1I94L

Crystal structures of the small ribosomal subunit with tetracycline, edeine and if3
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
131
structure length
131
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEAAKTAAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 6
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2001-03-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1i94L00
1EUJA 2XGTA 3T1YQ 4C3IH 2RCNA 4DV7L 4P72A 4OO1G 1HZ9A 2D62A 1EQQA 1CKOA 3BU2A 4NB3A 4NXNL 5GAGC 4DR3L 2JA6G 1JJCB 4R4QA 2VQEQ 3PO2G 4LFAL 4BA1I 1JJGA 3J81c 3W1GA 3K81C 2V1CC 1XNRQ 1IBLL 2ZTDA 4YWLA 1WOCA 1G51A 2R7ZG 4A76A 1SRUA 3HFZB 1X55A 3CCJA 5M3MG 2QA4A 4GNXC 4P71A 1KC8C 4GS3A 1HZAA 5H1SE 3H15A 4NXMQ 4DUZL 4YY3L 3BZCA 3KF6B 1N33L 3NENA 4A3EH 3PV0A 4MTNA 4A3IG 4B3TL 4POGA 1PH7A 2WP8J 2B3GA 4LFCQ 1VQ6A 3CW2C 1NMFA 3OTOQ 4LFBL 3KJOA 1N34L 1CSQA 2Q2TA 2EQSA 2L15A 4LWCA 3ULJA 1KRTA 2RHSB 3I56A 1JB7A 1TWAH 3H0GG 4TQUS 3F2BA 4GLVB 1AE2A 1GKHA 5IYCH 4LF5L 4GLXA 1SLJA 1QUQA 3U58A 4UP9A 4HJAA 2NZOA 1B8AA 5J3BA 1C9OA 2K14A 4B3ML 4A3IH 1M1KC 5GQOA 3M4OH 3TS2A 2QEXA 1UE6A 2JA6H 3PO2H 2UXBL 1Q86C 1Q1BA 3TQYA 1VQ7A 2ATWA 5M5XH 3WWVA 5IP7H 2AKWB 1TWGH 4LNQA 3HOWG 2NVTH 2ASBA 2JK8A 1MJEA 4DR6Q 1EOVA 4QGUA 1FL0A 3CPWA 4GN4B 1E1TA 5FLMG 1JE5A 1WJJA 3AFQA 4OONA 4QIWE 3SGIA 3ICEA 1PH8A 4DR5L 4A93H 5C44G 2E2HH 4BXXG 1N32L 1EYGA 3GTQH 3CC7A 1HR0Q 2CQOA 3S2DH 4HIMA 4IPCA 3JAMc 2UUBQ 3NEMA 3RN5A 1W2BA 4JBJA 1BBWA 1CSPA 4YWKA 1EFWA 4BY1G 1VQNA 2WAQG 4LW1A 2OCEA 2BH2A 4LF9L 5JEAJ 1NBWA 2YTYA 3DM3A 5FLMH 2OQKA 3HOZH 3TRZA 1XPOA 3HKZE 3AEVA 2UU9L 4X65Q 2VL6A 4IFDJ 4DV5L 4DV2L 2UXCQ 1L1OA 1KD1C 3STBC 1N36Q 1PV4A 3J81j 3L2PA 3CCSA 1HNZQ 4IPHA 4HIDA 3UE1A 1SN8A 4PG3A 4BBRG 3UDGA 5C0XI 4UP7A 2Z6KC 3T1HQ 4BY7H 2N3SA 1HNXL 5IWAQ 4BY1H 1E22A 4DR1L 1VQJA 4PZ7A 2B29A 1I94Q 4L5SA 1TXYA 4DR7Q 2UXDL 3ZJYC 2ZM6Q 1XMQQ 5C44H 1P16A 2BH8A 4BXXH 4JG2A 3G71A 4X64L 4KHPL 4IFDG 3K7AH 3E0EA 4X62L 3H0GH 3UE0A 5M3FH 4GOPA 4BY7G 5C4JH 1IBML 1E24A 1QVFA 3B6YA 1RIPA 4QQBX 2K75A 4WJ4A 4DV3Q 4J15A 1XMOQ 2R93G 2N49A 4YWMA 5C0XG 2ZTEA 3KOJA 1LYLA 2VY3A 1PFSA 3M9BA 3F2DA 3J7ZC 1WCMH 5FJ8H 2YU9H 2EIFA 3CXCA 5AJ3Q 1OXUA 4P73A 1QZHA 4LF6Q 4IJLA 4YHHQ 3G48A 1YVCA 1L1OC 3PUVA 1Y1VG 2ALYB 4JI6L 2E2IH 1XNQL 4UP8A 3KDFB 4IOAA 3EBEA 3LGJA 5ELNA 4JI5L 3J81i 1WI5A 2I5HA 4OX9Q 1YI2A 5IYDG 2UUCQ 4DR4L 5IP7G 1NTGA 2PMZE 3KJPA 1Q82C 4JI0Q 4B3SQ 3HOYG 4NPSA 1YHBA 4ME3A 3CP0A 1S72A 3K80C 1D8LA 1UE7A 1VQMA 1YEZA 1Y1WG 5LMNW 2UUAQ 3PIOA 3HOUH 1G6PA 4LF8Q 2WFWA 2GVAA 5BR8Q 1I6HH 3E9HA 1X54A 3MEFA 1YHAA 1A63A 1I5FA 3L7ZC 1TWCH 1Z9FA 2R7DA 3A0JA 2YTXA 3BZKA 4IPDA 4A75A 3K8AA 1YJWA 1TWFH 2HHHL 1IZ6A 2VS1A 4A3MG 1LM0A 3CMEA 1N8RC 3PUXA 5JJLA 4DV6Q 1MJCA 2E5LQ 1MKHA 1UE5A 2NZHA 1VQAA 2GN5A 5GAHC 4IPGA 4DR2L 1Q7YC 1FJGQ 3CQZH 3S14H 4A3BG 4DUYQ 1SFOH 5M5WH 4EX5A 2VNUD 1PH9A 2VQFQ 3RN2A 2R92G 4H02A 2N8NA 5C3EG 2Y0SE 1WYDA 5JEAG 4JYAL 1DGSA 5M3MH 2NN6G 4IO9A 3K7UC 1GD7A 1NMGA 3M4QA 1IBKL 4GKJL 3HOUG 5IY0A 4JI4Q 1J5EL 1LTLA 3F1ZA 1VQPA 4BBSG 3UDXA 3T1YL 1VQCA 4GOPC 4A3EG 5IT9c 1OXVA 4DV7Q 1EIFA 1KL9A 2PQAA 2HQLA 2IX0A 4NXNQ 1U0LA 3JAMi 2I0QA 2VQEL 1OTCA 4GKKQ 2VZAA 2KCMA 4LFAQ 2MFIA 3TREA 3HOXH 4DK3C 4A3FG 1Z47A 1ASYA 4KI0A 4YCWA 5GADC 4A3KH 1XNRL 4GN5A 3KFUA 4GNXB 1VQIA 2K50A 1S40A 2Z6KA 2A19A 3RNUA 1VS0A 4A3FH 1SROA 2GVBA 1TWHH 3PSIA 1YITA 1PA6A 5M5YH 1C0AA 3J7A5 4DUZQ 1MIUA 4YY3Q 4LUOA 4A3CH 4B3RL 1XPRA 3PO3H 4AQYL 1OXSC 1PHJA 4JI8L 2ES2A 2IHFA 2KHJA 4LFBQ 4HIOA 1KIXA 4JV5L 4A3JG 1HJPA 1PH2A 1VQGA 1N34Q 2PQAB 3Q8DA 1X3FA 4OXPA 1VCIA 4A3GG 3I4OA 1YIJA 3TEHB 2VUMH 2ZJPA 1HNWQ 2NVYH 1G291 3KF8B 1VQ5A 3GDEA 1YZ6A 1L1OB 1YJNA 1XPUA 4IFDI 2NN6I 4APVA 5IP9H 1EQRA 2H5XA 3CMAA 2JA5H 4QY7A 1S3OA 3I55A 2B63H 3D0FA 1X56A 2DUDA 5IYBG 4A3DG 2OQ0A 2LXJA 3F8TA 4DV0L 4DK6C 3GTOH 2MO0A 3M4PA 1K9MC 3I2ZA 2LSSA 2RHQB 4JI3L 4JI7L 2DGYA 2R7FA 5DLQE 2JA7G 4X66Q 3S15H 4JCVE 4A3BH 1V1QA 2F4VQ 4DV4L 3CCUA 3G6EA 2HIVA 2CCZA 4JI2L 1IL2A 4K0KL 1NY4A 1K8AC 1K83H 1Q12A 4A3JH 1PH5A 4LF7L 4LF4Q 2IY5B 4DV1Q 1EIYB 2PI2E 1Q8KA 2A1AA 1VQ8A 1KHIA 5E7NA 4JI1L 1CKMA 1YBYA 1L0WA 3HOVG 1C7YA 1VQ4A 5LMUL 2ZTCA 4KLKA 5C4XH 1V9PA 3NBHB 5LMNL 4X6AH 3UDFA 2ZJRA 1E7ZA 2UU9Q 2CWPA 4DV2Q 1D7QA 4OO1I 1QUQB 2OTLA 3FKIH 1T9HA 4A3LG 3AQQA 3E9IA 1IXRA 1Q1EA 3KF6A 2QGQA 3FHWA 1L2FA 1A8VA 2F52A 4MZ9A 1BVSA 4OWTB 4L5QA 4DR3Q 3ULPA 4PZ6A 1HNXQ 4HJ8A 2ID0A 4PMWA 3HOVH 3S16H 3A74A 3RZDH 4DR7L 2MO1A 3RLOA 2ZM6L 1CKNB 3FKIG 1IBLQ 2IHEA 3PGZA 4R1JA 3I4NH 1SE8A 4QJFA 2R6GA 5IE8A 2HIXA 2JJQA 4IOCA 4KHPQ 4AYBE 4X62Q 1GM5A 1X3GA 2IX1A 4NXML 2E8GA 3ULLA 2JE6I 3NELA 1CUKA 3GO5A 5C3EH 1IBMQ 2XTIA 5IYBH 4A3DH 1Y14B 4DV3L 1N33Q 4B3TQ 3J80i 4P74A 1W3SA 2RF4A 1QVGA 1UEBA 3OYYA 2VW9A 4LFCL 1VQLA 1I50H 4C2MH 1I3QH 3OTOL 1X9NA 2I5LX 4GN3B 3CAMA 3GD7A 5HY6A 3I7FA 4AH6A 1E1OA 2N78A 3JC66 5GAEC 3PO3G 1KAWA 4LUVA 4JBWA 1NJIC 1X65A 2HT1A 4A4IA 3FP9A 2OWOA 5M3FG 3CCVA 1VQ9A 1FGUA 1UE1A 2KCTA 1QVCA 4GNXA 3CC4A 4LF5Q 3STBD 3PF4A 1YHQA 3I4NG 1A62A 1XNQQ 2K52A 1AH9A 4JC0A 3F2CA 4B3MQ 4DPGA 2BA0A 2C35B 3OW2A 4JI5Q 4JBKA 3H3VI 1VQBA 4LUZA 2JA5G 2UXBQ 2UUCL 2KBNA 2ZJQA 3CCQA 3CC2A 3GTPH 4A3MH 3PIPA 3AFPA 1A0IA 1SR3A 2FXQA 1VQDA 4DNIA 1PYSB 4FDBA 1JT8A 4A3KG 5IYDH 4DR6L 2OTJA 3ER0A 2WB1G 2F3IA 4YCVA 5BR8L 4EQ5A 3PF5A 1KQSA 3KYHC 4PZ8A 3PUZA 3S1NH 1YNXA 3RLNA 5K36G 4DR5Q 2CKZB 1Y1WH 3S2HH 3GTKH 3A5ZB 4Y52H 3M7NA 1N32Q 2PNHA 1HR0L 1PVOA 4UY8C 1FVIA 1K73C 3RZOH 2UUBL 2E5LL 2JEAI 4RG1A 3GTGH 3H3VH 1EWIA 3S1MH 3HKZG 4WJ3M 3BJUA 4TVAB 1B7YB 4LF9Q 4L5TA 3S24A 2I5MX 4QL5A 2MNAA 2B63G 1OXXK 3GTJH 1N9WA 4DR2Q 1XTDA 4MNOA 4A3LH 1UWVA 4X65L 4DV5Q 3U4VA 2UXCL 1HH2P 4DUYL 1N36L 5C0XJ 3I4MG 2KENA 2R93H 1PH1A 1HNZL 1VQFA 5GROA 1JJ2A 1KXLA 4IJHA 5C4XG 4A3GH 2K5NA 4R4IA 3T1HL 3PUWA 2E2JH 5ELOA 5IWAL 4JBMA 4DR1Q 1WCMG 3CCMA 4GKJQ 3EIVA 1RL2A 1I94L 2UXDQ 2BA1A 3G4SA 1PH4A 1J5EQ 2A8VA 1XMQL 3W1BA 1O7IA 4O0AA 3KLWA 4X64Q 4JOIC 2VUMG 3CD6A 1CKNA 2WB1E 4GLAC 2NVQH 3AYHB 3U4ZA 4A3CG 4AIMA 2AWNA 4Y7NH 1NE3A 4DKAC 1PYBA 1WFQA 4GKKL 2PI2A 2R92H 2EXDA 1XMOL 1R9TH 3M3YH 1K0RA 2KHIA 3CCRA 2R7ZH 4L5RC 1IYJB 1HZBA 1B70B 1JMCA 3HOXG 2CWAA 2Q2HA 3W5OA 3HOZG 1H95A 3CF5A 4KHZA 4ALPA 3VDYA 2Q2IA 2YTVA 4RMFA 3ERSX 3D31A 1VQKA 4B3RQ 3UDIA 1J6QA 1SMXA 5AJ3L 3DLLA 1Q81C 1BBUA 4AQYQ 4LF6L 1Y1VH 4YHHL 4JI8Q 3HOYH 1P8LA 3TS0A 1E3PA 4DAYB 5HGQA 1OXTA 1LUZA 1KRSA 3S17H 4JV5Q 5IYCG 4P75A 4JI6Q 3RLFA 2NVXH 2K4KA 4XTCS 1X6OA 4DAMA 4OX9L 4HJ5A 2JEBI 2K5VA 4DR4Q 4HJ9A 4JI0L 4B3SL 2D0PA 3KDFA 1VQOA 1HNWL 4JOIA 3IRBA 3GTMH 1X3EA 3GTLH 1M90C 1V43A 1K3RA 2UUAL 4GOPB 2YYZA 1Q46A 1HZCA 4C3HH 4LF8L 2AWOA 3M85A 4HIKA 5EAYA 4AYBG 5FLXc 4DV0Q 4YCUA 3CCLA 4C3JH 1YJ9A 2JA8H 5IP9G 2YV5A 3K0XA 4XIGS 1XJVA 4BA2I 4O2DA 2Z0SA 4JI3Q 3J80c 4JI7Q 3U50C 3S1RH 2JA7H 3HOWH 2D0OA 2HHHQ 4X66L 1QZGA 5JJKA 2Y0SG 2MQHA 1HR0W 3CPFA 4HJ7A 3EN2A 3I4MH 4DV6L 2F4VL 4JI2Q 3RR5A 4DV4Q 1PH3A 4K0KQ 2K5HA 4OWWB 4R4TA 4OWXB 2JA8G 5FJ8G 4R4CA 1VQHA 1PH6A 4BBSH 4LF7Q 2JQOA 4LF4L 1FJGL 4DV1L 2Q2UA 2JA9A 4JI1Q 3L0OA 3S1QH 2CFMA 4A93G 2VQFL 4POFA 4UPAA 3PUYA 1K8GA 2AHOB 1U5KA 1VQEA 2LXKA 3CCEA 1BKBA 1GO3E 4R4OA 4BBRH 5LMUQ 2AMCB 3MXNB 3HKSA 1IBKQ 4JYAQ 5JJIA 5LMNQ 1ASZA 1AE3A 4JI4L 3PCOB 1GVPA 3A5UA 2IT1A 2WAQE
chains in the Genus database with same CATH superfamily
1TWCB 1R9TB 4M8AA 2KHSA 4HMIA 1CKOA 3BU2A 4NB3A 2IX3A 2PZWA 3J81c 4K5WA 3K81C 1B3AA 1XNRQ 3J7AV 1SNOA 2R7ZG 2BE5D 2QA4A 1A3TA 4NXMQ 4N9TA 4YY3L 1WTQA 3S1MB 5CV7A 4MIUA 1N33L 3HEJA 4B3TL 3PV0A 4MTNA 2XVSA 3N6RA 1PTOC 4LFCQ 2X69A 4HR7B 4KY6A 1HPCA 3OWFA 2Q2TA 4CKCA 3EQLC 1TWAH 2VXWA 1A3UA 4TQUS 3J7YW 5IYCH 3H3VC 2QILA 3P1HA 2NZOA 5J3BA 4MTKA 1PLFA 4A3IH 5GQOA 3TS2A 2PW5A 2I07B 3VYTA 1UE6A 3D6WA 1S4ZA 4FF1A 3TQYA 2M2LA 1HFGA 4CDFC 2NVTH 2ICIA 1WTXA 2EYHA 2K1BA 4QGUA 4WFN3 1PDQA 2EJFC 4OONA 1TKWB 3SGIA 4RKBA 4K6DA 1PH8A 4FXGC 1J9OA 5C44G 1N32L 1EYGA 1JORA 4CGYB 1E2ZA 4HIMA 3HOUB 4IPCA 5T1IA 3NEMA 3RN5A 1EFWA 3HOYB 5COYA 4LF9L 5JEAJ 2YTYA 1LLRD 2JA5B 3HOZH 1VF5C 1LABA 4IFDJ 4DV2L 3STBC 3L2PA 3AB9A 4PG3A 4BBRG 3UDGA 5C0XI 1PZJD 4BY1H 1E22A 1VQJA 2B29A 4ZKCB 3MEHA 2B2UC 1XMQQ 3S17B 4C3IB 2F0HA 2NUCA 3G71A 4X64L 3K7AH 3D4WA 5EPJA 3UE0A 5M3FH 3IFDA 4BY7G 5KYLA 1E24A 1RIPA 1C8CA 4DV3Q 2N49A 2ZTEA 2CH4W 3KOJA 1DD2A 1GUNA 2PPBC 1PFSA 3BZDB 5FJ8H 2YU9H 1RKNA 2B2VA 4P73A 3A8JE 2XRSD 1YVCA 5M5XB 4A3FB 3PUVA 5FLXL 3C3LA 1XNQL 4UP8A 2O5IC 5ELNA 1CA6A 4OX9Q 3VYRA 2VB3X 1SXTA 1JWSD 5DNFA 4CKBA 1H9MA 3KJPA 4B3SQ 4NPSA 2EE1A 3A55A 4ME3A 1UE7A 3M4OB 1HCZA 1YEZA 1ZYRC 1Y1WG 2UUAQ 1BO0A 3M4YA 2KEDA 5DM63 1I6HH 3E9HA 1I4XA 1YHAA 1Z9FA 3A0JA 2YTXA 3BZKA 2HHHL 4NDXA 2DY7A 1N8RC 3CRKC 1F9RA 2K05A 2E5LQ 2ENBA 1MKHA 2NZHA 3MAQA 2GN5A 1IKLA 3CQZH 3S14H 1TWAB 4A3BG 4DUYQ 4X3KA 3LWEA 5M5WH 1SNPA 4H02A 3NTHA 1B50A 4HN7A 4IO9A 5M3MH 2NN6G 3M4QA 1F2YA 2ZXPA 5IY0A 3JAME 4GOPC 4QUFA 4DV7Q 1EIFA 2IX0A 2TMPA 2VZAA 4IUQA 4KV6A 3TREA 4DK3C 1Z47A 1ASYA 4YCWA 3X3NA 3KFUA 1YNJD 4KY5A 3R3OA 1VQIA 1GUWA 4C3JG 3K58A 3Q0AA 4F7XA 3PSIA 2AUJD 3TZUA 1MIUA 2E2IB 4FXKC 4B9WA 1XX8A 4YY3Q 1F9SA 2NB0A 1ZXTA 1QE6A 4KJOA 4LFBQ 2PYKA 3IKJA 4I65A 1G2SA 3DEOA 1VQGA 1KTKA 3Q8DA 3NHHA 1I4RA 4A3GG 4CKEA 3TEHB 1HNWQ 3Q6SA 1O78A 3MFYA 1YZ6A 1ENCA 1XPUA 3GTPB 5IP9H 2H5XA 4QY7A 3I55A 5BN5A 2B63H 2DUDA 5IYBG 2EYPA 3NQIA 4JPBW 