2F0MA

Crystal structure of staphylococcal nuclease mutant v23l/i72v
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0mA00
1EY9A 3MHBA 2EYOA 4NDXA 3TP7A 3NK9A 2EY2A 2F0MA 1TR5A 1F2ZA 1TQOA 2ENBA 4ODGA 5J39A 2EYPA 2F0SA 4OL7A 2M00A 1STAA 3C1FA 4LAAA 4NMZA 1U9RA 3D4WA 4DGZA 5C4ZA 4WRDA 5IGCA 4IALA 3QOJA 2PQEA 3E5SA 1KDBA 4N9PA 3SR1A 3VA5A 4EVOA 2RKSA 1SYFA 4ZUJA 2OXPA 1SNOA 2EXZA 5ISRA 2PW5A 4N9TA 2SNMA 2F0KA 2F0WA 4ZUIA 1SNMA 2F0IA 5K5PA 4EQPA 2PW7A 3NHHA 3MEHA 5IIFA 1JOKA 2NUCA 1ENAA 2KHSA 3OMGA 3OWFA 3NQTA 3QB3A 4H7BA 4K2KA 5CV7A 5C5MA 5KYIA 5CC4A 5HURA 2EYLA 5E1FA 4KJOA 3DMUA 3SXHA 4QB4A 2LKVA 5KEEA 1EY6A 4IZ8A 1SYCA 4PMBA 2F0EA 1SNQA 1F2YA 4YIJA 1IHZA 2HQEA 3HZXA 1KDAA 1STGA 1SYBA 4K5VA 5IODA 5EKKA 2EY5A 1JOOA 2EY1A 1A2TA 3PMFA 4IUNA 5J22A 3R3OA 4ID6A 3NUCA 2F0TA 2SNSA 3EJIA 5EGTA 4NP5A 3ERQA 3S9WA 1STYA 1SYEA 5KRUA 1NUCA 1STHA 2RBMA 3MZ5A 4NKLA 3ITPA 3P75A 2F0JA 2RDFA 2PZUA 3U9OA 4QMGA 4PNYA 5F2DA 5M9OA 4EQNA 3C1EA 4KTAA 4MIUA 4RKBA 4K6DA 1EQVA 5JOBA 1II3A 4KY7A 4K2LA 4KJNA 5IGGA 1SYDA 1EY0A 1EYCA 1KAAA 1EY4A 4EQOA 2F0DA 2EY6A 2PZWA 1SNPA 4K8IA 5JAVA 3D4DA 4HMIA 2OF1A 2PYKA 3BDLA 3D6CA 2EYFA 2F0OA 2WACA 1EY8A 4QF4A 5I9OA 5NUCA 5DAUA 5C5LA 5IGDA 1ENCA 3D8GA 3MVVA 3T13A 3H6MA 3P1HA 5KYLA 3SK5A 5HGTA 5I9PA 5C6AA 4DFAA 1NSNS 2F0PA 3DHQA 1A3TA 5C3WA 1KDCA 3SK6A 4HTHA 5DEHA 5CV4A 2OEOA 5CV9A 3NP8A 4PMCA 1RKNA 1SNDA 2PZTA 1STBA 4KHVA 4DF7A 4E6IA 5IGEA 3HEJA 1JOQA 5IGFA 1AEXA 3TP8A 2F0HA 4KY6A 5I6YA 1TT2A 3TP5A 4R8NA 5KGUA 2SOBA 4KV6A 3T16A 5I6WA 4TRDA 4S3SA 1A3UA 4K5XA 4DU9A 4ZQ3A 1A2UA 4I65A 4J6HA 3TMEA 2F3WA 3RUZA 5IGBA 4KD4A 2F0QA 3SK8A 2F3VA 2EYMA 5EKLA 2QDBA 4RKLA 2KQ3A 3LX0A 2O4XA 4KY5A 1SYGA 2F0LA 5CV8A 1STNA 5C3XA 5J1ZA 3TP6A 3OSOA 5CV6A 5KIXA 5IOCA 1F2MA 2F0VA 3NXWA 4HMJA 1EY7A 2F0NA 2EYHA 5CV5A 1JORA 1EZ6A 4F7XA 4J1MA 5E3FA 3MXPA 4K5WA 3SK4A 4K8JA 4ME5A 3V2TA 3QOLA 1EZ8A 4G57A 4KD3A 3EVQA 1EY5A 2EYJA 1A3VA 1SNCA 2F0UA 3BDCA 3OMCA 3SHLA 4K14A 2F0FA 4F8MA 1EYDA 5C4HA 5CGKA 5CR3A 2F0GA 4WORA 4B9XA 4B9WA 3EROA 1KABA 1EYAA
chains in the Genus database with same CATH superfamily
2UUCL 1EY9A 2HCIA 2K5NA 4BBRG 3NK9A 5A2QE 1V1OA 1HZBA 1Q81C 3WOFA 2YTXA 3GV6A 4LUVA 1NAPA 5JVG3 5TSSA 2PQEA 2TMPA 3TN2A 4FO2A 3OTOQ 4ZLTF 1DM0B 3N6RA 1KHIA 5CV7A 4A3CG 2YTVA 1EWHA 3BG3A 1F9PA 1QVGA 3DMUA 4QB4A 3U9SA 3CHBD 3KF8B 4JBMA 3Q24A 4GKJQ 2WB1B 4EX5A 1PVOA 4L6TB 5JPMC 1Z7TA 4ID6A 1LTLA 3S9WA 2E2IH 4DNRB 3KLSA 1QVFA 1R4QB 4EQNA 1OXTA 3I4MB 2Y0SG 1VQBA 3S1RH 4LF4Q 1WCMH 4L63B 4DR6Q 2F0DA 2OWOA 5C0XI 1CTMA 3A7AB 4DV0Q 4TQUS 4QF4A 3VR6A 4OX9Q 3H94A 1F9QA 4A3IB 2IJ0A 1C4QA 2EOTA 2NN6I 4KN4C 5C4XG 1YBYA 3HS0C 1GD7A 1ILQA 1GOZA 2OEOA 4IN3A 4DN4M 1EQRA 1Z9FA 2JQOA 1YEZA 1K0SA 1PZJD 4RAUC 3RD4A 4XT1B 2PO4A 3OIPA 2EQSA 4K5XA 3I90A 1OXUA 2BDOA 3BVGA 4KD4A 4BY7G 3NELA 1IBKQ 1TWHB 1PRTD 4J8QA 3OSOA 1PH4A 4HMJA 4P75A 1Q1EA 3AFPA 1VQLA 2Q8RE 1F2LA 4QL5A 4ZKBB 1Q12A 2B2WC 4C3HG 1O7LA 2HIVA 2L1BA 4UP8A 3V2TA 5LMNL 1EZ8A 1PZKD 2KEDA 2KCTA 2NVXB 1A3VA 2B3GA 2WB1E 4X65L 3MTSA 2JA6G 1I6VC 1NY4A 4GNXC 1HQRD 1KABA 2NWGA 4PZ7A 2UUAL 2MUYA 3B6YA 2Z0SA 1ET6A 3KLRA 2WINB 1D5MC 2M00A 5IGCA 2N88A 3D4WA 3H0GG 4ABNA 1YJNA 1W2BA 1KDBA 1Q90A 4N9PA 4EVOA 2BA0A 1GUSA 2D9UA 1EU3A 4YCUA 2PW5A 3HKSA 3W1BA 1VQ8A 4HR7B 2NVQB 2UXDL 2ES2A 4K6LA 2LXJA 3NQTA 4DR4L 4A3GG 3PO2G 4C1NI 5E1FA 2VB2X 3HOVB 1IHZA 1TWFH 4RGNA 1TKWB 2I5LX 1L2FA 3CCQA 2LY7A 3VYRA 1SJED 2JJQA 5AJ3L 1V8QA 3DLLA 2G9HD 3RZDB 4DAPA 1GHJA 4ILWA 3UDGA 1S5BD 2WIIB 4Q0FA 1WTWA 2NN6G 3H3VI 1B8AA 5GROA 1SAPA 2PZUA 4R8IA 4V190 2B63H 2EVBA 4AYBG 4R4TA 5M3FG 3S17B 4OO1H 4GNXB 1STEA 1ZKOA 1S5FD 1F9SA 2PQAB 5GAGC 4JV5L 1QCBD 3BDLA 2WV6D 3D31A 1PH5A 2QKIC 2Q8IB 3T13A 3A8JE 4GLXA 3CC2A 1XNRQ 4OGQC 3C3LA 3GTLH 4A76A 1I4PA 4DUYQ 1AZPA 5EBCA 4P71A 4IURA 4KKTA 5EKIA 1YJWA 2R7ZB 3M3YH 2VQFL 5KGUA 1GKHA 4PMWA 5I6WA 3GQBA 4S3SA 1A2UA 1BF4A 2X6GA 3CMAA 2R93B 4B3SL 4AIMA 3GDEA 2MGSA 1SLJA 4R1JA 1T5XD 1SFOH 2K04A 1S5DD 1FVIA 1E2WA 1SE2A 5C3XA 2F03A 2HDLA 2CW0C 4HCEA 4FF3A 1E0BA 1AE3A 2N49A 3T1YQ 1IXRA 3CKIB 5LMUL 1TWGB 3IFTA 4YWLA 1ZYRD 1O78A 5C44H 3X3MA 1OTCA 4DAYB 4LNQA 1G91A 1GXDC 1J5EL 1NNXA 4LF9Q 3SHLA 2O5JC 3BDCA 1W6JA 5CR3A 4B9WA 2SEBD 3P7JA 3GTPB 2K5QA 3KF6B 3AU7A 1YIJA 3NEMA 1TR5A 3CRKC 5CBEE 4JI5Q 3KUPA 1I5FA 1HNXQ 4A3EG 1DZ1A 1QJOA 1V9PA 5IYDH 2ZJRA 2OXPA 2SNMA 1CKNA 3PIP3 2QCPX 3P20A 3CF5A 1VQ5A 3NHHA 5M5WH 3HOXG 4JI3Q 5M5YB 4DKAC 3WDNA 1NJIC 1F2YA 5M5XB 2A5HA 2HQEA 3M4QA 2KECA 3HZXA 1LTBD 2XGTA 5I2YA 3K5NA 1FNUA 4QGUA 1KL9A 1U4RA 4GOPA 4A3KH 4QQBX 5K36G 4R4OA 3OTOL 2GN5A 1B2TA 4K6DA 2EDGA 4FNFA 4LF5Q 4C56C 1UAPA 3VR2A 2LMCB 2I5HA 5IP7G 4OWXB 1WTOA 4GKJL 3K7AB 4ALPA 4A3DH 3R2TA 4X6AH 2JN4A 3KBXA 1E3PA 4R4IA 3MFGA 2LXKA 1KNEA 5IYCH 2B2UC 3CCRA 3HG9A 3K57A 1SE8A 4LF4L 1TWCB 4KHZA 3TP8A 4CDDC 4DV2Q 1HR0W 1PRTB 2CWAA 4MN3A 3ICEA 4R9WA 3S14H 4DV0L 3TMEA 2F3WA 5FJ8H 4B3RQ 4U68A 1VQEA 4GLAC 4OX9L 2WP8J 3LX0A 3U58A 1TY2A 4B3TQ 4WJ4A 1HHVA 4KKUA 4BBRH 4C2MH 1SMYC 1YI2A 1LABA 4ULLA 3J7A5 3S16H 1HFGA 4J1MA 1I6HB 1Y1VH 4KHPQ 4A93B 1EFID 3MFYA 4LMQD 5FK9C 3D3RA 1QUQA 1ESFA 1VQIA 2A6ED 4M1UB 2JA8G 4BWGB 1EYDA 4A3CH 2KCNA 2ATWA 1IBKL 2QW7A 4K0KL 1Z47A 1Q82C 1PYSB 3FRPB 3NBHA 1Q1BA 4DK0A 2ZTDA 4B08A 2AMCB 1B1ZA 2X6LA 5FLXL 3MEHA 2NUCA 2H5XA 2L9HA 2IHEA 4Y52H 5E4WC 3PGZA 2R6GA 2QF7A 2CFMA 1K3BC 3NTHA 5J22A 1SN8A 2F0TA 3E0EA 3ERQA 3ERSX 2MHVA 3LGJA 2E2IB 3E3XA 1ZYRC 3P75A 1EFWA 4BA2I 2ZTCA 4UP7A 4POFA 4FXGC 3A56A 5C4XH 3ZJYC 2EXDA 5IY0A 1WCMB 5D3DA 2SDFA 2MO1A 2OCEA 4A4IA 4KMUC 3S1QH 1Q86C 2WKDA 1TXYA 1X32A 3RN2A 3O13A 5EBDA 2DUDA 4LFCQ 3TS2A 4BY7H 1HTPA 4PG3A 1WD1A 1PZID 3NP8A 1SNDA 5FO7B 5KNDA 5KNCA 1A3UA 1PTOH 4C3HH 1VDZA 1YHBA 2Z6KA 5JJIA 1GHKA 2PI2E 3BDOA 2O4XA 3AEVA 5LMNW 1XNRL 2JA6H 5ELBA 2B63G 3J7AF 3OOCA 2D62A 4DUYL 4UAIA 1PFSA 3H0GH 2RQXA 1VQOA 2Z9HA 4GLVB 3BJUA 3SK4A 2BE5C 2A69D 2L5TA 2M2LA 1UWVA 4L5QA 3DEPA 4K14A 4F8MA 2K75A 4A3GH 4P74A 3PO2H 2B29A 1SMXA 2K5WA 2K05A 4CKCA 5M3MG 4OWTB 5C4ZA 1PFNA 1S40A 3KFUA 5ISRA 4DR1Q 2ASBA 1SR3A 4A3FH 2PNRC 1IYJB 3RN5A 4RFBA 3NQIA 2NN6H 3FVQA 1GVPA 3KF8A 5KYIA 1IBMQ 1CT1D 3R93A 3VYSA 3S1MH 5C3EG 2Q2HA 1SYCA 5M3FH 1WTHA 5IWAQ 4XIGS 1RF2D 1TWFB 1PTOF 1EOTA 2KCMA 5EKKA 4JI5L 5EGTA 2K5DA 1HNXL 4UY8C 3TREA 1M8AA 2EE1A 2XRQD 4XTCS 2Z1CA 4DA2A 1D5ZC 1VQ4A 4HJAA 4GZYC 1K9MC 4RKBA 4POGA 1II3A 1DYQA 1I4XA 4K2LA 4YCWA 2A6EC 4LFAQ 1PYBA 4JI3L 1HZ9A 2WAQB 1RODA 4PZ6A 1QNUA 2YTYA 1ICWA 5IGDA 3MVVA 4C3JH 3TEHB 4A3BG 1YNXA 1NSNS 1B3AA 4XYQA 3JC66 3GTLB 3RZOB 1TWAB 1IKMA 4O2DA 5EQ0A 3VYTA 2Z6KC 1RKNA 3HKZG 1PH1A 3AQQA 2BH2A 3HFZB 4J15A 3M3YB 4LF5L 3W3AA 4GKKQ 1EQTA 4KV6A 1X65A 4ZK9B 2E75C 4JC0A 2IX0A 2K7VA 1W3SA 3SK8A 5EKLA 2BH8A 4A3KG 1I3QB 1X3FA 1SFOB 5L37A 1D1KA 3GTKH 1HQMC 3PV0A 3H15A 1F2MA 1XMOQ 3X3NA 3I8ZA 3AB9A 5EJWA 4BBSB 5E3FA 1X9NA 3D4RA 4DK1A 4A3EH 4DV5Q 2RDGA 4C1NK 1B9MA 4O0AA 3CC4A 4BY1B 1LO5D 4DV2L 2MP1A 3NWTA 4RH6A 3FKIH 4CKBA 3HOXH 4KLKA 4WORA 3F1ZA 4B3RL 4EQ5A 4JOIC 3C1FA 1MI2A 1HR0L 4X62Q 2RKSA 1K83B 5JEAJ 2F0WA 3QO2A 1SNMA 5ELFA 2R7FA 1V1QA 1Q8IA 4EQPA 2WAQE 1CUKA 3OW7A 2K28A 3OWFA 1Y8PB 4WFN3 5M5WB 2I46A 2LS01 1H9JA 5FJ8G 1XX8A 5K36H 3MC0B 4IPGA 3HOWH 4YIJA 3VYUA 2E2JH 2FXQA 1HJPA 2HDMA 4H02A 1RTOA 1LV9A 1XYIA 4WJ3M 2C5CA 2KOLA 5IP7H 3VR4A 3I4MG 2CWPA 1Y1VG 2JA7G 2V4DA 5F2DA 4GNXA 1BCPD 2A69C 4MIUA 2K50A 4YWMA 3PUXA 5DM63 1IKLA 5FO9B 2NVTH 3KYHC 3IRBA 4JI7Q 4K8IA 4P73A 2JA5B 1TS3A 2ZXPA 3FPPA 2JE6I 5DAUA 4JI4Q 3P1HA 3SK5A 5I9PA 1H9RA 1LYLA 1L0XB 3OIQA 1CQFA 3MXGA 2IX1A 5C3WA 1KDCA 3SK6A 1VQ6A 1EWIA 1X56A 4XT3B 3GTQH 1XTCD 1DONA 2E74C 4ZCKA 4IJLA 4LW1A 3E6ZX 3QIAA 1LTAD 1X3QA 4NPSA 1O80A 3LWUA 2JA8H 1TU2B 3CW2C 4BA1I 2HHHQ 3LWEA 4R4QA 4DV7Q 4LFCL 2C9OA 3F2DA 2VY3A 4C2MB 4LF7Q 1S3OA 2YYZA 3FEWX 1JORA 4DAYA 5FLMG 1HNWL 3KOJA 1VQPA 3J80L 2Z6BA 3ND9A 2HT1A 2JXMB 1IZ6A 4CJ2C 3PIPA 4UPAA 1KLUD 3QJYA 1CK1A 1OXSC 5C4HA 4X66Q 3M4OH 4B9XA 4DV1Q 2AWNA 3RLOA 4MNOA 4L8JA 2NBFA 2EY2A 1HZAA 5J39A 4HJ7A 1QWYA 2J7ZA 1Y14B 2IPKD 2K52A 5GQOA 2EXZA 1BBXC 2V1CC 1NMGA 2IWHA 2R92G 3JAME 2F4VL 5JPNC 4HIKA 1N32L 1ZXTA 1RJTA 1QVCA 2DJGC 3V05A 2HIXA 2R61A 3SXHA 1DJRD 1SE3A 1Y69U 1HFNA 3DWQA 4JI8Q 1EWCA 3HRZC 1I4QA 4CGYB 3BVZA 1WTVA 2Z4HA 3I4NG 2ALYB 2E8GA 4B3ML 3PIO3 1B3QA 1U5KA 2ZT9C 3G4SA 4NXMQ 1RDPD 1STYA 1NUCA 1MHWC 2F0JA 2RDFA 4DR3Q 1LTTD 2JEBI 4CDFC 4DR1L 2FFKB 4KTAA 4FP5D 5EPJA 3T56B 1HNZQ 1P16A 1IBML 1JB7A 3MXUA 4UP9A 1QB5D 3VDYA 3S24A 1BDOA 2NZHA 4A75A 3S1QB 2XNAC 