1XTCD

Cholera toxin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPSSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCTWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN
publication title The three-dimensional crystal structure of cholera toxin.
pubmed doi rcsb
molecule tags Toxin
total genus 20
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 1996-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xtcD00
1PRTB 2ICIA 3R2TA 1FD7D 4L63B 1JWMD 1SBBB 2RDHA 1EEFD 1CQVA 2J4XA 3BVMA 1V1PA 1D5ZC 1FNUA 1I4RA 1HXYD 1EU4A 2WV6D 4RGTA 3R8BA 3CHBD 3DWQA 1I4GA 1XTCD 1LT6D 1PYWD 1RDPD 3MC0B 3EFXD 4RFBA 4RGNA 3W2DA 1S5BD 2CHBD 2TSSA 5ELDA 1SE3A 1KLGD 1ESFA 1I4PA 1RD9D 1LTGD 1L0XB 1BCPC 5D3IB 1CHQD 5I4DA 1TS5A 1LTTD 4RGMA 4RGOS 1PTOH 1LT4D 2IPKD 2AQ3B 3BYTB 1EU3A 1GOZA 1BCPF 1D5XC 1SE2A 1CT1D 1PZJD 1PZKD 1ENFA 1TS2A 1JR0D 1STEA 1BCPB 2XRQD 4K6LA 1UNSA 1JWUD 1EWCA 1S5FD 1TY2A 3TSSA 1EFID 1TS3A 1RCVD 5FK9C 2O2LD 2XN9C 3BZDB 1CK1A 3BVGA 5ELCA 1D6EC 4DXGA 1SXTA 1SJHD 1KTKA 2IJ0A 4RHRA 1PTOD 3BYYB 1LTBD 2QILA 3SEBA 2XNAC 1ET9A 3DWAA 2SEBD 1LTRD 1LTSD 1JQYD 1TS4A 1XXGA 1SJED 1JCKB 1JWSD 1HA5A 1QILA 3OWEB 3EA6A 5TSSA 1LT5D 1ET6A 1M4VA 1FNWA 1I4XA 4O1NA 1RF2D 2XRSD 3MFGA 4L6TB 1PTOC 1CHPD 2AQ2B 1LO5D 1PRTD 4RCOA 2R61A 1I4HA 1TY0A 1AW7A 2AQ1B 2NTSA 4BWGB 1SEBD 1EEID 1FGBD 2QEJC 4UDUC 4OHJA 4C56C 1PTOF 1V1PB 3O13A 1UUPA 5ELEA 1HTLD 1HQRD 1PTOB 1S5ED 3BVZA 1D5MC 1SE4A 4RH6A 2G9HD 1DYQA 1FNVA 2Z8LA 3GP7A 1B1ZA 4ZYSA 1V1OA 1L0YB 2RDGA 4RHSA 3DWPA 1B44D 1LT3D 3V05A 2NTTA 1F77A 1LLRD 1PRTC 1I4QA 4DXFA 5FKAC 1MD2D 3URYA 1S5CD 3R2IA 1PZID 5D3DA 1AN8A 4TSSA 1LTAD 1T5XD 4Z9CB 1G8ZD 5ELBA 3KLSX 1PRTF 1BCPD 5ELFA 1KLUD 1LTID 1BXTA 1S5DD 1DJRD
chains in the Genus database with same CATH superfamily
1KQSA 2NN6I 2OQKA 1XMQL 4CJ2C 3FEWX 1CM9A 3H15A 1LYLA 1SMYC 2EYJA 2CCZA 2F4VQ 3PUVA 1RTNA 4G4KA 4O0AA 1J6QA 1G2SA 1NR2A 3HKZB 5FOBB 2F0QA 2I07B 3A7AB 3KLSA 4MTNA 4X64Q 4IZ8A 2N8NA 4JCVE 4QGUA 4B08A 1X56A 4LFAL 1LTTD 2K5VA 3IKJA 4LF8L 4HIMA 2FMCA 5G3LF 1HNWQ 1WTXA 3PO2G 4KKSA 1IYUA 2K7VA 1HR0W 4KV6A 2PQAA 1AEXA 4OX9Q 3S1RB 1AZPA 4XYOA 3L2PA 1WCMH 1ICWA 2PNHA 1B9MA 1GXDC 5ELCA 5FLMH 4NW2A 2BH8A 1Y8PB 2IJ0A 4KN4C 4A3MB 1HNXL 4R9WA 4POFA 3GTPH 2A69C 2Z0SA 5LMNW 4PZ6A 4CJ0B 3CCRA 1LTSD 1SR3A 1XXGA 1U4MA 2AWNA 1NE3A 1B70B 2D0PA 4L8JA 4X3SA 4BBRB 4A3IB 1JMCA 5LL6S 1K3BC 1QILA 1VQBA 4DR2Q 3DM3A 3EA6A 2Z6BA 2FHTA 3T13A 4LF5L 3CCMA 4L6TB 3GV6A 4PMCA 3RZOH 3ND8A 4BY1B 3WOFA 1YIJA 4QQBX 1EFWA 2ES2A 3ITPA 4G7OC 3IL8A 3KDFB 1JB7A 1H9JA 1CFMA 3H3VH 3VR4A 3TP8A 4DV1L 3KK7A 5LL6X 1NR4A 3SK5A 4BBSB 2K5WA 2IHFA 1VQOA 2G9HD 2NVXH 3NBHA 5CV4A 3A5ZB 3HRZC 1WTVA 1V1OA 5IODA 4Y52H 2RDGA 3FHWA 1L1OC 4DA2A 1LT3D 3V05A 5JEAH 2D0OA 2MO0A 2PPBC 2LXKA 4TSSA 1HCZA 1SNDA 4JV5Q 3EIVA 3UDXA 1IBLL 1L1OB 1RJTA 2K52A 1BF4A 3S17H 2EY5A 1FD7D 5IOCA 1XNQQ 2Q2HA 2CH4A 3K7AB 1JOKA 1AZQA 4OO1G 2JJQA 3KF6B 3UE0A 1CA5A 3DWQA 1GUTA 1TXYA 1C7YA 3GTOB 1EY6A 3SR1A 4AYBE 5M5XH 1B7YB 1NJIC 1ONLA 3K6OA 1GHKA 3HOXB 3OTOQ 2C9OA 3CCJA 5DLQE 1HHVA 1I4PA 4YY3Q 2A8VA 5IP9G 4M1UB 4DAMA 3T1HQ 2CQAA 3D6WA 2ASBA 2XTIA 1I3QH 5M5YH 2F0VA 4JI7Q 3I4MH 4G7HC 3M4OB 4EVOA 1WFQA 3I4NG 5A2QE 3S2HH 4DV5L 2K33A 1VQDA 3GTLH 3CP0A 3D4RA 1PH7A 3I56A 1EZ8A 1B2TA 3BZDB 3K81C 2ZT9C 1D6EC 4C3HH 4I65A 2XWBB 1KDCA 3KOJA 2WFWA 1D7QA 1N34L 2A73B 3QOJA 4FXKC 1T5EA 5J22A 1SYEA 2BE5C 1PFMA 2QILA 3X3MA 2F0NA 3SEBA 2Q8TA 2NYZD 2M2LA 3CKIB 3UDIA 1YNJD 1GUOA 4A3BG 5IYDH 1U9RA 2L1BA 4IUPA 3J81j 4LF9L 1FR3A 4HMIA 4TKOB 1V1QA 3BZCA 1GUNA 1B8AA 3WDNA 2YU9H 4R1JA 5EAYA 3G4SA 1SEBD 2K03A 4NP5A 3HOZG 4DPGA 1PH9A 1HJPA 1EQVA 1BKBA 2NVYH 5LMUL 2F0LA 3E0JA 2JQOA 5CYUA 3L3OC 1N32L 3KFUA 3I3CA 2LXJA 3MTSA 2B2WC 1J5EQ 1RODA 2UXDL 1B9NA 1RL2A 4TVAB 3T16A 4DXFA 4DV2L 2UUBL 1MD2D 2N88A 3CCLA 5D14A 2RHQB 1CKNA 4LW1A 1Q90A 4IPGA 2AHOB 3CC4A 4DN4M 4ZAIA 1BQQT 1P8LA 1SBBB 2NVTB 2J4XA 4NXMQ 1L0WA 1HNXQ 3GTKH 3R8BA 2OTLA 5K5PA 2IHEA 2LMCB 1B50A 2KUMA 2OCEA 3PV0A 1G6ZA 3J80i 4EX5A 1W3SA 2TSSA 3KBXA 2EIFA 1SE3A 1ILPA 4KY6A 4HJ9A 5NUCA 4A3FG 4KKUA 4LUOA 5J3BA 5D3IB 1GUWA 2TMPA 3ULPA 3JC66 2IPKD 3CU7A 3SDZA 3TS0A 3NENA 2L12A 4OGQC 5C4XH 2L5TA 4AQYQ 1JR0D 5T1GA 1IW7C 2MHVA 2WAQE 1I6VC 4K6LA 2R7ZG 4ZKBB 4Y7NH 1ENCA 5FK9C 1KRSA 3RMHA 1HZAA 4DR6L 3N52A 1CKMA 4F8MA 2XNAC 3AU7A 1K3RA 2EE1A 1PV4A 2D2CC 1WTWA 2Z4HA 3I4NB 3RLNA 4R4CA 1FL0A 3UDGA 1VMCA 1IL8A 3CC2A 4LUVA 4GOPA 4P75A 4C2MH 4ZRZA 1A6XA 4R4OA 1VQ4A 5D65A 3BS1A 5HGTA 3MVVA 4ZKCB 3KF8A 4RCOA 1ILQA 4F7XA 1TU2B 2NTSA 4DNRB 1VCIA 1YEZA 4QUCA 2F0JA 1LM0A 3NQTA 1HNZL 1M1KC 4A3DG 5FLXc 5IYCG 2X6GA 3HGBA 3A5UA 4A3BB 3OSOA 4AYBG 4KY7A 1DYQA 2EYLA 4NXNL 1CA6A 1Y1VG 1VQEA 2EZVA 2OQ0A 2E2HB 4H13C 3MXUA 3FMCA 3L7ZC 1I6HH 4ZCKA 1ASYA 2JA9A 3R93A 4DV5Q 2JE6I 3BU2A 4JVZA 1S5CD 2K5NA 4X65Q 4A3MH 2F0PA 3SXHA 2JEBI 2JA6G 3KLSX 1BXTA 4NMZA 4QL5A 2PQAB 3BZKA 3STBC 1MKHA 1N34Q 3V96A 4WRDA 4JI1Q 4A3IH 2B2TA 3M4YA 4DAYA 5J39A 4A3CG 1EY9A 4K2KA 1SSOA 2V4DA 3CPWA 1PYWD 1RDPD 3CC7A 1F9PA 2R93G 4RAUC 4BY1H 2JA5G 2L15A 2ZTCA 1LTGD 4LF9Q 4P2CB 4MZ9A 4X66L 4BBSH 1O78A 2E2JB 1YBYA 2NWGA 2WACA 4ZUIA 2FFKB 2KQ3A 1X3FA 4BXXG 2RSOA 3KDFA 2BDOA 1VQLA 1MJCA 2HUGA 1CZWA 2IX3A 1TS3A 1RHPA 2DJGC 1N32Q 5IY0A 3HOUB 1EZ6A 1XPUA 4A3FB 2KECA 4BY7H 4DK6C 4J15A 3C1FA 4DV2Q 3K7AH 1C8CA 1QUQB 3RLOA 5C0XH 2X69A 1X65A 1A62A 4C1NK 3J81E 1JQYD 2MP1A 4YHHQ 1SFOH 2ALYB 3NTKA 3HOXH 1HA5A 1J8IA 2R7ZB 3FP9A 2OT2A 1A3UA 3TBIB 3KF6A 4XXEA 3V2TA 3LWEA 3J7A5 1PHJA 2AQ2B 2R3ZA 5C3EG 3M4OH 4Q5VA 1A3TA 4LFBQ 5FJ8G 1Q86C 3T1YL 1QVCA 3I4OA 1GUGA 5F2DA 1QE6A 2K28A 2R92B 3O13A 3D3RA 1A0IA 2JA8B 1A8VA 5AJ3Q 2Z8LA 3GP7A 3F2DA 3PF4A 1EYGA 3LWUA 4GS3A 2G5DA 1JB3A 2ZXOA 2NN6G 1W6JA 3HEJA 3K80C 3DUZA 4ULLA 4LF4L 3K5NA 2B8FA 1VQCA 4B9XA 3S1QB 4U68A 5ELBA 3H3VI 5G3LD 3PO2H 3TQYA 3AB9A 4OEMB 2NBFA 4IUTA 1MBYA 3QJYA 3KUPA 4DV7L 4A3DB 2AMCB 1D1IA 1JWMD 4L63B 4HIDA 1CQVA 1V1PA 4AYBB 3H94A 3NWTA 1Y1VB 4XDXA 4IPCA 2E5LL 1UE1A 5C4JH 1SYDA 4FF4A 4YWLA 4FDBA 3EFXD 3CD6A 1OTCA 4J6HA 1E0BA 1U0LA 1S3OA 3DLLA 1UEBA 1BO0A 1KLGD 1PFNA 1QG7A 1IXRA 4PNYA 5I4DA 3JAML 4DR3Q 2EJFC 3PUXA 1HFNA 2R7DA 2O5IC 4B3RQ 4IO9A 1ZKOA 4DR4L 1SROA 2F0IA 2DJFC 1D5XC 3EN2A 4LFCL 2YTYA 3ZJYC 1WTQA 2A69D 5IGEA 3W5OA 1P16A 1TWAB 2K50A 1EOTA 1NMGA 3MWYW 3KYHC 3B6YA 4XT3B 3J81i 2O5JC 3W1BA 4FP5D 1EIGA 1H9SA 2JK8A 3TSSA 2YYZA 4EQOA 2JSOA 2JA5B 1T9HA 1YI2A 2EY6A 3VYTA 1BBWA 5JJIA 5CV6A 2UUAL 1YJNA 1XPOA 4A3KG 5L37A 1NY4A 1KDAA 5EPJA 3OWFA 2KEEA 4QB4A 5COYA 4PZ8A 5CORA 5FO8B 1TS4A 1A2UA 2B2WA 4JI3L 1UE5A 5EPLA 2AWOA 3TP6A 2PQEA 3K5MA 1X32A 1I4XA 3SK8A 3NSWA 3T53B 3VDYA 4R4IA 1CKNB 3DEOA 5JPMC 1TY0A 1TR5A 1HUMA 5BN3A 3PO3G 1KABA 2MJ8A 1SYBA 2A6ED 4OO1H 2UXBQ 2N55A 3BG3A 4CDDC 2RA4A 5DNFA 4KN7C 1K83B 4JI8Q 1I50B 1XMOL 1ICFB 4F88A 4X66Q 5IWAL 4DAPA 4LF7L 2DGYA 2F3IA 4UP7A 5IP9H 1YHAA 4QF4A 5JJLA 2BH2A 5JJZA 4DV0Q 1VQAA 1G51A 4LJZC 2ZJQA 4IALA 1LTID 5I9OA 1DJRD 4HAEA 1E2VA 3G6JB 1PLFA 2B2UA 1OO9B 3DEPA 3SK4A 1XTCD 4K8JA 5E1FA 3RUZA 4B3SQ 5M3MG 3U50C 4L5TA 4GOPC 2BA0A 3M7NA 4R8NA 1RD9D 1BCPC 1SNQA 4RGMA 4RGOS 4DR5Q 1YITA 3GTMB 2CW0C 2ZJPA 2BE5D 1EWHA 2NB0A 3D31A 5KNBA 1K9MC 1BCPF 1RTOA 2KVMA 4YIJA 4GOPB 2E2HH 1X6OA 5A35A 1BCPB 3T1YQ 1O7IA 4UPAA 1RIPA 3OIQA 4ME5A 4DV6Q 3A8JE 5EQ0A 3KF8B 4POGA 3ULJA 3S9WA 3T4AC 2PW7A 2IL8A 2WKDA 1WOCA 3HOZH 3U9SA 1ESRA 1U5KA 4IPDA 4HJ7A 1FGUA 1VQ9A 2E75C 2A6HC 3M3YB 2FINB 1VQMA 3A0JA 2A74C 3W3AA 5M3FG 3DHQA 4GNXC 2EDGA 1VQIA 1DCZA 4JW0A 3RN5A 1Y8OB 2B2TC 1CQFA 1FNWA 3OHXC 5J1ZA 2I46A 1OXUA 1C48A 2HDMA 4GNXB 4IPHA 2E2JH 1Z9FA 2KEDA 4BWGB 3F8TA 4A3KB 4A3LG 1EEID 2QEJC 4UDUC 4DAYB 1PH5A 1G2TA 3G48A 4CGYB 1AFPA 2RQXA 4B3MQ 4DR4Q 3I7FA 4DR7L 2RSNA 3K8AA 5GAEC 1OXSC 4A3FH 4RHSA 2K04A 3D4DA 2CQOA 1QNKA 1WVLA 4KHZA 1PYSB 5JOBA 2CWAA 5D3DA 1AN8A 2HHHL 3PO3B 1T5XD 4N9TA 2WP8J 5JAVA 4YWKA 3HOWB 3HG9A 2UUAQ 2RF4A 3HS0C 5BR8L 2QA4A 2R7ZH 2ZJRA 1KXLA 1EU4A 1QUQA 1PXUA 3RZDB 4KHPL 2A68C 4MIUA 1IW7D 1GKHA 3QWNA 1TWFB 5DEHA 5GAGC 3U58A 1VQNA 1K0SA 1PH2A 1QOHA 4FXGC 5ELDA 4CDEC 1PH1A 2CH4W 2ZM6L 1MHWC 3NPPA 3ONAB 3TN2A 1HR0L 2G9DA 3EROA 4QJFA 1XX8A 3H91A 2CVRA 2K4KA 2IX0A 2A19A 3TEHB 4UP8A 1YVCA 1STGA 3HOVG 4X3TA 2H1EA 3NP8A 1TY2A 4ZLTF 1UEAB 1RCVD 1PFSA 4DKAC 3F1ZA 1XMOQ 5M3MB 4A3GG 1Q7YC 1KDBA 3GTGB 1DOMA 5KIXA 2VQEL 