2F0MA

Crystal structure of staphylococcal nuclease mutant v23l/i72v
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0mA00
2M00A 3D8GA 3PMFA 2NUCA 1EY5A 3LX0A 2WACA 3E5SA 4RKLA 3MXPA 3QOLA 3ITPA 1JORA 5CV5A 2OXPA 4KY7A 5CV6A 5ISRA 1SNDA 5CV7A 5KYLA 4WRDA 5EKLA 4IALA 4WORA 1IHZA 2F0OA 3V2TA 5KEEA 5C4ZA 2EY6A 2EYLA 2EYOA 4KY6A 4KJNA 1SYEA 2RDFA 5J39A 4H7BA 5IGBA 3OMCA 1KDCA 1EY9A 4K2LA 4N9PA 1F2ZA 5I6YA 4MIUA 4K8IA 3BDLA 2F0LA 3DHQA 4ME5A 3SK6A 2F0JA 3SXHA 3EJIA 4QB4A 4ZUJA 3U9OA 1STYA 4R8NA 2PYKA 2EXZA 4DGZA 3OMGA 5KGUA 1SYDA 1AEXA 2KQ3A 3C1EA 4K2KA 1EYDA 5KYIA 1F2MA 3BDCA 2F0VA 1NUCA 1EQVA 1EY7A 4NMZA 1TT2A 5C5LA 1II3A 2HQEA 1EY4A 4IUNA 4IZ8A 4TRDA 4F8MA 4KY5A 3SK4A 5HURA 4NKLA 4PMBA 5JOBA 3R3OA 5C6AA 5M9OA 5C4HA 2F3WA 3NP8A 1ENCA 2F3VA 4RKBA 4QMGA 4F7XA 3TP6A 2RBMA 1SYCA 3D4DA 5CC4A 1ENAA 5IIFA 3OWFA 4DF7A 1SYGA 1TR5A 1SYBA 2RKSA 4J1MA 4N9TA 2EY2A 4K5XA 5EKKA 4KV6A 4EQNA 5I9PA 2F0MA 2EYFA 3D4WA 4HMIA 4HTHA 5E3FA 5K5PA 4LAAA 5IGGA 2PZWA 4K6DA 4KTAA 3SK5A 1EY6A 3NQTA 2EYPA 4QF4A 4ID6A 1STHA 4E6IA 2F0QA 1STBA 1RKNA 1KDAA 4PMCA 5CV9A 4YIJA 2F0DA 1STAA 5E1FA 5J1ZA 5I9OA 5IGCA 3MVVA 1KABA 3MZ5A 4B9WA 4DFAA 3ERQA 4DU9A 5C3WA 2OEOA 4PNYA 5NUCA 2F0WA 1SNQA 3TMEA 3SK8A 2EYMA 2O4XA 3P1HA 2F0PA 2F0UA 5IGEA 1A2UA 3SR1A 1STNA 1A3VA 3NUCA 5IOCA 2PW7A 3OSOA 1SNPA 1SNOA 2ENBA 1EZ6A 5JAVA 1SNCA 4ODGA 4EQPA 1SNMA 3QOJA 4ZQ3A 5F2DA 3HZXA 2EYJA 3NK9A 4K14A 3MHBA 4NP5A 5DEHA 3EROA 2SNMA 5J22A 4KJOA 5I6WA 4B9XA 2EY5A 1KAAA 5HGTA 5EGTA 1STGA 1EY0A 5C5MA 3D6CA 2EY1A 2F0FA 5KIXA 4OL7A 2LKVA 4KHVA 2SNSA 1A3UA 1EY8A 1NSNS 1EYAA 3QB3A 2F0TA 4I65A 3VA5A 4KD3A 2F0GA 1TQOA 3DMUA 5CV4A 2PQEA 3SHLA 2PZTA 5KRUA 1JOKA 5CGKA 2OF1A 3S9WA 1KDBA 3NHHA 2PW5A 1EZ8A 2F0KA 4G57A 4K5VA 1A2TA 1JOQA 2F0NA 4NDXA 1F2YA 1SYFA 4K8JA 4ZUIA 2F0EA 4S3SA 3H6MA 3TP5A 2SOBA 5IGDA 4KD4A 1U9RA 2PZUA 2F0SA 2QDBA 5CR3A 3RUZA 3NXWA 2F0IA 5C3XA 4HMJA 4EVOA 2KHSA 3T16A 5IGFA 3MEHA 4EQOA 3T13A 5IODA 3HEJA 1JOOA 1A3TA 3C1FA 3P75A 5CV8A 4J6HA 2EYHA 5DAUA 1EYCA 3TP7A 2F0HA 3TP8A 3EVQA 4K5WA
chains in the Genus database with same CATH superfamily
1NR2A 2VQFQ 3E6ZX 1LUZA 2FMCA 4LWCA 2R7FA 5CV6A 1MSHA 2LFNA 3M4YA 5FLMH 2KEEA 4KI0A 3HOWG 5C4JB 2PQAA 3ERSX 3CCRA 4GOPC 3CCUA 5IYBH 4JI0L 4IFDG 4R8NA 1YIJA 4R4CA 4XDXA 5E4XA 2A6HD 1C48A 5KYIA 5M3FG 1MI2A 1EQVA 1F9SA 2F0VA 2NN6H 5M3MB 4IZ8A 3GTGH 1IZ6A 2A74C 2P5ZX 5D65A 3SK4A 1NCVA 1SMYD 3G48A 4RKBA 4QMGA 1I50H 3BG3A 4GZYC 4Q0FA 1I3QH 1D8LA 4J1MA 3AYHB 1PFSA 2KCMA 1KD1C 3A7LA 3U9SA 4POFA 4ME3A 4LF4L 1AE3A 4MNOA 2JA7H 1YVCA 4PMCA 5CV9A 5I9OA 2RSNA 3S1RB 4RHSA 2IHEA 3DXJC 4CKBA 5C3WA 4QGUA 1SNQA 3T1YL 2F4VL 2IW3A 3GTLB 2JE6I 2N78A 3NUCA 3N52A 4A75A 1SNOA 2R92G 4XQQA 5AJ3Q 3HGBA 3O13A 3GTJH 2EOTA 3H3VH 1KQSA 2R7ZB 2IX3A 4IO9A 3RMHA 1Q8KA 1X56A 4JI8Q 3CQZH 3T1HQ 1YNJC 4HEDA 1JOKA 3PUZA 3CMAA 2VS1A 4OELB 3ND9A 2GVBA 2AHOB 3AMUA 1S40A 4KD4A 2F0SA 1PHJA 1Y1VG 2JA5H 4L5SA 2I5MX 1FR3A 1HTPA 1PRTF 4JK1C 4ZKBB 4YWMA 3QG1A 1G6PA 1D1KA 3PO2B 3I70A 4HAEA 2K4KA 5CV7A 4WRDA 2L11A 4DR5Q 2PO4A 2RVLA 5D14A 2KVMA 2EIFA 4BBSG 3KF8B 5AJ3L 3S1RH 5EPLA 1EU4A 4DKAC 5LMUL 3S1MB 2DGYA 2PYKA 5KGUA 1A63A 1Y1VB 1X54A 1VQ9A 1GVPA 2I07B 4FYDA 1E1TA 1WFQA 2D2CC 1TT2A 3PO2G 4KY5A 1GO3E 4NXNL 5C0XH 3NWTA 1XNRQ 2F3WA 4RWSC 3G7LA 2F3VA 5L37A 1IYVA 1C0AA 1RODA 1VQLA 1YITA 2NVTH 3HOYG 4R8IA 1EQQA 1PDQA 3RNUA 1DGSA 1Z47A 1DYQA 1HNZQ 2BH8A 3CCEA 5IP9G 3IAYA 5CORA 4A3BB 2JA7G 3C2PA 2N3SA 4C3IB 4CDEC 4RG1A 1GXDC 4AYBB 3FPPA 1QNKA 4A3DG 4IN3A 5NUCA 3HOZB 2IPKD 3P1HA 3F1ZA 3SR1A 1A3VA 4A3BG 1B7YB 1XNQL 2VNUD 5KNDA 1VQIA 4A3KB 2WAQG 1UNSA 2CWAA 3MHBA 4P74A 3MXNA 2A69C 2WKCA 3HOYB 5DM63 1STGA 2E2DC 2VW9A 3D6CA 4C3IG 1NMFA 2UXBQ 5IP7H 2JA7B 1HJPA 1EYAA 3T53B 3RN2A 2QILA 3Q8DA 4N8X1 3NHHA 4K5VA 3LWEA 1PH8A 2F0NA 1E24A 3KFUA 2BH2A 3RZOH 4A3JH 3I55A 3TP5A 5M3FB 1XWEA 3D6WA 2JK8A 3KOJA 1SJED 2F0IA 1KNEA 1WI5A 5G3LD 2MPMA 2E2IH 1N34L 3BZDB 5CV8A 5C3EB 4YIJA 1JORA 1I4XA 2NUCA 4KK7A 1VQPA 3S17H 3MXPA 2Z4HA 4A93B 3PCOB 5E4WC 2EYOA 1E2WA 5J39A 1QNUA 1O80A 2KJXA 2F52A 3BDLA 1HNZL 1F77A 3L9AX 2L9HA 1IKLA 4DUYQ 1XX8A 3I73A 1U4RA 4A3BH 4DR1Q 3I2ZA 4IQZA 3M4PA 1HZCA 3CPWA 4DXFA 3QO2A 2R93B 3PIO3 1CQVA 3MWYW 4RCNA 1LT6D 4PMBA 2LS01 2EQSA 5GADC 2UUBQ 2Z9HA 3MAQA 4XT1B 4A3GG 2NBFA 1SMYC 1IBMQ 2A19A 4OIJA 4GOPA 2K1BA 2HD3A 4HIDA 1VS0A 2RDHA 1NNXA 1EYCA 1UAPA 2FJ2A 2F0MA 1CHQD 4PV1C 4NW2A 3JAMi 1RTOA 4P2CB 2Q8IB 3KDFB 1EOTA 4C1NK 2B2VC 4IFDJ 3AEVA 1GUTA 3TQYA 3KF6B 2ZJPA 4JVZA 1PTOH 1IYJB 2NVYB 5M5WB 2O4XA 4HIKA 3V05A 1TWCH 1VQBA 4LF5L 1XXGA 2Q2HA 4FF1A 1K3BC 1SNCA 5KNCA 3DM1A 1GHKA 4IFDH 1M90C 4FP5D 2RHSB 3CHBD 1KAWA 1V1QA 5EKIA 4HR7B 5ELFA 3H91A 3NPPA 1X3FA 3CKIB 4WJWA 1CUKA 4OL7A 3HKZG 1JJ2A 1S3OA 1OXSC 1Q81C 3FHWA 2IHFA 1PRTD 2CCZA 1BR9A 3NEMA 4DUZQ 1WYDA 5G3LF 4KN7C 2OF1A 4FF2A 4Z9CB 2VL6A 4JBKA 2QGQA 3L3OC 3HOXB 1EU3A 2SOBA 5DM73 1V1PB 5CR3A 2KHSA 2VUMH 5HY6A 4GLAC 1PVOA 4DK1A 2AMCB 2K32A 5H1SE 3W3AA 2JSOA 4K5WA 3T1YQ 2BCOA 1WTHA 2A68C 2D5DA 3UDIA 1S72A 4X3KA 2VY3A 5EKLA 1SFOH 5FLXE 2F0OA 2J4XA 4QUFA 3UDGA 4TSSA 3OPOA 4WJ4A 3DHQA 3EJIA 4A3DB 1STYA 4AYBG 1K0SA 3QWNA 3S2DB 1AEXA 1CHPD 1D1IA 3STBD 2MFIA 1VQ8A 3W1BA 3Q22A 3UI2A 5C4HA 1EYGA 1IW7D 1B3QA 4B08A 3CMEA 4KKUA 4IFDI 3F2UA 1TWHB 1D6EC 2JA6H 1LTAD 1PZKD 1PH6A 3I4MH 3S1MH 5JVH3 3EBEA 4MZ9A 3D0FA 3GTJB 3J80E 4WFN3 3I4NG 5A35A 1YNJD 2HCCA 4U68A 2F0QA 3EQLC 4PZ6A 3LGJA 2QF7A 2B2UA 4DR3L 4JYAQ 2VQFL 2OEOA 3SGIA 4HSPA 3HOVH 1STNA 3OSOA 3CC2A 4LF4Q 1G291 3OTOL 3HOUH 4H0LC 2DY7A 4NP5A 1VCIA 3AB9A 2HQLA 1F9RA 1UEAB 5I6WA 2UUBL 1KAAA 1YHAA 3I4MG 4GKJL 1R9TB 4FXKC 3GO5A 3U4VA 4KD3A 3VYSA 3SHLA 3UE0A 3OW7A 1SE3A 3CU7A 3S2DH 3HOYH 1WTPA 1LT3D 5ELOA 2BE5C 1F2YA 1TWCB 1PRTC 2ASBA 4IPDA 2H5XA 2CW0D 1JJGA 3RUZA 4XXEA 4XYOA 3NSWA 5IYDG 2NN6G 4A3FB 2EXDA 2ZXOA 4FXDA 2L4NA 4TQUS 4C1NI 3G71A 1ICWA 3K7AB 2A6ED 2UXDL 1JQYD 1MJEA 2IX0A 2M2LA 3J81E 5KYLA 5C44H 2JQOA 1QUQA 1AP0A 1SYEA 2RDFA 2E5LQ 1LTSD 2R3ZA 2EVBA 1JWSD 3HKZB 5FK9C 2A1AA 3K6OA 2JA6B 4JI4L 2WFWA 5AFWA 4HJ8A 4QB4A 3M9BA 3U9OA 4OIKA 1H9RA 3S1QB 1MHWC 1SYDA 4DAVA 3C1EA 4L5RC 3MXUA 3IFTA 1I3QB 1EY7A 1B4OA 2VB2X 1YBYA 1SROA 5LL6S 3K5NA 2UU9Q 5TSSA 2IX1A 1KIXA 3S15B 2R7ZH 4UP7A 5IIFA 3RZDB 3FPUB 3I4NB 4N9TA 2TMPA 1FGBD 4JI3L 4M1UB 2JYOA 1UE7A 3BU2A 4KHZA 5JEAH 5D3IB 4HMIA 2HT1A 1OXVA 4LAAA 4G7HC 2HHHQ 3SK5A 4KHPQ 4GNXB 3PSIA 2C35B 1TKWB 2NWGA 5J1ZA 4GS3A 1GKHA 2K01A 4B9WA 3RLOA 5KNBA 2A69D 1JR0D 3OYYA 3TMEA 3AQQA 4ZAIA 3PO3H 3PUYA 4OO1I 4DV7Q 3LWUA 1J6QA 2F0UA 4A3KG 4B3RQ 4CJ2C 1TWHH 2ENBA 2K14A 2ICEC 1FNWA 3TEHB 2N8NA 3HZXA 3FKIH 3H0GH 5BN3A 1TWGB 3GP7A 1EY0A 2EY1A 1SDFA 1N8RC 1EY8A 3K80C 3VA5A 1HPCA 1UE5A 3PF5A 1TQOA 4GKKL 4UAIA 4ZCKA 2B8FA 5EPKA 4A93G 3NELA 3NE5B 4TVAB 2AKWB 5GAGC 2AWOA 1P8LA 3JAME 1K8GA 1PH9A 2K28A 3CQZB 2MUYA 4RHRA 2ZJQA 1WTVA 4B3TQ 2X6LA 4C3JG 3PF4A 1D5XC 4EVOA 1PRTB 2K6AA 4B3TL 1L1OA 2L12A 3NWSA 4FO2A 3P20A 3T13A 5BR8Q 5GROA 1IYUA 3C46A 2M00A 4F88A 1V1OA 1H9SA 2WACA 4R4OA 3M4OB 1UE6A 2LXKA 5ISRA 3DWAA 1CTMA 4OGQC 3D3RA 2Y0SG 1SE2A 4IALA 2VUMB 3V2TA 5C4ZA 1V9PA 2WAQE 4L6TB 1QWYA 5JEAJ 1W3SA 3RZDH 1WOCA 4GN3B 3PUWA 1MGSA 2CKZB 1B50A 1WTQA 1WCMH 2CQAA 2QDLA 4UY8C 1JWUD 4A3MG 2DY8A 4DPGA 1JE4A 1K83H 5FO9B 4BY1B 5C3EG 1EEID 3K57A 5CBAE 1II3A 4IUNA 2UXCL 1XPOA 4NKLA 1AZQA 4H44C 3FKIB 1LLRD 3H0GB 4QJFA 4DR2L 1MD2D 4X65Q 2ZM6Q 1U4PA 3I91A 4JI6Q 3M3YB 4O0AA 4RGMA 3GTGB 1G2SA 1NR4A 5M5WH 1H95A 1PH3A 4DR3Q 3PUVA 1N32L 1ESRA 2N88A 4YHHL 5E1FA 1VQ5A 2IY5B 2YU9H 1STAA 4G7ZC 1ET9A 1LTGD 1G51A 3HP3A 3MZ5A 2DJGC 1ZEQX 1VQ6A 1I94L 2EYMA 4MHEA 3KLRA 1BBUA 5IGEA 4KN4C 1VQKA 2VB3X 1D5ZC 4BWGB 2DUDA 4TKOB 1KNAA 3QOJA 1RDPD 5F2DA 2ZTDA 3CRLC 5COYA 1PH2A 1FL0A 3MXGA 5J22A 1W6JA 4DAPA 1BUVT 2OTLA 2LKVA 3UDXA 3G6EA 3K7UC 5IP7G 1NSNS 4QY7A 2F0TA 3TDQA 2J0TD 2PI2E 1VQMA 2XIWA 1VQDA 1YEZA 1HFGA 1MJCA 3T1HL 2K52A 1JJCB 3ND8A 1A15A 2DJFC 1EZ8A 4G57A 4MTKA 1A2TA 4A3LG 4R4IA 1VMCA 1XJVA 2I5LX 1K8OA 3KUPA 1JMCA 4A3EG 3VR5A 5C3XA 3CC7A 3VYRA 1BQQT 1KRTA 5IGFA 3K5OA 3BZCA 1QUQB 3A55A 2F4VQ 2F0HA 4ME5A 4GNXA 4RGOS 5FKAC 4OWWB 1AZPA 3HS0C 2K5DA 1W2BA 1RJTA 1Y8NB 3OOCA 1PZJD 3VYTA 1IL8A 4N9PA 2I46A 3NTHA 3V96A 1EIHA 4LUZA 5I6YA 4BXXH 2Q2TA 1XMOL 2AUKA 2JEBI 2VXWA 1DOKA 1KHIA 1TWAB 5IWAL 3UDFA 1E2VA 1Q1EA 4DN4M 2UXCQ 3DWPA 4XYQA 1CT1D 4DNTB 2I0QA 2AWNA 2ZTCA 4F8MA 1TIID 2AQ1B 2YTYA 1O7ZA 5C6AA 1MKHA 4CHTB 1BXTA 4FDBA 2KBNA 4A3FH 2WAQB 1VMPA 2L15A 4RH6A 4DV5L 2B3GA 1ENAA 4R9WA 3TBIB 1I4RA 