1X32A

Three dimensional solution structure of the chromo1 domain of cpsrp43
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
47
structure length
47
Chain Sequence
GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chloroplast signal recognition particle component
publication title Three-dimensional solution structures of the chromodomains of cpSRP43
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 2
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2005-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x32A00
3LWEA 1B3AA 3DM1A 2HCIA 2Q8RE 2B2VA 4IUUA 1G6ZA 5EKIA 5JJZA 2EPBA 5CORA 1MSHA 2FFKB 2NZ1D 1F9RA 2N88A 1EOTA 1F9SA 3SVMA 1SDFA 2EOTA 3I90A 2RA4A 3G7LA 2EE1A 1B2TA 3N52A 4HEDA 2K03A 2MGSA 1F9PA 4XT3B 2DY7A 2L11A 2K1BA 3MWYW 2X6LA 1TVXA 2IL8A 2L1BA 1O80A 2B2TC 1EIHA 1RTOA 2B2WC 2D9UA 2FINB 2MJ8A 2MP1A 2KEEA 4UAIA 5DNFA 1IKLA 1G2SA 4IUTA 4R8IA 2XIWA 2B2TA 3UI2A 1DZ1A 2L4NA 2B2UA 5T1GA 1MSGA 1DOLA 4RA8A 1J8IA 1U4PA 1HFNA 3H91A 3FPUB 4O42A 1BF4A 1S4ZA 2FJ2A 4XDXA 1WD0A 1WTPA 5E4XA 4IUVA 4IUQA 2CVRA 1DOMA 1SSOA 2H1EA 3TZDA 1ML0D 1ESRA 2HUGA 4MHEA 1O7ZA 4ZLTF 5EQ0A 2Q8TA 1A15A 1XX8A 2NYZD 3I8ZA 1PFNA 3IL8A 1ZXTA 5EPKA 1HHVA 2SDFA 3R93A 2X6GA 4XT1B 1B53A 3HP3A 4ZK9B 3GV6A 1NCVA 1WVLA 1WTQA 1BNZA 2FMMA 1HA6A 1NAPA 1U4MA 1U4RA 5EPLA 1B50A 3GV3A 2B2UC 2RSNA 1JE4A 2JYOA 1O7YA 3KBXA 3IFDA 1X3QA 4HAEA 2K28A 1RJTA 4HCSA 5CMDA 1WTWA 1SAPA 1E0BA 1J9OA 3DEPA 1WTVA 1B4OA 4ZKBB 2KUMA 3ONAB 2JP1A 2M2LA 3KUPA 3Q6SA 1WTXA 2N55A 3I3CA 2HDLA 1WTOA 1AZQA 4QUFA 1DOKA 2KVMA 1MGSA 1PLFA 5AFWA 3DEOA 2RVLA 1XYIA 1QG7A 1ICWA 4MN3A 2K05A 1CA6A 1X3PA 2B2WA 5E4WC 1CA5A 1EIGA 5T1IA 1HUMA 4X3KA 4CJ0B 2FHTA 4NW2A 1AZPA 1HRJA 1CM9A 4OIKA 2HDMA 4U68A 1EQTA 2K01A 3F2UA 4HSVA 1HFGA 2L12A 4R9WA 1KNAA 2BDNA 1RTNA 3QO2A 4DN4M 5D14A 5EJWA 4ZAIA 1PFBA 1AP0A 4CJ1B 3D6WA 4CJ2C 1PFMA 1RODA 5EPJA 4IUPA 2B2YA 5CBEE 2RSOA 1GUWA 5D65A 4X3TA 1C8CA 1Q3LA 3TN2A 1WTRA 2KECA 4LMQD 3FDTA 2R3ZA 1QE6A 4X3UA 2KEDA 1G2TA 2NWGA 4IURA 1HUNA 1IKMA 1WD1A 3P7JA 1JICA 2K04A 5COYA 2X69A 4ZKCB 1BBXC 1F2LA 1EL0A 1VMCA 2L9HA 2VXWA 1U4LA 3I91A 2J7ZA 2KOLA 1PDQA 1IL8A 1DONA 2DY8A 2MPMA 1QNKA 1LV9A 1BO0A 2B2YC 3MTSA 5CBAE 1X32A 1ILQA 4QUCA 4RWSC 4OIJA 1MI2A 4RAUC 2HCCA 1RHPA 4X3SA 1F9QA 1M8AA 2B2VC 1G91A 1KNEA 1NR2A 1NR4A 1ILPA 1VMPA
chains in the Genus database with same CATH superfamily
3CQZH 1PTOC 3BZCA 1L1OA 1CSQA 2F0GA 3J7YW 2RDGA 5CORA 4XQJA 1F9RA 3AYHB 2I46A 3K0XA 1BCPD 1HH2P 4N8FA 2EY6A 3RD4A 1TWCH 2HT1A 4RGMA 3HOYG 4UAIA 1WCMG 4DR5Q 1GM5A 1HNXQ 3V96A 1WTPA 3RLNA 2EYOA 3FP9A 3T4AC 2GN5A 2CW0C 3W3AA 4LFBQ 5C3EH 2PNHA 2NYZD 4DXGA 4DFAA 4GNXB 4RFBA 3PIP3 2WKCA 1T5XD 2R93G 4LF5L 3QB3A 1BR9A 3RN5A 3SK4A 1B1ZA 1II3A 1SAPA 3CCUA 1OXVA 2K14A 1KHIA 4OHJA 3NBHA 3PO3H 4IJLA 1PLFA 2CQAA 1ICWA 4MN3A 2K05A 1JQYD 4X3KA 4K14A 2A69C 3GTQH 5EAYA 1HFGA 2VQFQ 3QO2A 4G4KA 2WAQE 2Z6KC 4ZAIA 5GQOA 5J1ZA 4NDXA 1Q90A 3BG3A 1GUWA 3HGBA 1FL0A 1S5FD 4C3HB 3GTKH 4DR7L 2BH2A 1SNDA 2ASBA 1AFPA 1L0YB 2RHQB 3S2HH 2L9HA 2OWOA 4BY7B 1J6QA 2L5TA 2EJFC 1I4PA 5M5YH 2E8GA 3L0OA 3PCOB 3SGIA 1PH6A 2HIXA 1IXRA 2B2YC 5IP9H 4R8NA 3K5MA 4RAUC 3AB9A 2K33A 2AQ3B 1KNEA 1NR4A 2E2HB 3I4OA 3GTJH 2B2VA 1KIXA 2OTLA 2XN9C 2UUCL 3PUXA 4JI2L 5I2XA 4R1JA 4U673 4A3MH 5IOCA 1RKNA 2WB1B 1IZ6A 5GROA 5BR8L 1EY9A 1TVXA 1U0LA 1VQBA 3GTOH 2F0SA 2L1BA 3CD6A 1I4RA 3S2DB 1A62A 3GQBA 1S72A 4G7ZC 1S3OA 2JA7G 1VF7A 4R8IA 1G2SA 1UNSA 1EU4A 2XIWA 2B2TA 4A3EG 3F2BA 3H91A 5IGCA 1OXSC 3FPUB 1PZKD 1K83H 2IPKD 4DAMA 1VF5C 4X62L 4XQNA 3CC7A 3RZDH 1JWUD 2NVTH 3MXNA 2EYFA 3I8ZA 2ALYB 1TS2A 2SDFA 4I7AA 3NE5B 4XT1B 4PMBA 4POGA 4BBSG 2QA4A 1NAPA 1QZHA 3FKIG 2Q2TA 4BXXG 3DUZA 3OMCA 1PZID 1SEBD 2AQ1B 4X65Q 4A3IG 3NP8A 1X3QA 1WTWA 4CHTB 4BY1G 1A0IA 1QZGA 4IFDJ 3KUPA 2A6ED 4QJFA 4P71A 2FXQA 4LF8L 4JI3L 2BA1A 1QOHA 3QWNA 2EYMA 4B3RQ 1CA5A 4HSPA 4WORA 4OX9Q 4NW2A 3L9AX 2F0HA 3HOYB 1LTRD 2F0FA 4OIKA 3HOVG 1WCMB 5FKAC 4XYQA 1GUSA 1JOOA 4P72A 3J7A5 1XPUA 1ET9A 2NUCA 5C6AA 4CGYB 5E7NA 2PW7A 1Z7TA 4YWMA 1HPCA 4BA1I 3S17H 3E3XA 4LUZA 3E9IA 2GA4B 1PH2A 4Y7NB 4A3FG 2LXJA 1IYJB 2GVAA 1SNCA 1BBXC 2RCNA 3S1MB 1VQGA 2R93B 1LTGD 5M3MH 3GDEA 2F0TA 4HCEA 3DHQA 1H9RA 2EY1A 4YCVA 1BO0A 1O78A 4OGQC 3CMAA 4JI5L 4RWSC 3NQTA 3PUYA 1GO3E 4OIJA 2UXBL 1VQKA 4K6DA 4PZ6A 3CW2C 1WI5A 2VZAA 3E0EA 3S1NH 4HR7B 4C3JG 1JR0D 4JI4Q 4ODGA 3DM1A 2B3GA 1T5EA 5JEAJ 1TWAB 3CPWA 1PRTF 1LT6D 1KLGD 1EYCA 5I6YA 1H9MA 3TBIB 2F1MA 3NTKA 3BVZA 5FLMH 1UUPA 1N9WA 4TVAB 3OWEB 3I56A 4IOAA 3X3NA 1WFQA 4IUTA 4RKLA 1DZ1A 2L4NA 4LJZC 5CV9A 4JBKA 3BVGA 3W1BA 3PIOA 1ASZA 1WTHA 1BF4A 1PYBA 5KNCA 3WWVA 4HIOA 1SYEA 1CKMA 4XDXA 4IUVA 1VQJA 1DOMA 4UPAA 4UHVA 3SXHA 4DNRB 1P8LA 3GV6A 3K6OA 4EQ5A 4MTKA 1XXGA 2N8NA 5EPLA 5A2QL 1N34Q 4UP8A 1XNQQ 5KNDA 3RLFA 1I94Q 5J3BA 1MKHA 2K28A 3M7GA 1F2MA 4R4IA 5DAUA 1L1OB 3H0GH 3GTMB 1A2TA 2M2LA 2IT1A 5KYIA 3QOJA 3RZOH 3S1QB 4JYAQ 1RL2A 1MGSA 4GOPA 1SR3A 1QVCA 2CCZA 2JA7B 4LNQA 4OO1G 5ELBA 3R2IA 4A3EB 5C3XA 3BU2A 4C56C 4BBRH 5C4JB 4DUZL 5LL6X 2IHFA 2EJMA 4CJ2C 3R8BA 2C35B 2KBNA 2Z6KA 3MHBA 4JI8Q 1XPOA 1PH4A 4KHZA 1I4QA 1A3VA 4IUNA 2XRSD 2BCOA 3C1FA 4GKJQ 1CZWA 5CV5A 4A3CG 3JAML 1PRTB 1IL2A 3FKIB 5IODA 1STEA 1TT2A 2EIFA 2WB1E 5M5WB 4A3IB 2YU9B 4LFAQ 5AJ3L 2AQ2B 5KEEA 5CBAE 4BY1B 3J7ZC 1JJ2A 3S16B 3M3YH 3RLOA 1Q86C 3OPOA 1PFSA 1UE7A 4IOCA 1NR2A 1VQHA 2F0NA 3T56B 4RH6A 5JJZA 3JAMc 2Q8RE 4XIGS 4IUUA 3NBHB 2ZJRA 2K5QA 1XMOL 3HOUG 3NELA 3HOVB 2LXKA 1F9SA 1FNVA 2EYJA 1Z47A 1WJJA 2MNAA 4JCVE 1N33Q 3D6CA 2F03A 3G6EA 1PH8A 1VQDA 3CF5A 1ENAA 1MBYA 4A3FB 5FO7B 3TP5A 1J8IA 5G3LD 2R61A 3TP7A 1GJXA 3J7AF 4OX9L 2RDFA 1KL9A 3VDYA 1EWHA 1HHVA 1TY2A 3HP3A 4A3DH 2A6HC 1I6VC 3TP8A 4C3JB 3ND9A 4L5SA 3K0YA 4LFCQ 1TWGH 2HHHQ 5DEHA 4YWLA 2ZJQA 1HCZA 5IY0A 3OW7A 1FVIA 2E76C 2VB3X 5IT9E 1JCKB 2F0WA 3GTPB 1EWIA 1KDBA 3J81j 4NP5A 4K0KL 2M9VA 2EDGA 4IFDH 3PF5A 4NPSA 3AFPA 1ASYA 1HRJA 1JB3A 3DWAA 1EQTA 3MFYA 1VCIA 5F2DA 2JJQA 4LF7L 1PFBA 4C3IG 3CAMA 1XNRQ 3A7LA 2KQ3A 1GD7A 4DV3L 4A3JG 2EY5A 5JPMC 3JC66 3CCEA 4IO9A 3R3OA 3DWQA 4JC0A 3I4MG 3P7JA 4V0BA 2K04A 5COYA 4JI7L 3T1HL 1J5EQ 1I6HB 2J4XA 5LMNL 3KLSA 1EQRA 1VMCA 4R4QA 4UP7A 2BE5C 3I91A 3S15B 5FLXL 4PMWA 1PDQA 4IPCA 4DR3Q 1KD1C 3PO2H 4A3KG 2YYZA 4DK1A 5M5XB 4DV6Q 3D31A 1TWFH 4MIUA 4OEMB 2EYLA 4A3BH 3TP6A 4C2MH 4KKSA 3EN2A 3P1HA 2JA6H 1B3AA 3Q22A 4KMUC 4A4IA 4BA2I 5EKIA 5FLXc 2IY5B 3TZUA 1L2FA 1JOKA 4DPGA 4FO2A 1EY8A 5M3MG 3ICEA 1AN8A 2RHSB 2NVYB 3ERQA 1EYGA 3CU7A 2JA8H 5K5PA 5DLQE 5JEAH 4X66Q 4XT3B 3BVMA 3HOXH 2SOBA 1K8OA 5I2YA 5M3FG 1SXTA 1X3EA 4DV1Q 1IBMQ 1A3UA 2CH4A 1SNPA 4LUVA 4A75A 1YEZA 1Q46A 1C7YA 2F4IA 3D3RA 1DD2A 5M9OA 5FJ8G 1G6PA 1V1PA 3K5OA 1YNND 5HGTA 3K7AB 3NEMA 1I4XA 2PQAA 3OYYA 4H13C 2CVRA 5FLMG 4DR1Q 1HR0L 3KF8B 1GHJA 3U4ZA 1SNQA 2K75A 5EQ0A 2SEBD 4P73A 2XWBB 4RCOA 5EPKA 4A3LH 3O13A 1WVLA 3VA7A 1EY5A 1LUZA 1VQ4A 4JI8L 5C44H 1YNJD 3GV3A 3S2HB 1QUQA 2DGYA 5M5YB 3SEBA 3A74A 5EGTA 5I4DA 3HOUB 1UEAB 5CMDA 4DAPA 3H3VH 3M9BA 3ONAB 5C4XH 1YZ6A 2HDLA 3GO5A 1KQSA 4L5QA 4A76A 2BOSA 3ULPA 3CC2A 1PTOB 4JI0L 4YWKA 2Q2HA 2VW9A 2N49A 1JOQA 1CUKA 2WKDA 1Y69U 5E4WC 5T1IA 4K2LA 3GTJB 1HUMA 4LF9L 4L63B 1P16A 1ZYRC 3SHLA 3S24A 3HOWG 2PZWA 1TXYA 4GLAC 1IYUA 1RD9D 3I72A 1PFMA 1RODA 3H0GG 1SMYC 4G7HC 3HOZG 3IRBA 1OTCA 3GTOB 4KTAA 4R4TA 1QE6A 2KEDA 4NXMQ 3LX0A 1EFWA 4B3SL 2UUAL 1VQEA 4ZKCB 2I5MX 2F0EA 3I2ZA 1JJGA 5JVH3 1G291 4BBRG 3J81L 4NB3A 1RIPA 2ICEC 1QNKA 3K81C 2Y0SG 3RZDB 3KF6A 2NVTB 1ESFA 2HCCA 3I4NH 1K8MA 3PIO3 5IGEA 3DM3A 1DJRD 3P75A 1KDAA 1IBLL 1PXUA 3LNNA 4GOPB 1D1IA 5FO8B 3STBD 2F0PA 4E6IA 4MNOA 1UEBA 4PV1C 3NENA 4C3IB 2L55A 4LFCL 2HHHL 3C3LA 4A3JB 3UDFA 1EZ6A 2RBMA 1U9RA 5ISRA 3G48A 1HNWL 3ERSX 3I4MB 1TY0A 4K8IA 1UAPA 2K6AA 1X56A 4J1MA 1PHJA 2E2JH 1NSNS 1RCVD 1CI3M 4A3KB 1SSOA 1PVOA 2PZTA 1ML0D 2H5XA 1X9NA 1BDOA 1SYDA 2K5HA 3S17B 2ICIA 2NVXH 3QOLA 1XNRL 3NSWA 3TS2A 4AQYL 3DXJC 1EY0A 2RSNA 4S3SA 3PV0A 2AHOB 1XJVA 1N8RC 1GXDC 1SFOB 5M3MB 1K0SA 1QJOA 1X6OA 5JOBA 4CKEA 4X6AH 1EFID 2ZXPA 5LMUQ 2JP1A 3CMEA 1WTXA 4KJOA 3A56A 3E6ZX 4DV0L 2PO4A 1SYCA 5M3FB 3HZXA 2E75C 1IHZA 4APVA 5GAGC 3J80L 3UDIA 3ER0A 2VUMH 3M4QA 4CJ0B 5IYBG 4R9WA 2UU9L 2ATWA 2O4XA 4CJ1B 3FEWX 4IALA 2A68C 4JVZA 5CBEE 3CRKC 4YY3Q 3CKIB 3J80c 1Q3LA 3TN2A 2K7VA 4UP9A 4IFDG 4GOPC 2F4VQ 2WINB 1MJEA 4LWCA 2QILA 1NMFA 4HMIA 4HJ8A 3QG1A 1CHQD 2D62A 5C0XI 1LV9A 5IYCH 1D2BA 1Y1WG 4QUCA 1YHQA 5K36G 5D3IB 3D8GA 1TS4A 2B2WA 1RDPD 1VMPA 1EQQA 1SRUA 2VY3A 1LYLA 2NN6H 4DR2Q 