1XTCD

Cholera toxin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPSSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCTWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
molecule tags Toxin
molecule keywords CHOLERA TOXIN
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xtcD00
2XN9C 1PRTB 1I4HA 1DJRD 1TS3A 1EU4A 3CHBD 1CK1A 1FGBD 3O13A 2Z8LA 1SE3A 3DWQA 4RGMA 1TS2A 3BZDB 1S5CD 5ELEA 1JWSD 2XNAC 1PTOC 1TS4A 1LTTD 1G8ZD 1PTOH 1BCPB 1LTID 1D5XC 1B1ZA 1SJHD 3BYTB 1L0YB 3GP7A 3R2IA 1LTGD 2RDGA 1TY0A 1ET9A 1S5FD 1LTRD 1PZJD 1FNUA 5ELFA 4DXGA 1I4GA 2NTSA 1PTOF 3EA6A 4RHSA 1KLGD 5FKAC 1STEA 1D5ZC 1HA5A 1MD2D 1EEID 2QEJC 2XRQD 1CT1D 4OHJA 1TS5A 1I4QA 1I4XA 3OWEB 1SE4A 1PRTD 1JWMD 1SXTA 3DWPA 1TY2A 1L0XB 4RH6A 1LT3D 3DWAA 1EFID 2QILA 2J4XA 4C56C 1V1PB 1B44D 1FNWA 3BVMA 1CQVA 1BCPF 1EEFD 2AQ2B 2IPKD 1KTKA 1LTBD 1SE2A 1LT5D 5I4DA 4RFBA 1BCPD 1HQRD 4Z9CB 1AW7A 3MC0B 1LT4D 5ELDA 1JCKB 1LT6D 1GOZA 2SEBD 1PZID 2WV6D 4DXFA 1V1OA 1T5XD 1FNVA 1PRTF 1LTAD 1PTOB 1RF2D 1EWCA 1SBBB 3V05A 1BCPC 4UDUC 2NTTA 1JR0D 1CHQD 1UNSA 5FK9C 1EU3A 1JWUD 4RGOS 4RHRA 5D3IB 1RCVD 1D5MC 4K6LA 1I4RA 4RGNA 1RD9D 1S5BD 5TSSA 3TSSA 1PRTC 1HTLD 1PTOD 4RCOA 1PYWD 1SEBD 3MFGA 1ENFA 2XRSD 2ICIA 1V1PA 1AN8A 1HXYD 1I4PA 1ESFA 2AQ3B 2AQ1B 3BYYB 3SEBA 1KLUD 1XXGA 4L6TB 2RDHA 3R2TA 1S5DD 1M4VA 4O1NA 4BWGB 4TSSA 1LLRD 4L63B 1FD7D 1F77A 1ET6A 1D6EC 1SJED 2O2LD 4RGTA 3EFXD 2TSSA 1PZKD 1CHPD 1UUPA 5ELCA 3R8BA 1S5ED 5ELBA 3BVGA 3URYA 1XTCD 1JQYD 3W2DA 1QILA 2G9HD 3KLSX 1LTSD 3BVZA 4ZYSA 1BXTA 1LO5D 1RDPD 2R61A 1DYQA 5D3DA 2IJ0A 2CHBD
chains in the Genus database with same CATH superfamily
2KHSA 5J3BA 1E0BA 1D1KA 2XN9C 4M8AA 3HOYH 4DV2L 1VQOA 1ILQA 2AHOB 2MO0A 3U58A 3WOEA 3NQIA 4A3CH 2R7DA 2EJFC 2K52A 1WTOA 4QF4A 1D5XC 1L0YB 3D8GA 4GKKL 3K5NA 2CWPA 1EYAA 2HDLA 3K7AB 4L5SA 1H9JA 2R93H 3W1GA 1D5ZC 3V2TA 3GTPH 3HEJA 2E2JB 2ZXPA 2LMCB 5KRUA 4OHJA 4A3JB 1KC8C 4A3BG 3TMEA 3T53B 4J15A 2R6GA 1SFOB 4TRDA 5CBAE 1ZYRD 3OTOQ 2OEOA 2J4XA 1XNRL 1TWFB 5EGTA 2A6EC 3SE0A 4LFCQ 1PXUA 1DONA 4IJLA 4DPGA 5ELOA 2RQXA 4NP5A 4QB4A 4YY3Q 2SEBD 3SK6A 3J80E 1OXVA 1YHBA 2F3IA 1N34L 3M4PA 1YJWA 5IYCG 5CV4A 2JXMB 3TS2A 3I90A 1TWGH 4DK6C 3CCJA 2WIIB 4HJ8A 5G3LD 1CA5A 4BY7H 4A3IG 4LF5Q 1E2ZA 2DUDA 2F0UA 1EYDA 3MVVA 2EYPA 3Q24A 5C5MA 4LF9L 3A7LA 4POGA 1QJOA 5BN5A 4RCOA 4A3MB 3MFGA 4A3KG 1ENFA 4BBSH 1SNMA 5A2QE 2CWAA 1SN8A 2CH4A 2F0OA 2WB1G 4F88A 1A8VA 3I4NH 4CJ0B 2K6AA 3CCVA 2G9DA 4KHPL 4GLXA 2BE5C 2I5LX 2EQSA 1F2LA 4HJ9A 1PA6A 2FINB 4PG3A 1KQSA 3EFXD 3CC7A 3ICEA 4FF3A 3SDZA 2CQOA 2K50A 2CW0C 4JI1Q 2UXCQ 2F03A 1TWCH 2Z4HA 4LUOA 4WFN3 2HHHL 4X62Q 3TEHB 4DNIA 1PFSA 1K8AC 1MGSA 4GS3A 3VYSA 2AWNA 3FP9A 4POFA 5KNDA 3LNNA 2WKCA 1Q82C 4IFDJ 4H02A 5KYLA 3M4YA 1NNXA 4PMBA 2EXDA 3I91A 5T1IA 3KBXA 4GOPA 2D0PA 2GVAA 1JWSD 2XNAC 2NUCA 2F0TA 3M4OB 1GUWA 1IKLA 2KUMA 4BY1H 1R9TB 4DV6L 4B3MQ 1MJCA 4DAPA 1F2YA 4JI6L 1GUTA 4K8IA 5C6AA 1M1KC 4UY8C 4PMCA 4BA2I 3U9SA 1EIYB 1ONLA 2GN5A 3Q8DA 1TS5A 1I4QA 1Y1VB 5IGGA 1XTDA 1S40A 3PIP3 3W3AA 1DXMA 2FFKB 2PQAB 2JA6G 2MQHA 4DR3Q 3GO5A 5J39A 1BDOA 3W1BA 4E6IA 1ML0D 2MNAA 2QGQA 1N8RC 2IL8A 4CJ1B 4N9TA 2RSNA 2WB1B 4JG2A 3PO2H 3S2HH 4K5WA 4K5VA 1X3FA 5KNBA 3ULLA 1F2ZA 4KV6A 2RBMA 2YV5A 3IFDA 3HOXH 1MJEA 2NVQH 2KENA 2HCCA 3K5LA 5IT9E 1LT6D 3WOFA 3GV6A 1A2TA 3VA5A 1AE2A 1HZ9A 1N32Q 1IL8A 3OMCA 3MAQA 1K3RA 3DHQA 2K05A 4R8IA 2KJXA 1Q12A 2B2VC 5LHY1 3P75A 1CHQD 3MEHA 4ULLA 5FJ8G 5LMUQ 2VUMG 1VQNA 5TSSA 5K5PA 2ZM6L 1LM0A 1XNQL 1PTOD 4LNQA 4DU9A 2V4DA 1A3TA 5AJ3Q 4R4OA 3JAMi 1S5DD 1CKMA 1L2FA 3H09A 4JBMA 3K5OA 4ZKCB 4L63B 5FO7B 1SRUA 1XWEA 4NXML 3S15H 4C3HH 4IUPA 3W2DA 4A3GH 4NW2A 1RDPD 5CYUA 2Q8RE 2K1BA 3H15A 3U50C 4R4IA 2HT1A 1JOKA 1Z9FA 2NN6G 5IGEA 2UXBL 4IJHA 2JA6H 4H13C 1CUKA 1STNA 2F0QA 1QWYA 2LFNA 4IURA 5GADC 3BYTB 3NHHA 2R7ZH 1ET9A 1HTPA 1S5FD 3OIPA 4GNXA 1E2WA 1X3GA 4NMZA 5E4XA 3ULJA 1EY7A 2BE5D 4DK1A 3F8TA 3NENA 3KF8A 1BVSA 1STEA 1YNNC 3TP7A 2PPBC 4BY1G 1VQ4A 2IWHA 5G3LF 5JVG3 4RKLA 4B9WA 1DZ1A 2E76C 3KYHC 1SE4A 2K04A 3T1YQ 2JA7H 4C3JG 2A19A 3BDCA 3S17B 3PCOB 3T1HQ 5CC4A 2KCCA 2I5MX 3SK5A 1FNWA 2OCEA 4R4CA 1Q7YC 1EY6A 3S2DH 2CCZA 4DV3L 4DV6Q 4B3ML 3K80C 3Q0AA 1WTPA 1QVFA 3RMHA 4IFDG 4EVOA 2MGSA 4PMWA 4YHHQ 5GQOA 5JJZA 5ISRA 1I94L 4FF2A 1GHJA 5M3FH 4N8FA 3Q23A 4AQYL 5JVH3 1SYBA 2F0HA 3E5SA 1JWUD 1HQMC 2Z6BA 4FO2A 1EIGA 4GLAC 2IT1A 3F2BA 4C2MH 3KJOA 1XPUA 4N9PA 3UI2A 2ZTCA 2WAQB 1P16A 2EJGC 3NXWA 4DR6L 3NWTA 5M5XH 4BWGB 1YIJA 4A3FG 3AMUA 3C1FA 4A3DH 3S16B 3DM1A 2DN8A 2O4XA 4JYAL 3K81C 5IGBA 4A3GG 4CKEA 4RGTA 2F0KA 5I9PA 3G71A 1UUPA 1S5ED 4AYBE 4KLKA 1A3UA 2EYLA 2XGTA 3HKSA 3OHXC 2CQAA 3A8KE 1PHJA 1ZYRC 4F87A 2VXWA 4XQJA 1Z6HA 1I4HA 3NUCA 1Y1WB 4L5TA 3DWQA 1TS2A 1EQVA 4JPBW 2ID0A 2JA5H 1KRSA 3P1HA 1YJ9A 5C4JB 1ASYA 4C2MB 1B50A 3R2IA 1TR5A 5M5YB 2YYZA 3DEPA 5KIXA 1A3VA 4OXPA 2NTSA 2K5QA 3M4QA 2BDOA 2UUAQ 5FKAC 3HKZB 3ITPA 1MD2D 3AFQA 3TP8A 5C0XG 4FF4A 1EIHA 3CCEA 5FOBB 1X54A 3N52A 3NTHA 2F0IA 4JI2Q 4H44C 4JI8L 5C3EG 1KNAA 1A2UA 1TY2A 1U4RA 1STGA 4B3SL 3J80c 4C56C 4DR7L 2FJ2A 4DN4M 2I46A 2VUMB 5CV7A 3J81E 4RFBA 1I6HH 1D7QA 2EDGA 1GD7A 3HOUG 3L2PA 1YNXA 1GOZA 2Z0SA 4GKJL 5DM73 5FO9B 2B2WA 4JI7Q 1KL9A 1PTOB 3J7ZC 1SBBB 4MIUA 1N33L 3J81c 1M8AA 2CKZB 4DUZQ 4J6HA 1K83B 4LJZC 4JI3L 1FVIA 2K33A 4PZ7A 4K6LA 3QOJA 5IYBH 4PZ8A 2G5DA 4LF8L 4WRDA 5DLQE 3V96A 3A74A 1GUNA 3QJYA 3CMAA 1JJ2A 2UUBQ 1QVCA 4LFCL 5C4XH 2N3SA 4ZUIA 2WB1E 4K8JA 1KLUD 1STBA 1L0WA 2Q2HA 1O7LA 4N8X1 1PH7A 4QIWE 1PMRA 3ER0A 4HIOA 1Z7TA 4UP9A 3J81j 2DY7A 5KNCA 4JW0A 4C3IG 5FLXc 1N34Q 1VQFA 2MFIA 2K5WA 3DUZA 3KFUA 1TWHH 2LY7A 4RG1A 3GTJB 1HHVA 2XSCA 1KABA 2B29A 5FLXE 1AZQA 4YWLA 1NMGA 4GNXB 2ZJRA 5C0XI 5HGTA 1GUSA 1EU4A 5M3MG 2E5LL 4CDCC 1IYJB 4FNFA 2YU9B 1E1OA 1LTTD 1G8ZD 1D8LA 1PFNA 2Y0SE 3MXUA 1CFMA 1HZAA 3H3VH 1YI2A 1B2TA 1G51A 4C1NK 1FYCA 1KIXA 3S1QH 4A3FH 3GTOH 3RZDB 2F0PA 1LTRD 4JI5L 1VMPA 2JA7B 3J80i 4JI1L 3TBIB 3S1QB 1IW7C 2MO1A 1BO0A 2BA1A 2PI2E 4P71A 2UU9L 2ZTEA 3UDFA 3J7YW 2RKSA 2YU9H 2A1AA 2IHFA 4HMIA 4KD3A 1GKHA 1B4OA 4YWMA 2A6HC 3PO2B 3DM3A 1VQIA 4C3HG 2JSOA 4TVAB 1EFID 1PH1A 1C7YA 3OMGA 3QB3A 2R7ZG 1GUOA 1IKMA 1BCPF 1OO9B 3M3YH 4K2KA 3M7GA 3PIO3 3S9WA 1BQQT 2OF1A 4Z9CB 3H0GG 4A3MH 3GTKB 3S1RB 3VA7A 3K57A 1PH4A 1UWVA 5CV6A 2JK8A 3A55A 1HPCA 1UEBA 5FLMG 4KJNA 1VQGA 4JI0Q 2GA4B 3T56B 5FK9C 1SMXA 3U4VA 2IX0A 3CC2A 3GTKH 5M5WB 3ERSX 4JI8Q 4JI2L 2KCTA 3OSOA 4C1NI 5GAHC 5M3MB 3C1EA 1D1IA 3HOZH 5IWAQ 3QWNA 1QOHA 4DR7Q 2AQ1B 1R9TH 1Q86C 1YBYA 5JEAJ 2VL6A 4L6TB 4B08A 4UP7A 5LL6X 5C3EH 1XMQQ 2E2IH 4XIGS 3T13A 4BBRH 1Q1EA 1N32L 4FVMA 2WACA 3TZDA 1HH2P 4A93G 4IZ8A 3GTQB 1K73C 1VQBA 4MNOA 1ZKOA 2E8GA 2R92G 5C44G 3BVZA 2NN6H 5BN3A 1LO5D 4JCVE 2C5CA 2B63G 4R9WA 3E0JA 4B3TQ 1G2SA 1VQ7A 2JQOA 1TWCB 3CCQA 3RLNA 5FO8B 3PIOA 1R4QB 1DOKA 3O13A 5I6WA 5IP9G 1EOVA 1PTOC 1TS4A 2J0TD 3J7AF 1LTID 3AU7A 2OT2A 1FJGQ 2JA8B 2HD3A 1TY0A 1WTQA 1PZJD 3I4MH 1OXXK 4KKSA 2FHTA 3D4WA 1O7YA 1SNOA 3A5ZB 4DNTB 3C46A 1HNWL 2CH4W 3S2HB 1NMFA 4KMUC 1I6VC 3HOWH 2J7ZA 2RHQB 1IYVA 1J5EL 2WINB 1EOTA 1PH9A 3KBGA 1X6OA 2PMZB 3AYHB 5EKIA 4KD4A 1MI2A 4GZYC 2B2WC 5IGDA 4DV5Q 4K0KQ 3STBC 5DAUA 3I72A 4FXKC 2FMMA 4JI4Q 4QY7A 2OWOA 3RN2A 1JJCB 1LT5D 3IKJA 2ICEC 4JI5Q 3X3MA 2JJQA 2OXPA 2MHVA 4Y52H 5JJKA 4CDDC 1X3EA 1EYCA 1Z47A 1VS0A 2HQEA 3HKZG 1UNSA 3BU2A 5D14A 2B2TC 3TRZA 3PUWA 1JB7A 4A75A 1S5BD 1T9HA 3CU7A 3LGJA 3F2UA 2NB0A 1S4ZA 2QKIC 1JB3A 1EWHA 3KUPA 4WJ4A 1GJXA 1EY9A 1KRTA 1AZPA 3GDEA 2ASBA 5NUCA 1K3BC 5JJLA 3ZYYX 4DK0A 2D62A 2E2HH 1CHPD 4H7BA 2VS1A 4XT3B 1VQKA 2Z4IA 4JI6Q 4AQYQ 2L5TA 5H1SE 2WFWA 2VW9A 4YCWA 4CDEC 1STAA 1DJRD 4QUFA 5IWAL 1ZXTA 4O0AA 3K0YA 2F0DA 3IFTA 3KDFB 5IP7G 2F0MA 4DK3C 2QDLA 2DJGC 4A76A 1IBMQ 4APVA 3EROA 1WI5A 2E75C 1PDQA 1Q90A 2EZVA 4A3CG 2JA8H 1H9RA 2R7ZB 1G6ZA 4BY1B 4TKOB 1J8IA 1IZ6A 4L8JA 3AQQA 5EKLA 3IRBA 2K4KA 4A4IA 1ILPA 4CBVA 2B63H 3E0EA 1E1TA 3G7LA 3MXGA 1O7IA 5M5XB 4XDXA 5J1ZA 2R92H 3VR3A 3HGBA 1II3A 1HZCA 2ZM6Q 1VQJA 4LUZA 1I6HB 2QILA 4LF4Q 4XT1B 5IYCH 3GTPB 1B44D 1FJGL 2JE6I 1KTKA 2Q2IA 3DMUA 2UUCL 1SYEA 4IPDA 2F0LA 4ZAIA 3RZOH 1IBLL 4DXFA 1U0LA 3NBHA 3T4AC 2Q8IB 3I55A 1VF7A 2A69C 1CA6A 4NXMQ 1C0AA 4HR7B 5IODA 4HJ7A 4K5XA 4A93H 2Y0SG 2WKDA 2VNUD 1CSPA 4HIMA 4DGZA 4DR2Q 2NZOA 4F7XA 1RCVD 1I4RA 2UXDQ 4NDXA 3CRKC 