1XTCD

Cholera toxin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPSSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCTWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CHOLERA TOXIN
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xtcD00
1RD9D 1CHQD 1JR0D 1UNSA 1EU3A 1LTID 1PTOF 5TSSA 4C56C 1FNUA 1HTLD 1XXGA 1B44D 1EWCA 1TS4A 5D3IB 1PRTD 1BCPF 1HA5A 1PZJD 1M4VA 4UDUC 4L63B 2O2LD 2ICIA 1LTAD 5I4DA 1D5XC 1LTBD 1D5MC 1KLGD 1S5ED 1S5CD 2AQ1B 2RDGA 3DWAA 1JWSD 1I4GA 3OWEB 1CT1D 1LTRD 3BYTB 1SE2A 4L6TB 3V05A 4DXFA 5ELCA 1S5FD 1HQRD 1EU4A 1PZID 3R2TA 1SE3A 2TSSA 2Z8LA 4RHRA 1LTGD 1V1PA 4RGTA 3BZDB 1BXTA 1SEBD 1LTSD 4TSSA 4RH6A 4RCOA 1ENFA 1ESFA 1EEID 3BVZA 1G8ZD 1D5ZC 1I4QA 2XNAC 3BYYB 1FD7D 1FNVA 3BVMA 1LT3D 1PYWD 1SXTA 1UUPA 2QILA 3TSSA 1LT6D 1DYQA 1TS5A 1PRTC 4K6LA 1SBBB 3CHBD 5FK9C 1ET9A 1PZKD 1RCVD 1T5XD 1LO5D 2IJ0A 1B1ZA 1KTKA 3KLSX 5FKAC 3W2DA 5D3DA 4ZYSA 1SE4A 1I4RA 1LLRD 1PTOB 1TY2A 2AQ2B 3R8BA 4RGOS 1TY0A 1AW7A 1V1OA 1LT4D 4RGMA 1TS2A 1BCPB 1I4XA 1CQVA 4RGNA 5ELFA 3EFXD 4DXGA 1PRTF 1F77A 1KLUD 1LT5D 1XTCD 4RFBA 1LTTD 1S5DD 1RF2D 2R61A 2XRQD 2WV6D 3SEBA 1I4PA 4O1NA 1QILA 1S5BD 3MC0B 4Z9CB 1JQYD 1L0XB 1EFID 2CHBD 1SJHD 5ELBA 3O13A 1SJED 1HXYD 3EA6A 2G9HD 3DWPA 1L0YB 1EEFD 1STEA 5ELEA 1AN8A 1GOZA 1PTOD 3URYA 4OHJA 1CK1A 3MFGA 1CHPD 2RDHA 1BCPD 2AQ3B 1D6EC 1FNWA 1I4HA 2J4XA 2XRSD 3GP7A 1PRTB 5ELDA 2SEBD 3BVGA 1PTOC 4RHSA 1FGBD 1JWMD 2NTTA 1BCPC 1JCKB 3R2IA 2IPKD 2QEJC 1RDPD 1DJRD 1MD2D 2NTSA 1PTOH 1V1PB 3DWQA 2XN9C 1JWUD 1ET6A 4BWGB 1TS3A
chains in the Genus database with same CATH superfamily
3IKJA 1CHQD 1B7YB 2JA5B 1Y1VB 4XYOA 4POFA 3BU2A 5FOBB 1K8GA 3AFQA 1RJTA 2BH2A 2R6GA 2Z4IA 1CKNB 3I7FA 1R9TH 3S1MB 1S5ED 4QIWE 3S17H 1JOQA 2L11A 4OL7A 4KN4C 4OWXB 3A5UA 1K8OA 4LF8Q 2VS1A 5J3BA 2HD3A 1EU4A 4A3FG 2LS01 4RHRA 1LTGD 2K5DA 3WOEA 1S3OA 1Y1WG 2CQOA 4LF9Q 2Z9HA 2JEAI 2BOSA 3A74A 4BBRH 4RCNA 1I3QB 4LUVA 3VR2A 3NTIA 1J5EQ 1NR4A 1VQAA 4K0KQ 2DNEA 1CZGA 3D4RA 2DJFC 4DUZQ 4DR1Q 1BBUA 1II3A 1PH9A 1VQ4A 1JE4A 4CGYB 2LKVA 2VXWA 1LUZA 4H02A 4Y7NH 3N6RA 1K3BC 2GVBA 3BDOA 4NXMQ 2PO4A 4YWKA 1Y8PB 2K4KA 2EY2A 3D6CA 3PIPA 1LT4D 1VQFA 1BCPB 1DXMA 1NCVA 5LHY1 1A15A 4JCVE 4J8QA 1G6ZA 2WV6D 3I4NB 2IX1A 3AMUA 5KNDA 1GVPA 2EQSA 5JPMC 2WIIB 4DR5Q 4YWLA 3ITPA 1EWHA 2CHBD 2E74C 3T56B 2A69C 1YHAA 1MGSA 1B70B 5GQOA 2WINB 5EPKA 4EGVA 3W1GA 3RZOH 4OHJA 4MNOA 5L37A 2B2WA 2WKCA 2JA8G 1BCPD 2PZTA 3GP7A 4R4QA 4CJ2C 1RTNA 3TZDA 1XJVA 1PFSA 4DR2Q 4G7OC 2F0IA 1WCMG 2EOTA 1K3RA 3K6OA 2EZVA 2ZJQA 1K83H 4R4TA 3IAYA 4JI7L 4I65A 2SNSA 5CV8A 4V190 1RD9D 1JR0D 1X6OA 3KLRA 3S16H 4G57A 1UNSA 2K03A 4GKKL 1LTID 2FINB 4C3IH 1NMGA 2ZT9C 5BR8Q 2UUAQ 1A3VA 3KJPA 3KDFB 4BS9A 1FJGL 1W2BA 2L4NA 2WACA 1DM0B 2O2LD 2VUMB 2A68D 2Q2HA 4UAIA 2R93H 1KLGD 1Q1BA 1EZ8A 4UHVA 2L55A 3V96A 2K7VA 4XXEA 2WB1G 1JORA 1BUVT 3OWEB 4ZUIA 4HEDA 4CDDC 2BA0A 2MQHA 4OXPA 4GNXC 2F0LA 2EXZA 5FO7B 4JBMA 5C3EB 4DV5Q 3ICEA 4LUOA 2WB1E 2ZXPA 1EQQA 3S15B 2JJQA 4CKEA 4HCSA 3TSSA 1HNXQ 1F9PA 3KDFA 1PRTC 4IFDJ 3HOUH 1PVOA 3FKIB 2IHEA 2KCMA 1W6KA 1JC7A 2OCEA 2IJ0A 1PH1A 1B1ZA 2B63G 4X64Q 1LLRD 1D1IA 1FYCA 1TY0A 4B3MQ 1ASYA 2OQ0A 4FNFA 3S1QH 1YNJD 2ALYB 2NB0A 1HPCA 4K2KA 1I94L 2Y0SB 4PMBA 2R61A 4DR3Q 4DR6L 1IYVA 2VZAA 2B39A 3M7GA 4LFCQ 1SYGA 1TWHH 3T1HL 4PG3A 3RMHA 2CKZB 4L5RC 2EPBA 4C3HG 4JI0L 2KA7A 1IL2A 4A3DH 5EPLA 1LABA 3OTOQ 1JOKA 3L9AX 2AQ3B 1GD7A 3I4MB 1I4HA 1WTHA 4DAYB 1F9QA 4A3JH 3GTGB 3B6YA 4A3BG 1C48A 1KNEA 3KYHC 1C8CA 3K0YA 2PPBC 1IW7C 4KD3A 4LUZA 5FJ8G 4OIKA 1JWUD 1FVIA 1KNAA 5AFWA 1YBYA 3RLNA 3GTLB 1QNKA 2Y0SE 3RR5A 2YU9B 3DXJC 3T1YL 4C56C 4DR4Q 2Q2TA 1PA6A 1L1OB 5C0XI 3A7LA 1HA5A 1B53A 5M3MG 4L63B 3MZ5A 4A3EB 2PQAB 2DUDA 4OEMB 1D5MC 1XNQQ 4B3TQ 4KTAA 4DAYA 3M4YA 2ZXRA 1SR3A 5LMNQ 4DFAA 3HOZG 5C44H 1ZEQX 3Q23A 2MUYA 2N78A 1MIUA 1SLJA 2ZXOA 4QGUA 3LWEA 3PUZA 5KRUA 3I8ZA 1D1KA 5JAVA 3H3VC 3GTJB 1KDBA 3STBC 5C4XB 1O7LA 5FLXE 1CA6A 4TSSA 4IOAA 2BDNA 1JB3A 3P7JA 2GN5A 1EIGA 5COYA 4KHPQ 1N32L 3E5SA 2YV5A 2ZM6L 2F0TA 3P1HA 4BA2I 2UXCQ 1L1OA 1H9SB 4Q0FA 4GOPC 5CV9A 1TS5A 4KJOA 4BY1B 3F2BA 2JA5H 5A2QL 4A3FH 1U4RA 2ICEC 2PQAA 1EIYB 5BN4A 2E5LL 4RKBA 3H0GB 2D5DA 3E0EA 4QL5A 3S1MH 1V1OA 4WORA 4NPSA 1EFWA 1KAWA 1CQVA 3CPWA 5IP9G 4LFAL 4OO1H 2MHVA 4HJAA 1NJIC 5JVH3 1D7QA 2UUBL 1SE8A 2GA4B 4HIMA 1VQPA 3M4OB 2MNAA 1S40A 2F3WA 2JP1A 3NXWA 1EYAA 2JQOA 2F0QA 2JA9A 1KL9A 5I2YA 1H9SA 4F7XA 5KIXA 1HUNA 4GLVB 3K59A 3PUXA 1HR0Q 3HFZB 3SDZA 4JI6L 4LF5Q 2XTIA 4PQXA 4NB3A 1Q12A 2FJ2A 2UXDL 3M7NA 1PRTB 3OMGA 5CORA 1PTOC 1E22A 5C6AA 1BO0A 4BA1I 4A3IB 4P73A 2QA4A 4IJHA 2QDBA 1MD2D 1IYUA 1X3EA 1TWCH 1ET6A 5LMUQ 3G7LA 3HOWB 2LXJA 3S17B 2UXBL 4B3RL 1LM0A 1V9PA 4P75A 3I4NH 3I72A 4A3MG 4UY8C 1IBLL 1B44D 5DM73 2JK8A 1PRTD 4MTKA 2G5DA 3AB9A 1E0BA 2Q2UA 2L5TA 3RD4A 2LSSA 4JYAQ 3A8IE 4X3SA 2E76C 2ENBA 2VQFQ 5IIFA 2UUCQ 3NTKA 5EJWA 1Q1EA 2OTLA 1EL0A 4ILWA 1WTPA 3N52A 1SYBA 3R2TA 4PZ6A 1SE3A 1QWYA 4OELB 1EOTA 2Z8LA 1GM5A 2Z1CA 3NPPA 3U50C 3L2PA 4X3TA 3HOVB 1JOOA 1N36Q 2CWPA 3JAME 2WKDA 5DM63 4Y7NB 2QILA 4MHEA 3I90A 2B2UA 3HOXG 2R92G 1PH8A 1RODA 1HNWL 5J1ZA 1R4PB 4OGQC 3D4WA 2NWGA 3PO2G 3MEFA 5GROA 4DR7L 3ONAB 3KF6B 2NVXB 1GUTA 4OWTB 4UPAA 2K5QA 2N3SA 1VDZA 1IW7D 5IY0A 2IL8A 4L8JA 5CR3A 4ID6A 1S5DD 1B3QA 2KBNA 5KNCA 1HA6A 4IUTA 4IPGA 3O13A 3VA5A 3GO5A 1U5KA 2MPMA 1HXYD 2R3ZA 4FF3A 4JOIC 4LMQD 3BG3A 3K8AA 5C3EH 1YHBA 3S14B 4DUYQ 2FXQA 2ZTEA 4MIUA 1PH6A 2RDHA 3NELA 1PH2A 3NQTA 1XMOQ 4K5XA 2JYOA 1ZKOA 3TMEA 3QOJA 1VQDA 3S16B 2F0EA 1H9RA 4DR6Q 3KF6A 1TXYA 3HG9A 4K8JA 4P74A 2KHSA 4DV7L 1Q7YC 1CI3M 3EROA 1V1PB 4JBKA 2VB2X 3CCEA 2B3GA 4BWGB 4BY7B 4JI0Q 2K52A 1YHQA 1JICA 3D3RA 3AQQA 1WTQA 4GKJL 2CW0C 5H1SE 1TS4A 5D3IB 2EYHA 4DNIA 3S2DB 4IUPA 3LX0A 2ICIA 4APVA 4KY5A 3EBEA 1Z6HA 3CC4A 2K14A 2UU9L 2RDGA 3E9IA 5BN3A 2I5MX 4X62Q 4IPDA 2RF4A 4JI8L 2LMCB 5JEAH 4JI1L 4BY7G 5CC4A 2A74C 4JI5Q 4LF4Q 1H9JA 1AP0A 5M3MH 3T1YQ 1EQTA 2K5VA 4A93B 1V1PA 3CD6A 1YNNC 1ESFA 4JI2L 3W3AA 2EJGC 1FR3A 4IQZA 3EIVA 3FHWA 5IYCG 2L12A 3J80i 3C1FA 5K36H 3F2UA 3CW2C 3CHBD 2YU9H 1B50A 2WAQB 3E6ZX 3S1QB 3OPOA 2F03A 1VCIA 1RCVD 4C3JG 4DV4L 4GS3A 5HY6A 2FMCA 3PUWA 2L15A 3J7ZC 2A8VA 1KRTA 2NVTB 4A3EH 1TWHB 1F2LA 5FLMH 4IALA 2M9VA 2ZTCA 2HDMA 4RGOS 1SRUA 2KEEA 1P8LA 2NZ1D 2K5HA 2CCZA 4LNQA 1KABA 4HMIA 1N32Q 3T51B 1TWAB 3G48A 4IURA 3S24A 3UDFA 1G6PA 1S5BD 2EE1A 2JN4A 1L0XB 2NN6G 1B4OA 3GTJH 1U0LA 3K5OA 5C4XH 1EY9A 2HQEA 3OHXC 5KNBA 2E5LQ 5DNFA 4JI4Q 1SYFA 2AMCB 3TN2A 2B29A 3BJUA 1TWGH 3URYA 3FVQA 1Z7TA 2E2DC 1D6EC 2WAQE 4LFAQ 2VB3X 4FF4A 1VQ7A 3TP7A 2NVYB 2KCCA 4WJWA 5A35A 5CV7A 3H0GH 5HGQA 4OX9Q 1MJCA 3FEWX 2XN9C 2K33A 3BS1A 2R7ZG 3X3NA 4JBWA 3QO2A 2N8NA 4EQPA 1QVGA 4QIWB 4JI6Q 5KEEA 2V4DA 3IFTA 5TSSA 1IKMA 3M4OH 3MA2B 4S3SA 1PH4A 2F4VQ 2EYLA 2OEOA 2OQKA 3TP6A 1S4ZA 1JMCA 4GN4B 5IP7G 2DNCA 3CMEA 2MO1A 1HH2P 1I6VC 4YY3L 3Q22A 1W6JA 1BQQT 1SE2A 2KHIA 3SK6A 5ELCA 3TP8A 1MSGA 3U9SA 5JOBA 4A3FB 1F2ZA 1BXTA 3UI2A 1LTSD 1SMYC 3GTOB 2OWOA 4DV1L 3DHQA 1G291 3H09A 4P2CB 4A3IH 1ENFA 4FYDA 4RG1A 3RLOA 5LL6X 5IT9E 4B3SQ 4JV5L 1Y1WB 2BDOA 1QE6A 4DN4M 3CCVA 1N33L 3HOWH 1EY4A 3VR4A 4YIJA 2JE6I 4BXXG 4LFBL 1SE4A 2RSOA 1TVXA 3ULLA 1NY4A 2F0DA 2BA1A 2HDLA 5FLXc 1GXDC 1WYDA 1PRTF 4KKTA 1GJXA 1VF5C 4WRDA 3CCSA 3PO2H 1Z47A 3WOFA 5C5LA 1HNWQ 2JEBI 3KBGA 2BE5D 1SFOH 2F0GA 1ONLA 4PNYA 1CKNA 3EA6A 1QCBD 5HGTA 4LF6L 2G9HD 2B8FA 1CKMA 3K5MA 1HQMC 2F3IA 3HOVH 4DR7Q 5EAYA 2RCNA 2EXDA 2N88A 1TWCB 1FNWA 1DOKA 2JA8B 2KVMA 1T5EA 3TQYA 1L2FA 1SYEA 1VMCA 5AJ3Q 3J81E 5C4ZA 1DZ1A 3NHHA 1WCMB 3HKZG 2K04A 3CQZH 3MHBA 3EVQA 2NVXH 4DV2Q 2I5HA 2HQLA 1YNND 4YHHL 1TS3A 4HIKA 3H6MA 3TS2A 2K5WA 4IUUA 3PIO3 1IBML 4QB4A 1FNUA 4OO1I 2F0MA 3QG1A 1KQSA 4FF1A 1STAA 4A3CH 1U9RA 1J6QA 1O7IA 3FDTA 3OIPA 1TU2B 3Q0AA 2YYZA 3CCRA 1ILPA 1LTLA 3S14H 3S2HH 4RA8A 1ML0D 4DAMA 5GAGC 5C4HA 3K58A 1CT1D 1J8IA 2WB1B 2KECA 1S5FD 1GKHA 5JPNC 4KKSA 4DV6Q 2RQXA 1A8VA 1EUJA 2YTVA 1MI2A 4F8MA 1VQBA 4GKJQ 1SYDA 2MGSA 1R4QB 3BZDB 4G4KA 4JI3L 3PCOB 4RCOA 1OTCA 2L0CA 2Q8TA 2I07B 1BBXC 4ZUJA 3QJYA 1E24A 4WJ4A 1FNVA 2OF1A 4BY7H 3NQIA 2Z0SA 3K81C 5M5WB 3H94A 4N8X1 4NKLA 4JI1Q 1ICFB 2KUMA 2IX3A 2X69A 1NE3A 3KF8B 3S2DH 2B2TC 4DV0L 4FO2A 3W2DA 4DK3C 1HHVA 5M9OA 2B63B 3OWFA 2XWBB 5IYCH 1XPUA 1EY8A 3D8GA 3PUVA 4JW0A 1ENAA 1TS2A 5ELFA 