1X32A

Three dimensional solution structure of the chromo1 domain of cpsrp43
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
47
structure length
47
Chain Sequence
GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chloroplast signal recognition particle component
publication title Three-dimensional solution structures of the chromodomains of cpSRP43
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 2
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2005-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x32A00
1GUWA 1Q3LA 2B2TA 2K1BA 2MJ8A 2RSOA 2SDFA 1BBXC 3TN2A 2B2YC 1RTOA 4ZK9B 4QUCA 2M2LA 2K28A 2X6GA 2X69A 3I91A 3I90A 4MN3A 1IL8A 1B53A 5EPJA 1AP0A 3F2UA 1HHVA 2HDLA 4IUVA 1XX8A 3DEOA 1O7ZA 1IKLA 1BO0A 1KNEA 1PFNA 2FINB 1ZXTA 2HCCA 5D65A 1J8IA 4IUUA 3D6WA 3GV6A 3ONAB 4MHEA 4X3TA 5E4WC 1HRJA 2NZ1D 2FMMA 4CJ0B 4RWSC 2K01A 1QG7A 4ZLTF 1SDFA 2NWGA 5D14A 1PLFA 1TVXA 1X3QA 1F9QA 3KUPA 4ZAIA 2VXWA 2R3ZA 1CA5A 1HFNA 1PFBA 4QUFA 3QO2A 3G7LA 5E4XA 1F9RA 1HUNA 3HP3A 1J9OA 1MSHA 1U4RA 5DNFA 2B2TC 3IL8A 3KBXA 5EPLA 2K03A 1A15A 2KOLA 2DY7A 5CMDA 1WTQA 5T1GA 2EPBA 2B2UA 2B2VA 1ICWA 1BNZA 1XYIA 4X3SA 1MSGA 3I3CA 4HAEA 4NW2A 1DOKA 3DEPA 3R93A 2K04A 5CORA 2FJ2A 4RAUC 1DOMA 5EQ0A 1ESRA 1WD0A 1LV9A 1RTNA 2RVLA 1B3AA 2L9HA 5JJZA 1WTXA 2KUMA 2L1BA 1M8AA 2H1EA 2KEEA 1BF4A 2EOTA 2N88A 3MTSA 4R8IA 1MGSA 2Q8RE 3LWEA 2JYOA 4U68A 4IUPA 1F9PA 2B2WA 3FDTA 5EJWA 2MGSA 1O7YA 1PDQA 2K05A 5COYA 2RSNA 2N55A 2X6LA 4RA8A 2FFKB 1G91A 3DM1A 3FPUB 5CBEE 2NYZD 1HFGA 2B2UC 2B2VC 1U4PA 2MP1A 1KNAA 1WTOA 1DZ1A 1SSOA 1F2LA 3GV3A 1RODA 2KECA 1AZPA 1G2TA 2J7ZA 4HEDA 1C8CA 1NAPA 4IUQA 2KVMA 1G6ZA 2XIWA 1EQTA 2L12A 2L4NA 3P7JA 3N52A 1WTPA 1CA6A 1EL0A 4CJ1B 1NR2A 1O80A 1PFMA 2HDMA 5EKIA 2IL8A 2BDNA 1E0BA 1B4OA 1HUMA 4IURA 2Q8TA 1EIHA 1ML0D 2DY8A 4OIKA 1S4ZA 4XT3B 3H91A 1CM9A 1VMCA 5CBAE 4HCSA 1EOTA 1IKMA 1EIGA 2B2YA 1RJTA 1ILPA 1DOLA 2HCIA 1WTVA 3Q6SA 1B2TA 1B50A 2L11A 1MI2A 2B2WC 1F9SA 4XDXA 1U4LA 4ZKBB 1WTRA 1X32A 4X3UA 1U4MA 1JE4A 4O42A 5T1IA 4CJ2C 1QE6A 1ILQA 3MWYW 1HA6A 2JP1A 2MPMA 5AFWA 1NCVA 1JICA 1G2SA 1QNKA 3IFDA 1RHPA 4ZKCB 1VMPA 3TZDA 2HUGA 5EPKA 4DN4M 1DONA 1X3PA 1AZQA 4OIJA 3SVMA 4R9WA 4XT1B 2CVRA 4HSVA 4LMQD 1WVLA 3UI2A 4IUTA 1NR4A 2RA4A 4X3KA 2EE1A 1WTWA 1WD1A 2D9UA 2FHTA 4UAIA 2KEDA 1SAPA 3I8ZA
chains in the Genus database with same CATH superfamily
4MZ9A 1GUWA 2MJ8A 1I3QH 4JI8L 1QVFA 4KJOA 2ZM6L 4CKCA 1BBWA 3FEWX 3DMUA 4CKEA 4IUVA 2NVYB 3J80E 3T53B 4B3ML 2JA8H 3M4QA 2AHOB 5M3MB 4FXDA 4Y52H 4HR7B 4MHEA 3M3YH 5C44H 3I2ZA 4LNQA 2PNHA 3WWVA 4IOCA 3F8TA 4LK1C 3FPPA 3G4SA 1EY9A 2VZAA 1MBYA 1VQMA 4PMWA 1LTLA 4K14A 2UUAQ 2K7VA 1ESFA 2I5LX 1BQQT 3HOZB 2JEBI 3H0GH 2D0OA 1N36L 1ASZA 1ZKOA 4BBSG 1LV9A 5JJZA 1B44D 1E2WA 3MVVA 5GQOA 5CYUA 1TS4A 2F0FA 2WIIB 4R8IA 3GO5A 3AFPA 1NY4A 4EGVA 1UAPA 4BS9A 1CFMA 1XXGA 3RNUA 4DR6L 1O7YA 5M5YB 1EY7A 2IX0A 2X6LA 1YIJA 3J81j 2B2VC 2A1AA 4GNXA 3L3OC 1AZPA 3NWSA 2K14A 2J7ZA 1U5KA 2MHVA 2WAQB 3PIO3 1H9JA 2L12A 4LF4L 4DR4L 1YHQA 1ML0D 2VUMH 3ZJYC 5EBCA 1N33Q 4A75A 1A0IA 1IYJB 4DR2L 1XPOA 1KABA 1WTRA 1TXYA 4HJ5A 3EVQA 3PUVA 3MA2B 4HIKA 1D5MC 1CHPD 1ILQA 2NN6H 2F03A 2GVAA 1I4QA 4JOIC 2NVQB 1LTBD 4BY7G 4Z9CB 3UDFA 1SRUA 4KY6A 2CW0D 2A68D 2Q8IB 1HR0Q 4A3DG 4DN4M 4FXKC 4OIJA 1YNJC 4KV6A 2JA7G 4JBMA 3E0EA 3T51B 3EA6A 1CQFA 1KLUD 2FHTA 4UAIA 1JB3A 1KC8C 5FO7B 1WOCA 3J7AV 5C3WA 2UUBL 2HHHQ 2AKWB 1CKMA 3CMEA 1RDPD 5FKAC 2F0QA 5DM73 1SYBA 2SNMA 3A8IE 4QUCA 4C2MB 2C35B 2NVXB 4NB3A 4YY3L 3E9IA 1NTGA 5BN5A 3KF6A 4A3KH 4CJ0B 1QG7A 2EY1A 2Z8LA 1CA5A 2FXQA 1S5ED 5E4XA 5M3FG 1F9RA 3FKIB 4LFCL 3VDYA 1CSQA 3DWPA 3I4NH 1JB7A 1D1KA 5A2QL 2F0OA 2NVTH 1M1KC 2K03A 4K0KL 4LF8L 1IBMQ 2A8VA 5KEEA 4A76A 1VQ4A 4ZYSA 3R93A 5IP7H 5EQ0A 3JC66 4EQNA 1S5FD 3RZOB 3S15H 2K5DA 1YITA 3RMHA 4OL7A 2R7ZB 3QB3A 1Y8NB 3MTSA 4J8QA 2IY5B 3S16H 4JI4L 4B9XA 3M7NA 1V1OA 2OXPA 1HQRD 3WOFA 1AFPA 4YHHQ 3OHXC 2UXDQ 5C5MA 3KDFA 4A93B 2KCNA 1LTGD 3W2DA 2D0PA 2B2UC 1SYEA 2DNEA 4B3SL 1NJIC 1EQTA 1HQMC 1SYFA 4C3HG 1DJRD 2AUJD 4RH6A 3UDIA 4JI3Q 1YJ9A 3NQTA 5KGUA 1S4ZA 2WB1B 5IP9G 3H3VC 1I94L 3SK5A 2N8NA 4OEMB 4DXGA 4DR5L 2Z1CA 1JE4A 1QOHA 1JMCA 4RGOS 1K83B 4K8IA 3TP6A 3D4DA 3E3XA 3RZDB 1LTTD 4A4IA 1SMYC 1VQHA 2LXKA 1JC7A 3S2HB 4HJAA 2JK8A 3A7LA 1W6JA 4IUTA 5A35A 4A3JH 3V2TA 3OPOA 3KYHC 2L55A 4QIWB 1EQVA 1WTHA 5M5WB 2GA4B 3W3AA 5C3EB 2JA6G 2ZTCA 4BY1B 1C48A 2MNAA 1HHVA 4WFN3 1LM0A 1K73C 3DEOA 2FINB 5D65A 3M4OH 2EYOA 4IUUA 1G291 2PZTA 4O1NA 4A3FH 3CC7A 4GLXA 2B8FA 3JAML 1IBLQ 4BA1I 4IUNA 1HH2P 2JE6I 4ZAIA 5CV6A 3MHBA 3HZXA 4G7HC 3NELA 2EYHA 1HZCA 3DXJC 1Y1WH 2Q2IA 4DNTB 2ICIA 4DAPA 5KYIA 1S40A 1IBKL 5T1GA 4GOPC 3VYRA 5F2DA 4DF7A 4XQJA 5CR3A 2ALYB 1PRTF 4KKSA 4DAVA 2UUAL 3FMCA 2NVQH 4RKLA 1BDOA 3BVMA 1RTNA 1Y8OB 2BE5C 5FLMG 3IRBA 3HOXH 2Q2UA 2A19A 2KUMA 5IOCA 3I72A 4RKBA 3J80L 4ILWA 5KRUA 2KCTA 1SE3A 4DAYB 2B29A 1CZGA 4KD4A 3QJYA 4JI0Q 4B3TQ 4FF1A 1ONLA 1B1ZA 3KF8A 2GVBA 1AE3A 1CKNA 2QW7A 3BZCA 3OOCA 2PMZE 3OWEB 3DLLA 1X55A 3EN2A 1CA6A 4N8X1 5LMNW 2EYLA 1EIHA 1Q81C 1I4XA 2WP8J 2LKVA 3CCLA 5D3IB 3KK7A 2RBMA 3FKIH 1MI2A 1B9NA 1F9SA 1QNUA 4POGA 2A6EC 3X3MA 4MNOA 1EEID 1TT2A 3R2TA 1E1OA 4L5SA 1F2MA 1PTOH 1G2SA 4NXNQ 3OTOL 1RHPA 3GTQB 2QKIC 3GTPB 4LMQD 4YWKA 1HR0L 4KN7C 3VR5A 1K8GA 4O2DA 5IIFA 1I4HA 3S1RB 4XQQA 4DV0Q 3TN2A 3UE1A 2ZXOA 1I6VC 5FJ8G 2UXBL 1IXRA 2HHHL 2E2HH 2YU9H 4TVAB 1B53A 4EX5A 2BH8A 4A3MB 3M4PA 1Z7TA 2DGYA 4PMBA 2LXJA 1ENAA 1KD1C 3K5MA 3HOUG 4MTKA 3NE5B 4OO1G 1GO3E 3MC0B 3TS0A 4IQZA 4BA2I 3JAMi 1HFNA 2PW7A 1G8ZD 4XQNA 3TBIB 3BG3A 5BR8Q 4HJ8A 3IL8A 1IYVA 1WCMB 2DY7A 2V4DA 4LF5Q 1EY0A 2F0WA 2DUDA 3H15A 1IBML 1PZID 1P16A 1K3BC 1PH7A 1LUZA 4GZYC 5FO8B 5CC4A 3PUZA 3E0JA 3S1NB 4GKKQ 1BF4A 4LUVA 4M8AA 3T13A 4FNFA 2VS1A 4H02A 4L5QA 4U68A 4I7ZC 2JJQA 3I4MB 2EJGC 5COYA 2RHSB 4RA8A 3NBHB 3HG9A 3DM1A 2NYZD 3ZYYX 1KNAA 4C3IG 1X6OA 4YHHL 1SSOA 3NBIA 3ER0A 3GV3A 2CW0C 4GLVB 2EYMA 1C8CA 4JI7Q 1QWYA 1SYCA 2XIWA 3P7JA 1Q46A 2Y0SE 3RLOA 1KDCA 3RLFA 4CBVA 1Y69U 4A3DH 1O80A 1PFMA 5EKIA 1HTPA 2BDNA 2E76C 3O13A 1H9KA 3IFTA 2NB0A 3FVQA 1R9TH 2E75C 3HKZE 4DV1Q 4HIOA 4L8JA 3OIQA 4OO1I 1XJVA 2J0TD 1SR3A 3HOYG 4FP5D 2K32A 4QMGA 2JA8B 4IPGA 3G48A 4AYBE 1VQ5A 2R6GA 3M3YB 5C44B 4ZKCB 2E2IH 1XNQL 1TWCB 3H09A 2Z0SA 4HSPA 4R9WA 3PV0A 1VQJA 1KDAA 1Y1VG 3VA7A 4V0BA 1JOOA 4R4CA 1PRTD 1WI5A 2Z6KC 1NBWA 3J80c 3PIPA 5FLXE 4J1MA 5ELFA 1BKBA 3H0GB 5C6AA 2DN8A 5CV4A 1CUKA 4M1UB 2K50A 5LMUL 1O7ZA 1SLJA 4GLAC 1H95A 1EFWA 4DU9A 3D6WA 4JPBW 2XTIA 2FMMA 4C1NI 4CDCC 5A2QE 3DWAA 1EWHA 2E2JH 2GN5A 1XPUA 2A69D 3LX0A 2JA5G 1MJEA 1GKHA 5DNFA 3CP0A 2QDLA 1JJ2A 4PNYA 1PH1A 4V190 1TWAH 1XYIA 3S17H 1Z47A 1A8VA 1ZYRC 1VQNA 4A3EG 1DOKA 4R4TA 2F0GA 4K2KA 5CORA 1SE2A 4RAUC 4J6HA 2RCNA 1ESRA 1CHQD 5EGTA 4C3HH 2K6AA 1F77A 5TSSA 3AEVA 2VUMB 3KDFB 3QR8A 5JPNC 1QUQA 2ASBA 1PDQA 5EBDA 4KK7A 2J4XA 1U4PA 2Y0SG 2PNRC 4YCVA 1N9WA 1L0XB 2ENBA 3MEHA 3M7GA 3ERQA 1CQVA 1HUMA 2RQXA 4OONA 2DY8A 5IGCA 4DV3Q 2KQ3A 1EOTA 5AJ3L 1IKMA 2HCIA 5C0XJ 1I5FA 1MHWC 4QL5A 2JA6H 1L0YB 4DK1A 4AYBG 4DV4Q 2WINB 5JOBA 1Q7YC 1EQQA 2TMPA 1N8RC 4G7OC 4A3KB 1O78A 2EY2A 4GNXC 1YHAA 2NBFA 1YNND 4C1NK 4UP7A 2EQSA 5IGDA 3KBGA 1UE6A 1OXUA 3UI2A 1TY2A 2EE1A 1C4QA 3K58A 3I4NB 4A3GH 1DYQA 4UP9A 1OXXK 5LMNQ 2RDHA 4S3SA 2NVTB 5IWAQ 4JCVE 2SDFA 5LL6X 1BR9A 1STAA 4DV7Q 1V8QA 2R92H 4DV0L 3JAME 1KQSA 1SMXA 1VQ7A 4DAMA 4XTCS 4KY7A 4X66Q 2BA1A 1XX8A 2QILA 5KYLA 3S15B 5JAVA 3J7ZC 1LO5D 1EWCA 1HA5A 4LJZC 5FLMH 3EFXD 2VNUD 1PFSA 1X3QA 3HOVG 3S16B 4YWMA 3GTOH 1XWEA 4KTAA 5HURA 3MXNA 1J9OA 2WKDA 4KD3A 1T9HA 1U4RA 3S2DH 2B8GA 3TMEA 3D3RA 4X62L 1WTQA 4RGTA 2CH4A 4QQBX 4HCEA 4X3SA 4IFDG 4LF5L 3PUXA 1VQPA 4L5RC 2ZTDA 3G6JB 4G7ZC 2XSCA 1CI3M 1XNRQ 5GAGC 1SNOA 1K8OA 3SR1A 4BBRG 1YI2A 4ABNA 1VQDA 2H4OA 3OYYA 3VR2A 2Q8RE 1EU4A 4AQYQ 4GKKL 4HTHA 2XRSD 3CCJA 1CTMA 3FDTA 3K8AA 5J22A 1JR0D 3FPUB 3W1BA 4Y7NH 1LTAD 2MP1A 2Z4IA 2JN4A 3DM3A 4KJNA 2QCPX 5EKLA 3KLSA 4OXPA 4HJ7A 2JXMB 4IUQA 2RHQB 3N52A 4LW1A 4F8MA 4A3IG 1NR2A 3C2PA 4A3JB 1QVGA 1GUOA 2WFWA 1ICFB 1L2FA 2K4KA 1SE4A 4I65A 3URYA 2VB2X 3C3LA 2KCCA 4X64Q 1HZAA 1M4VA 4XDXA 5FJ8H 4DV1L 1HTLD 2EYPA 3NTKA 1XMQQ 1RIPA 3I70A 2ZTEA 3M4OB 1X65A 4KHZA 4DV2Q 4QGUA 1I4GA 3A8JE 4A3FB 4G57A 4LUZA 4JBKA 3HKZB 5KNCA 2BCOA 2R7DA 4YCUA 4LFBQ 4TSSA 1GOZA 1Y1WB 1I4PA 1H9RA 4IFDI 1HRJA 2PW5A 2WB1G 3MFGA 4JI2Q 3PO3G 1VQ8A 4ZCKA 4P74A 3PIOA 4GKJQ 1LT5D 5EPJA 5I6YA 3HOXB 4RWSC 4JBJA 3ULLA 3CPWA 3KUPA 2PZUA 1J5EQ 4GOPB 1EUJA 