4L63B 4LFBQ 1SYBA 1X3QA 4DR6Q 2PNHA 5EKKA 1D7QA 2UUAQ 1N33L 4HTHA 2NB0A 3PGZA 4IURA 1PH7A 1CFMA 2FXQA 1H9JA 2HCIA 2QEXA 1RKNA 1Q1BA 2XWJB 1JC7A 4DV5Q 1Q82C 5C44G 1CA6A 4APVA 3B6YA 4X6AH 4HSVA 2MP1A 3MFYA 4IJHA 3EFXD 1ASYA 1E0BA 3CXCA 2K5WA 2ID0A 4BY1G 5JPNC 5M3MG 4EQPA 4C3HH 1ZKOA 1QG7A 2OWOA 4KJOA 5C5MA 1R4PB 4KHVA 3Q6SA 1A3UA 1DJRD 3K7AH 4OXPA 4I65A 4X3SA 3DMUA 1V8QA 3F8TA 1TWAH 1LT5D 4L8JA 4ZLTF 1FNVA 4JV5L 4A3EH 2F0EA 1K3RA 4P73A 1Y1WG 1LTTD 2EE1A 4DV1L 2A5HA 1K28A 5IP9H 4JI6L 2CH4W 1U5KA 3HEJA 2F03A 1NAPA 1K8AC 2XWBB 2OQ0A 1QCBD 2K04A 3D8GA 1EY5A 2RA4A 2G9HD 1EQTA 1DD2A 2NZ1D 1JT8A 3I90A 1J5EL 4CKEA 1FYCA 1LACA 1X55A 3ULPA 3KLSX 2KHIA 1QOHA 2LSSA 2D0PA 1PA6A 4K2LA 4V0BA 1X65A 3A56A 2GVAA 3KF6A 3WOFA 1HA6A 3I4MB 4BY7H 2WIIB 3KBGA 4ZUJA 1EUJA 1Q90A 1EIYB 5EQ0A 2NVTB 5FOBB 3GTPB 1EWCA 4TRDA 1GUSA 3URYA 3J81L 1U4LA 3EIVA 4A3CG 1PYSB 4LF9L 3SDZA 3KBXA 4F7XA 1SYCA 4B3SL 1DCZA 2K50A 4RGTA 2Z1CA 4IOAA 1Z7TA 1TR5A 2GN5A 3NQIA 1EL0A 1PFBA 1F2LA 2EYFA 1QVCA 3F2CA 1W6KA 2ZXRA 3X3NA 4KTAA 1QZHA 1I5FA 1EY6A 3F2BA 3OIQA 1Y1WH 4X62Q 2D62A 2JEAI 1FD7D 1SN8A 4YY3L 1S5CD 3DEOA 1KABA 4FF4A 4C3HG 2NYZD 3BJUA 5M5XH 4UHVA 3WDNA 4OWTB 4OO1G 2V4DA 1A2UA 1ENFA 2BOSA 5IOCA 1R9TH 1YHQA 2RHQB 3RZOB 3NBHB 1MBYA 4BBRH 3NBHA 4QIWB 2JA5B 2EYJA 2ZJRA 1NJIC 3PIOA 1UUPA 2Z0SA 4XQJA 3RR5A 4CJ1B 1CKNA 3GTLH 3M7GA 1PMRA 3ULLA 4PQXA 1GHJA 2H4OA 4QIWE 3GTMH 2OTJA 1BCPC 4NDXA 2PNRC 4I7ZC 4BA1I 2WP8J 3W1GA 1S5BD 3Q0AA 2G5DA 3J80L 3VR4A 4H02A 4HCEA 3S16B 2KHJA 2L1BA 4JI7Q 3K59A 1PXUA 3P75A 3CCQA 3GTPH 3TP7A 1ZYRD 1EWHA 3LX0A 3ITPA 1PV4A 1I6HB 1HQRD 1SNDA 1GM5A 2CQOA 1IBKQ 2EJGC 2OT2A 5KEEA 1OTCA 1E22A 4X66Q 2A6HC 4HIMA 1H9SB 1O78A 2F4IA 1S5FD 3BVGA 5GAEC 4JBWA 2F0LA 2PQAB 1YI2A 3SK6A 2F0JA 1S5DD 2JJQA 3MEFA 2K75A 4YCUA 4DK6C 1RHPA 4DGZA 4A3CH 5FJ8G 3LNNA 2R61A 2CWPA 1TWFB 2NVXH 1XNQQ 3DWQA 1E1OA 1E7ZA 4B3RL 3TRZA 1I4GA 3I72A 2MNAA 5HURA 2HUGA 1VQCA 1CQFA 1PTOB 2NVYH 3PO3B 2RBMA 4BY7G 4DR6L 1O7IA 4DF7A 1B1ZA 1H9KA 4I7AA 4KV6A 5I9PA 1RF2D 2VUMG 1YNND 3OWEB 4DR7L 2NVQB 1K8MA 4DNRB 3VR2A 3J7AV 3HOXH 1STBA 3BDOA 1H9MA 4HJ5A 3KYHC 3A74A 3KDFA 2PW7A 4P71A 5T1GA 3NK9A 4LNQA 4K14A 1EFWA 1UWVA 3A5ZB 5A2QL 3S2HB 1HUMA 2F0FA 1Q46A 2ICIA 5BN4A 2R6GA 3S17B 5JPMC 2F0GA 4JI1L 4OO1H 4CGYB 1JE5A 1BVSA 2V1CC 4A3IG 4RA8A 2KOLA 3J81i 4GOPB 2VZAA 1AW7A 4S3SA 3H6MA 1N9WA 4O2DA 4LF8L 4A3KH 2QDBA 3JAML 4OEMB 4LFBL 4IUVA 3M85A 2ZT9C 1QJOA 3TP8A 4A76A 2NVXB 1LTBD 1KL9A 3QOLA 1LTLA 4C3HB 5CV5A 2OXPA 1E2ZA 5ELCA 2B39A 1D5MC 1WD0A 2EY6A 2E76C 2EYLA 2E2IB 1OO9B 4KJNA 4JI8L 1BO0A 1EY9A 1F2ZA 3AFPA 4JW0A 4K8IA 5M3FH 3K81C 1DXMA 4X64L 5EAYA 3K5LA 3DM3A 2JA6G 2ZTEA 2E74C 1LTRD 4O42A 3OTOQ 3I3CA 1CKNB 3A54A 3GDEA 1B44D 1EOVA 1G8ZD 1VQOA 2WB1E 1X3EA 1WTOA 3L0OA 2YU9B 2B2UC 1X9NA 1A6XA 3JAMc 3K0YA 2WINB 2EJMA 3OW2A 2ALYB 4LK1C 1PH4A 1CKOA 4BBSB 4C2MB 1M1KC 3CC4A 1NBWA 3S24A 3BYTB 1G2TA 3MXNB 1Q8IA 2D0OA 4X65L 2A6EC 3E9IA 5EBCA 3PIPA 2L55A 2Q8RE 1GD7A 3I4OA 3HOUG 4K6DA 2BA1A 1LTID 1STHA 2Y0SE 1TU2B 3IRBA 3TN2A 1Y14B 3I4LA 3WOEA 1CK1A 1M8AA 2X6GA 5I2YA 1QZGA 5IYDH 1DOMA 1HFNA 4XT3B 2JN4A 1QVFA 2F0PA 4MTNA 4IUPA 2HIXA 5JAVA 2B2YA 1VDZA 1R4QB 4UP8A 2QKIC 1TS2A 1VQGA 5JJKA 1X32A 4LFCQ 3EN2A 5EGTA 4JI2L 2LXJA 1Y1WB 2K5VA 5KIXA 1HR0Q 1I6HH 3PO3G 2SEBD 2PZTA 1TS3A 2B2WA 4JI7L 1EWIA 1Y1VH 1SYFA 3R2TA 3PO2H 4JG2A 3R93A 4ZKCB 5IGDA 1YNXA 4BY7B 2YTVA 1B53A 1BCPB 1HZ9A 2G9DA 4HMJA 1RD9D 4N8FA 4EGVA 1BCPF 1FGUA 2CHBD 1MSGA 3S15H 3GTOH 3K58A 5LMNQ 3KJOA 1P16A 3PMFA 1WTRA 4DXGA 3RLNA 3CAMA 3OIPA 3H09A 4KY7A 3FDTA 1SEBD 4AH6A 2ATWA 1ET6A 4WORA 1HRJA 1SJHD 2QW7A 3OMCA 2Z8LA 3BZKA 4BBRG 2OCEA 3T4AC 2K5QA 4LJZC 2R7ZG 3SXHA 2Z6KC 2B2TC 1J9OA 3GTKB 2B63G 1F9QA 2LY7A 1GUOA 2KQ3A 4IJLA 3VR6A 5C0XG 4P72A 5D3DA 5C5LA 4F87A 2TSSA 1NTGA 1CM9A 3GQBA 3R3OA 1XMQL 3U58A 2HHHL 3EA6A 3SE0A 4CJ0B 5BR8L 1GUGA 4JI3Q 4ILWA 1CKMA 3OWFA 3GTQB 2R93G 4X64Q 2L0CA 4OWXB 1O7YA 3D4WA 5K5PA 2CH4A 5C4JH 2WB1B 3S2HH 4QQBX 1OXUA 3N6RA 4RAUC 4QF4A 5DLQE 4JI2Q 4HJAA 3MC0B 1IBML 1TY2A 2B63B 4PG3A 1L0WA 4DFAA 4GLXA 4POGA 2PMZB 3TZDA 2YTXA 2RF4A 2F0WA 1KLUD 2IWHA 4Y52H 2K5HA 1SXTA 3GTOB 3IFDA 3RN5A 4R1JA 5ELBA 1HNWQ 4DR1L 5K36G 1RL2A 3M4OH 3A5UA 4BS9A 5IYBG 4LF6L 4J8QA 1VF7A 4NB3A 1ZYRC 3E0EA 4A93H 1I50B 3HG9A 1AH9A 5CBEE 1LYLA 2NZHA 1JICA 4ULLA 2GA4B 2KUMA 4KKTA 3U4ZA 4KMUC 1BCPD 4DV6Q 5GQOA 2PW5A 5LL6X 4DV1Q 2IT1A 1KC8C 2E8GA 3QR8A 2M9VA 2RDGA 4P75A 4EQ5A 4ABNA 5C0XJ 2A68D 4B3MQ 3E3XA 3HRZC 4ZYSA 2JA8B 2Y0SB 1LT4D 1S4ZA 5IT9L 3PUXA 2K5NA 2PCFB 4JV5Q 3GD7A 5JJIA 2NN6I 2Q2IA 1G6ZA 4LMQD 3VDYA 2SNSA 4LF7L 2R93H 3TS0A 3L7ZC 3PQIA 2KEDA 4DV0L 4RKLA 1F9PA 4NXNQ 3JC66 1XTCD 4IUTA 5EJWA 3DUZA 4CBVA 2PPBC 2C9OA 3CF5A 5IGBA 2KCNA 4V190 2MO1A 2UXBL 4A3JB 4B3ML 1HQMC 2JXMB 2H1EA 1CZWA 4LW1A 5T1IA 4UP9A 1Z9FA 1YJNA 4K2KA 2RCNA 1HNXQ 4GLVB 1L0XB 1RIPA 1NMGA 2AQ2B 4X3UA 3U50C 1TS5A 4FNFA 2R92B 1HXYD 1B8AA 3TP6A 1AFPA 1SSOA 1Q7YC 2RQXA 3K8AA 4BXXG 4AYBE 3SVMA 1VQEA 1Q3LA 2XGTA 2Q2UA 4K5XA 4EQNA 3A0JA 2J7ZA 4JI1Q 1I4QA 4ZK9B 3A8KE 3ULJA 4G7OC 4X66L 4OONA 3BVZA 4ID6A 2PI2A 3VA7A 3TSSA 4L5TA 5JEAG 2QA4A 2BDNA 3G4SA 1XTDA 4DV0Q 2MO0A 1XNRL 2UUCQ 1XPRA 4A3MB 2L5TA 4OX9Q 4YHHQ 3J80c 4JBMA 1SBBB 1SE8A 3KJPA 2E2HB 3FP9A 3GTMB 4NXML 4LUVA 2EY5A 1KLGD 3E9HA 2KCTA 1N36L 2VQEL 1XYIA 4QCLA 1EFID 5CV4A 4DR5L 1IBLQ 1SFOB 2XRQD 4Y7NH 1BKBA 1PFNA 4IUUA 4C3IH 2QEJC 4K8JA 4CDFC 4GN4B 2B2TA 3M7NA 4DNIA 2Z6KA 1DZ1A 1BDOA 4LF6Q 4QL5A 4DR2Q 5FJ8H 2B2YC 1DOLA 1CA5A 2OQKA 3MEHA 1TVXA 4XTCS 3Q23A 3F2DA 1A3TA 4J6HA 2EYHA 3EVQA 5C0XI 2DNCA 3RLFA 1OXTA 3R8BA 4DV4Q 3ICEA 5LMNL 4A3DH 2E2JB 3SEBA 2IJ0A 2MQHA 1EIFA 4Q5VA 4X3TA 1IHZA 1HCZA 4A3JG 1NE3A 4IUQA 3BVMA 2C5CA 4KLKA 1FNUA 4AIMA 4G4KA 1L0YB 3NTIA 4NPSA 1YJWA 1ML0D 2SDFA 1IKMA 3K5MA 3KLSA 2CVRA 4IOCA 1KRSA 1F2MA 4JPBW 1VQJA 2KCCA 3BDCA 4A3EB 2K03A 4NMZA 2XSCA 2YYZA 5I2XA 1AE2A 1CI3M 1WJJA 1E3PA 2I5HA 2E2JH 3A8JE 1TS4A 1TY0A 3J81j 2JA8G 5FLMG 3A7AB 1G91A 2O5IC 1K83B 1J8IA 2K05A 4LUOA 1TWFH 1SLJA 4FF3A 3R2IA 5JJLA 3KLWA 1SYGA 5ELNA 1JB3A 1HR0W 3GV6A 3BS1A 1K9MC 4Y7NB 1ZXTA 3MTSA 3KF8A 4E6IA 5CMDA 2AUJD 1K73C 3A8IE 5M3MH 1I6VC 1X3GA 4IPHA 2WV6D 5IGCA 3ZJYC 3J7YW 4HJ7A 4J15A 2CFMA 1EIGA 5C4XB 2KENA 1K0RA 1EZ6A 5IT9E 4DV7L 2JA8H 1YHBA 3AFQA 1ICFB 3QJYA 1C8CA 3GV3A 5DEHA 4KKSA 5M5XB 4B9XA 4O1NA 2O5JC 4X62L 2EZVA 2RCFA 2XTIA 5C4XG 1SMXA 3TREA 2B2VA 1C4QA 1HR0L 1N34Q 4K0KL 1KXLA 1Y69U 1JOQA 5IYCH 4LFCL 4OX9L 1SRUA 1WD1A 2MGSA 1BNZA 5IT9c 2JA5G 1NY4A 2X69A 2E2HH 4A3LH 1LO5D 2EDGA 2K7VA 1O7LA 3ONAB 4GN5A 1L1OB 4EX5A 4DV4L 1HTLD 3E5SA 1A8VA 2O2LD 4K0KQ 4BBSH 4H7BA 5IY0A 4JOIC 1DONA 2FMMA 1SR3A 1CZGA 3S16H 3FRPB 1J5EQ 4DK3C 2EXZA 2R7DA 4C3JB 4HJ9A 5M5YB 2BE5D 3HKSA 4PMWA 1HH2P 4UPAA 5BN5A 3S1NB 3IL8A 2D9UA 4BA2I 3KK7A 1U4MA 2HQEA 1BF4A 3PV0A 4CDCC 1VQAA 5JOBA 1PLFA 1WTWA 1ENCA 1X3PA 1Y8PB 4PZ7A 3CCMA 4JI5Q 3D4DA 3X3MA 5C4XH 1QB5D 4GKJQ 1LV9A 1PTOC 1PZID 2RKSA 2JA9A 3HOUB 3Q24A 2AQ3B 1B9MA 1BBWA 1PH5A 3J80i 2HIVA 1X6OA 2UUCL 5IGGA 1YJ9A 3NQTA 1PYBA 3J7AF 3HOZG 2N55A 1TXYA 3H94A 3M4QA 3D4RA 1RTNA 2CW0C 2Q8TA 5EPJA 4PNYA 1MIUA 2MJ8A 1AN8A 1A0IA 5J3BA 4JI4Q 2A8VA 1PH1A 1FVIA 1B3AA 3H15A 4A3GB 4DAMA 1I4PA 3OHXC 4ODGA 2KA7A 3C3LA 1VQFA 1HHVA 4ZQ3A 5HGQA 4JYAL 1N33Q 4LF8Q 2E5LL 4UDUC 1VQ7A 2YV5A 3NBIA 2SNMA 2B29A 1SE4A 1Q12A 5FLXL 3CP0A 3HOXG 4DAYB 5IYCG 1A62A 1QE6A 1S5ED 4YCWA 2UXDQ 1HNXL 2UUAL 5JVG3 1VQHA 3HOVG 4DR4L 5GAHC 5KRUA 3W5OA 1PYWD 1ESFA 2XVSA 4C3JH 5M5YH 4XIGS 1BOSA 3H3VC 1B2TA 1V43A 4HN7A 4OHJA 3WWVA 3NTKA 3P7JA 3T16A 3S1QH 1D2BA 1T5XD 1C7YA 3C1FA 5CGKA 4BY1H 3K0XA 1HZAA 1I94Q 1I4HA 3CRKC 3E0JA 4DAYA 2EPBA 3MFGA 4LF7Q 5IWAQ 3CD6A 1L1OC 4H13C 1IBLL 1XMOQ 3VR3A 4DK0A 3CCSA 2NVQH 1IL2A 1N36Q 4DR7Q 2WKDA 1KDCA 2BA0A 1WVLA 4DV2Q 4XQNA 3IKJA 1XMQQ 2HDMA 4DV2L 5C44B 2R92H 1XPUA 3OMGA 3HOVB 2HDLA 2LMCB 3I56A 3S14B 1EY4A 1B70B 2FINB 1OXXK 2NTTA 5M9OA 1Y8OB 2RSOA 3CW2C 5A2QE 3NP8A 1V1PA 5CYUA 1PFMA 1DM0B 4IPGA 4YWLA 1C9OA 4JBJA 4RCOA 3HOWB 1CSQA 3BYYB 4DA2A 1HNWL 3I7FA 2QCPX 1VQ4A 3T51B 1HZBA 4DUZL 2XRSD 2EYPA 3I8ZA 2N49A 4YY3Q 1IBKL 3H3VI 4LF5Q 2Z4IA 3ER0A 4YCVA 1KDAA 2F0DA 2F1MA 2ES2A 4ZRZA 3ERQA 4DU9A 1WTXA 5ELEA 1UEBA 2XNAC 3SK8A 4RFBA 2A73B 1UE1A 2ZXPA 4JI0Q 4WJ3M 4HCSA 1SNPA 3M3YH 1N32Q 3GTQH 2B8GA 1JCKB 1SNMA 4ALPA 3EROA 3HOZH 5HGTA 2PMZE 2KECA 4JCVE 2ZM6L 1IXRA 1HA5A 3J7A5 4GNXC 2PQEA 1GJXA 1YNNC 3S9WA 2E75C 1KDBA 4C56C 1CSPA 1TWGH 2F0KA 2K33A 2XN9C 1M4VA 1ILPA 2DNEA 3PIP3 2FFKB 5IE8A 1PTOF 1U9RA 4JOIA 4DUYL 3NXWA 3UE1A 3CCJA 2BDOA 4R4TA 4EQOA 5IODA 4CDDC 4JI5L 5FLXc 3S14H 1ILQA 3J81c 2WB1G 2Z6BA 4DV6L 1VQNA 4RMFA 4DR4Q 2JP1A 4KY6A 4YWKA 3HOWH 4QUCA 4IPCA 4PZ8A 4JC0A 4MIUA 3I4NH 1GUWA 3MA2B 2NTSA 4A3IB 2NZOA 1EYDA 4C2MH 4B3SQ 1NUCA 4A3FG 4LF9Q 3G6JB 2IL8A 3AU7A 1ONLA 3DLLA 4A3MH 3GTKH 4K6LA 5ELDA 4GKKQ 1VF5C 4A4IA 5C3EH 5CC4A 3CPFA 1LABA 4L5QA 4BBRB 1JWMD 2EY2A 3STBC 1WCMB 3CCLA 3TZUA 1QVGA 3FMCA 4DV3L 1PTOD 5E3FA 3FKIG 3H0GG 2PZWA 1YZ6A 2EJFC 1Q86C 2B2WC 3FEWX 1IW7C 4MN3A 5FO8B 1ASZA 1HUNA 1QILA 1T9HA 3HKZE 1LM0A 3MVVA 1KTKA 4AQYL 1B9NA 2MHVA 1FJGL 2DN8A 1STEA 3W2DA 1GUNA 1L2FA 5I4DA 4LFAL 4R4QA 3J7ZC 3NENA 3VYUA 5DNFA 4KHPL 5LMNW 3ZYYX 4RGNA 1WCMG 3HFZB 4CKCA 5JJZA 1EEFD 3QIAA 2FHTA 4HIOA 3DEPA 1BBXC 2VQEQ 3D31A 4LFAQ 3CCVA 1FJGQ 4M8AA 3T56B 3QB3A 2B63H 4NXMQ 4AQYQ 2F3IA 3RD4A 1GOZA 5E7NA 3L2PA 1JB7A 4ZUIA 5K36H 1U0LA 3FVQA 4A3GH 4DV3Q 4U673 4FXGC 1RCVD 2PZUA 5LHY1 4A3IH 1EQRA 2UU9L 5EBDA 5LMUQ 3TS2A 1Z6HA 1T5EA 1JOOA 5DAUA 5FO7B 4FVMA 1SAPA 3S1NH