2F0WA 2R3ZA 1N9WA 1JICA 3RNUA 1C9OA 1X3QA 5EQ0A 3PO2G 4KK7A 1MIUA 1GUGA 1YZ6A 1I4PA 3BYYB 1VQ6A 1O80A 4IUQA 2B2VA 5HGQA 2OQKA 3NTIA 2F1MA 2I07B 1V43A 1LLRD 2D9UA 3GTMH 4GKJQ 4HIDA 2A8VA 1U4MA 1F77A 3VYRA 1YHAA 4DV4L 1SAPA 2L11A 3HOVB 2PQEA 4DUZL 3J80L 4G7ZC 2PZUA 1VQLA 2IHEA 3NBHB 5E1FA 1WTWA 5J22A 1CM9A 4LF8Q 1AH9A 1PRTB 4IN3A 4V190 1UE5A 4M1UB 1QUQA 5CV9A 2H5XA 2EPBA 1TWGB 1EY5A 1VQAA 3UE1A 4EGVA 1YNJD 5KYIA 5IP7H 3IAYA 2VQFQ 3H0GH 4A3MG 1XNRQ 4X66L 1B1ZA 2H1EA 2K01A 3J81i 1E22A 5CMDA 4YY3L 1L1OA 4IUVA 3M4OH 4JC0A 3M85A 2L4NA 3K7AH 1KLGD 2PW7A 1X55A 2BDNA 5LL6S 1TIID 2QEJC 1CT1D 2EY6A 4XQQA 4KY5A 1I4XA 3FDTA 3JAML 4MTKA 5BN4A 2E2JH 1PRTD 2DNCA 2E5LQ 5C3XA 2N8NA 5CV5A 1XMOL 4KJOA 4HSPA 2CVRA 3QOLA 3S2DB 2EYHA 2R93B 5CBEE 3OOCA 4A3KH 2IPKD 3PF5A 2N78A 3MC0B 1X56A 3AB9A 2PNHA 4CHTB 2KEDA 3SGIA 4KHPQ 4DUYQ 2WV6D 1W6JA 1T5XD 2UU9Q 3H91A 3NWSA 1CTMA 1WFQA 3H94A 1V1QA 3I4NB 3K58A 2UXCL 4HTHA 1KAWA 1CZWA 4LFAQ 3WWVA 1CSQA 4IPCA 3HOXB 4RHRA 2NVQB 4Y7NH 2F4VL 1K0SA 2GVBA 4RGNA 3UE0A 4IUNA 3M3YB 4A3EH 5IP9H 1HFNA 1VF5C 3NBIA 1PYWD 4OO1G 1VQDA 5CORA 2K28A 2AQ3B 3ONAB 3SEBA 2BCOA 3HP3A 2NVXH 2UUCQ 1GO3E 1EIFA 4S3SA 4O1NA 1R4PB 4HN7A 2AWOA 4I65A 4BA1I 1Y1WG 1WD0A 5C3WA 3L9AX 3D4DA 1F9PA 4GOPC 1IBKL 5EPJA 2TSSA 4JI0L 3URYA 2A69D 2A68D 2K5HA 4OWWB 5IGCA 3Q6SA 5IYBG 3OYYA 4G7OC 1MHWC 4DR2L 5D3DA 1HR0W 1W3SA 2Q2UA 1QB5D 3OW2A 4DV1L 1RJTA 1NJIC 1M90C 2O5JC 4IOAA 1Y8OB 2I0QA 2E2IB 2Z8LA 1QVGA 2MUYA 3BZDB 1SROA 3VYUA 2B2UC 2KVMA 4NPSA 5A35A 1UEAB 1ICWA 4IUUA 1IXRA 2DY8A 3GV3A 3C2PA 3HOZB 3TREA 3E9IA 3RR5A 4KHVA 2KQ3A 5ELFA 3RZOB 1FNUA 5EAYA 3A54A 3KK7A 5I9OA 5M5WH 1TWHB 4FP5D 4R1JA 1BUVT 2F4IA 1U5KA 1KD1C 3GTLB 4RWSC 2JA5B 3NELA 1HA5A 1A62A 1EEID 2K5NA 3NEMA 1J6QA 1Y1VG 4BXXH 1ENCA 5ELNA 4XTCS 3VR4A 2CFMA 1MKHA 3CCRA 4UHVA 5LMNQ 1Q8IA 1JWMD 1A15A 1I3QH 3DXJC 4YWKA 3X3NA 5IT9c 3CW2C 2WAQE 2UUBL 5K36H 1W2BA 3KOJA 3K5MA 3CCLA 5KEEA 1AW7A 2RCFA 3HOYG 1HZBA 1K28A 1HNWQ 3OIQA 2ATWA 4QGUA 1RF2D 4A3LG 4IFDI 1BCPC 2H4OA 3TN2A 3W5OA 1F9SA 3F2CA 4O42A 5C4HA 3GQBA 4KTAA 3QG1A 2F0JA 5D3IB 2VY3A 4A3DG 2KBNA 2EIFA 1PYBA 5I2XA 2N55A 3PUYA 1WCMH 3GTOB 5E3FA 1DD2A 4K0KL 4LF6Q 1JE5A 3VR6A 2UXBQ 3R2TA 2VQEQ 1M4VA 1K9MC 4DR5Q 1QZHA 2OTLA 2EY2A 2PW5A 4YCUA 5C44B 5ELBA 2F3VA 3MEFA 3HKZE 1U9RA 4DR1Q 2KOLA 4UPAA 1OXSC 2V1CC 4HIKA 3DEOA 4BBRB 3MHBA 2E74C 1TS3A 4HAEA 5BR8L 1Y8PB 3GTQH 1FR3A 3T1YL 1SMYC 4KN7C 2NBFA 3AEVA 3AFPA 2EOTA 1JMCA 1LYLA 3E6ZX 3K6OA 3PUZA 1WVLA 2HCIA 3S1NB 1AP0A 3GP7A 3I2ZA 3NSWA 3HOYB 1GM5A 1QE6A 4DV3Q 4HJAA 1BNZA 3H3VC 4ZQ3A 2K5DA 5JOBA 1PTOF 1QUQB 3H0GB 2K14A 4RMFA 2M00A 2KHIA 3FVQA 1BBWA 4DV1Q 4MN3A 4GN4B 4X3UA 3P20A 4DKAC 1VDZA 1TU2B 1VMCA 2OTJA 2KEEA 1AFPA 1EQTA 1L1OC 2LXKA 3KF8B 3S14B 2PZTA 3FKIB 5JPMC 2QCPX 4QMGA 3BVMA 3ND8A 4H0LC 3HRZC 4GKKQ 4A3GB 4JBWA 2B2TA 1Y69U 3GTGH 1RODA 1XMQL 2CW0D 4JYAQ 5K36G 1V1OA 1Y14B 2ZJPA 1K83H 2B8GA 3V05A 4LW1A 1JR0D 3NTKA 3RLFA 1HNZL 4FXDA 4HEDA 3DLLA 3TSSA 4A3IB 2B2YA 4R8NA 1N36L 1DOLA 3CPFA 1WTXA 3S17H 2XRSD 4P73A 1V1PA 1E3PA 5IY0A 4FDBA 2K32A 2B63B 2XWBB 4Q0FA 3KLRA 3BJUA 1EQRA 1VQHA 3ZJYC 1TWAH 1ENAA 4PQXA 2RF4A 1IBLQ 4PV1C 3NK9A 2KCNA 3RUZA 1NBWA 1YEZA 3G6JB 5HURA 3TS0A 3RD4A 5ELCA 1DM0B 1EY8A 2F0GA 1QZGA 1KAAA 2KECA 4CDFC 1BXTA 4LF5L 3FPPA 3S14H 3D6CA 1KNEA 2F0EA 2ES2A 2B2YC 3HOXG 4B3RQ 1QNKA 2A68C 3D4RA 3GTJH 1J5EQ 1Q46A 3FPUB 1Q1BA 3F2DA 3VDYA 1CK1A 2PI2A 4Q5VA 1HCZA 5C4JH 2JA5G 3NE5B 4RGMA 4XYQA 3FKIG 2QF7A 1S5CD 1HRJA 4OIJA 3K59A 4OGQC 1BCPB 2HUGA 4GNXC 1Y1WH 3I4MB 5F2DA 4DV7L 1LTGD 1CI3M 2HIXA 3G6EA 3TQYA 4MHEA 2EYOA 4DV4Q 2RCNA 1LUZA 2HDMA 4V0BA 1CQFA 3VR5A 1OXUA 4DR1L 2NVTB 1PLFA 1G291 2QEXA 2NVYB 1A63A 4X64Q 3KJPA 4HSVA 1HUNA 1Q8KA 4QCLA 3A0JA 3QIAA 1VQ5A 1UE7A 4J1MA 2I5HA 3FHWA 4GOPB 3RZDH 1NE3A 2EY5A 2VQFL 5FLMH 2A5HA 2JEBI 4WJWA 4C3IH 1CQVA 1EEFD 2AQ2B 2MJ8A 1EFWA 3JAME 5I4DA 1BCPD 2MP1A 3I73A 1TXYA 2Q2TA 1I50H 2RSOA 1EUJA 3MZ5A 1V8QA 1G91A 1HFGA 1PRTF 3FEWX 1HR0L 1GVPA 1LTAD 4LFBQ 1S3OA 4JBJA 3FMCA 4JOIC 4DF7A 5M3MH 4X3KA 1YJNA 3PF4A 5CV8A 1VQPA 4DR3L 2HIVA 1NCVA 3EIVA 3J7A5 1BOSA 1CKNA 2JYOA 2JEAI 1TVXA 4OWXB 1LTLA 4GLVB 4L5QA 3G48A 1SYCA 3TZUA 3PGZA 1VQMA 1IBML 1B3QA 2SNSA 2ZTDA 3PUVA 4DUYL 2EYMA 3TP5A 2D0OA 2F0SA 1D6EC 4BBSG 3R8BA 3BVGA 1DOMA 1PH2A 1HNXQ 4LFAL 1HNZQ 5GAEC 4ZYSA 3S1RH 1SLJA 2R61A 2IJ0A 2F4VQ 3I4OA 5C0XH 3CC4A 1SSOA 2PMZE 1CKOA 3WDNA 3HS0C 2Z6KA 4CGYB 1SE3A 5AJ3L 1AE3A 2Z9HA 3KLSA 4ABNA 4JK1C 1K8MA 1PTOH 4L5RC 3H3VI 1TT2A 1SDFA 1IBKQ 2D2CC 4IO9A 1SE8A 1OTCA 1RKNA 1QNUA 5C0XJ 4LUVA 3OWFA 4ZUJA 4A93B 4P72A 3A56A 4B3RL 2N88A 1NAPA 3A8JE 5CGKA 4NB3A 5EJWA 2DJFC 4O2DA 3OWEB 2WP8J 2UXDL 2ZT9C 5EPLA 2IX3A 1A0IA 1F2MA 1LT3D 2QW7A 2EJMA 3DWAA 4AYBG 5IIFA 2AMCB 3R3OA 2B8FA 2O5IC 3QO2A 1C48A 5FLXL 4CKCA 5ELDA 2XVSA 5FJ8H 4OONA 4A3JG 3UDXA 3ULPA 4IUTA 2L0CA 5COYA 1XPRA 2JA8G 3LWUA 1O7ZA 5C4ZA 4P74A 4RAUC 4HCSA 1MBYA 2FXQA 2AUKA 1S72A 3MXPA 2VB3X 3QR8A 1VQ8A 3EN2A 4OIKA 3PMFA 5C4XB 4ME3A 3S24A 4U673 1PRTC 3HOVG 4WJ3M 2LXJA 4Y7NB 3OTOL 2Z1CA 4ODGA 2ICIA 1STHA 1HXYD 5JEAG 4DNRB 2EXZA 3I3CA 4C3JB 2ZXOA 3PO3H 1ASZA 4XQNA 4X66Q 3UDGA 4DR4Q 2R7FA 1FD7D 1ICFB 2HQLA 4DFAA 1SJED 4K2LA 5AFWA 1MSHA 5GAGC 1PZKD 2RHSB 4KKTA 4YHHL 1CZGA 2PNRC 1H9SB 1QILA 1EZ8A 2NN6I 1L1OB 1XX8A 4K6DA 4J8QA 3OPOA 5M3FG 1DGSA 1RHPA 4G4KA 2M9VA 1NR4A 1X9NA 1I5FA 3A7AB 5IOCA 4KHZA 4DV5L 1J9OA 3CKIB 1TWAB 4ZRZA 3EBEA 4A3IH 4DR5L 1U4PA 2F0VA 1EQQA 2X69A 3CQZB 2ALYB 4I7AA 2KA7A 3I56A 3NP8A 3FKIH 3SVMA 5JPNC 1I4GA 4KY6A 1K8OA 4U68A 4A3FB 5DEHA 1BBUA 2HHHQ 4QQBX 2NVYH 4KI0A 3MFYA 1PH3A 3PO3G 2WAQG 2ENBA 4ALPA 1WD1A 5C4XG 1WOCA 1SXTA 3DWPA 4LAAA 3M9BA 4YCVA 5JEAH 4ZCKA 1G6PA 4DA2A 3HZXA 4DAYB 3SK8A 1HQRD 2NYZD 4JV5L 3RN5A 4LMQD 1PZID 4G57A 2M2LA 1NTGA 2UUAL 4EQPA 4X65L 1NUCA 1FNVA 4OEMB 3CCSA 2IY5B 3I8ZA 2NTTA 4A3DB 1B9NA 2VUMH 1QG7A 4DAVA 1UE6A 2NZ1D 3B6YA 3C3LA 2EYFA 3S1NH 2OQ0A 4YIJA 4DV2Q 1SEBD 2RA4A 5C44H 2N49A 2B3GA 3STBD 1X32A 2SNMA 4BXXG 3T51B 3D0FA 3S15B 4DAMA 1H95A 4P75A 3MA2B 4A3BH 3ERQA 2O2LD 2SDFA 2JN4A 2XIWA 5HY6A 4C3IB 1PVOA 3LWEA 1KDAA 1C4QA 1GXDC 1XTCD 1JQYD 3IL8A 3E3XA 3HOUB 3EQLC 3TDQA 4OL7A 5M5YH 4HJ5A 3GTLH 3SK4A 4ZLTF 1B8AA 2PZWA 2RDFA 1TKWB 4BBRG 3S1MB 3BG3A 2CHBD 4QIWB 5LMUL 1U4LA 3OW7A 1K0RA 3HOUH 5EBDA 4IOCA 1JORA 1XNQQ 3K8AA 1SR3A 2A74C 5EPKA 3CHBD 3KDFA 5LMNL 3ND9A 4EQNA 1IYUA 2BOSA 1BBXC 2EYJA 1RTOA 5ELEA 1SYDA 4A3EG 4LF4L 1XYIA 1VQ9A 3U9OA 3PIPA 4DV0Q 2XWJB 1X65A 4AH6A 1YNND 4BY7B 3L3OC 1B53A 2Y0SB 1JOQA 5JJIA 2PCFB 4AYBB 4RHSA 3VR2A 4LF7Q 2X6GA 2QDBA 3I7FA 5DM63 4R4TA 3HFZB 5T1GA 4EQOA 5I6YA 1EY4A 1A6XA 3J7AV 3MXNA 1VQEA 3JAMc 4LF9Q 4OX9L 4EX5A 1AEXA 3N6RA 3KLWA 3VYTA 3BS1A 5GROA 3CD6A 4LF6L 4C3HB 1V9PA 4IPGA 1Q3LA 2YTXA 1T5EA 4OO1H 1SE2A 4R4QA 1LACA 1NY4A 2VQEL 4AIMA 5CR3A 1H9MA 1ZEQX 1UAPA 4X3SA 4FXGC 2RVLA 1SYFA 5KGUA 2IX1A 2L55A 3PUXA 4CJ2C 4G7HC 2AKWB 3I4LA 1FL0A 1PH8A 4X64L 2B39A 1EL0A 1KXLA 3BDLA 3SR1A 2LKVA 5IYDG 1JT8A 4GN3B 1H9SA 3G4SA 4ID6A 1HTLD 1VQCA 2DGYA 1XJVA 5I2YA 1AN8A 1YVCA 3MXNB 3Q22A 1P8LA 1SYGA 4BS9A 3PSIA 1STYA 4JOIA 4XXEA 3CCMA 2RDHA 5M3FB 3E9HA 4LK1C 2ZJQA 2JA7G 4ME5A 2NVTH 1LV9A 3I70A 4TSSA 2NVXB 3PV0A 1HA6A 1ET6A 4X65Q 4LFBL 2JP1A 3A8IE 1WTRA 2KHJA 4HMJA 2G9HD 1RL2A 5IYDH 2A73B 3BDOA 4IFDH 1WCMG 1VCIA 3HOVH 2P5ZX 2BH8A 1HJPA 1B7YB 5M9OA 2A6ED 2B2UA 4LWCA 1RTNA 2VZAA 1JE4A 3H6MA 3HOWB 3P7JA 1XMOQ 4OO1I 3I4MG 4C3JH 3PO3B 1OXTA 1SJHD 3KF6A 3M7NA 3EVQA 2RDGA 3PQIA 2BA0A 3I4NG 1EZ6A 4TQUS 2NZHA 1F9QA 5EKKA 1SFOH 4UAIA 1HNXL 3MTSA 3RLOA 1EWIA 2L12A 4NXNL 1NSNS 3EA6A 1FGUA 4KKUA 5JAVA 4ZKBB 5E4WC 4K14A 1E24A 3D6WA 3SXHA 4B3TL 3EJIA 3HG9A 2XRQD 5IT9L 1LABA 4XYOA 4F8MA 1O78A 2IW3A 1KDBA 3T16A 2QA4A 3CAMA 4A3KB 1N36Q 2R93G 4QJFA 2X6LA 3S1MH 1IL2A 1V1PB 1YNJC 4DV0L 1F9RA 1B9MA 1PFBA 1LTBD 4MTNA 2TMPA 3LX0A 1B70B 2L9HA 1JCKB 2K7VA 2R92B 3KF6B 2PO4A 5IGFA 4A3BB 1IHZA 4LF7L 2EE1A 3HOZG 5C3EB 4UDUC 3A5UA 2VB2X 4RKBA 5C5LA 1WCMB 2L1BA 1HUMA 1MSGA 4PNYA 4QUCA 4ZK9B 4OX9Q 4X3TA 1PFMA 1PH5A 3JC66 4B3SQ 4DAYA 2A6HD 3CXCA 1QCBD 3L7ZC 1YITA 1EYGA 1JC7A 3CP0A 4JI4L 1XXGA 3K7UC 2Q8TA 4DV7Q 4QL5A 4NKLA 1WTVA 5D65A 2E2DC 4JI7L 1BKBA 4FF1A 1N33Q 2F3WA 1TWFH 4A3EB 1SMYD 4KY7A 3MWYW 3F1ZA 1LTSD 4JI3Q 1CKNB 4CKBA 1DYQA 1GHKA 4JBKA 2F52A 3GTMB 1SNPA 1SNDA 3CCUA 2JA6B 2EY1A 1FGBD 3BZKA 3S16H 1WJJA 5A2QL 1RIPA 1XPOA 1PV4A 2K03A 3L0OA 2LSSA 2K5VA 4IALA 3SHLA 3T1HL 3UDIA 4I7ZC 4FYDA 1IW7D 4DR4L 2LS01 2EVBA 1TQOA 4HCEA 3NQTA 4DXGA 4OELB 3GD7A 4WORA 1K8GA 4RA8A 1HR0Q 5L37A 2NWGA 5IE8A 1I94Q 2BH2A 1DCZA 2PQAA 3TP6A 4B9XA 1UE1A 2DNEA 4OWTB 4IQZA 1PYSB 1Q81C 1EY0A 1E7ZA 1I50B 3U4ZA 4RCNA 1L0XB 4RH6A 3CF5A 2FMCA 4P2CB 2PYKA 2AUJD 4DR6Q 2ZXRA 3D31A 2JA9A 1LT4D 2C9OA 2SOBA 1NR2A 1D2BA 1SNQA 4A3LH 3FRPB 1Y8NB 4BY7G 4ILWA 1SNCA 4NXNQ 4EQ5A 2L15A 4UP8A 1WTHA 3CMEA 2YTVA 5DNFA 1EWCA 4JVZA 1JOOA 5EBCA 1PH6A 4KN4C 1EU3A 5LMNW 3NPPA 4MZ9A 4RGOS 4X62L 3GTGB 2YTYA 1D5MC 3K0XA 4GN5A 3BZCA 4BBSB 1KDCA 1WYDA 1RD9D 1I3QB 1JJGA 1BF4A 3CRLC 1C8CA 5BR8Q 2K75A 5E7NA 1B3AA 1ESFA 2Z6KC 4A3JH 3D3RA 4X6AH 2D5DA 3R93A 4JV5Q 1H9KA 1Y1VH 2F0NA 1BR9A 2C35B 4IPHA 1E2VA 2F0FA 1YHQA 1X3PA 1W6KA 3HOWG 1G2TA 4PZ6A 3CPWA 3KLSX 2XTIA 2E2HB 2MPMA 3CQZH 1KHIA 2KCMA 3J81L 1ESRA