4X65Q 3PCOB 2F4VL 1E1TA 5JJIA 3I55A 2F0TA 3AYHB 2ES2A 3KLWA 3KBXA 4DXFA 5HGTA 5C3EG 3W5OA 4TKOB 4BY1G 3NTHA 2XN9C 1R4PB 2PCFB 3CRLC 1E22A 1QVCA 3S24A 4C3IH 5C4JH 1KTKA 2E74C 3BYYB 3GTLH 1DOMA 1T5EA 5FLXL 5C0XH 1PH9A 5J3BA 5IYDG 1LT6D 2H1EA 4DK0A 3SXHA 2AWNA 3AQQA 1YBYA 3SK4A 1U0LA 2TSSA 3MXPA 4JBWA 2F0DA 2N55A 4K5XA 2FFKB 2WKCA 3SDZA 3HOYH 1K28A 1PTOB 1Q8KA 4ME5A 2A74C 3U50C 4LF9L 1RODA 3HS0C 1GUNA 2HQEA 1SBBB 4XYQA 2L4NA 2UUCQ 2JA9A 4HIMA 1X3EA 1K0RA 4PG3A 4C3JG 4OIKA 3BJUA 5IY0A 3K81C 4B9WA 4RHRA 3E5SA 2WACA 4WORA 1EYAA 1PRTC 5C4XG 1RJTA 2B63H 3Q6SA 4DV3L 3PO2H 4XYOA 2E2HB 2XRQD 2YU9B 1KAAA 1SXTA 4PZ7A 3AFQA 3VYTA 3GTMH 3MWYW 2MPMA 1EY4A 4P71A 4YWLA 1JICA 1VQCA 5D3DA 2QEXA 1JOQA 1LT4D 2KHSA 4L5TA 1L1OA 2ID0A 1TWFH 3J81i 5ELNA 5JJKA 4GN3B 2JA5H 3W1GA 4KHPQ 2K1BA 2RSOA 1PVOA 1SNQA 2LSSA 5IWAL 4LF6Q 1HZ9A 1BCPF 2OQ0A 4QJFA 5K36G 4NKLA 2F0IA 2QA4A 4DV7L 4LF7Q 1A3VA 3B6YA 4A3EH 1IKLA 1GHJA 4RFBA 3T56B 2ZJPA 1F2YA 4X66L 2I5HA 4JI5Q 1TS2A 2CWAA 2IHEA 2K01A 3MZ5A 1BOSA 4JI1Q 3VR6A 1PH6A 3QO2A 3CC2A 2IX3A 5C3XA 1MSHA 5BN4A 1TQOA 3CQZB 2BA0A 4OWTB 1E24A 1I50H 2EPBA 2O2LD 2F0MA 3K0YA 3PMFA 4BY7B 4ZQ3A 1GD7A 2QF7A 2F0EA 1RL2A 5JVH3 2IX1A 4UHVA 4A3DB 1MIUA 3J7YW 2QEJC 3OMGA 2HIXA 4DR3Q 2JA7B 2L9HA 1O7LA 1BXTA 5E7NA 3H6MA 1R9TB 1GM5A 3PF4A 3STBD 2ZJQA 4FO2A 1MD2D 1F9PA 1JJCB 2B2WA 4LAAA 5ELOA 3CCSA 4AQYL 1PH4A 1NMFA 1PHJA 4F87A 4N8FA 2R93G 2PZWA 3T1HQ 2R61A 3G6EA 2E2IB 4HN7A 2CCZA 3HKSA 3BDCA 1RKNA 2LMCB 4A3CG 2PQAA 5M3FB 4PZ8A 1TR5A 2OEOA 1STHA 2YTXA 2R7FA 1EWIA 3K5LA 1VQEA 2RKSA 4DR7Q 2L11A 4UY8C 2F0KA 3BZDB 1SNCA 1VS0A 1D2BA 2AUKA 5IYCG 4GN5A 1Q8IA 3CC4A 1YNXA 4X64L 1UE7A 2EXDA 4XIGS 3UDGA 2DJGC 3LGJA 1XMQL 2AWOA 3RR5A 4DV2L 2E2JB 5EPKA 1LYLA 1PTOC 1GUSA 3HOVH 3V05A 2JSOA 3NENA 4DR1Q 5FLXc 1S72A 4LFBL 1VQLA 4MTNA 2N3SA 1TWAB 3SHLA 1N33L 2VQEQ 4JI2L 3S17B 2H5XA 4GKJL 4IFDH 5C5LA 1KXLA 1TWGH 1KNEA 1JOKA 1OXTA 4C3HB 3MXNB 1K3RA 4BBRH 5JEAG 3F2CA 3X3NA 2F0HA 2UXCQ 5E3FA 1S5BD 3BS1A 4N9TA 3CU7A 1G6PA 3OMCA 1J5EL 4X65L 2NTSA 5EPLA 1A15A 4ZRZA 2F0JA 5CMDA 1FR3A 3I4LA 3A0JA 4DUZQ 1V1QA 4K5VA 3SK8A 4A3BG 3C46A 3NUCA 3HOWG 1CZWA 2K04A 4BBSH 4A3IH 2RVLA 1XMOQ 2QDBA 1YJNA 2C5CA 3M9BA 1H9SA 2RDGA 3Q8DA 1LACA 3K7AH 2JA6B 5C4HA 1EU3A 3L0OA 2KCMA 2K05A 2K5VA 3AB9A 5M9OA 5K5PA 4FYDA 1LTSD 4PQXA 2Z6BA 3L7ZC 2EVBA 1HFGA 4IPCA 1DZ1A 3CCEA 2EZVA 1F2LA 3EJIA 1KAWA 3A74A 1EQRA 1TS3A 1FJGQ 4LWCA 3U4VA 5KNDA 3TS2A 1YEZA 1E0BA 1FNVA 2EYFA 1UE5A 3CHBD 4JI8Q 1ZEQX 3VYUA 4A3GB 1UE1A 1FVIA 2HQLA 5ISRA 1BCPD 4HCSA 1M90C 3PO3H 3WOEA 4JV5Q 4GNXB 2R92B 2YV5A 1RD9D 2I46A 3S9WA 1EOVA 1EYGA 4B3MQ 3SGIA 3J81E 2AMCB 5T1IA 1EY5A 2YYZA 4BWGB 4NPSA 3CQZH 2LY7A 3A5ZB 2M9VA 3IFDA 1SE8A 2UXDL 4BY7H 3OSOA 2A68C 3HFZB 2HUGA 1WFQA 3GDEA 1A2UA 2K5WA 2KA7A 1AZQA 3SVMA 1HPCA 3UE0A 1WVLA 3GTOB 2JA7H 3TEHB 1TU2B 2VB3X 1WTWA 1SAPA 1IL2A 2A6HD 3T4AC 3S2DB 1QILA 3U9SA 4JI3L 3JAMc 4B3RQ 1PV4A 4DKAC 4JK1C 2OTJA 4AH6A 2HT1A 4R8NA 3NK9A 1I6HH 4ULLA 1NUCA 1PYBA 4LF6L 1DXMA 5IT9L 5DEHA 5EAYA 2MUYA 4J15A 3ONAB 4LF7L 3NHHA 4Q5VA 4FF3A 3C1FA 3K6OA 2F3VA 4JI5L 1Y8PB 2WAQE 4EQ5A 3D8GA 4K2LA 5M3FH 4JVZA 3QG1A 2WV6D 1DM0B 5JEAJ 2F3WA 4E6IA 4Y7NB 1HR0W 3KF6B 2F0PA 4B08A 3OW2A 4IJLA 2A5HA 2OT2A 3GTJB 4NMZA 2AQ1B 5IP7G 1AH9A 3RN5A 5GROA 1B3AA 4ID6A 3GP7A 5GAEC 4C3JH 4DR3L 2V1CC 4DR2Q 4P2CB 1IBLL 2JYOA 4IUPA 3LWUA 5L37A 5C4XH 1V1PA 2YTVA 5CV9A 1IW7D 2CH4W 4JG2A 3RN2A 4DFAA 4A3LG 1MJCA 3MEFA 3SE0A 5ELEA 2KVMA 3PSIA 3MFYA 1EL0A 5M3MG 3PF5A 3T1HL 2D62A 2E2DC 5JJLA 2IL8A 4IPHA 4XT3B 3H91A 5J39A 1K0SA 4EQPA 1B9MA 4ZUIA 2B2YA 5IP9H 1SJED 1TWHB 1LT3D 3OWFA 3TSSA 1TY0A 3M4YA 4O42A 4JI0L 4B3TL 4DR7L 5K36H 1EYCA 3S1QH 1NCVA 3HOZG 1QNKA 2LS01 1PYSB 3BYTB 4KKTA 3EBEA 1E3PA 1UEAB 5ELCA 1DONA 4LUOA 3P20A 3FRPB 1BUVT 4QF4A 3VYSA 1F2ZA 2VW9A 4CDFC 4LF8Q 5FO9B 1BBUA 3OIPA 1EY8A 5FOBB 3NEMA 1RTOA 2PMZB 1II3A 4C3IB 2X6GA 1JQYD 5IE8A 2NZHA 5C4JB 4R4QA 1SFOB 4RHSA 2VQEL 3GTLB 1D8LA 4A3FG 2XWBB 2NZ1D 5IODA 2WAQG 2AQ2B 1E7ZA 4NXNL 4ZLTF 1SDFA 4JI4Q 1F9QA 1GJXA 4DPGA 1YHBA 4MIUA 5H1SE 3HP3A 2ZJRA 4HMJA 3HOYB 3ULPA 4JI6Q 4DAYA 2WB1E 4B3SQ 2P5ZX 1IYUA 2R93H 4KHVA 3Q0AA 1IZ6A 4DUZL 3CPFA 2EY6A 1WD0A 2IW3A 2BE5D 2DNCA 1EFID 3K59A 2CKZB 1WTXA 4U673 2K33A 1I94Q 3U58A 1XMOL 2B63B 4DR5Q 3OW7A 1X9NA 3PO2B 4RGMA 3RD4A 5LHY1 1STGA 5GADC 1JWSD 3T1YQ 1PMRA 3KFUA 3GTMB 4UP8A 3H3VI 5BR8L 1G91A 5CBEE 1D6EC 4EQOA 5DAUA 2FMCA 5M5XH 2O5IC 1HNZQ 1TWFB 4RGNA 1PRTB 4N9PA 4CJ1B 3BZKA 2EXZA 4FXGC 4RMFA 1W3SA 4XXEA 2JA5B 1UNSA 1SNDA 3KF8B 3GD7A 4WJWA 5IYBG 4CHTB 2K5QA 2K5HA 4DA2A 2E5LQ 1DOLA 3FKIG 1CKNB 4NDXA 2F3IA 2F1MA 2G5DA 3DWQA 2A6ED 2MFIA 4JV5L 1QE6A 4A3EB 1HA6A 1NE3A 3EIVA 1AE2A 2Q2HA 1EY6A 1QZGA 2OCEA 4G4KA 3S14H 3GTJH 1X3PA 5CV5A 5JEAH 1A3UA 2N49A 2CVRA 4XT1B 4AIMA 3GTKB 2MO1A 4JI7L 4Q0FA 1LLRD 2KBNA 2RCFA 2R7ZG 1OXVA 3I8ZA 2BDOA 1IBKQ 2UU9Q 1J6QA 2B2TA 2SEBD 1CKOA 1I50B 2IT1A 1N32Q 1T5XD 1S5DD 3ND9A 4B3RL 2K28A 4K6LA 2Y0SB 4A93G 3Q24A 4QB4A 4A3BH 1D5XC 3HOWH 2ATWA 4BXXG 3HOUH 3J81L 4OO1H 1L1OC 2BH2A 3DUZA 1CSPA 1PLFA 5D14A 5NUCA 3G71A 4PZ6A 1Q1BA 2R3ZA 3ITPA 3ND8A 4KY5A 1N34Q 3K7UC 3NTIA 1AEXA 4AYBB 4R4IA 4K5WA 4APVA 2F0LA 1TWHH 1BNZA 3BVZA 2LFNA 2L0CA 3DEPA 1NMGA 1A6XA 1Q90A 3NBHA 1H9SB 2OQKA 2B3GA 4HJ9A 2JEAI 1GUGA 3BDOA 2Q2TA 2BOSA 4YIJA 1VQIA 4P75A 1BCPC 1MGSA 3LWEA 1VCIA 2OWOA 3Q22A 5CV8A 1TS5A 2VQFQ 3KOJA 2KJXA 3I73A 1HJPA 3OTOQ 4R1JA 1PA6A 3RUZA 5HGQA 2VL6A 4CDDC 1EZ8A 3N6RA 5IGFA 1RF2D 3L9AX 4L6TB 1P8LA 1SFOH 1B70B 1PYWD 4R4OA 1XTDA 3HOVB 3U4ZA 2XGTA 5CGKA 2A6HC 4IFDJ 1CM9A 1STNA 2UXBQ 3I7FA 3K5OA 1ILPA 1X56A 4OELB 2B2WC 5JVG3 4CDEC 4ZKBB 2EDGA 1K8MA 1U4MA 4CJ2C 2PYKA 1TWGB 1EIYB 1UWVA 3TZDA 4BBRB 4KMUC 2L5TA 1SNMA 3IAYA 3I4OA 4LFAQ 2EY5A 4F88A 1KLGD 1LTID 1QCBD 3S1MH 1Y1VH 4KN4C 3PGZA 3ICEA 3R3OA 4NXMQ 5I2XA 3ERSX 5IT9E 4ZK9B 2M2LA 1TKWB 3NXWA 1PZJD 5E1FA 1FYCA 3I91A 1IL8A 2VY3A 3IKJA 4DV5Q 1LTRD 4BBSB 4DV4L 1BO0A 4A3IB 4OWWB 1YJWA 4KI0A 3GV6A 3F2DA 1VF7A 3CAMA 3T16A 1SJHD 2A69C 4QUFA 3K7AB 2MO0A 1TWCH 3PQIA 1IW7C 4DUYQ 2K5NA 1K9MC 3RLNA 2KOLA 3CCVA 2AQ3B 5LMNL 2B2VA 1ICWA 4O0AA 3KJPA 4A3LH 1MSGA 4JI6L 1ZYRD 1KIXA 4OX9Q 1QZHA 2F52A 2NVYH 4JYAQ 5M3MH 1VQBA 2CHBD 1V1PB 5G3LF 3HEJA 1M8AA 3CCQA 2EOTA 2N88A 1X54A 3GTKH 3PO3B 2E8GA 1SN8A 4NP5A 1JJGA 4IOAA 1XTCD 3MXUA 2KHIA 3QOLA 1PZKD 3LNNA 1S5CD 1B3QA 3EROA 3TRZA 1CT1D 2F0VA 4JOIA 2ZT9C 4WRDA 4IALA 3T1YL 1XNQQ 3K0XA 3K57A 5IGGA 3HOZH 1HZBA 4OGQC 4A3MG 1VQGA 3A56A 5I4DA 1NAPA 3CMAA 4HIDA 1QUQB 1AW7A 3H3VH 1HNZL 1EIFA 2I5MX 2Q8TA 1AN8A 2MQHA 2PPBC 1XNRL 3A5UA 1KRTA 3TDQA 5KNBA 3J81c 4K6DA 1E2VA 5EKKA 3J7AF 5C4ZA 4TRDA 3MXGA 5LMUQ 2E5LL 1I6HB 1WCMG 3KLSX 5M5YH 3TZUA 4QY7A 5AFWA 5ELDA 2HD3A 3A7AB 1HXYD 2OTLA 2G9HD 1YNNC 1STYA 3D6CA 4L63B 1GUTA 2G9DA 1FGUA 4A3GG 1E2ZA 4JC0A 3F2BA 1YVCA 4JW0A 1SEBD 2C9OA 1BVSA 3CKIB 1BBXC 4FF4A 4DK3C 2UU9L 2R92G 3BU2A 3I4MG 3F1ZA 4CKBA 1NNXA 1N32L 1FL0A 1AP0A 4DV6Q 1J8IA 2D5DA 1OO9B 4C3JB 1VQ6A 2NTTA 4IJHA 1TVXA 1VQKA 1PFBA 5HY6A 1O7IA 5C4XB 1PXUA 3FP9A 1IHZA 3TP7A 1Q86C 1D5ZC 4QCLA 1N34L 1YZ6A 3TREA 2B2UA 1DD2A 3P1HA 4C2MH 2ICEC 1A2TA 5FK9C 3I3CA 1Z6HA 1NSNS 4NW2A 5I9OA 2NVXH 2JA8G 2FJ2A 2Z4HA 5C44G 1DCZA 3L2PA 1FD7D 5AJ3Q 2L15A 2L1BA 4PMCA 5I9PA 2CQAA 2F0NA 2I0QA 5IYBH 3VA5A 1HNXQ 1EEFD 1C0AA 3VR3A 2KHJA 5EJWA 4WJ3M 3A55A 1SYDA 1Q82C 2RSNA 3S1QB 2VQFL 1WTOA 5CV7A 1D1IA 4PV1C 3H0GG 3D4RA 5BN3A 1FNWA 1S3OA 1JT8A 3R2IA 4P73A 5IGBA 3Q23A 1ET6A 3RZOH 2EYJA 4IZ8A 2R7ZH 1WJJA 5LL6S 3QWNA 1X32A 4IN3A 4TQUS 1Q1EA 4X3UA 3CF5A 4WJ4A 4A93H 1JORA 1HNWQ 2QGQA 1PH8A 3UDXA 1VMPA 1CK1A 2YTYA 4RG1A 4BXXH 1TIID 4DNRB 5I6WA 4P72A 1SYGA 4HSVA 1QJOA 4X6AH 1ENCA 1EZ6A 1GXDC 3A8KE 2IWHA 2UUCL 2VUMG 4X62Q 4LFAL 1H9MA 2ZM6Q 1Q3LA 1ASYA 2KENA 1JWMD 2B2YC 2PI2A 4GOPA 4NXML 3GTGB 2R93B 2X69A 4FF2A 2NUCA 4KLKA 2NN6G 3H94A 1KL9A 2HDLA 5G3LD 3EQLC 5JPMC 1PFNA 3CCMA 3CCUA 3BVGA 1ZXTA 1A3TA 1K83H 4DV5L 5DLQE 4FDBA 3GQBA 1K8AC 3RZDH 2XVSA 3S2HH 1YNJD 4POFA 1W6KA 2F4IA 3G7LA 1HUNA 3J80i 2IPKD 1OXSC 4YCWA 3K5NA 1PTOF 1R4QB 5M5WH 4DUYL 5C3EH 4KHPL 1N36Q 4BY1H 4F7XA 1Q12A 1FNUA 5M5XB 4CGYB 5J1ZA 4HAEA 2EJFC 4A3KG 1U9RA 5C0XG 4OX9L 1Z9FA 4JYAL 5IGEA 3NWTA 3J7A5 3KLRA 3PUWA 3QOJA 5IYDH 1I3QB 2O4XA 4DR6Q 4JI1L 3I56A 3KJOA 3I4NG 4H44C 3TP8A 3CW2C 2Z9HA 3QIAA 1L0WA 1W2BA 1WYDA 2DJFC 4ALPA 1STBA 4H7BA 2KECA 4LF4Q 2JQOA 3S14B 4DR4Q 1G6ZA 3PIP3 4GN4B 2HIVA 2K52A 4IPDA 2HDMA 2B39A 1VQ9A 4RCOA 1G51A 4ODGA 2PO4A 2NN6I 1VMCA 4KKUA 3A54A 5CBAE 4OHJA 2B63G 2EIFA 1X3GA 