chains in the Genus database with same CATH topology
1NR2A 3E6ZX 2FMCA 5CV6A 1MSHA 2LFNA 3M4YA 2KEEA 4KI0A 5C4JB 4IFDG 4R8NA 4XDXA 5KYIA 2A6HD 1C48A 5E4XA 1MI2A 1EQVA 1F9SA 2F0VA 2NN6H 5M3MB 4IZ8A 2A74C 5D65A 3SK4A 1NCVA 1SMYD 4RKBA 4QMGA 3BG3A 4GZYC 4Q0FA 4J1MA 3A7LA 3U9SA 4PMCA 5CV9A 5I9OA 2RSNA 3S1RB 4RHSA 3DXJC 4CKBA 5C3WA 1SNQA 2IW3A 3GTLB 2JE6I 3NUCA 3N52A 1SNOA 4XQQA 3HGBA 3O13A 2EOTA 2R7ZB 2IX3A 3RMHA 1YNJC 4HEDA 1JOKA 3PUZA 3ND9A 3AMUA 4KD4A 2F0SA 1FR3A 1HTPA 1PRTF 4JK1C 4ZKBB 3QG1A 1D1KA 3PO2B 3I70A 4HAEA 5CV7A 4WRDA 2L11A 2PO4A 2RVLA 5D14A 2KVMA 5EPLA 1EU4A 3S1MB 2PYKA 5KGUA 1Y1VB 2I07B 4FYDA 2D2CC 1TT2A 4KY5A 5C0XH 3NWTA 2F3WA 4RWSC 3G7LA 2F3VA 1IYVA 1RODA 4R8IA 1PDQA 1Z47A 1DYQA 3IAYA 5CORA 4A3BB 3C2PA 4C3IB 1GXDC 4AYBB 3FPPA 1QNKA 4IN3A 5NUCA 3HOZB 2IPKD 3P1HA 3SR1A 1A3VA 2VNUD 5KNDA 4A3KB 1UNSA 3MHBA 3MXNA 2A69C 2WKCA 3HOYB 5DM63 1STGA 2E2DC 3D6CA 4C3IG 2JA7B 1EYAA 3T53B 2QILA 3NHHA 4K5VA 3LWEA 2F0NA 3TP5A 5M3FB 1XWEA 3D6WA 1SJED 2F0IA 1KNEA 5G3LD 2MPMA 3BZDB 5CV8A 5C3EB 4YIJA 1JORA 1I4XA 2NUCA 4KK7A 3MXPA 2Z4HA 4A93B 5E4WC 2EYOA 1E2WA 5J39A 1QNUA 1O80A 2KJXA 3BDLA 1F77A 3L9AX 2L9HA 1IKLA 1XX8A 3I73A 1U4RA 4IQZA 2R93B 4DXFA 3QO2A 3PIO3 1CQVA 3MWYW 4RCNA 1LT6D 4PMBA 2LS01 3MAQA 4XT1B 2NBFA 1SMYC 4OIJA 2K1BA 2RDHA 1UAPA 2FJ2A 2F0MA 1CHQD 4PV1C 4NW2A 1RTOA 4P2CB 2Q8IB 4C1NK 1EOTA 2B2VC 4IFDJ 1GUTA 1PTOH 5M5WB 2NVYB 2O4XA 3V05A 1XXGA 4FF1A 5KNCA 1SNCA 3DM1A 1GHKA 4IFDH 4FP5D 3CHBD 5EKIA 4HR7B 5ELFA 3H91A 3NPPA 3CKIB 4WJWA 4OL7A 1OXSC 1PRTD 1BR9A 5G3LF 4KN7C 2OF1A 4FF2A 4Z9CB 3L3OC 3HOXB 1EU3A 2SOBA 5DM73 1V1PB 5CR3A 2KHSA 4DK1A 2K32A 3W3AA 2JSOA 4K5WA 2BCOA 2A68C 2D5DA 4X3KA 5EKLA 5FLXE 2F0OA 2J4XA 4QUFA 4TSSA 3OPOA 3DHQA 3EJIA 4A3DB 1STYA 3QWNA 3S2DB 1AEXA 1CHPD 1D1IA 3Q22A 3UI2A 5C4HA 1IW7D 4B08A 4KKUA 4IFDI 3F2UA 1TWHB 1D6EC 1LTAD 1PZKD 5JVH3 3GTJB 3J80E 4WFN3 5A35A 1YNJD 2HCCA 4U68A 2F0QA 3EQLC 2QF7A 2B2UA 2OEOA 4HSPA 1STNA 3OSOA 1G291 4H0LC 2DY7A 1VCIA 4NP5A 3AB9A 1F9RA 1UEAB 5I6WA 1KAAA 1R9TB 4FXKC 3GO5A 4KD3A 3VYSA 3SHLA 3OW7A 1SE3A 3CU7A 1WTPA 1LT3D 2BE5C 1F2YA 1TWCB 1PRTC 2CW0D 3RUZA 4XXEA 4XYOA 3NSWA 2NN6G 4A3FB 2ZXOA 4FXDA 2L4NA 4TQUS 4C1NI 1ICWA 3K7AB 2A6ED 1JQYD 2IX0A 2M2LA 3J81E 5KYLA 1AP0A 1SYEA 2RDFA 1LTSD 2R3ZA 2EVBA 1JWSD 3HKZB 5FK9C 3K6OA 2JA6B 5AFWA 4QB4A 3U9OA 4OIKA 1H9RA 3S1QB 1SYDA 4DAVA 3C1EA 3MXUA 3IFTA 1I3QB 1EY7A 1B4OA 2VB2X 5LL6S 3K5NA 5TSSA 2IX1A 3S15B 5IIFA 3RZDB 3FPUB 3I4NB 4N9TA 2TMPA 1FGBD 4M1UB 2JYOA 4KHZA 5JEAH 5D3IB 4HMIA 1OXVA 4LAAA 4G7HC 3SK5A 1TKWB 2NWGA 5J1ZA 2K01A 4B9WA 5KNBA 2A69D 1JR0D 3TMEA 4ZAIA 4OO1I 3PUYA 3LWUA 2F0UA 4CJ2C 2ENBA 2ICEC 1FNWA 3HZXA 5BN3A 1TWGB 3GP7A 1EY0A 2EY1A 1SDFA 1EY8A 3VA5A 1HPCA 1TQOA 4UAIA 2B8FA 5EPKA 3NE5B 2AWOA 3JAME 2K28A 3CQZB 2MUYA 4RHRA 1WTVA 2X6LA 4C3JG 1D5XC 4EVOA 1PRTB 2K6AA 2L12A 3NWSA 4FO2A 3P20A 3T13A 1IYUA 3C46A 2M00A 4F88A 1V1OA 1H9SA 2WACA 3M4OB 5ISRA 3DWAA 1CTMA 4OGQC 3D3RA 1SE2A 4IALA 2VUMB 3V2TA 5C4ZA 4L6TB 5JEAJ 1QWYA 3PUWA 1MGSA 1B50A 1WTQA 2CQAA 1JWUD 2DY8A 1JE4A 5FO9B 4BY1B 1EEID 3K57A 5CBAE 1II3A 4IUNA 4NKLA 1AZQA 4H44C 3FKIB 1LLRD 3H0GB 1MD2D 1U4PA 3I91A 3M3YB 4RGMA 3GTGB 1G2SA 1NR4A 3PUVA 1ESRA 2N88A 5E1FA 1STAA 4G7ZC 1ET9A 1LTGD 3HP3A 3MZ5A 1ZEQX 2EYMA 4MHEA 3KLRA 5IGEA 4KN4C 2VB3X 1D5ZC 4BWGB 4TKOB 1KNAA 3QOJA 1RDPD 5F2DA 3CRLC 5COYA 3MXGA 5J22A 1W6JA 4DAPA 1BUVT 2LKVA 1NSNS 2F0TA 3TDQA 2J0TD 2XIWA 1HFGA 3ND8A 1A15A 1EZ8A 4G57A 1A2TA 1VMCA 1K8OA 3KUPA 3VR5A 5C3XA 3VYRA 1BQQT 5IGFA 3K5OA 3A55A 2F0HA 4ME5A 4RGOS 5FKAC 1AZPA 3HS0C 2K5DA 1RJTA 1Y8NB 3OOCA 1PZJD 3VYTA 1IL8A 4N9PA 2I46A 3NTHA 3V96A 1EIHA 5I6YA 2AUKA 2JEBI 2VXWA 1DOKA 1TWAB 1E2VA 1Q1EA 4DN4M 3DWPA 4XYQA 1CT1D 4DNTB 2AWNA 4F8MA 1TIID 2AQ1B 1O7ZA 5C6AA 4CHTB 1BXTA 2WAQB 1VMPA 4RH6A 1ENAA 4R9WA 3TBIB 1I4RA 4L63B 1SYBA 1X3QA 5EKKA 4HTHA 2NB0A 4IURA 1CFMA 1H9JA 2HCIA 1RKNA 1Q1BA 2XWJB 1JC7A 1CA6A 4HSVA 2MP1A 3MFYA 3EFXD 1E0BA 2K5WA 2ID0A 5JPNC 4EQPA 1ZKOA 1QG7A 4KJOA 5C5MA 1R4PB 4KHVA 3Q6SA 1A3UA 1DJRD 4I65A 4X3SA 3DMUA 1V8QA 1LT5D 4L8JA 4ZLTF 1FNVA 2F0EA 1LTTD 2EE1A 2A5HA 3HEJA 2F03A 1NAPA 2XWBB 1QCBD 2K04A 3D8GA 1EY5A 2RA4A 2G9HD 1EQTA 1DD2A 2NZ1D 3I90A 4CKEA 1FYCA 1LACA 3KLSX 1QOHA 4K2LA 4V0BA 3A56A 3WOFA 1HA6A 3I4MB 2WIIB 3KBGA 4ZUJA 1Q90A 5EQ0A 2NVTB 5FOBB 3GTPB 1EWCA 4TRDA 1GUSA 3URYA 3J81L 1U4LA 3SDZA 3KBXA 4F7XA 1SYCA 1DCZA 4RGTA 2Z1CA 1Z7TA 1TR5A 3NQIA 1EL0A 1PFBA 1F2LA 2EYFA 1W6KA 2ZXRA 3X3NA 4KTAA 1EY6A 3OIQA 2D62A 2JEAI 1FD7D 1S5CD 3DEOA 1KABA 4FF4A 4C3HG 2NYZD 3WDNA 4OO1G 2V4DA 1A2UA 1ENFA 2BOSA 5IOCA 3RZOB 1MBYA 3NBHA 4QIWB 2JA5B 2EYJA 1UUPA 4XQJA 4CJ1B 3M7GA 1PMRA 4PQXA 1GHJA 2H4OA 1BCPC 4NDXA 2PNRC 4I7ZC 4BA1I 2WP8J 1S5BD 3Q0AA 3J80L 3VR4A 4HCEA 3S16B 2L1BA 3K59A 1PXUA 3P75A 3TP7A 1ZYRD 1EWHA 3LX0A 3ITPA 1I6HB 1HQRD 1SNDA 2EJGC 2OT2A 5KEEA 2A6HC 1H9SB 1O78A 2F4IA 1S5FD 3BVGA 4JBWA 2F0LA 3SK6A 2F0JA 1S5DD 1RHPA 4DGZA 3LNNA 2R61A 1TWFB 3DWQA 1I4GA 3I72A 5HURA 2HUGA 1CQFA 1PTOB 3PO3B 2RBMA 4DF7A 1B1ZA 1H9KA 4KV6A 5I9PA 1RF2D 1YNND 3OWEB 2NVQB 1K8MA 4DNRB 3VR2A 3J7AV 1STBA 3BDOA 1H9MA 2PW7A 5T1GA 3NK9A 4K14A 5A2QL 3S2HB 1HUMA 2F0FA 2ICIA 5BN4A 2R6GA 3S17B 5JPMC 2F0GA 4OO1H 4CGYB 4RA8A 2KOLA 1AW7A 4S3SA 3H6MA 2QDBA 3JAML 4IUVA 3M85A 2ZT9C 1QJOA 3TP8A 2NVXB 1LTBD 3QOLA 4C3HB 5CV5A 2OXPA 1E2ZA 5ELCA 2B39A 1D5MC 1WD0A 2EY6A 2E76C 2EYLA 2E2IB 1OO9B 4KJNA 1BO0A 1EY9A 1F2ZA 4K8IA 1DXMA 3K5LA 2E74C 1LTRD 4O42A 3A54A 3I3CA 1B44D 1G8ZD 1WTOA 2YU9B 2B2UC 1A6XA 3K0YA 2WINB 2EJMA 4LK1C 4BBSB 4C2MB 3BYTB 1G2TA 1Q8IA 2A6EC 5EBCA 2L55A 2Q8RE 4K6DA 2BA1A 1LTID 1STHA 1TU2B 3TN2A 3I4LA 3WOEA 1CK1A 1M8AA 2X6GA 5I2YA 1DOMA 1HFNA 4XT3B 2F0PA 4IUPA 5JAVA 2B2YA 1VDZA 1R4QB 2QKIC 1TS2A 1X32A 5EGTA 1Y1WB 5KIXA 2SEBD 2PZTA 1TS3A 2B2WA 1SYFA 3R2TA 3R93A 4ZKCB 5IGDA 4BY7B 1B53A 1BCPB 2G9DA 4HMJA 1RD9D 4EGVA 1BCPF 2CHBD 1MSGA 3K58A 3PMFA 1WTRA 4DXGA 3OIPA 3H09A 4KY7A 3FDTA 1SEBD 1ET6A 4WORA 1HRJA 1SJHD 3OMCA 2Z8LA 3T4AC 2K5QA 4LJZC 3SXHA 2B2TC 1J9OA 3GTKB 1F9QA 2LY7A 1GUOA 2KQ3A 3VR6A 5C0XG 5D3DA 5C5LA 4F87A 2TSSA 1CM9A 3GQBA 3R3OA 3EA6A 3SE0A 4CJ0B 1GUGA 4ILWA 3OWFA 3GTQB 2L0CA 1O7YA 3D4WA 5K5PA 2WB1B 1OXUA 3N6RA 4RAUC 4QF4A 3MC0B 1TY2A 2B63B 4DFAA 2PMZB 3TZDA 2F0WA 1KLUD 2IWHA 1SXTA 3GTOB 3IFDA 5ELBA 5K36G 4BS9A 4J8QA 1VF7A 1ZYRC 1I50B 3HG9A 5CBEE 1JICA 4ULLA 2GA4B 2KUMA 4KKTA 4KMUC 1BCPD 2PW5A 5LL6X 2IT1A 2M9VA 2RDGA 4ABNA 5C0XJ 2A68D 3HRZC 4ZYSA 2JA8B 2Y0SB 1LT4D 1S4ZA 5IT9L 3PUXA 2PCFB 3GD7A 2NN6I 1G6ZA 4LMQD 2SNSA 3L7ZC 2KEDA 4RKLA 1F9PA 1XTCD 4IUTA 5EJWA 3DUZA 4CBVA 2PPBC 2C9OA 5IGBA 2KCNA 4V190 4A3JB 1HQMC 2JXMB 2H1EA 1CZWA 5T1IA 4K2KA 1L0XB 4X3UA 2AQ2B 1TS5A 4FNFA 2R92B 1HXYD 3TP6A 1AFPA 1SSOA 2RQXA 3SVMA 1Q3LA 4K5XA 4EQNA 1SAPA 2J7ZA 1I4QA 4ZK9B 3A8KE 4G7OC 3BVZA 4ID6A 3VA7A 3TSSA 5JEAG 2BDNA 4A3MB 2L5TA 1SBBB 2E2HB 3GTMB 2EY5A 1KLGD 1XYIA 4QCLA 1EFID 5CV4A 1SFOB 2XRQD 1PFNA 4IUUA 2QEJC 4K8JA 2B2TA 3M7NA 1DZ1A 1BDOA 2B2YC 1DOLA 1CA5A 3MEHA 3Q23A 1TVXA 4XTCS 1A3TA 4J6HA 2EYHA 3EVQA 5C0XI 2DNCA 3RLFA 1OXTA 3R8BA 2E2JB 3SEBA 2IJ0A 4Q5VA 4X3TA 1IHZA 1HCZA 4IUQA 3BVMA 2C5CA 1FNUA 4G4KA 1L0YB 3NTIA 1ML0D 2SDFA 1IKMA 3K5MA 3KLSA 2CVRA 1F2MA 4A3EB 2KCCA 3BDCA 2K03A 4NMZA 2XSCA 2YYZA 5I2XA 1CI3M 3A8JE 1TS4A 1TY0A 1G91A 3A7AB 2O5IC 1K83B 1J8IA 2K05A 4FF3A 3R2IA 1SYGA 1JB3A 3GV6A 3BS1A 4Y7NB 1ZXTA 3MTSA 3KF8A 4E6IA 5CMDA 2AUJD 3A8IE 1I6VC 2WV6D 5IGCA 3J7YW 1EIGA 5C4XB 1EZ6A 5IT9E 3QJYA 1C8CA 