1IBMQ 4L5RC 2QCPX 3M7GA 3BYYB 1H9KA 5LMNL 4A76A 4A3DH 3S15B 2F0KA 4HN7A 4OL7A 4UP9A 4AH6A 5IGDA 1XPRA 2BCOA 4QCLA 4KJOA 2SEBD 1Y1VH 2BOSA 2F0GA 4FF2A 4A3JG 1OXVA 5K36G 1O80A 2VL6A 3HZXA 4JI0Q 2EYHA 3SVMA 4DFAA 4U673 1E2WA 4OWTB 1M4VA 1Q1BA 2CFMA 3TDQA 5CV5A 1R9TB 1V8QA 2JA6H 3HOYB 4JI4L 2F0TA 2PNRC 4JYAL 2MQHA 3RR5A 1I4HA 4JI6Q 1MSHA 1WTPA 3DM1A 4OHJA 3VYUA 1V1PB 5DM73 5KEEA 4CHTB 2B63B 3T56B 1F2MA 1K28A 1TWAH 1ZEQX 4A3CH 3QR8A 5C4ZA 3U4ZA 3E9HA 3STBD 4I7ZC 5M3FB 3K0YA 5IT9E 1UE6A 2R93H 4JC0A 1NUCA 2JA5H 2PMZE 2I5LX 3I70A 2HDLA 3GTJB 3UE1A 1V9PA 1XMQQ 1KL9A 2EYMA 3D4WA 3QOLA 4R4QA 4JI2L 3H6MA 2VQFL 3S16B 3SGIA 5M9OA 1KLUD 1U4LA 3TRZA 1VDZA 4BXXH 1KD1C 2YV5A 2RDHA 1EL0A 2DNCA 2EXZA 1IKMA 1H9SB 2I5HA 4NPSA 1D1KA 4LFAQ 3UI2A 3E9IA 3JAMc 4LF8Q 2VUMB 4PMBA 3FKIG 1GO3E 3DMUA 5C5LA 2XWJB 4RKBA 2NUCA 1EYDA 4EQPA 4IFDI 1KRTA 1Y69U 4IQZA 4N8FA 4CDFC 2K6AA 5KRUA 2UXCL 1J9OA 1I50H 1Q82C 1EQQA 1GOZA 1I5FA 2L9HA 4HIKA 3C3LA 5KNDA 3MXGA 5CV9A 4EQ5A 5CR3A 2K75A 3Q6SA 1Q8KA 1E3PA 1VQ6A 2AUJD 5C3EH 3J80L 3J7ZC 5FJ8H 1F2ZA 3HOUG 1R4QB 2B29A 3F2CA 1OXXK 4LF5Q 4DV3L 1N36L 1F2LA 2HHHQ 2PZTA 4O2DA 3HOVB 2NN6H 2IWHA 4XQNA 2KCNA 3S2DB 2V1CC 3OWEB 1LT5D 4DV1Q 2PYKA 2B2UC 4A3GB 4K5XA 3OW2A 4KHPQ 4JI5L 3GTMH 1X54A 5E3FA 1EY8A 3VYSA 4C3JB 2K5DA 3Q8DA 1SYGA 1Z7TA 2XIWA 4FNFA 3MXNB 1GJXA 2E76C 1EUJA 4S3SA 2SDFA 2R92G 1W2BA 4KY5A 4A3JB 3G7LA 1SE4A 4E6IA 5HURA 1K73C 1EQTA 2JA8G 5EKKA 2F0UA 1ZYRC 1IBLQ 1XJVA 1WYDA 4MHEA 1PMRA 1B44D 1C0AA 2NTTA 1PRTC 3NELA 3X3NA 2F1MA 1PZID 1VQFA 3S14B 1CZGA 1H9RA 2Q8RE 3M3YH 4DUYL 1PRTF 3N6RA 2VQEQ 2B2VA 1PRTB 4APVA 4DUZL 2IT1A 2Z9HA 3S1RH 1JOOA 2QKIC 2OTJA 5EGTA 4KD3A 4RFBA 3BDCA 2JA7G 3OIPA 2K01A 4WJWA 5CGKA 4A3KH 1KAAA 4GN3B 5C3XA 5I2YA 1VMPA 1HFGA 1KC8C 1LTLA 5AFWA 1UWVA 2PZWA 3KBGA 2E8GA 4GNXA 3NHHA 1TWHB 1Y8NB 3OYYA 4HCSA 4OIKA 5C44G 3FDTA 4BBRH 1ENFA 1MSGA 1TS2A 1X3PA 3A8KE 2K5HA 2N49A 3PQIA 3A8IE 3FKIB 3A55A 1V43A 3PO3H 1EY4A 1NBWA 4A3EG 1E2ZA 1SXTA 4GKJL 1ENAA 4IN3A 3SHLA 3AFQA 3D6CA 3QO2A 4LWCA 3L0OA 2HCIA 3KJOA 4PMWA 4ILWA 2VW9A 2F0MA 3RZDH 2L0CA 2QEXA 4JI2Q 2Z6KC 1LTRD 4JG2A 1TWFH 2VQFQ 4K0KL 2VY3A 1JCKB 5TSSA 5GAHC 1G6PA 1TIID 1G91A 1TWCB 2XRSD 4DK0A 1TQOA 5ELNA 5LMUQ 3NXWA 3EBEA 2EYFA 3CXCA 1Y14B 4RKLA 5CC4A 4HEDA 2UXDQ 4H0LC 2UUBQ 1UUPA 1DONA 3CCSA 2QDBA 3VYRA 3ICEA 2EJMA 5H1SE 2K1BA 2UXCQ 5M3MH 3GTOH 3GTGH 1KNAA 3D8GA 3BJUA 1PH3A 1XNRL 4V0BA 2JYOA 4LF6L 1IHZA 1BVSA 3IFDA 3S15H 4R8IA 2ZXPA 3H3VC 2HD3A 4JK1C 3MEFA 1BCPD 5IYBG 4MTKA 4IUVA 4HTHA 3QG1A 1S5DD 1VQHA 4DK1A 1EEFD 3NWSA 1EY5A 1HXYD 4P74A 4DV3Q 3PIP3 1R9TH 1I4GA 2C35B 2F0DA 1SMYD 5M5WB 3OMCA 1S5BD 2CHBD 2MNAA 1JJGA 2CKZB 3P7JA 4WJ3M 1AE3A 2L11A 3T51B 4L5QA 4P73A 4GN4B 4IURA 5M3FH 3WWVA 3I8ZA 4DU9A 2F4VL 1Q8IA 4DR6Q 2K14A 1PZJD 3CCQA 1E7ZA 1VQKA 1STEA 3HKSA 3FRPB 1QZHA 3Q24A 1MI2A 4GLVB 3PF5A 2JA7B 3S24A 5FO9B 3BVGA 4A3LH 4CKEA 1L2FA 3S16H 1QWYA 5M5XB 2GA4B 3CRKC 3C2PA 4FF1A 2NZHA 4RHRA 5KYLA 3VR2A 2XGTA 1BBXC 4PG3A 3L9AX 1Q81C 5I6WA 2PW5A 2RKSA 1QJOA 1I3QB 5M5YB 1N33L 5C44B 3I4MB 4F87A 2NVQB 5ELOA 4K8IA 3J81L 3E6ZX 1YHQA 1WTHA 1QNUA 4WJ4A 1ET6A 1HNZQ 3PUZA 3GQBA 4A3EB 1RF2D 2K05A 3MFGA 2DNEA 1PTOC 5EBDA 4NXNQ 2R61A 1HZBA 2F0OA 1EYAA 2AQ1B 1Y1WG 2J7ZA 1II3A 1FGBD 3I72A 1GVPA 1PTOF 2NVTH 2JXMB 2R7FA 1B3QA 2F0SA 1HTLD 2PMZB 3H0GG 1PTOB 1S5ED 4ID6A 2BDNA 4RCNA 2ICEC 1AP0A 1PDQA 4O42A 3RLFA 5EKLA 1DZ1A 4HMJA 3KLRA 3I91A 1AE2A 4YWMA 2RBMA 4RWSC 1UE7A 4GZYC 2A68D 4RA8A 3DWPA 1U4PA 5FLXE 4EGVA 4QMGA 2F0EA 3AFPA 4ODGA 1B4OA 4OWWB 1QB5D 3ERSX 3HOVH 4GKJQ 4TRDA 3VA7A 3S2DH 3HOWG 1VF5C 3PSIA 3S1MB 4A3GH 1LACA 1SLJA 4RGTA 3CHBD 3A56A 4DR1L 2WINB 2BA1A 1DOLA 4K0KQ 3MAQA 4X3KA 2OF1A 4BA1I 4X3UA 1JT8A 2SNMA 1XNQL 4N8X1 1VS0A 1EYCA 4Q0FA 3I4NH 2F0FA 1LT4D 4IUNA 4CBVA 3J80c 3BYTB 1YZ6A 1TKWB 5K36H 1SE2A 5I9PA 3MXNA 1CKOA 4JOIA 1M90C 2XRQD 1EWIA 5T1IA 3MA2B 3GO5A 3S14H 3KJPA 2FJ2A 4BS9A 3Q23A 4DXGA 3CF5A 2N3SA 3K5LA 3Q22A 1C4QA 3PMFA 3W1GA 2O4XA 4H02A 2VNUD 4LF6Q 4A3BH 2QDLA 4R4TA 2HQEA 1O7ZA 5CV8A 4J8QA 4G7ZC 5IP7G 4OWXB 1CI3M 3ERQA 5C4XB 4A75A 2B2VC 1BBUA 1A3VA 4GLAC 2B3GA 4FVMA 1O7YA 4QY7A 1JWSD 3I2ZA 1QVGA 2KHSA 2VS1A 3IRBA 1EY0A 1NAPA 2D9UA 3J7YW 3HOYG 5EJWA 1Q1EA 1Q12A 4IFDJ 2NZ1D 2GVAA 1TWHH 2EVBA 2MPMA 4LF4Q 4YCWA 2B39A 4DNIA 1KHIA 2A5HA 4N9PA 2B63G 3FKIH 4A93G 1K0RA 2Y0SG 4H44C 4IOCA 2KJXA 2SOBA 1Z47A 1IBKL 4FO2A 4DAVA 4DV7Q 3NQIA 2Q2TA 3HP3A 4C2MB 2GN5A 2E2IB 1SRUA 1IYVA 3R2IA 1PH6A 3CMEA 2E5LQ 2EPBA 2KBNA 4LNQA 1Y1WB 1K8GA 4IUQA 2IW3A 2UUCL 4IFDG 4LUZA 4RH6A 3H0GB 4QIWE 1PFBA 1J5EL 2QF7A 2X6LA 3NE5B 3RD4A 1FNUA 5EBCA 1OXTA 3MXPA 1TWCH 2I5MX 1BR9A 1E1TA 3MEHA 2VUMG 4LFCQ 1N33Q 3HOUH 3H09A 1WJJA 4YCUA 3W2DA 4OIJA 5DAUA 4C3IG 1I6HB 1ESFA 1LUZA 4KHVA 1VQPA 1TT2A 1L0XB 4G57A 4NXML 1TWGB 1TS5A 5I2XA 1VQJA 2KCTA 1YHBA 2E2DC 4GKKL 5FO7B 1MJEA 2Z6KA 1BNZA 4X6AH 3BDOA 2IY5B 3PUYA 1CT1D 3VA5A 2WB1G 1CUKA 1F9SA 2RCFA 5KNCA 1UNSA 3AQQA 3K58A 1XTDA 4UHVA 2XN9C 2P5ZX 3FPUB 1HZ9A 1HTPA 5C4HA 4JI3Q 1SJHD 4L5SA 1KTKA 1BUVT 3G71A 4AQYL 1E22A 2R92H 2GVBA 2JA8H 1E24A 1A15A 2FMMA 1LABA 3C46A 1VQ7A 5M5WH 2MUYA 1SJED 2XVSA 3I55A 5IE8A 4GLXA 2DN8A 1NTGA 1ZYRD 3ZYYX 4K5VA 1QCBD 2F3VA 3OOCA 2DUDA 5HGQA 1SN8A 3S1QH 2RDFA 5IWAQ 1LO5D 1PRTD 4DR1Q 4LF7Q 2A6EC 2K5QA 2Q2IA 2OXPA 3CQZB 4C3JG 3CPFA 4BY7B 1KAWA 4WFN3 3PCOB 3PIPA 5IYCH 3P20A 2B8GA 4KD4A 2RVLA 3HFZB 3EVQA 3BVZA 4KJNA 4V190 4XT1B 2JA7H 1BDOA 1SFOB 2OEOA 1F9QA 3NK9A 3PIO3 3A74A 5FKAC 1IZ6A 1WTOA 5C3WA 1A63A 5C0XI 5C44H 2NVQH 3UDFA 1D2BA 1E1OA 4M8AA 2UU9L 4A93B 2Y0SB 1D5ZC 1VQ5A 1I4RA 4X65L 4H7BA 4OELB 3J80E 4A3EH 4MN3A 1S40A 3MC0B 5IIFA 1YNNC 1IL2A 5JJKA 4JI1L 4C1NI 4LMQD 1PTOH 3GD7A 2YTVA 3PO2B 3FPPA 4K5WA 1PZKD 5KGUA 5IGFA 1WD0A 1Z6HA 2PO4A 2KCCA 5JVG3 4CKBA 1S5FD 4FXDA 4MNOA 4CKCA 5C4JB 2MFIA 1WI5A 2VB3X 4C3IB 4DV4L 5IGGA 1IBKQ 1JICA 3RN2A 3J81c 3PGZA 4A4IA 1SAPA 1AH9A 1GHJA 4XQJA 1YJ9A 1K83H 2KOLA 3S1MH 1HH2P 2ID0A 2WB1B 1HQMC 2JN4A 2UUCQ 2XSCA 1RKNA 1DGSA 5A2QL 3M85A 2Q8IB 1Q3LA 2N78A 4K2LA 2QW7A 4K6DA 4QUFA 1STAA 5IYBH 3S1NB 1ZXTA 1WCMG 4DR7Q 1STBA 2D62A 4YHHL 1JJ2A 2RHSB 3OPOA 1DM0B 5FLMG 2LY7A 4B3TL 5BN4A 1STHA 2L4NA 3EJIA 1D5MC 3G6EA 2VXWA 4GKKQ 4JPBW 1FNVA 2EJGC 5IT9L 3LX0A 1B1ZA 2ATWA 5LHY1 4LFBL 4ALPA 2MO1A 3IAYA 2HIXA 2PZUA 4JOIC 3QB3A 5JEAJ 5BR8Q 4YCVA 1HA6A 3PUWA 3D0FA 1LV9A 4PQXA 3GTQB 1SNMA 3NTHA 5AJ3L 2PI2E 3QIAA 1HRJA 1SE8A 2IX1A 1JORA 3R2TA 1SMXA 2ZM6Q 1SNPA 1X3GA 2J0TD 5BN5A 3VR5A 1HR0Q 5ISRA 2K32A 1LT6D 1IYJB 4PV1C 4TQUS 1I94L 3TZDA 1JOQA 4BA2I 4HR7B 3M4QA 1EIFA 2M00A 1K8OA 5JEAG 2PI2A 4OO1I 2Q2UA 1N8RC 3HKZE 1NCVA 3MFYA 1PH4A 3KLWA 2F0HA 1MIUA 1SNCA 4HJ5A 3TS2A 3OMGA 4OXPA 5LMNQ 1NNXA 2E2IH 2JEAI 1GD7A 4DR3L 1HPCA 3TMEA 4IOAA 3M9BA 2B2YA 2O2LD 4B3RL 1Y1WH 4J1MA 1D8LA 3CCVA 1PTOD 1LTBD 1EIYB 3H0GH 2DY7A 1YJWA 1FVIA 2Z1CA 2WIIB 2ZTDA 1X9NA 2F52A 3IFTA 5GQOA 4JI4Q 4JYAQ 3SE0A 3NEMA 1SDFA 1X3QA 3I4MG 2EYOA 4P72A 3E5SA 2UU9Q 4CJ1B 4HSPA 4O1NA 5HY6A 4EQNA 1TWGH 3M4PA 3ND9A 4UAIA 4X62L 1FYCA 3RNUA 3F2UA 2MGSA 2AKWB 4C3HG 3HOZB 3HOWH 1DXMA 2H5XA 1BOSA 5C5MA 2F0WA 1YNJC 1STNA 2RCNA 3CW2C 5ELEA 3VR3A 5IGCA 2HQLA 5CV7A 1S72A 5EKIA 3TZUA 2Z4IA 3ULLA 5KYIA 3CRLC 2C5CA 1VQGA 1F2YA 4HJAA 5IYDG 3NTIA 4XYQA 1F77A 2UXBL 3CCEA 1I4QA 1B53A 1WCMB 4JI8L 4DNTB 4QIWB 1O7LA 1PYBA 3P1HA 4RG1A 1F9RA 4DV4Q 3J7AV 2QGQA 4HSVA 3BVMA 1R4PB 2OWOA 4DV0L 3GTPB 5CBAE 4P71A 1XYIA 1H95A 3A54A 2HIVA 4LAAA 3I90A 4KKTA 1WTRA 1B3AA 1A2TA 4RGNA 1FJGL 3CQZH 4HJ8A 2DY8A 2YTXA 3JAME 4NDXA 2PCFB 1EIHA 1M8AA 4JBKA 1JJCB 3RZOB 5IP7H 2HT1A 1N9WA 1X55A 3NBHB 3GDEA 3E0EA 4B3SL 2CW0D 4JBMA 3U4VA 1L1OA 1K8MA 3K59A 2ZTEA 4RMFA 4B3TQ 1W6KA 1JWUD 1N36Q 1EWCA 4HIOA 3HOYH 4FF3A 2WKCA 1EFID 4DR5L 2NVXB 2Y0SE 1CK1A 3WOEA 2I0QA 4KK7A 4AIMA 3LGJA 2H4OA 1C9OA 5I6YA 2B63H 2E74C 3TREA 4A93H 4DV6L 3F2BA 3DWAA 4KMUC 1PVOA 1SYCA 2F3WA 2A1AA 3C1EA 1IKLA 4JI5Q 1EQRA 2D5DA 2A6HD 2HCCA 3TP5A 1CTMA 3PIOA 1S4ZA 3Q0AA 3S17B 1UAPA 4K14A 3GTJH 2KCMA 3AYHB 1QZGA 3K5OA 4PZ7A 5C4XG 2EYPA 4X64L 2NZOA 2EQSA 1X3EA 3P75A 4KTAA 3NUCA 2F4IA 3VR6A 1CHPD 1HNWL 4IFDH 1MGSA 3SK6A 1AW7A 1CSPA 2EY2A 2AUKA 4OX9L 4C56C 2WAQG 1I94Q 1PH8A 4FYDA 5E4WC 2SNSA 4DF7A 4ZUJA 1HQRD 2VUMH 3J7AF 1G291 1JE4A 3I4LA 4DUYQ 1GUSA 1STYA 4NKLA 3S2HB 4C3IH 4DGZA 4DUZQ 5JVH3 3GTLB 2VB2X 2WB1E 1YNXA 1JE5A 3HKZG 1TVXA 1WD1A 3U9OA 2F03A 2JA6B 1LTAD 5DM63 3JAMi 1G8ZD 4C3HB 4IUUA 2LKVA 4B3ML 2KHIA 5CMDA 1QVFA 1SNOA 4ME3A 4DR2L 2ICIA 4ZK9B 2EY1A 3BDLA 3K57A 4IJHA 1SYFA 5CBEE 2WV6D 3LNNA 4WORA 4DK3C 3AMUA 1VF7A 2R93B 3S1NH 4HCEA 4XQQA 1DOKA 4I7AA 4ABNA 1PA6A 4CDCC 2L55A 1CHQD 3K0XA 3OW7A 4A3MG 4XTCS 2AQ3B 1KNEA 1EU3A 2YU9B 3DXJC 4X62Q 3MHBA 2LFNA 2KHJA 3CCUA 3EQLC 3TP7A 5IGBA 2NVYB 4BBRG 4A3IG 4JV5L 3GV3A 1EOVA 4LK1C 5GADC 1Q46A 1EY7A 4C3JH 2R6GA 3GTQH 1U4RA 2CWPA 2LS01 4UY8C 4BY1G 2VZAA 4IJLA 3E3XA 1ET9A 4KLKA 4JBJA 2EOTA 3MZ5A 5C0XJ 4A3JH 1ML0D 4BBSG 3AEVA 3OTOL 2KA7A 1IBML 5EPKA 3ER0A 4YY3L 5C6AA 2KENA 3I73A 2JP1A 2ENBA 3T1HL 3GTKB 4XIGS 1NSNS 4JI7L 1ASZA 5C3EB 4NB3A 4JBWA 5IT9c 1KIXA 5GROA 1FJGQ 1XNRQ 2EXDA 4JI0L 1H9MA 4BY7G 4KI0A 1HUNA 1HZCA 2ZXRA 1GM5A 5JPNC 2LSSA 5E4XA 3CAMA 3FVQA 1VQ8A 5C0XG 1K8AC 3R3OA 4B9WA 4JI6L 4ZYSA 1DD2A 3A7LA 1XWEA 1L0YB 2M9VA 4ZQ3A 1NMFA 3K7UC 5E7NA 1LLRD 4OONA 1JC7A 3HOXG 3URYA 5FLXL 4Y7NB 3CMAA 1YNND 2B2YC 4Z9CB 1CSQA 4GN5A 2WAQB 5ELFA 2FXQA 3NBIA