1MSHA 3TDQA 1W3SA 3HOWB 1TIID 4DGZA 2EE1A 3N52A 4HEDA 2JXMB 4ID6A 1VQ5A 4WRDA 3H0GB 3HOZB 5HY6A 1PH9A 1UE5A 4H02A 2JA6G 2JA5H 2MP1A 2KEEA 2CH4W 1L0XB 3WOEA 1LT5D 3CCRA 1U4PA 2FMCA 1CQFA 4PZ7A 1MIUA 2JA8G 4BBRB 4QIWE 4KN7C 2OT2A 2H1EA 1XMQQ 3E9HA 4H7BA 3SE0A 1YIJA 2Y0SB 4HIMA 3QR8A 1V43A 1PRTD 4YCUA 1LO5D 1SYGA 4GKKQ 2X6GA 3LWUA 2ZTEA 3SK8A 3I70A 1U4RA 3S14B 1LLRD 3K5NA 1KRSA 4L8JA 2JE6I 4HAEA 3UDGA 1ZKOA 2A5HA 4C1NK 4RHSA 1SNOA 1B4OA 5JJLA 4FF3A 3Q6SA 1DYQA 4PNYA 4JBMA 3M3YB 4Y52H 3DEOA 1HJPA 3U50C 2B63G 2K32A 3KLRA 1X3PA 1EU3A 1E7ZA 3VYUA 3OTOL 5C44G 2NTSA 3I7FA 2IJ0A 4A3GH 3F2UA 1Q8IA 3U9SA 1JT8A 2M00A 1MD2D 2B8FA 1GHKA 2IW3A 4X3TA 1V1PB 2NVQH 1SE2A 5IGGA 4HMJA 1CZGA 4TQUS 2R7ZG 1IBKL 1FJGQ 2PQAB 1PH3A 3HKZE 1Q82C 4LAAA 1IKMA 1X3GA 1IW7C 2VNUD 1C4QA 3C1EA 2XWJB 2D2CC 3U9OA 2O5JC 3DLLA 1HZAA 3MXUA 4K5WA 2RCFA 3TQYA 3I4LA 3KK7A 5FO9B 2RKSA 3VYRA 4LF4Q 4F88A 3K80C 1FNUA 3LWEA 3M85A 2F0IA 3FHWA 1NBWA 2NZ1D 1EIFA 2OXPA 2V4DA 4L6TB 4JBWA 4KY7A 4G57A 5IYDG 3I4NG 1O80A 4DAYA 3S1RB 4DR5L 2NBFA 2VQEQ 1HNXL 1M4VA 3B6YA 2KA7A 4RG1A 3D0FA 1S4ZA 3N6RA 2DJFC 2SNMA 4LFBL 1O7LA 2K52A 1TS3A 5C0XH 4P74A 3FMCA 1Y1WB 3NPPA 3IL8A 4FP5D 4KJNA 1MJCA 1TS5A 4CDDC 5IWAQ 2Q2IA 4TKOB 1TWHH 3CPFA 3G6JB 1HNZQ 4YY3L 2F0JA 3HFZB 4GN4B 1VQCA 2K4KA 4M8AA 2Z8LA 1PH5A 3R2TA 1ET6A 4C1NI 4K5VA 4O2DA 3KFUA 3GP7A 4WJWA 2N55A 1K0RA 1Y8NB 1I4HA 4TRDA 1YBYA 3KLWA 2JA6B 1C0AA 4IZ8A 2VQFL 1CKOA 2HDMA 5ELFA 1SYFA 3T53B 1XPRA 2BH8A 2E2IB 4IUPA 3NK9A 4DR2L 2Z0SA 3C2PA 5GADC 4CDCC 5I9PA 2R3ZA 1CKNA 1HZBA 4DR6Q 2ZTCA 2E5LQ 5C3EG 1HUNA 3NHHA 1OXTA 4DK6C 5CGKA 1F2LA 3K5LA 1JWSD 1VQ8A 1LTAD 5CV7A 2OCEA 1AW7A 4RGTA 4DUYQ 3OMGA 4ME5A 4R4OA 4BY7H 1LM0A 3MFGA 5H1SE 3OOCA 3PO3G 2B63B 4H44C 4I65A 5C44B 4Q0FA 1I5FA 5A2QE 1BCPC 1JC7A 4QB4A 1EOTA 3SVMA 4DV4Q 1GUNA 1SDFA 2F0OA 1PTOD 4N9TA 2BA0A 4BBSB 1EY7A 1KAWA 3V05A 5FOBB 2MGSA 4XYOA 3F2CA 2Y0SE 1AE2A 3CCLA 3MWYW 1V9PA 5C3WA 2IL8A 4OXPA 5I9OA 3M4PA 2R7ZB 3NTIA 4OWTB 4Z9CB 2NN6G 1B3QA 4CKCA 4FNFA 5T1GA 4R4CA 1YJWA 1C48A 1HFNA 3RUZA 3EVQA 1WOCA 1KRTA 1GUTA 2PW5A 3RNUA 3IAYA 2XVSA 4ME3A 2F0MA 2R6GA 5IP9G 2XRQD 1T9HA 2VL6A 2CW0D 4X65L 3E0JA 1ENCA 3JAME 1JE4A 2JYOA 1JWMD 3BS1A 1LT3D 4JV5Q 5BN5A 2PI2A 3GTLB 2RF4A 4DV2Q 3D4DA 1GUOA 2LSSA 1EQVA 5EBDA 2F0LA 4A3MG 2R7DA 4B3RL 1QVFA 1CA6A 4DK3C 1A63A 2EY2A 4P2CB 4QMGA 1H9JA 2K01A 1I3QH 4RHRA 1HZCA 2UUBQ 2LY7A 4WJ3M 2A69D 3KJPA 1I50H 3VYSA 1BVSA 3A7AB 3ZJYC 3VYTA 1WCMH 2WIIB 3HEJA 1D5MC 3FVQA 1B8AA 4PG3A 5IT9c 2KCMA 3H3VC 1ONLA 1SNMA 3AFQA 4RGOS 3HKZG 3SK5A 2J7ZA 3H94A 2EVBA 4DA2A 2KCTA 3CQZB 1QILA 1IL8A 2N3SA 2E2JB 4JI1Q 3MEFA 2VQEL 1UE6A 3AU7A 3MTSA 2ZM6Q 1YITA 4Y7NH 3H6MA 5A35A 1N36Q 2QF7A 4JI4L 1RHPA 3ZYYX 2Z4HA 4A93H 3PUWA 3S1MH 2SNSA 2I07B 3ULLA 2NVXB 1STGA 1TWCB 2EPBA 2QDLA 2HQLA 4YCWA 1Y1VH 2MQHA 1LTTD 4FXKC 2EOTA 3SDZA 3G7LA 3MXNB 2Z1CA 2C9OA 1HNZL 2KCNA 4JG2A 4EQOA 4QCLA 2UXDQ 3SK6A 2QCPX 1K3BC 1TWAH 1CK1A 3A0JA 2F0DA 1RTOA 2B2WC 2MJ8A 1H9SA 1Z9FA 1ZEQX 3J7AV 3S9WA 2EYPA 5C3EB 4RKBA 3UI2A 2ZXRA 5GAEC 1X54A 1XTCD 2IX1A 2A74C 4IN3A 3F2DA 1SYBA 4DNTB 1B7YB 4B08A 5E4XA 2F0KA 2HUGA 2PCFB 4DF7A 4FF2A 1EWCA 2IHEA 4B3MQ 1R9TH 1N34L 4ZK9B 3FRPB 1XNQL 1WTQA 1YNXA 5JJIA 1BNZA 1I94L 3PO3B 2KENA 2A6EC 2R92H 5NUCA 2ZTDA 2DJGC 3KBXA 4HCSA 3JAMi 5FLXE 1E0BA 1J9OA 4LF5Q 4JYAL 5CC4A 4KD4A 3GTQB 3WDNA 1VQNA 1JJCB 3OIQA 1A3TA 1DOKA 4ULLA 3T51B 4ZUIA 4KHPQ 2KHSA 2EZVA 4I7ZC 4FDBA 3GTKB 1IW7D 1S5ED 4U68A 4OWXB 1OO9B 3H15A 4HSVA 2R7FA 1KNAA 4DAYB 5G3LF 2PMZE 5EPJA 3TRZA 3Q8DA 1E2VA 2JA7H 4GKJL 4OO1I 4QIWB 1NUCA 4YIJA 2BDOA 2NWGA 2HIVA 1D7QA 3OHXC 4ZQ3A 4DR7Q 1SE4A 1EL0A 2VXWA 4IJHA 4LFAL 1Z6HA 2DNCA 2KOLA 1DM0B 2P5ZX 4JI6Q 2NB0A 2DY8A 1HQRD 3K57A 2KHIA 3F8TA 1MI2A 4A3MB 1U5KA 3FKIH 1GVPA 4BXXH 1RF2D 4A3IH 1M90C 4DNIA 1F2ZA 1JORA 3PSIA 1X55A 3F1ZA 2WP8J 3QJYA 1KXLA 1N33L 2B8GA 2UUCQ 4FXDA 3TREA 4JI2Q 3UDXA 1F2YA 2L11A 1SE3A 1K83B 4JW0A 5C5MA 5LL6S 1FYCA 5BR8Q 5BN4A 1BBUA 2WACA 3HOVH 2D9UA 1CFMA 3D4WA 1EEFD 1K8GA 4GN3B 2F3WA 1STYA 2QEJC 3KBGA 5CYUA 2CFMA 1HZ9A 2NZHA 1CKNB 3BDCA 3HKZB 3MXGA 5HURA 1WD0A 2KCCA 2K5VA 5ELDA 1CHPD 3TMEA 3P20A 1ESRA 4MHEA 4AYBG 1B9MA 1Y14B 4X62Q 1VQ7A 3MA2B 4A3FH 2OQ0A 1LTLA 4FYDA 1HA5A 2MO1A 3NUCA 1GUGA 3R93A 3VR5A 1Q1BA 2AUJD 2K50A 2WV6D 4KY5A 2K5NA 4QF4A 2DN8A 1STHA 2OF1A 4BS9A 3J81E 3A54A 2TSSA 1KC8C 4ZKBB 2KUMA 5C0XJ 5C4HA 1AZQA 4C3JH 2ZXOA 2QKIC 5AFWA 4POFA 2RVLA 2CWPA 1V8QA 4F8MA 1W6KA 4LF8Q 1OXXK 2ZM6L 3GTGH 1QVGA 4WFN3 5IGBA 3L3OC 4HIDA 3GTPH 2MHVA 2LFNA 4B3TQ 1AP0A 1Q1EA 3D6WA 3E5SA 3VR3A 1JB7A 5D65A 2GVBA 1C8CA 2Q8IB 1YVCA 2KECA 3T16A 2PPBC 3FDTA 1EZ8A 4FF4A 1J5EL 2QDBA 1EIYB 2RQXA 3NXWA 4K6LA 4DR3L 2UXDL 4A3DG 1EY4A 3S1NB 1Q81C 4DV6L 3MC0B 2F3IA 1Y8PB 1VQFA 1I4GA 1M1KC 2MPMA 2PQEA 5ELCA 2K5WA 4PQXA 1STNA 2MUYA 2Z9HA 1W2BA 2E74C 4FF1A 4X3SA 1I6HH 1ICFB 4JI5Q 4UDUC 2UXBQ 3S15H 1A2UA 4HIKA 1BKBA 1TWHB 1G6ZA 5M5XH 4L5TA 4B3ML 4X66L 1TR5A 4F7XA 3GD7A 2JK8A 5BN3A 1NMGA 4DV1L 2CHBD 2K1BA 1IBML 3W5OA 1K3RA 4A93G 3KDFA 3T1YQ 4ZUJA 4OO1H 1S5BD 3HS0C 3J80E 1IKLA 2NVYH 5HGQA 2F52A 3Q24A 1DOLA 2O2LD 3EA6A 1PYWD 4DR1L 1Y1VG 5JJKA 4O42A 4KHPL 2E2DC 3PO2G 4GLVB 2YTXA 2Q8TA 1A15A 2F0VA 4A3CH 1PFNA 3U4VA 4P75A 4A3BG 3VR2A 3RZOB 3K7AH 2KJXA 3MVVA 2D0OA 4DKAC 2A6HD 1Q8KA 5IP7H 2OQKA 1B9NA 3IKJA 4JBJA 2XGTA 1AH9A 3J81i 1LABA 3HKSA 5JEAG 4JI6L 3M4OH 4ZCKA 3HOXG 4RMFA 4CKBA 3HOUH 1HQMC 1CM9A 4EX5A 3OWFA 1W6JA 2R92G 2A73B 3PGZA 2JQOA 1L0WA 3KJOA 3TS0A 5D14A 4JK1C 1PTOH 1E24A 3VA5A 1H9SB 4EVOA 3UE0A 4DUZQ 2C5CA 4AYBB 1R4PB 5CV6A 1DCZA 4NXML 2Z4IA 4K2KA 1WTRA 1VQLA 2AKWB 3KOJA 3PUVA 4G7OC 4IURA 5EKLA 1BCPF 4IPHA 4A3LG 1DGSA 4HJ7A 4GNXC 1AE3A 4NXNQ 3LGJA 1CT1D 2ZT9C 3TEHB 4DR4Q 2BE5D 5AJ3Q 2UXCQ 2CQOA 5C4XG 4DV5Q 3U58A 3BYTB 3IFTA 1SLJA 2A8VA 2FFKB 1VS0A 1NTGA 1B70B 3DMUA 1H95A 5JAVA 1XMOQ 1E3PA 2DY7A 3CP0A 3Q23A 1HTPA 1EIHA 1YNNC 1QUQB 2ENBA 2B2UA 1WYDA 4RA8A 4ZYSA 1K9MC 3CCSA 3J80i 4C3IH 4FXGC 4DXFA 1I3QB 4A3DB 3BZDB 1PMRA 4A3JH 3RR5A 1TWGB 4LK1C 1I50B 1O7ZA 4CDEC 3V2TA 1XX8A 1YNJC 3MXPA 5D3DA 3I4MH 4O0AA 4B3TL 1NCVA 2CWAA 1SBBB 3PQIA 3G71A 1HA6A 4QGUA 4A3KH 1KLUD 1O7YA 1STAA 3L7ZC 5FK9C 5LMNW 1STBA 5LMUL 1RJTA 1VQAA 4GS3A 5KNBA 2G5DA 2IWHA 4HJ5A 3I3CA 2AWNA 3W1GA 3A5UA 4TSSA 4HJ9A 3KF8A 1Y8OB 2F0QA 1QB5D 2EJGC 2B39A 4A93B 2LS01 3HRZC 1V1QA 5C4ZA 5J22A 2O5IC 1S5DD 1BCPB 1SFOH 4K0KQ 1AZPA 2Q2UA 1SMXA 3C46A 3NWSA 1G51A 2L12A 1XTDA 1RTNA 4LW1A 1Y1VB 3KF6B 4NKLA 3NTHA 5M3FH 1PV4A 1ZYRD 4IPDA 4J6HA 4LF7Q 4FVMA 3PO2B 1JE5A 4KD3A 3CC4A 1E2ZA 2F4VL 2PI2E 4LMQD 4DV3Q 5FJ8H 1TWFB 1SMYD 1S40A 4A3BB 1WD1A 2ES2A 2I5LX 3EFXD 2AUKA 2NZOA 4C2MB 4IQZA 4HN7A 5IGFA 3T1YL 4JI7Q 3T1HQ 3EBEA 5LMNQ 1FD7D 5J39A 1GKHA 2OEOA 4GLXA 4IFDI 1PH7A 1CQVA 5L37A 1HR0W 3A8IE 2JA8B 2MFIA 1F9QA 1M8AA 2HD3A 3BDLA 3H09A 1R9TB 4KKTA 1ILPA 3HOXB 1EEID 2HCIA 1TKWB 3STBC 5E1FA 4QY7A 1O7IA 4L5RC 2R92B 1EYDA 2TMPA 1VQPA 2VUMG 1NY4A 4CDFC 1HXYD 2PZUA 1FNWA 2K03A 2DNEA 4GN5A 4OELB 2LKVA 2PMZB 4C3HH 3CCJA 1K73C 2AWOA 1FGBD 3HOWH 4PZ8A 1S5CD 2AMCB 2LMCB 3HOZH 3A5ZB 1XMQL 1YJ9A 1LTSD 1E2WA 5JPNC 2CKZB 4N8X1 4GKKL 1HR0Q 4DV7Q 3AQQA 5IYCG 1IYVA 1CSPA 2E2HH 5C4XB 3PF4A 3OIPA 1KAAA 4YHHQ 1B50A 2HQEA 3EQLC 1A8VA 4XXEA 2WAQG 4LF6Q 3IFDA 4PMCA 4CBVA 3KLSX 1SJHD 4JPBW 4AYBE 1VQ6A 1CTMA 2JN4A 1N32Q 1PA6A 4GZYC 4QUFA 3S14H 5CR3A 3BYYB 4DK0A 2JEAI 3S2DH 2WFWA 4KV6A 1QG7A 4NXNL 4KLKA 4JI0Q 4DR4L 3TSSA 1EYAA 2FHTA 3A8KE 4KHVA 4JOIC 5CV8A 2JA5G 1BUVT 2UXCL 4HJAA 3KDFB 3X3MA 1JMCA 4LF9Q 4LUOA 1H9KA 3PIPA 4K8JA 5IP7G 3MZ5A 1KDCA 4DV5L 2B2YA 2EXZA 4ZRZA 4XTCS 4AH6A 1D1KA 4DAVA 1FJGL 3ND8A 1BOSA 3SR1A 3NBIA 4OL7A 2A68D 2XTIA 4EGVA 2ID0A 3H3VI 2X69A 3I4NB 3ITPA 3CCVA 1PZJD 4B3SQ 3HG9A 2UUAQ 3T13A 1KABA 3BDOA 3I73A 5ELOA 5IT9L 5E3FA 4GNXA 1UE1A 4MTNA 2EQSA 3PMFA 1LT4D 3CRLC 1ILQA 5GAHC 4LF4L 4BWGB 1B44D 2RDHA 1L1OC 1UWVA 1R4QB 4X64Q 1K8AC 4QQBX 3ULJA 4UY8C 2V1CC 3HOYH 1Q12A 1MHWC 1E22A 1YJNA 3I90A 2RA4A 3BZKA 4KN4C 1IBLQ 4A3GG 5JVG3 1D8LA 2XSCA 2X6LA 2Z6BA 1SJED 1FR3A 5IYBH 3QIAA 1YHAA 2JEBI 3CCQA 5DNFA 1LACA 2OTJA 1NJIC 2B29A 1QWYA 2L15A 3G4SA 3GTGB 5EBCA 2VS1A 5IGDA 4MZ9A 2R93H 1HNWQ 2FJ2A 1PRTC 3MEHA 2H4OA 4NMZA 3S1RH 3TZDA 2QW7A 4KKUA 3RMHA 3D4RA 3OW2A 5IWAL 1BBWA 1PYSB 1ZXTA 3NQIA 2I0QA 2YV5A 4J15A 1ENFA 2F3VA 4KY6A 4AQYQ 1Y1WH 2VUMB 3Q0AA 5IE8A 1VQOA 1WTVA 5K36H 2QGQA 4K5XA 1PTOF 4B9XA 5C5LA 5IIFA 2KVMA 1XYIA 4DV0Q 1SE8A 3K59A 3BJUA 2N78A 3A8JE 2PNRC 4DN4M 3A55A 4IPGA 5EJWA 3VR6A 4ALPA 2UU9Q 1LTID 1X3FA 2A19A 2D5DA 