3GV3A 5DEHA 4KKSA 5M5XB 4B9XA 4O1NA 2O5JC 2EZVA 2B2VA 1C4QA 1Y69U 1JOQA 1WD1A 2MGSA 1BNZA 2X69A 1LO5D 2EDGA 2K7VA 1O7LA 3ONAB 1HTLD 3E5SA 2O2LD 4H7BA 1DONA 2FMMA 1CZGA 3FRPB 2EXZA 4C3JB 5M5YB 2BE5D 4PMWA 5BN5A 3S1NB 3IL8A 2D9UA 4BA2I 3KK7A 1U4MA 2HQEA 1BF4A 3PV0A 5JOBA 1PLFA 1WTWA 1ENCA 1X3PA 1Y8PB 3D4DA 3X3MA 1QB5D 1LV9A 1PTOC 1PZID 2RKSA 3HOUB 3Q24A 2AQ3B 1B9MA 5IGGA 3NQTA 3J7AF 2N55A 3H94A 3D4RA 1RTNA 2CW0C 2Q8TA 5EPJA 4PNYA 2MJ8A 1AN8A 1B3AA 4A3GB 1I4PA 3OHXC 4ODGA 2KA7A 3C3LA 1HHVA 4ZQ3A 4UDUC 3NBIA 2SNMA 1SE4A 1Q12A 5FLXL 1S5ED 1QE6A 5JVG3 5KRUA 1PYWD 1ESFA 2XVSA 4XIGS 1BOSA 3H3VC 1B2TA 1V43A 4HN7A 4OHJA 3NTKA 3P7JA 3T16A 1D2BA 1T5XD 3C1FA 5CGKA 1I4HA 3CRKC 3E0JA 4DAYA 2EPBA 3MFGA 4H13C 3VR3A 4DK0A 2WKDA 1KDCA 2BA0A 1WVLA 4XQNA 3IKJA 2HDMA 5C44B 3OMGA 3HOVB 2HDLA 2LMCB 3S14B 1EY4A 2FINB 1OXXK 2NTTA 5M9OA 1Y8OB 2RSOA 5A2QE 3NP8A 1V1PA 5CYUA 1PFMA 1DM0B 4RCOA 3HOWB 3BYYB 4DA2A 2QCPX 3T51B 2XRSD 2EYPA 3I8ZA 2Z4IA 1KDAA 2F0DA 2F1MA 4ZRZA 3ERQA 4DU9A 1WTXA 5ELEA 2XNAC 3SK8A 4RFBA 2A73B 2ZXPA 4HCSA 1SNPA 2B8GA 1JCKB 1SNMA 3EROA 5HGTA 2KECA 1HA5A 2PQEA 1GJXA 1YNNC 3S9WA 2E75C 1KDBA 4C56C 2F0KA 2K33A 2XN9C 1M4VA 1ILPA 2DNEA 3PIP3 2FFKB 1PTOF 1U9RA 3NXWA 2BDOA 4EQOA 5IODA 1ILQA 2JP1A 4KY6A 4QUCA 4MIUA 1GUWA 3MA2B 2NTSA 4A3IB 1EYDA 1NUCA 3G6JB 2IL8A 3AU7A 1ONLA 4K6LA 5ELDA 1VF5C 5CC4A 1LABA 4BBRB 1JWMD 2EY2A 1WCMB 3TZUA 3FMCA 1PTOD 5E3FA 2PZWA 2EJFC 2B2WC 3FEWX 1IW7C 4MN3A 5FO8B 1HUNA 1QILA 3MVVA 1KTKA 1B9NA 2MHVA 2DN8A 1STEA 3W2DA 1GUNA 5I4DA 3VYUA 5DNFA 3ZYYX 4RGNA 4CKCA 5JJZA 1EEFD 2FHTA 3QIAA 3DEPA 1BBXC 3D31A 4M8AA 3T56B 3QB3A 3RD4A 1GOZA 4ZUIA 5K36H 3FVQA 4U673 4FXGC 1RCVD 2PZUA 5LHY1 5EBDA 1Z6HA 5FO7B 1T5EA 1JOOA 5DAUA 4FVMA 1EYCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M00 A;  3D8G A;  3PMF A;  2NUC A;  1EY5 A;  3LX0 A;  2WAC A;  3E5S A;  4RKL A;  3MXP A;  3QOL A;  3ITP A;  1JOR A;  5CV5 A;  2OXP A;  4KY7 A;  5CV6 A;  5ISR A;  1SND A;  5CV7 A;  5KYL A;  4WRD A;  5EKL A;  4IAL A;  4WOR A;  1IHZ A;  2F0O A;  3V2T A;  5KEE A;  5C4Z A;  2EY6 A;  2EYL A;  2EYO A;  4KY6 A;  4KJN A;  1SYE A;  2RDF A;  5J39 A;  4H7B A;  5IGB A;  3OMC A;  1KDC A;  1EY9 A;  4K2L A;  4N9P A;  1F2Z A;  5I6Y A;  4MIU A;  4K8I A;  3BDL A;  2F0L A;  3DHQ A;  4ME5 A;  3SK6 A;  2F0J A;  3SXH A;  3EJI A;  4QB4 A;  4ZUJ A;  3U9O A;  1STY A;  4R8N A;  2PYK A;  2EXZ A;  4DGZ A;  3OMG A;  5KGU A;  1SYD A;  1AEX A;  2KQ3 A;  3C1E A;  4K2K A;  1EYD A;  5KYI A;  1F2M A;  3BDC A;  2F0V A;  1NUC A;  1EQV A;  1EY7 A;  4NMZ A;  1TT2 A;  5C5L A;  1II3 A;  2HQE A;  1EY4 A;  4IUN A;  4IZ8 A;  4TRD A;  4F8M A;  4KY5 A;  3SK4 A;  5HUR A;  4NKL A;  4PMB A;  5JOB A;  3R3O A;  5C6A A;  5M9O A;  5C4H A;  2F3W A;  3NP8 A;  1ENC A;  2F3V A;  4RKB A;  4QMG A;  4F7X A;  3TP6 A;  2RBM A;  1SYC A;  3D4D A;  5CC4 A;  1ENA A;  5IIF A;  3OWF A;  4DF7 A;  1SYG A;  1TR5 A;  1SYB A;  2RKS A;  4J1M A;  4N9T A;  2EY2 A;  4K5X A;  5EKK A;  4KV6 A;  4EQN A;  5I9P A;  2F0M A;  2EYF A;  3D4W A;  4HMI A;  4HTH A;  5E3F A;  5K5P A;  4LAA A;  5IGG A;  2PZW A;  4K6D A;  4KTA A;  3SK5 A;  1EY6 A;  3NQT A;  2EYP A;  4QF4 A;  4ID6 A;  1STH A;  4E6I A;  2F0Q A;  1STB A;  1RKN A;  1KDA A;  4PMC A;  5CV9 A;  4YIJ A;  2F0D A;  1STA A;  5E1F A;  5J1Z A;  5I9O A;  5IGC A;  3MVV A;  1KAB A;  3MZ5 A;  4B9W A;  4DFA A;  3ERQ A;  4DU9 A;  5C3W A;  2OEO A;  4PNY A;  5NUC A;  2F0W A;  1SNQ A;  3TME A;  3SK8 A;  2EYM A;  2O4X A;  3P1H A;  2F0P A;  2F0U A;  5IGE A;  1A2U A;  3SR1 A;  1STN A;  1A3V A;  3NUC A;  5IOC A;  2PW7 A;  3OSO A;  1SNP A;  1SNO A;  2ENB A;  1EZ6 A;  5JAV A;  1SNC A;  4ODG A;  4EQP A;  1SNM A;  3QOJ A;  4ZQ3 A;  5F2D A;  3HZX A;  2EYJ A;  3NK9 A;  4K14 A;  3MHB A;  4NP5 A;  5DEH A;  3ERO A;  2SNM A;  5J22 A;  4KJO A;  5I6W A;  4B9X A;  2EY5 A;  1KAA A;  5HGT A;  5EGT A;  1STG A;  1EY0 A;  5C5M A;  3D6C A;  2EY1 A;  2F0F A;  5KIX A;  4OL7 A;  2LKV A;  4KHV A;  2SNS A;  1A3U A;  1EY8 A;  1NSN S;  1EYA A;  3QB3 A;  2F0T A;  4I65 A;  3VA5 A;  4KD3 A;  2F0G A;  1TQO A;  3DMU A;  5CV4 A;  2PQE A;  3SHL A;  2PZT A;  5KRU A;  1JOK A;  5CGK A;  2OF1 A;  3S9W A;  1KDB A;  3NHH A;  2PW5 A;  1EZ8 A;  2F0K A;  4G57 A;  4K5V A;  1A2T A;  1JOQ A;  2F0N A;  4NDX A;  1F2Y A;  1SYF A;  4K8J A;  4ZUI A;  2F0E A;  4S3S A;  3H6M A;  3TP5 A;  2SOB A;  5IGD A;  4KD4 A;  1U9R A;  2PZU A;  2F0S A;  2QDB A;  5CR3 A;  3RUZ A;  3NXW A;  2F0I A;  5C3X A;  4HMJ A;  4EVO A;  2KHS A;  3T16 A;  5IGF A;  3MEH A;  4EQO A;  3T13 A;  5IOD A;  3HEJ A;  1JOO A;  1A3T A;  3C1F A;  3P75 A;  5CV8 A;  4J6H A;  2EYH A;  5DAU A;  1EYC A;  3TP7 A;  2F0H A;  3TP8 A;  3EVQ A;  4K5W A; 
#chains in the Genus database with same CATH topology
 1NR2 A;  2VQF Q;  3E6Z X;  1LUZ A;  2FMC A;  4LWC A;  2R7F A;  5CV6 A;  1MSH A;  2LFN A;  3M4Y A;  5FLM H;  2KEE A;  4KI0 A;  3HOW G;  5C4J B;  2PQA A;  3ERS X;  3CCR A;  4GOP C;  3CCU A;  5IYB H;  4JI0 L;  4IFD G;  4R8N A;  1YIJ A;  4R4C A;  4XDX A;  5E4X A;  2A6H D;  1C48 A;  5KYI A;  5M3F G;  1MI2 A;  1EQV A;  1F9S A;  2F0V A;  2NN6 H;  5M3M B;  4IZ8 A;  3GTG H;  1IZ6 A;  2A74 C;  2P5Z X;  5D65 A;  3SK4 A;  1NCV A;  1SMY D;  3G48 A;  4RKB A;  4QMG A;  1I50 H;  3BG3 A;  4GZY C;  4Q0F A;  1I3Q H;  1D8L A;  4J1M A;  3AYH B;  1PFS A;  2KCM A;  1KD1 C;  3A7L A;  3U9S A;  4POF A;  4ME3 A;  4LF4 L;  1AE3 A;  4MNO A;  2JA7 H;  1YVC A;  4PMC A;  5CV9 A;  5I9O A;  2RSN A;  3S1R B;  4RHS A;  2IHE A;  3DXJ C;  4CKB A;  5C3W A;  4QGU A;  1SNQ A;  3T1Y L;  2F4V L;  2IW3 A;  3GTL B;  2JE6 I;  2N78 A;  3NUC A;  3N52 A;  4A75 A;  1SNO A;  2R92 G;  4XQQ A;  5AJ3 Q;  3HGB A;  3O13 A;  3GTJ H;  2EOT A;  3H3V H;  1KQS A;  2R7Z B;  2IX3 A;  4IO9 A;  3RMH A;  1Q8K A;  1X56 A;  4JI8 Q;  3CQZ H;  3T1H Q;  1YNJ C;  4HED A;  1JOK A;  3PUZ A;  3CMA A;  2VS1 A;  4OEL B;  3ND9 A;  2GVB A;  2AHO B;  3AMU A;  1S40 A;  4KD4 A;  2F0S A;  1PHJ A;  1Y1V G;  2JA5 H;  4L5S A;  2I5M X;  1FR3 A;  1HTP A;  1PRT F;  4JK1 C;  4ZKB B;  4YWM A;  3QG1 A;  1G6P A;  1D1K A;  3PO2 B;  3I70 A;  4HAE A;  2K4K A;  5CV7 A;  4WRD A;  2L11 A;  4DR5 Q;  2PO4 A;  2RVL A;  5D14 A;  2KVM A;  2EIF A;  4BBS G;  3KF8 B;  5AJ3 L;  3S1R H;  5EPL A;  1EU4 A;  4DKA C;  5LMU L;  3S1M B;  2DGY A;  2PYK A;  5KGU A;  1A63 A;  1Y1V B;  1X54 A;  1VQ9 A;  1GVP A;  2I07 B;  4FYD A;  1E1T A;  1WFQ A;  2D2C C;  1TT2 A;  3PO2 G;  4KY5 A;  1GO3 E;  4NXN L;  5C0X H;  3NWT A;  1XNR Q;  2F3W A;  4RWS C;  3G7L A;  2F3V A;  5L37 A;  1IYV A;  1C0A A;  1ROD A;  1VQL A;  1YIT A;  2NVT H;  3HOY G;  4R8I A;  1EQQ A;  1PDQ A;  3RNU A;  1DGS A;  1Z47 A;  1DYQ A;  1HNZ Q;  2BH8 A;  3CCE A;  5IP9 G;  3IAY A;  5COR A;  4A3B B;  2JA7 G;  3C2P A;  2N3S A;  4C3I B;  4CDE C;  4RG1 A;  1GXD C;  4AYB B;  3FPP A;  1QNK A;  4A3D G;  4IN3 A;  5NUC A;  3HOZ B;  2IPK D;  3P1H A;  3F1Z A;  3SR1 A;  1A3V A;  4A3B G;  1B7Y B;  1XNQ L;  2VNU D;  5KND A;  1VQI A;  4A3K B;  2WAQ G;  1UNS A;  2CWA A;  3MHB A;  4P74 A;  3MXN A;  2A69 C;  2WKC A;  3HOY B;  5DM6 3;  1STG A;  2E2D C;  2VW9 A;  3D6C A;  4C3I G;  1NMF A;  2UXB Q;  5IP7 H;  2JA7 B;  1HJP A;  1EYA A;  3T53 B;  3RN2 A;  2QIL A;  3Q8D A;  4N8X 1;  3NHH A;  4K5V A;  3LWE A;  1PH8 A;  2F0N A;  1E24 A;  3KFU A;  2BH2 A;  3RZO H;  4A3J H;  3I55 A;  3TP5 A;  5M3F B;  1XWE A;  3D6W A;  2JK8 A;  3KOJ A;  1SJE D;  2F0I A;  1KNE A;  1WI5 A;  5G3L D;  2MPM A;  2E2I H;  1N34 L;  3BZD B;  5CV8 A;  5C3E B;  4YIJ A;  1JOR A;  1I4X A;  2NUC A;  4KK7 A;  1VQP A;  3S17 H;  3MXP A;  2Z4H A;  4A93 B;  3PCO B;  5E4W C;  2EYO A;  1E2W A;  5J39 A;  1QNU A;  1O80 A;  2KJX A;  2F52 A;  3BDL A;  1HNZ L;  1F77 A;  3L9A X;  2L9H A;  1IKL A;  4DUY Q;  1XX8 A;  3I73 A;  1U4R A;  4A3B H;  4DR1 Q;  3I2Z A;  4IQZ A;  3M4P A;  1HZC A;  3CPW A;  4DXF A;  3QO2 A;  2R93 B;  3PIO 3;  1CQV A;  3MWY W;  4RCN A;  1LT6 D;  4PMB A;  2LS0 1;  2EQS A;  5GAD C;  2UUB Q;  2Z9H A;  3MAQ A;  4XT1 B;  4A3G G;  2NBF A;  1SMY C;  1IBM Q;  2A19 A;  4OIJ A;  4GOP A;  2K1B A;  2HD3 A;  4HID A;  1VS0 A;  2RDH A;  1NNX A;  1EYC A;  1UAP A;  2FJ2 A;  2F0M A;  1CHQ D;  4PV1 C;  4NW2 A;  3JAM i;  1RTO A;  4P2C B;  2Q8I B;  3KDF B;  1EOT A;  4C1N K;  2B2V C;  4IFD J;  3AEV A;  1GUT A;  3TQY A;  3KF6 B;  2ZJP A;  4JVZ A;  1PTO H;  1IYJ B;  2NVY B;  5M5W B;  2O4X A;  4HIK A;  3V05 A;  1TWC H;  1VQB A;  4LF5 L;  1XXG A;  2Q2H A;  4FF1 A;  1K3B C;  1SNC