1X32A

Three dimensional solution structure of the chromo1 domain of cpsrp43
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
47
structure length
47
Chain Sequence
GSGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords chloroplast signal recognition particle component
publication title Three-dimensional solution structures of the chromodomains of cpSRP43
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 2
structure length 47
sequence length 47
ec nomenclature
pdb deposition date 2005-04-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1x32A00
1X3QA 3FPUB 1CA5A 1G6ZA 3KUPA 1F2LA 3F2UA 2N55A 4NW2A 2D9UA 3TZDA 1NCVA 1ESRA 1RTNA 3DEPA 2RA4A 4HAEA 5CBAE 4CJ0B 2JYOA 2RSOA 3GV3A 1VMPA 4IUQA 1EIHA 1DOMA 1O80A 1B53A 2K04A 2EOTA 2B2YA 2HCIA 1U4MA 1X32A 2BDNA 2Q8TA 2FMMA 4HSVA 1PLFA 1BBXC 4HCSA 1ICWA 3R93A 3HP3A 5COYA 1EL0A 2R3ZA 2MP1A 2EPBA 3MTSA 2CVRA 5EKIA 2K1BA 4RWSC 2B2UC 1A15A 1PFNA 2NWGA 1G91A 1HHVA 4IUPA 5T1IA 1BF4A 1NR4A 4MHEA 1AP0A 3KBXA 3Q6SA 2X6LA 1NAPA 4RAUC 2B2VA 2NZ1D 1DOKA 2Q8RE 1ILPA 1M8AA 2K03A 1E0BA 3UI2A 1RJTA 2NYZD 1KNEA 2B2WA 4OIKA 2MJ8A 1B3AA 2B2TA 1WD1A 1C8CA 2KVMA 1B2TA 1WTQA 1F9SA 4IUTA 1MSHA 4U68A 1WTWA 2X6GA 5DNFA 4X3TA 1ML0D 1ZXTA 1NR2A 4X3KA 5EQ0A 5D65A 2L9HA 4O42A 3DM1A 4UAIA 1RHPA 4QUCA 4ZKCB 1LV9A 4R8IA 5D14A 2K01A 3H91A 2K05A 1XYIA 1U4RA 1HRJA 1S4ZA 1WTVA 4X3SA 1KNAA 5T1GA 1VMCA 5E4WC 1IKLA 1O7ZA 1DZ1A 3P7JA 4MN3A 3G7LA 3D6WA 2X69A 5CORA 1HFGA 5EPKA 1HUNA 1PDQA 1CM9A 2HUGA 3MWYW 1F9PA 3ONAB 2SDFA 4IUVA 5EPLA 1JICA 2J7ZA 1WTPA 1GUWA 2KUMA 4IUUA 2N88A 1SDFA 1WTRA 3N52A 1IKMA 5AFWA 2B2UA 3SVMA 1BO0A 1U4PA 3IFDA 2JP1A 1TVXA 2L11A 2HDLA 3QO2A 1RTOA 1XX8A 1AZPA 1J8IA 5EJWA 1G2SA 2DY8A 2FHTA 1J9OA 4HEDA 4DN4M 1WVLA 1ILQA 4XT3B 2RVLA 1SAPA 3IL8A 3I3CA 2HCCA 1HUMA 1EOTA 2KEEA 2VXWA 1CA6A 2KEDA 2FFKB 4QUFA 2MGSA 2MPMA 4OIJA 1DOLA 1B4OA 1JE4A 4RA8A 2H1EA 4XT1B 4ZLTF 2XIWA 3TN2A 1MSGA 3DEOA 4ZK9B 4R9WA 2RSNA 2FINB 1AZQA 3I91A 1IL8A 1MI2A 3I8ZA 1G2TA 1O7YA 2DY7A 1WTXA 1U4LA 2L1BA 1MGSA 1QNKA 3GV6A 4ZKBB 4XDXA 5CBEE 1RODA 2EE1A 1X3PA 2B2VC 1QE6A 1QG7A 2FJ2A 2IL8A 1F9RA 1EIGA 4CJ1B 4CJ2C 4X3UA 2KOLA 2HDMA 1F9QA 3FDTA 2B2WC 5CMDA 3LWEA 1B50A 2L4NA 1BNZA 2B2TC 5JJZA 1Q3LA 1DONA 1EQTA 1HA6A 4IURA 2L12A 5E4XA 1HFNA 2KECA 2B2YC 1PFBA 4ZAIA 5EPJA 1SSOA 2M2LA 4LMQD 1WTOA 1WD0A 3I90A 1PFMA 2K28A
chains in the Genus database with same CATH superfamily
2B63B 3TMEA 1PXUA 2R7FA 2SOBA 1PRTF 3CMEA 1I6HB 4DR4Q 2VY3A 2B2YA 1YJ9A 1Q82C 3W2DA 4KKTA 3S15H 2B39A 3I55A 5BN3A 4EX5A 4JV5Q 4P72A 3ICEA 2AWOA 1SYGA 4I7ZC 4DUYQ 3GTPB 1I4HA 4GNXC 2NVYB 3KBXA 2QCPX 2X6LA 1VQ4A 2E2HB 1SNQA 1XTDA 1LABA 3W5OA 4A3MB 3CCJA 4GKKQ 1RJTA 2NYZD 1T5XD 4GS3A 2JA7H 2MJ8A 3GTOB 1RCVD 2D0OA 1RKNA 3JC66 5C0XI 3R2TA 5DNFA 1ZXTA 1EFID 1Y1VH 1SYFA 4C3HG 1NJIC 3S2DB 3OW7A 4K5WA 1S4ZA 4JOIC 1WTVA 2CW0C 5T1GA 2IT1A 2MFIA 5BN4A 3FEWX 5ELCA 1KAAA 3P7JA 3TP6A 2UUAL 3D6WA 3HOYH 1HFGA 2IHEA 2OQ0A 1XNQQ 1EZ8A 1LTBD 2RF4A 1VQIA 1PH4A 4CDDC 3MHBA 2KHSA 1IKMA 3V96A 3SVMA 5JVG3 4NDXA 2KCTA 3I72A 1I4GA 2K75A 3CPFA 4G4KA 4NXNQ 4RCNA 3VA5A 3K80C 4JYAL 2F3VA 5JJLA 3GD7A 1HUMA 5I2XA 4Q0FA 2VXWA 3O13A 4XQJA 2QEJC 2FMCA 2KEDA 2EY2A 1TKWB 2EYJA 2MGSA 3DHQA 2VB3X 4CKCA 3N6RA 4IPCA 2Y0SG 3FPPA 4R9WA 3BU2A 2GN5A 1IL8A 1SFOB 3I8ZA 2DY7A 5NUCA 4K6LA 2R61A 1YBYA 1Z9FA 3A74A 4DUZL 3NSWA 1E2ZA 2F0EA 2BCOA 4X62Q 1LTID 4DV7Q 3T56B 3GO5A 1XMQQ 4HJ8A 3STBD 1X56A 3DUZA 4DK0A 4M1UB 5BR8L 2OTJA 3EVQA 1PFMA 4C3HH 1GM5A 1HZAA 2EQSA 3F2UA 3OSOA 1CZGA 2KCCA 1NCVA 3DEPA 2K4KA 2N8NA 5K5PA 3PSIA 2OT2A 3HKSA 2ZM6L 4N9PA 2R93B 3VYTA 4OX9Q 4B3MQ 1TWGH 2PMZB 1NSNS 2R3ZA 3KDFA 1WI5A 3H3VH 1VQ6A 3HKZG 2Z9HA 2DNEA 1NUCA 2UUBQ 2V4DA 4JBWA 4RGMA 3E6ZX 5A35A 1NR4A 5IIFA 2JA6G 2GVBA 1D2BA 4RAUC 2R7ZG 5KRUA 2AQ3B 1ZKOA 5IT9L 1YEZA 5IGEA 3M9BA 2MO0A 3PIO3 1LTSD 2KENA 3ERQA 2V1CC 1Z47A 5IODA 1K8GA 3I4NG 4UDUC 3SK5A 1DM0B 5M3MG 1KLGD 4R1JA 4POFA 2VQEL 1FD7D 3K57A 2JJQA 1UEBA 1HUNA 3STBC 3W3AA 3VR3A 2HUGA 3E9IA 1B70B 4IJHA 1GUWA 1EOVA 3BDOA 4TQUS 3RZOH 4KD4A 3AMUA 1OXVA 5I9PA 1C7YA 5AFWA 3S1MB 3CP0A 1VQAA 4FP5D 4JI1L 2JA8G 1PH8A 4BY1B 1HZCA 1J8IA 1HNZL 2WKDA 4JI7L 3M3YB 2WFWA 4HIKA 3J7ZC 1TWCB 3OIPA 2JE6I 2JK8A 2NVTB 4QY7A 5F2DA 4A3IB 5K36G 1B9NA 2ZJPA 1FGUA 1SMYD 2AWNA 5C3EG 4DR2Q 3CCEA 4JI6Q 1G8ZD 3RZDB 4A93B 3S24A 1CK1A 1LT3D 1STNA 5H1SE 4PV1C 2F0UA 4DAVA 2JA6H 1QUQB 2R7ZH 1S72A 1QE6A 4K14A 3VYSA 1PH1A 3CPWA 2ZXRA 1GXDC 2YU9B 5IYBG 2VZAA 3KLSX 4RGOS 5I9OA 5IGFA 2WACA 3F2DA 3I4NH 3AFQA 5M3MH 1VQ9A 1JC7A 1Q12A 4KKUA 1C9OA 2H5XA 2AUJD 3EIVA 1TS3A 3G6JB 4P75A 3UDXA 4HIOA 2IWHA 2UU9Q 4NXML 2YTVA 4O1NA 1DD2A 1D6EC 3J81j 1RTNA 1HNXL 2JYOA 4HR7B 2F0DA 1W6JA 2VQFL 2HCIA 3U4VA 1IBKL 4HMIA 4AQYQ 1IXRA 2EPBA 4DV0L 1BUVT 3D4RA 5JOBA 2CVRA 2G9HD 3MXNB 4H44C 5M9OA 2F0HA 2JA8H 4DV2L 1S5CD 2RCNA 2B2VA 1ENCA 3I4MB 3QR8A 1SMYC 3K5MA 5K36H 1CHPD 3PQIA 5C3EH 1IBML 1F9SA 2PQAA 5C44G 4P73A 4JI5L 2EZVA 4WFN3 1ICFB 4UAIA 3NQIA 1YNJD 1K0SA 3A8KE 3DWAA 2F1MA 1KNAA 3GTLH 4H0LC 1JOOA 2WAQG 1I50B 5EPKA 3ITPA 4Y7NB 3S14B 5IYBH 2AUKA 4IUVA 4KY7A 2N88A 2LY7A 3TDQA 1V9PA 4YCWA 3IFDA 4QGUA 2E2IH 5CV6A 3SR1A 1OTCA 4PNYA 2IX0A 3NTKA 1KAWA 3OIQA 5LMUL 2RDHA 3MC0B 2Z4IA 4JI7Q 4B3RL 3SK4A 1D5XC 3OW2A 5EKKA 1L1OB 1EOTA 3HOWG 3ER0A 1X9NA 1CQVA 2VS1A 2JEAI 2QW7A 1NBWA 4KTAA 2FFKB 4WJWA 1F77A 3PUWA 2CCZA 1D1KA 5FJ8G 2PQEA 5FLMG 1PZID 2Q8IB 2WV6D 5C3XA 3JAML 3KK7A 4B9WA 1UUPA 2L55A 4DV1Q 2A68D 4PZ8A 3FMCA 4J1MA 2I5LX 1VDZA 1S5BD 2KCMA 1EIGA 2Z6BA 2HQEA 4K8IA 4S3SA 4RKBA 3FDTA 4CBVA 5CMDA 2HD3A 2IPKD 1BNZA 3H0GG 3A55A 5C44H 5D3IB 3S16H 4GOPC 4BBSG 3UDFA 4DF7A 1OXTA 1EY5A 4WJ4A 3C1FA 4NXMQ 3F2BA 3K59A 3T13A 5I6WA 1N33L 2A8VA 3S2HH 1B53A 1YJWA 4DR3L 1EUJA 2F0SA 1X32A 3PUVA 1IBKQ 5M5YB 5GAEC 1YVCA 3TP5A 1HZBA 1NTGA 2F0IA 2O4XA 1ET6A 5C4ZA 3OMGA 5T1IA 4BY7B 3BYTB 1PV4A 4DK6C 4DV2Q 3UE0A 4QJFA 2VUMG 3UI2A 4FYDA 3TEHB 3HOWH 1KHIA 4C3IB 1YNND 1B3AA 2D2CC 1EWCA 1B2TA 1R4PB 4DR1L 4OWTB 1YHQA 3M4PA 5FJ8H 2AMCB 5FLMH 4UP8A 2IX1A 3DWQA 1C4QA 3BDLA 5KYLA 3VA7A 1GUSA 1HR0Q 3KF8A 3OWFA 1S5DD 2XGTA 4X3SA 2OXPA 3H0GH 3KLRA 5IWAL 1SNCA 1WTPA 1V1PB 4BBSH 2VB2X 1CTMA 1L0YB 2N3SA 1QVFA 4WJ3M 3D31A 1EYAA 1BO0A 2MO1A 5LMUQ 4B3RQ 2FHTA 2OQKA 3CC4A 1ILQA 3VR2A 4DPGA 2F4VQ 1SE4A 2JA5B 2PZTA 4LF4Q 1QZHA 2K7VA 1DOLA 2K5HA 3D8GA 3M4QA 1SNMA 1TY2A 4KV6A 5ELBA 4K2LA 4L8JA 2UXCL 1YHAA 1MKHA 4HJ9A 3J80E 4JI0L 2R92B 1A3UA 1EYCA 4DR5L 3A54A 2VUMH 1LUZA 1F9RA 1YNNC 2ID0A 2B29A 2BOSA 3EJIA 5C4XG 4E6IA 1YHBA 2ZTEA 2NZOA 3K7AB 3LNNA 3I4OA 4DAYA 3CF5A 1VQ5A 1LT6D 3NTIA 1STAA 1WD0A 4IQZA 4DNTB 1EY6A 3OOCA 3HZXA 5HURA 1KDAA 2XRSD 1WFQA 2IHFA 2R6GA 1I6VC 5IE8A 3J7AF 4ME5A 1QCBD 1KTKA 1EL0A 3J7AV 3GTQH 1V1QA 5C4JB 1G51A 1CKNA 4MHEA 4DV6L 1B3QA 1EEFD 1LTGD 2J0TD 2XNAC 1KNEA 3T53B 1PRTC 1JOKA 5HGQA 3SHLA 1PTOH 4A3EG 4K2KA 1HNWL 4U68A 1K28A 5IP9G 2Z6KC 4IFDJ 1JR0D 4HSPA 5FOBB 4H02A 4RGNA 2WP8J 4GKJL 1YZ6A 3KF6A 1JT8A 1HRJA 1A2UA 4JI8L 1SN8A 4JI3Q 1DYQA 3OTOL 3CAMA 2X69A 1Q81C 4KLKA 1PDQA 2WB1B 3MWYW 5IWAQ 1FR3A 1W3SA 2EY1A 1KL9A 2MQHA 2KUMA 1Y1WB 3DLLA 3BZKA 4ZQ3A 1EY0A 4FO2A 1IZ6A 2JP1A 4R4CA 2L11A 2A73B 1CUKA 3K7UC 3GTKH 2QDLA 1U5KA 1QB5D 4Y52H 1RF2D 3GTJH 3FKIB 1TWFH 3K58A 3K81C 2XWJB 2C5CA 3TS2A 3HOXB 3HOZB 1N36L 4MTNA 2ZXPA 2I5HA 2E75C 2TMPA 4ZK9B 3ULJA 4R4OA 2UXCQ 4A3GG 1TU2B 4JI0Q 1MI2A 3RD4A 1PH6A 4AYBG 5J3BA 1U4LA 1GHKA 3CD6A 4PG3A 4DR5Q 2HHHL 4DR6L 2KHIA 3EQLC 5JJIA 4IPDA 4BBRG 4ULLA 5CV8A 4X6AH 4DV3L 2GVAA 3X3MA 1EQTA 3MEHA 3M7NA 5JEAG 5IP9H 2F0WA 4HTHA 1VQHA 3JAMi 1CA5A 3KUPA 2JXMB 3T1YQ 4B9XA 1XTCD 1MJCA 3TZDA 4F8MA 4A3MG 4CJ0B 1VMPA 2OF1A 1MHWC 3G48A 5IYDH 1VQBA 1C0AA 4GOPA 2EOTA 1EY7A 2PW7A 2F0LA 1DGSA 1SE2A 4OONA 4A3CG 1STYA 4GN5A 3RR5A 3CCRA 5KNCA 2H4OA 1K83H 2KHJA 5CV7A 1F2ZA 1RL2A 3IFTA 1Q86C 1FJGL 2JN4A 3ERSX 1H9RA 4NMZA 3EN2A 4X64L 1E22A 1HNWQ 2QF7A 2QILA 3QWNA 3GTGH 4UP7A 3VYRA 4CKEA 4A3GH 1GHJA 4B3SL 3HOVG 4GKJQ 1UE7A 4DV4L 4JBKA 1E7ZA 4JI8Q 3S15B 1UE6A 4BBRH 3PO2B 3G7LA 1B44D 2CQAA 1ET9A 4PZ6A 4ODGA 5FKAC 1T5EA 3BS1A 1JOQA 5EGTA 5JEAH 1A3TA 3A7LA 3N52A 5HY6A 1I4PA 3T1HL 3GTPH 3CQZH 4A3MH 3BJUA 1J5EL 4LJZC 4XT3B 1TS5A 3GTOH 4WORA 1BQQT 4YY3L 3NK9A 4A3CH 2WIIB 4LF9L 3IAYA 1MSGA 1XJVA 1Y1VB 1KDBA 5FLXc 1TQOA 1YI2A 4BS9A 1HA5A 3PIP3 4N8FA 2I5MX 5G3LF 3NPPA 1QNKA 1UE5A 1TT2A 2HHHQ 4QUCA 1X3PA 1NMFA 3U9SA 5J1ZA 4CDFC 2KBNA 3M4OB 5JJZA 2YTYA 4DV3Q 4LK1C 3HFZB 3H94A 1FL0A 2WB1E 2LS01 1WTOA 1BXTA 3I90A 1QJOA 1Z7TA 3HOVH 4L5RC 1ESRA 1PH2A 