chains in the Genus database with same CATH topology
2NN6I 4CJ2C 3FEWX 1CM9A 1SMYC 2EYJA 3PUVA 1RTNA 4G4KA 1G2SA 1NR2A 3HKZB 5FOBB 2F0QA 2I07B 3A7AB 3KLSA 4IZ8A 4B08A 1LTTD 3IKJA 2FMCA 5G3LF 1WTXA 4KKSA 1IYUA 2K7VA 4KV6A 1AEXA 3S1RB 1AZPA 4XYOA 1ICWA 1B9MA 1GXDC 5ELCA 4NW2A 1Y8PB 2IJ0A 4KN4C 4A3MB 4R9WA 2A69C 4CJ0B 1LTSD 1XXGA 1U4MA 2AWNA 4X3SA 4L8JA 4BBRB 4A3IB 5LL6S 1QILA 3EA6A 2FHTA 3T13A 4L6TB 3GV6A 4PMCA 3ND8A 4BY1B 3WOFA 3ITPA 4G7OC 3IL8A 1H9JA 1CFMA 3VR4A 3TP8A 3KK7A 5LL6X 1NR4A 3SK5A 4BBSB 2K5WA 2G9HD 3NBHA 5CV4A 3HRZC 1WTVA 1V1OA 5IODA 2RDGA 4DA2A 1LT3D 3V05A 5JEAH 2PPBC 4TSSA 1HCZA 1SNDA 1RJTA 1BF4A 2EY5A 1FD7D 5IOCA 3K7AB 1JOKA 1AZQA 4OO1G 1CA5A 3DWQA 1GUTA 3GTOB 1EY6A 3SR1A 1GHKA 1ONLA 3K6OA 3HOXB 2C9OA 1HHVA 1I4PA 4M1UB 2CQAA 3D6WA 2F0VA 4G7HC 3M4OB 4EVOA 5A2QE 2K33A 3D4RA 1EZ8A 1B2TA 3BZDB 2ZT9C 1D6EC 4I65A 2XWBB 1KDCA 2A73B 3QOJA 4FXKC 1T5EA 5J22A 1SYEA 2BE5C 1PFMA 2QILA 3X3MA 2F0NA 3SEBA 2Q8TA 2NYZD 2M2LA 3CKIB 1YNJD 1GUOA 1U9RA 2L1BA 4IUPA 1FR3A 4HMIA 4TKOB 1GUNA 3WDNA 1SEBD 2K03A 4NP5A 1EQVA 2F0LA 3E0JA 5CYUA 3L3OC 3I3CA 3MTSA 2B2WC 1RODA 1B9NA 4DXFA 3T16A 1MD2D 2N88A 5D14A 1Q90A 4DN4M 4ZAIA 1BQQT 1SBBB 2NVTB 2J4XA 3R8BA 5K5PA 2LMCB 1B50A 2KUMA 3PV0A 1G6ZA 2TSSA 3KBXA 1SE3A 1ILPA 4KY6A 5NUCA 4KKUA 5D3IB 1GUWA 2TMPA 2IPKD 3CU7A 3SDZA 2L12A 4OGQC 2L5TA 1JR0D 5T1GA 1IW7C 2MHVA 1I6VC 4K6LA 4ZKBB 1ENCA 5FK9C 3RMHA 3N52A 4F8MA 2XNAC 3AU7A 2EE1A 2D2CC 1WTWA 2Z4HA 3I4NB 1VMCA 1IL8A 4ZRZA 1A6XA 5D65A 3BS1A 5HGTA 3MVVA 4ZKCB 3KF8A 4RCOA 1ILQA 4F7XA 1TU2B 2NTSA 4DNRB 1VCIA 4QUCA 2F0JA 3NQTA 2X6GA 3HGBA 4A3BB 3OSOA 4KY7A 1DYQA 2EYLA 1CA6A 2EZVA 2E2HB 4H13C 3MXUA 3FMCA 3L7ZC 3R93A 2JE6I 1S5CD 2F0PA 3SXHA 2JEBI 3KLSX 1BXTA 4NMZA 3V96A 4WRDA 2B2TA 3M4YA 4DAYA 5J39A 1EY9A 4K2KA 1SSOA 2V4DA 1PYWD 1RDPD 1F9PA 4RAUC 1LTGD 4P2CB 1O78A 2E2JB 2NWGA 2WACA 4ZUIA 2FFKB 2KQ3A 2RSOA 2BDOA 2HUGA 1CZWA 2IX3A 1TS3A 1RHPA 3HOUB 1EZ6A 4A3FB 2KECA 3C1FA 1C8CA 5C0XH 2X69A 4C1NK 3J81E 1JQYD 2MP1A 3NTKA 1HA5A 1J8IA 2R7ZB 2OT2A 1A3UA 3TBIB 4XXEA 3V2TA 3LWEA 2AQ2B 2R3ZA 4Q5VA 1A3TA 1GUGA 5F2DA 1QE6A 2K28A 2R92B 3O13A 3D3RA 2JA8B 2Z8LA 3GP7A 3LWUA 1JB3A 2ZXOA 2NN6G 1W6JA 3HEJA 3DUZA 4ULLA 3K5NA 2B8FA 4B9XA 3S1QB 4U68A 5ELBA 5G3LD 3AB9A 2NBFA 4IUTA 1MBYA 3QJYA 3KUPA 4A3DB 1D1IA 1JWMD 4L63B 1CQVA 1V1PA 4AYBB 3H94A 3NWTA 1Y1VB 4XDXA 1SYDA 4FF4A 3EFXD 4J6HA 1E0BA 1BO0A 1KLGD 1PFNA 1QG7A 4PNYA 5I4DA 3JAML 2EJFC 3PUXA 1HFNA 2O5IC 1ZKOA 2F0IA 1WTQA 1D5XC 2A69D 5IGEA 1TWAB 4XT3B 1EOTA 3MWYW 2O5JC 4FP5D 1EIGA 1H9SA 3TSSA 2YYZA 4EQOA 2JSOA 2JA5B 2EY6A 3VYTA 5CV6A 1KDAA 5EPJA 3OWFA 2KEEA 4QB4A 5COYA 5CORA 5FO8B 1TS4A 1A2UA 2B2WA 5EPLA 2AWOA 3TP6A 2PQEA 3K5MA 1X32A 1I4XA 3SK8A 3NSWA 3T53B 3DEOA 5JPMC 1TY0A 1TR5A 1HUMA 5BN3A 1KABA 2MJ8A 1SYBA 2A6ED 4OO1H 2N55A 3BG3A 2RA4A 5DNFA 4KN7C 1K83B 1I50B 4F88A 4DAPA 4QF4A 5JJZA 4LJZC 4IALA 1LTID 5I9OA 1DJRD 4HAEA 1E2VA 3G6JB 1PLFA 2B2UA 1OO9B 3DEPA 3SK4A 1XTCD 4K8JA 5E1FA 3RUZA 2BA0A 3M7NA 4R8NA 1RD9D 1BCPC 1SNQA 4RGMA 4RGOS 3GTMB 2CW0C 2BE5D 1EWHA 2NB0A 3D31A 5KNBA 1BCPF 1RTOA 2KVMA 4YIJA 5A35A 1BCPB 4ME5A 3OIQA 3A8JE 5EQ0A 3S9WA 3T4AC 2PW7A 2IL8A 2WKDA 3U9SA 1ESRA 2E75C 2A6HC 3M3YB 2FINB 2A74C 3W3AA 3DHQA 2EDGA 1DCZA 1Y8OB 2B2TC 1CQFA 1FNWA 3OHXC 5J1ZA 2I46A 1OXUA 1C48A 2HDMA 2KEDA 4BWGB 4A3KB 1EEID 2QEJC 4UDUC 1G2TA 4CGYB 1AFPA 2RQXA 2RSNA 1OXSC 4RHSA 2K04A 3D4DA 1WVLA 1QNKA 4KHZA 5JOBA 5D3DA 1AN8A 3PO3B 1T5XD 4N9TA 2WP8J 5JAVA 3HOWB 3HG9A 3HS0C 1EU4A 3RZDB 1PXUA 2A68C 4MIUA 1IW7D 3QWNA 1TWFB 5DEHA 1QOHA 4FXGC 5ELDA 3NPPA 3ONAB 3TN2A 2G9DA 3EROA 1XX8A 3H91A 2CVRA 2IX0A 1STGA 4X3TA 2H1EA 3NP8A 1TY2A 4ZLTF 1UEAB 1RCVD 5M3MB 1KDBA 3GTGB 1DOMA 5KIXA 2QCPX 3M7GA 3BYYB 1H9KA 3S15B 2F0KA 4HN7A 4OL7A 5IGDA 2BCOA 4QCLA 4KJOA 2SEBD 2BOSA 2F0GA 4FF2A 1OXVA 5K36G 1O80A 3HZXA 2EYHA 3SVMA 4DFAA 4U673 1E2WA 1M4VA 1Q1BA 3TDQA 5CV5A 1R9TB 1V8QA 3HOYB 2F0TA 2PNRC 1I4HA 1MSHA 1WTPA 3DM1A 4OHJA 3VYUA 1V1PB 5DM73 5KEEA 4CHTB 2B63B 3T56B 1F2MA 1ZEQX 5C4ZA 4I7ZC 5M3FB 3K0YA 5IT9E 1NUCA 3I70A 2HDLA 3GTJB 3D4WA 2EYMA 3QOLA 3H6MA 3S16B 5M9OA 1KLUD 1U4LA 1VDZA 2RDHA 1EL0A 2DNCA 2EXZA 1IKMA 1H9SB 1D1KA 3UI2A 2VUMB 4PMBA 3DMUA 5C5LA 2XWJB 4RKBA 2NUCA 1EYDA 4EQPA 4IFDI 1Y69U 4IQZA 2K6AA 5KRUA 1J9OA 1GOZA 2L9HA 3C3LA 5KNDA 3MXGA 5CV9A 5CR3A 3Q6SA 2AUJD 3J80L 1F2ZA 1R4QB 1OXXK 1F2LA 2PZTA 3HOVB 2NN6H 2IWHA 4XQNA 2KCNA 3S2DB 3OWEB 1LT5D 2PYKA 2B2UC 4A3GB 4K5XA 5E3FA 1EY8A 3VYSA 4C3JB 2K5DA 1SYGA 1Z7TA 2XIWA 4FNFA 1GJXA 2E76C 4S3SA 2SDFA 4KY5A 4A3JB 3G7LA 1SE4A 4E6IA 5HURA 1EQTA 5EKKA 2F0UA 1ZYRC 4MHEA 1PMRA 1B44D 2NTTA 1PRTC 3X3NA 2F1MA 1PZID 3S14B 1CZGA 1H9RA 2Q8RE 1PRTF 3N6RA 2B2VA 1PRTB 2IT1A 1JOOA 2QKIC 5EGTA 4KD3A 4RFBA 3BDCA 3OIPA 2K01A 4WJWA 5CGKA 1KAAA 5C3XA 5I2YA 1VMPA 1HFGA 5AFWA 2PZWA 3KBGA 3NHHA 1TWHB 1Y8NB 4HCSA 4OIKA 3FDTA 1ENFA 1MSGA 1TS2A 1X3PA 3A8KE 3A8IE 3FKIB 3A55A 1V43A 1EY4A 1E2ZA 1SXTA 1ENAA 4IN3A 3SHLA 3D6CA 3QO2A 2HCIA 4PMWA 4ILWA 2F0MA 2L0CA 1LTRD 1JCKB 5TSSA 1TIID 1G91A 1TWCB 2XRSD 4DK0A 1TQOA 3NXWA 2EYFA 4RKLA 5CC4A 4HEDA 4H0LC 1UUPA 1DONA 2QDBA 3VYRA 2EJMA 2K1BA 1KNAA 3D8GA 4V0BA 2JYOA 1IHZA 3IFDA 4R8IA 2ZXPA 3H3VC 4JK1C 1BCPD 4IUVA 4HTHA 3QG1A 1S5DD 4DK1A 1EEFD 3NWSA 1EY5A 1HXYD 3PIP3 1I4GA 2F0DA 1SMYD 5M5WB 3OMCA 1S5BD 2CHBD 3P7JA 2L11A 3T51B 4IURA 3I8ZA 4DU9A 1Q8IA 1PZJD 1STEA 3FRPB 3Q24A 1MI2A 2JA7B 5FO9B 3BVGA 4CKEA 1QWYA 5M5XB 2GA4B 3CRKC 3C2PA 4FF1A 4RHRA 5KYLA 3VR2A 1BBXC 3L9AX 5I6WA 2PW5A 2RKSA 1QJOA 1I3QB 5M5YB 3I4MB 5C44B 4F87A 2NVQB 4K8IA 3J81L 3E6ZX 1QNUA 1ET6A 3PUZA 3GQBA 4A3EB 1RF2D 2K05A 3MFGA 2DNEA 1PTOC 5EBDA 2R61A 2F0OA 1EYAA 2AQ1B 2J7ZA 1II3A 1FGBD 3I72A 1PTOF 2JXMB 2F0SA 1HTLD 2PMZB 1PTOB 1S5ED 4ID6A 2BDNA 4RCNA 2ICEC 1AP0A 1PDQA 4O42A 3RLFA 5EKLA 1DZ1A 4HMJA 3KLRA 3I91A 2RBMA 4RWSC 4GZYC 2A68D 4RA8A 3DWPA 1U4PA 5FLXE 4EGVA 4QMGA 2F0EA 4ODGA 1B4OA 1QB5D 4TRDA 3VA7A 1VF5C 3S1MB 1LACA 4RGTA 3CHBD 3A56A 2WINB 2BA1A 1DOLA 3MAQA 4X3KA 2OF1A 4BA1I 4X3UA 2SNMA 1EYCA 4Q0FA 2F0FA 1LT4D 4IUNA 4CBVA 3BYTB 1TKWB 5K36H 1SE2A 5I9PA 3MXNA 2XRQD 5T1IA 3MA2B 3GO5A 2FJ2A 4BS9A 3Q23A 4DXGA 3K5LA 3Q22A 1C4QA 3PMFA 2O4XA 2VNUD 2HQEA 1O7ZA 5CV8A 4J8QA 4G7ZC 1CI3M 3ERQA 5C4XB 2B2VC 1A3VA 1O7YA 4FVMA 1JWSD 2KHSA 1EY0A 1NAPA 2D9UA 3J7YW 5EJWA 1Q1EA 1Q12A 4IFDJ 2NZ1D 2EVBA 2MPMA 2B39A 4N9PA 2A5HA 4H44C 2KJXA 2SOBA 1Z47A 4FO2A 4DAVA 3NQIA 3HP3A 4C2MB 2E2IB 1IYVA 3R2IA 2EPBA 1Y1WB 4IUQA 2IW3A 4IFDG 4RH6A 3H0GB 1PFBA 2QF7A 2X6LA 3NE5B 3RD4A 1FNUA 5EBCA 1OXTA 3MXPA 1BR9A 3MEHA 3H09A 3W2DA 4OIJA 5DAUA 4C3IG 1I6HB 1ESFA 4KHVA 1TT2A 1L0XB 4G57A 1TWGB 1TS5A 5I2XA 2E2DC 5FO7B 1BNZA 3BDOA 3PUYA 1CT1D 3VA5A 1F9SA 5KNCA 1UNSA 3K58A 2XN9C 3FPUB 1HTPA 5C4HA 1SJHD 1KTKA 1BUVT 1A15A 2FMMA 1LABA 3C46A 2MUYA 1SJED 2XVSA 2DN8A 1ZYRD 3ZYYX 4K5VA 1QCBD 2F3VA 3OOCA 2RDFA 1LO5D 1PRTD 2A6EC 2K5QA 2OXPA 3CQZB 4C3JG 4BY7B 4WFN3 2B8GA 3P20A 4KD4A 2RVLA 3EVQA 3BVZA 4KJNA 4V190 4XT1B 1BDOA 1SFOB 2OEOA 1F9QA 3NK9A 3PIO3 5FKAC 1WTOA 5C3WA 5C0XI 1D2BA 4M8AA 4A93B 2Y0SB 1D5ZC 1I4RA 4H7BA 3J80E 4MN3A 3MC0B 5IIFA 1YNNC 4C1NI 4LMQD 1PTOH 3GD7A 3PO2B 3FPPA 4K5WA 1PZKD 5KGUA 5IGFA 1WD0A 1Z6HA 2PO4A 2KCCA 5JVG3 4CKBA 1S5FD 4FXDA 4CKCA 5C4JB 2VB3X 4C3IB 5IGGA 1JICA 1SAPA 1GHJA 4XQJA 2KOLA 2ID0A 2WB1B 1HQMC 2XSCA 1RKNA 