1X32A

Three dimensional solution structure of the chromo1 domain of cpsrp43
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
47
structure length
47
Chain Sequence
b'GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chloroplast signal recognition particle component
publication title Three-dimensional solution structures of the chromodomains of cpSRP43
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 2
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2005-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x32A00
2Q8RE 1PDQA 2X6GA 1ESRA 1SSOA 1U4PA 1O7ZA 2B2YA 2RSOA 4HCSA 4MN3A 5EPLA 1ILPA 4X3UA 2FFKB 3TZDA 3Q6SA 1RTNA 3I3CA 1XX8A 4OIKA 4XDXA 4DN4M 1MSGA 1F9RA 3MWYW 2HDLA 1MSHA 2X69A 3IFDA 3H91A 1TVXA 4IUPA 1F9QA 1X3PA 2SDFA 4X3KA 4QUFA 2RVLA 3SVMA 1B4OA 4HEDA 1O80A 2FINB 1DOLA 4X3SA 4ZAIA 5CBEE 4CJ0B 2FHTA 4RAUC 1WVLA 2X6LA 2H1EA 3GV3A 1DZ1A 2K03A 1PFNA 4HSVA 2B2TA 2B2WC 2K28A 3N52A 1WTQA 2IL8A 2B2VA 1EIGA 3GV6A 1G2SA 4LMQD 1LV9A 1VMPA 1DONA 1HFNA 1HUNA 1HRJA 1F2LA 4IUVA 2B2UC 1PFBA 4ZLTF 2VXWA 1EIHA 2RA4A 3I91A 4X3TA 2L11A 1RHPA 1CA5A 1WTRA 2RSNA 3QO2A 4XT1B 4R8IA 1G91A 2L9HA 1AZPA 2KUMA 2R3ZA 2KECA 1BO0A 1RJTA 2NWGA 3F2UA 2XIWA 3UI2A 2DY8A 2MGSA 1DOKA 1C8CA 1JICA 4RWSC 4R9WA 2EOTA 3IL8A 5COYA 1RTOA 1X32A 5E4WC 5T1GA 4CJ2C 3LWEA 4QUCA 1IKLA 2B2WA 4MHEA 4XT3B 2NYZD 3D6WA 1X3QA 1IL8A 4ZKBB 4CJ1B 4NW2A 2B2UA 1BBXC 3DEOA 2N88A 1M8AA 5CMDA 1B3AA 1DOMA 1WTPA 3TN2A 5JJZA 1WD1A 1VMCA 4ZK9B 3P7JA 2JYOA 2MJ8A 1WTXA 1SDFA 1CM9A 3HP3A 2HUGA 5AFWA 2FJ2A 1QNKA 1MI2A 1ZXTA 2FMMA 5EJWA 1U4LA 3KBXA 1EOTA 2KEDA 3MTSA 1ILQA 5EQ0A 1RODA 1MGSA 2CVRA 2KOLA 3G7LA 5EPJA 2KEEA 1NAPA 1NCVA 1QG7A 1U4MA 3DM1A 5EPKA 1WTVA 1IKMA 1XYIA 4UAIA 5EKIA 1SAPA 5E4XA 1QE6A 3R93A 4U68A 1KNAA 4ZKCB 1ICWA 2EE1A 1CA6A 1NR2A 1PLFA 3FPUB 2HCCA 4IUQA 1HUMA 2Q8TA 1B50A 1HA6A 1B2TA 2DY7A 1U4RA 3ONAB 1WD0A 2L4NA 2M2LA 1B53A 1S4ZA 2K04A 4HAEA 4OIJA 2L1BA 2B2YC 2N55A 5D14A 1G2TA 2HDMA 4IURA 2EPBA 1AP0A 1F9SA 5CBAE 1J8IA 1Q3LA 1F9PA 2MP1A 3KUPA 1BNZA 1AZQA 1EL0A 2K05A 2KVMA 4IUUA 4RA8A 5CORA 2JP1A 2K01A 3DEPA 1KNEA 5DNFA 2MPMA 5D65A 1GUWA 1O7YA 2L12A 3FDTA 1HFGA 1JE4A 1A15A 2BDNA 2HCIA 1WTWA 3I90A 1BF4A 2D9UA 1G6ZA 2K1BA 2NZ1D 4IUTA 1PFMA 1J9OA 3I8ZA 4O42A 2B2TC 5T1IA 1WTOA 2B2VC 2J7ZA 1E0BA 1EQTA 1NR4A 1HHVA 1ML0D
chains in the Genus database with same CATH superfamily
1EY4A 4I65A 3ULPA 4UPAA 2K5VA 2Q2UA 3GD7A 3D31A 1KXLA 1XX8A 3AYHB 2PI2A 2JA6H 4X3KA 1Q8IA 1H9JA 1B4OA 2WACA 3QOLA 1KAAA 4DAYB 5IWAL 1WVLA 2FMCA 2K03A 2VW9A 1BBUA 3JAMi 4B3TL 1G6ZA 4OHJA 1ENCA 4FXKC 3SDZA 1EIGA 1B3QA 5C5LA 4ME5A 2PQAA 1VQ9A 1PFBA 5C4JH 4NXML 1F2YA 1BKBA 5C3EH 4A93H 4DNRB 1PZKD 4K6DA 4XT1B 1U9RA 2R7DA 2HIVA 3K0XA 3CC7A 1DCZA 5ELEA 2CKZB 4KJNA 3GO5A 4V0BA 3T1HL 1STGA 1A3VA 3BYYB 4PQXA 4A3LG 4C3JG 1Q12A 3D3RA 4O1NA 5T1GA 1CFMA 5IT9L 3RZDB 3JAMc 4IZ8A 1LTID 3TREA 4JOIA 2NVQH 1VQ8A 3NTIA 4KD4A 1M8AA 3RR5A 5JJZA 1FL0A 1FYCA 2Z6KA 1PH1A 2VQFL 2JA6B 2JA7G 5M5XH 5C0XJ 5NUCA 5FLXL 4C1NI 3I4NH 3I4MH 4DV7L 2ATWA 1SMYD 3NP8A 1X9NA 3KLRA 1ILQA 4HTHA 3D6CA 3L2PA 5CR3A 1A3UA 2RDFA 4YCWA 3OOCA 3C1FA 5C4JB 5J22A 3S2DH 1CA6A 3KJOA 5C3EB 3H3VI 3J7A5 1VQ5A 4A93B 1B2TA 3TEHB 2F0OA 3OIQA 1RF2D 1JOQA 1F77A 1SNPA 4IURA 1UNSA 2EPBA 3F8TA 3VYRA 3IKJA 3KUPA 2CWAA 1OXXK 4ZUIA 4ILWA 4HIDA 1PH6A 3VA5A 4IALA 1K8MA 4DV5Q 4A3CG 4DNTB 1VCIA 1JWMD 1SR3A 2CWPA 3M7GA 3NXWA 2F52A 2LMCB 1TWCH 2NVQB 5T1IA 3TRZA 1TXYA 2OF1A 1E0BA 3LGJA 1AE3A 4LF4L 2EZVA 5EAYA 4BY7G 3NPPA 1DYQA 2XNAC 2AUKA 2ASBA 5M5XB 4B9XA 3I4MB 1G6PA 3I4NB 1CSPA 1MSGA 2UUAL 3CCSA 1E1TA 4FDBA 3S9WA 5BR8Q 1Q86C 3MHBA 3G6EA 1DD2A 4DUZQ 1PTOF 1SMYC 2LSSA 2X6LA 3GV3A 2Z9HA 3WOFA 4HSVA 2F0HA 3L3OC 1WTQA 5CV9A 3S2DB 1WCMH 3Q0AA 1UEAB 1Q46A 4H13C 4OWXB 3MFGA 2NZHA 5ELCA 3KDFA 3OMGA 2EVBA 4OWWB 1SRUA 2P5ZX 2VB3X 4GN3B 3MXPA 1PH2A 2XIWA 4R4IA 3UDIA 3SXHA 5IYDH 1OO9B 1GXDC 1VQNA 1MJCA 4NB3A 4ME3A 1TWCB 3GTMH 4CJ2C 4DV6L 2WFWA 3S14H 1CHQD 3FKIG 3K5NA 5C4XG 2E75C 2Y0SB 3D6WA 2A6HD 2JA8H 4A4IA 2RBMA 3DEOA 1YI2A 4LF7L 2EQSA 5CMDA 2NN6H 1DOMA 1X56A 2WINB 1EYCA 2NB0A 5IGDA 2VUMG 4QB4A 2BA1A 3R8BA 3NQIA 1EQQA 5EKKA 4YY3Q 4HIMA 3DM1A 5FO9B 1WCMB 4R4OA 4A3JG 4K2LA 5GROA 1PRTB 3NHHA 3A5ZB 4DXFA 4XXEA 1KABA 2EJFC 4C56C 5LL6X 1OXTA 1LO5D 1S5BD 3H0GH 1KC8C 3MFYA 4BXXG 2LKVA 3HOXH 3GTMB 1Z9FA 3NUCA 3S14B 3S1QH 1PYWD 2WKCA 1L1OA 3CD6A 3UDFA 1JJ2A 4O42A 2JA8B 4DAMA 3A0JA 4X6AH 3V05A 2YTYA 1FJGL 1VQCA 2A6HC 5BN3A 3RLNA 1VF7A 2Z6BA 4FF4A 2A8VA 4RHSA 4JPBW 2FFKB 1JOOA 3HKZB 1EFWA 4IPHA 1MSHA 3IFDA 3V2TA 2EXZA 2SDFA 3D4DA 4DF7A 3FPPA 2QILA 4A3IG 2FHTA 4RAUC 4C3IH 1I94Q 2H1EA 3IFTA 1U0LA 3S17H 1EYAA 2WAQG 1K83H 2EYOA 4JI2Q 4KHPQ 4LUVA 5GAGC 1SYBA 5IP7H 3PO3H 1AZPA 3TSSA 2QEXA 2ES2A 3HGBA 3H0GB 1HCZA 4A3FH 2NWGA 3HOXB 4R9WA 3ER0A 3S1QB 4LFBL 4BA1I 4DV4L 2OEOA 3A8IE 1ICFB 1A62A 3HS0C 2ZJRA 4DV1Q 4OO1I 2YTXA 1STBA 4DV2L 3PGZA 5C44G 4RGOS 4R4CA 2F4VQ 5C0XG 3A74A 5C4HA 1FGUA 3CCVA 1N32L 4B9WA 2K6AA 2K7VA 4K5VA 3CP0A 4XYOA 4FVMA 3K59A 2SEBD 4PMCA 1B8AA 4P73A 1VMCA 5FLMG 3MEHA 2K5HA 1X6OA 1U4LA 1Y1WG 1KLGD 3VYTA 4C3IB 1LYLA 3HOYH 4B3RQ 3CXCA 1GUTA 4C2MH 5EPJA 3S17B 1NAPA 1D6EC 4XQQA 4OO1G 1EWHA 1K83B 2EIFA 1VQAA 1VQOA 4M8AA 4DUYQ 5FO7B 2R7ZG 1L2FA 4ZCKA 3H94A 1PH7A 1CKOA 1Z47A 2E74C 3AFPA 3D4RA 3PO3B 1QVFA 2QCPX 3TS2A 3RUZA 3NWSA 4LF8L 2PW5A 4A3FB 3A5UA 4L5SA 4LF9Q 2DUDA 1BCPD 3GTKH 5DNFA 1A3TA 2MPMA 3I70A 3S15H 2A5HA 2BE5D 1HNZL 4YWLA 1YHAA 2K1BA 4JV5Q 2VL6A 1I4PA 1PRTC 1KDCA 2WIIB 4UP9A 2D2CC 1KTKA 2PZTA 2X6GA 3DHQA 4JI7L 2E5LQ 2PNRC 2OTLA 3PO2H 1EY9A 3HKZE 1BXTA 3U9OA 4MIUA 1AN8A 4DAPA 1JR0D 5IYCG 5IE8A 5DAUA 3HOYB 4PMWA 4TSSA 4HEDA 3D8GA 4C2MB 3EQLC 1PMRA 4LF6Q 1SFOH 2MNAA 4GZYC 3GQBA 5HURA 1HNWL 1EQVA 2TSSA 2B2TA 1K0SA 1HUNA 1KAWA 4K6LA 1QVGA 2QEJC 1HRJA 4N8FA 2I46A 2RA4A 3K5MA 1KDBA 4R8IA 4ZUJA 3GTKB 1EUJA 1N36Q 3M85A 1CK1A 5FJ8H 2RHQB 3S15B 5F2DA 1BCPC 2JA6G 1EZ6A 2MFIA 1LT5D 4L5QA 4P74A 1ENFA 5D3IB 5E4WC 2LFNA 4QUCA 1SBBB 1IKLA 2KHSA 4RGTA 1II3A 1S5ED 2J0TD 1PH8A 2C9OA 2BE5C 1C9OA 2B2UA 2B8FA 3B6YA 4X64Q 4DA2A 2OT2A 3PO2B 1I5FA 4ULLA 5C3EG 1XJVA 4A93G 4OL7A 2HQLA 2MJ8A 2UUCQ 4ZYSA 4DK3C 4F88A 5C6AA 1HZAA 2WKDA 1TS5A 1QOHA 4WFN3 1SFOB 3KLSA 4IJLA 4X66Q 4XYQA 1S5DD 5JOBA 4BS9A 2KOLA 4DV0L 5EPKA 1NCVA 4F87A 1SAPA 1HA5A 1IBLL 2R7FA 2K52A 1Y8NB 1HA6A 4GN4B 2JA5H 1U4RA 1WD0A 1CQVA 3I2ZA 3L7ZC 5CBAE 2IX1A 4L5TA 1BNZA 4DAVA 1M4VA 2VB2X 4QIWE 4B08A 5D65A 3J7YW 3I4NG 5AJ3Q 3PMFA 4OX9L 1A15A 1Z6HA 3VR5A 1BOSA 2NZ1D 3K8AA 5M5WH 1Q82C 1WTOA 4AQYQ 2B2TC 3QOJA 4RKLA 1TWHH 4OEMB 1HHVA 2F0VA 1ML0D 1KHIA 2PPBC 1K9MC 5LMUL 1XWEA 2R92G 1W3SA 2HQEA 1RTNA 1PTOD 1STYA 4IPGA 1F9RA 3VR4A 3R3OA 1IYUA 3SVMA 1TR5A 2ZJQA 4XIGS 4GOPB 3BDCA 2KBNA 1PFNA 3F2CA 1EYGA 3T56B 4KD3A 3TQYA 1VS0A 3OIPA 1JMCA 1X55A 4GS3A 4LMQD 4PZ6A 2JA5B 2B2UC 3L0OA 1GUNA 2Y0SG 5ELDA 3QO2A 2RQXA 2L9HA 1QCBD 2KECA 3K7UC 3UDXA 3CRKC 4I7ZC 4LF5Q 3J81E 2VQEQ 3IL8A 3JAML 5M3MG 5M5WB 2NVYB 1L0XB 2CCZA 4OWTB 1TWHB 1H9RA 4BBRG 4QF4A 3RN5A 3OTOQ 4GKKL 3A7LA 3BVZA 2DNCA 5TSSA 1X54A 3Q23A 4EQPA 4HMIA 4GOPA 3HOVG 1CTMA 2HUGA 2Z0SA 4N9PA 2ZXOA 1TKWB 3W5OA 4XQJA 3T51B 2CVRA 5IWAQ 3G7LA 1OTCA 4B3TQ 4FYDA 1IW7D 3VR3A 5E4XA 2A73B 2ID0A 2KCTA 2KHJA 4U68A 1RD9D 3HZXA 1PRTF 2JA8G 4JI5L 3ONAB 1Y14B 3F1ZA 1UE6A 2SOBA 1KLUD 4LFAL 1EOVA 1NMFA 4IFDJ 4NKLA 1J8IA 1G2TA 2H5XA 4A3GH 2NN6G 3T1HQ 2QF7A 5I4DA 2K05A 2MUYA 1D7QA 3GTGH 3BZKA 5A2QL 2B63H 1XNQL 1K28A 3NELA 1BR9A 4AYBG 1BF4A 5HY6A 3G71A 2RCFA 3PCOB 1PFMA 2XN9C 4C3HH 1RIPA 1VQIA 4DK0A 1UE1A 4RCOA 4EQNA 3J80E 4BA2I 2JXMB 4A3BH 2RSOA 5EPLA 4I7AA 3AU7A 4X3UA 2SNSA 1XNRL 2VQFQ 5CV4A 4A3MG 2HDLA 4LUZA 1LTRD 4DV7Q 4DU9A 3MZ5A 5LMNQ 4QUFA 4IPCA 1IBMQ 2SNMA 1D1KA 1BCPF 4FF2A 1JWUD 1TS4A 4UP8A 3GP7A 1LV9A 2MO1A 3I7FA 3C46A 4JCVE 4CKEA 3K58A 1SE3A 1NSNS 3I91A 5LMNW 1V9PA 4A3GB 3CPWA 3FHWA 1MBYA 3I55A 3GTGB 4GOPC 2B63B 3A56A 3CKIB 1LTGD 1TY0A 4A3EH 1TIID 2CH4A 3SK5A 2M9VA 4C3HB 3AEVA 1HR0W 4MHEA 2B2WA 3NBHB 4C3IG 2PMZB 4DR5L 2J4XA 5IYBH 4C1NK 3VA7A 4A3BB 3KF8B 5KNCA 5IP7G 3K5OA 3NSWA 2UUAQ 1VQMA 3PO3G 1RKNA 2HIXA 5DM63 3MC0B 2FMMA 2AHOB 2EYMA 3DLLA 1EQRA 2KEDA 2MO0A 4KN4C 2R93H 5ELNA 1K3RA 2UUBL 2UXDL 1RODA 3D4WA 1I50H 3RLFA 4UAIA 4JBJA 3R93A 3I4OA 1LT6D 2QDBA 1DGSA 5GAHC 3A8KE 4KY6A 4JI1L 3CAMA 3WWVA 4QJFA 1A6XA 4A3EB 4UHVA 2K01A 4DAYA 5I9PA 4IOCA 2L55A 3R2TA 2F0FA 4DV6Q 3HOYG 2HCIA 5FK9C 5K36H 4IJHA 3N6RA 1FVIA 1Z7TA 4A75A 2PYKA 5DLQE 1ENAA 4LF7Q 2E2DC 4RHRA 1PHJA 1D5ZC 