A;  5KNC A;  3DM1 A;  1GHK A;  4IFD H;  1M90 C;  4FP5 D;  2RHS B;  3CHB D;  1KAW A;  1V1Q A;  5EKI A;  4HR7 B;  5ELF A;  3H91 A;  3NPP A;  1X3F A;  3CKI B;  4WJW A;  1CUK A;  4OL7 A;  3HKZ G;  1JJ2 A;  1S3O A;  1OXS C;  1Q81 C;  3FHW A;  2IHF A;  1PRT D;  2CCZ A;  1BR9 A;  3NEM A;  4DUZ Q;  1WYD A;  5G3L F;  4KN7 C;  2OF1 A;  4FF2 A;  4Z9C B;  2VL6 A;  4JBK A;  2QGQ A;  3L3O C;  3HOX B;  1EU3 A;  2SOB A;  5DM7 3;  1V1P B;  5CR3 A;  2KHS A;  2VUM H;  5HY6 A;  4GLA C;  1PVO A;  4DK1 A;  2AMC B;  2K32 A;  5H1S E;  3W3A A;  2JSO A;  4K5W A;  3T1Y Q;  2BCO A;  1WTH A;  2A68 C;  2D5D A;  3UDI A;  1S72 A;  4X3K A;  2VY3 A;  5EKL A;  1SFO H;  5FLX E;  2F0O A;  2J4X A;  4QUF A;  3UDG A;  4TSS A;  3OPO A;  4WJ4 A;  3DHQ A;  3EJI A;  4A3D B;  1STY A;  4AYB G;  1K0S A;  3QWN A;  3S2D B;  1AEX A;  1CHP D;  1D1I A;  3STB D;  2MFI A;  1VQ8 A;  3W1B A;  3Q22 A;  3UI2 A;  5C4H A;  1EYG A;  1IW7 D;  1B3Q A;  4B08 A;  3CME A;  4KKU A;  4IFD I;  3F2U A;  1TWH B;  1D6E C;  2JA6 H;  1LTA D;  1PZK D;  1PH6 A;  3I4M H;  3S1M H;  5JVH 3;  3EBE A;  4MZ9 A;  3D0F A;  3GTJ B;  3J80 E;  4WFN 3;  3I4N G;  5A35 A;  1YNJ D;  2HCC A;  4U68 A;  2F0Q A;  3EQL C;  4PZ6 A;  3LGJ A;  2QF7 A;  2B2U A;  4DR3 L;  4JYA Q;  2VQF L;  2OEO A;  3SGI A;  4HSP A;  3HOV H;  1STN A;  3OSO A;  3CC2 A;  4LF4 Q;  1G29 1;  3OTO L;  3HOU H;  4H0L C;  2DY7 A;  4NP5 A;  1VCI A;  3AB9 A;  2HQL A;  1F9R A;  1UEA B;  5I6W A;  2UUB L;  1KAA A;  1YHA A;  3I4M G;  4GKJ L;  1R9T B;  4FXK C;  3GO5 A;  3U4V A;  4KD3 A;  3VYS A;  3SHL A;  3UE0 A;  3OW7 A;  1SE3 A;  3CU7 A;  3S2D H;  3HOY H;  1WTP A;  1LT3 D;  5ELO A;  2BE5 C;  1F2Y A;  1TWC B;  1PRT C;  2ASB A;  4IPD A;  2H5X A;  2CW0 D;  1JJG A;  3RUZ A;  4XXE A;  4XYO A;  3NSW A;  5IYD G;  2NN6 G;  4A3F B;  2EXD A;  2ZXO A;  4FXD A;  2L4N A;  4TQU S;  4C1N I;  3G71 A;  1ICW A;  3K7A B;  2A6E D;  2UXD L;  1JQY D;  1MJE A;  2IX0 A;  2M2L A;  3J81 E;  5KYL A;  5C44 H;  2JQO A;  1QUQ A;  1AP0 A;  1SYE A;  2RDF A;  2E5L Q;  1LTS D;  2R3Z A;  2EVB A;  1JWS D;  3HKZ B;  5FK9 C;  2A1A A;  3K6O A;  2JA6 B;  4JI4 L;  2WFW A;  5AFW A;  4HJ8 A;  4QB4 A;  3M9B A;  3U9O A;  4OIK A;  1H9R A;  3S1Q B;  1MHW C;  1SYD A;  4DAV A;  3C1E A;  4L5R C;  3MXU A;  3IFT A;  1I3Q B;  1EY7 A;  1B4O A;  2VB2 X;  1YBY A;  1SRO A;  5LL6 S;  3K5N A;  2UU9 Q;  5TSS A;  2IX1 A;  1KIX A;  3S15 B;  2R7Z H;  4UP7 A;  5IIF A;  3RZD B;  3FPU B;  3I4N B;  4N9T A;  2TMP A;  1FGB D;  4JI3 L;  4M1U B;  2JYO A;  1UE7 A;  3BU2 A;  4KHZ A;  5JEA H;  5D3I B;  4HMI A;  2HT1 A;  1OXV A;  4LAA A;  4G7H C;  2HHH Q;  3SK5 A;  4KHP Q;  4GNX B;  3PSI A;  2C35 B;  1TKW B;  2NWG A;  5J1Z A;  4GS3 A;  1GKH A;  2K01 A;  4B9W A;  3RLO A;  5KNB A;  2A69 D;  1JR0 D;  3OYY A;  3TME A;  3AQQ A;  4ZAI A;  3PO3 H;  3PUY A;  4OO1 I;  4DV7 Q;  3LWU A;  1J6Q A;  2F0U A;  4A3K G;  4B3R Q;  4CJ2 C;  1TWH H;  2ENB A;  2K14 A;  2ICE C;  1FNW A;  3TEH B;  2N8N A;  3HZX A;  3FKI H;  3H0G H;  5BN3 A;  1TWG B;  3GP7 A;  1EY0 A;  2EY1 A;  1SDF A;  1N8R C;  1EY8 A;  3K80 C;  3VA5 A;  1HPC A;  1UE5 A;  3PF5 A;  1TQO A;  4GKK L;  4UAI A;  4ZCK A;  2B8F A;  5EPK A;  4A93 G;  3NEL A;  3NE5 B;  4TVA B;  2AKW B;  5GAG C;  2AWO A;  1P8L A;  3JAM E;  1K8G A;  1PH9 A;  2K28 A;  3CQZ B;  2MUY A;  4RHR A;  2ZJQ A;  1WTV A;  4B3T Q;  2X6L A;  4C3J G;  3PF4 A;  1D5X C;  4EVO A;  1PRT B;  2K6A A;  4B3T L;  1L1O A;  2L12 A;  3NWS A;  4FO2 A;  3P20 A;  3T13 A;  5BR8 Q;  5GRO A;  1IYU A;  3C46 A;  2M00 A;  4F88 A;  1V1O A;  1H9S A;  2WAC A;  4R4O A;  3M4O B;  1UE6 A;  2LXK A;  5ISR A;  3DWA A;  1CTM A;  4OGQ C;  3D3R A;  2Y0S G;  1SE2 A;  4IAL A;  2VUM B;  3V2T A;  5C4Z A;  1V9P A;  2WAQ E;  4L6T B;  1QWY A;  5JEA J;  1W3S A;  3RZD H;  1WOC A;  4GN3 B;  3PUW A;  1MGS A;  2CKZ B;  1B50 A;  1WTQ A;  1WCM H;  2CQA A;  2QDL A;  4UY8 C;  1JWU D;  4A3M G;  2DY8 A;  4DPG A;  1JE4 A;  1K83 H;  5FO9 B;  4BY1 B;  5C3E G;  1EEI D;  3K57 A;  5CBA E;  1II3 A;  4IUN A;  2UXC L;  1XPO A;  4NKL A;  1AZQ A;  4H44 C;  3FKI B;  1LLR D;  3H0G B;  4QJF A;  4DR2 L;  1MD2 D;  4X65 Q;  2ZM6 Q;  1U4P A;  3I91 A;  4JI6 Q;  3M3Y B;  4O0A A;  4RGM A;  3GTG B;  1G2S A;  1NR4 A;  5M5W H;  1H95 A;  1PH3 A;  4DR3 Q;  3PUV A;  1N32 L;  1ESR A;  2N88 A;  4YHH L;  5E1F A;  1VQ5 A;  2IY5 B;  2YU9 H;  1STA A;  4G7Z C;  1ET9 A;  1LTG D;  1G51 A;  3HP3 A;  3MZ5 A;  2DJG C;  1ZEQ X;  1VQ6 A;  1I94 L;  2EYM A;  4MHE A;  3KLR A;  1BBU A;  5IGE A;  4KN4 C;  1VQK A;  2VB3 X;  1D5Z C;  4BWG B;  2DUD A;  4TKO B;  1KNA A;  3QOJ A;  1RDP D;  5F2D A;  2ZTD A;  3CRL C;  5COY A;  1PH2 A;  1FL0 A;  3MXG A;  5J22 A;  1W6J A;  4DAP A;  1BUV T;  2OTL A;  2LKV A;  3UDX A;  3G6E A;  3K7U C;  5IP7 G;  1NSN S;  4QY7 A;  2F0T A;  3TDQ A;  2J0T D;  2PI2 E;  1VQM A;  2XIW A;  1VQD A;  1YEZ A;  1HFG A;  1MJC A;  3T1H L;  2K52 A;  1JJC B;  3ND8 A;  1A15 A;  2DJF C;  1EZ8 A;  4G57 A;  4MTK A;  1A2T A;  4A3L G;  4R4I A;  1VMC A;  1XJV A;  2I5L X;  1K8O A;  3KUP A;  1JMC A;  4A3E G;  3VR5 A;  5C3X A;  3CC7 A;  3VYR A;  1BQQ T;  1KRT A;  5IGF A;  3K5O A;  3BZC A;  1QUQ B;  3A55 A;  2F4V Q;  2F0H A;  4ME5 A;  4GNX A;  4RGO S;  5FKA C;  4OWW B;  1AZP A;  3HS0 C;  2K5D A;  1W2B A;  1RJT A;  1Y8N B;  3OOC A;  1PZJ D;  3VYT A;  1IL8 A;  4N9P A;  2I46 A;  3NTH A;  3V96 A;  1EIH A;  4LUZ A;  5I6Y A;  4BXX H;  2Q2T A;  1XMO L;  2AUK A;  2JEB I;  2VXW A;  1DOK A;  1KHI A;  1TWA B;  5IWA L;  3UDF A;  1E2V A;  1Q1E A;  4DN4 M;  2UXC Q;  3DWP A;  4XYQ A;  1CT1 D;  4DNT B;  2I0Q A;  2AWN A;  2ZTC A;  4F8M A;  1TII D;  2AQ1 B;  2YTY A;  1O7Z A;  5C6A A;  1MKH A;  4CHT B;  1BXT A;  4FDB A;  2KBN A;  4A3F H;  2WAQ B;  1VMP A;  2L15 A;  4RH6 A;  4DV5 L;  2B3G A;  1ENA A;  4R9W A;  3TBI B;  1I4R A;  4L63 B;  4LFB Q;  1SYB A;  1X3Q A;  4DR6 Q;  2PNH A;  5EKK A;  1D7Q A;  2UUA Q;  1N33 L;  4HTH A;  2NB0 A;  3PGZ A;  4IUR A;  1PH7 A;  1CFM A;  2FXQ A;  1H9J A;  2HCI A;  2QEX A;  1RKN A;  1Q1B A;  2XWJ B;  1JC7 A;  4DV5 Q;  1Q82 C;  5C44 G;  1CA6 A;  4APV A;  3B6Y A;  4X6A H;  4HSV A;  2MP1 A;  3MFY A;  4IJH A;  3EFX D;  1ASY A;  1E0B A;  3CXC A;  2K5W A;  2ID0 A;  4BY1 G;  5JPN C;  5M3M G;  4EQP A;  4C3H H;  1ZKO A;  1QG7 A;  2OWO A;  4KJO A;  5C5M A;  1R4P B;  4KHV A;  3Q6S A;  1A3U A;  1DJR D;  3K7A H;  4OXP A;  4I65 A;  4X3S A;  3DMU A;  1V8Q A;  3F8T A;  1TWA H;  1LT5 D;  4L8J A;  4ZLT F;  1FNV A;  4JV5 L;  4A3E H;  2F0E A;  1K3R A;  4P73 A;  1Y1W G;  1LTT D;  2EE1 A;  4DV1 L;  2A5H A;  1K28 A;  5IP9 H;  4JI6 L;  2CH4 W;  1U5K A;  3HEJ A;  2F03 A;  1NAP A;  1K8A C;  2XWB B;  2OQ0 A;  1QCB D;  2K04 A;  3D8G A;  1EY5 A;  2RA4 A;  2G9H D;  1EQT A;  1DD2 A;  2NZ1 D;  1JT8 A;  3I90 A;  1J5E L;  4CKE A;  1FYC A;  1LAC A;  1X55 A;  3ULP A;  3KLS X;  2KHI A;  1QOH A;  2LSS A;  2D0P A;  1PA6 A;  4K2L A;  4V0B A;  1X65 A;  3A56 A;  2GVA A;  3KF6 A;  3WOF A;  1HA6 A;  3I4M B;  4BY7 H;  2WII B;  3KBG A;  4ZUJ A;  1EUJ A;  1Q90 A;  1EIY B;  5EQ0 A;  2NVT B;  5FOB B;  3GTP B;  1EWC A;  4TRD A;  1GUS A;  3URY A;  3J81 L;  1U4L A;  3EIV A;  4A3C G;  1PYS B;  4LF9 L;  3SDZ A;  3KBX A;  4F7X A;  1SYC A;  4B3S L;  1DCZ A;  2K50 A;  4RGT A;  2Z1C A;  4IOA A;  1Z7T A;  1TR5 A;  2GN5 A;  3NQI A;  1EL0 A;  1PFB A;  1F2L A;  2EYF A;  1QVC A;  3F2C A;  1W6K A;  2ZXR A;  3X3N A;  4KTA A;  1QZH A;  1I5F A;  1EY6 A;  3F2B A;  3OIQ A;  1Y1W H;  4X62 Q;  2D62 A;  2JEA I;  1FD7 D;  1SN8 A;  4YY3 L;  1S5C D;  3DEO A;  1KAB A;  4FF4 A;  4C3H G;  2NYZ D;  3BJU A;  5M5X H;  4UHV A;  3WDN A;  4OWT B;  4OO1 G;  2V4D A;  1A2U A;  1ENF A;  2BOS A;  5IOC A;  1R9T H;  1YHQ A;  2RHQ B;  3RZO B;  3NBH B;  1MBY A;  4BBR H;  3NBH A;  4QIW B;  2JA5 B;  2EYJ A;  2ZJR A;  1NJI C;  3PIO A;  1UUP A;  2Z0S A;  4XQJ A;  3RR5 A;  4CJ1 B;  1CKN A;  3GTL H;  3M7G A;  1PMR A;  3ULL A;  4PQX A;  1GHJ A;  2H4O A;  4QIW E;  3GTM H;  2OTJ A;  1BCP C;  4NDX A;  2PNR C;  4I7Z C;  4BA1 I;  2WP8 J;  3W1G A;  1S5B D;  3Q0A A;  2G5D A;  3J80 L;  3VR4 A;  4H02 A;  4HCE A;  3S16 B;  2KHJ A;  2L1B A;  4JI7 Q;  3K59 A;  1PXU A;  3P75 A;  3CCQ A;  3GTP H;  3TP7 A;  1ZYR D;  1EWH A;  3LX0 A;  3ITP A;  1PV4 A;  1I6H B;  1HQR D;  1SND A;  1GM5 A;  2CQO A;  1IBK Q;  2EJG C;  2OT2 A;  5KEE A;  1OTC A;  1E22 A;  4X66 Q;  2A6H C;  4HIM A;  1H9S B;  1O78 A;  2F4I A;  1S5F D;  3BVG A;  5GAE C;  4JBW A;  2F0L A;  2PQA B;  1YI2 A;  3SK6 A;  2F0J A;  