4XYQA 4IFDH 1IZ6A 1F9RA 3JAMc 5CV6A 4Z9CB 1EFID 4A93H 2K5NA 2Z6BA 1PYBA 4P72A 3GTQB 5IGFA 3CCJA 2F0OA 4B9WA 2C35B 2RDFA 4KHZA 4QQBX 1VMPA 1PH3A 1M90C 5EKIA 4C3HB 3G6EA 1C7YA 1BF4A 3G6JB 3CCLA 3T4AC 4AQYQ 3D4DA 2EYPA 3VR6A 4LJZC 5IYBG 4A3BB 3J80E 5EKKA 3S1RH 2FMMA 1SROA 5CV4A 1WI5A 4DF7A 2H4OA 2QGQA 2NVTH 1TWFB 1WOCA 4XIGS 5FLXL 2KJXA 1SDFA 1SMYD 3GV3A 1VQLA 1X65A 1SNQA 1AEXA 4TQUS 4Y52H 4ZK9B 3A0JA 4ALPA 1EWIA 4XT3B 3AFPA 3NENA 1PH7A 4ME5A 1BOSA 3NBHB 1MBYA 3K80C 1EU3A 1TWAH 3SE0A 2MO0A 1W3SA 1PTOF 2A1AA 4GLXA 4F87A 4L5QA 4GN5A 2HHHQ 1C9OA 1PMRA 5E4WC 4DAVA 5IGGA 1QVFA 2F3VA 5M3MB 1KAAA 4X3UA 1EQVA 1S5CD 4X66Q 4DV3L 3DWAA 1VQJA 3ZYYX 2RCFA 5C0XG 1CTMA 1RIPA 4K5WA 4A76A 3HOZB 4DXFA 4L6TB 2VQEQ 4PV1C 3M4PA 1YJNA 4NXNL 2ZJRA 4FF2A 1X9NA 4NP5A 1DGSA 4LF7Q 2NVYH 1YJ9A 3E3XA 3M85A 2E2JB 4JC0A 4O2DA 3K7AH 3NBHA 4FVMA 1ZYRC 2M00A 2E2IH 2EY1A 2AUJD 3P20A 3VYUA 4X65Q 4O42A 3UE0A 3H91A 4HJ7A 3EN2A 3OYYA 1G91A 2XSCA 3DMUA 2JSOA 3TEHB 1WD0A 3WDNA 5GADC 4PMWA 5KGUA 2VW9A 4DV1Q 2B2YC 4RGMA 4WFN3 2OTJA 4POGA 4DXGA 1LT5D 3SEBA 2A69D 1MSHA 1TWGB 1CFMA 1N33Q 1KXLA 1B2TA 3GTOH 1EZ6A 1L0YB 5ELNA 1FGUA 4CKCA 3I91A 1Y1WH 3MTSA 1WVLA 1VQIA 4J15A 4H0LC 4YCVA 1OXUA 5JJLA 3MEHA 1PFBA 3MXGA 3FMCA 3CF5A 2JXMB 4GN3B 4R8NA 4CKBA 3SK5A 5IOCA 3F2DA 3J7A5 4KKUA 4G7HC 2HCCA 2Z6KC 1WD1A 1CQFA 3OOCA 4GNXB 1EYCA 2KHJA 2FHTA 3RN2A 4N9PA 3V2TA 1A0IA 4XQJA 3DM3A 3JAML 1G2TA 3PUYA 1HTLD 2RBMA 4OIJA 3CC7A 3C46A 4JVZA 4A3MB 3KK7A 1XMQL 1F2YA 3IFDA 4RWSC 4XDXA 2DJGC 1XPRA 1BKBA 5KYLA 5J39A 1PDQA 3PF5A 1PYSB 1EY0A 1H9KA 1JWSD 5IGDA 1D8LA 2V1CC 1X3QA 2N49A 1DD2A 3V05A 4QF4A 2JA8H 4IUNA 1VQ8A 4LK1C 1OXSC 4UP7A 1XNRL 2SOBA 1X55A 2K32A 1VQ6A 3KFUA 4GNXA 2E8GA 1IYJB 2YTYA 1NBWA 2CQAA 2ES2A 1WCMH 5KYIA 1VQCA 2HCIA 3ZJYC 1B8AA 2BCOA 4XT1B 1CSPA 3I3CA 4JG2A 1AZPA 2F0NA 1N34L 3PO3B 3X3MA 1VQGA 3HOXB 2R92B 1ET9A 5HURA 1WFQA 4JI7Q 2WP8J 1LO5D 2JA7G 1MJEA 3KLSX 5FKAC 4KN7C 3ULJA 3PO2B 2QDLA 4GKKQ 4I7AA 1A2TA 2QF7A 4ZCKA 1D2BA 5GAEC 4Q5VA 1CUKA 1SFOB 5I2XA 4RAUC 3PV0A 1K9MC 1FJGQ 5IT9c 3HOYG 2K28A 1E2ZA 3S9WA 5G3LF 3UE1A 4A75A 2F0HA 1AE2A 1CZWA 1GUSA 4LW1A 1RL2A 3PO3G 2A6HC 5ELBA 1HZAA 3WWVA 3C2PA 4R8IA 3PIOA 5ELOA 4LF8L 4ZQ3A 1ICWA 5M5XB 4KV6A 5CMDA 3MXNB 3QR8A 3CQZB 1CHPD 2CWAA 2LY7A 1B9NA 2OXPA 3MAQA 5M5WH 4LF9L 1EY5A 2F0UA 3BVGA 3CP0A 4U68A 3QIAA 2B8GA 1J5EL 4K0KL 1X56A 5CBAE 2B63H 3GTKB 4BBRG 4DUZL 3MFYA 3HEJA 4HIOA 1GHKA 3S2HB 2F0PA 5ISRA 1JT8A 1LYLA 2IT1A 1BNZA 4NXML 2IY5B 3GQBA 2CH4A 1QVCA 5C4JB 2NZHA 4GOPB 5DLQE 1G51A 3MXNA 1I94Q 3J81c 1O7YA 3GTQH 3DM1A 1VQ5A 3BZKA 4QUFA 4DR5L 3OW2A 1SNCA 4IPHA 3T1HQ 4C3HH 4AYBB 1EYDA 3M9BA 3STBD 1STNA 4IUQA 1PHJA 2PNRC 1X3FA 4TVAB 2X6GA 4IJLA 5I6WA 2LXKA 3CMAA 4A3BH 2F0JA 2F0SA 1U4PA 5JVG3 1S72A 1JB7A 5BN5A 3SVMA 1TWFH 4DR2L 4C2MB 5FJ8H 2SNMA 4DV3Q 1VQHA 2MP1A 1LT6D 1RKNA 4DA2A 4AYBG 4K6LA 3R93A 4GOPA 4O0AA 3C3LA 1A62A 5D14A 3TP5A 1I5FA 5C0XJ 1YI2A 1EYGA 3K57A 1E2VA 1EQRA 1SNMA 1JJCB 3A7AB 3NWTA 2IHFA 4C3JB 2VNUD 4A3GG 1PTOB 3Q24A 2QCPX 1UE7A 5BR8L 2UUAL 4CJ1B 4AYBE 2ZJPA 1K28A 3DEPA 2D2CC 5K5PA 1F77A 4LWCA 4NMZA 4C3IG 3CCMA 1LTTD 1STHA 3HOZH 1I4PA 3H3VH 3TRZA 2Q8RE 3MC0B 3TZUA 3J7YW 4EQOA 2Z6KA 2EJMA 1LV9A 2R93G 4HAEA 4KMUC 4C1NI 5FO8B 2E2JH 1XYIA 2JA6G 1STEA 3NUCA 3S1RB 4HJ5A 1AN8A 2B2WC 3HP3A 4R4IA 5E7NA 1PTOD 3MFGA 5D65A 5F2DA 1SNOA 1EIFA 2J4XA 4M8AA 4DV5L 1YNXA 5ELDA 2H1EA 2ZM6Q 1YZ6A 2K01A 4MN3A 1BCPC 1E1TA 1DJRD 1UE1A 1Z9FA 4BBSG 2I5LX 3AYHB 5IT9L 3KLWA 3HOUG 2R7ZB 2EIFA 2G9DA 4ABNA 5IP9H 4X64L 3RNUA 2PI2E 3QWNA 4IFDI 4B3ML 2A73B 1YITA 3J7AF 2CH4W 3PGZA 1M8AA 2IW3A 1HUMA 2K1BA 4K8IA 2AHOB 1M4VA 2LFNA 1LTAD 2UUBQ 4DR3L 3RLFA 2KCTA 2BH8A 5E3FA 4PZ7A 1E3PA 1UEAB 3J80c 4LFCL 3BZCA 4YWMA 3VDYA 4A3KG 3K7AB 2E2IB 2A68C 2ID0A 5M3FB 1PFMA 3GTPH 1Q86C 3OTOL 4IOCA 1ESRA 1T9HA 3TS0A 1VQMA 2A6HD 2UXDQ 2RSNA 4A3DG 1G8ZD 1D5ZC 1EY7A 4E6IA 5IGBA 3G4SA 1DCZA 2FFKB 1HTPA 4A3JG 2C9OA 2F0WA 4FXKC 5FK9C 4HIDA 3Q6SA 5M3FG 1AFPA 4A3MH 3L3OC 4IUVA 1QZHA 3J81L 1VQNA 2UXBQ 5DAUA 1Q3LA 4B3RQ 1I4RA 3MVVA 2DY8A 1Y8OB 5IODA 1IBLQ 1AW7A 2XWJB 3L0OA 3QB3A 1C4QA 2QW7A 3EFXD 2B2VC 1XTCD 4RFBA 1QNUA 1EIHA 1N34Q 1QUQB 1XNQL 1Q90A 4I7ZC 5LMNL 1SJED 3KOJA 1GUGA 3P75A 4K5VA 4HJ9A 4JOIA 2RVLA 2NZOA 1GOZA 3HOYH 3I4LA 5C44G 3CKIB 4YCWA 1Y69U 2IWHA 4NW2A 3UDIA 3Q8DA 3F1ZA 4CHTB 3PO3H 2Q2IA 3S1NH 2NVQB 2E75C 3HOXH 4KHPL 2R92H 2P5ZX 1WTWA 1FGBD 2L1BA 5CGKA 2UXCL 3CPFA 3NBIA 1HFNA 1J9OA 4F88A 4CDCC 1IKLA 1QG7A 2E2HB 3HKZB 3KJOA 2CW0D 1EY6A 1QUQA 3A56A 3RZDB 2VL6A 2JA5G 1Y1VG 4CBVA 1XXGA 1I50B 4CDEC 2A5HA 4XQNA 1SNDA 3BDLA 1D5XC 3K5NA 1YJWA 1Q8IA 3K7UC 2ZTDA 3FPPA 5M5XH 3H15A 4OO1G 4KY6A 2AWOA 3C1EA 3ERQA 3KUPA 4JK1C 3DEOA 4H7BA 1HR0L 2Q8IB 1BVSA 1UAPA 4LF5L 2AKWB 5IYDG 1SEBD 2WFWA 1VQ9A 2ASBA 4R1JA 3HKZE 3GTKH 1K8AC 5G3LD 4GZYC 1SYCA 3E9HA 1FD7D 1L1OC 4HCEA 2D62A 1WTXA 1VQKA 1DYQA 4DV7Q 1WTVA 3M3YB 1O78A 3NSWA 4N8FA 1NUCA 4IZ8A 5CYUA 3OMCA 3HGBA 5EKLA 5LMUL 3GDEA 1T5XD 5C4JH 5D3DA 4K2LA 1V43A 3A54A 3J80L 2RHQB 5IGCA 1TY2A 3MWYW 3GD7A 1XWEA 3W5OA 3A5ZB 1DOLA 3G71A 3JAMi 3I4NG 1A6XA 4JYAL 1JJ2A 1IBKL 2XGTA 2VQFL 2UU9Q 1ILQA 2UUCL 4A3GH 3MXPA 4JI8Q 4A3LG 1EEFD 5T1IA 1F9SA 1TIID 2XVSA 4DK1A 4C2MH 1HZCA 1B9MA 4JPBW 2L9HA 1X32A 1KD1C 4FXDA 2EY5A 4L5SA 4JI2Q 3NE5B 2PW7A 4KHVA 2AUKA 4PMCA 3CRKC 4RHSA 3I56A 1N36L 2O5JC 4DK6C 1I6HB 4C3JH 1YEZA 2JA6H 1Q8KA 3J7AV 2NYZD 2NTSA 1PTOH 1QOHA 3DWQA 1Q82C 4DV4Q 2EYFA 1QB5D 1N9WA 3ULPA 1GO3E 5C5MA 2VUMG 3KF8A 2EY6A 5IWAL 5I4DA 2NN6H 1KC8C 1GUWA 1LTBD 4BBSH 1VF7A 3M4QA 1JE5A 2DY7A 3FP9A 4B9XA 2K05A 1SSOA 3ND8A 4QMGA 1A3TA 3CCQA 2KEDA 3CU7A 1UE6A 4DUYL 1N8RC 4KLKA 3I2ZA 5JJZA 5LMNW 1E7ZA 4QY7A 1OXXK 2F1MA 2D0PA 5C3EG 1CA5A 4YCUA 3DLLA 5IGEA 1LACA 1XTDA 2KCNA 1XMOL 1KDAA 2Z4HA 3D31A 1EEID 5CV5A 2B2VA 4A3KH 3CRLC 1OXVA 5CBEE 1SXTA 3SGIA 2B2UC 2A19A 4U673 2R7ZH 1BBWA 1HRJA 2C5CA 1NTGA 3FKIG 2EDGA 4UP9A 1K0RA 1FL0A 2NBFA 3RN5A 4J1MA 1BDOA 2AQ2B 3R8BA 2R7FA 2F4IA 4HR7B 3VR5A 4DNTB 4DGZA 1HNZL 2Y0SG 3I70A 5IP7H 5M3FH 2XRQD 3E0JA 3VYRA 3TBIB 1A2UA 3TREA 4X62L 3K5LA 5J22A 4YY3Q 3L7ZC 3EQLC 2A6EC 4JI5L 4LF4L 2X6LA 3T16A 2XIWA 2MFIA 1TQOA 5JEAG 3I4MG 3LWUA 4MTNA 2RA4A 1OO9B 3IRBA 5M5YB 1XPOA 1HR0W 4OONA 4PZ8A 4DPGA 3T13A 4JV5Q 4KY7A 1JWMD 1AH9A 4HSPA 2IX0A 3R2IA 3UDXA 4BXXH 3GTMB 2RKSA 4LAAA 4ZLTF 4CJ0B 2F0FA 3U4VA 1CM9A 5K36G 4EX5A 1NAPA 4LFBQ 2K6AA 5EGTA 2F52A 3U58A 1PH5A 4A4IA 1KIXA 1E1OA 3HRZC 1EWCA 3NTHA 3CXCA 1HZBA 1NNXA 3GTPB 1PZJD 2J0TD 4A3EG 3H3VI 4UDUC 5FLMG 4HN7A 1CSQA 4K6DA 2AQ1B 1Y1VH 1U4MA 1WTRA 1VQEA 1DONA 4LF6Q 3ERSX 2NVQH 3SHLA 4JI4L 1HQRD 1STYA 4L5TA 3J81j 1RTOA 5C4XG 1X3GA 1BR9A 4RGTA 4DNRB 3QOLA 3A8KE 3D0FA 2E2HH 3NEMA 4ODGA 2KOLA 1PYWD 4JBJA 4BY1G 3F8TA 3RZDH 1KRSA 2PQEA 1O7ZA 5EBCA 3GV6A 5T1GA 5I9OA 4DU9A 4OX9L 3OIQA 4X3KA 4IPCA 4HJ8A 5IYDH 4AIMA 1I50H 4YHHQ 2KQ3A 3H0GG 4ZRZA 1TKWB 1KTKA 1YVCA 3CCUA 2JA7B 1NMFA 2B2TA 2EYMA 5E1FA 1IBMQ 1STGA 1I3QH 3KBXA 3PSIA 2PZUA 1Y8NB 4EQNA 2F4VL 1UWVA 1UEBA 2DGYA 1RF2D 3HOYB 1PLFA 3PF4A 2N55A 1SJHD 4UP8A 3S1NB 1ZXTA 2F0KA 1R9TB 1MHWC 4R4CA 3FRPB 1V1QA 3I4OA 1WTOA 3F2CA 4G7ZC 2EVBA 2O4XA 1CK1A 5A2QE 1UE5A 4JI3Q 2R7DA 4ZAIA 3M3YH 1O80A 2I0QA 1STBA 3I55A 4B3SL 2SEBD 3PIP3 1YIJA 1L0WA 1GHJA 1KDCA 4A3IG 4FXGC 1IBKQ 4A3LH 2H5XA 2HIXA 4P71A 4ME3A 4XTCS 1VS0A 1QJOA 1GUOA 1K8MA 3CAMA 3R3OA 4BBRB 2F0VA 1V8QA 3HOWG 4DV0Q 1Y14B 2D0OA 1OXTA 3PQIA 1HJPA 1NSNS 1SMXA 4AH6A 2PCFB 1BCPF 1U4LA 4R4OA 4EQ5A 3J81i 4X6AH 2NUCA 5EPJA 1X3PA 2RHSB 3VR3A 2PMZB 4J6HA 4TKOB 4OWWB 1I4GA 2SDFA 4V0BA 1LTRD 2QEXA 2HUGA 4DR1L 1DOMA 1Q46A 4ULLA 2AWNA 2I46A 2PYKA 2VUMH 1MKHA 1PZID 1ZYRD 2TSSA 1I6HH 1TR5A 4FP5D 1AZQA 5IYBH 4RH6A 3HOVG 3BVZA 1A3UA 3BYYB 5IWAQ 5AJ3L 4R9WA 3RZOB 2PW5A 2MJ8A 3BVMA 4DKAC 4WJ3M 1H9MA 1LT3D 1UUPA 2A6ED 3CC2A 1ENCA 3VYSA 3W1BA 1SBBB 1F2MA 4DV2L 3NK9A 1EOVA 4C1NK 3S15H 3HZXA 4IN3A 2HT1A 4A3GB 1K83B 1WJJA 2PMZE 3DUZA 2B2YA 4RGNA 3JC66 1G2SA 4RMFA 3SK8A 1PFNA 5GAHC 1VQOA 3FKIH 5C0XH 1SN8A 4C3IB 4O1NA 4KK7A 3KLSA 1ASZA 3HS0C 4A3CG 1JQYD 4M1UB 4N9TA 3AEVA 2PNHA 2R93B 4B08A 3DWPA 4KD4A 4DV6L 4NXNQ 3HKSA 1M1KC 4KJNA 2JA6B 2BE5C 3A8JE 4IO9A 5DEHA 3SXHA 1HNZQ 1IXRA 3UDGA 3PMFA 5FO9B 4H44C 2EJFC 3BDCA 1K0SA 5LL6S 1JCKB 2YTXA 3OSOA 1NR2A 2QEJC 3NP8A 1Q81C 1RDPD 5EBDA 1SNPA 3I4MH 1KHIA 4ZKCB 4CDFC 1IHZA 2EYOA 4BBSB 3GTGH 4QCLA 3ND9A 3VYTA 1C0AA 1X54A 4NDXA 3HOUB 5JEAJ 1RHPA 5JJIA 3EJIA 2J7ZA 3LGJA 3GTLH 5C3WA 1B3AA 1HNXL 4IFDG 1H95A 2DN8A 2PZWA 3VA7A 3AU7A 5NUCA 2ATWA 3D6WA 3OW7A 3BYTB 4A3KB 4DAPA 1SAPA 5M5YH 2PI2A 3MXUA 4FDBA 4A93G 3RUZA 1XX8A 5EQ0A 2D9UA 4EVOA 1CKOA 4TRDA 4HTHA 4AQYL 3GTMH 1TT2A 1I4QA 2XNAC 4RKLA 4A3DB 2VY3A 5I9PA 4DK0A 2WAQG 3FPUB 5C3XA 4A3JB 1HZ9A 1AE3A 2KENA 2QKIC 1PZKD 3ER0A 4MZ9A 1QZGA 1K73C 4GLAC 2M2LA 4QJFA 4ZYSA 2HIVA 3I73A 2OT2A 4BY1H 2EYJA 2GVAA 2NN6I 2HHHL 1I4XA 1XMQQ 1GUNA 3IL8A 1KLUD 3U4ZA 2CVRA 3A55A 5E4XA 4QUCA 1QILA 4XQQA 4HMJA 4X66L 5I6YA 3SR1A 2VQEL 1XNRQ 3NWSA 5ELEA 3LNNA 1P16A 1PV4A 4LF7L 2O5IC 4DR4L 5C44B 2K75A 2XRSD 4KI0A 5IE8A 4X65L 1E2WA 3T53B 2NTTA 4HSVA 2K50A 1HFGA 1HCZA 4K14A 1IL8A 2IPKD 4B3TL 3K0XA 1PXUA 3SK4A 2JA7H 1YNJC 4ZKBB 1JJGA 2CFMA 4H13C 3U9OA 1A63A 3TDQA 5JJKA 2TMPA