5LL6S 1PVOA 3HOUB 1LLRD 3K6OA 1W2BA 1X55A 4LFCL 5GADC 4MIUA 4ZUIA 3R8BA 5GAHC 2PZWA 4KMUC 5L37A 2EXDA 1VS0A 1WYDA 4DKAC 2F0NA 2VL6A 4FDBA 1NAPA 1ILPA 1DOKA 2RDGA 3NWSA 2EYMA 3TBIB 2ZJRA 2B2WA 1FJGQ 2RHQB 2UUCL 2F0VA 1QZGA 5J22A 1H9SA 1BBUA 3H6MA 4KD3A 4FXGC 1UEAB 4OO1G 1FYCA 1HCZA 1RHPA 4HCEA 5A2QE 4MNOA 4B3SQ 3J80c 4DV4Q 5KYIA 5I2YA 1ASZA 1O7ZA 4DU9A 4MN3A 5BN5A 2R93H 4IFDI 1VQNA 1TWGB 4C3JB 1H9JA 1JB3A 1LTTD 1D8LA 1LTRD 1MBYA 1GJXA 4BA2I 4G7ZC 3B6YA 4XYOA 3T1HQ 4RHRA 1S40A 1TVXA 2NVXB 3NBHA 4DN4M 4OXPA 3SK8A 1WVLA 1J5EQ 3PO3B 1X3EA 1QOHA 3P75A 4YY3Q 2Y0SB 4KKSA 1EQQA 4OIJA 2NVQH 4LF9Q 3PUXA 2UUAQ 2E2JB 1M1KC 3EBEA 2RSNA 3NENA 1AH9A 1CFMA 1JB7A 3FP9A 3AFPA 3KFUA 1UWVA 3NQTA 4CGYB 1FNVA 3KJOA 1A3VA 2OEOA 1S5FD 3U58A 1HA6A 4JYAQ 4IURA 3U9OA 4C1NI 2M2LA 4LMQD 5IGBA 4OO1H 4L63B 1G6ZA 3M3YH 1AN8A 1TWCH 5E7NA 2NTSA 2R7DA 2E74C 5CBAE 2RSOA 2NVTH 5GQOA 4A3DG 3NHHA 1Q7YC 3QB3A 4LFCQ 5C0XG 1LT4D 2YV5A 4LF7L 1OXXK 1PLFA 5I4DA 4J8QA 4DUZQ 3MTSA 3X3NA 3A8JE 5M3FB 3CRLC 2EJGC 2R7ZB 3V2TA 4YWLA 4K0KL 5BR8Q 1S3OA 3Q6SA 1U0LA 3T16A 2K03A 1NMGA 1GUGA 1EWHA 2EJFC 3FRPB 4UHVA 2K32A 3A7AB 3G4SA 1I3QH 2KJXA 3I4NB 1Y8NB 5J39A 1PHJA 1RDPD 2SEBD 1N32L 1WJJA 2ZM6Q 1GUOA 2HT1A 3PUZA 4P71A 3CCMA 3J81c 1XYIA 1STBA 3RUZA 1PH5A 4JK1C 1IKLA 2SNMA 3CCUA 4LF6L 1GVPA 3LGJA 4DAYB 2RKSA 4IALA 4FF4A 1QNUA 4PMCA 3QOJA 1KRTA 1CHQD 3HEJA 2OWOA 4C2MH 1MJEA 5CV9A 1TY0A 4LUZA 4XQQA 2HDLA 4A76A 3QO2A 1RTOA 4GNXA 2XWBB 4CKBA 3CCQA 2RVLA 1SAPA 1R9TH 4A3DH 5C3EB 3M85A 1A8VA 2RHSB 5C0XH 3TRZA 2RCFA 2VQEQ 1L1OC 5M5XH 2C35B 4A75A 4ZLTF 2ES2A 5JJKA 3M7GA 1CKNB 4NPSA 1NNXA 1ENFA 1V8QA 1GUTA 3GTLB 1GO3E 3L7ZC 1PZJD 4JOIA 3ULLA 2NB0A 1IW7D 4ILWA 2Z4HA 4X3UA 2CWPA 4JI1Q 3UDGA 4RHSA 1B50A 2J4XA 2B2TC 1HNZQ 5E3FA 4EGVA 4IPGA 3NBIA 5DM63 3BYYB 2E2IB 1E1TA 5EPJA 2BH2A 5EBCA 4AIMA 1ZYRD 3QOLA 2DNCA 1XNRL 3KF6B 5JAVA 3AEVA 4IPHA 2E76C 5DM73 2F0KA 1L2FA 1WCMB 2RA4A 4L6TB 4C3IG 1O80A 1XMOL 5IY0A 1P8LA 1VQPA 3I2ZA 3KYHC 1H9MA 2EYFA 2Y0SE 2XSCA 5M5WH 4RH6A 3L9AX 2QA4A 2B2UC 1A15A 1G91A 4K0KQ 2NZHA 3GTMH 4TKOB 4EQNA 1ZEQX 1YNJC 4UPAA 4HIDA 4B08A 1M8AA 1E0BA 3D4DA 2A69D 5KGUA 3S16B 4KN7C 3DWPA 1SJED 1JWSD 1HNXQ 4KJNA 2X6GA 1ML0D 2Q2IA 2NN6I 2VQFQ 1SBBB 5FLXE 3T4AC 1JCKB 5KNDA 4ZKCB 1LV9A 2F3WA 2Z0SA 2WAQB 1IW7C 2F4IA 4DV0Q 3S2HB 2XTIA 2K5DA 1CI3M 1Q8KA 3K5NA 4LF6Q 1KLUD 4PMBA 5CORA 5M5YH 1X3GA 2EYPA 1K8AC 2QKIC 1BKBA 2J7ZA 1ZYRC 5IGGA 3NELA 2DUDA 4OGQC 1IBMQ 3HKZE 4BY7H 4ME3A 4JI5Q 4DAPA 4A3JB 1WTHA 2E2DC 2O2LD 2A68C 1XX8A 4X66L 4LWCA 3HOWB 2BDOA 4C3IH 4X65L 1EYDA 1EY4A 2KEEA 3V05A 5ELEA 1PYSB 5C5LA 4OWWB 1Q1BA 4QUFA 1H95A 2UXDL 1E1OA 2AQ2B 5IOCA 1WOCA 4A3BG 1DXMA 5TSSA 2LXKA 1Y14B 3QJYA 2OTLA 4B3TL 3E9HA 3FPUB 2A69C 5IT9c 5GROA 4YHHL 3NXWA 5CYUA 3P1HA 4BBSB 1DONA 2E5LL 5EAYA 4C1NK 1TIID 4GN3B 1PA6A 4PZ7A 3KBGA 2ALYB 2K6AA 5E4XA 2Z8LA 1N34L 1J6QA 4G7OC 2F0FA 1I94L 1ESFA 1QUQA 4MTKA 4V190 2DGYA 2K14A 1M90C 1VQ7A 3VR6A 1F2LA 4A3FB 2D9UA 4ZCKA 4L5SA 2A1AA 4QQBX 4IUQA 1LT5D 1CKOA 2JA5H 5CGKA 1XMOQ 2BA1A 1I4XA 3RLOA 2DN8A 4HSVA 1PZKD 1YNXA 3NEMA 3GQBA 4KY5A 2PPBC 2RBMA 3AU7A 4DNIA 1Y69U 4DA2A 3CCVA 1AW7A 2CHBD 3CHBD 2TSSA 4TRDA 2VUMB 2F0OA 4UY8C 4QB4A 5FO9B 3S1RH 3PMFA 4OL7A 2WB1G 4CDCC 3S1NH 1SYBA 1WD1A 4JW0A 1BDOA 4DV5L 3IKJA 3M4YA 1SEBD 5CR3A 1N33Q 4A3BH 4DR3Q 1HH2P 4YCUA 4PMWA 2CKZB 3PF5A 4DNRB 5EQ0A 1TWHH 2YTXA 4DR7L 1GOZA 5D3DA 4R8IA 3A8IE 1EZ6A 4PQXA 1QWYA 1ENAA 2A74C 3FKIG 1KQSA 2F0PA 1K8OA 5G3LD 3RN2A 2CFMA 3QIAA 1W6KA 1N9WA 3MVVA 5ELDA 3ONAB 4ZRZA 5DLQE 5DEHA 2VW9A 4CHTB 4O0AA 1I4QA 4DR1Q 4F87A 3J80L 1JMCA 3R2IA 4NP5A 1AZPA 4HEDA 2E8GA 1PTOB 4X65Q 1Z6HA 5ELOA 4HIMA 1SLJA 1STEA 4RA8A 4A3KB 4XT1B 1K3BC 5IYDG 3AQQA 3DEOA 2M00A 4HN7A 4ID6A 4RMFA 3I73A 4EQPA 2L5TA 3H3VI 5KIXA 4L5TA 4YCVA 4B3TQ 3C46A 1CT1D 4YHHQ 5C4XB 2WAQE 4LNQA 2D62A 2PI2A 3BZDB 1KD1C 1H9SB 3WOEA 2L15A 2L12A 3SGIA 3S17H 1VQCA 1Y8OB 3MZ5A 1HZ9A 3PGZA 1I94Q 5KEEA 1PYWD 3KDFB 2L0CA 1IHZA 1SNPA 3GTJB 1LACA 2B63G 1E2VA 1EY9A 3J81E 3FKIH 2ATWA 5LMNW 3MEFA 2F0JA 3HP3A 1EIYB 2MP1A 4RGTA 3I4LA 2ZJQA 5EKIA 1PMRA 1HHVA 1BCPB 1PFNA 2ASBA 3MXUA 1QVGA 4KJOA 1QILA 1CSPA 2BA0A 4A3EB 3PO2G 3P20A 4OHJA 2EXZA 4OWXB 1E3PA 3BVZA 4XYQA 2RDFA 3S1QB 1PH9A 1C8CA 3H15A 4IUTA 3VR5A 4DV5Q 1SMXA 2M9VA 1TWAH 4DR7Q 2KQ3A 3URYA 1LTLA 1YJNA 5D14A 1B7YB 4EQOA 1ASYA 5LHY1 4DFAA 4L5QA 2MHVA 1DZ1A 3K0XA 3WDNA 4KN4C 4DV6Q 2C9OA 3RLNA 2JA9A 4FXKC 2SDFA 5JPNC 3U4ZA 1SDFA 1K83B 4J15A 3RNUA 1EIFA 2N49A 2NTTA 5GAGC 4V0BA 3K5LA 1JQYD 4U673 2B63H 2I46A 4DV7L 3SDZA 2IY5B 1KIXA 5E1FA 3I3CA 1XXGA 1JJ2A 5C3WA 1V1PA 2EYHA 1I6HH 2O5IC 3GTGB 3G71A 5LL6X 4A3GB 1K73C 2XIWA 4AYBB 3OTOQ 1OXSC 2FINB 2LXJA 1VQLA 1S5ED 3D3RA 1A0IA 1O7YA 4N9TA 4FF1A 2KCNA 3AB9A 4A3LG 1MGSA 2UXBL 4BBRB 1RODA 2EE1A 1UAPA 2B2VC 2B3GA 4OX9L 4YIJA 3CC7A 3HOUG 3PO2H 4KK7A 4EQ5A 4B3ML 2FXQA 2HDMA 2NVYH 2F3IA 2E2HH 4GZYC 2QDBA 4XIGS 2JA7B 3CC2A 1II3A 1L0WA 2PYKA 2UUBL 1JWMD 1D5ZC 1BCPF 3ND9A 3CQZB 4I65A 5FK9C 2PW5A 1N36Q 2K5QA 4NW2A 3S2DH 2ENBA 4BXXG 3TP7A 3Q8DA 1GKHA 2F0MA 2FMMA 2HIXA 3HOYB 2IJ0A 3F2CA 4WRDA 4HCSA 4DR6Q 1TS4A 5ISRA 2G9DA 1D7QA 2R93G 3IRBA 2PQAB 1Y8PB 3E3XA 2NWGA 4APVA 4GNXB 4IUPA 3TS0A 4ABNA 4QL5A 3M4OH 3DM3A 3CXCA 1BBWA 2B8FA 4OIKA 4C3JG 2K33A 2WINB 4F7XA 4X3TA 4DK1A 4FF2A 1T9HA 5JPMC 1FVIA 4R4QA 3HOVB 2QGQA 4LF5L 1VQDA 3EROA 4RCOA 3AYHB 2K5NA 3BVMA 3D0FA 4A3LH 4XXEA 1SFOH 3HOUH 2IX3A 3PO3G 4YWKA 4DR2L 3DXJC 5E4WC 4JI6L 5IT9E 4LFBL 4OELB 1F9PA 3Q23A 5EPLA 3PUYA 2EJMA 2Q2HA 3H3VC 1V1OA 1VQMA 4X64Q 1PFSA 4FF3A 3LWUA 4C3HB 2G5DA 5KNBA 2DY8A 1A63A 1AFPA 4M8AA 4BXXH 4BY1G 1LM0A 5CV4A 1BR9A 3NP8A 2ZTCA 1JE4A 4O2DA 2UU9L 4A3IG 1VF7A 2BH8A 2PO4A 3I7FA 4HJ5A 2Z6KA 2JEBI 3I91A 4A93G 1HTLD 1EQVA 2NUCA 3J80i 4DXGA 5C6AA 5AJ3L 2UXBQ 5CBEE 2AQ1B 2CQOA 1QG7A 2FJ2A 3MAQA 3CCLA 4AQYL 3LWEA 4C3JH 3BG3A 3F8TA 2AHOB 1EU3A 1X3FA 4LAAA 4ZAIA 1PFBA 5M3FG 4FNFA 2NVXH 2K28A 1AE3A 2MUYA 4GN4B 1HTPA 1PH3A 2A6HD 3PO3H 4KHZA 1PH7A 1C48A 1EQRA 1LTAD 5JEAJ 4K8JA 3A0JA 5IP7G 2K04A 2NVQB 1SJHD 2P5ZX 1SNDA 1JJGA 5IGDA 2E2JH 4JI4L 1K0RA 3RZOB 1VQFA 1MD2D 3Q24A 2VNUD 4R4IA 1O7LA 4AYBE 1GD7A 1UE1A 3CKIB 5A2QL 1P16A 1RD9D 3KLWA 3S1MH 3RN5A 4LF8L 3KF8B 4BY1H 4P74A 3C3LA 2GA4B 4XTCS 2EYOA 3I4MG 1WTWA 2DJFC 4A3IH 1OXUA 5FO8B 3CRKC 4ALPA 1UNSA 3RZDH 4LF5Q 1NE3A 4A93H 1STGA 3HKZB 4I7AA 3H91A 3L0OA 4NKLA 2JA6B 3K8AA 1AEXA 4JCVE 2F03A 1O7IA 3MFYA 4LFBQ 2QEXA 4IJLA 1I5FA 2K5WA 4DV1L 2LMCB 1JICA 2YU9H 1WTRA 3J7A5 5M3FH 3K5OA 2UUCQ 1HPCA 4Z9CB 2CH4W 5M3MB 2A6HC 1U4PA 3ND8A 1SYDA 4G57A 2F0TA 1SYCA 5IP7H 1EEID 1I3QB 5C4HA 3ZYYX 4K5VA 4KHVA 1JJCB 1XPUA 2Q2UA 4RFBA 1B4OA 1Q1EA 4HJAA 5LMNL 3K0YA 3TQYA 4F88A 4TSSA 2LFNA 1AZQA 2AKWB 1DJRD 3J81i 3MXPA 1WCMG 2F0QA 1FNWA 5AJ3Q 1Q90A 3GV6A 2JA8B 3NWTA 1VQEA 1HJPA 3OYYA 1LYLA 1F2YA 1CKMA 1ONLA 2KOLA 2MNAA 3LX0A 1X54A 4QIWB 3I4MH 1IYJB 1K8MA 1HQRD 1LO5D 4H13C 4R4TA 3I70A 2XRQD 4C2MB 3JAME 1D5MC 2SNSA 1SSOA 1X3QA 1K3RA 1Q46A 4TVAB 2N55A 1R9TB 4A3DB 1CZWA 5JVH3 1B9MA 1EIHA 4LFAL 5M5XB 3UE1A 3OHXC 3VDYA 4CDEC 2N78A 1U4MA 2EDGA 2F52A 4QMGA 1E2WA 1I50H 3EFXD 1JWUD 5COYA 3PIPA 4Y7NH 3NE5B 4IN3A 1HR0L 4FXDA 3S14H 4JI4Q 3H09A 2D5DA 2HIVA 4RWSC 3PF4A 3TSSA 1BF4A 1AP0A 4N8X1 2NZ1D 4LF8Q 4BY7G 4IFDG 3VR4A 2PNRC 2EYLA 4JI2L 4Q5VA 1WTQA 2IW3A 4QF4A 2PMZE 3DMUA 5EBDA 1BVSA 4X3KA 4IOAA 4LF7Q 2L9HA 3TREA 4A3JG 2KA7A 2OCEA 1WCMH 4DAMA 2F4VL 2K01A 4LUVA 2HQLA 4LF4L 5DAUA 4ZYSA 1RIPA 5HGTA 3U50C 2Q2TA 1G6PA 1CM9A 3KLSA 4JBJA 5M5WB 5C44B 4DGZA 3GTMB 1EFWA 3QG1A 1SR3A 4JPBW 1N32Q 1N8RC 1A6XA 1J9OA 2BE5D 3FHWA 3Q22A 5C5MA 4QCLA 3CW2C 3GP7A 2EY6A 3ZJYC 3MFGA 1KABA 5I6YA 2A19A 1TR5A 2PCFB 3A5ZB 3KOJA 2JA5G 5LMNQ 4KI0A 3SE0A 1IYUA 4A3FG 3TZUA 2DJGC 1Q8IA 1WTXA 1G2TA 4K5XA 1SYEA 1X65A 4XDXA 2R92G 3Q0AA 4HMJA 4IFDH 2IL8A 2ZT9C 1EU4A 4IUNA 1B1ZA 1F9QA 2L4NA 1E24A 1QVCA 4KY6A 3WWVA 4YWMA 3PIOA 4GOPB 4GLVB 1O78A 1HFNA 3SEBA 4H7BA 1HQMC 2B2YC 4IO9A 4A3JH 4KHPL 1B8AA 3L3OC 3C2PA 1MIUA 4G7HC 1R4QB 1SE3A 1FNUA 4LFAQ 1DOMA 1M4VA 3T51B 1CSQA 1NY4A 2BDNA 1PTOD 1ICWA 3H0GB 3R93A 5ELFA 3VYUA 3S9WA 3OPOA 4R8NA 1U9RA 1TS2A 2A5HA 4OEMB 4JI3L 2O5JC 4IZ8A 5EKLA 2EVBA 3E0JA 2BE5C 3HRZC 4J6HA 3E5SA 5FLXL 5C0XJ 1I4RA 2YYZA 5CV5A 1XNRQ 1GUNA 4JI2Q 2KVMA 4RKLA 1MSHA 4QIWE 3OMCA 3A5UA 2ZXOA 5IGCA 5D65A 3NTHA 4O42A 4A3FH 3F1ZA 1L0XB 1KDCA 1VQ8A 2R92H 3NUCA 4BWGB 4RG1A 1AE2A 1PRTD 1VMCA 3WOFA 1CQFA 4A3KG 3RMHA 3HG9A 1SRUA 2JSOA 3D6CA 3MA2B 1V43A 3K7AH 1Y1WG 3MXNA 3S1RB 2B8GA 1BCPD 1BOSA 3S1NB 3IL8A 1PTOC 