1X32A

Three dimensional solution structure of the chromo1 domain of cpsrp43
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
47
structure length
47
Chain Sequence
GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structures of the chromodomains of cpSRP43
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
molecule keywords chloroplast signal recognition particle component
total genus 2
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2005-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x32A00
1A15A 2HCIA 3TN2A 1RTOA 1HFNA 3TZDA 2B2TA 4CJ1B 4IUUA 4OIJA 1F9SA 2FFKB 2HDMA 2RSOA 2L1BA 4XT1B 1AZPA 1BF4A 4DN4M 3D6WA 1PFMA 3IFDA 1IKMA 1DOLA 1MGSA 1RHPA 2EOTA 1VMCA 2L12A 1ZXTA 3G7LA 3I91A 1O7ZA 2DY8A 5AFWA 2L9HA 2X6GA 4MHEA 5D14A 4QUCA 1U4MA 4X3KA 2L4NA 4CJ0B 4XT3B 1KNEA 2RA4A 1VMPA 2K1BA 3I8ZA 2FJ2A 5CBAE 3KBXA 3SVMA 4HSVA 1WD1A 3I3CA 3Q6SA 1LV9A 1F9PA 2HDLA 2KOLA 3QO2A 1JICA 2BDNA 1WTRA 5EQ0A 1X32A 2B2UA 1F2LA 2B2UC 2R3ZA 1HA6A 2KEEA 1XYIA 3HP3A 1WTPA 1HUNA 2VXWA 1ILQA 4R8IA 1S4ZA 2IL8A 3FPUB 1EOTA 1ESRA 1NAPA 3P7JA 5D65A 1BNZA 5E4WC 1IL8A 2D9UA 5COYA 5T1IA 1QNKA 4ZKBB 1HRJA 2B2VC 5EJWA 4IUQA 1M8AA 1EQTA 3LWEA 1B4OA 2K05A 3DM1A 5EPJA 1KNAA 1EIGA 1EIHA 1PFBA 2L11A 4MN3A 2B2TC 2B2YC 1F9RA 1G91A 3F2UA 4QUFA 1CA5A 1AP0A 4OIKA 2NWGA 2MJ8A 3KUPA 2MPMA 1MSGA 2RSNA 1WD0A 1SDFA 1BO0A 2J7ZA 3DEPA 1DONA 4HEDA 4ZAIA 3I90A 1ML0D 1X3PA 1WTVA 5EPLA 2Q8TA 1J8IA 4CJ2C 2M2LA 1U4RA 2Q8RE 5JJZA 3N52A 4LMQD 1WTXA 1CA6A 1CM9A 1WVLA 2K04A 4XDXA 1ILPA 2EPBA 4HCSA 1O7YA 1EL0A 4IUPA 4ZK9B 3GV6A 1HFGA 1O80A 2K28A 3GV3A 1PLFA 2KEDA 1F9QA 2RVLA 5EPKA 2HUGA 2KECA 4IUTA 2SDFA 2HCCA 5DNFA 1B2TA 1JE4A 1QG7A 1RJTA 3MTSA 4UAIA 1IKLA 1HHVA 1AZQA 2JP1A 3ONAB 2EE1A 2X69A 1U4LA 2MGSA 1PFNA 5E4XA 2FINB 2B2WA 2XIWA 1NR2A 1ICWA 3IL8A 2B2WC 4X3UA 1G6ZA 5CMDA 2K01A 2N88A 2DY7A 4R9WA 1WTQA 5CORA 5EKIA 1PDQA 4RA8A 1WTOA 4IURA 1BBXC 1G2TA 1NCVA 4RWSC 4X3SA 1QE6A 5CBEE 2NZ1D 1DOMA 1B3AA 3H91A 1U4PA 1HUMA 3UI2A 1MI2A 4HAEA 4NW2A 1RTNA 1G2SA 1C8CA 1E0BA 4U68A 1B53A 1RODA 1X3QA 2NYZD 4X3TA 4ZKCB 1GUWA 2B2VA 2CVRA 2MP1A 2H1EA 3DEOA 1WTWA 1SSOA 1B50A 2JYOA 1TVXA 2K03A 4IUVA 1DZ1A 2FMMA 5T1GA 2B2YA 2X6LA 1MSHA 1SAPA 2FHTA 4O42A 2KUMA 3FDTA 1NR4A 3R93A 1XX8A 1Q3LA 4RAUC 4ZLTF 1DOKA 2KVMA 2N55A 3MWYW 1J9OA
chains in the Genus database with same CATH superfamily
4DV7L 4GNXA 2FFKB 2R92G 1DOLA 4C1NK 1VQOA 1DM0B 3DXJC 1WJJA 1BXTA 3SXHA 3T13A 2LMCB 1KDCA 1JE5A 2Z4IA 3C2PA 3E9HA 2OT2A 4KHPL 2AUJD 4UP7A 4DV1Q 2XSCA 2PMZE 4HSVA 2JN4A 2A6HD 4LFCQ 3OWFA 1EWHA 2NVQH 5M3MH 4YHHQ 1UE5A 3G48A 3KDFA 3T1HL 1Q90A 1GHKA 3P7JA 1WI5A 1T5EA 3HOVH 1VQ6A 4LF5L 2JK8A 3K80C 2B2VC 2EYHA 4LUOA 1KNAA 1EIGA 4RG1A 5CV7A 3A8KE 4A3DH 2Z6KA 3OIPA 4N9TA 1K3BC 1KRTA 2E2HH 4A3IB 1AP0A 3GTQH 1B44D 3A5ZB 3KUPA 1QVGA 1SE2A 4DNRB 2MQHA 3FKIB 4YWKA 5IT9E 2M2LA 4ULLA 1U4RA 2WB1E 1YVCA 2EPBA 1Y69U 4RKLA 2P5ZX 1AN8A 3RLNA 2YTVA 5A35A 1Y1WG 2HCCA 2KHSA 3LX0A 1UEBA 2F0LA 5FLXE 2NZOA 2X69A 1LO5D 1QVCA 1VCIA 1GKHA 1UEAB 1Z7TA 4DFAA 3IL8A 3VYRA 3CAMA 2NVTB 3E3XA 4R1JA 4C3IH 3K5OA 4J8QA 1R9TB 4IURA 2EIFA 4IPCA 1F2ZA 2LFNA 4IJLA 2NZ1D 4NKLA 3ND9A 4DF7A 5GAGC 2NYZD 2NVXB 2VB2X 3F2CA 2K5QA 2K5WA 5C5LA 2PW7A 1E1OA 4DU9A 3HOWB 5FJ8H 2RCNA 4IUNA 1HNXL 5FO9B 1VQ7A 3QB3A 1KAAA 4DV3L 2DJFC 2KVMA 3CCQA 4A76A 4KN4C 3W1BA 4PMWA 2HDMA 3FKIG 1BF4A 4YWLA 4A3FG 2DGYA 4JOIC 1KD1C 4PMBA 3HOVG 1VMCA 1ZXTA 4DV3Q 4CDCC 1KHIA 1HNXQ 3BG3A 3VR6A 3J7AF 2VNUD 4XT3B 1HTPA 4A3BB 2A5HA 1VQEA 4C1NI 3TP6A 2IX3A 1N9WA 1YNJD 1II3A 4M1UB 1M1KC 2PO4A 4O0AA 5CGKA 1KDBA 1AE2A 1X32A 3NK9A 2KJXA 3HP3A 1GXDC 4R8IA 5EKLA 2NVYH 3J7AV 2XWJB 1CZGA 2JA5B 5COYA 1HRJA 1HR0L 2BDOA 1B4OA 1XMOL 1D2BA 1W6JA 3A7AB 3S9WA 4H44C 1MSGA 4GN5A 4RCNA 4YCUA 2CFMA 1LT4D 4KJNA 4DV5L 1X3GA 1SJHD 2VL6A 3D8GA 2NB0A 3KF8A 5JJZA 2F0QA 3GTOH 3HOXG 1N36Q 2TMPA 1I4PA 3QWNA 4CDEC 1NE3A 3I56A 1DCZA 3I4LA 1RJTA 4OL7A 4PQXA 3PO2H 5IYBG 1LTRD 1A3TA 1N36L 1I3QH 2F0EA 3BDCA 1K83H 3T56B 3T1HQ 1JOKA 2VQEL 4HJ8A 5FJ8G 4F7XA 2ZTDA 4ODGA 1NCVA 3D0FA 4RWSC 1PHJA 2QEJC 2ZTEA 4ZKCB 4DV1L 5C3EH 1X55A 3UDXA 4CGYB 1XMOQ 5CV6A 1SMXA 3PO2B 3MXPA 1YI2A 1C0AA 3KFUA 4NP5A 3K81C 1YHBA 1Q3LA 4DA2A 1HFNA 3TZDA 4UDUC 2FMCA 4DV7Q 1Y1WH 4HIDA 2E2HB 5JOBA 1NUCA 3JAME 1S5DD 1PYWD 2ZXOA 2JA8B 3NTKA 4TRDA 2A69D 1Q8KA 4A3LG 2RF4A 5DEHA 4PNYA 2M00A 2IW3A 3K8AA 1GD7A 3I8ZA 4R8NA 1J5EL 4U673 1CQVA 3GTKH 4L5QA 3NBHA 1FNVA 1I6VC 5C4XG 3KLSA 1MJEA 4B3MQ 1TIID 1UUPA 3EJIA 3I73A 4RHSA 1N34L 1GVPA 4K14A 2C9OA 1HJPA 1SYCA 4YIJA 4A3FH 4C56C 4HIOA 3MXNA 4IUQA 3KF8B 3W2DA 3PO3G 1Q86C 3CD6A 1J6QA 3IRBA 5AJ3L 1SRUA 4IQZA 4ZRZA 1G91A 4JBMA 1IBLL 4OIKA 3PIO3 1YEZA 2JA7B 2HD3A 3J81c 5IYDH 4RGNA 3GTMB 3VYUA 2AQ2B 1TWCH 2A73B 3S24A 4HCSA 3S2HH 1HTLD 1EL0A 3OOCA 4DK6C 1GHJA 5G3LD 2OCEA 4A75A 5ELCA 4O2DA 4HN7A 4IUTA 5FKAC 1B2TA 2HQEA 1D7QA 1CQFA 2ZJPA 1W2BA 3S15H 1KLUD 3S2DB 1N33Q 2UXCL 4LUZA 1H95A 4E6IA 2F3WA 2PNHA 1L0YB 1FD7D 1U0LA 3QG1A 4POGA 1PFSA 2I0QA 4KKTA 1Y1VG 2A6ED 2WKDA 4FF3A 2JA6H 1X3QA 3I55A 1UNSA 2I46A 1STAA 1Y8NB 4KY7A 1S40A 5J39A 1TXYA 4LF5Q 1W3SA 4FP5D 4K2KA 1XX8A 2B3GA 1VQIA 4BBRH 3FPPA 4MZ9A 1EY8A 2LXKA 4UP9A 2RSOA 4DV2L 4DK1A 1I4HA 2EY5A 1PRTF 4LFCL 1B8AA 4B9XA 3WWVA 3A5UA 2QDBA 1JMCA 3GTPB 1VQKA 3E0JA 3KBGA 3KK7A 1LTAD 4FO2A 5LL6X 3GTGH 1IBKQ 1PRTC 4ABNA 1PH2A 2NN6H 1VF5C 4CDDC 2B2UA 1F2LA 4DAYA 1S72A 4A3LH 1STHA 1SMYD 1ESRA 3AFPA 5IODA 4DAMA 4IPHA 1EOVA 5T1IA 3M4YA 2R92H 1V1QA 2K05A 3DM1A 5E3FA 1HR0W 5GADC 2CWAA 3F2UA 3GTJB 2YU9H 3J7A5 3HKSA 2OXPA 5I4DA 3L7ZC 1Q46A 3CRKC 4GS3A 3OHXC 2E5LL 1O7IA 2F0TA 2Q8RE 1HCZA 1HNZL 1I4GA 1CA6A 3I4NB 5G3LF 4JI6Q 4O1NA 2ENBA 3K58A 3GV6A 3VA5A 3HFZB 4FNFA 1PLFA 5C3EB 3M4OB 1KAWA 4B3TQ 1VQFA 1AEXA 1OXTA 2AMCB 3K0XA 1QUQB 4BY1H 2UUBL 3NPPA 1A3UA 2AHOB 1PFNA 1HPCA 1R4QB 2PCFB 3VR5A 4KI0A 4C3HB 1UE6A 1EFWA 1I4XA 1BOSA 3K0YA 2N88A 5KRUA 3F8TA 3PO3H 1PH7A 4X3SA 1TWAH 1DXMA 3GTKB 2LXJA 1U4PA 5CC4A 4GOPA 1UAPA 5IP7G 2VQFQ 1JB3A 3KOJA 2BA0A 3M3YH 1STEA 5C6AA 4A3JH 4X3TA 2B2VA 1PYSB 2KENA 2MP1A 2V4DA 1WTWA 1QB5D 3JC66 3K5LA 4NXNL 1WFQA 1V9PA 2Z6BA 2XGTA 3KF6B 3K7AB 3PMFA 4O42A 5LHY1 3CCRA 4KLKA 4JOIA 4JV5Q 1LLRD 2G5DA 4OO1H 1BUVT 1YBYA 3TP5A 1TR5A 2PW5A 1B70B 3D4WA 4DR2Q 1LT6D 1PH3A 4Z9CB 3DLLA 4JI3L 4BY1B 2R7ZH 3PQIA 1JB7A 1PH5A 1FVIA 5M5YB 2SEBD 2UUAQ 1YNND 2F4IA 4JC0A 1A6XA 3CKIB 1VQDA 4JI0L 5C4JH 3M85A 1K9MC 4OGQC 3L0OA 3WDNA 2HDLA 2QCPX 2WKCA 5H1SE 3PO2G 3I7FA 2KEEA 4A3DG 2UXDL 1HUNA 4OWWB 2M9VA 3NHHA 4AQYQ 4K6LA 2EJMA 5BR8Q 4MTKA 3Q24A 4C3IG 2NN6I 4KKUA 5NUCA 2FXQA 1MJCA 2F4VL 4LFBL 4I7ZC 2EXDA 2B8FA 2K52A 1STBA 4LJZC 2IY5B 1NBWA 3A56A 1E22A 4UP8A 3AQQA 3X3NA 4CJ2C 3NXWA 3BZCA 1Y1WB 4QCLA 4LMQD 1WTXA 1VQHA 4L63B 1TWGB 4HIKA 1HFGA 2PZUA 1E7ZA 3S14H 5IY0A 3EFXD 3CMAA 4G7ZC 4DR3L 1PH9A 1JJGA 5LMUQ 4BXXH 2Q2UA 2K33A 3I70A 2L5TA 4FDBA 2I5MX 1JQYD 1LM0A 5FO7B 5L37A 5CMDA 1I6HH 5IP9H 2JA9A 3SDZA 3SK4A 4C3JH 5C0XI 1CKOA 1OXXK 1BVSA 2DJGC 4LK1C 4JVZA 2UXBQ 1YJWA 2JA5G 1K8OA 1B3AA 5A2QL 1G8ZD 2PPBC 2MO0A 4HTHA 4IPDA 4HAEA 1G2SA 4JYAQ 1N8RC 3VR3A 1UE7A 4LFBQ 4WFN3 1B50A 3W1GA 4XQNA 2E2IB 4IUVA 2HQLA 2RQXA 5FLMG 1MSHA 1SE4A 2WV6D 2I5LX 1D5MC 3A8IE 4A3MH 1K8MA 4RAUC 4DNTB 2K50A 4GN4B 3MWYW 5IYCH 4X66Q 1EIYB 1FR3A 2ATWA 3PUWA 1B9NA 5GQOA 4QGUA 2OEOA 3STBC 3U9SA 1VQ5A 3S15B 1QWYA 2RDHA 3HS0C 1HXYD 3V05A 1A8VA 4JI0Q 4X3KA 2WAQG 4UHVA 2UUAL 3D31A 2N3SA 5C3XA 4X64L 2K1BA 2FJ2A 4BA2I 4DUZL 1XPOA 2OTLA 3M3YB 1LV9A 1SNCA 4BBSB 2UUCQ 5IIFA 4GOPC 2LSSA 1LTBD 2B2UC 1IBML 5M5XH 3BVGA 1V1OA 1WCMG 5BN3A 4JV5L 2A68D 3M7GA 4GLVB 2QILA 2VY3A 4ZUJA 4RKBA 4Y7NB 5J1ZA 3GTPH 1SROA 3JAML 1UWVA 4NXNQ 3GTMH 1OXUA 2A6EC 1IXRA 2EYJA 4RMFA 2E2DC 5BN5A 4ZAIA 1GOZA 3S1MB 1SR3A 2DNEA 2L55A 1LUZA 1E1TA 3MXNB 1EQRA 1PTOH 1Y8PB 4DR4L 2YU9B 5IT9L 1Q12A 1RF2D 4EX5A 3C1EA 2RVLA 4KD4A 2SDFA 5DNFA 4B3TL 1U9RA 1N32L 4BY1G 3DM3A 5M5YH 3QOLA 1QUQA 4HMIA 1X65A 4XQQA 1VQ8A 1W6KA 2AWNA 3H3VC 3BDLA 5ELFA 1WTQA 1SFOH 1PDQA 3R2IA 2D0OA 2VW9A 1K73C 1IW7D 1MI2A 4NW2A 1EWIA 4X62Q 2R93B 1PZKD 1C8CA 2JA8H 2KCMA 2PMZB 3T1YQ 4L8JA 1L1OB 2CVRA 4JI2Q 3ITPA 4JI8Q 1JC7A 1L0XB 2R6GA 3U4ZA 4JBWA 5IP9G 2MHVA 4RGOS 1CZWA 4A3KG 2FHTA 4DR6L 1TS3A 3K7AH 4L5RC 4C2MB 1Y8OB 1KRSA 4BXXG 2J0TD 1ZYRC 1T5XD 2EXZA 4LF8L 5GAEC 2B2TA 2RDFA 2L1BA 4GLXA 1AZPA 4BY7H 1E24A 1KIXA 2EYLA 4KMUC 5D3IB 4ZUIA 3S17H 1IBKL 5IYDG 1HQRD 5C5MA 4CJ0B 1I94L 1QZGA 2ZXRA 1KABA 3D4RA 1A0IA 3SVMA 1K3RA 1B1ZA 4TQUS 3S1NH 4FF1A 4DV2Q 2G9DA 4A3EH 2OQ0A 