;  2XRS D;  1AEX A;  2IX1 A;  2WKD A;  4DN4 M;  3E6Z X;  3P1H A;  3V96 A;  4R9W A;  3J7A V;  1LTB D;  2IX3 A;  2LS0 1;  5KIX A;  2LFN A;  4IN3 A;  4PMW A;  1Y8O B;  2K03 A;  3RMH A;  1LAB A;  1U4R A;  4WOR A;  2L9H A;  1EY5 A;  1PFN A;  1JQY D;  1S5B D;  3GO5 A;  2KOL A;  2O5J C;  3BDC A;  3A7A B;  5FKA C;  1SAP A;  1CA6 A;  5FO9 B;  2EYP A;  4ZAI A;  1LTT D;  1F2Z A;  2A69 C;  4KN4 C;  3SK5 A;  3AB9 A;  3C1E A;  2A68 D;  3BS1 A;  1TS2 A;  1WTQ A;  3H0G B;  5CV8 A;  3D31 A;  4ODG A;  3IFT A;  1W6K A;  3M4O B;  1I4Q A;  4FXD A;  1QNU A;  3S1R B;  4C3H B;  1HA5 A;  1K8M A;  3WDN A;  2EY1 A;  5ELC A;  1H9K A;  4WFN 3;  3KLR A;  3VYS A;  4RKL A;  1IW7 C;  2QCP X;  5I2Y A;  3KUP A;  1ILQ A;  4FP5 D;  3EFX D;  3TZU A;  1TWC B;  2OEO A;  2F0L A;  5JEA H;  1AW7 A;  1BF4 A;  3WOE A;  5JEA J;  2EY5 A;  1HUN A;  1VF7 A;  3OHX C;  4X3S A;  1L0Y B;  4XIG S;  2L0C A;  2IPK D;  1A3V A;  1MI2 A;  1XXG A;  1M4V A;  1I4P A;  3DWQ A;  2ID0 A;  4EQO A;  3OWF A;  1HPC A;  1BCP C;  2A69 D;  2IW3 A;  4A3E B;  1HQR D;  1RJT A;  3FEW X;  1CZW A;  3KLS A;  1F77 A;  2FFK B;  4CHT B;  4DXG A;  5KYI A;  2HDM A;  4QF4 A;  1M8A A;  1O80 A;  1E0B A;  3NHH A;  4HED A;  1HUM A;  1KNA A;  4XDX A;  2RQX A;  1KLU D;  2EVB A;  1WTP A;  4DF7 A;  4DAP A;  3I4N B;  2E2J B;  1R4Q B;  5EKL A;  5AFW A;  2F1M A;  3TP6 A;  4IFD I;  4V0B A;  3AU7 A;  3Q24 A;  1O7Z A;  3UI2 A;  4ULL A;  4U67 3;  3JAM E;  5CGK A;  4LJZ C;  4RCO A;  1EQV A;  3T51 B;  1VDZ A;  1A6X A;  2F0P A;  2L11 A;  3J7Y W;  3VYR A;  3X3N A;  3KF8 A;  3SXH A;  1EL0 A;  5IGE A;  5IT9 L;  2QF7 A;  1I4G A;  2EJF C;  4U68 A;  1ICW A;  4A3I B;  4IUQ A;  2VXW A;  4L63 B;  1GHK A;  4CBV A;  1Q12 A;  5KEE A;  4PQX A;  4QIW B;  1OXT A;  2PPB C;  4M8A A;  4A3M B;  1C4Q A;  1BCP D;  3OSO A;  3QJY A;  1UAP A;  2WII B;  3OPO A;  1PFB A;  3QWN A;  1BQQ T;  3C1F A;  3H09 A;  2F0E A;  2F0J A;  3ITP A;  3MAQ A;  5C6A A;  5I4D A;  1PDQ A;  5BN3 A;  3HOZ B;  1H9J A;  2D2C C;  1TY2 A;  4DGZ A;  2IWH A;  3NP8 A;  4EVO A;  1STB A;  1JCK B;  3DEO A;  3MXU A;  4B9W A;  5M9O A;  3MFG A;  1B3A A;  5EBD A;  3BYY B;  1F9P