1F77A 3VR4A 1PH1A 4OWWB 3WOFA 4DR6L 2E5LL 4H0LC 4V190 3M7NA 5C0XG 1GOZA 3RN2A 3FPPA 4X3UA 5ELEA 3CXCA 3AEVA 2E2IH 2EXDA 1Q7YC 1U4LA 4N9PA 1EOVA 1OXUA 1TQOA 2K5DA 2ZJPA 1AEXA 2WAQB 4DUYL 3W2DA 5CV4A 3GTMH 2A1AA 1VDZA 1X32A 3S1QH 3AMUA 2B2VC 3OSOA 1G91A 1DONA 2PYKA 2FMMA 4EQPA 1EUJA 5EKKA 2J0TD 4A3EH 4DV4L 1BXTA 4WJ4A 3CHBD 3K58A 2G9DA 5KGUA 4DV7L 2JA5B 2N88A 1KTKA 3UE1A 5C4JH 1QCBD 1A6XA 1B2TA 5KIXA 1EY6A 1D5XC 1F9PA 2VB2X 1NE3A 4YHHL 2B63H 1SN8A 1XWEA 4HTHA 1YI2A 4LF6L 4OONA 2B2TC 3PUZA 3M4OB 3EJIA 3DWPA 2FINB 1G8ZD 5TSSA 4J8QA 4BBSH 1N32L 1MSGA 3URYA 3MAQA 1LTBD 1VQ9A 2F0UA 5M5WH 2YU9H 3L2PA 4IUQA 2L0CA 2KHJA 2R7ZH 4BY1H 3S16H 1BQQT 4AIMA 2JSOA 4C3HG 4ZLTF 2G9HD 2NN6I 2QEXA 4ILWA 1B53A 5KRUA 5DM73 1U4MA 2DUDA 2XNAC 4BY7G 4JV5L 5ELNA 2B2UC 2YTYA 4DV2L 2JA9A 4Q5VA 3DEPA 4XQQA 4A3GB 1FGUA 1E1OA 4O1NA 1WTOA 4RGNA 2YTVA 3I55A 2NVQB 1EIGA 4QL5A 4RCNA 3GTLH 1D6EC 2UUBL 3OTOQ 4KK7A 2BDNA 5IYDH 1NNXA 2WB1G 4X64L 3KYHC 4JOIA 4DU9A 1TU2B 2RSOA 1X65A 1HTLD 1K28A 1D5ZC 1E1TA 5DM63 3J81c 2NTTA 1G2TA 1YHBA 1SROA 1V1OA 4KI0A 1IBKQ 2D0PA 3M4YA 1JICA 2IX0A 3NWTA 4JI1L 4B9WA 4JI3Q 2MO0A 4EQNA 1VQIA 4M1UB 4ABNA 1N36L 1QNUA 3EROA 2IX3A 2EYHA 4F87A 1DXMA 3K7UC 5KYLA 3CCMA 1VQMA 1C9OA 5I6WA 3EIVA 5LHY1 2I5HA 3K8AA
chains in the Genus database with same CATH topology
1PTOC 2F0GA 3J7YW 2RDGA 5CORA 4XQJA 1F9RA 2I46A 1BCPD 3RD4A 2EY6A 4RGMA 4UAIA 3V96A 1WTPA 2EYOA 3T4AC 2CW0C 3W3AA 2NYZD 4DXGA 4DFAA 4RFBA 3PIP3 2WKCA 1T5XD 3QB3A 1BR9A 3SK4A 1B1ZA 1II3A 1SAPA 1OXVA 4OHJA 3NBHA 1PLFA 2CQAA 1ICWA 4MN3A 2K05A 1JQYD 4X3KA 4K14A 2A69C 1HFGA 3QO2A 4G4KA 4ZAIA 5J1ZA 4NDXA 1Q90A 3BG3A 1GUWA 3HGBA 1S5FD 4C3HB 1SNDA 1AFPA 1L0YB 2L9HA 4BY7B 2L5TA 2EJFC 1I4PA 2B2YC 4R8NA 3K5MA 4RAUC 3AB9A 2K33A 2AQ3B 1KNEA 1NR4A 2E2HB 2B2VA 2XN9C 3PUXA 5I2XA 4U673 5IOCA 1RKNA 2WB1B 1EY9A 1TVXA 2F0SA 2L1BA 1I4RA 3S2DB 3GQBA 4G7ZC 1VF7A 4R8IA 1G2SA 1UNSA 1EU4A 2XIWA 2B2TA 3H91A 5IGCA 1OXSC 3FPUB 1PZKD 2IPKD 1VF5C 4XQNA 1JWUD 3MXNA 2EYFA 3I8ZA 1TS2A 2SDFA 3NE5B 4XT1B 4PMBA 1NAPA 3DUZA 3OMCA 1PZID 1SEBD 2AQ1B 3NP8A 1X3QA 1WTWA 4CHTB 4IFDJ 3KUPA 2A6ED 2BA1A 1QOHA 3QWNA 2EYMA 1CA5A 4HSPA 4WORA 4NW2A 3L9AX 2F0HA 3HOYB 1LTRD 2F0FA 4OIKA 1WCMB 5FKAC 4XYQA 1GUSA 1JOOA 1ET9A 2NUCA 5C6AA 4CGYB 2PW7A 1Z7TA 1HPCA 4BA1I 2GA4B 4Y7NB 1SNCA 1BBXC 3S1MB 2R93B 1LTGD 2F0TA 4HCEA 3DHQA 1H9RA 2EY1A 1BO0A 1O78A 4OGQC 4RWSC 3NQTA 3PUYA 4OIJA 4K6DA 4HR7B 4C3JG 1JR0D 4ODGA 3DM1A 1T5EA 5JEAJ 1TWAB 1PRTF 1LT6D 1KLGD 1EYCA 5I6YA 1H9MA 3TBIB 2F1MA 3NTKA 3BVZA 1UUPA 3OWEB 3X3NA 4IUTA 4RKLA 1DZ1A 2L4NA 4LJZC 5CV9A 3BVGA 1BF4A 5KNCA 1SYEA 4XDXA 4IUVA 1DOMA 3SXHA 4DNRB 3GV6A 3K6OA 1XXGA 5EPLA 5A2QL 5KNDA 3RLFA 2K28A 3M7GA 1F2MA 5DAUA 3GTMB 1A2TA 2M2LA 2IT1A 5KYIA 3QOJA 3S1QB 1MGSA 2JA7B 4OO1G 5ELBA 3R2IA 4A3EB 5C3XA 4C56C 5C4JB 5LL6X 2EJMA 4CJ2C 3R8BA 3MHBA 4KHZA 1I4QA 1A3VA 4IUNA 2XRSD 2BCOA 3C1FA 1CZWA 5CV5A 3JAML 1PRTB 3FKIB 5IODA 1STEA 1TT2A 5M5WB 4A3IB 2YU9B 2AQ2B 5KEEA 5CBAE 4BY1B 3S16B 3OPOA 1NR2A 2F0NA 3T56B 5JJZA 4RH6A 2Q8RE 4XIGS 4IUUA 2K5QA 3HOVB 1F9SA 1FNVA 2EYJA 1Z47A 3D6CA 2F03A 1ENAA 1MBYA 4A3FB 5FO7B 3TP5A 1J8IA 5G3LD 2R61A 3TP7A 1GJXA 3J7AF 2RDFA 1EWHA 1HHVA 1TY2A 3HP3A 2A6HC 1I6VC 3TP8A 4C3JB 3ND9A 3K0YA 5DEHA 1HCZA 3OW7A 2E76C 2VB3X 5IT9E 1JCKB 2F0WA 3GTPB 1KDBA 4NP5A 2M9VA 2EDGA 4IFDH 1HRJA 1JB3A 3DWAA 1EQTA 3MFYA 1VCIA 5F2DA 1PFBA 4C3IG 3A7LA 2KQ3A 2EY5A 5JPMC 3R3OA 3DWQA 3P7JA 4V0BA 2K04A 5COYA 1I6HB 2J4XA 3KLSA 1VMCA 2BE5C 3I91A 3S15B 5FLXL 4PMWA 1PDQA 2YYZA 4DK1A 5M5XB 3D31A 4MIUA 2EYLA 3TP6A 4KKSA 3P1HA 1B3AA 3Q22A 4KMUC 4BA2I 5EKIA 3TZUA 1JOKA 4FO2A 1EY8A 1AN8A 2NVYB 3ERQA 3CU7A 5K5PA 5JEAH 4XT3B 3BVMA 2SOBA 1K8OA 5I2YA 1SXTA 1A3UA 1SNPA 2F4IA 3D3RA 1DD2A 5M9OA 1V1PA 3K5OA 1YNND 5HGTA 3K7AB 1I4XA 4H13C 2CVRA 1GHJA 1SNQA 5EQ0A 2SEBD 2XWBB 4RCOA 5EPKA 3O13A 1WVLA 3VA7A 1EY5A 1YNJD 3GV3A 3S2HB 5M5YB 3SEBA 5EGTA 5I4DA 3HOUB 1UEAB 5CMDA 4DAPA 3ONAB 2HDLA 3GO5A 2BOSA 1PTOB 1JOQA 2WKDA 1Y69U 5E4WC 5T1IA 4K2LA 3GTJB 1HUMA 4L63B 1ZYRC 3SHLA 2PZWA 1IYUA 1RD9D 3I72A 1PFMA 1RODA 1SMYC 4G7HC 3GTOB 4KTAA 1QE6A 2KEDA 3LX0A 4ZKCB 2F0EA 5JVH3 1G291 3J81L 2ICEC 1QNKA 3RZDB 2NVTB 1ESFA 2HCCA 1K8MA 3PIO3 5IGEA 1DJRD 3P75A 1KDAA 1PXUA 3LNNA 1D1IA 5FO8B 2F0PA 4E6IA 4PV1C 4C3IB 2L55A 3C3LA 4A3JB 1EZ6A 2RBMA 1U9RA 5ISRA 3I4MB 1TY0A 4K8IA 1UAPA 2K6AA 4J1MA 1NSNS 1RCVD 1CI3M 4A3KB 1SSOA 2PZTA 1ML0D 1BDOA 1SYDA 3S17B 2ICIA 3QOLA 3NSWA 4S3SA 1EY0A 2RSNA 3DXJC 3PV0A 1GXDC 1SFOB 5M3MB 1QJOA 5JOBA 4CKEA 1EFID 2ZXPA 2JP1A 1WTXA 4KJOA 3A56A 3E6ZX 2PO4A 1SYCA 5M3FB 3HZXA 2E75C 1IHZA 3J80L 4CJ0B 4R9WA 2O4XA 4CJ1B 3FEWX 4IALA 2A68C 5CBEE 3CRKC 3CKIB 1Q3LA 3TN2A 2K7VA 4IFDG 2WINB 2QILA 4HMIA 3QG1A 1CHQD 2D62A 5C0XI 1LV9A 1D2BA 4QUCA 5K36G 5D3IB 3D8GA 1TS4A 2B2WA 1RDPD 1VMPA 2NN6H 1MSHA 3TDQA 3HOWB 1TIID 4DGZA 2EE1A 3N52A 4HEDA 2JXMB 4ID6A 4WRDA 3H0GB 3HOZB 2MP1A 2KEEA 1L0XB 3WOEA 1LT5D 1U4PA 2FMCA 1CQFA 4BBRB 4KN7C 2OT2A 2H1EA 4H7BA 3SE0A 2Y0SB 1V43A 1PRTD 1LO5D 1SYGA 2X6GA 3LWUA 3SK8A 3I70A 1U4RA 3S14B 1LLRD 3K5NA 4L8JA 2JE6I 4HAEA 1ZKOA 2A5HA 4C1NK 4RHSA 1SNOA 1B4OA 4FF3A 3Q6SA 1DYQA 4PNYA 3M3YB 3DEOA 2K32A 3KLRA 1X3PA 1EU3A 3VYUA 2NTSA 2IJ0A 3F2UA 1Q8IA 3U9SA 2M00A 1MD2D 2B8FA 1GHKA 2IW3A 4X3TA 1V1PB 1SE2A 5IGGA 4HMJA 1CZGA 4TQUS 4LAAA 1IKMA 1IW7C 2VNUD 1C4QA 3C1EA 2XWJB 2D2CC 3U9OA 2O5JC 3MXUA 4K5WA 3I4LA 3KK7A 5FO9B 2RKSA 3VYRA 4F88A 1FNUA 3LWEA 3M85A 2F0IA 2NZ1D 2OXPA 2V4DA 4L6TB 4JBWA 4KY7A 4G57A 1O80A 4DAYA 3S1RB 2NBFA 1M4VA 2KA7A 1S4ZA 3N6RA 2SNMA 1O7LA 1TS3A 5C0XH 3FMCA 1Y1WB 3NPPA 3IL8A 4FP5D 4KJNA 1TS5A 4TKOB 3G6JB 2F0JA 4M8AA 2Z8LA 3R2TA 1ET6A 4C1NI 4K5VA 3GP7A 4WJWA 2N55A 1Y8NB 1I4HA 4TRDA 2JA6B 4IZ8A 2HDMA 5ELFA 1SYFA 3T53B 2E2IB 4IUPA 3NK9A 3C2PA 5I9PA 2R3ZA 1HUNA 3NHHA 1OXTA 5CGKA 1F2LA 3K5LA 1JWSD 1LTAD 5CV7A 1AW7A 4RGTA 3OMGA 4ME5A 3MFGA 3OOCA 2B63B 4H44C 4I65A 5C44B 4Q0FA 5A2QE 1BCPC 1JC7A 4QB4A 1EOTA 3SVMA 1GUNA 1SDFA 2F0OA 1PTOD 4N9TA 2BA0A 4BBSB 1EY7A 3V05A 5FOBB 2MGSA 4XYOA 3MWYW 5C3WA 2IL8A 5I9OA 2R7ZB 3NTIA 4Z9CB 2NN6G 4CKCA 4FNFA 5T1GA 1C48A 1HFNA 3RUZA 3EVQA 1GUTA 2PW5A 3IAYA 2XVSA 2F0MA 2R6GA 2XRQD 2CW0D 3E0JA 1ENCA 3JAME 1JE4A 2JYOA 1JWMD 3BS1A 1LT3D 5BN5A 3GTLB 3D4DA 1GUOA 1EQVA 5EBDA 2F0LA 1CA6A 2EY2A 4P2CB 4QMGA 1H9JA 2K01A 4RHRA 2LY7A 2A69D 3VYSA 3A7AB 3VYTA 2WIIB 3HEJA 1D5MC 3FVQA 3H3VC 1ONLA 1SNMA 4RGOS 3SK5A 2J7ZA 3H94A 2EVBA 4DA2A 3CQZB 1QILA 1IL8A 2E2JB 3AU7A 3MTSA 3H6MA 5A35A 2QF7A 1RHPA 3ZYYX 2Z4HA 3PUWA 2SNSA 2I07B 2NVXB 1STGA 1TWCB 2EPBA 1LTTD 4FXKC 2EOTA 3SDZA 3G7LA 2Z1CA 2C9OA 2KCNA 4EQOA 4QCLA 3SK6A 2QCPX 1CK1A 2F0DA 1RTOA 2B2WC 2MJ8A 1H9SA 1ZEQX 3J7AV 3S9WA 2EYPA 5C3EB 4RKBA 3UI2A 2ZXRA 1XTCD 2IX1A 2A74C 4IN3A 1SYBA 4DNTB 4B08A 5E4XA 2F0KA 2HUGA 2PCFB 4DF7A 4FF2A 1EWCA 4ZK9B 3FRPB 1WTQA 1BNZA 3PO3B 2A6EC 5NUCA 3KBXA 4HCSA 5FLXE 1E0BA 1J9OA 5CC4A 4KD4A 3GTQB 3WDNA 3OIQA 1A3TA 1DOKA 4ULLA 3T51B 4ZUIA 2KHSA 2EZVA 4I7ZC 3GTKB 1IW7D 1S5ED 4U68A 1OO9B 4HSVA 1KNAA 5G3LF 5EPJA 1E2VA 4OO1I 4QIWB 1NUCA 4YIJA 2BDOA 2NWGA 3OHXC 4ZQ3A 1SE4A 1EL0A 2VXWA 1Z6HA 2DNCA 2KOLA 1DM0B 2NB0A 2DY8A 1HQRD 3K57A 1MI2A 4A3MB 1RF2D 1F2ZA 1JORA 2WP8J 3QJYA 2B8GA 4FXDA 1F2YA 2L11A 1SE3A 1K83B 5C5MA 5LL6S 1FYCA 5BN4A 2WACA 2D9UA 1CFMA 3D4WA 1EEFD 2F3WA 1STYA 2QEJC 3KBGA 5CYUA 3BDCA 3HKZB 3MXGA 1WD0A 5HURA 2KCCA 5ELDA 1CHPD 3TMEA 3P20A 1ESRA 4MHEA 1B9MA 3MA2B 4FYDA 1HA5A 3NUCA 1GUGA 3R93A 3VR5A 1Q1BA 2AUJD 2WV6D 4KY5A 4QF4A 2DN8A 1STHA 2OF1A 4BS9A 3J81E 3A54A 2TSSA 4ZKBB 2KUMA 5C0XJ 5C4HA 1AZQA 2ZXOA 2QKIC 5AFWA 2RVLA 1V8QA 4F8MA 1W6KA 1OXXK 4WFN3 5IGBA 3L3OC 2MHVA 2LFNA 1AP0A 1Q1EA 3D6WA 3E5SA 3VR3A 5D65A 1C8CA 2Q8IB 2KECA 3T16A 2PPBC 3FDTA 1EZ8A 4FF4A 2QDBA 2RQXA 3NXWA 4K6LA 3S1NB 1EY4A 3MC0B 1Y8PB 1I4GA 2MPMA 2PQEA 5ELCA 2K5WA 4PQXA 1STNA 2MUYA 2E74C 4FF1A 4X3SA 4UDUC 1A2UA 1TWHB 1G6ZA 1TR5A 4F7XA 3GD7A 5BN3A 2CHBD 2K1BA 4ZUJA 4OO1H 1S5BD 3HS0C 3J80E 1IKLA 3Q24A 1DOLA 2O2LD 3EA6A 1PYWD 4O42A 2E2DC 2Q8TA 1A15A 2F0VA 1PFNA 3VR2A 3RZOB 2KJXA 3MVVA 2A6HD 1B9NA 3IKJA 1LABA 5JEAG 4CKBA 1HQMC 1CM9A 3OWFA 1W6JA 2A73B 5D14A 4JK1C 1PTOH 3VA5A 1H9SB 4EVOA 2C5CA 4AYBB 1R4PB 5CV6A 1DCZA 2Z4IA 4K2KA 1WTRA 3PUVA 4G7OC 4IURA 5EKLA 1BCPF 1CT1D 2ZT9C 2BE5D 3BYTB 3IFTA 2FFKB 3DMUA 5JAVA 2DY7A 3Q23A 1HTPA 1EIHA 1YNNC 2ENBA 2B2UA 4RA8A 4ZYSA 4FXGC 4DXFA 1I3QB 4A3DB 3BZDB 1PMRA 1TWGB 4LK1C 1I50B 1O7ZA 3V2TA 1XX8A 1YNJC 3MXPA 5D3DA 1NCVA 1SBBB 1HA6A 1KLUD 1O7YA 1STAA 3L7ZC 5FK9C 1STBA 