2F0MA

Crystal structure of staphylococcal nuclease mutant v23l/i72v
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTLKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKVEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0mA00
4KY6A 4HMIA 4DU9A 5I6YA 3S9WA 2EY6A 3DHQA 4J1MA 5J1ZA 5IGBA 5CV9A 2EXZA 4N9PA 4KJOA 5JAVA 4WRDA 1SNCA 1RKNA 5C4ZA 5KYLA 4KD3A 2F0IA 2WACA 1SYFA 1A2TA 4DFAA 2EYOA 4KY7A 4EVOA 5E1FA 3BDLA 3SR1A 2PQEA 2F0PA 4EQNA 5ISRA 4E6IA 1SYCA 1EZ6A 2OEOA 2M00A 1TT2A 2PW7A 2RKSA 4K2LA 4NP5A 4PMBA 3EJIA 1F2YA 5CV6A 5M9OA 3TP8A 2F0VA 5C3XA 3D8GA 1EY4A 2EYPA 1SNDA 2F0HA 2HQEA 4IALA 4B9XA 5I9OA 4I65A 5EKLA 5F2DA 5I6WA 1EY9A 5C6AA 4K5VA 1IHZA 3MVVA 2OF1A 4ZQ3A 3TMEA 1EZ8A 2SOBA 5CV7A 5DAUA 3VA5A 4ODGA 3T16A 4DGZA 1NUCA 2F0EA 4NKLA 3SK4A 3TP7A 2F0DA 1EYCA 4LAAA 5HURA 1KDCA 2F0MA 4KTAA 5C5MA 1STYA 3OMGA 5CV5A 4DF7A 5IGEA 4OL7A 4ZUIA 2SNMA 3EROA 2F0FA 2PZTA 4WORA 3MXPA 3E5SA 5CV4A 3TP6A 5IODA 3LX0A 1SNPA 4NDXA 4IZ8A 5KIXA 1EY7A 4HMJA 5IGDA 1F2ZA 5CR3A 1SNQA 1JOQA 5EGTA 1U9RA 3OSOA 3SXHA 2EYJA 3OMCA 1A3UA 1ENCA 4PMCA 1KAAA 4KY5A 3MZ5A 4K5XA 3SK5A 4NMZA 4QMGA 3MEHA 5EKKA 1AEXA 1TR5A 3HZXA 1EQVA 4K8JA 3SK6A 1EYDA 3NQTA 4H7BA 1KABA 1EY8A 3MHBA 2KHSA 4K8IA 2SNSA 2O4XA 1EY5A 4KV6A 2EYFA 4KJNA 4ID6A 1A2UA 2F0WA 2F0TA 2QDBA 3NK9A 3ERQA 4QF4A 3BDCA 1II3A 2ENBA 5IOCA 4KD4A 5K5PA 1A3VA 4PNYA 1SYEA 4EQOA 1F2MA 3H6MA 3QOJA 4ZUJA 2F0QA 1JOOA 1SNMA 4R8NA 5CGKA 2EYLA 1STNA 1SYDA 4TRDA 1JORA 1EY0A 1STHA 2KQ3A 3QOLA 3D4WA 2EY2A 3TP5A 3V2TA 4G57A 4RKBA 1JOKA 1KDAA 1STBA 3PMFA 3NP8A 5C3WA 2F0OA 2EYHA 3C1EA 2F0NA 1ENAA 4K6DA 3NHHA 3RUZA 5IIFA 4EQPA 1KDBA 1SYBA 2F0KA 4KHVA 5DEHA 2EYMA 5E3FA 3D4DA 2F3VA 2PZWA 2PZUA 4F7XA 5I9PA 3NXWA 4ME5A 1EY6A 5IGCA 5J22A 4YIJA 5IGGA 1NSNS 4K5WA 5NUCA 5C4HA 5IGFA 5KEEA 5J39A 1STAA 2F0LA 4HTHA 3R3OA 4RKLA 2F3WA 5JOBA 1STGA 5KRUA 2F0JA 4F8MA 4J6HA 3C1FA 2RDFA 3P75A 3P1HA 4K2KA 3HEJA 4S3SA 2EY5A 3ITPA 2EY1A 2F0UA 4K14A 2OXPA 1A3TA 2RBMA 4B9WA 5KYIA 1TQOA 5CV8A 2F0GA 2F0SA 2PYKA 3NUCA 1EYAA 4IUNA 2LKVA 3D6CA 4N9TA 3SHLA 3SK8A 3T13A 5CC4A 5C5LA 2PW5A 3DMUA 3U9OA 3QB3A 2NUCA 4MIUA 5HGTA 4QB4A 3EVQA 1SYGA 1SNOA 3OWFA 5KGUA
chains in the Genus database with same CATH superfamily
1S40A 3AFPA 4DU9A 3S9WA 2EY6A 3HKZE 3S1MB 1L1OA 1RKNA 1I4HA 5KYLA 4GZYC 4A3DG 4LFCQ 4DR5Q 5L37A 3FKIG 2EPBA 1H9SA 4DNRB 2EYPA 2ALYB 5I9OA 1QVCA 1E24A 4KKSA 3T51B 2Q8TA 4GKKQ 2NVXB 2IX0A 4ME3A 5CGKA 2HCCA 1EZ8A 3SVMA 1XPRA 4A3GB 4DR4L 4A3CG 4BBSG 5M5YB 1VDZA 3RN2A 1ZXTA 1MGSA 4LUVA 1GHKA 3EROA 4XIGS 1SNPA 3PO3G 1T9HA 4M8AA 1IKLA 4YWKA 2RA4A 1PRTC 1JOQA 4DKAC 3W1GA 3K59A 1W6JA 5COYA 2UU9L 1DYQA 3WOEA 1Z47A 4QMGA 4A3KH 2IT1A 1EYDA 2AWOA 2VUMH 4IUUA 3UE1A 4LW1A 2E75C 1MKHA 4ID6A 4JI0L 2QDBA 3HOWH 4ALPA 4X6AH 4QF4A 3J80E 4JYAL 4HJ8A 2QA4A 3D0FA 3V05A 5ELCA 3I4NB 3EQLC 2B63G 2XN9C 2NN6H 1EUJA 1CK1A 3WDNA 2B2UA 3T1HL 2ID0A 2R93G 2K5HA 3QJYA 1F2LA 5D3DA 2HHHL 4DNTB 5DEHA 5I9PA 4LNQA 1UE7A 3S2DB 1OTCA 3H0GH 5J22A 2NYZD 1E2ZA 2B2YC 1WTVA 1FGUA 1Q8IA 4X65L 4A3MG 4KN4C 1TWCH 2E2IH 4XQNA 3J81L 1VQLA 5IP9G 5KYIA 1X65A 1PRTF 3J81j 4JBWA 4DR5L 5C4XG 4NPSA 5FLXL 4IOCA 1GUSA 5C5LA 1NMGA 3PF4A 4GN3B 5HGTA 2CFMA 4KK7A 3PIOA 1YI2A 2NN6G 1QNUA 3ER0A 5CV9A 2CH4A 3NEMA 3FPPA 1Q8KA 2KCMA 1WTWA 1B8AA 3R93A 1DOLA 5JPMC 4X65Q 1RTNA 4DFAA 4JPBW 2PQAA 2Y0SG 3I8ZA 3J7ZC 2DY8A 1EQQA 2M00A 2G9DA 4JI3Q 1Q1EA 4I65A 5EKLA 4DPGA 1B44D 4JG2A 4HIOA 5CBEE 3VA5A 4FXGC 3DWPA 5JJIA 1STYA 4IFDJ 2Z4HA 4GOPC 3HOXB 3HOVG 4IUQA 1NE3A 3D6WA 5EPKA 1NY4A 1PZID 3MTSA 3PUXA 3PGZA 1Y1WH 2N8NA 3NBIA 4HIKA 4JI0Q 2HDLA 4PMCA 1X3PA 3DWAA 4C3HB 1JB7A 3PSIA 4RCNA 4K8JA 1KD1C 4DAVA 1QVGA 1HUNA 2ZXPA 2B2VA 1XMQQ 1EIGA 1PYSB 1CZGA 3ERQA 5M3MH 1U4RA 4N8X1 3MXNB 1A0IA 1S5ED 3G7LA 2B2TC 5K36G 4K0KL 4RHSA 4QUFA 1Q81C 3I4MG 3OTOL 3RN5A 1JOKA 1NNXA 2YYZA 4HJAA 2JP1A 1Y8NB 3X3MA 2MP1A 2J7ZA 1L0WA 2AMCB 1U0LA 4UAIA 4F7XA 3JAME 3R8BA 2IHFA 1WTPA 1C0AA 3IL8A 4K2KA 3TDQA 5M5WH 2HDMA 1V1OA 1LT5D 3KLRA 4RCOA 2OXPA 1VQHA 2F0GA 1E2WA 3O13A 3OIPA 3A56A 1CZWA 2B2UC 5C0XJ 3U58A 3HOXH 3HP3A 4RGMA 1GJXA 4Y7NB 1N34Q 2E2JH 1CFMA 4RGTA 4R8IA 5IT9c 4KKTA 3CRKC 1HNXQ 4FVMA 2BA1A 5IYCH 5IWAL 1E3PA 2ES2A 2EYOA 1FNVA 3TEHB 2XRQD 2JA8B 4O1NA 2PW7A 3NPPA 1TT2A 4A93B 4K2LA 4LF9L 3E9IA 1I50B 1A8VA 5C3XA 4OIKA 1G91A 1X56A 2X6LA 4TQUS 4DGZA 3KF6B 3J7A5 4ODGA 4WFN3 3C3LA 1LABA 5CV5A 4JI3L 2K33A 1NBWA 2MPMA 5IYDH 1H9MA 1P8LA 4JOIC 3FEWX 1BF4A 3GTPH 5CR3A 1WTRA 1SBBB 1K8GA 2HIVA 3S17H 3OSOA 2EDGA 2WKDA 1J6QA 4UP9A 2VQEL 1ET6A 3UDFA 4K5XA 1K83H 4NMZA 3ONAB 2QDLA 3OPOA 3SK6A 4M1UB 2NVQH 4XT1B 2WAQE 4DV0Q 4KJNA 2P5ZX 2A74C 2VL6A 2F0WA 4DXFA 2G5DA 4RGOS 1I6HH 2E2HB 3CKIB 4KHPQ 2LXKA 1G8ZD 1T5XD 2KUMA 1E1TA 3Q6SA 1SE4A 2FJ2A 2KECA 3PO3B 1SXTA 1VMPA 1ET9A 1RL2A 1VF7A 4JI8Q 3R2IA 3NP8A 3NBHB 4FYDA 3I4NG 2GVBA 4F88A 2YTVA 3G71A 3CCRA 4P74A 4DK6C 3PF5A 3CQZH 1IXRA 4FO2A 4DUYL 1UAPA 5D14A 2F0LA 4X3TA 2Z0SA 4A3IG 3T1HQ 1QNKA 1OXXK 1EFID 4GNXB 3C1FA 2E76C 1JJ2A 4K6LA 1EEFD 4A3BB 4X66L 1AFPA 2N78A 4A3IB 1I4PA 2JA6H 2CW0D 1FNUA 4XT3B 3F8TA 3T56B 1I94Q 4GKJL 2KEDA 1EWCA 2PI2A 1HNXL 1QCBD 4A3JB 2NUCA 1UE6A 3Q0AA 3F2BA 2AWNA 4HSPA 2B29A 5J1ZA 2IW3A 3GQBA 1BCPF 5C44B 5C4ZA 1F9PA 4KD3A 5M3FH 2JN4A 1QUQB 2PQEA 4EQNA 1KIXA 1X9NA 4QQBX 1EZ6A 4NXMQ 4DV3L 1JWUD 2XTIA 1R9TB 1C48A 4DV6Q 1GM5A 4GS3A 1AH9A 3CCSA 1A15A 4NXNL 1V43A 1GO3E 2F3IA 3UI2A 3TBIB 1EYCA 1VQ9A 3HRZC 4A3EG 1HPCA 1U4MA 1QB5D 3BVZA 1PV4A 4NXNQ 4H02A 4QL5A 4GNXC 4LFCL 3IRBA 1KRSA 1E22A 1TS4A 1LT6D 5I4DA 4G7OC 2F52A 4IN3A 2AQ1B 3NQTA 1KABA 1VQJA 2KHSA 3NTHA 1NTGA 4K8IA 3ULJA 1TIID 3A5ZB 3HOVH 2K03A 3MEFA 5E7NA 4P2CB 1XNRL 2HQLA 1PTOD 2UUBL 4HAEA 2AUJD 3PUVA 4CDFC 2MQHA 4PNYA 1SNMA 1R4QB 5IYBG 1LO5D 4F87A 3P20A 1Q7YC 3M4QA 4A3EH 3RD4A 1X3QA 1IW7C 4IFDG 3PUZA 5I2XA 3MXUA 4HIDA 2ATWA 3RZDH 3K57A 4K6DA 2RSNA 4JI6L 3GTGB 1Y1VH 4C2MH 1CKNB 4ZKBB 3VYRA 5DNFA 1Y1WG 2K28A 4A3LH 3F2UA 3F1ZA 2RDFA 3U50C 2JA8G 4S3SA 1SMYC 2K5DA 2IHEA 3HOZB 3CAMA 3FKIH 4GLAC 2UXDL 2A1AA 2OQ0A 5CC4A 3UDGA 2K7VA 2L12A 3A8JE 1SDFA 3QB3A 2NN6I 4HMIA 2ZM6L 2CQOA 1CHPD 5IGBA 2K01A 2Q2IA 1KQSA 3G6JB 4WRDA 3KDFB 3QG1A 1JMCA 1LV9A 4EVOA 4DAMA 5A35A 3BDLA 1S5BD 5C4JH 2ASBA 1YNND 5TSSA 4I7ZC 2R7ZB 2K52A 5CV6A 3NTKA 2F0VA 2HD3A 1XTDA 2R7ZH 2NBFA 2N3SA 2HQEA 3HOZG 3KJPA 4B9XA 1LTTD 3J80c 3M4OB 4ZQ3A 1PHJA 3SK4A 2F0DA 1KDCA 3IAYA 4L5RC 4DR1L 2MNAA 2NTTA 1DZ1A 2E2JB 2Q8RE 4YCWA 5AJ3L 4C3HH 3MZ5A 4OEMB 1SROA 2K14A 3Q22A 2EYFA 5ELNA 4CJ0B 1HZCA 1J8IA 4HCSA 2KCCA 4DUZQ 4FF3A 4Y52H 1NAPA 1X3FA 1L0XB 5EKIA 3PO2H 5CMDA 3PUYA 1IL8A 1PTOH 3EIVA 3J81E 1B3AA 3HS0C 1CA5A 1JOOA 2OWOA 2UU9Q 4QIWE 4RHRA 4DV7Q 2IY5B 1I3QH 5FOBB 1SJHD 3VA7A 4X64Q 4GOPA 4UPAA 3C1EA 1PDQA 5GROA 3TREA 3GTLB 5IGCA 5C3EG 2A6EC 3CCUA 3HOWG 3S14B 1MBYA 4B3SQ 2ICIA 2DY7A 4HTHA 2Z4IA 4YHHQ 1PFSA 2LMCB 2R3ZA 4C3JB 1A3TA 1LT4D 2JA9A 3HGBA 2PYKA 1B53A 3T1YQ 2XWBB 1WCMG 3L0OA 4Z9CB 2BA0A 2NTSA 2OQKA 4QB4A 5C4XB 1JC7A 4C3IG 2VB2X 3UDXA 2MJ8A 2JA5G 1LTAD 3BJUA 5KNDA 2UUCQ 4LWCA 1EWHA 5DM73 2UXDQ 3DXJC 1QZHA 4LF6L 4KN7C 1BCPC 3OW7A 2FINB 2RDGA 4OO1H 5C44H 3J7YW 2A19A 1HQRD 2VQFQ 1PXUA 2K5WA 4JK1C 4E6IA 1O7LA 1EOVA 4L5TA 4APVA 2N55A 4DV2Q 1WOCA 1TU2B 3RLNA 5M5WB 2VB3X 1XJVA 1PFMA 3S15B 2DNEA 4UP7A 1KNAA 1C8CA 4HJ7A 1TWHH 4BS9A 4BBRH 4BY1B 5IP7H 1IBML 3HKZB 3E0EA 5LHY1 4DF7A 5IGEA 2JA5B 5M5XH 2ZTEA 4C3HG 3S1QB 4POGA 1PH6A 1IBLQ 5K36H 2CKZB 2A8VA 1SEBD 2B2YA 2NZOA 4NB3A 1ENCA 5IWAQ 1IKMA 2RQXA 3MEHA 1EQVA 3GTJH 3QO2A 4PQXA 4POFA 2KJXA 1I4QA 2AQ2B 4CDDC 4TVAB 3I2ZA 4YCVA 2JA7G 1BNZA 1B50A 2OCEA 4G7HC 2NVTB 1HNWL 3MC0B 1SYEA 2L55A 1S72A 3S2DH 5IT9E 1Y1VB 3WOFA 5LMUL 2EYLA 1GVPA 3QIAA 1PH5A 5JJZA 3D4WA 4G57A 2PCFB 1KDAA 1U4LA 1LTLA 4MN3A 5IYDG 1MHWC 1EYGA 1KDBA 1SMYD 1W2BA 5E3FA 2PZWA 2DNCA 2X6GA 1Q3LA 3JC66 3CMEA 1WTXA 4XYQA 5GADC 4NXML 1B4OA 5M3FG 2AKWB 3H3VI 3CCQA 1V8QA 1M4VA 2VUMB 4N8FA 1J5EL 3K0XA 1ZKOA 5FKAC 4CKCA 4CKEA 1IW7D 2I46A 3AU7A 1PTOF 2JA5H 3CCVA 5T1IA 2I07B 4QY7A 5FJ8H 1HXYD 4JI4Q 2PO4A 4MTNA 1P16A 3GTQH 1XNQL 4YY3L 1SNCA 1Q86C 2D62A 2VS1A 2XIWA 3GD7A 2WACA 1SYFA 1A2TA 1VQFA 5ELDA 4DV5Q 2A6ED 5ISRA 1TWGH 3F2CA 4ZCKA 1XMOQ 1YHAA 4B08A 4HIMA 1R9TH 5LMNL 4X3KA 2R7ZG 3HOZH 2E2IB 4DR4Q 1YHQA 3H0GB 4KTAA 1XTCD 3KUPA 1J9OA 1O7YA 3LX0A 1S5CD 3CP0A 4YY3Q 2UUAQ 3CPWA 2LXJA 4C3JH 4DV1L 3LWEA 3M3YB 5A2QL 2DUDA 1LYLA 1BCPD 1OXSC 1H9JA 2BH2A 4DV0L 2RCNA 2TSSA 1PH1A 4DR6L 3VR4A 4A3BH 1VS0A 3KLSA 1HHVA 1BOSA 1A3VA 1PZJD 3SDZA 1TWAH 3OOCA 1STNA 3H15A 2KQ3A 