2I07B 4A3BB 2MPMA 5ELNA 2H1EA 1TWHB 3SXHA 2ICEC 1XPRA 3T1YL 1G291 3GTQB 3HOXG 3HOZG 4BA1I 3HGBA 5C4JH 1IL2A 4ZKBB 1A62A 1JE5A 1KXLA 1XPOA 1HXYD 2Z1CA 4CJ2C 1IBLL 4A4IA 2B2WC 2EY5A 2LKVA 3SK6A 2CWAA 4DXFA 4X66Q 3KJPA 2PI2E 3R3OA 1D1IA 3L2PA 1SE8A 3EA6A 1SNOA 4P2CB 1STHA 4IOCA 2WKCA 2K5VA 4KHPQ 2UXDQ 3BDCA 1SROA 1XWEA 1FGBD 4GLXA 3W1BA 4JBMA 4HAEA 3GV3A 5FO7B 1JORA 4DR4L 2I0QA 1L1OA 4A3KH 2Q8TA 5IYCG 2NN6G 2PNHA 1BBXC 3A56A 2CH4A 3RLFA 3OWEB 2RQXA 1YIJA 4JV5L 2A6ED 2E5LQ 2K1BA 1Y1WH 2ICIA 1BCPC 1N34Q 4DUYL 5C4XH 2Q8RE 1X6OA 1YITA 1K9MC 3GTKB 3UDIA 1PRTB 1VF5C 3MXGA 4GKKL 3PV0A 5CC4A 1VQJA 4C56C 2B2TA 3W1GA 1IYVA 3S17B 4MZ9A 1TWFB 2XVSA 3ULPA 2EIFA 3CCSA 1NR2A 4K6DA 3TP8A 3HOXH 3HOZH 1PYBA 3DM1A 2K05A 1U4RA 4JG2A 1A2TA 4JC0A 4UP9A 3NBHB 3CMAA 3FVQA 1EWIA 4ZUJA 4DK3C 2F0GA 1XNQL 3I56A 1EY8A 1H9KA 1TXYA 4LUOA 4IUUA 2LSSA 3PCOB 4EVOA 2B2UA 3JAMc 3D4WA 1OO9B 2XN9C 1VQKA 4OO1I 4A3EH 5EJWA 1G2SA 1KRSA 3GDEA 4NXNL 3S1QH 1F2MA 2HCCA 2K52A 4XQNA 4FVMA 2JA7G 1PTOF 5IYCH 2NN6H 1CA6A 4HJ7A 4GLAC 1TWAB 2A6EC 3TN2A 1HR0W 3CU7A 1EYGA 2NBFA 3HS0C 1Y1VG 4JVZA 1VCIA 2L1BA 4AH6A 4LW1A 4CJ1B 3J81L 1VQOA 1DCZA 1SXTA 1IBLQ 4NB3A 3J7YW 1VQGA 2CW0D 3G6EA 4POGA 3HOYG 4X62L 1Q3LA 2ZTDA 3E0EA 1XMQL 2PZUA 2KECA 1KC8C 2K50A 3C1EA 3BVGA 2JQOA 3BZCA 2D0PA
chains in the Genus database with same CATH topology
2B63B 3TMEA 1PXUA 2SOBA 1PRTF 1I6HB 2B2YA 3W2DA 4KKTA 2B39A 5BN3A 2AWOA 1SYGA 4I7ZC 3GTPB 1I4HA 2NVYB 3KBXA 2QCPX 2X6LA 2E2HB 1SNQA 1LABA 4A3MB 1RJTA 2NYZD 1T5XD 2MJ8A 3GTOB 1RCVD 1RKNA 5C0XI 3R2TA 5DNFA 1ZXTA 1EFID 1SYFA 4C3HG 3S2DB 3OW7A 4K5WA 1S4ZA 1WTVA 2CW0C 5T1GA 2IT1A 5BN4A 3FEWX 5ELCA 1KAAA 3P7JA 3TP6A 3D6WA 1HFGA 1EZ8A 1LTBD 3MHBA 2KHSA 1IKMA 3V96A 3SVMA 5JVG3 4NDXA 3I72A 1I4GA 4G4KA 4RCNA 3VA5A 2F3VA 3GD7A 1HUMA 5I2XA 4Q0FA 2VXWA 3O13A 4XQJA 2QEJC 2FMCA 2KEDA 2EY2A 1TKWB 2EYJA 2MGSA 3DHQA 2VB3X 4CKCA 3N6RA 3FPPA 4R9WA 1IL8A 1SFOB 3I8ZA 2DY7A 5NUCA 4K6LA 2R61A 3NSWA 1E2ZA 2F0EA 2BCOA 1LTID 3T56B 3GO5A 3DUZA 4DK0A 4M1UB 3EVQA 1PFMA 3F2UA 3OSOA 1CZGA 2KCCA 1NCVA 3DEPA 5K5PA 2OT2A 2R93B 4N9PA 3VYTA 2PMZB 1NSNS 2R3ZA 2DNEA 1NUCA 2V4DA 4JBWA 4RGMA 3E6ZX 5A35A 1NR4A 5IIFA 1D2BA 4RAUC 5KRUA 2AQ3B 1ZKOA 5IT9L 5IGEA 3PIO3 1LTSD 3ERQA 1Z47A 5IODA 4UDUC 3SK5A 1DM0B 1KLGD 1FD7D 3K57A 1HUNA 3W3AA 3VR3A 2HUGA 1GUWA 3BDOA 4TQUS 4KD4A 3AMUA 1OXVA 5I9PA 5AFWA 3S1MB 4FP5D 4BY1B 1J8IA 2WKDA 3M3YB 1TWCB 3OIPA 2JE6I 2NVTB 5F2DA 4A3IB 5K36G 1B9NA 1SMYD 2AWNA 1G8ZD 3RZDB 4A93B 1CK1A 1LT3D 1STNA 4PV1C 2F0UA 4DAVA 1QE6A 4K14A 3VYSA 2ZXRA 1GXDC 2YU9B 3KLSX 4RGOS 5I9OA 5IGFA 2WACA 1JC7A 1Q12A 4KKUA 2AUJD 1TS3A 3G6JB 2IWHA 1DD2A 4O1NA 1D6EC 1RTNA 2JYOA 4HR7B 2F0DA 1W6JA 2HCIA 4HMIA 2EPBA 1BUVT 3D4RA 5JOBA 2CVRA 2G9HD 5M9OA 4H44C 2F0HA 1S5CD 2B2VA 1ENCA 3I4MB 1SMYC 3K5MA 5K36H 1CHPD 1F9SA 2EZVA 4WFN3 4UAIA 3NQIA 1YNJD 3A8KE 3DWAA 1KNAA 4H0LC 1JOOA 1I50B 5EPKA 3ITPA 4Y7NB 3S14B 2AUKA 4IUVA 4KY7A 2N88A 2LY7A 3TDQA 3IFDA 5CV6A 3SR1A 4PNYA 2IX0A 3NTKA 3OIQA 2RDHA 3MC0B 2Z4IA 3SK4A 1D5XC 5EKKA 1EOTA 1CQVA 2JEAI 4KTAA 2FFKB 4WJWA 1F77A 3PUWA 1D1KA 2PQEA 1PZID 2Q8IB 2WV6D 5C3XA 3JAML 3KK7A 4B9WA 1UUPA 2L55A 2A68D 3FMCA 4J1MA 1VDZA 1S5BD 1EIGA 4S3SA 2HQEA 4K8IA 4RKBA 3FDTA 5CMDA 4CBVA 2IPKD 1BNZA 3A55A 5D3IB 4DF7A 1OXTA 1EY5A 3C1FA 3K59A 3T13A 5I6WA 1B53A 2F0SA 1X32A 3PUVA 5M5YB 3TP5A 2F0IA 2O4XA 1ET6A 5C4ZA 3OMGA 5T1IA 4BY7B 3BYTB 3UI2A 4FYDA 4C3IB 1YNND 1B3AA 2D2CC 1EWCA 1B2TA 1R4PB 2IX1A 3DWQA 1C4QA 3BDLA 5KYLA 3VA7A 1GUSA 3KF8A 3OWFA 1S5DD 4X3SA 2OXPA 3KLRA 1SNCA 1WTPA 1V1PB 2VB2X 1CTMA 1L0YB 3D31A 1EYAA 1BO0A 2FHTA 1ILQA 3VR2A 1SE4A 2JA5B 2PZTA 2K7VA 1DOLA 3D8GA 4KV6A 1SNMA 1TY2A 5ELBA 4K2LA 4L8JA 3J80E 2R92B 1A3UA 1EYCA 3A54A 1F9RA 1YNNC 2ID0A 2BOSA 3EJIA 4E6IA 4DAYA 3K7AB 3LNNA 1LT6D 3NTIA 1STAA 1WD0A 4IQZA 4DNTB 1EY6A 3OOCA 3HZXA 5HURA 1KDAA 2XRSD 2R6GA 1I6VC 3J7AF 4ME5A 1QCBD 1KTKA 1EL0A 3J7AV 5C4JB 4MHEA 1EEFD 1LTGD 2J0TD 2XNAC 1KNEA 3T53B 1PRTC 1JOKA 3SHLA 1PTOH 4K2KA 4U68A 4IFDJ 1JR0D 5FOBB 4HSPA 4RGNA 2WP8J 1HRJA 1A2UA 1DYQA 2X69A 1PDQA 2WB1B 3MWYW 1FR3A 2EY1A 2KUMA 1Y1WB 4ZQ3A 1EY0A 4FO2A 2JP1A 2L11A 2A73B 1QB5D 1RF2D 3FKIB 3K58A 2XWJB 2C5CA 3HOXB 3HOZB 2ZXPA 2E75C 2TMPA 4ZK9B 1TU2B 1MI2A 3RD4A 1U4LA 1GHKA 3EQLC 4ULLA 5CV8A 3X3MA 1EQTA 3MEHA 3M7NA 5JEAG 2F0WA 4HTHA 1CA5A 3KUPA 2JXMB 4B9XA 1XTCD 3TZDA 4F8MA 4CJ0B 1VMPA 2OF1A 2EOTA 1EY7A 2PW7A 2F0LA 1SE2A 1STYA 5KNCA 2H4OA 5CV7A 1F2ZA 3IFTA 1H9RA 4NMZA 2QF7A 2QILA 3QWNA 3VYRA 4CKEA 1GHJA 3S15B 3PO2B 3G7LA 1B44D 2CQAA 1ET9A 4ODGA 5FKAC 1T5EA 3BS1A 1JOQA 5EGTA 5JEAH 1A3TA 3A7LA 3N52A 1I4PA 4LJZC 4XT3B 1TS5A 4WORA 1BQQT 3NK9A 2WIIB 3IAYA 1MSGA 1Y1VB 1KDBA 1TQOA 4BS9A 1HA5A 3PIP3 5G3LF 3NPPA 1QNKA 1TT2A 4QUCA 1X3PA 3U9SA 5J1ZA 3M4OB 5JJZA 4LK1C 3H94A 2LS01 1WTOA 1BXTA 3I90A 1QJOA 1Z7TA 1ESRA 5LL6S 3HOUB 1LLRD 3K6OA 4MIUA 4ZUIA 3R8BA 2PZWA 4KMUC 2F0NA 1NAPA 1ILPA 1DOKA 2RDGA 3NWSA 2EYMA 3TBIB 2B2WA 2F0VA 5J22A 1H9SA 3H6MA 4KD3A 4FXGC 1UEAB 4OO1G 1FYCA 1HCZA 1RHPA 4HCEA 5A2QE 5KYIA 5I2YA 1O7ZA 4DU9A 4MN3A 5BN5A 4IFDI 1TWGB 4C3JB 1H9JA 1JB3A 1LTTD 1MBYA 1LTRD 1GJXA 4BA2I 4G7ZC 4XYOA 4RHRA 1TVXA 2NVXB 3NBHA 4DN4M 3SK8A 1WVLA 3PO3B 1QOHA 3P75A 2Y0SB 4KKSA 4OIJA 3PUXA 2E2JB 2RSNA 1CFMA 3NQTA 4CGYB 1FNVA 1A3VA 2OEOA 1S5FD 1HA6A 4IURA 3U9OA 4C1NI 2M2LA 4LMQD 5IGBA 4OO1H 4L63B 1G6ZA 1AN8A 2NTSA 5CBAE 2E74C 2RSOA 3NHHA 3QB3A 5C0XG 1LT4D 1OXXK 1PLFA 5I4DA 4J8QA 3MTSA 3X3NA 3A8JE 5M3FB 3CRLC 2EJGC 2R7ZB 3V2TA 3Q6SA 3T16A 2K03A 1GUGA 1EWHA 2EJFC 3FRPB 2K32A 3A7AB 2KJXA 3I4NB 1Y8NB 5J39A 1RDPD 2SEBD 1GUOA 3PUZA 1XYIA 1STBA 3RUZA 4JK1C 1IKLA 2SNMA 2RKSA 4IALA 4FF4A 1QNUA 4PMCA 3QOJA 1CHQD 3HEJA 5CV9A 1TY0A 4XQQA 2HDLA 3QO2A 1RTOA 2XWBB 4CKBA 2RVLA 1SAPA 5C3EB 3M85A 5C0XH 4ZLTF 3M7GA 1ENFA 1V8QA 1GUTA 3GTLB 3L7ZC 1PZJD 2NB0A 1IW7D 4ILWA 2Z4HA 4X3UA 1B50A 4RHSA 2J4XA 2B2TC 5E3FA 4EGVA 3NBIA 5DM63 3BYYB 2E2IB 5EPJA 5EBCA 1ZYRD 3QOLA 2DNCA 5JAVA 2E76C 5DM73 2F0KA 1WCMB 2RA4A 4L6TB 4C3IG 1O80A 1H9MA 2EYFA 2XSCA 4RH6A 3L9AX 1G91A 2B2UC 1A15A 4TKOB 4EQNA 1ZEQX 1YNJC 4B08A 1M8AA 1E0BA 3D4DA 2A69D 5KGUA 3S16B 4KN7C 3DWPA 1SJED 1JWSD 4KJNA 2X6GA 1ML0D 2NN6I 1SBBB 5FLXE 3T4AC 1JCKB 5KNDA 4ZKCB 1LV9A 2F3WA 2WAQB 1IW7C 2F4IA 3S2HB 2K5DA 1CI3M 3K5NA 1KLUD 4PMBA 5CORA 2EYPA 2QKIC 2J7ZA 1ZYRC 5IGGA 4OGQC 4DAPA 4A3JB 2E2DC 2O2LD 2A68C 1XX8A 3HOWB 2BDOA 1EYDA 1EY4A 2KEEA 3V05A 5ELEA 5C5LA 1Q1BA 4QUFA 2AQ2B 5IOCA 1DXMA 5TSSA 3QJYA 3FPUB 2A69C 3NXWA 5CYUA 3P1HA 4BBSB 1DONA 4C1NK 1TIID 3KBGA 2K6AA 5E4XA 2Z8LA 4G7OC 2F0FA 1ESFA 4V190 3VR6A 1F2LA 4A3FB 2D9UA 4IUQA 1LT5D 5CGKA 2BA1A 1I4XA 2DN8A 4HSVA 1PZKD 3GQBA 4KY5A 2PPBC 2RBMA 3AU7A 1Y69U 4DA2A 1AW7A 2CHBD 3CHBD 2TSSA 4TRDA 2VUMB 2F0OA 4QB4A 5FO9B 3PMFA 4OL7A 1SYBA 1WD1A 1BDOA 3IKJA 3M4YA 1SEBD 5CR3A 4PMWA 4DNRB 5EQ0A 1GOZA 5D3DA 4R8IA 3A8IE 1EZ6A 4PQXA 1QWYA 1ENAA 2A74C 1K8OA 2F0PA 5G3LD 3QIAA 1W6KA 3MVVA 5ELDA 3ONAB 4ZRZA 5DEHA 4CHTB 1I4QA 4F87A 3J80L 3R2IA 4NP5A 1AZPA 4HEDA 1PTOB 1Z6HA 1STEA 4RA8A 4A3KB 4XT1B 3DEOA 2M00A 4HN7A 4ID6A 3I73A 4EQPA 2L5TA 5KIXA 3C46A 1CT1D 5C4XB 2D62A 3BZDB 1H9SB 3WOEA 2L12A 1Y8OB 3MZ5A 5KEEA 1PYWD 2L0CA 1IHZA 1SNPA 3GTJB 1LACA 1E2VA 1EY9A 3J81E 2F0JA 3HP3A 2MP1A 4RGTA 3I4LA 5EKIA 1PMRA 1HHVA 1BCPB 1PFNA 3MXUA 4KJOA 1QILA 2BA0A 4A3EB 3P20A 4OHJA 2EXZA 3BVZA 4XYQA 2RDFA 3S1QB 1C8CA 4IUTA 3VR5A 2M9VA 2KQ3A 3URYA 5D14A 4EQOA 5LHY1 4DFAA 2MHVA 1DZ1A 3WDNA 4KN4C 2C9OA 4FXKC 2SDFA 5JPNC 1SDFA 1K83B 2NTTA 4V0BA 3K5LA 1JQYD 4U673 2I46A 3SDZA 5E1FA 3I3CA 1XXGA 5C3WA 1V1PA 2EYHA 2O5IC 3GTGB 5LL6X 4A3GB 2XIWA 4AYBB 1OXSC 2FINB 1S5ED 3D3RA 4N9TA 1O7YA 4FF1A 2KCNA 3AB9A 1MGSA 4BBRB 1RODA 2EE1A 1UAPA 2B2VC 4YIJA 4KK7A 2HDMA 4GZYC 2QDBA 4XIGS 2JA7B 1II3A 2PYKA 1JWMD 1D5ZC 1BCPF 3ND9A 3CQZB 4I65A 5FK9C 2PW5A 2K5QA 4NW2A 2ENBA 3TP7A 2F0MA 2FMMA 3HOYB 2IJ0A 4WRDA 4HCSA 1TS4A 5ISRA 2G9DA 1Y8PB 2NWGA 4IUPA 4ABNA 2B8FA 4OIKA 4C3JG 2K33A 2WINB 4F7XA 4X3TA 4DK1A 4FF2A 5JPMC 3HOVB 3EROA 4RCOA 3BVMA 4XXEA 2IX3A 3DXJC 5E4WC 5IT9E 1F9PA 3Q23A 5EPLA 3PUYA 2EJMA 3H3VC 1V1OA 4FF3A 3LWUA 4C3HB 5KNBA 2DY8A 1AFPA 4M8AA 5CV4A 1BR9A 3NP8A 1JE4A 1VF7A 2PO4A 2JEBI 3I91A 1HTLD 1EQVA 2NUCA 4DXGA 5C6AA 5CBEE 2AQ1B 1QG7A 2FJ2A 3MAQA 3LWEA 3BG3A 1EU3A 4LAAA 4ZAIA 1PFBA 4FNFA 2K28A 2MUYA 1HTPA 2A6HD 4KHZA 1C48A 1LTAD 5JEAJ 4K8JA 2K04A 2NVQB 1SJHD 1SNDA 5IGDA 3RZOB 1MD2D 3Q24A 2VNUD 1O7LA 3CKIB 5A2QL 1RD9D 3C3LA 2GA4B 4XTCS 2EYOA 1WTWA 1OXUA 5FO8B 3CRKC 1UNSA 1STGA 3HKZB 3H91A 4NKLA 