1RJTA 5KNBA 2IWHA 3I3CA 2AWNA 4TSSA 3KF8A 1Y8OB 2F0QA 1QB5D 2EJGC 2B39A 4A93B 2LS01 3HRZC 5C4ZA 5J22A 2O5IC 1S5DD 1BCPB 1AZPA 3C46A 3NWSA 2L12A 1RTNA 1Y1VB 4NKLA 3NTHA 1ZYRD 4J6HA 4FVMA 3PO2B 4KD3A 1E2ZA 4LMQD 1TWFB 1SMYD 4A3BB 1WD1A 3EFXD 2AUKA 4C2MB 4IQZA 4HN7A 5IGFA 1FD7D 5J39A 2OEOA 4IFDI 1CQVA 3A8IE 2JA8B 1F9QA 1M8AA 3BDLA 3H09A 1R9TB 4KKTA 1ILPA 3HOXB 1EEID 2HCIA 1TKWB 5E1FA 2R92B 1EYDA 2TMPA 1HXYD 2PZUA 1FNWA 2K03A 2DNEA 2LKVA 2PMZB 2AWOA 1FGBD 1S5CD 2LMCB 1LTSD 1E2WA 5JPNC 1IYVA 5C4XB 3OIPA 1KAAA 1B50A 2HQEA 3EQLC 4XXEA 3IFDA 4PMCA 4CBVA 3KLSX 1SJHD 1CTMA 4GZYC 4QUFA 5CR3A 3BYYB 4DK0A 2JEAI 4KV6A 1QG7A 3TSSA 1EYAA 2FHTA 3A8KE 4KHVA 5CV8A 1BUVT 3X3MA 1H9KA 4K8JA 3MZ5A 1KDCA 2B2YA 2EXZA 4ZRZA 4XTCS 1D1KA 4DAVA 3ND8A 1BOSA 3SR1A 3NBIA 4OL7A 2A68D 4EGVA 2ID0A 2X69A 3I4NB 3ITPA 1PZJD 3HG9A 3T13A 1KABA 3BDOA 3I73A 5IT9L 5E3FA 3PMFA 1LT4D 3CRLC 1ILQA 4BWGB 1B44D 2RDHA 1R4QB 1Q12A 3I90A 2RA4A 4KN4C 5JVG3 2XSCA 2X6LA 1SJED 1FR3A 3QIAA 2JEBI 5DNFA 1LACA 1QWYA 3GTGB 5EBCA 5IGDA 2FJ2A 1PRTC 3MEHA 2H4OA 4NMZA 3TZDA 4KKUA 3RMHA 3D4RA 1ZXTA 3NQIA 1ENFA 2F3VA 4KY6A 2VUMB 3Q0AA 1WTVA 5K36H 4K5XA 4B9XA 1PTOF 5C5LA 5IIFA 2KVMA 1XYIA 3K59A 3A8JE 2PNRC 4DN4M 3A55A 5EJWA 3VR6A 1LTID 2D5DA 1F77A 3VR4A 3WOFA 4H0LC 4V190 3M7NA 5C0XG 1GOZA 3FPPA 4X3UA 5ELEA 1U4LA 4N9PA 1OXUA 1TQOA 2K5DA 1AEXA 2WAQB 3W2DA 5CV4A 1VDZA 1X32A 3AMUA 2B2VC 3OSOA 1G91A 1DONA 2PYKA 2FMMA 4EQPA 5EKKA 2J0TD 1BXTA 3CHBD 3K58A 2G9DA 5KGUA 2JA5B 2N88A 1KTKA 1A6XA 1QCBD 1B2TA 5KIXA 1EY6A 1D5XC 1F9PA 2VB2X 1XWEA 4HTHA 2B2TC 3PUZA 3M4OB 3EJIA 3DWPA 2FINB 1G8ZD 5TSSA 4J8QA 1MSGA 3URYA 3MAQA 1LTBD 2F0UA 4IUQA 2L0CA 1BQQT 2JSOA 4C3HG 4ZLTF 2G9HD 2NN6I 4ILWA 1B53A 5KRUA 5DM73 1U4MA 2XNAC 2B2UC 4Q5VA 3DEPA 4XQQA 4A3GB 4O1NA 1WTOA 4RGNA 2NVQB 1EIGA 4RCNA 1D6EC 4KK7A 2BDNA 4DU9A 1TU2B 2RSOA 1HTLD 1D5ZC 5DM63 2NTTA 1G2TA 1V1OA 4KI0A 3M4YA 1JICA 2IX0A 3NWTA 4B9WA 4EQNA 4M1UB 4ABNA 1QNUA 3EROA 2IX3A 2EYHA 4F87A 1DXMA 5KYLA 5I6WA 5LHY1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWE A;  1B3A A;  3DM1 A;  2HCI A;  2Q8R E;  2B2V A;  4IUU A;  1G6Z A;  5EKI A;  5JJZ A;  2EPB A;  5COR A;  1MSH A;  2FFK B;  2NZ1 D;  1F9R A;  2N88 A;  1EOT A;  1F9S A;  3SVM A;  1SDF A;  2EOT A;  3I90 A;  2RA4 A;  3G7L A;  2EE1 A;  1B2T A;  3N52 A;  4HED A;  2K03 A;  2MGS A;  1F9P A;  4XT3 B;  2DY7 A;  2L11 A;  2K1B A;  3MWY W;  2X6L A;  1TVX A;  2IL8 A;  2L1B A;  1O80 A;  2B2T C;  1EIH A;  1RTO A;  2B2W C;  2D9U A;  2FIN B;  2MJ8 A;  2MP1 A;  2KEE A;  4UAI A;  5DNF A;  1IKL A;  1G2S A;  4IUT A;  4R8I A;  2XIW A;  2B2T A;  3UI2 A;  1DZ1 A;  2L4N A;  2B2U A;  5T1G A;  1MSG A;  1DOL A;  4RA8 A;  1J8I A;  1U4P A;  1HFN A;  3H91 A;  3FPU B;  4O42 A;  1BF4 A;  1S4Z A;  2FJ2 A;  4XDX A;  1WD0 A;  1WTP A;  5E4X A;  4IUV A;  4IUQ A;  2CVR A;  1DOM A;  1SSO A;  2H1E A;  3TZD A;  1ML0 D;  1ESR A;  2HUG A;  4MHE A;  1O7Z A;  4ZLT F;  5EQ0 A;  2Q8T A;  1A15 A;  1XX8 A;  2NYZ D;  3I8Z A;  1PFN A;  3IL8 A;  1ZXT A;  5EPK A;  1HHV A;  2SDF A;  3R93 A;  2X6G A;  4XT1 B;  1B53 A;  3HP3 A;  4ZK9 B;  3GV6 A;  1NCV A;  1WVL A;  1WTQ A;  1BNZ A;  2FMM A;  1HA6 A;  1NAP A;  1U4M A;  1U4R A;  5EPL A;  1B50 A;  3GV3 A;  2B2U C;  2RSN A;  1JE4 A;  2JYO A;  1O7Y A;  3KBX A;  3IFD A;  1X3Q A;  4HAE A;  2K28 A;  1RJT A;  4HCS A;  5CMD A;  1WTW A;  1SAP A;  1E0B A;  1J9O A;  3DEP A;  1WTV A;  1B4O A;  4ZKB B;  2KUM A;  3ONA B;  2JP1 A;  2M2L A;  3KUP A;  3Q6S A;  1WTX A;  2N55 A;  3I3C A;  2HDL A;  1WTO A;  1AZQ A;  4QUF A;  1DOK A;  2KVM A;  1MGS A;  1PLF A;  5AFW A;  3DEO A;  2RVL A;  1XYI A;  1QG7 A;  1ICW A;  4MN3 A;  2K05 A;  1CA6 A;  1X3P A;  2B2W A;  5E4W C;  1CA5 A;  1EIG A;  5T1I A;  1HUM A;  4X3K A;  4CJ0 B;  2FHT A;  4NW2 A;  1AZP A;  1HRJ A;  1CM9 A;  4OIK A;  2HDM A;  4U68 A;  1EQT A;  2K01 A;  3F2U A;  4HSV A;  1HFG A;  2L12 A;  4R9W A;  1KNA A;  2BDN A;  1RTN A;  3QO2 A;  4DN4 M;  5D14 A;  5EJW A;  4ZAI A;  1PFB A;  1AP0 A;  4CJ1 B;  3D6W A;  4CJ2 C;  1PFM A;  1ROD A;  5EPJ A;  4IUP A;  2B2Y A;  5CBE E;  2RSO A;  1GUW A;  5D65 A;  4X3T A;  1C8C A;  1Q3L A;  3TN2 A;  1WTR A;  2KEC A;  4LMQ D;  3FDT A;  2R3Z A;  1QE6 A;  4X3U A;  2KED A;  1G2T A;  2NWG A;  4IUR A;  1HUN A;  1IKM A;  1WD1 A;  3P7J A;  1JIC A;  2K04 A;  5COY A;  2X69 A;  4ZKC B;  1BBX C;  1F2L A;  1EL0 A;  1VMC A;  2L9H A;  2VXW A;  1U4L A;  3I91 A;  2J7Z A;  2KOL A;  1PDQ A;  1IL8 A;  1DON A;  2DY8 A;  2MPM A;  1QNK A;  1LV9 A;  1BO0 A;  2B2Y C;  3MTS A;  5CBA E;  1X32 A;  1ILQ A;  4QUC A;  4RWS C;  4OIJ A;  1MI2 A;  4RAU C;  2HCC A;  1RHP A;  4X3S A;  1F9Q A;  1M8A A;  2B2V C;  1G91 A;  1KNE A;  1NR2 A;  1NR4 A;  1ILP A;  1VMP A; 
#chains in the Genus database with same CATH topology
 3CQZ H;  1PTO C;  3BZC A;  1L1O A;  1CSQ A;  2F0G A;  3J7Y W;  2RDG A;  5COR A;  4XQJ A;  1F9R A;  3AYH B;  2I46 A;  3K0X A;  1BCP D;  1HH2 P;  4N8F A;  2EY6 A;  3RD4 A;  1TWC H;  2HT1 A;  4RGM A;  3HOY G;  4UAI A;  1WCM G;  4DR5 Q;  1GM5 A;  1HNX Q;  3V96 A;  1WTP A;  3RLN A;  2EYO A;  3FP9 A;  3T4A C;  2GN5 A;  2CW0 C;  3W3A A;  4LFB Q;  5C3E H;  2PNH A;  2NYZ D;  4DXG A;  4DFA A;  4GNX B;  4RFB A;  3PIP 3;  2WKC A;  1T5X D;  2R93 G;  4LF5 L;  3QB3 A;  1BR9 A;  3RN5 A;  3SK4 A;  1B1Z A;  1II3 A;  1SAP A;  3CCU A;  1OXV A;  2K14 A;  1KHI A;  4OHJ A;  3NBH A;  3PO3 H;  4IJL A;  1PLF A;  2CQA A;  1ICW A;  4MN3 A;  2K05 A;  1JQY D;  4X3K A;  4K14 A;  2A69 C;  3GTQ H;  5EAY A;  1HFG A;  2VQF Q;  3QO2 A;  4G4K A;  2WAQ E;  2Z6K C;  4ZAI A;  5GQO A;  5J1Z A;  4NDX A;  1Q90 A;  3BG3 A;  1GUW A;  3HGB A;  1FL0 A;  1S5F D;  4C3H B;  3GTK H;  4DR7 L;  2BH2 A;  1SND A;  2ASB A;  1AFP A;  1L0Y B;  2RHQ B;  3S2H H;  2L9H A;  2OWO A;  4BY7 B;  1J6Q A;  2L5T A;  2EJF C;  1I4P A;  5M5Y H;  2E8G A;  3L0O A;  3PCO B;  3SGI A;  1PH6 A;  2HIX A;  1IXR A;  2B2Y C;  5IP9 H;  4R8N A;  3K5M A;  4RAU C;  3AB9 A;  2K33 A;  2AQ3 B;  1KNE A;  1NR4 A;  2E2H B;  3I4O A;  3GTJ H;  2B2V A;  1KIX A;  2OTL A;  2XN9 C;  2UUC L;  3PUX A;  4JI2 L;  5I2X A;  4R1J A;  4U67 3;  4A3M H;  5IOC A;  1RKN A;  2WB1 B;  1IZ6 A;  5GRO A;  5BR8 L;  1EY9 A;  1TVX A;  1U0L A;  1VQB A;  3GTO H;  2F0S A;  2L1B A;  3CD6 A;  1I4R A;  3S2D B;  1A62 A;  3GQB A;  1S72 A;  4G7Z C;  1S3O A;  2JA7 G;  1VF7 A;  4R8I A;  1G2S A;  1UNS A;  1EU4 A;  2XIW A;  2B2T A;  4A3E G;  3F2B A;  3H91 A;  5IGC A;  1OXS C;  3FPU B;  1PZK D;  1K83 H;  2IPK D;  4DAM A;  1VF5 C;  4X62 L;  4XQN A;  3CC7 A;  3RZD H;  1JWU D;  2NVT H;  3MXN A;  2EYF A;  3I8Z A;  2ALY B;  1TS2 A;  2SDF A;  4I7A A;  3NE5 B;  4XT1 B;  4PMB A;  4POG A;  4BBS G;  2QA4 A;  1NAP A;  1QZH A;  3FKI G;  2Q2T A;  4BXX G;  3DUZ A;  3OMC A;  1PZI D;  1SEB D;  2AQ1 B;  4X65 Q;  4A3I G;  3NP8 A;  1X3Q A;  1WTW A;  4CHT B;  4BY1 G;  1A0I A;  1QZG A;  4IFD J;  3KUP A;  2A6E D;  4QJF A;  4P71 A;  2FXQ A;  4LF8 L;  4JI3 L;  2BA1 A;  1QOH A;  3QWN A;  2EYM A;  4B3R Q;  1CA5 A;  4HSP A;  4WOR A;  4OX9 Q;  4NW2 A;  3L9A X;  2F0H A;  3HOY B;  1LTR D;  2F0F A;  4OIK A;  3HOV G;  1WCM B;  5FKA C;  4XYQ A;  1GUS A;  1JOO A;  4P72 A;  3J7A 5;  1XPU A;  1ET9 A;  2NUC A;  5C6A A;  4CGY B;  5E7N A;  2PW7 A;  1Z7T A;  4YWM A;  1HPC A;  4BA1 I;  3S17 H;  3E3X A;  4LUZ A;  3E9I A;  2GA4 B;  1PH2 A;  4Y7N B;  4A3F G;  2LXJ A;  1IYJ B;  2GVA A;  1SNC A;  1BBX C;  2RCN A;  3S1M B;  1VQG A;  2R93 B;  1LTG D;  5M3M H;  3GDE A;  2F0T A;  4HCE A;  3DHQ A;  1H9R A;  2EY1 A;  4YCV A;  1BO0 A;  1O78 A;  4OGQ C;  3CMA A;  4JI5 L;  4RWS C;  3NQT A;  3PUY A;  1GO3 E;  4OIJ A;  2UXB L;  1VQK A;  4K6D A;  4PZ6 A;  3CW2 C;  1WI5 A;  2VZA A;  3E0E A;  3S1N H;  4HR7 B;  4C3J G;  1JR0 D;  4JI4 Q;  4ODG A;  3DM1 A;  2B3G A;  1T5E A;  5JEA J;  1TWA B;  3CPW A;  1PRT F;  1LT6 D;  1KLG D;  1EYC A;  5I6Y A;  1H9M A;  3TBI B;  2F1M A;  3NTK A;  3BVZ A;  5FLM H;  1UUP A;  1N9W A;  4TVA B;  3OWE B;  3I56 A;  4IOA A;  3X3N A;  1WFQ A;  4IUT A;  4RKL A;  1DZ1 A;  2L4N A;  4LJZ C;  5CV9 A;  4JBK A;  3BVG A;  3W1B A;  3PIO A;  1ASZ A;  1WTH A;  1BF4 A;  1PYB A;  5KNC A;  3WWV A;  4HIO A;  1SYE A;  1CKM A;  4XDX A;  4IUV A;  1VQJ A;  1DOM A;  4UPA A;  4UHV A;  3SXH A;  4DNR B;  1P8L A;  3GV6 A;  3K6O A;  4EQ5 A;  4MTK A;  1XXG A;  2N8N A;  5EPL A;  5A2Q L;  1N34 Q;  4UP8 A;  1XNQ Q;  5KND A;  3RLF A;  1I94 Q;  5J3B A;  1MKH A;  2K28 A;  3M7G A;  1F2M A;  4R4I A;  5DAU A;  1L1O B;  3H0G H;  