3PO2G 1B2TA 2NZOA 1B50A 1U4LA 2PI2E 4DK6C 2OF1A 3CD6A 4A3BB 3HOWB 3AU7A 3SK6A 2PQEA 2D2CC 3NSWA 3HOUB 2ZXPA 3C1EA 3U9OA 3SEBA 1PH5A 2I07B 3P75A 2F4VQ 3R8BA 1B8AA 1NR4A 2UUBQ 1WD1A 2D9UA 3E9HA 3PUYA 2EJMA 4OWXB 5I2YA 2CWPA 1RCVD 5C0XI 2IHFA 5ELBA 4YY3Q 1D7QA 1ET9A 1VQOA 1Y14B 4DGZA 3TP5A 3I90A 4MN3A 3MAQA 1JE5A 1L1OB 4IO9A 3F2UA 1UUPA 1EYDA 2HCCA 5GAHC 5DM63 4H13C 4X3TA 5E4WC 4DV6L 1VQFA 3GTQH 1VDZA 1SMYD 3GTPH 4LFCQ 2NWGA 3HRZC 2SOBA 1JWUD 5KIXA 3NPPA 2VXWA 4A3JG 3NP8A 1SROA 2ZXRA 1B7YB 4C56C 2SNSA 4K0KQ 2RDFA 2B2TC 3E6ZX 1SNPA 2CFMA 3S1RH 4LF9Q 1KRSA 1STEA 4DR1L 3VR4A 3CRKC 3HGBA 1LABA 1JCKB 3D4WA 3K80C 1BCPB 4A3MH 3D0FA 3HKZG 1KHIA 3D31A 3CXCA 2KEEA 1VF5C 4K8JA 3WDNA 1Y1WG 2XWJB 3STBC 3AMUA 4UPAA 2A73B 2UXCL 2MGSA 4FVMA 4H0LC 2M00A 4UDUC 1HNXL 1XPRA 2CQOA 1FGBD 4DNIA 1WCMH 2IJ0A 3DHQA 1DGSA 1C9OA 2F0UA 3GTGH 1G2TA 4HEDA 3FHWA 3TQYA 1WTPA 1QB5D 3HOXG 4HMIA 4IURA 4ZUJA 1B4OA 3S1MB 1I4RA 1Y1VB 4A3CH 1X3FA 4GS3A 4ME3A 3V96A 1PH3A 3S1NH 3ULJA 2N78A 1OTCA 1C7YA 3NQIA 1EIGA 2Z6KA 1WTVA 4RCNA 3CCRA 3I4MH 3BDLA 4I7AA 5IYCH 1KDBA 2XNAC 1V43A 1V9PA 1PH2A 1HCZA 2JP1A 2K75A 2RF4A 4QIWE 2PQAB 1UEBA 1HNWL 1GHKA 4EVOA 2O5JC 1ENFA 3M85A 2F0SA 1PTOD 1VQAA 2RA4A 1A62A 1A63A 4X3KA 5IT9c 2KEDA 1FJGL 1GVPA 1MKHA
chains in the Genus database with same CATH topology
1GUWA 2MJ8A 4KJOA 4CKCA 3FEWX 3DMUA 4CKEA 4IUVA 2NVYB 3J80E 3T53B 5M3MB 4FXDA 4HR7B 4MHEA 4LK1C 3FPPA 1EY9A 1MBYA 4PMWA 4K14A 2K7VA 1ESFA 1BQQT 3HOZB 2JEBI 1ZKOA 1LV9A 5JJZA 1B44D 1E2WA 3MVVA 5CYUA 1TS4A 2F0FA 2WIIB 4R8IA 3GO5A 4EGVA 1UAPA 4BS9A 1CFMA 1XXGA 1O7YA 5M5YB 1EY7A 2IX0A 2X6LA 2B2VC 3L3OC 1AZPA 3NWSA 2J7ZA 2MHVA 2WAQB 3PIO3 1H9JA 2L12A 1ML0D 5EBCA 1KABA 1WTRA 3EVQA 3PUVA 3MA2B 1D5MC 1CHPD 1ILQA 2NN6H 2F03A 2NVQB 1I4QA 1LTBD 4Z9CB 4KY6A 2CW0D 2A68D 2Q8IB 4DN4M 4FXKC 4OIJA 1YNJC 4KV6A 3T51B 3EA6A 1CQFA 1KLUD 2FHTA 4UAIA 1JB3A 5FO7B 3J7AV 5C3WA 1RDPD 5FKAC 2F0QA 5DM73 1SYBA 2SNMA 3A8IE 4QUCA 4C2MB 2NVXB 5BN5A 4CJ0B 1QG7A 2EY1A 2Z8LA 1CA5A 1S5ED 5E4XA 1F9RA 3FKIB 3DWPA 1D1KA 5A2QL 2F0OA 2K03A 5KEEA 4ZYSA 3R93A 5EQ0A 4EQNA 1S5FD 3RZOB 2K5DA 3RMHA 4OL7A 2R7ZB 3QB3A 1Y8NB 3MTSA 4J8QA 3M7NA 4B9XA 1V1OA 2OXPA 1HQRD 3WOFA 1AFPA 3OHXC 5C5MA 4A93B 2KCNA 1LTGD 3W2DA 2B2UC 1SYEA 2DNEA 1EQTA 1HQMC 1SYFA 4C3HG 1DJRD 2AUJD 4RH6A 3NQTA 5KGUA 1S4ZA 2WB1B 3H3VC 3SK5A 4DXGA 2Z1CA 1JE4A 1QOHA 4RGOS 1K83B 4K8IA 3TP6A 3D4DA 3RZDB 1LTTD 1SMYC 3S2HB 1JC7A 3A7LA 1W6JA 4IUTA 5A35A 3V2TA 3OPOA 2L55A 4QIWB 1EQVA 5M5WB 2GA4B 3W3AA 5C3EB 4BY1B 1C48A 1HHVA 4WFN3 3DEOA 2FINB 5D65A 2EYOA 4IUUA 1G291 2PZTA 4O1NA 2B8FA 3JAML 4BA1I 4IUNA 2JE6I 4ZAIA 5CV6A 3MHBA 3HZXA 4G7HC 2EYHA 3DXJC 4DNTB 2ICIA 4DAPA 5KYIA 5T1GA 3VYRA 5F2DA 4DF7A 4XQJA 5CR3A 1PRTF 4KKSA 4DAVA 3FMCA 4RKLA 1BDOA 3BVMA 1RTNA 1Y8OB 2BE5C 2KUMA 5IOCA 3I72A 4RKBA 3J80L 4ILWA 5KRUA 1SE3A 1CZGA 4KD4A 3QJYA 4FF1A 1ONLA 1B1ZA 3KF8A 3OWEB 3OOCA 1CA6A 2EYLA 1EIHA 1I4XA 2WP8J 2LKVA 5D3IB 3KK7A 2RBMA 1B9NA 1MI2A 1F9SA 1QNUA 2A6EC 3X3MA 1EEID 1TT2A 3R2TA 1F2MA 1PTOH 1G2SA 1RHPA 3GTQB 2QKIC 3GTPB 4LMQD 4KN7C 3VR5A 5IIFA 1I4HA 3S1RB 4XQQA 3TN2A 2ZXOA 1I6VC 1B53A 4A3MB 1Z7TA 4PMBA 1ENAA 3K5MA 3NE5B 4OO1G 3MC0B 4IQZA 4BA2I 1HFNA 2PW7A 1G8ZD 4XQNA 3TBIB 3BG3A 3IL8A 1IYVA 1WCMB 2DY7A 2V4DA 1EY0A 2F0WA 1PZID 4GZYC 5FO8B 5CC4A 3PUZA 3E0JA 3S1NB 1BF4A 4M8AA 3T13A 4FNFA 4U68A 4I7ZC 3I4MB 2EJGC 5COYA 4RA8A 3HG9A 3DM1A 2NYZD 3ZYYX 1KNAA 4C3IG 1SSOA 3NBIA 3GV3A 2CW0C 2EYMA 1C8CA 1QWYA 1SYCA 2XIWA 3P7JA 3RLFA 1Y69U 1KDCA 4CBVA 1O80A 1PFMA 5EKIA 1HTPA 2BDNA 2E76C 3O13A 1H9KA 3IFTA 2NB0A 3FVQA 2E75C 4L8JA 3OIQA 4OO1I 2J0TD 4FP5D 2K32A 4QMGA 2JA8B 2R6GA 3M3YB 5C44B 4ZKCB 1TWCB 3H09A 4HSPA 4R9WA 3PV0A 1KDAA 3VA7A 4V0BA 1JOOA 1PRTD 5FLXE 4J1MA 5ELFA 3H0GB 5C6AA 2DN8A 5CV4A 4M1UB 1O7ZA 4DU9A 3D6WA 2FMMA 4C1NI 5A2QE 3DWAA 1EWHA 2A69D 3LX0A 5DNFA 4PNYA 4V190 1XYIA 1Z47A 1ZYRC 1DOKA 2F0GA 4K2KA 5CORA 1SE2A 4RAUC 4J6HA 1ESRA 1CHQD 5EGTA 2K6AA 1F77A 5TSSA 2VUMB 5JPNC 1PDQA 5EBDA 4KK7A 2J4XA 1U4PA 2PNRC 1L0XB 2ENBA 3MEHA 3M7GA 3ERQA 1CQVA 1HUMA 2RQXA 2DY8A 5IGCA 2KQ3A 1EOTA 1IKMA 2HCIA 5C0XJ 1L0YB 4DK1A 2WINB 5JOBA 2TMPA 4G7OC 4A3KB 1O78A 2EY2A 2NBFA 1YNND 4C1NK 5IGDA 3KBGA 1OXUA 3UI2A 1TY2A 2EE1A 1C4QA 3K58A 3I4NB 1DYQA 1OXXK 2RDHA 4S3SA 2NVTB 2SDFA 5LL6X 1BR9A 1STAA 1V8QA 3JAME 4XTCS 4KY7A 2BA1A 1XX8A 2QILA 5KYLA 3S15B 5JAVA 1LO5D 1EWCA 1HA5A 4LJZC 3EFXD 2VNUD 1X3QA 3S16B 1XWEA 4KTAA 5HURA 3MXNA 1J9OA 2WKDA 4KD3A 1U4RA 2B8GA 3TMEA 3D3RA 1WTQA 4RGTA 4HCEA 4X3SA 4IFDG 3PUXA 3G6JB 4G7ZC 2XSCA 1CI3M 1SNOA 1K8OA 3SR1A 4ABNA 2H4OA 3VR2A 2Q8RE 1EU4A 4HTHA 2XRSD 1CTMA 3FDTA 5J22A 1JR0D 3FPUB 1LTAD 2MP1A 2Z4IA 4KJNA 2QCPX 5EKLA 3KLSA 2JXMB 4IUQA 3N52A 4F8MA 1NR2A 3C2PA 4A3JB 1GUOA 1SE4A 4I65A 3URYA 2VB2X 3C3LA 2KCCA 1M4VA 4XDXA 1HTLD 2EYPA 3NTKA 3I70A 3M4OB 4KHZA 1I4GA 3A8JE 4A3FB 4G57A 3HKZB 5KNCA 2BCOA 4TSSA 1GOZA 1Y1WB 1I4PA 1H9RA 4IFDI 1HRJA 2PW5A 3MFGA 1LT5D 5EPJA 5I6YA 3HOXB 4RWSC 3KUPA 2PZUA 2F0TA 3KBXA 4DXFA 5HGTA 4TKOB 3NTHA 2XN9C 1R4PB 2PCFB 3CRLC 1KTKA 2E74C 3BYYB 1DOMA 1T5EA 5FLXL 5C0XH 1LT6D 2H1EA 4DK0A 3SXHA 2AWNA 3SK4A 2TSSA 3MXPA 4JBWA 2F0DA 2N55A 4K5XA 2FFKB 2WKCA 3SDZA 1PTOB 4ME5A 2A74C 1RODA 3HS0C 1GUNA 2HQEA 1SBBB 4XYQA 2L4NA 4C3JG 4OIKA 4B9WA 4RHRA 3E5SA 2WACA 4WORA 1EYAA 1PRTC 1RJTA 3Q6SA 4XYOA 2E2HB 2XRQD 2YU9B 1KAAA 1SXTA 3VYTA 3MWYW 2MPMA 1EY4A 1JOQA 1JICA 5D3DA 1LT4D 2KHSA 2ID0A 2K1BA 2RSOA 1SNQA 1BCPF 5K36G 4NKLA 2F0IA 1A3VA 1IKLA 1GHJA 4RFBA 3T56B 1F2YA 1TS2A 2K01A 3MZ5A 1BOSA 3VR6A 3QO2A 2IX3A 5C3XA 1MSHA 5BN4A 1TQOA 3CQZB 2BA0A 2EPBA 2O2LD 2F0MA 3K0YA 3PMFA 4BY7B 4ZQ3A 2QF7A 2F0EA 5JVH3 2IX1A 4A3DB 3J7YW 2QEJC 3OMGA 2JA7B 2L9HA 1O7LA 1BXTA 3H6MA 1R9TB 4FO2A 1MD2D 1F9PA 2B2WA 4LAAA 4F87A 2PZWA 2R61A 2E2IB 4HN7A 3BDCA 1RKNA 2LMCB 5M3FB 1TR5A 2OEOA 1STHA 3K5LA 2RKSA 2L11A 2F0KA 3BZDB 1SNCA 1D2BA 2AUKA 1Q8IA 4XIGS 2AWOA 2E2JB 5EPKA 1PTOC 1GUSA 3V05A 2JSOA 1TWAB 3SHLA 3S17B 4IFDH 5C5LA 1KNEA 1JOKA 1OXTA 4C3HB 5JEAG 3X3NA 2F0HA 5E3FA 1S5BD 3BS1A 4N9TA 3CU7A 3OMCA 2NTSA 5EPLA 1A15A 4ZRZA 2F0JA 5CMDA 1FR3A 3I4LA 4K5VA 3SK8A 3C46A 3NUCA 1CZWA 2K04A 2RVLA 2QDBA 2C5CA 1H9SA 2RDGA 1LACA 2JA6B 5C4HA 1EU3A 2K05A 3AB9A 5M9OA 5K5PA 4FYDA 1LTSD 4PQXA 3L7ZC 2EVBA 1HFGA 1DZ1A 2EZVA 1F2LA 3EJIA 1TS3A 5KNDA 1E0BA 1FNVA 2EYFA 3CHBD 4A3GB 1ZEQX 3VYUA 5ISRA 1BCPD 4HCSA 3WOEA 2R92B 3S9WA 1RD9D 2I46A 3J81E 5T1IA 1EY5A 2YYZA 4BWGB 2LY7A 2M9VA 3IFDA 3OSOA 2A68C 2HUGA 1A2UA 2K5WA 2KA7A 1AZQA 3SVMA 1HPCA 1WVLA 3GTOB 1TU2B 2VB3X 1WTWA 1SAPA 2A6HD 3T4AC 3S2DB 1QILA 3U9SA 4JK1C 4R8NA 3NK9A 4ULLA 1NUCA 1DXMA 5IT9L 5DEHA 2MUYA 3ONAB 3NHHA 4Q5VA 4FF3A 3C1FA 3K6OA 2F3VA 1Y8PB 3D8GA 4K2LA 3QG1A 2WV6D 1DM0B 5JEAJ 2F3WA 4E6IA 4Y7NB 2F0PA 4B08A 2A5HA 2OT2A 3GTJB 4NMZA 2AQ1B 1B3AA 4ID6A 3GP7A 4P2CB 2JYOA 4IUPA 3LWUA 1V1PA 5CV9A 1IW7D 4DFAA 3SE0A 5ELEA 2KVMA 3MFYA 1EL0A 2D62A 2E2DC 2IL8A 4XT3B 3H91A 5J39A 4EQPA 1B9MA 4ZUIA 2B2YA 1SJED 1TWHB 1LT3D 3OWFA 3TSSA 1TY0A 3M4YA 4O42A 5K36H 1EYCA 1NCVA 1QNKA 2LS01 4KKTA 3BYTB 1UEAB 5ELCA 1DONA 3P20A 3FRPB 1BUVT 4QF4A 3VYSA 1F2ZA 5FO9B 3OIPA 1EY8A 5FOBB 1RTOA 2PMZB 1II3A 4C3IB 2X6GA 1JQYD 5C4JB 1SFOB 4RHSA 3GTLB 2XWBB 2NZ1D 5IODA 2AQ2B 4ZLTF 1SDFA 1F9QA 1GJXA 4MIUA 3HP3A 4HMJA 3HOYB 4DAYA 1IYUA 4KHVA 3Q0AA 2EY6A 1WD0A 2IW3A 2BE5D 2DNCA 1EFID 3K59A 1WTXA 4U673 2K33A 2B63B 3OW7A 3PO2B 4RGMA 3RD4A 5LHY1 1STGA 1JWSD 1PMRA 3GTMB 1G91A 5CBEE 1D6EC 4EQOA 5DAUA 2FMCA 2O5IC 1TWFB 4RGNA 1PRTB 4N9PA 4CJ1B 2EXZA 4FXGC 4XXEA 2JA5B 1UNSA 1SNDA 3GD7A 4WJWA 4CHTB 4DA2A 2K5QA 1DOLA 4NDXA 2F1MA 3DWQA 2A6ED 1QE6A 4A3EB 1HA6A 1EY6A 4G4KA 1X3PA 5CV5A 5JEAH 1A3UA 4XT1B 2CVRA 3GTKB 4Q0FA 1LLRD 1OXVA 3I8ZA 2BDOA 2B2TA 2SEBD 1I50B 2IT1A 1T5XD 1S5DD 3ND9A 2K28A 4K6LA 2Y0SB 3Q24A 4QB4A 1D5XC 3J81L 4OO1H 3DUZA 5D14A 1PLFA 5NUCA 1Q1BA 2R3ZA 3ITPA 3ND8A 4KY5A 3NTIA 1AEXA 4AYBB 4K5WA 2F0LA 1BNZA 3BVZA 2LFNA 2L0CA 3DEPA 1A6XA 1Q90A 3NBHA 1H9SB 2JEAI 1GUGA 3BDOA 2BOSA 4YIJA 1BCPC 1MGSA 3LWEA 1VCIA 3Q22A 5CV8A 1TS5A 2KJXA 3I73A 3RUZA 1EZ8A 3N6RA 5IGFA 1RF2D 3L9AX 4L6TB 1PYWD 3HOVB 5CGKA 2A6HC 4IFDJ 1CM9A 1STNA 3K5OA 1ILPA 2B2WC 5JVG3 4ZKBB 2EDGA 1K8MA 1U4MA 4CJ2C 2PYKA 1TWGB 3TZDA 4BBRB 4KMUC 2L5TA 1SNMA 3IAYA 2EY5A 4F88A 1QCBD 1KLGD 1LTID 4KN4C 3R3OA 5I2XA 5IT9E 4ZK9B 2M2LA 1TKWB 3NXWA 1PZJD 5E1FA 1FYCA 3I91A 1IL8A 3IKJA 1LTRD 4BBSB 1BO0A 4A3IB 4KI0A 3GV6A 1VF7A 3T16A 1SJHD 2A69C 4QUFA 3K7AB 1IW7C 2KOLA 2AQ3B 2B2VA 1ICWA 1MSGA 1ZYRD 2CHBD 1V1PB 5G3LF 