chains in the Genus database with same CATH topology
3IKJA 1CHQD 2JA5B 1Y1VB 4XYOA 5FOBB 1RJTA 2R6GA 2Z4IA 3S1MB 1S5ED 1JOQA 2L11A 4OL7A 4KN4C 1K8OA 1EU4A 2LS01 4RHRA 1LTGD 2K5DA 3WOEA 2JEAI 2BOSA 4RCNA 1I3QB 3VR2A 3NTIA 1NR4A 2DNEA 1CZGA 3D4RA 1II3A 1JE4A 4CGYB 2LKVA 2VXWA 3N6RA 3BDOA 3H3VC 2PO4A 1Y8PB 2EY2A 3D6CA 1LT4D 1BCPB 1DXMA 1NCVA 5LHY1 1A15A 4J8QA 1G6ZA 2WV6D 3I4NB 2IX1A 3AMUA 5KNDA 5JPMC 2WIIB 3ITPA 1EWHA 2CHBD 2E74C 3T56B 2A69C 1MGSA 2WINB 5EPKA 4EGVA 4OHJA 2B2WA 2WKCA 1BCPD 2PZTA 3GP7A 4CJ2C 1RTNA 3TZDA 4G7OC 2F0IA 2EOTA 3K6OA 2EZVA 3IAYA 4I65A 2SNSA 5CV8A 4V190 1RD9D 1JR0D 3KLRA 4G57A 1UNSA 2K03A 1LTID 2FINB 2ZT9C 1A3VA 4BS9A 2L4NA 2WACA 1DM0B 2O2LD 2VUMB 2A68D 4UAIA 1KLGD 1Q1BA 1EZ8A 2L55A 3V96A 2K7VA 4XXEA 1JORA 1BUVT 3OWEB 4ZUIA 4HEDA 2BA0A 2F0LA 2EXZA 5FO7B 5C3EB 2ZXPA 3S15B 4CKEA 4HCSA 3TSSA 1F9PA 1PRTC 4IFDJ 3FKIB 1W6KA 1JC7A 2IJ0A 1B1ZA 1LLRD 1D1IA 1FYCA 1TY0A 4FNFA 1YNJD 2NB0A 1HPCA 4K2KA 2Y0SB 4PMBA 2R61A 1IYVA 2B39A 3M7GA 1SYGA 3RMHA 2EPBA 4C3HG 2KA7A 5EPLA 1LABA 1JOKA 3L9AX 2AQ3B 3I4MB 1I4HA 1F9QA 3GTGB 1C48A 1KNEA 1C8CA 3K0YA 2PPBC 1IW7C 4KD3A 4OIKA 1JWUD 1KNAA 5AFWA 3GTLB 1QNKA 2YU9B 3DXJC 4C56C 5C0XI 3A7LA 1HA5A 1B53A 4L63B 3MZ5A 4A3EB 1D5MC 4KTAA 4DAYA 3M4YA 2ZXRA 4DFAA 1ZEQX 3Q23A 2MUYA 2ZXOA 3LWEA 3PUZA 5KRUA 3I8ZA 1D1KA 5JAVA 3GTJB 1KDBA 5C4XB 1O7LA 5FLXE 1CA6A 4TSSA 2BDNA 1JB3A 3P7JA 1EIGA 5COYA 3E5SA 2F0TA 3P1HA 4BA2I 1H9SB 4Q0FA 4BY1B 5CV9A 1TS5A 4KJOA 5A2QL 1U4RA 2ICEC 5BN4A 4RKBA 3H0GB 2D5DA 1V1OA 4WORA 1CQVA 4OO1H 2MHVA 5JVH3 2GA4B 3M4OB 2F3WA 2JP1A 3NXWA 1EYAA 2F0QA 5I2YA 1H9SA 4F7XA 5KIXA 1HUNA 3K59A 3PUXA 3SDZA 4PQXA 1Q12A 2FJ2A 3M7NA 1PRTB 3OMGA 5CORA 1PTOC 5C6AA 1BO0A 4BA1I 4A3IB 2QDBA 1MD2D 1IYUA 1ET6A 3G7LA 3HOWB 3S17B 3I72A 1B44D 5DM73 1PRTD 3AB9A 1E0BA 2L5TA 3RD4A 3A8IE 4X3SA 2E76C 2ENBA 5IIFA 3NTKA 5EJWA 1Q1EA 1EL0A 4ILWA 1WTPA 3N52A 1SYBA 3R2TA 1SE3A 1QWYA 1EOTA 2Z8LA 2Z1CA 3NPPA 4X3TA 3HOVB 1JOOA 3JAME 2WKDA 5DM63 4Y7NB 2QILA 4MHEA 3I90A 2B2UA 1RODA 5J1ZA 1R4PB 4OGQC 3D4WA 2NWGA 3ONAB 2NVXB 1GUTA 2K5QA 1VDZA 1IW7D 2IL8A 4L8JA 5CR3A 4ID6A 1S5DD 5KNCA 1HA6A 4IUTA 3O13A 3VA5A 3GO5A 2MPMA 1HXYD 2R3ZA 4FF3A 4LMQD 3BG3A 3S14B 4MIUA 2RDHA 3NQTA 4K5XA 2JYOA 1ZKOA 3TMEA 3QOJA 3S16B 2F0EA 1H9RA 3HG9A 4K8JA 2KHSA 1CI3M 3EROA 1V1PB 2VB2X 4BWGB 4BY7B 1JICA 3D3RA 1WTQA 2CW0C 1TS4A 5D3IB 2EYHA 3S2DB 4IUPA 3LX0A 2ICIA 4KY5A 1Z6HA 2RDGA 5BN3A 2LMCB 5JEAH 5CC4A 2A74C 1H9JA 1AP0A 1EQTA 4A93B 1V1PA 1YNNC 1ESFA 3W3AA 2EJGC 1FR3A 4IQZA 2L12A 3C1FA 5K36H 3F2UA 3CHBD 1B50A 2WAQB 3E6ZX 3S1QB 3OPOA 2F03A 1VCIA 1RCVD 4C3JG 2FMCA 3PUWA 2NVTB 1TWHB 1F2LA 4IALA 2M9VA 2HDMA 4RGOS 2KEEA 2NZ1D 1KABA 4HMIA 3T51B 1TWAB 4IURA 1S5BD 2EE1A 1L0XB 2NN6G 1B4OA 3K5OA 1EY9A 2HQEA 3OHXC 5KNBA 5DNFA 1SYFA 3TN2A 3URYA 3FVQA 1Z7TA 2E2DC 1D6EC 2VB3X 4FF4A 3TP7A 2NVYB 2KCCA 4WJWA 5A35A 5CV7A 3FEWX 2XN9C 2K33A 3BS1A 3X3NA 4JBWA 3QO2A 4EQPA 4QIWB 5KEEA 2V4DA 3IFTA 5TSSA 1IKMA 3MA2B 4S3SA 2EYLA 2OEOA 3TP6A 1S4ZA 2DNCA 1I6VC 3Q22A 1W6JA 1BQQT 1SE2A 3SK6A 5ELCA 3TP8A 1MSGA 3U9SA 5JOBA 4A3FB 1F2ZA 1BXTA 3UI2A 1LTSD 1SMYC 3GTOB 3DHQA 1G291 3H09A 4P2CB 1ENFA 4FYDA 5LL6X 5IT9E 1Y1WB 2BDOA 1QE6A 4DN4M 1EY4A 3VR4A 4YIJA 2JE6I 1SE4A 2RSOA 1TVXA 2F0DA 2BA1A 2HDLA 1GXDC 1PRTF 4KKTA 1GJXA 1VF5C 4WRDA 1Z47A 3WOFA 5C5LA 2JEBI 3KBGA 2BE5D 2F0GA 1ONLA 4PNYA 5HGTA 3EA6A 1QCBD 2G9HD 2B8FA 3K5MA 1HQMC 2N88A 1TWCB 1FNWA 1DOKA 2JA8B 2KVMA 1T5EA 1SYEA 1VMCA 3J81E 5C4ZA 1DZ1A 3NHHA 1WCMB 2K04A 3MHBA 3EVQA 1YNND 1TS3A 3H6MA 2K5WA 4IUUA 3PIO3 4QB4A 1FNUA 4OO1I 2F0MA 3QG1A 4FF1A 1STAA 1U9RA 3FDTA 3OIPA 1TU2B 3Q0AA 2YYZA 1ILPA 4RA8A 1ML0D 5C4HA 3K58A 1CT1D 1J8IA 2WB1B 2KECA 1S5FD 5JPNC 4KKSA 2RQXA 1MI2A 4F8MA 1SYDA 2MGSA 1R4QB 3BZDB 4G4KA 4RCOA 2L0CA 2Q8TA 2I07B 1BBXC 4ZUJA 3QJYA 1FNVA 2OF1A 3NQIA 5M5WB 3H94A 4NKLA 2KUMA 2IX3A 2X69A 2B2TC 4FO2A 3W2DA 1HHVA 5M9OA 2B63B 3OWFA 2XWBB 1EY8A 3D8GA 3PUVA 1ENAA 1TS2A 5ELFA 4XYQA 4IFDH 1F9RA 5CV6A 4Z9CB 1EFID 3GTQB 5IGFA 2F0OA 4B9WA 2RDFA 4KHZA 1VMPA 5EKIA 4C3HB 1BF4A 3G6JB 3T4AC 3D4DA 2EYPA 3VR6A 4LJZC 4A3BB 3J80E 5EKKA 2FMMA 5CV4A 4DF7A 2H4OA 1TWFB 4XIGS 5FLXL 2KJXA 1SDFA 1SMYD 3GV3A 1SNQA 1AEXA 4TQUS 4ZK9B 4XT3B 4ME5A 1BOSA 1MBYA 1EU3A 3SE0A 1PTOF 4F87A 1PMRA 5E4WC 4DAVA 5IGGA 2F3VA 5M3MB 1KAAA 4X3UA 1EQVA 1S5CD 3DWAA 3ZYYX 5C0XG 1CTMA 4K5WA 3HOZB 4DXFA 4L6TB 4PV1C 4FF2A 4NP5A 3M85A 2E2JB 3NBHA 4FVMA 1ZYRC 2M00A 2EY1A 2AUJD 3P20A 3VYUA 4O42A 3H91A 1G91A 2XSCA 3DMUA 2JSOA 1WD0A 3WDNA 4PMWA 5KGUA 2B2YC 4RGMA 4WFN3 4DXGA 1LT5D 3SEBA 2A69D 1MSHA 1TWGB 1CFMA 1B2TA 1EZ6A 1L0YB 4CKCA 3I91A 3MTSA 1WVLA 4H0LC 1OXUA 3MEHA 1PFBA 3MXGA 3FMCA 2JXMB 4R8NA 4CKBA 3SK5A 5IOCA 4KKUA 4G7HC 2HCCA 1WD1A 1CQFA 3OOCA 1EYCA 2FHTA 4N9PA 3V2TA 4XQJA 3JAML 1G2TA 3PUYA 1HTLD 2RBMA 4OIJA 3C46A 4A3MB 3KK7A 1F2YA 3IFDA 4RWSC 4XDXA 5KYLA 5J39A 1PDQA 1EY0A 1H9KA 1JWSD 5IGDA 1X3QA 1DD2A 3V05A 4QF4A 4IUNA 4LK1C 1OXSC 2SOBA 2K32A 2CQAA 5KYIA 2HCIA 2BCOA 4XT1B 3I3CA 1AZPA 2F0NA 3PO3B 3X3MA 3HOXB 2R92B 1ET9A 5HURA 2WP8J 1LO5D 3KLSX 5FKAC 4KN7C 3PO2B 1A2TA 2QF7A 1D2BA 4Q5VA 1SFOB 5I2XA 4RAUC 3PV0A 2K28A 1E2ZA 3S9WA 5G3LF 2F0HA 1CZWA 1GUSA 2A6HC 5ELBA 3C2PA 4R8IA 4ZQ3A 1ICWA 5M5XB 4KV6A 5CMDA 3CQZB 1CHPD 2LY7A 1B9NA 2OXPA 3MAQA 1EY5A 2F0UA 3BVGA 4U68A 3QIAA 2B8GA 5CBAE 3GTKB 3MFYA 3HEJA 1GHKA 3S2HB 2F0PA 5ISRA 2IT1A 1BNZA 3GQBA 5C4JB 3MXNA 1O7YA 3DM1A 4QUFA 1SNCA 4AYBB 1EYDA 1STNA 4IUQA 2PNRC 2X6GA 5I6WA 2F0JA 2F0SA 1U4PA 5JVG3 5BN5A 3SVMA 4C2MB 2SNMA 2MP1A 1LT6D 1RKNA 4DA2A 4K6LA 3R93A 3C3LA 3TP5A 5D14A 5C0XJ 3K57A 1E2VA 1SNMA 3NWTA 3A7AB 4C3JB 2VNUD 1PTOB 3Q24A 2QCPX 4CJ1B 3DEPA 2D2CC 5K5PA 1F77A 4NMZA 4C3IG 1LTTD 1STHA 1I4PA 2Q8RE 3MC0B 3TZUA 3J7YW 4EQOA 2EJMA 1LV9A 4HAEA 4KMUC 4C1NI 5FO8B 1XYIA 1STEA 3NUCA 3S1RB 1AN8A 2B2WC 3HP3A 1PTOD 3MFGA 5D65A 5F2DA 1SNOA 2J4XA 4M8AA 5ELDA 2H1EA 2K01A 4MN3A 1BCPC 1DJRD 5IT9L 2R7ZB 2G9DA 4ABNA 3QWNA 4IFDI 2A73B 3J7AF 1M8AA 2IW3A 1HUMA 2K1BA 4K8IA 1M4VA 2LFNA 1LTAD 3RLFA 5E3FA 1UEAB 3K7AB 2E2IB 2A68C 2ID0A 5M3FB 1PFMA 1ESRA 2A6HD 2RSNA 1G8ZD 1D5ZC 1EY7A 4E6IA 5IGBA 1DCZA 2FFKB 1HTPA 2C9OA 2F0WA 4FXKC 5FK9C 3Q6SA 1AFPA 3L3OC 4IUVA 3J81L 5DAUA 1Q3LA 1I4RA 3MVVA 2DY8A 1Y8OB 5IODA 1AW7A 2XWJB 3QB3A 1C4QA 3EFXD 2B2VC 1XTCD 4RFBA 1QNUA 1EIHA 1Q90A 4I7ZC 1SJED 1GUGA 3P75A 4K5VA 2RVLA 1GOZA 3I4LA 3CKIB 1Y69U 2IWHA 4NW2A 2NVQB 4CHTB 2E75C 1WTWA 1FGBD 2L1BA 5CGKA 3NBIA 1HFNA 1J9OA 4F88A 1IKLA 1QG7A 2E2HB 3HKZB 2CW0D 1EY6A 3A56A 3RZDB 4CBVA 1XXGA 1I50B 2A5HA 4XQNA 1SNDA 3BDLA 1D5XC 3K5NA 1Q8IA 3FPPA 4OO1G 4KY6A 2AWOA 3C1EA 3ERQA 3KUPA 4JK1C 3DEOA 4H7BA 2Q8IB 1UAPA 1SEBD 5G3LD 4GZYC 1SYCA 1FD7D 4HCEA 2D62A 1WTXA 1DYQA 1WTVA 3M3YB 1O78A 3NSWA 5CYUA 1NUCA 4IZ8A 3OMCA 3HGBA 5EKLA 1T5XD 5D3DA 4K2LA 1V43A 3A54A 3J80L 5IGCA 1TY2A 3MWYW 3GD7A 1XWEA 1DOLA 1A6XA 1ILQA 3MXPA 1EEFD 5T1IA 1F9SA 1TIID 2XVSA 4DK1A 1B9MA 2L9HA 1X32A 4FXDA 2EY5A 3NE5B 2PW7A 4KHVA 2AUKA 4PMCA 3CRKC 4RHSA 2O5JC 1I6HB 3J7AV 2NYZD 2NTSA 1PTOH 1QOHA 3DWQA 2EYFA 1QB5D 5C5MA 3KF8A 2EY6A 5I4DA 2NN6H 1GUWA 1LTBD 1VF7A 2DY7A 4B9XA 2K05A 1SSOA 3ND8A 4QMGA 1A3TA 2KEDA 3CU7A 5JJZA 1OXXK 2F1MA 1CA5A 5IGEA 1LACA 2KCNA 1KDAA 2Z4HA 3D31A 1EEID 5CV5A 2B2VA 3CRLC 1OXVA 5CBEE 1SXTA 2B2UC 4U673 1HRJA 2C5CA 2EDGA 2NBFA 4J1MA 1BDOA 2AQ2B 3R8BA 2F4IA 4HR7B 3VR5A 4DNTB 4DGZA 3I70A 2XRQD 3E0JA 3VYRA 3TBIB 1A2UA 3K5LA 5J22A 3L7ZC 3EQLC 2A6EC 