5JJKA 5IWAL 3KLSX 2KVMA 5NUCA 4LF8Q 3T4AC 4LJZC 4DV4L 4JG2A 1HCZA 3CPWA 1VQKA 3FDTA 2F3IA 1X3PA 3STBD 4A3FG 3PF5A 4DV6Q 4I7ZC 4LF6Q 1EEID 3K80C 4HAEA 5IT9E 2ID0A 1YNNC 3I56A 1DCZA 1PH7A 2F0HA 4LUZA 4XQJA 4LFAL 1PH3A 3T16A 3CD6A 4FF2A 4HIOA 5IGBA 4I65A 3S1NH 3HOUG 2F0QA 2VL6A 1CKOA 5EAYA 1VQNA 2VXWA 3CQZH 3WOEA 4IUQA 1H95A 1SYGA 3K81C 4MTKA 1N8RC 2E5LQ 1CA6A 4ZAIA 4GN5A 1B7YB 1B53A 3ONAB 2BDNA 3U50C 2ZXOA 4CHTB 5M3MH 1A6XA 2VQEQ 3H0GB 4HSVA 4AH6A 2XN9C 5JEAH 1G2TA 1PH6A 1C7YA 1VQHA 4QIWB 3F8TA 2UUBL 1JQYD 2B2UA 3A0JA 2OQKA 5DNFA 4DPGA 5CGKA 1UE5A 4RG1A 4C3JG 2UU9Q 1N9WA 3BZDB 1G8ZD 4A3GB 4XQQA 2PI2A 1FR3A 4RCNA 2FMCA 5C3EH 1VQFA 1BBUA 2ZTEA 4LAAA 4Y7NH 2A73B 1XMOL 3E5SA 5IGEA 1B50A 4M8AA 1EUJA 4YWKA 1CSQA 4I7AA 4N9TA 2ICIA 4DV5L 2PW7A 3CP0A 3OMGA 4H7BA 4UDUC 1X3GA 1XPUA 1N36Q 5ELOA 3ER0A 2HD3A 4AYBB 1UEBA 5M3FB 1RL2A 5IT9c 1STGA 4TKOB 4GN4B 1BCPB 4JBWA 3R3OA 4WJWA 4A3JB 4DK6C 4NP5A 1H9KA 1PLFA 4NXNQ 2L4NA 4OONA 1STHA 4AQYQ 4JI1Q 3ITPA 4X62L 1BQQT 1O7ZA 2N55A 4QMGA 2DN8A 1A8VA 4A3BH 2B8FA 2K5HA 2IL8A 3RLFA 3FKIG 1H9SB 3HGBA 4U673 1D7QA 3CCLA 4X64Q 2R3ZA 1JE4A 1YNJD 2PCFB 1EIGA 1JC7A 1EY8A 5I9OA 3H3VC 2EIFA 2J0TD 1PRTC 4N8X1 5C6AA 3MWYW 2F0PA 3TZDA 3H09A 2FMMA 2K1BA 3S2DH 4RHRA 3RMHA 1F9RA 1LT6D 1MJCA 1SSOA 1QILA 3G71A 1MD2D 4QIWE 1ENFA 5I6YA 3A8KE 3GTOH 4KY6A 1JJCB 2DY7A 1CA5A 3I91A 4DXGA 2SOBA 3HOWG 3QR8A 5LL6S 4TRDA 4JI7L 1R4PB 5HY6A 2Z8LA 3K0YA 4IUVA 2NTSA 1AW7A 1KAWA 4ZYSA 4JBKA 2KQ3A 1CFMA 3Q0AA 2Z4IA 3RR5A 2F0LA 4OIJA 1NR2A 1STNA 5IP9H 5A2QL 4H0LC 4FVMA 3BZKA 2E2DC 4IJHA 2A68D 5CORA 4BS9A 4A3EB 3L2PA 2CKZB 4AYBE 4YHHQ 4L5SA 4DR6L 4RCOA 4Q5VA 1R9TB 1NBWA 3EIVA 2RCNA 4XQNA 2RSOA 3STBC 2EYPA 1EIFA 4LF7L 1CKMA 4ZUJA 4DNIA 1Y1WG 1X54A 2NZ1D 3I4MH 1KXLA 1VS0A 1FGUA 3CCSA 1FNVA 1Q46A 1QE6A 2JA7H 1JOKA 1S5ED 3HOZG 4K2KA 2VUMG 2YV5A 1QZHA 1IBLQ 5BN3A 4X66L 5GAEC 4PQXA 1J6QA 3OW2A 1SNQA 2CH4A 2D0OA 2IW3A 1KDAA 1SYBA 4CDCC 1PFBA 2KCCA 3SGIA 1NCVA 2EY5A 2VZAA 3TDQA 2EY1A 3HOYG 2MPMA 2OT2A 4LWCA 1GUTA 3GTGH 2RBMA 1GUNA 1GUOA 1S5CD 1B44D 4LK1C 2Q8TA 3AYHB 2L15A 3ULLA 3T1HQ 1XNQQ 1LTID 1RHPA 2GVAA 1BNZA 4DAMA 1DD2A 1K73C 1LLRD 1AZQA 1MGSA 2R7DA 2RSNA 3OWEB 2HCCA 1EQQA 2OF1A 3PCOB 2UUCQ 1Q8KA 3D8GA 3N52A 3K7UC 2QA4A 4PZ8A 2MQHA 2ZM6Q 1KIXA 1K8MA 2IY5B 1FL0A 3G6JB 4DR3L 5JVH3 1HZCA 4TSSA 1CHPD 2B2YA 3UDXA 1JOQA 3S1RB 1HNZL 2NVXH 5FLMH 2E76C 3M4YA 4V0BA 1DOMA 2F3VA 5D3IB 5FO8B 2JA8B 1MJEA 4CJ0B 1A0IA 1LTRD 2TSSA 2F0VA 4DV6L 4X3SA 3KDFA 1IW7D 5DM73 3EFXD 1PA6A 4LF6L 5JJLA 3VA7A 2EZVA 2HQLA 4K5WA 4JI2Q 3KJOA 5E4XA 4ZKCB 1NE3A 1VQ7A 5DLQE 5C4JH 3BZCA 1EOVA 2MNAA 1L1OC 2M9VA 2R92H 4KKSA 3M4OB 3G7LA 1UEAB 3UE0A 1JR0D 3OHXC 4XDXA 3K8AA 2KA7A 2E5LL 4NMZA 1N33Q 5J3BA 2DGYA 3I4NH 5FKAC 3AFQA 4H13C 3TZUA 2I0QA 2L12A 3QB3A 3CPFA 3GTMH 3K58A 4IZ8A 5G3LF 2F0EA 1Q3LA 3HP3A 5A35A 1VCIA 5FOBB 1ET9A 5JJZA 3NE5B 2RF4A 1SROA 3EJIA 1SYEA 2A68C 3DM3A 2K14A 2B2TA 3ULJA 1FD7D 2Q2IA 5JEAG 2ICEC 1T9HA 2KBNA 3T1YL 3U9OA 4DXFA 4PNYA 4FF1A 2I5MX 3C1EA 1SDFA 1L1OB 1VQCA 4JOIA 2RDHA 1GJXA 5IGGA 1V1PB 1KAAA 2XWBB 1N36L 4LF9L 3S15H 3UDFA 5JAVA 2MJ8A 3GP7A 4OELB 4DAVA 4F88A 2B2YC 1WOCA 2VB3X 3RLNA 3HOUH 4NXNL 4AQYL 1TWGH 4JI1L 5CV4A 4JCVE 1RIPA 3EBEA 4KHVA 2UXDQ 2B63B 2NB0A 3UE1A 1XPOA 3L3OC 4DR4Q 1CZWA 4R8NA 1IYVA 1JICA 3MEFA 3CCUA 2D2CC 4X64L 2PPBC 3PO3G 2LFNA 1CHQD 1JWSD 1KLGD 2QDLA 4IUTA 5EPKA 1ILPA 2A6HD 3I3CA 3JAMi 1VQMA 1CM9A 1EY7A 4G7HC 4BY1G 2F0NA 1YHAA 4DR2Q 3A5ZB 4CDEC 2QEJC 3MXPA 1O7YA 4DNTB 4K8JA 4ME5A 1BR9A 3QWNA 1X3EA 2UXCQ 3IFDA 3F2UA 1HUMA 2EYJA 4JV5Q 2F1MA 3S2HH 4JI6Q 1L0WA 1SE4A 4GN3B 3IL8A 4A3MG 1SXTA 3FMCA 3PQIA 5C3EB 4R4CA 1LUZA 3Q22A 1X55A 1G51A 1PTOD 2JA9A 4C3IG 3PIOA 3RNUA 1FYCA 1VMCA 2O2LD 3CXCA 2OTLA 4FYDA 3L9AX 1B4OA 3NPPA 3CCEA 5BR8Q 5C44B 5IYBG 2VQFQ 1ENAA 2KHSA 2DNEA 4YHHL 1GUGA 4KJOA 1YVCA 2A74C 1U4LA 1XMQQ 1EY6A 2B2TC 3TSSA 2XTIA 5IP9G 3PMFA 1D1IA 4B3TL 3DXJC 3K5OA 3MAQA 1CZGA 3I70A 5LMUQ 2B39A 1LM0A 5LL6X 4A3BB 2JA5G 4KHPL 1TS4A 5JOBA 4HIMA 2EPBA 4HJ5A 4KJNA 2MFIA 2WB1G 1B70B 1EYCA 2XVSA 3HKZB 3E9HA 3D6CA 3ND8A 2WACA 1XPRA 1T5EA 4RWSC 1ENCA 3H6MA 3CU7A 1HH2P 1W6KA 2QEXA 3J7AV 1A3TA 1VQAA 2NYZD 4IFDI 3TBIB 2AUKA 1VQGA 5DEHA 4IOAA 5CV9A 4A3KB 1I6HH 1BOSA 2K01A 2ZXRA 3S2DB 3R2IA 1N34Q 1KD1C 2G9DA 2IX3A 1AEXA 4YCVA 1XNQL 1TT2A 2PQAA 3GTOB 4RGMA 2NTTA 3DWPA 5EPLA 1DOLA 4A3IG 1ASZA 4FDBA 5H1SE 1NTGA 3CCMA 2KHJA 1QZGA 1UUPA 4A3DB 2ZM6L 1FGBD 1BBWA 1CI3M 2OQ0A 3T53B 1I4HA 4IPCA 3TQYA 3EN2A 2L55A 1EZ6A 1Y8OB 2ZJPA 5E7NA 3W5OA 3QOLA 1Y1WH 4G57A 1K28A 1GO3E 2L11A 5ELEA 3C46A 1E1TA 2ZJQA 3HOZH 3S14B 1PRTF 4FXKC 2VUMH 4H44C 3I55A 1MSGA 2F0SA 1KRSA 1G2SA 1XXGA 2CW0D 3J81i 5IODA 4BBRB 3NTKA 3HOYH 4X3UA 5T1IA 3S16B 4JI2L 1E24A 3BYTB 1Y1VB 1O7IA 2JA7B 5C5MA 3HKZE 5CC4A 4IQZA 1TVXA 3KF6A 4QUCA 1KQSA 2N78A 1DXMA 2A6HC 1E2ZA 2H1EA 4JI0Q 4K5VA 4IUNA 3OYYA 3UDIA 1GUWA 3VR5A 1BXTA 1EEFD 1PDQA 1N33L 1ESRA 5KRUA 3GTGB 4QY7A 2JEAI 1H9SA 1MKHA 3NTIA 4IFDG 5FLXE 1AE2A 1UNSA 1EQVA 3HOVG 3KLWA 1I50H 4X3TA 1SNPA 4HMIA 2Y0SB 1SEBD 4RGTA 3CCJA 4JK1C 2VW9A 1KC8C 1K8AC 4K0KQ 4QJFA 1FNWA 5KYLA 1PTOC 2UXBQ 1KTKA 2K32A 3LNNA 1H9MA 3NENA 4OWWB 1JWUD 3E0JA 1EL0A 2RA4A 3K0XA 2CQOA 1VF7A 2PZTA 1STBA 1HXYD 5C4XB 5IGFA 1JT8A 1VQDA 3TP5A 3CMEA 3GTJH 1AP0A 2A19A 2CCZA 3NSWA 4BXXG 2K5VA 1OXXK 1UE6A 1GM5A 3U4VA 1WD0A 2K33A 5CV8A 5CMDA 1TIID 5KIXA 3PUYA 5IOCA 3NXWA 2WFWA 2R7ZG 4BY7B 3K59A 4IPDA 2RHQB 4CBVA 1PHJA 5D14A 3URYA 4N8FA 3I2ZA 5KNBA 2R93G 5C4JB 4OIKA 1QNKA 1Y8NB 1SNCA 3J7YW 2BOSA 1PTOB 1K0RA 4O1NA 1IL8A 4C3HB 2R92B 1G6ZA 5C0XG 5FLXc 2KHIA 2EYOA 1C8CA 3MXNB 3JAMc 3G6EA 2JA6B 4WRDA 4IALA 2RVLA 3VA5A 3DEOA 3I4NB 1SYFA 1SMYD 1BCPC 1XTDA 4DR2L 1WFQA 2MO0A 5LHY1 1HA5A 1HTLD 2F0KA 2F0IA 5IIFA 1IYUA 1EIYB 2UXCL 4LUOA 3I73A 4GKKL 3GTMB 2Y0SE 3V96A 2LKVA 4A3JG 1L0YB 1HPCA 3EQLC 4G4KA 3BS1A 4JI6L 4LFBQ 3PO2B 4JBJA 3PUWA 2JP1A 3DM1A 2KJXA 2G5DA 1JJ2A 1AH9A 2CHBD 3NUCA 5D65A 3DWAA 3RZOH 2E2HH 1TWAH 2D0PA 2IT1A 2AWOA 3CAMA 5I4DA 2P5ZX 1XJVA 2HUGA 1BVSA 3T51B 2FINB 4UHVA 5BR8L 4A3FB 1NR4A 4KY7A 4IFDJ 2NVYH 2AHOB 1SYDA 3IKJA 1AFPA 3ZYYX 1X6OA 3FP9A 2PZWA 2EY6A 3S15B 1XMQL 3S1MB 1WJJA 2RHSB 3KK7A 4JYAQ 2F0OA 3J80i 3A7LA 1PMRA 3A55A 1I3QH 3PO3H 4YY3Q 1E7ZA 2YU9H 3J81j 3HOUB 1EU4A 3UI2A 4KK7A 4HTHA 5BN5A 4BBSH 4E6IA 4HIDA 4BY1H 1LACA 1I94Q 4HJ8A 1G291 3M7GA 1MIUA 3J81E 2GA4B 1SBBB 4RKLA 4KY5A 1ZEQX 2LSSA 4C3JB 3TP6A 4HCSA 1DOKA 4A3MH 5IE8A 1K83H 1P8LA 2AUJD 4C3IH 1OXVA 1N34L 1HA6A 4HSPA 3EVQA 1VQJA 3FHWA 2K03A 1S72A 5IYBH 1B9NA 3TRZA 3S2HB 2F4IA 3A54A 2XRSD 4DV3Q 2KENA 1EYAA 4ME3A 3BYYB 1Z6HA 1ONLA 5C0XJ 4JI4L 2ENBA 4HEDA 4A3LG 1JJGA 1STAA 4DGZA 1U9RA 4A93G 3GTKB 3I4OA 1D6EC 3SR1A 3PUZA 2L0CA 3SDZA 2FJ2A 1HUNA 2WKCA 1WI5A 3GV3A 1E22A 1C9OA 2BE5D 4QUFA 5HURA 2EYLA 3SEBA 2JA5H 1J9OA 4DR7Q 3MA2B 3J7ZC 3FKIB 4JPBW 1RTNA 3U4ZA 2RCFA 1YJ9A 3HOXB 2BCOA 4KI0A 1XWEA 1OO9B 2HHHL 4DV7L 2N3SA 1K3RA 3J81c 2FHTA 1L1OA 3A8IE 1E2VA 4DUZQ 1V1PA 1YITA 1A62A 2PMZB 1VF5C 1PV4A 1U4PA 1EY0A 2A1AA 1MSHA 1RCVD 1LTSD 4P2CB 4EQOA 1FJGQ 3EA6A 3D4DA 1JE5A 4JW0A 1SRUA 4FF4A 4DV1L 3G48A 4JI0L 3HOWB 1C48A 1D2BA 2O5IC 2E2JB 4P72A 4PV1C 3Q23A 5GAHC 3R8BA 4A3IH 1M90C 3Q6SA 4L5RC 1YZ6A 1PXUA 3A5UA 4DFAA 2K4KA 1HR0Q 3D6WA 1LT3D 1WCMG 1LTGD 3W2DA 4NB3A 3DUZA 3H91A 1JCKB 3CCVA 1TS5A 3CC7A 2Q2TA 1VMPA 3NBIA 4F87A 2NVTB 4DU9A 2GVBA 3BU2A 4DR5Q 1LT4D 4JI8L 3AMUA 2EYMA 4X3KA 2CQAA 2QDBA 1A15A 2VNUD 1TWHH 2EJFC 1LT5D 2UXBL 2JSOA 1WTXA 3IAYA 4NXML 4OO1I 1PH8A 2DJFC 5CV5A 2EYHA 4IO9A 1K8OA 2EJGC 3K6OA 4NW2A 3GTQB 1Y1WB 2C35B 1WYDA 1QG7A 4ZRZA 3JAML 2F0UA 4HJ9A 1M1KC 5ELNA 4GOPC 5HGQA 3HOZB 3KBGA 2VUMB 4NDXA 4LF8L 1F2ZA 1TQOA 1I4RA 3CRLC 2QILA 3M4PA 2I07B 4CJ1B 3M9BA 3I7FA 2PMZE 1E1OA 3HOYB 3J80E 4ZUIA 2NVQH 3M7NA 5COYA 1CKNB 4IFDH 4CKEA 3GO5A 1BUVT 5ELCA 1ASYA 1YNJC 5KEEA 3HOVH 1PFMA 1BO0A 3E9IA 4IUPA 1JOOA 2DNCA 1A2TA 2SNSA 3GD7A 3OPOA 3RZDH 1HNWQ 5BN4A 4GOPB 1C0AA 1F77A 2VQEL 2X69A 5IT9L 1U0LA 3S17H 1AN8A 2NZOA 1I50B 2QGQA 3I4LA 4RGOS 5T1GA 2AQ1B 4IOCA 1PYWD 1EY4A 2PYKA 3M85A 2UU9L 1U4MA 4LFBL 3PSIA 5C5LA 1WTQA 3ULPA 1SJHD 5HGTA 2A8VA 4BXXH 1D5XC 4APVA 3DHQA 1D8LA 1YHQA 4OO1G 2WAQG 3SE0A 2AQ3B 1M4VA 1Q7YC 3I72A 3W1GA 4DF7A 3HEJA 3FPUB 2F4VQ 2R7ZH 1N32Q 5LMNQ 5ELDA 1ML0D 2IHFA 3GTJB 4EGVA 4RHSA 4ZQ3A 4X65Q 3RUZA 2XIWA 3D0FA 3PUVA 3F2BA 3J80c 4JYAL 2R93H 2Q2UA 3NWSA 4B3MQ 2UUAQ 4YY3L 2JYOA 5CYUA 1HRJA 5C0XH 2JK8A 5J1ZA 2DY8A 4OXPA 1CSPA 3K5MA 2XWJB 1I94L 4RA8A 4KD3A 1RD9D 4GS3A 5CBAE 4IUUA 1QUQB 4G7ZC 5GADC 3GTPH 3S1NB 1QOHA 1BKBA 1TS2A 2B2VA 4DV4Q 3MHBA 3TP7A 2F0MA 3CQZB 4ODGA 4A3JH 5AJ3Q 5G3LD 4BBSG 2F52A 4OL7A 5C44G 1J8IA 3QOJA 2XSCA 1PH2A 1G6PA 1SNOA 2H4OA 3NBHB 5M3MB 1VQ9A 2EJMA 5K5PA 2D5DA 4G7OC 1EYGA 5M5YH 1K8GA 1JB3A 5I2XA 3J81L 4PMBA 1KNAA 5M5XH 4DK3C 4DV3L 3PF4A 1JMCA 1WVLA 5IYDG 2AKWB 4OEMB 2VS1A 4MZ9A 2E2HB 4OHJA 3MZ5A 4NKLA 4Y7NB 4IPHA 1TY0A 3VR3A 5M9OA 3WWVA 4Z9CB 3F2CA 2UUBQ 2NVYB 3L7ZC 1UE1A 4RMFA 4DR7L 4MHEA 2KEEA 3SVMA 1I4GA 2EYFA 3TS0A 3K7AH 4B3SQ 1ICFB 1S4ZA 4KN7C 5AFWA 2KUMA 3L0OA 3PO3B 3BVMA 2CVRA 4JVZA 1PH9A 2YU9B 1BCPF 1IW7C 1NMFA 1WTPA 2B8GA 1KRTA 1CQVA 4PMCA 4DUZL 2BA1A 1JWMD 3KDFB 4O42A 4TVAB 1TWCH 3K5LA 3H3VH 2CH4W 1J5EQ 4MTNA 1R9TH 4A3DG 2J4XA 4HN7A 1FJGL 2N8NA 1IBLL 4J6HA 1IL2A 5IYCG 1MBYA 2OTJA 2PNHA 1V43A 3QG1A 1EIHA 5CV6A 1WTRA 4FXDA 4XXEA 4A3MB 2AQ2B 4A3LH 1UE7A 4F7XA 4A93H 2B2VC 4C3IB 1DGSA 3C2PA 1YNND 3T1HL 3KJPA 2K6AA 1EY5A 3OMCA 3A74A 4L5TA 1A63A 2F0FA 4DR5L 3MXNA 2F0GA 4QCLA 4XYOA 3EROA 2B2WA 3Q8DA