1X3GA 1P16A 1TWAH 3OWEB 4CKBA 4A3DH 1H95A 4IUPA 2WV6D 2R93B 1E7ZA 4TRDA 1RL2A 1XMQL 1VQFA 3U50C 4QCLA 2PI2E 1I50B 2Z1CA 5KIXA 4KKUA 2B39A 4AH6A 1STNA 3J7AF 2B2WC 1I4GA 2IL8A 5KNDA 2RSNA 1EY0A 4KKSA 1S3OA 5C3XA 3PO2G 1ZKOA 4KN7C 1SYCA 3MA2B 2C5CA 4POGA 3TS0A 1S5FD 4A3KH 1F2MA 1G8ZD 1HTLD 1SMXA 1X32A 4IFDI 1ONLA 3MEFA 3SR1A 2PMZE 2DGYA 1B44D 3HOUH 3PUZA 5I9OA 1E1OA 1PYSB 4WJWA 2GA4B 1IXRA 5FOBB 1VF5C 1TWAB 3CPFA 4A3DB 1VQ4A 2JQOA 1P8LA 1HNXL 1SE4A 1SDFA 5AFWA 4V190 1OXVA 4DR6L 4GLXA 3QWNA 1R9TH 1SYGA 2D0OA 5FJ8G 1JC7A 1MGSA 4IFDG 2F0MA 2KEEA 1QG7A 1NJIC 1JJCB 3GDEA 2F0TA 3K80C 4WJ3M 2F0LA 2F0IA 3QB3A 4BBSH 5JVH3 2N55A 4IPDA 3PIPA 5KYIA 4RGNA 5BN5A 2MP1A 5L37A 1GUOA 4UDUC 4IUUA 4A3KB 1LACA 2ZT9C 1YEZA 4DV4Q 4FXGC 1O7YA 1HFGA 1G51A 4DV2Q 1EY5A 2LXKA 3HOUB 4BY1G 4JI6L 1WTHA 2I07B 2NTTA 2H4OA 4MNOA 3J81L 1ESRA 3SHLA 3ZJYC 2JA5G 1SJED 1SNCA 1ILPA 4B3ML 1PYBA 2EJGC 3LWUA 5A35A 2F0JA 4HIOA 1R9TB 1YNNC 3PUXA 3EFXD 4DV5L 4X3SA 1K8AC 4S3SA 3S1NH 2O5JC 3DUZA 1C4QA 2K5DA 1S40A 3PIP3 3OW2A 2N8NA 4POFA 1EZ8A 1HTPA 1EIFA 4BBSB 3BZDB 4QL5A 5M5YH 2AMCB 2Q2HA 4HJ8A 1FGBD 2AQ3B 5E7NA 3F2DA 1WTRA 1G91A 3FP9A 2WB1B 3NEMA 1KDAA 1RJTA 4OONA 3CU7A 2I5MX 4K8IA 2UXBL 3E9IA 3EBEA 2AKWB 1N8RC 1PH3A 1HNZQ 4J1MA 4EGVA 2K14A 4JI4L 3HKSA 2F0PA 5C0XI 3FEWX 1N34Q 2L0CA 1M1KC 4JI7Q 3OW7A 1R4PB 4LFCL 3TN2A 1K73C 1MD2D 2I5HA 1JB3A 1VQGA 2JJQA 2F1MA 2F0EA 1CM9A 1N33L 4NP5A 1J6QA 4HIKA 3S1NB 4G57A 2F0SA 2RDGA 1SE2A 5EQ0A 1PRTD 3J80L 1HNWQ 4DR7L 3RZOH 1U4MA 1H9KA 4CBVA 3Q24A 2Z8LA 1QE6A 4O2DA 1ASYA 2LXJA 4DNIA 2ENBA 5M5YB 2EE1A 4RG1A 4E6IA 3KLWA 2NBFA 4Q5VA 1MHWC 2K04A 3S1RH 1YJWA 2IW3A 2ZTEA 2GVAA 4XTCS 3E3XA 1YBYA 2IX0A 4C3JH 4EX5A 3CCJA 3P75A 3GTOH 3WDNA 2PW7A 3H09A 1LABA 2ICEC 4JI3L 4G7ZC 1LTTD 1QWYA 2BH2A 2OCEA 3ULLA 1D1IA 3TP8A 3RN2A 2BOSA 2F0QA 1PDQA 1CUKA 2JA7H 4TQUS 3IAYA 3S1MH 3TZDA 5J3BA 5KRUA 4GNXB 3J81i 2JK8A 3CCRA 4LK1C 3K81C 1TVXA 3K7AH 3OYYA 3CCLA 1GM5A 2K32A 4DV0Q 2F0GA 3RZOB 3NQTA 4QIWB 4CJ0B 1SJHD 2QGQA 1LTLA 2XSCA 1TY2A 1V1PB 5IGEA 1F2LA 1DXMA 2ZTDA 2KENA 3S1RB 2GVBA 4JW0A 1WJJA 4KLKA 2WB1E 3GTQH 3J81c 2KUMA 4KTAA 4C3JB 1HH2P 2R3ZA 2Q2TA 2XGTA 3P1HA 2DY8A 1DOKA 4RWSC 1M90C 4OX9Q 2RHSB 3RMHA 3H3VH 4BY7H 5IT9E 5LMUQ 2JA7B 3S1MB 4LUOA 4HJ9A 2MQHA 1A2UA 3BVGA 4JI8L 3K7AB 1R4QB 2KQ3A 1SNMA 1MI2A 1IBKL 5C4ZA 3CQZH 3MXUA 3PUVA 5ELFA 4DV1L 4A3EG 4JBKA 2F0NA 2C35B 3URYA 4N9TA 4LJZC 4FP5D 5FLXE 3DWQA 1XYIA 1CZWA 4A76A 3J80i 3M4OH 2PNHA 1KNAA 3A55A 1GO3E 1QVCA 4DR3L 5IYBG 4HAEA 3GTQB 1K8GA 4J6HA 5D14A 4DV3L 4WJ4A 1F9SA 2AWOA 1D2BA 4DR2L 3PIOA 3HEJA 4K14A 1QNUA 1XPRA 4KY7A 2ZXPA 3FDTA 3FKIH 5C4XH 4NMZA 1XMOL 5IY0A 1KL9A 1LUZA 2K50A 4IUTA 4KHZA 4BY7B 3J80c 4APVA 4DR1Q 2J7ZA 1VQPA 3ZYYX 5H1SE 2K5NA 2IHFA 4ID6A 1D5MC 2RF4A 2QDLA 4HCSA 2VUMH 4H44C 4DN4M 4LF9L 1STHA 1B9NA 1QUQB 2IT1A 3CQZB 4JI0L 1OXUA 1ESFA 2EYFA 4ZAIA 3I4MG 4IOAA 2EY2A 4A3JH 2K4KA 3TP6A 1JE5A 1TWFH 3M4OB 1VQ6A 4X62L 1YJ9A 3PIO3 3BJUA 1S5CD 4JI5Q 5JJLA 5IGGA 2UXCL 4LFAQ 5IGBA 1MKHA 3ITPA 4DR4L 4RGMA 5K5PA 1JB7A 2QA4A 1Q90A 4BXXH 1BO0A 1KD1C 2HD3A 1IYVA 3F2UA 3T1YQ 4A3DG 3FKIB 5C4XB 1XXGA 1XNQQ 2YV5A 5CC4A 4NDXA 5COYA 2XVSA 1LM0A 2ZM6L 4K0KL 2K5WA 1X3QA 1RCVD 1FNUA 2BCOA 1PZID 3LX0A 1BBXC 3RLOA 4TKOB 2VUMB 3KF6B 1L0WA 4YHHQ 3S16H 1EY6A 1QUQA 2N3SA 3GTPH 3TMEA 4ZK9B 4QY7A 1VQEA 1WTXA 4PZ8A 3A7AB 3ERQA 1E2WA 2JA9A 1PV4A 3NENA 2AUJD 1I6HH 1N36L 1EOTA 4X65L 4A3JB 3BVMA 1CQFA 2EYJA 1LTAD 1TWFB 2G5DA 4YCVA 3X3MA 1EIYB 3MXNB 5FO8B 3VYUA 3HOUG 2NUCA 2PQEA 4NXNL 2L15A 1WCMG 2XRQD 2L4NA 4KI0A 5I6WA 2RDHA 5HGTA 3JC66 2HDMA 3UE1A 1AP0A 2NN6I 3A54A 1Q3LA 2PO4A 3C3LA 2CFMA 2KVMA 1VQLA 4QMGA 3DEPA 1KNEA 2VNUD 1STEA 3KK7A 1GJXA 1HPCA 5C44H 4CDEC 1F2ZA 5IYDG 2D9UA 3EROA 4DR5Q 3K6OA 5I2XA 1SYDA 2OWOA 3SK8A 3S16B 4NXMQ 3GTPB 2KCNA 3OMCA 1C0AA 1YJNA 2B2YA 5KEEA 3HG9A 3U9SA 1I6HB 4BBSG 1UUPA 5CBEE 4K5XA 1TT2A 1CSQA 5DM73 4KY5A 4R4QA 3H3VC 1WFQA 4OO1H 2UXDQ 2WAQB 3EN2A 3HKZG 2CW0D 3BZCA 2R7ZH 2B8GA 1EY8A 4JYAL 1YVCA 2EJMA 4AIMA 3I56A 1BQQT 1I4QA 3C1EA 1K3BC 1CA5A 1UWVA 3M3YH 3FMCA 4JI1Q 5J39A 2A68D 2KHIA 4HN7A 2F03A 3AB9A 4MTKA 4HJ7A 3NTHA 5C44B 1D8LA 3CC2A 4PZ7A 1T5EA 4F7XA 4HJ5A 2NTSA 3H0GG 3HOWH 2OQ0A 3LWEA 2RKSA 3HOXG 3R2IA 4GN5A 1YZ6A 1FR3A 4DK1A 3FVQA 2ZTCA 4MTNA 1HZCA 2A1AA 1J5EL 5KYLA 1A2TA 2PQAB 1NNXA 3VDYA 3HFZB 5IYCH 5EGTA 3CC4A 2I5LX 5BN4A 4Y7NH 1A8VA 4KK7A 1YIJA 4OELB 4JBMA 3KBGA 4FXDA 3U4VA 2R7ZB 2R61A 1XTCD 5EKIA 3W3AA 2CW0C 1GUGA 3QG1A 4ZKCB 1ICWA 1PVOA 4DGZA 3C2PA 4LF4Q 3FPUB 4FO2A 3M3YB 1B50A 4P72A 2DY7A 4B3SL 5CYUA 4OIJA 2B2YC 1VDZA 1YITA 3QR8A 1EYDA 5CORA 3FRPB 2A68C 3CCQA 1NMGA 1PH9A 1EWCA 3HOWB 1JJGA 4A3FG 5CV6A 1B70B 1O78A 3AFQA 2BDNA 1ET6A 1BDOA 1E2ZA 2K5QA 4Y52H 2EY6A 2UU9L 1V1QA 2OTJA 2WP8J 3CCMA 5JVG3 1O7ZA 4Y7NB 1HNXQ 4GKJL 3I3CA 5E3FA 1SN8A 3K0YA 1SYEA 1Y8PB 3MWYW 4DR6Q 1AE2A 2WAQE 3NBHA 4WORA 1LT4D 4P75A 3BDLA 2JN4A 3G4SA 1EY7A 3NTKA 3M4PA 2K28A 1DONA 1Y1VH 3KF8A 2Z4IA 4IUVA 1KQSA 1VQJA 5E1FA 5C3WA 3OHXC 4H0LC 1SEBD 4X3TA 4BWGB 1FNVA 3IRBA 2NVTH 1D5XC 4KMUC 2HHHL 4H02A 1AEXA 3G6JB 4YCUA 1L0YB 2AQ2B 3J81j 1W6JA 4HJAA 2R6GA 1E22A 1I3QH 4UY8C 5LMNL 4J8QA 4JBWA 3SK6A 3PF4A 1Q8KA 4K8JA 1YHQA 1GHJA 1IBML 4PMBA 3PQIA 2DJGC 4JI6Q 4YWMA 2R92H 2DN8A 4RCNA 1HR0L 1CZGA 2I0QA 4KHVA 5EKLA 1WD1A 4B3MQ 4RFBA 3PV0A 1HZ9A 5IP9H 1GUSA 3P7JA 5ISRA 3TP7A 3HOZH 1Y69U 3I4LA 3KDFB 3RNUA 3X3NA 3MTSA 2EXDA 4IO9A 1TS2A 3NE5B 4IQZA 4TVAB 4CDDC 4LNQA 2HT1A 1IKMA 1I4HA 1Y1VB 2VS1A 2CQOA 1C7YA 3QIAA 1W6KA 4EQ5A 1IL2A 4F8MA 2NVTB 5EBCA 1FJGQ 1Q1BA 3M4QA 5M9OA 2N78A 3CRLC 2M2LA 1B53A 4L8JA 4OXPA 3DXJC 1GHKA 2L1BA 1YNXA 4MZ9A 1YNND 1I3QB 1O7IA 4DPGA 5GADC 4RMFA 2K75A 3ERSX 2UXBQ 5M3MH 5HGQA 1WYDA 3SK4A 2B29A 1K0RA 1C48A 1WTWA 3DWPA 2DNEA 1ZYRD 4BBRH 1VQKA 4JI4Q 2KCCA 3ND9A 3EIVA 2R92B 4JOIC 1RDPD 1Y8OB 1EQTA 3BYTB 2V4DA 1FD7D 1HJPA 1NR4A 5JEAH 2Q8RE 4LFCQ 3HOVH 1U4PA 1JOKA 1NUCA 1SNDA 3HOZB 5IGFA 2Z6KC 1QJOA 4QQBX 4CHTB 4PNYA 1N33Q 4LW1A 3LNNA 1X3PA 2RVLA 2XTIA 1CHPD 4L5RC 3RD4A 4LFBQ 3Q22A 3OPOA 2EYLA 4DR7Q 5G3LD 4J15A 2L5TA 2YYZA 1G2SA 4P2CB 1L1OB 3I72A 1N32Q 2VXWA 1EU4A 1SROA 1RHPA 4LAAA 5M3FH 3E9HA 3GTLH 3VYSA 1AFPA 5M3MB 3M9BA 1GVPA 1I4RA 1B9MA 3OSOA 1EU3A 2CHBD 3GTJH 4KJOA 2E2IH 4JI3Q 4BBRB 1TWGH 2QW7A 2XWBB 5JPNC 1LTSD 5IT9c 2MHVA 2Q8IB 4CDFC 4ABNA 1IL8A 1B7YB 4LWCA 4NW2A 1Q1EA 1ZYRC 2EY1A 3JAME 3HOVB 5JAVA 4DXGA 4A3MH 1UEBA 1V1OA 4LF8Q 5JPMC 2FJ2A 1PFSA 5EJWA 3KBXA 5I2YA 3T4AC 5FLXc 1BUVT 1UE5A 3STBD 5BR8L 4L6TB 1PZJD 3E5SA 2BA0A 4DUZL 3DM3A 2N49A 3ULJA 5CV7A 1HQMC 4P71A 5M3FB 2F3VA 5KGUA 4HCEA 3GTLB 4DFAA 1IHZA 5CGKA 2G9DA 1AZQA 2TMPA 2JP1A 1QILA 1MJEA 4AYBB 2D62A 3GTJB 4CDCC 2A19A 2JSOA 2E2IB 1TWGB 1JE4A 1GKHA 2O4XA 3OWFA 1VQHA 3I90A 1BCPB 4JC0A 1J9OA 5A2QE 3A8JE 2ZJPA 5IODA 4A3MB 2EYPA 4HMJA 1SSOA 4JI8Q 3KYHC 3NBIA 3NWTA 4XDXA 4PV1C 3G48A 1H9SB 1N9WA 1NBWA 2D5DA 3H15A 4A3LH 1IBKQ 1O80A 3CCUA 4K2KA 1DOLA 5IGCA 2A69D 1VQ7A 2NVXH 1DZ1A 2Y0SE 5IOCA 2F0DA 4YY3L 4ODGA 3STBC 4JK1C 2O5IC 2JEAI 2EYHA 2CH4W 4DR3Q 1EIHA 2AQ1B 1SNQA 4DV3Q 3M7NA 3HRZC 4DR2Q 1I4XA 4A3GG 2MGSA 1E2VA 3J7AV 1C8CA 3U58A 1XPOA 5C5MA 4HR7B 4FF1A 1XMOQ 4IN3A 5JEAJ 1EEID 1L1OC 2B63G 4G4KA 4IUNA 1TU2B 3ICEA 2NYZD 2XWJB 2EDGA 2Q2IA 2GN5A 4CJ1B 1IBLQ 3EA6A 1QZGA 4C3HG 4CKCA 1NE3A 1XPUA 2E2HH 4G7HC 3AMUA 4Z9CB 1H9SA 1WOCA 4L63B 2E2JH 1JWSD 5FKAC 2LY7A 2YU9H 4A3BG 4JI0Q 1ZXTA 4A3CH 1TS3A 1WI5A 1OXSC 3GTOB 2NVXB 3T53B 1BVSA 4DK6C 3O13A 1KRTA 1SYFA 1I94L 1SE8A 3HOWG 4X62Q 3F2BA 2A69C 1PH4A 1PTOH 4GLVB 5D3DA 3E0JA 4JI2L 2V1CC 4KHPL 1N34L 1X3FA 2HCCA 4GNXA 1KIXA 2UXCQ 3I73A 4DR4Q 3PUWA 3TBIB 3BS1A 1AW7A 1F9PA 1DJRD 1LLRD 4AYBE 3CMEA 4RA8A 2ZXRA 3T13A 5I6YA 1V1PA 4EQOA 1GUWA 3SE0A 2L12A 1IZ6A 2ZM6Q 4K0KQ 1T9HA 2F3IA 3PF5A 1CKMA 4UP7A 1QB5D 5IIFA 1QZHA 2F0UA 2F4VL 3H6MA 2E2HB 4DKAC 3S2HH 2E2JB 5JJIA 2YU9B 3KOJA 4R4TA 2X69A 3SGIA 3H91A 4X65Q 4IFDH 1SXTA 2FINB 3BG3A 2JE6I 2NZOA 3WOEA 4B3RL 2R93G 1PTOB 2LS01 4G7OC 1PH5A 1GD7A 1H9MA 3N52A 1EFID 3MVVA 2B2VA 3GV6A 1HFNA 4RH6A 4DUYL 4NXNQ 4GKKQ 3T16A 1EEFD 3W1BA 1A0IA 3KJPA 3UDGA 3KFUA 1T5XD 1UE7A 3UE0A 3BU2A 3UI2A 1ET9A 4ZQ3A 2BDOA 4FF3A 1RTOA 1AH9A 4BY1H 1MIUA 1PA6A 3BDOA 4JG2A 3MAQA 4XT3B 4JV5L 2AWNA 1GOZA 1VQBA 3J7ZC 5K36G 1NY4A 3M4YA 1U5KA 3Q8DA 3S2HB 1Y1VG 4R8NA 2N88A 2F0KA 4GNXC 5G3LF 4KKTA 5LL6S 2KJXA 1WTPA 2IWHA 2E5LL 2O2LD 2JYOA 3VR2A 1O7LA 4YWKA 2IY5B 1KRSA 2BH8A 2PCFB 4LF6L 4JYAQ 2NVYH 4HSPA 4CGYB 1I6VC 1PLFA 1HUMA 3L9AX 1FNWA 1S4ZA 3D0FA 4OGQC 1STAA 3CCEA 1XNRQ 