chains in the Genus database with same CATH topology
2KHSA 1E0BA 1D1KA 2XN9C 4M8AA 1ILQA 3WOEA 3NQIA 2EJFC 1WTOA 4QF4A 1D5XC 1L0YB 3D8GA 3K5NA 1EYAA 2HDLA 3K7AB 1H9JA 1D5ZC 3V2TA 3HEJA 2E2JB 2ZXPA 2LMCB 5KRUA 4OHJA 4A3JB 3TMEA 3T53B 2R6GA 1SFOB 4TRDA 5CBAE 1ZYRD 2OEOA 2J4XA 1TWFB 5EGTA 2A6EC 3SE0A 1PXUA 1DONA 2RQXA 4NP5A 4QB4A 2SEBD 3SK6A 3J80E 1OXVA 5CV4A 2JXMB 3I90A 2WIIB 5G3LD 1CA5A 1E2ZA 2F0UA 1EYDA 3MVVA 2EYPA 3Q24A 5C5MA 3A7LA 1QJOA 5BN5A 4RCOA 4A3MB 3MFGA 1ENFA 1SNMA 5A2QE 2F0OA 4F88A 4CJ0B 2K6AA 2G9DA 2BE5C 1F2LA 2FINB 3EFXD 4FF3A 3SDZA 2CW0C 2F03A 2Z4HA 4WFN3 1MGSA 3VYSA 2AWNA 5KNDA 3LNNA 2WKCA 4IFDJ 5KYLA 3M4YA 4PMBA 3I91A 5T1IA 3KBXA 1JWSD 2XNAC 2NUCA 2F0TA 3M4OB 1GUWA 1IKLA 2KUMA 1R9TB 4DAPA 1F2YA 1GUTA 4K8IA 5C6AA 4PMCA 4BA2I 3U9SA 1ONLA 1TS5A 1I4QA 1Y1VB 5IGGA 3PIP3 3W3AA 1DXMA 2FFKB 3GO5A 5J39A 1BDOA 4E6IA 1ML0D 2IL8A 4CJ1B 4N9TA 2RSNA 2WB1B 4K5WA 4K5VA 5KNBA 1F2ZA 4KV6A 2RBMA 3IFDA 3K5LA 2HCCA 5IT9E 1LT6D 3WOFA 3GV6A 1A2TA 3VA5A 1IL8A 3OMCA 3MAQA 3DHQA 2K05A 4R8IA 2KJXA 1Q12A 2B2VC 5LHY1 3P75A 1CHQD 3MEHA 4ULLA 5TSSA 5K5PA 1PTOD 4DU9A 2V4DA 1A3TA 1S5DD 3H09A 3K5OA 4ZKCB 4L63B 5FO7B 1XWEA 4IUPA 3W2DA 4NW2A 1RDPD 5CYUA 2Q8RE 2K1BA 1JOKA 2NN6G 5IGEA 4H13C 1STNA 2F0QA 1QWYA 2LFNA 4IURA 3BYTB 3NHHA 1ET9A 1HTPA 1S5FD 3OIPA 1E2WA 5E4XA 4NMZA 1EY7A 2BE5D 4DK1A 3KF8A 1STEA 1YNNC 3TP7A 2PPBC 2IWHA 5G3LF 5JVG3 4RKLA 4B9WA 1DZ1A 2E76C 1SE4A 2K04A 4C3JG 3BDCA 3S17B 5CC4A 2KCCA 3SK5A 1FNWA 1EY6A 3Q0AA 1WTPA 3RMHA 4IFDG 4EVOA 2MGSA 4PMWA 5JJZA 5ISRA 4FF2A 1GHJA 3Q23A 5JVH3 1SYBA 2F0HA 3E5SA 1JWUD 1HQMC 4FO2A 1EIGA 2IT1A 4N9PA 3UI2A 2WAQB 2EJGC 3NXWA 3NWTA 4BWGB 3AMUA 3C1FA 3S16B 3DM1A 2DN8A 2O4XA 5IGBA 4CKEA 4RGTA 2F0KA 5I9PA 1UUPA 1S5ED 1A3UA 2EYLA 3OHXC 2CQAA 3A8KE 1ZYRC 4F87A 2VXWA 4XQJA 1Z6HA 1I4HA 3NUCA 1Y1WB 3DWQA 1TS2A 1EQVA 2ID0A 3P1HA 5C4JB 4C2MB 1B50A 3R2IA 1TR5A 5M5YB 2YYZA 3DEPA 5KIXA 1A3VA 2NTSA 2K5QA 2BDOA 5FKAC 3HKZB 3ITPA 1MD2D 3TP8A 5C0XG 4FF4A 1EIHA 5FOBB 3N52A 3NTHA 2F0IA 4H44C 1KNAA 1A2UA 1TY2A 1U4RA 1STGA 4C56C 2FJ2A 4DN4M 2I46A 2VUMB 5CV7A 3J81E 4RFBA 2EDGA 1GOZA 5DM73 5FO9B 2B2WA 1PTOB 1SBBB 4MIUA 1M8AA 4J6HA 1K83B 4LJZC 2K33A 3QOJA 4K6LA 4WRDA 3V96A 3QJYA 1GUNA 4ZUIA 4K8JA 1KLUD 1STBA 1O7LA 1PMRA 1Z7TA 2DY7A 5KNCA 4C3IG 3DUZA 2K5WA 2LY7A 1HHVA 3GTJB 2XSCA 1KABA 5FLXE 1AZQA 5C0XI 5HGTA 1GUSA 1EU4A 4FNFA 2YU9B 1LTTD 1G8ZD 1PFNA 3MXUA 1CFMA 1B2TA 4C1NK 1FYCA 3RZDB 2F0PA 1LTRD 1VMPA 2JA7B 3TBIB 3S1QB 1IW7C 1BO0A 2BA1A 3J7YW 2RKSA 4HMIA 4KD3A 1B4OA 2A6HC 3PO2B 4C3HG 2JSOA 1EFID 3OMGA 3QB3A 1GUOA 1IKMA 1BCPF 1OO9B 4K2KA 3M7GA 3PIO3 3S9WA 1BQQT 2OF1A 4Z9CB 3GTKB 3S1RB 3VA7A 3K57A 5CV6A 3A55A 1HPCA 4KJNA 2GA4B 3T56B 5FK9C 2IX0A 5M5WB 3OSOA 4C1NI 5M3MB 3C1EA 1D1IA 3QWNA 1QOHA 2AQ1B 5JEAJ 4L6TB 4B08A 5LL6X 4XIGS 3T13A 1Q1EA 4FVMA 2WACA 3TZDA 4IZ8A 3GTQB 1ZKOA 3BVZA 2NN6H 5BN3A 1LO5D 2C5CA 4R9WA 3E0JA 1G2SA 1TWCB 5FO8B 1R4QB 1DOKA 3O13A 5I6WA 1PTOC 1TS4A 2J0TD 3J7AF 1LTID 3AU7A 2OT2A 2JA8B 1TY0A 1WTQA 1PZJD 1OXXK 4KKSA 2FHTA 3D4WA 1O7YA 1SNOA 4DNTB 3C46A 3S2HB 4KMUC 1I6VC 2J7ZA 1IYVA 2WINB 1EOTA 3KBGA 2PMZB 5EKIA 4KD4A 1MI2A 4GZYC 2B2WC 5IGDA 5DAUA 3I72A 4FXKC 2FMMA 1ESRA 1LT5D 3IKJA 2ICEC 3X3MA 2OXPA 2MHVA 1EYCA 1Z47A 2HQEA 1UNSA 5D14A 2B2TC 3PUWA 1S5BD 3CU7A 3F2UA 2NB0A 1S4ZA 2QKIC 1JB3A 1EWHA 3KUPA 1GJXA 1EY9A 1AZPA 5NUCA 3ZYYX 4DK0A 2D62A 1CHPD 4H7BA 4XT3B 2Z4IA 2L5TA 1STAA 1DJRD 4QUFA 1ZXTA 3K0YA 2F0DA 3IFTA 2F0MA 3EROA 2E75C 1PDQA 1Q90A 2EZVA 1H9RA 2R7ZB 1G6ZA 4BY1B 4TKOB 1J8IA 4L8JA 5EKLA 1ILPA 4CBVA 3G7LA 3MXGA 5M5XB 4XDXA 5J1ZA 3VR3A 3HGBA 1II3A 1I6HB 2QILA 4XT1B 3GTPB 1B44D 2JE6I 1KTKA 3DMUA 1SYEA 2F0LA 4ZAIA 4DXFA 3NBHA 3T4AC 2Q8IB 1VF7A 2A69C 1CA6A 4HR7B 5IODA 4K5XA 2WKDA 2VNUD 4DGZA 4F7XA 1RCVD 1I4RA 4NDXA 3CRKC 2F0WA 2R3ZA 1JICA 1X3QA 5EQ0A 4KK7A 1GUGA 1I4PA 3BYYB 1O80A 4IUQA 2B2VA 3NTIA 2F1MA 2I07B 1V43A 1LLRD 2D9UA 1U4MA 1F77A 3VYRA 1SAPA 2L11A 3HOVB 2PQEA 4G7ZC 3J80L 2PZUA 5E1FA 1WTWA 5J22A 1CM9A 1PRTB 4IN3A 4V190 4M1UB 5CV9A 2EPBA 1TWGB 1EY5A 4EGVA 1YNJD 5KYIA 3IAYA 1B1ZA 2H1EA 2K01A 5CMDA 4IUVA 3M85A 2L4NA 1KLGD 2PW7A 2BDNA 5LL6S 1TIID 2QEJC 1CT1D 2EY6A 4XQQA 4KY5A 1I4XA 3FDTA 3JAML 5BN4A 1PRTD 2DNCA 5C3XA 5CV5A 4KJOA 4HSPA 2CVRA 3QOLA 3S2DB 2EYHA 2R93B 5CBEE 3OOCA 2IPKD 3MC0B 3AB9A 4CHTB 2KEDA 2WV6D 1W6JA 1T5XD 3H91A 3NWSA 1CTMA 3H94A 3I4NB 3K58A 4HTHA 1CZWA 3HOXB 2NVQB 4RHRA 4RGNA 4IUNA 3M3YB 1HFNA 1VF5C 3NBIA 1PYWD 4OO1G 5CORA 2K28A 2AQ3B 3ONAB 3SEBA 2BCOA 3HP3A 4S3SA 4O1NA 1R4PB 4HN7A 2AWOA 4I65A 4BA1I 1WD0A 5C3WA 3L9AX 3D4DA 1F9PA 5EPJA 2TSSA 3URYA 2A69D 2A68D 5IGCA 3Q6SA 4G7OC 5D3DA 1QB5D 1RJTA 2O5JC 1Y8OB 2E2IB 2Z8LA 2MUYA 3BZDB 3VYUA 2B2UC 2KVMA 5A35A 1UEAB 1ICWA 4IUUA 2DY8A 3GV3A 3C2PA 3HOZB 4KHVA 2KQ3A 5ELFA 3RZOB 1FNUA 3A54A 3KK7A 5I9OA 1TWHB 4FP5D 1BUVT 2F4IA 3GTLB 4RWSC 2JA5B 1HA5A 1EEID 1ENCA 4XTCS 3VR4A 1Q8IA 1JWMD 1A15A 3DXJC 3X3NA 5K36H 3K5MA 5KEEA 1AW7A 3OIQA 1RF2D 4IFDI 1BCPC 2H4OA 3TN2A 1F9SA 4O42A 5C4HA 3GQBA 4KTAA 3QG1A 2F0JA 5D3IB 5I2XA 2N55A 3PUYA 3GTOB 5E3FA 1DD2A 3VR6A 3R2TA 1M4VA 2EY2A 2PW5A 5C44B 5ELBA 2F3VA 1U9RA 2KOLA 1OXSC 3DEOA 4BBRB 3MHBA 2E74C 1TS3A 4HAEA 1Y8PB 1FR3A 1SMYC 4KN7C 2NBFA 2EOTA 3E6ZX 3K6OA 3PUZA 1WVLA 2HCIA 3S1NB 1AP0A 3GP7A 3NSWA 3HOYB 1QE6A 3H3VC 1BNZA 4ZQ3A 2K5DA 5JOBA 1PTOF 3H0GB 2M00A 3FVQA 4MN3A 4X3UA 3P20A 1VDZA 1TU2B 1VMCA 2KEEA 1AFPA 1EQTA 3S14B 2PZTA 3FKIB 5JPMC 2QCPX 4QMGA 3BVMA 3ND8A 4H0LC 3HRZC 4A3GB 4JBWA 2B2TA 1Y69U 1RODA 2CW0D 5K36G 1V1OA 2B8GA 3V05A 1JR0D 3NTKA 3RLFA 4FXDA 4HEDA 3TSSA 4A3IB 2B2YA 4R8NA 1DOLA 1WTXA 2XRSD 1V1PA 2K32A 2B63B 2XWBB 4Q0FA 3KLRA 1ENAA 4PQXA 4PV1C 3NK9A 2KCNA 3RUZA 3G6JB 5HURA 3RD4A 5ELCA 1DM0B 1EY8A 2F0GA 1KAAA 2KECA 1BXTA 3FPPA 3D6CA 1KNEA 2F0EA 2B2YC 1QNKA 2A68C 3D4RA 3FPUB 1Q1BA 1CK1A 4Q5VA 1HCZA 3NE5B 4RGMA 4XYQA 2QF7A 1S5CD 1HRJA 4OIJA 3K59A 4OGQC 1BCPB 2HUGA 3I4MB 5F2DA 1LTGD 1CI3M 4MHEA 2EYOA 2HDMA 4V0BA 1CQFA 3VR5A 1OXUA 2NVTB 1PLFA 1G291 2NVYB 4HSVA 1HUNA 4QCLA 3QIAA 4J1MA 2EY5A 2A5HA 2JEBI 4WJWA 1EEFD 1CQVA 2AQ2B 2MJ8A 3JAME 5I4DA 1BCPD 2MP1A 3I73A 2RSOA 3MZ5A 1V8QA 1G91A 1HFGA 1PRTF 3FEWX 1LTAD 3FMCA 4DF7A 4X3KA 5CV8A 1NCVA 1BOSA 2JYOA 2JEAI 1TVXA 1SYCA 3TZUA 2SNSA 3PUVA 2EYMA 3TP5A 2F0SA 1D6EC 3R8BA 3BVGA 1DOMA 4ZYSA 2R61A 2IJ0A 5C0XH 1SSOA 3WDNA 3HS0C 4CGYB 1SE3A 3KLSA 4ABNA 4JK1C 1K8MA 1PTOH 1TT2A 1SDFA 2D2CC 1RKNA 1QNUA 5C0XJ 3OWFA 4ZUJA 4A93B 3A56A 2N88A 1NAPA 3A8JE 5CGKA 5EJWA 3OWEB 2WP8J 2ZT9C 5EPLA 2IX3A 1F2MA 1LT3D 2EJMA 3DWAA 5IIFA 3R3OA 2B8FA 2O5IC 3QO2A 1C48A 5FLXL 4CKCA 5ELDA 2XVSA 4IUTA 2L0CA 5COYA 3LWUA 1O7ZA 5C4ZA 4RAUC 4HCSA 1MBYA 2AUKA 3MXPA 2VB3X 4OIKA 3PMFA 5C4XB 4U673 1PRTC 4Y7NB 2Z1CA 4ODGA 2ICIA 1STHA 1HXYD 5JEAG 4DNRB 2EXZA 3I3CA 4C3JB 2ZXOA 4XQNA 1FD7D 4DFAA 1SJED 4K2LA 5AFWA 1MSHA 1PZKD 4KKTA 1CZGA 2PNRC 1H9SB 1QILA 1EZ8A 2NN6I 1XX8A 4K6DA 4J8QA 3OPOA 1RHPA 4G4KA 2M9VA 1NR4A 3A7AB 5IOCA 4KHZA 1J9OA 3CKIB 1TWAB 4ZRZA 1U4PA 2F0VA 2X69A 3CQZB 2KA7A 3NP8A 3SVMA 5JPNC 1I4GA 4KY6A 1K8OA 4U68A 4A3FB 5DEHA 4KI0A 3MFYA 2ENBA 1WD1A 1SXTA 3DWPA 4LAAA 5JEAH 4DA2A 3HZXA 3SK8A 1HQRD 2NYZD 4LMQD 1PZID 4G57A 2M2LA 4EQPA 1NUCA 1FNVA 3I8ZA 2NTTA 4A3DB 1B9NA 1QG7A 4DAVA 2NZ1D 3C3LA 2EYFA 4YIJA 1SEBD 2RA4A 1X32A 2SNMA 3T51B 3S15B 3MA2B 3ERQA 2O2LD 2SDFA 2XIWA 4C3IB 3LWEA 1KDAA 1C4QA 1GXDC 1XTCD 1JQYD 3IL8A 3HOUB 3EQLC 3TDQA 