3GTM B;  1A2T A;  2M2L A;  2IT1 A;  5KYI A;  3QOJ A;  3RZO H;  3S1Q B;  4JYA Q;  1RL2 A;  1MGS A;  4GOP A;  1SR3 A;  1QVC A;  2CCZ A;  2JA7 B;  4LNQ A;  4OO1 G;  5ELB A;  3R2I A;  4A3E B;  5C3X A;  3BU2 A;  4C56 C;  4BBR H;  5C4J B;  4DUZ L;  5LL6 X;  2IHF A;  2EJM A;  4CJ2 C;  3R8B A;  2C35 B;  2KBN A;  2Z6K A;  3MHB A;  4JI8 Q;  1XPO A;  1PH4 A;  4KHZ A;  1I4Q A;  1A3V A;  4IUN A;  2XRS D;  2BCO A;  3C1F A;  4GKJ Q;  1CZW A;  5CV5 A;  4A3C G;  3JAM L;  1PRT B;  1IL2 A;  3FKI B;  5IOD A;  1STE A;  1TT2 A;  2EIF A;  2WB1 E;  5M5W B;  4A3I B;  2YU9 B;  4LFA Q;  5AJ3 L;  2AQ2 B;  5KEE A;  5CBA E;  4BY1 B;  3J7Z C;  1JJ2 A;  3S16 B;  3M3Y H;  3RLO A;  1Q86 C;  3OPO A;  1PFS A;  1UE7 A;  4IOC A;  1NR2 A;  1VQH A;  2F0N A;  3T56 B;  4RH6 A;  5JJZ A;  3JAM c;  2Q8R E;  4XIG S;  4IUU A;  3NBH B;  2ZJR A;  2K5Q A;  1XMO L;  3HOU G;  3NEL A;  3HOV B;  2LXK A;  1F9S A;  1FNV A;  2EYJ A;  1Z47 A;  1WJJ A;  2MNA A;  4JCV E;  1N33 Q;  3D6C A;  2F03 A;  3G6E A;  1PH8 A;  1VQD A;  3CF5 A;  1ENA A;  1MBY A;  4A3F B;  5FO7 B;  3TP5 A;  1J8I A;  5G3L D;  2R61 A;  3TP7 A;  1GJX A;  3J7A F;  4OX9 L;  2RDF A;  1KL9 A;  3VDY A;  1EWH A;  1HHV A;  1TY2 A;  3HP3 A;  4A3D H;  2A6H C;  1I6V C;  3TP8 A;  4C3J B;  3ND9 A;  4L5S A;  3K0Y A;  4LFC Q;  1TWG H;  2HHH Q;  5DEH A;  4YWL A;  2ZJQ A;  1HCZ A;  5IY0 A;  3OW7 A;  1FVI A;  2E76 C;  2VB3 X;  5IT9 E;  1JCK B;  2F0W A;  3GTP B;  1EWI A;  1KDB A;  3J81 j;  4NP5 A;  4K0K L;  2M9V A;  2EDG A;  4IFD H;  3PF5 A;  4NPS A;  3AFP A;  1ASY A;  1HRJ A;  1JB3 A;  3DWA A;  1EQT A;  3MFY A;  1VCI A;  5F2D A;  2JJQ A;  4LF7 L;  1PFB A;  4C3I G;  3CAM A;  1XNR Q;  3A7L A;  2KQ3 A;  1GD7 A;  4DV3 L;  4A3J G;  2EY5 A;  5JPM C;  3JC6 6;  3CCE A;  4IO9 A;  3R3O A;  3DWQ A;  4JC0 A;  3I4M G;  3P7J A;  4V0B A;  2K04 A;  5COY A;  4JI7 L;  3T1H L;  1J5E Q;  1I6H B;  2J4X A;  5LMN L;  3KLS A;  1EQR A;  1VMC A;  4R4Q A;  4UP7 A;  2BE5 C;  3I91 A;  3S15 B;  5FLX L;  4PMW A;  1PDQ A;  4IPC A;  4DR3 Q;  1KD1 C;  3PO2 H;  4A3K G;  2YYZ A;  4DK1 A;  5M5X B;  4DV6 Q;  3D31 A;  1TWF H;  4MIU A;  4OEM B;  2EYL A;  4A3B H;  3TP6 A;  4C2M H;  4KKS A;  3EN2 A;  3P1H A;  2JA6 H;  1B3A A;  3Q22 A;  4KMU C;  4A4I A;  4BA2 I;  5EKI A;  5FLX c;  2IY5 B;  3TZU A;  1L2F A;  1JOK A;  4DPG A;  4FO2 A;  1EY8 A;  5M3M G;  3ICE A;  1AN8 A;  2RHS B;  2NVY B;  3ERQ A;  1EYG A;  3CU7 A;  2JA8 H;  5K5P A;  5DLQ E;  5JEA H;  4X66 Q;  4XT3 B;  3BVM A;  3HOX H;  2SOB A;  1K8O A;  5I2Y A;  5M3F G;  1SXT A;  1X3E A;  4DV1 Q;  1IBM Q;  1A3U A;  2CH4 A;  1SNP A;  4LUV A;  4A75 A;  1YEZ A;  1Q46 A;  1C7Y A;  2F4I A;  3D3R A;  1DD2 A;  5M9O A;  5FJ8 G;  1G6P A;  1V1P A;  3K5O A;  1YNN D;  5HGT A;  3K7A B;  3NEM A;  1I4X A;  2PQA A;  3OYY A;  4H13 C;  2CVR A;  5FLM G;  4DR1 Q;  1HR0 L;  3KF8 B;  1GHJ A;  3U4Z A;  1SNQ A;  2K75 A;  5EQ0 A;  2SEB D;  4P73 A;  2XWB B;  4RCO A;  5EPK A;  4A3L H;  3O13 A;  1WVL A;  3VA7 A;  1EY5 A;  1LUZ A;  1VQ4 A;  4JI8 L;  5C44 H;  1YNJ D;  3GV3 A;  3S2H B;  1QUQ A;  2DGY A;  5M5Y B;  3SEB A;  3A74 A;  5EGT A;  5I4D A;  3HOU B;  1UEA B;  5CMD A;  4DAP A;  3H3V H;  3M9B A;  3ONA B;  5C4X H;  1YZ6 A;  2HDL A;  3GO5 A;  1KQS A;  4L5Q A;  4A76 A;  2BOS A;  3ULP A;  3CC2 A;  1PTO B;  4JI0 L;  4YWK A;  2Q2H A;  2VW9 A;  2N49 A;  1JOQ A;  1CUK A;  2WKD A;  1Y69 U;  5E4W C;  5T1I A;  4K2L A;  3GTJ B;  1HUM A;  4LF9 L;  4L63 B;  1P16 A;  1ZYR C;  3SHL A;  3S24 A;  3HOW G;  2PZW A;  1TXY A;  4GLA C;  1IYU A;  1RD9 D;  3I72 A;  1PFM A;  1ROD A;  3H0G G;  1SMY C;  4G7H C;  3HOZ G;  3IRB A;  1OTC A;  3GTO B;  4KTA A;  4R4T A;  1QE6 A;  2KED A;  4NXM Q;  3LX0 A;  1EFW A;  4B3S L;  2UUA L;  1VQE A;  4ZKC B;  2I5M X;  2F0E A;  3I2Z A;  1JJG A;  5JVH 3;  1G29 1;  4BBR G;  3J81 L;  4NB3 A;  1RIP A;  2ICE C;  1QNK A;  3K81 C;  2Y0S G;  3RZD B;  3KF6 A;  2NVT B;  1ESF A;  2HCC A;  3I4N H;  1K8M A;  3PIO 3;  5IGE A;  3DM3 A;  1DJR D;  3P75 A;  1KDA A;  1IBL L;  1PXU A;  3LNN A;  4GOP B;  1D1I A;  5FO8 B;  3STB D;  2F0P A;  4E6I A;  4MNO A;  1UEB A;  4PV1 C;  3NEN A;  4C3I B;  2L55 A;  4LFC L;  2HHH L;  3C3L A;  4A3J B;  3UDF A;  1EZ6 A;  2RBM A;  1U9R A;  5ISR A;  3G48 A;  1HNW L;  3ERS X;  3I4M B;  1TY0 A;  4K8I A;  1UAP A;  2K6A A;  1X56 A;  4J1M A;  1PHJ A;  2E2J H;  1NSN S;  1RCV D;  1CI3 M;  4A3K B;  1SSO A;  1PVO A;  2PZT A;  1ML0 D;  2H5X A;  1X9N A;  1BDO A;  1SYD A;  2K5H A;  3S17 B;  2ICI A;  2NVX H;  3QOL A;  1XNR L;  3NSW A;  3TS2 A;  4AQY L;  3DXJ C;  1EY0 A;  2RSN A;  4S3S A;  3PV0 A;  2AHO B;  1XJV A;  1N8R C;  1GXD C;  1SFO B;  5M3M B;  1K0S A;  1QJO A;  1X6O A;  5JOB A;  4CKE A;  4X6A H;  1EFI D;  2ZXP A;  5LMU Q;  2JP1 A;  3CME A;  1WTX A;  4KJO A;  3A56 A;  3E6Z X;  4DV0 L;  2PO4 A;  1SYC A;  5M3F B;  3HZX A;  2E75 C;  1IHZ A;  4APV A;  5GAG C;  3J80 L;  3UDI A;  3ER0 A;  2VUM H;  3M4Q A;  4CJ0 B;  5IYB G;  4R9W A;  2UU9 L;  2ATW A;  2O4X A;  4CJ1 B;  3FEW X;  4IAL A;  2A68 C;  4JVZ A;  5CBE E;  3CRK C;  4YY3 Q;  3CKI B;  3J80 c;  1Q3L A;  3TN2 A;  2K7V A;  4UP9 A;  4IFD G;  4GOP C;  2F4V Q;  2WIN B;  1MJE A;  4LWC A;  2QIL A;  1NMF A;  4HMI A;  4HJ8 A;  3QG1 A;  1CHQ D;  2D62 A;  5C0X I;  1LV9 A;  5IYC H;  1D2B A;  1Y1W G;  4QUC A;  1YHQ A;  5K36 G;  5D3I B;  3D8G A;  1TS4 A;  2B2W A;  1RDP D;  1VMP A;  1EQQ A;  1SRU A;  2VY3 A;  1LYL A;  2NN6 H;  4DR2 Q;  1MSH A;  3TDQ A;  1W3S A;  3HOW B;  1TII D;  4DGZ A;  2EE1 A;  3N52 A;  4HED A;  2JXM B;  4ID6 A;  1VQ5 A;  4WRD A;  3H0G B;  3HOZ B;  5HY6 A;  1PH9 A;  1UE5 A;  4H02 A;  2JA6 G;  2JA5 H;  2MP1 A;  2KEE A;  2CH4 W;  1L0X B;  3WOE A;  1LT5 D;  3CCR A;  1U4P A;  2FMC A;  1CQF A;  4PZ7 A;  1MIU A;  2JA8 G;  4BBR B;  4QIW E;  4KN7 C;  2OT2 A;  2H1E A;  1XMQ Q;  3E9H A;  4H7B A;  3SE0 A;  1YIJ A;  2Y0S B;  4HIM A;  3QR8 A;  1V43 A;  1PRT D;  4YCU A;  1LO5 D;  1SYG A;  4GKK Q;  2X6G A;  3LWU A;  2ZTE A;  3SK8 A;  3I70 A;  1U4R A;  3S14 B;  1LLR D;  3K5N A;  1KRS A;  4L8J A;  2JE6 I;  4HAE A;  3UDG A;  1ZKO A;  2A5H A;  4C1N K;  4RHS A;  1SNO A;  1B4O A;  5JJL A;  4FF3 A;  3Q6S A;  1DYQ A;  4PNY A;  4JBM A;  3M3Y B;  4Y52 H;  3DEO A;  1HJP A;  3U50 C;  2B63 G;  2K32 A;  3KLR A;  1X3P A;  1EU3 A;  1E7Z A;  3VYU A;  3OTO L;  5C44 G;  2NTS A;  3I7F A;  2IJ0 A;  4A3G H;  3F2U A;  1Q8I A;  3U9S A;  1JT8 A;  2M00 A;  1MD2 D;  2B8F A;  1GHK A;  2IW3 A;  4X3T A;  1V1P B;  2NVQ H;  1SE2 A;  5IGG A;  4HMJ A;  1CZG A;  4TQU S;  2R7Z G;  1IBK L;  1FJG Q;  2PQA B;  1PH3 A;  3HKZ E;  1Q82 C;  4LAA A;  1IKM A;  1X3G A;  1IW7 C;  2VNU D;  1C4Q A;  3C1E A;  2XWJ B;  2D2C C;  3U9O A;  2O5J C;  3DLL A;  1HZA A;  3MXU A;  4K5W A;  2RCF A;  3TQY A;  3I4L A;  3KK7 A;  5FO9 B;  2RKS A;  3VYR A;  4LF4 Q;  4F88 A;  3K80 C;  1FNU A;  3LWE A;  3M85 A;  2F0I A;  3FHW A;  1NBW A;  2NZ1 D;  1EIF A;  2OXP A;  2V4D A;  4L6T B;  4JBW A;  4KY7 A;  4G57 A;  5IYD G;  3I4N G;  1O80 A;  4DAY A;  3S1R B;  4DR5 L;  2NBF A;  2VQE Q;  1HNX L;  1M4V A;  3B6Y A;  2KA7 A;  4RG1 A;  3D0F A;  1S4Z A;  3N6R A;  2DJF C;  2SNM A;  4LFB L;  1O7L A;  2K52 A;  1TS3 A;  5C0X H;  4P74 A;  3FMC A;  1Y1W B;  3NPP A;  3IL8 A;  4FP5 D;  4KJN A;  1MJC A;  1TS5 A;  4CDD C;  5IWA Q;  2Q2I A;  4TKO B;  1TWH H;  3CPF A;  3G6J B;  1HNZ Q;  4YY3 L;  2F0J A;  3HFZ B;  4GN4 B;  1VQC A;  2K4K A;  4M8A A;  2Z8L A;  1PH5 A;  3R2T A;  1ET6 A;  4C1N I;  4K5V A;  4O2D A;  3KFU A;  3GP7 A;  4WJW A;  2N55 A;  1K0R A;  1Y8N B;  1I4H A;  4TRD A;  1YBY A;  3KLW A;  2JA6 B;  1C0A A;  4IZ8 A;  2VQF L;  1CKO A;  2HDM A;  5ELF A;  1SYF A;  3T53 B;  1XPR A;  2BH8 A;  2E2I B;  4IUP A;  3NK9 A;  4DR2 L;  2Z0S A;  3C2P A;  5GAD C;  4CDC C;  5I9P A;  2R3Z A;  1CKN A;  1HZB A;  4DR6 Q;  2ZTC A;  2E5L Q;  5C3E G;  1HUN A;  3NHH A;  1OXT A;  4DK6 C;  5CGK A;  1F2L A;  3K5L A;  1JWS D;  1VQ8 A;  1LTA D;  5CV7 A;  2OCE A;  1AW7 A;  4RGT A;  4DUY Q;  3OMG A;  4ME5 A;  4R4O A;  4BY7 H;  1LM0 A;  3MFG A;  5H1S E;  3OOC A;  3PO3 G;  2B63 B;  4H44 C;  4I65 A;  5C44 B;  4Q0F A;  1I5F A;  5A2Q E;  1BCP C;  1JC7 A;  4QB4 A;  1EOT A;  3SVM A;  4DV4 Q;  1GUN A;  1SDF A;  2F0O A;  1PTO D;  4N9T A;  2BA0 A;  4BBS B;  1EY7 A;  1KAW A;  3V05 A;  5FOB B;  2MGS A;  4XYO A;  3F2C A;  2Y0S E;  1AE2 A;  3CCL A;  3MWY W;  1V9P A;  5C3W A;  2IL8 A;  4OXP A;  5I9O A;  3M4P A;  2R7Z B;  3NTI A;  4OWT B;  4Z9C B;  2NN6 G;  1B3Q A;  4CKC A;  4FNF A;  5T1G