chains in the Genus database with same CATH topology
1EY9A 2HCIA 3NK9A 5A2QE 1V1OA 3WOFA 3GV6A 1NAPA 5JVG3 5TSSA 2PQEA 2TMPA 3TN2A 4FO2A 4ZLTF 1DM0B 3N6RA 5CV7A 1EWHA 3BG3A 1F9PA 3DMUA 4QB4A 3U9SA 3CHBD 3Q24A 2WB1B 4L6TB 5JPMC 1Z7TA 4ID6A 3S9WA 4DNRB 3KLSA 1R4QB 4EQNA 1OXTA 3I4MB 4L63B 2F0DA 5C0XI 1CTMA 3A7AB 4TQUS 4QF4A 3VR6A 3H94A 1F9QA 4A3IB 2IJ0A 1C4QA 2EOTA 2NN6I 4KN4C 3HS0C 1ILQA 1GOZA 2OEOA 4IN3A 4DN4M 1PZJD 4RAUC 3RD4A 4XT1B 2PO4A 3OIPA 4K5XA 3I90A 1OXUA 2BDOA 3BVGA 4KD4A 1TWHB 1PRTD 4J8QA 3OSOA 4HMJA 1Q1EA 2Q8RE 1F2LA 4ZKBB 1Q12A 2B2WC 4C3HG 1O7LA 2L1BA 3V2TA 1EZ8A 1PZKD 2KEDA 2NVXB 1A3VA 3MTSA 1I6VC 1HQRD 1KABA 2NWGA 2MUYA 1ET6A 3KLRA 2WINB 1D5MC 2M00A 5IGCA 2N88A 3D4WA 4ABNA 1KDBA 1Q90A 4N9PA 4EVOA 2BA0A 1GUSA 2D9UA 1EU3A 2PW5A 4HR7B 2NVQB 4K6LA 3NQTA 4C1NI 5E1FA 2VB2X 3HOVB 1IHZA 4RGNA 1TKWB 2LY7A 3VYRA 1SJED 1V8QA 2G9HD 3RZDB 4DAPA 1GHJA 4ILWA 1S5BD 2WIIB 4Q0FA 1WTWA 2NN6G 1SAPA 2PZUA 4R8IA 4V190 2EVBA 3S17B 4OO1H 1STEA 1ZKOA 1S5FD 1F9SA 1QCBD 3BDLA 2WV6D 3D31A 2QKIC 2Q8IB 3T13A 3A8JE 4OGQC 3C3LA 1I4PA 1AZPA 5EBCA 4IURA 4KKTA 5EKIA 2R7ZB 5KGUA 4PMWA 5I6WA 3GQBA 4S3SA 1A2UA 1BF4A 2X6GA 2R93B 2MGSA 1T5XD 2K04A 1S5DD 1E2WA 1SE2A 5C3XA 2F03A 2HDLA 2CW0C 4HCEA 4FF3A 1E0BA 3CKIB 1TWGB 3IFTA 1ZYRD 1O78A 3X3MA 1G91A 1GXDC 3SHLA 2O5JC 3BDCA 1W6JA 5CR3A 4B9WA 2SEBD 3P7JA 3GTPB 2K5QA 3AU7A 1TR5A 3CRKC 5CBEE 3KUPA 1DZ1A 1QJOA 2OXPA 2SNMA 3PIP3 2QCPX 3P20A 3NHHA 5M5YB 3WDNA 1F2YA 5M5XB 2A5HA 2HQEA 2KECA 3HZXA 1LTBD 5I2YA 3K5NA 1FNUA 1U4RA 5K36G 1B2TA 4K6DA 2EDGA 4FNFA 4C56C 1UAPA 3VR2A 2LMCB 1WTOA 3K7AB 3R2TA 3KBXA 3MFGA 1KNEA 2B2UC 3HG9A 3K57A 1TWCB 4KHZA 3TP8A 1PRTB 4MN3A 4R9WA 3TMEA 2F3WA 4U68A 2WP8J 3LX0A 1TY2A 1HHVA 4KKUA 1SMYC 1LABA 4ULLA 1HFGA 4J1MA 1I6HB 4A93B 1EFID 3MFYA 4LMQD 5FK9C 3D3RA 1ESFA 2A6ED 4M1UB 4BWGB 1EYDA 2KCNA 1Z47A 3FRPB 3NBHA 1Q1BA 4DK0A 4B08A 1B1ZA 2X6LA 5FLXL 3MEHA 2NUCA 2L9HA 5E4WC 2R6GA 2QF7A 3NTHA 5J22A 2F0TA 3ERQA 2MHVA 2E2IB 1ZYRC 3P75A 4BA2I 4FXGC 3A56A 1WCMB 5D3DA 2SDFA 4KMUC 2WKDA 1X32A 3O13A 5EBDA 1HTPA 1WD1A 1PZID 3NP8A 1SNDA 5FO7B 5KNDA 5KNCA 1A3UA 1PTOH 1VDZA 1GHKA 3BDOA 2O4XA 5ELBA 3J7AF 3OOCA 2D62A 4UAIA 2RQXA 3SK4A 2BE5C 2A69D 2L5TA 2M2LA 3DEPA 4K14A 4F8MA 2K5WA 2K05A 4CKCA 5C4ZA 1PFNA 5ISRA 2PNRC 4RFBA 3NQIA 2NN6H 3FVQA 3KF8A 5KYIA 1CT1D 3R93A 3VYSA 1SYCA 4XIGS 1RF2D 1TWFB 1PTOF 1EOTA 5EKKA 5EGTA 2K5DA 1M8AA 2EE1A 2XRQD 4XTCS 2Z1CA 4DA2A 1D5ZC 4GZYC 4RKBA 1II3A 1DYQA 1I4XA 4K2LA 2A6EC 2WAQB 1RODA 1QNUA 1ICWA 5IGDA 3MVVA 1NSNS 1B3AA 4XYQA 3GTLB 3RZOB 1TWAB 1IKMA 5EQ0A 3VYTA 1RKNA 3M3YB 3W3AA 1EQTA 4KV6A 4ZK9B 2E75C 2IX0A 2K7VA 3SK8A 5EKLA 1I3QB 1SFOB 1D1KA 1HQMC 3PV0A 1F2MA 3X3NA 3I8ZA 3AB9A 5EJWA 4BBSB 5E3FA 3D4RA 4DK1A 2RDGA 4C1NK 1B9MA 4BY1B 1LO5D 2MP1A 3NWTA 4RH6A 4CKBA 4WORA 3C1FA 1MI2A 2RKSA 1K83B 5JEAJ 2F0WA 3QO2A 1SNMA 5ELFA 1Q8IA 4EQPA 3OW7A 2K28A 3OWFA 1Y8PB 4WFN3 5M5WB 2I46A 2LS01 1H9JA 1XX8A 5K36H 3MC0B 4YIJA 3VYUA 2HDMA 1XYIA 1RTOA 1LV9A 2C5CA 2KOLA 3VR4A 2V4DA 5F2DA 1BCPD 2A69C 4MIUA 3PUXA 5DM63 1IKLA 5FO9B 4K8IA 2JA5B 1TS3A 2ZXPA 3FPPA 2JE6I 5DAUA 3P1HA 3SK5A 5I9PA 1H9RA 1L0XB 3OIQA 1CQFA 3MXGA 2IX1A 5C3WA 1KDCA 3SK6A 4XT3B 1XTCD 1DONA 2E74C 3E6ZX 3QIAA 1LTAD 1X3QA 1O80A 3LWUA 1TU2B 4BA1I 3LWEA 2C9OA 4C2MB 2YYZA 3FEWX 1JORA 4DAYA 3J80L 3ND9A 2JXMB 4CJ2C 1KLUD 3QJYA 1CK1A 1OXSC 5C4HA 4B9XA 2AWNA 4L8JA 2NBFA 2EY2A 5J39A 1QWYA 2J7ZA 2IPKD 2EXZA 1BBXC 2IWHA 3JAME 5JPNC 1ZXTA 1RJTA 3V05A 2R61A 3SXHA 1DJRD 1SE3A 1Y69U 1HFNA 3DWQA 1EWCA 3HRZC 1I4QA 4CGYB 3BVZA 1WTVA 2Z4HA 3PIO3 2ZT9C 1RDPD 1STYA 1NUCA 2F0JA 2RDFA 1LTTD 2JEBI 2FFKB 4KTAA 4FP5D 5EPJA 3T56B 3MXUA 1QB5D 1BDOA 3S1QB 2XNAC 3KLSX 2KVMA 5NUCA 3T4AC 4LJZC 1HCZA 3FDTA 1X3PA 4I7ZC 1EEID 4HAEA 5IT9E 2ID0A 1YNNC 1DCZA 2F0HA 4XQJA 3T16A 4FF2A 5IGBA 4I65A 2F0QA 2VXWA 3WOEA 4IUQA 1SYGA 1CA6A 4ZAIA 1B53A 3ONAB 2BDNA 2ZXOA 4CHTB 1A6XA 3H0GB 4HSVA 2XN9C 5JEAH 1G2TA 4QIWB 1JQYD 2B2UA 5DNFA 5CGKA 4C3JG 3BZDB 1G8ZD 4A3GB 4XQQA 1FR3A 4RCNA 2FMCA 4LAAA 2A73B 3E5SA 5IGEA 1B50A 4M8AA 4N9TA 2ICIA 2PW7A 3OMGA 4H7BA 4UDUC 4AYBB 5M3FB 1STGA 4TKOB 1BCPB 4JBWA 3R3OA 4WJWA 4A3JB 4NP5A 1H9KA 1PLFA 2L4NA 1STHA 3ITPA 1BQQT 1O7ZA 2N55A 4QMGA 2DN8A 2B8FA 2IL8A 3RLFA 1H9SB 3HGBA 4U673 2R3ZA 1JE4A 1YNJD 2PCFB 1EIGA 1JC7A 1EY8A 5I9OA 3H3VC 2J0TD 1PRTC 5C6AA 3MWYW 2F0PA 3TZDA 3H09A 2FMMA 2K1BA 4RHRA 3RMHA 1F9RA 1LT6D 1SSOA 1QILA 1MD2D 1ENFA 5I6YA 3A8KE 4KY6A 2DY7A 1CA5A 3I91A 4DXGA 2SOBA 5LL6S 4TRDA 1R4PB 2Z8LA 3K0YA 4IUVA 2NTSA 1AW7A 4ZYSA 2KQ3A 1CFMA 3Q0AA 2Z4IA 2F0LA 4OIJA 1NR2A 1STNA 5A2QL 4H0LC 4FVMA 2E2DC 2A68D 5CORA 4BS9A 4A3EB 4RCOA 4Q5VA 1R9TB 4XQNA 2RSOA 2EYPA 4ZUJA 2NZ1D 1FNVA 1QE6A 1JOKA 1S5ED 4K2KA 5BN3A 4PQXA 1SNQA 2IW3A 1KDAA 1SYBA 1PFBA 2KCCA 1NCVA 2EY5A 3TDQA 2EY1A 2MPMA 2OT2A 1GUTA 2RBMA 1GUNA 1GUOA 1S5CD 1B44D 4LK1C 2Q8TA 1LTID 1RHPA 1BNZA 1DD2A 1AZQA 1LLRD 1MGSA 2RSNA 3OWEB 2HCCA 2OF1A 3D8GA 3N52A 1K8MA 3G6JB 5JVH3 4TSSA 1CHPD 2B2YA 1JOQA 3S1RB 2E76C 3M4YA 4V0BA 1DOMA 2F3VA 5D3IB 5FO8B 2JA8B 4CJ0B 1LTRD 2TSSA 2F0VA 4X3SA 1IW7D 5DM73 3EFXD 3VA7A 2EZVA 4K5WA 5E4XA 4ZKCB 2M9VA 4KKSA 3M4OB 3G7LA 1UEAB 1JR0D 3OHXC 4XDXA 2KA7A 4NMZA 5FKAC 4H13C 3TZUA 2L12A 3QB3A 3K58A 4IZ8A 5G3LF 2F0EA 1Q3LA 3HP3A 5A35A 1VCIA 5FOBB 1ET9A 5JJZA 3NE5B 3EJIA 1SYEA 2A68C 2B2TA 1FD7D 5JEAG 2ICEC 3U9OA 4DXFA 4PNYA 4FF1A 3C1EA 1SDFA 2RDHA 1GJXA 5IGGA 1V1PB 1KAAA 2XWBB 5JAVA 2MJ8A 3GP7A 4DAVA 4F88A 2B2YC 2VB3X 5CV4A 4KHVA 2B63B 2NB0A 3L3OC 1CZWA 4R8NA 1IYVA 1JICA 2D2CC 2PPBC 2LFNA 1CHQD 1JWSD 1KLGD 5EPKA 4IUTA 1ILPA 2A6HD 3I3CA 1CM9A 1EY7A 4G7HC 2F0NA 2QEJC 3MXPA 1O7YA 4DNTB 4K8JA 4ME5A 1BR9A 3QWNA 3IFDA 3F2UA 1HUMA 2EYJA 2F1MA 1SE4A 3IL8A 1SXTA 3FMCA 5C3EB 3Q22A 4C3IG 1PTOD 1FYCA 1VMCA 2O2LD 4FYDA 3L9AX 1B4OA 3NPPA 5C44B 1ENAA 2KHSA 2DNEA 1GUGA 4KJOA 2A74C 1U4LA 1EY6A 2B2TC 3TSSA 3PMFA 1D1IA 3DXJC 3K5OA 3MAQA 1CZGA 3I70A 2B39A 5LL6X 4A3BB 1TS4A 5JOBA 2EPBA 4KJNA 1EYCA 2XVSA 3HKZB 3D6CA 3ND8A 2WACA 1T5EA 4RWSC 1ENCA 3H6MA 3CU7A 1W6KA 3J7AV 1A3TA 2NYZD 4IFDI 3TBIB 2AUKA 5DEHA 5CV9A 4A3KB 1BOSA 2K01A 2ZXRA 3S2DB 3R2IA 2G9DA 2IX3A 1AEXA 1TT2A 3GTOB 4RGMA 2NTTA 3DWPA 5EPLA 1DOLA 1UUPA 4A3DB 1FGBD 3T53B 1CI3M 1I4HA 2L55A 1EZ6A 1Y8OB 3QOLA 4G57A 2L11A 5ELEA 3C46A 3S14B 1PRTF 4FXKC 4H44C 1MSGA 2F0SA 1G2SA 1XXGA 2CW0D 5IODA 4BBRB 3NTKA 4X3UA 5T1IA 3S16B 3BYTB 1Y1VB 2JA7B 5C5MA 5CC4A 4IQZA 1TVXA 4QUCA 1DXMA 2A6HC 1E2ZA 2H1EA 4K5VA 4IUNA 1GUWA 3VR5A 1BXTA 1EEFD 1PDQA 1ESRA 5KRUA 3GTGB 2JEAI 1H9SA 3NTIA 4IFDG 5FLXE 1UNSA 1EQVA 4X3TA 1SNPA 4HMIA 2Y0SB 1SEBD 4RGTA 4JK1C 5KYLA 1FNWA 1PTOC 1KTKA 2K32A 3LNNA 1H9MA 1JWUD 3E0JA 1EL0A 2RA4A 1VF7A 2PZTA 1STBA 1HXYD 5C4XB 5IGFA 3TP5A 1AP0A 3NSWA 1OXXK 1WD0A 2K33A 5CV8A 5CMDA 1TIID 5KIXA 3PUYA 5IOCA 3NXWA 4BY7B 3K59A 4CBVA 5D14A 3URYA 5KNBA 5C4JB 4OIKA 1QNKA 1Y8NB 1SNCA 3J7YW 2BOSA 1PTOB 4C3HB 4O1NA 1IL8A 2R92B 1G6ZA 5C0XG 2EYOA 1C8CA 2JA6B 4WRDA 4IALA 2RVLA 3VA5A 3DEOA 3I4NB 1SYFA 1SMYD 1BCPC 5LHY1 1HA5A 1HTLD 2F0KA 2F0IA 5IIFA 1IYUA 3I73A 3GTMB 3V96A 2LKVA 1L0YB 1HPCA 3EQLC 4G4KA 3BS1A 3PO2B 3PUWA 2JP1A 3DM1A 2KJXA 2CHBD 3NUCA 5D65A 3DWAA 2IT1A 2AWOA 5I4DA 2HUGA 3T51B 2FINB 4A3FB 1NR4A 4KY7A 4IFDJ 1SYDA 3IKJA 1AFPA 3ZYYX 2PZWA 2EY6A 3S15B 3S1MB 3KK7A 2F0OA 3A7LA 1PMRA 3A55A 3HOUB 1EU4A 3UI2A 4KK7A 4HTHA 5BN5A 4E6IA 1LACA 1G291 3M7GA 3J81E 2GA4B 1SBBB 4RKLA 4KY5A 1ZEQX 4C3JB 3TP6A 4HCSA 1DOKA 2AUJD 1OXVA 1HA6A 4HSPA 3EVQA 2K03A 1B9NA 