2X6LA 3T16A 2XIWA 1TQOA 5JEAG 3LWUA 2RA4A 1OO9B 5M5YB 3T13A 4KY7A 1JWMD 4HSPA 2IX0A 3R2IA 3GTMB 2RKSA 4LAAA 4ZLTF 4CJ0B 2F0FA 1CM9A 5K36G 1NAPA 2K6AA 5EGTA 3HRZC 1EWCA 3NTHA 3GTPB 1PZJD 2J0TD 4UDUC 4HN7A 4K6DA 2AQ1B 1U4MA 1WTRA 1DONA 3SHLA 1HQRD 1STYA 1RTOA 1BR9A 4RGTA 4DNRB 3QOLA 3A8KE 4ODGA 2KOLA 1PYWD 2PQEA 1O7ZA 5EBCA 3GV6A 5I9OA 5T1GA 4DU9A 3OIQA 4X3KA 2KQ3A 4ZRZA 1TKWB 1KTKA 2JA7B 2B2TA 2EYMA 5E1FA 1STGA 3KBXA 2PZUA 1Y8NB 4EQNA 1RF2D 3HOYB 1PLFA 2N55A 1SJHD 3S1NB 1ZXTA 2F0KA 1R9TB 3FRPB 1WTOA 4G7ZC 2EVBA 2O4XA 1CK1A 5A2QE 4ZAIA 1O80A 1STBA 2SEBD 3PIP3 1GHJA 1KDCA 4FXGC 4XTCS 1QJOA 1GUOA 1K8MA 4BBRB 3R3OA 2F0VA 1V8QA 1OXTA 1NSNS 2PCFB 1BCPF 1U4LA 2NUCA 5EPJA 1X3PA 3VR3A 2PMZB 4J6HA 4TKOB 1I4GA 2SDFA 4V0BA 1LTRD 2HUGA 1DOMA 4ULLA 2AWNA 2I46A 2PYKA 1PZID 1ZYRD 2TSSA 1TR5A 4FP5D 1AZQA 4RH6A 3BVZA 1A3UA 3BYYB 4R9WA 3RZOB 2PW5A 2MJ8A 3BVMA 1H9MA 1LT3D 1UUPA 2A6ED 1ENCA 3VYSA 1SBBB 1F2MA 3NK9A 4C1NK 3HZXA 4IN3A 4A3GB 1K83B 3DUZA 2B2YA 4RGNA 3SK8A 1G2SA 1PFNA 5C0XH 4C3IB 4O1NA 4KK7A 3KLSA 3HS0C 1JQYD 4M1UB 4N9TA 2R93B 4B08A 3DWPA 4KD4A 4KJNA 2JA6B 2BE5C 3A8JE 5DEHA 3SXHA 3PMFA 5FO9B 4H44C 2EJFC 3BDCA 5LL6S 1JCKB 1NR2A 3OSOA 2QEJC 3NP8A 1RDPD 5EBDA 1SNPA 4ZKCB 1IHZA 2EYOA 4BBSB 4QCLA 3ND9A 3VYTA 4NDXA 3HOUB 5JEAJ 1RHPA 3EJIA 2J7ZA 5C3WA 1B3AA 4IFDG 2DN8A 2PZWA 3VA7A 3AU7A 5NUCA 3D6WA 3OW7A 3BYTB 4A3KB 4DAPA 1SAPA 3MXUA 3RUZA 1XX8A 5EQ0A 2D9UA 4EVOA 4TRDA 4HTHA 1TT2A 1I4QA 2XNAC 4RKLA 4A3DB 5I9PA 4DK0A 3FPUB 5C3XA 4A3JB 2QKIC 1PZKD 2M2LA 4ZYSA 3I73A 2OT2A 2EYJA 2NN6I 1I4XA 1GUNA 3IL8A 1KLUD 2CVRA 3A55A 5E4XA 4QUCA 1QILA 4XQQA 4HMJA 5I6YA 3SR1A 3NWSA 5ELEA 3LNNA 2O5IC 5C44B 2XRSD 4KI0A 1E2WA 3T53B 2NTTA 4HSVA 1HFGA 1HCZA 4K14A 1IL8A 2IPKD 1PXUA 3SK4A 1YNJC 4ZKBB 4H13C 3U9OA 3TDQA 2TMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RD9 D;  1CHQ D;  1JR0 D;  1UNS A;  1EU3 A;  1LTI D;  1PTO F;  5TSS A;  4C56 C;  1FNU A;  1HTL D;  1XXG A;  1B44 D;  1EWC A;  1TS4 A;  5D3I B;  1PRT D;  1BCP F;  1HA5 A;  1PZJ D;  1M4V A;  4UDU C;  4L63 B;  2O2L D;  2ICI A;  1LTA D;  5I4D A;  1D5X C;  1LTB D;  1D5M C;  1KLG D;  1S5E D;  1S5C D;  2AQ1 B;  2RDG A;  3DWA A;  1JWS D;  1I4G A;  3OWE B;  1CT1 D;  1LTR D;  3BYT B;  1SE2 A;  4L6T B;  3V05 A;  4DXF A;  5ELC A;  1S5F D;  1HQR D;  1EU4 A;  1PZI D;  3R2T A;  1SE3 A;  2TSS A;  2Z8L A;  4RHR A;  1LTG D;  1V1P A;  4RGT A;  3BZD B;  1BXT A;  1SEB D;  1LTS D;  4TSS A;  4RH6 A;  4RCO A;  1ENF A;  1ESF A;  1EEI D;  3BVZ A;  1G8Z D;  1D5Z C;  1I4Q A;  2XNA C;  3BYY B;  1FD7 D;  1FNV A;  3BVM A;  1LT3 D;  1PYW D;  1SXT A;  1UUP A;  2QIL A;  3TSS A;  1LT6 D;  1DYQ A;  1TS5 A;  1PRT C;  4K6L A;  1SBB B;  3CHB D;  5FK9 C;  1ET9 A;  1PZK D;  1RCV D;  1T5X D;  1LO5 D;  2IJ0 A;  1B1Z A;  1KTK A;  3KLS X;  5FKA C;  3W2D A;  5D3D A;  4ZYS A;  1SE4 A;  1I4R A;  1LLR D;  1PTO B;  1TY2 A;  2AQ2 B;  3R8B A;  4RGO S;  1TY0 A;  1AW7 A;  1V1O A;  1LT4 D;  4RGM A;  1TS2 A;  1BCP B;  1I4X A;  1CQV A;  4RGN A;  5ELF A;  3EFX D;  4DXG A;  1PRT F;  1F77 A;  1KLU D;  1LT5 D;  1XTC D;  4RFB A;  1LTT D;  1S5D D;  1RF2 D;  2R61 A;  2XRQ D;  2WV6 D;  3SEB A;  1I4P A;  4O1N A;  1QIL A;  1S5B D;  3MC0 B;  4Z9C B;  1JQY D;  1L0X B;  1EFI D;  2CHB D;  1SJH D;  5ELB A;  3O13 A;  1SJE D;  1HXY D;  3EA6 A;  2G9H D;  3DWP A;  1L0Y B;  1EEF D;  1STE A;  5ELE A;  1AN8 A;  1GOZ A;  1PTO D;  3URY A;  4OHJ A;  1CK1 A;  3MFG A;  1CHP D;  2RDH A;  1BCP D;  2AQ3 B;  1D6E C;  1FNW A;  1I4H A;  2J4X A;  2XRS D;  3GP7 A;  1PRT B;  5ELD A;  2SEB D;  3BVG A;  1PTO C;  4RHS A;  1FGB D;  1JWM D;  2NTT A;  1BCP C;  1JCK B;  3R2I A;  2IPK D;  2QEJ C;  1RDP D;  1DJR D;  1MD2 D;  2NTS A;  1PTO H;  1V1P B;  3DWQ A;  2XN9 C;  1JWU D;  1ET6 A;  4BWG B;  1TS3 A; 
#chains in the Genus database with same CATH topology
 3IKJ A;  1CHQ D;  1B7Y B;  2JA5 B;  1Y1V B;  4XYO A;  4POF A;  3BU2 A;  5FOB B;  1K8G A;  3AFQ A;  1RJT A;  2BH2 A;  2R6G A;  2Z4I A;  1CKN B;  3I7F A;  1R9T H;  3S1M B;  1S5E D;  4QIW E;  3S17 H;  1JOQ A;  2L11 A;  4OL7 A;  4KN4 C;  4OWX B;  3A5U A;  1K8O A;  4LF8 Q;  2VS1 A;  5J3B A;  2HD3 A;  1EU4 A;  4A3F G;  2LS0 1;  4RHR A;  1LTG D;  2K5D A;  3WOE A;  1S3O A;  1Y1W G;  2CQO A;  4LF9 Q;  2Z9H A;  2JEA I;  2BOS A;  3A74 A;  4BBR H;  4RCN A;  1I3Q B;  4LUV A;  3VR2 A;  3NTI A;  1J5E Q;  1NR4 A;  1VQA A;  4K0K Q;  2DNE A;  1CZG A;  3D4R A;  2DJF C;  4DUZ Q;  4DR1 Q;  1BBU A;  1II3 A;  1PH9 A;  1VQ4 A;  1JE4 A;  4CGY B;  2LKV A;  2VXW A;  1LUZ A;  4H02 A;  4Y7N H;  3N6R A;  1K3B C;  2GVB A;  3BDO A;  4NXM Q;  2PO4 A;  4YWK A;  1Y8P B;  2K4K A;  2EY2 A;  3D6C A;  3PIP A;  1LT4 D;  1VQF A;  1BCP B;  1DXM A;  1NCV A;  5LHY 1;  1A15 A;  4JCV E;  4J8Q A;  1G6Z A;  2WV6 D;  3I4N B;  2IX1 A;  3AMU A;  5KND A;  1GVP A;  2EQS A;  5JPM C;  2WII B;  4DR5 Q;  4YWL A;  3ITP A;  1EWH A;  2CHB D;  2E74 C;  3T56 B;  2A69 C;  1YHA A;  1MGS A;  1B70 B;  5GQO A;  2WIN B;  5EPK A;  4EGV A;  3W1G A;  3RZO H;  4OHJ A;  4MNO A;  5L37 A;  2B2W A;  2WKC A;  2JA8 G;  1BCP D;  2PZT A;  3GP7 A;  4R4Q A;  4CJ2 C;  1RTN A;  3TZD A;  1XJV A;  1PFS A;  4DR2 Q;  4G7O C;  2F0I A;  1WCM G;  2EOT A;  1K3R A;  3K6O A;  2EZV A;  2ZJQ A;  1K83 H;  4R4T A;  3IAY A;  4JI7 L;  4I65 A;  2SNS A;  5CV8 A;  4V19 0;  1RD9 D;  1JR0 D;  1X6O A;  3KLR A;  3S16 H;  4G57 A;  1UNS A;  2K03 A;  4GKK L;  1LTI D;  2FIN B;  4C3I H;  1NMG A;  2ZT9 C;  5BR8 Q;  2UUA Q;  1A3V A;  3KJP A;  3KDF B;  4BS9 A;  1FJG L;  1W2B A;  2L4N A;  2WAC A;  1DM0 B;  2O2L D;  2VUM B;  2A68 D;  2Q2H A;  4UAI A;  2R93 H;  1KLG D;  1Q1B A;  1EZ8 A;  4UHV A;  2L55 A;  3V96 A;  2K7V A;  4XXE A;  2WB1 G;  1JOR A;  1BUV T;  3OWE B;  4ZUI A;  4HED A;  4CDD C;  2BA0 A;  2MQH A;  4OXP A;  4GNX C;  2F0L A;  2EXZ A;  5FO7 B;  4JBM A;  5C3E B;  4DV5 Q;  3ICE A;  4LUO A;  2WB1 E;  2ZXP A;  1EQQ A;  3S15 B;  2JJQ A;  4CKE A;  4HCS A;  3TSS A;  1HNX Q;  1F9P A;  3KDF A;  1PRT C;  4IFD J;  3HOU H;  1PVO A;  3FKI B;  2IHE A;  2KCM A;  1W6K A;  1JC7 A;  2OCE A;  2IJ0 A;  1PH1 A;  1B1Z A;  2B63 G;  4X64 Q;  1LLR D;  1D1I A;  1FYC A;  1TY0 A;  4B3M Q;  1ASY A;  2OQ0 A;  4FNF A;  3S1Q H;  1YNJ D;  2ALY B;  2NB0 A;  1HPC A;  4K2K A;  1I94 L;  2Y0S B;  4PMB A;  2R61 A;  4DR3 Q;  4DR6 L;  1IYV A;  2VZA A;  2B39 A;  3M7G A;  4LFC Q;  1SYG A;  1TWH H;  3T1H L;  4PG3 A;  3RMH A;  2CKZ B;  4L5R C;  2EPB A;  4C3H G;  4JI0 L;  2KA7 A;  1IL2 A;  4A3D H;  5EPL A;  1LAB A;  3OTO Q;  1JOK A;  3L9A X;  2AQ3 B;  1GD7 A;  3I4M B;  1I4H A;  1WTH A;  4DAY B;  1F9Q A;  4A3J H;  3GTG B;  3B6Y A;  4A3B G;  1C48 A;  1KNE A;  3KYH C;  1C8C A;  3K0Y A;  2PPB C;  1IW7 C;  4KD3 A;  4LUZ A;  5FJ8 G;  4OIK A;  1JWU D;  1FVI A;  1KNA A;  5AFW A;  1YBY A;  3RLN A;  3GTL B;  1QNK A;  2Y0S E;  3RR5 A;  2YU9 B;  3DXJ C;  3T1Y L;  4C56 C;  4DR4 Q;  2Q2T A;  1PA6 A;  1L1O B;  5C0X I;  3A7L A;  1HA5 A;  1B53 A;  5M3M G;  4L63 B;  3MZ5 A;  4A3E B;  2PQA B;  2DUD A;  4OEM B;  1D5M C;  1XNQ Q;  4B3T Q;  4KTA A;  4DAY A;  3M4Y A;  2ZXR A;  1SR3 A;  5LMN Q;  4DFA A;  3HOZ G;  5C44 H;  1ZEQ X;  3Q23 A;  2MUY A;  2N78 A;  1MIU A;  1SLJ A;  2ZXO A;  4QGU A;  3LWE A;  3PUZ A;  5KRU A;  3I8Z A;  1D1K A;  5JAV A;  3H3V C;  3GTJ B;  1KDB A;  3STB C;  5C4X B;  1O7L A;  5FLX E;  1CA6 A;  4TSS A;  4IOA A;  2BDN A;  1JB3 A;  3P7J A;  2GN5 A;  1EIG A;  5COY A;  4KHP Q;  1N32 L;  3E5S A;  2YV5 A;  2ZM6 L;  2F0T A;  3P1H A;  4BA2 I;  2UXC Q;  1L1O A;  1H9S B;  4Q0F A;  4GOP C;  5CV9 A;  1TS5 A;  4KJO A;  4BY1 B;  3F2B A;  2JA5 H;  5A2Q L;  4A3F H;  1U4R A;  2ICE C;  2PQA A;  1EIY B;  5BN4 A;  2E5L L;  4RKB A;  3H0G B;  2D5D A;  3E0E A;  4QL5 A;  3S1M H;  1V1O A;  4WOR A;  4NPS A;  1EFW A;  1KAW A;  1CQV A;  3CPW A;  5IP9 G;  4LFA L;  4OO1 H;  2MHV A;  4HJA A;  1NJI C;  5JVH 3;  1D7Q A;  2UUB L;  1SE8 A;  2GA4 B;  4HIM A;  1VQP A;  3M4O B;  2MNA A;  1S40 A;  2F3W A;  2JP1 A;  3NXW A;  1EYA A;  2JQO A;  2F0Q A;  2JA9 A;  1KL9 A;  5I2Y A;  1H9S A;  4F7X A;  5KIX A;  1HUN A;  4GLV B;  3K59 A;  3PUX A;  1HR0 Q;  3HFZ B;  3SDZ A;  4JI6 L;  4LF5 Q;  2XTI A;  4PQX A;  4NB3 A;  1Q12 A;  2FJ2 A;  2UXD L;  3M7N A;  1PRT B;  3OMG A;  5COR A;  1PTO C;  1E22 A;  5C6A A;  1BO0 A;  4BA1 I;  4A3I