1JE4A 5KYIA 4DK6C 1SYBA 4O42A 4JI3L 2DGYA 1SNCA 4X66Q 2D5DA 2F4VQ 3CCUA 2HIVA 3OIQA 2B2TA 1K83H 2Q8RE 2NVXB 3H6MA 4DAPA 4LF7L 4DV1Q 3I4LA 3MA2B 2QDLA 1VQ8A 5E7NA 1CKMA 3R2TA 1MI2A 1EY5A 1L0WA 1HTLD 3HOVG 1C7YA 4ZQ3A 2ZTCA 5C4XH 3NBHB 2ZXOA 2RVLA 1JICA 3UDFA 4DAVA 1A6XA 1D7QA 1QUQB 1T9HA 2F1MA 4A3LG 3S9WA 1Q1EA 4IQZA 4ODGA 1L2FA 3UI2A 1A8VA 2F52A 4MZ9A 2EYOA 4PZ6A 3VR4A 1X3PA 1K8MA 2IJ0A 3PMFA 1EU3A 3RLOA 1IBLQ 1ILQA 3PGZA 3HGBA 4R9WA 4IOCA 2JJQA 3DWPA 2A69D 2IX1A 3BYYB 1C48A 1IBMQ 3ULLA 2IPKD 4OEMB 1CUKA 3GO5A 5C3EH 1B44D 2PZTA 5IYBH 4EQPA 4B3TQ 4KY7A 1ILPA 1W3SA 4L63B 3OTOL 1X9NA 3MVVA 2A68D 3I7FA 2IWHA 3QIAA 3JC66 1CQVA 1KAWA 4JBWA 2KVMA 3NUCA 4A4IA 1VQ9A 3E5SA 1FGUA 1UE1A 2KCTA 4GNXA 4RCOA 3STBD 3PF4A 1GUTA 3I4NG 3C1FA 4KN4C 1F9QA 2G9HD 3FVQA 4K8JA 2L11A 4PV1C 4X3UA 4LUZA 2JA5G 4C3HB 3CC2A 2A68C 2F0MA 1F2ZA 1A0IA 2D2CC 4OIKA 3NE5B 4KN7C 1KQSA 1JWUD 5ELCA 4CDCC 3PF5A 4ZLTF 4PZ8A 4NKLA 4K5XA 1WTPA 2CKZB 1T5EA 3S2HH 3RUZA 3A5ZB 3GTMB 3M7NA 4A3BB 5EJWA 1HR0L 1PVOA 2UUBL 4DK1A 2EY6A 2NN6H 4L5TA 3S24A 2I5MX 1BDOA 1OXXK 1UWVA 4DV5Q 3I4MG 3QB3A 2KUMA 4G7HC 1KXLA 5C4XG 2WAQB 4R4IA 3PUWA 2PW7A 2A5HA 1RL2A 3WOFA 1J5EQ 2A8VA 3H94A 4O0AA 3KLWA 1CKNA 4HMJA 2NVQH 2EY1A 4DKAC 5IIFA 1LTSD 1PRTB 3CHBD 1XMOL 3M3YH 3E6ZX 2QEJC 5I6WA 1IHZA 1B70B 2ICEC 2Q2HA 3SXHA 5LHY1 1H95A 4KHZA 4ALPA 3VDYA 4OIJA 4I7AA 1SMXA 3DLLA 4LF6L 2F0TA 1P8LA 1E3PA 5HGQA 3S17H 4JV5Q 4P75A 3K5LA 3BG3A 4XTCS 1JCKB 1DXMA 4ZUJA 4JI0L 2E2DC 3KDFA 1SE4A 3TSSA 4K5VA 1K3RA 1QG7A 3Q24A 2UUAL 1STYA 2YYZA 3RZOB 4LF8L 4I7ZC 1NSNS 2AWOA 3M85A 1I6VC 4AYBG 4C3JH 4K2LA 1YJ9A 3K0XA 1XJVA 1TVXA 3HOWH 3GTJB 2HHHQ 3H0GB 3CPFA 3EN2A 4K2KA 2F4VL 4JI2Q 3RR5A 4DV4Q 2K5HA 4X3TA 5FJ8G 1V1PB 1DZ1A 2JQOA 4LF4L 3MHBA 3T4AC 2Q2UA 3L0OA 3S1QH 2CFMA 2F0JA 2VQFL 3K5MA 1U5KA 3VYUA 2XWBB 3O13A 3HZXA 3MXNB 3WOEA 1IBKQ 1AE3A 1ENAA 1I3QB 1E0BA 2QW7A 3AU7A 3A5UA 2A73B 1EUJA 2RCNA 4CDDC 1HZ9A 4RGTA 4R8IA 3VA7A 2F4IA 4BA1I 1JJGA 3H09A 3FPUB 2V1CC 5E4WC 1X55A 3S14B 4E6IA 1BR9A 1HZAA 4F88A 1QNUA 1S5ED 2MJ8A 1SMYC 4A3EH 1ZYRD 4OO1H 1UAPA 1PH7A 3EJIA 1Z6HA 5I2XA 1VQ6A 4LFBL 3KJOA 2CH4A 3MXUA 1N34L 1CSQA 1EZ8A 3IFTA 1CTMA 3ULJA 5D14A 2I46A 1S5DD 1JB7A 2K6AA 3F2BA 1AE2A 4QUCA 4GLXA 1GHJA 2A74C 3N52A 4TKOB 4QF4A 3KLSA 1C9OA 2X6LA 3SEBA 4CJ2C 2NVQB 1EFID 1Q86C 1Q1BA 5E4XA 3J80L 1BCPD 5IP7H 2AKWB 4RHSA 2B8FA 3J7AF 1EOVA 1H9SB 3CPWA 1XTCD 2F0DA 3ICEA 1VDZA 2WKCA 1SNMA 3I4MB 2F0WA 4IUPA 1BQQT 4UDUC 3S2DH 1AP0A 2CW0C 1VQNA 4BY1G 2WAQG 2MPMA 4BBSB 4PMCA 1NBWA 3DM3A 5CV9A 3AMUA 3I91A 2WIIB 5EQ0A 3BYTB 2R7ZB 1EQTA 2A6ED 1N36Q 2PO4A 1OO9B 3J81j 3UE1A 1WTWA 2Z4HA 4BS9A 1K3BC 3X3MA 3T1HQ 2N3SA 4DR1L 4L5SA 1TXYA 3ZJYC 2ZM6Q 3VR6A 3TP6A 4FYDA 5C44H 4JG2A 4N8FA 2PQEA 4IUUA 3H0GH 5JEAH 1IBML 1QVFA 4QQBX 3G6JB 4QMGA 4WJ4A 4KHVA 5NUCA 2R93G 3G7LA 5KNCA 5C0XG 5CC4A 1PYWD 1LYLA 1A3VA 1PRTF 4CJ0B 2B2WC 2FMCA 4ZCKA 2LMCB 5AJ3Q 1WTVA 4KKTA 3RD4A 3G48A 1TWHB 2VUMB 4WJWA 5JOBA 1EYAA 4N8X1 3KDFB 3LGJA 4FVMA 1D5ZC 2I5HA 5JPNC 1YI2A 5IYDG 2UUCQ 4DR4L 5IODA 1NTGA 2PMZE 4XQQA 1YHBA 5K5PA 1G6PA 3OOCA 4LF8Q 3M7GA 2WFWA 2GVAA 4DXGA 3V2TA 1A63A 3L7ZC 5FO7B 3W2DA 1YJWA 2VS1A 3PUXA 5JJLA 4DV6Q 4HAEA 2AQ1B 2E2HB 4DR2L 1Q7YC 2F0IA 3KBGA 1BXTA 5C4HA 4LJZC 3TP7A 1K28A 3FKIB 1YNND 2SDFA 5C3EG 3OMGA 4EQNA 3K59A 4CBVA 1GD7A 1NMGA 4TRDA 1II3A 2K5QA 1HA6A 3F1ZA 5DM73 2M00A 3S2HB 4WRDA 1NR2A 1OXVA 1EWHA 1KAAA 2PQAA 2V4DA 2I0QA 2VQEL 3BDLA 2KCMA 1WCMB 4LFAQ 2B2WA 4ME5A 1XNRL 1ET6A 4GNXB 1EY4A 3ND8A 2A19A 1VS0A 5C3XA 1PA6A 2HQEA 1RJTA 3FPPA 3PO3H 4AQYL 4HSPA 4V0BA 4V190 1OXSC 1PHJA 1X3QA 3I70A 3URYA 2IHFA 1KIXA 1RCVD 1HJPA 2PQAB 1X3FA 2B2UA 4RKLA 3P20A 5E3FA 2TSSA 4C2MB 1YIJA 1SE3A 2ZJPA 3QOJA 4PNYA 2NVYH 1L1OB 5BN4A 4IFDI 1YJNA 2NN6I 1EQRA 2HCCA 1ZKOA 2K28A 3J81E 2EYJA 2GA4B 4A3DG 2OQ0A 2LXJA 5KRUA 2L5TA 1AN8A 1CQFA 2MO0A 3FRPB 3HKZB 3M4PA 4B08A 1K9MC 3C2PA 4KMUC 1B9MA 1JWMD 5EKIA 2JA7G 1JOQA 3BVGA 1V1QA 1DOLA 2DJGC 2F0KA 1NCVA 3P7JA 4RA8A 5AFWA 1PH5A 4LF4Q 4QIWB 4OGQC 2RSOA 4HTHA 1EIYB 4FF4A 1Q8KA 3DMUA 4JI1L 1KLGD 1YBYA 1IYVA 4RGOS 3E3XA 5LMUL 2VB2X 5JVG3 1ICWA 3HG9A 2ZJRA 1V1OA 2UU9Q 1KDCA 4C3JB 1XXGA 4DV2Q 2OTLA 2SEBD 3NPPA 3OWEB 3HOWB 1IXRA 1L0XB 4OWTB 4DR3Q 1HNXQ 2ID0A 3S16H 4CDEC 5FOBB 3RZDH 4DR7L 1CKNB 3FKIG 4C1NI 3I4NH 3D6CA 1NNXA 1SE8A 4QJFA 2R6GA 5ELBA 1HTPA 1GM5A 1A2UA 1X3GA 4NXML 1O7YA 2E8GA 4KJNA 4DGZA 1E2VA 2DY8A 1N33Q 3J80i 1AEXA 1STBA 1QVGA 1I3QH 1JOKA 2I5LX 3J81L 4PQXA 1E1OA 2N78A 3Q22A 1LTRD 4LUVA 1NJIC 1X65A 5CYUA 4WORA 5FLXE 2A6EC 1HQMC 4RGNA 3F2CA 1H9KA 2BA0A 2C35B 3OW2A 4JI5Q 3A56A 2BDOA 2F0FA 5FKAC 2UUCL 4NMZA 2JA8B 4A3JB 2FXQA 1VQDA 1UUPA 4G7OC 2R3ZA 1PYSB 3E0JA 5F2DA 5J1ZA 5IYDH 4DR6L 3EFXD 2AQ3B 5BR8L 1XYIA 4EQ5A 3SDZA 3PUZA 3S1NH 1N32Q 2HD3A 1K73C 1BCPC 3BVZA 2IL8A 1D1IA 4RG1A 2JEAI 1RD9D 1BOSA 2L55A 4QL5A 2B63G 4DR2Q 4A3LH 3OSOA 1HH2P 1LT6D 5C0XJ 2EVBA 2KENA 3GQBA 2R93H 1PH1A 2NVYB 3NWTA 1TS3A 4A3GH 1K8OA 2RCFA 3CCMA 3TN2A 1SYFA 2BA1A 3H91A 1J8IA 1O7IA 1EIGA 2F03A 3S2DB 4BBRB 3AYHB 3U4ZA 4A3CG 4AIMA 2AWNA 5CV8A 2QDBA 1PYBA 4GKKL 2PI2A 1Q3LA 2R92H 1G6ZA 2EXDA 1R9TH 1K0RA 2R7ZH 1FD7D 1IYJB 2X6GA 4F87A 2CWAA 3HOZG 1SBBB 3CF5A 3GTOB 4JW0A 4RMFA 3ERSX 1VQKA 3S15B 1CM9A 4L6TB 1Y1VH 2KECA 4YHHL 3KLRA 1TQOA 1OXTA 1KRSA 4KD3A 4A3MB 1GHKA 1HUNA 4JI6Q 2RDFA 3RLFA 1AZPA 1DCZA 3NK9A 3C46A 2JEBI 4HJ9A 3RZDB 4JOIA 1RTNA 3GTLH 2G9DA 3LX0A 1V43A 2AQ2B 1Q46A 3ZYYX 5ELFA 2XNAC 3GTGB 1X32A 2B8GA 2K01A 1G91A 4KK7A 3S1RH 2JA7H 2KJXA 4X66L 1QZGA 1RODA 2H1EA 2Y0SG 1B4OA 4DV6L 1D6EC 3NQTA 2OXPA 3BS1A 2JA8G 4R4CA 1VQHA 2JP1A 4JI1Q 5J22A 1VF7A 4POFA 3MFGA 1K8GA 5FK9C 1BKBA 5JJIA 5LMNQ 1BCPF 2QCPX 1I50B 2E75C 1CZWA 5C6AA 3PCOB 4JK1C 1GVPA 2N88A 2WAQE 4IZ8A 1CFMA 2XGTA 1MHWC 4C3IH 5BN3A 4P72A 2D62A 5GAGC 2F0LA 4DR3L 3P75A 5CORA 2VQEQ 2NBFA 4ZRZA 2K33A 4XQNA 3W1GA 1IBLL 2ZTDA 2BOSA 4YWLA 1WOCA 1G51A 1YNJC 4A76A 1SRUA 3HFZB 1A15A 3QWNA 3CCJA 1S5CD 3MZ5A 1EQVA 1Z7TA 4LK1C 4A3IG 5CGKA 3DHQA 3A8IE 2B3GA 1GUOA 5IGEA 2N55A 1AW7A 2EQSA 1HHVA 1KRTA 3I56A 5D3DA 1Y1WB 3H0GG 4IURA 5LL6X 1GKHA 4LF5L 3EROA 3LNNA 4UP9A 3I73A 2CQAA 4HJAA 1B8AA 2K14A 1M1KC 3M4OH 4IN3A 3CRLC 2JA6H 1MSGA 3PO2H 2UXBL 1IYUA 1VQ7A 5M5XH 3WWVA 1TU2B 4XYOA 1TWGH 2L12A 3HOWG 3DEPA 1DONA 3TBIB 2QKIC 1MJEA 4DR6Q 1FL0A 4GN4B 1E1TA 1FNWA 1WJJA 1WTHA 2EJMA 4QIWE 1SJHD 1G8ZD 1F77A 4A93H 4BXXG 2DJFC 3GTQH 3D4DA 1HR0Q 3L9AX 1W2BA 4YWKA 2MUYA 4LW1A 2OCEA 1I6HB 1SSOA 3J80E 1SYCA 2A6HD 2G5DA 1XPOA 3HKZE 4ZK9B 1O80A 5M3MB 1TY2A 1DYQA 1L1OA 5IOCA 1PV4A 4DAYA 1HNZQ 4HIDA 1DJRD 1H9RA 1F9PA 2EY5A 3K6OA 4FNFA 4BY7H 5IGFA 2CVRA 1PXUA 2D9UA 1STEA 2BDNA 3CQZB 2PCFB 4J8QA 1P16A 3HRZC 5ELDA 2F0GA 4KHPL 3LWUA 3E0EA 4X62L 2EXZA 2PZUA 1I4GA 1IW7C 1XMOQ 3KF8A 4YWMA 1L0YB 1RHPA 2VY3A 3NP8A 1D2BA 3M9BA 3CXCA 5CMDA 5J39A 1OXUA 4U673 4LF6Q 3K0YA 4EVOA 4EQOA 3BDOA 1EYCA 1WD1A 1L1OC 3MXNA 2ALYB 5E1FA 2E2IH 4JI6L 4IOAA 3EBEA 2NVTB 3I90A 4JI5L 1T5XD 1WI5A 2B63B 1CT1D 5IP7G 4J6HA 4ULLA 5KGUA 3K80C 4ID6A 1VQMA 2RDGA 2O2LD 2B2TC 2FHTA 3PIOA 1WD0A 3HOUH 5BR8Q 5CBAE 3MEFA 1AFPA 1I5FA 1CI3M 2R7DA 4IPDA 5I9PA 4A75A 1U4RA 3K8AA 1QILA 2K32A 1LM0A 3QJYA 3CMEA 3EA6A 3NTKA 1UE5A 1SJED 1DM0B 2KQ3A 5GAHC 2EOTA 2EZVA 3DUZA 2VNUD 1PH9A 5T1GA 3OW7A 3RN2A 1H9SA 5EBCA 3HOZB 1EU4A 1NAPA 2KCNA 1WYDA 1IL8A 2PMZB 1DGSA 4GKJL 4M1UB 3HOUG 2B2YC 1LTLA 2KOLA 1TT2A 1PTOD 2F0QA 3RMHA 3T1YL 1VQCA 3FEWX 5D3IB 4A3EG 2F0VA 5C4XB 2HQLA 3CKIB 4DNTB 1U0LA 3D4RA 1OTCA 1D5XC 4GKKQ 2MFIA 3HOXH 2YU9B 2FMMA 1PTOH 3D3RA 5GADC 3K7AB 4A3KH 2WV6D 5I4DA 1S40A 5M3FB 4A93B 2Z6KA 1SYDA 3RNUA 4KD4A 3GTQB 4A3FH 2GVBA 5M5YH 1Y8NB 3K5NA 4DUZQ 3J7A5 2M9VA 4LUOA 5EBDA 1XPRA 1LTGD 1AZQA 4FO2A 3SHLA 2ES2A 3OIPA 2KHJA 1PMRA 4TSSA 4XDXA 4H13C 3QG1A 1PH2A 5D65A 3SK4A 1HUMA 1FNUA 4OXPA 4C1NK 3I4OA 1CZGA 1G291 1VQ5A 1DOMA 3GDEA 4CJ1B 4APVA 2WINB 3OPOA 4YIJA 1S3OA 2Z4IA 3D0FA 1X56A 2XSCA 1TS5A 4DV0L 2DNCA 1Q90A 3GTOH 5EPLA 3I2ZA 4HCSA 2LSSA 2JN4A 1B53A 5DLQE 5C5LA 3S15H 4JCVE 4A3BH 1LT5D 4Y7NB 3QOLA 3I3CA 4K6LA 3VR5A 4DV4L 3G6EA 5M5WB 4JI2L 1IL2A 3IL8A 1UNSA 4DA2A 1K8AC 2B2YA 2IY5B 2PI2E 1KHIA 4RCNA 3PQIA 1E2WA 1W6KA 1V9PA 5LMNL 4X6AH 1E7ZA 1G2TA 2CWPA 1SEBD 3ERQA 2NWGA 1I4QA 5G3LF 2HCIA 3E9IA 1JR0D 1KNAA 3DXJC 3KF6A 1BVSA 4L5QA 4OL7A 3ULPA 4L8JA 4HJ8A 4ABNA 2EY2A 4KKUA 1M8AA 4KKSA 4R1JA 4FF3A 5IE8A 4KHPQ 2HIXA 1TR5A 2L1BA 5C5MA 1EEID 3NELA 2H4OA 2XTIA 1Y14B 4ZKBB 4P74A 2Z6BA 3OYYA 5JJZA 1VQLA 1I50H 3HS0C 2E74C 4GN3B 4AH6A 3V96A 1NUCA 1R4PB 2EYFA 3M3YB 1GXDC 5M3FG 3CCVA 5KNBA 3CC4A 1STNA 1LT4D 1XNQQ 2K52A 1AH9A 3K5OA 4JC0A 5ELEA 4B3MQ 4JBKA 1PFMA 3GTPH 3PIPA 3AFPA 1SNQA 4DNIA 5L37A 1PTOB 1PZID 4A3KG 2WB1G 3ER0A 2F3IA 1KLUD 4EGVA 5M5YB 1EIHA 2C5CA 2A69C 5K36G 4DR5Q 1Y1WH 1Y8OB 3GTKH 4UY8C 1FVIA 3RZOH 2E5LL 1K83B 3H3VH 3NBIA 4DFAA 4OHJA 4TVAB 1B7YB 2RKSA 3FDTA 2MNAA 1R4QB 3GTJH 1XTDA 4MNOA 2JA6B 4X65L 3PO2B 4RWSC 2XRQD 1EOTA 1VQFA 3SK5A 1JJ2A 2C9OA 4RAUC 3VR2A 2O4XA 5ELOA 3R8BA 4JBMA 4GKJQ 3EIVA 2F0UA 4LAAA 2CW0D 2Z9HA 1PRTC 3W1BA 4X64Q 4K14A 3CD6A 4GLAC 4Y7NH 3MWYW 4NP5A 1WFQA 3KLSX 4IUVA 3VYSA 1O7LA 4ZAIA 2BE5C 4Z9CB 2JYOA 5KEEA 2KHIA 3CCRA 5KIXA 4L5RC 4G7ZC 2XN9C 4HCEA 3VR3A 3HOXG 2J4XA 5C3EB 3W5OA 5KNDA 3TZDA 3SE0A 2YTVA 1MD2D 3D31A 3UDIA 1J6QA 1EY7A 5AJ3L 4N9PA 1Q81C 3R93A 2J0TD 4JI8Q 1SAPA 1RDPD 2E76C 3SR1A 2MGSA 2OT2A 4DAMA 