3S2HB 2F4IA 3A54A 2XRSD 1EYAA 3BYYB 1Z6HA 1ONLA 5C0XJ 2ENBA 4HEDA 1STAA 4DGZA 1U9RA 3GTKB 1D6EC 3SR1A 3PUZA 2L0CA 3SDZA 2FJ2A 1HUNA 2WKCA 3GV3A 2BE5D 4QUFA 5HURA 2EYLA 3SEBA 1J9OA 3MA2B 3FKIB 1RTNA 3HOXB 2BCOA 4KI0A 1XWEA 1OO9B 2FHTA 3A8IE 1E2VA 1V1PA 2PMZB 1VF5C 1U4PA 1EY0A 1MSHA 1RCVD 1LTSD 4P2CB 4EQOA 3EA6A 3D4DA 4FF4A 3HOWB 1C48A 1D2BA 2O5IC 2E2JB 4PV1C 3Q23A 3R8BA 3Q6SA 1PXUA 4DFAA 3D6WA 1LT3D 1LTGD 3W2DA 3DUZA 3H91A 1JCKB 1TS5A 1VMPA 3NBIA 4F87A 2NVTB 4DU9A 1LT4D 3AMUA 2EYMA 4X3KA 2CQAA 2QDBA 1A15A 2VNUD 2EJFC 1LT5D 2JSOA 1WTXA 3IAYA 4OO1I 5CV5A 2EYHA 1K8OA 2EJGC 3K6OA 4NW2A 3GTQB 1Y1WB 1QG7A 4ZRZA 3JAML 2F0UA 3HOZB 3KBGA 2VUMB 4NDXA 1F2ZA 1TQOA 1I4RA 3CRLC 2QILA 2I07B 4CJ1B 3HOYB 3J80E 4ZUIA 3M7NA 5COYA 4IFDH 4CKEA 3GO5A 1BUVT 5ELCA 1YNJC 5KEEA 1PFMA 1BO0A 4IUPA 1JOOA 2DNCA 1A2TA 2SNSA 3GD7A 3OPOA 5BN4A 1F77A 2X69A 5IT9L 1AN8A 1I50B 3I4LA 4RGOS 5T1GA 2AQ1B 1PYWD 1EY4A 2PYKA 3M85A 1U4MA 5C5LA 1WTQA 1SJHD 5HGTA 1D5XC 3DHQA 4OO1G 3SE0A 2AQ3B 1M4VA 3I72A 4DF7A 3HEJA 3FPUB 5ELDA 1ML0D 3GTJB 4EGVA 4RHSA 4ZQ3A 3RUZA 2XIWA 3PUVA 3NWSA 2JYOA 5CYUA 1HRJA 5C0XH 5J1ZA 2DY8A 3K5MA 2XWJB 4RA8A 4KD3A 1RD9D 5CBAE 4IUUA 4G7ZC 3S1NB 1QOHA 1TS2A 2B2VA 3MHBA 3TP7A 2F0MA 3CQZB 4ODGA 5G3LD 4OL7A 1J8IA 3QOJA 2XSCA 1SNOA 2H4OA 5M3MB 2EJMA 5K5PA 2D5DA 4G7OC 1JB3A 5I2XA 3J81L 4PMBA 1KNAA 1WVLA 2E2HB 4OHJA 3MZ5A 4NKLA 4Y7NB 1TY0A 3VR3A 5M9OA 4Z9CB 2NVYB 3L7ZC 4MHEA 2KEEA 3SVMA 1I4GA 2EYFA 1S4ZA 4KN7C 5AFWA 2KUMA 3PO3B 3BVMA 2CVRA 2YU9B 1BCPF 1IW7C 1WTPA 2B8GA 1CQVA 4PMCA 2BA1A 1JWMD 4O42A 3K5LA 2J4XA 4HN7A 4J6HA 1MBYA 1V43A 3QG1A 1EIHA 5CV6A 1WTRA 4FXDA 4XXEA 4A3MB 2AQ2B 4F7XA 2B2VC 4C3IB 3C2PA 1YNND 2K6AA 1EY5A 3OMCA 2F0FA 3MXNA 2F0GA 4QCLA 4XYOA 3EROA 2B2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY9 A;  3MHB A;  2EYO A;  4NDX A;  3TP7 A;  3NK9 A;  2EY2 A;  2F0M A;  1TR5 A;  1F2Z A;  1TQO A;  2ENB A;  4ODG A;  5J39 A;  2EYP A;  2F0S A;  4OL7 A;  2M00 A;  1STA A;  3C1F A;  4LAA A;  4NMZ A;  1U9R A;  3D4W A;  4DGZ A;  5C4Z A;  4WRD A;  5IGC A;  4IAL A;  3QOJ A;  2PQE A;  3E5S A;  1KDB A;  4N9P A;  3SR1 A;  3VA5 A;  4EVO A;  2RKS A;  1SYF A;  4ZUJ A;  2OXP A;  1SNO A;  2EXZ A;  5ISR A;  2PW5 A;  4N9T A;  2SNM A;  2F0K A;  2F0W A;  4ZUI A;  1SNM A;  2F0I A;  5K5P A;  4EQP A;  2PW7 A;  3NHH A;  3MEH A;  5IIF A;  1JOK A;  2NUC A;  1ENA A;  2KHS A;  3OMG A;  3OWF A;  3NQT A;  3QB3 A;  4H7B A;  4K2K A;  5CV7 A;  5C5M A;  5KYI A;  5CC4 A;  5HUR A;  2EYL A;  5E1F A;  4KJO A;  3DMU A;  3SXH A;  4QB4 A;  2LKV A;  5KEE A;  1EY6 A;  4IZ8 A;  1SYC A;  4PMB A;  2F0E A;  1SNQ A;  1F2Y A;  4YIJ A;  1IHZ A;  2HQE A;  3HZX A;  1KDA A;  1STG A;  1SYB A;  4K5V A;  5IOD A;  5EKK A;  2EY5 A;  1JOO A;  2EY1 A;  1A2T A;  3PMF A;  4IUN A;  5J22 A;  3R3O A;  4ID6 A;  3NUC A;  2F0T A;  2SNS A;  3EJI A;  5EGT A;  4NP5 A;  3ERQ A;  3S9W A;  1STY A;  1SYE A;  5KRU A;  1NUC A;  1STH A;  2RBM A;  3MZ5 A;  4NKL A;  3ITP A;  3P75 A;  2F0J A;  2RDF A;  2PZU A;  3U9O A;  4QMG A;  4PNY A;  5F2D A;  5M9O A;  4EQN A;  3C1E A;  4KTA A;  4MIU A;  4RKB A;  4K6D A;  1EQV A;  5JOB A;  1II3 A;  4KY7 A;  4K2L A;  4KJN A;  5IGG A;  1SYD A;  1EY0 A;  1EYC A;  1KAA A;  1EY4 A;  4EQO A;  2F0D A;  2EY6 A;  2PZW A;  1SNP A;  4K8I A;  5JAV A;  3D4D A;  4HMI A;  2OF1 A;  2PYK A;  3BDL A;  3D6C A;  2EYF A;  2F0O A;  2WAC A;  1EY8 A;  4QF4 A;  5I9O A;  5NUC A;  5DAU A;  5C5L A;  5IGD A;  1ENC A;  3D8G A;  3MVV A;  3T13 A;  3H6M A;  3P1H A;  5KYL A;  3SK5 A;  5HGT A;  5I9P A;  5C6A A;  4DFA A;  1NSN S;  2F0P A;  3DHQ A;  1A3T A;  5C3W A;  1KDC A;  3SK6 A;  4HTH A;  5DEH A;  5CV4 A;  2OEO A;  5CV9 A;  3NP8 A;  4PMC A;  1RKN A;  1SND A;  2PZT A;  1STB A;  4KHV A;  4DF7 A;  4E6I A;  5IGE A;  3HEJ A;  1JOQ A;  5IGF A;  1AEX A;  3TP8 A;  2F0H A;  4KY6 A;  5I6Y A;  1TT2 A;  3TP5 A;  4R8N A;  5KGU A;  2SOB A;  4KV6 A;  3T16 A;  5I6W A;  4TRD A;  4S3S A;  1A3U A;  4K5X A;  4DU9 A;  4ZQ3 A;  1A2U A;  4I65 A;  4J6H A;  3TME A;  2F3W A;  3RUZ A;  5IGB A;  4KD4 A;  2F0Q A;  3SK8 A;  2F3V A;  2EYM A;  5EKL A;  2QDB A;  4RKL A;  2KQ3 A;  3LX0 A;  2O4X A;  4KY5 A;  1SYG A;  2F0L A;  5CV8 A;  1STN A;  5C3X A;  5J1Z A;  3TP6 A;  3OSO A;  5CV6 A;  5KIX A;  5IOC A;  1F2M A;  2F0V A;  3NXW A;  4HMJ A;  1EY7 A;  2F0N A;  2EYH A;  5CV5 A;  1JOR A;  1EZ6 A;  4F7X A;  4J1M A;  5E3F A;  3MXP A;  4K5W A;  3SK4 A;  4K8J A;  4ME5 A;  3V2T A;  3QOL A;  1EZ8 A;  4G57 A;  4KD3 A;  3EVQ A;  1EY5 A;  2EYJ A;  1A3V A;  1SNC A;  2F0U A;  3BDC A;  3OMC A;  3SHL A;  4K14 A;  2F0F A;  4F8M A;  1EYD A;  5C4H A;  5CGK A;  5CR3 A;  2F0G A;  4WOR A;  4B9X A;  4B9W A;  3ERO A;  1KAB A;  1EYA A; 
#chains in the Genus database with same CATH topology
 2UUC L;  1EY9 A;  2HCI A;  2K5N A;  4BBR G;  3NK9 A;  5A2Q E;  1V1O A;  1HZB A;  1Q81 C;  3WOF A;  2YTX A;  3GV6 A;  4LUV A;  1NAP A;  5JVG 3;  5TSS A;  2PQE A;  2TMP A;  3TN2 A;  4FO2 A;  3OTO Q;  4ZLT F;  1DM0 B;  3N6R A;  1KHI A;  5CV7 A;  4A3C G;  2YTV A;  1EWH A;  3BG3 A;  1F9P A;  1QVG A;  3DMU A;  4QB4 A;  3U9S A;  3CHB D;  3KF8 B;  4JBM A;  3Q24 A;  4GKJ Q;  2WB1 B;  4EX5 A;  1PVO A;  4L6T B;  5JPM C;  1Z7T A;  4ID6 A;  1LTL A;  3S9W A;  2E2I H;  4DNR B;  3KLS A;  1QVF A;  1R4Q B;  4EQN A;  1OXT A;  3I4M B;  2Y0S G;  1VQB A;  3S1R H;  4LF4 Q;  1WCM H;  4L63 B;  4DR6 Q;  2F0D A;  2OWO A;  5C0X I;  1CTM A;  3A7A B;  4DV0 Q;  4TQU S;  4QF4 A;  3VR6 A;  4OX9 Q;  3H94 A;  1F9Q A;  4A3I B;  2IJ0 A;  1C4Q A;  2EOT A;  2NN6 I;  4KN4 C;  5C4X G;  1YBY A;  3HS0 C;  1GD7 A;  1ILQ A;  1GOZ A;  2OEO A;  4IN3 A;  4DN4 M;  1EQR A;  1Z9F A;  2JQO A;  1YEZ A;  1K0S A;  1PZJ D;  4RAU C;  3RD4 A;  4XT1 B;  2PO4 A;  3OIP A;  2EQS A;  4K5X A;  3I90 A;  1OXU A;  2BDO A;  3BVG A;  4KD4 A;  4BY7 G;  3NEL A;  1IBK Q;  1TWH B;  1PRT D;  4J8Q A;  3OSO A;  1PH4 A;  4HMJ A;  4P75 A;  1Q1E A;  3AFP A;  1VQL A;  2Q8R E;  1F2L A;  4QL5 A;  4ZKB B;  1Q12 A;  2B2W C;  4C3H G;  1O7L A;  2HIV A;  2L1B A;  4UP8 A;  3V2T A;  5LMN L;  1EZ8 A;  1PZK D;  2KED A;  2KCT A;  2NVX B;  1A3V A;  2B3G A;  2WB1 E;  4X65 L;  3MTS A;  2JA6 G;  1I6V C;  1NY4 A;  4GNX C;  1HQR D;  1KAB A;  2NWG A;  4PZ7 A;  2UUA L;  2MUY A;  3B6Y A;  2Z0S A;  1ET6 A;  3KLR A;  2WIN B;  1D5M C;  2M00 A;  5IGC A;  2N88 A;  3D4W A;  3H0G G;  4ABN A;  1YJN A;  1W2B A;  1KDB A;  1Q90 A;  4N9P A;  4EVO A;  2BA0 A;  1GUS A;  2D9U A;  1EU3 A;  4YCU A;  2PW5 A;  3HKS A;  3W1B A;  1VQ8 A;  4HR7 B;  2NVQ B;  2UXD L;  2ES2 A;  4K6L A;  2LXJ A;  3NQT A;  4DR4 L;  4A3G G;  3PO2 G;  4C1N I;  5E1F A;  2VB2 X;  3HOV B;  1IHZ A;  1TWF H;  4RGN A;  1TKW B;  2I5L X;  1L2F A;  3CCQ A;  2LY7 A;  3VYR A;  1SJE D;  2JJQ A;  5AJ3 L;  1V8Q A;  3DLL A;  2G9H D;  3RZD B;  4DAP A;  1GHJ A;  4ILW A;  3UDG A;  1S5B D;  2WII B;  4Q0F A;  1WTW A;  2NN6 G;  3H3V I;  1B8A A;  5GRO A;  1SAP A;  2PZU A;  4R8I A;  4V19 0;  2B63 H;  2EVB A;  4AYB G;  4R4T A;  5M3F G;  3S17 B;  4OO1 H;  4GNX B;  1STE A;  1ZKO A;  1S5F D;  1F9S A;  2PQA B;  5GAG C;  4JV5 L;  1QCB D;  3BDL A;  2WV6 D;  3D31 A;  1PH5 A;  2QKI C;  2Q8I B;  3T13 A;  3A8J E;  4GLX A;  3CC2 A;  1XNR Q;  4OGQ C;  3C3L A;  3GTL H;  4A76 A;  1I4P A;  4DUY Q;  1AZP A;  5EBC A;  4P71 A;  4IUR A;  4KKT A;  5EKI A;  1YJW A;  2R7Z B;  3M3Y H;  2VQF L;  5KGU A;  1GKH A;  4PMW A;  5I6W A;  3GQB A;  4S3S A;  1A2U A;  1BF4 A;  2X6G A;  3CMA A;  2R93 B;  4B3S L;  4AIM A;  3GDE A;  2MGS A;  1SLJ A;  4R1J A;  1T5X D;  1SFO H;  2K04 A;  1S5D D;  1FVI A;  1E2W A;  1SE2 A;  5C3X A;  2F03 A;  2HDL A;  2CW0 C;  4HCE A;  4FF3 A;  1E0B A;  1AE3 A;  2N49 A;  3T1Y Q;  1IXR A;  3CKI B;  5LMU L;  1TWG B;  3IFT A;  4YWL A;  1ZYR D;  1O78 A;  5C44 H;  3X3M A;  1OTC A;  4DAY B;  4LNQ A;  1G91 A;  1GXD C;  1J5E L;  1NNX A;  4LF9 Q;  3SHL A;  2O5J C;  3BDC A;  1W6J A;  5CR3 A;  4B9W A;  2SEB D;  3P7J A;  3GTP B;  2K5Q A;  3KF6 B;  3AU7 A;  1YIJ A;  3NEM A;  1TR5 A;  3CRK C;  5CBE E;  4JI5 Q;  3KUP A;  1I5F A;  1HNX Q;  4A3E G;  1DZ1 A;  1QJO A;  1V9P A;  5IYD H;  2ZJR A;  2OXP A;  2SNM A;  1CKN A;  3PIP 3;  2QCP X;  3P20 A;  3CF5 A;  1VQ5 A;  3NHH A;  5M5W H;  3HOX G;  4JI3 Q;  5M5Y B;  4DKA C;  3WDN A;  1NJI C;  1F2Y A;  5M5X B;  2A5H A;  2HQE A;  3M4Q A;  2KEC A;  3HZX A;  1LTB D;  2XGT A;  5I2Y A;  3K5N A;  1FNU A;  4QGU A;  1KL9 A;  1U4R A;  4GOP A;  4A3K H;  4QQB X;  5K36 G;  4R4O A;  3OTO L;  2GN5 A;  1B2T