2JA6B 1AEXA 2F03A 3MFYA 2K5WA 2LMCB 1JICA 1WTRA 3K5OA 1HPCA 4Z9CB 5M3MB 2A6HC 1U4PA 3ND8A 1SYDA 4G57A 2F0TA 1SYCA 1EEID 1I3QB 5C4HA 3ZYYX 4K5VA 4KHVA 4RFBA 1B4OA 1Q1EA 3K0YA 4F88A 4TSSA 2LFNA 1AZQA 1DJRD 3MXPA 2F0QA 1FNWA 1Q90A 3GV6A 2JA8B 3NWTA 1F2YA 1ONLA 2KOLA 3LX0A 4QIWB 1K8MA 1HQRD 1LO5D 4H13C 3I70A 2XRQD 4C2MB 3JAME 1D5MC 2SNSA 1SSOA 1X3QA 2N55A 1R9TB 4A3DB 1CZWA 5JVH3 1B9MA 1EIHA 5M5XB 3OHXC 1U4MA 2EDGA 4QMGA 1E2WA 3EFXD 1JWUD 5COYA 3NE5B 4IN3A 4FXDA 3H09A 2D5DA 4RWSC 3TSSA 1BF4A 1AP0A 2NZ1D 4IFDG 3VR4A 2PNRC 2EYLA 4Q5VA 1WTQA 2IW3A 4QF4A 3DMUA 5EBDA 4X3KA 2L9HA 2KA7A 2K01A 5DAUA 4ZYSA 5HGTA 1CM9A 3KLSA 5M5WB 5C44B 4DGZA 3GTMB 3QG1A 1A6XA 1J9OA 2BE5D 3Q22A 5C5MA 4QCLA 3GP7A 2EY6A 3MFGA 1KABA 5I6YA 1TR5A 2PCFB 4KI0A 3SE0A 1IYUA 3TZUA 1G2TA 1Q8IA 1WTXA 4K5XA 1SYEA 4XDXA 3Q0AA 4HMJA 4IFDH 2IL8A 2ZT9C 1EU4A 4IUNA 1B1ZA 1F9QA 2L4NA 4KY6A 1O78A 1HFNA 3SEBA 4H7BA 1HQMC 2B2YC 3L3OC 3C2PA 4G7HC 1R4QB 1SE3A 1FNUA 1DOMA 1M4VA 3T51B 2BDNA 1PTOD 1ICWA 3H0GB 3R93A 5ELFA 3VYUA 3S9WA 3OPOA 4R8NA 1U9RA 1TS2A 2A5HA 2O5JC 4IZ8A 5EKLA 2EVBA 3E0JA 2BE5C 3HRZC 4J6HA 3E5SA 5FLXL 5C0XJ 1I4RA 2YYZA 5CV5A 1GUNA 2KVMA 4RKLA 1MSHA 3OMCA 2ZXOA 5IGCA 5D65A 3NTHA 4O42A 1L0XB 1KDCA 3NUCA 4BWGB 1PRTD 1VMCA 3WOFA 1CQFA 3RMHA 3HG9A 2JSOA 3D6CA 3MA2B 1V43A 3MXNA 3S1RB 2B8GA 1BCPD 1BOSA 3S1NB 3IL8A 1PTOC 2I07B 4A3BB 2MPMA 2H1EA 1TWHB 3SXHA 2ICEC 1G291 3GTQB 4BA1I 3HGBA 4ZKBB 1HXYD 2Z1CA 4CJ2C 2B2WC 2EY5A 2LKVA 3SK6A 4DXFA 3R3OA 1D1IA 3EA6A 1SNOA 4P2CB 1STHA 2WKCA 3BDCA 1XWEA 1FGBD 4HAEA 3GV3A 5FO7B 1JORA 2Q8TA 2NN6G 1BBXC 3A56A 3RLFA 3OWEB 2RQXA 2A6ED 2K1BA 2ICIA 1BCPC 2Q8RE 3GTKB 1PRTB 1VF5C 3MXGA 5CC4A 3PV0A 4C56C 2B2TA 1IYVA 3S17B 1TWFB 2XVSA 1NR2A 4K6DA 3TP8A 3DM1A 2K05A 1U4RA 1A2TA 3FVQA 4ZUJA 2F0GA 1EY8A 1H9KA 4IUUA 4EVOA 2B2UA 3D4WA 1OO9B 2XN9C 4OO1I 5EJWA 1G2SA 1F2MA 2HCCA 4XQNA 4FVMA 1PTOF 1CA6A 2NN6H 1TWAB 2A6EC 3TN2A 3CU7A 2NBFA 3HS0C 1VCIA 2L1BA 4CJ1B 3J81L 1DCZA 1SXTA 3J7YW 2CW0D 1Q3LA 2PZUA 2KECA 3C1EA 3BVGA 2F1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Q A;  3FPU B;  1CA5 A;  1G6Z A;  3KUP A;  1F2L A;  3F2U A;  2N55 A;  4NW2 A;  2D9U A;  3TZD A;  1NCV A;  1ESR A;  1RTN A;  3DEP A;  2RA4 A;  4HAE A;  5CBA E;  4CJ0 B;  2JYO A;  2RSO A;  3GV3 A;  1VMP A;  4IUQ A;  1EIH A;  1DOM A;  1O80 A;  1B53 A;  2K04 A;  2EOT A;  2B2Y A;  2HCI A;  1U4M A;  1X32 A;  2BDN A;  2Q8T A;  2FMM A;  4HSV A;  1PLF A;  1BBX C;  4HCS A;  1ICW A;  3R93 A;  3HP3 A;  5COY A;  1EL0 A;  2R3Z A;  2MP1 A;  2EPB A;  3MTS A;  2CVR A;  5EKI A;  2K1B A;  4RWS C;  2B2U C;  1A15 A;  1PFN A;  2NWG A;  1G91 A;  1HHV A;  4IUP A;  5T1I A;  1BF4 A;  1NR4 A;  4MHE A;  1AP0 A;  3KBX A;  3Q6S A;  2X6L A;  1NAP A;  4RAU C;  2B2V A;  2NZ1 D;  1DOK A;  2Q8R E;  1ILP A;  1M8A A;  2K03 A;  1E0B A;  3UI2 A;  1RJT A;  2NYZ D;  1KNE A;  2B2W A;  4OIK A;  2MJ8 A;  1B3A A;  2B2T A;  1WD1 A;  1C8C A;  2KVM A;  1B2T A;  1WTQ A;  1F9S A;  4IUT A;  1MSH A;  4U68 A;  1WTW A;  2X6G A;  5DNF A;  4X3T A;  1ML0 D;  1ZXT A;  1NR2 A;  4X3K A;  5EQ0 A;  5D65 A;  2L9H A;  4O42 A;  3DM1 A;  4UAI A;  1RHP A;  4QUC A;  4ZKC B;  1LV9 A;  4R8I A;  5D14 A;  2K01 A;  3H91 A;  2K05 A;  1XYI A;  1U4R A;  1HRJ A;  1S4Z A;  1WTV A;  4X3S A;  1KNA A;  5T1G A;  1VMC A;  5E4W C;  1IKL A;  1O7Z A;  1DZ1 A;  3P7J A;  4MN3 A;  3G7L A;  3D6W A;  2X69 A;  5COR A;  1HFG A;  5EPK A;  1HUN A;  1PDQ A;  1CM9 A;  2HUG A;  3MWY W;  1F9P A;  3ONA B;  2SDF A;  4IUV A;  5EPL A;  1JIC A;  2J7Z A;  1WTP A;  1GUW A;  2KUM A;  4IUU A;  2N88 A;  1SDF A;  1WTR A;  3N52 A;  1IKM A;  5AFW A;  2B2U A;  3SVM A;  1BO0 A;  1U4P A;  3IFD A;  2JP1 A;  1TVX A;  2L11 A;  2HDL A;  3QO2 A;  1RTO A;  1XX8 A;  1AZP A;  1J8I A;  5EJW A;  1G2S A;  2DY8 A;  2FHT A;  1J9O A;  4HED A;  4DN4 M;  1WVL A;  1ILQ A;  4XT3 B;  2RVL A;  1SAP A;  3IL8 A;  3I3C A;  2HCC A;  1HUM A;  1EOT A;  2KEE A;  2VXW A;  1CA6 A;  2KED A;  2FFK B;  4QUF A;  2MGS A;  2MPM A;  4OIJ A;  1DOL A;  1B4O A;  1JE4 A;  4RA8 A;  2H1E A;  4XT1 B;  4ZLT F;  2XIW A;  3TN2 A;  1MSG A;  3DEO A;  4ZK9 B;  4R9W A;  2RSN A;  2FIN B;  1AZQ A;  3I91 A;  1IL8 A;  1MI2 A;  3I8Z A;  1G2T A;  1O7Y A;  2DY7 A;  1WTX A;  1U4L A;  2L1B A;  1MGS A;  1QNK A;  3GV6 A;  4ZKB B;  4XDX A;  5CBE E;  1ROD A;  2EE1 A;  1X3P A;  2B2V C;  1QE6 A;  1QG7 A;  2FJ2 A;  2IL8 A;  1F9R A;  1EIG A;  4CJ1 B;  4CJ2 C;  4X3U A;  2KOL A;  2HDM A;  1F9Q A;  3FDT A;  2B2W C;  5CMD A;  3LWE A;  1B50 A;  2L4N A;  1BNZ A;  2B2T C;  5JJZ A;  1Q3L A;  1DON A;  1EQT A;  1HA6 A;  4IUR A;  2L12 A;  5E4X A;  1HFN A;  2KEC A;  2B2Y C;  1PFB A;  4ZAI A;  5EPJ A;  1SSO A;  2M2L A;  4LMQ D;  1WTO A;  1WD0 A;  3I90 A;  1PFM A;  2K28 A; 
#chains in the Genus database with same CATH topology
 2B63 B;  3TME A;  1PXU A;  2R7F A;  2SOB A;  1PRT F;  3CME A;  1I6H B;  4DR4 Q;  2VY3 A;  2B2Y A;  1YJ9 A;  1Q82 C;  3W2D A;  4KKT A;  3S15 H;  2B39 A;  3I55 A;  5BN3 A;  4EX5 A;  4JV5 Q;  4P72 A;  3ICE A;  2AWO A;  1SYG A;  4I7Z C;  4DUY Q;  3GTP B;  1I4H A;  4GNX C;  2NVY B;  3KBX A;  2QCP X;  2X6L A;  1VQ4 A;  2E2H B;  1SNQ A;  1XTD A;  1LAB A;  3W5O A;  4A3M B;  3CCJ A;  4GKK Q;  1RJT A;  2NYZ D;  1T5X D;  4GS3 A;  2JA7 H;  2MJ8 A;  3GTO B;  1RCV D;  2D0O A;  1RKN A;  3JC6 6;  5C0X I;  3R2T A;  5DNF A;  1ZXT A;  1EFI D;  1Y1V H;  1SYF A;  4C3H G;  1NJI C;  3S2D B;  3OW7 A;  4K5W A;  1S4Z A;  4JOI C;  1WTV A;  2CW0 C;  5T1G A;  2IT1 A;  2MFI A;  5BN4 A;  3FEW X;  5ELC A;  1KAA A;  3P7J A;  3TP6 A;  2UUA L;  3D6W A;  3HOY H;  1HFG A;  2IHE A;  2OQ0 A;  1XNQ Q;  1EZ8 A;  1LTB D;  2RF4 A;  1VQI A;  1PH4 A;  4CDD C;  3MHB A;  2KHS A;  1IKM A;  3V96 A;  3SVM A;  5JVG 3;  4NDX A;  2KCT A;  3I72 A;  1I4G A;  2K75 A;  3CPF A;  4G4K A;  4NXN Q;  4RCN A;  3VA5 A;  3K80 C;  4JYA L;  2F3V A;  5JJL A;  3GD7 A;  1HUM A;  5I2X A;  4Q0F A;  2VXW A;  3O13 A;  4XQJ A;  2QEJ C;  2FMC A;  2KED A;  2EY2 A;  1TKW B;  2EYJ A;  2MGS A;  3DHQ A;  2VB3 X;  4CKC A;  3N6R A;  4IPC A;  2Y0S G;  3FPP A;  4R9W A;  3BU2 A;  2GN5 A;  1IL8 A;  1SFO B;  3I8Z A;  2DY7 A;  5NUC A;  4K6L A;  2R61 A;  1YBY A;  1Z9F A;  3A74 A;  4DUZ L;  3NSW A;  1E2Z A;  2F0E A;  2BCO A;  4X62 Q;  1LTI D;  4DV7 Q;  3T56 B;  3GO5 A;  1XMQ Q;  4HJ8 A;  3STB D;  1X56 A;  3DUZ A;  4DK0 A;  4M1U B;  5BR8 L;  2OTJ A;  3EVQ A;  1PFM A;  4C3H H;  1GM5 A;  1HZA A;  2EQS A;  3F2U A;  3OSO A;  1CZG A;  2KCC A;  1NCV A;  3DEP A;  2K4K A;  2N8N A;  5K5P A;  3PSI A;  2OT2 A;  3HKS A;  2ZM6 L;  4N9P A;  2R93 B;  3VYT A;  4OX9 Q;  4B3M Q;  1TWG H;  2PMZ B;  1NSN S;  2R3Z A;  3KDF A;  1WI5 A;  3H3V H;  1VQ6 A;  3HKZ G;  2Z9H A;  2DNE A;  1NUC A;  2UUB Q;  2V4D A;  4JBW A;  4RGM A;  3E6Z X;  5A35 A;  1NR4 A;  5IIF A;  2JA6 G;  2GVB A;  1D2B A;  4RAU C;  2R7Z G;  5KRU A;  2AQ3 B;  1ZKO A;  5IT9 L;  1YEZ A;  5IGE A;  3M9B A;  2MO0 A;  3PIO 3;  1LTS D;  2KEN A;  3ERQ A;  2V1C C;  1Z47 A;  5IOD A;  1K8G A;  3I4N G;  4UDU C;  3SK5 A;  1DM0 B;  5M3M G;  1KLG D;  4R1J A;  4POF A;  2VQE L;  1FD7 D;  3K57 A;  2JJQ A;  1UEB A;  1HUN A;  3STB C;  3W3A A;  3VR3 A;  2HUG A;  3E9I A;  1B70 B;  4IJH A;  1GUW A;  1EOV A;  3BDO A;  4TQU S;  3RZO H;  4KD4 A;  3AMU A;  1OXV A;  5I9P A;  1C7Y A;  5AFW A;  3S1M B;  3CP0 A;  1VQA A;  4FP5 D;  4JI1 L;  2JA8 G;  1PH8 A;  4BY1 B;  1HZC A;  1J8I A;  1HNZ L;  2WKD A;  4JI7 L;  3M3Y B;  2WFW A;  4HIK A;  3J7Z C;  1TWC B;  3OIP A;  2JE6 I;  2JK8 A;  2NVT B;  4QY7 A;  5F2D A;  4A3I B;  5K36 G;  1B9N A;  2ZJP A;  1FGU A;  1SMY D;  2AWN A;  5C3E G;  4DR2 Q;  3CCE A;  4JI6 Q;  1G8Z D;  3RZD B;  4A93 B;  3S24 A;  1CK1 A;  1LT3 D;  1STN A;  5H1S E;  4PV1 C;  2F0U A;  4DAV A;  2JA6 H;  1QUQ B;  2R7Z H;  1S72 A;  1QE6 A;  4K14 A;  3VYS A;  1PH1 A;  3CPW A;  2ZXR A;  1GXD C;  2YU9 B;  5IYB G;  2VZA A;  3KLS X;  4RGO S;  5I9O A;  5IGF A;  2WAC A;  3F2D A;  3I4N H;  3AFQ A;  5M3M H;  1VQ9 A;  1JC7 A;  1Q12 A;  4KKU A;  1C9O A;  2H5X A;  2AUJ D;  3EIV A;  1TS3 A;  3G6J B;  4P75 A;  3UDX A;  4HIO A;  2IWH A;  2UU9 Q;  4NXM L;  2YTV A;  4O1N A;  1DD2 A;  1D6E C;  3J81 j;  1RTN A;  1HNX L;  2JYO A;  4HR7 B;  2F0D A;  1W6J A;  2VQF L;  2HCI A;  3U4V A;  1IBK L;  4HMI A;  4AQY Q;  1IXR A;  2EPB A;  4DV0 L;  1BUV T;  3D4R A;  5JOB A;  2CVR A;  2G9H D;  3MXN B;  4H44 C;  5M9O A;  2F0H A;  2JA8 H;  4DV2 L;  1S5C D;  2RCN A;  2B2V A;  1ENC A;  3I4M B;  3QR8 A;  1SMY C;  3K5M A;  