2XRSD 3MXGA 4WRDA 1EL0A 3ND8A 3PSIA 1X3EA 2KA7A 5IP9G 4XQNA 1HQRD 3S24A 3E6ZX 1JT8A 3HOZG 4BY1B 3CMAA 4A3IH 1K8OA 5KNBA 2A6ED 2KCMA 1YNJD 4A3KG 2FXQA 3V96A 4RKBA 3I8ZA 1EWIA 2E76C 2B2VC 1Q7YC 3CHBD 1JORA 1J5EQ 2D0PA 2VZAA 4X64L 1A63A 3AQQA 3PUYA 4MN3A 1XTDA 1E24A 2IX3A 3Q6SA 4GLAC 5JJKA 1CT1D 4OIKA 1V43A 2UUCL 1F9QA 2K33A 3E0EA 2IPKD 1G291 2OXPA 3DWAA 1JQYD 2VY3A 2CQAA 1B1ZA 4X66L 5GAEC 1CKNB 1HXYD 2F3WA 3QJYA 5C0XH 4ZRZA 1V8QA 2F0WA 1ASZA 3KF6A 3P20A 1VMPA 4DR1L 2JEBI 2PZWA 1ZEQX 4ZLTF 5CV8A 2A74C 2RCNA 1Q81C 2DJFC 2L11A 4B3SQ 5FLMH 5JEAG 4U673 5CV5A 2E8GA 4KV6A 1Y1WH 3CW2C 1BBWA 1SNOA 3DMUA 4A3IB 3CF5A 1E3PA 1PTOC 3MXNA 2IJ0A 1JICA 3VR6A 2EOTA 1YHBA 3SEBA 1JCKB 2WB1G 2UUBQ 4R1JA 5AJ3L 4K5WA 3W2DA 3TP5A 4EVOA 1DM0B 2M00A 2A6EC 5LHY1 4N8X1 2YTVA 1YNJC 1IYJB 5DEHA 4ZKBB 4AQYL 1PXUA 2UU9Q 1UAPA 2G9HD 1B3AA 4QGUA 1HZBA 2OQKA 4GKJQ 5M3FG 2Z4HA 3HP3A 1CKNA 1QNKA 3T1YL 3TDQA 4JVZA 1NTGA 2EY5A 2F4IA 1X65A 4NPSA 5J1ZA 1WTVA 2ICIA 4FNFA 4ALPA 1NR2A 4IUQA 2Q8TA 4Q0FA 1W2BA 2HHHQ 4YHHL 3KLSX 5ELBA 1LT3D 1Y1WB 2ALYB 1LTBD 5EBDA 3TZUA 2PZUA 4H7BA 2B3GA 4PG3A 1XMQQ 5GQOA 3EVQA 4LF5L 1TQOA 2VQEL 3U4ZA 1SLJA 3K5LA 4O0AA 3NK9A 3EJIA 3RZDH 4YIJA 4M1UB 1IW7C 2QKIC 3W1GA 2IHEA 1HR0Q 1VQDA 5ELOA 1S72A 3K57A 3OTOL 1CI3M
chains in the Genus database with same CATH topology
1EY4A 4I65A 3GD7A 3D31A 1XX8A 4X3KA 1Q8IA 1H9JA 1B4OA 2WACA 3QOLA 1KAAA 1WVLA 2FMCA 2K03A 1G6ZA 4OHJA 1ENCA 4FXKC 3SDZA 1EIGA 5C5LA 4ME5A 1PFBA 1F2YA 4DNRB 1PZKD 4K6DA 4XT1B 1U9RA 1DCZA 5ELEA 4KJNA 3GO5A 4V0BA 1STGA 1A3VA 3BYYB 4PQXA 4C3JG 1Q12A 3D3RA 4O1NA 5T1GA 1CFMA 5IT9L 3RZDB 4IZ8A 1LTID 3NTIA 4KD4A 1M8AA 5JJZA 1FYCA 2JA6B 5C0XJ 5NUCA 5FLXL 4C1NI 1SMYD 3NP8A 3KLRA 1ILQA 4HTHA 3D6CA 5CR3A 1A3UA 2RDFA 3OOCA 3C1FA 5C4JB 5J22A 1CA6A 5C3EB 4A93B 1B2TA 2F0OA 3OIQA 1RF2D 1JOQA 1F77A 1SNPA 4IURA 1UNSA 2EPBA 3VYRA 3IKJA 3KUPA 1OXXK 4ZUIA 4ILWA 3VA5A 4IALA 1K8MA 4DNTB 1VCIA 1JWMD 3M7GA 3NXWA 2LMCB 2NVQB 5T1IA 2OF1A 1E0BA 2EZVA 3NPPA 1DYQA 2XNAC 2AUKA 5M5XB 4B9XA 3I4MB 3I4NB 1MSGA 3S9WA 3MHBA 1DD2A 1PTOF 1SMYC 2X6LA 3GV3A 3WOFA 4HSVA 2F0HA 3L3OC 1WTQA 5CV9A 3S2DB 3Q0AA 1UEAB 4H13C 3MFGA 5ELCA 3OMGA 2EVBA 2VB3X 3MXPA 2XIWA 3SXHA 1OO9B 1GXDC 1TWCB 4CJ2C 1CHQD 3K5NA 2E75C 2Y0SB 3D6WA 2A6HD 2RBMA 3DEOA 5CMDA 2NN6H 1DOMA 2WINB 1EYCA 2NB0A 5IGDA 4QB4A 2BA1A 3R8BA 3NQIA 5EKKA 3DM1A 5FO9B 1WCMB 4K2LA 1PRTB 3NHHA 4DXFA 4XXEA 1KABA 2EJFC 4C56C 5LL6X 1OXTA 1LO5D 1S5BD 3MFYA 2LKVA 3GTMB 3NUCA 3S14B 1PYWD 2WKCA 4O42A 2JA8B 3V05A 2A6HC 5BN3A 1VF7A 4FF4A 4RHSA 2FFKB 1JOOA 3HKZB 1MSHA 3IFDA 3V2TA 2EXZA 2SDFA 3D4DA 4DF7A 3FPPA 2QILA 2FHTA 4RAUC 2H1EA 3IFTA 1EYAA 2EYOA 1SYBA 1AZPA 3TSSA 3HGBA 3H0GB 1HCZA 2NWGA 3HOXB 4R9WA 3S1QB 4BA1I 2OEOA 3A8IE 3HS0C 4OO1I 1STBA 4RGOS 5C0XG 5C4HA 4B9WA 2K6AA 2K7VA 4K5VA 4XYOA 4FVMA 3K59A 2SEBD 4PMCA 1VMCA 3MEHA 1U4LA 1KLGD 3VYTA 4C3IB 1GUTA 5EPJA 3S17B 1NAPA 1D6EC 4XQQA 4OO1G 1EWHA 1K83B 4M8AA 5FO7B 3H94A 1Z47A 2E74C 3D4RA 3PO3B 2QCPX 3RUZA 3NWSA 2PW5A 4A3FB 1BCPD 5DNFA 1A3TA 2MPMA 3I70A 2A5HA 2BE5D 2K1BA 1I4PA 1PRTC 1KDCA 2WIIB 2D2CC 1KTKA 2PZTA 2X6GA 3DHQA 2PNRC 1EY9A 1BXTA 3U9OA 4MIUA 1AN8A 4DAPA 1JR0D 5DAUA 3HOYB 4PMWA 4TSSA 4HEDA 4C2MB 3D8GA 3EQLC 1PMRA 4GZYC 3GQBA 5HURA 1EQVA 2TSSA 2B2TA 1HUNA 4K6LA 2QEJC 1HRJA 2I46A 2RA4A 3K5MA 1KDBA 4R8IA 4ZUJA 3GTKB 3M85A 1CK1A 3S15B 5F2DA 1BCPC 1EZ6A 5D3IB 1LT5D 1ENFA 5E4WC 2LFNA 4QUCA 1SBBB 1IKLA 2KHSA 4RGTA 1II3A 1S5ED 2J0TD 2C9OA 2BE5C 2B8FA 2B2UA 4DA2A 2OT2A 3PO2B 4ULLA 4OL7A 2MJ8A 4ZYSA 4F88A 5C6AA 2WKDA 1TS5A 1QOHA 4WFN3 1SFOB 3KLSA 4BS9A 4XYQA 1S5DD 5JOBA 2KOLA 5EPKA 1NCVA 4F87A 1SAPA 1HA5A 1Y8NB 1HA6A 1U4RA 1WD0A 1CQVA 3L7ZC 5CBAE 2IX1A 1BNZA 4DAVA 1M4VA 2VB2X 4B08A 5D65A 3J7YW 3PMFA 1A15A 1Z6HA 3VR5A 1BOSA 2NZ1D 1WTOA 2B2TC 3QOJA 4RKLA 1HHVA 2F0VA 1ML0D 2PPBC 1XWEA 2HQEA 1RTNA 1PTOD 1STYA 1F9RA 3VR4A 3R3OA 1IYUA 3SVMA 1TR5A 4XIGS 3BDCA 1PFNA 3T56B 4KD3A 3OIPA 4LMQD 2JA5B 2B2UC 1GUNA 5ELDA 3QO2A 2RQXA 2L9HA 1QCBD 2KECA 3CRKC 4I7ZC 3J81E 3IL8A 3JAML 5M5WB 2NVYB 1L0XB 1TWHB 1H9RA 4QF4A 3A7LA 3BVZA 2DNCA 5TSSA 3Q23A 4EQPA 4HMIA 1CTMA 2HUGA 4N9PA 2ZXOA 1TKWB 4XQJA 3T51B 2CVRA 3G7LA 4FYDA 1IW7D 3VR3A 5E4XA 2A73B 2ID0A 4U68A 1RD9D 3HZXA 1PRTF 3ONAB 2SOBA 1KLUD 4IFDJ 4NKLA 1J8IA 1G2TA 2NN6G 2QF7A 5I4DA 2K05A 2MUYA 5A2QL 1BR9A 1BF4A 1PFMA 2XN9C 4DK0A 4RCOA 4EQNA 3J80E 4BA2I 2JXMB 2RSOA 5EPLA 3AU7A 4X3UA 2SNSA 5CV4A 2HDLA 1LTRD 4DU9A 3MZ5A 4QUFA 2SNMA 1D1KA 1BCPF 4FF2A 1JWUD 1TS4A 3GP7A 1LV9A 3C46A 4CKEA 3K58A 1SE3A 1NSNS 3I91A 4A3GB 1MBYA 3GTGB 2B63B 3A56A 3CKIB 1LTGD 1TY0A 1TIID 3SK5A 2M9VA 4C3HB 4MHEA 2B2WA 4C3IG 2PMZB 2J4XA 4C1NK 3VA7A 4A3BB 5KNCA 3K5OA 3NSWA 1RKNA 5DM63 3MC0B 2FMMA 2EYMA 2KEDA 4KN4C 1RODA 3D4WA 3RLFA 4UAIA 3R93A 1LT6D 2QDBA 3A8KE 4KY6A 1A6XA 4A3EB 2K01A 4DAYA 5I9PA 2L55A 3R2TA 2F0FA 2HCIA 5FK9C 5K36H 3N6RA 1Z7TA 2PYKA 1ENAA 2E2DC 4RHRA 1D5ZC 3OWEB 4CKBA 4IUPA 2WV6D 2R93B 4TRDA 4QCLA 1I50B 2Z1CA 5KIXA 4KKUA 2B39A 1STNA 3J7AF 2B2WC 1I4GA 2IL8A 5KNDA 2RSNA 1EY0A 4KKSA 5C3XA 1ZKOA 4KN7C 1SYCA 3MA2B 2C5CA 1S5FD 1F2MA 1G8ZD 1HTLD 1X32A 4IFDI 1ONLA 3SR1A 1B44D 3PUZA 5I9OA 4WJWA 2GA4B 5FOBB 1VF5C 1TWAB 4A3DB 1SE4A 1SDFA 5AFWA 4V190 1OXVA 3QWNA 1SYGA 1JC7A 1MGSA 4IFDG 2F0MA 2KEEA 1QG7A 2F0TA 2F0LA 2F0IA 3QB3A 5JVH3 2N55A 5KYIA 4RGNA 5BN5A 2MP1A 1GUOA 4UDUC 4IUUA 4A3KB 1LACA 2ZT9C 4FXGC 1O7YA 1HFGA 1EY5A 3HOUB 2I07B 2NTTA 2H4OA 3J81L 1ESRA 3SHLA 1SJED 1SNCA 1ILPA 2EJGC 3LWUA 5A35A 2F0JA 1R9TB 1YNNC 3PUXA 3EFXD 4X3SA 4S3SA 2O5JC 3DUZA 1C4QA 2K5DA 3PIP3 1EZ8A 1HTPA 4BBSB 3BZDB 1FGBD 2AQ3B 1WTRA 1G91A 2WB1B 1KDAA 1RJTA 3CU7A 4K8IA 4J1MA 4EGVA 2F0PA 5C0XI 3FEWX 2L0CA 3OW7A 1R4PB 3TN2A 1MD2D 1JB3A 2F1MA 2F0EA 1CM9A 4NP5A 3S1NB 4G57A 2F0SA 2RDGA 1SE2A 5EQ0A 1PRTD 3J80L 1U4MA 1H9KA 4CBVA 3Q24A 2Z8LA 1QE6A 2ENBA 5M5YB 2EE1A 4E6IA 2NBFA 4Q5VA 2K04A 2IW3A 4XTCS 2IX0A 3P75A 3WDNA 2PW7A 3H09A 1LABA 2ICEC 4G7ZC 1LTTD 1QWYA 1D1IA 3TP8A 2BOSA 2F0QA 1PDQA 4TQUS 3IAYA 3TZDA 5KRUA 4LK1C 1TVXA 2K32A 2F0GA 3RZOB 3NQTA 4QIWB 4CJ0B 1SJHD 2XSCA 1TY2A 1V1PB 5IGEA 1F2LA 1DXMA 3S1RB 2KUMA 4KTAA 4C3JB 2R3ZA 3P1HA 2DY8A 1DOKA 4RWSC 3RMHA 5IT9E 2JA7B 3S1MB 1A2UA 3BVGA 3K7AB 1R4QB 2KQ3A 1SNMA 1MI2A 5C4ZA 3MXUA 3PUVA 5ELFA 2F0NA 3URYA 4N9TA 4LJZC 4FP5D 5FLXE 3DWQA 1XYIA 1CZWA 1KNAA 3A55A 4HAEA 3GTQB 4J6HA 5D14A 1F9SA 2AWOA 1D2BA 3HEJA 4K14A 1QNUA 4KY7A 2ZXPA 3FDTA 4NMZA 4IUTA 4KHZA 4BY7B 2J7ZA 3ZYYX 4ID6A 1D5MC 4HCSA 4H44C 4DN4M 1STHA 1B9NA 2IT1A 3CQZB 1OXUA 1ESFA 2EYFA 4ZAIA 2EY2A 3TP6A 3M4OB 3PIO3 1S5CD 5IGGA 5IGBA 3ITPA 4RGMA 5K5PA 1Q90A 1IYVA 1BO0A 3F2UA 3FKIB 5C4XB 1XXGA 5CC4A 4NDXA 5COYA 2XVSA 2K5WA 1X3QA 1RCVD 1FNUA 2BCOA 1PZID 3LX0A 1BBXC 4TKOB 2VUMB 1EY6A 3TMEA 4ZK9B 1WTXA 3A7AB 3ERQA 1E2WA 2AUJD 1EOTA 4A3JB 3BVMA 1CQFA 2EYJA 1LTAD 1TWFB 3X3MA 5FO8B 3VYUA 2NUCA 2PQEA 2XRQD 2L4NA 4KI0A 5I6WA 2RDHA 5HGTA 2HDMA 1AP0A 2NN6I 3A54A 1Q3LA 2PO4A 3C3LA 2KVMA 4QMGA 3DEPA 1KNEA 2VNUD 1STEA 3KK7A 1GJXA 1HPCA 1F2ZA 2D9UA 3EROA 3K6OA 5I2XA 1SYDA 3SK8A 3S16B 3GTPB 2KCNA 3OMCA 2B2YA 5KEEA 3HG9A 3U9SA 1I6HB 1UUPA 5CBEE 4K5XA 1TT2A 5DM73 4KY5A 3H3VC 4OO1H 2WAQB 2CW0D 2B8GA 1EY8A 2EJMA 1BQQT 1I4QA 3C1EA 1CA5A 3FMCA 5J39A 2A68D 4HN7A 2F03A 3AB9A 3NTHA 5C44B 1T5EA 4F7XA 2NTSA 3LWEA 2RKSA 3R2IA 1FR3A 4DK1A 3FVQA 5KYLA 1A2TA 5EGTA 5BN4A 4KK7A 3KBGA 4FXDA 2R7ZB 2R61A 1XTCD 5EKIA 3W3AA 2CW0C 1GUGA 3QG1A 4ZKCB 1ICWA 4DGZA 3C2PA 3FPUB 4FO2A 3M3YB 1B50A 2DY7A 5CYUA 4OIJA 2B2YC 1VDZA 1EYDA 5CORA 3FRPB 2A68C 1EWCA 3HOWB 5CV6A 1O78A 2BDNA 1ET6A 1BDOA 1E2ZA 2K5QA 2EY6A 2WP8J 5JVG3 1O7ZA 4Y7NB 3I3CA 5E3FA 3K0YA 1SYEA 1Y8PB 3MWYW 3NBHA 4WORA 1LT4D 3BDLA 1EY7A 3NTKA 2K28A 1DONA 3KF8A 2Z4IA 4IUVA 5E1FA 5C3WA 3OHXC 4H0LC 1SEBD 4X3TA 4BWGB 1FNVA 1D5XC 4KMUC 1AEXA 3G6JB 1L0YB 2AQ2B 1W6JA 2R6GA 4J8QA 3SK6A 4JBWA 4K8JA 1GHJA 4PMBA 2DN8A 4RCNA 1CZGA 4KHVA 5EKLA 1WD1A 4RFBA 3PV0A 5ISRA 1GUSA 3P7JA 3TP7A 1Y69U 3I4LA 3X3NA 3MTSA 1TS2A 3NE5B 4IQZA 1IKMA 1I4HA 1Y1VB 3QIAA 1W6KA 4F8MA 2NVTB 5EBCA 1Q1BA 5M9OA 3CRLC 2M2LA 1B53A 4L8JA 3DXJC 1GHKA 2L1BA 1YNND 1I3QB 3SK4A 1C48A 1WTWA 3DWPA 2DNEA 1ZYRD 2KCCA 3ND9A 2R92B 1RDPD 1Y8OB 1EQTA 3BYTB 2V4DA 1FD7D 1NR4A 5JEAH 2Q8RE 1U4PA 1JOKA 1NUCA 1SNDA 3HOZB 5IGFA 1QJOA 4CHTB 4PNYA 3LNNA 1X3PA 2RVLA 1CHPD 3RD4A 3Q22A 3OPOA 2EYLA 5G3LD 2L5TA 2YYZA 1G2SA 4P2CB 3I72A 2VXWA 1EU4A 1RHPA 4LAAA 3VYSA 1AFPA 5M3MB 1I4RA 3OSOA 1B9MA 1EU3A 2CHBD 4KJOA 4BBRB 2XWBB 5JPNC 1LTSD 2MHVA 2Q8IB 4ABNA 1IL8A 4NW2A 1Q1EA 1ZYRC 