4OL7A 3SK4A 4ZLTF 2PZWA 2RDFA 1TKWB 3S1MB 3BG3A 2CHBD 1U4LA 3OW7A 5EBDA 1JORA 2A74C 5EPKA 3CHBD 3ND9A 4EQNA 1IYUA 2BOSA 1BBXC 2EYJA 1RTOA 5ELEA 1SYDA 1XYIA 3U9OA 2XWJB 1YNND 4BY7B 3L3OC 1B53A 2Y0SB 1JOQA 2PCFB 4AYBB 4RHSA 3VR2A 2X6GA 2QDBA 5DM63 5T1GA 4EQOA 5I6YA 1EY4A 1A6XA 3J7AV 3MXNA 1AEXA 3N6RA 3VYTA 3BS1A 4C3HB 1Q3LA 1T5EA 4OO1H 1SE2A 1LACA 5CR3A 1H9MA 1ZEQX 1UAPA 4X3SA 4FXGC 2RVLA 1SYFA 5KGUA 2IX1A 2L55A 3PUXA 4CJ2C 4G7HC 3I4LA 1EL0A 2B39A 3BDLA 3SR1A 2LKVA 1H9SA 4ID6A 1HTLD 5I2YA 1AN8A 3Q22A 1SYGA 4BS9A 4XXEA 1STYA 2RDHA 5M3FB 4LK1C 4ME5A 1LV9A 3I70A 4TSSA 2NVXB 3PV0A 1HA6A 1ET6A 2JP1A 3A8IE 1WTRA 4HMJA 2G9HD 2A73B 3BDOA 4IFDH 1VCIA 5M9OA 2A6ED 2B2UA 1RTNA 1JE4A 3H6MA 3HOWB 3P7JA 4OO1I 3PO3B 1OXTA 1SJHD 3M7NA 3EVQA 2RDGA 2BA0A 1EZ6A 4TQUS 1F9QA 5EKKA 4UAIA 3MTSA 2L12A 1NSNS 3EA6A 4KKUA 5JAVA 4ZKBB 5E4WC 4K14A 3D6WA 3SXHA 3EJIA 3HG9A 2XRQD 5IT9L 1LABA 4XYOA 4F8MA 1O78A 2IW3A 1KDBA 3T16A 4A3KB 2X6LA 1V1PB 1YNJC 1F9RA 1B9MA 1PFBA 1LTBD 2TMPA 3LX0A 2L9HA 1JCKB 2K7VA 2R92B 5IGFA 2PO4A 4A3BB 1IHZA 2EE1A 5C3EB 4UDUC 2VB2X 4RKBA 5C5LA 1WCMB 2L1BA 1HUMA 1MSGA 4PNYA 4QUCA 4ZK9B 4X3TA 1PFMA 4DAYA 2A6HD 1QCBD 3L7ZC 1JC7A 1XXGA 2Q8TA 4NKLA 1WTVA 5D65A 2E2DC 4FF1A 2F3WA 4A3EB 1SMYD 4KY7A 3MWYW 1LTSD 4CKBA 1DYQA 1GHKA 3GTMB 1SNPA 1SNDA 2JA6B 2EY1A 1FGBD 5A2QL 2K03A 4IALA 3SHLA 4I7ZC 4FYDA 1IW7D 2LS01 2EVBA 1TQOA 4HCEA 3NQTA 4DXGA 3GD7A 4WORA 4RA8A 2NWGA 1DCZA 3TP6A 4B9XA 2DNEA 4IQZA 1EY0A 1I50B 4RCNA 1L0XB 4RH6A 2FMCA 4P2CB 2PYKA 2AUJD 2ZXRA 3D31A 1LT4D 2C9OA 2SOBA 1NR2A 1D2BA 1SNQA 3FRPB 1Y8NB 4ILWA 1SNCA 5DNFA 1EWCA 1JOOA 5EBCA 4KN4C 1EU3A 3NPPA 4RGOS 3GTGB 1D5MC 4BBSB 1KDCA 1RD9D 1I3QB 1BF4A 3CRLC 1C8CA 1B3AA 1ESFA 3D3RA 2D5DA 3R93A 1H9KA 2F0NA 1BR9A 1E2VA 2F0FA 1G2TA 1X3PA 1W6KA 3KLSX 2E2HB 2MPMA 3J81L 4QIWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XN9 C;  1PRT B;  1I4H A;  1DJR D;  1TS3 A;  1EU4 A;  3CHB D;  1CK1 A;  1FGB D;  3O13 A;  2Z8L A;  1SE3 A;  3DWQ A;  4RGM A;  1TS2 A;  3BZD B;  1S5C D;  5ELE A;  1JWS D;  2XNA C;  1PTO C;  1TS4 A;  1LTT D;  1G8Z D;  1PTO H;  1BCP B;  1LTI D;  1D5X C;  1B1Z A;  1SJH D;  3BYT B;  1L0Y B;  3GP7 A;  3R2I A;  1LTG D;  2RDG A;  1TY0 A;  1ET9 A;  1S5F D;  1LTR D;  1PZJ D;  1FNU A;  5ELF A;  4DXG A;  1I4G A;  2NTS A;  1PTO F;  3EA6 A;  4RHS A;  1KLG D;  5FKA C;  1STE A;  1D5Z C;  1HA5 A;  1MD2 D;  1EEI D;  2QEJ C;  2XRQ D;  1CT1 D;  4OHJ A;  1TS5 A;  1I4Q A;  1I4X A;  3OWE B;  1SE4 A;  1PRT D;  1JWM D;  1SXT A;  3DWP A;  1TY2 A;  1L0X B;  4RH6 A;  1LT3 D;  3DWA A;  1EFI D;  2QIL A;  2J4X A;  4C56 C;  1V1P B;  1B44 D;  1FNW A;  3BVM A;  1CQV A;  1BCP F;  1EEF D;  2AQ2 B;  2IPK D;  1KTK A;  1LTB D;  1SE2 A;  1LT5 D;  5I4D A;  4RFB A;  1BCP D;  1HQR D;  4Z9C B;  1AW7 A;  3MC0 B;  1LT4 D;  5ELD A;  1JCK B;  1LT6 D;  1GOZ A;  2SEB D;  1PZI D;  2WV6 D;  4DXF A;  1V1O A;  1T5X D;  1FNV A;  1PRT F;  1LTA D;  1PTO B;  1RF2 D;  1EWC A;  1SBB B;  3V05 A;  1BCP C;  4UDU C;  2NTT A;  1JR0 D;  1CHQ D;  1UNS A;  5FK9 C;  1EU3 A;  1JWU D;  4RGO S;  4RHR A;  5D3I B;  1RCV D;  1D5M C;  4K6L A;  1I4R A;  4RGN A;  1RD9 D;  1S5B D;  5TSS A;  3TSS A;  1PRT C;  1HTL D;  1PTO D;  4RCO A;  1PYW D;  1SEB D;  3MFG A;  1ENF A;  2XRS D;  2ICI A;  1V1P A;  1AN8 A;  1HXY D;  1I4P A;  1ESF A;  2AQ3 B;  2AQ1 B;  3BYY B;  3SEB A;  1KLU D;  1XXG A;  4L6T B;  2RDH A;  3R2T A;  1S5D D;  1M4V A;  4O1N A;  4BWG B;  4TSS A;  1LLR D;  4L63 B;  1FD7 D;  1F77 A;  1ET6 A;  1D6E C;  1SJE D;  2O2L D;  4RGT A;  3EFX D;  2TSS A;  1PZK D;  1CHP D;  1UUP A;  5ELC A;  3R8B A;  1S5E D;  5ELB A;  3BVG A;  3URY A;  1XTC D;  1JQY D;  3W2D A;  1QIL A;  2G9H D;  3KLS X;  1LTS D;  3BVZ A;  4ZYS A;  1BXT A;  1LO5 D;  1RDP D;  2R61 A;  1DYQ A;  5D3D A;  2IJ0 A;  2CHB D; 
#chains in the Genus database with same CATH topology
 2KHS A;  5J3B A;  1E0B A;  1D1K A;  2XN9 C;  4M8A A;  3HOY H;  4DV2 L;  1VQO A;  1ILQ A;  2AHO B;  2MO0 A;  3U58 A;  3WOE A;  3NQI A;  4A3C H;  2R7D A;  2EJF C;  2K52 A;  1WTO A;  4QF4 A;  1D5X C;  1L0Y B;  3D8G A;  4GKK L;  3K5N A;  2CWP A;  1EYA A;  2HDL A;  3K7A B;  4L5S A;  1H9J A;  2R93 H;  3W1G A;  1D5Z C;  3V2T A;  3GTP H;  3HEJ A;  2E2J B;  2ZXP A;  2LMC B;  5KRU A;  4OHJ A;  4A3J B;  1KC8 C;  4A3B G;  3TME A;  3T53 B;  4J15 A;  2R6G A;  1SFO B;  4TRD A;  5CBA E;  1ZYR D;  3OTO Q;  2OEO A;  2J4X A;  1XNR L;  1TWF B;  5EGT A;  2A6E C;  3SE0 A;  4LFC Q;  1PXU A;  1DON A;  4IJL A;  4DPG A;  5ELO A;  2RQX A;  4NP5 A;  4QB4 A;  4YY3 Q;  2SEB D;  3SK6 A;  3J80 E;  1OXV A;  1YHB A;  2F3I A;  1N34 L;  3M4P A;  1YJW A;  5IYC G;  5CV4 A;  2JXM B;  3TS2 A;  3I90 A;  1TWG H;  4DK6 C;  3CCJ A;  2WII B;  4HJ8 A;  5G3L D;  1CA5 A;  4BY7 H;  4A3I G;  4LF5 Q;  1E2Z A;  2DUD A;  2F0U A;  1EYD A;  3MVV A;  2EYP A;  3Q24 A;  5C5M A;  4LF9 L;  3A7L A;  4POG A;  1QJO A;  5BN5 A;  4RCO A;  4A3M B;  3MFG A;  4A3K G;  1ENF A;  4BBS H;  1SNM A;  5A2Q E;  2CWA A;  1SN8 A;  2CH4 A;  2F0O A;  2WB1 G;  4F88 A;  1A8V A;  3I4N H;  4CJ0 B;  2K6A A;  3CCV A;  2G9D A;  4KHP L;  4GLX A;  2BE5 C;  2I5L X;  2EQS A;  1F2L A;  4HJ9 A;  1PA6 A;  2FIN B;  4PG3 A;  1KQS A;  3EFX D;  3CC7 A;  3ICE A;  4FF3 A;  3SDZ A;  2CQO A;  2K50 A;  2CW0 C;  4JI1 Q;  2UXC Q;  2F03 A;  1TWC H;  2Z4H A;  4LUO A;  4WFN 3;  2HHH L;  4X62 Q;  3TEH B;  4DNI A;  1PFS A;  1K8A C;  1MGS A;  4GS3 A;  3VYS A;  2AWN A;  3FP9 A;  4POF A;  5KND A;  3LNN A;  2WKC A;  1Q82 C;  4IFD J;  4H02 A;  5KYL A;  3M4Y A;  1NNX A;  4PMB A;  2EXD A;  3I91 A;  5T1I A;  3KBX A;  4GOP A;  2D0P A;  2GVA A;  1JWS D;  2XNA C;  2NUC A;  2F0T A;  3M4O B;  1GUW A;  1IKL A;  2KUM A;  4BY1 H;  1R9T B;  4DV6 L;  4B3M Q;  1MJC A;  4DAP A;  1F2Y A;  4JI6 L;  1GUT A;  4K8I A;  5C6A A;  1M1K C;  4UY8 C;  4PMC A;  4BA2 I;  3U9S A;  1EIY B;  1ONL A;  2GN5 A;  3Q8D A;  1TS5 A;  1I4Q A;  1Y1V B;  5IGG A;  1XTD A;  1S40 A;  3PIP 3;  3W3A A;  1DXM A;  2FFK B;  2PQA B;  2JA6 G;  2MQH A;  4DR3 Q;  3GO5 A;  5J39 A;  1BDO A;  3W1B A;  4E6I A;  1ML0 D;  2MNA A;  2QGQ A;  1N8R C;  2IL8 A;  4CJ1 B;  4N9T A;  2RSN A;  2WB1 B;  4JG2 A;  3PO2 H;  3S2H H;  4K5W A;  4K5V A;  1X3F A;  5KNB A;  3ULL A;  1F2Z A;  4KV6 A;  2RBM A;  2YV5 A;  3IFD A;  3HOX H;  1MJE A;  2NVQ H;  2KEN A;  2HCC A;  3K5L A;  5IT9 E;  1LT6 D;  3WOF A;  3GV6 A;  1A2T A;  3VA5 A;  1AE2 A;  1HZ9 A;  1N32 Q;  1IL8 A;  3OMC A;  3MAQ A;  1K3R A;  3DHQ A;  2K05 A;  4R8I A;  2KJX A;  1Q12 A;  2B2V C;  5LHY 1;  3P75 A;  1CHQ D;  3MEH A;  4ULL A;  5FJ8 G;  5LMU Q;  2VUM G;  1VQN A;  5TSS A;  5K5P A;  2ZM6 L;  1LM0 A;  1XNQ L;  1PTO D;  4LNQ A;  4DU9 A;  2V4D A;  1A3T A;  5AJ3 Q;  4R4O A;  3JAM i;  1S5D D;  1CKM A;  1L2F A;  3H09 A;  4JBM A;  3K5O A;  4ZKC B;  4L63 B;  5FO7 B;  1SRU A;  1XWE A;  4NXM L;  3S15 H;  4C3H H;  4IUP A;  3W2D A;  4A3G H;  4NW2 A;  1RDP D;  5CYU A;  2Q8R E;  2K1B A;  3H15 A;  3U50 C;  4R4I A;  2HT1 A;  1JOK A;  1Z9F A;  2NN6 G;  5IGE A;  2UXB L;  4IJH A;  2JA6 H;  4H13 C;  1CUK A;  1STN A;  2F0Q A;  1QWY A;  2LFN A;  4IUR A;  5GAD C;  3BYT B;  3NHH A;  2R7Z H;  1ET9 A;  1HTP A;  1S5F D;  3OIP A;  4GNX A;  1E2W A;  1X3G A;  4NMZ A;  5E4X A;  3ULJ A;  1EY7 A;  2BE5 D;  4DK1 A;  3F8T A;  3NEN A;  3KF8 A;  1BVS A;  1STE A;  1YNN C;  3TP7 A;  2PPB C;  4BY1 G;  1VQ4 A;  2IWH A;  5G3L F;  5JVG 3;  4RKL A;  4B9W A;  1DZ1 A;  2E76 C;  3KYH C;  1SE4 A;  2K04 A;  3T1Y Q;  2JA7 H;  4C3J G;  2A19 A;  3BDC A;  3S17 B;  3PCO B;  3T1H Q;  5CC4 A;  2KCC A;  2I5M X;  3SK5 A;  1FNW A;  2OCE A;  4R4C A;  1Q7Y C;  1EY6 A;  3S2D H;  2CCZ A;  4DV3 L;  4DV6 Q;  4B3M L;  3K80 C;  3Q0A A;  1WTP A;  1QVF A;  3RMH A;  4IFD G;  4EVO A;  2MGS A;  4PMW A;  4YHH Q;  5GQO A;  5JJZ A;  5ISR A;  1I94 L;  4FF2 A;  1GHJ A;  5M3F H;  4N8F A;  3Q23 A;  4AQY L;  5JVH 3;  1SYB A;  2F0H A;  3E5S A;  1JWU D;  1HQM C;  2Z6B A;  4FO2 A;  1EIG A;  4GLA C;  2IT1 A;  3F2B A;  4C2M H;  3KJO A;  1XPU A;  4N9P A;  3UI2 A;  2ZTC A;  2WAQ B;  1P16 A;  2EJG C;  3NXW A;  4DR6 L;  3NWT A;  5M5X H;  4BWG B;  1YIJ A;  4A3F G;  3AMU A;  3C1F A;  4A3D H;  3S16 B;  3DM1 A;  2DN8 A;  2O4X A;  4JYA L;  3K81 C;  5IGB A;  4A3G G;  4CKE A;  4RGT A;  2F0K A;  5I9P A;  3G71 A;  1UUP A;  1S5E D;  