5K36 H;  1CHP D;  3PQI A;  5C3E H;  1IBM L;  1F9S A;  2PQA A;  5C44 G;  4P73 A;  4JI5 L;  2EZV A;  4WFN 3;  1ICF B;  4UAI A;  3NQI A;  1YNJ D;  1K0S A;  3A8K E;  3DWA A;  2F1M A;  1KNA A;  3GTL H;  4H0L C;  1JOO A;  2WAQ G;  1I50 B;  5EPK A;  3ITP A;  4Y7N B;  3S14 B;  5IYB H;  2AUK A;  4IUV A;  4KY7 A;  2N88 A;  2LY7 A;  3TDQ A;  1V9P A;  4YCW A;  3IFD A;  4QGU A;  2E2I H;  5CV6 A;  3SR1 A;  1OTC A;  4PNY A;  2IX0 A;  3NTK A;  1KAW A;  3OIQ A;  5LMU L;  2RDH A;  3MC0 B;  2Z4I A;  4JI7 Q;  4B3R L;  3SK4 A;  1D5X C;  3OW2 A;  5EKK A;  1L1O B;  1EOT A;  3HOW G;  3ER0 A;  1X9N A;  1CQV A;  2VS1 A;  2JEA I;  2QW7 A;  1NBW A;  4KTA A;  2FFK B;  4WJW A;  1F77 A;  3PUW A;  2CCZ A;  1D1K A;  5FJ8 G;  2PQE A;  5FLM G;  1PZI D;  2Q8I B;  2WV6 D;  5C3X A;  3JAM L;  3KK7 A;  4B9W A;  1UUP A;  2L55 A;  4DV1 Q;  2A68 D;  4PZ8 A;  3FMC A;  4J1M A;  2I5L X;  1VDZ A;  1S5B D;  2KCM A;  1EIG A;  2Z6B A;  2HQE A;  4K8I A;  4S3S A;  4RKB A;  3FDT A;  4CBV A;  5CMD A;  2HD3 A;  2IPK D;  1BNZ A;  3H0G G;  3A55 A;  5C44 H;  5D3I B;  3S16 H;  4GOP C;  4BBS G;  3UDF A;  4DF7 A;  1OXT A;  1EY5 A;  4WJ4 A;  3C1F A;  4NXM Q;  3F2B A;  3K59 A;  3T13 A;  5I6W A;  1N33 L;  2A8V A;  3S2H H;  1B53 A;  1YJW A;  4DR3 L;  1EUJ A;  2F0S A;  1X32 A;  3PUV A;  1IBK Q;  5M5Y B;  5GAE C;  1YVC A;  3TP5 A;  1HZB A;  1NTG A;  2F0I A;  2O4X A;  1ET6 A;  5C4Z A;  3OMG A;  5T1I A;  4BY7 B;  3BYT B;  1PV4 A;  4DK6 C;  4DV2 Q;  3UE0 A;  4QJF A;  2VUM G;  3UI2 A;  4FYD A;  3TEH B;  3HOW H;  1KHI A;  4C3I B;  1YNN D;  1B3A A;  2D2C C;  1EWC A;  1B2T A;  1R4P B;  4DR1 L;  4OWT B;  1YHQ A;  3M4P A;  5FJ8 H;  2AMC B;  5FLM H;  4UP8 A;  2IX1 A;  3DWQ A;  1C4Q A;  3BDL A;  5KYL A;  3VA7 A;  1GUS A;  1HR0 Q;  3KF8 A;  3OWF A;  1S5D D;  2XGT A;  4X3S A;  2OXP A;  3H0G H;  3KLR A;  5IWA L;  1SNC A;  1WTP A;  1V1P B;  4BBS H;  2VB2 X;  1CTM A;  1L0Y B;  2N3S A;  1QVF A;  4WJ3 M;  3D31 A;  1EYA A;  1BO0 A;  2MO1 A;  5LMU Q;  4B3R Q;  2FHT A;  2OQK A;  3CC4 A;  1ILQ A;  3VR2 A;  4DPG A;  2F4V Q;  1SE4 A;  2JA5 B;  2PZT A;  4LF4 Q;  1QZH A;  2K7V A;  1DOL A;  2K5H A;  3D8G A;  3M4Q A;  1SNM A;  1TY2 A;  4KV6 A;  5ELB A;  4K2L A;  4L8J A;  2UXC L;  1YHA A;  1MKH A;  4HJ9 A;  3J80 E;  4JI0 L;  2R92 B;  1A3U A;  1EYC A;  4DR5 L;  3A54 A;  2VUM H;  1LUZ A;  1F9R A;  1YNN C;  2ID0 A;  2B29 A;  2BOS A;  3EJI A;  5C4X G;  4E6I A;  1YHB A;  2ZTE A;  2NZO A;  3K7A B;  3LNN A;  3I4O A;  4DAY A;  3CF5 A;  1VQ5 A;  1LT6 D;  3NTI A;  1STA A;  1WD0 A;  4IQZ A;  4DNT B;  1EY6 A;  3OOC A;  3HZX A;  5HUR A;  1KDA A;  2XRS D;  1WFQ A;  2IHF A;  2R6G A;  1I6V C;  5IE8 A;  3J7A F;  4ME5 A;  1QCB D;  1KTK A;  1EL0 A;  3J7A V;  3GTQ H;  1V1Q A;  5C4J B;  1G51 A;  1CKN A;  4MHE A;  4DV6 L;  1B3Q A;  1EEF D;  1LTG D;  2J0T D;  2XNA C;  1KNE A;  3T53 B;  1PRT C;  1JOK A;  5HGQ A;  3SHL A;  1PTO H;  4A3E G;  4K2K A;  1HNW L;  4U68 A;  1K28 A;  5IP9 G;  2Z6K C;  4IFD J;  1JR0 D;  4HSP A;  5FOB B;  4H02 A;  4RGN A;  2WP8 J;  4GKJ L;  1YZ6 A;  3KF6 A;  1JT8 A;  1HRJ A;  1A2U A;  4JI8 L;  1SN8 A;  4JI3 Q;  1DYQ A;  3OTO L;  3CAM A;  2X69 A;  1Q81 C;  4KLK A;  1PDQ A;  2WB1 B;  3MWY W;  5IWA Q;  1FR3 A;  1W3S A;  2EY1 A;  1KL9 A;  2MQH A;  2KUM A;  1Y1W B;  3DLL A;  3BZK A;  4ZQ3 A;  1EY0 A;  4FO2 A;  1IZ6 A;  2JP1 A;  4R4C A;  2L11 A;  2A73 B;  1CUK A;  3K7U C;  3GTK H;  2QDL A;  1U5K A;  1QB5 D;  4Y52 H;  1RF2 D;  3GTJ H;  3FKI B;  1TWF H;  3K58 A;  3K81 C;  2XWJ B;  2C5C A;  3TS2 A;  3HOX B;  3HOZ B;  1N36 L;  4MTN A;  2ZXP A;  2I5H A;  2E75 C;  2TMP A;  4ZK9 B;  3ULJ A;  4R4O A;  2UXC Q;  4A3G G;  1TU2 B;  4JI0 Q;  1MI2 A;  3RD4 A;  1PH6 A;  4AYB G;  5J3B A;  1U4L A;  1GHK A;  3CD6 A;  4PG3 A;  4DR5 Q;  2HHH L;  4DR6 L;  2KHI A;  3EQL C;  5JJI A;  4IPD A;  4BBR G;  4ULL A;  5CV8 A;  4X6A H;  4DV3 L;  2GVA A;  3X3M A;  1EQT A;  3MEH A;  3M7N A;  5JEA G;  5IP9 H;  2F0W A;  4HTH A;  1VQH A;  3JAM i;  1CA5 A;  3KUP A;  2JXM B;  3T1Y Q;  4B9X A;  1XTC D;  1MJC A;  3TZD A;  4F8M A;  4A3M G;  4CJ0 B;  1VMP A;  2OF1 A;  1MHW C;  3G48 A;  5IYD H;  1VQB A;  1C0A A;  4GOP A;  2EOT A;  1EY7 A;  2PW7 A;  2F0L A;  1DGS A;  1SE2 A;  4OON A;  4A3C G;  1STY A;  4GN5 A;  3RR5 A;  3CCR A;  5KNC A;  2H4O A;  1K83 H;  2KHJ A;  5CV7 A;  1F2Z A;  1RL2 A;  3IFT A;  1Q86 C;  1FJG L;  2JN4 A;  3ERS X;  1H9R A;  4NMZ A;  3EN2 A;  4X64 L;  1E22 A;  1HNW Q;  2QF7 A;  2QIL A;  3QWN A;  3GTG H;  4UP7 A;  3VYR A;  4CKE A;  4A3G H;  1GHJ A;  4B3S L;  3HOV G;  4GKJ Q;  1UE7 A;  4DV4 L;  4JBK A;  1E7Z A;  4JI8 Q;  3S15 B;  1UE6 A;  4BBR H;  3PO2 B;  3G7L A;  1B44 D;  2CQA A;  1ET9 A;  4PZ6 A;  4ODG A;  5FKA C;  1T5E A;  3BS1 A;  1JOQ A;  5EGT A;  5JEA H;  1A3T A;  3A7L A;  3N52 A;  5HY6 A;  1I4P A;  3T1H L;  3GTP H;  3CQZ H;  4A3M H;  3BJU A;  1J5E L;  4LJZ C;  4XT3 B;  1TS5 A;  3GTO H;  4WOR A;  1BQQ T;  4YY3 L;  3NK9 A;  4A3C H;  2WII B;  4LF9 L;  3IAY A;  1MSG A;  1XJV A;  1Y1V B;  1KDB A;  5FLX c;  1TQO A;  1YI2 A;  4BS9 A;  1HA5 A;  3PIP 3;  4N8F A;  2I5M X;  5G3L F;  3NPP A;  1QNK A;  1UE5 A;  1TT2 A;  2HHH Q;  4QUC A;  1X3P A;  1NMF A;  3U9S A;  5J1Z A;  4CDF C;  2KBN A;  3M4O B;  5JJZ A;  2YTY A;  4DV3 Q;  4LK1 C;  3HFZ B;  3H94 A;  1FL0 A;  2WB1 E;  2LS0 1;  1WTO A;  1BXT A;  3I90 A;  1QJO A;  1Z7T A;  3HOV H;  4L5R C;  1ESR A;  1PH2 A;  5LL6 S;  1PVO A;  3HOU B;  1LLR D;  3K6O A;  1W2B A;  1X55 A;  4LFC L;  5GAD C;  4MIU A;  4ZUI A;  3R8B A;  5GAH C;  2PZW A;  4KMU C;  5L37 A;  2EXD A;  1VS0 A;  1WYD A;  4DKA C;  2F0N A;  2VL6 A;  4FDB A;  1NAP A;  1ILP A;  1DOK A;  2RDG A;  3NWS A;  2EYM A;  3TBI B;  2ZJR A;  2B2W A;  1FJG Q;  2RHQ B;  2UUC L;  2F0V A;  1QZG A;  5J22 A;  1H9S A;  1BBU A;  3H6M A;  4KD3 A;  4FXG C;  1UEA B;  4OO1 G;  1FYC A;  1HCZ A;  1RHP A;  4HCE A;  5A2Q E;  4MNO A;  4B3S Q;  3J80 c;  4DV4 Q;  5KYI A;  5I2Y A;  1ASZ A;  1O7Z A;  4DU9 A;  4MN3 A;  5BN5 A;  2R93 H;  4IFD I;  1VQN A;  1TWG B;  4C3J B;  1H9J A;  1JB3 A;  1LTT D;  1D8L A;  1LTR D;  1MBY A;  1GJX A;  4BA2 I;  4G7Z C;  3B6Y A;  4XYO A;  3T1H Q;  4RHR A;  1S40 A;  1TVX A;  2NVX B;  3NBH A;  4DN4 M;  4OXP A;  3SK8 A;  1WVL A;  1J5E Q;  3PO3 B;  1X3E A;  1QOH A;  3P75 A;  4YY3 Q;  2Y0S B;  4KKS A;  1EQQ A;  4OIJ A;  2NVQ H;  4LF9 Q;  3PUX A;  2UUA Q;  2E2J B;  1M1K C;  3EBE A;  2RSN A;  3NEN A;  1AH9 A;  1CFM A;  1JB7 A;  3FP9 A;  3AFP A;  3KFU A;  1UWV A;  3NQT A;  4CGY B;  1FNV A;  3KJO A;  1A3V A;  2OEO A;  1S5F D;  3U58 A;  1HA6 A;  4JYA Q;  4IUR A;  3U9O A;  4C1N I;  2M2L A;  4LMQ D;  5IGB A;  4OO1 H;  4L63 B;  1G6Z A;  3M3Y H;  1AN8 A;  1TWC H;  5E7N A;  2NTS A;  2R7D A;  2E74 C;  5CBA E;  2RSO A;  2NVT H;  5GQO A;  4A3D G;  3NHH A;  1Q7Y C;  3QB3 A;  4LFC Q;  5C0X G;  1LT4 D;  2YV5 A;  4LF7 L;  1OXX K;  1PLF A;  5I4D A;  4J8Q A;  4DUZ Q;  3MTS A;  3X3N A;  3A8J E;  5M3F B;  3CRL C;  2EJG C;  2R7Z B;  3V2T A;  4YWL A;  4K0K L;  5BR8 Q;  1S3O A;  3Q6S A;  1U0L A;  3T16 A;  2K03 A;  1NMG A;  1GUG A;  1EWH A;  2EJF C;  3FRP B;  4UHV A;  2K32 A;  3A7A B;  3G4S A;  1I3Q H;  2KJX A;  3I4N B;  1Y8N B;  5J39 A;  1PHJ A;  1RDP D;  2SEB D;  1N32 L;  1WJJ A;  2ZM6 Q;  1GUO A;  2HT1 A;  3PUZ A;  4P71 A;  3CCM A;  3J81 c;  1XYI A;  1STB A;  3RUZ A;  1PH5 A;  4JK1 C;  1IKL A;  2SNM A;  3CCU A;  4LF6 L;  1GVP A;  3LGJ A;  4DAY B;  2RKS A;  4IAL A;  4FF4 A;  1QNU A;  4PMC A;  3QOJ A;  1KRT A;  1CHQ D;  3HEJ A;  2OWO A;  4C2M H;  1MJE A;  5CV9 A;  1TY0 A;  4LUZ A;  4XQQ A;  2HDL A;  4A76 A;  3QO2 A;  1RTO A;  4GNX A;  2XWB B;  4CKB A;  3CCQ A;  2RVL A;  1SAP A;  1R9T H;  4A3D H;  5C3E B;  3M85 A;  1A8V A;  2RHS B;  5C0X H;  3TRZ A;  2RCF A;  2VQE Q;  1L1O C;  5M5X H;  2C35 B;  4A75 A;  4ZLT F;  2ES2 A;  5JJK A;  3M7G A;  1CKN B;  4NPS A;  1NNX A;  1ENF A;  1V8Q A;  1GUT A;  3GTL B;  1GO3 E;  3L7Z C;  1PZJ D;  4JOI A;  3ULL A;  2NB0 A;  1IW7 D;  4ILW A;  2Z4H A;  4X3U A;  2CWP A;  4JI1 Q;  3UDG A;  4RHS A;  1B50 A;  2J4X A;  2B2T C;  1HNZ Q;  5E3F A;  4EGV A;  4IPG A;  3NBI A;  5DM6 3;  3BYY B;  2E2I B;  1E1T A;  5EPJ A;  2BH2 A;  5EBC A;  4AIM A;  1ZYR D;  3QOL A;  2DNC A;  1XNR L;  3KF6 B;  5JAV A;  3AEV A;  4IPH A;  2E76 C;  5DM7 3;  2F0K A;  1L2F A;  1WCM B;  2RA4 A;  4L6T B;  4C3I G;  1O80 A;  1XMO L;  5IY0 A;  1P8L A;  1VQP A;  3I2Z A;  3KYH C;  1H9M A;  2EYF A;  2Y0S E;  2XSC A;  5M5W H;  4RH6 A;  3L9A X;  2QA4 A;  2B2U C;  1A15 