2LFNA 2K5VA 4DR4Q 4XYQA 2XWJB 4B3SL 1VQOA 3IRBA 2IW3A 3GTMH 1M90C 2DN8A 1SMYD 1HZCA 4C3HH 1CHPD 1GOZA 2K03A 2KCCA 4HIKA 5EAYA 3F2UA 5FLXc 5IT9E 5IP9G 4XIGS 4JI3Q 2Z0SA 4H44C 4MHEA 2MQHA 4HJ7A 1S5FD 3I4MH 3HOVB 4K0KQ 4OWXB 1EY9A 1PH6A 1S5BD 4BBSH 4LF7Q 1FJGL 4DV1L 2PNRC 2WB1B 1F2MA 4A93G 2RQXA 2AHOB 4A3DB 1VQEA 2F0PA 5LMUQ 4R4OA 5DAUA 5IGGA 5HGTA 1CA5A 2WKDA 4MN3A 4JYAQ 1ASZA 4XXEA 2CHBD 2IT1A 3ND9A 4QB4A 3T1YQ 5C44B 4OO1G 4DV7L 3T53B 1TS4A 2K04A 1EQQA 3GP7A 1SE2A 4NXNL 2JA6G 3PO2G 1JJCB 4R4QA 4LFAL 5G3LD 1KNEA 2EYMA 2L4NA 5DEHA 3GTKB 4RFBA 5M3MG 4GNXC 4P71A 1KC8C 4GS3A 2F0NA 5H1SE 3H15A 1PFNA 1SYGA 1U4LA 4DUZL 3BZCA 3KF6B 3NENA 1TWFB 4POGA 1ESRA 2WP8J 2Z1CA 3CW2C 2EDGA 1NMFA 4IALA 3OTOQ 4R8NA 1MSHA 5CR3A 4FXDA 4GZYC 2L15A 4LWCA 2RHSB 1SNDA 3Q23A 2KA7A 1YNNC 3D8GA 3U9SA 1SFOB 3SK8A 4GLVB 1D5MC 3HOXB 1SLJA 1Y8PB 2WACA 1QUQA 4XT3B 3U58A 1V1PA 4A3KB 1EZ6A 4B3ML 4B9XA 3DWQA 3A7LA 2QEXA 2EYLA 1ET9A 1EY0A 2F0SA 4XT1B 2ATWA 4C56C 1LTID 3K57A 1QCBD 4LNQA 3A54A 4QCLA 4X3SA 2ASBA 2JK8A 5JVH3 5FLMG 3NWSA 1JE5A 1LTBD 3AFQA 3SVMA 1CK1A 4IUNA 4IFDH 4DR5L 1SDFA 3U9OA 5JAVA 2E2HH 1LT3D 3CC7A 2CQOA 1PRTD 4U68A 4XQJA 3JAMc 2UUBQ 5EPKA 4AYBB 4JBJA 1BBWA 1CSPA 2BH2A 5K36H 4RGMA 5FLMH 4P2CB 2OQKA 3TRZA 3AEVA 1EWCA 1LO5D 4X65Q 2VL6A 2UU9L 3S1QB 4DV5L 1A2TA 2UXCQ 1QB5D 1XWEA 1KD1C 5M9OA 1Y69U 3CCSA 4IPHA 1U4MA 1SN8A 1EYDA 1NR4A 3ITPA 4UP7A 2P5ZX 2Z6KC 2HDLA 1HNXL 5IWAQ 1M4VA 4PZ7A 1I94Q 4DR7Q 1PTOF 2UXDL 1W6JA 4BXXH 2BH8A 1VMPA 2F3VA 5CBEE 1LACA 3V05A 4IFDG 1IKMA 3NTIA 4GOPA 5C4JH 1ZEQX 3B6YA 2K75A 4C3HG 1TY0A 1JC7A 2MHVA 4J15A 1WTRA 2L9HA 1BCPB 1HXYD 3F2DA 3J7ZC 1WCMH 2EIFA 3VA5A 4A3EB 1B9NA 1EY6A 1LTTD 1QZHA 4IJLA 4YHHQ 4NW2A 1Y1VG 5CV6A 1I4PA 1BNZA 3PO3B 3J81i 1Q82C 4JI0Q 3HOYG 5CV4A 3CP0A 1S72A 1D8LA 2L0CA 5A35A 5LMNW 3TMEA 1LTAD 4ILWA 3QR8A 1X54A 3I72A 2MP1A 2FFKB 1GUSA 1TWCH 1TIID 1TWFH 3JAML 1IZ6A 1LV9A 4A3MG 1MJCA 2ZXRA 3R2IA 1BBXC 1VQAA 4Q0FA 4C3IG 4IPGA 1FJGQ 4DXFA 1SFOH 3NSWA 4EX5A 2VQFQ 2EJGC 2LS01 2R92G 3BDCA 3A8KE 2N8NA 2Y0SE 5JEAG 4BWGB 4JYAL 4DU9A 1IBKL 3K7UC 4IUTA 4JI4Q 1J5EL 1KDBA 3S16B 2Y0SB 3QO2A 1VQPA 1KDAA 3UDXA 4BBSG 5IT9c 2Z8LA 3IAYA 1B3QA 1KL9A 4NXNQ 3JAMi 4DN4M 4A3FG 1QOHA 4H7BA 1STAA 3GV3A 4KI0A 1EY8A 4ZYSA 4GN5A 2K50A 5EGTA 3A7AB 2RBMA 1SROA 1C0AA 1TWHH 3KK7A 5EKLA 2LY7A 1YITA 5C3WA 4A3CH 2K7VA 3NXWA 4B3RL 4UAIA 4JI8L 2NTSA 3DM1A 3NBHA 4HIOA 4JV5L 3ONAB 4A3JG 2XIWA 2SNMA 4KTAA 1N34Q 3MTSA 1VCIA 1EEFD 2VUMH 3T56B 3KF8B 2E2JB 3CMAA 2JA5H 2B2VC 1C4QA 3F8TA 2B39A 5C4JB 4JI7L 2RHQB 1PZKD 1U4PA 3S1NB 2R7FA 1MBYA 3OHXC 2NYZD 4BY1B 2CCZA 4K0KL 3HP3A 1NY4A 5IGCA 4DK0A 2LKVA 1FYCA 3TDQA 1Q12A 3KBXA 4A3JH 4FP5D 5TSSA 1ICFB 3T13A 5IGBA 2A1AA 4Q5VA 5JPMC 1VQ4A 1STGA 5ISRA 4KLKA 1I4HA 1RTOA 4G57A 1O7ZA 2JSOA 4OO1I 3FKIH 3AQQA 2QGQA 2JXMB 3FHWA 1RF2D 1PFBA 3HOVH 1FNVA 1VMCA 3A74A 2MO1A 2ZM6L 2R93B 2R92B 4H0LC 2IHEA 1JOOA 4F8MA 4AYBE 4ZUIA 4X62Q 4K8IA 3MC0B 2K5WA 5HURA 2JE6I 3OMCA 4A3DH 4DV3L 2F0OA 2HDMA 2RF4A 1UEBA 2VW9A 4LFCL 4C2MH 1ONLA 1Y1VB 1MGSA 3CAMA 3GD7A 5HY6A 1QJOA 5GAEC 1HQRD 3PO3G 3C1EA 4RHRA 1HFNA 2HT1A 3FP9A 2OWOA 1UEAB 1QVCA 1D1KA 1B1ZA 4LF5Q 1YHQA 1A62A 2OF1A 2O5JC 2DNEA 3L3OC 4DPGA 1V8QA 3H3VI 3BVMA 1JB3A 1VQBA 2UXBQ 2EPBA 2KBNA 2ZJQA 3CCQA 2RDHA 5IGDA 1TS2A 4A3MH 2FINB 1SR3A 2BCOA 5CV5A 4FDBA 1JT8A 4FF2A 1BF4A 1IW7D 2OTJA 4JVZA 4YCVA 3KYHC 3SK6A 1YNXA 2KEEA 3RLNA 1ESFA 4Y52H 3GTLB 5I2YA 4DNRB 2PNHA 3FMCA 4PMBA 3GTGH 3S1MH 1EWIA 3HKZG 4WJ3M 3BJUA 4LF9Q 4OELB 1K0SA 2Q8TA 3S1RB 2JA7B 1N9WA 5C4ZA 5A2QE 3U4VA 2UXCL 4DUYL 1N36L 1HNZL 5GROA 3W3AA 4LMQD 4IJHA 2A6HC 2K5NA 2OEOA 3T1HL 1GUGA 4J1MA 2E2JH 3KUPA 5IWAL 4DR1Q 1WCMG 1U9RA 1I94L 2UXDQ 3G4SA 1PH4A 1ML0D 1XMQL 4CHTB 4A3IB 4RH6A 2AUKA 4JOIC 2FJ2A 2VUMG 2ZT9C 2WB1E 2Q8IB 1NE3A 1QNKA 2F3WA 2SNSA 3I4NB 3EVQA 4HSVA 3PIO3 1HZBA 1JMCA 3MXPA 4DF7A 3PIP3 4S3SA 1EL0A 2Q2IA 1CHQD 1WTOA 4B3RQ 1QWYA 5I9OA 1BBUA 1JQYD 2K5DA 4AQYQ 5IT9L 1SYEA 3HOYH 1B2TA 3TS0A 1DOKA 3T51B 4DAYB 5EKKA 1LUZA 5IYCG 5LL6S 2NVXH 2K4KA 1X6OA 1HRJA 4OX9L 4HJ5A 4O1NA 1KABA 4HEDA 3MXGA 1H9JA 2D0PA 1HNWL 1ENFA 2SOBA 4UHVA 1STHA 1X3EA 5C0XH 3GV6A 4GOPB 4G4KA 3DWAA 2HUGA 2F0EA 2JA8H 5A2QL 4DV0Q 3CCLA 1FGBD 1FR3A 4YCUA 2YV5A 3WDNA 3TP5A 4BA2I 4O2DA 4JI7Q 1GJXA 3J80c 3U50C 2D0OA 3TP8A 3T16A 5JJKA 3CU7A 1HR0W 2RSNA 2NTTA 1PH3A 1F2LA 4OWWB 4R4TA 4A3GB 2QF7A 2J7ZA 5I6YA 1TWGB 2JA9A 5FO8B 5FO9B 4UPAA 3PUYA 1HA5A 2LXKA 3CCEA 1GO3E 4BBRH 2RA4A 2AMCB 3HKSA 1WVLA 3I8ZA 4BY7B 1Q8IA 4JI4L 2R61A 4PMWA 1BUVT 2NZ1D
chains in the Genus database with same CATH topology
1EUJA 2XGTA 3T1YQ 4C3IH 2RCNA 4DV7L 4P72A 4OO1G 1HZ9A 2D62A 1EQQA 1CKOA 3BU2A 4NB3A 4NXNL 5GAGC 4DR3L 2JA6G 1JJCB 4R4QA 2VQEQ 3PO2G 4LFAL 4BA1I 1JJGA 3J81c 3W1GA 3K81C 2V1CC 1XNRQ 1IBLL 2ZTDA 4YWLA 1WOCA 1G51A 2R7ZG 4A76A 1SRUA 3HFZB 1X55A 3CCJA 5M3MG 2QA4A 4GNXC 4P71A 1KC8C 4GS3A 1HZAA 5H1SE 3H15A 4NXMQ 4DUZL 4YY3L 3BZCA 3KF6B 1N33L 3NENA 4A3EH 3PV0A 4MTNA 4A3IG 4B3TL 4POGA 1PH7A 2WP8J 2B3GA 4LFCQ 1VQ6A 3CW2C 1NMFA 3OTOQ 4LFBL 3KJOA 1N34L 1CSQA 2Q2TA 2EQSA 2L15A 4LWCA 3ULJA 1KRTA 2RHSB 3I56A 1JB7A 1TWAH 3H0GG 4TQUS 3F2BA 4GLVB 1AE2A 1GKHA 5IYCH 4LF5L 4GLXA 1SLJA 1QUQA 3U58A 4UP9A 4HJAA 2NZOA 1B8AA 5J3BA 1C9OA 2K14A 4B3ML 4A3IH 1M1KC 5GQOA 3M4OH 3TS2A 2QEXA 1UE6A 2JA6H 3PO2H 2UXBL 1Q86C 1Q1BA 3TQYA 1VQ7A 2ATWA 5M5XH 3WWVA 5IP7H 2AKWB 1TWGH 4LNQA 3HOWG 2NVTH 2ASBA 2JK8A 1MJEA 4DR6Q 1EOVA 4QGUA 1FL0A 3CPWA 4GN4B 1E1TA 5FLMG 1JE5A 1WJJA 3AFQA 4OONA 4QIWE 3SGIA 3ICEA 1PH8A 4DR5L 4A93H 5C44G 2E2HH 4BXXG 1N32L 1EYGA 3GTQH 3CC7A 1HR0Q 2CQOA 3S2DH 4HIMA 4IPCA 3JAMc 2UUBQ 3NEMA 3RN5A 1W2BA 4JBJA 1BBWA 1CSPA 4YWKA 1EFWA 4BY1G 1VQNA 2WAQG 4LW1A 2OCEA 2BH2A 4LF9L 5JEAJ 1NBWA 2YTYA 3DM3A 5FLMH 2OQKA 3HOZH 3TRZA 1XPOA 3HKZE 3AEVA 2UU9L 4X65Q 2VL6A 4IFDJ 4DV5L 4DV2L 2UXCQ 1L1OA 1KD1C 3STBC 1N36Q 1PV4A 3J81j 3L2PA 3CCSA 1HNZQ 4IPHA 4HIDA 3UE1A 1SN8A 4PG3A 4BBRG 3UDGA 5C0XI 4UP7A 2Z6KC 3T1HQ 4BY7H 2N3SA 1HNXL 5IWAQ 4BY1H 1E22A 4DR1L 1VQJA 4PZ7A 2B29A 1I94Q 4L5SA 1TXYA 4DR7Q 2UXDL 3ZJYC 2ZM6Q 1XMQQ 5C44H 1P16A 2BH8A 4BXXH 4JG2A 3G71A 4X64L 4KHPL 4IFDG 3K7AH 3E0EA 4X62L 3H0GH 3UE0A 5M3FH 4GOPA 4BY7G 5C4JH 1IBML 1E24A 1QVFA 3B6YA 1RIPA 4QQBX 2K75A 4WJ4A 4DV3Q 4J15A 1XMOQ 2R93G 2N49A 4YWMA 5C0XG 2ZTEA 3KOJA 1LYLA 2VY3A 1PFSA 3M9BA 3F2DA 3J7ZC 1WCMH 5FJ8H 2YU9H 2EIFA 3CXCA 5AJ3Q 1OXUA 4P73A 1QZHA 4LF6Q 4IJLA 4YHHQ 3G48A 1YVCA 1L1OC 3PUVA 1Y1VG 2ALYB 4JI6L 2E2IH 1XNQL 4UP8A 3KDFB 4IOAA 3EBEA 3LGJA 5ELNA 4JI5L 3J81i 1WI5A 2I5HA 4OX9Q 1YI2A 5IYDG 2UUCQ 4DR4L 5IP7G 1NTGA 2PMZE 3KJPA 1Q82C 4JI0Q 4B3SQ 3HOYG 4NPSA 1YHBA 4ME3A 3CP0A 1S72A 3K80C 1D8LA 1UE7A 1VQMA 1YEZA 1Y1WG 5LMNW 2UUAQ 3PIOA 3HOUH 1G6PA 4LF8Q 2WFWA 2GVAA 5BR8Q 1I6HH 3E9HA 1X54A 3MEFA 1YHAA 1A63A 1I5FA 3L7ZC 1TWCH 1Z9FA 2R7DA 3A0JA 2YTXA 3BZKA 4IPDA 4A75A 3K8AA 1YJWA 1TWFH 2HHHL 1IZ6A 2VS1A 4A3MG 1LM0A 3CMEA 1N8RC 3PUXA 5JJLA 4DV6Q 1MJCA 2E5LQ 1MKHA 1UE5A 2NZHA 1VQAA 2GN5A 5GAHC 4IPGA 4DR2L 1Q7YC 1FJGQ 3CQZH 3S14H 4A3BG 4DUYQ 1SFOH 5M5WH 4EX5A 2VNUD 1PH9A 2VQFQ 3RN2A 2R92G 4H02A 2N8NA 5C3EG 2Y0SE 1WYDA 5JEAG 4JYAL 1DGSA 5M3MH 2NN6G 4IO9A 3K7UC 1GD7A 1NMGA 3M4QA 1IBKL 4GKJL 3HOUG 5IY0A 4JI4Q 1J5EL 1LTLA 3F1ZA 1VQPA 4BBSG 3UDXA 3T1YL 1VQCA 4GOPC 4A3EG 5IT9c 1OXVA 4DV7Q 1EIFA 1KL9A 2PQAA 2HQLA 2IX0A 4NXNQ 1U0LA 3JAMi 2I0QA 2VQEL 1OTCA 4GKKQ 2VZAA 2KCMA 4LFAQ 2MFIA 3TREA 3HOXH 4DK3C 4A3FG 1Z47A 1ASYA 4KI0A 4YCWA 5GADC 4A3KH 1XNRL 4GN5A 3KFUA 4GNXB 1VQIA 2K50A 1S40A 2Z6KA 2A19A 3RNUA 1VS0A 4A3FH 1SROA 2GVBA 1TWHH 3PSIA 1YITA 1PA6A 5M5YH 1C0AA 3J7A5 4DUZQ 1MIUA 4YY3Q 4LUOA 4A3CH 4B3RL 1XPRA 3PO3H 4AQYL 1OXSC 1PHJA 4JI8L 2ES2A 2IHFA 2KHJA 4LFBQ 4HIOA 1KIXA 4JV5L 4A3JG 1HJPA 1PH2A 1VQGA 1N34Q 2PQAB 3Q8DA 1X3FA 4OXPA 1VCIA 4A3GG 3I4OA 1YIJA 3TEHB 2VUMH 2ZJPA 1HNWQ 2NVYH 1G291 3KF8B 1VQ5A 3GDEA 1YZ6A 1L1OB 1YJNA 1XPUA 4IFDI 2NN6I 4APVA 5IP9H 1EQRA 2H5XA 3CMAA 2JA5H 4QY7A 1S3OA 3I55A 2B63H 3D0FA 1X56A 2DUDA 5IYBG 4A3DG 2OQ0A 2LXJA 3F8TA 4DV0L 4DK6C 3GTOH 2MO0A 3M4PA 1K9MC 3I2ZA 2LSSA 2RHQB 4JI3L 4JI7L 2DGYA 2R7FA 5DLQE 2JA7G 4X66Q 3S15H 4JCVE 4A3BH 1V1QA 2F4VQ 4DV4L 3CCUA 3G6EA 2HIVA 2CCZA 4JI2L 1IL2A 4K0KL 1NY4A 1K8AC 1K83H 1Q12A 4A3JH 1PH5A 4LF7L 4LF4Q 2IY5B 4DV1Q 1EIYB 2PI2E 1Q8KA 2A1AA 1VQ8A 1KHIA 5E7NA 4JI1L 1CKMA 1YBYA 1L0WA 3HOVG 1C7YA 1VQ4A 5LMUL 2ZTCA 4KLKA 5C4XH 1V9PA 3NBHB 5LMNL 4X6AH 3UDFA 2ZJRA 1E7ZA 2UU9Q 2CWPA 4DV2Q 1D7QA 4OO1I 1QUQB 2OTLA 3FKIH 1T9HA 4A3LG 3AQQA 3E9IA 1IXRA 1Q1EA 3KF6A 2QGQA 3FHWA 1L2FA 1A8VA 2F52A 4MZ9A 1BVSA 4OWTB 4L5QA 4DR3Q 3ULPA 4PZ6A 1HNXQ 4HJ8A 2ID0A 4PMWA 3HOVH 3S16H 3A74A 3RZDH 4DR7L 2MO1A 3RLOA 2ZM6L 1CKNB 3FKIG 1IBLQ 2IHEA 3PGZA 4R1JA 3I4NH 1SE8A 4QJFA 2R6GA 5IE8A 2HIXA 2JJQA 4IOCA 4KHPQ 4AYBE 4X62Q 1GM5A 1X3GA 2IX1A 4NXML 2E8GA 3ULLA 2JE6I 3NELA 1CUKA 3GO5A 5C3EH 1IBMQ 2XTIA 5IYBH 4A3DH 1Y14B 4DV3L 1N33Q 4B3TQ 3J80i 4P74A 1W3SA 2RF4A 1QVGA 1UEBA 3OYYA 2VW9A 4LFCL 1VQLA 1I50H 4C2MH 1I3QH 3OTOL 1X9NA 2I5LX 4GN3B 3CAMA 3GD7A 5HY6A 3I7FA 4AH6A 1E1OA 2N78A 3JC66 5GAEC 3PO3G 1KAWA 4LUVA 4JBWA 1NJIC 1X65A 2HT1A 4A4IA 3FP9A 2OWOA 5M3FG 3CCVA 1VQ9A 1FGUA 1UE1A 2KCTA 1QVCA 4GNXA 3CC4A 4LF5Q 3STBD 3PF4A 1YHQA 3I4NG 1A62A 1XNQQ 2K52A 1AH9A 4JC0A 3F2CA 4B3MQ 4DPGA 2BA0A 2C35B 3OW2A 4JI5Q 4JBKA 3H3VI 1VQBA 4LUZA 2JA5G 2UXBQ 2UUCL 2KBNA 