B;  4P73 A;  2QA4 A;  4IJH A;  2QDB A;  1MD2 D;  1IYU A;  1X3E A;  1TWC H;  1ET6 A;  5LMU Q;  3G7L A;  3HOW B;  2LXJ A;  3S17 B;  2UXB L;  4B3R L;  1LM0 A;  1V9P A;  4P75 A;  3I4N H;  3I72 A;  4A3M G;  4UY8 C;  1IBL L;  1B44 D;  5DM7 3;  2JK8 A;  1PRT D;  4MTK A;  2G5D A;  3AB9 A;  1E0B A;  2Q2U A;  2L5T A;  3RD4 A;  2LSS A;  4JYA Q;  3A8I E;  4X3S A;  2E76 C;  2ENB A;  2VQF Q;  5IIF A;  2UUC Q;  3NTK A;  5EJW A;  1Q1E A;  2OTL A;  1EL0 A;  4ILW A;  1WTP A;  3N52 A;  1SYB A;  3R2T A;  4PZ6 A;  1SE3 A;  1QWY A;  4OEL B;  1EOT A;  2Z8L A;  1GM5 A;  2Z1C A;  3NPP A;  3U50 C;  3L2P A;  4X3T A;  3HOV B;  1JOO A;  1N36 Q;  2CWP A;  3JAM E;  2WKD A;  5DM6 3;  4Y7N B;  2QIL A;  4MHE A;  3I90 A;  2B2U A;  3HOX G;  2R92 G;  1PH8 A;  1ROD A;  1HNW L;  5J1Z A;  1R4P B;  4OGQ C;  3D4W A;  2NWG A;  3PO2 G;  3MEF A;  5GRO A;  4DR7 L;  3ONA B;  3KF6 B;  2NVX B;  1GUT A;  4OWT B;  4UPA A;  2K5Q A;  2N3S A;  1VDZ A;  1IW7 D;  5IY0 A;  2IL8 A;  4L8J A;  5CR3 A;  4ID6 A;  1S5D D;  1B3Q A;  2KBN A;  5KNC A;  1HA6 A;  4IUT A;  4IPG A;  3O13 A;  3VA5 A;  3GO5 A;  1U5K A;  2MPM A;  1HXY D;  2R3Z A;  4FF3 A;  4JOI C;  4LMQ D;  3BG3 A;  3K8A A;  5C3E H;  1YHB A;  3S14 B;  4DUY Q;  2FXQ A;  2ZTE A;  4MIU A;  1PH6 A;  2RDH A;  3NEL A;  1PH2 A;  3NQT A;  1XMO Q;  4K5X A;  2JYO A;  1ZKO A;  3TME A;  3QOJ A;  1VQD A;  3S16 B;  2F0E A;  1H9R A;  4DR6 Q;  3KF6 A;  1TXY A;  3HG9 A;  4K8J A;  4P74 A;  2KHS A;  4DV7 L;  1Q7Y C;  1CI3 M;  3ERO A;  1V1P B;  4JBK A;  2VB2 X;  3CCE A;  2B3G A;  4BWG B;  4BY7 B;  4JI0 Q;  2K52 A;  1YHQ A;  1JIC A;  3D3R A;  3AQQ A;  1WTQ A;  4GKJ L;  2CW0 C;  5H1S E;  1TS4 A;  5D3I B;  2EYH A;  4DNI A;  3S2D B;  4IUP A;  3LX0 A;  2ICI A;  4APV A;  4KY5 A;  3EBE A;  1Z6H A;  3CC4 A;  2K14 A;  2UU9 L;  2RDG A;  3E9I A;  5BN3 A;  2I5M X;  4X62 Q;  4IPD A;  2RF4 A;  4JI8 L;  2LMC B;  5JEA H;  4JI1 L;  4BY7 G;  5CC4 A;  2A74 C;  4JI5 Q;  4LF4 Q;  1H9J A;  1AP0 A;  5M3M H;  3T1Y Q;  1EQT A;  2K5V A;  4A93 B;  1V1P A;  3CD6 A;  1YNN C;  1ESF A;  4JI2 L;  3W3A A;  2EJG C;  1FR3 A;  4IQZ A;  3EIV A;  3FHW A;  5IYC G;  2L12 A;  3J80 i;  3C1F A;  5K36 H;  3F2U A;  3CW2 C;  3CHB D;  2YU9 H;  1B50 A;  2WAQ B;  3E6Z X;  3S1Q B;  3OPO A;  2F03 A;  1VCI A;  1RCV D;  4C3J G;  4DV4 L;  4GS3 A;  5HY6 A;  2FMC A;  3PUW A;  2L15 A;  3J7Z C;  2A8V A;  1KRT A;  2NVT B;  4A3E H;  1TWH B;  1F2L A;  5FLM H;  4IAL A;  2M9V A;  2ZTC A;  2HDM A;  4RGO S;  1SRU A;  2KEE A;  1P8L A;  2NZ1 D;  2K5H A;  2CCZ A;  4LNQ A;  1KAB A;  4HMI A;  1N32 Q;  3T51 B;  1TWA B;  3G48 A;  4IUR A;  3S24 A;  3UDF A;  1G6P A;  1S5B D;  2EE1 A;  2JN4 A;  1L0X B;  2NN6 G;  1B4O A;  3GTJ H;  1U0L A;  3K5O A;  5C4X H;  1EY9 A;  2HQE A;  3OHX C;  5KNB A;  2E5L Q;  5DNF A;  4JI4 Q;  1SYF A;  2AMC B;  3TN2 A;  2B29 A;  3BJU A;  1TWG H;  3URY A;  3FVQ A;  1Z7T A;  2E2D C;  1D6E C;  2WAQ E;  4LFA Q;  2VB3 X;  4FF4 A;  1VQ7 A;  3TP7 A;  2NVY B;  2KCC A;  4WJW A;  5A35 A;  5CV7 A;  3H0G H;  5HGQ A;  4OX9 Q;  1MJC A;  3FEW X;  2XN9 C;  2K33 A;  3BS1 A;  2R7Z G;  3X3N A;  4JBW A;  3QO2 A;  2N8N A;  4EQP A;  1QVG A;  4QIW B;  4JI6 Q;  5KEE A;  2V4D A;  3IFT A;  5TSS A;  1IKM A;  3M4O H;  3MA2 B;  4S3S A;  1PH4 A;  2F4V Q;  2EYL A;  2OEO A;  2OQK A;  3TP6 A;  1S4Z A;  1JMC A;  4GN4 B;  5IP7 G;  2DNC A;  3CME A;  2MO1 A;  1HH2 P;  1I6V C;  4YY3 L;  3Q22 A;  1W6J A;  1BQQ T;  1SE2 A;  2KHI A;  3SK6 A;  5ELC A;  3TP8 A;  1MSG A;  3U9S A;  5JOB A;  4A3F B;  1F2Z A;  1BXT A;  3UI2 A;  1LTS D;  1SMY C;  3GTO B;  2OWO A;  4DV1 L;  3DHQ A;  1G29 1;  3H09 A;  4P2C B;  4A3I H;  1ENF A;  4FYD A;  4RG1 A;  3RLO A;  5LL6 X;  5IT9 E;  4B3S Q;  4JV5 L;  1Y1W B;  2BDO A;  1QE6 A;  4DN4 M;  3CCV A;  1N33 L;  3HOW H;  1EY4 A;  3VR4 A;  4YIJ A;  2JE6 I;  4BXX G;  4LFB L;  1SE4 A;  2RSO A;  1TVX A;  3ULL A;  1NY4 A;  2F0D A;  2BA1 A;  2HDL A;  5FLX c;  1GXD C;  1WYD A;  1PRT F;  4KKT A;  1GJX A;  1VF5 C;  4WRD A;  3CCS A;  3PO2 H;  1Z47 A;  3WOF A;  5C5L A;  1HNW Q;  2JEB I;  3KBG A;  2BE5 D;  1SFO H;  2F0G A;  1ONL A;  4PNY A;  1CKN A;  3EA6 A;  1QCB D;  5HGT A;  4LF6 L;  2G9H D;  2B8F A;  1CKM A;  3K5M A;  1HQM C;  2F3I A;  3HOV H;  4DR7 Q;  5EAY A;  2RCN A;  2EXD A;  2N88 A;  1TWC B;  1FNW A;  1DOK A;  2JA8 B;  2KVM A;  1T5E A;  3TQY A;  1L2F A;  1SYE A;  1VMC A;  5AJ3 Q;  3J81 E;  5C4Z A;  1DZ1 A;  3NHH A;  1WCM B;  3HKZ G;  2K04 A;  3CQZ H;  3MHB A;  3EVQ A;  2NVX H;  4DV2 Q;  2I5H A;  2HQL A;  1YNN D;  4YHH L;  1TS3 A;  4HIK A;  3H6M A;  3TS2 A;  2K5W A;  4IUU A;  3PIO 3;  1IBM L;  4QB4 A;  1FNU A;  4OO1 I;  2F0M A;  3QG1 A;  1KQS A;  4FF1 A;  1STA A;  4A3C H;  1U9R A;  1J6Q A;  1O7I A;  3FDT A;  3OIP A;  1TU2 B;  3Q0A A;  2YYZ A;  3CCR A;  1ILP A;  1LTL A;  3S14 H;  3S2H H;  4RA8 A;  1ML0 D;  4DAM A;  5GAG C;  5C4H A;  3K58 A;  1CT1 D;  1J8I A;  2WB1 B;  2KEC A;  1S5F D;  1GKH A;  5JPN C;  4KKS A;  4DV6 Q;  2RQX A;  1A8V A;  1EUJ A;  2YTV A;  1MI2 A;  4F8M A;  1VQB A;  4GKJ Q;  1SYD A;  2MGS A;  1R4Q B;  3BZD B;  4G4K A;  4JI3 L;  3PCO B;  4RCO A;  1OTC A;  2L0C A;  2Q8T A;  2I07 B;  1BBX C;  4ZUJ A;  3QJY A;  1E24 A;  4WJ4 A;  1FNV A;  2OF1 A;  4BY7 H;  3NQI A;  2Z0S A;  3K81 C;  5M5W B;  3H94 A;  4N8X 1;  4NKL A;  4JI1 Q;  1ICF B;  2KUM A;  2IX3 A;  2X69 A;  1NE3 A;  3KF8 B;  3S2D H;  2B2T C;  4DV0 L;  4FO2 A;  3W2D A;  4DK3 C;  1HHV A;  5M9O A;  2B63 B;  3OWF A;  2XWB B;  5IYC H;  1XPU A;  1EY8 A;  3D8G A;  3PUV A;  4JW0 A;  1ENA A;  1TS2 A;  5ELF A;  4XYQ A;  4IFD H;  1IZ6 A;  1F9R A;  3JAM c;  5CV6 A;  4Z9C B;  1EFI D;  4A93 H;  2K5N A;  2Z6B A;  1PYB A;  4P72 A;  3GTQ B;  5IGF A;  3CCJ A;  2F0O A;  4B9W A;  2C35 B;  2RDF A;  4KHZ A;  4QQB X;  1VMP A;  1PH3 A;  1M90 C;  5EKI A;  4C3H B;  3G6E A;  1C7Y A;  1BF4 A;  3G6J B;  3CCL A;  3T4A C;  4AQY Q;  3D4D A;  2EYP A;  3VR6 A;  4LJZ C;  5IYB G;  4A3B B;  3J80 E;  5EKK A;  3S1R H;  2FMM A;  1SRO A;  5CV4 A;  1WI5 A;  4DF7 A;  2H4O A;  2QGQ A;  2NVT H;  1TWF B;  1WOC A;  4XIG S;  5FLX L;  2KJX A;  1SDF A;  1SMY D;  3GV3 A;  1VQL A;  1X65 A;  1SNQ A;  1AEX A;  4TQU S;  4Y52 H;  4ZK9 B;  3A0J A;  4ALP A;  1EWI A;  4XT3 B;  3AFP A;  3NEN A;  1PH7 A;  4ME5 A;  1BOS A;  3NBH B;  1MBY A;  3K80 C;  1EU3 A;  1TWA H;  3SE0 A;  2MO0 A;  1W3S A;  1PTO F;  2A1A A;  4GLX A;  4F87 A;  4L5Q A;  4GN5 A;  2HHH Q;  1C9O A;  1PMR A;  5E4W C;  4DAV A;  5IGG A;  1QVF A;  2F3V A;  5M3M B;  1KAA A;  4X3U A;  1EQV A;  1S5C D;  4X66 Q;  4DV3 L;  3DWA A;  1VQJ A;  3ZYY X;  2RCF A;  5C0X G;  1CTM A;  1RIP A;  4K5W A;  4A76 A;  3HOZ B;  4DXF A;  4L6T B;  2VQE Q;  4PV1 C;  3M4P A;  1YJN A;  4NXN L;  2ZJR A;  4FF2 A;  1X9N A;  4NP5 A;  1DGS A;  4LF7 Q;  2NVY H;  1YJ9 A;  3E3X A;  3M85 A;  2E2J B;  4JC0 A;  4O2D A;  3K7A H;  3NBH A;  4FVM A;  1ZYR C;  2M00 A;  2E2I H;  2EY1 A;  2AUJ D;  3P20 A;  3VYU A;  4X65 Q;  4O42 A;  3UE0 A;  3H91 A;  4HJ7 A;  3EN2 A;  3OYY A;  1G91 A;  2XSC A;  3DMU A;  2JSO A;  3TEH B;  1WD0 A;  3WDN A;  5GAD C;  4PMW A;  5KGU A;  2VW9 A;  4DV1 Q;  2B2Y C;  4RGM A;  4WFN 3;  2OTJ A;  4POG A;  4DXG A;  1LT5 D;  3SEB A;  2A69 D;  1MSH A;  1TWG B;  1CFM A;  1N33 Q;  1KXL A;  1B2T A;  3GTO H;  1EZ6 A;  1L0Y B;  5ELN A;  1FGU A;  4CKC A;  3I91 A;  1Y1W H;  3MTS A;  1WVL A;  1VQI A;  4J15 A;  4H0L C;  4YCV A;  1OXU A;  5JJL A;  3MEH A;  1PFB A;  3MXG A;  3FMC A;  3CF5 A;  2JXM B;  4GN3 B;  4R8N A;  4CKB A;  3SK5 A;  5IOC A;  3F2D A;  3J7A 5;  4KKU A;  4G7H C;  2HCC A;  2Z6K C;  1WD1 A;  1CQF A;  3OOC A;  4GNX B;  1EYC A;  2KHJ A;  2FHT A;  3RN2 A;  4N9P A;  3V2T A;  1A0I A;  4XQJ A;  3DM3 A;  3JAM L;  1G2T A;  3PUY A;  1HTL D;  2RBM A;  4OIJ A;  3CC7 A;  3C46 A;  4JVZ A;  4A3M B;  3KK7 A;  1XMQ L;  1F2Y A;  3IFD A;  4RWS C;  4XDX A;  2DJG C;  1XPR A;  1BKB A;  5KYL A;  5J39 A;  1PDQ A;  3PF5 A;  1PYS B;  1EY0 A;  1H9K A;  1JWS D;  5IGD A;  1D8L A;  2V1C C;  1X3Q A;  2N49 A;  1DD2 A;  3V05 A;  4QF4 A;  2JA8 H;  4IUN A;  1VQ8 A;  4LK1 C;  1OXS C;  4UP7 A;  1XNR L;  2SOB A;  1X55 A;  2K32 A;  1VQ6 A;  3KFU A;  4GNX A;  2E8G A;  1IYJ B;  2YTY A;  1NBW A;  2CQA A;  2ES2 A;  1WCM H;  5KYI A;  1VQC A;  2HCI A;  3ZJY C;  1B8A A;  2BCO A;  4XT1 B;  1CSP A;  