4AYB E;  4KLK A;  1A3U A;  2EYL A;  2XGT A;  3HKS A;  3OHX C;  2CQA A;  3A8K E;  1PHJ A;  1ZYR C;  4F87 A;  2VXW A;  4XQJ A;  1Z6H A;  1I4H A;  3NUC A;  1Y1W B;  4L5T A;  3DWQ A;  1TS2 A;  1EQV A;  4JPB W;  2ID0 A;  2JA5 H;  1KRS A;  3P1H A;  1YJ9 A;  5C4J B;  1ASY A;  4C2M B;  1B50 A;  3R2I A;  1TR5 A;  5M5Y B;  2YYZ A;  3DEP A;  5KIX A;  1A3V A;  4OXP A;  2NTS A;  2K5Q A;  3M4Q A;  2BDO A;  2UUA Q;  5FKA C;  3HKZ B;  3ITP A;  1MD2 D;  3AFQ A;  3TP8 A;  5C0X G;  4FF4 A;  1EIH A;  3CCE A;  5FOB B;  1X54 A;  3N52 A;  3NTH A;  2F0I A;  4JI2 Q;  4H44 C;  4JI8 L;  5C3E G;  1KNA A;  1A2U A;  1TY2 A;  1U4R A;  1STG A;  4B3S L;  3J80 c;  4C56 C;  4DR7 L;  2FJ2 A;  4DN4 M;  2I46 A;  2VUM B;  5CV7 A;  3J81 E;  4RFB A;  1I6H H;  1D7Q A;  2EDG A;  1GD7 A;  3HOU G;  3L2P A;  1YNX A;  1GOZ A;  2Z0S A;  4GKJ L;  5DM7 3;  5FO9 B;  2B2W A;  4JI7 Q;  1KL9 A;  1PTO B;  3J7Z C;  1SBB B;  4MIU A;  1N33 L;  3J81 c;  1M8A A;  2CKZ B;  4DUZ Q;  4J6H A;  1K83 B;  4LJZ C;  4JI3 L;  1FVI A;  2K33 A;  4PZ7 A;  4K6L A;  3QOJ A;  5IYB H;  4PZ8 A;  2G5D A;  4LF8 L;  4WRD A;  5DLQ E;  3V96 A;  3A74 A;  1GUN A;  3QJY A;  3CMA A;  1JJ2 A;  2UUB Q;  1QVC A;  4LFC L;  5C4X H;  2N3S A;  4ZUI A;  2WB1 E;  4K8J A;  1KLU D;  1STB A;  1L0W A;  2Q2H A;  1O7L A;  4N8X 1;  1PH7 A;  4QIW E;  1PMR A;  3ER0 A;  4HIO A;  1Z7T A;  4UP9 A;  3J81 j;  2DY7 A;  5KNC A;  4JW0 A;  4C3I G;  5FLX c;  1N34 Q;  1VQF A;  2MFI A;  2K5W A;  3DUZ A;  3KFU A;  1TWH H;  2LY7 A;  4RG1 A;  3GTJ B;  1HHV A;  2XSC A;  1KAB A;  2B29 A;  5FLX E;  1AZQ A;  4YWL A;  1NMG A;  4GNX B;  2ZJR A;  5C0X I;  5HGT A;  1GUS A;  1EU4 A;  5M3M G;  2E5L L;  4CDC C;  1IYJ B;  4FNF A;  2YU9 B;  1E1O A;  1LTT D;  1G8Z D;  1D8L A;  1PFN A;  2Y0S E;  3MXU A;  1CFM A;  1HZA A;  3H3V H;  1YI2 A;  1B2T A;  1G51 A;  4C1N K;  1FYC A;  1KIX A;  3S1Q H;  4A3F H;  3GTO H;  3RZD B;  2F0P A;  1LTR D;  4JI5 L;  1VMP A;  2JA7 B;  3J80 i;  4JI1 L;  3TBI B;  3S1Q B;  1IW7 C;  2MO1 A;  1BO0 A;  2BA1 A;  2PI2 E;  4P71 A;  2UU9 L;  2ZTE A;  3UDF A;  3J7Y W;  2RKS A;  2YU9 H;  2A1A A;  2IHF A;  4HMI A;  4KD3 A;  1GKH A;  1B4O A;  4YWM A;  2A6H C;  3PO2 B;  3DM3 A;  1VQI A;  4C3H G;  2JSO A;  4TVA B;  1EFI D;  1PH1 A;  1C7Y A;  3OMG A;  3QB3 A;  2R7Z G;  1GUO A;  1IKM A;  1BCP F;  1OO9 B;  3M3Y H;  4K2K A;  3M7G A;  3PIO 3;  3S9W A;  1BQQ T;  2OF1 A;  4Z9C B;  3H0G G;  4A3M H;  3GTK B;  3S1R B;  3VA7 A;  3K57 A;  1PH4 A;  1UWV A;  5CV6 A;  2JK8 A;  3A55 A;  1HPC A;  1UEB A;  5FLM G;  4KJN A;  1VQG A;  4JI0 Q;  2GA4 B;  3T56 B;  5FK9 C;  1SMX A;  3U4V A;  2IX0 A;  3CC2 A;  3GTK H;  5M5W B;  3ERS X;  4JI8 Q;  4JI2 L;  2KCT A;  3OSO A;  4C1N I;  5GAH C;  5M3M B;  3C1E A;  1D1I A;  3HOZ H;  5IWA Q;  3QWN A;  1QOH A;  4DR7 Q;  2AQ1 B;  1R9T H;  1Q86 C;  1YBY A;  5JEA J;  2VL6 A;  4L6T B;  4B08 A;  4UP7 A;  5LL6 X;  5C3E H;  1XMQ Q;  2E2I H;  4XIG S;  3T13 A;  4BBR H;  1Q1E A;  1N32 L;  4FVM A;  2WAC A;  3TZD A;  1HH2 P;  4A93 G;  4IZ8 A;  3GTQ B;  1K73 C;  1VQB A;  4MNO A;  1ZKO A;  2E8G A;  2R92 G;  5C44 G;  3BVZ A;  2NN6 H;  5BN3 A;  1LO5 D;  4JCV E;  2C5C A;  2B63 G;  4R9W A;  3E0J A;  4B3T Q;  1G2S A;  1VQ7 A;  2JQO A;  1TWC B;  3CCQ A;  3RLN A;  5FO8 B;  3PIO A;  1R4Q B;  1DOK A;  3O13 A;  5I6W A;  5IP9 G;  1EOV A;  1PTO C;  1TS4 A;  2J0T D;  3J7A F;  1LTI D;  3AU7 A;  2OT2 A;  1FJG Q;  2JA8 B;  2HD3 A;  1TY0 A;  1WTQ A;  1PZJ D;  3I4M H;  1OXX K;  4KKS A;  2FHT A;  3D4W A;  1O7Y A;  1SNO A;  3A5Z B;  4DNT B;  3C46 A;  1HNW L;  2CH4 W;  3S2H B;  1NMF A;  4KMU C;  1I6V C;  3HOW H;  2J7Z A;  2RHQ B;  1IYV A;  1J5E L;  2WIN B;  1EOT A;  1PH9 A;  3KBG A;  1X6O A;  2PMZ B;  3AYH B;  5EKI A;  4KD4 A;  1MI2 A;  4GZY C;  2B2W C;  5IGD A;  4DV5 Q;  4K0K Q;  3STB C;  5DAU A;  3I72 A;  4FXK C;  2FMM A;  4JI4 Q;  4QY7 A;  2OWO A;  3RN2 A;  1JJC B;  1LT5 D;  3IKJ A;  2ICE C;  4JI5 Q;  3X3M A;  2JJQ A;  2OXP A;  2MHV A;  4Y52 H;  5JJK A;  4CDD C;  1X3E A;  1EYC A;  1Z47 A;  1VS0 A;  2HQE A;  3HKZ G;  1UNS A;  3BU2 A;  5D14 A;  2B2T C;  3TRZ A;  3PUW A;  1JB7 A;  4A75 A;  1S5B D;  1T9H A;  3CU7 A;  3LGJ A;  3F2U A;  2NB0 A;  1S4Z A;  2QKI C;  1JB3 A;  1EWH A;  3KUP A;  4WJ4 A;  1GJX A;  1EY9 A;  1KRT A;  1AZP A;  3GDE A;  2ASB A;  5NUC A;  1K3B C;  5JJL A;  3ZYY X;  4DK0 A;  2D62 A;  2E2H H;  1CHP D;  4H7B A;  2VS1 A;  4XT3 B;  1VQK A;  2Z4I A;  4JI6 Q;  4AQY Q;  2L5T A;  5H1S E;  2WFW A;  2VW9 A;  4YCW A;  4CDE C;  1STA A;  1DJR D;  4QUF A;  5IWA L;  1ZXT A;  4O0A A;  3K0Y A;  2F0D A;  3IFT A;  3KDF B;  5IP7 G;  2F0M A;  4DK3 C;  2QDL A;  2DJG C;  4A76 A;  1IBM Q;  4APV A;  3ERO A;  1WI5 A;  2E75 C;  1PDQ A;  1Q90 A;  2EZV A;  4A3C G;  2JA8 H;  1H9R A;  2R7Z B;  1G6Z A;  4BY1 B;  4TKO B;  1J8I A;  1IZ6 A;  4L8J A;  3AQQ A;  5EKL A;  3IRB A;  2K4K A;  4A4I A;  1ILP A;  4CBV A;  2B63 H;  3E0E A;  1E1T A;  3G7L A;  3MXG A;  1O7I A;  5M5X B;  4XDX A;  5J1Z A;  2R92 H;  3VR3 A;  3HGB A;  1II3 A;  1HZC A;  2ZM6 Q;  1VQJ A;  4LUZ A;  1I6H B;  2QIL A;  4LF4 Q;  4XT1 B;  5IYC H;  3GTP B;  1B44 D;  1FJG L;  2JE6 I;  1KTK A;  2Q2I A;  3DMU A;  2UUC L;  1SYE A;  4IPD A;  2F0L A;  4ZAI A;  3RZO H;  1IBL L;  4DXF A;  1U0L A;  3NBH A;  3T4A C;  2Q8I B;  3I55 A;  1VF7 A;  2A69 C;  1CA6 A;  4NXM Q;  1C0A A;  4HR7 B;  5IOD A;  4HJ7 A;  4K5X A;  4A93 H;  2Y0S G;  2WKD A;  2VNU D;  1CSP A;  4HIM A;  4DGZ A;  4DR2 Q;  2NZO A;  4F7X A;  1RCV D;  1I4R A;  2UXD Q;  4NDX A;  3CRK C;  2F0W A;  2R3Z A;  1N9W A;  1JIC A;  3RNU A;  1C9O A;  1X3Q A;  5EQ0 A;  3PO2 G;  4KK7 A;  1MIU A;  1GUG A;  1YZ6 A;  1I4P A;  3BYY B;  1VQ6 A;  1O80 A;  4IUQ A;  2B2V A;  5HGQ A;  2OQK A;  3NTI A;  2F1M A;  2I07 B;  1V43 A;  1LLR D;  2D9U A;  3GTM H;  4GKJ Q;  4HID A;  2A8V A;  1U4M A;  1F77 A;  3VYR A;  1YHA A;  4DV4 L;  1SAP A;  2L11 A;  3HOV B;  2PQE A;  4DUZ L;  3J80 L;  4G7Z C;  2PZU A;  1VQL A;  2IHE A;  3NBH B;  5E1F A;  1WTW A;  5J22 A;  1CM9 A;  4LF8 Q;  1AH9 A;  1PRT B;  4IN3 A;  4V19 0;  1UE5 A;  4M1U B;  1QUQ A;  5CV9 A;  2H5X A;  2EPB A;  1TWG B;  1EY5 A;  1VQA A;  3UE1 A;  4EGV A;  1YNJ D;  5KYI A;  5IP7 H;  3IAY A;  2VQF Q;  3H0G H;  4A3M G;  1XNR Q;  4X66 L;  1B1Z A;  2H1E A;  2K01 A;  3J81 i;  1E22 A;  5CMD A;  4YY3 L;  1L1O A;  4IUV A;  3M4O H;  4JC0 A;  3M85 A;  2L4N A;  3K7A H;  1KLG D;  2PW7 A;  1X55 A;  2BDN A;  5LL6 S;  1TII D;  2QEJ C;  1CT1 D;  2EY6 A;  4XQQ A;  4KY5 A;  1I4X A;  3FDT A;  3JAM L;  4MTK A;  5BN4 A;  2E2J H;  1PRT D;  2DNC A;  2E5L Q;  5C3X A;  2N8N A;  5CV5 A;  1XMO L;  4KJO A;  4HSP A;  2CVR A;  3QOL A;  3S2D B;  2EYH A;  2R93 B;  5CBE E;  3OOC A;  4A3K H;  2IPK D;  3PF5 A;  2N78 A;  3MC0 B;  1X56 A;  3AB9 A;  2PNH A;  4CHT B;  2KED A;  3SGI A;  4KHP Q;  4DUY Q;  2WV6 D;  1W6J A;  1T5X D;  2UU9 Q;  3H91 A;  3NWS A;  1CTM A;  1WFQ A;  3H94 A;  1V1Q A;  3I4N B;  3K58 A;  2UXC L;  4HTH A;  1KAW A;  1CZW A;  4LFA Q;  3WWV A;  1CSQ A;  4IPC A;  3HOX B;  4RHR A;  2NVQ B;  4Y7N H;  2F4V L;  1K0S A;  2GVB A;  4RGN A;  3UE0 A;  4IUN A;  3M3Y B;  4A3E H;  5IP9 H;  1HFN A;  1VF5 C;  3NBI A;  1PYW D;  4OO1 G;  1VQD A;  5COR A;  2K28 A;  2AQ3 B;  3ONA B;  3SEB A;  2BCO A;  3HP3 A;  2NVX H;  2UUC Q;  1GO3 E;  1EIF A;  4S3S A;  4O1N A;  1R4P B;  4HN7 A;  2AWO A;  4I65 A;  4BA1 I;  1Y1W G;  1WD0 A;  5C3W A;  3L9A X;  3D4D A;  1F9P A;  4GOP C;  1IBK L;  5EPJ A;  2TSS A;  4JI0 L;  3URY A;  2A69 D;  2A68 D;  2K5H A;  4OWW B;  5IGC A;  3Q6S A;  5IYB G;  3OYY A;  4G7O C;  1MHW C;  4DR2 L;  5D3D A;  1HR0 W;  1W3S A;  2Q2U A;  1QB5 D;  3OW2 A;  4DV1 L;  1RJT A;  1NJI C;  1M90 C;  2O5J C;  4IOA A;  1Y8O B;  2I0Q A;  2E2I B;  2Z8L A;  1QVG A;  2MUY A;  3BZD B;  1SRO A;  3VYU A;  2B2U C;  2KVM A;  4NPS A;  5A35 A;  1UEA B;  1ICW A;  4IUU A;  1IXR A;  2DY8 A;  3GV3 A;  3C2P A;  3HOZ B;  3TRE A;  3E9I A;  3RR5 A;  4KHV A;  2KQ3 A;  5ELF A;  3RZO B;  1FNU A;  5EAY A;  3A54 A;  3KK7 A;  5I9O A;  5M5W H;  1TWH B;  4FP5 D;  4R1J A;  1BUV T;  2F4I A;  1U5K A;  1KD1 C;  3GTL B;  4RWS C;  2JA5 B;  3NEL A;  1HA5 A;  1A62 A;  1EEI D;  2K5N A;  3NEM A;  1J6Q A;  1Y1V G;  4BXX H;  1ENC A;  5ELN A;  4XTC S;  3VR4 A;  2CFM A;  1MKH A;  3CCR A;  4UHV A;  5LMN Q;  1Q8I A;  1JWM