3HEJA 1M8AA 2EOTA 2N88A 3PO3B 4NP5A 1XTCD 3MXUA 3QOLA 1PZKD 3LNNA 1S5CD 3EROA 1CT1D 2F0VA 4WRDA 2ZT9C 4IALA 3K57A 5IGGA 4OGQC 3A56A 5I4DA 1NAPA 1AW7A 2Q8TA 1AN8A 2PPBC 3TDQA 5KNBA 4K6DA 1E2VA 5EKKA 3J7AF 5C4ZA 4TRDA 3MXGA 1I6HB 3KLSX 3TZUA 5AFWA 5ELDA 3A7AB 1HXYD 2G9HD 1YNNC 1STYA 3D6CA 4L63B 1GUTA 2G9DA 1E2ZA 1SEBD 2C9OA 3CKIB 1BBXC 4FF4A 4CKBA 1AP0A 1J8IA 2D5DA 1OO9B 4C3JB 2NTTA 1TVXA 1PFBA 5C4XB 1PXUA 1IHZA 3TP7A 1D5ZC 4QCLA 2B2UA 1DD2A 3P1HA 2ICEC 1A2TA 5FK9C 3I3CA 1Z6HA 1NSNS 4NW2A 5I9OA 2FJ2A 2Z4HA 1DCZA 1FD7D 2L1BA 4PMCA 5I9PA 2CQAA 2F0NA 3VA5A 1EEFD 3VR3A 5EJWA 3A55A 1SYDA 2RSNA 3S1QB 1WTOA 5CV7A 1D1IA 4PV1C 3D4RA 5BN3A 1FNWA 3R2IA 5IGBA 3Q23A 1ET6A 2EYJA 4IZ8A 5LL6S 3QWNA 1X32A 4IN3A 4TQUS 1Q1EA 4X3UA 1JORA 1VMPA 1CK1A 1TIID 4DNRB 5I6WA 1SYGA 4HSVA 1QJOA 1ENCA 1EZ6A 1GXDC 3A8KE 2IWHA 1H9MA 1Q3LA 1JWMD 2B2YC 3GTGB 2R93B 2X69A 4FF2A 2NUCA 2NN6G 3H94A 2HDLA 5G3LD 3EQLC 5JPMC 1PFNA 3BVGA 1ZXTA 1A3TA 3GQBA 2XVSA 1YNJD 1W6KA 2F4IA 3G7LA 1HUNA 2IPKD 1OXSC 3K5NA 1PTOF 1R4QB 4F7XA 1Q12A 1FNUA 5M5XB 4CGYB 5J1ZA 4HAEA 2EJFC 1U9RA 5C0XG 5IGEA 3NWTA 3KLRA 3PUWA 3QOJA 1I3QB 2O4XA 4H44C 3TP8A 3QIAA 1STBA 4H7BA 2KECA 3S14B 1G6ZA 3PIP3 2HDMA 2B39A 4RCOA 4ODGA 2PO4A 2NN6I 1VMCA 4KKUA 3A54A 5CBAE 4OHJA 1B2TA 1B50A 1U4LA 2OF1A 4A3BB 3HOWB 3AU7A 3SK6A 2PQEA 2D2CC 3NSWA 3HOUB 2ZXPA 3C1EA 3U9OA 3SEBA 2I07B 3P75A 3R8BA 1NR4A 1WD1A 2D9UA 3PUYA 2EJMA 5I2YA 1RCVD 5C0XI 5ELBA 1ET9A 4DGZA 3TP5A 3I90A 4MN3A 3MAQA 3F2UA 1UUPA 1EYDA 2HCCA 5DM63 4H13C 4X3TA 5E4WC 1VDZA 1SMYD 2NWGA 5KIXA 2SOBA 1JWUD 3HRZC 3NPPA 2VXWA 3NP8A 2ZXRA 4C56C 2SNSA 2RDFA 2B2TC 3E6ZX 1SNPA 1STEA 3VR4A 3CRKC 3HGBA 1LABA 1JCKB 3D4WA 1BCPB 3D31A 2KEEA 1VF5C 4K8JA 3WDNA 2XWJB 3AMUA 2A73B 2MGSA 4FVMA 4H0LC 2M00A 4UDUC 1FGBD 2IJ0A 3DHQA 2F0UA 1G2TA 4HEDA 1WTPA 1QB5D 4HMIA 4IURA 4ZUJA 1B4OA 3S1MB 1I4RA 1Y1VB 3V96A 3NQIA 1EIGA 1WTVA 4RCNA 3BDLA 1KDBA 2XNAC 1V43A 1HCZA 2JP1A 1GHKA 4EVOA 2O5JC 1ENFA 3M85A 2F0SA 1PTOD 2RA4A 4X3KA 2KEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUW A;  1Q3L A;  2B2T A;  2K1B A;  2MJ8 A;  2RSO A;  2SDF A;  1BBX C;  3TN2 A;  2B2Y C;  1RTO A;  4ZK9 B;  4QUC A;  2M2L A;  2K28 A;  2X6G A;  2X69 A;  3I91 A;  3I90 A;  4MN3 A;  1IL8 A;  1B53 A;  5EPJ A;  1AP0 A;  3F2U A;  1HHV A;  2HDL A;  4IUV A;  1XX8 A;  3DEO A;  1O7Z A;  1IKL A;  1BO0 A;  1KNE A;  1PFN A;  2FIN B;  1ZXT A;  2HCC A;  5D65 A;  1J8I A;  4IUU A;  3D6W A;  3GV6 A;  3ONA B;  4MHE A;  4X3T A;  5E4W C;  1HRJ A;  2NZ1 D;  2FMM A;  4CJ0 B;  4RWS C;  2K01 A;  1QG7 A;  4ZLT F;  1SDF A;  2NWG A;  5D14 A;  1PLF A;  1TVX A;  1X3Q A;  1F9Q A;  3KUP A;  4ZAI A;  2VXW A;  2R3Z A;  1CA5 A;  1HFN A;  1PFB A;  4QUF A;  3QO2 A;  3G7L A;  5E4X A;  1F9R A;  1HUN A;  3HP3 A;  1J9O A;  1MSH A;  1U4R A;  5DNF A;  2B2T C;  3IL8 A;  3KBX A;  5EPL A;  2K03 A;  1A15 A;  2KOL A;  2DY7 A;  5CMD A;  1WTQ A;  5T1G A;  2EPB A;  2B2U A;  2B2V A;  1ICW A;  1BNZ A;  1XYI A;  4X3S A;  1MSG A;  3I3C A;  4HAE A;  4NW2 A;  1DOK A;  3DEP A;  3R93 A;  2K04 A;  5COR A;  2FJ2 A;  4RAU C;  1DOM A;  5EQ0 A;  1ESR A;  1WD0 A;  1LV9 A;  1RTN A;  2RVL A;  1B3A A;  2L9H A;  5JJZ A;  1WTX A;  2KUM A;  2L1B A;  1M8A A;  2H1E A;  2KEE A;  1BF4 A;  2EOT A;  2N88 A;  3MTS A;  4R8I A;  1MGS A;  2Q8R E;  3LWE A;  2JYO A;  4U68 A;  4IUP A;  1F9P A;  2B2W A;  3FDT A;  5EJW A;  2MGS A;  1O7Y A;  1PDQ A;  2K05 A;  5COY A;  2RSN A;  2N55 A;  2X6L A;  4RA8 A;  2FFK B;  1G91 A;  3DM1 A;  3FPU B;  5CBE E;  2NYZ D;  1HFG A;  2B2U C;  2B2V C;  1U4P A;  2MP1 A;  1KNA A;  1WTO A;  1DZ1 A;  1SSO A;  1F2L A;  3GV3 A;  1ROD A;  2KEC A;  1AZP A;  1G2T A;  2J7Z A;  4HED A;  1C8C A;  1NAP A;  4IUQ A;  2KVM A;  1G6Z A;  2XIW A;  1EQT A;  2L12 A;  2L4N A;  3P7J A;  3N52 A;  1WTP A;  1CA6 A;  1EL0 A;  4CJ1 B;  1NR2 A;  1O80 A;  1PFM A;  2HDM A;  5EKI A;  2IL8 A;  2BDN A;  1E0B A;  1B4O A;  1HUM A;  4IUR A;  2Q8T A;  1EIH A;  1ML0 D;  2DY8 A;  4OIK A;  1S4Z A;  4XT3 B;  3H91 A;  1CM9 A;  1VMC A;  5CBA E;  4HCS A;  1EOT A;  1IKM A;  1EIG A;  2B2Y A;  1RJT A;  1ILP A;  1DOL A;  2HCI A;  1WTV A;  3Q6S A;  1B2T A;  1B50 A;  2L11 A;  1MI2 A;  2B2W C;  1F9S A;  4XDX A;  1U4L A;  4ZKB B;  1WTR A;  1X32 A;  4X3U A;  1U4M A;  1JE4 A;  4O42 A;  5T1I A;  4CJ2 C;  1QE6 A;  1ILQ A;  3MWY W;  1HA6 A;  2JP1 A;  2MPM A;  5AFW A;  1NCV A;  1JIC A;  1G2S A;  1QNK A;  3IFD A;  1RHP A;  4ZKC B;  1VMP A;  3TZD A;  2HUG A;  5EPK A;  4DN4 M;  1DON A;  1X3P A;  1AZQ A;  4OIJ A;  3SVM A;  4R9W A;  4XT1 B;  2CVR A;  4HSV A;  4LMQ D;  1WVL A;  3UI2 A;  4IUT A;  1NR4 A;  2RA4 A;  4X3K A;  2EE1 A;  1WTW A;  1WD1 A;  2D9U A;  2FHT A;  4UAI A;  2KED A;  1SAP A;  3I8Z A; 
#chains in the Genus database with same CATH topology
 4MZ9 A;  1GUW A;  2MJ8 A;  1I3Q H;  4JI8 L;  1QVF A;  4KJO A;  2ZM6 L;  4CKC A;  1BBW A;  3FEW X;  3DMU A;  4CKE A;  4IUV A;  2NVY B;  3J80 E;  3T53 B;  4B3M L;  2JA8 H;  3M4Q A;  2AHO B;  5M3M B;  4FXD A;  4Y52 H;  4HR7 B;  4MHE A;  3M3Y H;  5C44 H;  3I2Z A;  4LNQ A;  2PNH A;  3WWV A;  4IOC A;  3F8T A;  4LK1 C;  3FPP A;  3G4S A;  1EY9 A;  2VZA A;  1MBY A;  1VQM A;  4PMW A;  1LTL A;  4K14 A;  2UUA Q;  2K7V A;  1ESF A;  2I5L X;  1BQQ T;  3HOZ B;  2JEB I;  3H0G H;  2D0O A;  1N36 L;  1ASZ A;  1ZKO A;  4BBS G;  1LV9 A;  5JJZ A;  1B44 D;  1E2W A;  3MVV A;  5GQO A;  5CYU A;  1TS4 A;  2F0F A;  2WII B;  4R8I A;  3GO5 A;  3AFP A;  1NY4 A;  4EGV A;  1UAP A;  4BS9 A;  1CFM A;  1XXG A;  3RNU A;  4DR6 L;  1O7Y A;  5M5Y B;  1EY7 A;  2IX0 A;  2X6L A;  1YIJ A;  3J81 j;  2B2V C;  2A1A A;  4GNX A;  3L3O C;  1AZP A;  3NWS A;  2K14 A;  2J7Z A;  1U5K A;  2MHV A;  2WAQ B;  3PIO 3;  1H9J A;  2L12 A;  4LF4 L;  4DR4 L;  1YHQ A;  1ML0 D;  2VUM H;  3ZJY C;  5EBC A;  1N33 Q;  4A75 A;  1A0I A;  1IYJ B;  4DR2 L;  1XPO A;  1KAB A;  1WTR A;  1TXY A;  4HJ5 A;  3EVQ A;  3PUV A;  3MA2 B;  4HIK A;  1D5M C;  1CHP D;  1ILQ A;  2NN6 H;  2F03 A;  2GVA A;  1I4Q A;  4JOI C;  2NVQ B;  1LTB D;  4BY7 G;  4Z9C B;  3UDF A;  1SRU A;  4KY6 A;  2CW0 D;  2A68 D;  2Q8I B;  1HR0 Q;  4A3D G;  4DN4 M;  4FXK C;  4OIJ A;  1YNJ C;  4KV6 A;  2JA7 G;  4JBM A;  3E0E A;  3T51 B;  3EA6 A;  1CQF A;  1KLU D;  2FHT A;  4UAI A;  1JB3 A;  1KC8 C;  5FO7 B;  1WOC A;  3J7A V;  5C3W A;  2UUB L;  2HHH Q;  2AKW B;  1CKM A;  3CME A;  1RDP D;  5FKA C;  2F0Q A;  5DM7 3;  1SYB A;  2SNM A;  3A8I E;  4QUC A;  4C2M B;  2C35 B;  2NVX B;  4NB3 A;  4YY3 L;  3E9I A;  1NTG A;  5BN5 A;  3KF6 A;  4A3K H;  4CJ0 B;  1QG7 A;  2EY1 A;  2Z8L A;  1CA5 A;  2FXQ A;  1S5E D;  5E4X A;  5M3F G;  1F9R A;  3FKI B;  4LFC L;  3VDY A;  1CSQ A;  3DWP A;  3I4N H;  1JB7 A;  1D1K A;  5A2Q L;  2F0O A;  2NVT H;  1M1K C;  2K03 A;  4K0K L;  4LF8 L;  1IBM Q;  2A8V A;  5KEE A;  4A76 A;  1VQ4 A;  4ZYS A;  3R93 A;  5IP7 H;  5EQ0 A;  3JC6 6;  4EQN A;  1S5F D;  3RZO B;  3S15 H;  2K5D A;  1YIT A;  3RMH A;  4OL7 A;  2R7Z B;  3QB3 A;  1Y8N B;  3MTS A;  4J8Q A;  2IY5 B;  3S16 H;  4JI4 L;  4B9X A;  3M7N A;  1V1O A;  2OXP A;  1HQR D;  3WOF A;  1AFP A;  4YHH Q;  3OHX C;  2UXD Q;  5C5M A;  3KDF A;  4A93 B;  2KCN A;  1LTG D;  3W2D A;  2D0P A;  2B2U C;  1SYE A;  2DNE A;  4B3S L;  1NJI C;  1EQT A;  1HQM C;  1SYF A;  4C3H G;  1DJR D;  2AUJ D;  4RH6 A;  3UDI A;  4JI3 Q;  1YJ9 A;  3NQT A;  5KGU A;  1S4Z A;  2WB1 B;  5IP9 G;  3H3V C;  1I94 L;  3SK5 A;  2N8N A;  4OEM B;  4DXG A;  4DR5 L;  2Z1C A;  1JE4 A;  1QOH A;  1JMC A;  4RGO S;  1K83 B;  4K8I A;  3TP6 A;  3D4D A;  3E3X A;  3RZD B;  1LTT D;  4A4I A;  1SMY C;  1VQH A;  2LXK A;  1JC7 A;  3S2H B;  4HJA A;  2JK8 A;  3A7L A;  1W6J A;  4IUT A;  5A35 A;  4A3J H;  3V2T A;  3OPO A;  3KYH C;  2L55 A;  4QIW B;  1EQV A;  1WTH A;  5M5W B;  2GA4 B;  3W3A A;  5C3E B;  2JA6 G;  2ZTC A;  4BY1 B;  1C48 A;  2MNA A;  1HHV A;  4WFN 3;  1LM0 A;  1K73 C;  3DEO A;  2FIN B;  5D65 A;  3M4O H;  2EYO A;  4IUU A;  1G29 1;  2PZT A;  4O1N A;  4A3F H;  3CC7 A;  4GLX A;  2B8F A;  3JAM L;  1IBL Q;  4BA1 I;  4IUN A;  1HH2 P;  2JE6 I;  4ZAI A;  5CV6 A;  3MHB A;  3HZX A;  4G7H C;  3NEL A;  2EYH A;  1HZC A;  3DXJ C;  1Y1W H;  2Q2I A;  4DNT B;  2ICI A;  4DAP A;  5KYI A;  1S40 A;  1IBK L;  5T1G A;  4GOP C;  3VYR A;  5F2D A;  4DF7 A;  4XQJ A;  5CR3 A;  2ALY B;  1PRT F;  4KKS A;  4DAV A;  2UUA L;  3FMC A;  2NVQ H;  4RKL A;  1BDO A;  3BVM A;  1RTN A;  1Y8O B;  2BE5 C;  5FLM G;  3IRB A;  3HOX H;  2Q2U A;  2A19 A;  2KUM A;  5IOC A;  3I72 A;  4RKB A;  