A;  4R4C A;  1YJW A;  1C48 A;  1HFN A;  3RUZ A;  3EVQ A;  1WOC A;  1KRT A;  1GUT A;  2PW5 A;  3RNU A;  3IAY A;  2XVS A;  4ME3 A;  2F0M A;  2R6G A;  5IP9 G;  2XRQ D;  1T9H A;  2VL6 A;  2CW0 D;  4X65 L;  3E0J A;  1ENC A;  3JAM E;  1JE4 A;  2JYO A;  1JWM D;  3BS1 A;  1LT3 D;  4JV5 Q;  5BN5 A;  2PI2 A;  3GTL B;  2RF4 A;  4DV2 Q;  3D4D A;  1GUO A;  2LSS A;  1EQV A;  5EBD A;  2F0L A;  4A3M G;  2R7D A;  4B3R L;  1QVF A;  1CA6 A;  4DK3 C;  1A63 A;  2EY2 A;  4P2C B;  4QMG A;  1H9J A;  2K01 A;  1I3Q H;  4RHR A;  1HZC A;  2UUB Q;  2LY7 A;  4WJ3 M;  2A69 D;  3KJP A;  1I50 H;  3VYS A;  1BVS A;  3A7A B;  3ZJY C;  3VYT A;  1WCM H;  2WII B;  3HEJ A;  1D5M C;  3FVQ A;  1B8A A;  4PG3 A;  5IT9 c;  2KCM A;  3H3V C;  1ONL A;  1SNM A;  3AFQ A;  4RGO S;  3HKZ G;  3SK5 A;  2J7Z A;  3H94 A;  2EVB A;  4DA2 A;  2KCT A;  3CQZ B;  1QIL A;  1IL8 A;  2N3S A;  2E2J B;  4JI1 Q;  3MEF A;  2VQE L;  1UE6 A;  3AU7 A;  3MTS A;  2ZM6 Q;  1YIT A;  4Y7N H;  3H6M A;  5A35 A;  1N36 Q;  2QF7 A;  4JI4 L;  1RHP A;  3ZYY X;  2Z4H A;  4A93 H;  3PUW A;  3S1M H;  2SNS A;  2I07 B;  3ULL A;  2NVX B;  1STG A;  1TWC B;  2EPB A;  2QDL A;  2HQL A;  4YCW A;  1Y1V H;  2MQH A;  1LTT D;  4FXK C;  2EOT A;  3SDZ A;  3G7L A;  3MXN B;  2Z1C A;  2C9O A;  1HNZ L;  2KCN A;  4JG2 A;  4EQO A;  4QCL A;  2UXD Q;  3SK6 A;  2QCP X;  1K3B C;  1TWA H;  1CK1 A;  3A0J A;  2F0D A;  1RTO A;  2B2W C;  2MJ8 A;  1H9S A;  1Z9F A;  1ZEQ X;  3J7A V;  3S9W A;  2EYP A;  5C3E B;  4RKB A;  3UI2 A;  2ZXR A;  5GAE C;  1X54 A;  1XTC D;  2IX1 A;  2A74 C;  4IN3 A;  3F2D A;  1SYB A;  4DNT B;  1B7Y B;  4B08 A;  5E4X A;  2F0K A;  2HUG A;  2PCF B;  4DF7 A;  4FF2 A;  1EWC A;  2IHE A;  4B3M Q;  1R9T H;  1N34 L;  4ZK9 B;  3FRP B;  1XNQ L;  1WTQ A;  1YNX A;  5JJI A;  1BNZ A;  1I94 L;  3PO3 B;  2KEN A;  2A6E C;  2R92 H;  5NUC A;  2ZTD A;  2DJG C;  3KBX A;  4HCS A;  3JAM i;  5FLX E;  1E0B A;  1J9O A;  4LF5 Q;  4JYA L;  5CC4 A;  4KD4 A;  3GTQ B;  3WDN A;  1VQN A;  1JJC B;  3OIQ A;  1A3T A;  1DOK A;  4ULL A;  3T51 B;  4ZUI A;  4KHP Q;  2KHS A;  2EZV A;  4I7Z C;  4FDB A;  3GTK B;  1IW7 D;  1S5E D;  4U68 A;  4OWX B;  1OO9 B;  3H15 A;  4HSV A;  2R7F A;  1KNA A;  4DAY B;  5G3L F;  2PMZ E;  5EPJ A;  3TRZ A;  3Q8D A;  1E2V A;  2JA7 H;  4GKJ L;  4OO1 I;  4QIW B;  1NUC A;  4YIJ A;  2BDO A;  2NWG A;  2HIV A;  1D7Q A;  3OHX C;  4ZQ3 A;  4DR7 Q;  1SE4 A;  1EL0 A;  2VXW A;  4IJH A;  4LFA L;  1Z6H A;  2DNC A;  2KOL A;  1DM0 B;  2P5Z X;  4JI6 Q;  2NB0 A;  2DY8 A;  1HQR D;  3K57 A;  2KHI A;  3F8T A;  1MI2 A;  4A3M B;  1U5K A;  3FKI H;  1GVP A;  4BXX H;  1RF2 D;  4A3I H;  1M90 C;  4DNI A;  1F2Z A;  1JOR A;  3PSI A;  1X55 A;  3F1Z A;  2WP8 J;  3QJY A;  1KXL A;  1N33 L;  2B8G A;  2UUC Q;  4FXD A;  3TRE A;  4JI2 Q;  3UDX A;  1F2Y A;  2L11 A;  1SE3 A;  1K83 B;  4JW0 A;  5C5M A;  5LL6 S;  1FYC A;  5BR8 Q;  5BN4 A;  1BBU A;  2WAC A;  3HOV H;  2D9U A;  1CFM A;  3D4W A;  1EEF D;  1K8G A;  4GN3 B;  2F3W A;  1STY A;  2QEJ C;  3KBG A;  5CYU A;  2CFM A;  1HZ9 A;  2NZH A;  1CKN B;  3BDC A;  3HKZ B;  3MXG A;  5HUR A;  1WD0 A;  2KCC A;  2K5V A;  5ELD A;  1CHP D;  3TME A;  3P20 A;  1ESR A;  4MHE A;  4AYB G;  1B9M A;  1Y14 B;  4X62 Q;  1VQ7 A;  3MA2 B;  4A3F H;  2OQ0 A;  1LTL A;  4FYD A;  1HA5 A;  2MO1 A;  3NUC A;  1GUG A;  3R93 A;  3VR5 A;  1Q1B A;  2AUJ D;  2K50 A;  2WV6 D;  4KY5 A;  2K5N A;  4QF4 A;  2DN8 A;  1STH A;  2OF1 A;  4BS9 A;  3J81 E;  3A54 A;  2TSS A;  1KC8 C;  4ZKB B;  2KUM A;  5C0X J;  5C4H A;  1AZQ A;  4C3J H;  2ZXO A;  2QKI C;  5AFW A;  4POF A;  2RVL A;  2CWP A;  1V8Q A;  4F8M A;  1W6K A;  4LF8 Q;  1OXX K;  2ZM6 L;  3GTG H;  1QVG A;  4WFN 3;  5IGB A;  3L3O C;  4HID A;  3GTP H;  2MHV A;  2LFN A;  4B3T Q;  1AP0 A;  1Q1E A;  3D6W A;  3E5S A;  3VR3 A;  1JB7 A;  5D65 A;  2GVB A;  1C8C A;  2Q8I B;  1YVC A;  2KEC A;  3T16 A;  2PPB C;  3FDT A;  1EZ8 A;  4FF4 A;  1J5E L;  2QDB A;  1EIY B;  2RQX A;  3NXW A;  4K6L A;  4DR3 L;  2UXD L;  4A3D G;  1EY4 A;  3S1N B;  1Q81 C;  4DV6 L;  3MC0 B;  2F3I A;  1Y8P B;  1VQF A;  1I4G A;  1M1K C;  2MPM A;  2PQE A;  5ELC A;  2K5W A;  4PQX A;  1STN A;  2MUY A;  2Z9H A;  1W2B A;  2E74 C;  4FF1 A;  4X3S A;  1I6H H;  1ICF B;  4JI5 Q;  4UDU C;  2UXB Q;  3S15 H;  1A2U A;  4HIK A;  1BKB A;  1TWH B;  1G6Z A;  5M5X H;  4L5T A;  4B3M L;  4X66 L;  1TR5 A;  4F7X A;  3GD7 A;  2JK8 A;  5BN3 A;  1NMG A;  4DV1 L;  2CHB D;  2K1B A;  1IBM L;  3W5O A;  1K3R A;  4A93 G;  3KDF A;  3T1Y Q;  4ZUJ A;  4OO1 H;  1S5B D;  3HS0 C;  3J80 E;  1IKL A;  2NVY H;  5HGQ A;  2F52 A;  3Q24 A;  1DOL A;  2O2L D;  3EA6 A;  1PYW D;  4DR1 L;  1Y1V G;  5JJK A;  4O42 A;  4KHP L;  2E2D C;  3PO2 G;  4GLV B;  2YTX A;  2Q8T A;  1A15 A;  2F0V A;  4A3C H;  1PFN A;  3U4V A;  4P75 A;  4A3B G;  3VR2 A;  3RZO B;  3K7A H;  2KJX A;  3MVV A;  2D0O A;  4DKA C;  2A6H D;  1Q8K A;  5IP7 H;  2OQK A;  1B9N A;  3IKJ A;  4JBJ A;  2XGT A;  1AH9 A;  3J81 i;  1LAB A;  3HKS A;  5JEA G;  4JI6 L;  3M4O H;  4ZCK A;  3HOX G;  4RMF A;  4CKB A;  3HOU H;  1HQM C;  1CM9 A;  4EX5 A;  3OWF A;  1W6J A;  2R92 G;  2A73 B;  3PGZ A;  2JQO A;  1L0W A;  3KJO A;  3TS0 A;  5D14 A;  4JK1 C;  1PTO H;  1E24 A;  3VA5 A;  1H9S B;  4EVO A;  3UE0 A;  4DUZ Q;  2C5C A;  4AYB B;  1R4P B;  5CV6 A;  1DCZ A;  4NXM L;  2Z4I A;  4K2K A;  1WTR A;  1VQL A;  2AKW B;  3KOJ A;  3PUV A;  4G7O C;  4IUR A;  5EKL A;  1BCP F;  4IPH A;  4A3L G;  1DGS A;  4HJ7 A;  4GNX C;  1AE3 A;  4NXN Q;  3LGJ A;  1CT1 D;  2ZT9 C;  3TEH B;  4DR4 Q;  2BE5 D;  5AJ3 Q;  2UXC Q;  2CQO A;  5C4X G;  4DV5 Q;  3U58 A;  3BYT B;  3IFT A;  1SLJ A;  2A8V A;  2FFK B;  1VS0 A;  1NTG A;  1B70 B;  3DMU A;  1H95 A;  5JAV A;  1XMO Q;  1E3P A;  2DY7 A;  3CP0 A;  3Q23 A;  1HTP A;  1EIH A;  1YNN C;  1QUQ B;  2ENB A;  2B2U A;  1WYD A;  4RA8 A;  4ZYS A;  1K9M C;  3CCS A;  3J80 i;  4C3I H;  4FXG C;  4DXF A;  1I3Q B;  4A3D B;  3BZD B;  1PMR A;  4A3J H;  3RR5 A;  1TWG B;  4LK1 C;  1I50 B;  1O7Z A;  4CDE C;  3V2T A;  1XX8 A;  1YNJ C;  3MXP A;  5D3D A;  3I4M H;  4O0A A;  4B3T L;  1NCV A;  2CWA A;  1SBB B;  3PQI A;  3G71 A;  1HA6 A;  4QGU A;  4A3K H;  1KLU D;  1O7Y A;  1STA A;  3L7Z C;  5FK9 C;  5LMN W;  1STB A;  5LMU L;  1RJT A;  1VQA A;  4GS3 A;  5KNB A;  2G5D A;  2IWH A;  4HJ5 A;  3I3C A;  2AWN A;  3W1G A;  3A5U A;  4TSS A;  4HJ9 A;  3KF8 A;  1Y8O B;  2F0Q A;  1QB5 D;  2EJG C;  2B39 A;  4A93 B;  2LS0 1;  3HRZ C;  1V1Q A;  5C4Z A;  5J22 A;  2O5I C;  1S5D D;  1BCP B;  1SFO H;  4K0K Q;  1AZP A;  2Q2U A;  1SMX A;  3C46 A;  3NWS A;  1G51 A;  2L12 A;  1XTD A;  1RTN A;  4LW1 A;  1Y1V B;  3KF6 B;  4NKL A;  3NTH A;  5M3F H;  1PV4 A;  1ZYR D;  4IPD A;  4J6H A;  4LF7 Q;  4FVM A;  3PO2 B;  1JE5 A;  4KD3 A;  3CC4 A;  1E2Z A;  2F4V L;  2PI2 E;  4LMQ D;  4DV3 Q;  5FJ8 H;  1TWF B;  1SMY D;  1S40 A;  4A3B B;  1WD1 A;  2ES2 A;  2I5L X;  3EFX D;  2AUK A;  2NZO A;  4C2M B;  4IQZ A;  4HN7 A;  5IGF A;  3T1Y L;  4JI7 Q;  3T1H Q;  3EBE A;  5LMN Q;  1FD7 D;  5J39 A;  1GKH A;  2OEO A;  4GLX A;  4IFD I;  1PH7 A;  1CQV A;  5L37 A;  1HR0 W;  3A8I E;  2JA8 B;  2MFI A;  1F9Q A;  1M8A A;  2HD3 A;  3BDL A;  3H09 A;  1R9T B;  4KKT A;  1ILP A;  3HOX B;  1EEI D;  2HCI A;  1TKW B;  3STB C;  5E1F A;  4QY7 A;  1O7I A;  4L5R C;  2R92 B;  1EYD A;  2TMP A;  1VQP A;  2VUM G;  1NY4 A;  4CDF C;  1HXY D;  2PZU A;  1FNW A;  2K03 A;  2DNE A;  4GN5 A;  4OEL B;  2LKV A;  2PMZ B;  4C3H H;  3CCJ A;  1K73 C;  2AWO A;  1FGB D;  3HOW H;  4PZ8 A;  1S5C D;  2AMC B;  2LMC B;  3HOZ H;  3A5Z B;  1XMQ L;  1YJ9 A;  1LTS D;  1E2W A;  5JPN C;  2CKZ B;  4N8X 1;  4GKK L;  1HR0 Q;  4DV7 Q;  3AQQ A;  5IYC G;  1IYV A;  1CSP A;  2E2H H;  5C4X B;  3PF4 A;  3OIP A;  1KAA A;  4YHH Q;  1B50 A;  2HQE A;  3EQL C;  1A8V A;  4XXE A;  2WAQ G;  4LF6 Q;  3IFD A;  4PMC A;  4CBV A;  3KLS X;  1SJH D;  4JPB W;  4AYB E;  1VQ6 A;  1CTM A;  2JN4 A;  1N32 Q;  1PA6 A;  4GZY C;  4QUF A;  3S14 H;  5CR3 A;  3BYY B;  4DK0 A;  2JEA I;  3S2D H;  2WFW A;  4KV6 A;  1QG7 A;  4NXN L;  4KLK A;  4JI0 Q;  4DR4 L;  3TSS A;  1EYA A;  2FHT A;  3A8K E;  4KHV A;  4JOI C;  5CV8 A;  2JA5 G;  1BUV T;  2UXC L;  4HJA A;  3KDF B;  3X3M A;  1JMC A;  4LF9 Q;  4LUO A;  1H9K A;  3PIP A;  4K8J A;  5IP7 G;  3MZ5 A;  1KDC A;  4DV5 L;  2B2Y A;  2EXZ A;  4ZRZ A;  4XTC S;  4AH6 A;  1D1K A;  4DAV A;  1FJG L;  3ND8 A;  1BOS A;  3SR1 A;  3NBI A;  4OL7 A;  2A68 D;  2XTI A;  4EGV A;  2ID0 A;  3H3V I;  2X69 A;  3I4N B;  3ITP A;  3CCV A;  1PZJ D;  4B3S Q;  3HG9 