A;  1G91 A;  4K0K Q;  2NZH A;  3GTM H;  4TKO B;  4EQN A;  1ZEQ X;  1YNJ C;  4UPA A;  4HID A;  4B08 A;  1M8A A;  1E0B A;  3D4D A;  2A69 D;  5KGU A;  3S16 B;  4KN7 C;  3DWP A;  1SJE D;  1JWS D;  1HNX Q;  4KJN A;  2X6G A;  1ML0 D;  2Q2I A;  2NN6 I;  2VQF Q;  1SBB B;  5FLX E;  3T4A C;  1JCK B;  5KND A;  4ZKC B;  1LV9 A;  2F3W A;  2Z0S A;  2WAQ B;  1IW7 C;  2F4I A;  4DV0 Q;  3S2H B;  2XTI A;  2K5D A;  1CI3 M;  1Q8K A;  3K5N A;  4LF6 Q;  1KLU D;  4PMB A;  5COR A;  5M5Y H;  1X3G A;  2EYP A;  1K8A C;  2QKI C;  1BKB A;  2J7Z A;  1ZYR C;  5IGG A;  3NEL A;  2DUD A;  4OGQ C;  1IBM Q;  3HKZ E;  4BY7 H;  4ME3 A;  4JI5 Q;  4DAP A;  4A3J B;  1WTH A;  2E2D C;  2O2L D;  2A68 C;  1XX8 A;  4X66 L;  4LWC A;  3HOW B;  2BDO A;  4C3I H;  4X65 L;  1EYD A;  1EY4 A;  2KEE A;  3V05 A;  5ELE A;  1PYS B;  5C5L A;  4OWW B;  1Q1B A;  4QUF A;  1H95 A;  2UXD L;  1E1O A;  2AQ2 B;  5IOC A;  1WOC A;  4A3B G;  1DXM A;  5TSS A;  2LXK A;  1Y14 B;  3QJY A;  2OTL A;  4B3T L;  3E9H A;  3FPU B;  2A69 C;  5IT9 c;  5GRO A;  4YHH L;  3NXW A;  5CYU A;  3P1H A;  4BBS B;  1DON A;  2E5L L;  5EAY A;  4C1N K;  1TII D;  4GN3 B;  1PA6 A;  4PZ7 A;  3KBG A;  2ALY B;  2K6A A;  5E4X A;  2Z8L A;  1N34 L;  1J6Q A;  4G7O C;  2F0F A;  1I94 L;  1ESF A;  1QUQ A;  4MTK A;  4V19 0;  2DGY A;  2K14 A;  1M90 C;  1VQ7 A;  3VR6 A;  1F2L A;  4A3F B;  2D9U A;  4ZCK A;  4L5S A;  2A1A A;  4QQB X;  4IUQ A;  1LT5 D;  1CKO A;  2JA5 H;  5CGK A;  1XMO Q;  2BA1 A;  1I4X A;  3RLO A;  2DN8 A;  4HSV A;  1PZK D;  1YNX A;  3NEM A;  3GQB A;  4KY5 A;  2PPB C;  2RBM A;  3AU7 A;  4DNI A;  1Y69 U;  4DA2 A;  3CCV A;  1AW7 A;  2CHB D;  3CHB D;  2TSS A;  4TRD A;  2VUM B;  2F0O A;  4UY8 C;  4QB4 A;  5FO9 B;  3S1R H;  3PMF A;  4OL7 A;  2WB1 G;  4CDC C;  3S1N H;  1SYB A;  1WD1 A;  4JW0 A;  1BDO A;  4DV5 L;  3IKJ A;  3M4Y A;  1SEB D;  5CR3 A;  1N33 Q;  4A3B H;  4DR3 Q;  1HH2 P;  4YCU A;  4PMW A;  2CKZ B;  3PF5 A;  4DNR B;  5EQ0 A;  1TWH H;  2YTX A;  4DR7 L;  1GOZ A;  5D3D A;  4R8I A;  3A8I E;  1EZ6 A;  4PQX A;  1QWY A;  1ENA A;  2A74 C;  3FKI G;  1KQS A;  2F0P A;  1K8O A;  5G3L D;  3RN2 A;  2CFM A;  3QIA A;  1W6K A;  1N9W A;  3MVV A;  5ELD A;  3ONA B;  4ZRZ A;  5DLQ E;  5DEH A;  2VW9 A;  4CHT B;  4O0A A;  1I4Q A;  4DR1 Q;  4F87 A;  3J80 L;  1JMC A;  3R2I A;  4NP5 A;  1AZP A;  4HED A;  2E8G A;  1PTO B;  4X65 Q;  1Z6H A;  5ELO A;  4HIM A;  1SLJ A;  1STE A;  4RA8 A;  4A3K B;  4XT1 B;  1K3B C;  5IYD G;  3AQQ A;  3DEO A;  2M00 A;  4HN7 A;  4ID6 A;  4RMF A;  3I73 A;  4EQP A;  2L5T A;  3H3V I;  5KIX A;  4L5T A;  4YCV A;  4B3T Q;  3C46 A;  1CT1 D;  4YHH Q;  5C4X B;  2WAQ E;  4LNQ A;  2D62 A;  2PI2 A;  3BZD B;  1KD1 C;  1H9S B;  3WOE A;  2L15 A;  2L12 A;  3SGI A;  3S17 H;  1VQC A;  1Y8O B;  3MZ5 A;  1HZ9 A;  3PGZ A;  1I94 Q;  5KEE A;  1PYW D;  3KDF B;  2L0C A;  1IHZ A;  1SNP A;  3GTJ B;  1LAC A;  2B63 G;  1E2V A;  1EY9 A;  3J81 E;  3FKI H;  2ATW A;  5LMN W;  3MEF A;  2F0J A;  3HP3 A;  1EIY B;  2MP1 A;  4RGT A;  3I4L A;  2ZJQ A;  5EKI A;  1PMR A;  1HHV A;  1BCP B;  1PFN A;  2ASB A;  3MXU A;  1QVG A;  4KJO A;  1QIL A;  1CSP A;  2BA0 A;  4A3E B;  3PO2 G;  3P20 A;  4OHJ A;  2EXZ A;  4OWX B;  1E3P A;  3BVZ A;  4XYQ A;  2RDF A;  3S1Q B;  1PH9 A;  1C8C A;  3H15 A;  4IUT A;  3VR5 A;  4DV5 Q;  1SMX A;  2M9V A;  1TWA H;  4DR7 Q;  2KQ3 A;  3URY A;  1LTL A;  1YJN A;  5D14 A;  1B7Y B;  4EQO A;  1ASY A;  5LHY 1;  4DFA A;  4L5Q A;  2MHV A;  1DZ1 A;  3K0X A;  3WDN A;  4KN4 C;  4DV6 Q;  2C9O A;  3RLN A;  2JA9 A;  4FXK C;  2SDF A;  5JPN C;  3U4Z A;  1SDF A;  1K83 B;  4J15 A;  3RNU A;  1EIF A;  2N49 A;  2NTT A;  5GAG C;  4V0B A;  3K5L A;  1JQY D;  4U67 3;  2B63 H;  2I46 A;  4DV7 L;  3SDZ A;  2IY5 B;  1KIX A;  5E1F A;  3I3C A;  1XXG A;  1JJ2 A;  5C3W A;  1V1P A;  2EYH A;  1I6H H;  2O5I C;  3GTG B;  3G71 A;  5LL6 X;  4A3G B;  1K73 C;  2XIW A;  4AYB B;  3OTO Q;  1OXS C;  2FIN B;  2LXJ A;  1VQL A;  1S5E D;  3D3R A;  1A0I A;  1O7Y A;  4N9T A;  4FF1 A;  2KCN A;  3AB9 A;  4A3L G;  1MGS A;  2UXB L;  4BBR B;  1ROD A;  2EE1 A;  1UAP A;  2B2V C;  2B3G A;  4OX9 L;  4YIJ A;  3CC7 A;  3HOU G;  3PO2 H;  4KK7 A;  4EQ5 A;  4B3M L;  2FXQ A;  2HDM A;  2NVY H;  2F3I A;  2E2H H;  4GZY C;  2QDB A;  4XIG S;  2JA7 B;  3CC2 A;  1II3 A;  1L0W A;  2PYK A;  2UUB L;  1JWM D;  1D5Z C;  1BCP F;  3ND9 A;  3CQZ B;  4I65 A;  5FK9 C;  2PW5 A;  1N36 Q;  2K5Q A;  4NW2 A;  3S2D H;  2ENB A;  4BXX G;  3TP7 A;  3Q8D A;  1GKH A;  2F0M A;  2FMM A;  2HIX A;  3HOY B;  2IJ0 A;  3F2C A;  4WRD A;  4HCS A;  4DR6 Q;  1TS4 A;  5ISR A;  2G9D A;  1D7Q A;  2R93 G;  3IRB A;  2PQA B;  1Y8P B;  3E3X A;  2NWG A;  4APV A;  4GNX B;  4IUP A;  3TS0 A;  4ABN A;  4QL5 A;  3M4O H;  3DM3 A;  3CXC A;  1BBW A;  2B8F A;  4OIK A;  4C3J G;  2K33 A;  2WIN B;  4F7X A;  4X3T A;  4DK1 A;  4FF2 A;  1T9H A;  5JPM C;  1FVI A;  4R4Q A;  3HOV B;  2QGQ A;  4LF5 L;  1VQD A;  3ERO A;  4RCO A;  3AYH B;  2K5N A;  3BVM A;  3D0F A;  4A3L H;  4XXE A;  1SFO H;  3HOU H;  2IX3 A;  3PO3 G;  4YWK A;  4DR2 L;  3DXJ C;  5E4W C;  4JI6 L;  5IT9 E;  4LFB L;  4OEL B;  1F9P A;  3Q23 A;  5EPL A;  3PUY A;  2EJM A;  2Q2H A;  3H3V C;  1V1O A;  1VQM A;  4X64 Q;  1PFS A;  4FF3 A;  3LWU A;  4C3H B;  2G5D A;  5KNB A;  2DY8 A;  1A63 A;  1AFP A;  4M8A A;  4BXX H;  4BY1 G;  1LM0 A;  5CV4 A;  1BR9 A;  3NP8 A;  2ZTC A;  1JE4 A;  4O2D A;  2UU9 L;  4A3I G;  1VF7 A;  2BH8 A;  2PO4 A;  3I7F A;  4HJ5 A;  2Z6K A;  2JEB I;  3I91 A;  4A93 G;  1HTL D;  1EQV A;  2NUC A;  3J80 i;  4DXG A;  5C6A A;  5AJ3 L;  2UXB Q;  5CBE E;  2AQ1 B;  2CQO A;  1QG7 A;  2FJ2 A;  3MAQ A;  3CCL A;  4AQY L;  3LWE A;  4C3J H;  3BG3 A;  3F8T A;  2AHO B;  1EU3 A;  1X3F A;  4LAA A;  4ZAI A;  1PFB A;  5M3F G;  4FNF A;  2NVX H;  2K28 A;  1AE3 A;  2MUY A;  4GN4 B;  1HTP A;  1PH3 A;  2A6H D;  3PO3 H;  4KHZ A;  1PH7 A;  1C48 A;  1EQR A;  1LTA D;  5JEA J;  4K8J A;  3A0J A;  5IP7 G;  2K04 A;  2NVQ B;  1SJH D;  2P5Z X;  1SND A;  1JJG A;  5IGD A;  2E2J H;  4JI4 L;  1K0R A;  3RZO B;  1VQF A;  1MD2 D;  3Q24 A;  2VNU D;  4R4I A;  1O7L A;  4AYB E;  1GD7 A;  1UE1 A;  3CKI B;  5A2Q L;  1P16 A;  1RD9 D;  3KLW A;  3S1M H;  3RN5 A;  4LF8 L;  3KF8 B;  4BY1 H;  4P74 A;  3C3L A;  2GA4 B;  4XTC S;  2EYO A;  3I4M G;  1WTW A;  2DJF C;  4A3I H;  1OXU A;  5FO8 B;  3CRK C;  4ALP A;  1UNS A;  3RZD H;  4LF5 Q;  1NE3 A;  4A93 H;  1STG A;  3HKZ B;  4I7A A;  3H91 A;  3L0O A;  4NKL A;  2JA6 B;  3K8A A;  1AEX A;  4JCV E;  2F03 A;  1O7I A;  3MFY A;  4LFB Q;  2QEX A;  4IJL A;  1I5F A;  2K5W A;  4DV1 L;  2LMC B;  1JIC A;  2YU9 H;  1WTR A;  3J7A 5;  5M3F H;  3K5O A;  2UUC Q;  1HPC A;  4Z9C B;  2CH4 W;  5M3M B;  2A6H C;  1U4P A;  3ND8 A;  1SYD A;  4G57 A;  2F0T A;  1SYC A;  5IP7 H;  1EEI D;  1I3Q B;  5C4H A;  3ZYY X;  4K5V A;  4KHV A;  1JJC B;  1XPU A;  2Q2U A;  4RFB A;  1B4O A;  1Q1E A;  4HJA A;  5LMN L;  3K0Y A;  3TQY A;  4F88 A;  4TSS A;  2LFN A;  1AZQ A;  2AKW B;  1DJR D;  3J81 i;  3MXP A;  1WCM G;  2F0Q A;  1FNW A;  5AJ3 Q;  1Q90 A;  3GV6 A;  2JA8 B;  3NWT A;  1VQE A;  1HJP A;  3OYY A;  1LYL A;  1F2Y A;  1CKM A;  1ONL A;  2KOL A;  2MNA A;  3LX0 A;  1X54 A;  4QIW B;  3I4M H;  1IYJ B;  1K8M A;  1HQR D;  1LO5 D;  4H13 C;  4R4T A;  3I70 A;  2XRQ D;  4C2M B;  3JAM E;  1D5M C;  2SNS A;  1SSO A;  1X3Q A;  1K3R A;  1Q46 A;  4TVA B;  2N55 A;  1R9T B;  4A3D B;  1CZW A;  5JVH 3;  1B9M A;  1EIH A;  4LFA L;  5M5X B;  3UE1 A;  3OHX C;  3VDY A;  4CDE C;  2N78 A;  1U4M A;  2EDG A;  2F52 A;  4QMG A;  1E2W A;  1I50 H;  3EFX D;  1JWU D;  5COY A;  3PIP A;  4Y7N H;  3NE5 B;  4IN3 A;  1HR0 L;  4FXD A;  3S14 H;  4JI4 Q;  3H09 A;  2D5D A;  2HIV A;  4RWS C;  3PF4 A;  3TSS A;  1BF4 A;  1AP0 A;  4N8X 1;  2NZ1 D;  4LF8 Q;  4BY7 G;  4IFD G;  3VR4 A;  2PNR C;  2EYL A;  4JI2 L;  4Q5V A;  1WTQ A;  2IW3 A;  4QF4 A;  2PMZ E;  3DMU A;  5EBD A;  1BVS A;  4X3K A;  4IOA A;  4LF7 Q;  2L9H A;  3TRE A;  4A3J G;  2KA7 A;  2OCE A;  1WCM H;  4DAM A;  2F4V L;  2K01 A;  4LUV A;  2HQL A;  4LF4 L;  5DAU A;  4ZYS A;  1RIP A;  5HGT A;  3U50 C;  2Q2T A;  1G6P A;  1CM9 A;  3KLS A;  4JBJ A;  5M5W B;  5C44 B;  4DGZ A;  3GTM B;  1EFW A;  3QG1 A;  1SR3 A;  4JPB W;  1N32 Q;  1N8R C;  1A6X A;  1J9O A;  2BE5 D;  3FHW A;  3Q22 A;  5C5M A;  4QCL A;  3CW2 C;  3GP7 A;  2EY6 A;  3ZJY C;  3MFG A;  1KAB A;  5I6Y A;  2A19 A;  1TR5 A;  2PCF B;  3A5Z B;  3KOJ A;  2JA5 G;  5LMN Q;  4KI0 A;  3SE0 A;  1IYU A;  4A3F G;  3TZU A;  2DJG C;  1Q8I A;  1WTX A;  1G2T