A;  5EBC A;  2EYL A;  5C44 B;  3DXJ C;  1Q8I A;  3NUC A;  2HUG A;  1B53 A;  2R92 B;  4M1U B;  2O5I C;  4K8I A;  1WTW A;  2BCO A;  1QE6 A;  2X6L A;  4H0L C;  3S14 B;  4CKB A;  4RKB A;  2NVY B;  4K6D A;  3S17 B;  4KY5 A;  5CC4 A;  2B8F A;  1F2M A;  1BOS A;  3I4M B;  4RFB A;  2ZXO A;  2PZT A;  2A74 C;  2LMC B;  3M3Y B;  2CW0 C;  4Z9C B;  3I70 A;  4XT3 B;  4C56 C;  1YNJ C;  2K33 A;  2VB2 X;  4FO2 A;  4K5X A;  1PTO H;  4IFD G;  1SE4 A;  1SEB D;  4DK0 A;  1AP0 A;  4QUF A;  1ENF A;  2FMC A;  3OIP A;  2AQ1 B;  4HCE A;  1RF2 D;  5KND A;  2WP8 J;  5FK9 C;  3D4R A;  2WV6 D;  1GOZ A;  2NUC A;  1A2U A;  5M3F B;  4TRD A;  3VA5 A;  3A55 A;  2IJ0 A;  1GUW A;  1JOO A;  4DAY A;  4IUP A;  1H9S B;  1JIC A;  3D4W A;  5D14 A;  3G6J B;  2SNM A;  1HA6 A;  2QKI C;  5C0X I;  5TSS A;  5KNB A;  2NN6 H;  5M5X B;  3J7A F;  5CV4 A;  1Q1E A;  2NBF A;  1UNS A;  3URY A;  4EQN A;  1G2T A;  4R8I A;  2JA5 B;  3VR6 A;  5JOB A;  2K01 A;  3NK9 A;  1ENC A;  3RD4 A;  2K04 A;  1TS4 A;  3ZYY X;  1B2T A;  3HGB A;  1BDO A;  3K6O A;  1ILP A;  1EQT A;  1RDP D;  3A8J E;  2KCC A;  5E3F A;  1RTO A;  3OWE B;  4R8N A;  5ELB A;  2CW0 D;  3ND8 A;  2B2V C;  4FF2 A;  4OO1 G;  2PCF B;  2NZ1 D;  1YNJ D;  2NB0 A;  1DJR D;  5C3X A;  1E2W A;  3J80 E;  1GJX A;  5T1G A;  2KEE A;  2EY6 A;  3HG9 A;  4HSV A;  3NBI A;  2EPB A;  3A8I E;  2XNA C;  5I6W A;  2OT2 A;  3DHQ A;  3MEH A;  2F0K A;  4XXE A;  2AWN A;  4ZUJ A;  4KV6 A;  5IIF A;  1D6E C;  2RSO A;  3S1N B;  4V19 0;  4RGM A;  1G29 1;  4ILW A;  1NAP A;  1EZ8 A;  1PTO C;  2LKV A;  1CQV A;  1LTG D;  1ET9 A;  5C3W A;  1FD7 D;  4CKC A;  3VYT A;  5I2X A;  1PTO F;  1RKN A;  4XQQ A;  3ONA B;  5IGB A;  3BDL A;  1EU3 A;  3PIP 3;  2C9O A;  2E75 C;  3AMU A;  5I6Y A;  1IL8 A;  2O4X A;  2DNC A;  4S3S A;  5BN5 A;  3K57 A;  2IT1 A;  1KDA A;  1E2Z A;  1EWH A;  4KD3 A;  3SK8 A;  2B2U C;  3SVM A;  5M5W B;  3E0J A;  5E4X A;  2JA7 B;  2EZV A;  5EPL A;  1D1I A;  2I46 A;  3K5O A;  4BBR B;  4O1N A;  1F2L A;  1PMR A;  5ELE A;  1HTL D;  4ZQ3 A;  1O7Y A;  1SYG A;  2X6G A;  2OXP A;  5JVG 3;  1PRT B;  2K6A A;  2RDG A;  4KJN A;  5C0X G;  2NVX B;  5K36 G;  