1S5D D;  2JJQ A;  3MEF A;  2K75 A;  4YCU A;  4DK6 C;  1RHP A;  4DGZ A;  4A3C H;  5FJ8 G;  3LNN A;  2R61 A;  2CWP A;  1TWF B;  2NVX H;  1XNQ Q;  3DWQ A;  1E1O A;  1E7Z A;  4B3R L;  3TRZ A;  1I4G A;  3I72 A;  2MNA A;  5HUR A;  2HUG A;  1VQC A;  1CQF A;  1PTO B;  2NVY H;  3PO3 B;  2RBM A;  4BY7 G;  4DR6 L;  1O7I A;  4DF7 A;  1B1Z A;  1H9K A;  4I7A A;  4KV6 A;  5I9P A;  1RF2 D;  2VUM G;  1YNN D;  3OWE B;  4DR7 L;  2NVQ B;  1K8M A;  4DNR B;  3VR2 A;  3J7A V;  3HOX H;  1STB A;  3BDO A;  1H9M A;  4HJ5 A;  3KYH C;  3A74 A;  3KDF A;  2PW7 A;  4P71 A;  5T1G A;  3NK9 A;  4LNQ A;  4K14 A;  1EFW A;  1UWV A;  3A5Z B;  5A2Q L;  3S2H B;  1HUM A;  2F0F A;  1Q46 A;  2ICI A;  5BN4 A;  2R6G A;  3S17 B;  5JPM C;  2F0G A;  4JI1 L;  4OO1 H;  4CGY B;  1JE5 A;  1BVS A;  2V1C C;  4A3I G;  4RA8 A;  2KOL A;  3J81 i;  4GOP B;  2VZA A;  1AW7 A;  4S3S A;  3H6M A;  1N9W A;  4O2D A;  4LF8 L;  4A3K H;  2QDB A;  3JAM L;  4OEM B;  4LFB L;  4IUV A;  3M85 A;  2ZT9 C;  1QJO A;  3TP8 A;  4A76 A;  2NVX B;  1LTB D;  1KL9 A;  3QOL A;  1LTL A;  4C3H B;  5CV5 A;  2OXP A;  1E2Z A;  5ELC A;  2B39 A;  1D5M C;  1WD0 A;  2EY6 A;  2E76 C;  2EYL A;  2E2I B;  1OO9 B;  4KJN A;  4JI8 L;  1BO0 A;  1EY9 A;  1F2Z A;  3AFP A;  4JW0 A;  4K8I A;  5M3F H;  3K81 C;  1DXM A;  4X64 L;  5EAY A;  3K5L A;  3DM3 A;  2JA6 G;  2ZTE A;  2E74 C;  1LTR D;  4O42 A;  3OTO Q;  3I3C A;  1CKN B;  3A54 A;  3GDE A;  1B44 D;  1EOV A;  1G8Z D;  1VQO A;  2WB1 E;  1X3E A;  1WTO A;  3L0O A;  2YU9 B;  2B2U C;  1X9N A;  1A6X A;  3JAM c;  3K0Y A;  2WIN B;  2EJM A;  3OW2 A;  2ALY B;  4LK1 C;  1PH4 A;  1CKO A;  4BBS B;  4C2M B;  1M1K C;  3CC4 A;  1NBW A;  3S24 A;  3BYT B;  1G2T A;  3MXN B;  1Q8I A;  2D0O A;  4X65 L;  2A6E C;  3E9I A;  5EBC A;  3PIP A;  2L55 A;  2Q8R E;  1GD7 A;  3I4O A;  3HOU G;  4K6D A;  2BA1 A;  1LTI D;  1STH A;  2Y0S E;  1TU2 B;  3IRB A;  3TN2 A;  1Y14 B;  3I4L A;  3WOE A;  1CK1 A;  1M8A A;  2X6G A;  5I2Y A;  1QZG A;  5IYD H;  1DOM A;  1HFN A;  4XT3 B;  2JN4 A;  1QVF A;  2F0P A;  4MTN A;  4IUP A;  2HIX A;  5JAV A;  2B2Y A;  1VDZ A;  1R4Q B;  4UP8 A;  2QKI C;  1TS2 A;  1VQG A;  5JJK A;  1X32 A;  4LFC Q;  3EN2 A;  5EGT A;  4JI2 L;  2LXJ A;  1Y1W B;  2K5V A;  5KIX A;  1HR0 Q;  1I6H H;  3PO3 G;  2SEB D;  2PZT A;  1TS3 A;  2B2W A;  4JI7 L;  1EWI A;  1Y1V H;  1SYF A;  3R2T A;  3PO2 H;  4JG2 A;  3R93 A;  4ZKC B;  5IGD A;  1YNX A;  4BY7 B;  2YTV A;  1B53 A;  1BCP B;  1HZ9 A;  2G9D A;  4HMJ A;  1RD9 D;  4N8F A;  4EGV A;  1BCP F;  1FGU A;  2CHB D;  1MSG A;  3S15 H;  3GTO H;  3K58 A;  5LMN Q;  3KJO A;  1P16 A;  3PMF A;  1WTR A;  4DXG A;  3RLN A;  3CAM A;  3OIP A;  3H09 A;  4KY7 A;  3FDT A;  1SEB D;  4AH6 A;  2ATW A;  1ET6 A;  4WOR A;  1HRJ A;  1SJH D;  2QW7 A;  3OMC A;  2Z8L A;  3BZK A;  4BBR G;  2OCE A;  3T4A C;  2K5Q A;  4LJZ C;  2R7Z G;  3SXH A;  2Z6K C;  2B2T C;  1J9O A;  3GTK B;  2B63 G;  1F9Q A;  2LY7 A;  1GUO A;  2KQ3 A;  4IJL A;  3VR6 A;  5C0X G;  4P72 A;  5D3D A;  5C5L A;  4F87 A;  2TSS A;  1NTG A;  1CM9 A;  3GQB A;  3R3O A;  1XMQ L;  3U58 A;  2HHH L;  3EA6 A;  3SE0 A;  4CJ0 B;  5BR8 L;  1GUG A;  4JI3 Q;  4ILW A;  1CKM A;  3OWF A;  3GTQ B;  2R93 G;  4X64 Q;  2L0C A;  4OWX B;  1O7Y A;  3D4W A;  5K5P A;  2CH4 A;  5C4J H;  2WB1 B;  3S2H H;  4QQB X;  1OXU A;  3N6R A;  4RAU C;  4QF4 A;  5DLQ E;  4JI2 Q;  4HJA A;  3MC0 B;  1IBM L;  1TY2 A;  2B63 B;  4PG3 A;  1L0W A;  4DFA A;  4GLX A;  4POG A;  2PMZ B;  3TZD A;  2YTX A;  2RF4 A;  2F0W A;  1KLU D;  2IWH A;  4Y52 H;  2K5H A;  1SXT A;  3GTO B;  3IFD A;  3RN5 A;  4R1J A;  5ELB A;  1HNW Q;  4DR1 L;  5K36 G;  1RL2 A;  3M4O H;  3A5U A;  4BS9 A;  5IYB G;  4LF6 L;  4J8Q A;  1VF7 A;  4NB3 A;  1ZYR C;  3E0E A;  4A93 H;  1I50 B;  3HG9 A;  1AH9 A;  5CBE E;  1LYL A;  2NZH A;  1JIC A;  4ULL A;  2GA4 B;  2KUM A;  4KKT A;  3U4Z A;  4KMU C;  1BCP D;  4DV6 Q;  5GQO A;  2PW5 A;  5LL6 X;  4DV1 Q;  2IT1 A;  1KC8 C;  2E8G A;  3QR8 A;  2M9V A;  2RDG A;  4P75 A;  4EQ5 A;  4ABN A;  5C0X J;  2A68 D;  4B3M Q;  3E3X A;  3HRZ C;  4ZYS A;  2JA8 B;  2Y0S B;  1LT4 D;  1S4Z A;  5IT9 L;  3PUX A;  2K5N A;  2PCF B;  4JV5 Q;  3GD7 A;  5JJI A;  2NN6 I;  2Q2I A;  1G6Z A;  4LMQ D;  3VDY A;  2SNS A;  4LF7 L;  2R93 H;  3TS0 A;  3L7Z C;  3PQI A;  2KED A;  4DV0 L;  4RKL A;  1F9P A;  4NXN Q;  3JC6 6;  1XTC D;  4IUT A;  5EJW A;  3DUZ A;  4CBV A;  2PPB C;  2C9O A;  3CF5 A;  5IGB A;  2KCN A;  4V19 0;  2MO1 A;  2UXB L;  4A3J B;  4B3M L;  1HQM C;  2JXM B;  2H1E A;  1CZW A;  4LW1 A;  5T1I A;  4UP9 A;  1Z9F A;  1YJN A;  4K2K A;  2RCN A;  1HNX Q;  4GLV B;  1L0X B;  1RIP A;  1NMG A;  2AQ2 B;  4X3U A;  3U50 C;  1TS5 A;  4FNF A;  2R92 B;  1HXY D;  1B8A A;  3TP6 A;  1AFP A;  1SSO A;  1Q7Y C;  2RQX A;  3K8A A;  4BXX G;  4AYB E;  3SVM A;  1VQE A;  1Q3L A;  2XGT A;  2Q2U A;  4K5X A;  4EQN A;  3A0J A;  2J7Z A;  4JI1 Q;  1I4Q A;  4ZK9 B;  3A8K E;  3ULJ A;  4G7O C;  4X66 L;  4OON A;  3BVZ A;  4ID6 A;  2PI2 A;  3VA7 A;  3TSS A;  4L5T A;  5JEA G;  2QA4 A;  2BDN A;  3G4S A;  1XTD A;  4DV0 Q;  2MO0 A;  1XNR L;  2UUC Q;  1XPR A;  4A3M B;  2L5T A;  4OX9 Q;  4YHH Q;  3J80 c;  4JBM A;  1SBB B;  1SE8 A;  3KJP A;  2E2H B;  3FP9 A;  3GTM B;  4NXM L;  4LUV A;  2EY5 A;  1KLG D;  3E9H A;  2KCT A;  1N36 L;  2VQE L;  1XYI A;  4QCL A;  1EFI D;  5CV4 A;  4DR5 L;  1IBL Q;  1SFO B;  2XRQ D;  4Y7N H;  1BKB A;  1PFN A;  4IUU A;  4C3I H;  2QEJ C;  4K8J A;  4CDF C;  4GN4 B;  2B2T A;  3M7N A;  4DNI A;  2Z6K A;  1DZ1 A;  1BDO A;  4LF6 Q;  4QL5 A;  4DR2 Q;  5FJ8 H;  2B2Y C;  1DOL A;  1CA5 A;  2OQK A;  3MEH A;  1TVX A;  4XTC S;  3Q23 A;  3F2D A;  1A3T A;  4J6H A;  2EYH A;  3EVQ A;  5C0X I;  2DNC A;  3RLF A;  1OXT A;  3R8B A;  4DV4 Q;  3ICE A;  5LMN L;  4A3D H;  2E2J B;  3SEB A;  2IJ0 A;  2MQH A;  1EIF A;  4Q5V A;  4X3T A;  1IHZ A;  1HCZ A;  4A3J G;  1NE3 A;  4IUQ A;  3BVM A;  2C5C A;  4KLK A;  1FNU A;  4AIM A;  4G4K A;  1L0Y B;  3NTI A;  4NPS A;  1YJW A;  1ML0 D;  2SDF A;  1IKM A;  3K5M A;  3KLS A;  2CVR A;  4IOC A;  1KRS A;  1F2M A;  4JPB W;  1VQJ A;  2KCC A;  3BDC A;  4A3E B;  2K03 A;  4NMZ A;  2XSC A;  2YYZ A;  5I2X A;  1AE2 A;  1CI3 M;  1WJJ A;  1E3P A;  2I5H A;  2E2J H;  3A8J E;  1TS4 A;  1TY0 A;  3J81 j;  2JA8 G;  5FLM G;  3A7A B;  1G91 A;  2O5I C;  1K83 B;  1J8I A;  2K05 A;  4LUO A;  1TWF H;  1SLJ A;  4FF3 A;  3R2I A;  5JJL A;  3KLW A;  1SYG A;  5ELN A;  1JB3 A;  1HR0 W;  3GV6 A;  3BS1 A;  1K9M C;  4Y7N B;  1ZXT A;  3MTS A;  3KF8 A;  4E6I A;  5CMD A;  2AUJ D;  1K73 C;  3A8I E;  5M3M H;  1I6V C;  1X3G A;  4IPH A;  2WV6 D;  5IGC A;  3ZJY C;  3J7Y W;  4HJ7 A;  4J15 A;  2CFM A;  1EIG A;  5C4X B;  2KEN A;  1K0R A;  1EZ6 A;  5IT9 E;  4DV7 L;  2JA8 H;  1YHB A;  3AFQ A;  1ICF B;  3QJY A;  1C8C A;  3GV3 A;  5DEH A;  4KKS A;  5M5X B;  4B9X A;  4O1N A;  2O5J C;  4X62 L;  2EZV A;  2RCF A;  2XTI A;  5C4X G;  1SMX A;  3TRE A;  2B2V A;  1C4Q A;  1HR0 L;  1N34 Q;  4K0K L;  1KXL A;  1Y69 U;  1JOQ A;  5IYC H;  4LFC L;  4OX9 L;  1SRU A;  1WD1 A;  2MGS A;  1BNZ A;  5IT9 c;  2JA5 G;  1NY4 A;  2X69 A;  2E2H H;  4A3L H;  1LO5 D;  2EDG A;  2K7V A;  1O7L A;  3ONA B;  4GN5 A;  1L1O B;  4EX5 A;  4DV4 L;  1HTL D;  3E5S A;  1A8V A;  2O2L D;  4K0K Q;  4BBS H;  4H7B A;  5IY0 A;  4JOI C;  1DON A;  2FMM A;  1SR3 A;  1CZG A;  3S16 H;  3FRP B;  1J5E Q;  4DK3 C;  2EXZ A;  2R7D A;  4C3J B;  4HJ9 A;  5M5Y B;  2BE5 D;  3HKS A;  4PMW A;  1HH2 P;  4UPA A;  5BN5 A;  3S1N B;  3IL8 A;  2D9U A;  4BA2 I;  3KK7 A;  1U4M A;  2HQE A;  1BF4 A;  3PV0 A;  4CDC C;  1VQA A;  5JOB A;  1PLF A;  1WTW A;  1ENC A;  1X3P A;  1Y8P B;  4PZ7 A;  3CCM A;  4JI5 Q;  3D4D A;  3X3M A;  5C4X H;  1QB5 D;  4GKJ Q;  1LV9 A;  1PTO C;  1PZI D;  2RKS A;  2JA9 A;  3HOU B;  3Q24 A;  2AQ3 B;  1B9M A;  1BBW A;  1PH5 A;  3J80 i;  2HIV A;  1X6O A;  2UUC L;  5IGG A;  1YJ9 A;  3NQT A;  1PYB A;  3J7A F;  3HOZ G;  2N55 A;  1TXY A;  3H94 A;  3M4Q A;  3D4R A;  1RTN A;  2CW0 C;  2Q8T A;  5EPJ A;  4PNY A;  1MIU A;  2MJ8 A;  1AN8 A;  1A0I A;  5J3B A;  4JI4 Q;  2A8V A;  1PH1 A;  1FVI A;  1B3A A;  3H15 A;  4A3G B;  4DAM A;  1I4P A;  3OHX C;  4ODG A;  2KA7 A;  3C3L A;  1VQF A;  1HHV A;  4ZQ3 A;  5HGQ A;  4JYA L;  1N33 Q;  4LF8 Q;  2E5L L;  4UDU C;  1VQ7 A;  2YV5 A;  3NBI A;  2SNM A;  2B29 A;  1SE4 A;  1Q12 A;  5FLX L;  3CP0 A;  3HOX G;  4DAY B;  5IYC G;  1A62 A;  1QE6 A;  1S5E D;  4YCW A;  2UXD Q;  1HNX L;  2UUA L;  5JVG 3;  1VQH A;  3HOV G;  4DR4 L;  5GAH C;  5KRU A;  3W5O A;  