5A2QL 3M85A 2Q8IB 1Q3LA 4K2LA 4K6DA 4QUFA 1STAA 3S1NB 1ZXTA 1STBA 2D62A 3OPOA 1DM0B 2LY7A 5BN4A 1STHA 2L4NA 3EJIA 1D5MC 2VXWA 1FNVA 2EJGC 5IT9L 3LX0A 1B1ZA 5LHY1 3IAYA 2PZUA 3QB3A 5JEAJ 1HA6A 3PUWA 1LV9A 4PQXA 3GTQB 1SNMA 3NTHA 1HRJA 3QIAA 2IX1A 1JORA 3R2TA 1SNPA 2J0TD 5BN5A 3VR5A 5ISRA 2K32A 1LT6D 4PV1C 4TQUS 3TZDA 1JOQA 4BA2I 4HR7B 2M00A 1K8OA 5JEAG 4OO1I 1NCVA 3MFYA 2F0HA 1SNCA 3OMGA 2JEAI 1HPCA 3TMEA 2B2YA 2O2LD 4J1MA 1PTOD 1LTBD 2DY7A 2Z1CA 2WIIB 3IFTA 3SE0A 1SDFA 1X3QA 2EYOA 3E5SA 4CJ1B 4HSPA 4O1NA 4EQNA 3ND9A 4UAIA 1FYCA 3F2UA 2MGSA 4C3HG 3HOZB 1DXMA 1BOSA 5C5MA 2F0WA 1YNJC 1STNA 5ELEA 3VR3A 5IGCA 5CV7A 5EKIA 3TZUA 2Z4IA 5KYIA 3CRLC 2C5CA 1F2YA 3NTIA 4XYQA 1F77A 1I4QA 1B53A 1WCMB 4DNTB 4QIWB 1O7LA 3P1HA 1F9RA 3J7AV 4HSVA 3BVMA 1R4PB 3GTPB 5CBAE 1XYIA 3A54A 4LAAA 3I90A 4KKTA 1WTRA 1B3AA 1A2TA 4RGNA 2DY8A 3JAME 4NDXA 2PCFB 1EIHA 1M8AA 3RZOB 2CW0D 1K8MA 3K59A 1W6KA 1JWUD 1EWCA 4FF3A 2WKCA 1EFID 2NVXB 1CK1A 3WOEA 4KK7A 2H4OA 5I6YA 2E74C 3DWAA 4KMUC 1SYCA 2F3WA 3C1EA 1IKLA 2D5DA 2A6HD 2HCCA 3TP5A 1CTMA 1S4ZA 3Q0AA 3S17B 1UAPA 4K14A 3K5OA 2EYPA 3P75A 4KTAA 3NUCA 2F4IA 3VR6A 1CHPD 4IFDH 1MGSA 3SK6A 1AW7A 2EY2A 2AUKA 4C56C 4FYDA 5E4WC 2SNSA 4DF7A 4ZUJA 1HQRD 3J7AF 1G291 1JE4A 3I4LA 1GUSA 1STYA 4NKLA 3S2HB 4DGZA 5JVH3 3GTLB 2VB2X 1TVXA 1WD1A 3U9OA 2F03A 2JA6B 1LTAD 5DM63 1G8ZD 4C3HB 4IUUA 2LKVA 5CMDA 1SNOA 2ICIA 4ZK9B 2EY1A 3BDLA 3K57A 1SYFA 5CBEE 2WV6D 3LNNA 4WORA 3AMUA 1VF7A 2R93B 4HCEA 4XQQA 1DOKA 4ABNA 2L55A 1CHQD 3OW7A 4XTCS 2AQ3B 1KNEA 1EU3A 2YU9B 3DXJC 3MHBA 2LFNA 3EQLC 3TP7A 5IGBA 2NVYB 3GV3A 4LK1C 1EY7A 2R6GA 1U4RA 2LS01 1ET9A 2EOTA 3MZ5A 5C0XJ 1ML0D 2KA7A 5EPKA 5C6AA 3I73A 2JP1A 2ENBA 3GTKB 4XIGS 1NSNS 5C3EB 4JBWA 1H9MA 4KI0A 1HUNA 2ZXRA 5JPNC 5E4XA 3FVQA 5C0XG 3R3OA 4B9WA 4ZYSA 1DD2A 4ZQ3A 3A7LA 1XWEA 1L0YB 2M9VA 1LLRD 1JC7A 3URYA 5FLXL 4Y7NB 1YNND 2B2YC 4Z9CB 2WAQB 5ELFA 3NBIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PRT B;  2ICI A;  3R2T A;  1FD7 D;  4L63 B;  1JWM D;  1SBB B;  2RDH A;  1EEF D;  1CQV A;  2J4X A;  3BVM A;  1V1P A;  1D5Z C;  1FNU A;  1I4R A;  1HXY D;  1EU4 A;  2WV6 D;  4RGT A;  3R8B A;  3CHB D;  3DWQ A;  1I4G A;  1XTC D;  1LT6 D;  1PYW D;  1RDP D;  3MC0 B;  3EFX D;  4RFB A;  4RGN A;  3W2D A;  1S5B D;  2CHB D;  2TSS A;  5ELD A;  1SE3 A;  1KLG D;  1ESF A;  1I4P A;  1RD9 D;  1LTG D;  1L0X B;  1BCP C;  5D3I B;  1CHQ D;  5I4D A;  1TS5 A;  1LTT D;  4RGM A;  4RGO S;  1PTO H;  1LT4 D;  2IPK D;  2AQ3 B;  3BYT B;  1EU3 A;  1GOZ A;  1BCP F;  1D5X C;  1SE2 A;  1CT1 D;  1PZJ D;  1PZK D;  1ENF A;  1TS2 A;  1JR0 D;  1STE A;  1BCP B;  2XRQ D;  4K6L A;  1UNS A;  1JWU D;  1EWC A;  1S5F D;  1TY2 A;  3TSS A;  1EFI D;  1TS3 A;  1RCV D;  5FK9 C;  2O2L D;  2XN9 C;  3BZD B;  1CK1 A;  3BVG A;  5ELC A;  1D6E C;  4DXG A;  1SXT A;  1SJH D;  1KTK A;  2IJ0 A;  4RHR A;  1PTO D;  3BYY B;  1LTB D;  2QIL A;  3SEB A;  2XNA C;  1ET9 A;  3DWA A;  2SEB D;  1LTR D;  1LTS D;  1JQY D;  1TS4 A;  1XXG A;  1SJE D;  1JCK B;  1JWS D;  1HA5 A;  1QIL A;  3OWE B;  3EA6 A;  5TSS A;  1LT5 D;  1ET6 A;  1M4V A;  1FNW A;  1I4X A;  4O1N A;  1RF2 D;  2XRS D;  3MFG A;  4L6T B;  1PTO C;  1CHP D;  2AQ2 B;  1LO5 D;  1PRT D;  4RCO A;  2R61 A;  1I4H A;  1TY0 A;  1AW7 A;  2AQ1 B;  2NTS A;  4BWG B;  1SEB D;  1EEI D;  1FGB D;  2QEJ C;  4UDU C;  4OHJ A;  4C56 C;  1PTO F;  1V1P B;  3O13 A;  1UUP A;  5ELE A;  1HTL D;  1HQR D;  1PTO B;  1S5E D;  3BVZ A;  1D5M C;  1SE4 A;  4RH6 A;  2G9H D;  1DYQ A;  1FNV A;  2Z8L A;  3GP7 A;  1B1Z A;  4ZYS A;  1V1O A;  1L0Y B;  2RDG A;  4RHS A;  3DWP A;  1B44 D;  1LT3 D;  3V05 A;  2NTT A;  1F77 A;  1LLR D;  1PRT C;  1I4Q A;  4DXF A;  5FKA C;  1MD2 D;  3URY A;  1S5C D;  3R2I A;  1PZI D;  5D3D A;  1AN8 A;  4TSS A;  1LTA D;  1T5X D;  4Z9C B;  1G8Z D;  5ELB A;  3KLS X;  1PRT F;  1BCP D;  5ELF A;  1KLU D;  1LTI D;  1BXT A;  1S5D D;  1DJR D; 
#chains in the Genus database with same CATH topology
 1KQS A;  2NN6 I;  2OQK A;  1XMQ L;  4CJ2 C;  3FEW X;  1CM9 A;  3H15 A;  1LYL A;  1SMY C;  2EYJ A;  2CCZ A;  2F4V Q;  3PUV A;  1RTN A;  4G4K A;  4O0A A;  1J6Q A;  1G2S A;  1NR2 A;  3HKZ B;  5FOB B;  2F0Q A;  2I07 B;  3A7A B;  3KLS A;  4MTN A;  4X64 Q;  4IZ8 A;  2N8N A;  4JCV E;  4QGU A;  4B08 A;  1X56 A;  4LFA L;  1LTT D;  2K5V A;  3IKJ A;  4LF8 L;  4HIM A;  2FMC A;  5G3L F;  1HNW Q;  1WTX A;  3PO2 G;  4KKS A;  1IYU A;  2K7V A;  1HR0 W;  4KV6 A;  2PQA A;  1AEX A;  4OX9 Q;  3S1R B;  1AZP A;  4XYO A;  3L2P A;  1WCM H;  1ICW A;  2PNH A;  1B9M A;  1GXD C;  5ELC A;  5FLM H;  4NW2 A;  2BH8 A;  1Y8P B;  2IJ0 A;  4KN4 C;  4A3M B;  1HNX L;  4R9W A;  4POF A;  3GTP H;  2A69 C;  2Z0S A;  5LMN W;  4PZ6 A;  4CJ0 B;  3CCR A;  1LTS D;  1SR3 A;  1XXG A;  1U4M A;  2AWN A;  1NE3 A;  1B70 B;  2D0P A;  4L8J A;  4X3S A;  4BBR B;  4A3I B;  1JMC A;  5LL6 S;  1K3B C;  1QIL A;  1VQB A;  4DR2 Q;  3DM3 A;  3EA6 A;  2Z6B A;  2FHT A;  3T13 A;  4LF5 L;  3CCM A;  4L6T B;  3GV6 A;  4PMC A;  3RZO H;  3ND8 A;  4BY1 B;  3WOF A;  1YIJ A;  4QQB X;  1EFW A;  2ES2 A;  3ITP A;  4G7O C;  3IL8 A;  3KDF B;  1JB7 A;  1H9J A;  1CFM A;  3H3V H;  3VR4 A;  3TP8 A;  4DV1 L;  3KK7 A;  5LL6 X;  1NR4 A;  3SK5 A;  4BBS B;  2K5W A;  2IHF A;  1VQO A;  2G9H D;  2NVX H;  3NBH A;  5CV4 A;  3A5Z B;  3HRZ C;  1WTV A;  1V1O A;  5IOD A;  4Y52 H;  2RDG A;  3FHW A;  1L1O C;  4DA2 A;  1LT3 D;  3V05 A;  5JEA H;  2D0O A;  2MO0 A;  2PPB C;  2LXK A;  4TSS A;  1HCZ A;  1SND A;  4JV5 Q;  3EIV A;  3UDX A;  1IBL L;  1L1O B;  1RJT A;  2K52 A;  1BF4 A;  3S17 H;  2EY5 A;  1FD7 D;  5IOC A;  1XNQ Q;  2Q2H A;  2CH4 A;  3K7A B;  1JOK A;  1AZQ A;  4OO1 G;  2JJQ A;  3KF6 B;  3UE0 A;  1CA5 A;  3DWQ A;  1GUT A;  1TXY A;  1C7Y A;  3GTO B;  1EY6 A;  3SR1 A;  4AYB E;  5M5X H;  1B7Y B;  1NJI C;  1ONL A;  3K6O A;  1GHK A;  3HOX B;  3OTO Q;  2C9O A;  3CCJ A;  5DLQ E;  1HHV A;  1I4P A;  4YY3 Q;  2A8V A;  5IP9 G;  4M1U B;  4DAM A;  3T1H Q;  2CQA A;  3D6W A;  2ASB A;  2XTI A;  1I3Q H;  5M5Y H;  2F0V A;  4JI7 Q;  3I4M H;  4G7H C;  3M4O B;  4EVO A;  1WFQ A;  3I4N G;  5A2Q E;  3S2H H;  4DV5 L;  2K33 A;  1VQD A;  3GTL H;  3CP0 A;  3D4R A;  1PH7 A;  3I56 A;  1EZ8 A;  1B2T A;  3BZD B;  3K81 C;  2ZT9 C;  1D6E C;  4C3H H;  4I65 A;  2XWB B;  1KDC A;  3KOJ A;  2WFW A;  1D7Q A;  1N34 L;  2A73 B;  3QOJ A;  4FXK C;  1T5E A;  5J22 A;  1SYE A;  2BE5 C;  1PFM A;  2QIL A;  3X3M A;  2F0N A;  3SEB A;  2Q8T A;  2NYZ D;  2M2L A;  3CKI B;  3UDI A;  1YNJ D;  1GUO A;  4A3B G;  5IYD H;  1U9R A;  2L1B A;  4IUP A;  3J81 j;  4LF9 L;  1FR3 A;  4HMI A;  4TKO B;  1V1Q A;  3BZC A;  1GUN A;  1B8A A;  3WDN A;  2YU9 H;  4R1J A;  5EAY A;  3G4S A;  1SEB D;  2K03 A;  4NP5 A;  3HOZ G;  4DPG A;  1PH9 A;  1HJP A;  1EQV A;  1BKB A;  2NVY H;  5LMU L;  2F0L A;  3E0J A;  2JQO A;  5CYU A;  3L3O C;  1N32 L;  3KFU A;  3I3C A;  2LXJ A;  3MTS A;  2B2W C;  1J5E Q;  1ROD A;  2UXD L;  1B9N A;  1RL2 A;  4TVA B;  3T16 A;  4DXF A;  4DV2 L;  2UUB L;  1MD2 D;  2N88 A;  3CCL A;  5D14 A;  2RHQ B;  1CKN A;  4LW1 A;  1Q90 A;  4IPG A;  2AHO B;  3CC4 A;  4DN4 M;  4ZAI A;  1BQQ T;  1P8L A;  1SBB B;  2NVT B;  2J4X A;  4NXM Q;  1L0W A;  1HNX Q;  3GTK H;  3R8B A;  2OTL A;  5K5P A;  2IHE A;  2LMC B;  1B50 A;  2KUM A;  2OCE A;  3PV0 A;  1G6Z A;  3J80 i;  4EX5 A;  1W3S A;  2TSS A;  3KBX A;  2EIF A;  1SE3 A;  1ILP A;  4KY6 A;  4HJ9 A;  5NUC A;  4A3F G;  4KKU A;  4LUO A;  5J3B A;  5D3I B;  1GUW A;  2TMP A;  3ULP A;  3JC6 6;  2IPK D;  3CU7 A;  3SDZ A;  3TS0 A;  3NEN A;  2L12 A;  4OGQ C;  5C4X H;  2L5T A;  4AQY Q;  1JR0 D;  5T1G A;  1IW7 C;  2MHV A;  2WAQ E;  1I6V C;  4K6L A;  2R7Z G;  4ZKB B;  4Y7N H;  1ENC A;  5FK9 C;  1KRS A;  3RMH A;  1HZA A;  4DR6 L;  3N52 A;  1CKM A;  4F8M A;  2XNA C;  3AU7 A;  1K3R A;  2EE1 A;  1PV4 A;  2D2C C;  1WTW A;  2Z4H A;  3I4N B;  3RLN A;  4R4C A;  1FL0 A;  3UDG A;  1VMC A;  1IL8 A;  3CC2 A;  4LUV A;  4GOP A;  4P75 A;  4C2M H;  4ZRZ A;  1A6X A;  4R4O A;  1VQ4 A;  5D65 A;  3BS1 A;  5HGT A;  3MVV A;  4ZKC B;  3KF8 A;  4RCO A;  1ILQ A;  4F7X A;  1TU2 B;  2NTS A;  4DNR B;  1VCI A;  1YEZ A;  4QUC A;  2F0J A;  1LM0 A;  3NQT A;  1HNZ L;  1M1K C;  4A3D G;  5FLX c;  5IYC G;  2X6G A;  3HGB A;  3A5U A;  4A3B B;  3OSO A;  4AYB G;  4KY7 A;  1DYQ A;  2EYL A;  4NXN L;  1CA6 A;  1Y1V G;  1VQE