A;  4K6D A;  2EDG A;  4FNF A;  4LF5 Q;  4C56 C;  1UAP A;  3VR2 A;  2LMC B;  2I5H A;  5IP7 G;  4OWX B;  1WTO A;  4GKJ L;  3K7A B;  4ALP A;  4A3D H;  3R2T A;  4X6A H;  2JN4 A;  3KBX A;  1E3P A;  4R4I A;  3MFG A;  2LXK A;  1KNE A;  5IYC H;  2B2U C;  3CCR A;  3HG9 A;  3K57 A;  1SE8 A;  4LF4 L;  1TWC B;  4KHZ A;  3TP8 A;  4CDD C;  4DV2 Q;  1HR0 W;  1PRT B;  2CWA A;  4MN3 A;  3ICE A;  4R9W A;  3S14 H;  4DV0 L;  3TME A;  2F3W A;  5FJ8 H;  4B3R Q;  4U68 A;  1VQE A;  4GLA C;  4OX9 L;  2WP8 J;  3LX0 A;  3U58 A;  1TY2 A;  4B3T Q;  4WJ4 A;  1HHV A;  4KKU A;  4BBR H;  4C2M H;  1SMY C;  1YI2 A;  1LAB A;  4ULL A;  3J7A 5;  3S16 H;  1HFG A;  4J1M A;  1I6H B;  1Y1V H;  4KHP Q;  4A93 B;  1EFI D;  3MFY A;  4LMQ D;  5FK9 C;  3D3R A;  1QUQ A;  1ESF A;  1VQI A;  2A6E D;  4M1U B;  2JA8 G;  4BWG B;  1EYD A;  4A3C H;  2KCN A;  2ATW A;  1IBK L;  2QW7 A;  4K0K L;  1Z47 A;  1Q82 C;  1PYS B;  3FRP B;  3NBH A;  1Q1B A;  4DK0 A;  2ZTD A;  4B08 A;  2AMC B;  1B1Z A;  2X6L A;  5FLX L;  3MEH A;  2NUC A;  2H5X A;  2L9H A;  2IHE A;  4Y52 H;  5E4W C;  3PGZ A;  2R6G A;  2QF7 A;  2CFM A;  1K3B C;  3NTH A;  5J22 A;  1SN8 A;  2F0T A;  3E0E A;  3ERQ A;  3ERS X;  2MHV A;  3LGJ A;  2E2I B;  3E3X A;  1ZYR C;  3P75 A;  1EFW A;  4BA2 I;  2ZTC A;  4UP7 A;  4POF A;  4FXG C;  3A56 A;  5C4X H;  3ZJY C;  2EXD A;  5IY0 A;  1WCM B;  5D3D A;  2SDF A;  2MO1 A;  2OCE A;  4A4I A;  4KMU C;  3S1Q H;  1Q86 C;  2WKD A;  1TXY A;  1X32 A;  3RN2 A;  3O13 A;  5EBD A;  2DUD A;  4LFC Q;  3TS2 A;  4BY7 H;  1HTP A;  4PG3 A;  1WD1 A;  1PZI D;  3NP8 A;  1SND A;  5FO7 B;  5KND A;  5KNC A;  1A3U A;  1PTO H;  4C3H H;  1VDZ A;  1YHB A;  2Z6K A;  5JJI A;  1GHK A;  2PI2 E;  3BDO A;  2O4X A;  3AEV A;  5LMN W;  1XNR L;  2JA6 H;  5ELB A;  2B63 G;  3J7A F;  3OOC A;  2D62 A;  4DUY L;  4UAI A;  1PFS A;  3H0G H;  2RQX A;  1VQO A;  2Z9H A;  4GLV B;  3BJU A;  3SK4 A;  2BE5 C;  2A69 D;  2L5T A;  2M2L A;  1UWV A;  4L5Q A;  3DEP A;  4K14 A;  4F8M A;  2K75 A;  4A3G H;  4P74 A;  3PO2 H;  2B29 A;  1SMX A;  2K5W A;  2K05 A;  4CKC A;  5M3M G;  4OWT B;  5C4Z A;  1PFN A;  1S40 A;  3KFU A;  5ISR A;  4DR1 Q;  2ASB A;  1SR3 A;  4A3F H;  2PNR C;  1IYJ B;  3RN5 A;  4RFB A;  3NQI A;  2NN6 H;  3FVQ A;  1GVP A;  3KF8 A;  5KYI A;  1IBM Q;  1CT1 D;  3R93 A;  3VYS A;  3S1M H;  5C3E G;  2Q2H A;  1SYC A;  5M3F H;  1WTH A;  5IWA Q;  4XIG S;  1RF2 D;  1TWF B;  1PTO F;  1EOT A;  2KCM A;  5EKK A;  4JI5 L;  5EGT A;  2K5D A;  1HNX L;  4UY8 C;  3TRE A;  1M8A A;  2EE1 A;  2XRQ D;  4XTC S;  2Z1C A;  4DA2 A;  1D5Z C;  1VQ4 A;  4HJA A;  4GZY C;  1K9M C;  4RKB A;  4POG A;  1II3 A;  1DYQ A;  1I4X A;  4K2L A;  4YCW A;  2A6E C;  4LFA Q;  1PYB A;  4JI3 L;  1HZ9 A;  2WAQ B;  1ROD A;  4PZ6 A;  1QNU A;  2YTY A;  1ICW A;  5IGD A;  3MVV A;  4C3J H;  3TEH B;  4A3B G;  1YNX A;  1NSN S;  1B3A A;  4XYQ A;  3JC6 6;  3GTL B;  3RZO B;  1TWA B;  1IKM A;  4O2D A;  5EQ0 A;  3VYT A;  2Z6K C;  1RKN A;  3HKZ G;  1PH1 A;  3AQQ A;  2BH2 A;  3HFZ B;  4J15 A;  3M3Y B;  4LF5 L;  3W3A A;  4GKK Q;  1EQT A;  4KV6 A;  1X65 A;  4ZK9 B;  2E75 C;  4JC0 A;  2IX0 A;  2K7V A;  1W3S A;  3SK8 A;  5EKL A;  2BH8 A;  4A3K G;  1I3Q B;  1X3F A;  1SFO B;  5L37 A;  1D1K A;  3GTK H;  1HQM C;  3PV0 A;  3H15 A;  1F2M A;  1XMO Q;  3X3N A;  3I8Z A;  3AB9 A;  5EJW A;  4BBS B;  5E3F A;  1X9N A;  3D4R A;  4DK1 A;  4A3E H;  4DV5 Q;  2RDG A;  4C1N K;  1B9M A;  4O0A A;  3CC4 A;  4BY1 B;  1LO5 D;  4DV2 L;  2MP1 A;  3NWT A;  4RH6 A;  3FKI H;  4CKB A;  3HOX H;  4KLK A;  4WOR A;  3F1Z A;  4B3R L;  4EQ5 A;  4JOI C;  3C1F A;  1MI2 A;  1HR0 L;  4X62 Q;  2RKS A;  1K83 B;  5JEA J;  2F0W A;  3QO2 A;  1SNM A;  5ELF A;  2R7F A;  1V1Q A;  1Q8I A;  4EQP A;  2WAQ E;  1CUK A;  3OW7 A;  2K28 A;  3OWF A;  1Y8P B;  4WFN 3;  5M5W B;  2I46 A;  2LS0 1;  1H9J A;  5FJ8 G;  1XX8 A;  5K36 H;  3MC0 B;  4IPG A;  3HOW H;  4YIJ A;  3VYU A;  2E2J H;  2FXQ A;  1HJP A;  2HDM A;  4H02 A;  1RTO A;  1LV9 A;  1XYI A;  4WJ3 M;  2C5C A;  2KOL A;  5IP7 H;  3VR4 A;  3I4M G;  2CWP A;  1Y1V G;  2JA7 G;  2V4D A;  5F2D A;  4GNX A;  1BCP D;  2A69 C;  4MIU A;  2K50 A;  4YWM A;  3PUX A;  5DM6 3;  1IKL A;  5FO9 B;  2NVT H;  3KYH C;  3IRB A;  4JI7 Q;  4K8I A;  4P73 A;  2JA5 B;  1TS3 A;  2ZXP A;  3FPP A;  2JE6 I;  5DAU A;  4JI4 Q;  3P1H A;  3SK5 A;  5I9P A;  1H9R A;  1LYL A;  1L0X B;  3OIQ A;  1CQF A;  3MXG A;  2IX1 A;  5C3W A;  1KDC A;  3SK6 A;  1VQ6 A;  1EWI A;  1X56 A;  4XT3 B;  3GTQ H;  1XTC D;  1DON A;  2E74 C;  4ZCK A;  4IJL A;  4LW1 A;  3E6Z X;  3QIA A;  1LTA D;  1X3Q A;  4NPS A;  1O80 A;  3LWU A;  2JA8 H;  1TU2 B;  3CW2 C;  4BA1 I;  2HHH Q;  3LWE A;  4R4Q A;  4DV7 Q;  4LFC L;  2C9O A;  3F2D A;  2VY3 A;  4C2M B;  4LF7 Q;  1S3O A;  2YYZ A;  3FEW X;  1JOR A;  4DAY A;  5FLM G;  1HNW L;  3KOJ A;  1VQP A;  3J80 L;  2Z6B A;  3ND9 A;  2HT1 A;  2JXM B;  1IZ6 A;  4CJ2 C;  3PIP A;  4UPA A;  1KLU D;  3QJY A;  1CK1 A;  1OXS C;  5C4H A;  4X66 Q;  3M4O H;  4B9X A;  4DV1 Q;  2AWN A;  3RLO A;  4MNO A;  4L8J A;  2NBF A;  2EY2 A;  1HZA A;  5J39 A;  4HJ7 A;  1QWY A;  2J7Z A;  1Y14 B;  2IPK D;  2K52 A;  5GQO A;  2EXZ A;  1BBX C;  2V1C C;  1NMG A;  2IWH A;  2R92 G;  3JAM E;  2F4V L;  5JPN C;  4HIK A;  1N32 L;  1ZXT A;  1RJT A;  1QVC A;  2DJG C;  3V05 A;  2HIX A;  2R61 A;  3SXH A;  1DJR D;  1SE3 A;  1Y69 U;  1HFN A;  3DWQ A;  4JI8 Q;  1EWC A;  3HRZ C;  1I4Q A;  4CGY B;  3BVZ A;  1WTV A;  2Z4H A;  3I4N G;  2ALY B;  2E8G A;  4B3M L;  3PIO 3;  1B3Q A;  1U5K A;  2ZT9 C;  3G4S A;  4NXM Q;  1RDP D;  1STY A;  1NUC A;  1MHW C;  2F0J A;  2RDF A;  4DR3 Q;  1LTT D;  2JEB I;  4CDF C;  4DR1 L;  2FFK B;  4KTA A;  4FP5 D;  5EPJ A;  3T56 B;  1HNZ Q;  1P16 A;  1IBM L;  1JB7 A;  3MXU A;  4UP9 A;  1QB5 D;  3VDY A;  3S24 A;  1BDO A;  2NZH A;  4A75 A;  3S1Q B;  2XNA C;  5JJK A;  5IWA L;  3KLS X;  2KVM A;  5NUC A;  4LF8 Q;  3T4A C;  4LJZ C;  4DV4 L;  4JG2 A;  1HCZ A;  3CPW A;  1VQK A;  3FDT A;  2F3I A;  1X3P A;  3STB D;  4A3F G;  3PF5 A;  4DV6 Q;  4I7Z C;  4LF6 Q;  1EEI D;  3K80 C;  4HAE A;  5IT9 E;  2ID0 A;  1YNN C;  3I56 A;  1DCZ A;  1PH7 A;  2F0H A;  4LUZ A;  4XQJ A;  4LFA L;  1PH3 A;  3T16 A;  3CD6 A;  4FF2 A;  4HIO A;  5IGB A;  4I65 A;  3S1N H;  3HOU G;  2F0Q A;  2VL6 A;  1CKO A;  5EAY A;  1VQN A;  2VXW A;  3CQZ H;  3WOE A;  4IUQ A;  1H95 A;  1SYG A;  3K81 C;  4MTK A;  1N8R C;  2E5L Q;  1CA6 A;  4ZAI A;  4GN5 A;  1B7Y B;  1B53 A;  3ONA B;  2BDN A;  3U50 C;  2ZXO A;  4CHT B;  5M3M H;  1A6X A;  2VQE Q;  3H0G B;  4HSV A;  4AH6 A;  2XN9 C;  5JEA H;  1G2T A;  1PH6 A;  1C7Y A;  1VQH A;  4QIW B;  3F8T A;  2UUB L;  1JQY D;  2B2U A;  3A0J A;  2OQK A;  5DNF A;  4DPG A;  5CGK A;  1UE5 A;  4RG1 A;  4C3J G;  2UU9 Q;  1N9W A;  3BZD B;  1G8Z D;  4A3G B;  4XQQ A;  2PI2 A;  1FR3 A;  4RCN A;  2FMC A;  5C3E H;  1VQF A;  1BBU A;  2ZTE A;  4LAA A;  4Y7N H;  2A73 B;  1XMO L;  3E5S A;  5IGE A;  1B50 A;  4M8A A;  1EUJ A;  4YWK A;  1CSQ A;  4I7A A;  4N9T A;  2ICI A;  4DV5 L;  2PW7 A;  3CP0 A;  3OMG A;  4H7B A;  4UDU C;  1X3G A;  1XPU A;  1N36 Q;  5ELO A;  3ER0 A;  2HD3 A;  4AYB B;  1UEB A;  5M3F B;  1RL2 A;  5IT9 c;  1STG A;  4TKO B;  4GN4 B;  1BCP B;  4JBW A;  3R3O A;  4WJW A;  4A3J B;  4DK6 C;  4NP5 A;  1H9K A;  1PLF A;  4NXN Q;  2L4N A;  4OON A;  1STH A;  4AQY Q;  4JI1 Q;  3ITP A;  4X62 L;  1BQQ T;  1O7Z A;  2N55 A;  4QMG A;  2DN8 A;  1A8V A;  4A3B H;  2B8F A;  2K5H A;  2IL8 A;  3RLF A;  3FKI G;  1H9S B;  3HGB A;  4U67 3;  1D7Q A;  3CCL A;  4X64 Q;  2R3Z A;  1JE4 A;  1YNJ D;  2PCF B;  1EIG A;  1JC7 A;  1EY8 A;  5I9O A;  3H3V C;  2EIF A;  2J0T D;  1PRT C;  4N8X 1;  5C6A A;  3MWY W;  2F0P A;  3TZD A;  3H09 A;  2FMM A;  2K1B A;  3S2D H;  4RHR A;  3RMH A;  1F9R A;  1LT6 D;  1MJC A;  1SSO A;  1QIL A;  3G71 A;  1MD2 D;  4QIW E;  1ENF A;  5I6Y A;  3A8K E;  3GTO H;  4KY6 A;  1JJC B;  2DY7 A;  1CA5 A;  3I91 A;  4DXG A;  2SOB A;  3HOW G;  3QR8 A;  5LL6 S;  4TRD A;  4JI7 L;  1R4P B;  5HY6 A;  2Z8L A;  3K0Y A;  4IUV A;  2NTS A;  1AW7 A;  1KAW A;  4ZYS A;  4JBK A;  2KQ3 A;  1CFM A;  3Q0A A;  2Z4I A;  3RR5 A;  2F0L A;  4OIJ A;  1NR2 A;  1STN A;  5IP9 H;  5A2Q L;  4H0L C;  4FVM A;  3BZK A;  2E2D C;  4IJH A;  2A68 D;  5COR A;  4BS9 A;  4A3E B;  3L2P A;  2CKZ B;  4AYB E;  4YHH Q;  4L5S A;  4DR6 L;  4RCO A;  4Q5V A;  1R9T B;  1NBW A;  3EIV A;  2RCN A;  4XQN A;  2RSO A;  3STB C;  2EYP A;  1EIF A;  4LF7 L;  1CKM A;  4ZUJ A;  4DNI A;  1Y1W G;  1X54 A;  2NZ1 D;  3I4M H;  1KXL A;  