1PYW D;  1ESF A;  2XVS A;  4C3J H;  5M5Y H;  4XIG S;  1BOS A;  3H3V C;  1B2T A;  1V43 A;  4HN7 A;  4OHJ A;  3WWV A;  3NTK A;  3P7J A;  3T16 A;  3S1Q H;  1D2B A;  1T5X D;  1C7Y A;  3C1F A;  5CGK A;  4BY1 H;  3K0X A;  1HZA A;  1I94 Q;  1I4H A;  3CRK C;  3E0J A;  4DAY A;  2EPB A;  3MFG A;  4LF7 Q;  5IWA Q;  3CD6 A;  1L1O C;  4H13 C;  1IBL L;  1XMO Q;  3VR3 A;  4DK0 A;  3CCS A;  2NVQ H;  1IL2 A;  1N36 Q;  4DR7 Q;  2WKD A;  1KDC A;  2BA0 A;  1WVL A;  4DV2 Q;  4XQN A;  3IKJ A;  1XMQ Q;  2HDM A;  4DV2 L;  5C44 B;  2R92 H;  1XPU A;  3OMG A;  3HOV B;  2HDL A;  2LMC B;  3I56 A;  3S14 B;  1EY4 A;  1B70 B;  2FIN B;  1OXX K;  2NTT A;  5M9O A;  1Y8O B;  2RSO A;  3CW2 C;  5A2Q E;  3NP8 A;  1V1P A;  5CYU A;  1PFM A;  1DM0 B;  4IPG A;  4YWL A;  1C9O A;  4JBJ A;  4RCO A;  3HOW B;  1CSQ A;  3BYY B;  4DA2 A;  1HNW L;  3I7F A;  2QCP X;  1VQ4 A;  3T51 B;  1HZB A;  4DUZ L;  2XRS D;  2EYP A;  3I8Z A;  2N49 A;  4YY3 Q;  1IBK L;  3H3V I;  4LF5 Q;  2Z4I A;  3ER0 A;  4YCV A;  1KDA A;  2F0D A;  2F1M A;  2ES2 A;  4ZRZ A;  3ERQ A;  4DU9 A;  1WTX A;  5ELE A;  1UEB A;  2XNA C;  3SK8 A;  4RFB A;  2A73 B;  1UE1 A;  2ZXP A;  4JI0 Q;  4WJ3 M;  4HCS A;  1SNP A;  3M3Y H;  1N32 Q;  3GTQ H;  2B8G A;  1JCK B;  1SNM A;  4ALP A;  3ERO A;  3HOZ H;  5HGT A;  2PMZ E;  2KEC A;  4JCV E;  2ZM6 L;  1IXR A;  1HA5 A;  3J7A 5;  4GNX C;  2PQE A;  1GJX A;  1YNN C;  3S9W A;  2E75 C;  1KDB A;  4C56 C;  1CSP A;  1TWG H;  2F0K A;  2K33 A;  2XN9 C;  1M4V A;  1ILP A;  2DNE A;  3PIP 3;  2FFK B;  5IE8 A;  1PTO F;  1U9R A;  4JOI A;  4DUY L;  3NXW A;  3UE1 A;  3CCJ A;  2BDO A;  4R4T A;  4EQO A;  5IOD A;  4CDD C;  4JI5 L;  5FLX c;  3S14 H;  1ILQ A;  3J81 c;  2WB1 G;  2Z6B A;  4DV6 L;  1VQN A;  4RMF A;  4DR4 Q;  2JP1 A;  4KY6 A;  4YWK A;  3HOW H;  4QUC A;  4IPC A;  4PZ8 A;  4JC0 A;  4MIU A;  3I4N H;  1GUW A;  3MA2 B;  2NTS A;  4A3I B;  2NZO A;  1EYD A;  4C2M H;  4B3S Q;  1NUC A;  4A3F G;  4LF9 Q;  3G6J B;  2IL8 A;  3AU7 A;  1ONL A;  3DLL A;  4A3M H;  3GTK H;  4K6L A;  5ELD A;  4GKK Q;  1VF5 C;  4A4I A;  5C3E H;  5CC4 A;  3CPF A;  1LAB A;  4L5Q A;  4BBR B;  1JWM D;  2EY2 A;  3STB C;  1WCM B;  3CCL A;  3TZU A;  1QVG A;  3FMC A;  4DV3 L;  1PTO D;  5E3F A;  3FKI G;  3H0G G;  2PZW A;  1YZ6 A;  2EJF C;  1Q86 C;  2B2W C;  3FEW X;  1IW7 C;  4MN3 A;  5FO8 B;  1ASZ A;  1HUN A;  1QIL A;  1T9H A;  3HKZ E;  1LM0 A;  3MVV A;  1KTK A;  4AQY L;  1B9N A;  2MHV A;  1FJG L;  2DN8 A;  1STE A;  3W2D A;  1GUN A;  1L2F A;  5I4D A;  4LFA L;  4R4Q A;  3J7Z C;  3NEN A;  3VYU A;  5DNF A;  4KHP L;  5LMN W;  3ZYY X;  4RGN A;  1WCM G;  3HFZ B;  4CKC A;  5JJZ A;  1EEF D;  3QIA A;  2FHT A;  4HIO A;  3DEP A;  1BBX C;  2VQE Q;  3D31 A;  4LFA Q;  3CCV A;  1FJG Q;  4M8A A;  3T56 B;  3QB3 A;  2B63 H;  4NXM Q;  4AQY Q;  2F3I A;  3RD4 A;  1GOZ A;  5E7N A;  3L2P A;  1JB7 A;  4ZUI A;  5K36 H;  1U0L A;  3FVQ A;  4A3G H;  4DV3 Q;  4U67 3;  4FXG C;  1RCV D;  2PZU A;  5LHY 1;  4A3I H;  1EQR A;  2UU9 L;  5EBD A;  5LMU Q;  3TS2 A;  1Z6H A;  1T5E A;  1JOO A;  5DAU A;  5FO7 B;  4FVM A;  1SAP A;  3S1N H; 
#chains in the Genus database with same CATH homology
 1NR2 A;  3E6Z X;  2FMC A;  5CV6 A;  1MSH A;  2LFN A;  3M4Y A;  2KEE A;  4KI0 A;  5C4J B;  4IFD G;  4R8N A;  4XDX A;  5KYI A;  2A6H D;  1C48 A;  5E4X A;  1MI2 A;  1EQV A;  1F9S A;  2F0V A;  2NN6 H;  5M3M B;  4IZ8 A;  2A74 C;  5D65 A;  3SK4 A;  1NCV A;  1SMY D;  4RKB A;  4QMG A;  3BG3 A;  4GZY C;  4Q0F A;  4J1M A;  3A7L A;  3U9S A;  4PMC A;  5CV9 A;  5I9O A;  2RSN A;  3S1R B;  4RHS A;  3DXJ C;  4CKB A;  5C3W A;  1SNQ A;  2IW3 A;  3GTL B;  2JE6 I;  3NUC A;  3N52 A;  1SNO A;  4XQQ A;  3HGB A;  3O13 A;  2EOT A;  2R7Z B;  2IX3 A;  3RMH A;  1YNJ C;  4HED A;  1JOK A;  3PUZ A;  3ND9 A;  3AMU A;  4KD4 A;  2F0S A;  1FR3 A;  1HTP A;  1PRT F;  4JK1 C;  4ZKB B;  3QG1 A;  1D1K A;  3PO2 B;  3I70 A;  4HAE A;  5CV7 A;  4WRD A;  2L11 A;  2PO4 A;  2RVL A;  5D14 A;  2KVM A;  5EPL A;  1EU4 A;  3S1M B;  2PYK A;  5KGU A;  1Y1V B;  2I07 B;  4FYD A;  2D2C C;  1TT2 A;  4KY5 A;  5C0X H;  3NWT A;  2F3W A;  4RWS C;  3G7L A;  2F3V A;  1IYV A;  1ROD A;  4R8I A;  1PDQ A;  1Z47 A;  1DYQ A;  3IAY A;  5COR A;  4A3B B;  3C2P A;  4C3I B;  1GXD C;  4AYB B;  3FPP A;  1QNK A;  4IN3 A;  5NUC A;  3HOZ B;  2IPK D;  3P1H A;  3SR1 A;  1A3V A;  2VNU D;  5KND A;  4A3K B;  1UNS A;  3MHB A;  3MXN A;  2A69 C;  2WKC A;  3HOY B;  5DM6 3;  1STG A;  2E2D C;  3D6C A;  4C3I G;  2JA7 B;  1EYA A;  3T53 B;  2QIL A;  3NHH A;  4K5V A;  3LWE A;  2F0N A;  3TP5 A;  5M3F B;  1XWE A;  3D6W A;  1SJE D;  2F0I A;  1KNE A;  5G3L D;  2MPM A;  3BZD B;  5CV8 A;  5C3E B;  4YIJ A;  1JOR A;  1I4X A;  2NUC A;  4KK7 A;  3MXP A;  2Z4H A;  4A93 B;  5E4W C;  2EYO A;  1E2W A;  5J39 A;  1QNU A;  1O80 A;  2KJX A;  3BDL A;  1F77 A;  3L9A X;  2L9H A;  1IKL A;  1XX8 A;  3I73 A;  1U4R A;  4IQZ A;  2R93 B;  4DXF A;  3QO2 A;  3PIO 3;  1CQV A;  3MWY W;  4RCN A;  1LT6 D;  4PMB A;  2LS0 1;  3MAQ A;  4XT1 B;  2NBF A;  1SMY C;  4OIJ A;  2K1B A;  2RDH A;  1UAP A;  2FJ2 A;  2F0M A;  1CHQ D;  4PV1 C;  4NW2 A;  1RTO A;  4P2C B;  2Q8I B;  4C1N K;  1EOT A;  2B2V C;  4IFD J;  1GUT A;  1PTO H;  5M5W B;  2NVY B;  2O4X A;  3V05 A;  1XXG A;  4FF1 A;  5KNC A;  1SNC A;  3DM1 A;  1GHK A;  4IFD H;  4FP5 D;  3CHB D;  5EKI A;  4HR7 B;  5ELF A;  3H91 A;  3NPP A;  3CKI B;  4WJW A;  4OL7 A;  1OXS C;  1PRT D;  1BR9 A;  5G3L F;  4KN7 C;  2OF1 A;  4FF2 A;  4Z9C B;  3L3O C;  3HOX B;  1EU3 A;  2SOB A;  5DM7 3;  1V1P B;  5CR3 A;  2KHS A;  4DK1 A;  2K32 A;  3W3A A;  2JSO A;  4K5W A;  2BCO A;  2A68 C;  2D5D A;  4X3K A;  5EKL A;  5FLX E;  2F0O A;  2J4X A;  4QUF A;  4TSS A;  3OPO A;  3DHQ A;  3EJI A;  4A3D B;  1STY A;  3QWN A;  3S2D B;  1AEX A;  1CHP D;  1D1I A;  3Q22 A;  3UI2 A;  5C4H A;  1IW7 D;  4B08 A;  4KKU A;  4IFD I;  3F2U A;  1TWH B;  1D6E C;  1LTA D;  1PZK D;  5JVH 3;  3GTJ B;  3J80 E;  4WFN 3;  5A35 A;  1YNJ D;  2HCC A;  4U68 A;  2F0Q A;  3EQL C;  2QF7 A;  2B2U A;  2OEO A;  4HSP A;  1STN A;  3OSO A;  1G29 1;  4H0L C;  2DY7 A;  1VCI A;  4NP5 A;  3AB9 A;  1F9R A;  1UEA B;  5I6W A;  1KAA A;  1R9T B;  4FXK C;  3GO5 A;  4KD3 A;  3VYS A;  3SHL A;  3OW7 A;  1SE3 A;  3CU7 A;  1WTP A;  1LT3 D;  2BE5 C;  1F2Y A;  1TWC B;  1PRT C;  2CW0 D;  3RUZ A;  4XXE A;  4XYO A;  3NSW A;  2NN6 G;  4A3F B;  2ZXO A;  4FXD A;  2L4N A;  4TQU S;  4C1N I;  1ICW A;  3K7A B;  2A6E D;  1JQY D;  2IX0 A;  2M2L A;  3J81 E;  5KYL A;  1AP0 A;  1SYE A;  2RDF A;  1LTS D;  2R3Z A;  2EVB A;  1JWS D;  3HKZ B;  5FK9 C;  3K6O A;  2JA6 B;  5AFW A;  4QB4 A;  3U9O A;  4OIK A;  1H9R A;  3S1Q B;  1SYD A;  4DAV A;  3C1E A;  3MXU A;  3IFT A;  1I3Q B;  1EY7 A;  1B4O A;  2VB2 X;  5LL6 S;  3K5N A;  5TSS A;  2IX1 A;  3S15 B;  5IIF A;  3RZD B;  3FPU B;  3I4N B;  4N9T A;  2TMP A;  1FGB D;  4M1U B;  2JYO A;  4KHZ A;  5JEA H;  5D3I B;  4HMI A;  1OXV A;  4LAA A;  4G7H C;  3SK5 A;  1TKW B;  2NWG A;  5J1Z A;  2K01 A;  4B9W A;  5KNB A;  2A69 D;  1JR0 D;  3TME A;  4ZAI A;  4OO1 I;  3PUY A;  3LWU A;  2F0U A;  4CJ2 C;  2ENB A;  2ICE C;  1FNW A;  3HZX A;  5BN3 A;  1TWG B;  3GP7 A;  1EY0 A;  2EY1 A;  1SDF A;  1EY8 A;  3VA5 A;  1HPC A;  1TQO A;  4UAI A;  2B8F A;  5EPK A;  3NE5 B;  2AWO A;  3JAM E;  2K28 A;  3CQZ B;  2MUY A;  4RHR A;  1WTV A;  2X6L A;  4C3J G;  1D5X C;  4EVO A;  1PRT B;  2K6A A;  2L12 A;  3NWS A;  4FO2 A;  3P20 A;  3T13 A;  1IYU A;  3C46 A;  2M00 A;  4F88 A;  1V1O A;  1H9S A;  2WAC A;  3M4O B;  5ISR A;  3DWA A;  1CTM A;  4OGQ C;  3D3R A;  1SE2 A;  4IAL A;  2VUM B;  3V2T A;  5C4Z A;  4L6T B;  5JEA J;  1QWY A;  3PUW A;  1MGS A;  1B50 A;  1WTQ A;  2CQA A;  1JWU D;  2DY8 A;  1JE4 A;  5FO9 B;  4BY1 B;  1EEI D;  3K57 A;  5CBA E;  1II3 A;  4IUN A;  4NKL A;  1AZQ A;  4H44 C;  3FKI B;  1LLR D;  3H0G B;  1MD2 D;  1U4P A;  3I91 A;  3M3Y B;  4RGM A;  3GTG B;  1G2S A;  1NR4 A;  3PUV A;  1ESR A;  2N88 A;  5E1F A;  1STA A;  4G7Z C;  1ET9 A;  1LTG D;  3HP3 A;  3MZ5 A;  1ZEQ X;  2EYM A;  4MHE A;  3KLR A;  5IGE A;  4KN4 C;  2VB3 X;  1D5Z C;  4BWG B;  4TKO B;  1KNA A;  3QOJ A;  1RDP D;  5F2D A;  3CRL C;  5COY A;  3MXG A;  5J22 A;  1W6J A;  4DAP A;  1BUV T;  2LKV A;  1NSN S;  2F0T A;  3TDQ A;  2J0T D;  2XIW A;  1HFG A;  3ND8 A;  1A15 A;  1EZ8 A;  4G57 A;  1A2T A;  1VMC A;  1K8O A;  3KUP A;  3VR5 A;  5C3X A;  3VYR A;  1BQQ T;  5IGF A;  3K5O A;  3A55 A;  2F0H A;  4ME5 A;  4RGO S;  5FKA C;  1AZP A;  3HS0 C;  2K5D A;  1RJT A;  1Y8N