3KFUA 2NVYB 2IL8A 1VCIA 2N88A 2Z6BA 3S2HB 2UXBQ 4ZLTF 1ENAA 3NHHA 1A6XA 1SYBA 1K0SA 4AH6A 3VYUA 3D4DA 4TKOB 5C0XH 4ME5A 1TXYA 3LNNA 2BOSA 1RF2D 3SE0A 3IKJA 1JE5A 1EWIA 5CYUA 3NWTA 4RA8A 4A3DH 4B3RL 3FPUB 4A3JG 4JVZA 4DR3L 3E3XA 2F0SA 4C1NK 1VQEA 1JT8A 1SFOB 2K1BA 3T13A 1Y69U 1LTRD 4DK0A 1D1IA 2YTYA 4C3JG 5C44G 3S1MH 3P7JA 3GTQB 2KEEA 2EXZA 2PI2E 4N9PA 4U673 3CMAA 4JBJA 1M90C 4IPCA 2K4KA 4C3IH 5BR8Q 3S1NB 1SAPA 2J4XA 2Z9HA 5E1FA 4O0AA 5I2YA 3KJOA 1UEBA 2ZTCA 3TP8A 1GUWA 1PFBA 1SNDA 1C4QA 4J8QA 5F2DA 2RHSB 4A3KG 2EVBA 1TWAB 1TVXA 1UNSA 2MUYA 2KA7A 5IYCG 4IJLA 1LTBD 1HZ9A 4X62Q 4LMQD 2HCIA 3OMGA 4RFBA 5M5YH 2TMPA 4ZUIA 3BDOA 3TP6A 1SE3A 1VQNA 2NWGA 1EIHA 4RAUC 1K8OA 3OTOQ 1Q12A 1QG7A 1EY7A 5G3LF 4EQ5A 1YNNC 5EGTA 2B2TA 3SXHA 3OMCA 4DR6Q 3G48A 1IBKQ 3K5NA 1TR5A 3GO5A 3TS2A 1EY8A 5EPLA 5KNCA 5GAHC 1TWCB 4AQYL 4JI7Q 1CT1D 1BKBA 1LACA 1EQRA 4DV1Q 4HSVA 4LF8L 3GTMH 1Y1VG 4JI1L 2SDFA 4DK3C 5IP9H 1AE3A 1F2MA 2KCNA 1N36Q 1PRTB 1Z9FA 3A54A 1VQDA 2VZAA 4LUZA 3V2TA 2PPBC 4WJ4A 1O78A 3ND8A 4LK1C 1TY2A 4MTKA 2F0NA 1GUOA 3I73A 4PMWA 2F1MA 3GTKB 4OXPA 2NZHA 2R92G 4JCVE 3MWYW 3D3RA 5FLXE 1EY6A 4GLVB 2R93H 4FXKC 1MD2D 2F4VL 3FMCA 1DXMA 1VQPA 2Q2UA 1WFQA 2F0JA 4JI2Q 1ZYRD 3P75A 2WB1B 2G9HD 4FF1A 2RHQB 1G291 3NSWA 1Q90A 4B9WA 4X3UA 3TS0A 1OXUA 1N8RC 1QUQA 3SHLA 3M3YH 3HOYG 4BY7H 1H95A 4R4IA 4FP5D 1K8AC 3GTOH 1ESFA 4R4QA 3S1NH 1FNWA 5I6YA 4A4IA 1X3EA 5JJLA 4B3TQ 2EIFA 1YNJD 2LY7A 5C0XG 3HFZB 4BBRG 3VDYA 1AE2A 4DR7Q 3J81i 3T4AC 1DJRD 2CH4W 3PQIA 4UHVA 3J81c 4IUVA 3H0GG 4JV5L 2A69C 2A6HD 1DGSA 2A73B 4GNXA 4J15A 1IHZA 2QEXA 4NKLA 2E2DC 4DR7L 2E8GA 5LMUQ 2V1CC 3S14H 2UXCL 1L2FA 2CWPA 1VQ8A 1QE6A 1W6KA 3RMHA 2R93B 2EYJA 2H5XA 5EPJA 2E5LQ 1QJOA 3U4ZA 5IE8A 1EIFA 1YIJA 2I0QA 2PMZE 2ZJRA 3VYTA 2YU9B 1ASZA 1PTOB 4LF7L 2GA4B 2ICEC 1E0BA 1TS3A 2D0OA 5G3LD 1F9SA 1HJPA 5IY0A 2CCZA 1IBLL 2WB1E 2R7DA 4C1NI 4EQOA 4O2DA 3QOJA 3S15H 1I4GA 3GTKH 4G7ZC 1VQCA 5BN5A 1JCKB 3RZOH 2UXCQ 3BS1A 1GUGA 3BZDB 1SSOA 2I5LX 4KMUC 2NVXH 2KVMA 3PCOB 4R4CA 1K3BC 4DV2L 1XYIA 5H1SE 4EQPA 4JI5Q 1YNXA 4DR2L 1YVCA 1HZBA 3A8IE 1N32L 2GVAA 3TSSA 3M9BA 3RR5A 2L11A 1MIUA 4F8MA 2B2WA 2D9UA 1RHPA 1H9RA 4UDUC 1IYUA 4JI4L 2C9OA 4K14A 3BVMA 3I7FA 4XQJA 3K81C 4IUNA 1B2TA 1VQ4A 1UUPA 1PYBA 1RODA 1ZEQX 4A3KB 1L1OC 4UP8A 1YHBA 4B3TL 1IBKL 2O5IC 3DHQA 3HOXG 2WV6D 1OXVA 2FXQA 3QR8A 4R9WA 5E4XA 2ZTDA 1V1QA 4CHTB 1ML0D 1S3OA 3I3CA 1AZQA 1TY0A 2F0PA 1Y8PB 2D2CC 2OEOA 2Q2HA 3DLLA 3TQYA 3CCLA 1MSGA 4LFAL 2H1EA 3D8GA 1PH2A 3HKZG 3TZUA 1K3RA 4OONA 4JI2L 5I6WA 1EY9A 4DV6L 1R4PB 2F4VQ 2O5JC 4X64L 1HCZA 3L9AX 3M7GA 3A7AB 4IJHA 1PH4A 2JA7H 1M8AA 2RCFA 2JQOA 3L2PA 3M7NA 1CSPA 3T53B 1SJED 3X3NA 2JK8A 5KIXA 3PIP3 2ZT9C 1BBUA 2E74C 3GTMB 1JB3A 2Y0SB 2BDOA 2K32A 2QW7A 3SK5A 3CHBD 2V4DA 1AEXA 2E2HH 3BYYB 4IUTA 4OWTB 1V9PA 3K7AB 1NMFA 2D5DA 1WTHA 1M1KC 2LSSA 3E6ZX 1JWSD 4ZAIA 2RF4A 4B3RQ 4AQYQ 1VQ5A 4JI7L 2FHTA 2ENBA 3OHXC 4RGNA 4A3EB 1EQTA 4ZUJA 4B3MQ 1LTID 2F0QA 1S5DD 2JYOA 4AYBB 3CF5A 2KBNA 4HN7A 4TRDA 1L0YB 1STHA 3QOLA 4LF5Q 1W3SA 2UXBL 3I72A 1I3QB 4LF4Q 3AEVA 4JV5Q 5FO9B 2VQFL 1VQ7A 4YWMA 3S1QH 1N32Q 2MFIA 4LUOA 3S1RB 1TWHB 1STAA 4LF4L 3Q24A 4RKLA 1F9QA 3TZDA 4LF5L 1VQBA 2BE5D 2K6AA 2R92B 2M9VA 1LUZA 3S16H 2DJFC 4H44C 1C9OA 3FP9A 4A93G 3S24A 3CCEA 4ZRZA 4B3ML 4L5QA 2L15A 1ASYA 3AYHB 2KHIA 2XVSA 2LKVA 2R6GA 1NR2A 3H3VC 1HQMC 2OT2A 3R2TA 1CQFA 3MXNA 4QIWB 3D4RA 1D5ZC 3ULLA 4X3SA 3A7LA 3I4MH 3J7AV 1YJ9A 1H9KA 3CC4A 5FO8B 4IPDA 5HGQA 2QILA 1HUMA 4DR2Q 5M3FB 3HOYH 1UE1A 1VQKA 1EL0A 4PMBA 1HA6A 3PV0A 2WINB 1D1KA 2R61A 5EBDA 1SE2A 3URYA 1XMOL 5T1GA 3LWUA 1CKNA 1KTKA 2RVLA 2XSCA 2MO0A 5FJ8G 3KK7A 4K5VA 3I90A 2L4NA 3FHWA 4RG1A 1RCVD 2FMMA 4LAAA 1L1OB 1X6OA 3KOJA 3CQZB 1X32A 3GV3A 4WORA 2A68D 2EQSA 3E5SA 5CV4A 4NDXA 1AP0A 4IZ8A 5EJWA 4HMJA 2Z1CA 4A3FH 5ELFA 3SEBA 2HIXA 1A3UA 2PQAB 1KAAA 1VQOA 5KNBA 1PTOC 3CPFA 2QF7A 1PYWD 2R7FA 5EKKA 1TKWB 3HG9A 4OGQC 3KBGA 1B7YB 5ELOA 3A8KE 1WTQA 1FJGQ 1QWYA 1TWFB 3G4SA 1DOMA 2WAQB 1O7ZA 2NB0A 3ERSX 4JBKA 4A3GG 2WIIB 2A5HA 4KD4A 4DR1Q 3A0JA 3J80i 1KAWA 3H6MA 1BXTA 3KDFA 1T5EA 2BE5C 4JW0A 2NVTH 2B8FA 1VF5C 1SYDA 2AUKA 4DNIA 1BR9A 3K5OA 1WCMB 1G2TA 1E2VA 4RKBA 3PMFA 1ZYRC 2F0OA 2Z8LA 3K7UC 3PIO3 3GTPB 1NR4A 1A62A 1JJCB 1WD1A 2B63B 5EQ0A 1HTPA 2L0CA 4DXGA 2B8GA 5BN4A 5IGGA 1K9MC 1Z7TA 4V190 2H4OA 1VQAA 4L63B 4MHEA 3P1HA 1ESRA 2BH8A 5C3EB 3HOUH 3GTJB 1K73C 1GUTA 1O7IA 2M2LA 4IPGA 4A3MB 4BA2I 1EYAA 1YJNA 3JAML 3JAMi 1KHIA 1SN8A 4H0LC 4XQQA 1B1ZA 2PW5A 1K8MA 2Q2TA 1G2SA 1NJIC 3K8AA 3SGIA 4IOAA 5BN3A 1WVLA 2B2WC 1N9WA 3OWFA 1V1PA 3K80C 2HUGA 4A3CH 4OO1G 1PMRA 3NWSA 4KJOA 1CQVA 2K5NA 4Y7NH 4OWWB 4GN5A 2KENA 4CGYB 1PH9A 4HCEA 2I5MX 3J7AF 4IFDH 1CHQD 1ENFA 1F9RA 3BVGA 2IJ0A 3EA6A 2L5TA 4Q0FA 1SRUA 3TMEA 1YBYA 3I91A 5HURA 1MI2A 3K6OA 4CDEC 4FF2A 3GTGH 1QVFA 4BXXG 2F0FA 2PZTA 3OWEB 2OTJA 4AYBG 1TWFH 4YCUA 3FDTA 2PMZB 1XNRQ 1H9SB 4BY1G 1F2ZA 1HA5A 3S16B 2UUCL 4A3IH 3NELA 4DAYA 3S17B 3IFTA 5C3EH 3HOUB 3FVQA 1G6ZA 1D2BA 2ZXRA 2EZVA 4L5SA 3T1YL 2JA6G 3H09A 3MAQA 2VQEQ 5AFWA 5JJKA 4OO1I 1AZPA 2LFNA 2CW0C 2IX3A 2VUMG 1CUKA 2JSOA 3A55A 4R8NA 2QGQA 4OIJA 4Q5VA 1KL9A 1WCMH 1RD9D 1RJTA 2SEBD 4DR3Q 2IPKD 1STBA 3EBEA 2BDNA 1LM0A 1CKOA 2Y0SE 3IFDA 3EFXD 2HHHQ 1CI3M 1BUVT 3RUZA 1ILQA 3PO3H 3KF6A 1SLJA 4DV7L 1FYCA 1QOHA 3ULPA 1KC8C 2BCOA 4JBMA 5KEEA 1K0RA 4DV5L 2CQAA 3ND9A 3OW2A 4FXDA 1FGBD 1LTGD 3BZCA 4L8JA 1EIYB 3HEJA 3AQQA 4LFAQ 3PIPA 4C56C 2C35B 3CC2A 1BDOA 2VNUD 4FDBA 2E5LL 4A3FB 4X66Q 2R92H 2WKCA 1MJEA 1IYJB 1PVOA 2K75A 4IUPA 2YU9H 3KF8A 5AJ3Q 5EAYA 2CHBD 3M4PA 3MFGA 1HZAA 4RWSC 1HNZQ 4A3JH 4UY8C 1I4XA 5DM63 1XX8A 2X69A 1SYCA 5JAVA 3WWVA 1IL2A 2YV5A 2D0PA 2UUAL 3H91A 3UE0A 2AQ3B 1U5KA 1I50H 2F0HA 1B3QA 4R1JA 3VYSA 2A68C 3CCMA 3B6YA 2Z6KA 4GKKL 2A6HC 1ICFB 2EJMA 5C6AA 2JA8H 2WAQG 2DN8A 5DAUA 3T16A 1FL0A 4DK1A 1JJGA 3PUWA 4XXEA 3TP7A 2JE6I 5A2QE 3E0JA 5FK9C 5C5MA 1D6EC 2SNMA 2B63H 4LFBL 3CXCA 1TS5A 2WFWA 3C2PA 1CM9A 1CKMA 1I5FA 3W1BA 4A3DB 4PZ8A 1B9NA 2ZM6Q 1V1PB 1FD7D 1I4RA 3FKIB 1BQQT 3I56A 1EFWA 1BVSA 1UEAB 4HJ5A 4QGUA 1LT3D 1EY5A 4LF7Q 1FR3A 2FMCA 3E9HA 2CWAA 4BY7B 5ELBA 4CJ2C 4KLKA 1II3A 1I6HB 5K5PA 3S2HH 3N52A 1UWVA 1VQMA 3JAMc 4A75A 1N33L 3AFQA 3GV6A 1EY0A 3TRZA 1EU3A 4NW2A 4P73A 2OTLA 2EY2A 1WYDA 3TP5A 1XPUA 4LFBQ 3M4OH 1Y8OB 3NE5B 2L9HA 5HY6A 3CCJA 3BG3A 5GAGC 3OYYA 4KHVA 4ZK9B 5IT9L 1NSNS 4FNFA 4K5WA 1OXTA 5NUCA 1UE5A 1I6VC 4TSSA 3R3OA 2ZJQA 5KRUA 1IYVA 4J6HA 3K7AH 3CRLC 5M5XB 3W2DA 4LF8Q 3Q8DA 3KLWA 2YTXA 1HRJA 4A76A 4FF4A 1DCZA 1VQ6A 3M85A 5M3MG 1HNZL 3D6CA 5JEAG 2DJGC 3VR5A 1RIPA 4I7AA 4AYBE 4MIUA 1J5EQ 4QCLA 3Q23A 5FLMH 1SYGA 1SNOA 1D5MC 5KGUA 1PFNA 1FVIA 4J1MA 4ILWA 1D8LA 4PG3A 1JQYD 4R4TA 1XPOA 4LJZC 2F0IA 4KY7A 4PZ6A 1TWGB 3SR1A 5C4XH 2JJQA 4NP5A 5M9OA 3RLOA 1EY4A 1JWMD 1DM0B 2XWJB 1LTSD 2N49A 3KYHC 1PH7A 2OF1A 2SOBA 2EOTA 1KLGD 5LMNQ 4DV3Q 1S4ZA 4JI6Q 4OWXB 1STEA 2F0MA 2NZ1D 1HNWQ 2MGSA 2DGYA 4P71A 1GUNA 1Q46A 5IODA 2CVRA 3VR3A 1PA6A 1AW7A 1IZ6A 1KNEA 1E1OA 3BYTB 5IGDA 1SNQA 1XMQL 1WD0A 2F4IA 2J0TD 1G6PA 2JA6B 3HOVB 1OO9B 1G51A 3M4YA 4JI1Q 2IWHA 3GDEA 4LF6Q 3KBXA 4H13C 4JOIA 4PZ7A 1WTOA 5LL6S 3PO2G 4G4KA 4IPHA 4KV6A 1MSHA 1CTMA 3K0YA 4BXXH 1PRTD 1RTOA 2F0TA 3W5OA 1D7QA 5DLQE 3F2DA 1YNJC 3I4MB 3PO2B 2QKIC 1IBMQ 1JE4A 4KI0A 4GOPB 4GLXA 3EN2A 3I4LA 1SMXA 3V96A 3G6EA 3NTIA 2EJFC 1DOKA 3RZDB 3L3OC 5LMNW 3UDIA 5GQOA 4IO9A 5IIFA 2EXDA 3D31A 2B2VC 5ELEA 2HT1A 2EYMA 4B3SL 4X62L 2PNHA 5JPNC 1VMCA 1SE8A 3U9SA 4YIJA 5C4HA 5D65A 3W3AA 5J3BA 3AB9A 4JI5L 3S1RH 5JOBA 1GXDC 4KHPL 2JA7B 2WP8J 1EU4A 1YEZA 1BCPB 1B70B 1GD7A 2KHJA 4MZ9A 2F0UA 4IURA 5JEAH 5GAEC 2KCTA 1K83B 1XWEA 3ZYYX 2QCPX 4MNOA 1PH8A 4N9TA 4HEDA 2GN5A 2VXWA 3CU7A 2JXMB 1X3GA 1QILA 3NQIA 4ULLA 3DMUA 4R4OA 1GKHA 4AIMA 2B39A 1YZ6A 1KRTA 2F03A 1D5XC 4DUZL 2VY3A 4A3MH 2Q8IB 1KLUD 1X55A 4XYOA 5C4JB 2KOLA 3STBC 3HOYB 4RH6A 2JEBI 4WJ3M 1E7ZA 1C7YA 4A3FG 3L7ZC 2VW9A 2ZJPA 4CKBA 1Q82C 1MJCA 4GN4B 5JVH3 3N6RA 3MA2B 4A93H 4BBSB 3A74A 1LLRD 1HR0W 4LF9Q 1QZGA 4O42A 3I4OA 1K28A 4EX5A 5CV7A 2K04A 4DUYQ 1VQGA 1B9MA 4ZYSA 3H3VH 4OL7A 2EJGC 3GTOB 3DWQA 4C2MB 1Q1BA 2MO1A 3STBD 1U9RA 3MFYA 1TS2A 2Z6KC 3KLSX 1GOZA 4OELB 1A63A 2NVQB 4H7BA 5D3IB 3MHBA 3I4NH 3DEPA 2O4XA 3ZJYC 5C0XI 1FJGL 2ZXOA 3NK9A 1PLFA 3BDCA 4PV1C 5JEAJ 2PNRC 5IOCA 3GP7A 4RMFA 3RNUA 4OX9L 4YWLA 5M3MB 4BY7G 1DONA 4EGVA 5E4WC 2A69D 3DM1A 1SR3A 1WJJA 2EYHA 3FRPB 3AMUA 1BO0A 2XRSD 2QEJC 5LL6X 4C3IB 2F0KA 4BY1H 4WJWA 4BA1I 3NXWA 5J39A 4A3BG 2C5CA 2RDHA 5IGFA 4A3GH 2F3WA 4CDCC 1STGA 3K5MA 4DAPA 2IX1A 4BWGB 3U4VA 2XNAC 1ICWA 3ITPA 2O2LD 3HKSA 4HR7B 5EBCA 4CJ1B 3I55A 2JEAI 1SFOH 1ILPA 1U4PA 1N36L 3SK8A 1HR0L 3BU2A 4GKJQ 1XNQQ 4OHJA 3U9OA 2UUBQ 1HTLD 3EVQA 3CW2C 3RLFA 4KY6A 1Y14B 3DEOA 4KKUA 3KF8B 1Z6HA 1HH2P 1PZKD 4DV4L 3HOWB 1CSQA 5CORA 5CBAE 4BBSH 5FLXc 5FLMG 3TN2A 2EE1A 3ICEA 2B3GA 2FFKB 4ABNA 4IFDI 2RKSA 3EJIA 1F2YA 1PH3A 4IALA 1YJWA 3CC7A 1HFNA 3MVVA 2RSOA 3OIQA 1NUCA 2F0EA 2K5QA 3VR6A 3GTLH 4JI8L 4U68A 3QWNA 4DN4M 1O80A 3NENA 4OX9Q 4DA2A 5IYBH 3MXPA 1WI5A 3MXGA 4P75A 1DD2A 2K05A 1X54A 1S5FD 1YITA 4K0KQ 4V0BA 4KY5A 1RDPD 5BR8L 4HJ9A 4XDXA 4JC0A 4XTCS 3VR2A 3CD6A 3HZXA 4P72A 1HFGA 5FO7B 3A5UA 2SNSA 1JR0D 2I5HA 4A3LG 1JICA 1A2UA 1VQIA 3RZOB 1F77A 1Y1WB 1BBXC 3DM3A 1CA6A 4YHHL 3H94A 1BBWA 4QUCA 1I94L 1EEID 3LGJA 1EOTA 3NBHA 1ONLA 4DAYB 3K58A 3DUZA 1JORA 2NVYH 3K5LA 1XXGA 3J80L 5C3WA 5IP7G 4L6TB 2K50A 1KXLA 3HOUG 2AHOB 2WB1G 2F3VA 2PZUA 1GHJA 4JYAQ 4BBRB 1AN8A 1N33Q 2XGTA 4DV4Q 3I70A 2EY5A 2EY1A 4CBVA 2RBMA 1NCVA 4IQZA 1TQOA 4ZKCB 2L1BA 5CV8A 3NUCA 2MHVA 1N34L 1HR0Q 3BZKA 5JVG3 2LS01 3C46A 2K5VA 4QJFA 4KHZA