2X69 A;  5K5P A;  2KJX A;  4XT1 B;  4ABN A;  3S1M B;  3EVQ A;  5JPN C;  4BS9 A;  4DA2 A;  1GUG A;  1EFI D;  1GUS A;  3SK6 A;  1S5D D;  1B9M A;  4BY7 B;  1S5E D;  5CBE E;  3PIO 3;  5J1Z A;  3BG3 A;  5J22 A;  2QIL A;  1U4M A;  3NPP A;  4HN7 A;  4N9T A;  3CHB D;  2PQE A;  1MBY A;  3Q23 A;  1DCZ A;  1JOR A;  2F0T A;  2A6E C;  3L7Z C;  2GA4 B;  1RHP A;  2Q8R E;  2EOT A;  2WAQ B;  1DZ1 A;  1SNC A;  4DFA A;  2FIN B;  5D3D A;  1DON A;  1G6Z A;  4C1N I;  1X3Q A;  4E6I A;  3BYT B;  2NVQ B;  5C4H A;  1TR5 A;  1H9R A;  3X3M A;  1GUT A;  2F0S A;  1EY0 A;  1Y8N B;  1CQF A;  2B2W A;  4RHR A;  4RHS A;  2BE5 C;  1SE3 A;  2E74 C;  4F7X A;  2NYZ D;  2BDO A;  5CV7 A;  1IHZ A;  1S4Z A;  3MXG A;  4C2M B;  4HR7 B;  1WCM B;  4H7B A;  1D5M C;  5JVH 3;  3HEJ A;  3A7L A;  1ZEQ X;  4L6T B;  4HTH A;  1WD1 A;  4JK1 C;  1TY0 A;  2JA8 B;  1C48 A;  2F0U A;  1HTP A;  4A3G B;  3FPU B;  2EDG A;  2RDH A;  4B08 A;  1STE A;  3GTL B;  2CQA A;  1SNO A;  1SXT A;  1NCV A;  3Q6S A;  2K5W A;  1YNN C;  2K28 A;  2E2D C;  1V1P B;  3D6W A;  1S5C D;  1DOL A;  5I9O A;  2R6G A;  2B2U A;  1I50 B;  1BUV T;  2A6H C;  5EGT A;  1I6V C;  1EU4 A;  1H9S A;  4FYD A;  4X3K A;  5DEH A;  4HCS A;  5KRU A;  1PLF A;  1ZXT A;  2VUM B;  2A6E D;  5HUR A;  2R3Z A;  2J4X A;  1B9N A;  4LAA A;  1XYI A;  1S5F D;  1I4R A;  1TWA B;  1ROD A;  1NUC A;  3QOL A;  1KNE A;  1PRT C;  1TWG B;  3S1Q B;  2JSO A;  2YU9 B;  3VR4 A;  3SR1 A;  4RAU C;  4XYO A;  2BE5 D;  1VMC A;  2KVM A;  3S2H B;  3IKJ A;  4XYQ A;  1G91 A;  2DNE A;  4OGQ C;  1RD9 D;  3T56 B;  1AFP A;  3PUZ A;  2SDF A;  5CYU A;  4G7O C;  1PRT F;  3E5S A;  1STH A;  4C3I G;  1TWF B;  3SDZ A;  1EIG A;  1EYD A;  2L1B A;  2XN9 C;  1LT4 D;  5IT9 E;  2AUK A;  4OHJ A;  1EY6 A;  2RDF A;  4C1N K;  3K7A B;  1YNN D;  3PUY A;  4PMB A;  2JA6 B;  5FO8 B;  5FOB B;  2Z4H A;  2A6H D;  2RA4 A;  3R3O A;  1NR2 A;  1K8O A;  3I90 A;  3ND9 A;  3SE0 A;  1IW7 D;  5HGT A;  2EJM A;  1A2T A;  5JJZ A;  2V4D A;  3FRP B;  4YIJ A;  3MXN A;  3T13 A;  1Y1W B;  4TQU S;  5KYL A;  4IFD H;  5JAV A;  1V43 A;  1KAA A;  4IUT A;  1STY A;  1SNM A;  1CI3 M;  1FNV A;  2SNS A;  4IFD