D;  1A15 A;  1I3Q H;  3DXJ C;  4YWK A;  3X3N A;  5IT9 c;  3CW2 C;  2WAQ E;  2UUB L;  5K36 H;  1W2B A;  3KOJ A;  3K5M A;  3CCL A;  5KEE A;  1AW7 A;  2RCF A;  3HOY G;  1HZB A;  1K28 A;  1HNW Q;  3OIQ A;  2ATW A;  4QGU A;  1RF2 D;  4A3L G;  4IFD I;  1BCP C;  2H4O A;  3TN2 A;  3W5O A;  1F9S A;  3F2C A;  4O42 A;  5C4H A;  3GQB A;  4KTA A;  3QG1 A;  2F0J A;  5D3I B;  2VY3 A;  4A3D G;  2KBN A;  2EIF A;  1PYB A;  5I2X A;  2N55 A;  3PUY A;  1WCM H;  3GTO B;  5E3F A;  1DD2 A;  4K0K L;  4LF6 Q;  1JE5 A;  3VR6 A;  2UXB Q;  3R2T A;  2VQE Q;  1M4V A;  1K9M C;  4DR5 Q;  1QZH A;  2OTL A;  2EY2 A;  2PW5 A;  4YCU A;  5C44 B;  5ELB A;  2F3V A;  3MEF A;  3HKZ E;  1U9R A;  4DR1 Q;  2KOL A;  4UPA A;  1OXS C;  2V1C C;  4HIK A;  3DEO A;  4BBR B;  3MHB A;  2E74 C;  1TS3 A;  4HAE A;  5BR8 L;  1Y8P B;  3GTQ H;  1FR3 A;  3T1Y L;  1SMY C;  4KN7 C;  2NBF A;  3AEV A;  3AFP A;  2EOT A;  1JMC A;  1LYL A;  3E6Z X;  3K6O A;  3PUZ A;  1WVL A;  2HCI A;  3S1N B;  1AP0 A;  3GP7 A;  3I2Z A;  3NSW A;  3HOY B;  1GM5 A;  1QE6 A;  4DV3 Q;  4HJA A;  1BNZ A;  3H3V C;  4ZQ3 A;  2K5D A;  5JOB A;  1PTO F;  1QUQ B;  3H0G B;  2K14 A;  4RMF A;  2M00 A;  2KHI A;  3FVQ A;  1BBW A;  4DV1 Q;  4MN3 A;  4GN4 B;  4X3U A;  3P20 A;  4DKA C;  1VDZ A;  1TU2 B;  1VMC A;  2OTJ A;  2KEE A;  1AFP A;  1EQT A;  1L1O C;  2LXK A;  3KF8 B;  3S14 B;  2PZT A;  3FKI B;  5JPM C;  2QCP X;  4QMG A;  3BVM A;  3ND8 A;  4H0L C;  3HRZ C;  4GKK Q;  4A3G B;  4JBW A;  2B2T A;  1Y69 U;  3GTG H;  1ROD A;  1XMQ L;  2CW0 D;  4JYA Q;  5K36 G;  1V1O A;  1Y14 B;  2ZJP A;  1K83 H;  2B8G A;  3V05 A;  4LW1 A;  1JR0 D;  3NTK A;  3RLF A;  1HNZ L;  4FXD A;  4HED A;  3DLL A;  3TSS A;  4A3I B;  2B2Y A;  4R8N A;  1N36 L;  1DOL A;  3CPF A;  1WTX A;  3S17 H;  2XRS D;  4P73 A;  1V1P A;  1E3P A;  5IY0 A;  4FDB A;  2K32 A;  2B63 B;  2XWB B;  4Q0F A;  3KLR A;  3BJU A;  1EQR A;  1VQH A;  3ZJY C;  1TWA H;  1ENA A;  4PQX A;  2RF4 A;  1IBL Q;  4PV1 C;  3NK9 A;  2KCN A;  3RUZ A;  1NBW A;  1YEZ A;  3G6J B;  5HUR A;  3TS0 A;  3RD4 A;  5ELC A;  1DM0 B;  1EY8 A;  2F0G A;  1QZG A;  1KAA A;  2KEC A;  4CDF C;  1BXT A;  4LF5 L;  3FPP A;  3S14 H;  3D6C A;  1KNE A;  2F0E A;  2ES2 A;  2B2Y C;  3HOX G;  4B3R Q;  1QNK A;  2A68 C;  3D4R A;  3GTJ H;  1J5E Q;  1Q46 A;  3FPU B;  1Q1B A;  3F2D A;  3VDY A;  1CK1 A;  2PI2 A;  4Q5V A;  1HCZ A;  5C4J H;  2JA5 G;  3NE5 B;  4RGM A;  4XYQ A;  3FKI G;  2QF7 A;  1S5C D;  1HRJ A;  4OIJ A;  3K59 A;  4OGQ C;  1BCP B;  2HUG A;  4GNX C;  1Y1W H;  3I4M B;  5F2D A;  4DV7 L;  1LTG D;  1CI3 M;  2HIX A;  3G6E A;  3TQY A;  4MHE A;  2EYO A;  4DV4 Q;  2RCN A;  1LUZ A;  2HDM A;  4V0B A;  1CQF A;  3VR5 A;  1OXU A;  4DR1 L;  2NVT B;  1PLF A;  1G29 1;  2QEX A;  2NVY B;  1A63 A;  4X64 Q;  3KJP A;  4HSV A;  1HUN A;  1Q8K A;  4QCL A;  3A0J A;  3QIA A;  1VQ5 A;  1UE7 A;  4J1M A;  2I5H A;  3FHW A;  4GOP B;  3RZD H;  1NE3 A;  2EY5 A;  2VQF L;  5FLM H;  2A5H A;  2JEB I;  4WJW A;  4C3I H;  1CQV A;  1EEF D;  2AQ2 B;  2MJ8 A;  1EFW A;  3JAM E;  5I4D A;  1BCP D;  2MP1 A;  3I73 A;  1TXY A;  2Q2T A;  1I50 H;  2RSO A;  1EUJ A;  3MZ5 A;  1V8Q A;  1G91 A;  1HFG A;  1PRT F;  3FEW X;  1HR0 L;  1GVP A;  1LTA D;  4LFB Q;  1S3O A;  4JBJ A;  3FMC A;  4JOI C;  4DF7 A;  5M3M H;  4X3K A;  1YJN A;  3PF4 A;  5CV8 A;  1VQP A;  4DR3 L;  2HIV A;  1NCV A;  3EIV A;  3J7A 5;  1BOS A;  1CKN A;  2JYO A;  2JEA I;  1TVX A;  4OWX B;  1LTL A;  4GLV B;  4L5Q A;  3G48 A;  1SYC A;  3TZU A;  3PGZ A;  1VQM A;  1IBM L;  1B3Q A;  2SNS A;  2ZTD A;  3PUV A;  4DUY L;  2EYM A;  3TP5 A;  2D0O A;  2F0S A;  1D6E C;  4BBS G;  3R8B A;  3BVG A;  1DOM A;  1PH2 A;  1HNX Q;  4LFA L;  1HNZ Q;  5GAE C;  4ZYS A;  3S1R H;  1SLJ A;  2R61 A;  2IJ0 A;  2F4V Q;  3I4O A;  5C0X H;  3CC4 A;  1SSO A;  2PMZ E;  1CKO A;  3WDN A;  3HS0 C;  2Z6K A;  4CGY B;  1SE3 A;  5AJ3 L;  1AE3 A;  2Z9H A;  3KLS A;  4ABN A;  4JK1 C;  1K8M A;  1PTO H;  4L5R C;  3H3V I;  1TT2 A;  1SDF A;  1IBK Q;  2D2C C;  4IO9 A;  1SE8 A;  1OTC A;  1RKN A;  1QNU A;  5C0X J;  4LUV A;  3OWF A;  4ZUJ A;  4A93 B;  4P72 A;  3A56 A;  4B3R L;  2N88 A;  1NAP A;  3A8J E;  5CGK A;  4NB3 A;  5EJW A;  2DJF C;  4O2D A;  3OWE B;  2WP8 J;  2UXD L;  2ZT9 C;  5EPL A;  2IX3 A;  1A0I A;  1F2M A;  1LT3 D;  2QW7 A;  2EJM A;  3DWA A;  4AYB G;  5IIF A;  2AMC B;  3R3O A;  2B8F A;  2O5I C;  3QO2 A;  1C48 A;  5FLX L;  4CKC A;  5ELD A;  2XVS A;  5FJ8 H;  4OON A;  4A3J G;  3UDX A;  3ULP A;  4IUT A;  2L0C A;  5COY A;  1XPR A;  2JA8 G;  3LWU A;  1O7Z A;  5C4Z A;  4P74 A;  4RAU C;  4HCS A;  1MBY A;  2FXQ A;  2AUK A;  1S72 A;  3MXP A;  2VB3 X;  3QR8 A;  1VQ8 A;  3EN2 A;  4OIK A;  3PMF A;  5C4X B;  4ME3 A;  3S24 A;  4U67 3;  1PRT C;  3HOV G;  4WJ3 M;  2LXJ A;  4Y7N B;  3OTO L;  2Z1C A;  4ODG A;  2ICI A;  1STH A;  1HXY D;  5JEA G;  4DNR B;  2EXZ A;  3I3C A;  4C3J B;  2ZXO A;  3PO3 H;  1ASZ A;  4XQN A;  4X66 Q;  3UDG A;  4DR4 Q;  2R7F A;  1FD7 D;  1ICF B;  2HQL A;  4DFA A;  1SJE D;  4K2L A;  5AFW A;  1MSH A;  5GAG C;  1PZK D;  2RHS B;  4KKT A;  4YHH L;  1CZG A;  2PNR C;  1H9S B;  1QIL A;  1EZ8 A;  2NN6 I;  1L1O B;  1XX8 A;  4K6D A;  4J8Q A;  3OPO A;  5M3F G;  1DGS A;  1RHP A;  4G4K A;  2M9V A;  1NR4 A;  1X9N A;  1I5F A;  3A7A B;  5IOC A;  4KHZ A;  4DV5 L;  1J9O A;  3CKI B;  1TWA B;  4ZRZ A;  3EBE A;  4A3I H;  4DR5 L;  1U4P A;  2F0V A;  1EQQ A;  2X69 A;  3CQZ B;  2ALY B;  4I7A A;  2KA7 A;  3I56 A;  3NP8 A;  3FKI H;  3SVM A;  5JPN C;  1I4G A;  4KY6 A;  1K8O A;  4U68 A;  4A3F B;  5DEH A;  1BBU A;  2HHH Q;  4QQB X;  2NVY H;  4KI0 A;  3MFY A;  1PH3 A;  3PO3 G;  2WAQ G;  2ENB A;  4ALP A;  1WD1 A;  5C4X G;  1WOC A;  1SXT A;  3DWP A;  4LAA A;  3M9B A;  4YCV A;  5JEA H;  4ZCK A;  1G6P A;  4DA2 A;  3HZX A;  4DAY B;  3SK8 A;  1HQR D;  2NYZ D;  4JV5 L;  3RN5 A;  4LMQ D;  1PZI D;  4G57 A;  2M2L A;  1NTG A;  2UUA L;  4EQP A;  4X65 L;  1NUC A;  1FNV A;  4OEM B;  3CCS A;  2IY5 B;  3I8Z A;  2NTT A;  4A3D B;  1B9N A;  2VUM H;  1QG7 A;  4DAV A;  1UE6 A;  2NZ1 D;  3B6Y A;  3C3L A;  2EYF A;  3S1N H;  2OQ0 A;  4YIJ A;  4DV2 Q;  1SEB D;  2RA4 A;  5C44 H;  2N49 A;  2B3G A;  3STB D;  1X32 A;  2SNM A;  4BXX G;  3T51 B;  3D0F A;  3S15 B;  4DAM A;  1H95 A;  4P75 A;  3MA2 B;  4A3B H;  3ERQ A;  2O2L D;  2SDF A;  2JN4 A;  2XIW A;  5HY6 A;  4C3I B;  1PVO A;  3LWE A;  1KDA A;  1C4Q A;  1GXD C;  1XTC D;  1JQY D;  3IL8 A;  3E3X A;  3HOU B;  3EQL C;  3TDQ A;  4OL7 A;  5M5Y H;  4HJ5 A;  3GTL H;  3SK4 A;  4ZLT F;  1B8A A;  2PZW A;  2RDF A;  1TKW B;  4BBR G;  3S1M B;  3BG3 A;  2CHB D;  4QIW B;  5LMU L;  1U4L A;  3OW7 A;  1K0R A;  3HOU H;  5EBD A;  4IOC A;  1JOR A;  1XNQ Q;  3K8A A;  1SR3 A;  2A74 C;  5EPK A;  3CHB D;  3KDF A;  5LMN L;  3ND9 A;  4EQN A;  1IYU A;  2BOS A;  1BBX C;  2EYJ A;  1RTO A;  5ELE A;  1SYD A;  4A3E G;  4LF4 L;  1XYI A;  1VQ9 A;  3U9O A;  3PIP A;  4DV0 Q;  2XWJ B;  1X65 A;  4AH6 A;  1YNN D;  4BY7 B;  3L3O C;  1B53 A;  2Y0S B;  1JOQ A;  5JJI A;  2PCF B;  4AYB B;  4RHS A;  3VR2 A;  4LF7 Q;  2X6G A;  2QDB A;  3I7F A;  5DM6 3;  4R4T A;  3HFZ B;  5T1G A;  4EQO A;  5I6Y A;  1EY4 A;  1A6X A;  3J7A V;  3MXN A;  1VQE A;  3JAM c;  4LF9 Q;  4OX9 L;  4EX5 A;  1AEX A;  3N6R A;  3KLW A;  3VYT A;  3BS1 A;  5GRO A;  3CD6 A;  4LF6 L;  4C3H B;  1V9P A;  4IPG A;  1Q3L A;  2YTX A;  1T5E A;  4OO1 H;  1SE2 A;  4R4Q A;  1LAC A;  1NY4 A;  2VQE L;  4AIM A;  5CR3 A;  1H9M A;  1ZEQ X;  1UAP A;  4X3S A;  4FXG C;  2RVL A;  1SYF A;  5KGU A;  2IX1 A;  2L55 A;  3PUX A;  4CJ2 C;  4G7H C;  2AKW B;  3I4L A;  1FL0 A;  1PH8 A;  4X64 L;  2B39 A;  1EL0 A;  1KXL A;  3BDL A;  3SR1 A;  2LKV A;  5IYD G;  1JT8 A;  4GN3 B;  1H9S A;  3G4S A;  4ID6 A;  1HTL D;  1VQC A;  2DGY A;  1XJV A;  5I2Y A;  1AN8 A;  1YVC A;  3MXN B;  3Q22 A;  1P8L A;  1SYG A;  4BS9 A;  3PSI A;  1STY A;  4JOI A;  4XXE A;  3CCM A;  2RDH A;  5M3F B;  3E9H A;  4LK1 C;  2ZJQ A;  2JA7 G;  4ME5 A;  2NVT H;  1LV9 A;  3I70 A;  4TSS A;  2NVX B;  3PV0 A;  1HA6 A;  1ET6 A;  4X65 Q;  4LFB L;  2JP1 A;  3A8I E;  1WTR A;  2KHJ A;  4HMJ A;  2G9H D;  1RL2 A;  5IYD H;  2A73 B;  3BDO A;  4IFD H;  1WCM G;  1VCI A;  3HOV H;  2P5Z X;  2BH8 A;  1HJP A;  1B7Y B;  5M9O A;  2A6E D;  2B2U A;  4LWC A;  1RTN A;  2VZA A;  1JE4 A;  3H6M A;  3HOW B;  3P7J A;  1XMO Q;  4OO1 I;  