A;  4K5X A;  1SYE A;  1X65 A;  4XDX A;  2R92 G;  3Q0A A;  4HMJ A;  4IFD H;  2IL8 A;  2ZT9 C;  1EU4 A;  4IUN A;  1B1Z A;  1F9Q A;  2L4N A;  1E24 A;  1QVC A;  4KY6 A;  3WWV A;  4YWM A;  3PIO A;  4GOP B;  4GLV B;  1O78 A;  1HFN A;  3SEB A;  4H7B A;  1HQM C;  2B2Y C;  4IO9 A;  4A3J H;  4KHP L;  1B8A A;  3L3O C;  3C2P A;  1MIU A;  4G7H C;  1R4Q B;  1SE3 A;  1FNU A;  4LFA Q;  1DOM A;  1M4V A;  3T51 B;  1CSQ A;  1NY4 A;  2BDN A;  1PTO D;  1ICW A;  3H0G B;  3R93 A;  5ELF A;  3VYU A;  3S9W A;  3OPO A;  4R8N A;  1U9R A;  1TS2 A;  2A5H A;  4OEM B;  4JI3 L;  2O5J C;  4IZ8 A;  5EKL A;  2EVB A;  3E0J A;  2BE5 C;  3HRZ C;  4J6H A;  3E5S A;  5FLX L;  5C0X J;  1I4R A;  2YYZ A;  5CV5 A;  1XNR Q;  1GUN A;  4JI2 Q;  2KVM A;  4RKL A;  1MSH A;  4QIW E;  3OMC A;  3A5U A;  2ZXO A;  5IGC A;  5D65 A;  3NTH A;  4O42 A;  4A3F H;  3F1Z A;  1L0X B;  1KDC A;  1VQ8 A;  2R92 H;  3NUC A;  4BWG B;  4RG1 A;  1AE2 A;  1PRT D;  1VMC A;  3WOF A;  1CQF A;  4A3K G;  3RMH A;  3HG9 A;  1SRU A;  2JSO A;  3D6C A;  3MA2 B;  1V43 A;  3K7A H;  1Y1W G;  3MXN A;  3S1R B;  2B8G A;  1BCP D;  1BOS A;  3S1N B;  3IL8 A;  1PTO C;  2I07 B;  4A3B B;  2MPM A;  5ELN A;  2H1E A;  1TWH B;  3SXH A;  2ICE C;  1XPR A;  3T1Y L;  1G29 1;  3GTQ B;  3HOX G;  3HOZ G;  4BA1 I;  3HGB A;  5C4J H;  1IL2 A;  4ZKB B;  1A62 A;  1JE5 A;  1KXL A;  1XPO A;  1HXY D;  2Z1C A;  4CJ2 C;  1IBL L;  4A4I A;  2B2W C;  2EY5 A;  2LKV A;  3SK6 A;  2CWA A;  4DXF A;  4X66 Q;  3KJP A;  2PI2 E;  3R3O A;  1D1I A;  3L2P A;  1SE8 A;  3EA6 A;  1SNO A;  4P2C B;  1STH A;  4IOC A;  2WKC A;  2K5V A;  4KHP Q;  2UXD Q;  3BDC A;  1SRO A;  1XWE A;  1FGB D;  4GLX A;  3W1B A;  4JBM A;  4HAE A;  3GV3 A;  5FO7 B;  1JOR A;  4DR4 L;  2I0Q A;  1L1O A;  4A3K H;  2Q8T A;  5IYC G;  2NN6 G;  2PNH A;  1BBX C;  3A56 A;  2CH4 A;  3RLF A;  3OWE B;  2RQX A;  1YIJ A;  4JV5 L;  2A6E D;  2E5L Q;  2K1B A;  1Y1W H;  2ICI A;  1BCP C;  1N34 Q;  4DUY L;  5C4X H;  2Q8R E;  1X6O A;  1YIT A;  1K9M C;  3GTK B;  3UDI A;  1PRT B;  1VF5 C;  3MXG A;  4GKK L;  3PV0 A;  5CC4 A;  1VQJ A;  4C56 C;  2B2T A;  3W1G A;  1IYV A;  3S17 B;  4MZ9 A;  1TWF B;  2XVS A;  3ULP A;  2EIF A;  3CCS A;  1NR2 A;  4K6D A;  3TP8 A;  3HOX H;  3HOZ H;  1PYB A;  3DM1 A;  2K05 A;  1U4R A;  4JG2 A;  1A2T A;  4JC0 A;  4UP9 A;  3NBH B;  3CMA A;  3FVQ A;  1EWI A;  4ZUJ A;  4DK3 C;  2F0G A;  1XNQ L;  3I56 A;  1EY8 A;  1H9K A;  1TXY A;  4LUO A;  4IUU A;  2LSS A;  3PCO B;  4EVO A;  2B2U A;  3JAM c;  3D4W A;  1OO9 B;  2XN9 C;  1VQK A;  4OO1 I;  4A3E H;  5EJW A;  1G2S A;  1KRS A;  3GDE A;  4NXN L;  3S1Q H;  1F2M A;  2HCC A;  2K52 A;  4XQN A;  4FVM A;  2JA7 G;  1PTO F;  5IYC H;  2NN6 H;  1CA6 A;  4HJ7 A;  4GLA C;  1TWA B;  2A6E C;  3TN2 A;  1HR0 W;  3CU7 A;  1EYG A;  2NBF A;  3HS0 C;  1Y1V G;  4JVZ A;  1VCI A;  2L1B A;  4AH6 A;  4LW1 A;  4CJ1 B;  3J81 L;  1VQO A;  1DCZ A;  1SXT A;  1IBL Q;  4NB3 A;  3J7Y W;  1VQG A;  2CW0 D;  3G6E A;  4POG A;  3HOY G;  4X62 L;  1Q3L A;  2ZTD A;  3E0E A;  1XMQ L;  2PZU A;  2KEC A;  1KC8 C;  2K50 A;  3C1E A;  3BVG A;  2JQO A;  3BZC A;  2D0P A; 
#chains in the Genus database with same CATH homology
 2B63 B;  3TME A;  1PXU A;  2SOB A;  1PRT F;  1I6H B;  2B2Y A;  3W2D A;  4KKT A;  2B39 A;  5BN3 A;  2AWO A;  1SYG A;  4I7Z C;  3GTP B;  1I4H A;  2NVY B;  3KBX A;  2QCP X;  2X6L A;  2E2H B;  1SNQ A;  1LAB A;  4A3M B;  1RJT A;  2NYZ D;  1T5X D;  2MJ8 A;  3GTO B;  1RCV D;  1RKN A;  5C0X I;  3R2T A;  5DNF A;  1ZXT A;  1EFI D;  1SYF A;  4C3H G;  3S2D B;  3OW7 A;  4K5W A;  1S4Z A;  1WTV A;  2CW0 C;  5T1G A;  2IT1 A;  5BN4 A;  3FEW X;  5ELC A;  1KAA A;  3P7J A;  3TP6 A;  3D6W A;  1HFG A;  1EZ8 A;  1LTB D;  3MHB A;  2KHS A;  1IKM A;  3V96 A;  3SVM A;  5JVG 3;  4NDX A;  3I72 A;  1I4G A;  4G4K A;  4RCN A;  3VA5 A;  2F3V A;  3GD7 A;  1HUM A;  5I2X A;  4Q0F A;  2VXW A;  3O13 A;  4XQJ A;  2QEJ C;  2FMC A;  2KED A;  2EY2 A;  1TKW B;  2EYJ A;  2MGS A;  3DHQ A;  2VB3 X;  4CKC A;  3N6R A;  3FPP A;  4R9W A;  1IL8 A;  1SFO B;  3I8Z A;  2DY7 A;  5NUC A;  4K6L A;  2R61 A;  3NSW A;  1E2Z A;  2F0E A;  2BCO A;  1LTI D;  3T56 B;  3GO5 A;  3DUZ A;  4DK0 A;  4M1U B;  3EVQ A;  1PFM A;  3F2U A;  3OSO A;  1CZG A;  2KCC A;  1NCV A;  3DEP A;  5K5P A;  2OT2 A;  2R93 B;  4N9P A;  3VYT A;  2PMZ B;  1NSN S;  2R3Z A;  2DNE A;  1NUC A;  2V4D A;  4JBW A;  4RGM A;  3E6Z X;  5A35 A;  1NR4 A;  5IIF A;  1D2B A;  4RAU C;  5KRU A;  2AQ3 B;  1ZKO A;  5IT9 L;  5IGE A;  3PIO 3;  1LTS D;  3ERQ A;  1Z47 A;  5IOD A;  4UDU C;  3SK5 A;  1DM0 B;  1KLG D;  1FD7 D;  3K57 A;  1HUN A;  3W3A A;  3VR3 A;  2HUG A;  1GUW A;  3BDO A;  4TQU S;  4KD4 A;  3AMU A;  1OXV A;  5I9P A;  5AFW A;  3S1M B;  4FP5 D;  4BY1 B;  1J8I A;  2WKD A;  3M3Y B;  1TWC B;  3OIP A;  2JE6 I;  2NVT B;  5F2D A;  4A3I B;  5K36 G;  1B9N A;  1SMY D;  2AWN A;  1G8Z D;  3RZD B;  4A93 B;  1CK1 A;  1LT3 D;  1STN A;  4PV1 C;  2F0U A;  4DAV A;  1QE6 A;  4K14 A;  3VYS A;  2ZXR A;  1GXD C;  2YU9 B;  3KLS X;  4RGO S;  5I9O A;  5IGF A;  2WAC A;  1JC7 A;  1Q12 A;  4KKU A;  2AUJ D;  1TS3 A;  3G6J B;  2IWH A;  1DD2 A;  4O1N A;  1D6E C;  1RTN A;  2JYO A;  4HR7 B;  2F0D A;  1W6J A;  2HCI A;  4HMI A;  2EPB A;  1BUV T;  3D4R A;  5JOB A;  2CVR A;  2G9H D;  5M9O A;  4H44 C;  2F0H A;  1S5C D;  2B2V A;  1ENC A;  3I4M B;  1SMY C;  3K5M A;  5K36 H;  1CHP D;  1F9S A;  2EZV A;  4WFN 3;  4UAI A;  3NQI A;  1YNJ D;  3A8K E;  3DWA A;  1KNA A;  4H0L C;  1JOO A;  1I50 B;  5EPK A;  3ITP A;  4Y7N B;  3S14 B;  2AUK A;  4IUV A;  4KY7 A;  2N88 A;  2LY7 A;  3TDQ A;  3IFD A;  5CV6 A;  3SR1 A;  4PNY A;  2IX0 A;  3NTK A;  3OIQ A;  2RDH A;  3MC0 B;  2Z4I A;  3SK4 A;  1D5X C;  5EKK A;  1EOT A;  1CQV A;  2JEA I;  4KTA A;  2FFK B;  4WJW A;  1F77 A;  3PUW A;  1D1K A;  2PQE A;  1PZI D;  2Q8I B;  2WV6 D;  5C3X A;  3JAM L;  3KK7 A;  4B9W A;  1UUP A;  2L55 A;  2A68 D;  3FMC A;  4J1M A;  1VDZ A;  1S5B D;  1EIG A;  4S3S A;  2HQE A;  4K8I A;  4RKB A;  3FDT A;  5CMD A;  4CBV A;  2IPK D;  1BNZ A;  3A55 A;  5D3I B;  4DF7 A;  1OXT A;  1EY5 A;  3C1F A;  3K59 A;  3T13 A;  5I6W A;  1B53 A;  2F0S A;  1X32 A;  3PUV A;  5M5Y B;  3TP5 A;  2F0I A;  2O4X A;  1ET6 A;  5C4Z A;  3OMG A;  5T1I A;  4BY7 B;  3BYT B;  3UI2 A;  4FYD A;  4C3I B;  1YNN D;  1B3A A;  2D2C C;  1EWC A;  1B2T A;  1R4P B;  2IX1 A;  3DWQ A;  1C4Q A;  3BDL A;  5KYL A;  3VA7 A;  1GUS A;  3KF8 A;  3OWF A;  1S5D D;  4X3S A;  2OXP A;  3KLR A;  1SNC A;  1WTP A;  1V1P B;  2VB2 X;  1CTM A;  1L0Y B;  3D31 A;  1EYA A;  1BO0 A;  2FHT A;  1ILQ A;  3VR2 A;  1SE4 A;  2JA5 B;  2PZT A;  2K7V A;  1DOL A;  3D8G A;  4KV6 A;  1SNM A;  1TY2 A;  5ELB A;  4K2L A;  4L8J A;  3J80 E;  2R92 B;  1A3U A;  1EYC A;  3A54 A;  1F9R A;  1YNN C;  2ID0 A;  2BOS A;  3EJI A;  4E6I A;  4DAY A;  3K7A B;  3LNN A;  1LT6 D;  3NTI A;  1STA A;  1WD0 A;  4IQZ A;  4DNT B;  1EY6 A;  3OOC A;  3HZX A;  5HUR A;  1KDA A;  2XRS D;  2R6G A;  1I6V C;  3J7A F;  4ME5 A;  1QCB D;  1KTK A;  1EL0 A;  3J7A V;  5C4J B;  4MHE A;  1EEF D;  1LTG D;  2J0T D;  2XNA C;  1KNE A;  3T53 B;  1PRT C;  1JOK A;  3SHL A;  1PTO H;  4K2K A;  4U68 A;  4IFD J;  1JR0 D;  5FOB B;  4HSP A;  4RGN A;  2WP8 J;  1HRJ A;  1A2U A;  1DYQ A;  2X69 A;  1PDQ A;  2WB1 B;  3MWY W;  1FR3 A;  2EY1 A;  2KUM A;  1Y1W B;  4ZQ3 A;  1EY0 A;  4FO2 A;  2JP1 A;  2L11 A;  2A73 B;  1QB5 D;  1RF2 D;  3FKI B;  3K58 A;  2XWJ B;  2C5C A;  3HOX B;  3HOZ B;  2ZXP A;  2E75 C;  2TMP A;  4ZK9 B;  1TU2 B;  1MI2 A;  3RD4 A;  1U4L A;  1GHK A;  3EQL C;  4ULL A;  5CV8 A;  3X3M A;  1EQT A;  3MEH A;  3M7N A;  5JEA G;  2F0W A;  4HTH A;  1CA5 A;  3KUP A;  2JXM B;  4B9X A;  1XTC D;  3TZD A;  4F8M A;  4CJ0 B;  1VMP A;  2OF1 A;  2EOT A;  1EY7 A;  2PW7 A;  2F0L A;  1SE2 A;  1STY A;  5KNC A;  2H4O A;  5CV7 A;  1F2Z A;  3IFT A;  1H9R A;  4NMZ A;  2QF7 A;  2QIL A;  3QWN A;  3VYR A;  4CKE A;  1GHJ A;  3S15 B;  3PO2 B;  3G7L A;  1B44 D;  2CQA A;  1ET9 A;  4ODG A;  5FKA C;  1T5E A;  3BS1 A;  1JOQ A;  5EGT A;  5JEA H;  1A3T A;  3A7L A;  3N52 A;  1I4P A;  4LJZ C;  4XT3 B;  1TS5 A;  4WOR A;  1BQQ T;  3NK9 A;  2WII B;  3IAY A;  1MSG A;  1Y1V B;  1KDB A;  1TQO A;  4BS9 A;  1HA5 A;  3PIP 3;  5G3L F;  3NPP A;  1QNK A;  1TT2 A;  4QUC A;  1X3P A;  3U9S A;  5J1Z A;  3M4O B;  5JJZ A;  4LK1 C;  3H94 A;  2LS0 1;  1WTO A;  1BXT A;  3I90 A;  1QJO A;  1Z7T A;  1ESR A;  5LL6 S;  3HOU B;  1LLR D;  3K6O A;  4MIU A;  4ZUI A;  3R8B A;  2PZW A;  4KMU C;  2F0N A;  1NAP A;  1ILP