2EY1A 3JAME 3HOVB 5JAVA 4DXGA 1V1OA 5JPMC 2FJ2A 5EJWA 3KBXA 5I2YA 3T4AC 1BUVT 4L6TB 1PZJD 3E5SA 2BA0A 5CV7A 1HQMC 5M3FB 2F3VA 5KGUA 4HCEA 3GTLB 4DFAA 1IHZA 5CGKA 2G9DA 1AZQA 2TMPA 2JP1A 1QILA 4AYBB 2D62A 3GTJB 2JSOA 2E2IB 1TWGB 1JE4A 2O4XA 3OWFA 3I90A 1BCPB 1J9OA 5A2QE 3A8JE 5IODA 4A3MB 2EYPA 4HMJA 1SSOA 3NBIA 3NWTA 4XDXA 4PV1C 1H9SB 2D5DA 1O80A 4K2KA 1DOLA 5IGCA 2A69D 1DZ1A 5IOCA 2F0DA 4ODGA 4JK1C 2O5IC 2JEAI 2EYHA 1EIHA 2AQ1B 1SNQA 3M7NA 3HRZC 1I4XA 2MGSA 1E2VA 3J7AV 1C8CA 5C5MA 4HR7B 4FF1A 4IN3A 5JEAJ 1EEID 4G4KA 4IUNA 1TU2B 2NYZD 2XWJB 2EDGA 4CJ1B 3EA6A 4C3HG 4CKCA 3AMUA 4G7HC 4Z9CB 1H9SA 4L63B 1JWSD 5FKAC 2LY7A 1ZXTA 1TS3A 1OXSC 3GTOB 2NVXB 3T53B 3O13A 1SYFA 2A69C 1PTOH 5D3DA 3E0JA 2HCCA 3I73A 3PUWA 3TBIB 3BS1A 1AW7A 1F9PA 1DJRD 1LLRD 4RA8A 2ZXRA 3T13A 5I6YA 1V1PA 4EQOA 1GUWA 3SE0A 2L12A 1QB5D 5IIFA 2F0UA 3H6MA 2E2HB 2E2JB 2YU9B 2X69A 3H91A 4IFDH 1SXTA 2FINB 3BG3A 2JE6I 3WOEA 1PTOB 2LS01 4G7OC 1H9MA 1EFID 3N52A 3MVVA 2B2VA 3GV6A 1HFNA 4RH6A 3T16A 1EEFD 1T5XD 3UI2A 1ET9A 4ZQ3A 2BDOA 4FF3A 1RTOA 3BDOA 3MAQA 4XT3B 2AWNA 1GOZA 5K36G 3M4YA 3S2HB 4R8NA 2N88A 2F0KA 5G3LF 4KKTA 5LL6S 2KJXA 1WTPA 2IWHA 2O2LD 2JYOA 3VR2A 1O7LA 2PCFB 4HSPA 4CGYB 1I6VC 1PLFA 1HUMA 3L9AX 1FNWA 1S4ZA 4OGQC 1STAA 2XRSD 3MXGA 4WRDA 1EL0A 3ND8A 2KA7A 4XQNA 1HQRD 3E6ZX 4BY1B 1K8OA 5KNBA 2A6ED 1YNJD 3V96A 4RKBA 3I8ZA 2E76C 2B2VC 3CHBD 1JORA 3PUYA 4MN3A 2IX3A 3Q6SA 1CT1D 4OIKA 1V43A 1F9QA 2K33A 2IPKD 1G291 2OXPA 3DWAA 1JQYD 2CQAA 1B1ZA 1HXYD 2F3WA 3QJYA 5C0XH 4ZRZA 1V8QA 2F0WA 3P20A 1VMPA 2JEBI 2PZWA 1ZEQX 4ZLTF 5CV8A 2A74C 2L11A 5JEAG 4U673 5CV5A 4KV6A 4A3IB 1SNOA 3DMUA 1PTOC 3MXNA 2IJ0A 1JICA 3VR6A 2EOTA 3SEBA 1JCKB 4K5WA 3W2DA 3TP5A 4EVOA 1DM0B 2M00A 2A6EC 5LHY1 1YNJC 5DEHA 4ZKBB 1PXUA 1UAPA 2G9HD 1B3AA 2Z4HA 3HP3A 1QNKA 3TDQA 2EY5A 2F4IA 5J1ZA 1WTVA 2ICIA 4FNFA 1NR2A 4IUQA 2Q8TA 4Q0FA 3KLSX 5ELBA 1LT3D 1Y1WB 1LTBD 5EBDA 3TZUA 2PZUA 4H7BA 3EVQA 1TQOA 3K5LA 3NK9A 3EJIA 4YIJA 4M1UB 1IW7C 2QKIC 3K57A 1CI3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8R E;  1PDQ A;  2X6G A;  1ESR A;  1SSO A;  1U4P A;  1O7Z A;  2B2Y A;  2RSO A;  4HCS A;  4MN3 A;  5EPL A;  1ILP A;  4X3U A;  2FFK B;  3TZD A;  3Q6S A;  1RTN A;  3I3C A;  1XX8 A;  4OIK A;  4XDX A;  4DN4 M;  1MSG A;  1F9R A;  3MWY W;  2HDL A;  1MSH A;  2X69 A;  3IFD A;  3H91 A;  1TVX A;  4IUP A;  1F9Q A;  1X3P A;  2SDF A;  4X3K A;  4QUF A;  2RVL A;  3SVM A;  1B4O A;  4HED A;  1O80 A;  2FIN B;  1DOL A;  4X3S A;  4ZAI A;  5CBE E;  4CJ0 B;  2FHT A;  4RAU C;  1WVL A;  2X6L A;  2H1E A;  3GV3 A;  1DZ1 A;  2K03 A;  1PFN A;  4HSV A;  2B2T A;  2B2W C;  2K28 A;  3N52 A;  1WTQ A;  2IL8 A;  2B2V A;  1EIG A;  3GV6 A;  1G2S A;  4LMQ D;  1LV9 A;  1VMP A;  1DON A;  1HFN A;  1HUN A;  1HRJ A;  1F2L A;  4IUV A;  2B2U C;  1PFB A;  4ZLT F;  2VXW A;  1EIH A;  2RA4 A;  3I91 A;  4X3T A;  2L11 A;  1RHP A;  1CA5 A;  1WTR A;  2RSN A;  3QO2 A;  4XT1 B;  4R8I A;  1G91 A;  2L9H A;  1AZP A;  2KUM A;  2R3Z A;  2KEC A;  1BO0 A;  1RJT A;  2NWG A;  3F2U A;  2XIW A;  3UI2 A;  2DY8 A;  2MGS A;  1DOK A;  1C8C A;  1JIC A;  4RWS C;  4R9W A;  2EOT A;  3IL8 A;  5COY A;  1RTO A;  1X32 A;  5E4W C;  5T1G A;  4CJ2 C;  3LWE A;  4QUC A;  1IKL A;  2B2W A;  4MHE A;  4XT3 B;  2NYZ D;  3D6W A;  1X3Q A;  1IL8 A;  4ZKB B;  4CJ1 B;  4NW2 A;  2B2U A;  1BBX C;  3DEO A;  2N88 A;  1M8A A;  5CMD A;  1B3A A;  1DOM A;  1WTP A;  3TN2 A;  5JJZ A;  1WD1 A;  1VMC A;  4ZK9 B;  3P7J A;  2JYO A;  2MJ8 A;  1WTX A;  1SDF A;  1CM9 A;  3HP3 A;  2HUG A;  5AFW A;  2FJ2 A;  1QNK A;  1MI2 A;  1ZXT A;  2FMM A;  5EJW A;  1U4L A;  3KBX A;  1EOT A;  2KED A;  3MTS A;  1ILQ A;  5EQ0 A;  1ROD A;  1MGS A;  2CVR A;  2KOL A;  3G7L A;  5EPJ A;  2KEE A;  1NAP A;  1NCV A;  1QG7 A;  1U4M A;  3DM1 A;  5EPK A;  1WTV A;  1IKM A;  1XYI A;  4UAI A;  5EKI A;  1SAP A;  5E4X A;  1QE6 A;  3R93 A;  4U68 A;  1KNA A;  4ZKC B;  1ICW A;  2EE1 A;  1CA6 A;  1NR2 A;  1PLF A;  3FPU B;  2HCC A;  4IUQ A;  1HUM A;  2Q8T A;  1B50 A;  1HA6 A;  1B2T A;  2DY7 A;  1U4R A;  3ONA B;  1WD0 A;  2L4N A;  2M2L A;  1B53 A;  1S4Z A;  2K04 A;  4HAE A;  4OIJ A;  2L1B A;  2B2Y C;  2N55 A;  5D14 A;  1G2T A;  2HDM A;  4IUR A;  2EPB A;  1AP0 A;  1F9S A;  5CBA E;  1J8I A;  1Q3L A;  1F9P A;  2MP1 A;  3KUP A;  1BNZ A;  1AZQ A;  1EL0 A;  2K05 A;  2KVM A;  4IUU A;  4RA8 A;  5COR A;  2JP1 A;  2K01 A;  3DEP A;  1KNE A;  5DNF A;  2MPM A;  5D65 A;  1GUW A;  1O7Y A;  2L12 A;  3FDT A;  1HFG A;  1JE4 A;  1A15 A;  2BDN A;  2HCI A;  1WTW A;  3I90 A;  1BF4 A;  2D9U A;  1G6Z A;  2K1B A;  2NZ1 D;  4IUT A;  1PFM A;  1J9O A;  3I8Z A;  4O42 A;  2B2T C;  5T1I A;  1WTO A;  2B2V C;  2J7Z A;  1E0B A;  1EQT A;  1NR4 A;  1HHV A;  1ML0 D; 
#chains in the Genus database with same CATH topology
 1EY4 A;  4I65 A;  3ULP A;  4UPA A;  2K5V A;  2Q2U A;  3GD7 A;  3D31 A;  1KXL A;  1XX8 A;  3AYH B;  2PI2 A;  2JA6 H;  4X3K A;  1Q8I A;  1H9J A;  1B4O A;  2WAC A;  3QOL A;  1KAA A;  4DAY B;  5IWA L;  1WVL A;  2FMC A;  2K03 A;  2VW9 A;  1BBU A;  3JAM i;  4B3T L;  1G6Z A;  4OHJ A;  1ENC A;  4FXK C;  3SDZ A;  1EIG A;  1B3Q A;  5C5L A;  4ME5 A;  2PQA A;  1VQ9 A;  1PFB A;  5C4J H;  4NXM L;  1F2Y A;  1BKB A;  5C3E H;  4A93 H;  4DNR B;  1PZK D;  4K6D A;  4XT1 B;  1U9R A;  2R7D A;  2HIV A;  3K0X A;  3CC7 A;  1DCZ A;  5ELE A;  2CKZ B;  4KJN A;  3GO5 A;  4V0B A;  3T1H L;  1STG A;  1A3V A;  3BYY B;  4PQX A;  4A3L G;  4C3J G;  1Q12 A;  3D3R A;  4O1N A;  5T1G A;  1CFM A;  5IT9 L;  3RZD B;  3JAM c;  4IZ8 A;  1LTI D;  3TRE A;  4JOI A;  2NVQ H;  1VQ8 A;  3NTI A;  4KD4 A;  1M8A A;  3RR5 A;  5JJZ A;  1FL0 A;  1FYC A;  2Z6K A;  1PH1 A;  2VQF L;  2JA6 B;  2JA7 G;  5M5X H;  5C0X J;  5NUC A;  5FLX L;  4C1N I;  3I4N H;  3I4M H;  4DV7 L;  2ATW A;  1SMY D;  3NP8 A;  1X9N A;  3KLR A;  1ILQ A;  4HTH A;  3D6C A;  3L2P A;  5CR3 A;  1A3U A;  2RDF A;  4YCW A;  3OOC A;  3C1F A;  5C4J B;  5J22 A;  3S2D H;  1CA6 A;  3KJO A;  5C3E B;  3H3V I;  3J7A 5;  1VQ5 A;  4A93 B;  1B2T A;  3TEH B;  2F0O A;  3OIQ A;  1RF2 D;  1JOQ A;  1F77 A;  1SNP A;  4IUR A;  1UNS A;  2EPB A;  3F8T A;  3VYR A;  3IKJ A;  3KUP A;  2CWA A;  1OXX K;  4ZUI A;  4ILW A;  4HID A;  1PH6 A;  3VA5 A;  4IAL A;  1K8M A;  4DV5 Q;  4A3C G;  4DNT B;  1VCI A;  1JWM D;  1SR3 A;  2CWP A;  3M7G A;  3NXW A;  2F52 A;  2LMC B;  1TWC H;  2NVQ B;  5T1I A;  3TRZ A;  1TXY A;  2OF1 A;  1E0B A;  3LGJ A;  1AE3 A;  4LF4 L;  2EZV A;  5EAY A;  4BY7 G;  3NPP A;  1DYQ A;  2XNA C;  2AUK A;  2ASB A;  5M5X B;  4B9X A;  3I4M B;  1G6P A;  3I4N B;  1CSP A;  1MSG A;  2UUA L;  3CCS A;  1E1T A;  4FDB A;  3S9W A;  5BR8 Q;  1Q86 C;  3MHB A;  3G6E A;  1DD2 A;  4DUZ Q;  1PTO F;  1SMY C;  2LSS A;  2X6L A;  3GV3 A;  2Z9H A;  3WOF A;  4HSV A;  2F0H A;  3L3O C;  1WTQ A;  5CV9 A;  3S2D B;  1WCM H;  3Q0A A;  1UEA B;  1Q46 A;  4H13 C;  4OWX B;  3MFG A;  2NZH A;  5ELC A;  3KDF A;  3OMG A;  2EVB A;  4OWW B;  1SRU A;  2P5Z X;  2VB3 X;  4GN3 B;  3MXP A;  1PH2 A;  2XIW A;  4R4I A;  3UDI A;  3SXH A;  5IYD H;  1OO9 B;  1GXD C;  1VQN A;  1MJC A;  4NB3 A;  4ME3 A;  1TWC B;  3GTM H;  4CJ2 C;  4DV6 L;  2WFW A;  3S14 H;  1CHQ D;  3FKI G;  3K5N A;  5C4X G;  2E75 C;  2Y0S B;  3D6W A;  2A6H D;  2JA8 H;  4A4I A;  2RBM A;  3DEO A;  1YI2 A;  4LF7 L;  2EQS A;  5CMD A;  2NN6 H;  1DOM A;  1X56 A;  2WIN B;  1EYC A;  2NB0 A;  5IGD A;  2VUM G;  4QB4 A;  2BA1 A;  3R8B A;  3NQI A;  1EQQ A;  5EKK A;  4YY3 Q;  4HIM A;  3DM1 A;  5FO9 B;  1WCM B;  4R4O A;  4A3J G;  4K2L A;  5GRO A;  1PRT B;  3NHH A;  3A5Z B;  4DXF A;  4XXE A;  1KAB A;  2EJF C;  4C56 C;  5LL6 X;  1OXT A;  1LO5 D;  1S5B D;  3H0G H;  1KC8 C;  3MFY A;  4BXX G;  2LKV A;  3HOX H;  3GTM B;  1Z9F A;  3NUC A;  3S14 B;  3S1Q H;  1PYW D;  2WKC A;  1L1O A;  3CD6 A;  3UDF A;  1JJ2 A;  4O42 A;  2JA8 B;  4DAM A;  3A0J A;  4X6A H;  3V05 A;  2YTY A;  1FJG L;  1VQC A;  2A6H C;  5BN3 A;  3RLN A;  1VF7 A;  2Z6B A;  4FF4 A;  2A8V A;  4RHS A;  4JPB W;  2FFK B;  1JOO A;  3HKZ B;  1EFW A;  4IPH A;  1MSH A;  3IFD A;  3V2T A;  2EXZ A;  2SDF A;  3D4D A;  4DF7 A;  3FPP A;  2QIL A;  4A3I G;  2FHT A;  4RAU C;  4C3I H;  1I94 Q;  2H1E A;  3IFT A;  1U0L A;  3S17 H;  1EYA A;  2WAQ G;  1K83 H;  2EYO A;  4JI2 Q;  4KHP Q;  4LUV A;  5GAG C;  1SYB A;  5IP7 H;  3PO3 H;  1AZP A;  3TSS A;  2QEX A;  2ES2 A;  3HGB A;  3H0G B;  1HCZ A;  4A3F H;  2NWG A;  3HOX B;  4R9W A;  3ER0 A;  3S1Q B;  4LFB L;  4BA1 I;  4DV4 L;  2OEO A;  3A8I E;  1ICF B;  1A62 A;  