A;  2EZV A;  2OQ0 A;  2E2H B;  4H13 C;  3MXU A;  3FMC A;  3L7Z C;  1I6H H;  4ZCK A;  1ASY A;  2JA9 A;  3R93 A;  4DV5 Q;  2JE6 I;  3BU2 A;  4JVZ A;  1S5C D;  2K5N A;  4X65 Q;  4A3M H;  2F0P A;  3SXH A;  2JEB I;  2JA6 G;  3KLS X;  1BXT A;  4NMZ A;  4QL5 A;  2PQA B;  3BZK A;  3STB C;  1MKH A;  1N34 Q;  3V96 A;  4WRD A;  4JI1 Q;  4A3I H;  2B2T A;  3M4Y A;  4DAY A;  5J39 A;  4A3C G;  1EY9 A;  4K2K A;  1SSO A;  2V4D A;  3CPW A;  1PYW D;  1RDP D;  3CC7 A;  1F9P A;  2R93 G;  4RAU C;  4BY1 H;  2JA5 G;  2L15 A;  2ZTC A;  1LTG D;  4LF9 Q;  4P2C B;  4MZ9 A;  4X66 L;  4BBS H;  1O78 A;  2E2J B;  1YBY A;  2NWG A;  2WAC A;  4ZUI A;  2FFK B;  2KQ3 A;  1X3F A;  4BXX G;  2RSO A;  3KDF A;  2BDO A;  1VQL A;  1MJC A;  2HUG A;  1CZW A;  2IX3 A;  1TS3 A;  1RHP A;  2DJG C;  1N32 Q;  5IY0 A;  3HOU B;  1EZ6 A;  1XPU A;  4A3F B;  2KEC A;  4BY7 H;  4DK6 C;  4J15 A;  3C1F A;  4DV2 Q;  3K7A H;  1C8C A;  1QUQ B;  3RLO A;  5C0X H;  2X69 A;  1X65 A;  1A62 A;  4C1N K;  3J81 E;  1JQY D;  2MP1 A;  4YHH Q;  1SFO H;  2ALY B;  3NTK A;  3HOX H;  1HA5 A;  1J8I A;  2R7Z B;  3FP9 A;  2OT2 A;  1A3U A;  3TBI B;  3KF6 A;  4XXE A;  3V2T A;  3LWE A;  3J7A 5;  1PHJ A;  2AQ2 B;  2R3Z A;  5C3E G;  3M4O H;  4Q5V A;  1A3T A;  4LFB Q;  5FJ8 G;  1Q86 C;  3T1Y L;  1QVC A;  3I4O A;  1GUG A;  5F2D A;  1QE6 A;  2K28 A;  2R92 B;  3O13 A;  3D3R A;  1A0I A;  2JA8 B;  1A8V A;  5AJ3 Q;  2Z8L A;  3GP7 A;  3F2D A;  3PF4 A;  1EYG A;  3LWU A;  4GS3 A;  2G5D A;  1JB3 A;  2ZXO A;  2NN6 G;  1W6J A;  3HEJ A;  3K80 C;  3DUZ A;  4ULL A;  4LF4 L;  3K5N A;  2B8F A;  1VQC A;  4B9X A;  3S1Q B;  4U68 A;  5ELB A;  3H3V I;  5G3L D;  3PO2 H;  3TQY A;  3AB9 A;  4OEM B;  2NBF A;  4IUT A;  1MBY A;  3QJY A;  3KUP A;  4DV7 L;  4A3D B;  2AMC B;  1D1I A;  1JWM D;  4L63 B;  4HID A;  1CQV A;  1V1P A;  4AYB B;  3H94 A;  3NWT A;  1Y1V B;  4XDX A;  4IPC A;  2E5L L;  1UE1 A;  5C4J H;  1SYD A;  4FF4 A;  4YWL A;  4FDB A;  3EFX D;  3CD6 A;  1OTC A;  4J6H A;  1E0B A;  1U0L A;  1S3O A;  3DLL A;  1UEB A;  1BO0 A;  1KLG D;  1PFN A;  1QG7 A;  1IXR A;  4PNY A;  5I4D A;  3JAM L;  4DR3 Q;  2EJF C;  3PUX A;  1HFN A;  2R7D A;  2O5I C;  4B3R Q;  4IO9 A;  1ZKO A;  4DR4 L;  1SRO A;  2F0I A;  2DJF C;  1D5X C;  3EN2 A;  4LFC L;  2YTY A;  3ZJY C;  1WTQ A;  2A69 D;  5IGE A;  3W5O A;  1P16 A;  1TWA B;  2K50 A;  1EOT A;  1NMG A;  3MWY W;  3KYH C;  3B6Y A;  4XT3 B;  3J81 i;  2O5J C;  3W1B A;  4FP5 D;  1EIG A;  1H9S A;  2JK8 A;  3TSS A;  2YYZ A;  4EQO A;  2JSO A;  2JA5 B;  1T9H A;  1YI2 A;  2EY6 A;  3VYT A;  1BBW A;  5JJI A;  5CV6 A;  2UUA L;  1YJN A;  1XPO A;  4A3K G;  5L37 A;  1NY4 A;  1KDA A;  5EPJ A;  3OWF A;  2KEE A;  4QB4 A;  5COY A;  4PZ8 A;  5COR A;  5FO8 B;  1TS4 A;  1A2U A;  2B2W A;  4JI3 L;  1UE5 A;  5EPL A;  2AWO A;  3TP6 A;  2PQE A;  3K5M A;  1X32 A;  1I4X A;  3SK8 A;  3NSW A;  3T53 B;  3VDY A;  4R4I A;  1CKN B;  3DEO A;  5JPM C;  1TY0 A;  1TR5 A;  1HUM A;  5BN3 A;  3PO3 G;  1KAB A;  2MJ8 A;  1SYB A;  2A6E D;  4OO1 H;  2UXB Q;  2N55 A;  3BG3 A;  4CDD C;  2RA4 A;  5DNF A;  4KN7 C;  1K83 B;  4JI8 Q;  1I50 B;  1XMO L;  1ICF B;  4F88 A;  4X66 Q;  5IWA L;  4DAP A;  4LF7 L;  2DGY A;  2F3I A;  4UP7 A;  5IP9 H;  1YHA A;  4QF4 A;  5JJL A;  2BH2 A;  5JJZ A;  4DV0 Q;  1VQA A;  1G51 A;  4LJZ C;  2ZJQ A;  4IAL A;  1LTI D;  5I9O A;  1DJR D;  4HAE A;  1E2V A;  3G6J B;  1PLF A;  2B2U A;  1OO9 B;  3DEP A;  3SK4 A;  1XTC D;  4K8J A;  5E1F A;  3RUZ A;  4B3S Q;  5M3M G;  3U50 C;  4L5T A;  4GOP C;  2BA0 A;  3M7N A;  4R8N A;  1RD9 D;  1BCP C;  1SNQ A;  4RGM A;  4RGO S;  4DR5 Q;  1YIT A;  3GTM B;  2CW0 C;  2ZJP A;  2BE5 D;  1EWH A;  2NB0 A;  3D31 A;  5KNB A;  1K9M C;  1BCP F;  1RTO A;  2KVM A;  4YIJ A;  4GOP B;  2E2H H;  1X6O A;  5A35 A;  1BCP B;  3T1Y Q;  1O7I A;  4UPA A;  1RIP A;  3OIQ A;  4ME5 A;  4DV6 Q;  3A8J E;  5EQ0 A;  3KF8 B;  4POG A;  3ULJ A;  3S9W A;  3T4A C;  2PW7 A;  2IL8 A;  2WKD A;  1WOC A;  3HOZ H;  3U9S A;  1ESR A;  1U5K A;  4IPD A;  4HJ7 A;  1FGU A;  1VQ9 A;  2E75 C;  2A6H C;  3M3Y B;  2FIN B;  1VQM A;  3A0J A;  2A74 C;  3W3A A;  5M3F G;  3DHQ A;  4GNX C;  2EDG A;  1VQI A;  1DCZ A;  4JW0 A;  3RN5 A;  1Y8O B;  2B2T C;  1CQF A;  1FNW A;  3OHX C;  5J1Z A;  2I46 A;  1OXU A;  1C48 A;  2HDM A;  4GNX B;  4IPH A;  2E2J H;  1Z9F A;  2KED A;  4BWG B;  3F8T A;  4A3K B;  4A3L G;  1EEI D;  2QEJ C;  4UDU C;  4DAY B;  1PH5 A;  1G2T A;  3G48 A;  4CGY B;  1AFP A;  2RQX A;  4B3M Q;  4DR4 Q;  3I7F A;  4DR7 L;  2RSN A;  3K8A A;  5GAE C;  1OXS C;  4A3F H;  4RHS A;  2K04 A;  3D4D A;  2CQO A;  1QNK A;  1WVL A;  4KHZ A;  1PYS B;  5JOB A;  2CWA A;  5D3D A;  1AN8 A;  2HHH L;  3PO3 B;  1T5X D;  4N9T A;  2WP8 J;  5JAV A;  4YWK A;  3HOW B;  3HG9 A;  2UUA Q;  2RF4 A;  3HS0 C;  5BR8 L;  2QA4 A;  2R7Z H;  2ZJR A;  1KXL A;  1EU4 A;  1QUQ A;  1PXU A;  3RZD B;  4KHP L;  2A68 C;  4MIU A;  1IW7 D;  1GKH A;  3QWN A;  1TWF B;  5DEH A;  5GAG C;  3U58 A;  1VQN A;  1K0S A;  1PH2 A;  1QOH A;  4FXG C;  5ELD A;  4CDE C;  1PH1 A;  2CH4 W;  2ZM6 L;  1MHW C;  3NPP A;  3ONA B;  3TN2 A;  1HR0 L;  2G9D A;  3ERO A;  4QJF A;  1XX8 A;  3H91 A;  2CVR A;  2K4K A;  2IX0 A;  2A19 A;  3TEH B;  4UP8 A;  1YVC A;  1STG A;  3HOV G;  4X3T A;  2H1E A;  3NP8 A;  1TY2 A;  4ZLT F;  1UEA B;  1RCV D;  1PFS A;  4DKA C;  3F1Z A;  1XMO Q;  5M3M B;  4A3G G;  1Q7Y C;  1KDB A;  3GTG B;  1DOM A;  5KIX A;  2VQE L;  1IBM Q;  4L5R C;  2QCP X;  3M7G A;  3BYY B;  1H9K A;  5LMN L;  4A76 A;  4A3D H;  3S15 B;  2F0K A;  4HN7 A;  4OL7 A;  4UP9 A;  4AH6 A;  5IGD A;  1XPR A;  2BCO A;  4QCL A;  4KJO A;  2SEB D;  1Y1V H;  2BOS A;  2F0G A;  4FF2 A;  4A3J G;  1OXV A;  5K36 G;  1O80 A;  2VL6 A;  3HZX A;  4JI0 Q;  2EYH A;  3SVM A;  4DFA A;  4U67 3;  1E2W A;  4OWT B;  1M4V A;  1Q1B A;  2CFM A;  3TDQ A;  5CV5 A;  1R9T B;  1V8Q A;  2JA6 H;  3HOY B;  4JI4 L;  2F0T A;  2PNR C;  4JYA L;  2MQH A;  3RR5 A;  1I4H A;  4JI6 Q;  1MSH A;  1WTP A;  3DM1 A;  4OHJ A;  3VYU A;  1V1P B;  5DM7 3;  5KEE A;  4CHT B;  2B63 B;  3T56 B;  1F2M A;  1K28 A;  1TWA H;  1ZEQ X;  4A3C H;  3QR8 A;  5C4Z A;  3U4Z A;  3E9H A;  3STB D;  4I7Z C;  5M3F B;  3K0Y A;  5IT9 E;  1UE6 A;  2R93 H;  4JC0 A;  1NUC A;  2JA5 H;  2PMZ E;  2I5L X;  3I70 A;  2HDL A;  3GTJ B;  3UE1 A;  1V9P A;  1XMQ Q;  1KL9 A;  2EYM A;  3D4W A;  3QOL A;  4R4Q A;  4JI2 L;  3H6M A;  2VQF L;  3S16 B;  3SGI A;  5M9O A;  1KLU D;  1U4L A;  3TRZ A;  1VDZ A;  4BXX H;  1KD1 C;  2YV5 A;  2RDH A;  1EL0 A;  2DNC A;  2EXZ A;  1IKM A;  1H9S B;  2I5H A;  4NPS A;  1D1K A;  4LFA Q;  3UI2 A;  3E9I A;  3JAM c;  4LF8 Q;  2VUM B;  4PMB A;  3FKI G;  1GO3 E;  3DMU A;  5C5L A;  2XWJ B;  4RKB A;  2NUC A;  1EYD A;  4EQP A;  4IFD I;  1KRT A;  1Y69 U;  4IQZ A;  4N8F A;  4CDF C;  2K6A A;  5KRU A;  2UXC L;  1J9O A;  1I50 H;  1Q82 C;  1EQQ A;  1GOZ A;  1I5F A;  2L9H A;  4HIK A;  3C3L A;  5KND A;  3MXG A;  5CV9 A;  4EQ5 A;  5CR3 A;  2K75 A;  3Q6S A;  1Q8K A;  1E3P A;  1VQ6 A;  2AUJ D;  5C3E H;  3J80 L;  3J7Z C;  5FJ8 H;  1F2Z A;  3HOU G;  1R4Q B;  2B29 A;  3F2C A;  1OXX K;  4LF5 Q;  4DV3 L;  1N36 L;  1F2L A;  2HHH Q;  2PZT A;  4O2D A;  3HOV B;  2NN6 H;  2IWH A;  4XQN A;  2KCN A;  3S2D B;  2V1C C;  3OWE B;  1LT5 D;  4DV1 Q;  2PYK A;  2B2U C;  4A3G B;  4K5X A;  3OW2 A;  4KHP Q;  4JI5 L;  3GTM H;  1X54 A;  5E3F A;  1EY8 A;  3VYS A;  4C3J B;  2K5D A;  3Q8D A;  1SYG A;  1Z7T A;  2XIW A;  4FNF A;  3MXN B;  1GJX A;  2E76 C;  1EUJ A;  4S3S A;  2SDF A;  2R92 G;  1W2B A;  4KY5 A;  4A3J B;  3G7L A;  1SE4 A;  4E6I A;  5HUR A;  1K73 C;  1EQT A;  2JA8 G;  5EKK A;  2F0U A;  1ZYR C;  1IBL Q;  1XJV A;  1WYD A;  4MHE A;  1PMR A;  1B44 D;  1C0A A;  2NTT A;  1PRT C;  3NEL A;  3X3N A;  2F1M A;  1PZI D;  1VQF A;  3S14 B;  1CZG A;  1H9R A;  2Q8R E;  3M3Y H;  4DUY L;  1PRT F;  3N6R A;  2VQE Q;  2B2V A;  1PRT B;  4APV A;  4DUZ L;  2IT1 A;  2Z9H A;  3S1R H;  1JOO A;  2QKI C;  2OTJ A;  5EGT A;  4KD3 A;  4RFB A;  3BDC A;  2JA7 G;  3OIP A;  2K01 A;  4WJW A;  5CGK A;  4A3K H;  1KAA A;  4GN3 B;  5C3X A;  5I2Y A;  1VMP A;  1HFG A;  1KC8 C;  1LTL A;  5AFW A;  1UWV A;  2PZW A;  3KBG A;  2E8G A;  4GNX A;  3NHH A;  1TWH B;  1Y8N B;  3OYY A;  4HCS A;  4OIK A;  5C44 G;  3FDT A;  4BBR H;  1ENF A;  1MSG A;  1TS2 A;  1X3P A;  3A8K E;  2K5H A;  2N49 A;  3PQI A;  3A8I E;  