3J80 L;  4ILW A;  5KRU A;  2KCT A;  1SE3 A;  4DAY B;  2B29 A;  1CZG A;  4KD4 A;  3QJY A;  4JI0 Q;  4B3T Q;  4FF1 A;  1ONL A;  1B1Z A;  3KF8 A;  2GVB A;  1AE3 A;  1CKN A;  2QW7 A;  3BZC A;  3OOC A;  2PMZ E;  3OWE B;  3DLL A;  1X55 A;  3EN2 A;  1CA6 A;  4N8X 1;  5LMN W;  2EYL A;  1EIH A;  1Q81 C;  1I4X A;  2WP8 J;  2LKV A;  3CCL A;  5D3I B;  3KK7 A;  2RBM A;  3FKI H;  1MI2 A;  1B9N A;  1F9S A;  1QNU A;  4POG A;  2A6E C;  3X3M A;  4MNO A;  1EEI D;  1TT2 A;  3R2T A;  1E1O A;  4L5S A;  1F2M A;  1PTO H;  1G2S A;  4NXN Q;  3OTO L;  1RHP A;  3GTQ B;  2QKI C;  3GTP B;  4LMQ D;  4YWK A;  1HR0 L;  4KN7 C;  3VR5 A;  1K8G A;  4O2D A;  5IIF A;  1I4H A;  3S1R B;  4XQQ A;  4DV0 Q;  3TN2 A;  3UE1 A;  2ZXO A;  1I6V C;  5FJ8 G;  2UXB L;  1IXR A;  2HHH L;  2E2H H;  2YU9 H;  4TVA B;  1B53 A;  4EX5 A;  2BH8 A;  4A3M B;  3M4P A;  1Z7T A;  2DGY A;  4PMB A;  2LXJ A;  1ENA A;  1KD1 C;  3K5M A;  3HOU G;  4MTK A;  3NE5 B;  4OO1 G;  1GO3 E;  3MC0 B;  3TS0 A;  4IQZ A;  4BA2 I;  3JAM i;  1HFN A;  2PW7 A;  1G8Z D;  4XQN A;  3TBI B;  3BG3 A;  5BR8 Q;  4HJ8 A;  3IL8 A;  1IYV A;  1WCM B;  2DY7 A;  2V4D A;  4LF5 Q;  1EY0 A;  2F0W A;  2DUD A;  3H15 A;  1IBM L;  1PZI D;  1P16 A;  1K3B C;  1PH7 A;  1LUZ A;  4GZY C;  5FO8 B;  5CC4 A;  3PUZ A;  3E0J A;  3S1N B;  4GKK Q;  1BF4 A;  4LUV A;  4M8A A;  3T13 A;  4FNF A;  2VS1 A;  4H02 A;  4L5Q A;  4U68 A;  4I7Z C;  2JJQ A;  3I4M B;  2EJG C;  5COY A;  2RHS B;  4RA8 A;  3NBH B;  3HG9 A;  3DM1 A;  2NYZ D;  3ZYY X;  1KNA A;  4C3I G;  1X6O A;  4YHH L;  1SSO A;  3NBI A;  3ER0 A;  3GV3 A;  2CW0 C;  4GLV B;  2EYM A;  1C8C A;  4JI7 Q;  1QWY A;  1SYC A;  2XIW A;  3P7J A;  1Q46 A;  2Y0S E;  3RLO A;  1KDC A;  3RLF A;  4CBV A;  1Y69 U;  4A3D H;  1O80 A;  1PFM A;  5EKI A;  1HTP A;  2BDN A;  2E76 C;  3O13 A;  1H9K A;  3IFT A;  2NB0 A;  3FVQ A;  1R9T H;  2E75 C;  3HKZ E;  4DV1 Q;  4HIO A;  4L8J A;  3OIQ A;  4OO1 I;  1XJV A;  2J0T D;  1SR3 A;  3HOY G;  4FP5 D;  2K32 A;  4QMG A;  2JA8 B;  4IPG A;  3G48 A;  4AYB E;  1VQ5 A;  2R6G A;  3M3Y B;  5C44 B;  4ZKC B;  2E2I H;  1XNQ L;  1TWC B;  3H09 A;  2Z0S A;  4HSP A;  4R9W A;  3PV0 A;  1VQJ A;  1KDA A;  1Y1V G;  3VA7 A;  4V0B A;  1JOO A;  4R4C A;  1PRT D;  1WI5 A;  2Z6K C;  1NBW A;  3J80 c;  3PIP A;  5FLX E;  4J1M A;  5ELF A;  1BKB A;  3H0G B;  5C6A A;  2DN8 A;  5CV4 A;  1CUK A;  4M1U B;  2K50 A;  5LMU L;  1O7Z A;  1SLJ A;  4GLA C;  1H95 A;  1EFW A;  4DU9 A;  3D6W A;  4JPB W;  2XTI A;  2FMM A;  4C1N I;  4CDC C;  5A2Q E;  3DWA A;  1EWH A;  2E2J H;  2GN5 A;  1XPU A;  2A69 D;  3LX0 A;  2JA5 G;  1MJE A;  1GKH A;  5DNF A;  3CP0 A;  2QDL A;  1JJ2 A;  4PNY A;  1PH1 A;  4V19 0;  1TWA H;  1XYI A;  3S17 H;  1Z47 A;  1A8V A;  1ZYR C;  1VQN A;  4A3E G;  1DOK A;  4R4T A;  2F0G A;  4K2K A;  5COR A;  1SE2 A;  4RAU C;  4J6H A;  2RCN A;  1ESR A;  1CHQ D;  5EGT A;  4C3H H;  2K6A A;  1F77 A;  5TSS A;  3AEV A;  2VUM B;  3KDF B;  3QR8 A;  5JPN C;  1QUQ A;  2ASB A;  1PDQ A;  5EBD A;  4KK7 A;  2J4X A;  1U4P A;  2Y0S G;  2PNR C;  4YCV A;  1N9W A;  1L0X B;  2ENB A;  3MEH A;  3M7G A;  3ERQ A;  1CQV A;  1HUM A;  2RQX A;  4OON A;  2DY8 A;  5IGC A;  4DV3 Q;  2KQ3 A;  1EOT A;  5AJ3 L;  1IKM A;  2HCI A;  5C0X J;  1I5F A;  1MHW C;  4QL5 A;  2JA6 H;  1L0Y B;  4DK1 A;  4AYB G;  4DV4 Q;  2WIN B;  5JOB A;  1Q7Y C;  1EQQ A;  2TMP A;  1N8R C;  4G7O C;  4A3K B;  1O78 A;  2EY2 A;  4GNX C;  1YHA A;  2NBF A;  1YNN D;  4C1N K;  4UP7 A;  2EQS A;  5IGD A;  3KBG A;  1UE6 A;  1OXU A;  3UI2 A;  1TY2 A;  2EE1 A;  1C4Q A;  3K58 A;  3I4N B;  4A3G H;  1DYQ A;  4UP9 A;  1OXX K;  5LMN Q;  2RDH A;  4S3S A;  2NVT B;  5IWA Q;  4JCV E;  2SDF A;  5LL6 X;  1BR9 A;  1STA A;  4DV7 Q;  1V8Q A;  2R92 H;  4DV0 L;  3JAM E;  1KQS A;  1SMX A;  1VQ7 A;  4DAM A;  4XTC S;  4KY7 A;  4X66 Q;  2BA1 A;  1XX8 A;  2QIL A;  5KYL A;  3S15 B;  5JAV A;  3J7Z C;  1LO5 D;  1EWC A;  1HA5 A;  4LJZ C;  5FLM H;  3EFX D;  2VNU D;  1PFS A;  1X3Q A;  3HOV G;  3S16 B;  4YWM A;  3GTO H;  1XWE A;  4KTA A;  5HUR A;  3MXN A;  1J9O A;  2WKD A;  4KD3 A;  1T9H A;  1U4R A;  3S2D H;  2B8G A;  3TME A;  3D3R A;  4X62 L;  1WTQ A;  4RGT A;  2CH4 A;  4QQB X;  4HCE A;  4X3S A;  4IFD G;  4LF5 L;  3PUX A;  1VQP A;  4L5R C;  2ZTD A;  3G6J B;  4G7Z C;  2XSC A;  1CI3 M;  1XNR Q;  5GAG C;  1SNO A;  1K8O A;  3SR1 A;  4BBR G;  1YI2 A;  4ABN A;  1VQD A;  2H4O A;  3OYY A;  3VR2 A;  2Q8R E;  1EU4 A;  4AQY Q;  4GKK L;  4HTH A;  2XRS D;  3CCJ A;  1CTM A;  3FDT A;  3K8A A;  5J22 A;  1JR0 D;  3FPU B;  3W1B A;  4Y7N H;  1LTA D;  2MP1 A;  2Z4I A;  2JN4 A;  3DM3 A;  4KJN A;  2QCP X;  5EKL A;  3KLS A;  4OXP A;  4HJ7 A;  2JXM B;  4IUQ A;  2RHQ B;  3N52 A;  4LW1 A;  4F8M A;  4A3I G;  1NR2 A;  3C2P A;  4A3J B;  1QVG A;  1GUO A;  2WFW A;  1ICF B;  1L2F A;  2K4K A;  1SE4 A;  4I65 A;  3URY A;  2VB2 X;  3C3L A;  2KCC A;  4X64 Q;  1HZA A;  1M4V A;  4XDX A;  5FJ8 H;  4DV1 L;  1HTL D;  2EYP A;  3NTK A;  1XMQ Q;  1RIP A;  3I70 A;  2ZTE A;  3M4O B;  1X65 A;  4KHZ A;  4DV2 Q;  4QGU A;  1I4G A;  3A8J E;  4A3F B;  4G57 A;  4LUZ A;  4JBK A;  3HKZ B;  5KNC A;  2BCO A;  2R7D A;  4YCU A;  4LFB Q;  4TSS A;  1GOZ A;  1Y1W B;  1I4P A;  1H9R A;  4IFD I;  1HRJ A;  2PW5 A;  2WB1 G;  3MFG A;  4JI2 Q;  3PO3 G;  1VQ8 A;  4ZCK A;  4P74 A;  3PIO A;  4GKJ Q;  1LT5 D;  5EPJ A;  5I6Y A;  3HOX B;  4RWS C;  4JBJ A;  3ULL A;  3CPW A;  3KUP A;  2PZU A;  1J5E Q;  4GOP B;  1EUJ A;  4X65 Q;  3PCO B;  2F4V L;  1E1T A;  5JJI A;  3I55 A;  2F0T A;  3AYH B;  2ES2 A;  3KLW A;  3KBX A;  4DXF A;  5HGT A;  5C3E G;  3W5O A;  4TKO B;  4BY1 G;  3NTH A;  2XN9 C;  1R4P B;  2PCF B;  3CRL C;  1E22 A;  1QVC A;  3S24 A;  4C3I H;  5C4J H;  1KTK A;  2E74 C;  3BYY B;  3GTL H;  1DOM A;  1T5E A;  5FLX L;  5C0X H;  1PH9 A;  5J3B A;  5IYD G;  1LT6 D;  2H1E A;  4DK0 A;  3SXH A;  2AWN A;  3AQQ A;  1YBY A;  3SK4 A;  1U0L A;  2TSS A;  3MXP A;  4JBW A;  2F0D A;  2N55 A;  4K5X A;  2FFK B;  2WKC A;  3SDZ A;  3HOY H;  1K28 A;  1PTO B;  1Q8K A;  4ME5 A;  2A74 C;  3U50 C;  4LF9 L;  1ROD A;  3HS0 C;  1GUN A;  2HQE A;  1SBB B;  4XYQ A;  2L4N A;  2UUC Q;  2JA9 A;  4HIM A;  1X3E A;  1K0R A;  4PG3 A;  4C3J G;  4OIK A;  3BJU A;  5IY0 A;  3K81 C;  4B9W A;  4RHR A;  3E5S A;  2WAC A;  4WOR A;  1EYA A;  1PRT C;  5C4X G;  1RJT A;  2B63 H;  3Q6S A;  4DV3 L;  3PO2 H;  4XYO A;  2E2H B;  2XRQ D;  2YU9 B;  1KAA A;  1SXT A;  4PZ7 A;  3AFQ A;  3VYT A;  3GTM H;  3MWY W;  2MPM A;  1EY4 A;  4P71 A;  4YWL A;  1JIC A;  1VQC A;  5D3D A;  2QEX A;  1JOQ A;  1LT4 D;  2KHS A;  4L5T A;  1L1O A;  2ID0 A;  1TWF H;  3J81 i;  5ELN A;  5JJK A;  4GN3 B;  2JA5 H;  3W1G A;  4KHP Q;  2K1B A;  2RSO A;  1PVO A;  1SNQ A;  2LSS A;  5IWA L;  4LF6 Q;  1HZ9 A;  1BCP F;  2OQ0 A;  4QJF A;  5K36 G;  4NKL A;  2F0I A;  2QA4 A;  4DV7 L;  4LF7 Q;  1A3V A;  3B6Y A;  4A3E H;  1IKL A;  1GHJ A;  4RFB A;  3T56 B;  2ZJP A;  1F2Y A;  4X66 L;  2I5H A;  4JI5 Q;  1TS2 A;  2CWA A;  2IHE A;  2K01 A;  3MZ5 A;  1BOS A;  4JI1 Q;  3VR6 A;  1PH6 A;  3QO2 A;  3CC2 A;  2IX3 A;  5C3X A;  1MSH A;  5BN4 A;  1TQO A;  3CQZ B;  2BA0 A;  4OWT B;  1E24 A;  1I50 H;  2EPB A;  2O2L D;  2F0M A;  3K0Y A;  3PMF A;  4BY7 B;  4ZQ3 A;  1GD7 A;  2QF7 A;  2F0E A;  1RL2 A;  5JVH 3;  2IX1 A;  4UHV A;  4A3D B;  1MIU A;  3J7Y W;  2QEJ C;  3OMG A;  2HIX A;  4DR3 Q;  2JA7 B;  2L9H A;  1O7L A;  1BXT A;  5E7N A;  3H6M A;  1R9T B;  1GM5 A;  3PF4 A;  3STB D;  2ZJQ A;  4FO2 A;  1MD2 D;  1F9P A;  1JJC B;  2B2W A;  4LAA A;  5ELO A;  3CCS A;  4AQY L;  1PH4 A;  1NMF A;  1PHJ A;  4F87 A;  4N8F A;  2R93 G;  2PZW A;  3T1H Q;  2R61 A;  3G6E A;  2E2I B;  4HN7 A;  2CCZ A;  3HKS A;  3BDC A;  1RKN A;  2LMC B;  4A3C G;  2PQA A;  5M3F B;  4PZ8 A;  1TR5 A;  2OEO A;  1STH A;  2YTX A;  2R7F A;  1EWI A;  3K5L A;  1VQE A;  2RKS A;  4DR7 Q;  2L11 A;  4UY8 C;  2F0K A;  3BZD B;  1SNC A;  1VS0 A;  1D2B A;  2AUK A;  5IYC G;  4GN5 A;  1Q8I A;  3CC4 A;  1YNX A;  4X64 L;  1UE7 A;  2EXD A;  4XIG S;  3UDG A;  2DJG C;  3LGJ A;  1XMQ L;  2AWO A;  3RR5 A;  4DV2 L;  2E2J B;  5EPK A;  1LYL A;  1PTO C;  1GUS A;  3HOV H;  3V05 A;  2JSO A;  3NEN A;  4DR1 Q;  5FLX c;  1S72 A;  4LFB L;  1VQL A;  4MTN A;  2N3S A;  1TWA B;  3SHL A;  1N33 L;  2VQE Q;  4JI2 L;  3S17 B;  2H5X A;  4GKJ L;  4IFD H;  5C5L A;  1KXL A;  1TWG H;  1KNE A;  1JOK A;  1OXT A;  4C3H B;  3MXN B;  1K3R A;  4BBR H;  5JEA G;  3F2C A;  3X3N A;  2F0H A;  2UXC Q;  5E3F A;  1S5B D;  3BS1 A;  4N9T A;  3CU7 A;  1G6P A;  3OMC