3HS0 C;  2ZJR A;  4DV1 Q;  4OO1 I;  2YTX A;  1STB A;  4DV2 L;  3PGZ A;  5C44 G;  4RGO S;  4R4C A;  2F4V Q;  5C0X G;  3A74 A;  5C4H A;  1FGU A;  3CCV A;  1N32 L;  4B9W A;  2K6A A;  2K7V A;  4K5V A;  3CP0 A;  4XYO A;  4FVM A;  3K59 A;  2SEB D;  4PMC A;  1B8A A;  4P73 A;  1VMC A;  5FLM G;  3MEH A;  2K5H A;  1X6O A;  1U4L A;  1Y1W G;  1KLG D;  3VYT A;  4C3I B;  1LYL A;  3HOY H;  4B3R Q;  3CXC A;  1GUT A;  4C2M H;  5EPJ A;  3S17 B;  1NAP A;  1D6E C;  4XQQ A;  4OO1 G;  1EWH A;  1K83 B;  2EIF A;  1VQA A;  1VQO A;  4M8A A;  4DUY Q;  5FO7 B;  2R7Z G;  1L2F A;  4ZCK A;  3H94 A;  1PH7 A;  1CKO A;  1Z47 A;  2E74 C;  3AFP A;  3D4R A;  3PO3 B;  1QVF A;  2QCP X;  3TS2 A;  3RUZ A;  3NWS A;  4LF8 L;  2PW5 A;  4A3F B;  3A5U A;  4L5S A;  4LF9 Q;  2DUD A;  1BCP D;  3GTK H;  5DNF A;  1A3T A;  2MPM A;  3I70 A;  3S15 H;  2A5H A;  2BE5 D;  1HNZ L;  4YWL A;  1YHA A;  2K1B A;  4JV5 Q;  2VL6 A;  1I4P A;  1PRT C;  1KDC A;  2WII B;  4UP9 A;  2D2C C;  1KTK A;  2PZT A;  2X6G A;  3DHQ A;  4JI7 L;  2E5L Q;  2PNR C;  2OTL A;  3PO2 H;  1EY9 A;  3HKZ E;  1BXT A;  3U9O A;  4MIU A;  1AN8 A;  4DAP A;  1JR0 D;  5IYC G;  5IE8 A;  5DAU A;  3HOY B;  4PMW A;  4TSS A;  4HED A;  3D8G A;  4C2M B;  3EQL C;  1PMR A;  4LF6 Q;  1SFO H;  2MNA A;  4GZY C;  3GQB A;  5HUR A;  1HNW L;  1EQV A;  2TSS A;  2B2T A;  1K0S A;  1HUN A;  1KAW A;  4K6L A;  1QVG A;  2QEJ C;  1HRJ A;  4N8F A;  2I46 A;  2RA4 A;  3K5M A;  1KDB A;  4R8I A;  4ZUJ A;  3GTK B;  1EUJ A;  1N36 Q;  3M85 A;  1CK1 A;  5FJ8 H;  2RHQ B;  3S15 B;  5F2D A;  1BCP C;  2JA6 G;  1EZ6 A;  2MFI A;  1LT5 D;  4L5Q A;  4P74 A;  1ENF A;  5D3I B;  5E4W C;  2LFN A;  4QUC A;  1SBB B;  1IKL A;  2KHS A;  4RGT A;  1II3 A;  1S5E D;  2J0T D;  1PH8 A;  2C9O A;  2BE5 C;  1C9O A;  2B2U A;  2B8F A;  3B6Y A;  4X64 Q;  4DA2 A;  2OT2 A;  3PO2 B;  1I5F A;  4ULL A;  5C3E G;  1XJV A;  4A93 G;  4OL7 A;  2HQL A;  2MJ8 A;  2UUC Q;  4ZYS A;  4DK3 C;  4F88 A;  5C6A A;  1HZA A;  2WKD A;  1TS5 A;  1QOH A;  4WFN 3;  1SFO B;  3KLS A;  4IJL A;  4X66 Q;  4XYQ A;  1S5D D;  5JOB A;  4BS9 A;  2KOL A;  4DV0 L;  5EPK A;  1NCV A;  4F87 A;  1SAP A;  1HA5 A;  1IBL L;  2R7F A;  2K52 A;  1Y8N B;  1HA6 A;  4GN4 B;  2JA5 H;  1U4R A;  1WD0 A;  1CQV A;  3I2Z A;  3L7Z C;  5CBA E;  2IX1 A;  4L5T A;  1BNZ A;  4DAV A;  1M4V A;  2VB2 X;  4QIW E;  4B08 A;  5D65 A;  3J7Y W;  3I4N G;  5AJ3 Q;  3PMF A;  4OX9 L;  1A15 A;  1Z6H A;  3VR5 A;  1BOS A;  2NZ1 D;  3K8A A;  5M5W H;  1Q82 C;  1WTO A;  4AQY Q;  2B2T C;  3QOJ A;  4RKL A;  1TWH H;  4OEM B;  1HHV A;  2F0V A;  1ML0 D;  1KHI A;  2PPB C;  1K9M C;  5LMU L;  1XWE A;  2R92 G;  1W3S A;  2HQE A;  1RTN A;  1PTO D;  1STY A;  4IPG A;  1F9R A;  3VR4 A;  3R3O A;  1IYU A;  3SVM A;  1TR5 A;  2ZJQ A;  4XIG S;  4GOP B;  3BDC A;  2KBN A;  1PFN A;  3F2C A;  1EYG A;  3T56 B;  4KD3 A;  3TQY A;  1VS0 A;  3OIP A;  1JMC A;  1X55 A;  4GS3 A;  4LMQ D;  4PZ6 A;  2JA5 B;  2B2U C;  3L0O A;  1GUN A;  2Y0S G;  5ELD A;  3QO2 A;  2RQX A;  2L9H A;  1QCB D;  2KEC A;  3K7U C;  3UDX A;  3CRK C;  4I7Z C;  4LF5 Q;  3J81 E;  2VQE Q;  3IL8 A;  3JAM L;  5M3M G;  5M5W B;  2NVY B;  1L0X B;  2CCZ A;  4OWT B;  1TWH B;  1H9R A;  4BBR G;  4QF4 A;  3RN5 A;  3OTO Q;  4GKK L;  3A7L A;  3BVZ A;  2DNC A;  5TSS A;  1X54 A;  3Q23 A;  4EQP A;  4HMI A;  4GOP A;  3HOV G;  1CTM A;  2HUG A;  2Z0S A;  4N9P A;  2ZXO A;  1TKW B;  3W5O A;  4XQJ A;  3T51 B;  2CVR A;  5IWA Q;  3G7L A;  1OTC A;  4B3T Q;  4FYD A;  1IW7 D;  3VR3 A;  5E4X A;  2A73 B;  2ID0 A;  2KCT A;  2KHJ A;  4U68 A;  1RD9 D;  3HZX A;  1PRT F;  2JA8 G;  4JI5 L;  3ONA B;  1Y14 B;  3F1Z A;  1UE6 A;  2SOB A;  1KLU D;  4LFA L;  1EOV A;  1NMF A;  4IFD J;  4NKL A;  1J8I A;  1G2T A;  2H5X A;  4A3G H;  2NN6 G;  3T1H Q;  2QF7 A;  5I4D A;  2K05 A;  2MUY A;  1D7Q A;  3GTG H;  3BZK A;  5A2Q L;  2B63 H;  1XNQ L;  1K28 A;  3NEL A;  1BR9 A;  4AYB G;  1BF4 A;  5HY6 A;  3G71 A;  2RCF A;  3PCO B;  1PFM A;  2XN9 C;  4C3H H;  1RIP A;  1VQI A;  4DK0 A;  1UE1 A;  4RCO A;  4EQN A;  3J80 E;  4BA2 I;  2JXM B;  4A3B H;  2RSO A;  5EPL A;  4I7A A;  3AU7 A;  4X3U A;  2SNS A;  1XNR L;  2VQF Q;  5CV4 A;  4A3M G;  2HDL A;  4LUZ A;  1LTR D;  4DV7 Q;  4DU9 A;  3MZ5 A;  5LMN Q;  4QUF A;  4IPC A;  1IBM Q;  2SNM A;  1D1K A;  1BCP F;  4FF2 A;  1JWU D;  1TS4 A;  4UP8 A;  3GP7 A;  1LV9 A;  2MO1 A;  3I7F A;  3C46 A;  4JCV E;  4CKE A;  3K58 A;  1SE3 A;  1NSN S;  3I91 A;  5LMN W;  1V9P A;  4A3G B;  3CPW A;  3FHW A;  1MBY A;  3I55 A;  3GTG B;  4GOP C;  2B63 B;  3A56 A;  3CKI B;  1LTG D;  1TY0 A;  4A3E H;  1TII D;  2CH4 A;  3SK5 A;  2M9V A;  4C3H B;  3AEV A;  1HR0 W;  4MHE A;  2B2W A;  3NBH B;  4C3I G;  2PMZ B;  4DR5 L;  2J4X A;  5IYB H;  4C1N K;  3VA7 A;  4A3B B;  3KF8 B;  5KNC A;  5IP7 G;  3K5O A;  3NSW A;  2UUA Q;  1VQM A;  3PO3 G;  1RKN A;  2HIX A;  5DM6 3;  3MC0 B;  2FMM A;  2AHO B;  2EYM A;  3DLL A;  1EQR A;  2KED A;  2MO0 A;  4KN4 C;  2R93 H;  5ELN A;  1K3R A;  2UUB L;  2UXD L;  1ROD A;  3D4W A;  1I50 H;  3RLF A;  4UAI A;  4JBJ A;  3R93 A;  3I4O A;  1LT6 D;  2QDB A;  1DGS A;  5GAH C;  3A8K E;  4KY6 A;  4JI1 L;  3CAM A;  3WWV A;  4QJF A;  1A6X A;  4A3E B;  4UHV A;  2K01 A;  4DAY A;  5I9P A;  4IOC A;  2L55 A;  3R2T A;  2F0F A;  4DV6 Q;  3HOY G;  2HCI A;  5FK9 C;  5K36 H;  4IJH A;  3N6R A;  1FVI A;  1Z7T A;  4A75 A;  2PYK A;  5DLQ E;  1ENA A;  4LF7 Q;  2E2D C;  4RHR A;  1PHJ A;  1D5Z C;  1X3G A;  1P16 A;  1TWA H;  3OWE B;  4CKB A;  4A3D H;  1H95 A;  4IUP A;  2WV6 D;  2R93 B;  1E7Z A;  4TRD A;  1RL2 A;  1XMQ L;  1VQF A;  3U50 C;  4QCL A;  2PI2 E;  1I50 B;  2Z1C A;  5KIX A;  4KKU A;  2B39 A;  4AH6 A;  1STN A;  3J7A F;  2B2W C;  1I4G A;  2IL8 A;  5KND A;  2RSN A;  1EY0 A;  4KKS A;  1S3O A;  5C3X A;  3PO2 G;  1ZKO A;  4KN7 C;  1SYC A;  3MA2 B;  2C5C A;  4POG A;  3TS0 A;  1S5F D;  4A3K H;  1F2M A;  1G8Z D;  1HTL D;  1SMX A;  1X32 A;  4IFD I;  1ONL A;  3MEF A;  3SR1 A;  2PMZ E;  2DGY A;  1B44 D;  3HOU H;  3PUZ A;  5I9O A;  1E1O A;  1PYS B;  4WJW A;  2GA4 B;  1IXR A;  5FOB B;  1VF5 C;  1TWA B;  3CPF A;  4A3D B;  1VQ4 A;  2JQO A;  1P8L A;  1HNX L;  1SE4 A;  1SDF A;  5AFW A;  4V19 0;  1OXV A;  4DR6 L;  4GLX A;  3QWN A;  1R9T H;  1SYG A;  2D0O A;  5FJ8 G;  1JC7 A;  1MGS A;  4IFD G;  2F0M A;  2KEE A;  1QG7 A;  1NJI C;  1JJC B;  3GDE A;  2F0T A;  3K80 C;  4WJ3 M;  2F0L A;  2F0I A;  3QB3 A;  4BBS H;  5JVH 3;  2N55 A;  4IPD A;  3PIP A;  5KYI A;  4RGN A;  5BN5 A;  2MP1 A;  5L37 A;  1GUO A;  4UDU C;  4IUU A;  4A3K B;  1LAC A;  2ZT9 C;  1YEZ A;  4DV4 Q;  4FXG C;  1O7Y A;  1HFG A;  1G51 A;  4DV2 Q;  1EY5 A;  2LXK A;  3HOU B;  4BY1 G;  4JI6 L;  1WTH A;  2I07 B;  2NTT A;  2H4O A;  4MNO A;  3J81 L;  1ESR A;  3SHL A;  3ZJY C;  2JA5 G;  1SJE D;  1SNC A;  1ILP A;  4B3M L;  1PYB A;  2EJG C;  3LWU A;  5A35 A;  2F0J A;  4HIO A;  1R9T B;  1YNN C;  3PUX A;  3EFX D;  4DV5 L;  4X3S A;  1K8A C;  4S3S A;  3S1N H;  2O5J C;  3DUZ A;  1C4Q A;  2K5D A;  1S40 A;  3PIP 3;  3OW2 A;  2N8N A;  4POF A;  1EZ8 A;  1HTP A;  1EIF A;  4BBS B;  3BZD B;  4QL5 A;  5M5Y H;  2AMC B;  2Q2H A;  4HJ8 A;  1FGB D;  2AQ3 B;  5E7N A;  3F2D A;  1WTR A;  1G91 A;  3FP9 A;  2WB1 B;  3NEM A;  1KDA A;  1RJT A;  4OON A;  3CU7 A;  2I5M X;  4K8I A;  2UXB L;  3E9I A;  3EBE A;  2AKW B;  1N8R C;  1PH3 A;  1HNZ Q;  4J1M A;  4EGV A;  2K14 A;  4JI4 L;  3HKS A;  2F0P A;  5C0X I;  3FEW X;  1N34 Q;  2L0C A;  1M1K C;  4JI7 Q;  3OW7 A;  1R4P B;  4LFC L;  3TN2 A;  1K73 C;  1MD2 D;  2I5H A;  1JB3 A;  1VQG A;  2JJQ A;  2F1M A;  2F0E A;  1CM9 A;  1N33 L;  4NP5 A;  1J6Q A;  4HIK A;  3S1N B;  4G57 A;  2F0S A;  2RDG A;  1SE2 A;  5EQ0 A;  1PRT D;  3J80 L;  1HNW Q;  4DR7 L;  3RZO H;  1U4M A;  1H9K A;  4CBV A;  3Q24 A;  2Z8L A;  1QE6 A;  4O2D A;  1ASY A;  2LXJ A;  4DNI A;  2ENB A;  5M5Y B;  2EE1 A;  4RG1 A;  4E6I A;  3KLW A;  2NBF A;  4Q5V A;  1MHW C;  2K04 A;  3S1R H;  1YJW A;  2IW3 A;  2ZTE A;  2GVA A;  4XTC S;  3E3X A;  1YBY A;  2IX0 A;  4C3J H;  4EX5 A;  3CCJ A;  3P75 A;  3GTO H;  3WDN A;  2PW7 A;  3H09 A;  1LAB A;  2ICE C;  4JI3 L;  4G7Z C;  1LTT D;  1QWY A;  2BH2 A;  2OCE A;  3ULL A;  1D1I A;  3TP8 A;  3RN2 A;  2BOS A;  2F0Q A;  1PDQ A;  1CUK A;  2JA7 H;  4TQU S;  3IAY A;  3S1M H;  3TZD A;  5J3B A;  5KRU A;  4GNX B;  3J81 i;  2JK8 A;  3CCR A;  4LK1 C;  3K81 C;  1TVX A;  3K7A H;  3OYY A;  3CCL A;  1GM5 A;  2K32 A;  4DV0 Q;  2F0G A;  3RZO B;  3NQT A;  4QIW B;  4CJ0 B;  1SJH D;  2QGQ A;  1LTL A;  2XSC A;  1TY2 