chains in the Genus database with same CATH topology
4DU9A 3S9WA 2EY6A 3S1MB 1RKNA 4GZYC 1I4HA 5KYLA 2EPBA 1H9SA 4DNRB 2EYPA 5I9OA 4KKSA 3T51B 2Q8TA 2NVXB 2IX0A 5CGKA 2HCCA 1EZ8A 3SVMA 4A3GB 5M5YB 1VDZA 1ZXTA 1MGSA 1GHKA 3EROA 4XIGS 1SNPA 4M8AA 1IKLA 2RA4A 1PRTC 1JOQA 3K59A 1W6JA 5COYA 1DYQA 3WOEA 1Z47A 4QMGA 2IT1A 1EYDA 2AWOA 4IUUA 2E75C 4ID6A 2QDBA 4QF4A 3J80E 3V05A 5ELCA 3I4NB 3EQLC 2XN9C 2NN6H 1CK1A 3WDNA 2B2UA 2ID0A 3QJYA 1F2LA 5D3DA 4DNTB 5DEHA 5I9PA 3S2DB 5J22A 2NYZD 1E2ZA 2B2YC 1WTVA 1Q8IA 4KN4C 4XQNA 3J81L 5KYIA 1PRTF 4JBWA 5FLXL 1GUSA 5C5LA 5HGTA 4KK7A 2NN6G 1QNUA 5CV9A 3FPPA 1WTWA 3R93A 1DOLA 5JPMC 1RTNA 4DFAA 3I8ZA 2DY8A 2M00A 2G9DA 1Q1EA 4I65A 5EKLA 1B44D 5CBEE 3VA5A 4FXGC 3DWPA 1STYA 4IFDJ 2Z4HA 3HOXB 4IUQA 3D6WA 5EPKA 1PZID 3MTSA 3PUXA 3NBIA 2HDLA 4PMCA 1X3PA 3DWAA 4C3HB 4RCNA 4K8JA 4DAVA 1HUNA 2ZXPA 2B2VA 1EIGA 1CZGA 3ERQA 1U4RA 1S5ED 3G7LA 2B2TC 5K36G 4RHSA 4QUFA 1JOKA 2YYZA 2JP1A 1Y8NB 3X3MA 2MP1A 2J7ZA 4UAIA 4F7XA 3JAME 3R8BA 1WTPA 3IL8A 4K2KA 3TDQA 2HDMA 1V1OA 1LT5D 3KLRA 4RCOA 2OXPA 2F0GA 1E2WA 3O13A 3OIPA 3A56A 1CZWA 2B2UC 5C0XJ 3HP3A 4RGMA 1GJXA 4Y7NB 1CFMA 4RGTA 4R8IA 4KKTA 3CRKC 4FVMA 2BA1A 2EYOA 1FNVA 2XRQD 2JA8B 4O1NA 2PW7A 3NPPA 1TT2A 4A93B 4K2LA 1I50B 5C3XA 4OIKA 1G91A 2X6LA 4TQUS 4DGZA 4ODGA 4WFN3 3C3LA 1LABA 5CV5A 2K33A 2MPMA 1H9MA 3FEWX 1BF4A 5CR3A 1WTRA 1SBBB 2WKDA 2EDGA 3OSOA 1ET6A 4K5XA 4NMZA 3ONAB 3OPOA 3SK6A 4M1UB 4XT1B 4KJNA 2A74C 2F0WA 4DXFA 4RGOS 2E2HB 3CKIB 1G8ZD 1T5XD 2KUMA 3Q6SA 1SE4A 2FJ2A 2KECA 3PO3B 1SXTA 1VMPA 1ET9A 1VF7A 3R2IA 3NP8A 4FYDA 4F88A 4FO2A 1UAPA 5D14A 2F0LA 4X3TA 1QNKA 1OXXK 1EFID 3C1FA 2E76C 4K6LA 1EEFD 4A3BB 1AFPA 4A3IB 1I4PA 2CW0D 1FNUA 4XT3B 3T56B 2KEDA 1EWCA 1QCBD 4A3JB 2NUCA 3Q0AA 2AWNA 4HSPA 5J1ZA 2IW3A 3GQBA 1BCPF 5C44B 5C4ZA 1F9PA 4KD3A 2PQEA 4EQNA 1EZ6A 1JWUD 1R9TB 1C48A 1A15A 1V43A 3UI2A 3TBIB 1EYCA 3HRZC 1HPCA 1U4MA 1QB5D 3BVZA 1TS4A 1LT6D 5I4DA 4G7OC 4IN3A 2AQ1B 3NQTA 1KABA 2KHSA 3NTHA 4K8IA 1TIID 2K03A 4P2CB 1PTOD 4HAEA 2AUJD 3PUVA 4PNYA 1SNMA 1R4QB 1LO5D 4F87A 3P20A 3RD4A 1X3QA 1IW7C 4IFDG 3PUZA 5I2XA 3MXUA 3K57A 4K6DA 2RSNA 3GTGB 4ZKBB 3VYRA 5DNFA 2K28A 3F2UA 2RDFA 4S3SA 1SMYC 2K5DA 3HOZB 5CC4A 2K7VA 2L12A 3A8JE 1SDFA 3QB3A 2NN6I 4HMIA 1CHPD 5IGBA 2K01A 3G6JB 4WRDA 3QG1A 1LV9A 4EVOA 5A35A 3BDLA 1S5BD 1YNND 5TSSA 4I7ZC 2R7ZB 5CV6A 3NTKA 2F0VA 2NBFA 2HQEA 4B9XA 1LTTD 3M4OB 4ZQ3A 3SK4A 2F0DA 1KDCA 3IAYA 2NTTA 1DZ1A 2E2JB 2Q8RE 3MZ5A 3Q22A 2EYFA 4CJ0B 1J8IA 4HCSA 2KCCA 4FF3A 1NAPA 1L0XB 5EKIA 5CMDA 3PUYA 1IL8A 1PTOH 3J81E 1B3AA 3HS0C 1CA5A 1JOOA 4RHRA 5FOBB 1SJHD 3VA7A 3C1EA 1PDQA 3GTLB 5IGCA 2A6EC 3S14B 1MBYA 2ICIA 2DY7A 4HTHA 2Z4IA 2LMCB 2R3ZA 4C3JB 1A3TA 1LT4D 3HGBA 2PYKA 1B53A 2XWBB 4Z9CB 2BA0A 2NTSA 4QB4A 5C4XB 1JC7A 4C3IG 2VB2X 2MJ8A 1LTAD 5KNDA 1EWHA 5DM73 3DXJC 4KN7C 1BCPC 3OW7A 2FINB 2RDGA 4OO1H 3J7YW 1HQRD 1PXUA 2K5WA 4JK1C 4E6IA 1O7LA 2N55A 1TU2B 5M5WB 2VB3X 1PFMA 3S15B 2DNEA 1KNAA 1C8CA 4BS9A 4BY1B 3HKZB 5LHY1 4DF7A 5IGEA 2JA5B 4C3HG 3S1QB 5K36H 1SEBD 2B2YA 1ENCA 1IKMA 2RQXA 3MEHA 1EQVA 3QO2A 4PQXA 2KJXA 1I4QA 2AQ2B 1BNZA 1B50A 4G7HC 2NVTB 3MC0B 1SYEA 2L55A 5IT9E 1Y1VB 3WOFA 2EYLA 3QIAA 5JJZA 3D4WA 4G57A 2PCFB 1KDAA 1U4LA 4MN3A 1KDBA 1SMYD 5E3FA 2PZWA 2DNCA 2X6GA 1Q3LA 1WTXA 4XYQA 1B4OA 1V8QA 1M4VA 2VUMB 1ZKOA 5FKAC 4CKCA 4CKEA 1IW7D 2I46A 3AU7A 1PTOF 5T1IA 2I07B 1HXYD 2PO4A 1SNCA 2D62A 2XIWA 3GD7A 2WACA 1SYFA 1A2TA 5ELDA 2A6ED 5ISRA 4B08A 4X3KA 2E2IB 3H0GB 4KTAA 1XTCD 3KUPA 1J9OA 1O7YA 3LX0A 1S5CD 3LWEA 3M3YB 5A2QL 1BCPD 1OXSC 1H9JA 2TSSA 3VR4A 3KLSA 1HHVA 1BOSA 1A3VA 1PZJD 3SDZA 3OOCA 1STNA 2KQ3A 2NVYB 2IL8A 1VCIA 2N88A 3S2HB 4ZLTF 1ENAA 3NHHA 1A6XA 1SYBA 3VYUA 3D4DA 4TKOB 5C0XH 4ME5A 3LNNA 2BOSA 1RF2D 3SE0A 3IKJA 5CYUA 3NWTA 4RA8A 3FPUB 2F0SA 4C1NK 1SFOB 2K1BA 3T13A 1Y69U 1LTRD 4DK0A 1D1IA 4C3JG 3P7JA 3GTQB 2KEEA 2EXZA 4N9PA 4U673 3S1NB 1SAPA 2J4XA 5E1FA 5I2YA 3TP8A 1GUWA 1PFBA 1SNDA 1C4QA 4J8QA 5F2DA 2EVBA 1TWAB 1TVXA 1UNSA 2MUYA 2KA7A 1LTBD 4LMQD 2HCIA 3OMGA 4RFBA 2TMPA 4ZUIA 3BDOA 3TP6A 1SE3A 2NWGA 1EIHA 4RAUC 1K8OA 1Q12A 1QG7A 1EY7A 5G3LF 1YNNC 5EGTA 2B2TA 3SXHA 3OMCA 3K5NA 1TR5A 3GO5A 1EY8A 5KNCA 5EPLA 1TWCB 1CT1D 1LACA 4HSVA 2SDFA 1F2MA 2KCNA 1PRTB 3A54A 3V2TA 2PPBC 1O78A 3ND8A 4LK1C 1TY2A 2F0NA 1GUOA 3I73A 4PMWA 2F1MA 3GTKB 3MWYW 3D3RA 5FLXE 1EY6A 4FXKC 1MD2D 3FMCA 1DXMA 2F0JA 1ZYRD 3P75A 2WB1B 2G9HD 4FF1A 1G291 3NSWA 1Q90A 4B9WA 4X3UA 1OXUA 3SHLA 4FP5D 1ESFA 1FNWA 5I6YA 1YNJD 2LY7A 5C0XG 3T4AC 1DJRD 4IUVA 2A69C 2A6HD 2A73B 1IHZA 4NKLA 2E2DC 1QE6A 1W6KA 3RMHA 2R93B 2EYJA 5EPJA 1QJOA 3VYTA 2YU9B 1PTOB 2GA4B 2ICEC 1E0BA 1TS3A 5G3LD 1F9SA 4C1NI 4EQOA 3QOJA 1I4GA 4G7ZC 5BN5A 1JCKB 3BS1A 1GUGA 3BZDB 1SSOA 4KMUC 2KVMA 1XYIA 4EQPA 3A8IE 3TSSA 2L11A 4F8MA 2B2WA 2D9UA 1RHPA 1H9RA 4UDUC 1IYUA 2C9OA 4K14A 3BVMA 4XQJA 4IUNA 1B2TA 1UUPA 1RODA 1ZEQX 4A3KB 2O5IC 3DHQA 2WV6D 1OXVA 4R9WA 5E4XA 4CHTB 1ML0D 3I3CA 1AZQA 1TY0A 2F0PA 1Y8PB 2D2CC 2OEOA 1MSGA 2H1EA 3D8GA 3TZUA 5I6WA 1EY9A 1R4PB 2O5JC 1HCZA 3L9AX 3M7GA 3A7AB 1M8AA 3M7NA 3T53B 1SJED 3X3NA 5KIXA 3PIP3 2ZT9C 2E74C 3GTMB 1JB3A 2Y0SB 2BDOA 2K32A 3SK5A 3CHBD 2V4DA 1AEXA 3BYYB 4IUTA 3K7AB 2D5DA 3E6ZX 1JWSD 4ZAIA 2FHTA 2ENBA 3OHXC 4RGNA 4A3EB 1EQTA 4ZUJA 1LTID 2F0QA 1S5DD 2JYOA 4AYBB 4HN7A 4TRDA 1L0YB 1STHA 3QOLA 3I72A 1I3QB 5FO9B 3S1RB 1TWHB 1STAA 3Q24A 4RKLA 1F9QA 3TZDA 2BE5D 2K6AA 2R92B 2M9VA 4H44C 4ZRZA 2XVSA 2LKVA 2R6GA 1NR2A 3H3VC 1HQMC 2OT2A 3R2TA 1CQFA 3MXNA 4QIWB 3D4RA 1D5ZC 4X3SA 3A7LA 3J7AV 1H9KA 5FO8B 2QILA 1HUMA 5M3FB 1EL0A 4PMBA 1HA6A 3PV0A 2WINB 1D1KA 2R61A 5EBDA 1SE2A 3URYA 5T1GA 3LWUA 1KTKA 2RVLA 2XSCA 3KK7A 4K5VA 3I90A 2L4NA 1RCVD 2FMMA 4LAAA 3CQZB 1X32A 3GV3A 4WORA 2A68D 3E5SA 5CV4A 4NDXA 1AP0A 4IZ8A 5EJWA 4HMJA 2Z1CA 5ELFA 3SEBA 1A3UA 1KAAA 5KNBA 1PTOC 2QF7A 1PYWD 5EKKA 1TKWB 3HG9A 4OGQC 3KBGA 3A8KE 1WTQA 1QWYA 1TWFB 1DOMA 2WAQB 1O7ZA 2NB0A 2WIIB 2A5HA 4KD4A 3H6MA 1BXTA 1T5EA 2BE5C 2B8FA 1VF5C 1SYDA 2AUKA 1BR9A 3K5OA 1WCMB 1G2TA 1E2VA 4RKBA 3PMFA 1ZYRC 2F0OA 2Z8LA 3PIO3 3GTPB 1NR4A 1WD1A 2B63B 5EQ0A 1HTPA 2L0CA 4DXGA 2B8GA 5BN4A 5IGGA 4V190 1Z7TA 2H4OA 4L63B 4MHEA 3P1HA 1ESRA 5C3EB 3GTJB 1GUTA 2M2LA 4BA2I 4A3MB 1EYAA 3JAML 4H0LC 4XQQA 1B1ZA 2PW5A 1K8MA 1G2SA 5BN3A 1WVLA 2B2WC 3OWFA 1V1PA 4OO1G 2HUGA 1PMRA 3NWSA 4KJOA 1CQVA 4CGYB 4HCEA 3J7AF 4IFDH 1ENFA 1CHQD 1F9RA 3BVGA 2IJ0A 3EA6A 2L5TA 4Q0FA 3TMEA 3I91A 5HURA 1MI2A 3K6OA 4FF2A 2F0FA 2PZTA 3OWEB 3FDTA 2PMZB 1H9SB 1F2ZA 1HA5A 3S16B 4DAYA 3S17B 3IFTA 3HOUB 3FVQA 1G6ZA 1D2BA 2ZXRA 2EZVA 3H09A 3MAQA 5AFWA 4OO1I 1AZPA 2LFNA 2CW0C 2IX3A 2JSOA 3A55A 4R8NA 4OIJA 4Q5VA 1RD9D 1RJTA 2SEBD 2IPKD 1STBA 2BDNA 3IFDA 3EFXD 1CI3M 1BUVT 3RUZA 1ILQA 1FYCA 1QOHA 2BCOA 5KEEA 2CQAA 3ND9A 4FXDA 1FGBD 1LTGD 4L8JA 3HEJA 4C56C 1BDOA 2VNUD 4A3FB 2WKCA 4IUPA 3KF8A 2CHBD 3MFGA 4RWSC 1I4XA 5DM63 1XX8A 2X69A 1SYCA 5JAVA 3H91A 2AQ3B 2F0HA 3VYSA 2A68C 2A6HC 5C6AA 2EJMA 2DN8A 5DAUA 3T16A 4DK1A 3PUWA 4XXEA 3TP7A 2JE6I 5A2QE 3E0JA 5FK9C 5C5MA 1D6EC 2SNMA 1TS5A 3C2PA 1CM9A 4A3DB 1B9NA 1V1PB 1FD7D 1I4RA 3FKIB 1BQQT 1UEAB 1LT3D 1EY5A 1FR3A 2FMCA 4BY7B 5ELBA 4CJ2C 1II3A 1I6HB 5K5PA 3N52A 3GV6A 1EY0A 1EU3A 4NW2A 2EY2A 3TP5A 1Y8OB 3NE5B 2L9HA 3BG3A 4KHVA 4ZK9B 5IT9L 1NSNS 4FNFA 4K5WA 1OXTA 5NUCA 1I6VC 4TSSA 3R3OA 5KRUA 1IYVA 4J6HA 3CRLC 5M5XB 3W2DA 1HRJA 4FF4A 1DCZA 3M85A 3D6CA 5JEAG 3VR5A 4MIUA 4QCLA 3Q23A 