1VS0 A;  1FGU A;  3CCS A;  1FNV A;  1Q46 A;  1QE6 A;  2JA7 H;  1JOK A;  1S5E D;  3HOZ G;  4K2K A;  2VUM G;  2YV5 A;  1QZH A;  1IBL Q;  5BN3 A;  4X66 L;  5GAE C;  4PQX A;  1J6Q A;  3OW2 A;  1SNQ A;  2CH4 A;  2D0O A;  2IW3 A;  1KDA A;  1SYB A;  4CDC C;  1PFB A;  2KCC A;  3SGI A;  1NCV A;  2EY5 A;  2VZA A;  3TDQ A;  2EY1 A;  3HOY G;  2MPM A;  2OT2 A;  4LWC A;  1GUT A;  3GTG H;  2RBM A;  1GUN A;  1GUO A;  1S5C D;  1B44 D;  4LK1 C;  2Q8T A;  3AYH B;  2L15 A;  3ULL A;  3T1H Q;  1XNQ Q;  1LTI D;  1RHP A;  2GVA A;  1BNZ A;  4DAM A;  1DD2 A;  1K73 C;  1LLR D;  1AZQ A;  1MGS A;  2R7D A;  2RSN A;  3OWE B;  2HCC A;  1EQQ A;  2OF1 A;  3PCO B;  2UUC Q;  1Q8K A;  3D8G A;  3N52 A;  3K7U C;  2QA4 A;  4PZ8 A;  2MQH A;  2ZM6 Q;  1KIX A;  1K8M A;  2IY5 B;  1FL0 A;  3G6J B;  4DR3 L;  5JVH 3;  1HZC A;  4TSS A;  1CHP D;  2B2Y A;  3UDX A;  1JOQ A;  3S1R B;  1HNZ L;  2NVX H;  5FLM H;  2E76 C;  3M4Y A;  4V0B A;  1DOM A;  2F3V A;  5D3I B;  5FO8 B;  2JA8 B;  1MJE A;  4CJ0 B;  1A0I A;  1LTR D;  2TSS A;  2F0V A;  4DV6 L;  4X3S A;  3KDF A;  1IW7 D;  5DM7 3;  3EFX D;  1PA6 A;  4LF6 L;  5JJL A;  3VA7 A;  2EZV A;  2HQL A;  4K5W A;  4JI2 Q;  3KJO A;  5E4X A;  4ZKC B;  1NE3 A;  1VQ7 A;  5DLQ E;  5C4J H;  3BZC A;  1EOV A;  2MNA A;  1L1O C;  2M9V A;  2R92 H;  4KKS A;  3M4O B;  3G7L A;  1UEA B;  3UE0 A;  1JR0 D;  3OHX C;  4XDX A;  3K8A A;  2KA7 A;  2E5L L;  4NMZ A;  1N33 Q;  5J3B A;  2DGY A;  3I4N H;  5FKA C;  3AFQ A;  4H13 C;  3TZU A;  2I0Q A;  2L12 A;  3QB3 A;  3CPF A;  3GTM H;  3K58 A;  4IZ8 A;  5G3L F;  2F0E A;  1Q3L A;  3HP3 A;  5A35 A;  1VCI A;  5FOB B;  1ET9 A;  5JJZ A;  3NE5 B;  2RF4 A;  1SRO A;  3EJI A;  1SYE A;  2A68 C;  3DM3 A;  2K14 A;  2B2T A;  3ULJ A;  1FD7 D;  2Q2I A;  5JEA G;  2ICE C;  1T9H A;  2KBN A;  3T1Y L;  3U9O A;  4DXF A;  4PNY A;  4FF1 A;  2I5M X;  3C1E A;  1SDF A;  1L1O B;  1VQC A;  4JOI A;  2RDH A;  1GJX A;  5IGG A;  1V1P B;  1KAA A;  2XWB B;  1N36 L;  4LF9 L;  3S15 H;  3UDF A;  5JAV A;  2MJ8 A;  3GP7 A;  4OEL B;  4DAV A;  4F88 A;  2B2Y C;  1WOC A;  2VB3 X;  3RLN A;  3HOU H;  4NXN L;  4AQY L;  1TWG H;  4JI1 L;  5CV4 A;  4JCV E;  1RIP A;  3EBE A;  4KHV A;  2UXD Q;  2B63 B;  2NB0 A;  3UE1 A;  1XPO A;  3L3O C;  4DR4 Q;  1CZW A;  4R8N A;  1IYV A;  1JIC A;  3MEF A;  3CCU A;  2D2C C;  4X64 L;  2PPB C;  3PO3 G;  2LFN A;  1CHQ D;  1JWS D;  1KLG D;  2QDL A;  4IUT A;  5EPK A;  1ILP A;  2A6H D;  3I3C A;  3JAM i;  1VQM A;  1CM9 A;  1EY7 A;  4G7H C;  4BY1 G;  2F0N A;  1YHA A;  4DR2 Q;  3A5Z B;  4CDE C;  2QEJ C;  3MXP A;  1O7Y A;  4DNT B;  4K8J A;  4ME5 A;  1BR9 A;  3QWN A;  1X3E A;  2UXC Q;  3IFD A;  3F2U A;  1HUM A;  2EYJ A;  4JV5 Q;  2F1M A;  3S2H H;  4JI6 Q;  1L0W A;  1SE4 A;  4GN3 B;  3IL8 A;  4A3M G;  1SXT A;  3FMC A;  3PQI A;  5C3E B;  4R4C A;  1LUZ A;  3Q22 A;  1X55 A;  1G51 A;  1PTO D;  2JA9 A;  4C3I G;  3PIO A;  3RNU A;  1FYC A;  1VMC A;  2O2L D;  3CXC A;  2OTL A;  4FYD A;  3L9A X;  1B4O A;  3NPP A;  3CCE A;  5BR8 Q;  5C44 B;  5IYB G;  2VQF Q;  1ENA A;  2KHS A;  2DNE A;  4YHH L;  1GUG A;  4KJO A;  1YVC A;  2A74 C;  1U4L A;  1XMQ Q;  1EY6 A;  2B2T C;  3TSS A;  2XTI A;  5IP9 G;  3PMF A;  1D1I A;  4B3T L;  3DXJ C;  3K5O A;  3MAQ A;  1CZG A;  3I70 A;  5LMU Q;  2B39 A;  1LM0 A;  5LL6 X;  4A3B B;  2JA5 G;  4KHP L;  1TS4 A;  5JOB A;  4HIM A;  2EPB A;  4HJ5 A;  4KJN A;  2MFI A;  2WB1 G;  1B70 B;  1EYC A;  2XVS A;  3HKZ B;  3E9H A;  3D6C A;  3ND8 A;  2WAC A;  1XPR A;  1T5E A;  4RWS C;  1ENC A;  3H6M A;  3CU7 A;  1HH2 P;  1W6K A;  2QEX A;  3J7A V;  1A3T A;  1VQA A;  2NYZ D;  4IFD I;  3TBI B;  2AUK A;  1VQG A;  5DEH A;  4IOA A;  5CV9 A;  4A3K B;  1I6H H;  1BOS A;  2K01 A;  2ZXR A;  3S2D B;  3R2I A;  1N34 Q;  1KD1 C;  2G9D A;  2IX3 A;  1AEX A;  4YCV A;  1XNQ L;  1TT2 A;  2PQA A;  3GTO B;  4RGM A;  2NTT A;  3DWP A;  5EPL A;  1DOL A;  4A3I G;  1ASZ A;  4FDB A;  5H1S E;  1NTG A;  3CCM A;  2KHJ A;  1QZG A;  1UUP A;  4A3D B;  2ZM6 L;  1FGB D;  1BBW A;  1CI3 M;  2OQ0 A;  3T53 B;  1I4H A;  4IPC A;  3TQY A;  3EN2 A;  2L55 A;  1EZ6 A;  1Y8O B;  2ZJP A;  5E7N A;  3W5O A;  3QOL A;  1Y1W H;  4G57 A;  1K28 A;  1GO3 E;  2L11 A;  5ELE A;  3C46 A;  1E1T A;  2ZJQ A;  3HOZ H;  3S14 B;  1PRT F;  4FXK C;  2VUM H;  4H44 C;  3I55 A;  1MSG A;  2F0S A;  1KRS A;  1G2S A;  1XXG A;  2CW0 D;  3J81 i;  5IOD A;  4BBR B;  3NTK A;  3HOY H;  4X3U A;  5T1I A;  3S16 B;  4JI2 L;  1E24 A;  3BYT B;  1Y1V B;  1O7I A;  2JA7 B;  5C5M A;  3HKZ E;  5CC4 A;  4IQZ A;  1TVX A;  3KF6 A;  4QUC A;  1KQS A;  2N78 A;  1DXM A;  2A6H C;  1E2Z A;  2H1E A;  4JI0 Q;  4K5V A;  4IUN A;  3OYY A;  3UDI A;  1GUW A;  3VR5 A;  1BXT A;  1EEF D;  1PDQ A;  1N33 L;  1ESR A;  5KRU A;  3GTG B;  4QY7 A;  2JEA I;  1H9S A;  1MKH A;  3NTI A;  4IFD G;  5FLX E;  1AE2 A;  1UNS A;  1EQV A;  3HOV G;  3KLW A;  1I50 H;  4X3T A;  1SNP A;  4HMI A;  2Y0S B;  1SEB D;  4RGT A;  3CCJ A;  4JK1 C;  2VW9 A;  1KC8 C;  1K8A C;  4K0K Q;  4QJF A;  1FNW A;  5KYL A;  1PTO C;  2UXB Q;  1KTK A;  2K32 A;  3LNN A;  1H9M A;  3NEN A;  4OWW B;  1JWU D;  3E0J A;  1EL0 A;  2RA4 A;  3K0X A;  2CQO A;  1VF7 A;  2PZT A;  1STB A;  1HXY D;  5C4X B;  5IGF A;  1JT8 A;  1VQD A;  3TP5 A;  3CME A;  3GTJ H;  1AP0 A;  2A19 A;  2CCZ A;  3NSW A;  4BXX G;  2K5V A;  1OXX K;  1UE6 A;  1GM5 A;  3U4V A;  1WD0 A;  2K33 A;  5CV8 A;  5CMD A;  1TII D;  5KIX A;  3PUY A;  5IOC A;  3NXW A;  2WFW A;  2R7Z G;  4BY7 B;  3K59 A;  4IPD A;  2RHQ B;  4CBV A;  1PHJ A;  5D14 A;  3URY A;  4N8F A;  3I2Z A;  5KNB A;  2R93 G;  5C4J B;  4OIK A;  1QNK A;  1Y8N B;  1SNC A;  3J7Y W;  2BOS A;  1PTO B;  1K0R A;  4O1N A;  1IL8 A;  4C3H B;  2R92 B;  1G6Z A;  5C0X G;  5FLX c;  2KHI A;  2EYO A;  1C8C A;  3MXN B;  3JAM c;  3G6E A;  2JA6 B;  4WRD A;  4IAL A;  2RVL A;  3VA5 A;  3DEO A;  3I4N B;  1SYF A;  1SMY D;  1BCP C;  1XTD A;  4DR2 L;  1WFQ A;  2MO0 A;  5LHY 1;  1HA5 A;  1HTL D;  2F0K A;  2F0I A;  5IIF A;  1IYU A;  1EIY B;  2UXC L;  4LUO A;  3I73 A;  4GKK L;  3GTM B;  2Y0S E;  3V96 A;  2LKV A;  4A3J G;  1L0Y B;  1HPC A;  3EQL C;  4G4K A;  3BS1 A;  4JI6 L;  4LFB Q;  3PO2 B;  4JBJ A;  3PUW A;  2JP1 A;  3DM1 A;  2KJX A;  2G5D A;  1JJ2 A;  1AH9 A;  2CHB D;  3NUC A;  5D65 A;  3DWA A;  3RZO H;  2E2H H;  1TWA H;  2D0P A;  2IT1 A;  2AWO A;  3CAM A;  5I4D A;  2P5Z X;  1XJV A;  2HUG A;  1BVS A;  3T51 B;  2FIN B;  4UHV A;  5BR8 L;  4A3F B;  1NR4 A;  4KY7 A;  4IFD J;  2NVY H;  2AHO B;  1SYD A;  3IKJ A;  1AFP A;  3ZYY X;  1X6O A;  3FP9 A;  2PZW A;  2EY6 A;  3S15 B;  1XMQ L;  3S1M B;  1WJJ A;  2RHS B;  3KK7 A;  4JYA Q;  2F0O A;  3J80 i;  3A7L A;  1PMR A;  3A55 A;  1I3Q H;  3PO3 H;  4YY3 Q;  1E7Z A;  2YU9 H;  3J81 j;  3HOU B;  1EU4 A;  3UI2 A;  4KK7 A;  4HTH A;  5BN5 A;  4BBS H;  4E6I A;  4HID A;  4BY1 H;  1LAC A;  1I94 Q;  4HJ8 A;  1G29 1;  3M7G A;  1MIU A;  3J81 E;  2GA4 B;  1SBB B;  4RKL A;  4KY5 A;  1ZEQ X;  2LSS A;  4C3J B;  3TP6 A;  4HCS A;  1DOK A;  4A3M H;  5IE8 A;  1K83 H;  1P8L A;  2AUJ D;  4C3I H;  1OXV A;  1N34 L;  1HA6 A;  4HSP A;  3EVQ A;  1VQJ A;  3FHW A;  2K03 A;  1S72 A;  5IYB H;  1B9N A;  3TRZ A;  3S2H B;  2F4I A;  3A54 A;  2XRS D;  4DV3 Q;  2KEN A;  1EYA A;  4ME3 A;  3BYY B;  1Z6H A;  1ONL A;  5C0X J;  4JI4 L;  2ENB A;  4HED A;  4A3L G;  1JJG A;  1STA A;  4DGZ A;  1U9R A;  4A93 G;  3GTK B;  3I4O A;  1D6E C;  3SR1 A;  3PUZ A;  2L0C A;  3SDZ A;  2FJ2 A;  1HUN A;  2WKC A;  1WI5 A;  3GV3 A;  1E22 A;  1C9O A;  2BE5 D;  4QUF A;  5HUR A;  2EYL A;  3SEB A;  2JA5 H;  1J9O A;  4DR7 Q;  3MA2 B;  3J7Z C;  3FKI B;  4JPB W;  1RTN A;  3U4Z A;  2RCF A;  1YJ9 A;  3HOX B;  2BCO A;  4KI0 A;  1XWE A;  1OO9 B;  2HHH L;  4DV7 L;  2N3S A;  1K3R A;  3J81 c;  2FHT A;  1L1O A;  3A8I E;  1E2V A;  4DUZ Q;  1V1P A;  1YIT A;  1A62 A;  2PMZ B;  1VF5 C;  1PV4 A;  1U4P A;  1EY0 A;  2A1A A;  1MSH A;  1RCV D;  1LTS D;  4P2C B;  4EQO A;  1FJG Q;  3EA6 A;  3D4D A;  1JE5 A;  4JW0 A;  1SRU A;  4FF4 A;  4DV1 L;  3G48 A;  4JI0 L;  3HOW B;  1C48 A;  1D2B A;  2O5I C;  2E2J B;  4P72 A;  4PV1 C;  3Q23 A;  5GAH C;  3R8B A;  4A3I H;  1M90 C;  3Q6S A;  4L5R C;  1YZ6 A;  1PXU A;  3A5U A;  4DFA A;  2K4K A;  1HR0 Q;  3D6W A;  1LT3 D;  1WCM G;  1LTG D;  3W2D A;  4NB3 A;  3DUZ A;  3H91 A;  1JCK B;  3CCV A;  1TS5 A;  3CC7 A;  2Q2T A;  1VMP A;  3NBI A;  4F87 A;  2NVT B;  4DU9 A;  2GVB A;  3BU2 A;  4DR5 Q;  1LT4 D;  4JI8 L;  3AMU A;  2EYM A;  4X3K A;  2CQA A;  2QDB A;  1A15 A;  2VNU D;  1TWH H;  2EJF C;  