A;  1V1P B;  5IGE A;  1F2L A;  1DXM A;  2ZTD A;  2KEN A;  3S1R B;  2GVB A;  4JW0 A;  1WJJ A;  4KLK A;  2WB1 E;  3GTQ H;  3J81 c;  2KUM A;  4KTA A;  4C3J B;  1HH2 P;  2R3Z A;  2Q2T A;  2XGT A;  3P1H A;  2DY8 A;  1DOK A;  4RWS C;  1M90 C;  4OX9 Q;  2RHS B;  3RMH A;  3H3V H;  4BY7 H;  5IT9 E;  5LMU Q;  2JA7 B;  3S1M B;  4LUO A;  4HJ9 A;  2MQH A;  1A2U A;  3BVG A;  4JI8 L;  3K7A B;  1R4Q B;  2KQ3 A;  1SNM A;  1MI2 A;  1IBK L;  5C4Z A;  3CQZ H;  3MXU A;  3PUV A;  5ELF A;  4DV1 L;  4A3E G;  4JBK A;  2F0N A;  2C35 B;  3URY A;  4N9T A;  4LJZ C;  4FP5 D;  5FLX E;  3DWQ A;  1XYI A;  1CZW A;  4A76 A;  3J80 i;  3M4O H;  2PNH A;  1KNA A;  3A55 A;  1GO3 E;  1QVC A;  4DR3 L;  5IYB G;  4HAE A;  3GTQ B;  1K8G A;  4J6H A;  5D14 A;  4DV3 L;  4WJ4 A;  1F9S A;  2AWO A;  1D2B A;  4DR2 L;  3PIO A;  3HEJ A;  4K14 A;  1QNU A;  1XPR A;  4KY7 A;  2ZXP A;  3FDT A;  3FKI H;  5C4X H;  4NMZ A;  1XMO L;  5IY0 A;  1KL9 A;  1LUZ A;  2K50 A;  4IUT A;  4KHZ A;  4BY7 B;  3J80 c;  4APV A;  4DR1 Q;  2J7Z A;  1VQP A;  3ZYY X;  5H1S E;  2K5N A;  2IHF A;  4ID6 A;  1D5M C;  2RF4 A;  2QDL A;  4HCS A;  2VUM H;  4H44 C;  4DN4 M;  4LF9 L;  1STH A;  1B9N A;  1QUQ B;  2IT1 A;  3CQZ B;  4JI0 L;  1OXU A;  1ESF A;  2EYF A;  4ZAI A;  3I4M G;  4IOA A;  2EY2 A;  4A3J H;  2K4K A;  3TP6 A;  1JE5 A;  1TWF H;  3M4O B;  1VQ6 A;  4X62 L;  1YJ9 A;  3PIO 3;  3BJU A;  1S5C D;  4JI5 Q;  5JJL A;  5IGG A;  2UXC L;  4LFA Q;  5IGB A;  1MKH A;  3ITP A;  4DR4 L;  4RGM A;  5K5P A;  1JB7 A;  2QA4 A;  1Q90 A;  4BXX H;  1BO0 A;  1KD1 C;  2HD3 A;  1IYV A;  3F2U A;  3T1Y Q;  4A3D G;  3FKI B;  5C4X B;  1XXG A;  1XNQ Q;  2YV5 A;  5CC4 A;  4NDX A;  5COY A;  2XVS A;  1LM0 A;  2ZM6 L;  4K0K L;  2K5W A;  1X3Q A;  1RCV D;  1FNU A;  2BCO A;  1PZI D;  3LX0 A;  1BBX C;  3RLO A;  4TKO B;  2VUM B;  3KF6 B;  1L0W A;  4YHH Q;  3S16 H;  1EY6 A;  1QUQ A;  2N3S A;  3GTP H;  3TME A;  4ZK9 B;  4QY7 A;  1VQE A;  1WTX A;  4PZ8 A;  3A7A B;  3ERQ A;  1E2W A;  2JA9 A;  1PV4 A;  3NEN A;  2AUJ D;  1I6H H;  1N36 L;  1EOT A;  4X65 L;  4A3J B;  3BVM A;  1CQF A;  2EYJ A;  1LTA D;  1TWF B;  2G5D A;  4YCV A;  3X3M A;  1EIY B;  3MXN B;  5FO8 B;  3VYU A;  3HOU G;  2NUC A;  2PQE A;  4NXN L;  2L15 A;  1WCM G;  2XRQ D;  2L4N A;  4KI0 A;  5I6W A;  2RDH A;  5HGT A;  3JC6 6;  2HDM A;  3UE1 A;  1AP0 A;  2NN6 I;  3A54 A;  1Q3L A;  2PO4 A;  3C3L A;  2CFM A;  2KVM A;  1VQL A;  4QMG A;  3DEP A;  1KNE A;  2VNU D;  1STE A;  3KK7 A;  1GJX A;  1HPC A;  5C44 H;  4CDE C;  1F2Z A;  5IYD G;  2D9U A;  3ERO A;  4DR5 Q;  3K6O A;  5I2X A;  1SYD A;  2OWO A;  3SK8 A;  3S16 B;  4NXM Q;  3GTP B;  2KCN A;  3OMC A;  1C0A A;  1YJN A;  2B2Y A;  5KEE A;  3HG9 A;  3U9S A;  1I6H B;  4BBS G;  1UUP A;  5CBE E;  4K5X A;  1TT2 A;  1CSQ A;  5DM7 3;  4KY5 A;  4R4Q A;  3H3V C;  1WFQ A;  4OO1 H;  2UXD Q;  2WAQ B;  3EN2 A;  3HKZ G;  2CW0 D;  3BZC A;  2R7Z H;  2B8G A;  1EY8 A;  4JYA L;  1YVC A;  2EJM A;  4AIM A;  3I56 A;  1BQQ T;  1I4Q A;  3C1E A;  1K3B C;  1CA5 A;  1UWV A;  3M3Y H;  3FMC A;  4JI1 Q;  5J39 A;  2A68 D;  2KHI A;  4HN7 A;  2F03 A;  3AB9 A;  4MTK A;  4HJ7 A;  3NTH A;  5C44 B;  1D8L A;  3CC2 A;  4PZ7 A;  1T5E A;  4F7X A;  4HJ5 A;  2NTS A;  3H0G G;  3HOW H;  2OQ0 A;  3LWE A;  2RKS A;  3HOX G;  3R2I A;  4GN5 A;  1YZ6 A;  1FR3 A;  4DK1 A;  3FVQ A;  2ZTC A;  4MTN A;  1HZC A;  2A1A A;  1J5E L;  5KYL A;  1A2T A;  2PQA B;  1NNX A;  3VDY A;  3HFZ B;  5IYC H;  5EGT A;  3CC4 A;  2I5L X;  5BN4 A;  4Y7N H;  1A8V A;  4KK7 A;  1YIJ A;  4OEL B;  4JBM A;  3KBG A;  4FXD A;  3U4V A;  2R7Z B;  2R61 A;  1XTC D;  5EKI A;  3W3A A;  2CW0 C;  1GUG A;  3QG1 A;  4ZKC B;  1ICW A;  1PVO A;  4DGZ A;  3C2P A;  4LF4 Q;  3FPU B;  4FO2 A;  3M3Y B;  1B50 A;  4P72 A;  2DY7 A;  4B3S L;  5CYU A;  4OIJ A;  2B2Y C;  1VDZ A;  1YIT A;  3QR8 A;  1EYD A;  5COR A;  3FRP B;  2A68 C;  3CCQ A;  1NMG A;  1PH9 A;  1EWC A;  3HOW B;  1JJG A;  4A3F G;  5CV6 A;  1B70 B;  1O78 A;  3AFQ A;  2BDN A;  1ET6 A;  1BDO A;  1E2Z A;  2K5Q A;  4Y52 H;  2EY6 A;  2UU9 L;  1V1Q A;  2OTJ A;  2WP8 J;  3CCM A;  5JVG 3;  1O7Z A;  4Y7N B;  1HNX Q;  4GKJ L;  3I3C A;  5E3F A;  1SN8 A;  3K0Y A;  1SYE A;  1Y8P B;  3MWY W;  4DR6 Q;  1AE2 A;  2WAQ E;  3NBH A;  4WOR A;  1LT4 D;  4P75 A;  3BDL A;  2JN4 A;  3G4S A;  1EY7 A;  3NTK A;  3M4P A;  2K28 A;  1DON A;  1Y1V H;  3KF8 A;  2Z4I A;  4IUV A;  1KQS A;  1VQJ A;  5E1F A;  5C3W A;  3OHX C;  4H0L C;  1SEB D;  4X3T A;  4BWG B;  1FNV A;  3IRB A;  2NVT H;  1D5X C;  4KMU C;  2HHH L;  4H02 A;  1AEX A;  3G6J B;  4YCU A;  1L0Y B;  2AQ2 B;  3J81 j;  1W6J A;  4HJA A;  2R6G A;  1E22 A;  1I3Q H;  4UY8 C;  5LMN L;  4J8Q A;  4JBW A;  3SK6 A;  3PF4 A;  1Q8K A;  4K8J A;  1YHQ A;  1GHJ A;  1IBM L;  4PMB A;  3PQI A;  2DJG C;  4JI6 Q;  4YWM A;  2R92 H;  2DN8 A;  4RCN A;  1HR0 L;  1CZG A;  2I0Q A;  4KHV A;  5EKL A;  1WD1 A;  4B3M Q;  4RFB A;  3PV0 A;  1HZ9 A;  5IP9 H;  1GUS A;  3P7J A;  5ISR A;  3TP7 A;  3HOZ H;  1Y69 U;  3I4L A;  3KDF B;  3RNU A;  3X3N A;  3MTS A;  2EXD A;  4IO9 A;  1TS2 A;  3NE5 B;  4IQZ A;  4TVA B;  4CDD C;  4LNQ A;  2HT1 A;  1IKM A;  1I4H A;  1Y1V B;  2VS1 A;  2CQO A;  1C7Y A;  3QIA A;  1W6K A;  4EQ5 A;  1IL2 A;  4F8M A;  2NVT B;  5EBC A;  1FJG Q;  1Q1B A;  3M4Q A;  5M9O A;  2N78 A;  3CRL C;  2M2L A;  1B53 A;  4L8J A;  4OXP A;  3DXJ C;  1GHK A;  2L1B A;  1YNX A;  4MZ9 A;  1YNN D;  1I3Q B;  1O7I A;  4DPG A;  5GAD C;  4RMF A;  2K75 A;  3ERS X;  2UXB Q;  5M3M H;  5HGQ A;  1WYD A;  3SK4 A;  2B29 A;  1K0R A;  1C48 A;  1WTW A;  3DWP A;  2DNE A;  1ZYR D;  4BBR H;  1VQK A;  4JI4 Q;  2KCC A;  3ND9 A;  3EIV A;  2R92 B;  4JOI C;  1RDP D;  1Y8O B;  1EQT A;  3BYT B;  2V4D A;  1FD7 D;  1HJP A;  1NR4 A;  5JEA H;  2Q8R E;  4LFC Q;  3HOV H;  1U4P A;  1JOK A;  1NUC A;  1SND A;  3HOZ B;  5IGF A;  2Z6K C;  1QJO A;  4QQB X;  4CHT B;  4PNY A;  1N33 Q;  4LW1 A;  3LNN A;  1X3P A;  2RVL A;  2XTI A;  1CHP D;  4L5R C;  3RD4 A;  4LFB Q;  3Q22 A;  3OPO A;  2EYL A;  4DR7 Q;  5G3L D;  4J15 A;  2L5T A;  2YYZ A;  1G2S A;  4P2C B;  1L1O B;  3I72 A;  1N32 Q;  2VXW A;  1EU4 A;  1SRO A;  1RHP A;  4LAA A;  5M3F H;  3E9H A;  3GTL H;  3VYS A;  1AFP A;  5M3M B;  3M9B A;  1GVP A;  1I4R A;  1B9M A;  3OSO A;  1EU3 A;  2CHB D;  3GTJ H;  4KJO A;  2E2I H;  4JI3 Q;  4BBR B;  1TWG H;  2QW7 A;  2XWB B;  5JPN C;  1LTS D;  5IT9 c;  2MHV A;  2Q8I B;  4CDF C;  4ABN A;  1IL8 A;  1B7Y B;  4LWC A;  4NW2 A;  1Q1E A;  1ZYR C;  2EY1 A;  3JAM E;  3HOV B;  5JAV A;  4DXG A;  4A3M H;  1UEB A;  1V1O A;  4LF8 Q;  5JPM C;  2FJ2 A;  1PFS A;  5EJW A;  3KBX A;  5I2Y A;  3T4A C;  5FLX c;  1BUV T;  1UE5 A;  3STB D;  5BR8 L;  4L6T B;  1PZJ D;  3E5S A;  2BA0 A;  4DUZ L;  3DM3 A;  2N49 A;  3ULJ A;  5CV7 A;  1HQM C;  4P71 A;  5M3F B;  2F3V A;  5KGU A;  4HCE A;  3GTL B;  4DFA A;  1IHZ A;  5CGK A;  2G9D A;  1AZQ A;  2TMP A;  2JP1 A;  1QIL A;  1MJE A;  4AYB B;  2D62 A;  3GTJ B;  4CDC C;  2A19 A;  2JSO A;  2E2I B;  1TWG B;  1JE4 A;  1GKH A;  2O4X A;  3OWF A;  1VQH A;  3I90 A;  1BCP B;  4JC0 A;  1J9O A;  5A2Q E;  3A8J E;  2ZJP A;  5IOD A;  4A3M B;  2EYP A;  4HMJ A;  1SSO A;  4JI8 Q;  3KYH C;  3NBI A;  3NWT A;  4XDX A;  4PV1 C;  3G48 A;  1H9S B;  1N9W A;  1NBW A;  2D5D A;  3H15 A;  4A3L H;  1IBK Q;  1O80 A;  3CCU A;  4K2K A;  1DOL A;  5IGC A;  2A69 D;  1VQ7 A;  2NVX H;  1DZ1 A;  2Y0S E;  5IOC A;  2F0D A;  4YY3 L;  4ODG A;  3STB C;  4JK1 C;  2O5I C;  2JEA I;  2EYH A;  2CH4 W;  4DR3 Q;  1EIH A;  2AQ1 B;  1SNQ A;  4DV3 Q;  3M7N A;  3HRZ C;  4DR2 Q;  1I4X A;  4A3G G;  2MGS A;  1E2V A;  3J7A V;  1C8C A;  3U58 A;  1XPO A;  5C5M A;  4HR7 B;  4FF1 A;  1XMO Q;  4IN3 A;  5JEA J;  1EEI D;  1L1O C;  2B63 G;  4G4K A;  4IUN A;  1TU2 B;  3ICE A;  2NYZ D;  2XWJ B;  2EDG A;  2Q2I A;  2GN5 A;  4CJ1 B;  1IBL Q;  3EA6 A;  1QZG A;  4C3H G;  4CKC A;  1NE3 A;  1XPU A;  2E2H H;  4G7H C;  3AMU A;  4Z9C B;  1H9S A;  1WOC A;  4L63 B;  2E2J H;  1JWS D;  5FKA C;  2LY7 A;  2YU9 H;  4A3B G;  4JI0 Q;  1ZXT A;  4A3C H;  1TS3 A;  1WI5 A;  1OXS C;  3GTO B;  2NVX B;  3T53 B;  1BVS A;  4DK6 C;  3O13 A;  1KRT A;  1SYF A;  1I94 L;  1SE8 A;  3HOW G;  4X62 Q;  3F2B A;  2A69 C;  1PH4 A;  1PTO H;  4GLV B;  5D3D A;  3E0J A;  4JI2 L;  2V1C C;  4KHP L;  1N34 L;  1X3F A;  2HCC A;  4GNX A;  1KIX A;  2UXC Q;  3I73 A;  4DR4 Q;  3PUW A;  3TBI B;  3BS1 A;  1AW7 A;  1F9P A;  1DJR D;  1LLR D;  4AYB E;  3CME A;  4RA8 A;  2ZXR A;  3T13 A;  5I6Y A;  1V1P A;  4EQO A;  1GUW A;  3SE0 A;  2L12 