1SYGA 1SNOA 1D5MC 5KGUA 1PFNA 4J1MA 4ILWA 1JQYD 4LJZC 2F0IA 4KY7A 1TWGB 3SR1A 4NP5A 5M9OA 1EY4A 1JWMD 1DM0B 2XWJB 1LTSD 2OF1A 2SOBA 2EOTA 1KLGD 1S4ZA 1STEA 2F0MA 2NZ1D 2MGSA 1GUNA 5IODA 2CVRA 3VR3A 1AW7A 1KNEA 3BYTB 5IGDA 1SNQA 1WD0A 2F4IA 2J0TD 2JA6B 3HOVB 1OO9B 3M4YA 2IWHA 3KBXA 4H13C 1WTOA 5LL6S 4G4KA 4KV6A 1MSHA 1CTMA 3K0YA 1PRTD 1RTOA 2F0TA 1YNJC 3I4MB 3PO2B 2QKIC 1JE4A 4KI0A 3I4LA 3V96A 3NTIA 2EJFC 1DOKA 3RZDB 3L3OC 5IIFA 3D31A 2B2VC 5ELEA 2EYMA 5JPNC 1VMCA 3U9SA 4YIJA 5C4HA 5D65A 3W3AA 3AB9A 5JOBA 1GXDC 2JA7B 2WP8J 1EU4A 1BCPB 2F0UA 4IURA 5JEAH 1K83B 1XWEA 3ZYYX 2QCPX 4N9TA 4HEDA 2VXWA 3CU7A 2JXMB 1QILA 3NQIA 4ULLA 3DMUA 2B39A 2F03A 1D5XC 2Q8IB 1KLUD 4XYOA 5C4JB 2KOLA 3HOYB 4RH6A 2JEBI 3L7ZC 4CKBA 5JVH3 3N6RA 3MA2B 4BBSB 1LLRD 4O42A 5CV7A 2K04A 1B9MA 4ZYSA 4OL7A 2EJGC 3GTOB 3DWQA 4C2MB 1Q1BA 1U9RA 3MFYA 1TS2A 3KLSX 1GOZA 2NVQB 4H7BA 5D3IB 3MHBA 3DEPA 2O4XA 5C0XI 2ZXOA 3NK9A 1PLFA 3BDCA 4PV1C 5JEAJ 2PNRC 5IOCA 3GP7A 5M3MB 1DONA 4EGVA 5E4WC 2A69D 3DM1A 2EYHA 3AMUA 3FRPB 1BO0A 2XRSD 2QEJC 5LL6X 4C3IB 2F0KA 4WJWA 4BA1I 3NXWA 5J39A 2C5CA 2RDHA 5IGFA 2F3WA 3K5MA 1STGA 4DAPA 2IX1A 4BWGB 2XNAC 1ICWA 3ITPA 2O2LD 4HR7B 5EBCA 4CJ1B 2JEAI 1ILPA 1U4PA 3SK8A 4OHJA 3U9OA 1HTLD 3EVQA 3RLFA 4KY6A 3DEOA 4KKUA 1Z6HA 1PZKD 3HOWB 5CORA 5CBAE 3TN2A 2EE1A 2FFKB 4ABNA 4IFDI 2RKSA 3EJIA 1F2YA 4IALA 1HFNA 3MVVA 2RSOA 3OIQA 1NUCA 2F0EA 2K5QA 3VR6A 4U68A 3QWNA 4DN4M 1O80A 4DA2A 3MXPA 3MXGA 1DD2A 2K05A 1S5FD 4V0BA 4KY5A 1RDPD 4XDXA 4XTCS 3VR2A 3HZXA 1HFGA 5FO7B 2SNSA 1JR0D 1JICA 1A2UA 3RZOB 1F77A 1Y1WB 1BBXC 1CA6A 3H94A 4QUCA 1EEID 3NBHA 1EOTA 1ONLA 3K58A 3DUZA 1JORA 3K5LA 1XXGA 3J80L 5C3WA 4L6TB 2F3VA 2PZUA 1GHJA 4BBRB 1AN8A 3I70A 2EY5A 2EY1A 4CBVA 2RBMA 1NCVA 4IQZA 1TQOA 4ZKCB 2L1BA 5CV8A 3NUCA 2MHVA 5JVG3 2LS01 3C46A 4KHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY6 A;  4HMI A;  4DU9 A;  5I6Y A;  3S9W A;  2EY6 A;  3DHQ A;  4J1M A;  5J1Z A;  5IGB A;  5CV9 A;  2EXZ A;  4N9P A;  4KJO A;  5JAV A;  4WRD A;  1SNC A;  1RKN A;  5C4Z A;  5KYL A;  4KD3 A;  2F0I A;  2WAC A;  1SYF A;  1A2T A;  4DFA A;  2EYO A;  4KY7 A;  4EVO A;  5E1F A;  3BDL A;  3SR1 A;  2PQE A;  2F0P A;  4EQN A;  5ISR A;  4E6I A;  1SYC A;  1EZ6 A;  2OEO A;  2M00 A;  1TT2 A;  2PW7 A;  2RKS A;  4K2L A;  4NP5 A;  4PMB A;  3EJI A;  1F2Y A;  5CV6 A;  5M9O A;  3TP8 A;  2F0V A;  5C3X A;  3D8G A;  1EY4 A;  2EYP A;  1SND A;  2F0H A;  2HQE A;  4IAL A;  4B9X A;  5I9O A;  4I65 A;  5EKL A;  5F2D A;  5I6W A;  1EY9 A;  5C6A A;  4K5V A;  1IHZ A;  3MVV A;  2OF1 A;  4ZQ3 A;  3TME A;  1EZ8 A;  2SOB A;  5CV7 A;  5DAU A;  3VA5 A;  4ODG A;  3T16 A;  4DGZ A;  1NUC A;  2F0E A;  4NKL A;  3SK4 A;  3TP7 A;  2F0D A;  1EYC A;  4LAA A;  5HUR A;  1KDC A;  2F0M A;  4KTA A;  5C5M A;  1STY A;  3OMG A;  5CV5 A;  4DF7 A;  5IGE A;  4OL7 A;  4ZUI A;  2SNM A;  3ERO A;  2F0F A;  2PZT A;  4WOR A;  3MXP A;  3E5S A;  5CV4 A;  3TP6 A;  5IOD A;  3LX0 A;  1SNP A;  4NDX A;  4IZ8 A;  5KIX A;  1EY7 A;  4HMJ A;  5IGD A;  1F2Z A;  5CR3 A;  1SNQ A;  1JOQ A;  5EGT A;  1U9R A;  3OSO A;  3SXH A;  2EYJ A;  3OMC A;  1A3U A;  1ENC A;  4PMC A;  1KAA A;  4KY5 A;  3MZ5 A;  4K5X A;  3SK5 A;  4NMZ A;  4QMG A;  3MEH A;  5EKK A;  1AEX A;  1TR5 A;  3HZX A;  1EQV A;  4K8J A;  3SK6 A;  1EYD A;  3NQT A;  4H7B A;  1KAB A;  1EY8 A;  3MHB A;  2KHS A;  4K8I A;  2SNS A;  2O4X A;  1EY5 A;  4KV6 A;  2EYF A;  4KJN A;  4ID6 A;  1A2U A;  2F0W A;  2F0T A;  2QDB A;  3NK9 A;  3ERQ A;  4QF4 A;  3BDC A;  1II3 A;  2ENB A;  5IOC A;  4KD4 A;  5K5P A;  1A3V A;  4PNY A;  1SYE A;  4EQO A;  1F2M A;  3H6M A;  3QOJ A;  4ZUJ A;  2F0Q A;  1JOO A;  1SNM A;  4R8N A;  5CGK A;  2EYL A;  1STN A;  1SYD A;  4TRD A;  1JOR A;  1EY0 A;  1STH A;  2KQ3 A;  3QOL A;  3D4W A;  2EY2 A;  3TP5 A;  3V2T A;  4G57 A;  4RKB A;  1JOK A;  1KDA A;  1STB A;  3PMF A;  3NP8 A;  5C3W A;  2F0O A;  2EYH A;  3C1E A;  2F0N A;  1ENA A;  4K6D A;  3NHH A;  3RUZ A;  5IIF A;  4EQP A;  1KDB A;  1SYB A;  2F0K A;  4KHV A;  5DEH A;  2EYM A;  5E3F A;  3D4D A;  2F3V A;  2PZW A;  2PZU A;  4F7X A;  5I9P A;  3NXW A;  4ME5 A;  1EY6 A;  5IGC A;  5J22 A;  4YIJ A;  5IGG A;  1NSN S;  4K5W A;  5NUC A;  5C4H A;  5IGF A;  5KEE A;  5J39 A;  1STA A;  2F0L A;  4HTH A;  3R3O A;  4RKL A;  2F3W A;  5JOB A;  1STG A;  5KRU A;  2F0J A;  4F8M A;  4J6H A;  3C1F A;  2RDF A;  3P75 A;  3P1H A;  4K2K A;  3HEJ A;  4S3S A;  2EY5 A;  3ITP A;  2EY1 A;  2F0U A;  4K14 A;  2OXP A;  1A3T A;  2RBM A;  4B9W A;  5KYI A;  1TQO A;  5CV8 A;  2F0G A;  2F0S A;  2PYK A;  3NUC A;  1EYA A;  4IUN A;  2LKV A;  3D6C A;  4N9T A;  3SHL A;  3SK8 A;  3T13 A;  5CC4 A;  5C5L A;  2PW5 A;  3DMU A;  3U9O A;  3QB3 A;  2NUC A;  4MIU A;  5HGT A;  4QB4 A;  3EVQ A;  1SYG A;  1SNO A;  3OWF A;  5KGU A; 
#chains in the Genus database with same CATH topology
 1S40 A;  3AFP A;  4DU9 A;  3S9W A;  2EY6 A;  3HKZ E;  3S1M B;  1L1O A;  1RKN A;  1I4H A;  5KYL A;  4GZY C;  4A3D G;  4LFC Q;  4DR5 Q;  5L37 A;  3FKI G;  2EPB A;  1H9S A;  4DNR B;  2EYP A;  2ALY B;  5I9O A;  1QVC A;  1E24 A;  4KKS A;  3T51 B;  2Q8T A;  4GKK Q;  2NVX B;  2IX0 A;  4ME3 A;  5CGK A;  2HCC A;  1EZ8 A;  3SVM A;  1XPR A;  4A3G B;  4DR4 L;  4A3C G;  4BBS G;  5M5Y B;  1VDZ A;  3RN2 A;  1ZXT A;  1MGS A;  4LUV A;  1GHK A;  3ERO A;  4XIG S;  1SNP A;  3PO3 G;  1T9H A;  4M8A A;  1IKL A;  4YWK A;  2RA4 A;  1PRT C;  1JOQ A;  4DKA C;  3W1G A;  3K59 A;  1W6J A;  5COY A;  2UU9 L;  1DYQ A;  3WOE A;  1Z47 A;  4QMG A;  4A3K H;  2IT1 A;  1EYD A;  2AWO A;  2VUM H;  4IUU A;  3UE1 A;  4LW1 A;  2E75 C;  1MKH A;  4ID6 A;  4JI0 L;  2QDB A;  3HOW H;  4ALP A;  4X6A H;  4QF4 A;  3J80 E;  4JYA L;  4HJ8 A;  2QA4 A;  3D0F A;  3V05 A;  5ELC A;  3I4N B;  3EQL C;  2B63 G;  2XN9 C;  2NN6 H;  1EUJ A;  1CK1 A;  3WDN A;  2B2U A;  3T1H L;  2ID0 A;  2R93 G;  2K5H A;  3QJY A;  1F2L A;  5D3D A;  2HHH L;  4DNT B;  5DEH A;  5I9P A;  4LNQ A;  1UE7 A;  3S2D B;  1OTC A;  3H0G H;  5J22 A;  2NYZ D;  1E2Z A;  2B2Y C;  1WTV A;  1FGU A;  1Q8I A;  4X65 L;  4A3M G;  4KN4 C;  1TWC H;  2E2I H;  4XQN A;  3J81 L;  1VQL A;  5IP9 G;  5KYI A;  1X65 A;  1PRT F;  3J81 j;  4JBW A;  4DR5 L;  5C4X G;  4NPS A;  5FLX L;  4IOC A;  1GUS A;  5C5L A;  1NMG A;  3PF4 A;  4GN3 B;  5HGT A;  2CFM A;  4KK7 A;  3PIO A;  1YI2 A;  2NN6 G;  1QNU A;  3ER0 A;  5CV9 A;  2CH4 A;  3NEM A;  3FPP A;  1Q8K A;  2KCM A;  1WTW A;  1B8A A;  3R93 A;  1DOL A;  5JPM C;  4X65 Q;  1RTN A;  4DFA A;  4JPB W;  2PQA A;  2Y0S G;  3I8Z A;  3J7Z C;  2DY8 A;  1EQQ A;  2M00 A;  2G9D A;  4JI3 Q;  1Q1E A;  4I65 A;  5EKL A;  4DPG A;  1B44 D;  4JG2 A;  4HIO A;  5CBE E;  3VA5 A;  4FXG C;  3DWP A;  5JJI A;  1STY A;  4IFD J;  2Z4H A;  4GOP C;  3HOX B;  3HOV G;  4IUQ A;  1NE3 A;  3D6W A;  5EPK A;  1NY4 A;  1PZI D;  3MTS A;  3PUX A;  3PGZ A;  1Y1W H;  2N8N A;  3NBI A;  4HIK A;  4JI0 Q;  2HDL A;  4PMC A;  1X3P A;  3DWA A;  4C3H B;  1JB7 A;  3PSI A;  4RCN A;  4K8J A;  1KD1 C;  4DAV A;  1QVG A;  1HUN A;  2ZXP A;  2B2V A;  1XMQ Q;  1EIG A;  1PYS B;  1CZG A;  3ERQ A;  5M3M H;  1U4R A;  4N8X 1;  3MXN B;  1A0I A;  1S5E D;  3G7L A;  2B2T C;  5K36 G;  4K0K L;  4RHS A;  4QUF A;  1Q81 C;  3I4M G;  3OTO L;  3RN5 A;  1JOK A;  1NNX A;  2YYZ A;  4HJA A;  2JP1 A;  1Y8N B;  3X3M A;  2MP1 A;  2J7Z A;  1L0W A;  2AMC B;  1U0L A;  4UAI A;  4F7X A;  3JAM E;  3R8B A;  2IHF A;  1WTP A;  1C0A A;  3IL8 A;  4K2K A;  3TDQ A;  5M5W H;  2HDM A;  1V1O A;  1LT5 D;  3KLR A;  4RCO A;  2OXP A;  1VQH A;  2F0G A;  1E2W A;  3O13 A;  3OIP A;  3A56 A;  1CZW A;  2B2U C;  5C0X J;  3U58 A;  3HOX H;  3HP3 A;  4RGM A;  1GJX A;  4Y7N B;  1N34 Q;  2E2J H;  1CFM A;  4RGT A;  4R8I A;  5IT9 c;  4KKT A;  3CRK C;  1HNX Q;  4FVM A;  2BA1 A;  5IYC H;  5IWA L;  1E3P A;  2ES2 A;  2EYO A;  1FNV A;  3TEH B;  2XRQ D;  2JA8 B;  4O1N A;  2PW7 A;  3NPP A;  1TT2 A;  4A93 B;  4K2L A;  4LF9 L;  3E9I A;  1I50 B;  1A8V A;  5C3X A;  4OIK A;  1G91 A;  1X56 A;  2X6L A;  4TQU S;  4DGZ A;  3KF6 B;  3J7A 5;  4ODG A;  4WFN 3;  3C3L A;  1LAB A;  5CV5 A;  4JI3 L;  2K33 A;  1NBW A;  2MPM A;  5IYD H;  1H9M A;  1P8L A;  4JOI C;  3FEW X;  1BF4 A;  3GTP H;  5CR3 A;  1WTR A;  1SBB B;  1K8G A;  2HIV A;  3S17 H;  3OSO A;  2EDG A;  2WKD A;  1J6Q A;  4UP9 A;  2VQE L;  1ET6 A;  3UDF A;  4K5X A;  1K83 H;  4NMZ A;  3ONA B;  2QDL A;  3OPO A;  3SK6 A;  4M1U B;  2NVQ H;  4XT1 B;  2WAQ E;  4DV0 Q;  4KJN A;  2P5Z X;  2A74 C;  2VL6 A;  2F0W A;  4DXF A;  2G5D A;  4RGO S;  1I6H H;  2E2H