A;  2UUA Q;  3T13 A;  1KAB A;  3BDO A;  3I73 A;  5ELO A;  5IT9 L;  5E3F A;  4GNX A;  1UE1 A;  4MTN A;  2EQS A;  3PMF A;  1LT4 D;  3CRL C;  1ILQ A;  5GAH C;  4LF4 L;  4BWG B;  1B44 D;  2RDH A;  1L1O C;  1UWV A;  1R4Q B;  4X64 Q;  1K8A C;  4QQB X;  3ULJ A;  4UY8 C;  2V1C C;  3HOY H;  1Q12 A;  1MHW C;  1E22 A;  1YJN A;  3I90 A;  2RA4 A;  3BZK A;  4KN4 C;  1IBL Q;  4A3G G;  5JVG 3;  1D8L A;  2XSC A;  2X6L A;  2Z6B A;  1SJE D;  1FR3 A;  5IYB H;  3QIA A;  1YHA A;  2JEB I;  3CCQ A;  5DNF A;  1LAC A;  2OTJ A;  1NJI C;  2B29 A;  1QWY A;  2L15 A;  3G4S A;  3GTG B;  5EBC A;  2VS1 A;  5IGD A;  4MZ9 A;  2R93 H;  1HNW Q;  2FJ2 A;  1PRT C;  3MEH A;  2H4O A;  4NMZ A;  3S1R H;  3TZD A;  2QW7 A;  4KKU A;  3RMH A;  3D4R A;  3OW2 A;  5IWA L;  1BBW A;  1PYS B;  1ZXT A;  3NQI A;  2I0Q A;  2YV5 A;  4J15 A;  1ENF A;  2F3V A;  4KY6 A;  4AQY Q;  1Y1W H;  2VUM B;  3Q0A A;  5IE8 A;  1VQO A;  1WTV A;  5K36 H;  2QGQ A;  4K5X A;  1PTO F;  4B9X A;  5C5L A;  5IIF A;  2KVM A;  1XYI A;  4DV0 Q;  1SE8 A;  3K59 A;  3BJU A;  2N78 A;  3A8J E;  2PNR C;  4DN4 M;  3A55 A;  4IPG A;  5EJW A;  3VR6 A;  4ALP A;  2UU9 Q;  1LTI D;  1X3F A;  2A19 A;  2D5D A;  1F77 A;  3VR4 A;  1PH1 A;  4OWW B;  3WOF A;  4DR6 L;  2E5L L;  4H0L C;  4V19 0;  3M7N A;  5C0X G;  1GOZ A;  3RN2 A;  3FPP A;  4X3U A;  5ELE A;  3CXC A;  3AEV A;  2E2I H;  2EXD A;  1Q7Y C;  1U4L A;  4N9P A;  1EOV A;  1OXU A;  1TQO A;  2K5D A;  2ZJP A;  1AEX A;  2WAQ B;  4DUY L;  3W2D A;  5CV4 A;  3GTM H;  2A1A A;  1VDZ A;  1X32 A;  3S1Q H;  3AMU A;  2B2V C;  3OSO A;  1G91 A;  1DON A;  2PYK A;  2FMM A;  4EQP A;  1EUJ A;  5EKK A;  2J0T D;  4A3E H;  4DV4 L;  1BXT A;  4WJ4 A;  3CHB D;  3K58 A;  2G9D A;  5KGU A;  4DV7 L;  2JA5 B;  2N88 A;  1KTK A;  3UE1 A;  5C4J H;  1QCB D;  1A6X A;  1B2T A;  5KIX A;  1EY6 A;  1D5X C;  1F9P A;  2VB2 X;  1NE3 A;  4YHH L;  2B63 H;  1SN8 A;  1XWE A;  4HTH A;  1YI2 A;  4LF6 L;  4OON A;  2B2T C;  3PUZ A;  3M4O B;  3EJI A;  3DWP A;  2FIN B;  1G8Z D;  5TSS A;  4J8Q A;  4BBS H;  1N32 L;  1MSG A;  3URY A;  3MAQ A;  1LTB D;  1VQ9 A;  2F0U A;  5M5W H;  2YU9 H;  3L2P A;  4IUQ A;  2L0C A;  2KHJ A;  2R7Z H;  4BY1 H;  3S16 H;  1BQQ T;  4AIM A;  2JSO A;  4C3H G;  4ZLT F;  2G9H D;  2NN6 I;  2QEX A;  4ILW A;  1B53 A;  5KRU A;  5DM7 3;  1U4M A;  2DUD A;  2XNA C;  4BY7 G;  4JV5 L;  5ELN A;  2B2U C;  2YTY A;  4DV2 L;  2JA9 A;  4Q5V A;  3DEP A;  4XQQ A;  4A3G B;  1FGU A;  1E1O A;  4O1N A;  1WTO A;  4RGN A;  2YTV A;  3I55 A;  2NVQ B;  1EIG A;  4QL5 A;  4RCN A;  3GTL H;  1D6E C;  2UUB L;  3OTO Q;  4KK7 A;  2BDN A;  5IYD H;  1NNX A;  2WB1 G;  4X64 L;  3KYH C;  4JOI A;  4DU9 A;  1TU2 B;  2RSO A;  1X65 A;  1HTL D;  1K28 A;  1D5Z C;  1E1T A;  5DM6 3;  3J81 c;  2NTT A;  1G2T A;  1YHB A;  1SRO A;  1V1O A;  4KI0 A;  1IBK Q;  2D0P A;  3M4Y A;  1JIC A;  2IX0 A;  3NWT A;  4JI1 L;  4B9W A;  4JI3 Q;  2MO0 A;  4EQN A;  1VQI A;  4M1U B;  4ABN A;  1N36 L;  1QNU A;  3ERO A;  2IX3 A;  2EYH A;  4F87 A;  1DXM A;  3K7U C;  5KYL A;  3CCM A;  1VQM A;  1C9O A;  5I6W A;  3EIV A;  5LHY 1;  2I5H A;  3K8A A; 
#chains in the Genus database with same CATH homology
 1PTO C;  2F0G A;  3J7Y W;  2RDG A;  5COR A;  4XQJ A;  1F9R A;  2I46 A;  1BCP D;  3RD4 A;  2EY6 A;  4RGM A;  4UAI A;  3V96 A;  1WTP A;  2EYO A;  3T4A C;  2CW0 C;  3W3A A;  2NYZ D;  4DXG A;  4DFA A;  4RFB A;  3PIP 3;  2WKC A;  1T5X D;  3QB3 A;  1BR9 A;  3SK4 A;  1B1Z A;  1II3 A;  1SAP A;  1OXV A;  4OHJ A;  3NBH A;  1PLF A;  2CQA A;  1ICW A;  4MN3 A;  2K05 A;  1JQY D;  4X3K A;  4K14 A;  2A69 C;  1HFG A;  3QO2 A;  4G4K A;  4ZAI A;  5J1Z A;  4NDX A;  1Q90 A;  3BG3 A;  1GUW A;  3HGB A;  1S5F D;  4C3H B;  1SND A;  1AFP A;  1L0Y B;  2L9H A;  4BY7 B;  2L5T A;  2EJF C;  1I4P A;  2B2Y C;  4R8N A;  3K5M A;  4RAU C;  3AB9 A;  2K33 A;  2AQ3 B;  1KNE A;  1NR4 A;  2E2H B;  2B2V A;  2XN9 C;  3PUX A;  5I2X A;  4U67 3;  5IOC A;  1RKN A;  2WB1 B;  1EY9 A;  1TVX A;  2F0S A;  2L1B A;  1I4R A;  3S2D B;  3GQB A;  4G7Z C;  1VF7 A;  4R8I A;  1G2S A;  1UNS A;  1EU4 A;  2XIW A;  2B2T A;  3H91 A;  5IGC A;  1OXS C;  3FPU B;  1PZK D;  2IPK D;  1VF5 C;  4XQN A;  1JWU D;  3MXN A;  2EYF A;  3I8Z A;  1TS2 A;  2SDF A;  3NE5 B;  4XT1 B;  4PMB A;  1NAP A;  3DUZ A;  3OMC A;  1PZI D;  1SEB D;  2AQ1 B;  3NP8 A;  1X3Q A;  1WTW A;  4CHT B;  4IFD J;  3KUP A;  2A6E D;  2BA1 A;  1QOH A;  3QWN A;  2EYM A;  1CA5 A;  4HSP A;  4WOR A;  4NW2 A;  3L9A X;  2F0H A;  3HOY B;  1LTR D;  2F0F A;  4OIK A;  1WCM B;  5FKA C;  4XYQ A;  1GUS A;  1JOO A;  1ET9 A;  2NUC A;  5C6A A;  4CGY B;  2PW7 A;  1Z7T A;  1HPC A;  4BA1 I;  2GA4 B;  4Y7N B;  1SNC A;  1BBX C;  3S1M B;  2R93 B;  1LTG D;  2F0T A;  4HCE A;  3DHQ A;  1H9R A;  2EY1 A;  1BO0 A;  1O78 A;  4OGQ C;  4RWS C;  3NQT A;  3PUY A;  4OIJ A;  4K6D A;  4HR7 B;  4C3J G;  1JR0 D;  4ODG A;  3DM1 A;  1T5E A;  5JEA J;  1TWA B;  1PRT F;  1LT6 D;  1KLG D;  1EYC A;  5I6Y A;  1H9M A;  3TBI B;  2F1M A;  3NTK A;  3BVZ A;  1UUP A;  3OWE B;  3X3N A;  4IUT A;  4RKL A;  1DZ1 A;  2L4N A;  4LJZ C;  5CV9 A;  3BVG A;  1BF4 A;  5KNC A;  1SYE A;  4XDX A;  4IUV A;  1DOM A;  3SXH A;  4DNR B;  3GV6 A;  3K6O A;  1XXG A;  5EPL A;  5A2Q L;  5KND A;  3RLF A;  2K28 A;  3M7G A;  1F2M A;  5DAU A;  3GTM B;  1A2T A;  2M2L A;  2IT1 A;  5KYI A;  3QOJ A;  3S1Q B;  1MGS A;  2JA7 B;  4OO1 G;  5ELB A;  3R2I A;  4A3E B;  5C3X A;  4C56 C;  5C4J B;  5LL6 X;  2EJM A;  4CJ2 C;  3R8B A;  3MHB A;  4KHZ A;  1I4Q A;  1A3V A;  4IUN A;  2XRS D;  2BCO A;  3C1F A;  1CZW A;  5CV5 A;  3JAM L;  1PRT B;  3FKI B;  5IOD A;  1STE A;  1TT2 A;  5M5W B;  4A3I B;  2YU9 B;  2AQ2 B;  5KEE A;  5CBA E;  4BY1 B;  3S16 B;  3OPO A;  1NR2 A;  2F0N A;  3T56 B;  5JJZ A;  4RH6 A;  2Q8R E;  4XIG S;  4IUU A;  2K5Q A;  3HOV B;  1F9S A;  1FNV A;  2EYJ A;  1Z47 A;  3D6C A;  2F03 A;  1ENA A;  1MBY A;  4A3F B;  5FO7 B;  3TP5 A;  1J8I A;  5G3L D;  2R61 A;  3TP7 A;  1GJX A;  3J7A F;  2RDF A;  1EWH A;  1HHV A;  1TY2 A;  3HP3 A;  2A6H C;  1I6V C;  3TP8 A;  4C3J B;  3ND9 A;  3K0Y A;  5DEH A;  1HCZ A;  3OW7 A;  2E76 C;  2VB3 X;  5IT9 E;  1JCK B;  2F0W A;  3GTP B;  1KDB A;  4NP5 A;  2M9V A;  2EDG A;  4IFD H;  1HRJ A;  1JB3 A;  3DWA A;  1EQT A;  3MFY A;  1VCI A;  5F2D A;  1PFB A;  4C3I G;  3A7L A;  2KQ3 A;  2EY5 A;  5JPM C;  3R3O A;  3DWQ A;  3P7J A;  4V0B A;  2K04 A;  5COY A;  1I6H B;  2J4X A;  3KLS A;  1VMC A;  2BE5 C;  3I91 A;  3S15 B;  5FLX L;  4PMW A;  1PDQ A;  2YYZ A;  4DK1 A;  5M5X B;  3D31 A;  4MIU A;  2EYL A;  3TP6 A;  4KKS A;  3P1H A;  1B3A A;  3Q22 A;  4KMU C;  4BA2 I;  5EKI A;  3TZU A;  1JOK A;  4FO2 A;  1EY8 A;  1AN8 A;  2NVY B;  3ERQ A;  3CU7 A;  5K5P A;  5JEA H;  4XT3 B;  3BVM A;  2SOB A;  1K8O A;  5I2Y A;  1SXT A;  1A3U A;  1SNP A;  2F4I A;  3D3R A;  1DD2 A;  5M9O A;  1V1P A;  3K5O A;  1YNN D;  5HGT A;  3K7A B;  1I4X A;  4H13 C;  2CVR A;  1GHJ A;  1SNQ A;  5EQ0 A;  2SEB D;  2XWB B;  4RCO A;  5EPK A;  3O13 A;  1WVL A;  3VA7 A;  1EY5 A;  1YNJ D;  3GV3 A;  3S2H B;  5M5Y B;  3SEB A;  5EGT A;  5I4D A;  3HOU B;  1UEA B;  5CMD A;  4DAP A;  3ONA B;  2HDL A;  3GO5 A;  2BOS A;  1PTO B;  1JOQ A;  2WKD A;  1Y69 U;  5E4W C;  5T1I A;  4K2L A;  3GTJ B;  1HUM A;  4L63 B;  1ZYR C;  3SHL A;  2PZW A;  1IYU A;  1RD9 D;  3I72 A;  1PFM A;  1ROD A;  1SMY C;  4G7H C;  3GTO B;  4KTA A;  1QE6 A;  2KED A;  3LX0 A;  4ZKC B;  2F0E A;  5JVH 3;  1G29 1;  3J81 L;  2ICE C;  1QNK A;  3RZD B;  2NVT B;  1ESF A;  2HCC A;  1K8M A;  3PIO 3;  5IGE A;  1DJR D;  3P75 A;  1KDA A;  1PXU A;  3LNN A;  1D1I A;  5FO8 B;  2F0P A;  4E6I A;  4PV1 C;  4C3I B;  2L55 A;  3C3L A;  4A3J B;  1EZ6 A;  2RBM A;  1U9R A;  5ISR A;  3I4M B;  1TY0 A;  4K8I A;  1UAP A;  2K6A A;  4J1M A;  1NSN S;  1RCV D;  1CI3 M;  4A3K B;  1SSO A;  2PZT A;  1ML0 D;  1BDO A;  1SYD A;  3S17 B;  2ICI A;  3QOL A;  3NSW A;  4S3S A;  1EY0 A;  2RSN A;  3DXJ C;  3PV0 A;  1GXD C;  1SFO B;  5M3M B;  1QJO A;  5JOB A;  4CKE A;  1EFI D;  2ZXP A;  2JP1 A;  1WTX A;  4KJO A;  3A56 A;  3E6Z X;  2PO4 A;  1SYC A;  5M3F B;  3HZX A;  2E75 C;  1IHZ A;  3J80 L;  4CJ0 B;  4R9W A;  2O4X A;  4CJ1 B;  3FEW X;  4IAL A;  2A68 C;  5CBE E;  3CRK C;  3CKI B;  1Q3L A;  3TN2 A;  2K7V A;  4IFD G;  2WIN B;  2QIL A;  4HMI A;  3QG1 A;  1CHQ D;  2D62 A;  5C0X I;  1LV9 A;  1D2B A;  4QUC A;  5K36 G;  5D3I B;  3D8G A;  1TS4 A;  2B2W A;  1RDP D;  1VMP A;  2NN6 H;  1MSH A;  3TDQ A;  3HOW B;  1TII D;  4DGZ A;  2EE1 A;  3N52 A;  4HED A;  2JXM B;  