A;  1IZ6 A;  2ZM6 Q;  4K0K Q;  1T9H A;  2F3I A;  3PF5 A;  1CKM A;  4UP7 A;  1QB5 D;  5IIF A;  1QZH A;  2F0U A;  2F4V L;  3H6M A;  2E2H B;  4DKA C;  3S2H H;  2E2J B;  5JJI A;  2YU9 B;  3KOJ A;  4R4T A;  2X69 A;  3SGI A;  3H91 A;  4X65 Q;  4IFD H;  1SXT A;  2FIN B;  3BG3 A;  2JE6 I;  2NZO A;  3WOE A;  4B3R L;  2R93 G;  1PTO B;  2LS0 1;  4G7O C;  1PH5 A;  1GD7 A;  1H9M A;  3N52 A;  1EFI D;  3MVV A;  2B2V A;  3GV6 A;  1HFN A;  4RH6 A;  4DUY L;  4NXN Q;  4GKK Q;  3T16 A;  1EEF D;  3W1B A;  1A0I A;  3KJP A;  3UDG A;  3KFU A;  1T5X D;  1UE7 A;  3UE0 A;  3BU2 A;  3UI2 A;  1ET9 A;  4ZQ3 A;  2BDO A;  4FF3 A;  1RTO A;  1AH9 A;  4BY1 H;  1MIU A;  1PA6 A;  3BDO A;  4JG2 A;  3MAQ A;  4XT3 B;  4JV5 L;  2AWN A;  1GOZ A;  1VQB A;  3J7Z C;  5K36 G;  1NY4 A;  3M4Y A;  1U5K A;  3Q8D A;  3S2H B;  1Y1V G;  4R8N A;  2N88 A;  2F0K A;  4GNX C;  5G3L F;  4KKT A;  5LL6 S;  2KJX A;  1WTP A;  2IWH A;  2E5L L;  2O2L D;  2JYO A;  3VR2 A;  1O7L A;  4YWK A;  2IY5 B;  1KRS A;  2BH8 A;  2PCF B;  4LF6 L;  4JYA Q;  2NVY H;  4HSP A;  4CGY B;  1I6V C;  1PLF A;  1HUM A;  3L9A X;  1FNW A;  1S4Z A;  3D0F A;  4OGQ C;  1STA A;  3CCE A;  1XNR Q;  2XRS D;  3MXG A;  4WRD A;  1EL0 A;  3ND8 A;  3PSI A;  1X3E A;  2KA7 A;  5IP9 G;  4XQN A;  1HQR D;  3S24 A;  3E6Z X;  1JT8 A;  3HOZ G;  4BY1 B;  3CMA A;  4A3I H;  1K8O A;  5KNB A;  2A6E D;  2KCM A;  1YNJ D;  4A3K G;  2FXQ A;  3V96 A;  4RKB A;  3I8Z A;  1EWI A;  2E76 C;  2B2V C;  1Q7Y C;  3CHB D;  1JOR A;  1J5E Q;  2D0P A;  2VZA A;  4X64 L;  1A63 A;  3AQQ A;  3PUY A;  4MN3 A;  1XTD A;  1E24 A;  2IX3 A;  3Q6S A;  4GLA C;  5JJK A;  1CT1 D;  4OIK A;  1V43 A;  2UUC L;  1F9Q A;  2K33 A;  3E0E A;  2IPK D;  1G29 1;  2OXP A;  3DWA A;  1JQY D;  2VY3 A;  2CQA A;  1B1Z A;  4X66 L;  5GAE C;  1CKN B;  1HXY D;  2F3W A;  3QJY A;  5C0X H;  4ZRZ A;  1V8Q A;  2F0W A;  1ASZ A;  3KF6 A;  3P20 A;  1VMP A;  4DR1 L;  2JEB I;  2PZW A;  1ZEQ X;  4ZLT F;  5CV8 A;  2A74 C;  2RCN A;  1Q81 C;  2DJF C;  2L11 A;  4B3S Q;  5FLM H;  5JEA G;  4U67 3;  5CV5 A;  2E8G A;  4KV6 A;  1Y1W H;  3CW2 C;  1BBW A;  1SNO A;  3DMU A;  4A3I B;  3CF5 A;  1E3P A;  1PTO C;  3MXN A;  2IJ0 A;  1JIC A;  3VR6 A;  2EOT A;  1YHB A;  3SEB A;  1JCK B;  2WB1 G;  2UUB Q;  4R1J A;  5AJ3 L;  4K5W A;  3W2D A;  3TP5 A;  4EVO A;  1DM0 B;  2M00 A;  2A6E C;  5LHY 1;  4N8X 1;  2YTV A;  1YNJ C;  1IYJ B;  5DEH A;  4ZKB B;  4AQY L;  1PXU A;  2UU9 Q;  1UAP A;  2G9H D;  1B3A A;  4QGU A;  1HZB A;  2OQK A;  4GKJ Q;  5M3F G;  2Z4H A;  3HP3 A;  1CKN A;  1QNK A;  3T1Y L;  3TDQ A;  4JVZ A;  1NTG A;  2EY5 A;  2F4I A;  1X65 A;  4NPS A;  5J1Z A;  1WTV A;  2ICI A;  4FNF A;  4ALP A;  1NR2 A;  4IUQ A;  2Q8T A;  4Q0F A;  1W2B A;  2HHH Q;  4YHH L;  3KLS X;  5ELB A;  1LT3 D;  1Y1W B;  2ALY B;  1LTB D;  5EBD A;  3TZU A;  2PZU A;  4H7B A;  2B3G A;  4PG3 A;  1XMQ Q;  5GQO A;  3EVQ A;  4LF5 L;  1TQO A;  2VQE L;  3U4Z A;  1SLJ A;  3K5L A;  4O0A A;  3NK9 A;  3EJI A;  3RZD H;  4YIJ A;  4M1U B;  1IW7 C;  2QKI C;  3W1G A;  2IHE A;  1HR0 Q;  1VQD A;  5ELO A;  1S72 A;  3K57 A;  3OTO L;  1CI3 M; 
#chains in the Genus database with same CATH homology
 1EY4 A;  4I65 A;  3GD7 A;  3D31 A;  1XX8 A;  4X3K A;  1Q8I A;  1H9J A;  1B4O A;  2WAC A;  3QOL A;  1KAA A;  1WVL A;  2FMC A;  2K03 A;  1G6Z A;  4OHJ A;  1ENC A;  4FXK C;  3SDZ A;  1EIG A;  5C5L A;  4ME5 A;  1PFB A;  1F2Y A;  4DNR B;  1PZK D;  4K6D A;  4XT1 B;  1U9R A;  1DCZ A;  5ELE A;  4KJN A;  3GO5 A;  4V0B A;  1STG A;  1A3V A;  3BYY B;  4PQX A;  4C3J G;  1Q12 A;  3D3R A;  4O1N A;  5T1G A;  1CFM A;  5IT9 L;  3RZD B;  4IZ8 A;  1LTI D;  3NTI A;  4KD4 A;  1M8A A;  5JJZ A;  1FYC A;  2JA6 B;  5C0X J;  5NUC A;  5FLX L;  4C1N I;  1SMY D;  3NP8 A;  3KLR A;  1ILQ A;  4HTH A;  3D6C A;  5CR3 A;  1A3U A;  2RDF A;  3OOC A;  3C1F A;  5C4J B;  5J22 A;  1CA6 A;  5C3E B;  4A93 B;  1B2T A;  2F0O A;  3OIQ A;  1RF2 D;  1JOQ A;  1F77 A;  1SNP A;  4IUR A;  1UNS A;  2EPB A;  3VYR A;  3IKJ A;  3KUP A;  1OXX K;  4ZUI A;  4ILW A;  3VA5 A;  4IAL A;  1K8M A;  4DNT B;  1VCI A;  1JWM D;  3M7G A;  3NXW A;  2LMC B;  2NVQ B;  5T1I A;  2OF1 A;  1E0B A;  2EZV A;  3NPP A;  1DYQ A;  2XNA C;  2AUK A;  5M5X B;  4B9X A;  3I4M B;  3I4N B;  1MSG A;  3S9W A;  3MHB A;  1DD2 A;  1PTO F;  1SMY C;  2X6L A;  3GV3 A;  3WOF A;  4HSV A;  2F0H A;  3L3O C;  1WTQ A;  5CV9 A;  3S2D B;  3Q0A A;  1UEA B;  4H13 C;  3MFG A;  5ELC A;  3OMG A;  2EVB A;  2VB3 X;  3MXP A;  2XIW A;  3SXH A;  1OO9 B;  1GXD C;  1TWC B;  4CJ2 C;  1CHQ D;  3K5N A;  2E75 C;  2Y0S B;  3D6W A;  2A6H D;  2RBM A;  3DEO A;  5CMD A;  2NN6 H;  1DOM A;  2WIN B;  1EYC A;  2NB0 A;  5IGD A;  4QB4 A;  2BA1 A;  3R8B A;  3NQI A;  5EKK A;  3DM1 A;  5FO9 B;  1WCM B;  4K2L A;  1PRT B;  3NHH A;  4DXF A;  4XXE A;  1KAB A;  2EJF C;  4C56 C;  5LL6 X;  1OXT A;  1LO5 D;  1S5B D;  3MFY A;  2LKV A;  3GTM B;  3NUC A;  3S14 B;  1PYW D;  2WKC A;  4O42 A;  2JA8 B;  3V05 A;  2A6H C;  5BN3 A;  1VF7 A;  4FF4 A;  4RHS A;  2FFK B;  1JOO A;  3HKZ B;  1MSH A;  3IFD A;  3V2T A;  2EXZ A;  2SDF A;  3D4D A;  4DF7 A;  3FPP A;  2QIL A;  2FHT A;  4RAU C;  2H1E A;  3IFT A;  1EYA A;  2EYO A;  1SYB A;  1AZP A;  3TSS A;  3HGB A;  3H0G B;  1HCZ A;  2NWG A;  3HOX B;  4R9W A;  3S1Q B;  4BA1 I;  2OEO A;  3A8I E;  3HS0 C;  4OO1 I;  1STB A;  4RGO S;  5C0X G;  5C4H A;  4B9W A;  2K6A A;  2K7V A;  4K5V A;  4XYO A;  4FVM A;  3K59 A;  2SEB D;  4PMC A;  1VMC A;  3MEH A;  1U4L A;  1KLG D;  3VYT A;  4C3I B;  1GUT A;  5EPJ A;  3S17 B;  1NAP A;  1D6E C;  4XQQ A;  4OO1 G;  1EWH A;  1K83 B;  4M8A A;  5FO7 B;  3H94 A;  1Z47 A;  2E74 C;  3D4R A;  3PO3 B;  2QCP X;  3RUZ A;  3NWS A;  2PW5 A;  4A3F B;  1BCP D;  5DNF A;  1A3T A;  2MPM A;  3I70 A;  2A5H A;  2BE5 D;  2K1B A;  1I4P A;  1PRT C;  1KDC A;  2WII B;  2D2C C;  1KTK A;  2PZT A;  2X6G A;  3DHQ A;  2PNR C;  1EY9 A;  1BXT A;  3U9O A;  4MIU A;  1AN8 A;  4DAP A;  1JR0 D;  5DAU A;  3HOY B;  4PMW A;  4TSS A;  4HED A;  4C2M B;  3D8G A;  3EQL C;  1PMR A;  4GZY C;  3GQB A;  5HUR A;  1EQV A;  2TSS A;  2B2T A;  1HUN A;  4K6L A;  2QEJ C;  1HRJ A;  2I46 A;  2RA4 A;  3K5M A;  1KDB A;  4R8I A;  4ZUJ A;  3GTK B;  3M85 A;  1CK1 A;  3S15 B;  5F2D A;  1BCP C;  1EZ6 A;  5D3I B;  1LT5 D;  1ENF A;  5E4W C;  2LFN A;  4QUC A;  1SBB B;  1IKL A;  2KHS A;  4RGT A;  1II3 A;  1S5E D;  2J0T D;  2C9O A;  2BE5 C;  2B8F A;  2B2U A;  4DA2 A;  2OT2 A;  3PO2 B;  4ULL A;  4OL7 A;  2MJ8 A;  4ZYS A;  4F88 A;  5C6A A;  2WKD A;  1TS5 A;  1QOH A;  4WFN 3;  1SFO B;  3KLS A;  4BS9 A;  4XYQ A;  1S5D D;  5JOB A;  2KOL A;  5EPK A;  1NCV A;  4F87 A;  1SAP A;  1HA5 A;  1Y8N B;  1HA6 A;  1U4R A;  1WD0 A;  1CQV A;  3L7Z C;  5CBA E;  2IX1 A;  1BNZ A;  4DAV A;  1M4V A;  2VB2 X;  4B08 A;  5D65 A;  3J7Y W;  3PMF A;  1A15 A;  1Z6H A;  3VR5 A;  1BOS A;  2NZ1 D;  1WTO A;  2B2T C;  3QOJ A;  4RKL A;  1HHV A;  2F0V A;  1ML0 D;  2PPB C;  1XWE A;  2HQE A;  1RTN A;  1PTO D;  1STY A;  1F9R A;  3VR4 A;  3R3O A;  1IYU A;  3SVM A;  1TR5 A;  4XIG S;  3BDC A;  1PFN A;  3T56 B;  4KD3 A;  3OIP A;  4LMQ D;  2JA5 B;  2B2U C;  1GUN A;  5ELD A;  3QO2 A;  2RQX A;  2L9H A;  1QCB D;  2KEC A;  3CRK C;  4I7Z C;  3J81 E;  3IL8 A;  3JAM L;  5M5W B;  2NVY B;  1L0X B;  1TWH B;  1H9R A;  4QF4 A;  3A7L A;  3BVZ A;  2DNC A;  5TSS A;  3Q23 A;  4EQP A;  4HMI A;  1CTM A;  2HUG A;  4N9P A;  2ZXO A;  1TKW B;  4XQJ A;  3T51 B;  2CVR A;  3G7L A;  4FYD A;  1IW7 D;  3VR3 A;  5E4X A;  2A73 B;  2ID0 A;  4U68 A;  1RD9 D;  3HZX A;  1PRT F;  3ONA B;  2SOB A;  1KLU D;  4IFD J;  4NKL A;  1J8I A;  1G2T A;  2NN6 G;  2QF7 A;  5I4D A;  2K05 A;  2MUY A;  5A2Q L;  1BR9 A;  1BF4 A;  1PFM A;  2XN9 C;  4DK0 A;  4RCO A;  4EQN A;  3J80 E;  4BA2 I;  2JXM B;  2RSO A;  5EPL A;  3AU7 A;  4X3U A;  2SNS A;  5CV4 A;  2HDL A;  1LTR D;  4DU9 A;  3MZ5 A;  4QUF A;  2SNM A;  1D1K A;  1BCP F;  4FF2 A;  1JWU D;  1TS4 A;  3GP7 A;  1LV9 A;  3C46 A;  4CKE A;  3K58 A;  1SE3 A;  1NSN S;  3I91 A;  4A3G B;  1MBY A;  3GTG B;  2B63 B;  3A56 A;  3CKI B;  1LTG D;  1TY0 A;  1TII D;  3SK5 A;  2M9V A;  4C3H B;  4MHE A;  2B2W A;  4C3I G;  2PMZ B;  2J4X A;  4C1N K;  3VA7 A;  4A3B B;  5KNC A;  3K5O A;  3NSW A;  1RKN A;  5DM6 3;  3MC0 B;  2FMM A;  2EYM A;  2KED A;  4KN4 C;  1ROD A;  3D4W A;  3RLF A;  4UAI A;  3R93 A;  1LT6 D;  2QDB A;  3A8K E;  4KY6 A;  1A6X A;  4A3E B;  2K01 A;  4DAY A;  5I9P A;  2L55 A;  3R2T A;  2F0F A;  2HCI A;  5FK9 C;  5K36 H;  3N6R A;  1Z7T A;  2PYK A;  