3I4NH 4QL5A 2Y0SB 2UU9Q 2E74C 1HNWQ 2R7ZB 3C46A 3FHWA 5KIXA 3PF5A 5ELNA 3G4SA 5JVG3 3KLSX 4G4KA 3ULJA 4XIGS 1LTTD 1TKWB 2I07B 4YWMA 3HOZG 2B2YC 1F9RA 1CA5A 3C3LA 2QEXA 4LF4Q 1LTLA 1BO0A 2J7ZA 2D0PA 3K7UC 1VQBA 1H9MA 3CMEA 2A1AA 1FGUA 1A2TA 3CCMA 1Y1VH 1XMQL 4Y52H 2XRSD 3BU2A 5LL6S 4G57A 2KA7A 5C44H 1WOCA 1A62A 1KXLA 2K32A 3RZDH 4UPAA 5K36H 1G291 1JE4A 4L5TA 2WP8J 3BZKA 3VR4A 1PTOC 2PI2E 5CV4A 4K6DA 5C0XH 5JJKA 4KV6A 1I4QA 5E4XA 1D5ZC 3WOEA 1I6HB 2F0IA 1K83B 3MHBA 4X3UA 2C35B 4GZYC 5K36G 3RLOA 4A93B 3S1MH 4ZQ3A 3H3VI 4DUZQ 1IBLQ 3I4OA 4HJAA 3PF4A 4X64Q 4KHZA 1F2YA 4IOAA 2FMMA 1AE3A 2X6LA 3GTJH 3GTQB 1H9JA 1SN8A 3U50C 3MFYA 1H9SA 4P75A 1CFMA 3URYA 4OIJA 4X66L 4XT1B 2G9HD 1VQAA 1IKMA 4ME3A 1RHPA 4DUYL 1JORA 2SNMA 1MBYA 3CCJA 4B08A 4LFAL 3PV0A 5F2DA 2F0JA 4C3IB 1X3EA 1Z6HA 2F3IA 3ER0A 3KLWA 2Q2TA 1LT3D 1D5XC 3D3RA 3F2BA 1E2VA 2VZAA 3MA2B 3A74A 2VUMB 4PMCA 2F0WA 1S5FD 3NTIA 4RH6A 4DGZA 3H0GB 5JPMC 1QNKA 1M8AA 1ZYRD 4QIWE 4A4IA 1BCPD 2B2TC 2OWOA 1EZ6A 5D3DA 5HGTA 5M3FH 2PQAB 4DK0A 3FEWX 1ET9A 2XTIA 2XWBB 3TS0A 2YV5A 3NWSA 5C0XG 2N49A 3M9BA 3V96A 2ICEC 4JBJA 1NMFA 1K28A 1SE8A 3BVZA 1KQSA 3PUVA 1M4VA 3RN2A 3R8BA 1XXGA 1I50H 2ZJQA 5HURA 1AH9A 2F0PA 2F4VQ 1L2FA 4UAIA 1TWAB 5BR8L 1TWFB 1CK1A 3D6CA 3OSOA 5IOCA 1QOHA 2RDGA 2B2WA 4P71A 1PH1A 1FYCA 4BA1I 4BBRB 1X6OA 1EU4A 2UXDQ 2Z8LA 4B9WA 1C4QA 4KD3A 4NMZA 1TWHH 4DV5Q 3ULPA 1NSNS 1WTOA 1G2TA 1LACA 1QE6A 5KNBA 1IZ6A 1PTOB 3H0GG 3UE0A 4P72A 2OTJA 1E0BA 4AYBE 1AFPA 1BCPB 4NDXA 4WJWA 4JBKA 2LS01 2VUMG 1HR0Q 2EYFA 4TVAB 1EYDA 1NR4A 4EQ5A 4G7OC 3P1HA 4R4IA 1VQJA 1RDPD 3OTOQ 2PNRC 4JI4Q 2EYMA 2F0KA 3RR5A 4IUUA 4CDFC 1Q1EA 3PIOA 3HOYB 1JOOA 2BE5D 2EJGC 2HHHL 2F0FA 2L12A 3HOUB 2L9HA 1U4MA 1IYVA 1PH4A 4I7AA 1U5KA 3TDQA 4QY7A 5KGUA 2VQFL 1WD1A 3Q6SA 5IWAQ 3TS2A 5HGQA 4HJ5A 5M5WB 5IGBA 1HZ9A 1GUGA 4DK3C 2NTTA 3HKZB 4QJFA 3F1ZA 4IZ8A 3NUCA 1EOTA 4CHTB 4A3CH 1EY5A 2UUBQ 1BR9A 2AWOA 4AH6A 2ES2A 2I5HA 3CCVA 1EIHA 2DN8A 1PYBA 3A0JA 3MC0B 4A3MB 1K8AC 4QUFA 2RCFA 2EY1A 3FP9A 4OONA 3S1NB 2ASBA 2OQKA 4PV1C 3K57A 5CV9A 1GM5A 4I65A 2ZT9C 4A3IH 4WORA 1SNQA 4DKAC 4GKJQ 1CTMA 3H09A 1MKHA 1HZAA 3DWAA 4C3JG 2IX1A 3ULLA 4DAYB 3G6JB 1HH2P 3ONAB 5JAVA 2AKWB 3HOVB 5DM73 1STYA 1R4PB 1HZCA 4ILWA 5HY6A 1V1PB 1SNDA 4LF6L 2B63B 2VUMH 4MIUA 3T16A 1TWHB 3MZ5A 2ZM6L 1BBXC 2Q8IB 3S2DH 2O2LD 5CBEE 1TWGH 3KYHC 3CCLA 3CF5A 2K7VA 2A6HC 4IJHA 3SGIA 4QMGA 1BDOA 3N6RA 2K03A 1BBUA 3U4VA 3CPWA 1L1OC 4K0KQ 2KUMA 5J22A 5EKKA 5M3FB 4LAAA 3SK6A 4FF2A 2HCIA 1RTOA 3HOZH 4TSSA 3PIPA 2IX0A 4NB3A 4KTAA 5IGGA 1PFMA 1MGSA 2JA7G 5E1FA 2WACA 4K0KL 2DY8A 3NP8A 4R4QA 1ENAA 1AW7A 4ME5A 4KHPQ 3H15A 1LABA 2PZTA 4X6AH 2RA4A 5C4XH 3H6MA 3KBXA 4G7HC 2E2JH 3I3CA 3QJYA 1UE1A 1KLGD 3RD4A 5ELBA 1EYAA 1WYDA 4A3KH 1PH6A 2ZM6Q 4OXPA 2RHQB 1TY2A 4V0BA 2F0VA 2A8VA 1SXTA 4LUVA 1YHAA 1IL8A 4A3IG 1WTHA 2UXCQ 2Y0SE 1N33L 2NZHA 1PTOF 3Q22A 3K6OA 1CT1D 1MD2D 4GNXB 1XTCD 4XTCS 1FJGL 3HOUG 3S1QB 4K8JA 2JA6B 2MPMA 2A69C 2RSNA 3BDOA 1LYLA 5M5XB 1WTVA 4DR7L 3OIQA 3CRLC 3KJOA 1G6PA 4IPGA 2CKZB 3I2ZA 5I9OA 3ND8A 4GOPB 4IUPA 5DAUA 1X54A 2AQ3B 4FXGC 1E2WA 5EPKA 1EYGA 2HUGA 1EYCA 5AJ3Q 2WAQE 4EQPA 3CXCA 1YZ6A 1IYUA 3AU7A 3MTSA 3STBD 3I4MG 1AZQA 3GO5A 1S5CD 2HIVA 3PUZA 1HQMC 2IT1A 4M8AA 4CKCA 1RL2A 1N34Q 1Q8IA 5CORA 1VQPA 4B3ML 4K5VA 4J15A 4NXML 3UI2A 3H91A 2YTYA 5IWAL 1YNJC 2R7ZG 2QF7A 1OTCA 4EGVA 1GUWA 1L0WA 4KY6A 2F52A 3PGZA 2KHJA 5CYUA 4EQOA 1FJGQ 2E8GA 3EVQA 3J7YW 3L2PA 4S3SA 3EA6A 4DV6L 2SOBA 1GUNA 2ZTCA 3CHBD 5DLQE 4ID6A 1BCPC 3KLRA 1L1OA 3OTOL 4JI4L 1TU2B 4A3JG 4HIMA 1WCMH 3UDIA 5GAHC 2YYZA 5LMNL 4A3EB 1Q81C 2L4NA 1H9KA 2WFWA 1BCPF 3J81L 5DM63 2NVYB 2BDNA 3RMHA 1K0RA 3CC2A 1BKBA 1PZJD 2VQEQ 5IGDA 3E5SA 2IL8A 3FPUB 2F0GA 3RN5A 1RKNA 2JA6G 4R4OA 3HOXH 2Q2IA 2IJ0A 4RGTA 5EJWA 4LNQA 1NTGA 1YHQA 3B6YA 1E2ZA 2E2IH 4RGMA 3HEJA 3CCSA 2MJ8A 3PCOB 4A3FB 5EPLA 5KNDA 2QA4A 4KHVA 1J8IA 3HG9A 3KJPA 3V2TA 1EQVA 3DUZA 4EVOA 2KCCA 4LF6Q 2KHIA 2O5IC 3NE5B 1VQ4A 3FVQA 4H13C 2KEDA 2LY7A 2NVXH 5I6WA 4K5XA 2MFIA 3ZYYX 2MO1A 2ZXPA 3MXGA 2L0CA 1BQQT 5I2XA 4GKJL 2LKVA 4QQBX 1HA5A 3IFTA 1VDZA 2BE5C 5LMNW 1I5FA 3HZXA 2Z4HA 4DXGA 2FINB 2XIWA 1QCBD 4GN3B 1C7YA 3HOUH 3R2TA 2K01A 3X3MA 3ERSX 1NMGA 3GTGB 5C4HA 4RA8A 2CW0D 1TWFH 3S2HB 1SYDA 1HUMA 3CC7A 1WCMB 4CKBA 4EQNA 4OX9Q 4NPSA 1PMRA 3ICEA 1CSQA 1SSOA 4DV4L 2JYOA 3T4AC 5KYLA 1XJVA 4LFAQ 5M3MG 4A3GG 2VS1A 3CP0A 3FDTA 1DGSA 5EAYA 4DUYQ 3PUXA 5FLMH 2AQ1B 3TN2A 3A54A 3GQBA 2PYKA 2YTXA 3RZOH 2BA1A 4H02A 2F0DA 5ELOA 3RUZA 2F0SA 2K4KA 2GA4B 3A8JE 1Z47A 1KDAA 2AUKA 4LWCA 3I91A 1O7ZA 1ET6A 3UE1A 2X6GA 3D4DA 4DAPA 2WIIB 4A3BH 1SYBA 3A55A 3H94A 1ICFB 4OWXB 1VQNA 1KC8C 2CCZA 1IHZA 3Q23A 4JI5L 2HHHQ 5EQ0A 3VYTA 2N78A 4A3GB 5M3MB 3IKJA 2CWPA 1VQCA 2GN5A 5FLXc 5A2QE 3CPFA 3GTOB 1NAPA 1EIFA 1PTOD 4F88A 5E4WC 5C4ZA 1CHQD 2CH4A 2EY6A 2PI2A 1PRTB 2HIXA 1XWEA 3NELA 3J80E 3BS1A 2B39A 4MN3A 3F2DA 4QB4A 4C3HG 1FGBD 1I50B 2NWGA 3Q8DA 1XMQQ 5ELDA 5IYBH 4IN3A 1DONA 2Z1CA 3UDGA 4HEDA 2WINB 1YNNC 4A93H 3HOYH 1JOQA 3TBIB 3RZOB 2E2JB 5C3EG 2BH8A 3VYSA 5IGFA 4LF4L 2EYPA 3QR8A 1O78A 4OHJA 5JEAH 4X65Q 1CKNB 5JPNC 3TQYA 2EDGA 2QGQA 3I4NG 5FLXL 1PXUA 2RHSB 1EFID 3AEVA 4AIMA 1I3QB 1CI3M 1U4LA 2R93G 3MXUA 1HNWL 1EU3A 4PZ8A 2UU9L 2JEAI 4YCVA 1FL0A 1RIPA 2DY7A 4JI1L 4YHHL 1PRTD 1EZ8A 4DR5L 1SYGA 1GUTA 3OWEB 3S1RB 2R7DA 1I94Q 4A3DB 3DWQA 3JAMc 1SMYC 4OO1I 1Z9FA 3DWPA 1GUOA 4FF4A 1DD2A 4HSPA 1DOKA 4IFDI 2XN9C 4XQJA 3GP7A 3KF6A 4DNIA 2IPKD 2F03A 1F9SA 1VQMA 4LF8Q 1SNMA 3D6WA 1MHWC 4RCOA 4WJ3M 4IFDJ 2O5JC 4IO9A 4RHRA 3CCEA 2CQOA 2IHEA 3PUYA 5D14A 2D2CC 3M7NA 3VR2A 1QVFA 2KCTA 4JI8L 1KNEA 1LT5D 1OXVA 1NJIC 1VMPA 3T1YL 1ENCA 3MEFA 5CBAE 1X3FA 2TSSA 4ZCKA 1F9PA 1JICA 2MUYA 3GDEA 3UDFA 1XNRL 2PQEA 2J4XA 5FK9C 1HA6A 4HR7B 1XYIA 4IFDG 4GKKL 2XNAC 5JJIA 4JI7Q 1TT2A 4IOCA 2K5VA 4DR1Q 3VA7A 4B3RL 1BNZA 3CC4A 1JWMD 3FMCA 4BBSG 4AYBB 5JEAG 4C2MH 2DNCA 1YIJA 1LTSD 5EBDA 5E7NA 2WAQB 5C4JB 3TMEA 2KQ3A 3SK5A 2A19A 2H4OA 1P8LA 2WB1G 4BY7B 1JJ2A 3TRZA 4F8MA 2PQAA 4DR4Q 3EIVA 1A2UA 3CQZB 3I4MB 1X3PA 4RFBA 1VQLA 4A3GH 4Q0FA 1SFOB 5JEAJ 2B63H 1PZID 5I6YA 1B9MA 5I9PA 2PZWA 1CM9A 2K04A 3S1QH 2F0UA 1O7YA 2JA5H 4K5WA 2NVQB 1D1KA 3GD7A 3J81j 3MFGA 1QJOA 5K5PA 3HGBA 2Z9HA 2BOSA 4PZ6A 4H0LC 1SJED 3NBIA 3OW7A 2MGSA 1IYJB 4L6TB 4DXFA 1ICWA 3S17B 1G6ZA 3NQIA 5EKIA 3I72A 3T53B 3PO3B 5C44G 2JA7H 2Z0SA 4FYDA 3M4QA 4PZ7A 4FXDA 1JJCB 2H5XA 2F1MA 3FKIH 1RD9D 3RNUA 3MAQA 3H3VH 4YY3L 4JPBW 5T1GA 1KL9A 1SAPA 2EYOA 4KKSA 2ALYB 3R93A 1TS5A 5C44B 3NQTA 4H7BA 1QILA 1VF7A 1J9OA 1S5BD 4DR1L 4JI7L 4DV0Q 4CJ1B 1MIUA 3ERQA 5JVH3 1EEID 5KYIA 4LF9Q 2A74C 4DAVA 4FVMA 1F77A 4BBSH 3G7LA 1SBBB 3QIAA 4A3CG 3HOYG 4Y7NH 3KDFB 4IFDH 4WJ4A 3NWTA 1B3QA 1ASYA 1PH8A 3OYYA 4OEMB 1PV4A 1IW7C 3PIP3 2K5NA 2CHBD 3SHLA 5M3FG 4LF7Q 2KOLA 1BBWA 2F0OA 3SE0A 2UXBL 4BWGB 3AB9A 2K6AA 2R3ZA 2HT1A 1FNWA 1K0SA 5D65A 3G6EA 5KEEA 1V43A 1JWSD 4APVA 4ZKBB 2N8NA 2EVBA 3EN2A 3CQZH 4HCEA 4DR6Q 1M90C 2B63G 5EPJA 1PFBA 4DR3Q 2L11A 2CW0C 4BBRG 4GNXC 4JI2L 1B7YB 3O13A 4X62L 4P74A 2NN6G 4AYBG 1SE3A 5IT9c 4DR5Q 4YCWA 1WD0A 3GTLB 5CV5A 1JR0D 4BS9A 2NTSA 3SR1A 2Q8TA 4JI1Q 3ZJYC 1Q1BA 3SEBA 4C3JB 1P16A 1GJXA 2F0NA 4R4CA 3BJUA 2IHFA 1C9OA 4XDXA 1N32Q 4L5SA 3J81i 3HOXB 3OMCA 3H0GH 3GV3A 1F9QA 1EQQA 2KECA 2DUDA 1EY4A 1PA6A 5M9OA 3J80L 3TP8A 3NBHB 3EQLC 2EE1A 4X65L 3J80i 4V190 3L9AX 4J1MA 4A3MG 1A63A 2B2WC 1GUSA 2R7FA 4R9WA 3HKZE 1XNQL 2K5DA 2C5CA 4K2LA 1DJRD 3NEMA 1QZHA 1CKNA 2Q2HA 3M4PA 3TZUA 3DMUA 1ZKOA 2H1EA 3BYTB 3HKZG 4POFA 4B3SQ 2K5HA 3RLFA 1Q7YC 1ASZA 4N8FA 2A68C 5BN4A 3W3AA 2B8GA 1A15A 1D6EC 3J80c 4C3HH 4UY8C 2RBMA 4A3BG 3HRZC 2QKIC 5ELEA 4F87A 3IAYA 1IBMQ 4ALPA 2GVBA 1XPRA 3J7ZC 2UUCL 4GLAC 5IP7H 5JJLA 2JA8G 2F3VA 1F2MA 2JJQA 4JI5Q 4P73A 5AFWA 2E76C 1JCKB 4HJ9A 2BCOA 3RZDB 4B3SL 2KBNA 3K59A 3NENA 3MEHA 3E0EA 3PSIA 1RCVD 3G71A 1TS2A 3S14B 5KNCA 1TS4A 4DPGA 1G51A 1WTRA 1XNQQ 1XPUA 3Q0AA 4HJ7A 3HOWG 2VXWA 1ILQA 1LTGD 4TKOB 1IL2A 3P20A 1EY9A 1CHPD 2D9UA 4OELB 5J3BA 5M5WH 1SNPA 4FXKC 2ZJRA 2KCNA 1EY6A 4R4TA 1EQTA 1STGA 3LWEA 4XYQA 3CU7A 5IYCG 4DV4Q 3HOWH 1H9SB 1I4RA 4A93G 3TREA 4OX9L 1KTKA 1NNXA 4JYAL 1CKMA 5EBCA 5CV8A 5C3WA 1Y14B 3LGJA 1SDFA 1X56A 3DEPA 2F0HA 3I90A 4K8IA 3CW2C 2ID0A 5ISRA 2NUCA 3BYYB 3N52A 1SLJA 1JWUD 1ILPA 1O80A 2K28A 3AFQA 5FOBB 1PVOA 1EWCA 5LMUL 1EEFD 5IGCA 1TQOA 1QG7A 1SNOA 4OO1G 3OPOA 1HHVA 5EGTA 2EZVA 4QIWB 1C48A 2ICIA 1YNXA 1Y1VB 4OWTB 4KN7C 4PG3A 3AMUA 3HOZB 1ESFA 1VS0A 2EQSA 4KJOA 4LF7L 3U58A 3K5MA 3NSWA 1RTNA 1YJ9A 1DYQA 1B53A 4U68A 4JG2A 3S16H 3M4OH 1O7LA 2OF1A 1XTDA 5C0XJ 1DZ1A 2D5DA 2B2YA 2XVSA 2SNSA 3OW2A 5IE8A 2IWHA 1A3VA 4ZLTF 3BZDB 2N55A 2R61A 1YITA 3W5OA 3VDYA 4AQYL 4LF9L 3I4MH 3LWUA 1X9NA 1YJNA 4DV0L 1V8QA 1JT8A 2O4XA 4DN4M 3TP7A 3IFDA 1S3OA 5TSSA 2XRQD 5IGEA 1SYFA 2EOTA 3S16B 3P75A 1FNUA 2WB1B 4MTNA 3OMGA 4BY7G 2D62A 4MHEA 3TEHB 4QUCA 2R92B 2QW7A 1CUKA 2EY2A 3NTHA 5FO8B 4YY3Q 1Q82C 1NY4A 1V1PA 1SYEA 5LMNQ 4QF4A 1QNUA 3EBEA 3QO2A 4JI3Q 1E3PA 4JW0A 4ZYSA 1OXSC 4A3KB 1CSPA 2JXMB 1VQ9A 4DR2L 2VB3X 1WTPA 2F0MA 1S4ZA 5C4XB 3DHQA 2Z6KC 4JK1C 4Q5VA 1D1IA 3C1FA 4DV6Q 3GTLH 1H9RA 4KK7A 3WOFA 1OO9B 1HZBA 1ZEQX 2V1CC 4N9PA 3MVVA 1T9HA 4XYOA 1EY0A 2R93H 3E9IA 3E6ZX 1EUJA 2RKSA 3AYHB 2NBFA 3L3OC 4MNOA 1VQGA 4P2CB 2JQOA 4NXMQ 1ML0D 1D8LA 2B29A 1LTID 3LNNA 3CCUA 1STNA 1WVLA 3T51B 1K8GA 4ZK9B 2JEBI 3EROA 2CQAA 1EY7A 1S5ED 3TSSA 3S1RH 3QOJA 2NVTH 4CBVA 2E75C 2CH4W 2MNAA 4A3EG 2K14A 1IKLA 2JP1A 2JSOA 3U9OA 4XXEA 4JI6L 4A3JB 3R3OA 1HNZQ 1NR2A 4B3RQ 5I2YA 3JAMi 4J6HA 3FRPB 2L15A 2E5LQ 4GKKQ 4N8X1 3K5NA 4DR7Q 1SEBD 1R9TH 1XNRQ 1ONLA 4KY5A 1TY0A 1DOMA 5GROA 1J5EQ 4JCVE 1RODA 2Y0SG 3SK8A 4HMJA 3J81E 4LW1A 1ENFA 3DEOA 2JE6I 1TVXA 4IALA 3BVMA 1TWCB 2GVAA 1GO3E 2BH2A 4WRDA 4CKEA 5CR3A 2K75A 2QDLA 3A7LA 2EJFC