B;  3CKI B;  4KHP Q;  2LXK A;  1G8Z D;  1T5X D;  2KUM A;  1E1T A;  3Q6S A;  1SE4 A;  2FJ2 A;  2KEC A;  3PO3 B;  1SXT A;  1VMP A;  1ET9 A;  1RL2 A;  1VF7 A;  4JI8 Q;  3R2I A;  3NP8 A;  3NBH B;  4FYD A;  3I4N G;  2GVB A;  4F88 A;  2YTV A;  3G71 A;  3CCR A;  4P74 A;  4DK6 C;  3PF5 A;  3CQZ H;  1IXR A;  4FO2 A;  4DUY L;  1UAP A;  5D14 A;  2F0L A;  4X3T A;  2Z0S A;  4A3I G;  3T1H Q;  1QNK A;  1OXX K;  1EFI D;  4GNX B;  3C1F A;  2E76 C;  1JJ2 A;  4K6L A;  1EEF D;  4A3B B;  4X66 L;  1AFP A;  2N78 A;  4A3I B;  1I4P A;  2JA6 H;  2CW0 D;  1FNU A;  4XT3 B;  3F8T A;  3T56 B;  1I94 Q;  4GKJ L;  2KED A;  1EWC A;  2PI2 A;  1HNX L;  1QCB D;  4A3J B;  2NUC A;  1UE6 A;  3Q0A A;  3F2B A;  2AWN A;  4HSP A;  2B29 A;  5J1Z A;  2IW3 A;  3GQB A;  1BCP F;  5C44 B;  5C4Z A;  1F9P A;  4KD3 A;  5M3F H;  2JN4 A;  1QUQ B;  2PQE A;  4EQN A;  1KIX A;  1X9N A;  4QQB X;  1EZ6 A;  4NXM Q;  4DV3 L;  1JWU D;  2XTI A;  1R9T B;  1C48 A;  4DV6 Q;  1GM5 A;  4GS3 A;  1AH9 A;  3CCS A;  1A15 A;  4NXN L;  1V43 A;  1GO3 E;  2F3I A;  3UI2 A;  3TBI B;  1EYC A;  1VQ9 A;  3HRZ C;  4A3E G;  1HPC A;  1U4M A;  1QB5 D;  3BVZ A;  1PV4 A;  4NXN Q;  4H02 A;  4QL5 A;  4GNX C;  4LFC L;  3IRB A;  1KRS A;  1E22 A;  1TS4 A;  1LT6 D;  5I4D A;  4G7O C;  2F52 A;  4IN3 A;  2AQ1 B;  3NQT A;  1KAB A;  1VQJ A;  2KHS A;  3NTH A;  1NTG A;  4K8I A;  3ULJ A;  1TII D;  3A5Z B;  3HOV H;  2K03 A;  3MEF A;  5E7N A;  4P2C B;  1XNR L;  2HQL A;  1PTO D;  2UUB L;  4HAE A;  2AUJ D;  3PUV A;  4CDF C;  2MQH A;  4PNY A;  1SNM A;  1R4Q B;  5IYB G;  1LO5 D;  4F87 A;  3P20 A;  1Q7Y C;  3M4Q A;  4A3E H;  3RD4 A;  1X3Q A;  1IW7 C;  4IFD G;  3PUZ A;  5I2X A;  3MXU A;  4HID A;  2ATW A;  3RZD H;  3K57 A;  4K6D A;  2RSN A;  4JI6 L;  3GTG B;  1Y1V H;  4C2M H;  1CKN B;  4ZKB B;  3VYR A;  5DNF A;  1Y1W G;  2K28 A;  4A3L H;  3F2U A;  3F1Z A;  2RDF A;  3U50 C;  2JA8 G;  4S3S A;  1SMY C;  2K5D A;  2IHE A;  3HOZ B;  3CAM A;  3FKI H;  4GLA C;  2UXD L;  2A1A A;  2OQ0 A;  5CC4 A;  3UDG A;  2K7V A;  2L12 A;  3A8J E;  1SDF A;  3QB3 A;  2NN6 I;  4HMI A;  2ZM6 L;  2CQO A;  1CHP D;  5IGB A;  2K01 A;  2Q2I A;  1KQS A;  3G6J B;  4WRD A;  3KDF B;  3QG1 A;  1JMC A;  1LV9 A;  4EVO A;  4DAM A;  5A35 A;  3BDL A;  1S5B D;  5C4J H;  2ASB A;  1YNN D;  5TSS A;  4I7Z C;  2R7Z B;  2K52 A;  5CV6 A;  3NTK A;  2F0V A;  2HD3 A;  1XTD A;  2R7Z H;  2NBF A;  2N3S A;  2HQE A;  3HOZ G;  3KJP A;  4B9X A;  1LTT D;  3J80 c;  3M4O B;  4ZQ3 A;  1PHJ A;  3SK4 A;  2F0D A;  1KDC A;  3IAY A;  4L5R C;  4DR1 L;  2MNA A;  2NTT A;  1DZ1 A;  2E2J B;  2Q8R E;  4YCW A;  5AJ3 L;  4C3H H;  3MZ5 A;  4OEM B;  1SRO A;  2K14 A;  3Q22 A;  2EYF A;  5ELN A;  4CJ0 B;  1HZC A;  1J8I A;  4HCS A;  2KCC A;  4DUZ Q;  4FF3 A;  4Y52 H;  1NAP A;  1X3F A;  1L0X B;  5EKI A;  3PO2 H;  5CMD A;  3PUY A;  1IL8 A;  1PTO H;  3EIV A;  3J81 E;  1B3A A;  3HS0 C;  1CA5 A;  1JOO A;  2OWO A;  2UU9 Q;  4QIW E;  4RHR A;  4DV7 Q;  2IY5 B;  1I3Q H;  5FOB B;  1SJH D;  3VA7 A;  4X64 Q;  4GOP A;  4UPA A;  3C1E A;  1PDQ A;  5GRO A;  3TRE A;  3GTL B;  5IGC A;  5C3E G;  2A6E C;  3CCU A;  3HOW G;  3S14 B;  1MBY A;  4B3S Q;  2ICI A;  2DY7 A;  4HTH A;  2Z4I A;  4YHH Q;  1PFS A;  2LMC B;  2R3Z A;  4C3J B;  1A3T A;  1LT4 D;  2JA9 A;  3HGB A;  2PYK A;  1B53 A;  3T1Y Q;  2XWB B;  1WCM G;  3L0O A;  4Z9C B;  2BA0 A;  2NTS A;  2OQK A;  4QB4 A;  5C4X B;  1JC7 A;  4C3I G;  2VB2 X;  3UDX A;  2MJ8 A;  2JA5 G;  1LTA D;  3BJU A;  5KND A;  2UUC Q;  4LWC A;  1EWH A;  5DM7 3;  2UXD Q;  3DXJ C;  1QZH A;  4LF6 L;  4KN7 C;  1BCP C;  3OW7 A;  2FIN B;  2RDG A;  4OO1 H;  5C44 H;  3J7Y W;  2A19 A;  1HQR D;  2VQF Q;  1PXU A;  2K5W A;  4JK1 C;  4E6I A;  1O7L A;  1EOV A;  4L5T A;  4APV A;  2N55 A;  4DV2 Q;  1WOC A;  1TU2 B;  3RLN A;  5M5W B;  2VB3 X;  1XJV A;  1PFM A;  3S15 B;  2DNE A;  4UP7 A;  1KNA A;  1C8C A;  4HJ7 A;  1TWH H;  4BS9 A;  4BBR H;  4BY1 B;  5IP7 H;  1IBM L;  3HKZ B;  3E0E A;  5LHY 1;  4DF7 A;  5IGE A;  2JA5 B;  5M5X H;  2ZTE A;  4C3H G;  3S1Q B;  4POG A;  1PH6 A;  1IBL Q;  5K36 H;  2CKZ B;  2A8V A;  1SEB D;  2B2Y A;  2NZO A;  4NB3 A;  1ENC A;  5IWA Q;  1IKM A;  2RQX A;  3MEH A;  1EQV A;  3GTJ H;  3QO2 A;  4PQX A;  4POF A;  2KJX A;  1I4Q A;  2AQ2 B;  4CDD C;  4TVA B;  3I2Z A;  4YCV A;  2JA7 G;  1BNZ A;  1B50 A;  2OCE A;  4G7H C;  2NVT B;  1HNW L;  3MC0 B;  1SYE A;  2L55 A;  1S72 A;  3S2D H;  5IT9 E;  1Y1V B;  3WOF A;  5LMU L;  2EYL A;  1GVP A;  3QIA A;  1PH5 A;  5JJZ A;  3D4W A;  4G57 A;  2PCF B;  1KDA A;  1U4L A;  1LTL A;  4MN3 A;  5IYD G;  1MHW C;  1EYG A;  1KDB A;  1SMY D;  1W2B A;  5E3F A;  2PZW A;  2DNC A;  2X6G A;  1Q3L A;  3JC6 6;  3CME A;  1WTX A;  4XYQ A;  5GAD C;  4NXM L;  1B4O A;  5M3F G;  2AKW B;  3H3V I;  3CCQ A;  1V8Q A;  1M4V A;  2VUM B;  4N8F A;  1J5E L;  3K0X A;  1ZKO A;  5FKA C;  4CKC A;  4CKE A;  1IW7 D;  2I46 A;  3AU7 A;  1PTO F;  2JA5 H;  3CCV A;  5T1I A;  2I07 B;  4QY7 A;  5FJ8 H;  1HXY D;  4JI4 Q;  2PO4 A;  4MTN A;  1P16 A;  3GTQ H;  1XNQ L;  4YY3 L;  1SNC A;  1Q86 C;  2D62 A;  2VS1 A;  2XIW A;  3GD7 A;  2WAC A;  1SYF A;  1A2T A;  1VQF A;  5ELD A;  4DV5 Q;  2A6E D;  5ISR A;  1TWG H;  3F2C A;  4ZCK A;  1XMO Q;  1YHA A;  4B08 A;  4HIM A;  1R9T H;  5LMN L;  4X3K A;  2R7Z G;  3HOZ H;  2E2I B;  4DR4 Q;  1YHQ A;  3H0G B;  4KTA A;  1XTC D;  3KUP A;  1J9O A;  1O7Y A;  3LX0 A;  1S5C D;  3CP0 A;  4YY3 Q;  2UUA Q;  3CPW A;  2LXJ A;  4C3J H;  4DV1 L;  3LWE A;  3M3Y B;  5A2Q L;  2DUD A;  1LYL A;  1BCP D;  1OXS C;  1H9J A;  2BH2 A;  4DV0 L;  2RCN A;  2TSS A;  1PH1 A;  4DR6 L;  3VR4 A;  4A3B H;  1VS0 A;  3KLS A;  1HHV A;  1BOS A;  1A3V A;  1PZJ D;  3SDZ A;  1TWA H;  3OOC A;  1STN A;  3H15 A;  2KQ3 A;  3KFU A;  2NVY B;  2IL8 A;  1VCI A;  2N88 A;  2Z6B A;  3S2H B;  2UXB Q;  4ZLT F;  1ENA A;  3NHH A;  1A6X A;  1SYB A;  1K0S A;  4AH6 A;  3VYU A;  3D4D A;  4TKO B;  5C0X H;  4ME5 A;  1TXY A;  3LNN A;  2BOS A;  1RF2 D;  3SE0 A;  3IKJ A;  1JE5 A;  1EWI A;  5CYU A;  3NWT A;  4RA8 A;  4A3D H;  4B3R L;  3FPU B;  4A3J G;  4JVZ A;  4DR3 L;  3E3X A;  2F0S A;  4C1N K;  1VQE A;  1JT8 A;  1SFO B;  2K1B A;  3T13 A;  1Y69 U;  1LTR D;  4DK0 A;  1D1I A;  2YTY A;  4C3J G;  5C44 G;  3S1M H;  3P7J A;  3GTQ B;  2KEE A;  2EXZ A;  2PI2 E;  4N9P A;  4U67 3;  3CMA A;  4JBJ A;  1M90 C;  4IPC A;  2K4K A;  4C3I H;  5BR8 Q;  3S1N B;  1SAP A;  2J4X A;  2Z9H A;  5E1F A;  4O0A A;  5I2Y A;  3KJO A;  1UEB A;  2ZTC A;  3TP8 A;  1GUW A;  1PFB A;  1SND A;  1C4Q A;  4J8Q A;  5F2D A;  2RHS B;  4A3K G;  2EVB A;  1TWA B;  1TVX A;  1UNS A;  2MUY A;  2KA7 A;  5IYC G;  4IJL A;  1LTB D;  1HZ9 A;  4X62 Q;  4LMQ D;  2HCI A;  3OMG A;  4RFB A;  5M5Y H;  2TMP A;  4ZUI A;  3BDO A;  3TP6 A;  1SE3 A;  1VQN A;  2NWG A;  1EIH A;  4RAU C;  1K8O A;  3OTO Q;  1Q12 A;  1QG7 A;  1EY7 A;  5G3L F;  4EQ5 A;  1YNN C;  5EGT A;  2B2T A;  3SXH A;  3OMC A;  4DR6 Q;  3G48 A;  1IBK Q;  3K5N A;  1TR5 A;  3GO5 A;  3TS2 A;  1EY8 A;  5EPL A;  5KNC A;  5GAH C;  1TWC B;  4AQY L;  4JI7 Q;  1CT1 D;  1BKB A;  1LAC A;  1EQR A;  4DV1 Q;  4HSV A;  4LF8 L;  3GTM H;  1Y1V G;  4JI1 L;  2SDF A;  4DK3 C;  5IP9 H;  1AE3 A;  1F2M A;  2KCN A;  1N36 Q;  1PRT B;  1Z9F A;  3A54 A;  1VQD A;  2VZA A;  4LUZ A;  3V2T A;  2PPB C;  4WJ4 A;  1O78 A;  3ND8 A;  4LK1 C;  1TY2 A;  4MTK A;  2F0N A;  1GUO A;  3I73 A;  4PMW A;  2F1M A;  3GTK B;  4OXP A;  2NZH A;  2R92 G;  4JCV E;  3MWY W;  3D3R A;  5FLX E;  1EY6 A;  4GLV B;  2R93 H;  4FXK C;  1MD2 D;  2F4V L;  3FMC A;  1DXM A;  1VQP A;  2Q2U A;  1WFQ A;  2F0J A;  4JI2 Q;  1ZYR D;  3P75 A;  2WB1 B;  2G9H D;  4FF1 A;  2RHQ B;  1G29 1;  3NSW A;  1Q90 A;  4B9W A;  4X3U A;  3TS0 A;  1OXU A;  1N8R C;  1QUQ A;  3SHL A;  3M3Y H;  3HOY G;  4BY7 H;  1H95 A;  4R4I A;  4FP5 D;  1K8A C;  3GTO H;  1ESF A;  4R4Q A;  3S1N H;  1FNW A;  5I6Y A;  4A4I A;  1X3E A;  5JJL A;  4B3T Q;  2EIF A;  1YNJ D;  2LY7 A;  5C0X G;  3HFZ B;  4BBR G;  3VDY A;  1AE2 A;  4DR7 Q;  3J81 i;  3T4A C;  1DJR D;  2CH4 W;  3PQI A;  4UHV A;  3J81 c;  4IUV A;  3H0G G;  4JV5 L;  2A69 C;  2A6H D;  1DGS A;  2A73 B;  4GNX A;  4J15 A;  1IHZ A;  2QEX A;  4NKL A;  2E2D C;  4DR7 L;  2E8G A;  5LMU Q;  2V1C C;  3S14 H;  2UXC L;  1L2F A;  2CWP A;  1VQ8 A;  1QE6 A;  1W6K A;  3RMH A;  2R93 B;  2EYJ A;  2H5X A;  5EPJ A;  2E5L Q;  1QJO A;  3U4Z A;  5IE8 A;  1EIF A;  1YIJ A;  2I0Q A;  2PMZ E;  2ZJR A;  3VYT A;  2YU9 B;  1ASZ A;  1PTO B;  4LF7 L;  2GA4 B;  2ICE C;  1E0B A;  1TS3 A;  2D0O A;  5G3L D;  1F9S