A;  1DOK A;  2RDG A;  3NWS A;  2EYM A;  3TBI B;  2B2W A;  2F0V A;  5J22 A;  1H9S A;  3H6M A;  4KD3 A;  4FXG C;  1UEA B;  4OO1 G;  1FYC A;  1HCZ A;  1RHP A;  4HCE A;  5A2Q E;  5KYI A;  5I2Y A;  1O7Z A;  4DU9 A;  4MN3 A;  5BN5 A;  4IFD I;  1TWG B;  4C3J B;  1H9J A;  1JB3 A;  1LTT D;  1MBY A;  1LTR D;  1GJX A;  4BA2 I;  4G7Z C;  4XYO A;  4RHR A;  1TVX A;  2NVX B;  3NBH A;  4DN4 M;  3SK8 A;  1WVL A;  3PO3 B;  1QOH A;  3P75 A;  2Y0S B;  4KKS A;  4OIJ A;  3PUX A;  2E2J B;  2RSN A;  1CFM A;  3NQT A;  4CGY B;  1FNV A;  1A3V A;  2OEO A;  1S5F D;  1HA6 A;  4IUR A;  3U9O A;  4C1N I;  2M2L A;  4LMQ D;  5IGB A;  4OO1 H;  4L63 B;  1G6Z A;  1AN8 A;  2NTS A;  5CBA E;  2E74 C;  2RSO A;  3NHH A;  3QB3 A;  5C0X G;  1LT4 D;  1OXX K;  1PLF A;  5I4D A;  4J8Q A;  3MTS A;  3X3N A;  3A8J E;  5M3F B;  3CRL C;  2EJG C;  2R7Z B;  3V2T A;  3Q6S A;  3T16 A;  2K03 A;  1GUG A;  1EWH A;  2EJF C;  3FRP B;  2K32 A;  3A7A B;  2KJX A;  3I4N B;  1Y8N B;  5J39 A;  1RDP D;  2SEB D;  1GUO A;  3PUZ A;  1XYI A;  1STB A;  3RUZ A;  4JK1 C;  1IKL A;  2SNM A;  2RKS A;  4IAL A;  4FF4 A;  1QNU A;  4PMC A;  3QOJ A;  1CHQ D;  3HEJ A;  5CV9 A;  1TY0 A;  4XQQ A;  2HDL A;  3QO2 A;  1RTO A;  2XWB B;  4CKB A;  2RVL A;  1SAP A;  5C3E B;  3M85 A;  5C0X H;  4ZLT F;  3M7G A;  1ENF A;  1V8Q A;  1GUT A;  3GTL B;  3L7Z C;  1PZJ D;  2NB0 A;  1IW7 D;  4ILW A;  2Z4H A;  4X3U A;  1B50 A;  4RHS A;  2J4X A;  2B2T C;  5E3F A;  4EGV A;  3NBI A;  5DM6 3;  3BYY B;  2E2I B;  5EPJ A;  5EBC A;  1ZYR D;  3QOL A;  2DNC A;  5JAV A;  2E76 C;  5DM7 3;  2F0K A;  1WCM B;  2RA4 A;  4L6T B;  4C3I G;  1O80 A;  1H9M A;  2EYF A;  2XSC A;  4RH6 A;  3L9A X;  1G91 A;  2B2U C;  1A15 A;  4TKO B;  4EQN A;  1ZEQ X;  1YNJ C;  4B08 A;  1M8A A;  1E0B A;  3D4D A;  2A69 D;  5KGU A;  3S16 B;  4KN7 C;  3DWP A;  1SJE D;  1JWS D;  4KJN A;  2X6G A;  1ML0 D;  2NN6 I;  1SBB B;  5FLX E;  3T4A C;  1JCK B;  5KND A;  4ZKC B;  1LV9 A;  2F3W A;  2WAQ B;  1IW7 C;  2F4I A;  3S2H B;  2K5D A;  1CI3 M;  3K5N A;  1KLU D;  4PMB A;  5COR A;  2EYP A;  2QKI C;  2J7Z A;  1ZYR C;  5IGG A;  4OGQ C;  4DAP A;  4A3J B;  2E2D C;  2O2L D;  2A68 C;  1XX8 A;  3HOW B;  2BDO A;  1EYD A;  1EY4 A;  2KEE A;  3V05 A;  5ELE A;  5C5L A;  1Q1B A;  4QUF A;  2AQ2 B;  5IOC A;  1DXM A;  5TSS A;  3QJY A;  3FPU B;  2A69 C;  3NXW A;  5CYU A;  3P1H A;  4BBS B;  1DON A;  4C1N K;  1TII D;  3KBG A;  2K6A A;  5E4X A;  2Z8L A;  4G7O C;  2F0F A;  1ESF A;  4V19 0;  3VR6 A;  1F2L A;  4A3F B;  2D9U A;  4IUQ A;  1LT5 D;  5CGK A;  2BA1 A;  1I4X A;  2DN8 A;  4HSV A;  1PZK D;  3GQB A;  4KY5 A;  2PPB C;  2RBM A;  3AU7 A;  1Y69 U;  4DA2 A;  1AW7 A;  2CHB D;  3CHB D;  2TSS A;  4TRD A;  2VUM B;  2F0O A;  4QB4 A;  5FO9 B;  3PMF A;  4OL7 A;  1SYB A;  1WD1 A;  1BDO A;  3IKJ A;  3M4Y A;  1SEB D;  5CR3 A;  4PMW A;  4DNR B;  5EQ0 A;  1GOZ A;  5D3D A;  4R8I A;  3A8I E;  1EZ6 A;  4PQX A;  1QWY A;  1ENA A;  2A74 C;  1K8O A;  2F0P A;  5G3L D;  3QIA A;  1W6K A;  3MVV A;  5ELD A;  3ONA B;  4ZRZ A;  5DEH A;  4CHT B;  1I4Q A;  4F87 A;  3J80 L;  3R2I A;  4NP5 A;  1AZP A;  4HED A;  1PTO B;  1Z6H A;  1STE A;  4RA8 A;  4A3K B;  4XT1 B;  3DEO A;  2M00 A;  4HN7 A;  4ID6 A;  3I73 A;  4EQP A;  2L5T A;  5KIX A;  3C46 A;  1CT1 D;  5C4X B;  2D62 A;  3BZD B;  1H9S B;  3WOE A;  2L12 A;  1Y8O B;  3MZ5 A;  5KEE A;  1PYW D;  2L0C A;  1IHZ A;  1SNP A;  3GTJ B;  1LAC A;  1E2V A;  1EY9 A;  3J81 E;  2F0J A;  3HP3 A;  2MP1 A;  4RGT A;  3I4L A;  5EKI A;  1PMR A;  1HHV A;  1BCP B;  1PFN A;  3MXU A;  4KJO A;  1QIL A;  2BA0 A;  4A3E B;  3P20 A;  4OHJ A;  2EXZ A;  3BVZ A;  4XYQ A;  2RDF A;  3S1Q B;  1C8C A;  4IUT A;  3VR5 A;  2M9V A;  2KQ3 A;  3URY A;  5D14 A;  4EQO A;  5LHY 1;  4DFA A;  2MHV A;  1DZ1 A;  3WDN A;  4KN4 C;  2C9O A;  4FXK C;  2SDF A;  5JPN C;  1SDF A;  1K83 B;  2NTT A;  4V0B A;  3K5L A;  1JQY D;  4U67 3;  2I46 A;  3SDZ A;  5E1F A;  3I3C A;  1XXG A;  5C3W A;  1V1P A;  2EYH A;  2O5I C;  3GTG B;  5LL6 X;  4A3G B;  2XIW A;  4AYB B;  1OXS C;  2FIN B;  1S5E D;  3D3R A;  4N9T A;  1O7Y A;  4FF1 A;  2KCN A;  3AB9 A;  1MGS A;  4BBR B;  1ROD A;  2EE1 A;  1UAP A;  2B2V C;  4YIJ A;  4KK7 A;  2HDM A;  4GZY C;  2QDB A;  4XIG S;  2JA7 B;  1II3 A;  2PYK A;  1JWM D;  1D5Z C;  1BCP F;  3ND9 A;  3CQZ B;  4I65 A;  5FK9 C;  2PW5 A;  2K5Q A;  4NW2 A;  2ENB A;  3TP7 A;  2F0M A;  2FMM A;  3HOY B;  2IJ0 A;  4WRD A;  4HCS A;  1TS4 A;  5ISR A;  2G9D A;  1Y8P B;  2NWG A;  4IUP A;  4ABN A;  2B8F A;  4OIK A;  4C3J G;  2K33 A;  2WIN B;  4F7X A;  4X3T A;  4DK1 A;  4FF2 A;  5JPM C;  3HOV B;  3ERO A;  4RCO A;  3BVM A;  4XXE A;  2IX3 A;  3DXJ C;  5E4W C;  5IT9 E;  1F9P A;  3Q23 A;  5EPL A;  3PUY A;  2EJM A;  3H3V C;  1V1O A;  4FF3 A;  3LWU A;  4C3H B;  5KNB A;  2DY8 A;  1AFP A;  4M8A A;  5CV4 A;  1BR9 A;  3NP8 A;  1JE4 A;  1VF7 A;  2PO4 A;  2JEB I;  3I91 A;  1HTL D;  1EQV A;  2NUC A;  4DXG A;  5C6A A;  5CBE E;  2AQ1 B;  1QG7 A;  2FJ2 A;  3MAQ A;  3LWE A;  3BG3 A;  1EU3 A;  4LAA A;  4ZAI A;  1PFB A;  4FNF A;  2K28 A;  2MUY A;  1HTP A;  2A6H D;  4KHZ A;  1C48 A;  1LTA D;  5JEA J;  4K8J A;  2K04 A;  2NVQ B;  1SJH D;  1SND A;  5IGD A;  3RZO B;  1MD2 D;  3Q24 A;  2VNU D;  1O7L A;  3CKI B;  5A2Q L;  1RD9 D;  3C3L A;  2GA4 B;  4XTC S;  2EYO A;  1WTW A;  1OXU A;  5FO8 B;  3CRK C;  1UNS A;  1STG A;  3HKZ B;  3H91 A;  4NKL A;  2JA6 B;  1AEX A;  2F03 A;  3MFY A;  2K5W A;  2LMC B;  1JIC A;  1WTR A;  3K5O A;  1HPC A;  4Z9C B;  5M3M B;  2A6H C;  1U4P A;  3ND8 A;  1SYD A;  4G57 A;  2F0T A;  1SYC A;  1EEI D;  1I3Q B;  5C4H A;  3ZYY X;  4K5V A;  4KHV A;  4RFB A;  1B4O A;  1Q1E A;  3K0Y A;  4F88 A;  4TSS A;  2LFN A;  1AZQ A;  1DJR D;  3MXP A;  2F0Q A;  1FNW A;  1Q90 A;  3GV6 A;  2JA8 B;  3NWT A;  1F2Y A;  1ONL A;  2KOL A;  3LX0 A;  4QIW B;  1K8M A;  1HQR D;  1LO5 D;  4H13 C;  3I70 A;  2XRQ D;  4C2M B;  3JAM E;  1D5M C;  2SNS A;  1SSO A;  1X3Q A;  2N55 A;  1R9T B;  4A3D B;  1CZW A;  5JVH 3;  1B9M A;  1EIH A;  5M5X B;  3OHX C;  1U4M A;  2EDG A;  4QMG A;  1E2W A;  3EFX D;  1JWU D;  5COY A;  3NE5 B;  4IN3 A;  4FXD A;  3H09 A;  2D5D A;  4RWS C;  3TSS A;  1BF4 A;  1AP0 A;  2NZ1 D;  4IFD G;  3VR4 A;  2PNR C;  2EYL A;  4Q5V A;  1WTQ A;  2IW3 A;  4QF4 A;  3DMU A;  5EBD A;  4X3K A;  2L9H A;  2KA7 A;  2K01 A;  5DAU A;  4ZYS A;  5HGT A;  1CM9 A;  3KLS A;  5M5W B;  5C44 B;  4DGZ A;  3GTM B;  3QG1 A;  1A6X A;  1J9O A;  2BE5 D;  3Q22 A;  5C5M A;  4QCL A;  3GP7 A;  2EY6 A;  3MFG A;  1KAB A;  5I6Y A;  1TR5 A;  2PCF B;  4KI0 A;  3SE0 A;  1IYU A;  3TZU A;  1G2T A;  1Q8I A;  1WTX A;  4K5X A;  1SYE A;  4XDX A;  3Q0A A;  4HMJ A;  4IFD H;  2IL8 A;  2ZT9 C;  1EU4 A;  4IUN A;  1B1Z A;  1F9Q A;  2L4N A;  4KY6 A;  1O78 A;  1HFN A;  3SEB A;  4H7B A;  1HQM C;  2B2Y C;  3L3O C;  3C2P A;  4G7H C;  1R4Q B;  1SE3 A;  1FNU A;  1DOM A;  1M4V A;  3T51 B;  2BDN A;  1PTO D;  1ICW A;  3H0G B;  3R93 A;  5ELF A;  3VYU A;  3S9W A;  3OPO A;  4R8N A;  1U9R A;  1TS2 A;  2A5H A;  2O5J C;  4IZ8 A;  5EKL A;  2EVB A;  3E0J A;  2BE5 C;  3HRZ C;  4J6H A;  3E5S A;  5FLX L;  5C0X J;  1I4R A;  2YYZ A;  5CV5 A;  1GUN A;  2KVM A;  4RKL A;  1MSH A;  3OMC A;  2ZXO A;  5IGC A;  5D65 A;  3NTH A;  4O42 A;  1L0X B;  1KDC A;  3NUC A;  4BWG B;  1PRT D;  1VMC A;  3WOF A;  1CQF A;  3RMH A;  3HG9 A;  2JSO A;  3D6C A;  3MA2 B;  1V43 A;  3MXN A;  3S1R B;  2B8G A;  1BCP D;  1BOS A;  3S1N B;  3IL8 A;  1PTO C;  2I07 B;  4A3B B;  2MPM A;  2H1E A;  1TWH B;  3SXH A;  2ICE C;  1G29 1;  3GTQ B;  4BA1 I;  3HGB A;  4ZKB B;  1HXY D;  2Z1C A;  4CJ2 C;  2B2W C;  2EY5 A;  2LKV A;  3SK6 A;  4DXF A;  3R3O A;  1D1I A;  3EA6 A;  1SNO A;  4P2C B;  1STH A;  2WKC A;  3BDC A;  1XWE A;  1FGB D;  4HAE A;  3GV3 A;  5FO7 B;  1JOR A;  2Q8T A;  2NN6 G;  1BBX C;  3A56 A;  3RLF A;  3OWE B;  2RQX A;  2A6E D;  2K1B A;  2ICI A;  1BCP C;  2Q8R E;  3GTK B;  1PRT B;  1VF5 C;  3MXG A;  5CC4 A;  3PV0 A;  4C56 C;  2B2T A;  1IYV A;  3S17 B;  1TWF B;  2XVS A;  1NR2 A;  4K6D A;  3TP8 A;  3DM1 A;  2K05 A;  1U4R A;  1A2T A;  3FVQ A;  4ZUJ A;  2F0G A;  1EY8 A;  1H9K A;  4IUU A;  4EVO A;  2B2U A;  3D4W A;  1OO9 B;  2XN9 C;  4OO1 I;  5EJW A;  1G2S A;  1F2M A;  2HCC A;  4XQN A;  4FVM A;  1PTO F;  1CA6 A;  2NN6 H;  1TWA B;  2A6E C;  3TN2 A;  3CU7 A;  2NBF A;  3HS0 C;  1VCI A;  2L1B A;  4CJ1 B;  3J81 L;  1DCZ A;  1SXT A;  3J7Y W;  2CW0 D;  1Q3L A;  2PZU A;  2KEC A;  3C1E A;  3BVG A;  2F1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...