chains in the Genus database with same CATH topology
2FFKB 1DOLA 4C1NK 1DM0B 3DXJC 1BXTA 3SXHA 3T13A 2LMCB 1KDCA 2Z4IA 3C2PA 2OT2A 2AUJD 2XSCA 4HSVA 2A6HD 3OWFA 1EWHA 1Q90A 1GHKA 3P7JA 1T5EA 2B2VC 2EYHA 1KNAA 1EIGA 5CV7A 3A8KE 3OIPA 4N9TA 4A3IB 1AP0A 1B44D 3KUPA 1SE2A 4DNRB 3FKIB 5IT9E 2M2LA 4ULLA 1U4RA 2EPBA 1Y69U 4RKLA 1AN8A 5A35A 2HCCA 2KHSA 3LX0A 2F0LA 5FLXE 2X69A 1LO5D 1VCIA 1Z7TA 1UEAB 4DFAA 3IL8A 3VYRA 2NVTB 3K5OA 4J8QA 1R9TB 4IURA 1F2ZA 2LFNA 2NZ1D 4NKLA 3ND9A 4DF7A 2NYZD 2NVXB 2VB2X 2K5QA 2K5WA 5C5LA 2PW7A 4DU9A 3HOWB 4IUNA 5FO9B 3QB3A 1KAAA 2KVMA 4KN4C 4PMWA 2HDMA 1BF4A 4PMBA 1VMCA 1ZXTA 3BG3A 3VR6A 3J7AF 2VNUD 4XT3B 1HTPA 4A3BB 2A5HA 4C1NI 3TP6A 2IX3A 1YNJD 1II3A 4M1UB 2PO4A 5CGKA 1KDBA 3NK9A 1X32A 2KJXA 3HP3A 1GXDC 4R8IA 5EKLA 3J7AV 2XWJB 1CZGA 2JA5B 5COYA 1HRJA 2BDOA 1B4OA 1D2BA 1W6JA 3A7AB 3S9WA 4H44C 1MSGA 4RCNA 1LT4D 4KJNA 1SJHD 3D8GA 2NB0A 3KF8A 5JJZA 2F0QA 2TMPA 1I4PA 3QWNA 1DCZA 3I4LA 1RJTA 4OL7A 4PQXA 1LTRD 1A3TA 2F0EA 3BDCA 3T56B 1JOKA 4F7XA 4ODGA 1NCVA 4RWSC 2QEJC 4ZKCB 4CGYB 5CV6A 3PO2B 3MXPA 4NP5A 1Q3LA 4DA2A 1HFNA 3TZDA 4UDUC 2FMCA 2E2HB 5JOBA 1NUCA 3JAME 1S5DD 1PYWD 2ZXOA 2JA8B 3NTKA 4TRDA 2A69D 5DEHA 4PNYA 2M00A 2IW3A 3I8ZA 4R8NA 4U673 1CQVA 3NBHA 1FNVA 1I6VC 3KLSA 1TIID 1UUPA 3EJIA 3I73A 4RHSA 4K14A 2C9OA 1SYCA 4YIJA 4C56C 3MXNA 4IUQA 3W2DA 4IQZA 4ZRZA 1G91A 4OIKA 3PIO3 2JA7B 4RGNA 3GTMB 3VYUA 2AQ2B 2A73B 4HCSA 1HTLD 1EL0A 3OOCA 1GHJA 5G3LD 5ELCA 4HN7A 4IUTA 5FKAC 1B2TA 2HQEA 1CQFA 1KLUD 3S2DB 4E6IA 2F3WA 1L0YB 1FD7D 3QG1A 4KKTA 2A6ED 2WKDA 4FF3A 1X3QA 1UNSA 2I46A 1STAA 1Y8NB 4KY7A 5J39A 4FP5D 4K2KA 1XX8A 3FPPA 1EY8A 2RSOA 4DK1A 1I4HA 2EY5A 1PRTF 4B9XA 2QDBA 3GTPB 3E0JA 3KBGA 3KK7A 1LTAD 4FO2A 5LL6X 1PRTC 4ABNA 2NN6H 1VF5C 2B2UA 1F2LA 4DAYA 1STHA 1SMYD 1ESRA 5IODA 5T1IA 3M4YA 2K05A 3DM1A 5E3FA 3F2UA 3GTJB 2OXPA 5I4DA 3L7ZC 3CRKC 3OHXC 2F0TA 2Q8RE 1HCZA 3I4NB 1I4GA 1CA6A 5G3LF 3K58A 4O1NA 2ENBA 3GV6A 3VA5A 4FNFA 1PLFA 5C3EB 3M4OB 1AEXA 1OXTA 3NPPA 1A3UA 1PFNA 1HPCA 1R4QB 2PCFB 3VR5A 4KI0A 4C3HB 1I4XA 1BOSA 2N88A 3K0YA 5KRUA 4X3SA 1DXMA 3GTKB 1U4PA 5CC4A 1UAPA 1JB3A 2BA0A 1STEA 5C6AA 4X3TA 2B2VA 2MP1A 2V4DA 1WTWA 1QB5D 3K5LA 3K7AB 3PMFA 4O42A 5LHY1 1LLRD 4OO1H 1BUVT 3TP5A 1TR5A 2PW5A 3D4WA 1LT6D 4Z9CB 4BY1B 5M5YB 2SEBD 1YNND 2F4IA 1A6XA 3CKIB 3M85A 4OGQC 3WDNA 2HDLA 2QCPX 2WKCA 2KEEA 1HUNA 2M9VA 3NHHA 4K6LA 2EJMA 3Q24A 4C3IG 2NN6I 4KKUA 5NUCA 4I7ZC 2B8FA 1STBA 4LJZC 3A56A 3X3NA 4CJ2C 3NXWA 1Y1WB 4QCLA 4LMQD 1WTXA 4L63B 1TWGB 1HFGA 2PZUA 3EFXD 4G7ZC 2K33A 3I70A 2L5TA 1JQYD 5FO7B 5CMDA 3SDZA 3SK4A 5C0XI 1OXXK 4LK1C 1K8OA 1B3AA 5A2QL 1G8ZD 2PPBC 4HTHA 4HAEA 1G2SA 3VR3A 4WFN3 1B50A 4XQNA 2E2IB 4IUVA 2RQXA 1MSHA 1SE4A 2WV6D 1D5MC 3A8IE 1K8MA 4RAUC 4DNTB 3MWYW 1FR3A 3PUWA 1B9NA 2OEOA 3U9SA 3S15B 1QWYA 2RDHA 3HS0C 1HXYD 3V05A 4X3KA 3D31A 5C3XA 2K1BA 2FJ2A 4BA2I 3M3YB 1LV9A 1SNCA 4BBSB 5IIFA 1LTBD 2B2UC 3BVGA 1V1OA 5BN3A 2A68D 3M7GA 2QILA 4ZUJA 4RKBA 4Y7NB 5J1ZA 3JAML 1OXUA 2A6EC 2EYJA 5BN5A 2E2DC 4ZAIA 1GOZA 3S1MB 2DNEA 2L55A 1PTOH 1Y8PB 2YU9B 5IT9L 1Q12A 1RF2D 3C1EA 2RVLA 4KD4A 2SDFA 5DNFA 1U9RA 3QOLA 4HMIA 4XQQA 1W6KA 2AWNA 3H3VC 1WTQA 3BDLA 5ELFA 1PDQA 3R2IA 1IW7D 1MI2A 4NW2A 2R93B 1PZKD 1C8CA 2PMZB 4L8JA 2CVRA 3ITPA 1JC7A 1L0XB 2R6GA 4JBWA 2MHVA 4RGOS 1CZWA 2FHTA 1TS3A 4C2MB 1Y8OB 2J0TD 1ZYRC 1T5XD 2EXZA 2B2TA 2RDFA 2L1BA 1AZPA 2EYLA 4KMUC 5D3IB 4ZUIA 1HQRD 5C5MA 4CJ0B 2ZXRA 1KABA 3D4RA 3SVMA 1B1ZA 4TQUS 4FF1A 2G9DA 2Y0SB 2E74C 2R7ZB 3C46A 5KIXA 5JVG3 3KLSX 4G4KA 4XIGS 1LTTD 1TKWB 2I07B 2B2YC 1F9RA 1CA5A 3C3LA 1BO0A 2J7ZA 1H9MA 1A2TA 2XRSD 5LL6S 4G57A 2KA7A 2K32A 5K36H 1G291 1JE4A 2WP8J 3VR4A 1PTOC 5CV4A 4K6DA 5C0XH 4KV6A 1I4QA 5E4XA 1D5ZC 3WOEA 1I6HB 2F0IA 1K83B 3MHBA 4X3UA 4GZYC 5K36G 4A93B 4ZQ3A 4KHZA 1F2YA 2FMMA 2X6LA 3GTQB 1H9JA 3MFYA 1H9SA 1CFMA 3URYA 4OIJA 4XT1B 2G9HD 1IKMA 1RHPA 1JORA 2SNMA 1MBYA 4B08A 3PV0A 5F2DA 2F0JA 4C3IB 1Z6HA 1LT3D 1D5XC 3D3RA 1E2VA 3MA2B 2VUMB 4PMCA 2F0WA 1S5FD 3NTIA 4RH6A 4DGZA 3H0GB 5JPMC 1QNKA 1M8AA 1ZYRD 1BCPD 2B2TC 1EZ6A 5D3DA 5HGTA 4DK0A 3FEWX 1ET9A 2XWBB 5C0XG 3NWSA 3V96A 2ICEC 3BVZA 3PUVA 1M4VA 3R8BA 1XXGA 5HURA 2F0PA 4UAIA 1TWAB 1TWFB 1CK1A 3D6CA 3OSOA 5IOCA 1QOHA 2RDGA 2B2WA 1FYCA 4BA1I 4BBRB 1EU4A 2Z8LA 4B9WA 1C4QA 4KD3A 4NMZA 1WTOA 1NSNS 1G2TA 1LACA 1QE6A 5KNBA 1PTOB 1E0BA 1AFPA 1BCPB 4NDXA 4WJWA 2LS01 2EYFA 1EYDA 1NR4A 4G7OC 3P1HA 1RDPD 2PNRC 2EYMA 2F0KA 4IUUA 1Q1EA 3HOYB 1JOOA 2BE5D 2EJGC 2F0FA 2L12A 3HOUB 2L9HA 1U4MA 1IYVA 3TDQA 5KGUA 1WD1A 3Q6SA 5M5WB 5IGBA 1GUGA 2NTTA 3HKZB 4IZ8A 3NUCA 1EOTA 4CHTB 1EY5A 1BR9A 2AWOA 1EIHA 2DN8A 3MC0B 4A3MB 4QUFA 2EY1A 3S1NB 4PV1C 3K57A 5CV9A 4I65A 2ZT9C 4WORA 1SNQA 1CTMA 3H09A 4C3JG 3DWAA 2IX1A 3G6JB 3ONAB 5JAVA 3HOVB 5DM73 1STYA 1R4PB 4ILWA 1V1PB 1SNDA 2B63B 4MIUA 3T16A 1TWHB 3MZ5A 1BBXC 2Q8IB 2O2LD 5CBEE 2K7VA 2A6HC 4QMGA 1BDOA 3N6RA 2K03A 2KUMA 5J22A 5EKKA 5M3FB 4LAAA 3SK6A 4FF2A 2HCIA 1RTOA 4TSSA 2IX0A 4KTAA 5IGGA 1PFMA 1MGSA 5E1FA 2WACA 2DY8A 3NP8A 1ENAA 1AW7A 4ME5A 1LABA 2PZTA 2RA4A 3H6MA 3KBXA 4G7HC 3I3CA 3QJYA 1KLGD 3RD4A 5ELBA 1EYAA 4V0BA 1TY2A 2F0VA 1SXTA 1IL8A 1PTOF 3Q22A 3K6OA 1CT1D 1MD2D 1XTCD 4XTCS 3S1QB 4K8JA 2JA6B 2MPMA 2A69C 2RSNA 3BDOA 5M5XB 1WTVA 3OIQA 3CRLC 5I9OA 3ND8A 4IUPA 5DAUA 2AQ3B 4FXGC 1E2WA 5EPKA 2HUGA 1EYCA 4EQPA 1IYUA 3AU7A 3MTSA 1AZQA 3GO5A 1S5CD 3PUZA 1HQMC 2IT1A 4M8AA 4CKCA 1Q8IA 5CORA 4K5VA 3UI2A 3H91A 1YNJC 2QF7A 4EGVA 1GUWA 4KY6A 4EQOA 5CYUA 3EVQA 3J7YW 4S3SA 3EA6A 2SOBA 1GUNA 3CHBD 4ID6A 1BCPC 3KLRA 1TU2B 2YYZA 4A3EB 2L4NA 1H9KA 1BCPF 3J81L 5DM63 2NVYB 2BDNA 3RMHA 1PZJD 5IGDA 3E5SA 2IL8A 3FPUB 2F0GA 1RKNA 2IJ0A 4RGTA 5EJWA 1E2ZA 4RGMA 3HEJA 2MJ8A 4A3FB 5EPLA 5KNDA 4KHVA 1J8IA 3HG9A 3V2TA 1EQVA 3DUZA 4EVOA 2KCCA 2O5IC 3NE5B 3FVQA 4H13C 2KEDA 2LY7A 5I6WA 4K5XA 3ZYYX 2ZXPA 3MXGA 2L0CA 1BQQT 5I2XA 2LKVA 1HA5A 3IFTA 1VDZA 2BE5C 3HZXA 2Z4HA 4DXGA 2FINB 2XIWA 1QCBD 3R2TA 2K01A 3X3MA 3GTGB 5C4HA 4RA8A 2CW0D 3S2HB 1SYDA 1HUMA 1WCMB 4CKBA 4EQNA 1PMRA 1SSOA 2JYOA 3T4AC 5KYLA 3FDTA 3PUXA 2AQ1B 3TN2A 3A54A 3GQBA 2PYKA 2BA1A 2F0DA 3RUZA 2F0SA 2GA4B 1Z47A 3A8JE 1KDAA 2AUKA 3I91A 1O7ZA 1ET6A 2X6GA 3D4DA 4DAPA 2WIIB 1SYBA 3A55A 3H94A 1IHZA 3Q23A 5EQ0A 3VYTA 4A3GB 5M3MB 3IKJA 5A2QE 3GTOB 1NAPA 1PTOD 4F88A 5E4WC 5C4ZA 1CHQD 2EY6A 1PRTB 1XWEA 3J80E 3BS1A 2B39A 4MN3A 4QB4A 4C3HG 1FGBD 1I50B 2NWGA 5ELDA 4IN3A 1DONA 2Z1CA 4HEDA 2WINB 1YNNC 1JOQA 3TBIB 3RZOB 2E2JB 3VYSA 5IGFA 2EYPA 1O78A 4OHJA 5JEAH 5JPNC 2EDGA 5FLXL 1PXUA 1EFID 1I3QB 1CI3M 1U4LA 3MXUA 1EU3A 2JEAI 2DY7A 1PRTD 1EZ8A 1SYGA 1GUTA 3OWEB 3S1RB 4A3DB 3DWQA 1SMYC 4OO1I 3DWPA 1GUOA 4FF4A 1DD2A 4HSPA 1DOKA 4IFDI 2XN9C 4XQJA 3GP7A 2IPKD 2F03A 1F9SA 1SNMA 3D6WA 4RCOA 4IFDJ 2O5JC 4RHRA 3PUYA 5D14A 2D2CC 3M7NA 3VR2A 1KNEA 1LT5D 1OXVA 1VMPA 1ENCA 5CBAE 2TSSA 1F9PA 1JICA 2MUYA 2PQEA 2J4XA 5FK9C 1HA6A 4HR7B 1XYIA 4IFDG 2XNAC 1TT2A 3VA7A 1BNZA 1JWMD 3FMCA 4AYBB 5JEAG 2DNCA 1LTSD 5EBDA 2WAQB 5C4JB 3TMEA 2KQ3A 3SK5A 2H4OA 4BY7B 4F8MA 1A2UA 3CQZB 3I4MB 1X3PA 4RFBA 4Q0FA 1SFOB 5JEAJ 1PZID 5I6YA 1B9MA 5I9PA 2PZWA 1CM9A 2K04A 2F0UA 1O7YA 4K5WA 2NVQB 1D1KA 3GD7A 3MFGA 1QJOA 5K5PA 3HGBA 2BOSA 4H0LC 1SJED 3NBIA 3OW7A 2MGSA 4L6TB 4DXFA 1ICWA 