A;  1HJP A;  5IY0 A;  2CCZ A;  1IBL L;  2WB1 E;  2R7D A;  4C1N I;  4EQO A;  4O2D A;  3QOJ A;  3S15 H;  1I4G A;  3GTK H;  4G7Z C;  1VQC A;  5BN5 A;  1JCK B;  3RZO H;  2UXC Q;  3BS1 A;  1GUG A;  3BZD B;  1SSO A;  2I5L X;  4KMU C;  2NVX H;  2KVM A;  3PCO B;  4R4C A;  1K3B C;  4DV2 L;  1XYI A;  5H1S E;  4EQP A;  4JI5 Q;  1YNX A;  4DR2 L;  1YVC A;  1HZB A;  3A8I E;  1N32 L;  2GVA A;  3TSS A;  3M9B A;  3RR5 A;  2L11 A;  1MIU A;  4F8M A;  2B2W A;  2D9U A;  1RHP A;  1H9R A;  4UDU C;  1IYU A;  4JI4 L;  2C9O A;  4K14 A;  3BVM A;  3I7F A;  4XQJ A;  3K81 C;  4IUN A;  1B2T A;  1VQ4 A;  1UUP A;  1PYB A;  1ROD A;  1ZEQ X;  4A3K B;  1L1O C;  4UP8 A;  1YHB A;  4B3T L;  1IBK L;  2O5I C;  3DHQ A;  3HOX G;  2WV6 D;  1OXV A;  2FXQ A;  3QR8 A;  4R9W A;  5E4X A;  2ZTD A;  1V1Q A;  4CHT B;  1ML0 D;  1S3O A;  3I3C A;  1AZQ A;  1TY0 A;  2F0P A;  1Y8P B;  2D2C C;  2OEO A;  2Q2H A;  3DLL A;  3TQY A;  3CCL A;  1MSG A;  4LFA L;  2H1E A;  3D8G A;  1PH2 A;  3HKZ G;  3TZU A;  1K3R A;  4OON A;  4JI2 L;  5I6W A;  1EY9 A;  4DV6 L;  1R4P B;  2F4V Q;  2O5J C;  4X64 L;  1HCZ A;  3L9A X;  3M7G A;  3A7A B;  4IJH A;  1PH4 A;  2JA7 H;  1M8A A;  2RCF A;  2JQO A;  3L2P A;  3M7N A;  1CSP A;  3T53 B;  1SJE D;  3X3N A;  2JK8 A;  5KIX A;  3PIP 3;  2ZT9 C;  1BBU A;  2E74 C;  3GTM B;  1JB3 A;  2Y0S B;  2BDO A;  2K32 A;  2QW7 A;  3SK5 A;  3CHB D;  2V4D A;  1AEX A;  2E2H H;  3BYY B;  4IUT A;  4OWT B;  1V9P A;  3K7A B;  1NMF A;  2D5D A;  1WTH A;  1M1K C;  2LSS A;  3E6Z X;  1JWS D;  4ZAI A;  2RF4 A;  4B3R Q;  4AQY Q;  1VQ5 A;  4JI7 L;  2FHT A;  2ENB A;  3OHX C;  4RGN A;  4A3E B;  1EQT A;  4ZUJ A;  4B3M Q;  1LTI D;  2F0Q A;  1S5D D;  2JYO A;  4AYB B;  3CF5 A;  2KBN A;  4HN7 A;  4TRD A;  1L0Y B;  1STH A;  3QOL A;  4LF5 Q;  1W3S A;  2UXB L;  3I72 A;  1I3Q B;  4LF4 Q;  3AEV A;  4JV5 Q;  5FO9 B;  2VQF L;  1VQ7 A;  4YWM A;  3S1Q H;  1N32 Q;  2MFI A;  4LUO A;  3S1R B;  1TWH B;  1STA A;  4LF4 L;  3Q24 A;  4RKL A;  1F9Q A;  3TZD A;  4LF5 L;  1VQB A;  2BE5 D;  2K6A A;  2R92 B;  2M9V A;  1LUZ A;  3S16 H;  2DJF C;  4H44 C;  1C9O A;  3FP9 A;  4A93 G;  3S24 A;  3CCE A;  4ZRZ A;  4B3M L;  4L5Q A;  2L15 A;  1ASY A;  3AYH B;  2KHI A;  2XVS A;  2LKV A;  2R6G A;  1NR2 A;  3H3V C;  1HQM C;  2OT2 A;  3R2T A;  1CQF A;  3MXN A;  4QIW B;  3D4R A;  1D5Z C;  3ULL A;  4X3S A;  3A7L A;  3I4M H;  3J7A V;  1YJ9 A;  1H9K A;  3CC4 A;  5FO8 B;  4IPD A;  5HGQ A;  2QIL A;  1HUM A;  4DR2 Q;  5M3F B;  3HOY H;  1UE1 A;  1VQK A;  1EL0 A;  4PMB A;  1HA6 A;  3PV0 A;  2WIN B;  1D1K A;  2R61 A;  5EBD A;  1SE2 A;  3URY A;  1XMO L;  5T1G A;  3LWU A;  1CKN A;  1KTK A;  2RVL A;  2XSC A;  2MO0 A;  5FJ8 G;  3KK7 A;  4K5V A;  3I90 A;  2L4N A;  3FHW A;  4RG1 A;  1RCV D;  2FMM A;  4LAA A;  1L1O B;  1X6O A;  3KOJ A;  3CQZ B;  1X32 A;  3GV3 A;  4WOR A;  2A68 D;  2EQS A;  3E5S A;  5CV4 A;  4NDX A;  1AP0 A;  4IZ8 A;  5EJW A;  4HMJ A;  2Z1C A;  4A3F H;  5ELF A;  3SEB A;  2HIX A;  1A3U A;  2PQA B;  1KAA A;  1VQO A;  5KNB A;  1PTO C;  3CPF A;  2QF7 A;  1PYW D;  2R7F A;  5EKK A;  1TKW B;  3HG9 A;  4OGQ C;  3KBG A;  1B7Y B;  5ELO A;  3A8K E;  1WTQ A;  1FJG Q;  1QWY A;  1TWF B;  3G4S A;  1DOM A;  2WAQ B;  1O7Z A;  2NB0 A;  3ERS X;  4JBK A;  4A3G G;  2WII B;  2A5H A;  4KD4 A;  4DR1 Q;  3A0J A;  3J80 i;  1KAW A;  3H6M A;  1BXT A;  3KDF A;  1T5E A;  2BE5 C;  4JW0 A;  2NVT H;  2B8F A;  1VF5 C;  1SYD A;  2AUK A;  4DNI A;  1BR9 A;  3K5O A;  1WCM B;  1G2T A;  1E2V A;  4RKB A;  3PMF A;  1ZYR C;  2F0O A;  2Z8L A;  3K7U C;  3PIO 3;  3GTP B;  1NR4 A;  1A62 A;  1JJC B;  1WD1 A;  2B63 B;  5EQ0 A;  1HTP A;  2L0C A;  4DXG A;  2B8G A;  5BN4 A;  5IGG A;  1K9M C;  1Z7T A;  4V19 0;  2H4O A;  1VQA A;  4L63 B;  4MHE A;  3P1H A;  1ESR A;  2BH8 A;  5C3E B;  3HOU H;  3GTJ B;  1K73 C;  1GUT A;  1O7I A;  2M2L A;  4IPG A;  4A3M B;  4BA2 I;  1EYA A;  1YJN A;  3JAM L;  3JAM i;  1KHI A;  1SN8 A;  4H0L C;  4XQQ A;  1B1Z A;  2PW5 A;  1K8M A;  2Q2T A;  1G2S A;  1NJI C;  3K8A A;  3SGI A;  4IOA A;  5BN3 A;  1WVL A;  2B2W C;  1N9W A;  3OWF A;  1V1P A;  3K80 C;  2HUG A;  4A3C H;  4OO1 G;  1PMR A;  3NWS A;  4KJO A;  1CQV A;  2K5N A;  4Y7N H;  4OWW B;  4GN5 A;  2KEN A;  4CGY B;  1PH9 A;  4HCE A;  2I5M X;  3J7A F;  4IFD H;  1CHQ D;  1ENF A;  1F9R A;  3BVG A;  2IJ0 A;  3EA6 A;  2L5T A;  4Q0F A;  1SRU A;  3TME A;  1YBY A;  3I91 A;  5HUR A;  1MI2 A;  3K6O A;  4CDE C;  4FF2 A;  3GTG H;  1QVF A;  4BXX G;  2F0F A;  2PZT A;  3OWE B;  2OTJ A;  4AYB G;  1TWF H;  4YCU A;  3FDT A;  2PMZ B;  1XNR Q;  1H9S B;  4BY1 G;  1F2Z A;  1HA5 A;  3S16 B;  2UUC L;  4A3I H;  3NEL A;  4DAY A;  3S17 B;  3IFT A;  5C3E H;  3HOU B;  3FVQ A;  1G6Z A;  1D2B A;  2ZXR A;  2EZV A;  4L5S A;  3T1Y L;  2JA6 G;  3H09 A;  3MAQ A;  2VQE Q;  5AFW A;  5JJK A;  4OO1 I;  1AZP A;  2LFN A;  2CW0 C;  2IX3 A;  2VUM G;  1CUK A;  2JSO A;  3A55 A;  4R8N A;  2QGQ A;  4OIJ A;  4Q5V A;  1KL9 A;  1WCM H;  1RD9 D;  1RJT A;  2SEB D;  4DR3 Q;  2IPK D;  1STB A;  3EBE A;  2BDN A;  1LM0 A;  1CKO A;  2Y0S E;  3IFD A;  3EFX D;  2HHH Q;  1CI3 M;  1BUV T;  3RUZ A;  1ILQ A;  3PO3 H;  3KF6 A;  1SLJ A;  4DV7 L;  1FYC A;  1QOH A;  3ULP A;  1KC8 C;  2BCO A;  4JBM A;  5KEE A;  1K0R A;  4DV5 L;  2CQA A;  3ND9 A;  3OW2 A;  4FXD A;  1FGB D;  1LTG D;  3BZC A;  4L8J A;  1EIY B;  3HEJ A;  3AQQ A;  4LFA Q;  3PIP A;  4C56 C;  2C35 B;  3CC2 A;  1BDO A;  2VNU D;  4FDB A;  2E5L L;  4A3F B;  4X66 Q;  2R92 H;  2WKC A;  1MJE A;  1IYJ B;  1PVO A;  2K75 A;  4IUP A;  2YU9 H;  3KF8 A;  5AJ3 Q;  5EAY A;  2CHB D;  3M4P A;  3MFG A;  1HZA A;  4RWS C;  1HNZ Q;  4A3J H;  4UY8 C;  1I4X A;  5DM6 3;  1XX8 A;  2X69 A;  1SYC A;  5JAV A;  3WWV A;  1IL2 A;  2YV5 A;  2D0P A;  2UUA L;  3H91 A;  3UE0 A;  2AQ3 B;  1U5K A;  1I50 H;  2F0H A;  1B3Q A;  4R1J A;  3VYS A;  2A68 C;  3CCM A;  3B6Y A;  2Z6K A;  4GKK L;  2A6H C;  1ICF B;  2EJM A;  5C6A A;  2JA8 H;  2WAQ G;  2DN8 A;  5DAU A;  3T16 A;  1FL0 A;  4DK1 A;  1JJG A;  3PUW A;  4XXE A;  3TP7 A;  2JE6 I;  5A2Q E;  3E0J A;  5FK9 C;  5C5M A;  1D6E C;  2SNM A;  2B63 H;  4LFB L;  3CXC A;  1TS5 A;  2WFW A;  3C2P A;  1CM9 A;  1CKM A;  1I5F A;  3W1B A;  4A3D B;  4PZ8 A;  1B9N A;  2ZM6 Q;  1V1P B;  1FD7 D;  1I4R A;  3FKI B;  1BQQ T;  3I56 A;  1EFW A;  1BVS A;  1UEA B;  4HJ5 A;  4QGU A;  1LT3 D;  1EY5 A;  4LF7 Q;  1FR3 A;  2FMC A;  3E9H A;  2CWA A;  4BY7 B;  5ELB A;  4CJ2 C;  4KLK A;  1II3 A;  1I6H B;  5K5P A;  3S2H H;  3N52 A;  1UWV A;  1VQM A;  3JAM c;  4A75 A;  1N33 L;  3AFQ A;  3GV6 A;  1EY0 A;  3TRZ A;  1EU3 A;  4NW2 A;  4P73 A;  2OTL A;  2EY2 A;  1WYD A;  3TP5 A;  1XPU A;  4LFB Q;  3M4O H;  1Y8O B;  3NE5 B;  2L9H A;  5HY6 A;  3CCJ A;  3BG3 A;  5GAG C;  3OYY A;  4KHV A;  4ZK9 B;  5IT9 L;  1NSN S;  4FNF A;  4K5W A;  1OXT A;  5NUC A;  1UE5 A;  1I6V C;  4TSS A;  3R3O A;  2ZJQ A;  5KRU A;  1IYV A;  4J6H A;  3K7A H;  3CRL C;  5M5X B;  3W2D A;  4LF8 Q;  3Q8D A;  3KLW A;  2YTX A;  1HRJ A;  4A76 A;  4FF4 A;  1DCZ A;  1VQ6 A;  3M85 A;  5M3M G;  1HNZ L;  3D6C A;  5JEA G;  2DJG C;  3VR5 A;  1RIP A;  4I7A A;  4AYB E;  4MIU A;  1J5E Q;  4QCL A;  3Q23 A;  5FLM H;  1SYG A;  1SNO A;  1D5M C;  5KGU A;  1PFN A;  1FVI A;  4J1M A;  4ILW A;  1D8L A;  4PG3 A;  1JQY D;  4R4T A;  1XPO A;  4LJZ C;  2F0I A;  4KY7 A;  4PZ6 A;  1TWG B;  3SR1 A;  5C4X H;  2JJQ A;  4NP5 A;  5M9O A;  3RLO A;  1EY4 A;  1JWM D;  1DM0 B;  2XWJ B;  1LTS D;  2N49 A;  3KYH C;  1PH7 A;  2OF1 A;  2SOB A;  2EOT A;  1KLG D;  5LMN Q;  4DV3 Q;  1S4Z A;  4JI6 Q;  4OWX B;  1STE A;  2F0M A;  2NZ1 D;  1HNW Q;  2MGS A;  2DGY A;  4P71 A;  1GUN A;  1Q46 A;  5IOD A;  2CVR A;  3VR3 A;  1PA6 A;  1AW7 A;  1IZ6 A;  1KNE A;  1E1O A;  3BYT B;  5IGD A;  1SNQ A;  1XMQ L;  1WD0 A;  2F4I A;  2J0T D;  1G6P A;  2JA6 B;  3HOV B;  1OO9 B;  1G51 A;  3M4Y A;  4JI1 Q;  2IWH A;  3GDE A;  4LF6 Q;  3KBX A;  4H13 C;  4JOI A;  4PZ7 A;  1WTO A;  5LL6 S;  3PO2 G;  4G4K A;  4IPH A;  4KV6 A;  1MSH A;  1CTM A;  3K0Y A;  4BXX H;  1PRT D;  1RTO A;  2F0T A;  3W5O A;  1D7Q A;  5DLQ E;  3F2D A;  1YNJ C;  3I4M B;  3PO2 B;  2QKI C;  1IBM Q;  1JE4 A;  4KI0 A;  4GOP B;  4GLX A;  3EN2 A;  3I4L A;  1SMX A;  3V96 A;  3G6E A;  3NTI A;  2EJF C;  1DOK A;  3RZD B;  3L3O C;  5LMN W;  3UDI A;  5GQO A;  4IO9 A;  5IIF A;  2EXD A;  3D31 A;  2B2V C;  5ELE A;  2HT1 A;  2EYM A;  4B3S L;  4X62 L;  2PNH A;  5JPN C;  1VMC A;  1SE8 A;  3U9S A;  4YIJ A;  5C4H A;  5D65 A;  3W3A A;  5J3B A;  3AB9 A;  4JI5 L;  3S1R H;  5JOB A;  