1LT5 D;  2UXB L;  2JSO A;  1WTX A;  3IAY A;  4NXM L;  4OO1 I;  1PH8 A;  2DJF C;  5CV5 A;  2EYH A;  4IO9 A;  1K8O A;  2EJG C;  3K6O A;  4NW2 A;  3GTQ B;  1Y1W B;  2C35 B;  1WYD A;  1QG7 A;  4ZRZ A;  3JAM L;  2F0U A;  4HJ9 A;  1M1K C;  5ELN A;  4GOP C;  5HGQ A;  3HOZ B;  3KBG A;  2VUM B;  4NDX A;  4LF8 L;  1F2Z A;  1TQO A;  1I4R A;  3CRL C;  2QIL A;  3M4P A;  2I07 B;  4CJ1 B;  3M9B A;  3I7F A;  2PMZ E;  1E1O A;  3HOY B;  3J80 E;  4ZUI A;  2NVQ H;  3M7N A;  5COY A;  1CKN B;  4IFD H;  4CKE A;  3GO5 A;  1BUV T;  5ELC A;  1ASY A;  1YNJ C;  5KEE A;  3HOV H;  1PFM A;  1BO0 A;  3E9I A;  4IUP A;  1JOO A;  2DNC A;  1A2T A;  2SNS A;  3GD7 A;  3OPO A;  3RZD H;  1HNW Q;  5BN4 A;  4GOP B;  1C0A A;  1F77 A;  2VQE L;  2X69 A;  5IT9 L;  1U0L A;  3S17 H;  1AN8 A;  2NZO A;  1I50 B;  2QGQ A;  3I4L A;  4RGO S;  5T1G A;  2AQ1 B;  4IOC A;  1PYW D;  1EY4 A;  2PYK A;  3M85 A;  2UU9 L;  1U4M A;  4LFB L;  3PSI A;  5C5L A;  1WTQ A;  3ULP A;  1SJH D;  5HGT A;  2A8V A;  4BXX H;  1D5X C;  4APV A;  3DHQ A;  1D8L A;  1YHQ A;  4OO1 G;  2WAQ G;  3SE0 A;  2AQ3 B;  1M4V A;  1Q7Y C;  3I72 A;  3W1G A;  4DF7 A;  3HEJ A;  3FPU B;  2F4V Q;  2R7Z H;  1N32 Q;  5LMN Q;  5ELD A;  1ML0 D;  2IHF A;  3GTJ B;  4EGV A;  4RHS A;  4ZQ3 A;  4X65 Q;  3RUZ A;  2XIW A;  3D0F A;  3PUV A;  3F2B A;  3J80 c;  4JYA L;  2R93 H;  2Q2U A;  3NWS A;  4B3M Q;  2UUA Q;  4YY3 L;  2JYO A;  5CYU A;  1HRJ A;  5C0X H;  2JK8 A;  5J1Z A;  2DY8 A;  4OXP A;  1CSP A;  3K5M A;  2XWJ B;  1I94 L;  4RA8 A;  4KD3 A;  1RD9 D;  4GS3 A;  5CBA E;  4IUU A;  1QUQ B;  4G7Z C;  5GAD C;  3GTP H;  3S1N B;  1QOH A;  1BKB A;  1TS2 A;  2B2V A;  4DV4 Q;  3MHB A;  3TP7 A;  2F0M A;  3CQZ B;  4ODG A;  4A3J H;  5AJ3 Q;  5G3L D;  4BBS G;  2F52 A;  4OL7 A;  5C44 G;  1J8I A;  3QOJ A;  2XSC A;  1PH2 A;  1G6P A;  1SNO A;  2H4O A;  3NBH B;  5M3M B;  1VQ9 A;  2EJM A;  5K5P A;  2D5D A;  4G7O C;  1EYG A;  5M5Y H;  1K8G A;  1JB3 A;  5I2X A;  3J81 L;  4PMB A;  1KNA A;  5M5X H;  4DK3 C;  4DV3 L;  3PF4 A;  1JMC A;  1WVL A;  5IYD G;  2AKW B;  4OEM B;  2VS1 A;  4MZ9 A;  2E2H B;  4OHJ A;  3MZ5 A;  4NKL A;  4Y7N B;  4IPH A;  1TY0 A;  3VR3 A;  5M9O A;  3WWV A;  4Z9C B;  3F2C A;  2UUB Q;  2NVY B;  3L7Z C;  1UE1 A;  4RMF A;  4DR7 L;  4MHE A;  2KEE A;  3SVM A;  1I4G A;  2EYF A;  3TS0 A;  3K7A H;  4B3S Q;  1ICF B;  1S4Z A;  4KN7 C;  5AFW A;  2KUM A;  3L0O A;  3PO3 B;  3BVM A;  2CVR A;  4JVZ A;  1PH9 A;  2YU9 B;  1BCP F;  1IW7 C;  1NMF A;  1WTP A;  2B8G A;  1KRT A;  1CQV A;  4PMC A;  4DUZ L;  2BA1 A;  1JWM D;  3KDF B;  4O42 A;  4TVA B;  1TWC H;  3K5L A;  3H3V H;  2CH4 W;  1J5E Q;  4MTN A;  1R9T H;  4A3D G;  2J4X A;  4HN7 A;  1FJG L;  2N8N A;  1IBL L;  4J6H A;  1IL2 A;  5IYC G;  1MBY A;  2OTJ A;  2PNH A;  1V43 A;  3QG1 A;  1EIH A;  5CV6 A;  1WTR A;  4FXD A;  4XXE A;  4A3M B;  2AQ2 B;  4A3L H;  1UE7 A;  4F7X A;  4A93 H;  2B2V C;  4C3I B;  1DGS A;  3C2P A;  1YNN D;  3T1H L;  3KJP A;  2K6A A;  1EY5 A;  3OMC A;  3A74 A;  4L5T A;  1A63 A;  2F0F A;  4DR5 L;  3MXN A;  2F0G A;  4QCL A;  4XYO A;  3ERO A;  2B2W A;  3Q8D A; 
#chains in the Genus database with same CATH homology
 1EY9 A;  2HCI A;  3NK9 A;  5A2Q E;  1V1O A;  3WOF A;  3GV6 A;  1NAP A;  5JVG 3;  5TSS A;  2PQE A;  2TMP A;  3TN2 A;  4FO2 A;  4ZLT F;  1DM0 B;  3N6R A;  5CV7 A;  1EWH A;  3BG3 A;  1F9P A;  3DMU A;  4QB4 A;  3U9S A;  3CHB D;  3Q24 A;  2WB1 B;  4L6T B;  5JPM C;  1Z7T A;  4ID6 A;  3S9W A;  4DNR B;  3KLS A;  1R4Q B;  4EQN A;  1OXT A;  3I4M B;  4L63 B;  2F0D A;  5C0X I;  1CTM A;  3A7A B;  4TQU S;  4QF4 A;  3VR6 A;  3H94 A;  1F9Q A;  4A3I B;  2IJ0 A;  1C4Q A;  2EOT A;  2NN6 I;  4KN4 C;  3HS0 C;  1ILQ A;  1GOZ A;  2OEO A;  4IN3 A;  4DN4 M;  1PZJ D;  4RAU C;  3RD4 A;  4XT1 B;  2PO4 A;  3OIP A;  4K5X A;  3I90 A;  1OXU A;  2BDO A;  3BVG A;  4KD4 A;  1TWH B;  1PRT D;  4J8Q A;  3OSO A;  4HMJ A;  1Q1E A;  2Q8R E;  1F2L A;  4ZKB B;  1Q12 A;  2B2W C;  4C3H G;  1O7L A;  2L1B A;  3V2T A;  1EZ8 A;  1PZK D;  2KED A;  2NVX B;  1A3V A;  3MTS A;  1I6V C;  1HQR D;  1KAB A;  2NWG A;  2MUY A;  1ET6 A;  3KLR A;  2WIN B;  1D5M C;  2M00 A;  5IGC A;  2N88 A;  3D4W A;  4ABN A;  1KDB A;  1Q90 A;  4N9P A;  4EVO A;  2BA0 A;  1GUS A;  2D9U A;  1EU3 A;  2PW5 A;  4HR7 B;  2NVQ B;  4K6L A;  3NQT A;  4C1N I;  5E1F A;  2VB2 X;  3HOV B;  1IHZ A;  4RGN A;  1TKW B;  2LY7 A;  3VYR A;  1SJE D;  1V8Q A;  2G9H D;  3RZD B;  4DAP A;  1GHJ A;  4ILW A;  1S5B D;  2WII B;  4Q0F A;  1WTW A;  2NN6 G;  1SAP A;  2PZU A;  4R8I A;  4V19 0;  2EVB A;  3S17 B;  4OO1 H;  1STE A;  1ZKO A;  1S5F D;  1F9S A;  1QCB D;  3BDL A;  2WV6 D;  3D31 A;  2QKI C;  2Q8I B;  3T13 A;  3A8J E;  4OGQ C;  3C3L A;  1I4P A;  1AZP A;  5EBC A;  4IUR A;  4KKT A;  5EKI A;  2R7Z B;  5KGU A;  4PMW A;  5I6W A;  3GQB A;  4S3S A;  1A2U A;  1BF4 A;  2X6G A;  2R93 B;  2MGS A;  1T5X D;  2K04 A;  1S5D D;  1E2W A;  1SE2 A;  5C3X A;  2F03 A;  2HDL A;  2CW0 C;  4HCE A;  4FF3 A;  1E0B A;  3CKI B;  1TWG B;  3IFT A;  1ZYR D;  1O78 A;  3X3M A;  1G91 A;  1GXD C;  3SHL A;  2O5J C;  3BDC A;  1W6J A;  5CR3 A;  4B9W A;  2SEB D;  3P7J A;  3GTP B;  2K5Q A;  3AU7 A;  1TR5 A;  3CRK C;  5CBE E;  3KUP A;  1DZ1 A;  1QJO A;  2OXP A;  2SNM A;  3PIP 3;  2QCP X;  3P20 A;  3NHH A;  5M5Y B;  3WDN A;  1F2Y A;  5M5X B;  2A5H A;  2HQE A;  2KEC A;  3HZX A;  1LTB D;  5I2Y A;  3K5N A;  1FNU A;  1U4R A;  5K36 G;  1B2T A;  4K6D A;  2EDG A;  4FNF A;  4C56 C;  1UAP A;  3VR2 A;  2LMC B;  1WTO A;  3K7A B;  3R2T A;  3KBX A;  3MFG A;  1KNE A;  2B2U C;  3HG9 A;  3K57 A;  1TWC B;  4KHZ A;  3TP8 A;  1PRT B;  4MN3 A;  4R9W A;  3TME A;  2F3W A;  4U68 A;  2WP8 J;  3LX0 A;  1TY2 A;  1HHV A;  4KKU A;  1SMY C;  1LAB A;  4ULL A;  1HFG A;  4J1M A;  1I6H B;  4A93 B;  1EFI D;  3MFY A;  4LMQ D;  5FK9 C;  3D3R A;  1ESF A;  2A6E D;  4M1U B;  4BWG B;  1EYD A;  2KCN A;  1Z47 A;  3FRP B;  3NBH A;  1Q1B A;  4DK0 A;  4B08 A;  1B1Z A;  2X6L A;  5FLX L;  3MEH A;  2NUC A;  2L9H A;  5E4W C;  2R6G A;  2QF7 A;  3NTH A;  5J22 A;  2F0T A;  3ERQ A;  2MHV A;  2E2I B;  1ZYR C;  3P75 A;  4BA2 I;  4FXG C;  3A56 A;  1WCM B;  5D3D A;  2SDF A;  4KMU C;  2WKD A;  1X32 A;  3O13 A;  5EBD A;  1HTP A;  1WD1 A;  1PZI D;  3NP8 A;  1SND A;  5FO7 B;  5KND A;  5KNC A;  1A3U A;  1PTO H;  1VDZ A;  1GHK A;  3BDO A;  2O4X A;  5ELB A;  3J7A F;  3OOC A;  2D62 A;  4UAI A;  2RQX A;  3SK4 A;  2BE5 C;  2A69 D;  2L5T A;  2M2L A;  3DEP A;  4K14 A;  4F8M A;  2K5W A;  2K05 A;  4CKC A;  5C4Z A;  1PFN A;  5ISR A;  2PNR C;  4RFB A;  3NQI A;  2NN6 H;  3FVQ A;  3KF8 A;  5KYI A;  1CT1 D;  3R93 A;  3VYS A;  1SYC A;  4XIG S;  1RF2 D;  1TWF B;  1PTO F;  1EOT A;  5EKK A;  5EGT A;  2K5D A;  1M8A A;  2EE1 A;  2XRQ D;  4XTC S;  2Z1C A;  4DA2 A;  1D5Z C;  4GZY C;  4RKB A;  1II3 A;  1DYQ A;  1I4X A;  4K2L A;  2A6E C;  2WAQ B;  1ROD A;  1QNU A;  1ICW A;  5IGD A;  3MVV A;  1NSN S;  1B3A A;  4XYQ A;  3GTL B;  3RZO B;  1TWA B;  1IKM A;  5EQ0 A;  3VYT A;  1RKN A;  3M3Y B;  3W3A A;  1EQT A;  4KV6 A;  4ZK9 B;  2E75 C;  2IX0 A;  2K7V A;  3SK8 A;  5EKL A;  1I3Q B;  1SFO B;  1D1K A;  1HQM C;  3PV0 A;  1F2M A;  3X3N A;  3I8Z A;  3AB9 A;  5EJW A;  4BBS B;  5E3F A;  3D4R A;  4DK1 A;  2RDG A;  4C1N K;  1B9M A;  4BY1 B;  1LO5 D;  2MP1 A;  3NWT A;  4RH6 A;  4CKB A;  4WOR A;  3C1F A;  1MI2 A;  2RKS A;  1K83 B;  5JEA J;  2F0W A;  3QO2 A;  1SNM A;  5ELF A;  1Q8I A;  4EQP A;  3OW7 A;  2K28 A;  3OWF A;  1Y8P B;  4WFN 3;  5M5W B;  2I46 A;  2LS0 1;  1H9J A;  1XX8 A;  5K36 H;  3MC0 B;  4YIJ A;  3VYU A;  2HDM A;  1XYI A;  1RTO A;  1LV9 A;  2C5C A;  2KOL A;  3VR4 A;  2V4D A;  5F2D A;  1BCP D;  2A69 C;  4MIU A;  3PUX A;  5DM6 3;  1IKL A;  5FO9 B;  4K8I A;  2JA5 B;  1TS3 A;  2ZXP A;  3FPP A;  2JE6 I;  5DAU A;  3P1H A;  3SK5 A;  5I9P A;  1H9R A;  1L0X B;  3OIQ A;  1CQF A;  3MXG A;  2IX1 A;  5C3W A;  1KDC A;  3SK6 A;  4XT3 B;  1XTC D;  1DON A;  2E74 C;  3E6Z X;  3QIA A;  1LTA D;  1X3Q A;  1O80 A;  3LWU A;  1TU2 B;  4BA1 I;  3LWE A;  2C9O A;  4C2M B;  2YYZ A;  3FEW X;  1JOR A;  4DAY A;  3J80 L;  3ND9 A;  2JXM B;  4CJ2 C;  1KLU D;  3QJY A;  1CK1 A;  1OXS C;  5C4H A;  4B9X A;  2AWN A;  4L8J A;  2NBF A;  2EY2 A;  5J39 A;  1QWY A;  2J7Z A;  2IPK D;  2EXZ A;  1BBX C;  2IWH A;  3JAM E;  5JPN C;  1ZXT A;  1RJT A;  3V05 A;  2R61 A;  3SXH A;  1DJR D;  1SE3 A;  1Y69 U;  1HFN A;  3DWQ A;  1EWC A;  3HRZ C;  1I4Q A;  4CGY B;  3BVZ A;  1WTV A;  2Z4H A;  3PIO 3;  2ZT9 C;  1RDP D;  1STY A;  1NUC