3S17B 1G6ZA 3NQIA 5EKIA 3I72A 3T53B 3PO3B 4FYDA 4FXDA 2F1MA 1RD9D 3MAQA 5T1GA 1SAPA 2EYOA 4KKSA 3R93A 1TS5A 5C44B 3NQTA 4H7BA 1QILA 1VF7A 1J9OA 1S5BD 4CJ1B 3ERQA 5JVH3 1EEID 5KYIA 2A74C 4DAVA 4FVMA 1F77A 3G7LA 1SBBB 3QIAA 4IFDH 3NWTA 1IW7C 3PIP3 2CHBD 3SHLA 2KOLA 2F0OA 3SE0A 4BWGB 3AB9A 2K6AA 2R3ZA 1FNWA 5D65A 5KEEA 1V43A 1JWSD 4ZKBB 2EVBA 4HCEA 5EPJA 1PFBA 2L11A 2CW0C 3O13A 2NN6G 1SE3A 1WD0A 3GTLB 5CV5A 1JR0D 4BS9A 2NTSA 3SR1A 2Q8TA 1Q1BA 3SEBA 4C3JB 1GJXA 2F0NA 4XDXA 3HOXB 3OMCA 3GV3A 1F9QA 2KECA 1EY4A 5M9OA 3J80L 3TP8A 3EQLC 2EE1A 4V190 3L9AX 4J1MA 2B2WC 1GUSA 4R9WA 2K5DA 2C5CA 4K2LA 1DJRD 3TZUA 3DMUA 1ZKOA 2H1EA 3BYTB 3RLFA 2A68C 5BN4A 3W3AA 2B8GA 1A15A 1D6EC 2RBMA 3HRZC 2QKIC 5ELEA 4F87A 3IAYA 2F3VA 1F2MA 5AFWA 2E76C 1JCKB 2BCOA 3RZDB 3K59A 3MEHA 1RCVD 3S14B 1TS2A 5KNCA 1TS4A 1WTRA 3Q0AA 2VXWA 1ILQA 1LTGD 4TKOB 3P20A 1EY9A 1CHPD 2D9UA 1SNPA 4FXKC 2KCNA 1EY6A 1EQTA 1STGA 3LWEA 4XYQA 3CU7A 1H9SB 1I4RA 1KTKA 5EBCA 5CV8A 5C3WA 1SDFA 3DEPA 2F0HA 3I90A 4K8IA 2ID0A 5ISRA 2NUCA 3BYYB 3N52A 1JWUD 1ILPA 1O80A 2K28A 5FOBB 1EWCA 1EEFD 5IGCA 1TQOA 1QG7A 1SNOA 4OO1G 3OPOA 1HHVA 5EGTA 2EZVA 4QIWB 1C48A 2ICIA 1Y1VB 4KN7C 3AMUA 3HOZB 1ESFA 4KJOA 3K5MA 3NSWA 1RTNA 1DYQA 1B53A 4U68A 1O7LA 2OF1A 5C0XJ 1DZ1A 2D5DA 2B2YA 2XVSA 2SNSA 2IWHA 1A3VA 4ZLTF 3BZDB 2N55A 2R61A 3LWUA 1V8QA 2O4XA 4DN4M 3TP7A 3IFDA 5TSSA 2XRQD 5IGEA 1SYFA 2EOTA 3S16B 3P75A 1FNUA 2WB1B 3OMGA 2D62A 4MHEA 4QUCA 2R92B 3NTHA 2EY2A 5FO8B 1V1PA 1SYEA 4QF4A 1QNUA 3QO2A 4ZYSA 1OXSC 4A3KB 2JXMB 2VB3X 1WTPA 2F0MA 1S4ZA 5C4XB 3DHQA 4JK1C 4Q5VA 1D1IA 3C1FA 1H9RA 4KK7A 3WOFA 1OO9B 1ZEQX 4N9PA 3MVVA 4XYOA 1EY0A 3E6ZX 2RKSA 2NBFA 3L3OC 4P2CB 1ML0D 1LTID 3LNNA 1STNA 1WVLA 3T51B 4ZK9B 2JEBI 3EROA 2CQAA 1EY7A 1S5ED 3TSSA 3QOJA 4CBVA 2E75C 1IKLA 2JP1A 2JSOA 3U9OA 4XXEA 4A3JB 3R3OA 1NR2A 5I2YA 4J6HA 3FRPB 3K5NA 1SEBD 1ONLA 4KY5A 1TY0A 1DOMA 1RODA 3SK8A 4HMJA 3J81E 1ENFA 3DEOA 2JE6I 1TVXA 4IALA 3BVMA 1TWCB 4WRDA 4CKEA 5CR3A 3A7LA 2EJFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A15 A;  2HCI A;  3TN2 A;  1RTO A;  1HFN A;  3TZD A;  2B2T A;  4CJ1 B;  4IUU A;  4OIJ A;  1F9S A;  2FFK B;  2HDM A;  2RSO A;  2L1B A;  4XT1 B;  1AZP A;  1BF4 A;  4DN4 M;  3D6W A;  1PFM A;  3IFD A;  1IKM A;  1DOL A;  1MGS A;  1RHP A;  2EOT A;  1VMC A;  2L12 A;  1ZXT A;  3G7L A;  3I91 A;  1O7Z A;  2DY8 A;  5AFW A;  2L9H A;  2X6G A;  4MHE A;  5D14 A;  4QUC A;  1U4M A;  4X3K A;  2L4N A;  4CJ0 B;  4XT3 B;  1KNE A;  2RA4 A;  1VMP A;  2K1B A;  3I8Z A;  2FJ2 A;  5CBA E;  3KBX A;  3SVM A;  4HSV A;  1WD1 A;  3I3C A;  3Q6S A;  1LV9 A;  1F9P A;  2HDL A;  2KOL A;  3QO2 A;  1JIC A;  2BDN A;  1WTR A;  5EQ0 A;  1X32 A;  2B2U A;  1F2L A;  2B2U C;  2R3Z A;  1HA6 A;  2KEE A;  1XYI A;  3HP3 A;  1WTP A;  1HUN A;  2VXW A;  1ILQ A;  4R8I A;  1S4Z A;  2IL8 A;  3FPU B;  1EOT A;  1ESR A;  1NAP A;  3P7J A;  5D65 A;  1BNZ A;  5E4W C;  1IL8 A;  2D9U A;  5COY A;  5T1I A;  1QNK A;  4ZKB B;  1HRJ A;  2B2V C;  5EJW A;  4IUQ A;  1M8A A;  1EQT A;  3LWE A;  1B4O A;  2K05 A;  3DM1 A;  5EPJ A;  1KNA A;  1EIG A;  1EIH A;  1PFB A;  2L11 A;  4MN3 A;  2B2T C;  2B2Y C;  1F9R A;  1G91 A;  3F2U A;  4QUF A;  1CA5 A;  1AP0 A;  4OIK A;  2NWG A;  2MJ8 A;  3KUP A;  2MPM A;  1MSG A;  2RSN A;  1WD0 A;  1SDF A;  1BO0 A;  2J7Z A;  3DEP A;  1DON A;  4HED A;  4ZAI A;  3I90 A;  1ML0 D;  1X3P A;  1WTV A;  5EPL A;  2Q8T A;  1J8I A;  4CJ2 C;  2M2L A;  1U4R A;  2Q8R E;  5JJZ A;  3N52 A;  4LMQ D;  1WTX A;  1CA6 A;  1CM9 A;  1WVL A;  2K04 A;  4XDX A;  1ILP A;  2EPB A;  4HCS A;  1O7Y A;  1EL0 A;  4IUP A;  4ZK9 B;  3GV6 A;  1HFG A;  1O80 A;  2K28 A;  3GV3 A;  1PLF A;  2KED A;  1F9Q A;  2RVL A;  5EPK A;  2HUG A;  2KEC A;  4IUT A;  2SDF A;  2HCC A;  5DNF A;  1B2T A;  1JE4 A;  1QG7 A;  1RJT A;  3MTS A;  4UAI A;  1IKL A;  1HHV A;  1AZQ A;  2JP1 A;  3ONA B;  2EE1 A;  2X69 A;  1U4L A;  2MGS A;  1PFN A;  5E4X A;  2FIN B;  2B2W A;  2XIW A;  1NR2 A;  1ICW A;  3IL8 A;  2B2W C;  4X3U A;  1G6Z A;  5CMD A;  2K01 A;  2N88 A;  2DY7 A;  4R9W A;  1WTQ A;  5COR A;  5EKI A;  1PDQ A;  4RA8 A;  1WTO A;  4IUR A;  1BBX C;  1G2T A;  1NCV A;  4RWS C;  4X3S A;  1QE6 A;  5CBE E;  2NZ1 D;  1DOM A;  1B3A A;  3H91 A;  1U4P A;  1HUM A;  3UI2 A;  1MI2 A;  4HAE A;  4NW2 A;  1RTN A;  1G2S A;  1C8C A;  1E0B A;  4U68 A;  1B53 A;  1ROD A;  1X3Q A;  2NYZ D;  4X3T A;  4ZKC B;  1GUW A;  2B2V A;  2CVR A;  2MP1 A;  2H1E A;  3DEO A;  1WTW A;  1SSO A;  1B50 A;  2JYO A;  1TVX A;  2K03 A;  4IUV A;  1DZ1 A;  2FMM A;  5T1G A;  2B2Y A;  2X6L A;  1MSH A;  1SAP A;  2FHT A;  4O42 A;  2KUM A;  3FDT A;  1NR4 A;  3R93 A;  1XX8 A;  1Q3L A;  4RAU C;  4ZLT F;  1DOK A;  2KVM A;  2N55 A;  3MWY W;  1J9O A; 
#chains in the Genus database with same CATH topology
 4DV7 L;  4GNX A;  2FFK B;  2R92 G;  1DOL A;  4C1N K;  1VQO A;  1DM0 B;  3DXJ C;  1WJJ A;  1BXT A;  3SXH A;  3T13 A;  2LMC B;  1KDC A;  1JE5 A;  2Z4I A;  3C2P A;  3E9H A;  2OT2 A;  4KHP L;  2AUJ D;  4UP7 A;  4DV1 Q;  2XSC A;  2PMZ E;  4HSV A;  2JN4 A;  2A6H D;  4LFC Q;  3OWF A;  1EWH A;  2NVQ H;  5M3M H;  4YHH Q;  1UE5 A;  3G48 A;  3KDF A;  3T1H L;  1Q90 A;  1GHK A;  3P7J A;  1WI5 A;  1T5E A;  3HOV H;  1VQ6 A;  4LF5 L;  2JK8 A;  3K80 C;  2B2V C;  2EYH A;  4LUO A;  1KNA A;  1EIG A;  4RG1 A;  5CV7 A;  3A8K E;  4A3D H;  2Z6K A;  3OIP A;  4N9T A;  1K3B C;  1KRT A;  2E2H H;  4A3I B;  1AP0 A;  3GTQ H;  1B44 D;  3A5Z B;  3KUP A;  1QVG A;  1SE2 A;  4DNR B;  2MQH A;  3FKI B;  4YWK A;  5IT9 E;  2M2L A;  4ULL A;  1U4R A;  2WB1 E;  1YVC A;  2EPB A;  1Y69 U;  4RKL A;  2P5Z X;  1AN8 A;  3RLN A;  2YTV A;  5A35 A;  1Y1W G;  2HCC A;  2KHS A;  3LX0 A;  1UEB A;  2F0L A;  5FLX E;  2NZO A;  2X69 A;  1LO5 D;  1QVC A;  1VCI A;  1GKH A;  1UEA B;  1Z7T A;  4DFA A;  3IL8 A;  3VYR A;  3CAM A;  2NVT B;  3E3X A;  4R1J A;  4C3I H;  3K5O A;  4J8Q A;  1R9T B;  4IUR A;  2EIF A;  4IPC A;  1F2Z A;  2LFN A;  4IJL A;  2NZ1 D;  4NKL A;  3ND9 A;  4DF7 A;  5GAG C;  2NYZ D;  2NVX B;  2VB2 X;  3F2C A;  2K5Q A;  2K5W A;  5C5L A;  2PW7 A;  1E1O A;  4DU9 A;  3HOW B;  5FJ8 H;  2RCN A;  4IUN A;  1HNX L;  5FO9 B;  1VQ7 A;  3QB3 A;  1KAA A;  4DV3 L;  2DJF C;  2KVM A;  3CCQ A;  4A76 A;  4KN4 C;  3W1B A;  4PMW A;  2HDM A;  3FKI G;  1BF4 A;  4YWL A;  4A3F G;  2DGY A;  4JOI C;  1KD1 C;  4PMB A;  3HOV G;  1VMC A;  1ZXT A;  4DV3 Q;  4CDC C;  1KHI A;  1HNX Q;  3BG3 A;  3VR6 A;  3J7A F;  2VNU D;  4XT3 B;  1HTP A;  4A3B B;  2A5H A;  1VQE A;  4C1N I;  3TP6 A;  2IX3 A;  1N9W A;  1YNJ D;  1II3 A;  4M1U B;  1M1K C;  2PO4 A;  4O0A A;  5CGK A;  1KDB A;  1AE2 A;  1X32 A;  3NK9 A;  2KJX A;  3HP3 A;  1GXD C;  4R8I A;  5EKL A;  2NVY H;  3J7A V;  2XWJ B;  1CZG A;  2JA5 B;  5COY A;  1HRJ A;  1HR0 L;  2BDO A;  1B4O A;  1XMO L;  1D2B A;  1W6J A;  3A7A B;  3S9W A;  4H44 C;  1MSG A;  4GN5 A;  4RCN A;  4YCU A;  2CFM A;  1LT4 D;  4KJN A;  4DV5 L;  1X3G A;  1SJH D;  2VL6 A;  3D8G A;  2NB0 A;  3KF8 A;  5JJZ A;  2F0Q A;  3GTO H;  3HOX G;  1N36 Q;  2TMP A;  1I4P A;  3QWN A;  4CDE C;  1NE3 A;  3I56 A;  1DCZ A;  3I4L A;  1RJT A;  4OL7 A;  4PQX A;  3PO2 H;  5IYB G;  1LTR D;  1A3T A;  1N36 L;  1I3Q H;  2F0E A;  3BDC A;  1K83 H;  3T56 B;  3T1H Q;  1JOK A;  2VQE L;  4HJ8 A;  5FJ8 G;  4F7X A;  2ZTD A;  4ODG A;  1NCV A;  3D0F A;  4RWS C;  1PHJ A;  2QEJ C;  2ZTE A;  4ZKC B;  4DV1 L;  5C3E H;  1X55 A;  3UDX A;  4CGY B;  1XMO Q;  5CV6 A;  1SMX A;  3PO2 B;  3MXP A;  1YI2 A;  1C0A A;  3KFU A;  4NP5 A;  3K81 C;  1YHB A;  1Q3L A;  4DA2 A;  1HFN A;  3TZD A;  4UDU C;  2FMC A;  4DV7 Q;  1Y1W H;  4HID A;  2E2H B;  5JOB A;  1NUC A;  3JAM E;  1S5D D;  1PYW D;  2ZXO A;  2JA8 B;  3NTK A;  4TRD A;  2A69 D;  1Q8K A;  4A3L G;  2RF4 A;  5DEH A;  4PNY A;  2M00 A;  2IW3 A;  3K8A A;  1GD7 A;  3I8Z A;  4R8N A;  1J5E L;  4U67 3;  1CQV A;  3GTK H;  4L5Q A;  3NBH A;  1FNV A;  1I6V C;  5C4X G;  3KLS A;  1MJE A;  4B3M Q;  1TII D;  1UUP A;  3EJI A;  3I73 A;  4RHS A;  1N34 L;  1GVP A;  4K14 A;  2C9O A;  1HJP A;  1SYC A;  4YIJ A;  4A3F H;  4C56 C;  4HIO A;  3MXN A;  4IUQ A;  3KF8 B;  3W2D A;  3PO3 G;  1Q86 C;  3CD6 A;  1J6Q A;  3IRB A;  5AJ3 L;  1SRU A;  4IQZ A;  4ZRZ A;  1G91 A;  4JBM A;  1IBL L;  4OIK A;  3PIO 3;  1YEZ A;  2JA7 B;  2HD3 A;  3J81 c;  5IYD H;  4RGN A;  3GTM B;  3VYU A;  2AQ2 B;  1TWC H;  2A73 B;  3S24 A;  4HCS A;  3S2H H;  1HTL D;  1EL0 A;  3OOC A;  4DK6 C;  1GHJ A;  5G3L D;  2OCE A;  4A75 A;  5ELC A;  4O2D A;  4HN7 A;  4IUT A;  5FKA