1ENA A;  2E2D C;  4RHR A;  1D5Z C;  3OWE B;  4CKB A;  4IUP A;  2WV6 D;  2R93 B;  4TRD A;  4QCL A;  1I50 B;  2Z1C A;  5KIX A;  4KKU A;  2B39 A;  1STN A;  3J7A F;  2B2W C;  1I4G A;  2IL8 A;  5KND A;  2RSN A;  1EY0 A;  4KKS A;  5C3X A;  1ZKO A;  4KN7 C;  1SYC A;  3MA2 B;  2C5C A;  1S5F D;  1F2M A;  1G8Z D;  1HTL D;  1X32 A;  4IFD I;  1ONL A;  3SR1 A;  1B44 D;  3PUZ A;  5I9O A;  4WJW A;  2GA4 B;  5FOB B;  1VF5 C;  1TWA B;  4A3D B;  1SE4 A;  1SDF A;  5AFW A;  4V19 0;  1OXV A;  3QWN A;  1SYG A;  1JC7 A;  1MGS A;  4IFD G;  2F0M A;  2KEE A;  1QG7 A;  2F0T A;  2F0L A;  2F0I A;  3QB3 A;  5JVH 3;  2N55 A;  5KYI A;  4RGN A;  5BN5 A;  2MP1 A;  1GUO A;  4UDU C;  4IUU A;  4A3K B;  1LAC A;  2ZT9 C;  4FXG C;  1O7Y A;  1HFG A;  1EY5 A;  3HOU B;  2I07 B;  2NTT A;  2H4O A;  3J81 L;  1ESR A;  3SHL A;  1SJE D;  1SNC A;  1ILP A;  2EJG C;  3LWU A;  5A35 A;  2F0J A;  1R9T B;  1YNN C;  3PUX A;  3EFX D;  4X3S A;  4S3S A;  2O5J C;  3DUZ A;  1C4Q A;  2K5D A;  3PIP 3;  1EZ8 A;  1HTP A;  4BBS B;  3BZD B;  1FGB D;  2AQ3 B;  1WTR A;  1G91 A;  2WB1 B;  1KDA A;  1RJT A;  3CU7 A;  4K8I A;  4J1M A;  4EGV A;  2F0P A;  5C0X I;  3FEW X;  2L0C A;  3OW7 A;  1R4P B;  3TN2 A;  1MD2 D;  1JB3 A;  2F1M A;  2F0E A;  1CM9 A;  4NP5 A;  3S1N B;  4G57 A;  2F0S A;  2RDG A;  1SE2 A;  5EQ0 A;  1PRT D;  3J80 L;  1U4M A;  1H9K A;  4CBV A;  3Q24 A;  2Z8L A;  1QE6 A;  2ENB A;  5M5Y B;  2EE1 A;  4E6I A;  2NBF A;  4Q5V A;  2K04 A;  2IW3 A;  4XTC S;  2IX0 A;  3P75 A;  3WDN A;  2PW7 A;  3H09 A;  1LAB A;  2ICE C;  4G7Z C;  1LTT D;  1QWY A;  1D1I A;  3TP8 A;  2BOS A;  2F0Q A;  1PDQ A;  4TQU S;  3IAY A;  3TZD A;  5KRU A;  4LK1 C;  1TVX A;  2K32 A;  2F0G A;  3RZO B;  3NQT A;  4QIW B;  4CJ0 B;  1SJH D;  2XSC A;  1TY2 A;  1V1P B;  5IGE A;  1F2L A;  1DXM A;  3S1R B;  2KUM A;  4KTA A;  4C3J B;  2R3Z A;  3P1H A;  2DY8 A;  1DOK A;  4RWS C;  3RMH A;  5IT9 E;  2JA7 B;  3S1M B;  1A2U A;  3BVG A;  3K7A B;  1R4Q B;  2KQ3 A;  1SNM A;  1MI2 A;  5C4Z A;  3MXU A;  3PUV A;  5ELF A;  2F0N A;  3URY A;  4N9T A;  4LJZ C;  4FP5 D;  5FLX E;  3DWQ A;  1XYI A;  1CZW A;  1KNA A;  3A55 A;  4HAE A;  3GTQ B;  4J6H A;  5D14 A;  1F9S A;  2AWO A;  1D2B A;  3HEJ A;  4K14 A;  1QNU A;  4KY7 A;  2ZXP A;  3FDT A;  4NMZ A;  4IUT A;  4KHZ A;  4BY7 B;  2J7Z A;  3ZYY X;  4ID6 A;  1D5M C;  4HCS A;  4H44 C;  4DN4 M;  1STH A;  1B9N A;  2IT1 A;  3CQZ B;  1OXU A;  1ESF A;  2EYF A;  4ZAI A;  2EY2 A;  3TP6 A;  3M4O B;  3PIO 3;  1S5C D;  5IGG A;  5IGB A;  3ITP A;  4RGM A;  5K5P A;  1Q90 A;  1IYV A;  1BO0 A;  3F2U A;  3FKI B;  5C4X B;  1XXG A;  5CC4 A;  4NDX A;  5COY A;  2XVS A;  2K5W A;  1X3Q A;  1RCV D;  1FNU A;  2BCO A;  1PZI D;  3LX0 A;  1BBX C;  4TKO B;  2VUM B;  1EY6 A;  3TME A;  4ZK9 B;  1WTX A;  3A7A B;  3ERQ A;  1E2W A;  2AUJ D;  1EOT A;  4A3J B;  3BVM A;  1CQF A;  2EYJ A;  1LTA D;  1TWF B;  3X3M A;  5FO8 B;  3VYU A;  2NUC A;  2PQE A;  2XRQ D;  2L4N A;  4KI0 A;  5I6W A;  2RDH A;  5HGT A;  2HDM A;  1AP0 A;  2NN6 I;  3A54 A;  1Q3L A;  2PO4 A;  3C3L A;  2KVM A;  4QMG A;  3DEP A;  1KNE A;  2VNU D;  1STE A;  3KK7 A;  1GJX A;  1HPC A;  1F2Z A;  2D9U A;  3ERO A;  3K6O A;  5I2X A;  1SYD A;  3SK8 A;  3S16 B;  3GTP B;  2KCN A;  3OMC A;  2B2Y A;  5KEE A;  3HG9 A;  3U9S A;  1I6H B;  1UUP A;  5CBE E;  4K5X A;  1TT2 A;  5DM7 3;  4KY5 A;  3H3V C;  4OO1 H;  2WAQ B;  2CW0 D;  2B8G A;  1EY8 A;  2EJM A;  1BQQ T;  1I4Q A;  3C1E A;  1CA5 A;  3FMC A;  5J39 A;  2A68 D;  4HN7 A;  2F03 A;  3AB9 A;  3NTH A;  5C44 B;  1T5E A;  4F7X A;  2NTS A;  3LWE A;  2RKS A;  3R2I A;  1FR3 A;  4DK1 A;  3FVQ A;  5KYL A;  1A2T A;  5EGT A;  5BN4 A;  4KK7 A;  3KBG A;  4FXD A;  2R7Z B;  2R61 A;  1XTC D;  5EKI A;  3W3A A;  2CW0 C;  1GUG A;  3QG1 A;  4ZKC B;  1ICW A;  4DGZ A;  3C2P A;  3FPU B;  4FO2 A;  3M3Y B;  1B50 A;  2DY7 A;  5CYU A;  4OIJ A;  2B2Y C;  1VDZ A;  1EYD A;  5COR A;  3FRP B;  2A68 C;  1EWC A;  3HOW B;  5CV6 A;  1O78 A;  2BDN A;  1ET6 A;  1BDO A;  1E2Z A;  2K5Q A;  2EY6 A;  2WP8 J;  5JVG 3;  1O7Z A;  4Y7N B;  3I3C A;  5E3F A;  3K0Y A;  1SYE A;  1Y8P B;  3MWY W;  3NBH A;  4WOR A;  1LT4 D;  3BDL A;  1EY7 A;  3NTK A;  2K28 A;  1DON A;  3KF8 A;  2Z4I A;  4IUV A;  5E1F A;  5C3W A;  3OHX C;  4H0L C;  1SEB D;  4X3T A;  4BWG B;  1FNV A;  1D5X C;  4KMU C;  1AEX A;  3G6J B;  1L0Y B;  2AQ2 B;  1W6J A;  2R6G A;  4J8Q A;  3SK6 A;  4JBW A;  4K8J A;  1GHJ A;  4PMB A;  2DN8 A;  4RCN A;  1CZG A;  4KHV A;  5EKL A;  1WD1 A;  4RFB A;  3PV0 A;  5ISR A;  1GUS A;  3P7J A;  3TP7 A;  1Y69 U;  3I4L A;  3X3N A;  3MTS A;  1TS2 A;  3NE5 B;  4IQZ A;  1IKM A;  1I4H A;  1Y1V B;  3QIA A;  1W6K A;  4F8M A;  2NVT B;  5EBC A;  1Q1B A;  5M9O A;  3CRL C;  2M2L A;  1B53 A;  4L8J A;  3DXJ C;  1GHK A;  2L1B A;  1YNN D;  1I3Q B;  3SK4 A;  1C48 A;  1WTW A;  3DWP A;  2DNE A;  1ZYR D;  2KCC A;  3ND9 A;  2R92 B;  1RDP D;  1Y8O B;  1EQT A;  3BYT B;  2V4D A;  1FD7 D;  1NR4 A;  5JEA H;  2Q8R E;  1U4P A;  1JOK A;  1NUC A;  1SND A;  3HOZ B;  5IGF A;  1QJO A;  4CHT B;  4PNY A;  3LNN A;  1X3P A;  2RVL A;  1CHP D;  3RD4 A;  3Q22 A;  3OPO A;  2EYL A;  5G3L D;  2L5T A;  2YYZ A;  1G2S A;  4P2C B;  3I72 A;  2VXW A;  1EU4 A;  1RHP A;  4LAA A;  3VYS A;  1AFP A;  5M3M B;  1I4R A;  3OSO A;  1B9M A;  1EU3 A;  2CHB D;  4KJO A;  4BBR B;  2XWB B;  5JPN C;  1LTS D;  2MHV A;  2Q8I B;  4ABN A;  1IL8 A;  4NW2 A;  1Q1E A;  1ZYR C;  2EY1 A;  3JAM E;  3HOV B;  5JAV A;  4DXG A;  1V1O A;  5JPM C;  2FJ2 A;  5EJW A;  3KBX A;  5I2Y A;  3T4A C;  1BUV T;  4L6T B;  1PZJ D;  3E5S A;  2BA0 A;  5CV7 A;  1HQM C;  5M3F B;  2F3V A;  5KGU A;  4HCE A;  3GTL B;  4DFA A;  1IHZ A;  5CGK A;  2G9D A;  1AZQ A;  2TMP A;  2JP1 A;  1QIL A;  4AYB B;  2D62 A;  3GTJ B;  2JSO A;  2E2I B;  1TWG B;  1JE4 A;  2O4X A;  3OWF A;  3I90 A;  1BCP B;  1J9O A;  5A2Q E;  3A8J E;  5IOD A;  4A3M B;  2EYP A;  4HMJ A;  1SSO A;  3NBI A;  3NWT A;  4XDX A;  4PV1 C;  1H9S B;  2D5D A;  1O80 A;  4K2K A;  1DOL A;  5IGC A;  2A69 D;  1DZ1 A;  5IOC A;  2F0D A;  4ODG A;  4JK1 C;  2O5I C;  2JEA I;  2EYH A;  1EIH A;  2AQ1 B;  1SNQ A;  3M7N A;  3HRZ C;  1I4X A;  2MGS A;  1E2V A;  3J7A V;  1C8C A;  5C5M A;  4HR7 B;  4FF1 A;  4IN3 A;  5JEA J;  1EEI D;  4G4K A;  4IUN A;  1TU2 B;  2NYZ D;  2XWJ B;  2EDG A;  4CJ1 B;  3EA6 A;  4C3H G;  4CKC A;  3AMU A;  4G7H C;  4Z9C B;  1H9S A;  4L63 B;  1JWS D;  5FKA C;  2LY7 A;  1ZXT A;  1TS3 A;  1OXS C;  3GTO B;  2NVX B;  3T53 B;  3O13 A;  1SYF A;  2A69 C;  1PTO H;  5D3D A;  3E0J A;  2HCC A;  3I73 A;  3PUW A;  3TBI B;  3BS1 A;  1AW7 A;  1F9P A;  1DJR D;  1LLR D;  4RA8 A;  2ZXR A;  3T13 A;  5I6Y A;  1V1P A;  4EQO A;  1GUW A;  3SE0 A;  2L12 A;  1QB5 D;  5IIF A;  2F0U A;  3H6M A;  2E2H B;  2E2J B;  2YU9 B;  2X69 A;  3H91 A;  4IFD H;  1SXT A;  2FIN B;  3BG3 A;  2JE6 I;  3WOE A;  1PTO B;  2LS0 1;  4G7O C;  1H9M A;  1EFI D;  3N52 A;  3MVV A;  2B2V A;  3GV6 A;  1HFN A;  4RH6 A;  3T16 A;  1EEF D;  1T5X D;  3UI2 A;  1ET9 A;  4ZQ3 A;  2BDO A;  4FF3 A;  1RTO A;  3BDO A;  3MAQ A;  4XT3 B;  2AWN A;  1GOZ A;  5K36 G;  3M4Y A;  3S2H B;  4R8N A;  2N88 A;  2F0K A;  5G3L F;  4KKT A;  5LL6 S;  2KJX A;  1WTP A;  2IWH A;  2O2L D;  2JYO A;  3VR2 A;  1O7L A;  2PCF B;  4HSP A;  4CGY B;  1I6V C;  1PLF A;  1HUM A;  3L9A X;  1FNW A;  1S4Z A;  4OGQ C;  1STA A;  2XRS D;  3MXG A;  4WRD A;  1EL0 A;  3ND8 A;  2KA7 A;  4XQN A;  1HQR D;  3E6Z X;  4BY1 B;  1K8O A;  5KNB A;  2A6E D;  1YNJ D;  3V96 A;  4RKB A;  3I8Z A;  2E76 C;  2B2V C;  3CHB D;  1JOR A;  3PUY A;  4MN3 A;  2IX3 A;  3Q6S A;  1CT1 D;  4OIK A;  1V43 A;  1F9Q A;  2K33 A;  2IPK D;  1G29 1;  2OXP A;  3DWA A;  1JQY D;  2CQA A;  1B1Z A;  1HXY D;  2F3W A;  3QJY A;  5C0X H;  4ZRZ A;  1V8Q A;  2F0W A;  3P20 A;  1VMP A;  2JEB I;  2PZW A;  1ZEQ X;  4ZLT F;  5CV8 A;  2A74 C;  2L11 A;  5JEA G;  4U67 3;  5CV5 A;  4KV6 A;  4A3I B;  1SNO A;  3DMU A;  1PTO C;  3MXN A;  2IJ0 A;  1JIC A;  3VR6 A;  2EOT A;  3SEB A;  1JCK B;  4K5W A;  3W2D A;  3TP5 A;  4EVO A;  1DM0 B;  2M00 A;  2A6E C;  5LHY 1;  1YNJ C;  5DEH A;  4ZKB B;  1PXU A;  1UAP A;  2G9H D;  1B3A A;  2Z4H A;  3HP3 A;  1QNK A;  3TDQ A;  2EY5 A;  2F4I A;  5J1Z A;  1WTV A;  2ICI A;  4FNF A;  1NR2 A;  4IUQ A;  2Q8T A;  4Q0F A;  3KLS X;  5ELB A;  1LT3 D;  1Y1W B;  1LTB D;  5EBD A;  3TZU A;  2PZU A;  4H7B A;  3EVQ A;  1TQO A;  3K5L A;  3NK9 A;  3EJI A;  4YIJ A;  4M1U B;  1IW7 C;  2QKI C;  3K57 A;  1CI3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...