2ZJQA 3CCQA 3CC2A 3GTPH 4A3MH 3PIPA 3AFPA 1A0IA 1SR3A 2FXQA 1VQDA 4DNIA 1PYSB 4FDBA 1JT8A 4A3KG 5IYDH 4DR6L 2OTJA 3ER0A 2WB1G 2F3IA 4YCVA 5BR8L 4EQ5A 3PF5A 1KQSA 3KYHC 4PZ8A 3PUZA 3S1NH 1YNXA 3RLNA 5K36G 4DR5Q 2CKZB 1Y1WH 3S2HH 3GTKH 3A5ZB 4Y52H 3M7NA 1N32Q 2PNHA 1HR0L 1PVOA 4UY8C 1FVIA 1K73C 3RZOH 2UUBL 2E5LL 2JEAI 4RG1A 3GTGH 3H3VH 1EWIA 3S1MH 3HKZG 4WJ3M 3BJUA 4TVAB 1B7YB 4LF9Q 4L5TA 3S24A 2I5MX 4QL5A 2MNAA 2B63G 1OXXK 3GTJH 1N9WA 4DR2Q 1XTDA 4MNOA 4A3LH 1UWVA 4X65L 4DV5Q 3U4VA 2UXCL 1HH2P 4DUYL 1N36L 5C0XJ 3I4MG 2KENA 2R93H 1PH1A 1HNZL 1VQFA 5GROA 1JJ2A 1KXLA 4IJHA 5C4XG 4A3GH 2K5NA 4R4IA 3T1HL 3PUWA 2E2JH 5ELOA 5IWAL 4JBMA 4DR1Q 1WCMG 3CCMA 4GKJQ 3EIVA 1RL2A 1I94L 2UXDQ 2BA1A 3G4SA 1PH4A 1J5EQ 2A8VA 1XMQL 3W1BA 1O7IA 4O0AA 3KLWA 4X64Q 4JOIC 2VUMG 3CD6A 1CKNA 2WB1E 4GLAC 2NVQH 3AYHB 3U4ZA 4A3CG 4AIMA 2AWNA 4Y7NH 1NE3A 4DKAC 1PYBA 1WFQA 4GKKL 2PI2A 2R92H 2EXDA 1XMOL 1R9TH 3M3YH 1K0RA 2KHIA 3CCRA 2R7ZH 4L5RC 1IYJB 1HZBA 1B70B 1JMCA 3HOXG 2CWAA 2Q2HA 3W5OA 3HOZG 1H95A 3CF5A 4KHZA 4ALPA 3VDYA 2Q2IA 2YTVA 4RMFA 3ERSX 3D31A 1VQKA 4B3RQ 3UDIA 1J6QA 1SMXA 5AJ3L 3DLLA 1Q81C 1BBUA 4AQYQ 4LF6L 1Y1VH 4YHHL 4JI8Q 3HOYH 1P8LA 3TS0A 1E3PA 4DAYB 5HGQA 1OXTA 1LUZA 1KRSA 3S17H 4JV5Q 5IYCG 4P75A 4JI6Q 3RLFA 2NVXH 2K4KA 4XTCS 1X6OA 4DAMA 4OX9L 4HJ5A 2JEBI 2K5VA 4DR4Q 4HJ9A 4JI0L 4B3SL 2D0PA 3KDFA 1VQOA 1HNWL 4JOIA 3IRBA 3GTMH 1X3EA 3GTLH 1M90C 1V43A 1K3RA 2UUAL 4GOPB 2YYZA 1Q46A 1HZCA 4C3HH 4LF8L 2AWOA 3M85A 4HIKA 5EAYA 4AYBG 5FLXc 4DV0Q 4YCUA 3CCLA 4C3JH 1YJ9A 2JA8H 5IP9G 2YV5A 3K0XA 4XIGS 1XJVA 4BA2I 4O2DA 2Z0SA 4JI3Q 3J80c 4JI7Q 3U50C 3S1RH 2JA7H 3HOWH 2D0OA 2HHHQ 4X66L 1QZGA 5JJKA 2Y0SG 2MQHA 1HR0W 3CPFA 4HJ7A 3EN2A 3I4MH 4DV6L 2F4VL 4JI2Q 3RR5A 4DV4Q 1PH3A 4K0KQ 2K5HA 4OWWB 4R4TA 4OWXB 2JA8G 5FJ8G 4R4CA 1VQHA 1PH6A 4BBSH 4LF7Q 2JQOA 4LF4L 1FJGL 4DV1L 2Q2UA 2JA9A 4JI1Q 3L0OA 3S1QH 2CFMA 4A93G 2VQFL 4POFA 4UPAA 3PUYA 1K8GA 2AHOB 1U5KA 1VQEA 2LXKA 3CCEA 1BKBA 1GO3E 4R4OA 4BBRH 5LMUQ 2AMCB 3MXNB 3HKSA 1IBKQ 4JYAQ 5JJIA 5LMNQ 1ASZA 1AE3A 4JI4L 3PCOB 1GVPA 3A5UA 2IT1A 2WAQE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUJ A;  2XGT A;  3T1Y Q;  4C3I H;  2RCN A;  4DV7 L;  4P72 A;  4OO1 G;  1HZ9 A;  2D62 A;  1EQQ A;  1CKO A;  3BU2 A;  4NB3 A;  4NXN L;  5GAG C;  4DR3 L;  2JA6 G;  1JJC B;  4R4Q A;  2VQE Q;  3PO2 G;  4LFA L;  4BA1 I;  1JJG A;  3J81 c;  3W1G A;  3K81 C;  2V1C C;  1XNR Q;  1IBL L;  2ZTD A;  4YWL A;  1WOC A;  1G51 A;  2R7Z G;  4A76 A;  1SRU A;  3HFZ B;  1X55 A;  3CCJ A;  5M3M G;  2QA4 A;  4GNX C;  4P71 A;  1KC8 C;  4GS3 A;  1HZA A;  5H1S E;  3H15 A;  4NXM Q;  4DUZ L;  4YY3 L;  3BZC A;  3KF6 B;  1N33 L;  3NEN A;  4A3E H;  3PV0 A;  4MTN A;  4A3I G;  4B3T L;  4POG A;  1PH7 A;  2WP8 J;  2B3G A;  4LFC Q;  1VQ6 A;  3CW2 C;  1NMF A;  3OTO Q;  4LFB L;  3KJO A;  1N34 L;  1CSQ A;  2Q2T A;  2EQS A;  2L15 A;  4LWC A;  3ULJ A;  1KRT A;  2RHS B;  3I56 A;  1JB7 A;  1TWA H;  3H0G G;  4TQU S;  3F2B A;  4GLV B;  1AE2 A;  1GKH A;  5IYC H;  4LF5 L;  4GLX A;  1SLJ A;  1QUQ A;  3U58 A;  4UP9 A;  4HJA A;  2NZO A;  1B8A A;  5J3B A;  1C9O A;  2K14 A;  4B3M L;  4A3I H;  1M1K C;  5GQO A;  3M4O H;  3TS2 A;  2QEX A;  1UE6 A;  2JA6 H;  3PO2 H;  2UXB L;  1Q86 C;  1Q1B A;  3TQY A;  1VQ7 A;  2ATW A;  5M5X H;  3WWV A;  5IP7 H;  2AKW B;  1TWG H;  4LNQ A;  3HOW G;  2NVT H;  2ASB A;  2JK8 A;  1MJE A;  4DR6 Q;  1EOV A;  4QGU A;  1FL0 A;  3CPW A;  4GN4 B;  1E1T A;  5FLM G;  1JE5 A;  1WJJ A;  3AFQ A;  4OON A;  4QIW E;  3SGI A;  3ICE A;  1PH8 A;  4DR5 L;  4A93 H;  5C44 G;  2E2H H;  4BXX G;  1N32 L;  1EYG A;  3GTQ H;  3CC7 A;  1HR0 Q;  2CQO A;  3S2D H;  4HIM A;  4IPC A;  3JAM c;  2UUB Q;  3NEM A;  3RN5 A;  1W2B A;  4JBJ A;  1BBW A;  1CSP A;  4YWK A;  1EFW A;  4BY1 G;  1VQN A;  2WAQ G;  4LW1 A;  2OCE A;  2BH2 A;  4LF9 L;  5JEA J;  1NBW A;  2YTY A;  3DM3 A;  5FLM H;  2OQK A;  3HOZ H;  3TRZ A;  1XPO A;  3HKZ E;  3AEV A;  2UU9 L;  4X65 Q;  2VL6 A;  4IFD J;  4DV5 L;  4DV2 L;  2UXC Q;  1L1O A;  1KD1 C;  3STB C;  1N36 Q;  1PV4 A;  3J81 j;  3L2P A;  3CCS A;  1HNZ Q;  4IPH A;  4HID A;  3UE1 A;  1SN8 A;  4PG3 A;  4BBR G;  3UDG A;  5C0X I;  4UP7 A;  2Z6K C;  3T1H Q;  4BY7 H;  2N3S A;  1HNX L;  5IWA Q;  4BY1 H;  1E22 A;  4DR1 L;  1VQJ A;  4PZ7 A;  2B29 A;  1I94 Q;  4L5S A;  1TXY A;  4DR7 Q;  2UXD L;  3ZJY C;  2ZM6 Q;  1XMQ Q;  5C44 H;  1P16 A;  2BH8 A;  4BXX H;  4JG2 A;  3G71 A;  4X64 L;  4KHP L;  4IFD G;  3K7A H;  3E0E A;  4X62 L;  3H0G H;  3UE0 A;  5M3F H;  4GOP A;  4BY7 G;  5C4J H;  1IBM L;  1E24 A;  1QVF A;  3B6Y A;  1RIP A;  4QQB X;  2K75 A;  4WJ4 A;  4DV3 Q;  4J15 A;  1XMO Q;  2R93 G;  2N49 A;  4YWM A;  5C0X G;  2ZTE A;  3KOJ A;  1LYL A;  2VY3 A;  1PFS A;  3M9B A;  3F2D A;  3J7Z C;  1WCM H;  5FJ8 H;  2YU9 H;  2EIF A;  3CXC A;  5AJ3 Q;  1OXU A;  4P73 A;  1QZH A;  4LF6 Q;  4IJL A;  4YHH Q;  3G48 A;  1YVC A;  1L1O C;  3PUV A;  1Y1V G;  2ALY B;  4JI6 L;  2E2I H;  1XNQ L;  4UP8 A;  3KDF B;  4IOA A;  3EBE A;  3LGJ A;  5ELN A;  4JI5 L;  3J81 i;  1WI5 A;  2I5H A;  4OX9 Q;  1YI2 A;  5IYD G;  2UUC Q;  4DR4 L;  5IP7 G;  1NTG A;  2PMZ E;  3KJP A;  1Q82 C;  4JI0 Q;  4B3S Q;  3HOY G;  4NPS A;  1YHB A;  4ME3 A;  3CP0 A;  1S72 A;  3K80 C;  1D8L A;  1UE7 A;  1VQM A;  1YEZ A;  1Y1W G;  5LMN W;  2UUA Q;  3PIO A;  3HOU H;  1G6P A;  4LF8 Q;  2WFW A;  2GVA A;  5BR8 Q;  1I6H H;  3E9H A;  1X54 A;  3MEF A;  1YHA A;  1A63 A;  1I5F A;  3L7Z C;  1TWC H;  1Z9F A;  2R7D A;  3A0J A;  2YTX A;  3BZK A;  4IPD A;  4A75 A;  3K8A A;  1YJW A;  1TWF H;  2HHH L;  1IZ6 A;  2VS1 A;  4A3M G;  1LM0 A;  3CME A;  1N8R C;  3PUX A;  5JJL A;  4DV6 Q;  1MJC A;  2E5L Q;  1MKH A;  1UE5 A;  2NZH A;  1VQA A;  2GN5 A;  5GAH C;  4IPG A;  4DR2 L;  1Q7Y C;  1FJG Q;  3CQZ H;  3S14 H;  4A3B G;  4DUY Q;  1SFO H;  5M5W H;  4EX5 A;  2VNU D;  1PH9 A;  2VQF Q;  3RN2 A;  2R92 G;  4H02 A;  2N8N A;  5C3E G;  2Y0S E;  1WYD A;  5JEA G;  4JYA L;  1DGS A;  5M3M H;  2NN6 G;  4IO9 A;  3K7U C;  1GD7 A;  1NMG A;  3M4Q A;  1IBK L;  4GKJ L;  3HOU G;  5IY0 A;  4JI4 Q;  1J5E L;  1LTL A;  3F1Z A;  1VQP A;  4BBS G;  3UDX A;  3T1Y L;  1VQC A;  4GOP C;  4A3E G;  5IT9 c;  1OXV A;  4DV7 Q;  1EIF A;  1KL9 A;  2PQA A;  2HQL A;  2IX0 A;  4NXN Q;  1U0L A;  3JAM i;  2I0Q A;  2VQE L;  1OTC A;  4GKK Q;  2VZA A;  2KCM A;  4LFA Q;  2MFI A;  3TRE A;  3HOX H;  4DK3 C;  4A3F G;  1Z47 A;  1ASY A;  4KI0 A;  4YCW A;  5GAD C;  4A3K H;  1XNR L;  4GN5 A;  3KFU A;  4GNX B;  1VQI A;  2K50 A;  1S40 A;  2Z6K A;  2A19 A;  3RNU A;  1VS0 A;  4A3F H;  1SRO A;  2GVB A;  1TWH H;  3PSI A;  1YIT A;  1PA6 A;  5M5Y H;  1C0A A;  3J7A 5;  4DUZ Q;  1MIU A;  4YY3 Q;  4LUO A;  4A3C H;  4B3R L;  1XPR A;  3PO3 H;  4AQY L;  1OXS C;  1PHJ A;  4JI8 L;  2ES2 A;  2IHF A;  2KHJ A;  4LFB Q;  4HIO A;  1KIX A;  4JV5 L;  4A3J G;  1HJP A;  1PH2 A;  1VQG A;  1N34 Q;  2PQA B;  3Q8D A;  1X3F A;  4OXP A;  1VCI A;  4A3G G;  3I4O A;  1YIJ A;  3TEH B;  2VUM H;  2ZJP A;  1HNW Q;  2NVY H;  1G29 1;  3KF8 B;  1VQ5 A;  3GDE A;  1YZ6 A;  1L1O B;  1YJN A;  1XPU A;  4IFD I;  2NN6 I;  4APV A;  5IP9 H;  1EQR A;  2H5X A;  3CMA A;  2JA5 H;  4QY7 A;  1S3O A;  3I55 A;  2B63 H;  3D0F A;  1X56 A;  2DUD A;  5IYB G;  4A3D G;  2OQ0 A;  2LXJ A;  3F8T A;  4DV0 L;  4DK6 C;  3GTO H;  2MO0 A;  3M4P A;  1K9M C;  3I2Z A;  2LSS A;  2RHQ B;  4JI3 L;  4JI7 L;  2DGY A;  2R7F A;  5DLQ E;  2JA7 G;  4X66 Q;  3S15 H;  4JCV E;  4A3B H;  1V1Q A;  2F4V Q;  4DV4 L;  3CCU A;  3G6E A;  2HIV A;  2CCZ A;  4JI2 L;  1IL2 A;  4K0K L;  1NY4 A;  1K8A C;  1K83 H;  1Q12 A;  4A3J H;  1PH5 A;  4LF7 L;  4LF4 Q;  2IY5 B;  4DV1 Q;  1EIY B;  2PI2 E;  1Q8K A;  2A1A A;  1VQ8 A;  1KHI A;  5E7N A;  4JI1 L;  1CKM A;  1YBY A;  1L0W A;  3HOV G;  1C7Y A;  1VQ4 A;  5LMU L;  2ZTC A;  4KLK A;  5C4X H;  1V9P A;  3NBH B;  5LMN L;  4X6A H;  3UDF A;  2ZJR A;  1E7Z A;  2UU9 Q;  2CWP A;  4DV2 Q;  1D7Q A;  4OO1 I;  1QUQ B;  2OTL A;  3FKI H;  1T9H A;  4A3L G;  3AQQ A;  3E9I A;  1IXR A;  1Q1E A;  3KF6 A;  2QGQ A;  3FHW A;  1L2F A;  1A8V A;  2F52 A;  4MZ9 A;  1BVS A;  4OWT B;  4L5Q A;  4DR3 Q;  3ULP A;  4PZ6 A;  1HNX Q;  4HJ8 A;  2ID0 A;  4PMW A;  3HOV H;  3S16 H;  3A74 A;  3RZD H;  4DR7 L;  2MO1 A;  3RLO A;  2ZM6 L;  1CKN B;  3FKI G;  1IBL Q;  2IHE A;  3PGZ A;  4R1J A;  3I4N H;  1SE8 A;  4QJF A;  2R6G A;  5IE8 A;  2HIX A;  2JJQ A;  4IOC A;  4KHP Q;  4AYB E;  4X62 Q;  1GM5 A;  1X3G A;  2IX1 A;  4NXM L;  2E8G A;  3ULL A;  2JE6 I;  3NEL A;  1CUK A;  3GO5 A;  5C3E H;  1IBM Q;  2XTI A;  5IYB H;  4A3D H;  1Y14 B;  4DV3 L;  1N33 Q;  4B3T Q;  3J80 i;  4P74 A;  1W3S A;  2RF4 A;  1QVG A;  1UEB A;  3OYY A;  2VW9 A;  4LFC L;  1VQL A;  1I50 H;  4C2M H;  1I3Q H;  3OTO L;  1X9N A;  2I5L X;  4GN3 B;  3CAM A;  3GD7 A;  5HY6 A;  3I7F A;  4AH6 A;  1E1O A;  2N78 A;  3JC6 6;  5GAE C;  3PO3 G;  1KAW A;  4LUV A;  4JBW A;  1NJI C;  1X65 A;  2HT1 A;  4A4I A;  3FP9 A;  2OWO A;  5M3F G;  3CCV A;  1VQ9 A;  1FGU A;  1UE1 A;  2KCT A;  1QVC A;  4GNX A;  3CC4 A;  4LF5 Q;  3STB D;  3PF4 A;  1YHQ A;  3I4N G;  1A62 A;  1XNQ Q;  2K52 A;  1AH9 A;  4JC0 A;  3F2C A;  4B3M Q;  4DPG A;  2BA0 A;  2C35 B;  3OW2 A;  4JI5 Q;  4JBK A;  3H3V I;  1VQB A;  4LUZ A;  2JA5 G;  2UXB Q;  2UUC L;  2KBN A;  2ZJQ A;  3CCQ A;  3CC2 A;  3GTP H;  4A3M H;  3PIP A;  3AFP A;  1A0I