C;  1B2T A;  2HQE A;  1D7Q A;  1CQF A;  2ZJP A;  1W2B A;  3S15 H;  1KLU D;  3S2D B;  1N33 Q;  2UXC L;  4LUZ A;  1H95 A;  4E6I A;  2F3W A;  2PNH A;  1L0Y B;  1FD7 D;  1U0L A;  3QG1 A;  4POG A;  1PFS A;  2I0Q A;  4KKT A;  1Y1V G;  2A6E D;  2WKD A;  4FF3 A;  2JA6 H;  1X3Q A;  3I55 A;  1UNS A;  2I46 A;  1STA A;  1Y8N B;  4KY7 A;  1S40 A;  5J39 A;  1TXY A;  4LF5 Q;  1W3S A;  4FP5 D;  4K2K A;  1XX8 A;  2B3G A;  1VQI A;  4BBR H;  3FPP A;  4MZ9 A;  1EY8 A;  2LXK A;  4UP9 A;  2RSO A;  4DV2 L;  4DK1 A;  1I4H A;  2EY5 A;  1PRT F;  4LFC L;  1B8A A;  4B9X A;  3WWV A;  3A5U A;  2QDB A;  1JMC A;  3GTP B;  1VQK A;  3E0J A;  3KBG A;  3KK7 A;  1LTA D;  4FO2 A;  5LL6 X;  3GTG H;  1IBK Q;  1PRT C;  4ABN A;  1PH2 A;  2NN6 H;  1VF5 C;  4CDD C;  2B2U A;  1F2L A;  4DAY A;  1S72 A;  4A3L H;  1STH A;  1SMY D;  1ESR A;  3AFP A;  5IOD A;  4DAM A;  4IPH A;  1EOV A;  5T1I A;  3M4Y A;  2R92 H;  1V1Q A;  2K05 A;  3DM1 A;  5E3F A;  1HR0 W;  5GAD C;  2CWA A;  3F2U A;  3GTJ B;  2YU9 H;  3J7A 5;  3HKS A;  2OXP A;  5I4D A;  3L7Z C;  1Q46 A;  3CRK C;  4GS3 A;  3OHX C;  2E5L L;  1O7I A;  2F0T A;  2Q8R E;  1HCZ A;  1HNZ L;  1I4G A;  1CA6 A;  3I4N B;  5G3L F;  4JI6 Q;  4O1N A;  2ENB A;  3K58 A;  3GV6 A;  3VA5 A;  3HFZ B;  4FNF A;  1PLF A;  5C3E B;  3M4O B;  1KAW A;  4B3T Q;  1VQF A;  1AEX A;  1OXT A;  2AMC B;  3K0X A;  1QUQ B;  4BY1 H;  2UUB L;  3NPP A;  1A3U A;  2AHO B;  1PFN A;  1HPC A;  1R4Q B;  2PCF B;  3VR5 A;  4KI0 A;  4C3H B;  1UE6 A;  1EFW A;  1I4X A;  1BOS A;  3K0Y A;  2N88 A;  5KRU A;  3F8T A;  3PO3 H;  1PH7 A;  4X3S A;  1TWA H;  1DXM A;  3GTK B;  2LXJ A;  1U4P A;  5CC4 A;  4GOP A;  1UAP A;  5IP7 G;  2VQF Q;  1JB3 A;  3KOJ A;  2BA0 A;  3M3Y H;  1STE A;  5C6A A;  4A3J H;  4X3T A;  2B2V A;  1PYS B;  2KEN A;  2MP1 A;  2V4D A;  1WTW A;  1QB5 D;  3JC6 6;  3K5L A;  4NXN L;  1WFQ A;  1V9P A;  2Z6B A;  2XGT A;  3KF6 B;  3K7A B;  3PMF A;  4O42 A;  5LHY 1;  3CCR A;  4KLK A;  4JOI A;  4JV5 Q;  1LLR D;  2G5D A;  4OO1 H;  1BUV T;  1YBY A;  3TP5 A;  1TR5 A;  2PW5 A;  1B70 B;  3D4W A;  4DR2 Q;  1LT6 D;  1PH3 A;  4Z9C B;  3DLL A;  4JI3 L;  4BY1 B;  2R7Z H;  3PQI A;  1JB7 A;  1PH5 A;  1FVI A;  5M5Y B;  2SEB D;  2UUA Q;  1YNN D;  2F4I A;  4JC0 A;  1A6X A;  3CKI B;  1VQD A;  4JI0 L;  5C4J H;  3M85 A;  1K9M C;  4OGQ C;  3L0O A;  3WDN A;  2HDL A;  2QCP X;  2WKC A;  5H1S E;  3PO2 G;  3I7F A;  2KEE A;  4A3D G;  2UXD L;  1HUN A;  4OWW B;  2M9V A;  3NHH A;  4AQY Q;  4K6L A;  2EJM A;  5BR8 Q;  4MTK A;  3Q24 A;  4C3I G;  2NN6 I;  4KKU A;  5NUC A;  2FXQ A;  1MJC A;  2F4V L;  4LFB L;  4I7Z C;  2EXD A;  2B8F A;  2K52 A;  1STB A;  4LJZ C;  2IY5 B;  1NBW A;  3A56 A;  1E22 A;  4UP8 A;  3AQQ A;  3X3N A;  4CJ2 C;  3NXW A;  3BZC A;  1Y1W B;  4QCL A;  4LMQ D;  1WTX A;  1VQH A;  4L63 B;  1TWG B;  4HIK A;  1HFG A;  2PZU A;  1E7Z A;  3S14 H;  5IY0 A;  3EFX D;  3CMA A;  4G7Z C;  4DR3 L;  1PH9 A;  1JJG A;  5LMU Q;  4BXX H;  2Q2U A;  2K33 A;  3I70 A;  2L5T A;  4FDB A;  2I5M X;  1JQY D;  1LM0 A;  5FO7 B;  5L37 A;  5CMD A;  1I6H H;  5IP9 H;  2JA9 A;  3SDZ A;  3SK4 A;  4C3J H;  5C0X I;  1CKO A;  1OXX K;  1BVS A;  2DJG C;  4LK1 C;  4JVZ A;  2UXB Q;  1YJW A;  2JA5 G;  1K8O A;  1B3A A;  5A2Q L;  1G8Z D;  2PPB C;  2MO0 A;  4HTH A;  4IPD A;  4HAE A;  1G2S A;  4JYA Q;  1N8R C;  3VR3 A;  1UE7 A;  4LFB Q;  4WFN 3;  1B50 A;  3W1G A;  4XQN A;  2E2I B;  4IUV A;  2HQL A;  2RQX A;  5FLM G;  1MSH A;  1SE4 A;  2WV6 D;  2I5L X;  1D5M C;  3A8I E;  4A3M H;  1K8M A;  4RAU C;  4DNT B;  2K50 A;  4GN4 B;  3MWY W;  5IYC H;  4X66 Q;  1EIY B;  1FR3 A;  2ATW A;  3PUW A;  1B9N A;  5GQO A;  4QGU A;  2OEO A;  3STB C;  3U9S A;  1VQ5 A;  3S15 B;  1QWY A;  2RDH A;  3HS0 C;  1HXY D;  3V05 A;  1A8V A;  4JI0 Q;  4X3K A;  2WAQ G;  4UHV A;  2UUA L;  3D31 A;  2N3S A;  5C3X A;  4X64 L;  2K1B A;  2FJ2 A;  4BA2 I;  4DUZ L;  1XPO A;  2OTL A;  3M3Y B;  1LV9 A;  1SNC A;  4BBS B;  2UUC Q;  5IIF A;  4GOP C;  2LSS A;  1LTB D;  2B2U C;  1IBM L;  5M5X H;  3BVG A;  1V1O A;  1WCM G;  5BN3 A;  4JV5 L;  2A68 D;  3M7G A;  4GLV B;  2QIL A;  2VY3 A;  4ZUJ A;  4RKB A;  4Y7N B;  5J1Z A;  3GTP H;  1SRO A;  3JAM L;  1UWV A;  4NXN Q;  3GTM H;  1OXU A;  2A6E C;  1IXR A;  2EYJ A;  4RMF A;  2E2D C;  5BN5 A;  4ZAI A;  1GOZ A;  3S1M B;  1SR3 A;  2DNE A;  2L55 A;  1LUZ A;  1E1T A;  3MXN B;  1EQR A;  1PTO H;  1Y8P B;  4DR4 L;  2YU9 B;  5IT9 L;  1Q12 A;  1RF2 D;  4EX5 A;  3C1E A;  2RVL A;  4KD4 A;  2SDF A;  5DNF A;  4B3T L;  1U9R A;  1N32 L;  4BY1 G;  3DM3 A;  5M5Y H;  3QOL A;  1QUQ A;  4HMI A;  1X65 A;  4XQQ A;  1VQ8 A;  1W6K A;  2AWN A;  3H3V C;  3BDL A;  5ELF A;  1WTQ A;  1SFO H;  1PDQ A;  3R2I A;  2D0O A;  2VW9 A;  1K73 C;  1IW7 D;  1MI2 A;  4NW2 A;  1EWI A;  4X62 Q;  2R93 B;  1PZK D;  1C8C A;  2JA8 H;  2KCM A;  2PMZ B;  3T1Y Q;  4L8J A;  1L1O B;  2CVR A;  4JI2 Q;  3ITP A;  4JI8 Q;  1JC7 A;  1L0X B;  2R6G A;  3U4Z A;  4JBW A;  5IP9 G;  2MHV A;  4RGO S;  1CZW A;  4A3K G;  2FHT A;  4DR6 L;  1TS3 A;  3K7A H;  4L5R C;  4C2M B;  1Y8O B;  1KRS A;  4BXX G;  2J0T D;  1ZYR C;  1T5X D;  2EXZ A;  4LF8 L;  5GAE C;  2B2T A;  2RDF A;  2L1B A;  4GLX A;  1AZP A;  4BY7 H;  1E24 A;  1KIX A;  2EYL A;  4KMU C;  5D3I B;  4ZUI A;  3S17 H;  1IBK L;  5IYD G;  1HQR D;  5C5M A;  4CJ0 B;  1I94 L;  1QZG A;  2ZXR A;  1KAB A;  3D4R A;  1A0I A;  3SVM A;  1K3R A;  1B1Z A;  4TQU S;  3S1N H;  4FF1 A;  4DV2 Q;  2G9D A;  4A3E H;  2OQ0 A;  3I4N H;  4QL5 A;  2Y0S B;  2UU9 Q;  2E74 C;  1HNW Q;  2R7Z B;  3C46 A;  3FHW A;  5KIX A;  3PF5 A;  5ELN A;  3G4S A;  5JVG 3;  3KLS X;  4G4K A;  3ULJ A;  4XIG S;  1LTT D;  1TKW B;  2I07 B;  4YWM A;  3HOZ G;  2B2Y C;  1F9R A;  1CA5 A;  3C3L A;  2QEX A;  4LF4 Q;  1LTL A;  1BO0 A;  2J7Z A;  2D0P A;  3K7U C;  1VQB A;  1H9M A;  3CME A;  2A1A A;  1FGU A;  1A2T A;  3CCM A;  1Y1V H;  1XMQ L;  4Y52 H;  2XRS D;  3BU2 A;  5LL6 S;  4G57 A;  2KA7 A;  5C44 H;  1WOC A;  1A62 A;  1KXL A;  2K32 A;  3RZD H;  4UPA A;  5K36 H;  1G29 1;  1JE4 A;  4L5T A;  2WP8 J;  3BZK A;  3VR4 A;  1PTO C;  2PI2 E;  5CV4 A;  4K6D A;  5C0X H;  5JJK A;  4KV6 A;  1I4Q A;  5E4X A;  1D5Z C;  3WOE A;  1I6H B;  2F0I A;  1K83 B;  3MHB A;  4X3U A;  2C35 B;  4GZY C;  5K36 G;  3RLO A;  4A93 B;  3S1M H;  4ZQ3 A;  3H3V I;  4DUZ Q;  1IBL Q;  3I4O A;  4HJA A;  3PF4 A;  4X64 Q;  4KHZ A;  1F2Y A;  4IOA A;  2FMM A;  1AE3 A;  2X6L A;  3GTJ H;  3GTQ B;  1H9J A;  1SN8 A;  3U50 C;  3MFY A;  1H9S A;  4P75 A;  1CFM A;  3URY A;  4OIJ A;  4X66 L;  4XT1 B;  2G9H D;  1VQA A;  1IKM A;  4ME3 A;  1RHP A;  4DUY L;  1JOR A;  2SNM A;  1MBY A;  3CCJ A;  4B08 A;  4LFA L;  3PV0 A;  5F2D A;  2F0J A;  4C3I B;  1X3E A;  1Z6H A;  2F3I A;  3ER0 A;  3KLW A;  2Q2T A;  1LT3 D;  1D5X C;  3D3R A;  3F2B A;  1E2V A;  2VZA A;  3MA2 B;  3A74 A;  2VUM B;  4PMC A;  2F0W A;  1S5F D;  3NTI A;  4RH6 A;  4DGZ A;  3H0G B;  5JPM C;  1QNK A;  1M8A A;  1ZYR D;  4QIW E;  4A4I A;  1BCP D;  2B2T C;  2OWO A;  1EZ6 A;  5D3D A;  5HGT A;  5M3F H;  2PQA B;  4DK0 A;  3FEW X;  1ET9 A;  2XTI A;  2XWB B;  3TS0 A;  2YV5 A;  3NWS A;  5C0X G;  2N49 A;  3M9B A;  3V96 A;  2ICE C;  4JBJ A;  1NMF A;  1K28 A;  1SE8 A;  3BVZ A;  1KQS A;  3PUV A;  1M4V A;  3RN2 A;  3R8B A;  1XXG A;  1I50 H;  2ZJQ A;  5HUR A;  1AH9 A;  2F0P A;  2F4V Q;  1L2F A;  4UAI A;  1TWA B;  5BR8 L;  1TWF B;  1CK1 A;  3D6C A;  3OSO A;  5IOC A;  1QOH A;  2RDG A;  2B2W A;  4P71 A;  1PH1 A;  1FYC A;  4BA1 I;  4BBR B;  1X6O A;  1EU4 A;  2UXD Q;  2Z8L A;  4B9W A;  1C4Q A;  4KD3 A;  4NMZ A;  1TWH H;  4DV5 Q;  3ULP A;  1NSN S;  1WTO A;  1G2T A;  1LAC A;  1QE6 A;  5KNB A;  1IZ6 A;  1PTO B;  3H0G G;  3UE0 A;  4P72 A;  2OTJ A;  1E0B A;  4AYB E;  1AFP A;  1BCP B;  4NDX A;  4WJW A;  4JBK A;  2LS0 1;  2VUM G;  1HR0 Q;  2EYF A;  4TVA B;  1EYD A;  1NR4 A;  4EQ5 A;  4G7O C;  3P1H A;  4R4I A;  1VQJ A;  1RDP D;  3OTO Q;  2PNR C;  4JI4 Q;  2EYM A;  2F0K A;  3RR5 A;  4IUU A;  4CDF C;  1Q1E A;  3PIO A;  3HOY B;  1JOO A;  2BE5 D;  2EJG C;  2HHH L;  2F0F A;  2L12 A;  3HOU B;  2L9H A;  1U4M A;  1IYV A;  1PH4 A;  4I7A A;  1U5K A;  3TDQ A;  4QY7 A;  5KGU A;  2VQF L;  1WD1 A;  3Q6S A;  5IWA Q;  3TS2 A;  5HGQ A;  4HJ5 A;  5M5W B;  5IGB A;  1HZ9 A;  1GUG A;  4DK3 C;  2NTT A;  3HKZ B;  4QJF A;  3F1Z A;  4IZ8 A;  3NUC A;  1EOT A;  4CHT B;  4A3C H;  1EY5 A;  2UUB Q;  1BR9 A;  2AWO A;  4AH6 A;  2ES2 A;  2I5H A;  3CCV A;  1EIH A;  2DN8 A;  1PYB A;  3A0J A;  3MC0 B;  4A3M B;  1K8A C;  4QUF A;  2RCF A;  