3FKI B;  3A55 A;  1V43 A;  3PO3 H;  1EY4 A;  1NBW A;  4A3E G;  1E2Z A;  1SXT A;  4GKJ L;  1ENA A;  4IN3 A;  3SHL A;  3AFQ A;  3D6C A;  3QO2 A;  4LWC A;  3L0O A;  2HCI A;  3KJO A;  4PMW A;  4ILW A;  2VW9 A;  2F0M A;  3RZD H;  2L0C A;  2QEX A;  4JI2 Q;  2Z6K C;  1LTR D;  4JG2 A;  1TWF H;  2VQF Q;  4K0K L;  2VY3 A;  1JCK B;  5TSS A;  5GAH C;  1G6P A;  1TII D;  1G91 A;  1TWC B;  2XRS D;  4DK0 A;  1TQO A;  5ELN A;  5LMU Q;  3NXW A;  3EBE A;  2EYF A;  3CXC A;  1Y14 B;  4RKL A;  5CC4 A;  4HED A;  2UXD Q;  4H0L C;  2UUB Q;  1UUP A;  1DON A;  3CCS A;  2QDB A;  3VYR A;  3ICE A;  2EJM A;  5H1S E;  2K1B A;  2UXC Q;  5M3M H;  3GTO H;  3GTG H;  1KNA A;  3D8G A;  3BJU A;  1PH3 A;  1XNR L;  4V0B A;  2JYO A;  4LF6 L;  1IHZ A;  1BVS A;  3IFD A;  3S15 H;  4R8I A;  2ZXP A;  3H3V C;  2HD3 A;  4JK1 C;  3MEF A;  1BCP D;  5IYB G;  4MTK A;  4IUV A;  4HTH A;  3QG1 A;  1S5D D;  1VQH A;  4DK1 A;  1EEF D;  3NWS A;  1EY5 A;  1HXY D;  4P74 A;  4DV3 Q;  3PIP 3;  1R9T H;  1I4G A;  2C35 B;  2F0D A;  1SMY D;  5M5W B;  3OMC A;  1S5B D;  2CHB D;  2MNA A;  1JJG A;  2CKZ B;  3P7J A;  4WJ3 M;  1AE3 A;  2L11 A;  3T51 B;  4L5Q A;  4P73 A;  4GN4 B;  4IUR A;  5M3F H;  3WWV A;  3I8Z A;  4DU9 A;  2F4V L;  1Q8I A;  4DR6 Q;  2K14 A;  1PZJ D;  3CCQ A;  1E7Z A;  1VQK A;  1STE A;  3HKS A;  3FRP B;  1QZH A;  3Q24 A;  1MI2 A;  4GLV B;  3PF5 A;  2JA7 B;  3S24 A;  5FO9 B;  3BVG A;  4A3L H;  4CKE A;  1L2F A;  3S16 H;  1QWY A;  5M5X B;  2GA4 B;  3CRK C;  3C2P A;  4FF1 A;  2NZH A;  4RHR A;  5KYL A;  3VR2 A;  2XGT A;  1BBX C;  4PG3 A;  3L9A X;  1Q81 C;  5I6W A;  2PW5 A;  2RKS A;  1QJO A;  1I3Q B;  5M5Y B;  1N33 L;  5C44 B;  3I4M B;  4F87 A;  2NVQ B;  5ELO A;  4K8I A;  3J81 L;  3E6Z X;  1YHQ A;  1WTH A;  1QNU A;  4WJ4 A;  1ET6 A;  1HNZ Q;  3PUZ A;  3GQB A;  4A3E B;  1RF2 D;  2K05 A;  3MFG A;  2DNE A;  1PTO C;  5EBD A;  4NXN Q;  2R61 A;  1HZB A;  2F0O A;  1EYA A;  2AQ1 B;  1Y1W G;  2J7Z A;  1II3 A;  1FGB D;  3I72 A;  1GVP A;  1PTO F;  2NVT H;  2JXM B;  2R7F A;  1B3Q A;  2F0S A;  1HTL D;  2PMZ B;  3H0G G;  1PTO B;  1S5E D;  4ID6 A;  2BDN A;  4RCN A;  2ICE C;  1AP0 A;  1PDQ A;  4O42 A;  3RLF A;  5EKL A;  1DZ1 A;  4HMJ A;  3KLR A;  3I91 A;  1AE2 A;  4YWM A;  2RBM A;  4RWS C;  1UE7 A;  4GZY C;  2A68 D;  4RA8 A;  3DWP A;  1U4P A;  5FLX E;  4EGV A;  4QMG A;  2F0E A;  3AFP A;  4ODG A;  1B4O A;  4OWW B;  1QB5 D;  3ERS X;  3HOV H;  4GKJ Q;  4TRD A;  3VA7 A;  3S2D H;  3HOW G;  1VF5 C;  3PSI A;  3S1M B;  4A3G H;  1LAC A;  1SLJ A;  4RGT A;  3CHB D;  3A56 A;  4DR1 L;  2WIN B;  2BA1 A;  1DOL A;  4K0K Q;  3MAQ A;  4X3K A;  2OF1 A;  4BA1 I;  4X3U A;  1JT8 A;  2SNM A;  1XNQ L;  4N8X 1;  1VS0 A;  1EYC A;  4Q0F A;  3I4N H;  2F0F A;  1LT4 D;  4IUN A;  4CBV A;  3J80 c;  3BYT B;  1YZ6 A;  1TKW B;  5K36 H;  1SE2 A;  5I9P A;  3MXN A;  1CKO A;  4JOI A;  1M90 C;  2XRQ D;  1EWI A;  5T1I A;  3MA2 B;  3GO5 A;  3S14 H;  3KJP A;  2FJ2 A;  4BS9 A;  3Q23 A;  4DXG A;  3CF5 A;  2N3S A;  3K5L A;  3Q22 A;  1C4Q A;  3PMF A;  3W1G A;  2O4X A;  4H02 A;  2VNU D;  4LF6 Q;  4A3B H;  2QDL A;  4R4T A;  2HQE A;  1O7Z A;  5CV8 A;  4J8Q A;  4G7Z C;  5IP7 G;  4OWX B;  1CI3 M;  3ERQ A;  5C4X B;  4A75 A;  2B2V C;  1BBU A;  1A3V A;  4GLA C;  2B3G A;  4FVM A;  1O7Y A;  4QY7 A;  1JWS D;  3I2Z A;  1QVG A;  2KHS A;  2VS1 A;  3IRB A;  1EY0 A;  1NAP A;  2D9U A;  3J7Y W;  3HOY G;  5EJW A;  1Q1E A;  1Q12 A;  4IFD J;  2NZ1 D;  2GVA A;  1TWH H;  2EVB A;  2MPM A;  4LF4 Q;  4YCW A;  2B39 A;  4DNI A;  1KHI A;  2A5H A;  4N9P A;  2B63 G;  3FKI H;  4A93 G;  1K0R A;  2Y0S G;  4H44 C;  4IOC A;  2KJX A;  2SOB A;  1Z47 A;  1IBK L;  4FO2 A;  4DAV A;  4DV7 Q;  3NQI A;  2Q2T A;  3HP3 A;  4C2M B;  2GN5 A;  2E2I B;  1SRU A;  1IYV A;  3R2I A;  1PH6 A;  3CME A;  2E5L Q;  2EPB A;  2KBN A;  4LNQ A;  1Y1W B;  1K8G A;  4IUQ A;  2IW3 A;  2UUC L;  4IFD G;  4LUZ A;  4RH6 A;  3H0G B;  4QIW E;  1PFB A;  1J5E L;  2QF7 A;  2X6L A;  3NE5 B;  3RD4 A;  1FNU A;  5EBC A;  1OXT A;  3MXP A;  1TWC H;  2I5M X;  1BR9 A;  1E1T A;  3MEH A;  2VUM G;  4LFC Q;  1N33 Q;  3HOU H;  3H09 A;  1WJJ A;  4YCU A;  3W2D A;  4OIJ A;  5DAU A;  4C3I G;  1I6H B;  1ESF A;  1LUZ A;  4KHV A;  1VQP A;  1TT2 A;  1L0X B;  4G57 A;  4NXM L;  1TWG B;  1TS5 A;  5I2X A;  1VQJ A;  2KCT A;  1YHB A;  2E2D C;  4GKK L;  5FO7 B;  1MJE A;  2Z6K A;  1BNZ A;  4X6A H;  3BDO A;  2IY5 B;  3PUY A;  1CT1 D;  3VA5 A;  2WB1 G;  1CUK A;  1F9S A;  2RCF A;  5KNC A;  1UNS A;  3AQQ A;  3K58 A;  1XTD A;  4UHV A;  2XN9 C;  2P5Z X;  3FPU B;  1HZ9 A;  1HTP A;  5C4H A;  4JI3 Q;  1SJH D;  4L5S A;  1KTK A;  1BUV T;  3G71 A;  4AQY L;  1E22 A;  2R92 H;  2GVB A;  2JA8 H;  1E24 A;  1A15 A;  2FMM A;  1LAB A;  3C46 A;  1VQ7 A;  5M5W H;  2MUY A;  1SJE D;  2XVS A;  3I55 A;  5IE8 A;  4GLX A;  2DN8 A;  1NTG A;  1ZYR D;  3ZYY X;  4K5V A;  1QCB D;  2F3V A;  3OOC A;  2DUD A;  5HGQ A;  1SN8 A;  3S1Q H;  2RDF A;  5IWA Q;  1LO5 D;  1PRT D;  4DR1 Q;  4LF7 Q;  2A6E C;  2K5Q A;  2Q2I A;  2OXP A;  3CQZ B;  4C3J G;  3CPF A;  4BY7 B;  1KAW A;  4WFN 3;  3PCO B;  3PIP A;  5IYC H;  3P20 A;  2B8G A;  4KD4 A;  2RVL A;  3HFZ B;  3EVQ A;  3BVZ A;  4KJN A;  4V19 0;  4XT1 B;  2JA7 H;  1BDO A;  1SFO B;  2OEO A;  1F9Q A;  3NK9 A;  3PIO 3;  3A74 A;  5FKA C;  1IZ6 A;  1WTO A;  5C3W A;  1A63 A;  5C0X I;  5C44 H;  2NVQ H;  3UDF A;  1D2B A;  1E1O A;  4M8A A;  2UU9 L;  4A93 B;  2Y0S B;  1D5Z C;  1VQ5 A;  1I4R A;  4X65 L;  4H7B A;  4OEL B;  3J80 E;  4A3E H;  4MN3 A;  1S40 A;  3MC0 B;  5IIF A;  1YNN C;  1IL2 A;  5JJK A;  4JI1 L;  4C1N I;  4LMQ D;  1PTO H;  3GD7 A;  2YTV A;  3PO2 B;  3FPP A;  4K5W A;  1PZK D;  5KGU A;  5IGF A;  1WD0 A;  1Z6H A;  2PO4 A;  2KCC A;  5JVG 3;  4CKB A;  1S5F D;  4FXD A;  4MNO A;  4CKC A;  5C4J B;  2MFI A;  1WI5 A;  2VB3 X;  4C3I B;  4DV4 L;  5IGG A;  1IBK Q;  1JIC A;  3RN2 A;  3J81 c;  3PGZ A;  4A4I A;  1SAP A;  1AH9 A;  1GHJ A;  4XQJ A;  1YJ9 A;  1K83 H;  2KOL A;  3S1M H;  1HH2 P;  2ID0 A;  2WB1 B;  1HQM C;  2JN4 A;  2UUC Q;  2XSC A;  1RKN A;  1DGS A;  5A2Q L;  3M85 A;  2Q8I B;  1Q3L A;  2N78 A;  4K2L A;  2QW7 A;  4K6D A;  4QUF A;  1STA A;  5IYB H;  3S1N B;  1ZXT A;  1WCM G;  4DR7 Q;  1STB A;  2D62 A;  4YHH L;  1JJ2 A;  2RHS B;  3OPO A;  1DM0 B;  5FLM G;  2LY7 A;  4B3T L;  5BN4 A;  1STH A;  2L4N A;  3EJI A;  1D5M C;  3G6E A;  2VXW A;  4GKK Q;  4JPB W;  1FNV A;  2EJG C;  5IT9 L;  3LX0 A;  1B1Z A;  2ATW A;  5LHY 1;  4LFB L;  4ALP A;  2MO1 A;  3IAY A;  2HIX A;  2PZU A;  4JOI C;  3QB3 A;  5JEA J;  5BR8 Q;  4YCV A;  1HA6 A;  3PUW A;  3D0F A;  1LV9 A;  4PQX A;  3GTQ B;  1SNM A;  3NTH A;  5AJ3 L;  2PI2 E;  3QIA A;  1HRJ A;  1SE8 A;  2IX1 A;  1JOR A;  3R2T A;  1SMX A;  2ZM6 Q;  1SNP A;  1X3G A;  2J0T D;  5BN5 A;  3VR5 A;  1HR0 Q;  5ISR A;  2K32 A;  1LT6 D;  1IYJ B;  4PV1 C;  4TQU S;  1I94 L;  3TZD A;  1JOQ A;  4BA2 I;  4HR7 B;  3M4Q A;  1EIF A;  2M00 A;  1K8O A;  5JEA G;  2PI2 A;  4OO1 I;  2Q2U A;  1N8R C;  3HKZ E;  1NCV A;  3MFY A;  1PH4 A;  3KLW A;  2F0H A;  1MIU A;  1SNC A;  4HJ5 A;  3TS2 A;  3OMG A;  4OXP A;  5LMN Q;  1NNX A;  2E2I H;  2JEA I;  1GD7 A;  4DR3 L;  1HPC A;  3TME A;  4IOA A;  3M9B A;  2B2Y A;  2O2L D;  4B3R L;  1Y1W H;  4J1M A;  1D8L A;  3CCV A;  1PTO D;  1LTB D;  1EIY B;  3H0G H;  2DY7 A;  1YJW A;  1FVI A;  2Z1C A;  2WII B;  2ZTD A;  1X9N A;  2F52 A;  3IFT A;  5GQO A;  4JI4 Q;  4JYA Q;  3SE0 A;  3NEM A;  1SDF A;  1X3Q A;  3I4M G;  2EYO A;  4P72 A;  3E5S A;  2UU9 Q;  4CJ1 B;  4HSP A;  4O1N A;  5HY6 A;  4EQN A;  1TWG H;  3M4P A;  3ND9 A;  4UAI A;  4X62 L;  1FYC A;  3RNU A;  3F2U A;  2MGS A;  2AKW B;  4C3H G;  3HOZ B;  3HOW H;  1DXM A;  2H5X A;  1BOS A;  5C5M A;  2F0W A;  1YNJ C;  1STN A;  2RCN A;  3CW2 C;  5ELE A;  3VR3 A;  5IGC A;  2HQL A;  5CV7 A;  1S72 A;  5EKI A;  3TZU A;  2Z4I A;  3ULL A;  5KYI A;  3CRL C;  2C5C A;  1VQG A;  1F2Y A;  4HJA A;  5IYD G;  3NTI A;  4XYQ A;  1F77 A;  2UXB L;  3CCE A;  1I4Q A;  1B53 A;  1WCM B;  4JI8 L;  4DNT B;  4QIW B;  1O7L A;  1PYB A;  3P1H A;  4RG1 A;  1F9R A;  4DV4 Q;  3J7A V;  2QGQ A;  4HSV A;  3BVM A;  1R4P B;  2OWO A;  4DV0 L;  3GTP B;  5CBA E;  4P71 A;  1XYI A;  1H95 A;  3A54 A;  2HIV A;  4LAA A;  3I90 A;  4KKT A;  1WTR A;  1B3A A;  1A2T A;  4RGN A;  1FJG L;  3CQZ H;  4HJ8 A;  2DY8 A;  2YTX A;  3JAM E;  