J;  1EY8 A;  2ZXR A;  2I07 B;  4CJ2 C;  2NTT A;  4FNF A;  1OXV A;  1R9T B;  4JBW A;  2J0T D;  4H13 C;  1H9M A;  2L4N A;  1X3P A;  4A3F B;  3C46 A;  2LY7 A;  2F0M A;  1SSO A;  1UUP A;  3KBX A;  3EQL C;  2E2I B;  1CZG A;  1RCV D;  1TT2 A;  1JOQ A;  1SYF A;  3G7L A;  4F8M A;  5EJW A;  1BR9 A;  3FMC A;  3GP7 A;  1ML0 D;  4ZKC B;  4G4K A;  2KED A;  1FYC A;  1LT3 D;  3QOJ A;  4OO1 I;  5G3L F;  4C3J G;  3OOC A;  2B2Y A;  4NDX A;  1BBX C;  2JYO A;  3GTM B;  3NTK A;  4O42 A;  1QNK A;  5JPM C;  1EYA A;  1EYC A;  2XIW A;  5CV9 A;  3MC0 B;  1SBB B;  1F9Q A;  2MUY A;  1G2S A;  5FLX L;  1Q90 A;  1BO0 A;  1ET6 A;  2R61 A;  4DAV A;  1WTV A;  4F87 A;  2O2L D;  1PTO B;  4K2K A;  5A2Q L;  4FXG C;  2QDB A;  3S2D B;  3VA7 A;  4IUV A;  1CTM A;  3GV6 A;  3RZD B;  1O78 A;  4K8J A;  4PMC A;  3TP8 A;  2N88 A;  4RH6 A;  2L12 A;  4UAI A;  4BY1 B;  3D3R A;  5EQ0 A;  4IUR A;  3HOY B;  2IL8 A;  3DEP A;  2RBM A;  1TVX A;  3A8K E;  3N6R A;  2D9U A;  2VB3 X;  4IAL A;  1I3Q B;  1IYV A;  1DYQ A;  2N55 A;  4LMQ D;  3HKZ B;  3MTS A;  5IGF A;  2M00 A;  2K5Q A;  4IQZ A;  1J9O A;  2KA7 A;  1CHQ D;  4WJW A;  3Q22 A;  3MWY W;  4GZY C;  1XX8 A;  2MJ8 A;  2DY7 A;  1B4O A;  2PW5 A;  3TDQ A;  1MSG A;  2FHT A;  5IGG A;  2HCI A;  2PO4 A;  1V1P A;  3NTH A;  5CV6 A;  2EY2 A;  1SYE A;  3VR3 A;  2RKS A;  1QG7 A;  1QIL A;  3P20 A;  1Z7T A;  2EYH A;  1JR0 D;  3P7J A;  4J1M A;  4KKU A;  5C0X H;  1BNZ A;  5K36 H;  1JWU D;  1CFM A;  3GD7 A;  5C0X J;  1U9R A;  3I72 A;  4HMI A;  4F88 A;  1ENA A;  2F0H A;  2ICI A;  3KBG A;  1B1Z A;  4HSP A;  1D2B A;  1SMY C;  1VMP A;  2F0V A;  2Z4I A;  2SOB A;  4XQJ A;  3J81 L;  2K05 A;  5LHY 1;  5M5Y B;  3HZX A;  3R8B A;  1HFN A;  3D8G A;  2AQ3 B;  3PUW A;  1SYC A;  3EJI A;  2H4O A;  1CK1 A;  4FVM A;  3M4Y A;  1LT6 D;  2XRQ D;  3ERO A;  1UEA B;  2PZW A;  4BBS B;  3TZD A;  3FDT A;  1RTN A;  1STA A;  4NW2 A;  3V05 A;  1LTR D;  1A15 A;  3HOX B;  1ZYR C;  4FXK C;  5CBA E;  3NWT A;  1JOK A;  1K83 B;  2B2W C;  4MHE A;  3HOV B;  3M85 A;  1LTA D;  5IGD A;  1EEI D;  1WVL A;  2AWO A;  3L9A X;  4J6H A;  3WOF A;  3N52 A;  1WTX A;  1DOM A;  5E4W C;  