A;  1SR3 A;  2FXQ A;  1VQD A;  4DNI A;  1PYS B;  4FDB A;  1JT8 A;  4A3K G;  5IYD H;  4DR6 L;  2OTJ A;  3ER0 A;  2WB1 G;  2F3I A;  4YCV A;  5BR8 L;  4EQ5 A;  3PF5 A;  1KQS A;  3KYH C;  4PZ8 A;  3PUZ A;  3S1N H;  1YNX A;  3RLN A;  5K36 G;  4DR5 Q;  2CKZ B;  1Y1W H;  3S2H H;  3GTK H;  3A5Z B;  4Y52 H;  3M7N A;  1N32 Q;  2PNH A;  1HR0 L;  1PVO A;  4UY8 C;  1FVI A;  1K73 C;  3RZO H;  2UUB L;  2E5L L;  2JEA I;  4RG1 A;  3GTG H;  3H3V H;  1EWI A;  3S1M H;  3HKZ G;  4WJ3 M;  3BJU A;  4TVA B;  1B7Y B;  4LF9 Q;  4L5T A;  3S24 A;  2I5M X;  4QL5 A;  2MNA A;  2B63 G;  1OXX K;  3GTJ H;  1N9W A;  4DR2 Q;  1XTD A;  4MNO A;  4A3L H;  1UWV A;  4X65 L;  4DV5 Q;  3U4V A;  2UXC L;  1HH2 P;  4DUY L;  1N36 L;  5C0X J;  3I4M G;  2KEN A;  2R93 H;  1PH1 A;  1HNZ L;  1VQF A;  5GRO A;  1JJ2 A;  1KXL A;  4IJH A;  5C4X G;  4A3G H;  2K5N A;  4R4I A;  3T1H L;  3PUW A;  2E2J H;  5ELO A;  5IWA L;  4JBM A;  4DR1 Q;  1WCM G;  3CCM A;  4GKJ Q;  3EIV A;  1RL2 A;  1I94 L;  2UXD Q;  2BA1 A;  3G4S A;  1PH4 A;  1J5E Q;  2A8V A;  1XMQ L;  3W1B A;  1O7I A;  4O0A A;  3KLW A;  4X64 Q;  4JOI C;  2VUM G;  3CD6 A;  1CKN A;  2WB1 E;  4GLA C;  2NVQ H;  3AYH B;  3U4Z A;  4A3C G;  4AIM A;  2AWN A;  4Y7N H;  1NE3 A;  4DKA C;  1PYB A;  1WFQ A;  4GKK L;  2PI2 A;  2R92 H;  2EXD A;  1XMO L;  1R9T H;  3M3Y H;  1K0R A;  2KHI A;  3CCR A;  2R7Z H;  4L5R C;  1IYJ B;  1HZB A;  1B70 B;  1JMC A;  3HOX G;  2CWA A;  2Q2H A;  3W5O A;  3HOZ G;  1H95 A;  3CF5 A;  4KHZ A;  4ALP A;  3VDY A;  2Q2I A;  2YTV A;  4RMF A;  3ERS X;  3D31 A;  1VQK A;  4B3R Q;  3UDI A;  1J6Q A;  1SMX A;  5AJ3 L;  3DLL A;  1Q81 C;  1BBU A;  4AQY Q;  4LF6 L;  1Y1V H;  4YHH L;  4JI8 Q;  3HOY H;  1P8L A;  3TS0 A;  1E3P A;  4DAY B;  5HGQ A;  1OXT A;  1LUZ A;  1KRS A;  3S17 H;  4JV5 Q;  5IYC G;  4P75 A;  4JI6 Q;  3RLF A;  2NVX H;  2K4K A;  4XTC S;  1X6O A;  4DAM A;  4OX9 L;  4HJ5 A;  2JEB I;  2K5V A;  4DR4 Q;  4HJ9 A;  4JI0 L;  4B3S L;  2D0P A;  3KDF A;  1VQO A;  1HNW L;  4JOI A;  3IRB A;  3GTM H;  1X3E A;  3GTL H;  1M90 C;  1V43 A;  1K3R A;  2UUA L;  4GOP B;  2YYZ A;  1Q46 A;  1HZC A;  4C3H H;  4LF8 L;  2AWO A;  3M85 A;  4HIK A;  5EAY A;  4AYB G;  5FLX c;  4DV0 Q;  4YCU A;  3CCL A;  4C3J H;  1YJ9 A;  2JA8 H;  5IP9 G;  2YV5 A;  3K0X A;  4XIG S;  1XJV A;  4BA2 I;  4O2D A;  2Z0S A;  4JI3 Q;  3J80 c;  4JI7 Q;  3U50 C;  3S1R H;  2JA7 H;  3HOW H;  2D0O A;  2HHH Q;  4X66 L;  1QZG A;  5JJK A;  2Y0S G;  2MQH A;  1HR0 W;  3CPF A;  4HJ7 A;  3EN2 A;  3I4M H;  4DV6 L;  2F4V L;  4JI2 Q;  3RR5 A;  4DV4 Q;  1PH3 A;  4K0K Q;  2K5H A;  4OWW B;  4R4T A;  4OWX B;  2JA8 G;  5FJ8 G;  4R4C A;  1VQH A;  1PH6 A;  4BBS H;  4LF7 Q;  2JQO A;  4LF4 L;  1FJG L;  4DV1 L;  2Q2U A;  2JA9 A;  4JI1 Q;  3L0O A;  3S1Q H;  2CFM A;  4A93 G;  2VQF L;  4POF A;  4UPA A;  3PUY A;  1K8G A;  2AHO B;  1U5K A;  1VQE A;  2LXK A;  3CCE A;  1BKB A;  1GO3 E;  4R4O A;  4BBR H;  5LMU Q;  2AMC B;  3MXN B;  3HKS A;  1IBK Q;  4JYA Q;  5JJI A;  5LMN Q;  1ASZ A;  1AE3 A;  4JI4 L;  3PCO B;  1GVP A;  3A5U A;  2IT1 A;  2WAQ E; 
#chains in the Genus database with same CATH topology
 1TWC B;  1R9T B;  4M8A A;  2KHS A;  4HMI A;  1CKO A;  3BU2 A;  4NB3 A;  2IX3 A;  2PZW A;  3J81 c;  4K5W A;  3K81 C;  1B3A A;  1XNR Q;  3J7A V;  1SNO A;  2R7Z G;  2BE5 D;  2QA4 A;  1A3T A;  4NXM Q;  4N9T A;  4YY3 L;  1WTQ A;  3S1M B;  5CV7 A;  4MIU A;  1N33 L;  3HEJ A;  4B3T L;  3PV0 A;  4MTN A;  2XVS A;  3N6R A;  1PTO C;  4LFC Q;  2X69 A;  4HR7 B;  4KY6 A;  1HPC A;  3OWF A;  2Q2T A;  4CKC A;  3EQL C;  1TWA H;  2VXW A;  1A3U A;  4TQU S;  3J7Y W;  5IYC H;  3H3V C;  2QIL A;  3P1H A;  2NZO A;  5J3B A;  4MTK A;  1PLF A;  4A3I H;  5GQO A;  3TS2 A;  2PW5 A;  2I07 B;  3VYT A;  1UE6 A;  3D6W A;  1S4Z A;  4FF1 A;  3TQY A;  2M2L A;  1HFG A;  4CDF C;  2NVT H;  2ICI A;  1WTX A;  2EYH A;  2K1B A;  4QGU A;  4WFN 3;  1PDQ A;  2EJF C;  4OON A;  1TKW B;  3SGI A;  4RKB A;  4K6D A;  1PH8 A;  4FXG C;  1J9O A;  5C44 G;  1N32 L;  1EYG A;  1JOR A;  4CGY B;  1E2Z A;  4HIM A;  3HOU B;  4IPC A;  5T1I A;  3NEM A;  3RN5 A;  1EFW A;  3HOY B;  5COY A;  4LF9 L;  5JEA J;  2YTY A;  1LLR D;  2JA5 B;  3HOZ H;  1VF5 C;  1LAB A;  4IFD J;  4DV2 L;  3STB C;  3L2P A;  3AB9 A;  4PG3 A;  4BBR G;  3UDG A;  5C0X I;  1PZJ D;  4BY1 H;  1E22 A;  1VQJ A;  2B29 A;  4ZKC B;  3MEH A;  2B2U C;  1XMQ Q;  3S17 B;  4C3I B;  2F0H A;  2NUC A;  3G71 A;  4X64 L;  3K7A H;  3D4W A;  5EPJ A;  3UE0 A;  5M3F H;  3IFD A;  4BY7 G;  5KYL A;  1E24 A;  1RIP A;  1C8C A;  4DV3 Q;  2N49 A;  2ZTE A;  2CH4 W;  3KOJ A;  1DD2 A;  1GUN A;  2PPB C;  1PFS A;  3BZD B;  5FJ8 H;  2YU9 H;  1RKN A;  2B2V A;  4P73 A;  3A8J E;  2XRS D;  1YVC A;  5M5X B;  4A3F B;  3PUV A;  5FLX L;  3C3L A;  1XNQ L;  4UP8 A;  2O5I C;  5ELN A;  1CA6 A;  4OX9 Q;  3VYR A;  2VB3 X;  1SXT A;  1JWS D;  5DNF A;  4CKB A;  1H9M A;  3KJP A;  4B3S Q;  4NPS A;  2EE1 A;  3A55 A;  4ME3 A;  1UE7 A;  3M4O B;  1HCZ A;  1YEZ A;  1ZYR C;  1Y1W G;  2UUA Q;  1BO0 A;  3M4Y A;  2KED A;  5DM6 3;  1I6H H;  3E9H A;  1I4X A;  1YHA A;  1Z9F A;  3A0J A;  2YTX A;  3BZK A;  2HHH L;  4NDX A;  2DY7 A;  1N8R C;  3CRK C;  1F9R A;  2K05 A;  2E5L Q;  2ENB A;  1MKH A;  2NZH A;  3MAQ A;  2GN5 A;  1IKL A;  3CQZ H;  3S14 H;  1TWA B;  4A3B G;  4DUY Q;  4X3K A;  3LWE A;  5M5W H;  1SNP A;  4H02 A;  3NTH A;  1B50 A;  4HN7 A;  4IO9 A;  5M3M H;  2NN6 G;  3M4Q A;  1F2Y A;  2ZXP A;  5IY0 A;  3JAM E;  4GOP C;  4QUF A;  4DV7 Q;  1EIF A;  2IX0 A;  2TMP A;  2VZA A;  4IUQ A;  4KV6 A;  3TRE A;  4DK3 C;  1Z47 A;  1ASY A;  4YCW A;  3X3N A;  3KFU A;  1YNJ D;  4KY5 A;  3R3O A;  1VQI A;  1GUW A;  4C3J G;  3K58 A;  3Q0A A;  4F7X A;  3PSI A;  2AUJ D;  3TZU A;  1MIU A;  2E2I B;  4FXK C;  4B9W A;  1XX8 A;  4YY3 Q;  1F9S A;  2NB0 A;  1ZXT A;  1QE6 A;  4KJO A;  4LFB Q;  2PYK A;  3IKJ A;  4I65 A;  1G2S A;  3DEO A;  1VQG A;  1KTK A;  3Q8D A;  3NHH A;  1I4R A;  4A3G G;  4CKE A;  3TEH B;  1HNW Q;  3Q6S A;  1O78 A;  3MFY A;  1YZ6 A;  1ENC A;  1XPU A;  3GTP B;  5IP9 H;  2H5X A;  4QY7 A;  3I55 A;  5BN5 A;  2B63 H;  2DUD A;  5IYB G;  2EYP A;  3NQI A;  4JPB W;  1JE4 A;  5KYI A;  4DK6 C;  1SYB A;  4O42 A;  4JI3 L;  2DGY A;  1SNC A;  4X66 Q;  2D5D A;  2F4V Q;  3CCU A;  2HIV A;  3OIQ A;  2B2T A;  1K83 H;  2Q8R E;  2NVX B;  3H6M A;  4DAP A;  4LF7 L;  4DV1 Q;  3I4L A;  3MA2 B;  2QDL A;  1VQ8 A;  5E7N A;  1CKM A;  3R2T A;  1MI2 A;  1EY5 A;  1L0W A;  1HTL D;  3HOV G;  1C7Y A;  4ZQ3 A;  2ZTC A;  5C4X H;  3NBH B;  2ZXO A;  2RVL A;  1JIC A;  3UDF A;  4DAV A;  1A6X A;  1D7Q A;  1QUQ B;  1T9H A;  2F1M A;  4A3L G;  3S9W A;  1Q1E A;  4IQZ A;  4ODG A;  1L2F A;  3UI2 A;  1A8V A;  2F52 A;  4MZ9 A;  2EYO A;  4PZ6 A;  3VR4 A;  1X3P A;  1K8M A;  2IJ0 A;  3PMF A;  1EU3 A;  3RLO A;  1IBL Q;  1ILQ A;  3PGZ A;  3HGB A;  4R9W A;  4IOC A;  2JJQ A;  3DWP A;  2A69 D;  2IX1 A;  3BYY B;  1C48 A;  1IBM Q;  3ULL A;  2IPK D;  4OEM B;  1CUK A;  3GO5 A;  5C3E H;  1B44 D;  2PZT A;  5IYB H;  4EQP A;  4B3T Q;  4KY7 A;  1ILP A;  1W3S A;  4L63 B;  3OTO L;  1X9N A;  3MVV A;  2A68 D;  3I7F A;  2IWH A;  3QIA A;  3JC6 6;  1CQV A;  1KAW A;  4JBW A;  2KVM A;  3NUC A;  4A4I A;  1VQ9 A;  3E5S A;  1FGU A;  1UE1 A;  2KCT A;  4GNX A;  4RCO A;  3STB D;  3PF4 A;  1GUT A;  3I4N G;  3C1F A;  4KN4 C;  1F9Q A;  2G9H D;  3FVQ A;  4K8J A;  2L11 A;  4PV1 C;  4X3U A;  4LUZ A;  2JA5 G;  4C3H B;  3CC2 A;  2A68 C;  2F0M A;  1F2Z A;  1A0I A;  2D2C C;  4OIK A;  3NE5 B;  4KN7 C;  1KQS A;  1JWU D;  5ELC A;  4CDC C;  3PF5 A;  4ZLT F;  4PZ8 A;  4NKL A;  4K5X A;  1WTP A;  2CKZ B;  1T5E A;  3S2H H;  3RUZ A;  3A5Z B;  3GTM B;  3M7N A;  4A3B B;  5EJW A;  1HR0 L;  1PVO A;  2UUB L;  4DK1 A;  2EY6 A;  2NN6 H;  4L5T A;  3S24 A;  2I5M X;  1BDO A;  1OXX K;  1UWV A;  4DV5 Q;  3I4M G;  3QB3 A;  2KUM A;  4G7H C;  1KXL A;  5C4X G;  2WAQ B;  4R4I A;  3PUW A;  2PW7 A;  2A5H A;  1RL2 A;  3WOF A;  1J5E Q;  2A8V A;  3H94 A;  4O0A A;  3KLW A;  1CKN A;  4HMJ A;  2NVQ H;  2EY1 A;  4DKA C;  5IIF A;  1LTS D;  1PRT B;  3CHB D;  1XMO L;  3M3Y H;  3E6Z X;  2QEJ C;  5I6W A;  1IHZ A;  1B70 B;  2ICE C;  2Q2H A;  3SXH A;  5LHY 1;  1H95 A;  4KHZ A;  4ALP A;  3VDY A;  4OIJ A;  4I7A A;  1SMX A;  3DLL A;  4LF6 L;  2F0T A;  1P8L A;  1E3P A;  5HGQ A;  3S17 H;  4JV5 Q;  4P75 A;  3K5L A;  3BG3 A;  4XTC S;  1JCK B;  1DXM A;  4ZUJ A;  4JI0 L;  2E2D C;  3KDF A;  1SE4 A;  3TSS A;  4K5V A;  1K3R A;  1QG7 A;  3Q24 A;  2UUA L;  1STY A;  2YYZ A;  3RZO B;  4LF8 L;  4I7Z C;  1NSN S;  2AWO A;  3M85 A;  1I6V C;  4AYB G;  4C3J H;  4K2L A;  1YJ9 A;  3K0X A;  1XJV A;  1TVX A;  3HOW H;  3GTJ B;  2HHH Q;  3H0G B;  3CPF A;  3EN2 A;  4K2K A;  2F4V L;  4JI2 Q;  3RR5 A;  4DV4 Q;  2K5H A;  4X3T A;  5FJ8 G;  1V1P B;  1DZ1 A;  2JQO A;  4LF4 L;  3MHB A;  3T4A C;  2Q2U A;  3L0O A;  3S1Q H;  2CFM A;  2F0J A;  2VQF L;  3K5M A;  1U5K A;  3VYU A;  2XWB B;  3O13 A;  3HZX A;  3MXN B;  3WOE A;  1IBK Q;  1AE3 A;  1ENA A;  1I3Q B;  1E0B A;  2QW7 A;  3AU7 A;  3A5U A;  2A73 B;  1EUJ A;  2RCN A;  4CDD C;  1HZ9 A;  4RGT A;  4R8I A;  3VA7 A;  2F4I A;  4BA1 I;  1JJG A;  3H09 A;  3FPU B;  2V1C C;  5E4W C;  1X55 A;  3S14 B;  4E6I A;  1BR9 A;  1HZA A;  4F88 A;  1QNU A;  1S5E D;  2MJ8 A;  1SMY C;  4A3E H;  1ZYR D;  4OO1 H;  1UAP A;  1PH7 A;  3EJI A;  1Z6H A;  5I2X A;  