A;  2F0J A;  2RDF A;  1LTT D;  2JEB I;  2FFK B;  4KTA A;  4FP5 D;  5EPJ A;  3T56 B;  3MXU A;  1QB5 D;  1BDO A;  3S1Q B;  2XNA C;  3KLS X;  2KVM A;  5NUC A;  3T4A C;  4LJZ C;  1HCZ A;  3FDT A;  1X3P A;  4I7Z C;  1EEI D;  4HAE A;  5IT9 E;  2ID0 A;  1YNN C;  1DCZ A;  2F0H A;  4XQJ A;  3T16 A;  4FF2 A;  5IGB A;  4I65 A;  2F0Q A;  2VXW A;  3WOE A;  4IUQ A;  1SYG A;  1CA6 A;  4ZAI A;  1B53 A;  3ONA B;  2BDN A;  2ZXO A;  4CHT B;  1A6X A;  3H0G B;  4HSV A;  2XN9 C;  5JEA H;  1G2T A;  4QIW B;  1JQY D;  2B2U A;  5DNF A;  5CGK A;  4C3J G;  3BZD B;  1G8Z D;  4A3G B;  4XQQ A;  1FR3 A;  4RCN A;  2FMC A;  4LAA A;  2A73 B;  3E5S A;  5IGE A;  1B50 A;  4M8A A;  4N9T A;  2ICI A;  2PW7 A;  3OMG A;  4H7B A;  4UDU C;  4AYB B;  5M3F B;  1STG A;  4TKO B;  1BCP B;  4JBW A;  3R3O A;  4WJW A;  4A3J B;  4NP5 A;  1H9K A;  1PLF A;  2L4N A;  1STH A;  3ITP A;  1BQQ T;  1O7Z A;  2N55 A;  4QMG A;  2DN8 A;  2B8F A;  2IL8 A;  3RLF A;  1H9S B;  3HGB A;  4U67 3;  2R3Z A;  1JE4 A;  1YNJ D;  2PCF B;  1EIG A;  1JC7 A;  1EY8 A;  5I9O A;  3H3V C;  2J0T D;  1PRT C;  5C6A A;  3MWY W;  2F0P A;  3TZD A;  3H09 A;  2FMM A;  2K1B A;  4RHR A;  3RMH A;  1F9R A;  1LT6 D;  1SSO A;  1QIL A;  1MD2 D;  1ENF A;  5I6Y A;  3A8K E;  4KY6 A;  2DY7 A;  1CA5 A;  3I91 A;  4DXG A;  2SOB A;  5LL6 S;  4TRD A;  1R4P B;  2Z8L A;  3K0Y A;  4IUV A;  2NTS A;  1AW7 A;  4ZYS A;  2KQ3 A;  1CFM A;  3Q0A A;  2Z4I A;  2F0L A;  4OIJ A;  1NR2 A;  1STN A;  5A2Q L;  4H0L C;  4FVM A;  2E2D C;  2A68 D;  5COR A;  4BS9 A;  4A3E B;  4RCO A;  4Q5V A;  1R9T B;  4XQN A;  2RSO A;  2EYP A;  4ZUJ A;  2NZ1 D;  1FNV A;  1QE6 A;  1JOK A;  1S5E D;  4K2K A;  5BN3 A;  4PQX A;  1SNQ A;  2IW3 A;  1KDA A;  1SYB A;  1PFB A;  2KCC A;  1NCV A;  2EY5 A;  3TDQ A;  2EY1 A;  2MPM A;  2OT2 A;  1GUT A;  2RBM A;  1GUN A;  1GUO A;  1S5C D;  1B44 D;  4LK1 C;  2Q8T A;  1LTI D;  1RHP A;  1BNZ A;  1DD2 A;  1AZQ A;  1LLR D;  1MGS A;  2RSN A;  3OWE B;  2HCC A;  2OF1 A;  3D8G A;  3N52 A;  1K8M A;  3G6J B;  5JVH 3;  4TSS A;  1CHP D;  2B2Y A;  1JOQ A;  3S1R B;  2E76 C;  3M4Y A;  4V0B A;  1DOM A;  2F3V A;  5D3I B;  5FO8 B;  2JA8 B;  4CJ0 B;  1LTR D;  2TSS A;  2F0V A;  4X3S A;  1IW7 D;  5DM7 3;  3EFX D;  3VA7 A;  2EZV A;  4K5W A;  5E4X A;  4ZKC B;  2M9V A;  4KKS A;  3M4O B;  3G7L A;  1UEA B;  1JR0 D;  3OHX C;  4XDX A;  2KA7 A;  4NMZ A;  5FKA C;  4H13 C;  3TZU A;  2L12 A;  3QB3 A;  3K58 A;  4IZ8 A;  5G3L F;  2F0E A;  1Q3L A;  3HP3 A;  5A35 A;  1VCI A;  5FOB B;  1ET9 A;  5JJZ A;  3NE5 B;  3EJI A;  1SYE A;  2A68 C;  2B2T A;  1FD7 D;  5JEA G;  2ICE C;  3U9O A;  4DXF A;  4PNY A;  4FF1 A;  3C1E A;  1SDF A;  2RDH A;  1GJX A;  5IGG A;  1V1P B;  1KAA A;  2XWB B;  5JAV A;  2MJ8 A;  3GP7 A;  4DAV A;  4F88 A;  2B2Y C;  2VB3 X;  5CV4 A;  4KHV A;  2B63 B;  2NB0 A;  3L3O C;  1CZW A;  4R8N A;  1IYV A;  1JIC A;  2D2C C;  2PPB C;  2LFN A;  1CHQ D;  1JWS D;  1KLG D;  5EPK A;  4IUT A;  1ILP A;  2A6H D;  3I3C A;  1CM9 A;  1EY7 A;  4G7H C;  2F0N A;  2QEJ C;  3MXP A;  1O7Y A;  4DNT B;  4K8J A;  4ME5 A;  1BR9 A;  3QWN A;  3IFD A;  3F2U A;  1HUM A;  2EYJ A;  2F1M A;  1SE4 A;  3IL8 A;  1SXT A;  3FMC A;  5C3E B;  3Q22 A;  4C3I G;  1PTO D;  1FYC A;  1VMC A;  2O2L D;  4FYD A;  3L9A X;  1B4O A;  3NPP A;  5C44 B;  1ENA A;  2KHS A;  2DNE A;  1GUG A;  4KJO A;  2A74 C;  1U4L A;  1EY6 A;  2B2T C;  3TSS A;  3PMF A;  1D1I A;  3DXJ C;  3K5O A;  3MAQ A;  1CZG A;  3I70 A;  2B39 A;  5LL6 X;  4A3B B;  1TS4 A;  5JOB A;  2EPB A;  4KJN A;  1EYC A;  2XVS A;  3HKZ B;  3D6C A;  3ND8 A;  2WAC A;  1T5E A;  4RWS C;  1ENC A;  3H6M A;  3CU7 A;  1W6K A;  3J7A V;  1A3T A;  2NYZ D;  4IFD I;  3TBI B;  2AUK A;  5DEH A;  5CV9 A;  4A3K B;  1BOS A;  2K01 A;  2ZXR A;  3S2D B;  3R2I A;  2G9D A;  2IX3 A;  1AEX A;  1TT2 A;  3GTO B;  4RGM A;  2NTT A;  3DWP A;  5EPL A;  1DOL A;  1UUP A;  4A3D B;  1FGB D;  3T53 B;  1CI3 M;  1I4H A;  2L55 A;  1EZ6 A;  1Y8O B;  3QOL A;  4G57 A;  2L11 A;  5ELE A;  3C46 A;  3S14 B;  1PRT F;  4FXK C;  4H44 C;  1MSG A;  2F0S A;  1G2S A;  1XXG A;  2CW0 D;  5IOD A;  4BBR B;  3NTK A;  4X3U A;  5T1I A;  3S16 B;  3BYT B;  1Y1V B;  2JA7 B;  5C5M A;  5CC4 A;  4IQZ A;  1TVX A;  4QUC A;  1DXM A;  2A6H C;  1E2Z A;  2H1E A;  4K5V A;  4IUN A;  1GUW A;  3VR5 A;  1BXT A;  1EEF D;  1PDQ A;  1ESR A;  5KRU A;  3GTG B;  2JEA I;  1H9S A;  3NTI A;  4IFD G;  5FLX E;  1UNS A;  1EQV A;  4X3T A;  1SNP A;  4HMI A;  2Y0S B;  1SEB D;  4RGT A;  4JK1 C;  5KYL A;  1FNW A;  1PTO C;  1KTK A;  2K32 A;  3LNN A;  1H9M A;  1JWU D;  3E0J A;  1EL0 A;  2RA4 A;  1VF7 A;  2PZT A;  1STB A;  1HXY D;  5C4X B;  5IGF A;  3TP5 A;  1AP0 A;  3NSW A;  1OXX K;  1WD0 A;  2K33 A;  5CV8 A;  5CMD A;  1TII D;  5KIX A;  3PUY A;  5IOC A;  3NXW A;  4BY7 B;  3K59 A;  4CBV A;  5D14 A;  3URY A;  5KNB A;  5C4J B;  4OIK A;  1QNK A;  1Y8N B;  1SNC A;  3J7Y W;  2BOS A;  1PTO B;  4C3H B;  4O1N A;  1IL8 A;  2R92 B;  1G6Z A;  5C0X G;  2EYO A;  1C8C A;  2JA6 B;  4WRD A;  4IAL A;  2RVL A;  3VA5 A;  3DEO A;  3I4N B;  1SYF A;  1SMY D;  1BCP C;  5LHY 1;  1HA5 A;  1HTL D;  2F0K A;  2F0I A;  5IIF A;  1IYU A;  3I73 A;  3GTM B;  3V96 A;  2LKV A;  1L0Y B;  1HPC A;  3EQL C;  4G4K A;  3BS1 A;  3PO2 B;  3PUW A;  2JP1 A;  3DM1 A;  2KJX A;  2CHB D;  3NUC A;  5D65 A;  3DWA A;  2IT1 A;  2AWO A;  5I4D A;  2HUG A;  3T51 B;  2FIN B;  4A3F B;  1NR4 A;  4KY7 A;  4IFD J;  1SYD A;  3IKJ A;  1AFP A;  3ZYY X;  2PZW A;  2EY6 A;  3S15 B;  3S1M B;  3KK7 A;  2F0O A;  3A7L A;  1PMR A;  3A55 A;  3HOU B;  1EU4 A;  3UI2 A;  4KK7 A;  4HTH A;  5BN5 A;  4E6I A;  1LAC A;  1G29 1;  3M7G A;  3J81 E;  2GA4 B;  1SBB B;  4RKL A;  4KY5 A;  1ZEQ X;  4C3J B;  3TP6 A;  4HCS A;  1DOK A;  2AUJ D;  1OXV A;  1HA6 A;  4HSP A;  3EVQ A;  2K03 A;  1B9N A;  3S2H B;  2F4I A;  3A54 A;  2XRS D;  1EYA A;  3BYY B;  1Z6H A;  1ONL A;  5C0X J;  2ENB A;  4HED A;  1STA A;  4DGZ A;  1U9R A;  3GTK B;  1D6E C;  3SR1 A;  3PUZ A;  2L0C A;  3SDZ A;  2FJ2 A;  1HUN A;  2WKC A;  3GV3 A;  2BE5 D;  4QUF A;  5HUR A;  2EYL A;  3SEB A;  1J9O A;  3MA2 B;  3FKI B;  1RTN A;  3HOX B;  2BCO A;  4KI0 A;  1XWE A;  1OO9 B;  2FHT A;  3A8I E;  1E2V A;  1V1P A;  2PMZ B;  1VF5 C;  1U4P A;  1EY0 A;  1MSH A;  1RCV D;  1LTS D;  4P2C B;  4EQO A;  3EA6 A;  3D4D A;  4FF4 A;  3HOW B;  1C48 A;  1D2B A;  2O5I C;  2E2J B;  4PV1 C;  3Q23 A;  3R8B A;  3Q6S A;  1PXU A;  4DFA A;  3D6W A;  1LT3 D;  1LTG D;  3W2D A;  3DUZ A;  3H91 A;  1JCK B;  1TS5 A;  1VMP A;  3NBI A;  4F87 A;  2NVT B;  4DU9 A;  1LT4 D;  3AMU A;  2EYM A;  4X3K A;  2CQA A;  2QDB A;  1A15 A;  2VNU D;  2EJF C;  1LT5 D;  2JSO A;  1WTX A;  3IAY A;  4OO1 I;  5CV5 A;  2EYH A;  1K8O A;  2EJG C;  3K6O A;  4NW2 A;  3GTQ B;  1Y1W B;  1QG7 A;  4ZRZ A;  3JAM L;  2F0U A;  3HOZ B;  3KBG A;  2VUM B;  4NDX A;  1F2Z A;  1TQO A;  1I4R A;  3CRL C;  2QIL A;  2I07 B;  4CJ1 B;  3HOY B;  3J80 E;  4ZUI A;  3M7N A;  5COY A;  4IFD H;  4CKE A;  3GO5 A;  1BUV T;  5ELC A;  1YNJ C;  5KEE A;  1PFM A;  1BO0 A;  4IUP A;  1JOO A;  2DNC A;  1A2T A;  2SNS A;  3GD7 A;  3OPO A;  5BN4 A;  1F77 A;  2X69 A;  5IT9 L;  1AN8 A;  1I50 B;  3I4L A;  4RGO S;  5T1G A;  2AQ1 B;  1PYW D;  1EY4 A;  2PYK A;  3M85 A;  1U4M A;  5C5L A;  1WTQ A;  1SJH D;  5HGT A;  1D5X C;  3DHQ A;  4OO1 G;  3SE0 A;  2AQ3 B;  1M4V A;  3I72 A;  4DF7 A;  3HEJ A;  3FPU B;  5ELD A;  1ML0 D;  3GTJ B;  4EGV A;  4RHS A;  4ZQ3 A;  3RUZ A;  2XIW A;  3PUV A;  3NWS A;  2JYO A;  5CYU A;  1HRJ A;  5C0X H;  5J1Z A;  2DY8 A;  3K5M A;  2XWJ B;  4RA8 A;  4KD3 A;  1RD9 D;  5CBA E;  4IUU A;  4G7Z C;  3S1N B;  1QOH A;  1TS2 A;  2B2V A;  3MHB A;  3TP7 A;  2F0M A;  3CQZ B;  4ODG A;  5G3L D;  4OL7 A;  1J8I A;  3QOJ A;  2XSC A;  1SNO A;  2H4O A;  5M3M B;  2EJM A;  5K5P A;  2D5D A;  4G7O C;  1JB3 A;  5I2X A;  3J81 L;  4PMB A;  1KNA A;  1WVL A;  2E2H B;  4OHJ A;  3MZ5 A;  4NKL A;  4Y7N B;  1TY0 A;  3VR3 A;  5M9O A;  4Z9C B;  2NVY B;  3L7Z C;  4MHE A;  2KEE A;  3SVM A;  1I4G A;  2EYF A;  1S4Z A;  4KN7 C;  5AFW A;  2KUM A;  3PO3 B;  3BVM A;  2CVR A;  2YU9 B;  1BCP F;  1IW7 C;  1WTP A;  2B8G A;  1CQV A;  4PMC A;  2BA1 A;  1JWM D;  4O42 A;  3K5L A;  2J4X A;  4HN7 A;  4J6H A;  1MBY A;  1V43 A;  3QG1 A;  1EIH A;  5CV6 A;  1WTR A;  4FXD A;  4XXE A;  4A3M B;  2AQ2 B;  4F7X A;  2B2V C;  4C3I B;  3C2P A;  1YNN D;  2K6A A;  1EY5 A;  3OMC A;  2F0F A;  3MXN A;  2F0G A;  4QCL A;  4XYO A;  3ERO A;  2B2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...