1AZQ A;  4ME5 A;  5EKI A;  4J8Q A;  1XWE A;  2JE6 I;  1FGB D;  2A73 B;  3HP3 A;  5CV5 A;  1Y8P B;  2F0W A;  4DNT B;  3GTK B;  1W6J A;  2BA1 A;  5IOD A;  1OXS C;  1T5E A;  4FF1 A;  4IZ8 A;  4QMG A;  4XTC S;  4A3J B;  1T5X D;  1D5Z C;  1CA5 A;  2EE1 A;  1SYD A;  4CGY B;  3K5L A;  4HAE A;  5ISR A;  5I9P A;  2DN8 A;  2JXM B;  1TU2 B;  4DXF A;  4KMU C;  2B2T A;  2HQE A;  2A5H A;  3K0Y A;  5NUC A;  4KJO A;  3EA6 A;  1I4X A;  3RUZ A;  2L5T A;  2EYJ A;  4OIJ A;  1STG A;  3OW7 A;  2H1E A;  2F0F A;  4QCL A;  4HMJ A;  2A68 C;  3K58 A;  5DM7 3;  4NMZ A;  3BZD B;  2D62 A;  4I7Z C;  1KLG D;  1PFM A;  2PNR C;  3DMU A;  1I4H A;  1ZYR D;  5C4Z A;  3S15 B;  1PTO D;  4CJ1 B;  5IGC A;  3PO2 B;  2ICE C;  5C5L A;  1KDB A;  3TN2 A;  1IYU A;  3NE5 B;  2F0I A;  4FF3 A;  3GTO B;  2JEA I;  2D5D A;  5M3M B;  3MVV A;  5COR A;  3S16 B;  1EOT A;  3IL8 A;  3S9W A;  3DWA A;  5LL6 X;  1MGS A;  1JC7 A;  4K6L A;  2XVS A;  2F3W A;  3OIQ A;  1HRJ A;  3DM1 A;  4BA1 I;  5A35 A;  1GUN A;  1C8C A;  2F0N A;  1TS3 A;  4QUC A;  2ENB A;  3PMF A;  1OXX K;  3KLS X;  4NP5 A;  2F0O A;  1AZP A;  2C5C A;  3W2D A;  5D3I B;  1OO9 B;  1LTS D;  2K32 A;  4K14 A;  4DNR B;  3K59 A;  2K1B A;  2F0G A;  3H6M A;  3CRL C;  1G8Z D;  3QB3 A;  1TKW B;  1Z47 A;  4ZLT F;  1D1K A;  1DM0 B;  3H91 A;  3DUZ A;  5EPK A;  2XWJ B;  1NSN S;  1SNP A;  4FF4 A;  1ONL A;  1CM9 A;  2K5D A;  1XTC D;  3R2T A;  4C3J B;  3QO2 A;  5DNF A;  1PZI D;  2NWG A;  1F9S A;  2PMZ B;  3GTQ B;  1DD2 A;  1QWY A;  4XQN A;  3U9S A;  3NXW A;  4G7H C;  1Y1V B;  4G7Z C;  3H3V C;  3MZ5 A;  2B2Y C;  3I73 A;  2AUJ D;  1DOK A;  4KK7 A;  1R4P B;  3QIA A;  2K7V A;  1FNU A;  3F2U A;  2BDN A;  5C5M A;  2KQ3 A;  2E76 C;  1ESF A;  1HCZ A;  2B39 A;  1EZ6 A;  5FO7 B;  3NBH A;  1AN8 A;  3I4L A;  1EY7 A;  3O13 A;  1TQO A;  1LTI D;  2Z1C A;  4EGV A;  5T1I A;  5DAU A;  4DU9 A;  2EYF A;  2WB1 B;  1WTO A;  1II3 A;  4ZUI A;  1Y69 U;  2M2L A;  3HOU B;  3CRK C;  4AYB B;  2YYZ A;  3MHB A;  2JEB I;  1DXM A;  4OIK A;  2QEJ C;  2EJG C;  1BCP F;  4BA2 I;  2WAC A;  1VF5 C;  4RA8 A;  4RGO S;  1JWS D;  2KHS A;  3OMG A;  1SDF A;  2FJ2 A;  4L8J A;  