A;  1J5E L;  4X65 L;  2NTS A;  5EPL A;  1A15 A;  4ZRZ A;  2F0J A;  5CMD A;  1FR3 A;  3I4L A;  3A0J A;  4DUZ Q;  1V1Q A;  4K5V A;  3SK8 A;  4A3B G;  3C46 A;  3NUC A;  3HOW G;  1CZW A;  2K04 A;  4BBS H;  4A3I H;  2RVL A;  1XMO Q;  2QDB A;  1YJN A;  2C5C A;  3M9B A;  1H9S A;  2RDG A;  3Q8D A;  1LAC A;  3K7A H;  2JA6 B;  5C4H A;  1EU3 A;  3L0O A;  2KCM A;  2K05 A;  2K5V A;  3AB9 A;  5M9O A;  5K5P A;  4FYD A;  1LTS D;  4PQX A;  2Z6B A;  3L7Z C;  2EVB A;  1HFG A;  4IPC A;  1DZ1 A;  3CCE A;  2EZV A;  1F2L A;  3EJI A;  1KAW A;  3A74 A;  1EQR A;  1TS3 A;  1FJG Q;  4LWC A;  3U4V A;  5KND A;  3TS2 A;  1YEZ A;  1E0B A;  1FNV A;  2EYF A;  1UE5 A;  3CHB D;  4JI8 Q;  1ZEQ X;  3VYU A;  4A3G B;  1UE1 A;  1FVI A;  2HQL A;  5ISR A;  1BCP D;  4HCS A;  1M90 C;  3PO3 H;  3WOE A;  4JV5 Q;  4GNX B;  2R92 B;  2YV5 A;  1RD9 D;  2I46 A;  3S9W A;  1EOV A;  1EYG A;  4B3M Q;  3SGI A;  3J81 E;  2AMC B;  5T1I A;  1EY5 A;  2YYZ A;  4BWG B;  4NPS A;  3CQZ H;  2LY7 A;  3A5Z B;  2M9V A;  3IFD A;  1SE8 A;  2UXD L;  4BY7 H;  3OSO A;  2A68 C;  3HFZ B;  2HUG A;  1WFQ A;  3GDE A;  1A2U A;  2K5W A;  2KA7 A;  1AZQ A;  3SVM A;  1HPC A;  3UE0 A;  1WVL A;  3GTO B;  2JA7 H;  3TEH B;  1TU2 B;  2VB3 X;  1WTW A;  1SAP A;  1IL2 A;  2A6H D;  3T4A C;  3S2D B;  1QIL A;  3U9S A;  4JI3 L;  3JAM c;  4B3R Q;  1PV4 A;  4DKA C;  4JK1 C;  2OTJ A;  4AH6 A;  2HT1 A;  4R8N A;  3NK9 A;  1I6H H;  4ULL A;  1NUC A;  1PYB A;  4LF6 L;  1DXM A;  5IT9 L;  5DEH A;  5EAY A;  2MUY A;  4J15 A;  3ONA B;  4LF7 L;  3NHH A;  4Q5V A;  4FF3 A;  3C1F A;  3K6O A;  2F3V A;  4JI5 L;  1Y8P B;  2WAQ E;  4EQ5 A;  3D8G A;  4K2L A;  5M3F H;  4JVZ A;  3QG1 A;  2WV6 D;  1DM0 B;  5JEA J;  2F3W A;  4E6I A;  4Y7N B;  1HR0 W;  3KF6 B;  2F0P A;  4B08 A;  3OW2 A;  4IJL A;  2A5H A;  2OT2 A;  3GTJ B;  4NMZ A;  2AQ1 B;  5IP7 G;  1AH9 A;  3RN5 A;  5GRO A;  1B3A A;  4ID6 A;  3GP7 A;  5GAE C;  4C3J H;  4DR3 L;  2V1C C;  4DR2 Q;  4P2C B;  1IBL L;  2JYO A;  4IUP A;  3LWU A;  5L37 A;  5C4X H;  1V1P A;  2YTV A;  5CV9 A;  1IW7 D;  2CH4 W;  4JG2 A;  3RN2 A;  4DFA A;  4A3L G;  1MJC A;  3MEF A;  3SE0 A;  5ELE A;  2KVM A;  3PSI A;  3MFY A;  1EL0 A;  5M3M G;  3PF5 A;  3T1H L;  2D62 A;  2E2D C;  5JJL A;  2IL8 A;  4IPH A;  4XT3 B;  3H91 A;  5J39 A;  1K0S A;  4EQP A;  1B9M A;  4ZUI A;  2B2Y A;  5IP9 H;  1SJE D;  1TWH B;  1LT3 D;  3OWF A;  3TSS A;  1TY0 A;  3M4Y A;  4O42 A;  4JI0 L;  4B3T L;  4DR7 L;  5K36 H;  1EYC A;  3S1Q H;  1NCV A;  3HOZ G;  1QNK A;  2LS0 1;  1PYS B;  3BYT B;  4KKT A;  3EBE A;  1E3P A;  1UEA B;  5ELC A;  1DON A;  4LUO A;  3P20 A;  3FRP B;  1BUV T;  4QF4 A;  3VYS A;  1F2Z A;  2VW9 A;  4CDF C;  4LF8 Q;  5FO9 B;  1BBU A;  3OIP A;  1EY8 A;  5FOB B;  3NEM A;  1RTO A;  2PMZ B;  1II3 A;  4C3I B;  2X6G A;  1JQY D;  5IE8 A;  2NZH A;  5C4J B;  4R4Q A;  1SFO B;  4RHS A;  2VQE L;  3GTL B;  1D8L A;  4A3F G;  2XWB B;  2NZ1 D;  5IOD A;  2WAQ G;  2AQ2 B;  1E7Z A;  4NXN L;  4ZLT F;  1SDF A;  4JI4 Q;  1F9Q A;  1GJX A;  4DPG A;  1YHB A;  4MIU A;  5H1S E;  3HP3 A;  2ZJR A;  4HMJ A;  3HOY B;  3ULP A;  4JI6 Q;  4DAY A;  2WB1 E;  4B3S Q;  2P5Z X;  1IYU A;  2R93 H;  4KHV A;  3Q0A A;  1IZ6 A;  4DUZ L;  3CPF A;  2EY6 A;  1WD0 A;  2IW3 A;  2BE5 D;  2DNC A;  1EFI D;  3K59 A;  2CKZ B;  1WTX A;  4U67 3;  2K33 A;  1I94 Q;  3U58 A;  1XMO L;  2B63 B;  4DR5 Q;  3OW7 A;  1X9N A;  3PO2 B;  4RGM A;  3RD4 A;  5LHY 1;  1STG A;  5GAD C;  1JWS D;  3T1Y Q;  1PMR A;  3KFU A;  3GTM B;  4UP8 A;  3H3V I;  5BR8 L;  1G91 A;  5CBE E;  1D6E C;  4EQO A;  5DAU A;  2FMC A;  5M5X H;  2O5I C;  1HNZ Q;  1TWF B;  4RGN A;  1PRT B;  4N9P A;  4CJ1 B;  3BZK A;  2EXZ A;  4FXG C;  4RMF A;  1W3S A;  4XXE A;  2JA5 B;  1UNS A;  1SND A;  3KF8 B;  3GD7 A;  4WJW A;  5IYB G;  4CHT B;  2K5Q A;  2K5H A;  4DA2 A;  2E5L Q;  1DOL A;  3FKI G;  1CKN B;  4NDX A;  2F3I A;  2F1M A;  2G5D A;  3DWQ A;  2A6E D;  2MFI A;  4JV5 L;  1QE6 A;  4A3E B;  1HA6 A;  1NE3 A;  3EIV A;  1AE2 A;  2Q2H A;  1EY6 A;  1QZG A;  2OCE A;  4G4K A;  3S14 H;  3GTJ H;  1X3P A;  5CV5 A;  5JEA H;  1A3U A;  2N49 A;  2CVR A;  4XT1 B;  4AIM A;  3GTK B;  2MO1 A;  4JI7 L;  4Q0F A;  1LLR D;  2KBN A;  2RCF A;  2R7Z G;  1OXV A;  3I8Z A;  2BDO A;  1IBK Q;  2UU9 Q;  1J6Q A;  2B2T A;  2SEB D;  1CKO A;  1I50 B;  2IT1 A;  1N32 Q;  1T5X D;  1S5D D;  3ND9 A;  4B3R L;  2K28 A;  4K6L A;  2Y0S B;  4A93 G;  3Q24 A;  4QB4 A;  4A3B H;  1D5X C;  3HOW H;  2ATW A;  4BXX G;  3HOU H;  3J81 L;  4OO1 H;  1L1O C;  2BH2 A;  3DUZ A;  1CSP A;  1PLF A;  5D14 A;  5NUC A;  3G71 A;  4PZ6 A;  1Q1B A;  2R3Z A;  3ITP A;  3ND8 A;  4KY5 A;  1N34 Q;  3K7U C;  3NTI A;  1AEX A;  4AYB B;  4R4I A;  4K5W A;  4APV A;  2F0L A;  1TWH H;  1BNZ A;  3BVZ A;  2LFN A;  2L0C A;  3DEP A;  1NMG A;  1A6X A;  1Q90 A;  3NBH A;  1H9S B;  2OQK A;  2B3G A;  4HJ9 A;  2JEA I;  1GUG A;  3BDO A;  2Q2T A;  2BOS A;  4YIJ A;  1VQI A;  4P75 A;  1BCP C;  1MGS A;  3LWE A;  1VCI A;  2OWO A;  3Q22 A;  5CV8 A;  1TS5 A;  2VQF Q;  3KOJ A;  2KJX A;  3I73 A;  1HJP A;  3OTO Q;  4R1J A;  1PA6 A;  3RUZ A;  5HGQ A;  2VL6 A;  4CDD C;  1EZ8 A;  3N6R A;  5IGF A;  1RF2 D;  3L9A X;  4L6T B;  1P8L A;  1SFO H;  1B70 B;  1PYW D;  4R4O A;  1XTD A;  3HOV B;  3U4Z A;  2XGT A;  5CGK A;  2A6H C;  4IFD J;  1CM9 A;  1STN A;  2UXB Q;  3I7F A;  3K5O A;  1ILP A;  1X56 A;  4OEL B;  2B2W C;  5JVG 3;  4CDE C;  4ZKB B;  2EDG A;  1K8M A;  1U4M A;  4CJ2 C;  2PYK A;  1TWG B;  1EIY B;  1UWV A;  3TZD A;  4BBR B;  4KMU C;  2L5T A;  1SNM A;  3IAY A;  3I4O A;  4LFA Q;  2EY5 A;  4F88 A;  1KLG D;  1LTI D;  1QCB D;  3S1M H;  1Y1V H;  4KN4 C;  3PGZ A;  3ICE A;  3R3O A;  4NXM Q;  5I2X A;  3ERS X;  5IT9 E;  4ZK9 B;  2M2L A;  1TKW B;  3NXW A;  1PZJ D;  5E1F A;  1FYC A;  3I91 A;  1IL8 A;  2VY3 A;  3IKJ A;  4DV5 Q;  1LTR D;  4BBS B;  4DV4 L;  1BO0 A;  4A3I B;  4OWW B;  1YJW A;  4KI0 A;  3GV6 A;  3F2D A;  1VF7 A;  3CAM A;  3T16 A;  1SJH D;  2A69 C;  4QUF A;  3K7A B;  2MO0 A;  1TWC H;  3PQI A;  1IW7 C;  4DUY Q;  2K5N A;  1K9M C;  3RLN A;  2KOL A;  3CCV A;  2AQ3 B;  5LMN L;  2B2V A;  1ICW A;  4O0A A;  3KJP A;  4A3L H;  1MSG A;  4JI6 L;  1ZYR D;  1KIX A;  4OX9 Q;  1QZH A;  2F52 A;  2NVY H;  4JYA Q;  5M3M H;  1VQB A;  2CHB D;  1V1P B;  5G3L F;  3HEJ A;  1M8A A;  3CCQ A;  2EOT A;  2N88 A;  1X54 A;  3GTK H;  3PO3 B;  2E8G A;  1SN8 A;  4NP5 A;  1JJG A;  4IOA A;  1XTC D;  3MXU A;  2KHI A;  3QOL A;  1PZK D;  3LNN A;  1S5C D;  1B3Q A;  3ERO A;  3TRZ A;  1CT1 D;  2F0V A;  4JOI A;  2ZT9 C;  4WRD A;  4IAL A;  3T1Y L;  1XNQ Q;  3K0X A;  3K57 A;  5IGG A;  3HOZ H;  1HZB A;  4OGQ C;  4A3M G;  1VQG A;  3A56 A;  5I4D A;  1NAP A;  3CMA A;  4HID A;  1QUQ B;  1AW7 A;  3H3V H;  1HNZ L;  1EIF A;  2I5M X;  2Q8T A;  1AN8 A;  2MQH A;  2PPB C;  1XNR L;  3A5U A;  1KRT A;  3TDQ A;  5KNB A;  3J81 c;  4K6D A;  1E2V A;  5EKK A;  3J7A F;  5C4Z A;  4TRD A;  3MXG A;  5LMU Q;  2E5L L;  1I6H B;  1WCM G;  3KLS X;  5M5Y H;  3TZU A;  4QY7 A;  5AFW A;  5ELD A;  2HD3 A;  3A7A B;  1HXY D;  2OTL A;  2G9H D;  1YNN C;  1STY A;  3D6C A;  4L63 B;  1GUT A;  2G9D A;  1FGU A;  4A3G G;  1E2Z A;  4JC0 A;  3F2B A;  1YVC A;  4JW0 A;  1SEB D;  2C9O A;  1BVS A;  3CKI B;  1BBX C;  4FF4 A;  4DK3 C;  2UU9 L;  2R92 G;  3BU2 A;  3I4M G;  3F1Z A;  4CKB A;  1NNX A;  1N32 L;  1FL0 A;  1AP0 A;  4DV6 Q;  1J8I A;  2D5D A;  1OO9 B;  4C3J B;  1VQ6 A;  2NTT A;  4IJH A;  1TVX A;  1VQK A;  1PFB A;  5HY6 A;  1O7I A;  5C4X B;  1PXU A;  3FP9 A;  1IHZ A;  3TP7 A;  1Q86 C;  1D5Z C;  4QCL A;  1N34 L;  1YZ6 A;  3TRE A;  2B2U A;  1DD2 A;  3P1H A;  4C2M H;  2ICE C;  1A2T A;  5FK9 C;  3I3C A;  1Z6H A;  1NSN S;  4NW2 A;  5I9O A;  2NVX H;  2JA8 G;  2FJ2 A;  2Z4H A;  5C44 G;  1DCZ A;  3L2P A;  1FD7 D;  5AJ3 Q;  2L15 A;  2L1B A;  4PMC A;  5I9P A;  2CQA A;  2F0N A;  2I0Q A;  5IYB H;  3VA5 A;  1HNX Q;  1EEF D;  1C0A A;  3VR3 A;  2KHJ A;  5EJW A;  4WJ3 M;  3A55 A;  1SYD A;  1Q82 C;  2RSN A;  3S1Q B;  2VQF L;  1WTO A;  5CV7 A;  1D1I A;  4PV1 C;  3H0G G;  3D4R A;  5BN3 A;  1FNW A;  1S3O A;  1JT8 A;  3R2I A;  4P73 A;  5IGB A;  3Q23 A;  1ET6 A;  3RZO H;  2EYJ A;  4IZ8 A;  2R7Z H;  1WJJ A;  5LL6 S;  3QWN A;  1X32 A;  4IN3 A;  4TQU S;  1Q1E A;  4X3U A;  3CF5 A;  4WJ4 A;  4A93 H;  1JOR A;  1HNW Q;  2QGQ A;  1PH8 A;  3UDX A;  1VMP A;  1CK1 A;  2YTY A;  4RG1 A;  4BXX H;  1TII D;  4DNR B;  5I6W A;  4P72 A;  1SYG A;  4HSV A;  1QJO A;  4X6A H;  1ENC A;  1EZ6 A;  1GXD C;  3A8K E;  2IWH A;  2UUC L;  2VUM G;  4X62 