1GXD C;  4KHP L;  2JA7 B;  2WP8 J;  1EU4 A;  1YEZ A;  1BCP B;  1B70 B;  1GD7 A;  2KHJ A;  4MZ9 A;  2F0U A;  4IUR A;  5JEA H;  5GAE C;  2KCT A;  1K83 B;  1XWE A;  3ZYY X;  2QCP X;  4MNO A;  1PH8 A;  4N9T A;  4HED A;  2GN5 A;  2VXW A;  3CU7 A;  2JXM B;  1X3G A;  1QIL A;  3NQI A;  4ULL A;  3DMU A;  4R4O A;  1GKH A;  4AIM A;  2B39 A;  1YZ6 A;  1KRT A;  2F03 A;  1D5X C;  4DUZ L;  2VY3 A;  4A3M H;  2Q8I B;  1KLU D;  1X55 A;  4XYO A;  5C4J B;  2KOL A;  3STB C;  3HOY B;  4RH6 A;  2JEB I;  4WJ3 M;  1E7Z A;  1C7Y A;  4A3F G;  3L7Z C;  2VW9 A;  2ZJP A;  4CKB A;  1Q82 C;  1MJC A;  4GN4 B;  5JVH 3;  3N6R A;  3MA2 B;  4A93 H;  4BBS B;  3A74 A;  1LLR D;  1HR0 W;  4LF9 Q;  1QZG A;  4O42 A;  3I4O A;  1K28 A;  4EX5 A;  5CV7 A;  2K04 A;  4DUY Q;  1VQG A;  1B9M A;  4ZYS A;  3H3V H;  4OL7 A;  2EJG C;  3GTO B;  3DWQ A;  4C2M B;  1Q1B A;  2MO1 A;  3STB D;  1U9R A;  3MFY A;  1TS2 A;  2Z6K C;  3KLS X;  1GOZ A;  4OEL B;  1A63 A;  2NVQ B;  4H7B A;  5D3I B;  3MHB A;  3I4N H;  3DEP A;  2O4X A;  3ZJY C;  5C0X I;  1FJG L;  2ZXO A;  3NK9 A;  1PLF A;  3BDC A;  4PV1 C;  5JEA J;  2PNR C;  5IOC A;  3GP7 A;  4RMF A;  3RNU A;  4OX9 L;  4YWL A;  5M3M B;  4BY7 G;  1DON A;  4EGV A;  5E4W C;  2A69 D;  3DM1 A;  1SR3 A;  1WJJ A;  2EYH A;  3FRP B;  3AMU A;  1BO0 A;  2XRS D;  2QEJ C;  5LL6 X;  4C3I B;  2F0K A;  4BY1 H;  4WJW A;  4BA1 I;  3NXW A;  5J39 A;  4A3B G;  2C5C A;  2RDH A;  5IGF A;  4A3G H;  2F3W A;  4CDC C;  1STG A;  3K5M A;  4DAP A;  2IX1 A;  4BWG B;  3U4V A;  2XNA C;  1ICW A;  3ITP A;  2O2L D;  3HKS A;  4HR7 B;  5EBC A;  4CJ1 B;  3I55 A;  2JEA I;  1SFO H;  1ILP A;  1U4P A;  1N36 L;  3SK8 A;  1HR0 L;  3BU2 A;  4GKJ Q;  1XNQ Q;  4OHJ A;  3U9O A;  2UUB Q;  1HTL D;  3EVQ A;  3CW2 C;  3RLF A;  4KY6 A;  1Y14 B;  3DEO A;  4KKU A;  3KF8 B;  1Z6H A;  1HH2 P;  1PZK D;  4DV4 L;  3HOW B;  1CSQ A;  5COR A;  5CBA E;  4BBS H;  5FLX c;  5FLM G;  3TN2 A;  2EE1 A;  3ICE A;  2B3G A;  2FFK B;  4ABN A;  4IFD I;  2RKS A;  3EJI A;  1F2Y A;  1PH3 A;  4IAL A;  1YJW A;  3CC7 A;  1HFN A;  3MVV A;  2RSO A;  3OIQ A;  1NUC A;  2F0E A;  2K5Q A;  3VR6 A;  3GTL H;  4JI8 L;  4U68 A;  3QWN A;  4DN4 M;  1O80 A;  3NEN A;  4OX9 Q;  4DA2 A;  5IYB H;  3MXP A;  1WI5 A;  3MXG A;  4P75 A;  1DD2 A;  2K05 A;  1X54 A;  1S5F D;  1YIT A;  4K0K Q;  4V0B A;  4KY5 A;  1RDP D;  5BR8 L;  4HJ9 A;  4XDX A;  4JC0 A;  4XTC S;  3VR2 A;  3CD6 A;  3HZX A;  4P72 A;  1HFG A;  5FO7 B;  3A5U A;  2SNS A;  1JR0 D;  2I5H A;  4A3L G;  1JIC A;  1A2U A;  1VQI A;  3RZO B;  1F77 A;  1Y1W B;  1BBX C;  3DM3 A;  1CA6 A;  4YHH L;  3H94 A;  1BBW A;  4QUC A;  1I94 L;  1EEI D;  3LGJ A;  1EOT A;  3NBH A;  1ONL A;  4DAY B;  3K58 A;  3DUZ A;  1JOR A;  2NVY H;  3K5L A;  1XXG A;  3J80 L;  5C3W A;  5IP7 G;  4L6T B;  2K50 A;  1KXL A;  3HOU G;  2AHO B;  2WB1 G;  2F3V A;  2PZU A;  1GHJ A;  4JYA Q;  4BBR B;  1AN8 A;  1N33 Q;  2XGT A;  4DV4 Q;  3I70 A;  2EY5 A;  2EY1 A;  4CBV A;  2RBM A;  1NCV A;  4IQZ A;  1TQO A;  4ZKC B;  2L1B A;  5CV8 A;  3NUC A;  2MHV A;  1N34 L;  1HR0 Q;  3BZK A;  5JVG 3;  2LS0 1;  3C46 A;  2K5V A;  4QJF A;  4KHZ A; 
#chains in the Genus database with same CATH homology
 4DU9 A;  3S9W A;  2EY6 A;  3S1M B;  1RKN A;  4GZY C;  1I4H A;  5KYL A;  2EPB A;  1H9S A;  4DNR B;  2EYP A;  5I9O A;  4KKS A;  3T51 B;  2Q8T A;  2NVX B;  2IX0 A;  5CGK A;  2HCC A;  1EZ8 A;  3SVM A;  4A3G B;  5M5Y B;  1VDZ A;  1ZXT A;  1MGS A;  1GHK A;  3ERO A;  4XIG S;  1SNP A;  4M8A A;  1IKL A;  2RA4 A;  1PRT C;  1JOQ A;  3K59 A;  1W6J A;  5COY A;  1DYQ A;  3WOE A;  1Z47 A;  4QMG A;  2IT1 A;  1EYD A;  2AWO A;  4IUU A;  2E75 C;  4ID6 A;  2QDB A;  4QF4 A;  3J80 E;  3V05 A;  5ELC A;  3I4N B;  3EQL C;  2XN9 C;  2NN6 H;  1CK1 A;  3WDN A;  2B2U A;  2ID0 A;  3QJY A;  1F2L A;  5D3D A;  4DNT B;  5DEH A;  5I9P A;  3S2D B;  5J22 A;  2NYZ D;  1E2Z A;  2B2Y C;  1WTV A;  1Q8I A;  4KN4 C;  4XQN A;  3J81 L;  5KYI A;  1PRT F;  4JBW A;  5FLX L;  1GUS A;  5C5L A;  5HGT A;  4KK7 A;  2NN6 G;  1QNU A;  5CV9 A;  3FPP A;  1WTW A;  3R93 A;  1DOL A;  5JPM C;  1RTN A;  4DFA A;  3I8Z A;  2DY8 A;  2M00 A;  2G9D A;  1Q1E A;  4I65 A;  5EKL A;  1B44 D;  5CBE E;  3VA5 A;  4FXG C;  3DWP A;  1STY A;  4IFD J;  2Z4H A;  3HOX B;  4IUQ A;  3D6W A;  5EPK A;  1PZI D;  3MTS A;  3PUX A;  3NBI A;  2HDL A;  4PMC A;  1X3P A;  3DWA A;  4C3H B;  4RCN A;  4K8J A;  4DAV A;  1HUN A;  2ZXP A;  2B2V A;  1EIG A;  1CZG A;  3ERQ A;  1U4R A;  1S5E D;  3G7L A;  2B2T C;  5K36 G;  4RHS A;  4QUF A;  1JOK A;  2YYZ A;  2JP1 A;  1Y8N B;  3X3M A;  2MP1 A;  2J7Z A;  4UAI A;  4F7X A;  3JAM E;  3R8B A;  1WTP A;  3IL8 A;  4K2K A;  3TDQ A;  2HDM A;  1V1O A;  1LT5 D;  3KLR A;  4RCO A;  2OXP A;  2F0G A;  1E2W A;  3O13 A;  3OIP A;  3A56 A;  1CZW A;  2B2U C;  5C0X J;  3HP3 A;  4RGM A;  1GJX A;  4Y7N B;  1CFM A;  4RGT A;  4R8I A;  4KKT A;  3CRK C;  4FVM A;  2BA1 A;  2EYO A;  1FNV A;  2XRQ D;  2JA8 B;  4O1N A;  2PW7 A;  3NPP A;  1TT2 A;  4A93 B;  4K2L A;  1I50 B;  5C3X A;  4OIK A;  1G91 A;  2X6L A;  4TQU S;  4DGZ A;  4ODG A;  4WFN 3;  3C3L A;  1LAB A;  5CV5 A;  2K33 A;  2MPM A;  1H9M A;  3FEW X;  1BF4 A;  5CR3 A;  1WTR A;  1SBB B;  2WKD A;  2EDG A;  3OSO A;  1ET6 A;  4K5X A;  4NMZ A;  3ONA B;  3OPO A;  3SK6 A;  4M1U B;  4XT1 B;  4KJN A;  2A74 C;  2F0W A;  4DXF A;  4RGO S;  2E2H B;  3CKI B;  1G8Z D;  1T5X D;  2KUM A;  3Q6S A;  1SE4 A;  2FJ2 A;  2KEC A;  3PO3 B;  1SXT A;  1VMP A;  1ET9 A;  1VF7 A;  3R2I A;  3NP8 A;  4FYD A;  4F88 A;  4FO2 A;  1UAP A;  5D14 A;  2F0L A;  4X3T A;  1QNK A;  1OXX K;  1EFI D;  3C1F A;  2E76 C;  4K6L A;  1EEF D;  4A3B B;  1AFP A;  4A3I B;  1I4P A;  2CW0 D;  1FNU A;  4XT3 B;  3T56 B;  2KED A;  1EWC A;  1QCB D;  4A3J B;  2NUC A;  3Q0A A;  2AWN A;  4HSP A;  5J1Z A;  2IW3 A;  3GQB A;  1BCP F;  5C44 B;  5C4Z A;  1F9P A;  4KD3 A;  2PQE A;  4EQN A;  1EZ6 A;  1JWU D;  1R9T B;  1C48 A;  1A15 A;  1V43 A;  3UI2 A;  3TBI B;  1EYC A;  3HRZ C;  1HPC A;  1U4M A;  1QB5 D;  3BVZ A;  1TS4 A;  1LT6 D;  5I4D A;  4G7O C;  4IN3 A;  2AQ1 B;  3NQT A;  1KAB A;  2KHS A;  3NTH A;  4K8I A;  1TII D;  2K03 A;  4P2C B;  1PTO D;  4HAE A;  2AUJ D;  3PUV A;  4PNY A;  1SNM A;  1R4Q B;  1LO5 D;  4F87 A;  3P20 A;  3RD4 A;  1X3Q A;  1IW7 C;  4IFD G;  3PUZ A;  5I2X A;  3MXU A;  3K57 A;  4K6D A;  2RSN A;  3GTG B;  4ZKB B;  3VYR A;  5DNF A;  2K28 A;  3F2U A;  2RDF A;  4S3S A;  1SMY C;  2K5D A;  3HOZ B;  5CC4 A;  2K7V A;  2L12 A;  3A8J E;  1SDF A;  3QB3 A;  2NN6 I;  4HMI A;  1CHP D;  5IGB A;  2K01 A;  3G6J B;  4WRD A;  3QG1 A;  1LV9 A;  4EVO A;  5A35 A;  3BDL A;  1S5B D;  1YNN D;  5TSS A;  4I7Z C;  2R7Z B;  5CV6 A;  3NTK A;  2F0V A;  2NBF A;  2HQE A;  4B9X A;  1LTT D;  3M4O B;  4ZQ3 A;  3SK4 A;  2F0D A;  1KDC A;  3IAY A;  2NTT A;  1DZ1 A;  2E2J B;  2Q8R E;  3MZ5 A;  3Q22 A;  2EYF A;  4CJ0 B;  1J8I A;  4HCS A;  2KCC A;  4FF3 A;  1NAP A;  1L0X B;  5EKI A;  5CMD A;  3PUY A;  1IL8 A;  1PTO H;  3J81 E;  1B3A A;  3HS0 C;  1CA5 A;  1JOO A;  4RHR A;  5FOB B;  1SJH D;  3VA7 A;  3C1E A;  1PDQ A;  3GTL B;  5IGC A;  2A6E C;  3S14 B;  1MBY A;  2ICI A;  2DY7 A;  4HTH A;  2Z4I A;  2LMC B;  2R3Z A;  4C3J B;  1A3T A;  1LT4 D;  3HGB A;  2PYK A;  1B53 A;  2XWB B;  4Z9C B;  2BA0 A;  2NTS A;  4QB4 A;  5C4X B;  1JC7 A;  4C3I G;  2VB2 X;  2MJ8 A;  1LTA D;  5KND A;  1EWH A;  5DM7 3;  3DXJ C;  4KN7 C;  1BCP C;  3OW7 A;  2FIN B;  2RDG A;  4OO1 H;  3J7Y W;  1HQR D;  1PXU A;  2K5W A;  4JK1 C;  4E6I A;  1O7L A;  2N55 A;  1TU2 B;  5M5W B;  2VB3 X;  1PFM A;  3S15 B;  2DNE A;  1KNA A;  1C8C A;  4BS9 A;  4BY1 B;  3HKZ B;  5LHY 1;  4DF7 A;  5IGE A;  2JA5 B;  4C3H G;  3S1Q B;  5K36 H;  1SEB D;  2B2Y A;  1ENC A;  1IKM A;  2RQX A;  3MEH A;  1EQV A;  3QO2 A;  4PQX A;  2KJX A;  1I4Q A;  2AQ2 B;  1BNZ A;  1B50 A;  4G7H C;  2NVT B;  3MC0 B;  1SYE A;  2L55 A;  5IT9 E;  1Y1V B;  3WOF A;  2EYL A;  3QIA A;  5JJZ A;  3D4W A;  4G57 A;  2PCF B;  1KDA A;  1U4L A;  4MN3 A;  1KDB A;  1SMY D;  5E3F A;  2PZW A;  2DNC A;  2X6G A;  1Q3L A;  1WTX A;  4XYQ A;  1B4O A;  1V8Q A;  1M4V A;  2VUM B;  1ZKO A;  5FKA C;  4CKC A;  4CKE A;  1IW7 D;  2I46 A;  3AU7 A;  1PTO F;  5T1I A;  2I07 B;  1HXY D;  2PO4 A;  1SNC A;  2D62 A;  2XIW A;  3GD7 A;  2WAC A;  1SYF A;  1A2T A;  5ELD A;  2A6E D;  5ISR A;  4B08 A;  4X3K A;  2E2I B;  3H0G B;  4KTA A;  1XTC D;  3KUP A;  1J9O A;  1O7Y A;  3LX0 A;  1S5C D;  3LWE A;  3M3Y B;  5A2Q L;  1BCP D;  1OXS C;  1H9J A;  2TSS A;  3VR4 A;  3KLS A;  1HHV