1Z6H A;  4KY7 A;  3HRZ C;  3FPP A;  1TS5 A;  3TBI B;  3U9O A;  1A3T A;  5F2D A;  1QCB D;  5D65 A;  1GXD C;  4RGN A;  3FVQ A;  3MXP A;  5KNC A;  3CKI B;  4G57 A;  3TP5 A;  4KKT A;  1FNW A;  1GUO A;  3M7N A;  3PUX A;  2HCC A;  4KKS A;  1J8I A;  2R93 B;  1PRT D;  3RZO B;  2NTS A;  3GQB A;  3H94 A;  2MGS A;  2DY8 A;  3CQZ B;  3LWE A;  3NWS A;  1BXT A;  1V8Q A;  3I8Z A;  3K5M A;  1WTR A;  3JAM L;  2F4I A;  4KY6 A;  2BOS A;  5FLX E;  2B63 B;  2FMM A;  2VNU D;  4A3B B;  1SJE D;  3NTI A;  3T16 A;  2KCN A;  5JEA G;  1Q1B A;  2CVR A;  1QOH A;  2R7Z B;  1MD2 D;  3R2I A;  4MN3 A;  1LLR D;  4C3H G;  2RSN A;  1TWH B;  1EY9 A;  3C2P A;  2TSS A;  1WD0 A;  3A56 A;  4ZK9 B;  5J39 A;  5A2Q E;  3LWU A;  5DM6 3;  3SHL A;  1ZKO A;  5C4J B;  4Q0F A;  4K2L A;  1LAC A;  3LX0 A;  1EY4 A;  4OO1 H;  2WIN B;  1TII D;  2PYK A;  1PYW D;  4NKL A;  1SFO B;  4UDU C;  2KUM A;  4TSS A;  4P2C B;  5C4X B;  3PO3 B;  1U4P A;  1SJH D;  4RGT A;  1LV9 A;  3GTG B;  2MHV A;  2EYO A;  3ERQ A;  4Q5V A;  4QB4 A;  1NR4 A;  1F2Y A;  3CU7 A;  2XWB B;  3MFY A;  3IAY A;  4X3U A;  3BDO A;  4RCN A;  1JE4 A;  2PZU A;  5G3L D;  5LL6 S;  3FKI B;  5BN4 A;  2Q8T A;  1B44 D;  4EQP A;  1HQM C;  1FR3 A;  1X32 A;  1EEF D;  1PZK D;  3LNN A;  2F03 A;  1E2V A;  2MPM A;  2M9V A;  3T53 B;  5CMD A;  1A3U A;  2F3V A;  5ELD A;  2EXZ A;  1U4L A;  1MSH A;  4N9P A;  3VYU A;  4ZKB B;  2NN6 I;  3NQT A;  1Q3L A;  4KHV A;  2ZT9 C;  3J81 E;  1EIH A;  4CKE A;  1PXU A;  1SND A;  4OL7 A;  2B2T C;  2B8G A;  4K5W A;  4CJ0 B;  1QB5 D;  1JB3 A;  1IKM A;  1EWC A;  2ZXP A;  3NSW A;  2MP1 A;  3OMC A;  3GTJ B;  4A3D B;  1OXU A;  2Y0S B;  4WRD A;  4BWG B;  3NQI A;  2NVT B;  1QJO A;  1V1O A;  4IUN A;  2J7Z A;  5EPJ A;  2WKC A;  1SYB A;  2G9H D;  2PW7 A;  2KEC A;  5CR3 A;  1SNQ A;  4KHZ A;  3DWP A;  2AQ2 B;  2Q8I B;  4IUU A;  2L55 A;  3D4D A;  5E1F A;  3A54 A;  3I3C A;  4TKO B;  1GHJ A;  2BA0 A;  4LK1 C;  3BVM A;  2F0Q A;  1LO5 D;  1HXY D;  2XSC A;  3V2T A;  5EKK A;  2OF1 A;  1SE2 A;  2Z8L A;  3BVZ A;  2SEB D;  1KDC A;  1HFG A;  2TMP A;  2JP1 A;  1KTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...