1VQ6 A;  4LFB L;  3KJO A;  2CH4 A;  3MXU A;  1N34 L;  1CSQ A;  1EZ8 A;  3IFT A;  1CTM A;  3ULJ A;  5D14 A;  2I46 A;  1S5D D;  1JB7 A;  2K6A A;  3F2B A;  1AE2 A;  4QUC A;  4GLX A;  1GHJ A;  2A74 C;  3N52 A;  4TKO B;  4QF4 A;  3KLS A;  1C9O A;  2X6L A;  3SEB A;  4CJ2 C;  2NVQ B;  1EFI D;  1Q86 C;  1Q1B A;  5E4X A;  3J80 L;  1BCP D;  5IP7 H;  2AKW B;  4RHS A;  2B8F A;  3J7A F;  1EOV A;  1H9S B;  3CPW A;  1XTC D;  2F0D A;  3ICE A;  1VDZ A;  2WKC A;  1SNM A;  3I4M B;  2F0W A;  4IUP A;  1BQQ T;  4UDU C;  3S2D H;  1AP0 A;  2CW0 C;  1VQN A;  4BY1 G;  2WAQ G;  2MPM A;  4BBS B;  4PMC A;  1NBW A;  3DM3 A;  5CV9 A;  3AMU A;  3I91 A;  2WII B;  5EQ0 A;  3BYT B;  2R7Z B;  1EQT A;  2A6E D;  1N36 Q;  2PO4 A;  1OO9 B;  3J81 j;  3UE1 A;  1WTW A;  2Z4H A;  4BS9 A;  1K3B C;  3X3M A;  3T1H Q;  2N3S A;  4DR1 L;  4L5S A;  1TXY A;  3ZJY C;  2ZM6 Q;  3VR6 A;  3TP6 A;  4FYD A;  5C44 H;  4JG2 A;  4N8F A;  2PQE A;  4IUU A;  3H0G H;  5JEA H;  1IBM L;  1QVF A;  4QQB X;  3G6J B;  4QMG A;  4WJ4 A;  4KHV A;  5NUC A;  2R93 G;  3G7L A;  5KNC A;  5C0X G;  5CC4 A;  1PYW D;  1LYL A;  1A3V A;  1PRT F;  4CJ0 B;  2B2W C;  2FMC A;  4ZCK A;  2LMC B;  5AJ3 Q;  1WTV A;  4KKT A;  3RD4 A;  3G48 A;  1TWH B;  2VUM B;  4WJW A;  5JOB A;  1EYA A;  4N8X 1;  3KDF B;  3LGJ A;  4FVM A;  1D5Z C;  2I5H A;  5JPN C;  1YI2 A;  5IYD G;  2UUC Q;  4DR4 L;  5IOD A;  1NTG A;  2PMZ E;  4XQQ A;  1YHB A;  5K5P A;  1G6P A;  3OOC A;  4LF8 Q;  3M7G A;  2WFW A;  2GVA A;  4DXG A;  3V2T A;  1A63 A;  3L7Z C;  5FO7 B;  3W2D A;  1YJW A;  2VS1 A;  3PUX A;  5JJL A;  4DV6 Q;  4HAE A;  2AQ1 B;  2E2H B;  4DR2 L;  1Q7Y C;  2F0I A;  3KBG A;  1BXT A;  5C4H A;  4LJZ C;  3TP7 A;  1K28 A;  3FKI B;  1YNN D;  2SDF A;  5C3E G;  3OMG A;  4EQN A;  3K59 A;  4CBV A;  1GD7 A;  1NMG A;  4TRD A;  1II3 A;  2K5Q A;  1HA6 A;  3F1Z A;  5DM7 3;  2M00 A;  3S2H B;  4WRD A;  1NR2 A;  1OXV A;  1EWH A;  1KAA A;  2PQA A;  2V4D A;  2I0Q A;  2VQE L;  3BDL A;  2KCM A;  1WCM B;  4LFA Q;  2B2W A;  4ME5 A;  1XNR L;  1ET6 A;  4GNX B;  1EY4 A;  3ND8 A;  2A19 A;  1VS0 A;  5C3X A;  1PA6 A;  2HQE A;  1RJT A;  3FPP A;  3PO3 H;  4AQY L;  4HSP A;  4V0B A;  4V19 0;  1OXS C;  1PHJ A;  1X3Q A;  3I70 A;  3URY A;  2IHF A;  1KIX A;  1RCV D;  1HJP A;  2PQA B;  1X3F A;  2B2U A;  4RKL A;  3P20 A;  5E3F A;  2TSS A;  4C2M B;  1YIJ A;  1SE3 A;  2ZJP A;  3QOJ A;  4PNY A;  2NVY H;  1L1O B;  5BN4 A;  4IFD I;  1YJN A;  2NN6 I;  1EQR A;  2HCC A;  1ZKO A;  2K28 A;  3J81 E;  2EYJ A;  2GA4 B;  4A3D G;  2OQ0 A;  2LXJ A;  5KRU A;  2L5T A;  1AN8 A;  1CQF A;  2MO0 A;  3FRP B;  3HKZ B;  3M4P A;  4B08 A;  1K9M C;  3C2P A;  4KMU C;  1B9M A;  1JWM D;  5EKI A;  2JA7 G;  1JOQ A;  3BVG A;  1V1Q A;  1DOL A;  2DJG C;  2F0K A;  1NCV A;  3P7J A;  4RA8 A;  5AFW A;  1PH5 A;  4LF4 Q;  4QIW B;  4OGQ C;  2RSO A;  4HTH A;  1EIY B;  4FF4 A;  1Q8K A;  3DMU A;  4JI1 L;  1KLG D;  1YBY A;  1IYV A;  4RGO S;  3E3X A;  5LMU L;  2VB2 X;  5JVG 3;  1ICW A;  3HG9 A;  2ZJR A;  1V1O A;  2UU9 Q;  1KDC A;  4C3J B;  1XXG A;  4DV2 Q;  2OTL A;  2SEB D;  3NPP A;  3OWE B;  3HOW B;  1IXR A;  1L0X B;  4OWT B;  4DR3 Q;  1HNX Q;  2ID0 A;  3S16 H;  4CDE C;  5FOB B;  3RZD H;  4DR7 L;  1CKN B;  3FKI G;  4C1N I;  3I4N H;  3D6C A;  1NNX A;  1SE8 A;  4QJF A;  2R6G A;  5ELB A;  1HTP A;  1GM5 A;  1A2U A;  1X3G A;  4NXM L;  1O7Y A;  2E8G A;  4KJN A;  4DGZ A;  1E2V A;  2DY8 A;  1N33 Q;  3J80 i;  1AEX A;  1STB A;  1QVG A;  1I3Q H;  1JOK A;  2I5L X;  3J81 L;  4PQX A;  1E1O A;  2N78 A;  3Q22 A;  1LTR D;  4LUV A;  1NJI C;  1X65 A;  5CYU A;  4WOR A;  5FLX E;  2A6E C;  1HQM C;  4RGN A;  3F2C A;  1H9K A;  2BA0 A;  2C35 B;  3OW2 A;  4JI5 Q;  3A56 A;  2BDO A;  2F0F A;  5FKA C;  2UUC L;  4NMZ A;  2JA8 B;  4A3J B;  2FXQ A;  1VQD A;  1UUP A;  4G7O C;  2R3Z A;  1PYS B;  3E0J A;  5F2D A;  5J1Z A;  5IYD H;  4DR6 L;  3EFX D;  2AQ3 B;  5BR8 L;  1XYI A;  4EQ5 A;  3SDZ A;  3PUZ A;  3S1N H;  1N32 Q;  2HD3 A;  1K73 C;  1BCP C;  3BVZ A;  2IL8 A;  1D1I A;  4RG1 A;  2JEA I;  1RD9 D;  1BOS A;  2L55 A;  4QL5 A;  2B63 G;  4DR2 Q;  4A3L H;  3OSO A;  1HH2 P;  1LT6 D;  5C0X J;  2EVB A;  2KEN A;  3GQB A;  2R93 H;  1PH1 A;  2NVY B;  3NWT A;  1TS3 A;  4A3G H;  1K8O A;  2RCF A;  3CCM A;  3TN2 A;  1SYF A;  2BA1 A;  3H91 A;  1J8I A;  1O7I A;  1EIG A;  2F03 A;  3S2D B;  4BBR B;  3AYH B;  3U4Z A;  4A3C G;  4AIM A;  2AWN A;  5CV8 A;  2QDB A;  1PYB A;  4GKK L;  2PI2 A;  1Q3L A;  2R92 H;  1G6Z A;  2EXD A;  1R9T H;  1K0R A;  2R7Z H;  1FD7 D;  1IYJ B;  2X6G A;  4F87 A;  2CWA A;  3HOZ G;  1SBB B;  3CF5 A;  3GTO B;  4JW0 A;  4RMF A;  3ERS X;  1VQK A;  3S15 B;  1CM9 A;  4L6T B;  1Y1V H;  2KEC A;  4YHH L;  3KLR A;  1TQO A;  1OXT A;  1KRS A;  4KD3 A;  4A3M B;  1GHK A;  1HUN A;  4JI6 Q;  2RDF A;  3RLF A;  1AZP A;  1DCZ A;  3NK9 A;  3C46 A;  2JEB I;  4HJ9 A;  3RZD B;  4JOI A;  1RTN A;  3GTL H;  2G9D A;  3LX0 A;  1V43 A;  2AQ2 B;  1Q46 A;  3ZYY X;  5ELF A;  2XNA C;  3GTG B;  1X32 A;  2B8G A;  2K01 A;  1G91 A;  4KK7 A;  3S1R H;  2JA7 H;  2KJX A;  4X66 L;  1QZG A;  1ROD A;  2H1E A;  2Y0S G;  1B4O A;  4DV6 L;  1D6E C;  3NQT A;  2OXP A;  3BS1 A;  2JA8 G;  4R4C A;  1VQH A;  2JP1 A;  4JI1 Q;  5J22 A;  1VF7 A;  4POF A;  3MFG A;  1K8G A;  5FK9 C;  1BKB A;  5JJI A;  5LMN Q;  1BCP F;  2QCP X;  1I50 B;  2E75 C;  1CZW A;  5C6A A;  3PCO B;  4JK1 C;  1GVP A;  2N88 A;  2WAQ E;  4IZ8 A;  1CFM A;  2XGT A;  1MHW C;  4C3I H;  5BN3 A;  4P72 A;  2D62 A;  5GAG C;  2F0L A;  4DR3 L;  3P75 A;  5COR A;  2VQE Q;  2NBF A;  4ZRZ A;  2K33 A;  4XQN A;  3W1G A;  1IBL L;  2ZTD A;  2BOS A;  4YWL A;  1WOC A;  1G51 A;  1YNJ C;  4A76 A;  1SRU A;  3HFZ B;  1A15 A;  3QWN A;  3CCJ A;  1S5C D;  3MZ5 A;  1EQV A;  1Z7T A;  4LK1 C;  4A3I G;  5CGK A;  3DHQ A;  3A8I E;  2B3G A;  1GUO A;  5IGE A;  2N55 A;  1AW7 A;  2EQS A;  1HHV A;  1KRT A;  3I56 A;  5D3D A;  1Y1W B;  3H0G G;  4IUR A;  5LL6 X;  1GKH A;  4LF5 L;  3ERO A;  3LNN A;  4UP9 A;  3I73 A;  2CQA A;  4HJA A;  1B8A A;  2K14 A;  1M1K C;  3M4O H;  4IN3 A;  3CRL C;  2JA6 H;  1MSG A;  3PO2 H;  2UXB L;  1IYU A;  1VQ7 A;  5M5X H;  3WWV A;  1TU2 B;  4XYO A;  1TWG H;  2L12 A;  3HOW G;  3DEP A;  1DON A;  3TBI B;  2QKI C;  1MJE A;  4DR6 Q;  1FL0 A;  4GN4 B;  1E1T A;  1FNW A;  1WJJ A;  1WTH A;  2EJM A;  4QIW E;  1SJH D;  1G8Z D;  1F77 A;  4A93 H;  4BXX G;  2DJF C;  3GTQ H;  3D4D A;  1HR0 Q;  3L9A X;  1W2B A;  4YWK A;  2MUY A;  4LW1 A;  2OCE A;  1I6H B;  1SSO A;  3J80 E;  1SYC A;  2A6H D;  2G5D A;  1XPO A;  3HKZ E;  4ZK9 B;  1O80 A;  5M3M B;  1TY2 A;  1DYQ A;  1L1O A;  5IOC A;  1PV4 A;  4DAY A;  1HNZ Q;  4HID A;  1DJR D;  1H9R A;  1F9P A;  2EY5 A;  3K6O A;  4FNF A;  4BY7 H;  5IGF A;  2CVR A;  1PXU A;  2D9U A;  1STE A;  2BDN A;  3CQZ B;  2PCF B;  4J8Q A;  1P16 A;  3HRZ C;  5ELD A;  2F0G A;  4KHP L;  3LWU A;  3E0E A;  4X62 L;  2EXZ A;  2PZU A;  1I4G A;  1IW7 C;  1XMO Q;  3KF8 A;  4YWM A;  1L0Y B;  1RHP A;  2VY3 A;  3NP8 A;  1D2B A;  3M9B A;  3CXC A;  5CMD A;  5J39 A;  1OXU A;  4U67 3;  4LF6 Q;  3K0Y A;  4EVO A;  4EQO A;  3BDO A;  1EYC A;  1WD1 A;  1L1O C;  3MXN A;  2ALY B;  5E1F A;  2E2I H;  4JI6 L;  4IOA A;  3EBE A;  2NVT B;  3I90 A;  4JI5 L;  1T5X D;  1WI5 A;  2B63 B;  1CT1 D;  5IP7 G;  4J6H A;  4ULL A;  5KGU A;  3K80 C;  4ID6 A;  1VQM A;  2RDG A;  2O2L D;  2B2T C;  2FHT A;  3PIO A;  1WD0 A;  3HOU H;  5BR8 Q;  5CBA E;  3MEF A;  1AFP A;  1I5F A;  1CI3 M;  2R7D A;  4IPD A;  5I9P A;  4A75 A;  1U4R A;  3K8A A;  1QIL A;  2K32 A;  1LM0 A;  3QJY A;  3CME A;  3EA6 A;  3NTK A;  1UE5 A;  1SJE D;  1DM0 B;  2KQ3 A;  5GAH C;  2EOT A;  2EZV A;  3DUZ A;  2VNU D;  1PH9 A;  5T1G A;  3OW7 A;  3RN2 A;  1H9S A;  5EBC A;  3HOZ B;  1EU4 A;  1NAP A;  2KCN A;  1WYD A;  1IL8 A;  2PMZ B;  1DGS A;  4GKJ L;  4M1U B;  3HOU G;  2B2Y C;  1LTL A;  2KOL A;  1TT2 A;  1PTO D;  2F0Q A;  3RMH A;  3T1Y L;  1VQC A;  3FEW X;  5D3I B;  4A3E G;  2F0V A;  5C4X B;  2HQL A;  3CKI B;  4DNT B;  1U0L A;  3D4R A;  1OTC A;  1D5X C;  4GKK Q;  2MFI A;  3HOX H;  2YU9 B;  2FMM A;  1PTO H;  3D3R A;  5GAD C;  3K7A B;  4A3K H;  2WV6 D;  5I4D A;  1S40 A;  5M3F B;  4A93 B;  2Z6K A;  1SYD A;  3RNU A;  4KD4 A;  3GTQ B;  4A3F H;  2GVB A;  5M5Y H;  1Y8N B;  3K5N A;  4DUZ Q;  3J7A 5;  2M9V A;  4LUO A;  5EBD A;  1XPR A;  1LTG D;  1AZQ A;  4FO2 A;  3SHL A;  2ES2 A;  3OIP A;  2KHJ A;  1PMR A;  4TSS A;  4XDX A;  4H13 C;  3QG1 A;  1PH2 A;  5D65 A;  3SK4 A;  1HUM A;  1FNU A;  4OXP A;  4C1N K;  3I4O A;  1CZG A;  1G29 1;  1VQ5 A;  1DOM A;  3GDE A;  4CJ1 B;  4APV A;  2WIN B;  3OPO A;  4YIJ A;  1S3O A;  2Z4I A;  3D0F A;  1X56 A;  2XSC A;  1TS5 A;  4DV0 L;  2DNC A;  1Q90 A;  3GTO H;  5EPL A;  3I2Z A;  4HCS A;  2LSS A;  2JN4 A;  1B53 A;  5DLQ E;  5C5L A;  3S15 H;  4JCV E;  4A3B H;  1LT5 D;  4Y7N B;  3QOL A;  3I3C A;  4K6L A;  3VR5 A;  4DV4 L;  3G6E A;  5M5W B;  4JI2 L;  1IL2 A;  3IL8 A;  1UNS A;  4DA2 A;  1K8A C;  2B2Y A;  2IY5 B;  2PI2 E;  1KHI A;  4RCN A;  3PQI A;  1E2W A;  1W6K A;  1V9P A;  5LMN L;  4X6A H;  1E7Z A;  1G2T A;  2CWP A;  1SEB D;  3ERQ A;  2NWG A;  1I4Q A;  5G3L F;  2HCI A;  3E9I A;  1JR0 D;  1KNA A;  3DXJ C;  3KF6 A;  1BVS A;  4L5Q A;  4OL7 A;  3ULP A;  4L8J A;  4HJ8 A;  4ABN A;  2EY2 A;  4KKU A;  1M8A A;  4KKS A;  4R1J A;  4FF3 A;  5IE8 A;  4KHP Q;  2HIX A;  