3I4M G;  4C3J H;  3PO3 B;  1OXT A;  1SJH D;  3KF6 A;  3M7N A;  3EVQ A;  2RDG A;  3PQI A;  2BA0 A;  3I4N G;  1EZ6 A;  4TQU S;  2NZH A;  1F9Q A;  5EKK A;  1SFO H;  4UAI A;  1HNX L;  3MTS A;  3RLO A;  1EWI A;  2L12 A;  4NXN L;  1NSN S;  3EA6 A;  1FGU A;  4KKU A;  5JAV A;  4ZKB B;  5E4W C;  4K14 A;  1E24 A;  3D6W A;  3SXH A;  4B3T L;  3EJI A;  3HG9 A;  2XRQ D;  5IT9 L;  1LAB A;  4XYO A;  4F8M A;  1O78 A;  2IW3 A;  1KDB A;  3T16 A;  2QA4 A;  3CAM A;  4A3K B;  1N36 Q;  2R93 G;  4QJF A;  2X6L A;  3S1M H;  1IL2 A;  1V1P B;  1YNJ C;  4DV0 L;  1F9R A;  1B9M A;  1PFB A;  1LTB D;  4MTN A;  2TMP A;  3LX0 A;  1B70 B;  2L9H A;  1JCK B;  2K7V A;  2R92 B;  3KF6 B;  2PO4 A;  5IGF A;  4A3B B;  1IHZ A;  4LF7 L;  2EE1 A;  3HOZ G;  5C3E B;  4UDU C;  3A5U A;  2VB2 X;  4RKB A;  5C5L A;  1WCM B;  2L1B A;  1HUM A;  1MSG A;  4PNY A;  4QUC A;  4ZK9 B;  4OX9 Q;  4X3T A;  1PFM A;  1PH5 A;  3JC6 6;  4B3S Q;  4DAY A;  2A6H D;  3CXC A;  1QCB D;  3L7Z C;  1YIT A;  1EYG A;  1JC7 A;  3CP0 A;  4JI4 L;  1XXG A;  3K7U C;  2Q8T A;  4DV7 Q;  4QL5 A;  4NKL A;  1WTV A;  5D65 A;  2E2D C;  4JI7 L;  1BKB A;  4FF1 A;  1N33 Q;  2F3W A;  1TWF H;  4A3E B;  1SMY D;  4KY7 A;  3MWY W;  3F1Z A;  1LTS D;  4JI3 Q;  1CKN B;  4CKB A;  1DYQ A;  1GHK A;  4JBK A;  2F52 A;  3GTM B;  1SNP A;  1SND A;  3CCU A;  2JA6 B;  2EY1 A;  1FGB D;  3BZK A;  3S16 H;  1WJJ A;  5A2Q L;  1RIP A;  1XPO A;  1PV4 A;  2K03 A;  3L0O A;  2LSS A;  2K5V A;  4IAL A;  3SHL A;  3T1H L;  3UDI A;  4I7Z C;  4FYD A;  1IW7 D;  4DR4 L;  2LS0 1;  2EVB A;  1TQO A;  4HCE A;  3NQT A;  4DXG A;  4OEL B;  3GD7 A;  4WOR A;  1K8G A;  4RA8 A;  1HR0 Q;  5L37 A;  2NWG A;  5IE8 A;  1I94 Q;  2BH2 A;  1DCZ A;  2PQA A;  3TP6 A;  4B9X A;  1UE1 A;  2DNE A;  4OWT B;  4IQZ A;  1PYS B;  1Q81 C;  1EY0 A;  1E7Z A;  1I50 B;  3U4Z A;  4RCN A;  1L0X B;  4RH6 A;  3CF5 A;  2FMC A;  4P2C B;  2PYK A;  2AUJ D;  4DR6 Q;  2ZXR A;  3D31 A;  2JA9 A;  1LT4 D;  2C9O A;  2SOB A;  1NR2 A;  1D2B A;  1SNQ A;  4A3L H;  3FRP B;  1Y8N B;  4BY7 G;  4ILW A;  1SNC A;  4NXN Q;  4EQ5 A;  2L15 A;  4UP8 A;  1WTH A;  3CME A;  2YTV A;  5DNF A;  1EWC A;  4JVZ A;  1JOO A;  5EBC A;  1PH6 A;  4KN4 C;  1EU3 A;  5LMN W;  3NPP A;  4MZ9 A;  4RGO S;  4X62 L;  3GTG B;  2YTY A;  1D5M C;  3K0X A;  4GN5 A;  3BZC A;  4BBS B;  1KDC A;  1WYD A;  1RD9 D;  1I3Q B;  1JJG A;  1BF4 A;  3CRL C;  1C8C A;  5BR8 Q;  2K75 A;  5E7N A;  1B3A A;  1ESF A;  2Z6K C;  4A3J H;  3D3R A;  4X6A H;  2D5D A;  3R93 A;  4JV5 Q;  1H9K A;  1Y1V H;  2F0N A;  1BR9 A;  2C35 B;  4IPH A;  1E2V A;  2F0F A;  1YHQ A;  1X3P A;  1W6K A;  3HOW G;  1G2T A;  4PZ6 A;  3CPW A;  3KLS X;  2XTI A;  2E2H B;  2MPM A;  3CQZ H;  1KHI A;  2KCM A;  3J81 L;  1ESR A; 
#chains in the Genus database with same CATH homology
 2KHS A;  1E0B A;  1D1K A;  2XN9 C;  4M8A A;  1ILQ A;  3WOE A;  3NQI A;  2EJF C;  1WTO A;  4QF4 A;  1D5X C;  1L0Y B;  3D8G A;  3K5N A;  1EYA A;  2HDL A;  3K7A B;  1H9J A;  1D5Z C;  3V2T A;  3HEJ A;  2E2J B;  2ZXP A;  2LMC B;  5KRU A;  4OHJ A;  4A3J B;  3TME A;  3T53 B;  2R6G A;  1SFO B;  4TRD A;  5CBA E;  1ZYR D;  2OEO A;  2J4X A;  1TWF B;  5EGT A;  2A6E C;  3SE0 A;  1PXU A;  1DON A;  2RQX A;  4NP5 A;  4QB4 A;  2SEB D;  3SK6 A;  3J80 E;  1OXV A;  5CV4 A;  2JXM B;  3I90 A;  2WII B;  5G3L D;  1CA5 A;  1E2Z A;  2F0U A;  1EYD A;  3MVV A;  2EYP A;  3Q24 A;  5C5M A;  3A7L A;  1QJO A;  5BN5 A;  4RCO A;  4A3M B;  3MFG A;  1ENF A;  1SNM A;  5A2Q E;  2F0O A;  4F88 A;  4CJ0 B;  2K6A A;  2G9D A;  2BE5 C;  1F2L A;  2FIN B;  3EFX D;  4FF3 A;  3SDZ A;  2CW0 C;  2F03 A;  2Z4H A;  4WFN 3;  1MGS A;  3VYS A;  2AWN A;  5KND A;  3LNN A;  2WKC A;  4IFD J;  5KYL A;  3M4Y A;  4PMB A;  3I91 A;  5T1I A;  3KBX A;  1JWS D;  2XNA C;  2NUC A;  2F0T A;  3M4O B;  1GUW A;  1IKL A;  2KUM A;  1R9T B;  4DAP A;  1F2Y A;  1GUT A;  4K8I A;  5C6A A;  4PMC A;  4BA2 I;  3U9S A;  1ONL A;  1TS5 A;  1I4Q A;  1Y1V B;  5IGG A;  3PIP 3;  3W3A A;  1DXM A;  2FFK B;  3GO5 A;  5J39 A;  1BDO A;  4E6I A;  1ML0 D;  2IL8 A;  4CJ1 B;  4N9T A;  2RSN A;  2WB1 B;  4K5W A;  4K5V A;  5KNB A;  1F2Z A;  4KV6 A;  2RBM A;  3IFD A;  3K5L A;  2HCC A;  5IT9 E;  1LT6 D;  3WOF A;  3GV6 A;  1A2T A;  3VA5 A;  1IL8 A;  3OMC A;  3MAQ A;  3DHQ A;  2K05 A;  4R8I A;  2KJX A;  1Q12 A;  2B2V C;  5LHY 1;  3P75 A;  1CHQ D;  3MEH A;  4ULL A;  5TSS A;  5K5P A;  1PTO D;  4DU9 A;  2V4D A;  1A3T A;  1S5D D;  3H09 A;  3K5O A;  4ZKC B;  4L63 B;  5FO7 B;  1XWE A;  4IUP A;  3W2D A;  4NW2 A;  1RDP D;  5CYU A;  2Q8R E;  2K1B A;  1JOK A;  2NN6 G;  5IGE A;  4H13 C;  1STN A;  2F0Q A;  1QWY A;  2LFN A;  4IUR A;  3BYT B;  3NHH A;  1ET9 A;  1HTP A;  1S5F D;  3OIP A;  1E2W A;  5E4X A;  4NMZ A;  1EY7 A;  2BE5 D;  4DK1 A;  3KF8 A;  1STE A;  1YNN C;  3TP7 A;  2PPB C;  2IWH A;  5G3L F;  5JVG 3;  4RKL A;  4B9W A;  1DZ1 A;  2E76 C;  1SE4 A;  2K04 A;  4C3J G;  3BDC A;  3S17 B;  5CC4 A;  2KCC A;  3SK5 A;  1FNW A;  1EY6 A;  3Q0A A;  1WTP A;  3RMH A;  4IFD G;  4EVO A;  2MGS A;  4PMW A;  5JJZ A;  5ISR A;  4FF2 A;  1GHJ A;  3Q23 A;  5JVH 3;  1SYB A;  2F0H A;  3E5S A;  1JWU D;  1HQM C;  4FO2 A;  1EIG A;  2IT1 A;  4N9P A;  3UI2 A;  2WAQ B;  2EJG C;  3NXW A;  3NWT A;  4BWG B;  3AMU A;  3C1F A;  3S16 B;  3DM1 A;  2DN8 A;  2O4X A;  5IGB A;  4CKE A;  4RGT A;  2F0K A;  5I9P A;  1UUP A;  1S5E D;  1A3U A;  2EYL A;  3OHX C;  2CQA A;  3A8K E;  1ZYR C;  4F87 A;  2VXW A;  4XQJ A;  1Z6H A;  1I4H A;  3NUC A;  1Y1W B;  3DWQ A;  1TS2 A;  1EQV A;  2ID0 A;  3P1H A;  5C4J B;  4C2M B;  1B50 A;  3R2I A;  1TR5 A;  5M5Y B;  2YYZ A;  3DEP A;  5KIX A;  1A3V A;  2NTS A;  2K5Q A;  2BDO A;  5FKA C;  3HKZ B;  3ITP A;  1MD2 D;  3TP8 A;  5C0X G;  4FF4 A;  1EIH A;  5FOB B;  3N52 A;  3NTH A;  2F0I A;  4H44 C;  1KNA A;  1A2U A;  1TY2 A;  1U4R A;  1STG A;  4C56 C;  2FJ2 A;  4DN4 M;  2I46 A;  2VUM B;  5CV7 A;  3J81 E;  4RFB A;  2EDG A;  1GOZ A;  5DM7 3;  5FO9 B;  2B2W A;  1PTO B;  1SBB B;  4MIU A;  1M8A A;  4J6H A;  1K83 B;  4LJZ C;  2K33 A;  3QOJ A;  4K6L A;  4WRD A;  3V96 A;  3QJY A;  1GUN A;  4ZUI A;  4K8J A;  1KLU D;  1STB A;  1O7L A;  1PMR A;  1Z7T A;  2DY7 A;  5KNC A;  4C3I G;  3DUZ A;  2K5W A;  2LY7 A;  1HHV A;  3GTJ B;  2XSC A;  1KAB A;  5FLX E;  1AZQ A;  5C0X I;  5HGT A;  1GUS A;  1EU4 A;  4FNF A;  2YU9 B;  1LTT D;  1G8Z D;  1PFN A;  3MXU A;  1CFM A;  1B2T A;  4C1N K;  1FYC A;  3RZD B;  2F0P A;  1LTR D;  1VMP A;  2JA7 B;  3TBI B;  3S1Q B;  1IW7 C;  1BO0 A;  2BA1 A;  3J7Y W;  2RKS A;  4HMI A;  4KD3 A;  1B4O A;  2A6H C;  3PO2 B;  4C3H G;  2JSO A;  1EFI D;  3OMG A;  3QB3 A;  1GUO A;  1IKM A;  1BCP F;  1OO9 B;  4K2K A;  3M7G A;  3PIO 3;  3S9W A;  1BQQ T;  2OF1 A;  4Z9C B;  3GTK B;  3S1R B;  3VA7 A;  3K57 A;  5CV6 A;  3A55 A;  1HPC A;  4KJN A;  2GA4 B;  3T56 B;  5FK9 C;  2IX0 A;  5M5W B;  3OSO A;  4C1N I;  5M3M B;  3C1E A;  1D1I A;  3QWN A;  1QOH A;  2AQ1 B;  5JEA J;  4L6T B;  4B08 A;  5LL6 X;  4XIG S;  3T13 A;  1Q1E A;  4FVM A;  2WAC A;  3TZD A;  4IZ8 A;  3GTQ B;  1ZKO A;  3BVZ A;  2NN6 H;  5BN3 A;  1LO5 D;  2C5C A;  4R9W A;  3E0J A;  1G2S A;  1TWC B;  5FO8 B;  1R4Q B;  1DOK A;  3O13 A;  5I6W A;  1PTO C;  1TS4 A;  2J0T D;  3J7A F;  1LTI D;  3AU7 A;  2OT2 A;  2JA8 B;  1TY0 A;  1WTQ A;  1PZJ D;  1OXX K;  4KKS A;  2FHT A;  3D4W A;  1O7Y A;  1SNO A;  4DNT B;  3C46 A;  3S2H B;  4KMU C;  1I6V C;  2J7Z A;  1IYV A;  2WIN B;  1EOT A;  3KBG A;  2PMZ B;  5EKI A;  4KD4 A;  1MI2 A;  4GZY C;  2B2W C;  5IGD A;  5DAU A;  3I72 A;  4FXK C;  2FMM A;  1ESR A;  1LT5 D;  3IKJ A;  2ICE C;  3X3M A;  2OXP A;  2MHV A;  1EYC A;  1Z47 A;  2HQE A;  1UNS A;  5D14 A;  2B2T C;  3PUW A;  1S5B D;  3CU7 A;  3F2U A;  2NB0 A;  1S4Z A;  2QKI C;  1JB3 A;  1EWH A;  3KUP A;  1GJX A;  1EY9 A;  1AZP A;  5NUC A;  3ZYY X;  4DK0 A;  2D62 A;  1CHP D;  4H7B A;  4XT3 B;  2Z4I A;  2L5T A;  1STA A;  1DJR D;  4QUF A;  1ZXT A;  3K0Y A;  2F0D A;  3IFT A;  2F0M A;  3ERO A;  2E75 C;  1PDQ A;  1Q90 A;  2EZV A;  1H9R A;  2R7Z B;  1G6Z A;  4BY1 B;  4TKO B;  1J8I A;  4L8J A;  5EKL A;  1ILP A;  4CBV A;  3G7L A;  3MXG A;  5M5X B;  4XDX A;  5J1Z A;  3VR3 A;  3HGB A;  1II3 A;  1I6H B;  2QIL A;  4XT1 B;  3GTP B;  1B44 D;  2JE6 I;  1KTK A;  3DMU A;  1SYE A;  2F0L A;  4ZAI A;  4DXF A;  3NBH A;  3T4A C;  2Q8I B;  1VF7 