Q;  4LFA L;  1H9M A;  2ZM6 Q;  1Q3L A;  1ASY A;  2KEN A;  1JWM D;  2B2Y C;  2PI2 A;  4GOP A;  4NXM L;  3GTG B;  2R93 B;  2X69 A;  4FF2 A;  2NUC A;  4KLK A;  2NN6 G;  3H94 A;  1KL9 A;  2HDL A;  5G3L D;  3EQL C;  5JPM C;  1PFN A;  3CCM A;  3CCU A;  3BVG A;  1ZXT A;  1A3T A;  1K83 H;  4DV5 L;  5DLQ E;  4FDB A;  3GQB A;  1K8A C;  3RZD H;  2XVS A;  3S2H H;  1YNJ D;  4POF A;  1W6K A;  2F4I A;  3G7L A;  1HUN A;  3J80 i;  2IPK D;  1OXS C;  4YCW A;  3K5N A;  1PTO F;  1R4Q B;  5M5W H;  4DUY L;  5C3E H;  4KHP L;  1N36 Q;  4BY1 H;  4F7X A;  1Q12 A;  1FNU A;  5M5X B;  4CGY B;  5J1Z A;  4HAE A;  2EJF C;  4A3K G;  1U9R A;  5C0X G;  4OX9 L;  1Z9F A;  4JYA L;  5IGE A;  3NWT A;  3J7A 5;  3KLR A;  3PUW A;  3QOJ A;  5IYD H;  1I3Q B;  2O4X A;  4DR6 Q;  4JI1 L;  3I56 A;  3KJO A;  3I4N G;  4H44 C;  3TP8 A;  3CW2 C;  2Z9H A;  3QIA A;  1L0W A;  1W2B A;  1WYD A;  2DJF C;  4ALP A;  1STB A;  4H7B A;  2KEC A;  4LF4 Q;  2JQO A;  3S14 B;  4DR4 Q;  1G6Z A;  3PIP 3;  4GN4 B;  2HIV A;  2K52 A;  4IPD A;  2HDM A;  2B39 A;  1VQ9 A;  4RCO A;  1G51 A;  4ODG A;  2PO4 A;  2NN6 I;  1VMC A;  4KKU A;  3A54 A;  5CBA E;  4OHJ A;  2B63 G;  2EIF A;  1X3G A;  3PO2 G;  1B2T A;  2NZO A;  1B50 A;  1U4L A;  2PI2 E;  4DK6 C;  2OF1 A;  3CD6 A;  4A3B B;  3HOW B;  3AU7 A;  3SK6 A;  2PQE A;  2D2C C;  3NSW A;  3HOU B;  2ZXP A;  3C1E A;  3U9O A;  3SEB A;  1PH5 A;  2I07 B;  3P75 A;  2F4V Q;  3R8B A;  1B8A A;  1NR4 A;  2UUB Q;  1WD1 A;  2D9U A;  3E9H A;  3PUY A;  2EJM A;  4OWX B;  5I2Y A;  2CWP A;  1RCV D;  5C0X I;  2IHF A;  5ELB A;  4YY3 Q;  1D7Q A;  1ET9 A;  1VQO A;  1Y14 B;  4DGZ A;  3TP5 A;  3I90 A;  4MN3 A;  3MAQ A;  1JE5 A;  1L1O B;  4IO9 A;  3F2U A;  1UUP A;  1EYD A;  2HCC A;  5GAH C;  5DM6 3;  4H13 C;  4X3T A;  5E4W C;  4DV6 L;  1VQF A;  3GTQ H;  1VDZ A;  1SMY D;  3GTP H;  4LFC Q;  2NWG A;  3HRZ C;  2SOB A;  1JWU D;  5KIX A;  3NPP A;  2VXW A;  4A3J G;  3NP8 A;  1SRO A;  2ZXR A;  1B7Y B;  4C56 C;  2SNS A;  4K0K Q;  2RDF A;  2B2T C;  3E6Z X;  1SNP A;  2CFM A;  3S1R H;  4LF9 Q;  1KRS A;  1STE A;  4DR1 L;  3VR4 A;  3CRK C;  3HGB A;  1LAB A;  1JCK B;  3D4W A;  3K80 C;  1BCP B;  4A3M H;  3D0F A;  3HKZ G;  1KHI A;  3D31 A;  3CXC A;  2KEE A;  1VF5 C;  4K8J A;  3WDN A;  1Y1W G;  2XWJ B;  3STB C;  3AMU A;  4UPA A;  2A73 B;  2UXC L;  2MGS A;  4FVM A;  4H0L C;  2M00 A;  4UDU C;  1HNX L;  1XPR A;  2CQO A;  1FGB D;  4DNI A;  1WCM H;  2IJ0 A;  3DHQ A;  1DGS A;  1C9O A;  2F0U A;  3GTG H;  1G2T A;  4HED A;  3FHW A;  3TQY A;  1WTP A;  1QB5 D;  3HOX G;  4HMI A;  4IUR A;  4ZUJ A;  1B4O A;  3S1M B;  1I4R A;  1Y1V B;  4A3C H;  1X3F A;  4GS3 A;  4ME3 A;  3V96 A;  1PH3 A;  3S1N H;  3ULJ A;  2N78 A;  1OTC A;  1C7Y A;  3NQI A;  1EIG A;  2Z6K A;  1WTV A;  4RCN A;  3CCR A;  3I4M H;  3BDL A;  4I7A A;  5IYC H;  1KDB A;  2XNA C;  1V43 A;  1V9P A;  1PH2 A;  1HCZ A;  2JP1 A;  2K75 A;  2RF4 A;  4QIW E;  2PQA B;  1UEB A;  1HNW L;  1GHK A;  4EVO A;  2O5J C;  1ENF A;  3M85 A;  2F0S A;  1PTO D;  1VQA A;  2RA4 A;  1A62 A;  1A63 A;  4X3K A;  5IT9 c;  2KED A;  1FJG L;  1GVP A;  1MKH A; 
#chains in the Genus database with same CATH homology
 1GUW A;  2MJ8 A;  4KJO A;  4CKC A;  3FEW X;  3DMU A;  4CKE A;  4IUV A;  2NVY B;  3J80 E;  3T53 B;  5M3M B;  4FXD A;  4HR7 B;  4MHE A;  4LK1 C;  3FPP A;  1EY9 A;  1MBY A;  4PMW A;  4K14 A;  2K7V A;  1ESF A;  1BQQ T;  3HOZ B;  2JEB I;  1ZKO A;  1LV9 A;  5JJZ A;  1B44 D;  1E2W A;  3MVV A;  5CYU A;  1TS4 A;  2F0F A;  2WII B;  4R8I A;  3GO5 A;  4EGV A;  1UAP A;  4BS9 A;  1CFM A;  1XXG A;  1O7Y A;  5M5Y B;  1EY7 A;  2IX0 A;  2X6L A;  2B2V C;  3L3O C;  1AZP A;  3NWS A;  2J7Z A;  2MHV A;  2WAQ B;  3PIO 3;  1H9J A;  2L12 A;  1ML0 D;  5EBC A;  1KAB A;  1WTR A;  3EVQ A;  3PUV A;  3MA2 B;  1D5M C;  1CHP D;  1ILQ A;  2NN6 H;  2F03 A;  2NVQ B;  1I4Q A;  1LTB D;  4Z9C B;  4KY6 A;  2CW0 D;  2A68 D;  2Q8I B;  4DN4 M;  4FXK C;  4OIJ A;  1YNJ C;  4KV6 A;  3T51 B;  3EA6 A;  1CQF A;  1KLU D;  2FHT A;  4UAI A;  1JB3 A;  5FO7 B;  3J7A V;  5C3W A;  1RDP D;  5FKA C;  2F0Q A;  5DM7 3;  1SYB A;  2SNM A;  3A8I E;  4QUC A;  4C2M B;  2NVX B;  5BN5 A;  4CJ0 B;  1QG7 A;  2EY1 A;  2Z8L A;  1CA5 A;  1S5E D;  5E4X A;  1F9R A;  3FKI B;  3DWP A;  1D1K A;  5A2Q L;  2F0O A;  2K03 A;  5KEE A;  4ZYS A;  3R93 A;  5EQ0 A;  4EQN A;  1S5F D;  3RZO B;  2K5D A;  3RMH A;  4OL7 A;  2R7Z B;  3QB3 A;  1Y8N B;  3MTS A;  4J8Q A;  3M7N A;  4B9X A;  1V1O A;  2OXP A;  1HQR D;  3WOF A;  1AFP A;  3OHX C;  5C5M A;  4A93 B;  2KCN A;  1LTG D;  3W2D A;  2B2U C;  1SYE A;  2DNE A;  1EQT A;  1HQM C;  1SYF A;  4C3H G;  1DJR D;  2AUJ D;  4RH6 A;  3NQT A;  5KGU A;  1S4Z A;  2WB1 B;  3H3V C;  3SK5 A;  4DXG A;  2Z1C A;  1JE4 A;  1QOH A;  4RGO S;  1K83 B;  4K8I A;  3TP6 A;  3D4D A;  3RZD B;  1LTT D;  1SMY C;  3S2H B;  1JC7 A;  3A7L A;  1W6J A;  4IUT A;  5A35 A;  3V2T A;  3OPO A;  2L55 A;  4QIW B;  1EQV A;  5M5W B;  2GA4 B;  3W3A A;  5C3E B;  4BY1 B;  1C48 A;  1HHV A;  4WFN 3;  3DEO A;  2FIN B;  5D65 A;  2EYO A;  4IUU A;  1G29 1;  2PZT A;  4O1N A;  2B8F A;  3JAM L;  4BA1 I;  4IUN A;  2JE6 I;  4ZAI A;  5CV6 A;  3MHB A;  3HZX A;  4G7H C;  2EYH A;  3DXJ C;  4DNT B;  2ICI A;  4DAP A;  5KYI A;  5T1G A;  3VYR A;  5F2D A;  4DF7 A;  4XQJ A;  5CR3 A;  1PRT F;  4KKS A;  4DAV A;  3FMC A;  4RKL A;  1BDO A;  3BVM A;  1RTN A;  1Y8O B;  2BE5 C;  2KUM A;  5IOC A;  3I72 A;  4RKB A;  3J80 L;  4ILW A;  5KRU A;  1SE3 A;  1CZG A;  4KD4 A;  3QJY A;  4FF1 A;  1ONL A;  1B1Z A;  3KF8 A;  3OWE B;  3OOC A;  1CA6 A;  2EYL A;  1EIH A;  1I4X A;  2WP8 J;  2LKV A;  5D3I B;  3KK7 A;  2RBM A;  1B9N A;  1MI2 A;  1F9S A;  1QNU A;  2A6E C;  3X3M A;  1EEI D;  1TT2 A;  3R2T A;  1F2M A;  1PTO H;  1G2S A;  1RHP A;  3GTQ B;  2QKI C;  3GTP B;  4LMQ D;  4KN7 C;  3VR5 A;  5IIF A;  1I4H A;  3S1R B;  4XQQ A;  3TN2 A;  2ZXO A;  1I6V C;  1B53 A;  4A3M B;  1Z7T A;  4PMB A;  1ENA A;  3K5M A;  3NE5 B;  4OO1 G;  3MC0 B;  4IQZ A;  4BA2 I;  1HFN A;  2PW7 A;  1G8Z D;  4XQN A;  3TBI B;  3BG3 A;  3IL8 A;  1IYV A;  1WCM B;  2DY7 A;  2V4D A;  1EY0 A;  2F0W A;  1PZI D;  4GZY C;  5FO8 B;  5CC4 A;  3PUZ A;  3E0J A;  3S1N B;  1BF4 A;  4M8A A;  3T13 A;  4FNF A;  4U68 A;  4I7Z C;  3I4M B;  2EJG C;  5COY A;  4RA8 A;  3HG9 A;  3DM1 A;  2NYZ D;  3ZYY X;  1KNA A;  4C3I G;  1SSO A;  3NBI A;  3GV3 A;  2CW0 C;  2EYM A;  1C8C A;  1QWY A;  1SYC A;  2XIW A;  3P7J A;  3RLF A;  1Y69 U;  1KDC A;  4CBV A;  1O80 A;  1PFM A;  5EKI A;  1HTP A;  2BDN A;  2E76 C;  3O13 A;  1H9K A;  3IFT A;  2NB0 A;  3FVQ A;  2E75 C;  4L8J A;  3OIQ A;  4OO1 I;  2J0T D;  4FP5 D;  2K32 A;  4QMG A;  2JA8 B;  2R6G A;  3M3Y B;  5C44 B;  4ZKC B;  1TWC B;  3H09 A;  4HSP A;  4R9W A;  3PV0 A;  1KDA A;  3VA7 A;  4V0B A;  1JOO A;  1PRT D;  5FLX E;  4J1M A;  5ELF A;  3H0G B;  5C6A A;  2DN8 A;  5CV4 A;  4M1U B;  1O7Z A;  4DU9 A;  3D6W A;  2FMM A;  4C1N I;  5A2Q E;  3DWA A;  1EWH A;  2A69 D;  3LX0 A;  5DNF A;  4PNY A;  4V19 0;  1XYI A;  1Z47 A;  1ZYR C;  1DOK A;  2F0G A;  4K2K A;  5COR A;  1SE2 A;  4RAU C;  4J6H A;  1ESR A;  1CHQ D;  5EGT A;  2K6A A;  1F77 A;  5TSS A;  2VUM B;  5JPN C;  1PDQ A;  5EBD A;  4KK7 A;  2J4X A;  1U4P A;  2PNR C;  1L0X B;  2ENB A;  3MEH A;  3M7G A;  3ERQ A;  1CQV A;  1HUM A;  2RQX A;  2DY8 A;  5IGC A;  2KQ3 A;  1EOT A;  1IKM A;  2HCI A;  5C0X J;  1L0Y B;  4DK1 A;  2WIN B;  5JOB A;  2TMP A;  4G7O C;  4A3K B;  1O78 A;  2EY2 A;  2NBF A;  1YNN D;  4C1N K;  5IGD A;  3KBG A;  1OXU A;  3UI2 A;  1TY2 A;  2EE1 A;  1C4Q A;  3K58 A;  3I4N B;  1DYQ A;  1OXX K;  2RDH A;  4S3S A;  2NVT B;  2SDF A;  5LL6 X;  1BR9 A;  1STA A;  1V8Q A;  3JAM E;  4XTC S;  4KY7 A;  2BA1 A;  1XX8 A;  2QIL A;  5KYL A;  3S15 B;  5JAV A;  1LO5 D;  1EWC A;  1HA5 A;  4LJZ C;  3EFX D;  2VNU D;  1X3Q A;  3S16 B;  1XWE A;  4KTA A;  5HUR A;  3MXN A;  1J9O A;  2WKD A;  4KD3 A;  1U4R A;  2B8G A;  3TME A;  3D3R A;  1WTQ A;  4RGT A;  4HCE A;  4X3S A;  4IFD G;  3PUX A;  3G6J B;  4G7Z C;  2XSC A;  1CI3 M;  1SNO A;  1K8O A;  3SR1 A;  4ABN A;  2H4O A;  3VR2 A;  2Q8R E;  1EU4 A;  4HTH A;  2XRS D;  1CTM A;  3FDT A;  5J22 A;  1JR0 D;  3FPU B;  1LTA D;  2MP1 A;  2Z4I A;  4KJN A;  2QCP X;  5EKL A;  3KLS A;  2JXM B;  4IUQ A;  3N52 A;  4F8M A;  1NR2 A;  3C2P A;  4A3J B;  1GUO A;  1SE4 A;  4I65 A;  3URY A;  2VB2 X;  3C3L A;  2KCC A;  1M4V A;  4XDX A;  1HTL D;  2EYP A;  3NTK A;  3I70 A;  3M4O B;  4KHZ A;  1I4G A;  3A8J E;  4A3F B;  4G57 A;  3HKZ B;  5KNC A;  