4ID6 A;  4WRD A;  3H0G B;  3HOZ B;  2MP1 A;  2KEE A;  1L0X B;  3WOE A;  1LT5 D;  1U4P A;  2FMC A;  1CQF A;  4BBR B;  4KN7 C;  2OT2 A;  2H1E A;  4H7B A;  3SE0 A;  2Y0S B;  1V43 A;  1PRT D;  1LO5 D;  1SYG A;  2X6G A;  3LWU A;  3SK8 A;  3I70 A;  1U4R A;  3S14 B;  1LLR D;  3K5N A;  4L8J A;  2JE6 I;  4HAE A;  1ZKO A;  2A5H A;  4C1N K;  4RHS A;  1SNO A;  1B4O A;  4FF3 A;  3Q6S A;  1DYQ A;  4PNY A;  3M3Y B;  3DEO A;  2K32 A;  3KLR A;  1X3P A;  1EU3 A;  3VYU A;  2NTS A;  2IJ0 A;  3F2U A;  1Q8I A;  3U9S A;  2M00 A;  1MD2 D;  2B8F A;  1GHK A;  2IW3 A;  4X3T A;  1V1P B;  1SE2 A;  5IGG A;  4HMJ A;  1CZG A;  4TQU S;  4LAA A;  1IKM A;  1IW7 C;  2VNU D;  1C4Q A;  3C1E A;  2XWJ B;  2D2C C;  3U9O A;  2O5J C;  3MXU A;  4K5W A;  3I4L A;  3KK7 A;  5FO9 B;  2RKS A;  3VYR A;  4F88 A;  1FNU A;  3LWE A;  3M85 A;  2F0I A;  2NZ1 D;  2OXP A;  2V4D A;  4L6T B;  4JBW A;  4KY7 A;  4G57 A;  1O80 A;  4DAY A;  3S1R B;  2NBF A;  1M4V A;  2KA7 A;  1S4Z A;  3N6R A;  2SNM A;  1O7L A;  1TS3 A;  5C0X H;  3FMC A;  1Y1W B;  3NPP A;  3IL8 A;  4FP5 D;  4KJN A;  1TS5 A;  4TKO B;  3G6J B;  2F0J A;  4M8A A;  2Z8L A;  3R2T A;  1ET6 A;  4C1N I;  4K5V A;  3GP7 A;  4WJW A;  2N55 A;  1Y8N B;  1I4H A;  4TRD A;  2JA6 B;  4IZ8 A;  2HDM A;  5ELF A;  1SYF A;  3T53 B;  2E2I B;  4IUP A;  3NK9 A;  3C2P A;  5I9P A;  2R3Z A;  1HUN A;  3NHH A;  1OXT A;  5CGK A;  1F2L A;  3K5L A;  1JWS D;  1LTA D;  5CV7 A;  1AW7 A;  4RGT A;  3OMG A;  4ME5 A;  3MFG A;  3OOC A;  2B63 B;  4H44 C;  4I65 A;  5C44 B;  4Q0F A;  5A2Q E;  1BCP C;  1JC7 A;  4QB4 A;  1EOT A;  3SVM A;  1GUN A;  1SDF A;  2F0O A;  1PTO D;  4N9T A;  2BA0 A;  4BBS B;  1EY7 A;  3V05 A;  5FOB B;  2MGS A;  4XYO A;  3MWY W;  5C3W A;  2IL8 A;  5I9O A;  2R7Z B;  3NTI A;  4Z9C B;  2NN6 G;  4CKC A;  4FNF A;  5T1G A;  1C48 A;  1HFN A;  3RUZ A;  3EVQ A;  1GUT A;  2PW5 A;  3IAY A;  2XVS A;  2F0M A;  2R6G A;  2XRQ D;  2CW0 D;  3E0J A;  1ENC A;  3JAM E;  1JE4 A;  2JYO A;  1JWM D;  3BS1 A;  1LT3 D;  5BN5 A;  3GTL B;  3D4D A;  1GUO A;  1EQV A;  5EBD A;  2F0L A;  1CA6 A;  2EY2 A;  4P2C B;  4QMG A;  1H9J A;  2K01 A;  4RHR A;  2LY7 A;  2A69 D;  3VYS A;  3A7A B;  3VYT A;  2WII B;  3HEJ A;  1D5M C;  3FVQ A;  3H3V C;  1ONL A;  1SNM A;  4RGO S;  3SK5 A;  2J7Z A;  3H94 A;  2EVB A;  4DA2 A;  3CQZ B;  1QIL A;  1IL8 A;  2E2J B;  3AU7 A;  3MTS A;  3H6M A;  5A35 A;  2QF7 A;  1RHP A;  3ZYY X;  2Z4H A;  3PUW A;  2SNS A;  2I07 B;  2NVX B;  1STG A;  1TWC B;  2EPB A;  1LTT D;  4FXK C;  2EOT A;  3SDZ A;  3G7L A;  2Z1C A;  2C9O A;  2KCN A;  4EQO A;  4QCL A;  3SK6 A;  2QCP X;  1CK1 A;  2F0D A;  1RTO A;  2B2W C;  2MJ8 A;  1H9S A;  1ZEQ X;  3J7A V;  3S9W A;  2EYP A;  5C3E B;  4RKB A;  3UI2 A;  2ZXR A;  1XTC D;  2IX1 A;  2A74 C;  4IN3 A;  1SYB A;  4DNT B;  4B08 A;  5E4X A;  2F0K A;  2HUG A;  2PCF B;  4DF7 A;  4FF2 A;  1EWC A;  4ZK9 B;  3FRP B;  1WTQ A;  1BNZ A;  3PO3 B;  2A6E C;  5NUC A;  3KBX A;  4HCS A;  5FLX E;  1E0B A;  1J9O A;  5CC4 A;  4KD4 A;  3GTQ B;  3WDN A;  3OIQ A;  1A3T A;  1DOK A;  4ULL A;  3T51 B;  4ZUI A;  2KHS A;  2EZV A;  4I7Z C;  3GTK B;  1IW7 D;  1S5E D;  4U68 A;  1OO9 B;  4HSV A;  1KNA A;  5G3L F;  5EPJ A;  1E2V A;  4OO1 I;  4QIW B;  1NUC A;  4YIJ A;  2BDO A;  2NWG A;  3OHX C;  4ZQ3 A;  1SE4 A;  1EL0 A;  2VXW A;  1Z6H A;  2DNC A;  2KOL A;  1DM0 B;  2NB0 A;  2DY8 A;  1HQR D;  3K57 A;  1MI2 A;  4A3M B;  1RF2 D;  1F2Z A;  1JOR A;  2WP8 J;  3QJY A;  2B8G A;  4FXD A;  1F2Y A;  2L11 A;  1SE3 A;  1K83 B;  5C5M A;  5LL6 S;  1FYC A;  5BN4 A;  2WAC A;  2D9U A;  1CFM A;  3D4W A;  1EEF D;  2F3W A;  1STY A;  2QEJ C;  3KBG A;  5CYU A;  3BDC A;  3HKZ B;  3MXG A;  1WD0 A;  5HUR A;  2KCC A;  5ELD A;  1CHP D;  3TME A;  3P20 A;  1ESR A;  4MHE A;  1B9M A;  3MA2 B;  4FYD A;  1HA5 A;  3NUC A;  1GUG A;  3R93 A;  3VR5 A;  1Q1B A;  2AUJ D;  2WV6 D;  4KY5 A;  4QF4 A;  2DN8 A;  1STH A;  2OF1 A;  4BS9 A;  3J81 E;  3A54 A;  2TSS A;  4ZKB B;  2KUM A;  5C0X J;  5C4H A;  1AZQ A;  2ZXO A;  2QKI C;  5AFW A;  2RVL A;  1V8Q A;  4F8M A;  1W6K A;  1OXX K;  4WFN 3;  5IGB A;  3L3O C;  2MHV A;  2LFN A;  1AP0 A;  1Q1E A;  3D6W A;  3E5S A;  3VR3 A;  5D65 A;  1C8C A;  2Q8I B;  2KEC A;  3T16 A;  2PPB C;  3FDT A;  1EZ8 A;  4FF4 A;  2QDB A;  2RQX A;  3NXW A;  4K6L A;  3S1N B;  1EY4 A;  3MC0 B;  1Y8P B;  1I4G A;  2MPM A;  2PQE A;  5ELC A;  2K5W A;  4PQX A;  1STN A;  2MUY A;  2E74 C;  4FF1 A;  4X3S A;  4UDU C;  1A2U A;  1TWH B;  1G6Z A;  1TR5 A;  4F7X A;  3GD7 A;  5BN3 A;  2CHB D;  2K1B A;  4ZUJ A;  4OO1 H;  1S5B D;  3HS0 C;  3J80 E;  1IKL A;  3Q24 A;  1DOL A;  2O2L D;  3EA6 A;  1PYW D;  4O42 A;  2E2D C;  2Q8T A;  1A15 A;  2F0V A;  1PFN A;  3VR2 A;  3RZO B;  2KJX A;  3MVV A;  2A6H D;  1B9N A;  3IKJ A;  1LAB A;  5JEA G;  4CKB A;  1HQM C;  1CM9 A;  3OWF A;  1W6J A;  2A73 B;  5D14 A;  4JK1 C;  1PTO H;  3VA5 A;  1H9S B;  4EVO A;  2C5C A;  4AYB B;  1R4P B;  5CV6 A;  1DCZ A;  2Z4I A;  4K2K A;  1WTR A;  3PUV A;  4G7O C;  4IUR A;  5EKL A;  1BCP F;  1CT1 D;  2ZT9 C;  2BE5 D;  3BYT B;  3IFT A;  2FFK B;  3DMU A;  5JAV A;  2DY7 A;  3Q23 A;  1HTP A;  1EIH A;  1YNN C;  2ENB A;  2B2U A;  4RA8 A;  4ZYS A;  4FXG C;  4DXF A;  1I3Q B;  4A3D B;  3BZD B;  1PMR A;  1TWG B;  4LK1 C;  1I50 B;  1O7Z A;  3V2T A;  1XX8 A;  1YNJ C;  3MXP A;  5D3D A;  1NCV A;  1SBB B;  1HA6 A;  1KLU D;  1O7Y A;  1STA A;  3L7Z C;  5FK9 C;  1STB A;  1RJT A;  5KNB A;  2IWH A;  3I3C A;  2AWN A;  4TSS A;  3KF8 A;  1Y8O B;  2F0Q A;  1QB5 D;  2EJG C;  2B39 A;  4A93 B;  2LS0 1;  3HRZ C;  5C4Z A;  5J22 A;  2O5I C;  1S5D D;  1BCP B;  1AZP A;  3C46 A;  3NWS A;  2L12 A;  1RTN A;  1Y1V B;  4NKL A;  3NTH A;  1ZYR D;  4J6H A;  4FVM A;  3PO2 B;  4KD3 A;  1E2Z A;  4LMQ D;  1TWF B;  1SMY D;  4A3B B;  1WD1 A;  3EFX D;  2AUK A;  4C2M B;  4IQZ A;  4HN7 A;  5IGF A;  1FD7 D;  5J39 A;  2OEO A;  4IFD I;  1CQV A;  3A8I E;  2JA8 B;  1F9Q A;  1M8A A;  3BDL A;  3H09 A;  1R9T B;  4KKT A;  1ILP A;  3HOX B;  1EEI D;  2HCI A;  1TKW B;  5E1F A;  2R92 B;  1EYD A;  2TMP A;  1HXY D;  2PZU A;  1FNW A;  2K03 A;  2DNE A;  2LKV A;  2PMZ B;  2AWO A;  1FGB D;  1S5C D;  2LMC B;  1LTS D;  1E2W A;  5JPN C;  1IYV A;  5C4X B;  3OIP A;  1KAA A;  1B50 A;  2HQE A;  3EQL C;  4XXE A;  3IFD A;  4PMC A;  4CBV A;  3KLS X;  1SJH D;  1CTM A;  4GZY C;  4QUF A;  5CR3 A;  3BYY B;  4DK0 A;  2JEA I;  4KV6 A;  1QG7 A;  3TSS A;  1EYA A;  2FHT A;  3A8K E;  4KHV A;  5CV8 A;  1BUV T;  3X3M A;  1H9K A;  4K8J A;  3MZ5 A;  1KDC A;  2B2Y A;  2EXZ A;  4ZRZ A;  4XTC S;  1D1K A;  4DAV A;  3ND8 A;  1BOS A;  3SR1 A;  3NBI A;  4OL7 A;  2A68 D;  4EGV A;  2ID0 A;  2X69 A;  3I4N B;  3ITP A;  1PZJ D;  3HG9 A;  3T13 A;  1KAB A;  3BDO A;  3I73 A;  5IT9 L;  5E3F A;  3PMF A;  1LT4 D;  3CRL C;  1ILQ A;  4BWG B;  1B44 D;  2RDH A;  1R4Q B;  1Q12 A;  3I90 A;  2RA4 A;  4KN4 C;  5JVG 3;  2XSC A;  2X6L A;  1SJE D;  1FR3 A;  3QIA A;  2JEB I;  5DNF A;  1LAC A;  1QWY A;  3GTG B;  5EBC A;  5IGD A;  2FJ2 A;  1PRT C;  3MEH A;  2H4O A;  4NMZ A;  3TZD A;  4KKU A;  3RMH A;  3D4R A;  1ZXT A;  3NQI A;  1ENF A;  2F3V A;  4KY6 A;  2VUM B;  3Q0A A;  1WTV A;  5K36 H;  4K5X A;  4B9X A;  1PTO F;  5C5L A;  5IIF A;  2KVM A;  1XYI A;  3K59 A;  3A8J E;  2PNR C;  4DN4 M;  3A55 A;  5EJW A;  3VR6 A;  1LTI D;  2D5D A;  1F77 A;  3VR4 A;  3WOF A;  4H0L C;  4V19 0;  3M7N A;  5C0X G;  1GOZ A;  3FPP A;  4X3U A;  5ELE A;  1U4L A;  4N9P A;  1OXU A;  1TQO A;  2K5D A;  1AEX A;  2WAQ B;  3W2D A;  5CV4 A;  1VDZ A;  1X32 A;  3AMU A;  2B2V C;  3OSO A;  1G91 A;  1DON A;  2PYK A;  2FMM A;  4EQP A;  5EKK A;  2J0T D;  1BXT A;  3CHB D;  3K58 A;  2G9D A;  5KGU A;  2JA5 B;  2N88 A;  1KTK A;  1A6X A;  1QCB D;  1B2T A;  5KIX A;  1EY6 A;  1D5X C;  1F9P A;  2VB2 X;  1XWE A;  4HTH A;  2B2T C;  3PUZ A;  3M4O B;  3EJI A;  3DWP A;  2FIN B;  1G8Z D;  5TSS A;  4J8Q A;  1MSG A;  3URY A;  3MAQ A;  1LTB D;  2F0U A;  4IUQ A;  2L0C A;  1BQQ T;  2JSO A;  4C3H G;  4ZLT F;  2G9H D;  2NN6 I;  4ILW A;  1B53 A;  5KRU A;  5DM7 3;  1U4M A;  2XNA C;  2B2U C;  4Q5V A;  3DEP A;  4XQQ A;  4A3G B;  4O1N A;  1WTO A;  4RGN A;  2NVQ B;  1EIG A;  4RCN A;  1D6E C;  4KK7 A;  2BDN A;  4DU9 A;  1TU2 B;  2RSO A;  1HTL D;  1D5Z C;  5DM6 3;  2NTT A;  1G2T A;  1V1O A;  4KI0 A;  3M4Y A;  1JIC A;  2IX0 A;  3NWT A;  4B9W A;  4EQN A;  4M1U B;  4ABN A;  1QNU A;  3ERO A;  2IX3 A;  2EYH A;  4F87 A;  1DXM A;  5KYL A;  5I6W A;  5LHY 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...