1TR5 A;  2L1B A;  5C5M A;  1EEI D;  3NEL A;  2H4O A;  2XTI A;  1Y14 B;  4ZKB B;  4P74 A;  2Z6B A;  3OYY A;  5JJZ A;  1VQL A;  1I50 H;  3HS0 C;  2E74 C;  4GN3 B;  4AH6 A;  3V96 A;  1NUC A;  1R4P B;  2EYF A;  3M3Y B;  1GXD C;  5M3F G;  3CCV A;  5KNB A;  3CC4 A;  1STN A;  1LT4 D;  1XNQ Q;  2K52 A;  1AH9 A;  3K5O A;  4JC0 A;  5ELE A;  4B3M Q;  4JBK A;  1PFM A;  3GTP H;  3PIP A;  3AFP A;  1SNQ A;  4DNI A;  5L37 A;  1PTO B;  1PZI D;  4A3K G;  2WB1 G;  3ER0 A;  2F3I A;  1KLU D;  4EGV A;  5M5Y B;  1EIH A;  2C5C A;  2A69 C;  5K36 G;  4DR5 Q;  1Y1W H;  1Y8O B;  3GTK H;  4UY8 C;  1FVI A;  3RZO H;  2E5L L;  1K83 B;  3H3V H;  3NBI A;  4DFA A;  4OHJ A;  4TVA B;  1B7Y B;  2RKS A;  3FDT A;  2MNA A;  1R4Q B;  3GTJ H;  1XTD A;  4MNO A;  2JA6 B;  4X65 L;  3PO2 B;  4RWS C;  2XRQ D;  1EOT A;  1VQF A;  3SK5 A;  1JJ2 A;  2C9O A;  4RAU C;  3VR2 A;  2O4X A;  5ELO A;  3R8B A;  4JBM A;  4GKJ Q;  3EIV A;  2F0U A;  4LAA A;  2CW0 D;  2Z9H A;  1PRT C;  3W1B A;  4X64 Q;  4K14 A;  3CD6 A;  4GLA C;  4Y7N H;  3MWY W;  4NP5 A;  1WFQ A;  3KLS X;  4IUV A;  3VYS A;  1O7L A;  4ZAI A;  2BE5 C;  4Z9C B;  2JYO A;  5KEE A;  2KHI A;  3CCR A;  5KIX A;  4L5R C;  4G7Z C;  2XN9 C;  4HCE A;  3VR3 A;  3HOX G;  2J4X A;  5C3E B;  3W5O A;  5KND A;  3TZD A;  3SE0 A;  2YTV A;  1MD2 D;  3D31 A;  3UDI A;  1J6Q A;  1EY7 A;  5AJ3 L;  4N9P A;  1Q81 C;  3R93 A;  2J0T D;  4JI8 Q;  1SAP A;  1RDP D;  2E76 C;  3SR1 A;  2MGS A;  2OT2 A;  4DAM A;  2LFN A;  2K5V A;  4DR4 Q;  4XYQ A;  2XWJ B;  4B3S L;  1VQO A;  3IRB A;  2IW3 A;  3GTM H;  1M90 C;  2DN8 A;  1SMY D;  1HZC A;  4C3H H;  1CHP D;  1GOZ A;  2K03 A;  2KCC A;  4HIK A;  5EAY A;  3F2U A;  5FLX c;  5IT9 E;  5IP9 G;  4XIG S;  4JI3 Q;  2Z0S A;  4H44 C;  4MHE A;  2MQH A;  4HJ7 A;  1S5F D;  3I4M H;  3HOV B;  4K0K Q;  4OWX B;  1EY9 A;  1PH6 A;  1S5B D;  4BBS H;  4LF7 Q;  1FJG L;  4DV1 L;  2PNR C;  2WB1 B;  1F2M A;  4A93 G;  2RQX A;  2AHO B;  4A3D B;  1VQE A;  2F0P A;  5LMU Q;  4R4O A;  5DAU A;  5IGG A;  5HGT A;  1CA5 A;  2WKD A;  4MN3 A;  4JYA Q;  1ASZ A;  4XXE A;  2CHB D;  2IT1 A;  3ND9 A;  4QB4 A;  3T1Y Q;  5C44 B;  4OO1 G;  4DV7 L;  3T53 B;  1TS4 A;  2K04 A;  1EQQ A;  3GP7 A;  1SE2 A;  4NXN L;  2JA6 G;  3PO2 G;  1JJC B;  4R4Q A;  4LFA L;  5G3L D;  1KNE A;  2EYM A;  2L4N A;  5DEH A;  3GTK B;  4RFB A;  5M3M G;  4GNX C;  4P71 A;  1KC8 C;  4GS3 A;  2F0N A;  5H1S E;  3H15 A;  1PFN A;  1SYG A;  1U4L A;  4DUZ L;  3BZC A;  3KF6 B;  3NEN A;  1TWF B;  4POG A;  1ESR A;  2WP8 J;  2Z1C A;  3CW2 C;  2EDG A;  1NMF A;  4IAL A;  3OTO Q;  4R8N A;  1MSH A;  5CR3 A;  4FXD A;  4GZY C;  2L15 A;  4LWC A;  2RHS B;  1SND A;  3Q23 A;  2KA7 A;  1YNN C;  3D8G A;  3U9S A;  1SFO B;  3SK8 A;  4GLV B;  1D5M C;  3HOX B;  1SLJ A;  1Y8P B;  2WAC A;  1QUQ A;  4XT3 B;  3U58 A;  1V1P A;  4A3K B;  1EZ6 A;  4B3M L;  4B9X A;  3DWQ A;  3A7L A;  2QEX A;  2EYL A;  1ET9 A;  1EY0 A;  2F0S A;  4XT1 B;  2ATW A;  4C56 C;  1LTI D;  3K57 A;  1QCB D;  4LNQ A;  3A54 A;  4QCL A;  4X3S A;  2ASB A;  2JK8 A;  5JVH 3;  5FLM G;  3NWS A;  1JE5 A;  1LTB D;  3AFQ A;  3SVM A;  1CK1 A;  4IUN A;  4IFD H;  4DR5 L;  1SDF A;  3U9O A;  5JAV A;  2E2H H;  1LT3 D;  3CC7 A;  2CQO A;  1PRT D;  4U68 A;  4XQJ A;  3JAM c;  2UUB Q;  5EPK A;  4AYB B;  4JBJ A;  1BBW A;  1CSP A;  2BH2 A;  5K36 H;  4RGM A;  5FLM H;  4P2C B;  2OQK A;  3TRZ A;  3AEV A;  1EWC A;  1LO5 D;  4X65 Q;  2VL6 A;  2UU9 L;  3S1Q B;  4DV5 L;  1A2T A;  2UXC Q;  1QB5 D;  1XWE A;  1KD1 C;  5M9O A;  1Y69 U;  3CCS A;  4IPH A;  1U4M A;  1SN8 A;  1EYD A;  1NR4 A;  3ITP A;  4UP7 A;  2P5Z X;  2Z6K C;  2HDL A;  1HNX L;  5IWA Q;  1M4V A;  4PZ7 A;  1I94 Q;  4DR7 Q;  1PTO F;  2UXD L;  1W6J A;  4BXX H;  2BH8 A;  1VMP A;  2F3V A;  5CBE E;  1LAC A;  3V05 A;  4IFD G;  1IKM A;  3NTI A;  4GOP A;  5C4J H;  1ZEQ X;  3B6Y A;  2K75 A;  4C3H G;  1TY0 A;  1JC7 A;  2MHV A;  4J15 A;  1WTR A;  2L9H A;  1BCP B;  1HXY D;  3F2D A;  3J7Z C;  1WCM H;  2EIF A;  3VA5 A;  4A3E B;  1B9N A;  1EY6 A;  1LTT D;  1QZH A;  4IJL A;  4YHH Q;  4NW2 A;  1Y1V G;  5CV6 A;  1I4P A;  1BNZ A;  3PO3 B;  3J81 i;  1Q82 C;  4JI0 Q;  3HOY G;  5CV4 A;  3CP0 A;  1S72 A;  1D8L A;  2L0C A;  5A35 A;  5LMN W;  3TME A;  1LTA D;  4ILW A;  3QR8 A;  1X54 A;  3I72 A;  2MP1 A;  2FFK B;  1GUS A;  1TWC H;  1TII D;  1TWF H;  3JAM L;  1IZ6 A;  1LV9 A;  4A3M G;  1MJC A;  2ZXR A;  3R2I A;  1BBX C;  1VQA A;  4Q0F A;  4C3I G;  4IPG A;  1FJG Q;  4DXF A;  1SFO H;  3NSW A;  4EX5 A;  2VQF Q;  2EJG C;  2LS0 1;  2R92 G;  3BDC A;  3A8K E;  2N8N A;  2Y0S E;  5JEA G;  4BWG B;  4JYA L;  4DU9 A;  1IBK L;  3K7U C;  4IUT A;  4JI4 Q;  1J5E L;  1KDB A;  3S16 B;  2Y0S B;  3QO2 A;  1VQP A;  1KDA A;  3UDX A;  4BBS G;  5IT9 c;  2Z8L A;  3IAY A;  1B3Q A;  1KL9 A;  4NXN Q;  3JAM i;  4DN4 M;  4A3F G;  1QOH A;  4H7B A;  1STA A;  3GV3 A;  4KI0 A;  1EY8 A;  4ZYS A;  4GN5 A;  2K50 A;  5EGT A;  3A7A B;  2RBM A;  1SRO A;  1C0A A;  1TWH H;  3KK7 A;  5EKL A;  2LY7 A;  1YIT A;  5C3W A;  4A3C H;  2K7V A;  3NXW A;  4B3R L;  4UAI A;  4JI8 L;  2NTS A;  3DM1 A;  3NBH A;  4HIO A;  4JV5 L;  3ONA B;  4A3J G;  2XIW A;  2SNM A;  4KTA A;  1N34 Q;  3MTS A;  1VCI A;  1EEF D;  2VUM H;  3T56 B;  3KF8 B;  2E2J B;  3CMA A;  2JA5 H;  2B2V C;  1C4Q A;  3F8T A;  2B39 A;  5C4J B;  4JI7 L;  2RHQ B;  1PZK D;  1U4P A;  3S1N B;  2R7F A;  1MBY A;  3OHX C;  2NYZ D;  4BY1 B;  2CCZ A;  4K0K L;  3HP3 A;  1NY4 A;  5IGC A;  4DK0 A;  2LKV A;  1FYC A;  3TDQ A;  1Q12 A;  3KBX A;  4A3J H;  4FP5 D;  5TSS A;  1ICF B;  3T13 A;  5IGB A;  2A1A A;  4Q5V A;  5JPM C;  1VQ4 A;  1STG A;  5ISR A;  4KLK A;  1I4H A;  1RTO A;  4G57 A;  1O7Z A;  2JSO A;  4OO1 I;  3FKI H;  3AQQ A;  2QGQ A;  2JXM B;  3FHW A;  1RF2 D;  1PFB A;  3HOV H;  1FNV A;  1VMC A;  3A74 A;  2MO1 A;  2ZM6 L;  2R93 B;  2R92 B;  4H0L C;  2IHE A;  1JOO A;  4F8M A;  4AYB E;  4ZUI A;  4X62 Q;  4K8I A;  3MC0 B;  2K5W A;  5HUR A;  2JE6 I;  3OMC A;  4A3D H;  4DV3 L;  2F0O A;  2HDM A;  2RF4 A;  1UEB A;  2VW9 A;  4LFC L;  4C2M H;  1ONL A;  1Y1V B;  1MGS A;  3CAM A;  3GD7 A;  5HY6 A;  1QJO A;  5GAE C;  1HQR D;  3PO3 G;  3C1E A;  4RHR A;  1HFN A;  2HT1 A;  3FP9 A;  2OWO A;  1UEA B;  1QVC A;  1D1K A;  1B1Z A;  4LF5 Q;  1YHQ A;  1A62 A;  2OF1 A;  2O5J C;  2DNE A;  3L3O C;  4DPG A;  1V8Q A;  3H3V I;  3BVM A;  1JB3 A;  1VQB A;  2UXB Q;  2EPB A;  2KBN A;  2ZJQ A;  3CCQ A;  2RDH A;  5IGD A;  1TS2 A;  4A3M H;  2FIN B;  1SR3 A;  2BCO A;  5CV5 A;  4FDB A;  1JT8 A;  4FF2 A;  1BF4 A;  1IW7 D;  2OTJ A;  4JVZ A;  4YCV A;  3KYH C;  3SK6 A;  1YNX A;  2KEE A;  3RLN A;  1ESF A;  4Y52 H;  3GTL B;  5I2Y A;  4DNR B;  2PNH A;  3FMC A;  4PMB A;  3GTG H;  3S1M H;  1EWI A;  3HKZ G;  4WJ3 M;  3BJU A;  4LF9 Q;  4OEL B;  1K0S A;  2Q8T A;  3S1R B;  2JA7 B;  1N9W A;  5C4Z A;  5A2Q E;  3U4V A;  2UXC L;  4DUY L;  1N36 L;  1HNZ L;  5GRO A;  3W3A A;  4LMQ D;  4IJH A;  2A6H C;  2K5N A;  2OEO A;  3T1H L;  1GUG A;  4J1M A;  2E2J H;  3KUP A;  5IWA L;  4DR1 Q;  1WCM G;  1U9R A;  1I94 L;  2UXD Q;  3G4S A;  1PH4 A;  1ML0 D;  1XMQ L;  4CHT B;  4A3I B;  4RH6 A;  2AUK A;  4JOI C;  2FJ2 A;  2VUM G;  2ZT9 C;  2WB1 E;  2Q8I B;  1NE3 A;  1QNK A;  2F3W A;  2SNS A;  3I4N B;  3EVQ A;  4HSV A;  3PIO 3;  1HZB A;  1JMC A;  3MXP A;  4DF7 A;  3PIP 3;  4S3S A;  1EL0 A;  2Q2I A;  1CHQ D;  1WTO A;  4B3R Q;  1QWY A;  5I9O A;  1BBU A;  1JQY D;  2K5D A;  4AQY Q;  5IT9 L;  1SYE A;  3HOY H;  1B2T A;  3TS0 A;  1DOK A;  3T51 B;  4DAY B;  5EKK A;  1LUZ A;  5IYC G;  5LL6 S;  2NVX H;  2K4K A;  1X6O A;  1HRJ A;  4OX9 L;  4HJ5 A;  4O1N A;  1KAB A;  4HED A;  3MXG A;  1H9J A;  2D0P A;  1HNW L;  1ENF A;  2SOB A;  4UHV A;  1STH A;  1X3E A;  5C0X H;  3GV6 A;  4GOP B;  4G4K A;  3DWA A;  2HUG A;  2F0E A;  2JA8 H;  5A2Q L;  4DV0 Q;  3CCL A;  1FGB D;  1FR3 A;  4YCU A;  2YV5 A;  3WDN A;  3TP5 A;  4BA2 I;  4O2D A;  4JI7 Q;  1GJX A;  3J80 c;  3U50 C;  2D0O A;  3TP8 A;  3T16 A;  5JJK A;  3CU7 A;  1HR0 W;  2RSN A;  2NTT A;  1PH3 A;  1F2L A;  4OWW B;  4R4T A;  4A3G B;  2QF7 A;  2J7Z A;  5I6Y A;  1TWG B;  2JA9 A;  5FO8 B;  5FO9 B;  4UPA A;  3PUY A;  1HA5 A;  2LXK A;  3CCE A;  1GO3 E;  4BBR H;  2RA4 A;  2AMC B;  3HKS A;  1WVL A;  3I8Z A;  4BY7 B;  1Q8I A;  4JI4 L;  2R61 A;  4PMW A;  1BUV T;  2NZ1 D; 
#chains in the Genus database with same CATH homology