4NDX A;  2PCF B;  1EIH A;  1M8A A;  4JBK A;  1JJC B;  3RZO B;  5IP7 H;  2HT1 A;  1N9W A;  1X55 A;  3NBH B;  3GDE A;  3E0E A;  4B3S L;  2CW0 D;  4JBM A;  3U4V A;  1L1O A;  1K8M A;  3K59 A;  2ZTE A;  4RMF A;  4B3T Q;  1W6K A;  1JWU D;  1N36 Q;  1EWC A;  4HIO A;  3HOY H;  4FF3 A;  2WKC A;  1EFI D;  4DR5 L;  2NVX B;  2Y0S E;  1CK1 A;  3WOE A;  2I0Q A;  4KK7 A;  4AIM A;  3LGJ A;  2H4O A;  1C9O A;  5I6Y A;  2B63 H;  2E74 C;  3TRE A;  4A93 H;  4DV6 L;  3F2B A;  3DWA A;  4KMU C;  1PVO A;  1SYC A;  2F3W A;  2A1A A;  3C1E A;  1IKL A;  4JI5 Q;  1EQR A;  2D5D A;  2A6H D;  2HCC A;  3TP5 A;  1CTM A;  3PIO A;  1S4Z A;  3Q0A A;  3S17 B;  1UAP A;  4K14 A;  3GTJ H;  2KCM A;  3AYH B;  1QZG A;  3K5O A;  4PZ7 A;  5C4X G;  2EYP A;  4X64 L;  2NZO A;  2EQS A;  1X3E A;  3P75 A;  4KTA A;  3NUC A;  2F4I A;  3VR6 A;  1CHP D;  1HNW L;  4IFD H;  1MGS A;  3SK6 A;  1AW7 A;  1CSP A;  2EY2 A;  2AUK A;  4OX9 L;  4C56 C;  2WAQ G;  1I94 Q;  1PH8 A;  4FYD A;  5E4W C;  2SNS A;  4DF7 A;  4ZUJ A;  1HQR D;  2VUM H;  3J7A F;  1G29 1;  1JE4 A;  3I4L A;  4DUY Q;  1GUS A;  1STY A;  4NKL A;  3S2H B;  4C3I H;  4DGZ A;  4DUZ Q;  5JVH 3;  3GTL B;  2VB2 X;  2WB1 E;  1YNX A;  1JE5 A;  3HKZ G;  1TVX A;  1WD1 A;  3U9O A;  2F03 A;  2JA6 B;  1LTA D;  5DM6 3;  3JAM i;  1G8Z D;  4C3H B;  4IUU A;  2LKV A;  4B3M L;  2KHI A;  5CMD A;  1QVF A;  1SNO A;  4ME3 A;  4DR2 L;  2ICI A;  4ZK9 B;  2EY1 A;  3BDL A;  3K57 A;  4IJH A;  1SYF A;  5CBE E;  2WV6 D;  3LNN A;  4WOR A;  4DK3 C;  3AMU A;  1VF7 A;  2R93 B;  3S1N H;  4HCE A;  4XQQ A;  1DOK A;  4I7A A;  4ABN A;  1PA6 A;  4CDC C;  2L55 A;  1CHQ D;  3K0X A;  3OW7 A;  4A3M G;  4XTC S;  2AQ3 B;  1KNE A;  1EU3 A;  2YU9 B;  3DXJ C;  4X62 Q;  3MHB A;  2LFN A;  2KHJ A;  3CCU A;  3EQL C;  3TP7 A;  5IGB A;  2NVY B;  4BBR G;  4A3I G;  4JV5 L;  3GV3 A;  1EOV A;  4LK1 C;  5GAD C;  1Q46 A;  1EY7 A;  4C3J H;  2R6G A;  3GTQ H;  1U4R A;  2CWP A;  2LS0 1;  4UY8 C;  4BY1 G;  2VZA A;  4IJL A;  3E3X A;  1ET9 A;  4KLK A;  4JBJ A;  2EOT A;  3MZ5 A;  5C0X J;  4A3J H;  1ML0 D;  4BBS G;  3AEV A;  3OTO L;  2KA7 A;  1IBM L;  5EPK A;  3ER0 A;  4YY3 L;  5C6A A;  2KEN A;  3I73 A;  2JP1 A;  2ENB A;  3T1H L;  3GTK B;  4XIG S;  1NSN S;  4JI7 L;  1ASZ A;  5C3E B;  4NB3 A;  4JBW A;  5IT9 c;  1KIX A;  5GRO A;  1FJG Q;  1XNR Q;  2EXD A;  4JI0 L;  1H9M A;  4BY7 G;  4KI0 A;  1HUN A;  1HZC A;  2ZXR A;  1GM5 A;  5JPN C;  2LSS A;  5E4X A;  3CAM A;  3FVQ A;  1VQ8 A;  5C0X G;  1K8A C;  3R3O A;  4B9W A;  4JI6 L;  4ZYS A;  1DD2 A;  3A7L A;  1XWE A;  1L0Y B;  2M9V A;  4ZQ3 A;  1NMF A;  3K7U C;  5E7N A;  1LLR D;  4OON A;  1JC7 A;  3HOX G;  3URY A;  5FLX L;  4Y7N B;  3CMA A;  1YNN D;  2B2Y C;  4Z9C B;  1CSQ A;  4GN5 A;  2WAQ B;  5ELF A;  2FXQ A;  3NBI A; 
#chains in the Genus database with same CATH homology
 2NN6 I;  4CJ2 C;  3FEW X;  1CM9 A;  1SMY C;  2EYJ A;  3PUV A;  1RTN A;  4G4K A;  1G2S A;  1NR2 A;  3HKZ B;  5FOB B;  2F0Q A;  2I07 B;  3A7A B;  3KLS A;  4IZ8 A;  4B08 A;  1LTT D;  3IKJ A;  2FMC A;  5G3L F;  1WTX A;  4KKS A;  1IYU A;  2K7V A;  4KV6 A;  1AEX A;  3S1R B;  1AZP A;  4XYO A;  1ICW A;  1B9M A;  1GXD C;  5ELC A;  4NW2 A;  1Y8P B;  2IJ0 A;  4KN4 C;  4A3M B;  4R9W A;  2A69 C;  4CJ0 B;  1LTS D;  1XXG A;  1U4M A;  2AWN A;  4X3S A;  4L8J A;  4BBR B;  4A3I B;  5LL6 S;  1QIL A;  3EA6 A;  2FHT A;  3T13 A;  4L6T B;  3GV6 A;  4PMC A;  3ND8 A;  4BY1 B;  3WOF A;  3ITP A;  4G7O C;  3IL8 A;  1H9J A;  1CFM A;  3VR4 A;  3TP8 A;  3KK7 A;  5LL6 X;  1NR4 A;  3SK5 A;  4BBS B;  2K5W A;  2G9H D;  3NBH A;  5CV4 A;  3HRZ C;  1WTV A;  1V1O A;  5IOD A;  2RDG A;  4DA2 A;  1LT3 D;  3V05 A;  5JEA H;  2PPB C;  4TSS A;  1HCZ A;  1SND A;  1RJT A;  1BF4 A;  2EY5 A;  1FD7 D;  5IOC A;  3K7A B;  1JOK A;  1AZQ A;  4OO1 G;  1CA5 A;  3DWQ A;  1GUT A;  3GTO B;  1EY6 A;  3SR1 A;  1GHK A;  1ONL A;  3K6O A;  3HOX B;  2C9O A;  1HHV A;  1I4P A;  4M1U B;  2CQA A;  3D6W A;  2F0V A;  4G7H C;  3M4O B;  4EVO A;  5A2Q E;  2K33 A;  3D4R A;  1EZ8 A;  1B2T A;  3BZD B;  2ZT9 C;  1D6E C;  4I65 A;  2XWB B;  1KDC A;  2A73 B;  3QOJ A;  4FXK C;  1T5E A;  5J22 A;  1SYE A;  2BE5 C;  1PFM A;  2QIL A;  3X3M A;  2F0N A;  3SEB A;  2Q8T A;  2NYZ D;  2M2L A;  3CKI B;  1YNJ D;  1GUO A;  1U9R A;  2L1B A;  4IUP A;  1FR3 A;  4HMI A;  4TKO B;  1GUN A;  3WDN A;  1SEB D;  2K03 A;  4NP5 A;  1EQV A;  2F0L A;  3E0J A;  5CYU A;  3L3O C;  3I3C A;  3MTS A;  2B2W C;  1ROD A;  1B9N A;  4DXF A;  3T16 A;  1MD2 D;  2N88 A;  5D14 A;  1Q90 A;  4DN4 M;  4ZAI A;  1BQQ T;  1SBB B;  2NVT B;  2J4X A;  3R8B A;  5K5P A;  2LMC B;  1B50 A;  2KUM A;  3PV0 A;  1G6Z A;  2TSS A;  3KBX A;  1SE3 A;  1ILP A;  4KY6 A;  5NUC A;  4KKU A;  5D3I B;  1GUW A;  2TMP A;  2IPK D;  3CU7 A;  3SDZ A;  2L12 A;  4OGQ C;  2L5T A;  1JR0 D;  5T1G A;  1IW7 C;  2MHV A;  1I6V C;  4K6L A;  4ZKB B;  1ENC A;  5FK9 C;  3RMH A;  3N52 A;  4F8M A;  2XNA C;  3AU7 A;  2EE1 A;  2D2C C;  1WTW A;  2Z4H A;  3I4N B;  1VMC A;  1IL8 A;  4ZRZ A;  1A6X A;  5D65 A;  3BS1 A;  5HGT A;  3MVV A;  4ZKC B;  3KF8 A;  4RCO A;  1ILQ A;  4F7X A;  1TU2 B;  2NTS A;  4DNR B;  1VCI A;  4QUC A;  2F0J A;  3NQT A;  2X6G A;  3HGB A;  4A3B B;  3OSO A;  4KY7 A;  1DYQ A;  2EYL A;  1CA6 A;  2EZV A;  2E2H B;  4H13 C;  3MXU A;  3FMC A;  3L7Z C;  3R93 A;  2JE6 I;  1S5C D;  2F0P A;  3SXH A;  2JEB I;  3KLS X;  1BXT A;  4NMZ A;  3V96 A;  4WRD A;  2B2T A;  3M4Y A;  4DAY A;  5J39 A;  1EY9 A;  4K2K A;  1SSO A;  2V4D A;  1PYW D;  1RDP D;  1F9P A;  4RAU C;  1LTG D;  4P2C B;  1O78 A;  2E2J B;  2NWG A;  2WAC A;  4ZUI A;  2FFK B;  2KQ3 A;  2RSO A;  2BDO A;  2HUG A;  1CZW A;  2IX3 A;  1TS3 A;  1RHP A;  3HOU B;  1EZ6 A;  4A3F B;  2KEC A;  3C1F A;  1C8C A;  5C0X H;  2X69 A;  4C1N K;  3J81 E;  1JQY D;  2MP1 A;  3NTK A;  1HA5 A;  1J8I A;  2R7Z B;  2OT2 A;  1A3U A;  3TBI B;  4XXE A;  3V2T A;  3LWE A;  2AQ2 B;  2R3Z A;  4Q5V A;  1A3T A;  1GUG A;  5F2D A;  1QE6 A;  2K28 A;  2R92 B;  3O13 A;  3D3R A;  2JA8 B;  2Z8L A;  3GP7 A;  3LWU A;  1JB3 A;  2ZXO A;  2NN6 G;  1W6J A;  3HEJ A;  3DUZ A;  4ULL A;  3K5N A;  2B8F A;  4B9X A;  3S1Q B;  4U68 A;  5ELB A;  5G3L D;  3AB9 A;  2NBF A;  4IUT A;  1MBY A;  3QJY A;  3KUP A;  4A3D B;  1D1I A;  1JWM D;  4L63 B;  1CQV A;  1V1P A;  4AYB B;  3H94 A;  3NWT A;  1Y1V B;  4XDX A;  1SYD A;  4FF4 A;  3EFX D;  4J6H A;  1E0B A;  1BO0 A;  1KLG D;  1PFN A;  1QG7 A;  4PNY A;  5I4D A;  3JAM L;  2EJF C;  3PUX A;  1HFN A;  2O5I C;  1ZKO A;  2F0I A;  1WTQ A;  1D5X C;  2A69 D;  5IGE A;  1TWA B;  4XT3 B;  1EOT A;  3MWY W;  2O5J C;  4FP5 D;  1EIG A;  1H9S A;  3TSS A;  2YYZ A;  4EQO A;  2JSO A;  2JA5 B;  2EY6 A;  3VYT A;  5CV6 A;  1KDA A;  5EPJ A;  3OWF A;  2KEE A;  4QB4 A;  5COY A;  5COR A;  5FO8 B;  1TS4 A;  1A2U A;  2B2W A;  5EPL A;  2AWO A;  3TP6 A;  2PQE A;  3K5M A;  1X32 A;  1I4X A;  3SK8 A;  3NSW A;  3T53 B;  3DEO A;  5JPM C;  1TY0 A;  1TR5 A;  1HUM A;  5BN3 A;  1KAB A;  2MJ8 A;  1SYB A;  2A6E D;  4OO1 H;  2N55 A;  3BG3 A;  2RA4 A;  5DNF A;  4KN7 C;  1K83 B;  1I50 B;  4F88 A;  4DAP A;  4QF4 A;  5JJZ A;  4LJZ C;  4IAL A;  1LTI D;  5I9O A;  1DJR D;  4HAE A;  1E2V A;  3G6J B;  1PLF A;  2B2U A;  1OO9 B;  3DEP A;  3SK4 A;  1XTC D;  4K8J A;  5E1F A;  3RUZ A;  2BA0 A;  3M7N A;  4R8N A;  1RD9 D;  1BCP C;  1SNQ A;  4RGM A;  4RGO S;  3GTM B;  2CW0 C;  2BE5 D;  1EWH A;  2NB0 A;  3D31 A;  5KNB A;  1BCP F;  1RTO A;  2KVM A;  4YIJ A;  5A35 A;  1BCP B;  4ME5 A;  3OIQ A;  3A8J E;  5EQ0 A;  3S9W A;  3T4A C;  2PW7 A;  2IL8 A;  2WKD A;  3U9S A;  1ESR A;  2E75 C;  2A6H C;  3M3Y B;  2FIN B;  2A74 C;  3W3A A;  3DHQ A;  2EDG A;  1DCZ A;  1Y8O B;  2B2T C;  1CQF A;  1FNW A;  3OHX C;  5J1Z A;  2I46 A;  1OXU A;  1C48 A;  2HDM A;  2KED A;  4BWG B;  4A3K B;  1EEI D;  2QEJ C;  4UDU C;  1G2T A;  4CGY B;  1AFP A;  2RQX A;  2RSN A;  1OXS C;  4RHS A;  2K04 A;  3D4D A;  1WVL A;  1QNK A;  4KHZ A;  5JOB A;  5D3D A;  1AN8 A;  3PO3 B;  1T5X D;  4N9T A;  2WP8 J;  5JAV A;  3HOW B;  3HG9 A;  3HS0 C;  1EU4 A;  3RZD B;  1PXU A;  2A68 C;  4MIU A;  1IW7 D;  3QWN A;  1TWF B;  5DEH A;  1QOH A;  4FXG C;  5ELD A;  3NPP A;  3ONA B;  3TN2 A;  2G9D A;  3ERO A;  1XX8 A;  3H91 A;  2CVR A;  2IX0 A;  1STG A;  4X3T A;  2H1E A;  3NP8 A;  1TY2 A;  4ZLT F;  1UEA B;  1RCV D;  5M3M B;  1KDB A;  3GTG B;  1DOM