2EY1 A;  3FP9 A;  4OON A;  3S1N B;  2ASB A;  2OQK A;  4PV1 C;  3K57 A;  5CV9 A;  1GM5 A;  4I65 A;  2ZT9 C;  4A3I H;  4WOR A;  1SNQ A;  4DKA C;  4GKJ Q;  1CTM A;  3H09 A;  1MKH A;  1HZA A;  3DWA A;  4C3J G;  2IX1 A;  3ULL A;  4DAY B;  3G6J B;  1HH2 P;  3ONA B;  5JAV A;  2AKW B;  3HOV B;  5DM7 3;  1STY A;  1R4P B;  1HZC A;  4ILW A;  5HY6 A;  1V1P B;  1SND A;  4LF6 L;  2B63 B;  2VUM H;  4MIU A;  3T16 A;  1TWH B;  3MZ5 A;  2ZM6 L;  1BBX C;  2Q8I B;  3S2D H;  2O2L D;  5CBE E;  1TWG H;  3KYH C;  3CCL A;  3CF5 A;  2K7V A;  2A6H C;  4IJH A;  3SGI A;  4QMG A;  1BDO A;  3N6R A;  2K03 A;  1BBU A;  3U4V A;  3CPW A;  1L1O C;  4K0K Q;  2KUM A;  5J22 A;  5EKK A;  5M3F B;  4LAA A;  3SK6 A;  4FF2 A;  2HCI A;  1RTO A;  3HOZ H;  4TSS A;  3PIP A;  2IX0 A;  4NB3 A;  4KTA A;  5IGG A;  1PFM A;  1MGS A;  2JA7 G;  5E1F A;  2WAC A;  4K0K L;  2DY8 A;  3NP8 A;  4R4Q A;  1ENA A;  1AW7 A;  4ME5 A;  4KHP Q;  3H15 A;  1LAB A;  2PZT A;  4X6A H;  2RA4 A;  5C4X H;  3H6M A;  3KBX A;  4G7H C;  2E2J H;  3I3C A;  3QJY A;  1UE1 A;  1KLG D;  3RD4 A;  5ELB A;  1EYA A;  1WYD A;  4A3K H;  1PH6 A;  2ZM6 Q;  4OXP A;  2RHQ B;  1TY2 A;  4V0B A;  2F0V A;  2A8V A;  1SXT A;  4LUV A;  1YHA A;  1IL8 A;  4A3I G;  1WTH A;  2UXC Q;  2Y0S E;  1N33 L;  2NZH A;  1PTO F;  3Q22 A;  3K6O A;  1CT1 D;  1MD2 D;  4GNX B;  1XTC D;  4XTC S;  1FJG L;  3HOU G;  3S1Q B;  4K8J A;  2JA6 B;  2MPM A;  2A69 C;  2RSN A;  3BDO A;  1LYL A;  5M5X B;  1WTV A;  4DR7 L;  3OIQ A;  3CRL C;  3KJO A;  1G6P A;  4IPG A;  2CKZ B;  3I2Z A;  5I9O A;  3ND8 A;  4GOP B;  4IUP A;  5DAU A;  1X54 A;  2AQ3 B;  4FXG C;  1E2W A;  5EPK A;  1EYG A;  2HUG A;  1EYC A;  5AJ3 Q;  2WAQ E;  4EQP A;  3CXC A;  1YZ6 A;  1IYU A;  3AU7 A;  3MTS A;  3STB D;  3I4M G;  1AZQ A;  3GO5 A;  1S5C D;  2HIV A;  3PUZ A;  1HQM C;  2IT1 A;  4M8A A;  4CKC A;  1RL2 A;  1N34 Q;  1Q8I A;  5COR A;  1VQP A;  4B3M L;  4K5V A;  4J15 A;  4NXM L;  3UI2 A;  3H91 A;  2YTY A;  5IWA L;  1YNJ C;  2R7Z G;  2QF7 A;  1OTC A;  4EGV A;  1GUW A;  1L0W A;  4KY6 A;  2F52 A;  3PGZ A;  2KHJ A;  5CYU A;  4EQO A;  1FJG Q;  2E8G A;  3EVQ A;  3J7Y W;  3L2P A;  4S3S A;  3EA6 A;  4DV6 L;  2SOB A;  1GUN A;  2ZTC A;  3CHB D;  5DLQ E;  4ID6 A;  1BCP C;  3KLR A;  1L1O A;  3OTO L;  4JI4 L;  1TU2 B;  4A3J G;  4HIM A;  1WCM H;  3UDI A;  5GAH C;  2YYZ A;  5LMN L;  4A3E B;  1Q81 C;  2L4N A;  1H9K A;  2WFW A;  1BCP F;  3J81 L;  5DM6 3;  2NVY B;  2BDN A;  3RMH A;  1K0R A;  3CC2 A;  1BKB A;  1PZJ D;  2VQE Q;  5IGD A;  3E5S A;  2IL8 A;  3FPU B;  2F0G A;  3RN5 A;  1RKN A;  2JA6 G;  4R4O A;  3HOX H;  2Q2I A;  2IJ0 A;  4RGT A;  5EJW A;  4LNQ A;  1NTG A;  1YHQ A;  3B6Y A;  1E2Z A;  2E2I H;  4RGM A;  3HEJ A;  3CCS A;  2MJ8 A;  3PCO B;  4A3F B;  5EPL A;  5KND A;  2QA4 A;  4KHV A;  1J8I A;  3HG9 A;  3KJP A;  3V2T A;  1EQV A;  3DUZ A;  4EVO A;  2KCC A;  4LF6 Q;  2KHI A;  2O5I C;  3NE5 B;  1VQ4 A;  3FVQ A;  4H13 C;  2KED A;  2LY7 A;  2NVX H;  5I6W A;  4K5X A;  2MFI A;  3ZYY X;  2MO1 A;  2ZXP A;  3MXG A;  2L0C A;  1BQQ T;  5I2X A;  4GKJ L;  2LKV A;  4QQB X;  1HA5 A;  3IFT A;  1VDZ A;  2BE5 C;  5LMN W;  1I5F A;  3HZX A;  2Z4H A;  4DXG A;  2FIN B;  2XIW A;  1QCB D;  4GN3 B;  1C7Y A;  3HOU H;  3R2T A;  2K01 A;  3X3M A;  3ERS X;  1NMG A;  3GTG B;  5C4H A;  4RA8 A;  2CW0 D;  1TWF H;  3S2H B;  1SYD A;  1HUM A;  3CC7 A;  1WCM B;  4CKB A;  4EQN A;  4OX9 Q;  4NPS A;  1PMR A;  3ICE A;  1CSQ A;  1SSO A;  4DV4 L;  2JYO A;  3T4A C;  5KYL A;  1XJV A;  4LFA Q;  5M3M G;  4A3G G;  2VS1 A;  3CP0 A;  3FDT A;  1DGS A;  5EAY A;  4DUY Q;  3PUX A;  5FLM H;  2AQ1 B;  3TN2 A;  3A54 A;  3GQB A;  2PYK A;  2YTX A;  3RZO H;  2BA1 A;  4H02 A;  2F0D A;  5ELO A;  3RUZ A;  2F0S A;  2K4K A;  2GA4 B;  3A8J E;  1Z47 A;  1KDA A;  2AUK A;  4LWC A;  3I91 A;  1O7Z A;  1ET6 A;  3UE1 A;  2X6G A;  3D4D A;  4DAP A;  2WII B;  4A3B H;  1SYB A;  3A55 A;  3H94 A;  1ICF B;  4OWX B;  1VQN A;  1KC8 C;  2CCZ A;  1IHZ A;  3Q23 A;  4JI5 L;  2HHH Q;  5EQ0 A;  3VYT A;  2N78 A;  4A3G B;  5M3M B;  3IKJ A;  2CWP A;  1VQC A;  2GN5 A;  5FLX c;  5A2Q E;  3CPF A;  3GTO B;  1NAP A;  1EIF A;  1PTO D;  4F88 A;  5E4W C;  5C4Z A;  1CHQ D;  2CH4 A;  2EY6 A;  2PI2 A;  1PRT B;  2HIX A;  1XWE A;  3NEL A;  3J80 E;  3BS1 A;  2B39 A;  4MN3 A;  3F2D A;  4QB4 A;  4C3H G;  1FGB D;  1I50 B;  2NWG A;  3Q8D A;  1XMQ Q;  5ELD A;  5IYB H;  4IN3 A;  1DON A;  2Z1C A;  3UDG A;  4HED A;  2WIN B;  1YNN C;  4A93 H;  3HOY H;  1JOQ A;  3TBI B;  3RZO B;  2E2J B;  5C3E G;  2BH8 A;  3VYS A;  5IGF A;  4LF4 L;  2EYP A;  3QR8 A;  1O78 A;  4OHJ A;  5JEA H;  4X65 Q;  1CKN B;  5JPN C;  3TQY A;  2EDG A;  2QGQ A;  3I4N G;  5FLX L;  1PXU A;  2RHS B;  1EFI D;  3AEV A;  4AIM A;  1I3Q B;  1CI3 M;  1U4L A;  2R93 G;  3MXU A;  1HNW L;  1EU3 A;  4PZ8 A;  2UU9 L;  2JEA I;  4YCV A;  1FL0 A;  1RIP A;  2DY7 A;  4JI1 L;  4YHH L;  1PRT D;  1EZ8 A;  4DR5 L;  1SYG A;  1GUT A;  3OWE B;  3S1R B;  2R7D A;  1I94 Q;  4A3D B;  3DWQ A;  3JAM c;  1SMY C;  4OO1 I;  1Z9F A;  3DWP A;  1GUO A;  4FF4 A;  1DD2 A;  4HSP A;  1DOK A;  4IFD I;  2XN9 C;  4XQJ A;  3GP7 A;  3KF6 A;  4DNI A;  2IPK D;  2F03 A;  1F9S A;  1VQM A;  4LF8 Q;  1SNM A;  3D6W A;  1MHW C;  4RCO A;  4WJ3 M;  4IFD J;  2O5J C;  4IO9 A;  4RHR A;  3CCE A;  2CQO A;  2IHE A;  3PUY A;  5D14 A;  2D2C C;  3M7N A;  3VR2 A;  1QVF A;  2KCT A;  4JI8 L;  1KNE A;  1LT5 D;  1OXV A;  1NJI C;  1VMP A;  3T1Y L;  1ENC A;  3MEF A;  5CBA E;  1X3F A;  2TSS A;  4ZCK A;  1F9P A;  1JIC A;  2MUY A;  3GDE A;  3UDF A;  1XNR L;  2PQE A;  2J4X A;  5FK9 C;  1HA6 A;  4HR7 B;  1XYI A;  4IFD G;  4GKK L;  2XNA C;  5JJI A;  4JI7 Q;  1TT2 A;  4IOC A;  2K5V A;  4DR1 Q;  3VA7 A;  4B3R L;  1BNZ A;  3CC4 A;  1JWM D;  3FMC A;  4BBS G;  4AYB B;  5JEA G;  4C2M H;  2DNC A;  1YIJ A;  1LTS D;  5EBD A;  5E7N A;  2WAQ B;  5C4J B;  3TME A;  2KQ3 A;  3SK5 A;  2A19 A;  2H4O A;  1P8L A;  2WB1 G;  4BY7 B;  1JJ2 A;  3TRZ A;  4F8M A;  2PQA A;  4DR4 Q;  3EIV A;  1A2U A;  3CQZ B;  3I4M B;  1X3P A;  4RFB A;  1VQL A;  4A3G H;  4Q0F A;  1SFO B;  5JEA J;  2B63 H;  1PZI D;  5I6Y A;  1B9M A;  5I9P A;  2PZW A;  1CM9 A;  2K04 A;  3S1Q H;  2F0U A;  1O7Y A;  2JA5 H;  4K5W A;  2NVQ B;  1D1K A;  3GD7 A;  3J81 j;  3MFG A;  1QJO A;  5K5P A;  3HGB A;  2Z9H A;  2BOS A;  4PZ6 A;  4H0L C;  1SJE D;  3NBI A;  3OW7 A;  2MGS A;  1IYJ B;  4L6T B;  4DXF A;  1ICW A;  3S17 B;  1G6Z A;  3NQI A;  5EKI A;  3I72 A;  3T53 B;  3PO3 B;  5C44 G;  2JA7 H;  2Z0S A;  4FYD A;  3M4Q A;  4PZ7 A;  4FXD A;  1JJC B;  2H5X A;  2F1M A;  3FKI H;  1RD9 D;  3RNU A;  3MAQ A;  3H3V H;  4YY3 L;  4JPB W;  5T1G A;  1KL9 A;  1SAP A;  2EYO A;  4KKS A;  2ALY B;  3R93 A;  1TS5 A;  5C44 B;  3NQT A;  4H7B A;  1QIL A;  1VF7 A;  1J9O A;  1S5B D;  4DR1 L;  4JI7 L;  4DV0 Q;  4CJ1 B;  1MIU A;  3ERQ A;  5JVH 3;  1EEI D;  5KYI A;  4LF9 Q;  2A74 C;  4DAV A;  4FVM A;  1F77 A;  4BBS H;  3G7L A;  1SBB B;  3QIA A;  4A3C G;  3HOY G;  4Y7N H;  3KDF B;  4IFD H;  4WJ4 A;  3NWT A;  1B3Q A;  1ASY A;  1PH8 A;  3OYY A;  4OEM B;  1PV4 A;  1IW7 C;  3PIP 3;  2K5N A;  2CHB D;  3SHL A;  5M3F G;  4LF7 Q;  2KOL A;  1BBW A;  2F0O A;  3SE0 A;  2UXB L;  4BWG B;  3AB9 A;  2K6A A;  2R3Z A;  2HT1 A;  1FNW A;  1K0S A;  5D65 A;  3G6E A;  5KEE A;  1V43 A;  1JWS D;  4APV A;  4ZKB B;  2N8N A;  2EVB A;  3EN2 A;  3CQZ H;  4HCE A;  4DR6 Q;  1M90 C;  2B63 G;  5EPJ A;  1PFB A;  4DR3 Q;  2L11 A;  2CW0 C;  4BBR G;  4GNX C;  4JI2 L;  1B7Y B;  3O13 A;  4X62 L;  4P74 A;  2NN6 G;  4AYB G;  1SE3 A;  5IT9 c;  4DR5 Q;  4YCW A;  1WD0 A;  3GTL B;  5CV5 A;  1JR0 D;  4BS9 A;  2NTS A;  3SR1 A;  2Q8T A;  4JI1 Q;  3ZJY C;  1Q1B A;  3SEB A;  4C3J B;  1P16 A;  1GJX A;  2F0N A;  4R4C A;  3BJU A;  2IHF A;  1C9O A;  4XDX A;  1N32 Q;  4L5S A;  3J81 i;  3HOX B;  3OMC A;  3H0G H;  3GV3 A;  1F9Q A;  1EQQ A;  2KEC A;  2DUD A;  1EY4 A;  1PA6 A;  5M9O A;  3J80 L;  3TP8 A;  3NBH B;  3EQL C;  2EE1 A;  4X65 L;  3J80 i;  4V19 0;  3L9A X;  4J1M A;  4A3M G;  1A63 A;  2B2W C;  1GUS A;  2R7F A;  4R9W A;  3HKZ E;  1XNQ L;  2K5D A;  2C5C A;  4K2L A;  1DJR D;  3NEM A;  1QZH A;  1CKN A;  2Q2H A;  3M4P A;  3TZU A;  3DMU A;  1ZKO A;  2H1E A;  3BYT B;  3HKZ G;  4POF A;  4B3S Q;  2K5H A;  3RLF A;  1Q7Y C;  1ASZ A;  4N8F A;  2A68 C;  5BN4 A;  3W3A A;  2B8G A;  1A15 A;  1D6E C;  3J80 c;  4C3H H;  4UY8 C;  2RBM A;  4A3B G;  3HRZ C;  2QKI C;  5ELE A;  4F87 A;  3IAY A;  1IBM Q;  4ALP A;  2GVB A;  1XPR A;  3J7Z C;  2UUC L;  4GLA