A;  1BOS A;  1A3V A;  1PZJ D;  3SDZ A;  3OOC A;  1STN A;  2KQ3 A;  2NVY B;  2IL8 A;  1VCI A;  2N88 A;  3S2H B;  4ZLT F;  1ENA A;  3NHH A;  1A6X A;  1SYB A;  3VYU A;  3D4D A;  4TKO B;  5C0X H;  4ME5 A;  3LNN A;  2BOS A;  1RF2 D;  3SE0 A;  3IKJ A;  5CYU A;  3NWT A;  4RA8 A;  3FPU B;  2F0S A;  4C1N K;  1SFO B;  2K1B A;  3T13 A;  1Y69 U;  1LTR D;  4DK0 A;  1D1I A;  4C3J G;  3P7J A;  3GTQ B;  2KEE A;  2EXZ A;  4N9P A;  4U67 3;  3S1N B;  1SAP A;  2J4X A;  5E1F A;  5I2Y A;  3TP8 A;  1GUW A;  1PFB A;  1SND A;  1C4Q A;  4J8Q A;  5F2D A;  2EVB A;  1TWA B;  1TVX A;  1UNS A;  2MUY A;  2KA7 A;  1LTB D;  4LMQ D;  2HCI A;  3OMG A;  4RFB A;  2TMP A;  4ZUI A;  3BDO A;  3TP6 A;  1SE3 A;  2NWG A;  1EIH A;  4RAU C;  1K8O A;  1Q12 A;  1QG7 A;  1EY7 A;  5G3L F;  1YNN C;  5EGT A;  2B2T A;  3SXH A;  3OMC A;  3K5N A;  1TR5 A;  3GO5 A;  1EY8 A;  5KNC A;  5EPL A;  1TWC B;  1CT1 D;  1LAC A;  4HSV A;  2SDF A;  1F2M A;  2KCN A;  1PRT B;  3A54 A;  3V2T A;  2PPB C;  1O78 A;  3ND8 A;  4LK1 C;  1TY2 A;  2F0N A;  1GUO A;  3I73 A;  4PMW A;  2F1M A;  3GTK B;  3MWY W;  3D3R A;  5FLX E;  1EY6 A;  4FXK C;  1MD2 D;  3FMC A;  1DXM A;  2F0J A;  1ZYR D;  3P75 A;  2WB1 B;  2G9H D;  4FF1 A;  1G29 1;  3NSW A;  1Q90 A;  4B9W A;  4X3U A;  1OXU A;  3SHL A;  4FP5 D;  1ESF A;  1FNW A;  5I6Y A;  1YNJ D;  2LY7 A;  5C0X G;  3T4A C;  1DJR D;  4IUV A;  2A69 C;  2A6H D;  2A73 B;  1IHZ A;  4NKL A;  2E2D C;  1QE6 A;  1W6K A;  3RMH A;  2R93 B;  2EYJ A;  5EPJ A;  1QJO A;  3VYT A;  2YU9 B;  1PTO B;  2GA4 B;  2ICE C;  1E0B A;  1TS3 A;  5G3L D;  1F9S A;  4C1N I;  4EQO A;  3QOJ A;  1I4G A;  4G7Z C;  5BN5 A;  1JCK B;  3BS1 A;  1GUG A;  3BZD B;  1SSO A;  4KMU C;  2KVM A;  1XYI A;  4EQP A;  3A8I E;  3TSS A;  2L11 A;  4F8M A;  2B2W A;  2D9U A;  1RHP A;  1H9R A;  4UDU C;  1IYU A;  2C9O A;  4K14 A;  3BVM A;  4XQJ A;  4IUN A;  1B2T A;  1UUP A;  1ROD A;  1ZEQ X;  4A3K B;  2O5I C;  3DHQ A;  2WV6 D;  1OXV A;  4R9W A;  5E4X A;  4CHT B;  1ML0 D;  3I3C A;  1AZQ A;  1TY0 A;  2F0P A;  1Y8P B;  2D2C C;  2OEO A;  1MSG A;  2H1E A;  3D8G A;  3TZU A;  5I6W A;  1EY9 A;  1R4P B;  2O5J C;  1HCZ A;  3L9A X;  3M7G A;  3A7A B;  1M8A A;  3M7N A;  3T53 B;  1SJE D;  3X3N A;  5KIX A;  3PIP 3;  2ZT9 C;  2E74 C;  3GTM B;  1JB3 A;  2Y0S B;  2BDO A;  2K32 A;  3SK5 A;  3CHB D;  2V4D A;  1AEX A;  3BYY B;  4IUT A;  3K7A B;  2D5D A;  3E6Z X;  1JWS D;  4ZAI A;  2FHT A;  2ENB A;  3OHX C;  4RGN A;  4A3E B;  1EQT A;  4ZUJ A;  1LTI D;  2F0Q A;  1S5D D;  2JYO A;  4AYB B;  4HN7 A;  4TRD A;  1L0Y B;  1STH A;  3QOL A;  3I72 A;  1I3Q B;  5FO9 B;  3S1R B;  1TWH B;  1STA A;  3Q24 A;  4RKL A;  1F9Q A;  3TZD A;  2BE5 D;  2K6A A;  2R92 B;  2M9V A;  4H44 C;  4ZRZ A;  2XVS A;  2LKV A;  2R6G A;  1NR2 A;  3H3V C;  1HQM C;  2OT2 A;  3R2T A;  1CQF A;  3MXN A;  4QIW B;  3D4R A;  1D5Z C;  4X3S A;  3A7L A;  3J7A V;  1H9K A;  5FO8 B;  2QIL A;  1HUM A;  5M3F B;  1EL0 A;  4PMB A;  1HA6 A;  3PV0 A;  2WIN B;  1D1K A;  2R61 A;  5EBD A;  1SE2 A;  3URY A;  5T1G A;  3LWU A;  1KTK A;  2RVL A;  2XSC A;  3KK7 A;  4K5V A;  3I90 A;  2L4N A;  1RCV D;  2FMM A;  4LAA A;  3CQZ B;  1X32 A;  3GV3 A;  4WOR A;  2A68 D;  3E5S A;  5CV4 A;  4NDX A;  1AP0 A;  4IZ8 A;  5EJW A;  4HMJ A;  2Z1C A;  5ELF A;  3SEB A;  1A3U A;  1KAA A;  5KNB A;  1PTO C;  2QF7 A;  1PYW D;  5EKK A;  1TKW B;  3HG9 A;  4OGQ C;  3KBG A;  3A8K E;  1WTQ A;  1QWY A;  1TWF B;  1DOM A;  2WAQ B;  1O7Z A;  2NB0 A;  2WII B;  2A5H A;  4KD4 A;  3H6M A;  1BXT A;  1T5E A;  2BE5 C;  2B8F A;  1VF5 C;  1SYD A;  2AUK A;  1BR9 A;  3K5O A;  1WCM B;  1G2T A;  1E2V A;  4RKB A;  3PMF A;  1ZYR C;  2F0O A;  2Z8L A;  3PIO 3;  3GTP B;  1NR4 A;  1WD1 A;  2B63 B;  5EQ0 A;  1HTP A;  2L0C A;  4DXG A;  2B8G A;  5BN4 A;  5IGG A;  4V19 0;  1Z7T A;  2H4O A;  4L63 B;  4MHE A;  3P1H A;  1ESR A;  5C3E B;  3GTJ B;  1GUT A;  2M2L A;  4BA2 I;  4A3M B;  1EYA A;  3JAM L;  4H0L C;  4XQQ A;  1B1Z A;  2PW5 A;  1K8M A;  1G2S A;  5BN3 A;  1WVL A;  2B2W C;  3OWF A;  1V1P A;  4OO1 G;  2HUG A;  1PMR A;  3NWS A;  4KJO A;  1CQV A;  4CGY B;  4HCE A;  3J7A F;  4IFD H;  1ENF A;  1CHQ D;  1F9R A;  3BVG A;  2IJ0 A;  3EA6 A;  2L5T A;  4Q0F A;  3TME A;  3I91 A;  5HUR A;  1MI2 A;  3K6O A;  4FF2 A;  2F0F A;  2PZT A;  3OWE B;  3FDT A;  2PMZ B;  1H9S B;  1F2Z A;  1HA5 A;  3S16 B;  4DAY A;  3S17 B;  3IFT A;  3HOU B;  3FVQ A;  1G6Z A;  1D2B A;  2ZXR A;  2EZV A;  3H09 A;  3MAQ A;  5AFW A;  4OO1 I;  1AZP A;  2LFN A;  2CW0 C;  2IX3 A;  2JSO A;  3A55 A;  4R8N A;  4OIJ A;  4Q5V A;  1RD9 D;  1RJT A;  2SEB D;  2IPK D;  1STB A;  2BDN A;  3IFD A;  3EFX D;  1CI3 M;  1BUV T;  3RUZ A;  1ILQ A;  1FYC A;  1QOH A;  2BCO A;  5KEE A;  2CQA A;  3ND9 A;  4FXD A;  1FGB D;  1LTG D;  4L8J A;  3HEJ A;  4C56 C;  1BDO A;  2VNU D;  4A3F B;  2WKC A;  4IUP A;  3KF8 A;  2CHB D;  3MFG A;  4RWS C;  1I4X A;  5DM6 3;  1XX8 A;  2X69 A;  1SYC A;  5JAV A;  3H91 A;  2AQ3 B;  2F0H A;  3VYS A;  2A68 C;  2A6H C;  5C6A A;  2EJM A;  2DN8 A;  5DAU A;  3T16 A;  4DK1 A;  3PUW A;  4XXE A;  3TP7 A;  2JE6 I;  5A2Q E;  3E0J A;  5FK9 C;  5C5M A;  1D6E C;  2SNM A;  1TS5 A;  3C2P A;  1CM9 A;  4A3D B;  1B9N A;  1V1P B;  1FD7 D;  1I4R A;  3FKI B;  1BQQ T;  1UEA B;  1LT3 D;  1EY5 A;  1FR3 A;  2FMC A;  4BY7 B;  5ELB A;  4CJ2 C;  1II3 A;  1I6H B;  5K5P A;  3N52 A;  3GV6 A;  1EY0 A;  1EU3 A;  4NW2 A;  2EY2 A;  3TP5 A;  1Y8O B;  3NE5 B;  2L9H A;  3BG3 A;  4KHV A;  4ZK9 B;  5IT9 L;  1NSN S;  4FNF A;  4K5W A;  1OXT A;  5NUC A;  1I6V C;  4TSS A;  3R3O A;  5KRU A;  1IYV A;  4J6H A;  3CRL C;  5M5X B;  3W2D A;  1HRJ A;  4FF4 A;  1DCZ A;  3M85 A;  3D6C A;  5JEA G;  3VR5 A;  4MIU A;  4QCL A;  3Q23 A;  1SYG A;  1SNO A;  1D5M C;  5KGU A;  1PFN A;  4J1M A;  4ILW A;  1JQY D;  4LJZ C;  2F0I A;  4KY7 A;  1TWG B;  3SR1 A;  4NP5 A;  5M9O A;  1EY4 A;  1JWM D;  1DM0 B;  2XWJ B;  1LTS D;  2OF1 A;  2SOB A;  2EOT A;  1KLG D;  1S4Z A;  1STE A;  2F0M A;  2NZ1 D;  2MGS A;  1GUN A;  5IOD A;  2CVR A;  3VR3 A;  1AW7 A;  1KNE A;  3BYT B;  5IGD A;  1SNQ A;  1WD0 A;  2F4I A;  2J0T D;  2JA6 B;  3HOV B;  1OO9 B;  3M4Y A;  2IWH A;  3KBX A;  4H13 C;  1WTO A;  5LL6 S;  4G4K A;  4KV6 A;  1MSH A;  1CTM A;  3K0Y A;  1PRT D;  1RTO A;  2F0T A;  1YNJ C;  3I4M B;  3PO2 B;  2QKI C;  1JE4 A;  4KI0 A;  3I4L A;  3V96 A;  3NTI A;  2EJF C;  1DOK A;  3RZD B;  3L3O C;  5IIF A;  3D31 A;  2B2V C;  5ELE A;  2EYM A;  5JPN C;  1VMC A;  3U9S A;  4YIJ A;  5C4H A;  5D65 A;  3W3A A;  3AB9 A;  5JOB A;  1GXD C;  2JA7 B;  2WP8 J;  1EU4 A;  1BCP B;  2F0U A;  4IUR A;  5JEA H;  1K83 B;  1XWE A;  3ZYY X;  2QCP X;  4N9T A;  4HED A;  2VXW A;  3CU7 A;  2JXM B;  1QIL A;  3NQI A;  4ULL A;  3DMU A;  2B39 A;  2F03 A;  1D5X C;  2Q8I B;  1KLU D;  4XYO A;  5C4J B;  2KOL A;  3HOY B;  4RH6 A;  2JEB I;  3L7Z C;  4CKB A;  5JVH 3;  3N6R A;  3MA2 B;  4BBS B;  1LLR D;  4O42 A;  5CV7 A;  2K04 A;  1B9M A;  4ZYS A;  4OL7 A;  2EJG C;  3GTO B;  3DWQ A;  4C2M B;  1Q1B A;  1U9R A;  3MFY A;  1TS2 A;  3KLS X;  1GOZ A;  2NVQ B;  4H7B A;  5D3I B;  3MHB A;  3DEP A;  2O4X A;  5C0X I;  2ZXO A;  3NK9 A;  1PLF A;  3BDC A;  4PV1 C;  5JEA J;  2PNR C;  5IOC A;  3GP7 A;  5M3M B;  1DON A;  4EGV A;  5E4W C;  2A69 D;  3DM1 A;  2EYH A;  3AMU A;  3FRP B;  1BO0 A;  2XRS D;  2QEJ C;  5LL6 X;  4C3I B;  2F0K A;  4WJW A;  4BA1 I;  3NXW A;  5J39 A;  2C5C A;  2RDH A;  5IGF A;  2F3W A;  3K5M A;  1STG A;  4DAP A;  2IX1 A;  4BWG B;  2XNA C;  1ICW A;  3ITP A;  2O2L D;  4HR7 B;  5EBC A;  4CJ1 B;  2JEA I;  1ILP A;  1U4P A;  3SK8 A;  4OHJ A;  3U9O A;  1HTL D;  3EVQ A;  3RLF A;  4KY6 A;  3DEO A;  4KKU A;  1Z6H A;  1PZK D;  3HOW B;  5COR A;  5CBA E;  3TN2 A;  2EE1 A;  2FFK B;  4ABN A;  4IFD I;  2RKS A;  3EJI A;  1F2Y A;  4IAL A;  1HFN A;  3MVV A;  2RSO A;  3OIQ A;  1NUC A;  2F0E A;  2K5Q A;  3VR6 A;  4U68 A;  3QWN A;  4DN4 M;  1O80 A;  4DA2 A;  3MXP A;  3MXG A;  1DD2 A;  2K05 A;  1S5F D;  4V0B A;  4KY5 A;  1RDP D;  4XDX A;  4XTC S;  3VR2 A;  3HZX A;  1HFG A;  5FO7 B;  2SNS A;  1JR0 D;  1JIC A;  1A2U A;  3RZO B;  1F77 A;  1Y1W B;  1BBX C;  1CA6 A;  3H94 A;  4QUC A;  1EEI D;  3NBH A;  1EOT A;  1ONL A;  3K58 A;  3DUZ A;  1JOR A;  3K5L A;  1XXG A;  3J80 L;  5C3W A;  4L6T B;  2F3V A;  2PZU A;  1GHJ A;  4BBR B;  1AN8 A;  3I70 A;  2EY5 A;  2EY1 A;  4CBV A;  2RBM A;  1NCV A;  4IQZ A;  1TQO A;  4ZKC B;  2L1B A;  5CV8 A;  3NUC A;  2MHV A;  5JVG 3;  2LS0 1;  3C46 A;  4KHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...