3I3C A;  4JG2 A;  1AZP A;  2F0N A;  1N34 L;  3PO3 B;  3X3M A;  1VQG A;  3HOX B;  2R92 B;  1ET9 A;  5HUR A;  1WFQ A;  4JI7 Q;  2WP8 J;  1LO5 D;  2JA7 G;  1MJE A;  3KLS X;  5FKA C;  4KN7 C;  3ULJ A;  3PO2 B;  2QDL A;  4GKK Q;  4I7A A;  1A2T A;  2QF7 A;  4ZCK A;  1D2B A;  5GAE C;  4Q5V A;  1CUK A;  1SFO B;  5I2X A;  4RAU C;  3PV0 A;  1K9M C;  1FJG Q;  5IT9 c;  3HOY G;  2K28 A;  1E2Z A;  3S9W A;  5G3L F;  3UE1 A;  4A75 A;  2F0H A;  1AE2 A;  1CZW A;  1GUS A;  4LW1 A;  1RL2 A;  3PO3 G;  2A6H C;  5ELB A;  1HZA A;  3WWV A;  3C2P A;  4R8I A;  3PIO A;  5ELO A;  4LF8 L;  4ZQ3 A;  1ICW A;  5M5X B;  4KV6 A;  5CMD A;  3MXN B;  3QR8 A;  3CQZ B;  1CHP D;  2CWA A;  2LY7 A;  1B9N A;  2OXP A;  3MAQ A;  5M5W H;  4LF9 L;  1EY5 A;  2F0U A;  3BVG A;  3CP0 A;  4U68 A;  3QIA A;  2B8G A;  1J5E L;  4K0K L;  1X56 A;  5CBA E;  2B63 H;  3GTK B;  4BBR G;  4DUZ L;  3MFY A;  3HEJ A;  4HIO A;  1GHK A;  3S2H B;  2F0P A;  5ISR A;  1JT8 A;  1LYL A;  2IT1 A;  1BNZ A;  4NXM L;  2IY5 B;  3GQB A;  2CH4 A;  1QVC A;  5C4J B;  2NZH A;  4GOP B;  5DLQ E;  1G51 A;  3MXN A;  1I94 Q;  3J81 c;  1O7Y A;  3GTQ H;  3DM1 A;  1VQ5 A;  3BZK A;  4QUF A;  4DR5 L;  3OW2 A;  1SNC A;  4IPH A;  3T1H Q;  4C3H H;  4AYB B;  1EYD A;  3M9B A;  3STB D;  1STN A;  4IUQ A;  1PHJ A;  2PNR C;  1X3F A;  4TVA B;  2X6G A;  4IJL A;  5I6W A;  2LXK A;  3CMA A;  4A3B H;  2F0J A;  2F0S A;  1U4P A;  5JVG 3;  1S72 A;  1JB7 A;  5BN5 A;  3SVM A;  1TWF H;  4DR2 L;  4C2M B;  5FJ8 H;  2SNM A;  4DV3 Q;  1VQH A;  2MP1 A;  1LT6 D;  1RKN A;  4DA2 A;  4AYB G;  4K6L A;  3R93 A;  4GOP A;  4O0A A;  3C3L A;  1A62 A;  5D14 A;  3TP5 A;  1I5F A;  5C0X J;  1YI2 A;  1EYG A;  3K57 A;  1E2V A;  1EQR A;  1SNM A;  1JJC B;  3A7A B;  3NWT A;  2IHF A;  4C3J B;  2VNU D;  4A3G G;  1PTO B;  3Q24 A;  2QCP X;  1UE7 A;  5BR8 L;  2UUA L;  4CJ1 B;  4AYB E;  2ZJP A;  1K28 A;  3DEP A;  2D2C C;  5K5P A;  1F77 A;  4LWC A;  4NMZ A;  4C3I G;  3CCM A;  1LTT D;  1STH A;  3HOZ H;  1I4P A;  3H3V H;  3TRZ A;  2Q8R E;  3MC0 B;  3TZU A;  3J7Y W;  4EQO A;  2Z6K A;  2EJM A;  1LV9 A;  2R93 G;  4HAE A;  4KMU C;  4C1N I;  5FO8 B;  2E2J H;  1XYI A;  2JA6 G;  1STE A;  3NUC A;  3S1R B;  4HJ5 A;  1AN8 A;  2B2W C;  3HP3 A;  4R4I A;  5E7N A;  1PTO D;  3MFG A;  5D65 A;  5F2D A;  1SNO A;  1EIF A;  2J4X A;  4M8A A;  4DV5 L;  1YNX A;  5ELD A;  2H1E A;  2ZM6 Q;  1YZ6 A;  2K01 A;  4MN3 A;  1BCP C;  1E1T A;  1DJR D;  1UE1 A;  1Z9F A;  4BBS G;  2I5L X;  3AYH B;  5IT9 L;  3KLW A;  3HOU G;  2R7Z B;  2EIF A;  2G9D A;  4ABN A;  5IP9 H;  4X64 L;  3RNU A;  2PI2 E;  3QWN A;  4IFD I;  4B3M L;  2A73 B;  1YIT A;  3J7A F;  2CH4 W;  3PGZ A;  1M8A A;  2IW3 A;  1HUM A;  2K1B A;  4K8I A;  2AHO B;  1M4V A;  2LFN A;  1LTA D;  2UUB Q;  4DR3 L;  3RLF A;  2KCT A;  2BH8 A;  5E3F A;  4PZ7 A;  1E3P A;  1UEA B;  3J80 c;  4LFC L;  3BZC A;  4YWM A;  3VDY A;  4A3K G;  3K7A B;  2E2I B;  2A68 C;  2ID0 A;  5M3F B;  1PFM A;  3GTP H;  1Q86 C;  3OTO L;  4IOC A;  1ESR A;  1T9H A;  3TS0 A;  1VQM A;  2A6H D;  2UXD Q;  2RSN A;  4A3D G;  1G8Z D;  1D5Z C;  1EY7 A;  4E6I A;  5IGB A;  3G4S A;  1DCZ A;  2FFK B;  1HTP A;  4A3J G;  2C9O A;  2F0W A;  4FXK C;  5FK9 C;  4HID A;  3Q6S A;  5M3F G;  1AFP A;  4A3M H;  3L3O C;  4IUV A;  1QZH A;  3J81 L;  1VQN A;  2UXB Q;  5DAU A;  1Q3L A;  4B3R Q;  1I4R A;  3MVV A;  2DY8 A;  1Y8O B;  5IOD A;  1IBL Q;  1AW7 A;  2XWJ B;  3L0O A;  3QB3 A;  1C4Q A;  2QW7 A;  3EFX D;  2B2V C;  1XTC D;  4RFB A;  1QNU A;  1EIH A;  1N34 Q;  1QUQ B;  1XNQ L;  1Q90 A;  4I7Z C;  5LMN L;  1SJE D;  3KOJ A;  1GUG A;  3P75 A;  4K5V A;  4HJ9 A;  4JOI A;  2RVL A;  2NZO A;  1GOZ A;  3HOY H;  3I4L A;  5C44 G;  3CKI B;  4YCW A;  1Y69 U;  2IWH A;  4NW2 A;  3UDI A;  3Q8D A;  3F1Z A;  4CHT B;  3PO3 H;  2Q2I A;  3S1N H;  2NVQ B;  2E75 C;  3HOX H;  4KHP L;  2R92 H;  2P5Z X;  1WTW A;  1FGB D;  2L1B A;  5CGK A;  2UXC L;  3CPF A;  3NBI A;  1HFN A;  1J9O A;  4F88 A;  4CDC C;  1IKL A;  1QG7 A;  2E2H B;  3HKZ B;  3KJO A;  2CW0 D;  1EY6 A;  1QUQ A;  3A56 A;  3RZD B;  2VL6 A;  2JA5 G;  1Y1V G;  4CBV A;  1XXG A;  1I50 B;  4CDE C;  2A5H A;  4XQN A;  1SND A;  3BDL A;  1D5X C;  3K5N A;  1YJW A;  1Q8I A;  3K7U C;  2ZTD A;  3FPP A;  5M5X H;  3H15 A;  4OO1 G;  4KY6 A;  2AWO A;  3C1E A;  3ERQ A;  3KUP A;  4JK1 C;  3DEO A;  4H7B A;  1HR0 L;  2Q8I B;  1BVS A;  1UAP A;  4LF5 L;  2AKW B;  5IYD G;  1SEB D;  2WFW A;  1VQ9 A;  2ASB A;  4R1J A;  3HKZ E;  3GTK H;  1K8A C;  5G3L D;  4GZY C;  1SYC A;  3E9H A;  1FD7 D;  1L1O C;  4HCE A;  2D62 A;  1WTX A;  1VQK A;  1DYQ A;  4DV7 Q;  1WTV A;  3M3Y B;  1O78 A;  3NSW A;  4N8F A;  1NUC A;  4IZ8 A;  5CYU A;  3OMC A;  3HGB A;  5EKL A;  5LMU L;  3GDE A;  1T5X D;  5C4J H;  5D3D A;  4K2L A;  1V43 A;  3A54 A;  3J80 L;  2RHQ B;  5IGC A;  1TY2 A;  3MWY W;  3GD7 A;  1XWE A;  3W5O A;  3A5Z B;  1DOL A;  3G71 A;  3JAM i;  3I4N G;  1A6X A;  4JYA L;  1JJ2 A;  1IBK L;  2XGT A;  2VQF L;  2UU9 Q;  1ILQ A;  2UUC L;  4A3G H;  3MXP A;  4JI8 Q;  4A3L G;  1EEF D;  5T1I A;  1F9S A;  1TII D;  2XVS A;  4DK1 A;  4C2M H;  1HZC A;  1B9M A;  4JPB W;  2L9H A;  1X32 A;  1KD1 C;  4FXD A;  2EY5 A;  4L5S A;  4JI2 Q;  3NE5 B;  2PW7 A;  4KHV A;  2AUK A;  4PMC A;  3CRK C;  4RHS A;  3I56 A;  1N36 L;  2O5J C;  4DK6 C;  1I6H B;  4C3J H;  1YEZ A;  2JA6 H;  1Q8K A;  3J7A V;  2NYZ D;  2NTS A;  1PTO H;  1QOH A;  3DWQ A;  1Q82 C;  4DV4 Q;  2EYF A;  1QB5 D;  1N9W A;  3ULP A;  1GO3 E;  5C5M A;  2VUM G;  3KF8 A;  2EY6 A;  5IWA L;  5I4D A;  2NN6 H;  1KC8 C;  1GUW A;  1LTB D;  4BBS H;  1VF7 A;  3M4Q A;  1JE5 A;  2DY7 A;  3FP9 A;  4B9X A;  2K05 A;  1SSO A;  3ND8 A;  4QMG A;  1A3T A;  3CCQ A;  2KED A;  3CU7 A;  1UE6 A;  4DUY L;  1N8R C;  4KLK A;  3I2Z A;  5JJZ A;  5LMN W;  1E7Z A;  4QY7 A;  1OXX K;  2F1M A;  2D0P A;  5C3E G;  1CA5 A;  4YCU A;  3DLL A;  5IGE A;  1LAC A;  1XTD A;  2KCN A;  1XMO L;  1KDA A;  2Z4H A;  3D31 A;  1EEI D;  5CV5 A;  2B2V A;  4A3K H;  3CRL C;  1OXV A;  5CBE E;  1SXT A;  3SGI A;  2B2U C;  2A19 A;  4U67 3;  2R7Z H;  1BBW A;  1HRJ A;  2C5C A;  1NTG A;  3FKI G;  2EDG A;  4UP9 A;  1K0R A;  1FL0 A;  2NBF A;  3RN5 A;  4J1M A;  1BDO A;  2AQ2 B;  3R8B A;  2R7F A;  2F4I A;  4HR7 B;  3VR5 A;  4DNT B;  4DGZ A;  1HNZ L;  2Y0S G;  3I70 A;  5IP7 H;  5M3F H;  2XRQ D;  3E0J A;  3VYR A;  3TBI B;  1A2U A;  3TRE A;  4X62 L;  3K5L A;  5J22 A;  4YY3 Q;  3L7Z C;  3EQL C;  2A6E C;  4JI5 L;  4LF4 L;  2X6L A;  3T16 A;  2XIW A;  2MFI A;  1TQO A;  5JEA G;  3I4M G;  3LWU A;  4MTN A;  2RA4 A;  1OO9 B;  3IRB A;  5M5Y B;  1XPO A;  1HR0 W;  4OON A;  4PZ8 A;  4DPG A;  3T13 A;  4JV5 Q;  4KY7 A;  1JWM D;  1AH9 A;  4HSP A;  2IX0 A;  3R2I A;  3UDX A;  4BXX H;  3GTM B;  2RKS A;  4LAA A;  4ZLT F;  4CJ0 B;  2F0F A;  3U4V A;  1CM9 A;  5K36 G;  4EX5 A;  1NAP A;  4LFB Q;  2K6A A;  5EGT A;  2F52 A;  3U58 A;  1PH5 A;  4A4I A;  1KIX A;  1E1O A;  3HRZ C;  1EWC A;  3NTH A;  3CXC A;  1HZB A;  1NNX A;  3GTP B;  1PZJ D;  2J0T D;  4A3E G;  3H3V I;  4UDU C;  5FLM G;  4HN7 A;  1CSQ A;  4K6D A;  2AQ1 B;  1Y1V H;  1U4M A;  1WTR A;  1VQE A;  1DON A;  4LF6 Q;  3ERS X;  2NVQ H;  3SHL A;  4JI4 L;  1HQR D;  1STY A;  4L5T A;  3J81 j;  1RTO A;  5C4X G;  1X3G A;  1BR9 A;  4RGT A;  4DNR B;  3QOL A;  3A8K E;  3D0F A;  2E2H H;  3NEM A;  4ODG A;  2KOL A;  1PYW D;  4JBJ A;  4BY1 G;  3F8T A;  3RZD H;  1KRS A;  2PQE A;  1O7Z A;  5EBC A;  3GV6 A;  5T1G A;  5I9O A;  4DU9 A;  4OX9 L;  3OIQ A;  4X3K A;  4IPC A;  4HJ8 A;  5IYD H;  4AIM A;  1I50 H;  4YHH Q;  2KQ3 A;  3H0G G;  4ZRZ A;  1TKW B;  1KTK A;  1YVC A;  3CCU A;  2JA7 B;  1NMF A;  2B2T A;  2EYM A;  5E1F A;  1IBM Q;  1STG A;  1I3Q H;  3KBX A;  3PSI A;  2PZU A;  1Y8N B;  4EQN A;  2F4V L;  1UWV A;  1UEB A;  2DGY A;  1RF2 D;  3HOY B;  1PLF A;  3PF4 A;  2N55 A;  1SJH D;  4UP8 A;  3S1N B;  1ZXT A;  2F0K A;  1R9T B;  1MHW C;  4R4C A;  3FRP B;  1V1Q A;  3I4O A;  1WTO A;  3F2C A;  4G7Z C;  2EVB A;  2O4X A;  1CK1 A;  5A2Q E;  1UE5 A;  4JI3 Q;  2R7D A;  4ZAI A;  3M3Y H;  1O80 A;  2I0Q A;  1STB A;  3I55 A;  4B3S L;  2SEB D;  3PIP 3;  1YIJ A;  1L0W A;  1GHJ A;  1KDC A;  4A3I G;  4FXG C;  1IBK Q;  4A3L H;  2H5X A;  2HIX A;  4P71 A;  4ME3 A;  4XTC S;  1VS0 A;  1QJO A;  1GUO A;  1K8M A;  3CAM A;  3R3O A;  4BBR B;  2F0V A;  1V8Q A;  3HOW G;  