C;  5IP7 H;  5JJL A;  2JA8 G;  2F3V A;  1F2M A;  2JJQ A;  4JI5 Q;  4P73 A;  5AFW A;  2E76 C;  1JCK B;  4HJ9 A;  2BCO A;  3RZD B;  4B3S L;  2KBN A;  3K59 A;  3NEN A;  3MEH A;  3E0E A;  3PSI A;  1RCV D;  3G71 A;  1TS2 A;  3S14 B;  5KNC A;  1TS4 A;  4DPG A;  1G51 A;  1WTR A;  1XNQ Q;  1XPU A;  3Q0A A;  4HJ7 A;  3HOW G;  2VXW A;  1ILQ A;  1LTG D;  4TKO B;  1IL2 A;  3P20 A;  1EY9 A;  1CHP D;  2D9U A;  4OEL B;  5J3B A;  5M5W H;  1SNP A;  4FXK C;  2ZJR A;  2KCN A;  1EY6 A;  4R4T A;  1EQT A;  1STG A;  3LWE A;  4XYQ A;  3CU7 A;  5IYC G;  4DV4 Q;  3HOW H;  1H9S B;  1I4R A;  4A93 G;  3TRE A;  4OX9 L;  1KTK A;  1NNX A;  4JYA L;  1CKM A;  5EBC A;  5CV8 A;  5C3W A;  1Y14 B;  3LGJ A;  1SDF A;  1X56 A;  3DEP A;  2F0H A;  3I90 A;  4K8I A;  3CW2 C;  2ID0 A;  5ISR A;  2NUC A;  3BYY B;  3N52 A;  1SLJ A;  1JWU D;  1ILP A;  1O80 A;  2K28 A;  3AFQ A;  5FOB B;  1PVO A;  1EWC A;  5LMU L;  1EEF D;  5IGC A;  1TQO A;  1QG7 A;  1SNO A;  4OO1 G;  3OPO A;  1HHV A;  5EGT A;  2EZV A;  4QIW B;  1C48 A;  2ICI A;  1YNX A;  1Y1V B;  4OWT B;  4KN7 C;  4PG3 A;  3AMU A;  3HOZ B;  1ESF A;  1VS0 A;  2EQS A;  4KJO A;  4LF7 L;  3U58 A;  3K5M A;  3NSW A;  1RTN A;  1YJ9 A;  1DYQ A;  1B53 A;  4U68 A;  4JG2 A;  3S16 H;  3M4O H;  1O7L A;  2OF1 A;  1XTD A;  5C0X J;  1DZ1 A;  2D5D A;  2B2Y A;  2XVS A;  2SNS A;  3OW2 A;  5IE8 A;  2IWH A;  1A3V A;  4ZLT F;  3BZD B;  2N55 A;  2R61 A;  1YIT A;  3W5O A;  3VDY A;  4AQY L;  4LF9 L;  3I4M H;  3LWU A;  1X9N A;  1YJN A;  4DV0 L;  1V8Q A;  1JT8 A;  2O4X A;  4DN4 M;  3TP7 A;  3IFD A;  1S3O A;  5TSS A;  2XRQ D;  5IGE A;  1SYF A;  2EOT A;  3S16 B;  3P75 A;  1FNU A;  2WB1 B;  4MTN A;  3OMG A;  4BY7 G;  2D62 A;  4MHE A;  3TEH B;  4QUC A;  2R92 B;  2QW7 A;  1CUK A;  2EY2 A;  3NTH A;  5FO8 B;  4YY3 Q;  1Q82 C;  1NY4 A;  1V1P A;  1SYE A;  5LMN Q;  4QF4 A;  1QNU A;  3EBE A;  3QO2 A;  4JI3 Q;  1E3P A;  4JW0 A;  4ZYS A;  1OXS C;  4A3K B;  1CSP A;  2JXM B;  1VQ9 A;  4DR2 L;  2VB3 X;  1WTP A;  2F0M A;  1S4Z A;  5C4X B;  3DHQ A;  2Z6K C;  4JK1 C;  4Q5V A;  1D1I A;  3C1F A;  4DV6 Q;  3GTL H;  1H9R A;  4KK7 A;  3WOF A;  1OO9 B;  1HZB A;  1ZEQ X;  2V1C C;  4N9P A;  3MVV A;  1T9H A;  4XYO A;  1EY0 A;  2R93 H;  3E9I A;  3E6Z X;  1EUJ A;  2RKS A;  3AYH B;  2NBF A;  3L3O C;  4MNO A;  1VQG A;  4P2C B;  2JQO A;  4NXM Q;  1ML0 D;  1D8L A;  2B29 A;  1LTI D;  3LNN A;  3CCU A;  1STN A;  1WVL A;  3T51 B;  1K8G A;  4ZK9 B;  2JEB I;  3ERO A;  2CQA A;  1EY7 A;  1S5E D;  3TSS A;  3S1R H;  3QOJ A;  2NVT H;  4CBV A;  2E75 C;  2CH4 W;  2MNA A;  4A3E G;  2K14 A;  1IKL A;  2JP1 A;  2JSO A;  3U9O A;  4XXE A;  4JI6 L;  4A3J B;  3R3O A;  1HNZ Q;  1NR2 A;  4B3R Q;  5I2Y A;  3JAM i;  4J6H A;  3FRP B;  2L15 A;  2E5L Q;  4GKK Q;  4N8X 1;  3K5N A;  4DR7 Q;  1SEB D;  1R9T H;  1XNR Q;  1ONL A;  4KY5 A;  1TY0 A;  1DOM A;  5GRO A;  1J5E Q;  4JCV E;  1ROD A;  2Y0S G;  3SK8 A;  4HMJ A;  3J81 E;  4LW1 A;  1ENF A;  3DEO A;  2JE6 I;  1TVX A;  4IAL A;  3BVM A;  1TWC B;  2GVA A;  1GO3 E;  2BH2 A;  4WRD A;  4CKE A;  5CR3 A;  2K75 A;  2QDL A;  3A7L A;  2EJF C; 
#chains in the Genus database with same CATH homology
 2FFK B;  1DOL A;  4C1N K;  1DM0 B;  3DXJ C;  1BXT A;  3SXH A;  3T13 A;  2LMC B;  1KDC A;  2Z4I A;  3C2P A;  2OT2 A;  2AUJ D;  2XSC A;  4HSV A;  2A6H D;  3OWF A;  1EWH A;  1Q90 A;  1GHK A;  3P7J A;  1T5E A;  2B2V C;  2EYH A;  1KNA A;  1EIG A;  5CV7 A;  3A8K E;  3OIP A;  4N9T A;  4A3I B;  1AP0 A;  1B44 D;  3KUP A;  1SE2 A;  4DNR B;  3FKI B;  5IT9 E;  2M2L A;  4ULL A;  1U4R A;  2EPB A;  1Y69 U;  4RKL A;  1AN8 A;  5A35 A;  2HCC A;  2KHS A;  3LX0 A;  2F0L A;  5FLX E;  2X69 A;  1LO5 D;  1VCI A;  1Z7T A;  1UEA B;  4DFA A;  3IL8 A;  3VYR A;  2NVT B;  3K5O A;  4J8Q A;  1R9T B;  4IUR A;  1F2Z A;  2LFN A;  2NZ1 D;  4NKL A;  3ND9 A;  4DF7 A;  2NYZ D;  2NVX B;  2VB2 X;  2K5Q A;  2K5W A;  5C5L A;  2PW7 A;  4DU9 A;  3HOW B;  4IUN A;  5FO9 B;  3QB3 A;  1KAA A;  2KVM A;  4KN4 C;  4PMW A;  2HDM A;  1BF4 A;  4PMB A;  1VMC A;  1ZXT A;  3BG3 A;  3VR6 A;  3J7A F;  2VNU D;  4XT3 B;  1HTP A;  4A3B B;  2A5H A;  4C1N I;  3TP6 A;  2IX3 A;  1YNJ D;  1II3 A;  4M1U B;  2PO4 A;  5CGK A;  1KDB A;  3NK9 A;  1X32 A;  2KJX A;  3HP3 A;  1GXD C;  4R8I A;  5EKL A;  3J7A V;  2XWJ B;  1CZG A;  2JA5 B;  5COY A;  1HRJ A;  2BDO A;  1B4O A;  1D2B A;  1W6J A;  3A7A B;  3S9W A;  4H44 C;  1MSG A;  4RCN A;  1LT4 D;  4KJN A;  1SJH D;  3D8G A;  2NB0 A;  3KF8 A;  5JJZ A;  2F0Q A;  2TMP A;  1I4P A;  3QWN A;  1DCZ A;  3I4L A;  1RJT A;  4OL7 A;  4PQX A;  1LTR D;  1A3T A;  2F0E A;  3BDC A;  3T56 B;  1JOK A;  4F7X A;  4ODG A;  1NCV A;  4RWS C;  2QEJ C;  4ZKC B;  4CGY B;  5CV6 A;  3PO2 B;  3MXP A;  4NP5 A;  1Q3L A;  4DA2 A;  1HFN A;  3TZD A;  4UDU C;  2FMC A;  2E2H B;  5JOB A;  1NUC A;  3JAM E;  1S5D D;  1PYW D;  2ZXO A;  2JA8 B;  3NTK A;  4TRD A;  2A69 D;  5DEH A;  4PNY A;  2M00 A;  2IW3 A;  3I8Z A;  4R8N A;  4U67 3;  1CQV A;  3NBH A;  1FNV A;  1I6V C;  3KLS A;  1TII D;  1UUP A;  3EJI A;  3I73 A;  4RHS A;  4K14 A;  2C9O A;  1SYC A;  4YIJ A;  4C56 C;  3MXN A;  4IUQ A;  3W2D A;  4IQZ A;  4ZRZ A;  1G91 A;  4OIK A;  3PIO 3;  2JA7 B;  4RGN A;  3GTM B;  3VYU A;  2AQ2 B;  2A73 B;  4HCS A;  1HTL D;  1EL0 A;  3OOC A;  1GHJ A;  5G3L D;  5ELC A;  4HN7 A;  4IUT A;  5FKA C;  1B2T A;  2HQE A;  1CQF A;  1KLU D;  3S2D B;  4E6I A;  2F3W A;  1L0Y B;  1FD7 D;  3QG1 A;  4KKT A;  2A6E D;  2WKD A;  4FF3 A;  1X3Q A;  1UNS A;  2I46 A;  1STA A;  1Y8N B;  4KY7 A;  5J39 A;  4FP5 D;  4K2K A;  1XX8 A;  3FPP A;  1EY8 A;  2RSO A;  4DK1 A;  1I4H A;  2EY5 A;  1PRT F;  4B9X A;  2QDB A;  3GTP B;  3E0J A;  3KBG A;  3KK7 A;  1LTA D;  4FO2 A;  5LL6 X;  1PRT C;  4ABN A;  2NN6 H;  1VF5 C;  2B2U A;  1F2L A;  4DAY A;  1STH A;  1SMY D;  1ESR A;  5IOD A;  5T1I A;  3M4Y A;  2K05 A;  3DM1 A;  5E3F A;  3F2U A;  3GTJ B;  2OXP A;  5I4D A;  3L7Z C;  3CRK C;  3OHX C;  2F0T A;  2Q8R E;  1HCZ A;  3I4N B;  1I4G A;  1CA6 A;  5G3L F;  3K58 A;  4O1N A;  2ENB A;  3GV6 A;  3VA5 A;  4FNF A;  1PLF A;  5C3E B;  3M4O B;  1AEX A;  1OXT A;  3NPP A;  1A3U A;  1PFN A;  1HPC A;  1R4Q B;  2PCF B;  3VR5 A;  4KI0 A;  4C3H B;  1I4X A;  1BOS A;  2N88 A;  3K0Y A;  5KRU A;  4X3S A;  1DXM A;  3GTK B;  1U4P A;  5CC4 A;  1UAP A;  1JB3 A;  2BA0 A;  1STE A;  5C6A A;  4X3T A;  2B2V A;  2MP1 A;  2V4D A;  1WTW A;  1QB5 D;  3K5L A;  3K7A B;  3PMF A;  4O42 A;  5LHY 1;  1LLR D;  4OO1 H;  1BUV T;  3TP5 A;  1TR5 A;  2PW5 A;  3D4W A;  1LT6 D;  4Z9C B;  4BY1 B;  5M5Y B;  2SEB D;  1YNN D;  2F4I A;  1A6X A;  3CKI B;  3M85 A;  4OGQ C;  3WDN A;  2HDL A;  2QCP X;  2WKC A;  2KEE A;  1HUN A;  2M9V A;  3NHH A;  4K6L A;  2EJM A;  3Q24 A;  4C3I G;  2NN6 I;  4KKU A;  5NUC A;  4I7Z C;  2B8F A;  1STB A;  4LJZ C;  3A56 A;  3X3N A;  4CJ2 C;  3NXW A;  1Y1W B;  4QCL A;  4LMQ D;  1WTX A;  4L63 B;  1TWG B;  1HFG A;  2PZU A;  3EFX D;  4G7Z C;  2K33 A;  3I70 A;  2L5T A;  1JQY D;  5FO7 B;  5CMD A;  3SDZ A;  3SK4 A;  5C0X I;  1OXX K;  4LK1 C;  1K8O A;  1B3A A;  5A2Q L;  1G8Z D;  2PPB C;  4HTH A;  4HAE A;  1G2S A;  3VR3 A;  4WFN 3;  1B50 A;  4XQN A;  2E2I B;  4IUV A;  2RQX A;  1MSH A;  1SE4 A;  2WV6 D;  1D5M C;  3A8I E;  1K8M A;  4RAU C;  4DNT B;  3MWY W;  1FR3 A;  3PUW A;  1B9N A;  2OEO A;  3U9S A;  3S15 B;  1QWY A;  2RDH A;  3HS0 C;  1HXY D;  3V05 A;  4X3K A;  3D31 A;  5C3X A;  2K1B A;  2FJ2 A;  4BA2 I;  3M3Y B;  1LV9 A;  1SNC A;  4BBS B;  5IIF A;  1LTB D;  2B2U C;  3BVG A;  1V1O A;  5BN3 A;  2A68 D;  3M7G A;  2QIL A;  4ZUJ A;  4RKB A;  4Y7N B;  5J1Z A;  3JAM L;  1OXU A;  2A6E C;  2EYJ A;  5BN5 A;  2E2D C;  4ZAI A;  1GOZ A;  3S1M B;  2DNE A;  2L55 A;  1PTO H;  1Y8P B;  2YU9 B;  5IT9 L;  1Q12 A;  1RF2 D;  3C1E A;  2RVL A;  4KD4 A;  2SDF A;  5DNF A;  1U9R A;  3QOL A;  4HMI A;  4XQQ A;  1W6K A;  2AWN A;  3H3V C;  1WTQ A;  3BDL A;  5ELF A;  1PDQ A;  3R2I A;  1IW7 D;  1MI2 A;  4NW2 A;  2R93 B;  1PZK D;  1C8C A;  2PMZ B;  4L8J A;  2CVR A;  3ITP A;  1JC7 A;  1L0X B;  2R6G A;  4JBW A;  2MHV A;  4RGO S;  1CZW A;  2FHT A;  1TS3 A;  4C2M B;  1Y8O B;  2J0T D;  1ZYR C;  1T5X D;  2EXZ A;  2B2T A;  2RDF A;  2L1B A;  1AZP A;  2EYL A;  4KMU C;  5D3I B;  4ZUI A;  1HQR D;  5C5M A;  4CJ0 B;  2ZXR A;  1KAB A;  3D4R A;  3SVM A;  1B1Z A;  4TQU S;  4FF1 A;  2G9D A;  2Y0S B;  2E74 C;  2R7Z B;  3C46 A;  5KIX A;  5JVG 3;  3KLS X;  4G4K A;  4XIG S;  1LTT D;  1TKW B;  2I07 B;  2B2Y C;  1F9R A;  1CA5 A;  3C3L A;  1BO0 A;  2J7Z A;  