2BCO A;  4TSS A;  1GOZ A;  1Y1W B;  1I4P A;  1H9R A;  4IFD I;  1HRJ A;  2PW5 A;  3MFG A;  1LT5 D;  5EPJ A;  5I6Y A;  3HOX B;  4RWS C;  3KUP A;  2PZU A;  2F0T A;  3KBX A;  4DXF A;  5HGT A;  4TKO B;  3NTH A;  2XN9 C;  1R4P B;  2PCF B;  3CRL C;  1KTK A;  2E74 C;  3BYY B;  1DOM A;  1T5E A;  5FLX L;  5C0X H;  1LT6 D;  2H1E A;  4DK0 A;  3SXH A;  2AWN A;  3SK4 A;  2TSS A;  3MXP A;  4JBW A;  2F0D A;  2N55 A;  4K5X A;  2FFK B;  2WKC A;  3SDZ A;  1PTO B;  4ME5 A;  2A74 C;  1ROD A;  3HS0 C;  1GUN A;  2HQE A;  1SBB B;  4XYQ A;  2L4N A;  4C3J G;  4OIK A;  4B9W A;  4RHR A;  3E5S A;  2WAC A;  4WOR A;  1EYA A;  1PRT C;  1RJT A;  3Q6S A;  4XYO A;  2E2H B;  2XRQ D;  2YU9 B;  1KAA A;  1SXT A;  3VYT A;  3MWY W;  2MPM A;  1EY4 A;  1JOQ A;  1JIC A;  5D3D A;  1LT4 D;  2KHS A;  2ID0 A;  2K1B A;  2RSO A;  1SNQ A;  1BCP F;  5K36 G;  4NKL A;  2F0I A;  1A3V A;  1IKL A;  1GHJ A;  4RFB A;  3T56 B;  1F2Y A;  1TS2 A;  2K01 A;  3MZ5 A;  1BOS A;  3VR6 A;  3QO2 A;  2IX3 A;  5C3X A;  1MSH A;  5BN4 A;  1TQO A;  3CQZ B;  2BA0 A;  2EPB A;  2O2L D;  2F0M A;  3K0Y A;  3PMF A;  4BY7 B;  4ZQ3 A;  2QF7 A;  2F0E A;  5JVH 3;  2IX1 A;  4A3D B;  3J7Y W;  2QEJ C;  3OMG A;  2JA7 B;  2L9H A;  1O7L A;  1BXT A;  3H6M A;  1R9T B;  4FO2 A;  1MD2 D;  1F9P A;  2B2W A;  4LAA A;  4F87 A;  2PZW A;  2R61 A;  2E2I B;  4HN7 A;  3BDC A;  1RKN A;  2LMC B;  5M3F B;  1TR5 A;  2OEO A;  1STH A;  3K5L A;  2RKS A;  2L11 A;  2F0K A;  3BZD B;  1SNC A;  1D2B A;  2AUK A;  1Q8I A;  4XIG S;  2AWO A;  2E2J B;  5EPK A;  1PTO C;  1GUS A;  3V05 A;  2JSO A;  1TWA B;  3SHL A;  3S17 B;  4IFD H;  5C5L A;  1KNE A;  1JOK A;  1OXT A;  4C3H B;  5JEA G;  3X3N A;  2F0H A;  5E3F A;  1S5B D;  3BS1 A;  4N9T A;  3CU7 A;  3OMC A;  2NTS A;  5EPL A;  1A15 A;  4ZRZ A;  2F0J A;  5CMD A;  1FR3 A;  3I4L A;  4K5V A;  3SK8 A;  3C46 A;  3NUC A;  1CZW A;  2K04 A;  2RVL A;  2QDB A;  2C5C A;  1H9S A;  2RDG A;  1LAC A;  2JA6 B;  5C4H A;  1EU3 A;  2K05 A;  3AB9 A;  5M9O A;  5K5P A;  4FYD A;  1LTS D;  4PQX A;  3L7Z C;  2EVB A;  1HFG A;  1DZ1 A;  2EZV A;  1F2L A;  3EJI A;  1TS3 A;  5KND A;  1E0B A;  1FNV A;  2EYF A;  3CHB D;  4A3G B;  1ZEQ X;  3VYU A;  5ISR A;  1BCP D;  4HCS A;  3WOE A;  2R92 B;  3S9W A;  1RD9 D;  2I46 A;  3J81 E;  5T1I A;  1EY5 A;  2YYZ A;  4BWG B;  2LY7 A;  2M9V A;  3IFD A;  3OSO A;  2A68 C;  2HUG A;  1A2U A;  2K5W A;  2KA7 A;  1AZQ A;  3SVM A;  1HPC A;  1WVL A;  3GTO B;  1TU2 B;  2VB3 X;  1WTW A;  1SAP A;  2A6H D;  3T4A C;  3S2D B;  1QIL A;  3U9S A;  4JK1 C;  4R8N A;  3NK9 A;  4ULL A;  1NUC A;  1DXM A;  5IT9 L;  5DEH A;  2MUY A;  3ONA B;  3NHH A;  4Q5V A;  4FF3 A;  3C1F A;  3K6O A;  2F3V A;  1Y8P B;  3D8G A;  4K2L A;  3QG1 A;  2WV6 D;  1DM0 B;  5JEA J;  2F3W A;  4E6I A;  4Y7N B;  2F0P A;  4B08 A;  2A5H A;  2OT2 A;  3GTJ B;  4NMZ A;  2AQ1 B;  1B3A A;  4ID6 A;  3GP7 A;  4P2C B;  2JYO A;  4IUP A;  3LWU A;  1V1P A;  5CV9 A;  1IW7 D;  4DFA A;  3SE0 A;  5ELE A;  2KVM A;  3MFY A;  1EL0 A;  2D62 A;  2E2D C;  2IL8 A;  4XT3 B;  3H91 A;  5J39 A;  4EQP A;  1B9M A;  4ZUI A;  2B2Y A;  1SJE D;  1TWH B;  1LT3 D;  3OWF A;  3TSS A;  1TY0 A;  3M4Y A;  4O42 A;  5K36 H;  1EYC A;  1NCV A;  1QNK A;  2LS0 1;  4KKT A;  3BYT B;  1UEA B;  5ELC A;  1DON A;  3P20 A;  3FRP B;  1BUV T;  4QF4 A;  3VYS A;  1F2Z A;  5FO9 B;  3OIP A;  1EY8 A;  5FOB B;  1RTO A;  2PMZ B;  1II3 A;  4C3I B;  2X6G A;  1JQY D;  5C4J B;  1SFO B;  4RHS A;  3GTL B;  2XWB B;  2NZ1 D;  5IOD A;  2AQ2 B;  4ZLT F;  1SDF A;  1F9Q A;  1GJX A;  4MIU A;  3HP3 A;  4HMJ A;  3HOY B;  4DAY A;  1IYU A;  4KHV A;  3Q0A A;  2EY6 A;  1WD0 A;  2IW3 A;  2BE5 D;  2DNC A;  1EFI D;  3K59 A;  1WTX A;  4U67 3;  2K33 A;  2B63 B;  3OW7 A;  3PO2 B;  4RGM A;  3RD4 A;  5LHY 1;  1STG A;  1JWS D;  1PMR A;  3GTM B;  1G91 A;  5CBE E;  1D6E C;  4EQO A;  5DAU A;  2FMC A;  2O5I C;  1TWF B;  4RGN A;  1PRT B;  4N9P A;  4CJ1 B;  2EXZ A;  4FXG C;  4XXE A;  2JA5 B;  1UNS A;  1SND A;  3GD7 A;  4WJW A;  4CHT B;  4DA2 A;  2K5Q A;  1DOL A;  4NDX A;  2F1M A;  3DWQ A;  2A6E D;  1QE6 A;  4A3E B;  1HA6 A;  1EY6 A;  4G4K A;  1X3P A;  5CV5 A;  5JEA H;  1A3U A;  4XT1 B;  2CVR A;  3GTK B;  4Q0F A;  1LLR D;  1OXV A;  3I8Z A;  2BDO A;  2B2T A;  2SEB D;  1I50 B;  2IT1 A;  1T5X D;  1S5D D;  3ND9 A;  2K28 A;  4K6L A;  2Y0S B;  3Q24 A;  4QB4 A;  1D5X C;  3J81 L;  4OO1 H;  3DUZ A;  5D14 A;  1PLF A;  5NUC A;  1Q1B A;  2R3Z A;  3ITP A;  3ND8 A;  4KY5 A;  3NTI A;  1AEX A;  4AYB B;  4K5W A;  2F0L A;  1BNZ A;  3BVZ A;  2LFN A;  2L0C A;  3DEP A;  1A6X A;  1Q90 A;  3NBH A;  1H9S B;  2JEA I;  1GUG A;  3BDO A;  2BOS A;  4YIJ A;  1BCP C;  1MGS A;  3LWE A;  1VCI A;  3Q22 A;  5CV8 A;  1TS5 A;  2KJX A;  3I73 A;  3RUZ A;  1EZ8 A;  3N6R A;  5IGF A;  1RF2 D;  3L9A X;  4L6T B;  1PYW D;  3HOV B;  5CGK A;  2A6H C;  4IFD J;  1CM9 A;  1STN A;  3K5O A;  1ILP A;  2B2W C;  5JVG 3;  4ZKB B;  2EDG A;  1K8M A;  1U4M A;  4CJ2 C;  2PYK A;  1TWG B;  3TZD A;  4BBR B;  4KMU C;  2L5T A;  1SNM A;  3IAY A;  2EY5 A;  4F88 A;  1QCB D;  1KLG D;  1LTI D;  4KN4 C;  3R3O A;  5I2X A;  5IT9 E;  4ZK9 B;  2M2L A;  1TKW B;  3NXW A;  1PZJ D;  5E1F A;  1FYC A;  3I91 A;  1IL8 A;  3IKJ A;  1LTR D;  4BBS B;  1BO0 A;  4A3I B;  4KI0 A;  3GV6 A;  1VF7 A;  3T16 A;  1SJH D;  2A69 C;  4QUF A;  3K7A B;  1IW7 C;  2KOL A;  2AQ3 B;  2B2V A;  1ICW A;  1MSG A;  1ZYR D;  2CHB D;  1V1P B;  5G3L F;  3HEJ A;  1M8A A;  2EOT A;  2N88 A;  3PO3 B;  4NP5 A;  1XTC D;  3MXU A;  3QOL A;  1PZK D;  3LNN A;  1S5C D;  3ERO A;  1CT1 D;  2F0V A;  4WRD A;  2ZT9 C;  4IAL A;  3K57 A;  5IGG A;  4OGQ C;  3A56 A;  5I4D A;  1NAP A;  1AW7 A;  2Q8T A;  1AN8 A;  2PPB C;  3TDQ A;  5KNB A;  4K6D A;  1E2V A;  5EKK A;  3J7A F;  5C4Z A;  4TRD A;  3MXG A;  1I6H B;  3KLS X;  3TZU A;  5AFW A;  5ELD A;  3A7A B;  1HXY D;  2G9H D;  1YNN C;  1STY A;  3D6C A;  4L63 B;  1GUT A;  2G9D A;  1E2Z A;  1SEB D;  2C9O A;  3CKI B;  1BBX C;  4FF4 A;  4CKB A;  1AP0 A;  1J8I A;  2D5D A;  1OO9 B;  4C3J B;  2NTT A;  1TVX A;  1PFB A;  5C4X B;  1PXU A;  1IHZ A;  3TP7 A;  1D5Z C;  4QCL A;  2B2U A;  1DD2 A;  3P1H A;  2ICE C;  1A2T A;  5FK9 C;  3I3C A;  1Z6H A;  1NSN S;  4NW2 A;  5I9O A;  2FJ2 A;  2Z4H A;  1DCZ A;  1FD7 D;  2L1B A;  4PMC A;  5I9P A;  2CQA A;  2F0N A;  3VA5 A;  1EEF D;  3VR3 A;  5EJW A;  3A55 A;  1SYD A;  2RSN A;  3S1Q B;  1WTO A;  5CV7 A;  1D1I A;  4PV1 C;  3D4R A;  5BN3 A;  1FNW A;  3R2I A;  5IGB A;  3Q23 A;  1ET6 A;  2EYJ A;  4IZ8 A;  5LL6 S;  3QWN A;  1X32 A;  4IN3 A;  4TQU S;  1Q1E A;  4X3U A;  1JOR A;  1VMP A;  1CK1 A;  1TII D;  4DNR B;  5I6W A;  1SYG A;  4HSV A;  1QJO A;  1ENC A;  1EZ6 A;  1GXD C;  3A8K E;  2IWH A;  1H9M A;  1Q3L A;  1JWM D;  2B2Y C;  3GTG B;  2R93 B;  2X69 A;  4FF2 A;  2NUC A;  2NN6 G;  3H94 A;  2HDL A;  5G3L D;  3EQL C;  5JPM C;  1PFN A;  3BVG A;  1ZXT A;  1A3T A;  3GQB A;  2XVS A;  1YNJ D;  1W6K A;  2F4I A;  3G7L A;  1HUN A;  2IPK D;  1OXS C;  3K5N A;  1PTO F;  1R4Q B;  4F7X A;  1Q12 A;  1FNU A;  5M5X B;  4CGY B;  5J1Z A;  4HAE A;  2EJF C;  1U9R A;  5C0X G;  5IGE A;  3NWT A;  3KLR A;  3PUW A;  3QOJ A;  1I3Q B;  2O4X A;  4H44 C;  3TP8 A;  3QIA A;  1STB A;  4H7B A;  2KEC A;  3S14 B;  1G6Z A;  3PIP 3;  2HDM A;  2B39 A;  4RCO A;  4ODG A;  2PO4 A;  2NN6 I;  1VMC A;  4KKU A;  3A54 A;  5CBA E;  4OHJ A;  1B2T A;  1B50 A;  1U4L A;  2OF1 A;  4A3B B;  3HOW B;  3AU7 A;  3SK6 A;  2PQE A;  2D2C C;  3NSW A;  3HOU B;  2ZXP A;  3C1E A;  3U9O A;  3SEB A;  2I07 B;  3P75 A;  3R8B A;  1NR4 A;  1WD1 A;  2D9U A;  3PUY A;  2EJM A;  5I2Y A;  1RCV D;  5C0X I;  5ELB A;  1ET9 A;  4DGZ A;  3TP5 A;  3I90 A;  4MN3 A;  3MAQ A;  3F2U A;  1UUP A;  1EYD A;  2HCC A;  5DM6 3;  4H13 C;  4X3T A;  5E4W C;  1VDZ A;  1SMY D;  2NWG A;  5KIX A;  2SOB A;  1JWU D;  3HRZ C;  3NPP A;  2VXW A;  3NP8 A;  2ZXR A;  4C56 C;  2SNS A;  2RDF A;  2B2T C;  3E6Z X;  1SNP A;  1STE A;  3VR4 A;  3CRK C;  3HGB A;  1LAB A;  1JCK B;  3D4W A;  1BCP B;  3D31 A;  2KEE A;  1VF5 C;  4K8J A;  3WDN A;  2XWJ B;  3AMU A;  2A73 B;  2MGS A;  4FVM A;  4H0L C;  2M00 A;  4UDU C;  1FGB D;  2IJ0 A;  3DHQ A;  2F0U A;  1G2T A;  4HED A;  1WTP A;  1QB5 D;  4HMI A;  4IUR A;  4ZUJ A;  1B4O A;  3S1M B;  1I4R A;  1Y1V B;  3V96 A;  3NQI A;  1EIG A;  1WTV A;  4RCN A;  3BDL A;  1KDB A;  2XNA C;  1V43 A;  1HCZ A;  2JP1 A;  1GHK A;  4EVO A;  2O5J C;  1ENF A;  3M85 A;  2F0S A;  1PTO D;  2RA4 A;  4X3K A;  2KED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...