4DV0 Q;  1Y14 B;  2D0O A;  1OXT A;  3PQI A;  1HJP A;  1NSN S;  1SMX A;  4AH6 A;  2PCF B;  1BCP F;  1U4L A;  4R4O A;  4EQ5 A;  3J81 i;  4X6A H;  2NUC A;  5EPJ A;  1X3P A;  2RHS B;  3VR3 A;  2PMZ B;  4J6H A;  4TKO B;  4OWW B;  1I4G A;  2SDF A;  4V0B A;  1LTR D;  2QEX A;  2HUG A;  4DR1 L;  1DOM A;  1Q46 A;  4ULL A;  2AWN A;  2I46 A;  2PYK A;  2VUM H;  1MKH A;  1PZI D;  1ZYR D;  2TSS A;  1I6H H;  1TR5 A;  4FP5 D;  1AZQ A;  5IYB H;  4RH6 A;  3HOV G;  3BVZ A;  1A3U A;  3BYY B;  5IWA Q;  5AJ3 L;  4R9W A;  3RZO B;  2PW5 A;  2MJ8 A;  3BVM A;  4DKA C;  4WJ3 M;  1H9M A;  1LT3 D;  1UUP A;  2A6E D;  3CC2 A;  1ENC A;  3VYS A;  3W1B A;  1SBB B;  1F2M A;  4DV2 L;  3NK9 A;  1EOV A;  4C1N K;  3S15 H;  3HZX A;  4IN3 A;  2HT1 A;  4A3G B;  1K83 B;  1WJJ A;  2PMZ E;  3DUZ A;  2B2Y A;  4RGN A;  3JC6 6;  1G2S A;  4RMF A;  3SK8 A;  1PFN A;  5GAH C;  1VQO A;  3FKI H;  5C0X H;  1SN8 A;  4C3I B;  4O1N A;  4KK7 A;  3KLS A;  1ASZ A;  3HS0 C;  4A3C G;  1JQY D;  4M1U B;  4N9T A;  3AEV A;  2PNH A;  2R93 B;  4B08 A;  3DWP A;  4KD4 A;  4DV6 L;  4NXN Q;  3HKS A;  1M1K C;  4KJN A;  2JA6 B;  2BE5 C;  3A8J E;  4IO9 A;  5DEH A;  3SXH A;  1HNZ Q;  1IXR A;  3UDG A;  3PMF A;  5FO9 B;  4H44 C;  2EJF C;  3BDC A;  1K0S A;  5LL6 S;  1JCK B;  2YTX A;  3OSO A;  1NR2 A;  2QEJ C;  3NP8 A;  1Q81 C;  1RDP D;  5EBD A;  1SNP A;  3I4M H;  1KHI A;  4ZKC B;  4CDF C;  1IHZ A;  2EYO A;  4BBS B;  3GTG H;  4QCL A;  3ND9 A;  3VYT A;  1C0A A;  1X54 A;  4NDX A;  3HOU B;  5JEA J;  1RHP A;  5JJI A;  3EJI A;  2J7Z A;  3LGJ A;  3GTL H;  5C3W A;  1B3A A;  1HNX L;  4IFD G;  1H95 A;  2DN8 A;  2PZW A;  3VA7 A;  3AU7 A;  5NUC A;  2ATW A;  3D6W A;  3OW7 A;  3BYT B;  4A3K B;  4DAP A;  1SAP A;  5M5Y H;  2PI2 A;  3MXU A;  4FDB A;  4A93 G;  3RUZ A;  1XX8 A;  5EQ0 A;  2D9U A;  4EVO A;  1CKO A;  4TRD A;  4HTH A;  4AQY L;  3GTM H;  1TT2 A;  1I4Q A;  2XNA C;  4RKL A;  4A3D B;  2VY3 A;  5I9P A;  4DK0 A;  2WAQ G;  3FPU B;  5C3X A;  4A3J B;  1HZ9 A;  1AE3 A;  2KEN A;  2QKI C;  1PZK D;  3ER0 A;  4MZ9 A;  1QZG A;  1K73 C;  4GLA C;  2M2L A;  4QJF A;  4ZYS A;  2HIV A;  3I73 A;  2OT2 A;  4BY1 H;  2EYJ A;  2GVA A;  2NN6 I;  2HHH L;  1I4X A;  1XMQ Q;  1GUN A;  3IL8 A;  1KLU D;  3U4Z A;  2CVR A;  3A55 A;  5E4X A;  4QUC A;  1QIL A;  4XQQ A;  4HMJ A;  4X66 L;  5I6Y A;  3SR1 A;  2VQE L;  1XNR Q;  3NWS A;  5ELE A;  3LNN A;  1P16 A;  1PV4 A;  4LF7 L;  2O5I C;  4DR4 L;  5C44 B;  2K75 A;  2XRS D;  4KI0 A;  5IE8 A;  4X65 L;  1E2W A;  3T53 B;  2NTT A;  4HSV A;  2K50 A;  1HFG A;  1HCZ A;  4K14 A;  1IL8 A;  2IPK D;  4B3T L;  3K0X A;  1PXU A;  3SK4 A;  2JA7 H;  1YNJ C;  4ZKB B;  1JJG A;  2CFM A;  4H13 C;  3U9O A;  1A63 A;  3TDQ A;  5JJK A;  2TMP A; 
#chains in the Genus database with same CATH homology
 3IKJ A;  1CHQ D;  2JA5 B;  1Y1V B;  4XYO A;  5FOB B;  1RJT A;  2R6G A;  2Z4I A;  3S1M B;  1S5E D;  1JOQ A;  2L11 A;  4OL7 A;  4KN4 C;  1K8O A;  1EU4 A;  2LS0 1;  4RHR A;  1LTG D;  2K5D A;  3WOE A;  2JEA I;  2BOS A;  4RCN A;  1I3Q B;  3VR2 A;  3NTI A;  1NR4 A;  2DNE A;  1CZG A;  3D4R A;  1II3 A;  1JE4 A;  4CGY B;  2LKV A;  2VXW A;  3N6R A;  3BDO A;  3H3V C;  2PO4 A;  1Y8P B;  2EY2 A;  3D6C A;  1LT4 D;  1BCP B;  1DXM A;  1NCV A;  5LHY 1;  1A15 A;  4J8Q A;  1G6Z A;  2WV6 D;  3I4N B;  2IX1 A;  3AMU A;  5KND A;  5JPM C;  2WII B;  3ITP A;  1EWH A;  2CHB D;  2E74 C;  3T56 B;  2A69 C;  1MGS A;  2WIN B;  5EPK A;  4EGV A;  4OHJ A;  2B2W A;  2WKC A;  1BCP D;  2PZT A;  3GP7 A;  4CJ2 C;  1RTN A;  3TZD A;  4G7O C;  2F0I A;  2EOT A;  3K6O A;  2EZV A;  3IAY A;  4I65 A;  2SNS A;  5CV8 A;  4V19 0;  1RD9 D;  1JR0 D;  3KLR A;  4G57 A;  1UNS A;  2K03 A;  1LTI D;  2FIN B;  2ZT9 C;  1A3V A;  4BS9 A;  2L4N A;  2WAC A;  1DM0 B;  2O2L D;  2VUM B;  2A68 D;  4UAI A;  1KLG D;  1Q1B A;  1EZ8 A;  2L55 A;  3V96 A;  2K7V A;  4XXE A;  1JOR A;  1BUV T;  3OWE B;  4ZUI A;  4HED A;  2BA0 A;  2F0L A;  2EXZ A;  5FO7 B;  5C3E B;  2ZXP A;  3S15 B;  4CKE A;  4HCS A;  3TSS A;  1F9P A;  1PRT C;  4IFD J;  3FKI B;  1W6K A;  1JC7 A;  2IJ0 A;  1B1Z A;  1LLR D;  1D1I A;  1FYC A;  1TY0 A;  4FNF A;  1YNJ D;  2NB0 A;  1HPC A;  4K2K A;  2Y0S B;  4PMB A;  2R61 A;  1IYV A;  2B39 A;  3M7G A;  1SYG A;  3RMH A;  2EPB A;  4C3H G;  2KA7 A;  5EPL A;  1LAB A;  1JOK A;  3L9A X;  2AQ3 B;  3I4M B;  1I4H A;  1F9Q A;  3GTG B;  1C48 A;  1KNE A;  1C8C A;  3K0Y A;  2PPB C;  1IW7 C;  4KD3 A;  4OIK A;  1JWU D;  1KNA A;  5AFW A;  3GTL B;  1QNK A;  2YU9 B;  3DXJ C;  4C56 C;  5C0X I;  3A7L A;  1HA5 A;  1B53 A;  4L63 B;  3MZ5 A;  4A3E B;  1D5M C;  4KTA A;  4DAY A;  3M4Y A;  2ZXR A;  4DFA A;  1ZEQ X;  3Q23 A;  2MUY A;  2ZXO A;  3LWE A;  3PUZ A;  5KRU A;  3I8Z A;  1D1K A;  5JAV A;  3GTJ B;  1KDB A;  5C4X B;  1O7L A;  5FLX E;  1CA6 A;  4TSS A;  2BDN A;  1JB3 A;  3P7J A;  1EIG A;  5COY A;  3E5S A;  2F0T A;  3P1H A;  4BA2 I;  1H9S B;  4Q0F A;  4BY1 B;  5CV9 A;  1TS5 A;  4KJO A;  5A2Q L;  1U4R A;  2ICE C;  5BN4 A;  4RKB A;  3H0G B;  2D5D A;  1V1O A;  4WOR A;  1CQV A;  4OO1 H;  2MHV A;  5JVH 3;  2GA4 B;  3M4O B;  2F3W A;  2JP1 A;  3NXW A;  1EYA A;  2F0Q A;  5I2Y A;  1H9S A;  4F7X A;  5KIX A;  1HUN A;  3K59 A;  3PUX A;  3SDZ A;  4PQX A;  1Q12 A;  2FJ2 A;  3M7N A;  1PRT B;  3OMG A;  5COR A;  1PTO C;  5C6A A;  1BO0 A;  4BA1 I;  4A3I B;  2QDB A;  1MD2 D;  1IYU A;  1ET6 A;  3G7L A;  3HOW B;  3S17 B;  3I72 A;  1B44 D;  5DM7 3;  1PRT D;  3AB9 A;  1E0B A;  2L5T A;  3RD4 A;  3A8I E;  4X3S A;  2E76 C;  2ENB A;  5IIF A;  3NTK A;  5EJW A;  1Q1E A;  1EL0 A;  4ILW A;  1WTP A;  3N52 A;  1SYB A;  3R2T A;  1SE3 A;  1QWY A;  1EOT A;  2Z8L A;  2Z1C A;  3NPP A;  4X3T A;  3HOV B;  1JOO A;  3JAM E;  2WKD A;  5DM6 3;  4Y7N B;  2QIL A;  4MHE A;  3I90 A;  2B2U A;  1ROD A;  5J1Z A;  1R4P B;  4OGQ C;  3D4W A;  2NWG A;  3ONA B;  2NVX B;  1GUT A;  2K5Q A;  1VDZ A;  1IW7 D;  2IL8 A;  4L8J A;  5CR3 A;  4ID6 A;  1S5D D;  5KNC A;  1HA6 A;  4IUT A;  3O13 A;  3VA5 A;  3GO5 A;  2MPM A;  1HXY D;  2R3Z A;  4FF3 A;  4LMQ D;  3BG3 A;  3S14 B;  4MIU A;  2RDH A;  3NQT A;  4K5X A;  2JYO A;  1ZKO A;  3TME A;  3QOJ A;  3S16 B;  2F0E A;  1H9R A;  3HG9 A;  4K8J A;  2KHS A;  1CI3 M;  3ERO A;  1V1P B;  2VB2 X;  4BWG B;  4BY7 B;  1JIC A;  3D3R A;  1WTQ A;  2CW0 C;  1TS4 A;  5D3I B;  2EYH A;  3S2D B;  4IUP A;  3LX0 A;  2ICI A;  4KY5 A;  1Z6H A;  2RDG A;  5BN3 A;  2LMC B;  5JEA H;  5CC4 A;  2A74 C;  1H9J A;  1AP0 A;  1EQT A;  4A93 B;  1V1P A;  1YNN C;  1ESF A;  3W3A A;  2EJG C;  1FR3 A;  4IQZ A;  2L12 A;  3C1F A;  5K36 H;  3F2U A;  3CHB D;  1B50 A;  2WAQ B;  3E6Z X;  3S1Q B;  3OPO A;  2F03 A;  1VCI A;  1RCV D;  4C3J G;  2FMC A;  3PUW A;  2NVT B;  1TWH B;  1F2L A;  4IAL A;  2M9V A;  2HDM A;  4RGO S;  2KEE A;  2NZ1 D;  1KAB A;  4HMI A;  3T51 B;  1TWA B;  4IUR A;  1S5B D;  2EE1 A;  1L0X B;  2NN6 G;  1B4O A;  3K5O A;  1EY9 A;  2HQE A;  3OHX C;  5KNB A;  5DNF A;  1SYF A;  3TN2 A;  3URY A;  3FVQ A;  1Z7T A;  2E2D C;  1D6E C;  2VB3 X;  4FF4 A;  3TP7 A;  2NVY B;  2KCC A;  4WJW A;  5A35 A;  5CV7 A;  3FEW X;  2XN9 C;  2K33 A;  3BS1 A;  3X3N A;  4JBW A;  3QO2 A;  4EQP A;  4QIW B;  5KEE A;  2V4D A;  3IFT A;  5TSS A;  1IKM A;  3MA2 B;  4S3S A;  2EYL A;  2OEO A;  3TP6 A;  1S4Z A;  2DNC A;  1I6V C;  3Q22 A;  1W6J A;  1BQQ T;  1SE2 A;  3SK6 A;  5ELC A;  3TP8 A;  1MSG A;  3U9S A;  5JOB A;  4A3F B;  1F2Z A;  1BXT A;  3UI2 A;  1LTS D;  1SMY C;  3GTO B;  3DHQ A;  1G29 1;  3H09 A;  4P2C B;  1ENF A;  4FYD A;  5LL6 X;  5IT9 E;  1Y1W B;  2BDO A;  1QE6 A;  4DN4 M;  1EY4 A;  3VR4 A;  4YIJ A;  2JE6 I;  1SE4 A;  2RSO A;  1TVX A;  2F0D A;  2BA1 A;  2HDL A;  1GXD C;  1PRT F;  4KKT A;  1GJX A;  1VF5 C;  4WRD A;  1Z47 A;  3WOF A;  5C5L A;  2JEB I;  3KBG A;  2BE5 D;  2F0G A;  1ONL A;  4PNY A;  5HGT A;  3EA6 A;  1QCB D;  2G9H D;  2B8F A;  3K5M A;  1HQM C;  2N88 A;  1TWC B;  1FNW A;  1DOK A;  2JA8 B;  2KVM A;  1T5E A;  1SYE A;  1VMC A;  3J81 E;  5C4Z A;  1DZ1 A;  3NHH A;  1WCM B;  2K04 A;  3MHB A;  3EVQ A;  1YNN D;  1TS3 A;  3H6M A;  2K5W A;  4IUU A;  3PIO 3;  4QB4 A;  1FNU A;  4OO1 I;  2F0M A;  3QG1 A;  4FF1 A;  1STA A;  1U9R A;  3FDT A;  3OIP A;  1TU2 B;  3Q0A A;  2YYZ A;  1ILP A;  4RA8 A;  1ML0 D;  5C4H A;  3K58 A;  1CT1 D;  1J8I A;  2WB1 B;  2KEC A;  1S5F D;  5JPN C;  4KKS