 1EUJ A;  2XGT A;  3T1Y Q;  4C3I H;  2RCN A;  4DV7 L;  4P72 A;  4OO1 G;  1HZ9 A;  2D62 A;  1EQQ A;  1CKO A;  3BU2 A;  4NB3 A;  4NXN L;  5GAG C;  4DR3 L;  2JA6 G;  1JJC B;  4R4Q A;  2VQE Q;  3PO2 G;  4LFA L;  4BA1 I;  1JJG A;  3J81 c;  3W1G A;  3K81 C;  2V1C C;  1XNR Q;  1IBL L;  2ZTD A;  4YWL A;  1WOC A;  1G51 A;  2R7Z G;  4A76 A;  1SRU A;  3HFZ B;  1X55 A;  3CCJ A;  5M3M G;  2QA4 A;  4GNX C;  4P71 A;  1KC8 C;  4GS3 A;  1HZA A;  5H1S E;  3H15 A;  4NXM Q;  4DUZ L;  4YY3 L;  3BZC A;  3KF6 B;  1N33 L;  3NEN A;  4A3E H;  3PV0 A;  4MTN A;  4A3I G;  4B3T L;  4POG A;  1PH7 A;  2WP8 J;  2B3G A;  4LFC Q;  1VQ6 A;  3CW2 C;  1NMF A;  3OTO Q;  4LFB L;  3KJO A;  1N34 L;  1CSQ A;  2Q2T A;  2EQS A;  2L15 A;  4LWC A;  3ULJ A;  1KRT A;  2RHS B;  3I56 A;  1JB7 A;  1TWA H;  3H0G G;  4TQU S;  3F2B A;  4GLV B;  1AE2 A;  1GKH A;  5IYC H;  4LF5 L;  4GLX A;  1SLJ A;  1QUQ A;  3U58 A;  4UP9 A;  4HJA A;  2NZO A;  1B8A A;  5J3B A;  1C9O A;  2K14 A;  4B3M L;  4A3I H;  1M1K C;  5GQO A;  3M4O H;  3TS2 A;  2QEX A;  1UE6 A;  2JA6 H;  3PO2 H;  2UXB L;  1Q86 C;  1Q1B A;  3TQY A;  1VQ7 A;  2ATW A;  5M5X H;  3WWV A;  5IP7 H;  2AKW B;  1TWG H;  4LNQ A;  3HOW G;  2NVT H;  2ASB A;  2JK8 A;  1MJE A;  4DR6 Q;  1EOV A;  4QGU A;  1FL0 A;  3CPW A;  4GN4 B;  1E1T A;  5FLM G;  1JE5 A;  1WJJ A;  3AFQ A;  4OON A;  4QIW E;  3SGI A;  3ICE A;  1PH8 A;  4DR5 L;  4A93 H;  5C44 G;  2E2H H;  4BXX G;  1N32 L;  1EYG A;  3GTQ H;  3CC7 A;  1HR0 Q;  2CQO A;  3S2D H;  4HIM A;  4IPC A;  3JAM c;  2UUB Q;  3NEM A;  3RN5 A;  1W2B A;  4JBJ A;  1BBW A;  1CSP A;  4YWK A;  1EFW A;  4BY1 G;  1VQN A;  2WAQ G;  4LW1 A;  2OCE A;  2BH2 A;  4LF9 L;  5JEA J;  1NBW A;  2YTY A;  3DM3 A;  5FLM H;  2OQK A;  3HOZ H;  3TRZ A;  1XPO A;  3HKZ E;  3AEV A;  2UU9 L;  4X65 Q;  2VL6 A;  4IFD J;  4DV5 L;  4DV2 L;  2UXC Q;  1L1O A;  1KD1 C;  3STB C;  1N36 Q;  1PV4 A;  3J81 j;  3L2P A;  3CCS A;  1HNZ Q;  4IPH A;  4HID A;  3UE1 A;  1SN8 A;  4PG3 A;  4BBR G;  3UDG A;  5C0X I;  4UP7 A;  2Z6K C;  3T1H Q;  4BY7 H;  2N3S A;  1HNX L;  5IWA Q;  4BY1 H;  1E22 A;  4DR1 L;  1VQJ A;  4PZ7 A;  2B29 A;  1I94 Q;  4L5S A;  1TXY A;  4DR7 Q;  2UXD L;  3ZJY C;  2ZM6 Q;  1XMQ Q;  5C44 H;  1P16 A;  2BH8 A;  4BXX H;  4JG2 A;  3G71 A;  4X64 L;  4KHP L;  4IFD G;  3K7A H;  3E0E A;  4X62 L;  3H0G H;  3UE0 A;  5M3F H;  4GOP A;  4BY7 G;  5C4J H;  1IBM L;  1E24 A;  1QVF A;  3B6Y A;  1RIP A;  4QQB X;  2K75 A;  4WJ4 A;  4DV3 Q;  4J15 A;  1XMO Q;  2R93 G;  2N49 A;  4YWM A;  5C0X G;  2ZTE A;  3KOJ A;  1LYL A;  2VY3 A;  1PFS A;  3M9B A;  3F2D A;  3J7Z C;  1WCM H;  5FJ8 H;  2YU9 H;  2EIF A;  3CXC A;  5AJ3 Q;  1OXU A;  4P73 A;  1QZH A;  4LF6 Q;  4IJL A;  4YHH Q;  3G48 A;  1YVC A;  1L1O C;  3PUV A;  1Y1V G;  2ALY B;  4JI6 L;  2E2I H;  1XNQ L;  4UP8 A;  3KDF B;  4IOA A;  3EBE A;  3LGJ A;  5ELN A;  4JI5 L;  3J81 i;  1WI5 A;  2I5H A;  4OX9 Q;  1YI2 A;  5IYD G;  2UUC Q;  4DR4 L;  5IP7 G;  1NTG A;  2PMZ E;  3KJP A;  1Q82 C;  4JI0 Q;  4B3S Q;  3HOY G;  4NPS A;  1YHB A;  4ME3 A;  3CP0 A;  1S72 A;  3K80 C;  1D8L A;  1UE7 A;  1VQM A;  1YEZ A;  1Y1W G;  5LMN W;  2UUA Q;  3PIO A;  3HOU H;  1G6P A;  4LF8 Q;  2WFW A;  2GVA A;  5BR8 Q;  1I6H H;  3E9H A;  1X54 A;  3MEF A;  1YHA A;  1A63 A;  1I5F A;  3L7Z C;  1TWC H;  1Z9F A;  2R7D A;  3A0J A;  2YTX A;  3BZK A;  4IPD A;  4A75 A;  3K8A A;  1YJW A;  1TWF H;  2HHH L;  1IZ6 A;  2VS1 A;  4A3M G;  1LM0 A;  3CME A;  1N8R C;  3PUX A;  5JJL A;  4DV6 Q;  1MJC A;  2E5L Q;  1MKH A;  1UE5 A;  2NZH A;  1VQA A;  2GN5 A;  5GAH C;  4IPG A;  4DR2 L;  1Q7Y C;  1FJG Q;  3CQZ H;  3S14 H;  4A3B G;  4DUY Q;  1SFO H;  5M5W H;  4EX5 A;  2VNU D;  1PH9 A;  2VQF Q;  3RN2 A;  2R92 G;  4H02 A;  2N8N A;  5C3E G;  2Y0S E;  1WYD A;  5JEA G;  4JYA L;  1DGS A;  5M3M H;  2NN6 G;  4IO9 A;  3K7U C;  1GD7 A;  1NMG A;  3M4Q A;  1IBK L;  4GKJ L;  3HOU G;  5IY0 A;  4JI4 Q;  1J5E L;  1LTL A;  3F1Z A;  1VQP A;  4BBS G;  3UDX A;  3T1Y L;  1VQC A;  4GOP C;  4A3E G;  5IT9 c;  1OXV A;  4DV7 Q;  1EIF A;  1KL9 A;  2PQA A;  2HQL A;  2IX0 A;  4NXN Q;  1U0L A;  3JAM i;  2I0Q A;  2VQE L;  1OTC A;  4GKK Q;  2VZA A;  2KCM A;  4LFA Q;  2MFI A;  3TRE A;  3HOX H;  4DK3 C;  4A3F G;  1Z47 A;  1ASY A;  4KI0 A;  4YCW A;  5GAD C;  4A3K H;  1XNR L;  4GN5 A;  3KFU A;  4GNX B;  1VQI A;  2K50 A;  1S40 A;  2Z6K A;  2A19 A;  3RNU A;  1VS0 A;  4A3F H;  1SRO A;  2GVB A;  1TWH H;  3PSI A;  1YIT A;  1PA6 A;  5M5Y H;  1C0A A;  3J7A 5;  4DUZ Q;  1MIU A;  4YY3 Q;  4LUO A;  4A3C H;  4B3R L;  1XPR A;  3PO3 H;  4AQY L;  1OXS C;  1PHJ A;  4JI8 L;  2ES2 A;  2IHF A;  2KHJ A;  4LFB Q;  4HIO A;  1KIX A;  4JV5 L;  4A3J G;  1HJP A;  1PH2 A;  1VQG A;  1N34 Q;  2PQA B;  3Q8D A;  1X3F A;  4OXP A;  1VCI A;  4A3G G;  3I4O A;  1YIJ A;  3TEH B;  2VUM H;  2ZJP A;  1HNW Q;  2NVY H;  1G29 1;  3KF8 B;  1VQ5 A;  3GDE A;  1YZ6 A;  1L1O B;  1YJN A;  1XPU A;  4IFD I;  2NN6 I;  4APV A;  5IP9 H;  1EQR A;  2H5X A;  3CMA A;  2JA5 H;  4QY7 A;  1S3O A;  3I55 A;  2B63 H;  3D0F A;  1X56 A;  2DUD A;  5IYB G;  4A3D G;  2OQ0 A;  2LXJ A;  3F8T A;  4DV0 L;  4DK6 C;  3GTO H;  2MO0 A;  3M4P A;  1K9M C;  3I2Z A;  2LSS A;  2RHQ B;  4JI3 L;  4JI7 L;  2DGY A;  2R7F A;  5DLQ E;  2JA7 G;  4X66 Q;  3S15 H;  4JCV E;  4A3B H;  1V1Q A;  2F4V Q;  4DV4 L;  3CCU A;  3G6E A;  2HIV A;  2CCZ A;  4JI2 L;  1IL2 A;  4K0K L;  1NY4 A;  1K8A C;  1K83 H;  1Q12 A;  4A3J H;  1PH5 A;  4LF7 L;  4LF4 Q;  2IY5 B;  4DV1 Q;  1EIY B;  2PI2 E;  1Q8K A;  2A1A A;  1VQ8 A;  1KHI A;  5E7N A;  4JI1 L;  1CKM A;  1YBY A;  1L0W A;  3HOV G;  1C7Y A;  1VQ4 A;  5LMU L;  2ZTC A;  4KLK A;  5C4X H;  1V9P A;  3NBH B;  5LMN L;  4X6A H;  3UDF A;  2ZJR A;  1E7Z A;  2UU9 Q;  2CWP A;  4DV2 Q;  1D7Q A;  4OO1 I;  1QUQ B;  2OTL A;  3FKI H;  1T9H A;  4A3L G;  3AQQ A;  3E9I A;  1IXR A;  1Q1E A;  3KF6 A;  2QGQ A;  3FHW A;  1L2F A;  1A8V A;  2F52 A;  4MZ9 A;  1BVS A;  4OWT B;  4L5Q A;  4DR3 Q;  3ULP A;  4PZ6 A;  1HNX Q;  4HJ8 A;  2ID0 A;  4PMW A;  3HOV H;  3S16 H;  3A74 A;  3RZD H;  4DR7 L;  2MO1 A;  3RLO A;  2ZM6 L;  1CKN B;  3FKI G;  1IBL Q;  2IHE A;  3PGZ A;  4R1J A;  3I4N H;  1SE8 A;  4QJF A;  2R6G A;  5IE8 A;  2HIX A;  2JJQ A;  4IOC A;  4KHP Q;  4AYB E;  4X62 Q;  1GM5 A;  1X3G A;  2IX1 A;  4NXM L;  2E8G A;  3ULL A;  2JE6 I;  3NEL A;  1CUK A;  3GO5 A;  5C3E H;  1IBM Q;  2XTI A;  5IYB H;  4A3D H;  1Y14 B;  4DV3 L;  1N33 Q;  4B3T Q;  3J80 i;  4P74 A;  1W3S A;  2RF4 A;  1QVG A;  1UEB A;  3OYY A;  2VW9 A;  4LFC L;  1VQL A;  1I50 H;  4C2M H;  1I3Q H;  3OTO L;  1X9N A;  2I5L X;  4GN3 B;  3CAM A;  3GD7 A;  5HY6 A;  3I7F A;  4AH6 A;  1E1O A;  2N78 A;  3JC6 6;  5GAE C;  3PO3 G;  1KAW A;  4LUV A;  4JBW A;  1NJI C;  1X65 A;  2HT1 A;  4A4I A;  3FP9 A;  2OWO A;  5M3F G;  3CCV A;  1VQ9 A;  1FGU A;  1UE1 A;  2KCT A;  1QVC A;  4GNX A;  3CC4 A;  4LF5 Q;  3STB D;  3PF4 A;  1YHQ A;  3I4N G;  1A62 A;  1XNQ Q;  2K52 A;  1AH9 A;  4JC0 A;  3F2C A;  4B3M Q;  4DPG A;  2BA0 A;  2C35 B;  3OW2 A;  4JI5 Q;  4JBK A;  3H3V I;  1VQB A;  4LUZ A;  2JA5 G;  2UXB Q;  2UUC L;  2KBN A;  2ZJQ A;  3CCQ A;  3CC2 A;  3GTP H;  4A3M H;  3PIP A;  3AFP A;  1A0I A;  1SR3 A;  2FXQ A;  1VQD A;  4DNI A;  1PYS B;  4FDB A;  1JT8 A;  4A3K G;  5IYD H;  4DR6 L;  2OTJ A;  3ER0 A;  2WB1 G;  2F3I A;  4YCV A;  5BR8 L;  4EQ5 A;  3PF5 A;  1KQS A;  3KYH C;  4PZ8 A;  3PUZ A;  3S1N H;  1YNX A;  3RLN A;  5K36 G;  4DR5 Q;  2CKZ B;  1Y1W H;  3S2H H;  3GTK H;  3A5Z B;  4Y52 H;  3M7N A;  1N32 Q;  2PNH A;  1HR0 L;  1PVO A;  4UY8 C;  1FVI A;  1K73 C;  3RZO H;  2UUB L;  2E5L L;  2JEA I;  4RG1 A;  3GTG H;  3H3V H;  1EWI A;  3S1M H;  3HKZ G;  4WJ3 M;  3BJU A;  4TVA B;  1B7Y B;  4LF9 Q;  4L5T A;  3S24 A;  2I5M X;  4QL5 A;  2MNA A;  2B63 G;  1OXX K;  3GTJ H;  1N9W A;  4DR2 Q;  1XTD A;  4MNO A;  4A3L H;  1UWV A;  4X65 L;  4DV5 Q;  3U4V A;  2UXC L;  1HH2 P;  4DUY L;  1N36 L;  5C0X J;  3I4M G;  2KEN A;  2R93 H;  1PH1 A;  1HNZ L;  1VQF A;  5GRO A;  1JJ2 A;  1KXL A;  4IJH A;  5C4X G;  4A3G H;  2K5N A;  4R4I A;  3T1H L;  3PUW A;  2E2J H;  5ELO A;  5IWA L;  4JBM A;  4DR1 Q;  1WCM G;  3CCM A;  4GKJ Q;  3EIV A;  1RL2 A;  1I94 L;  2UXD Q;  2BA1 A;  3G4S A;  1PH4 A;  1J5E Q;  2A8V A;  1XMQ L;  3W1B A;  1O7I A;  4O0A A;  3KLW A;  4X64 Q;  4JOI C;  2VUM G;  3CD6 A;  1CKN A;  2WB1 E;  4GLA C;  2NVQ H;  3AYH B;  3U4Z A;  4A3C G;  4AIM A;  2AWN A;  4Y7N H;  1NE3 A;  4DKA C;  1PYB A;  1WFQ A;  4GKK L;  2PI2 A;  2R92 H;  2EXD A;  1XMO L;  1R9T H;  3M3Y H;  1K0R A;  2KHI A;  3CCR A;  2R7Z H;  4L5R C;  1IYJ B;  1HZB A;  1B70 B;  1JMC A;  3HOX G;  2CWA A;  2Q2H A;  3W5O A;  3HOZ G;  1H95 A;  3CF5 A;  4KHZ A;  4ALP A;  3VDY A;  2Q2I A;  2YTV A;  4RMF A;  3ERS X;  3D31 A;  1VQK A;  4B3R Q;  3UDI A;  1J6Q A;  1SMX A;  5AJ3 L;  3DLL A;  1Q81 C;  1BBU A;  4AQY Q;  4LF6 L;  1Y1V H;  4YHH L;  4JI8 Q;  3HOY H;  1P8L A;  3TS0 A;  1E3P A;  4DAY B;  5HGQ A;  1OXT A;  1LUZ A;  1KRS A;  3S17 H;  4JV5 Q;  5IYC G;  4P75 A;  4JI6 Q;  3RLF A;  2NVX H;  2K4K A;  4XTC S;  1X6O A;  4DAM A;  4OX9 L;  4HJ5 A;  2JEB I;  2K5V A;  4DR4 Q;  4HJ9 A;  4JI0 L;  4B3S L;  2D0P A;  3KDF A;  1VQO A;  1HNW L;  4JOI A;  3IRB A;  3GTM H;  1X3E A;  3GTL H;  1M90 C;  1V43 A;  1K3R A;  2UUA L;  4GOP B;  2YYZ A;  1Q46 A;  1HZC A;  4C3H H;  4LF8 L;  2AWO A;  3M85 A;  4HIK A;  5EAY A;  4AYB G;  5FLX c;  4DV0 Q;  4YCU A;  3CCL A;  4C3J H;  1YJ9 A;  2JA8 H;  5IP9 G;  2YV5 A;  3K0X A;  4XIG S;  1XJV A;  4BA2 I;  4O2D A;  2Z0S A;  4JI3 Q;  3J80 c;  4JI7 Q;  3U50 C;  3S1R H;  2JA7 H;  3HOW H;  2D0O A;  2HHH Q;  4X66 L;  1QZG A;  5JJK A;  2Y0S G;  2MQH A;  1HR0 W;  3CPF A;  4HJ7 A;  3EN2 A;  3I4M H;  4DV6 L;  2F4V L;  4JI2 Q;  3RR5 A;  4DV4 Q;  1PH3 A;  4K0K Q;  2K5H A;  4OWW B;  4R4T A;  4OWX B;  2JA8 G;  5FJ8 G;  4R4C A;  1VQH A;  1PH6 A;  4BBS H;  4LF7 Q;  2JQO A;  4LF4 L;  1FJG L;  4DV1 L;  2Q2U A;  2JA9 A;  4JI1 Q;  3L0O A;  3S1Q H;  2CFM A;  4A93 G;  2VQF L;  4POF A;  4UPA A;  3PUY A;  1K8G A;  2AHO B;  1U5K A;  1VQE A;  2LXK A;  3CCE A;  1BKB A;  1GO3 E;  4R4O A;  4BBR H;  5LMU Q;  2AMC B;  3MXN B;  3HKS A;  1IBK Q;  4JYA Q;  5JJI A;  5LMN Q;  1ASZ A;  1AE3 A;  4JI4 L;  3PCO B;  1GVP A;  3A5U A;  2IT1 A;  2WAQ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...