1H9M A;  1A2T A;  2XRS D;  5LL6 S;  4G57 A;  2KA7 A;  2K32 A;  5K36 H;  1G29 1;  1JE4 A;  2WP8 J;  3VR4 A;  1PTO C;  5CV4 A;  4K6D A;  5C0X H;  4KV6 A;  1I4Q A;  5E4X A;  1D5Z C;  3WOE A;  1I6H B;  2F0I A;  1K83 B;  3MHB A;  4X3U A;  4GZY C;  5K36 G;  4A93 B;  4ZQ3 A;  4KHZ A;  1F2Y A;  2FMM A;  2X6L A;  3GTQ B;  1H9J A;  3MFY A;  1H9S A;  1CFM A;  3URY A;  4OIJ A;  4XT1 B;  2G9H D;  1IKM A;  1RHP A;  1JOR A;  2SNM A;  1MBY A;  4B08 A;  3PV0 A;  5F2D A;  2F0J A;  4C3I B;  1Z6H A;  1LT3 D;  1D5X C;  3D3R A;  1E2V A;  3MA2 B;  2VUM B;  4PMC A;  2F0W A;  1S5F D;  3NTI A;  4RH6 A;  4DGZ A;  3H0G B;  5JPM C;  1QNK A;  1M8A A;  1ZYR D;  1BCP D;  2B2T C;  1EZ6 A;  5D3D A;  5HGT A;  4DK0 A;  3FEW X;  1ET9 A;  2XWB B;  5C0X G;  3NWS A;  3V96 A;  2ICE C;  3BVZ A;  3PUV A;  1M4V A;  3R8B A;  1XXG A;  5HUR A;  2F0P A;  4UAI A;  1TWA B;  1TWF B;  1CK1 A;  3D6C A;  3OSO A;  5IOC A;  1QOH A;  2RDG A;  2B2W A;  1FYC A;  4BA1 I;  4BBR B;  1EU4 A;  2Z8L A;  4B9W A;  1C4Q A;  4KD3 A;  4NMZ A;  1WTO A;  1NSN S;  1G2T A;  1LAC A;  1QE6 A;  5KNB A;  1PTO B;  1E0B A;  1AFP A;  1BCP B;  4NDX A;  4WJW A;  2LS0 1;  2EYF A;  1EYD A;  1NR4 A;  4G7O C;  3P1H A;  1RDP D;  2PNR C;  2EYM A;  2F0K A;  4IUU A;  1Q1E A;  3HOY B;  1JOO A;  2BE5 D;  2EJG C;  2F0F A;  2L12 A;  3HOU B;  2L9H A;  1U4M A;  1IYV A;  3TDQ A;  5KGU A;  1WD1 A;  3Q6S A;  5M5W B;  5IGB A;  1GUG A;  2NTT A;  3HKZ B;  4IZ8 A;  3NUC A;  1EOT A;  4CHT B;  1EY5 A;  1BR9 A;  2AWO A;  1EIH A;  2DN8 A;  3MC0 B;  4A3M B;  4QUF A;  2EY1 A;  3S1N B;  4PV1 C;  3K57 A;  5CV9 A;  4I65 A;  2ZT9 C;  4WOR A;  1SNQ A;  1CTM A;  3H09 A;  4C3J G;  3DWA A;  2IX1 A;  3G6J B;  3ONA B;  5JAV A;  3HOV B;  5DM7 3;  1STY A;  1R4P B;  4ILW A;  1V1P B;  1SND A;  2B63 B;  4MIU A;  3T16 A;  1TWH B;  3MZ5 A;  1BBX C;  2Q8I B;  2O2L D;  5CBE E;  2K7V A;  2A6H C;  4QMG A;  1BDO A;  3N6R A;  2K03 A;  2KUM A;  5J22 A;  5EKK A;  5M3F B;  4LAA A;  3SK6 A;  4FF2 A;  2HCI A;  1RTO A;  4TSS A;  2IX0 A;  4KTA A;  5IGG A;  1PFM A;  1MGS A;  5E1F A;  2WAC A;  2DY8 A;  3NP8 A;  1ENA A;  1AW7 A;  4ME5 A;  1LAB A;  2PZT A;  2RA4 A;  3H6M A;  3KBX A;  4G7H C;  3I3C A;  3QJY A;  1KLG D;  3RD4 A;  5ELB A;  1EYA A;  4V0B A;  1TY2 A;  2F0V A;  1SXT A;  1IL8 A;  1PTO F;  3Q22 A;  3K6O A;  1CT1 D;  1MD2 D;  1XTC D;  4XTC S;  3S1Q B;  4K8J A;  2JA6 B;  2MPM A;  2A69 C;  2RSN A;  3BDO A;  5M5X B;  1WTV A;  3OIQ A;  3CRL C;  5I9O A;  3ND8 A;  4IUP A;  5DAU A;  2AQ3 B;  4FXG C;  1E2W A;  5EPK A;  2HUG A;  1EYC A;  4EQP A;  1IYU A;  3AU7 A;  3MTS A;  1AZQ A;  3GO5 A;  1S5C D;  3PUZ A;  1HQM C;  2IT1 A;  4M8A A;  4CKC A;  1Q8I A;  5COR A;  4K5V A;  3UI2 A;  3H91 A;  1YNJ C;  2QF7 A;  4EGV A;  1GUW A;  4KY6 A;  4EQO A;  5CYU A;  3EVQ A;  3J7Y W;  4S3S A;  3EA6 A;  2SOB A;  1GUN A;  3CHB D;  4ID6 A;  1BCP C;  3KLR A;  1TU2 B;  2YYZ A;  4A3E B;  2L4N A;  1H9K A;  1BCP F;  3J81 L;  5DM6 3;  2NVY B;  2BDN A;  3RMH A;  1PZJ D;  5IGD A;  3E5S A;  2IL8 A;  3FPU B;  2F0G A;  1RKN A;  2IJ0 A;  4RGT A;  5EJW A;  1E2Z A;  4RGM A;  3HEJ A;  2MJ8 A;  4A3F B;  5EPL A;  5KND A;  4KHV A;  1J8I A;  3HG9 A;  3V2T A;  1EQV A;  3DUZ A;  4EVO A;  2KCC A;  2O5I C;  3NE5 B;  3FVQ A;  4H13 C;  2KED A;  2LY7 A;  5I6W A;  4K5X A;  3ZYY X;  2ZXP A;  3MXG A;  2L0C A;  1BQQ T;  5I2X A;  2LKV A;  1HA5 A;  3IFT A;  1VDZ A;  2BE5 C;  3HZX A;  2Z4H A;  4DXG A;  2FIN B;  2XIW A;  1QCB D;  3R2T A;  2K01 A;  3X3M A;  3GTG B;  5C4H A;  4RA8 A;  2CW0 D;  3S2H B;  1SYD A;  1HUM A;  1WCM B;  4CKB A;  4EQN A;  1PMR A;  1SSO A;  2JYO A;  3T4A C;  5KYL A;  3FDT A;  3PUX A;  2AQ1 B;  3TN2 A;  3A54 A;  3GQB A;  2PYK A;  2BA1 A;  2F0D A;  3RUZ A;  2F0S A;  2GA4 B;  1Z47 A;  3A8J E;  1KDA A;  2AUK A;  3I91 A;  1O7Z A;  1ET6 A;  2X6G A;  3D4D A;  4DAP A;  2WII B;  1SYB A;  3A55 A;  3H94 A;  1IHZ A;  3Q23 A;  5EQ0 A;  3VYT A;  4A3G B;  5M3M B;  3IKJ A;  5A2Q E;  3GTO B;  1NAP A;  1PTO D;  4F88 A;  5E4W C;  5C4Z A;  1CHQ D;  2EY6 A;  1PRT B;  1XWE A;  3J80 E;  3BS1 A;  2B39 A;  4MN3 A;  4QB4 A;  4C3H G;  1FGB D;  1I50 B;  2NWG A;  5ELD A;  4IN3 A;  1DON A;  2Z1C A;  4HED A;  2WIN B;  1YNN C;  1JOQ A;  3TBI B;  3RZO B;  2E2J B;  3VYS A;  5IGF A;  2EYP A;  1O78 A;  4OHJ A;  5JEA H;  5JPN C;  2EDG A;  5FLX L;  1PXU A;  1EFI D;  1I3Q B;  1CI3 M;  1U4L A;  3MXU A;  1EU3 A;  2JEA I;  2DY7 A;  1PRT D;  1EZ8 A;  1SYG A;  1GUT A;  3OWE B;  3S1R B;  4A3D B;  3DWQ A;  1SMY C;  4OO1 I;  3DWP A;  1GUO A;  4FF4 A;  1DD2 A;  4HSP A;  1DOK A;  4IFD I;  2XN9 C;  4XQJ A;  3GP7 A;  2IPK D;  2F03 A;  1F9S A;  1SNM A;  3D6W A;  4RCO A;  4IFD J;  2O5J C;  4RHR A;  3PUY A;  5D14 A;  2D2C C;  3M7N A;  3VR2 A;  1KNE A;  1LT5 D;  1OXV A;  1VMP A;  1ENC A;  5CBA E;  2TSS A;  1F9P A;  1JIC A;  2MUY A;  2PQE A;  2J4X A;  5FK9 C;  1HA6 A;  4HR7 B;  1XYI A;  4IFD G;  2XNA C;  1TT2 A;  3VA7 A;  1BNZ A;  1JWM D;  3FMC A;  4AYB B;  5JEA G;  2DNC A;  1LTS D;  5EBD A;  2WAQ B;  5C4J B;  3TME A;  2KQ3 A;  3SK5 A;  2H4O A;  4BY7 B;  4F8M A;  1A2U A;  3CQZ B;  3I4M B;  1X3P A;  4RFB A;  4Q0F A;  1SFO B;  5JEA J;  1PZI D;  5I6Y A;  1B9M A;  5I9P A;  2PZW A;  1CM9 A;  2K04 A;  2F0U A;  1O7Y A;  4K5W A;  2NVQ B;  1D1K A;  3GD7 A;  3MFG A;  1QJO A;  5K5P A;  3HGB A;  2BOS A;  4H0L C;  1SJE D;  3NBI A;  3OW7 A;  2MGS A;  4L6T B;  4DXF A;  1ICW A;  3S17 B;  1G6Z A;  3NQI A;  5EKI A;  3I72 A;  3T53 B;  3PO3 B;  4FYD A;  4FXD A;  2F1M A;  1RD9 D;  3MAQ A;  5T1G A;  1SAP A;  2EYO A;  4KKS A;  3R93 A;  1TS5 A;  5C44 B;  3NQT A;  4H7B A;  1QIL A;  1VF7 A;  1J9O A;  1S5B D;  4CJ1 B;  3ERQ A;  5JVH 3;  1EEI D;  5KYI A;  2A74 C;  4DAV A;  4FVM A;  1F77 A;  3G7L A;  1SBB B;  3QIA A;  4IFD H;  3NWT A;  1IW7 C;  3PIP 3;  2CHB D;  3SHL A;  2KOL A;  2F0O A;  3SE0 A;  4BWG B;  3AB9 A;  2K6A A;  2R3Z A;  1FNW A;  5D65 A;  5KEE A;  1V43 A;  1JWS D;  4ZKB B;  2EVB A;  4HCE A;  5EPJ A;  1PFB A;  2L11 A;  2CW0 C;  3O13 A;  2NN6 G;  1SE3 A;  1WD0 A;  3GTL B;  5CV5 A;  1JR0 D;  4BS9 A;  2NTS A;  3SR1 A;  2Q8T A;  1Q1B A;  3SEB A;  4C3J B;  1GJX A;  2F0N A;  4XDX A;  3HOX B;  3OMC A;  3GV3 A;  1F9Q A;  2KEC A;  1EY4 A;  5M9O A;  3J80 L;  3TP8 A;  3EQL C;  2EE1 A;  4V19 0;  3L9A X;  4J1M A;  2B2W C;  1GUS A;  4R9W A;  2K5D A;  2C5C A;  4K2L A;  1DJR D;  3TZU A;  3DMU A;  1ZKO A;  2H1E A;  3BYT B;  3RLF A;  2A68 C;  5BN4 A;  3W3A A;  2B8G A;  1A15 A;  1D6E C;  2RBM A;  3HRZ C;  2QKI C;  5ELE A;  4F87 A;  3IAY A;  2F3V A;  1F2M A;  5AFW A;  2E76 C;  1JCK B;  2BCO A;  3RZD B;  3K59 A;  3MEH A;  1RCV D;  3S14 B;  1TS2 A;  5KNC A;  1TS4 A;  1WTR A;  3Q0A A;  2VXW A;  1ILQ A;  1LTG D;  4TKO B;  3P20 A;  1EY9 A;  1CHP D;  2D9U A;  1SNP A;  4FXK C;  2KCN A;  1EY6 A;  1EQT A;  1STG A;  3LWE A;  4XYQ A;  3CU7 A;  1H9S B;  1I4R A;  1KTK A;  5EBC A;  5CV8 A;  5C3W A;  1SDF A;  3DEP A;  2F0H A;  3I90 A;  4K8I A;  2ID0 A;  5ISR A;  2NUC A;  3BYY B;  3N52 A;  1JWU D;  1ILP A;  1O80 A;  2K28 A;  5FOB B;  1EWC A;  1EEF D;  5IGC A;  1TQO A;  1QG7 A;  1SNO A;  4OO1 G;  3OPO A;  1HHV A;  5EGT A;  2EZV A;  4QIW B;  1C48 A;  2ICI A;  1Y1V B;  4KN7 C;  3AMU A;  3HOZ B;  1ESF A;  4KJO A;  3K5M A;  3NSW A;  1RTN A;  1DYQ A;  1B53 A;  4U68 A;  1O7L A;  2OF1 A;  5C0X J;  1DZ1 A;  2D5D A;  2B2Y A;  2XVS A;  2SNS A;  2IWH A;  1A3V A;  4ZLT F;  3BZD B;  2N55 A;  2R61 A;  3LWU A;  1V8Q A;  2O4X A;  4DN4 M;  3TP7 A;  3IFD A;  5TSS A;  2XRQ D;  5IGE A;  1SYF A;  2EOT A;  3S16 B;  3P75 A;  1FNU A;  2WB1 B;  3OMG A;  2D62 A;  4MHE A;  4QUC A;  2R92 B;  3NTH A;  2EY2 A;  5FO8 B;  1V1P A;  1SYE A;  4QF4 A;  1QNU A;  3QO2 A;  4ZYS A;  1OXS C;  4A3K B;  2JXM B;  2VB3 X;  1WTP A;  2F0M A;  1S4Z A;  5C4X B;  3DHQ A;  4JK1 C;  4Q5V A;  1D1I A;  3C1F A;  1H9R A;  4KK7 A;  3WOF A;  1OO9 B;  1ZEQ X;  4N9P A;  3MVV A;  4XYO A;  1EY0 A;  3E6Z X;  2RKS A;  2NBF A;  3L3O C;  4P2C B;  1ML0 D;  1LTI D;  3LNN A;  1STN A;  1WVL A;  3T51 B;  4ZK9 B;  2JEB I;  3ERO A;  2CQA A;  1EY7 A;  1S5E D;  3TSS A;  3QOJ A;  4CBV A;  2E75 C;  1IKL A;  2JP1 A;  2JSO A;  3U9O A;  4XXE A;  4A3J B;  3R3O A;  1NR2 A;  5I2Y A;  4J6H A;  3FRP B;  3K5N A;  1SEB D;  1ONL A;  4KY5 A;  1TY0 A;  1DOM A;  1ROD A;  3SK8 A;  4HMJ A;  3J81 E;  1ENF A;  3DEO A;  2JE6 I;  1TVX A;  4IAL A;  3BVM A;  1TWC B;  4WRD A;  4CKE A;  5CR3 A;  3A7L A;  2EJF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...