A;  2A69 C;  1CA6 A;  4HR7 B;  5IOD A;  4K5X A;  2WKD A;  2VNU D;  4DGZ A;  4F7X A;  1RCV D;  1I4R A;  4NDX A;  3CRK C;  2F0W A;  2R3Z A;  1JIC A;  1X3Q A;  5EQ0 A;  4KK7 A;  1GUG A;  1I4P A;  3BYY B;  1O80 A;  4IUQ A;  2B2V A;  3NTI A;  2F1M A;  2I07 B;  1V43 A;  1LLR D;  2D9U A;  1U4M A;  1F77 A;  3VYR A;  1SAP A;  2L11 A;  3HOV B;  2PQE A;  4G7Z C;  3J80 L;  2PZU A;  5E1F A;  1WTW A;  5J22 A;  1CM9 A;  1PRT B;  4IN3 A;  4V19 0;  4M1U B;  5CV9 A;  2EPB A;  1TWG B;  1EY5 A;  4EGV A;  1YNJ D;  5KYI A;  3IAY A;  1B1Z A;  2H1E A;  2K01 A;  5CMD A;  4IUV A;  3M85 A;  2L4N A;  1KLG D;  2PW7 A;  2BDN A;  5LL6 S;  1TII D;  2QEJ C;  1CT1 D;  2EY6 A;  4XQQ A;  4KY5 A;  1I4X A;  3FDT A;  3JAM L;  5BN4 A;  1PRT D;  2DNC A;  5C3X A;  5CV5 A;  4KJO A;  4HSP A;  2CVR A;  3QOL A;  3S2D B;  2EYH A;  2R93 B;  5CBE E;  3OOC A;  2IPK D;  3MC0 B;  3AB9 A;  4CHT B;  2KED A;  2WV6 D;  1W6J A;  1T5X D;  3H91 A;  3NWS A;  1CTM A;  3H94 A;  3I4N B;  3K58 A;  4HTH A;  1CZW A;  3HOX B;  2NVQ B;  4RHR A;  4RGN A;  4IUN A;  3M3Y B;  1HFN A;  1VF5 C;  3NBI A;  1PYW D;  4OO1 G;  5COR A;  2K28 A;  2AQ3 B;  3ONA B;  3SEB A;  2BCO A;  3HP3 A;  4S3S A;  4O1N A;  1R4P B;  4HN7 A;  2AWO A;  4I65 A;  4BA1 I;  1WD0 A;  5C3W A;  3L9A X;  3D4D A;  1F9P A;  5EPJ A;  2TSS A;  3URY A;  2A69 D;  2A68 D;  5IGC A;  3Q6S A;  4G7O C;  5D3D A;  1QB5 D;  1RJT A;  2O5J C;  1Y8O B;  2E2I B;  2Z8L A;  2MUY A;  3BZD B;  3VYU A;  2B2U C;  2KVM A;  5A35 A;  1UEA B;  1ICW A;  4IUU A;  2DY8 A;  3GV3 A;  3C2P A;  3HOZ B;  4KHV A;  2KQ3 A;  5ELF A;  3RZO B;  1FNU A;  3A54 A;  3KK7 A;  5I9O A;  1TWH B;  4FP5 D;  1BUV T;  2F4I A;  3GTL B;  4RWS C;  2JA5 B;  1HA5 A;  1EEI D;  1ENC A;  4XTC S;  3VR4 A;  1Q8I A;  1JWM D;  1A15 A;  3DXJ C;  3X3N A;  5K36 H;  3K5M A;  5KEE A;  1AW7 A;  3OIQ A;  1RF2 D;  4IFD I;  1BCP C;  2H4O A;  3TN2 A;  1F9S A;  4O42 A;  5C4H A;  3GQB A;  4KTA A;  3QG1 A;  2F0J A;  5D3I B;  5I2X A;  2N55 A;  3PUY A;  3GTO B;  5E3F A;  1DD2 A;  3VR6 A;  3R2T A;  1M4V A;  2EY2 A;  2PW5 A;  5C44 B;  5ELB A;  2F3V A;  1U9R A;  2KOL A;  1OXS C;  3DEO A;  4BBR B;  3MHB A;  2E74 C;  1TS3 A;  4HAE A;  1Y8P B;  1FR3 A;  1SMY C;  4KN7 C;  2NBF A;  2EOT A;  3E6Z X;  3K6O A;  3PUZ A;  1WVL A;  2HCI A;  3S1N B;  1AP0 A;  3GP7 A;  3NSW A;  3HOY B;  1QE6 A;  3H3V C;  1BNZ A;  4ZQ3 A;  2K5D A;  5JOB A;  1PTO F;  3H0G B;  2M00 A;  3FVQ A;  4MN3 A;  4X3U A;  3P20 A;  1VDZ A;  1TU2 B;  1VMC A;  2KEE A;  1AFP A;  1EQT A;  3S14 B;  2PZT A;  3FKI B;  5JPM C;  2QCP X;  4QMG A;  3BVM A;  3ND8 A;  4H0L C;  3HRZ C;  4A3G B;  4JBW A;  2B2T A;  1Y69 U;  1ROD A;  2CW0 D;  5K36 G;  1V1O A;  2B8G A;  3V05 A;  1JR0 D;  3NTK A;  3RLF A;  4FXD A;  4HED A;  3TSS A;  4A3I B;  2B2Y A;  4R8N A;  1DOL A;  1WTX A;  2XRS D;  1V1P A;  2K32 A;  2B63 B;  2XWB B;  4Q0F A;  3KLR A;  1ENA A;  4PQX A;  4PV1 C;  3NK9 A;  2KCN A;  3RUZ A;  3G6J B;  5HUR A;  3RD4 A;  5ELC A;  1DM0 B;  1EY8 A;  2F0G A;  1KAA A;  2KEC A;  1BXT A;  3FPP A;  3D6C A;  1KNE A;  2F0E A;  2B2Y C;  1QNK A;  2A68 C;  3D4R A;  3FPU B;  1Q1B A;  1CK1 A;  4Q5V A;  1HCZ A;  3NE5 B;  4RGM A;  4XYQ A;  2QF7 A;  1S5C D;  1HRJ A;  4OIJ A;  3K59 A;  4OGQ C;  1BCP B;  2HUG A;  3I4M B;  5F2D A;  1LTG D;  1CI3 M;  4MHE A;  2EYO A;  2HDM A;  4V0B A;  1CQF A;  3VR5 A;  1OXU A;  2NVT B;  1PLF A;  1G29 1;  2NVY B;  4HSV A;  1HUN A;  4QCL A;  3QIA A;  4J1M A;  2EY5 A;  2A5H A;  2JEB I;  4WJW A;  1EEF D;  1CQV A;  2AQ2 B;  2MJ8 A;  3JAM E;  5I4D A;  1BCP D;  2MP1 A;  3I73 A;  2RSO A;  3MZ5 A;  1V8Q A;  1G91 A;  1HFG A;  1PRT F;  3FEW X;  1LTA D;  3FMC A;  4DF7 A;  4X3K A;  5CV8 A;  1NCV A;  1BOS A;  2JYO A;  2JEA I;  1TVX A;  1SYC A;  3TZU A;  2SNS A;  3PUV A;  2EYM A;  3TP5 A;  2F0S A;  1D6E C;  3R8B A;  3BVG A;  1DOM A;  4ZYS A;  2R61 A;  2IJ0 A;  5C0X H;  1SSO A;  3WDN A;  3HS0 C;  4CGY B;  1SE3 A;  3KLS A;  4ABN A;  4JK1 C;  1K8M A;  1PTO H;  1TT2 A;  1SDF A;  2D2C C;  1RKN A;  1QNU A;  5C0X J;  3OWF A;  4ZUJ A;  4A93 B;  3A56 A;  2N88 A;  1NAP A;  3A8J E;  5CGK A;  5EJW A;  3OWE B;  2WP8 J;  2ZT9 C;  5EPL A;  2IX3 A;  1F2M A;  1LT3 D;  2EJM A;  3DWA A;  5IIF A;  3R3O A;  2B8F A;  2O5I C;  3QO2 A;  1C48 A;  5FLX L;  4CKC A;  5ELD A;  2XVS A;  4IUT A;  2L0C A;  5COY A;  3LWU A;  1O7Z A;  5C4Z A;  4RAU C;  4HCS A;  1MBY A;  2AUK A;  3MXP A;  2VB3 X;  4OIK A;  3PMF A;  5C4X B;  4U67 3;  1PRT C;  4Y7N B;  2Z1C A;  4ODG A;  2ICI A;  1STH A;  1HXY D;  5JEA G;  4DNR B;  2EXZ A;  3I3C A;  4C3J B;  2ZXO A;  4XQN A;  1FD7 D;  4DFA A;  1SJE D;  4K2L A;  5AFW A;  1MSH A;  1PZK D;  4KKT A;  1CZG A;  2PNR C;  1H9S B;  1QIL A;  1EZ8 A;  2NN6 I;  1XX8 A;  4K6D A;  4J8Q A;  3OPO A;  1RHP A;  4G4K A;  2M9V A;  1NR4 A;  3A7A B;  5IOC A;  4KHZ A;  1J9O A;  3CKI B;  1TWA B;  4ZRZ A;  1U4P A;  2F0V A;  2X69 A;  3CQZ B;  2KA7 A;  3NP8 A;  3SVM A;  5JPN C;  1I4G A;  4KY6 A;  1K8O A;  4U68 A;  4A3F B;  5DEH A;  4KI0 A;  3MFY A;  2ENB A;  1WD1 A;  1SXT A;  3DWP A;  4LAA A;  5JEA H;  4DA2 A;  3HZX A;  3SK8 A;  1HQR D;  2NYZ D;  4LMQ D;  1PZI D;  4G57 A;  2M2L A;  4EQP A;  1NUC A;  1FNV A;  3I8Z A;  2NTT A;  4A3D B;  1B9N A;  1QG7 A;  4DAV A;  2NZ1 D;  3C3L A;  2EYF A;  4YIJ A;  1SEB D;  2RA4 A;  1X32 A;  2SNM A;  3T51 B;  3S15 B;  3MA2 B;  3ERQ A;  2O2L D;  2SDF A;  2XIW A;  4C3I B;  3LWE A;  1KDA A;  1C4Q A;  1GXD C;  1XTC D;  1JQY D;  3IL8 A;  3HOU B;  3EQL C;  3TDQ A;  4OL7 A;  3SK4 A;  4ZLT F;  2PZW A;  2RDF A;  1TKW B;  3S1M B;  3BG3 A;  2CHB D;  1U4L A;  3OW7 A;  5EBD A;  1JOR A;  2A74 C;  5EPK A;  3CHB D;  3ND9 A;  4EQN A;  1IYU A;  2BOS A;  1BBX C;  2EYJ A;  1RTO A;  5ELE A;  1SYD A;  1XYI A;  3U9O A;  2XWJ B;  1YNN D;  4BY7 B;  3L3O C;  1B53 A;  2Y0S B;  1JOQ A;  2PCF B;  4AYB B;  4RHS A;  3VR2 A;  2X6G A;  2QDB A;  5DM6 3;  5T1G A;  4EQO A;  5I6Y A;  1EY4 A;  1A6X A;  3J7A V;  3MXN A;  1AEX A;  3N6R A;  3VYT A;  3BS1 A;  4C3H B;  1Q3L A;  1T5E A;  4OO1 H;  1SE2 A;  1LAC A;  5CR3 A;  1H9M A;  1ZEQ X;  1UAP A;  4X3S A;  4FXG C;  2RVL A;  1SYF A;  5KGU A;  2IX1 A;  2L55 A;  3PUX A;  4CJ2 C;  4G7H C;  3I4L A;  1EL0 A;  2B39 A;  3BDL A;  3SR1 A;  2LKV A;  1H9S A;  4ID6 A;  1HTL D;  5I2Y A;  1AN8 A;  3Q22 A;  1SYG A;  4BS9 A;  4XXE A;  1STY A;  2RDH A;  5M3F B;  4LK1 C;  4ME5 A;  1LV9 A;  3I70 A;  4TSS A;  2NVX B;  3PV0 A;  1HA6 A;  1ET6 A;  2JP1 A;  3A8I E;  1WTR A;  4HMJ A;  2G9H D;  2A73 B;  3BDO A;  4IFD H;  1VCI A;  5M9O A;  2A6E D;  2B2U A;  1RTN A;  1JE4 A;  3H6M A;  3HOW B;  3P7J A;  4OO1 I;  3PO3 B;  1OXT A;  1SJH D;  3M7N A;  3EVQ A;  2RDG A;  2BA0 A;  1EZ6 A;  4TQU S;  1F9Q A;  5EKK A;  4UAI A;  3MTS A;  2L12 A;  1NSN S;  3EA6 A;  4KKU A;  5JAV A;  4ZKB B;  5E4W C;  4K14 A;  3D6W A;  3SXH A;  3EJI A;  3HG9 A;  2XRQ D;  5IT9 L;  1LAB A;  4XYO A;  4F8M A;  1O78 A;  2IW3 A;  1KDB A;  3T16 A;  4A3K B;  2X6L A;  1V1P B;  1YNJ C;  1F9R A;  1B9M A;  1PFB A;  1LTB D;  2TMP A;  3LX0 A;  2L9H A;  1JCK B;  2K7V A;  2R92 B;  5IGF A;  2PO4 A;  4A3B B;  1IHZ A;  2EE1 A;  5C3E B;  4UDU C;  2VB2 X;  4RKB A;  5C5L A;  1WCM B;  2L1B A;  1HUM A;  1MSG A;  4PNY A;  4QUC A;  4ZK9 B;  4X3T A;  1PFM A;  4DAY A;  2A6H D;  1QCB D;  3L7Z C;  1JC7 A;  1XXG A;  2Q8T A;  4NKL A;  1WTV A;  5D65 A;  2E2D C;  4FF1 A;  2F3W A;  4A3E B;  1SMY D;  4KY7 A;  3MWY W;  1LTS D;  4CKB A;  1DYQ A;  1GHK A;  3GTM B;  1SNP A;  1SND A;  2JA6 B;  2EY1 A;  1FGB D;  5A2Q L;  2K03 A;  4IAL A;  3SHL A;  4I7Z C;  4FYD A;  1IW7 D;  2LS0 1;  2EVB A;  1TQO A;  4HCE A;  3NQT A;  4DXG A;  3GD7 A;  4WOR A;  4RA8 A;  2NWG A;  1DCZ A;  3TP6 A;  4B9X A;  2DNE A;  4IQZ A;  1EY0 A;  1I50 B;  4RCN A;  1L0X B;  4RH6 A;  2FMC A;  4P2C B;  2PYK A;  2AUJ D;  2ZXR A;  3D31 A;  1LT4 D;  2C9O A;  2SOB A;  1NR2 A;  1D2B A;  1SNQ A;  3FRP B;  1Y8N B;  4ILW A;  1SNC A;  5DNF A;  1EWC A;  1JOO A;  5EBC A;  4KN4 C;  1EU3 A;  3NPP A;  4RGO S;  3GTG B;  1D5M C;  4BBS B;  1KDC A;  1RD9 D;  1I3Q B;  1BF4 A;  3CRL C;  1C8C A;  1B3A A;  1ESF A;  3D3R A;  2D5D A;  3R93 A;  1H9K A;  2F0N A;  1BR9 A;  1E2V A;  2F0F A;  1G2T A;  1X3P A;  1W6K A;  3KLS X;  2E2H B;  2MPM A;  3J81 L;  4QIW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...