B;  3OOC A;  1PZJ D;  3VYT A;  1IL8 A;  4N9P A;  2I46 A;  3NTH A;  3V96 A;  1EIH A;  5I6Y A;  2AUK A;  2JEB I;  2VXW A;  1DOK A;  1TWA B;  1E2V A;  1Q1E A;  4DN4 M;  3DWP A;  4XYQ A;  1CT1 D;  4DNT B;  2AWN A;  4F8M A;  1TII D;  2AQ1 B;  1O7Z A;  5C6A A;  4CHT B;  1BXT A;  2WAQ B;  1VMP A;  4RH6 A;  1ENA A;  4R9W A;  3TBI B;  1I4R A;  4L63 B;  1SYB A;  1X3Q A;  5EKK A;  4HTH A;  2NB0 A;  4IUR A;  1CFM A;  1H9J A;  2HCI A;  1RKN A;  1Q1B A;  2XWJ B;  1JC7 A;  1CA6 A;  4HSV A;  2MP1 A;  3MFY A;  3EFX D;  1E0B A;  2K5W A;  2ID0 A;  5JPN C;  4EQP A;  1ZKO A;  1QG7 A;  4KJO A;  5C5M A;  1R4P B;  4KHV A;  3Q6S A;  1A3U A;  1DJR D;  4I65 A;  4X3S A;  3DMU A;  1V8Q A;  1LT5 D;  4L8J A;  4ZLT F;  1FNV A;  2F0E A;  1LTT D;  2EE1 A;  2A5H A;  3HEJ A;  2F03 A;  1NAP A;  2XWB B;  1QCB D;  2K04 A;  3D8G A;  1EY5 A;  2RA4 A;  2G9H D;  1EQT A;  1DD2 A;  2NZ1 D;  3I90 A;  4CKE A;  1FYC A;  1LAC A;  3KLS X;  1QOH A;  4K2L A;  4V0B A;  3A56 A;  3WOF A;  1HA6 A;  3I4M B;  2WII B;  3KBG A;  4ZUJ A;  1Q90 A;  5EQ0 A;  2NVT B;  5FOB B;  3GTP B;  1EWC A;  4TRD A;  1GUS A;  3URY A;  3J81 L;  1U4L A;  3SDZ A;  3KBX A;  4F7X A;  1SYC A;  1DCZ A;  4RGT A;  2Z1C A;  1Z7T A;  1TR5 A;  3NQI A;  1EL0 A;  1PFB A;  1F2L A;  2EYF A;  1W6K A;  2ZXR A;  3X3N A;  4KTA A;  1EY6 A;  3OIQ A;  2D62 A;  2JEA I;  1FD7 D;  1S5C D;  3DEO A;  1KAB A;  4FF4 A;  4C3H G;  2NYZ D;  3WDN A;  4OO1 G;  2V4D A;  1A2U A;  1ENF A;  2BOS A;  5IOC A;  3RZO B;  1MBY A;  3NBH A;  4QIW B;  2JA5 B;  2EYJ A;  1UUP A;  4XQJ A;  4CJ1 B;  3M7G A;  1PMR A;  4PQX A;  1GHJ A;  2H4O A;  1BCP C;  4NDX A;  2PNR C;  4I7Z C;  4BA1 I;  2WP8 J;  1S5B D;  3Q0A A;  3J80 L;  3VR4 A;  4HCE A;  3S16 B;  2L1B A;  3K59 A;  1PXU A;  3P75 A;  3TP7 A;  1ZYR D;  1EWH A;  3LX0 A;  3ITP A;  1I6H B;  1HQR D;  1SND A;  2EJG C;  2OT2 A;  5KEE A;  2A6H C;  1H9S B;  1O78 A;  2F4I A;  1S5F D;  3BVG A;  4JBW A;  2F0L A;  3SK6 A;  2F0J A;  1S5D D;  1RHP A;  4DGZ A;  3LNN A;  2R61 A;  1TWF B;  3DWQ A;  1I4G A;  3I72 A;  5HUR A;  2HUG A;  1CQF A;  1PTO B;  3PO3 B;  2RBM A;  4DF7 A;  1B1Z A;  1H9K A;  4KV6 A;  5I9P A;  1RF2 D;  1YNN D;  3OWE B;  2NVQ B;  1K8M A;  4DNR B;  3VR2 A;  3J7A V;  1STB A;  3BDO A;  1H9M A;  2PW7 A;  5T1G A;  3NK9 A;  4K14 A;  5A2Q L;  3S2H B;  1HUM A;  2F0F A;  2ICI A;  5BN4 A;  2R6G A;  3S17 B;  5JPM C;  2F0G A;  4OO1 H;  4CGY B;  4RA8 A;  2KOL A;  1AW7 A;  4S3S A;  3H6M A;  2QDB A;  3JAM L;  4IUV A;  3M85 A;  2ZT9 C;  1QJO A;  3TP8 A;  2NVX B;  1LTB D;  3QOL A;  4C3H B;  5CV5 A;  2OXP A;  1E2Z A;  5ELC A;  2B39 A;  1D5M C;  1WD0 A;  2EY6 A;  2E76 C;  2EYL A;  2E2I B;  1OO9 B;  4KJN A;  1BO0 A;  1EY9 A;  1F2Z A;  4K8I A;  1DXM A;  3K5L A;  2E74 C;  1LTR D;  4O42 A;  3A54 A;  3I3C A;  1B44 D;  1G8Z D;  1WTO A;  2YU9 B;  2B2U C;  1A6X A;  3K0Y A;  2WIN B;  2EJM A;  4LK1 C;  4BBS B;  4C2M B;  3BYT B;  1G2T A;  1Q8I A;  2A6E C;  5EBC A;  2L55 A;  2Q8R E;  4K6D A;  2BA1 A;  1LTI D;  1STH A;  1TU2 B;  3TN2 A;  3I4L A;  3WOE A;  1CK1 A;  1M8A A;  2X6G A;  5I2Y A;  1DOM A;  1HFN A;  4XT3 B;  2F0P A;  4IUP A;  5JAV A;  2B2Y A;  1VDZ A;  1R4Q B;  2QKI C;  1TS2 A;  1X32 A;  5EGT A;  1Y1W B;  5KIX A;  2SEB D;  2PZT A;  1TS3 A;  2B2W A;  1SYF A;  3R2T A;  3R93 A;  4ZKC B;  5IGD A;  4BY7 B;  1B53 A;  1BCP B;  2G9D A;  4HMJ A;  1RD9 D;  4EGV A;  1BCP F;  2CHB D;  1MSG A;  3K58 A;  3PMF A;  1WTR A;  4DXG A;  3OIP A;  3H09 A;  4KY7 A;  3FDT A;  1SEB D;  1ET6 A;  4WOR A;  1HRJ A;  1SJH D;  3OMC A;  2Z8L A;  3T4A C;  2K5Q A;  4LJZ C;  3SXH A;  2B2T C;  1J9O A;  3GTK B;  1F9Q A;  2LY7 A;  1GUO A;  2KQ3 A;  3VR6 A;  5C0X G;  5D3D A;  5C5L A;  4F87 A;  2TSS A;  1CM9 A;  3GQB A;  3R3O A;  3EA6 A;  3SE0 A;  4CJ0 B;  1GUG A;  4ILW A;  3OWF A;  3GTQ B;  2L0C A;  1O7Y A;  3D4W A;  5K5P A;  2WB1 B;  1OXU A;  3N6R A;  4RAU C;  4QF4 A;  3MC0 B;  1TY2 A;  2B63 B;  4DFA A;  2PMZ B;  3TZD A;  2F0W A;  1KLU D;  2IWH A;  1SXT A;  3GTO B;  3IFD A;  5ELB A;  5K36 G;  4BS9 A;  4J8Q A;  1VF7 A;  1ZYR C;  1I50 B;  3HG9 A;  5CBE E;  1JIC A;  4ULL A;  2GA4 B;  2KUM A;  4KKT A;  4KMU C;  1BCP D;  2PW5 A;  5LL6 X;  2IT1 A;  2M9V A;  2RDG A;  4ABN A;  5C0X J;  2A68 D;  3HRZ C;  4ZYS A;  2JA8 B;  2Y0S B;  1LT4 D;  1S4Z A;  5IT9 L;  3PUX A;  2PCF B;  3GD7 A;  2NN6 I;  1G6Z A;  4LMQ D;  2SNS A;  3L7Z C;  2KED A;  4RKL A;  1F9P A;  1XTC D;  4IUT A;  5EJW A;  3DUZ A;  4CBV A;  2PPB C;  2C9O A;  5IGB A;  2KCN A;  4V19 0;  4A3J B;  1HQM C;  2JXM B;  2H1E A;  1CZW A;  5T1I A;  4K2K A;  1L0X B;  4X3U A;  2AQ2 B;  1TS5 A;  4FNF A;  2R92 B;  1HXY D;  3TP6 A;  1AFP A;  1SSO A;  2RQX A;  3SVM A;  1Q3L A;  4K5X A;  4EQN A;  1SAP A;  2J7Z A;  1I4Q A;  4ZK9 B;  3A8K E;  4G7O C;  3BVZ A;  4ID6 A;  3VA7 A;  3TSS A;  5JEA G;  2BDN A;  4A3M B;  2L5T A;  1SBB B;  2E2H B;  3GTM B;  2EY5 A;  1KLG D;  1XYI A;  4QCL A;  1EFI D;  5CV4 A;  1SFO B;  2XRQ D;  1PFN A;  4IUU A;  2QEJ C;  4K8J A;  2B2T A;  3M7N A;  1DZ1 A;  1BDO A;  2B2Y C;  1DOL A;  1CA5 A;  3MEH A;  3Q23 A;  1TVX A;  4XTC S;  1A3T A;  4J6H A;  2EYH A;  3EVQ A;  5C0X I;  2DNC A;  3RLF A;  1OXT A;  3R8B A;  2E2J B;  3SEB A;  2IJ0 A;  4Q5V A;  4X3T A;  1IHZ A;  1HCZ A;  4IUQ A;  3BVM A;  2C5C A;  1FNU A;  4G4K A;  1L0Y B;  3NTI A;  1ML0 D;  2SDF A;  1IKM A;  3K5M A;  3KLS A;  2CVR A;  1F2M A;  4A3E B;  2KCC A;  3BDC A;  2K03 A;  4NMZ A;  2XSC A;  2YYZ A;  5I2X A;  1CI3 M;  3A8J E;  1TS4 A;  1TY0 A;  1G91 A;  3A7A B;  2O5I C;  1K83 B;  1J8I A;  2K05 A;  4FF3 A;  3R2I A;  1SYG A;  1JB3 A;  3GV6 A;  3BS1 A;  4Y7N B;  1ZXT A;  3MTS A;  3KF8 A;  4E6I A;  5CMD A;  2AUJ D;  3A8I E;  1I6V C;  2WV6 D;  5IGC A;  3J7Y W;  1EIG A;  5C4X B;  1EZ6 A;  5IT9 E;  3QJY A;  1C8C A;  3GV3 A;  5DEH A;  4KKS A;  5M5X B;  4B9X A;  4O1N A;  2O5J C;  2EZV A;  2B2V A;  1C4Q A;  1Y69 U;  1JOQ A;  1WD1 A;  2MGS A;  1BNZ A;  2X69 A;  1LO5 D;  2EDG A;  2K7V A;  1O7L A;  3ONA B;  1HTL D;  3E5S A;  2O2L D;  4H7B A;  1DON A;  2FMM A;  1CZG A;  3FRP B;  2EXZ A;  4C3J B;  5M5Y B;  2BE5 D;  4PMW A;  5BN5 A;  3S1N B;  3IL8 A;  2D9U A;  4BA2 I;  3KK7 A;  1U4M A;  2HQE A;  1BF4 A;  3PV0 A;  5JOB A;  1PLF A;  1WTW A;  1ENC A;  1X3P A;  1Y8P B;  3D4D A;  3X3M A;  1QB5 D;  1LV9 A;  1PTO C;  1PZI D;  2RKS A;  3HOU B;  3Q24 A;  2AQ3 B;  1B9M A;  5IGG A;  3NQT A;  3J7A F;  2N55 A;  3H94 A;  3D4R A;  1RTN A;  2CW0 C;  2Q8T A;  5EPJ A;  4PNY A;  2MJ8 A;  1AN8 A;  1B3A A;  4A3G B;  1I4P A;  3OHX C;  4ODG A;  2KA7 A;  3C3L A;  1HHV A;  4ZQ3 A;  4UDU C;  3NBI A;  2SNM A;  1SE4 A;  1Q12 A;  5FLX L;  1S5E D;  1QE6 A;  5JVG 3;  5KRU A;  1PYW D;  1ESF A;  2XVS A;  4XIG S;  1BOS A;  3H3V C;  1B2T A;  1V43 A;  4HN7 A;  4OHJ A;  3NTK A;  3P7J A;  3T16 A;  1D2B A;  1T5X D;  3C1F A;  5CGK A;  1I4H A;  3CRK C;  3E0J A;  4DAY A;  2EPB A;  3MFG A;  4H13 C;  3VR3 A;  4DK0 A;  2WKD A;  1KDC A;  2BA0 A;  1WVL A;  4XQN A;  3IKJ A;  2HDM A;  5C44 B;  3OMG A;  3HOV B;  2HDL A;  2LMC B;  3S14 B;  1EY4 A;  2FIN B;  1OXX K;  2NTT A;  5M9O A;  1Y8O B;  2RSO A;  5A2Q E;  3NP8 A;  1V1P A;  5CYU A;  1PFM A;  1DM0 B;  4RCO A;  3HOW B;  3BYY B;  4DA2 A;  2QCP X;  3T51 B;  2XRS D;  2EYP A;  3I8Z A;  2Z4I A;  1KDA A;  2F0D A;  2F1M A;  4ZRZ A;  3ERQ A;  4DU9 A;  1WTX A;  5ELE A;  2XNA C;  3SK8 A;  4RFB A;  2A73 B;  2ZXP A;  4HCS A;  1SNP A;  2B8G A;  1JCK B;  1SNM A;  3ERO A;  5HGT A;  2KEC A;  1HA5 A;  2PQE A;  1GJX A;  1YNN C;  3S9W A;  2E75 C;  1KDB A;  4C56 C;  2F0K A;  2K33 A;  2XN9 C;  1M4V A;  1ILP A;  2DNE A;  3PIP 3;  2FFK B;  1PTO F;  1U9R A;  3NXW A;  2BDO A;  4EQO A;  5IOD A;  1ILQ A;  2JP1 A;  4KY6 A;  4QUC A;  4MIU A;  1GUW A;  3MA2 B;  2NTS A;  4A3I B;  1EYD A;  1NUC A;  3G6J B;  2IL8 A;  3AU7 A;  1ONL A;  4K6L A;  5ELD A;  1VF5 C;  5CC4 A;  1LAB A;  4BBR B;  1JWM D;  2EY2 A;  1WCM B;  3TZU A;  3FMC A;  1PTO D;  5E3F A;  2PZW A;  2EJF C;  2B2W C;  3FEW X;  1IW7 C;  4MN3 A;  5FO8 B;  1HUN A;  1QIL A;  3MVV A;  1KTK A;  1B9N A;  2MHV A;  2DN8 A;  1STE A;  3W2D A;  1GUN A;  5I4D A;  3VYU A;  5DNF A;  3ZYY X;  4RGN A;  4CKC A;  5JJZ A;  1EEF D;  2FHT A;  3QIA A;  3DEP A;  1BBX C;  3D31 A;  4M8A A;  3T56 B;  3QB3 A;  3RD4 A;  1GOZ A;  4ZUI A;  5K36 H;  3FVQ A;  4U67 3;  4FXG C;  1RCV D;  2PZU A;  5LHY 1;  5EBD A;  1Z6H A;  5FO7 B;  1T5E A;  1JOO A;  5DAU A;  4FVM A;  1EYC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...