A;  5KIX A;  2QCP X;  3M7G A;  3BYY B;  1H9K A;  3S15 B;  2F0K A;  4HN7 A;  4OL7 A;  5IGD A;  2BCO A;  4QCL A;  4KJO A;  2SEB D;  2BOS A;  2F0G A;  4FF2 A;  1OXV A;  5K36 G;  1O80 A;  3HZX A;  2EYH A;  3SVM A;  4DFA A;  4U67 3;  1E2W A;  1M4V A;  1Q1B A;  3TDQ A;  5CV5 A;  1R9T B;  1V8Q A;  3HOY B;  2F0T A;  2PNR C;  1I4H A;  1MSH A;  1WTP A;  3DM1 A;  4OHJ A;  3VYU A;  1V1P B;  5DM7 3;  5KEE A;  4CHT B;  2B63 B;  3T56 B;  1F2M A;  1ZEQ X;  5C4Z A;  4I7Z C;  5M3F B;  3K0Y A;  5IT9 E;  1NUC A;  3I70 A;  2HDL A;  3GTJ B;  3D4W A;  2EYM A;  3QOL A;  3H6M A;  3S16 B;  5M9O A;  1KLU D;  1U4L A;  1VDZ A;  2RDH A;  1EL0 A;  2DNC A;  2EXZ A;  1IKM A;  1H9S B;  1D1K A;  3UI2 A;  2VUM B;  4PMB A;  3DMU A;  5C5L A;  2XWJ B;  4RKB A;  2NUC A;  1EYD A;  4EQP A;  4IFD I;  1Y69 U;  4IQZ A;  2K6A A;  5KRU A;  1J9O A;  1GOZ A;  2L9H A;  3C3L A;  5KND A;  3MXG A;  5CV9 A;  5CR3 A;  3Q6S A;  2AUJ D;  3J80 L;  1F2Z A;  1R4Q B;  1OXX K;  1F2L A;  2PZT A;  3HOV B;  2NN6 H;  2IWH A;  4XQN A;  2KCN A;  3S2D B;  3OWE B;  1LT5 D;  2PYK A;  2B2U C;  4A3G B;  4K5X A;  5E3F A;  1EY8 A;  3VYS A;  4C3J B;  2K5D A;  1SYG A;  1Z7T A;  2XIW A;  4FNF A;  1GJX A;  2E76 C;  4S3S A;  2SDF A;  4KY5 A;  4A3J B;  3G7L A;  1SE4 A;  4E6I A;  5HUR A;  1EQT A;  5EKK A;  2F0U A;  1ZYR C;  4MHE A;  1PMR A;  1B44 D;  2NTT A;  1PRT C;  3X3N A;  2F1M A;  1PZI D;  3S14 B;  1CZG A;  1H9R A;  2Q8R E;  1PRT F;  3N6R A;  2B2V A;  1PRT B;  2IT1 A;  1JOO A;  2QKI C;  5EGT A;  4KD3 A;  4RFB A;  3BDC A;  3OIP A;  2K01 A;  4WJW A;  5CGK A;  1KAA A;  5C3X A;  5I2Y A;  1VMP A;  1HFG A;  5AFW A;  2PZW A;  3KBG A;  3NHH A;  1TWH B;  1Y8N B;  4HCS A;  4OIK A;  3FDT A;  1ENF A;  1MSG A;  1TS2 A;  1X3P A;  3A8K E;  3A8I E;  3FKI B;  3A55 A;  1V43 A;  1EY4 A;  1E2Z A;  1SXT A;  1ENA A;  4IN3 A;  3SHL A;  3D6C A;  3QO2 A;  2HCI A;  4PMW A;  4ILW A;  2F0M A;  2L0C A;  1LTR D;  1JCK B;  5TSS A;  1TII D;  1G91 A;  1TWC B;  2XRS D;  4DK0 A;  1TQO A;  3NXW A;  2EYF A;  4RKL A;  5CC4 A;  4HED A;  4H0L C;  1UUP A;  1DON A;  2QDB A;  3VYR A;  2EJM A;  2K1B A;  1KNA A;  3D8G A;  4V0B A;  2JYO A;  1IHZ A;  3IFD A;  4R8I A;  2ZXP A;  3H3V C;  4JK1 C;  1BCP D;  4IUV A;  4HTH A;  3QG1 A;  1S5D D;  4DK1 A;  1EEF D;  3NWS A;  1EY5 A;  1HXY D;  3PIP 3;  1I4G A;  2F0D A;  1SMY D;  5M5W B;  3OMC A;  1S5B D;  2CHB D;  3P7J A;  2L11 A;  3T51 B;  4IUR A;  3I8Z A;  4DU9 A;  1Q8I A;  1PZJ D;  1STE A;  3FRP B;  3Q24 A;  1MI2 A;  2JA7 B;  5FO9 B;  3BVG A;  4CKE A;  1QWY A;  5M5X B;  2GA4 B;  3CRK C;  3C2P A;  4FF1 A;  4RHR A;  5KYL A;  3VR2 A;  1BBX C;  3L9A X;  5I6W A;  2PW5 A;  2RKS A;  1QJO A;  1I3Q B;  5M5Y B;  3I4M B;  5C44 B;  4F87 A;  2NVQ B;  4K8I A;  3J81 L;  3E6Z X;  1QNU A;  1ET6 A;  3PUZ A;  3GQB A;  4A3E B;  1RF2 D;  2K05 A;  3MFG A;  2DNE A;  1PTO C;  5EBD A;  2R61 A;  2F0O A;  1EYA A;  2AQ1 B;  2J7Z A;  1II3 A;  1FGB D;  3I72 A;  1PTO F;  2JXM B;  2F0S A;  1HTL D;  2PMZ B;  1PTO B;  1S5E D;  4ID6 A;  2BDN A;  4RCN A;  2ICE C;  1AP0 A;  1PDQ A;  4O42 A;  3RLF A;  5EKL A;  1DZ1 A;  4HMJ A;  3KLR A;  3I91 A;  2RBM A;  4RWS C;  4GZY C;  2A68 D;  4RA8 A;  3DWP A;  1U4P A;  5FLX E;  4EGV A;  4QMG A;  2F0E A;  4ODG A;  1B4O A;  1QB5 D;  4TRD A;  3VA7 A;  1VF5 C;  3S1M B;  1LAC A;  4RGT A;  3CHB D;  3A56 A;  2WIN B;  2BA1 A;  1DOL A;  3MAQ A;  4X3K A;  2OF1 A;  4BA1 I;  4X3U A;  2SNM A;  1EYC A;  4Q0F A;  2F0F A;  1LT4 D;  4IUN A;  4CBV A;  3BYT B;  1TKW B;  5K36 H;  1SE2 A;  5I9P A;  3MXN A;  2XRQ D;  5T1I A;  3MA2 B;  3GO5 A;  2FJ2 A;  4BS9 A;  3Q23 A;  4DXG A;  3K5L A;  3Q22 A;  1C4Q A;  3PMF A;  2O4X A;  2VNU D;  2HQE A;  1O7Z A;  5CV8 A;  4J8Q A;  4G7Z C;  1CI3 M;  3ERQ A;  5C4X B;  2B2V C;  1A3V A;  1O7Y A;  4FVM A;  1JWS D;  2KHS A;  1EY0 A;  1NAP A;  2D9U A;  3J7Y W;  5EJW A;  1Q1E A;  1Q12 A;  4IFD J;  2NZ1 D;  2EVB A;  2MPM A;  2B39 A;  4N9P A;  2A5H A;  4H44 C;  2KJX A;  2SOB A;  1Z47 A;  4FO2 A;  4DAV A;  3NQI A;  3HP3 A;  4C2M B;  2E2I B;  1IYV A;  3R2I A;  2EPB A;  1Y1W B;  4IUQ A;  2IW3 A;  4IFD G;  4RH6 A;  3H0G B;  1PFB A;  2QF7 A;  2X6L A;  3NE5 B;  3RD4 A;  1FNU A;  5EBC A;  1OXT A;  3MXP A;  1BR9 A;  3MEH A;  3H09 A;  3W2D A;  4OIJ A;  5DAU A;  4C3I G;  1I6H B;  1ESF A;  4KHV A;  1TT2 A;  1L0X B;  4G57 A;  1TWG B;  1TS5 A;  5I2X A;  2E2D C;  5FO7 B;  1BNZ A;  3BDO A;  3PUY A;  1CT1 D;  3VA5 A;  1F9S A;  5KNC A;  1UNS A;  3K58 A;  2XN9 C;  3FPU B;  1HTP A;  5C4H A;  1SJH D;  1KTK A;  1BUV T;  1A15 A;  2FMM A;  1LAB A;  3C46 A;  2MUY A;  1SJE D;  2XVS A;  2DN8 A;  1ZYR D;  3ZYY X;  4K5V A;  1QCB D;  2F3V A;  3OOC A;  2RDF A;  1LO5 D;  1PRT D;  2A6E C;  2K5Q A;  2OXP A;  3CQZ B;  4C3J G;  4BY7 B;  4WFN 3;  2B8G A;  3P20 A;  4KD4 A;  2RVL A;  3EVQ A;  3BVZ A;  4KJN A;  4V19 0;  4XT1 B;  1BDO A;  1SFO B;  2OEO A;  1F9Q A;  3NK9 A;  3PIO 3;  5FKA C;  1WTO A;  5C3W A;  5C0X I;  1D2B A;  4M8A A;  4A93 B;  2Y0S B;  1D5Z C;  1I4R A;  4H7B A;  3J80 E;  4MN3 A;  3MC0 B;  5IIF A;  1YNN C;  4C1N I;  4LMQ D;  1PTO H;  3GD7 A;  3PO2 B;  3FPP A;  4K5W A;  1PZK D;  5KGU A;  5IGF A;  1WD0 A;  1Z6H A;  2PO4 A;  2KCC A;  5JVG 3;  4CKB A;  1S5F D;  4FXD A;  4CKC A;  5C4J B;  2VB3 X;  4C3I B;  5IGG A;  1JIC A;  1SAP A;  1GHJ A;  4XQJ A;  2KOL A;  2ID0 A;  2WB1 B;  1HQM C;  2XSC A;  1RKN A;  5A2Q L;  3M85 A;  2Q8I B;  1Q3L A;  4K2L A;  4K6D A;  4QUF A;  1STA A;  3S1N B;  1ZXT A;  1STB A;  2D62 A;  3OPO A;  1DM0 B;  2LY7 A;  5BN4 A;  1STH A;  2L4N A;  3EJI A;  1D5M C;  2VXW A;  1FNV A;  2EJG C;  5IT9 L;  3LX0 A;  1B1Z A;  5LHY 1;  3IAY A;  2PZU A;  3QB3 A;  5JEA J;  1HA6 A;  3PUW A;  1LV9 A;  4PQX A;  3GTQ B;  1SNM A;  3NTH A;  1HRJ A;  3QIA A;  2IX1 A;  1JOR A;  3R2T A;  1SNP A;  2J0T D;  5BN5 A;  3VR5 A;  5ISR A;  2K32 A;  1LT6 D;  4PV1 C;  4TQU S;  3TZD A;  1JOQ A;  4BA2 I;  4HR7 B;  2M00 A;  1K8O A;  5JEA G;  4OO1 I;  1NCV A;  3MFY A;  2F0H A;  1SNC A;  3OMG A;  2JEA I;  1HPC A;  3TME A;  2B2Y A;  2O2L D;  4J1M A;  1PTO D;  1LTB D;  2DY7 A;  2Z1C A;  2WII B;  3IFT A;  3SE0 A;  1SDF A;  1X3Q A;  2EYO A;  3E5S A;  4CJ1 B;  4HSP A;  4O1N A;  4EQN A;  3ND9 A;  4UAI A;  1FYC A;  3F2U A;  2MGS A;  4C3H G;  3HOZ B;  1DXM A;  1BOS A;  5C5M A;  2F0W A;  1YNJ C;  1STN A;  5ELE A;  3VR3 A;  5IGC A;  5CV7 A;  5EKI A;  3TZU A;  2Z4I A;  5KYI A;  3CRL C;  2C5C A;  1F2Y A;  3NTI A;  4XYQ A;  1F77 A;  1I4Q A;  1B53 A;  1WCM B;  4DNT B;  4QIW B;  1O7L A;  3P1H A;  1F9R A;  3J7A V;  4HSV A;  3BVM A;  1R4P B;  3GTP B;  5CBA E;  1XYI A;  3A54 A;  4LAA A;  3I90 A;  4KKT A;  1WTR A;  1B3A A;  1A2T A;  4RGN A;  2DY8 A;  3JAM E;  4NDX A;  2PCF B;  1EIH A;  1M8A A;  3RZO B;  2CW0 D;  1K8M A;  3K59 A;  1W6K A;  1JWU D;  1EWC A;  4FF3 A;  2WKC A;  1EFI D;  2NVX B;  1CK1 A;  3WOE A;  4KK7 A;  2H4O A;  5I6Y A;  2E74 C;  3DWA A;  4KMU C;  1SYC A;  2F3W A;  3C1E A;  1IKL A;  2D5D A;  2A6H D;  2HCC A;  3TP5 A;  1CTM A;  1S4Z A;  3Q0A A;  3S17 B;  1UAP A;  4K14 A;  3K5O A;  2EYP A;  3P75 A;  4KTA A;  3NUC A;  2F4I A;  3VR6 A;  1CHP D;  4IFD H;  1MGS A;  3SK6 A;  1AW7 A;  2EY2 A;  2AUK A;  4C56 C;  4FYD A;  5E4W C;  2SNS A;  4DF7 A;  4ZUJ A;  1HQR D;  3J7A F;  1G29 1;  1JE4 A;  3I4L A;  1GUS A;  1STY A;  4NKL A;  3S2H B;  4DGZ A;  5JVH 3;  3GTL B;  2VB2 X;  1TVX A;  1WD1 A;  3U9O A;  2F03 A;  2JA6 B;  1LTA D;  5DM6 3;  1G8Z D;  4C3H B;  4IUU A;  2LKV A;  5CMD A;  1SNO A;  2ICI A;  4ZK9 B;  2EY1 A;  3BDL A;  3K57 A;  1SYF A;  5CBE E;  2WV6 D;  3LNN A;  4WOR A;  3AMU A;  1VF7 A;  2R93 B;  4HCE A;  4XQQ A;  1DOK A;  4ABN A;  2L55 A;  1CHQ D;  3OW7 A;  4XTC S;  2AQ3 B;  1KNE A;  1EU3 A;  2YU9 B;  3DXJ C;  3MHB A;  2LFN A;  3EQL C;  3TP7 A;  5IGB A;  2NVY B;  3GV3 A;  4LK1 C;  1EY7 A;  2R6G A;  1U4R A;  2LS0 1;  1ET9 A;  2EOT A;  3MZ5 A;  5C0X J;  1ML0 D;  2KA7 A;  5EPK A;  5C6A A;  3I73 A;  2JP1 A;  2ENB A;  3GTK B;  4XIG S;  1NSN S;  5C3E B;  4JBW A;  1H9M A;  4KI0 A;  1HUN A;  2ZXR A;  5JPN C;  5E4X A;  3FVQ A;  5C0X G;  3R3O A;  4B9W A;  4ZYS A;  1DD2 A;  4ZQ3 A;  3A7L A;  1XWE A;  1L0Y B;  2M9V A;  1LLR D;  1JC7 A;  3URY A;  5FLX L;  4Y7N B;  1YNN D;  2B2Y C;  4Z9C B;  2WAQ B;  5ELF A;  3NBI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...