A;  2RQX A;  1MI2 A;  4F8M A;  1SYD A;  2MGS A;  1R4Q B;  3BZD B;  4G4K A;  4RCO A;  2L0C A;  2Q8T A;  2I07 B;  1BBX C;  4ZUJ A;  3QJY A;  1FNV A;  2OF1 A;  3NQI A;  5M5W B;  3H94 A;  4NKL A;  2KUM A;  2IX3 A;  2X69 A;  2B2T C;  4FO2 A;  3W2D A;  1HHV A;  5M9O A;  2B63 B;  3OWF A;  2XWB B;  1EY8 A;  3D8G A;  3PUV A;  1ENA A;  1TS2 A;  5ELF A;  4XYQ A;  4IFD H;  1F9R A;  5CV6 A;  4Z9C B;  1EFI D;  3GTQ B;  5IGF A;  2F0O A;  4B9W A;  2RDF A;  4KHZ A;  1VMP A;  5EKI A;  4C3H B;  1BF4 A;  3G6J B;  3T4A C;  3D4D A;  2EYP A;  3VR6 A;  4LJZ C;  4A3B B;  3J80 E;  5EKK A;  2FMM A;  5CV4 A;  4DF7 A;  2H4O A;  1TWF B;  4XIG S;  5FLX L;  2KJX A;  1SDF A;  1SMY D;  3GV3 A;  1SNQ A;  1AEX A;  4TQU S;  4ZK9 B;  4XT3 B;  4ME5 A;  1BOS A;  1MBY A;  1EU3 A;  3SE0 A;  1PTO F;  4F87 A;  1PMR A;  5E4W C;  4DAV A;  5IGG A;  2F3V A;  5M3M B;  1KAA A;  4X3U A;  1EQV A;  1S5C D;  3DWA A;  3ZYY X;  5C0X G;  1CTM A;  4K5W A;  3HOZ B;  4DXF A;  4L6T B;  4PV1 C;  4FF2 A;  4NP5 A;  3M85 A;  2E2J B;  3NBH A;  4FVM A;  1ZYR C;  2M00 A;  2EY1 A;  2AUJ D;  3P20 A;  3VYU A;  4O42 A;  3H91 A;  1G91 A;  2XSC A;  3DMU A;  2JSO A;  1WD0 A;  3WDN A;  4PMW A;  5KGU A;  2B2Y C;  4RGM A;  4WFN 3;  4DXG A;  1LT5 D;  3SEB A;  2A69 D;  1MSH A;  1TWG B;  1CFM A;  1B2T A;  1EZ6 A;  1L0Y B;  4CKC A;  3I91 A;  3MTS A;  1WVL A;  4H0L C;  1OXU A;  3MEH A;  1PFB A;  3MXG A;  3FMC A;  2JXM B;  4R8N A;  4CKB A;  3SK5 A;  5IOC A;  4KKU A;  4G7H C;  2HCC A;  1WD1 A;  1CQF A;  3OOC A;  1EYC A;  2FHT A;  4N9P A;  3V2T A;  4XQJ A;  3JAM L;  1G2T A;  3PUY A;  1HTL D;  2RBM A;  4OIJ A;  3C46 A;  4A3M B;  3KK7 A;  1F2Y A;  3IFD A;  4RWS C;  4XDX A;  5KYL A;  5J39 A;  1PDQ A;  1EY0 A;  1H9K A;  1JWS D;  5IGD A;  1X3Q A;  1DD2 A;  3V05 A;  4QF4 A;  4IUN A;  4LK1 C;  1OXS C;  2SOB A;  2K32 A;  2CQA A;  5KYI A;  2HCI A;  2BCO A;  4XT1 B;  3I3C A;  1AZP A;  2F0N A;  3PO3 B;  3X3M A;  3HOX B;  2R92 B;  1ET9 A;  5HUR A;  2WP8 J;  1LO5 D;  3KLS X;  5FKA C;  4KN7 C;  3PO2 B;  1A2T A;  2QF7 A;  1D2B A;  4Q5V A;  1SFO B;  5I2X A;  4RAU C;  3PV0 A;  2K28 A;  1E2Z A;  3S9W A;  5G3L F;  2F0H A;  1CZW A;  1GUS A;  2A6H C;  5ELB A;  3C2P A;  4R8I A;  4ZQ3 A;  1ICW A;  5M5X B;  4KV6 A;  5CMD A;  3CQZ B;  1CHP D;  2LY7 A;  1B9N A;  2OXP A;  3MAQ A;  1EY5 A;  2F0U A;  3BVG A;  4U68 A;  3QIA A;  2B8G A;  5CBA E;  3GTK B;  3MFY A;  3HEJ A;  1GHK A;  3S2H B;  2F0P A;  5ISR A;  2IT1 A;  1BNZ A;  3GQB A;  5C4J B;  3MXN A;  1O7Y A;  3DM1 A;  4QUF A;  1SNC A;  4AYB B;  1EYD A;  1STN A;  4IUQ A;  2PNR C;  2X6G A;  5I6W A;  2F0J A;  2F0S A;  1U4P A;  5JVG 3;  5BN5 A;  3SVM A;  4C2M B;  2SNM A;  2MP1 A;  1LT6 D;  1RKN A;  4DA2 A;  4K6L A;  3R93 A;  3C3L A;  3TP5 A;  5D14 A;  5C0X J;  3K57 A;  1E2V A;  1SNM A;  3NWT A;  3A7A B;  4C3J B;  2VNU D;  1PTO B;  3Q24 A;  2QCP X;  4CJ1 B;  3DEP A;  2D2C C;  5K5P A;  1F77 A;  4NMZ A;  4C3I G;  1LTT D;  1STH A;  1I4P A;  2Q8R E;  3MC0 B;  3TZU A;  3J7Y W;  4EQO A;  2EJM A;  1LV9 A;  4HAE A;  4KMU C;  4C1N I;  5FO8 B;  1XYI A;  1STE A;  3NUC A;  3S1R B;  1AN8 A;  2B2W C;  3HP3 A;  1PTO D;  3MFG A;  5D65 A;  5F2D A;  1SNO A;  2J4X A;  4M8A A;  5ELD A;  2H1E A;  2K01 A;  4MN3 A;  1BCP C;  1DJR D;  5IT9 L;  2R7Z B;  2G9D A;  4ABN A;  3QWN A;  4IFD I;  2A73 B;  3J7A F;  1M8A A;  2IW3 A;  1HUM A;  2K1B A;  4K8I A;  1M4V A;  2LFN A;  1LTA D;  3RLF A;  5E3F A;  1UEA B;  3K7A B;  2E2I B;  2A68 C;  2ID0 A;  5M3F B;  1PFM A;  1ESR A;  2A6H D;  2RSN A;  1G8Z D;  1D5Z C;  1EY7 A;  4E6I A;  5IGB A;  1DCZ A;  2FFK B;  1HTP A;  2C9O A;  2F0W A;  4FXK C;  5FK9 C;  3Q6S A;  1AFP A;  3L3O C;  4IUV A;  3J81 L;  5DAU A;  1Q3L A;  1I4R A;  3MVV A;  2DY8 A;  1Y8O B;  5IOD A;  1AW7 A;  2XWJ B;  3QB3 A;  1C4Q A;  3EFX D;  2B2V C;  1XTC D;  4RFB A;  1QNU A;  1EIH A;  1Q90 A;  4I7Z C;  1SJE D;  1GUG A;  3P75 A;  4K5V A;  2RVL A;  1GOZ A;  3I4L A;  3CKI B;  1Y69 U;  2IWH A;  4NW2 A;  2NVQ B;  4CHT B;  2E75 C;  1WTW A;  1FGB D;  2L1B A;  5CGK A;  3NBI A;  1HFN A;  1J9O A;  4F88 A;  1IKL A;  1QG7 A;  2E2H B;  3HKZ B;  2CW0 D;  1EY6 A;  3A56 A;  3RZD B;  4CBV A;  1XXG A;  1I50 B;  2A5H A;  4XQN A;  1SND A;  3BDL A;  1D5X C;  3K5N A;  1Q8I A;  3FPP A;  4OO1 G;  4KY6 A;  2AWO A;  3C1E A;  3ERQ A;  3KUP A;  4JK1 C;  3DEO A;  4H7B A;  2Q8I B;  1UAP A;  1SEB D;  5G3L D;  4GZY C;  1SYC A;  1FD7 D;  4HCE A;  2D62 A;  1WTX A;  1DYQ A;  1WTV A;  3M3Y B;  1O78 A;  3NSW A;  5CYU A;  1NUC A;  4IZ8 A;  3OMC A;  3HGB A;  5EKL A;  1T5X D;  5D3D A;  4K2L A;  1V43 A;  3A54 A;  3J80 L;  5IGC A;  1TY2 A;  3MWY W;  3GD7 A;  1XWE A;  1DOL A;  1A6X A;  1ILQ A;  3MXP A;  1EEF D;  5T1I A;  1F9S A;  1TII D;  2XVS A;  4DK1 A;  1B9M A;  2L9H A;  1X32 A;  4FXD A;  2EY5 A;  3NE5 B;  2PW7 A;  4KHV A;  2AUK A;  4PMC A;  3CRK C;  4RHS A;  2O5J C;  1I6H B;  3J7A V;  2NYZ D;  2NTS A;  1PTO H;  1QOH A;  3DWQ A;  2EYF A;  1QB5 D;  5C5M A;  3KF8 A;  2EY6 A;  5I4D A;  2NN6 H;  1GUW A;  1LTB D;  1VF7 A;  2DY7 A;  4B9X A;  2K05 A;  1SSO A;  3ND8 A;  4QMG A;  1A3T A;  2KED A;  3CU7 A;  5JJZ A;  1OXX K;  2F1M A;  1CA5 A;  5IGE A;  1LAC A;  2KCN A;  1KDA A;  2Z4H A;  3D31 A;  1EEI D;  5CV5 A;  2B2V A;  3CRL C;  1OXV A;  5CBE E;  1SXT A;  2B2U C;  4U67 3;  1HRJ A;  2C5C A;  2EDG A;  2NBF A;  4J1M A;  1BDO A;  2AQ2 B;  3R8B A;  2F4I A;  4HR7 B;  3VR5 A;  4DNT B;  4DGZ A;  3I70 A;  2XRQ D;  3E0J A;  3VYR A;  3TBI B;  1A2U A;  3K5L A;  5J22 A;  3L7Z C;  3EQL C;  2A6E C;  2X6L A;  3T16 A;  2XIW A;  1TQO A;  5JEA G;  3LWU A;  2RA4 A;  1OO9 B;  5M5Y B;  3T13 A;  4KY7 A;  1JWM D;  4HSP A;  2IX0 A;  3R2I A;  3GTM B;  2RKS A;  4LAA A;  4ZLT F;  4CJ0 B;  2F0F A;  1CM9 A;  5K36 G;  1NAP A;  2K6A A;  5EGT A;  3HRZ C;  1EWC A;  3NTH A;  3GTP B;  1PZJ D;  2J0T D;  4UDU C;  4HN7 A;  4K6D A;  2AQ1 B;  1U4M A;  1WTR A;  1DON A;  3SHL A;  1HQR D;  1STY A;  1RTO A;  1BR9 A;  4RGT A;  4DNR B;  3QOL A;  3A8K E;  4ODG A;  2KOL A;  1PYW D;  2PQE A;  1O7Z A;  5EBC A;  3GV6 A;  5I9O A;  5T1G A;  4DU9 A;  3OIQ A;  4X3K A;  2KQ3 A;  4ZRZ A;  1TKW B;  1KTK A;  2JA7 B;  2B2T A;  2EYM A;  5E1F A;  1STG A;  3KBX A;  2PZU A;  1Y8N B;  4EQN A;  1RF2 D;  3HOY B;  1PLF A;  2N55 A;  1SJH D;  3S1N B;  1ZXT A;  2F0K A;  1R9T B;  3FRP B;  1WTO A;  4G7Z C;  2EVB A;  2O4X A;  1CK1 A;  5A2Q E;  4ZAI A;  1O80 A;  1STB A;  2SEB D;  3PIP 3;  1GHJ A;  1KDC A;  4FXG C;  4XTC S;  1QJO A;  1GUO A;  1K8M A;  4BBR B;  3R3O A;  2F0V A;  1V8Q A;  1OXT A;  1NSN S;  2PCF B;  1BCP F;  1U4L A;  2NUC A;  5EPJ A;  1X3P A;  3VR3 A;  2PMZ B;  4J6H A;  4TKO B;  1I4G A;  2SDF A;  4V0B A;  1LTR D;  2HUG A;  1DOM A;  4ULL A;  2AWN A;  2I46 A;  2PYK A;  1PZI D;  1ZYR D;  2TSS A;  1TR5 A;  4FP5 D;  1AZQ A;  4RH6 A;  3BVZ A;  1A3U A;  3BYY B;  4R9W A;  3RZO B;  2PW5 A;  2MJ8 A;  3BVM A;  1H9M A;  1LT3 D;  1UUP A;  2A6E D;  1ENC A;  3VYS A;  1SBB B;  1F2M A;  3NK9 A;  4C1N K;  3HZX A;  4IN3 A;  4A3G B;  1K83 B;  3DUZ A;  2B2Y A;  4RGN A;  3SK8 A;  1G2S A;  1PFN A;  5C0X H;  4C3I B;  4O1N A;  4KK7 A;  3KLS A;  3HS0 C;  1JQY D;  4M1U B;  4N9T A;  2R93 B;  4B08 A;  3DWP A;  4KD4 A;  4KJN A;  2JA6 B;  2BE5 C;  3A8J E;  5DEH A;  3SXH A;  3PMF A;  5FO9 B;  4H44 C;  2EJF C;  3BDC A;  5LL6 S;  1JCK B;  1NR2 A;  3OSO A;  2QEJ C;  3NP8 A;  1RDP D;  5EBD A;  1SNP A;  4ZKC B;  1IHZ A;  2EYO A;  4BBS B;  4QCL A;  3ND9 A;  3VYT A;  4NDX A;  3HOU B;  5JEA J;  1RHP A;  3EJI A;  2J7Z A;  5C3W A;  1B3A A;  4IFD G;  2DN8 A;  2PZW A;  3VA7 A;  3AU7 A;  5NUC A;  3D6W A;  3OW7 A;  3BYT B;  4A3K B;  4DAP A;  1SAP A;  3MXU A;  3RUZ A;  1XX8 A;  5EQ0 A;  2D9U A;  4EVO A;  4TRD A;  4HTH A;  1TT2 A;  1I4Q A;  2XNA C;  4RKL A;  4A3D B;  5I9P A;  4DK0 A;  3FPU B;  5C3X A;  4A3J B;  2QKI C;  1PZK D;  2M2L A;  4ZYS A;  3I73 A;  2OT2 A;  2EYJ A;  2NN6 I;  1I4X A;  1GUN A;  3IL8 A;  1KLU D;  2CVR A;  3A55 A;  5E4X A;  4QUC A;  1QIL A;  4XQQ A;  4HMJ A;  5I6Y A;  3SR1 A;  3NWS A;  5ELE A;  3LNN A;  2O5I C;  5C44 B;  2XRS D;  4KI0 A;  1E2W A;  3T53 B;  2NTT A;  4HSV A;  1HFG A;  1HCZ A;  4K14 A;  1IL8 A;  2IPK D;  1PXU A;  3SK4 A;  1YNJ C;  4ZKB B;  4H13 C;  3U9O A;  3TDQ A;  2TMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...